3KF6A

Crystal structure of s. pombe stn1-ten1 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
136
Chain Sequence
b'SRWNPMFISDVHKISFHPHYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRDPNDEWKAWQKRMRYKKNLTKISKNHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein stn1
publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Structural protein
total genus 36
structure length 136
sequence length 139
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kf6A00
3JAMi 3CCQA 3PO2G 4DR6L 4DV6L 4GN4B 1H95A 4LF6Q 1TWCH 4GKKQ 4IPDA 2AWOA 3U4ZA 3I2ZA 1HR0W 1HNZL 3S2HH 1RIPA 1ASZA 3AFPA 2WB1G 4A3EG 3G6EA 5BR8L 1X54A 2YTYA 1QUQB 4DKAC 4A3LH 3CXCA 4DR5L 3CPFA 1I94L 4YWKA 4A3JH 1S40A 1Y14B 1Q81C 4IOCA 2R93H 2ZM6Q 3CD6A 2VQEL 3HOWG 3T1YL 2ID0A 4GN5A 4YHHQ 4WJ4A 1IZ6A 2EQSA 2Z6KA 3PIOA 2ZJPA 4DV3L 1N34L 1QUQA 3PF5A 1IBLL 1VQ7A 3PUZA 2RCNA 3ULPA 4POGA 1WOCA 4EX5A 5IYDH 4ALPA 3K7UC 1VQ5A 4JBKA 2YTVA 4JCVE 2OCEA 5GAHC 4A76A 1Y1VH 4B3TL 1MIUA 4A3MG 2IX1A 2NVQH 3I4MG 4BBRH 1XMQL 3AQQA 1E7ZA 2LXJA 1HNWL 1I6HH 3M7NA 3S15H 4JV5L 1HZAA 1NY4A 4PG3A 3RLNA 1Y1WH 4A3BG 2A1AA 4R1JA 4RMFA 4P73A 4LF9Q 5LMNL 4YY3L 3KOJA 4JI3L 1QVCA 2I5HA 4LUZA 2IHEA 1MJEA 2GN5A 5JEAG 1AE2A 1V9PA 1WCMG 2YV5A 5E7NA 1HNXL 4PZ7A 3M4QA 1UE1A 4HJ5A 4DV2Q 5M3MH 1NTGA 3D0FA 3PUWA 2E2JH 3CMAA 1Q82C 2GVBA 4EQ5A 2Q2TA 5FLMH 4JI4Q 4DR4L 2K5HA 4O2DA 4YCUA 3W1BA 1B7YB 1CKOA 3HKZG 3W1GA 1A0IA 5JJIA 2KENA 2A8VA 3BZCA 1KHIA 1VQMA 4C2MH 2UUBQ 2Z6KC 4NXNL 1QZHA 3U4VA 3CCMA 2E5LL 1N36L 4L5SA 4BA1I 2R6GA 4OWXB 1XPUA 5IYBH 4LW1A 1VCIA 3UDFA 4DV5Q 3K81C 4ME3A 3M9BA 2FXQA 3NEMA 5C0XG 1HH2P 1FGUA 4DR2Q 1YHBA 3ZJYC 4JI8L 5IT9c 4JI7Q 4JI6L 1IBKQ 2QEXA 5IP7G 4DUYQ 4P75A 1I50H 3FP9A 4JI5Q 3DM3A 2YYZA 1LTLA 1CUKA 2RHSB 2CCZA 3OYYA 5AJ3Q 4BY1H 1IBML 1C7YA 2UUCQ 1G291 1HR0L 2H5XA 4DR7L 2UXCQ 2NVYH 4LF7Q 2JQOA 3NBHB 3J81c 3CCVA 4IO9A 4A3DH 2HIVA 4DK6C 2KCTA 4IFDI 1CKNB 3HOZG 2R7ZG 4OO1G 1BVSA 1EUJA 1QVGA 3CCUA 1JJCB 1D8LA 1JT8A 4OX9L 3NENA 1PH4A 1P16A 4NB3A 1KC8C 1K73C 3ER0A 1N8RC 5M5XH 4B3ML 3CCRA 2B63G 2R92G 1CKNA 1KRSA 5DLQE 4IJHA 2I0QA 2JA5G 1N32L 3OW2A 2QA4A 4LFBL 3EIVA 3AFQA 1S3OA 5M5WH 2JA6G 1A62A 1VQBA 1X3FA 1ASYA 4GKJQ 3S17H 2B3GA 5K36G 2JE6I 5C0XJ 1YHQA 4GOPB 1UE7A 2UUAQ 2MNAA 4LFAL 2WFWA 2E8GA 2WAQG 2LXKA 4DV1L 1VQPA 4L5QA 2F4VL 1PYSB 5GAGC 1K83H 5IWAL 1FL0A 2ZTEA 2JEBI 3A5UA 4DR3L 1VQFA 1K8AC 4DV7L 3STBC 4A3JG 4AQYL 3S1RH 1XNRQ 3M85A 4GOPA 3CCJA 3HOXH 4DV0Q 4Y52H 5LMUQ 1KAWA 4DR1Q 2B29A 1HZBA 4GLXA 3RNUA 3S1QH 1N33Q 4OONA 2IX0A 3LGJA 2F3IA 4YCWA 3KDFB 4X64Q 4RG1A 3GTJH 4NXMQ 2OWOA 4K0KQ 4H02A 4DAMA 2NN6G 4QIWE 5IYDG 3UE1A 3RN5A 2JA7H 3HOVH 1GKHA 1V43A 1A8VA 1Y1VG 1SMXA 2L15A 4DV4L 1Q1BA 4X62Q 2HQLA 2RF4A 3KDFA 4BBRG 2EIFA 4HIKA 3CPWA 3GTKH 4JYAQ 4JI1L 1MKHA 3HFZB 1G51A 4GNXC 3T1HL 1YI2A 2E2IH 1QZGA 1WFQA 1SFOH 3JC66 2XGTA 4HJ9A 2YTXA 4MZ9A 2JA9A 5ELNA 1Q8KA 1CSQA 4JBJA 2K50A 3M4PA 4IPCA 3I7FA 4P72A 4JI2L 4AYBG 4A75A 3EN2A 3Q8DA 1SR3A 5JJLA 1MJCA 1TWHH 2PNHA 3PSIA 3S16H 1IXRA 3RN2A 3PCOB 1HNZQ 5M3MG 2UU9L 1PFSA 5C4XH 1Q86C 2N8NA 5C3EH 5M5YH 4OO1I 2OQ0A 1O7IA 2IT1A 5BR8Q 2PI2A 1RL2A 4APVA 1GVPA 1XPRA 3KF6B 3WWVA 4GOPC 1EIYB 4DR5Q 3VDYA 1PH1A 1I94Q 3RZOH 3KJOA 1WJJA 4JOIA 1JMCA 1LYLA 2Q2IA 1LM0A 4A93H 1PH3A 2VQEQ 3F1ZA 1EFWA 3MXNB 2MO0A 3GO5A 3T1YQ 4JG2A 3L2PA 4BXXH 4DV3Q 4R4OA 1PHJA 1N34Q 3S2DH 3PGZA 1PH9A 3PIPA 1IBLQ 4LFCL 2LSSA 1JJGA 3KYHC 5IYBG 1VQHA 4DV2L 2EXDA 2VY3A 4LUVA 1PA6A 1BKBA 1E3PA 2F52A 3L0OA 1K9MC 4KHZA 2KBNA 4DUZQ 1L2FA 1K0RA 2WP8J 2BH8A 2ZTCA 4Y7NH 3F2DA 2HHHL 2NVTH 1HNWQ 1HJPA 3TS0A 3HOWH 2KHIA 1YNXA 4BY1G 1XMOL 4HIMA 3E9HA 1PVOA 4X65L 4OXPA 2N78A 1Q7YC 1IL2A 2JJQA 4PZ6A 3NELA 1E22A 3STBD 3DLLA 1C9OA 1E24A 3S1NH 5C44H 1E1TA 4YY3Q 5LMNQ 1UEBA 4PMWA 2NZOA 2VQFQ 1J5EQ 2E2HH 4A3DG 4B3RL 1HNXQ 1KL9A 2NVXH 3HKSA 5JJKA 1YIJA 3I4MH 4IPHA 2Y0SE 3J80c 4JI0Q 4A3FG 2D0PA 1VQIA 3GD7A 4R4QA 1KRTA 4JI5L 4C3IH 3J81j 4IOAA 2VL6A 4JOIC 1I3QH 1M90C 1FJGL 4DR4Q 3M3YH 5GAEC 2JA8G 4P74A 4LF4Q 2ALYB 4HJ8A 3CCLA 4A3CH 2GVAA 2CKZB 2AMCB 3AEVA 3PF4A 1YITA 1SN8A 4NXNQ 1S72A 2NZHA 3M4OH 3I4NH 4DK3C 2E5LQ 1KIXA 2ZJRA 1OXXK 4BY7H 1XJVA 1GD7A 1VQJA 2K4KA 3TEHB 5GROA 4YWMA 1NMFA 2BA1A 4MTNA 4LF8L 4PZ8A 3J7A5 1YVCA 4L5TA 3BZKA 1AE3A 4J15A 4GNXB 2MO1A 3UDGA 1JB7A 2A19A 4JI6Q 3KFUA 1P8LA 2ZTDA 1PH5A 3HOYH 2I5MX 4GLAC 3BJUA 3CC4A 4QQBX 2K5VA 4IPGA 2UXDL 1IBMQ 3GTQH 1HR0Q 3RLFA 4GNXA 4DR7Q 3CW2C 3F2BA 1KQSA 1B70B 1K8GA 2UXBL 3RZDH 2BA0A 4GKJL 4AIMA 3J81i 4UP7A 1XTDA 1X56A 3KLWA 2OQKA 3K7AH 4A3IH 2D0OA 1XNQL 2K52A 2PQAB 4GLVB 1K3RA 4YWLA 1JE5A 2V1CC 3CMEA 5M3FH 3HOUH 4BBSH 2OTJA 2MFIA 2ZJQA 4L5RC 3TREA 1BBWA 2VS1A 4KHPL 4OX9Q 3OTOL 2JA7G 3HOVG 1VS0A 1UE5A 2WB1E 5LMNW 2VUMH 2PQAA 2VZAA 4A3LG 1CSPA 4B3MQ 1UWVA 4X66L 3ICEA 4DV0L 1N32Q 2Q2UA 1TXYA 2R93G 2K14A 3I4OA 1M1KC 1J6QA 3RLOA 1VQCA 3H3VI 2QGQA 3JAMc 1SROA 3KJPA 3PV0A 3U50C 5IP9H 2AKWB 1PH6A 1T9HA 1EYGA 1Q12A 5GQOA 4LF6L 2R7ZH 4GKKL 1U5KA 4QGUA 4R4TA 3K80C 4LFAQ 1Q1EA 2IHFA 4TVAB 5C0XI 1PH8A 3GTMH 4DV1Q 5C4XG 2F4VQ 1WI5A 5IWAQ 5IY0A 3H0GH 4LF5Q 4A3KH 1VQNA 4B3SQ 4JBMA 4DR3Q 2ZM6L 3G48A 3PUYA 4AQYQ 4YHHL 3PUVA 2ES2A 1X9NA 4A93G 1EQRA 1Y1WG 1CKMA 4HIDA 1VQEA 1AH9A 3FKIH 2HT1A 2VNUD 4BXXG 4KLKA 4QJFA 4DR6Q 4DV6Q 2XTIA 1D7QA 2K75A 5HY6A 1XPOA 5IYCH 3GTGH 4UP9A 3SGIA 3CC2A 2ASBA 3PO3H 4FDBA 4DV4Q 2AHOB 1N9WA 3UE0A 3H15A 5FLMG 1Z47A 1HZCA 4A4IA 4JI1Q 1NBWA 2DGYA 3HKZE 1B8AA 5FJ8H 3CAMA 3T1HQ 1VQOA 3IRBA 4UY8C 1EOVA 1TWFH 2PI2E 4LF9L 4BBSG 2MQHA 3PO2H 4IFDG 2I5LX 3D31A 3KF6A 1NMGA 1VQGA 2RHQB 4JI2Q 3J7ZC 4O0AA 1SRUA 5C44G 3CP0A 3TS2A 1DGSA 5ELOA 1PV4A 4LUOA 3GTOH 1EWIA 1X3EA 2ATWA 4UP8A 4A3EH 1KXLA 3EBEA 4GS3A 2UU9Q 3TQYA 1OXTA 3K0XA 4B3TQ 1PH7A 4JI4L 4DUZL 3BU2A 4IJLA 2CFMA 1XMQQ 4XIGS 3E0EA 4DPGA 1X65A 3TRZA 3ULLA 2KHJA 2UUBL 1WYDA 2N49A 4R4IA 4A3CG 4JV5Q 4JC0A 5FLXc 3I55A 1OXUA 3CCEA 3I4NG 1VQLA 3KF8B 2VQFL 3S24A 1J5EL 1W2BA 4BY7G 4JI3Q 3RR5A 4DV5L 4LFCQ 1QVFA 4XTCS 4DR2L 2CQOA 2IY5B 2CWAA 2C35B 4P71A 1VQDA 1SE8A 2AWNA 5J3BA 1YJ9A 4A3MH 4JI7L 3A5ZB 1IBKL 4JI0L 1YEZA 2NN6I 2R7FA 4DUYL 1VQ4A 1EIFA 3A0JA 1VQKA 2OTLA 4HJ7A 5GADC 4LF4L 5AJ3L 1C0AA 3HOYG 2HHHQ 1Q46A 4HIOA 2UUCL 5C4JH 1YJNA 4A3BH 2UXCL 2CWPA 4JBWA 3CQZH 4GN3B 1XMOQ 1YZ6A 4LF7L 4X65Q 4LNQA 4A3GH 2PMZE 3GTPH 4DNIA 1NJIC 1N36Q 4IFDJ 2R7DA 1L1OB 1WCMH 4UPAA 1VQ9A 4A3GG 3U58A 4A3IG 1UE6A 3HOUG 3S1MH 5M3FG 2DUDA 3B6YA 1I5FA 4B3RQ 3UDXA 4OWWB 1A63A 3GDEA 5HGQA 4JI8Q 3J80i 1X6OA 2WAQE 4LWCA 1L1OA 4C3JH 1L0WA 2VUMG 1FJGQ 1U0LA 3F2CA 1VQ6A 3ERSX 4AH6A 1GO3E 4KI0A 4R4CA 3H3VH 3I56A 3W5OA 1G6PA 3F8TA 2VW9A 3HOXG 1BBUA 1KD1C 2KCMA 1VQAA 1VQ8A 5H1SE 2YU9H 5JEAJ 4HJAA 1NE3A 1X3GA 3FHWA 1PH2A 2HIXA 5IP9G 3CC7A 1E1OA 2UUAL 4C3HH 4LF8Q 4YCVA 2N3SA 2Y0SG 4A3FH 1IYJB 5IP7H 3CCSA 4OWTB 3A74A 2JA8H 1W3SA 1XNRL 3PUXA 3H0GG 2D62A 4A3KG 4WJ3M 1OXVA 4X6AH 4TQUS 1YHAA 5LMUL 3CF5A 4DR1L 2UXDQ 3AYHB 1HZ9A 4DAYB 4LFBQ 1TWGH 1V1QA 5IE8A 1N33L 5EAYA 1LUZA 3K8AA 2UXBQ 4NPSA 4QL5A 4X64L 3FKIG 1XNQQ 3UDIA 1X55A 4NXML 3MEFA 4AYBE 1PYBA 3HOZH 1YBYA 3G71A 4K0KL 2Q2HA 2BH2A 2JK8A 1OTCA 1SLJA 4MNOA 3S14H 1FVIA 1JJ2A 5IYCG 3GTLH 1L1OC 3ULJA 4KHPQ 1OXSC 4X62L 3OTOQ 3E9IA 5C3EG 3G4SA 1R9TH 4LF5L 2B63H 2R92H 3PO3G 1TWAH 4B3SL 4JYAL 2JA5H 4POFA 4DV7Q 1GM5A 4X66Q 3L7ZC 4BA2I 2JA6H 4QY7A 5FJ8G 2Z0SA 1EQQA 1YJWA 2JEAI 2K5NA 1Z9FA
chains in the Genus database with same CATH superfamily
1RDPD 4GN4B 2RKSA 3M4OB 2EY5A 2AWOA 3U4ZA 1HR0W 3C1EA 4TSSA 1G2SA 1JB3A 3AFPA 4A3EG 2YTYA 1QUQB 4MIUA 4A3LH 1AN8A 4A3JH 1ZYRD 1CM9A 4G7ZC 1S40A 4IOCA 1D2BA 3I72A 3CD6A 2VQEL 1IYVA 4YHHQ 1EYAA 1IZ6A 2EQSA 5C5LA 1N34L 1LLRD 1VQ7A 1QUQA 2RCNA 2P5ZX 3ULPA 3DM1A 3AB9A 3VYRA 1VQ5A 1DOKA 2DY8A 5GAHC 4A76A 4A3IB 4B3TL 3UI2A 2IX1A 4KKUA 1SNDA 2F0QA 1XMQL 2JYOA 5G3LF 3M7NA 4JV5L 4KY5A 4CDFC 1Y1WH 5J22A 1QILA 4A3BG 2Z9HA 2SDFA 4LF9Q 3T56B 2JSOA 4R8NA 1MJEA 5JEAG 1AE2A 1WCMG 1HNXL 5E7NA 4HJ5A 2ZXPA 4DV2Q 3SDZA 2CQAA 2QDBA 2R7ZB 5FLMH 3NPPA 5IGCA 3KF8A 4JI4Q 3BVGA 3HKZG 3W1GA 4C3JG 4BS9A 1A0IA 3GTMB 2KENA 3A7LA 1VQMA 2Z6KC 4NXNL 2CVRA 2B63B 5CR3A 3MXGA 4L8JA 4DXFA 2E5LL 4L5SA 2R6GA 4OWXB 3IFDA 3UDFA 3E6ZX 4BBSG 1HH2P 3FKIB 4JI8L 1ML0D 2F0FA 2QEXA 1K0SA 5IP7G 2F0NA 1MI2A 1LTLA 3TSSA 3OYYA 3PMFA 1FR3A 2A5HA 4DR7L 2UXCQ 4LF7Q 3J81c 4IO9A 4A3DH 4OIJA 3VA7A 5D3IB 1O7LA 1BVSA 4OO1G 1KDBA 1U9RA 1PH4A 1VF7A 4OL7A 2F4IA 1P16A 4CDCC 1K3BC 3ER0A 4X3SA 3GTOB 3NTHA 5M5XH 2F0JA 1SJHD 2R92G 5DLQE 2ENBA 3DEOA 4LFBL 5M5WH 2QDLA 2JA6G 1PRTD 4G4KA 1A3TA 2B3GA 1MSHA 2F0PA 1TIID 1AW7A 1LV9A 2H4OA 2WAQG 2LXKA 4L5QA 2F4VL 1HTLD 1K8AC 3STBC 3S1RH 1B50A 4BWGB 5LMUQ 4ZAIA 2BDNA 2B29A 1B3AA 1HQMC 4WJWA 3GQBA 4OONA 1G8ZD 3LGJA 2F3IA 5C4JB 3QR8A 1EY7A 2DY7A 3GTJH 4J8QA 2OWOA 3GTPB 4PNYA 4DAMA 2NZ1D 3TZUA 5IYDG 2L1BA 5CV7A 1A8VA 1Y1VG 4MTKA 5JAVA 3CPWA 3HFZB 3R8BA 3JAML 3FRPB 3T1HL 1YI2A 1M8AA 4IQZA 2YTXA 1Q8KA 1CSQA 2I07B 1RCVD 5COYA 2K50A 4JI2L 2L9HA 3EN2A 1SR3A 4RWSC 1TWHH 2PNHA 3S16H 4K5WA 3PCOB 5M3MG 1PFSA 4CDEC 5M5YH 4OO1I 1XPRA 2PI2A 4APVA 4QUCA 3KLRA 4RKBA 1PH1A 4PMCA 1WJJA 1JMCA 1LYLA 5CYUA 3EROA 2VQEQ 1W6KA 2JA8B 1EFWA 3GO5A 1PHJA 1N34Q 5JJZA 3PGZA 3PIPA 3VR2A 3W3AA 1TWGB 3NQTA 2VB3X 1FYCA 1BKBA 2ICEC 2SEBD 4KHZA 4DUZQ 2I46A 4NDXA 2RDFA 2XN9C 4Y7NH 1RF2D 1EY0A 1KABA 1YNXA 3D3RA 3E9HA 2JJQA 4PZ6A 3NELA 4XYOA 3STBD 2F3WA 1C9OA 2F0IA 5IGFA 3PIO3 4IFDH 1EIHA 4KD3A 3K5LA 2SNSA 1UEBA 4B3RL 1HNXQ 3MXUA 3HKSA 4FVMA 1F2LA 2Q8RE 4S3SA 4A3FG 3GD7A 4OHJA 1S5BD 3TP5A 4K5XA 4P74A 2BCOA 4HJ8A 4A3CH 3CCLA 3CU7A 1CK1A 2CKZB 5EPKA 4NXNQ 1EWCA 2NZHA 3IFTA 1JE4A 4DA2A 3FVQA 1KIXA 2E5LQ 4BY7H 1OXXK 4XXEA 2X6GA 4E6IA 1QB5D 1Y8NB 1C48A 5CV6A 4J15A 4GNXB 1Y8OB 5ELFA 3UDGA 1JB7A 2A19A 5E4XA 2FINB 2I5MX 2EZVA 3BJUA 2B2TA 4ZKCB 4DF7A 4BBRB 3H91A 5I9PA 4GNXA 4DR7Q 4XT3B 5BN5A 3RZDH 1WTVA 4AIMA 3J81i 4ZUJA 4GKJL 2V4DA 3VA5A 1XNQL 2PQAB 5M3FH 2MFIA 2ZJQA 1BBXC 1ENCA 4AYBB 1BBWA 1EYCA 4CKBA 3OTOL 3HOVG 1EIGA 2PQAA 4A3LG 3J81L 3HGBA 1VDZA 3NBIA 4DV0L 2Q2UA 1U4MA 1TXYA 2HQEA 1KNAA 2KJXA 1M1KC 4UHVA 1J6QA 1SMYC 3RLOA 1SNPA 1SROA 2M9VA 3PV0A 4C2MB 2AKWB 4J6HA 3T51B 1T9HA 3I4LA 2R61A 2RA4A 3K80C 5CGKA 1QE6A 4WORA 3NSWA 2LFNA 2F4VQ 1WI5A 5IY0A 1VQNA 4N9TA 1NNXA 3ZYYX 4KKSA 3PUYA 5DNFA 3I70A 2A74C 1B2TA 4ME5A 4Q5VA 1X9NA 1EQRA 3X3MA 1Y1WG 5BN3A 1AH9A 3HP3A 4KLKA 3FMCA 3MHBA 5KYIA 1D7QA 1XPOA 3KBGA 3SGIA 3CC2A 2ASBA 4R8IA 4FDBA 1DOMA 3UE0A 5FLMG 1Z47A 1HCZA 3FEWX 2B2VA 5FJ8H 3T1HQ 3E0JA 5IGEA 1TWFH 5L37A 3J7YW 4KJOA 2I5LX 1NMGA 4JI2Q 1KLGD 2L5TA 3RZDB 4NKLA 3GP7A 2K5DA 2EYPA 2ATWA 4A3EH 5KYLA 2EJFC 3OSOA 5I4DA 2CFMA 4C3IG 1B53A 5C4ZA 1RTOA 1WYDA 5FLXc 4RKLA 4C1NK 3I4NG 1AEXA 1CI3M 4JI3Q 3RR5A 1SMYD 1MHWC 2LS01 3DXJC 4XTCS 3S1QB 4DR2L 5EBCA 4JI7L 2NB0A 4EVOA 4DAVA 1ESRA 5CV5A 3A0JA 2LKVA 2OTLA 4HJ7A 5GADC 1GXDC 4FXKC 1C0AA 1PTOH 3HOYG 4C1NI 4A3BH 3GTQB 3D4DA 4GN3B 3GTKB 1SBBB 1YZ6A 4LNQA 2PMZE 2R7DA 2E2IB 1WCMH 1SFOB 1PDQA 3U58A 4A3GG 1EU3A 1HHVA 1I5FA 3I90A 3UDXA 5EJWA 4I65A 4B3RQ 1PFNA 3GDEA 4Q0FA 1HRJA 1NAPA 2EJGC 1D5XC 2O4XA 1WTOA 3DWPA 1BUVT 3SK8A 4C3JH 1L0WA 1F2YA 2VUMG 1U0LA 3F2CA 4AH6A 4KK7A 1DM0B 5C4XB 4R4CA 3W5OA 3RZOB 5H1SE 5IT9L 2OF1A 4HCEA 4IUVA 1NE3A 5IP9G 2UUAL 4C3HH 1OO9B 1VF5C 4YCVA 1IYJB 5IP7H 1AFPA 3CRLC 5CV4A 3PUXA 1XNRL 3H0GG 2RSOA 3M7GA 1HFGA 2K5QA 4X6AH 4DR1L 4ID6A 3IL8A 1HZ9A 4DAYB 4U68A 5IE8A 1N33L 5EAYA 1L0XB 3K5NA 1E2ZA 1T5EA 1XNQQ 1X55A 1Y69U 4NXML 4K0KL 5IIFA 4OO1H 1TS2A 2BH2A 4MHEA 2BE5C 3S1NB 1PRTB 2WINB 4DAYA 5C44B 1JJ2A 3TP6A 3N52A 3OTOQ 3PO3G 3E9IA 4JYAL 3BYTB 2R92H 2NVXB 1WTRA 5CBAE 1LTRD 3NE5B 2JA6H 1DZ1A 5GQOA 3M3YB 1SYCA 3CCQA 3PO2G 4DR6L 3SEBA 1SAPA 5EKIA 4N9PA 3A54A 1I4RA 3V05A 1ASZA 1GUNA 2PZUA 2WB1G 3FPUB 4K2KA 1X54A 1STHA 2NUCA 4YWKA 2PQEA 1LO5D 3KBXA 1RJTA 3QG1A 1Q81C 4K6LA 2X6LA 3HKZB 4WJ4A 2MPMA 1K28A 3VR6A 2KCNA 2Z6KA 2B8FA 3PIOA 4U673 2EYFA 4EX5A 5IYDH 4ALPA 3U9SA 1EQTA 4JCVE 1K8OA 1EFID 2OCEA 1CQVA 1LABA 2HCCA 3HOUB 1Y1VH 4BBSB 1PZJD 3H09A 4KN4C 1J9OA 2LXJA 3S15H 1NY4A 2A1AA 1QG7A 3P75A 4R1JA 2E74C 3D6WA 4YY3L 4LUZA 2IHEA 2GN5A 1JC7A 1V9PA 3NUCA 4I7AA 4PZ7A 1X3QA 1UE1A 5M3MH 2E2JH 2DNEA 2L0CA 4EQ5A 2A6EC 4O2DA 2BE5D 1CKOA 5CORA 3AMUA 3I73A 3BZCA 1QZHA 4A3KB 3CCMA 1N36L 5CC4A 1GUGA 3PIP3 1GUOA 1ESFA 1LTSD 1LACA 2B2UC 1HPCA 4LW1A 3K81C 1STYA 3M9BA 2FXQA 1FGUA 4DR2Q 3ZJYC 5LHY1 4JI7Q 4JI6L 4IUNA 1I50H 1LT4D 3FP9A 4JI5Q 1CUKA 2WAQB 2QILA 5E3FA 3GTGB 2AQ3B 4P2CB 1C7YA 1A6XA 3OWEB 3NBHB 1RHPA 1EU4A 1C8CA 1HQRD 5HGTA 4NW2A 2KCTA 1JCKB 4IFDI 1LT5D 3HOZG 1QVGA 1D8LA 1LTAD 3NENA 4NB3A 3NBHA 1KC8C 3OPOA 1F9RA 1KNEA 1H95A 4HTHA 3CCRA 4IJHA 2JA5G 5M9OA 1N32L 2QA4A 2F0LA 3AFQA 4KJNA 1WVLA 1ASYA 5K36G 2JE6I 3N6RA 1I4XA 5C0XJ 1UE7A 2UUAQ 4LFAL 5FLXE 4DV1L 1WD1A 1PYSB 1K83H 1FL0A 2ZTEA 2JEBI 5LL6X 3OWFA 5IGBA 1VQFA 4A3MB 4DV7L 1XNRQ 3CCJA 1ICWA 4DR1Q 2JN4A 2FMCA 4GLXA 1N33Q 1AP0A 1A2UA 4KD4A 3DWAA 5C3WA 3BDOA 3CQZB 5KGUA 4NXMQ 4K0KQ 4H02A 2NN6G 2LMCB 1O7ZA 1QOHA 3UE1A 3HOVH 1GKHA 4L6TB 1V43A 2L15A 1RKNA 1Q1BA 4HIKA 2F0SA 2RF4A 2EIFA 4JYAQ 4JI1L 4DNTB 2BDOA 2KA7A 1QZGA 1QJOA 4MZ9A 4WFN3 3I8ZA 3M4PA 3SK6A 3I7FA 3Q8DA 1XWEA 1HUMA 3RN2A 2YU9B 1Q86C 3FPPA 1JWSD 5C3EH 2IT1A 3KF6B 2NYZD 1L0YB 4A3FB 2PPBC 1O78A 2Q2IA 1JWUD 4KN7C 3LWUA 2IL8A 3F1ZA 4JG2A 3QIAA 5C3XA 4R4OA 1TKWB 2LSSA 4LFCL 5IGGA 1JJGA 1VQHA 1RD9D 1U4PA 1HA6A 1PTOC 1E3PA 3L0OA 1RTNA 3PQIA 2QF7A 1K0RA 2WP8J 5I9OA 3S14B 2BH8A 2NVTH 3F2DA 3TS0A 4BY1G 1XMOL 4HIMA 3V96A 4OXPA 2N78A 1TWAB 1E22A 1E24A 2PMZB 4YY3Q 2EYMA 2NZOA 2VQFQ 1J5EQ 2E2HH 1EEFD 3K59A 1SNQA 4KHVA 1KL9A 4C3HG 3HRZC 1YIJA 3I4MH 4IPHA 2Y0SE 3J80c 3OW7A 2D0PA 4R4QA 4C3IH 1ENFA 1Q90A 3J81j 4JOIC 2KUMA 5GAEC 4DU9A 4LF4Q 2GVAA 4LK1C 1F2ZA 1YITA 1SN8A 1S72A 4A3JB 2OT2A 3I4NH 4DK3C 2ZJRA 1XJVA 2O2LD 2RSNA 2K4KA 3EQLC 1JORA 2F1MA 1NMFA 2BA1A 4L5TA 1AE3A 4JI6Q 2ICIA 3HOYH 1A2TA 4GLAC 3HZXA 4QQBX 2K5VA 4QCLA 3VYUA 5DM63 3F2BA 1KQSA 1K8GA 2UXBL 1IW7C 4UP7A 4A3GH 3K7AH 4QUFA 4GLVB 3CMEA 1K3RA 2WV6D 1JE5A 1Y1WB 2F0HA 4L5RC 3TREA 4KHPL 3WDNA 2B2YC 2JA7G 2K28A 2VUMH 1TY2A 1O80A 1KDCA 4ZRZA 1N32Q 2K14A 3ERQA 1NSNS 1DXMA 3KJPA 3U50C 3SK4A 1EL0A 5IP9H 2CW0C 4WRDA 4LF6L 1EYGA 4GKKL 2G9HD 4LFAQ 4OELB 1G91A 2E2HB 1SJED 4TVAB 1PH8A 4DV1Q 3H0GH 4F88A 3OOCA 4HCSA 2J7ZA 1JR0D 2EY6A 3PUVA 5LL6S 2ES2A 4A93G 1CKMA 1VQEA 2XSCA 3O13A 3CRKC 4QJFA 2E75C 2MHVA 2OXPA 2SNMA 4A3DB 1V1PB 2K75A 5HY6A 1CZWA 3PO3H 4HR7B 5J1ZA 2F0EA 1H9JA 3R2TA 3H15A 4HMIA 4RHRA 4A4IA 4JI1Q 3T4AC 2DGYA 3HKZE 4NP5A 3IRBA 4UY8C 1EOVA 3HOYB 5M5XB 2KECA 4OGQC 3PO2H 4KY7A 1AZPA 3QWNA 1B9NA 3J7ZC 1VQGA 3D6CA 3TS2A 5M5WB 3MWYW 1D1KA 1SYBA 2IWHA 1H9SB 1PV4A 1EWIA 1BQQT 3D8GA 4ULLA 3TQYA 1OXTA 4B3TQ 2PZWA 1PH7A 4IJLA 4CJ1B 1XMQQ 4XIGS 4DPGA 1FNWA 1H9SA 1TT2A 3ULLA 4B9XA 1LTBD 2UUBL 4JV5Q 1NR4A 3MVVA 1OXUA 1XXGA 1TU2B 3BVMA 3S1RB 1W2BA 4ILWA 1H9MA 4LFCQ 4P71A 1YJ9A 4K2LA 2K01A 3A5ZB 2CW0D 4JI0L 4DUYL 3GTJB 1DONA 3RMHA 4M8AA 5AJ3L 1CZGA 2UUCL 1TS4A 2PZTA 1XMOQ 4X3UA 1BF4A 1SNCA 4DNIA 1K8MA 1NJIC 3HG9A 1NCVA 3G7LA 1VQ9A 1FNUA 4A3IG 1UE6A 2QEJC 3S1MH 1B4OA 4OWWB 2TSSA 1SSOA 2K05A 4JI8Q 3J80i 2WAQE 1TWHB 3S16B 3FDTA 5C6AA 2KEEA 1VQ6A 2F0VA 5BN4A 4KI0A 5M5YB 3I56A 1BBUA 1KD1C 3SR1A 5JEAJ 2XVSA 1X3GA 2HIXA 2J0TD 1S4ZA 1UUPA 2WKDA 1GUTA 4OWTB 3A74A 3HS0C 2XNAC 1JOOA 2EVBA 4LFBQ 1LUZA 5C4HA 1PFMA 4Y7NB 2UXBQ 4QL5A 1Z7TA 4X64L 3FKIG 5JOBA 2KQ3A 3MAQA 3HOZH 1PYBA 1YBYA 2Q2HA 2JK8A 3OHXC 3GTLH 5IYCG 4KHPQ 1L1OC 1HUNA 4O42A 1PTOF 5A35A 4X62L 5C3EG 1R9TH 4LF5L 4B3SL 2JA5H 3X3NA 4C56C 3DLLA 1GM5A 1CQFA 4QY7A 4DGZA 3Q6SA 2HDLA 1EQQA 1YJWA 3TZDA 2Q8IB 1JOKA 3J80E 2JEAI 5CV9A 5FO8B 1V8QA 1BNZA 5K36H 4DV6L 4K8JA 4LF6Q 1TWCH 4GKKQ 4IPDA 4BY7B 1HNZL 3S2HH 2XRQD 3G6EA 3K0YA 1ET9A 4DKAC 1EEID 3CXCA 4DR5L 3CPFA 1PZKD 1Y14B 1WTQA 4FF3A 2R93H 1LTGD 1F9PA 3DWQA 2K04A 5JVH3 2ID0A 4GN5A 5D14A 3PUZA 1PXUA 3TN2A 2NN6H 3K7UC 2B2UA 4JBKA 2RVLA 2NVQH 5M3FB 3I4MG 3TP8A 3SVMA 1E7ZA 1HNWL 1GUSA 2N88A 1I6HH 1HZAA 5FO7B 3RLNA 1C4QA 5ELCA 4P73A 5JPMC 3KOJA 2BOSA 1QVCA 2I5HA 2YV5A 1NR2A 4ZCKA 3M4QA 3NP8A 4B9WA 4V0BA 1NTGA 3P1HA 3CMAA 1Q82C 3K58A 1ICFB 2GVBA 3GV3A 2Y0SB 4DR4L 3W1BA 4B08A 5EPLA 2ZXOA 4CHTB 2A8VA 2UUBQ 3WOFA 1GHKA 3U4VA 1I4PA 3ONAB 1STAA 3HEJA 3OIQA 5C0XG 3NHHA 1YHBA 1WTXA 4RH6A 4N8FA 4DUYQ 2OEOA 2SOBA 1TS5A 3A7AB 5AJ3Q 4BY1H 1IBML 1BCPF 2UUCQ 1G291 1KDAA 2NVYH 3SE0A 3CCVA 1S5DD 2XWJB 1MD2D 5IOCA 4HN7A 5EKLA 5D65A 3IKJA 1TWFB 3CCUA 1JJCB 1JT8A 4DNRB 1R4PB 2K1BA 1K73C 3MA2B 1YNJC 2KHSA 4B3ML 4A3EB 2I0QA 1S3OA 1B3QA 3BDCA 4GKJQ 3S17H 2NTSA 4RGNA 2EYJA 2E8GA 4RCNA 3BG3A 5GAGC 1STNA 2EYOA 4KV6A 3A5UA 2MUYA 3M85A 3HOXH 2PYKA 4DV0Q 4Y52H 1KAWA 3NWTA 1YNNC 3RNUA 1PTOB 2IX0A 4YCWA 3KDFB 3J7AV 4A3BB 4X64Q 4RG1A 2EXZA 3Q0AA 2O5JC 1WCMB 3RN5A 2JA7H 5EPJA 3C2PA 3KUPA 4PMBA 4DV4L 1SMXA 4X62Q 3KDFA 4BBRG 2EYLA 2L11A 2R3ZA 1MKHA 2RDGA 5T1IA 4DK0A 1G2TA 4GNXC 4V190 2DNCA 3JC66 2XGTA 2WKCA 4K14A 4C3JB 3MC0B 3DHQA 2D5DA 4P72A 4AYBG 3TP7A 4EGVA 1MJCA 5JJLA 3PSIA 5DM73 3A8IE 1HNZQ 2N8NA 1O7IA 1FD7D 4KY6A 1RL2A 1GVPA 4C3HB 1IKMA 4GOPC 2K5WA 4DR5Q 3VDYA 1EIYB 3NK9A 3KJOA 3VR3A 4JOIA 5ELEA 1LM0A 4A93H 1YNJD 4LAAA 3NQIA 1LT6D 4EQNA 3S2DH 5I2XA 5IYBG 1S5CD 2EXDA 4DV2L 1BR9A 1W6JA 3C46A 1PA6A 3A8KE 4HSPA 2F52A 2L55A 3VR4A 3I91A 3MFYA 3G6JB 4KMUC 1K9MC 1L2FA 3CHBD 3P20A 2HHHL 1HNWQ 2EY1A 1HJPA 3HOWH 1PVOA 2R92B 1Q7YC 4IUUA 1G6ZA 1E1TA 1STBA 2JA6B 1YNND 1VMCA 5JJKA 2VB2X 4ZYSA 1VQIA 3MFGA 2L4NA 5FLXL 1I3QH 4DR4Q 4RGMA 1IL8A 2ALYB 3AEVA 3PF4A 3M4OH 1HFNA 2PW7A 2RQXA 1GD7A 1DOLA 4YWMA 1XTCD 4LF8L 3J7A5 4PZ8A 1YVCA 1D5MC 1IHZA 4XDXA 1ET6A 4FYDA 1P8LA 1PH5A 4HMJA 3BS1A 1Y1VB 4IPGA 4CKCA 5KNCA 3S9WA 1IBMQ 4H0LC 1Q3LA 3RLFA 4FF2A 1B70B 3S15B 4A3IH 1U4RA 2JXMB 3E3XA 2OTJA 5IGDA 3TMEA 2VS1A 3K5OA 1DD2A 1VS0A 1UE5A 2WB1E 5LMNW 5M3MB 4B3MQ 2E2JB 4ZK9B 5I2YA 2CH4A 2A6ED 2R93G 1F2MA 4XYQA 3NWSA 3I4OA 1VQCA 3JAMc 1PH6A 2F0UA 2R7ZH 4R4TA 2HUGA 2PO4A 1Q1EA 2IHFA 3C3LA 1EY4A 3GTMH 1ENAA 5C4XG 3DUZA 2ZM6L 1LT3D 2F0WA 3V2TA 1WD0A 1I50B 3C1FA 4JPBW 2CH4W 1MBYA 4ABNA 3FKIH 1XX8A 2HT1A 1U4LA 4PQXA 4BXXG 4DR6Q 2XTIA 3L9AX 3A55A 5IYCH 4UP9A 3QB3A 4DV4Q 2AHOB 4K8IA 2MJ8A 1HZCA 1NBWA 4FP5D 1IKLA 2TMPA 3CAMA 3GV6A 5E1FA 2PCFB 3I3CA 2B2WC 2MQHA 4G57A 3KF6A 1ZKOA 2RHQB 4OEMB 5C44G 3CP0A 5ELBA 4CBVA 4OIKA 5ELOA 4LUOA 3GTOH 1X3EA 2QW7A 3EBEA 4GS3A 3K0XA 2ZT9C 4DUZL 4ZQ3A 2HCIA 3E0EA 4KTAA 1F9SA 1PRTC 2FMMA 4CJ2C 3EVQA 1X65A 3TRZA 2KHJA 2N49A 1K83B 4Z9CB 3TBIB 3CCEA 2A68C 1CHQD 3KF8B 3OMGA 4DV5L 2HDMA 1QVFA 4XQNA 4F7XA 1F9QA 2IY5B 1SE8A 2F0GA 5I6YA 1IBKL 5KNBA 2NN6I 3F2UA 3QJYA 1VQ4A 1S5ED 3HOVB 2HHHQ 1LTTD 1Q46A 1SYFA 4HIOA 5C4JH 4ZLTF 1JICA 2CWPA 3GTPH 1WTPA 1N36Q 4IFDJ 1EQVA 1L1OB 4UPAA 2F03A 3HOUG 1A63A 1A15A 1CA6A 1I4HA 1X6OA 2NTTA 4LWCA 4LJZC 1L1OA 3KLSA 2KCCA 3ERSX 1GO3E 2Z6BA 5C3EB 3H3VH 4X3KA 3HOXG 1DCZA 2KCMA 1UEAB 3IAYA 2F0KA 3SXHA 4DXGA 5C0XH 5DEHA 4LF8Q 1SNOA 3EFXD 1E2WA 2JA8H 1PTOD 1W3SA 4A3KG 4WJ3M 1OXVA 2QCPX 4TQUS 1YHAA 4RA8A 3AYHB 1TWGH 2NVTB 2F0TA 4TRDA 5A2QL 3MEFA 1TY0A 2A68D 1OTCA 4IN3A 1SLJA 4MNOA 3W2DA 5K5PA 1VMPA 2RCFA 1DJRD 3ULJA 4H13C 4FO2A 3BYYB 1UNSA 3G4SA 5FKAC 1BCPC 4POFA 3I4MB 3R93A 4DV7Q 3SK5A 3L7ZC 4C3IB 4BA2I 2Z0SA 3JAMi 1EWHA 2MP1A 3I4NB 3I2ZA 1RIPA 1ONLA 2NBFA 4FXGC 4XT1B 5BR8L 1I4QA 1I94L 1H9RA 2C9OA 2ZM6Q 4X3TA 1V1PA 3HOWG 3T1YL 4RGOS 5A2QE 4DV3L 1CHPD 2ZJPA 1IBLL 3PF5A 1XYIA 1MGSA 4POGA 1QNUA 1WOCA 1IW7D 2YTVA 3NXWA 5FO9B 3K7AB 4A3GB 1MIUA 4A3MG 1I4GA 4BBRH 1KLUD 2IJ0A 3AQQA 2A69C 4EQPA 1SEBD 2Z4IA 1HTPA 4FXDA 2VUMB 4PG3A 1SYDA 4HSVA 1ZXTA 4RMFA 5LMNL 4JI3L 3T13A 4RCOA 1GJXA 1CTMA 5CMDA 4HAEA 3D0FA 3PUWA 5EQ0A 4XQJA 1JQYD 1JOQA 5F2DA 3JAME 2Q2TA 2K5HA 4YCUA 3J7AF 1B7YB 4F87A 5JJIA 1NUCA 5DAUA 1B44D 4YIJA 1KHIA 2J4XA 1WTHA 4C2MH 1BCPD 3H0GB 1I6VC 2JP1A 4BA1I 1BXTA 1PZID 2EDGA 2H1EA 1XPUA 5IYBH 1TVXA 1CA5A 1VCIA 4DV5Q 4ME3A 3RUZA 3MZ5A 3NEMA 4QF4A 4ZKBB 2E2DC 2XWBB 5IT9c 1IBKQ 3QOLA 3ND8A 3VYTA 4P75A 3DM3A 2YYZA 2RHSB 2CCZA 3K5MA 3PO3B 1ILQA 1HR0L 2H5XA 4JVZA 2JQOA 1CFMA 2D9UA 3OMCA 4QB4A 1EY5A 1Q8IA 2HIVA 1H9KA 1EZ6A 4IURA 3J80L 1EOTA 4DK6C 1CKNB 4JK1C 2EOTA 5CBEE 2R7ZG 3PO2B 1EUJA 2PW5A 1SDFA 4OX9L 1SE2A 2L12A 2F0OA 2XIWA 1LTID 1N8RC 2WB1B 1E0BA 2B63G 1KRSA 1CKNA 4IUQA 3OW2A 1E2VA 3VR5A 1STGA 3EIVA 2A69D 1A62A 1VQBA 1DYQA 1X3FA 5ELDA 1B1ZA 2N55A 3DMUA 3WOEA 1YHQA 4GOPB 1ZEQX 2MNAA 2WFWA 2K32A 1VQPA 4FF4A 1Z6HA 5IWAL 2QKIC 4DR3L 3R3OA 4K6DA 4A3JG 4AQYL 4GOPA 1CT1D 2Q8TA 5E4WC 2G5DA 3BZDB 1HZBA 1PRTF 3S1QH 1A3UA 1BOSA 1SE4A 1S5FD 2Z1CA 3SHLA 1O7YA 2RDHA 1TS3A 2AUKA 4QIWE 3Q24A 3EA6A 2GA4B 3K6OA 1IYUA 1EY8A 3S1MB 3GTQH 2M00A 2HQLA 3GTKH 2K03A 3R2IA 1HA5A 1G51A 2E2IH 1WFQA 1SFOH 4HJ9A 2JA9A 5ELNA 2XRSD 2EY2A 2PNRC 1SXTA 2DJGC 3MEHA 2F3VA 4IPCA 4JBJA 1X3PA 4L63B 3H6MA 2DN8A 4A75A 4O1NA 4N8X1 1STEA 1FNVA 1IXRA 1WTWA 2UU9L 1GUWA 5C4XH 2OQ0A 3J81E 5BR8Q 3WWVA 1I94Q 1J8IA 3RZOH 1II3A 1A3VA 1PH3A 3MXNB 2MO0A 3T1YQ 3L2PA 1SYEA 4BXXH 2KEDA 5KRUA 4DV3Q 1IBLQ 1PH9A 4RAUC 3KYHC 2M2LA 4DFAA 3K57A 2VY3A 3NTKA 3LNNA 4LUVA 1EY9A 3MXNA 3HOZB 1X32A 2EYHA 2KBNA 2E76C 2ZTCA 2B39A 2WIIB 2HD3A 5KEEA 3GTLB 1GOZA 2KHIA 1PYWD 2FHTA 4FF1A 1R9TB 4X65L 1IL2A 2JA5B 3MTSA 3S1NH 5C44H 5LMNQ 4A3DG 4PMWA 2IX3A 2KOLA 1R4QB 3T53B 3CKIB 2NVXH 3H3VC 5JVG3 3QO2A 1EY6A 4JI0Q 2ZXRA 1KRTA 4JI5L 1TWCB 4IOAA 2VL6A 1M90C 1FJGL 3S2HB 4HEDA 3M3YH 2JA8G 4G7OC 2AQ1B 3URYA 2AMCB 3U9OA 4F8MA 4I7ZC 3H94A 3D4WA 2R93B 4NMZA 5JEAH 1VQJA 3Q22A 3TEHB 4J1MA 5GROA 4MTNA 5KIXA 2IPKD 4TKOB 1RODA 3BZKA 5TSSA 4H44C 2MO1A 3KFUA 2ZTDA 3CC4A 3A8JE 2NVQB 2UXDL 4EQOA 1HR0Q 2WACA 3CW2C 2FFKB 4CKEA 2BA0A 1I6HB 2A6HC 4LMQD 1XTDA 1X56A 3KLWA 2OQKA 3T16A 2D0OA 2K52A 4YWLA 4DAPA 3HOUH 4BBSH 2V1CC 1JWMD 1KTKA 3L3OC 1F77A 3LX0A 4G7HC 5JPNC 4OX9Q 2A73B 3BVZA 1HXYD 3A56A 5EBDA 2VZAA 1CSPA 4R9WA 1UWVA 3AU7A 4X66L 3ICEA 3D4RA 4MN3A 4CJ0B 4KKTA 1FGBD 3E5SA 4GZYC 5I6WA 1V1OA 2C5CA 2QGQA 1M4VA 3H3VI 1PMRA 2B2WA 5C5MA 4RHSA 2B8GA 1Q12A 1U5KA 4QGUA 1D1IA 1PLFA 5C0XI 5IWAQ 2B2TC 4LF5Q 2EPBA 4A3KH 2G9DA 2X69A 4B3SQ 1T5XD 4JBMA 4DR3Q 3G48A 4AQYQ 2RBMA 4YHHL 5IT9E 3QOJA 5NUCA 4CGYB 4HIDA 4BY1B 2VNUD 5T1GA 5FOBB 1TQOA 2NVYB 4DV6Q 2EJMA 3GTGH 1BO0A 2DJFC 1SE3A 1QWYA 3EJIA 1QNKA 1N9WA 2IW3A 5G3LD 1B8AA 1VQOA 1BDOA 2PI2E 4LF9L 1MSGA 4FNFA 4IFDG 4IUPA 3D31A 4O0AA 1SRUA 4IZ8A 1DGSA 2A6HD 4RFBA 2KVMA 5EKKA 4UP8A 3S17B 1KXLA 2UU9Q 4JI4L 4CDDC 3BU2A 4IUTA 2VXWA 3KLSX 3TDQA 1EZ8A 4A3CG 4R4IA 4JC0A 3BDLA 5AFWA 2D2CC 3I55A 4DK1A 1VQLA 2VQFL 3ND9A 4QMGA 3S24A 1J5EL 3HOXB 4BY7G 1UAPA 2CQOA 3LWEA 2CWAA 2C35B 3KK7A 1VQDA 2AWNA 5J3BA 2Z8LA 4A3MH 2MGSA 1YEZA 2R7FA 1Y8PB 1SYGA 4K5VA 1EIFA 1VQKA 2B2YA 1SNMA 1KAAA 2B2VC 4LF4L 2Z4HA 2NWGA 2JA7B 4UAIA 4DN4M 1YJNA 2UXCL 4JBWA 3CQZH 4LF7L 4ODGA 4X65Q 2EE1A 2LY7A 4H7BA 4RGTA 4UDUC 5IODA 1B9MA 1BCPB 2DUDA 3B6YA 5M3FG 3M4YA 3ITPA 5EGTA 5HGQA 1ZYRC 1AZQA 2AUJD 4JW0A 3MXPA 2K6AA 4XQQA 1ILPA 1FJGQ 3VYSA 3Q23A 2AQ2B 1G6PA 3F8TA 2VW9A 1VQAA 1VQ8A 1D6EC 2CHBD 5KNDA 2YU9H 4A93B 3RD4A 4HJAA 2F0DA 3FHWA 1PH2A 3CC7A 1E1OA 1EYDA 2FJ2A 5FK9C 2N3SA 2Y0SG 3S2DB 2F0MA 4A3FH 3CCSA 3OIPA 2D62A 1PFBA 3P7JA 5LMUL 1TR5A 3CF5A 4IALA 2UXDQ 1V1QA 2K7VA 2O5IC 3K8AA 4NPSA 5HURA 3NTIA 3HOWB 5ISRA 3UDIA 4AYBE 3G71A 4PV1C 1D5ZC 1GHJA 1QCBD 3S14H 4QIWB 1FVIA 1OXSC 5D3DA 2B63H 1TWAH 3DEPA 5J39A 4ZUIA 4X66Q 5FJ8G 2K33A 5CV8A 1I3QB 2K5NA 4M1UB 1Z9FA
chains in the Genus database with same CATH topology
3JAMi 3CCQA 3PO2G 4DR6L 4DV6L 4GN4B 1H95A 4LF6Q 1TWCH 4GKKQ 4IPDA 2AWOA 3U4ZA 3I2ZA 1HR0W 1HNZL 3S2HH 1RIPA 1ASZA 3AFPA 2WB1G 4A3EG 3G6EA 5BR8L 1X54A 2YTYA 1QUQB 4DKAC 4A3LH 3CXCA 4DR5L 3CPFA 1I94L 4YWKA 4A3JH 1S40A 1Y14B 1Q81C 4IOCA 2R93H 2ZM6Q 3CD6A 2VQEL 3HOWG 3T1YL 2ID0A 4GN5A 4YHHQ 4WJ4A 1IZ6A 2EQSA 2Z6KA 3PIOA 2ZJPA 4DV3L 1N34L 1QUQA 3PF5A 1IBLL 1VQ7A 3PUZA 2RCNA 3ULPA 4POGA 1WOCA 4EX5A 5IYDH 4ALPA 3K7UC 1VQ5A 4JBKA 2YTVA 4JCVE 2OCEA 5GAHC 4A76A 1Y1VH 4B3TL 1MIUA 4A3MG 2IX1A 2NVQH 3I4MG 4BBRH 1XMQL 3AQQA 1E7ZA 2LXJA 1HNWL 1I6HH 3M7NA 3S15H 4JV5L 1HZAA 1NY4A 4PG3A 3RLNA 1Y1WH 4A3BG 2A1AA 4R1JA 4RMFA 4P73A 4LF9Q 5LMNL 4YY3L 3KOJA 4JI3L 1QVCA 2I5HA 4LUZA 2IHEA 1MJEA 2GN5A 5JEAG 1AE2A 1V9PA 1WCMG 2YV5A 5E7NA 1HNXL 4PZ7A 3M4QA 1UE1A 4HJ5A 4DV2Q 5M3MH 1NTGA 3D0FA 3PUWA 2E2JH 3CMAA 1Q82C 2GVBA 4EQ5A 2Q2TA 5FLMH 4JI4Q 4DR4L 2K5HA 4O2DA 4YCUA 3W1BA 1B7YB 1CKOA 3HKZG 3W1GA 1A0IA 5JJIA 2KENA 2A8VA 3BZCA 1KHIA 1VQMA 4C2MH 2UUBQ 2Z6KC 4NXNL 1QZHA 3U4VA 3CCMA 2E5LL 1N36L 4L5SA 4BA1I 2R6GA 4OWXB 1XPUA 5IYBH 4LW1A 1VCIA 3UDFA 4DV5Q 3K81C 4ME3A 3M9BA 2FXQA 3NEMA 5C0XG 1HH2P 1FGUA 4DR2Q 1YHBA 3ZJYC 4JI8L 5IT9c 4JI7Q 4JI6L 1IBKQ 2QEXA 5IP7G 4DUYQ 4P75A 1I50H 3FP9A 4JI5Q 3DM3A 2YYZA 1LTLA 1CUKA 2RHSB 2CCZA 3OYYA 5AJ3Q 4BY1H 1IBML 1C7YA 2UUCQ 1G291 1HR0L 2H5XA 4DR7L 2UXCQ 2NVYH 4LF7Q 2JQOA 3NBHB 3J81c 3CCVA 4IO9A 4A3DH 2HIVA 4DK6C 2KCTA 4IFDI 1CKNB 3HOZG 2R7ZG 4OO1G 1BVSA 1EUJA 1QVGA 3CCUA 1JJCB 1D8LA 1JT8A 4OX9L 3NENA 1PH4A 1P16A 4NB3A 1KC8C 1K73C 3ER0A 1N8RC 5M5XH 4B3ML 3CCRA 2B63G 2R92G 1CKNA 1KRSA 5DLQE 4IJHA 2I0QA 2JA5G 1N32L 3OW2A 2QA4A 4LFBL 3EIVA 3AFQA 1S3OA 5M5WH 2JA6G 1A62A 1VQBA 1X3FA 1ASYA 4GKJQ 3S17H 2B3GA 5K36G 2JE6I 5C0XJ 1YHQA 4GOPB 1UE7A 2UUAQ 2MNAA 4LFAL 2WFWA 2E8GA 2WAQG 2LXKA 4DV1L 1VQPA 4L5QA 2F4VL 1PYSB 5GAGC 1K83H 5IWAL 1FL0A 2ZTEA 2JEBI 3A5UA 4DR3L 1VQFA 1K8AC 4DV7L 3STBC 4A3JG 4AQYL 3S1RH 1XNRQ 3M85A 4GOPA 3CCJA 3HOXH 4DV0Q 4Y52H 5LMUQ 1KAWA 4DR1Q 2B29A 1HZBA 4GLXA 3RNUA 3S1QH 1N33Q 4OONA 2IX0A 3LGJA 2F3IA 4YCWA 3KDFB 4X64Q 4RG1A 3GTJH 4NXMQ 2OWOA 4K0KQ 4H02A 4DAMA 2NN6G 4QIWE 5IYDG 3UE1A 3RN5A 2JA7H 3HOVH 1GKHA 1V43A 1A8VA 1Y1VG 1SMXA 2L15A 4DV4L 1Q1BA 4X62Q 2HQLA 2RF4A 3KDFA 4BBRG 2EIFA 4HIKA 3CPWA 3GTKH 4JYAQ 4JI1L 1MKHA 3HFZB 1G51A 4GNXC 3T1HL 1YI2A 2E2IH 1QZGA 1WFQA 1SFOH 3JC66 2XGTA 4HJ9A 2YTXA 4MZ9A 2JA9A 5ELNA 1Q8KA 1CSQA 4JBJA 2K50A 3M4PA 4IPCA 3I7FA 4P72A 4JI2L 4AYBG 4A75A 3EN2A 3Q8DA 1SR3A 5JJLA 1MJCA 1TWHH 2PNHA 3PSIA 3S16H 1IXRA 3RN2A 3PCOB 1HNZQ 5M3MG 2UU9L 1PFSA 5C4XH 1Q86C 2N8NA 5C3EH 5M5YH 4OO1I 2OQ0A 1O7IA 2IT1A 5BR8Q 2PI2A 1RL2A 4APVA 1GVPA 1XPRA 3KF6B 3WWVA 4GOPC 1EIYB 4DR5Q 3VDYA 1PH1A 1I94Q 3RZOH 3KJOA 1WJJA 4JOIA 1JMCA 1LYLA 2Q2IA 1LM0A 4A93H 1PH3A 2VQEQ 3F1ZA 1EFWA 3MXNB 2MO0A 3GO5A 3T1YQ 4JG2A 3L2PA 4BXXH 4DV3Q 4R4OA 1PHJA 1N34Q 3S2DH 3PGZA 1PH9A 3PIPA 1IBLQ 4LFCL 2LSSA 1JJGA 3KYHC 5IYBG 1VQHA 4DV2L 2EXDA 2VY3A 4LUVA 1PA6A 1BKBA 1E3PA 2F52A 3L0OA 1K9MC 4KHZA 2KBNA 4DUZQ 1L2FA 1K0RA 2WP8J 2BH8A 2ZTCA 4Y7NH 3F2DA 2HHHL 2NVTH 1HNWQ 1HJPA 3TS0A 3HOWH 2KHIA 1YNXA 4BY1G 1XMOL 4HIMA 3E9HA 1PVOA 4X65L 4OXPA 2N78A 1Q7YC 1IL2A 2JJQA 4PZ6A 3NELA 1E22A 3STBD 3DLLA 1C9OA 1E24A 3S1NH 5C44H 1E1TA 4YY3Q 5LMNQ 1UEBA 4PMWA 2NZOA 2VQFQ 1J5EQ 2E2HH 4A3DG 4B3RL 1HNXQ 1KL9A 2NVXH 3HKSA 5JJKA 1YIJA 3I4MH 4IPHA 2Y0SE 3J80c 4JI0Q 4A3FG 2D0PA 1VQIA 3GD7A 4R4QA 1KRTA 4JI5L 4C3IH 3J81j 4IOAA 2VL6A 4JOIC 1I3QH 1M90C 1FJGL 4DR4Q 3M3YH 5GAEC 2JA8G 4P74A 4LF4Q 2ALYB 4HJ8A 3CCLA 4A3CH 2GVAA 2CKZB 2AMCB 3AEVA 3PF4A 1YITA 1SN8A 4NXNQ 1S72A 2NZHA 3M4OH 3I4NH 4DK3C 2E5LQ 1KIXA 2ZJRA 1OXXK 4BY7H 1XJVA 1GD7A 1VQJA 2K4KA 3TEHB 5GROA 4YWMA 1NMFA 2BA1A 4MTNA 4LF8L 4PZ8A 3J7A5 1YVCA 4L5TA 3BZKA 1AE3A 4J15A 4GNXB 2MO1A 3UDGA 1JB7A 2A19A 4JI6Q 3KFUA 1P8LA 2ZTDA 1PH5A 3HOYH 2I5MX 4GLAC 3BJUA 3CC4A 4QQBX 2K5VA 4IPGA 2UXDL 1IBMQ 3GTQH 1HR0Q 3RLFA 4GNXA 4DR7Q 3CW2C 3F2BA 1KQSA 1B70B 1K8GA 2UXBL 3RZDH 2BA0A 4GKJL 4AIMA 3J81i 4UP7A 1XTDA 1X56A 3KLWA 2OQKA 3K7AH 4A3IH 2D0OA 1XNQL 2K52A 2PQAB 4GLVB 1K3RA 4YWLA 1JE5A 2V1CC 3CMEA 5M3FH 3HOUH 4BBSH 2OTJA 2MFIA 2ZJQA 4L5RC 3TREA 1BBWA 2VS1A 4KHPL 4OX9Q 3OTOL 2JA7G 3HOVG 1VS0A 1UE5A 2WB1E 5LMNW 2VUMH 2PQAA 2VZAA 4A3LG 1CSPA 4B3MQ 1UWVA 4X66L 3ICEA 4DV0L 1N32Q 2Q2UA 1TXYA 2R93G 2K14A 3I4OA 1M1KC 1J6QA 3RLOA 1VQCA 3H3VI 2QGQA 3JAMc 1SROA 3KJPA 3PV0A 3U50C 5IP9H 2AKWB 1PH6A 1T9HA 1EYGA 1Q12A 5GQOA 4LF6L 2R7ZH 4GKKL 1U5KA 4QGUA 4R4TA 3K80C 4LFAQ 1Q1EA 2IHFA 4TVAB 5C0XI 1PH8A 3GTMH 4DV1Q 5C4XG 2F4VQ 1WI5A 5IWAQ 5IY0A 3H0GH 4LF5Q 4A3KH 1VQNA 4B3SQ 4JBMA 4DR3Q 2ZM6L 3G48A 3PUYA 4AQYQ 4YHHL 3PUVA 2ES2A 1X9NA 4A93G 1EQRA 1Y1WG 1CKMA 4HIDA 1VQEA 1AH9A 3FKIH 2HT1A 2VNUD 4BXXG 4KLKA 4QJFA 4DR6Q 4DV6Q 2XTIA 1D7QA 2K75A 5HY6A 1XPOA 5IYCH 3GTGH 4UP9A 3SGIA 3CC2A 2ASBA 3PO3H 4FDBA 4DV4Q 2AHOB 1N9WA 3UE0A 3H15A 5FLMG 1Z47A 1HZCA 4A4IA 4JI1Q 1NBWA 2DGYA 3HKZE 1B8AA 5FJ8H 3CAMA 3T1HQ 1VQOA 3IRBA 4UY8C 1EOVA 1TWFH 2PI2E 4LF9L 4BBSG 2MQHA 3PO2H 4IFDG 2I5LX 3D31A 3KF6A 1NMGA 1VQGA 2RHQB 4JI2Q 3J7ZC 4O0AA 1SRUA 5C44G 3CP0A 3TS2A 1DGSA 5ELOA 1PV4A 4LUOA 3GTOH 1EWIA 1X3EA 2ATWA 4UP8A 4A3EH 1KXLA 3EBEA 4GS3A 2UU9Q 3TQYA 1OXTA 3K0XA 4B3TQ 1PH7A 4JI4L 4DUZL 3BU2A 4IJLA 2CFMA 1XMQQ 4XIGS 3E0EA 4DPGA 1X65A 3TRZA 3ULLA 2KHJA 2UUBL 1WYDA 2N49A 4R4IA 4A3CG 4JV5Q 4JC0A 5FLXc 3I55A 1OXUA 3CCEA 3I4NG 1VQLA 3KF8B 2VQFL 3S24A 1J5EL 1W2BA 4BY7G 4JI3Q 3RR5A 4DV5L 4LFCQ 1QVFA 4XTCS 4DR2L 2CQOA 2IY5B 2CWAA 2C35B 4P71A 1VQDA 1SE8A 2AWNA 5J3BA 1YJ9A 4A3MH 4JI7L 3A5ZB 1IBKL 4JI0L 1YEZA 2NN6I 2R7FA 4DUYL 1VQ4A 1EIFA 3A0JA 1VQKA 2OTLA 4HJ7A 5GADC 4LF4L 5AJ3L 1C0AA 3HOYG 2HHHQ 1Q46A 4HIOA 2UUCL 5C4JH 1YJNA 4A3BH 2UXCL 2CWPA 4JBWA 3CQZH 4GN3B 1XMOQ 1YZ6A 4LF7L 4X65Q 4LNQA 4A3GH 2PMZE 3GTPH 4DNIA 1NJIC 1N36Q 4IFDJ 2R7DA 1L1OB 1WCMH 4UPAA 1VQ9A 4A3GG 3U58A 4A3IG 1UE6A 3HOUG 3S1MH 5M3FG 2DUDA 3B6YA 1I5FA 4B3RQ 3UDXA 4OWWB 1A63A 3GDEA 5HGQA 4JI8Q 3J80i 1X6OA 2WAQE 4LWCA 1L1OA 4C3JH 1L0WA 2VUMG 1FJGQ 1U0LA 3F2CA 1VQ6A 3ERSX 4AH6A 1GO3E 4KI0A 4R4CA 3H3VH 3I56A 3W5OA 1G6PA 3F8TA 2VW9A 3HOXG 1BBUA 1KD1C 2KCMA 1VQAA 1VQ8A 5H1SE 2YU9H 5JEAJ 4HJAA 1NE3A 1X3GA 3FHWA 1PH2A 2HIXA 5IP9G 3CC7A 1E1OA 2UUAL 4C3HH 4LF8Q 4YCVA 2N3SA 2Y0SG 4A3FH 1IYJB 5IP7H 3CCSA 4OWTB 3A74A 2JA8H 1W3SA 1XNRL 3PUXA 3H0GG 2D62A 4A3KG 4WJ3M 1OXVA 4X6AH 4TQUS 1YHAA 5LMUL 3CF5A 4DR1L 2UXDQ 3AYHB 1HZ9A 4DAYB 4LFBQ 1TWGH 1V1QA 5IE8A 1N33L 5EAYA 1LUZA 3K8AA 2UXBQ 4NPSA 4QL5A 4X64L 3FKIG 1XNQQ 3UDIA 1X55A 4NXML 3MEFA 4AYBE 1PYBA 3HOZH 1YBYA 3G71A 4K0KL 2Q2HA 2BH2A 2JK8A 1OTCA 1SLJA 4MNOA 3S14H 1FVIA 1JJ2A 5IYCG 3GTLH 1L1OC 3ULJA 4KHPQ 1OXSC 4X62L 3OTOQ 3E9IA 5C3EG 3G4SA 1R9TH 4LF5L 2B63H 2R92H 3PO3G 1TWAH 4B3SL 4JYAL 2JA5H 4POFA 4DV7Q 1GM5A 4X66Q 3L7ZC 4BA2I 2JA6H 4QY7A 5FJ8G 2Z0SA 1EQQA 1YJWA 2JEAI 2K5NA 1Z9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM i;  3CCQ A;  3PO2 G;  4DR6 L;  4DV6 L;  4GN4 B;  1H95 A;  4LF6 Q;  1TWC H;  4GKK Q;  4IPD A;  2AWO A;  3U4Z A;  3I2Z A;  1HR0 W;  1HNZ L;  3S2H H;  1RIP A;  1ASZ A;  3AFP A;  2WB1 G;  4A3E G;  3G6E A;  5BR8 L;  1X54 A;  2YTY A;  1QUQ B;  4DKA C;  4A3L H;  3CXC A;  4DR5 L;  3CPF A;  1I94 L;  4YWK A;  4A3J H;  1S40 A;  1Y14 B;  1Q81 C;  4IOC A;  2R93 H;  2ZM6 Q;  3CD6 A;  2VQE L;  3HOW G;  3T1Y L;  2ID0 A;  4GN5 A;  4YHH Q;  4WJ4 A;  1IZ6 A;  2EQS A;  2Z6K A;  3PIO A;  2ZJP A;  4DV3 L;  1N34 L;  1QUQ A;  3PF5 A;  1IBL L;  1VQ7 A;  3PUZ A;  2RCN A;  3ULP A;  4POG A;  1WOC A;  4EX5 A;  5IYD H;  4ALP A;  3K7U C;  1VQ5 A;  4JBK A;  2YTV A;  4JCV E;  2OCE A;  5GAH C;  4A76 A;  1Y1V H;  4B3T L;  1MIU A;  4A3M G;  2IX1 A;  2NVQ H;  3I4M G;  4BBR H;  1XMQ L;  3AQQ A;  1E7Z A;  2LXJ A;  1HNW L;  1I6H H;  3M7N A;  3S15 H;  4JV5 L;  1HZA A;  1NY4 A;  4PG3 A;  3RLN A;  1Y1W H;  4A3B G;  2A1A A;  4R1J A;  4RMF A;  4P73 A;  4LF9 Q;  5LMN L;  4YY3 L;  3KOJ A;  4JI3 L;  1QVC A;  2I5H A;  4LUZ A;  2IHE A;  1MJE A;  2GN5 A;  5JEA G;  1AE2 A;  1V9P A;  1WCM G;  2YV5 A;  5E7N A;  1HNX L;  4PZ7 A;  3M4Q A;  1UE1 A;  4HJ5 A;  4DV2 Q;  5M3M H;  1NTG A;  3D0F A;  3PUW A;  2E2J H;  3CMA A;  1Q82 C;  2GVB A;  4EQ5 A;  2Q2T A;  5FLM H;  4JI4 Q;  4DR4 L;  2K5H A;  4O2D A;  4YCU A;  3W1B A;  1B7Y B;  1CKO A;  3HKZ G;  3W1G A;  1A0I A;  5JJI A;  2KEN A;  2A8V A;  3BZC A;  1KHI A;  1VQM A;  4C2M H;  2UUB Q;  2Z6K C;  4NXN L;  1QZH A;  3U4V A;  3CCM A;  2E5L L;  1N36 L;  4L5S A;  4BA1 I;  2R6G A;  4OWX B;  1XPU A;  5IYB H;  4LW1 A;  1VCI A;  3UDF A;  4DV5 Q;  3K81 C;  4ME3 A;  3M9B A;  2FXQ A;  3NEM A;  5C0X G;  1HH2 P;  1FGU A;  4DR2 Q;  1YHB A;  3ZJY C;  4JI8 L;  5IT9 c;  4JI7 Q;  4JI6 L;  1IBK Q;  2QEX A;  5IP7 G;  4DUY Q;  4P75 A;  1I50 H;  3FP9 A;  4JI5 Q;  3DM3 A;  2YYZ A;  1LTL A;  1CUK A;  2RHS B;  2CCZ A;  3OYY A;  5AJ3 Q;  4BY1 H;  1IBM L;  1C7Y A;  2UUC Q;  1G29 1;  1HR0 L;  2H5X A;  4DR7 L;  2UXC Q;  2NVY H;  4LF7 Q;  2JQO A;  3NBH B;  3J81 c;  3CCV A;  4IO9 A;  4A3D H;  2HIV A;  4DK6 C;  2KCT A;  4IFD I;  1CKN B;  3HOZ G;  2R7Z G;  4OO1 G;  1BVS A;  1EUJ A;  1QVG A;  3CCU A;  1JJC B;  1D8L A;  1JT8 A;  4OX9 L;  3NEN A;  1PH4 A;  1P16 A;  4NB3 A;  1KC8 C;  1K73 C;  3ER0 A;  1N8R C;  5M5X H;  4B3M L;  3CCR A;  2B63 G;  2R92 G;  1CKN A;  1KRS A;  5DLQ E;  4IJH A;  2I0Q A;  2JA5 G;  1N32 L;  3OW2 A;  2QA4 A;  4LFB L;  3EIV A;  3AFQ A;  1S3O A;  5M5W H;  2JA6 G;  1A62 A;  1VQB A;  1X3F A;  1ASY A;  4GKJ Q;  3S17 H;  2B3G A;  5K36 G;  2JE6 I;  5C0X J;  1YHQ A;  4GOP B;  1UE7 A;  2UUA Q;  2MNA A;  4LFA L;  2WFW A;  2E8G A;  2WAQ G;  2LXK A;  4DV1 L;  1VQP A;  4L5Q A;  2F4V L;  1PYS B;  5GAG C;  1K83 H;  5IWA L;  1FL0 A;  2ZTE A;  2JEB I;  3A5U A;  4DR3 L;  1VQF A;  1K8A C;  4DV7 L;  3STB C;  4A3J G;  4AQY L;  3S1R H;  1XNR Q;  3M85 A;  4GOP A;  3CCJ A;  3HOX H;  4DV0 Q;  4Y52 H;  5LMU Q;  1KAW A;  4DR1 Q;  2B29 A;  1HZB A;  4GLX A;  3RNU A;  3S1Q H;  1N33 Q;  4OON A;  2IX0 A;  3LGJ A;  2F3I A;  4YCW A;  3KDF B;  4X64 Q;  4RG1 A;  3GTJ H;  4NXM Q;  2OWO A;  4K0K Q;  4H02 A;  4DAM A;  2NN6 G;  4QIW E;  5IYD G;  3UE1 A;  3RN5 A;  2JA7 H;  3HOV H;  1GKH A;  1V43 A;  1A8V A;  1Y1V G;  1SMX A;  2L15 A;  4DV4 L;  1Q1B A;  4X62 Q;  2HQL A;  2RF4 A;  3KDF A;  4BBR G;  2EIF A;  4HIK A;  3CPW A;  3GTK H;  4JYA Q;  4JI1 L;  1MKH A;  3HFZ B;  1G51 A;  4GNX C;  3T1H L;  1YI2 A;  2E2I H;  1QZG A;  1WFQ A;  1SFO H;  3JC6 6;  2XGT A;  4HJ9 A;  2YTX A;  4MZ9 A;  2JA9 A;  5ELN A;  1Q8K A;  1CSQ A;  4JBJ A;  2K50 A;  3M4P A;  4IPC A;  3I7F A;  4P72 A;  4JI2 L;  4AYB G;  4A75 A;  3EN2 A;  3Q8D A;  1SR3 A;  5JJL A;  1MJC A;  1TWH H;  2PNH A;  3PSI A;  3S16 H;  1IXR A;  3RN2 A;  3PCO B;  1HNZ Q;  5M3M G;  2UU9 L;  1PFS A;  5C4X H;  1Q86 C;  2N8N A;  5C3E H;  5M5Y H;  4OO1 I;  2OQ0 A;  1O7I A;  2IT1 A;  5BR8 Q;  2PI2 A;  1RL2 A;  4APV A;  1GVP A;  1XPR A;  3KF6 B;  3WWV A;  4GOP C;  1EIY B;  4DR5 Q;  3VDY A;  1PH1 A;  1I94 Q;  3RZO H;  3KJO A;  1WJJ A;  4JOI A;  1JMC A;  1LYL A;  2Q2I A;  1LM0 A;  4A93 H;  1PH3 A;  2VQE Q;  3F1Z A;  1EFW A;  3MXN B;  2MO0 A;  3GO5 A;  3T1Y Q;  4JG2 A;  3L2P A;  4BXX H;  4DV3 Q;  4R4O A;  1PHJ A;  1N34 Q;  3S2D H;  3PGZ A;  1PH9 A;  3PIP A;  1IBL Q;  4LFC L;  2LSS A;  1JJG A;  3KYH C;  5IYB G;  1VQH A;  4DV2 L;  2EXD A;  2VY3 A;  4LUV A;  1PA6 A;  1BKB A;  1E3P A;  2F52 A;  3L0O A;  1K9M C;  4KHZ A;  2KBN A;  4DUZ Q;  1L2F A;  1K0R A;  2WP8 J;  2BH8 A;  2ZTC A;  4Y7N H;  3F2D A;  2HHH L;  2NVT H;  1HNW Q;  1HJP A;  3TS0 A;  3HOW H;  2KHI A;  1YNX A;  4BY1 G;  1XMO L;  4HIM A;  3E9H A;  1PVO A;  4X65 L;  4OXP A;  2N78 A;  1Q7Y C;  1IL2 A;  2JJQ A;  4PZ6 A;  3NEL A;  1E22 A;  3STB D;  3DLL A;  1C9O A;  1E24 A;  3S1N H;  5C44 H;  1E1T A;  4YY3 Q;  5LMN Q;  1UEB A;  4PMW A;  2NZO A;  2VQF Q;  1J5E Q;  2E2H H;  4A3D G;  4B3R L;  1HNX Q;  1KL9 A;  2NVX H;  3HKS A;  5JJK A;  1YIJ A;  3I4M H;  4IPH A;  2Y0S E;  3J80 c;  4JI0 Q;  4A3F G;  2D0P A;  1VQI A;  3GD7 A;  4R4Q A;  1KRT A;  4JI5 L;  4C3I H;  3J81 j;  4IOA A;  2VL6 A;  4JOI C;  1I3Q H;  1M90 C;  1FJG L;  4DR4 Q;  3M3Y H;  5GAE C;  2JA8 G;  4P74 A;  4LF4 Q;  2ALY B;  4HJ8 A;  3CCL A;  4A3C H;  2GVA A;  2CKZ B;  2AMC B;  3AEV A;  3PF4 A;  1YIT A;  1SN8 A;  4NXN Q;  1S72 A;  2NZH A;  3M4O H;  3I4N H;  4DK3 C;  2E5L Q;  1KIX A;  2ZJR A;  1OXX K;  4BY7 H;  1XJV A;  1GD7 A;  1VQJ A;  2K4K A;  3TEH B;  5GRO A;  4YWM A;  1NMF A;  2BA1 A;  4MTN A;  4LF8 L;  4PZ8 A;  3J7A 5;  1YVC A;  4L5T A;  3BZK A;  1AE3 A;  4J15 A;  4GNX B;  2MO1 A;  3UDG A;  1JB7 A;  2A19 A;  4JI6 Q;  3KFU A;  1P8L A;  2ZTD A;  1PH5 A;  3HOY H;  2I5M X;  4GLA C;  3BJU A;  3CC4 A;  4QQB X;  2K5V A;  4IPG A;  2UXD L;  1IBM Q;  3GTQ H;  1HR0 Q;  3RLF A;  4GNX A;  4DR7 Q;  3CW2 C;  3F2B A;  1KQS A;  1B70 B;  1K8G A;  2UXB L;  3RZD H;  2BA0 A;  4GKJ L;  4AIM A;  3J81 i;  4UP7 A;  1XTD A;  1X56 A;  3KLW A;  2OQK A;  3K7A H;  4A3I H;  2D0O A;  1XNQ L;  2K52 A;  2PQA B;  4GLV B;  1K3R A;  4YWL A;  1JE5 A;  2V1C C;  3CME A;  5M3F H;  3HOU H;  4BBS H;  2OTJ A;  2MFI A;  2ZJQ A;  4L5R C;  3TRE A;  1BBW A;  2VS1 A;  4KHP L;  4OX9 Q;  3OTO L;  2JA7 G;  3HOV G;  1VS0 A;  1UE5 A;  2WB1 E;  5LMN W;  2VUM H;  2PQA A;  2VZA A;  4A3L G;  1CSP A;  4B3M Q;  1UWV A;  4X66 L;  3ICE A;  4DV0 L;  1N32 Q;  2Q2U A;  1TXY A;  2R93 G;  2K14 A;  3I4O A;  1M1K C;  1J6Q A;  3RLO A;  1VQC A;  3H3V I;  2QGQ A;  3JAM c;  1SRO A;  3KJP A;  3PV0 A;  3U50 C;  5IP9 H;  2AKW B;  1PH6 A;  1T9H A;  1EYG A;  1Q12 A;  5GQO A;  4LF6 L;  2R7Z H;  4GKK L;  1U5K A;  4QGU A;  4R4T A;  3K80 C;  4LFA Q;  1Q1E A;  2IHF A;  4TVA B;  5C0X I;  1PH8 A;  3GTM H;  4DV1 Q;  5C4X G;  2F4V Q;  1WI5 A;  5IWA Q;  5IY0 A;  3H0G H;  4LF5 Q;  4A3K H;  1VQN A;  4B3S Q;  4JBM A;  4DR3 Q;  2ZM6 L;  3G48 A;  3PUY A;  4AQY Q;  4YHH L;  3PUV A;  2ES2 A;  1X9N A;  4A93 G;  1EQR A;  1Y1W G;  1CKM A;  4HID A;  1VQE A;  1AH9 A;  3FKI H;  2HT1 A;  2VNU D;  4BXX G;  4KLK A;  4QJF A;  4DR6 Q;  4DV6 Q;  2XTI A;  1D7Q A;  2K75 A;  5HY6 A;  1XPO A;  5IYC H;  3GTG H;  4UP9 A;  3SGI A;  3CC2 A;  2ASB A;  3PO3 H;  4FDB A;  4DV4 Q;  2AHO B;  1N9W A;  3UE0 A;  3H15 A;  5FLM G;  1Z47 A;  1HZC A;  4A4I A;  4JI1 Q;  1NBW A;  2DGY A;  3HKZ E;  1B8A A;  5FJ8 H;  3CAM A;  3T1H Q;  1VQO A;  3IRB A;  4UY8 C;  1EOV A;  1TWF H;  2PI2 E;  4LF9 L;  4BBS G;  2MQH A;  3PO2 H;  4IFD G;  2I5L X;  3D31 A;  3KF6 A;  1NMG A;  1VQG A;  2RHQ B;  4JI2 Q;  3J7Z C;  4O0A A;  1SRU A;  5C44 G;  3CP0 A;  3TS2 A;  1DGS A;  5ELO A;  1PV4 A;  4LUO A;  3GTO H;  1EWI A;  1X3E A;  2ATW A;  4UP8 A;  4A3E H;  1KXL A;  3EBE A;  4GS3 A;  2UU9 Q;  3TQY A;  1OXT A;  3K0X A;  4B3T Q;  1PH7 A;  4JI4 L;  4DUZ L;  3BU2 A;  4IJL A;  2CFM A;  1XMQ Q;  4XIG S;  3E0E A;  4DPG A;  1X65 A;  3TRZ A;  3ULL A;  2KHJ A;  2UUB L;  1WYD A;  2N49 A;  4R4I A;  4A3C G;  4JV5 Q;  4JC0 A;  5FLX c;  3I55 A;  1OXU A;  3CCE A;  3I4N G;  1VQL A;  3KF8 B;  2VQF L;  3S24 A;  1J5E L;  1W2B A;  4BY7 G;  4JI3 Q;  3RR5 A;  4DV5 L;  4LFC Q;  1QVF A;  4XTC S;  4DR2 L;  2CQO A;  2IY5 B;  2CWA A;  2C35 B;  4P71 A;  1VQD A;  1SE8 A;  2AWN A;  5J3B A;  1YJ9 A;  4A3M H;  4JI7 L;  3A5Z B;  1IBK L;  4JI0 L;  1YEZ A;  2NN6 I;  2R7F A;  4DUY L;  1VQ4 A;  1EIF A;  3A0J A;  1VQK A;  2OTL A;  4HJ7 A;  5GAD C;  4LF4 L;  5AJ3 L;  1C0A A;  3HOY G;  2HHH Q;  1Q46 A;  4HIO A;  2UUC L;  5C4J H;  1YJN A;  4A3B H;  2UXC L;  2CWP A;  4JBW A;  3CQZ H;  4GN3 B;  1XMO Q;  1YZ6 A;  4LF7 L;  4X65 Q;  4LNQ A;  4A3G H;  2PMZ E;  3GTP H;  4DNI A;  1NJI C;  1N36 Q;  4IFD J;  2R7D A;  1L1O B;  1WCM H;  4UPA A;  1VQ9 A;  4A3G G;  3U58 A;  4A3I G;  1UE6 A;  3HOU G;  3S1M H;  5M3F G;  2DUD A;  3B6Y A;  1I5F A;  4B3R Q;  3UDX A;  4OWW B;  1A63 A;  3GDE A;  5HGQ A;  4JI8 Q;  3J80 i;  1X6O A;  2WAQ E;  4LWC A;  1L1O A;  4C3J H;  1L0W A;  2VUM G;  1FJG Q;  1U0L A;  3F2C A;  1VQ6 A;  3ERS X;  4AH6 A;  1GO3 E;  4KI0 A;  4R4C A;  3H3V H;  3I56 A;  3W5O A;  1G6P A;  3F8T A;  2VW9 A;  3HOX G;  1BBU A;  1KD1 C;  2KCM A;  1VQA A;  1VQ8 A;  5H1S E;  2YU9 H;  5JEA J;  4HJA A;  1NE3 A;  1X3G A;  3FHW A;  1PH2 A;  2HIX A;  5IP9 G;  3CC7 A;  1E1O A;  2UUA L;  4C3H H;  4LF8 Q;  4YCV A;  2N3S A;  2Y0S G;  4A3F H;  1IYJ B;  5IP7 H;  3CCS A;  4OWT B;  3A74 A;  2JA8 H;  1W3S A;  1XNR L;  3PUX A;  3H0G G;  2D62 A;  4A3K G;  4WJ3 M;  1OXV A;  4X6A H;  4TQU S;  1YHA A;  5LMU L;  3CF5 A;  4DR1 L;  2UXD Q;  3AYH B;  1HZ9 A;  4DAY B;  4LFB Q;  1TWG H;  1V1Q A;  5IE8 A;  1N33 L;  5EAY A;  1LUZ A;  3K8A A;  2UXB Q;  4NPS A;  4QL5 A;  4X64 L;  3FKI G;  1XNQ Q;  3UDI A;  1X55 A;  4NXM L;  3MEF A;  4AYB E;  1PYB A;  3HOZ H;  1YBY A;  3G71 A;  4K0K L;  2Q2H A;  2BH2 A;  2JK8 A;  1OTC A;  1SLJ A;  4MNO A;  3S14 H;  1FVI A;  1JJ2 A;  5IYC G;  3GTL H;  1L1O C;  3ULJ A;  4KHP Q;  1OXS C;  4X62 L;  3OTO Q;  3E9I A;  5C3E G;  3G4S A;  1R9T H;  4LF5 L;  2B63 H;  2R92 H;  3PO3 G;  1TWA H;  4B3S L;  4JYA L;  2JA5 H;  4POF A;  4DV7 Q;  1GM5 A;  4X66 Q;  3L7Z C;  4BA2 I;  2JA6 H;  4QY7 A;  5FJ8 G;  2Z0S A;  1EQQ A;  1YJW A;  2JEA I;  2K5N A;  1Z9F A; 
#chains in the Genus database with same CATH topology
 1RDP D;  4GN4 B;  2RKS A;  3M4O B;  2EY5 A;  2AWO A;  3U4Z A;  1HR0 W;  3C1E A;  4TSS A;  1G2S A;  1JB3 A;  3AFP A;  4A3E G;  2YTY A;  1QUQ B;  4MIU A;  4A3L H;  1AN8 A;  4A3J H;  1ZYR D;  1CM9 A;  4G7Z C;  1S40 A;  4IOC A;  1D2B A;  3I72 A;  3CD6 A;  2VQE L;  1IYV A;  4YHH Q;  1EYA A;  1IZ6 A;  2EQS A;  5C5L A;  1N34 L;  1LLR D;  1VQ7 A;  1QUQ A;  2RCN A;  2P5Z X;  3ULP A;  3DM1 A;  3AB9 A;  3VYR A;  1VQ5 A;  1DOK A;  2DY8 A;  5GAH C;  4A76 A;  4A3I B;  4B3T L;  3UI2 A;  2IX1 A;  4KKU A;  1SND A;  2F0Q A;  1XMQ L;  2JYO A;  5G3L F;  3M7N A;  4JV5 L;  4KY5 A;  4CDF C;  1Y1W H;  5J22 A;  1QIL A;  4A3B G;  2Z9H A;  2SDF A;  4LF9 Q;  3T56 B;  2JSO A;  4R8N A;  1MJE A;  5JEA G;  1AE2 A;  1WCM G;  1HNX L;  5E7N A;  4HJ5 A;  2ZXP A;  4DV2 Q;  3SDZ A;  2CQA A;  2QDB A;  2R7Z B;  5FLM H;  3NPP A;  5IGC A;  3KF8 A;  4JI4 Q;  3BVG A;  3HKZ G;  3W1G A;  4C3J G;  4BS9 A;  1A0I A;  3GTM B;  2KEN A;  3A7L A;  1VQM A;  2Z6K C;  4NXN L;  2CVR A;  2B63 B;  5CR3 A;  3MXG A;  4L8J A;  4DXF A;  2E5L L;  4L5S A;  2R6G A;  4OWX B;  3IFD A;  3UDF A;  3E6Z X;  4BBS G;  1HH2 P;  3FKI B;  4JI8 L;  1ML0 D;  2F0F A;  2QEX A;  1K0S A;  5IP7 G;  2F0N A;  1MI2 A;  1LTL A;  3TSS A;  3OYY A;  3PMF A;  1FR3 A;  2A5H A;  4DR7 L;  2UXC Q;  4LF7 Q;  3J81 c;  4IO9 A;  4A3D H;  4OIJ A;  3VA7 A;  5D3I B;  1O7L A;  1BVS A;  4OO1 G;  1KDB A;  1U9R A;  1PH4 A;  1VF7 A;  4OL7 A;  2F4I A;  1P16 A;  4CDC C;  1K3B C;  3ER0 A;  4X3S A;  3GTO B;  3NTH A;  5M5X H;  2F0J A;  1SJH D;  2R92 G;  5DLQ E;  2ENB A;  3DEO A;  4LFB L;  5M5W H;  2QDL A;  2JA6 G;  1PRT D;  4G4K A;  1A3T A;  2B3G A;  1MSH A;  2F0P A;  1TII D;  1AW7 A;  1LV9 A;  2H4O A;  2WAQ G;  2LXK A;  4L5Q A;  2F4V L;  1HTL D;  1K8A C;  3STB C;  3S1R H;  1B50 A;  4BWG B;  5LMU Q;  4ZAI A;  2BDN A;  2B29 A;  1B3A A;  1HQM C;  4WJW A;  3GQB A;  4OON A;  1G8Z D;  3LGJ A;  2F3I A;  5C4J B;  3QR8 A;  1EY7 A;  2DY7 A;  3GTJ H;  4J8Q A;  2OWO A;  3GTP B;  4PNY A;  4DAM A;  2NZ1 D;  3TZU A;  5IYD G;  2L1B A;  5CV7 A;  1A8V A;  1Y1V G;  4MTK A;  5JAV A;  3CPW A;  3HFZ B;  3R8B A;  3JAM L;  3FRP B;  3T1H L;  1YI2 A;  1M8A A;  4IQZ A;  2YTX A;  1Q8K A;  1CSQ A;  2I07 B;  1RCV D;  5COY A;  2K50 A;  4JI2 L;  2L9H A;  3EN2 A;  1SR3 A;  4RWS C;  1TWH H;  2PNH A;  3S16 H;  4K5W A;  3PCO B;  5M3M G;  1PFS A;  4CDE C;  5M5Y H;  4OO1 I;  1XPR A;  2PI2 A;  4APV A;  4QUC A;  3KLR A;  4RKB A;  1PH1 A;  4PMC A;  1WJJ A;  1JMC A;  1LYL A;  5CYU A;  3ERO A;  2VQE Q;  1W6K A;  2JA8 B;  1EFW A;  3GO5 A;  1PHJ A;  1N34 Q;  5JJZ A;  3PGZ A;  3PIP A;  3VR2 A;  3W3A A;  1TWG B;  3NQT A;  2VB3 X;  1FYC A;  1BKB A;  2ICE C;  2SEB D;  4KHZ A;  4DUZ Q;  2I46 A;  4NDX A;  2RDF A;  2XN9 C;  4Y7N H;  1RF2 D;  1EY0 A;  1KAB A;  1YNX A;  3D3R A;  3E9H A;  2JJQ A;  4PZ6 A;  3NEL A;  4XYO A;  3STB D;  2F3W A;  1C9O A;  2F0I A;  5IGF A;  3PIO 3;  4IFD H;  1EIH A;  4KD3 A;  3K5L A;  2SNS A;  1UEB A;  4B3R L;  1HNX Q;  3MXU A;  3HKS A;  4FVM A;  1F2L A;  2Q8R E;  4S3S A;  4A3F G;  3GD7 A;  4OHJ A;  1S5B D;  3TP5 A;  4K5X A;  4P74 A;  2BCO A;  4HJ8 A;  4A3C H;  3CCL A;  3CU7 A;  1CK1 A;  2CKZ B;  5EPK A;  4NXN Q;  1EWC A;  2NZH A;  3IFT A;  1JE4 A;  4DA2 A;  3FVQ A;  1KIX A;  2E5L Q;  4BY7 H;  1OXX K;  4XXE A;  2X6G A;  4E6I A;  1QB5 D;  1Y8N B;  1C48 A;  5CV6 A;  4J15 A;  4GNX B;  1Y8O B;  5ELF A;  3UDG A;  1JB7 A;  2A19 A;  5E4X A;  2FIN B;  2I5M X;  2EZV A;  3BJU A;  2B2T A;  4ZKC B;  4DF7 A;  4BBR B;  3H91 A;  5I9P A;  4GNX A;  4DR7 Q;  4XT3 B;  5BN5 A;  3RZD H;  1WTV A;  4AIM A;  3J81 i;  4ZUJ A;  4GKJ L;  2V4D A;  3VA5 A;  1XNQ L;  2PQA B;  5M3F H;  2MFI A;  2ZJQ A;  1BBX C;  1ENC A;  4AYB B;  1BBW A;  1EYC A;  4CKB A;  3OTO L;  3HOV G;  1EIG A;  2PQA A;  4A3L G;  3J81 L;  3HGB A;  1VDZ A;  3NBI A;  4DV0 L;  2Q2U A;  1U4M A;  1TXY A;  2HQE A;  1KNA A;  2KJX A;  1M1K C;  4UHV A;  1J6Q A;  1SMY C;  3RLO A;  1SNP A;  1SRO A;  2M9V A;  3PV0 A;  4C2M B;  2AKW B;  4J6H A;  3T51 B;  1T9H A;  3I4L A;  2R61 A;  2RA4 A;  3K80 C;  5CGK A;  1QE6 A;  4WOR A;  3NSW A;  2LFN A;  2F4V Q;  1WI5 A;  5IY0 A;  1VQN A;  4N9T A;  1NNX A;  3ZYY X;  4KKS A;  3PUY A;  5DNF A;  3I70 A;  2A74 C;  1B2T A;  4ME5 A;  4Q5V A;  1X9N A;  1EQR A;  3X3M A;  1Y1W G;  5BN3 A;  1AH9 A;  3HP3 A;  4KLK A;  3FMC A;  3MHB A;  5KYI A;  1D7Q A;  1XPO A;  3KBG A;  3SGI A;  3CC2 A;  2ASB A;  4R8I A;  4FDB A;  1DOM A;  3UE0 A;  5FLM G;  1Z47 A;  1HCZ A;  3FEW X;  2B2V A;  5FJ8 H;  3T1H Q;  3E0J A;  5IGE A;  1TWF H;  5L37 A;  3J7Y W;  4KJO A;  2I5L X;  1NMG A;  4JI2 Q;  1KLG D;  2L5T A;  3RZD B;  4NKL A;  3GP7 A;  2K5D A;  2EYP A;  2ATW A;  4A3E H;  5KYL A;  2EJF C;  3OSO A;  5I4D A;  2CFM A;  4C3I G;  1B53 A;  5C4Z A;  1RTO A;  1WYD A;  5FLX c;  4RKL A;  4C1N K;  3I4N G;  1AEX A;  1CI3 M;  4JI3 Q;  3RR5 A;  1SMY D;  1MHW C;  2LS0 1;  3DXJ C;  4XTC S;  3S1Q B;  4DR2 L;  5EBC A;  4JI7 L;  2NB0 A;  4EVO A;  4DAV A;  1ESR A;  5CV5 A;  3A0J A;  2LKV A;  2OTL A;  4HJ7 A;  5GAD C;  1GXD C;  4FXK C;  1C0A A;  1PTO H;  3HOY G;  4C1N I;  4A3B H;  3GTQ B;  3D4D A;  4GN3 B;  3GTK B;  1SBB B;  1YZ6 A;  4LNQ A;  2PMZ E;  2R7D A;  2E2I B;  1WCM H;  1SFO B;  1PDQ A;  3U58 A;  4A3G G;  1EU3 A;  1HHV A;  1I5F A;  3I90 A;  3UDX A;  5EJW A;  4I65 A;  4B3R Q;  1PFN A;  3GDE A;  4Q0F A;  1HRJ A;  1NAP A;  2EJG C;  1D5X C;  2O4X A;  1WTO A;  3DWP A;  1BUV T;  3SK8 A;  4C3J H;  1L0W A;  1F2Y A;  2VUM G;  1U0L A;  3F2C A;  4AH6 A;  4KK7 A;  1DM0 B;  5C4X B;  4R4C A;  3W5O A;  3RZO B;  5H1S E;  5IT9 L;  2OF1 A;  4HCE A;  4IUV A;  1NE3 A;  5IP9 G;  2UUA L;  4C3H H;  1OO9 B;  1VF5 C;  4YCV A;  1IYJ B;  5IP7 H;  1AFP A;  3CRL C;  5CV4 A;  3PUX A;  1XNR L;  3H0G G;  2RSO A;  3M7G A;  1HFG A;  2K5Q A;  4X6A H;  4DR1 L;  4ID6 A;  3IL8 A;  1HZ9 A;  4DAY B;  4U68 A;  5IE8 A;  1N33 L;  5EAY A;  1L0X B;  3K5N A;  1E2Z A;  1T5E A;  1XNQ Q;  1X55 A;  1Y69 U;  4NXM L;  4K0K L;  5IIF A;  4OO1 H;  1TS2 A;  2BH2 A;  4MHE A;  2BE5 C;  3S1N B;  1PRT B;  2WIN B;  4DAY A;  5C44 B;  1JJ2 A;  3TP6 A;  3N52 A;  3OTO Q;  3PO3 G;  3E9I A;  4JYA L;  3BYT B;  2R92 H;  2NVX B;  1WTR A;  5CBA E;  1LTR D;  3NE5 B;  2JA6 H;  1DZ1 A;  5GQO A;  3M3Y B;  1SYC A;  3CCQ A;  3PO2 G;  4DR6 L;  3SEB A;  1SAP A;  5EKI A;  4N9P A;  3A54 A;  1I4R A;  3V05 A;  1ASZ A;  1GUN A;  2PZU A;  2WB1 G;  3FPU B;  4K2K A;  1X54 A;  1STH A;  2NUC A;  4YWK A;  2PQE A;  1LO5 D;  3KBX A;  1RJT A;  3QG1 A;  1Q81 C;  4K6L A;  2X6L A;  3HKZ B;  4WJ4 A;  2MPM A;  1K28 A;  3VR6 A;  2KCN A;  2Z6K A;  2B8F A;  3PIO A;  4U67 3;  2EYF A;  4EX5 A;  5IYD H;  4ALP A;  3U9S A;  1EQT A;  4JCV E;  1K8O A;  1EFI D;  2OCE A;  1CQV A;  1LAB A;  2HCC A;  3HOU B;  1Y1V H;  4BBS B;  1PZJ D;  3H09 A;  4KN4 C;  1J9O A;  2LXJ A;  3S15 H;  1NY4 A;  2A1A A;  1QG7 A;  3P75 A;  4R1J A;  2E74 C;  3D6W A;  4YY3 L;  4LUZ A;  2IHE A;  2GN5 A;  1JC7 A;  1V9P A;  3NUC A;  4I7A A;  4PZ7 A;  1X3Q A;  1UE1 A;  5M3M H;  2E2J H;  2DNE A;  2L0C A;  4EQ5 A;  2A6E C;  4O2D A;  2BE5 D;  1CKO A;  5COR A;  3AMU A;  3I73 A;  3BZC A;  1QZH A;  4A3K B;  3CCM A;  1N36 L;  5CC4 A;  1GUG A;  3PIP 3;  1GUO A;  1ESF A;  1LTS D;  1LAC A;  2B2U C;  1HPC A;  4LW1 A;  3K81 C;  1STY A;  3M9B A;  2FXQ A;  1FGU A;  4DR2 Q;  3ZJY C;  5LHY 1;  4JI7 Q;  4JI6 L;  4IUN A;  1I50 H;  1LT4 D;  3FP9 A;  4JI5 Q;  1CUK A;  2WAQ B;  2QIL A;  5E3F A;  3GTG B;  2AQ3 B;  4P2C B;  1C7Y A;  1A6X A;  3OWE B;  3NBH B;  1RHP A;  1EU4 A;  1C8C A;  1HQR D;  5HGT A;  4NW2 A;  2KCT A;  1JCK B;  4IFD I;  1LT5 D;  3HOZ G;  1QVG A;  1D8L A;  1LTA D;  3NEN A;  4NB3 A;  3NBH A;  1KC8 C;  3OPO A;  1F9R A;  1KNE A;  1H95 A;  4HTH A;  3CCR A;  4IJH A;  2JA5 G;  5M9O A;  1N32 L;  2QA4 A;  2F0L A;  3AFQ A;  4KJN A;  1WVL A;  1ASY A;  5K36 G;  2JE6 I;  3N6R A;  1I4X A;  5C0X J;  1UE7 A;  2UUA Q;  4LFA L;  5FLX E;  4DV1 L;  1WD1 A;  1PYS B;  1K83 H;  1FL0 A;  2ZTE A;  2JEB I;  5LL6 X;  3OWF A;  5IGB A;  1VQF A;  4A3M B;  4DV7 L;  1XNR Q;  3CCJ A;  1ICW A;  4DR1 Q;  2JN4 A;  2FMC A;  4GLX A;  1N33 Q;  1AP0 A;  1A2U A;  4KD4 A;  3DWA A;  5C3W A;  3BDO A;  3CQZ B;  5KGU A;  4NXM Q;  4K0K Q;  4H02 A;  2NN6 G;  2LMC B;  1O7Z A;  1QOH A;  3UE1 A;  3HOV H;  1GKH A;  4L6T B;  1V43 A;  2L15 A;  1RKN A;  1Q1B A;  4HIK A;  2F0S A;  2RF4 A;  2EIF A;  4JYA Q;  4JI1 L;  4DNT B;  2BDO A;  2KA7 A;  1QZG A;  1QJO A;  4MZ9 A;  4WFN 3;  3I8Z A;  3M4P A;  3SK6 A;  3I7F A;  3Q8D A;  1XWE A;  1HUM A;  3RN2 A;  2YU9 B;  1Q86 C;  3FPP A;  1JWS D;  5C3E H;  2IT1 A;  3KF6 B;  2NYZ D;  1L0Y B;  4A3F B;  2PPB C;  1O78 A;  2Q2I A;  1JWU D;  4KN7 C;  3LWU A;  2IL8 A;  3F1Z A;  4JG2 A;  3QIA A;  5C3X A;  4R4O A;  1TKW B;  2LSS A;  4LFC L;  5IGG A;  1JJG A;  1VQH A;  1RD9 D;  1U4P A;  1HA6 A;  1PTO C;  1E3P A;  3L0O A;  1RTN A;  3PQI A;  2QF7 A;  1K0R A;  2WP8 J;  5I9O A;  3S14 B;  2BH8 A;  2NVT H;  3F2D A;  3TS0 A;  4BY1 G;  1XMO L;  4HIM A;  3V96 A;  4OXP A;  2N78 A;  1TWA B;  1E22 A;  1E24 A;  2PMZ B;  4YY3 Q;  2EYM A;  2NZO A;  2VQF Q;  1J5E Q;  2E2H H;  1EEF D;  3K59 A;  1SNQ A;  4KHV A;  1KL9 A;  4C3H G;  3HRZ C;  1YIJ A;  3I4M H;  4IPH A;  2Y0S E;  3J80 c;  3OW7 A;  2D0P A;  4R4Q A;  4C3I H;  1ENF A;  1Q90 A;  3J81 j;  4JOI C;  2KUM A;  5GAE C;  4DU9 A;  4LF4 Q;  2GVA A;  4LK1 C;  1F2Z A;  1YIT A;  1SN8 A;  1S72 A;  4A3J B;  2OT2 A;  3I4N H;  4DK3 C;  2ZJR A;  1XJV A;  2O2L D;  2RSN A;  2K4K A;  3EQL C;  1JOR A;  2F1M A;  1NMF A;  2BA1 A;  4L5T A;  1AE3 A;  4JI6 Q;  2ICI A;  3HOY H;  1A2T A;  4GLA C;  3HZX A;  4QQB X;  2K5V A;  4QCL A;  3VYU A;  5DM6 3;  3F2B A;  1KQS A;  1K8G A;  2UXB L;  1IW7 C;  4UP7 A;  4A3G H;  3K7A H;  4QUF A;  4GLV B;  3CME A;  1K3R A;  2WV6 D;  1JE5 A;  1Y1W B;  2F0H A;  4L5R C;  3TRE A;  4KHP L;  3WDN A;  2B2Y C;  2JA7 G;  2K28 A;  2VUM H;  1TY2 A;  1O80 A;  1KDC A;  4ZRZ A;  1N32 Q;  2K14 A;  3ERQ A;  1NSN S;  1DXM A;  3KJP A;  3U50 C;  3SK4 A;  1EL0 A;  5IP9 H;  2CW0 C;  4WRD A;  4LF6 L;  1EYG A;  4GKK L;  2G9H D;  4LFA Q;  4OEL B;  1G91 A;  2E2H B;  1SJE D;  4TVA B;  1PH8 A;  4DV1 Q;  3H0G H;  4F88 A;  3OOC A;  4HCS A;  2J7Z A;  1JR0 D;  2EY6 A;  3PUV A;  5LL6 S;  2ES2 A;  4A93 G;  1CKM A;  1VQE A;  2XSC A;  3O13 A;  3CRK C;  4QJF A;  2E75 C;  2MHV A;  2OXP A;  2SNM A;  4A3D B;  1V1P B;  2K75 A;  5HY6 A;  1CZW A;  3PO3 H;  4HR7 B;  5J1Z A;  2F0E A;  1H9J A;  3R2T A;  3H15 A;  4HMI A;  4RHR A;  4A4I A;  4JI1 Q;  3T4A C;  2DGY A;  3HKZ E;  4NP5 A;  3IRB A;  4UY8 C;  1EOV A;  3HOY B;  5M5X B;  2KEC A;  4OGQ C;  3PO2 H;  4KY7 A;  1AZP A;  3QWN A;  1B9N A;  3J7Z C;  1VQG A;  3D6C A;  3TS2 A;  5M5W B;  3MWY W;  1D1K A;  1SYB A;  2IWH A;  1H9S B;  1PV4 A;  1EWI A;  1BQQ T;  3D8G A;  4ULL A;  3TQY A;  1OXT A;  4B3T Q;  2PZW A;  1PH7 A;  4IJL A;  4CJ1 B;  1XMQ Q;  4XIG S;  4DPG A;  1FNW A;  1H9S A;  1TT2 A;  3ULL A;  4B9X A;  1LTB D;  2UUB L;  4JV5 Q;  1NR4 A;  3MVV A;  1OXU A;  1XXG A;  1TU2 B;  3BVM A;  3S1R B;  1W2B A;  4ILW A;  1H9M A;  4LFC Q;  4P71 A;  1YJ9 A;  4K2L A;  2K01 A;  3A5Z B;  2CW0 D;  4JI0 L;  4DUY L;  3GTJ B;  1DON A;  3RMH A;  4M8A A;  5AJ3 L;  1CZG A;  2UUC L;  1TS4 A;  2PZT A;  1XMO Q;  4X3U A;  1BF4 A;  1SNC A;  4DNI A;  1K8M A;  1NJI C;  3HG9 A;  1NCV A;  3G7L A;  1VQ9 A;  1FNU A;  4A3I G;  1UE6 A;  2QEJ C;  3S1M H;  1B4O A;  4OWW B;  2TSS A;  1SSO A;  2K05 A;  4JI8 Q;  3J80 i;  2WAQ E;  1TWH B;  3S16 B;  3FDT A;  5C6A A;  2KEE A;  1VQ6 A;  2F0V A;  5BN4 A;  4KI0 A;  5M5Y B;  3I56 A;  1BBU A;  1KD1 C;  3SR1 A;  5JEA J;  2XVS A;  1X3G A;  2HIX A;  2J0T D;  1S4Z A;  1UUP A;  2WKD A;  1GUT A;  4OWT B;  3A74 A;  3HS0 C;  2XNA C;  1JOO A;  2EVB A;  4LFB Q;  1LUZ A;  5C4H A;  1PFM A;  4Y7N B;  2UXB Q;  4QL5 A;  1Z7T A;  4X64 L;  3FKI G;  5JOB A;  2KQ3 A;  3MAQ A;  3HOZ H;  1PYB A;  1YBY A;  2Q2H A;  2JK8 A;  3OHX C;  3GTL H;  5IYC G;  4KHP Q;  1L1O C;  1HUN A;  4O42 A;  1PTO F;  5A35 A;  4X62 L;  5C3E G;  1R9T H;  4LF5 L;  4B3S L;  2JA5 H;  3X3N A;  4C56 C;  3DLL A;  1GM5 A;  1CQF A;  4QY7 A;  4DGZ A;  3Q6S A;  2HDL A;  1EQQ A;  1YJW A;  3TZD A;  2Q8I B;  1JOK A;  3J80 E;  2JEA I;  5CV9 A;  5FO8 B;  1V8Q A;  1BNZ A;  5K36 H;  4DV6 L;  4K8J A;  4LF6 Q;  1TWC H;  4GKK Q;  4IPD A;  4BY7 B;  1HNZ L;  3S2H H;  2XRQ D;  3G6E A;  3K0Y A;  1ET9 A;  4DKA C;  1EEI D;  3CXC A;  4DR5 L;  3CPF A;  1PZK D;  1Y14 B;  1WTQ A;  4FF3 A;  2R93 H;  1LTG D;  1F9P A;  3DWQ A;  2K04 A;  5JVH 3;  2ID0 A;  4GN5 A;  5D14 A;  3PUZ A;  1PXU A;  3TN2 A;  2NN6 H;  3K7U C;  2B2U A;  4JBK A;  2RVL A;  2NVQ H;  5M3F B;  3I4M G;  3TP8 A;  3SVM A;  1E7Z A;  1HNW L;  1GUS A;  2N88 A;  1I6H H;  1HZA A;  5FO7 B;  3RLN A;  1C4Q A;  5ELC A;  4P73 A;  5JPM C;  3KOJ A;  2BOS A;  1QVC A;  2I5H A;  2YV5 A;  1NR2 A;  4ZCK A;  3M4Q A;  3NP8 A;  4B9W A;  4V0B A;  1NTG A;  3P1H A;  3CMA A;  1Q82 C;  3K58 A;  1ICF B;  2GVB A;  3GV3 A;  2Y0S B;  4DR4 L;  3W1B A;  4B08 A;  5EPL A;  2ZXO A;  4CHT B;  2A8V A;  2UUB Q;  3WOF A;  1GHK A;  3U4V A;  1I4P A;  3ONA B;  1STA A;  3HEJ A;  3OIQ A;  5C0X G;  3NHH A;  1YHB A;  1WTX A;  4RH6 A;  4N8F A;  4DUY Q;  2OEO A;  2SOB A;  1TS5 A;  3A7A B;  5AJ3 Q;  4BY1 H;  1IBM L;  1BCP F;  2UUC Q;  1G29 1;  1KDA A;  2NVY H;  3SE0 A;  3CCV A;  1S5D D;  2XWJ B;  1MD2 D;  5IOC A;  4HN7 A;  5EKL A;  5D65 A;  3IKJ A;  1TWF B;  3CCU A;  1JJC B;  1JT8 A;  4DNR B;  1R4P B;  2K1B A;  1K73 C;  3MA2 B;  1YNJ C;  2KHS A;  4B3M L;  4A3E B;  2I0Q A;  1S3O A;  1B3Q A;  3BDC A;  4GKJ Q;  3S17 H;  2NTS A;  4RGN A;  2EYJ A;  2E8G A;  4RCN A;  3BG3 A;  5GAG C;  1STN A;  2EYO A;  4KV6 A;  3A5U A;  2MUY A;  3M85 A;  3HOX H;  2PYK A;  4DV0 Q;  4Y52 H;  1KAW A;  3NWT A;  1YNN C;  3RNU A;  1PTO B;  2IX0 A;  4YCW A;  3KDF B;  3J7A V;  4A3B B;  4X64 Q;  4RG1 A;  2EXZ A;  3Q0A A;  2O5J C;  1WCM B;  3RN5 A;  2JA7 H;  5EPJ A;  3C2P A;  3KUP A;  4PMB A;  4DV4 L;  1SMX A;  4X62 Q;  3KDF A;  4BBR G;  2EYL A;  2L11 A;  2R3Z A;  1MKH A;  2RDG A;  5T1I A;  4DK0 A;  1G2T A;  4GNX C;  4V19 0;  2DNC A;  3JC6 6;  2XGT A;  2WKC A;  4K14 A;  4C3J B;  3MC0 B;  3DHQ A;  2D5D A;  4P72 A;  4AYB G;  3TP7 A;  4EGV A;  1MJC A;  5JJL A;  3PSI A;  5DM7 3;  3A8I E;  1HNZ Q;  2N8N A;  1O7I A;  1FD7 D;  4KY6 A;  1RL2 A;  1GVP A;  4C3H B;  1IKM A;  4GOP C;  2K5W A;  4DR5 Q;  3VDY A;  1EIY B;  3NK9 A;  3KJO A;  3VR3 A;  4JOI A;  5ELE A;  1LM0 A;  4A93 H;  1YNJ D;  4LAA A;  3NQI A;  1LT6 D;  4EQN A;  3S2D H;  5I2X A;  5IYB G;  1S5C D;  2EXD A;  4DV2 L;  1BR9 A;  1W6J A;  3C46 A;  1PA6 A;  3A8K E;  4HSP A;  2F52 A;  2L55 A;  3VR4 A;  3I91 A;  3MFY A;  3G6J B;  4KMU C;  1K9M C;  1L2F A;  3CHB D;  3P20 A;  2HHH L;  1HNW Q;  2EY1 A;  1HJP A;  3HOW H;  1PVO A;  2R92 B;  1Q7Y C;  4IUU A;  1G6Z A;  1E1T A;  1STB A;  2JA6 B;  1YNN D;  1VMC A;  5JJK A;  2VB2 X;  4ZYS A;  1VQI A;  3MFG A;  2L4N A;  5FLX L;  1I3Q H;  4DR4 Q;  4RGM A;  1IL8 A;  2ALY B;  3AEV A;  3PF4 A;  3M4O H;  1HFN A;  2PW7 A;  2RQX A;  1GD7 A;  1DOL A;  4YWM A;  1XTC D;  4LF8 L;  3J7A 5;  4PZ8 A;  1YVC A;  1D5M C;  1IHZ A;  4XDX A;  1ET6 A;  4FYD A;  1P8L A;  1PH5 A;  4HMJ A;  3BS1 A;  1Y1V B;  4IPG A;  4CKC A;  5KNC A;  3S9W A;  1IBM Q;  4H0L C;  1Q3L A;  3RLF A;  4FF2 A;  1B70 B;  3S15 B;  4A3I H;  1U4R A;  2JXM B;  3E3X A;  2OTJ A;  5IGD A;  3TME A;  2VS1 A;  3K5O A;  1DD2 A;  1VS0 A;  1UE5 A;  2WB1 E;  5LMN W;  5M3M B;  4B3M Q;  2E2J B;  4ZK9 B;  5I2Y A;  2CH4 A;  2A6E D;  2R93 G;  1F2M A;  4XYQ A;  3NWS A;  3I4O A;  1VQC A;  3JAM c;  1PH6 A;  2F0U A;  2R7Z H;  4R4T A;  2HUG A;  2PO4 A;  1Q1E A;  2IHF A;  3C3L A;  1EY4 A;  3GTM H;  1ENA A;  5C4X G;  3DUZ A;  2ZM6 L;  1LT3 D;  2F0W A;  3V2T A;  1WD0 A;  1I50 B;  3C1F A;  4JPB W;  2CH4 W;  1MBY A;  4ABN A;  3FKI H;  1XX8 A;  2HT1 A;  1U4L A;  4PQX A;  4BXX G;  4DR6 Q;  2XTI A;  3L9A X;  3A55 A;  5IYC H;  4UP9 A;  3QB3 A;  4DV4 Q;  2AHO B;  4K8I A;  2MJ8 A;  1HZC A;  1NBW A;  4FP5 D;  1IKL A;  2TMP A;  3CAM A;  3GV6 A;  5E1F A;  2PCF B;  3I3C A;  2B2W C;  2MQH A;  4G57 A;  3KF6 A;  1ZKO A;  2RHQ B;  4OEM B;  5C44 G;  3CP0 A;  5ELB A;  4CBV A;  4OIK A;  5ELO A;  4LUO A;  3GTO H;  1X3E A;  2QW7 A;  3EBE A;  4GS3 A;  3K0X A;  2ZT9 C;  4DUZ L;  4ZQ3 A;  2HCI A;  3E0E A;  4KTA A;  1F9S A;  1PRT C;  2FMM A;  4CJ2 C;  3EVQ A;  1X65 A;  3TRZ A;  2KHJ A;  2N49 A;  1K83 B;  4Z9C B;  3TBI B;  3CCE A;  2A68 C;  1CHQ D;  3KF8 B;  3OMG A;  4DV5 L;  2HDM A;  1QVF A;  4XQN A;  4F7X A;  1F9Q A;  2IY5 B;  1SE8 A;  2F0G A;  5I6Y A;  1IBK L;  5KNB A;  2NN6 I;  3F2U A;  3QJY A;  1VQ4 A;  1S5E D;  3HOV B;  2HHH Q;  1LTT D;  1Q46 A;  1SYF A;  4HIO A;  5C4J H;  4ZLT F;  1JIC A;  2CWP A;  3GTP H;  1WTP A;  1N36 Q;  4IFD J;  1EQV A;  1L1O B;  4UPA A;  2F03 A;  3HOU G;  1A63 A;  1A15 A;  1CA6 A;  1I4H A;  1X6O A;  2NTT A;  4LWC A;  4LJZ C;  1L1O A;  3KLS A;  2KCC A;  3ERS X;  1GO3 E;  2Z6B A;  5C3E B;  3H3V H;  4X3K A;  3HOX G;  1DCZ A;  2KCM A;  1UEA B;  3IAY A;  2F0K A;  3SXH A;  4DXG A;  5C0X H;  5DEH A;  4LF8 Q;  1SNO A;  3EFX D;  1E2W A;  2JA8 H;  1PTO D;  1W3S A;  4A3K G;  4WJ3 M;  1OXV A;  2QCP X;  4TQU S;  1YHA A;  4RA8 A;  3AYH B;  1TWG H;  2NVT B;  2F0T A;  4TRD A;  5A2Q L;  3MEF A;  1TY0 A;  2A68 D;  1OTC A;  4IN3 A;  1SLJ A;  4MNO A;  3W2D A;  5K5P A;  1VMP A;  2RCF A;  1DJR D;  3ULJ A;  4H13 C;  4FO2 A;  3BYY B;  1UNS A;  3G4S A;  5FKA C;  1BCP C;  4POF A;  3I4M B;  3R93 A;  4DV7 Q;  3SK5 A;  3L7Z C;  4C3I B;  4BA2 I;  2Z0S A;  3JAM i;  1EWH A;  2MP1 A;  3I4N B;  3I2Z A;  1RIP A;  1ONL A;  2NBF A;  4FXG C;  4XT1 B;  5BR8 L;  1I4Q A;  1I94 L;  1H9R A;  2C9O A;  2ZM6 Q;  4X3T A;  1V1P A;  3HOW G;  3T1Y L;  4RGO S;  5A2Q E;  4DV3 L;  1CHP D;  2ZJP A;  1IBL L;  3PF5 A;  1XYI A;  1MGS A;  4POG A;  1QNU A;  1WOC A;  1IW7 D;  2YTV A;  3NXW A;  5FO9 B;  3K7A B;  4A3G B;  1MIU A;  4A3M G;  1I4G A;  4BBR H;  1KLU D;  2IJ0 A;  3AQQ A;  2A69 C;  4EQP A;  1SEB D;  2Z4I A;  1HTP A;  4FXD A;  2VUM B;  4PG3 A;  1SYD A;  4HSV A;  1ZXT A;  4RMF A;  5LMN L;  4JI3 L;  3T13 A;  4RCO A;  1GJX A;  1CTM A;  5CMD A;  4HAE A;  3D0F A;  3PUW A;  5EQ0 A;  4XQJ A;  1JQY D;  1JOQ A;  5F2D A;  3JAM E;  2Q2T A;  2K5H A;  4YCU A;  3J7A F;  1B7Y B;  4F87 A;  5JJI A;  1NUC A;  5DAU A;  1B44 D;  4YIJ A;  1KHI A;  2J4X A;  1WTH A;  4C2M H;  1BCP D;  3H0G B;  1I6V C;  2JP1 A;  4BA1 I;  1BXT A;  1PZI D;  2EDG A;  2H1E A;  1XPU A;  5IYB H;  1TVX A;  1CA5 A;  1VCI A;  4DV5 Q;  4ME3 A;  3RUZ A;  3MZ5 A;  3NEM A;  4QF4 A;  4ZKB B;  2E2D C;  2XWB B;  5IT9 c;  1IBK Q;  3QOL A;  3ND8 A;  3VYT A;  4P75 A;  3DM3 A;  2YYZ A;  2RHS B;  2CCZ A;  3K5M A;  3PO3 B;  1ILQ A;  1HR0 L;  2H5X A;  4JVZ A;  2JQO A;  1CFM A;  2D9U A;  3OMC A;  4QB4 A;  1EY5 A;  1Q8I A;  2HIV A;  1H9K A;  1EZ6 A;  4IUR A;  3J80 L;  1EOT A;  4DK6 C;  1CKN B;  4JK1 C;  2EOT A;  5CBE E;  2R7Z G;  3PO2 B;  1EUJ A;  2PW5 A;  1SDF A;  4OX9 L;  1SE2 A;  2L12 A;  2F0O A;  2XIW A;  1LTI D;  1N8R C;  2WB1 B;  1E0B A;  2B63 G;  1KRS A;  1CKN A;  4IUQ A;  3OW2 A;  1E2V A;  3VR5 A;  1STG A;  3EIV A;  2A69 D;  1A62 A;  1VQB A;  1DYQ A;  1X3F A;  5ELD A;  1B1Z A;  2N55 A;  3DMU A;  3WOE A;  1YHQ A;  4GOP B;  1ZEQ X;  2MNA A;  2WFW A;  2K32 A;  1VQP A;  4FF4 A;  1Z6H A;  5IWA L;  2QKI C;  4DR3 L;  3R3O A;  4K6D A;  4A3J G;  4AQY L;  4GOP A;  1CT1 D;  2Q8T A;  5E4W C;  2G5D A;  3BZD B;  1HZB A;  1PRT F;  3S1Q H;  1A3U A;  1BOS A;  1SE4 A;  1S5F D;  2Z1C A;  3SHL A;  1O7Y A;  2RDH A;  1TS3 A;  2AUK A;  4QIW E;  3Q24 A;  3EA6 A;  2GA4 B;  3K6O A;  1IYU A;  1EY8 A;  3S1M B;  3GTQ H;  2M00 A;  2HQL A;  3GTK H;  2K03 A;  3R2I A;  1HA5 A;  1G51 A;  2E2I H;  1WFQ A;  1SFO H;  4HJ9 A;  2JA9 A;  5ELN A;  2XRS D;  2EY2 A;  2PNR C;  1SXT A;  2DJG C;  3MEH A;  2F3V A;  4IPC A;  4JBJ A;  1X3P A;  4L63 B;  3H6M A;  2DN8 A;  4A75 A;  4O1N A;  4N8X 1;  1STE A;  1FNV A;  1IXR A;  1WTW A;  2UU9 L;  1GUW A;  5C4X H;  2OQ0 A;  3J81 E;  5BR8 Q;  3WWV A;  1I94 Q;  1J8I A;  3RZO H;  1II3 A;  1A3V A;  1PH3 A;  3MXN B;  2MO0 A;  3T1Y Q;  3L2P A;  1SYE A;  4BXX H;  2KED A;  5KRU A;  4DV3 Q;  1IBL Q;  1PH9 A;  4RAU C;  3KYH C;  2M2L A;  4DFA A;  3K57 A;  2VY3 A;  3NTK A;  3LNN A;  4LUV A;  1EY9 A;  3MXN A;  3HOZ B;  1X32 A;  2EYH A;  2KBN A;  2E76 C;  2ZTC A;  2B39 A;  2WII B;  2HD3 A;  5KEE A;  3GTL B;  1GOZ A;  2KHI A;  1PYW D;  2FHT A;  4FF1 A;  1R9T B;  4X65 L;  1IL2 A;  2JA5 B;  3MTS A;  3S1N H;  5C44 H;  5LMN Q;  4A3D G;  4PMW A;  2IX3 A;  2KOL A;  1R4Q B;  3T53 B;  3CKI B;  2NVX H;  3H3V C;  5JVG 3;  3QO2 A;  1EY6 A;  4JI0 Q;  2ZXR A;  1KRT A;  4JI5 L;  1TWC B;  4IOA A;  2VL6 A;  1M90 C;  1FJG L;  3S2H B;  4HED A;  3M3Y H;  2JA8 G;  4G7O C;  2AQ1 B;  3URY A;  2AMC B;  3U9O A;  4F8M A;  4I7Z C;  3H94 A;  3D4W A;  2R93 B;  4NMZ A;  5JEA H;  1VQJ A;  3Q22 A;  3TEH B;  4J1M A;  5GRO A;  4MTN A;  5KIX A;  2IPK D;  4TKO B;  1ROD A;  3BZK A;  5TSS A;  4H44 C;  2MO1 A;  3KFU A;  2ZTD A;  3CC4 A;  3A8J E;  2NVQ B;  2UXD L;  4EQO A;  1HR0 Q;  2WAC A;  3CW2 C;  2FFK B;  4CKE A;  2BA0 A;  1I6H B;  2A6H C;  4LMQ D;  1XTD A;  1X56 A;  3KLW A;  2OQK A;  3T16 A;  2D0O A;  2K52 A;  4YWL A;  4DAP A;  3HOU H;  4BBS H;  2V1C C;  1JWM D;  1KTK A;  3L3O C;  1F77 A;  3LX0 A;  4G7H C;  5JPN C;  4OX9 Q;  2A73 B;  3BVZ A;  1HXY D;  3A56 A;  5EBD A;  2VZA A;  1CSP A;  4R9W A;  1UWV A;  3AU7 A;  4X66 L;  3ICE A;  3D4R A;  4MN3 A;  4CJ0 B;  4KKT A;  1FGB D;  3E5S A;  4GZY C;  5I6W A;  1V1O A;  2C5C A;  2QGQ A;  1M4V A;  3H3V I;  1PMR A;  2B2W A;  5C5M A;  4RHS A;  2B8G A;  1Q12 A;  1U5K A;  4QGU A;  1D1I A;  1PLF A;  5C0X I;  5IWA Q;  2B2T C;  4LF5 Q;  2EPB A;  4A3K H;  2G9D A;  2X69 A;  4B3S Q;  1T5X D;  4JBM A;  4DR3 Q;  3G48 A;  4AQY Q;  2RBM A;  4YHH L;  5IT9 E;  3QOJ A;  5NUC A;  4CGY B;  4HID A;  4BY1 B;  2VNU D;  5T1G A;  5FOB B;  1TQO A;  2NVY B;  4DV6 Q;  2EJM A;  3GTG H;  1BO0 A;  2DJF C;  1SE3 A;  1QWY A;  3EJI A;  1QNK A;  1N9W A;  2IW3 A;  5G3L D;  1B8A A;  1VQO A;  1BDO A;  2PI2 E;  4LF9 L;  1MSG A;  4FNF A;  4IFD G;  4IUP A;  3D31 A;  4O0A A;  1SRU A;  4IZ8 A;  1DGS A;  2A6H D;  4RFB A;  2KVM A;  5EKK A;  4UP8 A;  3S17 B;  1KXL A;  2UU9 Q;  4JI4 L;  4CDD C;  3BU2 A;  4IUT A;  2VXW A;  3KLS X;  3TDQ A;  1EZ8 A;  4A3C G;  4R4I A;  4JC0 A;  3BDL A;  5AFW A;  2D2C C;  3I55 A;  4DK1 A;  1VQL A;  2VQF L;  3ND9 A;  4QMG A;  3S24 A;  1J5E L;  3HOX B;  4BY7 G;  1UAP A;  2CQO A;  3LWE A;  2CWA A;  2C35 B;  3KK7 A;  1VQD A;  2AWN A;  5J3B A;  2Z8L A;  4A3M H;  2MGS A;  1YEZ A;  2R7F A;  1Y8P B;  1SYG A;  4K5V A;  1EIF A;  1VQK A;  2B2Y A;  1SNM A;  1KAA A;  2B2V C;  4LF4 L;  2Z4H A;  2NWG A;  2JA7 B;  4UAI A;  4DN4 M;  1YJN A;  2UXC L;  4JBW A;  3CQZ H;  4LF7 L;  4ODG A;  4X65 Q;  2EE1 A;  2LY7 A;  4H7B A;  4RGT A;  4UDU C;  5IOD A;  1B9M A;  1BCP B;  2DUD A;  3B6Y A;  5M3F G;  3M4Y A;  3ITP A;  5EGT A;  5HGQ A;  1ZYR C;  1AZQ A;  2AUJ D;  4JW0 A;  3MXP A;  2K6A A;  4XQQ A;  1ILP A;  1FJG Q;  3VYS A;  3Q23 A;  2AQ2 B;  1G6P A;  3F8T A;  2VW9 A;  1VQA A;  1VQ8 A;  1D6E C;  2CHB D;  5KND A;  2YU9 H;  4A93 B;  3RD4 A;  4HJA A;  2F0D A;  3FHW A;  1PH2 A;  3CC7 A;  1E1O A;  1EYD A;  2FJ2 A;  5FK9 C;  2N3S A;  2Y0S G;  3S2D B;  2F0M A;  4A3F H;  3CCS A;  3OIP A;  2D62 A;  1PFB A;  3P7J A;  5LMU L;  1TR5 A;  3CF5 A;  4IAL A;  2UXD Q;  1V1Q A;  2K7V A;  2O5I C;  3K8A A;  4NPS A;  5HUR A;  3NTI A;  3HOW B;  5ISR A;  3UDI A;  4AYB E;  3G71 A;  4PV1 C;  1D5Z C;  1GHJ A;  1QCB D;  3S14 H;  4QIW B;  1FVI A;  1OXS C;  5D3D A;  2B63 H;  1TWA H;  3DEP A;  5J39 A;  4ZUI A;  4X66 Q;  5FJ8 G;  2K33 A;  5CV8 A;  1I3Q B;  2K5N A;  4M1U B;  1Z9F A; 
#chains in the Genus database with same CATH homology
 3JAM i;  3CCQ A;  3PO2 G;  4DR6 L;  4DV6 L;  4GN4 B;  1H95 A;  4LF6 Q;  1TWC H;  4GKK Q;  4IPD A;  2AWO A;  3U4Z A;  3I2Z A;  1HR0 W;  1HNZ L;  3S2H H;  1RIP A;  1ASZ A;  3AFP A;  2WB1 G;  4A3E G;  3G6E A;  5BR8 L;  1X54 A;  2YTY A;  1QUQ B;  4DKA C;  4A3L H;  3CXC A;  4DR5 L;  3CPF A;  1I94 L;  4YWK A;  4A3J H;  1S40 A;  1Y14 B;  1Q81 C;  4IOC A;  2R93 H;  2ZM6 Q;  3CD6 A;  2VQE L;  3HOW G;  3T1Y L;  2ID0 A;  4GN5 A;  4YHH Q;  4WJ4 A;  1IZ6 A;  2EQS A;  2Z6K A;  3PIO A;  2ZJP A;  4DV3 L;  1N34 L;  1QUQ A;  3PF5 A;  1IBL L;  1VQ7 A;  3PUZ A;  2RCN A;  3ULP A;  4POG A;  1WOC A;  4EX5 A;  5IYD H;  4ALP A;  3K7U C;  1VQ5 A;  4JBK A;  2YTV A;  4JCV E;  2OCE A;  5GAH C;  4A76 A;  1Y1V H;  4B3T L;  1MIU A;  4A3M G;  2IX1 A;  2NVQ H;  3I4M G;  4BBR H;  1XMQ L;  3AQQ A;  1E7Z A;  2LXJ A;  1HNW L;  1I6H H;  3M7N A;  3S15 H;  4JV5 L;  1HZA A;  1NY4 A;  4PG3 A;  3RLN A;  1Y1W H;  4A3B G;  2A1A A;  4R1J A;  4RMF A;  4P73 A;  4LF9 Q;  5LMN L;  4YY3 L;  3KOJ A;  4JI3 L;  1QVC A;  2I5H A;  4LUZ A;  2IHE A;  1MJE A;  2GN5 A;  5JEA G;  1AE2 A;  1V9P A;  1WCM G;  2YV5 A;  5E7N A;  1HNX L;  4PZ7 A;  3M4Q A;  1UE1 A;  4HJ5 A;  4DV2 Q;  5M3M H;  1NTG A;  3D0F A;  3PUW A;  2E2J H;  3CMA A;  1Q82 C;  2GVB A;  4EQ5 A;  2Q2T A;  5FLM H;  4JI4 Q;  4DR4 L;  2K5H A;  4O2D A;  4YCU A;  3W1B A;  1B7Y B;  1CKO A;  3HKZ G;  3W1G A;  1A0I A;  5JJI A;  2KEN A;  2A8V A;  3BZC A;  1KHI A;  1VQM A;  4C2M H;  2UUB Q;  2Z6K C;  4NXN L;  1QZH A;  3U4V A;  3CCM A;  2E5L L;  1N36 L;  4L5S A;  4BA1 I;  2R6G A;  4OWX B;  1XPU A;  5IYB H;  4LW1 A;  1VCI A;  3UDF A;  4DV5 Q;  3K81 C;  4ME3 A;  3M9B A;  2FXQ A;  3NEM A;  5C0X G;  1HH2 P;  1FGU A;  4DR2 Q;  1YHB A;  3ZJY C;  4JI8 L;  5IT9 c;  4JI7 Q;  4JI6 L;  1IBK Q;  2QEX A;  5IP7 G;  4DUY Q;  4P75 A;  1I50 H;  3FP9 A;  4JI5 Q;  3DM3 A;  2YYZ A;  1LTL A;  1CUK A;  2RHS B;  2CCZ A;  3OYY A;  5AJ3 Q;  4BY1 H;  1IBM L;  1C7Y A;  2UUC Q;  1G29 1;  1HR0 L;  2H5X A;  4DR7 L;  2UXC Q;  2NVY H;  4LF7 Q;  2JQO A;  3NBH B;  3J81 c;  3CCV A;  4IO9 A;  4A3D H;  2HIV A;  4DK6 C;  2KCT A;  4IFD I;  1CKN B;  3HOZ G;  2R7Z G;  4OO1 G;  1BVS A;  1EUJ A;  1QVG A;  3CCU A;  1JJC B;  1D8L A;  1JT8 A;  4OX9 L;  3NEN A;  1PH4 A;  1P16 A;  4NB3 A;  1KC8 C;  1K73 C;  3ER0 A;  1N8R C;  5M5X H;  4B3M L;  3CCR A;  2B63 G;  2R92 G;  1CKN A;  1KRS A;  5DLQ E;  4IJH A;  2I0Q A;  2JA5 G;  1N32 L;  3OW2 A;  2QA4 A;  4LFB L;  3EIV A;  3AFQ A;  1S3O A;  5M5W H;  2JA6 G;  1A62 A;  1VQB A;  1X3F A;  1ASY A;  4GKJ Q;  3S17 H;  2B3G A;  5K36 G;  2JE6 I;  5C0X J;  1YHQ A;  4GOP B;  1UE7 A;  2UUA Q;  2MNA A;  4LFA L;  2WFW A;  2E8G A;  2WAQ G;  2LXK A;  4DV1 L;  1VQP A;  4L5Q A;  2F4V L;  1PYS B;  5GAG C;  1K83 H;  5IWA L;  1FL0 A;  2ZTE A;  2JEB I;  3A5U A;  4DR3 L;  1VQF A;  1K8A C;  4DV7 L;  3STB C;  4A3J G;  4AQY L;  3S1R H;  1XNR Q;  3M85 A;  4GOP A;  3CCJ A;  3HOX H;  4DV0 Q;  4Y52 H;  5LMU Q;  1KAW A;  4DR1 Q;  2B29 A;  1HZB A;  4GLX A;  3RNU A;  3S1Q H;  1N33 Q;  4OON A;  2IX0 A;  3LGJ A;  2F3I A;  4YCW A;  3KDF B;  4X64 Q;  4RG1 A;  3GTJ H;  4NXM Q;  2OWO A;  4K0K Q;  4H02 A;  4DAM A;  2NN6 G;  4QIW E;  5IYD G;  3UE1 A;  3RN5 A;  2JA7 H;  3HOV H;  1GKH A;  1V43 A;  1A8V A;  1Y1V G;  1SMX A;  2L15 A;  4DV4 L;  1Q1B A;  4X62 Q;  2HQL A;  2RF4 A;  3KDF A;  4BBR G;  2EIF A;  4HIK A;  3CPW A;  3GTK H;  4JYA Q;  4JI1 L;  1MKH A;  3HFZ B;  1G51 A;  4GNX C;  3T1H L;  1YI2 A;  2E2I H;  1QZG A;  1WFQ A;  1SFO H;  3JC6 6;  2XGT A;  4HJ9 A;  2YTX A;  4MZ9 A;  2JA9 A;  5ELN A;  1Q8K A;  1CSQ A;  4JBJ A;  2K50 A;  3M4P A;  4IPC A;  3I7F A;  4P72 A;  4JI2 L;  4AYB G;  4A75 A;  3EN2 A;  3Q8D A;  1SR3 A;  5JJL A;  1MJC A;  1TWH H;  2PNH A;  3PSI A;  3S16 H;  1IXR A;  3RN2 A;  3PCO B;  1HNZ Q;  5M3M G;  2UU9 L;  1PFS A;  5C4X H;  1Q86 C;  2N8N A;  5C3E H;  5M5Y H;  4OO1 I;  2OQ0 A;  1O7I A;  2IT1 A;  5BR8 Q;  2PI2 A;  1RL2 A;  4APV A;  1GVP A;  1XPR A;  3KF6 B;  3WWV A;  4GOP C;  1EIY B;  4DR5 Q;  3VDY A;  1PH1 A;  1I94 Q;  3RZO H;  3KJO A;  1WJJ A;  4JOI A;  1JMC A;  1LYL A;  2Q2I A;  1LM0 A;  4A93 H;  1PH3 A;  2VQE Q;  3F1Z A;  1EFW A;  3MXN B;  2MO0 A;  3GO5 A;  3T1Y Q;  4JG2 A;  3L2P A;  4BXX H;  4DV3 Q;  4R4O A;  1PHJ A;  1N34 Q;  3S2D H;  3PGZ A;  1PH9 A;  3PIP A;  1IBL Q;  4LFC L;  2LSS A;  1JJG A;  3KYH C;  5IYB G;  1VQH A;  4DV2 L;  2EXD A;  2VY3 A;  4LUV A;  1PA6 A;  1BKB A;  1E3P A;  2F52 A;  3L0O A;  1K9M C;  4KHZ A;  2KBN A;  4DUZ Q;  1L2F A;  1K0R A;  2WP8 J;  2BH8 A;  2ZTC A;  4Y7N H;  3F2D A;  2HHH L;  2NVT H;  1HNW Q;  1HJP A;  3TS0 A;  3HOW H;  2KHI A;  1YNX A;  4BY1 G;  1XMO L;  4HIM A;  3E9H A;  1PVO A;  4X65 L;  4OXP A;  2N78 A;  1Q7Y C;  1IL2 A;  2JJQ A;  4PZ6 A;  3NEL A;  1E22 A;  3STB D;  3DLL A;  1C9O A;  1E24 A;  3S1N H;  5C44 H;  1E1T A;  4YY3 Q;  5LMN Q;  1UEB A;  4PMW A;  2NZO A;  2VQF Q;  1J5E Q;  2E2H H;  4A3D G;  4B3R L;  1HNX Q;  1KL9 A;  2NVX H;  3HKS A;  5JJK A;  1YIJ A;  3I4M H;  4IPH A;  2Y0S E;  3J80 c;  4JI0 Q;  4A3F G;  2D0P A;  1VQI A;  3GD7 A;  4R4Q A;  1KRT A;  4JI5 L;  4C3I H;  3J81 j;  4IOA A;  2VL6 A;  4JOI C;  1I3Q H;  1M90 C;  1FJG L;  4DR4 Q;  3M3Y H;  5GAE C;  2JA8 G;  4P74 A;  4LF4 Q;  2ALY B;  4HJ8 A;  3CCL A;  4A3C H;  2GVA A;  2CKZ B;  2AMC B;  3AEV A;  3PF4 A;  1YIT A;  1SN8 A;  4NXN Q;  1S72 A;  2NZH A;  3M4O H;  3I4N H;  4DK3 C;  2E5L Q;  1KIX A;  2ZJR A;  1OXX K;  4BY7 H;  1XJV A;  1GD7 A;  1VQJ A;  2K4K A;  3TEH B;  5GRO A;  4YWM A;  1NMF A;  2BA1 A;  4MTN A;  4LF8 L;  4PZ8 A;  3J7A 5;  1YVC A;  4L5T A;  3BZK A;  1AE3 A;  4J15 A;  4GNX B;  2MO1 A;  3UDG A;  1JB7 A;  2A19 A;  4JI6 Q;  3KFU A;  1P8L A;  2ZTD A;  1PH5 A;  3HOY H;  2I5M X;  4GLA C;  3BJU A;  3CC4 A;  4QQB X;  2K5V A;  4IPG A;  2UXD L;  1IBM Q;  3GTQ H;  1HR0 Q;  3RLF A;  4GNX A;  4DR7 Q;  3CW2 C;  3F2B A;  1KQS A;  1B70 B;  1K8G A;  2UXB L;  3RZD H;  2BA0 A;  4GKJ L;  4AIM A;  3J81 i;  4UP7 A;  1XTD A;  1X56 A;  3KLW A;  2OQK A;  3K7A H;  4A3I H;  2D0O A;  1XNQ L;  2K52 A;  2PQA B;  4GLV B;  1K3R A;  4YWL A;  1JE5 A;  2V1C C;  3CME A;  5M3F H;  3HOU H;  4BBS H;  2OTJ A;  2MFI A;  2ZJQ A;  4L5R C;  3TRE A;  1BBW A;  2VS1 A;  4KHP L;  4OX9 Q;  3OTO L;  2JA7 G;  3HOV G;  1VS0 A;  1UE5 A;  2WB1 E;  5LMN W;  2VUM H;  2PQA A;  2VZA A;  4A3L G;  1CSP A;  4B3M Q;  1UWV A;  4X66 L;  3ICE A;  4DV0 L;  1N32 Q;  2Q2U A;  1TXY A;  2R93 G;  2K14 A;  3I4O A;  1M1K C;  1J6Q A;  3RLO A;  1VQC A;  3H3V I;  2QGQ A;  3JAM c;  1SRO A;  3KJP A;  3PV0 A;  3U50 C;  5IP9 H;  2AKW B;  1PH6 A;  1T9H A;  1EYG A;  1Q12 A;  5GQO A;  4LF6 L;  2R7Z H;  4GKK L;  1U5K A;  4QGU A;  4R4T A;  3K80 C;  4LFA Q;  1Q1E A;  2IHF A;  4TVA B;  5C0X I;  1PH8 A;  3GTM H;  4DV1 Q;  5C4X G;  2F4V Q;  1WI5 A;  5IWA Q;  5IY0 A;  3H0G H;  4LF5 Q;  4A3K H;  1VQN A;  4B3S Q;  4JBM A;  4DR3 Q;  2ZM6 L;  3G48 A;  3PUY A;  4AQY Q;  4YHH L;  3PUV A;  2ES2 A;  1X9N A;  4A93 G;  1EQR A;  1Y1W G;  1CKM A;  4HID A;  1VQE A;  1AH9 A;  3FKI H;  2HT1 A;  2VNU D;  4BXX G;  4KLK A;  4QJF A;  4DR6 Q;  4DV6 Q;  2XTI A;  1D7Q A;  2K75 A;  5HY6 A;  1XPO A;  5IYC H;  3GTG H;  4UP9 A;  3SGI A;  3CC2 A;  2ASB A;  3PO3 H;  4FDB A;  4DV4 Q;  2AHO B;  1N9W A;  3UE0 A;  3H15 A;  5FLM G;  1Z47 A;  1HZC A;  4A4I A;  4JI1 Q;  1NBW A;  2DGY A;  3HKZ E;  1B8A A;  5FJ8 H;  3CAM A;  3T1H Q;  1VQO A;  3IRB A;  4UY8 C;  1EOV A;  1TWF H;  2PI2 E;  4LF9 L;  4BBS G;  2MQH A;  3PO2 H;  4IFD G;  2I5L X;  3D31 A;  3KF6 A;  1NMG A;  1VQG A;  2RHQ B;  4JI2 Q;  3J7Z C;  4O0A A;  1SRU A;  5C44 G;  3CP0 A;  3TS2 A;  1DGS A;  5ELO A;  1PV4 A;  4LUO A;  3GTO H;  1EWI A;  1X3E A;  2ATW A;  4UP8 A;  4A3E H;  1KXL A;  3EBE A;  4GS3 A;  2UU9 Q;  3TQY A;  1OXT A;  3K0X A;  4B3T Q;  1PH7 A;  4JI4 L;  4DUZ L;  3BU2 A;  4IJL A;  2CFM A;  1XMQ Q;  4XIG S;  3E0E A;  4DPG A;  1X65 A;  3TRZ A;  3ULL A;  2KHJ A;  2UUB L;  1WYD A;  2N49 A;  4R4I A;  4A3C G;  4JV5 Q;  4JC0 A;  5FLX c;  3I55 A;  1OXU A;  3CCE A;  3I4N G;  1VQL A;  3KF8 B;  2VQF L;  3S24 A;  1J5E L;  1W2B A;  4BY7 G;  4JI3 Q;  3RR5 A;  4DV5 L;  4LFC Q;  1QVF A;  4XTC S;  4DR2 L;  2CQO A;  2IY5 B;  2CWA A;  2C35 B;  4P71 A;  1VQD A;  1SE8 A;  2AWN A;  5J3B A;  1YJ9 A;  4A3M H;  4JI7 L;  3A5Z B;  1IBK L;  4JI0 L;  1YEZ A;  2NN6 I;  2R7F A;  4DUY L;  1VQ4 A;  1EIF A;  3A0J A;  1VQK A;  2OTL A;  4HJ7 A;  5GAD C;  4LF4 L;  5AJ3 L;  1C0A A;  3HOY G;  2HHH Q;  1Q46 A;  4HIO A;  2UUC L;  5C4J H;  1YJN A;  4A3B H;  2UXC L;  2CWP A;  4JBW A;  3CQZ H;  4GN3 B;  1XMO Q;  1YZ6 A;  4LF7 L;  4X65 Q;  4LNQ A;  4A3G H;  2PMZ E;  3GTP H;  4DNI A;  1NJI C;  1N36 Q;  4IFD J;  2R7D A;  1L1O B;  1WCM H;  4UPA A;  1VQ9 A;  4A3G G;  3U58 A;  4A3I G;  1UE6 A;  3HOU G;  3S1M H;  5M3F G;  2DUD A;  3B6Y A;  1I5F A;  4B3R Q;  3UDX A;  4OWW B;  1A63 A;  3GDE A;  5HGQ A;  4JI8 Q;  3J80 i;  1X6O A;  2WAQ E;  4LWC A;  1L1O A;  4C3J H;  1L0W A;  2VUM G;  1FJG Q;  1U0L A;  3F2C A;  1VQ6 A;  3ERS X;  4AH6 A;  1GO3 E;  4KI0 A;  4R4C A;  3H3V H;  3I56 A;  3W5O A;  1G6P A;  3F8T A;  2VW9 A;  3HOX G;  1BBU A;  1KD1 C;  2KCM A;  1VQA A;  1VQ8 A;  5H1S E;  2YU9 H;  5JEA J;  4HJA A;  1NE3 A;  1X3G A;  3FHW A;  1PH2 A;  2HIX A;  5IP9 G;  3CC7 A;  1E1O A;  2UUA L;  4C3H H;  4LF8 Q;  4YCV A;  2N3S A;  2Y0S G;  4A3F H;  1IYJ B;  5IP7 H;  3CCS A;  4OWT B;  3A74 A;  2JA8 H;  1W3S A;  1XNR L;  3PUX A;  3H0G G;  2D62 A;  4A3K G;  4WJ3 M;  1OXV A;  4X6A H;  4TQU S;  1YHA A;  5LMU L;  3CF5 A;  4DR1 L;  2UXD Q;  3AYH B;  1HZ9 A;  4DAY B;  4LFB Q;  1TWG H;  1V1Q A;  5IE8 A;  1N33 L;  5EAY A;  1LUZ A;  3K8A A;  2UXB Q;  4NPS A;  4QL5 A;  4X64 L;  3FKI G;  1XNQ Q;  3UDI A;  1X55 A;  4NXM L;  3MEF A;  4AYB E;  1PYB A;  3HOZ H;  1YBY A;  3G71 A;  4K0K L;  2Q2H A;  2BH2 A;  2JK8 A;  1OTC A;  1SLJ A;  4MNO A;  3S14 H;  1FVI A;  1JJ2 A;  5IYC G;  3GTL H;  1L1O C;  3ULJ A;  4KHP Q;  1OXS C;  4X62 L;  3OTO Q;  3E9I A;  5C3E G;  3G4S A;  1R9T H;  4LF5 L;  2B63 H;  2R92 H;  3PO3 G;  1TWA H;  4B3S L;  4JYA L;  2JA5 H;  4POF A;  4DV7 Q;  1GM5 A;  4X66 Q;  3L7Z C;  4BA2 I;  2JA6 H;  4QY7 A;  5FJ8 G;  2Z0S A;  1EQQ A;  1YJW A;  2JEA I;  2K5N A;  1Z9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...