3KF6A

Crystal structure of s. pombe stn1-ten1 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
136
Chain Sequence
SRWNPMFISDVHKISFHPHYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRDPNDEWKAWQKRMRYKKNLTKISKNHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein stn1
publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Structural protein
total genus 36
structure length 136
sequence length 139
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kf6A00
4YWMA 3J7A5 1WCMG 4YY3Q 4UPAA 4LF6Q 3U4ZA 1KXLA 1U0LA 2BA1A 5C3EG 4IPGA 3HOZG 4YCUA 1G51A 3CC7A 1SE8A 1I94L 1Q7YC 3MXNB 4UP9A 4DV7L 3GTQH 3E9HA 5IWAQ 4KI0A 4A3MH 4A3LG 2IX0A 3S14H 4KHPL 1HH2P 3E9IA 4BBSG 2UXDL 2ASBA 1J5EL 1YHAA 3NEMA 3BU2A 5LMUQ 2KHJA 4DV1Q 1G291 2DUDA 2ZTDA 4GNXB 3RN2A 2QGQA 4GN5A 4GOPA 2JA9A 4R4IA 1XPRA 4JI4L 5IP7H 1RIPA 5IYBH 3OYYA 3F1ZA 2I5MX 1FGUA 3CW2C 3W1BA 4APVA 1YJ9A 1QVFA 4FDBA 3EBEA 2IY5B 4JI8Q 3GTPH 1BBWA 1P16A 4AQYQ 2N3SA 2UUAL 4IPCA 5M3MH 1FJGQ 1AH9A 4A4IA 1KD1C 4B3SL 3MEFA 1HNWQ 4BY1H 3CCVA 4OWTB 1JMCA 1UE7A 3PO2G 1N9WA 4NXNQ 3CMAA 4DV2Q 2R92G 1OXXK 1CKOA 4GLAC 1UE1A 1XTDA 3T1HQ 3E0EA 1PVOA 1SR3A 1X3FA 1K9MC 1HNXQ 3RLOA 3HOYH 1Y14B 4QGUA 4R4TA 1B8AA 3CXCA 1IBMQ 4JI0Q 2JA7H 4WJ4A 1OXUA 2KHIA 1IBLQ 4JOIA 1M90C 4IFDJ 1WCMH 2VS1A 1CUKA 1KHIA 3I2ZA 3G4SA 1OTCA 5C3EH 2RF4A 5DLQE 3HOZH 1I50H 1YJNA 3PCOB 4DK3C 1QVGA 3NELA 1PV4A 4X64Q 3CCMA 4DV0Q 4DR7L 4DV5L 2IHEA 1CSQA 3PV0A 4A3LH 4GLVB 3K81C 1GM5A 4LF7Q 4X66Q 3PIPA 2F4VL 1QZGA 2VZAA 1DGSA 1RL2A 3OTOL 2NZOA 1PH3A 1TWHH 4L5TA 5C44H 1X65A 4DV3Q 4JI7L 5H1SE 2OQKA 1VQ9A 4YY3L 5FLXc 4JC0A 4X6AH 1BVSA 3PIOA 1X55A 5ELNA 3I55A 2KENA 1PYSB 4KHZA 2F52A 1OXVA 3ULLA 1KC8C 3TS2A 4IOAA 3ZJYC 2NN6I 1KRSA 1D8LA 3HOWG 2N49A 1IL2A 5IWAL 1AE2A 2FXQA 4DAMA 1VQ5A 3CQZH 2E2JH 2A19A 4DV6Q 2Y0SG 3CP0A 3S16H 1PH5A 1KAWA 1YVCA 5LMUL 4GNXC 1YIJA 2VW9A 1KQSA 2Q2UA 3AFQA 3HFZB 4P74A 4PZ6A 3PO2H 5K36G 2B63G 1XNRL 4HIOA 3CPFA 4NPSA 2R92H 2EXDA 1CKNA 1S40A 1UEBA 2K75A 3CAMA 1J5EQ 4R4QA 1X54A 4DR3L 3UDXA 2NVTH 1ASZA 4B3TQ 4LWCA 1VQNA 5IP9G 2UUCL 3GDEA 3ULJA 4JI4Q 4JI2Q 5M3FG 1B70B 1A63A 3AFPA 1K0RA 3DLLA 2D0PA 4LF9Q 2RCNA 4B3RQ 3B6YA 4R4OA 1HNWL 1K8GA 2IX1A 5LMNQ 4MTNA 3CC2A 3PO3G 2B29A 2EQSA 2UUAQ 3A5ZB 4EQ5A 2OWOA 1H95A 3UDIA 4DV2L 4IFDI 3M7NA 1NY4A 1EUJA 5IYCG 3GTJH 2ZM6L 3RZDH 3T1HL 4B3SQ 1TXYA 4A75A 2Z6KA 4X62Q 1QZHA 1WI5A 4JI0L 1C7YA 3Q8DA 5LMNW 4IFDG 2CFMA 3DM3A 1XMOL 1HZAA 1X56A 1PFSA 1YZ6A 2YTVA 4LUZA 5E7NA 4X65Q 1YI2A 4OONA 2CWPA 2F3IA 5IYDG 3M4OH 4O0AA 1SMXA 3M4PA 1GKHA 2R6GA 1EWIA 5C0XJ 1VCIA 4HIMA 1HNZL 3ICEA 1JT8A 4DV0L 4OO1I 3HOWH 2JK8A 2GVAA 2Z0SA 4QL5A 2JA6G 2YU9H 2HIVA 3HOXG 1FL0A 2VL6A 1VQ8A 5ELOA 2K5VA 3I4OA 1SROA 4LFAQ 4DPGA 4BXXG 2B63H 2F4VQ 3KOJA 3OTOQ 1XMQQ 1IXRA 2XGTA 1PH9A 4P73A 2JA7G 2WB1E 1N36L 1VQIA 3KF6A 5IP9H 2KCMA 3G48A 5IE8A 3I4MG 4JV5L 5M3FH 1E1OA 3I56A 4JBWA 2YYZA 2JJQA 4JBJA 5FLMG 3LGJA 4DV6L 2ZTEA 4H02A 3L7ZC 2K50A 1JJCB 1X3EA 1IBKL 1PH7A 3PO3H 4KLKA 4YHHQ 3F8TA 4HJ9A 3PF4A 1L1OA 3EIVA 5IYCH 3TRZA 5C44G 1JJ2A 1VQEA 1A8VA 4B3TL 1Y1VG 1XNRQ 4GOPC 2AKWB 3CCUA 4DR6L 1PH2A 2WP8J 4JI1L 2QA4A 1MJEA 4JI2L 4LFCQ 1TWCH 2R93H 4LF9L 1CKNB 1WOCA 2WAQG 4DR3Q 4B3RL 1P8LA 3F2CA 2UUCQ 4AH6A 5EAYA 1EOVA 4HIDA 3H0GH 3U58A 2PQAA 3KYHC 5LMNL 5IYDH 5HGQA 3FHWA 2E8GA 2K5HA 4DR1L 5AJ3L 2K52A 2Q2IA 4TVAB 2Q2TA 2N78A 4OX9L 2D62A 5BR8L 2JA6H 3HOXH 1VQDA 2A1AA 1BKBA 2GN5A 3KF8B 4RG1A 4JI3L 4AYBE 4RMFA 4C2MH 4X62L 4LF5Q 3I4NG 2CKZB 5C0XI 1IYJB 4YCVA 2ZM6Q 4BXXH 3CCJA 2PI2A 2MO1A 4R4CA 1C0AA 1N34Q 4GKKQ 4X65L 1VQCA 5FJ8G 1VQAA 4DUYL 1QUQA 1K3RA 1Q1BA 4A93G 5C0XG 1XMOQ 4JOIC 2IT1A 5JEAG 3HKSA 4A76A 2VY3A 3G71A 1YJWA 3I4MH 4MZ9A 2RHQB 3TQYA 5FLMH 1EYGA 3HOUG 4A3EG 3BZKA 1HNZQ 1XJVA 1K83H 1V9PA 4LFAL 4QQBX 4JBKA 1GD7A 4DUZQ 1SN8A 1XMQL 1JB7A 4IOCA 4WJ3M 2D0OA 2ID0A 1VS0A 4PZ8A 4HJ7A 1PYBA 1Y1VH 1PH4A 4GKJQ 1B7YB 1FVIA 2JEBI 1JE5A 2HIXA 4OWWB 1E1TA 1YHBA 2YV5A 3UE1A 4MNOA 1N36Q 4DR5L 4JV5Q 1VQKA 1C9OA 1SLJA 1CSPA 4L5QA 3KF6B 3JAMi 4L5SA 2VUMG 2OTJA 2DGYA 4YHHL 3S15H 3JC66 1VQPA 4A3FH 2BH2A 3D31A 2R7ZG 4DKAC 1IBKQ 1HR0L 2EIFA 3M85A 2NN6G 2RHSB 2VQFQ 3CCQA 4XIGS 3I4NH 3T1YL 4YCWA 4A3JG 1N32L 3OW2A 2AMCB 4LFCL 3CCEA 4DNIA 4POFA 1L1OB 5HY6A 5C4XH 1Q82C 4DV4L 2JE6I 3PUYA 2ZJPA 3W5OA 4DR6Q 5FJ8H 1YNXA 4JI1Q 3A5UA 4GOPB 4LF4L 4A93H 3AYHB 4JYAL 1XPUA 2PNHA 2ES2A 4IJHA 2AWNA 3CCLA 4LNQA 1WYDA 3HKZE 4DK6C 5IT9c 4PG3A 3GTOH 4P72A 1M1KC 3J7ZC 3HOUH 2PQAB 4A3EH 4LF5L 2CCZA 3GD7A 4DR1Q 5AJ3Q 2WB1G 4BBRG 1L0WA 3BJUA 1VQBA 2E5LQ 3F2BA 5BR8Q 4OX9Q 3HOVG 1UE6A 3K7AH 2Z6KC 4YWLA 2LSSA 1N34L 3RLNA 1VQLA 4JI3Q 3GTMH 4GKKL 3STBD 5GAEC 4JBMA 3PF5A 1VQOA 1VQ7A 2R93G 3RZOH 1E7ZA 1W3SA 3CCRA 1EIFA 3D0FA 2L15A 5GQOA 2MFIA 1VQJA 3H0GG 4BY7G 2LXJA 4DUYQ 2JEAI 5J3BA 2NVYH 3UE0A 1QUQB 4YWKA 4POGA 1EIYB 2BH8A 1XNQL 1HJPA 3A74A 2VUMH 4LF8L 3FKIH 4UY8C 1LTLA 1SFOH 4DUZL 4LW1A 1Q12A 2R7ZH 1Q46A 1Q8KA 4UP8A 3JAMc 3GTGH 3K7UC 4OO1G 4HIKA 1O7IA 4A3JH 4GKJL 4K0KL 1NJIC 3S1QH 1NTGA 3VDYA 1L2FA 2E2HH 2OTLA 2Y0SE 4HJ5A 1E3PA 1MIUA 1VQGA 1EFWA 3CF5A 1PA6A 2NZHA 2ZJQA 3KJPA 4AYBG 1KIXA 1S3OA 4LUOA 1NE3A 3BZCA 3PSIA 3S2HH 4C3IH 1QVCA 4DR5Q 2CWAA 3AEVA 2VQFL 1ASYA 3PUXA 3PUZA 4NB3A 1E22A 1A62A 4Y52H 4BBRH 1L1OC 4JI5L 1HR0Q 5JJKA 3HOVH 2XTIA 3K0XA 3RLFA 1Z9FA 4JG2A 2C35B 3T1YQ 4A3CG 2JA8G 3SGIA 1N8RC 2Q2HA 3PGZA 1W2BA 3CC4A 4BA1I 4DV4Q 1D7QA 3CMEA 4J15A 1HR0W 3S1MH 4BY7H 4LF4Q 1SRUA 3GO5A 4JYAQ 2V1CC 4JI6Q 2QEXA 1PH8A 2I0QA 3CPWA 4A3FG 4DAYB 3S17H 4A3BG 3ER0A 1VQ4A 2E5LL 1EQQA 2KBNA 5JJIA 3RN5A 4C3HH 3KLWA 2OQ0A 1LM0A 1VQHA 1OXSC 2N8NA 3S24A 3J81j 4DR4L 5C4JH 1Q86C 1TWFH 4OWXB 5GADC 2R7FA 1VQ6A 5C4XG 2VNUD 2WFWA 3UDGA 3K8AA 1KRTA 3RNUA 4LFBQ 4B3ML 2YTXA 1K73C 2HHHQ 3EN2A 3S1NH 1X9NA 1Q81C 1UE5A 4TQUS 3CD6A 1N33Q 2VQEL 1HZCA 1Y1WG 2K5NA 3U4VA 4NXMQ 3M3YH 2IHFA 3KFUA 1YBYA 4A3IG 1NBWA 1TWGH 1XNQQ 2K4KA 2MNAA 4LF8Q 3UDFA 4A3KG 3RR5A 2MO0A 1MKHA 1KL9A 3GTLH 4PZ7A 4P75A 4P71A 4HJ8A 1YITA 1VQFA 2R7DA 3KDFA 4A3GG 1Z47A 4GS3A 3HKZG 1BBUA 4GN3B 5GAHC 1Q1EA 4A3CH 4K0KQ 2PI2E 2JA8H 1NMGA 4EX5A 1X3GA 2UXBQ 5GROA 1G6PA 2ZTCA 4A3DG 1WJJA 3H3VI 3FP9A 2HT1A 4HJAA 2LXKA 4R1JA 2ZJRA 5IY0A 2JA5G 4IJLA 1YHQA 5JJLA 1WFQA 3FKIG 3H15A 1A0IA 2ALYB 2AHOB 2UUBL 3F2DA 4OXPA 4A3BH 2WAQE 1I3QH 1PHJA 3WWVA 1V43A 2UXCL 4BBSH 4DR2Q 3J81i 2PMZE 2I5LX 3M9BA 4ME3A 1MJCA 3J80i 2NVXH 2MQHA 4JI5Q 4IPHA 4LF6L 3KJOA 2UU9Q 3NBHB 1I6HH 1GO3E 4PMWA 2CQOA 1PH6A 4JI6L 4UP7A 1I5FA 1T9HA 3IRBA 2K14A 3PUWA 3ULPA 2HQLA 1U5KA 1XPOA 2BA0A 1Y1WH 4GN4B 1I94Q 4O2DA 3G6EA 4DV7Q 1IZ6A 4GNXA 4C3JH 5M5YH 4DV1L 4IO9A 4A3IH 4L5RC 3TREA 3I7FA 1LYLA 3U50C 1VQMA 4A3KH 4KHPQ 3L2PA 2UXDQ 1YEZA 4LFBL 2B3GA 4DR4Q 3M4QA 4A3GH 5GAGC 2HHHL 2JQOA 3L0OA 4JI8L 1N33L 3PUVA 1V1QA 1UWVA 4JCVE 4AQYL 4B3MQ 1TWAH 4NXML 4A3DH 1FJGL 1OXTA 2I5HA 1E24A 1JJGA 1X6OA 3AQQA 1N32Q 2YTYA 2JA5H 2NVQH 1HZ9A 4NXNL 2VQEQ 4A3MG 3S2DH 1CKMA 4AIMA 4XTCS 1J6QA 3TEHB 3H3VH 1NMFA 3K80C 4GLXA 4LUVA 1HNXL 1IBML 5IP7G 5IYBG 1IBLL 2UXBL 3NENA 2OCEA 1AE3A 1K8AC 1R9TH 4IPDA 3KDFB 3J81c 4QY7A 2H5XA 3STBC 2ATWA 4BA2I 3J80c 4ALPA 4X64L 5JEAJ 5M3MG 1HZBA 1S72A 1LUZA 4BY1G 3ERSX 1PH1A 2AWOA 4X66L 4LF7L 4QIWE 4QJFA 4Y7NH 4DR2L 2UUBQ 4DR7Q 1EQRA 4DV3L 4DV5Q 3GTKH 2GVBA 3W1GA 3CCSA 2UXCQ 5M5XH 3S1RH 1GVPA 2UU9L 2A8VA 3HOYG 5M5WH 3A0JA 2KCTA 3TS0A 2E2IH 4JI7Q
chains in the Genus database with same CATH superfamily
2PZTA 4YY3Q 3JAML 3A8IE 2WKCA 1EWHA 2HDMA 1QCBD 3CC7A 1EY5A 4DV7L 4A3GB 3E9HA 1L0XB 3HKZB 4BBSG 1YHAA 1SYFA 1G291 2ZTDA 3SE0A 4GNXB 2Z8LA 4DFAA 3S2DB 4G57A 4K5XA 4G7ZC 3F1ZA 1DCZA 4APVA 3W1BA 5I2XA 4JK1C 4X3KA 5FOBB 1P16A 4AQYQ 4IPCA 4DK1A 1FJGQ 4A4IA 2SEBD 1R9TB 3CCVA 1DD2A 3PO2G 4NXNQ 3K0YA 1MBYA 2FHTA 5LL6X 2R92G 3IKJA 4EVOA 1CKOA 4GLAC 5EKLA 4RAUC 1K9MC 3BVMA 1KLUD 1XXGA 4QGUA 3CXCA 4R4TA 1IBMQ 2JA7H 1C8CA 2A6HD 2KHIA 2K7VA 1FNWA 5FK9C 5A2QE 2VS1A 5EPKA 3QOJA 5M5XB 3S1RB 1YJNA 1F2LA 4DK3C 2E2IB 1QVGA 4DR7L 2F3VA 1D5MC 3PV0A 2F4VL 4X66Q 1DGSA 1PH3A 1I4XA 1TWHH 4L5TA 4ZKCB 3S17B 5FLXc 3I90A 1PMRA 4HMIA 4RKBA 3HS0C 1X55A 1PRTB 2DY8A 4KHZA 1JC7A 3OOCA 2N49A 2A6HC 2F0JA 5IWAL 1VQ5A 2E2JH 1E2WA 2Y0SG 3CP0A 1PH5A 1EEFD 1YVCA 2VW9A 3PO2H 3HFZB 3R2TA 5K36G 1EQTA 2RCFA 1T5EA 3A56A 3CPFA 4NPSA 2R92H 1X3QA 3EJIA 3DWQA 3GDEA 5ELDA 2JXMB 3CRKC 3U9OA 3LX0A 1A63A 1EY4A 3AFPA 4LF9Q 1NAPA 5JEAH 4B3RQ 2F0SA 5FLXL 1JE4A 3KF8A 4R4OA 5IGEA 2VB3X 5LMNQ 1IYUA 2B29A 1SNPA 1H95A 4C1NI 1UNSA 1NY4A 5IYCG 1V1PA 2ZM6L 3MC0B 1EWCA 3T1HL 4B3SQ 4A75A 2Z6KA 1PZID 4ODGA 5LMNW 4UHVA 1X56A 1PFSA 1YI2A 4BBSB 5IYDG 2A69D 3M4PA 2R6GA 2OF1A 1EWIA 3ICEA 4DV0L 1LABA 2GVAA 2Z0SA 2R3ZA 1HUNA 1DJRD 1ILQA 4CKBA 1F77A 4LFAQ 5K36H 2L0CA 2B8GA 5FO7B 1IXRA 2DY7A 2E2JB 3MWYW 4XT1B 1DOLA 2PZUA 1VQIA 1F9QA 5IE8A 3PO2B 1E1OA 3I56A 1S5ED 5EBCA 1FNVA 2R92B 3KBGA 2C9OA 5FLMG 4FF1A 2F0MA 1X3EA 1IBKL 1PH7A 1X32A 2A69C 3PF4A 5IYCH 5C44G 1JJ2A 4DN4M 1LTAD 1A8VA 1I4HA 4KJOA 4B3TL 1XNRQ 3CCUA 3TP6A 2B2WA 1TWCH 1GUWA 1CKNB 2WAQG 1JCKB 3EFXD 1XX8A 4DR3Q 1P8LA 3F2CA 1EOVA 5IYDH 3H0GH 4KJNA 1BUVT 5HGQA 2K5HA 2K5QA 2Q2IA 2Q2TA 3R8BA 1VQDA 1Y8PB 3NWTA 4AYBE 3M4YA 1E2ZA 4X3UA 1BCPB 3HG9A 3OIPA 4R4CA 5D65A 4ZCKA 1N34Q 3NWSA 1QILA 2ZXPA 1D1IA 1U4PA 2Q8RE 1RKNA 2Y0SB 3A8KE 1XMOQ 3DHQA 3VYTA 5FO9B 5FLMH 3HOUG 5AFWA 3FPUB 4KKSA 4NP5A 1K83H 2XNAC 2K6AA 4WJ3M 1QOHA 4IOCA 1CA5A 2D0OA 4HJ7A 1B7YB 1FVIA 2SNMA 5E4XA 3ONAB 1AW7A 2YV5A 1SDFA 1X3PA 2FMMA 4MNOA 4IUUA 5IGFA 4JV5Q 1C9OA 1SLJA 5A2QL 4L5QA 3KF6B 3S15H 1TWCB 4A3FH 1VQPA 3D31A 1ENAA 2EIFA 4HEDA 1HFNA 3H0GB 3T1YL 2EYHA 3CCEA 4MIUA 4C56C 1GUNA 2JE6I 3PUYA 2ZJPA 4DR6Q 4CGYB 3AYHB 2ES2A 4OGQC 4IJHA 3HKZE 2B2TA 1M1KC 2LKVA 3HOUH 2Z4HA 3BDLA 5KNDA 4DR1Q 5AJ3Q 4H13C 3F2BA 3QOLA 5BR8Q 3HOVG 2AUJD 4GKKL 4JBMA 1ENCA 3I4LA 4H0LC 1VQOA 1I4PA 1K83B 1DOKA 3CCRA 4ZK9B 1KDCA 4DUYQ 3D3RA 1S5BD 1QUQB 4YWKA 5C44B 2BH8A 4K6LA 1M8AA 5I6WA 3BVZA 4V190 1Q12A 2WAQB 1SNQA 4UP8A 3KUPA 4HIKA 4K0KL 1EEID 1SJHD 3S1QH 3VDYA 2IWHA 3S15B 4A3FB 1NNXA 1VQGA 3I3CA 1HQRD 3A8JE 1KAAA 1KIXA 1FYCA 1F2YA 1NE3A 1S5CD 1SXTA 2K03A 1TS3A 4NMZA 1UUPA 1FNUA 2L12A 3J80E 3TP7A 2G9HD 3GP7A 3P20A 2F3WA 3PUXA 4NB3A 1L1OC 5TSSA 3OMCA 1RD9D 5I2YA 1HR0Q 3HOVH 1TY2A 3K0XA 4JG2A 2F0LA 3SGIA 3HOUB 3DUZA 3PGZA 4K5VA 1W2BA 3CC4A 2Z9HA 4M1UB 4DV4Q 1VF5C 1D7QA 3CMEA 1HR0W 2EY1A 1SRUA 2QEXA 1PH8A 1JB3A 3V05A 2E5LL 1EQQA 1W6JA 1G2TA 5EKIA 1H9KA 4DR4L 2EY6A 1TWFH 4OWXB 2KVMA 1Z6HA 1STEA 3TDQA 3K8AA 4F88A 1KRTA 4LFBQ 3VA7A 2YTXA 3FMCA 3EN2A 4OIKA 1Q81C 3PIP3 2B2YC 3S1QB 3FPPA 3U4VA 2IHFA 1Q90A 2Z4IA 1TWGH 1MHWC 2K4KA 2MNAA 3SEBA 2MO0A 1MKHA 4V0BA 4HJ8A 1AZQA 1BNZA 5G3LF 4GN3B 4Q5VA 1PLFA 4EX5A 2O4XA 5ELFA 1G6PA 1BOSA 2ZTCA 2K01A 4A3DG 3H3VI 1L0YB 4HSPA 3HOVB 4R1JA 3WOFA 3R3OA 3TZUA 3TZDA 4B9WA 4IUTA 4FF2A 1PHJA 2UXCL 1TVXA 1RF2D 2BDOA 3J80i 3M9BA 2G9DA 4ZUIA 2NVXH 2NTSA 3VR3A 2UU9Q 3C46A 3EA6A 2F0FA 2B39A 2CQOA 3MXNA 4JI6L 1B44D 1TWFB 1XPOA 3D4DA 3PUWA 1QJOA 2HQLA 5KIXA 2JN4A 4IO9A 4KHPQ 1EYCA 4HAEA 2UXDQ 5CV9A 4J6HA 3NTIA 4HR7B 1TWGB 2F1MA 1V1QA 3KBXA 4AQYL 4B3MQ 1WVLA 4A3DH 2AQ1B 1FJGL 1DONA 1E24A 1HZ9A 4NXNL 4A3MG 1MGSA 2AQ2B 1IHZA 1QE6A 1J6QA 3QWNA 4GLXA 5FKAC 1ONLA 3T13A 1K0SA 1IBML 5IYBG 3MFGA 4IPDA 1BF4A 3PQIA 3J80c 5C3WA 2B2VC 1H9JA 2NVXB 2F0WA 3ERSX 4X66L 5C6AA 4DR2L 1EZ6A 3IFTA 5CBEE 1JQYD 1ZKOA 5DEHA 3W1GA 3GTOB 5M5WH 3QR8A 2EYOA 1WCMG 4UPAA 3U4ZA 2F0GA 4YCUA 2MP1A 2XRSD 1I94L 1Q7YC 4UP9A 4IALA 4RA8A 4A3MH 4A3LG 2IX0A 4F8MA 5ELBA 3DMUA 3J80L 4MTKA 3DEOA 4RHRA 4DV1Q 4A3DB 2DUDA 4R4IA 3I72A 1JICA 5IYBH 1C48A 4DAPA 2I5MX 3CW2C 1YJ9A 5K5PA 4K2LA 4FDBA 3EBEA 2IY5B 5CORA 5CV6A 3OIQA 4OEMB 2N3SA 2XWJB 4R8NA 1KD1C 4C3JG 4B3SL 3MEFA 5CYUA 3UI2A 1HNWQ 4OWTB 1UE7A 2QDBA 1TU2B 2HD3A 4KKUA 4F7XA 3H09A 1OXXK 2QEJC 1XTDA 3E0EA 1SR3A 4R8IA 1STBA 1NCVA 4XT3B 2WINB 3RLOA 4JI0Q 1H9SB 2JP1A 2OXPA 1IBLQ 4JOIA 1WCMH 2X69A 1CUKA 1KHIA 3C1FA 3KLSA 4KN7C 3G4SA 2RF4A 1WTVA 1AZPA 5M5WB 3NELA 1PV4A 1KNEA 3CCMA 1CSQA 4CJ0B 4A3LH 4GLVB 4LF7Q 1QZGA 2VZAA 3E0JA 1X65A 1AN8A 4JI7L 5H1SE 2OQKA 3D4WA 2A68C 2EYLA 3W3AA 1J8IA 1NR4A 4A3MB 1IW7D 5ELNA 3I55A 5COYA 1OXVA 4IOAA 1ZEQX 1KRSA 1D8LA 3HOWG 3A55A 5L37A 2V4DA 1KAWA 5LMUL 2Q2UA 3AFQA 4P74A 4PZ6A 3ZYYX 2B63G 1XNRL 3MXPA 1GHKA 3KLRA 1S40A 1J5EQ 3URYA 1A3UA 4R4QA 4DR3L 3NQTA 1ASZA 1VQNA 4FP5D 4LWCA 1PZJD 3R93A 1B70B 1K0RA 1JOKA 2EY2A 4ULLA 1PRTF 3N6RA 1MSGA 1IW7C 2F0VA 2IX1A 1ICWA 4MTNA 3PO3G 2UUAQ 3A5ZB 4EQ5A 2OWOA 3UDIA 4DV2L 4IFDI 1WCMB 4WFN3 4FF4A 3RZDH 4Z9CB 4X62Q 2XSCA 1C7YA 2CFMA 2A73B 1XMOL 1CT1D 2YTVA 5E7NA 4X65Q 2CWPA 4NKLA 1SMXA 1GKHA 1K28A 2AUKA 4HIMA 1U4LA 3HOWH 2JA6G 2YU9H 2HIVA 4QUCA 1FL0A 4IURA 1VQ8A 2DJFC 2Z6BA 4DPGA 4BXXG 4ID6A 2B63H 3KOJA 4MHEA 3OTOQ 1CZWA 1PH9A 2JA7G 4KY6A 4C3JB 2RDFA 4JV5L 4K6DA 2F0PA 3NHHA 4JBWA 4K14A 2JJQA 4DV6L 3LGJA 2ZTEA 1SYBA 1STAA 3PO3H 4HJ9A 2G5DA 5KRUA 1Y1VG 4DR6L 2KJXA 4JI2L 1S4ZA 1BR9A 2WP8J 4LFCQ 4CJ2C 1RODA 2R93H 2KQ3A 3NQIA 3RZDB 1MI2A 4AH6A 5EAYA 4HIDA 1Z7TA 2PQAA 3KYHC 5EPLA 4DGZA 3T56B 4DR1L 1S5DD 5AJ3L 3KLSX 3OSOA 3NP8A 4FVMA 1O7ZA 2D62A 5BR8L 2JA6H 1D5XC 2A1AA 1YNND 3RN2A 4RG1A 3TS2A 3I4NG 4Y52H 4C2MH 5C0XI 1IYJB 1LT3D 1EZ8A 4BXXH 2PI2A 2MO1A 3HOWB 1ZYRD 4KMUC 1VQCA 2YU9B 5FJ8G 4DUYL 5CV8A 5JEAG 3HKSA 1YJWA 3AMUA 1HCZA 2NTTA 2B63B 4MZ9A 4OELB 5FO8B 2RHQB 3NBIA 2K1BA 1VDZA 3I8ZA 2SDFA 1XMQL 1VS0A 1Y1VH 1YNNC 3K5MA 4XDXA 4RHSA 3PO3B 2L11A 1BCPF 2JEBI 2HIXA 1YHBA 4N9PA 4I7ZC 1LACA 4KN4C 1ZYRC 5G3LD 1EY9A 1CSPA 3PMFA 4N8X1 1QWYA 2OTJA 4YHHL 1ICFB 2BH2A 2R93B 2R7ZG 4FXGC 1HR0L 2RVLA 3M85A 2HCIA 4TRDA 2CW0D 2RHSB 3CCQA 5LL6S 3I4NH 1N32L 1EIHA 2AMCB 1L1OB 5HY6A 1Q82C 1LTSD 4DV4L 1HFGA 5EQ0A 3W5OA 2QDLA 4ABNA 2JA6B 5FJ8H 1YNXA 3A5UA 4GOPB 4C2MB 1UEAB 1DZ1A 1XPUA 4DAYA 2K05A 4C3IG 1G2SA 4ILWA 3CCLA 4DK6C 4PG3A 1JOOA 4LF5L 2JA7B 2CCZA 3FVQA 3GD7A 4RGNA 1WD0A 3VR2A 4OX9Q 2E76C 1UE6A 2N55A 2Z6KC 5D3DA 2LSSA 4JI3Q 3STBD 2CW0C 3RZOH 3NPPA 3HGBA 3D0FA 1B50A 3H0GG 1B3QA 2LXJA 1EYDA 2JEAI 5J3BA 1TWHB 2NVYH 3UE0A 1SYEA 1Y1VB 2RDGA 2L55A 4DUZL 1EIGA 4LW1A 4RH6A 5EKKA 5I9OA 2R7ZH 1Q46A 1Q8KA 3BDOA 1R4PB 1HXYD 3K7UC 4L6TB 3SK8A 3GTGH 4OO1G 4GKJL 1NJIC 1NTGA 1L2FA 2E2HH 1MIUA 1PTOD 1PA6A 2NZHA 3H94A 2ZJQA 3E3XA 3I4NB 3S2HH 3PSIA 4C3IH 1HA6A 4ZYSA 3J81E 1QVCA 4DR5Q 1HRJA 3U9SA 2VQFL 1T5XD 3G6JB 2XTIA 4TKOB 3CKIB 2B2WC 4RCOA 2Q2HA 5ELCA 2E2DC 4BA1I 1KTKA 1XTCD 2B2UA 4CDEC 1BQQT 5ISRA 3S1MH 4LF4Q 1GJXA 4JYAQ 1PTOC 3CPWA 4A3FG 4A3BG 3QJYA 3OHXC 2H4OA 3RZOB 5JJIA 5EBDA 4G7HC 1LM0A 1VQHA 5CV7A 2NVYB 1SNOA 1EFID 3MA2B 1KABA 4OO1H 2MPMA 2VNUD 3UDGA 3RNUA 4B3ML 4KHVA 5C5LA 2R7ZB 1K73C 3T4AC 1X9NA 1B9MA 4TQUS 1ET9A 1LO5D 5IODA 3GTGB 2DNEA 3KK7A 2BE5D 4I65A 2K5NA 4NXMQ 5DAUA 2RKSA 3FDTA 2E2HB 4IN3A 1XNQQ 1RJTA 2O2LD 3PIO3 3UDFA 4ZKBB 1KL9A 4PZ7A 4P75A 3S2HB 4P71A 4C3IB 1I4GA 1VQFA 3NTHA 4GS3A 5KEEA 5GAHC 4DK0A 1Q1EA 3ND9A 4QF4A 2UXBQ 2MJ8A 4FNFA 3V96A 3S9WA 4HJAA 2ZJRA 2JA5G 1EQVA 1YHQA 3VR6A 3H15A 4F87A 1LTBD 2AHOB 2IJ0A 3F2DA 4A3BH 1G6ZA 2NZ1D 3WWVA 2BE5C 3MEHA 2F0DA 2L9HA 3J81i 1F2ZA 2I5LX 1SEBD 2XIWA 4JI5Q 3A54A 3NBHB 1I6HH 4PMWA 1UAPA 1PH6A 4UP7A 3OMGA 2K14A 1U5KA 2B2TC 4GN4B 3K58A 2FMCA 4O2DA 4DV7Q 4GNXA 4DV1L 4L5RC 5KNCA 2H1EA 2SOBA 3K5LA 4PMBA 1NUCA 3TN2A 2HHHL 1BDOA 2K5WA 1N33L 1UWVA 1E0BA 4JCVE 2KUMA 1TWAH 1SE3A 3MAQA 1OXTA 3MZ5A 1X6OA 2JA5H 1TQOA 2NVQH 2VQEQ 1CKMA 4AIMA 1PRTD 4XTCS 4HSVA 1NMFA 3N52A 2J7ZA 4P2CB 2GA4B 1IBLL 3NENA 4A3BB 3RD4A 4IUPA 3KDFB 3J81c 4QY7A 2H5XA 2ATWA 2FJ2A 1EU3A 1O7LA 1SYDA 5BN5A 1S72A 3EROA 4BY1G 4LF7L 2AWOA 3SHLA 4QJFA 1I6HB 4Y7NH 2D2CC 3SK6A 4DR7Q 1KDAA 3GTKH 2GVBA 4CDFC 3CCSA 1HPCA 1HTPA 1GVPA 1PRTC 2KCTA 2MGSA 3I73A 1F9PA 2ICEC 2PW5A 1O7YA 4LF6Q 1U0LA 2BA1A 5C3EG 4IPGA 1G51A 1STGA 5E4WC 5IWAQ 4KI0A 3J81L 1U4RA 3S14H 4QMGA 2ASBA 1J5EL 1O78A 2QCPX 1TWAB 2KHJA 3P1HA 2XWBB 2QGQA 1NR2A 4CDDC 4GOPA 2JA5B 2JA9A 2NVQB 1RIPA 4JW0A 2RSOA 5IOCA 3GTPH 1BBWA 3T51B 2UUAL 4Q0FA 3Q24A 1D1KA 5KYIA 3K6OA 4BY1H 2NUCA 2KCCA 2F0IA 3O13A 5IGGA 5KYLA 3T1HQ 1PVOA 2BCOA 3K59A 4HCSA 1RHPA 1Y14B 2EVBA 4WJ4A 1OXUA 3IAYA 1M90C 4IFDJ 4J1MA 1IKMA 3GTKB 3I2ZA 2L1BA 5C3EH 5DLQE 3BZDB 3QG1A 3ERQA 4X64Q 4DV0Q 4DV5L 5J39A 4EQPA 3K81C 1GM5A 3PIPA 3OTOL 3A7LA 1KDBA 1VMPA 4JVZA 3VYUA 2F0UA 3H91A 2K28A 1VQ9A 4YY3L 3BYYB 2KECA 1BVSA 1EY8A 1LT5D 2KHSA 2KENA 3QIAA 3ULLA 1CM9A 1TR5A 1TS5A 4L63B 1BCPD 1IL2A 2EYMA 3CQZH 2A19A 3J7AF 2KEDA 1KQSA 3GV6A 4ME5A 3GTPB 2EXDA 1CKNA 2K75A 3CAMA 2NB0A 3OWEB 4CDCC 2PW7A 1X54A 3H3VC 4B3TQ 2D9UA 4BY1B 3ULJA 4JI4Q 4CKEA 3DLLA 2D0PA 1FR3A 1K8GA 4WJWA 5E3FA 3CC2A 1ENFA 4M8AA 2EQSA 3M7NA 2CQAA 5IT9E 3GTJH 1CA6A 1TXYA 3EQLC 1B3AA 5C3EB 1QZHA 1WI5A 1A2TA 1K8OA 5C4ZA 3OWFA 4KKTA 4YIJA 1EY0A 3IL8A 1CK1A 5F2DA 4LUZA 4B08A 5I4DA 3M4OH 4O0AA 1OO9B 5C0XJ 1VCIA 1STYA 4KK7A 4OO1I 1LTID 2ZXOA 1WTHA 4QCLA 1I4RA 2VL6A 1LTRD 3NTKA 1SROA 2EE1A 1JOQA 4EQOA 2ENBA 3OPOA 3P75A 3CQZB 3KF6A 1IL8A 4WORA 4JBJA 3X3MA 4H02A 2K50A 4KLKA 4XYQA 1II3A 4U673 2K33A 3EIVA 3TP5A 1VQEA 2AKWB 3TSSA 2QA4A 5JVH3 1BBXC 4LF9L 1WOCA 4PQXA 4B3RL 3GTJB 2PCFB 2UUCQ 2D5DA 5LMNL 3FHWA 1SE2A 1TS2A 5D3IB 2M2LA 1XYIA 4OX9L 3KF8B 1BKBA 4JI3L 3M4OB 4RMFA 1V1OA 4E6IA 4ZQ3A 1V1PB 4GKKQ 3MVVA 2SNSA 4A93G 1QNKA 1QUQA 1K3RA 1PTOH 4XYOA 5BN3A 3DXJC 2QW7A 4JOIC 5HURA 3CRLC 2VY3A 3G71A 1CI3M 1WTPA 1DYQA 4BWGB 2JSOA 2M00A 3MXGA 4A3EG 1HNZQ 1BXTA 4LFAL 4QQBX 3SK5A 4S3SA 5IGCA 4JBKA 1GD7A 1SN8A 1JB7A 3OW7A 4RFBA 1PH4A 1E1TA 1D2BA 1IKLA 2EXZA 3BYTB 4I7AA 2HDLA 4CBVA 5JAVA 3UE1A 1N36Q 4DR5L 4FF3A 3JAMi 2VUMG 2A74C 2EOTA 1VF7A 2LFNA 2NN6G 3C1EA 4YCWA 5CBAE 3OW2A 5C4XH 4POFA 2VXWA 1AP0A 1STHA 5KGUA 4JI1Q 4LF4L 4A93H 4JYAL 2PNHA 1B1ZA 4IZ8A 1WYDA 5IT9c 3K57A 4P72A 2A5HA 3LWUA 4A3EH 1PTOB 1SBBB 4PNYA 5IGBA 2WB1G 4BBRG 1L0WA 3BJUA 3D6WA 2E5LQ 5JPNC 2E74C 4RWSC 4ZLTF 4YWLA 1VQLA 1N34L 3PF5A 2RBMA 3FEWX 4B9XA 4ZRZA 2R93G 3TMEA 2PQEA 1E7ZA 1W3SA 3IFDA 1EIFA 3AU7A 2L15A 5GQOA 2MFIA 4BY7G 2EYPA 1GHJA 4POGA 2NBFA 1XNQL 2CH4A 3FRPB 2VUMH 3FKIH 1SFOH 3DM1A 2NN6H 3JAMc 1DXMA 5IT9L 1O7IA 2OTLA 2WKDA 4DF7A 1EFWA 1TIID 3HZXA 3GV3A 3CF5A 3KJPA 4FO2A 2E75C 1S5FD 1S3OA 4LUOA 3C3LA 5EPJA 4TSSA 3EVQA 3AEVA 1ASYA 5JVG3 4A93B 1E22A 1A62A 4BBRH 1J9OA 3P7JA 4JI5L 1IYVA 4O42A 1Z9FA 4A3CG 4KY7A 2JA8G 1V8QA 4A3EB 1R4QB 1TKWB 4XQQA 3F2UA 4BY7H 4RKLA 3GO5A 2V1CC 4JI6Q 4RGOS 3S17H 3ER0A 1VQ4A 2KBNA 3RN5A 2OQ0A 1OXSC 3S24A 1D6EC 3J81j 1Q86C 3NXWA 2VUMB 3FKIB 4KD4A 3A7AB 1SFOB 2X6LA 4QB4A 2NWGA 1I6VC 1LV9A 3CD6A 2VQEL 1WTOA 1LT6D 3M3YH 1DOMA 3KFUA 2HQEA 4A3IG 1GXDC 1NBWA 4LF8Q 4A3KG 4G7OC 3L3OC 4CJ1B 1LTGD 5T1IA 3I91A 3C2PA 2KEEA 4A3CH 1W6KA 2PI2E 2JA8H 2L4NA 1X3GA 5GROA 2WACA 2WB1B 3GQBA 1CHPD 1SNMA 4BBRB 1WTRA 1WJJA 3FP9A 2HT1A 2LXKA 5IY0A 5JJLA 4IJLA 3CHBD 3SXHA 2ALYB 4OXPA 1WTXA 2MUYA 4BBSH 4DR2Q 4BY7B 4IUVA 1GUGA 1HTLD 3SVMA 4IPHA 2FINB 4LF6L 3KJOA 4K8JA 1GO3E 5LHY1 3R2IA 3E5SA 1EOTA 4DNRB 1T9HA 3DWPA 4O1NA 3IRBA 3M7GA 1I4QA 3ULPA 2BA0A 1SYGA 1M4VA 1I94Q 1HHVA 4OIJA 5M5YH 4A3IH 1LYLA 4A3KH 4HN7A 1QG7A 1YEZA 1NSNS 3X3NA 4LFBL 4DU9A 3M3YB 2Q8TA 5GAGC 3L0OA 3PUVA 2Z1CA 1O80A 2F0NA 2I5HA 2TMPA 2N88A 5I6YA 1KNAA 4UAIA 2JA8B 3D6CA 3NK9A 3TEHB 2BOSA 1QB5D 4H7BA 3H3VH 4FYDA 1F9SA 2O5JC 1H9SA 1KLGD 4LUVA 3J7AV 5IP7G 2OCEA 2ZXRA 3STBC 4BA2I 3BVGA 4ALPA 4X64L 5JEAJ 2PYKA 5M3MG 1CQFA 1PH1A 1A3VA 3K5OA 4QIWE 2I46A 5C4HA 2UUBQ 1Q3LA 2FFKB 3AB9A 2OT2A 1B2TA 2QF7A 1QNUA 1U9RA 2UU9L 2A8VA 3TS0A 3HOYG 1MD2D 4JI7Q 2PZWA 4YWMA 3J7A5 4A3IB 5M5YB 1HA5A 1WTWA 1KXLA 2B2UC 1Y69U 4A3KB 3HOZG 1SNCA 3I70A 4K2KA 1SE8A 3MXNB 3GTQH 3QO2A 2XRQD 4KHPL 1HH2P 3E9IA 3V2TA 2UXDL 2F03A 1ESFA 3NEMA 3BU2A 3SR1A 5LMUQ 1PFNA 4GN5A 2TSSA 3E6ZX 1XPRA 4JI4L 5ELEA 5IP7H 3TBIB 3OYYA 4QUFA 1FGUA 4CHTB 1QVFA 3BG3A 4JI8Q 4R9WA 2PO4A 1Y8NB 4MN3A 5JOBA 2DN8A 5M3MH 1AH9A 1JMCA 1N9WA 3CMAA 4DV2Q 1UE1A 3HP3A 1X3FA 1HNXQ 3HOYH 1LT4D 1B8AA 1JR0D 2DJGC 4IQZA 1EU4A 5EGTA 1OTCA 3HOZH 1I50H 3PCOB 5HGTA 2IHEA 5J22A 1AFPA 1SSOA 1RL2A 2JYOA 3S1MB 2NZOA 2ZT9C 3SDZA 5C44H 4DV3Q 3GTQB 1LTTD 4OHJA 4DXGA 5E1FA 1A6XA 4JC0A 4X6AH 3PIOA 2EPBA 1SJED 1PYSB 2F52A 2CVRA 1KC8C 3ZJYC 2NN6I 2PNRC 1JWUD 1AE2A 2FXQA 4IUNA 4DAMA 4ZUJA 1RDPD 2XVSA 4DV6Q 4XXEA 3S16H 1YIJA 4GNXC 2F0KA 1F2MA 4BS9A 4HIOA 1UEBA 4OL7A 2IL8A 5M3MB 2K5DA 3UDXA 2NVTH 5IP9G 2UUCL 4JI2Q 1EY7A 1ZXTA 5M3FG 1B9NA 5IGDA 2RCNA 5JPMC 1HQMC 3B6YA 1HNWL 3MFYA 1Y8OB 1F9RA 1H9MA 1SE4A 3HOYB 4HCEA 4CKCA 1EUJA 3HOZB 1A3TA 1I50B 4JI0L 3Q8DA 1CZGA 2J4XA 2A6ED 3LWEA 5I9PA 4IFDG 1PXUA 3DM3A 1HZAA 3HEJA 1YZ6A 2QKIC 4OONA 2F3IA 3Q23A 4KY5A 2R61A 1HNZL 1VMCA 2IPKD 1JT8A 5D14A 1D5ZC 3NE5B 2JK8A 4XQNA 4QL5A 2EJGC 2DNCA 3HOXG 4GZYC 2EYFA 2K5VA 3I4OA 2XN9C 5ELOA 3SK4A 2EJFC 2F4VQ 5C5MA 1XMQQ 2PMZB 4DXFA 2XGTA 4P73A 5EJWA 3Q22A 5CV4A 2C5CA 3S16B 2WB1E 1N36L 4LK1C 5IP9H 2KCMA 3G48A 3I4MG 1CTMA 5M3FH 5A35A 2A6EC 2YYZA 1G91A 3L7ZC 1JJCB 2NVTB 2F0HA 4J8QA 2EDGA 4YHHQ 3RMHA 3F8TA 1L1OA 2IX3A 3MHBA 3TRZA 3VR4A 1N32Q 4GOPC 5CC4A 1PH2A 4JI1L 1MJEA 1JORA 4KV6A 4IFDH 1A2UA 3L9AX 4H44C 4HTHA 4RGMA 3U58A 2E8GA 2F0QA 2K52A 4KD3A 4TVAB 2N78A 4JPBW 3NSWA 3HOXH 4DNTB 2GN5A 4X62L 4LF5Q 2EZVA 2CKZB 4YCVA 2ZM6Q 3CCJA 2ICIA 3NUCA 1C0AA 4X65L 1VQAA 3MTSA 4Y7NB 1Q1BA 5C0XG 2IT1A 4A76A 3I4MH 2B2YA 1HUMA 1STNA 3TQYA 1EYGA 3BZKA 1EL0A 3VR5A 1GUTA 1XJVA 2BDNA 1V9PA 5M9OA 5M3FB 4DUZQ 4RGTA 4DA2A 2ID0A 4PZ8A 1PYBA 1RTNA 1YNJD 4GKJQ 3VA5A 4K5WA 1JE5A 4OWWB 3S14B 3VYRA 1VQKA 4L5SA 1WD1A 2B8FA 4L8JA 2DGYA 2P5ZX 3JC66 1CFMA 1RCVD 4DAVA 1XWEA 2O5IC 4DKAC 1IBKQ 5J1ZA 2VQFQ 4XIGS 1B4OA 4A3JG 4LFCL 3Q0AA 4DNIA 2LY7A 3TP8A 4FXDA 2EJMA 3HOXB 2M9VA 5C0XH 3Q6SA 1YNJC 1B53A 4K8IA 2I07B 2CH4W 2AWNA 4LNQA 1FGBD 3GTOH 3J7ZC 1G8ZD 2CHBD 2PQAB 3T53B 1BCPC 1VQBA 3I4MB 4EGVA 3K7AH 3GTMH 3RLNA 5KNBA 5NUCA 4LJZC 5GAEC 1VQ7A 1VQJA 1LLRD 4U68A 1EIYB 1HJPA 3A74A 3H6MA 4LF8L 1H9RA 4UY8C 2K04A 4C3HG 1LTLA 1PTOF 4A3JH 4N8FA 1CHQD 2Y0SE 3JAME 4HJ5A 1E3PA 2QILA 1TT2A 4AYBG 2B2VA 2PPBC 3BZCA 2F4IA 2CWAA 4X3SA 2AQ3B 2RSNA 3D8GA 1GOZA 3PUZA 2J0TD 3WDNA 5JJKA 3K5NA 4C1NK 3NBHA 3RLFA 2C35B 3T1YQ 1N8RC 1CQVA 2LMCB 1WTQA 4J15A 2WV6D 3K7AB 3GTMB 2I0QA 1ILPA 3QB3A 4DAYB 3D4RA 2EYJA 1JWMD 4C3HH 3KLWA 5BN4A 1SYCA 2N8NA 1EY6A 5DNFA 5C4JH 1GUOA 5GADC 5C4XG 2R7FA 1VQ6A 1FD7D 2KOLA 2WFWA 1AEXA 2K32A 1K3BC 1RTOA 3W2DA 2HHHQ 1Q8IA 3S1NH 1UE5A 5IIFA 4UDUC 1N33Q 3ITPA 4A3JB 1HZCA 1Y1WG 4ZAIA 4HMJA 1YBYA 2EY5A 4G4KA 4FXKC 5C3XA 2A68D 4QIWB 3RR5A 3GTLH 1BO0A 2RDHA 1YITA 2R7DA 3KDFA 4A3GG 5CMDA 1Z47A 3HKZG 1BBUA 1GUSA 4K0KQ 1C4QA 2HUGA 1NMGA 2MHVA 1EYAA 3RUZA 1DM0B 3CU7A 5JJZA 1PFBA 2RA4A 1WFQA 3FKIG 5DM63 1A0IA 3HRZC 1SMYD 2UUBL 2OEOA 2WAQE 1I3QH 1V43A 4NDXA 2F0TA 4LAAA 2KCNA 2PMZE 4ME3A 1MJCA 2MQHA 3DWAA 4C3HB 4X3TA 5FLXE 1I5FA 5C4JB 3T16A 1MSHA 2Q8IB 2RQXA 1Y1WH 2F0OA 3G6EA 1IZ6A 4C3JH 5CR3A 1K8MA 1TY0A 3TREA 3S1NB 3I7FA 3U50C 4KTAA 5DM73 1VQMA 2HCCA 2NYZD 1SMYC 4AYBB 3L2PA 4N9TA 2B3GA 4DR4Q 1ML0D 3M4QA 4PMCA 4A3GH 2JQOA 4EQNA 3WOEA 4WRDA 4JI8L 1PZKD 2IW3A 4IUQA 1ESRA 1SAPA 3GTLB 4NXML 1ET6A 1JJGA 3AQQA 1PYWD 2YTYA 3ND8A 3S2DH 1U4MA 2KA7A 2LS01 3MXUA 2VB2X 2WIIB 5T1GA 3K80C 1HNXL 3VYSA 1SNDA 1JWSD 3J7YW 1PFMA 1TS4A 2UXBL 3G7LA 3BS1A 1AE3A 1K8AC 1R9TH 5CV5A 1I3QB 4PV1C 3BDCA 4XQJA 1PDQA 4RCNA 5C4XB 1HZBA 1LUZA 4LMQD 2F0EA 3LNNA 3DEPA 1EQRA 4DV3L 4DV5Q 1A15A 2UXCQ 4NW2A 5M5XH 3S1RH 5CGKA 1Y1WB 3A0JA 1E2VA 2X6GA 2E2IH 2L5TA
chains in the Genus database with same CATH topology
4YWMA 3J7A5 1WCMG 4YY3Q 4UPAA 4LF6Q 3U4ZA 1KXLA 1U0LA 2BA1A 5C3EG 4IPGA 3HOZG 4YCUA 1G51A 3CC7A 1SE8A 1I94L 1Q7YC 3MXNB 4UP9A 4DV7L 3GTQH 3E9HA 5IWAQ 4KI0A 4A3MH 4A3LG 2IX0A 3S14H 4KHPL 1HH2P 3E9IA 4BBSG 2UXDL 2ASBA 1J5EL 1YHAA 3NEMA 3BU2A 5LMUQ 2KHJA 4DV1Q 1G291 2DUDA 2ZTDA 4GNXB 3RN2A 2QGQA 4GN5A 4GOPA 2JA9A 4R4IA 1XPRA 4JI4L 5IP7H 1RIPA 5IYBH 3OYYA 3F1ZA 2I5MX 1FGUA 3CW2C 3W1BA 4APVA 1YJ9A 1QVFA 4FDBA 3EBEA 2IY5B 4JI8Q 3GTPH 1BBWA 1P16A 4AQYQ 2N3SA 2UUAL 4IPCA 5M3MH 1FJGQ 1AH9A 4A4IA 1KD1C 4B3SL 3MEFA 1HNWQ 4BY1H 3CCVA 4OWTB 1JMCA 1UE7A 3PO2G 1N9WA 4NXNQ 3CMAA 4DV2Q 2R92G 1OXXK 1CKOA 4GLAC 1UE1A 1XTDA 3T1HQ 3E0EA 1PVOA 1SR3A 1X3FA 1K9MC 1HNXQ 3RLOA 3HOYH 1Y14B 4QGUA 4R4TA 1B8AA 3CXCA 1IBMQ 4JI0Q 2JA7H 4WJ4A 1OXUA 2KHIA 1IBLQ 4JOIA 1M90C 4IFDJ 1WCMH 2VS1A 1CUKA 1KHIA 3I2ZA 3G4SA 1OTCA 5C3EH 2RF4A 5DLQE 3HOZH 1I50H 1YJNA 3PCOB 4DK3C 1QVGA 3NELA 1PV4A 4X64Q 3CCMA 4DV0Q 4DR7L 4DV5L 2IHEA 1CSQA 3PV0A 4A3LH 4GLVB 3K81C 1GM5A 4LF7Q 4X66Q 3PIPA 2F4VL 1QZGA 2VZAA 1DGSA 1RL2A 3OTOL 2NZOA 1PH3A 1TWHH 4L5TA 5C44H 1X65A 4DV3Q 4JI7L 5H1SE 2OQKA 1VQ9A 4YY3L 5FLXc 4JC0A 4X6AH 1BVSA 3PIOA 1X55A 5ELNA 3I55A 2KENA 1PYSB 4KHZA 2F52A 1OXVA 3ULLA 1KC8C 3TS2A 4IOAA 3ZJYC 2NN6I 1KRSA 1D8LA 3HOWG 2N49A 1IL2A 5IWAL 1AE2A 2FXQA 4DAMA 1VQ5A 3CQZH 2E2JH 2A19A 4DV6Q 2Y0SG 3CP0A 3S16H 1PH5A 1KAWA 1YVCA 5LMUL 4GNXC 1YIJA 2VW9A 1KQSA 2Q2UA 3AFQA 3HFZB 4P74A 4PZ6A 3PO2H 5K36G 2B63G 1XNRL 4HIOA 3CPFA 4NPSA 2R92H 2EXDA 1CKNA 1S40A 1UEBA 2K75A 3CAMA 1J5EQ 4R4QA 1X54A 4DR3L 3UDXA 2NVTH 1ASZA 4B3TQ 4LWCA 1VQNA 5IP9G 2UUCL 3GDEA 3ULJA 4JI4Q 4JI2Q 5M3FG 1B70B 1A63A 3AFPA 1K0RA 3DLLA 2D0PA 4LF9Q 2RCNA 4B3RQ 3B6YA 4R4OA 1HNWL 1K8GA 2IX1A 5LMNQ 4MTNA 3CC2A 3PO3G 2B29A 2EQSA 2UUAQ 3A5ZB 4EQ5A 2OWOA 1H95A 3UDIA 4DV2L 4IFDI 3M7NA 1NY4A 1EUJA 5IYCG 3GTJH 2ZM6L 3RZDH 3T1HL 4B3SQ 1TXYA 4A75A 2Z6KA 4X62Q 1QZHA 1WI5A 4JI0L 1C7YA 3Q8DA 5LMNW 4IFDG 2CFMA 3DM3A 1XMOL 1HZAA 1X56A 1PFSA 1YZ6A 2YTVA 4LUZA 5E7NA 4X65Q 1YI2A 4OONA 2CWPA 2F3IA 5IYDG 3M4OH 4O0AA 1SMXA 3M4PA 1GKHA 2R6GA 1EWIA 5C0XJ 1VCIA 4HIMA 1HNZL 3ICEA 1JT8A 4DV0L 4OO1I 3HOWH 2JK8A 2GVAA 2Z0SA 4QL5A 2JA6G 2YU9H 2HIVA 3HOXG 1FL0A 2VL6A 1VQ8A 5ELOA 2K5VA 3I4OA 1SROA 4LFAQ 4DPGA 4BXXG 2B63H 2F4VQ 3KOJA 3OTOQ 1XMQQ 1IXRA 2XGTA 1PH9A 4P73A 2JA7G 2WB1E 1N36L 1VQIA 3KF6A 5IP9H 2KCMA 3G48A 5IE8A 3I4MG 4JV5L 5M3FH 1E1OA 3I56A 4JBWA 2YYZA 2JJQA 4JBJA 5FLMG 3LGJA 4DV6L 2ZTEA 4H02A 3L7ZC 2K50A 1JJCB 1X3EA 1IBKL 1PH7A 3PO3H 4KLKA 4YHHQ 3F8TA 4HJ9A 3PF4A 1L1OA 3EIVA 5IYCH 3TRZA 5C44G 1JJ2A 1VQEA 1A8VA 4B3TL 1Y1VG 1XNRQ 4GOPC 2AKWB 3CCUA 4DR6L 1PH2A 2WP8J 4JI1L 2QA4A 1MJEA 4JI2L 4LFCQ 1TWCH 2R93H 4LF9L 1CKNB 1WOCA 2WAQG 4DR3Q 4B3RL 1P8LA 3F2CA 2UUCQ 4AH6A 5EAYA 1EOVA 4HIDA 3H0GH 3U58A 2PQAA 3KYHC 5LMNL 5IYDH 5HGQA 3FHWA 2E8GA 2K5HA 4DR1L 5AJ3L 2K52A 2Q2IA 4TVAB 2Q2TA 2N78A 4OX9L 2D62A 5BR8L 2JA6H 3HOXH 1VQDA 2A1AA 1BKBA 2GN5A 3KF8B 4RG1A 4JI3L 4AYBE 4RMFA 4C2MH 4X62L 4LF5Q 3I4NG 2CKZB 5C0XI 1IYJB 4YCVA 2ZM6Q 4BXXH 3CCJA 2PI2A 2MO1A 4R4CA 1C0AA 1N34Q 4GKKQ 4X65L 1VQCA 5FJ8G 1VQAA 4DUYL 1QUQA 1K3RA 1Q1BA 4A93G 5C0XG 1XMOQ 4JOIC 2IT1A 5JEAG 3HKSA 4A76A 2VY3A 3G71A 1YJWA 3I4MH 4MZ9A 2RHQB 3TQYA 5FLMH 1EYGA 3HOUG 4A3EG 3BZKA 1HNZQ 1XJVA 1K83H 1V9PA 4LFAL 4QQBX 4JBKA 1GD7A 4DUZQ 1SN8A 1XMQL 1JB7A 4IOCA 4WJ3M 2D0OA 2ID0A 1VS0A 4PZ8A 4HJ7A 1PYBA 1Y1VH 1PH4A 4GKJQ 1B7YB 1FVIA 2JEBI 1JE5A 2HIXA 4OWWB 1E1TA 1YHBA 2YV5A 3UE1A 4MNOA 1N36Q 4DR5L 4JV5Q 1VQKA 1C9OA 1SLJA 1CSPA 4L5QA 3KF6B 3JAMi 4L5SA 2VUMG 2OTJA 2DGYA 4YHHL 3S15H 3JC66 1VQPA 4A3FH 2BH2A 3D31A 2R7ZG 4DKAC 1IBKQ 1HR0L 2EIFA 3M85A 2NN6G 2RHSB 2VQFQ 3CCQA 4XIGS 3I4NH 3T1YL 4YCWA 4A3JG 1N32L 3OW2A 2AMCB 4LFCL 3CCEA 4DNIA 4POFA 1L1OB 5HY6A 5C4XH 1Q82C 4DV4L 2JE6I 3PUYA 2ZJPA 3W5OA 4DR6Q 5FJ8H 1YNXA 4JI1Q 3A5UA 4GOPB 4LF4L 4A93H 3AYHB 4JYAL 1XPUA 2PNHA 2ES2A 4IJHA 2AWNA 3CCLA 4LNQA 1WYDA 3HKZE 4DK6C 5IT9c 4PG3A 3GTOH 4P72A 1M1KC 3J7ZC 3HOUH 2PQAB 4A3EH 4LF5L 2CCZA 3GD7A 4DR1Q 5AJ3Q 2WB1G 4BBRG 1L0WA 3BJUA 1VQBA 2E5LQ 3F2BA 5BR8Q 4OX9Q 3HOVG 1UE6A 3K7AH 2Z6KC 4YWLA 2LSSA 1N34L 3RLNA 1VQLA 4JI3Q 3GTMH 4GKKL 3STBD 5GAEC 4JBMA 3PF5A 1VQOA 1VQ7A 2R93G 3RZOH 1E7ZA 1W3SA 3CCRA 1EIFA 3D0FA 2L15A 5GQOA 2MFIA 1VQJA 3H0GG 4BY7G 2LXJA 4DUYQ 2JEAI 5J3BA 2NVYH 3UE0A 1QUQB 4YWKA 4POGA 1EIYB 2BH8A 1XNQL 1HJPA 3A74A 2VUMH 4LF8L 3FKIH 4UY8C 1LTLA 1SFOH 4DUZL 4LW1A 1Q12A 2R7ZH 1Q46A 1Q8KA 4UP8A 3JAMc 3GTGH 3K7UC 4OO1G 4HIKA 1O7IA 4A3JH 4GKJL 4K0KL 1NJIC 3S1QH 1NTGA 3VDYA 1L2FA 2E2HH 2OTLA 2Y0SE 4HJ5A 1E3PA 1MIUA 1VQGA 1EFWA 3CF5A 1PA6A 2NZHA 2ZJQA 3KJPA 4AYBG 1KIXA 1S3OA 4LUOA 1NE3A 3BZCA 3PSIA 3S2HH 4C3IH 1QVCA 4DR5Q 2CWAA 3AEVA 2VQFL 1ASYA 3PUXA 3PUZA 4NB3A 1E22A 1A62A 4Y52H 4BBRH 1L1OC 4JI5L 1HR0Q 5JJKA 3HOVH 2XTIA 3K0XA 3RLFA 1Z9FA 4JG2A 2C35B 3T1YQ 4A3CG 2JA8G 3SGIA 1N8RC 2Q2HA 3PGZA 1W2BA 3CC4A 4BA1I 4DV4Q 1D7QA 3CMEA 4J15A 1HR0W 3S1MH 4BY7H 4LF4Q 1SRUA 3GO5A 4JYAQ 2V1CC 4JI6Q 2QEXA 1PH8A 2I0QA 3CPWA 4A3FG 4DAYB 3S17H 4A3BG 3ER0A 1VQ4A 2E5LL 1EQQA 2KBNA 5JJIA 3RN5A 4C3HH 3KLWA 2OQ0A 1LM0A 1VQHA 1OXSC 2N8NA 3S24A 3J81j 4DR4L 5C4JH 1Q86C 1TWFH 4OWXB 5GADC 2R7FA 1VQ6A 5C4XG 2VNUD 2WFWA 3UDGA 3K8AA 1KRTA 3RNUA 4LFBQ 4B3ML 2YTXA 1K73C 2HHHQ 3EN2A 3S1NH 1X9NA 1Q81C 1UE5A 4TQUS 3CD6A 1N33Q 2VQEL 1HZCA 1Y1WG 2K5NA 3U4VA 4NXMQ 3M3YH 2IHFA 3KFUA 1YBYA 4A3IG 1NBWA 1TWGH 1XNQQ 2K4KA 2MNAA 4LF8Q 3UDFA 4A3KG 3RR5A 2MO0A 1MKHA 1KL9A 3GTLH 4PZ7A 4P75A 4P71A 4HJ8A 1YITA 1VQFA 2R7DA 3KDFA 4A3GG 1Z47A 4GS3A 3HKZG 1BBUA 4GN3B 5GAHC 1Q1EA 4A3CH 4K0KQ 2PI2E 2JA8H 1NMGA 4EX5A 1X3GA 2UXBQ 5GROA 1G6PA 2ZTCA 4A3DG 1WJJA 3H3VI 3FP9A 2HT1A 4HJAA 2LXKA 4R1JA 2ZJRA 5IY0A 2JA5G 4IJLA 1YHQA 5JJLA 1WFQA 3FKIG 3H15A 1A0IA 2ALYB 2AHOB 2UUBL 3F2DA 4OXPA 4A3BH 2WAQE 1I3QH 1PHJA 3WWVA 1V43A 2UXCL 4BBSH 4DR2Q 3J81i 2PMZE 2I5LX 3M9BA 4ME3A 1MJCA 3J80i 2NVXH 2MQHA 4JI5Q 4IPHA 4LF6L 3KJOA 2UU9Q 3NBHB 1I6HH 1GO3E 4PMWA 2CQOA 1PH6A 4JI6L 4UP7A 1I5FA 1T9HA 3IRBA 2K14A 3PUWA 3ULPA 2HQLA 1U5KA 1XPOA 2BA0A 1Y1WH 4GN4B 1I94Q 4O2DA 3G6EA 4DV7Q 1IZ6A 4GNXA 4C3JH 5M5YH 4DV1L 4IO9A 4A3IH 4L5RC 3TREA 3I7FA 1LYLA 3U50C 1VQMA 4A3KH 4KHPQ 3L2PA 2UXDQ 1YEZA 4LFBL 2B3GA 4DR4Q 3M4QA 4A3GH 5GAGC 2HHHL 2JQOA 3L0OA 4JI8L 1N33L 3PUVA 1V1QA 1UWVA 4JCVE 4AQYL 4B3MQ 1TWAH 4NXML 4A3DH 1FJGL 1OXTA 2I5HA 1E24A 1JJGA 1X6OA 3AQQA 1N32Q 2YTYA 2JA5H 2NVQH 1HZ9A 4NXNL 2VQEQ 4A3MG 3S2DH 1CKMA 4AIMA 4XTCS 1J6QA 3TEHB 3H3VH 1NMFA 3K80C 4GLXA 4LUVA 1HNXL 1IBML 5IP7G 5IYBG 1IBLL 2UXBL 3NENA 2OCEA 1AE3A 1K8AC 1R9TH 4IPDA 3KDFB 3J81c 4QY7A 2H5XA 3STBC 2ATWA 4BA2I 3J80c 4ALPA 4X64L 5JEAJ 5M3MG 1HZBA 1S72A 1LUZA 4BY1G 3ERSX 1PH1A 2AWOA 4X66L 4LF7L 4QIWE 4QJFA 4Y7NH 4DR2L 2UUBQ 4DR7Q 1EQRA 4DV3L 4DV5Q 3GTKH 2GVBA 3W1GA 3CCSA 2UXCQ 5M5XH 3S1RH 1GVPA 2UU9L 2A8VA 3HOYG 5M5WH 3A0JA 2KCTA 3TS0A 2E2IH 4JI7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWM A;  3J7A 5;  1WCM G;  4YY3 Q;  4UPA A;  4LF6 Q;  3U4Z A;  1KXL A;  1U0L A;  2BA1 A;  5C3E G;  4IPG A;  3HOZ G;  4YCU A;  1G51 A;  3CC7 A;  1SE8 A;  1I94 L;  1Q7Y C;  3MXN B;  4UP9 A;  4DV7 L;  3GTQ H;  3E9H A;  5IWA Q;  4KI0 A;  4A3M H;  4A3L G;  2IX0 A;  3S14 H;  4KHP L;  1HH2 P;  3E9I A;  4BBS G;  2UXD L;  2ASB A;  1J5E L;  1YHA A;  3NEM A;  3BU2 A;  5LMU Q;  2KHJ A;  4DV1 Q;  1G29 1;  2DUD A;  2ZTD A;  4GNX B;  3RN2 A;  2QGQ A;  4GN5 A;  4GOP A;  2JA9 A;  4R4I A;  1XPR A;  4JI4 L;  5IP7 H;  1RIP A;  5IYB H;  3OYY A;  3F1Z A;  2I5M X;  1FGU A;  3CW2 C;  3W1B A;  4APV A;  1YJ9 A;  1QVF A;  4FDB A;  3EBE A;  2IY5 B;  4JI8 Q;  3GTP H;  1BBW A;  1P16 A;  4AQY Q;  2N3S A;  2UUA L;  4IPC A;  5M3M H;  1FJG Q;  1AH9 A;  4A4I A;  1KD1 C;  4B3S L;  3MEF A;  1HNW Q;  4BY1 H;  3CCV A;  4OWT B;  1JMC A;  1UE7 A;  3PO2 G;  1N9W A;  4NXN Q;  3CMA A;  4DV2 Q;  2R92 G;  1OXX K;  1CKO A;  4GLA C;  1UE1 A;  1XTD A;  3T1H Q;  3E0E A;  1PVO A;  1SR3 A;  1X3F A;  1K9M C;  1HNX Q;  3RLO A;  3HOY H;  1Y14 B;  4QGU A;  4R4T A;  1B8A A;  3CXC A;  1IBM Q;  4JI0 Q;  2JA7 H;  4WJ4 A;  1OXU A;  2KHI A;  1IBL Q;  4JOI A;  1M90 C;  4IFD J;  1WCM H;  2VS1 A;  1CUK A;  1KHI A;  3I2Z A;  3G4S A;  1OTC A;  5C3E H;  2RF4 A;  5DLQ E;  3HOZ H;  1I50 H;  1YJN A;  3PCO B;  4DK3 C;  1QVG A;  3NEL A;  1PV4 A;  4X64 Q;  3CCM A;  4DV0 Q;  4DR7 L;  4DV5 L;  2IHE A;  1CSQ A;  3PV0 A;  4A3L H;  4GLV B;  3K81 C;  1GM5 A;  4LF7 Q;  4X66 Q;  3PIP A;  2F4V L;  1QZG A;  2VZA A;  1DGS A;  1RL2 A;  3OTO L;  2NZO A;  1PH3 A;  1TWH H;  4L5T A;  5C44 H;  1X65 A;  4DV3 Q;  4JI7 L;  5H1S E;  2OQK A;  1VQ9 A;  4YY3 L;  5FLX c;  4JC0 A;  4X6A H;  1BVS A;  3PIO A;  1X55 A;  5ELN A;  3I55 A;  2KEN A;  1PYS B;  4KHZ A;  2F52 A;  1OXV A;  3ULL A;  1KC8 C;  3TS2 A;  4IOA A;  3ZJY C;  2NN6 I;  1KRS A;  1D8L A;  3HOW G;  2N49 A;  1IL2 A;  5IWA L;  1AE2 A;  2FXQ A;  4DAM A;  1VQ5 A;  3CQZ H;  2E2J H;  2A19 A;  4DV6 Q;  2Y0S G;  3CP0 A;  3S16 H;  1PH5 A;  1KAW A;  1YVC A;  5LMU L;  4GNX C;  1YIJ A;  2VW9 A;  1KQS A;  2Q2U A;  3AFQ A;  3HFZ B;  4P74 A;  4PZ6 A;  3PO2 H;  5K36 G;  2B63 G;  1XNR L;  4HIO A;  3CPF A;  4NPS A;  2R92 H;  2EXD A;  1CKN A;  1S40 A;  1UEB A;  2K75 A;  3CAM A;  1J5E Q;  4R4Q A;  1X54 A;  4DR3 L;  3UDX A;  2NVT H;  1ASZ A;  4B3T Q;  4LWC A;  1VQN A;  5IP9 G;  2UUC L;  3GDE A;  3ULJ A;  4JI4 Q;  4JI2 Q;  5M3F G;  1B70 B;  1A63 A;  3AFP A;  1K0R A;  3DLL A;  2D0P A;  4LF9 Q;  2RCN A;  4B3R Q;  3B6Y A;  4R4O A;  1HNW L;  1K8G A;  2IX1 A;  5LMN Q;  4MTN A;  3CC2 A;  3PO3 G;  2B29 A;  2EQS A;  2UUA Q;  3A5Z B;  4EQ5 A;  2OWO A;  1H95 A;  3UDI A;  4DV2 L;  4IFD I;  3M7N A;  1NY4 A;  1EUJ A;  5IYC G;  3GTJ H;  2ZM6 L;  3RZD H;  3T1H L;  4B3S Q;  1TXY A;  4A75 A;  2Z6K A;  4X62 Q;  1QZH A;  1WI5 A;  4JI0 L;  1C7Y A;  3Q8D A;  5LMN W;  4IFD G;  2CFM A;  3DM3 A;  1XMO L;  1HZA A;  1X56 A;  1PFS A;  1YZ6 A;  2YTV A;  4LUZ A;  5E7N A;  4X65 Q;  1YI2 A;  4OON A;  2CWP A;  2F3I A;  5IYD G;  3M4O H;  4O0A A;  1SMX A;  3M4P A;  1GKH A;  2R6G A;  1EWI A;  5C0X J;  1VCI A;  4HIM A;  1HNZ L;  3ICE A;  1JT8 A;  4DV0 L;  4OO1 I;  3HOW H;  2JK8 A;  2GVA A;  2Z0S A;  4QL5 A;  2JA6 G;  2YU9 H;  2HIV A;  3HOX G;  1FL0 A;  2VL6 A;  1VQ8 A;  5ELO A;  2K5V A;  3I4O A;  1SRO A;  4LFA Q;  4DPG A;  4BXX G;  2B63 H;  2F4V Q;  3KOJ A;  3OTO Q;  1XMQ Q;  1IXR A;  2XGT A;  1PH9 A;  4P73 A;  2JA7 G;  2WB1 E;  1N36 L;  1VQI A;  3KF6 A;  5IP9 H;  2KCM A;  3G48 A;  5IE8 A;  3I4M G;  4JV5 L;  5M3F H;  1E1O A;  3I56 A;  4JBW A;  2YYZ A;  2JJQ A;  4JBJ A;  5FLM G;  3LGJ A;  4DV6 L;  2ZTE A;  4H02 A;  3L7Z C;  2K50 A;  1JJC B;  1X3E A;  1IBK L;  1PH7 A;  3PO3 H;  4KLK A;  4YHH Q;  3F8T A;  4HJ9 A;  3PF4 A;  1L1O A;  3EIV A;  5IYC H;  3TRZ A;  5C44 G;  1JJ2 A;  1VQE A;  1A8V A;  4B3T L;  1Y1V G;  1XNR Q;  4GOP C;  2AKW B;  3CCU A;  4DR6 L;  1PH2 A;  2WP8 J;  4JI1 L;  2QA4 A;  1MJE A;  4JI2 L;  4LFC Q;  1TWC H;  2R93 H;  4LF9 L;  1CKN B;  1WOC A;  2WAQ G;  4DR3 Q;  4B3R L;  1P8L A;  3F2C A;  2UUC Q;  4AH6 A;  5EAY A;  1EOV A;  4HID A;  3H0G H;  3U58 A;  2PQA A;  3KYH C;  5LMN L;  5IYD H;  5HGQ A;  3FHW A;  2E8G A;  2K5H A;  4DR1 L;  5AJ3 L;  2K52 A;  2Q2I A;  4TVA B;  2Q2T A;  2N78 A;  4OX9 L;  2D62 A;  5BR8 L;  2JA6 H;  3HOX H;  1VQD A;  2A1A A;  1BKB A;  2GN5 A;  3KF8 B;  4RG1 A;  4JI3 L;  4AYB E;  4RMF A;  4C2M H;  4X62 L;  4LF5 Q;  3I4N G;  2CKZ B;  5C0X I;  1IYJ B;  4YCV A;  2ZM6 Q;  4BXX H;  3CCJ A;  2PI2 A;  2MO1 A;  4R4C A;  1C0A A;  1N34 Q;  4GKK Q;  4X65 L;  1VQC A;  5FJ8 G;  1VQA A;  4DUY L;  1QUQ A;  1K3R A;  1Q1B A;  4A93 G;  5C0X G;  1XMO Q;  4JOI C;  2IT1 A;  5JEA G;  3HKS A;  4A76 A;  2VY3 A;  3G71 A;  1YJW A;  3I4M H;  4MZ9 A;  2RHQ B;  3TQY A;  5FLM H;  1EYG A;  3HOU G;  4A3E G;  3BZK A;  1HNZ Q;  1XJV A;  1K83 H;  1V9P A;  4LFA L;  4QQB X;  4JBK A;  1GD7 A;  4DUZ Q;  1SN8 A;  1XMQ L;  1JB7 A;  4IOC A;  4WJ3 M;  2D0O A;  2ID0 A;  1VS0 A;  4PZ8 A;  4HJ7 A;  1PYB A;  1Y1V H;  1PH4 A;  4GKJ Q;  1B7Y B;  1FVI A;  2JEB I;  1JE5 A;  2HIX A;  4OWW B;  1E1T A;  1YHB A;  2YV5 A;  3UE1 A;  4MNO A;  1N36 Q;  4DR5 L;  4JV5 Q;  1VQK A;  1C9O A;  1SLJ A;  1CSP A;  4L5Q A;  3KF6 B;  3JAM i;  4L5S A;  2VUM G;  2OTJ A;  2DGY A;  4YHH L;  3S15 H;  3JC6 6;  1VQP A;  4A3F H;  2BH2 A;  3D31 A;  2R7Z G;  4DKA C;  1IBK Q;  1HR0 L;  2EIF A;  3M85 A;  2NN6 G;  2RHS B;  2VQF Q;  3CCQ A;  4XIG S;  3I4N H;  3T1Y L;  4YCW A;  4A3J G;  1N32 L;  3OW2 A;  2AMC B;  4LFC L;  3CCE A;  4DNI A;  4POF A;  1L1O B;  5HY6 A;  5C4X H;  1Q82 C;  4DV4 L;  2JE6 I;  3PUY A;  2ZJP A;  3W5O A;  4DR6 Q;  5FJ8 H;  1YNX A;  4JI1 Q;  3A5U A;  4GOP B;  4LF4 L;  4A93 H;  3AYH B;  4JYA L;  1XPU A;  2PNH A;  2ES2 A;  4IJH A;  2AWN A;  3CCL A;  4LNQ A;  1WYD A;  3HKZ E;  4DK6 C;  5IT9 c;  4PG3 A;  3GTO H;  4P72 A;  1M1K C;  3J7Z C;  3HOU H;  2PQA B;  4A3E H;  4LF5 L;  2CCZ A;  3GD7 A;  4DR1 Q;  5AJ3 Q;  2WB1 G;  4BBR G;  1L0W A;  3BJU A;  1VQB A;  2E5L Q;  3F2B A;  5BR8 Q;  4OX9 Q;  3HOV G;  1UE6 A;  3K7A H;  2Z6K C;  4YWL A;  2LSS A;  1N34 L;  3RLN A;  1VQL A;  4JI3 Q;  3GTM H;  4GKK L;  3STB D;  5GAE C;  4JBM A;  3PF5 A;  1VQO A;  1VQ7 A;  2R93 G;  3RZO H;  1E7Z A;  1W3S A;  3CCR A;  1EIF A;  3D0F A;  2L15 A;  5GQO A;  2MFI A;  1VQJ A;  3H0G G;  4BY7 G;  2LXJ A;  4DUY Q;  2JEA I;  5J3B A;  2NVY H;  3UE0 A;  1QUQ B;  4YWK A;  4POG A;  1EIY B;  2BH8 A;  1XNQ L;  1HJP A;  3A74 A;  2VUM H;  4LF8 L;  3FKI H;  4UY8 C;  1LTL A;  1SFO H;  4DUZ L;  4LW1 A;  1Q12 A;  2R7Z H;  1Q46 A;  1Q8K A;  4UP8 A;  3JAM c;  3GTG H;  3K7U C;  4OO1 G;  4HIK A;  1O7I A;  4A3J H;  4GKJ L;  4K0K L;  1NJI C;  3S1Q H;  1NTG A;  3VDY A;  1L2F A;  2E2H H;  2OTL A;  2Y0S E;  4HJ5 A;  1E3P A;  1MIU A;  1VQG A;  1EFW A;  3CF5 A;  1PA6 A;  2NZH A;  2ZJQ A;  3KJP A;  4AYB G;  1KIX A;  1S3O A;  4LUO A;  1NE3 A;  3BZC A;  3PSI A;  3S2H H;  4C3I H;  1QVC A;  4DR5 Q;  2CWA A;  3AEV A;  2VQF L;  1ASY A;  3PUX A;  3PUZ A;  4NB3 A;  1E22 A;  1A62 A;  4Y52 H;  4BBR H;  1L1O C;  4JI5 L;  1HR0 Q;  5JJK A;  3HOV H;  2XTI A;  3K0X A;  3RLF A;  1Z9F A;  4JG2 A;  2C35 B;  3T1Y Q;  4A3C G;  2JA8 G;  3SGI A;  1N8R C;  2Q2H A;  3PGZ A;  1W2B A;  3CC4 A;  4BA1 I;  4DV4 Q;  1D7Q A;  3CME A;  4J15 A;  1HR0 W;  3S1M H;  4BY7 H;  4LF4 Q;  1SRU A;  3GO5 A;  4JYA Q;  2V1C C;  4JI6 Q;  2QEX A;  1PH8 A;  2I0Q A;  3CPW A;  4A3F G;  4DAY B;  3S17 H;  4A3B G;  3ER0 A;  1VQ4 A;  2E5L L;  1EQQ A;  2KBN A;  5JJI A;  3RN5 A;  4C3H H;  3KLW A;  2OQ0 A;  1LM0 A;  1VQH A;  1OXS C;  2N8N A;  3S24 A;  3J81 j;  4DR4 L;  5C4J H;  1Q86 C;  1TWF H;  4OWX B;  5GAD C;  2R7F A;  1VQ6 A;  5C4X G;  2VNU D;  2WFW A;  3UDG A;  3K8A A;  1KRT A;  3RNU A;  4LFB Q;  4B3M L;  2YTX A;  1K73 C;  2HHH Q;  3EN2 A;  3S1N H;  1X9N A;  1Q81 C;  1UE5 A;  4TQU S;  3CD6 A;  1N33 Q;  2VQE L;  1HZC A;  1Y1W G;  2K5N A;  3U4V A;  4NXM Q;  3M3Y H;  2IHF A;  3KFU A;  1YBY A;  4A3I G;  1NBW A;  1TWG H;  1XNQ Q;  2K4K A;  2MNA A;  4LF8 Q;  3UDF A;  4A3K G;  3RR5 A;  2MO0 A;  1MKH A;  1KL9 A;  3GTL H;  4PZ7 A;  4P75 A;  4P71 A;  4HJ8 A;  1YIT A;  1VQF A;  2R7D A;  3KDF A;  4A3G G;  1Z47 A;  4GS3 A;  3HKZ G;  1BBU A;  4GN3 B;  5GAH C;  1Q1E A;  4A3C H;  4K0K Q;  2PI2 E;  2JA8 H;  1NMG A;  4EX5 A;  1X3G A;  2UXB Q;  5GRO A;  1G6P A;  2ZTC A;  4A3D G;  1WJJ A;  3H3V I;  3FP9 A;  2HT1 A;  4HJA A;  2LXK A;  4R1J A;  2ZJR A;  5IY0 A;  2JA5 G;  4IJL A;  1YHQ A;  5JJL A;  1WFQ A;  3FKI G;  3H15 A;  1A0I A;  2ALY B;  2AHO B;  2UUB L;  3F2D A;  4OXP A;  4A3B H;  2WAQ E;  1I3Q H;  1PHJ A;  3WWV A;  1V43 A;  2UXC L;  4BBS H;  4DR2 Q;  3J81 i;  2PMZ E;  2I5L X;  3M9B A;  4ME3 A;  1MJC A;  3J80 i;  2NVX H;  2MQH A;  4JI5 Q;  4IPH A;  4LF6 L;  3KJO A;  2UU9 Q;  3NBH B;  1I6H H;  1GO3 E;  4PMW A;  2CQO A;  1PH6 A;  4JI6 L;  4UP7 A;  1I5F A;  1T9H A;  3IRB A;  2K14 A;  3PUW A;  3ULP A;  2HQL A;  1U5K A;  1XPO A;  2BA0 A;  1Y1W H;  4GN4 B;  1I94 Q;  4O2D A;  3G6E A;  4DV7 Q;  1IZ6 A;  4GNX A;  4C3J H;  5M5Y H;  4DV1 L;  4IO9 A;  4A3I H;  4L5R C;  3TRE A;  3I7F A;  1LYL A;  3U50 C;  1VQM A;  4A3K H;  4KHP Q;  3L2P A;  2UXD Q;  1YEZ A;  4LFB L;  2B3G A;  4DR4 Q;  3M4Q A;  4A3G H;  5GAG C;  2HHH L;  2JQO A;  3L0O A;  4JI8 L;  1N33 L;  3PUV A;  1V1Q A;  1UWV A;  4JCV E;  4AQY L;  4B3M Q;  1TWA H;  4NXM L;  4A3D H;  1FJG L;  1OXT A;  2I5H A;  1E24 A;  1JJG A;  1X6O A;  3AQQ A;  1N32 Q;  2YTY A;  2JA5 H;  2NVQ H;  1HZ9 A;  4NXN L;  2VQE Q;  4A3M G;  3S2D H;  1CKM A;  4AIM A;  4XTC S;  1J6Q A;  3TEH B;  3H3V H;  1NMF A;  3K80 C;  4GLX A;  4LUV A;  1HNX L;  1IBM L;  5IP7 G;  5IYB G;  1IBL L;  2UXB L;  3NEN A;  2OCE A;  1AE3 A;  1K8A C;  1R9T H;  4IPD A;  3KDF B;  3J81 c;  4QY7 A;  2H5X A;  3STB C;  2ATW A;  4BA2 I;  3J80 c;  4ALP A;  4X64 L;  5JEA J;  5M3M G;  1HZB A;  1S72 A;  1LUZ A;  4BY1 G;  3ERS X;  1PH1 A;  2AWO A;  4X66 L;  4LF7 L;  4QIW E;  4QJF A;  4Y7N H;  4DR2 L;  2UUB Q;  4DR7 Q;  1EQR A;  4DV3 L;  4DV5 Q;  3GTK H;  2GVB A;  3W1G A;  3CCS A;  2UXC Q;  5M5X H;  3S1R H;  1GVP A;  2UU9 L;  2A8V A;  3HOY G;  5M5W H;  3A0J A;  2KCT A;  3TS0 A;  2E2I H;  4JI7 Q; 
#chains in the Genus database with same CATH topology
 2PZT A;  4YY3 Q;  3JAM L;  3A8I E;  2WKC A;  1EWH A;  2HDM A;  1QCB D;  3CC7 A;  1EY5 A;  4DV7 L;  4A3G B;  3E9H A;  1L0X B;  3HKZ B;  4BBS G;  1YHA A;  1SYF A;  1G29 1;  2ZTD A;  3SE0 A;  4GNX B;  2Z8L A;  4DFA A;  3S2D B;  4G57 A;  4K5X A;  4G7Z C;  3F1Z A;  1DCZ A;  4APV A;  3W1B A;  5I2X A;  4JK1 C;  4X3K A;  5FOB B;  1P16 A;  4AQY Q;  4IPC A;  4DK1 A;  1FJG Q;  4A4I A;  2SEB D;  1R9T B;  3CCV A;  1DD2 A;  3PO2 G;  4NXN Q;  3K0Y A;  1MBY A;  2FHT A;  5LL6 X;  2R92 G;  3IKJ A;  4EVO A;  1CKO A;  4GLA C;  5EKL A;  4RAU C;  1K9M C;  3BVM A;  1KLU D;  1XXG A;  4QGU A;  3CXC A;  4R4T A;  1IBM Q;  2JA7 H;  1C8C A;  2A6H D;  2KHI A;  2K7V A;  1FNW A;  5FK9 C;  5A2Q E;  2VS1 A;  5EPK A;  3QOJ A;  5M5X B;  3S1R B;  1YJN A;  1F2L A;  4DK3 C;  2E2I B;  1QVG A;  4DR7 L;  2F3V A;  1D5M C;  3PV0 A;  2F4V L;  4X66 Q;  1DGS A;  1PH3 A;  1I4X A;  1TWH H;  4L5T A;  4ZKC B;  3S17 B;  5FLX c;  3I90 A;  1PMR A;  4HMI A;  4RKB A;  3HS0 C;  1X55 A;  1PRT B;  2DY8 A;  4KHZ A;  1JC7 A;  3OOC A;  2N49 A;  2A6H C;  2F0J A;  5IWA L;  1VQ5 A;  2E2J H;  1E2W A;  2Y0S G;  3CP0 A;  1PH5 A;  1EEF D;  1YVC A;  2VW9 A;  3PO2 H;  3HFZ B;  3R2T A;  5K36 G;  1EQT A;  2RCF A;  1T5E A;  3A56 A;  3CPF A;  4NPS A;  2R92 H;  1X3Q A;  3EJI A;  3DWQ A;  3GDE A;  5ELD A;  2JXM B;  3CRK C;  3U9O A;  3LX0 A;  1A63 A;  1EY4 A;  3AFP A;  4LF9 Q;  1NAP A;  5JEA H;  4B3R Q;  2F0S A;  5FLX L;  1JE4 A;  3KF8 A;  4R4O A;  5IGE A;  2VB3 X;  5LMN Q;  1IYU A;  2B29 A;  1SNP A;  1H95 A;  4C1N I;  1UNS A;  1NY4 A;  5IYC G;  1V1P A;  2ZM6 L;  3MC0 B;  1EWC A;  3T1H L;  4B3S Q;  4A75 A;  2Z6K A;  1PZI D;  4ODG A;  5LMN W;  4UHV A;  1X56 A;  1PFS A;  1YI2 A;  4BBS B;  5IYD G;  2A69 D;  3M4P A;  2R6G A;  2OF1 A;  1EWI A;  3ICE A;  4DV0 L;  1LAB A;  2GVA A;  2Z0S A;  2R3Z A;  1HUN A;  1DJR D;  1ILQ A;  4CKB A;  1F77 A;  4LFA Q;  5K36 H;  2L0C A;  2B8G A;  5FO7 B;  1IXR A;  2DY7 A;  2E2J B;  3MWY W;  4XT1 B;  1DOL A;  2PZU A;  1VQI A;  1F9Q A;  5IE8 A;  3PO2 B;  1E1O A;  3I56 A;  1S5E D;  5EBC A;  1FNV A;  2R92 B;  3KBG A;  2C9O A;  5FLM G;  4FF1 A;  2F0M A;  1X3E A;  1IBK L;  1PH7 A;  1X32 A;  2A69 C;  3PF4 A;  5IYC H;  5C44 G;  1JJ2 A;  4DN4 M;  1LTA D;  1A8V A;  1I4H A;  4KJO A;  4B3T L;  1XNR Q;  3CCU A;  3TP6 A;  2B2W A;  1TWC H;  1GUW A;  1CKN B;  2WAQ G;  1JCK B;  3EFX D;  1XX8 A;  4DR3 Q;  1P8L A;  3F2C A;  1EOV A;  5IYD H;  3H0G H;  4KJN A;  1BUV T;  5HGQ A;  2K5H A;  2K5Q A;  2Q2I A;  2Q2T A;  3R8B A;  1VQD A;  1Y8P B;  3NWT A;  4AYB E;  3M4Y A;  1E2Z A;  4X3U A;  1BCP B;  3HG9 A;  3OIP A;  4R4C A;  5D65 A;  4ZCK A;  1N34 Q;  3NWS A;  1QIL A;  2ZXP A;  1D1I A;  1U4P A;  2Q8R E;  1RKN A;  2Y0S B;  3A8K E;  1XMO Q;  3DHQ A;  3VYT A;  5FO9 B;  5FLM H;  3HOU G;  5AFW A;  3FPU B;  4KKS A;  4NP5 A;  1K83 H;  2XNA C;  2K6A A;  4WJ3 M;  1QOH A;  4IOC A;  1CA5 A;  2D0O A;  4HJ7 A;  1B7Y B;  1FVI A;  2SNM A;  5E4X A;  3ONA B;  1AW7 A;  2YV5 A;  1SDF A;  1X3P A;  2FMM A;  4MNO A;  4IUU A;  5IGF A;  4JV5 Q;  1C9O A;  1SLJ A;  5A2Q L;  4L5Q A;  3KF6 B;  3S15 H;  1TWC B;  4A3F H;  1VQP A;  3D31 A;  1ENA A;  2EIF A;  4HED A;  1HFN A;  3H0G B;  3T1Y L;  2EYH A;  3CCE A;  4MIU A;  4C56 C;  1GUN A;  2JE6 I;  3PUY A;  2ZJP A;  4DR6 Q;  4CGY B;  3AYH B;  2ES2 A;  4OGQ C;  4IJH A;  3HKZ E;  2B2T A;  1M1K C;  2LKV A;  3HOU H;  2Z4H A;  3BDL A;  5KND A;  4DR1 Q;  5AJ3 Q;  4H13 C;  3F2B A;  3QOL A;  5BR8 Q;  3HOV G;  2AUJ D;  4GKK L;  4JBM A;  1ENC A;  3I4L A;  4H0L C;  1VQO A;  1I4P A;  1K83 B;  1DOK A;  3CCR A;  4ZK9 B;  1KDC A;  4DUY Q;  3D3R A;  1S5B D;  1QUQ B;  4YWK A;  5C44 B;  2BH8 A;  4K6L A;  1M8A A;  5I6W A;  3BVZ A;  4V19 0;  1Q12 A;  2WAQ B;  1SNQ A;  4UP8 A;  3KUP A;  4HIK A;  4K0K L;  1EEI D;  1SJH D;  3S1Q H;  3VDY A;  2IWH A;  3S15 B;  4A3F B;  1NNX A;  1VQG A;  3I3C A;  1HQR D;  3A8J E;  1KAA A;  1KIX A;  1FYC A;  1F2Y A;  1NE3 A;  1S5C D;  1SXT A;  2K03 A;  1TS3 A;  4NMZ A;  1UUP A;  1FNU A;  2L12 A;  3J80 E;  3TP7 A;  2G9H D;  3GP7 A;  3P20 A;  2F3W A;  3PUX A;  4NB3 A;  1L1O C;  5TSS A;  3OMC A;  1RD9 D;  5I2Y A;  1HR0 Q;  3HOV H;  1TY2 A;  3K0X A;  4JG2 A;  2F0L A;  3SGI A;  3HOU B;  3DUZ A;  3PGZ A;  4K5V A;  1W2B A;  3CC4 A;  2Z9H A;  4M1U B;  4DV4 Q;  1VF5 C;  1D7Q A;  3CME A;  1HR0 W;  2EY1 A;  1SRU A;  2QEX A;  1PH8 A;  1JB3 A;  3V05 A;  2E5L L;  1EQQ A;  1W6J A;  1G2T A;  5EKI A;  1H9K A;  4DR4 L;  2EY6 A;  1TWF H;  4OWX B;  2KVM A;  1Z6H A;  1STE A;  3TDQ A;  3K8A A;  4F88 A;  1KRT A;  4LFB Q;  3VA7 A;  2YTX A;  3FMC A;  3EN2 A;  4OIK A;  1Q81 C;  3PIP 3;  2B2Y C;  3S1Q B;  3FPP A;  3U4V A;  2IHF A;  1Q90 A;  2Z4I A;  1TWG H;  1MHW C;  2K4K A;  2MNA A;  3SEB A;  2MO0 A;  1MKH A;  4V0B A;  4HJ8 A;  1AZQ A;  1BNZ A;  5G3L F;  4GN3 B;  4Q5V A;  1PLF A;  4EX5 A;  2O4X A;  5ELF A;  1G6P A;  1BOS A;  2ZTC A;  2K01 A;  4A3D G;  3H3V I;  1L0Y B;  4HSP A;  3HOV B;  4R1J A;  3WOF A;  3R3O A;  3TZU A;  3TZD A;  4B9W A;  4IUT A;  4FF2 A;  1PHJ A;  2UXC L;  1TVX A;  1RF2 D;  2BDO A;  3J80 i;  3M9B A;  2G9D A;  4ZUI A;  2NVX H;  2NTS A;  3VR3 A;  2UU9 Q;  3C46 A;  3EA6 A;  2F0F A;  2B39 A;  2CQO A;  3MXN A;  4JI6 L;  1B44 D;  1TWF B;  1XPO A;  3D4D A;  3PUW A;  1QJO A;  2HQL A;  5KIX A;  2JN4 A;  4IO9 A;  4KHP Q;  1EYC A;  4HAE A;  2UXD Q;  5CV9 A;  4J6H A;  3NTI A;  4HR7 B;  1TWG B;  2F1M A;  1V1Q A;  3KBX A;  4AQY L;  4B3M Q;  1WVL A;  4A3D H;  2AQ1 B;  1FJG L;  1DON A;  1E24 A;  1HZ9 A;  4NXN L;  4A3M G;  1MGS A;  2AQ2 B;  1IHZ A;  1QE6 A;  1J6Q A;  3QWN A;  4GLX A;  5FKA C;  1ONL A;  3T13 A;  1K0S A;  1IBM L;  5IYB G;  3MFG A;  4IPD A;  1BF4 A;  3PQI A;  3J80 c;  5C3W A;  2B2V C;  1H9J A;  2NVX B;  2F0W A;  3ERS X;  4X66 L;  5C6A A;  4DR2 L;  1EZ6 A;  3IFT A;  5CBE E;  1JQY D;  1ZKO A;  5DEH A;  3W1G A;  3GTO B;  5M5W H;  3QR8 A;  2EYO A;  1WCM G;  4UPA A;  3U4Z A;  2F0G A;  4YCU A;  2MP1 A;  2XRS D;  1I94 L;  1Q7Y C;  4UP9 A;  4IAL A;  4RA8 A;  4A3M H;  4A3L G;  2IX0 A;  4F8M A;  5ELB A;  3DMU A;  3J80 L;  4MTK A;  3DEO A;  4RHR A;  4DV1 Q;  4A3D B;  2DUD A;  4R4I A;  3I72 A;  1JIC A;  5IYB H;  1C48 A;  4DAP A;  2I5M X;  3CW2 C;  1YJ9 A;  5K5P A;  4K2L A;  4FDB A;  3EBE A;  2IY5 B;  5COR A;  5CV6 A;  3OIQ A;  4OEM B;  2N3S A;  2XWJ B;  4R8N A;  1KD1 C;  4C3J G;  4B3S L;  3MEF A;  5CYU A;  3UI2 A;  1HNW Q;  4OWT B;  1UE7 A;  2QDB A;  1TU2 B;  2HD3 A;  4KKU A;  4F7X A;  3H09 A;  1OXX K;  2QEJ C;  1XTD A;  3E0E A;  1SR3 A;  4R8I A;  1STB A;  1NCV A;  4XT3 B;  2WIN B;  3RLO A;  4JI0 Q;  1H9S B;  2JP1 A;  2OXP A;  1IBL Q;  4JOI A;  1WCM H;  2X69 A;  1CUK A;  1KHI A;  3C1F A;  3KLS A;  4KN7 C;  3G4S A;  2RF4 A;  1WTV A;  1AZP A;  5M5W B;  3NEL A;  1PV4 A;  1KNE A;  3CCM A;  1CSQ A;  4CJ0 B;  4A3L H;  4GLV B;  4LF7 Q;  1QZG A;  2VZA A;  3E0J A;  1X65 A;  1AN8 A;  4JI7 L;  5H1S E;  2OQK A;  3D4W A;  2A68 C;  2EYL A;  3W3A A;  1J8I A;  1NR4 A;  4A3M B;  1IW7 D;  5ELN A;  3I55 A;  5COY A;  1OXV A;  4IOA A;  1ZEQ X;  1KRS A;  1D8L A;  3HOW G;  3A55 A;  5L37 A;  2V4D A;  1KAW A;  5LMU L;  2Q2U A;  3AFQ A;  4P74 A;  4PZ6 A;  3ZYY X;  2B63 G;  1XNR L;  3MXP A;  1GHK A;  3KLR A;  1S40 A;  1J5E Q;  3URY A;  1A3U A;  4R4Q A;  4DR3 L;  3NQT A;  1ASZ A;  1VQN A;  4FP5 D;  4LWC A;  1PZJ D;  3R93 A;  1B70 B;  1K0R A;  1JOK A;  2EY2 A;  4ULL A;  1PRT F;  3N6R A;  1MSG A;  1IW7 C;  2F0V A;  2IX1 A;  1ICW A;  4MTN A;  3PO3 G;  2UUA Q;  3A5Z B;  4EQ5 A;  2OWO A;  3UDI A;  4DV2 L;  4IFD I;  1WCM B;  4WFN 3;  4FF4 A;  3RZD H;  4Z9C B;  4X62 Q;  2XSC A;  1C7Y A;  2CFM A;  2A73 B;  1XMO L;  1CT1 D;  2YTV A;  5E7N A;  4X65 Q;  2CWP A;  4NKL A;  1SMX A;  1GKH A;  1K28 A;  2AUK A;  4HIM A;  1U4L A;  3HOW H;  2JA6 G;  2YU9 H;  2HIV A;  4QUC A;  1FL0 A;  4IUR A;  1VQ8 A;  2DJF C;  2Z6B A;  4DPG A;  4BXX G;  4ID6 A;  2B63 H;  3KOJ A;  4MHE A;  3OTO Q;  1CZW A;  1PH9 A;  2JA7 G;  4KY6 A;  4C3J B;  2RDF A;  4JV5 L;  4K6D A;  2F0P A;  3NHH A;  4JBW A;  4K14 A;  2JJQ A;  4DV6 L;  3LGJ A;  2ZTE A;  1SYB A;  1STA A;  3PO3 H;  4HJ9 A;  2G5D A;  5KRU A;  1Y1V G;  4DR6 L;  2KJX A;  4JI2 L;  1S4Z A;  1BR9 A;  2WP8 J;  4LFC Q;  4CJ2 C;  1ROD A;  2R93 H;  2KQ3 A;  3NQI A;  3RZD B;  1MI2 A;  4AH6 A;  5EAY A;  4HID A;  1Z7T A;  2PQA A;  3KYH C;  5EPL A;  4DGZ A;  3T56 B;  4DR1 L;  1S5D D;  5AJ3 L;  3KLS X;  3OSO A;  3NP8 A;  4FVM A;  1O7Z A;  2D62 A;  5BR8 L;  2JA6 H;  1D5X C;  2A1A A;  1YNN D;  3RN2 A;  4RG1 A;  3TS2 A;  3I4N G;  4Y52 H;  4C2M H;  5C0X I;  1IYJ B;  1LT3 D;  1EZ8 A;  4BXX H;  2PI2 A;  2MO1 A;  3HOW B;  1ZYR D;  4KMU C;  1VQC A;  2YU9 B;  5FJ8 G;  4DUY L;  5CV8 A;  5JEA G;  3HKS A;  1YJW A;  3AMU A;  1HCZ A;  2NTT A;  2B63 B;  4MZ9 A;  4OEL B;  5FO8 B;  2RHQ B;  3NBI A;  2K1B A;  1VDZ A;  3I8Z A;  2SDF A;  1XMQ L;  1VS0 A;  1Y1V H;  1YNN C;  3K5M A;  4XDX A;  4RHS A;  3PO3 B;  2L11 A;  1BCP F;  2JEB I;  2HIX A;  1YHB A;  4N9P A;  4I7Z C;  1LAC A;  4KN4 C;  1ZYR C;  5G3L D;  1EY9 A;  1CSP A;  3PMF A;  4N8X 1;  1QWY A;  2OTJ A;  4YHH L;  1ICF B;  2BH2 A;  2R93 B;  2R7Z G;  4FXG C;  1HR0 L;  2RVL A;  3M85 A;  2HCI A;  4TRD A;  2CW0 D;  2RHS B;  3CCQ A;  5LL6 S;  3I4N H;  1N32 L;  1EIH A;  2AMC B;  1L1O B;  5HY6 A;  1Q82 C;  1LTS D;  4DV4 L;  1HFG A;  5EQ0 A;  3W5O A;  2QDL A;  4ABN A;  2JA6 B;  5FJ8 H;  1YNX A;  3A5U A;  4GOP B;  4C2M B;  1UEA B;  1DZ1 A;  1XPU A;  4DAY A;  2K05 A;  4C3I G;  1G2S A;  4ILW A;  3CCL A;  4DK6 C;  4PG3 A;  1JOO A;  4LF5 L;  2JA7 B;  2CCZ A;  3FVQ A;  3GD7 A;  4RGN A;  1WD0 A;  3VR2 A;  4OX9 Q;  2E76 C;  1UE6 A;  2N55 A;  2Z6K C;  5D3D A;  2LSS A;  4JI3 Q;  3STB D;  2CW0 C;  3RZO H;  3NPP A;  3HGB A;  3D0F A;  1B50 A;  3H0G G;  1B3Q A;  2LXJ A;  1EYD A;  2JEA I;  5J3B A;  1TWH B;  2NVY H;  3UE0 A;  1SYE A;  1Y1V B;  2RDG A;  2L55 A;  4DUZ L;  1EIG A;  4LW1 A;  4RH6 A;  5EKK A;  5I9O A;  2R7Z H;  1Q46 A;  1Q8K A;  3BDO A;  1R4P B;  1HXY D;  3K7U C;  4L6T B;  3SK8 A;  3GTG H;  4OO1 G;  4GKJ L;  1NJI C;  1NTG A;  1L2F A;  2E2H H;  1MIU A;  1PTO D;  1PA6 A;  2NZH A;  3H94 A;  2ZJQ A;  3E3X A;  3I4N B;  3S2H H;  3PSI A;  4C3I H;  1HA6 A;  4ZYS A;  3J81 E;  1QVC A;  4DR5 Q;  1HRJ A;  3U9S A;  2VQF L;  1T5X D;  3G6J B;  2XTI A;  4TKO B;  3CKI B;  2B2W C;  4RCO A;  2Q2H A;  5ELC A;  2E2D C;  4BA1 I;  1KTK A;  1XTC D;  2B2U A;  4CDE C;  1BQQ T;  5ISR A;  3S1M H;  4LF4 Q;  1GJX A;  4JYA Q;  1PTO C;  3CPW A;  4A3F G;  4A3B G;  3QJY A;  3OHX C;  2H4O A;  3RZO B;  5JJI A;  5EBD A;  4G7H C;  1LM0 A;  1VQH A;  5CV7 A;  2NVY B;  1SNO A;  1EFI D;  3MA2 B;  1KAB A;  4OO1 H;  2MPM A;  2VNU D;  3UDG A;  3RNU A;  4B3M L;  4KHV A;  5C5L A;  2R7Z B;  1K73 C;  3T4A C;  1X9N A;  1B9M A;  4TQU S;  1ET9 A;  1LO5 D;  5IOD A;  3GTG B;  2DNE A;  3KK7 A;  2BE5 D;  4I65 A;  2K5N A;  4NXM Q;  5DAU A;  2RKS A;  3FDT A;  2E2H B;  4IN3 A;  1XNQ Q;  1RJT A;  2O2L D;  3PIO 3;  3UDF A;  4ZKB B;  1KL9 A;  4PZ7 A;  4P75 A;  3S2H B;  4P71 A;  4C3I B;  1I4G A;  1VQF A;  3NTH A;  4GS3 A;  5KEE A;  5GAH C;  4DK0 A;  1Q1E A;  3ND9 A;  4QF4 A;  2UXB Q;  2MJ8 A;  4FNF A;  3V96 A;  3S9W A;  4HJA A;  2ZJR A;  2JA5 G;  1EQV A;  1YHQ A;  3VR6 A;  3H15 A;  4F87 A;  1LTB D;  2AHO B;  2IJ0 A;  3F2D A;  4A3B H;  1G6Z A;  2NZ1 D;  3WWV A;  2BE5 C;  3MEH A;  2F0D A;  2L9H A;  3J81 i;  1F2Z A;  2I5L X;  1SEB D;  2XIW A;  4JI5 Q;  3A54 A;  3NBH B;  1I6H H;  4PMW A;  1UAP A;  1PH6 A;  4UP7 A;  3OMG A;  2K14 A;  1U5K A;  2B2T C;  4GN4 B;  3K58 A;  2FMC A;  4O2D A;  4DV7 Q;  4GNX A;  4DV1 L;  4L5R C;  5KNC A;  2H1E A;  2SOB A;  3K5L A;  4PMB A;  1NUC A;  3TN2 A;  2HHH L;  1BDO A;  2K5W A;  1N33 L;  1UWV A;  1E0B A;  4JCV E;  2KUM A;  1TWA H;  1SE3 A;  3MAQ A;  1OXT A;  3MZ5 A;  1X6O A;  2JA5 H;  1TQO A;  2NVQ H;  2VQE Q;  1CKM A;  4AIM A;  1PRT D;  4XTC S;  4HSV A;  1NMF A;  3N52 A;  2J7Z A;  4P2C B;  2GA4 B;  1IBL L;  3NEN A;  4A3B B;  3RD4 A;  4IUP A;  3KDF B;  3J81 c;  4QY7 A;  2H5X A;  2ATW A;  2FJ2 A;  1EU3 A;  1O7L A;  1SYD A;  5BN5 A;  1S72 A;  3ERO A;  4BY1 G;  4LF7 L;  2AWO A;  3SHL A;  4QJF A;  1I6H B;  4Y7N H;  2D2C C;  3SK6 A;  4DR7 Q;  1KDA A;  3GTK H;  2GVB A;  4CDF C;  3CCS A;  1HPC A;  1HTP A;  1GVP A;  1PRT C;  2KCT A;  2MGS A;  3I73 A;  1F9P A;  2ICE C;  2PW5 A;  1O7Y A;  4LF6 Q;  1U0L A;  2BA1 A;  5C3E G;  4IPG A;  1G51 A;  1STG A;  5E4W C;  5IWA Q;  4KI0 A;  3J81 L;  1U4R A;  3S14 H;  4QMG A;  2ASB A;  1J5E L;  1O78 A;  2QCP X;  1TWA B;  2KHJ A;  3P1H A;  2XWB B;  2QGQ A;  1NR2 A;  4CDD C;  4GOP A;  2JA5 B;  2JA9 A;  2NVQ B;  1RIP A;  4JW0 A;  2RSO A;  5IOC A;  3GTP H;  1BBW A;  3T51 B;  2UUA L;  4Q0F A;  3Q24 A;  1D1K A;  5KYI A;  3K6O A;  4BY1 H;  2NUC A;  2KCC A;  2F0I A;  3O13 A;  5IGG A;  5KYL A;  3T1H Q;  1PVO A;  2BCO A;  3K59 A;  4HCS A;  1RHP A;  1Y14 B;  2EVB A;  4WJ4 A;  1OXU A;  3IAY A;  1M90 C;  4IFD J;  4J1M A;  1IKM A;  3GTK B;  3I2Z A;  2L1B A;  5C3E H;  5DLQ E;  3BZD B;  3QG1 A;  3ERQ A;  4X64 Q;  4DV0 Q;  4DV5 L;  5J39 A;  4EQP A;  3K81 C;  1GM5 A;  3PIP A;  3OTO L;  3A7L A;  1KDB A;  1VMP A;  4JVZ A;  3VYU A;  2F0U A;  3H91 A;  2K28 A;  1VQ9 A;  4YY3 L;  3BYY B;  2KEC A;  1BVS A;  1EY8 A;  1LT5 D;  2KHS A;  2KEN A;  3QIA A;  3ULL A;  1CM9 A;  1TR5 A;  1TS5 A;  4L63 B;  1BCP D;  1IL2 A;  2EYM A;  3CQZ H;  2A19 A;  3J7A F;  2KED A;  1KQS A;  3GV6 A;  4ME5 A;  3GTP B;  2EXD A;  1CKN A;  2K75 A;  3CAM A;  2NB0 A;  3OWE B;  4CDC C;  2PW7 A;  1X54 A;  3H3V C;  4B3T Q;  2D9U A;  4BY1 B;  3ULJ A;  4JI4 Q;  4CKE A;  3DLL A;  2D0P A;  1FR3 A;  1K8G A;  4WJW A;  5E3F A;  3CC2 A;  1ENF A;  4M8A A;  2EQS A;  3M7N A;  2CQA A;  5IT9 E;  3GTJ H;  1CA6 A;  1TXY A;  3EQL C;  1B3A A;  5C3E B;  1QZH A;  1WI5 A;  1A2T A;  1K8O A;  5C4Z A;  3OWF A;  4KKT A;  4YIJ A;  1EY0 A;  3IL8 A;  1CK1 A;  5F2D A;  4LUZ A;  4B08 A;  5I4D A;  3M4O H;  4O0A A;  1OO9 B;  5C0X J;  1VCI A;  1STY A;  4KK7 A;  4OO1 I;  1LTI D;  2ZXO A;  1WTH A;  4QCL A;  1I4R A;  2VL6 A;  1LTR D;  3NTK A;  1SRO A;  2EE1 A;  1JOQ A;  4EQO A;  2ENB A;  3OPO A;  3P75 A;  3CQZ B;  3KF6 A;  1IL8 A;  4WOR A;  4JBJ A;  3X3M A;  4H02 A;  2K50 A;  4KLK A;  4XYQ A;  1II3 A;  4U67 3;  2K33 A;  3EIV A;  3TP5 A;  1VQE A;  2AKW B;  3TSS A;  2QA4 A;  5JVH 3;  1BBX C;  4LF9 L;  1WOC A;  4PQX A;  4B3R L;  3GTJ B;  2PCF B;  2UUC Q;  2D5D A;  5LMN L;  3FHW A;  1SE2 A;  1TS2 A;  5D3I B;  2M2L A;  1XYI A;  4OX9 L;  3KF8 B;  1BKB A;  4JI3 L;  3M4O B;  4RMF A;  1V1O A;  4E6I A;  4ZQ3 A;  1V1P B;  4GKK Q;  3MVV A;  2SNS A;  4A93 G;  1QNK A;  1QUQ A;  1K3R A;  1PTO H;  4XYO A;  5BN3 A;  3DXJ C;  2QW7 A;  4JOI C;  5HUR A;  3CRL C;  2VY3 A;  3G71 A;  1CI3 M;  1WTP A;  1DYQ A;  4BWG B;  2JSO A;  2M00 A;  3MXG A;  4A3E G;  1HNZ Q;  1BXT A;  4LFA L;  4QQB X;  3SK5 A;  4S3S A;  5IGC A;  4JBK A;  1GD7 A;  1SN8 A;  1JB7 A;  3OW7 A;  4RFB A;  1PH4 A;  1E1T A;  1D2B A;  1IKL A;  2EXZ A;  3BYT B;  4I7A A;  2HDL A;  4CBV A;  5JAV A;  3UE1 A;  1N36 Q;  4DR5 L;  4FF3 A;  3JAM i;  2VUM G;  2A74 C;  2EOT A;  1VF7 A;  2LFN A;  2NN6 G;  3C1E A;  4YCW A;  5CBA E;  3OW2 A;  5C4X H;  4POF A;  2VXW A;  1AP0 A;  1STH A;  5KGU A;  4JI1 Q;  4LF4 L;  4A93 H;  4JYA L;  2PNH A;  1B1Z A;  4IZ8 A;  1WYD A;  5IT9 c;  3K57 A;  4P72 A;  2A5H A;  3LWU A;  4A3E H;  1PTO B;  1SBB B;  4PNY A;  5IGB A;  2WB1 G;  4BBR G;  1L0W A;  3BJU A;  3D6W A;  2E5L Q;  5JPN C;  2E74 C;  4RWS C;  4ZLT F;  4YWL A;  1VQL A;  1N34 L;  3PF5 A;  2RBM A;  3FEW X;  4B9X A;  4ZRZ A;  2R93 G;  3TME A;  2PQE A;  1E7Z A;  1W3S A;  3IFD A;  1EIF A;  3AU7 A;  2L15 A;  5GQO A;  2MFI A;  4BY7 G;  2EYP A;  1GHJ A;  4POG A;  2NBF A;  1XNQ L;  2CH4 A;  3FRP B;  2VUM H;  3FKI H;  1SFO H;  3DM1 A;  2NN6 H;  3JAM c;  1DXM A;  5IT9 L;  1O7I A;  2OTL A;  2WKD A;  4DF7 A;  1EFW A;  1TII D;  3HZX A;  3GV3 A;  3CF5 A;  3KJP A;  4FO2 A;  2E75 C;  1S5F D;  1S3O A;  4LUO A;  3C3L A;  5EPJ A;  4TSS A;  3EVQ A;  3AEV A;  1ASY A;  5JVG 3;  4A93 B;  1E22 A;  1A62 A;  4BBR H;  1J9O A;  3P7J A;  4JI5 L;  1IYV A;  4O42 A;  1Z9F A;  4A3C G;  4KY7 A;  2JA8 G;  1V8Q A;  4A3E B;  1R4Q B;  1TKW B;  4XQQ A;  3F2U A;  4BY7 H;  4RKL A;  3GO5 A;  2V1C C;  4JI6 Q;  4RGO S;  3S17 H;  3ER0 A;  1VQ4 A;  2KBN A;  3RN5 A;  2OQ0 A;  1OXS C;  3S24 A;  1D6E C;  3J81 j;  1Q86 C;  3NXW A;  2VUM B;  3FKI B;  4KD4 A;  3A7A B;  1SFO B;  2X6L A;  4QB4 A;  2NWG A;  1I6V C;  1LV9 A;  3CD6 A;  2VQE L;  1WTO A;  1LT6 D;  3M3Y H;  1DOM A;  3KFU A;  2HQE A;  4A3I G;  1GXD C;  1NBW A;  4LF8 Q;  4A3K G;  4G7O C;  3L3O C;  4CJ1 B;  1LTG D;  5T1I A;  3I91 A;  3C2P A;  2KEE A;  4A3C H;  1W6K A;  2PI2 E;  2JA8 H;  2L4N A;  1X3G A;  5GRO A;  2WAC A;  2WB1 B;  3GQB A;  1CHP D;  1SNM A;  4BBR B;  1WTR A;  1WJJ A;  3FP9 A;  2HT1 A;  2LXK A;  5IY0 A;  5JJL A;  4IJL A;  3CHB D;  3SXH A;  2ALY B;  4OXP A;  1WTX A;  2MUY A;  4BBS H;  4DR2 Q;  4BY7 B;  4IUV A;  1GUG A;  1HTL D;  3SVM A;  4IPH A;  2FIN B;  4LF6 L;  3KJO A;  4K8J A;  1GO3 E;  5LHY 1;  3R2I A;  3E5S A;  1EOT A;  4DNR B;  1T9H A;  3DWP A;  4O1N A;  3IRB A;  3M7G A;  1I4Q A;  3ULP A;  2BA0 A;  1SYG A;  1M4V A;  1I94 Q;  1HHV A;  4OIJ A;  5M5Y H;  4A3I H;  1LYL A;  4A3K H;  4HN7 A;  1QG7 A;  1YEZ A;  1NSN S;  3X3N A;  4LFB L;  4DU9 A;  3M3Y B;  2Q8T A;  5GAG C;  3L0O A;  3PUV A;  2Z1C A;  1O80 A;  2F0N A;  2I5H A;  2TMP A;  2N88 A;  5I6Y A;  1KNA A;  4UAI A;  2JA8 B;  3D6C A;  3NK9 A;  3TEH B;  2BOS A;  1QB5 D;  4H7B A;  3H3V H;  4FYD A;  1F9S A;  2O5J C;  1H9S A;  1KLG D;  4LUV A;  3J7A V;  5IP7 G;  2OCE A;  2ZXR A;  3STB C;  4BA2 I;  3BVG A;  4ALP A;  4X64 L;  5JEA J;  2PYK A;  5M3M G;  1CQF A;  1PH1 A;  1A3V A;  3K5O A;  4QIW E;  2I46 A;  5C4H A;  2UUB Q;  1Q3L A;  2FFK B;  3AB9 A;  2OT2 A;  1B2T A;  2QF7 A;  1QNU A;  1U9R A;  2UU9 L;  2A8V A;  3TS0 A;  3HOY G;  1MD2 D;  4JI7 Q;  2PZW A;  4YWM A;  3J7A 5;  4A3I B;  5M5Y B;  1HA5 A;  1WTW A;  1KXL A;  2B2U C;  1Y69 U;  4A3K B;  3HOZ G;  1SNC A;  3I70 A;  4K2K A;  1SE8 A;  3MXN B;  3GTQ H;  3QO2 A;  2XRQ D;  4KHP L;  1HH2 P;  3E9I A;  3V2T A;  2UXD L;  2F03 A;  1ESF A;  3NEM A;  3BU2 A;  3SR1 A;  5LMU Q;  1PFN A;  4GN5 A;  2TSS A;  3E6Z X;  1XPR A;  4JI4 L;  5ELE A;  5IP7 H;  3TBI B;  3OYY A;  4QUF A;  1FGU A;  4CHT B;  1QVF A;  3BG3 A;  4JI8 Q;  4R9W A;  2PO4 A;  1Y8N B;  4MN3 A;  5JOB A;  2DN8 A;  5M3M H;  1AH9 A;  1JMC A;  1N9W A;  3CMA A;  4DV2 Q;  1UE1 A;  3HP3 A;  1X3F A;  1HNX Q;  3HOY H;  1LT4 D;  1B8A A;  1JR0 D;  2DJG C;  4IQZ A;  1EU4 A;  5EGT A;  1OTC A;  3HOZ H;  1I50 H;  3PCO B;  5HGT A;  2IHE A;  5J22 A;  1AFP A;  1SSO A;  1RL2 A;  2JYO A;  3S1M B;  2NZO A;  2ZT9 C;  3SDZ A;  5C44 H;  4DV3 Q;  3GTQ B;  1LTT D;  4OHJ A;  4DXG A;  5E1F A;  1A6X A;  4JC0 A;  4X6A H;  3PIO A;  2EPB A;  1SJE D;  1PYS B;  2F52 A;  2CVR A;  1KC8 C;  3ZJY C;  2NN6 I;  2PNR C;  1JWU D;  1AE2 A;  2FXQ A;  4IUN A;  4DAM A;  4ZUJ A;  1RDP D;  2XVS A;  4DV6 Q;  4XXE A;  3S16 H;  1YIJ A;  4GNX C;  2F0K A;  1F2M A;  4BS9 A;  4HIO A;  1UEB A;  4OL7 A;  2IL8 A;  5M3M B;  2K5D A;  3UDX A;  2NVT H;  5IP9 G;  2UUC L;  4JI2 Q;  1EY7 A;  1ZXT A;  5M3F G;  1B9N A;  5IGD A;  2RCN A;  5JPM C;  1HQM C;  3B6Y A;  1HNW L;  3MFY A;  1Y8O B;  1F9R A;  1H9M A;  1SE4 A;  3HOY B;  4HCE A;  4CKC A;  1EUJ A;  3HOZ B;  1A3T A;  1I50 B;  4JI0 L;  3Q8D A;  1CZG A;  2J4X A;  2A6E D;  3LWE A;  5I9P A;  4IFD G;  1PXU A;  3DM3 A;  1HZA A;  3HEJ A;  1YZ6 A;  2QKI C;  4OON A;  2F3I A;  3Q23 A;  4KY5 A;  2R61 A;  1HNZ L;  1VMC A;  2IPK D;  1JT8 A;  5D14 A;  1D5Z C;  3NE5 B;  2JK8 A;  4XQN A;  4QL5 A;  2EJG C;  2DNC A;  3HOX G;  4GZY C;  2EYF A;  2K5V A;  3I4O A;  2XN9 C;  5ELO A;  3SK4 A;  2EJF C;  2F4V Q;  5C5M A;  1XMQ Q;  2PMZ B;  4DXF A;  2XGT A;  4P73 A;  5EJW A;  3Q22 A;  5CV4 A;  2C5C A;  3S16 B;  2WB1 E;  1N36 L;  4LK1 C;  5IP9 H;  2KCM A;  3G48 A;  3I4M G;  1CTM A;  5M3F H;  5A35 A;  2A6E C;  2YYZ A;  1G91 A;  3L7Z C;  1JJC B;  2NVT B;  2F0H A;  4J8Q A;  2EDG A;  4YHH Q;  3RMH A;  3F8T A;  1L1O A;  2IX3 A;  3MHB A;  3TRZ A;  3VR4 A;  1N32 Q;  4GOP C;  5CC4 A;  1PH2 A;  4JI1 L;  1MJE A;  1JOR A;  4KV6 A;  4IFD H;  1A2U A;  3L9A X;  4H44 C;  4HTH A;  4RGM A;  3U58 A;  2E8G A;  2F0Q A;  2K52 A;  4KD3 A;  4TVA B;  2N78 A;  4JPB W;  3NSW A;  3HOX H;  4DNT B;  2GN5 A;  4X62 L;  4LF5 Q;  2EZV A;  2CKZ B;  4YCV A;  2ZM6 Q;  3CCJ A;  2ICI A;  3NUC A;  1C0A A;  4X65 L;  1VQA A;  3MTS A;  4Y7N B;  1Q1B A;  5C0X G;  2IT1 A;  4A76 A;  3I4M H;  2B2Y A;  1HUM A;  1STN A;  3TQY A;  1EYG A;  3BZK A;  1EL0 A;  3VR5 A;  1GUT A;  1XJV A;  2BDN A;  1V9P A;  5M9O A;  5M3F B;  4DUZ Q;  4RGT A;  4DA2 A;  2ID0 A;  4PZ8 A;  1PYB A;  1RTN A;  1YNJ D;  4GKJ Q;  3VA5 A;  4K5W A;  1JE5 A;  4OWW B;  3S14 B;  3VYR A;  1VQK A;  4L5S A;  1WD1 A;  2B8F A;  4L8J A;  2DGY A;  2P5Z X;  3JC6 6;  1CFM A;  1RCV D;  4DAV A;  1XWE A;  2O5I C;  4DKA C;  1IBK Q;  5J1Z A;  2VQF Q;  4XIG S;  1B4O A;  4A3J G;  4LFC L;  3Q0A A;  4DNI A;  2LY7 A;  3TP8 A;  4FXD A;  2EJM A;  3HOX B;  2M9V A;  5C0X H;  3Q6S A;  1YNJ C;  1B53 A;  4K8I A;  2I07 B;  2CH4 W;  2AWN A;  4LNQ A;  1FGB D;  3GTO H;  3J7Z C;  1G8Z D;  2CHB D;  2PQA B;  3T53 B;  1BCP C;  1VQB A;  3I4M B;  4EGV A;  3K7A H;  3GTM H;  3RLN A;  5KNB A;  5NUC A;  4LJZ C;  5GAE C;  1VQ7 A;  1VQJ A;  1LLR D;  4U68 A;  1EIY B;  1HJP A;  3A74 A;  3H6M A;  4LF8 L;  1H9R A;  4UY8 C;  2K04 A;  4C3H G;  1LTL A;  1PTO F;  4A3J H;  4N8F A;  1CHQ D;  2Y0S E;  3JAM E;  4HJ5 A;  1E3P A;  2QIL A;  1TT2 A;  4AYB G;  2B2V A;  2PPB C;  3BZC A;  2F4I A;  2CWA A;  4X3S A;  2AQ3 B;  2RSN A;  3D8G A;  1GOZ A;  3PUZ A;  2J0T D;  3WDN A;  5JJK A;  3K5N A;  4C1N K;  3NBH A;  3RLF A;  2C35 B;  3T1Y Q;  1N8R C;  1CQV A;  2LMC B;  1WTQ A;  4J15 A;  2WV6 D;  3K7A B;  3GTM B;  2I0Q A;  1ILP A;  3QB3 A;  4DAY B;  3D4R A;  2EYJ A;  1JWM D;  4C3H H;  3KLW A;  5BN4 A;  1SYC A;  2N8N A;  1EY6 A;  5DNF A;  5C4J H;  1GUO A;  5GAD C;  5C4X G;  2R7F A;  1VQ6 A;  1FD7 D;  2KOL A;  2WFW A;  1AEX A;  2K32 A;  1K3B C;  1RTO A;  3W2D A;  2HHH Q;  1Q8I A;  3S1N H;  1UE5 A;  5IIF A;  4UDU C;  1N33 Q;  3ITP A;  4A3J B;  1HZC A;  1Y1W G;  4ZAI A;  4HMJ A;  1YBY A;  2EY5 A;  4G4K A;  4FXK C;  5C3X A;  2A68 D;  4QIW B;  3RR5 A;  3GTL H;  1BO0 A;  2RDH A;  1YIT A;  2R7D A;  3KDF A;  4A3G G;  5CMD A;  1Z47 A;  3HKZ G;  1BBU A;  1GUS A;  4K0K Q;  1C4Q A;  2HUG A;  1NMG A;  2MHV A;  1EYA A;  3RUZ A;  1DM0 B;  3CU7 A;  5JJZ A;  1PFB A;  2RA4 A;  1WFQ A;  3FKI G;  5DM6 3;  1A0I A;  3HRZ C;  1SMY D;  2UUB L;  2OEO A;  2WAQ E;  1I3Q H;  1V43 A;  4NDX A;  2F0T A;  4LAA A;  2KCN A;  2PMZ E;  4ME3 A;  1MJC A;  2MQH A;  3DWA A;  4C3H B;  4X3T A;  5FLX E;  1I5F A;  5C4J B;  3T16 A;  1MSH A;  2Q8I B;  2RQX A;  1Y1W H;  2F0O A;  3G6E A;  1IZ6 A;  4C3J H;  5CR3 A;  1K8M A;  1TY0 A;  3TRE A;  3S1N B;  3I7F A;  3U50 C;  4KTA A;  5DM7 3;  1VQM A;  2HCC A;  2NYZ D;  1SMY C;  4AYB B;  3L2P A;  4N9T A;  2B3G A;  4DR4 Q;  1ML0 D;  3M4Q A;  4PMC A;  4A3G H;  2JQO A;  4EQN A;  3WOE A;  4WRD A;  4JI8 L;  1PZK D;  2IW3 A;  4IUQ A;  1ESR A;  1SAP A;  3GTL B;  4NXM L;  1ET6 A;  1JJG A;  3AQQ A;  1PYW D;  2YTY A;  3ND8 A;  3S2D H;  1U4M A;  2KA7 A;  2LS0 1;  3MXU A;  2VB2 X;  2WII B;  5T1G A;  3K80 C;  1HNX L;  3VYS A;  1SND A;  1JWS D;  3J7Y W;  1PFM A;  1TS4 A;  2UXB L;  3G7L A;  3BS1 A;  1AE3 A;  1K8A C;  1R9T H;  5CV5 A;  1I3Q B;  4PV1 C;  3BDC A;  4XQJ A;  1PDQ A;  4RCN A;  5C4X B;  1HZB A;  1LUZ A;  4LMQ D;  2F0E A;  3LNN A;  3DEP A;  1EQR A;  4DV3 L;  4DV5 Q;  1A15 A;  2UXC Q;  4NW2 A;  5M5X H;  3S1R H;  5CGK A;  1Y1W B;  3A0J A;  1E2V A;  2X6G A;  2E2I H;  2L5T A; 
#chains in the Genus database with same CATH homology
 4YWM A;  3J7A 5;  1WCM G;  4YY3 Q;  4UPA A;  4LF6 Q;  3U4Z A;  1KXL A;  1U0L A;  2BA1 A;  5C3E G;  4IPG A;  3HOZ G;  4YCU A;  1G51 A;  3CC7 A;  1SE8 A;  1I94 L;  1Q7Y C;  3MXN B;  4UP9 A;  4DV7 L;  3GTQ H;  3E9H A;  5IWA Q;  4KI0 A;  4A3M H;  4A3L G;  2IX0 A;  3S14 H;  4KHP L;  1HH2 P;  3E9I A;  4BBS G;  2UXD L;  2ASB A;  1J5E L;  1YHA A;  3NEM A;  3BU2 A;  5LMU Q;  2KHJ A;  4DV1 Q;  1G29 1;  2DUD A;  2ZTD A;  4GNX B;  3RN2 A;  2QGQ A;  4GN5 A;  4GOP A;  2JA9 A;  4R4I A;  1XPR A;  4JI4 L;  5IP7 H;  1RIP A;  5IYB H;  3OYY A;  3F1Z A;  2I5M X;  1FGU A;  3CW2 C;  3W1B A;  4APV A;  1YJ9 A;  1QVF A;  4FDB A;  3EBE A;  2IY5 B;  4JI8 Q;  3GTP H;  1BBW A;  1P16 A;  4AQY Q;  2N3S A;  2UUA L;  4IPC A;  5M3M H;  1FJG Q;  1AH9 A;  4A4I A;  1KD1 C;  4B3S L;  3MEF A;  1HNW Q;  4BY1 H;  3CCV A;  4OWT B;  1JMC A;  1UE7 A;  3PO2 G;  1N9W A;  4NXN Q;  3CMA A;  4DV2 Q;  2R92 G;  1OXX K;  1CKO A;  4GLA C;  1UE1 A;  1XTD A;  3T1H Q;  3E0E A;  1PVO A;  1SR3 A;  1X3F A;  1K9M C;  1HNX Q;  3RLO A;  3HOY H;  1Y14 B;  4QGU A;  4R4T A;  1B8A A;  3CXC A;  1IBM Q;  4JI0 Q;  2JA7 H;  4WJ4 A;  1OXU A;  2KHI A;  1IBL Q;  4JOI A;  1M90 C;  4IFD J;  1WCM H;  2VS1 A;  1CUK A;  1KHI A;  3I2Z A;  3G4S A;  1OTC A;  5C3E H;  2RF4 A;  5DLQ E;  3HOZ H;  1I50 H;  1YJN A;  3PCO B;  4DK3 C;  1QVG A;  3NEL A;  1PV4 A;  4X64 Q;  3CCM A;  4DV0 Q;  4DR7 L;  4DV5 L;  2IHE A;  1CSQ A;  3PV0 A;  4A3L H;  4GLV B;  3K81 C;  1GM5 A;  4LF7 Q;  4X66 Q;  3PIP A;  2F4V L;  1QZG A;  2VZA A;  1DGS A;  1RL2 A;  3OTO L;  2NZO A;  1PH3 A;  1TWH H;  4L5T A;  5C44 H;  1X65 A;  4DV3 Q;  4JI7 L;  5H1S E;  2OQK A;  1VQ9 A;  4YY3 L;  5FLX c;  4JC0 A;  4X6A H;  1BVS A;  3PIO A;  1X55 A;  5ELN A;  3I55 A;  2KEN A;  1PYS B;  4KHZ A;  2F52 A;  1OXV A;  3ULL A;  1KC8 C;  3TS2 A;  4IOA A;  3ZJY C;  2NN6 I;  1KRS A;  1D8L A;  3HOW G;  2N49 A;  1IL2 A;  5IWA L;  1AE2 A;  2FXQ A;  4DAM A;  1VQ5 A;  3CQZ H;  2E2J H;  2A19 A;  4DV6 Q;  2Y0S G;  3CP0 A;  3S16 H;  1PH5 A;  1KAW A;  1YVC A;  5LMU L;  4GNX C;  1YIJ A;  2VW9 A;  1KQS A;  2Q2U A;  3AFQ A;  3HFZ B;  4P74 A;  4PZ6 A;  3PO2 H;  5K36 G;  2B63 G;  1XNR L;  4HIO A;  3CPF A;  4NPS A;  2R92 H;  2EXD A;  1CKN A;  1S40 A;  1UEB A;  2K75 A;  3CAM A;  1J5E Q;  4R4Q A;  1X54 A;  4DR3 L;  3UDX A;  2NVT H;  1ASZ A;  4B3T Q;  4LWC A;  1VQN A;  5IP9 G;  2UUC L;  3GDE A;  3ULJ A;  4JI4 Q;  4JI2 Q;  5M3F G;  1B70 B;  1A63 A;  3AFP A;  1K0R A;  3DLL A;  2D0P A;  4LF9 Q;  2RCN A;  4B3R Q;  3B6Y A;  4R4O A;  1HNW L;  1K8G A;  2IX1 A;  5LMN Q;  4MTN A;  3CC2 A;  3PO3 G;  2B29 A;  2EQS A;  2UUA Q;  3A5Z B;  4EQ5 A;  2OWO A;  1H95 A;  3UDI A;  4DV2 L;  4IFD I;  3M7N A;  1NY4 A;  1EUJ A;  5IYC G;  3GTJ H;  2ZM6 L;  3RZD H;  3T1H L;  4B3S Q;  1TXY A;  4A75 A;  2Z6K A;  4X62 Q;  1QZH A;  1WI5 A;  4JI0 L;  1C7Y A;  3Q8D A;  5LMN W;  4IFD G;  2CFM A;  3DM3 A;  1XMO L;  1HZA A;  1X56 A;  1PFS A;  1YZ6 A;  2YTV A;  4LUZ A;  5E7N A;  4X65 Q;  1YI2 A;  4OON A;  2CWP A;  2F3I A;  5IYD G;  3M4O H;  4O0A A;  1SMX A;  3M4P A;  1GKH A;  2R6G A;  1EWI A;  5C0X J;  1VCI A;  4HIM A;  1HNZ L;  3ICE A;  1JT8 A;  4DV0 L;  4OO1 I;  3HOW H;  2JK8 A;  2GVA A;  2Z0S A;  4QL5 A;  2JA6 G;  2YU9 H;  2HIV A;  3HOX G;  1FL0 A;  2VL6 A;  1VQ8 A;  5ELO A;  2K5V A;  3I4O A;  1SRO A;  4LFA Q;  4DPG A;  4BXX G;  2B63 H;  2F4V Q;  3KOJ A;  3OTO Q;  1XMQ Q;  1IXR A;  2XGT A;  1PH9 A;  4P73 A;  2JA7 G;  2WB1 E;  1N36 L;  1VQI A;  3KF6 A;  5IP9 H;  2KCM A;  3G48 A;  5IE8 A;  3I4M G;  4JV5 L;  5M3F H;  1E1O A;  3I56 A;  4JBW A;  2YYZ A;  2JJQ A;  4JBJ A;  5FLM G;  3LGJ A;  4DV6 L;  2ZTE A;  4H02 A;  3L7Z C;  2K50 A;  1JJC B;  1X3E A;  1IBK L;  1PH7 A;  3PO3 H;  4KLK A;  4YHH Q;  3F8T A;  4HJ9 A;  3PF4 A;  1L1O A;  3EIV A;  5IYC H;  3TRZ A;  5C44 G;  1JJ2 A;  1VQE A;  1A8V A;  4B3T L;  1Y1V G;  1XNR Q;  4GOP C;  2AKW B;  3CCU A;  4DR6 L;  1PH2 A;  2WP8 J;  4JI1 L;  2QA4 A;  1MJE A;  4JI2 L;  4LFC Q;  1TWC H;  2R93 H;  4LF9 L;  1CKN B;  1WOC A;  2WAQ G;  4DR3 Q;  4B3R L;  1P8L A;  3F2C A;  2UUC Q;  4AH6 A;  5EAY A;  1EOV A;  4HID A;  3H0G H;  3U58 A;  2PQA A;  3KYH C;  5LMN L;  5IYD H;  5HGQ A;  3FHW A;  2E8G A;  2K5H A;  4DR1 L;  5AJ3 L;  2K52 A;  2Q2I A;  4TVA B;  2Q2T A;  2N78 A;  4OX9 L;  2D62 A;  5BR8 L;  2JA6 H;  3HOX H;  1VQD A;  2A1A A;  1BKB A;  2GN5 A;  3KF8 B;  4RG1 A;  4JI3 L;  4AYB E;  4RMF A;  4C2M H;  4X62 L;  4LF5 Q;  3I4N G;  2CKZ B;  5C0X I;  1IYJ B;  4YCV A;  2ZM6 Q;  4BXX H;  3CCJ A;  2PI2 A;  2MO1 A;  4R4C A;  1C0A A;  1N34 Q;  4GKK Q;  4X65 L;  1VQC A;  5FJ8 G;  1VQA A;  4DUY L;  1QUQ A;  1K3R A;  1Q1B A;  4A93 G;  5C0X G;  1XMO Q;  4JOI C;  2IT1 A;  5JEA G;  3HKS A;  4A76 A;  2VY3 A;  3G71 A;  1YJW A;  3I4M H;  4MZ9 A;  2RHQ B;  3TQY A;  5FLM H;  1EYG A;  3HOU G;  4A3E G;  3BZK A;  1HNZ Q;  1XJV A;  1K83 H;  1V9P A;  4LFA L;  4QQB X;  4JBK A;  1GD7 A;  4DUZ Q;  1SN8 A;  1XMQ L;  1JB7 A;  4IOC A;  4WJ3 M;  2D0O A;  2ID0 A;  1VS0 A;  4PZ8 A;  4HJ7 A;  1PYB A;  1Y1V H;  1PH4 A;  4GKJ Q;  1B7Y B;  1FVI A;  2JEB I;  1JE5 A;  2HIX A;  4OWW B;  1E1T A;  1YHB A;  2YV5 A;  3UE1 A;  4MNO A;  1N36 Q;  4DR5 L;  4JV5 Q;  1VQK A;  1C9O A;  1SLJ A;  1CSP A;  4L5Q A;  3KF6 B;  3JAM i;  4L5S A;  2VUM G;  2OTJ A;  2DGY A;  4YHH L;  3S15 H;  3JC6 6;  1VQP A;  4A3F H;  2BH2 A;  3D31 A;  2R7Z G;  4DKA C;  1IBK Q;  1HR0 L;  2EIF A;  3M85 A;  2NN6 G;  2RHS B;  2VQF Q;  3CCQ A;  4XIG S;  3I4N H;  3T1Y L;  4YCW A;  4A3J G;  1N32 L;  3OW2 A;  2AMC B;  4LFC L;  3CCE A;  4DNI A;  4POF A;  1L1O B;  5HY6 A;  5C4X H;  1Q82 C;  4DV4 L;  2JE6 I;  3PUY A;  2ZJP A;  3W5O A;  4DR6 Q;  5FJ8 H;  1YNX A;  4JI1 Q;  3A5U A;  4GOP B;  4LF4 L;  4A93 H;  3AYH B;  4JYA L;  1XPU A;  2PNH A;  2ES2 A;  4IJH A;  2AWN A;  3CCL A;  4LNQ A;  1WYD A;  3HKZ E;  4DK6 C;  5IT9 c;  4PG3 A;  3GTO H;  4P72 A;  1M1K C;  3J7Z C;  3HOU H;  2PQA B;  4A3E H;  4LF5 L;  2CCZ A;  3GD7 A;  4DR1 Q;  5AJ3 Q;  2WB1 G;  4BBR G;  1L0W A;  3BJU A;  1VQB A;  2E5L Q;  3F2B A;  5BR8 Q;  4OX9 Q;  3HOV G;  1UE6 A;  3K7A H;  2Z6K C;  4YWL A;  2LSS A;  1N34 L;  3RLN A;  1VQL A;  4JI3 Q;  3GTM H;  4GKK L;  3STB D;  5GAE C;  4JBM A;  3PF5 A;  1VQO A;  1VQ7 A;  2R93 G;  3RZO H;  1E7Z A;  1W3S A;  3CCR A;  1EIF A;  3D0F A;  2L15 A;  5GQO A;  2MFI A;  1VQJ A;  3H0G G;  4BY7 G;  2LXJ A;  4DUY Q;  2JEA I;  5J3B A;  2NVY H;  3UE0 A;  1QUQ B;  4YWK A;  4POG A;  1EIY B;  2BH8 A;  1XNQ L;  1HJP A;  3A74 A;  2VUM H;  4LF8 L;  3FKI H;  4UY8 C;  1LTL A;  1SFO H;  4DUZ L;  4LW1 A;  1Q12 A;  2R7Z H;  1Q46 A;  1Q8K A;  4UP8 A;  3JAM c;  3GTG H;  3K7U C;  4OO1 G;  4HIK A;  1O7I A;  4A3J H;  4GKJ L;  4K0K L;  1NJI C;  3S1Q H;  1NTG A;  3VDY A;  1L2F A;  2E2H H;  2OTL A;  2Y0S E;  4HJ5 A;  1E3P A;  1MIU A;  1VQG A;  1EFW A;  3CF5 A;  1PA6 A;  2NZH A;  2ZJQ A;  3KJP A;  4AYB G;  1KIX A;  1S3O A;  4LUO A;  1NE3 A;  3BZC A;  3PSI A;  3S2H H;  4C3I H;  1QVC A;  4DR5 Q;  2CWA A;  3AEV A;  2VQF L;  1ASY A;  3PUX A;  3PUZ A;  4NB3 A;  1E22 A;  1A62 A;  4Y52 H;  4BBR H;  1L1O C;  4JI5 L;  1HR0 Q;  5JJK A;  3HOV H;  2XTI A;  3K0X A;  3RLF A;  1Z9F A;  4JG2 A;  2C35 B;  3T1Y Q;  4A3C G;  2JA8 G;  3SGI A;  1N8R C;  2Q2H A;  3PGZ A;  1W2B A;  3CC4 A;  4BA1 I;  4DV4 Q;  1D7Q A;  3CME A;  4J15 A;  1HR0 W;  3S1M H;  4BY7 H;  4LF4 Q;  1SRU A;  3GO5 A;  4JYA Q;  2V1C C;  4JI6 Q;  2QEX A;  1PH8 A;  2I0Q A;  3CPW A;  4A3F G;  4DAY B;  3S17 H;  4A3B G;  3ER0 A;  1VQ4 A;  2E5L L;  1EQQ A;  2KBN A;  5JJI A;  3RN5 A;  4C3H H;  3KLW A;  2OQ0 A;  1LM0 A;  1VQH A;  1OXS C;  2N8N A;  3S24 A;  3J81 j;  4DR4 L;  5C4J H;  1Q86 C;  1TWF H;  4OWX B;  5GAD C;  2R7F A;  1VQ6 A;  5C4X G;  2VNU D;  2WFW A;  3UDG A;  3K8A A;  1KRT A;  3RNU A;  4LFB Q;  4B3M L;  2YTX A;  1K73 C;  2HHH Q;  3EN2 A;  3S1N H;  1X9N A;  1Q81 C;  1UE5 A;  4TQU S;  3CD6 A;  1N33 Q;  2VQE L;  1HZC A;  1Y1W G;  2K5N A;  3U4V A;  4NXM Q;  3M3Y H;  2IHF A;  3KFU A;  1YBY A;  4A3I G;  1NBW A;  1TWG H;  1XNQ Q;  2K4K A;  2MNA A;  4LF8 Q;  3UDF A;  4A3K G;  3RR5 A;  2MO0 A;  1MKH A;  1KL9 A;  3GTL H;  4PZ7 A;  4P75 A;  4P71 A;  4HJ8 A;  1YIT A;  1VQF A;  2R7D A;  3KDF A;  4A3G G;  1Z47 A;  4GS3 A;  3HKZ G;  1BBU A;  4GN3 B;  5GAH C;  1Q1E A;  4A3C H;  4K0K Q;  2PI2 E;  2JA8 H;  1NMG A;  4EX5 A;  1X3G A;  2UXB Q;  5GRO A;  1G6P A;  2ZTC A;  4A3D G;  1WJJ A;  3H3V I;  3FP9 A;  2HT1 A;  4HJA A;  2LXK A;  4R1J A;  2ZJR A;  5IY0 A;  2JA5 G;  4IJL A;  1YHQ A;  5JJL A;  1WFQ A;  3FKI G;  3H15 A;  1A0I A;  2ALY B;  2AHO B;  2UUB L;  3F2D A;  4OXP A;  4A3B H;  2WAQ E;  1I3Q H;  1PHJ A;  3WWV A;  1V43 A;  2UXC L;  4BBS H;  4DR2 Q;  3J81 i;  2PMZ E;  2I5L X;  3M9B A;  4ME3 A;  1MJC A;  3J80 i;  2NVX H;  2MQH A;  4JI5 Q;  4IPH A;  4LF6 L;  3KJO A;  2UU9 Q;  3NBH B;  1I6H H;  1GO3 E;  4PMW A;  2CQO A;  1PH6 A;  4JI6 L;  4UP7 A;  1I5F A;  1T9H A;  3IRB A;  2K14 A;  3PUW A;  3ULP A;  2HQL A;  1U5K A;  1XPO A;  2BA0 A;  1Y1W H;  4GN4 B;  1I94 Q;  4O2D A;  3G6E A;  4DV7 Q;  1IZ6 A;  4GNX A;  4C3J H;  5M5Y H;  4DV1 L;  4IO9 A;  4A3I H;  4L5R C;  3TRE A;  3I7F A;  1LYL A;  3U50 C;  1VQM A;  4A3K H;  4KHP Q;  3L2P A;  2UXD Q;  1YEZ A;  4LFB L;  2B3G A;  4DR4 Q;  3M4Q A;  4A3G H;  5GAG C;  2HHH L;  2JQO A;  3L0O A;  4JI8 L;  1N33 L;  3PUV A;  1V1Q A;  1UWV A;  4JCV E;  4AQY L;  4B3M Q;  1TWA H;  4NXM L;  4A3D H;  1FJG L;  1OXT A;  2I5H A;  1E24 A;  1JJG A;  1X6O A;  3AQQ A;  1N32 Q;  2YTY A;  2JA5 H;  2NVQ H;  1HZ9 A;  4NXN L;  2VQE Q;  4A3M G;  3S2D H;  1CKM A;  4AIM A;  4XTC S;  1J6Q A;  3TEH B;  3H3V H;  1NMF A;  3K80 C;  4GLX A;  4LUV A;  1HNX L;  1IBM L;  5IP7 G;  5IYB G;  1IBL L;  2UXB L;  3NEN A;  2OCE A;  1AE3 A;  1K8A C;  1R9T H;  4IPD A;  3KDF B;  3J81 c;  4QY7 A;  2H5X A;  3STB C;  2ATW A;  4BA2 I;  3J80 c;  4ALP A;  4X64 L;  5JEA J;  5M3M G;  1HZB A;  1S72 A;  1LUZ A;  4BY1 G;  3ERS X;  1PH1 A;  2AWO A;  4X66 L;  4LF7 L;  4QIW E;  4QJF A;  4Y7N H;  4DR2 L;  2UUB Q;  4DR7 Q;  1EQR A;  4DV3 L;  4DV5 Q;  3GTK H;  2GVB A;  3W1G A;  3CCS A;  2UXC Q;  5M5X H;  3S1R H;  1GVP A;  2UU9 L;  2A8V A;  3HOY G;  5M5W H;  3A0J A;  2KCT A;  3TS0 A;  2E2I H;  4JI7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...