4JI5Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji5Q00
2K4KA 4BA1I 3JC66 3CMAA 1KRTA 3I2ZA 4DUYL 4HJAA 1WYDA 3KF6B 1VQMA 4EX5A 1IBLQ 4OO1I 4A93G 2R7DA 1A8VA 4FDBA 4JBKA 4BBSH 5M3MH 4GNXC 3G4SA 2PI2A 5LMUQ 1QVCA 1VQAA 2YV5A 5C4XG 4HJ8A 4GOPC 2K14A 3JAMi 2K75A 2E2JH 4AH6A 4NXMQ 3TS2A 3D0FA 1KRSA 2AMCB 4GN5A 4LUVA 4RMFA 2NN6G 3S16H 2K5HA 2ATWA 1Q12A 4JYAQ 3EBEA 1N34Q 4LFBL 1C7YA 4JI7Q 2VQFL 3RLFA 4LF8L 4DR7Q 1U0LA 4LF7Q 4DPGA 4QIWE 5M3FG 1YJ9A 5GQOA 2PQAA 1C9OA 3RLNA 1IBKQ 2XTIA 1PH6A 1OXTA 2DUDA 2WFWA 2GN5A 1PYSB 3UDFA 4APVA 2F4VQ 3ICEA 1SROA 1UEBA 1A62A 4L5SA 2HQLA 3GTGH 2ZJPA 1AE3A 1NMFA 3A5ZB 4P75A 1XNQL 1AH9A 3WWVA 4A3JH 2MQHA 4KHZA 3NENA 2UXBQ 2K50A 2EQSA 4JI5L 1WI5A 2R93H 1HNWQ 3T1YL 4LF6L 4K0KL 2YTVA 5JJKA 4JCVE 5C0XI 2XGTA 2NZHA 1YITA 2CCZA 4X66Q 3S15H 4XIGS 5K36G 2Z6KA 3KFUA 5IP9H 1I94Q 4R4IA 2JEBI 1EIYB 1VQBA 3L7ZC 3F2BA 1K83H 1K9MC 1C0AA 3UE0A 3ULPA 2LXKA 4P73A 4BBRH 3PIOA 1IL2A 1PH7A 4LFAQ 4JI2L 1Q46A 4R4CA 2Z0SA 1PHJA 4X62Q 3CP0A 4A3GG 3ERSX 1YZ6A 1FVIA 3HOUH 2IHEA 2IT1A 4OXPA 2Z6KC 1N9WA 4Y52H 1XMOQ 3U4ZA 4JI0L 2NZOA 1KD1C 1OXXK 1TWGH 1XPOA 4IFDJ 2F52A 3GTMH 1JT8A 4PZ7A 2V1CC 3STBD 3TEHB 3E9HA 2WAQG 4A75A 1GVPA 3UDXA 1QZHA 1LYLA 2ZJQA 1BBWA 3CCRA 2VZAA 4L5QA 3TREA 4RG1A 3I4MG 3GTJH 2R7FA 4PZ6A 1X3FA 1SRUA 4NXNQ 4DV0Q 3G48A 2WP8J 3NBHB 4HJ9A 4A3MG 4A3KG 3CCQA 2JA7G 3M3YH 4GKKQ 2UXDQ 1IBML 1Y1WG 2I0QA 4BY7G 1PH5A 1WCMG 5LMNL 4B3MQ 4JI1L 2JA5G 1E1TA 5E7NA 2E2IH 1K8AC 5HGQA 4LF5L 4JV5L 3H0GG 2A19A 2LSSA 3OTOQ 1HH2P 1E1OA 1WJJA 4LUOA 4AIMA 1NY4A 3CAMA 4C3HH 2QEXA 4GNXB 2R7ZG 1MKHA 5J3BA 4JI7L 4H02A 3KDFA 4JI3Q 4GOPB 1BBUA 4X64Q 3S17H 3A74A 4DR4L 1KQSA 4IPHA 3HOWG 1D8LA 2VY3A 4L5TA 3HKZG 3FP9A 3UDGA 1J5EL 4A3EH 2K52A 1HZBA 4YCUA 1Q7YC 3I4OA 3K0XA 4HIMA 3J7A5 4DV4Q 1SE8A 4NPSA 3J81j 2QGQA 2KBNA 3AYHB 1L0WA 1VQ5A 1GO3E 3U50C 3KJOA 2E5LQ 3F1ZA 4LF4L 1I5FA 3K7UC 3PUVA 1KC8C 4BA2I 3KYHC 1IZ6A 1W3SA 4PG3A 1SLJA 2HHHQ 2EIFA 3U4VA 3UDIA 4JG2A 3F2CA 5GROA 1G51A 4IO9A 1PH1A 1N33Q 3TS0A 3E9IA 2ASBA 2BH2A 4LNQA 2KCMA 4AQYQ 2UUAQ 3T1HQ 3BU2A 3CPFA 1PA6A 4DR3L 1RL2A 1VQ6A 2B63H 3PGZA 3NELA 4GN3B 4QJFA 4Y7NH 1IYJB 1HR0L 3EIVA 5IWAL 1PH2A 1NJIC 2PNHA 4YY3Q 5IT9c 1CUKA 4A3IH 1TWHH 4BY1H 1QVFA 3F8TA 3G6EA 4DV3Q 3PO2H 1X56A 3BZCA 1NBWA 4DR5Q 2VQEL 1XMQQ 1X3EA 4LF9L 3W5OA 2YTXA 2ZM6L 2HIVA 3AFPA 5BR8L 1YHQA 1HNZL 4A3BH 4LW1A 1QVGA 1GD7A 1X65A 1E7ZA 3RZDH 4OX9Q 5ELNA 2VUMG 4OONA 2WB1E 3EN2A 4HIDA 2ZJRA 4XTCS 1A63A 1V43A 3HOZH 2OQ0A 3ZJYC 3CC2A 2MFIA 3PV0A 2YU9H 3KLWA 1VQCA 1HNWL 1KIXA 4AYBE 1VQ7A 1YEZA 2JA9A 2VW9A 3G71A 1PH3A 4IFDI 1XNRL 1PH9A 1OXVA 2JA6G 3UE1A 2CQOA 2JA8G 4DAMA 3D31A 1TWCH 2Y0SG 3J80i 5IP7H 3CC7A 1D7QA 2NVQH 1FJGQ 3GO5A 5FJ8G 5C3EG 1MJEA 1PVOA 4WJ4A 3M4QA 3RNUA 3GTLH 1NMGA 5AJ3Q 4YCVA 3HOYG 3CCLA 1L2FA 3FKIG 2UU9L 1VQKA 1EQQA 5IYBG 1K3RA 4NB3A 1CSPA 2A8VA 5FLMG 1VQEA 3HKSA 3RR5A 2D62A 1ASZA 5IYCH 2UUCL 4YHHQ 1Q81C 1ASYA 4WJ3M 3J81c 3CCVA 4KLKA 2NVXH 4B3SL 1H95A 2Q2UA 1S3OA 3PF4A 1VQDA 1UE6A 3ER0A 2PI2E 4DR1L 4R1JA 2BH8A 4JI8Q 3CCJA 4DV6L 1IXRA 2VNUD 2R6GA 3ULJA 1JJCB 2RHQB 3M9BA 5M3MG 5GAEC 4BBSG 3M4OH 2Q2TA 1JMCA 4JI6L 5IYDH 4DV1Q 4LFCQ 2UUBQ 1X6OA 1S72A 4KHPL 1WOCA 3GTQH 4X65L 3PO3H 3AQQA 3HOXH 2LXJA 3ULLA 2MO1A 1I50H 1Y1VH 4L5RC 3CC4A 2HIXA 3K7AH 4DR6Q 4DV2Q 1BKBA 3A0JA 4UY8C 4C2MH 2UXCQ 1Z9FA 3PIPA 1M1KC 2VS1A 1JB7A 2Q2IA 1N32L 3KDFB 3I4NH 1K73C 1B70B 1UE7A 3KOJA 4GLAC 1NE3A 2RCNA 5JJLA 3HOVH 4B3RQ 2AWNA 3VDYA 2E8GA 2I5HA 1Z47A 4YWKA 3DLLA 3CMEA 1VQ4A 3K8AA 2GVAA 4A3JG 1VQPA 1PH8A 3MXNB 4DR2Q 4JI4Q 4BXXH 1P16A 1MIUA 2R93G 1U5KA 3FHWA 4DUYQ 4DK6C 4A3CH 4OWXB 2MNAA 2EXDA 1KXLA 1IBLL 1G6PA 5IP9G 5LMUL 2D0PA 4IOCA 4YWLA 4JBJA 4QY7A 4UP9A 4NXML 3RN2A 1OXSC 1Q1EA 4BBRG 1Q82C 2R92H 1Q1BA 2C35B 3W1BA 4LFBQ 3RZOH 2N3SA 4O2DA 1N34L 4JYAL 2VQFQ 4OO1G 5M5WH 2CWPA 3E0EA 4LF8Q 2OCEA 4UPAA 1QZGA 3A5UA 3HOUG 2N78A 3S1MH 4DR7L 1A0IA 3S2HH 1CSQA 1VQHA 1VQ8A 4LF7L 4A3LH 1X3GA 2D0OA 1QUQA 3JAMc 1K8GA 4DV5Q 1YIJA 1VQNA 1IBKL 2Y0SE 2F4VL 3PUWA 5C44H 5IY0A 3CCMA 2AKWB 1O7IA 2BA1A 1E24A 4A3FH 4IPGA 3J80c 1PV4A 1Q86C 5GAHC 1XNQQ 4JI5Q 2UXBL 4DKAC 4A3DH 1XTDA 2RF4A 5C0XJ 3T1YQ 3F2DA 4LF6Q 4K0KQ 4GN4B 1YNXA 2NVYH 2L15A 1E3PA 2H5XA 3M4PA 4A93H 1KHIA 1VQLA 4X66L 4MZ9A 4POGA 1I94L 5C4XH 1HJPA 3CXCA 1YJWA 5DLQE 4DV7Q 1XJVA 4JBWA 2ALYB 1TWFH 2CFMA 3S1QH 4JI2Q 4A4IA 2OWOA 4LFAL 5C0XG 4OWTB 3OW2A 1SN8A 3CPWA 2MO0A 1B8AA 4GKJL 1E22A 1CKMA 3K81C 4X62L 2BA0A 5M5XH 2YYZA 5M3FH 4YWMA 3OYYA 3TRZA 4A3EG 1XMOL 2OTJA 2E2HH 1OXUA 3KF8B 3M7NA 3RN5A 3CW2C 2NVTH 4B3TQ 1P8LA 4IOAA 1LUZA 2IY5B 4KI0A 3L0OA 4PZ8A 3L2PA 5JEAJ 4UP8A 1PFSA 1N36Q 4GS3A 1FGUA 1L1OA 2B29A 3MEFA 4POFA 1VQJA 1MJCA 2I5MX 4NXNL 1YBYA 4DV0L 3S14H 1EOVA 2WAQE 4GKKL 2CKZB 2UXDL 1IBMQ 4JOIA 3S1NH 3PCOB 5LMNQ 2PMZE 4JI1Q 1R9TH 4B3ML 4C3JH 2B63G 5EAYA 5GAGC 4LF5Q 4JV5Q 1VQFA 2VL6A 3GD7A 3RLOA 1G291 5JEAG 4A3IG 1VQ9A 4BY1G 1VCIA 3OTOL 4O0AA 1L1OC 3W1GA 1HR0W 4IPDA 3PO2G 1AE2A 1TWAH 4TQUS 2QA4A 4A3BG 4JOIC 3BJUA 4JI3L 3S1RH 1J6QA 1YI2A 2A1AA 4X64L 4DR4Q 3CD6A 4YCWA 4J15A 1HNXQ 4A3GH 2N49A 4DNIA 1OTCA 4P72A 2JQOA 3HFZB 4A76A 1J5EQ 1T9HA 3HOZG 2KHIA 4DV5L 2B3GA 1JE5A 1VQGA 4DV4L 3PSIA 3DM3A 4LWCA 4P74A 4QGUA 4LF4Q 3GTOH 4R4QA 3HKZE 2E5LL 1XPRA 1VQIA 3KF6A 4R4TA 5IP7G 4LUZA 3I4MH 4HJ7A 1V9PA 3H3VI 4IJHA 2ZTCA 1EWIA 1KL9A 5H1SE 2HHHL 4A3KH 2JA7H 4HIKA 3PUZA 5GADC 4A3MH 4GKJQ 2IX0A 1N33L 1EUJA 4MNOA 3AFQA 1Y1WH 4BY7H 1WCMH 3KJPA 4AQYL 4DR3Q 2UUAL 3T1HL 5FLXc 4DUZQ 2JA5H 1PH4A 1K0RA 3PF5A 1HR0Q 5IWAQ 1QUQB 3S24A 3H0GH 4QL5A 1X55A 4YY3L 2I5LX 5IYCG 3H15A 4DV7L 2WB1G 4DV3L 1WFQA 2R7ZH 2VQEQ 4ALPA 4PMWA 4DR5L 4LF9Q 3PUXA 1XMQL 5C4JH 2ZM6Q 1HNZQ 5BR8Q 5IE8A 1LM0A 2NN6I 1LTLA 2FXQA 3STBC 1X54A 4HIOA 4AYBG 1TXYA 3S2DH 1SMXA 4ME3A 1Q8KA 3HOWH 4OX9L 5IYDG 4GLXA 3AEVA 5ELOA 1I6HH 1N8RC 3PO3G 3HOXG 1CKNB 1XPUA 2DGYA 4JBMA 1UE1A 1Y1VG 2OQKA 4B3TL 1XNRQ 1JJ2A 2ID0A 1S40A 1EQRA 3BZKA 2AWOA 1W2BA 1X9NA 1SFOH 1EYGA 3LGJA 2ZTEA 2KHJA 3SGIA 3CF5A 1N36L 1EFWA 2OTLA 3J81i 1FJGL 2KENA 1HZ9A 3K80C 3I4NG 4IFDG 5AJ3L 1YHAA 4IPCA 2ES2A 3NEMA 3HOVG 2UU9Q 3M85A 1SR3A 2JJQA 4C3IH 3U58A 5M5YH 4P71A 3H3VH 2HT1A 4DK3C 2UUCQ 4BXXG 3TQYA 1HZCA 4YHHL 3PUYA 4B3SQ 1VS0A 4QQBX 3Q8DA 3CCSA 2IHFA 2GVBA 2Q2HA 1YHBA 3IRBA 3CCUA 3GDEA 4DR1Q 3GTPH 1NTGA 1PYBA 4JC0A 4A3CG 1YVCA 4JI8L 4DV6Q 1CKNA 1HNXL 1GKHA 5HY6A 1VQOA 2JEAI 2ZTDA 1L1OB 2VUMH 1UWVA 2K5VA 3B6YA 4TVAB 4JI6Q 4HJ5A 3I56A 4KHPQ 5LMNW 4LFCL 4DV1L 4MTNA 1GM5A 2UUBL 4X65Q 1HZAA 1B7YB 1M90C 2R92G 4UP7A 1RIPA 2JA6H 4IJLA 3CCEA 1BVSA 4DR6L 4DV2L 1FL0A 2JA8H 3I7FA 1YJNA 2KCTA 2JK8A 1V1QA 2JE6I 2CWAA 4A3LG 3GTKH 5FJ8H 4GLVB 5C3EH 2UXCL 4JI0Q 1JJGA 1N32Q 3HOYH 2K5NA 2RHSB 1UE5A 3FKIH 3CQZH 4X6AH 4B3RL 4DUZL 4GNXA 1I3QH 2F3IA 1DGSA 5IYBH 5C44G 4EQ5A 5JJIA 4A3FG 2PQAB 1CKOA 1EIFA 1KAWA 4GOPA 3I55A 2AHOB 2YTYA 4R4OA 5FLMH 4DAYB 4OWWB 2IX1A 2N8NA 4DR2L 4JI4L 3J7ZC 4A3DG 1Y14B
chains in the Genus database with same CATH superfamily
3W2DA 4HN7A 4BA1I 2KJXA 3SK5A 3KF6B 1WTHA 2MP1A 1XX8A 3D4WA 4BBSH 4H0LC 2RSNA 1QVCA 1VQAA 2YV5A 4GOPC 2VB2X 2K75A 3JAMi 1GUWA 4HR7B 2ATWA 4N8X1 1CHPD 2EDGA 2F0FA 1GXDC 4NDXA 5KNDA 1K3BC 4LF7Q 4DPGA 1YJ9A 2CW0C 1A3VA 2PQAA 4B9XA 2F0GA 1OXTA 1WVLA 3UDFA 1C8CA 5DM73 1UEBA 2B2YA 1A2TA 1XNQL 2O5JC 2B2TC 2EQSA 1WI5A 2R93H 1KTKA 1HNWQ 1EY5A 4IQZA 4LF6L 4K0KL 1TT2A 1EEID 4JCVE 2NZHA 1YITA 3S15H 4XIGS 4CJ0B 5BN3A 3KFUA 1CA5A 3HRZC 3HOZB 3F2BA 5CV7A 1K9MC 2RDHA 1PRTC 2LXKA 4P73A 3PIOA 1PH7A 2QW7A 3K5OA 4XYOA 1WTVA 3Q23A 4X62Q 3HOUH 2IHEA 2IT1A 1PZKD 1SJED 2X6LA 4CKEA 3NTIA 4Y52H 2Q8TA 1BBXC 1DXMA 1TWGH 2F52A 1EU4A 4PZ7A 3STBD 1AZQA 3I4LA 3FPPA 4ZAIA 4NMZA 4RG1A 4F7XA 3GTJH 5EBCA 2PW7A 1SRUA 5E4WC 2RKSA 2SEBD 1IBML 1PH5A 3WOFA 5LMNL 3AU7A 3A54A 5E7NA 5M9OA 1WTRA 2E2IH 1WTWA 4LF5L 3H0GG 4RAUC 1SNMA 4EQOA 1WJJA 1I50B 5J3BA 4JI7L 4GOPB 4RHRA 1LT3D 1KQSA 1U4MA 4L5TA 4CJ1B 2K52A 2K5WA 4YCUA 3MXNA 4RKLA 2K5QA 3HOVB 4NPSA 2KBNA 3IFTA 2G9DA 1VQ5A 1GO3E 1SEBD 3KJOA 4BA2I 2CQAA 2J0TD 1EU3A 4PG3A 1SLJA 1F2LA 2ASBA 1I4RA 4IO9A 1S5DD 3TS0A 2BH2A 1PA6A 3BU2A 4WORA 4FYDA 3PGZA 5E1FA 1HR0L 5IWAL 4OL7A 2PNHA 1CUKA 5EJWA 4DV3Q 1X56A 3RZOB 1SNQA 2VB3X 4EGVA 1YHQA 4LW1A 3D8GA 1XWEA 1PRTB 4XQJA 3MXPA 2F0PA 2VUMG 4OONA 2WB1E 2J7ZA 3HOZH 2OQ0A 4Z9CB 2MFIA 1VQCA 1KIXA 4AYBE 3NBIA 1LTAD 2JA6G 3UE1A 2JA8G 5D3IB 3D31A 3J80i 2Y0SG 3CC7A 1D7QA 3GO5A 4ODGA 1PVOA 4WJ4A 3M4QA 2EYMA 5IGCA 2QDLA 5FLXE 2L11A 5ISRA 1WTXA 2UU9L 1B53A 1VQKA 2KCNA 1K3RA 4NB3A 2F0TA 2D62A 1JE4A 3S1QB 1QWYA 4YHHQ 3IFDA 4WJ3M 1H95A 4K2KA 3CCVA 1VQDA 1UE6A 4R1JA 3CCJA 4DV6L 2VNUD 3M9BA 5M3MG 1TQOA 1X6OA 5JAVA 1RTNA 4X65L 2NVTB 3I3CA 2LXJA 1HPCA 1I50H 3CC4A 4DR6Q 3A0JA 4RHSA 3S14B 1MHWC 1H9MA 2Q2IA 1HRJA 1N32L 1K73C 1UE7A 3KOJA 1R9TB 4FF1A 3HOVH 2BCOA 3VDYA 2A68C 2LY7A 4HSPA 4YWKA 4DFAA 1VQ4A 2L0CA 3K8AA 2F0OA 4M8AA 4OHJA 2NVXB 3OHXC 4RKBA 3FHWA 4DK6C 2ZXRA 1F9QA 3AB9A 4H13C 3RD4A 4JBJA 4Q5VA 4UP9A 4BBRG 1Q82C 2QILA 3W1BA 3RZOH 2CWPA 1BDOA 3FPUB 4RCOA 1PXUA 4B9WA 5KGUA 4UPAA 2N78A 1EWHA 1A0IA 1SSOA 1A3UA 1VQHA 5CORA 1G2TA 3OWFA 1RD9D 1K8GA 1B3AA 2Y0SE 1DZ1A 3PUWA 2FMMA 3CCMA 3H0GB 1E24A 4IPGA 3Q24A 1PV4A 1XNQQ 3N6RA 2L9HA 4DKAC 2PZUA 1T5XD 1MGSA 1HCZA 4LF6Q 4K0KQ 1V1PA 1WTQA 2QEJC 2H5XA 1KHIA 2TMPA 4X66L 4U673 5DLQE 1XJVA 1F9RA 2ALYB 3S1QH 2WV6D 4C3HG 4LMQD 5C0XG 1EY0A 1PFMA 1SN8A 2F0NA 4FNFA 1CKMA 2NTSA 3A8KE 2YYZA 5F2DA 4IURA 1E2VA 2D5DA 1VMCA 1SNPA 2NVTH 4ZYSA 1D5MC 1N36Q 3MEFA 4POFA 1VQJA 1MJCA 1PFNA 4JPBW 4QMGA 3S14H 2WAQE 3LNNA 5KIXA 4GKKL 2UXDL 3E3XA 1IBMQ 5IT9L 3PCOB 5LMNQ 4A93B 1R9TH 3DXJC 3CRLC 4ZQ3A 2VUMB 3QIAA 1G6ZA 4LF5Q 5C4XB 2D2CC 3RLOA 5JEAG 1VQ9A 2K01A 1LO5D 3M4YA 3W1GA 1HR0W 2JA6B 1YI2A 4JI3L 1J6QA 2Y0SB 4DNIA 2JQOA 5M3FB 3HFZB 1B4OA 1T9HA 1SE2A 3PIP3 1JE5A 3FRPB 4V0BA 4DV4L 3EROA 3DM3A 4DU9A 4QGUA 3HKZE 2E5LL 1VQIA 3EA6A 3ND9A 4DA2A 5IP7G 1STBA 4HJ7A 1LTGD 4G7ZC 2IX0A 4N8FA 1EUJA 3O13A 5M3MB 2UUAL 4C3JB 4DUZQ 3LWEA 1PH4A 1K0RA 1SNDA 1HR0Q 5IWAQ 3H0GH 1SNCA 1FNWA 4ID6A 4DGZA 1WFQA 5CBEE 2HDLA 1S5ED 2G5DA 1LTLA 3STBC 3R93A 1X54A 1K28A 1TXYA 4ME3A 4ZCKA 2F0DA 2XWJB 2IX3A 1JWUD 1CKNB 2DGYA 1NAPA 2EY6A 3U9OA 3QR8A 5CR3A 2WAQB 4IUQA 2PZWA 3QWNA 4ABNA 3DHQA 3BZKA 1H9SB 2F0WA 5G3LD 1HQMC 3CF5A 1VF7A 2L5TA 2L12A 5CV9A 1FJGL 2SNSA 1YHAA 2UU9Q 2EY1A 4NW2A 4XYQA 5E3FA 4BBRB 1MSHA 4QIWB 2PNRC 4QQBX 2ZXOA 3IRBA 1EQTA 4DV6Q 3EQLC 4K8IA 3VR6A 3C2PA 1GKHA 2ZTDA 2VUMH 4TVAB 3D4DA 3HKZB 1EYAA 2GA4B 4G57A 3S9WA 4LFCL 4MTNA 2EYJA 2BOSA 4X65Q 1GOZA 3UI2A 5KNBA 5KYIA 3P75A 1TY2A 4UP7A 4U68A 2JA6H 4KV6A 4IJLA 1BVSA 3JAML 3TBIB 2JA8H 4QF4A 1IYUA 4A3LG 2F3VA 1I4XA 4GLVB 2J4XA 5D3DA 2UXCL 1N32Q 2A73B 3K0YA 4BS9A 4A3FG 2PQAB 3CHBD 1EIGA 2AHOB 4R4OA 2RQXA 3MC0B 4DR2L 4KN4C 4C3HB 3CMAA 3I2ZA 1TIID 1LTID 5EKLA 1WYDA 3DWQA 4OO1I 4EX5A 1IW7D 5M3MH 4GNXC 3G4SA 2B8GA 5ELFA 4HJ8A 2AUJD 4AH6A 3D0FA 1KRSA 2K1BA 4RMFA 1KAAA 1SNOA 5CV8A 1Q12A 2EJMA 3EBEA 2FJ2A 1S5FD 3RLFA 1EYCA 4L6TB 4LF8L 5C5MA 1U0LA 1NSNS 2OXPA 5GQOA 3MAQA 1C9OA 1HA6A 4RH6A 2EJFC 2SOBA 1PYSB 3L9AX 2P5ZX 2QCPX 3A5ZB 2CHBD 4P75A 1AH9A 1TWHB 3WWVA 2MPMA 1SXTA 2K6AA 3NENA 2K50A 3MZ5A 4KD4A 2KHSA 2F0JA 4Q0FA 3EJIA 2XGTA 1DONA 4X66Q 4DAPA 2B2UA 2Z6KA 4WFN3 1EIYB 2YU9B 1SYFA 1NR2A 3ULPA 4BBRH 3KLSX 4J1MA 1Q46A 4R4CA 2O2LD 3ONAB 1Y69U 5BN5A 3ERSX 2WACA 1YZ6A 1FVIA 4OXPA 5I2XA 1HXYD 3C3LA 4JI0L 2ICEC 1HQRD 1U9RA 3L3OC 5IOCA 1B3QA 2IX1A 1CZWA 3F2UA 1QZHA 1GVPA 1LYLA 1F9PA 2F0QA 1ILQA 5IGDA 2BE5C 1X3FA 1GHJA 2R93B 4A3KG 2WP8J 2JA7G 4GKKQ 4A3MG 2UXDQ 1Y1WG 2I0QA 1WCMG 1JWSD 3VA7A 5HGQA 4JV5L 1EFID 1ICFB 1CT1D 4H44C 5C4HA 1E1OA 1RF2D 4LUOA 5HURA 4C3HH 2QEXA 4GNXB 5C0XH 1NCVA 2AQ2B 3KDFA 2WKDA 3OMCA 4JI3Q 3A74A 4DR4L 2VY3A 2BDNA 5T1IA 3VYUA 1PZID 2VXWA 4S3SA 3UDGA 1J5EL 4IN3A 1ET9A 3BYTB 1Q7YC 4HIMA 3J7A5 4DV4Q 1SE8A 3J81j 4EQNA 2HQEA 5FO9B 2E5LQ 1AW7A 1I5FA 3AMUA 5KYLA 5ELCA 4UAIA 2EIFA 3F2CA 4JG2A 1G51A 5I9OA 1EY6A 2AQ3B 1I4HA 3J80L 2KCMA 3NWSA 2UUAQ 1VQ6A 2XWBB 4DR3L 1RL2A 3NHHA 3OWEB 4QJFA 1TVXA 4UHVA 1PH2A 3SVMA 5JEAH 1QVFA 1TWHH 3F8TA 3TP6A 2VQEL 3KLRA 3T56B 3AFPA 3S1MB 3DMUA 3C1FA 1E7ZA 2KECA 5K5PA 1BCPF 3I90A 3CC2A 4DN4M 3PV0A 2YU9H 3KLWA 4ZRZA 2VW9A 3G71A 4IFDI 1GUNA 1S5BD 1PH9A 5IP7H 1FJGQ 5A35A 5FJ8G 3RNUA 4YCVA 3J7AF 3SEBA 3FKIG 3BS1A 3A55A 4RGOS 4FXDA 1X3PA 1D1KA 2A8VA 5FLMG 2EZVA 3RR5A 2UUCL 1SYBA 2F03A 1ASYA 3A56A 5FO7B 3J81c 2C9OA 1S3OA 3PF4A 3ER0A 2PI2E 2BH8A 3I91A 4N9TA 3RUZA 1CFMA 5M5XB 2R6GA 1KDBA 3MXUA 5AFWA 3FEWX 4LFCQ 1S72A 1AN8A 4E6IA 1PFBA 2A6HD 4L5RC 1H9KA 1SYEA 1HUMA 2BDOA 3HZXA 2OF1A 4ME5A 3MA2B 4K5VA 3VR4A 1LTTD 1M1KC 3H3VC 2UXCQ 3EVQA 1B70B 2HD3A 5DM63 1XXGA 2NB0A 4GLAC 5JJLA 1TU2B 2I5HA 5CV4A 1Z47A 4NKLA 4XT3B 2XN9C 4DR2Q 2ENBA 4KY7A 1PTOF 2DY7A 1TWAB 4DF7A 1J9OA 4OWXB 5IIFA 2LMCB 2D0PA 3OIQA 4QY7A 3RN2A 5LL6S 1OXSC 1Q1EA 3D4RA 2QKIC 2C35B 4JYAL 2N3SA 1N34L 1GUSA 4LF8Q 2OCEA 2PMZB 3S1MH 1QZGA 3A5UA 4DR7L 1CSQA 3D6CA 4A3LH 4A3KB 3H91A 2D0OA 4A3MB 1QUQA 2F4IA 4DV5Q 4C1NK 1YIJA 1Y1WB 1IBKL 1WCMB 1AP0A 4EQPA 4KTAA 2F4VL 1LTSD 5LL6X 3D6WA 1E2ZA 2AKWB 1O7IA 4A3FH 4G7OC 1EYDA 2EOTA 1XTDA 1TR5A 1F2ZA 1HFNA 3F2DA 1UAPA 1A3TA 1YNXA 2L15A 1ILPA 4K2LA 1I94L 3D3RA 1JOKA 4DV7Q 5JJZA 4JBWA 3X3MA 4A4IA 3OW2A 3CPWA 2MO0A 3E0JA 1YNND 4K6DA 5EGTA 5M5XH 2EJGC 1RODA 1HFGA 3TRZA 1EIHA 1ZYRD 1PYWD 4A3EG 1QCBD 1LUZA 1QILA 5M5YB 2IY5B 1IW7C 3I70A 1FGUA 4NXNL 3BZDB 1YBYA 4K5WA 3SXHA 3GTPB 4DXGA 2K5DA 1TKWB 3OIPA 3NXWA 5GAGC 4JV5Q 2PCFB 1VQFA 3NQIA 1G291 2CH4W 4A3IG 3OTOL 3PO2G 1L1OC 5TSSA 4KMUC 4IPDA 1TWAH 4CDFC 4A3BG 4JOIC 5EPKA 1W6JA 5CV6A 4X64L 3CD6A 4DR4Q 4J15A 4KJNA 3GTKB 4P72A 4A76A 3J7YW 1J5EQ 5J22A 1VQGA 3FKIB 4V190 4DAYA 4P74A 2RBMA 1ESFA 3R8BA 1FNVA 2IL8A 3KF6A 1SYGA 4I65A 2HHHL 4A3KH 2JA7H 4HIKA 4A3MH 4MTKA 3R2IA 1Y1WH 3AFQA 1WCMH 4AQYL 4DR3Q 3T1HL 5FLXc 4G7HC 3PF5A 1R4PB 1WTOA 4QL5A 1MBYA 5IYCG 2F0VA 1BUVT 2VQEQ 4ALPA 1XMQL 5IE8A 3T51B 5E4XA 5BN4A 4QUFA 1Q8KA 2B2UC 4OX9L 1QJOA 2RA4A 1HTLD 1I6VC 2BE5D 3VA5A 3KBGA 1N8RC 3PO3G 3HOXG 1XPUA 1Y1VG 2OQKA 4B3TL 3VR5A 1AZPA 3GTGB 4X3KA 4NP5A 1X9NA 1EFWA 4PNYA 2K28A 2KHJA 1ENFA 4OIKA 2OTLA 2I07B 5IGFA 3J81i 3OMGA 4I7AA 1DJRD 4F87A 2H1EA 3MXGA 4LJZC 2A6ED 4R8IA 5AJ3L 1BXTA 1U4LA 3NEMA 2X6GA 1SR3A 5IT9E 2JJQA 2JN4A 3TP7A 5M5YH 4P71A 3H3VH 3H09A 2HT1A 2UUCQ 4C1NI 1O7ZA 4XXEA 3CCSA 2GVBA 3CCUA 4A3CG 3GTPH 2M2LA 4JC0A 4JI8L 1BQQT 1HNXL 4ILWA 3TZUA 1KLUD 1FD7D 1WTPA 1SE3A 1L1OB 1AFPA 2L55A 3B6YA 4HJ5A 5LMNW 4BWGB 1KNEA 3GTMB 1T5EA 3K5NA 1PDQA 1HZAA 2R92G 5EKIA 2KEEA 3QG1A 2DNEA 1RIPA 2G9HD 3NPPA 2FINB 4RWSC 4DV2L 2HDMA 5EBDA 2B2WC 2JK8A 3HEJA 4LAAA 3NK9A 5FJ8H 3GTKH 1KDCA 3M3YB 1KNAA 1VF5C 2K5NA 1UE5A 3DEOA 3FKIH 4X6AH 4B3RL 1I3QH 1DGSA 5C44G 4FF2A 4EQ5A 5JJIA 1CKOA 3QB3A 4GOPA 2A74C 2I46A 5FLMH 4K6LA 2KQ3A 2N8NA 3L2PA 1E2WA 3KLSA 2RSOA 1KRTA 4DUYL 3S17B 1VQMA 1JQYD 5I2YA 4JBKA 3K5LA 5DAUA 2PI2A 4XDXA 4A3EB 2K14A 3TS2A 1DYQA 2AMCB 4GN5A 4LUVA 4JYAQ 1N34Q 4JI7Q 2VQFL 3EFXD 1IHZA 3ERQA 2JA8B 1EZ6A 4DR7Q 2LS01 2B2TA 1U4PA 3A7LA 4QIWE 2X69A 4LK1C 4GZYC 1IBKQ 5FO8B 2DUDA 2PZTA 2GN5A 2WFWA 4APVA 3ICEA 2F4VQ 2RDGA 1SROA 1O7YA 2XRQD 4Y7NB 1A62A 4L5SA 3GTGH 4PQXA 1SAPA 5C3XA 4A3IB 1ICWA 1Q3LA 2EY2A 4KHZA 4JI5L 3PO2B 1JC7A 5C4ZA 3T1YL 1TS5A 3KK7A 2YTVA 4A3BB 4FO2A 2A6HC 1LTRD 3Q6SA 4HAEA 4KHVA 2CCZA 4QCLA 4TSSA 4DK0A 1F9SA 2B2YC 5K36G 1I94Q 4R4IA 4TRDA 4DAVA 3L7ZC 4JW0A 1C0AA 1FNUA 3FDTA 1V8QA 4JI2L 2XNAC 3BDOA 1PHJA 1TWCB 4A3GG 2NVQB 3JAME 4YIJA 1N9WA 3U4ZA 2NZOA 1KD1C 1OXXK 2K7VA 5JOBA 1XPOA 3GTMH 4IFDJ 1JT8A 2L1BA 3TEHB 3E9HA 4A75A 3UDXA 4CGYB 3CCRA 1RKNA 2VZAA 4L5QA 4UDUC 3I4MG 4PZ6A 3BG3A 2Z6BA 5LHY1 4NXNQ 3G48A 3NBHB 4HJ9A 3M3YH 3CCQA 4CHTB 1DM0B 4JI1L 4MIUA 3M4OB 1DOKA 1E1TA 2JA5G 4PV1C 4HMIA 2EE1A 3GTQB 3PO3B 2A19A 2LSSA 3OTOQ 3HOXB 4AIMA 2EXZA 4JK1C 1MKHA 1EY7A 1VDZA 1BBUA 1TS2A 2F1MA 3R2TA 4HSVA 4X64Q 3S17H 3HOWG 1D8LA 4C2MB 2Z9HA 3FP9A 2EVBA 5CBAE 2QF7A 4A3EH 1HZBA 5DEHA 1Y8NB 4R9WA 1QG7A 4MHEA 3HP3A 4O1NA 3AYHB 1L0WA 4ZLTF 4LF4L 4CJ2C 3PUVA 3VYRA 2C5CA 3KYHC 1IZ6A 4IUPA 2HHHQ 3UDIA 3U4VA 1PH1A 1HNWL 2F0IA 4AQYQ 3T1HQ 3CPFA 4CDEC 1LT4D 1YNNC 5DNFA 3NELA 4GN3B 4C3IG 4Y7NH 1IYJB 3EIVA 1NJIC 4A3IH 2E76C 2LKVA 1ZYRC 2D9UA 2B39A 4WJWA 3PO2H 2R92B 3BZCA 1NBWA 4ULLA 1XMQQ 5NUCA 3W5OA 2F0KA 4A3BH 1PRTF 2CVRA 1GD7A 3S2HB 1X65A 4OX9Q 5ELNA 4QB4A 3EN2A 5IODA 2SDFA 2ZJRA 4XTCS 1V43A 1YEZA 5C44B 1OXVA 2DY8A 1GUTA 1TWCH 4R8NA 3A8JE 2NVQH 3DWAA 4DNRB 4IUNA 5AJ3Q 2B2VA 2NZ1D 3N52A 1YNJD 3CCLA 1JWMD 2MUYA 1ESRA 1EQQA 5IYBG 1JICA 5COYA 1FGBD 2MHVA 1VQEA 2XVSA 5IYCH 1EY8A 3K5MA 3VR2A 4KLKA 2E75C 3SHLA 2Q2UA 1STGA 4X3UA 4DR1L 1ZXTA 4JI8Q 1JJCB 2RHQB 1NUCA 3M4OH 3VR3A 4JI6L 1PMRA 2E2HB 3GTQH 2F3WA 5FK9C 1BF4A 3AQQA 1Z7TA 3HOXH 3PO3H 3ULLA 1A6XA 2MO1A 1Y1VH 3BDLA 1Q8IA 3VYTA 2HIXA 3K7AH 4DV2Q 2WIIB 2F0LA 3FMCA 1IKMA 4UY8C 3FVQA 4C2MH 3PIPA 3S1NB 3BVGA 4DXFA 1BCPD 5CV5A 4B3RQ 1KABA 2E8GA 3J80E 3Q0AA 3CMEA 1E0BA 4A3JG 1PH8A 3MXNB 3KUPA 1F2MA 4I7ZC 2K05A 1K8OA 4DUYQ 2Q8IB 4A3CH 2MNAA 2ZXPA 4A3GB 1SYCA 1IBLL 4RA8A 5IP9G 5LMUL 4NXML 2RCFA 1QB5D 2NUCA 5FKAC 1Q1BA 2A6EC 2R92H 4OO1G 1QNUA 1D5ZC 2VQFQ 1CQVA 2M00A 3I4MB 1GHKA 4OELB 3S2HH 1CQFA 3ZYYX 1VQ8A 2KEDA 1VQNA 3P1HA 5L37A 2Z4HA 1DCZA 2JA5B 5C44H 1CHQD 2BA1A 3J80c 1Q86C 5GAHC 2V4DA 4JI5Q 2UXBL 4ZKBB 2RF4A 3TDQA 1TY0A 5C0XJ 3T1YQ 1LT5D 4RFBA 1MD2D 5A2QE 3S2DB 3HOWB 2K03A 1CI3M 1I6HB 4IZ8A 1HJPA 1YJWA 1I4GA 4FF3A 1H9JA 1A2UA 2CFMA 4JI2Q 2OWOA 4LFAL 2R3ZA 1C4QA 1E22A 1CA6A 1SFOB 1PTOD 3K81C 3SR1A 1L0YB 2BA0A 2KA7A 1KDAA 2PO4A 1XMOL 3KBXA 3ND8A 4ZUJA 1GUOA 2E2HH 3M7NA 3A7AB 1P8LA 1QOHA 4C3IB 4G4KA 4A3FB 1RHPA 4RGMA 4KI0A 5JEAJ 1PFSA 4TKOB 2B29A 4KY6A 3V96A 2I5MX 1KXLA 2O4XA 4DV0L 1EOVA 2CKZB 3S1NH 3I8ZA 1UNSA 3BYYB 2PMZE 4JI1Q 4B3ML 2E74C 1Q90A 2B63G 4KN7C 5EAYA 5K36H 1EZ8A 4KKSA 3GD7A 3NQTA 4BY1G 3NE5B 5A2QL 2F0MA 4ZUIA 1AE2A 4TQUS 1PLFA 4KK7A 3KF8A 4A3GH 4YCWA 2N49A 4RCNA 2N88A 3MHBA 1NR4A 2KHIA 3URYA 2B3GA 3MWYW 1G8ZD 3CQZB 1S5CD 2L4NA 3CRKC 4LWCA 2F0UA 1HHVA 1PZJD 3SK4A 4LF4Q 4CDCC 1B1ZA 3PMFA 4R4TA 1SDFA 4LUZA 3I4MH 2HUGA 1V9PA 4IJHA 1LV9A 2ZTCA 1KL9A 2RVLA 5CMDA 5GADC 1N33L 4MNOA 1I4PA 2N55A 3DUZA 2RDFA 3J81L 2JA5H 1BO0A 2PYKA 2E2JB 2MGSA 2Z8LA 3T13A 1HUNA 3S24A 3GQBA 4O42A 4YY3L 3S16B 2I5LX 3H15A 1CK1A 1XTCD 1K0SA 2WB1G 2PW5A 4DR5L 3PUXA 1DOLA 1LM0A 2NN6I 3TN2A 4HIOA 4AYBG 3S2DH 3HOWH 4WRDA 5IYDG 4GLXA 4FXKC 5ELOA 2A69D 1I6HH 3HGBA 1V1PB 4B08A 1UE1A 1D1IA 1L0XB 1EQRA 1SFOH 2AWOA 2Z4IA 5JPMC 4A3JB 3LGJA 2JSOA 3SGIA 1N36L 1LTBD 2KENA 2JA7B 1HZ9A 3K80C 3T53B 3I4NG 4IFDG 1AEXA 4C3IH 1UUPA 1K83B 4BXXG 4HCSA 4KKUA 1VS0A 4H7BA 3Q8DA 2Q2HA 1YHBA 4DR1Q 4K8JA 5HGTA 2XIWA 5HY6A 1VQOA 4FXGC 3MFGA 4JI6Q 1TS4A 2K5VA 3I56A 4DV1L 1GM5A 4J8QA 2UUBL 2JXMB 2SNMA 1IL8A 2B8FA 3CU7A 4FP5D 2WINB 3G6JB 3WDNA 4L8JA 4EVOA 3CCEA 1KLGD 1ENAA 3NTHA 4JI0Q 2ICIA 4PMCA 2RHSB 1MSGA 2EPBA 3C1EA 3CQZH 1BOSA 4DUZL 4GNXA 3E5SA 5IYBH 1STYA 4OWWB 4FF4A 1R4QB 4A3DG 4JI4L 1Y14B 4FVMA 3OW7A 2K4KA 3JC66 4HJAA 1CTMA 4HEDA 4A93G 1IBLQ 2R7DA 1A8VA 4FDBA 3X3NA 1D5XC 5KEEA 5LMUQ 5C4XG 1RCVD 4XQQA 2E2JH 4NXMQ 4IUTA 2NN6G 3S16H 2K5HA 5ELEA 4LFBL 1YNJC 1C7YA 1EY4A 1M4VA 2KUMA 5M3FG 3E6ZX 2FFKB 3RLNA 2XTIA 1PH6A 2WKCA 1O78A 2B63B 1I3QB 3WOEA 2HQLA 1FYCA 2ZJPA 1AE3A 1NMFA 4BY1B 4A3JH 2MQHA 2UXBQ 2MJ8A 1EQVA 2CH4A 2B2VC 3BVZA 3T4AC 2HCCA 5JJKA 2K04A 3DEPA 5C0XI 3RZDB 4CKBA 3SE0A 4C3JG 3OOCA 5IP9H 2JEBI 1VQBA 3DWPA 1K83H 3UE0A 1IL2A 4LFAQ 3K59A 4OO1H 1BCPC 2Z0SA 3K58A 4K5XA 4OEMB 2A5HA 2EYHA 3CP0A 1GUGA 3SDZA 2Z6KC 3GTLB 1XMOQ 3H94A 4QUCA 2PPBC 1S4ZA 2F0HA 1SMYD 2V1CC 4DNTB 3QOJA 2WAQG 2ZJQA 1BBWA 3TREA 1STEA 2KVMA 1CZGA 2R7FA 2WB1B 1WD0A 5FLXL 1LACA 2EYFA 4DV0Q 5EKKA 3HG9A 3IKJA 4C56C 4BY7G 4AYBB 1DOMA 2NBFA 4B3MQ 4ZK9B 2JYOA 5IGGA 1K8AC 5EQ0A 1LLRD 5ELBA 1HH2P 1RDPD 1NY4A 1JCKB 2XSCA 3CAMA 2NTTA 2R7ZG 1BR9A 4H02A 1G91A 4IPHA 1FR3A 1F77A 3TMEA 3HKZG 3I4NB 1EY9A 3R3OA 3I4OA 3K0XA 3IAYA 3CKIB 2EYOA 2QGQA 1B9NA 3U50C 3F1ZA 3K7UC 1KC8C 5CGKA 3BDCA 1W3SA 1X3QA 5I6WA 5GROA 4GKJL 3DM1A 1N33Q 3E9IA 4LNQA 1LABA 1PTOC 2B63H 4YY3Q 5IT9c 1ET6A 4BY1H 3G6EA 3NP8A 2JP1A 4DR5Q 5M5WB 1X3EA 4LF9L 2YTXA 2ZM6L 2HIVA 5BR8L 1HNZL 3K6OA 2QDBA 1QVGA 3RZDH 4HIDA 1BCPB 1A63A 4RGTA 3GV3A 3ZJYC 3QOLA 4L63B 1DD2A 1VQ7A 2JA9A 5FOBB 1PH3A 1XNRL 2CQOA 2PQEA 3QO2A 3V05A 2NWGA 4DAMA 5JVG3 1B44D 4A3DB 1X32A 1STAA 3LWUA 3NUCA 1EEFD 5C3EG 1MJEA 2KOLA 1VMPA 3GTLH 1NMGA 2NVYB 3HOYG 1L2FA 2DNCA 1Y8OB 3NSWA 1CSPA 3HS0C 2CW0D 3HKSA 1ASZA 1TWFB 3J7AV 1Q81C 1EL0A 1V1OA 2NVXH 4B3SL 1SE4A 5J39A 1IXRA 3ULJA 1RJTA 5GAEC 4BBSG 3T16A 2Q2TA 1JMCA 5IYDH 4DV1Q 2UUBQ 4KHPL 1WOCA 2IW3A 5J1ZA 1HA5A 2NYZD 2IJ0A 2H4OA 4HTHA 3I72A 3W3AA 1NNXA 1BKBA 2Q8RE 2Z1CA 5JVH3 4HMJA 1Z9FA 1I4QA 1PRTD 2VS1A 1IYVA 1JB7A 2AUKA 3KDFB 3I4NH 4IFDH 4IALA 1NE3A 2RCNA 1JORA 2AWNA 1ZEQX 1JOQA 3DLLA 4M1UB 2GVAA 1VQPA 4BXXH 4JI4Q 2A69C 1P16A 1MIUA 4P2CB 1PTOB 3NWTA 1HTPA 3QJYA 2R93G 1U5KA 4K14A 1EOTA 2IPKD 3S1RB 1CM9A 2EXDA 1JOOA 4X3SA 4KJOA 1G6PA 4IOCA 4YWLA 3P7JA 1UEAB 1Y1VB 1SBBB 4LFBQ 4XQNA 4O2DA 3GTOB 3A8IE 3I73A 3K7AB 1OO9B 5M5WH 4N9PA 3E0EA 3SK8A 1B50A 3HOUG 4LF7L 4XT1B 2E2DC 1X3GA 3K57A 4RGNA 3JAMc 5I4DA 4BY7B 1K8MA 3GV6A 2EY5A 5IY0A 1QE6A 4MN3A 2OEOA 2F0EA 4A3DH 3NTKA 2R7ZB 4IUVA 5IGBA 5C4JB 4DK1A 5JPNC 4GN4B 2NVYH 1E3PA 3M4PA 4A93H 1VQLA 1O80A 4MZ9A 5C5LA 4POGA 2AQ1B 5D14A 5C4XH 3CXCA 1TWFH 2NN6H 3VYSA 4CKCA 4OWTB 2K32A 1B8AA 3MFYA 2IWHA 4PMBA 4X62L 1G2SA 1IKLA 5M3FH 4YWMA 3OYYA 4F88A 2TSSA 1B2TA 2OTJA 2FHTA 1W6KA 1OXUA 3KF8B 3RN5A 1Y8PB 3CW2C 1SYDA 4B3TQ 4IOAA 3MEHA 3L0OA 4PZ8A 4UP8A 4GS3A 1L1OA 1A15A 1STHA 2M9VA 2ZT9C 4JOIA 3TSSA 5IGEA 4C3JH 3TP8A 1J8IA 2VL6A 4KY5A 1VCIA 5EPJA 4O0AA 1RTOA 4KD3A 5G3LF 5I9PA 1PTOH 3PIO3 5CC4A 2QA4A 3BJUA 1LT6D 3S1RH 2A1AA 1HNXQ 1ZKOA 3P20A 1GJXA 5C3EB 1OTCA 3TP5A 5KRUA 3HOZG 3HOYB 3OPOA 4DV5L 3PSIA 3GP7A 1XYIA 1F2YA 1BNZA 3GTOH 4R4QA 3BVMA 4KKTA 1XPRA 2EYPA 1SJHD 3G7LA 5CYUA 3H3VI 1EWIA 5H1SE 4GKJQ 3PUZA 1ENCA 4BY7H 4IUUA 3KJPA 4BBSB 1D6EC 1TS3A 5ELDA 5C3WA 2R61A 1QUQB 4DV7L 1X55A 4HCEA 4J6HA 3M7GA 3V2TA 2F0SA 4DV3L 2R7ZH 4PMWA 4LF9Q 5C4JH 2ZM6Q 1HNZQ 5BR8Q 1SMYC 2FXQA 2A68D 1JR0D 3C46A 1JB3A 1SMXA 5D65A 3AEVA 1C48A 2FMCA 2DJGC 2DN8A 4JBMA 3TZDA 1XNRQ 1JJ2A 2ID0A 1S40A 2LFNA 1W2BA 1EYGA 3SK6A 2EYLA 2ZTEA 2XRSD 3H6MA 1D2BA 4CDDC 3ITPA 1B9MA 2HCIA 4IPCA 2ES2A 3HOVG 3S15B 3M85A 3U58A 4ZKCB 4DK3C 3TQYA 1HZCA 4YHHL 3PUYA 4B3SQ 1ML0D 3Q22A 2IHFA 4F8MA 1MI2A 5T1GA 3GDEA 1NTGA 1PYBA 3OSOA 3MVVA 1YVCA 1U4RA 2OT2A 1CKNA 3HOUB 1O7LA 2B2WA 2JEAI 1UWVA 3LX0A 4OIJA 4X3TA 4KHPQ 1TWGB 1H9SA 1QNKA 1B7YB 1M90C 3IL8A 2KCCA 5KNCA 2K33A 2O5IC 3NBHA 1WD1A 1ONLA 4DR6L 1FL0A 3I7FA 1YJNA 5EPLA 3GTJB 2KCTA 1Z6HA 1V1QA 3U9SA 2JE6I 2CWAA 1II3A 3PQIA 5C3EH 3RMHA 5I6YA 1JJGA 3HOYH 4JVZA 2DJFC 3MTSA 4OGQC 2E2IB 1STNA 2F3IA 5C6AA 1EIFA 4CBVA 1KAWA 3I55A 3J81E 2YTYA 4DAYB 1EWCA 1H9RA 3J7ZC 1M8AA
chains in the Genus database with same CATH topology
2K4KA 4BA1I 3JC66 3CMAA 1KRTA 3I2ZA 4DUYL 4HJAA 1WYDA 3KF6B 1VQMA 4EX5A 1IBLQ 4OO1I 4A93G 2R7DA 1A8VA 4FDBA 4JBKA 4BBSH 5M3MH 4GNXC 3G4SA 2PI2A 5LMUQ 1QVCA 1VQAA 2YV5A 5C4XG 4HJ8A 4GOPC 2K14A 3JAMi 2K75A 2E2JH 4AH6A 4NXMQ 3TS2A 3D0FA 1KRSA 2AMCB 4GN5A 4LUVA 4RMFA 2NN6G 3S16H 2K5HA 2ATWA 1Q12A 4JYAQ 3EBEA 1N34Q 4LFBL 1C7YA 4JI7Q 2VQFL 3RLFA 4LF8L 4DR7Q 1U0LA 4LF7Q 4DPGA 4QIWE 5M3FG 1YJ9A 5GQOA 2PQAA 1C9OA 3RLNA 1IBKQ 2XTIA 1PH6A 1OXTA 2DUDA 2WFWA 2GN5A 1PYSB 3UDFA 4APVA 2F4VQ 3ICEA 1SROA 1UEBA 1A62A 4L5SA 2HQLA 3GTGH 2ZJPA 1AE3A 1NMFA 3A5ZB 4P75A 1XNQL 1AH9A 3WWVA 4A3JH 2MQHA 4KHZA 3NENA 2UXBQ 2K50A 2EQSA 4JI5L 1WI5A 2R93H 1HNWQ 3T1YL 4LF6L 4K0KL 2YTVA 5JJKA 4JCVE 5C0XI 2XGTA 2NZHA 1YITA 2CCZA 4X66Q 3S15H 4XIGS 5K36G 2Z6KA 3KFUA 5IP9H 1I94Q 4R4IA 2JEBI 1EIYB 1VQBA 3L7ZC 3F2BA 1K83H 1K9MC 1C0AA 3UE0A 3ULPA 2LXKA 4P73A 4BBRH 3PIOA 1IL2A 1PH7A 4LFAQ 4JI2L 1Q46A 4R4CA 2Z0SA 1PHJA 4X62Q 3CP0A 4A3GG 3ERSX 1YZ6A 1FVIA 3HOUH 2IHEA 2IT1A 4OXPA 2Z6KC 1N9WA 4Y52H 1XMOQ 3U4ZA 4JI0L 2NZOA 1KD1C 1OXXK 1TWGH 1XPOA 4IFDJ 2F52A 3GTMH 1JT8A 4PZ7A 2V1CC 3STBD 3TEHB 3E9HA 2WAQG 4A75A 1GVPA 3UDXA 1QZHA 1LYLA 2ZJQA 1BBWA 3CCRA 2VZAA 4L5QA 3TREA 4RG1A 3I4MG 3GTJH 2R7FA 4PZ6A 1X3FA 1SRUA 4NXNQ 4DV0Q 3G48A 2WP8J 3NBHB 4HJ9A 4A3MG 4A3KG 3CCQA 2JA7G 3M3YH 4GKKQ 2UXDQ 1IBML 1Y1WG 2I0QA 4BY7G 1PH5A 1WCMG 5LMNL 4B3MQ 4JI1L 2JA5G 1E1TA 5E7NA 2E2IH 1K8AC 5HGQA 4LF5L 4JV5L 3H0GG 2A19A 2LSSA 3OTOQ 1HH2P 1E1OA 1WJJA 4LUOA 4AIMA 1NY4A 3CAMA 4C3HH 2QEXA 4GNXB 2R7ZG 1MKHA 5J3BA 4JI7L 4H02A 3KDFA 4JI3Q 4GOPB 1BBUA 4X64Q 3S17H 3A74A 4DR4L 1KQSA 4IPHA 3HOWG 1D8LA 2VY3A 4L5TA 3HKZG 3FP9A 3UDGA 1J5EL 4A3EH 2K52A 1HZBA 4YCUA 1Q7YC 3I4OA 3K0XA 4HIMA 3J7A5 4DV4Q 1SE8A 4NPSA 3J81j 2QGQA 2KBNA 3AYHB 1L0WA 1VQ5A 1GO3E 3U50C 3KJOA 2E5LQ 3F1ZA 4LF4L 1I5FA 3K7UC 3PUVA 1KC8C 4BA2I 3KYHC 1IZ6A 1W3SA 4PG3A 1SLJA 2HHHQ 2EIFA 3U4VA 3UDIA 4JG2A 3F2CA 5GROA 1G51A 4IO9A 1PH1A 1N33Q 3TS0A 3E9IA 2ASBA 2BH2A 4LNQA 2KCMA 4AQYQ 2UUAQ 3T1HQ 3BU2A 3CPFA 1PA6A 4DR3L 1RL2A 1VQ6A 2B63H 3PGZA 3NELA 4GN3B 4QJFA 4Y7NH 1IYJB 1HR0L 3EIVA 5IWAL 1PH2A 1NJIC 2PNHA 4YY3Q 5IT9c 1CUKA 4A3IH 1TWHH 4BY1H 1QVFA 3F8TA 3G6EA 4DV3Q 3PO2H 1X56A 3BZCA 1NBWA 4DR5Q 2VQEL 1XMQQ 1X3EA 4LF9L 3W5OA 2YTXA 2ZM6L 2HIVA 3AFPA 5BR8L 1YHQA 1HNZL 4A3BH 4LW1A 1QVGA 1GD7A 1X65A 1E7ZA 3RZDH 4OX9Q 5ELNA 2VUMG 4OONA 2WB1E 3EN2A 4HIDA 2ZJRA 4XTCS 1A63A 1V43A 3HOZH 2OQ0A 3ZJYC 3CC2A 2MFIA 3PV0A 2YU9H 3KLWA 1VQCA 1HNWL 1KIXA 4AYBE 1VQ7A 1YEZA 2JA9A 2VW9A 3G71A 1PH3A 4IFDI 1XNRL 1PH9A 1OXVA 2JA6G 3UE1A 2CQOA 2JA8G 4DAMA 3D31A 1TWCH 2Y0SG 3J80i 5IP7H 3CC7A 1D7QA 2NVQH 1FJGQ 3GO5A 5FJ8G 5C3EG 1MJEA 1PVOA 4WJ4A 3M4QA 3RNUA 3GTLH 1NMGA 5AJ3Q 4YCVA 3HOYG 3CCLA 1L2FA 3FKIG 2UU9L 1VQKA 1EQQA 5IYBG 1K3RA 4NB3A 1CSPA 2A8VA 5FLMG 1VQEA 3HKSA 3RR5A 2D62A 1ASZA 5IYCH 2UUCL 4YHHQ 1Q81C 1ASYA 4WJ3M 3J81c 3CCVA 4KLKA 2NVXH 4B3SL 1H95A 2Q2UA 1S3OA 3PF4A 1VQDA 1UE6A 3ER0A 2PI2E 4DR1L 4R1JA 2BH8A 4JI8Q 3CCJA 4DV6L 1IXRA 2VNUD 2R6GA 3ULJA 1JJCB 2RHQB 3M9BA 5M3MG 5GAEC 4BBSG 3M4OH 2Q2TA 1JMCA 4JI6L 5IYDH 4DV1Q 4LFCQ 2UUBQ 1X6OA 1S72A 4KHPL 1WOCA 3GTQH 4X65L 3PO3H 3AQQA 3HOXH 2LXJA 3ULLA 2MO1A 1I50H 1Y1VH 4L5RC 3CC4A 2HIXA 3K7AH 4DR6Q 4DV2Q 1BKBA 3A0JA 4UY8C 4C2MH 2UXCQ 1Z9FA 3PIPA 1M1KC 2VS1A 1JB7A 2Q2IA 1N32L 3KDFB 3I4NH 1K73C 1B70B 1UE7A 3KOJA 4GLAC 1NE3A 2RCNA 5JJLA 3HOVH 4B3RQ 2AWNA 3VDYA 2E8GA 2I5HA 1Z47A 4YWKA 3DLLA 3CMEA 1VQ4A 3K8AA 2GVAA 4A3JG 1VQPA 1PH8A 3MXNB 4DR2Q 4JI4Q 4BXXH 1P16A 1MIUA 2R93G 1U5KA 3FHWA 4DUYQ 4DK6C 4A3CH 4OWXB 2MNAA 2EXDA 1KXLA 1IBLL 1G6PA 5IP9G 5LMUL 2D0PA 4IOCA 4YWLA 4JBJA 4QY7A 4UP9A 4NXML 3RN2A 1OXSC 1Q1EA 4BBRG 1Q82C 2R92H 1Q1BA 2C35B 3W1BA 4LFBQ 3RZOH 2N3SA 4O2DA 1N34L 4JYAL 2VQFQ 4OO1G 5M5WH 2CWPA 3E0EA 4LF8Q 2OCEA 4UPAA 1QZGA 3A5UA 3HOUG 2N78A 3S1MH 4DR7L 1A0IA 3S2HH 1CSQA 1VQHA 1VQ8A 4LF7L 4A3LH 1X3GA 2D0OA 1QUQA 3JAMc 1K8GA 4DV5Q 1YIJA 1VQNA 1IBKL 2Y0SE 2F4VL 3PUWA 5C44H 5IY0A 3CCMA 2AKWB 1O7IA 2BA1A 1E24A 4A3FH 4IPGA 3J80c 1PV4A 1Q86C 5GAHC 1XNQQ 4JI5Q 2UXBL 4DKAC 4A3DH 1XTDA 2RF4A 5C0XJ 3T1YQ 3F2DA 4LF6Q 4K0KQ 4GN4B 1YNXA 2NVYH 2L15A 1E3PA 2H5XA 3M4PA 4A93H 1KHIA 1VQLA 4X66L 4MZ9A 4POGA 1I94L 5C4XH 1HJPA 3CXCA 1YJWA 5DLQE 4DV7Q 1XJVA 4JBWA 2ALYB 1TWFH 2CFMA 3S1QH 4JI2Q 4A4IA 2OWOA 4LFAL 5C0XG 4OWTB 3OW2A 1SN8A 3CPWA 2MO0A 1B8AA 4GKJL 1E22A 1CKMA 3K81C 4X62L 2BA0A 5M5XH 2YYZA 5M3FH 4YWMA 3OYYA 3TRZA 4A3EG 1XMOL 2OTJA 2E2HH 1OXUA 3KF8B 3M7NA 3RN5A 3CW2C 2NVTH 4B3TQ 1P8LA 4IOAA 1LUZA 2IY5B 4KI0A 3L0OA 4PZ8A 3L2PA 5JEAJ 4UP8A 1PFSA 1N36Q 4GS3A 1FGUA 1L1OA 2B29A 3MEFA 4POFA 1VQJA 1MJCA 2I5MX 4NXNL 1YBYA 4DV0L 3S14H 1EOVA 2WAQE 4GKKL 2CKZB 2UXDL 1IBMQ 4JOIA 3S1NH 3PCOB 5LMNQ 2PMZE 4JI1Q 1R9TH 4B3ML 4C3JH 2B63G 5EAYA 5GAGC 4LF5Q 4JV5Q 1VQFA 2VL6A 3GD7A 3RLOA 1G291 5JEAG 4A3IG 1VQ9A 4BY1G 1VCIA 3OTOL 4O0AA 1L1OC 3W1GA 1HR0W 4IPDA 3PO2G 1AE2A 1TWAH 4TQUS 2QA4A 4A3BG 4JOIC 3BJUA 4JI3L 3S1RH 1J6QA 1YI2A 2A1AA 4X64L 4DR4Q 3CD6A 4YCWA 4J15A 1HNXQ 4A3GH 2N49A 4DNIA 1OTCA 4P72A 2JQOA 3HFZB 4A76A 1J5EQ 1T9HA 3HOZG 2KHIA 4DV5L 2B3GA 1JE5A 1VQGA 4DV4L 3PSIA 3DM3A 4LWCA 4P74A 4QGUA 4LF4Q 3GTOH 4R4QA 3HKZE 2E5LL 1XPRA 1VQIA 3KF6A 4R4TA 5IP7G 4LUZA 3I4MH 4HJ7A 1V9PA 3H3VI 4IJHA 2ZTCA 1EWIA 1KL9A 5H1SE 2HHHL 4A3KH 2JA7H 4HIKA 3PUZA 5GADC 4A3MH 4GKJQ 2IX0A 1N33L 1EUJA 4MNOA 3AFQA 1Y1WH 4BY7H 1WCMH 3KJPA 4AQYL 4DR3Q 2UUAL 3T1HL 5FLXc 4DUZQ 2JA5H 1PH4A 1K0RA 3PF5A 1HR0Q 5IWAQ 1QUQB 3S24A 3H0GH 4QL5A 1X55A 4YY3L 2I5LX 5IYCG 3H15A 4DV7L 2WB1G 4DV3L 1WFQA 2R7ZH 2VQEQ 4ALPA 4PMWA 4DR5L 4LF9Q 3PUXA 1XMQL 5C4JH 2ZM6Q 1HNZQ 5BR8Q 5IE8A 1LM0A 2NN6I 1LTLA 2FXQA 3STBC 1X54A 4HIOA 4AYBG 1TXYA 3S2DH 1SMXA 4ME3A 1Q8KA 3HOWH 4OX9L 5IYDG 4GLXA 3AEVA 5ELOA 1I6HH 1N8RC 3PO3G 3HOXG 1CKNB 1XPUA 2DGYA 4JBMA 1UE1A 1Y1VG 2OQKA 4B3TL 1XNRQ 1JJ2A 2ID0A 1S40A 1EQRA 3BZKA 2AWOA 1W2BA 1X9NA 1SFOH 1EYGA 3LGJA 2ZTEA 2KHJA 3SGIA 3CF5A 1N36L 1EFWA 2OTLA 3J81i 1FJGL 2KENA 1HZ9A 3K80C 3I4NG 4IFDG 5AJ3L 1YHAA 4IPCA 2ES2A 3NEMA 3HOVG 2UU9Q 3M85A 1SR3A 2JJQA 4C3IH 3U58A 5M5YH 4P71A 3H3VH 2HT1A 4DK3C 2UUCQ 4BXXG 3TQYA 1HZCA 4YHHL 3PUYA 4B3SQ 1VS0A 4QQBX 3Q8DA 3CCSA 2IHFA 2GVBA 2Q2HA 1YHBA 3IRBA 3CCUA 3GDEA 4DR1Q 3GTPH 1NTGA 1PYBA 4JC0A 4A3CG 1YVCA 4JI8L 4DV6Q 1CKNA 1HNXL 1GKHA 5HY6A 1VQOA 2JEAI 2ZTDA 1L1OB 2VUMH 1UWVA 2K5VA 3B6YA 4TVAB 4JI6Q 4HJ5A 3I56A 4KHPQ 5LMNW 4LFCL 4DV1L 4MTNA 1GM5A 2UUBL 4X65Q 1HZAA 1B7YB 1M90C 2R92G 4UP7A 1RIPA 2JA6H 4IJLA 3CCEA 1BVSA 4DR6L 4DV2L 1FL0A 2JA8H 3I7FA 1YJNA 2KCTA 2JK8A 1V1QA 2JE6I 2CWAA 4A3LG 3GTKH 5FJ8H 4GLVB 5C3EH 2UXCL 4JI0Q 1JJGA 1N32Q 3HOYH 2K5NA 2RHSB 1UE5A 3FKIH 3CQZH 4X6AH 4B3RL 4DUZL 4GNXA 1I3QH 2F3IA 1DGSA 5IYBH 5C44G 4EQ5A 5JJIA 4A3FG 2PQAB 1CKOA 1EIFA 1KAWA 4GOPA 3I55A 2AHOB 2YTYA 4R4OA 5FLMH 4DAYB 4OWWB 2IX1A 2N8NA 4DR2L 4JI4L 3J7ZC 4A3DG 1Y14B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4K A;  4BA1 I;  3JC6 6;  3CMA A;  1KRT A;  3I2Z A;  4DUY L;  4HJA A;  1WYD A;  3KF6 B;  1VQM A;  4EX5 A;  1IBL Q;  4OO1 I;  4A93 G;  2R7D A;  1A8V A;  4FDB A;  4JBK A;  4BBS H;  5M3M H;  4GNX C;  3G4S A;  2PI2 A;  5LMU Q;  1QVC A;  1VQA A;  2YV5 A;  5C4X G;  4HJ8 A;  4GOP C;  2K14 A;  3JAM i;  2K75 A;  2E2J H;  4AH6 A;  4NXM Q;  3TS2 A;  3D0F A;  1KRS A;  2AMC B;  4GN5 A;  4LUV A;  4RMF A;  2NN6 G;  3S16 H;  2K5H A;  2ATW A;  1Q12 A;  4JYA Q;  3EBE A;  1N34 Q;  4LFB L;  1C7Y A;  4JI7 Q;  2VQF L;  3RLF A;  4LF8 L;  4DR7 Q;  1U0L A;  4LF7 Q;  4DPG A;  4QIW E;  5M3F G;  1YJ9 A;  5GQO A;  2PQA A;  1C9O A;  3RLN A;  1IBK Q;  2XTI A;  1PH6 A;  1OXT A;  2DUD A;  2WFW A;  2GN5 A;  1PYS B;  3UDF A;  4APV A;  2F4V Q;  3ICE A;  1SRO A;  1UEB A;  1A62 A;  4L5S A;  2HQL A;  3GTG H;  2ZJP A;  1AE3 A;  1NMF A;  3A5Z B;  4P75 A;  1XNQ L;  1AH9 A;  3WWV A;  4A3J H;  2MQH A;  4KHZ A;  3NEN A;  2UXB Q;  2K50 A;  2EQS A;  4JI5 L;  1WI5 A;  2R93 H;  1HNW Q;  3T1Y L;  4LF6 L;  4K0K L;  2YTV A;  5JJK A;  4JCV E;  5C0X I;  2XGT A;  2NZH A;  1YIT A;  2CCZ A;  4X66 Q;  3S15 H;  4XIG S;  5K36 G;  2Z6K A;  3KFU A;  5IP9 H;  1I94 Q;  4R4I A;  2JEB I;  1EIY B;  1VQB A;  3L7Z C;  3F2B A;  1K83 H;  1K9M C;  1C0A A;  3UE0 A;  3ULP A;  2LXK A;  4P73 A;  4BBR H;  3PIO A;  1IL2 A;  1PH7 A;  4LFA Q;  4JI2 L;  1Q46 A;  4R4C A;  2Z0S A;  1PHJ A;  4X62 Q;  3CP0 A;  4A3G G;  3ERS X;  1YZ6 A;  1FVI A;  3HOU H;  2IHE A;  2IT1 A;  4OXP A;  2Z6K C;  1N9W A;  4Y52 H;  1XMO Q;  3U4Z A;  4JI0 L;  2NZO A;  1KD1 C;  1OXX K;  1TWG H;  1XPO A;  4IFD J;  2F52 A;  3GTM H;  1JT8 A;  4PZ7 A;  2V1C C;  3STB D;  3TEH B;  3E9H A;  2WAQ G;  4A75 A;  1GVP A;  3UDX A;  1QZH A;  1LYL A;  2ZJQ A;  1BBW A;  3CCR A;  2VZA A;  4L5Q A;  3TRE A;  4RG1 A;  3I4M G;  3GTJ H;  2R7F A;  4PZ6 A;  1X3F A;  1SRU A;  4NXN Q;  4DV0 Q;  3G48 A;  2WP8 J;  3NBH B;  4HJ9 A;  4A3M G;  4A3K G;  3CCQ A;  2JA7 G;  3M3Y H;  4GKK Q;  2UXD Q;  1IBM L;  1Y1W G;  2I0Q A;  4BY7 G;  1PH5 A;  1WCM G;  5LMN L;  4B3M Q;  4JI1 L;  2JA5 G;  1E1T A;  5E7N A;  2E2I H;  1K8A C;  5HGQ A;  4LF5 L;  4JV5 L;  3H0G G;  2A19 A;  2LSS A;  3OTO Q;  1HH2 P;  1E1O A;  1WJJ A;  4LUO A;  4AIM A;  1NY4 A;  3CAM A;  4C3H H;  2QEX A;  4GNX B;  2R7Z G;  1MKH A;  5J3B A;  4JI7 L;  4H02 A;  3KDF A;  4JI3 Q;  4GOP B;  1BBU A;  4X64 Q;  3S17 H;  3A74 A;  4DR4 L;  1KQS A;  4IPH A;  3HOW G;  1D8L A;  2VY3 A;  4L5T A;  3HKZ G;  3FP9 A;  3UDG A;  1J5E L;  4A3E H;  2K52 A;  1HZB A;  4YCU A;  1Q7Y C;  3I4O A;  3K0X A;  4HIM A;  3J7A 5;  4DV4 Q;  1SE8 A;  4NPS A;  3J81 j;  2QGQ A;  2KBN A;  3AYH B;  1L0W A;  1VQ5 A;  1GO3 E;  3U50 C;  3KJO A;  2E5L Q;  3F1Z A;  4LF4 L;  1I5F A;  3K7U C;  3PUV A;  1KC8 C;  4BA2 I;  3KYH C;  1IZ6 A;  1W3S A;  4PG3 A;  1SLJ A;  2HHH Q;  2EIF A;  3U4V A;  3UDI A;  4JG2 A;  3F2C A;  5GRO A;  1G51 A;  4IO9 A;  1PH1 A;  1N33 Q;  3TS0 A;  3E9I A;  2ASB A;  2BH2 A;  4LNQ A;  2KCM A;  4AQY Q;  2UUA Q;  3T1H Q;  3BU2 A;  3CPF A;  1PA6 A;  4DR3 L;  1RL2 A;  1VQ6 A;  2B63 H;  3PGZ A;  3NEL A;  4GN3 B;  4QJF A;  4Y7N H;  1IYJ B;  1HR0 L;  3EIV A;  5IWA L;  1PH2 A;  1NJI C;  2PNH A;  4YY3 Q;  5IT9 c;  1CUK A;  4A3I H;  1TWH H;  4BY1 H;  1QVF A;  3F8T A;  3G6E A;  4DV3 Q;  3PO2 H;  1X56 A;  3BZC A;  1NBW A;  4DR5 Q;  2VQE L;  1XMQ Q;  1X3E A;  4LF9 L;  3W5O A;  2YTX A;  2ZM6 L;  2HIV A;  3AFP A;  5BR8 L;  1YHQ A;  1HNZ L;  4A3B H;  4LW1 A;  1QVG A;  1GD7 A;  1X65 A;  1E7Z A;  3RZD H;  4OX9 Q;  5ELN A;  2VUM G;  4OON A;  2WB1 E;  3EN2 A;  4HID A;  2ZJR A;  4XTC S;  1A63 A;  1V43 A;  3HOZ H;  2OQ0 A;  3ZJY C;  3CC2 A;  2MFI A;  3PV0 A;  2YU9 H;  3KLW A;  1VQC A;  1HNW L;  1KIX A;  4AYB E;  1VQ7 A;  1YEZ A;  2JA9 A;  2VW9 A;  3G71 A;  1PH3 A;  4IFD I;  1XNR L;  1PH9 A;  1OXV A;  2JA6 G;  3UE1 A;  2CQO A;  2JA8 G;  4DAM A;  3D31 A;  1TWC H;  2Y0S G;  3J80 i;  5IP7 H;  3CC7 A;  1D7Q A;  2NVQ H;  1FJG Q;  3GO5 A;  5FJ8 G;  5C3E G;  1MJE A;  1PVO A;  4WJ4 A;  3M4Q A;  3RNU A;  3GTL H;  1NMG A;  5AJ3 Q;  4YCV A;  3HOY G;  3CCL A;  1L2F A;  3FKI G;  2UU9 L;  1VQK A;  1EQQ A;  5IYB G;  1K3R A;  4NB3 A;  1CSP A;  2A8V A;  5FLM G;  1VQE A;  3HKS A;  3RR5 A;  2D62 A;  1ASZ A;  5IYC H;  2UUC L;  4YHH Q;  1Q81 C;  1ASY A;  4WJ3 M;  3J81 c;  3CCV A;  4KLK A;  2NVX H;  4B3S L;  1H95 A;  2Q2U A;  1S3O A;  3PF4 A;  1VQD A;  1UE6 A;  3ER0 A;  2PI2 E;  4DR1 L;  4R1J A;  2BH8 A;  4JI8 Q;  3CCJ A;  4DV6 L;  1IXR A;  2VNU D;  2R6G A;  3ULJ A;  1JJC B;  2RHQ B;  3M9B A;  5M3M G;  5GAE C;  4BBS G;  3M4O H;  2Q2T A;  1JMC A;  4JI6 L;  5IYD H;  4DV1 Q;  4LFC Q;  2UUB Q;  1X6O A;  1S72 A;  4KHP L;  1WOC A;  3GTQ H;  4X65 L;  3PO3 H;  3AQQ A;  3HOX H;  2LXJ A;  3ULL A;  2MO1 A;  1I50 H;  1Y1V H;  4L5R C;  3CC4 A;  2HIX A;  3K7A H;  4DR6 Q;  4DV2 Q;  1BKB A;  3A0J A;  4UY8 C;  4C2M H;  2UXC Q;  1Z9F A;  3PIP A;  1M1K C;  2VS1 A;  1JB7 A;  2Q2I A;  1N32 L;  3KDF B;  3I4N H;  1K73 C;  1B70 B;  1UE7 A;  3KOJ A;  4GLA C;  1NE3 A;  2RCN A;  5JJL A;  3HOV H;  4B3R Q;  2AWN A;  3VDY A;  2E8G A;  2I5H A;  1Z47 A;  4YWK A;  3DLL A;  3CME A;  1VQ4 A;  3K8A A;  2GVA A;  4A3J G;  1VQP A;  1PH8 A;  3MXN B;  4DR2 Q;  4JI4 Q;  4BXX H;  1P16 A;  1MIU A;  2R93 G;  1U5K A;  3FHW A;  4DUY Q;  4DK6 C;  4A3C H;  4OWX B;  2MNA A;  2EXD A;  1KXL A;  1IBL L;  1G6P A;  5IP9 G;  5LMU L;  2D0P A;  4IOC A;  4YWL A;  4JBJ A;  4QY7 A;  4UP9 A;  4NXM L;  3RN2 A;  1OXS C;  1Q1E A;  4BBR G;  1Q82 C;  2R92 H;  1Q1B A;  2C35 B;  3W1B A;  4LFB Q;  3RZO H;  2N3S A;  4O2D A;  1N34 L;  4JYA L;  2VQF Q;  4OO1 G;  5M5W H;  2CWP A;  3E0E A;  4LF8 Q;  2OCE A;  4UPA A;  1QZG A;  3A5U A;  3HOU G;  2N78 A;  3S1M H;  4DR7 L;  1A0I A;  3S2H H;  1CSQ A;  1VQH A;  1VQ8 A;  4LF7 L;  4A3L H;  1X3G A;  2D0O A;  1QUQ A;  3JAM c;  1K8G A;  4DV5 Q;  1YIJ A;  1VQN A;  1IBK L;  2Y0S E;  2F4V L;  3PUW A;  5C44 H;  5IY0 A;  3CCM A;  2AKW B;  1O7I A;  2BA1 A;  1E24 A;  4A3F H;  4IPG A;  3J80 c;  1PV4 A;  1Q86 C;  5GAH C;  1XNQ Q;  4JI5 Q;  2UXB L;  4DKA C;  4A3D H;  1XTD A;  2RF4 A;  5C0X J;  3T1Y Q;  3F2D A;  4LF6 Q;  4K0K Q;  4GN4 B;  1YNX A;  2NVY H;  2L15 A;  1E3P A;  2H5X A;  3M4P A;  4A93 H;  1KHI A;  1VQL A;  4X66 L;  4MZ9 A;  4POG A;  1I94 L;  5C4X H;  1HJP A;  3CXC A;  1YJW A;  5DLQ E;  4DV7 Q;  1XJV A;  4JBW A;  2ALY B;  1TWF H;  2CFM A;  3S1Q H;  4JI2 Q;  4A4I A;  2OWO A;  4LFA L;  5C0X G;  4OWT B;  3OW2 A;  1SN8 A;  3CPW A;  2MO0 A;  1B8A A;  4GKJ L;  1E22 A;  1CKM A;  3K81 C;  4X62 L;  2BA0 A;  5M5X H;  2YYZ A;  5M3F H;  4YWM A;  3OYY A;  3TRZ A;  4A3E G;  1XMO L;  2OTJ A;  2E2H H;  1OXU A;  3KF8 B;  3M7N A;  3RN5 A;  3CW2 C;  2NVT H;  4B3T Q;  1P8L A;  4IOA A;  1LUZ A;  2IY5 B;  4KI0 A;  3L0O A;  4PZ8 A;  3L2P A;  5JEA J;  4UP8 A;  1PFS A;  1N36 Q;  4GS3 A;  1FGU A;  1L1O A;  2B29 A;  3MEF A;  4POF A;  1VQJ A;  1MJC A;  2I5M X;  4NXN L;  1YBY A;  4DV0 L;  3S14 H;  1EOV A;  2WAQ E;  4GKK L;  2CKZ B;  2UXD L;  1IBM Q;  4JOI A;  3S1N H;  3PCO B;  5LMN Q;  2PMZ E;  4JI1 Q;  1R9T H;  4B3M L;  4C3J H;  2B63 G;  5EAY A;  5GAG C;  4LF5 Q;  4JV5 Q;  1VQF A;  2VL6 A;  3GD7 A;  3RLO A;  1G29 1;  5JEA G;  4A3I G;  1VQ9 A;  4BY1 G;  1VCI A;  3OTO L;  4O0A A;  1L1O C;  3W1G A;  1HR0 W;  4IPD A;  3PO2 G;  1AE2 A;  1TWA H;  4TQU S;  2QA4 A;  4A3B G;  4JOI C;  3BJU A;  4JI3 L;  3S1R H;  1J6Q A;  1YI2 A;  2A1A A;  4X64 L;  4DR4 Q;  3CD6 A;  4YCW A;  4J15 A;  1HNX Q;  4A3G H;  2N49 A;  4DNI A;  1OTC A;  4P72 A;  2JQO A;  3HFZ B;  4A76 A;  1J5E Q;  1T9H A;  3HOZ G;  2KHI A;  4DV5 L;  2B3G A;  1JE5 A;  1VQG A;  4DV4 L;  3PSI A;  3DM3 A;  4LWC A;  4P74 A;  4QGU A;  4LF4 Q;  3GTO H;  4R4Q A;  3HKZ E;  2E5L L;  1XPR A;  1VQI A;  3KF6 A;  4R4T A;  5IP7 G;  4LUZ A;  3I4M H;  4HJ7 A;  1V9P A;  3H3V I;  4IJH A;  2ZTC A;  1EWI A;  1KL9 A;  5H1S E;  2HHH L;  4A3K H;  2JA7 H;  4HIK A;  3PUZ A;  5GAD C;  4A3M H;  4GKJ Q;  2IX0 A;  1N33 L;  1EUJ A;  4MNO A;  3AFQ A;  1Y1W H;  4BY7 H;  1WCM H;  3KJP A;  4AQY L;  4DR3 Q;  2UUA L;  3T1H L;  5FLX c;  4DUZ Q;  2JA5 H;  1PH4 A;  1K0R A;  3PF5 A;  1HR0 Q;  5IWA Q;  1QUQ B;  3S24 A;  3H0G H;  4QL5 A;  1X55 A;  4YY3 L;  2I5L X;  5IYC G;  3H15 A;  4DV7 L;  2WB1 G;  4DV3 L;  1WFQ A;  2R7Z H;  2VQE Q;  4ALP A;  4PMW A;  4DR5 L;  4LF9 Q;  3PUX A;  1XMQ L;  5C4J H;  2ZM6 Q;  1HNZ Q;  5BR8 Q;  5IE8 A;  1LM0 A;  2NN6 I;  1LTL A;  2FXQ A;  3STB C;  1X54 A;  4HIO A;  4AYB G;  1TXY A;  3S2D H;  1SMX A;  4ME3 A;  1Q8K A;  3HOW H;  4OX9 L;  5IYD G;  4GLX A;  3AEV A;  5ELO A;  1I6H H;  1N8R C;  3PO3 G;  3HOX G;  1CKN B;  1XPU A;  2DGY A;  4JBM A;  1UE1 A;  1Y1V G;  2OQK A;  4B3T L;  1XNR Q;  1JJ2 A;  2ID0 A;  1S40 A;  1EQR A;  3BZK A;  2AWO A;  1W2B A;  1X9N A;  1SFO H;  1EYG A;  3LGJ A;  2ZTE A;  2KHJ A;  3SGI A;  3CF5 A;  1N36 L;  1EFW A;  2OTL A;  3J81 i;  1FJG L;  2KEN A;  1HZ9 A;  3K80 C;  3I4N G;  4IFD G;  5AJ3 L;  1YHA A;  4IPC A;  2ES2 A;  3NEM A;  3HOV G;  2UU9 Q;  3M85 A;  1SR3 A;  2JJQ A;  4C3I H;  3U58 A;  5M5Y H;  4P71 A;  3H3V H;  2HT1 A;  4DK3 C;  2UUC Q;  4BXX G;  3TQY A;  1HZC A;  4YHH L;  3PUY A;  4B3S Q;  1VS0 A;  4QQB X;  3Q8D A;  3CCS A;  2IHF A;  2GVB A;  2Q2H A;  1YHB A;  3IRB A;  3CCU A;  3GDE A;  4DR1 Q;  3GTP H;  1NTG A;  1PYB A;  4JC0 A;  4A3C G;  1YVC A;  4JI8 L;  4DV6 Q;  1CKN A;  1HNX L;  1GKH A;  5HY6 A;  1VQO A;  2JEA I;  2ZTD A;  1L1O B;  2VUM H;  1UWV A;  2K5V A;  3B6Y A;  4TVA B;  4JI6 Q;  4HJ5 A;  3I56 A;  4KHP Q;  5LMN W;  4LFC L;  4DV1 L;  4MTN A;  1GM5 A;  2UUB L;  4X65 Q;  1HZA A;  1B7Y B;  1M90 C;  2R92 G;  4UP7 A;  1RIP A;  2JA6 H;  4IJL A;  3CCE A;  1BVS A;  4DR6 L;  4DV2 L;  1FL0 A;  2JA8 H;  3I7F A;  1YJN A;  2KCT A;  2JK8 A;  1V1Q A;  2JE6 I;  2CWA A;  4A3L G;  3GTK H;  5FJ8 H;  4GLV B;  5C3E H;  2UXC L;  4JI0 Q;  1JJG A;  1N32 Q;  3HOY H;  2K5N A;  2RHS B;  1UE5 A;  3FKI H;  3CQZ H;  4X6A H;  4B3R L;  4DUZ L;  4GNX A;  1I3Q H;  2F3I A;  1DGS A;  5IYB H;  5C44 G;  4EQ5 A;  5JJI A;  4A3F G;  2PQA B;  1CKO A;  1EIF A;  1KAW A;  4GOP A;  3I55 A;  2AHO B;  2YTY A;  4R4O A;  5FLM H;  4DAY B;  4OWW B;  2IX1 A;  2N8N A;  4DR2 L;  4JI4 L;  3J7Z C;  4A3D G;  1Y14 B; 
#chains in the Genus database with same CATH topology
 3W2D A;  4HN7 A;  4BA1 I;  2KJX A;  3SK5 A;  3KF6 B;  1WTH A;  2MP1 A;  1XX8 A;  3D4W A;  4BBS H;  4H0L C;  2RSN A;  1QVC A;  1VQA A;  2YV5 A;  4GOP C;  2VB2 X;  2K75 A;  3JAM i;  1GUW A;  4HR7 B;  2ATW A;  4N8X 1;  1CHP D;  2EDG A;  2F0F A;  1GXD C;  4NDX A;  5KND A;  1K3B C;  4LF7 Q;  4DPG A;  1YJ9 A;  2CW0 C;  1A3V A;  2PQA A;  4B9X A;  2F0G A;  1OXT A;  1WVL A;  3UDF A;  1C8C A;  5DM7 3;  1UEB A;  2B2Y A;  1A2T A;  1XNQ L;  2O5J C;  2B2T C;  2EQS A;  1WI5 A;  2R93 H;  1KTK A;  1HNW Q;  1EY5 A;  4IQZ A;  4LF6 L;  4K0K L;  1TT2 A;  1EEI D;  4JCV E;  2NZH A;  1YIT A;  3S15 H;  4XIG S;  4CJ0 B;  5BN3 A;  3KFU A;  1CA5 A;  3HRZ C;  3HOZ B;  3F2B A;  5CV7 A;  1K9M C;  2RDH A;  1PRT C;  2LXK A;  4P73 A;  3PIO A;  1PH7 A;  2QW7 A;  3K5O A;  4XYO A;  1WTV A;  3Q23 A;  4X62 Q;  3HOU H;  2IHE A;  2IT1 A;  1PZK D;  1SJE D;  2X6L A;  4CKE A;  3NTI A;  4Y52 H;  2Q8T A;  1BBX C;  1DXM A;  1TWG H;  2F52 A;  1EU4 A;  4PZ7 A;  3STB D;  1AZQ A;  3I4L A;  3FPP A;  4ZAI A;  4NMZ A;  4RG1 A;  4F7X A;  3GTJ H;  5EBC A;  2PW7 A;  1SRU A;  5E4W C;  2RKS A;  2SEB D;  1IBM L;  1PH5 A;  3WOF A;  5LMN L;  3AU7 A;  3A54 A;  5E7N A;  5M9O A;  1WTR A;  2E2I H;  1WTW A;  4LF5 L;  3H0G G;  4RAU C;  1SNM A;  4EQO A;  1WJJ A;  1I50 B;  5J3B A;  4JI7 L;  4GOP B;  4RHR A;  1LT3 D;  1KQS A;  1U4M A;  4L5T A;  4CJ1 B;  2K52 A;  2K5W A;  4YCU A;  3MXN A;  4RKL A;  2K5Q A;  3HOV B;  4NPS A;  2KBN A;  3IFT A;  2G9D A;  1VQ5 A;  1GO3 E;  1SEB D;  3KJO A;  4BA2 I;  2CQA A;  2J0T D;  1EU3 A;  4PG3 A;  1SLJ A;  1F2L A;  2ASB A;  1I4R A;  4IO9 A;  1S5D D;  3TS0 A;  2BH2 A;  1PA6 A;  3BU2 A;  4WOR A;  4FYD A;  3PGZ A;  5E1F A;  1HR0 L;  5IWA L;  4OL7 A;  2PNH A;  1CUK A;  5EJW A;  4DV3 Q;  1X56 A;  3RZO B;  1SNQ A;  2VB3 X;  4EGV A;  1YHQ A;  4LW1 A;  3D8G A;  1XWE A;  1PRT B;  4XQJ A;  3MXP A;  2F0P A;  2VUM G;  4OON A;  2WB1 E;  2J7Z A;  3HOZ H;  2OQ0 A;  4Z9C B;  2MFI A;  1VQC A;  1KIX A;  4AYB E;  3NBI A;  1LTA D;  2JA6 G;  3UE1 A;  2JA8 G;  5D3I B;  3D31 A;  3J80 i;  2Y0S G;  3CC7 A;  1D7Q A;  3GO5 A;  4ODG A;  1PVO A;  4WJ4 A;  3M4Q A;  2EYM A;  5IGC A;  2QDL A;  5FLX E;  2L11 A;  5ISR A;  1WTX A;  2UU9 L;  1B53 A;  1VQK A;  2KCN A;  1K3R A;  4NB3 A;  2F0T A;  2D62 A;  1JE4 A;  3S1Q B;  1QWY A;  4YHH Q;  3IFD A;  4WJ3 M;  1H95 A;  4K2K A;  3CCV A;  1VQD A;  1UE6 A;  4R1J A;  3CCJ A;  4DV6 L;  2VNU D;  3M9B A;  5M3M G;  1TQO A;  1X6O A;  5JAV A;  1RTN A;  4X65 L;  2NVT B;  3I3C A;  2LXJ A;  1HPC A;  1I50 H;  3CC4 A;  4DR6 Q;  3A0J A;  4RHS A;  3S14 B;  1MHW C;  1H9M A;  2Q2I A;  1HRJ A;  1N32 L;  1K73 C;  1UE7 A;  3KOJ A;  1R9T B;  4FF1 A;  3HOV H;  2BCO A;  3VDY A;  2A68 C;  2LY7 A;  4HSP A;  4YWK A;  4DFA A;  1VQ4 A;  2L0C A;  3K8A A;  2F0O A;  4M8A A;  4OHJ A;  2NVX B;  3OHX C;  4RKB A;  3FHW A;  4DK6 C;  2ZXR A;  1F9Q A;  3AB9 A;  4H13 C;  3RD4 A;  4JBJ A;  4Q5V A;  4UP9 A;  4BBR G;  1Q82 C;  2QIL A;  3W1B A;  3RZO H;  2CWP A;  1BDO A;  3FPU B;  4RCO A;  1PXU A;  4B9W A;  5KGU A;  4UPA A;  2N78 A;  1EWH A;  1A0I A;  1SSO A;  1A3U A;  1VQH A;  5COR A;  1G2T A;  3OWF A;  1RD9 D;  1K8G A;  1B3A A;  2Y0S E;  1DZ1 A;  3PUW A;  2FMM A;  3CCM A;  3H0G B;  1E24 A;  4IPG A;  3Q24 A;  1PV4 A;  1XNQ Q;  3N6R A;  2L9H A;  4DKA C;  2PZU A;  1T5X D;  1MGS A;  1HCZ A;  4LF6 Q;  4K0K Q;  1V1P A;  1WTQ A;  2QEJ C;  2H5X A;  1KHI A;  2TMP A;  4X66 L;  4U67 3;  5DLQ E;  1XJV A;  1F9R A;  2ALY B;  3S1Q H;  2WV6 D;  4C3H G;  4LMQ D;  5C0X G;  1EY0 A;  1PFM A;  1SN8 A;  2F0N A;  4FNF A;  1CKM A;  2NTS A;  3A8K E;  2YYZ A;  5F2D A;  4IUR A;  1E2V A;  2D5D A;  1VMC A;  1SNP A;  2NVT H;  4ZYS A;  1D5M C;  1N36 Q;  3MEF A;  4POF A;  1VQJ A;  1MJC A;  1PFN A;  4JPB W;  4QMG A;  3S14 H;  2WAQ E;  3LNN A;  5KIX A;  4GKK L;  2UXD L;  3E3X A;  1IBM Q;  5IT9 L;  3PCO B;  5LMN Q;  4A93 B;  1R9T H;  3DXJ C;  3CRL C;  4ZQ3 A;  2VUM B;  3QIA A;  1G6Z A;  4LF5 Q;  5C4X B;  2D2C C;  3RLO A;  5JEA G;  1VQ9 A;  2K01 A;  1LO5 D;  3M4Y A;  3W1G A;  1HR0 W;  2JA6 B;  1YI2 A;  4JI3 L;  1J6Q A;  2Y0S B;  4DNI A;  2JQO A;  5M3F B;  3HFZ B;  1B4O A;  1T9H A;  1SE2 A;  3PIP 3;  1JE5 A;  3FRP B;  4V0B A;  4DV4 L;  3ERO A;  3DM3 A;  4DU9 A;  4QGU A;  3HKZ E;  2E5L L;  1VQI A;  3EA6 A;  3ND9 A;  4DA2 A;  5IP7 G;  1STB A;  4HJ7 A;  1LTG D;  4G7Z C;  2IX0 A;  4N8F A;  1EUJ A;  3O13 A;  5M3M B;  2UUA L;  4C3J B;  4DUZ Q;  3LWE A;  1PH4 A;  1K0R A;  1SND A;  1HR0 Q;  5IWA Q;  3H0G H;  1SNC A;  1FNW A;  4ID6 A;  4DGZ A;  1WFQ A;  5CBE E;  2HDL A;  1S5E D;  2G5D A;  1LTL A;  3STB C;  3R93 A;  1X54 A;  1K28 A;  1TXY A;  4ME3 A;  4ZCK A;  2F0D A;  2XWJ B;  2IX3 A;  1JWU D;  1CKN B;  2DGY A;  1NAP A;  2EY6 A;  3U9O A;  3QR8 A;  5CR3 A;  2WAQ B;  4IUQ A;  2PZW A;  3QWN A;  4ABN A;  3DHQ A;  3BZK A;  1H9S B;  2F0W A;  5G3L D;  1HQM C;  3CF5 A;  1VF7 A;  2L5T A;  2L12 A;  5CV9 A;  1FJG L;  2SNS A;  1YHA A;  2UU9 Q;  2EY1 A;  4NW2 A;  4XYQ A;  5E3F A;  4BBR B;  1MSH A;  4QIW B;  2PNR C;  4QQB X;  2ZXO A;  3IRB A;  1EQT A;  4DV6 Q;  3EQL C;  4K8I A;  3VR6 A;  3C2P A;  1GKH A;  2ZTD A;  2VUM H;  4TVA B;  3D4D A;  3HKZ B;  1EYA A;  2GA4 B;  4G57 A;  3S9W A;  4LFC L;  4MTN A;  2EYJ A;  2BOS A;  4X65 Q;  1GOZ A;  3UI2 A;  5KNB A;  5KYI A;  3P75 A;  1TY2 A;  4UP7 A;  4U68 A;  2JA6 H;  4KV6 A;  4IJL A;  1BVS A;  3JAM L;  3TBI B;  2JA8 H;  4QF4 A;  1IYU A;  4A3L G;  2F3V A;  1I4X A;  4GLV B;  2J4X A;  5D3D A;  2UXC L;  1N32 Q;  2A73 B;  3K0Y A;  4BS9 A;  4A3F G;  2PQA B;  3CHB D;  1EIG A;  2AHO B;  4R4O A;  2RQX A;  3MC0 B;  4DR2 L;  4KN4 C;  4C3H B;  3CMA A;  3I2Z A;  1TII D;  1LTI D;  5EKL A;  1WYD A;  3DWQ A;  4OO1 I;  4EX5 A;  1IW7 D;  5M3M H;  4GNX C;  3G4S A;  2B8G A;  5ELF A;  4HJ8 A;  2AUJ D;  4AH6 A;  3D0F A;  1KRS A;  2K1B A;  4RMF A;  1KAA A;  1SNO A;  5CV8 A;  1Q12 A;  2EJM A;  3EBE A;  2FJ2 A;  1S5F D;  3RLF A;  1EYC A;  4L6T B;  4LF8 L;  5C5M A;  1U0L A;  1NSN S;  2OXP A;  5GQO A;  3MAQ A;  1C9O A;  1HA6 A;  4RH6 A;  2EJF C;  2SOB A;  1PYS B;  3L9A X;  2P5Z X;  2QCP X;  3A5Z B;  2CHB D;  4P75 A;  1AH9 A;  1TWH B;  3WWV A;  2MPM A;  1SXT A;  2K6A A;  3NEN A;  2K50 A;  3MZ5 A;  4KD4 A;  2KHS A;  2F0J A;  4Q0F A;  3EJI A;  2XGT A;  1DON A;  4X66 Q;  4DAP A;  2B2U A;  2Z6K A;  4WFN 3;  1EIY B;  2YU9 B;  1SYF A;  1NR2 A;  3ULP A;  4BBR H;  3KLS X;  4J1M A;  1Q46 A;  4R4C A;  2O2L D;  3ONA B;  1Y69 U;  5BN5 A;  3ERS X;  2WAC A;  1YZ6 A;  1FVI A;  4OXP A;  5I2X A;  1HXY D;  3C3L A;  4JI0 L;  2ICE C;  1HQR D;  1U9R A;  3L3O C;  5IOC A;  1B3Q A;  2IX1 A;  1CZW A;  3F2U A;  1QZH A;  1GVP A;  1LYL A;  1F9P A;  2F0Q A;  1ILQ A;  5IGD A;  2BE5 C;  1X3F A;  1GHJ A;  2R93 B;  4A3K G;  2WP8 J;  2JA7 G;  4GKK Q;  4A3M G;  2UXD Q;  1Y1W G;  2I0Q A;  1WCM G;  1JWS D;  3VA7 A;  5HGQ A;  4JV5 L;  1EFI D;  1ICF B;  1CT1 D;  4H44 C;  5C4H A;  1E1O A;  1RF2 D;  4LUO A;  5HUR A;  4C3H H;  2QEX A;  4GNX B;  5C0X H;  1NCV A;  2AQ2 B;  3KDF A;  2WKD A;  3OMC A;  4JI3 Q;  3A74 A;  4DR4 L;  2VY3 A;  2BDN A;  5T1I A;  3VYU A;  1PZI D;  2VXW A;  4S3S A;  3UDG A;  1J5E L;  4IN3 A;  1ET9 A;  3BYT B;  1Q7Y C;  4HIM A;  3J7A 5;  4DV4 Q;  1SE8 A;  3J81 j;  4EQN A;  2HQE A;  5FO9 B;  2E5L Q;  1AW7 A;  1I5F A;  3AMU A;  5KYL A;  5ELC A;  4UAI A;  2EIF A;  3F2C A;  4JG2 A;  1G51 A;  5I9O A;  1EY6 A;  2AQ3 B;  1I4H A;  3J80 L;  2KCM A;  3NWS A;  2UUA Q;  1VQ6 A;  2XWB B;  4DR3 L;  1RL2 A;  3NHH A;  3OWE B;  4QJF A;  1TVX A;  4UHV A;  1PH2 A;  3SVM A;  5JEA H;  1QVF A;  1TWH H;  3F8T A;  3TP6 A;  2VQE L;  3KLR A;  3T56 B;  3AFP A;  3S1M B;  3DMU A;  3C1F A;  1E7Z A;  2KEC A;  5K5P A;  1BCP F;  3I90 A;  3CC2 A;  4DN4 M;  3PV0 A;  2YU9 H;  3KLW A;  4ZRZ A;  2VW9 A;  3G71 A;  4IFD I;  1GUN A;  1S5B D;  1PH9 A;  5IP7 H;  1FJG Q;  5A35 A;  5FJ8 G;  3RNU A;  4YCV A;  3J7A F;  3SEB A;  3FKI G;  3BS1 A;  3A55 A;  4RGO S;  4FXD A;  1X3P A;  1D1K A;  2A8V A;  5FLM G;  2EZV A;  3RR5 A;  2UUC L;  1SYB A;  2F03 A;  1ASY A;  3A56 A;  5FO7 B;  3J81 c;  2C9O A;  1S3O A;  3PF4 A;  3ER0 A;  2PI2 E;  2BH8 A;  3I91 A;  4N9T A;  3RUZ A;  1CFM A;  5M5X B;  2R6G A;  1KDB A;  3MXU A;  5AFW A;  3FEW X;  4LFC Q;  1S72 A;  1AN8 A;  4E6I A;  1PFB A;  2A6H D;  4L5R C;  1H9K A;  1SYE A;  1HUM A;  2BDO A;  3HZX A;  2OF1 A;  4ME5 A;  3MA2 B;  4K5V A;  3VR4 A;  1LTT D;  1M1K C;  3H3V C;  2UXC Q;  3EVQ A;  1B70 B;  2HD3 A;  5DM6 3;  1XXG A;  2NB0 A;  4GLA C;  5JJL A;  1TU2 B;  2I5H A;  5CV4 A;  1Z47 A;  4NKL A;  4XT3 B;  2XN9 C;  4DR2 Q;  2ENB A;  4KY7 A;  1PTO F;  2DY7 A;  1TWA B;  4DF7 A;  1J9O A;  4OWX B;  5IIF A;  2LMC B;  2D0P A;  3OIQ A;  4QY7 A;  3RN2 A;  5LL6 S;  1OXS C;  1Q1E A;  3D4R A;  2QKI C;  2C35 B;  4JYA L;  2N3S A;  1N34 L;  1GUS A;  4LF8 Q;  2OCE A;  2PMZ B;  3S1M H;  1QZG A;  3A5U A;  4DR7 L;  1CSQ A;  3D6C A;  4A3L H;  4A3K B;  3H91 A;  2D0O A;  4A3M B;  1QUQ A;  2F4I A;  4DV5 Q;  4C1N K;  1YIJ A;  1Y1W B;  1IBK L;  1WCM B;  1AP0 A;  4EQP A;  4KTA A;  2F4V L;  1LTS D;  5LL6 X;  3D6W A;  1E2Z A;  2AKW B;  1O7I A;  4A3F H;  4G7O C;  1EYD A;  2EOT A;  1XTD A;  1TR5 A;  1F2Z A;  1HFN A;  3F2D A;  1UAP A;  1A3T A;  1YNX A;  2L15 A;  1ILP A;  4K2L A;  1I94 L;  3D3R A;  1JOK A;  4DV7 Q;  5JJZ A;  4JBW A;  3X3M A;  4A4I A;  3OW2 A;  3CPW A;  2MO0 A;  3E0J A;  1YNN D;  4K6D A;  5EGT A;  5M5X H;  2EJG C;  1ROD A;  1HFG A;  3TRZ A;  1EIH A;  1ZYR D;  1PYW D;  4A3E G;  1QCB D;  1LUZ A;  1QIL A;  5M5Y B;  2IY5 B;  1IW7 C;  3I70 A;  1FGU A;  4NXN L;  3BZD B;  1YBY A;  4K5W A;  3SXH A;  3GTP B;  4DXG A;  2K5D A;  1TKW B;  3OIP A;  3NXW A;  5GAG C;  4JV5 Q;  2PCF B;  1VQF A;  3NQI A;  1G29 1;  2CH4 W;  4A3I G;  3OTO L;  3PO2 G;  1L1O C;  5TSS A;  4KMU C;  4IPD A;  1TWA H;  4CDF C;  4A3B G;  4JOI C;  5EPK A;  1W6J A;  5CV6 A;  4X64 L;  3CD6 A;  4DR4 Q;  4J15 A;  4KJN A;  3GTK B;  4P72 A;  4A76 A;  3J7Y W;  1J5E Q;  5J22 A;  1VQG A;  3FKI B;  4V19 0;  4DAY A;  4P74 A;  2RBM A;  1ESF A;  3R8B A;  1FNV A;  2IL8 A;  3KF6 A;  1SYG A;  4I65 A;  2HHH L;  4A3K H;  2JA7 H;  4HIK A;  4A3M H;  4MTK A;  3R2I A;  1Y1W H;  3AFQ A;  1WCM H;  4AQY L;  4DR3 Q;  3T1H L;  5FLX c;  4G7H C;  3PF5 A;  1R4P B;  1WTO A;  4QL5 A;  1MBY A;  5IYC G;  2F0V A;  1BUV T;  2VQE Q;  4ALP A;  1XMQ L;  5IE8 A;  3T51 B;  5E4X A;  5BN4 A;  4QUF A;  1Q8K A;  2B2U C;  4OX9 L;  1QJO A;  2RA4 A;  1HTL D;  1I6V C;  2BE5 D;  3VA5 A;  3KBG A;  1N8R C;  3PO3 G;  3HOX G;  1XPU A;  1Y1V G;  2OQK A;  4B3T L;  3VR5 A;  1AZP A;  3GTG B;  4X3K A;  4NP5 A;  1X9N A;  1EFW A;  4PNY A;  2K28 A;  2KHJ A;  1ENF A;  4OIK A;  2OTL A;  2I07 B;  5IGF A;  3J81 i;  3OMG A;  4I7A A;  1DJR D;  4F87 A;  2H1E A;  3MXG A;  4LJZ C;  2A6E D;  4R8I A;  5AJ3 L;  1BXT A;  1U4L A;  3NEM A;  2X6G A;  1SR3 A;  5IT9 E;  2JJQ A;  2JN4 A;  3TP7 A;  5M5Y H;  4P71 A;  3H3V H;  3H09 A;  2HT1 A;  2UUC Q;  4C1N I;  1O7Z A;  4XXE A;  3CCS A;  2GVB A;  3CCU A;  4A3C G;  3GTP H;  2M2L A;  4JC0 A;  4JI8 L;  1BQQ T;  1HNX L;  4ILW A;  3TZU A;  1KLU D;  1FD7 D;  1WTP A;  1SE3 A;  1L1O B;  1AFP A;  2L55 A;  3B6Y A;  4HJ5 A;  5LMN W;  4BWG B;  1KNE A;  3GTM B;  1T5E A;  3K5N A;  1PDQ A;  1HZA A;  2R92 G;  5EKI A;  2KEE A;  3QG1 A;  2DNE A;  1RIP A;  2G9H D;  3NPP A;  2FIN B;  4RWS C;  4DV2 L;  2HDM A;  5EBD A;  2B2W C;  2JK8 A;  3HEJ A;  4LAA A;  3NK9 A;  5FJ8 H;  3GTK H;  1KDC A;  3M3Y B;  1KNA A;  1VF5 C;  2K5N A;  1UE5 A;  3DEO A;  3FKI H;  4X6A H;  4B3R L;  1I3Q H;  1DGS A;  5C44 G;  4FF2 A;  4EQ5 A;  5JJI A;  1CKO A;  3QB3 A;  4GOP A;  2A74 C;  2I46 A;  5FLM H;  4K6L A;  2KQ3 A;  2N8N A;  3L2P A;  1E2W A;  3KLS A;  2RSO A;  1KRT A;  4DUY L;  3S17 B;  1VQM A;  1JQY D;  5I2Y A;  4JBK A;  3K5L A;  5DAU A;  2PI2 A;  4XDX A;  4A3E B;  2K14 A;  3TS2 A;  1DYQ A;  2AMC B;  4GN5 A;  4LUV A;  4JYA Q;  1N34 Q;  4JI7 Q;  2VQF L;  3EFX D;  1IHZ A;  3ERQ A;  2JA8 B;  1EZ6 A;  4DR7 Q;  2LS0 1;  2B2T A;  1U4P A;  3A7L A;  4QIW E;  2X69 A;  4LK1 C;  4GZY C;  1IBK Q;  5FO8 B;  2DUD A;  2PZT A;  2GN5 A;  2WFW A;  4APV A;  3ICE A;  2F4V Q;  2RDG A;  1SRO A;  1O7Y A;  2XRQ D;  4Y7N B;  1A62 A;  4L5S A;  3GTG H;  4PQX A;  1SAP A;  5C3X A;  4A3I B;  1ICW A;  1Q3L A;  2EY2 A;  4KHZ A;  4JI5 L;  3PO2 B;  1JC7 A;  5C4Z A;  3T1Y L;  1TS5 A;  3KK7 A;  2YTV A;  4A3B B;  4FO2 A;  2A6H C;  1LTR D;  3Q6S A;  4HAE A;  4KHV A;  2CCZ A;  4QCL A;  4TSS A;  4DK0 A;  1F9S A;  2B2Y C;  5K36 G;  1I94 Q;  4R4I A;  4TRD A;  4DAV A;  3L7Z C;  4JW0 A;  1C0A A;  1FNU A;  3FDT A;  1V8Q A;  4JI2 L;  2XNA C;  3BDO A;  1PHJ A;  1TWC B;  4A3G G;  2NVQ B;  3JAM E;  4YIJ A;  1N9W A;  3U4Z A;  2NZO A;  1KD1 C;  1OXX K;  2K7V A;  5JOB A;  1XPO A;  3GTM H;  4IFD J;  1JT8 A;  2L1B A;  3TEH B;  3E9H A;  4A75 A;  3UDX A;  4CGY B;  3CCR A;  1RKN A;  2VZA A;  4L5Q A;  4UDU C;  3I4M G;  4PZ6 A;  3BG3 A;  2Z6B A;  5LHY 1;  4NXN Q;  3G48 A;  3NBH B;  4HJ9 A;  3M3Y H;  3CCQ A;  4CHT B;  1DM0 B;  4JI1 L;  4MIU A;  3M4O B;  1DOK A;  1E1T A;  2JA5 G;  4PV1 C;  4HMI A;  2EE1 A;  3GTQ B;  3PO3 B;  2A19 A;  2LSS A;  3OTO Q;  3HOX B;  4AIM A;  2EXZ A;  4JK1 C;  1MKH A;  1EY7 A;  1VDZ A;  1BBU A;  1TS2 A;  2F1M A;  3R2T A;  4HSV A;  4X64 Q;  3S17 H;  3HOW G;  1D8L A;  4C2M B;  2Z9H A;  3FP9 A;  2EVB A;  5CBA E;  2QF7 A;  4A3E H;  1HZB A;  5DEH A;  1Y8N B;  4R9W A;  1QG7 A;  4MHE A;  3HP3 A;  4O1N A;  3AYH B;  1L0W A;  4ZLT F;  4LF4 L;  4CJ2 C;  3PUV A;  3VYR A;  2C5C A;  3KYH C;  1IZ6 A;  4IUP A;  2HHH Q;  3UDI A;  3U4V A;  1PH1 A;  1HNW L;  2F0I A;  4AQY Q;  3T1H Q;  3CPF A;  4CDE C;  1LT4 D;  1YNN C;  5DNF A;  3NEL A;  4GN3 B;  4C3I G;  4Y7N H;  1IYJ B;  3EIV A;  1NJI C;  4A3I H;  2E76 C;  2LKV A;  1ZYR C;  2D9U A;  2B39 A;  4WJW A;  3PO2 H;  2R92 B;  3BZC A;  1NBW A;  4ULL A;  1XMQ Q;  5NUC A;  3W5O A;  2F0K A;  4A3B H;  1PRT F;  2CVR A;  1GD7 A;  3S2H B;  1X65 A;  4OX9 Q;  5ELN A;  4QB4 A;  3EN2 A;  5IOD A;  2SDF A;  2ZJR A;  4XTC S;  1V43 A;  1YEZ A;  5C44 B;  1OXV A;  2DY8 A;  1GUT A;  1TWC H;  4R8N A;  3A8J E;  2NVQ H;  3DWA A;  4DNR B;  4IUN A;  5AJ3 Q;  2B2V A;  2NZ1 D;  3N52 A;  1YNJ D;  3CCL A;  1JWM D;  2MUY A;  1ESR A;  1EQQ A;  5IYB G;  1JIC A;  5COY A;  1FGB D;  2MHV A;  1VQE A;  2XVS A;  5IYC H;  1EY8 A;  3K5M A;  3VR2 A;  4KLK A;  2E75 C;  3SHL A;  2Q2U A;  1STG A;  4X3U A;  4DR1 L;  1ZXT A;  4JI8 Q;  1JJC B;  2RHQ B;  1NUC A;  3M4O H;  3VR3 A;  4JI6 L;  1PMR A;  2E2H B;  3GTQ H;  2F3W A;  5FK9 C;  1BF4 A;  3AQQ A;  1Z7T A;  3HOX H;  3PO3 H;  3ULL A;  1A6X A;  2MO1 A;  1Y1V H;  3BDL A;  1Q8I A;  3VYT A;  2HIX A;  3K7A H;  4DV2 Q;  2WII B;  2F0L A;  3FMC A;  1IKM A;  4UY8 C;  3FVQ A;  4C2M H;  3PIP A;  3S1N B;  3BVG A;  4DXF A;  1BCP D;  5CV5 A;  4B3R Q;  1KAB A;  2E8G A;  3J80 E;  3Q0A A;  3CME A;  1E0B A;  4A3J G;  1PH8 A;  3MXN B;  3KUP A;  1F2M A;  4I7Z C;  2K05 A;  1K8O A;  4DUY Q;  2Q8I B;  4A3C H;  2MNA A;  2ZXP A;  4A3G B;  1SYC A;  1IBL L;  4RA8 A;  5IP9 G;  5LMU L;  4NXM L;  2RCF A;  1QB5 D;  2NUC A;  5FKA C;  1Q1B A;  2A6E C;  2R92 H;  4OO1 G;  1QNU A;  1D5Z C;  2VQF Q;  1CQV A;  2M00 A;  3I4M B;  1GHK A;  4OEL B;  3S2H H;  1CQF A;  3ZYY X;  1VQ8 A;  2KED A;  1VQN A;  3P1H A;  5L37 A;  2Z4H A;  1DCZ A;  2JA5 B;  5C44 H;  1CHQ D;  2BA1 A;  3J80 c;  1Q86 C;  5GAH C;  2V4D A;  4JI5 Q;  2UXB L;  4ZKB B;  2RF4 A;  3TDQ A;  1TY0 A;  5C0X J;  3T1Y Q;  1LT5 D;  4RFB A;  1MD2 D;  5A2Q E;  3S2D B;  3HOW B;  2K03 A;  1CI3 M;  1I6H B;  4IZ8 A;  1HJP A;  1YJW A;  1I4G A;  4FF3 A;  1H9J A;  1A2U A;  2CFM A;  4JI2 Q;  2OWO A;  4LFA L;  2R3Z A;  1C4Q A;  1E22 A;  1CA6 A;  1SFO B;  1PTO D;  3K81 C;  3SR1 A;  1L0Y B;  2BA0 A;  2KA7 A;  1KDA A;  2PO4 A;  1XMO L;  3KBX A;  3ND8 A;  4ZUJ A;  1GUO A;  2E2H H;  3M7N A;  3A7A B;  1P8L A;  1QOH A;  4C3I B;  4G4K A;  4A3F B;  1RHP A;  4RGM A;  4KI0 A;  5JEA J;  1PFS A;  4TKO B;  2B29 A;  4KY6 A;  3V96 A;  2I5M X;  1KXL A;  2O4X A;  4DV0 L;  1EOV A;  2CKZ B;  3S1N H;  3I8Z A;  1UNS A;  3BYY B;  2PMZ E;  4JI1 Q;  4B3M L;  2E74 C;  1Q90 A;  2B63 G;  4KN7 C;  5EAY A;  5K36 H;  1EZ8 A;  4KKS A;  3GD7 A;  3NQT A;  4BY1 G;  3NE5 B;  5A2Q L;  2F0M A;  4ZUI A;  1AE2 A;  4TQU S;  1PLF A;  4KK7 A;  3KF8 A;  4A3G H;  4YCW A;  2N49 A;  4RCN A;  2N88 A;  3MHB A;  1NR4 A;  2KHI A;  3URY A;  2B3G A;  3MWY W;  1G8Z D;  3CQZ B;  1S5C D;  2L4N A;  3CRK C;  4LWC A;  2F0U A;  1HHV A;  1PZJ D;  3SK4 A;  4LF4 Q;  4CDC C;  1B1Z A;  3PMF A;  4R4T A;  1SDF A;  4LUZ A;  3I4M H;  2HUG A;  1V9P A;  4IJH A;  1LV9 A;  2ZTC A;  1KL9 A;  2RVL A;  5CMD A;  5GAD C;  1N33 L;  4MNO A;  1I4P A;  2N55 A;  3DUZ A;  2RDF A;  3J81 L;  2JA5 H;  1BO0 A;  2PYK A;  2E2J B;  2MGS A;  2Z8L A;  3T13 A;  1HUN A;  3S24 A;  3GQB A;  4O42 A;  4YY3 L;  3S16 B;  2I5L X;  3H15 A;  1CK1 A;  1XTC D;  1K0S A;  2WB1 G;  2PW5 A;  4DR5 L;  3PUX A;  1DOL A;  1LM0 A;  2NN6 I;  3TN2 A;  4HIO A;  4AYB G;  3S2D H;  3HOW H;  4WRD A;  5IYD G;  4GLX A;  4FXK C;  5ELO A;  2A69 D;  1I6H H;  3HGB A;  1V1P B;  4B08 A;  1UE1 A;  1D1I A;  1L0X B;  1EQR A;  1SFO H;  2AWO A;  2Z4I A;  5JPM C;  4A3J B;  3LGJ A;  2JSO A;  3SGI A;  1N36 L;  1LTB D;  2KEN A;  2JA7 B;  1HZ9 A;  3K80 C;  3T53 B;  3I4N G;  4IFD G;  1AEX A;  4C3I H;  1UUP A;  1K83 B;  4BXX G;  4HCS A;  4KKU A;  1VS0 A;  4H7B A;  3Q8D A;  2Q2H A;  1YHB A;  4DR1 Q;  4K8J A;  5HGT A;  2XIW A;  5HY6 A;  1VQO A;  4FXG C;  3MFG A;  4JI6 Q;  1TS4 A;  2K5V A;  3I56 A;  4DV1 L;  1GM5 A;  4J8Q A;  2UUB L;  2JXM B;  2SNM A;  1IL8 A;  2B8F A;  3CU7 A;  4FP5 D;  2WIN B;  3G6J B;  3WDN A;  4L8J A;  4EVO A;  3CCE A;  1KLG D;  1ENA A;  3NTH A;  4JI0 Q;  2ICI A;  4PMC A;  2RHS B;  1MSG A;  2EPB A;  3C1E A;  3CQZ H;  1BOS A;  4DUZ L;  4GNX A;  3E5S A;  5IYB H;  1STY A;  4OWW B;  4FF4 A;  1R4Q B;  4A3D G;  4JI4 L;  1Y14 B;  4FVM A;  3OW7 A;  2K4K A;  3JC6 6;  4HJA A;  1CTM A;  4HED A;  4A93 G;  1IBL Q;  2R7D A;  1A8V A;  4FDB A;  3X3N A;  1D5X C;  5KEE A;  5LMU Q;  5C4X G;  1RCV D;  4XQQ A;  2E2J H;  4NXM Q;  4IUT A;  2NN6 G;  3S16 H;  2K5H A;  5ELE A;  4LFB L;  1YNJ C;  1C7Y A;  1EY4 A;  1M4V A;  2KUM A;  5M3F G;  3E6Z X;  2FFK B;  3RLN A;  2XTI A;  1PH6 A;  2WKC A;  1O78 A;  2B63 B;  1I3Q B;  3WOE A;  2HQL A;  1FYC A;  2ZJP A;  1AE3 A;  1NMF A;  4BY1 B;  4A3J H;  2MQH A;  2UXB Q;  2MJ8 A;  1EQV A;  2CH4 A;  2B2V C;  3BVZ A;  3T4A C;  2HCC A;  5JJK A;  2K04 A;  3DEP A;  5C0X I;  3RZD B;  4CKB A;  3SE0 A;  4C3J G;  3OOC A;  5IP9 H;  2JEB I;  1VQB A;  3DWP A;  1K83 H;  3UE0 A;  1IL2 A;  4LFA Q;  3K59 A;  4OO1 H;  1BCP C;  2Z0S A;  3K58 A;  4K5X A;  4OEM B;  2A5H A;  2EYH A;  3CP0 A;  1GUG A;  3SDZ A;  2Z6K C;  3GTL B;  1XMO Q;  3H94 A;  4QUC A;  2PPB C;  1S4Z A;  2F0H A;  1SMY D;  2V1C C;  4DNT B;  3QOJ A;  2WAQ G;  2ZJQ A;  1BBW A;  3TRE A;  1STE A;  2KVM A;  1CZG A;  2R7F A;  2WB1 B;  1WD0 A;  5FLX L;  1LAC A;  2EYF A;  4DV0 Q;  5EKK A;  3HG9 A;  3IKJ A;  4C56 C;  4BY7 G;  4AYB B;  1DOM A;  2NBF A;  4B3M Q;  4ZK9 B;  2JYO A;  5IGG A;  1K8A C;  5EQ0 A;  1LLR D;  5ELB A;  1HH2 P;  1RDP D;  1NY4 A;  1JCK B;  2XSC A;  3CAM A;  2NTT A;  2R7Z G;  1BR9 A;  4H02 A;  1G91 A;  4IPH A;  1FR3 A;  1F77 A;  3TME A;  3HKZ G;  3I4N B;  1EY9 A;  3R3O A;  3I4O A;  3K0X A;  3IAY A;  3CKI B;  2EYO A;  2QGQ A;  1B9N A;  3U50 C;  3F1Z A;  3K7U C;  1KC8 C;  5CGK A;  3BDC A;  1W3S A;  1X3Q A;  5I6W A;  5GRO A;  4GKJ L;  3DM1 A;  1N33 Q;  3E9I A;  4LNQ A;  1LAB A;  1PTO C;  2B63 H;  4YY3 Q;  5IT9 c;  1ET6 A;  4BY1 H;  3G6E A;  3NP8 A;  2JP1 A;  4DR5 Q;  5M5W B;  1X3E A;  4LF9 L;  2YTX A;  2ZM6 L;  2HIV A;  5BR8 L;  1HNZ L;  3K6O A;  2QDB A;  1QVG A;  3RZD H;  4HID A;  1BCP B;  1A63 A;  4RGT A;  3GV3 A;  3ZJY C;  3QOL A;  4L63 B;  1DD2 A;  1VQ7 A;  2JA9 A;  5FOB B;  1PH3 A;  1XNR L;  2CQO A;  2PQE A;  3QO2 A;  3V05 A;  2NWG A;  4DAM A;  5JVG 3;  1B44 D;  4A3D B;  1X32 A;  1STA A;  3LWU A;  3NUC A;  1EEF D;  5C3E G;  1MJE A;  2KOL A;  1VMP A;  3GTL H;  1NMG A;  2NVY B;  3HOY G;  1L2F A;  2DNC A;  1Y8O B;  3NSW A;  1CSP A;  3HS0 C;  2CW0 D;  3HKS A;  1ASZ A;  1TWF B;  3J7A V;  1Q81 C;  1EL0 A;  1V1O A;  2NVX H;  4B3S L;  1SE4 A;  5J39 A;  1IXR A;  3ULJ A;  1RJT A;  5GAE C;  4BBS G;  3T16 A;  2Q2T A;  1JMC A;  5IYD H;  4DV1 Q;  2UUB Q;  4KHP L;  1WOC A;  2IW3 A;  5J1Z A;  1HA5 A;  2NYZ D;  2IJ0 A;  2H4O A;  4HTH A;  3I72 A;  3W3A A;  1NNX A;  1BKB A;  2Q8R E;  2Z1C A;  5JVH 3;  4HMJ A;  1Z9F A;  1I4Q A;  1PRT D;  2VS1 A;  1IYV A;  1JB7 A;  2AUK A;  3KDF B;  3I4N H;  4IFD H;  4IAL A;  1NE3 A;  2RCN A;  1JOR A;  2AWN A;  1ZEQ X;  1JOQ A;  3DLL A;  4M1U B;  2GVA A;  1VQP A;  4BXX H;  4JI4 Q;  2A69 C;  1P16 A;  1MIU A;  4P2C B;  1PTO B;  3NWT A;  1HTP A;  3QJY A;  2R93 G;  1U5K A;  4K14 A;  1EOT A;  2IPK D;  3S1R B;  1CM9 A;  2EXD A;  1JOO A;  4X3S A;  4KJO A;  1G6P A;  4IOC A;  4YWL A;  3P7J A;  1UEA B;  1Y1V B;  1SBB B;  4LFB Q;  4XQN A;  4O2D A;  3GTO B;  3A8I E;  3I73 A;  3K7A B;  1OO9 B;  5M5W H;  4N9P A;  3E0E A;  3SK8 A;  1B50 A;  3HOU G;  4LF7 L;  4XT1 B;  2E2D C;  1X3G A;  3K57 A;  4RGN A;  3JAM c;  5I4D A;  4BY7 B;  1K8M A;  3GV6 A;  2EY5 A;  5IY0 A;  1QE6 A;  4MN3 A;  2OEO A;  2F0E A;  4A3D H;  3NTK A;  2R7Z B;  4IUV A;  5IGB A;  5C4J B;  4DK1 A;  5JPN C;  4GN4 B;  2NVY H;  1E3P A;  3M4P A;  4A93 H;  1VQL A;  1O80 A;  4MZ9 A;  5C5L A;  4POG A;  2AQ1 B;  5D14 A;  5C4X H;  3CXC A;  1TWF H;  2NN6 H;  3VYS A;  4CKC A;  4OWT B;  2K32 A;  1B8A A;  3MFY A;  2IWH A;  4PMB A;  4X62 L;  1G2S A;  1IKL A;  5M3F H;  4YWM A;  3OYY A;  4F88 A;  2TSS A;  1B2T A;  2OTJ A;  2FHT A;  1W6K A;  1OXU A;  3KF8 B;  3RN5 A;  1Y8P B;  3CW2 C;  1SYD A;  4B3T Q;  4IOA A;  3MEH A;  3L0O A;  4PZ8 A;  4UP8 A;  4GS3 A;  1L1O A;  1A15 A;  1STH A;  2M9V A;  2ZT9 C;  4JOI A;  3TSS A;  5IGE A;  4C3J H;  3TP8 A;  1J8I A;  2VL6 A;  4KY5 A;  1VCI A;  5EPJ A;  4O0A A;  1RTO A;  4KD3 A;  5G3L F;  5I9P A;  1PTO H;  3PIO 3;  5CC4 A;  2QA4 A;  3BJU A;  1LT6 D;  3S1R H;  2A1A A;  1HNX Q;  1ZKO A;  3P20 A;  1GJX A;  5C3E B;  1OTC A;  3TP5 A;  5KRU A;  3HOZ G;  3HOY B;  3OPO A;  4DV5 L;  3PSI A;  3GP7 A;  1XYI A;  1F2Y A;  1BNZ A;  3GTO H;  4R4Q A;  3BVM A;  4KKT A;  1XPR A;  2EYP A;  1SJH D;  3G7L A;  5CYU A;  3H3V I;  1EWI A;  5H1S E;  4GKJ Q;  3PUZ A;  1ENC A;  4BY7 H;  4IUU A;  3KJP A;  4BBS B;  1D6E C;  1TS3 A;  5ELD A;  5C3W A;  2R61 A;  1QUQ B;  4DV7 L;  1X55 A;  4HCE A;  4J6H A;  3M7G A;  3V2T A;  2F0S A;  4DV3 L;  2R7Z H;  4PMW A;  4LF9 Q;  5C4J H;  2ZM6 Q;  1HNZ Q;  5BR8 Q;  1SMY C;  2FXQ A;  2A68 D;  1JR0 D;  3C46 A;  1JB3 A;  1SMX A;  5D65 A;  3AEV A;  1C48 A;  2FMC A;  2DJG C;  2DN8 A;  4JBM A;  3TZD A;  1XNR Q;  1JJ2 A;  2ID0 A;  1S40 A;  2LFN A;  1W2B A;  1EYG A;  3SK6 A;  2EYL A;  2ZTE A;  2XRS D;  3H6M A;  1D2B A;  4CDD C;  3ITP A;  1B9M A;  2HCI A;  4IPC A;  2ES2 A;  3HOV G;  3S15 B;  3M85 A;  3U58 A;  4ZKC B;  4DK3 C;  3TQY A;  1HZC A;  4YHH L;  3PUY A;  4B3S Q;  1ML0 D;  3Q22 A;  2IHF A;  4F8M A;  1MI2 A;  5T1G A;  3GDE A;  1NTG A;  1PYB A;  3OSO A;  3MVV A;  1YVC A;  1U4R A;  2OT2 A;  1CKN A;  3HOU B;  1O7L A;  2B2W A;  2JEA I;  1UWV A;  3LX0 A;  4OIJ A;  4X3T A;  4KHP Q;  1TWG B;  1H9S A;  1QNK A;  1B7Y B;  1M90 C;  3IL8 A;  2KCC A;  5KNC A;  2K33 A;  2O5I C;  3NBH A;  1WD1 A;  1ONL A;  4DR6 L;  1FL0 A;  3I7F A;  1YJN A;  5EPL A;  3GTJ B;  2KCT A;  1Z6H A;  1V1Q A;  3U9S A;  2JE6 I;  2CWA A;  1II3 A;  3PQI A;  5C3E H;  3RMH A;  5I6Y A;  1JJG A;  3HOY H;  4JVZ A;  2DJF C;  3MTS A;  4OGQ C;  2E2I B;  1STN A;  2F3I A;  5C6A A;  1EIF A;  4CBV A;  1KAW A;  3I55 A;  3J81 E;  2YTY A;  4DAY B;  1EWC A;  1H9R A;  3J7Z C;  1M8A A; 
#chains in the Genus database with same CATH homology
 2K4K A;  4BA1 I;  3JC6 6;  3CMA A;  1KRT A;  3I2Z A;  4DUY L;  4HJA A;  1WYD A;  3KF6 B;  1VQM A;  4EX5 A;  1IBL Q;  4OO1 I;  4A93 G;  2R7D A;  1A8V A;  4FDB A;  4JBK A;  4BBS H;  5M3M H;  4GNX C;  3G4S A;  2PI2 A;  5LMU Q;  1QVC A;  1VQA A;  2YV5 A;  5C4X G;  4HJ8 A;  4GOP C;  2K14 A;  3JAM i;  2K75 A;  2E2J H;  4AH6 A;  4NXM Q;  3TS2 A;  3D0F A;  1KRS A;  2AMC B;  4GN5 A;  4LUV A;  4RMF A;  2NN6 G;  3S16 H;  2K5H A;  2ATW A;  1Q12 A;  4JYA Q;  3EBE A;  1N34 Q;  4LFB L;  1C7Y A;  4JI7 Q;  2VQF L;  3RLF A;  4LF8 L;  4DR7 Q;  1U0L A;  4LF7 Q;  4DPG A;  4QIW E;  5M3F G;  1YJ9 A;  5GQO A;  2PQA A;  1C9O A;  3RLN A;  1IBK Q;  2XTI A;  1PH6 A;  1OXT A;  2DUD A;  2WFW A;  2GN5 A;  1PYS B;  3UDF A;  4APV A;  2F4V Q;  3ICE A;  1SRO A;  1UEB A;  1A62 A;  4L5S A;  2HQL A;  3GTG H;  2ZJP A;  1AE3 A;  1NMF A;  3A5Z B;  4P75 A;  1XNQ L;  1AH9 A;  3WWV A;  4A3J H;  2MQH A;  4KHZ A;  3NEN A;  2UXB Q;  2K50 A;  2EQS A;  4JI5 L;  1WI5 A;  2R93 H;  1HNW Q;  3T1Y L;  4LF6 L;  4K0K L;  2YTV A;  5JJK A;  4JCV E;  5C0X I;  2XGT A;  2NZH A;  1YIT A;  2CCZ A;  4X66 Q;  3S15 H;  4XIG S;  5K36 G;  2Z6K A;  3KFU A;  5IP9 H;  1I94 Q;  4R4I A;  2JEB I;  1EIY B;  1VQB A;  3L7Z C;  3F2B A;  1K83 H;  1K9M C;  1C0A A;  3UE0 A;  3ULP A;  2LXK A;  4P73 A;  4BBR H;  3PIO A;  1IL2 A;  1PH7 A;  4LFA Q;  4JI2 L;  1Q46 A;  4R4C A;  2Z0S A;  1PHJ A;  4X62 Q;  3CP0 A;  4A3G G;  3ERS X;  1YZ6 A;  1FVI A;  3HOU H;  2IHE A;  2IT1 A;  4OXP A;  2Z6K C;  1N9W A;  4Y52 H;  1XMO Q;  3U4Z A;  4JI0 L;  2NZO A;  1KD1 C;  1OXX K;  1TWG H;  1XPO A;  4IFD J;  2F52 A;  3GTM H;  1JT8 A;  4PZ7 A;  2V1C C;  3STB D;  3TEH B;  3E9H A;  2WAQ G;  4A75 A;  1GVP A;  3UDX A;  1QZH A;  1LYL A;  2ZJQ A;  1BBW A;  3CCR A;  2VZA A;  4L5Q A;  3TRE A;  4RG1 A;  3I4M G;  3GTJ H;  2R7F A;  4PZ6 A;  1X3F A;  1SRU A;  4NXN Q;  4DV0 Q;  3G48 A;  2WP8 J;  3NBH B;  4HJ9 A;  4A3M G;  4A3K G;  3CCQ A;  2JA7 G;  3M3Y H;  4GKK Q;  2UXD Q;  1IBM L;  1Y1W G;  2I0Q A;  4BY7 G;  1PH5 A;  1WCM G;  5LMN L;  4B3M Q;  4JI1 L;  2JA5 G;  1E1T A;  5E7N A;  2E2I H;  1K8A C;  5HGQ A;  4LF5 L;  4JV5 L;  3H0G G;  2A19 A;  2LSS A;  3OTO Q;  1HH2 P;  1E1O A;  1WJJ A;  4LUO A;  4AIM A;  1NY4 A;  3CAM A;  4C3H H;  2QEX A;  4GNX B;  2R7Z G;  1MKH A;  5J3B A;  4JI7 L;  4H02 A;  3KDF A;  4JI3 Q;  4GOP B;  1BBU A;  4X64 Q;  3S17 H;  3A74 A;  4DR4 L;  1KQS A;  4IPH A;  3HOW G;  1D8L A;  2VY3 A;  4L5T A;  3HKZ G;  3FP9 A;  3UDG A;  1J5E L;  4A3E H;  2K52 A;  1HZB A;  4YCU A;  1Q7Y C;  3I4O A;  3K0X A;  4HIM A;  3J7A 5;  4DV4 Q;  1SE8 A;  4NPS A;  3J81 j;  2QGQ A;  2KBN A;  3AYH B;  1L0W A;  1VQ5 A;  1GO3 E;  3U50 C;  3KJO A;  2E5L Q;  3F1Z A;  4LF4 L;  1I5F A;  3K7U C;  3PUV A;  1KC8 C;  4BA2 I;  3KYH C;  1IZ6 A;  1W3S A;  4PG3 A;  1SLJ A;  2HHH Q;  2EIF A;  3U4V A;  3UDI A;  4JG2 A;  3F2C A;  5GRO A;  1G51 A;  4IO9 A;  1PH1 A;  1N33 Q;  3TS0 A;  3E9I A;  2ASB A;  2BH2 A;  4LNQ A;  2KCM A;  4AQY Q;  2UUA Q;  3T1H Q;  3BU2 A;  3CPF A;  1PA6 A;  4DR3 L;  1RL2 A;  1VQ6 A;  2B63 H;  3PGZ A;  3NEL A;  4GN3 B;  4QJF A;  4Y7N H;  1IYJ B;  1HR0 L;  3EIV A;  5IWA L;  1PH2 A;  1NJI C;  2PNH A;  4YY3 Q;  5IT9 c;  1CUK A;  4A3I H;  1TWH H;  4BY1 H;  1QVF A;  3F8T A;  3G6E A;  4DV3 Q;  3PO2 H;  1X56 A;  3BZC A;  1NBW A;  4DR5 Q;  2VQE L;  1XMQ Q;  1X3E A;  4LF9 L;  3W5O A;  2YTX A;  2ZM6 L;  2HIV A;  3AFP A;  5BR8 L;  1YHQ A;  1HNZ L;  4A3B H;  4LW1 A;  1QVG A;  1GD7 A;  1X65 A;  1E7Z A;  3RZD H;  4OX9 Q;  5ELN A;  2VUM G;  4OON A;  2WB1 E;  3EN2 A;  4HID A;  2ZJR A;  4XTC S;  1A63 A;  1V43 A;  3HOZ H;  2OQ0 A;  3ZJY C;  3CC2 A;  2MFI A;  3PV0 A;  2YU9 H;  3KLW A;  1VQC A;  1HNW L;  1KIX A;  4AYB E;  1VQ7 A;  1YEZ A;  2JA9 A;  2VW9 A;  3G71 A;  1PH3 A;  4IFD I;  1XNR L;  1PH9 A;  1OXV A;  2JA6 G;  3UE1 A;  2CQO A;  2JA8 G;  4DAM A;  3D31 A;  1TWC H;  2Y0S G;  3J80 i;  5IP7 H;  3CC7 A;  1D7Q A;  2NVQ H;  1FJG Q;  3GO5 A;  5FJ8 G;  5C3E G;  1MJE A;  1PVO A;  4WJ4 A;  3M4Q A;  3RNU A;  3GTL H;  1NMG A;  5AJ3 Q;  4YCV A;  3HOY G;  3CCL A;  1L2F A;  3FKI G;  2UU9 L;  1VQK A;  1EQQ A;  5IYB G;  1K3R A;  4NB3 A;  1CSP A;  2A8V A;  5FLM G;  1VQE A;  3HKS A;  3RR5 A;  2D62 A;  1ASZ A;  5IYC H;  2UUC L;  4YHH Q;  1Q81 C;  1ASY A;  4WJ3 M;  3J81 c;  3CCV A;  4KLK A;  2NVX H;  4B3S L;  1H95 A;  2Q2U A;  1S3O A;  3PF4 A;  1VQD A;  1UE6 A;  3ER0 A;  2PI2 E;  4DR1 L;  4R1J A;  2BH8 A;  4JI8 Q;  3CCJ A;  4DV6 L;  1IXR A;  2VNU D;  2R6G A;  3ULJ A;  1JJC B;  2RHQ B;  3M9B A;  5M3M G;  5GAE C;  4BBS G;  3M4O H;  2Q2T A;  1JMC A;  4JI6 L;  5IYD H;  4DV1 Q;  4LFC Q;  2UUB Q;  1X6O A;  1S72 A;  4KHP L;  1WOC A;  3GTQ H;  4X65 L;  3PO3 H;  3AQQ A;  3HOX H;  2LXJ A;  3ULL A;  2MO1 A;  1I50 H;  1Y1V H;  4L5R C;  3CC4 A;  2HIX A;  3K7A H;  4DR6 Q;  4DV2 Q;  1BKB A;  3A0J A;  4UY8 C;  4C2M H;  2UXC Q;  1Z9F A;  3PIP A;  1M1K C;  2VS1 A;  1JB7 A;  2Q2I A;  1N32 L;  3KDF B;  3I4N H;  1K73 C;  1B70 B;  1UE7 A;  3KOJ A;  4GLA C;  1NE3 A;  2RCN A;  5JJL A;  3HOV H;  4B3R Q;  2AWN A;  3VDY A;  2E8G A;  2I5H A;  1Z47 A;  4YWK A;  3DLL A;  3CME A;  1VQ4 A;  3K8A A;  2GVA A;  4A3J G;  1VQP A;  1PH8 A;  3MXN B;  4DR2 Q;  4JI4 Q;  4BXX H;  1P16 A;  1MIU A;  2R93 G;  1U5K A;  3FHW A;  4DUY Q;  4DK6 C;  4A3C H;  4OWX B;  2MNA A;  2EXD A;  1KXL A;  1IBL L;  1G6P A;  5IP9 G;  5LMU L;  2D0P A;  4IOC A;  4YWL A;  4JBJ A;  4QY7 A;  4UP9 A;  4NXM L;  3RN2 A;  1OXS C;  1Q1E A;  4BBR G;  1Q82 C;  2R92 H;  1Q1B A;  2C35 B;  3W1B A;  4LFB Q;  3RZO H;  2N3S A;  4O2D A;  1N34 L;  4JYA L;  2VQF Q;  4OO1 G;  5M5W H;  2CWP A;  3E0E A;  4LF8 Q;  2OCE A;  4UPA A;  1QZG A;  3A5U A;  3HOU G;  2N78 A;  3S1M H;  4DR7 L;  1A0I A;  3S2H H;  1CSQ A;  1VQH A;  1VQ8 A;  4LF7 L;  4A3L H;  1X3G A;  2D0O A;  1QUQ A;  3JAM c;  1K8G A;  4DV5 Q;  1YIJ A;  1VQN A;  1IBK L;  2Y0S E;  2F4V L;  3PUW A;  5C44 H;  5IY0 A;  3CCM A;  2AKW B;  1O7I A;  2BA1 A;  1E24 A;  4A3F H;  4IPG A;  3J80 c;  1PV4 A;  1Q86 C;  5GAH C;  1XNQ Q;  4JI5 Q;  2UXB L;  4DKA C;  4A3D H;  1XTD A;  2RF4 A;  5C0X J;  3T1Y Q;  3F2D A;  4LF6 Q;  4K0K Q;  4GN4 B;  1YNX A;  2NVY H;  2L15 A;  1E3P A;  2H5X A;  3M4P A;  4A93 H;  1KHI A;  1VQL A;  4X66 L;  4MZ9 A;  4POG A;  1I94 L;  5C4X H;  1HJP A;  3CXC A;  1YJW A;  5DLQ E;  4DV7 Q;  1XJV A;  4JBW A;  2ALY B;  1TWF H;  2CFM A;  3S1Q H;  4JI2 Q;  4A4I A;  2OWO A;  4LFA L;  5C0X G;  4OWT B;  3OW2 A;  1SN8 A;  3CPW A;  2MO0 A;  1B8A A;  4GKJ L;  1E22 A;  1CKM A;  3K81 C;  4X62 L;  2BA0 A;  5M5X H;  2YYZ A;  5M3F H;  4YWM A;  3OYY A;  3TRZ A;  4A3E G;  1XMO L;  2OTJ A;  2E2H H;  1OXU A;  3KF8 B;  3M7N A;  3RN5 A;  3CW2 C;  2NVT H;  4B3T Q;  1P8L A;  4IOA A;  1LUZ A;  2IY5 B;  4KI0 A;  3L0O A;  4PZ8 A;  3L2P A;  5JEA J;  4UP8 A;  1PFS A;  1N36 Q;  4GS3 A;  1FGU A;  1L1O A;  2B29 A;  3MEF A;  4POF A;  1VQJ A;  1MJC A;  2I5M X;  4NXN L;  1YBY A;  4DV0 L;  3S14 H;  1EOV A;  2WAQ E;  4GKK L;  2CKZ B;  2UXD L;  1IBM Q;  4JOI A;  3S1N H;  3PCO B;  5LMN Q;  2PMZ E;  4JI1 Q;  1R9T H;  4B3M L;  4C3J H;  2B63 G;  5EAY A;  5GAG C;  4LF5 Q;  4JV5 Q;  1VQF A;  2VL6 A;  3GD7 A;  3RLO A;  1G29 1;  5JEA G;  4A3I G;  1VQ9 A;  4BY1 G;  1VCI A;  3OTO L;  4O0A A;  1L1O C;  3W1G A;  1HR0 W;  4IPD A;  3PO2 G;  1AE2 A;  1TWA H;  4TQU S;  2QA4 A;  4A3B G;  4JOI C;  3BJU A;  4JI3 L;  3S1R H;  1J6Q A;  1YI2 A;  2A1A A;  4X64 L;  4DR4 Q;  3CD6 A;  4YCW A;  4J15 A;  1HNX Q;  4A3G H;  2N49 A;  4DNI A;  1OTC A;  4P72 A;  2JQO A;  3HFZ B;  4A76 A;  1J5E Q;  1T9H A;  3HOZ G;  2KHI A;  4DV5 L;  2B3G A;  1JE5 A;  1VQG A;  4DV4 L;  3PSI A;  3DM3 A;  4LWC A;  4P74 A;  4QGU A;  4LF4 Q;  3GTO H;  4R4Q A;  3HKZ E;  2E5L L;  1XPR A;  1VQI A;  3KF6 A;  4R4T A;  5IP7 G;  4LUZ A;  3I4M H;  4HJ7 A;  1V9P A;  3H3V I;  4IJH A;  2ZTC A;  1EWI A;  1KL9 A;  5H1S E;  2HHH L;  4A3K H;  2JA7 H;  4HIK A;  3PUZ A;  5GAD C;  4A3M H;  4GKJ Q;  2IX0 A;  1N33 L;  1EUJ A;  4MNO A;  3AFQ A;  1Y1W H;  4BY7 H;  1WCM H;  3KJP A;  4AQY L;  4DR3 Q;  2UUA L;  3T1H L;  5FLX c;  4DUZ Q;  2JA5 H;  1PH4 A;  1K0R A;  3PF5 A;  1HR0 Q;  5IWA Q;  1QUQ B;  3S24 A;  3H0G H;  4QL5 A;  1X55 A;  4YY3 L;  2I5L X;  5IYC G;  3H15 A;  4DV7 L;  2WB1 G;  4DV3 L;  1WFQ A;  2R7Z H;  2VQE Q;  4ALP A;  4PMW A;  4DR5 L;  4LF9 Q;  3PUX A;  1XMQ L;  5C4J H;  2ZM6 Q;  1HNZ Q;  5BR8 Q;  5IE8 A;  1LM0 A;  2NN6 I;  1LTL A;  2FXQ A;  3STB C;  1X54 A;  4HIO A;  4AYB G;  1TXY A;  3S2D H;  1SMX A;  4ME3 A;  1Q8K A;  3HOW H;  4OX9 L;  5IYD G;  4GLX A;  3AEV A;  5ELO A;  1I6H H;  1N8R C;  3PO3 G;  3HOX G;  1CKN B;  1XPU A;  2DGY A;  4JBM A;  1UE1 A;  1Y1V G;  2OQK A;  4B3T L;  1XNR Q;  1JJ2 A;  2ID0 A;  1S40 A;  1EQR A;  3BZK A;  2AWO A;  1W2B A;  1X9N A;  1SFO H;  1EYG A;  3LGJ A;  2ZTE A;  2KHJ A;  3SGI A;  3CF5 A;  1N36 L;  1EFW A;  2OTL A;  3J81 i;  1FJG L;  2KEN A;  1HZ9 A;  3K80 C;  3I4N G;  4IFD G;  5AJ3 L;  1YHA A;  4IPC A;  2ES2 A;  3NEM A;  3HOV G;  2UU9 Q;  3M85 A;  1SR3 A;  2JJQ A;  4C3I H;  3U58 A;  5M5Y H;  4P71 A;  3H3V H;  2HT1 A;  4DK3 C;  2UUC Q;  4BXX G;  3TQY A;  1HZC A;  4YHH L;  3PUY A;  4B3S Q;  1VS0 A;  4QQB X;  3Q8D A;  3CCS A;  2IHF A;  2GVB A;  2Q2H A;  1YHB A;  3IRB A;  3CCU A;  3GDE A;  4DR1 Q;  3GTP H;  1NTG A;  1PYB A;  4JC0 A;  4A3C G;  1YVC A;  4JI8 L;  4DV6 Q;  1CKN A;  1HNX L;  1GKH A;  5HY6 A;  1VQO A;  2JEA I;  2ZTD A;  1L1O B;  2VUM H;  1UWV A;  2K5V A;  3B6Y A;  4TVA B;  4JI6 Q;  4HJ5 A;  3I56 A;  4KHP Q;  5LMN W;  4LFC L;  4DV1 L;  4MTN A;  1GM5 A;  2UUB L;  4X65 Q;  1HZA A;  1B7Y B;  1M90 C;  2R92 G;  4UP7 A;  1RIP A;  2JA6 H;  4IJL A;  3CCE A;  1BVS A;  4DR6 L;  4DV2 L;  1FL0 A;  2JA8 H;  3I7F A;  1YJN A;  2KCT A;  2JK8 A;  1V1Q A;  2JE6 I;  2CWA A;  4A3L G;  3GTK H;  5FJ8 H;  4GLV B;  5C3E H;  2UXC L;  4JI0 Q;  1JJG A;  1N32 Q;  3HOY H;  2K5N A;  2RHS B;  1UE5 A;  3FKI H;  3CQZ H;  4X6A H;  4B3R L;  4DUZ L;  4GNX A;  1I3Q H;  2F3I A;  1DGS A;  5IYB H;  5C44 G;  4EQ5 A;  5JJI A;  4A3F G;  2PQA B;  1CKO A;  1EIF A;  1KAW A;  4GOP A;  3I55 A;  2AHO B;  2YTY A;  4R4O A;  5FLM H;  4DAY B;  4OWW B;  2IX1 A;  2N8N A;  4DR2 L;  4JI4 L;  3J7Z C;  4A3D G;  1Y14 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...