2PW5A

Crystal structure of staphylococcal nuclease variant v66y/p117g/h124l/s128a at room temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMYENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pw5A00
3EVQA 4KJOA 1EY9A 3R3OA 1NSNS 4ME5A 4KY5A 1SYEA 1JOOA 5I6YA 5CV7A 4NMZA 4G57A 1JOQA 2ENBA 5C3XA 3MHBA 2EYMA 3P1HA 4I65A 4K2KA 3T16A 4K5WA 4QMGA 2NUCA 5IOCA 1STBA 3OWFA 4MIUA 4RKLA 4DFAA 5IGEA 2OXPA 5CV5A 1SYCA 3QOJA 1SNQA 1II3A 4EQPA 1A3TA 2QDBA 2RDFA 3V2TA 4OL7A 5C4HA 3C1EA 4TRDA 1KDBA 3RUZA 1EY5A 3ITPA 4KD4A 2EY5A 3BDLA 4HMIA 3SK5A 4EVOA 3QOLA 4J6HA 2EYOA 4R8NA 2F0DA 2PW5A 2F0SA 4N9PA 2KQ3A 4J1MA 2F0UA 5C6AA 4B9XA 5C5MA 3E5SA 4EQOA 4HTHA 5F2DA 4K14A 5HURA 2OF1A 2WACA 4HMJA 3D6CA 4KJNA 4KTAA 1SYBA 4DGZA 2F0MA 2LKVA 3D4DA 5NUCA 1A3UA 2SNMA 3EJIA 2EY6A 5JOBA 4ODGA 1A3VA 1EZ8A 3D4WA 2SOBA 3U9OA 2EXZA 2F3VA 5E3FA 5EKKA 1ENCA 1EY8A 3C1FA 1EYCA 3EROA 2EYPA 3OMGA 5EKLA 5HGTA 4K5XA 1STHA 5CGKA 1EY4A 2EY1A 4KY7A 2O4XA 1SNDA 4LAAA 3SR1A 3TP8A 3D8GA 2F0GA 3P75A 2PW7A 1KDCA 4IZ8A 1STGA 5C5LA 2F3WA 3MVVA 4DF7A 5I9PA 5K5PA 3S9WA 3PMFA 1SNPA 1A2TA 1STYA 5KIXA 2OEOA 2PZWA 3NP8A 2F0FA 4ID6A 3TP7A 3NQTA 4YIJA 2EYJA 5KRUA 3TP5A 5M9OA 1F2YA 1KDAA 1EY0A 2F0IA 1KABA 4IUNA 5EGTA 5I6WA 5IGBA 5IGFA 3TP6A 5KYLA 4K2LA 2F0HA 2KHSA 2F0TA 5IODA 4NDXA 5C4ZA 3LX0A 3OSOA 1ENAA 5IGGA 1F2MA 1TQOA 2RKSA 5IGDA 4KY6A 1SNOA 2HQEA 2M00A 5J1ZA 1NUCA 4F8MA 4E6IA 3SHLA 5KEEA 4NKLA 4PMBA 3SK4A 1KAAA 1STAA 2EYHA 3BDCA 4IALA 4B9WA 3NXWA 5KYIA 5DAUA 2F0NA 4PNYA 2EY2A 1TR5A 1EQVA 2F0PA 4QF4A 5C3WA 5CV4A 4EQNA 4KV6A 5IIFA 1SNCA 2F0JA 3NK9A 4WRDA 1U9RA 2RBMA 2PZUA 3H6MA 2PZTA 3SXHA 3VA5A 2F0QA 4K5VA 4ZQ3A 5JAVA 4K8IA 1JORA 4K8JA 2PYKA 1EY7A 2SNSA 4F7XA 5CV8A 5DEHA 4ZUJA 1SYFA 4K6DA 1RKNA 3DHQA 3HEJA 4ZUIA 2F0WA 3MEHA 5CR3A 5J22A 5E1FA 1SYDA 4PMCA 1A2UA 3QB3A 4N9TA 2F0EA 5CC4A 1EYAA 1TT2A 5I9OA 3OMCA 1EZ6A 4KD3A 1IHZA 1SNMA 4QB4A 5CV9A 5KGUA 5IGCA 3SK6A 2F0LA 4KHVA 5CV6A 2EYLA 1JOKA 4NP5A 2F0VA 1STNA 1EYDA 3ERQA 4H7BA 4WORA 3T13A 1AEXA 3TMEA 1EY6A 2EYFA 3SK8A 4DU9A 3HZXA 3MXPA 4S3SA 5ISRA 2F0OA 4RKBA 1SYGA 1F2ZA 2F0KA 5J39A 3MZ5A 3DMUA 3NHHA 2PQEA 3NUCA
chains in the Genus database with same CATH superfamily
1I94Q 1EU3A 4KI0A 1O80A 4KK7A 5CV7A 4LJZC 4DV0Q 5C3XA 5M3FB 2ATWA 4AQYL 3BJUA 4IFDH 1VS0A 1E24A 1SE8A 3V2TA 4DAMA 2A6EC 4CJ0B 3RUZA 4TRDA 1ET6A 4TQUS 4P73A 5J3BA 2MUYA 4QUCA 1K8OA 2KENA 2MO1A 2F0UA 1Y1WG 1MIUA 3STBC 3RZOH 4K14A 4DV1L 3CF5A 1XNRQ 1BNZA 2DGYA 2F0MA 3I4MH 1KC8C 1SJHD 3MFYA 5ELDA 1A3VA 1EZ8A 2F3VA 1F9PA 4HIKA 1AW7A 1V1PB 4A3FG 3C1FA 3A74A 3K5MA 3PSIA 4A3MG 1EY4A 3SR1A 1BBXC 5FLXE 4YWKA 2EJFC 2PW7A 1U4LA 2F3WA 5C44B 2XWJB 4Y52H 2LMCB 3JC66 3U9SA 4WJ4A 2IX3A 1KDAA 4R9WA 2VB3X 4GLXA 3K0YA 4DV3Q 1TWGH 5IODA 3A7LA 3QO2A 1ONLA 1PRTD 2FMCA 2RKSA 1JQYD 2CQAA 1EOVA 1Z47A 1ZYRC 1NE3A 3T56B 4CDDC 4GLAC 4APVA 3HOZG 5IP7G 1CQVA 3S16H 1G51A 2K03A 5M5YB 3AFQA 4C3IH 4DR4Q 5IP9H 1FR3A 2F0PA 2L11A 4CDCC 3TDQA 4A76A 1B1ZA 4LNQA 3PUZA 4OO1G 2L9HA 1RL2A 4R4IA 1NR2A 4V0BA 3AEVA 1STEA 4ABNA 3RN5A 1VQ6A 3S2DB 1K0SA 2KVMA 5LMNQ 1I4RA 1K8AC 5JJKA 2K1BA 3CKIB 2L4NA 1EIGA 2J4XA 4XXEA 5M3MG 1BDOA 1R4QB 3W1GA 1PH4A 1JC7A 5EPLA 1MI2A 2I07B 2IHFA 1TIID 3M7NA 1GUSA 3M4QA 2FFKB 5C4XG 4BY1G 3PUVA 3A54A 3CQZB 1ICWA 1LTGD 1TWAB 4HN7A 2UUAL 4RMFA 5C0XG 3CW2C 3NTHA 4OHJA 3VR6A 4I65A 4K5WA 3J81E 5T1GA 3OWFA 1B3AA 2FJ2A 4DKAC 1YHQA 4C1NI 1PH5A 2D0PA 2NVTB 1WCMH 4PZ6A 4DA2A 2C9OA 4ZKBB 3A0JA 4UP8A 1F9SA 4CKCA 1DD2A 4XQQA 2AWNA 3BG3A 2K5NA 5AFWA 2VL6A 1YI2A 4WJ3M 4X3UA 1GO3E 4DUYQ 4HMJA 3F2CA 1A63A 4A3JH 4C3HB 2HDLA 4A3KG 4IOCA 3U9OA 3P7JA 1JJCB 1GM5A 4P75A 1GVPA 2VNUD 1CZWA 4DXFA 1JT8A 1Y1VH 2RCNA 3PO2G 3D8GA 1Y8OB 2RQXA 2V4DA 1FNVA 3PO3B 2KHJA 1M1KC 4DV6L 1N34L 3NQTA 1IBMQ 1BF4A 4KLKA 1IBLQ 4GS3A 4P72A 5IGDA 1E3PA 1XXGA 1HTLD 4MTKA 1YJWA 4BY7B 2N55A 3I2ZA 1DM0B 5C4JB 2ZXOA 1D5XC 5IYCG 2KBNA 4A3GH 1U9RA 1R4PB 1PMRA 5ELEA 4K8IA 3HOXH 4FXDA 2FINB 5CV8A 1SYFA 2VS1A 1BBUA 3GTKB 4A75A 1QILA 2MQHA 2Z6KC 1L1OC 5CC4A 1LTTD 2P5ZX 4O2DA 4HIOA 1AP0A 5IWAL 1PFSA 2VQEL 2WAQG 5IT9E 4HJ7A 1OTCA 1KXLA 4XQJA 1EY6A 1J5EQ 4BBSB 1XX8A 4DN4M 3S15B 1V8QA 5DM63 3GV3A 3NUCA 3H91A 3M4OH 4LFBL 1I94L 2QDLA 4IQZA 4PZ8A 2NN6I 1FD7D 1KNAA 4YY3L 1SAPA 4DV0L 3J80i 2OXPA 3K0XA 1SNQA 5M3FG 1EFID 3UE1A 4LF5Q 2A5HA 2CQOA 1M90C 3AMUA 1K83H 4R8NA 3NWTA 2XNAC 5C6AA 3R2IA 4UP9A 2WACA 4DV4Q 1WTOA 2MP1A 3I56A 1XNRL 4A3LH 1W2BA 1YNND 3E0EA 2E74C 3L7ZC 3CP0A 3J7AF 2MJ8A 4FVMA 4OEMB 4FF1A 3S1MH 1QZGA 2EJMA 3PF5A 2EY1A 1PTOH 3WDNA 3A8KE 4PZ7A 1KDCA 1SR3A 3KJPA 5ELFA 1EIFA 3I55A 3BVGA 4RWSC 1HNWQ 5C44G 2A69D 2H4OA 4BWGB 2R92B 2F0TA 4JI2Q 3ER0A 1ESRA 4OO1I 2RA4A 3D3RA 1XMQQ 4LUZA 2KOLA 3FRPB 2C5CA 1HUMA 4PMBA 1KAAA 2EQSA 3D4RA 4B9WA 1S40A 4GNXB 3HG9A 1K73C 1PH6A 3MXGA 5IIFA 4DUZQ 4A3BB 4DAPA 3JAME 4DAVA 4KKUA 1JORA 4A93B 4X65Q 3S24A 1Y1WH 1TWHH 2XWBB 2NWGA 1I50H 1SMYC 3VDYA 4IPCA 4X64Q 3ND8A 4X6AH 3G6EA 3WOEA 4B3TQ 2LY7A 3K5NA 1I3QB 4RAUC 1XTDA 5C0XI 4A3FH 2ZJQA 4RGTA 3K6OA 2EVBA 1QZHA 4DV5Q 4FXGC 4JYAQ 5D3IB 5FKAC 1PZID 1L0XB 1RJTA 2R7ZG 4RGOS 3NHHA 4XDXA 4A4IA 4LWCA 2A6HD 5DLQE 2EYMA 4LF7Q 3A55A 2WIIB 5ELBA 3F8TA 4FYDA 1SYCA 1II3A 5C0XJ 1H95A 5T1IA 4YWMA 3HOZH 5IP7H 1EU4A 2JE6I 3KF8B 2EY5A 3SK5A 1IKLA 4EVOA 4LF8Q 4G7HC 2PQAA 2X6LA 4OGQC 1D1IA 2VZAA 3HOUB 3MXNB 4JI1L 1FGBD 4R8IA 4X3TA 4OO1H 1WYDA 4P71A 4DUYL 4IUQA 5NUCA 3D0FA 3KBXA 4C3HG 5EKKA 1XNQQ 1IW7C 1NTGA 2WKCA 1HCZA 3IKJA 5HGTA 3GTJB 3CAMA 5M3MH 4DV7Q 1GKHA 1NY4A 2N88A 1YBYA 1G8ZD 1RDPD 2B2UC 4JI8Q 2F0FA 3PO3G 5C4XH 2B2VA 2BOSA 4BY1H 2WV6D 1IBML 3I70A 3HKSA 4M1UB 4XT3B 1IBLL 4JI5L 5C0XH 5FK9C 3QWNA 1YJNA 2Q2TA 2LSSA 4BY7G 3IFTA 4I7ZC 3D6WA 4RH6A 1IYUA 3K7AH 3BZCA 5KNDA 4DR2Q 2C35B 2D2CC 4ZUJA 2I5LX 2M9VA 2TSSA 2WKDA 1PA6A 3FVQA 2MFIA 4ZKCB 5J22A 2MGSA 2QILA 3DWAA 1EYAA 1BCPF 2D0OA 2Z8LA 4QB4A 4A3KH 1PRTB 3GD7A 4GOPA 4JI7Q 2KJXA 4HSPA 3GTPB 1RCVD 3H0GB 2EYFA 3PO2H 5LMUQ 3HZXA 1J5EL 1YHBA 1PRTF 3KF6A 3K81C 4QL5A 1Q82C 2RDGA 1JE5A 4CJ1B 4BBSG 4IJLA 2E2IH 1QJOA 4LUOA 1WD1A 2OQ0A 1VQ7A 1GUWA 3S2HB 1NSNS 1UAPA 3CCSA 4TVAB 3J80c 1N36L 3KLSX 1SBBB 2ENBA 3MHBA 4L5QA 3S1QH 2A8VA 1JWUD 2AQ3B 4JI6Q 4F88A 5IYBG 2NVQB 5C4HA 2AHOB 4LF5L 4DNIA 3KDFA 2BH8A 3HFZB 5LL6X 3CCJA 3Q8DA 2PW5A 3NTKA 2KQ3A 5IYCH 1ZXTA 1T9HA 1NCVA 5BR8L 3RLOA 3KJOA 4HTHA 4RGNA 5A35A 1JCKB 1OXVA 4GOPB 2UUAQ 5CMDA 2ZM6L 1V9PA 3CC4A 4ODGA 2R93B 2SOBA 1W3SA 2E76C 3OOCA 2FMMA 2CW0D 2NTSA 3M85A 1O7YA 3OMGA 1I4GA 2KCNA 1TS5A 2E2DC 2VQFQ 1HA6A 1G6PA 5IYDG 1TWCB 3DUZA 4RFBA 4HIDA 5GAHC 3BS1A 4IUVA 3TS2A 2CWAA 4XYOA 3TP5A 3QIAA 1RF2D 2CFMA 4BA1I 5IGBA 1GUNA 1CHQD 2E2HB 3TSSA 3GTQB 2OCEA 5IGGA 1F2MA 1TQOA 1XPOA 4JI2L 2RHSB 1QB5D 1EUJA 4DAYA 2HQEA 2Y0SE 4JV5Q 4YCUA 3QR8A 5JJZA 3MWYW 3OIQA 5M3FH 1QE6A 3BZKA 1K3BC 1SEBD 2QGQA 5CBEE 4JOIA 1UWVA 1SNCA 5TSSA 4DV6Q 3GP7A 2L55A 3ZJYC 1AE2A 4ZRZA 5JVH3 3T53B 2JN4A 1WTQA 1PFMA 3S17B 3GTMB 4L5SA 1LTLA 5CV9A 3KOJA 1CZGA 1Y14B 5KGUA 3TBIB 3SK6A 5IGCA 1OXSC 3DLLA 2K7VA 1JOKA 3DM3A 1I4PA 1PYBA 4P74A 3UE0A 4KN7C 2MO0A 3TMEA 3DXJC 3I3CA 4DV5L 2EE1A 1G291 2F0OA 5ELOA 5J39A 2GA4B 2B2YC 1SRUA 5KNCA 1S5BD 1CHPD 1N9WA 1VF5C 2N8NA 1OXUA 4CBVA 4PG3A 1JOOA 1X32A 2AWOA 3X3MA 1VCIA 4MTNA 1HNZQ 1IKMA 3BDOA 4L8JA 4LF7L 3VR2A 2EDGA 5IWAQ 1VMPA 4WFN3 2VQEQ 3U58A 3P20A 2E2JB 2B2TA 4HSVA 2ZJPA 3G6JB 3F2DA 3K58A 1V1PA 4UY8C 4J1MA 3M4YA 3U4VA 2UUBQ 2GVAA 1YHAA 2OF1A 4B3SQ 3HOUG 4PMWA 2A6ED 3I90A 5AJ3Q 1B50A 1Q3LA 3D4DA 5C3EB 4YY3Q 2WP8J 2KCMA 5M5XB 1ILPA 4RCOA 4CGYB 1ENCA 3J7YW 3S2DH 1HUNA 3EROA 1XNQL 3NQIA 4DR7L 1PTOC 2XN9C 2I5HA 4KY7A 1EOTA 2OQKA 1J8IA 5E4XA 2GN5A 3I4NB 4A3EB 4IZ8A 1STGA 2DUDA 3AB9A 4DV7L 3KLSA 1K8MA 2K5HA 1CQFA 4Z9CB 5E7NA 3FEWX 4YIJA 2UU9Q 4JI8L 5BN5A 2R7ZH 2PO4A 3TP6A 2WINB 1JJGA 2A68C 3PF4A 1NJIC 5I4DA 3CQZH 4KY6A 3KFUA 4UHVA 3KYHC 1LTBD 1N8RC 4OWWB 1BR9A 1CSPA 2B29A 2EY2A 3RR5A 3A7AB 1EQVA 1IYVA 4EQNA 2FHTA 2YTYA 1CA5A 1ZYRD 4DPGA 4DR2L 1VQ5A 2UXCQ 3S1RB 5CR3A 4QY7A 1QNUA 1SYDA 1YNJD 1EQQA 5JEAG 4B3MQ 1BVSA 4C3HH 1Q8KA 4JI7L 5CV6A 3HKZE 3GTLB 3T1HL 3TRZA 4LUVA 1DOMA 2A19A 4DR6L 2B3GA 1K8GA 2O5JC 3H0GG 5LMUL 1SXTA 3A5ZB 4RG1A 1QWYA 2PPBC 2BDOA 3BVZA 2G5DA 3HS0C 1Z7TA 1WTPA 2VY3A 3PO3H 1BCPC 3Q0AA 1QVCA 5CYUA 2OT2A 4PV1C 2UXDQ 1SSOA 1XJVA 4O1NA 2BE5D 5A2QE 4QMGA 3H3VI 1PH8A 3VR3A 4C3JB 4JI6L 1A3TA 1FNWA 3K5OA 1Q7YC 2JA6B 3BDLA 4AYBB 1ILQA 4BY7H 4J8QA 5C4JH 5BN4A 1VQAA 2L12A 1T5XD 3L0OA 1PH1A 2IL8A 2E8GA 2Z4HA 3PUYA 4KN4C 2FXQA 4FP5D 4DGZA 4JBKA 1NMGA 1A3UA 3EJIA 4JG2A 3NBIA 4RA8A 2X6GA 4MNOA 2B39A 3GTKH 1C48A 2EPBA 1ESFA 2DJGC 2KUMA 4DV2L 2R93G 4K5XA 1K0RA 1ASYA 2N49A 5I2XA 1PFNA 4CKBA 3F2BA 3RZOB 5C5LA 1E2VA 3G7LA 1NMFA 2VQFL 1GJXA 1A2TA 1STYA 1HRJA 3I4MB 3GQBA 4JI1Q 1G6ZA 5EKIA 3NSWA 2CVRA 3PQIA 4DK0A 4BBSH 2NZHA 2KHSA 2ZXPA 3BYTB 1RIPA 4RHSA 3OSOA 1XMOQ 1E2WA 1PHJA 1E22A 3R8BA 4LF6L 1O7ZA 1KRSA 4JV5L 5IYBH 4RCNA 2XRSD 2AKWB 2NVYH 1R9TB 1Y8PB 1Y8NB 2PZUA 3ICEA 2PZTA 4MN3A 3VA5A 2F0QA 3B6YA 4U68A 4IURA 2IX1A 1O7LA 4GN3B 3H3VH 1GD7A 3K57A 4BXXG 2NBFA 3HOWB 4JI5Q 1U0LA 2HQLA 1JWSD 3OMCA 2ES2A 4BBRB 3GO5A 1IL8A 1STNA 2NB0A 3CRLC 1VQJA 2YTVA 4S3SA 5FLXL 3ZYYX 2KHIA 3MXUA 5IYDH 1WTRA 3QG1A 2KECA 4HMIA 1P16A 4FO2A 2CWPA 5H1SE 1EY9A 2DNCA 4UAIA 4ME5A 3A8IE 2UUCL 3PGZA 4NMZA 1E1TA 4G57A 1MSGA 4DK6C 2Z9HA 1PV4A 2CHBD 4MIUA 1HNZL 2K5QA 1U4RA 3CCVA 1CSQA 1ZKOA 3PV0A 5CBAE 2N3SA 3JAMi 5G3LF 1FL0A 2IX0A 3ITPA 3ULLA 4FDBA 5EQ0A 3KUPA 2E5LL 5DNFA 1XPRA 1AN8A 2HDMA 3FHWA 2UUBL 1Y69U 5GADC 4ZLTF 2DY7A 1WCMB 4B3SL 2D62A 1N36Q 4LF9L 5AJ3L 4LF4L 3R93A 3ONAB 1VQCA 1WI5A 5C3EG 2EXZA 4IPDA 1BOSA 3GTGH 1A6XA 1CTMA 4GKKL 1EL0A 3TP8A 4ULLA 1HQRD 1HZBA 3S9WA 1Q12A 2XSCA 1D5MC 3PMFA 1EWIA 4A3JB 2OEOA 4A3EG 5BR8Q 2PNRC 3CCEA 3TEHB 2EYJA 2RSNA 4GNXA 2UU9L 1TY0A 3TS0A 1UNSA 2ZM6Q 5C4ZA 2AUJD 4IJHA 2BA1A 3L9AX 4EX5A 1WOCA 5J1ZA 1NUCA 3J7AV 4E6IA 3RMHA 4DR3L 2JA8B 3FDTA 2F0NA 4PNYA 2F03A 1GUOA 1B53A 5CV4A 4Q5VA 3PIO3 1LV9A 3TZDA 2Z6BA 4ZUIA 2Z4IA 2XTIA 2AQ1B 2UXCL 3HOUH 3QB3A 4RGMA 4HJ8A 4X66Q 1QG7A 4B3ML 1X56A 1H9SB 5JPNC 3TQYA 3HOXB 5JEAJ 3ERQA 4H7BA 1IYJB 3IFDA 2QKIC 3AQQA 1K9MC 3GTJH 2JA9A 3SEBA 2UXBL 1O78A 1PYSB 3AFPA 4HIMA 2RSOA 4AYBE 3RN2A 3UDGA 2L15A 1JJ2A 4XTCS 2JA5B 4L5TA 3KF8A 1GHKA 4FNFA 3U4ZA 5D3DA 3T16A 2Y0SB 2KEEA 2UXDL 3MXNA 1CI3M 1D7QA 1STBA 1Q1EA 4RKLA 1ZEQX 2A1AA 2HIXA 3Q22A 4DR1L 1CKNB 2D5DA 2RDFA 3CCQA 1C0AA 3CC7A 4C3JG 2RCFA 4K6LA 2JYOA 4A3MH 4J6HA 1KAWA 2F4VQ 3M4OB 2JA6G 1CK1A 1UE7A 1PVOA 4FXKC 1TWFH 3M4PA 1MGSA 5HURA 1Q8IA 1HFNA 3W5OA 3PIPA 4A3DB 1LTAD 2L0CA 3VYRA 1LTRD 1Q81C 1FJGL 3D4WA 4MZ9A 1K83B 3CCUA 5JEAH 2EYPA 3I4LA 1QVGA 1IBKL 3J80E 4CHTB 3G71A 4TSSA 5GAGC 4Y7NH 3MVVA 3MAQA 1B70B 5IT9L 3GTPH 3S1NH 3H0GH 2EZVA 3CPFA 1F9RA 4JBWA 1IL2A 4QGUA 4CDEC 4H13C 1S5DD 5LL6S 4NDXA 1OO9B 2LXKA 3EN2A 1LUZA 1XMOL 2M00A 2R7FA 3S2HH 2Q2UA 1KL9A 2RDHA 3CC2A 2R7DA 1I4XA 4H44C 4DR7Q 3MEFA 3ULPA 1QNKA 1G2SA 2CKZB 1F77A 5C3WA 4JPBW 2F0JA 3GV6A 5FLMG 2B2WA 1VQLA 4YCVA 3RNUA 4ZQ3A 4K8JA 2PYKA 4C56C 5K36G 3RLFA 4B3RL 3X3NA 3HEJA 1HTPA 1TU2B 3CXCA 1C4QA 4LFAL 1LT5D 3HOWG 2F0LA 4C2MB 4G4KA 3I73A 1I4HA 2HUGA 4NP5A 2R93H 1Y1WB 1VF7A 4BBRG 1TWHB 5KNBA 1Z6HA 5COYA 4EQ5A 1HNXQ 4FF3A 4U673 4HAEA 4EGVA 1TWCH 2ZTCA 1DCZA 5M5WB 1HJPA 4KY5A 4OWTB 4A3FB 1O7IA 4IOAA 1HA5A 3K5LA 3F1ZA 2NUCA 3H94A 2O5IC 2K14A 3CCRA 2XIWA 3OHXC 3GTQH 2JXMB 2JK8A 2JA7B 3T1HQ 1Q46A 3N6RA 4DR6Q 1FNUA 3Q24A 4KKTA 4YHHQ 1EIHA 4OELB 2PI2E 4XT1B 1X6OA 1SE4A 3JAML 3HOVB 4GKJQ 2R3ZA 2EJGC 1RODA 2LKVA 4ZK9B 3A56A 3HOZB 5JOBA 2EY6A 1NBWA 1OXXK 2WB1E 1WCMG 4BXXH 1YZ6A 3S17H 3HKZB 1EY8A 4AIMA 5FO7B 1PH7A 2O4XA 3EQLC 2H1EA 1WJJA 4QIWE 3NBHB 1AZPA 5FJ8G 2EIFA 2PZWA 3DWPA 2MHVA 3FKIB 2ICEC 4IUNA 2JQOA 2YYZA 3VYUA 2K04A 4L5RC 4NW2A 3KK7A 1VQGA 1Z9FA 1EEID 2K75A 3UDXA 1A8VA 1ENAA 1JICA 4JI0L 1AH9A 3UI2A 1ML0D 2PNHA 1CT1D 4IUUA 4KHPL 4DV2Q 5EBDA 1CM9A 4DNRB 5IE8A 2JA8G 1KIXA 2DN8A 1TR5A 4BY1B 1IXRA 2E2JH 1C9OA 2QCPX 3MFGA 3H3VC 4ALPA 1QUQB 3DHQA 1UE5A 1WTHA 3S14B 2V1CC 3ND9A 5E1FA 2NVXH 2R92G 1TT2A 1W6JA 3UDFA 5FOBB 1WVLA 4LF6Q 4ZAIA 3Q6SA 4X66L 5C3EH 1D5ZC 1CA6A 4LFCL 1SE3A 1EYDA 4N8X1 3UDIA 2DJFC 1S5CD 3EIVA 3MXPA 3HOXG 2CW0C 4DNTB 2YU9B 2VXWA 1DZ1A 2F1MA 3DMUA 4A3BG 4A3KB 2ID0A 1VQEA 2CH4A 3R3OA 4A93G 1TY2A 2JA5G 1SYEA 1S5ED 2MNAA 2ALYB 4B08A 3PO2B 3QOJA 1LTID 4OWXB 2Y0SG 1KLGD 2Q8TA 5HGQA 3SGIA 1KDBA 4J15A 4CDFC 4HCSA 1XWEA 4V190 2EYOA 3FPUB 4GNXC 4OIJA 2F4VL 3M3YB 3W1BA 4B9XA 3E5SA 1YVCA 3HOYB 3S1QB 1L1OB 2XVSA 4KTAA 2K52A 5C44H 4OX9L 3MTSA 2UUCQ 2RF4A 2B8FA 1JWMD 3I91A 3GTOB 3S1RH 4A3DG 2EOTA 2ZTDA 1STHA 3N52A 1VQOA 5I9PA 2ZJRA 1KTKA 5GAEC 2E5LQ 1UE1A 2VUMB 4JI3L 1SFOB 5M5YH 3J7ZC 1IZ6A 3CCLA 2KA7A 3V05A 1PTOD 4LF9Q 1KHIA 3LX0A 4LF4Q 1H9RA 2DNEA 3D31A 3I8ZA 4GN4B 4HJ5A 4GKKQ 1E1OA 1UE6A 4JBMA 2RVLA 3IAYA 3STBD 2K33A 2B63B 1I4QA 4QF4A 5KYIA 2DY8A 4WRDA 2F52A 2IPKD 4C3JH 2A68D 1E2ZA 4IPGA 1VQHA 2IHEA 2JA6H 1MHWC 1EY7A 4QCLA 4K0KQ 4R4OA 3RZDB 3J81i 2HHHQ 2VB2X 4POGA 4PMCA 2F0EA 1B3QA 1GXDC 5I9OA 1H9MA 1I6HB 1MBYA 4KD3A 2WFWA 5EPJA 1TWAH 4DR3Q 1D1KA 3O13A 1RD9D 2NVTH 2NN6G 1PYWD 1SYGA 4JBJA 2BA0A 2R6GA 1JB3A 4DR5L 2K6AA 4DXGA 1U4PA 1HNXL 2K28A 1FGUA 4JW0A 4G7OC 1U4MA 2XRQD 2JEAI 4FF4A 5IOCA 4R1JA 1A0IA 4ZCKA 1EYGA 4QUFA 4OL7A 3C1EA 2IT1A 1G2TA 1BCPD 4A3IB 2JA7G 5JJLA 4POFA 2F0SA 3A8JE 2UXBQ 5FLMH 3DEPA 1HR0L 2IY5B 2CCZA 4YHHL 1SJED 1R9TH 1UEBA 4A3CG 5K36H 1X65A 4DK3C 5IY0A 4QJFA 4GKJL 4NPSA 3HOVG 4OIKA 4O0AA 3WWVA 5EBCA 4DR1Q 3HOWH 1LO5D 1Q1BA 1PLFA 2B2WC 3HKZG 4C1NK 1SNDA 1PRTC 1EIYB 1YNJC 2TMPA 4BBRH 2B2VC 5JJIA 1ICFB 2O2LD 3FMCA 5M9OA 4LMQD 2B2UA 3T4AC 1WTXA 2F0HA 5CORA 3FKIG 2QA4A 3DWQA 2A74C 3H15A 1RHPA 1FJGQ 1VQBA 3EA6A 4F8MA 3VYTA 1L2FA 4L63B 4X62Q 3SK4A 1STAA 2EYHA 4KMUC 1IBKQ 2SEBD 1KLUD 4AH6A 1HZCA 2BE5C 2NTTA 2R7ZB 4KV6A 2ASBA 1BQQT 1JB7A 3LWUA 1YEZA 2SNSA 4GZYC 4ZYSA 3HP3A 5BN3A 1XYIA 4JI4Q 2B8GA 1B7YB 1X3GA 5ELNA 3S15H 1DXMA 2AQ2B 1PZJD 3BU2A 4GOPC 4R4QA 4F87A 1W6KA 1VQNA 4KHVA 4R4CA 2EYLA 3OYYA 1PH3A 1WTVA 3IL8A 2F0VA 1B8AA 1EWCA 1D2BA 1AEXA 2VW9A 4NXNL 1TWGB 3R2TA 2F0KA 4I7AA 1PDQA 3G48A 3W3AA 4RHRA 3ERSX 1L0WA 5FJ8H 1VQKA 2Q2HA 1C8CA 2EXDA 4B3RQ 2K32A 3VR4A 1VQIA 1X3PA 4XIGS 1D8LA 2JP1A 5EJWA 4HJAA 1K28A 1N33L 5JPMC 4X3SA 5FLXc 1JOQA 1V1QA 2BH2A 3CHBD 3S16B 4LFAQ 4GN5A 4C3IB 1VMCA 4DFAA 1F2LA 5D65A 5CV5A 3OTOL 2AUKA 2K5WA 4R4TA 1SMXA 1X9NA 2JA8H 3K80C 3QOLA 4IUPA 4CJ2C 2F0DA 3MA2B 1BUVT 2OTLA 5C5MA 1S3OA 3URYA 3SE0A 4H0LC 1SLJA 3D6CA 4JK1C 1SYBA 2PI2A 3T1YL 3CD6A 3HOYG 4HJ9A 2JJQA 1P8LA 3A5UA 1G91A 3L2PA 2R92H 1YITA 5E3FA 1L0YB 2OWOA 5EKLA 2WAQE 3PUWA 4ILWA 1LYLA 3K59A 1MKHA 3L3OC 2BCOA 4KKSA 4DU9A 1LLRD 3P75A 5K5PA 1EWHA 4DF7A 1VQ4A 3E0JA 3CPWA 4ID6A 2I5MX 5KRUA 4UPAA 1F2YA 4FF2A 2VUMG 1HXYD 2F0IA 4A3BH 3E9HA 2GVBA 3CRKC 4A93H 5ELCA 2JA5H 4JC0A 3TZUA 1T5EA 1TS3A 1NR4A 5A2QL 4JOIC 1VQMA 3W2DA 1PH2A 3NK9A 3NEMA 1B9MA 1I3QH 3ULJA 2B63G 1H9KA 1N32Q 1ET9A 3J81c 1H9SA 3I4NG 1M4VA 1UEAB 4K0KL 2F0WA 3PIOA 3Q23A 2WB1B 4OXPA 2HHHL 4JI0Q 1Y1VB 4M8AA 3G4SA 1IHZA 2K01A 2NVYB 4JVZA 1X3EA 4KHPQ 4A3DH 2HCIA 3OPOA 1MJCA 3KLWA 3J81L 4QIWB 5GQOA 3VYSA 3SK8A 3AYHB 1C7YA 1D6EC 1CKNA 4RKBA 1S4ZA 1E0BA 2IW3A 1Q90A 1KNEA 1JMCA 3E3XA 1HR0W 1ENFA 3EVQA 2B2YA 5EPKA 2Q8IB 1K3RA 4K2KA 2HD3A 3VR5A 2E75C 3K7UC 5IGEA 2B2TC 3TREA 4A3GB 4LW1A 3BZDB 4LFCQ 1KQSA 1YNNC 2Q2IA 3I7FA 1SROA 1QVFA 1X3FA 1SMYD 4A3IG 4N9PA 1EQRA 1GOZA 1LM0A 1MJEA 1PXUA 3IRBA 1A62A 1EFWA 5F2DA 1GUTA 1GHJA 4KJNA 3I72A 5GROA 4DV3L 2A69C 3AU7A 1HQMC 1DJRD 4PQXA 1EYCA 5CGKA 4KHZA 1NNXA 1LABA 4LAAA 3BVMA 2R61A 1XPUA 1LTSD 4DR4L 1SNPA 2IWHA 4C2MH 5KIXA 5E4WC 4IUTA 2NN6H 4AYBG 2ZXRA 4WJWA 1KABA 5EGTA 1KRTA 1A15A 1V43A 2F3IA 5IGFA 4OX9Q 3GTGB 5IT9c 4HR7B 1TS4A 4IFDG 5FO9B 5LMNL 2LFNA 3CMEA 4HCEA 3EBEA 5M5WH 5FO8B 1TXYA 1KD1C 4X62L 1CUKA 3NXWA 2F4IA 3WOFA 1WFQA 1TKWB 3FPPA 2H5XA 2JA7H 4JI3Q 1B44D 3H6MA 3SXHA 1DYQA 5JAVA 5D14A 3DEOA 2JSOA 1HZ9A 4K6DA 1FVIA 1IW7D 1X54A 3I4MG 1HFGA 4G7ZC 4BA2I 4A3CH 4L6TB 2Z0SA 3S1MB 4JI4L 2LS01 2L1BA 1RTOA 3HOVH 1M8AA 1VQPA 1VQ9A 1PTOB 1EZ6A 1SNMA 1LACA 4CKEA 1LT3D 2NZ1D 5JVG3 4IN3A 5LHY1 2A6HC 4OONA 1VQDA 1SN8A 2ZTEA 1PTOF 3PIP3 5ISRA 1AE3A 2NVQH 1F2ZA 3MZ5A 4NXMQ 1AZQA 3BYYB 3T51B 3GDEA 2G9HD 4AQYQ 4XQNA 1X55A 1WD0A 3FKIH 2PMZB 2QF7A 4EQPA 2BDNA 2IJ0A 3OW7A 4C3IG 5IP9G 1GUGA 2K5DA 1EY5A 4KD4A 4QQBX 3VA7A 3FP9A 3C2PA 2RHQB 2HCCA 2XGTA 3CU7A 1I50B 4O42A 4DV1Q 4DR5Q 1YNXA 3HGBA 1Q86C 2SNMA 3NBHA 1LT6D 1UUPA 2QW7A 3H09A 2PQAB 3JAMc 4A3MB 3S14H 3NPPA 4ME3A 2E2HH 1EEFD 3KBGA 2NZOA 2X69A 1TWFB 2F0GA 1S5FD 2NYZD 3C46A 1BCPB 3M7GA 1OXTA 3NP8A 5G3LD 1HR0Q 1B9NA 3SVMA 1EY0A 2SDFA 2I46A 4GLVB 4K2LA 4X3KA 2YU9H 4N8FA 1TS2A 3LGJA 1J9OA 2G9DA 4Y7NB 1VDZA 3HRZC 4NKLA 1QUQA 3GTMH 2L5TA 3BDCA 3KLRA 3OIPA 1YJ9A 4IALA 3S1NB 2PCFB 5DAUA 3V96A 2JEBI 4HEDA 1DOLA 5L37A 2KCTA 4K5VA 1N32L 1YIJA 1RKNA 4A3JG 1B2TA 3M3YH 3MEHA 2QEXA 3CCMA 4N9TA 2KEDA 3RLNA 3HOYH 2HT1A 2WB1G 5M3MB 2MPMA 1VQFA 1Y1VG 1HPCA 3CMAA 2I0QA 1NAPA 2D9UA 1BO0A 3GTOH 1J6QA 5C4XB 3LWEA 1BBWA 2K4KA 3J80L 1DOKA 1F9QA 2A73B 2PQEA 1DGSA 4KJOA 4DV4L 2VUMH 3OWEB 1JR0D 3DM1A 1SFOH 5I6YA 3P1HA 1SDFA 2M2LA 3NELA 1PZKD 3J81j 1DONA 2Z6KA 1L1OA 3KF6B 2QDBA 4UP7A 1WTWA 2N78A 1HH2P 5HY6A 3K7AB 3C3LA 1CKMA 1PFBA 1RTNA 2J7ZA 5M5XH 3EFXD 4A3GG 3OW2A 4NXNQ 4MHEA 3M9BA 2K50A 4Q0FA 4P2CB 4YWLA 2Z1CA 3SDZA 2B63H 1HNWL 1MSHA 4EQOA 5I2YA 4YCWA 3I4NH 4A3EH 1N33Q 3PUXA 2KCCA 2CH4W 1CKOA 3K8AA 3KDFB 3NENA 1SE2A 3RZDH 4UDUC 1XMQL 3OTOQ 5LMNW 1U5KA 1ASZA 3NE5B 2K05A 4IFDI 2YV5A 1I6HH 1AFPA 4LK1C 1HHVA 4DUZL 5EAYA 4DK1A 2E2IB 3E6ZX 4IO9A 1N34Q 2K5VA 3TP7A 1S72A 4TKOB 1QOHA 3PCOB 4X65L 2HIVA 5I6WA 5KYLA 3RD4A 2J0TD 3T1YQ 2QEJC 1V1OA 4XYQA 3MC0B 2AMCB 2LXJA 4IPHA 3NTIA 1I6VC 1SNOA 4NB3A 4X64L 5KEEA 3SHLA 3J7A5 4B3TL 4IFDJ 1BKBA 4JCVE 3E9IA 1H9JA 2ICIA 3LNNA 2ZT9C 1QCBD 4JYAL 2RBMA 3TN2A 1JE4A 1XTCD 3GTLH 4A3IH 4DAYB 3QJYA 1BXTA 4F7XA 5DEHA 3U50C 1I5FA 4A3LG 1E7ZA 4H02A 1X3QA 2Q8RE 1A2UA 1MD2D 3F2UA 1LT4D 2WAQB 1EQTA 1CFMA 2PMZE 1TVXA 1HZAA 3I4OA 1B4OA 3T13A 4WORA 1PH9A 4LF8L 3NWSA 4BS9A 1VQ8A 2OTJA 5DM73 1FYCA 2NVXB 2YTXA 4LFBQ 4NXML
chains in the Genus database with same CATH topology
1EU3A 4KI0A 1O80A 4KK7A 5CV7A 4LJZC 5C3XA 5M3FB 4IFDH 3V2TA 2A6EC 4CJ0B 3RUZA 4TRDA 1ET6A 4TQUS 2MUYA 4QUCA 1K8OA 2F0UA 4K14A 1BNZA 2F0MA 1SJHD 3MFYA 5ELDA 1A3VA 1EZ8A 2F3VA 1F9PA 1AW7A 1V1PB 3C1FA 3K5MA 1EY4A 3SR1A 1BBXC 5FLXE 2EJFC 2PW7A 1U4LA 2F3WA 5C44B 2XWJB 2LMCB 3U9SA 2IX3A 1KDAA 4R9WA 2VB3X 3K0YA 5IODA 3A7LA 3QO2A 1ONLA 1PRTD 2FMCA 2RKSA 1JQYD 2CQAA 1Z47A 1ZYRC 3T56B 1CQVA 2K03A 5M5YB 1FR3A 2F0PA 2L11A 3TDQA 1B1ZA 3PUZA 4OO1G 2L9HA 1NR2A 4V0BA 1STEA 4ABNA 3S2DB 2KVMA 1I4RA 2K1BA 3CKIB 2L4NA 1EIGA 2J4XA 4XXEA 1BDOA 1R4QB 1JC7A 5EPLA 1MI2A 2I07B 1TIID 3M7NA 1GUSA 2FFKB 3PUVA 3A54A 3CQZB 1ICWA 1LTGD 1TWAB 4HN7A 5C0XG 3NTHA 4OHJA 3VR6A 4I65A 4K5WA 3J81E 5T1GA 3OWFA 1B3AA 2FJ2A 4C1NI 2NVTB 4DA2A 2C9OA 4ZKBB 1F9SA 4CKCA 1DD2A 4XQQA 2AWNA 3BG3A 5AFWA 4X3UA 4HMJA 4C3HB 2HDLA 3U9OA 3P7JA 2VNUD 1CZWA 4DXFA 3D8GA 1Y8OB 2RQXA 2V4DA 1FNVA 3PO3B 3NQTA 1BF4A 5IGDA 1XXGA 1HTLD 4BY7B 2N55A 1DM0B 5C4JB 2ZXOA 1D5XC 1U9RA 1R4PB 1PMRA 5ELEA 4K8IA 4FXDA 2FINB 5CV8A 1SYFA 3GTKB 1QILA 5CC4A 1LTTD 1AP0A 5IT9E 4XQJA 1EY6A 4BBSB 1XX8A 4DN4M 3S15B 1V8QA 5DM63 3GV3A 3NUCA 3H91A 4IQZA 2NN6I 1FD7D 1KNAA 1SAPA 2OXPA 1SNQA 1EFID 2A5HA 3AMUA 4R8NA 3NWTA 2XNAC 5C6AA 3R2IA 2WACA 1WTOA 2MP1A 1YNND 2E74C 3L7ZC 3J7AF 2MJ8A 4FVMA 4FF1A 2EJMA 2EY1A 1PTOH 3WDNA 3A8KE 1KDCA 5ELFA 3BVGA 4RWSC 2A69D 2H4OA 4BWGB 2R92B 2F0TA 1ESRA 4OO1I 2RA4A 3D3RA 2KOLA 3FRPB 2C5CA 1HUMA 4PMBA 1KAAA 3D4RA 4B9WA 3HG9A 3MXGA 5IIFA 4A3BB 4DAPA 3JAME 4DAVA 4KKUA 1JORA 4A93B 2XWBB 2NWGA 1SMYC 3ND8A 3WOEA 2LY7A 3K5NA 1I3QB 4RAUC 5C0XI 4RGTA 3K6OA 2EVBA 4FXGC 5D3IB 5FKAC 1PZID 1L0XB 1RJTA 4RGOS 3NHHA 4XDXA 2A6HD 2EYMA 3A55A 2WIIB 5ELBA 4FYDA 1SYCA 1II3A 5C0XJ 5T1IA 1EU4A 2JE6I 2EY5A 3SK5A 1IKLA 4EVOA 4G7HC 2X6LA 4OGQC 1D1IA 3HOUB 1FGBD 4R8IA 4X3TA 4OO1H 4IUQA 5NUCA 3KBXA 4C3HG 5EKKA 1IW7C 2WKCA 1HCZA 3IKJA 5HGTA 3GTJB 2N88A 1G8ZD 1RDPD 2B2UC 2F0FA 2B2VA 2BOSA 2WV6D 3I70A 4M1UB 4XT3B 5C0XH 5FK9C 3QWNA 3IFTA 4I7ZC 3D6WA 4RH6A 1IYUA 5KNDA 2D2CC 4ZUJA 2M9VA 2TSSA 2WKDA 3FVQA 4ZKCB 5J22A 2MGSA 2QILA 3DWAA 1EYAA 1BCPF 2Z8LA 4QB4A 1PRTB 3GD7A 2KJXA 4HSPA 3GTPB 1RCVD 3H0GB 2EYFA 3HZXA 1PRTF 2RDGA 4CJ1B 1QJOA 1WD1A 1GUWA 3S2HB 1NSNS 1UAPA 3KLSX 1SBBB 2ENBA 3MHBA 1JWUD 2AQ3B 4F88A 2NVQB 5C4HA 5LL6X 2PW5A 3NTKA 2KQ3A 1ZXTA 1NCVA 4HTHA 4RGNA 5A35A 1JCKB 1OXVA 5CMDA 4ODGA 2R93B 2SOBA 2E76C 3OOCA 2FMMA 2CW0D 2NTSA 3M85A 1O7YA 3OMGA 1I4GA 2KCNA 1TS5A 2E2DC 1HA6A 1TWCB 3DUZA 4RFBA 3BS1A 4IUVA 4XYOA 3TP5A 3QIAA 1RF2D 4BA1I 5IGBA 1GUNA 1CHQD 2E2HB 3TSSA 3GTQB 5IGGA 1F2MA 1TQOA 1QB5D 4DAYA 2HQEA 5JJZA 3MWYW 3OIQA 1QE6A 1SEBD 5CBEE 1SNCA 5TSSA 3GP7A 2L55A 4ZRZA 5JVH3 3T53B 1WTQA 1PFMA 3S17B 3GTMB 5CV9A 1CZGA 5KGUA 3TBIB 3SK6A 5IGCA 1OXSC 2K7VA 1JOKA 1I4PA 4KN7C 3TMEA 3DXJC 3I3CA 2EE1A 1G291 2F0OA 5J39A 2GA4B 2B2YC 5KNCA 1S5BD 1CHPD 1VF5C 1OXUA 4CBVA 1JOOA 1X32A 2AWOA 3X3MA 1VCIA 1IKMA 3BDOA 4L8JA 3VR2A 2EDGA 1VMPA 4WFN3 3P20A 2E2JB 2B2TA 4HSVA 3G6JB 3K58A 1V1PA 4J1MA 3M4YA 2OF1A 4PMWA 2A6ED 3I90A 1B50A 1Q3LA 3D4DA 5C3EB 2WP8J 5M5XB 1ILPA 4RCOA 4CGYB 1ENCA 3J7YW 1HUNA 3EROA 3NQIA 1PTOC 2XN9C 4KY7A 1EOTA 1J8IA 5E4XA 3I4NB 4A3EB 4IZ8A 1STGA 3AB9A 3KLSA 1K8MA 4Z9CB 1CQFA 3FEWX 4YIJA 5BN5A 2PO4A 3TP6A 2WINB 2A68C 5I4DA 4KY6A 1LTBD 1BR9A 2EY2A 3A7AB 1EQVA 1IYVA 4EQNA 2FHTA 1CA5A 1ZYRD 3S1RB 5CR3A 1QNUA 1SYDA 1YNJD 5JEAG 5CV6A 3GTLB 1DOMA 2O5JC 1SXTA 1QWYA 2PPBC 2BDOA 3BVZA 3HS0C 1Z7TA 1WTPA 1BCPC 3Q0AA 5CYUA 2OT2A 4PV1C 1SSOA 4O1NA 2BE5D 5A2QE 4QMGA 3VR3A 4C3JB 1A3TA 1FNWA 3K5OA 2JA6B 3BDLA 4AYBB 1ILQA 4J8QA 5BN4A 2L12A 1T5XD 2IL8A 2Z4HA 3PUYA 4KN4C 4FP5D 4DGZA 1A3UA 3EJIA 3NBIA 4RA8A 2X6GA 2B39A 1C48A 2EPBA 1ESFA 2KUMA 4K5XA 5I2XA 1PFNA 4CKBA 3RZOB 5C5LA 1E2VA 3G7LA 1GJXA 1A2TA 1STYA 1HRJA 3I4MB 3GQBA 1G6ZA 5EKIA 3NSWA 2CVRA 4DK0A 2KHSA 2ZXPA 3BYTB 4RHSA 3OSOA 1E2WA 3R8BA 1O7ZA 4RCNA 2XRSD 1R9TB 1Y8PB 1Y8NB 2PZUA 2PZTA 4MN3A 3VA5A 2F0QA 4U68A 4IURA 2IX1A 1O7LA 3K57A 2NBFA 3HOWB 1JWSD 3OMCA 4BBRB 3GO5A 1STNA 1IL8A 2NB0A 3CRLC 4S3SA 5FLXL 3ZYYX 3MXUA 1WTRA 3QG1A 2KECA 4HMIA 4FO2A 1EY9A 2DNCA 4UAIA 4ME5A 3A8IE 4NMZA 4G57A 1MSGA 2CHBD 4MIUA 2K5QA 1U4RA 1ZKOA 3PV0A 5CBAE 5G3LF 2IX0A 3ITPA 5EQ0A 3KUPA 5DNFA 1AN8A 2HDMA 1Y69U 4ZLTF 2DY7A 1WCMB 2D62A 3R93A 3ONAB 2EXZA 1BOSA 1A6XA 1CTMA 1EL0A 3TP8A 4ULLA 1HQRD 3S9WA 1Q12A 2XSCA 1D5MC 3PMFA 4A3JB 2OEOA 2PNRC 2EYJA 2RSNA 1TY0A 1UNSA 5C4ZA 2AUJD 2BA1A 3L9AX 5J1ZA 1NUCA 3J7AV 4E6IA 3RMHA 2JA8B 3FDTA 2F0NA 4PNYA 2F03A 1GUOA 1B53A 5CV4A 4Q5VA 3PIO3 1LV9A 3TZDA 4ZUIA 2Z4IA 2AQ1B 3QB3A 4RGMA 1QG7A 1H9SB 5JPNC 3HOXB 5JEAJ 3ERQA 4H7BA 3IFDA 2QKIC 3SEBA 1O78A 2RSOA 4XTCS 2JA5B 3KF8A 1GHKA 4FNFA 5D3DA 3T16A 2Y0SB 2KEEA 3MXNA 1CI3M 1STBA 1Q1EA 4RKLA 1ZEQX 3Q22A 2D5DA 2RDFA 4C3JG 4K6LA 2JYOA 4J6HA 3M4OB 1CK1A 4FXKC 1MGSA 5HURA 1Q8IA 1HFNA 4A3DB 1LTAD 2L0CA 3VYRA 1LTRD 3D4WA 1K83B 5JEAH 2EYPA 3I4LA 3J80E 4CHTB 4TSSA 3MVVA 3MAQA 5IT9L 2EZVA 1F9RA 4JBWA 4H13C 1S5DD 5LL6S 4NDXA 1OO9B 2M00A 2RDHA 4H44C 1I4XA 1QNKA 1G2SA 1F77A 5C3WA 2F0JA 3GV6A 2B2WA 4ZQ3A 4K8JA 2PYKA 4C56C 5K36G 3RLFA 3X3NA 3HEJA 1HTPA 1TU2B 1C4QA 1LT5D 2F0LA 4C2MB 4G4KA 3I73A 1I4HA 2HUGA 4NP5A 1Y1WB 1VF7A 1TWHB 5KNBA 1Z6HA 5COYA 4FF3A 4U673 4HAEA 4EGVA 1DCZA 5M5WB 4KY5A 4A3FB 1HA5A 3K5LA 2NUCA 3H94A 2O5IC 2XIWA 3OHXC 2JXMB 2JA7B 3N6RA 1FNUA 3Q24A 4KKTA 1EIHA 4XT1B 1SE4A 3JAML 3HOVB 2R3ZA 2EJGC 1RODA 2LKVA 4ZK9B 3A56A 3HOZB 5JOBA 2EY6A 1OXXK 3HKZB 1EY8A 5FO7B 2O4XA 3EQLC 2H1EA 1AZPA 2PZWA 3DWPA 2MHVA 3FKIB 2ICEC 4IUNA 2YYZA 3VYUA 2K04A 4NW2A 3KK7A 1EEID 1ENAA 1JICA 3UI2A 1ML0D 1CT1D 4IUUA 5EBDA 1CM9A 4DNRB 2DN8A 1TR5A 4BY1B 2QCPX 3MFGA 3H3VC 3DHQA 3S14B 3ND9A 5E1FA 1TT2A 1W6JA 5FOBB 1WVLA 4ZAIA 3Q6SA 1D5ZC 1CA6A 1SE3A 1EYDA 1S5CD 3MXPA 2CW0C 4DNTB 2YU9B 2VXWA 1DZ1A 2F1MA 3DMUA 4A3KB 2ID0A 3R3OA 1TY2A 1SYEA 1S5ED 4B08A 3PO2B 3QOJA 1LTID 1KLGD 2Q8TA 1KDBA 4HCSA 1XWEA 4V190 2EYOA 3FPUB 4OIJA 3M3YB 4B9XA 3E5SA 3HOYB 3S1QB 2XVSA 4KTAA 3MTSA 2B8FA 1JWMD 3I91A 3GTOB 2EOTA 1STHA 3N52A 5I9PA 1KTKA 2VUMB 1SFOB 2KA7A 3V05A 1PTOD 3LX0A 1H9RA 2DNEA 3D31A 3I8ZA 2RVLA 3IAYA 2K33A 2B63B 1I4QA 4QF4A 5KYIA 2DY8A 4WRDA 2IPKD 2A68D 1E2ZA 1EY7A 4QCLA 3RZDB 2VB2X 4PMCA 2F0EA 1GXDC 5I9OA 1H9MA 1I6HB 1MBYA 4KD3A 5EPJA 1D1KA 3O13A 1RD9D 2NN6G 1PYWD 1SYGA 2BA0A 2R6GA 1JB3A 2K6AA 4DXGA 1U4PA 2K28A 4G7OC 1U4MA 2XRQD 2JEAI 4FF4A 5IOCA 4QUFA 4OL7A 3C1EA 2IT1A 1G2TA 1BCPD 4A3IB 2F0SA 3A8JE 3DEPA 1SJED 5K36H 4OIKA 5EBCA 1LO5D 1Q1BA 1PLFA 2B2WC 4C1NK 1SNDA 1PRTC 1YNJC 2TMPA 2B2VC 2O2LD 3FMCA 5M9OA 4LMQD 2B2UA 3T4AC 1WTXA 2F0HA 5CORA 3DWQA 2A74C 1RHPA 3EA6A 4F8MA 3VYTA 4L63B 3SK4A 1STAA 2EYHA 4KMUC 2SEBD 1KLUD 2BE5C 2NTTA 2R7ZB 4KV6A 1BQQT 3LWUA 2SNSA 4GZYC 4ZYSA 3HP3A 5BN3A 1XYIA 2B8GA 1DXMA 2AQ2B 1PZJD 4F87A 1W6KA 4KHVA 2EYLA 1WTVA 3IL8A 2F0VA 1EWCA 1D2BA 1AEXA 1TWGB 3R2TA 2F0KA 4RHRA 1PDQA 3W3AA 1C8CA 2K32A 3VR4A 1X3PA 4XIGS 2JP1A 5EJWA 5JPMC 4X3SA 1JOQA 3CHBD 3S16B 4C3IB 1VMCA 4DFAA 1F2LA 5D65A 5CV5A 2AUKA 2K5WA 3QOLA 4IUPA 4CJ2C 2F0DA 3MA2B 1BUVT 5C5MA 3URYA 3SE0A 4H0LC 3D6CA 4JK1C 1SYBA 1G91A 5E3FA 1L0YB 5EKLA 3PUWA 4ILWA 3K59A 3L3OC 2BCOA 4KKSA 4DU9A 1LLRD 3P75A 5K5PA 1EWHA 4DF7A 3E0JA 4ID6A 5KRUA 1F2YA 4FF2A 1HXYD 2F0IA 3CRKC 5ELCA 3TZUA 1T5EA 1TS3A 1NR4A 5A2QL 3W2DA 3NK9A 1B9MA 1H9KA 1ET9A 1H9SA 1M4VA 1UEAB 2F0WA 3Q23A 2WB1B 1Y1VB 4M8AA 1IHZA 2K01A 2NVYB 2HCIA 3OPOA 3J81L 4QIWB 3VYSA 3SK8A 1D6EC 4RKBA 1S4ZA 1E0BA 2IW3A 1Q90A 1KNEA 1ENFA 3EVQA 2B2YA 5EPKA 2Q8IB 4K2KA 3VR5A 2E75C 5IGEA 2B2TC 4A3GB 3BZDB 1YNNC 1SMYD 4N9PA 1GOZA 1PXUA 5F2DA 1GUTA 1GHJA 4KJNA 3I72A 2A69C 3AU7A 1HQMC 1DJRD 4PQXA 1EYCA 5CGKA 4KHZA 1LABA 4LAAA 3BVMA 2R61A 1LTSD 1SNPA 2IWHA 5KIXA 5E4WC 4IUTA 2NN6H 2ZXRA 4WJWA 1KABA 5EGTA 5IGFA 1A15A 1V43A 3GTGB 4HR7B 1TS4A 4IFDG 5FO9B 2LFNA 4HCEA 5FO8B 3NXWA 2F4IA 3WOFA 1TKWB 3FPPA 1B44D 3H6MA 3SXHA 1DYQA 5JAVA 5D14A 3DEOA 2JSOA 4K6DA 1IW7D 1HFGA 4G7ZC 4BA2I 4L6TB 3S1MB 2LS01 2L1BA 1RTOA 1M8AA 1PTOB 1EZ6A 1SNMA 1LACA 4CKEA 1LT3D 2NZ1D 5JVG3 4IN3A 5LHY1 2A6HC 1PTOF 3PIP3 5ISRA 1F2ZA 3MZ5A 1AZQA 3BYYB 3T51B 2G9HD 4XQNA 1WD0A 2PMZB 2QF7A 4EQPA 2BDNA 2IJ0A 3OW7A 4C3IG 1GUGA 2K5DA 1EY5A 4KD4A 3VA7A 3C2PA 2HCCA 3CU7A 1I50B 4O42A 3HGBA 2SNMA 3NBHA 1LT6D 1UUPA 3H09A 4A3MB 3NPPA 1EEFD 3KBGA 2X69A 1TWFB 2F0GA 1S5FD 2NYZD 3C46A 1BCPB 3M7GA 1OXTA 3NP8A 5G3LD 1B9NA 3SVMA 1EY0A 2SDFA 2I46A 4K2LA 4X3KA 1TS2A 1J9OA 2G9DA 4Y7NB 1VDZA 3HRZC 4NKLA 2L5TA 3BDCA 3KLRA 3OIPA 3S1NB 4IALA 2PCFB 5DAUA 3V96A 2JEBI 4HEDA 1DOLA 4K5VA 1RKNA 1B2TA 3MEHA 4N9TA 2KEDA 5M3MB 2MPMA 1HPCA 1NAPA 2D9UA 1BO0A 5C4XB 3LWEA 3J80L 1DOKA 1F9QA 2A73B 2PQEA 4KJOA 3OWEB 1JR0D 3DM1A 5I6YA 3P1HA 1SDFA 2M2LA 1PZKD 1DONA 2QDBA 1WTWA 3K7AB 3C3LA 1PFBA 1RTNA 2J7ZA 3EFXD 4MHEA 4Q0FA 4P2CB 2Z1CA 3SDZA 1MSHA 4EQOA 5I2YA 3PUXA 2KCCA 1SE2A 4UDUC 3NE5B 2K05A 4IFDI 1AFPA 4LK1C 1HHVA 2E2IB 4DK1A 3E6ZX 3TP7A 4TKOB 1QOHA 5I6WA 5KYLA 3RD4A 2J0TD 2QEJC 1V1OA 4XYQA 3MC0B 3NTIA 1I6VC 1SNOA 5KEEA 3SHLA 4IFDJ 1H9JA 2ICIA 3LNNA 2ZT9C 1QCBD 2RBMA 3TN2A 1JE4A 1XTCD 3QJYA 1BXTA 4F7XA 5DEHA 1X3QA 2Q8RE 1A2UA 1MD2D 3F2UA 1LT4D 2WAQB 1EQTA 1CFMA 1TVXA 1B4OA 3T13A 4WORA 3NWSA 4BS9A 5DM73 1FYCA 2NVXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVQ A;  4KJO A;  1EY9 A;  3R3O A;  1NSN S;  4ME5 A;  4KY5 A;  1SYE A;  1JOO A;  5I6Y A;  5CV7 A;  4NMZ A;  4G57 A;  1JOQ A;  2ENB A;  5C3X A;  3MHB A;  2EYM A;  3P1H A;  4I65 A;  4K2K A;  3T16 A;  4K5W A;  4QMG A;  2NUC A;  5IOC A;  1STB A;  3OWF A;  4MIU A;  4RKL A;  4DFA A;  5IGE A;  2OXP A;  5CV5 A;  1SYC A;  3QOJ A;  1SNQ A;  1II3 A;  4EQP A;  1A3T A;  2QDB A;  2RDF A;  3V2T A;  4OL7 A;  5C4H A;  3C1E A;  4TRD A;  1KDB A;  3RUZ A;  1EY5 A;  3ITP A;  4KD4 A;  2EY5 A;  3BDL A;  4HMI A;  3SK5 A;  4EVO A;  3QOL A;  4J6H A;  2EYO A;  4R8N A;  2F0D A;  2PW5 A;  2F0S A;  4N9P A;  2KQ3 A;  4J1M A;  2F0U A;  5C6A A;  4B9X A;  5C5M A;  3E5S A;  4EQO A;  4HTH A;  5F2D A;  4K14 A;  5HUR A;  2OF1 A;  2WAC A;  4HMJ A;  3D6C A;  4KJN A;  4KTA A;  1SYB A;  4DGZ A;  2F0M A;  2LKV A;  3D4D A;  5NUC A;  1A3U A;  2SNM A;  3EJI A;  2EY6 A;  5JOB A;  4ODG A;  1A3V A;  1EZ8 A;  3D4W A;  2SOB A;  3U9O A;  2EXZ A;  2F3V A;  5E3F A;  5EKK A;  1ENC A;  1EY8 A;  3C1F A;  1EYC A;  3ERO A;  2EYP A;  3OMG A;  5EKL A;  5HGT A;  4K5X A;  1STH A;  5CGK A;  1EY4 A;  2EY1 A;  4KY7 A;  2O4X A;  1SND A;  4LAA A;  3SR1 A;  3TP8 A;  3D8G A;  2F0G A;  3P75 A;  2PW7 A;  1KDC A;  4IZ8 A;  1STG A;  5C5L A;  2F3W A;  3MVV A;  4DF7 A;  5I9P A;  5K5P A;  3S9W A;  3PMF A;  1SNP A;  1A2T A;  1STY A;  5KIX A;  2OEO A;  2PZW A;  3NP8 A;  2F0F A;  4ID6 A;  3TP7 A;  3NQT A;  4YIJ A;  2EYJ A;  5KRU A;  3TP5 A;  5M9O A;  1F2Y A;  1KDA A;  1EY0 A;  2F0I A;  1KAB A;  4IUN A;  5EGT A;  5I6W A;  5IGB A;  5IGF A;  3TP6 A;  5KYL A;  4K2L A;  2F0H A;  2KHS A;  2F0T A;  5IOD A;  4NDX A;  5C4Z A;  3LX0 A;  3OSO A;  1ENA A;  5IGG A;  1F2M A;  1TQO A;  2RKS A;  5IGD A;  4KY6 A;  1SNO A;  2HQE A;  2M00 A;  5J1Z A;  1NUC A;  4F8M A;  4E6I A;  3SHL A;  5KEE A;  4NKL A;  4PMB A;  3SK4 A;  1KAA A;  1STA A;  2EYH A;  3BDC A;  4IAL A;  4B9W A;  3NXW A;  5KYI A;  5DAU A;  2F0N A;  4PNY A;  2EY2 A;  1TR5 A;  1EQV A;  2F0P A;  4QF4 A;  5C3W A;  5CV4 A;  4EQN A;  4KV6 A;  5IIF A;  1SNC A;  2F0J A;  3NK9 A;  4WRD A;  1U9R A;  2RBM A;  2PZU A;  3H6M A;  2PZT A;  3SXH A;  3VA5 A;  2F0Q A;  4K5V A;  4ZQ3 A;  5JAV A;  4K8I A;  1JOR A;  4K8J A;  2PYK A;  1EY7 A;  2SNS A;  4F7X A;  5CV8 A;  5DEH A;  4ZUJ A;  1SYF A;  4K6D A;  1RKN A;  3DHQ A;  3HEJ A;  4ZUI A;  2F0W A;  3MEH A;  5CR3 A;  5J22 A;  5E1F A;  1SYD A;  4PMC A;  1A2U A;  3QB3 A;  4N9T A;  2F0E A;  5CC4 A;  1EYA A;  1TT2 A;  5I9O A;  3OMC A;  1EZ6 A;  4KD3 A;  1IHZ A;  1SNM A;  4QB4 A;  5CV9 A;  5KGU A;  5IGC A;  3SK6 A;  2F0L A;  4KHV A;  5CV6 A;  2EYL A;  1JOK A;  4NP5 A;  2F0V A;  1STN A;  1EYD A;  3ERQ A;  4H7B A;  4WOR A;  3T13 A;  1AEX A;  3TME A;  1EY6 A;  2EYF A;  3SK8 A;  4DU9 A;  3HZX A;  3MXP A;  4S3S A;  5ISR A;  2F0O A;  4RKB A;  1SYG A;  1F2Z A;  2F0K A;  5J39 A;  3MZ5 A;  3DMU A;  3NHH A;  2PQE A;  3NUC A; 
#chains in the Genus database with same CATH topology
 1I94 Q;  1EU3 A;  4KI0 A;  1O80 A;  4KK7 A;  5CV7 A;  4LJZ C;  4DV0 Q;  5C3X A;  5M3F B;  2ATW A;  4AQY L;  3BJU A;  4IFD H;  1VS0 A;  1E24 A;  1SE8 A;  3V2T A;  4DAM A;  2A6E C;  4CJ0 B;  3RUZ A;  4TRD A;  1ET6 A;  4TQU S;  4P73 A;  5J3B A;  2MUY A;  4QUC A;  1K8O A;  2KEN A;  2MO1 A;  2F0U A;  1Y1W G;  1MIU A;  3STB C;  3RZO H;  4K14 A;  4DV1 L;  3CF5 A;  1XNR Q;  1BNZ A;  2DGY A;  2F0M A;  3I4M H;  1KC8 C;  1SJH D;  3MFY A;  5ELD A;  1A3V A;  1EZ8 A;  2F3V A;  1F9P A;  4HIK A;  1AW7 A;  1V1P B;  4A3F G;  3C1F A;  3A74 A;  3K5M A;  3PSI A;  4A3M G;  1EY4 A;  3SR1 A;  1BBX C;  5FLX E;  4YWK A;  2EJF C;  2PW7 A;  1U4L A;  2F3W A;  5C44 B;  2XWJ B;  4Y52 H;  2LMC B;  3JC6 6;  3U9S A;  4WJ4 A;  2IX3 A;  1KDA A;  4R9W A;  2VB3 X;  4GLX A;  3K0Y A;  4DV3 Q;  1TWG H;  5IOD A;  3A7L A;  3QO2 A;  1ONL A;  1PRT D;  2FMC A;  2RKS A;  1JQY D;  2CQA A;  1EOV A;  1Z47 A;  1ZYR C;  1NE3 A;  3T56 B;  4CDD C;  4GLA C;  4APV A;  3HOZ G;  5IP7 G;  1CQV A;  3S16 H;  1G51 A;  2K03 A;  5M5Y B;  3AFQ A;  4C3I H;  4DR4 Q;  5IP9 H;  1FR3 A;  2F0P A;  2L11 A;  4CDC C;  3TDQ A;  4A76 A;  1B1Z A;  4LNQ A;  3PUZ A;  4OO1 G;  2L9H A;  1RL2 A;  4R4I A;  1NR2 A;  4V0B A;  3AEV A;  1STE A;  4ABN A;  3RN5 A;  1VQ6 A;  3S2D B;  1K0S A;  2KVM A;  5LMN Q;  1I4R A;  1K8A C;  5JJK A;  2K1B A;  3CKI B;  2L4N A;  1EIG A;  2J4X A;  4XXE A;  5M3M G;  1BDO A;  1R4Q B;  3W1G A;  1PH4 A;  1JC7 A;  5EPL A;  1MI2 A;  2I07 B;  2IHF A;  1TII D;  3M7N A;  1GUS A;  3M4Q A;  2FFK B;  5C4X G;  4BY1 G;  3PUV A;  3A54 A;  3CQZ B;  1ICW A;  1LTG D;  1TWA B;  4HN7 A;  2UUA L;  4RMF A;  5C0X G;  3CW2 C;  3NTH A;  4OHJ A;  3VR6 A;  4I65 A;  4K5W A;  3J81 E;  5T1G A;  3OWF A;  1B3A A;  2FJ2 A;  4DKA C;  1YHQ A;  4C1N I;  1PH5 A;  2D0P A;  2NVT B;  1WCM H;  4PZ6 A;  4DA2 A;  2C9O A;  4ZKB B;  3A0J A;  4UP8 A;  1F9S A;  4CKC A;  1DD2 A;  4XQQ A;  2AWN A;  3BG3 A;  2K5N A;  5AFW A;  2VL6 A;  1YI2 A;  4WJ3 M;  4X3U A;  1GO3 E;  4DUY Q;  4HMJ A;  3F2C A;  1A63 A;  4A3J H;  4C3H B;  2HDL A;  4A3K G;  4IOC A;  3U9O A;  3P7J A;  1JJC B;  1GM5 A;  4P75 A;  1GVP A;  2VNU D;  1CZW A;  4DXF A;  1JT8 A;  1Y1V H;  2RCN A;  3PO2 G;  3D8G A;  1Y8O B;  2RQX A;  2V4D A;  1FNV A;  3PO3 B;  2KHJ A;  1M1K C;  4DV6 L;  1N34 L;  3NQT A;  1IBM Q;  1BF4 A;  4KLK A;  1IBL Q;  4GS3 A;  4P72 A;  5IGD A;  1E3P A;  1XXG A;  1HTL D;  4MTK A;  1YJW A;  4BY7 B;  2N55 A;  3I2Z A;  1DM0 B;  5C4J B;  2ZXO A;  1D5X C;  5IYC G;  2KBN A;  4A3G H;  1U9R A;  1R4P B;  1PMR A;  5ELE A;  4K8I A;  3HOX H;  4FXD A;  2FIN B;  5CV8 A;  1SYF A;  2VS1 A;  1BBU A;  3GTK B;  4A75 A;  1QIL A;  2MQH A;  2Z6K C;  1L1O C;  5CC4 A;  1LTT D;  2P5Z X;  4O2D A;  4HIO A;  1AP0 A;  5IWA L;  1PFS A;  2VQE L;  2WAQ G;  5IT9 E;  4HJ7 A;  1OTC A;  1KXL A;  4XQJ A;  1EY6 A;  1J5E Q;  4BBS B;  1XX8 A;  4DN4 M;  3S15 B;  1V8Q A;  5DM6 3;  3GV3 A;  3NUC A;  3H91 A;  3M4O H;  4LFB L;  1I94 L;  2QDL A;  4IQZ A;  4PZ8 A;  2NN6 I;  1FD7 D;  1KNA A;  4YY3 L;  1SAP A;  4DV0 L;  3J80 i;  2OXP A;  3K0X A;  1SNQ A;  5M3F G;  1EFI D;  3UE1 A;  4LF5 Q;  2A5H A;  2CQO A;  1M90 C;  3AMU A;  1K83 H;  4R8N A;  3NWT A;  2XNA C;  5C6A A;  3R2I A;  4UP9 A;  2WAC A;  4DV4 Q;  1WTO A;  2MP1 A;  3I56 A;  1XNR L;  4A3L H;  1W2B A;  1YNN D;  3E0E A;  2E74 C;  3L7Z C;  3CP0 A;  3J7A F;  2MJ8 A;  4FVM A;  4OEM B;  4FF1 A;  3S1M H;  1QZG A;  2EJM A;  3PF5 A;  2EY1 A;  1PTO H;  3WDN A;  3A8K E;  4PZ7 A;  1KDC A;  1SR3 A;  3KJP A;  5ELF A;  1EIF A;  3I55 A;  3BVG A;  4RWS C;  1HNW Q;  5C44 G;  2A69 D;  2H4O A;  4BWG B;  2R92 B;  2F0T A;  4JI2 Q;  3ER0 A;  1ESR A;  4OO1 I;  2RA4 A;  3D3R A;  1XMQ Q;  4LUZ A;  2KOL A;  3FRP B;  2C5C A;  1HUM A;  4PMB A;  1KAA A;  2EQS A;  3D4R A;  4B9W A;  1S40 A;  4GNX B;  3HG9 A;  1K73 C;  1PH6 A;  3MXG A;  5IIF A;  4DUZ Q;  4A3B B;  4DAP A;  3JAM E;  4DAV A;  4KKU A;  1JOR A;  4A93 B;  4X65 Q;  3S24 A;  1Y1W H;  1TWH H;  2XWB B;  2NWG A;  1I50 H;  1SMY C;  3VDY A;  4IPC A;  4X64 Q;  3ND8 A;  4X6A H;  3G6E A;  3WOE A;  4B3T Q;  2LY7 A;  3K5N A;  1I3Q B;  4RAU C;  1XTD A;  5C0X I;  4A3F H;  2ZJQ A;  4RGT A;  3K6O A;  2EVB A;  1QZH A;  4DV5 Q;  4FXG C;  4JYA Q;  5D3I B;  5FKA C;  1PZI D;  1L0X B;  1RJT A;  2R7Z G;  4RGO S;  3NHH A;  4XDX A;  4A4I A;  4LWC A;  2A6H D;  5DLQ E;  2EYM A;  4LF7 Q;  3A55 A;  2WII B;  5ELB A;  3F8T A;  4FYD A;  1SYC A;  1II3 A;  5C0X J;  1H95 A;  5T1I A;  4YWM A;  3HOZ H;  5IP7 H;  1EU4 A;  2JE6 I;  3KF8 B;  2EY5 A;  3SK5 A;  1IKL A;  4EVO A;  4LF8 Q;  4G7H C;  2PQA A;  2X6L A;  4OGQ C;  1D1I A;  2VZA A;  3HOU B;  3MXN B;  4JI1 L;  1FGB D;  4R8I A;  4X3T A;  4OO1 H;  1WYD A;  4P71 A;  4DUY L;  4IUQ A;  5NUC A;  3D0F A;  3KBX A;  4C3H G;  5EKK A;  1XNQ Q;  1IW7 C;  1NTG A;  2WKC A;  1HCZ A;  3IKJ A;  5HGT A;  3GTJ B;  3CAM A;  5M3M H;  4DV7 Q;  1GKH A;  1NY4 A;  2N88 A;  1YBY A;  1G8Z D;  1RDP D;  2B2U C;  4JI8 Q;  2F0F A;  3PO3 G;  5C4X H;  2B2V A;  2BOS A;  4BY1 H;  2WV6 D;  1IBM L;  3I70 A;  3HKS A;  4M1U B;  4XT3 B;  1IBL L;  4JI5 L;  5C0X H;  5FK9 C;  3QWN A;  1YJN A;  2Q2T A;  2LSS A;  4BY7 G;  3IFT A;  4I7Z C;  3D6W A;  4RH6 A;  1IYU A;  3K7A H;  3BZC A;  5KND A;  4DR2 Q;  2C35 B;  2D2C C;  4ZUJ A;  2I5L X;  2M9V A;  2TSS A;  2WKD A;  1PA6 A;  3FVQ A;  2MFI A;  4ZKC B;  5J22 A;  2MGS A;  2QIL A;  3DWA A;  1EYA A;  1BCP F;  2D0O A;  2Z8L A;  4QB4 A;  4A3K H;  1PRT B;  3GD7 A;  4GOP A;  4JI7 Q;  2KJX A;  4HSP A;  3GTP B;  1RCV D;  3H0G B;  2EYF A;  3PO2 H;  5LMU Q;  3HZX A;  1J5E L;  1YHB A;  1PRT F;  3KF6 A;  3K81 C;  4QL5 A;  1Q82 C;  2RDG A;  1JE5 A;  4CJ1 B;  4BBS G;  4IJL A;  2E2I H;  1QJO A;  4LUO A;  1WD1 A;  2OQ0 A;  1VQ7 A;  1GUW A;  3S2H B;  1NSN S;  1UAP A;  3CCS A;  4TVA B;  3J80 c;  1N36 L;  3KLS X;  1SBB B;  2ENB A;  3MHB A;  4L5Q A;  3S1Q H;  2A8V A;  1JWU D;  2AQ3 B;  4JI6 Q;  4F88 A;  5IYB G;  2NVQ B;  5C4H A;  2AHO B;  4LF5 L;  4DNI A;  3KDF A;  2BH8 A;  3HFZ B;  5LL6 X;  3CCJ A;  3Q8D A;  2PW5 A;  3NTK A;  2KQ3 A;  5IYC H;  1ZXT A;  1T9H A;  1NCV A;  5BR8 L;  3RLO A;  3KJO A;  4HTH A;  4RGN A;  5A35 A;  1JCK B;  1OXV A;  4GOP B;  2UUA Q;  5CMD A;  2ZM6 L;  1V9P A;  3CC4 A;  4ODG A;  2R93 B;  2SOB A;  1W3S A;  2E76 C;  3OOC A;  2FMM A;  2CW0 D;  2NTS A;  3M85 A;  1O7Y A;  3OMG A;  1I4G A;  2KCN A;  1TS5 A;  2E2D C;  2VQF Q;  1HA6 A;  1G6P A;  5IYD G;  1TWC B;  3DUZ A;  4RFB A;  4HID A;  5GAH C;  3BS1 A;  4IUV A;  3TS2 A;  2CWA A;  4XYO A;  3TP5 A;  3QIA A;  1RF2 D;  2CFM A;  4BA1 I;  5IGB A;  1GUN A;  1CHQ D;  2E2H B;  3TSS A;  3GTQ B;  2OCE A;  5IGG A;  1F2M A;  1TQO A;  1XPO A;  4JI2 L;  2RHS B;  1QB5 D;  1EUJ A;  4DAY A;  2HQE A;  2Y0S E;  4JV5 Q;  4YCU A;  3QR8 A;  5JJZ A;  3MWY W;  3OIQ A;  5M3F H;  1QE6 A;  3BZK A;  1K3B C;  1SEB D;  2QGQ A;  5CBE E;  4JOI A;  1UWV A;  1SNC A;  5TSS A;  4DV6 Q;  3GP7 A;  2L55 A;  3ZJY C;  1AE2 A;  4ZRZ A;  5JVH 3;  3T53 B;  2JN4 A;  1WTQ A;  1PFM A;  3S17 B;  3GTM B;  4L5S A;  1LTL A;  5CV9 A;  3KOJ A;  1CZG A;  1Y14 B;  5KGU A;  3TBI B;  3SK6 A;  5IGC A;  1OXS C;  3DLL A;  2K7V A;  1JOK A;  3DM3 A;  1I4P A;  1PYB A;  4P74 A;  3UE0 A;  4KN7 C;  2MO0 A;  3TME A;  3DXJ C;  3I3C A;  4DV5 L;  2EE1 A;  1G29 1;  2F0O A;  5ELO A;  5J39 A;  2GA4 B;  2B2Y C;  1SRU A;  5KNC A;  1S5B D;  1CHP D;  1N9W A;  1VF5 C;  2N8N A;  1OXU A;  4CBV A;  4PG3 A;  1JOO A;  1X32 A;  2AWO A;  3X3M A;  1VCI A;  4MTN A;  1HNZ Q;  1IKM A;  3BDO A;  4L8J A;  4LF7 L;  3VR2 A;  2EDG A;  5IWA Q;  1VMP A;  4WFN 3;  2VQE Q;  3U58 A;  3P20 A;  2E2J B;  2B2T A;  4HSV A;  2ZJP A;  3G6J B;  3F2D A;  3K58 A;  1V1P A;  4UY8 C;  4J1M A;  3M4Y A;  3U4V A;  2UUB Q;  2GVA A;  1YHA A;  2OF1 A;  4B3S Q;  3HOU G;  4PMW A;  2A6E D;  3I90 A;  5AJ3 Q;  1B50 A;  1Q3L A;  3D4D A;  5C3E B;  4YY3 Q;  2WP8 J;  2KCM A;  5M5X B;  1ILP A;  4RCO A;  4CGY B;  1ENC A;  3J7Y W;  3S2D H;  1HUN A;  3ERO A;  1XNQ L;  3NQI A;  4DR7 L;  1PTO C;  2XN9 C;  2I5H A;  4KY7 A;  1EOT A;  2OQK A;  1J8I A;  5E4X A;  2GN5 A;  3I4N B;  4A3E B;  4IZ8 A;  1STG A;  2DUD A;  3AB9 A;  4DV7 L;  3KLS A;  1K8M A;  2K5H A;  1CQF A;  4Z9C B;  5E7N A;  3FEW X;  4YIJ A;  2UU9 Q;  4JI8 L;  5BN5 A;  2R7Z H;  2PO4 A;  3TP6 A;  2WIN B;  1JJG A;  2A68 C;  3PF4 A;  1NJI C;  5I4D A;  3CQZ H;  4KY6 A;  3KFU A;  4UHV A;  3KYH C;  1LTB D;  1N8R C;  4OWW B;  1BR9 A;  1CSP A;  2B29 A;  2EY2 A;  3RR5 A;  3A7A B;  1EQV A;  1IYV A;  4EQN A;  2FHT A;  2YTY A;  1CA5 A;  1ZYR D;  4DPG A;  4DR2 L;  1VQ5 A;  2UXC Q;  3S1R B;  5CR3 A;  4QY7 A;  1QNU A;  1SYD A;  1YNJ D;  1EQQ A;  5JEA G;  4B3M Q;  1BVS A;  4C3H H;  1Q8K A;  4JI7 L;  5CV6 A;  3HKZ E;  3GTL B;  3T1H L;  3TRZ A;  4LUV A;  1DOM A;  2A19 A;  4DR6 L;  2B3G A;  1K8G A;  2O5J C;  3H0G G;  5LMU L;  1SXT A;  3A5Z B;  4RG1 A;  1QWY A;  2PPB C;  2BDO A;  3BVZ A;  2G5D A;  3HS0 C;  1Z7T A;  1WTP A;  2VY3 A;  3PO3 H;  1BCP C;  3Q0A A;  1QVC A;  5CYU A;  2OT2 A;  4PV1 C;  2UXD Q;  1SSO A;  1XJV A;  4O1N A;  2BE5 D;  5A2Q E;  4QMG A;  3H3V I;  1PH8 A;  3VR3 A;  4C3J B;  4JI6 L;  1A3T A;  1FNW A;  3K5O A;  1Q7Y C;  2JA6 B;  3BDL A;  4AYB B;  1ILQ A;  4BY7 H;  4J8Q A;  5C4J H;  5BN4 A;  1VQA A;  2L12 A;  1T5X D;  3L0O A;  1PH1 A;  2IL8 A;  2E8G A;  2Z4H A;  3PUY A;  4KN4 C;  2FXQ A;  4FP5 D;  4DGZ A;  4JBK A;  1NMG A;  1A3U A;  3EJI A;  4JG2 A;  3NBI A;  4RA8 A;  2X6G A;  4MNO A;  2B39 A;  3GTK H;  1C48 A;  2EPB A;  1ESF A;  2DJG C;  2KUM A;  4DV2 L;  2R93 G;  4K5X A;  1K0R A;  1ASY A;  2N49 A;  5I2X A;  1PFN A;  4CKB A;  3F2B A;  3RZO B;  5C5L A;  1E2V A;  3G7L A;  1NMF A;  2VQF L;  1GJX A;  1A2T A;  1STY A;  1HRJ A;  3I4M B;  3GQB A;  4JI1 Q;  1G6Z A;  5EKI A;  3NSW A;  2CVR A;  3PQI A;  4DK0 A;  4BBS H;  2NZH A;  2KHS A;  2ZXP A;  3BYT B;  1RIP A;  4RHS A;  3OSO A;  1XMO Q;  1E2W A;  1PHJ A;  1E22 A;  3R8B A;  4LF6 L;  1O7Z A;  1KRS A;  4JV5 L;  5IYB H;  4RCN A;  2XRS D;  2AKW B;  2NVY H;  1R9T B;  1Y8P B;  1Y8N B;  2PZU A;  3ICE A;  2PZT A;  4MN3 A;  3VA5 A;  2F0Q A;  3B6Y A;  4U68 A;  4IUR A;  2IX1 A;  1O7L A;  4GN3 B;  3H3V H;  1GD7 A;  3K57 A;  4BXX G;  2NBF A;  3HOW B;  4JI5 Q;  1U0L A;  2HQL A;  1JWS D;  3OMC A;  2ES2 A;  4BBR B;  3GO5 A;  1IL8 A;  1STN A;  2NB0 A;  3CRL C;  1VQJ A;  2YTV A;  4S3S A;  5FLX L;  3ZYY X;  2KHI A;  3MXU A;  5IYD H;  1WTR A;  3QG1 A;  2KEC A;  4HMI A;  1P16 A;  4FO2 A;  2CWP A;  5H1S E;  1EY9 A;  2DNC A;  4UAI A;  4ME5 A;  3A8I E;  2UUC L;  3PGZ A;  4NMZ A;  1E1T A;  4G57 A;  1MSG A;  4DK6 C;  2Z9H A;  1PV4 A;  2CHB D;  4MIU A;  1HNZ L;  2K5Q A;  1U4R A;  3CCV A;  1CSQ A;  1ZKO A;  3PV0 A;  5CBA E;  2N3S A;  3JAM i;  5G3L F;  1FL0 A;  2IX0 A;  3ITP A;  3ULL A;  4FDB A;  5EQ0 A;  3KUP A;  2E5L L;  5DNF A;  1XPR A;  1AN8 A;  2HDM A;  3FHW A;  2UUB L;  1Y69 U;  5GAD C;  4ZLT F;  2DY7 A;  1WCM B;  4B3S L;  2D62 A;  1N36 Q;  4LF9 L;  5AJ3 L;  4LF4 L;  3R93 A;  3ONA B;  1VQC A;  1WI5 A;  5C3E G;  2EXZ A;  4IPD A;  1BOS A;  3GTG H;  1A6X A;  1CTM A;  4GKK L;  1EL0 A;  3TP8 A;  4ULL A;  1HQR D;  1HZB A;  3S9W A;  1Q12 A;  2XSC A;  1D5M C;  3PMF A;  1EWI A;  4A3J B;  2OEO A;  4A3E G;  5BR8 Q;  2PNR C;  3CCE A;  3TEH B;  2EYJ A;  2RSN A;  4GNX A;  2UU9 L;  1TY0 A;  3TS0 A;  1UNS A;  2ZM6 Q;  5C4Z A;  2AUJ D;  4IJH A;  2BA1 A;  3L9A X;  4EX5 A;  1WOC A;  5J1Z A;  1NUC A;  3J7A V;  4E6I A;  3RMH A;  4DR3 L;  2JA8 B;  3FDT A;  2F0N A;  4PNY A;  2F03 A;  1GUO A;  1B53 A;  5CV4 A;  4Q5V A;  3PIO 3;  1LV9 A;  3TZD A;  2Z6B A;  4ZUI A;  2Z4I A;  2XTI A;  2AQ1 B;  2UXC L;  3HOU H;  3QB3 A;  4RGM A;  4HJ8 A;  4X66 Q;  1QG7 A;  4B3M L;  1X56 A;  1H9S B;  5JPN C;  3TQY A;  3HOX B;  5JEA J;  3ERQ A;  4H7B A;  1IYJ B;  3IFD A;  2QKI C;  3AQQ A;  1K9M C;  3GTJ H;  2JA9 A;  3SEB A;  2UXB L;  1O78 A;  1PYS B;  3AFP A;  4HIM A;  2RSO A;  4AYB E;  3RN2 A;  3UDG A;  2L15 A;  1JJ2 A;  4XTC S;  2JA5 B;  4L5T A;  3KF8 A;  1GHK A;  4FNF A;  3U4Z A;  5D3D A;  3T16 A;  2Y0S B;  2KEE A;  2UXD L;  3MXN A;  1CI3 M;  1D7Q A;  1STB A;  1Q1E A;  4RKL A;  1ZEQ X;  2A1A A;  2HIX A;  3Q22 A;  4DR1 L;  1CKN B;  2D5D A;  2RDF A;  3CCQ A;  1C0A A;  3CC7 A;  4C3J G;  2RCF A;  4K6L A;  2JYO A;  4A3M H;  4J6H A;  1KAW A;  2F4V Q;  3M4O B;  2JA6 G;  1CK1 A;  1UE7 A;  1PVO A;  4FXK C;  1TWF H;  3M4P A;  1MGS A;  5HUR A;  1Q8I A;  1HFN A;  3W5O A;  3PIP A;  4A3D B;  1LTA D;  2L0C A;  3VYR A;  1LTR D;  1Q81 C;  1FJG L;  3D4W A;  4MZ9 A;  1K83 B;  3CCU A;  5JEA H;  2EYP A;  3I4L A;  1QVG A;  1IBK L;  3J80 E;  4CHT B;  3G71 A;  4TSS A;  5GAG C;  4Y7N H;  3MVV A;  3MAQ A;  1B70 B;  5IT9 L;  3GTP H;  3S1N H;  3H0G H;  2EZV A;  3CPF A;  1F9R A;  4JBW A;  1IL2 A;  4QGU A;  4CDE C;  4H13 C;  1S5D D;  5LL6 S;  4NDX A;  1OO9 B;  2LXK A;  3EN2 A;  1LUZ A;  1XMO L;  2M00 A;  2R7F A;  3S2H H;  2Q2U A;  1KL9 A;  2RDH A;  3CC2 A;  2R7D A;  1I4X A;  4H44 C;  4DR7 Q;  3MEF A;  3ULP A;  1QNK A;  1G2S A;  2CKZ B;  1F77 A;  5C3W A;  4JPB W;  2F0J A;  3GV6 A;  5FLM G;  2B2W A;  1VQL A;  4YCV A;  3RNU A;  4ZQ3 A;  4K8J A;  2PYK A;  4C56 C;  5K36 G;  3RLF A;  4B3R L;  3X3N A;  3HEJ A;  1HTP A;  1TU2 B;  3CXC A;  1C4Q A;  4LFA L;  1LT5 D;  3HOW G;  2F0L A;  4C2M B;  4G4K A;  3I73 A;  1I4H A;  2HUG A;  4NP5 A;  2R93 H;  1Y1W B;  1VF7 A;  4BBR G;  1TWH B;  5KNB A;  1Z6H A;  5COY A;  4EQ5 A;  1HNX Q;  4FF3 A;  4U67 3;  4HAE A;  4EGV A;  1TWC H;  2ZTC A;  1DCZ A;  5M5W B;  1HJP A;  4KY5 A;  4OWT B;  4A3F B;  1O7I A;  4IOA A;  1HA5 A;  3K5L A;  3F1Z A;  2NUC A;  3H94 A;  2O5I C;  2K14 A;  3CCR A;  2XIW A;  3OHX C;  3GTQ H;  2JXM B;  2JK8 A;  2JA7 B;  3T1H Q;  1Q46 A;  3N6R A;  4DR6 Q;  1FNU A;  3Q24 A;  4KKT A;  4YHH Q;  1EIH A;  4OEL B;  2PI2 E;  4XT1 B;  1X6O A;  1SE4 A;  3JAM L;  3HOV B;  4GKJ Q;  2R3Z A;  2EJG C;  1ROD A;  2LKV A;  4ZK9 B;  3A56 A;  3HOZ B;  5JOB A;  2EY6 A;  1NBW A;  1OXX K;  2WB1 E;  1WCM G;  4BXX H;  1YZ6 A;  3S17 H;  3HKZ B;  1EY8 A;  4AIM A;  5FO7 B;  1PH7 A;  2O4X A;  3EQL C;  2H1E A;  1WJJ A;  4QIW E;  3NBH B;  1AZP A;  5FJ8 G;  2EIF A;  2PZW A;  3DWP A;  2MHV A;  3FKI B;  2ICE C;  4IUN A;  2JQO A;  2YYZ A;  3VYU A;  2K04 A;  4L5R C;  4NW2 A;  3KK7 A;  1VQG A;  1Z9F A;  1EEI D;  2K75 A;  3UDX A;  1A8V A;  1ENA A;  1JIC A;  4JI0 L;  1AH9 A;  3UI2 A;  1ML0 D;  2PNH A;  1CT1 D;  4IUU A;  4KHP L;  4DV2 Q;  5EBD A;  1CM9 A;  4DNR B;  5IE8 A;  2JA8 G;  1KIX A;  2DN8 A;  1TR5 A;  4BY1 B;  1IXR A;  2E2J H;  1C9O A;  2QCP X;  3MFG A;  3H3V C;  4ALP A;  1QUQ B;  3DHQ A;  1UE5 A;  1WTH A;  3S14 B;  2V1C C;  3ND9 A;  5E1F A;  2NVX H;  2R92 G;  1TT2 A;  1W6J A;  3UDF A;  5FOB B;  1WVL A;  4LF6 Q;  4ZAI A;  3Q6S A;  4X66 L;  5C3E H;  1D5Z C;  1CA6 A;  4LFC L;  1SE3 A;  1EYD A;  4N8X 1;  3UDI A;  2DJF C;  1S5C D;  3EIV A;  3MXP A;  3HOX G;  2CW0 C;  4DNT B;  2YU9 B;  2VXW A;  1DZ1 A;  2F1M A;  3DMU A;  4A3B G;  4A3K B;  2ID0 A;  1VQE A;  2CH4 A;  3R3O A;  4A93 G;  1TY2 A;  2JA5 G;  1SYE A;  1S5E D;  2MNA A;  2ALY B;  4B08 A;  3PO2 B;  3QOJ A;  1LTI D;  4OWX B;  2Y0S G;  1KLG D;  2Q8T A;  5HGQ A;  3SGI A;  1KDB A;  4J15 A;  4CDF C;  4HCS A;  1XWE A;  4V19 0;  2EYO A;  3FPU B;  4GNX C;  4OIJ A;  2F4V L;  3M3Y B;  3W1B A;  4B9X A;  3E5S A;  1YVC A;  3HOY B;  3S1Q B;  1L1O B;  2XVS A;  4KTA A;  2K52 A;  5C44 H;  4OX9 L;  3MTS A;  2UUC Q;  2RF4 A;  2B8F A;  1JWM D;  3I91 A;  3GTO B;  3S1R H;  4A3D G;  2EOT A;  2ZTD A;  1STH A;  3N52 A;  1VQO A;  5I9P A;  2ZJR A;  1KTK A;  5GAE C;  2E5L Q;  1UE1 A;  2VUM B;  4JI3 L;  1SFO B;  5M5Y H;  3J7Z C;  1IZ6 A;  3CCL A;  2KA7 A;  3V05 A;  1PTO D;  4LF9 Q;  1KHI A;  3LX0 A;  4LF4 Q;  1H9R A;  2DNE A;  3D31 A;  3I8Z A;  4GN4 B;  4HJ5 A;  4GKK Q;  1E1O A;  1UE6 A;  4JBM A;  2RVL A;  3IAY A;  3STB D;  2K33 A;  2B63 B;  1I4Q A;  4QF4 A;  5KYI A;  2DY8 A;  4WRD A;  2F52 A;  2IPK D;  4C3J H;  2A68 D;  1E2Z A;  4IPG A;  1VQH A;  2IHE A;  2JA6 H;  1MHW C;  1EY7 A;  4QCL A;  4K0K Q;  4R4O A;  3RZD B;  3J81 i;  2HHH Q;  2VB2 X;  4POG A;  4PMC A;  2F0E A;  1B3Q A;  1GXD C;  5I9O A;  1H9M A;  1I6H B;  1MBY A;  4KD3 A;  2WFW A;  5EPJ A;  1TWA H;  4DR3 Q;  1D1K A;  3O13 A;  1RD9 D;  2NVT H;  2NN6 G;  1PYW D;  1SYG A;  4JBJ A;  2BA0 A;  2R6G A;  1JB3 A;  4DR5 L;  2K6A A;  4DXG A;  1U4P A;  1HNX L;  2K28 A;  1FGU A;  4JW0 A;  4G7O C;  1U4M A;  2XRQ D;  2JEA I;  4FF4 A;  5IOC A;  4R1J A;  1A0I A;  4ZCK A;  1EYG A;  4QUF A;  4OL7 A;  3C1E A;  2IT1 A;  1G2T A;  1BCP D;  4A3I B;  2JA7 G;  5JJL A;  4POF A;  2F0S A;  3A8J E;  2UXB Q;  5FLM H;  3DEP A;  1HR0 L;  2IY5 B;  2CCZ A;  4YHH L;  1SJE D;  1R9T H;  1UEB A;  4A3C G;  5K36 H;  1X65 A;  4DK3 C;  5IY0 A;  4QJF A;  4GKJ L;  4NPS A;  3HOV G;  4OIK A;  4O0A A;  3WWV A;  5EBC A;  4DR1 Q;  3HOW H;  1LO5 D;  1Q1B A;  1PLF A;  2B2W C;  3HKZ G;  4C1N K;  1SND A;  1PRT C;  1EIY B;  1YNJ C;  2TMP A;  4BBR H;  2B2V C;  5JJI A;  1ICF B;  2O2L D;  3FMC A;  5M9O A;  4LMQ D;  2B2U A;  3T4A C;  1WTX A;  2F0H A;  5COR A;  3FKI G;  2QA4 A;  3DWQ A;  2A74 C;  3H15 A;  1RHP A;  1FJG Q;  1VQB A;  3EA6 A;  4F8M A;  3VYT A;  1L2F A;  4L63 B;  4X62 Q;  3SK4 A;  1STA A;  2EYH A;  4KMU C;  1IBK Q;  2SEB D;  1KLU D;  4AH6 A;  1HZC A;  2BE5 C;  2NTT A;  2R7Z B;  4KV6 A;  2ASB A;  1BQQ T;  1JB7 A;  3LWU A;  1YEZ A;  2SNS A;  4GZY C;  4ZYS A;  3HP3 A;  5BN3 A;  1XYI A;  4JI4 Q;  2B8G A;  1B7Y B;  1X3G A;  5ELN A;  3S15 H;  1DXM A;  2AQ2 B;  1PZJ D;  3BU2 A;  4GOP C;  4R4Q A;  4F87 A;  1W6K A;  1VQN A;  4KHV A;  4R4C A;  2EYL A;  3OYY A;  1PH3 A;  1WTV A;  3IL8 A;  2F0V A;  1B8A A;  1EWC A;  1D2B A;  1AEX A;  2VW9 A;  4NXN L;  1TWG B;  3R2T A;  2F0K A;  4I7A A;  1PDQ A;  3G48 A;  3W3A A;  4RHR A;  3ERS X;  1L0W A;  5FJ8 H;  1VQK A;  2Q2H A;  1C8C A;  2EXD A;  4B3R Q;  2K32 A;  3VR4 A;  1VQI A;  1X3P A;  4XIG S;  1D8L A;  2JP1 A;  5EJW A;  4HJA A;  1K28 A;  1N33 L;  5JPM C;  4X3S A;  5FLX c;  1JOQ A;  1V1Q A;  2BH2 A;  3CHB D;  3S16 B;  4LFA Q;  4GN5 A;  4C3I B;  1VMC A;  4DFA A;  1F2L A;  5D65 A;  5CV5 A;  3OTO L;  2AUK A;  2K5W A;  4R4T A;  1SMX A;  1X9N A;  2JA8 H;  3K80 C;  3QOL A;  4IUP A;  4CJ2 C;  2F0D A;  3MA2 B;  1BUV T;  2OTL A;  5C5M A;  1S3O A;  3URY A;  3SE0 A;  4H0L C;  1SLJ A;  3D6C A;  4JK1 C;  1SYB A;  2PI2 A;  3T1Y L;  3CD6 A;  3HOY G;  4HJ9 A;  2JJQ A;  1P8L A;  3A5U A;  1G91 A;  3L2P A;  2R92 H;  1YIT A;  5E3F A;  1L0Y B;  2OWO A;  5EKL A;  2WAQ E;  3PUW A;  4ILW A;  1LYL A;  3K59 A;  1MKH A;  3L3O C;  2BCO A;  4KKS A;  4DU9 A;  1LLR D;  3P75 A;  5K5P A;  1EWH A;  4DF7 A;  1VQ4 A;  3E0J A;  3CPW A;  4ID6 A;  2I5M X;  5KRU A;  4UPA A;  1F2Y A;  4FF2 A;  2VUM G;  1HXY D;  2F0I A;  4A3B H;  3E9H A;  2GVB A;  3CRK C;  4A93 H;  5ELC A;  2JA5 H;  4JC0 A;  3TZU A;  1T5E A;  1TS3 A;  1NR4 A;  5A2Q L;  4JOI C;  1VQM A;  3W2D A;  1PH2 A;  3NK9 A;  3NEM A;  1B9M A;  1I3Q H;  3ULJ A;  2B63 G;  1H9K A;  1N32 Q;  1ET9 A;  3J81 c;  1H9S A;  3I4N G;  1M4V A;  1UEA B;  4K0K L;  2F0W A;  3PIO A;  3Q23 A;  2WB1 B;  4OXP A;  2HHH L;  4JI0 Q;  1Y1V B;  4M8A A;  3G4S A;  1IHZ A;  2K01 A;  2NVY B;  4JVZ A;  1X3E A;  4KHP Q;  4A3D H;  2HCI A;  3OPO A;  1MJC A;  3KLW A;  3J81 L;  4QIW B;  5GQO A;  3VYS A;  3SK8 A;  3AYH B;  1C7Y A;  1D6E C;  1CKN A;  4RKB A;  1S4Z A;  1E0B A;  2IW3 A;  1Q90 A;  1KNE A;  1JMC A;  3E3X A;  1HR0 W;  1ENF A;  3EVQ A;  2B2Y A;  5EPK A;  2Q8I B;  1K3R A;  4K2K A;  2HD3 A;  3VR5 A;  2E75 C;  3K7U C;  5IGE A;  2B2T C;  3TRE A;  4A3G B;  4LW1 A;  3BZD B;  4LFC Q;  1KQS A;  1YNN C;  2Q2I A;  3I7F A;  1SRO A;  1QVF A;  1X3F A;  1SMY D;  4A3I G;  4N9P A;  1EQR A;  1GOZ A;  1LM0 A;  1MJE A;  1PXU A;  3IRB A;  1A62 A;  1EFW A;  5F2D A;  1GUT A;  1GHJ A;  4KJN A;  3I72 A;  5GRO A;  4DV3 L;  2A69 C;  3AU7 A;  1HQM C;  1DJR D;  4PQX A;  1EYC A;  5CGK A;  4KHZ A;  1NNX A;  1LAB A;  4LAA A;  3BVM A;  2R61 A;  1XPU A;  1LTS D;  4DR4 L;  1SNP A;  2IWH A;  4C2M H;  5KIX A;  5E4W C;  4IUT A;  2NN6 H;  4AYB G;  2ZXR A;  4WJW A;  1KAB A;  5EGT A;  1KRT A;  1A15 A;  1V43 A;  2F3I A;  5IGF A;  4OX9 Q;  3GTG B;  5IT9 c;  4HR7 B;  1TS4 A;  4IFD G;  5FO9 B;  5LMN L;  2LFN A;  3CME A;  4HCE A;  3EBE A;  5M5W H;  5FO8 B;  1TXY A;  1KD1 C;  4X62 L;  1CUK A;  3NXW A;  2F4I A;  3WOF A;  1WFQ A;  1TKW B;  3FPP A;  2H5X A;  2JA7 H;  4JI3 Q;  1B44 D;  3H6M A;  3SXH A;  1DYQ A;  5JAV A;  5D14 A;  3DEO A;  2JSO A;  1HZ9 A;  4K6D A;  1FVI A;  1IW7 D;  1X54 A;  3I4M G;  1HFG A;  4G7Z C;  4BA2 I;  4A3C H;  4L6T B;  2Z0S A;  3S1M B;  4JI4 L;  2LS0 1;  2L1B A;  1RTO A;  3HOV H;  1M8A A;  1VQP A;  1VQ9 A;  1PTO B;  1EZ6 A;  1SNM A;  1LAC A;  4CKE A;  1LT3 D;  2NZ1 D;  5JVG 3;  4IN3 A;  5LHY 1;  2A6H C;  4OON A;  1VQD A;  1SN8 A;  2ZTE A;  1PTO F;  3PIP 3;  5ISR A;  1AE3 A;  2NVQ H;  1F2Z A;  3MZ5 A;  4NXM Q;  1AZQ A;  3BYY B;  3T51 B;  3GDE A;  2G9H D;  4AQY Q;  4XQN A;  1X55 A;  1WD0 A;  3FKI H;  2PMZ B;  2QF7 A;  4EQP A;  2BDN A;  2IJ0 A;  3OW7 A;  4C3I G;  5IP9 G;  1GUG A;  2K5D A;  1EY5 A;  4KD4 A;  4QQB X;  3VA7 A;  3FP9 A;  3C2P A;  2RHQ B;  2HCC A;  2XGT A;  3CU7 A;  1I50 B;  4O42 A;  4DV1 Q;  4DR5 Q;  1YNX A;  3HGB A;  1Q86 C;  2SNM A;  3NBH A;  1LT6 D;  1UUP A;  2QW7 A;  3H09 A;  2PQA B;  3JAM c;  4A3M B;  3S14 H;  3NPP A;  4ME3 A;  2E2H H;  1EEF D;  3KBG A;  2NZO A;  2X69 A;  1TWF B;  2F0G A;  1S5F D;  2NYZ D;  3C46 A;  1BCP B;  3M7G A;  1OXT A;  3NP8 A;  5G3L D;  1HR0 Q;  1B9N A;  3SVM A;  1EY0 A;  2SDF A;  2I46 A;  4GLV B;  4K2L A;  4X3K A;  2YU9 H;  4N8F A;  1TS2 A;  3LGJ A;  1J9O A;  2G9D A;  4Y7N B;  1VDZ A;  3HRZ C;  4NKL A;  1QUQ A;  3GTM H;  2L5T A;  3BDC A;  3KLR A;  3OIP A;  1YJ9 A;  4IAL A;  3S1N B;  2PCF B;  5DAU A;  3V96 A;  2JEB I;  4HED A;  1DOL A;  5L37 A;  2KCT A;  4K5V A;  1N32 L;  1YIJ A;  1RKN A;  4A3J G;  1B2T A;  3M3Y H;  3MEH A;  2QEX A;  3CCM A;  4N9T A;  2KED A;  3RLN A;  3HOY H;  2HT1 A;  2WB1 G;  5M3M B;  2MPM A;  1VQF A;  1Y1V G;  1HPC A;  3CMA A;  2I0Q A;  1NAP A;  2D9U A;  1BO0 A;  3GTO H;  1J6Q A;  5C4X B;  3LWE A;  1BBW A;  2K4K A;  3J80 L;  1DOK A;  1F9Q A;  2A73 B;  2PQE A;  1DGS A;  4KJO A;  4DV4 L;  2VUM H;  3OWE B;  1JR0 D;  3DM1 A;  1SFO H;  5I6Y A;  3P1H A;  1SDF A;  2M2L A;  3NEL A;  1PZK D;  3J81 j;  1DON A;  2Z6K A;  1L1O A;  3KF6 B;  2QDB A;  4UP7 A;  1WTW A;  2N78 A;  1HH2 P;  5HY6 A;  3K7A B;  3C3L A;  1CKM A;  1PFB A;  1RTN A;  2J7Z A;  5M5X H;  3EFX D;  4A3G G;  3OW2 A;  4NXN Q;  4MHE A;  3M9B A;  2K50 A;  4Q0F A;  4P2C B;  4YWL A;  2Z1C A;  3SDZ A;  2B63 H;  1HNW L;  1MSH A;  4EQO A;  5I2Y A;  4YCW A;  3I4N H;  4A3E H;  1N33 Q;  3PUX A;  2KCC A;  2CH4 W;  1CKO A;  3K8A A;  3KDF B;  3NEN A;  1SE2 A;  3RZD H;  4UDU C;  1XMQ L;  3OTO Q;  5LMN W;  1U5K A;  1ASZ A;  3NE5 B;  2K05 A;  4IFD I;  2YV5 A;  1I6H H;  1AFP A;  4LK1 C;  1HHV A;  4DUZ L;  5EAY A;  4DK1 A;  2E2I B;  3E6Z X;  4IO9 A;  1N34 Q;  2K5V A;  3TP7 A;  1S72 A;  4TKO B;  1QOH A;  3PCO B;  4X65 L;  2HIV A;  5I6W A;  5KYL A;  3RD4 A;  2J0T D;  3T1Y Q;  2QEJ C;  1V1O A;  4XYQ A;  3MC0 B;  2AMC B;  2LXJ A;  4IPH A;  3NTI A;  1I6V C;  1SNO A;  4NB3 A;  4X64 L;  5KEE A;  3SHL A;  3J7A 5;  4B3T L;  4IFD J;  1BKB A;  4JCV E;  3E9I A;  1H9J A;  2ICI A;  3LNN A;  2ZT9 C;  1QCB D;  4JYA L;  2RBM A;  3TN2 A;  1JE4 A;  1XTC D;  3GTL H;  4A3I H;  4DAY B;  3QJY A;  1BXT A;  4F7X A;  5DEH A;  3U50 C;  1I5F A;  4A3L G;  1E7Z A;  4H02 A;  1X3Q A;  2Q8R E;  1A2U A;  1MD2 D;  3F2U A;  1LT4 D;  2WAQ B;  1EQT A;  1CFM A;  2PMZ E;  1TVX A;  1HZA A;  3I4O A;  1B4O A;  3T13 A;  4WOR A;  1PH9 A;  4LF8 L;  3NWS A;  4BS9 A;  1VQ8 A;  2OTJ A;  5DM7 3;  1FYC A;  2NVX B;  2YTX A;  4LFB Q;  4NXM L; 
#chains in the Genus database with same CATH homology
 1EU3 A;  4KI0 A;  1O80 A;  4KK7 A;  5CV7 A;  4LJZ C;  5C3X A;  5M3F B;  4IFD H;  3V2T A;  2A6E C;  4CJ0 B;  3RUZ A;  4TRD A;  1ET6 A;  4TQU S;  2MUY A;  4QUC A;  1K8O A;  2F0U A;  4K14 A;  1BNZ A;  2F0M A;  1SJH D;  3MFY A;  5ELD A;  1A3V A;  1EZ8 A;  2F3V A;  1F9P A;  1AW7 A;  1V1P B;  3C1F A;  3K5M A;  1EY4 A;  3SR1 A;  1BBX C;  5FLX E;  2EJF C;  2PW7 A;  1U4L A;  2F3W A;  5C44 B;  2XWJ B;  2LMC B;  3U9S A;  2IX3 A;  1KDA A;  4R9W A;  2VB3 X;  3K0Y A;  5IOD A;  3A7L A;  3QO2 A;  1ONL A;  1PRT D;  2FMC A;  2RKS A;  1JQY D;  2CQA A;  1Z47 A;  1ZYR C;  3T56 B;  1CQV A;  2K03 A;  5M5Y B;  1FR3 A;  2F0P A;  2L11 A;  3TDQ A;  1B1Z A;  3PUZ A;  4OO1 G;  2L9H A;  1NR2 A;  4V0B A;  1STE A;  4ABN A;  3S2D B;  2KVM A;  1I4R A;  2K1B A;  3CKI B;  2L4N A;  1EIG A;  2J4X A;  4XXE A;  1BDO A;  1R4Q B;  1JC7 A;  5EPL A;  1MI2 A;  2I07 B;  1TII D;  3M7N A;  1GUS A;  2FFK B;  3PUV A;  3A54 A;  3CQZ B;  1ICW A;  1LTG D;  1TWA B;  4HN7 A;  5C0X G;  3NTH A;  4OHJ A;  3VR6 A;  4I65 A;  4K5W A;  3J81 E;  5T1G A;  3OWF A;  1B3A A;  2FJ2 A;  4C1N I;  2NVT B;  4DA2 A;  2C9O A;  4ZKB B;  1F9S A;  4CKC A;  1DD2 A;  4XQQ A;  2AWN A;  3BG3 A;  5AFW A;  4X3U A;  4HMJ A;  4C3H B;  2HDL A;  3U9O A;  3P7J A;  2VNU D;  1CZW A;  4DXF A;  3D8G A;  1Y8O B;  2RQX A;  2V4D A;  1FNV A;  3PO3 B;  3NQT A;  1BF4 A;  5IGD A;  1XXG A;  1HTL D;  4BY7 B;  2N55 A;  1DM0 B;  5C4J B;  2ZXO A;  1D5X C;  1U9R A;  1R4P B;  1PMR A;  5ELE A;  4K8I A;  4FXD A;  2FIN B;  5CV8 A;  1SYF A;  3GTK B;  1QIL A;  5CC4 A;  1LTT D;  1AP0 A;  5IT9 E;  4XQJ A;  1EY6 A;  4BBS B;  1XX8 A;  4DN4 M;  3S15 B;  1V8Q A;  5DM6 3;  3GV3 A;  3NUC A;  3H91 A;  4IQZ A;  2NN6 I;  1FD7 D;  1KNA A;  1SAP A;  2OXP A;  1SNQ A;  1EFI D;  2A5H A;  3AMU A;  4R8N A;  3NWT A;  2XNA C;  5C6A A;  3R2I A;  2WAC A;  1WTO A;  2MP1 A;  1YNN D;  2E74 C;  3L7Z C;  3J7A F;  2MJ8 A;  4FVM A;  4FF1 A;  2EJM A;  2EY1 A;  1PTO H;  3WDN A;  3A8K E;  1KDC A;  5ELF A;  3BVG A;  4RWS C;  2A69 D;  2H4O A;  4BWG B;  2R92 B;  2F0T A;  1ESR A;  4OO1 I;  2RA4 A;  3D3R A;  2KOL A;  3FRP B;  2C5C A;  1HUM A;  4PMB A;  1KAA A;  3D4R A;  4B9W A;  3HG9 A;  3MXG A;  5IIF A;  4A3B B;  4DAP A;  3JAM E;  4DAV A;  4KKU A;  1JOR A;  4A93 B;  2XWB B;  2NWG A;  1SMY C;  3ND8 A;  3WOE A;  2LY7 A;  3K5N A;  1I3Q B;  4RAU C;  5C0X I;  4RGT A;  3K6O A;  2EVB A;  4FXG C;  5D3I B;  5FKA C;  1PZI D;  1L0X B;  1RJT A;  4RGO S;  3NHH A;  4XDX A;  2A6H D;  2EYM A;  3A55 A;  2WII B;  5ELB A;  4FYD A;  1SYC A;  1II3 A;  5C0X J;  5T1I A;  1EU4 A;  2JE6 I;  2EY5 A;  3SK5 A;  1IKL A;  4EVO A;  4G7H C;  2X6L A;  4OGQ C;  1D1I A;  3HOU B;  1FGB D;  4R8I A;  4X3T A;  4OO1 H;  4IUQ A;  5NUC A;  3KBX A;  4C3H G;  5EKK A;  1IW7 C;  2WKC A;  1HCZ A;  3IKJ A;  5HGT A;  3GTJ B;  2N88 A;  1G8Z D;  1RDP D;  2B2U C;  2F0F A;  2B2V A;  2BOS A;  2WV6 D;  3I70 A;  4M1U B;  4XT3 B;  5C0X H;  5FK9 C;  3QWN A;  3IFT A;  4I7Z C;  3D6W A;  4RH6 A;  1IYU A;  5KND A;  2D2C C;  4ZUJ A;  2M9V A;  2TSS A;  2WKD A;  3FVQ A;  4ZKC B;  5J22 A;  2MGS A;  2QIL A;  3DWA A;  1EYA A;  1BCP F;  2Z8L A;  4QB4 A;  1PRT B;  3GD7 A;  2KJX A;  4HSP A;  3GTP B;  1RCV D;  3H0G B;  2EYF A;  3HZX A;  1PRT F;  2RDG A;  4CJ1 B;  1QJO A;  1WD1 A;  1GUW A;  3S2H B;  1NSN S;  1UAP A;  3KLS X;  1SBB B;  2ENB A;  3MHB A;  1JWU D;  2AQ3 B;  4F88 A;  2NVQ B;  5C4H A;  5LL6 X;  2PW5 A;  3NTK A;  2KQ3 A;  1ZXT A;  1NCV A;  4HTH A;  4RGN A;  5A35 A;  1JCK B;  1OXV A;  5CMD A;  4ODG A;  2R93 B;  2SOB A;  2E76 C;  3OOC A;  2FMM A;  2CW0 D;  2NTS A;  3M85 A;  1O7Y A;  3OMG A;  1I4G A;  2KCN A;  1TS5 A;  2E2D C;  1HA6 A;  1TWC B;  3DUZ A;  4RFB A;  3BS1 A;  4IUV A;  4XYO A;  3TP5 A;  3QIA A;  1RF2 D;  4BA1 I;  5IGB A;  1GUN A;  1CHQ D;  2E2H B;  3TSS A;  3GTQ B;  5IGG A;  1F2M A;  1TQO A;  1QB5 D;  4DAY A;  2HQE A;  5JJZ A;  3MWY W;  3OIQ A;  1QE6 A;  1SEB D;  5CBE E;  1SNC A;  5TSS A;  3GP7 A;  2L55 A;  4ZRZ A;  5JVH 3;  3T53 B;  1WTQ A;  1PFM A;  3S17 B;  3GTM B;  5CV9 A;  1CZG A;  5KGU A;  3TBI B;  3SK6 A;  5IGC A;  1OXS C;  2K7V A;  1JOK A;  1I4P A;  4KN7 C;  3TME A;  3DXJ C;  3I3C A;  2EE1 A;  1G29 1;  2F0O A;  5J39 A;  2GA4 B;  2B2Y C;  5KNC A;  1S5B D;  1CHP D;  1VF5 C;  1OXU A;  4CBV A;  1JOO A;  1X32 A;  2AWO A;  3X3M A;  1VCI A;  1IKM A;  3BDO A;  4L8J A;  3VR2 A;  2EDG A;  1VMP A;  4WFN 3;  3P20 A;  2E2J B;  2B2T A;  4HSV A;  3G6J B;  3K58 A;  1V1P A;  4J1M A;  3M4Y A;  2OF1 A;  4PMW A;  2A6E D;  3I90 A;  1B50 A;  1Q3L A;  3D4D A;  5C3E B;  2WP8 J;  5M5X B;  1ILP A;  4RCO A;  4CGY B;  1ENC A;  3J7Y W;  1HUN A;  3ERO A;  3NQI A;  1PTO C;  2XN9 C;  4KY7 A;  1EOT A;  1J8I A;  5E4X A;  3I4N B;  4A3E B;  4IZ8 A;  1STG A;  3AB9 A;  3KLS A;  1K8M A;  4Z9C B;  1CQF A;  3FEW X;  4YIJ A;  5BN5 A;  2PO4 A;  3TP6 A;  2WIN B;  2A68 C;  5I4D A;  4KY6 A;  1LTB D;  1BR9 A;  2EY2 A;  3A7A B;  1EQV A;  1IYV A;  4EQN A;  2FHT A;  1CA5 A;  1ZYR D;  3S1R B;  5CR3 A;  1QNU A;  1SYD A;  1YNJ D;  5JEA G;  5CV6 A;  3GTL B;  1DOM A;  2O5J C;  1SXT A;  1QWY A;  2PPB C;  2BDO A;  3BVZ A;  3HS0 C;  1Z7T A;  1WTP A;  1BCP C;  3Q0A A;  5CYU A;  2OT2 A;  4PV1 C;  1SSO A;  4O1N A;  2BE5 D;  5A2Q E;  4QMG A;  3VR3 A;  4C3J B;  1A3T A;  1FNW A;  3K5O A;  2JA6 B;  3BDL A;  4AYB B;  1ILQ A;  4J8Q A;  5BN4 A;  2L12 A;  1T5X D;  2IL8 A;  2Z4H A;  3PUY A;  4KN4 C;  4FP5 D;  4DGZ A;  1A3U A;  3EJI A;  3NBI A;  4RA8 A;  2X6G A;  2B39 A;  1C48 A;  2EPB A;  1ESF A;  2KUM A;  4K5X A;  5I2X A;  1PFN A;  4CKB A;  3RZO B;  5C5L A;  1E2V A;  3G7L A;  1GJX A;  1A2T A;  1STY A;  1HRJ A;  3I4M B;  3GQB A;  1G6Z A;  5EKI A;  3NSW A;  2CVR A;  4DK0 A;  2KHS A;  2ZXP A;  3BYT B;  4RHS A;  3OSO A;  1E2W A;  3R8B A;  1O7Z A;  4RCN A;  2XRS D;  1R9T B;  1Y8P B;  1Y8N B;  2PZU A;  2PZT A;  4MN3 A;  3VA5 A;  2F0Q A;  4U68 A;  4IUR A;  2IX1 A;  1O7L A;  3K57 A;  2NBF A;  3HOW B;  1JWS D;  3OMC A;  4BBR B;  3GO5 A;  1STN A;  1IL8 A;  2NB0 A;  3CRL C;  4S3S A;  5FLX L;  3ZYY X;  3MXU A;  1WTR A;  3QG1 A;  2KEC A;  4HMI A;  4FO2 A;  1EY9 A;  2DNC A;  4UAI A;  4ME5 A;  3A8I E;  4NMZ A;  4G57 A;  1MSG A;  2CHB D;  4MIU A;  2K5Q A;  1U4R A;  1ZKO A;  3PV0 A;  5CBA E;  5G3L F;  2IX0 A;  3ITP A;  5EQ0 A;  3KUP A;  5DNF A;  1AN8 A;  2HDM A;  1Y69 U;  4ZLT F;  2DY7 A;  1WCM B;  2D62 A;  3R93 A;  3ONA B;  2EXZ A;  1BOS A;  1A6X A;  1CTM A;  1EL0 A;  3TP8 A;  4ULL A;  1HQR D;  3S9W A;  1Q12 A;  2XSC A;  1D5M C;  3PMF A;  4A3J B;  2OEO A;  2PNR C;  2EYJ A;  2RSN A;  1TY0 A;  1UNS A;  5C4Z A;  2AUJ D;  2BA1 A;  3L9A X;  5J1Z A;  1NUC A;  3J7A V;  4E6I A;  3RMH A;  2JA8 B;  3FDT A;  2F0N A;  4PNY A;  2F03 A;  1GUO A;  1B53 A;  5CV4 A;  4Q5V A;  3PIO 3;  1LV9 A;  3TZD A;  4ZUI A;  2Z4I A;  2AQ1 B;  3QB3 A;  4RGM A;  1QG7 A;  1H9S B;  5JPN C;  3HOX B;  5JEA J;  3ERQ A;  4H7B A;  3IFD A;  2QKI C;  3SEB A;  1O78 A;  2RSO A;  4XTC S;  2JA5 B;  3KF8 A;  1GHK A;  4FNF A;  5D3D A;  3T16 A;  2Y0S B;  2KEE A;  3MXN A;  1CI3 M;  1STB A;  1Q1E A;  4RKL A;  1ZEQ X;  3Q22 A;  2D5D A;  2RDF A;  4C3J G;  4K6L A;  2JYO A;  4J6H A;  3M4O B;  1CK1 A;  4FXK C;  1MGS A;  5HUR A;  1Q8I A;  1HFN A;  4A3D B;  1LTA D;  2L0C A;  3VYR A;  1LTR D;  3D4W A;  1K83 B;  5JEA H;  2EYP A;  3I4L A;  3J80 E;  4CHT B;  4TSS A;  3MVV A;  3MAQ A;  5IT9 L;  2EZV A;  1F9R A;  4JBW A;  4H13 C;  1S5D D;  5LL6 S;  4NDX A;  1OO9 B;  2M00 A;  2RDH A;  4H44 C;  1I4X A;  1QNK A;  1G2S A;  1F77 A;  5C3W A;  2F0J A;  3GV6 A;  2B2W A;  4ZQ3 A;  4K8J A;  2PYK A;  4C56 C;  5K36 G;  3RLF A;  3X3N A;  3HEJ A;  1HTP A;  1TU2 B;  1C4Q A;  1LT5 D;  2F0L A;  4C2M B;  4G4K A;  3I73 A;  1I4H A;  2HUG A;  4NP5 A;  1Y1W B;  1VF7 A;  1TWH B;  5KNB A;  1Z6H A;  5COY A;  4FF3 A;  4U67 3;  4HAE A;  4EGV A;  1DCZ A;  5M5W B;  4KY5 A;  4A3F B;  1HA5 A;  3K5L A;  2NUC A;  3H94 A;  2O5I C;  2XIW A;  3OHX C;  2JXM B;  2JA7 B;  3N6R A;  1FNU A;  3Q24 A;  4KKT A;  1EIH A;  4XT1 B;  1SE4 A;  3JAM L;  3HOV B;  2R3Z A;  2EJG C;  1ROD A;  2LKV A;  4ZK9 B;  3A56 A;  3HOZ B;  5JOB A;  2EY6 A;  1OXX K;  3HKZ B;  1EY8 A;  5FO7 B;  2O4X A;  3EQL C;  2H1E A;  1AZP A;  2PZW A;  3DWP A;  2MHV A;  3FKI B;  2ICE C;  4IUN A;  2YYZ A;  3VYU A;  2K04 A;  4NW2 A;  3KK7 A;  1EEI D;  1ENA A;  1JIC A;  3UI2 A;  1ML0 D;  1CT1 D;  4IUU A;  5EBD A;  1CM9 A;  4DNR B;  2DN8 A;  1TR5 A;  4BY1 B;  2QCP X;  3MFG A;  3H3V C;  3DHQ A;  3S14 B;  3ND9 A;  5E1F A;  1TT2 A;  1W6J A;  5FOB B;  1WVL A;  4ZAI A;  3Q6S A;  1D5Z C;  1CA6 A;  1SE3 A;  1EYD A;  1S5C D;  3MXP A;  2CW0 C;  4DNT B;  2YU9 B;  2VXW A;  1DZ1 A;  2F1M A;  3DMU A;  4A3K B;  2ID0 A;  3R3O A;  1TY2 A;  1SYE A;  1S5E D;  4B08 A;  3PO2 B;  3QOJ A;  1LTI D;  1KLG D;  2Q8T A;  1KDB A;  4HCS A;  1XWE A;  4V19 0;  2EYO A;  3FPU B;  4OIJ A;  3M3Y B;  4B9X A;  3E5S A;  3HOY B;  3S1Q B;  2XVS A;  4KTA A;  3MTS A;  2B8F A;  1JWM D;  3I91 A;  3GTO B;  2EOT A;  1STH A;  3N52 A;  5I9P A;  1KTK A;  2VUM B;  1SFO B;  2KA7 A;  3V05 A;  1PTO D;  3LX0 A;  1H9R A;  2DNE A;  3D31 A;  3I8Z A;  2RVL A;  3IAY A;  2K33 A;  2B63 B;  1I4Q A;  4QF4 A;  5KYI A;  2DY8 A;  4WRD A;  2IPK D;  2A68 D;  1E2Z A;  1EY7 A;  4QCL A;  3RZD B;  2VB2 X;  4PMC A;  2F0E A;  1GXD C;  5I9O A;  1H9M A;  1I6H B;  1MBY A;  4KD3 A;  5EPJ A;  1D1K A;  3O13 A;  1RD9 D;  2NN6 G;  1PYW D;  1SYG A;  2BA0 A;  2R6G A;  1JB3 A;  2K6A A;  4DXG A;  1U4P A;  2K28 A;  4G7O C;  1U4M A;  2XRQ D;  2JEA I;  4FF4 A;  5IOC A;  4QUF A;  4OL7 A;  3C1E A;  2IT1 A;  1G2T A;  1BCP D;  4A3I B;  2F0S A;  3A8J E;  3DEP A;  1SJE D;  5K36 H;  4OIK A;  5EBC A;  1LO5 D;  1Q1B A;  1PLF A;  2B2W C;  4C1N K;  1SND A;  1PRT C;  1YNJ C;  2TMP A;  2B2V C;  2O2L D;  3FMC A;  5M9O A;  4LMQ D;  2B2U A;  3T4A C;  1WTX A;  2F0H A;  5COR A;  3DWQ A;  2A74 C;  1RHP A;  3EA6 A;  4F8M A;  3VYT A;  4L63 B;  3SK4 A;  1STA A;  2EYH A;  4KMU C;  2SEB D;  1KLU D;  2BE5 C;  2NTT A;  2R7Z B;  4KV6 A;  1BQQ T;  3LWU A;  2SNS A;  4GZY C;  4ZYS A;  3HP3 A;  5BN3 A;  1XYI A;  2B8G A;  1DXM A;  2AQ2 B;  1PZJ D;  4F87 A;  1W6K A;  4KHV A;  2EYL A;  1WTV A;  3IL8 A;  2F0V A;  1EWC A;  1D2B A;  1AEX A;  1TWG B;  3R2T A;  2F0K A;  4RHR A;  1PDQ A;  3W3A A;  1C8C A;  2K32 A;  3VR4 A;  1X3P A;  4XIG S;  2JP1 A;  5EJW A;  5JPM C;  4X3S A;  1JOQ A;  3CHB D;  3S16 B;  4C3I B;  1VMC A;  4DFA A;  1F2L A;  5D65 A;  5CV5 A;  2AUK A;  2K5W A;  3QOL A;  4IUP A;  4CJ2 C;  2F0D A;  3MA2 B;  1BUV T;  5C5M A;  3URY A;  3SE0 A;  4H0L C;  3D6C A;  4JK1 C;  1SYB A;  1G91 A;  5E3F A;  1L0Y B;  5EKL A;  3PUW A;  4ILW A;  3K59 A;  3L3O C;  2BCO A;  4KKS A;  4DU9 A;  1LLR D;  3P75 A;  5K5P A;  1EWH A;  4DF7 A;  3E0J A;  4ID6 A;  5KRU A;  1F2Y A;  4FF2 A;  1HXY D;  2F0I A;  3CRK C;  5ELC A;  3TZU A;  1T5E A;  1TS3 A;  1NR4 A;  5A2Q L;  3W2D A;  3NK9 A;  1B9M A;  1H9K A;  1ET9 A;  1H9S A;  1M4V A;  1UEA B;  2F0W A;  3Q23 A;  2WB1 B;  1Y1V B;  4M8A A;  1IHZ A;  2K01 A;  2NVY B;  2HCI A;  3OPO A;  3J81 L;  4QIW B;  3VYS A;  3SK8 A;  1D6E C;  4RKB A;  1S4Z A;  1E0B A;  2IW3 A;  1Q90 A;  1KNE A;  1ENF A;  3EVQ A;  2B2Y A;  5EPK A;  2Q8I B;  4K2K A;  3VR5 A;  2E75 C;  5IGE A;  2B2T C;  4A3G B;  3BZD B;  1YNN C;  1SMY D;  4N9P A;  1GOZ A;  1PXU A;  5F2D A;  1GUT A;  1GHJ A;  4KJN A;  3I72 A;  2A69 C;  3AU7 A;  1HQM C;  1DJR D;  4PQX A;  1EYC A;  5CGK A;  4KHZ A;  1LAB A;  4LAA A;  3BVM A;  2R61 A;  1LTS D;  1SNP A;  2IWH A;  5KIX A;  5E4W C;  4IUT A;  2NN6 H;  2ZXR A;  4WJW A;  1KAB A;  5EGT A;  5IGF A;  1A15 A;  1V43 A;  3GTG B;  4HR7 B;  1TS4 A;  4IFD G;  5FO9 B;  2LFN A;  4HCE A;  5FO8 B;  3NXW A;  2F4I A;  3WOF A;  1TKW B;  3FPP A;  1B44 D;  3H6M A;  3SXH A;  1DYQ A;  5JAV A;  5D14 A;  3DEO A;  2JSO A;  4K6D A;  1IW7 D;  1HFG A;  4G7Z C;  4BA2 I;  4L6T B;  3S1M B;  2LS0 1;  2L1B A;  1RTO A;  1M8A A;  1PTO B;  1EZ6 A;  1SNM A;  1LAC A;  4CKE A;  1LT3 D;  2NZ1 D;  5JVG 3;  4IN3 A;  5LHY 1;  2A6H C;  1PTO F;  3PIP 3;  5ISR A;  1F2Z A;  3MZ5 A;  1AZQ A;  3BYY B;  3T51 B;  2G9H D;  4XQN A;  1WD0 A;  2PMZ B;  2QF7 A;  4EQP A;  2BDN A;  2IJ0 A;  3OW7 A;  4C3I G;  1GUG A;  2K5D A;  1EY5 A;  4KD4 A;  3VA7 A;  3C2P A;  2HCC A;  3CU7 A;  1I50 B;  4O42 A;  3HGB A;  2SNM A;  3NBH A;  1LT6 D;  1UUP A;  3H09 A;  4A3M B;  3NPP A;  1EEF D;  3KBG A;  2X69 A;  1TWF B;  2F0G A;  1S5F D;  2NYZ D;  3C46 A;  1BCP B;  3M7G A;  1OXT A;  3NP8 A;  5G3L D;  1B9N A;  3SVM A;  1EY0 A;  2SDF A;  2I46 A;  4K2L A;  4X3K A;  1TS2 A;  1J9O A;  2G9D A;  4Y7N B;  1VDZ A;  3HRZ C;  4NKL A;  2L5T A;  3BDC A;  3KLR A;  3OIP A;  3S1N B;  4IAL A;  2PCF B;  5DAU A;  3V96 A;  2JEB I;  4HED A;  1DOL A;  4K5V A;  1RKN A;  1B2T A;  3MEH A;  4N9T A;  2KED A;  5M3M B;  2MPM A;  1HPC A;  1NAP A;  2D9U A;  1BO0 A;  5C4X B;  3LWE A;  3J80 L;  1DOK A;  1F9Q A;  2A73 B;  2PQE A;  4KJO A;  3OWE B;  1JR0 D;  3DM1 A;  5I6Y A;  3P1H A;  1SDF A;  2M2L A;  1PZK D;  1DON A;  2QDB A;  1WTW A;  3K7A B;  3C3L A;  1PFB A;  1RTN A;  2J7Z A;  3EFX D;  4MHE A;  4Q0F A;  4P2C B;  2Z1C A;  3SDZ A;  1MSH A;  4EQO A;  5I2Y A;  3PUX A;  2KCC A;  1SE2 A;  4UDU C;  3NE5 B;  2K05 A;  4IFD I;  1AFP A;  4LK1 C;  1HHV A;  2E2I B;  4DK1 A;  3E6Z X;  3TP7 A;  4TKO B;  1QOH A;  5I6W A;  5KYL A;  3RD4 A;  2J0T D;  2QEJ C;  1V1O A;  4XYQ A;  3MC0 B;  3NTI A;  1I6V C;  1SNO A;  5KEE A;  3SHL A;  4IFD J;  1H9J A;  2ICI A;  3LNN A;  2ZT9 C;  1QCB D;  2RBM A;  3TN2 A;  1JE4 A;  1XTC D;  3QJY A;  1BXT A;  4F7X A;  5DEH A;  1X3Q A;  2Q8R E;  1A2U A;  1MD2 D;  3F2U A;  1LT4 D;  2WAQ B;  1EQT A;  1CFM A;  1TVX A;  1B4O A;  3T13 A;  4WOR A;  3NWS A;  4BS9 A;  5DM7 3;  1FYC A;  2NVX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...