4JI5Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji5Q00
4DV2L 4DR2L 1IBKL 1SRUA 1QZHA 3H3VI 3I4NH 2RHSB 1T9HA 1VQ7A 1H95A 4UP7A 2R7ZG 1E3PA 1WOCA 5C44G 3I55A 2BA0A 3CF5A 3UDGA 2E2HH 3EBEA 2UUBL 2F52A 1A8VA 2NN6I 4GLXA 4AQYQ 1O7IA 1XMQL 5C44H 4JI7L 2UXDL 2CWAA 3PUZA 3RN5A 1OXUA 2JA6H 4A4IA 4DR5Q 3A5UA 4EQ5A 4LFBL 3L0OA 2Y0SG 3W1BA 5BR8L 4YCUA 5JEAG 4LF5Q 4JC0A 4LWCA 2K5VA 5IYCH 4JI0Q 4LF8Q 2B63H 4XIGS 4UP9A 4R4IA 3T1HL 3GO5A 2PQAA 4B3SQ 4RG1A 4X66Q 1EQRA 2UUAL 4YCVA 1S72A 1L1OB 3SGIA 1A63A 1EIFA 2LXKA 1EYGA 1WI5A 2NN6G 3L2PA 2VQFQ 2Z6KA 2JA5G 4YHHQ 1HJPA 4R4CA 2NZOA 2WFWA 4NPSA 1X3GA 4DNIA 4TVAB 2Q2TA 2YV5A 2KHJA 4GN4B 5JEAJ 2AWOA 3CXCA 5H1SE 4HJ9A 1CKMA 5HY6A 4WJ4A 5ELNA 2D62A 4DV0L 1X3EA 2KCTA 5M5WH 1EFWA 3I4MH 1PH6A 4JI2L 2RCNA 1KC8C 1N36Q 4IJHA 4KI0A 4HJAA 3BZKA 2Q2UA 1VQAA 5IYBG 2K52A 1MJEA 4LFAL 2I5HA 2RF4A 3D31A 1HR0W 3UDIA 1L1OA 1Y1WG 1XNQQ 3EIVA 1PH3A 1TWAH 1M1KC 5IP9H 3L7ZC 1B70B 2CCZA 1G6PA 5IYDH 4KHZA 2KBNA 4WJ3M 4A3KG 1XMOQ 4JI4Q 1VQJA 4BXXH 3T1YQ 1KAWA 2D0OA 1SFOH 1CUKA 1N32L 1S3OA 2A8VA 3KF6B 3CP0A 4IOCA 4LF7Q 1B8AA 2IX1A 1HNWQ 1IXRA 1UE6A 2MO1A 1Z9FA 4KLKA 2HT1A 3HOUH 1EWIA 1SMXA 3F1ZA 2VL6A 4DR2Q 2N49A 4JI6L 4JBJA 4QQBX 1Q86C 1ASYA 2E2JH 3A0JA 3TS0A 2K5NA 4X65L 5LMNQ 1XNRL 3S17H 4DUYQ 2UU9Q 2ALYB 4OXPA 4PZ6A 3OW2A 1Q7YC 2IT1A 1B7YB 5C4JH 3H0GG 3NBHB 1W2BA 1PFSA 1K3RA 3K7UC 4A3FH 4IOAA 3S14H 3OTOL 4DUZL 1YHQA 3H0GH 2C35B 3GTKH 3CCUA 1EOVA 3J81j 3GTPH 4GN3B 3GTOH 1GVPA 3CW2C 1IBLQ 1XTDA 3KF6A 4YWLA 2AMCB 3UDFA 3M3YH 1GD7A 3HOXG 2VY3A 2N78A 2R93G 4DK6C 2N8NA 4LF9L 1HZ9A 3S24A 3A74A 4LF6Q 4OO1I 3HOXH 5C3EG 4DV3Q 4DR6L 2R93H 2R6GA 3U4VA 3PUWA 4HJ7A 4DR7Q 4MZ9A 4UPAA 2XGTA 3M7NA 2HIXA 3AFPA 4IFDI 5EAYA 4ME3A 2K4KA 4PZ7A 1QVCA 2CKZB 2QGQA 3RLFA 3G71A 1BBWA 2QA4A 4DR1Q 5LMUL 3S1MH 1K73C 4DV0Q 5FLMH 2GN5A 4O2DA 4XTCS 5HGQA 2JA8G 1FL0A 3HKSA 3PUYA 4LFCQ 1KHIA 5GAEC 1OXXK 3TEHB 4GLVB 1R9TH 4OO1G 4DV5L 4DV7Q 1VQ5A 4DR3L 2HHHQ 3DM3A 1VQ6A 4A3IH 3I4OA 3KOJA 4JYAL 4BBRH 4OWXB 4JI3L 1BVSA 4LUOA 4DV4L 1Y1VH 1CKOA 1WFQA 3CPFA 4IFDG 1IL2A 1IBMQ 1A0IA 2CFMA 4NB3A 4YY3L 1K8AC 4DV6Q 3HOYH 3HOZG 3AQQA 2ID0A 4KHPL 3VDYA 2UXCL 2IHEA 3E9HA 2PNHA 3HOWH 2OTJA 4A3DH 3KJPA 2ATWA 4MNOA 4OX9Q 1EIYB 2I5LX 5JJIA 2EIFA 3J7ZC 4IFDJ 1LM0A 3GDEA 2R7ZH 4BBSH 1K83H 5AJ3Q 2JJQA 2EXDA 5E7NA 2VQEL 4GOPC 5DLQE 4A3GG 2Q2HA 1P8LA 4PMWA 3F2CA 3CCQA 3PO2G 1VQMA 1JJCB 3ULJA 4A3GH 1HR0Q 4P73A 1X9NA 3CMEA 4C3IH 3E9IA 1EQQA 4A3MG 1I94Q 3S1RH 3PO2H 2FXQA 3ZJYC 1VQDA 3H3VH 3IRBA 1I3QH 1VS0A 3K8AA 1UEBA 4JCVE 3CCVA 1HNXQ 2UUCL 1NY4A 1ASZA 5FLXc 2LXJA 2ZTCA 3ICEA 4B3RQ 1N34L 4JI1Q 1N33Q 2MFIA 4X62Q 4LF4Q 2JA5H 4A3CG 2YTXA 5C0XI 3KJOA 2H5XA 4A3EG 1TWHH 4B3TL 1NJIC 3BZCA 1MJCA 3FHWA 2R92G 1TWCH 4HIOA 3M9BA 3G4SA 2WAQE 1VQBA 4IPCA 4AH6A 2ZM6L 2WP8J 2ZJPA 4UP8A 2R92H 2B29A 4JOIA 1Q46A 3RR5A 5FJ8G 4L5RC 1FJGL 3PV0A 4R1JA 1YIJA 4A3BG 4DR4Q 4BA2I 4LUVA 5IE8A 5IYBH 4BY7G 4JI8L 2E2IH 3H15A 4DV1Q 5M3FG 4JBKA 1CKNA 4NXNL 1Y1WH 4DPGA 2MQHA 2IX0A 1VQGA 4X64Q 1J5EQ 4B3ML 3CD6A 5C0XG 3U4ZA 4UY8C 1IYJB 4BY7H 2GVBA 3I2ZA 4Y7NH 5M3FH 1G291 3BU2A 4GKJQ 4LW1A 3U50C 1MIUA 1OTCA 4GLAC 3RLNA 4A3KH 2NVTH 4DKAC 2F4VQ 1YHBA 3S1NH 1JMCA 2JQOA 2KCMA 1NE3A 3G6EA 2UXCQ 2YYZA 3PF4A 3STBC 1HNZQ 4HIMA 4QGUA 2UXBQ 2VW9A 5GADC 4DV2Q 1IBKQ 1SN8A 2IHFA 3NELA 2E5LL 4GNXC 3AFQA 2K50A 1I6HH 1TWFH 2BH2A 4GKKL 5C0XJ 1NTGA 2B3GA 4LFBQ 3ERSX 4MTNA 2UUBQ 1VQCA 3M4OH 4HIDA 3GTQH 2KENA 4R4QA 2NVYH 1PHJA 1C9OA 1WYDA 1PVOA 1XMQQ 4JI7Q 2UXDQ 1UE7A 3NEMA 1HZBA 4X6AH 4HJ5A 1KRSA 2A1AA 4JV5L 4YCWA 5J3BA 3S15H 1YVCA 3U58A 1GO3E 2ZTDA 1WCMG 5BR8Q 4POFA 1XPUA 1C0AA 4R4OA 3T1HQ 3KLWA 3F8TA 2QEXA 3I7FA 1PH8A 1UE1A 1YNXA 4AQYL 3GTLH 2I5MX 2YTVA 1YJWA 1W3SA 4JBMA 1YITA 1PA6A 3W1GA 2YTYA 3PIOA 2UUCQ 3K80C 4DR5L 4IPHA 2JEBI 1K8GA 5C3EH 4Y52H 4EX5A 1VQNA 1KD1C 4LF5L 4LF8L 4JI0L 3MXNB 3OYYA 4B3SL 1DGSA 3M4PA 4X66L 4PG3A 2WAQG 1XPOA 3I56A 1VQEA 3JAMi 3CCJA 1L2FA 3GTMH 1Q1BA 4JI2Q 2VQFL 2IY5B 2MO0A 1QVFA 1Q81C 4LFAQ 1X6OA 2JA9A 3ULLA 4YHHL 4L5TA 3KDFB 1QVGA 2R7DA 2JA8H 3S1QH 5JJKA 1U0LA 1XJVA 1X54A 1Z47A 4TQUS 3HOVG 3PO3G 3Q8DA 4IJLA 1QZGA 3TS2A 1EUJA 3PO3H 2JA7G 3RLOA 1LYLA 3W5OA 3HOVH 2CWPA 4L5QA 1KQSA 1JT8A 1NBWA 1UWVA 2OCEA 3G48A 5GQOA 1N36L 4DK3C 4GS3A 1SLJA 3STBD 3HOZH 3RZDH 3S2DH 1N32Q 1RL2A 4O0AA 5M3MG 1X56A 1TWGH 1XNQL 2VUMG 3ULPA 4C2MH 4POGA 5C4XG 4JI6Q 1G51A 1HZAA 1KRTA 5GAHC 2HQLA 3K7AH 3EN2A 2YU9H 3KDFA 3AYHB 1XMOL 4X65Q 5C4XH 3CC7A 1XNRQ 1I50H 3PUXA 1L0WA 4K0KL 1VQKA 4JI4L 4P71A 4C3JH 2Z0SA 3PCOB 5IP7G 3T1YL 2OWOA 1AE3A 5GAGC 1V9PA 4A3JG 1PH2A 3OTOQ 4DUZQ 1VQ9A 4LF7L 1HNWL 4L5SA 4H02A 1Y14B 3HKZE 3PUVA 2JK8A 3DLLA 4ALPA 1XPRA 1KL9A 1D7QA 5IWAL 1SR3A 3PF5A 1RIPA 3FKIG 1Q8KA 2ASBA 4AIMA 3S2HH 3J81i 5LMNL 3A5ZB 1V43A 3PSIA 1MKHA 3JAMc 4DUYL 3FKIH 1CKNB 2UU9L 4LF9Q 4A3MH 3GTGH 3KF8B 1QUQA 2JA6G 1YHAA 4NXML 3JC66 4DR6Q 3E0EA 1N8RC 2PMZE 2DUDA 5IYCG 1PH1A 1CSQA 1PH7A 1VQFA 2B63G 1U5KA 3RNUA 2D0PA 5M5YH 4A3CH 1IBLL 4A3EH 2UUAQ 1WJJA 4OONA 3TQYA 3J7A5 5LMUQ 4OWTB 2HIVA 2Z6KC 2AHOB 4LF6L 1VQIA 1SE8A 4R4TA 1OXTA 3ER0A 4DV3L 2A19A 4GNXB 1JJGA 1YI2A 5FJ8H 1JB7A 1N9WA 3CQZH 1YZ6A 3TREA 4DV5Q 2I0QA 5IT9c 1OXSC 4DR3Q 2JEAI 3D0FA 4OWWB 4A3BH 4DR7L 1FGUA 3B6YA 4FDBA 5ELOA 1BBUA 1PH5A 1K0RA 3MEFA 1X55A 4DV4Q 3RN2A 4BY1G 4JI5L 4JI3Q 2WB1E 3I4MG 4DR1L 3AEVA 4P75A 4YY3Q 1YJ9A 1X3FA 4JOIC 1PH4A 4BY1H 5K36G 4AYBE 3CPWA 1D8LA 4KHPQ 1Q1EA 4LFCL 1LTLA 2KHIA 1L1OC 2NZHA 5IP9G 2AKWB 4DV7L 1VQHA 5IYDG 2HHHL 3RZOH 1K9MC 3HFZB 2K5HA 1UE5A 1IZ6A 2LSSA 2E8GA 3NENA 4YWKA 2GVAA 3M4QA 1AE2A 4APVA 2L15A 3PIPA 2DGYA 1M90C 4GNXA 2OTLA 2ZJQA 3J81c 1PYSB 4BXXG 3CAMA 4DAYB 1E1TA 3PGZA 2MNAA 1IBML 2NVXH 4K0KQ 2K14A 4DV6L 4QL5A 3KFUA 2VQEQ 4JBWA 3CCEA 3J80i 1YEZA 1GM5A 4DAMA 1E1OA 3HOUG 3HKZG 4J15A 4OX9L 4BA1I 1VQ8A 1VQOA 2CQOA 1PYBA 5IWAQ 1WCMH 1NMGA 2PI2E 5M5XH 2VNUD 4YWMA 3K81C 4RMFA 1AH9A 1HZCA 3BJUA 5AJ3L 3CCSA 4A3FG 1YBYA 2BH8A 2BA1A 4NXMQ 4LNQA 1N34Q 2ZTEA 2F3IA 2VS1A 1OXVA 5GROA 2Y0SE 4JYAQ 3S16H 4QIWE 1C7YA 4B3TQ 1HR0L 2Q2IA 4IPDA 1JE5A 1VQ4A 1KIXA 1J6QA 1E7ZA 1I94L 1A62A 3CCRA 2ZM6Q 3KYHC 3CCLA 3F2DA 1X65A 1HNXL 1Q82C 3WWVA 1VCIA 1GKHA 1FJGQ 3CMAA 4B3RL 2XTIA 4JI1L 3UE0A 3GTJH 1N33L 3FP9A 4PZ8A 4X62L 4JI8Q 4QJFA 4LF4L 2NVQH 1TXYA 4NXNQ 1VQLA 4P74A 5LMNW 1YJNA 3CC2A 4GOPB 4B3MQ 1PV4A 3TRZA 2WB1G 1E22A 5FLMG 3GD7A 4A75A 2RHQB 1NMFA 3K0XA 4P72A 2JA7H 4BBSG 3LGJA 2ZJRA 1V1QA 4AYBG 2R7FA 3J80c 1P16A 5IY0A 4JG2A 1S40A 4DR4L 3UE1A 1PH9A 3UDXA 4A3IG 4A3LG 2OQ0A 4BBRG 4IPGA 3CCMA 1VQPA 1QUQB 1LUZA 2N3SA 4DV1L 1Y1VG 4HJ8A 2PI2A 5M3MH 2AWNA 2E5LQ 1Q12A 2ES2A 2VUMH 4X64L 1J5EL 1SROA 4GKKQ 4A3LH 2EQSA 4GN5A 4HIKA 4GKJL 3HOYG 2VZAA 1CSPA 1I5FA 5JJLA 4A93G 1E24A 3M85A 1BKBA 3F2BA 1FVIA 2K75A 1JJ2A 2OQKA 4C3HH 3CC4A 1KXLA 2F4VL 2V1CC 3HOWG 4GOPA 4A3DG 4QY7A 4A76A 4JI5Q 4A93H 1HH2P 4JV5Q 5IP7H 2PQAB 3I4NG 4LUZA 1HNZL 2UXBL 2JE6I 4A3JH 4IO9A
chains in the Genus database with same CATH superfamily
2MGSA 1II3A 4NP5A 4RGTA 5EKLA 3H3VI 1LT4D 1T9HA 1AZPA 2E2IB 1VQ7A 4L8JA 4BBSG 2B8FA 3I55A 2E2HH 2BA0A 1A8VA 4FXDA 5A2QE 1OXUA 4A3KB 1GUTA 4EQ5A 4LAAA 1GXDC 2F0WA 4LF5Q 4LWCA 4C3IG 5IYCH 2FFKB 2EJGC 3GO5A 4B3SQ 4RG1A 2K32A 1I6HB 1C8CA 1EIFA 3DM1A 2L11A 2LXKA 4M8AA 3L2PA 2Z6KA 1HJPA 2PCFB 2NZOA 4DNIA 1X3GA 3LNNA 2KHJA 2AWOA 2ICIA 2IPKD 2RDFA 2Z4IA 3D8GA 3W2DA 5BN5A 2ICEC 3I4MH 1EQTA 2RCNA 3I70A 1KC8C 3L9AX 2Q2UA 3NBIA 1SYGA 2G9HD 2K52A 1Y1WG 1L1OA 5ELFA 1HFNA 5CORA 2MP1A 2CCZA 1G6PA 5IYDH 4WJ3M 1XMOQ 2O4XA 3NPPA 4CJ1B 1VQJA 3K5OA 4DXGA 1S3OA 3CP0A 1STAA 1L0XB 2EYOA 1IXRA 2CQAA 2MO1A 1BCPF 3NTHA 3S1QB 1PFNA 1EWIA 3F1ZA 1KLUD 4DR2Q 4JI6L 1TIID 1FD7D 1PTOB 1I4PA 5LMNQ 5D65A 3S17H 2UU9Q 2ALYB 4QF4A 1UNSA 5EPJA 4A3FH 4IOAA 4RKLA 1IKLA 1TS5A 1CZGA 1VF5C 1B2TA 3A7LA 4IUNA 1F2MA 3CCUA 1RJTA 1TWGB 2NYZD 4N8FA 2X6LA 1XTDA 4R8NA 5KYLA 1ZEQX 1YNJC 2EY2A 2N78A 1SNQA 2HD3A 4DK6C 4LF9L 1HZ9A 4V0BA 1HPCA 4DV3Q 4DR6L 3P75A 1D5XC 4WJWA 2R6GA 1HA6A 4U673 5CYUA 3OWEB 3EA6A 4IUTA 4B9WA 3Q0AA 2K4KA 3RLFA 2CKZB 3PO2B 1GHKA 4XTCS 1ZKOA 1FL0A 3X3MA 2PW5A 5GAEC 3TEHB 1R9TH 4KHVA 1VQ5A 2HHHQ 3A56A 4KY5A 4A3IH 4OWXB 4DV4L 3BVZA 1UEAB 2E75C 2NBFA 4IFDG 3D4WA 1A0IA 2CFMA 5I6WA 4YY3L 1JB3A 3HOYH 1Z6HA 2UXCL 1WVLA 2EZVA 3HOWH 4CJ2C 3KJPA 2ATWA 3D4DA 2I5LX 1A2UA 3EFXD 4U68A 2XSCA 2F0UA 5DLQE 1EZ6A 4PMWA 3F2CA 1H9SB 1JWUD 1SNPA 5FO9B 4UHVA 2SNMA 3ULJA 1C4QA 5G3LD 2BE5C 1YNJD 1JWMD 3E9IA 4EQNA 3MXGA 3S1RH 2RBMA 3ZJYC 1VQDA 3H3VH 3IRBA 1I3QH 1VS0A 2AQ2B 3VR2A 1GUOA 5IGCA 1ASZA 3K5NA 4B3RQ 4ZQ3A 1PFBA 1N33Q 3R2IA 4X62Q 4A3EG 3BZCA 1IYUA 5I2XA 3QOJA 3RD4A 1WCMB 4EQPA 4C56C 5C5LA 4L5RC 1FJGL 3PV0A 1YIJA 4A3BG 4DR4Q 2DY7A 3NSWA 4BA2I 1K8OA 3IFDA 5IYBH 4FF1A 4JBKA 2EYLA 1CKNA 4KKTA 3K58A 2IX0A 4X64Q 1J5EQ 5C0XG 1IYJB 3I8ZA 2GVBA 3I2ZA 4LW1A 1QWYA 4RGNA 1MIUA 2NVTH 2P5ZX 4KK7A 1JMCA 1CI3M 2L9HA 2WAQB 5C3XA 3R8BA 1HNZQ 2UXBQ 4DN4M 4S3SA 3FRPB 5I6YA 1MD2D 5GADC 1IBKQ 2E5LL 3HG9A 1PMRA 4RHSA 2F0QA 1BUVT 5KGUA 4GKKL 2UUBQ 3EQLC 3HOVB 1BXTA 3VA5A 4R4QA 1HZBA 3W3AA 1TY0A 5ELEA 1JR0D 3KLSX 1GO3E 1YNNC 5BR8Q 1XX8A 1XPUA 1KDCA 3F8TA 2FMCA 1UE1A 1YNXA 3I3CA 4AQYL 2A5HA 2YTVA 1YJWA 1YITA 2K05A 4IUPA 1K8GA 4N9PA 4EX5A 4LF8L 4A3JB 5KNDA 1GUSA 1DCZA 1HQMC 2JN4A 3M4PA 2KEEA 4PNYA 3I56A 1VQEA 3GTMH 2E2HB 3FKIB 5JJKA 4YHHL 3LWEA 3VYTA 2JA8H 2R7DA 1PYWD 3PO3G 4XDXA 1X54A 4TQUS 4XQQA 3KBXA 1D2BA 1WD0A 1PRTB 3PO3H 2JA7G 1HTLD 1Y8OB 5CV9A 3RLOA 3G48A 4RFBA 4GS3A 1ESFA 3HOZH 3S2DH 1RKNA 3I90A 4HEDA 1JOKA 3E0JA 2DNEA 4O0AA 3V05A 5JAVA 3J80L 5EGTA 2LKVA 1TR5A 1KRTA 2HQLA 3K7AH 3EN2A 2M2LA 4X65Q 4C3HG 1XNRQ 3SK4A 1VQKA 3VYSA 4P71A 1SE2A 2R61A 3T1YL 2BOSA 4BY1B 1EYAA 1AE3A 3BYYB 1V9PA 3QJYA 1VQ9A 3OTOQ 3DMUA 3I4MB 1YNND 1LLRD 4H02A 1Y14B 3HKZE 3DLLA 1XPRA 1EFID 4ALPA 3HRZC 1K8MA 4HR7B 4KY7A 2ASBA 4AIMA 3J81i 4FF2A 3OSOA 3KF8B 2JA6G 1YHAA 5ELCA 2I07B 3E0EA 1EY8A 2MUYA 2PMZE 3WOFA 3GV6A 3MEHA 2D0PA 2CW0D 4A3CH 1KTKA 4OONA 3J7A5 5LMUQ 5IGBA 2LMCB 4J8QA 3S17B 1KDAA 4CDCC 4R4TA 1OXTA 3ER0A 5I4DA 4GNXB 4UDUC 3CQZH 4A3FB 4DV5Q 4DR7L 3NTKA 1OXSC 2XNAC 4OWWB 2FINB 3OMGA 3B6YA 4FDBA 5ELOA 1X55A 2F0DA 4JI5L 4K2KA 4OHJA 4BS9A 3AEVA 1ENCA 3ITPA 3T56B 3J7YW 1X3FA 1DOKA 4F88A 4KHPQ 3SHLA 4LFCL 1LTLA 4DFAA 5IP9G 4DV7L 3J7AF 2WIIB 3RZOH 1R4QB 2ZJPA 1UE5A 3OW2A 3PIPA 3M4QA 1M90C 2DGYA 4K5XA 2LFNA 4BXXG 1LO5D 1IBML 3QWNA 2NVXH 2C9OA 1HHVA 4QL5A 3AB9A 3SE0A 1YEZA 1TU2B 1STBA 2F0EA 3FPUB 3HOUG 3VA7A 3U9SA 1VQ8A 1R9TB 2WACA 5D3DA 2CQOA 1PYBA 2VNUD 1NMGA 5M5XH 1STYA 3K5MA 4A3IB 3T53B 1U4PA 1I4RA 1HZCA 3NHHA 3UI2A 4H0LC 3BJUA 4MHEA 3CCSA 3KLRA 4NXMQ 3HOYB 4LNQA 2ZTEA 2KJXA 4A93B 2VS1A 4ULLA 1A3VA 3HOWB 3S16H 4QIWE 1C7YA 4HCSA 1QNUA 4RWSC 5CR3A 4MN3A 1VDZA 1X65A 1HNXL 1Q82C 1GKHA 3UE0A 3DEOA 3FP9A 3QOLA 4JI8Q 1TXYA 1YJNA 3N6RA 2F0IA 2WB1G 2Y0SB 5FLMG 3RUZA 4A75A 1NMFA 3K0XA 3A55A 3LGJA 4AYBG 2R7FA 3J80c 3BYTB 1I3QB 4FO2A 1M4VA 1VQPA 4BBRG 2WKDA 2PI2A 5M3MH 2ES2A 2VUMH 2DN8A 5JJLA 3F2BA 1FVIA 2K75A 1JJ2A 1DZ1A 2E76C 2PZWA 3QIAA 4KN4C 4JV5Q 2KEDA 4CDEC 2L0CA 1F9SA 4HMIA 4OL7A 2R7ZG 5C44G 3CF5A 2F52A 1STEA 5C44H 4JI7L 2UXDL 1K0SA 3PUZA 3RN5A 2NVTB 1E2WA 3L0OA 4G7ZC 4YCUA 1EIGA 2K5VA 1B3QA 1ENAA 3WDNA 2H1EA 4XIGS 4UP9A 1HUNA 4X66Q 3GQBA 4YCVA 1S72A 3SGIA 1A63A 5KNBA 2Z6BA 1JC7A 2G5DA 4OEMB 4CJ0B 2NN6G 2VQFQ 4KD4A 2JA5G 4R4CA 3F2UA 2WFWA 2YV5A 2F3WA 5JEAJ 3CXCA 5H1SE 2PZTA 5HY6A 4WJ4A 2RA4A 2SNSA 3M3YB 4FF4A 3TDQA 4JI2L 4ZUIA 1T5EA 1N36Q 3MZ5A 1EU3A 4LFAL 1MJEA 4DNTB 4G4KA 2BH2A 3EIVA 1PH3A 1M1KC 2XRSD 2KBNA 1EYDA 4TRDA 3HZXA 4JI4Q 2B2TA 1SFOH 1CUKA 3O13A 3GTMB 2A8VA 1ESRA 1HNWQ 5FKAC 1ZXTA 2JA8B 3VR4A 5IGDA 3S9WA 1TQOA 2OT2A 2E2JH 2KCNA 2K5NA 3TS0A 2K6AA 1Q7YC 1B7YB 2AUJD 5C4JH 4G57A 3JAME 3NBHB 2EXZA 3K7UC 3PMFA 4DUZL 2F0HA 2N55A 3NUCA 3HOZB 3GTKH 4F7XA 1EOVA 1JQYD 3GTPH 5T1IA 4GN3B 1PTOF 1X3QA 3KF6A 2AMCB 3G7LA 2VY3A 2R93G 1G91A 2NTTA 1EEFD 5A2QL 4JK1C 5C3EG 1HUMA 2R93H 3KLSA 3PUWA 4HJ7A 5I9OA 4MZ9A 3E5SA 1CQFA 2G9DA 4K8JA 3C1FA 4IFDI 4A3GB 4ME3A 2UUAL 3S1MH 1BBWA 2QF7A 2QILA 4OO1G 1LT6D 4DR3L 5CV6A 3DM3A 3I4OA 4JYAL 2IW3A 4OO1H 1BVSA 1Y1VH 4B08A 3CPFA 3BVGA 4NB3A 2EYJA 4DV6Q 2RCFA 3T13A 3VDYA 4KN7C 2B2YC 5JJZA 2PNHA 1BBXC 3NWSA 3CQZB 3J7ZC 2DY8A 4BY7B 4BBSH 1K83H 1PRTC 4ZKCB 5E7NA 2VQEL 4GOPC 4LK1C 1F9QA 4NKLA 2DJFC 1TS4A 5BN4A 1JJCB 4IQZA 3RZOB 4C3IH 1EQQA 4A3MG 5EBDA 4RCNA 3IFTA 2RSOA 2UUCL 1STNA 1F2YA 2LXJA 1TS2A 2B2WC 4JI1Q 1EY6A 4LF4Q 2YTXA 5C0XI 3KJOA 4B3TL 1U4RA 3FHWA 1NJIC 1TWCH 4HIOA 3G4SA 2XWJB 2A69C 1VQBA 2ZM6L 2RVLA 4UP8A 2M9VA 1Q46A 3RR5A 4ZCKA 3TP5A 3CRLC 4R1JA 4KKSA 3ONAB 4K2LA 3SXHA 1D5MC 3FPPA 4DV1Q 5M3FG 1SYFA 1Y1WH 1VQGA 3CD6A 1ZYRC 3U4ZA 5KNCA 4X3TA 4WFN3 4Y7NH 5M3FH 3S16B 1G291 4KJOA 4PMBA 4GLAC 2HCIA 3R93A 1YHBA 4DU9A 3MWYW 2E2DC 2F4VQ 3S1NH 2KCMA 4HMJA 2UXCQ 3PF4A 3STBC 4HIMA 4OIJA 5I2YA 4DV2Q 4L63B 1GHJA 3NELA 4GNXC 5IOCA 2B3GA 4LFBQ 1PRTD 3GTQH 2KENA 2NZ1D 1C9OA 4DAVA 1PVOA 2F0LA 1XMQQ 3NEMA 2FHTA 4X6AH 4HJ5A 1AW7A 1KRSA 4YCWA 5J3BA 3RZDB 3S15H 1EWHA 4POFA 1TS3A 4K8IA 1LT3D 1G8ZD 2R3ZA 4R4OA 3T1HQ 3KLWA 3NQIA 5M3MB 4ZKBB 2J0TD 1NCVA 2VUMB 3I7FA 2CH4A 5JVG3 5C4XB 3GTLH 1W3SA 1AEXA 2NB0A 1CA6A 4Y52H 2FJ2A 2O5IC 2A6EC 4LF5L 3MXNB 2A69D 4B3SL 1O7LA 4PG3A 1XPOA 3I4LA 4LJZC 1Q81C 1X6OA 3ULLA 4L5TA 1LT5D 1U0LA 2RDGA 3NE5B 1ZYRD 3C46A 2WINB 1EUJA 3W5OA 5M5YB 2CWPA 1KQSA 1JT8A 1NBWA 3SK6A 4IFDH 3STBD 5T1GA 1N32Q 4ILWA 1SYDA 2TSSA 4C1NK 5F2DA 3MTSA 4POGA 1HZAA 4C3JG 2YU9H 3KDFA 3AYHB 1XMOL 3PUXA 4K0KL 2A74C 3D6CA 4C3JH 2ZT9C 3KBGA 5IP7G 2OWOA 5GAGC 4L5SA 2JK8A 4NMZA 4Q0FA 3H3VC 1NR2A 2O5JC 3CU7A 3PF5A 2IX3A 1PZKD 4XXEA 3S2HH 5LMNL 1IL8A 3A5ZB 3PSIA 2UU9L 3GTGH 3FVQA 1SNOA 4CBVA 4PV1C 2F4IA 2A6ED 1PH1A 1PH7A 2B63G 1FNWA 3RNUA 1CFMA 2A68C 5FK9C 4A3EH 3HKZB 2HIVA 3FMCA 1CTMA 2AHOB 1SE8A 4DV3L 2A19A 3E3XA 5C4JB 2Z4HA 1N9WA 2JEAI 5ISRA 4A3BH 3D0FA 3H94A 2K01A 1BBUA 2PMZB 3MEFA 1PH5A 4JI3Q 1V1PA 3GTKB 2WB1E 2D9UA 3OIPA 1F9RA 4FXKC 3GTPB 4P75A 5C0XH 1YJ9A 2CVRA 1PH4A 4AYBE 1D8LA 1Q1EA 2KECA 5HGTA 1Y8NB 2R93B 2HHHL 2HDLA 5CMDA 3D3RA 4YWKA 2E8GA 2NVQB 1VMPA 1AE2A 2B2VC 2L15A 2ZJQA 2D5DA 2IWHA 1AZQA 1E1TA 1MSGA 3S1MB 1F2LA 3AU7A 2DNCA 3J80i 3KK7A 1Y69U 1GM5A 5G3LF 4O42A 1QILA 1CT1D 2BCOA 1VQOA 5EPLA 4K6LA 1SAPA 2PI2E 3NP8A 4YWMA 3PQIA 2CH4W 4M1UB 4RHRA 1Y1VB 3K6OA 1YBYA 5HURA 1EQVA 2Z9HA 1ET6A 2BH8A 2BA1A 4OIKA 1N34Q 5GROA 1OXVA 5FLXE 1SNMA 2EY6A 2RQXA 2A68D 2K5QA 1JE5A 1VQ4A 2CW0C 3FDTA 1J6QA 1E7ZA 3KYHC 3CCLA 5CGKA 3V96A 3WWVA 1VCIA 4BBSB 1K83B 4R8IA 3CMAA 1Y8PB 4B3RL 2XTIA 2PNRC 3GTJH 1N33L 2F0FA 4XQNA 4PZ8A 4X62L 4UAIA 3TN2A 4NXNQ 1VQLA 3OMCA 4GOPB 1QE6A 4B3MQ 3NBHA 4XYQA 3TRZA 4V190 1WTHA 3GD7A 2RHQB 4P72A 2JA7H 4QIWB 4C3IB 1V1QA 3SDZA 1P16A 4JG2A 1S40A 4DR4L 1MBYA 3VYUA 4A3LG 5C3WA 4IPGA 1WTVA 1H9MA 2Q8TA 1WTWA 3EJIA 4A3LH 4X64L 1J5EL 2EVBA 4HIKA 2EYHA 2F3VA 1Q90A 1I5FA 1G2TA 1TWCB 1KXLA 4C3HH 3A7AB 4A3DG 1X32A 5KYIA 1HH2P 3ERQA 1A3TA 3I4NG 1HNZL 2NWGA 2UXBL 1RDPD 1IBKL 1SRUA 2L55A 4X3KA 3I4NH 1H95A 1E3PA 1JJGA 1Y1WB 2UUBL 3EBEA 2NN6I 4IUVA 4GLXA 5I9PA 1RTNA 1Q8IA 2JA6H 4A4IA 4DR5Q 3A5UA 3H6MA 3S1NB 3W1BA 5EPKA 5BR8L 5IGEA 4EVOA 4JC0A 4JI0Q 1PDQA 2L4NA 5C4HA 2PQAA 1L1OB 1O7ZA 1EYGA 4DXFA 1WI5A 2KA7A 1LTRD 1A2TA 2PQEA 4NPSA 2Q2TA 4DK0A 4TVAB 2KHSA 1GUWA 5JOBA 1CM9A 4GN4B 4ABNA 1WTRA 1K28A 1CKMA 3A8KE 5ELNA 2D62A 4ODGA 4OELB 3HGBA 4DV0L 1X3EA 2KCTA 5CV5A 1EFWA 3M4YA 2KCCA 3IAYA 1D1IA 1GOZA 4KI0A 4HJAA 3BZKA 1X3PA 1VQAA 3GTLB 4FP5D 2I5HA 1HR0W 3UDIA 1CQVA 3J80E 1XNQQ 5IP9H 1QNKA 1B70B 3L7ZC 4A3KG 5FO8B 1A3UA 4BXXH 1KAWA 1JOOA 2D0OA 1I4QA 3TP6A 2TMPA 4LF7Q 5IGGA 1B8AA 5E4WC 4TSSA 1UE6A 2NUCA 3HOUH 3OHXC 4JBJA 4OGQC 1Q86C 1ASYA 3A0JA 4JW0A 3MFGA 4X65L 1XNRL 4DUYQ 1AN8A 3DXJC 2IT1A 5EQ0A 1KAAA 4J1MA 3OTOL 2PW7A 2B39A 4PMCA 2B2UC 2C35B 5DNFA 3J81j 5M9OA 3GTOH 1IBLQ 4YWLA 4FF3A 3UDFA 1GD7A 3TBIB 3HOXG 1QG7A 3LWUA 2F0GA 2YU9B 1LTBD 1SYEA 3A74A 3BDOA 4LF6Q 4OO1I 2JSOA 3HOXH 4C3JB 1AP0A 4UPAA 2A6HC 3AFPA 2SDFA 3G71A 1QVCA 4JVZA 4DR1Q 1JOQA 5LMUL 3K0YA 3S1RB 5FLMH 2GN5A 3S2HB 5HGQA 3P7JA 3QR8A 1MI2A 1PZID 4GLVB 4DV5L 3G6JB 4HCEA 3KOJA 4CGYB 4G7HC 3DUZA 4BBRH 2HCCA 4ZLTF 1CKOA 1IL2A 1EU4A 1SE4A 3Q6SA 1K8AC 1EY0A 3J81E 4A3EB 3AQQA 2ID0A 4KHPL 2F0PA 3E9HA 3FEWX 2OTJA 3MXNA 1XTCD 2CHBD 2D2CC 4Q5VA 4MNOA 4OX9Q 1EIYB 4ID6A 3Q24A 5JJIA 2EIFA 1EY7A 4HN7A 4A3BB 1SNCA 4IALA 4IFDJ 1LM0A 5NUCA 3TSSA 2R7ZH 1RF2D 5AJ3Q 2QDLA 4CDFC 1STGA 2VB3X 2Q2HA 1P8LA 2K7VA 5CV8A 3CCQA 1A6XA 3PO2G 2NTSA 1SEBD 1HR0Q 4P73A 4I65A 3CMEA 1I94Q 3PO2H 4ZAIA 5JPMC 3OIQA 4JCVE 3K8AA 1S5FD 1UEBA 1NY4A 4RA8A 4XT1B 4RH6A 3JAML 2ZTCA 3ICEA 2NN6H 1F77A 1SSOA 3RMHA 1QJOA 2JA5H 2A6HD 2H5XA 1TWHH 3I73A 1EY4A 1MJCA 3BDLA 4RGOS 4IPCA 5EJWA 1H9SA 1SYCA 2F0SA 1PXUA 2F0OA 2B29A 2WP8J 4JOIA 4AH6A 1FNUA 4ZYSA 5FJ8G 1RCVD 2Z8LA 5IE8A 1D5ZC 4JI8L 2EE1A 3H15A 1PLFA 1QB5D 4DPGA 3HP3A 4JYAQ 2SEBD 5IT9L 1B44D 1DD2A 4UY8C 4GKJQ 3BU2A 1SMYC 2B8GA 3U50C 1IKMA 3OPOA 3RLNA 1OTCA 1HTPA 3TP7A 4K6DA 4DKAC 2EY5A 2JQOA 1NE3A 3C1EA 3G6EA 4EQOA 4QGUA 3IKJA 3GTJB 1SN8A 2IHFA 2Q8RE 1QCBD 2K50A 1TWFH 3PIO3 5C0XJ 1NTGA 3GV3A 4MTNA 3M4OH 3PO3B 2XIWA 2MPMA 2NVYH 5IIFA 3MHBA 2F1MA 2JA7B 3VR3A 5D3IB 2ZXPA 4JV5L 2WV6D 2K5WA 4BWGB 2AQ1B 3S2DB 2N88A 3CHBD 1WCMG 5DM63 3ND8A 4R9WA 4DNRB 4XQJA 2JXMB 2F03A 1BCPC 3K7AB 1MGSA 1PH8A 1A15A 1SNDA 2L5TA 2UUCQ 3W1GA 5CV7A 4C3HB 4IPHA 2JEBI 5C3EH 1SJED 3NQTA 3OYYA 1DGSA 4X66L 3MVVA 2WAQG 1V1OA 3CCJA 1Q1BA 3EVQA 5LL6X 2VQFL 2MO0A 2IY5B 2ENBA 1QVFA 1J8IA 1FR3A 4HAEA 1QVGA 3BZDB 5CV4A 1XJVA 1Z47A 3T51B 2JA6B 3HOVG 2Q8IB 3URYA 4IJLA 1QZGA 3NXWA 1SMYD 4YIJA 5LHY1 2HQEA 3HOVH 3V2TA 4L5QA 1BO0A 5AFWA 1G2SA 1TY2A 2C5CA 2OCEA 1N36L 2B2YA 1X56A 3A54A 3SEBA 4C2MH 4JI6Q 4I7ZC 1G51A 2VXWA 5GAHC 1JE4A 1LTSD 4XT3B 1I50H 4JI4L 1JICA 2PYKA 4FXGC 4A3JG 1PH2A 3OOCA 1HNWL 1JWSD 2EOTA 4X3UA 1HXYD 5IWAL 1SR3A 1RIPA 2QKIC 3FKIG 3P20A 1LACA 1Q8KA 1EOTA 1BCPD 1I6VC 3JAMc 1MKHA 3FKIH 4LF9Q 1LV9A 4A3MH 2LY7A 2NVXB 3DWAA 1EY5A 1NAPA 4DR6Q 1DONA 2EYMA 5IYCG 2B2WA 4N8X1 1S5CD 3A8IE 5E3FA 4IUUA 3HOUB 5M5XB 3TQYA 4OWTB 1UUPA 1KLGD 2Z6KC 5JPNC 1VQIA 1ICWA 2MHVA 1YI2A 3T16A 1DOMA 4ZUJA 5IT9c 1VMCA 1W6JA 3QB3A 3KF8A 1S5BD 4DV4Q 4BY1G 3E6ZX 1LTAD 3I4MG 1F2ZA 4YY3Q 3GTOB 3H91A 4BY1H 3CPWA 2KHIA 1L1OC 1LTGD 3TZDA 3HOXB 4H44C 5IYDG 3NENA 2PO4A 2F0TA 2H4OA 3LX0A 3SK5A 4GNXA 2OTLA 1PYSB 4DAYB 3PGZA 5EBCA 3Q22A 3R3OA 4K0KQ 4DV6L 3KFUA 1TT2A 4JBWA 4MTKA 2WB1B 1E1OA 4J15A 2E74C 4AYBB 1STHA 1DYQA 2KUMA 2K28A 3TMEA 1DXMA 3Q23A 1AH9A 3K81C 4RMFA 4KJNA 4BBRB 1IHZA 3QG1A 4A3FG 1ML0D 1H9RA 5KRUA 2F3IA 3DHQA 1B53A 3U9OA 1DJRD 1QOHA 1CHQD 4JPBW 4QB4A 1O80A 1SYBA 3BG3A 4F87A 2J7ZA 2R7ZB 5C44B 1NSNS 3CKIB 1FJGQ 4JI1L 1BQQT 4LF4L 4QJFA 4O1NA 3HEJA 2F0KA 1PV4A 2J4XA 4L6TB 4TKOB 1E22A 4ZRZA 1XYIA 1LABA 1R4PB 1ICFB 1E2ZA 1KABA 5TSSA 1EWCA 2AQ3B 3UDXA 4A3IG 2OQ0A 1QUQB 2N3SA 4DV1L 4HJ8A 1PRTF 2E5LQ 4DGZA 2JA5B 1SROA 4GKKQ 2F0VA 1TWHB 1KDBA 4KV6A 2VZAA 1CSPA 4ZK9B 5C4ZA 3HOYG 4A93G 1E24A 3M85A 1BKBA 1NR4A 1BF4A 2F4VL 3HOWG 5E1FA 4A93H 3AMUA 5IP7H 5A35A 4LUZA 4DK1A 1EY9A 4IO9A 4DV2L 4WRDA 4DR2L 1QZHA 2RHSB 3D4RA 3DWPA 4UP7A 1WOCA 4LFBL 4F8MA 3UDGA 1B9MA 2K1BA 3MAQA 4AQYQ 1O7IA 2AUKA 1XMQL 1BNZA 2CWAA 2MJ8A 1SFOB 2L1BA 4XYOA 1SJHD 2Y0SG 2JYOA 5JEAG 4LF8Q 1HQRD 2HDMA 2B63H 4R4IA 3T1HL 3SK8A 5JEAH 1EQRA 1TWFB 2E2JB 3MFYA 3MXUA 2XRQD 3IL8A 3M4OB 1LTID 2NVYB 4DA2A 2RDHA 4DF7A 4YHHQ 1SXTA 1B9NA 5FLXL 3P1HA 4HJ9A 5KEEA 1EIHA 3C2PA 2JP1A 2XN9C 1DOLA 2RSNA 1B4OA 1BOSA 5M5WH 3K5LA 1HCZA 1EYCA 1ENFA 1PH6A 4B9XA 4IJHA 5IYBG 1IW7C 2RF4A 3D31A 1XXGA 1BCPB 1TWAH 3H09A 5CBEE 5C3EB 1E0BA 2XWBB 2X69A 4KHZA 2B2VA 1M8AA 5COYA 2OF1A 4FVMA 1GJXA 3T1YQ 1TVXA 1T5XD 2I46A 1N32L 3KF6B 1KNEA 4IOCA 1O7YA 2IX1A 4KLKA 1Z9FA 2HT1A 3MXPA 1ONLA 1SMXA 2VL6A 2N49A 5JVH3 4QQBX 1FNVA 2ZXOA 4QMGA 3MA2B 1HFGA 3CRKC 4OXPA 4PZ6A 3H0GG 1SE3A 1W2BA 1PFSA 1K3RA 3S14H 1YHQA 3H0GH 3QO2A 3DEPA 1IYVA 2BE5D 2EYPA 5J1ZA 4KKUA 3T4AC 1GVPA 3CW2C 4C2MB 3M3YH 1ILPA 1G6ZA 2N8NA 3I72A 4WORA 2BDNA 3S24A 1HA5A 1H9JA 1I50B 4IZ8A 4K5VA 3U4VA 4DR7Q 2XGTA 3M7NA 2HIXA 2L12A 2IL8A 5EAYA 4JI5Q 4PZ7A 2QGQA 2QA4A 1MHWC 2K03A 1K73C 4DV0Q 4O2DA 4KMUC 2JA8G 3HKSA 3PUYA 4LFCQ 1KHIA 1IW7D 4A3MB 1CA5A 1OXXK 1FGBD 4DV7Q 1U4MA 1VQ6A 4HTHA 4JI3L 4LUOA 1WFQA 1DM0B 2WKCA 1IBMQ 4QUFA 3HOZG 4H13C 4CKEA 2IHEA 4A3DH 3SVMA 2KOLA 3VR6A 3C3LA 4HSVA 3J7AV 2X6GA 1GUNA 2DJGC 2EYFA 3GP7A 2A73B 3GDEA 4Y7NB 5M3FB 2JJQA 2EXDA 3WOEA 2SOBA 3A8JE 1PFMA 3D6WA 1GUGA 4A3GG 2PPBC 3X3NA 2EPBA 1VQMA 4A3GH 1WTPA 2Z1CA 4CHTB 1X9NA 2HUGA 2FXQA 1VF7A 1O78A 3GTQB 3CCVA 1HNXQ 5FLXc 1C48A 1N34L 1JCKB 2OXPA 2MFIA 4H7BA 3S15B 4A3CG 5BN3A 1WTQA 2R92G 3M9BA 2EY1A 2WAQE 2R92H 1B1ZA 2EDGA 4X3SA 4MIUA 1S4ZA 4LUVA 4RGMA 4BY7G 2E2IH 1MSHA 1KNAA 4DAPA 4NXNL 5K5PA 1I4XA 2MQHA 4B3ML 4BY7H 5LL6S 3K59A 1W6KA 3I91A 4CKBA 4A3KH 1V8QA 2YYZA 4CKCA 2VW9A 3EROA 2F0MA 3AFQA 1I6HH 4KY6A 3ERSX 1VQCA 4HIDA 1PHJA 1WYDA 3NWTA 3J81L 4JI7Q 2UXDQ 1UE7A 1RTOA 2A1AA 1WD1A 5D14A 1YVCA 3U58A 2KVMA 2ZTDA 4EGVA 1FYCA 1EL0A 1B3AA 2B2UA 4NDXA 1C0AA 1BR9A 2QEXA 1CZWA 2I5MX 4JBMA 3ZYYX 2LS01 3PIOA 2YTYA 1PA6A 3K80C 4DR5L 2PZUA 4DAYA 1VQNA 4K5WA 1KD1C 4I7AA 4JI0L 3MC0B 1XWEA 5L37A 1U4LA 2RKSA 3NK9A 3JAMi 1L2FA 3OWFA 4JI2Q 3GTGB 5C5MA 4FNFA 1PTOC 5EKKA 3VYRA 4LFAQ 2JA9A 1S5ED 3S1QH 3KDFB 5KIXA 5C6AA 1F9PA 1PTOH 3Q8DA 1L0YB 3TS2A 4FYDA 5EKIA 5DAUA 4RAUC 1LYLA 2EJFC 2B63B 3VR5A 1UWVA 5GQOA 1D6EC 1NNXA 1OO9B 4DK3C 2QDBA 1SLJA 3RZDH 2V4DA 1RL2A 5M3MG 1TWGH 3NTIA 3K57A 1XNQL 3ULPA 5FOBB 2VUMG 5ELDA 5C4XG 4E6IA 4C1NI 3ND9A 2FMMA 4CDDC 2K04A 3M7GA 1Q3LA 5C4XH 1L0WA 3CC7A 2Z0SA 1LTTD 3PCOB 5M5WB 2OEOA 4DUZQ 4LF7L 3KUPA 1D7QA 3PUVA 5CBAE 1KL9A 3BS1A 1TWAB 2QEJC 1V43A 4DUYL 1CKNB 1EEID 2QCPX 1QUQA 1J9OA 1UAPA 4J6HA 3JC66 4NXML 1N8RC 1V1PB 4ME5A 2DUDA 1U9RA 1CSQA 1VQFA 2KQ3A 1U5KA 3OW7A 5M5YH 1IBLL 2UUAQ 1WJJA 1PTOD 5DM73 3PIP3 4LF6L 5FJ8H 1JB7A 2IJ0A 1YZ6A 4IUQA 3TREA 2I0QA 4DR3Q 3S14B 1FGUA 1PZJD 3H0GB 3SR1A 2K33A 1K0RA 3RN2A 1BDOA 4DR1L 4G7OC 2ZXRA 1CHPD 4JOIC 2M00A 5K36G 2QW7A 1I4GA 1S5DD 2NZHA 1SDFA 2F0JA 4LMQD 5K36H 1B50A 2AKWB 1VQHA 1RD9D 3HFZB 4K14A 1K9MC 2K5HA 2LSSA 1IZ6A 2F0NA 2GVAA 4APVA 3DWQA 2K5DA 3J81c 1NUCA 2B2TC 1WTOA 3CAMA 2MNAA 1WTXA 2K14A 2VQEQ 1I4HA 3CCEA 4HSPA 4DAMA 1HRJA 3BDCA 3TP8A 3HKZG 5E4XA 1JORA 4OX9L 4BA1I 4RKBA 5IWAQ 1WCMH 4QUCA 5IGFA 2O2LD 1EZ8A 5CC4A 4KTAA 5AJ3L 5J22A 4PQXA 2Y0SE 2VB2X 4A3DB 4Z9CB 4B3TQ 3L3OC 5J39A 1HR0L 2Q2IA 4IPDA 1ET9A 3I4NB 1KIXA 1CK1A 3R2TA 1I94L 1A62A 4N9TA 3CCRA 2XVSA 1K3BC 2ZM6Q 3F2DA 1Z7TA 3BVMA 3TZUA 1ILQA 5FO7B 1D1KA 4RCOA 4GZYC 1E2VA 2NVQH 1SBBB 4P74A 5LMNW 3CC2A 4QCLA 5IT9E 2BDOA 2EJMA 1AFPA 4P2CB 3N52A 2ZJRA 4KD3A 5IY0A 3UE1A 1PH9A 1H9KA 3CCMA 1LUZA 2GA4B 5IODA 1Y1VG 2AWNA 1Q12A 4NW2A 5DEHA 4IURA 1RHPA 2EQSA 1TKWB 4GN5A 4GKJL 5ELBA 3CC4A 2OQKA 2V1CC 4IN3A 4GOPA 2R92B 4QY7A 4A76A 1RODA 2PQAB 3HS0C 2JE6I 4A3JH
chains in the Genus database with same CATH topology
4DV2L 4DR2L 1IBKL 1SRUA 1QZHA 3H3VI 3I4NH 2RHSB 1T9HA 1VQ7A 1H95A 4UP7A 2R7ZG 1E3PA 1WOCA 5C44G 3I55A 2BA0A 3CF5A 3UDGA 2E2HH 3EBEA 2UUBL 2F52A 1A8VA 2NN6I 4GLXA 4AQYQ 1O7IA 1XMQL 5C44H 4JI7L 2UXDL 2CWAA 3PUZA 3RN5A 1OXUA 2JA6H 4A4IA 4DR5Q 3A5UA 4EQ5A 4LFBL 3L0OA 2Y0SG 3W1BA 5BR8L 4YCUA 5JEAG 4LF5Q 4JC0A 4LWCA 2K5VA 5IYCH 4JI0Q 4LF8Q 2B63H 4XIGS 4UP9A 4R4IA 3T1HL 3GO5A 2PQAA 4B3SQ 4RG1A 4X66Q 1EQRA 2UUAL 4YCVA 1S72A 1L1OB 3SGIA 1A63A 1EIFA 2LXKA 1EYGA 1WI5A 2NN6G 3L2PA 2VQFQ 2Z6KA 2JA5G 4YHHQ 1HJPA 4R4CA 2NZOA 2WFWA 4NPSA 1X3GA 4DNIA 4TVAB 2Q2TA 2YV5A 2KHJA 4GN4B 5JEAJ 2AWOA 3CXCA 5H1SE 4HJ9A 1CKMA 5HY6A 4WJ4A 5ELNA 2D62A 4DV0L 1X3EA 2KCTA 5M5WH 1EFWA 3I4MH 1PH6A 4JI2L 2RCNA 1KC8C 1N36Q 4IJHA 4KI0A 4HJAA 3BZKA 2Q2UA 1VQAA 5IYBG 2K52A 1MJEA 4LFAL 2I5HA 2RF4A 3D31A 1HR0W 3UDIA 1L1OA 1Y1WG 1XNQQ 3EIVA 1PH3A 1TWAH 1M1KC 5IP9H 3L7ZC 1B70B 2CCZA 1G6PA 5IYDH 4KHZA 2KBNA 4WJ3M 4A3KG 1XMOQ 4JI4Q 1VQJA 4BXXH 3T1YQ 1KAWA 2D0OA 1SFOH 1CUKA 1N32L 1S3OA 2A8VA 3KF6B 3CP0A 4IOCA 4LF7Q 1B8AA 2IX1A 1HNWQ 1IXRA 1UE6A 2MO1A 1Z9FA 4KLKA 2HT1A 3HOUH 1EWIA 1SMXA 3F1ZA 2VL6A 4DR2Q 2N49A 4JI6L 4JBJA 4QQBX 1Q86C 1ASYA 2E2JH 3A0JA 3TS0A 2K5NA 4X65L 5LMNQ 1XNRL 3S17H 4DUYQ 2UU9Q 2ALYB 4OXPA 4PZ6A 3OW2A 1Q7YC 2IT1A 1B7YB 5C4JH 3H0GG 3NBHB 1W2BA 1PFSA 1K3RA 3K7UC 4A3FH 4IOAA 3S14H 3OTOL 4DUZL 1YHQA 3H0GH 2C35B 3GTKH 3CCUA 1EOVA 3J81j 3GTPH 4GN3B 3GTOH 1GVPA 3CW2C 1IBLQ 1XTDA 3KF6A 4YWLA 2AMCB 3UDFA 3M3YH 1GD7A 3HOXG 2VY3A 2N78A 2R93G 4DK6C 2N8NA 4LF9L 1HZ9A 3S24A 3A74A 4LF6Q 4OO1I 3HOXH 5C3EG 4DV3Q 4DR6L 2R93H 2R6GA 3U4VA 3PUWA 4HJ7A 4DR7Q 4MZ9A 4UPAA 2XGTA 3M7NA 2HIXA 3AFPA 4IFDI 5EAYA 4ME3A 2K4KA 4PZ7A 1QVCA 2CKZB 2QGQA 3RLFA 3G71A 1BBWA 2QA4A 4DR1Q 5LMUL 3S1MH 1K73C 4DV0Q 5FLMH 2GN5A 4O2DA 4XTCS 5HGQA 2JA8G 1FL0A 3HKSA 3PUYA 4LFCQ 1KHIA 5GAEC 1OXXK 3TEHB 4GLVB 1R9TH 4OO1G 4DV5L 4DV7Q 1VQ5A 4DR3L 2HHHQ 3DM3A 1VQ6A 4A3IH 3I4OA 3KOJA 4JYAL 4BBRH 4OWXB 4JI3L 1BVSA 4LUOA 4DV4L 1Y1VH 1CKOA 1WFQA 3CPFA 4IFDG 1IL2A 1IBMQ 1A0IA 2CFMA 4NB3A 4YY3L 1K8AC 4DV6Q 3HOYH 3HOZG 3AQQA 2ID0A 4KHPL 3VDYA 2UXCL 2IHEA 3E9HA 2PNHA 3HOWH 2OTJA 4A3DH 3KJPA 2ATWA 4MNOA 4OX9Q 1EIYB 2I5LX 5JJIA 2EIFA 3J7ZC 4IFDJ 1LM0A 3GDEA 2R7ZH 4BBSH 1K83H 5AJ3Q 2JJQA 2EXDA 5E7NA 2VQEL 4GOPC 5DLQE 4A3GG 2Q2HA 1P8LA 4PMWA 3F2CA 3CCQA 3PO2G 1VQMA 1JJCB 3ULJA 4A3GH 1HR0Q 4P73A 1X9NA 3CMEA 4C3IH 3E9IA 1EQQA 4A3MG 1I94Q 3S1RH 3PO2H 2FXQA 3ZJYC 1VQDA 3H3VH 3IRBA 1I3QH 1VS0A 3K8AA 1UEBA 4JCVE 3CCVA 1HNXQ 2UUCL 1NY4A 1ASZA 5FLXc 2LXJA 2ZTCA 3ICEA 4B3RQ 1N34L 4JI1Q 1N33Q 2MFIA 4X62Q 4LF4Q 2JA5H 4A3CG 2YTXA 5C0XI 3KJOA 2H5XA 4A3EG 1TWHH 4B3TL 1NJIC 3BZCA 1MJCA 3FHWA 2R92G 1TWCH 4HIOA 3M9BA 3G4SA 2WAQE 1VQBA 4IPCA 4AH6A 2ZM6L 2WP8J 2ZJPA 4UP8A 2R92H 2B29A 4JOIA 1Q46A 3RR5A 5FJ8G 4L5RC 1FJGL 3PV0A 4R1JA 1YIJA 4A3BG 4DR4Q 4BA2I 4LUVA 5IE8A 5IYBH 4BY7G 4JI8L 2E2IH 3H15A 4DV1Q 5M3FG 4JBKA 1CKNA 4NXNL 1Y1WH 4DPGA 2MQHA 2IX0A 1VQGA 4X64Q 1J5EQ 4B3ML 3CD6A 5C0XG 3U4ZA 4UY8C 1IYJB 4BY7H 2GVBA 3I2ZA 4Y7NH 5M3FH 1G291 3BU2A 4GKJQ 4LW1A 3U50C 1MIUA 1OTCA 4GLAC 3RLNA 4A3KH 2NVTH 4DKAC 2F4VQ 1YHBA 3S1NH 1JMCA 2JQOA 2KCMA 1NE3A 3G6EA 2UXCQ 2YYZA 3PF4A 3STBC 1HNZQ 4HIMA 4QGUA 2UXBQ 2VW9A 5GADC 4DV2Q 1IBKQ 1SN8A 2IHFA 3NELA 2E5LL 4GNXC 3AFQA 2K50A 1I6HH 1TWFH 2BH2A 4GKKL 5C0XJ 1NTGA 2B3GA 4LFBQ 3ERSX 4MTNA 2UUBQ 1VQCA 3M4OH 4HIDA 3GTQH 2KENA 4R4QA 2NVYH 1PHJA 1C9OA 1WYDA 1PVOA 1XMQQ 4JI7Q 2UXDQ 1UE7A 3NEMA 1HZBA 4X6AH 4HJ5A 1KRSA 2A1AA 4JV5L 4YCWA 5J3BA 3S15H 1YVCA 3U58A 1GO3E 2ZTDA 1WCMG 5BR8Q 4POFA 1XPUA 1C0AA 4R4OA 3T1HQ 3KLWA 3F8TA 2QEXA 3I7FA 1PH8A 1UE1A 1YNXA 4AQYL 3GTLH 2I5MX 2YTVA 1YJWA 1W3SA 4JBMA 1YITA 1PA6A 3W1GA 2YTYA 3PIOA 2UUCQ 3K80C 4DR5L 4IPHA 2JEBI 1K8GA 5C3EH 4Y52H 4EX5A 1VQNA 1KD1C 4LF5L 4LF8L 4JI0L 3MXNB 3OYYA 4B3SL 1DGSA 3M4PA 4X66L 4PG3A 2WAQG 1XPOA 3I56A 1VQEA 3JAMi 3CCJA 1L2FA 3GTMH 1Q1BA 4JI2Q 2VQFL 2IY5B 2MO0A 1QVFA 1Q81C 4LFAQ 1X6OA 2JA9A 3ULLA 4YHHL 4L5TA 3KDFB 1QVGA 2R7DA 2JA8H 3S1QH 5JJKA 1U0LA 1XJVA 1X54A 1Z47A 4TQUS 3HOVG 3PO3G 3Q8DA 4IJLA 1QZGA 3TS2A 1EUJA 3PO3H 2JA7G 3RLOA 1LYLA 3W5OA 3HOVH 2CWPA 4L5QA 1KQSA 1JT8A 1NBWA 1UWVA 2OCEA 3G48A 5GQOA 1N36L 4DK3C 4GS3A 1SLJA 3STBD 3HOZH 3RZDH 3S2DH 1N32Q 1RL2A 4O0AA 5M3MG 1X56A 1TWGH 1XNQL 2VUMG 3ULPA 4C2MH 4POGA 5C4XG 4JI6Q 1G51A 1HZAA 1KRTA 5GAHC 2HQLA 3K7AH 3EN2A 2YU9H 3KDFA 3AYHB 1XMOL 4X65Q 5C4XH 3CC7A 1XNRQ 1I50H 3PUXA 1L0WA 4K0KL 1VQKA 4JI4L 4P71A 4C3JH 2Z0SA 3PCOB 5IP7G 3T1YL 2OWOA 1AE3A 5GAGC 1V9PA 4A3JG 1PH2A 3OTOQ 4DUZQ 1VQ9A 4LF7L 1HNWL 4L5SA 4H02A 1Y14B 3HKZE 3PUVA 2JK8A 3DLLA 4ALPA 1XPRA 1KL9A 1D7QA 5IWAL 1SR3A 3PF5A 1RIPA 3FKIG 1Q8KA 2ASBA 4AIMA 3S2HH 3J81i 5LMNL 3A5ZB 1V43A 3PSIA 1MKHA 3JAMc 4DUYL 3FKIH 1CKNB 2UU9L 4LF9Q 4A3MH 3GTGH 3KF8B 1QUQA 2JA6G 1YHAA 4NXML 3JC66 4DR6Q 3E0EA 1N8RC 2PMZE 2DUDA 5IYCG 1PH1A 1CSQA 1PH7A 1VQFA 2B63G 1U5KA 3RNUA 2D0PA 5M5YH 4A3CH 1IBLL 4A3EH 2UUAQ 1WJJA 4OONA 3TQYA 3J7A5 5LMUQ 4OWTB 2HIVA 2Z6KC 2AHOB 4LF6L 1VQIA 1SE8A 4R4TA 1OXTA 3ER0A 4DV3L 2A19A 4GNXB 1JJGA 1YI2A 5FJ8H 1JB7A 1N9WA 3CQZH 1YZ6A 3TREA 4DV5Q 2I0QA 5IT9c 1OXSC 4DR3Q 2JEAI 3D0FA 4OWWB 4A3BH 4DR7L 1FGUA 3B6YA 4FDBA 5ELOA 1BBUA 1PH5A 1K0RA 3MEFA 1X55A 4DV4Q 3RN2A 4BY1G 4JI5L 4JI3Q 2WB1E 3I4MG 4DR1L 3AEVA 4P75A 4YY3Q 1YJ9A 1X3FA 4JOIC 1PH4A 4BY1H 5K36G 4AYBE 3CPWA 1D8LA 4KHPQ 1Q1EA 4LFCL 1LTLA 2KHIA 1L1OC 2NZHA 5IP9G 2AKWB 4DV7L 1VQHA 5IYDG 2HHHL 3RZOH 1K9MC 3HFZB 2K5HA 1UE5A 1IZ6A 2LSSA 2E8GA 3NENA 4YWKA 2GVAA 3M4QA 1AE2A 4APVA 2L15A 3PIPA 2DGYA 1M90C 4GNXA 2OTLA 2ZJQA 3J81c 1PYSB 4BXXG 3CAMA 4DAYB 1E1TA 3PGZA 2MNAA 1IBML 2NVXH 4K0KQ 2K14A 4DV6L 4QL5A 3KFUA 2VQEQ 4JBWA 3CCEA 3J80i 1YEZA 1GM5A 4DAMA 1E1OA 3HOUG 3HKZG 4J15A 4OX9L 4BA1I 1VQ8A 1VQOA 2CQOA 1PYBA 5IWAQ 1WCMH 1NMGA 2PI2E 5M5XH 2VNUD 4YWMA 3K81C 4RMFA 1AH9A 1HZCA 3BJUA 5AJ3L 3CCSA 4A3FG 1YBYA 2BH8A 2BA1A 4NXMQ 4LNQA 1N34Q 2ZTEA 2F3IA 2VS1A 1OXVA 5GROA 2Y0SE 4JYAQ 3S16H 4QIWE 1C7YA 4B3TQ 1HR0L 2Q2IA 4IPDA 1JE5A 1VQ4A 1KIXA 1J6QA 1E7ZA 1I94L 1A62A 3CCRA 2ZM6Q 3KYHC 3CCLA 3F2DA 1X65A 1HNXL 1Q82C 3WWVA 1VCIA 1GKHA 1FJGQ 3CMAA 4B3RL 2XTIA 4JI1L 3UE0A 3GTJH 1N33L 3FP9A 4PZ8A 4X62L 4JI8Q 4QJFA 4LF4L 2NVQH 1TXYA 4NXNQ 1VQLA 4P74A 5LMNW 1YJNA 3CC2A 4GOPB 4B3MQ 1PV4A 3TRZA 2WB1G 1E22A 5FLMG 3GD7A 4A75A 2RHQB 1NMFA 3K0XA 4P72A 2JA7H 4BBSG 3LGJA 2ZJRA 1V1QA 4AYBG 2R7FA 3J80c 1P16A 5IY0A 4JG2A 1S40A 4DR4L 3UE1A 1PH9A 3UDXA 4A3IG 4A3LG 2OQ0A 4BBRG 4IPGA 3CCMA 1VQPA 1QUQB 1LUZA 2N3SA 4DV1L 1Y1VG 4HJ8A 2PI2A 5M3MH 2AWNA 2E5LQ 1Q12A 2ES2A 2VUMH 4X64L 1J5EL 1SROA 4GKKQ 4A3LH 2EQSA 4GN5A 4HIKA 4GKJL 3HOYG 2VZAA 1CSPA 1I5FA 5JJLA 4A93G 1E24A 3M85A 1BKBA 3F2BA 1FVIA 2K75A 1JJ2A 2OQKA 4C3HH 3CC4A 1KXLA 2F4VL 2V1CC 3HOWG 4GOPA 4A3DG 4QY7A 4A76A 4JI5Q 4A93H 1HH2P 4JV5Q 5IP7H 2PQAB 3I4NG 4LUZA 1HNZL 2UXBL 2JE6I 4A3JH 4IO9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 L;  4DR2 L;  1IBK L;  1SRU A;  1QZH A;  3H3V I;  3I4N H;  2RHS B;  1T9H A;  1VQ7 A;  1H95 A;  4UP7 A;  2R7Z G;  1E3P A;  1WOC A;  5C44 G;  3I55 A;  2BA0 A;  3CF5 A;  3UDG A;  2E2H H;  3EBE A;  2UUB L;  2F52 A;  1A8V A;  2NN6 I;  4GLX A;  4AQY Q;  1O7I A;  1XMQ L;  5C44 H;  4JI7 L;  2UXD L;  2CWA A;  3PUZ A;  3RN5 A;  1OXU A;  2JA6 H;  4A4I A;  4DR5 Q;  3A5U A;  4EQ5 A;  4LFB L;  3L0O A;  2Y0S G;  3W1B A;  5BR8 L;  4YCU A;  5JEA G;  4LF5 Q;  4JC0 A;  4LWC A;  2K5V A;  5IYC H;  4JI0 Q;  4LF8 Q;  2B63 H;  4XIG S;  4UP9 A;  4R4I A;  3T1H L;  3GO5 A;  2PQA A;  4B3S Q;  4RG1 A;  4X66 Q;  1EQR A;  2UUA L;  4YCV A;  1S72 A;  1L1O B;  3SGI A;  1A63 A;  1EIF A;  2LXK A;  1EYG A;  1WI5 A;  2NN6 G;  3L2P A;  2VQF Q;  2Z6K A;  2JA5 G;  4YHH Q;  1HJP A;  4R4C A;  2NZO A;  2WFW A;  4NPS A;  1X3G A;  4DNI A;  4TVA B;  2Q2T A;  2YV5 A;  2KHJ A;  4GN4 B;  5JEA J;  2AWO A;  3CXC A;  5H1S E;  4HJ9 A;  1CKM A;  5HY6 A;  4WJ4 A;  5ELN A;  2D62 A;  4DV0 L;  1X3E A;  2KCT A;  5M5W H;  1EFW A;  3I4M H;  1PH6 A;  4JI2 L;  2RCN A;  1KC8 C;  1N36 Q;  4IJH A;  4KI0 A;  4HJA A;  3BZK A;  2Q2U A;  1VQA A;  5IYB G;  2K52 A;  1MJE A;  4LFA L;  2I5H A;  2RF4 A;  3D31 A;  1HR0 W;  3UDI A;  1L1O A;  1Y1W G;  1XNQ Q;  3EIV A;  1PH3 A;  1TWA H;  1M1K C;  5IP9 H;  3L7Z C;  1B70 B;  2CCZ A;  1G6P A;  5IYD H;  4KHZ A;  2KBN A;  4WJ3 M;  4A3K G;  1XMO Q;  4JI4 Q;  1VQJ A;  4BXX H;  3T1Y Q;  1KAW A;  2D0O A;  1SFO H;  1CUK A;  1N32 L;  1S3O A;  2A8V A;  3KF6 B;  3CP0 A;  4IOC A;  4LF7 Q;  1B8A A;  2IX1 A;  1HNW Q;  1IXR A;  1UE6 A;  2MO1 A;  1Z9F A;  4KLK A;  2HT1 A;  3HOU H;  1EWI A;  1SMX A;  3F1Z A;  2VL6 A;  4DR2 Q;  2N49 A;  4JI6 L;  4JBJ A;  4QQB X;  1Q86 C;  1ASY A;  2E2J H;  3A0J A;  3TS0 A;  2K5N A;  4X65 L;  5LMN Q;  1XNR L;  3S17 H;  4DUY Q;  2UU9 Q;  2ALY B;  4OXP A;  4PZ6 A;  3OW2 A;  1Q7Y C;  2IT1 A;  1B7Y B;  5C4J H;  3H0G G;  3NBH B;  1W2B A;  1PFS A;  1K3R A;  3K7U C;  4A3F H;  4IOA A;  3S14 H;  3OTO L;  4DUZ L;  1YHQ A;  3H0G H;  2C35 B;  3GTK H;  3CCU A;  1EOV A;  3J81 j;  3GTP H;  4GN3 B;  3GTO H;  1GVP A;  3CW2 C;  1IBL Q;  1XTD A;  3KF6 A;  4YWL A;  2AMC B;  3UDF A;  3M3Y H;  1GD7 A;  3HOX G;  2VY3 A;  2N78 A;  2R93 G;  4DK6 C;  2N8N A;  4LF9 L;  1HZ9 A;  3S24 A;  3A74 A;  4LF6 Q;  4OO1 I;  3HOX H;  5C3E G;  4DV3 Q;  4DR6 L;  2R93 H;  2R6G A;  3U4V A;  3PUW A;  4HJ7 A;  4DR7 Q;  4MZ9 A;  4UPA A;  2XGT A;  3M7N A;  2HIX A;  3AFP A;  4IFD I;  5EAY A;  4ME3 A;  2K4K A;  4PZ7 A;  1QVC A;  2CKZ B;  2QGQ A;  3RLF A;  3G71 A;  1BBW A;  2QA4 A;  4DR1 Q;  5LMU L;  3S1M H;  1K73 C;  4DV0 Q;  5FLM H;  2GN5 A;  4O2D A;  4XTC S;  5HGQ A;  2JA8 G;  1FL0 A;  3HKS A;  3PUY A;  4LFC Q;  1KHI A;  5GAE C;  1OXX K;  3TEH B;  4GLV B;  1R9T H;  4OO1 G;  4DV5 L;  4DV7 Q;  1VQ5 A;  4DR3 L;  2HHH Q;  3DM3 A;  1VQ6 A;  4A3I H;  3I4O A;  3KOJ A;  4JYA L;  4BBR H;  4OWX B;  4JI3 L;  1BVS A;  4LUO A;  4DV4 L;  1Y1V H;  1CKO A;  1WFQ A;  3CPF A;  4IFD G;  1IL2 A;  1IBM Q;  1A0I A;  2CFM A;  4NB3 A;  4YY3 L;  1K8A C;  4DV6 Q;  3HOY H;  3HOZ G;  3AQQ A;  2ID0 A;  4KHP L;  3VDY A;  2UXC L;  2IHE A;  3E9H A;  2PNH A;  3HOW H;  2OTJ A;  4A3D H;  3KJP A;  2ATW A;  4MNO A;  4OX9 Q;  1EIY B;  2I5L X;  5JJI A;  2EIF A;  3J7Z C;  4IFD J;  1LM0 A;  3GDE A;  2R7Z H;  4BBS H;  1K83 H;  5AJ3 Q;  2JJQ A;  2EXD A;  5E7N A;  2VQE L;  4GOP C;  5DLQ E;  4A3G G;  2Q2H A;  1P8L A;  4PMW A;  3F2C A;  3CCQ A;  3PO2 G;  1VQM A;  1JJC B;  3ULJ A;  4A3G H;  1HR0 Q;  4P73 A;  1X9N A;  3CME A;  4C3I H;  3E9I A;  1EQQ A;  4A3M G;  1I94 Q;  3S1R H;  3PO2 H;  2FXQ A;  3ZJY C;  1VQD A;  3H3V H;  3IRB A;  1I3Q H;  1VS0 A;  3K8A A;  1UEB A;  4JCV E;  3CCV A;  1HNX Q;  2UUC L;  1NY4 A;  1ASZ A;  5FLX c;  2LXJ A;  2ZTC A;  3ICE A;  4B3R Q;  1N34 L;  4JI1 Q;  1N33 Q;  2MFI A;  4X62 Q;  4LF4 Q;  2JA5 H;  4A3C G;  2YTX A;  5C0X I;  3KJO A;  2H5X A;  4A3E G;  1TWH H;  4B3T L;  1NJI C;  3BZC A;  1MJC A;  3FHW A;  2R92 G;  1TWC H;  4HIO A;  3M9B A;  3G4S A;  2WAQ E;  1VQB A;  4IPC A;  4AH6 A;  2ZM6 L;  2WP8 J;  2ZJP A;  4UP8 A;  2R92 H;  2B29 A;  4JOI A;  1Q46 A;  3RR5 A;  5FJ8 G;  4L5R C;  1FJG L;  3PV0 A;  4R1J A;  1YIJ A;  4A3B G;  4DR4 Q;  4BA2 I;  4LUV A;  5IE8 A;  5IYB H;  4BY7 G;  4JI8 L;  2E2I H;  3H15 A;  4DV1 Q;  5M3F G;  4JBK A;  1CKN A;  4NXN L;  1Y1W H;  4DPG A;  2MQH A;  2IX0 A;  1VQG A;  4X64 Q;  1J5E Q;  4B3M L;  3CD6 A;  5C0X G;  3U4Z A;  4UY8 C;  1IYJ B;  4BY7 H;  2GVB A;  3I2Z A;  4Y7N H;  5M3F H;  1G29 1;  3BU2 A;  4GKJ Q;  4LW1 A;  3U50 C;  1MIU A;  1OTC A;  4GLA C;  3RLN A;  4A3K H;  2NVT H;  4DKA C;  2F4V Q;  1YHB A;  3S1N H;  1JMC A;  2JQO A;  2KCM A;  1NE3 A;  3G6E A;  2UXC Q;  2YYZ A;  3PF4 A;  3STB C;  1HNZ Q;  4HIM A;  4QGU A;  2UXB Q;  2VW9 A;  5GAD C;  4DV2 Q;  1IBK Q;  1SN8 A;  2IHF A;  3NEL A;  2E5L L;  4GNX C;  3AFQ A;  2K50 A;  1I6H H;  1TWF H;  2BH2 A;  4GKK L;  5C0X J;  1NTG A;  2B3G A;  4LFB Q;  3ERS X;  4MTN A;  2UUB Q;  1VQC A;  3M4O H;  4HID A;  3GTQ H;  2KEN A;  4R4Q A;  2NVY H;  1PHJ A;  1C9O A;  1WYD A;  1PVO A;  1XMQ Q;  4JI7 Q;  2UXD Q;  1UE7 A;  3NEM A;  1HZB A;  4X6A H;  4HJ5 A;  1KRS A;  2A1A A;  4JV5 L;  4YCW A;  5J3B A;  3S15 H;  1YVC A;  3U58 A;  1GO3 E;  2ZTD A;  1WCM G;  5BR8 Q;  4POF A;  1XPU A;  1C0A A;  4R4O A;  3T1H Q;  3KLW A;  3F8T A;  2QEX A;  3I7F A;  1PH8 A;  1UE1 A;  1YNX A;  4AQY L;  3GTL H;  2I5M X;  2YTV A;  1YJW A;  1W3S A;  4JBM A;  1YIT A;  1PA6 A;  3W1G A;  2YTY A;  3PIO A;  2UUC Q;  3K80 C;  4DR5 L;  4IPH A;  2JEB I;  1K8G A;  5C3E H;  4Y52 H;  4EX5 A;  1VQN A;  1KD1 C;  4LF5 L;  4LF8 L;  4JI0 L;  3MXN B;  3OYY A;  4B3S L;  1DGS A;  3M4P A;  4X66 L;  4PG3 A;  2WAQ G;  1XPO A;  3I56 A;  1VQE A;  3JAM i;  3CCJ A;  1L2F A;  3GTM H;  1Q1B A;  4JI2 Q;  2VQF L;  2IY5 B;  2MO0 A;  1QVF A;  1Q81 C;  4LFA Q;  1X6O A;  2JA9 A;  3ULL A;  4YHH L;  4L5T A;  3KDF B;  1QVG A;  2R7D A;  2JA8 H;  3S1Q H;  5JJK A;  1U0L A;  1XJV A;  1X54 A;  1Z47 A;  4TQU S;  3HOV G;  3PO3 G;  3Q8D A;  4IJL A;  1QZG A;  3TS2 A;  1EUJ A;  3PO3 H;  2JA7 G;  3RLO A;  1LYL A;  3W5O A;  3HOV H;  2CWP A;  4L5Q A;  1KQS A;  1JT8 A;  1NBW A;  1UWV A;  2OCE A;  3G48 A;  5GQO A;  1N36 L;  4DK3 C;  4GS3 A;  1SLJ A;  3STB D;  3HOZ H;  3RZD H;  3S2D H;  1N32 Q;  1RL2 A;  4O0A A;  5M3M G;  1X56 A;  1TWG H;  1XNQ L;  2VUM G;  3ULP A;  4C2M H;  4POG A;  5C4X G;  4JI6 Q;  1G51 A;  1HZA A;  1KRT A;  5GAH C;  2HQL A;  3K7A H;  3EN2 A;  2YU9 H;  3KDF A;  3AYH B;  1XMO L;  4X65 Q;  5C4X H;  3CC7 A;  1XNR Q;  1I50 H;  3PUX A;  1L0W A;  4K0K L;  1VQK A;  4JI4 L;  4P71 A;  4C3J H;  2Z0S A;  3PCO B;  5IP7 G;  3T1Y L;  2OWO A;  1AE3 A;  5GAG C;  1V9P A;  4A3J G;  1PH2 A;  3OTO Q;  4DUZ Q;  1VQ9 A;  4LF7 L;  1HNW L;  4L5S A;  4H02 A;  1Y14 B;  3HKZ E;  3PUV A;  2JK8 A;  3DLL A;  4ALP A;  1XPR A;  1KL9 A;  1D7Q A;  5IWA L;  1SR3 A;  3PF5 A;  1RIP A;  3FKI G;  1Q8K A;  2ASB A;  4AIM A;  3S2H H;  3J81 i;  5LMN L;  3A5Z B;  1V43 A;  3PSI A;  1MKH A;  3JAM c;  4DUY L;  3FKI H;  1CKN B;  2UU9 L;  4LF9 Q;  4A3M H;  3GTG H;  3KF8 B;  1QUQ A;  2JA6 G;  1YHA A;  4NXM L;  3JC6 6;  4DR6 Q;  3E0E A;  1N8R C;  2PMZ E;  2DUD A;  5IYC G;  1PH1 A;  1CSQ A;  1PH7 A;  1VQF A;  2B63 G;  1U5K A;  3RNU A;  2D0P A;  5M5Y H;  4A3C H;  1IBL L;  4A3E H;  2UUA Q;  1WJJ A;  4OON A;  3TQY A;  3J7A 5;  5LMU Q;  4OWT B;  2HIV A;  2Z6K C;  2AHO B;  4LF6 L;  1VQI A;  1SE8 A;  4R4T A;  1OXT A;  3ER0 A;  4DV3 L;  2A19 A;  4GNX B;  1JJG A;  1YI2 A;  5FJ8 H;  1JB7 A;  1N9W A;  3CQZ H;  1YZ6 A;  3TRE A;  4DV5 Q;  2I0Q A;  5IT9 c;  1OXS C;  4DR3 Q;  2JEA I;  3D0F A;  4OWW B;  4A3B H;  4DR7 L;  1FGU A;  3B6Y A;  4FDB A;  5ELO A;  1BBU A;  1PH5 A;  1K0R A;  3MEF A;  1X55 A;  4DV4 Q;  3RN2 A;  4BY1 G;  4JI5 L;  4JI3 Q;  2WB1 E;  3I4M G;  4DR1 L;  3AEV A;  4P75 A;  4YY3 Q;  1YJ9 A;  1X3F A;  4JOI C;  1PH4 A;  4BY1 H;  5K36 G;  4AYB E;  3CPW A;  1D8L A;  4KHP Q;  1Q1E A;  4LFC L;  1LTL A;  2KHI A;  1L1O C;  2NZH A;  5IP9 G;  2AKW B;  4DV7 L;  1VQH A;  5IYD G;  2HHH L;  3RZO H;  1K9M C;  3HFZ B;  2K5H A;  1UE5 A;  1IZ6 A;  2LSS A;  2E8G A;  3NEN A;  4YWK A;  2GVA A;  3M4Q A;  1AE2 A;  4APV A;  2L15 A;  3PIP A;  2DGY A;  1M90 C;  4GNX A;  2OTL A;  2ZJQ A;  3J81 c;  1PYS B;  4BXX G;  3CAM A;  4DAY B;  1E1T A;  3PGZ A;  2MNA A;  1IBM L;  2NVX H;  4K0K Q;  2K14 A;  4DV6 L;  4QL5 A;  3KFU A;  2VQE Q;  4JBW A;  3CCE A;  3J80 i;  1YEZ A;  1GM5 A;  4DAM A;  1E1O A;  3HOU G;  3HKZ G;  4J15 A;  4OX9 L;  4BA1 I;  1VQ8 A;  1VQO A;  2CQO A;  1PYB A;  5IWA Q;  1WCM H;  1NMG A;  2PI2 E;  5M5X H;  2VNU D;  4YWM A;  3K81 C;  4RMF A;  1AH9 A;  1HZC A;  3BJU A;  5AJ3 L;  3CCS A;  4A3F G;  1YBY A;  2BH8 A;  2BA1 A;  4NXM Q;  4LNQ A;  1N34 Q;  2ZTE A;  2F3I A;  2VS1 A;  1OXV A;  5GRO A;  2Y0S E;  4JYA Q;  3S16 H;  4QIW E;  1C7Y A;  4B3T Q;  1HR0 L;  2Q2I A;  4IPD A;  1JE5 A;  1VQ4 A;  1KIX A;  1J6Q A;  1E7Z A;  1I94 L;  1A62 A;  3CCR A;  2ZM6 Q;  3KYH C;  3CCL A;  3F2D A;  1X65 A;  1HNX L;  1Q82 C;  3WWV A;  1VCI A;  1GKH A;  1FJG Q;  3CMA A;  4B3R L;  2XTI A;  4JI1 L;  3UE0 A;  3GTJ H;  1N33 L;  3FP9 A;  4PZ8 A;  4X62 L;  4JI8 Q;  4QJF A;  4LF4 L;  2NVQ H;  1TXY A;  4NXN Q;  1VQL A;  4P74 A;  5LMN W;  1YJN A;  3CC2 A;  4GOP B;  4B3M Q;  1PV4 A;  3TRZ A;  2WB1 G;  1E22 A;  5FLM G;  3GD7 A;  4A75 A;  2RHQ B;  1NMF A;  3K0X A;  4P72 A;  2JA7 H;  4BBS G;  3LGJ A;  2ZJR A;  1V1Q A;  4AYB G;  2R7F A;  3J80 c;  1P16 A;  5IY0 A;  4JG2 A;  1S40 A;  4DR4 L;  3UE1 A;  1PH9 A;  3UDX A;  4A3I G;  4A3L G;  2OQ0 A;  4BBR G;  4IPG A;  3CCM A;  1VQP A;  1QUQ B;  1LUZ A;  2N3S A;  4DV1 L;  1Y1V G;  4HJ8 A;  2PI2 A;  5M3M H;  2AWN A;  2E5L Q;  1Q12 A;  2ES2 A;  2VUM H;  4X64 L;  1J5E L;  1SRO A;  4GKK Q;  4A3L H;  2EQS A;  4GN5 A;  4HIK A;  4GKJ L;  3HOY G;  2VZA A;  1CSP A;  1I5F A;  5JJL A;  4A93 G;  1E24 A;  3M85 A;  1BKB A;  3F2B A;  1FVI A;  2K75 A;  1JJ2 A;  2OQK A;  4C3H H;  3CC4 A;  1KXL A;  2F4V L;  2V1C C;  3HOW G;  4GOP A;  4A3D G;  4QY7 A;  4A76 A;  4JI5 Q;  4A93 H;  1HH2 P;  4JV5 Q;  5IP7 H;  2PQA B;  3I4N G;  4LUZ A;  1HNZ L;  2UXB L;  2JE6 I;  4A3J H;  4IO9 A; 
#chains in the Genus database with same CATH topology
 2MGS A;  1II3 A;  4NP5 A;  4RGT A;  5EKL A;  3H3V I;  1LT4 D;  1T9H A;  1AZP A;  2E2I B;  1VQ7 A;  4L8J A;  4BBS G;  2B8F A;  3I55 A;  2E2H H;  2BA0 A;  1A8V A;  4FXD A;  5A2Q E;  1OXU A;  4A3K B;  1GUT A;  4EQ5 A;  4LAA A;  1GXD C;  2F0W A;  4LF5 Q;  4LWC A;  4C3I G;  5IYC H;  2FFK B;  2EJG C;  3GO5 A;  4B3S Q;  4RG1 A;  2K32 A;  1I6H B;  1C8C A;  1EIF A;  3DM1 A;  2L11 A;  2LXK A;  4M8A A;  3L2P A;  2Z6K A;  1HJP A;  2PCF B;  2NZO A;  4DNI A;  1X3G A;  3LNN A;  2KHJ A;  2AWO A;  2ICI A;  2IPK D;  2RDF A;  2Z4I A;  3D8G A;  3W2D A;  5BN5 A;  2ICE C;  3I4M H;  1EQT A;  2RCN A;  3I70 A;  1KC8 C;  3L9A X;  2Q2U A;  3NBI A;  1SYG A;  2G9H D;  2K52 A;  1Y1W G;  1L1O A;  5ELF A;  1HFN A;  5COR A;  2MP1 A;  2CCZ A;  1G6P A;  5IYD H;  4WJ3 M;  1XMO Q;  2O4X A;  3NPP A;  4CJ1 B;  1VQJ A;  3K5O A;  4DXG A;  1S3O A;  3CP0 A;  1STA A;  1L0X B;  2EYO A;  1IXR A;  2CQA A;  2MO1 A;  1BCP F;  3NTH A;  3S1Q B;  1PFN A;  1EWI A;  3F1Z A;  1KLU D;  4DR2 Q;  4JI6 L;  1TII D;  1FD7 D;  1PTO B;  1I4P A;  5LMN Q;  5D65 A;  3S17 H;  2UU9 Q;  2ALY B;  4QF4 A;  1UNS A;  5EPJ A;  4A3F H;  4IOA A;  4RKL A;  1IKL A;  1TS5 A;  1CZG A;  1VF5 C;  1B2T A;  3A7L A;  4IUN A;  1F2M A;  3CCU A;  1RJT A;  1TWG B;  2NYZ D;  4N8F A;  2X6L A;  1XTD A;  4R8N A;  5KYL A;  1ZEQ X;  1YNJ C;  2EY2 A;  2N78 A;  1SNQ A;  2HD3 A;  4DK6 C;  4LF9 L;  1HZ9 A;  4V0B A;  1HPC A;  4DV3 Q;  4DR6 L;  3P75 A;  1D5X C;  4WJW A;  2R6G A;  1HA6 A;  4U67 3;  5CYU A;  3OWE B;  3EA6 A;  4IUT A;  4B9W A;  3Q0A A;  2K4K A;  3RLF A;  2CKZ B;  3PO2 B;  1GHK A;  4XTC S;  1ZKO A;  1FL0 A;  3X3M A;  2PW5 A;  5GAE C;  3TEH B;  1R9T H;  4KHV A;  1VQ5 A;  2HHH Q;  3A56 A;  4KY5 A;  4A3I H;  4OWX B;  4DV4 L;  3BVZ A;  1UEA B;  2E75 C;  2NBF A;  4IFD G;  3D4W A;  1A0I A;  2CFM A;  5I6W A;  4YY3 L;  1JB3 A;  3HOY H;  1Z6H A;  2UXC L;  1WVL A;  2EZV A;  3HOW H;  4CJ2 C;  3KJP A;  2ATW A;  3D4D A;  2I5L X;  1A2U A;  3EFX D;  4U68 A;  2XSC A;  2F0U A;  5DLQ E;  1EZ6 A;  4PMW A;  3F2C A;  1H9S B;  1JWU D;  1SNP A;  5FO9 B;  4UHV A;  2SNM A;  3ULJ A;  1C4Q A;  5G3L D;  2BE5 C;  1YNJ D;  1JWM D;  3E9I A;  4EQN A;  3MXG A;  3S1R H;  2RBM A;  3ZJY C;  1VQD A;  3H3V H;  3IRB A;  1I3Q H;  1VS0 A;  2AQ2 B;  3VR2 A;  1GUO A;  5IGC A;  1ASZ A;  3K5N A;  4B3R Q;  4ZQ3 A;  1PFB A;  1N33 Q;  3R2I A;  4X62 Q;  4A3E G;  3BZC A;  1IYU A;  5I2X A;  3QOJ A;  3RD4 A;  1WCM B;  4EQP A;  4C56 C;  5C5L A;  4L5R C;  1FJG L;  3PV0 A;  1YIJ A;  4A3B G;  4DR4 Q;  2DY7 A;  3NSW A;  4BA2 I;  1K8O A;  3IFD A;  5IYB H;  4FF1 A;  4JBK A;  2EYL A;  1CKN A;  4KKT A;  3K58 A;  2IX0 A;  4X64 Q;  1J5E Q;  5C0X G;  1IYJ B;  3I8Z A;  2GVB A;  3I2Z A;  4LW1 A;  1QWY A;  4RGN A;  1MIU A;  2NVT H;  2P5Z X;  4KK7 A;  1JMC A;  1CI3 M;  2L9H A;  2WAQ B;  5C3X A;  3R8B A;  1HNZ Q;  2UXB Q;  4DN4 M;  4S3S A;  3FRP B;  5I6Y A;  1MD2 D;  5GAD C;  1IBK Q;  2E5L L;  3HG9 A;  1PMR A;  4RHS A;  2F0Q A;  1BUV T;  5KGU A;  4GKK L;  2UUB Q;  3EQL C;  3HOV B;  1BXT A;  3VA5 A;  4R4Q A;  1HZB A;  3W3A A;  1TY0 A;  5ELE A;  1JR0 D;  3KLS X;  1GO3 E;  1YNN C;  5BR8 Q;  1XX8 A;  1XPU A;  1KDC A;  3F8T A;  2FMC A;  1UE1 A;  1YNX A;  3I3C A;  4AQY L;  2A5H A;  2YTV A;  1YJW A;  1YIT A;  2K05 A;  4IUP A;  1K8G A;  4N9P A;  4EX5 A;  4LF8 L;  4A3J B;  5KND A;  1GUS A;  1DCZ A;  1HQM C;  2JN4 A;  3M4P A;  2KEE A;  4PNY A;  3I56 A;  1VQE A;  3GTM H;  2E2H B;  3FKI B;  5JJK A;  4YHH L;  3LWE A;  3VYT A;  2JA8 H;  2R7D A;  1PYW D;  3PO3 G;  4XDX A;  1X54 A;  4TQU S;  4XQQ A;  3KBX A;  1D2B A;  1WD0 A;  1PRT B;  3PO3 H;  2JA7 G;  1HTL D;  1Y8O B;  5CV9 A;  3RLO A;  3G48 A;  4RFB A;  4GS3 A;  1ESF A;  3HOZ H;  3S2D H;  1RKN A;  3I90 A;  4HED A;  1JOK A;  3E0J A;  2DNE A;  4O0A A;  3V05 A;  5JAV A;  3J80 L;  5EGT A;  2LKV A;  1TR5 A;  1KRT A;  2HQL A;  3K7A H;  3EN2 A;  2M2L A;  4X65 Q;  4C3H G;  1XNR Q;  3SK4 A;  1VQK A;  3VYS A;  4P71 A;  1SE2 A;  2R61 A;  3T1Y L;  2BOS A;  4BY1 B;  1EYA A;  1AE3 A;  3BYY B;  1V9P A;  3QJY A;  1VQ9 A;  3OTO Q;  3DMU A;  3I4M B;  1YNN D;  1LLR D;  4H02 A;  1Y14 B;  3HKZ E;  3DLL A;  1XPR A;  1EFI D;  4ALP A;  3HRZ C;  1K8M A;  4HR7 B;  4KY7 A;  2ASB A;  4AIM A;  3J81 i;  4FF2 A;  3OSO A;  3KF8 B;  2JA6 G;  1YHA A;  5ELC A;  2I07 B;  3E0E A;  1EY8 A;  2MUY A;  2PMZ E;  3WOF A;  3GV6 A;  3MEH A;  2D0P A;  2CW0 D;  4A3C H;  1KTK A;  4OON A;  3J7A 5;  5LMU Q;  5IGB A;  2LMC B;  4J8Q A;  3S17 B;  1KDA A;  4CDC C;  4R4T A;  1OXT A;  3ER0 A;  5I4D A;  4GNX B;  4UDU C;  3CQZ H;  4A3F B;  4DV5 Q;  4DR7 L;  3NTK A;  1OXS C;  2XNA C;  4OWW B;  2FIN B;  3OMG A;  3B6Y A;  4FDB A;  5ELO A;  1X55 A;  2F0D A;  4JI5 L;  4K2K A;  4OHJ A;  4BS9 A;  3AEV A;  1ENC A;  3ITP A;  3T56 B;  3J7Y W;  1X3F A;  1DOK A;  4F88 A;  4KHP Q;  3SHL A;  4LFC L;  1LTL A;  4DFA A;  5IP9 G;  4DV7 L;  3J7A F;  2WII B;  3RZO H;  1R4Q B;  2ZJP A;  1UE5 A;  3OW2 A;  3PIP A;  3M4Q A;  1M90 C;  2DGY A;  4K5X A;  2LFN A;  4BXX G;  1LO5 D;  1IBM L;  3QWN A;  2NVX H;  2C9O A;  1HHV A;  4QL5 A;  3AB9 A;  3SE0 A;  1YEZ A;  1TU2 B;  1STB A;  2F0E A;  3FPU B;  3HOU G;  3VA7 A;  3U9S A;  1VQ8 A;  1R9T B;  2WAC A;  5D3D A;  2CQO A;  1PYB A;  2VNU D;  1NMG A;  5M5X H;  1STY A;  3K5M A;  4A3I B;  3T53 B;  1U4P A;  1I4R A;  1HZC A;  3NHH A;  3UI2 A;  4H0L C;  3BJU A;  4MHE A;  3CCS A;  3KLR A;  4NXM Q;  3HOY B;  4LNQ A;  2ZTE A;  2KJX A;  4A93 B;  2VS1 A;  4ULL A;  1A3V A;  3HOW B;  3S16 H;  4QIW E;  1C7Y A;  4HCS A;  1QNU A;  4RWS C;  5CR3 A;  4MN3 A;  1VDZ A;  1X65 A;  1HNX L;  1Q82 C;  1GKH A;  3UE0 A;  3DEO A;  3FP9 A;  3QOL A;  4JI8 Q;  1TXY A;  1YJN A;  3N6R A;  2F0I A;  2WB1 G;  2Y0S B;  5FLM G;  3RUZ A;  4A75 A;  1NMF A;  3K0X A;  3A55 A;  3LGJ A;  4AYB G;  2R7F A;  3J80 c;  3BYT B;  1I3Q B;  4FO2 A;  1M4V A;  1VQP A;  4BBR G;  2WKD A;  2PI2 A;  5M3M H;  2ES2 A;  2VUM H;  2DN8 A;  5JJL A;  3F2B A;  1FVI A;  2K75 A;  1JJ2 A;  1DZ1 A;  2E76 C;  2PZW A;  3QIA A;  4KN4 C;  4JV5 Q;  2KED A;  4CDE C;  2L0C A;  1F9S A;  4HMI A;  4OL7 A;  2R7Z G;  5C44 G;  3CF5 A;  2F52 A;  1STE A;  5C44 H;  4JI7 L;  2UXD L;  1K0S A;  3PUZ A;  3RN5 A;  2NVT B;  1E2W A;  3L0O A;  4G7Z C;  4YCU A;  1EIG A;  2K5V A;  1B3Q A;  1ENA A;  3WDN A;  2H1E A;  4XIG S;  4UP9 A;  1HUN A;  4X66 Q;  3GQB A;  4YCV A;  1S72 A;  3SGI A;  1A63 A;  5KNB A;  2Z6B A;  1JC7 A;  2G5D A;  4OEM B;  4CJ0 B;  2NN6 G;  2VQF Q;  4KD4 A;  2JA5 G;  4R4C A;  3F2U A;  2WFW A;  2YV5 A;  2F3W A;  5JEA J;  3CXC A;  5H1S E;  2PZT A;  5HY6 A;  4WJ4 A;  2RA4 A;  2SNS A;  3M3Y B;  4FF4 A;  3TDQ A;  4JI2 L;  4ZUI A;  1T5E A;  1N36 Q;  3MZ5 A;  1EU3 A;  4LFA L;  1MJE A;  4DNT B;  4G4K A;  2BH2 A;  3EIV A;  1PH3 A;  1M1K C;  2XRS D;  2KBN A;  1EYD A;  4TRD A;  3HZX A;  4JI4 Q;  2B2T A;  1SFO H;  1CUK A;  3O13 A;  3GTM B;  2A8V A;  1ESR A;  1HNW Q;  5FKA C;  1ZXT A;  2JA8 B;  3VR4 A;  5IGD A;  3S9W A;  1TQO A;  2OT2 A;  2E2J H;  2KCN A;  2K5N A;  3TS0 A;  2K6A A;  1Q7Y C;  1B7Y B;  2AUJ D;  5C4J H;  4G57 A;  3JAM E;  3NBH B;  2EXZ A;  3K7U C;  3PMF A;  4DUZ L;  2F0H A;  2N55 A;  3NUC A;  3HOZ B;  3GTK H;  4F7X A;  1EOV A;  1JQY D;  3GTP H;  5T1I A;  4GN3 B;  1PTO F;  1X3Q A;  3KF6 A;  2AMC B;  3G7L A;  2VY3 A;  2R93 G;  1G91 A;  2NTT A;  1EEF D;  5A2Q L;  4JK1 C;  5C3E G;  1HUM A;  2R93 H;  3KLS A;  3PUW A;  4HJ7 A;  5I9O A;  4MZ9 A;  3E5S A;  1CQF A;  2G9D A;  4K8J A;  3C1F A;  4IFD I;  4A3G B;  4ME3 A;  2UUA L;  3S1M H;  1BBW A;  2QF7 A;  2QIL A;  4OO1 G;  1LT6 D;  4DR3 L;  5CV6 A;  3DM3 A;  3I4O A;  4JYA L;  2IW3 A;  4OO1 H;  1BVS A;  1Y1V H;  4B08 A;  3CPF A;  3BVG A;  4NB3 A;  2EYJ A;  4DV6 Q;  2RCF A;  3T13 A;  3VDY A;  4KN7 C;  2B2Y C;  5JJZ A;  2PNH A;  1BBX C;  3NWS A;  3CQZ B;  3J7Z C;  2DY8 A;  4BY7 B;  4BBS H;  1K83 H;  1PRT C;  4ZKC B;  5E7N A;  2VQE L;  4GOP C;  4LK1 C;  1F9Q A;  4NKL A;  2DJF C;  1TS4 A;  5BN4 A;  1JJC B;  4IQZ A;  3RZO B;  4C3I H;  1EQQ A;  4A3M G;  5EBD A;  4RCN A;  3IFT A;  2RSO A;  2UUC L;  1STN A;  1F2Y A;  2LXJ A;  1TS2 A;  2B2W C;  4JI1 Q;  1EY6 A;  4LF4 Q;  2YTX A;  5C0X I;  3KJO A;  4B3T L;  1U4R A;  3FHW A;  1NJI C;  1TWC H;  4HIO A;  3G4S A;  2XWJ B;  2A69 C;  1VQB A;  2ZM6 L;  2RVL A;  4UP8 A;  2M9V A;  1Q46 A;  3RR5 A;  4ZCK A;  3TP5 A;  3CRL C;  4R1J A;  4KKS A;  3ONA B;  4K2L A;  3SXH A;  1D5M C;  3FPP A;  4DV1 Q;  5M3F G;  1SYF A;  1Y1W H;  1VQG A;  3CD6 A;  1ZYR C;  3U4Z A;  5KNC A;  4X3T A;  4WFN 3;  4Y7N H;  5M3F H;  3S16 B;  1G29 1;  4KJO A;  4PMB A;  4GLA C;  2HCI A;  3R93 A;  1YHB A;  4DU9 A;  3MWY W;  2E2D C;  2F4V Q;  3S1N H;  2KCM A;  4HMJ A;  2UXC Q;  3PF4 A;  3STB C;  4HIM A;  4OIJ A;  5I2Y A;  4DV2 Q;  4L63 B;  1GHJ A;  3NEL A;  4GNX C;  5IOC A;  2B3G A;  4LFB Q;  1PRT D;  3GTQ H;  2KEN A;  2NZ1 D;  1C9O A;  4DAV A;  1PVO A;  2F0L A;  1XMQ Q;  3NEM A;  2FHT A;  4X6A H;  4HJ5 A;  1AW7 A;  1KRS A;  4YCW A;  5J3B A;  3RZD B;  3S15 H;  1EWH A;  4POF A;  1TS3 A;  4K8I A;  1LT3 D;  1G8Z D;  2R3Z A;  4R4O A;  3T1H Q;  3KLW A;  3NQI A;  5M3M B;  4ZKB B;  2J0T D;  1NCV A;  2VUM B;  3I7F A;  2CH4 A;  5JVG 3;  5C4X B;  3GTL H;  1W3S A;  1AEX A;  2NB0 A;  1CA6 A;  4Y52 H;  2FJ2 A;  2O5I C;  2A6E C;  4LF5 L;  3MXN B;  2A69 D;  4B3S L;  1O7L A;  4PG3 A;  1XPO A;  3I4L A;  4LJZ C;  1Q81 C;  1X6O A;  3ULL A;  4L5T A;  1LT5 D;  1U0L A;  2RDG A;  3NE5 B;  1ZYR D;  3C46 A;  2WIN B;  1EUJ A;  3W5O A;  5M5Y B;  2CWP A;  1KQS A;  1JT8 A;  1NBW A;  3SK6 A;  4IFD H;  3STB D;  5T1G A;  1N32 Q;  4ILW A;  1SYD A;  2TSS A;  4C1N K;  5F2D A;  3MTS A;  4POG A;  1HZA A;  4C3J G;  2YU9 H;  3KDF A;  3AYH B;  1XMO L;  3PUX A;  4K0K L;  2A74 C;  3D6C A;  4C3J H;  2ZT9 C;  3KBG A;  5IP7 G;  2OWO A;  5GAG C;  4L5S A;  2JK8 A;  4NMZ A;  4Q0F A;  3H3V C;  1NR2 A;  2O5J C;  3CU7 A;  3PF5 A;  2IX3 A;  1PZK D;  4XXE A;  3S2H H;  5LMN L;  1IL8 A;  3A5Z B;  3PSI A;  2UU9 L;  3GTG H;  3FVQ A;  1SNO A;  4CBV A;  4PV1 C;  2F4I A;  2A6E D;  1PH1 A;  1PH7 A;  2B63 G;  1FNW A;  3RNU A;  1CFM A;  2A68 C;  5FK9 C;  4A3E H;  3HKZ B;  2HIV A;  3FMC A;  1CTM A;  2AHO B;  1SE8 A;  4DV3 L;  2A19 A;  3E3X A;  5C4J B;  2Z4H A;  1N9W A;  2JEA I;  5ISR A;  4A3B H;  3D0F A;  3H94 A;  2K01 A;  1BBU A;  2PMZ B;  3MEF A;  1PH5 A;  4JI3 Q;  1V1P A;  3GTK B;  2WB1 E;  2D9U A;  3OIP A;  1F9R A;  4FXK C;  3GTP B;  4P75 A;  5C0X H;  1YJ9 A;  2CVR A;  1PH4 A;  4AYB E;  1D8L A;  1Q1E A;  2KEC A;  5HGT A;  1Y8N B;  2R93 B;  2HHH L;  2HDL A;  5CMD A;  3D3R A;  4YWK A;  2E8G A;  2NVQ B;  1VMP A;  1AE2 A;  2B2V C;  2L15 A;  2ZJQ A;  2D5D A;  2IWH A;  1AZQ A;  1E1T A;  1MSG A;  3S1M B;  1F2L A;  3AU7 A;  2DNC A;  3J80 i;  3KK7 A;  1Y69 U;  1GM5 A;  5G3L F;  4O42 A;  1QIL A;  1CT1 D;  2BCO A;  1VQO A;  5EPL A;  4K6L A;  1SAP A;  2PI2 E;  3NP8 A;  4YWM A;  3PQI A;  2CH4 W;  4M1U B;  4RHR A;  1Y1V B;  3K6O A;  1YBY A;  5HUR A;  1EQV A;  2Z9H A;  1ET6 A;  2BH8 A;  2BA1 A;  4OIK A;  1N34 Q;  5GRO A;  1OXV A;  5FLX E;  1SNM A;  2EY6 A;  2RQX A;  2A68 D;  2K5Q A;  1JE5 A;  1VQ4 A;  2CW0 C;  3FDT A;  1J6Q A;  1E7Z A;  3KYH C;  3CCL A;  5CGK A;  3V96 A;  3WWV A;  1VCI A;  4BBS B;  1K83 B;  4R8I A;  3CMA A;  1Y8P B;  4B3R L;  2XTI A;  2PNR C;  3GTJ H;  1N33 L;  2F0F A;  4XQN A;  4PZ8 A;  4X62 L;  4UAI A;  3TN2 A;  4NXN Q;  1VQL A;  3OMC A;  4GOP B;  1QE6 A;  4B3M Q;  3NBH A;  4XYQ A;  3TRZ A;  4V19 0;  1WTH A;  3GD7 A;  2RHQ B;  4P72 A;  2JA7 H;  4QIW B;  4C3I B;  1V1Q A;  3SDZ A;  1P16 A;  4JG2 A;  1S40 A;  4DR4 L;  1MBY A;  3VYU A;  4A3L G;  5C3W A;  4IPG A;  1WTV A;  1H9M A;  2Q8T A;  1WTW A;  3EJI A;  4A3L H;  4X64 L;  1J5E L;  2EVB A;  4HIK A;  2EYH A;  2F3V A;  1Q90 A;  1I5F A;  1G2T A;  1TWC B;  1KXL A;  4C3H H;  3A7A B;  4A3D G;  1X32 A;  5KYI A;  1HH2 P;  3ERQ A;  1A3T A;  3I4N G;  1HNZ L;  2NWG A;  2UXB L;  1RDP D;  1IBK L;  1SRU A;  2L55 A;  4X3K A;  3I4N H;  1H95 A;  1E3P A;  1JJG A;  1Y1W B;  2UUB L;  3EBE A;  2NN6 I;  4IUV A;  4GLX A;  5I9P A;  1RTN A;  1Q8I A;  2JA6 H;  4A4I A;  4DR5 Q;  3A5U A;  3H6M A;  3S1N B;  3W1B A;  5EPK A;  5BR8 L;  5IGE A;  4EVO A;  4JC0 A;  4JI0 Q;  1PDQ A;  2L4N A;  5C4H A;  2PQA A;  1L1O B;  1O7Z A;  1EYG A;  4DXF A;  1WI5 A;  2KA7 A;  1LTR D;  1A2T A;  2PQE A;  4NPS A;  2Q2T A;  4DK0 A;  4TVA B;  2KHS A;  1GUW A;  5JOB A;  1CM9 A;  4GN4 B;  4ABN A;  1WTR A;  1K28 A;  1CKM A;  3A8K E;  5ELN A;  2D62 A;  4ODG A;  4OEL B;  3HGB A;  4DV0 L;  1X3E A;  2KCT A;  5CV5 A;  1EFW A;  3M4Y A;  2KCC A;  3IAY A;  1D1I A;  1GOZ A;  4KI0 A;  4HJA A;  3BZK A;  1X3P A;  1VQA A;  3GTL B;  4FP5 D;  2I5H A;  1HR0 W;  3UDI A;  1CQV A;  3J80 E;  1XNQ Q;  5IP9 H;  1QNK A;  1B70 B;  3L7Z C;  4A3K G;  5FO8 B;  1A3U A;  4BXX H;  1KAW A;  1JOO A;  2D0O A;  1I4Q A;  3TP6 A;  2TMP A;  4LF7 Q;  5IGG A;  1B8A A;  5E4W C;  4TSS A;  1UE6 A;  2NUC A;  3HOU H;  3OHX C;  4JBJ A;  4OGQ C;  1Q86 C;  1ASY A;  3A0J A;  4JW0 A;  3MFG A;  4X65 L;  1XNR L;  4DUY Q;  1AN8 A;  3DXJ C;  2IT1 A;  5EQ0 A;  1KAA A;  4J1M A;  3OTO L;  2PW7 A;  2B39 A;  4PMC A;  2B2U C;  2C35 B;  5DNF A;  3J81 j;  5M9O A;  3GTO H;  1IBL Q;  4YWL A;  4FF3 A;  3UDF A;  1GD7 A;  3TBI B;  3HOX G;  1QG7 A;  3LWU A;  2F0G A;  2YU9 B;  1LTB D;  1SYE A;  3A74 A;  3BDO A;  4LF6 Q;  4OO1 I;  2JSO A;  3HOX H;  4C3J B;  1AP0 A;  4UPA A;  2A6H C;  3AFP A;  2SDF A;  3G71 A;  1QVC A;  4JVZ A;  4DR1 Q;  1JOQ A;  5LMU L;  3K0Y A;  3S1R B;  5FLM H;  2GN5 A;  3S2H B;  5HGQ A;  3P7J A;  3QR8 A;  1MI2 A;  1PZI D;  4GLV B;  4DV5 L;  3G6J B;  4HCE A;  3KOJ A;  4CGY B;  4G7H C;  3DUZ A;  4BBR H;  2HCC A;  4ZLT F;  1CKO A;  1IL2 A;  1EU4 A;  1SE4 A;  3Q6S A;  1K8A C;  1EY0 A;  3J81 E;  4A3E B;  3AQQ A;  2ID0 A;  4KHP L;  2F0P A;  3E9H A;  3FEW X;  2OTJ A;  3MXN A;  1XTC D;  2CHB D;  2D2C C;  4Q5V A;  4MNO A;  4OX9 Q;  1EIY B;  4ID6 A;  3Q24 A;  5JJI A;  2EIF A;  1EY7 A;  4HN7 A;  4A3B B;  1SNC A;  4IAL A;  4IFD J;  1LM0 A;  5NUC A;  3TSS A;  2R7Z H;  1RF2 D;  5AJ3 Q;  2QDL A;  4CDF C;  1STG A;  2VB3 X;  2Q2H A;  1P8L A;  2K7V A;  5CV8 A;  3CCQ A;  1A6X A;  3PO2 G;  2NTS A;  1SEB D;  1HR0 Q;  4P73 A;  4I65 A;  3CME A;  1I94 Q;  3PO2 H;  4ZAI A;  5JPM C;  3OIQ A;  4JCV E;  3K8A A;  1S5F D;  1UEB A;  1NY4 A;  4RA8 A;  4XT1 B;  4RH6 A;  3JAM L;  2ZTC A;  3ICE A;  2NN6 H;  1F77 A;  1SSO A;  3RMH A;  1QJO A;  2JA5 H;  2A6H D;  2H5X A;  1TWH H;  3I73 A;  1EY4 A;  1MJC A;  3BDL A;  4RGO S;  4IPC A;  5EJW A;  1H9S A;  1SYC A;  2F0S A;  1PXU A;  2F0O A;  2B29 A;  2WP8 J;  4JOI A;  4AH6 A;  1FNU A;  4ZYS A;  5FJ8 G;  1RCV D;  2Z8L A;  5IE8 A;  1D5Z C;  4JI8 L;  2EE1 A;  3H15 A;  1PLF A;  1QB5 D;  4DPG A;  3HP3 A;  4JYA Q;  2SEB D;  5IT9 L;  1B44 D;  1DD2 A;  4UY8 C;  4GKJ Q;  3BU2 A;  1SMY C;  2B8G A;  3U50 C;  1IKM A;  3OPO A;  3RLN A;  1OTC A;  1HTP A;  3TP7 A;  4K6D A;  4DKA C;  2EY5 A;  2JQO A;  1NE3 A;  3C1E A;  3G6E A;  4EQO A;  4QGU A;  3IKJ A;  3GTJ B;  1SN8 A;  2IHF A;  2Q8R E;  1QCB D;  2K50 A;  1TWF H;  3PIO 3;  5C0X J;  1NTG A;  3GV3 A;  4MTN A;  3M4O H;  3PO3 B;  2XIW A;  2MPM A;  2NVY H;  5IIF A;  3MHB A;  2F1M A;  2JA7 B;  3VR3 A;  5D3I B;  2ZXP A;  4JV5 L;  2WV6 D;  2K5W A;  4BWG B;  2AQ1 B;  3S2D B;  2N88 A;  3CHB D;  1WCM G;  5DM6 3;  3ND8 A;  4R9W A;  4DNR B;  4XQJ A;  2JXM B;  2F03 A;  1BCP C;  3K7A B;  1MGS A;  1PH8 A;  1A15 A;  1SND A;  2L5T A;  2UUC Q;  3W1G A;  5CV7 A;  4C3H B;  4IPH A;  2JEB I;  5C3E H;  1SJE D;  3NQT A;  3OYY A;  1DGS A;  4X66 L;  3MVV A;  2WAQ G;  1V1O A;  3CCJ A;  1Q1B A;  3EVQ A;  5LL6 X;  2VQF L;  2MO0 A;  2IY5 B;  2ENB A;  1QVF A;  1J8I A;  1FR3 A;  4HAE A;  1QVG A;  3BZD B;  5CV4 A;  1XJV A;  1Z47 A;  3T51 B;  2JA6 B;  3HOV G;  2Q8I B;  3URY A;  4IJL A;  1QZG A;  3NXW A;  1SMY D;  4YIJ A;  5LHY 1;  2HQE A;  3HOV H;  3V2T A;  4L5Q A;  1BO0 A;  5AFW A;  1G2S A;  1TY2 A;  2C5C A;  2OCE A;  1N36 L;  2B2Y A;  1X56 A;  3A54 A;  3SEB A;  4C2M H;  4JI6 Q;  4I7Z C;  1G51 A;  2VXW A;  5GAH C;  1JE4 A;  1LTS D;  4XT3 B;  1I50 H;  4JI4 L;  1JIC A;  2PYK A;  4FXG C;  4A3J G;  1PH2 A;  3OOC A;  1HNW L;  1JWS D;  2EOT A;  4X3U A;  1HXY D;  5IWA L;  1SR3 A;  1RIP A;  2QKI C;  3FKI G;  3P20 A;  1LAC A;  1Q8K A;  1EOT A;  1BCP D;  1I6V C;  3JAM c;  1MKH A;  3FKI H;  4LF9 Q;  1LV9 A;  4A3M H;  2LY7 A;  2NVX B;  3DWA A;  1EY5 A;  1NAP A;  4DR6 Q;  1DON A;  2EYM A;  5IYC G;  2B2W A;  4N8X 1;  1S5C D;  3A8I E;  5E3F A;  4IUU A;  3HOU B;  5M5X B;  3TQY A;  4OWT B;  1UUP A;  1KLG D;  2Z6K C;  5JPN C;  1VQI A;  1ICW A;  2MHV A;  1YI2 A;  3T16 A;  1DOM A;  4ZUJ A;  5IT9 c;  1VMC A;  1W6J A;  3QB3 A;  3KF8 A;  1S5B D;  4DV4 Q;  4BY1 G;  3E6Z X;  1LTA D;  3I4M G;  1F2Z A;  4YY3 Q;  3GTO B;  3H91 A;  4BY1 H;  3CPW A;  2KHI A;  1L1O C;  1LTG D;  3TZD A;  3HOX B;  4H44 C;  5IYD G;  3NEN A;  2PO4 A;  2F0T A;  2H4O A;  3LX0 A;  3SK5 A;  4GNX A;  2OTL A;  1PYS B;  4DAY B;  3PGZ A;  5EBC A;  3Q22 A;  3R3O A;  4K0K Q;  4DV6 L;  3KFU A;  1TT2 A;  4JBW A;  4MTK A;  2WB1 B;  1E1O A;  4J15 A;  2E74 C;  4AYB B;  1STH A;  1DYQ A;  2KUM A;  2K28 A;  3TME A;  1DXM A;  3Q23 A;  1AH9 A;  3K81 C;  4RMF A;  4KJN A;  4BBR B;  1IHZ A;  3QG1 A;  4A3F G;  1ML0 D;  1H9R A;  5KRU A;  2F3I A;  3DHQ A;  1B53 A;  3U9O A;  1DJR D;  1QOH A;  1CHQ D;  4JPB W;  4QB4 A;  1O80 A;  1SYB A;  3BG3 A;  4F87 A;  2J7Z A;  2R7Z B;  5C44 B;  1NSN S;  3CKI B;  1FJG Q;  4JI1 L;  1BQQ T;  4LF4 L;  4QJF A;  4O1N A;  3HEJ A;  2F0K A;  1PV4 A;  2J4X A;  4L6T B;  4TKO B;  1E22 A;  4ZRZ A;  1XYI A;  1LAB A;  1R4P B;  1ICF B;  1E2Z A;  1KAB A;  5TSS A;  1EWC A;  2AQ3 B;  3UDX A;  4A3I G;  2OQ0 A;  1QUQ B;  2N3S A;  4DV1 L;  4HJ8 A;  1PRT F;  2E5L Q;  4DGZ A;  2JA5 B;  1SRO A;  4GKK Q;  2F0V A;  1TWH B;  1KDB A;  4KV6 A;  2VZA A;  1CSP A;  4ZK9 B;  5C4Z A;  3HOY G;  4A93 G;  1E24 A;  3M85 A;  1BKB A;  1NR4 A;  1BF4 A;  2F4V L;  3HOW G;  5E1F A;  4A93 H;  3AMU A;  5IP7 H;  5A35 A;  4LUZ A;  4DK1 A;  1EY9 A;  4IO9 A;  4DV2 L;  4WRD A;  4DR2 L;  1QZH A;  2RHS B;  3D4R A;  3DWP A;  4UP7 A;  1WOC A;  4LFB L;  4F8M A;  3UDG A;  1B9M A;  2K1B A;  3MAQ A;  4AQY Q;  1O7I A;  2AUK A;  1XMQ L;  1BNZ A;  2CWA A;  2MJ8 A;  1SFO B;  2L1B A;  4XYO A;  1SJH D;  2Y0S G;  2JYO A;  5JEA G;  4LF8 Q;  1HQR D;  2HDM A;  2B63 H;  4R4I A;  3T1H L;  3SK8 A;  5JEA H;  1EQR A;  1TWF B;  2E2J B;  3MFY A;  3MXU A;  2XRQ D;  3IL8 A;  3M4O B;  1LTI D;  2NVY B;  4DA2 A;  2RDH A;  4DF7 A;  4YHH Q;  1SXT A;  1B9N A;  5FLX L;  3P1H A;  4HJ9 A;  5KEE A;  1EIH A;  3C2P A;  2JP1 A;  2XN9 C;  1DOL A;  2RSN A;  1B4O A;  1BOS A;  5M5W H;  3K5L A;  1HCZ A;  1EYC A;  1ENF A;  1PH6 A;  4B9X A;  4IJH A;  5IYB G;  1IW7 C;  2RF4 A;  3D31 A;  1XXG A;  1BCP B;  1TWA H;  3H09 A;  5CBE E;  5C3E B;  1E0B A;  2XWB B;  2X69 A;  4KHZ A;  2B2V A;  1M8A A;  5COY A;  2OF1 A;  4FVM A;  1GJX A;  3T1Y Q;  1TVX A;  1T5X D;  2I46 A;  1N32 L;  3KF6 B;  1KNE A;  4IOC A;  1O7Y A;  2IX1 A;  4KLK A;  1Z9F A;  2HT1 A;  3MXP A;  1ONL A;  1SMX A;  2VL6 A;  2N49 A;  5JVH 3;  4QQB X;  1FNV A;  2ZXO A;  4QMG A;  3MA2 B;  1HFG A;  3CRK C;  4OXP A;  4PZ6 A;  3H0G G;  1SE3 A;  1W2B A;  1PFS A;  1K3R A;  3S14 H;  1YHQ A;  3H0G H;  3QO2 A;  3DEP A;  1IYV A;  2BE5 D;  2EYP A;  5J1Z A;  4KKU A;  3T4A C;  1GVP A;  3CW2 C;  4C2M B;  3M3Y H;  1ILP A;  1G6Z A;  2N8N A;  3I72 A;  4WOR A;  2BDN A;  3S24 A;  1HA5 A;  1H9J A;  1I50 B;  4IZ8 A;  4K5V A;  3U4V A;  4DR7 Q;  2XGT A;  3M7N A;  2HIX A;  2L12 A;  2IL8 A;  5EAY A;  4JI5 Q;  4PZ7 A;  2QGQ A;  2QA4 A;  1MHW C;  2K03 A;  1K73 C;  4DV0 Q;  4O2D A;  4KMU C;  2JA8 G;  3HKS A;  3PUY A;  4LFC Q;  1KHI A;  1IW7 D;  4A3M B;  1CA5 A;  1OXX K;  1FGB D;  4DV7 Q;  1U4M A;  1VQ6 A;  4HTH A;  4JI3 L;  4LUO A;  1WFQ A;  1DM0 B;  2WKC A;  1IBM Q;  4QUF A;  3HOZ G;  4H13 C;  4CKE A;  2IHE A;  4A3D H;  3SVM A;  2KOL A;  3VR6 A;  3C3L A;  4HSV A;  3J7A V;  2X6G A;  1GUN A;  2DJG C;  2EYF A;  3GP7 A;  2A73 B;  3GDE A;  4Y7N B;  5M3F B;  2JJQ A;  2EXD A;  3WOE A;  2SOB A;  3A8J E;  1PFM A;  3D6W A;  1GUG A;  4A3G G;  2PPB C;  3X3N A;  2EPB A;  1VQM A;  4A3G H;  1WTP A;  2Z1C A;  4CHT B;  1X9N A;  2HUG A;  2FXQ A;  1VF7 A;  1O78 A;  3GTQ B;  3CCV A;  1HNX Q;  5FLX c;  1C48 A;  1N34 L;  1JCK B;  2OXP A;  2MFI A;  4H7B A;  3S15 B;  4A3C G;  5BN3 A;  1WTQ A;  2R92 G;  3M9B A;  2EY1 A;  2WAQ E;  2R92 H;  1B1Z A;  2EDG A;  4X3S A;  4MIU A;  1S4Z A;  4LUV A;  4RGM A;  4BY7 G;  2E2I H;  1MSH A;  1KNA A;  4DAP A;  4NXN L;  5K5P A;  1I4X A;  2MQH A;  4B3M L;  4BY7 H;  5LL6 S;  3K59 A;  1W6K A;  3I91 A;  4CKB A;  4A3K H;  1V8Q A;  2YYZ A;  4CKC A;  2VW9 A;  3ERO A;  2F0M A;  3AFQ A;  1I6H H;  4KY6 A;  3ERS X;  1VQC A;  4HID A;  1PHJ A;  1WYD A;  3NWT A;  3J81 L;  4JI7 Q;  2UXD Q;  1UE7 A;  1RTO A;  2A1A A;  1WD1 A;  5D14 A;  1YVC A;  3U58 A;  2KVM A;  2ZTD A;  4EGV A;  1FYC A;  1EL0 A;  1B3A A;  2B2U A;  4NDX A;  1C0A A;  1BR9 A;  2QEX A;  1CZW A;  2I5M X;  4JBM A;  3ZYY X;  2LS0 1;  3PIO A;  2YTY A;  1PA6 A;  3K80 C;  4DR5 L;  2PZU A;  4DAY A;  1VQN A;  4K5W A;  1KD1 C;  4I7A A;  4JI0 L;  3MC0 B;  1XWE A;  5L37 A;  1U4L A;  2RKS A;  3NK9 A;  3JAM i;  1L2F A;  3OWF A;  4JI2 Q;  3GTG B;  5C5M A;  4FNF A;  1PTO C;  5EKK A;  3VYR A;  4LFA Q;  2JA9 A;  1S5E D;  3S1Q H;  3KDF B;  5KIX A;  5C6A A;  1F9P A;  1PTO H;  3Q8D A;  1L0Y B;  3TS2 A;  4FYD A;  5EKI A;  5DAU A;  4RAU C;  1LYL A;  2EJF C;  2B63 B;  3VR5 A;  1UWV A;  5GQO A;  1D6E C;  1NNX A;  1OO9 B;  4DK3 C;  2QDB A;  1SLJ A;  3RZD H;  2V4D A;  1RL2 A;  5M3M G;  1TWG H;  3NTI A;  3K57 A;  1XNQ L;  3ULP A;  5FOB B;  2VUM G;  5ELD A;  5C4X G;  4E6I A;  4C1N I;  3ND9 A;  2FMM A;  4CDD C;  2K04 A;  3M7G A;  1Q3L A;  5C4X H;  1L0W A;  3CC7 A;  2Z0S A;  1LTT D;  3PCO B;  5M5W B;  2OEO A;  4DUZ Q;  4LF7 L;  3KUP A;  1D7Q A;  3PUV A;  5CBA E;  1KL9 A;  3BS1 A;  1TWA B;  2QEJ C;  1V43 A;  4DUY L;  1CKN B;  1EEI D;  2QCP X;  1QUQ A;  1J9O A;  1UAP A;  4J6H A;  3JC6 6;  4NXM L;  1N8R C;  1V1P B;  4ME5 A;  2DUD A;  1U9R A;  1CSQ A;  1VQF A;  2KQ3 A;  1U5K A;  3OW7 A;  5M5Y H;  1IBL L;  2UUA Q;  1WJJ A;  1PTO D;  5DM7 3;  3PIP 3;  4LF6 L;  5FJ8 H;  1JB7 A;  2IJ0 A;  1YZ6 A;  4IUQ A;  3TRE A;  2I0Q A;  4DR3 Q;  3S14 B;  1FGU A;  1PZJ D;  3H0G B;  3SR1 A;  2K33 A;  1K0R A;  3RN2 A;  1BDO A;  4DR1 L;  4G7O C;  2ZXR A;  1CHP D;  4JOI C;  2M00 A;  5K36 G;  2QW7 A;  1I4G A;  1S5D D;  2NZH A;  1SDF A;  2F0J A;  4LMQ D;  5K36 H;  1B50 A;  2AKW B;  1VQH A;  1RD9 D;  3HFZ B;  4K14 A;  1K9M C;  2K5H A;  2LSS A;  1IZ6 A;  2F0N A;  2GVA A;  4APV A;  3DWQ A;  2K5D A;  3J81 c;  1NUC A;  2B2T C;  1WTO A;  3CAM A;  2MNA A;  1WTX A;  2K14 A;  2VQE Q;  1I4H A;  3CCE A;  4HSP A;  4DAM A;  1HRJ A;  3BDC A;  3TP8 A;  3HKZ G;  5E4X A;  1JOR A;  4OX9 L;  4BA1 I;  4RKB A;  5IWA Q;  1WCM H;  4QUC A;  5IGF A;  2O2L D;  1EZ8 A;  5CC4 A;  4KTA A;  5AJ3 L;  5J22 A;  4PQX A;  2Y0S E;  2VB2 X;  4A3D B;  4Z9C B;  4B3T Q;  3L3O C;  5J39 A;  1HR0 L;  2Q2I A;  4IPD A;  1ET9 A;  3I4N B;  1KIX A;  1CK1 A;  3R2T A;  1I94 L;  1A62 A;  4N9T A;  3CCR A;  2XVS A;  1K3B C;  2ZM6 Q;  3F2D A;  1Z7T A;  3BVM A;  3TZU A;  1ILQ A;  5FO7 B;  1D1K A;  4RCO A;  4GZY C;  1E2V A;  2NVQ H;  1SBB B;  4P74 A;  5LMN W;  3CC2 A;  4QCL A;  5IT9 E;  2BDO A;  2EJM A;  1AFP A;  4P2C B;  3N52 A;  2ZJR A;  4KD3 A;  5IY0 A;  3UE1 A;  1PH9 A;  1H9K A;  3CCM A;  1LUZ A;  2GA4 B;  5IOD A;  1Y1V G;  2AWN A;  1Q12 A;  4NW2 A;  5DEH A;  4IUR A;  1RHP A;  2EQS A;  1TKW B;  4GN5 A;  4GKJ L;  5ELB A;  3CC4 A;  2OQK A;  2V1C C;  4IN3 A;  4GOP A;  2R92 B;  4QY7 A;  4A76 A;  1ROD A;  2PQA B;  3HS0 C;  2JE6 I;  4A3J H; 
#chains in the Genus database with same CATH homology
 4DV2 L;  4DR2 L;  1IBK L;  1SRU A;  1QZH A;  3H3V I;  3I4N H;  2RHS B;  1T9H A;  1VQ7 A;  1H95 A;  4UP7 A;  2R7Z G;  1E3P A;  1WOC A;  5C44 G;  3I55 A;  2BA0 A;  3CF5 A;  3UDG A;  2E2H H;  3EBE A;  2UUB L;  2F52 A;  1A8V A;  2NN6 I;  4GLX A;  4AQY Q;  1O7I A;  1XMQ L;  5C44 H;  4JI7 L;  2UXD L;  2CWA A;  3PUZ A;  3RN5 A;  1OXU A;  2JA6 H;  4A4I A;  4DR5 Q;  3A5U A;  4EQ5 A;  4LFB L;  3L0O A;  2Y0S G;  3W1B A;  5BR8 L;  4YCU A;  5JEA G;  4LF5 Q;  4JC0 A;  4LWC A;  2K5V A;  5IYC H;  4JI0 Q;  4LF8 Q;  2B63 H;  4XIG S;  4UP9 A;  4R4I A;  3T1H L;  3GO5 A;  2PQA A;  4B3S Q;  4RG1 A;  4X66 Q;  1EQR A;  2UUA L;  4YCV A;  1S72 A;  1L1O B;  3SGI A;  1A63 A;  1EIF A;  2LXK A;  1EYG A;  1WI5 A;  2NN6 G;  3L2P A;  2VQF Q;  2Z6K A;  2JA5 G;  4YHH Q;  1HJP A;  4R4C A;  2NZO A;  2WFW A;  4NPS A;  1X3G A;  4DNI A;  4TVA B;  2Q2T A;  2YV5 A;  2KHJ A;  4GN4 B;  5JEA J;  2AWO A;  3CXC A;  5H1S E;  4HJ9 A;  1CKM A;  5HY6 A;  4WJ4 A;  5ELN A;  2D62 A;  4DV0 L;  1X3E A;  2KCT A;  5M5W H;  1EFW A;  3I4M H;  1PH6 A;  4JI2 L;  2RCN A;  1KC8 C;  1N36 Q;  4IJH A;  4KI0 A;  4HJA A;  3BZK A;  2Q2U A;  1VQA A;  5IYB G;  2K52 A;  1MJE A;  4LFA L;  2I5H A;  2RF4 A;  3D31 A;  1HR0 W;  3UDI A;  1L1O A;  1Y1W G;  1XNQ Q;  3EIV A;  1PH3 A;  1TWA H;  1M1K C;  5IP9 H;  3L7Z C;  1B70 B;  2CCZ A;  1G6P A;  5IYD H;  4KHZ A;  2KBN A;  4WJ3 M;  4A3K G;  1XMO Q;  4JI4 Q;  1VQJ A;  4BXX H;  3T1Y Q;  1KAW A;  2D0O A;  1SFO H;  1CUK A;  1N32 L;  1S3O A;  2A8V A;  3KF6 B;  3CP0 A;  4IOC A;  4LF7 Q;  1B8A A;  2IX1 A;  1HNW Q;  1IXR A;  1UE6 A;  2MO1 A;  1Z9F A;  4KLK A;  2HT1 A;  3HOU H;  1EWI A;  1SMX A;  3F1Z A;  2VL6 A;  4DR2 Q;  2N49 A;  4JI6 L;  4JBJ A;  4QQB X;  1Q86 C;  1ASY A;  2E2J H;  3A0J A;  3TS0 A;  2K5N A;  4X65 L;  5LMN Q;  1XNR L;  3S17 H;  4DUY Q;  2UU9 Q;  2ALY B;  4OXP A;  4PZ6 A;  3OW2 A;  1Q7Y C;  2IT1 A;  1B7Y B;  5C4J H;  3H0G G;  3NBH B;  1W2B A;  1PFS A;  1K3R A;  3K7U C;  4A3F H;  4IOA A;  3S14 H;  3OTO L;  4DUZ L;  1YHQ A;  3H0G H;  2C35 B;  3GTK H;  3CCU A;  1EOV A;  3J81 j;  3GTP H;  4GN3 B;  3GTO H;  1GVP A;  3CW2 C;  1IBL Q;  1XTD A;  3KF6 A;  4YWL A;  2AMC B;  3UDF A;  3M3Y H;  1GD7 A;  3HOX G;  2VY3 A;  2N78 A;  2R93 G;  4DK6 C;  2N8N A;  4LF9 L;  1HZ9 A;  3S24 A;  3A74 A;  4LF6 Q;  4OO1 I;  3HOX H;  5C3E G;  4DV3 Q;  4DR6 L;  2R93 H;  2R6G A;  3U4V A;  3PUW A;  4HJ7 A;  4DR7 Q;  4MZ9 A;  4UPA A;  2XGT A;  3M7N A;  2HIX A;  3AFP A;  4IFD I;  5EAY A;  4ME3 A;  2K4K A;  4PZ7 A;  1QVC A;  2CKZ B;  2QGQ A;  3RLF A;  3G71 A;  1BBW A;  2QA4 A;  4DR1 Q;  5LMU L;  3S1M H;  1K73 C;  4DV0 Q;  5FLM H;  2GN5 A;  4O2D A;  4XTC S;  5HGQ A;  2JA8 G;  1FL0 A;  3HKS A;  3PUY A;  4LFC Q;  1KHI A;  5GAE C;  1OXX K;  3TEH B;  4GLV B;  1R9T H;  4OO1 G;  4DV5 L;  4DV7 Q;  1VQ5 A;  4DR3 L;  2HHH Q;  3DM3 A;  1VQ6 A;  4A3I H;  3I4O A;  3KOJ A;  4JYA L;  4BBR H;  4OWX B;  4JI3 L;  1BVS A;  4LUO A;  4DV4 L;  1Y1V H;  1CKO A;  1WFQ A;  3CPF A;  4IFD G;  1IL2 A;  1IBM Q;  1A0I A;  2CFM A;  4NB3 A;  4YY3 L;  1K8A C;  4DV6 Q;  3HOY H;  3HOZ G;  3AQQ A;  2ID0 A;  4KHP L;  3VDY A;  2UXC L;  2IHE A;  3E9H A;  2PNH A;  3HOW H;  2OTJ A;  4A3D H;  3KJP A;  2ATW A;  4MNO A;  4OX9 Q;  1EIY B;  2I5L X;  5JJI A;  2EIF A;  3J7Z C;  4IFD J;  1LM0 A;  3GDE A;  2R7Z H;  4BBS H;  1K83 H;  5AJ3 Q;  2JJQ A;  2EXD A;  5E7N A;  2VQE L;  4GOP C;  5DLQ E;  4A3G G;  2Q2H A;  1P8L A;  4PMW A;  3F2C A;  3CCQ A;  3PO2 G;  1VQM A;  1JJC B;  3ULJ A;  4A3G H;  1HR0 Q;  4P73 A;  1X9N A;  3CME A;  4C3I H;  3E9I A;  1EQQ A;  4A3M G;  1I94 Q;  3S1R H;  3PO2 H;  2FXQ A;  3ZJY C;  1VQD A;  3H3V H;  3IRB A;  1I3Q H;  1VS0 A;  3K8A A;  1UEB A;  4JCV E;  3CCV A;  1HNX Q;  2UUC L;  1NY4 A;  1ASZ A;  5FLX c;  2LXJ A;  2ZTC A;  3ICE A;  4B3R Q;  1N34 L;  4JI1 Q;  1N33 Q;  2MFI A;  4X62 Q;  4LF4 Q;  2JA5 H;  4A3C G;  2YTX A;  5C0X I;  3KJO A;  2H5X A;  4A3E G;  1TWH H;  4B3T L;  1NJI C;  3BZC A;  1MJC A;  3FHW A;  2R92 G;  1TWC H;  4HIO A;  3M9B A;  3G4S A;  2WAQ E;  1VQB A;  4IPC A;  4AH6 A;  2ZM6 L;  2WP8 J;  2ZJP A;  4UP8 A;  2R92 H;  2B29 A;  4JOI A;  1Q46 A;  3RR5 A;  5FJ8 G;  4L5R C;  1FJG L;  3PV0 A;  4R1J A;  1YIJ A;  4A3B G;  4DR4 Q;  4BA2 I;  4LUV A;  5IE8 A;  5IYB H;  4BY7 G;  4JI8 L;  2E2I H;  3H15 A;  4DV1 Q;  5M3F G;  4JBK A;  1CKN A;  4NXN L;  1Y1W H;  4DPG A;  2MQH A;  2IX0 A;  1VQG A;  4X64 Q;  1J5E Q;  4B3M L;  3CD6 A;  5C0X G;  3U4Z A;  4UY8 C;  1IYJ B;  4BY7 H;  2GVB A;  3I2Z A;  4Y7N H;  5M3F H;  1G29 1;  3BU2 A;  4GKJ Q;  4LW1 A;  3U50 C;  1MIU A;  1OTC A;  4GLA C;  3RLN A;  4A3K H;  2NVT H;  4DKA C;  2F4V Q;  1YHB A;  3S1N H;  1JMC A;  2JQO A;  2KCM A;  1NE3 A;  3G6E A;  2UXC Q;  2YYZ A;  3PF4 A;  3STB C;  1HNZ Q;  4HIM A;  4QGU A;  2UXB Q;  2VW9 A;  5GAD C;  4DV2 Q;  1IBK Q;  1SN8 A;  2IHF A;  3NEL A;  2E5L L;  4GNX C;  3AFQ A;  2K50 A;  1I6H H;  1TWF H;  2BH2 A;  4GKK L;  5C0X J;  1NTG A;  2B3G A;  4LFB Q;  3ERS X;  4MTN A;  2UUB Q;  1VQC A;  3M4O H;  4HID A;  3GTQ H;  2KEN A;  4R4Q A;  2NVY H;  1PHJ A;  1C9O A;  1WYD A;  1PVO A;  1XMQ Q;  4JI7 Q;  2UXD Q;  1UE7 A;  3NEM A;  1HZB A;  4X6A H;  4HJ5 A;  1KRS A;  2A1A A;  4JV5 L;  4YCW A;  5J3B A;  3S15 H;  1YVC A;  3U58 A;  1GO3 E;  2ZTD A;  1WCM G;  5BR8 Q;  4POF A;  1XPU A;  1C0A A;  4R4O A;  3T1H Q;  3KLW A;  3F8T A;  2QEX A;  3I7F A;  1PH8 A;  1UE1 A;  1YNX A;  4AQY L;  3GTL H;  2I5M X;  2YTV A;  1YJW A;  1W3S A;  4JBM A;  1YIT A;  1PA6 A;  3W1G A;  2YTY A;  3PIO A;  2UUC Q;  3K80 C;  4DR5 L;  4IPH A;  2JEB I;  1K8G A;  5C3E H;  4Y52 H;  4EX5 A;  1VQN A;  1KD1 C;  4LF5 L;  4LF8 L;  4JI0 L;  3MXN B;  3OYY A;  4B3S L;  1DGS A;  3M4P A;  4X66 L;  4PG3 A;  2WAQ G;  1XPO A;  3I56 A;  1VQE A;  3JAM i;  3CCJ A;  1L2F A;  3GTM H;  1Q1B A;  4JI2 Q;  2VQF L;  2IY5 B;  2MO0 A;  1QVF A;  1Q81 C;  4LFA Q;  1X6O A;  2JA9 A;  3ULL A;  4YHH L;  4L5T A;  3KDF B;  1QVG A;  2R7D A;  2JA8 H;  3S1Q H;  5JJK A;  1U0L A;  1XJV A;  1X54 A;  1Z47 A;  4TQU S;  3HOV G;  3PO3 G;  3Q8D A;  4IJL A;  1QZG A;  3TS2 A;  1EUJ A;  3PO3 H;  2JA7 G;  3RLO A;  1LYL A;  3W5O A;  3HOV H;  2CWP A;  4L5Q A;  1KQS A;  1JT8 A;  1NBW A;  1UWV A;  2OCE A;  3G48 A;  5GQO A;  1N36 L;  4DK3 C;  4GS3 A;  1SLJ A;  3STB D;  3HOZ H;  3RZD H;  3S2D H;  1N32 Q;  1RL2 A;  4O0A A;  5M3M G;  1X56 A;  1TWG H;  1XNQ L;  2VUM G;  3ULP A;  4C2M H;  4POG A;  5C4X G;  4JI6 Q;  1G51 A;  1HZA A;  1KRT A;  5GAH C;  2HQL A;  3K7A H;  3EN2 A;  2YU9 H;  3KDF A;  3AYH B;  1XMO L;  4X65 Q;  5C4X H;  3CC7 A;  1XNR Q;  1I50 H;  3PUX A;  1L0W A;  4K0K L;  1VQK A;  4JI4 L;  4P71 A;  4C3J H;  2Z0S A;  3PCO B;  5IP7 G;  3T1Y L;  2OWO A;  1AE3 A;  5GAG C;  1V9P A;  4A3J G;  1PH2 A;  3OTO Q;  4DUZ Q;  1VQ9 A;  4LF7 L;  1HNW L;  4L5S A;  4H02 A;  1Y14 B;  3HKZ E;  3PUV A;  2JK8 A;  3DLL A;  4ALP A;  1XPR A;  1KL9 A;  1D7Q A;  5IWA L;  1SR3 A;  3PF5 A;  1RIP A;  3FKI G;  1Q8K A;  2ASB A;  4AIM A;  3S2H H;  3J81 i;  5LMN L;  3A5Z B;  1V43 A;  3PSI A;  1MKH A;  3JAM c;  4DUY L;  3FKI H;  1CKN B;  2UU9 L;  4LF9 Q;  4A3M H;  3GTG H;  3KF8 B;  1QUQ A;  2JA6 G;  1YHA A;  4NXM L;  3JC6 6;  4DR6 Q;  3E0E A;  1N8R C;  2PMZ E;  2DUD A;  5IYC G;  1PH1 A;  1CSQ A;  1PH7 A;  1VQF A;  2B63 G;  1U5K A;  3RNU A;  2D0P A;  5M5Y H;  4A3C H;  1IBL L;  4A3E H;  2UUA Q;  1WJJ A;  4OON A;  3TQY A;  3J7A 5;  5LMU Q;  4OWT B;  2HIV A;  2Z6K C;  2AHO B;  4LF6 L;  1VQI A;  1SE8 A;  4R4T A;  1OXT A;  3ER0 A;  4DV3 L;  2A19 A;  4GNX B;  1JJG A;  1YI2 A;  5FJ8 H;  1JB7 A;  1N9W A;  3CQZ H;  1YZ6 A;  3TRE A;  4DV5 Q;  2I0Q A;  5IT9 c;  1OXS C;  4DR3 Q;  2JEA I;  3D0F A;  4OWW B;  4A3B H;  4DR7 L;  1FGU A;  3B6Y A;  4FDB A;  5ELO A;  1BBU A;  1PH5 A;  1K0R A;  3MEF A;  1X55 A;  4DV4 Q;  3RN2 A;  4BY1 G;  4JI5 L;  4JI3 Q;  2WB1 E;  3I4M G;  4DR1 L;  3AEV A;  4P75 A;  4YY3 Q;  1YJ9 A;  1X3F A;  4JOI C;  1PH4 A;  4BY1 H;  5K36 G;  4AYB E;  3CPW A;  1D8L A;  4KHP Q;  1Q1E A;  4LFC L;  1LTL A;  2KHI A;  1L1O C;  2NZH A;  5IP9 G;  2AKW B;  4DV7 L;  1VQH A;  5IYD G;  2HHH L;  3RZO H;  1K9M C;  3HFZ B;  2K5H A;  1UE5 A;  1IZ6 A;  2LSS A;  2E8G A;  3NEN A;  4YWK A;  2GVA A;  3M4Q A;  1AE2 A;  4APV A;  2L15 A;  3PIP A;  2DGY A;  1M90 C;  4GNX A;  2OTL A;  2ZJQ A;  3J81 c;  1PYS B;  4BXX G;  3CAM A;  4DAY B;  1E1T A;  3PGZ A;  2MNA A;  1IBM L;  2NVX H;  4K0K Q;  2K14 A;  4DV6 L;  4QL5 A;  3KFU A;  2VQE Q;  4JBW A;  3CCE A;  3J80 i;  1YEZ A;  1GM5 A;  4DAM A;  1E1O A;  3HOU G;  3HKZ G;  4J15 A;  4OX9 L;  4BA1 I;  1VQ8 A;  1VQO A;  2CQO A;  1PYB A;  5IWA Q;  1WCM H;  1NMG A;  2PI2 E;  5M5X H;  2VNU D;  4YWM A;  3K81 C;  4RMF A;  1AH9 A;  1HZC A;  3BJU A;  5AJ3 L;  3CCS A;  4A3F G;  1YBY A;  2BH8 A;  2BA1 A;  4NXM Q;  4LNQ A;  1N34 Q;  2ZTE A;  2F3I A;  2VS1 A;  1OXV A;  5GRO A;  2Y0S E;  4JYA Q;  3S16 H;  4QIW E;  1C7Y A;  4B3T Q;  1HR0 L;  2Q2I A;  4IPD A;  1JE5 A;  1VQ4 A;  1KIX A;  1J6Q A;  1E7Z A;  1I94 L;  1A62 A;  3CCR A;  2ZM6 Q;  3KYH C;  3CCL A;  3F2D A;  1X65 A;  1HNX L;  1Q82 C;  3WWV A;  1VCI A;  1GKH A;  1FJG Q;  3CMA A;  4B3R L;  2XTI A;  4JI1 L;  3UE0 A;  3GTJ H;  1N33 L;  3FP9 A;  4PZ8 A;  4X62 L;  4JI8 Q;  4QJF A;  4LF4 L;  2NVQ H;  1TXY A;  4NXN Q;  1VQL A;  4P74 A;  5LMN W;  1YJN A;  3CC2 A;  4GOP B;  4B3M Q;  1PV4 A;  3TRZ A;  2WB1 G;  1E22 A;  5FLM G;  3GD7 A;  4A75 A;  2RHQ B;  1NMF A;  3K0X A;  4P72 A;  2JA7 H;  4BBS G;  3LGJ A;  2ZJR A;  1V1Q A;  4AYB G;  2R7F A;  3J80 c;  1P16 A;  5IY0 A;  4JG2 A;  1S40 A;  4DR4 L;  3UE1 A;  1PH9 A;  3UDX A;  4A3I G;  4A3L G;  2OQ0 A;  4BBR G;  4IPG A;  3CCM A;  1VQP A;  1QUQ B;  1LUZ A;  2N3S A;  4DV1 L;  1Y1V G;  4HJ8 A;  2PI2 A;  5M3M H;  2AWN A;  2E5L Q;  1Q12 A;  2ES2 A;  2VUM H;  4X64 L;  1J5E L;  1SRO A;  4GKK Q;  4A3L H;  2EQS A;  4GN5 A;  4HIK A;  4GKJ L;  3HOY G;  2VZA A;  1CSP A;  1I5F A;  5JJL A;  4A93 G;  1E24 A;  3M85 A;  1BKB A;  3F2B A;  1FVI A;  2K75 A;  1JJ2 A;  2OQK A;  4C3H H;  3CC4 A;  1KXL A;  2F4V L;  2V1C C;  3HOW G;  4GOP A;  4A3D G;  4QY7 A;  4A76 A;  4JI5 Q;  4A93 H;  1HH2 P;  4JV5 Q;  5IP7 H;  2PQA B;  3I4N G;  4LUZ A;  1HNZ L;  2UXB L;  2JE6 I;  4A3J H;  4IO9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...