4JI5Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji5Q00
1SLJA 3LGJA 3E0EA 4OONA 5EAYA 1KRTA 4C3JH 1XMQL 1LUZA 3CPWA 4A3IG 2UU9Q 2OQKA 1YJWA 3GTPH 4HJ8A 2C35B 3HOXG 1KD1C 3CP0A 1E22A 1EYGA 2B63H 4EQ5A 2I5MX 4GOPA 4TVAB 1WCMH 4IJLA 1O7IA 4R4IA 1KIXA 5ELOA 1OXSC 2NVYH 1X55A 3W1GA 4UY8C 2VUMG 4KHPQ 1LM0A 2R92G 1X54A 1GM5A 4DV5Q 1GO3E 4LF8Q 3AQQA 3CQZH 4OWXB 1D7QA 3GTLH 1VQIA 4A3FG 4A4IA 1IBKL 3E9IA 4LFCL 4EX5A 3J81c 2WP8J 3RZOH 4JOIC 2Y0SG 3J7A5 3RZDH 4POFA 4LF9L 3S1QH 2ZJRA 3CCUA 2PMZE 4A3CH 4DV4Q 1EWIA 1GVPA 4KHZA 4GN3B 4KLKA 3CXCA 1L1OA 1SFOH 4LUVA 1Y1WG 2UUAL 4KHPL 4JG2A 4JYAL 4UP8A 5C4JH 3J81j 5HY6A 3GDEA 2YTYA 3BZCA 4DV6Q 2UU9L 4R1JA 2JA6H 2MFIA 1PV4A 1IBLQ 1K8AC 1FL0A 2AWOA 3H0GG 5IYBH 1J5EQ 4Y52H 4X66Q 2E2HH 3T1HQ 3KLWA 3J80c 3KFUA 5AJ3Q 2QGQA 4PMWA 1IBMQ 4DV5L 1YZ6A 4YY3L 4LF8L 4PG3A 1KL9A 4A3FH 1N8RC 1L0WA 1N32Q 2BA0A 4GS3A 1QVCA 4UP7A 1K0RA 1XPOA 3F1ZA 2VNUD 3ER0A 1FGUA 4DV3L 3GO5A 1JJ2A 2AKWB 2D0PA 4RMFA 3A0JA 4JBWA 3I4MH 3K80C 2JA7H 2CCZA 4P71A 1U5KA 3A74A 1PA6A 3S1RH 4AQYQ 1KAWA 2NVXH 3UDGA 1A63A 1HZ9A 1T9HA 4JYAQ 1PVOA 2F3IA 3STBD 4HJ5A 2IX1A 2LSSA 4JI3Q 2KHJA 1J5EL 3HKSA 1SMXA 1XPRA 4YHHQ 4X66L 1IZ6A 3FKIH 4X65Q 1VQAA 1YI2A 4R4TA 1R9TH 3STBC 1PYSB 4WJ4A 1X3EA 4X62L 2N8NA 1XMQQ 2F4VQ 2JE6I 4HIKA 3F2DA 3H15A 1PHJA 3U58A 1TWAH 1Q86C 1Q81C 1PH7A 4DK6C 4DV3Q 4BXXG 2NVQH 1W3SA 1MIUA 3K7AH 2V1CC 2WAQG 2K5NA 2D62A 5GADC 4R4OA 2Q2TA 2ZTEA 4AQYL 4JBKA 4KI0A 1IBKQ 1WCMG 5JEAG 4GLVB 2A8VA 3H3VI 4DR7L 5C0XJ 1YBYA 4K0KL 1I50H 1UE5A 4YHHL 3DLLA 1N34L 4BY7H 3GTJH 4QQBX 4QY7A 1VQGA 2QA4A 4A3EG 4B3ML 2OTJA 1X65A 1IYJB 5M5XH 1Q82C 2PQAA 5C4XH 5GAEC 2F4VL 3TS0A 3CD6A 1G291 4XIGS 1E24A 2AHOB 4P75A 5GAGC 2JA5H 2D0OA 2CQOA 1L1OC 1PH3A 3I7FA 1PH6A 1YHBA 4OWTB 3CC4A 4B3RL 3PO3H 3I56A 2JA9A 1UEBA 5AJ3L 1IBML 4IOAA 4QIWE 4JI2Q 3PF5A 3CC7A 3S14H 4A93H 1JB7A 2I5HA 1I94L 1YHAA 2KCTA 3J80i 1YNXA 2JA8G 1N32L 4LFAQ 4DV1L 2UXBL 5IP7H 3PIOA 4X6AH 4LW1A 4L5SA 1B8AA 1SROA 1VQBA 3CW2C 3PSIA 5M3FH 4DR3Q 1XTDA 1V1QA 4P73A 4PZ7A 1N36L 2HQLA 1N34Q 5FLMG 1NMFA 3ICEA 4A3MH 2WAQE 1SN8A 2B29A 3HFZB 1TWHH 2JA6G 5IYCH 2R7ZG 2R93H 1UE1A 3OW2A 2HHHQ 1QUQB 3S16H 2BH2A 3AFQA 2MO0A 2HIVA 1TWCH 2Q2HA 2VUMH 3K7UC 3OTOL 3J81i 2GN5A 1HZAA 3I4NH 1A0IA 1QZHA 4X65L 3ZJYC 4C2MH 1S3OA 3UDIA 2CWAA 4JI7L 4X62Q 1NBWA 4MZ9A 1I94Q 4IFDG 5M5YH 3L0OA 1UE6A 3I4OA 3CCSA 4DV1Q 4LFAL 2UXBQ 2N49A 3HKZE 4DR3L 1WI5A 1Q12A 2K52A 3PCOB 5IP9H 2R92H 4LWCA 3CCEA 3EBEA 3M4OH 2NN6G 4DR6Q 1G51A 4BXXH 2DGYA 3BU2A 3KDFA 1HNXQ 2K50A 1XNQL 3PGZA 2R7FA 3UDFA 1VQ9A 4LF4L 3HOYG 3HOWG 1MJCA 2Q2IA 1N33Q 5JJLA 4GNXB 3KOJA 3KYHC 5GQOA 4DPGA 5IYBG 2VZAA 1TXYA 2RHSB 1CKOA 2E8GA 4L5TA 3KDFB 3T1YL 2HHHL 3PO2G 1PYBA 4K0KQ 3OTOQ 3KJPA 3CAMA 3UE0A 3PUYA 1Z9FA 1YHQA 5FJ8H 4A76A 2UUCL 4B3MQ 2OTLA 3OYYA 2KBNA 3CC2A 4JI7Q 4A3BH 4DAYB 3F2CA 4NXNL 4GOPC 4DAMA 1MKHA 3AFPA 3UE1A 3SGIA 4DR6L 3B6YA 4JBMA 4B3RQ 2MQHA 2PI2A 1EIYB 4DNIA 1XNQQ 5E7NA 3TEHB 4JI2L 3HOUG 2N78A 2A1AA 4IFDI 3NBHB 4QGUA 4OO1G 1H95A 1JJCB 1X3FA 1VQDA 2QEXA 1VQHA 4DUZL 1K8GA 1C7YA 2JJQA 4DR4Q 1ASYA 1K73C 2KCMA 1X9NA 1N36Q 1EFWA 3WWVA 3J7ZC 1AH9A 3PUZA 1VQPA 3KJOA 3ULPA 3CCLA 1VQCA 4ALPA 4HJ9A 3GTOH 1V43A 4DKAC 2JA8H 3F8TA 4GNXA 1NJIC 3CCJA 4PZ8A 5GROA 4JI6L 2RCNA 4UPAA 4NXNQ 4OWWB 2GVBA 4JCVE 5GAHC 3M3YH 2DUDA 4UP9A 2H5XA 2ID0A 2YYZA 3NENA 2YTXA 2FXQA 4R4CA 3RLOA 5C0XG 2VW9A 2VQEL 1B70B 1CKNB 1Y14B 3AEVA 5IYDH 5JJIA 2GVAA 1HZCA 1OTCA 1S72A 3G6EA 5M3MH 5IP7G 2PQAB 3JAMc 3F2BA 1CSPA 2MNAA 4LUZA 1VQ4A 4JI8L 1SR3A 5C3EG 4DUZQ 1C0AA 1W2BA 3I4NG 1VQ7A 4C3IH 1EIFA 1E3PA 4JI4L 4A3LG 3S2HH 2UXDQ 4LF4Q 1VQ6A 3U4VA 3FHWA 4A3KG 3M85A 2E5LQ 2PI2E 4J15A 2A19A 5C3EH 3TQYA 1GD7A 3A5UA 3T1YQ 3CPFA 4JI6Q 2K75A 3PUWA 1PH5A 2ZM6Q 4IO9A 1A62A 2Q2UA 1E1OA 4P74A 4HIDA 3DM3A 3L7ZC 1K9MC 5J3BA 1EUJA 2UXCL 1SRUA 2VQEQ 2UUCQ 3A5ZB 4HIMA 4L5RC 4A3DH 1P16A 4A75A 4HJ7A 1Q8KA 1U0LA 4YWMA 3CMEA 1M90C 1VQNA 1QVFA 1Z47A 1BBWA 4YCVA 4JI1L 1UWVA 1WYDA 3PIPA 2JK8A 2NZOA 3KF8B 3S2DH 3GTKH 1CUKA 3I4MG 1FVIA 2JEAI 1Q1BA 2YV5A 2LXJA 5M5WH 3NEMA 4A3LH 1K3RA 4AH6A 4JI4Q 4DR2Q 1PH1A 3UDXA 3RLNA 1Q46A 2R93G 5JJKA 4A3KH 1KC8C 3ERSX 1B7YB 4P72A 3W1BA 4YWLA 5LMUQ 1HNZQ 4O0AA 1NTGA 2I0QA 4RG1A 1IL2A 1GKHA 2VL6A 2ZM6L 4LF7L 1VQ5A 1JE5A 4IFDJ 1D8LA 3HOUH 2UXCQ 3CCQA 1UE7A 2EQSA 4HJAA 4DR5L 3Q8DA 1PFSA 4H02A 3K0XA 4O2DA 4JI1Q 5IE8A 1CKMA 4GKKQ 2LXKA 4Y7NH 1VQOA 3G48A 1OXTA 1VQEA 1EQQA 1HR0W 3EIVA 3PF4A 1X3GA 4C3HH 2OQ0A 4DR2L 1CSQA 1HNWQ 2NVTH 1V9PA 4GN4B 1FJGL 1X56A 1Y1VG 2Y0SE 1MJEA 2RHQB 4YCWA 2ES2A 4JI8Q 2NZHA 3FP9A 5LMUL 4A3GH 5IY0A 1YJNA 3RR5A 4LNQA 1HNXL 4POGA 2K5HA 4BY7G 2R7DA 3CCRA 1A8VA 3L2PA 4DV2Q 4LF5Q 3HOVG 1QUQA 1KHIA 4LUOA 3RNUA 4BBSG 2UXDL 2JQOA 1WFQA 2KENA 4A3BG 2VS1A 3H0GH 1I5FA 2L15A 2BH8A 3E9HA 2ZJPA 3CCVA 2JA5G 1RL2A 2IY5B 2VQFQ 4NB3A 2E5LL 5IP9G 4DR5Q 2ZJQA 1SE8A 1TWFH 4AYBG 4IOCA 3M4PA 5DLQE 1XNRL 4JI0Q 4AIMA 3PO3G 1OXVA 4FDBA 4A3EH 4GKKL 5FJ8G 4OO1I 2CFMA 4DV0Q 2XTIA 2YTVA 3D0FA 4LF6Q 3MXNB 3G4SA 4A3JG 4NXMQ 4BBSH 3K81C 5IYCG 2R7ZH 3HOZG 3GD7A 4JI5Q 1HNWL 4IPHA 3G71A 4IJHA 4GLAC 4A3GG 3CF5A 3TREA 3PUXA 2E2IH 1XMOL 4OX9Q 2MO1A 3JC66 4MNOA 2IX0A 2F52A 3S24A 1EOVA 1QZGA 3BJUA 4DV2L 4X64Q 2ZTDA 2EXDA 1YIJA 4LF5L 2ZTCA 1VCIA 3U4ZA 4LFBQ 1KXLA 1YVCA 3HKZG 3IRBA 2IHFA 5IWAQ 1TWGH 1L2FA 1VQFA 5FLXc 4IPGA 1VS0A 1X6OA 3M9BA 4TQUS 1YITA 1HNZL 2UUBL 1QVGA 1NMGA 4DV7L 1RIPA 2HIXA 5H1SE 4PZ6A 2ATWA 2OWOA 1AE3A 1AE2A 4DV0L 4LF7Q 4LF6L 3GTGH 1JT8A 1J6QA 3AYHB 3TS2A 1P8LA 4R4QA 5ELNA 1KQSA 3ULJA 5LMNW 4BA1I 1VQJA 2YU9H 3NELA 4A3CG 2XGTA 1PH2A 4AYBE 5BR8L 5IYDG 1XMOQ 2K14A 4OX9L 4GKJL 4A3IH 4BBRG 3HOWH 4A3JH 3HOYH 4GN5A 5C4XG 1N33L 1EQRA 5K36G 1YEZA 3M7NA 4WJ3M 1M1KC 2Z0SA 3GTQH 4LFBL 4L5QA 1IXRA 3S1MH 1FJGQ 4YWKA 4DR1Q 5IWAL 1HH2P 3S1NH 5C0XI 3RLFA 5FLMH 4B3TQ 2UUBQ 4A93G 4IPCA 1YJ9A 3HOXH 5JEAJ 3TRZA 3M4QA 3H3VH 1N9WA 1PH9A 4DR4L 4A3DG 1PH4A 2JEBI 3KF6A 5LMNL 4NPSA 2CKZB 3ULLA 2VQFL 4GOPB 3RN5A 1HR0L 5C44H 3BZKA 1JMCA 1E7ZA 1XNRQ 2KHIA 1Y1WH 4JI0L 3PV0A 2PNHA 4DR7Q 4GKJQ 4NXML 2K4KA 1I3QH 2AWNA 4APVA 3D31A 1VQ8A 2WB1G 2B3GA 4JI5L 1BKBA 4IPDA 5IT9c 1VQMA 3JAMi 2NN6I 1HJPA 3FKIG 4JOIA 5HGQA 1LYLA 4DUYL 4JV5Q 1ASZA 1LTLA 1CKNA 4GNXC 4B3SQ 3EN2A 2I5LX 4ME3A 4B3TL 3I55A 2EIFA 1JJGA 3KF6B 3MEFA 4X64L 4QJFA 3VDYA 4LF9Q 1NE3A 5LMNQ 4OXPA 3K8AA 1WJJA 2OCEA 4DV4L 4JBJA 3U50C 1OXUA 3S15H 4BY1H 3RN2A 5C44G 1HR0Q 1E1TA 2CWPA 4DV6L 4DV7Q 1I6HH 2ALYB 1IBLL 1S40A 2ASBA 2Z6KA 5M3MG 1HZBA 4DK3C 3T1HL 2WFWA 1KRSA 2AMCB 3PO2H 3PUVA 4QL5A 2JA7G 2HT1A 4YY3Q 1VQKA 4YCUA 1OXXK 3W5OA 1VQLA 4DUYQ 1WOCA 2R6GA 5BR8Q 2K5VA 2Z6KC 3CMAA 3HOVH 4JV5L 2N3SA 4B3SL 2RF4A 1NY4A 3I2ZA 2VY3A 2E2JH 1XJVA 2WB1E 1Q7YC 3CCMA 4XTCS 4BY1G 4DR1L 1PH8A 1Q1EA 2IHEA 2BA1A 1K83H 4GLXA 4A3MG 4LFCQ 3GTMH 4MTNA 4BBRH 2B63G 4BA2I 1BVSA 4JC0A 4JI3L 4HIOA 1DGSA 3HOZH 1G6PA 1Y1VH 2IT1A 1C9OA 5M3FG 1BBUA 1XPUA 3S17H 1L1OB 2UUAQ
chains in the Genus database with same CATH superfamily
5E1FA 1SLJA 3CPWA 3H91A 2A6HD 4A3IG 1YJWA 2SNMA 3CP0A 1E22A 4EQ5A 1F9QA 1A6XA 4RHRA 5IOCA 4IJLA 3KBXA 1KIXA 1X55A 3Q23A 2M2LA 3CQZH 3E9IA 4LFCL 4EX5A 5KNDA 1WTXA 2WP8J 3RZOH 3CCUA 3I72A 1D1KA 2PMZE 1PZKD 1EWIA 4GN3B 1ILQA 1V1PA 4HMJA 4TSSA 5C4JH 3J81j 1BCPB 2MFIA 1PV4A 1K8AC 2EY1A 1FL0A 1ML0D 4X66Q 3WDNA 4HAEA 3KFUA 1IBMQ 2GA4B 1S5DD 1EQTA 1PXUA 1YZ6A 3J7AF 1XWEA 4PG3A 4A3FH 4OL7A 1RDPD 3VYRA 2B2TC 4IQZA 4UP7A 3JAME 1AEXA 2D0PA 1BCPF 1BO0A 3I4MH 2CCZA 3S1RH 1A63A 3UDGA 2QW7A 1PVOA 1LTTD 2F3IA 3QOJA 5ELDA 1XPRA 5E4XA 1IZ6A 1HA5A 2EYOA 4R4TA 1PYSB 5KNBA 3OHXC 2F4VQ 2I07B 2JE6I 3H15A 3LX0A 5BN5A 1Q86C 1EY0A 1PH7A 1PRTF 2EY5A 4DA2A 2V1CC 1BNZA 5KYLA 4X3UA 1IYVA 3HGBA 5LL6X 4GLVB 3H3VI 4DR7L 4FXGC 3OW7A 1UE5A 2BE5D 4YHHL 4FF1A 3P75A 2RVLA 1JOOA 5EPKA 4HMIA 1Q82C 1W6KA 5C4XH 5GAEC 1WCMB 3IFDA 1G291 1EY7A 4P75A 3ERQA 3GV6A 1IW7C 2CQOA 4OWTB 1QB5D 5EKKA 3CC4A 4B3RL 1E2WA 1KNEA 3H6MA 1IBML 4IOAA 4QIWE 1QCBD 2B63B 2IJ0A 4LFAQ 2M9VA 4K5XA 1Y8NB 3CW2C 2XN9C 1T5EA 1J9OA 1F2YA 1N34Q 4XQJA 1NMFA 2Q8RE 5ELCA 1GXDC 2B29A 1H9RA 3HFZB 4FNFA 1G6ZA 2R7ZG 2V4DA 5CV6A 3Q6SA 3S16H 2BH2A 2MO0A 1TWCH 1HUMA 3K57A 2VUMH 3R2TA 3IAYA 1HZAA 2PO4A 3R93A 4FYDA 5CV8A 3ZJYC 4C2MH 4JI7L 3M4YA 3FMCA 1DYQA 2SEBD 5C6AA 3SK8A 3L0OA 4DV1Q 2UXBQ 1KDAA 4DR3L 1WI5A 1Q12A 5IP9H 1NR2A 3CCEA 4C3IB 4BXXH 2NN6G 2BE5C 3HOYG 1I6VC 2Q2IA 3KYHC 4DPGA 4DR7Q 4KMUC 3PO2G 3T4AC 1PYBA 3PIO3 1JORA 3OTOQ 3I4LA 4BY7B 2UUCL 1KAAA 1LTAD 3OYYA 3CC2A 2HDLA 3OIQA 3MVVA 4DAYB 2RDHA 1YNNC 1V8QA 3IKJA 1MKHA 4I7ZC 3AFPA 1TVXA 3UE1A 3SGIA 3B6YA 4B3RQ 4IFDI 2N78A 1H95A 3NBHB 5G3LD 1X3FA 1F2ZA 4F87A 3NK9A 1ENFA 4DFAA 4ZLTF 2QDBA 4DR4Q 1RKNA 4U673 1GOZA 2KCMA 2SNSA 1SJHD 3ULPA 1KDCA 3I73A 3CCLA 1VQCA 3VR6A 2F1MA 1V43A 4HJ9A 2TMPA 4MTKA 2VB3X 1Y69U 5FO7B 2F0TA 2A68C 4S3SA 1CQVA 4ULLA 3M3YH 2YTXA 3AEVA 3DEOA 5JJIA 1CKNB 2GVAA 2EY6A 2F0NA 3G6EA 3JAMc 3BG3A 2FINB 4LUZA 2QEJC 3AMUA 1SR3A 2PZUA 1C0AA 1VQ7A 1CHQD 4KKTA 3SDZA 4C3IH 4C2MB 5EBDA 1VQ6A 3U4VA 1B50A 3SK5A 3M85A 4FXKC 2PI2E 3I4NB 3NBIA 5C3EH 1TWGB 3CPFA 1JOKA 3PUWA 4JW0A 1A62A 3DM3A 1EUJA 1SRUA 2UUCQ 4HSPA 4YWMA 1M90C 1VQNA 1UWVA 1IHZA 2JK8A 1DOLA 1JWMD 2A69D 3S2DH 5M5WH 4IZ8A 2BCOA 3S2HB 4G7HC 4UDUC 2DY7A 1Q46A 2JXMB 2R93G 4A3KH 3ERSX 5HURA 3E5SA 3NE5B 2NVXB 4MIUA 1IL2A 3TMEA 1B44D 2L11A 1UE7A 1F2LA 3DWAA 3J81L 2KHSA 3K0XA 2ZT9C 1VQOA 1VQEA 5LL6S 2MUYA 3HG9A 4C3HH 4DR2L 4BBSB 1CSQA 2AQ3B 3U9OA 3RZOB 1HNWQ 3TN2A 3RMHA 1TT2A 1V9PA 3G6JB 3AB9A 5LMUL 4A3GH 1YJNA 3K7AB 3RR5A 2K5HA 2RSNA 5FOBB 3LWEA 4DV2Q 3L2PA 1QUQA 1HFNA 1LTID 1SNMA 3RNUA 4BBSG 2NB0A 3HRZC 2JQOA 3VA5A 2KENA 4A3JB 2VS1A 2G9DA 1RHPA 4WJ4A 2L15A 3E9HA 3FDTA 2ZJPA 3C1FA 1RL2A 3S16B 3OPOA 4AYBG 4IOCA 3ZYYX 4JI0Q 1OXVA 1SNQA 5FJ8G 4M1UB 2CFMA 4NXMQ 3G4SA 2K5DA 3K81C 5IYCG 5A2QE 1EU4A 3HOZG 4RGMA 4JI5Q 4F88A 1QNKA 4IPHA 4IJHA 3HKZB 4A3GG 3WOEA 3TREA 2HCIA 4L6TB 3CKIB 2MO1A 1QZGA 4IUTA 1D5MC 4G57A 4LF5L 2ZTCA 4HEDA 4ZUJA 3U4ZA 1ICFB 1EWHA 5IWAQ 1TWGH 4DF7A 5FLXc 3M9BA 3VYSA 1YITA 2HCCA 2UUBL 4DV7L 1RIPA 1ICWA 3M7GA 5FO9B 1TWHB 2OWOA 4LF6L 3GTOB 3AYHB 3TS2A 3ULJA 4BA1I 1VQJA 4CDFC 2F0LA 4QUCA 3NWTA 4AYBE 4FF3A 4JPBW 3VR2A 4GKJL 4BBRG 3HOWH 4A93B 2Z8LA 5IT9L 4A3DB 1I3QB 1EY5A 3MC0B 1R4PB 1B3AA 3S1MH 5DEHA 1HCZA 3A54A 2EYMA 4B3TQ 4LK1C 1LABA 3HOXH 3M4QA 1STHA 1WTOA 1PH9A 1CZWA 3H3VH 4RCOA 2JEBI 3KF6A 5LMNL 2B2UA 2EE1A 2Z1CA 5JVH3 3ULLA 4XYOA 3BZKA 1Y1WH 4JI0L 1NCVA 2DJGC 1IL8A 2K1BA 1DJRD 4NXML 2NVTB 2SOBA 2K4KA 2HD3A 3F2UA 4JI5L 1H9JA 1PZJD 3JAMi 3EQLC 1LYLA 2NN6H 3E6ZX 1LTLA 1CKNA 1WTRA 4ME3A 4OO1H 1TKWB 2EIFA 4QJFA 3VDYA 4X3KA 1NNXA 4DNRB 2EYJA 1TU2B 4IUUA 2OCEA 1QJOA 3S15H 1HR0Q 5CR3A 2CWPA 4DV7Q 1I6HH 2Z4HA 1IBLL 3R8BA 2WIIB 1X3QA 5M3MG 1HZBA 1DOMA 3T1HL 2WFWA 3PO2H 2X69A 2PMZB 1JWSD 1K83B 5KYIA 4O1NA 4DN4M 4DUYQ 4JV5L 3CRLC 2K5VA 4ABNA 1I6HB 2LS01 1XJVA 2WB1E 2LFNA 3CCMA 4BY1G 3FRPB 3KBGA 1K83H 5C5LA 4GLXA 4IURA 4A3MG 2E75C 4BBRH 4BA2I 4JC0A 4JI3L 2CHBD 3H09A 5C5MA 3K5NA 1WD0A 4K8IA 3K5MA 3S17H 2UUAQ 4KHPQ 3LGJA 1SMYD 5EAYA 1KRTA 1LUZA 3GTPH 1BCPC 3TP8A 1VMCA 2C35B 2O4XA 3CHBD 3HOXG 1EYGA 2B63H 4TVAB 5JPNC 2HUGA 3RD4A 1RTNA 2VUMG 3BVGA 2R92G 3S17B 4DV5Q 3QOLA 4LF8Q 4A3IB 3NUCA 3J81c 4B9WA 3RZDH 2ZJRA 1QE6A 1TWAB 4A3CH 4KLKA 1KTKA 1L1OA 4C3IG 5I9OA 1Y1WG 4QF4A 1ET9A 5C4XB 1DOKA 3SE0A 2K04A 2YTYA 3BZCA 2JA6H 4R1JA 2MJ8A 1IBLQ 1GUGA 4Y52H 5M9OA 5I6WA 4DU9A 3T1HQ 2CH4W 3KLWA 3PO2B 2KA7A 3SVMA 4EQPA 4OIJA 1KL9A 2A68D 4KHVA 5K5PA 1QVCA 5ELFA 1G8ZD 1BF4A 1JJ2A 4DV3L 1M8AA 3EJIA 3K80C 3D8GA 1U5KA 4AQYQ 1HZ9A 3T56B 2EYFA 4CGYB 4TRDA 4HJ5A 2LSSA 3EA6A 4JI3Q 1ENAA 3HKSA 5FKAC 4X66L 2O2LD 3FKIH 1U4MA 4X65Q 3U9SA 1YNND 2Q8TA 2KECA 2QKIC 1PHJA 5CV5A 1F9PA 4LAAA 4DK6C 1RF2D 1PRTD 5GADC 2ZTEA 1KABA 3GP7A 4KI0A 1WCMG 5JEAG 2A8VA 5C0XJ 3CU7A 1YBYA 1I50H 2F0KA 1DM0B 1PYWD 3DLLA 4BY7H 1Q90A 1VMPA 4K8JA 3GTJH 4B3ML 2QA4A 4MN3A 5M5XH 1TS3A 2F4VL 3CD6A 1D6EC 3E3XA 4XIGS 3A8IE 2EYPA 3DHQA 1U4LA 3QB3A 3J7YW 1EZ6A 1PH6A 5DM63 1K3BC 1O78A 3GTJB 2B2WA 1LTGD 1ZXTA 1UNSA 2EJMA 3CC7A 3S14H 2KCTA 1YNJD 2JA8G 3PIOA 4LW1A 4L5SA 5M3FH 1XTDA 1V1QA 4PZ7A 1N36L 2X6LA 4OEMB 2WAQE 2AQ2B 4RGNA 1EYAA 1LT6D 1UE1A 1GHKA 2OXPA 2HIVA 2Q2HA 5D65A 3K7UC 3TP5A 4X65L 5J22A 1CA5A 1RCVD 4ILWA 5M5WB 1S3OA 3UDIA 1WD1A 3HOYB 1CI3M 4IUPA 4MZ9A 4N8X1 1PFNA 5FO8B 5M5YH 4LFAL 3NTHA 3CCSA 3MXGA 3MXPA 1SJED 3M4OH 1AZPA 4LWCA 4DR6Q 4ZCKA 1H9MA 2EYHA 2K50A 2R7FA 2F0GA 5JJLA 4DAPA 3A8JE 5GQOA 2RHSB 2F0JA 2QF7A 3KDFB 1WTVA 1SNPA 3CQZB 3UE0A 1Z9FA 1YHQA 4A76A 4B3MQ 4JI7Q 1JE4A 4FVMA 1EL0A 4NXNL 4Z9CB 1U4PA 2EPBA 3ONAB 4JBMA 2PI2A 1EIYB 4JVZA 3TEHB 3HOUG 4OO1G 2A1AA 4QGUA 1ENCA 1VQHA 4DUZL 1K8GA 1TS4A 3QIAA 2I46A 1K73C 1STYA 2D9UA 5C4ZA 1N36Q 1EFWA 3WWVA 2MP1A 3NHHA 3PUZA 3KJOA 2F0UA 5ISRA 5I4DA 2F3WA 4ZKCB 4GNXA 1VF7A 3GQBA 4HTHA 1Z7TA 4JI6L 4UPAA 4JCVE 5GAHC 2DUDA 3D4RA 2YYZA 4R4CA 2FXQA 3RLOA 4RAUC 1HZCA 1EEFD 5M3MH 1ONLA 2AQ1B 1S5BD 1ZYRD 3SK6A 5M5YB 1W2BA 5JAVA 3I4NG 1XX8A 1QOHA 1EIFA 4JI4L 4A3LG 3S2HH 3BS1A 4HSVA 2E76C 2NTSA 5AFWA 3PMFA 2KVMA 3FPUB 2EYLA 3KLSX 3W2DA 5EPJA 3TQYA 2K75A 2ZM6Q 1I4HA 4HIDA 3Q0AA 3L7ZC 2UXCL 1SEBD 1K9MC 2KEDA 4L5RC 4A3DH 3A5ZB 1P16A 4HJ7A 1Q8KA 3CMEA 1A15A 2R93B 5JJZA 1BBWA 4JI1L 3LNNA 2NZOA 3KF8B 4KK7A 3TP6A 3GTKH 3I4MG 2LXJA 1PZID 2DJFC 3NEMA 1K3RA 4AH6A 3J80L 4C3HB 1PH1A 1A3UA 1JWUD 5JJKA 1B7YB 4YWLA 1NTGA 4CHTB 1TWFB 2PNRC 1CFMA 2I0QA 4RG1A 2VL6A 4LF7L 1I4RA 1VQ5A 4J1MA 1JQYD 3I3CA 3HOUH 2EQSA 4HJAA 2F4IA 3RZDB 4DR5L 3NP8A 4H02A 3TDQA 5IE8A 4GKKQ 2L0CA 2LMCB 1OXTA 4OGQC 2Z6BA 5C44B 1FD7D 1HA6A 4GN4B 1Y1VG 4YCWA 3S1NB 3EVQA 1A2UA 5C3XA 5IY0A 4AYBB 1HNXL 3CCRA 1ESRA 1CT1D 2NYZD 4LUOA 1SE4A 5CV7A 3H0GH 3H94A 1Y1VB 1VF5C 3C46A 3KUPA 3CCVA 4NB3A 5JOBA 1XNRL 2F0FA 4AIMA 3P7JA 4FDBA 4DV0Q 4A3JG 1NAPA 1HNWL 4XQQA 4DAYA 3W3AA 4V190 4ZK9B 4OX9Q 4MNOA 2IX0A 3BJUA 3K5OA 2F0IA 2ZTDA 2EXDA 3DEPA 4R9WA 4DV2L 5IIFA 1VCIA 2F0HA 1KXLA 4G7OC 1RODA 1YVCA 2IHFA 3SR1A 1L2FA 1HRJA 4TQUS 3E0JA 1QVGA 3LWUA 3D6WA 4K5VA 4PZ6A 2RCFA 1TS2A 2VB2X 4LF7Q 3GTGH 1AE2A 3C1EA 1P8LA 4XT1B 5ELNA 2B2YA 2Y0SB 5LMNW 1STNA 2LKVA 4FF4A 2O5JC 3QR8A 5CMDA 2K14A 4DK1A 1Y1WB 2G9HD 1UAPA 4A3IH 2EJGC 1LLRD 2A69C 1MSHA 2Z0SA 4L5QA 1XXGA 1IXRA 3ND8A 5IWAL 1HH2P 5J39A 3VA7A 3S1NH 1DZ1A 5C0XI 3RLFA 5FLMH 4BBRB 2UUBQ 4A93G 2JSOA 4NPSA 2CKZB 3GTQB 1I4XA 2WB1B 3RN5A 5CBEE 4MHEA 4CDDC 2BOSA 1JMCA 1XNRQ 2X6GA 3PV0A 4GKJQ 2N55A 1B9NA 1CZGA 3OIPA 2B3GA 1BKBA 4IPDA 4H44C 3FKIG 4KD3A 1U9RA 3TZUA 4F8MA 3GTLB 4QIWB 4B3TL 3I55A 1JJGA 3MEFA 1II3A 1NE3A 5LMNQ 4OXPA 4XYQA 2KOLA 1IYUA 1KDBA 5C44G 4WJWA 2XSCA 4DV6L 2ALYB 1GJXA 1LTSD 1MHWC 3TSSA 3PUVA 4FF2A 2E2DC 2K03A 1VQKA 4BY1B 4PNYA 4YCUA 1VQLA 1WOCA 4L8JA 3HOVH 2Z6KC 4CJ2C 4CJ1B 3CMAA 2CW0C 4ZAIA 2RF4A 5C4JB 1NY4A 3I2ZA 5C4HA 1Q7YC 2F0SA 3T13A 1WTWA 3H3VC 1A3TA 2B63G 2F0PA 1DGSA 1G6PA 3BDCA 1C9OA 5M3FG 4U68A 1XPUA 4K14A 5TSSA 3VYUA 3N6RA 3E0EA 4NKLA 4OONA 3X3NA 2UU9Q 2OQKA 3HP3A 2JA6B 4GOPA 5KRUA 1O7IA 2YU9B 5ELOA 1OXSC 1W6JA 3W1GA 1C8CA 1LM0A 1X54A 1GM5A 1O80A 1GO3E 3P20A 3Q22A 3GTLH 1VQIA 2NUCA 4A4IA 1IBKL 4ZQ3A 3J7AV 1BXTA 5F2DA 3NXWA 4JOIC 4POFA 3H0GB 4RHSA 1GVPA 1JT8A 2UUAL 4KHPL 3MXNA 4JG2A 4JYAL 2XNAC 2KCCA 1PRTC 3GDEA 4DV6Q 4KKUA 5KGUA 1EY9A 2AWOA 1J5EQ 1STEA 2E2HH 3J80c 2A5HA 5AJ3Q 4PMWA 4DV5L 2K05A 4LF8L 1L0WA 4GS3A 1XPOA 2F0MA 2VNUD 3D3RA 3ER0A 2Z4IA 3GO5A 3K6OA 2AKWB 4RMFA 3MXUA 2JA7H 1AFPA 2E2IB 3A74A 4NP5A 1LT5D 3GTMB 1MGSA 1EFID 3I70A 1SMXA 3DUZA 5J1ZA 5D3DA 5HGTA 2EJFC 3N52A 1YI2A 3STBC 4K6LA 5C0XH 1X3EA 2WAQB 2N8NA 2VXWA 4KTAA 1PRTB 2EOTA 1DCZA 3F2DA 1PTOB 1S5ED 4RWSC 3U58A 3BYYB 2JYOA 2G5DA 4DV3Q 4BXXG 2NVQH 1MIUA 1RTOA 3K7AH 2H1EA 4R4OA 2KEEA 2Q2TA 4AQYL 1O7YA 1IBKQ 1SBBB 1KLUD 4PQXA 4K0KL 1FYCA 2K6AA 5NUCA 1E2VA 4QQBX 4N9PA 1VQGA 4QY7A 2XRSD 4A3EG 2OTJA 1SYEA 1S5FD 2PQAA 3TS0A 3VR3A 5GAGC 2JA5H 2IWHA 1I4GA 1PH3A 4K5WA 4NMZA 1ZKOA 3I7FA 1YNJC 1YHBA 3BYTB 3I56A 5AJ3L 3PF5A 3J80E 1Y8PB 1JB7A 2I5HA 1I94L 1YHAA 5IP7H 4X6AH 1B8AA 1SROA 1VQBA 3PSIA 3BDLA 1I4QA 1HTPA 2HQLA 2L55A 1EOTA 4IUNA 4A3MH 2D5DA 3SK4A 3HOXB 1PTOD 2BDNA 3OW2A 5EKIA 2HHHQ 3T51B 3AFQA 5ELEA 4RFBA 3J81i 1A0IA 5ELBA 1SNOA 2EVBA 3I8ZA 2R7ZB 1A3VA 2CWAA 4EGVA 4C1NK 3DXJC 3HOWB 2WKCA 1E2ZA 2ENBA 3HKZE 1EEID 3OMGA 3EBEA 5KIXA 1G51A 3DWQA 2DGYA 3D4WA 1XNQL 1HXYD 3PGZA 3UDFA 1VQ9A 5EPLA 4LF4L 1MJCA 4H0LC 1Y8OB 3KOJA 4EQNA 5IYBG 1TXYA 2VZAA 2E8GA 3A8KE 2RQXA 3D4DA 4K0KQ 1DXMA 4KKSA 1TR5A 3CAMA 3PUYA 1GUNA 5IGBA 2OTLA 5K36H 4A3BH 4CKCA 4DNTB 4JK1C 1LT4D 4DAMA 2JA5B 4K6DA 3C3LA 1K28A 4H13C 1Z6HA 4DR6L 2MQHA 2FMCA 5E7NA 4J6HA 1JJCB 1VQDA 1CA6A 2ZXRA 1TS5A 1C7YA 1SXTA 2B2VC 2QILA 3HOUB 4NW2A 2R3ZA 1PMRA 4DKAC 5C3WA 2OT2A 1V1OA 1TY2A 3CCJA 4PZ8A 5I9PA 1XYIA 2RCNA 4NXNQ 4Y7NB 4OWWB 2IL8A 3P1HA 4UP9A 2DNCA 3D6CA 2ID0A 3NENA 3RUZA 5C0XG 5IYDH 2VQEL 1B70B 1Y14B 1WTQA 2FMMA 5IP7G 2PQAB 1PTOH 1BQQT 1CSPA 1CTMA 1SDFA 3KLSA 3O13A 4RGTA 4Q5VA 2RA4A 4JI8L 1VQ4A 1NUCA 4DUZQ 3NQIA 2NVQB 4K2LA 1BCPD 4PMCA 4FXDA 2UXDQ 3MAQA 1ZYRC 1WTHA 1LTBD 4LF4Q 3FHWA 4JI6Q 1GD7A 3A5UA 4DXFA 1PH5A 2Q2UA 4IO9A 1LTRD 4RCNA 3G7LA 1A2TA 4HIMA 3KF8A 3J81E 1Z47A 4YCVA 1WYDA 2K01A 3I90A 1EIGA 1CUKA 1FVIA 3T16A 4C3JG 5T1GA 4A3LH 1ZEQX 4G7ZC 4JI4Q 4I7AA 1EY4A 3RLNA 2KJXA 2EXZA 3QJYA 1KC8C 3W1BA 4O0AA 1UEAB 3MHBA 2N88A 4C3JB 1R4QB 1AP0A 4QB4A 2ZM6L 1JE5A 4IFDJ 1D8LA 2UXCQ 4IFDH 3GV3A 2XVSA 1DD2A 3EROA 1SE2A 1D5XC 4O2DA 4JI1Q 1CKMA 4Y7NH 3G48A 4KJOA 5IODA 1EQQA 1X3GA 2OQ0A 4TKOB 3QG1A 1X56A 2Y0SE 1J8IA 3KLRA 1QILA 3KK7A 5IGFA 4JI8Q 2NZHA 1B4OA 4BY7G 4POGA 2R7DA 4CKEA 3HOVG 2HDMA 2UXDL 4XT3B 1WFQA 2ZXOA 1I5FA 3SXHA 2BH8A 1QG7A 4DR5Q 4LMQD 3M4PA 3NTIA 1B2TA 3PO3G 3HOVB 4GKKL 1GUWA 1KNAA 1D2BA 3MXNB 4FP5D 5FK9C 1QWYA 4B9XA 2K28A 3GD7A 3FPPA 3G71A 4ODGA 3VR5A 2C5CA 4GLAC 3CF5A 2E2IH 1XMOL 5EKLA 2F3VA 1HNXQ 3S24A 1N33Q 1YIJA 1PFMA 4LFBQ 3IRBA 2DY8A 4X3SA 1B9MA 1D5ZC 1V1PB 2J0TD 3BZDB 1X6OA 2P5ZX 1S5CD 3L9AX 1LV9A 5G3LF 1UUPA 2HIXA 1SSOA 4DV0L 4DK0A 1CK1A 1J6QA 1X32A 4IN3A 4R4QA 3R3OA 1JC7A 5C3EB 3MA2B 2YU9H 4IUVA 3GTKB 1PH2A 4HN7A 1IKLA 5BR8L 1SNDA 4OX9L 2FFKB 4A3JH 4GN5A 5C4XG 3HZXA 1EQRA 1M1KC 4KY5A 2FJ2A 1E0BA 3GTQH 4P2CB 4YWKA 3S9WA 3Q24A 5E3FA 1MI2A 4IPCA 2K5QA 2Q8IB 3TRZA 4A3DG 1PH4A 2K33A 3IFTA 2WINB 4XXEA 2MHVA 4C1NI 4N8FA 4GOPB 3X3MA 5C44H 4L63B 1NSNS 2F0WA 2KHIA 3S2DB 2WKDA 4C3HG 1GUTA 1VDZA 5IT9E 1ILPA 2AWNA 3PIP3 2A6HC 5IT9c 1BDOA 4IALA 1EU3A 1Q3LA 1SMYC 4JOIA 5HGQA 1T5XD 2PQEA 1ASZA 1B1ZA 4GNXC 2B2TA 4B3SQ 2I5LX 4DXGA 3IL8A 3NBHA 4LF9Q 4KY7A 3K8AA 3FKIB 1GUOA 1WJJA 4DV4L 2IW3A 2NWGA 4C56C 2KCNA 4WFN3 4BY1H 1E1TA 1CQFA 5IGDA 1PTOC 4UHVA 5FLXL 1H9KA 2O5IC 1SYGA 1S40A 1H9SB 2Z6KA 2LY7A 4DK3C 4OHJA 2PW5A 2AMCB 2MPMA 1JICA 4EQOA 1X3PA 3ND9A 2HT1A 4YY3Q 2KUMA 2D2CC 3SHLA 2R6GA 3BVZA 5BR8Q 4A3EB 4ID6A 4H7BA 2VY3A 4ZUIA 2E2JH 4RA8A 2JA7B 5EQ0A 1PH8A 1Q1EA 2IHEA 1L0YB 4LFCQ 3GTMH 3V05A 4MTNA 4IUQA 1BVSA 3A7AB 4PMBA 1LACA 4RH6A 1Y1VH 2IT1A 2IPKD 4DGZA 2PYKA 4BWGB 2A6EC 1L1OB 2B39A 3M3YB 4EVOA 3M4OB 1IKMA 4C3JH 1XMQL 4HJ8A 4A3FB 1KD1C 2I5MX 4FO2A 1WCMH 5JEAH 4R4IA 3S1QB 4UY8C 2NVYH 4QUFA 1PLFA 2EDGA 3AQQA 1D7QA 4OWXB 4CBVA 2BDOA 5EJWA 4A3FG 1EY6A 2Y0SG 3J7A5 4LF9L 4M8AA 4R8NA 3S1QH 5EGTA 2ICEC 4DV4Q 4KHZA 3CXCA 4I65A 1SFOH 4LUVA 4O42A 2IX3A 1GHJA 4UP8A 2UU9L 5HY6A 1C4QA 1MD2D 5D3IB 3TZDA 3H0GG 5IYBH 5CC4A 2A73B 1ESFA 1MBYA 2QGQA 1EIHA 2CVRA 4YY3L 1XTCD 3HEJA 1N8RC 3BDOA 1N32Q 1PTOF 2BA0A 3NTKA 1K0RA 4CJ0B 1G2TA 3F1ZA 1FGUA 1K0SA 4YIJA 3A0JA 3OMCA 4JBWA 4P71A 1PA6A 2NVXH 4K2KA 1FR3A 1KAWA 1T9HA 4JYAQ 4BS9A 1ET6A 3STBD 2IX1A 4CDCC 2KHJA 1J5EL 4YHHQ 1VQAA 1R9TH 1G91A 4X62L 1XMQQ 4HIKA 3OWFA 2AUKA 2M00A 5JVG3 5I2XA 3JAML 4XDXA 2JP1A 1TWAH 1Q81C 1U4RA 5DNFA 1W3SA 4OELB 2DN8A 2C9OA 2SDFA 2WAQG 2K5NA 2D62A 5DM73 1WTPA 3VR4A 5T1IA 4JBKA 4LJZC 1RD9D 2PPBC 4RGOS 2XIWA 1BBXC 2CW0D 1FNVA 2OF1A 5A35A 1M4VA 1N34L 1X65A 1IYJB 2JA8B 1E24A 2AHOB 2PCFB 2D0OA 2DNEA 1L1OC 3S1MB 5JPMC 3PO3H 2JA9A 1UEBA 4Q0FA 2EY2A 4JI2Q 4A93H 5I6YA 3J80i 1YNXA 1N32L 4DV1L 2UXBL 4RKLA 3C2PA 1TY0A 2MGSA 4DR3Q 1SFOB 4P73A 5FLMG 1F2MA 2RBMA 3ICEA 3I4MB 1SN8A 1TWHH 2JA6G 5IYCH 1F9RA 4WORA 1GUSA 5BN3A 2R93H 1QUQB 4KY6A 1PFBA 1HUNA 3EFXD 1STAA 3OTOL 3MFYA 2GN5A 4B08A 1QZHA 3K0YA 2F03A 4X62Q 1NBWA 1I94Q 2H4OA 4IFDG 4HR7B 1UE6A 3I4OA 2N49A 3I4NH 3PCOB 2RKSA 2K52A 2R92H 2L5TA 4X3TA 1R9TB 4N9TA 3BU2A 3QO2A 3KDFA 3AU7A 3HOWG 2F0VA 4GNXB 3A56A 1BR9A 2A6ED 1YJ9A 1FNUA 4DR4L 2HHHL 1CKOA 1B53A 4L5TA 3T1YL 4ZKBB 3KJPA 1AW7A 5FJ8H 2B2WC 2KBNA 1G2SA 3F2CA 4GOPC 2NZ1D 1O7ZA 3V2TA 3PO3B 2RSOA 2QDLA 4DNIA 1XNQQ 4JI2L 2CQAA 2QEXA 3HOZB 4KD4A 2R61A 1K8MA 2RDGA 1STGA 2JJQA 1ASYA 1X9NA 2XWJB 3J7ZC 1AH9A 4F7XA 4ZRZA 1VQPA 4ALPA 2QCPX 3GTOH 2JA8H 3F8TA 4QMGA 2KQ3A 1F9SA 5IGEA 1NJIC 4OIKA 5GROA 2GVBA 2H5XA 3QWNA 2VW9A 3BVMA 1OTCA 1S72A 5IGGA 3F2BA 2OEOA 3L3OC 2MNAA 4A3KB 1EWCA 5C3EG 2WACA 5CV4A 5IGCA 5CBAE 5I2YA 1E3PA 4KN4C 1F77A 2PW7A 5E4WC 3GTGB 5KEEA 3NPPA 4A3KG 2ICIA 2E5LQ 4J15A 3TP7A 2A19A 1JB3A 4RKBA 3T1YQ 1SE3A 1B3QA 1E1OA 4P74A 5J3BA 2EZVA 2VQEQ 2NBFA 2K32A 4A75A 1U0LA 5D14A 4QCLA 1QVFA 3PIPA 3DMUA 2JEAI 1Q1BA 1LT3D 2YV5A 3FEWX 5M5XB 1BOSA 1Q8IA 1BUVT 4DR2Q 1CM9A 3UDXA 2F0OA 4ME5A 1HQMC 3K59A 4KJNA 4P72A 5LMUQ 1HNZQ 1SYCA 5BN4A 1HFGA 3WOFA 1GKHA 1K8OA 3MEHA 5CYUA 3CCQA 1RJTA 2F0QA 3Q8DA 1PFSA 2XWBB 3V96A 1DONA 3S15B 2K7VA 2LXKA 3GTPB 1HR0W 3EIVA 2TSSA 3PF4A 1FGBD 5A2QL 4PV1C 2NVTH 1OO9B 2J4XA 1FJGL 1MJEA 2CH4A 3NQTA 2RHQB 2ES2A 1KLGD 3FP9A 3T53B 4XQNA 4LNQA 1TIID 2B2VA 1EYCA 1A8VA 4CKBA 4LF5Q 1KHIA 3MFGA 4NDXA 1EYDA 2NTTA 4A3BG 5LHY1 3A7LA 2JA5G 2IY5B 2B8FA 2VQFQ 2E5LL 5IP9G 2ZJQA 1JCKB 1SE8A 1TWFH 3PQIA 4E6IA 5DLQE 4A3GB 4KN7C 3TBIB 4A3EH 4OO1I 2XTIA 2YTVA 3D0FA 3CRKC 4LF6Q 4BBSH 3OWEB 2R7ZH 2E2JB 1STBA 2B8GA 1JOQA 5M3FB 4DAVA 3PUXA 1FNWA 3MWYW 3NWSA 3JC66 2F52A 3S14B 1EOVA 1MSGA 4X64Q 4J8QA 3HKZG 3MTSA 4WRDA 1TWCB 1VQFA 3ITPA 4IPGA 1VS0A 5COYA 2FHTA 4R8IA 1HNZL 2VUMB 2R92B 1I4PA 1NMGA 5H1SE 1IW7D 2ATWA 2L1BA 1AE3A 3SEBA 3DWPA 1EZ8A 2Z9HA 2E74C 4V0BA 1KQSA 2F0EA 2XRQD 3R2IA 4A3CG 3NELA 2XGTA 3DM1A 5L37A 5CGKA 1S4ZA 5IYDG 1XMOQ 2J7ZA 3HOYH 1N33L 1H9SA 1C48A 5K36G 1YEZA 3M7NA 4WJ3M 1QNUA 4GZYC 2E2HB 4LFBL 1FJGQ 4CDEC 4DR1Q 2B2UC 3K5LA 2A74C 3UI2A 2PZTA 2RDFA 5JEAJ 1TQOA 1N9WA 2HQEA 2L9HA 4KV6A 1WVLA 5KNCA 1SAPA 1AN8A 2AUJD 2VQFL 1HR0L 1E7ZA 2JN4A 2PNHA 1SYDA 2K5WA 2L4NA 4G4KA 3OOCA 1SNCA 1HHVA 1I3QH 4APVA 3D31A 1VQ8A 2WB1G 2WV6D 2ZXPA 4ZYSA 1VQMA 2NN6I 1HJPA 5CORA 1I50B 1AZQA 1O7LA 4DUYL 4JV5Q 3EN2A 1SYFA 3KF6B 3OSOA 4X64L 1HTLD 4UAIA 3NSWA 3URYA 1JR0D 3A55A 4JBJA 3MZ5A 3U50C 1OXUA 3RN2A 5DAUA 2ASBA 1CHPD 1KRSA 4QL5A 2JA7G 1LO5D 2F0DA 1OXXK 4HCSA 3W5OA 3S1RB 4A3MB 2N3SA 4B3SL 2B2YC 4A3BB 5EBCA 5M3MB 3I91A 1EY8A 1PDQA 1SYBA 2NVYB 3VYTA 3HS0C 2PZWA 4DR1L 4XTCS 4HCEA 2BA1A 1L0XB 1EQVA 2L12A 5FLXE 4HIOA 1NR4A 3K58A 3HOZH 1D1IA 3FVQA 1HQRD 1BBUA 5CV9A 1HPCA
chains in the Genus database with same CATH topology
1SLJA 3LGJA 3E0EA 4OONA 5EAYA 1KRTA 4C3JH 1XMQL 1LUZA 3CPWA 4A3IG 2UU9Q 2OQKA 1YJWA 3GTPH 4HJ8A 2C35B 3HOXG 1KD1C 3CP0A 1E22A 1EYGA 2B63H 4EQ5A 2I5MX 4GOPA 4TVAB 1WCMH 4IJLA 1O7IA 4R4IA 1KIXA 5ELOA 1OXSC 2NVYH 1X55A 3W1GA 4UY8C 2VUMG 4KHPQ 1LM0A 2R92G 1X54A 1GM5A 4DV5Q 1GO3E 4LF8Q 3AQQA 3CQZH 4OWXB 1D7QA 3GTLH 1VQIA 4A3FG 4A4IA 1IBKL 3E9IA 4LFCL 4EX5A 3J81c 2WP8J 3RZOH 4JOIC 2Y0SG 3J7A5 3RZDH 4POFA 4LF9L 3S1QH 2ZJRA 3CCUA 2PMZE 4A3CH 4DV4Q 1EWIA 1GVPA 4KHZA 4GN3B 4KLKA 3CXCA 1L1OA 1SFOH 4LUVA 1Y1WG 2UUAL 4KHPL 4JG2A 4JYAL 4UP8A 5C4JH 3J81j 5HY6A 3GDEA 2YTYA 3BZCA 4DV6Q 2UU9L 4R1JA 2JA6H 2MFIA 1PV4A 1IBLQ 1K8AC 1FL0A 2AWOA 3H0GG 5IYBH 1J5EQ 4Y52H 4X66Q 2E2HH 3T1HQ 3KLWA 3J80c 3KFUA 5AJ3Q 2QGQA 4PMWA 1IBMQ 4DV5L 1YZ6A 4YY3L 4LF8L 4PG3A 1KL9A 4A3FH 1N8RC 1L0WA 1N32Q 2BA0A 4GS3A 1QVCA 4UP7A 1K0RA 1XPOA 3F1ZA 2VNUD 3ER0A 1FGUA 4DV3L 3GO5A 1JJ2A 2AKWB 2D0PA 4RMFA 3A0JA 4JBWA 3I4MH 3K80C 2JA7H 2CCZA 4P71A 1U5KA 3A74A 1PA6A 3S1RH 4AQYQ 1KAWA 2NVXH 3UDGA 1A63A 1HZ9A 1T9HA 4JYAQ 1PVOA 2F3IA 3STBD 4HJ5A 2IX1A 2LSSA 4JI3Q 2KHJA 1J5EL 3HKSA 1SMXA 1XPRA 4YHHQ 4X66L 1IZ6A 3FKIH 4X65Q 1VQAA 1YI2A 4R4TA 1R9TH 3STBC 1PYSB 4WJ4A 1X3EA 4X62L 2N8NA 1XMQQ 2F4VQ 2JE6I 4HIKA 3F2DA 3H15A 1PHJA 3U58A 1TWAH 1Q86C 1Q81C 1PH7A 4DK6C 4DV3Q 4BXXG 2NVQH 1W3SA 1MIUA 3K7AH 2V1CC 2WAQG 2K5NA 2D62A 5GADC 4R4OA 2Q2TA 2ZTEA 4AQYL 4JBKA 4KI0A 1IBKQ 1WCMG 5JEAG 4GLVB 2A8VA 3H3VI 4DR7L 5C0XJ 1YBYA 4K0KL 1I50H 1UE5A 4YHHL 3DLLA 1N34L 4BY7H 3GTJH 4QQBX 4QY7A 1VQGA 2QA4A 4A3EG 4B3ML 2OTJA 1X65A 1IYJB 5M5XH 1Q82C 2PQAA 5C4XH 5GAEC 2F4VL 3TS0A 3CD6A 1G291 4XIGS 1E24A 2AHOB 4P75A 5GAGC 2JA5H 2D0OA 2CQOA 1L1OC 1PH3A 3I7FA 1PH6A 1YHBA 4OWTB 3CC4A 4B3RL 3PO3H 3I56A 2JA9A 1UEBA 5AJ3L 1IBML 4IOAA 4QIWE 4JI2Q 3PF5A 3CC7A 3S14H 4A93H 1JB7A 2I5HA 1I94L 1YHAA 2KCTA 3J80i 1YNXA 2JA8G 1N32L 4LFAQ 4DV1L 2UXBL 5IP7H 3PIOA 4X6AH 4LW1A 4L5SA 1B8AA 1SROA 1VQBA 3CW2C 3PSIA 5M3FH 4DR3Q 1XTDA 1V1QA 4P73A 4PZ7A 1N36L 2HQLA 1N34Q 5FLMG 1NMFA 3ICEA 4A3MH 2WAQE 1SN8A 2B29A 3HFZB 1TWHH 2JA6G 5IYCH 2R7ZG 2R93H 1UE1A 3OW2A 2HHHQ 1QUQB 3S16H 2BH2A 3AFQA 2MO0A 2HIVA 1TWCH 2Q2HA 2VUMH 3K7UC 3OTOL 3J81i 2GN5A 1HZAA 3I4NH 1A0IA 1QZHA 4X65L 3ZJYC 4C2MH 1S3OA 3UDIA 2CWAA 4JI7L 4X62Q 1NBWA 4MZ9A 1I94Q 4IFDG 5M5YH 3L0OA 1UE6A 3I4OA 3CCSA 4DV1Q 4LFAL 2UXBQ 2N49A 3HKZE 4DR3L 1WI5A 1Q12A 2K52A 3PCOB 5IP9H 2R92H 4LWCA 3CCEA 3EBEA 3M4OH 2NN6G 4DR6Q 1G51A 4BXXH 2DGYA 3BU2A 3KDFA 1HNXQ 2K50A 1XNQL 3PGZA 2R7FA 3UDFA 1VQ9A 4LF4L 3HOYG 3HOWG 1MJCA 2Q2IA 1N33Q 5JJLA 4GNXB 3KOJA 3KYHC 5GQOA 4DPGA 5IYBG 2VZAA 1TXYA 2RHSB 1CKOA 2E8GA 4L5TA 3KDFB 3T1YL 2HHHL 3PO2G 1PYBA 4K0KQ 3OTOQ 3KJPA 3CAMA 3UE0A 3PUYA 1Z9FA 1YHQA 5FJ8H 4A76A 2UUCL 4B3MQ 2OTLA 3OYYA 2KBNA 3CC2A 4JI7Q 4A3BH 4DAYB 3F2CA 4NXNL 4GOPC 4DAMA 1MKHA 3AFPA 3UE1A 3SGIA 4DR6L 3B6YA 4JBMA 4B3RQ 2MQHA 2PI2A 1EIYB 4DNIA 1XNQQ 5E7NA 3TEHB 4JI2L 3HOUG 2N78A 2A1AA 4IFDI 3NBHB 4QGUA 4OO1G 1H95A 1JJCB 1X3FA 1VQDA 2QEXA 1VQHA 4DUZL 1K8GA 1C7YA 2JJQA 4DR4Q 1ASYA 1K73C 2KCMA 1X9NA 1N36Q 1EFWA 3WWVA 3J7ZC 1AH9A 3PUZA 1VQPA 3KJOA 3ULPA 3CCLA 1VQCA 4ALPA 4HJ9A 3GTOH 1V43A 4DKAC 2JA8H 3F8TA 4GNXA 1NJIC 3CCJA 4PZ8A 5GROA 4JI6L 2RCNA 4UPAA 4NXNQ 4OWWB 2GVBA 4JCVE 5GAHC 3M3YH 2DUDA 4UP9A 2H5XA 2ID0A 2YYZA 3NENA 2YTXA 2FXQA 4R4CA 3RLOA 5C0XG 2VW9A 2VQEL 1B70B 1CKNB 1Y14B 3AEVA 5IYDH 5JJIA 2GVAA 1HZCA 1OTCA 1S72A 3G6EA 5M3MH 5IP7G 2PQAB 3JAMc 3F2BA 1CSPA 2MNAA 4LUZA 1VQ4A 4JI8L 1SR3A 5C3EG 4DUZQ 1C0AA 1W2BA 3I4NG 1VQ7A 4C3IH 1EIFA 1E3PA 4JI4L 4A3LG 3S2HH 2UXDQ 4LF4Q 1VQ6A 3U4VA 3FHWA 4A3KG 3M85A 2E5LQ 2PI2E 4J15A 2A19A 5C3EH 3TQYA 1GD7A 3A5UA 3T1YQ 3CPFA 4JI6Q 2K75A 3PUWA 1PH5A 2ZM6Q 4IO9A 1A62A 2Q2UA 1E1OA 4P74A 4HIDA 3DM3A 3L7ZC 1K9MC 5J3BA 1EUJA 2UXCL 1SRUA 2VQEQ 2UUCQ 3A5ZB 4HIMA 4L5RC 4A3DH 1P16A 4A75A 4HJ7A 1Q8KA 1U0LA 4YWMA 3CMEA 1M90C 1VQNA 1QVFA 1Z47A 1BBWA 4YCVA 4JI1L 1UWVA 1WYDA 3PIPA 2JK8A 2NZOA 3KF8B 3S2DH 3GTKH 1CUKA 3I4MG 1FVIA 2JEAI 1Q1BA 2YV5A 2LXJA 5M5WH 3NEMA 4A3LH 1K3RA 4AH6A 4JI4Q 4DR2Q 1PH1A 3UDXA 3RLNA 1Q46A 2R93G 5JJKA 4A3KH 1KC8C 3ERSX 1B7YB 4P72A 3W1BA 4YWLA 5LMUQ 1HNZQ 4O0AA 1NTGA 2I0QA 4RG1A 1IL2A 1GKHA 2VL6A 2ZM6L 4LF7L 1VQ5A 1JE5A 4IFDJ 1D8LA 3HOUH 2UXCQ 3CCQA 1UE7A 2EQSA 4HJAA 4DR5L 3Q8DA 1PFSA 4H02A 3K0XA 4O2DA 4JI1Q 5IE8A 1CKMA 4GKKQ 2LXKA 4Y7NH 1VQOA 3G48A 1OXTA 1VQEA 1EQQA 1HR0W 3EIVA 3PF4A 1X3GA 4C3HH 2OQ0A 4DR2L 1CSQA 1HNWQ 2NVTH 1V9PA 4GN4B 1FJGL 1X56A 1Y1VG 2Y0SE 1MJEA 2RHQB 4YCWA 2ES2A 4JI8Q 2NZHA 3FP9A 5LMUL 4A3GH 5IY0A 1YJNA 3RR5A 4LNQA 1HNXL 4POGA 2K5HA 4BY7G 2R7DA 3CCRA 1A8VA 3L2PA 4DV2Q 4LF5Q 3HOVG 1QUQA 1KHIA 4LUOA 3RNUA 4BBSG 2UXDL 2JQOA 1WFQA 2KENA 4A3BG 2VS1A 3H0GH 1I5FA 2L15A 2BH8A 3E9HA 2ZJPA 3CCVA 2JA5G 1RL2A 2IY5B 2VQFQ 4NB3A 2E5LL 5IP9G 4DR5Q 2ZJQA 1SE8A 1TWFH 4AYBG 4IOCA 3M4PA 5DLQE 1XNRL 4JI0Q 4AIMA 3PO3G 1OXVA 4FDBA 4A3EH 4GKKL 5FJ8G 4OO1I 2CFMA 4DV0Q 2XTIA 2YTVA 3D0FA 4LF6Q 3MXNB 3G4SA 4A3JG 4NXMQ 4BBSH 3K81C 5IYCG 2R7ZH 3HOZG 3GD7A 4JI5Q 1HNWL 4IPHA 3G71A 4IJHA 4GLAC 4A3GG 3CF5A 3TREA 3PUXA 2E2IH 1XMOL 4OX9Q 2MO1A 3JC66 4MNOA 2IX0A 2F52A 3S24A 1EOVA 1QZGA 3BJUA 4DV2L 4X64Q 2ZTDA 2EXDA 1YIJA 4LF5L 2ZTCA 1VCIA 3U4ZA 4LFBQ 1KXLA 1YVCA 3HKZG 3IRBA 2IHFA 5IWAQ 1TWGH 1L2FA 1VQFA 5FLXc 4IPGA 1VS0A 1X6OA 3M9BA 4TQUS 1YITA 1HNZL 2UUBL 1QVGA 1NMGA 4DV7L 1RIPA 2HIXA 5H1SE 4PZ6A 2ATWA 2OWOA 1AE3A 1AE2A 4DV0L 4LF7Q 4LF6L 3GTGH 1JT8A 1J6QA 3AYHB 3TS2A 1P8LA 4R4QA 5ELNA 1KQSA 3ULJA 5LMNW 4BA1I 1VQJA 2YU9H 3NELA 4A3CG 2XGTA 1PH2A 4AYBE 5BR8L 5IYDG 1XMOQ 2K14A 4OX9L 4GKJL 4A3IH 4BBRG 3HOWH 4A3JH 3HOYH 4GN5A 5C4XG 1N33L 1EQRA 5K36G 1YEZA 3M7NA 4WJ3M 1M1KC 2Z0SA 3GTQH 4LFBL 4L5QA 1IXRA 3S1MH 1FJGQ 4YWKA 4DR1Q 5IWAL 1HH2P 3S1NH 5C0XI 3RLFA 5FLMH 4B3TQ 2UUBQ 4A93G 4IPCA 1YJ9A 3HOXH 5JEAJ 3TRZA 3M4QA 3H3VH 1N9WA 1PH9A 4DR4L 4A3DG 1PH4A 2JEBI 3KF6A 5LMNL 4NPSA 2CKZB 3ULLA 2VQFL 4GOPB 3RN5A 1HR0L 5C44H 3BZKA 1JMCA 1E7ZA 1XNRQ 2KHIA 1Y1WH 4JI0L 3PV0A 2PNHA 4DR7Q 4GKJQ 4NXML 2K4KA 1I3QH 2AWNA 4APVA 3D31A 1VQ8A 2WB1G 2B3GA 4JI5L 1BKBA 4IPDA 5IT9c 1VQMA 3JAMi 2NN6I 1HJPA 3FKIG 4JOIA 5HGQA 1LYLA 4DUYL 4JV5Q 1ASZA 1LTLA 1CKNA 4GNXC 4B3SQ 3EN2A 2I5LX 4ME3A 4B3TL 3I55A 2EIFA 1JJGA 3KF6B 3MEFA 4X64L 4QJFA 3VDYA 4LF9Q 1NE3A 5LMNQ 4OXPA 3K8AA 1WJJA 2OCEA 4DV4L 4JBJA 3U50C 1OXUA 3S15H 4BY1H 3RN2A 5C44G 1HR0Q 1E1TA 2CWPA 4DV6L 4DV7Q 1I6HH 2ALYB 1IBLL 1S40A 2ASBA 2Z6KA 5M3MG 1HZBA 4DK3C 3T1HL 2WFWA 1KRSA 2AMCB 3PO2H 3PUVA 4QL5A 2JA7G 2HT1A 4YY3Q 1VQKA 4YCUA 1OXXK 3W5OA 1VQLA 4DUYQ 1WOCA 2R6GA 5BR8Q 2K5VA 2Z6KC 3CMAA 3HOVH 4JV5L 2N3SA 4B3SL 2RF4A 1NY4A 3I2ZA 2VY3A 2E2JH 1XJVA 2WB1E 1Q7YC 3CCMA 4XTCS 4BY1G 4DR1L 1PH8A 1Q1EA 2IHEA 2BA1A 1K83H 4GLXA 4A3MG 4LFCQ 3GTMH 4MTNA 4BBRH 2B63G 4BA2I 1BVSA 4JC0A 4JI3L 4HIOA 1DGSA 3HOZH 1G6PA 1Y1VH 2IT1A 1C9OA 5M3FG 1BBUA 1XPUA 3S17H 1L1OB 2UUAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SLJ A;  3LGJ A;  3E0E A;  4OON A;  5EAY A;  1KRT A;  4C3J H;  1XMQ L;  1LUZ A;  3CPW A;  4A3I G;  2UU9 Q;  2OQK A;  1YJW A;  3GTP H;  4HJ8 A;  2C35 B;  3HOX G;  1KD1 C;  3CP0 A;  1E22 A;  1EYG A;  2B63 H;  4EQ5 A;  2I5M X;  4GOP A;  4TVA B;  1WCM H;  4IJL A;  1O7I A;  4R4I A;  1KIX A;  5ELO A;  1OXS C;  2NVY H;  1X55 A;  3W1G A;  4UY8 C;  2VUM G;  4KHP Q;  1LM0 A;  2R92 G;  1X54 A;  1GM5 A;  4DV5 Q;  1GO3 E;  4LF8 Q;  3AQQ A;  3CQZ H;  4OWX B;  1D7Q A;  3GTL H;  1VQI A;  4A3F G;  4A4I A;  1IBK L;  3E9I A;  4LFC L;  4EX5 A;  3J81 c;  2WP8 J;  3RZO H;  4JOI C;  2Y0S G;  3J7A 5;  3RZD H;  4POF A;  4LF9 L;  3S1Q H;  2ZJR A;  3CCU A;  2PMZ E;  4A3C H;  4DV4 Q;  1EWI A;  1GVP A;  4KHZ A;  4GN3 B;  4KLK A;  3CXC A;  1L1O A;  1SFO H;  4LUV A;  1Y1W G;  2UUA L;  4KHP L;  4JG2 A;  4JYA L;  4UP8 A;  5C4J H;  3J81 j;  5HY6 A;  3GDE A;  2YTY A;  3BZC A;  4DV6 Q;  2UU9 L;  4R1J A;  2JA6 H;  2MFI A;  1PV4 A;  1IBL Q;  1K8A C;  1FL0 A;  2AWO A;  3H0G G;  5IYB H;  1J5E Q;  4Y52 H;  4X66 Q;  2E2H H;  3T1H Q;  3KLW A;  3J80 c;  3KFU A;  5AJ3 Q;  2QGQ A;  4PMW A;  1IBM Q;  4DV5 L;  1YZ6 A;  4YY3 L;  4LF8 L;  4PG3 A;  1KL9 A;  4A3F H;  1N8R C;  1L0W A;  1N32 Q;  2BA0 A;  4GS3 A;  1QVC A;  4UP7 A;  1K0R A;  1XPO A;  3F1Z A;  2VNU D;  3ER0 A;  1FGU A;  4DV3 L;  3GO5 A;  1JJ2 A;  2AKW B;  2D0P A;  4RMF A;  3A0J A;  4JBW A;  3I4M H;  3K80 C;  2JA7 H;  2CCZ A;  4P71 A;  1U5K A;  3A74 A;  1PA6 A;  3S1R H;  4AQY Q;  1KAW A;  2NVX H;  3UDG A;  1A63 A;  1HZ9 A;  1T9H A;  4JYA Q;  1PVO A;  2F3I A;  3STB D;  4HJ5 A;  2IX1 A;  2LSS A;  4JI3 Q;  2KHJ A;  1J5E L;  3HKS A;  1SMX A;  1XPR A;  4YHH Q;  4X66 L;  1IZ6 A;  3FKI H;  4X65 Q;  1VQA A;  1YI2 A;  4R4T A;  1R9T H;  3STB C;  1PYS B;  4WJ4 A;  1X3E A;  4X62 L;  2N8N A;  1XMQ Q;  2F4V Q;  2JE6 I;  4HIK A;  3F2D A;  3H15 A;  1PHJ A;  3U58 A;  1TWA H;  1Q86 C;  1Q81 C;  1PH7 A;  4DK6 C;  4DV3 Q;  4BXX G;  2NVQ H;  1W3S A;  1MIU A;  3K7A H;  2V1C C;  2WAQ G;  2K5N A;  2D62 A;  5GAD C;  4R4O A;  2Q2T A;  2ZTE A;  4AQY L;  4JBK A;  4KI0 A;  1IBK Q;  1WCM G;  5JEA G;  4GLV B;  2A8V A;  3H3V I;  4DR7 L;  5C0X J;  1YBY A;  4K0K L;  1I50 H;  1UE5 A;  4YHH L;  3DLL A;  1N34 L;  4BY7 H;  3GTJ H;  4QQB X;  4QY7 A;  1VQG A;  2QA4 A;  4A3E G;  4B3M L;  2OTJ A;  1X65 A;  1IYJ B;  5M5X H;  1Q82 C;  2PQA A;  5C4X H;  5GAE C;  2F4V L;  3TS0 A;  3CD6 A;  1G29 1;  4XIG S;  1E24 A;  2AHO B;  4P75 A;  5GAG C;  2JA5 H;  2D0O A;  2CQO A;  1L1O C;  1PH3 A;  3I7F A;  1PH6 A;  1YHB A;  4OWT B;  3CC4 A;  4B3R L;  3PO3 H;  3I56 A;  2JA9 A;  1UEB A;  5AJ3 L;  1IBM L;  4IOA A;  4QIW E;  4JI2 Q;  3PF5 A;  3CC7 A;  3S14 H;  4A93 H;  1JB7 A;  2I5H A;  1I94 L;  1YHA A;  2KCT A;  3J80 i;  1YNX A;  2JA8 G;  1N32 L;  4LFA Q;  4DV1 L;  2UXB L;  5IP7 H;  3PIO A;  4X6A H;  4LW1 A;  4L5S A;  1B8A A;  1SRO A;  1VQB A;  3CW2 C;  3PSI A;  5M3F H;  4DR3 Q;  1XTD A;  1V1Q A;  4P73 A;  4PZ7 A;  1N36 L;  2HQL A;  1N34 Q;  5FLM G;  1NMF A;  3ICE A;  4A3M H;  2WAQ E;  1SN8 A;  2B29 A;  3HFZ B;  1TWH H;  2JA6 G;  5IYC H;  2R7Z G;  2R93 H;  1UE1 A;  3OW2 A;  2HHH Q;  1QUQ B;  3S16 H;  2BH2 A;  3AFQ A;  2MO0 A;  2HIV A;  1TWC H;  2Q2H A;  2VUM H;  3K7U C;  3OTO L;  3J81 i;  2GN5 A;  1HZA A;  3I4N H;  1A0I A;  1QZH A;  4X65 L;  3ZJY C;  4C2M H;  1S3O A;  3UDI A;  2CWA A;  4JI7 L;  4X62 Q;  1NBW A;  4MZ9 A;  1I94 Q;  4IFD G;  5M5Y H;  3L0O A;  1UE6 A;  3I4O A;  3CCS A;  4DV1 Q;  4LFA L;  2UXB Q;  2N49 A;  3HKZ E;  4DR3 L;  1WI5 A;  1Q12 A;  2K52 A;  3PCO B;  5IP9 H;  2R92 H;  4LWC A;  3CCE A;  3EBE A;  3M4O H;  2NN6 G;  4DR6 Q;  1G51 A;  4BXX H;  2DGY A;  3BU2 A;  3KDF A;  1HNX Q;  2K50 A;  1XNQ L;  3PGZ A;  2R7F A;  3UDF A;  1VQ9 A;  4LF4 L;  3HOY G;  3HOW G;  1MJC A;  2Q2I A;  1N33 Q;  5JJL A;  4GNX B;  3KOJ A;  3KYH C;  5GQO A;  4DPG A;  5IYB G;  2VZA A;  1TXY A;  2RHS B;  1CKO A;  2E8G A;  4L5T A;  3KDF B;  3T1Y L;  2HHH L;  3PO2 G;  1PYB A;  4K0K Q;  3OTO Q;  3KJP A;  3CAM A;  3UE0 A;  3PUY A;  1Z9F A;  1YHQ A;  5FJ8 H;  4A76 A;  2UUC L;  4B3M Q;  2OTL A;  3OYY A;  2KBN A;  3CC2 A;  4JI7 Q;  4A3B H;  4DAY B;  3F2C A;  4NXN L;  4GOP C;  4DAM A;  1MKH A;  3AFP A;  3UE1 A;  3SGI A;  4DR6 L;  3B6Y A;  4JBM A;  4B3R Q;  2MQH A;  2PI2 A;  1EIY B;  4DNI A;  1XNQ Q;  5E7N A;  3TEH B;  4JI2 L;  3HOU G;  2N78 A;  2A1A A;  4IFD I;  3NBH B;  4QGU A;  4OO1 G;  1H95 A;  1JJC B;  1X3F A;  1VQD A;  2QEX A;  1VQH A;  4DUZ L;  1K8G A;  1C7Y A;  2JJQ A;  4DR4 Q;  1ASY A;  1K73 C;  2KCM A;  1X9N A;  1N36 Q;  1EFW A;  3WWV A;  3J7Z C;  1AH9 A;  3PUZ A;  1VQP A;  3KJO A;  3ULP A;  3CCL A;  1VQC A;  4ALP A;  4HJ9 A;  3GTO H;  1V43 A;  4DKA C;  2JA8 H;  3F8T A;  4GNX A;  1NJI C;  3CCJ A;  4PZ8 A;  5GRO A;  4JI6 L;  2RCN A;  4UPA A;  4NXN Q;  4OWW B;  2GVB A;  4JCV E;  5GAH C;  3M3Y H;  2DUD A;  4UP9 A;  2H5X A;  2ID0 A;  2YYZ A;  3NEN A;  2YTX A;  2FXQ A;  4R4C A;  3RLO A;  5C0X G;  2VW9 A;  2VQE L;  1B70 B;  1CKN B;  1Y14 B;  3AEV A;  5IYD H;  5JJI A;  2GVA A;  1HZC A;  1OTC A;  1S72 A;  3G6E A;  5M3M H;  5IP7 G;  2PQA B;  3JAM c;  3F2B A;  1CSP A;  2MNA A;  4LUZ A;  1VQ4 A;  4JI8 L;  1SR3 A;  5C3E G;  4DUZ Q;  1C0A A;  1W2B A;  3I4N G;  1VQ7 A;  4C3I H;  1EIF A;  1E3P A;  4JI4 L;  4A3L G;  3S2H H;  2UXD Q;  4LF4 Q;  1VQ6 A;  3U4V A;  3FHW A;  4A3K G;  3M85 A;  2E5L Q;  2PI2 E;  4J15 A;  2A19 A;  5C3E H;  3TQY A;  1GD7 A;  3A5U A;  3T1Y Q;  3CPF A;  4JI6 Q;  2K75 A;  3PUW A;  1PH5 A;  2ZM6 Q;  4IO9 A;  1A62 A;  2Q2U A;  1E1O A;  4P74 A;  4HID A;  3DM3 A;  3L7Z C;  1K9M C;  5J3B A;  1EUJ A;  2UXC L;  1SRU A;  2VQE Q;  2UUC Q;  3A5Z B;  4HIM A;  4L5R C;  4A3D H;  1P16 A;  4A75 A;  4HJ7 A;  1Q8K A;  1U0L A;  4YWM A;  3CME A;  1M90 C;  1VQN A;  1QVF A;  1Z47 A;  1BBW A;  4YCV A;  4JI1 L;  1UWV A;  1WYD A;  3PIP A;  2JK8 A;  2NZO A;  3KF8 B;  3S2D H;  3GTK H;  1CUK A;  3I4M G;  1FVI A;  2JEA I;  1Q1B A;  2YV5 A;  2LXJ A;  5M5W H;  3NEM A;  4A3L H;  1K3R A;  4AH6 A;  4JI4 Q;  4DR2 Q;  1PH1 A;  3UDX A;  3RLN A;  1Q46 A;  2R93 G;  5JJK A;  4A3K H;  1KC8 C;  3ERS X;  1B7Y B;  4P72 A;  3W1B A;  4YWL A;  5LMU Q;  1HNZ Q;  4O0A A;  1NTG A;  2I0Q A;  4RG1 A;  1IL2 A;  1GKH A;  2VL6 A;  2ZM6 L;  4LF7 L;  1VQ5 A;  1JE5 A;  4IFD J;  1D8L A;  3HOU H;  2UXC Q;  3CCQ A;  1UE7 A;  2EQS A;  4HJA A;  4DR5 L;  3Q8D A;  1PFS A;  4H02 A;  3K0X A;  4O2D A;  4JI1 Q;  5IE8 A;  1CKM A;  4GKK Q;  2LXK A;  4Y7N H;  1VQO A;  3G48 A;  1OXT A;  1VQE A;  1EQQ A;  1HR0 W;  3EIV A;  3PF4 A;  1X3G A;  4C3H H;  2OQ0 A;  4DR2 L;  1CSQ A;  1HNW Q;  2NVT H;  1V9P A;  4GN4 B;  1FJG L;  1X56 A;  1Y1V G;  2Y0S E;  1MJE A;  2RHQ B;  4YCW A;  2ES2 A;  4JI8 Q;  2NZH A;  3FP9 A;  5LMU L;  4A3G H;  5IY0 A;  1YJN A;  3RR5 A;  4LNQ A;  1HNX L;  4POG A;  2K5H A;  4BY7 G;  2R7D A;  3CCR A;  1A8V A;  3L2P A;  4DV2 Q;  4LF5 Q;  3HOV G;  1QUQ A;  1KHI A;  4LUO A;  3RNU A;  4BBS G;  2UXD L;  2JQO A;  1WFQ A;  2KEN A;  4A3B G;  2VS1 A;  3H0G H;  1I5F A;  2L15 A;  2BH8 A;  3E9H A;  2ZJP A;  3CCV A;  2JA5 G;  1RL2 A;  2IY5 B;  2VQF Q;  4NB3 A;  2E5L L;  5IP9 G;  4DR5 Q;  2ZJQ A;  1SE8 A;  1TWF H;  4AYB G;  4IOC A;  3M4P A;  5DLQ E;  1XNR L;  4JI0 Q;  4AIM A;  3PO3 G;  1OXV A;  4FDB A;  4A3E H;  4GKK L;  5FJ8 G;  4OO1 I;  2CFM A;  4DV0 Q;  2XTI A;  2YTV A;  3D0F A;  4LF6 Q;  3MXN B;  3G4S A;  4A3J G;  4NXM Q;  4BBS H;  3K81 C;  5IYC G;  2R7Z H;  3HOZ G;  3GD7 A;  4JI5 Q;  1HNW L;  4IPH A;  3G71 A;  4IJH A;  4GLA C;  4A3G G;  3CF5 A;  3TRE A;  3PUX A;  2E2I H;  1XMO L;  4OX9 Q;  2MO1 A;  3JC6 6;  4MNO A;  2IX0 A;  2F52 A;  3S24 A;  1EOV A;  1QZG A;  3BJU A;  4DV2 L;  4X64 Q;  2ZTD A;  2EXD A;  1YIJ A;  4LF5 L;  2ZTC A;  1VCI A;  3U4Z A;  4LFB Q;  1KXL A;  1YVC A;  3HKZ G;  3IRB A;  2IHF A;  5IWA Q;  1TWG H;  1L2F A;  1VQF A;  5FLX c;  4IPG A;  1VS0 A;  1X6O A;  3M9B A;  4TQU S;  1YIT A;  1HNZ L;  2UUB L;  1QVG A;  1NMG A;  4DV7 L;  1RIP A;  2HIX A;  5H1S E;  4PZ6 A;  2ATW A;  2OWO A;  1AE3 A;  1AE2 A;  4DV0 L;  4LF7 Q;  4LF6 L;  3GTG H;  1JT8 A;  1J6Q A;  3AYH B;  3TS2 A;  1P8L A;  4R4Q A;  5ELN A;  1KQS A;  3ULJ A;  5LMN W;  4BA1 I;  1VQJ A;  2YU9 H;  3NEL A;  4A3C G;  2XGT A;  1PH2 A;  4AYB E;  5BR8 L;  5IYD G;  1XMO Q;  2K14 A;  4OX9 L;  4GKJ L;  4A3I H;  4BBR G;  3HOW H;  4A3J H;  3HOY H;  4GN5 A;  5C4X G;  1N33 L;  1EQR A;  5K36 G;  1YEZ A;  3M7N A;  4WJ3 M;  1M1K C;  2Z0S A;  3GTQ H;  4LFB L;  4L5Q A;  1IXR A;  3S1M H;  1FJG Q;  4YWK A;  4DR1 Q;  5IWA L;  1HH2 P;  3S1N H;  5C0X I;  3RLF A;  5FLM H;  4B3T Q;  2UUB Q;  4A93 G;  4IPC A;  1YJ9 A;  3HOX H;  5JEA J;  3TRZ A;  3M4Q A;  3H3V H;  1N9W A;  1PH9 A;  4DR4 L;  4A3D G;  1PH4 A;  2JEB I;  3KF6 A;  5LMN L;  4NPS A;  2CKZ B;  3ULL A;  2VQF L;  4GOP B;  3RN5 A;  1HR0 L;  5C44 H;  3BZK A;  1JMC A;  1E7Z A;  1XNR Q;  2KHI A;  1Y1W H;  4JI0 L;  3PV0 A;  2PNH A;  4DR7 Q;  4GKJ Q;  4NXM L;  2K4K A;  1I3Q H;  2AWN A;  4APV A;  3D31 A;  1VQ8 A;  2WB1 G;  2B3G A;  4JI5 L;  1BKB A;  4IPD A;  5IT9 c;  1VQM A;  3JAM i;  2NN6 I;  1HJP A;  3FKI G;  4JOI A;  5HGQ A;  1LYL A;  4DUY L;  4JV5 Q;  1ASZ A;  1LTL A;  1CKN A;  4GNX C;  4B3S Q;  3EN2 A;  2I5L X;  4ME3 A;  4B3T L;  3I55 A;  2EIF A;  1JJG A;  3KF6 B;  3MEF A;  4X64 L;  4QJF A;  3VDY A;  4LF9 Q;  1NE3 A;  5LMN Q;  4OXP A;  3K8A A;  1WJJ A;  2OCE A;  4DV4 L;  4JBJ A;  3U50 C;  1OXU A;  3S15 H;  4BY1 H;  3RN2 A;  5C44 G;  1HR0 Q;  1E1T A;  2CWP A;  4DV6 L;  4DV7 Q;  1I6H H;  2ALY B;  1IBL L;  1S40 A;  2ASB A;  2Z6K A;  5M3M G;  1HZB A;  4DK3 C;  3T1H L;  2WFW A;  1KRS A;  2AMC B;  3PO2 H;  3PUV A;  4QL5 A;  2JA7 G;  2HT1 A;  4YY3 Q;  1VQK A;  4YCU A;  1OXX K;  3W5O A;  1VQL A;  4DUY Q;  1WOC A;  2R6G A;  5BR8 Q;  2K5V A;  2Z6K C;  3CMA A;  3HOV H;  4JV5 L;  2N3S A;  4B3S L;  2RF4 A;  1NY4 A;  3I2Z A;  2VY3 A;  2E2J H;  1XJV A;  2WB1 E;  1Q7Y C;  3CCM A;  4XTC S;  4BY1 G;  4DR1 L;  1PH8 A;  1Q1E A;  2IHE A;  2BA1 A;  1K83 H;  4GLX A;  4A3M G;  4LFC Q;  3GTM H;  4MTN A;  4BBR H;  2B63 G;  4BA2 I;  1BVS A;  4JC0 A;  4JI3 L;  4HIO A;  1DGS A;  3HOZ H;  1G6P A;  1Y1V H;  2IT1 A;  1C9O A;  5M3F G;  1BBU A;  1XPU A;  3S17 H;  1L1O B;  2UUA Q; 
#chains in the Genus database with same CATH topology
 5E1F A;  1SLJ A;  3CPW A;  3H91 A;  2A6H D;  4A3I G;  1YJW A;  2SNM A;  3CP0 A;  1E22 A;  4EQ5 A;  1F9Q A;  1A6X A;  4RHR A;  5IOC A;  4IJL A;  3KBX A;  1KIX A;  1X55 A;  3Q23 A;  2M2L A;  3CQZ H;  3E9I A;  4LFC L;  4EX5 A;  5KND A;  1WTX A;  2WP8 J;  3RZO H;  3CCU A;  3I72 A;  1D1K A;  2PMZ E;  1PZK D;  1EWI A;  4GN3 B;  1ILQ A;  1V1P A;  4HMJ A;  4TSS A;  5C4J H;  3J81 j;  1BCP B;  2MFI A;  1PV4 A;  1K8A C;  2EY1 A;  1FL0 A;  1ML0 D;  4X66 Q;  3WDN A;  4HAE A;  3KFU A;  1IBM Q;  2GA4 B;  1S5D D;  1EQT A;  1PXU A;  1YZ6 A;  3J7A F;  1XWE A;  4PG3 A;  4A3F H;  4OL7 A;  1RDP D;  3VYR A;  2B2T C;  4IQZ A;  4UP7 A;  3JAM E;  1AEX A;  2D0P A;  1BCP F;  1BO0 A;  3I4M H;  2CCZ A;  3S1R H;  1A63 A;  3UDG A;  2QW7 A;  1PVO A;  1LTT D;  2F3I A;  3QOJ A;  5ELD A;  1XPR A;  5E4X A;  1IZ6 A;  1HA5 A;  2EYO A;  4R4T A;  1PYS B;  5KNB A;  3OHX C;  2F4V Q;  2I07 B;  2JE6 I;  3H15 A;  3LX0 A;  5BN5 A;  1Q86 C;  1EY0 A;  1PH7 A;  1PRT F;  2EY5 A;  4DA2 A;  2V1C C;  1BNZ A;  5KYL A;  4X3U A;  1IYV A;  3HGB A;  5LL6 X;  4GLV B;  3H3V I;  4DR7 L;  4FXG C;  3OW7 A;  1UE5 A;  2BE5 D;  4YHH L;  4FF1 A;  3P75 A;  2RVL A;  1JOO A;  5EPK A;  4HMI A;  1Q82 C;  1W6K A;  5C4X H;  5GAE C;  1WCM B;  3IFD A;  1G29 1;  1EY7 A;  4P75 A;  3ERQ A;  3GV6 A;  1IW7 C;  2CQO A;  4OWT B;  1QB5 D;  5EKK A;  3CC4 A;  4B3R L;  1E2W A;  1KNE A;  3H6M A;  1IBM L;  4IOA A;  4QIW E;  1QCB D;  2B63 B;  2IJ0 A;  4LFA Q;  2M9V A;  4K5X A;  1Y8N B;  3CW2 C;  2XN9 C;  1T5E A;  1J9O A;  1F2Y A;  1N34 Q;  4XQJ A;  1NMF A;  2Q8R E;  5ELC A;  1GXD C;  2B29 A;  1H9R A;  3HFZ B;  4FNF A;  1G6Z A;  2R7Z G;  2V4D A;  5CV6 A;  3Q6S A;  3S16 H;  2BH2 A;  2MO0 A;  1TWC H;  1HUM A;  3K57 A;  2VUM H;  3R2T A;  3IAY A;  1HZA A;  2PO4 A;  3R93 A;  4FYD A;  5CV8 A;  3ZJY C;  4C2M H;  4JI7 L;  3M4Y A;  3FMC A;  1DYQ A;  2SEB D;  5C6A A;  3SK8 A;  3L0O A;  4DV1 Q;  2UXB Q;  1KDA A;  4DR3 L;  1WI5 A;  1Q12 A;  5IP9 H;  1NR2 A;  3CCE A;  4C3I B;  4BXX H;  2NN6 G;  2BE5 C;  3HOY G;  1I6V C;  2Q2I A;  3KYH C;  4DPG A;  4DR7 Q;  4KMU C;  3PO2 G;  3T4A C;  1PYB A;  3PIO 3;  1JOR A;  3OTO Q;  3I4L A;  4BY7 B;  2UUC L;  1KAA A;  1LTA D;  3OYY A;  3CC2 A;  2HDL A;  3OIQ A;  3MVV A;  4DAY B;  2RDH A;  1YNN C;  1V8Q A;  3IKJ A;  1MKH A;  4I7Z C;  3AFP A;  1TVX A;  3UE1 A;  3SGI A;  3B6Y A;  4B3R Q;  4IFD I;  2N78 A;  1H95 A;  3NBH B;  5G3L D;  1X3F A;  1F2Z A;  4F87 A;  3NK9 A;  1ENF A;  4DFA A;  4ZLT F;  2QDB A;  4DR4 Q;  1RKN A;  4U67 3;  1GOZ A;  2KCM A;  2SNS A;  1SJH D;  3ULP A;  1KDC A;  3I73 A;  3CCL A;  1VQC A;  3VR6 A;  2F1M A;  1V43 A;  4HJ9 A;  2TMP A;  4MTK A;  2VB3 X;  1Y69 U;  5FO7 B;  2F0T A;  2A68 C;  4S3S A;  1CQV A;  4ULL A;  3M3Y H;  2YTX A;  3AEV A;  3DEO A;  5JJI A;  1CKN B;  2GVA A;  2EY6 A;  2F0N A;  3G6E A;  3JAM c;  3BG3 A;  2FIN B;  4LUZ A;  2QEJ C;  3AMU A;  1SR3 A;  2PZU A;  1C0A A;  1VQ7 A;  1CHQ D;  4KKT A;  3SDZ A;  4C3I H;  4C2M B;  5EBD A;  1VQ6 A;  3U4V A;  1B50 A;  3SK5 A;  3M85 A;  4FXK C;  2PI2 E;  3I4N B;  3NBI A;  5C3E H;  1TWG B;  3CPF A;  1JOK A;  3PUW A;  4JW0 A;  1A62 A;  3DM3 A;  1EUJ A;  1SRU A;  2UUC Q;  4HSP A;  4YWM A;  1M90 C;  1VQN A;  1UWV A;  1IHZ A;  2JK8 A;  1DOL A;  1JWM D;  2A69 D;  3S2D H;  5M5W H;  4IZ8 A;  2BCO A;  3S2H B;  4G7H C;  4UDU C;  2DY7 A;  1Q46 A;  2JXM B;  2R93 G;  4A3K H;  3ERS X;  5HUR A;  3E5S A;  3NE5 B;  2NVX B;  4MIU A;  1IL2 A;  3TME A;  1B44 D;  2L11 A;  1UE7 A;  1F2L A;  3DWA A;  3J81 L;  2KHS A;  3K0X A;  2ZT9 C;  1VQO A;  1VQE A;  5LL6 S;  2MUY A;  3HG9 A;  4C3H H;  4DR2 L;  4BBS B;  1CSQ A;  2AQ3 B;  3U9O A;  3RZO B;  1HNW Q;  3TN2 A;  3RMH A;  1TT2 A;  1V9P A;  3G6J B;  3AB9 A;  5LMU L;  4A3G H;  1YJN A;  3K7A B;  3RR5 A;  2K5H A;  2RSN A;  5FOB B;  3LWE A;  4DV2 Q;  3L2P A;  1QUQ A;  1HFN A;  1LTI D;  1SNM A;  3RNU A;  4BBS G;  2NB0 A;  3HRZ C;  2JQO A;  3VA5 A;  2KEN A;  4A3J B;  2VS1 A;  2G9D A;  1RHP A;  4WJ4 A;  2L15 A;  3E9H A;  3FDT A;  2ZJP A;  3C1F A;  1RL2 A;  3S16 B;  3OPO A;  4AYB G;  4IOC A;  3ZYY X;  4JI0 Q;  1OXV A;  1SNQ A;  5FJ8 G;  4M1U B;  2CFM A;  4NXM Q;  3G4S A;  2K5D A;  3K81 C;  5IYC G;  5A2Q E;  1EU4 A;  3HOZ G;  4RGM A;  4JI5 Q;  4F88 A;  1QNK A;  4IPH A;  4IJH A;  3HKZ B;  4A3G G;  3WOE A;  3TRE A;  2HCI A;  4L6T B;  3CKI B;  2MO1 A;  1QZG A;  4IUT A;  1D5M C;  4G57 A;  4LF5 L;  2ZTC A;  4HED A;  4ZUJ A;  3U4Z A;  1ICF B;  1EWH A;  5IWA Q;  1TWG H;  4DF7 A;  5FLX c;  3M9B A;  3VYS A;  1YIT A;  2HCC A;  2UUB L;  4DV7 L;  1RIP A;  1ICW A;  3M7G A;  5FO9 B;  1TWH B;  2OWO A;  4LF6 L;  3GTO B;  3AYH B;  3TS2 A;  3ULJ A;  4BA1 I;  1VQJ A;  4CDF C;  2F0L A;  4QUC A;  3NWT A;  4AYB E;  4FF3 A;  4JPB W;  3VR2 A;  4GKJ L;  4BBR G;  3HOW H;  4A93 B;  2Z8L A;  5IT9 L;  4A3D B;  1I3Q B;  1EY5 A;  3MC0 B;  1R4P B;  1B3A A;  3S1M H;  5DEH A;  1HCZ A;  3A54 A;  2EYM A;  4B3T Q;  4LK1 C;  1LAB A;  3HOX H;  3M4Q A;  1STH A;  1WTO A;  1PH9 A;  1CZW A;  3H3V H;  4RCO A;  2JEB I;  3KF6 A;  5LMN L;  2B2U A;  2EE1 A;  2Z1C A;  5JVH 3;  3ULL A;  4XYO A;  3BZK A;  1Y1W H;  4JI0 L;  1NCV A;  2DJG C;  1IL8 A;  2K1B A;  1DJR D;  4NXM L;  2NVT B;  2SOB A;  2K4K A;  2HD3 A;  3F2U A;  4JI5 L;  1H9J A;  1PZJ D;  3JAM i;  3EQL C;  1LYL A;  2NN6 H;  3E6Z X;  1LTL A;  1CKN A;  1WTR A;  4ME3 A;  4OO1 H;  1TKW B;  2EIF A;  4QJF A;  3VDY A;  4X3K A;  1NNX A;  4DNR B;  2EYJ A;  1TU2 B;  4IUU A;  2OCE A;  1QJO A;  3S15 H;  1HR0 Q;  5CR3 A;  2CWP A;  4DV7 Q;  1I6H H;  2Z4H A;  1IBL L;  3R8B A;  2WII B;  1X3Q A;  5M3M G;  1HZB A;  1DOM A;  3T1H L;  2WFW A;  3PO2 H;  2X69 A;  2PMZ B;  1JWS D;  1K83 B;  5KYI A;  4O1N A;  4DN4 M;  4DUY Q;  4JV5 L;  3CRL C;  2K5V A;  4ABN A;  1I6H B;  2LS0 1;  1XJV A;  2WB1 E;  2LFN A;  3CCM A;  4BY1 G;  3FRP B;  3KBG A;  1K83 H;  5C5L A;  4GLX A;  4IUR A;  4A3M G;  2E75 C;  4BBR H;  4BA2 I;  4JC0 A;  4JI3 L;  2CHB D;  3H09 A;  5C5M A;  3K5N A;  1WD0 A;  4K8I A;  3K5M A;  3S17 H;  2UUA Q;  4KHP Q;  3LGJ A;  1SMY D;  5EAY A;  1KRT A;  1LUZ A;  3GTP H;  1BCP C;  3TP8 A;  1VMC A;  2C35 B;  2O4X A;  3CHB D;  3HOX G;  1EYG A;  2B63 H;  4TVA B;  5JPN C;  2HUG A;  3RD4 A;  1RTN A;  2VUM G;  3BVG A;  2R92 G;  3S17 B;  4DV5 Q;  3QOL A;  4LF8 Q;  4A3I B;  3NUC A;  3J81 c;  4B9W A;  3RZD H;  2ZJR A;  1QE6 A;  1TWA B;  4A3C H;  4KLK A;  1KTK A;  1L1O A;  4C3I G;  5I9O A;  1Y1W G;  4QF4 A;  1ET9 A;  5C4X B;  1DOK A;  3SE0 A;  2K04 A;  2YTY A;  3BZC A;  2JA6 H;  4R1J A;  2MJ8 A;  1IBL Q;  1GUG A;  4Y52 H;  5M9O A;  5I6W A;  4DU9 A;  3T1H Q;  2CH4 W;  3KLW A;  3PO2 B;  2KA7 A;  3SVM A;  4EQP A;  4OIJ A;  1KL9 A;  2A68 D;  4KHV A;  5K5P A;  1QVC A;  5ELF A;  1G8Z D;  1BF4 A;  1JJ2 A;  4DV3 L;  1M8A A;  3EJI A;  3K80 C;  3D8G A;  1U5K A;  4AQY Q;  1HZ9 A;  3T56 B;  2EYF A;  4CGY B;  4TRD A;  4HJ5 A;  2LSS A;  3EA6 A;  4JI3 Q;  1ENA A;  3HKS A;  5FKA C;  4X66 L;  2O2L D;  3FKI H;  1U4M A;  4X65 Q;  3U9S A;  1YNN D;  2Q8T A;  2KEC A;  2QKI C;  1PHJ A;  5CV5 A;  1F9P A;  4LAA A;  4DK6 C;  1RF2 D;  1PRT D;  5GAD C;  2ZTE A;  1KAB A;  3GP7 A;  4KI0 A;  1WCM G;  5JEA G;  2A8V A;  5C0X J;  3CU7 A;  1YBY A;  1I50 H;  2F0K A;  1DM0 B;  1PYW D;  3DLL A;  4BY7 H;  1Q90 A;  1VMP A;  4K8J A;  3GTJ H;  4B3M L;  2QA4 A;  4MN3 A;  5M5X H;  1TS3 A;  2F4V L;  3CD6 A;  1D6E C;  3E3X A;  4XIG S;  3A8I E;  2EYP A;  3DHQ A;  1U4L A;  3QB3 A;  3J7Y W;  1EZ6 A;  1PH6 A;  5DM6 3;  1K3B C;  1O78 A;  3GTJ B;  2B2W A;  1LTG D;  1ZXT A;  1UNS A;  2EJM A;  3CC7 A;  3S14 H;  2KCT A;  1YNJ D;  2JA8 G;  3PIO A;  4LW1 A;  4L5S A;  5M3F H;  1XTD A;  1V1Q A;  4PZ7 A;  1N36 L;  2X6L A;  4OEM B;  2WAQ E;  2AQ2 B;  4RGN A;  1EYA A;  1LT6 D;  1UE1 A;  1GHK A;  2OXP A;  2HIV A;  2Q2H A;  5D65 A;  3K7U C;  3TP5 A;  4X65 L;  5J22 A;  1CA5 A;  1RCV D;  4ILW A;  5M5W B;  1S3O A;  3UDI A;  1WD1 A;  3HOY B;  1CI3 M;  4IUP A;  4MZ9 A;  4N8X 1;  1PFN A;  5FO8 B;  5M5Y H;  4LFA L;  3NTH A;  3CCS A;  3MXG A;  3MXP A;  1SJE D;  3M4O H;  1AZP A;  4LWC A;  4DR6 Q;  4ZCK A;  1H9M A;  2EYH A;  2K50 A;  2R7F A;  2F0G A;  5JJL A;  4DAP A;  3A8J E;  5GQO A;  2RHS B;  2F0J A;  2QF7 A;  3KDF B;  1WTV A;  1SNP A;  3CQZ B;  3UE0 A;  1Z9F A;  1YHQ A;  4A76 A;  4B3M Q;  4JI7 Q;  1JE4 A;  4FVM A;  1EL0 A;  4NXN L;  4Z9C B;  1U4P A;  2EPB A;  3ONA B;  4JBM A;  2PI2 A;  1EIY B;  4JVZ A;  3TEH B;  3HOU G;  4OO1 G;  2A1A A;  4QGU A;  1ENC A;  1VQH A;  4DUZ L;  1K8G A;  1TS4 A;  3QIA A;  2I46 A;  1K73 C;  1STY A;  2D9U A;  5C4Z A;  1N36 Q;  1EFW A;  3WWV A;  2MP1 A;  3NHH A;  3PUZ A;  3KJO A;  2F0U A;  5ISR A;  5I4D A;  2F3W A;  4ZKC B;  4GNX A;  1VF7 A;  3GQB A;  4HTH A;  1Z7T A;  4JI6 L;  4UPA A;  4JCV E;  5GAH C;  2DUD A;  3D4R A;  2YYZ A;  4R4C A;  2FXQ A;  3RLO A;  4RAU C;  1HZC A;  1EEF D;  5M3M H;  1ONL A;  2AQ1 B;  1S5B D;  1ZYR D;  3SK6 A;  5M5Y B;  1W2B A;  5JAV A;  3I4N G;  1XX8 A;  1QOH A;  1EIF A;  4JI4 L;  4A3L G;  3S2H H;  3BS1 A;  4HSV A;  2E76 C;  2NTS A;  5AFW A;  3PMF A;  2KVM A;  3FPU B;  2EYL A;  3KLS X;  3W2D A;  5EPJ A;  3TQY A;  2K75 A;  2ZM6 Q;  1I4H A;  4HID A;  3Q0A A;  3L7Z C;  2UXC L;  1SEB D;  1K9M C;  2KED A;  4L5R C;  4A3D H;  3A5Z B;  1P16 A;  4HJ7 A;  1Q8K A;  3CME A;  1A15 A;  2R93 B;  5JJZ A;  1BBW A;  4JI1 L;  3LNN A;  2NZO A;  3KF8 B;  4KK7 A;  3TP6 A;  3GTK H;  3I4M G;  2LXJ A;  1PZI D;  2DJF C;  3NEM A;  1K3R A;  4AH6 A;  3J80 L;  4C3H B;  1PH1 A;  1A3U A;  1JWU D;  5JJK A;  1B7Y B;  4YWL A;  1NTG A;  4CHT B;  1TWF B;  2PNR C;  1CFM A;  2I0Q A;  4RG1 A;  2VL6 A;  4LF7 L;  1I4R A;  1VQ5 A;  4J1M A;  1JQY D;  3I3C A;  3HOU H;  2EQS A;  4HJA A;  2F4I A;  3RZD B;  4DR5 L;  3NP8 A;  4H02 A;  3TDQ A;  5IE8 A;  4GKK Q;  2L0C A;  2LMC B;  1OXT A;  4OGQ C;  2Z6B A;  5C44 B;  1FD7 D;  1HA6 A;  4GN4 B;  1Y1V G;  4YCW A;  3S1N B;  3EVQ A;  1A2U A;  5C3X A;  5IY0 A;  4AYB B;  1HNX L;  3CCR A;  1ESR A;  1CT1 D;  2NYZ D;  4LUO A;  1SE4 A;  5CV7 A;  3H0G H;  3H94 A;  1Y1V B;  1VF5 C;  3C46 A;  3KUP A;  3CCV A;  4NB3 A;  5JOB A;  1XNR L;  2F0F A;  4AIM A;  3P7J A;  4FDB A;  4DV0 Q;  4A3J G;  1NAP A;  1HNW L;  4XQQ A;  4DAY A;  3W3A A;  4V19 0;  4ZK9 B;  4OX9 Q;  4MNO A;  2IX0 A;  3BJU A;  3K5O A;  2F0I A;  2ZTD A;  2EXD A;  3DEP A;  4R9W A;  4DV2 L;  5IIF A;  1VCI A;  2F0H A;  1KXL A;  4G7O C;  1ROD A;  1YVC A;  2IHF A;  3SR1 A;  1L2F A;  1HRJ A;  4TQU S;  3E0J A;  1QVG A;  3LWU A;  3D6W A;  4K5V A;  4PZ6 A;  2RCF A;  1TS2 A;  2VB2 X;  4LF7 Q;  3GTG H;  1AE2 A;  3C1E A;  1P8L A;  4XT1 B;  5ELN A;  2B2Y A;  2Y0S B;  5LMN W;  1STN A;  2LKV A;  4FF4 A;  2O5J C;  3QR8 A;  5CMD A;  2K14 A;  4DK1 A;  1Y1W B;  2G9H D;  1UAP A;  4A3I H;  2EJG C;  1LLR D;  2A69 C;  1MSH A;  2Z0S A;  4L5Q A;  1XXG A;  1IXR A;  3ND8 A;  5IWA L;  1HH2 P;  5J39 A;  3VA7 A;  3S1N H;  1DZ1 A;  5C0X I;  3RLF A;  5FLM H;  4BBR B;  2UUB Q;  4A93 G;  2JSO A;  4NPS A;  2CKZ B;  3GTQ B;  1I4X A;  2WB1 B;  3RN5 A;  5CBE E;  4MHE A;  4CDD C;  2BOS A;  1JMC A;  1XNR Q;  2X6G A;  3PV0 A;  4GKJ Q;  2N55 A;  1B9N A;  1CZG A;  3OIP A;  2B3G A;  1BKB A;  4IPD A;  4H44 C;  3FKI G;  4KD3 A;  1U9R A;  3TZU A;  4F8M A;  3GTL B;  4QIW B;  4B3T L;  3I55 A;  1JJG A;  3MEF A;  1II3 A;  1NE3 A;  5LMN Q;  4OXP A;  4XYQ A;  2KOL A;  1IYU A;  1KDB A;  5C44 G;  4WJW A;  2XSC A;  4DV6 L;  2ALY B;  1GJX A;  1LTS D;  1MHW C;  3TSS A;  3PUV A;  4FF2 A;  2E2D C;  2K03 A;  1VQK A;  4BY1 B;  4PNY A;  4YCU A;  1VQL A;  1WOC A;  4L8J A;  3HOV H;  2Z6K C;  4CJ2 C;  4CJ1 B;  3CMA A;  2CW0 C;  4ZAI A;  2RF4 A;  5C4J B;  1NY4 A;  3I2Z A;  5C4H A;  1Q7Y C;  2F0S A;  3T13 A;  1WTW A;  3H3V C;  1A3T A;  2B63 G;  2F0P A;  1DGS A;  1G6P A;  3BDC A;  1C9O A;  5M3F G;  4U68 A;  1XPU A;  4K14 A;  5TSS A;  3VYU A;  3N6R A;  3E0E A;  4NKL A;  4OON A;  3X3N A;  2UU9 Q;  2OQK A;  3HP3 A;  2JA6 B;  4GOP A;  5KRU A;  1O7I A;  2YU9 B;  5ELO A;  1OXS C;  1W6J A;  3W1G A;  1C8C A;  1LM0 A;  1X54 A;  1GM5 A;  1O80 A;  1GO3 E;  3P20 A;  3Q22 A;  3GTL H;  1VQI A;  2NUC A;  4A4I A;  1IBK L;  4ZQ3 A;  3J7A V;  1BXT A;  5F2D A;  3NXW A;  4JOI C;  4POF A;  3H0G B;  4RHS A;  1GVP A;  1JT8 A;  2UUA L;  4KHP L;  3MXN A;  4JG2 A;  4JYA L;  2XNA C;  2KCC A;  1PRT C;  3GDE A;  4DV6 Q;  4KKU A;  5KGU A;  1EY9 A;  2AWO A;  1J5E Q;  1STE A;  2E2H H;  3J80 c;  2A5H A;  5AJ3 Q;  4PMW A;  4DV5 L;  2K05 A;  4LF8 L;  1L0W A;  4GS3 A;  1XPO A;  2F0M A;  2VNU D;  3D3R A;  3ER0 A;  2Z4I A;  3GO5 A;  3K6O A;  2AKW B;  4RMF A;  3MXU A;  2JA7 H;  1AFP A;  2E2I B;  3A74 A;  4NP5 A;  1LT5 D;  3GTM B;  1MGS A;  1EFI D;  3I70 A;  1SMX A;  3DUZ A;  5J1Z A;  5D3D A;  5HGT A;  2EJF C;  3N52 A;  1YI2 A;  3STB C;  4K6L A;  5C0X H;  1X3E A;  2WAQ B;  2N8N A;  2VXW A;  4KTA A;  1PRT B;  2EOT A;  1DCZ A;  3F2D A;  1PTO B;  1S5E D;  4RWS C;  3U58 A;  3BYY B;  2JYO A;  2G5D A;  4DV3 Q;  4BXX G;  2NVQ H;  1MIU A;  1RTO A;  3K7A H;  2H1E A;  4R4O A;  2KEE A;  2Q2T A;  4AQY L;  1O7Y A;  1IBK Q;  1SBB B;  1KLU D;  4PQX A;  4K0K L;  1FYC A;  2K6A A;  5NUC A;  1E2V A;  4QQB X;  4N9P A;  1VQG A;  4QY7 A;  2XRS D;  4A3E G;  2OTJ A;  1SYE A;  1S5F D;  2PQA A;  3TS0 A;  3VR3 A;  5GAG C;  2JA5 H;  2IWH A;  1I4G A;  1PH3 A;  4K5W A;  4NMZ A;  1ZKO A;  3I7F A;  1YNJ C;  1YHB A;  3BYT B;  3I56 A;  5AJ3 L;  3PF5 A;  3J80 E;  1Y8P B;  1JB7 A;  2I5H A;  1I94 L;  1YHA A;  5IP7 H;  4X6A H;  1B8A A;  1SRO A;  1VQB A;  3PSI A;  3BDL A;  1I4Q A;  1HTP A;  2HQL A;  2L55 A;  1EOT A;  4IUN A;  4A3M H;  2D5D A;  3SK4 A;  3HOX B;  1PTO D;  2BDN A;  3OW2 A;  5EKI A;  2HHH Q;  3T51 B;  3AFQ A;  5ELE A;  4RFB A;  3J81 i;  1A0I A;  5ELB A;  1SNO A;  2EVB A;  3I8Z A;  2R7Z B;  1A3V A;  2CWA A;  4EGV A;  4C1N K;  3DXJ C;  3HOW B;  2WKC A;  1E2Z A;  2ENB A;  3HKZ E;  1EEI D;  3OMG A;  3EBE A;  5KIX A;  1G51 A;  3DWQ A;  2DGY A;  3D4W A;  1XNQ L;  1HXY D;  3PGZ A;  3UDF A;  1VQ9 A;  5EPL A;  4LF4 L;  1MJC A;  4H0L C;  1Y8O B;  3KOJ A;  4EQN A;  5IYB G;  1TXY A;  2VZA A;  2E8G A;  3A8K E;  2RQX A;  3D4D A;  4K0K Q;  1DXM A;  4KKS A;  1TR5 A;  3CAM A;  3PUY A;  1GUN A;  5IGB A;  2OTL A;  5K36 H;  4A3B H;  4CKC A;  4DNT B;  4JK1 C;  1LT4 D;  4DAM A;  2JA5 B;  4K6D A;  3C3L A;  1K28 A;  4H13 C;  1Z6H A;  4DR6 L;  2MQH A;  2FMC A;  5E7N A;  4J6H A;  1JJC B;  1VQD A;  1CA6 A;  2ZXR A;  1TS5 A;  1C7Y A;  1SXT A;  2B2V C;  2QIL A;  3HOU B;  4NW2 A;  2R3Z A;  1PMR A;  4DKA C;  5C3W A;  2OT2 A;  1V1O A;  1TY2 A;  3CCJ A;  4PZ8 A;  5I9P A;  1XYI A;  2RCN A;  4NXN Q;  4Y7N B;  4OWW B;  2IL8 A;  3P1H A;  4UP9 A;  2DNC A;  3D6C A;  2ID0 A;  3NEN A;  3RUZ A;  5C0X G;  5IYD H;  2VQE L;  1B70 B;  1Y14 B;  1WTQ A;  2FMM A;  5IP7 G;  2PQA B;  1PTO H;  1BQQ T;  1CSP A;  1CTM A;  1SDF A;  3KLS A;  3O13 A;  4RGT A;  4Q5V A;  2RA4 A;  4JI8 L;  1VQ4 A;  1NUC A;  4DUZ Q;  3NQI A;  2NVQ B;  4K2L A;  1BCP D;  4PMC A;  4FXD A;  2UXD Q;  3MAQ A;  1ZYR C;  1WTH A;  1LTB D;  4LF4 Q;  3FHW A;  4JI6 Q;  1GD7 A;  3A5U A;  4DXF A;  1PH5 A;  2Q2U A;  4IO9 A;  1LTR D;  4RCN A;  3G7L A;  1A2T A;  4HIM A;  3KF8 A;  3J81 E;  1Z47 A;  4YCV A;  1WYD A;  2K01 A;  3I90 A;  1EIG A;  1CUK A;  1FVI A;  3T16 A;  4C3J G;  5T1G A;  4A3L H;  1ZEQ X;  4G7Z C;  4JI4 Q;  4I7A A;  1EY4 A;  3RLN A;  2KJX A;  2EXZ A;  3QJY A;  1KC8 C;  3W1B A;  4O0A A;  1UEA B;  3MHB A;  2N88 A;  4C3J B;  1R4Q B;  1AP0 A;  4QB4 A;  2ZM6 L;  1JE5 A;  4IFD J;  1D8L A;  2UXC Q;  4IFD H;  3GV3 A;  2XVS A;  1DD2 A;  3ERO A;  1SE2 A;  1D5X C;  4O2D A;  4JI1 Q;  1CKM A;  4Y7N H;  3G48 A;  4KJO A;  5IOD A;  1EQQ A;  1X3G A;  2OQ0 A;  4TKO B;  3QG1 A;  1X56 A;  2Y0S E;  1J8I A;  3KLR A;  1QIL A;  3KK7 A;  5IGF A;  4JI8 Q;  2NZH A;  1B4O A;  4BY7 G;  4POG A;  2R7D A;  4CKE A;  3HOV G;  2HDM A;  2UXD L;  4XT3 B;  1WFQ A;  2ZXO A;  1I5F A;  3SXH A;  2BH8 A;  1QG7 A;  4DR5 Q;  4LMQ D;  3M4P A;  3NTI A;  1B2T A;  3PO3 G;  3HOV B;  4GKK L;  1GUW A;  1KNA A;  1D2B A;  3MXN B;  4FP5 D;  5FK9 C;  1QWY A;  4B9X A;  2K28 A;  3GD7 A;  3FPP A;  3G71 A;  4ODG A;  3VR5 A;  2C5C A;  4GLA C;  3CF5 A;  2E2I H;  1XMO L;  5EKL A;  2F3V A;  1HNX Q;  3S24 A;  1N33 Q;  1YIJ A;  1PFM A;  4LFB Q;  3IRB A;  2DY8 A;  4X3S A;  1B9M A;  1D5Z C;  1V1P B;  2J0T D;  3BZD B;  1X6O A;  2P5Z X;  1S5C D;  3L9A X;  1LV9 A;  5G3L F;  1UUP A;  2HIX A;  1SSO A;  4DV0 L;  4DK0 A;  1CK1 A;  1J6Q A;  1X32 A;  4IN3 A;  4R4Q A;  3R3O A;  1JC7 A;  5C3E B;  3MA2 B;  2YU9 H;  4IUV A;  3GTK B;  1PH2 A;  4HN7 A;  1IKL A;  5BR8 L;  1SND A;  4OX9 L;  2FFK B;  4A3J H;  4GN5 A;  5C4X G;  3HZX A;  1EQR A;  1M1K C;  4KY5 A;  2FJ2 A;  1E0B A;  3GTQ H;  4P2C B;  4YWK A;  3S9W A;  3Q24 A;  5E3F A;  1MI2 A;  4IPC A;  2K5Q A;  2Q8I B;  3TRZ A;  4A3D G;  1PH4 A;  2K33 A;  3IFT A;  2WIN B;  4XXE A;  2MHV A;  4C1N I;  4N8F A;  4GOP B;  3X3M A;  5C44 H;  4L63 B;  1NSN S;  2F0W A;  2KHI A;  3S2D B;  2WKD A;  4C3H G;  1GUT A;  1VDZ A;  5IT9 E;  1ILP A;  2AWN A;  3PIP 3;  2A6H C;  5IT9 c;  1BDO A;  4IAL A;  1EU3 A;  1Q3L A;  1SMY C;  4JOI A;  5HGQ A;  1T5X D;  2PQE A;  1ASZ A;  1B1Z A;  4GNX C;  2B2T A;  4B3S Q;  2I5L X;  4DXG A;  3IL8 A;  3NBH A;  4LF9 Q;  4KY7 A;  3K8A A;  3FKI B;  1GUO A;  1WJJ A;  4DV4 L;  2IW3 A;  2NWG A;  4C56 C;  2KCN A;  4WFN 3;  4BY1 H;  1E1T A;  1CQF A;  5IGD A;  1PTO C;  4UHV A;  5FLX L;  1H9K A;  2O5I C;  1SYG A;  1S40 A;  1H9S B;  2Z6K A;  2LY7 A;  4DK3 C;  4OHJ A;  2PW5 A;  2AMC B;  2MPM A;  1JIC A;  4EQO A;  1X3P A;  3ND9 A;  2HT1 A;  4YY3 Q;  2KUM A;  2D2C C;  3SHL A;  2R6G A;  3BVZ A;  5BR8 Q;  4A3E B;  4ID6 A;  4H7B A;  2VY3 A;  4ZUI A;  2E2J H;  4RA8 A;  2JA7 B;  5EQ0 A;  1PH8 A;  1Q1E A;  2IHE A;  1L0Y B;  4LFC Q;  3GTM H;  3V05 A;  4MTN A;  4IUQ A;  1BVS A;  3A7A B;  4PMB A;  1LAC A;  4RH6 A;  1Y1V H;  2IT1 A;  2IPK D;  4DGZ A;  2PYK A;  4BWG B;  2A6E C;  1L1O B;  2B39 A;  3M3Y B;  4EVO A;  3M4O B;  1IKM A;  4C3J H;  1XMQ L;  4HJ8 A;  4A3F B;  1KD1 C;  2I5M X;  4FO2 A;  1WCM H;  5JEA H;  4R4I A;  3S1Q B;  4UY8 C;  2NVY H;  4QUF A;  1PLF A;  2EDG A;  3AQQ A;  1D7Q A;  4OWX B;  4CBV A;  2BDO A;  5EJW A;  4A3F G;  1EY6 A;  2Y0S G;  3J7A 5;  4LF9 L;  4M8A A;  4R8N A;  3S1Q H;  5EGT A;  2ICE C;  4DV4 Q;  4KHZ A;  3CXC A;  4I65 A;  1SFO H;  4LUV A;  4O42 A;  2IX3 A;  1GHJ A;  4UP8 A;  2UU9 L;  5HY6 A;  1C4Q A;  1MD2 D;  5D3I B;  3TZD A;  3H0G G;  5IYB H;  5CC4 A;  2A73 B;  1ESF A;  1MBY A;  2QGQ A;  1EIH A;  2CVR A;  4YY3 L;  1XTC D;  3HEJ A;  1N8R C;  3BDO A;  1N32 Q;  1PTO F;  2BA0 A;  3NTK A;  1K0R A;  4CJ0 B;  1G2T A;  3F1Z A;  1FGU A;  1K0S A;  4YIJ A;  3A0J A;  3OMC A;  4JBW A;  4P71 A;  1PA6 A;  2NVX H;  4K2K A;  1FR3 A;  1KAW A;  1T9H A;  4JYA Q;  4BS9 A;  1ET6 A;  3STB D;  2IX1 A;  4CDC C;  2KHJ A;  1J5E L;  4YHH Q;  1VQA A;  1R9T H;  1G91 A;  4X62 L;  1XMQ Q;  4HIK A;  3OWF A;  2AUK A;  2M00 A;  5JVG 3;  5I2X A;  3JAM L;  4XDX A;  2JP1 A;  1TWA H;  1Q81 C;  1U4R A;  5DNF A;  1W3S A;  4OEL B;  2DN8 A;  2C9O A;  2SDF A;  2WAQ G;  2K5N A;  2D62 A;  5DM7 3;  1WTP A;  3VR4 A;  5T1I A;  4JBK A;  4LJZ C;  1RD9 D;  2PPB C;  4RGO S;  2XIW A;  1BBX C;  2CW0 D;  1FNV A;  2OF1 A;  5A35 A;  1M4V A;  1N34 L;  1X65 A;  1IYJ B;  2JA8 B;  1E24 A;  2AHO B;  2PCF B;  2D0O A;  2DNE A;  1L1O C;  3S1M B;  5JPM C;  3PO3 H;  2JA9 A;  1UEB A;  4Q0F A;  2EY2 A;  4JI2 Q;  4A93 H;  5I6Y A;  3J80 i;  1YNX A;  1N32 L;  4DV1 L;  2UXB L;  4RKL A;  3C2P A;  1TY0 A;  2MGS A;  4DR3 Q;  1SFO B;  4P73 A;  5FLM G;  1F2M A;  2RBM A;  3ICE A;  3I4M B;  1SN8 A;  1TWH H;  2JA6 G;  5IYC H;  1F9R A;  4WOR A;  1GUS A;  5BN3 A;  2R93 H;  1QUQ B;  4KY6 A;  1PFB A;  1HUN A;  3EFX D;  1STA A;  3OTO L;  3MFY A;  2GN5 A;  4B08 A;  1QZH A;  3K0Y A;  2F03 A;  4X62 Q;  1NBW A;  1I94 Q;  2H4O A;  4IFD G;  4HR7 B;  1UE6 A;  3I4O A;  2N49 A;  3I4N H;  3PCO B;  2RKS A;  2K52 A;  2R92 H;  2L5T A;  4X3T A;  1R9T B;  4N9T A;  3BU2 A;  3QO2 A;  3KDF A;  3AU7 A;  3HOW G;  2F0V A;  4GNX B;  3A56 A;  1BR9 A;  2A6E D;  1YJ9 A;  1FNU A;  4DR4 L;  2HHH L;  1CKO A;  1B53 A;  4L5T A;  3T1Y L;  4ZKB B;  3KJP A;  1AW7 A;  5FJ8 H;  2B2W C;  2KBN A;  1G2S A;  3F2C A;  4GOP C;  2NZ1 D;  1O7Z A;  3V2T A;  3PO3 B;  2RSO A;  2QDL A;  4DNI A;  1XNQ Q;  4JI2 L;  2CQA A;  2QEX A;  3HOZ B;  4KD4 A;  2R61 A;  1K8M A;  2RDG A;  1STG A;  2JJQ A;  1ASY A;  1X9N A;  2XWJ B;  3J7Z C;  1AH9 A;  4F7X A;  4ZRZ A;  1VQP A;  4ALP A;  2QCP X;  3GTO H;  2JA8 H;  3F8T A;  4QMG A;  2KQ3 A;  1F9S A;  5IGE A;  1NJI C;  4OIK A;  5GRO A;  2GVB A;  2H5X A;  3QWN A;  2VW9 A;  3BVM A;  1OTC A;  1S72 A;  5IGG A;  3F2B A;  2OEO A;  3L3O C;  2MNA A;  4A3K B;  1EWC A;  5C3E G;  2WAC A;  5CV4 A;  5IGC A;  5CBA E;  5I2Y A;  1E3P A;  4KN4 C;  1F77 A;  2PW7 A;  5E4W C;  3GTG B;  5KEE A;  3NPP A;  4A3K G;  2ICI A;  2E5L Q;  4J15 A;  3TP7 A;  2A19 A;  1JB3 A;  4RKB A;  3T1Y Q;  1SE3 A;  1B3Q A;  1E1O A;  4P74 A;  5J3B A;  2EZV A;  2VQE Q;  2NBF A;  2K32 A;  4A75 A;  1U0L A;  5D14 A;  4QCL A;  1QVF A;  3PIP A;  3DMU A;  2JEA I;  1Q1B A;  1LT3 D;  2YV5 A;  3FEW X;  5M5X B;  1BOS A;  1Q8I A;  1BUV T;  4DR2 Q;  1CM9 A;  3UDX A;  2F0O A;  4ME5 A;  1HQM C;  3K59 A;  4KJN A;  4P72 A;  5LMU Q;  1HNZ Q;  1SYC A;  5BN4 A;  1HFG A;  3WOF A;  1GKH A;  1K8O A;  3MEH A;  5CYU A;  3CCQ A;  1RJT A;  2F0Q A;  3Q8D A;  1PFS A;  2XWB B;  3V96 A;  1DON A;  3S15 B;  2K7V A;  2LXK A;  3GTP B;  1HR0 W;  3EIV A;  2TSS A;  3PF4 A;  1FGB D;  5A2Q L;  4PV1 C;  2NVT H;  1OO9 B;  2J4X A;  1FJG L;  1MJE A;  2CH4 A;  3NQT A;  2RHQ B;  2ES2 A;  1KLG D;  3FP9 A;  3T53 B;  4XQN A;  4LNQ A;  1TII D;  2B2V A;  1EYC A;  1A8V A;  4CKB A;  4LF5 Q;  1KHI A;  3MFG A;  4NDX A;  1EYD A;  2NTT A;  4A3B G;  5LHY 1;  3A7L A;  2JA5 G;  2IY5 B;  2B8F A;  2VQF Q;  2E5L L;  5IP9 G;  2ZJQ A;  1JCK B;  1SE8 A;  1TWF H;  3PQI A;  4E6I A;  5DLQ E;  4A3G B;  4KN7 C;  3TBI B;  4A3E H;  4OO1 I;  2XTI A;  2YTV A;  3D0F A;  3CRK C;  4LF6 Q;  4BBS H;  3OWE B;  2R7Z H;  2E2J B;  1STB A;  2B8G A;  1JOQ A;  5M3F B;  4DAV A;  3PUX A;  1FNW A;  3MWY W;  3NWS A;  3JC6 6;  2F52 A;  3S14 B;  1EOV A;  1MSG A;  4X64 Q;  4J8Q A;  3HKZ G;  3MTS A;  4WRD A;  1TWC B;  1VQF A;  3ITP A;  4IPG A;  1VS0 A;  5COY A;  2FHT A;  4R8I A;  1HNZ L;  2VUM B;  2R92 B;  1I4P A;  1NMG A;  5H1S E;  1IW7 D;  2ATW A;  2L1B A;  1AE3 A;  3SEB A;  3DWP A;  1EZ8 A;  2Z9H A;  2E74 C;  4V0B A;  1KQS A;  2F0E A;  2XRQ D;  3R2I A;  4A3C G;  3NEL A;  2XGT A;  3DM1 A;  5L37 A;  5CGK A;  1S4Z A;  5IYD G;  1XMO Q;  2J7Z A;  3HOY H;  1N33 L;  1H9S A;  1C48 A;  5K36 G;  1YEZ A;  3M7N A;  4WJ3 M;  1QNU A;  4GZY C;  2E2H B;  4LFB L;  1FJG Q;  4CDE C;  4DR1 Q;  2B2U C;  3K5L A;  2A74 C;  3UI2 A;  2PZT A;  2RDF A;  5JEA J;  1TQO A;  1N9W A;  2HQE A;  2L9H A;  4KV6 A;  1WVL A;  5KNC A;  1SAP A;  1AN8 A;  2AUJ D;  2VQF L;  1HR0 L;  1E7Z A;  2JN4 A;  2PNH A;  1SYD A;  2K5W A;  2L4N A;  4G4K A;  3OOC A;  1SNC A;  1HHV A;  1I3Q H;  4APV A;  3D31 A;  1VQ8 A;  2WB1 G;  2WV6 D;  2ZXP A;  4ZYS A;  1VQM A;  2NN6 I;  1HJP A;  5COR A;  1I50 B;  1AZQ A;  1O7L A;  4DUY L;  4JV5 Q;  3EN2 A;  1SYF A;  3KF6 B;  3OSO A;  4X64 L;  1HTL D;  4UAI A;  3NSW A;  3URY A;  1JR0 D;  3A55 A;  4JBJ A;  3MZ5 A;  3U50 C;  1OXU A;  3RN2 A;  5DAU A;  2ASB A;  1CHP D;  1KRS A;  4QL5 A;  2JA7 G;  1LO5 D;  2F0D A;  1OXX K;  4HCS A;  3W5O A;  3S1R B;  4A3M B;  2N3S A;  4B3S L;  2B2Y C;  4A3B B;  5EBC A;  5M3M B;  3I91 A;  1EY8 A;  1PDQ A;  1SYB A;  2NVY B;  3VYT A;  3HS0 C;  2PZW A;  4DR1 L;  4XTC S;  4HCE A;  2BA1 A;  1L0X B;  1EQV A;  2L12 A;  5FLX E;  4HIO A;  1NR4 A;  3K58 A;  3HOZ H;  1D1I A;  3FVQ A;  1HQR D;  1BBU A;  5CV9 A;  1HPC A; 
#chains in the Genus database with same CATH homology
 1SLJ A;  3LGJ A;  3E0E A;  4OON A;  5EAY A;  1KRT A;  4C3J H;  1XMQ L;  1LUZ A;  3CPW A;  4A3I G;  2UU9 Q;  2OQK A;  1YJW A;  3GTP H;  4HJ8 A;  2C35 B;  3HOX G;  1KD1 C;  3CP0 A;  1E22 A;  1EYG A;  2B63 H;  4EQ5 A;  2I5M X;  4GOP A;  4TVA B;  1WCM H;  4IJL A;  1O7I A;  4R4I A;  1KIX A;  5ELO A;  1OXS C;  2NVY H;  1X55 A;  3W1G A;  4UY8 C;  2VUM G;  4KHP Q;  1LM0 A;  2R92 G;  1X54 A;  1GM5 A;  4DV5 Q;  1GO3 E;  4LF8 Q;  3AQQ A;  3CQZ H;  4OWX B;  1D7Q A;  3GTL H;  1VQI A;  4A3F G;  4A4I A;  1IBK L;  3E9I A;  4LFC L;  4EX5 A;  3J81 c;  2WP8 J;  3RZO H;  4JOI C;  2Y0S G;  3J7A 5;  3RZD H;  4POF A;  4LF9 L;  3S1Q H;  2ZJR A;  3CCU A;  2PMZ E;  4A3C H;  4DV4 Q;  1EWI A;  1GVP A;  4KHZ A;  4GN3 B;  4KLK A;  3CXC A;  1L1O A;  1SFO H;  4LUV A;  1Y1W G;  2UUA L;  4KHP L;  4JG2 A;  4JYA L;  4UP8 A;  5C4J H;  3J81 j;  5HY6 A;  3GDE A;  2YTY A;  3BZC A;  4DV6 Q;  2UU9 L;  4R1J A;  2JA6 H;  2MFI A;  1PV4 A;  1IBL Q;  1K8A C;  1FL0 A;  2AWO A;  3H0G G;  5IYB H;  1J5E Q;  4Y52 H;  4X66 Q;  2E2H H;  3T1H Q;  3KLW A;  3J80 c;  3KFU A;  5AJ3 Q;  2QGQ A;  4PMW A;  1IBM Q;  4DV5 L;  1YZ6 A;  4YY3 L;  4LF8 L;  4PG3 A;  1KL9 A;  4A3F H;  1N8R C;  1L0W A;  1N32 Q;  2BA0 A;  4GS3 A;  1QVC A;  4UP7 A;  1K0R A;  1XPO A;  3F1Z A;  2VNU D;  3ER0 A;  1FGU A;  4DV3 L;  3GO5 A;  1JJ2 A;  2AKW B;  2D0P A;  4RMF A;  3A0J A;  4JBW A;  3I4M H;  3K80 C;  2JA7 H;  2CCZ A;  4P71 A;  1U5K A;  3A74 A;  1PA6 A;  3S1R H;  4AQY Q;  1KAW A;  2NVX H;  3UDG A;  1A63 A;  1HZ9 A;  1T9H A;  4JYA Q;  1PVO A;  2F3I A;  3STB D;  4HJ5 A;  2IX1 A;  2LSS A;  4JI3 Q;  2KHJ A;  1J5E L;  3HKS A;  1SMX A;  1XPR A;  4YHH Q;  4X66 L;  1IZ6 A;  3FKI H;  4X65 Q;  1VQA A;  1YI2 A;  4R4T A;  1R9T H;  3STB C;  1PYS B;  4WJ4 A;  1X3E A;  4X62 L;  2N8N A;  1XMQ Q;  2F4V Q;  2JE6 I;  4HIK A;  3F2D A;  3H15 A;  1PHJ A;  3U58 A;  1TWA H;  1Q86 C;  1Q81 C;  1PH7 A;  4DK6 C;  4DV3 Q;  4BXX G;  2NVQ H;  1W3S A;  1MIU A;  3K7A H;  2V1C C;  2WAQ G;  2K5N A;  2D62 A;  5GAD C;  4R4O A;  2Q2T A;  2ZTE A;  4AQY L;  4JBK A;  4KI0 A;  1IBK Q;  1WCM G;  5JEA G;  4GLV B;  2A8V A;  3H3V I;  4DR7 L;  5C0X J;  1YBY A;  4K0K L;  1I50 H;  1UE5 A;  4YHH L;  3DLL A;  1N34 L;  4BY7 H;  3GTJ H;  4QQB X;  4QY7 A;  1VQG A;  2QA4 A;  4A3E G;  4B3M L;  2OTJ A;  1X65 A;  1IYJ B;  5M5X H;  1Q82 C;  2PQA A;  5C4X H;  5GAE C;  2F4V L;  3TS0 A;  3CD6 A;  1G29 1;  4XIG S;  1E24 A;  2AHO B;  4P75 A;  5GAG C;  2JA5 H;  2D0O A;  2CQO A;  1L1O C;  1PH3 A;  3I7F A;  1PH6 A;  1YHB A;  4OWT B;  3CC4 A;  4B3R L;  3PO3 H;  3I56 A;  2JA9 A;  1UEB A;  5AJ3 L;  1IBM L;  4IOA A;  4QIW E;  4JI2 Q;  3PF5 A;  3CC7 A;  3S14 H;  4A93 H;  1JB7 A;  2I5H A;  1I94 L;  1YHA A;  2KCT A;  3J80 i;  1YNX A;  2JA8 G;  1N32 L;  4LFA Q;  4DV1 L;  2UXB L;  5IP7 H;  3PIO A;  4X6A H;  4LW1 A;  4L5S A;  1B8A A;  1SRO A;  1VQB A;  3CW2 C;  3PSI A;  5M3F H;  4DR3 Q;  1XTD A;  1V1Q A;  4P73 A;  4PZ7 A;  1N36 L;  2HQL A;  1N34 Q;  5FLM G;  1NMF A;  3ICE A;  4A3M H;  2WAQ E;  1SN8 A;  2B29 A;  3HFZ B;  1TWH H;  2JA6 G;  5IYC H;  2R7Z G;  2R93 H;  1UE1 A;  3OW2 A;  2HHH Q;  1QUQ B;  3S16 H;  2BH2 A;  3AFQ A;  2MO0 A;  2HIV A;  1TWC H;  2Q2H A;  2VUM H;  3K7U C;  3OTO L;  3J81 i;  2GN5 A;  1HZA A;  3I4N H;  1A0I A;  1QZH A;  4X65 L;  3ZJY C;  4C2M H;  1S3O A;  3UDI A;  2CWA A;  4JI7 L;  4X62 Q;  1NBW A;  4MZ9 A;  1I94 Q;  4IFD G;  5M5Y H;  3L0O A;  1UE6 A;  3I4O A;  3CCS A;  4DV1 Q;  4LFA L;  2UXB Q;  2N49 A;  3HKZ E;  4DR3 L;  1WI5 A;  1Q12 A;  2K52 A;  3PCO B;  5IP9 H;  2R92 H;  4LWC A;  3CCE A;  3EBE A;  3M4O H;  2NN6 G;  4DR6 Q;  1G51 A;  4BXX H;  2DGY A;  3BU2 A;  3KDF A;  1HNX Q;  2K50 A;  1XNQ L;  3PGZ A;  2R7F A;  3UDF A;  1VQ9 A;  4LF4 L;  3HOY G;  3HOW G;  1MJC A;  2Q2I A;  1N33 Q;  5JJL A;  4GNX B;  3KOJ A;  3KYH C;  5GQO A;  4DPG A;  5IYB G;  2VZA A;  1TXY A;  2RHS B;  1CKO A;  2E8G A;  4L5T A;  3KDF B;  3T1Y L;  2HHH L;  3PO2 G;  1PYB A;  4K0K Q;  3OTO Q;  3KJP A;  3CAM A;  3UE0 A;  3PUY A;  1Z9F A;  1YHQ A;  5FJ8 H;  4A76 A;  2UUC L;  4B3M Q;  2OTL A;  3OYY A;  2KBN A;  3CC2 A;  4JI7 Q;  4A3B H;  4DAY B;  3F2C A;  4NXN L;  4GOP C;  4DAM A;  1MKH A;  3AFP A;  3UE1 A;  3SGI A;  4DR6 L;  3B6Y A;  4JBM A;  4B3R Q;  2MQH A;  2PI2 A;  1EIY B;  4DNI A;  1XNQ Q;  5E7N A;  3TEH B;  4JI2 L;  3HOU G;  2N78 A;  2A1A A;  4IFD I;  3NBH B;  4QGU A;  4OO1 G;  1H95 A;  1JJC B;  1X3F A;  1VQD A;  2QEX A;  1VQH A;  4DUZ L;  1K8G A;  1C7Y A;  2JJQ A;  4DR4 Q;  1ASY A;  1K73 C;  2KCM A;  1X9N A;  1N36 Q;  1EFW A;  3WWV A;  3J7Z C;  1AH9 A;  3PUZ A;  1VQP A;  3KJO A;  3ULP A;  3CCL A;  1VQC A;  4ALP A;  4HJ9 A;  3GTO H;  1V43 A;  4DKA C;  2JA8 H;  3F8T A;  4GNX A;  1NJI C;  3CCJ A;  4PZ8 A;  5GRO A;  4JI6 L;  2RCN A;  4UPA A;  4NXN Q;  4OWW B;  2GVB A;  4JCV E;  5GAH C;  3M3Y H;  2DUD A;  4UP9 A;  2H5X A;  2ID0 A;  2YYZ A;  3NEN A;  2YTX A;  2FXQ A;  4R4C A;  3RLO A;  5C0X G;  2VW9 A;  2VQE L;  1B70 B;  1CKN B;  1Y14 B;  3AEV A;  5IYD H;  5JJI A;  2GVA A;  1HZC A;  1OTC A;  1S72 A;  3G6E A;  5M3M H;  5IP7 G;  2PQA B;  3JAM c;  3F2B A;  1CSP A;  2MNA A;  4LUZ A;  1VQ4 A;  4JI8 L;  1SR3 A;  5C3E G;  4DUZ Q;  1C0A A;  1W2B A;  3I4N G;  1VQ7 A;  4C3I H;  1EIF A;  1E3P A;  4JI4 L;  4A3L G;  3S2H H;  2UXD Q;  4LF4 Q;  1VQ6 A;  3U4V A;  3FHW A;  4A3K G;  3M85 A;  2E5L Q;  2PI2 E;  4J15 A;  2A19 A;  5C3E H;  3TQY A;  1GD7 A;  3A5U A;  3T1Y Q;  3CPF A;  4JI6 Q;  2K75 A;  3PUW A;  1PH5 A;  2ZM6 Q;  4IO9 A;  1A62 A;  2Q2U A;  1E1O A;  4P74 A;  4HID A;  3DM3 A;  3L7Z C;  1K9M C;  5J3B A;  1EUJ A;  2UXC L;  1SRU A;  2VQE Q;  2UUC Q;  3A5Z B;  4HIM A;  4L5R C;  4A3D H;  1P16 A;  4A75 A;  4HJ7 A;  1Q8K A;  1U0L A;  4YWM A;  3CME A;  1M90 C;  1VQN A;  1QVF A;  1Z47 A;  1BBW A;  4YCV A;  4JI1 L;  1UWV A;  1WYD A;  3PIP A;  2JK8 A;  2NZO A;  3KF8 B;  3S2D H;  3GTK H;  1CUK A;  3I4M G;  1FVI A;  2JEA I;  1Q1B A;  2YV5 A;  2LXJ A;  5M5W H;  3NEM A;  4A3L H;  1K3R A;  4AH6 A;  4JI4 Q;  4DR2 Q;  1PH1 A;  3UDX A;  3RLN A;  1Q46 A;  2R93 G;  5JJK A;  4A3K H;  1KC8 C;  3ERS X;  1B7Y B;  4P72 A;  3W1B A;  4YWL A;  5LMU Q;  1HNZ Q;  4O0A A;  1NTG A;  2I0Q A;  4RG1 A;  1IL2 A;  1GKH A;  2VL6 A;  2ZM6 L;  4LF7 L;  1VQ5 A;  1JE5 A;  4IFD J;  1D8L A;  3HOU H;  2UXC Q;  3CCQ A;  1UE7 A;  2EQS A;  4HJA A;  4DR5 L;  3Q8D A;  1PFS A;  4H02 A;  3K0X A;  4O2D A;  4JI1 Q;  5IE8 A;  1CKM A;  4GKK Q;  2LXK A;  4Y7N H;  1VQO A;  3G48 A;  1OXT A;  1VQE A;  1EQQ A;  1HR0 W;  3EIV A;  3PF4 A;  1X3G A;  4C3H H;  2OQ0 A;  4DR2 L;  1CSQ A;  1HNW Q;  2NVT H;  1V9P A;  4GN4 B;  1FJG L;  1X56 A;  1Y1V G;  2Y0S E;  1MJE A;  2RHQ B;  4YCW A;  2ES2 A;  4JI8 Q;  2NZH A;  3FP9 A;  5LMU L;  4A3G H;  5IY0 A;  1YJN A;  3RR5 A;  4LNQ A;  1HNX L;  4POG A;  2K5H A;  4BY7 G;  2R7D A;  3CCR A;  1A8V A;  3L2P A;  4DV2 Q;  4LF5 Q;  3HOV G;  1QUQ A;  1KHI A;  4LUO A;  3RNU A;  4BBS G;  2UXD L;  2JQO A;  1WFQ A;  2KEN A;  4A3B G;  2VS1 A;  3H0G H;  1I5F A;  2L15 A;  2BH8 A;  3E9H A;  2ZJP A;  3CCV A;  2JA5 G;  1RL2 A;  2IY5 B;  2VQF Q;  4NB3 A;  2E5L L;  5IP9 G;  4DR5 Q;  2ZJQ A;  1SE8 A;  1TWF H;  4AYB G;  4IOC A;  3M4P A;  5DLQ E;  1XNR L;  4JI0 Q;  4AIM A;  3PO3 G;  1OXV A;  4FDB A;  4A3E H;  4GKK L;  5FJ8 G;  4OO1 I;  2CFM A;  4DV0 Q;  2XTI A;  2YTV A;  3D0F A;  4LF6 Q;  3MXN B;  3G4S A;  4A3J G;  4NXM Q;  4BBS H;  3K81 C;  5IYC G;  2R7Z H;  3HOZ G;  3GD7 A;  4JI5 Q;  1HNW L;  4IPH A;  3G71 A;  4IJH A;  4GLA C;  4A3G G;  3CF5 A;  3TRE A;  3PUX A;  2E2I H;  1XMO L;  4OX9 Q;  2MO1 A;  3JC6 6;  4MNO A;  2IX0 A;  2F52 A;  3S24 A;  1EOV A;  1QZG A;  3BJU A;  4DV2 L;  4X64 Q;  2ZTD A;  2EXD A;  1YIJ A;  4LF5 L;  2ZTC A;  1VCI A;  3U4Z A;  4LFB Q;  1KXL A;  1YVC A;  3HKZ G;  3IRB A;  2IHF A;  5IWA Q;  1TWG H;  1L2F A;  1VQF A;  5FLX c;  4IPG A;  1VS0 A;  1X6O A;  3M9B A;  4TQU S;  1YIT A;  1HNZ L;  2UUB L;  1QVG A;  1NMG A;  4DV7 L;  1RIP A;  2HIX A;  5H1S E;  4PZ6 A;  2ATW A;  2OWO A;  1AE3 A;  1AE2 A;  4DV0 L;  4LF7 Q;  4LF6 L;  3GTG H;  1JT8 A;  1J6Q A;  3AYH B;  3TS2 A;  1P8L A;  4R4Q A;  5ELN A;  1KQS A;  3ULJ A;  5LMN W;  4BA1 I;  1VQJ A;  2YU9 H;  3NEL A;  4A3C G;  2XGT A;  1PH2 A;  4AYB E;  5BR8 L;  5IYD G;  1XMO Q;  2K14 A;  4OX9 L;  4GKJ L;  4A3I H;  4BBR G;  3HOW H;  4A3J H;  3HOY H;  4GN5 A;  5C4X G;  1N33 L;  1EQR A;  5K36 G;  1YEZ A;  3M7N A;  4WJ3 M;  1M1K C;  2Z0S A;  3GTQ H;  4LFB L;  4L5Q A;  1IXR A;  3S1M H;  1FJG Q;  4YWK A;  4DR1 Q;  5IWA L;  1HH2 P;  3S1N H;  5C0X I;  3RLF A;  5FLM H;  4B3T Q;  2UUB Q;  4A93 G;  4IPC A;  1YJ9 A;  3HOX H;  5JEA J;  3TRZ A;  3M4Q A;  3H3V H;  1N9W A;  1PH9 A;  4DR4 L;  4A3D G;  1PH4 A;  2JEB I;  3KF6 A;  5LMN L;  4NPS A;  2CKZ B;  3ULL A;  2VQF L;  4GOP B;  3RN5 A;  1HR0 L;  5C44 H;  3BZK A;  1JMC A;  1E7Z A;  1XNR Q;  2KHI A;  1Y1W H;  4JI0 L;  3PV0 A;  2PNH A;  4DR7 Q;  4GKJ Q;  4NXM L;  2K4K A;  1I3Q H;  2AWN A;  4APV A;  3D31 A;  1VQ8 A;  2WB1 G;  2B3G A;  4JI5 L;  1BKB A;  4IPD A;  5IT9 c;  1VQM A;  3JAM i;  2NN6 I;  1HJP A;  3FKI G;  4JOI A;  5HGQ A;  1LYL A;  4DUY L;  4JV5 Q;  1ASZ A;  1LTL A;  1CKN A;  4GNX C;  4B3S Q;  3EN2 A;  2I5L X;  4ME3 A;  4B3T L;  3I55 A;  2EIF A;  1JJG A;  3KF6 B;  3MEF A;  4X64 L;  4QJF A;  3VDY A;  4LF9 Q;  1NE3 A;  5LMN Q;  4OXP A;  3K8A A;  1WJJ A;  2OCE A;  4DV4 L;  4JBJ A;  3U50 C;  1OXU A;  3S15 H;  4BY1 H;  3RN2 A;  5C44 G;  1HR0 Q;  1E1T A;  2CWP A;  4DV6 L;  4DV7 Q;  1I6H H;  2ALY B;  1IBL L;  1S40 A;  2ASB A;  2Z6K A;  5M3M G;  1HZB A;  4DK3 C;  3T1H L;  2WFW A;  1KRS A;  2AMC B;  3PO2 H;  3PUV A;  4QL5 A;  2JA7 G;  2HT1 A;  4YY3 Q;  1VQK A;  4YCU A;  1OXX K;  3W5O A;  1VQL A;  4DUY Q;  1WOC A;  2R6G A;  5BR8 Q;  2K5V A;  2Z6K C;  3CMA A;  3HOV H;  4JV5 L;  2N3S A;  4B3S L;  2RF4 A;  1NY4 A;  3I2Z A;  2VY3 A;  2E2J H;  1XJV A;  2WB1 E;  1Q7Y C;  3CCM A;  4XTC S;  4BY1 G;  4DR1 L;  1PH8 A;  1Q1E A;  2IHE A;  2BA1 A;  1K83 H;  4GLX A;  4A3M G;  4LFC Q;  3GTM H;  4MTN A;  4BBR H;  2B63 G;  4BA2 I;  1BVS A;  4JC0 A;  4JI3 L;  4HIO A;  1DGS A;  3HOZ H;  1G6P A;  1Y1V H;  2IT1 A;  1C9O A;  5M3F G;  1BBU A;  1XPU A;  3S17 H;  1L1O B;  2UUA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...