4JI5Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji5Q00
4C3JH 4BA1I 4A76A 1TXYA 4IPGA 4IPCA 2IHFA 4OXPA 3KJPA 5FJ8G 3ULLA 4ME3A 1BBUA 3I4OA 1QUQA 2CQOA 5H1SE 4YCWA 4DV5Q 3NENA 4JBKA 3S1QH 2WP8J 5IYDG 2UXDL 4DAYB 2KBNA 3I2ZA 4X64Q 1IYJB 1RL2A 4P72A 5C44H 4A3JH 4PG3A 4DV4L 4JCVE 3PO2G 3J7A5 4OO1I 1KRSA 2K5NA 4MNOA 2IY5B 4JI1Q 4TQUS 2NVTH 1KD1C 1Q82C 1QZGA 2VQEQ 4NXML 4DR4Q 3JAMc 4X6AH 4AH6A 1OXXK 3GTLH 4APVA 4JV5L 2KCTA 3J80i 5AJ3Q 1Q86C 1Y14B 1G6PA 5C0XI 3T1HQ 4UP9A 2VUMH 3S14H 4JI0Q 1QUQB 4IO9A 4L5RC 1KL9A 4LF7Q 1WI5A 2C35B 1TWFH 4JI2Q 3TREA 2NVQH 1SRUA 4DV3L 1HNZL 2ES2A 4JI6Q 1C9OA 2IX0A 1XMQL 1PH1A 1LYLA 1N34L 5JJIA 1WCMH 3TS0A 2EIFA 3ZJYC 3AQQA 5IYCG 1X3EA 4R4QA 3RN5A 1Y1VH 2LXJA 4X62L 2JK8A 3UDGA 2E5LQ 3B6YA 5LMUQ 2K4KA 2ZJPA 1PH4A 3HOUH 1K9MC 4IFDG 1VQFA 2PI2A 4XIGS 4X66L 2K5HA 4AQYL 4A3IG 2ASBA 1QZHA 1VQ5A 1HNWL 4BBSG 3I56A 1I94Q 1FVIA 2K75A 3MEFA 1VQHA 2B3GA 1DGSA 3M4OH 4JYAL 1XMOL 5FLMH 2PQAB 4JG2A 1W2BA 3PV0A 4LF9Q 3I4NH 2YYZA 3J80c 1NTGA 2R7ZG 3F8TA 1E3PA 1VQ6A 1UE7A 3KFUA 3G48A 4LF6Q 1UEBA 4A3MG 3PF5A 2GN5A 2JE6I 2QEXA 1NJIC 1HZCA 4LFAL 3TS2A 4LF5L 1PH3A 1I6HH 1PH9A 3TRZA 4DR3L 3RZOH 3S17H 4OO1G 4O2DA 3AFPA 3NBHB 5JEAJ 1IBKQ 3GTMH 4AYBG 1VQJA 4DR1L 3AYHB 4HJAA 4JI8Q 2R93H 4K0KQ 4BY1H 1Q8KA 1SROA 1A8VA 5IYBH 5ELNA 1KRTA 1X55A 4YHHL 2UU9Q 5LMNW 1FJGQ 3CCEA 4HJ9A 3GTQH 2WB1G 2AWNA 1JMCA 2R7DA 5M3FG 3M7NA 1OXTA 1Z47A 5C0XG 3HOXH 3A0JA 1YJWA 1GVPA 1EFWA 3GTGH 1PFSA 1XNRQ 4DPGA 3HOWH 2B29A 2D62A 4R4IA 4DV7Q 2OQKA 1JJ2A 3S2HH 4NB3A 1TWHH 4AYBE 3T1YL 1AE3A 3STBD 2UXBQ 2PMZE 1K73C 1NE3A 2A19A 2UUBL 3I4MH 1WJJA 2R7FA 3G4SA 4A3KH 2YTVA 1VQCA 4POFA 2FXQA 2YV5A 2WB1E 3CMEA 1YJNA 4B3SQ 5C44G 4A3JG 1XNQQ 4WJ3M 4EX5A 1SR3A 2N78A 2RCNA 4AIMA 3HKZG 3K81C 2AMCB 4JOIA 2MO0A 4RMFA 5IWAL 3S1NH 2UXCQ 2HIVA 3M9BA 2E2JH 3ULPA 4A3FH 3BJUA 4DNIA 1M1KC 3S1MH 4YCVA 4DUYQ 4HIDA 2KHIA 1EIFA 4IJLA 1IBML 2VUMG 5K36G 4MZ9A 1L1OA 1L0WA 3H0GH 2CCZA 1G291 1B8AA 4XTCS 4A3GH 4QL5A 3CPWA 3ULJA 3HKZE 5J3BA 3JAMi 4DV1Q 1A62A 1WCMG 2Q2UA 2B63H 2YTYA 1K8GA 3A74A 2D0PA 5GROA 3GTOH 1YHQA 5ELOA 4L5SA 2I5MX 4JI4L 1Q1BA 4GKJQ 1UWVA 4YWKA 3PO3H 1Y1VG 5C3EH 4HJ5A 1B70B 4QJFA 2GVAA 2YTXA 2JA5H 1VQKA 1SN8A 4LFCQ 3L2PA 3M85A 5EAYA 3HOUG 1VQLA 4A3CH 2JA9A 1Q46A 3TQYA 1PH6A 1L1OB 4X64L 1EYGA 1HZBA 2BH2A 5M3MH 4PZ7A 5FLMG 1X3GA 1JJCB 3I4NG 2JEBI 1QVGA 1JB7A 1JT8A 4DR2Q 1SLJA 4A3BH 4PZ8A 3L7ZC 2E2HH 4TVAB 2IX1A 4B3RL 3KYHC 3CC7A 4DV0Q 3RZDH 4GN5A 1KAWA 4BA2I 5IY0A 3I7FA 1YI2A 3J81j 1EOVA 1U0LA 3T1HL 2BA0A 2NZHA 2PI2E 4GLAC 4LF7L 4X65Q 4JBWA 1PYBA 1EQRA 4DUZL 4OX9Q 4JI6L 3Q8DA 4BY1G 3G6EA 1B7YB 2R93G 5IYBG 4BXXH 1EQQA 1K0RA 1Y1WH 2JA8H 1X3FA 1KQSA 2CWPA 2AKWB 4NPSA 3HOXG 1KC8C 1ASZA 1VS0A 3PUZA 4KLKA 1IZ6A 4J15A 3K7AH 3HOWG 1KHIA 4DKAC 2ZM6L 3U58A 2F4VQ 5IP7H 1GD7A 2PQAA 2E5LL 2JA7H 5LMUL 3RLFA 3FHWA 5IP9G 4Y7NH 2RHQB 2VQFL 1D7QA 3I4MG 4A3KG 2K5VA 4P74A 1V9PA 1S72A 2UXDQ 1SMXA 4IFDJ 2HHHQ 4GNXA 1XPRA 5BR8Q 3KLWA 4DV2Q 4DR5L 3RN2A 4LFBL 4QGUA 2A1AA 1BBWA 2HQLA 1WFQA 2Q2IA 1P8LA 4IOAA 4P73A 3BZCA 4LF6L 3E9IA 1X6OA 2ID0A 4GKKQ 4A3FG 4YY3Q 1Q7YC 1EIYB 5LMNQ 1HR0L 1YHAA 1IBLQ 1OTCA 2JJQA 1CSPA 1X56A 2BA1A 3F2DA 1PH2A 4HJ8A 1PHJA 1TWGH 3ICEA 4Y52H 3CD6A 1I3QH 3KDFA 3H0GG 1FGUA 1G51A 1NBWA 4LUZA 2CWAA 4KHZA 4JI8L 4B3TQ 1I50H 1CUKA 2MFIA 4DV3Q 3HOZG 2JQOA 4A3GG 4YWLA 1FJGL 4GNXB 4DV6L 2B63G 1PH8A 3EBEA 4PMWA 1YIJA 2UUAQ 1N34Q 1N32L 4C3HH 4JI5Q 3AEVA 4NXNL 4JI7Q 2E8GA 2MO1A 4OWWB 1KIXA 5C3EG 2KHJA 4LF8Q 3PO3G 2OTLA 1CKMA 4MTNA 1A0IA 4IJHA 2JA5G 1H95A 4X62Q 3CCVA 3M4PA 5C0XJ 1N8RC 4A3CG 3BZKA 4LF4Q 4C2MH 4B3ML 3KDFB 1HNWQ 1W3SA 4IPDA 1S3OA 3OW2A 1VQIA 4B3SL 3D31A 5M3MG 1VCIA 1CSQA 3PUYA 2OWOA 4JYAQ 2ATWA 4JI3Q 3PIPA 1X54A 1XMOQ 4A3DH 3SGIA 5IP9H 3CXCA 4OWTB 4A3BG 3CPFA 3PF4A 3M3YH 3EIVA 3LGJA 1YVCA 3FKIH 4KHPL 1SE8A 4DUYL 1P16A 4GOPA 1HNXL 1VQ7A 1VQDA 4LF5Q 4P75A 3S15H 3ERSX 3MXNB 4DR3Q 2A8VA 4DK6C 1YJ9A 2OCEA 5IE8A 2UUCQ 2OTJA 2N49A 2Q2TA 4DR1Q 3K80C 2XTIA 1VQOA 3HOYH 4BXXG 5M5YH 4DV1L 2AWOA 4BY7H 5JJLA 4YHHQ 1VQBA 1Y1WG 5M5WH 2JA8G 4GS3A 4A93H 1VQEA 4POGA 3A5ZB 1M90C 4GKJL 1LM0A 1N9WA 3UDIA 5HGQA 1D8LA 3UE1A 3HOZH 1PYSB 5IP7G 1YBYA 1ASYA 2JA7G 1J6QA 3UDFA 4GOPB 1VQ9A 3T1YQ 3PGZA 4GLVB 4R4OA 1GM5A 2OQ0A 1N33Q 2HIXA 1JJGA 4YCUA 3RLOA 1TWAH 4IOCA 4FDBA 4DR7Q 1E7ZA 4QQBX 3OYYA 4A3LH 1A63A 1K8AC 1QVCA 3JC66 2CKZB 3RR5A 4BBRH 3KJOA 4UY8C 3U4ZA 4DR6Q 2N8NA 2MNAA 4RG1A 4DV5L 4GOPC 4A75A 3OTOQ 3CCQA 4DR2L 1L2FA 3K8AA 1N36Q 2ALYB 4JOIC 5IWAQ 3S16H 2K14A 3CCJA 1V1QA 1AH9A 3K0XA 4ALPA 4R1JA 4HIOA 4A3EH 3CP0A 4O0AA 2DGYA 3IRBA 3F2BA 2RHSB 3NEMA 5GAGC 2WFWA 4JI1L 3I55A 5GAEC 2LSSA 2R92H 2VQEL 4DR4L 3PUXA 1JE5A 1XJVA 4P71A 1L1OC 1NY4A 1XTDA 2JA6H 4R4CA 3GTPH 4OX9L 2CFMA 4QIWE 3K7UC 5AJ3L 2ZTCA 4GN3B 1PA6A 3W5OA 1UE5A 4OWXB 1HH2P 1R9TH 3H15A 4JI0L 3CW2C 1NMFA 1EUJA 1I5FA 3CQZH 1IXRA 4JI2L 2QGQA 1X9NA 1VQNA 2VNUD 5E7NA 2F4VL 3HOVH 3E0EA 1J5EQ 1BVSA 2XGTA 1HZAA 4C3IH 1CKOA 3WWVA 3GTKH 2NN6I 1BKBA 4HIMA 1XPOA 3KF8B 1CKNA 1Q1EA 2VY3A 5GADC 2HHHL 1GO3E 5BR8L 4DV2L 4UPAA 4JI4Q 1VQMA 1HJPA 3CCRA 1SFOH 3KF6A 3J7ZC 1PVOA 4A3DG 1VQAA 3GO5A 3STBC 3M4QA 2DUDA 1I94L 2IT1A 4GKKL 5FLXc 1NMGA 2ZTDA 2I5LX 3FKIG 3J81i 4YY3L 4HJ7A 1YEZA 1IL2A 3S2DH 4L5QA 4B3RQ 3UDXA 5LMNL 1IBLL 4DAMA 4DV4Q 4LF9L 2F52A 2LXKA 3PCOB 4NXMQ 4KI0A 1V43A 2Y0SG 2ZTEA 1E22A 4B3TL 2VZAA 3W1BA 2QA4A 1CKNB 4DUZQ 3HOYG 1Z9FA 1O7IA 3HKSA 1VQPA 4BY7G 4JV5Q 1VQ4A 4A93G 2UUAL 1VQGA 3PUWA 5M5XH 3KF6B 1E1TA 4JI5L 1IBKL 1T9HA 5GAHC 4JI7L 3E9HA 3CF5A 1PV4A 4LF8L 2RF4A 5C4XH 4K0KL 1LUZA 1HNZQ 2ZM6Q 1XMQQ 1MIUA 2UU9L 2VL6A 4UP8A 2NVXH 1K83H 2I5HA 2Y0SE 1GKHA 1EWIA 4LF4L 4LUVA 2VQFQ 2R6GA 1XNRL 4GN4B 3H3VH 4A3LG 1HZ9A 1AE2A 4DV7L 2EQSA 4BBRG 1OXVA 5FJ8H 4LFBQ 4JI3L 3CCUA 4GNXC 4DR5Q 1VQ8A 2UXBL 4QY7A 3U50C 2NZOA 3J81c 1Q81C 3EN2A 1UE1A 4X66Q 5C4JH 3CCMA 4AQYQ 1X65A 2WAQG 4L5TA 3PUVA 2MQHA 1YITA 3F2CA 2NN6G 3CC4A 5IYDH 1XNQL 4A3EG 4YWMA 3PO2H 2PNHA 1HR0Q 1KXLA 2BH8A 2R92G 3CCSA 5DLQE 2UUCL 5GQOA 2UXCL 2JA6G 2JEAI 1Q12A 1OXSC 4R4TA 5JEAG 2Z6KA 3VDYA 4DK3C 4LW1A 2F3IA 4LFAQ 1K3RA 2WAQE 4WJ4A 1QVFA 4DV6Q 4IPHA 3PIOA 3A5UA 3CC2A 1OXUA 1N32Q 3W1GA 3H3VI 1S40A 1RIPA 4EQ5A 1PH7A 4NXNQ 5HY6A 3HOVG 4PZ6A 3U4VA 2VW9A 2KENA 1HR0W 2V1CC 3HFZB 1U5KA 1N33L 2Q2HA 1TWCH 3TEHB 3RNUA 4B3MQ 1C7YA 2L15A 4DR7L 3GDEA 5IYCH 3F1ZA 3UE0A 4JBJA 1MJEA 1MJCA 2GVBA 3KOJA 4OONA 4LFCL 1C0AA 1YHBA 3ER0A 5IT9c 2D0OA 4DR6L 3NELA 2AHOB 1WOCA 3OTOL 4A4IA 1N36L 2K50A 4A3IH 2ZJQA 5JJKA 1MKHA 2VS1A 2H5XA 2I0QA 2UUBQ 4BBSH 3GTJH 4GLXA 2KCMA 3DM3A 4KHPQ 2Z6KC 1WYDA 1UE6A 2Z0SA 1HNXQ 4UP7A 2HT1A 4HIKA 2K52A 2N3SA 1E1OA 3PSIA 2R7ZH 3DLLA 3D0FA 3CMAA 2EXDA 4A3MH 2NVYH 4DV0L 4LNQA 3S24A 1LTLA 1XPUA 2E2IH 3CAMA 3L0OA 1IBMQ 2YU9H 4H02A 4LWCA 4X65L 3CCLA 3FP9A 5C4XG 3AFQA 1FL0A 1YZ6A 1J5EL 4LUOA 3S1RH 4IFDI 1YNXA 3G71A 2IHEA 3RLNA 4JBMA 2ZJRA 3BU2A 5M3FH 4JC0A 1PH5A 1E24A 3GD7A
chains in the Genus database with same CATH superfamily
1IW7C 1TXYA 4IPGA 4IPCA 2PZTA 2E2IB 1EZ6A 3NWSA 1HHVA 4QMGA 4JBKA 2CQOA 2KCCA 3QR8A 4DV5Q 1HFNA 4KKTA 2WP8J 1I4PA 2KBNA 1CK1A 2B8GA 3MEHA 1ESFA 2WB1B 4PG3A 5M3FB 4JI1Q 1MI2A 1ZYRC 4N9PA 2EYPA 4KTAA 1EYCA 3BYYB 4UP9A 2NYZD 3S14H 5K36H 4K6DA 1QE6A 1TWFH 3TREA 5D3DA 3Q0AA 2NVQH 2ES2A 4CJ2C 1LYLA 1XXGA 1LV9A 4HAEA 1ZXTA 1WTHA 3NTHA 4NKLA 2MJ8A 1ML0D 2XRQD 1Y1VH 5BN4A 3UDGA 3TMEA 5LMUQ 5COYA 1TWFB 4AQYL 2NVQB 2KEDA 4BBSG 1GUWA 1FVIA 1I4GA 4JYAL 1XMOL 1W2BA 4BWGB 1O80A 1Y1VB 3KFUA 1E3PA 3SDZA 1UE7A 4HSPA 1C48A 3G48A 5IGDA 4LF6Q 4CDFC 2GN5A 1KLGD 4B9WA 1CI3M 1PH9A 5KIXA 4DR3L 3AFPA 1UAPA 1BOSA 3JAME 1IBKQ 4AYBG 4PNYA 5I9OA 4DR1L 4B9XA 4HJAA 2R93H 2B39A 2A5HA 3RD4A 5LMNW 1FJGQ 3CCEA 2R7DA 2XWJB 4DXFA 3M7NA 3FPPA 5C0XG 1SXTA 3IAYA 1EY0A 3GTGH 1PFSA 3VA5A 2D62A 4R4IA 4DV7Q 2OQKA 1JJ2A 3S9WA 1TWHH 4AYBE 3T1YL 1AE3A 2K04A 1A6XA 1LT3D 1NE3A 2R93B 2UUBL 2F0LA 4A3KH 1E2WA 2YTVA 3CMEA 2N55A 1YJNA 5C44G 4A3JG 4WJ3M 3GTGB 5CMDA 2AUKA 2N78A 2E2DC 3HKZG 4RMFA 4QUFA 1WTRA 5CV7A 1TWHB 1U4RA 4KD3A 4DNIA 2A6HC 2NB0A 3EROA 2A74C 4IJLA 5IGGA 4A3KB 2VUMG 2K28A 3DWPA 3H0GH 4XTCS 1U4PA 4A3GH 4QL5A 3CPWA 1PFNA 5C4ZA 3HKZE 1A62A 4RGNA 3NHHA 1LABA 4L5SA 2K5QA 3PO3H 1B70B 5CGKA 4QJFA 2CVRA 2FJ2A 1VQKA 4XXEA 3L2PA 5BN5A 3HOUG 4GZYC 3H0GB 1VQLA 2JA9A 1MHWC 1Q46A 1TKWB 3H91A 4A3GB 5KRUA 5HURA 4PV1C 4PZ7A 1S5FD 1JJCB 2LY7A 2VB2X 1QVGA 2LFNA 4EQOA 3PO3B 1H9KA 4CJ0B 4X3KA 2E2HH 2IX1A 2XVSA 3KYHC 2B2VA 3NTKA 4DV0Q 3I7FA 2PI2E 5A2QL 2AQ2B 5DM73 4L6TB 1WD0A 1I4RA 4HR7B 3OMCA 4DUZL 3ND8A 2XNAC 3Q23A 1EQQA 2F0VA 1FNUA 4IUQA 1RHPA 2E2HB 3BS1A 3HOXG 1KC8C 1ASZA 2F4IA 1LTBD 4KLKA 1O7ZA 3BZDB 3HOWG 1CZGA 2DN8A 4V0BA 3U58A 5IP7H 1GD7A 3I4LA 4FF2A 3QG1A 2JA7H 5LMUL 3NUCA 5KEEA 5IP9G 1MGSA 1TS3A 5K5PA 1D7QA 3QB3A 2UXDQ 3FMCA 2HQEA 2LKVA 3RN2A 3NBHA 1G2SA 2HQLA 4DGZA 2Q2IA 1NSNS 3ERQA 4CJ1B 4P73A 4IOAA 4LF6L 3E9IA 2JA7B 4YY3Q 5T1IA 4FF1A 2EJMA 1IBLQ 1B4OA 1EQVA 2BA1A 5J22A 1Y8OB 1TWGH 3CD6A 3KDFA 3HOZG 4KHZA 4B3TQ 1I50H 4DF7A 1JOKA 2OF1A 5CV6A 1FJGL 3EBEA 1VF5C 4K14A 3T16A 3AEVA 1HA6A 4PQXA 4NXNL 1CKMA 1KABA 1A0IA 2QDLA 4IJHA 1K8MA 5ELDA 2NUCA 4A3CG 5FLXL 1K8OA 2PW7A 4C2MH 4B3ML 2SDFA 1I50B 3KDFB 1HNWQ 1PTOB 1S3OA 3D8GA 5LL6S 3GQBA 5M3MG 2NVXB 1VCIA 1EY6A 4DU9A 3CXCA 1A3UA 2JN4A 1EEFD 2K6AA 3EIVA 3M3YH 1SE4A 1ILPA 2OEOA 2TMPA 1CT1D 1SE8A 4C2MB 3NXWA 1LT5D 2EY2A 2OCEA 1SYFA 5IE8A 2OTJA 3V05A 1LT6D 3K80C 1EWCA 2AWOA 1VDZA 2JYOA 5D14A 4A93H 4GS3A 3M3YB 4K5WA 1VQEA 4POGA 3A5ZB 1DOKA 1LM0A 5HGQA 1AW7A 1SE2A 1PYSB 5I6WA 5FK9C 3UDFA 4IUTA 4GLVB 4FF3A 2Y0SB 4DXGA 5T1GA 1N33Q 1YNND 1QWYA 2HIXA 2H4OA 4DR7Q 5CBEE 4FO2A 3OYYA 4A93B 3ZYYX 1O78A 2Z4IA 4UY8C 5DM63 2IWHA 3CCQA 1L2FA 1EY5A 2HD3A 2ALYB 1V1QA 3K0XA 5EKIA 4R1JA 4HIOA 4A3EH 3IRBA 3NEMA 1STHA 3CRLC 4MIUA 3PUXA 1PTOD 1XJVA 3H09A 1JWUD 1GXDC 2CFMA 3KUPA 5JEAH 3TSSA 2ZTCA 5AJ3L 4XT1B 4ZKCB 3W5OA 4OWXB 3H15A 3TP8A 1I5FA 3CQZH 4I65A 5IT9L 4A3EB 2O2LD 2QGQA 3MFYA 2A73B 3EVQA 1HZAA 5KYLA 4FYDA 1SYEA 1GUOA 3WWVA 1BKBA 1TIID 1IL8A 1CKNA 3D6WA 1SFOH 1PVOA 3J7ZC 3CQZB 1SEBD 3STBC 1I94L 2A68C 2GA4B 3FKIG 1IL2A 3J81i 4YY3L 1YEZA 3S2DH 3AMUA 1EIGA 1IBLL 2EY5A 4DV4Q 1BF4A 2HDLA 1MSGA 3VYUA 3PCOB 1D6EC 4NXMQ 4B3TL 2VZAA 3W1BA 1SFOB 2IX3A 5KYIA 1CKNB 3DEPA 4BY7G 1VQPA 4UHVA 5G3LD 2J7ZA 1CFMA 3D3RA 5GAHC 3E9HA 3S2DB 4FXDA 1RTNA 4K0KL 1MIUA 2VL6A 3IKJA 4UP8A 5EQ0A 1EWIA 4LUVA 1LO5D 2PO4A 4A3LG 1NCVA 1HZ9A 4IUUA 5CYUA 1EQTA 3SR1A 4BBRG 1OXVA 3DHQA 1TVXA 4GNXC 4DR5Q 4KK7A 4PMCA 3PQIA 1UE1A 2KA7A 4L5TA 1YITA 3F2CA 1HPCA 1XNQL 4YWMA 2PNHA 1IKLA 3Q24A 1K28A 2BH8A 2R92G 5AFWA 4KY7A 3HG9A 2UXCL 3KBXA 1Q12A 4CKBA 4R4TA 2Z6KA 4FNFA 4LFAQ 3PIOA 1S5CD 3CC2A 3NPPA 1N32Q 2OT2A 1HR0W 5C5LA 1U9RA 1I4XA 3HEJA 1N33L 1JOQA 1BCPC 1ONLA 1TWCH 1Q3LA 2L15A 4DR7L 4JBJA 5D3IB 4OONA 5L37A 1Q8IA 3ER0A 4ZUJA 2AHOB 4KD4A 4IFDH 4A4IA 2ZJQA 1MKHA 4WFN3 4K2KA 3KLRA 4DNRB 2Z6KC 3BVGA 1D5ZC 2Z0SA 4UP7A 1F77A 3VR6A 3T13A 1D2BA 3PSIA 5C5MA 1C8CA 3T56B 1HRJA 2EXDA 4A3MH 2NVYH 4HEDA 1WTQA 4ZLTF 3S1NB 3CCLA 3S1MB 3FP9A 3V96A 5C4XG 2CH4A 1FL0A 1FYCA 1YZ6A 4LUOA 3MAQA 1YNXA 1SJED 3OIPA 3RLNA 4JBMA 1NNXA 2ZJRA 2NVYB 2IPKD 1PH5A 2EYJA 4BA1I 4C3JH 4OXPA 3ULLA 1BBUA 3A56A 2RDGA 2PQEA 2PMZB 3R2IA 5IYDG 4X64Q 3I2ZA 4G7OC 1IYJB 1RL2A 4N8X1 2R61A 2RA4A 4DV4L 2K5NA 1J8IA 2F0UA 4C3JB 1KD1C 4NXML 2KUMA 4ZKBB 4WORA 3GTLH 4APVA 2KCTA 2A6ED 5J1ZA 2EYLA 5C0XI 3T1HQ 2SNMA 2XRSD 1DZ1A 2C35B 1PMRA 2RCFA 4DV3L 4JI6Q 1EZ8A 3GP7A 3TN2A 3MA2B 3TS0A 2DNCA 5FO9B 3GTLB 2O4XA 1G8ZD 3AQQA 5IYCG 1X3EA 3RN5A 4KN4C 2LXJA 3KLSA 3U9OA 1JWSD 4X62L 2JK8A 1RJTA 4HN7A 3X3MA 3BDLA 4A3IG 3N6RA 1QZHA 3NE5B 2PZWA 2B3GA 5CV9A 4OGQC 5FLMH 2PQAB 2Z9HA 4JG2A 4LF9Q 3I4NH 2YYZA 1DXMA 1A2UA 3J80c 4K5VA 2R7ZG 1VQ6A 4LJZC 2JE6I 3MZ5A 4LFAL 3A55A 4LF5L 1I6HH 3FDTA 3S17H 4V190 4O2DA 5JEAJ 1ENAA 4O42A 4U68A 1VQJA 4J6HA 4JI8Q 4BY1H 3I4NB 5IYBH 2B2TA 4WJWA 5KNDA 2UU9Q 4RWSC 1PRTF 1M8AA 3Q22A 1OXTA 1Z47A 1E2ZA 1GVPA 1XNRQ 1I6HB 4QB4A 1EU3A 3S17B 4NB3A 2UXBQ 1ET6A 4F88A 2A19A 5JVG3 4BY1B 3I4MH 1WJJA 1GUNA 2FXQA 2YV5A 1LTTD 5IGBA 4C1NK 4RGOS 4JOIA 2HIVA 3M9BA 1EWHA 3ULPA 2E2JH 4YCVA 4DUYQ 1EIHA 3OOCA 3TZUA 4MZ9A 1L1OA 3EJIA 2CCZA 1G291 3OSOA 1B8AA 1JR0D 2WACA 1HA5A 4JW0A 3D4WA 5JPNC 2ZT9C 1B2TA 5J3BA 3VR5A 1WCMG 2Q2UA 2B63H 4IN3A 5LL6X 2E2JB 2I5MX 4MHEA 4H7BA 4YWKA 5M5YB 4XT3B 3OWEB 1A3TA 4HJ5A 4EVOA 3DUZA 4IZ8A 2YTXA 4ODGA 1SN8A 3M85A 5EAYA 4R8IA 2F0FA 2B2UA 1L1OB 3SK6A 2I07B 4X64L 3RMHA 1HZBA 2B63B 1Y8NB 2A69C 2FINB 4DNTB 3DWQA 3BYTB 1JB7A 1JT8A 4A3BH 3SHLA 5M9OA 5ELFA 2F0IA 4K8JA 4B3RL 3EA6A 3J81j 1CZWA 1U0LA 3T1HL 2BA0A 3PMFA 3LWUA 4X65Q 4JI6L 4NW2A 1GUSA 4BXXH 2R92B 4A3BB 1Y1WH 2L0CA 2JA8H 1KQSA 2AKWB 4J1MA 4X3SA 2B2UC 3PUZA 3CKIB 3T51B 3NQTA 1KHIA 2F4VQ 2CW0D 1WTWA 3RLFA 5JVH3 3QIAA 2VQFL 1S72A 1V9PA 1NR2A 1Y1WB 4IFDJ 2JA8B 4LFBL 3M7GA 4DV2Q 4ABNA 2A1AA 1BBWA 2L1BA 2B8FA 2ID0A 4A3FG 1EIYB 5I2XA 1X56A 1PHJA 1AEXA 4HJ8A 1I3QH 1FGUA 4LUZA 2CWAA 4JI8L 4O1NA 4YWLA 4OL7A 4DV6L 1YIJA 4PMWA 1N34Q 4QF4A 1D5MC 3SK8A 2G9DA 5C3EG 2JA5G 3CCVA 1Y69U 3P75A 1I3QB 3M4PA 2LMCB 3MXNA 2WKCA 1HFGA 1W3SA 1EYDA 1VQIA 3D31A 3SK4A 2K32A 3PUYA 2OWOA 2F0KA 2ATWA 3PIPA 1X54A 4TRDA 4A3DH 3SGIA 3LGJA 1ICFB 2BDNA 4KHPL 2E74C 4DUYL 1Z6HA 3MXNB 3NQIA 1G2TA 1YJ9A 2UUCQ 4J8QA 4KY5A 2NWGA 1VQOA 4A3DB 3KBGA 4F7XA 1JQYD 4YHHQ 1VQBA 4LAAA 4DK0A 1B53A 1M90C 3R2TA 3OHXC 5EBDA 3UDIA 1O7LA 2F0PA 3J81L 1GM5A 4XYOA 2OQ0A 4RKBA 3TZDA 3I70A 1JJGA 2VB3X 4YCUA 1TWAH 1T5EA 5JOBA 1B3AA 1E7ZA 1A63A 2CQAA 1K8AC 1QVCA 1I4QA 4KKSA 4Q0FA 2MNAA 4DV5L 1CQVA 2QILA 1GJXA 1S5ED 5IWAQ 3S16H 3CCJA 1QJOA 1NUCA 4ALPA 4EQNA 3D4RA 2RHSB 2WFWA 4JI1L 3I55A 1TWAB 4S3SA 4MTKA 3QOLA 3KF8A 3I8ZA 2JA6H 4R4CA 3GTPH 2DJFC 4QIWE 2O5JC 1PZID 3K7UC 3LX0A 1SJHD 4F8MA 1W6KA 3J7AV 1SSOA 2L5TA 4C3HG 2ICIA 3S16B 1EUJA 3H6MA 3I91A 5EPJA 5E7NA 1BR9A 2F4VL 2EYMA 2XGTA 4C3IH 2JA6B 3GTPB 1CKOA 3GTKH 1XPOA 4HIMA 3KF8B 1Q1EA 4DV2L 3FVQA 4K2LA 3KF6A 4H13C 1D5XC 3VYSA 2O5IC 2IT1A 5FLXc 1NMGA 4HJ7A 4C3IB 2B2VC 3GTKB 4KV6A 1PDQA 3V2TA 2G5DA 3E3XA 4KI0A 2ZTEA 5CV8A 4CKCA 5FKAC 2QA4A 3HOYG 5LHY1 3HKSA 4FP5D 1GUGA 3MWYW 1TY0A 3KF6B 3PUWA 3BDOA 1SNDA 1IBKL 4JK1C 1L0YB 4RAUC 1K3BC 1HNZQ 1EFID 1PTOH 2ZM6Q 1WTPA 2NVXH 2I5HA 3M4YA 1LTAD 4MN3A 5CR3A 2R6GA 5ISRA 3MXPA 4GN4B 5EPKA 1V1OA 4DV7L 2PPBC 3K5LA 2F0OA 3CCUA 1VQ8A 3JAML 3N52A 3U50C 4XYQA 1Q81C 4X66Q 5KNBA 2WAQG 4RHRA 1B1ZA 2MQHA 2NN6G 4L63B 3VR4A 1HR0Q 1KXLA 4L8JA 3DM1A 2UUCL 1PTOC 1LTGD 3QOJA 3VDYA 1GHJA 5EKKA 2WAQE 2HDMA 1QVFA 4WJ4A 1SYDA 2QKIC 3ITPA 3W1GA 3H3VI 1O7YA 1CM9A 2M00A 1HTLD 3HOVG 1QNKA 1JWMD 1J9OA 2KENA 2XWBB 3HFZB 5C3XA 1U5KA 3TEHB 3HZXA 1A2TA 3UE0A 3SE0A 1AP0A 1MJCA 2GVBA 3KOJA 1QOHA 1YHBA 3DXJC 5IT9c 3NELA 4RGMA 1QB5D 4DAVA 5JJKA 2Z1CA 4BBSH 1DOLA 1F2YA 3DM3A 3J7AF 2JSOA 4ME5A 2F0GA 2MUYA 3G6JB 1WYDA 4N9TA 1F9PA 1HNXQ 2HT1A 2F0SA 5EBCA 2N3SA 3C46A 1E1OA 1E2VA 2DY7A 3DLLA 1PRTB 4DV0L 3S24A 1LTLA 1XPUA 1AZPA 3GV3A 4BBSB 2YU9H 4LWCA 4M8AA 3Q6SA 2RSNA 2KEEA 4K5XA 1WTXA 5C0XH 4CKEA 4A76A 3KJPA 5FJ8G 2YU9B 4ME3A 3URYA 4AYBB 4HCSA 2FMMA 2KCNA 2F0QA 2UXDL 1H9SA 2BCOA 5C44H 4A3JH 2X6GA 1SDFA 1XTCD 4JCVE 3PO2G 4RA8A 1V8QA 4TQUS 4DR4Q 2VQEQ 3T4AC 4AH6A 1OXXK 2H1EA 4HCEA 1G6PA 2VUMH 4JI0Q 1JE4A 5I6YA 1UNSA 4L5RC 3BDCA 5C44B 4A3JB 4JI2Q 5E4XA 1HNZL 4HMJA 1GUTA 1H9SB 1PH1A 1JOOA 1STEA 1KTKA 3HKZB 4R8NA 3TP7A 5CBAE 3ZJYC 1ENCA 4G57A 1PRTD 4R4QA 5C4HA 4IQZA 4F87A 3P1HA 5HGTA 1QCBD 4P2CB 2VUMB 3B6YA 2K4KA 2ZJPA 1PH4A 3HOUH 2PI2A 4XIGS 4X66L 1HQMC 1HTPA 2BOSA 2K5HA 1HNWL 1VQ5A 3OPOA 3I56A 3MEFA 1VQHA 3M4OH 1HCZA 1FD7D 1U4MA 2ENBA 4IUVA 4QUCA 2WINB 1UEBA 4M1UB 2QEXA 3PF5A 1NJIC 3HOUB 1PH3A 4Z9CB 3TRZA 4OO1G 2EDGA 3NP8A 3HGBA 3MTSA 3GTMH 4FXKC 3M4OB 1II3A 4OEMB 1Q8KA 1A8VA 5ELNA 1X55A 1PXUA 4HJ9A 3GTQH 2WB1G 2AWNA 2SOBA 5M3FG 3HOXH 1IYUA 2QCPX 3HOWH 2B29A 3S2HH 3GTMB 3STBD 1V1PB 4RH6A 1K73C 2E75C 2RQXA 2R7FA 4POFA 4B3SQ 2L12A 2WB1E 3GTQB 4KJNA 3HOXB 4EX5A 1PLFA 3KK7A 4AIMA 3HOWB 3F2UA 2MO0A 3S1NH 3S2HB 3OMGA 2MHVA 3S1MH 3BJUA 1B3QA 3TBIB 4IUPA 4NP5A 1EIFA 1CHQD 3J80E 5K36G 4JPBW 1L0WA 2F0EA 1TQOA 3ULJA 3JAMi 2RVLA 4DV1Q 3VR2A 1F2ZA 2YTYA 3EFXD 5GROA 1K8GA 5ELOA 3DMUA 2XIWA 4GKJQ 1Q1BA 2K1BA 1CA5A 1Y1VG 5E4WC 4LFCQ 1B44D 2Q8TA 4RFBA 3TP6A 4A3CH 2VXWA 3TQYA 3HOZB 3PIO3 2CH4W 2AQ1B 5M3MH 3BVZA 1SMYC 2PYKA 2C9OA 2JEBI 1TR5A 2EYFA 4DR2Q 4PZ8A 2F1MA 1HXYD 5I4DA 4EGVA 3E5SA 4LK1C 2EY1A 4GN5A 5IY0A 1EOVA 2V4DA 5M3MB 4CGYB 3P20A 4OX9Q 2R93G 1CHPD 2L11A 3G6EA 3J7YW 3C2PA 2XN9C 5IGFA 2CWPA 4NPSA 5I9PA 5E3FA 4J15A 2NBFA 2WV6D 4LMQD 2PQAA 1VMPA 4EQPA 1DM0B 4Y7NH 2F03A 2RHQB 1RDPD 2QF7A 4A3KG 2K5VA 4P74A 1C4QA 2HHHQ 1XPRA 4DR5L 1KNAA 3I90A 4GKKQ 1X6OA 1G6ZA 3RUZA 4TKOB 4Y7NB 5LMNQ 1OTCA 1CSPA 3F2DA 3ICEA 3AB9A 2F0JA 3H0GG 1G51A 3WOFA 2Q8IB 4A3GG 2EOTA 2PNRC 1XWEA 3EQLC 2Q8RE 2UUAQ 1N32L 1GHKA 4H44C 4JI5Q 1QG7A 4JI7Q 2MO1A 2WKDA 1KIXA 3PO3G 2KHJA 1JB3A 4MTNA 1H95A 3QWNA 5FO8B 5C0XJ 1N8RC 3BZKA 2BE5C 1STNA 4IPDA 4B3SL 1CSQA 4JYAQ 3DEOA 3ONAB 1XMOQ 4ILWA 4OWTB 3CPFA 1YVCA 3OW7A 3FKIH 1EOTA 1DD2A 4GOPA 2CHBD 2K33A 1VQDA 3H94A 1VQ7A 4DR3Q 2Z8LA 3VA7A 1DCZA 1PZJD 2Q2TA 1LT4D 4DR1Q 5M5YH 4DV1L 4BY7H 5JJLA 4H0LC 4R9WA 4ZK9B 2B2TC 1A3VA 3IL8A 3FKIB 4GKJL 1CQFA 1D8LA 1RCVD 3UE1A 3E0JA 5IP7G 3MXGA 1YBYA 2I46A 1YNJD 2F0MA 1ASYA 4DN4M 3NSWA 2JA7G 1J6QA 4GOPB 2EJFC 1SNCA 3T1YQ 3PGZA 4R4OA 1A15A 1VQ9A 1LLRD 1EEID 1KDCA 3RLOA 4BY7B 4A3LH 2OXPA 1T5XD 3JC66 3RR5A 2CKZB 4BBRH 3KJOA 4RCOA 2KECA 2SEBD 3U4ZA 1KNEA 3J81E 4GOPC 4DK1A 4DR2L 1N36Q 4JOIC 4I7AA 2Z4HA 4O0AA 5GAGC 4ZAIA 2R92H 2E76C 1F2LA 2HCIA 1IYVA 4KHVA 3GTJB 1BQQT 1L1OC 4BBRB 4OX9L 3HP3A 1BO0A 1PA6A 1Q90A 1UE5A 1R9TH 2KOLA 2MPMA 1ET9A 3W3AA 5IODA 5CORA 2NN6I 4KJOA 1IKMA 2G9HD 2J0TD 5A2QE 2VY3A 2HHHL 1JORA 1GO3E 1R9TB 4UPAA 3CCRA 1D1IA 1K0SA 4GKKL 3ND9A 1SAPA 2F0NA 2ZTDA 3A7LA 4CHTB 5NUCA 3UDXA 5LMNL 4DAMA 4LF9L 1I6VC 3K59A 3T53B 3D6CA 2K03A 2F52A 2LXKA 2Y0SG 1E22A 1GOZA 4Q5VA 4DUZQ 4JV5Q 1Z9FA 5KNCA 1DYQA 3QJYA 4A93G 3C1EA 4C1NI 2UUAL 4JI5L 4JI7L 2IW3A 2RF4A 5C4XH 1PFBA 1BCPF 5I2YA 4CDDC 1XMQQ 2UU9L 1STAA 3D4DA 3S14B 1K83H 2Y0SE 1GKHA 2M9VA 1IW7D 4CDCC 2ICEC 1XNRL 3H3VH 2JXMB 2A69D 1AE2A 2EQSA 3I72A 4ZYSA 2UXBL 4QY7A 1LACA 1B9MA 3J81c 5C4JH 5C4XB 3CCMA 3LWEA 3PUVA 5IYDH 1Z7TA 1K83B 4A3EG 2P5ZX 2D2CC 1S4ZA 1EY4A 1ZYRD 2L4NA 5GQOA 5FLXE 2JEAI 1MD2D 5JEAG 2F0WA 4LW1A 5C4JB 4B08A 4IPHA 3A5UA 3H3VC 5A35A 1RIPA 1PH7A 4NXNQ 1BBXC 2X69A 4X3TA 4PZ6A 3U4VA 2V1CC 3K5MA 1WD1A 2Q2HA 4B3MQ 2AUJD 1TS4A 5IYCH 3F1ZA 1MJEA 3K58A 1I4HA 2D0OA 1ZKOA 4RKLA 1WOCA 2F0HA 2B2WA 1N36L 3A7AB 2K50A 4A3IH 2I0QA 1S5DD 1STYA 1BXTA 2KCMA 1B9NA 1UE6A 2WIIB 1F9QA 1UUPA 1RTOA 2K52A 2R7ZH 3BG3A 3D0FA 2QDBA 3MVVA 4HMIA 4X3UA 5DNFA 5IGEA 4LNQA 2MP1A 3A8JE 4A3IB 3L0OA 1IBMQ 3AU7A 4H02A 4G4KA 3PIP3 4X65L 3IFDA 4DAYA 1SYGA 1X3QA 3S1RH 3CHBD 4WRDA 1EU4A 2R7ZB 2IHEA 3BU2A 1SNMA 1G91A 2B2WC 1E24A 4JI4Q 2IHFA 2K01A 3MXUA 2RKSA 3QO2A 3I4OA 1QUQA 5H1SE 3S1QH 4YCWA 3NENA 5JAVA 4DAYB 3S1RB 2C5CA 2AQ3B 4P72A 5IT9E 1DJRD 4OO1I 3J7A5 1NR4A 1KRSA 4MNOA 2IY5B 4IALA 4KY6A 2NVTH 1Q82C 1QZGA 2EYHA 1KDAA 3JAMc 3HRZC 4X6AH 1ZEQX 4JV5L 4KN7C 3J80i 1WTOA 2A6HD 3U9SA 5AJ3Q 3S1QB 4UDUC 1Q86C 2EJGC 1Y14B 2KQ3A 2RSOA 2K7VA 1QUQB 4NDXA 1STBA 4IO9A 1EL0A 1KL9A 4LF7Q 1WI5A 1FNWA 1FNVA 1TT2A 1SRUA 3VR3A 1C9OA 2IX0A 1S5BD 1XMQL 2NVTB 3CU7A 5EJWA 1N34L 5JJIA 1WCMH 4CBVA 5JJZA 4XQJA 2EIFA 1MBYA 2J4XA 5IIFA 3A54A 1EY9A 3FRPB 5CV5A 2E5LQ 1K9MC 4IFDG 1VQFA 4K8IA 2ASBA 1AFPA 1YNNC 3BVMA 2EZVA 1I94Q 2K75A 5J39A 4ULLA 1DGSA 1WCMB 2LS01 3PV0A 5CC4A 1NTGA 2KVMA 3F8TA 1RKNA 2NTTA 4A3MG 1HZCA 2PW5A 3TS2A 4YIJA 3RZOH 4FF4A 3NBHB 3AYHB 4K0KQ 1SROA 1HUNA 5DEHA 1KRTA 1TWGB 5JPMC 3LNNA 2FHTA 4YHHL 1FGBD 2EYOA 1WTVA 1JMCA 1YJWA 1EFWA 3A0JA 4C3JG 1BUVT 4DPGA 1R4QB 3RZOB 1BNZA 2PMZE 4OIKA 4G7HC 1XX8A 3MC0B 3E6ZX 3G4SA 1U4LA 2EVBA 1VQCA 3OIQA 4XDXA 1XNQQ 3MFGA 2HCCA 2ZXPA 3NBIA 3VYRA 1SR3A 1PYWD 1IHZA 2RCNA 3X3NA 3K81C 2AMCB 4DA2A 5IWAL 2UXCQ 3WDNA 4A3FH 1M1KC 2F0DA 5ELCA 4HIDA 2KHIA 1HUMA 1IBML 1Y8PB 2BDOA 5ELBA 4DFAA 1VMCA 2F3VA 3A74A 2D0PA 3GTOH 4I7ZC 1YHQA 4A3FB 4JI4L 1PZKD 1UWVA 5C3EH 3A8KE 1PRTC 2GVAA 2JA5H 1L0XB 2SNSA 1UEAB 1PH6A 1X3PA 1EYGA 2BH2A 3GTOB 5FLMG 1X3GA 3I4NG 1ENFA 2FFKB 5C3EB 1SLJA 2DJGC 4JVZA 3SK5A 3L7ZC 2JA5B 4TVAB 3CC7A 3RZDH 1WVLA 4BA2I 1KAWA 1YI2A 1ESRA 2NZHA 3C3LA 1RF2D 4GLAC 4LF7L 2B2YA 2R3ZA 4JBWA 1PYBA 1EQRA 3Q8DA 4BY1G 1B7YB 5IYBG 1EY7A 1K0RA 1X3FA 1BDOA 4ZQ3A 1VS0A 4FXGC 1FR3A 1IZ6A 3RZDB 3K7AH 4DKAC 1CTMA 4RGTA 2ZM6L 2EPBA 4HTHA 2E5LL 1CA6A 2EY6A 1SNOA 4BS9A 3FHWA 4UAIA 3I3CA 3I4MG 2IJ0A 1SE3A 1SMXA 1VF7A 4GNXA 1OO9B 3KLWA 5BR8Q 4QGUA 1AZQA 3K7AB 1WFQA 1P8LA 3K57A 3BZCA 2B2YC 1Q7YC 4G7ZC 1HR0L 1YHAA 2JJQA 1KLUD 1PH2A 4Y52H 5IGCA 4XQQA 2QEJC 2RDFA 1NBWA 2FMCA 3MHBA 2TSSA 3NWTA 2DY8A 2MFIA 1CUKA 3L9AX 4DV3Q 2JQOA 4QIWB 1B50A 1V1PA 4GNXB 3FEWX 1PH8A 1TU2B 2B63G 4C3HH 1TS5A 1F9RA 4OWWB 2E8GA 4LF8Q 2OTLA 1MSHA 1RODA 5FOBB 4X62Q 1JC7A 3A8IE 4LF4Q 4N8FA 1LTID 3OW2A 4C3HB 1HQRD 4FVMA 5IOCA 4JI3Q 3NTIA 5IP9H 4A3BG 1LTSD 2A68D 3PF4A 1F2MA 1P16A 1HNXL 4LF5Q 4P75A 3S15H 3ERSX 3SXHA 2A8VA 4DK6C 1BCPB 2D5DA 2NTSA 2N49A 1EY8A 2XTIA 4BXXG 3HOYH 2A6EC 1Y1WG 1SNPA 5M5WH 2JA8G 1KAAA 1N9WA 5E1FA 3HOZH 3K5NA 4RCNA 2L9HA 3S15B 1EYAA 5EPLA 1H9RA 3HOYB 4IOCA 4FDBA 3SEBA 4QQBX 5M5WB 4DR6Q 2N8NA 4RG1A 1TWCB 4A75A 3OTOQ 3IFTA 3K8AA 5DAUA 1F9SA 2K14A 1R4PB 1AH9A 2NN6H 1W6JA 2Z6BA 3CP0A 2DGYA 3F2BA 5GAEC 2LSSA 3L3OC 2VQEL 4DR4L 1JE5A 4P71A 1NY4A 1XTDA 1X32A 3UI2A 2JP1A 3W2DA 4GN3B 4QCLA 3HS0C 5KGUA 1HH2P 2WAQB 4JI0L 3CW2C 1NMFA 1ILQA 3R93A 5C3WA 3G7LA 4OIJA 4A3MB 1IXRA 4JI2L 1X9NA 1VQNA 2VNUD 3HOVH 3E0EA 1RD9D 2RBMA 1BVSA 1J5EQ 5TSSA 1SYCA 4C56C 2ZXRA 2L55A 1BCPD 3VYTA 4HSVA 5EGTA 5GADC 1TS2A 2MGSA 4ZUIA 1NAPA 5BR8L 5D65A 1VQMA 1HJPA 4ZRZA 2RDHA 4A3DG 2D9UA 1VQAA 3GO5A 4XQNA 3M4QA 4TSSA 3HOVB 2DUDA 2PCFB 2PZUA 2I5LX 1H9JA 4KMUC 4L5QA 4U673 4B3RQ 1PTOF 1QNUA 4RHSA 4DAPA 3DWAA 3NK9A 4K6LA 2NZ1D 1V43A 3K5OA 1O7IA 1SBBB 1VQ4A 2DNEA 1VQGA 5M5XH 1E1TA 1T9HA 1PFMA 3CF5A 3O13A 1PV4A 4LF8L 1LUZA 3FPUB 2ZXOA 3SVMA 1ICWA 1YNJC 1JCKB 2KJXA 4ZCKA 4LF4L 2VQFQ 3OWFA 1AN8A 2XSCA 5M5XB 1TY2A 3TDQA 1SMYD 5FJ8H 4LFBQ 4JI3L 4NMZA 1KDBA 2NZOA 4PMBA 3EN2A 4AQYQ 1X65A 1DONA 3WOEA 2QW7A 2IL8A 4IURA 1SNQA 4CDEC 3CC4A 2K05A 4ID6A 3PO2H 3CCSA 5DLQE 3R3OA 5G3LF 2JA6G 1STGA 1OXSC 1SYBA 4DK3C 2F3IA 1K3RA 2EXZA 4DV6Q 2EE1A 2X6LA 3GV6A 1OXUA 2F3WA 1S40A 4EQ5A 2K5DA 1DOMA 1XYIA 3PO2B 3R8BA 5HY6A 3P7JA 2M2LA 5CV4A 2F0TA 3CRKC 1M4VA 2VW9A 4C3IG 1H9MA 3K6OA 2K5WA 3RNUA 1C7YA 3GDEA 1E0BA 4LFCL 1C0AA 2HUGA 3J80L 4OHJA 4DR6L 2N88A 2CW0C 5F2DA 3OTOL 5EKLA 2VS1A 2UUBQ 2H5XA 5FO7B 3GTJH 5C6AA 4GLXA 4KHPQ 2KHSA 1LTRD 3I73A 3I4MB 4HIKA 1D1KA 1QILA 4KKUA 3CMAA 4OELB 4IUNA 3K0YA 2E2IH 3CAMA 4OO1H 4E6IA 3AFQA 5ELEA 1J5EL 4IFDI 3TP5A 2BE5D 3G71A 5M3FH 1JICA 3KLSX 4JC0A 5BN3A 3C1FA 3GD7A
chains in the Genus database with same CATH topology
4C3JH 4BA1I 4A76A 1TXYA 4IPGA 4IPCA 2IHFA 4OXPA 3KJPA 5FJ8G 3ULLA 4ME3A 1BBUA 3I4OA 1QUQA 2CQOA 5H1SE 4YCWA 4DV5Q 3NENA 4JBKA 3S1QH 2WP8J 5IYDG 2UXDL 4DAYB 2KBNA 3I2ZA 4X64Q 1IYJB 1RL2A 4P72A 5C44H 4A3JH 4PG3A 4DV4L 4JCVE 3PO2G 3J7A5 4OO1I 1KRSA 2K5NA 4MNOA 2IY5B 4JI1Q 4TQUS 2NVTH 1KD1C 1Q82C 1QZGA 2VQEQ 4NXML 4DR4Q 3JAMc 4X6AH 4AH6A 1OXXK 3GTLH 4APVA 4JV5L 2KCTA 3J80i 5AJ3Q 1Q86C 1Y14B 1G6PA 5C0XI 3T1HQ 4UP9A 2VUMH 3S14H 4JI0Q 1QUQB 4IO9A 4L5RC 1KL9A 4LF7Q 1WI5A 2C35B 1TWFH 4JI2Q 3TREA 2NVQH 1SRUA 4DV3L 1HNZL 2ES2A 4JI6Q 1C9OA 2IX0A 1XMQL 1PH1A 1LYLA 1N34L 5JJIA 1WCMH 3TS0A 2EIFA 3ZJYC 3AQQA 5IYCG 1X3EA 4R4QA 3RN5A 1Y1VH 2LXJA 4X62L 2JK8A 3UDGA 2E5LQ 3B6YA 5LMUQ 2K4KA 2ZJPA 1PH4A 3HOUH 1K9MC 4IFDG 1VQFA 2PI2A 4XIGS 4X66L 2K5HA 4AQYL 4A3IG 2ASBA 1QZHA 1VQ5A 1HNWL 4BBSG 3I56A 1I94Q 1FVIA 2K75A 3MEFA 1VQHA 2B3GA 1DGSA 3M4OH 4JYAL 1XMOL 5FLMH 2PQAB 4JG2A 1W2BA 3PV0A 4LF9Q 3I4NH 2YYZA 3J80c 1NTGA 2R7ZG 3F8TA 1E3PA 1VQ6A 1UE7A 3KFUA 3G48A 4LF6Q 1UEBA 4A3MG 3PF5A 2GN5A 2JE6I 2QEXA 1NJIC 1HZCA 4LFAL 3TS2A 4LF5L 1PH3A 1I6HH 1PH9A 3TRZA 4DR3L 3RZOH 3S17H 4OO1G 4O2DA 3AFPA 3NBHB 5JEAJ 1IBKQ 3GTMH 4AYBG 1VQJA 4DR1L 3AYHB 4HJAA 4JI8Q 2R93H 4K0KQ 4BY1H 1Q8KA 1SROA 1A8VA 5IYBH 5ELNA 1KRTA 1X55A 4YHHL 2UU9Q 5LMNW 1FJGQ 3CCEA 4HJ9A 3GTQH 2WB1G 2AWNA 1JMCA 2R7DA 5M3FG 3M7NA 1OXTA 1Z47A 5C0XG 3HOXH 3A0JA 1YJWA 1GVPA 1EFWA 3GTGH 1PFSA 1XNRQ 4DPGA 3HOWH 2B29A 2D62A 4R4IA 4DV7Q 2OQKA 1JJ2A 3S2HH 4NB3A 1TWHH 4AYBE 3T1YL 1AE3A 3STBD 2UXBQ 2PMZE 1K73C 1NE3A 2A19A 2UUBL 3I4MH 1WJJA 2R7FA 3G4SA 4A3KH 2YTVA 1VQCA 4POFA 2FXQA 2YV5A 2WB1E 3CMEA 1YJNA 4B3SQ 5C44G 4A3JG 1XNQQ 4WJ3M 4EX5A 1SR3A 2N78A 2RCNA 4AIMA 3HKZG 3K81C 2AMCB 4JOIA 2MO0A 4RMFA 5IWAL 3S1NH 2UXCQ 2HIVA 3M9BA 2E2JH 3ULPA 4A3FH 3BJUA 4DNIA 1M1KC 3S1MH 4YCVA 4DUYQ 4HIDA 2KHIA 1EIFA 4IJLA 1IBML 2VUMG 5K36G 4MZ9A 1L1OA 1L0WA 3H0GH 2CCZA 1G291 1B8AA 4XTCS 4A3GH 4QL5A 3CPWA 3ULJA 3HKZE 5J3BA 3JAMi 4DV1Q 1A62A 1WCMG 2Q2UA 2B63H 2YTYA 1K8GA 3A74A 2D0PA 5GROA 3GTOH 1YHQA 5ELOA 4L5SA 2I5MX 4JI4L 1Q1BA 4GKJQ 1UWVA 4YWKA 3PO3H 1Y1VG 5C3EH 4HJ5A 1B70B 4QJFA 2GVAA 2YTXA 2JA5H 1VQKA 1SN8A 4LFCQ 3L2PA 3M85A 5EAYA 3HOUG 1VQLA 4A3CH 2JA9A 1Q46A 3TQYA 1PH6A 1L1OB 4X64L 1EYGA 1HZBA 2BH2A 5M3MH 4PZ7A 5FLMG 1X3GA 1JJCB 3I4NG 2JEBI 1QVGA 1JB7A 1JT8A 4DR2Q 1SLJA 4A3BH 4PZ8A 3L7ZC 2E2HH 4TVAB 2IX1A 4B3RL 3KYHC 3CC7A 4DV0Q 3RZDH 4GN5A 1KAWA 4BA2I 5IY0A 3I7FA 1YI2A 3J81j 1EOVA 1U0LA 3T1HL 2BA0A 2NZHA 2PI2E 4GLAC 4LF7L 4X65Q 4JBWA 1PYBA 1EQRA 4DUZL 4OX9Q 4JI6L 3Q8DA 4BY1G 3G6EA 1B7YB 2R93G 5IYBG 4BXXH 1EQQA 1K0RA 1Y1WH 2JA8H 1X3FA 1KQSA 2CWPA 2AKWB 4NPSA 3HOXG 1KC8C 1ASZA 1VS0A 3PUZA 4KLKA 1IZ6A 4J15A 3K7AH 3HOWG 1KHIA 4DKAC 2ZM6L 3U58A 2F4VQ 5IP7H 1GD7A 2PQAA 2E5LL 2JA7H 5LMUL 3RLFA 3FHWA 5IP9G 4Y7NH 2RHQB 2VQFL 1D7QA 3I4MG 4A3KG 2K5VA 4P74A 1V9PA 1S72A 2UXDQ 1SMXA 4IFDJ 2HHHQ 4GNXA 1XPRA 5BR8Q 3KLWA 4DV2Q 4DR5L 3RN2A 4LFBL 4QGUA 2A1AA 1BBWA 2HQLA 1WFQA 2Q2IA 1P8LA 4IOAA 4P73A 3BZCA 4LF6L 3E9IA 1X6OA 2ID0A 4GKKQ 4A3FG 4YY3Q 1Q7YC 1EIYB 5LMNQ 1HR0L 1YHAA 1IBLQ 1OTCA 2JJQA 1CSPA 1X56A 2BA1A 3F2DA 1PH2A 4HJ8A 1PHJA 1TWGH 3ICEA 4Y52H 3CD6A 1I3QH 3KDFA 3H0GG 1FGUA 1G51A 1NBWA 4LUZA 2CWAA 4KHZA 4JI8L 4B3TQ 1I50H 1CUKA 2MFIA 4DV3Q 3HOZG 2JQOA 4A3GG 4YWLA 1FJGL 4GNXB 4DV6L 2B63G 1PH8A 3EBEA 4PMWA 1YIJA 2UUAQ 1N34Q 1N32L 4C3HH 4JI5Q 3AEVA 4NXNL 4JI7Q 2E8GA 2MO1A 4OWWB 1KIXA 5C3EG 2KHJA 4LF8Q 3PO3G 2OTLA 1CKMA 4MTNA 1A0IA 4IJHA 2JA5G 1H95A 4X62Q 3CCVA 3M4PA 5C0XJ 1N8RC 4A3CG 3BZKA 4LF4Q 4C2MH 4B3ML 3KDFB 1HNWQ 1W3SA 4IPDA 1S3OA 3OW2A 1VQIA 4B3SL 3D31A 5M3MG 1VCIA 1CSQA 3PUYA 2OWOA 4JYAQ 2ATWA 4JI3Q 3PIPA 1X54A 1XMOQ 4A3DH 3SGIA 5IP9H 3CXCA 4OWTB 4A3BG 3CPFA 3PF4A 3M3YH 3EIVA 3LGJA 1YVCA 3FKIH 4KHPL 1SE8A 4DUYL 1P16A 4GOPA 1HNXL 1VQ7A 1VQDA 4LF5Q 4P75A 3S15H 3ERSX 3MXNB 4DR3Q 2A8VA 4DK6C 1YJ9A 2OCEA 5IE8A 2UUCQ 2OTJA 2N49A 2Q2TA 4DR1Q 3K80C 2XTIA 1VQOA 3HOYH 4BXXG 5M5YH 4DV1L 2AWOA 4BY7H 5JJLA 4YHHQ 1VQBA 1Y1WG 5M5WH 2JA8G 4GS3A 4A93H 1VQEA 4POGA 3A5ZB 1M90C 4GKJL 1LM0A 1N9WA 3UDIA 5HGQA 1D8LA 3UE1A 3HOZH 1PYSB 5IP7G 1YBYA 1ASYA 2JA7G 1J6QA 3UDFA 4GOPB 1VQ9A 3T1YQ 3PGZA 4GLVB 4R4OA 1GM5A 2OQ0A 1N33Q 2HIXA 1JJGA 4YCUA 3RLOA 1TWAH 4IOCA 4FDBA 4DR7Q 1E7ZA 4QQBX 3OYYA 4A3LH 1A63A 1K8AC 1QVCA 3JC66 2CKZB 3RR5A 4BBRH 3KJOA 4UY8C 3U4ZA 4DR6Q 2N8NA 2MNAA 4RG1A 4DV5L 4GOPC 4A75A 3OTOQ 3CCQA 4DR2L 1L2FA 3K8AA 1N36Q 2ALYB 4JOIC 5IWAQ 3S16H 2K14A 3CCJA 1V1QA 1AH9A 3K0XA 4ALPA 4R1JA 4HIOA 4A3EH 3CP0A 4O0AA 2DGYA 3IRBA 3F2BA 2RHSB 3NEMA 5GAGC 2WFWA 4JI1L 3I55A 5GAEC 2LSSA 2R92H 2VQEL 4DR4L 3PUXA 1JE5A 1XJVA 4P71A 1L1OC 1NY4A 1XTDA 2JA6H 4R4CA 3GTPH 4OX9L 2CFMA 4QIWE 3K7UC 5AJ3L 2ZTCA 4GN3B 1PA6A 3W5OA 1UE5A 4OWXB 1HH2P 1R9TH 3H15A 4JI0L 3CW2C 1NMFA 1EUJA 1I5FA 3CQZH 1IXRA 4JI2L 2QGQA 1X9NA 1VQNA 2VNUD 5E7NA 2F4VL 3HOVH 3E0EA 1J5EQ 1BVSA 2XGTA 1HZAA 4C3IH 1CKOA 3WWVA 3GTKH 2NN6I 1BKBA 4HIMA 1XPOA 3KF8B 1CKNA 1Q1EA 2VY3A 5GADC 2HHHL 1GO3E 5BR8L 4DV2L 4UPAA 4JI4Q 1VQMA 1HJPA 3CCRA 1SFOH 3KF6A 3J7ZC 1PVOA 4A3DG 1VQAA 3GO5A 3STBC 3M4QA 2DUDA 1I94L 2IT1A 4GKKL 5FLXc 1NMGA 2ZTDA 2I5LX 3FKIG 3J81i 4YY3L 4HJ7A 1YEZA 1IL2A 3S2DH 4L5QA 4B3RQ 3UDXA 5LMNL 1IBLL 4DAMA 4DV4Q 4LF9L 2F52A 2LXKA 3PCOB 4NXMQ 4KI0A 1V43A 2Y0SG 2ZTEA 1E22A 4B3TL 2VZAA 3W1BA 2QA4A 1CKNB 4DUZQ 3HOYG 1Z9FA 1O7IA 3HKSA 1VQPA 4BY7G 4JV5Q 1VQ4A 4A93G 2UUAL 1VQGA 3PUWA 5M5XH 3KF6B 1E1TA 4JI5L 1IBKL 1T9HA 5GAHC 4JI7L 3E9HA 3CF5A 1PV4A 4LF8L 2RF4A 5C4XH 4K0KL 1LUZA 1HNZQ 2ZM6Q 1XMQQ 1MIUA 2UU9L 2VL6A 4UP8A 2NVXH 1K83H 2I5HA 2Y0SE 1GKHA 1EWIA 4LF4L 4LUVA 2VQFQ 2R6GA 1XNRL 4GN4B 3H3VH 4A3LG 1HZ9A 1AE2A 4DV7L 2EQSA 4BBRG 1OXVA 5FJ8H 4LFBQ 4JI3L 3CCUA 4GNXC 4DR5Q 1VQ8A 2UXBL 4QY7A 3U50C 2NZOA 3J81c 1Q81C 3EN2A 1UE1A 4X66Q 5C4JH 3CCMA 4AQYQ 1X65A 2WAQG 4L5TA 3PUVA 2MQHA 1YITA 3F2CA 2NN6G 3CC4A 5IYDH 1XNQL 4A3EG 4YWMA 3PO2H 2PNHA 1HR0Q 1KXLA 2BH8A 2R92G 3CCSA 5DLQE 2UUCL 5GQOA 2UXCL 2JA6G 2JEAI 1Q12A 1OXSC 4R4TA 5JEAG 2Z6KA 3VDYA 4DK3C 4LW1A 2F3IA 4LFAQ 1K3RA 2WAQE 4WJ4A 1QVFA 4DV6Q 4IPHA 3PIOA 3A5UA 3CC2A 1OXUA 1N32Q 3W1GA 3H3VI 1S40A 1RIPA 4EQ5A 1PH7A 4NXNQ 5HY6A 3HOVG 4PZ6A 3U4VA 2VW9A 2KENA 1HR0W 2V1CC 3HFZB 1U5KA 1N33L 2Q2HA 1TWCH 3TEHB 3RNUA 4B3MQ 1C7YA 2L15A 4DR7L 3GDEA 5IYCH 3F1ZA 3UE0A 4JBJA 1MJEA 1MJCA 2GVBA 3KOJA 4OONA 4LFCL 1C0AA 1YHBA 3ER0A 5IT9c 2D0OA 4DR6L 3NELA 2AHOB 1WOCA 3OTOL 4A4IA 1N36L 2K50A 4A3IH 2ZJQA 5JJKA 1MKHA 2VS1A 2H5XA 2I0QA 2UUBQ 4BBSH 3GTJH 4GLXA 2KCMA 3DM3A 4KHPQ 2Z6KC 1WYDA 1UE6A 2Z0SA 1HNXQ 4UP7A 2HT1A 4HIKA 2K52A 2N3SA 1E1OA 3PSIA 2R7ZH 3DLLA 3D0FA 3CMAA 2EXDA 4A3MH 2NVYH 4DV0L 4LNQA 3S24A 1LTLA 1XPUA 2E2IH 3CAMA 3L0OA 1IBMQ 2YU9H 4H02A 4LWCA 4X65L 3CCLA 3FP9A 5C4XG 3AFQA 1FL0A 1YZ6A 1J5EL 4LUOA 3S1RH 4IFDI 1YNXA 3G71A 2IHEA 3RLNA 4JBMA 2ZJRA 3BU2A 5M3FH 4JC0A 1PH5A 1E24A 3GD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3J H;  4BA1 I;  4A76 A;  1TXY A;  4IPG A;  4IPC A;  2IHF A;  4OXP A;  3KJP A;  5FJ8 G;  3ULL A;  4ME3 A;  1BBU A;  3I4O A;  1QUQ A;  2CQO A;  5H1S E;  4YCW A;  4DV5 Q;  3NEN A;  4JBK A;  3S1Q H;  2WP8 J;  5IYD G;  2UXD L;  4DAY B;  2KBN A;  3I2Z A;  4X64 Q;  1IYJ B;  1RL2 A;  4P72 A;  5C44 H;  4A3J H;  4PG3 A;  4DV4 L;  4JCV E;  3PO2 G;  3J7A 5;  4OO1 I;  1KRS A;  2K5N A;  4MNO A;  2IY5 B;  4JI1 Q;  4TQU S;  2NVT H;  1KD1 C;  1Q82 C;  1QZG A;  2VQE Q;  4NXM L;  4DR4 Q;  3JAM c;  4X6A H;  4AH6 A;  1OXX K;  3GTL H;  4APV A;  4JV5 L;  2KCT A;  3J80 i;  5AJ3 Q;  1Q86 C;  1Y14 B;  1G6P A;  5C0X I;  3T1H Q;  4UP9 A;  2VUM H;  3S14 H;  4JI0 Q;  1QUQ B;  4IO9 A;  4L5R C;  1KL9 A;  4LF7 Q;  1WI5 A;  2C35 B;  1TWF H;  4JI2 Q;  3TRE A;  2NVQ H;  1SRU A;  4DV3 L;  1HNZ L;  2ES2 A;  4JI6 Q;  1C9O A;  2IX0 A;  1XMQ L;  1PH1 A;  1LYL A;  1N34 L;  5JJI A;  1WCM H;  3TS0 A;  2EIF A;  3ZJY C;  3AQQ A;  5IYC G;  1X3E A;  4R4Q A;  3RN5 A;  1Y1V H;  2LXJ A;  4X62 L;  2JK8 A;  3UDG A;  2E5L Q;  3B6Y A;  5LMU Q;  2K4K A;  2ZJP A;  1PH4 A;  3HOU H;  1K9M C;  4IFD G;  1VQF A;  2PI2 A;  4XIG S;  4X66 L;  2K5H A;  4AQY L;  4A3I G;  2ASB A;  1QZH A;  1VQ5 A;  1HNW L;  4BBS G;  3I56 A;  1I94 Q;  1FVI A;  2K75 A;  3MEF A;  1VQH A;  2B3G A;  1DGS A;  3M4O H;  4JYA L;  1XMO L;  5FLM H;  2PQA B;  4JG2 A;  1W2B A;  3PV0 A;  4LF9 Q;  3I4N H;  2YYZ A;  3J80 c;  1NTG A;  2R7Z G;  3F8T A;  1E3P A;  1VQ6 A;  1UE7 A;  3KFU A;  3G48 A;  4LF6 Q;  1UEB A;  4A3M G;  3PF5 A;  2GN5 A;  2JE6 I;  2QEX A;  1NJI C;  1HZC A;  4LFA L;  3TS2 A;  4LF5 L;  1PH3 A;  1I6H H;  1PH9 A;  3TRZ A;  4DR3 L;  3RZO H;  3S17 H;  4OO1 G;  4O2D A;  3AFP A;  3NBH B;  5JEA J;  1IBK Q;  3GTM H;  4AYB G;  1VQJ A;  4DR1 L;  3AYH B;  4HJA A;  4JI8 Q;  2R93 H;  4K0K Q;  4BY1 H;  1Q8K A;  1SRO A;  1A8V A;  5IYB H;  5ELN A;  1KRT A;  1X55 A;  4YHH L;  2UU9 Q;  5LMN W;  1FJG Q;  3CCE A;  4HJ9 A;  3GTQ H;  2WB1 G;  2AWN A;  1JMC A;  2R7D A;  5M3F G;  3M7N A;  1OXT A;  1Z47 A;  5C0X G;  3HOX H;  3A0J A;  1YJW A;  1GVP A;  1EFW A;  3GTG H;  1PFS A;  1XNR Q;  4DPG A;  3HOW H;  2B29 A;  2D62 A;  4R4I A;  4DV7 Q;  2OQK A;  1JJ2 A;  3S2H H;  4NB3 A;  1TWH H;  4AYB E;  3T1Y L;  1AE3 A;  3STB D;  2UXB Q;  2PMZ E;  1K73 C;  1NE3 A;  2A19 A;  2UUB L;  3I4M H;  1WJJ A;  2R7F A;  3G4S A;  4A3K H;  2YTV A;  1VQC A;  4POF A;  2FXQ A;  2YV5 A;  2WB1 E;  3CME A;  1YJN A;  4B3S Q;  5C44 G;  4A3J G;  1XNQ Q;  4WJ3 M;  4EX5 A;  1SR3 A;  2N78 A;  2RCN A;  4AIM A;  3HKZ G;  3K81 C;  2AMC B;  4JOI A;  2MO0 A;  4RMF A;  5IWA L;  3S1N H;  2UXC Q;  2HIV A;  3M9B A;  2E2J H;  3ULP A;  4A3F H;  3BJU A;  4DNI A;  1M1K C;  3S1M H;  4YCV A;  4DUY Q;  4HID A;  2KHI A;  1EIF A;  4IJL A;  1IBM L;  2VUM G;  5K36 G;  4MZ9 A;  1L1O A;  1L0W A;  3H0G H;  2CCZ A;  1G29 1;  1B8A A;  4XTC S;  4A3G H;  4QL5 A;  3CPW A;  3ULJ A;  3HKZ E;  5J3B A;  3JAM i;  4DV1 Q;  1A62 A;  1WCM G;  2Q2U A;  2B63 H;  2YTY A;  1K8G A;  3A74 A;  2D0P A;  5GRO A;  3GTO H;  1YHQ A;  5ELO A;  4L5S A;  2I5M X;  4JI4 L;  1Q1B A;  4GKJ Q;  1UWV A;  4YWK A;  3PO3 H;  1Y1V G;  5C3E H;  4HJ5 A;  1B70 B;  4QJF A;  2GVA A;  2YTX A;  2JA5 H;  1VQK A;  1SN8 A;  4LFC Q;  3L2P A;  3M85 A;  5EAY A;  3HOU G;  1VQL A;  4A3C H;  2JA9 A;  1Q46 A;  3TQY A;  1PH6 A;  1L1O B;  4X64 L;  1EYG A;  1HZB A;  2BH2 A;  5M3M H;  4PZ7 A;  5FLM G;  1X3G A;  1JJC B;  3I4N G;  2JEB I;  1QVG A;  1JB7 A;  1JT8 A;  4DR2 Q;  1SLJ A;  4A3B H;  4PZ8 A;  3L7Z C;  2E2H H;  4TVA B;  2IX1 A;  4B3R L;  3KYH C;  3CC7 A;  4DV0 Q;  3RZD H;  4GN5 A;  1KAW A;  4BA2 I;  5IY0 A;  3I7F A;  1YI2 A;  3J81 j;  1EOV A;  1U0L A;  3T1H L;  2BA0 A;  2NZH A;  2PI2 E;  4GLA C;  4LF7 L;  4X65 Q;  4JBW A;  1PYB A;  1EQR A;  4DUZ L;  4OX9 Q;  4JI6 L;  3Q8D A;  4BY1 G;  3G6E A;  1B7Y B;  2R93 G;  5IYB G;  4BXX H;  1EQQ A;  1K0R A;  1Y1W H;  2JA8 H;  1X3F A;  1KQS A;  2CWP A;  2AKW B;  4NPS A;  3HOX G;  1KC8 C;  1ASZ A;  1VS0 A;  3PUZ A;  4KLK A;  1IZ6 A;  4J15 A;  3K7A H;  3HOW G;  1KHI A;  4DKA C;  2ZM6 L;  3U58 A;  2F4V Q;  5IP7 H;  1GD7 A;  2PQA A;  2E5L L;  2JA7 H;  5LMU L;  3RLF A;  3FHW A;  5IP9 G;  4Y7N H;  2RHQ B;  2VQF L;  1D7Q A;  3I4M G;  4A3K G;  2K5V A;  4P74 A;  1V9P A;  1S72 A;  2UXD Q;  1SMX A;  4IFD J;  2HHH Q;  4GNX A;  1XPR A;  5BR8 Q;  3KLW A;  4DV2 Q;  4DR5 L;  3RN2 A;  4LFB L;  4QGU A;  2A1A A;  1BBW A;  2HQL A;  1WFQ A;  2Q2I A;  1P8L A;  4IOA A;  4P73 A;  3BZC A;  4LF6 L;  3E9I A;  1X6O A;  2ID0 A;  4GKK Q;  4A3F G;  4YY3 Q;  1Q7Y C;  1EIY B;  5LMN Q;  1HR0 L;  1YHA A;  1IBL Q;  1OTC A;  2JJQ A;  1CSP A;  1X56 A;  2BA1 A;  3F2D A;  1PH2 A;  4HJ8 A;  1PHJ A;  1TWG H;  3ICE A;  4Y52 H;  3CD6 A;  1I3Q H;  3KDF A;  3H0G G;  1FGU A;  1G51 A;  1NBW A;  4LUZ A;  2CWA A;  4KHZ A;  4JI8 L;  4B3T Q;  1I50 H;  1CUK A;  2MFI A;  4DV3 Q;  3HOZ G;  2JQO A;  4A3G G;  4YWL A;  1FJG L;  4GNX B;  4DV6 L;  2B63 G;  1PH8 A;  3EBE A;  4PMW A;  1YIJ A;  2UUA Q;  1N34 Q;  1N32 L;  4C3H H;  4JI5 Q;  3AEV A;  4NXN L;  4JI7 Q;  2E8G A;  2MO1 A;  4OWW B;  1KIX A;  5C3E G;  2KHJ A;  4LF8 Q;  3PO3 G;  2OTL A;  1CKM A;  4MTN A;  1A0I A;  4IJH A;  2JA5 G;  1H95 A;  4X62 Q;  3CCV A;  3M4P A;  5C0X J;  1N8R C;  4A3C G;  3BZK A;  4LF4 Q;  4C2M H;  4B3M L;  3KDF B;  1HNW Q;  1W3S A;  4IPD A;  1S3O A;  3OW2 A;  1VQI A;  4B3S L;  3D31 A;  5M3M G;  1VCI A;  1CSQ A;  3PUY A;  2OWO A;  4JYA Q;  2ATW A;  4JI3 Q;  3PIP A;  1X54 A;  1XMO Q;  4A3D H;  3SGI A;  5IP9 H;  3CXC A;  4OWT B;  4A3B G;  3CPF A;  3PF4 A;  3M3Y H;  3EIV A;  3LGJ A;  1YVC A;  3FKI H;  4KHP L;  1SE8 A;  4DUY L;  1P16 A;  4GOP A;  1HNX L;  1VQ7 A;  1VQD A;  4LF5 Q;  4P75 A;  3S15 H;  3ERS X;  3MXN B;  4DR3 Q;  2A8V A;  4DK6 C;  1YJ9 A;  2OCE A;  5IE8 A;  2UUC Q;  2OTJ A;  2N49 A;  2Q2T A;  4DR1 Q;  3K80 C;  2XTI A;  1VQO A;  3HOY H;  4BXX G;  5M5Y H;  4DV1 L;  2AWO A;  4BY7 H;  5JJL A;  4YHH Q;  1VQB A;  1Y1W G;  5M5W H;  2JA8 G;  4GS3 A;  4A93 H;  1VQE A;  4POG A;  3A5Z B;  1M90 C;  4GKJ L;  1LM0 A;  1N9W A;  3UDI A;  5HGQ A;  1D8L A;  3UE1 A;  3HOZ H;  1PYS B;  5IP7 G;  1YBY A;  1ASY A;  2JA7 G;  1J6Q A;  3UDF A;  4GOP B;  1VQ9 A;  3T1Y Q;  3PGZ A;  4GLV B;  4R4O A;  1GM5 A;  2OQ0 A;  1N33 Q;  2HIX A;  1JJG A;  4YCU A;  3RLO A;  1TWA H;  4IOC A;  4FDB A;  4DR7 Q;  1E7Z A;  4QQB X;  3OYY A;  4A3L H;  1A63 A;  1K8A C;  1QVC A;  3JC6 6;  2CKZ B;  3RR5 A;  4BBR H;  3KJO A;  4UY8 C;  3U4Z A;  4DR6 Q;  2N8N A;  2MNA A;  4RG1 A;  4DV5 L;  4GOP C;  4A75 A;  3OTO Q;  3CCQ A;  4DR2 L;  1L2F A;  3K8A A;  1N36 Q;  2ALY B;  4JOI C;  5IWA Q;  3S16 H;  2K14 A;  3CCJ A;  1V1Q A;  1AH9 A;  3K0X A;  4ALP A;  4R1J A;  4HIO A;  4A3E H;  3CP0 A;  4O0A A;  2DGY A;  3IRB A;  3F2B A;  2RHS B;  3NEM A;  5GAG C;  2WFW A;  4JI1 L;  3I55 A;  5GAE C;  2LSS A;  2R92 H;  2VQE L;  4DR4 L;  3PUX A;  1JE5 A;  1XJV A;  4P71 A;  1L1O C;  1NY4 A;  1XTD A;  2JA6 H;  4R4C A;  3GTP H;  4OX9 L;  2CFM A;  4QIW E;  3K7U C;  5AJ3 L;  2ZTC A;  4GN3 B;  1PA6 A;  3W5O A;  1UE5 A;  4OWX B;  1HH2 P;  1R9T H;  3H15 A;  4JI0 L;  3CW2 C;  1NMF A;  1EUJ A;  1I5F A;  3CQZ H;  1IXR A;  4JI2 L;  2QGQ A;  1X9N A;  1VQN A;  2VNU D;  5E7N A;  2F4V L;  3HOV H;  3E0E A;  1J5E Q;  1BVS A;  2XGT A;  1HZA A;  4C3I H;  1CKO A;  3WWV A;  3GTK H;  2NN6 I;  1BKB A;  4HIM A;  1XPO A;  3KF8 B;  1CKN A;  1Q1E A;  2VY3 A;  5GAD C;  2HHH L;  1GO3 E;  5BR8 L;  4DV2 L;  4UPA A;  4JI4 Q;  1VQM A;  1HJP A;  3CCR A;  1SFO H;  3KF6 A;  3J7Z C;  1PVO A;  4A3D G;  1VQA A;  3GO5 A;  3STB C;  3M4Q A;  2DUD A;  1I94 L;  2IT1 A;  4GKK L;  5FLX c;  1NMG A;  2ZTD A;  2I5L X;  3FKI G;  3J81 i;  4YY3 L;  4HJ7 A;  1YEZ A;  1IL2 A;  3S2D H;  4L5Q A;  4B3R Q;  3UDX A;  5LMN L;  1IBL L;  4DAM A;  4DV4 Q;  4LF9 L;  2F52 A;  2LXK A;  3PCO B;  4NXM Q;  4KI0 A;  1V43 A;  2Y0S G;  2ZTE A;  1E22 A;  4B3T L;  2VZA A;  3W1B A;  2QA4 A;  1CKN B;  4DUZ Q;  3HOY G;  1Z9F A;  1O7I A;  3HKS A;  1VQP A;  4BY7 G;  4JV5 Q;  1VQ4 A;  4A93 G;  2UUA L;  1VQG A;  3PUW A;  5M5X H;  3KF6 B;  1E1T A;  4JI5 L;  1IBK L;  1T9H A;  5GAH C;  4JI7 L;  3E9H A;  3CF5 A;  1PV4 A;  4LF8 L;  2RF4 A;  5C4X H;  4K0K L;  1LUZ A;  1HNZ Q;  2ZM6 Q;  1XMQ Q;  1MIU A;  2UU9 L;  2VL6 A;  4UP8 A;  2NVX H;  1K83 H;  2I5H A;  2Y0S E;  1GKH A;  1EWI A;  4LF4 L;  4LUV A;  2VQF Q;  2R6G A;  1XNR L;  4GN4 B;  3H3V H;  4A3L G;  1HZ9 A;  1AE2 A;  4DV7 L;  2EQS A;  4BBR G;  1OXV A;  5FJ8 H;  4LFB Q;  4JI3 L;  3CCU A;  4GNX C;  4DR5 Q;  1VQ8 A;  2UXB L;  4QY7 A;  3U50 C;  2NZO A;  3J81 c;  1Q81 C;  3EN2 A;  1UE1 A;  4X66 Q;  5C4J H;  3CCM A;  4AQY Q;  1X65 A;  2WAQ G;  4L5T A;  3PUV A;  2MQH A;  1YIT A;  3F2C A;  2NN6 G;  3CC4 A;  5IYD H;  1XNQ L;  4A3E G;  4YWM A;  3PO2 H;  2PNH A;  1HR0 Q;  1KXL A;  2BH8 A;  2R92 G;  3CCS A;  5DLQ E;  2UUC L;  5GQO A;  2UXC L;  2JA6 G;  2JEA I;  1Q12 A;  1OXS C;  4R4T A;  5JEA G;  2Z6K A;  3VDY A;  4DK3 C;  4LW1 A;  2F3I A;  4LFA Q;  1K3R A;  2WAQ E;  4WJ4 A;  1QVF A;  4DV6 Q;  4IPH A;  3PIO A;  3A5U A;  3CC2 A;  1OXU A;  1N32 Q;  3W1G A;  3H3V I;  1S40 A;  1RIP A;  4EQ5 A;  1PH7 A;  4NXN Q;  5HY6 A;  3HOV G;  4PZ6 A;  3U4V A;  2VW9 A;  2KEN A;  1HR0 W;  2V1C C;  3HFZ B;  1U5K A;  1N33 L;  2Q2H A;  1TWC H;  3TEH B;  3RNU A;  4B3M Q;  1C7Y A;  2L15 A;  4DR7 L;  3GDE A;  5IYC H;  3F1Z A;  3UE0 A;  4JBJ A;  1MJE A;  1MJC A;  2GVB A;  3KOJ A;  4OON A;  4LFC L;  1C0A A;  1YHB A;  3ER0 A;  5IT9 c;  2D0O A;  4DR6 L;  3NEL A;  2AHO B;  1WOC A;  3OTO L;  4A4I A;  1N36 L;  2K50 A;  4A3I H;  2ZJQ A;  5JJK A;  1MKH A;  2VS1 A;  2H5X A;  2I0Q A;  2UUB Q;  4BBS H;  3GTJ H;  4GLX A;  2KCM A;  3DM3 A;  4KHP Q;  2Z6K C;  1WYD A;  1UE6 A;  2Z0S A;  1HNX Q;  4UP7 A;  2HT1 A;  4HIK A;  2K52 A;  2N3S A;  1E1O A;  3PSI A;  2R7Z H;  3DLL A;  3D0F A;  3CMA A;  2EXD A;  4A3M H;  2NVY H;  4DV0 L;  4LNQ A;  3S24 A;  1LTL A;  1XPU A;  2E2I H;  3CAM A;  3L0O A;  1IBM Q;  2YU9 H;  4H02 A;  4LWC A;  4X65 L;  3CCL A;  3FP9 A;  5C4X G;  3AFQ A;  1FL0 A;  1YZ6 A;  1J5E L;  4LUO A;  3S1R H;  4IFD I;  1YNX A;  3G71 A;  2IHE A;  3RLN A;  4JBM A;  2ZJR A;  3BU2 A;  5M3F H;  4JC0 A;  1PH5 A;  1E24 A;  3GD7 A; 
#chains in the Genus database with same CATH topology
 1IW7 C;  1TXY A;  4IPG A;  4IPC A;  2PZT A;  2E2I B;  1EZ6 A;  3NWS A;  1HHV A;  4QMG A;  4JBK A;  2CQO A;  2KCC A;  3QR8 A;  4DV5 Q;  1HFN A;  4KKT A;  2WP8 J;  1I4P A;  2KBN A;  1CK1 A;  2B8G A;  3MEH A;  1ESF A;  2WB1 B;  4PG3 A;  5M3F B;  4JI1 Q;  1MI2 A;  1ZYR C;  4N9P A;  2EYP A;  4KTA A;  1EYC A;  3BYY B;  4UP9 A;  2NYZ D;  3S14 H;  5K36 H;  4K6D A;  1QE6 A;  1TWF H;  3TRE A;  5D3D A;  3Q0A A;  2NVQ H;  2ES2 A;  4CJ2 C;  1LYL A;  1XXG A;  1LV9 A;  4HAE A;  1ZXT A;  1WTH A;  3NTH A;  4NKL A;  2MJ8 A;  1ML0 D;  2XRQ D;  1Y1V H;  5BN4 A;  3UDG A;  3TME A;  5LMU Q;  5COY A;  1TWF B;  4AQY L;  2NVQ B;  2KED A;  4BBS G;  1GUW A;  1FVI A;  1I4G A;  4JYA L;  1XMO L;  1W2B A;  4BWG B;  1O80 A;  1Y1V B;  3KFU A;  1E3P A;  3SDZ A;  1UE7 A;  4HSP A;  1C48 A;  3G48 A;  5IGD A;  4LF6 Q;  4CDF C;  2GN5 A;  1KLG D;  4B9W A;  1CI3 M;  1PH9 A;  5KIX A;  4DR3 L;  3AFP A;  1UAP A;  1BOS A;  3JAM E;  1IBK Q;  4AYB G;  4PNY A;  5I9O A;  4DR1 L;  4B9X A;  4HJA A;  2R93 H;  2B39 A;  2A5H A;  3RD4 A;  5LMN W;  1FJG Q;  3CCE A;  2R7D A;  2XWJ B;  4DXF A;  3M7N A;  3FPP A;  5C0X G;  1SXT A;  3IAY A;  1EY0 A;  3GTG H;  1PFS A;  3VA5 A;  2D62 A;  4R4I A;  4DV7 Q;  2OQK A;  1JJ2 A;  3S9W A;  1TWH H;  4AYB E;  3T1Y L;  1AE3 A;  2K04 A;  1A6X A;  1LT3 D;  1NE3 A;  2R93 B;  2UUB L;  2F0L A;  4A3K H;  1E2W A;  2YTV A;  3CME A;  2N55 A;  1YJN A;  5C44 G;  4A3J G;  4WJ3 M;  3GTG B;  5CMD A;  2AUK A;  2N78 A;  2E2D C;  3HKZ G;  4RMF A;  4QUF A;  1WTR A;  5CV7 A;  1TWH B;  1U4R A;  4KD3 A;  4DNI A;  2A6H C;  2NB0 A;  3ERO A;  2A74 C;  4IJL A;  5IGG A;  4A3K B;  2VUM G;  2K28 A;  3DWP A;  3H0G H;  4XTC S;  1U4P A;  4A3G H;  4QL5 A;  3CPW A;  1PFN A;  5C4Z A;  3HKZ E;  1A62 A;  4RGN A;  3NHH A;  1LAB A;  4L5S A;  2K5Q A;  3PO3 H;  1B70 B;  5CGK A;  4QJF A;  2CVR A;  2FJ2 A;  1VQK A;  4XXE A;  3L2P A;  5BN5 A;  3HOU G;  4GZY C;  3H0G B;  1VQL A;  2JA9 A;  1MHW C;  1Q46 A;  1TKW B;  3H91 A;  4A3G B;  5KRU A;  5HUR A;  4PV1 C;  4PZ7 A;  1S5F D;  1JJC B;  2LY7 A;  2VB2 X;  1QVG A;  2LFN A;  4EQO A;  3PO3 B;  1H9K A;  4CJ0 B;  4X3K A;  2E2H H;  2IX1 A;  2XVS A;  3KYH C;  2B2V A;  3NTK A;  4DV0 Q;  3I7F A;  2PI2 E;  5A2Q L;  2AQ2 B;  5DM7 3;  4L6T B;  1WD0 A;  1I4R A;  4HR7 B;  3OMC A;  4DUZ L;  3ND8 A;  2XNA C;  3Q23 A;  1EQQ A;  2F0V A;  1FNU A;  4IUQ A;  1RHP A;  2E2H B;  3BS1 A;  3HOX G;  1KC8 C;  1ASZ A;  2F4I A;  1LTB D;  4KLK A;  1O7Z A;  3BZD B;  3HOW G;  1CZG A;  2DN8 A;  4V0B A;  3U58 A;  5IP7 H;  1GD7 A;  3I4L A;  4FF2 A;  3QG1 A;  2JA7 H;  5LMU L;  3NUC A;  5KEE A;  5IP9 G;  1MGS A;  1TS3 A;  5K5P A;  1D7Q A;  3QB3 A;  2UXD Q;  3FMC A;  2HQE A;  2LKV A;  3RN2 A;  3NBH A;  1G2S A;  2HQL A;  4DGZ A;  2Q2I A;  1NSN S;  3ERQ A;  4CJ1 B;  4P73 A;  4IOA A;  4LF6 L;  3E9I A;  2JA7 B;  4YY3 Q;  5T1I A;  4FF1 A;  2EJM A;  1IBL Q;  1B4O A;  1EQV A;  2BA1 A;  5J22 A;  1Y8O B;  1TWG H;  3CD6 A;  3KDF A;  3HOZ G;  4KHZ A;  4B3T Q;  1I50 H;  4DF7 A;  1JOK A;  2OF1 A;  5CV6 A;  1FJG L;  3EBE A;  1VF5 C;  4K14 A;  3T16 A;  3AEV A;  1HA6 A;  4PQX A;  4NXN L;  1CKM A;  1KAB A;  1A0I A;  2QDL A;  4IJH A;  1K8M A;  5ELD A;  2NUC A;  4A3C G;  5FLX L;  1K8O A;  2PW7 A;  4C2M H;  4B3M L;  2SDF A;  1I50 B;  3KDF B;  1HNW Q;  1PTO B;  1S3O A;  3D8G A;  5LL6 S;  3GQB A;  5M3M G;  2NVX B;  1VCI A;  1EY6 A;  4DU9 A;  3CXC A;  1A3U A;  2JN4 A;  1EEF D;  2K6A A;  3EIV A;  3M3Y H;  1SE4 A;  1ILP A;  2OEO A;  2TMP A;  1CT1 D;  1SE8 A;  4C2M B;  3NXW A;  1LT5 D;  2EY2 A;  2OCE A;  1SYF A;  5IE8 A;  2OTJ A;  3V05 A;  1LT6 D;  3K80 C;  1EWC A;  2AWO A;  1VDZ A;  2JYO A;  5D14 A;  4A93 H;  4GS3 A;  3M3Y B;  4K5W A;  1VQE A;  4POG A;  3A5Z B;  1DOK A;  1LM0 A;  5HGQ A;  1AW7 A;  1SE2 A;  1PYS B;  5I6W A;  5FK9 C;  3UDF A;  4IUT A;  4GLV B;  4FF3 A;  2Y0S B;  4DXG A;  5T1G A;  1N33 Q;  1YNN D;  1QWY A;  2HIX A;  2H4O A;  4DR7 Q;  5CBE E;  4FO2 A;  3OYY A;  4A93 B;  3ZYY X;  1O78 A;  2Z4I A;  4UY8 C;  5DM6 3;  2IWH A;  3CCQ A;  1L2F A;  1EY5 A;  2HD3 A;  2ALY B;  1V1Q A;  3K0X A;  5EKI A;  4R1J A;  4HIO A;  4A3E H;  3IRB A;  3NEM A;  1STH A;  3CRL C;  4MIU A;  3PUX A;  1PTO D;  1XJV A;  3H09 A;  1JWU D;  1GXD C;  2CFM A;  3KUP A;  5JEA H;  3TSS A;  2ZTC A;  5AJ3 L;  4XT1 B;  4ZKC B;  3W5O A;  4OWX B;  3H15 A;  3TP8 A;  1I5F A;  3CQZ H;  4I65 A;  5IT9 L;  4A3E B;  2O2L D;  2QGQ A;  3MFY A;  2A73 B;  3EVQ A;  1HZA A;  5KYL A;  4FYD A;  1SYE A;  1GUO A;  3WWV A;  1BKB A;  1TII D;  1IL8 A;  1CKN A;  3D6W A;  1SFO H;  1PVO A;  3J7Z C;  3CQZ B;  1SEB D;  3STB C;  1I94 L;  2A68 C;  2GA4 B;  3FKI G;  1IL2 A;  3J81 i;  4YY3 L;  1YEZ A;  3S2D H;  3AMU A;  1EIG A;  1IBL L;  2EY5 A;  4DV4 Q;  1BF4 A;  2HDL A;  1MSG A;  3VYU A;  3PCO B;  1D6E C;  4NXM Q;  4B3T L;  2VZA A;  3W1B A;  1SFO B;  2IX3 A;  5KYI A;  1CKN B;  3DEP A;  4BY7 G;  1VQP A;  4UHV A;  5G3L D;  2J7Z A;  1CFM A;  3D3R A;  5GAH C;  3E9H A;  3S2D B;  4FXD A;  1RTN A;  4K0K L;  1MIU A;  2VL6 A;  3IKJ A;  4UP8 A;  5EQ0 A;  1EWI A;  4LUV A;  1LO5 D;  2PO4 A;  4A3L G;  1NCV A;  1HZ9 A;  4IUU A;  5CYU A;  1EQT A;  3SR1 A;  4BBR G;  1OXV A;  3DHQ A;  1TVX A;  4GNX C;  4DR5 Q;  4KK7 A;  4PMC A;  3PQI A;  1UE1 A;  2KA7 A;  4L5T A;  1YIT A;  3F2C A;  1HPC A;  1XNQ L;  4YWM A;  2PNH A;  1IKL A;  3Q24 A;  1K28 A;  2BH8 A;  2R92 G;  5AFW A;  4KY7 A;  3HG9 A;  2UXC L;  3KBX A;  1Q12 A;  4CKB A;  4R4T A;  2Z6K A;  4FNF A;  4LFA Q;  3PIO A;  1S5C D;  3CC2 A;  3NPP A;  1N32 Q;  2OT2 A;  1HR0 W;  5C5L A;  1U9R A;  1I4X A;  3HEJ A;  1N33 L;  1JOQ A;  1BCP C;  1ONL A;  1TWC H;  1Q3L A;  2L15 A;  4DR7 L;  4JBJ A;  5D3I B;  4OON A;  5L37 A;  1Q8I A;  3ER0 A;  4ZUJ A;  2AHO B;  4KD4 A;  4IFD H;  4A4I A;  2ZJQ A;  1MKH A;  4WFN 3;  4K2K A;  3KLR A;  4DNR B;  2Z6K C;  3BVG A;  1D5Z C;  2Z0S A;  4UP7 A;  1F77 A;  3VR6 A;  3T13 A;  1D2B A;  3PSI A;  5C5M A;  1C8C A;  3T56 B;  1HRJ A;  2EXD A;  4A3M H;  2NVY H;  4HED A;  1WTQ A;  4ZLT F;  3S1N B;  3CCL A;  3S1M B;  3FP9 A;  3V96 A;  5C4X G;  2CH4 A;  1FL0 A;  1FYC A;  1YZ6 A;  4LUO A;  3MAQ A;  1YNX A;  1SJE D;  3OIP A;  3RLN A;  4JBM A;  1NNX A;  2ZJR A;  2NVY B;  2IPK D;  1PH5 A;  2EYJ A;  4BA1 I;  4C3J H;  4OXP A;  3ULL A;  1BBU A;  3A56 A;  2RDG A;  2PQE A;  2PMZ B;  3R2I A;  5IYD G;  4X64 Q;  3I2Z A;  4G7O C;  1IYJ B;  1RL2 A;  4N8X 1;  2R61 A;  2RA4 A;  4DV4 L;  2K5N A;  1J8I A;  2F0U A;  4C3J B;  1KD1 C;  4NXM L;  2KUM A;  4ZKB B;  4WOR A;  3GTL H;  4APV A;  2KCT A;  2A6E D;  5J1Z A;  2EYL A;  5C0X I;  3T1H Q;  2SNM A;  2XRS D;  1DZ1 A;  2C35 B;  1PMR A;  2RCF A;  4DV3 L;  4JI6 Q;  1EZ8 A;  3GP7 A;  3TN2 A;  3MA2 B;  3TS0 A;  2DNC A;  5FO9 B;  3GTL B;  2O4X A;  1G8Z D;  3AQQ A;  5IYC G;  1X3E A;  3RN5 A;  4KN4 C;  2LXJ A;  3KLS A;  3U9O A;  1JWS D;  4X62 L;  2JK8 A;  1RJT A;  4HN7 A;  3X3M A;  3BDL A;  4A3I G;  3N6R A;  1QZH A;  3NE5 B;  2PZW A;  2B3G A;  5CV9 A;  4OGQ C;  5FLM H;  2PQA B;  2Z9H A;  4JG2 A;  4LF9 Q;  3I4N H;  2YYZ A;  1DXM A;  1A2U A;  3J80 c;  4K5V A;  2R7Z G;  1VQ6 A;  4LJZ C;  2JE6 I;  3MZ5 A;  4LFA L;  3A55 A;  4LF5 L;  1I6H H;  3FDT A;  3S17 H;  4V19 0;  4O2D A;  5JEA J;  1ENA A;  4O42 A;  4U68 A;  1VQJ A;  4J6H A;  4JI8 Q;  4BY1 H;  3I4N B;  5IYB H;  2B2T A;  4WJW A;  5KND A;  2UU9 Q;  4RWS C;  1PRT F;  1M8A A;  3Q22 A;  1OXT A;  1Z47 A;  1E2Z A;  1GVP A;  1XNR Q;  1I6H B;  4QB4 A;  1EU3 A;  3S17 B;  4NB3 A;  2UXB Q;  1ET6 A;  4F88 A;  2A19 A;  5JVG 3;  4BY1 B;  3I4M H;  1WJJ A;  1GUN A;  2FXQ A;  2YV5 A;  1LTT D;  5IGB A;  4C1N K;  4RGO S;  4JOI A;  2HIV A;  3M9B A;  1EWH A;  3ULP A;  2E2J H;  4YCV A;  4DUY Q;  1EIH A;  3OOC A;  3TZU A;  4MZ9 A;  1L1O A;  3EJI A;  2CCZ A;  1G29 1;  3OSO A;  1B8A A;  1JR0 D;  2WAC A;  1HA5 A;  4JW0 A;  3D4W A;  5JPN C;  2ZT9 C;  1B2T A;  5J3B A;  3VR5 A;  1WCM G;  2Q2U A;  2B63 H;  4IN3 A;  5LL6 X;  2E2J B;  2I5M X;  4MHE A;  4H7B A;  4YWK A;  5M5Y B;  4XT3 B;  3OWE B;  1A3T A;  4HJ5 A;  4EVO A;  3DUZ A;  4IZ8 A;  2YTX A;  4ODG A;  1SN8 A;  3M85 A;  5EAY A;  4R8I A;  2F0F A;  2B2U A;  1L1O B;  3SK6 A;  2I07 B;  4X64 L;  3RMH A;  1HZB A;  2B63 B;  1Y8N B;  2A69 C;  2FIN B;  4DNT B;  3DWQ A;  3BYT B;  1JB7 A;  1JT8 A;  4A3B H;  3SHL A;  5M9O A;  5ELF A;  2F0I A;  4K8J A;  4B3R L;  3EA6 A;  3J81 j;  1CZW A;  1U0L A;  3T1H L;  2BA0 A;  3PMF A;  3LWU A;  4X65 Q;  4JI6 L;  4NW2 A;  1GUS A;  4BXX H;  2R92 B;  4A3B B;  1Y1W H;  2L0C A;  2JA8 H;  1KQS A;  2AKW B;  4J1M A;  4X3S A;  2B2U C;  3PUZ A;  3CKI B;  3T51 B;  3NQT A;  1KHI A;  2F4V Q;  2CW0 D;  1WTW A;  3RLF A;  5JVH 3;  3QIA A;  2VQF L;  1S72 A;  1V9P A;  1NR2 A;  1Y1W B;  4IFD J;  2JA8 B;  4LFB L;  3M7G A;  4DV2 Q;  4ABN A;  2A1A A;  1BBW A;  2L1B A;  2B8F A;  2ID0 A;  4A3F G;  1EIY B;  5I2X A;  1X56 A;  1PHJ A;  1AEX A;  4HJ8 A;  1I3Q H;  1FGU A;  4LUZ A;  2CWA A;  4JI8 L;  4O1N A;  4YWL A;  4OL7 A;  4DV6 L;  1YIJ A;  4PMW A;  1N34 Q;  4QF4 A;  1D5M C;  3SK8 A;  2G9D A;  5C3E G;  2JA5 G;  3CCV A;  1Y69 U;  3P75 A;  1I3Q B;  3M4P A;  2LMC B;  3MXN A;  2WKC A;  1HFG A;  1W3S A;  1EYD A;  1VQI A;  3D31 A;  3SK4 A;  2K32 A;  3PUY A;  2OWO A;  2F0K A;  2ATW A;  3PIP A;  1X54 A;  4TRD A;  4A3D H;  3SGI A;  3LGJ A;  1ICF B;  2BDN A;  4KHP L;  2E74 C;  4DUY L;  1Z6H A;  3MXN B;  3NQI A;  1G2T A;  1YJ9 A;  2UUC Q;  4J8Q A;  4KY5 A;  2NWG A;  1VQO A;  4A3D B;  3KBG A;  4F7X A;  1JQY D;  4YHH Q;  1VQB A;  4LAA A;  4DK0 A;  1B53 A;  1M90 C;  3R2T A;  3OHX C;  5EBD A;  3UDI A;  1O7L A;  2F0P A;  3J81 L;  1GM5 A;  4XYO A;  2OQ0 A;  4RKB A;  3TZD A;  3I70 A;  1JJG A;  2VB3 X;  4YCU A;  1TWA H;  1T5E A;  5JOB A;  1B3A A;  1E7Z A;  1A63 A;  2CQA A;  1K8A C;  1QVC A;  1I4Q A;  4KKS A;  4Q0F A;  2MNA A;  4DV5 L;  1CQV A;  2QIL A;  1GJX A;  1S5E D;  5IWA Q;  3S16 H;  3CCJ A;  1QJO A;  1NUC A;  4ALP A;  4EQN A;  3D4R A;  2RHS B;  2WFW A;  4JI1 L;  3I55 A;  1TWA B;  4S3S A;  4MTK A;  3QOL A;  3KF8 A;  3I8Z A;  2JA6 H;  4R4C A;  3GTP H;  2DJF C;  4QIW E;  2O5J C;  1PZI D;  3K7U C;  3LX0 A;  1SJH D;  4F8M A;  1W6K A;  3J7A V;  1SSO A;  2L5T A;  4C3H G;  2ICI A;  3S16 B;  1EUJ A;  3H6M A;  3I91 A;  5EPJ A;  5E7N A;  1BR9 A;  2F4V L;  2EYM A;  2XGT A;  4C3I H;  2JA6 B;  3GTP B;  1CKO A;  3GTK H;  1XPO A;  4HIM A;  3KF8 B;  1Q1E A;  4DV2 L;  3FVQ A;  4K2L A;  3KF6 A;  4H13 C;  1D5X C;  3VYS A;  2O5I C;  2IT1 A;  5FLX c;  1NMG A;  4HJ7 A;  4C3I B;  2B2V C;  3GTK B;  4KV6 A;  1PDQ A;  3V2T A;  2G5D A;  3E3X A;  4KI0 A;  2ZTE A;  5CV8 A;  4CKC A;  5FKA C;  2QA4 A;  3HOY G;  5LHY 1;  3HKS A;  4FP5 D;  1GUG A;  3MWY W;  1TY0 A;  3KF6 B;  3PUW A;  3BDO A;  1SND A;  1IBK L;  4JK1 C;  1L0Y B;  4RAU C;  1K3B C;  1HNZ Q;  1EFI D;  1PTO H;  2ZM6 Q;  1WTP A;  2NVX H;  2I5H A;  3M4Y A;  1LTA D;  4MN3 A;  5CR3 A;  2R6G A;  5ISR A;  3MXP A;  4GN4 B;  5EPK A;  1V1O A;  4DV7 L;  2PPB C;  3K5L A;  2F0O A;  3CCU A;  1VQ8 A;  3JAM L;  3N52 A;  3U50 C;  4XYQ A;  1Q81 C;  4X66 Q;  5KNB A;  2WAQ G;  4RHR A;  1B1Z A;  2MQH A;  2NN6 G;  4L63 B;  3VR4 A;  1HR0 Q;  1KXL A;  4L8J A;  3DM1 A;  2UUC L;  1PTO C;  1LTG D;  3QOJ A;  3VDY A;  1GHJ A;  5EKK A;  2WAQ E;  2HDM A;  1QVF A;  4WJ4 A;  1SYD A;  2QKI C;  3ITP A;  3W1G A;  3H3V I;  1O7Y A;  1CM9 A;  2M00 A;  1HTL D;  3HOV G;  1QNK A;  1JWM D;  1J9O A;  2KEN A;  2XWB B;  3HFZ B;  5C3X A;  1U5K A;  3TEH B;  3HZX A;  1A2T A;  3UE0 A;  3SE0 A;  1AP0 A;  1MJC A;  2GVB A;  3KOJ A;  1QOH A;  1YHB A;  3DXJ C;  5IT9 c;  3NEL A;  4RGM A;  1QB5 D;  4DAV A;  5JJK A;  2Z1C A;  4BBS H;  1DOL A;  1F2Y A;  3DM3 A;  3J7A F;  2JSO A;  4ME5 A;  2F0G A;  2MUY A;  3G6J B;  1WYD A;  4N9T A;  1F9P A;  1HNX Q;  2HT1 A;  2F0S A;  5EBC A;  2N3S A;  3C46 A;  1E1O A;  1E2V A;  2DY7 A;  3DLL A;  1PRT B;  4DV0 L;  3S24 A;  1LTL A;  1XPU A;  1AZP A;  3GV3 A;  4BBS B;  2YU9 H;  4LWC A;  4M8A A;  3Q6S A;  2RSN A;  2KEE A;  4K5X A;  1WTX A;  5C0X H;  4CKE A;  4A76 A;  3KJP A;  5FJ8 G;  2YU9 B;  4ME3 A;  3URY A;  4AYB B;  4HCS A;  2FMM A;  2KCN A;  2F0Q A;  2UXD L;  1H9S A;  2BCO A;  5C44 H;  4A3J H;  2X6G A;  1SDF A;  1XTC D;  4JCV E;  3PO2 G;  4RA8 A;  1V8Q A;  4TQU S;  4DR4 Q;  2VQE Q;  3T4A C;  4AH6 A;  1OXX K;  2H1E A;  4HCE A;  1G6P A;  2VUM H;  4JI0 Q;  1JE4 A;  5I6Y A;  1UNS A;  4L5R C;  3BDC A;  5C44 B;  4A3J B;  4JI2 Q;  5E4X A;  1HNZ L;  4HMJ A;  1GUT A;  1H9S B;  1PH1 A;  1JOO A;  1STE A;  1KTK A;  3HKZ B;  4R8N A;  3TP7 A;  5CBA E;  3ZJY C;  1ENC A;  4G57 A;  1PRT D;  4R4Q A;  5C4H A;  4IQZ A;  4F87 A;  3P1H A;  5HGT A;  1QCB D;  4P2C B;  2VUM B;  3B6Y A;  2K4K A;  2ZJP A;  1PH4 A;  3HOU H;  2PI2 A;  4XIG S;  4X66 L;  1HQM C;  1HTP A;  2BOS A;  2K5H A;  1HNW L;  1VQ5 A;  3OPO A;  3I56 A;  3MEF A;  1VQH A;  3M4O H;  1HCZ A;  1FD7 D;  1U4M A;  2ENB A;  4IUV A;  4QUC A;  2WIN B;  1UEB A;  4M1U B;  2QEX A;  3PF5 A;  1NJI C;  3HOU B;  1PH3 A;  4Z9C B;  3TRZ A;  4OO1 G;  2EDG A;  3NP8 A;  3HGB A;  3MTS A;  3GTM H;  4FXK C;  3M4O B;  1II3 A;  4OEM B;  1Q8K A;  1A8V A;  5ELN A;  1X55 A;  1PXU A;  4HJ9 A;  3GTQ H;  2WB1 G;  2AWN A;  2SOB A;  5M3F G;  3HOX H;  1IYU A;  2QCP X;  3HOW H;  2B29 A;  3S2H H;  3GTM B;  3STB D;  1V1P B;  4RH6 A;  1K73 C;  2E75 C;  2RQX A;  2R7F A;  4POF A;  4B3S Q;  2L12 A;  2WB1 E;  3GTQ B;  4KJN A;  3HOX B;  4EX5 A;  1PLF A;  3KK7 A;  4AIM A;  3HOW B;  3F2U A;  2MO0 A;  3S1N H;  3S2H B;  3OMG A;  2MHV A;  3S1M H;  3BJU A;  1B3Q A;  3TBI B;  4IUP A;  4NP5 A;  1EIF A;  1CHQ D;  3J80 E;  5K36 G;  4JPB W;  1L0W A;  2F0E A;  1TQO A;  3ULJ A;  3JAM i;  2RVL A;  4DV1 Q;  3VR2 A;  1F2Z A;  2YTY A;  3EFX D;  5GRO A;  1K8G A;  5ELO A;  3DMU A;  2XIW A;  4GKJ Q;  1Q1B A;  2K1B A;  1CA5 A;  1Y1V G;  5E4W C;  4LFC Q;  1B44 D;  2Q8T A;  4RFB A;  3TP6 A;  4A3C H;  2VXW A;  3TQY A;  3HOZ B;  3PIO 3;  2CH4 W;  2AQ1 B;  5M3M H;  3BVZ A;  1SMY C;  2PYK A;  2C9O A;  2JEB I;  1TR5 A;  2EYF A;  4DR2 Q;  4PZ8 A;  2F1M A;  1HXY D;  5I4D A;  4EGV A;  3E5S A;  4LK1 C;  2EY1 A;  4GN5 A;  5IY0 A;  1EOV A;  2V4D A;  5M3M B;  4CGY B;  3P20 A;  4OX9 Q;  2R93 G;  1CHP D;  2L11 A;  3G6E A;  3J7Y W;  3C2P A;  2XN9 C;  5IGF A;  2CWP A;  4NPS A;  5I9P A;  5E3F A;  4J15 A;  2NBF A;  2WV6 D;  4LMQ D;  2PQA A;  1VMP A;  4EQP A;  1DM0 B;  4Y7N H;  2F03 A;  2RHQ B;  1RDP D;  2QF7 A;  4A3K G;  2K5V A;  4P74 A;  1C4Q A;  2HHH Q;  1XPR A;  4DR5 L;  1KNA A;  3I90 A;  4GKK Q;  1X6O A;  1G6Z A;  3RUZ A;  4TKO B;  4Y7N B;  5LMN Q;  1OTC A;  1CSP A;  3F2D A;  3ICE A;  3AB9 A;  2F0J A;  3H0G G;  1G51 A;  3WOF A;  2Q8I B;  4A3G G;  2EOT A;  2PNR C;  1XWE A;  3EQL C;  2Q8R E;  2UUA Q;  1N32 L;  1GHK A;  4H44 C;  4JI5 Q;  1QG7 A;  4JI7 Q;  2MO1 A;  2WKD A;  1KIX A;  3PO3 G;  2KHJ A;  1JB3 A;  4MTN A;  1H95 A;  3QWN A;  5FO8 B;  5C0X J;  1N8R C;  3BZK A;  2BE5 C;  1STN A;  4IPD A;  4B3S L;  1CSQ A;  4JYA Q;  3DEO A;  3ONA B;  1XMO Q;  4ILW A;  4OWT B;  3CPF A;  1YVC A;  3OW7 A;  3FKI H;  1EOT A;  1DD2 A;  4GOP A;  2CHB D;  2K33 A;  1VQD A;  3H94 A;  1VQ7 A;  4DR3 Q;  2Z8L A;  3VA7 A;  1DCZ A;  1PZJ D;  2Q2T A;  1LT4 D;  4DR1 Q;  5M5Y H;  4DV1 L;  4BY7 H;  5JJL A;  4H0L C;  4R9W A;  4ZK9 B;  2B2T C;  1A3V A;  3IL8 A;  3FKI B;  4GKJ L;  1CQF A;  1D8L A;  1RCV D;  3UE1 A;  3E0J A;  5IP7 G;  3MXG A;  1YBY A;  2I46 A;  1YNJ D;  2F0M A;  1ASY A;  4DN4 M;  3NSW A;  2JA7 G;  1J6Q A;  4GOP B;  2EJF C;  1SNC A;  3T1Y Q;  3PGZ A;  4R4O A;  1A15 A;  1VQ9 A;  1LLR D;  1EEI D;  1KDC A;  3RLO A;  4BY7 B;  4A3L H;  2OXP A;  1T5X D;  3JC6 6;  3RR5 A;  2CKZ B;  4BBR H;  3KJO A;  4RCO A;  2KEC A;  2SEB D;  3U4Z A;  1KNE A;  3J81 E;  4GOP C;  4DK1 A;  4DR2 L;  1N36 Q;  4JOI C;  4I7A A;  2Z4H A;  4O0A A;  5GAG C;  4ZAI A;  2R92 H;  2E76 C;  1F2L A;  2HCI A;  1IYV A;  4KHV A;  3GTJ B;  1BQQ T;  1L1O C;  4BBR B;  4OX9 L;  3HP3 A;  1BO0 A;  1PA6 A;  1Q90 A;  1UE5 A;  1R9T H;  2KOL A;  2MPM A;  1ET9 A;  3W3A A;  5IOD A;  5COR A;  2NN6 I;  4KJO A;  1IKM A;  2G9H D;  2J0T D;  5A2Q E;  2VY3 A;  2HHH L;  1JOR A;  1GO3 E;  1R9T B;  4UPA A;  3CCR A;  1D1I A;  1K0S A;  4GKK L;  3ND9 A;  1SAP A;  2F0N A;  2ZTD A;  3A7L A;  4CHT B;  5NUC A;  3UDX A;  5LMN L;  4DAM A;  4LF9 L;  1I6V C;  3K59 A;  3T53 B;  3D6C A;  2K03 A;  2F52 A;  2LXK A;  2Y0S G;  1E22 A;  1GOZ A;  4Q5V A;  4DUZ Q;  4JV5 Q;  1Z9F A;  5KNC A;  1DYQ A;  3QJY A;  4A93 G;  3C1E A;  4C1N I;  2UUA L;  4JI5 L;  4JI7 L;  2IW3 A;  2RF4 A;  5C4X H;  1PFB A;  1BCP F;  5I2Y A;  4CDD C;  1XMQ Q;  2UU9 L;  1STA A;  3D4D A;  3S14 B;  1K83 H;  2Y0S E;  1GKH A;  2M9V A;  1IW7 D;  4CDC C;  2ICE C;  1XNR L;  3H3V H;  2JXM B;  2A69 D;  1AE2 A;  2EQS A;  3I72 A;  4ZYS A;  2UXB L;  4QY7 A;  1LAC A;  1B9M A;  3J81 c;  5C4J H;  5C4X B;  3CCM A;  3LWE A;  3PUV A;  5IYD H;  1Z7T A;  1K83 B;  4A3E G;  2P5Z X;  2D2C C;  1S4Z A;  1EY4 A;  1ZYR D;  2L4N A;  5GQO A;  5FLX E;  2JEA I;  1MD2 D;  5JEA G;  2F0W A;  4LW1 A;  5C4J B;  4B08 A;  4IPH A;  3A5U A;  3H3V C;  5A35 A;  1RIP A;  1PH7 A;  4NXN Q;  1BBX C;  2X69 A;  4X3T A;  4PZ6 A;  3U4V A;  2V1C C;  3K5M A;  1WD1 A;  2Q2H A;  4B3M Q;  2AUJ D;  1TS4 A;  5IYC H;  3F1Z A;  1MJE A;  3K58 A;  1I4H A;  2D0O A;  1ZKO A;  4RKL A;  1WOC A;  2F0H A;  2B2W A;  1N36 L;  3A7A B;  2K50 A;  4A3I H;  2I0Q A;  1S5D D;  1STY A;  1BXT A;  2KCM A;  1B9N A;  1UE6 A;  2WII B;  1F9Q A;  1UUP A;  1RTO A;  2K52 A;  2R7Z H;  3BG3 A;  3D0F A;  2QDB A;  3MVV A;  4HMI A;  4X3U A;  5DNF A;  5IGE A;  4LNQ A;  2MP1 A;  3A8J E;  4A3I B;  3L0O A;  1IBM Q;  3AU7 A;  4H02 A;  4G4K A;  3PIP 3;  4X65 L;  3IFD A;  4DAY A;  1SYG A;  1X3Q A;  3S1R H;  3CHB D;  4WRD A;  1EU4 A;  2R7Z B;  2IHE A;  3BU2 A;  1SNM A;  1G91 A;  2B2W C;  1E24 A;  4JI4 Q;  2IHF A;  2K01 A;  3MXU A;  2RKS A;  3QO2 A;  3I4O A;  1QUQ A;  5H1S E;  3S1Q H;  4YCW A;  3NEN A;  5JAV A;  4DAY B;  3S1R B;  2C5C A;  2AQ3 B;  4P72 A;  5IT9 E;  1DJR D;  4OO1 I;  3J7A 5;  1NR4 A;  1KRS A;  4MNO A;  2IY5 B;  4IAL A;  4KY6 A;  2NVT H;  1Q82 C;  1QZG A;  2EYH A;  1KDA A;  3JAM c;  3HRZ C;  4X6A H;  1ZEQ X;  4JV5 L;  4KN7 C;  3J80 i;  1WTO A;  2A6H D;  3U9S A;  5AJ3 Q;  3S1Q B;  4UDU C;  1Q86 C;  2EJG C;  1Y14 B;  2KQ3 A;  2RSO A;  2K7V A;  1QUQ B;  4NDX A;  1STB A;  4IO9 A;  1EL0 A;  1KL9 A;  4LF7 Q;  1WI5 A;  1FNW A;  1FNV A;  1TT2 A;  1SRU A;  3VR3 A;  1C9O A;  2IX0 A;  1S5B D;  1XMQ L;  2NVT B;  3CU7 A;  5EJW A;  1N34 L;  5JJI A;  1WCM H;  4CBV A;  5JJZ A;  4XQJ A;  2EIF A;  1MBY A;  2J4X A;  5IIF A;  3A54 A;  1EY9 A;  3FRP B;  5CV5 A;  2E5L Q;  1K9M C;  4IFD G;  1VQF A;  4K8I A;  2ASB A;  1AFP A;  1YNN C;  3BVM A;  2EZV A;  1I94 Q;  2K75 A;  5J39 A;  4ULL A;  1DGS A;  1WCM B;  2LS0 1;  3PV0 A;  5CC4 A;  1NTG A;  2KVM A;  3F8T A;  1RKN A;  2NTT A;  4A3M G;  1HZC A;  2PW5 A;  3TS2 A;  4YIJ A;  3RZO H;  4FF4 A;  3NBH B;  3AYH B;  4K0K Q;  1SRO A;  1HUN A;  5DEH A;  1KRT A;  1TWG B;  5JPM C;  3LNN A;  2FHT A;  4YHH L;  1FGB D;  2EYO A;  1WTV A;  1JMC A;  1YJW A;  1EFW A;  3A0J A;  4C3J G;  1BUV T;  4DPG A;  1R4Q B;  3RZO B;  1BNZ A;  2PMZ E;  4OIK A;  4G7H C;  1XX8 A;  3MC0 B;  3E6Z X;  3G4S A;  1U4L A;  2EVB A;  1VQC A;  3OIQ A;  4XDX A;  1XNQ Q;  3MFG A;  2HCC A;  2ZXP A;  3NBI A;  3VYR A;  1SR3 A;  1PYW D;  1IHZ A;  2RCN A;  3X3N A;  3K81 C;  2AMC B;  4DA2 A;  5IWA L;  2UXC Q;  3WDN A;  4A3F H;  1M1K C;  2F0D A;  5ELC A;  4HID A;  2KHI A;  1HUM A;  1IBM L;  1Y8P B;  2BDO A;  5ELB A;  4DFA A;  1VMC A;  2F3V A;  3A74 A;  2D0P A;  3GTO H;  4I7Z C;  1YHQ A;  4A3F B;  4JI4 L;  1PZK D;  1UWV A;  5C3E H;  3A8K E;  1PRT C;  2GVA A;  2JA5 H;  1L0X B;  2SNS A;  1UEA B;  1PH6 A;  1X3P A;  1EYG A;  2BH2 A;  3GTO B;  5FLM G;  1X3G A;  3I4N G;  1ENF A;  2FFK B;  5C3E B;  1SLJ A;  2DJG C;  4JVZ A;  3SK5 A;  3L7Z C;  2JA5 B;  4TVA B;  3CC7 A;  3RZD H;  1WVL A;  4BA2 I;  1KAW A;  1YI2 A;  1ESR A;  2NZH A;  3C3L A;  1RF2 D;  4GLA C;  4LF7 L;  2B2Y A;  2R3Z A;  4JBW A;  1PYB A;  1EQR A;  3Q8D A;  4BY1 G;  1B7Y B;  5IYB G;  1EY7 A;  1K0R A;  1X3F A;  1BDO A;  4ZQ3 A;  1VS0 A;  4FXG C;  1FR3 A;  1IZ6 A;  3RZD B;  3K7A H;  4DKA C;  1CTM A;  4RGT A;  2ZM6 L;  2EPB A;  4HTH A;  2E5L L;  1CA6 A;  2EY6 A;  1SNO A;  4BS9 A;  3FHW A;  4UAI A;  3I3C A;  3I4M G;  2IJ0 A;  1SE3 A;  1SMX A;  1VF7 A;  4GNX A;  1OO9 B;  3KLW A;  5BR8 Q;  4QGU A;  1AZQ A;  3K7A B;  1WFQ A;  1P8L A;  3K57 A;  3BZC A;  2B2Y C;  1Q7Y C;  4G7Z C;  1HR0 L;  1YHA A;  2JJQ A;  1KLU D;  1PH2 A;  4Y52 H;  5IGC A;  4XQQ A;  2QEJ C;  2RDF A;  1NBW A;  2FMC A;  3MHB A;  2TSS A;  3NWT A;  2DY8 A;  2MFI A;  1CUK A;  3L9A X;  4DV3 Q;  2JQO A;  4QIW B;  1B50 A;  1V1P A;  4GNX B;  3FEW X;  1PH8 A;  1TU2 B;  2B63 G;  4C3H H;  1TS5 A;  1F9R A;  4OWW B;  2E8G A;  4LF8 Q;  2OTL A;  1MSH A;  1ROD A;  5FOB B;  4X62 Q;  1JC7 A;  3A8I E;  4LF4 Q;  4N8F A;  1LTI D;  3OW2 A;  4C3H B;  1HQR D;  4FVM A;  5IOC A;  4JI3 Q;  3NTI A;  5IP9 H;  4A3B G;  1LTS D;  2A68 D;  3PF4 A;  1F2M A;  1P16 A;  1HNX L;  4LF5 Q;  4P75 A;  3S15 H;  3ERS X;  3SXH A;  2A8V A;  4DK6 C;  1BCP B;  2D5D A;  2NTS A;  2N49 A;  1EY8 A;  2XTI A;  4BXX G;  3HOY H;  2A6E C;  1Y1W G;  1SNP A;  5M5W H;  2JA8 G;  1KAA A;  1N9W A;  5E1F A;  3HOZ H;  3K5N A;  4RCN A;  2L9H A;  3S15 B;  1EYA A;  5EPL A;  1H9R A;  3HOY B;  4IOC A;  4FDB A;  3SEB A;  4QQB X;  5M5W B;  4DR6 Q;  2N8N A;  4RG1 A;  1TWC B;  4A75 A;  3OTO Q;  3IFT A;  3K8A A;  5DAU A;  1F9S A;  2K14 A;  1R4P B;  1AH9 A;  2NN6 H;  1W6J A;  2Z6B A;  3CP0 A;  2DGY A;  3F2B A;  5GAE C;  2LSS A;  3L3O C;  2VQE L;  4DR4 L;  1JE5 A;  4P71 A;  1NY4 A;  1XTD A;  1X32 A;  3UI2 A;  2JP1 A;  3W2D A;  4GN3 B;  4QCL A;  3HS0 C;  5KGU A;  1HH2 P;  2WAQ B;  4JI0 L;  3CW2 C;  1NMF A;  1ILQ A;  3R93 A;  5C3W A;  3G7L A;  4OIJ A;  4A3M B;  1IXR A;  4JI2 L;  1X9N A;  1VQN A;  2VNU D;  3HOV H;  3E0E A;  1RD9 D;  2RBM A;  1BVS A;  1J5E Q;  5TSS A;  1SYC A;  4C56 C;  2ZXR A;  2L55 A;  1BCP D;  3VYT A;  4HSV A;  5EGT A;  5GAD C;  1TS2 A;  2MGS A;  4ZUI A;  1NAP A;  5BR8 L;  5D65 A;  1VQM A;  1HJP A;  4ZRZ A;  2RDH A;  4A3D G;  2D9U A;  1VQA A;  3GO5 A;  4XQN A;  3M4Q A;  4TSS A;  3HOV B;  2DUD A;  2PCF B;  2PZU A;  2I5L X;  1H9J A;  4KMU C;  4L5Q A;  4U67 3;  4B3R Q;  1PTO F;  1QNU A;  4RHS A;  4DAP A;  3DWA A;  3NK9 A;  4K6L A;  2NZ1 D;  1V43 A;  3K5O A;  1O7I A;  1SBB B;  1VQ4 A;  2DNE A;  1VQG A;  5M5X H;  1E1T A;  1T9H A;  1PFM A;  3CF5 A;  3O13 A;  1PV4 A;  4LF8 L;  1LUZ A;  3FPU B;  2ZXO A;  3SVM A;  1ICW A;  1YNJ C;  1JCK B;  2KJX A;  4ZCK A;  4LF4 L;  2VQF Q;  3OWF A;  1AN8 A;  2XSC A;  5M5X B;  1TY2 A;  3TDQ A;  1SMY D;  5FJ8 H;  4LFB Q;  4JI3 L;  4NMZ A;  1KDB A;  2NZO A;  4PMB A;  3EN2 A;  4AQY Q;  1X65 A;  1DON A;  3WOE A;  2QW7 A;  2IL8 A;  4IUR A;  1SNQ A;  4CDE C;  3CC4 A;  2K05 A;  4ID6 A;  3PO2 H;  3CCS A;  5DLQ E;  3R3O A;  5G3L F;  2JA6 G;  1STG A;  1OXS C;  1SYB A;  4DK3 C;  2F3I A;  1K3R A;  2EXZ A;  4DV6 Q;  2EE1 A;  2X6L A;  3GV6 A;  1OXU A;  2F3W A;  1S40 A;  4EQ5 A;  2K5D A;  1DOM A;  1XYI A;  3PO2 B;  3R8B A;  5HY6 A;  3P7J A;  2M2L A;  5CV4 A;  2F0T A;  3CRK C;  1M4V A;  2VW9 A;  4C3I G;  1H9M A;  3K6O A;  2K5W A;  3RNU A;  1C7Y A;  3GDE A;  1E0B A;  4LFC L;  1C0A A;  2HUG A;  3J80 L;  4OHJ A;  4DR6 L;  2N88 A;  2CW0 C;  5F2D A;  3OTO L;  5EKL A;  2VS1 A;  2UUB Q;  2H5X A;  5FO7 B;  3GTJ H;  5C6A A;  4GLX A;  4KHP Q;  2KHS A;  1LTR D;  3I73 A;  3I4M B;  4HIK A;  1D1K A;  1QIL A;  4KKU A;  3CMA A;  4OEL B;  4IUN A;  3K0Y A;  2E2I H;  3CAM A;  4OO1 H;  4E6I A;  3AFQ A;  5ELE A;  1J5E L;  4IFD I;  3TP5 A;  2BE5 D;  3G71 A;  5M3F H;  1JIC A;  3KLS X;  4JC0 A;  5BN3 A;  3C1F A;  3GD7 A; 
#chains in the Genus database with same CATH homology
 4C3J H;  4BA1 I;  4A76 A;  1TXY A;  4IPG A;  4IPC A;  2IHF A;  4OXP A;  3KJP A;  5FJ8 G;  3ULL A;  4ME3 A;  1BBU A;  3I4O A;  1QUQ A;  2CQO A;  5H1S E;  4YCW A;  4DV5 Q;  3NEN A;  4JBK A;  3S1Q H;  2WP8 J;  5IYD G;  2UXD L;  4DAY B;  2KBN A;  3I2Z A;  4X64 Q;  1IYJ B;  1RL2 A;  4P72 A;  5C44 H;  4A3J H;  4PG3 A;  4DV4 L;  4JCV E;  3PO2 G;  3J7A 5;  4OO1 I;  1KRS A;  2K5N A;  4MNO A;  2IY5 B;  4JI1 Q;  4TQU S;  2NVT H;  1KD1 C;  1Q82 C;  1QZG A;  2VQE Q;  4NXM L;  4DR4 Q;  3JAM c;  4X6A H;  4AH6 A;  1OXX K;  3GTL H;  4APV A;  4JV5 L;  2KCT A;  3J80 i;  5AJ3 Q;  1Q86 C;  1Y14 B;  1G6P A;  5C0X I;  3T1H Q;  4UP9 A;  2VUM H;  3S14 H;  4JI0 Q;  1QUQ B;  4IO9 A;  4L5R C;  1KL9 A;  4LF7 Q;  1WI5 A;  2C35 B;  1TWF H;  4JI2 Q;  3TRE A;  2NVQ H;  1SRU A;  4DV3 L;  1HNZ L;  2ES2 A;  4JI6 Q;  1C9O A;  2IX0 A;  1XMQ L;  1PH1 A;  1LYL A;  1N34 L;  5JJI A;  1WCM H;  3TS0 A;  2EIF A;  3ZJY C;  3AQQ A;  5IYC G;  1X3E A;  4R4Q A;  3RN5 A;  1Y1V H;  2LXJ A;  4X62 L;  2JK8 A;  3UDG A;  2E5L Q;  3B6Y A;  5LMU Q;  2K4K A;  2ZJP A;  1PH4 A;  3HOU H;  1K9M C;  4IFD G;  1VQF A;  2PI2 A;  4XIG S;  4X66 L;  2K5H A;  4AQY L;  4A3I G;  2ASB A;  1QZH A;  1VQ5 A;  1HNW L;  4BBS G;  3I56 A;  1I94 Q;  1FVI A;  2K75 A;  3MEF A;  1VQH A;  2B3G A;  1DGS A;  3M4O H;  4JYA L;  1XMO L;  5FLM H;  2PQA B;  4JG2 A;  1W2B A;  3PV0 A;  4LF9 Q;  3I4N H;  2YYZ A;  3J80 c;  1NTG A;  2R7Z G;  3F8T A;  1E3P A;  1VQ6 A;  1UE7 A;  3KFU A;  3G48 A;  4LF6 Q;  1UEB A;  4A3M G;  3PF5 A;  2GN5 A;  2JE6 I;  2QEX A;  1NJI C;  1HZC A;  4LFA L;  3TS2 A;  4LF5 L;  1PH3 A;  1I6H H;  1PH9 A;  3TRZ A;  4DR3 L;  3RZO H;  3S17 H;  4OO1 G;  4O2D A;  3AFP A;  3NBH B;  5JEA J;  1IBK Q;  3GTM H;  4AYB G;  1VQJ A;  4DR1 L;  3AYH B;  4HJA A;  4JI8 Q;  2R93 H;  4K0K Q;  4BY1 H;  1Q8K A;  1SRO A;  1A8V A;  5IYB H;  5ELN A;  1KRT A;  1X55 A;  4YHH L;  2UU9 Q;  5LMN W;  1FJG Q;  3CCE A;  4HJ9 A;  3GTQ H;  2WB1 G;  2AWN A;  1JMC A;  2R7D A;  5M3F G;  3M7N A;  1OXT A;  1Z47 A;  5C0X G;  3HOX H;  3A0J A;  1YJW A;  1GVP A;  1EFW A;  3GTG H;  1PFS A;  1XNR Q;  4DPG A;  3HOW H;  2B29 A;  2D62 A;  4R4I A;  4DV7 Q;  2OQK A;  1JJ2 A;  3S2H H;  4NB3 A;  1TWH H;  4AYB E;  3T1Y L;  1AE3 A;  3STB D;  2UXB Q;  2PMZ E;  1K73 C;  1NE3 A;  2A19 A;  2UUB L;  3I4M H;  1WJJ A;  2R7F A;  3G4S A;  4A3K H;  2YTV A;  1VQC A;  4POF A;  2FXQ A;  2YV5 A;  2WB1 E;  3CME A;  1YJN A;  4B3S Q;  5C44 G;  4A3J G;  1XNQ Q;  4WJ3 M;  4EX5 A;  1SR3 A;  2N78 A;  2RCN A;  4AIM A;  3HKZ G;  3K81 C;  2AMC B;  4JOI A;  2MO0 A;  4RMF A;  5IWA L;  3S1N H;  2UXC Q;  2HIV A;  3M9B A;  2E2J H;  3ULP A;  4A3F H;  3BJU A;  4DNI A;  1M1K C;  3S1M H;  4YCV A;  4DUY Q;  4HID A;  2KHI A;  1EIF A;  4IJL A;  1IBM L;  2VUM G;  5K36 G;  4MZ9 A;  1L1O A;  1L0W A;  3H0G H;  2CCZ A;  1G29 1;  1B8A A;  4XTC S;  4A3G H;  4QL5 A;  3CPW A;  3ULJ A;  3HKZ E;  5J3B A;  3JAM i;  4DV1 Q;  1A62 A;  1WCM G;  2Q2U A;  2B63 H;  2YTY A;  1K8G A;  3A74 A;  2D0P A;  5GRO A;  3GTO H;  1YHQ A;  5ELO A;  4L5S A;  2I5M X;  4JI4 L;  1Q1B A;  4GKJ Q;  1UWV A;  4YWK A;  3PO3 H;  1Y1V G;  5C3E H;  4HJ5 A;  1B70 B;  4QJF A;  2GVA A;  2YTX A;  2JA5 H;  1VQK A;  1SN8 A;  4LFC Q;  3L2P A;  3M85 A;  5EAY A;  3HOU G;  1VQL A;  4A3C H;  2JA9 A;  1Q46 A;  3TQY A;  1PH6 A;  1L1O B;  4X64 L;  1EYG A;  1HZB A;  2BH2 A;  5M3M H;  4PZ7 A;  5FLM G;  1X3G A;  1JJC B;  3I4N G;  2JEB I;  1QVG A;  1JB7 A;  1JT8 A;  4DR2 Q;  1SLJ A;  4A3B H;  4PZ8 A;  3L7Z C;  2E2H H;  4TVA B;  2IX1 A;  4B3R L;  3KYH C;  3CC7 A;  4DV0 Q;  3RZD H;  4GN5 A;  1KAW A;  4BA2 I;  5IY0 A;  3I7F A;  1YI2 A;  3J81 j;  1EOV A;  1U0L A;  3T1H L;  2BA0 A;  2NZH A;  2PI2 E;  4GLA C;  4LF7 L;  4X65 Q;  4JBW A;  1PYB A;  1EQR A;  4DUZ L;  4OX9 Q;  4JI6 L;  3Q8D A;  4BY1 G;  3G6E A;  1B7Y B;  2R93 G;  5IYB G;  4BXX H;  1EQQ A;  1K0R A;  1Y1W H;  2JA8 H;  1X3F A;  1KQS A;  2CWP A;  2AKW B;  4NPS A;  3HOX G;  1KC8 C;  1ASZ A;  1VS0 A;  3PUZ A;  4KLK A;  1IZ6 A;  4J15 A;  3K7A H;  3HOW G;  1KHI A;  4DKA C;  2ZM6 L;  3U58 A;  2F4V Q;  5IP7 H;  1GD7 A;  2PQA A;  2E5L L;  2JA7 H;  5LMU L;  3RLF A;  3FHW A;  5IP9 G;  4Y7N H;  2RHQ B;  2VQF L;  1D7Q A;  3I4M G;  4A3K G;  2K5V A;  4P74 A;  1V9P A;  1S72 A;  2UXD Q;  1SMX A;  4IFD J;  2HHH Q;  4GNX A;  1XPR A;  5BR8 Q;  3KLW A;  4DV2 Q;  4DR5 L;  3RN2 A;  4LFB L;  4QGU A;  2A1A A;  1BBW A;  2HQL A;  1WFQ A;  2Q2I A;  1P8L A;  4IOA A;  4P73 A;  3BZC A;  4LF6 L;  3E9I A;  1X6O A;  2ID0 A;  4GKK Q;  4A3F G;  4YY3 Q;  1Q7Y C;  1EIY B;  5LMN Q;  1HR0 L;  1YHA A;  1IBL Q;  1OTC A;  2JJQ A;  1CSP A;  1X56 A;  2BA1 A;  3F2D A;  1PH2 A;  4HJ8 A;  1PHJ A;  1TWG H;  3ICE A;  4Y52 H;  3CD6 A;  1I3Q H;  3KDF A;  3H0G G;  1FGU A;  1G51 A;  1NBW A;  4LUZ A;  2CWA A;  4KHZ A;  4JI8 L;  4B3T Q;  1I50 H;  1CUK A;  2MFI A;  4DV3 Q;  3HOZ G;  2JQO A;  4A3G G;  4YWL A;  1FJG L;  4GNX B;  4DV6 L;  2B63 G;  1PH8 A;  3EBE A;  4PMW A;  1YIJ A;  2UUA Q;  1N34 Q;  1N32 L;  4C3H H;  4JI5 Q;  3AEV A;  4NXN L;  4JI7 Q;  2E8G A;  2MO1 A;  4OWW B;  1KIX A;  5C3E G;  2KHJ A;  4LF8 Q;  3PO3 G;  2OTL A;  1CKM A;  4MTN A;  1A0I A;  4IJH A;  2JA5 G;  1H95 A;  4X62 Q;  3CCV A;  3M4P A;  5C0X J;  1N8R C;  4A3C G;  3BZK A;  4LF4 Q;  4C2M H;  4B3M L;  3KDF B;  1HNW Q;  1W3S A;  4IPD A;  1S3O A;  3OW2 A;  1VQI A;  4B3S L;  3D31 A;  5M3M G;  1VCI A;  1CSQ A;  3PUY A;  2OWO A;  4JYA Q;  2ATW A;  4JI3 Q;  3PIP A;  1X54 A;  1XMO Q;  4A3D H;  3SGI A;  5IP9 H;  3CXC A;  4OWT B;  4A3B G;  3CPF A;  3PF4 A;  3M3Y H;  3EIV A;  3LGJ A;  1YVC A;  3FKI H;  4KHP L;  1SE8 A;  4DUY L;  1P16 A;  4GOP A;  1HNX L;  1VQ7 A;  1VQD A;  4LF5 Q;  4P75 A;  3S15 H;  3ERS X;  3MXN B;  4DR3 Q;  2A8V A;  4DK6 C;  1YJ9 A;  2OCE A;  5IE8 A;  2UUC Q;  2OTJ A;  2N49 A;  2Q2T A;  4DR1 Q;  3K80 C;  2XTI A;  1VQO A;  3HOY H;  4BXX G;  5M5Y H;  4DV1 L;  2AWO A;  4BY7 H;  5JJL A;  4YHH Q;  1VQB A;  1Y1W G;  5M5W H;  2JA8 G;  4GS3 A;  4A93 H;  1VQE A;  4POG A;  3A5Z B;  1M90 C;  4GKJ L;  1LM0 A;  1N9W A;  3UDI A;  5HGQ A;  1D8L A;  3UE1 A;  3HOZ H;  1PYS B;  5IP7 G;  1YBY A;  1ASY A;  2JA7 G;  1J6Q A;  3UDF A;  4GOP B;  1VQ9 A;  3T1Y Q;  3PGZ A;  4GLV B;  4R4O A;  1GM5 A;  2OQ0 A;  1N33 Q;  2HIX A;  1JJG A;  4YCU A;  3RLO A;  1TWA H;  4IOC A;  4FDB A;  4DR7 Q;  1E7Z A;  4QQB X;  3OYY A;  4A3L H;  1A63 A;  1K8A C;  1QVC A;  3JC6 6;  2CKZ B;  3RR5 A;  4BBR H;  3KJO A;  4UY8 C;  3U4Z A;  4DR6 Q;  2N8N A;  2MNA A;  4RG1 A;  4DV5 L;  4GOP C;  4A75 A;  3OTO Q;  3CCQ A;  4DR2 L;  1L2F A;  3K8A A;  1N36 Q;  2ALY B;  4JOI C;  5IWA Q;  3S16 H;  2K14 A;  3CCJ A;  1V1Q A;  1AH9 A;  3K0X A;  4ALP A;  4R1J A;  4HIO A;  4A3E H;  3CP0 A;  4O0A A;  2DGY A;  3IRB A;  3F2B A;  2RHS B;  3NEM A;  5GAG C;  2WFW A;  4JI1 L;  3I55 A;  5GAE C;  2LSS A;  2R92 H;  2VQE L;  4DR4 L;  3PUX A;  1JE5 A;  1XJV A;  4P71 A;  1L1O C;  1NY4 A;  1XTD A;  2JA6 H;  4R4C A;  3GTP H;  4OX9 L;  2CFM A;  4QIW E;  3K7U C;  5AJ3 L;  2ZTC A;  4GN3 B;  1PA6 A;  3W5O A;  1UE5 A;  4OWX B;  1HH2 P;  1R9T H;  3H15 A;  4JI0 L;  3CW2 C;  1NMF A;  1EUJ A;  1I5F A;  3CQZ H;  1IXR A;  4JI2 L;  2QGQ A;  1X9N A;  1VQN A;  2VNU D;  5E7N A;  2F4V L;  3HOV H;  3E0E A;  1J5E Q;  1BVS A;  2XGT A;  1HZA A;  4C3I H;  1CKO A;  3WWV A;  3GTK H;  2NN6 I;  1BKB A;  4HIM A;  1XPO A;  3KF8 B;  1CKN A;  1Q1E A;  2VY3 A;  5GAD C;  2HHH L;  1GO3 E;  5BR8 L;  4DV2 L;  4UPA A;  4JI4 Q;  1VQM A;  1HJP A;  3CCR A;  1SFO H;  3KF6 A;  3J7Z C;  1PVO A;  4A3D G;  1VQA A;  3GO5 A;  3STB C;  3M4Q A;  2DUD A;  1I94 L;  2IT1 A;  4GKK L;  5FLX c;  1NMG A;  2ZTD A;  2I5L X;  3FKI G;  3J81 i;  4YY3 L;  4HJ7 A;  1YEZ A;  1IL2 A;  3S2D H;  4L5Q A;  4B3R Q;  3UDX A;  5LMN L;  1IBL L;  4DAM A;  4DV4 Q;  4LF9 L;  2F52 A;  2LXK A;  3PCO B;  4NXM Q;  4KI0 A;  1V43 A;  2Y0S G;  2ZTE A;  1E22 A;  4B3T L;  2VZA A;  3W1B A;  2QA4 A;  1CKN B;  4DUZ Q;  3HOY G;  1Z9F A;  1O7I A;  3HKS A;  1VQP A;  4BY7 G;  4JV5 Q;  1VQ4 A;  4A93 G;  2UUA L;  1VQG A;  3PUW A;  5M5X H;  3KF6 B;  1E1T A;  4JI5 L;  1IBK L;  1T9H A;  5GAH C;  4JI7 L;  3E9H A;  3CF5 A;  1PV4 A;  4LF8 L;  2RF4 A;  5C4X H;  4K0K L;  1LUZ A;  1HNZ Q;  2ZM6 Q;  1XMQ Q;  1MIU A;  2UU9 L;  2VL6 A;  4UP8 A;  2NVX H;  1K83 H;  2I5H A;  2Y0S E;  1GKH A;  1EWI A;  4LF4 L;  4LUV A;  2VQF Q;  2R6G A;  1XNR L;  4GN4 B;  3H3V H;  4A3L G;  1HZ9 A;  1AE2 A;  4DV7 L;  2EQS A;  4BBR G;  1OXV A;  5FJ8 H;  4LFB Q;  4JI3 L;  3CCU A;  4GNX C;  4DR5 Q;  1VQ8 A;  2UXB L;  4QY7 A;  3U50 C;  2NZO A;  3J81 c;  1Q81 C;  3EN2 A;  1UE1 A;  4X66 Q;  5C4J H;  3CCM A;  4AQY Q;  1X65 A;  2WAQ G;  4L5T A;  3PUV A;  2MQH A;  1YIT A;  3F2C A;  2NN6 G;  3CC4 A;  5IYD H;  1XNQ L;  4A3E G;  4YWM A;  3PO2 H;  2PNH A;  1HR0 Q;  1KXL A;  2BH8 A;  2R92 G;  3CCS A;  5DLQ E;  2UUC L;  5GQO A;  2UXC L;  2JA6 G;  2JEA I;  1Q12 A;  1OXS C;  4R4T A;  5JEA G;  2Z6K A;  3VDY A;  4DK3 C;  4LW1 A;  2F3I A;  4LFA Q;  1K3R A;  2WAQ E;  4WJ4 A;  1QVF A;  4DV6 Q;  4IPH A;  3PIO A;  3A5U A;  3CC2 A;  1OXU A;  1N32 Q;  3W1G A;  3H3V I;  1S40 A;  1RIP A;  4EQ5 A;  1PH7 A;  4NXN Q;  5HY6 A;  3HOV G;  4PZ6 A;  3U4V A;  2VW9 A;  2KEN A;  1HR0 W;  2V1C C;  3HFZ B;  1U5K A;  1N33 L;  2Q2H A;  1TWC H;  3TEH B;  3RNU A;  4B3M Q;  1C7Y A;  2L15 A;  4DR7 L;  3GDE A;  5IYC H;  3F1Z A;  3UE0 A;  4JBJ A;  1MJE A;  1MJC A;  2GVB A;  3KOJ A;  4OON A;  4LFC L;  1C0A A;  1YHB A;  3ER0 A;  5IT9 c;  2D0O A;  4DR6 L;  3NEL A;  2AHO B;  1WOC A;  3OTO L;  4A4I A;  1N36 L;  2K50 A;  4A3I H;  2ZJQ A;  5JJK A;  1MKH A;  2VS1 A;  2H5X A;  2I0Q A;  2UUB Q;  4BBS H;  3GTJ H;  4GLX A;  2KCM A;  3DM3 A;  4KHP Q;  2Z6K C;  1WYD A;  1UE6 A;  2Z0S A;  1HNX Q;  4UP7 A;  2HT1 A;  4HIK A;  2K52 A;  2N3S A;  1E1O A;  3PSI A;  2R7Z H;  3DLL A;  3D0F A;  3CMA A;  2EXD A;  4A3M H;  2NVY H;  4DV0 L;  4LNQ A;  3S24 A;  1LTL A;  1XPU A;  2E2I H;  3CAM A;  3L0O A;  1IBM Q;  2YU9 H;  4H02 A;  4LWC A;  4X65 L;  3CCL A;  3FP9 A;  5C4X G;  3AFQ A;  1FL0 A;  1YZ6 A;  1J5E L;  4LUO A;  3S1R H;  4IFD I;  1YNX A;  3G71 A;  2IHE A;  3RLN A;  4JBM A;  2ZJR A;  3BU2 A;  5M3F H;  4JC0 A;  1PH5 A;  1E24 A;  3GD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...