2PW5A

Crystal structure of staphylococcal nuclease variant v66y/p117g/h124l/s128a at room temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
130
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKVEKYGPEASAFTKKMYENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystallographic study of hydration of an internal cavity in engineered proteins with buried polar or ionizable groups.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 130
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2pw5A00
4NKLA 4RKBA 1TQOA 2PZWA 3NP8A 4EVOA 1SYGA 3ITPA 4YIJA 5M9OA 1F2YA 2PZUA 3BDLA 3P75A 4TRDA 3TMEA 4KV6A 1SYFA 3OMGA 5CV7A 4ZUJA 2HQEA 5CGKA 1NUCA 3NUCA 3NXWA 3DMUA 2EY1A 5C5MA 4HMIA 2PQEA 2F0EA 2NUCA 3C1FA 1SNQA 4K6DA 3SK5A 3S9WA 5I6YA 4KY7A 2OEOA 1A3TA 4H7BA 3SHLA 1EY7A 4I65A 1EY5A 4KY5A 2F0TA 1EY9A 2F0NA 2PW7A 4J1MA 4DU9A 3ERQA 4LAAA 3LX0A 4EQOA 4PNYA 2O4XA 1U9RA 5C3XA 2M00A 5KIXA 5CV4A 2OF1A 1EYCA 1SNMA 5EKLA 5IGDA 2EYMA 2PW5A 2RBMA 5IIFA 3MEHA 1STBA 1AEXA 2PYKA 4QF4A 1EY4A 2F0HA 2F3VA 5DAUA 4ZQ3A 1STNA 1KABA 2SOBA 2SNMA 2QDBA 3OSOA 5C6AA 3TP7A 5DEHA 3DHQA 2EYHA 4RKLA 2EXZA 1TT2A 3TP8A 2EYJA 4IALA 5KEEA 4QMGA 5ISRA 3QOJA 1KDBA 2F0LA 3QB3A 1EY6A 1KAAA 5CV5A 5CV8A 3TP6A 1SNOA 3NK9A 2F0OA 1II3A 3RUZA 4ME5A 4KJNA 2F0QA 5EGTA 5E1FA 3T13A 5IODA 2ENBA 3EROA 4ODGA 5KYIA 1EYDA 3E5SA 5IGEA 5J22A 3D4DA 5I9PA 2RDFA 1SYBA 4ID6A 3SK8A 4B9XA 4PMBA 2F0JA 1KDCA 4N9PA 1SNPA 5CR3A 3U9OA 3VA5A 4DF7A 4E6IA 4F7XA 3T16A 2LKVA 2F0KA 4PMCA 3R3OA 2F3WA 5IGFA 4G57A 2KQ3A 3SXHA 3PMFA 4K5XA 3SK4A 5K5PA 3MXPA 1SYCA 2F0WA 3EJIA 2EYLA 3C1EA 4J6HA 5KGUA 4ZUIA 3MHBA 4K5VA 1JOOA 1TR5A 2F0MA 1SNDA 5CC4A 1JOKA 4B9WA 4N9TA 4NP5A 4HMJA 1EY8A 2EYFA 5JOBA 4NMZA 3HZXA 4F8MA 1SYDA 4K2LA 5KRUA 2EY6A 4KHVA 5E3FA 1A3UA 5I9OA 4K8JA 4KJOA 5C3WA 4K2KA 5C4HA 3HEJA 5IGBA 4K5WA 3OMCA 4IZ8A 4K14A 5IGCA 5KYLA 5J39A 4MIUA 5CV6A 3NQTA 5JAVA 1A3VA 1ENAA 1SYEA 4NDXA 5C4ZA 3P1HA 3BDCA 3OWFA 2F0DA 2SNSA 4QB4A 3D6CA 4EQNA 5CV9A 1NSNS 2KHSA 3SR1A 1A2TA 4KTAA 1EY0A 3QOLA 1EZ6A 5NUCA 5HGTA 2F0FA 4DFAA 3EVQA 5HURA 1STYA 1EQVA 1JOQA 4KY6A 5IOCA 1A2UA 1F2ZA 1F2MA 2EY5A 3TP5A 1IHZA 4KD3A 4K8IA 4R8NA 4DGZA 5IGGA 4OL7A 4HTHA 2F0SA 5C5LA 2EY2A 2F0GA 3MVVA 5F2DA 1STGA 4KD4A 2WACA 4S3SA 1STHA 5I6WA 2EYPA 2RKSA 3D4WA 3H6MA 2EYOA 3MZ5A 2OXPA 3NHHA 5J1ZA 1SNCA 1EZ8A 1EYAA 3V2TA 1KDAA 4EQPA 3D8GA 5EKKA 2F0PA 1JORA 1STAA 2F0IA 2F0VA 3SK6A 4WORA 2PZTA 2F0UA 4WRDA 1ENCA 4IUNA 1RKNA
chains in the Genus database with same CATH superfamily
1GKHA 5C0XI 2NVXH 2CCZA 1V1PA 3D4RA 1V1OA 2JA5B 4RFBA 4F87A 3H09A 2MO0A 1KLUD 5A35A 5CGKA 3BU2A 4XYOA 2UUCQ 1NTGA 1CUKA 2IHFA 2PNRC 1GHJA 4DV6Q 4A3FH 1I4XA 2ZJQA 4KY7A 4DV1L 1EWHA 2WAQB 5A2QL 1SMYD 5BR8Q 1VQ8A 4LW1A 2M00A 3H0GB 1N34Q 1UUPA 2V1CC 1BCPF 1CA6A 2B63G 4DR4Q 1STBA 1I50B 5EJWA 4HJ9A 2K33A 5DEHA 1ZYRD 2XIWA 1W3SA 3OWEB 2DY8A 3EQLC 1G6ZA 1ZXTA 3FDTA 4IOCA 3S15H 1VQPA 1L0XB 1NMFA 2RCNA 5LMUQ 2L9HA 5JVH3 5KYIA 5FO7B 1C48A 4X65Q 1BNZA 5I9PA 3PO2G 5FLXc 1TWHB 2NTTA 2JA8G 4DV0L 1HNXL 2Q2TA 1VQ9A 3MXPA 1H95A 2EYLA 3C1EA 2L4NA 1M8AA 4IO9A 3CQZH 1WFQA 4BBRG 4LF7Q 1G51A 4K8JA 4KJOA 4DUYQ 4OEMB 1VQBA 4A3DG 1IBMQ 1H9MA 1SYEA 4RG1A 4R9WA 5M5WB 2JEAI 1O80A 4GKKL 3G4SA 1U4LA 1OO9B 3SR1A 1HZBA 5C44H 5FLXE 1VQEA 1A6XA 3RN2A 1LTBD 3T56B 2F03A 3G7LA 1OXTA 4C2MH 2L5TA 2OQ0A 1KNAA 2EY2A 1RIPA 3E9IA 2OXPA 3NHHA 2B3GA 1PYWD 1QVCA 4BBSG 5M3FB 2IHEA 3OHXC 1EL0A 1Z6HA 2BH2A 1ET6A 2ZT9C 1BO0A 2NVQB 3AEVA 1O78A 1KNEA 2KOLA 4KV6A 2AUJD 2FJ2A 1V1PB 3OTOL 3PIPA 2NVYH 2F0EA 2PQEA 1YZ6A 2HDLA 2LFNA 3GTLH 2ZTCA 4RGMA 3G6JB 3RMHA 4FVMA 2MHVA 1R9TB 2OF1A 1DJRD 4IOAA 2ICEC 5JJIA 4CDEC 2JA6B 1XNQL 1NAPA 4LFCQ 1TXYA 1AW7A 4JW0A 1HNZL 1DOMA 4NXML 2XGTA 4DR5L 1LACA 5KEEA 5IP9G 1CKNA 5ISRA 4A3BG 3QB3A 3CCJA 3S1RB 4GOPA 1HUNA 3T13A 3S17H 3HOVG 3MFGA 4KMUC 3MXNB 3O13A 1IW7C 1EFWA 4PV1C 3TS2A 4F7XA 5JJKA 4IQZA 1BF4A 1VQ6A 5IYDH 2KQ3A 1WTWA 5GROA 1XXGA 3HOUG 4N9TA 4NP5A 1TVXA 5IT9E 1PH2A 2EDGA 3HOWH 2WAQE 2IPKD 3J81E 3UDIA 4NXNL 1MJEA 4AQYL 1JJGA 1WTPA 3F8TA 2VY3A 1GXDC 2HIXA 3CPWA 4KTAA 3S2HH 1BBUA 1MIUA 4GOPC 1ZEQX 1ENFA 1LTRD 3RR5A 1STYA 2VQFL 4DR2L 1NY4A 4R8NA 1K3RA 4JG2A 5M3MH 3ND8A 3S2DB 2KHJA 2D9UA 3D4WA 2H1EA 3H6MA 3Q6SA 1EOVA 4IFDH 5EKKA 1JORA 1JMCA 4JI3Q 4X64L 2X6GA 2VUMG 3LNNA 1OXXK 4DV5Q 1X65A 3DWPA 3TQYA 1YIJA 4IUTA 1F77A 4ME3A 2Q8IB 1HXYD 4QY7A 4L5TA 4K6DA 3RN5A 3SK5A 4DN4M 2WV6D 3TREA 4C3JB 2WB1G 2GVBA 1EY5A 3WOFA 1LV9A 2PW7A 4DU9A 3K7AH 1UEAB 2K32A 4JPBW 2KENA 5C4JH 1SEBD 4BS9A 3RZOH 1OXSC 2JEBI 2RBMA 3BS1A 1KQSA 3AFQA 3S14B 2I5MX 3CC7A 5LL6X 5IY0A 5AJ3Q 3PO3B 2KJXA 1LABA 1EEID 3HKZE 1WTRA 4RCNA 1SE2A 3CF5A 3TP8A 1W6JA 2WFWA 2UUCL 3R8BA 4DV6L 3DWAA 1JWSD 1H9SA 1CKNB 4BY1B 2EJGC 4QQBX 5BR8L 5IODA 3KLSX 2ENBA 1M1KC 4GOPB 3M7GA 2E2IH 1N34L 1HR0W 5IYCH 1ET9A 4DKAC 2F0KA 1EQRA 2MP1A 1BDOA 4DR4L 2B8GA 4OO1G 1KL9A 2R7ZH 2EJFC 2H4OA 1JOOA 2E2HH 5I2YA 5KRUA 1I6VC 4Y52H 1AH9A 1MSHA 5IGBA 1VQNA 4GKJQ 5CORA 3VR3A 4MIUA 2Z4HA 2R61A 5CV6A 4G4KA 5LMUL 4ALPA 3P1HA 3PO2B 3NBHA 4X65L 2SNSA 1VMCA 2JQOA 4QB4A 3I2ZA 5CV9A 2UUBQ 1EZ6A 1K28A 2R93G 1PRTF 5LHY1 4B3TQ 4XIGS 2L55A 1SE4A 4YCUA 1JOQA 1YEZA 2AQ1B 3CC4A 4DR6Q 5JEAG 3N6RA 2OTLA 1VQOA 4LF7L 4A3EG 3PIP3 4DUYL 3NWTA 2Q8TA 3HOXG 4KK7A 3KUPA 5BN4A 1V8QA 3EBEA 1IBML 1B3QA 3QO2A 4WORA 1Q1BA 1VCIA 1B7YB 3VYUA 2PZUA 4TRDA 3TMEA 1JB7A 2UXDQ 1CZGA 4AYBG 2JA5G 3CMAA 1L1OA 1IYJB 2K5QA 2DNEA 4CKCA 1B2TA 2NN6H 4B3SQ 3FPPA 2Z0SA 1AN8A 3FMCA 4BBSB 4GN3B 2Z9HA 3ERSX 1VQLA 4JK1C 1K9MC 3M3YH 3DUZA 1VF7A 3G48A 3I90A 3VYSA 5GQOA 2QDBA 4A3JB 2YTVA 3KF6B 1UNSA 2PMZB 4RGTA 2ZXOA 4BWGB 4ZYSA 3CCVA 5EBCA 3RD4A 2K6AA 1N33Q 1NCVA 1H9SB 2N55A 3E5SA 3GTOB 1LYLA 1VQGA 1L1OC 1KRSA 1VQDA 3ICEA 2GVAA 1HTPA 2B2YA 1SYCA 1VQKA 3S1NB 1K0SA 4GLXA 1TY0A 4R4CA 5E4WC 5EKIA 1HQMC 4LFCL 5JOBA 1B9MA 2G9HD 2Q2HA 5LMNW 3DXJC 2K1BA 2Q2IA 1NBWA 2LMCB 1Q46A 3I4NH 2DN8A 2ZTDA 4DK1A 2CWAA 1E2ZA 3HOVB 2H5XA 1ENAA 1BCPD 1H9JA 3A7LA 5C4ZA 3A74A 2WP8J 4LF5Q 1L0YB 4HEDA 5G3LD 2B2TA 2FFKB 2QA4A 3D6CA 4EQNA 3NBHB 1FGBD 1HZCA 1X9NA 1OXVA 1BBXC 1WTHA 3H0GH 1F2MA 4CGYB 1JT8A 4A3LH 2F0SA 5COYA 2X69A 1VQMA 1VDZA 2YTYA 2GN5A 1CQVA 2B2YC 1UEBA 3H94A 4GS3A 3WDNA 3PSIA 5M3FG 2A5HA 4I7ZC 4NKLA 5IP7G 1HR0Q 1PHJA 3RNUA 2XTIA 2K5NA 4DAMA 2KCCA 2CH4A 3SEBA 1TS2A 3X3NA 2RQXA 1UWVA 1YNNC 1IBLQ 4IFDI 1ICWA 4QL5A 3I7FA 3HOZH 1LTSD 1A0IA 1PLFA 4LJZC 1L1OB 4JI2Q 3TN2A 4A3CG 1G291 1EY9A 3K0XA 1V1QA 2C35B 4P73A 1GM5A 4JI3L 1I4HA 3WWVA 5ELOA 1CFMA 2F0HA 4DV5L 4JI5Q 1SE3A 1STNA 1D5XC 4CKBA 1PMRA 3KJPA 3ONAB 2L15A 4HIMA 2F0LA 2JP1A 1SNOA 2WB1B 4L5RC 1II3A 2RDGA 2RHSB 2F0QA 2F1MA 4X6AH 3UDXA 2QILA 2VW9A 5ELNA 1GHKA 4X62Q 2CW0D 4C3HB 5GAEC 2QEJC 1KDCA 1EUJA 4DF7A 1TWGB 5IGFA 4HSPA 3SXHA 5AJ3L 3IAYA 5KGUA 1KD1C 1CQFA 1KHIA 3GDEA 4A3KB 4H13C 1Y8PB 1HZ9A 3STBC 4KHVA 1S5BD 2ID0A 2I07B 2ZXPA 3CW2C 3FKIH 2IY5B 1K8MA 2F52A 4JI8Q 2B2VA 4F88A 1JR0D 1R4PB 1RDPD 3HOYH 3OYYA 1BKBA 1I4RA 2ASBA 3GTPH 1DONA 1SXTA 2DY7A 2KUMA 1WD1A 3T4AC 2XVSA 2XNAC 3SE0A 1BUVT 3T53B 4R8IA 3Q24A 2PMZE 1SFOB 4A3GH 3C46A 1ILPA 2D62A 4OXPA 4RGNA 4FO2A 3IFTA 3UI2A 3HFZB 4JBJA 2JA6H 1IYUA 2Z8LA 4GKJL 4G7ZC 1QVGA 4A93G 3W1GA 4Q0FA 1SE8A 2PNHA 3CCRA 1C7YA 3NP8A 1VQCA 2UUBL 1GJXA 3VR6A 2HHHQ 1SYFA 4GN5A 4X3KA 4B3TL 1KAWA 2B2VC 3GP7A 3W3AA 4PMWA 3SDZA 4HIDA 2QEXA 4DR6L 1S5FD 4P72A 1XTDA 5LMNQ 1HRJA 5M5YH 3I4MH 4LAAA 3MEFA 1IBKQ 1AZQA 2DNCA 1D5ZC 5KNDA 3GTGB 1AEXA 4I7AA 1EIFA 1Y1WB 3J80L 3PO3G 4AYBB 3CHBD 1Q82C 2UXDL 1TS3A 3M9BA 1PH4A 2EXZA 2Y0SG 4UAIA 3WOEA 3LGJA 4LUVA 1EEFD 5CBEE 1SN8A 2O2LD 3KFUA 1WJJA 2YU9B 2UXCQ 3CP0A 3JAME 4A3IB 5EGTA 2VL6A 4BY1G 4B3SL 4YCWA 5M5XB 1GUNA 3D4DA 4DAVA 1I3QB 5FO8B 1FVIA 4JI1Q 4IURA 5IYBG 1F9QA 3E9HA 3GD7A 2N49A 5T1IA 5G3LF 5FJ8H 3SGIA 4BA1I 3PUWA 1G91A 3CCMA 1TWCB 1C0AA 1HTLD 1JOKA 5JPNC 4HJ5A 3MA2B 1SYDA 3S1QH 4POGA 3HEJA 1D5MC 1N33L 3LWEA 4IZ8A 1I94Q 4K14A 2J4XA 5IGCA 5KYLA 3S16H 3MXNA 1CT1D 3EFXD 3CC2A 4MTNA 5D3DA 4B08A 2F0DA 5CYUA 3S1MH 4OELB 4C3JH 3V96A 4O42A 1QE6A 2JJQA 2MUYA 3A8KE 4MN3A 1I5FA 2F0FA 3K7UC 1K8OA 3I4OA 3Q0AA 5IOCA 1IW7D 1A2UA 5KNCA 4RCOA 3TP5A 4ZKCB 4C3IG 4QJFA 3VR5A 5C3EG 2WB1E 2Z4IA 5ELBA 5C5LA 1HA5A 1STGA 3MZ5A 1C9OA 1Q90A 1SNCA 1EYAA 5JPMC 3KOJA 2F0PA 1LT3D 2HCIA 4LUZA 2R7FA 4LF5L 3C3LA 3GTJB 3CRLC 2NBFA 5JJLA 3ITPA 5GAHC 2RVLA 3P75A 1DOKA 1BVSA 3P20A 4XT1B 4DV3Q 4GNXA 3GTMH 2Z6BA 2B63H 1RF2D 4WJWA 5ELFA 1CHPD 2NZ1D 2OEOA 3MFYA 1WTOA 4I65A 2F0TA 2RF4A 4PNYA 4KKUA 1PH9A 4KHPQ 1JICA 4U68A 1PRTD 4QF4A 1HR0L 1KABA 1NNXA 2EE1A 3D6WA 3PF4A 3PO2H 1J8IA 4A3JG 1QNKA 4CJ1B 2R92B 3MAQA 2JA8H 4Y7NB 4DNRB 2F0OA 4JI2L 4KJNA 2B29A 1WYDA 1HA6A 4IUQA 3GO5A 2Q8RE 1QZGA 4GNXC 4BBRH 4FDBA 4IUUA 4N9PA 1HPCA 3BZCA 3T16A 5FO9B 1STEA 1H9KA 5IWAQ 4A3DH 1SMYC 2RSOA 4QUCA 4JI5L 1WOCA 4RAUC 2VZAA 1SNDA 4HMJA 2E2JB 3HZXA 1U4PA 3BVMA 3TZDA 2HCCA 5I9OA 4IPHA 2HDMA 1A63A 5C4HA 4RA8A 1QB5D 5C0XJ 4ZRZA 1PH6A 5C4XB 1YVCA 4PZ8A 4GZYC 1KXLA 4LF4Q 2E5LQ 1A62A 1LM0A 4X62L 2C5CA 1LT5D 1DD2A 4A4IA 5JEAJ 2AQ2B 3VYRA 2JK8A 4AYBE 4BBSH 1WCMG 5JJZA 3P7JA 1B44D 2XSCA 1F2ZA 3B6YA 4MHEA 4OL7A 2WIIB 4TKOB 3HG9A 3PUXA 3OPOA 3J7A5 2F4IA 4JI8L 4A3MG 5DNFA 3CCEA 2VQEQ 2NWGA 1E1TA 1BBWA 1JWUD 1LT6D 3MTSA 3NSWA 5E4XA 3A0JA 2A68D 2O5JC 4KN7C 1PFBA 2K28A 2KBNA 1N32Q 4HSVA 3H3VI 1NUCA 3NXWA 4DPGA 3I55A 4K6LA 4GNXB 3S9WA 4BY7B 2CKZB 1FL0A 3SHLA 4KKSA 4QIWB 1SLJA 3S1NH 1TWFH 1T5EA 1JQYD 4M1UB 4EQOA 1YITA 4A93B 5IP9H 4A3BH 3E0JA 3GTKB 5IGDA 2PW5A 4A3FB 3MEHA 4ABNA 4LFBQ 1C8CA 3HOVH 2E2DC 2SOBA 2K7VA 1F2LA 3N52A 2HHHL 1X54A 4IALA 1EQQA 4LUOA 1X6OA 2PI2A 5LMNL 3HOUH 4XYQA 4AH6A 3S24A 4R4TA 2QKIC 1B9NA 5EBDA 2FHTA 4C3HG 4B9XA 4WFN3 1IBKL 1VQJA 2N8NA 1I6HB 1Q7YC 3A8IE 3KF8A 3KF6A 1FYCA 1V9PA 2F0WA 3S15B 3M85A 1K83B 1BOSA 4O1NA 4A3KG 1X3GA 5CC4A 3PUVA 2Y0SB 2ICIA 4J8QA 1EY8A 2EYFA 4K2LA 4OX9Q 1B70B 4R4IA 4CDFC 4K2KA 4UP9A 2UXCL 2A6EC 3CXCA 1IL8A 1CKOA 1M4VA 1A3VA 3NE5B 3NQIA 2JSOA 2K5DA 3CQZB 3K5NA 4B3MQ 1QG7A 2P5ZX 4HCEA 4JI1L 3NTKA 1W6KA 1P8LA 5EPJA 5NUCA 1Q8KA 4CJ2C 4JI7Q 1FNUA 2EQSA 4DNTB 2XWBB 4DGZA 2VUMH 1ZKOA 2NTSA 5F2DA 4XQNA 3U4ZA 2I46A 3J7ZC 1I94L 3AYHB 2ES2A 4EQPA 1PH5A 2F0IA 4C2MB 1ENCA 4OGQC 1JJ2A 4FYDA 1TQOA 4EVOA 5C0XG 1F2YA 5HGQA 2WKDA 5CV7A 3BVGA 5FLXL 4CHTB 3NUCA 4OIJA 4C3IB 1TWGH 5C3EB 1EIHA 2RA4A 4X3SA 1YJNA 1YNJC 2CQOA 3LWUA 2IX1A 2MO1A 2UU9Q 1VQ7A 2R7DA 2NVYB 4A76A 3IL8A 1EY4A 3TDQA 1FGUA 4ZKBB 2N3SA 1CI3M 3OSOA 1Y1WG 4DV3L 4MZ9A 3VDYA 2CHBD 3VR4A 4O2DA 4HJ7A 4OO1H 3A55A 1RHPA 4TQUS 3K5LA 1PFSA 2SDFA 2LY7A 4KI0A 4A3IG 5E1FA 4WJ3M 2IX3A 3F2DA 3BJUA 1EYDA 3J80c 4YY3Q 1HH2P 3CCQA 1RL2A 4P71A 4KHPL 3GV3A 1Y1VG 1S5DD 2AUKA 5FLMG 2A6HD 3S17B 2NVTB 2ZJPA 3KF8B 1NE3A 2FINB 1Q81C 2R93H 5JEAH 1G8ZD 1N36Q 4OONA 2JXMB 4A3EH 1E1OA 1M90C 3HOWB 3Q8DA 2V4DA 3J80E 3HOXH 1B53A 4R4OA 4ZAIA 5IWAL 3J81i 1PTOC 4DFAA 1HFGA 1EQVA 3I70A 5EQ0A 3CRKC 1IKMA 4KD3A 4H44C 4K8IA 4O0AA 3AB9A 1SAPA 2K04A 5IT9L 1CTMA 1SBBB 1IKLA 3AU7A 5A2QE 5K36G 4N8X1 3W2DA 2VB2X 3J81L 3S2HB 4UY8C 2IT1A 2ALYB 2EYOA 4HCSA 2JA5H 1LTAD 3M4YA 4K0KQ 3RLFA 5T1GA 4LF4L 2NB0A 2E5LL 2F0VA 1E0BA 2FMCA 2PZTA 2YU9H 1D2BA 4A3IH 5JVG3 2PZWA 3GQBA 1CSQA 1WCMB 2Y0SE 4Q5VA 1EOTA 4QUFA 1PYBA 3OIQA 2X6LA 3ER0A 4LFAQ 1SR3A 4H7BA 1L0WA 1XMOQ 4XTCS 1I50H 2PQAA 2HIVA 1ICFB 5AFWA 1YHAA 4A3MB 1VQIA 1RTNA 3T1YQ 4RHRA 2VQEL 4V0BA 4V190 1GVPA 5DAUA 4ZQ3A 3KLRA 1N8RC 3K7AB 3TP7A 1XPOA 3DHQA 1N32L 2EYHA 4BA2I 1D1IA 3CMEA 5C4JB 4ZK9B 4FXDA 1NJIC 3QOJA 1KDBA 1LTID 4KKTA 4RMFA 1Q8IA 2R92G 1TWHH 2K03A 2AWOA 1JC7A 4Z9CB 2L12A 1XTCD 3TZUA 5GAGC 3I3CA 1PTOB 2E74C 4JC0A 1U4RA 3F2CA 1G2TA 5CBAE 1O7IA 1XPUA 3GTQB 1ESRA 2N88A 1LT4D 5LL6S 4J15A 4J6HA 4LFBL 1VQ5A 1CSPA 1NMGA 4B9WA 5M5WH 1IYVA 4YWMA 3UDFA 2A1AA 2E2IB 3CCLA 2EY6A 2A8VA 1EU4A 1Q1EA 1AP0A 5C3WA 2AQ3B 3QR8A 1QUQB 1PTOF 5C4XG 3F2BA 2E2HB 3BDCA 2EJMA 4JYAQ 1S5ED 5H1SE 1NSNS 4TVAB 3BYYB 1D8LA 1XNQQ 3E6ZX 2UUAQ 2ZTEA 4HAEA 3EVQA 4FXKC 1HFNA 5M3FH 1J5EQ 2HD3A 2KHIA 2EY5A 2PPBC 4OWWB 4LF6Q 1VQ4A 4DR7Q 5IP7H 4HTHA 1VS0A 3MWYW 4OX9L 2NVQH 1CKMA 4BXXG 3NWSA 2ZM6Q 3K5OA 4OIKA 2PI2E 5E7NA 3DM1A 1ONLA 2BCOA 3HRZC 1GUWA 2K14A 3T51B 1VQAA 2LSSA 2PYKA 1K0RA 1RJTA 1OTCA 1PH7A 4B3ML 4A3CH 3L7ZC 1SYGA 4C1NI 5M9OA 3BDLA 2CH4W 2VS1A 3OMGA 4XQJA 3L2PA 4DUZQ 1IZ6A 2JA7G 1R9TH 4JI7L 4IJHA 1BCPC 1LO5D 1PZID 1K73C 2ATWA 2MPMA 2NYZD 3PF5A 1TKWB 4DNIA 4BY7G 1MGSA 4XDXA 4KY5A 3I8ZA 3ERQA 1WTQA 4JI6Q 2O4XA 3NPPA 4EQ5A 1A15A 1EYCA 1PDQA 1XPRA 1RTOA 2CFMA 5EKLA 1DGSA 2PQAB 1X3PA 3S1RH 1CK1A 1LTGD 4L63B 3A5ZB 4DR1Q 4A3FG 3BVZA 3DEOA 1UE7A 2SNMA 1K8AC 1TT2A 4YWKA 1E2WA 4APVA 5DM63 3CKIB 3OOCA 4L6TB 5CV5A 1XNRQ 5I2XA 4UPAA 1P16A 3CD6A 1XX8A 4C56C 2CVRA 1MD2D 5IGEA 2KCNA 2UU9L 3U9OA 2J0TD 5CR3A 3DLLA 2L1BA 4DV2Q 2JN4A 4K5XA 1JCKB 3Q23A 4G7OC 3MHBA 4K5VA 2EOTA 2NN6I 3U9SA 2ZJRA 4CBVA 2KECA 4YHHQ 1B3AA 3PCOB 1SDFA 2MJ8A 4RH6A 3D31A 4JBKA 5J39A 1JB3A 3U58A 2VB3X 2FXQA 1SRUA 1BCPB 1MKHA 4YY3L 4IFDJ 1FNVA 1X3EA 1Y1VB 4UDUC 3S2DH 3TSSA 3QOLA 3I4NB 4ZCKA 1ASYA 1EU3A 4A93H 4M8AA 2CW0C 4YWLA 2I5HA 3GTKH 3VYTA 4EGVA 1PFNA 4IJLA 4JBWA 2F0GA 2G9DA 1O7YA 1WTXA 5C44G 1NR4A 1HNWQ 1N9WA 3A8JE 4H02A 1N36L 3SK6A 1AE3A 3FP9A 4XT3B 1YI2A 3OW7A 2B2WC 2A69C 5DM73 4RKBA 4L5SA 3RLOA 1L2FA 4JI0Q 4ZUJA 2K75A 4JBMA 1AE2A 2IX0A 2E76C 1VQHA 3S14H 1I6HH 5I6YA 1HQRD 2VNUD 4DAYA 3KLSA 3PO3H 2BDOA 3CU7A 3ZYYX 1K83H 3W1BA 2RSNA 1U9RA 3J7AF 4P74A 2E75C 2KEDA 3L9AX 4K0KL 1FNWA 3E3XA 4IPCA 4HIKA 1RCVD 3HOZB 2BDNA 2O5IC 1T9HA 1WI5A 4BY1H 2YYZA 3M7NA 1E2VA 4YCVA 2BE5C 2QDLA 5HY6A 2PCFB 5IYBH 4NPSA 1EY6A 3KLWA 4L5QA 3PGZA 4LFAL 3RUZA 3H3VC 1XMOL 1Y8OB 4RHSA 3H15A 4JI4Q 1TWAB 4ODGA 4DXGA 4FF3A 1JJCB 1X3FA 2RDFA 2KA7A 3T1YL 3SK8A 4DAPA 3VA5A 4UP8A 4E6IA 1PYSB 3KBGA 5K5PA 2AMCB 3I72A 1PH8A 3K81C 3HKZB 4X3TA 2K05A 4CJ0B 3ND9A 3TBIB 4XQQA 1IBLL 1A3UA 1EIGA 4DR3Q 4FF4A 1QVFA 2D2CC 3MXGA 3OMCA 5IYDG 2AHOB 2DJFC 2I5LX 4C3IH 2AWNA 5C3EH 2R6GA 4PQXA 3HOWG 3FKIB 4U673 1BXTA 4MNOA 1DM0B 3OW2A 1WD0A 4HJAA 2UXBQ 1B1ZA 3KBXA 2MNAA 3C2PA 3HOYB 5EPKA 3GTPB 4LF8Q 3A7AB 3MVVA 5J3BA 2EYPA 5J1ZA 1JWMD 1EZ8A 2JA9A 1ZYRC 4R4QA 4KLKA 4A3GB 3T1HQ 2C9OA 3ULPA 2L0CA 3K8AA 2F0UA 4WRDA 5CMDA 1RKNA 4UP7A 2A6ED 3HGBA 4JYAL 1U0LA 5IT9c 4YIJA 3K58A 2KCMA 5M3MG 1GUSA 5KNBA 4QCLA 3F1ZA 2UUAL 3J81c 1J5EL 2EY1A 1R4QB 4JOIA 1UAPA 2NUCA 3C1FA 4R1JA 4LF6L 4DR7L 3NBIA 3KK7A 4IFDG 4B3RQ 2PO4A 3M4OB 3J7AV 2ZM6L 5L37A 2NVTH 4J1MA 4A3JH 2AKWB 4DAYB 2D0OA 3RZDB 1HZAA 1YJWA 5IIFA 4LWCA 1C4QA 3K80C 3V05A 3D3RA 5M5YB 3I4MB 3J81j 1AZPA 2JA7B 3GTOH 1LLRD 5EPLA 4DUZL 2EYJA 2A74C 2QGQA 3NTIA 4QMGA 1KAAA 1TU2B 2K52A 3NELA 4FP5D 2NVXB 2KCTA 4JI6L 5J22A 2KEEA 1SYBA 4ID6A 4PMBA 1S72A 5HURA 1CM9A 1SJHD 4JOIC 3DWQA 1YNJD 2LKVA 4X3UA 5ELCA 4DR1L 4IN3A 3JAMi 4JV5Q 5FKAC 2CWPA 2F0MA 3KYHC 4H0LC 1V43A 2I0QA 2BH8A 2K5VA 4P75A 4TSSA 3J7YW 5IYCG 4LF9Q 1PRTC 1S5CD 1WCMH 2K4KA 1XNRL 1MBYA 4ULLA 3JAML 5JAVA 2R7ZG 3IFDA 1D6EC 3OWFA 1TY2A 2DJGC 4JVZA 2IWHA 1PXUA 3HP3A 3KDFA 5IE8A 3S1QB 3A56A 4PZ6A 1GUOA 2KHSA 4DV2L 3S16B 4A3MH 2NZOA 3W5OA 3FPUB 3BYTB 3U4VA 4KY6A 1PH1A 3PQIA 4OWXB 1IHZA 1QILA 5BN5A 5IGGA 2OWOA 3U50C 1Q12A 4YHHL 1D1KA 2LXKA 1DOLA 1XWEA 3S1MB 1GOZA 3BZDB 1VMPA 2FMMA 4XXEA 2RKSA 5I4DA 4X66Q 2KVMA 1HCZA 2JYOA 1KDAA 3IRBA 3QWNA 2HUGA 5D14A 1PA6A 1YBYA 1FJGQ 1H9RA 1AFPA 1YHQA 4HIOA 1G6PA 2YV5A 3R2IA 1PTOH 1E3PA 3VA7A 3GTQH 1SJED 2RHQB 3TEHB 1YJ9A 1SNQA 1XMQQ 4FF1A 1XYIA 2MQHA 3EA6A 1TIID 1PTOD 4RGOS 4OHJA 3LX0A 1F9SA 1QNUA 5C3XA 2CQAA 5C44B 5KIXA 1HNWL 4DV7Q 3GTMB 5DLQE 2B63B 1BR9A 3R2TA 3I4LA 2F3VA 1CHQD 1WVLA 1PRTB 3CCSA 4LK1C 2NN6G 4C3HH 4JI0L 2K50A 2B8FA 2WKCA 4DV4Q 1KLGD 1RODA 1HUMA 1DCZA 1GO3E 2JE6I 3NK9A 2A73B 2A68C 3VR2A 2BA0A 1BQQT 4A3KH 3EROA 4QGUA 2F4VQ 2K01A 1K8GA 2NZHA 1KTKA 2LXJA 1SNPA 2JA8B 3L3OC 4NW2A 4PMCA 4G7HC 2F3WA 2QF7A 3GTLB 1QCBD 4DK0A 3EJIA 2MFIA 1TR5A 1PZJD 3TS0A 1W2BA 3EIVA 2B2UA 5FK9C 3K5MA 4GN4B 4NMZA 4BBRB 1PVOA 3BDOA 4IPGA 3X3MA 1IL2A 4MTKA 3FEWX 3K6OA 3K59A 4A3DB 3R93A 1B8AA 2R3ZA 3GV6A 2IJ0A 1QJOA 1IXRA 1SFOH 4JI4L 1YNND 4WJ4A 4NDXA 3FHWA 1Q3LA 1E7ZA 1EY0A 3UE1A 1S40A 2E8GA 3KDFB 1CA5A 3K57A 3I4NG 4P2CB 3UDGA 5TSSA 2SEBD 4DV1Q 1OXUA 3PUZA 5C0XH 3DM3A 3NEMA 4QIWE 3URYA 4DR3L 1QUQA 4KD4A 2WAQG 4S3SA 3Q22A 4AIMA 1VQFA 3H0GG 4DK3C 1VF5C 1CZWA 2EXDA 3MC0B 2B2UC 1K3BC 2IW3A 2D5DA 4A3LG 2OT2A 2MGSA 3E0EA 4IUPA 3BG3A 1FD7D 1MHWC 4KHZA 1Z47A 3JC66 2HQEA 1LTLA 1GUGA 2N78A 5C5MA 4NB3A 4HMIA 3PIOA 2UXBL 4N8FA 2EVBA 4JCVE 4LF8L 2HT1A 3AMUA 3GTGH 1A3TA 1ILQA 5BN3A 4DA2A 1Y1WH 3G6EA 3ULJA 5CV4A 1SNMA 1Z9FA 3STBD 4KN4C 1EWCA 3T1HL 2EYMA 4LMQD 4EX5A 4DV0Q 1HNXQ 3HOZG 2EIFA 5M3MB 4ILWA 1TWFB 2XRQD 1X55A 1DYQA 5M5XH 4RKLA 4A3BB 1I3QH 1PFMA 3I73A 1F9PA 4C1NK 1Y1VH 5CV8A 4B3RL 4FXGC 5FLMH 2GA4B 4ME5A 1UE5A 4HN7A 1PH3A 3NTHA 1B50A 1Z7TA 1TWCH 1U4MA 5EAYA 1A8VA 1S4ZA 4GKKQ 1B4OA 3MXUA 3FRPB 4DXFA 3PMFA 2LS01 2L11A 3HS0C 4ZUIA 3HOUB 2XN9C 3M4QA 3HKZG 4F8MA 4PG3A 2Z6KA 1QWYA 2K5WA 5E3FA 3RZOB 4IUVA 2Q2UA 1G2SA 2IL8A 4K5WA 2M2LA 1E24A 1MJCA 4DK6C 1D7QA 5FOBB 1E22A 1PV4A 2F3IA 3A54A 1X3QA 2OCEA 5K36H 4L8JA 4GLVB 1T5XD 5ELEA 2OQKA 1GD7A 4RWSC 4CDDC 3K0YA 2QW7A 5HGTA 1Y69U 3FKIG 3G71A 2D0PA 3UE0A 3OTOQ 3L0OA 4JV5L 3IKJA 1MI2A 1I4QA 3SVMA 4UHVA 3GTJH 2B2TC 3HOYG 1J6QA 1STHA 4LF9L 1Y8NB 1SROA 2R7ZB 2A6HC 1WTVA 1FR3A 1UE6A 1NR2A 2VUMB 3F2UA 4A3GG 1U5KA 2Z6KC 4IUNA 3I91A 2J7ZA 3BZKA 1TWAH 2QCPX 1HNZQ 1EIYB 2JA6G 4NXMQ 1KRTA 3DMUA 4DR5Q 2Z1CA 4ZLTF 2OTJA 2VXWA 4GLAC 1EY7A 1PZKD 1GUTA 3FVQA 3QJYA 1Q86C 1I4GA 2F0NA 4POFA 5ELDA 1TS4A 2K5HA 4X66L 1I4PA 3RLNA 3CAMA 2R92H 3ZJYC 1UE1A 4Y7NH 1FJGL 1LTTD 1ESFA 1ASZA 1J9OA 3TRZA 4A75A 5C6AA 3KJOA 1EWIA 4OWTB 3I4MG 1YNXA 3EN2A 1HJPA 2A69D 3I56A 1SMXA 1JE4A 4IPDA 1XMQL 1LUZA 1Y14B 1ML0D 3TP6A 4CKEA 1EYGA 3OIPA 1EQTA 4NXNQ 1TS5A 1DXMA 4AQYQ 2EPBA 1DZ1A 5GADC 2E2JH 2G5DA 3AFPA 1XJVA 4DV7L 2F0JA 2BA1A 3PUYA 2XWJB 2DUDA 3R3OA 3ULLA 4G57A 5C4XH 2WINB 3SK4A 1QOHA 2VQFQ 2RCFA 4DR2Q 5D65A 4PZ7A 3A5UA 3D0FA 4LNQA 1JE5A 1F9RA 1RD9D 4DV4L 4FNFA 1S3OA 4CDCC 3M3YB 1X56A 3QIAA 1KIXA 3H3VH 3PV0A 3CPFA 1YHBA 5FJ8G 3NQTA 2BE5D 2F4VL 2RDHA 3H91A 4X64Q 1O7LA 3HKSA 2XRSD 4BXXH 3M4OH 3QG1A 4FF2A 2R93B 1A2TA 3DEPA 4OO1I 5D3IB 2TMPA 3CCUA 1KC8C 2BOSA 2HQLA 3RZDH 3JAMc 1HHVA 2DGYA 4A3EB 2EZVA 2B2WA 4HJ8A 2B39A 1MSGA 1EFID 2M9VA 1QZHA 4C3JG 3NENA 3PIO3 2WACA 1O7ZA 2TSSA 3M4PA 2A19A 5I6WA 3HOXB 2YTXA 3J80i 2JA7H 1SSOA 3V2TA 3D8GA 1STAA 4HR7B 3AQQA 4BY7H 1X32A 2ZXRA
chains in the Genus database with same CATH topology
5C0XI 1V1PA 3D4RA 1V1OA 2JA5B 4RFBA 4F87A 3H09A 1KLUD 5A35A 5CGKA 4XYOA 2PNRC 1GHJA 1I4XA 4KY7A 1EWHA 2WAQB 5A2QL 1SMYD 2M00A 3H0GB 1UUPA 1BCPF 1CA6A 1STBA 1I50B 5EJWA 2K33A 5DEHA 1ZYRD 2XIWA 3OWEB 2DY8A 3EQLC 1G6ZA 1ZXTA 3FDTA 1L0XB 2L9HA 5JVH3 5KYIA 5FO7B 1C48A 1BNZA 5I9PA 1TWHB 2NTTA 3MXPA 2EYLA 3C1EA 2L4NA 1M8AA 4K8JA 4KJOA 1SYEA 1H9MA 4R9WA 5M5WB 2JEAI 1O80A 1U4LA 1OO9B 3SR1A 5FLXE 1A6XA 1LTBD 3T56B 2F03A 3G7LA 1OXTA 2L5TA 1KNAA 2EY2A 2OXPA 3NHHA 1PYWD 5M3FB 3OHXC 1EL0A 1Z6HA 1ET6A 2ZT9C 1BO0A 2NVQB 1O78A 1KNEA 2KOLA 4KV6A 2AUJD 2FJ2A 1V1PB 2PQEA 2F0EA 2HDLA 2LFNA 4RGMA 3G6JB 3RMHA 4FVMA 2MHVA 1R9TB 2OF1A 1DJRD 2ICEC 2JA6B 1NAPA 1AW7A 1DOMA 1LACA 5KEEA 5ISRA 3QB3A 3S1RB 1HUNA 3T13A 3MFGA 4KMUC 3O13A 1IW7C 4PV1C 4F7XA 4IQZA 1BF4A 2KQ3A 1WTWA 1XXGA 4N9TA 4NP5A 1TVXA 5IT9E 2EDGA 2IPKD 3J81E 1WTPA 1GXDC 4KTAA 1ZEQX 1ENFA 1LTRD 1STYA 4R8NA 3ND8A 3S2DB 3H6MA 2D9UA 3D4WA 2H1EA 3Q6SA 4IFDH 5EKKA 1JORA 2X6GA 3LNNA 1OXXK 3DWPA 4IUTA 1F77A 2Q8IB 1HXYD 4K6DA 3SK5A 4DN4M 2WV6D 4C3JB 1EY5A 3WOFA 1LV9A 2PW7A 4DU9A 1UEAB 2K32A 1SEBD 4BS9A 1OXSC 2JEBI 2RBMA 3BS1A 3S14B 5LL6X 3PO3B 2KJXA 1LABA 1EEID 1WTRA 4RCNA 1SE2A 3TP8A 1W6JA 3R8BA 3DWAA 1JWSD 1H9SA 4BY1B 2EJGC 5IODA 3KLSX 2ENBA 3M7GA 1ET9A 2F0KA 2MP1A 1BDOA 2B8GA 4OO1G 2EJFC 2H4OA 1JOOA 5I2YA 5KRUA 1I6VC 1MSHA 5IGBA 5CORA 3VR3A 4MIUA 2Z4HA 2R61A 5CV6A 4G4KA 3P1HA 3PO2B 3NBHA 2SNSA 1VMCA 4QB4A 5CV9A 1EZ6A 1PRTF 5LHY1 4XIGS 2L55A 1SE4A 1JOQA 2AQ1B 5JEAG 3N6RA 3PIP3 3NWTA 2Q8TA 4KK7A 3KUPA 5BN4A 1V8QA 3QO2A 4WORA 1Q1BA 1VCIA 3VYUA 2PZUA 4TRDA 3TMEA 1CZGA 2K5QA 2DNEA 4CKCA 1B2TA 2NN6H 3FPPA 1AN8A 3FMCA 4BBSB 4JK1C 3DUZA 1VF7A 3I90A 3VYSA 2QDBA 4A3JB 1UNSA 2PMZB 4RGTA 2ZXOA 4BWGB 4ZYSA 5EBCA 3RD4A 2K6AA 1NCVA 1H9SB 2N55A 3E5SA 3GTOB 1HTPA 2B2YA 1SYCA 3S1NB 1TY0A 5E4WC 5EKIA 1HQMC 5JOBA 1B9MA 2G9HD 3DXJC 2K1BA 2LMCB 2DN8A 4DK1A 1E2ZA 3HOVB 1ENAA 1BCPD 1H9JA 3A7LA 5C4ZA 2WP8J 1L0YB 4HEDA 5G3LD 2B2TA 2FFKB 3D6CA 4EQNA 1FGBD 1OXVA 1BBXC 1F2MA 4CGYB 2F0SA 5COYA 2X69A 1VDZA 1CQVA 2B2YC 3H94A 3WDNA 2A5HA 4I7ZC 4NKLA 2KCCA 3X3NA 3SEBA 1TS2A 2RQXA 1YNNC 4IFDI 1ICWA 1LTSD 1PLFA 4LJZC 3TN2A 1G291 1EY9A 1I4HA 1CFMA 2F0HA 1STNA 1SE3A 1D5XC 4CKBA 1PMRA 3ONAB 2F0LA 2JP1A 1SNOA 2WB1B 1II3A 2RDGA 2F0QA 2F1MA 2QILA 1GHKA 2CW0D 4C3HB 2QEJC 1KDCA 4DF7A 1TWGB 5IGFA 4HSPA 3SXHA 3IAYA 5KGUA 1CQFA 4A3KB 4H13C 1Y8PB 4KHVA 1S5BD 2ID0A 2I07B 2ZXPA 1K8MA 2B2VA 4F88A 1JR0D 1R4PB 1RDPD 1I4RA 1DONA 1SXTA 2DY7A 2KUMA 1WD1A 3T4AC 2XVSA 2XNAC 3SE0A 1BUVT 3T53B 4R8IA 3Q24A 1SFOB 3C46A 1ILPA 2D62A 4RGNA 3UI2A 3IFTA 4FO2A 1IYUA 2Z8LA 4G7ZC 4Q0FA 3NP8A 1GJXA 3VR6A 1SYFA 4X3KA 2B2VC 3GP7A 3W3AA 4PMWA 3SDZA 1S5FD 1HRJA 4LAAA 1AZQA 2DNCA 1D5ZC 5KNDA 3GTGB 1AEXA 1Y1WB 3J80L 4AYBB 3CHBD 1TS3A 2EXZA 4UAIA 3WOEA 5CBEE 1EEFD 2O2LD 2YU9B 4A3IB 3JAME 5EGTA 5M5XB 1GUNA 3D4DA 4DAVA 1I3QB 5FO8B 4IURA 1F9QA 3GD7A 5T1IA 5G3LF 4BA1I 3PUWA 1G91A 1TWCB 1HTLD 1JOKA 5JPNC 3MA2B 1SYDA 3HEJA 1D5MC 3LWEA 4IZ8A 4K14A 5IGCA 2J4XA 5KYLA 3MXNA 1CT1D 3EFXD 5D3DA 4B08A 2F0DA 5CYUA 3V96A 4O42A 1QE6A 2MUYA 3A8KE 4MN3A 2F0FA 1K8OA 3Q0AA 5IOCA 1IW7D 1A2UA 5KNCA 4RCOA 3TP5A 4ZKCB 4C3IG 3VR5A 2Z4IA 5ELBA 5C5LA 1HA5A 1STGA 3MZ5A 1Q90A 1SNCA 1EYAA 5JPMC 2F0PA 1LT3D 2HCIA 3C3LA 3GTJB 3CRLC 2NBFA 3ITPA 2RVLA 3P75A 1DOKA 3P20A 4XT1B 1RF2D 4WJWA 5ELFA 1CHPD 2NZ1D 2OEOA 3MFYA 1WTOA 4I65A 2F0TA 4PNYA 4KKUA 1JICA 4U68A 1PRTD 4QF4A 1KABA 3D6WA 2EE1A 1J8IA 1QNKA 4CJ1B 2R92B 3MAQA 4Y7NB 4DNRB 2F0OA 4KJNA 1HA6A 4IUQA 3GO5A 2Q8RE 4IUUA 4N9PA 1HPCA 3T16A 5FO9B 1STEA 1H9KA 1SMYC 2RSOA 4QUCA 4RAUC 1SNDA 4HMJA 2E2JB 3HZXA 1U4PA 3BVMA 3TZDA 2HCCA 5I9OA 2HDMA 5C4HA 4RA8A 1QB5D 5C0XJ 4ZRZA 5C4XB 4GZYC 2C5CA 1LT5D 1DD2A 5JEAJ 2AQ2B 3VYRA 5JJZA 3P7JA 1B44D 2XSCA 1F2ZA 4MHEA 4OL7A 2WIIB 4TKOB 3HG9A 3PUXA 3OPOA 2F4IA 5DNFA 2NWGA 1JWUD 1LT6D 3MTSA 3NSWA 5E4XA 2A68D 2O5JC 4KN7C 1PFBA 2K28A 4HSVA 1NUCA 3NXWA 4K6LA 3S9WA 4BY7B 3SHLA 4KKSA 4QIWB 1T5EA 1JQYD 4M1UB 4EQOA 4A93B 3E0JA 3GTKB 5IGDA 2PW5A 4A3FB 3MEHA 4ABNA 1C8CA 2E2DC 2SOBA 2K7VA 1F2LA 3N52A 4IALA 4XYQA 2QKIC 1B9NA 5EBDA 2FHTA 4C3HG 4B9XA 4WFN3 1I6HB 3A8IE 3KF8A 1FYCA 2F0WA 3S15B 3M85A 1K83B 1BOSA 4O1NA 5CC4A 3PUVA 2Y0SB 2ICIA 4J8QA 1EY8A 2EYFA 4K2LA 4K2KA 2A6EC 1IL8A 1M4VA 1A3VA 3NE5B 3NQIA 2JSOA 2K5DA 3CQZB 3K5NA 1QG7A 4HCEA 3NTKA 1W6KA 5EPJA 5NUCA 4CJ2C 1FNUA 4DNTB 2XWBB 4DGZA 1ZKOA 2NTSA 5F2DA 4XQNA 2I46A 4EQPA 2F0IA 4C2MB 1ENCA 4OGQC 4FYDA 1TQOA 4EVOA 5C0XG 1F2YA 2WKDA 5CV7A 3BVGA 5FLXL 4CHTB 3NUCA 4OIJA 4C3IB 5C3EB 1EIHA 2RA4A 4X3SA 1YNJC 3LWUA 2IX1A 2NVYB 3IL8A 1EY4A 3TDQA 4ZKBB 1CI3M 3OSOA 2CHBD 3VR4A 4OO1H 3A55A 1RHPA 4TQUS 3K5LA 2SDFA 2LY7A 4KI0A 5E1FA 2IX3A 1EYDA 3GV3A 1S5DD 2AUKA 2A6HD 3S17B 2NVTB 2FINB 5JEAH 1G8ZD 2JXMB 3HOWB 2V4DA 3J80E 1B53A 4ZAIA 1PTOC 4DFAA 1HFGA 1EQVA 3I70A 5EQ0A 3CRKC 1IKMA 4KD3A 4H44C 4K8IA 3AB9A 1SAPA 2K04A 5IT9L 1CTMA 1SBBB 1IKLA 3AU7A 5A2QE 5K36G 3W2DA 2VB2X 3J81L 3S2HB 2IT1A 2EYOA 4HCSA 1LTAD 3M4YA 3RLFA 5T1GA 2NB0A 2F0VA 1E0BA 2FMCA 2PZTA 1D2BA 5JVG3 2PZWA 3GQBA 1WCMB 4Q5VA 1EOTA 4QUFA 3OIQA 2X6LA 4H7BA 4XTCS 4A3MB 5AFWA 1RTNA 4RHRA 4V0BA 4V190 5DAUA 4ZQ3A 3KLRA 3K7AB 3TP7A 3DHQA 2EYHA 4BA2I 1D1IA 5C4JB 4ZK9B 4FXDA 3QOJA 1KDBA 1LTID 4KKTA 1Q8IA 2K03A 2AWOA 1JC7A 4Z9CB 2L12A 1XTCD 3TZUA 3I3CA 1PTOB 2E74C 1U4RA 1G2TA 5CBAE 3GTQB 1ESRA 2N88A 1LT4D 5LL6S 4J6HA 4B9WA 1IYVA 2E2IB 2EY6A 1EU4A 1Q1EA 1AP0A 5C3WA 2AQ3B 1PTOF 2E2HB 3BDCA 2EJMA 1S5ED 1NSNS 3BYYB 3E6ZX 4HAEA 3EVQA 4FXKC 1HFNA 2EY5A 2PPBC 4HTHA 3MWYW 3NWSA 3K5OA 4OIKA 3DM1A 1ONLA 2BCOA 3HRZC 1GUWA 3T51B 2PYKA 1RJTA 3L7ZC 1SYGA 4C1NI 5M9OA 3BDLA 3OMGA 4XQJA 1BCPC 1LO5D 1PZID 2MPMA 2NYZD 1TKWB 1MGSA 4XDXA 4KY5A 3I8ZA 3ERQA 1WTQA 2O4XA 3NPPA 1A15A 1EYCA 1PDQA 1RTOA 5EKLA 1X3PA 1CK1A 1LTGD 4L63B 3BVZA 3DEOA 2SNMA 1TT2A 1E2WA 5DM63 3CKIB 3OOCA 4L6TB 5CV5A 5I2XA 1XX8A 4C56C 2CVRA 1MD2D 5IGEA 2KCNA 3U9OA 2J0TD 5CR3A 2L1BA 4K5XA 1JCKB 3Q23A 4G7OC 3MHBA 4K5VA 2EOTA 2NN6I 3U9SA 4CBVA 2KECA 1B3AA 1SDFA 2MJ8A 4RH6A 3D31A 5J39A 1JB3A 2VB3X 1BCPB 4IFDJ 1FNVA 1Y1VB 4UDUC 3TSSA 3QOLA 3I4NB 1EU3A 4M8AA 2CW0C 3VYTA 4EGVA 1PFNA 4JBWA 2F0GA 2G9DA 1O7YA 1WTXA 1NR4A 3A8JE 3SK6A 4XT3B 3OW7A 2B2WC 2A69C 5DM73 4RKBA 4ZUJA 2IX0A 2E76C 5I6YA 1HQRD 2VNUD 4DAYA 3KLSA 2BDOA 3CU7A 3ZYYX 2RSNA 1U9RA 3J7AF 2E75C 2KEDA 3L9AX 1FNWA 1RCVD 3HOZB 2BDNA 2O5IC 2YYZA 3M7NA 1E2VA 2BE5C 2PCFB 1EY6A 3RUZA 3H3VC 1Y8OB 4RHSA 1TWAB 4ODGA 4DXGA 4FF3A 2RDFA 2KA7A 3SK8A 4DAPA 3VA5A 4E6IA 3KBGA 5K5PA 3I72A 3HKZB 4X3TA 2K05A 4CJ0B 3ND9A 3TBIB 4XQQA 1A3UA 1EIGA 4FF4A 2D2CC 3MXGA 3OMCA 2AWNA 2R6GA 4PQXA 3FKIB 4U673 1BXTA 1DM0B 1WD0A 1B1ZA 3KBXA 3C2PA 3HOYB 5EPKA 3GTPB 3A7AB 3MVVA 2EYPA 5J1ZA 1JWMD 1EZ8A 1ZYRC 4A3GB 2C9OA 2L0CA 2F0UA 4WRDA 5CMDA 1RKNA 2A6ED 3HGBA 4YIJA 3K58A 1GUSA 5KNBA 4QCLA 2EY1A 1R4QB 1UAPA 2NUCA 3C1FA 4IFDG 3NBIA 3KK7A 2PO4A 3M4OB 3J7AV 4J1MA 3RZDB 5IIFA 1C4QA 3V05A 3D3RA 5M5YB 3I4MB 1AZPA 2JA7B 1LLRD 5EPLA 2EYJA 2A74C 3NTIA 4QMGA 1KAAA 1TU2B 4FP5D 2NVXB 5J22A 2KEEA 1SYBA 4ID6A 4PMBA 5HURA 1CM9A 1SJHD 3DWQA 1YNJD 2LKVA 4X3UA 5ELCA 4IN3A 5FKAC 2F0MA 4H0LC 1V43A 4TSSA 3J7YW 1PRTC 1S5CD 1MBYA 4ULLA 3JAML 5JAVA 3IFDA 1D6EC 3OWFA 1TY2A 2IWHA 1PXUA 3HP3A 3S1QB 3A56A 1GUOA 2KHSA 3S16B 3FPUB 3BYTB 4KY6A 1IHZA 1QILA 5BN5A 5IGGA 1Q12A 1D1KA 1DOLA 1XWEA 3S1MB 1GOZA 3BZDB 1VMPA 2FMMA 4XXEA 2RKSA 5I4DA 2KVMA 1HCZA 2JYOA 1KDAA 3QWNA 2HUGA 5D14A 1H9RA 1AFPA 3R2IA 1PTOH 3VA7A 1SJED 1SNQA 4FF1A 1XYIA 3EA6A 1TIID 1PTOD 4RGOS 4OHJA 3LX0A 1F9SA 1QNUA 5C3XA 2CQAA 5C44B 5KIXA 3GTMB 2B63B 1BR9A 3R2TA 3I4LA 2F3VA 1CHQD 1WVLA 1PRTB 4LK1C 2NN6G 2B8FA 2WKCA 1KLGD 1RODA 1HUMA 1DCZA 2JE6I 3NK9A 2A73B 2A68C 3VR2A 2BA0A 1BQQT 3EROA 2K01A 1KTKA 1SNPA 2JA8B 3L3OC 4NW2A 4PMCA 4G7HC 2F3WA 2QF7A 3GTLB 1QCBD 4DK0A 3EJIA 1TR5A 1PZJD 2B2UA 5FK9C 3K5MA 4NMZA 4BBRB 3BDOA 3X3MA 3FEWX 3K6OA 3K59A 4A3DB 3R93A 2R3ZA 3GV6A 2IJ0A 1QJOA 1YNND 4NDXA 1Q3LA 1EY0A 1CA5A 3K57A 4P2CB 5TSSA 2SEBD 1OXUA 3PUZA 5C0XH 3URYA 4KD4A 4S3SA 3Q22A 1VF5C 1CZWA 3MC0B 2B2UC 2IW3A 2D5DA 2OT2A 2MGSA 4IUPA 3BG3A 1FD7D 4KHZA 1Z47A 2HQEA 1GUGA 5C5MA 4HMIA 2EVBA 3AMUA 1A3TA 1ILQA 5BN3A 4DA2A 5CV4A 1SNMA 4KN4C 1EWCA 2EYMA 4LMQD 5M3MB 4ILWA 1TWFB 2XRQD 1DYQA 4RKLA 4A3BB 1PFMA 3I73A 1F9PA 4C1NK 5CV8A 4FXGC 2GA4B 4ME5A 4HN7A 3NTHA 1B50A 1Z7TA 1U4MA 1S4ZA 1B4OA 3MXUA 3FRPB 4DXFA 3PMFA 2LS01 2L11A 3HS0C 4ZUIA 3HOUB 2XN9C 4F8MA 1QWYA 2K5WA 5E3FA 3RZOB 4IUVA 1G2SA 2IL8A 4K5WA 2M2LA 5FOBB 3A54A 1X3QA 5K36H 4L8JA 1T5XD 5ELEA 4RWSC 3K0YA 5HGTA 1Y69U 3IKJA 1MI2A 1I4QA 3SVMA 2B2TC 1STHA 1Y8NB 2R7ZB 2A6HC 1WTVA 1FR3A 1NR2A 2VUMB 3F2UA 4IUNA 3I91A 2J7ZA 2QCPX 3DMUA 2Z1CA 4ZLTF 2VXWA 1EY7A 1PZKD 1GUTA 3FVQA 3QJYA 1I4GA 2F0NA 5ELDA 1TS4A 1I4PA 1LTTD 1ESFA 1J9OA 5C6AA 2A69D 1JE4A 3TP6A 1ML0D 4CKEA 3OIPA 1EQTA 1TS5A 1DXMA 2EPBA 1DZ1A 2F0JA 2BA1A 3PUYA 2XWJB 3R3OA 4G57A 2WINB 3SK4A 1QOHA 5D65A 1F9RA 1RD9D 4FNFA 3M3YB 3QIAA 3PV0A 2BE5D 3NQTA 2RDHA 3H91A 1O7LA 2XRSD 3QG1A 4FF2A 2R93B 1A2TA 3DEPA 4OO1I 5D3IB 2TMPA 2BOSA 1HHVA 4A3EB 2EZVA 2B2WA 2B39A 1MSGA 1EFID 2M9VA 4C3JG 3PIO3 2WACA 1O7ZA 2TSSA 5I6WA 3HOXB 1SSOA 3V2TA 3D8GA 1STAA 4HR7B 1X32A 2ZXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKL A;  4RKB A;  1TQO A;  2PZW A;  3NP8 A;  4EVO A;  1SYG A;  3ITP A;  4YIJ A;  5M9O A;  1F2Y A;  2PZU A;  3BDL A;  3P75 A;  4TRD A;  3TME A;  4KV6 A;  1SYF A;  3OMG A;  5CV7 A;  4ZUJ A;  2HQE A;  5CGK A;  1NUC A;  3NUC A;  3NXW A;  3DMU A;  2EY1 A;  5C5M A;  4HMI A;  2PQE A;  2F0E A;  2NUC A;  3C1F A;  1SNQ A;  4K6D A;  3SK5 A;  3S9W A;  5I6Y A;  4KY7 A;  2OEO A;  1A3T A;  4H7B A;  3SHL A;  1EY7 A;  4I65 A;  1EY5 A;  4KY5 A;  2F0T A;  1EY9 A;  2F0N A;  2PW7 A;  4J1M A;  4DU9 A;  3ERQ A;  4LAA A;  3LX0 A;  4EQO A;  4PNY A;  2O4X A;  1U9R A;  5C3X A;  2M00 A;  5KIX A;  5CV4 A;  2OF1 A;  1EYC A;  1SNM A;  5EKL A;  5IGD A;  2EYM A;  2PW5 A;  2RBM A;  5IIF A;  3MEH A;  1STB A;  1AEX A;  2PYK A;  4QF4 A;  1EY4 A;  2F0H A;  2F3V A;  5DAU A;  4ZQ3 A;  1STN A;  1KAB A;  2SOB A;  2SNM A;  2QDB A;  3OSO A;  5C6A A;  3TP7 A;  5DEH A;  3DHQ A;  2EYH A;  4RKL A;  2EXZ A;  1TT2 A;  3TP8 A;  2EYJ A;  4IAL A;  5KEE A;  4QMG A;  5ISR A;  3QOJ A;  1KDB A;  2F0L A;  3QB3 A;  1EY6 A;  1KAA A;  5CV5 A;  5CV8 A;  3TP6 A;  1SNO A;  3NK9 A;  2F0O A;  1II3 A;  3RUZ A;  4ME5 A;  4KJN A;  2F0Q A;  5EGT A;  5E1F A;  3T13 A;  5IOD A;  2ENB A;  3ERO A;  4ODG A;  5KYI A;  1EYD A;  3E5S A;  5IGE A;  5J22 A;  3D4D A;  5I9P A;  2RDF A;  1SYB A;  4ID6 A;  3SK8 A;  4B9X A;  4PMB A;  2F0J A;  1KDC A;  4N9P A;  1SNP A;  5CR3 A;  3U9O A;  3VA5 A;  4DF7 A;  4E6I A;  4F7X A;  3T16 A;  2LKV A;  2F0K A;  4PMC A;  3R3O A;  2F3W A;  5IGF A;  4G57 A;  2KQ3 A;  3SXH A;  3PMF A;  4K5X A;  3SK4 A;  5K5P A;  3MXP A;  1SYC A;  2F0W A;  3EJI A;  2EYL A;  3C1E A;  4J6H A;  5KGU A;  4ZUI A;  3MHB A;  4K5V A;  1JOO A;  1TR5 A;  2F0M A;  1SND A;  5CC4 A;  1JOK A;  4B9W A;  4N9T A;  4NP5 A;  4HMJ A;  1EY8 A;  2EYF A;  5JOB A;  4NMZ A;  3HZX A;  4F8M A;  1SYD A;  4K2L A;  5KRU A;  2EY6 A;  4KHV A;  5E3F A;  1A3U A;  5I9O A;  4K8J A;  4KJO A;  5C3W A;  4K2K A;  5C4H A;  3HEJ A;  5IGB A;  4K5W A;  3OMC A;  4IZ8 A;  4K14 A;  5IGC A;  5KYL A;  5J39 A;  4MIU A;  5CV6 A;  3NQT A;  5JAV A;  1A3V A;  1ENA A;  1SYE A;  4NDX A;  5C4Z A;  3P1H A;  3BDC A;  3OWF A;  2F0D A;  2SNS A;  4QB4 A;  3D6C A;  4EQN A;  5CV9 A;  1NSN S;  2KHS A;  3SR1 A;  1A2T A;  4KTA A;  1EY0 A;  3QOL A;  1EZ6 A;  5NUC A;  5HGT A;  2F0F A;  4DFA A;  3EVQ A;  5HUR A;  1STY A;  1EQV A;  1JOQ A;  4KY6 A;  5IOC A;  1A2U A;  1F2Z A;  1F2M A;  2EY5 A;  3TP5 A;  1IHZ A;  4KD3 A;  4K8I A;  4R8N A;  4DGZ A;  5IGG A;  4OL7 A;  4HTH A;  2F0S A;  5C5L A;  2EY2 A;  2F0G A;  3MVV A;  5F2D A;  1STG A;  4KD4 A;  2WAC A;  4S3S A;  1STH A;  5I6W A;  2EYP A;  2RKS A;  3D4W A;  3H6M A;  2EYO A;  3MZ5 A;  2OXP A;  3NHH A;  5J1Z A;  1SNC A;  1EZ8 A;  1EYA A;  3V2T A;  1KDA A;  4EQP A;  3D8G A;  5EKK A;  2F0P A;  1JOR A;  1STA A;  2F0I A;  2F0V A;  3SK6 A;  4WOR A;  2PZT A;  2F0U A;  4WRD A;  1ENC A;  4IUN A;  1RKN A; 
#chains in the Genus database with same CATH topology
 1GKH A;  5C0X I;  2NVX H;  2CCZ A;  1V1P A;  3D4R A;  1V1O A;  2JA5 B;  4RFB A;  4F87 A;  3H09 A;  2MO0 A;  1KLU D;  5A35 A;  5CGK A;  3BU2 A;  4XYO A;  2UUC Q;  1NTG A;  1CUK A;  2IHF A;  2PNR C;  1GHJ A;  4DV6 Q;  4A3F H;  1I4X A;  2ZJQ A;  4KY7 A;  4DV1 L;  1EWH A;  2WAQ B;  5A2Q L;  1SMY D;  5BR8 Q;  1VQ8 A;  4LW1 A;  2M00 A;  3H0G B;  1N34 Q;  1UUP A;  2V1C C;  1BCP F;  1CA6 A;  2B63 G;  4DR4 Q;  1STB A;  1I50 B;  5EJW A;  4HJ9 A;  2K33 A;  5DEH A;  1ZYR D;  2XIW A;  1W3S A;  3OWE B;  2DY8 A;  3EQL C;  1G6Z A;  1ZXT A;  3FDT A;  4IOC A;  3S15 H;  1VQP A;  1L0X B;  1NMF A;  2RCN A;  5LMU Q;  2L9H A;  5JVH 3;  5KYI A;  5FO7 B;  1C48 A;  4X65 Q;  1BNZ A;  5I9P A;  3PO2 G;  5FLX c;  1TWH B;  2NTT A;  2JA8 G;  4DV0 L;  1HNX L;  2Q2T A;  1VQ9 A;  3MXP A;  1H95 A;  2EYL A;  3C1E A;  2L4N A;  1M8A A;  4IO9 A;  3CQZ H;  1WFQ A;  4BBR G;  4LF7 Q;  1G51 A;  4K8J A;  4KJO A;  4DUY Q;  4OEM B;  1VQB A;  4A3D G;  1IBM Q;  1H9M A;  1SYE A;  4RG1 A;  4R9W A;  5M5W B;  2JEA I;  1O80 A;  4GKK L;  3G4S A;  1U4L A;  1OO9 B;  3SR1 A;  1HZB A;  5C44 H;  5FLX E;  1VQE A;  1A6X A;  3RN2 A;  1LTB D;  3T56 B;  2F03 A;  3G7L A;  1OXT A;  4C2M H;  2L5T A;  2OQ0 A;  1KNA A;  2EY2 A;  1RIP A;  3E9I A;  2OXP A;  3NHH A;  2B3G A;  1PYW D;  1QVC A;  4BBS G;  5M3F B;  2IHE A;  3OHX C;  1EL0 A;  1Z6H A;  2BH2 A;  1ET6 A;  2ZT9 C;  1BO0 A;  2NVQ B;  3AEV A;  1O78 A;  1KNE A;  2KOL A;  4KV6 A;  2AUJ D;  2FJ2 A;  1V1P B;  3OTO L;  3PIP A;  2NVY H;  2F0E A;  2PQE A;  1YZ6 A;  2HDL A;  2LFN A;  3GTL H;  2ZTC A;  4RGM A;  3G6J B;  3RMH A;  4FVM A;  2MHV A;  1R9T B;  2OF1 A;  1DJR D;  4IOA A;  2ICE C;  5JJI A;  4CDE C;  2JA6 B;  1XNQ L;  1NAP A;  4LFC Q;  1TXY A;  1AW7 A;  4JW0 A;  1HNZ L;  1DOM A;  4NXM L;  2XGT A;  4DR5 L;  1LAC A;  5KEE A;  5IP9 G;  1CKN A;  5ISR A;  4A3B G;  3QB3 A;  3CCJ A;  3S1R B;  4GOP A;  1HUN A;  3T13 A;  3S17 H;  3HOV G;  3MFG A;  4KMU C;  3MXN B;  3O13 A;  1IW7 C;  1EFW A;  4PV1 C;  3TS2 A;  4F7X A;  5JJK A;  4IQZ A;  1BF4 A;  1VQ6 A;  5IYD H;  2KQ3 A;  1WTW A;  5GRO A;  1XXG A;  3HOU G;  4N9T A;  4NP5 A;  1TVX A;  5IT9 E;  1PH2 A;  2EDG A;  3HOW H;  2WAQ E;  2IPK D;  3J81 E;  3UDI A;  4NXN L;  1MJE A;  4AQY L;  1JJG A;  1WTP A;  3F8T A;  2VY3 A;  1GXD C;  2HIX A;  3CPW A;  4KTA A;  3S2H H;  1BBU A;  1MIU A;  4GOP C;  1ZEQ X;  1ENF A;  1LTR D;  3RR5 A;  1STY A;  2VQF L;  4DR2 L;  1NY4 A;  4R8N A;  1K3R A;  4JG2 A;  5M3M H;  3ND8 A;  3S2D B;  2KHJ A;  2D9U A;  3D4W A;  2H1E A;  3H6M A;  3Q6S A;  1EOV A;  4IFD H;  5EKK A;  1JOR A;  1JMC A;  4JI3 Q;  4X64 L;  2X6G A;  2VUM G;  3LNN A;  1OXX K;  4DV5 Q;  1X65 A;  3DWP A;  3TQY A;  1YIJ A;  4IUT A;  1F77 A;  4ME3 A;  2Q8I B;  1HXY D;  4QY7 A;  4L5T A;  4K6D A;  3RN5 A;  3SK5 A;  4DN4 M;  2WV6 D;  3TRE A;  4C3J B;  2WB1 G;  2GVB A;  1EY5 A;  3WOF A;  1LV9 A;  2PW7 A;  4DU9 A;  3K7A H;  1UEA B;  2K32 A;  4JPB W;  2KEN A;  5C4J H;  1SEB D;  4BS9 A;  3RZO H;  1OXS C;  2JEB I;  2RBM A;  3BS1 A;  1KQS A;  3AFQ A;  3S14 B;  2I5M X;  3CC7 A;  5LL6 X;  5IY0 A;  5AJ3 Q;  3PO3 B;  2KJX A;  1LAB A;  1EEI D;  3HKZ E;  1WTR A;  4RCN A;  1SE2 A;  3CF5 A;  3TP8 A;  1W6J A;  2WFW A;  2UUC L;  3R8B A;  4DV6 L;  3DWA A;  1JWS D;  1H9S A;  1CKN B;  4BY1 B;  2EJG C;  4QQB X;  5BR8 L;  5IOD A;  3KLS X;  2ENB A;  1M1K C;  4GOP B;  3M7G A;  2E2I H;  1N34 L;  1HR0 W;  5IYC H;  1ET9 A;  4DKA C;  2F0K A;  1EQR A;  2MP1 A;  1BDO A;  4DR4 L;  2B8G A;  4OO1 G;  1KL9 A;  2R7Z H;  2EJF C;  2H4O A;  1JOO A;  2E2H H;  5I2Y A;  5KRU A;  1I6V C;  4Y52 H;  1AH9 A;  1MSH A;  5IGB A;  1VQN A;  4GKJ Q;  5COR A;  3VR3 A;  4MIU A;  2Z4H A;  2R61 A;  5CV6 A;  4G4K A;  5LMU L;  4ALP A;  3P1H A;  3PO2 B;  3NBH A;  4X65 L;  2SNS A;  1VMC A;  2JQO A;  4QB4 A;  3I2Z A;  5CV9 A;  2UUB Q;  1EZ6 A;  1K28 A;  2R93 G;  1PRT F;  5LHY 1;  4B3T Q;  4XIG S;  2L55 A;  1SE4 A;  4YCU A;  1JOQ A;  1YEZ A;  2AQ1 B;  3CC4 A;  4DR6 Q;  5JEA G;  3N6R A;  2OTL A;  1VQO A;  4LF7 L;  4A3E G;  3PIP 3;  4DUY L;  3NWT A;  2Q8T A;  3HOX G;  4KK7 A;  3KUP A;  5BN4 A;  1V8Q A;  3EBE A;  1IBM L;  1B3Q A;  3QO2 A;  4WOR A;  1Q1B A;  1VCI A;  1B7Y B;  3VYU A;  2PZU A;  4TRD A;  3TME A;  1JB7 A;  2UXD Q;  1CZG A;  4AYB G;  2JA5 G;  3CMA A;  1L1O A;  1IYJ B;  2K5Q A;  2DNE A;  4CKC A;  1B2T A;  2NN6 H;  4B3S Q;  3FPP A;  2Z0S A;  1AN8 A;  3FMC A;  4BBS B;  4GN3 B;  2Z9H A;  3ERS X;  1VQL A;  4JK1 C;  1K9M C;  3M3Y H;  3DUZ A;  1VF7 A;  3G48 A;  3I90 A;  3VYS A;  5GQO A;  2QDB A;  4A3J B;  2YTV A;  3KF6 B;  1UNS A;  2PMZ B;  4RGT A;  2ZXO A;  4BWG B;  4ZYS A;  3CCV A;  5EBC A;  3RD4 A;  2K6A A;  1N33 Q;  1NCV A;  1H9S B;  2N55 A;  3E5S A;  3GTO B;  1LYL A;  1VQG A;  1L1O C;  1KRS A;  1VQD A;  3ICE A;  2GVA A;  1HTP A;  2B2Y A;  1SYC A;  1VQK A;  3S1N B;  1K0S A;  4GLX A;  1TY0 A;  4R4C A;  5E4W C;  5EKI A;  1HQM C;  4LFC L;  5JOB A;  1B9M A;  2G9H D;  2Q2H A;  5LMN W;  3DXJ C;  2K1B A;  2Q2I A;  1NBW A;  2LMC B;  1Q46 A;  3I4N H;  2DN8 A;  2ZTD A;  4DK1 A;  2CWA A;  1E2Z A;  3HOV B;  2H5X A;  1ENA A;  1BCP D;  1H9J A;  3A7L A;  5C4Z A;  3A74 A;  2WP8 J;  4LF5 Q;  1L0Y B;  4HED A;  5G3L D;  2B2T A;  2FFK B;  2QA4 A;  3D6C A;  4EQN A;  3NBH B;  1FGB D;  1HZC A;  1X9N A;  1OXV A;  1BBX C;  1WTH A;  3H0G H;  1F2M A;  4CGY B;  1JT8 A;  4A3L H;  2F0S A;  5COY A;  2X69 A;  1VQM A;  1VDZ A;  2YTY A;  2GN5 A;  1CQV A;  2B2Y C;  1UEB A;  3H94 A;  4GS3 A;  3WDN A;  3PSI A;  5M3F G;  2A5H A;  4I7Z C;  4NKL A;  5IP7 G;  1HR0 Q;  1PHJ A;  3RNU A;  2XTI A;  2K5N A;  4DAM A;  2KCC A;  2CH4 A;  3SEB A;  1TS2 A;  3X3N A;  2RQX A;  1UWV A;  1YNN C;  1IBL Q;  4IFD I;  1ICW A;  4QL5 A;  3I7F A;  3HOZ H;  1LTS D;  1A0I A;  1PLF A;  4LJZ C;  1L1O B;  4JI2 Q;  3TN2 A;  4A3C G;  1G29 1;  1EY9 A;  3K0X A;  1V1Q A;  2C35 B;  4P73 A;  1GM5 A;  4JI3 L;  1I4H A;  3WWV A;  5ELO A;  1CFM A;  2F0H A;  4DV5 L;  4JI5 Q;  1SE3 A;  1STN A;  1D5X C;  4CKB A;  1PMR A;  3KJP A;  3ONA B;  2L15 A;  4HIM A;  2F0L A;  2JP1 A;  1SNO A;  2WB1 B;  4L5R C;  1II3 A;  2RDG A;  2RHS B;  2F0Q A;  2F1M A;  4X6A H;  3UDX A;  2QIL A;  2VW9 A;  5ELN A;  1GHK A;  4X62 Q;  2CW0 D;  4C3H B;  5GAE C;  2QEJ C;  1KDC A;  1EUJ A;  4DF7 A;  1TWG B;  5IGF A;  4HSP A;  3SXH A;  5AJ3 L;  3IAY A;  5KGU A;  1KD1 C;  1CQF A;  1KHI A;  3GDE A;  4A3K B;  4H13 C;  1Y8P B;  1HZ9 A;  3STB C;  4KHV A;  1S5B D;  2ID0 A;  2I07 B;  2ZXP A;  3CW2 C;  3FKI H;  2IY5 B;  1K8M A;  2F52 A;  4JI8 Q;  2B2V A;  4F88 A;  1JR0 D;  1R4P B;  1RDP D;  3HOY H;  3OYY A;  1BKB A;  1I4R A;  2ASB A;  3GTP H;  1DON A;  1SXT A;  2DY7 A;  2KUM A;  1WD1 A;  3T4A C;  2XVS A;  2XNA C;  3SE0 A;  1BUV T;  3T53 B;  4R8I A;  3Q24 A;  2PMZ E;  1SFO B;  4A3G H;  3C46 A;  1ILP A;  2D62 A;  4OXP A;  4RGN A;  4FO2 A;  3IFT A;  3UI2 A;  3HFZ B;  4JBJ A;  2JA6 H;  1IYU A;  2Z8L A;  4GKJ L;  4G7Z C;  1QVG A;  4A93 G;  3W1G A;  4Q0F A;  1SE8 A;  2PNH A;  3CCR A;  1C7Y A;  3NP8 A;  1VQC A;  2UUB L;  1GJX A;  3VR6 A;  2HHH Q;  1SYF A;  4GN5 A;  4X3K A;  4B3T L;  1KAW A;  2B2V C;  3GP7 A;  3W3A A;  4PMW A;  3SDZ A;  4HID A;  2QEX A;  4DR6 L;  1S5F D;  4P72 A;  1XTD A;  5LMN Q;  1HRJ A;  5M5Y H;  3I4M H;  4LAA A;  3MEF A;  1IBK Q;  1AZQ A;  2DNC A;  1D5Z C;  5KND A;  3GTG B;  1AEX A;  4I7A A;  1EIF A;  1Y1W B;  3J80 L;  3PO3 G;  4AYB B;  3CHB D;  1Q82 C;  2UXD L;  1TS3 A;  3M9B A;  1PH4 A;  2EXZ A;  2Y0S G;  4UAI A;  3WOE A;  3LGJ A;  4LUV A;  1EEF D;  5CBE E;  1SN8 A;  2O2L D;  3KFU A;  1WJJ A;  2YU9 B;  2UXC Q;  3CP0 A;  3JAM E;  4A3I B;  5EGT A;  2VL6 A;  4BY1 G;  4B3S L;  4YCW A;  5M5X B;  1GUN A;  3D4D A;  4DAV A;  1I3Q B;  5FO8 B;  1FVI A;  4JI1 Q;  4IUR A;  5IYB G;  1F9Q A;  3E9H A;  3GD7 A;  2N49 A;  5T1I A;  5G3L F;  5FJ8 H;  3SGI A;  4BA1 I;  3PUW A;  1G91 A;  3CCM A;  1TWC B;  1C0A A;  1HTL D;  1JOK A;  5JPN C;  4HJ5 A;  3MA2 B;  1SYD A;  3S1Q H;  4POG A;  3HEJ A;  1D5M C;  1N33 L;  3LWE A;  4IZ8 A;  1I94 Q;  4K14 A;  2J4X A;  5IGC A;  5KYL A;  3S16 H;  3MXN A;  1CT1 D;  3EFX D;  3CC2 A;  4MTN A;  5D3D A;  4B08 A;  2F0D A;  5CYU A;  3S1M H;  4OEL B;  4C3J H;  3V96 A;  4O42 A;  1QE6 A;  2JJQ A;  2MUY A;  3A8K E;  4MN3 A;  1I5F A;  2F0F A;  3K7U C;  1K8O A;  3I4O A;  3Q0A A;  5IOC A;  1IW7 D;  1A2U A;  5KNC A;  4RCO A;  3TP5 A;  4ZKC B;  4C3I G;  4QJF A;  3VR5 A;  5C3E G;  2WB1 E;  2Z4I A;  5ELB A;  5C5L A;  1HA5 A;  1STG A;  3MZ5 A;  1C9O A;  1Q90 A;  1SNC A;  1EYA A;  5JPM C;  3KOJ A;  2F0P A;  1LT3 D;  2HCI A;  4LUZ A;  2R7F A;  4LF5 L;  3C3L A;  3GTJ B;  3CRL C;  2NBF A;  5JJL A;  3ITP A;  5GAH C;  2RVL A;  3P75 A;  1DOK A;  1BVS A;  3P20 A;  4XT1 B;  4DV3 Q;  4GNX A;  3GTM H;  2Z6B A;  2B63 H;  1RF2 D;  4WJW A;  5ELF A;  1CHP D;  2NZ1 D;  2OEO A;  3MFY A;  1WTO A;  4I65 A;  2F0T A;  2RF4 A;  4PNY A;  4KKU A;  1PH9 A;  4KHP Q;  1JIC A;  4U68 A;  1PRT D;  4QF4 A;  1HR0 L;  1KAB A;  1NNX A;  2EE1 A;  3D6W A;  3PF4 A;  3PO2 H;  1J8I A;  4A3J G;  1QNK A;  4CJ1 B;  2R92 B;  3MAQ A;  2JA8 H;  4Y7N B;  4DNR B;  2F0O A;  4JI2 L;  4KJN A;  2B29 A;  1WYD A;  1HA6 A;  4IUQ A;  3GO5 A;  2Q8R E;  1QZG A;  4GNX C;  4BBR H;  4FDB A;  4IUU A;  4N9P A;  1HPC A;  3BZC A;  3T16 A;  5FO9 B;  1STE A;  1H9K A;  5IWA Q;  4A3D H;  1SMY C;  2RSO A;  4QUC A;  4JI5 L;  1WOC A;  4RAU C;  2VZA A;  1SND A;  4HMJ A;  2E2J B;  3HZX A;  1U4P A;  3BVM A;  3TZD A;  2HCC A;  5I9O A;  4IPH A;  2HDM A;  1A63 A;  5C4H A;  4RA8 A;  1QB5 D;  5C0X J;  4ZRZ A;  1PH6 A;  5C4X B;  1YVC A;  4PZ8 A;  4GZY C;  1KXL A;  4LF4 Q;  2E5L Q;  1A62 A;  1LM0 A;  4X62 L;  2C5C A;  1LT5 D;  1DD2 A;  4A4I A;  5JEA J;  2AQ2 B;  3VYR A;  2JK8 A;  4AYB E;  4BBS H;  1WCM G;  5JJZ A;  3P7J A;  1B44 D;  2XSC A;  1F2Z A;  3B6Y A;  4MHE A;  4OL7 A;  2WII B;  4TKO B;  3HG9 A;  3PUX A;  3OPO A;  3J7A 5;  2F4I A;  4JI8 L;  4A3M G;  5DNF A;  3CCE A;  2VQE Q;  2NWG A;  1E1T A;  1BBW A;  1JWU D;  1LT6 D;  3MTS A;  3NSW A;  5E4X A;  3A0J A;  2A68 D;  2O5J C;  4KN7 C;  1PFB A;  2K28 A;  2KBN A;  1N32 Q;  4HSV A;  3H3V I;  1NUC A;  3NXW A;  4DPG A;  3I55 A;  4K6L A;  4GNX B;  3S9W A;  4BY7 B;  2CKZ B;  1FL0 A;  3SHL A;  4KKS A;  4QIW B;  1SLJ A;  3S1N H;  1TWF H;  1T5E A;  1JQY D;  4M1U B;  4EQO A;  1YIT A;  4A93 B;  5IP9 H;  4A3B H;  3E0J A;  3GTK B;  5IGD A;  2PW5 A;  4A3F B;  3MEH A;  4ABN A;  4LFB Q;  1C8C A;  3HOV H;  2E2D C;  2SOB A;  2K7V A;  1F2L A;  3N52 A;  2HHH L;  1X54 A;  4IAL A;  1EQQ A;  4LUO A;  1X6O A;  2PI2 A;  5LMN L;  3HOU H;  4XYQ A;  4AH6 A;  3S24 A;  4R4T A;  2QKI C;  1B9N A;  5EBD A;  2FHT A;  4C3H G;  4B9X A;  4WFN 3;  1IBK L;  1VQJ A;  2N8N A;  1I6H B;  1Q7Y C;  3A8I E;  3KF8 A;  3KF6 A;  1FYC A;  1V9P A;  2F0W A;  3S15 B;  3M85 A;  1K83 B;  1BOS A;  4O1N A;  4A3K G;  1X3G A;  5CC4 A;  3PUV A;  2Y0S B;  2ICI A;  4J8Q A;  1EY8 A;  2EYF A;  4K2L A;  4OX9 Q;  1B70 B;  4R4I A;  4CDF C;  4K2K A;  4UP9 A;  2UXC L;  2A6E C;  3CXC A;  1IL8 A;  1CKO A;  1M4V A;  1A3V A;  3NE5 B;  3NQI A;  2JSO A;  2K5D A;  3CQZ B;  3K5N A;  4B3M Q;  1QG7 A;  2P5Z X;  4HCE A;  4JI1 L;  3NTK A;  1W6K A;  1P8L A;  5EPJ A;  5NUC A;  1Q8K A;  4CJ2 C;  4JI7 Q;  1FNU A;  2EQS A;  4DNT B;  2XWB B;  4DGZ A;  2VUM H;  1ZKO A;  2NTS A;  5F2D A;  4XQN A;  3U4Z A;  2I46 A;  3J7Z C;  1I94 L;  3AYH B;  2ES2 A;  4EQP A;  1PH5 A;  2F0I A;  4C2M B;  1ENC A;  4OGQ C;  1JJ2 A;  4FYD A;  1TQO A;  4EVO A;  5C0X G;  1F2Y A;  5HGQ A;  2WKD A;  5CV7 A;  3BVG A;  5FLX L;  4CHT B;  3NUC A;  4OIJ A;  4C3I B;  1TWG H;  5C3E B;  1EIH A;  2RA4 A;  4X3S A;  1YJN A;  1YNJ C;  2CQO A;  3LWU A;  2IX1 A;  2MO1 A;  2UU9 Q;  1VQ7 A;  2R7D A;  2NVY B;  4A76 A;  3IL8 A;  1EY4 A;  3TDQ A;  1FGU A;  4ZKB B;  2N3S A;  1CI3 M;  3OSO A;  1Y1W G;  4DV3 L;  4MZ9 A;  3VDY A;  2CHB D;  3VR4 A;  4O2D A;  4HJ7 A;  4OO1 H;  3A55 A;  1RHP A;  4TQU S;  3K5L A;  1PFS A;  2SDF A;  2LY7 A;  4KI0 A;  4A3I G;  5E1F A;  4WJ3 M;  2IX3 A;  3F2D A;  3BJU A;  1EYD A;  3J80 c;  4YY3 Q;  1HH2 P;  3CCQ A;  1RL2 A;  4P71 A;  4KHP L;  3GV3 A;  1Y1V G;  1S5D D;  2AUK A;  5FLM G;  2A6H D;  3S17 B;  2NVT B;  2ZJP A;  3KF8 B;  1NE3 A;  2FIN B;  1Q81 C;  2R93 H;  5JEA H;  1G8Z D;  1N36 Q;  4OON A;  2JXM B;  4A3E H;  1E1O A;  1M90 C;  3HOW B;  3Q8D A;  2V4D A;  3J80 E;  3HOX H;  1B53 A;  4R4O A;  4ZAI A;  5IWA L;  3J81 i;  1PTO C;  4DFA A;  1HFG A;  1EQV A;  3I70 A;  5EQ0 A;  3CRK C;  1IKM A;  4KD3 A;  4H44 C;  4K8I A;  4O0A A;  3AB9 A;  1SAP A;  2K04 A;  5IT9 L;  1CTM A;  1SBB B;  1IKL A;  3AU7 A;  5A2Q E;  5K36 G;  4N8X 1;  3W2D A;  2VB2 X;  3J81 L;  3S2H B;  4UY8 C;  2IT1 A;  2ALY B;  2EYO A;  4HCS A;  2JA5 H;  1LTA D;  3M4Y A;  4K0K Q;  3RLF A;  5T1G A;  4LF4 L;  2NB0 A;  2E5L L;  2F0V A;  1E0B A;  2FMC A;  2PZT A;  2YU9 H;  1D2B A;  4A3I H;  5JVG 3;  2PZW A;  3GQB A;  1CSQ A;  1WCM B;  2Y0S E;  4Q5V A;  1EOT A;  4QUF A;  1PYB A;  3OIQ A;  2X6L A;  3ER0 A;  4LFA Q;  1SR3 A;  4H7B A;  1L0W A;  1XMO Q;  4XTC S;  1I50 H;  2PQA A;  2HIV A;  1ICF B;  5AFW A;  1YHA A;  4A3M B;  1VQI A;  1RTN A;  3T1Y Q;  4RHR A;  2VQE L;  4V0B A;  4V19 0;  1GVP A;  5DAU A;  4ZQ3 A;  3KLR A;  1N8R C;  3K7A B;  3TP7 A;  1XPO A;  3DHQ A;  1N32 L;  2EYH A;  4BA2 I;  1D1I A;  3CME A;  5C4J B;  4ZK9 B;  4FXD A;  1NJI C;  3QOJ A;  1KDB A;  1LTI D;  4KKT A;  4RMF A;  1Q8I A;  2R92 G;  1TWH H;  2K03 A;  2AWO A;  1JC7 A;  4Z9C B;  2L12 A;  1XTC D;  3TZU A;  5GAG C;  3I3C A;  1PTO B;  2E74 C;  4JC0 A;  1U4R A;  3F2C A;  1G2T A;  5CBA E;  1O7I A;  1XPU A;  3GTQ B;  1ESR A;  2N88 A;  1LT4 D;  5LL6 S;  4J15 A;  4J6H A;  4LFB L;  1VQ5 A;  1CSP A;  1NMG A;  4B9W A;  5M5W H;  1IYV A;  4YWM A;  3UDF A;  2A1A A;  2E2I B;  3CCL A;  2EY6 A;  2A8V A;  1EU4 A;  1Q1E A;  1AP0 A;  5C3W A;  2AQ3 B;  3QR8 A;  1QUQ B;  1PTO F;  5C4X G;  3F2B A;  2E2H B;  3BDC A;  2EJM A;  4JYA Q;  1S5E D;  5H1S E;  1NSN S;  4TVA B;  3BYY B;  1D8L A;  1XNQ Q;  3E6Z X;  2UUA Q;  2ZTE A;  4HAE A;  3EVQ A;  4FXK C;  1HFN A;  5M3F H;  1J5E Q;  2HD3 A;  2KHI A;  2EY5 A;  2PPB C;  4OWW B;  4LF6 Q;  1VQ4 A;  4DR7 Q;  5IP7 H;  4HTH A;  1VS0 A;  3MWY W;  4OX9 L;  2NVQ H;  1CKM A;  4BXX G;  3NWS A;  2ZM6 Q;  3K5O A;  4OIK A;  2PI2 E;  5E7N A;  3DM1 A;  1ONL A;  2BCO A;  3HRZ C;  1GUW A;  2K14 A;  3T51 B;  1VQA A;  2LSS A;  2PYK A;  1K0R A;  1RJT A;  1OTC A;  1PH7 A;  4B3M L;  4A3C H;  3L7Z C;  1SYG A;  4C1N I;  5M9O A;  3BDL A;  2CH4 W;  2VS1 A;  3OMG A;  4XQJ A;  3L2P A;  4DUZ Q;  1IZ6 A;  2JA7 G;  1R9T H;  4JI7 L;  4IJH A;  1BCP C;  1LO5 D;  1PZI D;  1K73 C;  2ATW A;  2MPM A;  2NYZ D;  3PF5 A;  1TKW B;  4DNI A;  4BY7 G;  1MGS A;  4XDX A;  4KY5 A;  3I8Z A;  3ERQ A;  1WTQ A;  4JI6 Q;  2O4X A;  3NPP A;  4EQ5 A;  1A15 A;  1EYC A;  1PDQ A;  1XPR A;  1RTO A;  2CFM A;  5EKL A;  1DGS A;  2PQA B;  1X3P A;  3S1R H;  1CK1 A;  1LTG D;  4L63 B;  3A5Z B;  4DR1 Q;  4A3F G;  3BVZ A;  3DEO A;  1UE7 A;  2SNM A;  1K8A C;  1TT2 A;  4YWK A;  1E2W A;  4APV A;  5DM6 3;  3CKI B;  3OOC A;  4L6T B;  5CV5 A;  1XNR Q;  5I2X A;  4UPA A;  1P16 A;  3CD6 A;  1XX8 A;  4C56 C;  2CVR A;  1MD2 D;  5IGE A;  2KCN A;  2UU9 L;  3U9O A;  2J0T D;  5CR3 A;  3DLL A;  2L1B A;  4DV2 Q;  2JN4 A;  4K5X A;  1JCK B;  3Q23 A;  4G7O C;  3MHB A;  4K5V A;  2EOT A;  2NN6 I;  3U9S A;  2ZJR A;  4CBV A;  2KEC A;  4YHH Q;  1B3A A;  3PCO B;  1SDF A;  2MJ8 A;  4RH6 A;  3D31 A;  4JBK A;  5J39 A;  1JB3 A;  3U58 A;  2VB3 X;  2FXQ A;  1SRU A;  1BCP B;  1MKH A;  4YY3 L;  4IFD J;  1FNV A;  1X3E A;  1Y1V B;  4UDU C;  3S2D H;  3TSS A;  3QOL A;  3I4N B;  4ZCK A;  1ASY A;  1EU3 A;  4A93 H;  4M8A A;  2CW0 C;  4YWL A;  2I5H A;  3GTK H;  3VYT A;  4EGV A;  1PFN A;  4IJL A;  4JBW A;  2F0G A;  2G9D A;  1O7Y A;  1WTX A;  5C44 G;  1NR4 A;  1HNW Q;  1N9W A;  3A8J E;  4H02 A;  1N36 L;  3SK6 A;  1AE3 A;  3FP9 A;  4XT3 B;  1YI2 A;  3OW7 A;  2B2W C;  2A69 C;  5DM7 3;  4RKB A;  4L5S A;  3RLO A;  1L2F A;  4JI0 Q;  4ZUJ A;  2K75 A;  4JBM A;  1AE2 A;  2IX0 A;  2E76 C;  1VQH A;  3S14 H;  1I6H H;  5I6Y A;  1HQR D;  2VNU D;  4DAY A;  3KLS A;  3PO3 H;  2BDO A;  3CU7 A;  3ZYY X;  1K83 H;  3W1B A;  2RSN A;  1U9R A;  3J7A F;  4P74 A;  2E75 C;  2KED A;  3L9A X;  4K0K L;  1FNW A;  3E3X A;  4IPC A;  4HIK A;  1RCV D;  3HOZ B;  2BDN A;  2O5I C;  1T9H A;  1WI5 A;  4BY1 H;  2YYZ A;  3M7N A;  1E2V A;  4YCV A;  2BE5 C;  2QDL A;  5HY6 A;  2PCF B;  5IYB H;  4NPS A;  1EY6 A;  3KLW A;  4L5Q A;  3PGZ A;  4LFA L;  3RUZ A;  3H3V C;  1XMO L;  1Y8O B;  4RHS A;  3H15 A;  4JI4 Q;  1TWA B;  4ODG A;  4DXG A;  4FF3 A;  1JJC B;  1X3F A;  2RDF A;  2KA7 A;  3T1Y L;  3SK8 A;  4DAP A;  3VA5 A;  4UP8 A;  4E6I A;  1PYS B;  3KBG A;  5K5P A;  2AMC B;  3I72 A;  1PH8 A;  3K81 C;  3HKZ B;  4X3T A;  2K05 A;  4CJ0 B;  3ND9 A;  3TBI B;  4XQQ A;  1IBL L;  1A3U A;  1EIG A;  4DR3 Q;  4FF4 A;  1QVF A;  2D2C C;  3MXG A;  3OMC A;  5IYD G;  2AHO B;  2DJF C;  2I5L X;  4C3I H;  2AWN A;  5C3E H;  2R6G A;  4PQX A;  3HOW G;  3FKI B;  4U67 3;  1BXT A;  4MNO A;  1DM0 B;  3OW2 A;  1WD0 A;  4HJA A;  2UXB Q;  1B1Z A;  3KBX A;  2MNA A;  3C2P A;  3HOY B;  5EPK A;  3GTP B;  4LF8 Q;  3A7A B;  3MVV A;  5J3B A;  2EYP A;  5J1Z A;  1JWM D;  1EZ8 A;  2JA9 A;  1ZYR C;  4R4Q A;  4KLK A;  4A3G B;  3T1H Q;  2C9O A;  3ULP A;  2L0C A;  3K8A A;  2F0U A;  4WRD A;  5CMD A;  1RKN A;  4UP7 A;  2A6E D;  3HGB A;  4JYA L;  1U0L A;  5IT9 c;  4YIJ A;  3K58 A;  2KCM A;  5M3M G;  1GUS A;  5KNB A;  4QCL A;  3F1Z A;  2UUA L;  3J81 c;  1J5E L;  2EY1 A;  1R4Q B;  4JOI A;  1UAP A;  2NUC A;  3C1F A;  4R1J A;  4LF6 L;  4DR7 L;  3NBI A;  3KK7 A;  4IFD G;  4B3R Q;  2PO4 A;  3M4O B;  3J7A V;  2ZM6 L;  5L37 A;  2NVT H;  4J1M A;  4A3J H;  2AKW B;  4DAY B;  2D0O A;  3RZD B;  1HZA A;  1YJW A;  5IIF A;  4LWC A;  1C4Q A;  3K80 C;  3V05 A;  3D3R A;  5M5Y B;  3I4M B;  3J81 j;  1AZP A;  2JA7 B;  3GTO H;  1LLR D;  5EPL A;  4DUZ L;  2EYJ A;  2A74 C;  2QGQ A;  3NTI A;  4QMG A;  1KAA A;  1TU2 B;  2K52 A;  3NEL A;  4FP5 D;  2NVX B;  2KCT A;  4JI6 L;  5J22 A;  2KEE A;  1SYB A;  4ID6 A;  4PMB A;  1S72 A;  5HUR A;  1CM9 A;  1SJH D;  4JOI C;  3DWQ A;  1YNJ D;  2LKV A;  4X3U A;  5ELC A;  4DR1 L;  4IN3 A;  3JAM i;  4JV5 Q;  5FKA C;  2CWP A;  2F0M A;  3KYH C;  4H0L C;  1V43 A;  2I0Q A;  2BH8 A;  2K5V A;  4P75 A;  4TSS A;  3J7Y W;  5IYC G;  4LF9 Q;  1PRT C;  1S5C D;  1WCM H;  2K4K A;  1XNR L;  1MBY A;  4ULL A;  3JAM L;  5JAV A;  2R7Z G;  3IFD A;  1D6E C;  3OWF A;  1TY2 A;  2DJG C;  4JVZ A;  2IWH A;  1PXU A;  3HP3 A;  3KDF A;  5IE8 A;  3S1Q B;  3A56 A;  4PZ6 A;  1GUO A;  2KHS A;  4DV2 L;  3S16 B;  4A3M H;  2NZO A;  3W5O A;  3FPU B;  3BYT B;  3U4V A;  4KY6 A;  1PH1 A;  3PQI A;  4OWX B;  1IHZ A;  1QIL A;  5BN5 A;  5IGG A;  2OWO A;  3U50 C;  1Q12 A;  4YHH L;  1D1K A;  2LXK A;  1DOL A;  1XWE A;  3S1M B;  1GOZ A;  3BZD B;  1VMP A;  2FMM A;  4XXE A;  2RKS A;  5I4D A;  4X66 Q;  2KVM A;  1HCZ A;  2JYO A;  1KDA A;  3IRB A;  3QWN A;  2HUG A;  5D14 A;  1PA6 A;  1YBY A;  1FJG Q;  1H9R A;  1AFP A;  1YHQ A;  4HIO A;  1G6P A;  2YV5 A;  3R2I A;  1PTO H;  1E3P A;  3VA7 A;  3GTQ H;  1SJE D;  2RHQ B;  3TEH B;  1YJ9 A;  1SNQ A;  1XMQ Q;  4FF1 A;  1XYI A;  2MQH A;  3EA6 A;  1TII D;  1PTO D;  4RGO S;  4OHJ A;  3LX0 A;  1F9S A;  1QNU A;  5C3X A;  2CQA A;  5C44 B;  5KIX A;  1HNW L;  4DV7 Q;  3GTM B;  5DLQ E;  2B63 B;  1BR9 A;  3R2T A;  3I4L A;  2F3V A;  1CHQ D;  1WVL A;  1PRT B;  3CCS A;  4LK1 C;  2NN6 G;  4C3H H;  4JI0 L;  2K50 A;  2B8F A;  2WKC A;  4DV4 Q;  1KLG D;  1ROD A;  1HUM A;  1DCZ A;  1GO3 E;  2JE6 I;  3NK9 A;  2A73 B;  2A68 C;  3VR2 A;  2BA0 A;  1BQQ T;  4A3K H;  3ERO A;  4QGU A;  2F4V Q;  2K01 A;  1K8G A;  2NZH A;  1KTK A;  2LXJ A;  1SNP A;  2JA8 B;  3L3O C;  4NW2 A;  4PMC A;  4G7H C;  2F3W A;  2QF7 A;  3GTL B;  1QCB D;  4DK0 A;  3EJI A;  2MFI A;  1TR5 A;  1PZJ D;  3TS0 A;  1W2B A;  3EIV A;  2B2U A;  5FK9 C;  3K5M A;  4GN4 B;  4NMZ A;  4BBR B;  1PVO A;  3BDO A;  4IPG A;  3X3M A;  1IL2 A;  4MTK A;  3FEW X;  3K6O A;  3K59 A;  4A3D B;  3R93 A;  1B8A A;  2R3Z A;  3GV6 A;  2IJ0 A;  1QJO A;  1IXR A;  1SFO H;  4JI4 L;  1YNN D;  4WJ4 A;  4NDX A;  3FHW A;  1Q3L A;  1E7Z A;  1EY0 A;  3UE1 A;  1S40 A;  2E8G A;  3KDF B;  1CA5 A;  3K57 A;  3I4N G;  4P2C B;  3UDG A;  5TSS A;  2SEB D;  4DV1 Q;  1OXU A;  3PUZ A;  5C0X H;  3DM3 A;  3NEM A;  4QIW E;  3URY A;  4DR3 L;  1QUQ A;  4KD4 A;  2WAQ G;  4S3S A;  3Q22 A;  4AIM A;  1VQF A;  3H0G G;  4DK3 C;  1VF5 C;  1CZW A;  2EXD A;  3MC0 B;  2B2U C;  1K3B C;  2IW3 A;  2D5D A;  4A3L G;  2OT2 A;  2MGS A;  3E0E A;  4IUP A;  3BG3 A;  1FD7 D;  1MHW C;  4KHZ A;  1Z47 A;  3JC6 6;  2HQE A;  1LTL A;  1GUG A;  2N78 A;  5C5M A;  4NB3 A;  4HMI A;  3PIO A;  2UXB L;  4N8F A;  2EVB A;  4JCV E;  4LF8 L;  2HT1 A;  3AMU A;  3GTG H;  1A3T A;  1ILQ A;  5BN3 A;  4DA2 A;  1Y1W H;  3G6E A;  3ULJ A;  5CV4 A;  1SNM A;  1Z9F A;  3STB D;  4KN4 C;  1EWC A;  3T1H L;  2EYM A;  4LMQ D;  4EX5 A;  4DV0 Q;  1HNX Q;  3HOZ G;  2EIF A;  5M3M B;  4ILW A;  1TWF B;  2XRQ D;  1X55 A;  1DYQ A;  5M5X H;  4RKL A;  4A3B B;  1I3Q H;  1PFM A;  3I73 A;  1F9P A;  4C1N K;  1Y1V H;  5CV8 A;  4B3R L;  4FXG C;  5FLM H;  2GA4 B;  4ME5 A;  1UE5 A;  4HN7 A;  1PH3 A;  3NTH A;  1B50 A;  1Z7T A;  1TWC H;  1U4M A;  5EAY A;  1A8V A;  1S4Z A;  4GKK Q;  1B4O A;  3MXU A;  3FRP B;  4DXF A;  3PMF A;  2LS0 1;  2L11 A;  3HS0 C;  4ZUI A;  3HOU B;  2XN9 C;  3M4Q A;  3HKZ G;  4F8M A;  4PG3 A;  2Z6K A;  1QWY A;  2K5W A;  5E3F A;  3RZO B;  4IUV A;  2Q2U A;  1G2S A;  2IL8 A;  4K5W A;  2M2L A;  1E24 A;  1MJC A;  4DK6 C;  1D7Q A;  5FOB B;  1E22 A;  1PV4 A;  2F3I A;  3A54 A;  1X3Q A;  2OCE A;  5K36 H;  4L8J A;  4GLV B;  1T5X D;  5ELE A;  2OQK A;  1GD7 A;  4RWS C;  4CDD C;  3K0Y A;  2QW7 A;  5HGT A;  1Y69 U;  3FKI G;  3G71 A;  2D0P A;  3UE0 A;  3OTO Q;  3L0O A;  4JV5 L;  3IKJ A;  1MI2 A;  1I4Q A;  3SVM A;  4UHV A;  3GTJ H;  2B2T C;  3HOY G;  1J6Q A;  1STH A;  4LF9 L;  1Y8N B;  1SRO A;  2R7Z B;  2A6H C;  1WTV A;  1FR3 A;  1UE6 A;  1NR2 A;  2VUM B;  3F2U A;  4A3G G;  1U5K A;  2Z6K C;  4IUN A;  3I91 A;  2J7Z A;  3BZK A;  1TWA H;  2QCP X;  1HNZ Q;  1EIY B;  2JA6 G;  4NXM Q;  1KRT A;  3DMU A;  4DR5 Q;  2Z1C A;  4ZLT F;  2OTJ A;  2VXW A;  4GLA C;  1EY7 A;  1PZK D;  1GUT A;  3FVQ A;  3QJY A;  1Q86 C;  1I4G A;  2F0N A;  4POF A;  5ELD A;  1TS4 A;  2K5H A;  4X66 L;  1I4P A;  3RLN A;  3CAM A;  2R92 H;  3ZJY C;  1UE1 A;  4Y7N H;  1FJG L;  1LTT D;  1ESF A;  1ASZ A;  1J9O A;  3TRZ A;  4A75 A;  5C6A A;  3KJO A;  1EWI A;  4OWT B;  3I4M G;  1YNX A;  3EN2 A;  1HJP A;  2A69 D;  3I56 A;  1SMX A;  1JE4 A;  4IPD A;  1XMQ L;  1LUZ A;  1Y14 B;  1ML0 D;  3TP6 A;  4CKE A;  1EYG A;  3OIP A;  1EQT A;  4NXN Q;  1TS5 A;  1DXM A;  4AQY Q;  2EPB A;  1DZ1 A;  5GAD C;  2E2J H;  2G5D A;  3AFP A;  1XJV A;  4DV7 L;  2F0J A;  2BA1 A;  3PUY A;  2XWJ B;  2DUD A;  3R3O A;  3ULL A;  4G57 A;  5C4X H;  2WIN B;  3SK4 A;  1QOH A;  2VQF Q;  2RCF A;  4DR2 Q;  5D65 A;  4PZ7 A;  3A5U A;  3D0F A;  4LNQ A;  1JE5 A;  1F9R A;  1RD9 D;  4DV4 L;  4FNF A;  1S3O A;  4CDC C;  3M3Y B;  1X56 A;  3QIA A;  1KIX A;  3H3V H;  3PV0 A;  3CPF A;  1YHB A;  5FJ8 G;  3NQT A;  2BE5 D;  2F4V L;  2RDH A;  3H91 A;  4X64 Q;  1O7L A;  3HKS A;  2XRS D;  4BXX H;  3M4O H;  3QG1 A;  4FF2 A;  2R93 B;  1A2T A;  3DEP A;  4OO1 I;  5D3I B;  2TMP A;  3CCU A;  1KC8 C;  2BOS A;  2HQL A;  3RZD H;  3JAM c;  1HHV A;  2DGY A;  4A3E B;  2EZV A;  2B2W A;  4HJ8 A;  2B39 A;  1MSG A;  1EFI D;  2M9V A;  1QZH A;  4C3J G;  3NEN A;  3PIO 3;  2WAC A;  1O7Z A;  2TSS A;  3M4P A;  2A19 A;  5I6W A;  3HOX B;  2YTX A;  3J80 i;  2JA7 H;  1SSO A;  3V2T A;  3D8G A;  1STA A;  4HR7 B;  3AQQ A;  4BY7 H;  1X32 A;  2ZXR A; 
#chains in the Genus database with same CATH homology
 5C0X I;  1V1P A;  3D4R A;  1V1O A;  2JA5 B;  4RFB A;  4F87 A;  3H09 A;  1KLU D;  5A35 A;  5CGK A;  4XYO A;  2PNR C;  1GHJ A;  1I4X A;  4KY7 A;  1EWH A;  2WAQ B;  5A2Q L;  1SMY D;  2M00 A;  3H0G B;  1UUP A;  1BCP F;  1CA6 A;  1STB A;  1I50 B;  5EJW A;  2K33 A;  5DEH A;  1ZYR D;  2XIW A;  3OWE B;  2DY8 A;  3EQL C;  1G6Z A;  1ZXT A;  3FDT A;  1L0X B;  2L9H A;  5JVH 3;  5KYI A;  5FO7 B;  1C48 A;  1BNZ A;  5I9P A;  1TWH B;  2NTT A;  3MXP A;  2EYL A;  3C1E A;  2L4N A;  1M8A A;  4K8J A;  4KJO A;  1SYE A;  1H9M A;  4R9W A;  5M5W B;  2JEA I;  1O80 A;  1U4L A;  1OO9 B;  3SR1 A;  5FLX E;  1A6X A;  1LTB D;  3T56 B;  2F03 A;  3G7L A;  1OXT A;  2L5T A;  1KNA A;  2EY2 A;  2OXP A;  3NHH A;  1PYW D;  5M3F B;  3OHX C;  1EL0 A;  1Z6H A;  1ET6 A;  2ZT9 C;  1BO0 A;  2NVQ B;  1O78 A;  1KNE A;  2KOL A;  4KV6 A;  2AUJ D;  2FJ2 A;  1V1P B;  2PQE A;  2F0E A;  2HDL A;  2LFN A;  4RGM A;  3G6J B;  3RMH A;  4FVM A;  2MHV A;  1R9T B;  2OF1 A;  1DJR D;  2ICE C;  2JA6 B;  1NAP A;  1AW7 A;  1DOM A;  1LAC A;  5KEE A;  5ISR A;  3QB3 A;  3S1R B;  1HUN A;  3T13 A;  3MFG A;  4KMU C;  3O13 A;  1IW7 C;  4PV1 C;  4F7X A;  4IQZ A;  1BF4 A;  2KQ3 A;  1WTW A;  1XXG A;  4N9T A;  4NP5 A;  1TVX A;  5IT9 E;  2EDG A;  2IPK D;  3J81 E;  1WTP A;  1GXD C;  4KTA A;  1ZEQ X;  1ENF A;  1LTR D;  1STY A;  4R8N A;  3ND8 A;  3S2D B;  3H6M A;  2D9U A;  3D4W A;  2H1E A;  3Q6S A;  4IFD H;  5EKK A;  1JOR A;  2X6G A;  3LNN A;  1OXX K;  3DWP A;  4IUT A;  1F77 A;  2Q8I B;  1HXY D;  4K6D A;  3SK5 A;  4DN4 M;  2WV6 D;  4C3J B;  1EY5 A;  3WOF A;  1LV9 A;  2PW7 A;  4DU9 A;  1UEA B;  2K32 A;  1SEB D;  4BS9 A;  1OXS C;  2JEB I;  2RBM A;  3BS1 A;  3S14 B;  5LL6 X;  3PO3 B;  2KJX A;  1LAB A;  1EEI D;  1WTR A;  4RCN A;  1SE2 A;  3TP8 A;  1W6J A;  3R8B A;  3DWA A;  1JWS D;  1H9S A;  4BY1 B;  2EJG C;  5IOD A;  3KLS X;  2ENB A;  3M7G A;  1ET9 A;  2F0K A;  2MP1 A;  1BDO A;  2B8G A;  4OO1 G;  2EJF C;  2H4O A;  1JOO A;  5I2Y A;  5KRU A;  1I6V C;  1MSH A;  5IGB A;  5COR A;  3VR3 A;  4MIU A;  2Z4H A;  2R61 A;  5CV6 A;  4G4K A;  3P1H A;  3PO2 B;  3NBH A;  2SNS A;  1VMC A;  4QB4 A;  5CV9 A;  1EZ6 A;  1PRT F;  5LHY 1;  4XIG S;  2L55 A;  1SE4 A;  1JOQ A;  2AQ1 B;  5JEA G;  3N6R A;  3PIP 3;  3NWT A;  2Q8T A;  4KK7 A;  3KUP A;  5BN4 A;  1V8Q A;  3QO2 A;  4WOR A;  1Q1B A;  1VCI A;  3VYU A;  2PZU A;  4TRD A;  3TME A;  1CZG A;  2K5Q A;  2DNE A;  4CKC A;  1B2T A;  2NN6 H;  3FPP A;  1AN8 A;  3FMC A;  4BBS B;  4JK1 C;  3DUZ A;  1VF7 A;  3I90 A;  3VYS A;  2QDB A;  4A3J B;  1UNS A;  2PMZ B;  4RGT A;  2ZXO A;  4BWG B;  4ZYS A;  5EBC A;  3RD4 A;  2K6A A;  1NCV A;  1H9S B;  2N55 A;  3E5S A;  3GTO B;  1HTP A;  2B2Y A;  1SYC A;  3S1N B;  1TY0 A;  5E4W C;  5EKI A;  1HQM C;  5JOB A;  1B9M A;  2G9H D;  3DXJ C;  2K1B A;  2LMC B;  2DN8 A;  4DK1 A;  1E2Z A;  3HOV B;  1ENA A;  1BCP D;  1H9J A;  3A7L A;  5C4Z A;  2WP8 J;  1L0Y B;  4HED A;  5G3L D;  2B2T A;  2FFK B;  3D6C A;  4EQN A;  1FGB D;  1OXV A;  1BBX C;  1F2M A;  4CGY B;  2F0S A;  5COY A;  2X69 A;  1VDZ A;  1CQV A;  2B2Y C;  3H94 A;  3WDN A;  2A5H A;  4I7Z C;  4NKL A;  2KCC A;  3X3N A;  3SEB A;  1TS2 A;  2RQX A;  1YNN C;  4IFD I;  1ICW A;  1LTS D;  1PLF A;  4LJZ C;  3TN2 A;  1G29 1;  1EY9 A;  1I4H A;  1CFM A;  2F0H A;  1STN A;  1SE3 A;  1D5X C;  4CKB A;  1PMR A;  3ONA B;  2F0L A;  2JP1 A;  1SNO A;  2WB1 B;  1II3 A;  2RDG A;  2F0Q A;  2F1M A;  2QIL A;  1GHK A;  2CW0 D;  4C3H B;  2QEJ C;  1KDC A;  4DF7 A;  1TWG B;  5IGF A;  4HSP A;  3SXH A;  3IAY A;  5KGU A;  1CQF A;  4A3K B;  4H13 C;  1Y8P B;  4KHV A;  1S5B D;  2ID0 A;  2I07 B;  2ZXP A;  1K8M A;  2B2V A;  4F88 A;  1JR0 D;  1R4P B;  1RDP D;  1I4R A;  1DON A;  1SXT A;  2DY7 A;  2KUM A;  1WD1 A;  3T4A C;  2XVS A;  2XNA C;  3SE0 A;  1BUV T;  3T53 B;  4R8I A;  3Q24 A;  1SFO B;  3C46 A;  1ILP A;  2D62 A;  4RGN A;  3UI2 A;  3IFT A;  4FO2 A;  1IYU A;  2Z8L A;  4G7Z C;  4Q0F A;  3NP8 A;  1GJX A;  3VR6 A;  1SYF A;  4X3K A;  2B2V C;  3GP7 A;  3W3A A;  4PMW A;  3SDZ A;  1S5F D;  1HRJ A;  4LAA A;  1AZQ A;  2DNC A;  1D5Z C;  5KND A;  3GTG B;  1AEX A;  1Y1W B;  3J80 L;  4AYB B;  3CHB D;  1TS3 A;  2EXZ A;  4UAI A;  3WOE A;  5CBE E;  1EEF D;  2O2L D;  2YU9 B;  4A3I B;  3JAM E;  5EGT A;  5M5X B;  1GUN A;  3D4D A;  4DAV A;  1I3Q B;  5FO8 B;  4IUR A;  1F9Q A;  3GD7 A;  5T1I A;  5G3L F;  4BA1 I;  3PUW A;  1G91 A;  1TWC B;  1HTL D;  1JOK A;  5JPN C;  3MA2 B;  1SYD A;  3HEJ A;  1D5M C;  3LWE A;  4IZ8 A;  4K14 A;  5IGC A;  2J4X A;  5KYL A;  3MXN A;  1CT1 D;  3EFX D;  5D3D A;  4B08 A;  2F0D A;  5CYU A;  3V96 A;  4O42 A;  1QE6 A;  2MUY A;  3A8K E;  4MN3 A;  2F0F A;  1K8O A;  3Q0A A;  5IOC A;  1IW7 D;  1A2U A;  5KNC A;  4RCO A;  3TP5 A;  4ZKC B;  4C3I G;  3VR5 A;  2Z4I A;  5ELB A;  5C5L A;  1HA5 A;  1STG A;  3MZ5 A;  1Q90 A;  1SNC A;  1EYA A;  5JPM C;  2F0P A;  1LT3 D;  2HCI A;  3C3L A;  3GTJ B;  3CRL C;  2NBF A;  3ITP A;  2RVL A;  3P75 A;  1DOK A;  3P20 A;  4XT1 B;  1RF2 D;  4WJW A;  5ELF A;  1CHP D;  2NZ1 D;  2OEO A;  3MFY A;  1WTO A;  4I65 A;  2F0T A;  4PNY A;  4KKU A;  1JIC A;  4U68 A;  1PRT D;  4QF4 A;  1KAB A;  3D6W A;  2EE1 A;  1J8I A;  1QNK A;  4CJ1 B;  2R92 B;  3MAQ A;  4Y7N B;  4DNR B;  2F0O A;  4KJN A;  1HA6 A;  4IUQ A;  3GO5 A;  2Q8R E;  4IUU A;  4N9P A;  1HPC A;  3T16 A;  5FO9 B;  1STE A;  1H9K A;  1SMY C;  2RSO A;  4QUC A;  4RAU C;  1SND A;  4HMJ A;  2E2J B;  3HZX A;  1U4P A;  3BVM A;  3TZD A;  2HCC A;  5I9O A;  2HDM A;  5C4H A;  4RA8 A;  1QB5 D;  5C0X J;  4ZRZ A;  5C4X B;  4GZY C;  2C5C A;  1LT5 D;  1DD2 A;  5JEA J;  2AQ2 B;  3VYR A;  5JJZ A;  3P7J A;  1B44 D;  2XSC A;  1F2Z A;  4MHE A;  4OL7 A;  2WII B;  4TKO B;  3HG9 A;  3PUX A;  3OPO A;  2F4I A;  5DNF A;  2NWG A;  1JWU D;  1LT6 D;  3MTS A;  3NSW A;  5E4X A;  2A68 D;  2O5J C;  4KN7 C;  1PFB A;  2K28 A;  4HSV A;  1NUC A;  3NXW A;  4K6L A;  3S9W A;  4BY7 B;  3SHL A;  4KKS A;  4QIW B;  1T5E A;  1JQY D;  4M1U B;  4EQO A;  4A93 B;  3E0J A;  3GTK B;  5IGD A;  2PW5 A;  4A3F B;  3MEH A;  4ABN A;  1C8C A;  2E2D C;  2SOB A;  2K7V A;  1F2L A;  3N52 A;  4IAL A;  4XYQ A;  2QKI C;  1B9N A;  5EBD A;  2FHT A;  4C3H G;  4B9X A;  4WFN 3;  1I6H B;  3A8I E;  3KF8 A;  1FYC A;  2F0W A;  3S15 B;  3M85 A;  1K83 B;  1BOS A;  4O1N A;  5CC4 A;  3PUV A;  2Y0S B;  2ICI A;  4J8Q A;  1EY8 A;  2EYF A;  4K2L A;  4K2K A;  2A6E C;  1IL8 A;  1M4V A;  1A3V A;  3NE5 B;  3NQI A;  2JSO A;  2K5D A;  3CQZ B;  3K5N A;  1QG7 A;  4HCE A;  3NTK A;  1W6K A;  5EPJ A;  5NUC A;  4CJ2 C;  1FNU A;  4DNT B;  2XWB B;  4DGZ A;  1ZKO A;  2NTS A;  5F2D A;  4XQN A;  2I46 A;  4EQP A;  2F0I A;  4C2M B;  1ENC A;  4OGQ C;  4FYD A;  1TQO A;  4EVO A;  5C0X G;  1F2Y A;  2WKD A;  5CV7 A;  3BVG A;  5FLX L;  4CHT B;  3NUC A;  4OIJ A;  4C3I B;  5C3E B;  1EIH A;  2RA4 A;  4X3S A;  1YNJ C;  3LWU A;  2IX1 A;  2NVY B;  3IL8 A;  1EY4 A;  3TDQ A;  4ZKB B;  1CI3 M;  3OSO A;  2CHB D;  3VR4 A;  4OO1 H;  3A55 A;  1RHP A;  4TQU S;  3K5L A;  2SDF A;  2LY7 A;  4KI0 A;  5E1F A;  2IX3 A;  1EYD A;  3GV3 A;  1S5D D;  2AUK A;  2A6H D;  3S17 B;  2NVT B;  2FIN B;  5JEA H;  1G8Z D;  2JXM B;  3HOW B;  2V4D A;  3J80 E;  1B53 A;  4ZAI A;  1PTO C;  4DFA A;  1HFG A;  1EQV A;  3I70 A;  5EQ0 A;  3CRK C;  1IKM A;  4KD3 A;  4H44 C;  4K8I A;  3AB9 A;  1SAP A;  2K04 A;  5IT9 L;  1CTM A;  1SBB B;  1IKL A;  3AU7 A;  5A2Q E;  5K36 G;  3W2D A;  2VB2 X;  3J81 L;  3S2H B;  2IT1 A;  2EYO A;  4HCS A;  1LTA D;  3M4Y A;  3RLF A;  5T1G A;  2NB0 A;  2F0V A;  1E0B A;  2FMC A;  2PZT A;  1D2B A;  5JVG 3;  2PZW A;  3GQB A;  1WCM B;  4Q5V A;  1EOT A;  4QUF A;  3OIQ A;  2X6L A;  4H7B A;  4XTC S;  4A3M B;  5AFW A;  1RTN A;  4RHR A;  4V0B A;  4V19 0;  5DAU A;  4ZQ3 A;  3KLR A;  3K7A B;  3TP7 A;  3DHQ A;  2EYH A;  4BA2 I;  1D1I A;  5C4J B;  4ZK9 B;  4FXD A;  3QOJ A;  1KDB A;  1LTI D;  4KKT A;  1Q8I A;  2K03 A;  2AWO A;  1JC7 A;  4Z9C B;  2L12 A;  1XTC D;  3TZU A;  3I3C A;  1PTO B;  2E74 C;  1U4R A;  1G2T A;  5CBA E;  3GTQ B;  1ESR A;  2N88 A;  1LT4 D;  5LL6 S;  4J6H A;  4B9W A;  1IYV A;  2E2I B;  2EY6 A;  1EU4 A;  1Q1E A;  1AP0 A;  5C3W A;  2AQ3 B;  1PTO F;  2E2H B;  3BDC A;  2EJM A;  1S5E D;  1NSN S;  3BYY B;  3E6Z X;  4HAE A;  3EVQ A;  4FXK C;  1HFN A;  2EY5 A;  2PPB C;  4HTH A;  3MWY W;  3NWS A;  3K5O A;  4OIK A;  3DM1 A;  1ONL A;  2BCO A;  3HRZ C;  1GUW A;  3T51 B;  2PYK A;  1RJT A;  3L7Z C;  1SYG A;  4C1N I;  5M9O A;  3BDL A;  3OMG A;  4XQJ A;  1BCP C;  1LO5 D;  1PZI D;  2MPM A;  2NYZ D;  1TKW B;  1MGS A;  4XDX A;  4KY5 A;  3I8Z A;  3ERQ A;  1WTQ A;  2O4X A;  3NPP A;  1A15 A;  1EYC A;  1PDQ A;  1RTO A;  5EKL A;  1X3P A;  1CK1 A;  1LTG D;  4L63 B;  3BVZ A;  3DEO A;  2SNM A;  1TT2 A;  1E2W A;  5DM6 3;  3CKI B;  3OOC A;  4L6T B;  5CV5 A;  5I2X A;  1XX8 A;  4C56 C;  2CVR A;  1MD2 D;  5IGE A;  2KCN A;  3U9O A;  2J0T D;  5CR3 A;  2L1B A;  4K5X A;  1JCK B;  3Q23 A;  4G7O C;  3MHB A;  4K5V A;  2EOT A;  2NN6 I;  3U9S A;  4CBV A;  2KEC A;  1B3A A;  1SDF A;  2MJ8 A;  4RH6 A;  3D31 A;  5J39 A;  1JB3 A;  2VB3 X;  1BCP B;  4IFD J;  1FNV A;  1Y1V B;  4UDU C;  3TSS A;  3QOL A;  3I4N B;  1EU3 A;  4M8A A;  2CW0 C;  3VYT A;  4EGV A;  1PFN A;  4JBW A;  2F0G A;  2G9D A;  1O7Y A;  1WTX A;  1NR4 A;  3A8J E;  3SK6 A;  4XT3 B;  3OW7 A;  2B2W C;  2A69 C;  5DM7 3;  4RKB A;  4ZUJ A;  2IX0 A;  2E76 C;  5I6Y A;  1HQR D;  2VNU D;  4DAY A;  3KLS A;  2BDO A;  3CU7 A;  3ZYY X;  2RSN A;  1U9R A;  3J7A F;  2E75 C;  2KED A;  3L9A X;  1FNW A;  1RCV D;  3HOZ B;  2BDN A;  2O5I C;  2YYZ A;  3M7N A;  1E2V A;  2BE5 C;  2PCF B;  1EY6 A;  3RUZ A;  3H3V C;  1Y8O B;  4RHS A;  1TWA B;  4ODG A;  4DXG A;  4FF3 A;  2RDF A;  2KA7 A;  3SK8 A;  4DAP A;  3VA5 A;  4E6I A;  3KBG A;  5K5P A;  3I72 A;  3HKZ B;  4X3T A;  2K05 A;  4CJ0 B;  3ND9 A;  3TBI B;  4XQQ A;  1A3U A;  1EIG A;  4FF4 A;  2D2C C;  3MXG A;  3OMC A;  2AWN A;  2R6G A;  4PQX A;  3FKI B;  4U67 3;  1BXT A;  1DM0 B;  1WD0 A;  1B1Z A;  3KBX A;  3C2P A;  3HOY B;  5EPK A;  3GTP B;  3A7A B;  3MVV A;  2EYP A;  5J1Z A;  1JWM D;  1EZ8 A;  1ZYR C;  4A3G B;  2C9O A;  2L0C A;  2F0U A;  4WRD A;  5CMD A;  1RKN A;  2A6E D;  3HGB A;  4YIJ A;  3K58 A;  1GUS A;  5KNB A;  4QCL A;  2EY1 A;  1R4Q B;  1UAP A;  2NUC A;  3C1F A;  4IFD G;  3NBI A;  3KK7 A;  2PO4 A;  3M4O B;  3J7A V;  4J1M A;  3RZD B;  5IIF A;  1C4Q A;  3V05 A;  3D3R A;  5M5Y B;  3I4M B;  1AZP A;  2JA7 B;  1LLR D;  5EPL A;  2EYJ A;  2A74 C;  3NTI A;  4QMG A;  1KAA A;  1TU2 B;  4FP5 D;  2NVX B;  5J22 A;  2KEE A;  1SYB A;  4ID6 A;  4PMB A;  5HUR A;  1CM9 A;  1SJH D;  3DWQ A;  1YNJ D;  2LKV A;  4X3U A;  5ELC A;  4IN3 A;  5FKA C;  2F0M A;  4H0L C;  1V43 A;  4TSS A;  3J7Y W;  1PRT C;  1S5C D;  1MBY A;  4ULL A;  3JAM L;  5JAV A;  3IFD A;  1D6E C;  3OWF A;  1TY2 A;  2IWH A;  1PXU A;  3HP3 A;  3S1Q B;  3A56 A;  1GUO A;  2KHS A;  3S16 B;  3FPU B;  3BYT B;  4KY6 A;  1IHZ A;  1QIL A;  5BN5 A;  5IGG A;  1Q12 A;  1D1K A;  1DOL A;  1XWE A;  3S1M B;  1GOZ A;  3BZD B;  1VMP A;  2FMM A;  4XXE A;  2RKS A;  5I4D A;  2KVM A;  1HCZ A;  2JYO A;  1KDA A;  3QWN A;  2HUG A;  5D14 A;  1H9R A;  1AFP A;  3R2I A;  1PTO H;  3VA7 A;  1SJE D;  1SNQ A;  4FF1 A;  1XYI A;  3EA6 A;  1TII D;  1PTO D;  4RGO S;  4OHJ A;  3LX0 A;  1F9S A;  1QNU A;  5C3X A;  2CQA A;  5C44 B;  5KIX A;  3GTM B;  2B63 B;  1BR9 A;  3R2T A;  3I4L A;  2F3V A;  1CHQ D;  1WVL A;  1PRT B;  4LK1 C;  2NN6 G;  2B8F A;  2WKC A;  1KLG D;  1ROD A;  1HUM A;  1DCZ A;  2JE6 I;  3NK9 A;  2A73 B;  2A68 C;  3VR2 A;  2BA0 A;  1BQQ T;  3ERO A;  2K01 A;  1KTK A;  1SNP A;  2JA8 B;  3L3O C;  4NW2 A;  4PMC A;  4G7H C;  2F3W A;  2QF7 A;  3GTL B;  1QCB D;  4DK0 A;  3EJI A;  1TR5 A;  1PZJ D;  2B2U A;  5FK9 C;  3K5M A;  4NMZ A;  4BBR B;  3BDO A;  3X3M A;  3FEW X;  3K6O A;  3K59 A;  4A3D B;  3R93 A;  2R3Z A;  3GV6 A;  2IJ0 A;  1QJO A;  1YNN D;  4NDX A;  1Q3L A;  1EY0 A;  1CA5 A;  3K57 A;  4P2C B;  5TSS A;  2SEB D;  1OXU A;  3PUZ A;  5C0X H;  3URY A;  4KD4 A;  4S3S A;  3Q22 A;  1VF5 C;  1CZW A;  3MC0 B;  2B2U C;  2IW3 A;  2D5D A;  2OT2 A;  2MGS A;  4IUP A;  3BG3 A;  1FD7 D;  4KHZ A;  1Z47 A;  2HQE A;  1GUG A;  5C5M A;  4HMI A;  2EVB A;  3AMU A;  1A3T A;  1ILQ A;  5BN3 A;  4DA2 A;  5CV4 A;  1SNM A;  4KN4 C;  1EWC A;  2EYM A;  4LMQ D;  5M3M B;  4ILW A;  1TWF B;  2XRQ D;  1DYQ A;  4RKL A;  4A3B B;  1PFM A;  3I73 A;  1F9P A;  4C1N K;  5CV8 A;  4FXG C;  2GA4 B;  4ME5 A;  4HN7 A;  3NTH A;  1B50 A;  1Z7T A;  1U4M A;  1S4Z A;  1B4O A;  3MXU A;  3FRP B;  4DXF A;  3PMF A;  2LS0 1;  2L11 A;  3HS0 C;  4ZUI A;  3HOU B;  2XN9 C;  4F8M A;  1QWY A;  2K5W A;  5E3F A;  3RZO B;  4IUV A;  1G2S A;  2IL8 A;  4K5W A;  2M2L A;  5FOB B;  3A54 A;  1X3Q A;  5K36 H;  4L8J A;  1T5X D;  5ELE A;  4RWS C;  3K0Y A;  5HGT A;  1Y69 U;  3IKJ A;  1MI2 A;  1I4Q A;  3SVM A;  2B2T C;  1STH A;  1Y8N B;  2R7Z B;  2A6H C;  1WTV A;  1FR3 A;  1NR2 A;  2VUM B;  3F2U A;  4IUN A;  3I91 A;  2J7Z A;  2QCP X;  3DMU A;  2Z1C A;  4ZLT F;  2VXW A;  1EY7 A;  1PZK D;  1GUT A;  3FVQ A;  3QJY A;  1I4G A;  2F0N A;  5ELD A;  1TS4 A;  1I4P A;  1LTT D;  1ESF A;  1J9O A;  5C6A A;  2A69 D;  1JE4 A;  3TP6 A;  1ML0 D;  4CKE A;  3OIP A;  1EQT A;  1TS5 A;  1DXM A;  2EPB A;  1DZ1 A;  2F0J A;  2BA1 A;  3PUY A;  2XWJ B;  3R3O A;  4G57 A;  2WIN B;  3SK4 A;  1QOH A;  5D65 A;  1F9R A;  1RD9 D;  4FNF A;  3M3Y B;  3QIA A;  3PV0 A;  2BE5 D;  3NQT A;  2RDH A;  3H91 A;  1O7L A;  2XRS D;  3QG1 A;  4FF2 A;  2R93 B;  1A2T A;  3DEP A;  4OO1 I;  5D3I B;  2TMP A;  2BOS A;  1HHV A;  4A3E B;  2EZV A;  2B2W A;  2B39 A;  1MSG A;  1EFI D;  2M9V A;  4C3J G;  3PIO 3;  2WAC A;  1O7Z A;  2TSS A;  5I6W A;  3HOX B;  1SSO A;  3V2T A;  3D8G A;  1STA A;  4HR7 B;  1X32 A;  2ZXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...