3KF6A

Crystal structure of s. pombe stn1-ten1 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
136
Chain Sequence
SRWNPMFISDVHKISFHPHYIGFWMGFPIRWIQIVGYIAAIDIYEGKHVLTVDDCSGMVLRVVFIIQDDFSMSKRAISMSPGNVVCVFGKINSFRSEVELIAQSFEELRDPNDEWKAWQKRMRYKKNLTKISKNHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stn1-Ten1 is an Rpa2-Rpa3-like complex at telomeres.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Structural protein
molecule keywords Protein stn1
total genus 36
structure length 136
sequence length 139
ec nomenclature
pdb deposition date 2009-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3kf6A00
3HOUG 1L1OB 5E7NA 3EBEA 1DGSA 3D31A 5BR8Q 1QUQA 1KRTA 4DR2L 1E7ZA 4BA2I 1N32Q 3CMEA 4A3MH 2B63H 3M4PA 5JEAJ 4YY3Q 4JBWA 3U58A 1VQ5A 1FL0A 4A3JG 4JI3Q 3HOUH 1CKMA 2XGTA 4GLAC 4LF9Q 2JA7H 2MO1A 4GKKL 4A76A 3GTOH 3H0GG 3NELA 1K8GA 5IYDH 1KL9A 1CSQA 4JCVE 5GADC 2OWOA 3BJUA 1NTGA 1KHIA 1EYGA 4IPGA 3CCVA 3NBHB 2JEAI 2R6GA 1IBML 5C44H 3H0GH 2F3IA 4JOIA 1L0WA 4LF7L 1TWCH 4B3RL 4FDBA 3CCUA 1U0LA 2AKWB 5FLMH 1WOCA 4YWMA 4B3SQ 4JI6L 4BBSH 4LF6Q 2UUAQ 1I6HH 2H5XA 4DV0L 2E5LQ 1NE3A 5M3MG 2ID0A 1K83H 4ME3A 1UE7A 2GVAA 3BZKA 3JC66 3K0XA 4LW1A 1TXYA 4DPGA 5IP7G 4IJLA 4Y7NH 1XMOL 1QVGA 1MJEA 4IFDI 4DUYL 4B3TQ 2FXQA 1XMOQ 4O0AA 1CKNA 2CWAA 4POGA 3OTOQ 4LF4L 2UUCL 3RR5A 4DV4L 1XNRL 2JA8G 2BH2A 3CQZH 4APVA 1OTCA 1KD1C 2ZTCA 5GAHC 1I50H 4DUZL 4HJ8A 2VUMG 3S1NH 2QGQA 3E9HA 4MTNA 1HNXQ 2WFWA 4JC0A 4YWKA 4GLVB 5M3MH 1YIJA 1VQ6A 1HJPA 2DUDA 4HIOA 2AMCB 1IBLL 5LMNQ 2UUBQ 1L1OA 3KDFA 1N9WA 3M4QA 1V43A 3E0EA 5C0XG 3KJOA 2IY5B 2VL6A 1K8AC 2CQOA 1C7YA 1VQJA 3KF6A 4X65Q 3RNUA 3UDFA 3I4MH 3KFUA 3KJPA 4BY1G 4LWCA 4DR4L 4B3MQ 4OO1G 3CCLA 2VQEL 1OXXK 1EIYB 3I55A 2E2HH 1RIPA 3W1GA 3M4OH 4QQBX 1EQRA 2AHOB 2OTJA 4C3HH 1R9TH 1VQ7A 1VQBA 4LUZA 4BY7G 3F2DA 1UWVA 2VQEQ 5M5YH 2Y0SE 4YY3L 1YHQA 3I4NH 3RZDH 3CCQA 2K52A 1Q1BA 4JBJA 2UU9L 3HOZH 3TS2A 1YITA 3CW2C 1PH1A 2MFIA 1UE1A 5C3EG 1PH3A 4DAMA 5IY0A 5EAYA 1PH6A 4R4IA 1HR0L 1I94Q 3J80c 4JI2L 3S1QH 4X64L 2YTVA 2HHHQ 3CMAA 3PO2H 1QVCA 3GD7A 2E2JH 1VS0A 2EIFA 3K81C 4P72A 4LF8Q 4IFDG 4P75A 2HQLA 4NB3A 1B70B 3HOZG 1QVFA 4WJ4A 1SRUA 3G71A 2E8GA 2HHHL 2B3GA 3D0FA 2ES2A 5IYDG 1GVPA 1VQCA 4GLXA 3I4NG 3G6EA 2LXKA 4PZ8A 3PUYA 1A0IA 2CFMA 5C4XG 2ZJPA 4DR5Q 1EQQA 3F2BA 5IYBH 4C2MH 3KDFB 1BKBA 5K36G 4IOCA 2JEBI 3I4MG 1IBKQ 3PO2G 2B29A 2R7ZG 5M5WH 3NEMA 1OXUA 4A3LG 4DR7L 1EFWA 4PZ7A 2JA5G 3S24A 4A4IA 4YCUA 4BXXG 5GQOA 4BY7H 1GKHA 1FJGL 3I4OA 1CUKA 1S3OA 1YHBA 4IFDJ 3H15A 5LMUQ 4DUZQ 1YVCA 2QA4A 1MIUA 5FLXc 1A63A 1FJGQ 3HKZE 5IYBG 1MKHA 2YTYA 3BU2A 3PGZA 4DR1Q 3CD6A 1V9PA 1XMQL 4A3FH 1LM0A 1J5EL 1Q46A 5AJ3L 5GAEC 4A3EH 4JI7Q 1ASZA 4A3GH 3PO3G 1VQ8A 1T9HA 3CAMA 4A3LH 1EIFA 3T1HL 2OTLA 2MO0A 1Q12A 4JI8L 4ALPA 1JJCB 1XPUA 2WAQG 3J80i 4EQ5A 2OQ0A 3T1HQ 4LFBL 3RLNA 2PQAA 3AFPA 1PHJA 2HT1A 1TWGH 3TREA 1HH2P 4AIMA 1VQNA 3ULLA 4HIMA 5FLMG 4A3BG 1X3FA 2JQOA 4IJHA 4A75A 3NENA 5JEAG 5IWAL 4A3JH 4LUVA 2PMZE 1QZGA 1PH9A 5JJLA 3CCRA 1KAWA 2WP8J 2JA7G 4IO9A 4GOPC 1BVSA 4IOAA 5IWAQ 5C0XJ 4PG3A 1XPOA 1P8LA 4JI0Q 1Q8KA 3PO3H 3S2DH 1J6QA 4A3KH 4MNOA 3K7UC 2ATWA 2ZM6L 1KIXA 2VY3A 3OW2A 1VQFA 2WB1G 3RLOA 1UEBA 1Q1EA 1HR0W 2JK8A 2E2IH 1E22A 4LFAL 3HKSA 4A3CG 3H3VH 3GDEA 3STBC 1XNQL 2PI2A 5JJKA 4POFA 2CCZA 2PI2E 4DK3C 3KF8B 4NPSA 2VUMH 2K4KA 4A3KG 2HIXA 5ELOA 2L15A 1CKNB 4OWTB 1P16A 3U50C 2VW9A 3A0JA 3M9BA 3A5ZB 2UXBQ 5IYCG 2NVYH 3KOJA 4J15A 4BA1I 2Q2TA 4KHPL 2QEXA 4DV1Q 2YYZA 4HJ9A 1SROA 2N49A 3HOYH 1VQOA 2I0QA 2VNUD 1B8AA 2KBNA 2IX1A 1E24A 1PH5A 2F4VQ 1Y1VG 3HFZB 1VQLA 4YWLA 2V1CC 4DV1L 3CC4A 4OO1I 3HOXG 2YTXA 1C9OA 1PFSA 3K80C 4JBMA 3PUZA 3JAMi 1E3PA 2UUAL 2F4VL 5GROA 1HZBA 1AE2A 3UDXA 1JJ2A 5M3FG 4LFCL 4X66L 1OXVA 1HNWQ 2R7ZH 5H1SE 1Y1VH 3UE0A 4DV6L 4QY7A 2NZOA 4GNXA 1GO3E 3BZCA 4DUYQ 2JA5H 4DNIA 2MNAA 4B3TL 1Y1WH 1Y14B 1K73C 2K75A 3S15H 1SMXA 1HNWL 1GM5A 4DR1L 4R4TA 1N36L 1PYBA 4KLKA 1KC8C 2R93H 1XMQQ 4DV4Q 3HOYG 1XNRQ 1CSPA 2Q2UA 4DV2L 1W2BA 4GS3A 3A5UA 2JA6H 4BY1H 1VQAA 4IPHA 4L5QA 4AH6A 1N36Q 2CWPA 4IPDA 1WFQA 1YBYA 3AQQA 1IXRA 2KCTA 3CC7A 3T1YQ 1X3EA 1O7IA 3I7FA 4JI4L 4X6AH 4P73A 1FVIA 4A3GG 4LFBQ 3PUVA 3ZJYC 4DV7L 4LF6L 1X56A 1TWHH 4A3IG 4L5TA 2E5LL 3GTGH 1YJ9A 3S2HH 2Y0SG 2ALYB 3AEVA 1YHAA 5DLQE 2CKZB 1VQHA 2IHEA 3G4SA 4DR6L 4NXNL 1YJNA 4AYBE 1Q82C 4X62L 3S1MH 2XTIA 2Q2HA 5C3EH 3U4ZA 4B3ML 4HIDA 5C0XI 4DR6Q 1RL2A 1TWFH 4JI0L 4GNXB 1WCMH 4AQYQ 1X6OA 4WJ3M 3PCOB 2UXCL 3FHWA 1SLJA 2IHFA 2N8NA 3CP0A 1PH8A 4BBRG 3Q8DA 2IT1A 4GN5A 4DAYB 4DR2Q 1IYJB 1N32L 4OXPA 2RF4A 4TQUS 4XIGS 2UU9Q 3KYHC 2K50A 1NBWA 1A8VA 1LTLA 1NY4A 1VQGA 4DK6C 4GOPA 3ULPA 4NXMQ 2NVQH 3W1BA 1HNZL 3ICEA 4IPCA 1X55A 2JJQA 3WWVA 5C4XH 2Z0SA 3CF5A 1Y1WG 3J7ZC 2R92G 3PF4A 1B7YB 1NMFA 3JAMc 1HNZQ 2NN6I 1VQ4A 4GN3B 4X65L 1E1TA 4HIKA 1IL2A 1X65A 1OXSC 3KLWA 3PSIA 4P71A 4DR4Q 2C35B 2AWOA 1VQDA 2K5VA 3LGJA 1I5FA 4LNQA 4A93H 3F1ZA 4A3DG 4LF5Q 4H02A 1K9MC 2KHJA 1IBMQ 3MXNB 4JYAL 1X54A 2ZJQA 3KF6B 4UPAA 5BR8L 1JT8A 1PV4A 4HJ5A 1NMGA 4Y52H 2BA1A 3PIOA 3FKIH 1XJVA 4LFCQ 5J3BA 4X66Q 1L2FA 1KRSA 4GNXC 4A93G 1KQSA 4BXXH 2NN6G 2JE6I 4DV0Q 1HR0Q 1I3QH 2PQAB 3HOXH 1I94L 3CPFA 4JI3L 4YHHL 5IP9H 4R4QA 4KHZA 4C3JH 1VQKA 1JMCA 1X3GA 1ASYA 4RMFA 4PZ6A 1WI5A 2Q2IA 1EWIA 4DR3L 1YZ6A 4A3FG 2KHIA 3ER0A 3T1YL 4JI5Q 1VQMA 1Q81C 4AYBG 1SFOH 2HIVA 3E9IA 5IP9G 3CCSA 4DV3Q 1N33Q 3AYHB 4JOIC 4DR3Q 3RZOH 1V1QA 4KI0A 4HJAA 1YJWA 5GAGC 4LF7Q 4DR5L 1HNXL 4B3RQ 4JBKA 4DV3L 2UXDL 4QGUA 1S72A 1VQEA 3W5OA 3M85A 1S40A 4YCWA 1IBLQ 5LMNL 2UUBL 2D62A 3K7AH 3DLLA 1IBKL 1BBWA 1JE5A 3HKZG 2UXDQ 1L1OC 3TQYA 2Z6KC 1PVOA 2AWNA 3GTLH 3S17H 3PUWA 3PUXA 4UP7A 5IE8A 1N8RC 1PA6A 1VQPA 3TRZA 5M5XH 1LYLA 3M3YH 1CKOA 1G291 2Z6KA 1U5KA 2UUCQ 5M3FH 4GKJQ 2LXJA 1WCMG 4NXML 2OQKA 1PH2A 4A3CH 4HJ7A 1SN8A 1YI2A 4QL5A 5AJ3Q 2WAQE 4GN4B 4JI7L 1OXTA 1E1OA 3F8TA 4OWWB 4K0KL 2R93G 1WJJA 2I5HA 4JI8Q 2BH8A 4OX9Q 3A74A 1EUJA 3HOWH 4QIWE 4R1JA 3RN5A 2ASBA 4JV5L 3SGIA 5IYCH 3B6YA 3TS0A 5C44G 4UP9A 3S16H 1JJGA 4YCVA 2R92H 2N3SA 2KENA 5C4JH 2MQHA 4JV5Q 4JI1L 4JYAQ 4C3IH 3J81c 4KHPQ 1YEZA 2VQFQ 1BBUA 4JI1Q 3CCJA 4A3MG 5HY6A 1LUZA 4DKAC 3VDYA 1XPRA 3S14H 4A3DH 3AFQA 2OCEA 3U4VA 4RG1A 3FP9A 2VQFL 3RN2A 1AH9A 4YHHQ 3J81j 1M90C 1HZCA 3L7ZC 4P74A 1UE6A 2RHQB 2VS1A 4LFAQ 2A8VA 3FKIG 3L2PA 5ELNA 3CCMA 3PV0A 4JI2Q 1X9NA 1GD7A 2I5LX 2RCNA 2IX0A 3DM3A 3OYYA 4MZ9A 4X64Q 4GKKQ 1KXLA 1WYDA 1M1KC 1Z9FA 3J81i 4JI5L 1SE8A 1A62A 2BA0A 4LF8L 3TEHB 2EQSA 1XTDA 3ULJA 4LF9L 2JA6G 1K0RA 4A3IH 3J7A5 4XTCS 3I56A 5HGQA 1EOVA 3UDGA 1N34L 2NVXH 1N33L 2UXBL 4DV2Q 4UP8A 1SR3A 2KCMA 5IT9c 3M7NA 1N34Q 2ZJRA 1G51A 3G48A 2JA9A 2NVTH 3F2CA 4BBSG 4EX5A 3GTKH 2F52A 2I5MX 4JI4Q 2R7FA 3STBD 2D0OA 4O2DA 3CXCA 3MEFA 2ZTEA 1UE5A 5JJIA 3H3VI 1AE3A 1QUQB 3UE1A 3PIPA 3GTJH 2NZHA 4BBRH 3HOVG 1H95A 4L5SA 3EN2A 3IRBA 2N78A 2WB1E 1IZ6A 4DR7Q 4B3SL 2K5HA 3S1RH 4JI6Q 2ZTDA 2EXDA 1Q7YC 4DV6Q 2PNHA 2GN5A 1QZHA 1JB7A 1VQ9A 4GKJL 2JA8H 2GVBA 2VZAA 1MJCA 3RLFA 1K3RA 4LUOA 2K5NA 3PF5A 3CC2A 4L5RC 4AQYL 4JG2A 1D7QA 2YU9H 4R4OA 2UXCQ 5LMUL 1Z47A 1W3SA 2DGYA 5FJ8H 1C0AA 3GO5A 4A3BH 4UY8C 1VQIA 3OTOL 4LF4Q 4K0KQ 2D0PA 1J5EQ 2LSSA 2ZM6Q 4QJFA 4R4CA 1HZ9A 1TWAH 4OONA 5LMNW 4TVAB 3HOVH 4OX9L 2YV5A 2R7DA 1VCIA 4PMWA 2K14A 4DV5L 3GTMH 3GTQH 2A19A 4DV7Q 3ERSX 4GOPB 1XNQQ 5FJ8G 3GTPH 1HZAA 1G6PA 1PYSB 2RHSB 3I2ZA 1Q86C 3K8AA 3L0OA 4DV5Q 1D8LA 4NXNQ 4X62Q 1YNXA 4OWXB 2A1AA 3HOWG 3UDIA 1NJIC 3CPWA 2B63G 1FGUA 3CCEA 1PH4A 4A3EG 1PH7A 5IP7H 4LF5L 3EIVA
chains in the Genus database with same CATH superfamily
1HUNA 1RODA 1DGSA 3D31A 3K5MA 1E7ZA 2RDFA 3CMEA 2B63H 2MUYA 3MXNA 2F0SA 3U58A 2VXWA 4JI3Q 1CKMA 2CH4W 4GLAC 4K8JA 4LF9Q 2MO1A 4A76A 2L11A 3CU7A 5IYDH 1KL9A 4X3SA 5GADC 4YIJA 1K8OA 2H4OA 1AN8A 1TIID 5K5PA 1PXUA 2AUJD 1BNZA 1TS4A 4EQNA 1X32A 1Y8PB 3CCUA 1U0LA 1PFMA 2AKWB 1SJED 4ILWA 3IKJA 4LF6Q 5T1IA 2K1BA 4DV0L 3J7AF 2GVAA 3K0XA 1XMOL 4LW1A 2ATWA 1TXYA 1K3BC 1B9NA 1XMOQ 3NWSA 2BOSA 2CWAA 5I6YA 3HOWB 3CQZH 3ND8A 4XXEA 1KD1C 1H9SB 3DWAA 4DUZL 4RA8A 3U9SA 2QGQA 1HNXQ 1XWEA 4MTKA 1YIJA 1HJPA 5EQ0A 1ZKOA 3D4RA 1L1OA 5CGKA 3KJOA 1V43A 2DJFC 3E0EA 4Q0FA 2VL6A 1EY0A 3KF6A 3FDTA 1SBBB 2KA7A 3UDFA 3P20A 3I70A 1U4LA 4LWCA 1OXXK 1IKLA 1EIYB 1UEAB 2E2HH 1Z6HA 3W1GA 3OWEB 4CJ0B 5FOBB 1EQRA 1FGBD 3M4OH 4C3HH 4QQBX 1D5MC 1VQBA 4LUZA 2LKVA 4YY3L 1FYCA 3NSWA 2Z6BA 4QMGA 4XQJA 1TU2B 4KY5A 2F0EA 2UU9L 3X3NA 4HCEA 5C3EG 2E74C 3L3OC 4DAMA 2LY7A 1HR0L 3D6WA 1IW7C 3NWTA 4X64L 3D6CA 3S2HB 1NR2A 1RTOA 3CMAA 1E0BA 2E2JH 3MA2B 2EIFA 4IFDG 2CH4A 2HQLA 3HOZG 5G3LF 5M3MB 1QVFA 3D0FA 3VR4A 1KNAA 2F0NA 1I50B 2K03A 3GP7A 1EEID 3SK5A 2LXKA 2WB1B 4PZ8A 2CFMA 5C4XG 1BR9A 3F2BA 2Q8TA 2J4XA 2JEBI 3I4MG 4UDUC 2R7ZG 3NK9A 2JA5G 4XQNA 3QR8A 3T53B 1EU3A 1ICWA 2IPKD 3J80L 1YHBA 2B2VC 2XN9C 3H15A 2OT2A 3BU2A 3CD6A 1LM0A 4IALA 4A3EH 1HXYD 5JVG3 2EYOA 4JI8L 1GUTA 4ALPA 1JJCB 2K5DA 3DHQA 3SXHA 3S17B 4ODGA 3TREA 5CV4A 1S4ZA 1X3FA 4IJHA 4A3JH 3K6OA 1DONA 1PH9A 5JJLA 3HEJA 1DM0B 4IO9A 3HOZB 2NBFA 2BDNA 4DF7A 4PG3A 1P8LA 1TY0A 2C5CA 1J6QA 2VY3A 2E2IH 4LFAL 1EZ6A 4K5WA 2PI2E 2X6LA 2B2WA 4DK3C 4NPSA 1AZPA 1CKNB 2VW9A 3A5ZB 2UXBQ 3KOJA 4DXGA 4CBVA 2YYZA 2L0CA 1E24A 2IX1A 1YNJC 3HFZB 1HCZA 1S5FD 1QOHA 1VQLA 1JE4A 4YWLA 5EKLA 3NPPA 3HOXG 4JBMA 3JAMi 1DOLA 2UUAL 3MXPA 5GROA 3Q23A 2HDLA 3UDXA 1JJ2A 1HNWQ 4RHSA 2IWHA 2R7ZH 1Y1VH 4A3GB 4DV6L 2K32A 2NZOA 1GO3E 3BZCA 1U4MA 5IIFA 1B9MA 1HNWL 1GM5A 4DR1L 2A73B 4R4TA 1PYBA 1KLUD 4DAYA 2R93H 1XNRQ 1W2BA 2PCFB 4GS3A 2JA6H 4N8FA 3PIP3 2XVSA 1WFQA 3AQQA 3EQLC 5KNBA 1H9SA 4RHRA 2JXMB 3I7FA 4JI4L 2A6HD 3PUVA 4HAEA 4C3IG 2QEJC 2F0FA 2E5LL 2ZXRA 3S2HH 3TN2A 3G4SA 4DR6L 3MFYA 1Q82C 4AYBE 2NVXB 1LT6D 2XTIA 2Q2HA 5CV9A 5C3EH 4DAPA 3IAYA 2BE5C 4DR6Q 2XIWA 1TWFH 1WCMH 5T1GA 4DGZA 3NTKA 1PH8A 3M4YA 1CTMA 3NUCA 2TSSA 5CMDA 4DR2Q 4C3IB 1N32L 3A55A 4OGQC 1NY4A 1D2BA 2BDOA 2XRQD 4DK0A 2PYKA 3NTHA 1X55A 4OIKA 2A69D 3K59A 1Y8NB 1Q3LA 1CZGA 3HOXB 1NMFA 1A2UA 2NN6I 1VQ4A 4GN3B 2DY8A 4P71A 1JC7A 2C35B 1RJTA 1STNA 2K5VA 1EQTA 5IGEA 4JYAL 1X54A 2EJMA 4KY7A 4LMQD 4KN4C 4IN3A 1PV4A 2BA1A 4LFCQ 5J3BA 1L2FA 1KRSA 2CVRA 2A6ED 5A35A 2NN6G 2JE6I 1V1PB 3BG3A 1PDQA 2RSOA 4JI3L 1A2TA 4YHHL 5IP9H 4IUUA 4C3JH 4KHZA 1VQKA 3I73A 1U4PA 1WI5A 2NTSA 4IUQA 5JVH3 1EWIA 4JI5Q 2KHIA 3DMUA 3V05A 3T1YL 1D5ZC 4AYBG 1SFOH 2HIVA 1JQYD 1UUPA 5IP9G 1NUCA 1K28A 4JOIC 3RZOH 4KI0A 1YJWA 4DR5L 1IKMA 4QGUA 4JPBW 1S72A 4RFBA 5DM73 1S40A 1IBLQ 5LMNL 3K7AH 2KEDA 1KDAA 3NQIA 2Z6KC 4KK7A 1F9RA 2DJGC 5M5XH 1QWYA 2VB2X 3A8JE 1CKOA 1DCZA 2EYJA 3KF8A 1JORA 3OHXC 2LXJA 1SN8A 2RVLA 4QL5A 4JI7L 1OXTA 5C3WA 4ZUJA 4K0KL 2R93G 1F77A 1STYA 1WJJA 2O2LD 3OSOA 4OX9Q 1OO9B 3RN5A 3VR3A 3S16H 4C1NI 1PLFA 5C5LA 3J81c 3TP7A 5KGUA 4A3DH 3VDYA 3U4VA 1AH9A 5C4HA 1HZCA 3C2PA 2A8VA 2VS1A 5D65A 3M3YB 4BBSB 3L2PA 5ELNA 2N88A 4X64Q 3TP8A 3J81i 1XTDA 1E2ZA 4A3IH 1LACA 1N33L 1N34L 2Z1CA 1SYDA 2F0TA 2KCMA 5IT9c 3M7NA 5LL6S 1N34Q 4L8JA 1G51A 3G48A 3GTOB 3RZOB 3FKIB 2F52A 1KDCA 2IW3A 3STBD 4OO1H 4O2DA 1VDZA 1WCMB 2MGSA 2ZTEA 1ZEQX 3GV3A 1G8ZD 1QUQB 3UE1A 2NZHA 4BBRH 3IRBA 3A54A 4B3SL 2PO4A 5EPLA 2EOTA 3KK7A 1S5BD 4H7BA 1MJCA 3CC2A 1ZYRC 2R61A 4JG2A 4AQYL 2RBMA 4EQPA 5I4DA 1KTKA 5FJ8H 2B63B 1JICA 1C8CA 1CM9A 1VQIA 4LF4Q 4WORA 5JEAH 4FYDA 1HZ9A 1A6XA 1WVLA 1XNQQ 5FJ8G 1HZAA 3I2ZA 1L0YB 1QG7A 3L0OA 4GZYC 1D8LA 4NXNQ 3C1EA 1YNXA 4J8QA 1GXDC 2A1AA 3UDIA 4X62Q 1NJIC 1FNVA 2B63G 1FGUA 2ZXOA 1PH4A 1PRTF 5BN5A 5DM63 2QKIC 1L1OB 1FD7D 3EBEA 1F2LA 2NN6H 2X6GA 1QUQA 4BA2I 4H44C 1NR4A 4A3MH 3M4PA 4RKBA 4HTHA 1VQ5A 2GA4B 4BY1B 4A3JG 3HOUH 2XGTA 4CKCA 3PQIA 3CKIB 3GTOH 3H0GG 3HOUB 5JJZA 5L37A 1D1IA 5HGTA 3CCVA 2JEAI 3SE0A 1IBML 3GQBA 1L0WA 4B3RL 4FDBA 2QW7A 3D4DA 1BUVT 3BYYB 1IW7D 3I3CA 2UUAQ 1K8MA 1I6HH 1NE3A 2ID0A 1K83H 5IT9L 4ME3A 1UE7A 3SDZA 3BVMA 1MJEA 2I46A 1LT5D 2FXQA 1CKNA 3OTOQ 1Q90A 1GUWA 1XNRL 2FMMA 2JA8G 1GUOA 1OTCA 4A3EB 5E1FA 3VYUA 1I50H 5D3IB 2AUKA 5FO9B 5KEEA 2VUMG 5EKKA 1A3VA 4MTNA 4KJNA 1HFGA 2WFWA 5EPJA 4KD4A 2RSNA 1VQ6A 3Q6SA 2B2YA 4FNFA 4LAAA 2KCCA 5C0XG 2PZTA 1C7YA 1VQJA 3KFUA 4X65Q 1FNUA 3SEBA 1PFNA 1GOZA 2EDGA 3CCLA 3MXUA 2VQEL 3I55A 1RIPA 3J7AV 2PW7A 5M5YB 2VQEQ 3K7AB 4KN7C 2Y0SE 1DD2A 2WKCA 2K52A 1MSGA 4BS9A 5JPMC 1PH1A 3OMGA 5IY0A 3J80c 5EBCA 1STAA 1PRTC 2H1EA 3PO2B 4XYOA 4WJ4A 2E8GA 2EVBA 1AFPA 2B3GA 1BBXC 5IYDG 1GVPA 1NCVA 1LV9A 1DXMA 3I4NG 2RKSA 3W2DA 4ZLTF 2ZJPA 1HA5A 3CRKC 3NTIA 1TQOA 5IYBH 4C2MH 3NQTA 4IOCA 2MHVA 3SK6A 1EU4A 4OELB 1IBKQ 2L12A 4PZ7A 3BYTB 1CI3M 3GTQB 1QJOA 1GKHA 1CUKA 1RHPA 4TSSA 1YVCA 4PNYA 1A63A 1IYVA 1MBYA 3PGZA 2F3WA 1XMQL 2B2YC 4A3FH 1GJXA 1Q46A 5AJ3L 3I8ZA 3PO3G 3CAMA 3T1HL 5IGDA 2MO0A 5TSSA 1XPUA 4EQ5A 3T1HQ 1PHJA 2HT1A 1Q8IA 4G4KA 4HIMA 4FVMA 4NW2A 2B2VA 3NENA 1I6HB 1XTCD 1KAWA 4HMJA 3CCRA 2JA7G 3PO3B 1BVSA 4IOAA 5C0XJ 1Q8KA 3IL8A 1HA6A 1KIXA 3M7GA 2JK8A 3M4OB 4PV1C 4A3CG 1Y1VB 1EY5A 3LX0A 1BDOA 2VUMH 3I4MB 4A3KG 5ELOA 1HQRD 1K0SA 3K57A 2K01A 4Y7NB 1S5DD 3S14B 1EFID 4DV1Q 2VNUD 2K05A 4PMBA 1Y1VG 5LHY1 2V4DA 2EY5A 4KHVA 2V1CC 4DV1L 4X3UA 3AU7A 3TMEA 1E3PA 3T13A 1AE2A 2WIIB 2MJ8A 3KLSA 5M3FG 4X66L 4ZYSA 1RKNA 4GNXA 2LS01 4DUYQ 4B3TL 2WAQB 1Y1WH 1Y14B 2K75A 2OXPA 1KC8C 4DV4Q 3HOYG 1CSPA 4I65A 1PTOF 4BY1H 1VQAA 5EBDA 4KKTA 2CW0D 2KCTA 1QCBD 1O7IA 4A3GG 4LFBQ 1X3QA 4A3IG 1Y8OB 3H91A 4RCOA 3GTGH 4RKLA 1W6KA 2WKDA 2ALYB 5J1ZA 3G6JB 5DLQE 2HCIA 3U4ZA 2N55A 3EVQA 4B3ML 1HPCA 3ITPA 4CDEC 1F9QA 2KJXA 4JI0L 1EY7A 1SNCA 5FKAC 4AQYQ 4WJ3M 4XDXA 3FHWA 1SLJA 2FHTA 3Q8DA 4CKEA 4M1UB 1IYJB 3S9WA 1E2WA 1NBWA 2IJ0A 4GOPA 4NXMQ 1HNZL 1RTNA 1SE2A 4XT3B 4WJWA 3WWVA 2Z0SA 1Y1WG 2Z9HA 3J7ZC 3OOCA 2R92G 1B7YB 1TT2A 1HNZQ 2FFKB 3OWFA 1HTPA 5KYLA 3J80E 1OXSC 4DR4Q 5IOCA 1LTTD 2AWOA 3F1ZA 4A3DG 4H02A 2BE5D 3CHBD 1S5CD 4EQOA 2M2LA 2XNAC 2QCPX 3MXNB 3G7LA 4A3FB 1PRTB 4G7OC 1TKWB 2RCFA 3TBIB 3HRZC 4Y52H 5C6AA 3I4LA 3GTKB 3KBXA 4GNXC 4A93G 3VA5A 1CT1D 1HQMC 4DV0Q 1ILQA 2PQAB 3E3XA 1I94L 4G7HC 2B8FA 5ELCA 1ASYA 1SNPA 4RMFA 4A3IB 4OIJA 1DZ1A 3SVMA 4DR3L 1YZ6A 1I6VC 5CC4A 3MWYW 1Q81C 3E9IA 3AYHB 4DR3Q 2NVTB 3GTLB 3NXWA 4HJAA 5GAGC 1HNXL 4B3RQ 3W5OA 3TZUA 4YCWA 4CHTB 5I2YA 1AEXA 3GTGB 3KUPA 3NBHA 3TQYA 2EY6A 2E2JB 3LWUA 3S17H 1O7ZA 2Z4HA 3PUWA 3PUXA 4ZK9B 3BDOA 5IE8A 1VQPA 1N8RC 2O5IC 3S16B 1G291 1U5KA 1O7LA 5FK9C 4GKJQ 2DNCA 4A3CH 4A3DB 1YI2A 1SNQA 3J7YW 2BH8A 5C4JB 1EUJA 5DEHA 3FPPA 4A93B 5IYCH 4V0BA 4P2CB 4B9WA 1H9MA 1JJGA 5FLXE 5M5XB 2N3SA 2KENA 5C4JH 2MQHA 3X3MA 4I7AA 4KHPQ 1YEZA 2Q8IB 1EOTA 1MGSA 2EXZA 3OMCA 2VQFQ 4A3MG 1IL8A 1XPRA 3S1NB 1A3UA 1XX8A 2OCEA 2VQFL 3RN2A 2Q8RE 4ME5A 5IGBA 2HD3A 4HN7A 2ZT9C 3FKIG 3PV0A 1X9NA 1LABA 3VR6A 3OYYA 1KXLA 4HSVA 1WTXA 2E2HB 1SE8A 1A62A 2BA0A 4C3JG 4LF9L 3UDGA 2PW5A 4DV2Q 1B4OA 1SR3A 3VYSA 2ZJRA 3RZDB 1WD0A 2NVTH 4EX5A 2NZ1D 4C3HB 3CXCA 1CA6A 3MEFA 5IGGA 1UE5A 4E6IA 3PIPA 1NAPA 2MP1A 4MN3A 1H95A 3EN2A 2WB1E 2OF1A 2WV6D 2K5HA 3N52A 5I9PA 2R93B 2ZTDA 1Q7YC 2DNEA 2PNHA 1O7YA 1QZHA 1JB7A 1VQ9A 2GVBA 2VZAA 3RLFA 2EYHA 3PF5A 4JK1C 5NUCA 2KOLA 2AQ2B 2UXCQ 2EY1A 3H6MA 2KQ3A 1VF5C 2LSSA 3R2IA 1B2TA 4QJFA 1UAPA 5COYA 4K14A 4TVAB 5LMNW 2YV5A 3HOVH 1SJHD 1SDFA 1TVXA 1I4HA 1VCIA 4PMWA 2A19A 4IURA 3ERSX 4DV7Q 4GOPB 1G6PA 5KRUA 4Q5VA 2K5QA 4I7ZC 4BWGB 2JA8B 1K83B 3CCEA 4K6DA 1V1PA 4L63B 3DXJC 5IP7H 4LF5L 3EIVA 3FPUB 3HOUG 2JP1A 1DJRD 1SE3A 4B9XA 1SE4A 3J81L 5JEAJ 4YY3Q 1D5XC 4JBWA 2F0HA 2QILA 3LNNA 2KUMA 3TP5A 3EFXD 2JA7H 3JAME 3H09A 2RA4A 3NELA 1K8GA 3S2DB 4CJ2C 1CSQA 2G5DA 5C4ZA 5C0XH 1NTGA 1KHIA 3GTJB 1EYGA 4IPGA 2K5WA 1ESRA 3JAML 5ELBA 2F0OA 3H3VC 5C44H 2F3IA 4IUTA 5CORA 1LT4D 3TDQA 4C1NK 4JI6L 4BBSH 1B50A 3MXGA 2H5XA 2E5LQ 5M3MG 4HEDA 1RD9D 1B3QA 1QVGA 5IP7G 4IJLA 3I4NB 4DUYL 4B3TQ 1BO0A 4KJOA 4POGA 2UUCL 4FO2A 4DV4L 4NMZA 2F0VA 2SDFA 3CQZB 2K6AA 4HJ8A 3S1NH 5A2QL 4CDFC 3KLRA 3E9HA 1LLRD 4TKOB 4GLVB 2DUDA 1SYFA 2AMCB 2UUBQ 3KDFA 1N9WA 3M4QA 1CK1A 3Q22A 4S3SA 1PMRA 3I4MH 5FO7B 3N6RA 4BY1G 4K8IA 4B3MQ 4KV6A 3K58A 5HURA 3IFTA 2AHOB 3H0GB 4HCSA 1R9TH 1VQ7A 1R4PB 4BY7G 3F2DA 1UWVA 4C2MB 3C3LA 4FF3A 3RZDH 4RGTA 3CCQA 5IT9E 4JBJA 3HOZH 1YITA 3CW2C 4F87A 4LK1C 1PH3A 5C4XB 2NWGA 5EAYA 3ZYYX 4R4IA 1PH6A 1GUGA 4JI2L 3S1QH 3D3RA 2HHHQ 1YNJD 1WTOA 5CBAE 1VS0A 3K81C 1W6JA 2NB0A 4P75A 4BY7B 1SRUA 4KD3A 2HHHL 5FLXL 1SFOB 4OEMB 1TS3A 5ELDA 4GLXA 1EIGA 3G6EA 3PUYA 1RDPD 1A0IA 4EGVA 5C3EB 4DR5Q 3T16A 3KDFB 1BKBA 1WTWA 1I3QB 4QUFA 3H94A 1STBA 1G2TA 2B29A 4DR7L 4A3LG 3QJYA 1KAAA 3S24A 4QB4A 4ID6A 5GQOA 2E75C 3RMHA 3I4OA 5EJWA 1S3OA 4IFDJ 1II3A 3DUZA 5CYUA 5LMUQ 4DUZQ 2QA4A 1D6EC 5FLXc 3TZDA 3HKZE 2F0LA 1C4QA 3QIAA 4DR1Q 5GAEC 4JI7Q 4A3GH 1ASZA 2R7ZB 1SXTA 4NKLA 1T9HA 5M3FB 1EIFA 3OIPA 4ZRZA 1XYIA 1Q12A 3EA6A 1M4VA 2EPBA 2PQAA 2LMCB 3AFPA 1HH2P 2HDMA 2SEBD 3MFGA 4FXKC 2JYOA 3ULLA 4AIMA 1VQNA 4A3BG 4FF4A 4A75A 3WOFA 3BS1A 3T4AC 1EWCA 4ABNA 2PMZE 4A3KB 4HMIA 4QCLA 4GOPC 3A7AB 3I72A 4HR7B 1EQVA 1LTSD 4RAUC 3S2DH 4A3KH 4MNOA 2EJGC 2ZM6L 1I4GA 3OW2A 3RLOA 4WFN3 1O80A 3R93A 1HR0W 4O42A 1E22A 1R4QB 1TWFB 3H3VH 2E2IB 1HUMA 3GDEA 3QB3A 3STBC 2PI2A 4RGOS 5JJKA 1SEBD 2L15A 3U50C 1P16A 1JOQA 1EEFD 3M9BA 3VA7A 4FXDA 4FF1A 4QIWB 4BA1I 4KHPL 3MZ5A 3K0YA 1SROA 4HJ9A 3HOYH 2I0QA 4CGYB 2F0QA 2KBNA 3MC0B 1TWAB 5BN3A 4OO1I 2YTXA 1STEA 2RDHA 3PUZA 1WTVA 1LTID 3WDNA 4K5VA 3L9AX 3HZXA 4LFCL 1OXVA 4U673 2A5HA 3E6ZX 1CA5A 5H1SE 3UE0A 2L9HA 3R2TA 5J39A 5IODA 3LWEA 4DNIA 2MNAA 2JA5H 2B39A 1K73C 2PZWA 2F0UA 2F0GA 2NVYB 4KLKA 1O78A 2NVQB 2Q2UA 1HTLD 4DV2L 3A5UA 2X69A 4L5QA 2CWPA 4IPDA 3CC7A 3BDCA 3T1YQ 2J7ZA 4C56C 4CDDC 2IX3A 3DEOA 4PMCA 1FVIA 3ZJYC 4LF6L 1X56A 5ISRA 2Y0SG 3AEVA 2CKZB 2IHEA 2G9DA 1B44D 4NXNL 2R3ZA 4X62L 2F3VA 3DM1A 1Y1WB 5C0XI 2NTTA 2UXCL 1PRTD 2IHFA 1KDBA 2N8NA 3SR1A 4BBRG 2IT1A 4DAYB 5KNDA 2K50A 4DK6C 1LTLA 1UNSA 4F8MA 4X3KA 5F2DA 3W1BA 3ICEA 4IPCA 2ICEC 4H0LC 2K04A 1B53A 2PNRC 3JAMc 4QUCA 3O13A 4HIKA 3KLWA 3PSIA 5CV7A 1EYAA 3NBIA 4EVOA 1CFMA 4LF5Q 1ML0D 1SAPA 1K9MC 2KHJA 1EY9A 1IBMQ 1CQVA 3HOYB 1SMYC 1NMGA 4HJ5A 4JW0A 2F0MA 5M5WB 1KQSA 3C1FA 1HR0Q 3EROA 4QF4A 4N9PA 3FEWX 3ERQA 1GUSA 4KY6A 1G2SA 4L6TB 1BCPD 1F2YA 3ER0A 2L5TA 4DV3Q 1N33Q 2EYLA 1V1QA 3T56B 3KBGA 1ONLA 4JBKA 4DV3L 1PTOD 2UXDL 1PTOH 1MD2D 3E0JA 1VQEA 2QDLA 1CZWA 1CHPD 3C46A 2PMZB 3DLLA 1PYWD 4XYQA 1BBWA 1IYUA 1JE5A 3P75A 4KMUC 2UXDQ 4WRDA 1I4XA 1PVOA 2AWNA 1QB5D 5I6WA 4UP7A 1PA6A 1MHWC 4KKUA 3TRZA 1LYLA 2F03A 3J81E 2Z6KA 2F4IA 2UUCQ 1TS2A 5C3XA 4K2LA 1KABA 3DWQA 2WINB 1B1ZA 1ET6A 1MI2A 1PH2A 4MIUA 1U4RA 1WTRA 2WAQE 1STGA 2KEEA 4HSPA 4JI8Q 3A74A 2JN4A 2Z4IA 4R1JA 2QDBA 2ASBA 3SGIA 4N8X1 3TS0A 4UP9A 4YCVA 1BOSA 4JI1L 4JYAQ 3MAQA 5A2QE 1G6ZA 1I4QA 1BBUA 4JI1Q 2A69C 3S14H 2K33A 1Z7TA 1ENFA 4YHHQ 3J81j 2A74C 1M90C 1NSNS 4P74A 2NYZD 3P7JA 1UE6A 5C44B 1WTPA 4LFAQ 2FMCA 4JI2Q 1F9PA 1GD7A 3DM3A 2IX0A 4C3HG 4MZ9A 4GKKQ 1M1KC 1Z9FA 2OEOA 4JI5L 4J1MA 1NNXA 1VMPA 3TEHB 3ULJA 4RCNA 4A3MB 1JR0D 4GKKL 2NVXH 3VR5A 2UXBL 3TSSA 1BCPF 2KVMA 4UP8A 1L0XB 1TWCB 5EGTA 1G91A 1XXGA 3F2CA 4BBSG 3GTKH 2R7FA 3KLSX 1TWHB 4XT1B 1AW7A 5JJIA 3H3VI 4DR7Q 1IZ6A 1EL0A 3S1RH 3S1MB 4ULLA 1FR3A 4FXGC 1J9OA 4V190 4DV6Q 1SNOA 2GN5A 2JA8H 1QE6A 4LUOA 1K3RA 3A8KE 1D7QA 4JVZA 1H9RA 4ZKCB 1F2MA 2YU9H 1EWHA 5LMUL 5CV5A 1C0AA 3GO5A 1BXTA 3OTOL 4K0KQ 3GV6A 2XWBB 3OW7A 3D4WA 5AFWA 5E4XA 2KHSA 3K5LA 4OX9L 3HP3A 3FRPB 2R7DA 3FVQA 2K14A 4G57A 4DV5L 1H9KA 3GTQH 1KLGD 3GTPH 2WACA 1PYSB 2RHSB 3VR2A 4ZCKA 4DV5Q 3HOWG 3CPWA 5K36H 2E76C 2ENBA 4ZUIA 2L1BA 1RF2D 2M00A 2DY7A 5E7NA 5BR8Q 1KRTA 4DR2L 1N32Q 4J6HA 1JCKB 3ONAB 2B2TC 1J8IA 1FL0A 3CRLC 4KTAA 1ESFA 1F9SA 2B2TA 1PTOB 2OWOA 4JCVE 1MSHA 2P5ZX 1TR5A 3BJUA 4IUNA 1YNND 4DNRB 4RGMA 3NBHB 2VB3X 2R6GA 4TRDA 3H0GH 4JOIA 4LF7L 1TWCH 2RDGA 1GUNA 3Q0AA 4O1NA 4Z9CB 3QG1A 5FLMH 1WOCA 4YWMA 4B3SQ 2G9HD 1JWUD 4ZKBB 2IL8A 3BZKA 3JC66 4IFDI 4DPGA 4Y7NH 1DYQA 3NE5B 3ND9A 3QO2A 1BCPC 2PZUA 1SNMA 4O0AA 1QNUA 4LF4L 5CV8A 3RR5A 5LL6X 2BH2A 1V8QA 5E4WC 4APVA 2B2UA 2ZTCA 5GAHC 2EE1A 2A6EC 2D5DA 1M8AA 4JC0A 4YWKA 5M3MH 4HIOA 4R8IA 1IBLL 1LTGD 4CDCC 5LMNQ 3AMUA 2IY5B 3A8IE 1K8AC 3S1QB 2CQOA 1HHVA 3RNUA 3KJPA 4DR4L 4OO1G 2OTJA 1LO5D 1CQFA 1V1OA 1A3TA 5M5YH 5KIXA 1EY8A 1YHQA 2D2CC 3I4NH 2EYMA 1Q1BA 1PZID 1GHKA 3TS2A 3Q24A 2MFIA 1UE1A 1SNDA 2C9OA 4DU9A 2F0KA 1I94Q 3K5OA 1EIHA 2YTVA 3PO2H 1JB3A 1QVCA 3GD7A 4K6LA 4P72A 4LF8Q 4NB3A 1B70B 1F2ZA 3G71A 2ES2A 3NHHA 2FJ2A 1VQCA 1EY6A 1D1KA 2D9UA 5ELEA 4DXFA 1TY2A 1EQQA 3MHBA 5K36G 1B3AA 4XQQA 1FNWA 3PO2G 4LJZC 5M5WH 3NEMA 1OXUA 2O4XA 2QF7A 3HS0C 5I9OA 1EZ8A 1EFWA 2HQEA 5IGCA 4A4IA 4YCUA 4BXXG 4DK1A 4BY7H 1WTHA 2EZVA 2EYFA 1FJGL 5D14A 3R3OA 2KCNA 2MPMA 4A3BB 1MIUA 1FJGQ 5IYBG 1MKHA 2YTYA 4DFAA 1E2VA 1V9PA 5CV6A 1J5EL 1RCVD 5KNCA 1VQ8A 4A3LH 2OTLA 3QOLA 1PZJD 1SYBA 2K28A 3OPOA 2O5JC 2WAQG 3J80i 1VF7A 2B8GA 2OQ0A 1IHZA 4LFBL 3K5NA 3RLNA 1TWGH 5FLMG 5DNFA 2JQOA 4IUVA 4CJ1B 4B08A 5JEAG 5IWAL 4LUVA 1QZGA 1C48A 2WP8J 1JOOA 1AZQA 5ELFA 5IWAQ 4JI0Q 1XPOA 3PO3H 2HUGA 3K7UC 1I4PA 2B2WC 1VQFA 2WB1G 4H13C 1UEBA 3W3AA 1Q1EA 3HKSA 2DN8A 1XNQL 2A68C 4POFA 2CCZA 3KF8B 3URYA 1HRJA 2CW0C 2K4KA 1T5EA 2HIXA 2ZXPA 5I2XA 2JA7B 4ZAIA 1WTQA 4OWTB 2F0DA 3A0JA 2JA5B 1PZKD 3WOEA 5IYCG 2NVYH 3MEHA 4J15A 2Q2TA 2QEXA 2N49A 4MHEA 1VQOA 1B8AA 1PH5A 2F4VQ 3P1HA 1ZXTA 3OIQA 4M8AA 3T51B 3CC4A 1PTOC 1LT3D 2R92B 1C9OA 1PFSA 3K80C 1AP0A 2F4VL 1HZBA 4RH6A 1S5ED 1SYGA 3S15B 1X3PA 1SYEA 4QY7A 2SNMA 3S15H 1SMXA 1N36L 1XMQQ 1BF4A 2SOBA 3U9OA 2LFNA 4IPHA 5G3LD 4KKSA 4AH6A 1N36Q 1SYCA 1YBYA 4IFDH 1IXRA 4R8NA 2Z8LA 3SHLA 1TS5A 1X3EA 1EY4A 4X6AH 3V2TA 4P73A 4BBRB 1ENAA 5E3FA 1KNEA 4DV7L 1TWHH 4L5TA 5BN4A 1YJ9A 1YHAA 1VQHA 1T5XD 1YJNA 4NP5A 3S1RB 2HCCA 2XRSD 2NUCA 4F88A 3S1MH 3DEPA 4HIDA 3NP8A 1RL2A 4GNXB 1X6OA 4RGNA 3PCOB 3CP0A 4GN5A 1GHJA 3I91A 1Y69U 4OXPA 2RF4A 4TQUS 4XIGS 1HFNA 2UU9Q 5JAVA 3KYHC 3D8GA 1A8VA 1VQGA 4X3TA 3QWNA 3EJIA 4CKBA 4G7ZC 3ULPA 1DOKA 2NVQH 2JJQA 5C4XH 3CF5A 5CR3A 4N9TA 3PF4A 4X65L 1E1TA 1IL2A 1X65A 1VQDA 3LGJA 4LNQA 1I5FA 4A93H 1ENCA 3PMFA 4UAIA 2ZJQA 3KF6B 4UPAA 2TMPA 3DWPA 5BR8L 1JT8A 4AYBB 4DAVA 3PIOA 4FF2A 3FKIH 1XJVA 4F7XA 4X66Q 4UHVA 1WD1A 4BXXH 1ET9A 1I3QH 3QOJA 3FMCA 3HOXH 1SMYD 3CPFA 3SK4A 2FINB 4R4QA 3RUZA 1JMCA 1X3GA 5FO8B 1JWSD 4PZ6A 1CHQD 3HKZB 2Q2IA 2Y0SB 2AQ3B 4A3FG 4OHJA 2PPBC 1ICFB 1VQMA 2L55A 3IFDA 3CCSA 1PFBA 2B2UC 2XWJB 5D3DA 4RWSC 4LF7Q 1DOMA 1EYCA 1EYDA 2BCOA 3M85A 3BDLA 2UUBL 2D62A 1IBKL 2F1MA 4C3JB 3HKZG 1L1OC 1I4RA 4DN4M 2XSCA 3GTLH 1H9JA 2K7VA 2J0TD 4U68A 3BVZA 3M3YH 1LTRD 1ZYRD 1R9TB 1QILA 2AQ1B 5M3FH 5C5MA 1WCMG 1VMCA 2OQKA 4NXML 4HJ7A 5AJ3Q 4GN4B 2A68D 5JPNC 1JWMD 1E1OA 3F8TA 3MVVA 4OWWB 2A6HC 2I5HA 2F0JA 5EKIA 3HOWH 3V96A 4QIWE 1LTBD 4JV5L 3B6YA 3PIO3 5C44G 1ILPA 3VYRA 2R92H 3AB9A 4K2KA 4JV5Q 4C3IH 4IUPA 4ZQ3A 3HGBA 3CCJA 2ICIA 5HY6A 1LUZA 4DKAC 2YU9B 3A56A 5M9OA 1BCPB 3AFQA 4RG1A 3FP9A 3L7ZC 3UI2A 2RHQB 3CCMA 2I5LX 2PQEA 2RCNA 3SK8A 1WYDA 1A15A 1YNNC 2F0WA 4IQZA 4LF8L 2EQSA 2JA6G 1K0RA 3J7A5 4XTCS 3I56A 5HGQA 1EOVA 4OL7A 3HG9A 4R9WA 5EPKA 2JA9A 3A7LA 4NDXA 4A3JB 2I5MX 4JI4Q 4DA2A 2D0OA 2M9VA 2EJFC 3MTSA 1AE3A 2KECA 3GTJH 1SSOA 3HOVG 4L5SA 5IGFA 2N78A 2JSOA 3VYTA 2JA6B 3RD4A 4JI6Q 3GTPB 2I07B 1U9RA 2EXDA 1BQQT 1LTAD 3TP6A 4PQXA 4K5XA 1STHA 2L4NA 4GKJL 3F2UA 2K5NA 2EYPA 4L5RC 4R4OA 1Z47A 1W3SA 2DGYA 5CBEE 2F0IA 4A3BH 2CHBD 4UY8C 3GTMB 2D0PA 1J5EQ 1TWGB 2CQAA 4FP5D 5DAUA 2ZM6Q 3HOVB 4R4CA 1TWAH 4OONA 2RQXA 1JOKA 3GTMH 2E2DC 3I90A 1QNKA 5J22A 1Q86C 4DNTB 5KYIA 3K8AA 4IZ8A 3R8BA 2F0PA 5JOBA 4OWXB 3BZDB 2SNSA 3BVGA 3E5SA 4A3EG 2EY2A 1PH7A 2VUMB
chains in the Genus database with same CATH topology
3HOUG 1L1OB 5E7NA 3EBEA 1DGSA 3D31A 5BR8Q 1QUQA 1KRTA 4DR2L 1E7ZA 4BA2I 1N32Q 3CMEA 4A3MH 2B63H 3M4PA 5JEAJ 4YY3Q 4JBWA 3U58A 1VQ5A 1FL0A 4A3JG 4JI3Q 3HOUH 1CKMA 2XGTA 4GLAC 4LF9Q 2JA7H 2MO1A 4GKKL 4A76A 3GTOH 3H0GG 3NELA 1K8GA 5IYDH 1KL9A 1CSQA 4JCVE 5GADC 2OWOA 3BJUA 1NTGA 1KHIA 1EYGA 4IPGA 3CCVA 3NBHB 2JEAI 2R6GA 1IBML 5C44H 3H0GH 2F3IA 4JOIA 1L0WA 4LF7L 1TWCH 4B3RL 4FDBA 3CCUA 1U0LA 2AKWB 5FLMH 1WOCA 4YWMA 4B3SQ 4JI6L 4BBSH 4LF6Q 2UUAQ 1I6HH 2H5XA 4DV0L 2E5LQ 1NE3A 5M3MG 2ID0A 1K83H 4ME3A 1UE7A 2GVAA 3BZKA 3JC66 3K0XA 4LW1A 1TXYA 4DPGA 5IP7G 4IJLA 4Y7NH 1XMOL 1QVGA 1MJEA 4IFDI 4DUYL 4B3TQ 2FXQA 1XMOQ 4O0AA 1CKNA 2CWAA 4POGA 3OTOQ 4LF4L 2UUCL 3RR5A 4DV4L 1XNRL 2JA8G 2BH2A 3CQZH 4APVA 1OTCA 1KD1C 2ZTCA 5GAHC 1I50H 4DUZL 4HJ8A 2VUMG 3S1NH 2QGQA 3E9HA 4MTNA 1HNXQ 2WFWA 4JC0A 4YWKA 4GLVB 5M3MH 1YIJA 1VQ6A 1HJPA 2DUDA 4HIOA 2AMCB 1IBLL 5LMNQ 2UUBQ 1L1OA 3KDFA 1N9WA 3M4QA 1V43A 3E0EA 5C0XG 3KJOA 2IY5B 2VL6A 1K8AC 2CQOA 1C7YA 1VQJA 3KF6A 4X65Q 3RNUA 3UDFA 3I4MH 3KFUA 3KJPA 4BY1G 4LWCA 4DR4L 4B3MQ 4OO1G 3CCLA 2VQEL 1OXXK 1EIYB 3I55A 2E2HH 1RIPA 3W1GA 3M4OH 4QQBX 1EQRA 2AHOB 2OTJA 4C3HH 1R9TH 1VQ7A 1VQBA 4LUZA 4BY7G 3F2DA 1UWVA 2VQEQ 5M5YH 2Y0SE 4YY3L 1YHQA 3I4NH 3RZDH 3CCQA 2K52A 1Q1BA 4JBJA 2UU9L 3HOZH 3TS2A 1YITA 3CW2C 1PH1A 2MFIA 1UE1A 5C3EG 1PH3A 4DAMA 5IY0A 5EAYA 1PH6A 4R4IA 1HR0L 1I94Q 3J80c 4JI2L 3S1QH 4X64L 2YTVA 2HHHQ 3CMAA 3PO2H 1QVCA 3GD7A 2E2JH 1VS0A 2EIFA 3K81C 4P72A 4LF8Q 4IFDG 4P75A 2HQLA 4NB3A 1B70B 3HOZG 1QVFA 4WJ4A 1SRUA 3G71A 2E8GA 2HHHL 2B3GA 3D0FA 2ES2A 5IYDG 1GVPA 1VQCA 4GLXA 3I4NG 3G6EA 2LXKA 4PZ8A 3PUYA 1A0IA 2CFMA 5C4XG 2ZJPA 4DR5Q 1EQQA 3F2BA 5IYBH 4C2MH 3KDFB 1BKBA 5K36G 4IOCA 2JEBI 3I4MG 1IBKQ 3PO2G 2B29A 2R7ZG 5M5WH 3NEMA 1OXUA 4A3LG 4DR7L 1EFWA 4PZ7A 2JA5G 3S24A 4A4IA 4YCUA 4BXXG 5GQOA 4BY7H 1GKHA 1FJGL 3I4OA 1CUKA 1S3OA 1YHBA 4IFDJ 3H15A 5LMUQ 4DUZQ 1YVCA 2QA4A 1MIUA 5FLXc 1A63A 1FJGQ 3HKZE 5IYBG 1MKHA 2YTYA 3BU2A 3PGZA 4DR1Q 3CD6A 1V9PA 1XMQL 4A3FH 1LM0A 1J5EL 1Q46A 5AJ3L 5GAEC 4A3EH 4JI7Q 1ASZA 4A3GH 3PO3G 1VQ8A 1T9HA 3CAMA 4A3LH 1EIFA 3T1HL 2OTLA 2MO0A 1Q12A 4JI8L 4ALPA 1JJCB 1XPUA 2WAQG 3J80i 4EQ5A 2OQ0A 3T1HQ 4LFBL 3RLNA 2PQAA 3AFPA 1PHJA 2HT1A 1TWGH 3TREA 1HH2P 4AIMA 1VQNA 3ULLA 4HIMA 5FLMG 4A3BG 1X3FA 2JQOA 4IJHA 4A75A 3NENA 5JEAG 5IWAL 4A3JH 4LUVA 2PMZE 1QZGA 1PH9A 5JJLA 3CCRA 1KAWA 2WP8J 2JA7G 4IO9A 4GOPC 1BVSA 4IOAA 5IWAQ 5C0XJ 4PG3A 1XPOA 1P8LA 4JI0Q 1Q8KA 3PO3H 3S2DH 1J6QA 4A3KH 4MNOA 3K7UC 2ATWA 2ZM6L 1KIXA 2VY3A 3OW2A 1VQFA 2WB1G 3RLOA 1UEBA 1Q1EA 1HR0W 2JK8A 2E2IH 1E22A 4LFAL 3HKSA 4A3CG 3H3VH 3GDEA 3STBC 1XNQL 2PI2A 5JJKA 4POFA 2CCZA 2PI2E 4DK3C 3KF8B 4NPSA 2VUMH 2K4KA 4A3KG 2HIXA 5ELOA 2L15A 1CKNB 4OWTB 1P16A 3U50C 2VW9A 3A0JA 3M9BA 3A5ZB 2UXBQ 5IYCG 2NVYH 3KOJA 4J15A 4BA1I 2Q2TA 4KHPL 2QEXA 4DV1Q 2YYZA 4HJ9A 1SROA 2N49A 3HOYH 1VQOA 2I0QA 2VNUD 1B8AA 2KBNA 2IX1A 1E24A 1PH5A 2F4VQ 1Y1VG 3HFZB 1VQLA 4YWLA 2V1CC 4DV1L 3CC4A 4OO1I 3HOXG 2YTXA 1C9OA 1PFSA 3K80C 4JBMA 3PUZA 3JAMi 1E3PA 2UUAL 2F4VL 5GROA 1HZBA 1AE2A 3UDXA 1JJ2A 5M3FG 4LFCL 4X66L 1OXVA 1HNWQ 2R7ZH 5H1SE 1Y1VH 3UE0A 4DV6L 4QY7A 2NZOA 4GNXA 1GO3E 3BZCA 4DUYQ 2JA5H 4DNIA 2MNAA 4B3TL 1Y1WH 1Y14B 1K73C 2K75A 3S15H 1SMXA 1HNWL 1GM5A 4DR1L 4R4TA 1N36L 1PYBA 4KLKA 1KC8C 2R93H 1XMQQ 4DV4Q 3HOYG 1XNRQ 1CSPA 2Q2UA 4DV2L 1W2BA 4GS3A 3A5UA 2JA6H 4BY1H 1VQAA 4IPHA 4L5QA 4AH6A 1N36Q 2CWPA 4IPDA 1WFQA 1YBYA 3AQQA 1IXRA 2KCTA 3CC7A 3T1YQ 1X3EA 1O7IA 3I7FA 4JI4L 4X6AH 4P73A 1FVIA 4A3GG 4LFBQ 3PUVA 3ZJYC 4DV7L 4LF6L 1X56A 1TWHH 4A3IG 4L5TA 2E5LL 3GTGH 1YJ9A 3S2HH 2Y0SG 2ALYB 3AEVA 1YHAA 5DLQE 2CKZB 1VQHA 2IHEA 3G4SA 4DR6L 4NXNL 1YJNA 4AYBE 1Q82C 4X62L 3S1MH 2XTIA 2Q2HA 5C3EH 3U4ZA 4B3ML 4HIDA 5C0XI 4DR6Q 1RL2A 1TWFH 4JI0L 4GNXB 1WCMH 4AQYQ 1X6OA 4WJ3M 3PCOB 2UXCL 3FHWA 1SLJA 2IHFA 2N8NA 3CP0A 1PH8A 4BBRG 3Q8DA 2IT1A 4GN5A 4DAYB 4DR2Q 1IYJB 1N32L 4OXPA 2RF4A 4TQUS 4XIGS 2UU9Q 3KYHC 2K50A 1NBWA 1A8VA 1LTLA 1NY4A 1VQGA 4DK6C 4GOPA 3ULPA 4NXMQ 2NVQH 3W1BA 1HNZL 3ICEA 4IPCA 1X55A 2JJQA 3WWVA 5C4XH 2Z0SA 3CF5A 1Y1WG 3J7ZC 2R92G 3PF4A 1B7YB 1NMFA 3JAMc 1HNZQ 2NN6I 1VQ4A 4GN3B 4X65L 1E1TA 4HIKA 1IL2A 1X65A 1OXSC 3KLWA 3PSIA 4P71A 4DR4Q 2C35B 2AWOA 1VQDA 2K5VA 3LGJA 1I5FA 4LNQA 4A93H 3F1ZA 4A3DG 4LF5Q 4H02A 1K9MC 2KHJA 1IBMQ 3MXNB 4JYAL 1X54A 2ZJQA 3KF6B 4UPAA 5BR8L 1JT8A 1PV4A 4HJ5A 1NMGA 4Y52H 2BA1A 3PIOA 3FKIH 1XJVA 4LFCQ 5J3BA 4X66Q 1L2FA 1KRSA 4GNXC 4A93G 1KQSA 4BXXH 2NN6G 2JE6I 4DV0Q 1HR0Q 1I3QH 2PQAB 3HOXH 1I94L 3CPFA 4JI3L 4YHHL 5IP9H 4R4QA 4KHZA 4C3JH 1VQKA 1JMCA 1X3GA 1ASYA 4RMFA 4PZ6A 1WI5A 2Q2IA 1EWIA 4DR3L 1YZ6A 4A3FG 2KHIA 3ER0A 3T1YL 4JI5Q 1VQMA 1Q81C 4AYBG 1SFOH 2HIVA 3E9IA 5IP9G 3CCSA 4DV3Q 1N33Q 3AYHB 4JOIC 4DR3Q 3RZOH 1V1QA 4KI0A 4HJAA 1YJWA 5GAGC 4LF7Q 4DR5L 1HNXL 4B3RQ 4JBKA 4DV3L 2UXDL 4QGUA 1S72A 1VQEA 3W5OA 3M85A 1S40A 4YCWA 1IBLQ 5LMNL 2UUBL 2D62A 3K7AH 3DLLA 1IBKL 1BBWA 1JE5A 3HKZG 2UXDQ 1L1OC 3TQYA 2Z6KC 1PVOA 2AWNA 3GTLH 3S17H 3PUWA 3PUXA 4UP7A 5IE8A 1N8RC 1PA6A 1VQPA 3TRZA 5M5XH 1LYLA 3M3YH 1CKOA 1G291 2Z6KA 1U5KA 2UUCQ 5M3FH 4GKJQ 2LXJA 1WCMG 4NXML 2OQKA 1PH2A 4A3CH 4HJ7A 1SN8A 1YI2A 4QL5A 5AJ3Q 2WAQE 4GN4B 4JI7L 1OXTA 1E1OA 3F8TA 4OWWB 4K0KL 2R93G 1WJJA 2I5HA 4JI8Q 2BH8A 4OX9Q 3A74A 1EUJA 3HOWH 4QIWE 4R1JA 3RN5A 2ASBA 4JV5L 3SGIA 5IYCH 3B6YA 3TS0A 5C44G 4UP9A 3S16H 1JJGA 4YCVA 2R92H 2N3SA 2KENA 5C4JH 2MQHA 4JV5Q 4JI1L 4JYAQ 4C3IH 3J81c 4KHPQ 1YEZA 2VQFQ 1BBUA 4JI1Q 3CCJA 4A3MG 5HY6A 1LUZA 4DKAC 3VDYA 1XPRA 3S14H 4A3DH 3AFQA 2OCEA 3U4VA 4RG1A 3FP9A 2VQFL 3RN2A 1AH9A 4YHHQ 3J81j 1M90C 1HZCA 3L7ZC 4P74A 1UE6A 2RHQB 2VS1A 4LFAQ 2A8VA 3FKIG 3L2PA 5ELNA 3CCMA 3PV0A 4JI2Q 1X9NA 1GD7A 2I5LX 2RCNA 2IX0A 3DM3A 3OYYA 4MZ9A 4X64Q 4GKKQ 1KXLA 1WYDA 1M1KC 1Z9FA 3J81i 4JI5L 1SE8A 1A62A 2BA0A 4LF8L 3TEHB 2EQSA 1XTDA 3ULJA 4LF9L 2JA6G 1K0RA 4A3IH 3J7A5 4XTCS 3I56A 5HGQA 1EOVA 3UDGA 1N34L 2NVXH 1N33L 2UXBL 4DV2Q 4UP8A 1SR3A 2KCMA 5IT9c 3M7NA 1N34Q 2ZJRA 1G51A 3G48A 2JA9A 2NVTH 3F2CA 4BBSG 4EX5A 3GTKH 2F52A 2I5MX 4JI4Q 2R7FA 3STBD 2D0OA 4O2DA 3CXCA 3MEFA 2ZTEA 1UE5A 5JJIA 3H3VI 1AE3A 1QUQB 3UE1A 3PIPA 3GTJH 2NZHA 4BBRH 3HOVG 1H95A 4L5SA 3EN2A 3IRBA 2N78A 2WB1E 1IZ6A 4DR7Q 4B3SL 2K5HA 3S1RH 4JI6Q 2ZTDA 2EXDA 1Q7YC 4DV6Q 2PNHA 2GN5A 1QZHA 1JB7A 1VQ9A 4GKJL 2JA8H 2GVBA 2VZAA 1MJCA 3RLFA 1K3RA 4LUOA 2K5NA 3PF5A 3CC2A 4L5RC 4AQYL 4JG2A 1D7QA 2YU9H 4R4OA 2UXCQ 5LMUL 1Z47A 1W3SA 2DGYA 5FJ8H 1C0AA 3GO5A 4A3BH 4UY8C 1VQIA 3OTOL 4LF4Q 4K0KQ 2D0PA 1J5EQ 2LSSA 2ZM6Q 4QJFA 4R4CA 1HZ9A 1TWAH 4OONA 5LMNW 4TVAB 3HOVH 4OX9L 2YV5A 2R7DA 1VCIA 4PMWA 2K14A 4DV5L 3GTMH 3GTQH 2A19A 4DV7Q 3ERSX 4GOPB 1XNQQ 5FJ8G 3GTPH 1HZAA 1G6PA 1PYSB 2RHSB 3I2ZA 1Q86C 3K8AA 3L0OA 4DV5Q 1D8LA 4NXNQ 4X62Q 1YNXA 4OWXB 2A1AA 3HOWG 3UDIA 1NJIC 3CPWA 2B63G 1FGUA 3CCEA 1PH4A 4A3EG 1PH7A 5IP7H 4LF5L 3EIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU G;  1L1O B;  5E7N A;  3EBE A;  1DGS A;  3D31 A;  5BR8 Q;  1QUQ A;  1KRT A;  4DR2 L;  1E7Z A;  4BA2 I;  1N32 Q;  3CME A;  4A3M H;  2B63 H;  3M4P A;  5JEA J;  4YY3 Q;  4JBW A;  3U58 A;  1VQ5 A;  1FL0 A;  4A3J G;  4JI3 Q;  3HOU H;  1CKM A;  2XGT A;  4GLA C;  4LF9 Q;  2JA7 H;  2MO1 A;  4GKK L;  4A76 A;  3GTO H;  3H0G G;  3NEL A;  1K8G A;  5IYD H;  1KL9 A;  1CSQ A;  4JCV E;  5GAD C;  2OWO A;  3BJU A;  1NTG A;  1KHI A;  1EYG A;  4IPG A;  3CCV A;  3NBH B;  2JEA I;  2R6G A;  1IBM L;  5C44 H;  3H0G H;  2F3I A;  4JOI A;  1L0W A;  4LF7 L;  1TWC H;  4B3R L;  4FDB A;  3CCU A;  1U0L A;  2AKW B;  5FLM H;  1WOC A;  4YWM A;  4B3S Q;  4JI6 L;  4BBS H;  4LF6 Q;  2UUA Q;  1I6H H;  2H5X A;  4DV0 L;  2E5L Q;  1NE3 A;  5M3M G;  2ID0 A;  1K83 H;  4ME3 A;  1UE7 A;  2GVA A;  3BZK A;  3JC6 6;  3K0X A;  4LW1 A;  1TXY A;  4DPG A;  5IP7 G;  4IJL A;  4Y7N H;  1XMO L;  1QVG A;  1MJE A;  4IFD I;  4DUY L;  4B3T Q;  2FXQ A;  1XMO Q;  4O0A A;  1CKN A;  2CWA A;  4POG A;  3OTO Q;  4LF4 L;  2UUC L;  3RR5 A;  4DV4 L;  1XNR L;  2JA8 G;  2BH2 A;  3CQZ H;  4APV A;  1OTC A;  1KD1 C;  2ZTC A;  5GAH C;  1I50 H;  4DUZ L;  4HJ8 A;  2VUM G;  3S1N H;  2QGQ A;  3E9H A;  4MTN A;  1HNX Q;  2WFW A;  4JC0 A;  4YWK A;  4GLV B;  5M3M H;  1YIJ A;  1VQ6 A;  1HJP A;  2DUD A;  4HIO A;  2AMC B;  1IBL L;  5LMN Q;  2UUB Q;  1L1O A;  3KDF A;  1N9W A;  3M4Q A;  1V43 A;  3E0E A;  5C0X G;  3KJO A;  2IY5 B;  2VL6 A;  1K8A C;  2CQO A;  1C7Y A;  1VQJ A;  3KF6 A;  4X65 Q;  3RNU A;  3UDF A;  3I4M H;  3KFU A;  3KJP A;  4BY1 G;  4LWC A;  4DR4 L;  4B3M Q;  4OO1 G;  3CCL A;  2VQE L;  1OXX K;  1EIY B;  3I55 A;  2E2H H;  1RIP A;  3W1G A;  3M4O H;  4QQB X;  1EQR A;  2AHO B;  2OTJ A;  4C3H H;  1R9T H;  1VQ7 A;  1VQB A;  4LUZ A;  4BY7 G;  3F2D A;  1UWV A;  2VQE Q;  5M5Y H;  2Y0S E;  4YY3 L;  1YHQ A;  3I4N H;  3RZD H;  3CCQ A;  2K52 A;  1Q1B A;  4JBJ A;  2UU9 L;  3HOZ H;  3TS2 A;  1YIT A;  3CW2 C;  1PH1 A;  2MFI A;  1UE1 A;  5C3E G;  1PH3 A;  4DAM A;  5IY0 A;  5EAY A;  1PH6 A;  4R4I A;  1HR0 L;  1I94 Q;  3J80 c;  4JI2 L;  3S1Q H;  4X64 L;  2YTV A;  2HHH Q;  3CMA A;  3PO2 H;  1QVC A;  3GD7 A;  2E2J H;  1VS0 A;  2EIF A;  3K81 C;  4P72 A;  4LF8 Q;  4IFD G;  4P75 A;  2HQL A;  4NB3 A;  1B70 B;  3HOZ G;  1QVF A;  4WJ4 A;  1SRU A;  3G71 A;  2E8G A;  2HHH L;  2B3G A;  3D0F A;  2ES2 A;  5IYD G;  1GVP A;  1VQC A;  4GLX A;  3I4N G;  3G6E A;  2LXK A;  4PZ8 A;  3PUY A;  1A0I A;  2CFM A;  5C4X G;  2ZJP A;  4DR5 Q;  1EQQ A;  3F2B A;  5IYB H;  4C2M H;  3KDF B;  1BKB A;  5K36 G;  4IOC A;  2JEB I;  3I4M G;  1IBK Q;  3PO2 G;  2B29 A;  2R7Z G;  5M5W H;  3NEM A;  1OXU A;  4A3L G;  4DR7 L;  1EFW A;  4PZ7 A;  2JA5 G;  3S24 A;  4A4I A;  4YCU A;  4BXX G;  5GQO A;  4BY7 H;  1GKH A;  1FJG L;  3I4O A;  1CUK A;  1S3O A;  1YHB A;  4IFD J;  3H15 A;  5LMU Q;  4DUZ Q;  1YVC A;  2QA4 A;  1MIU A;  5FLX c;  1A63 A;  1FJG Q;  3HKZ E;  5IYB G;  1MKH A;  2YTY A;  3BU2 A;  3PGZ A;  4DR1 Q;  3CD6 A;  1V9P A;  1XMQ L;  4A3F H;  1LM0 A;  1J5E L;  1Q46 A;  5AJ3 L;  5GAE C;  4A3E H;  4JI7 Q;  1ASZ A;  4A3G H;  3PO3 G;  1VQ8 A;  1T9H A;  3CAM A;  4A3L H;  1EIF A;  3T1H L;  2OTL A;  2MO0 A;  1Q12 A;  4JI8 L;  4ALP A;  1JJC B;  1XPU A;  2WAQ G;  3J80 i;  4EQ5 A;  2OQ0 A;  3T1H Q;  4LFB L;  3RLN A;  2PQA A;  3AFP A;  1PHJ A;  2HT1 A;  1TWG H;  3TRE A;  1HH2 P;  4AIM A;  1VQN A;  3ULL A;  4HIM A;  5FLM G;  4A3B G;  1X3F A;  2JQO A;  4IJH A;  4A75 A;  3NEN A;  5JEA G;  5IWA L;  4A3J H;  4LUV A;  2PMZ E;  1QZG A;  1PH9 A;  5JJL A;  3CCR A;  1KAW A;  2WP8 J;  2JA7 G;  4IO9 A;  4GOP C;  1BVS A;  4IOA A;  5IWA Q;  5C0X J;  4PG3 A;  1XPO A;  1P8L A;  4JI0 Q;  1Q8K A;  3PO3 H;  3S2D H;  1J6Q A;  4A3K H;  4MNO A;  3K7U C;  2ATW A;  2ZM6 L;  1KIX A;  2VY3 A;  3OW2 A;  1VQF A;  2WB1 G;  3RLO A;  1UEB A;  1Q1E A;  1HR0 W;  2JK8 A;  2E2I H;  1E22 A;  4LFA L;  3HKS A;  4A3C G;  3H3V H;  3GDE A;  3STB C;  1XNQ L;  2PI2 A;  5JJK A;  4POF A;  2CCZ A;  2PI2 E;  4DK3 C;  3KF8 B;  4NPS A;  2VUM H;  2K4K A;  4A3K G;  2HIX A;  5ELO A;  2L15 A;  1CKN B;  4OWT B;  1P16 A;  3U50 C;  2VW9 A;  3A0J A;  3M9B A;  3A5Z B;  2UXB Q;  5IYC G;  2NVY H;  3KOJ A;  4J15 A;  4BA1 I;  2Q2T A;  4KHP L;  2QEX A;  4DV1 Q;  2YYZ A;  4HJ9 A;  1SRO A;  2N49 A;  3HOY H;  1VQO A;  2I0Q A;  2VNU D;  1B8A A;  2KBN A;  2IX1 A;  1E24 A;  1PH5 A;  2F4V Q;  1Y1V G;  3HFZ B;  1VQL A;  4YWL A;  2V1C C;  4DV1 L;  3CC4 A;  4OO1 I;  3HOX G;  2YTX A;  1C9O A;  1PFS A;  3K80 C;  4JBM A;  3PUZ A;  3JAM i;  1E3P A;  2UUA L;  2F4V L;  5GRO A;  1HZB A;  1AE2 A;  3UDX A;  1JJ2 A;  5M3F G;  4LFC L;  4X66 L;  1OXV A;  1HNW Q;  2R7Z H;  5H1S E;  1Y1V H;  3UE0 A;  4DV6 L;  4QY7 A;  2NZO A;  4GNX A;  1GO3 E;  3BZC A;  4DUY Q;  2JA5 H;  4DNI A;  2MNA A;  4B3T L;  1Y1W H;  1Y14 B;  1K73 C;  2K75 A;  3S15 H;  1SMX A;  1HNW L;  1GM5 A;  4DR1 L;  4R4T A;  1N36 L;  1PYB A;  4KLK A;  1KC8 C;  2R93 H;  1XMQ Q;  4DV4 Q;  3HOY G;  1XNR Q;  1CSP A;  2Q2U A;  4DV2 L;  1W2B A;  4GS3 A;  3A5U A;  2JA6 H;  4BY1 H;  1VQA A;  4IPH A;  4L5Q A;  4AH6 A;  1N36 Q;  2CWP A;  4IPD A;  1WFQ A;  1YBY A;  3AQQ A;  1IXR A;  2KCT A;  3CC7 A;  3T1Y Q;  1X3E A;  1O7I A;  3I7F A;  4JI4 L;  4X6A H;  4P73 A;  1FVI A;  4A3G G;  4LFB Q;  3PUV A;  3ZJY C;  4DV7 L;  4LF6 L;  1X56 A;  1TWH H;  4A3I G;  4L5T A;  2E5L L;  3GTG H;  1YJ9 A;  3S2H H;  2Y0S G;  2ALY B;  3AEV A;  1YHA A;  5DLQ E;  2CKZ B;  1VQH A;  2IHE A;  3G4S A;  4DR6 L;  4NXN L;  1YJN A;  4AYB E;  1Q82 C;  4X62 L;  3S1M H;  2XTI A;  2Q2H A;  5C3E H;  3U4Z A;  4B3M L;  4HID A;  5C0X I;  4DR6 Q;  1RL2 A;  1TWF H;  4JI0 L;  4GNX B;  1WCM H;  4AQY Q;  1X6O A;  4WJ3 M;  3PCO B;  2UXC L;  3FHW A;  1SLJ A;  2IHF A;  2N8N A;  3CP0 A;  1PH8 A;  4BBR G;  3Q8D A;  2IT1 A;  4GN5 A;  4DAY B;  4DR2 Q;  1IYJ B;  1N32 L;  4OXP A;  2RF4 A;  4TQU S;  4XIG S;  2UU9 Q;  3KYH C;  2K50 A;  1NBW A;  1A8V A;  1LTL A;  1NY4 A;  1VQG A;  4DK6 C;  4GOP A;  3ULP A;  4NXM Q;  2NVQ H;  3W1B A;  1HNZ L;  3ICE A;  4IPC A;  1X55 A;  2JJQ A;  3WWV A;  5C4X H;  2Z0S A;  3CF5 A;  1Y1W G;  3J7Z C;  2R92 G;  3PF4 A;  1B7Y B;  1NMF A;  3JAM c;  1HNZ Q;  2NN6 I;  1VQ4 A;  4GN3 B;  4X65 L;  1E1T A;  4HIK A;  1IL2 A;  1X65 A;  1OXS C;  3KLW A;  3PSI A;  4P71 A;  4DR4 Q;  2C35 B;  2AWO A;  1VQD A;  2K5V A;  3LGJ A;  1I5F A;  4LNQ A;  4A93 H;  3F1Z A;  4A3D G;  4LF5 Q;  4H02 A;  1K9M C;  2KHJ A;  1IBM Q;  3MXN B;  4JYA L;  1X54 A;  2ZJQ A;  3KF6 B;  4UPA A;  5BR8 L;  1JT8 A;  1PV4 A;  4HJ5 A;  1NMG A;  4Y52 H;  2BA1 A;  3PIO A;  3FKI H;  1XJV A;  4LFC Q;  5J3B A;  4X66 Q;  1L2F A;  1KRS A;  4GNX C;  4A93 G;  1KQS A;  4BXX H;  2NN6 G;  2JE6 I;  4DV0 Q;  1HR0 Q;  1I3Q H;  2PQA B;  3HOX H;  1I94 L;  3CPF A;  4JI3 L;  4YHH L;  5IP9 H;  4R4Q A;  4KHZ A;  4C3J H;  1VQK A;  1JMC A;  1X3G A;  1ASY A;  4RMF A;  4PZ6 A;  1WI5 A;  2Q2I A;  1EWI A;  4DR3 L;  1YZ6 A;  4A3F G;  2KHI A;  3ER0 A;  3T1Y L;  4JI5 Q;  1VQM A;  1Q81 C;  4AYB G;  1SFO H;  2HIV A;  3E9I A;  5IP9 G;  3CCS A;  4DV3 Q;  1N33 Q;  3AYH B;  4JOI C;  4DR3 Q;  3RZO H;  1V1Q A;  4KI0 A;  4HJA A;  1YJW A;  5GAG C;  4LF7 Q;  4DR5 L;  1HNX L;  4B3R Q;  4JBK A;  4DV3 L;  2UXD L;  4QGU A;  1S72 A;  1VQE A;  3W5O A;  3M85 A;  1S40 A;  4YCW A;  1IBL Q;  5LMN L;  2UUB L;  2D62 A;  3K7A H;  3DLL A;  1IBK L;  1BBW A;  1JE5 A;  3HKZ G;  2UXD Q;  1L1O C;  3TQY A;  2Z6K C;  1PVO A;  2AWN A;  3GTL H;  3S17 H;  3PUW A;  3PUX A;  4UP7 A;  5IE8 A;  1N8R C;  1PA6 A;  1VQP A;  3TRZ A;  5M5X H;  1LYL A;  3M3Y H;  1CKO A;  1G29 1;  2Z6K A;  1U5K A;  2UUC Q;  5M3F H;  4GKJ Q;  2LXJ A;  1WCM G;  4NXM L;  2OQK A;  1PH2 A;  4A3C H;  4HJ7 A;  1SN8 A;  1YI2 A;  4QL5 A;  5AJ3 Q;  2WAQ E;  4GN4 B;  4JI7 L;  1OXT A;  1E1O A;  3F8T A;  4OWW B;  4K0K L;  2R93 G;  1WJJ A;  2I5H A;  4JI8 Q;  2BH8 A;  4OX9 Q;  3A74 A;  1EUJ A;  3HOW H;  4QIW E;  4R1J A;  3RN5 A;  2ASB A;  4JV5 L;  3SGI A;  5IYC H;  3B6Y A;  3TS0 A;  5C44 G;  4UP9 A;  3S16 H;  1JJG A;  4YCV A;  2R92 H;  2N3S A;  2KEN A;  5C4J H;  2MQH A;  4JV5 Q;  4JI1 L;  4JYA Q;  4C3I H;  3J81 c;  4KHP Q;  1YEZ A;  2VQF Q;  1BBU A;  4JI1 Q;  3CCJ A;  4A3M G;  5HY6 A;  1LUZ A;  4DKA C;  3VDY A;  1XPR A;  3S14 H;  4A3D H;  3AFQ A;  2OCE A;  3U4V A;  4RG1 A;  3FP9 A;  2VQF L;  3RN2 A;  1AH9 A;  4YHH Q;  3J81 j;  1M90 C;  1HZC A;  3L7Z C;  4P74 A;  1UE6 A;  2RHQ B;  2VS1 A;  4LFA Q;  2A8V A;  3FKI G;  3L2P A;  5ELN A;  3CCM A;  3PV0 A;  4JI2 Q;  1X9N A;  1GD7 A;  2I5L X;  2RCN A;  2IX0 A;  3DM3 A;  3OYY A;  4MZ9 A;  4X64 Q;  4GKK Q;  1KXL A;  1WYD A;  1M1K C;  1Z9F A;  3J81 i;  4JI5 L;  1SE8 A;  1A62 A;  2BA0 A;  4LF8 L;  3TEH B;  2EQS A;  1XTD A;  3ULJ A;  4LF9 L;  2JA6 G;  1K0R A;  4A3I H;  3J7A 5;  4XTC S;  3I56 A;  5HGQ A;  1EOV A;  3UDG A;  1N34 L;  2NVX H;  1N33 L;  2UXB L;  4DV2 Q;  4UP8 A;  1SR3 A;  2KCM A;  5IT9 c;  3M7N A;  1N34 Q;  2ZJR A;  1G51 A;  3G48 A;  2JA9 A;  2NVT H;  3F2C A;  4BBS G;  4EX5 A;  3GTK H;  2F52 A;  2I5M X;  4JI4 Q;  2R7F A;  3STB D;  2D0O A;  4O2D A;  3CXC A;  3MEF A;  2ZTE A;  1UE5 A;  5JJI A;  3H3V I;  1AE3 A;  1QUQ B;  3UE1 A;  3PIP A;  3GTJ H;  2NZH A;  4BBR H;  3HOV G;  1H95 A;  4L5S A;  3EN2 A;  3IRB A;  2N78 A;  2WB1 E;  1IZ6 A;  4DR7 Q;  4B3S L;  2K5H A;  3S1R H;  4JI6 Q;  2ZTD A;  2EXD A;  1Q7Y C;  4DV6 Q;  2PNH A;  2GN5 A;  1QZH A;  1JB7 A;  1VQ9 A;  4GKJ L;  2JA8 H;  2GVB A;  2VZA A;  1MJC A;  3RLF A;  1K3R A;  4LUO A;  2K5N A;  3PF5 A;  3CC2 A;  4L5R C;  4AQY L;  4JG2 A;  1D7Q A;  2YU9 H;  4R4O A;  2UXC Q;  5LMU L;  1Z47 A;  1W3S A;  2DGY A;  5FJ8 H;  1C0A A;  3GO5 A;  4A3B H;  4UY8 C;  1VQI A;  3OTO L;  4LF4 Q;  4K0K Q;  2D0P A;  1J5E Q;  2LSS A;  2ZM6 Q;  4QJF A;  4R4C A;  1HZ9 A;  1TWA H;  4OON A;  5LMN W;  4TVA B;  3HOV H;  4OX9 L;  2YV5 A;  2R7D A;  1VCI A;  4PMW A;  2K14 A;  4DV5 L;  3GTM H;  3GTQ H;  2A19 A;  4DV7 Q;  3ERS X;  4GOP B;  1XNQ Q;  5FJ8 G;  3GTP H;  1HZA A;  1G6P A;  1PYS B;  2RHS B;  3I2Z A;  1Q86 C;  3K8A A;  3L0O A;  4DV5 Q;  1D8L A;  4NXN Q;  4X62 Q;  1YNX A;  4OWX B;  2A1A A;  3HOW G;  3UDI A;  1NJI C;  3CPW A;  2B63 G;  1FGU A;  3CCE A;  1PH4 A;  4A3E G;  1PH7 A;  5IP7 H;  4LF5 L;  3EIV A; 
#chains in the Genus database with same CATH topology
 1HUN A;  1ROD A;  1DGS A;  3D31 A;  3K5M A;  1E7Z A;  2RDF A;  3CME A;  2B63 H;  2MUY A;  3MXN A;  2F0S A;  3U58 A;  2VXW A;  4JI3 Q;  1CKM A;  2CH4 W;  4GLA C;  4K8J A;  4LF9 Q;  2MO1 A;  4A76 A;  2L11 A;  3CU7 A;  5IYD H;  1KL9 A;  4X3S A;  5GAD C;  4YIJ A;  1K8O A;  2H4O A;  1AN8 A;  1TII D;  5K5P A;  1PXU A;  2AUJ D;  1BNZ A;  1TS4 A;  4EQN A;  1X32 A;  1Y8P B;  3CCU A;  1U0L A;  1PFM A;  2AKW B;  1SJE D;  4ILW A;  3IKJ A;  4LF6 Q;  5T1I A;  2K1B A;  4DV0 L;  3J7A F;  2GVA A;  3K0X A;  1XMO L;  4LW1 A;  2ATW A;  1TXY A;  1K3B C;  1B9N A;  1XMO Q;  3NWS A;  2BOS A;  2CWA A;  5I6Y A;  3HOW B;  3CQZ H;  3ND8 A;  4XXE A;  1KD1 C;  1H9S B;  3DWA A;  4DUZ L;  4RA8 A;  3U9S A;  2QGQ A;  1HNX Q;  1XWE A;  4MTK A;  1YIJ A;  1HJP A;  5EQ0 A;  1ZKO A;  3D4R A;  1L1O A;  5CGK A;  3KJO A;  1V43 A;  2DJF C;  3E0E A;  4Q0F A;  2VL6 A;  1EY0 A;  3KF6 A;  3FDT A;  1SBB B;  2KA7 A;  3UDF A;  3P20 A;  3I70 A;  1U4L A;  4LWC A;  1OXX K;  1IKL A;  1EIY B;  1UEA B;  2E2H H;  1Z6H A;  3W1G A;  3OWE B;  4CJ0 B;  5FOB B;  1EQR A;  1FGB D;  3M4O H;  4C3H H;  4QQB X;  1D5M C;  1VQB A;  4LUZ A;  2LKV A;  4YY3 L;  1FYC A;  3NSW A;  2Z6B A;  4QMG A;  4XQJ A;  1TU2 B;  4KY5 A;  2F0E A;  2UU9 L;  3X3N A;  4HCE A;  5C3E G;  2E74 C;  3L3O C;  4DAM A;  2LY7 A;  1HR0 L;  3D6W A;  1IW7 C;  3NWT A;  4X64 L;  3D6C A;  3S2H B;  1NR2 A;  1RTO A;  3CMA A;  1E0B A;  2E2J H;  3MA2 B;  2EIF A;  4IFD G;  2CH4 A;  2HQL A;  3HOZ G;  5G3L F;  5M3M B;  1QVF A;  3D0F A;  3VR4 A;  1KNA A;  2F0N A;  1I50 B;  2K03 A;  3GP7 A;  1EEI D;  3SK5 A;  2LXK A;  2WB1 B;  4PZ8 A;  2CFM A;  5C4X G;  1BR9 A;  3F2B A;  2Q8T A;  2J4X A;  2JEB I;  3I4M G;  4UDU C;  2R7Z G;  3NK9 A;  2JA5 G;  4XQN A;  3QR8 A;  3T53 B;  1EU3 A;  1ICW A;  2IPK D;  3J80 L;  1YHB A;  2B2V C;  2XN9 C;  3H15 A;  2OT2 A;  3BU2 A;  3CD6 A;  1LM0 A;  4IAL A;  4A3E H;  1HXY D;  5JVG 3;  2EYO A;  4JI8 L;  1GUT A;  4ALP A;  1JJC B;  2K5D A;  3DHQ A;  3SXH A;  3S17 B;  4ODG A;  3TRE A;  5CV4 A;  1S4Z A;  1X3F A;  4IJH A;  4A3J H;  3K6O A;  1DON A;  1PH9 A;  5JJL A;  3HEJ A;  1DM0 B;  4IO9 A;  3HOZ B;  2NBF A;  2BDN A;  4DF7 A;  4PG3 A;  1P8L A;  1TY0 A;  2C5C A;  1J6Q A;  2VY3 A;  2E2I H;  4LFA L;  1EZ6 A;  4K5W A;  2PI2 E;  2X6L A;  2B2W A;  4DK3 C;  4NPS A;  1AZP A;  1CKN B;  2VW9 A;  3A5Z B;  2UXB Q;  3KOJ A;  4DXG A;  4CBV A;  2YYZ A;  2L0C A;  1E24 A;  2IX1 A;  1YNJ C;  3HFZ B;  1HCZ A;  1S5F D;  1QOH A;  1VQL A;  1JE4 A;  4YWL A;  5EKL A;  3NPP A;  3HOX G;  4JBM A;  3JAM i;  1DOL A;  2UUA L;  3MXP A;  5GRO A;  3Q23 A;  2HDL A;  3UDX A;  1JJ2 A;  1HNW Q;  4RHS A;  2IWH A;  2R7Z H;  1Y1V H;  4A3G B;  4DV6 L;  2K32 A;  2NZO A;  1GO3 E;  3BZC A;  1U4M A;  5IIF A;  1B9M A;  1HNW L;  1GM5 A;  4DR1 L;  2A73 B;  4R4T A;  1PYB A;  1KLU D;  4DAY A;  2R93 H;  1XNR Q;  1W2B A;  2PCF B;  4GS3 A;  2JA6 H;  4N8F A;  3PIP 3;  2XVS A;  1WFQ A;  3AQQ A;  3EQL C;  5KNB A;  1H9S A;  4RHR A;  2JXM B;  3I7F A;  4JI4 L;  2A6H D;  3PUV A;  4HAE A;  4C3I G;  2QEJ C;  2F0F A;  2E5L L;  2ZXR A;  3S2H H;  3TN2 A;  3G4S A;  4DR6 L;  3MFY A;  1Q82 C;  4AYB E;  2NVX B;  1LT6 D;  2XTI A;  2Q2H A;  5CV9 A;  5C3E H;  4DAP A;  3IAY A;  2BE5 C;  4DR6 Q;  2XIW A;  1TWF H;  1WCM H;  5T1G A;  4DGZ A;  3NTK A;  1PH8 A;  3M4Y A;  1CTM A;  3NUC A;  2TSS A;  5CMD A;  4DR2 Q;  4C3I B;  1N32 L;  3A55 A;  4OGQ C;  1NY4 A;  1D2B A;  2BDO A;  2XRQ D;  4DK0 A;  2PYK A;  3NTH A;  1X55 A;  4OIK A;  2A69 D;  3K59 A;  1Y8N B;  1Q3L A;  1CZG A;  3HOX B;  1NMF A;  1A2U A;  2NN6 I;  1VQ4 A;  4GN3 B;  2DY8 A;  4P71 A;  1JC7 A;  2C35 B;  1RJT A;  1STN A;  2K5V A;  1EQT A;  5IGE A;  4JYA L;  1X54 A;  2EJM A;  4KY7 A;  4LMQ D;  4KN4 C;  4IN3 A;  1PV4 A;  2BA1 A;  4LFC Q;  5J3B A;  1L2F A;  1KRS A;  2CVR A;  2A6E D;  5A35 A;  2NN6 G;  2JE6 I;  1V1P B;  3BG3 A;  1PDQ A;  2RSO A;  4JI3 L;  1A2T A;  4YHH L;  5IP9 H;  4IUU A;  4C3J H;  4KHZ A;  1VQK A;  3I73 A;  1U4P A;  1WI5 A;  2NTS A;  4IUQ A;  5JVH 3;  1EWI A;  4JI5 Q;  2KHI A;  3DMU A;  3V05 A;  3T1Y L;  1D5Z C;  4AYB G;  1SFO H;  2HIV A;  1JQY D;  1UUP A;  5IP9 G;  1NUC A;  1K28 A;  4JOI C;  3RZO H;  4KI0 A;  1YJW A;  4DR5 L;  1IKM A;  4QGU A;  4JPB W;  1S72 A;  4RFB A;  5DM7 3;  1S40 A;  1IBL Q;  5LMN L;  3K7A H;  2KED A;  1KDA A;  3NQI A;  2Z6K C;  4KK7 A;  1F9R A;  2DJG C;  5M5X H;  1QWY A;  2VB2 X;  3A8J E;  1CKO A;  1DCZ A;  2EYJ A;  3KF8 A;  1JOR A;  3OHX C;  2LXJ A;  1SN8 A;  2RVL A;  4QL5 A;  4JI7 L;  1OXT A;  5C3W A;  4ZUJ A;  4K0K L;  2R93 G;  1F77 A;  1STY A;  1WJJ A;  2O2L D;  3OSO A;  4OX9 Q;  1OO9 B;  3RN5 A;  3VR3 A;  3S16 H;  4C1N I;  1PLF A;  5C5L A;  3J81 c;  3TP7 A;  5KGU A;  4A3D H;  3VDY A;  3U4V A;  1AH9 A;  5C4H A;  1HZC A;  3C2P A;  2A8V A;  2VS1 A;  5D65 A;  3M3Y B;  4BBS B;  3L2P A;  5ELN A;  2N88 A;  4X64 Q;  3TP8 A;  3J81 i;  1XTD A;  1E2Z A;  4A3I H;  1LAC A;  1N33 L;  1N34 L;  2Z1C A;  1SYD A;  2F0T A;  2KCM A;  5IT9 c;  3M7N A;  5LL6 S;  1N34 Q;  4L8J A;  1G51 A;  3G48 A;  3GTO B;  3RZO B;  3FKI B;  2F52 A;  1KDC A;  2IW3 A;  3STB D;  4OO1 H;  4O2D A;  1VDZ A;  1WCM B;  2MGS A;  2ZTE A;  1ZEQ X;  3GV3 A;  1G8Z D;  1QUQ B;  3UE1 A;  2NZH A;  4BBR H;  3IRB A;  3A54 A;  4B3S L;  2PO4 A;  5EPL A;  2EOT A;  3KK7 A;  1S5B D;  4H7B A;  1MJC A;  3CC2 A;  1ZYR C;  2R61 A;  4JG2 A;  4AQY L;  2RBM A;  4EQP A;  5I4D A;  1KTK A;  5FJ8 H;  2B63 B;  1JIC A;  1C8C A;  1CM9 A;  1VQI A;  4LF4 Q;  4WOR A;  5JEA H;  4FYD A;  1HZ9 A;  1A6X A;  1WVL A;  1XNQ Q;  5FJ8 G;  1HZA A;  3I2Z A;  1L0Y B;  1QG7 A;  3L0O A;  4GZY C;  1D8L A;  4NXN Q;  3C1E A;  1YNX A;  4J8Q A;  1GXD C;  2A1A A;  3UDI A;  4X62 Q;  1NJI C;  1FNV A;  2B63 G;  1FGU A;  2ZXO A;  1PH4 A;  1PRT F;  5BN5 A;  5DM6 3;  2QKI C;  1L1O B;  1FD7 D;  3EBE A;  1F2L A;  2NN6 H;  2X6G A;  1QUQ A;  4BA2 I;  4H44 C;  1NR4 A;  4A3M H;  3M4P A;  4RKB A;  4HTH A;  1VQ5 A;  2GA4 B;  4BY1 B;  4A3J G;  3HOU H;  2XGT A;  4CKC A;  3PQI A;  3CKI B;  3GTO H;  3H0G G;  3HOU B;  5JJZ A;  5L37 A;  1D1I A;  5HGT A;  3CCV A;  2JEA I;  3SE0 A;  1IBM L;  3GQB A;  1L0W A;  4B3R L;  4FDB A;  2QW7 A;  3D4D A;  1BUV T;  3BYY B;  1IW7 D;  3I3C A;  2UUA Q;  1K8M A;  1I6H H;  1NE3 A;  2ID0 A;  1K83 H;  5IT9 L;  4ME3 A;  1UE7 A;  3SDZ A;  3BVM A;  1MJE A;  2I46 A;  1LT5 D;  2FXQ A;  1CKN A;  3OTO Q;  1Q90 A;  1GUW A;  1XNR L;  2FMM A;  2JA8 G;  1GUO A;  1OTC A;  4A3E B;  5E1F A;  3VYU A;  1I50 H;  5D3I B;  2AUK A;  5FO9 B;  5KEE A;  2VUM G;  5EKK A;  1A3V A;  4MTN A;  4KJN A;  1HFG A;  2WFW A;  5EPJ A;  4KD4 A;  2RSN A;  1VQ6 A;  3Q6S A;  2B2Y A;  4FNF A;  4LAA A;  2KCC A;  5C0X G;  2PZT A;  1C7Y A;  1VQJ A;  3KFU A;  4X65 Q;  1FNU A;  3SEB A;  1PFN A;  1GOZ A;  2EDG A;  3CCL A;  3MXU A;  2VQE L;  3I55 A;  1RIP A;  3J7A V;  2PW7 A;  5M5Y B;  2VQE Q;  3K7A B;  4KN7 C;  2Y0S E;  1DD2 A;  2WKC A;  2K52 A;  1MSG A;  4BS9 A;  5JPM C;  1PH1 A;  3OMG A;  5IY0 A;  3J80 c;  5EBC A;  1STA A;  1PRT C;  2H1E A;  3PO2 B;  4XYO A;  4WJ4 A;  2E8G A;  2EVB A;  1AFP A;  2B3G A;  1BBX C;  5IYD G;  1GVP A;  1NCV A;  1LV9 A;  1DXM A;  3I4N G;  2RKS A;  3W2D A;  4ZLT F;  2ZJP A;  1HA5 A;  3CRK C;  3NTI A;  1TQO A;  5IYB H;  4C2M H;  3NQT A;  4IOC A;  2MHV A;  3SK6 A;  1EU4 A;  4OEL B;  1IBK Q;  2L12 A;  4PZ7 A;  3BYT B;  1CI3 M;  3GTQ B;  1QJO A;  1GKH A;  1CUK A;  1RHP A;  4TSS A;  1YVC A;  4PNY A;  1A63 A;  1IYV A;  1MBY A;  3PGZ A;  2F3W A;  1XMQ L;  2B2Y C;  4A3F H;  1GJX A;  1Q46 A;  5AJ3 L;  3I8Z A;  3PO3 G;  3CAM A;  3T1H L;  5IGD A;  2MO0 A;  5TSS A;  1XPU A;  4EQ5 A;  3T1H Q;  1PHJ A;  2HT1 A;  1Q8I A;  4G4K A;  4HIM A;  4FVM A;  4NW2 A;  2B2V A;  3NEN A;  1I6H B;  1XTC D;  1KAW A;  4HMJ A;  3CCR A;  2JA7 G;  3PO3 B;  1BVS A;  4IOA A;  5C0X J;  1Q8K A;  3IL8 A;  1HA6 A;  1KIX A;  3M7G A;  2JK8 A;  3M4O B;  4PV1 C;  4A3C G;  1Y1V B;  1EY5 A;  3LX0 A;  1BDO A;  2VUM H;  3I4M B;  4A3K G;  5ELO A;  1HQR D;  1K0S A;  3K57 A;  2K01 A;  4Y7N B;  1S5D D;  3S14 B;  1EFI D;  4DV1 Q;  2VNU D;  2K05 A;  4PMB A;  1Y1V G;  5LHY 1;  2V4D A;  2EY5 A;  4KHV A;  2V1C C;  4DV1 L;  4X3U A;  3AU7 A;  3TME A;  1E3P A;  3T13 A;  1AE2 A;  2WII B;  2MJ8 A;  3KLS A;  5M3F G;  4X66 L;  4ZYS A;  1RKN A;  4GNX A;  2LS0 1;  4DUY Q;  4B3T L;  2WAQ B;  1Y1W H;  1Y14 B;  2K75 A;  2OXP A;  1KC8 C;  4DV4 Q;  3HOY G;  1CSP A;  4I65 A;  1PTO F;  4BY1 H;  1VQA A;  5EBD A;  4KKT A;  2CW0 D;  2KCT A;  1QCB D;  1O7I A;  4A3G G;  4LFB Q;  1X3Q A;  4A3I G;  1Y8O B;  3H91 A;  4RCO A;  3GTG H;  4RKL A;  1W6K A;  2WKD A;  2ALY B;  5J1Z A;  3G6J B;  5DLQ E;  2HCI A;  3U4Z A;  2N55 A;  3EVQ A;  4B3M L;  1HPC A;  3ITP A;  4CDE C;  1F9Q A;  2KJX A;  4JI0 L;  1EY7 A;  1SNC A;  5FKA C;  4AQY Q;  4WJ3 M;  4XDX A;  3FHW A;  1SLJ A;  2FHT A;  3Q8D A;  4CKE A;  4M1U B;  1IYJ B;  3S9W A;  1E2W A;  1NBW A;  2IJ0 A;  4GOP A;  4NXM Q;  1HNZ L;  1RTN A;  1SE2 A;  4XT3 B;  4WJW A;  3WWV A;  2Z0S A;  1Y1W G;  2Z9H A;  3J7Z C;  3OOC A;  2R92 G;  1B7Y B;  1TT2 A;  1HNZ Q;  2FFK B;  3OWF A;  1HTP A;  5KYL A;  3J80 E;  1OXS C;  4DR4 Q;  5IOC A;  1LTT D;  2AWO A;  3F1Z A;  4A3D G;  4H02 A;  2BE5 D;  3CHB D;  1S5C D;  4EQO A;  2M2L A;  2XNA C;  2QCP X;  3MXN B;  3G7L A;  4A3F B;  1PRT B;  4G7O C;  1TKW B;  2RCF A;  3TBI B;  3HRZ C;  4Y52 H;  5C6A A;  3I4L A;  3GTK B;  3KBX A;  4GNX C;  4A93 G;  3VA5 A;  1CT1 D;  1HQM C;  4DV0 Q;  1ILQ A;  2PQA B;  3E3X A;  1I94 L;  4G7H C;  2B8F A;  5ELC A;  1ASY A;  1SNP A;  4RMF A;  4A3I B;  4OIJ A;  1DZ1 A;  3SVM A;  4DR3 L;  1YZ6 A;  1I6V C;  5CC4 A;  3MWY W;  1Q81 C;  3E9I A;  3AYH B;  4DR3 Q;  2NVT B;  3GTL B;  3NXW A;  4HJA A;  5GAG C;  1HNX L;  4B3R Q;  3W5O A;  3TZU A;  4YCW A;  4CHT B;  5I2Y A;  1AEX A;  3GTG B;  3KUP A;  3NBH A;  3TQY A;  2EY6 A;  2E2J B;  3LWU A;  3S17 H;  1O7Z A;  2Z4H A;  3PUW A;  3PUX A;  4ZK9 B;  3BDO A;  5IE8 A;  1VQP A;  1N8R C;  2O5I C;  3S16 B;  1G29 1;  1U5K A;  1O7L A;  5FK9 C;  4GKJ Q;  2DNC A;  4A3C H;  4A3D B;  1YI2 A;  1SNQ A;  3J7Y W;  2BH8 A;  5C4J B;  1EUJ A;  5DEH A;  3FPP A;  4A93 B;  5IYC H;  4V0B A;  4P2C B;  4B9W A;  1H9M A;  1JJG A;  5FLX E;  5M5X B;  2N3S A;  2KEN A;  5C4J H;  2MQH A;  3X3M A;  4I7A A;  4KHP Q;  1YEZ A;  2Q8I B;  1EOT A;  1MGS A;  2EXZ A;  3OMC A;  2VQF Q;  4A3M G;  1IL8 A;  1XPR A;  3S1N B;  1A3U A;  1XX8 A;  2OCE A;  2VQF L;  3RN2 A;  2Q8R E;  4ME5 A;  5IGB A;  2HD3 A;  4HN7 A;  2ZT9 C;  3FKI G;  3PV0 A;  1X9N A;  1LAB A;  3VR6 A;  3OYY A;  1KXL A;  4HSV A;  1WTX A;  2E2H B;  1SE8 A;  1A62 A;  2BA0 A;  4C3J G;  4LF9 L;  3UDG A;  2PW5 A;  4DV2 Q;  1B4O A;  1SR3 A;  3VYS A;  2ZJR A;  3RZD B;  1WD0 A;  2NVT H;  4EX5 A;  2NZ1 D;  4C3H B;  3CXC A;  1CA6 A;  3MEF A;  5IGG A;  1UE5 A;  4E6I A;  3PIP A;  1NAP A;  2MP1 A;  4MN3 A;  1H95 A;  3EN2 A;  2WB1 E;  2OF1 A;  2WV6 D;  2K5H A;  3N52 A;  5I9P A;  2R93 B;  2ZTD A;  1Q7Y C;  2DNE A;  2PNH A;  1O7Y A;  1QZH A;  1JB7 A;  1VQ9 A;  2GVB A;  2VZA A;  3RLF A;  2EYH A;  3PF5 A;  4JK1 C;  5NUC A;  2KOL A;  2AQ2 B;  2UXC Q;  2EY1 A;  3H6M A;  2KQ3 A;  1VF5 C;  2LSS A;  3R2I A;  1B2T A;  4QJF A;  1UAP A;  5COY A;  4K14 A;  4TVA B;  5LMN W;  2YV5 A;  3HOV H;  1SJH D;  1SDF A;  1TVX A;  1I4H A;  1VCI A;  4PMW A;  2A19 A;  4IUR A;  3ERS X;  4DV7 Q;  4GOP B;  1G6P A;  5KRU A;  4Q5V A;  2K5Q A;  4I7Z C;  4BWG B;  2JA8 B;  1K83 B;  3CCE A;  4K6D A;  1V1P A;  4L63 B;  3DXJ C;  5IP7 H;  4LF5 L;  3EIV A;  3FPU B;  3HOU G;  2JP1 A;  1DJR D;  1SE3 A;  4B9X A;  1SE4 A;  3J81 L;  5JEA J;  4YY3 Q;  1D5X C;  4JBW A;  2F0H A;  2QIL A;  3LNN A;  2KUM A;  3TP5 A;  3EFX D;  2JA7 H;  3JAM E;  3H09 A;  2RA4 A;  3NEL A;  1K8G A;  3S2D B;  4CJ2 C;  1CSQ A;  2G5D A;  5C4Z A;  5C0X H;  1NTG A;  1KHI A;  3GTJ B;  1EYG A;  4IPG A;  2K5W A;  1ESR A;  3JAM L;  5ELB A;  2F0O A;  3H3V C;  5C44 H;  2F3I A;  4IUT A;  5COR A;  1LT4 D;  3TDQ A;  4C1N K;  4JI6 L;  4BBS H;  1B50 A;  3MXG A;  2H5X A;  2E5L Q;  5M3M G;  4HED A;  1RD9 D;  1B3Q A;  1QVG A;  5IP7 G;  4IJL A;  3I4N B;  4DUY L;  4B3T Q;  1BO0 A;  4KJO A;  4POG A;  2UUC L;  4FO2 A;  4DV4 L;  4NMZ A;  2F0V A;  2SDF A;  3CQZ B;  2K6A A;  4HJ8 A;  3S1N H;  5A2Q L;  4CDF C;  3KLR A;  3E9H A;  1LLR D;  4TKO B;  4GLV B;  2DUD A;  1SYF A;  2AMC B;  2UUB Q;  3KDF A;  1N9W A;  3M4Q A;  1CK1 A;  3Q22 A;  4S3S A;  1PMR A;  3I4M H;  5FO7 B;  3N6R A;  4BY1 G;  4K8I A;  4B3M Q;  4KV6 A;  3K58 A;  5HUR A;  3IFT A;  2AHO B;  3H0G B;  4HCS A;  1R9T H;  1VQ7 A;  1R4P B;  4BY7 G;  3F2D A;  1UWV A;  4C2M B;  3C3L A;  4FF3 A;  3RZD H;  4RGT A;  3CCQ A;  5IT9 E;  4JBJ A;  3HOZ H;  1YIT A;  3CW2 C;  4F87 A;  4LK1 C;  1PH3 A;  5C4X B;  2NWG A;  5EAY A;  3ZYY X;  4R4I A;  1PH6 A;  1GUG A;  4JI2 L;  3S1Q H;  3D3R A;  2HHH Q;  1YNJ D;  1WTO A;  5CBA E;  1VS0 A;  3K81 C;  1W6J A;  2NB0 A;  4P75 A;  4BY7 B;  1SRU A;  4KD3 A;  2HHH L;  5FLX L;  1SFO B;  4OEM B;  1TS3 A;  5ELD A;  4GLX A;  1EIG A;  3G6E A;  3PUY A;  1RDP D;  1A0I A;  4EGV A;  5C3E B;  4DR5 Q;  3T16 A;  3KDF B;  1BKB A;  1WTW A;  1I3Q B;  4QUF A;  3H94 A;  1STB A;  1G2T A;  2B29 A;  4DR7 L;  4A3L G;  3QJY A;  1KAA A;  3S24 A;  4QB4 A;  4ID6 A;  5GQO A;  2E75 C;  3RMH A;  3I4O A;  5EJW A;  1S3O A;  4IFD J;  1II3 A;  3DUZ A;  5CYU A;  5LMU Q;  4DUZ Q;  2QA4 A;  1D6E C;  5FLX c;  3TZD A;  3HKZ E;  2F0L A;  1C4Q A;  3QIA A;  4DR1 Q;  5GAE C;  4JI7 Q;  4A3G H;  1ASZ A;  2R7Z B;  1SXT A;  4NKL A;  1T9H A;  5M3F B;  1EIF A;  3OIP A;  4ZRZ A;  1XYI A;  1Q12 A;  3EA6 A;  1M4V A;  2EPB A;  2PQA A;  2LMC B;  3AFP A;  1HH2 P;  2HDM A;  2SEB D;  3MFG A;  4FXK C;  2JYO A;  3ULL A;  4AIM A;  1VQN A;  4A3B G;  4FF4 A;  4A75 A;  3WOF A;  3BS1 A;  3T4A C;  1EWC A;  4ABN A;  2PMZ E;  4A3K B;  4HMI A;  4QCL A;  4GOP C;  3A7A B;  3I72 A;  4HR7 B;  1EQV A;  1LTS D;  4RAU C;  3S2D H;  4A3K H;  4MNO A;  2EJG C;  2ZM6 L;  1I4G A;  3OW2 A;  3RLO A;  4WFN 3;  1O80 A;  3R93 A;  1HR0 W;  4O42 A;  1E22 A;  1R4Q B;  1TWF B;  3H3V H;  2E2I B;  1HUM A;  3GDE A;  3QB3 A;  3STB C;  2PI2 A;  4RGO S;  5JJK A;  1SEB D;  2L15 A;  3U50 C;  1P16 A;  1JOQ A;  1EEF D;  3M9B A;  3VA7 A;  4FXD A;  4FF1 A;  4QIW B;  4BA1 I;  4KHP L;  3MZ5 A;  3K0Y A;  1SRO A;  4HJ9 A;  3HOY H;  2I0Q A;  4CGY B;  2F0Q A;  2KBN A;  3MC0 B;  1TWA B;  5BN3 A;  4OO1 I;  2YTX A;  1STE A;  2RDH A;  3PUZ A;  1WTV A;  1LTI D;  3WDN A;  4K5V A;  3L9A X;  3HZX A;  4LFC L;  1OXV A;  4U67 3;  2A5H A;  3E6Z X;  1CA5 A;  5H1S E;  3UE0 A;  2L9H A;  3R2T A;  5J39 A;  5IOD A;  3LWE A;  4DNI A;  2MNA A;  2JA5 H;  2B39 A;  1K73 C;  2PZW A;  2F0U A;  2F0G A;  2NVY B;  4KLK A;  1O78 A;  2NVQ B;  2Q2U A;  1HTL D;  4DV2 L;  3A5U A;  2X69 A;  4L5Q A;  2CWP A;  4IPD A;  3CC7 A;  3BDC A;  3T1Y Q;  2J7Z A;  4C56 C;  4CDD C;  2IX3 A;  3DEO A;  4PMC A;  1FVI A;  3ZJY C;  4LF6 L;  1X56 A;  5ISR A;  2Y0S G;  3AEV A;  2CKZ B;  2IHE A;  2G9D A;  1B44 D;  4NXN L;  2R3Z A;  4X62 L;  2F3V A;  3DM1 A;  1Y1W B;  5C0X I;  2NTT A;  2UXC L;  1PRT D;  2IHF A;  1KDB A;  2N8N A;  3SR1 A;  4BBR G;  2IT1 A;  4DAY B;  5KND A;  2K50 A;  4DK6 C;  1LTL A;  1UNS A;  4F8M A;  4X3K A;  5F2D A;  3W1B A;  3ICE A;  4IPC A;  2ICE C;  4H0L C;  2K04 A;  1B53 A;  2PNR C;  3JAM c;  4QUC A;  3O13 A;  4HIK A;  3KLW A;  3PSI A;  5CV7 A;  1EYA A;  3NBI A;  4EVO A;  1CFM A;  4LF5 Q;  1ML0 D;  1SAP A;  1K9M C;  2KHJ A;  1EY9 A;  1IBM Q;  1CQV A;  3HOY B;  1SMY C;  1NMG A;  4HJ5 A;  4JW0 A;  2F0M A;  5M5W B;  1KQS A;  3C1F A;  1HR0 Q;  3ERO A;  4QF4 A;  4N9P A;  3FEW X;  3ERQ A;  1GUS A;  4KY6 A;  1G2S A;  4L6T B;  1BCP D;  1F2Y A;  3ER0 A;  2L5T A;  4DV3 Q;  1N33 Q;  2EYL A;  1V1Q A;  3T56 B;  3KBG A;  1ONL A;  4JBK A;  4DV3 L;  1PTO D;  2UXD L;  1PTO H;  1MD2 D;  3E0J A;  1VQE A;  2QDL A;  1CZW A;  1CHP D;  3C46 A;  2PMZ B;  3DLL A;  1PYW D;  4XYQ A;  1BBW A;  1IYU A;  1JE5 A;  3P75 A;  4KMU C;  2UXD Q;  4WRD A;  1I4X A;  1PVO A;  2AWN A;  1QB5 D;  5I6W A;  4UP7 A;  1PA6 A;  1MHW C;  4KKU A;  3TRZ A;  1LYL A;  2F03 A;  3J81 E;  2Z6K A;  2F4I A;  2UUC Q;  1TS2 A;  5C3X A;  4K2L A;  1KAB A;  3DWQ A;  2WIN B;  1B1Z A;  1ET6 A;  1MI2 A;  1PH2 A;  4MIU A;  1U4R A;  1WTR A;  2WAQ E;  1STG A;  2KEE A;  4HSP A;  4JI8 Q;  3A74 A;  2JN4 A;  2Z4I A;  4R1J A;  2QDB A;  2ASB A;  3SGI A;  4N8X 1;  3TS0 A;  4UP9 A;  4YCV A;  1BOS A;  4JI1 L;  4JYA Q;  3MAQ A;  5A2Q E;  1G6Z A;  1I4Q A;  1BBU A;  4JI1 Q;  2A69 C;  3S14 H;  2K33 A;  1Z7T A;  1ENF A;  4YHH Q;  3J81 j;  2A74 C;  1M90 C;  1NSN S;  4P74 A;  2NYZ D;  3P7J A;  1UE6 A;  5C44 B;  1WTP A;  4LFA Q;  2FMC A;  4JI2 Q;  1F9P A;  1GD7 A;  3DM3 A;  2IX0 A;  4C3H G;  4MZ9 A;  4GKK Q;  1M1K C;  1Z9F A;  2OEO A;  4JI5 L;  4J1M A;  1NNX A;  1VMP A;  3TEH B;  3ULJ A;  4RCN A;  4A3M B;  1JR0 D;  4GKK L;  2NVX H;  3VR5 A;  2UXB L;  3TSS A;  1BCP F;  2KVM A;  4UP8 A;  1L0X B;  1TWC B;  5EGT A;  1G91 A;  1XXG A;  3F2C A;  4BBS G;  3GTK H;  2R7F A;  3KLS X;  1TWH B;  4XT1 B;  1AW7 A;  5JJI A;  3H3V I;  4DR7 Q;  1IZ6 A;  1EL0 A;  3S1R H;  3S1M B;  4ULL A;  1FR3 A;  4FXG C;  1J9O A;  4V19 0;  4DV6 Q;  1SNO A;  2GN5 A;  2JA8 H;  1QE6 A;  4LUO A;  1K3R A;  3A8K E;  1D7Q A;  4JVZ A;  1H9R A;  4ZKC B;  1F2M A;  2YU9 H;  1EWH A;  5LMU L;  5CV5 A;  1C0A A;  3GO5 A;  1BXT A;  3OTO L;  4K0K Q;  3GV6 A;  2XWB B;  3OW7 A;  3D4W A;  5AFW A;  5E4X A;  2KHS A;  3K5L A;  4OX9 L;  3HP3 A;  3FRP B;  2R7D A;  3FVQ A;  2K14 A;  4G57 A;  4DV5 L;  1H9K A;  3GTQ H;  1KLG D;  3GTP H;  2WAC A;  1PYS B;  2RHS B;  3VR2 A;  4ZCK A;  4DV5 Q;  3HOW G;  3CPW A;  5K36 H;  2E76 C;  2ENB A;  4ZUI A;  2L1B A;  1RF2 D;  2M00 A;  2DY7 A;  5E7N A;  5BR8 Q;  1KRT A;  4DR2 L;  1N32 Q;  4J6H A;  1JCK B;  3ONA B;  2B2T C;  1J8I A;  1FL0 A;  3CRL C;  4KTA A;  1ESF A;  1F9S A;  2B2T A;  1PTO B;  2OWO A;  4JCV E;  1MSH A;  2P5Z X;  1TR5 A;  3BJU A;  4IUN A;  1YNN D;  4DNR B;  4RGM A;  3NBH B;  2VB3 X;  2R6G A;  4TRD A;  3H0G H;  4JOI A;  4LF7 L;  1TWC H;  2RDG A;  1GUN A;  3Q0A A;  4O1N A;  4Z9C B;  3QG1 A;  5FLM H;  1WOC A;  4YWM A;  4B3S Q;  2G9H D;  1JWU D;  4ZKB B;  2IL8 A;  3BZK A;  3JC6 6;  4IFD I;  4DPG A;  4Y7N H;  1DYQ A;  3NE5 B;  3ND9 A;  3QO2 A;  1BCP C;  2PZU A;  1SNM A;  4O0A A;  1QNU A;  4LF4 L;  5CV8 A;  3RR5 A;  5LL6 X;  2BH2 A;  1V8Q A;  5E4W C;  4APV A;  2B2U A;  2ZTC A;  5GAH C;  2EE1 A;  2A6E C;  2D5D A;  1M8A A;  4JC0 A;  4YWK A;  5M3M H;  4HIO A;  4R8I A;  1IBL L;  1LTG D;  4CDC C;  5LMN Q;  3AMU A;  2IY5 B;  3A8I E;  1K8A C;  3S1Q B;  2CQO A;  1HHV A;  3RNU A;  3KJP A;  4DR4 L;  4OO1 G;  2OTJ A;  1LO5 D;  1CQF A;  1V1O A;  1A3T A;  5M5Y H;  5KIX A;  1EY8 A;  1YHQ A;  2D2C C;  3I4N H;  2EYM A;  1Q1B A;  1PZI D;  1GHK A;  3TS2 A;  3Q24 A;  2MFI A;  1UE1 A;  1SND A;  2C9O A;  4DU9 A;  2F0K A;  1I94 Q;  3K5O A;  1EIH A;  2YTV A;  3PO2 H;  1JB3 A;  1QVC A;  3GD7 A;  4K6L A;  4P72 A;  4LF8 Q;  4NB3 A;  1B70 B;  1F2Z A;  3G71 A;  2ES2 A;  3NHH A;  2FJ2 A;  1VQC A;  1EY6 A;  1D1K A;  2D9U A;  5ELE A;  4DXF A;  1TY2 A;  1EQQ A;  3MHB A;  5K36 G;  1B3A A;  4XQQ A;  1FNW A;  3PO2 G;  4LJZ C;  5M5W H;  3NEM A;  1OXU A;  2O4X A;  2QF7 A;  3HS0 C;  5I9O A;  1EZ8 A;  1EFW A;  2HQE A;  5IGC A;  4A4I A;  4YCU A;  4BXX G;  4DK1 A;  4BY7 H;  1WTH A;  2EZV A;  2EYF A;  1FJG L;  5D14 A;  3R3O A;  2KCN A;  2MPM A;  4A3B B;  1MIU A;  1FJG Q;  5IYB G;  1MKH A;  2YTY A;  4DFA A;  1E2V A;  1V9P A;  5CV6 A;  1J5E L;  1RCV D;  5KNC A;  1VQ8 A;  4A3L H;  2OTL A;  3QOL A;  1PZJ D;  1SYB A;  2K28 A;  3OPO A;  2O5J C;  2WAQ G;  3J80 i;  1VF7 A;  2B8G A;  2OQ0 A;  1IHZ A;  4LFB L;  3K5N A;  3RLN A;  1TWG H;  5FLM G;  5DNF A;  2JQO A;  4IUV A;  4CJ1 B;  4B08 A;  5JEA G;  5IWA L;  4LUV A;  1QZG A;  1C48 A;  2WP8 J;  1JOO A;  1AZQ A;  5ELF A;  5IWA Q;  4JI0 Q;  1XPO A;  3PO3 H;  2HUG A;  3K7U C;  1I4P A;  2B2W C;  1VQF A;  2WB1 G;  4H13 C;  1UEB A;  3W3A A;  1Q1E A;  3HKS A;  2DN8 A;  1XNQ L;  2A68 C;  4POF A;  2CCZ A;  3KF8 B;  3URY A;  1HRJ A;  2CW0 C;  2K4K A;  1T5E A;  2HIX A;  2ZXP A;  5I2X A;  2JA7 B;  4ZAI A;  1WTQ A;  4OWT B;  2F0D A;  3A0J A;  2JA5 B;  1PZK D;  3WOE A;  5IYC G;  2NVY H;  3MEH A;  4J15 A;  2Q2T A;  2QEX A;  2N49 A;  4MHE A;  1VQO A;  1B8A A;  1PH5 A;  2F4V Q;  3P1H A;  1ZXT A;  3OIQ A;  4M8A A;  3T51 B;  3CC4 A;  1PTO C;  1LT3 D;  2R92 B;  1C9O A;  1PFS A;  3K80 C;  1AP0 A;  2F4V L;  1HZB A;  4RH6 A;  1S5E D;  1SYG A;  3S15 B;  1X3P A;  1SYE A;  4QY7 A;  2SNM A;  3S15 H;  1SMX A;  1N36 L;  1XMQ Q;  1BF4 A;  2SOB A;  3U9O A;  2LFN A;  4IPH A;  5G3L D;  4KKS A;  4AH6 A;  1N36 Q;  1SYC A;  1YBY A;  4IFD H;  1IXR A;  4R8N A;  2Z8L A;  3SHL A;  1TS5 A;  1X3E A;  1EY4 A;  4X6A H;  3V2T A;  4P73 A;  4BBR B;  1ENA A;  5E3F A;  1KNE A;  4DV7 L;  1TWH H;  4L5T A;  5BN4 A;  1YJ9 A;  1YHA A;  1VQH A;  1T5X D;  1YJN A;  4NP5 A;  3S1R B;  2HCC A;  2XRS D;  2NUC A;  4F88 A;  3S1M H;  3DEP A;  4HID A;  3NP8 A;  1RL2 A;  4GNX B;  1X6O A;  4RGN A;  3PCO B;  3CP0 A;  4GN5 A;  1GHJ A;  3I91 A;  1Y69 U;  4OXP A;  2RF4 A;  4TQU S;  4XIG S;  1HFN A;  2UU9 Q;  5JAV A;  3KYH C;  3D8G A;  1A8V A;  1VQG A;  4X3T A;  3QWN A;  3EJI A;  4CKB A;  4G7Z C;  3ULP A;  1DOK A;  2NVQ H;  2JJQ A;  5C4X H;  3CF5 A;  5CR3 A;  4N9T A;  3PF4 A;  4X65 L;  1E1T A;  1IL2 A;  1X65 A;  1VQD A;  3LGJ A;  4LNQ A;  1I5F A;  4A93 H;  1ENC A;  3PMF A;  4UAI A;  2ZJQ A;  3KF6 B;  4UPA A;  2TMP A;  3DWP A;  5BR8 L;  1JT8 A;  4AYB B;  4DAV A;  3PIO A;  4FF2 A;  3FKI H;  1XJV A;  4F7X A;  4X66 Q;  4UHV A;  1WD1 A;  4BXX H;  1ET9 A;  1I3Q H;  3QOJ A;  3FMC A;  3HOX H;  1SMY D;  3CPF A;  3SK4 A;  2FIN B;  4R4Q A;  3RUZ A;  1JMC A;  1X3G A;  5FO8 B;  1JWS D;  4PZ6 A;  1CHQ D;  3HKZ B;  2Q2I A;  2Y0S B;  2AQ3 B;  4A3F G;  4OHJ A;  2PPB C;  1ICF B;  1VQM A;  2L55 A;  3IFD A;  3CCS A;  1PFB A;  2B2U C;  2XWJ B;  5D3D A;  4RWS C;  4LF7 Q;  1DOM A;  1EYC A;  1EYD A;  2BCO A;  3M85 A;  3BDL A;  2UUB L;  2D62 A;  1IBK L;  2F1M A;  4C3J B;  3HKZ G;  1L1O C;  1I4R A;  4DN4 M;  2XSC A;  3GTL H;  1H9J A;  2K7V A;  2J0T D;  4U68 A;  3BVZ A;  3M3Y H;  1LTR D;  1ZYR D;  1R9T B;  1QIL A;  2AQ1 B;  5M3F H;  5C5M A;  1WCM G;  1VMC A;  2OQK A;  4NXM L;  4HJ7 A;  5AJ3 Q;  4GN4 B;  2A68 D;  5JPN C;  1JWM D;  1E1O A;  3F8T A;  3MVV A;  4OWW B;  2A6H C;  2I5H A;  2F0J A;  5EKI A;  3HOW H;  3V96 A;  4QIW E;  1LTB D;  4JV5 L;  3B6Y A;  3PIO 3;  5C44 G;  1ILP A;  3VYR A;  2R92 H;  3AB9 A;  4K2K A;  4JV5 Q;  4C3I H;  4IUP A;  4ZQ3 A;  3HGB A;  3CCJ A;  2ICI A;  5HY6 A;  1LUZ A;  4DKA C;  2YU9 B;  3A56 A;  5M9O A;  1BCP B;  3AFQ A;  4RG1 A;  3FP9 A;  3L7Z C;  3UI2 A;  2RHQ B;  3CCM A;  2I5L X;  2PQE A;  2RCN A;  3SK8 A;  1WYD A;  1A15 A;  1YNN C;  2F0W A;  4IQZ A;  4LF8 L;  2EQS A;  2JA6 G;  1K0R A;  3J7A 5;  4XTC S;  3I56 A;  5HGQ A;  1EOV A;  4OL7 A;  3HG9 A;  4R9W A;  5EPK A;  2JA9 A;  3A7L A;  4NDX A;  4A3J B;  2I5M X;  4JI4 Q;  4DA2 A;  2D0O A;  2M9V A;  2EJF C;  3MTS A;  1AE3 A;  2KEC A;  3GTJ H;  1SSO A;  3HOV G;  4L5S A;  5IGF A;  2N78 A;  2JSO A;  3VYT A;  2JA6 B;  3RD4 A;  4JI6 Q;  3GTP B;  2I07 B;  1U9R A;  2EXD A;  1BQQ T;  1LTA D;  3TP6 A;  4PQX A;  4K5X A;  1STH A;  2L4N A;  4GKJ L;  3F2U A;  2K5N A;  2EYP A;  4L5R C;  4R4O A;  1Z47 A;  1W3S A;  2DGY A;  5CBE E;  2F0I A;  4A3B H;  2CHB D;  4UY8 C;  3GTM B;  2D0P A;  1J5E Q;  1TWG B;  2CQA A;  4FP5 D;  5DAU A;  2ZM6 Q;  3HOV B;  4R4C A;  1TWA H;  4OON A;  2RQX A;  1JOK A;  3GTM H;  2E2D C;  3I90 A;  1QNK A;  5J22 A;  1Q86 C;  4DNT B;  5KYI A;  3K8A A;  4IZ8 A;  3R8B A;  2F0P A;  5JOB A;  4OWX B;  3BZD B;  2SNS A;  3BVG A;  3E5S A;  4A3E G;  2EY2 A;  1PH7 A;  2VUM B; 
#chains in the Genus database with same CATH homology
 3HOU G;  1L1O B;  5E7N A;  3EBE A;  1DGS A;  3D31 A;  5BR8 Q;  1QUQ A;  1KRT A;  4DR2 L;  1E7Z A;  4BA2 I;  1N32 Q;  3CME A;  4A3M H;  2B63 H;  3M4P A;  5JEA J;  4YY3 Q;  4JBW A;  3U58 A;  1VQ5 A;  1FL0 A;  4A3J G;  4JI3 Q;  3HOU H;  1CKM A;  2XGT A;  4GLA C;  4LF9 Q;  2JA7 H;  2MO1 A;  4GKK L;  4A76 A;  3GTO H;  3H0G G;  3NEL A;  1K8G A;  5IYD H;  1KL9 A;  1CSQ A;  4JCV E;  5GAD C;  2OWO A;  3BJU A;  1NTG A;  1KHI A;  1EYG A;  4IPG A;  3CCV A;  3NBH B;  2JEA I;  2R6G A;  1IBM L;  5C44 H;  3H0G H;  2F3I A;  4JOI A;  1L0W A;  4LF7 L;  1TWC H;  4B3R L;  4FDB A;  3CCU A;  1U0L A;  2AKW B;  5FLM H;  1WOC A;  4YWM A;  4B3S Q;  4JI6 L;  4BBS H;  4LF6 Q;  2UUA Q;  1I6H H;  2H5X A;  4DV0 L;  2E5L Q;  1NE3 A;  5M3M G;  2ID0 A;  1K83 H;  4ME3 A;  1UE7 A;  2GVA A;  3BZK A;  3JC6 6;  3K0X A;  4LW1 A;  1TXY A;  4DPG A;  5IP7 G;  4IJL A;  4Y7N H;  1XMO L;  1QVG A;  1MJE A;  4IFD I;  4DUY L;  4B3T Q;  2FXQ A;  1XMO Q;  4O0A A;  1CKN A;  2CWA A;  4POG A;  3OTO Q;  4LF4 L;  2UUC L;  3RR5 A;  4DV4 L;  1XNR L;  2JA8 G;  2BH2 A;  3CQZ H;  4APV A;  1OTC A;  1KD1 C;  2ZTC A;  5GAH C;  1I50 H;  4DUZ L;  4HJ8 A;  2VUM G;  3S1N H;  2QGQ A;  3E9H A;  4MTN A;  1HNX Q;  2WFW A;  4JC0 A;  4YWK A;  4GLV B;  5M3M H;  1YIJ A;  1VQ6 A;  1HJP A;  2DUD A;  4HIO A;  2AMC B;  1IBL L;  5LMN Q;  2UUB Q;  1L1O A;  3KDF A;  1N9W A;  3M4Q A;  1V43 A;  3E0E A;  5C0X G;  3KJO A;  2IY5 B;  2VL6 A;  1K8A C;  2CQO A;  1C7Y A;  1VQJ A;  3KF6 A;  4X65 Q;  3RNU A;  3UDF A;  3I4M H;  3KFU A;  3KJP A;  4BY1 G;  4LWC A;  4DR4 L;  4B3M Q;  4OO1 G;  3CCL A;  2VQE L;  1OXX K;  1EIY B;  3I55 A;  2E2H H;  1RIP A;  3W1G A;  3M4O H;  4QQB X;  1EQR A;  2AHO B;  2OTJ A;  4C3H H;  1R9T H;  1VQ7 A;  1VQB A;  4LUZ A;  4BY7 G;  3F2D A;  1UWV A;  2VQE Q;  5M5Y H;  2Y0S E;  4YY3 L;  1YHQ A;  3I4N H;  3RZD H;  3CCQ A;  2K52 A;  1Q1B A;  4JBJ A;  2UU9 L;  3HOZ H;  3TS2 A;  1YIT A;  3CW2 C;  1PH1 A;  2MFI A;  1UE1 A;  5C3E G;  1PH3 A;  4DAM A;  5IY0 A;  5EAY A;  1PH6 A;  4R4I A;  1HR0 L;  1I94 Q;  3J80 c;  4JI2 L;  3S1Q H;  4X64 L;  2YTV A;  2HHH Q;  3CMA A;  3PO2 H;  1QVC A;  3GD7 A;  2E2J H;  1VS0 A;  2EIF A;  3K81 C;  4P72 A;  4LF8 Q;  4IFD G;  4P75 A;  2HQL A;  4NB3 A;  1B70 B;  3HOZ G;  1QVF A;  4WJ4 A;  1SRU A;  3G71 A;  2E8G A;  2HHH L;  2B3G A;  3D0F A;  2ES2 A;  5IYD G;  1GVP A;  1VQC A;  4GLX A;  3I4N G;  3G6E A;  2LXK A;  4PZ8 A;  3PUY A;  1A0I A;  2CFM A;  5C4X G;  2ZJP A;  4DR5 Q;  1EQQ A;  3F2B A;  5IYB H;  4C2M H;  3KDF B;  1BKB A;  5K36 G;  4IOC A;  2JEB I;  3I4M G;  1IBK Q;  3PO2 G;  2B29 A;  2R7Z G;  5M5W H;  3NEM A;  1OXU A;  4A3L G;  4DR7 L;  1EFW A;  4PZ7 A;  2JA5 G;  3S24 A;  4A4I A;  4YCU A;  4BXX G;  5GQO A;  4BY7 H;  1GKH A;  1FJG L;  3I4O A;  1CUK A;  1S3O A;  1YHB A;  4IFD J;  3H15 A;  5LMU Q;  4DUZ Q;  1YVC A;  2QA4 A;  1MIU A;  5FLX c;  1A63 A;  1FJG Q;  3HKZ E;  5IYB G;  1MKH A;  2YTY A;  3BU2 A;  3PGZ A;  4DR1 Q;  3CD6 A;  1V9P A;  1XMQ L;  4A3F H;  1LM0 A;  1J5E L;  1Q46 A;  5AJ3 L;  5GAE C;  4A3E H;  4JI7 Q;  1ASZ A;  4A3G H;  3PO3 G;  1VQ8 A;  1T9H A;  3CAM A;  4A3L H;  1EIF A;  3T1H L;  2OTL A;  2MO0 A;  1Q12 A;  4JI8 L;  4ALP A;  1JJC B;  1XPU A;  2WAQ G;  3J80 i;  4EQ5 A;  2OQ0 A;  3T1H Q;  4LFB L;  3RLN A;  2PQA A;  3AFP A;  1PHJ A;  2HT1 A;  1TWG H;  3TRE A;  1HH2 P;  4AIM A;  1VQN A;  3ULL A;  4HIM A;  5FLM G;  4A3B G;  1X3F A;  2JQO A;  4IJH A;  4A75 A;  3NEN A;  5JEA G;  5IWA L;  4A3J H;  4LUV A;  2PMZ E;  1QZG A;  1PH9 A;  5JJL A;  3CCR A;  1KAW A;  2WP8 J;  2JA7 G;  4IO9 A;  4GOP C;  1BVS A;  4IOA A;  5IWA Q;  5C0X J;  4PG3 A;  1XPO A;  1P8L A;  4JI0 Q;  1Q8K A;  3PO3 H;  3S2D H;  1J6Q A;  4A3K H;  4MNO A;  3K7U C;  2ATW A;  2ZM6 L;  1KIX A;  2VY3 A;  3OW2 A;  1VQF A;  2WB1 G;  3RLO A;  1UEB A;  1Q1E A;  1HR0 W;  2JK8 A;  2E2I H;  1E22 A;  4LFA L;  3HKS A;  4A3C G;  3H3V H;  3GDE A;  3STB C;  1XNQ L;  2PI2 A;  5JJK A;  4POF A;  2CCZ A;  2PI2 E;  4DK3 C;  3KF8 B;  4NPS A;  2VUM H;  2K4K A;  4A3K G;  2HIX A;  5ELO A;  2L15 A;  1CKN B;  4OWT B;  1P16 A;  3U50 C;  2VW9 A;  3A0J A;  3M9B A;  3A5Z B;  2UXB Q;  5IYC G;  2NVY H;  3KOJ A;  4J15 A;  4BA1 I;  2Q2T A;  4KHP L;  2QEX A;  4DV1 Q;  2YYZ A;  4HJ9 A;  1SRO A;  2N49 A;  3HOY H;  1VQO A;  2I0Q A;  2VNU D;  1B8A A;  2KBN A;  2IX1 A;  1E24 A;  1PH5 A;  2F4V Q;  1Y1V G;  3HFZ B;  1VQL A;  4YWL A;  2V1C C;  4DV1 L;  3CC4 A;  4OO1 I;  3HOX G;  2YTX A;  1C9O A;  1PFS A;  3K80 C;  4JBM A;  3PUZ A;  3JAM i;  1E3P A;  2UUA L;  2F4V L;  5GRO A;  1HZB A;  1AE2 A;  3UDX A;  1JJ2 A;  5M3F G;  4LFC L;  4X66 L;  1OXV A;  1HNW Q;  2R7Z H;  5H1S E;  1Y1V H;  3UE0 A;  4DV6 L;  4QY7 A;  2NZO A;  4GNX A;  1GO3 E;  3BZC A;  4DUY Q;  2JA5 H;  4DNI A;  2MNA A;  4B3T L;  1Y1W H;  1Y14 B;  1K73 C;  2K75 A;  3S15 H;  1SMX A;  1HNW L;  1GM5 A;  4DR1 L;  4R4T A;  1N36 L;  1PYB A;  4KLK A;  1KC8 C;  2R93 H;  1XMQ Q;  4DV4 Q;  3HOY G;  1XNR Q;  1CSP A;  2Q2U A;  4DV2 L;  1W2B A;  4GS3 A;  3A5U A;  2JA6 H;  4BY1 H;  1VQA A;  4IPH A;  4L5Q A;  4AH6 A;  1N36 Q;  2CWP A;  4IPD A;  1WFQ A;  1YBY A;  3AQQ A;  1IXR A;  2KCT A;  3CC7 A;  3T1Y Q;  1X3E A;  1O7I A;  3I7F A;  4JI4 L;  4X6A H;  4P73 A;  1FVI A;  4A3G G;  4LFB Q;  3PUV A;  3ZJY C;  4DV7 L;  4LF6 L;  1X56 A;  1TWH H;  4A3I G;  4L5T A;  2E5L L;  3GTG H;  1YJ9 A;  3S2H H;  2Y0S G;  2ALY B;  3AEV A;  1YHA A;  5DLQ E;  2CKZ B;  1VQH A;  2IHE A;  3G4S A;  4DR6 L;  4NXN L;  1YJN A;  4AYB E;  1Q82 C;  4X62 L;  3S1M H;  2XTI A;  2Q2H A;  5C3E H;  3U4Z A;  4B3M L;  4HID A;  5C0X I;  4DR6 Q;  1RL2 A;  1TWF H;  4JI0 L;  4GNX B;  1WCM H;  4AQY Q;  1X6O A;  4WJ3 M;  3PCO B;  2UXC L;  3FHW A;  1SLJ A;  2IHF A;  2N8N A;  3CP0 A;  1PH8 A;  4BBR G;  3Q8D A;  2IT1 A;  4GN5 A;  4DAY B;  4DR2 Q;  1IYJ B;  1N32 L;  4OXP A;  2RF4 A;  4TQU S;  4XIG S;  2UU9 Q;  3KYH C;  2K50 A;  1NBW A;  1A8V A;  1LTL A;  1NY4 A;  1VQG A;  4DK6 C;  4GOP A;  3ULP A;  4NXM Q;  2NVQ H;  3W1B A;  1HNZ L;  3ICE A;  4IPC A;  1X55 A;  2JJQ A;  3WWV A;  5C4X H;  2Z0S A;  3CF5 A;  1Y1W G;  3J7Z C;  2R92 G;  3PF4 A;  1B7Y B;  1NMF A;  3JAM c;  1HNZ Q;  2NN6 I;  1VQ4 A;  4GN3 B;  4X65 L;  1E1T A;  4HIK A;  1IL2 A;  1X65 A;  1OXS C;  3KLW A;  3PSI A;  4P71 A;  4DR4 Q;  2C35 B;  2AWO A;  1VQD A;  2K5V A;  3LGJ A;  1I5F A;  4LNQ A;  4A93 H;  3F1Z A;  4A3D G;  4LF5 Q;  4H02 A;  1K9M C;  2KHJ A;  1IBM Q;  3MXN B;  4JYA L;  1X54 A;  2ZJQ A;  3KF6 B;  4UPA A;  5BR8 L;  1JT8 A;  1PV4 A;  4HJ5 A;  1NMG A;  4Y52 H;  2BA1 A;  3PIO A;  3FKI H;  1XJV A;  4LFC Q;  5J3B A;  4X66 Q;  1L2F A;  1KRS A;  4GNX C;  4A93 G;  1KQS A;  4BXX H;  2NN6 G;  2JE6 I;  4DV0 Q;  1HR0 Q;  1I3Q H;  2PQA B;  3HOX H;  1I94 L;  3CPF A;  4JI3 L;  4YHH L;  5IP9 H;  4R4Q A;  4KHZ A;  4C3J H;  1VQK A;  1JMC A;  1X3G A;  1ASY A;  4RMF A;  4PZ6 A;  1WI5 A;  2Q2I A;  1EWI A;  4DR3 L;  1YZ6 A;  4A3F G;  2KHI A;  3ER0 A;  3T1Y L;  4JI5 Q;  1VQM A;  1Q81 C;  4AYB G;  1SFO H;  2HIV A;  3E9I A;  5IP9 G;  3CCS A;  4DV3 Q;  1N33 Q;  3AYH B;  4JOI C;  4DR3 Q;  3RZO H;  1V1Q A;  4KI0 A;  4HJA A;  1YJW A;  5GAG C;  4LF7 Q;  4DR5 L;  1HNX L;  4B3R Q;  4JBK A;  4DV3 L;  2UXD L;  4QGU A;  1S72 A;  1VQE A;  3W5O A;  3M85 A;  1S40 A;  4YCW A;  1IBL Q;  5LMN L;  2UUB L;  2D62 A;  3K7A H;  3DLL A;  1IBK L;  1BBW A;  1JE5 A;  3HKZ G;  2UXD Q;  1L1O C;  3TQY A;  2Z6K C;  1PVO A;  2AWN A;  3GTL H;  3S17 H;  3PUW A;  3PUX A;  4UP7 A;  5IE8 A;  1N8R C;  1PA6 A;  1VQP A;  3TRZ A;  5M5X H;  1LYL A;  3M3Y H;  1CKO A;  1G29 1;  2Z6K A;  1U5K A;  2UUC Q;  5M3F H;  4GKJ Q;  2LXJ A;  1WCM G;  4NXM L;  2OQK A;  1PH2 A;  4A3C H;  4HJ7 A;  1SN8 A;  1YI2 A;  4QL5 A;  5AJ3 Q;  2WAQ E;  4GN4 B;  4JI7 L;  1OXT A;  1E1O A;  3F8T A;  4OWW B;  4K0K L;  2R93 G;  1WJJ A;  2I5H A;  4JI8 Q;  2BH8 A;  4OX9 Q;  3A74 A;  1EUJ A;  3HOW H;  4QIW E;  4R1J A;  3RN5 A;  2ASB A;  4JV5 L;  3SGI A;  5IYC H;  3B6Y A;  3TS0 A;  5C44 G;  4UP9 A;  3S16 H;  1JJG A;  4YCV A;  2R92 H;  2N3S A;  2KEN A;  5C4J H;  2MQH A;  4JV5 Q;  4JI1 L;  4JYA Q;  4C3I H;  3J81 c;  4KHP Q;  1YEZ A;  2VQF Q;  1BBU A;  4JI1 Q;  3CCJ A;  4A3M G;  5HY6 A;  1LUZ A;  4DKA C;  3VDY A;  1XPR A;  3S14 H;  4A3D H;  3AFQ A;  2OCE A;  3U4V A;  4RG1 A;  3FP9 A;  2VQF L;  3RN2 A;  1AH9 A;  4YHH Q;  3J81 j;  1M90 C;  1HZC A;  3L7Z C;  4P74 A;  1UE6 A;  2RHQ B;  2VS1 A;  4LFA Q;  2A8V A;  3FKI G;  3L2P A;  5ELN A;  3CCM A;  3PV0 A;  4JI2 Q;  1X9N A;  1GD7 A;  2I5L X;  2RCN A;  2IX0 A;  3DM3 A;  3OYY A;  4MZ9 A;  4X64 Q;  4GKK Q;  1KXL A;  1WYD A;  1M1K C;  1Z9F A;  3J81 i;  4JI5 L;  1SE8 A;  1A62 A;  2BA0 A;  4LF8 L;  3TEH B;  2EQS A;  1XTD A;  3ULJ A;  4LF9 L;  2JA6 G;  1K0R A;  4A3I H;  3J7A 5;  4XTC S;  3I56 A;  5HGQ A;  1EOV A;  3UDG A;  1N34 L;  2NVX H;  1N33 L;  2UXB L;  4DV2 Q;  4UP8 A;  1SR3 A;  2KCM A;  5IT9 c;  3M7N A;  1N34 Q;  2ZJR A;  1G51 A;  3G48 A;  2JA9 A;  2NVT H;  3F2C A;  4BBS G;  4EX5 A;  3GTK H;  2F52 A;  2I5M X;  4JI4 Q;  2R7F A;  3STB D;  2D0O A;  4O2D A;  3CXC A;  3MEF A;  2ZTE A;  1UE5 A;  5JJI A;  3H3V I;  1AE3 A;  1QUQ B;  3UE1 A;  3PIP A;  3GTJ H;  2NZH A;  4BBR H;  3HOV G;  1H95 A;  4L5S A;  3EN2 A;  3IRB A;  2N78 A;  2WB1 E;  1IZ6 A;  4DR7 Q;  4B3S L;  2K5H A;  3S1R H;  4JI6 Q;  2ZTD A;  2EXD A;  1Q7Y C;  4DV6 Q;  2PNH A;  2GN5 A;  1QZH A;  1JB7 A;  1VQ9 A;  4GKJ L;  2JA8 H;  2GVB A;  2VZA A;  1MJC A;  3RLF A;  1K3R A;  4LUO A;  2K5N A;  3PF5 A;  3CC2 A;  4L5R C;  4AQY L;  4JG2 A;  1D7Q A;  2YU9 H;  4R4O A;  2UXC Q;  5LMU L;  1Z47 A;  1W3S A;  2DGY A;  5FJ8 H;  1C0A A;  3GO5 A;  4A3B H;  4UY8 C;  1VQI A;  3OTO L;  4LF4 Q;  4K0K Q;  2D0P A;  1J5E Q;  2LSS A;  2ZM6 Q;  4QJF A;  4R4C A;  1HZ9 A;  1TWA H;  4OON A;  5LMN W;  4TVA B;  3HOV H;  4OX9 L;  2YV5 A;  2R7D A;  1VCI A;  4PMW A;  2K14 A;  4DV5 L;  3GTM H;  3GTQ H;  2A19 A;  4DV7 Q;  3ERS X;  4GOP B;  1XNQ Q;  5FJ8 G;  3GTP H;  1HZA A;  1G6P A;  1PYS B;  2RHS B;  3I2Z A;  1Q86 C;  3K8A A;  3L0O A;  4DV5 Q;  1D8L A;  4NXN Q;  4X62 Q;  1YNX A;  4OWX B;  2A1A A;  3HOW G;  3UDI A;  1NJI C;  3CPW A;  2B63 G;  1FGU A;  3CCE A;  1PH4 A;  4A3E G;  1PH7 A;  5IP7 H;  4LF5 L;  3EIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...