4JI5Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji5Q00
1W3SA 4AH6A 4QGUA 1GD7A 1PVOA 1VQEA 1MIUA 4LF7L 1LYLA 1D8LA 2XTIA 3UDXA 5IP9H 3PCOB 4LF8Q 4DV0Q 3CXCA 4A3EH 2HT1A 4HJ8A 4R4QA 4A3CH 3W5OA 3FP9A 3HOZG 4JI6Q 2UXBL 1EUJA 3CCEA 4BY7H 2VNUD 4KI0A 3GTKH 3D0FA 4P73A 5IWAL 3PUWA 3F2CA 1HZBA 4DR5L 2VZAA 2QEXA 2ZTCA 1VQOA 4BY1H 3KFUA 5DLQE 2QA4A 4JI8L 4DUZQ 4A3FH 4GLVB 1K8GA 1YJ9A 5IYCH 1TWHH 3OYYA 2K52A 2WB1G 1FVIA 1SR3A 3LGJA 2R93H 2ZM6L 1QVCA 1Q81C 3W1GA 4LF4Q 5FJ8H 4LFAL 4P71A 2OQKA 4YY3Q 1HNZQ 5C4XH 4C3IH 3HOYG 4DR4L 2K5NA 3PGZA 1PH4A 3S24A 3PO2H 2GVAA 4UPAA 2CWAA 1EWIA 2F52A 3CCVA 1IBLL 1I6HH 4A3DH 2HHHL 4DK3C 1PH6A 1Q1BA 1XTDA 4KHZA 4A3GG 3PV0A 4YCVA 4DV4L 1A62A 1TXYA 3HOXG 3CMAA 1W2BA 3RZOH 4BXXH 1UE6A 3FKIH 3KLWA 4DR6L 1XMQL 2VS1A 4UP8A 4JV5Q 3RLNA 1J6QA 1XNRL 3CQZH 3S1QH 3GTMH 3KJPA 4POFA 4AQYQ 4DV3Q 1Y1WH 1VQ8A 2LSSA 1WJJA 2VUMG 2JA9A 4OWTB 1Z9FA 2YTXA 4DNIA 1PHJA 1SN8A 3M7NA 3K7UC 3J81c 1E24A 1HZ9A 2IT1A 4ALPA 1K83H 2N3SA 5M3FG 2PMZE 1K73C 1BVSA 4KHPL 1AH9A 1L1OC 4IJHA 1I3QH 1YITA 1MJEA 4JI0L 3CF5A 1Q86C 2H5XA 5IWAQ 1PH7A 2JA6H 4LNQA 3GTQH 1RL2A 1KIXA 2IHFA 1OXXK 4FDBA 1FL0A 1QUQB 1A8VA 3ULPA 2F4VL 1S3OA 1WCMG 3MEFA 1UE7A 2EXDA 1I5FA 1M90C 4JI1L 3UDIA 3UDFA 3J80c 4B3TL 1LM0A 2Z6KC 4JOIA 1L1OA 4LFBL 3GTOH 4DR1L 5GAGC 1A0IA 3U4VA 3U4ZA 1BKBA 1NMGA 3PIOA 4DV5Q 4QQBX 4OX9L 1TWAH 3W1BA 1SLJA 1M1KC 4A93H 3STBC 5IP7H 2PQAA 3PUYA 2HHHQ 4JI4L 4LF5Q 3PUXA 5IYDG 3HOVG 2CCZA 5BR8Q 4DUYQ 1Q46A 1OXUA 2HIXA 1CSQA 1X6OA 4OONA 3RN5A 4IOAA 2JEBI 2JA7H 3HKZG 4BBSH 4APVA 3L2PA 1QZHA 2K5HA 4YCUA 4IO9A 4A3BG 2YU9H 4C3HH 3K8AA 3G6EA 1GVPA 4A3IG 4UP7A 3GTJH 2KHIA 1QVFA 3CP0A 3B6YA 5EAYA 4LW1A 1LUZA 3F2BA 2I5MX 3NEMA 1E1TA 3E0EA 3K0XA 2B63H 1S40A 3JAMc 4JI0Q 2K4KA 2KENA 5M5XH 1VQNA 2A1AA 3CPWA 1K3RA 3I2ZA 4LWCA 5FLMG 2JA5G 1VQGA 1YVCA 4IFDJ 3TEHB 2R7ZH 3OTOQ 3KOJA 4X62L 1SRUA 1E7ZA 1KL9A 2F4VQ 1PH9A 5ELNA 4YHHQ 1OXSC 2RF4A 4X66Q 3U58A 1N8RC 1FJGQ 4JI1Q 5K36G 4B3TQ 3I56A 3A5ZB 1V43A 2UU9Q 2YV5A 5LMNW 4LF9L 2VQFQ 1G291 4UY8C 1YNXA 2OQ0A 4DR7Q 3BZCA 4JI5L 2JA8H 1PH5A 1N9WA 2CKZB 2OCEA 4LF6L 2R7DA 4L5QA 4A3KH 3KF8B 4LUOA 4DAMA 4NXML 1WFQA 1N34L 4JBKA 4WJ3M 3S1NH 3MXNB 4DR2Q 1FGUA 2YTYA 4A3JH 1HR0L 3I55A 1EQQA 2D0OA 2IX0A 4AYBE 5M3MH 4B3MQ 3KYHC 2RHSB 1KC8C 2OTJA 2EQSA 3CC7A 1BBUA 2E2JH 5LMNL 2B3GA 2MNAA 2BA1A 4GNXC 3DM3A 4R4CA 4L5RC 1J5EQ 3I4MH 3H0GH 4X65L 3J7ZC 2B29A 5C44G 4H02A 5GAHC 2WAQE 4GS3A 3S1RH 1YJNA 2KBNA 1CUKA 3A0JA 2Z0SA 3HOUG 5HY6A 1IBKQ 1DGSA 3CW2C 4GKJL 4EQ5A 5IP9G 1N32Q 1CKMA 2VL6A 4MTNA 2V1CC 4JBJA 2ZTDA 1KAWA 2LXJA 2MO1A 4GNXA 2ES2A 4JI7L 2JQOA 3RR5A 3E9IA 2OTLA 3H15A 1VQPA 4K0KQ 3HKSA 3KJOA 4BY7G 4DR3L 4GOPB 2K50A 2ID0A 4DV2L 4X62Q 5FLXc 1OTCA 2NZHA 1V1QA 3M4PA 4IPHA 4JI3L 1JMCA 5JJKA 3ZJYC 4A3FG 3HOUH 3S1MH 2Y0SE 4LFCL 3TS0A 1I94Q 4R4IA 3HOYH 2KCTA 4IOCA 1OXTA 4PMWA 1NMFA 2E5LL 5FJ8G 3CCSA 3H3VH 3U50C 5JEAG 4LF6Q 2UXCL 2R92H 4NXMQ 4L5SA 1IBMQ 3GO5A 3PO2G 1JJCB 1X65A 3I4OA 2ZJPA 1HR0Q 2UUAL 3KF6A 5H1SE 2JK8A 1Q82C 4LF7Q 3GTLH 1XMOL 4A3LH 2L15A 4HJAA 3KDFA 4DV6L 1N36L 1CKOA 1VQHA 1YZ6A 2PI2E 1X3GA 2RHQB 1Y14B 4QJFA 5C3EH 1G51A 2OWOA 4JYAL 4YWMA 1R9TH 1UE5A 4BXXG 4QY7A 4JG2A 3FKIG 1VQMA 2DUDA 4JCVE 4R4OA 1Q8KA 1X56A 3DLLA 1CKNB 4DV1L 1PH3A 1KQSA 3CC2A 2AWOA 2UXBQ 1QVGA 2AMCB 4DR5Q 2CQOA 4GKJQ 3PF4A 3PUZA 3S14H 4L5TA 4KLKA 2WB1E 4JI8Q 2I0QA 4YWKA 1V9PA 3NBHB 4JI7Q 1HJPA 2K5VA 3CCJA 3S17H 4B3RL 5C0XI 2UXDL 3IRBA 1VQFA 3CCMA 1XPUA 2LXKA 3PO3H 3TS2A 1T9HA 1U5KA 4TQUS 2ZM6Q 4GN3B 4GKKL 3ER0A 4LFAQ 1X3FA 1SE8A 2JA6G 4DR4Q 4O2DA 4R1JA 4B3SL 3CPFA 1E22A 4XIGS 1SROA 3G4SA 3GDEA 1NY4A 1H95A 1IBLQ 4PZ7A 4C3JH 3BZKA 4X64L 4EX5A 1VQDA 5IYBH 2GN5A 1VQ6A 1JT8A 3ULJA 3SGIA 4DV4Q 1XPRA 1L2FA 5GQOA 2Z6KA 2QGQA 3ERSX 1C7YA 4DR6Q 1XMQQ 1C0AA 5LMUL 4DPGA 3J81i 1PV4A 4DKAC 1I50H 3CAMA 3CMEA 1G6PA 3BJUA 3HOVH 1EIYB 2UUAQ 3AYHB 1XNRQ 3CD6A 3HOWH 2AHOB 3G71A 1N36Q 3PSIA 1Q12A 3M85A 2E2IH 3TRZA 1HZAA 4HJ9A 2NVYH 3CCRA 2JA7G 2N78A 4KHPQ 1EIFA 2UUBL 2JEAI 5AJ3L 4PG3A 4DV1Q 2IHEA 4DV7L 1GM5A 2UUCL 1PH2A 2R6GA 3J80i 5C0XG 2NVTH 4HIMA 1NBWA 1UE1A 2VW9A 4LF8L 3K7AH 4DV0L 1JB7A 1IZ6A 1SMXA 1KRTA 1AE2A 3F8TA 4B3RQ 5FLMH 4JI6L 3S2HH 2JA5H 3L0OA 2B63G 1HH2P 3HFZB 3AQQA 4RG1A 3RLFA 4Y52H 2WFWA 2ALYB 4GKKQ 1AE3A 5C4JH 1P8LA 4HIOA 1Y1VH 5IT9c 4A3MH 4LFBQ 3I4NH 3PUVA 3AFQA 4DR1Q 1KD1C 1TWGH 3WWVA 1XJVA 1E3PA 1YEZA 2VY3A 4J15A 1QZGA 3ULLA 1LTLA 4DUZL 3T1HL 4OX9Q 1PFSA 1O7IA 1VS0A 3F1ZA 4POGA 2IY5B 4JI4Q 4JBMA 3L7ZC 3HKZE 5GADC 2KCMA 4QL5A 4LF4L 4OWXB 1HNXL 3CCLA 1PA6A 1L0WA 4YY3L 3S16H 3K80C 4BBRG 2FXQA 1PH1A 2JA8G 3EIVA 2CFMA 2MO0A 3JAMi 4HJ5A 5JJLA 5J3BA 1GO3E 1IYJB 4IPCA 4QIWE 4HIDA 3AEVA 2JE6I 1IL2A 2PQAB 4PZ8A 3H3VI 2AWNA 1P16A 3VDYA 3HOZH 3M4OH 3K81C 4JV5L 4OO1I 2R7FA 2E2HH 4DV7Q 4A3EG 1X54A 3I4MG 3FHWA 3H0GG 4A3CG 1N33L 2F3IA 3GTPH 1QUQA 1VCIA 2AKWB 1B70B 5IY0A 4DV3L 4AQYL 1ASYA 2IX1A 2PNHA 3I7FA 2HIVA 4P74A 3RN2A 3S2DH 1HNWL 3BU2A 4BY1G 3OW2A 1YIJA 2JJQA 2ATWA 1NJIC 4WJ4A 2K14A 4AIMA 5IYCG 2I5LX 4LF9Q 1MKHA 2GVBA 2DGYA 4A4IA 1B7YB 1PH8A 1A63A 2R93G 4JI5Q 5M5YH 3TREA 3T1HQ 1C9OA 1EOVA 1Q1EA 5HGQA 1E1OA 1VQ4A 4OWWB 5C4XG 1YHAA 3ICEA 4GLXA 1N34Q 2Q2TA 1B8AA 3GD7A 3J81j 4A3GH 1K8AC 1SFOH 4HIKA 1WOCA 4A3DG 3HOXH 3UDGA 4IFDG 1NTGA 1CSPA 2KHJA 1KHIA 3A5UA 1HNXQ 3NELA 5LMNQ 2A8VA 2NVQH 2HQLA 2ASBA 4DV5L 2D62A 3EN2A 3J7A5 4P72A 1VQ7A 5M5WH 2YTVA 4R4TA 4X65Q 2R92G 2WP8J 4JC0A 1VQJA 1WI5A 2NN6I 1X3EA 3EBEA 4OXPA 5C0XJ 4LF5L 2VUMH 3GTGH 4OO1G 4C2MH 5BR8L 4NXNL 4DUYL 4IPGA 1VQ5A 2NVXH 1YJWA 4GLAC 1YHQA 4A3LG 1Y1WG 1KXLA 1KRSA 4JI2L 5M3FH 5C3EG 2BH2A 5IE8A 2ZJRA 4GN5A 2CWPA 4NPSA 5ELOA 1N33Q 4A76A 3RLOA 3A74A 3CC4A 4DR3Q 4BA1I 4DV2Q 4DAYB 4YWLA 1UEBA 1YBYA 1WCMH 3CCUA 3S15H 4A75A 2Q2IA 3TQYA 1ASZA 4JI3Q 2VQEL 4JOIC 2BH8A 4RMFA 1XNQL 1VQ9A 4ME3A 4LFCQ 3PO3G 4HJ7A 4GNXB 3OTOL 3NENA 5GAEC 2E5LQ 4NB3A 3M9BA 4O0AA 2UXCQ 1JE5A 1PYSB 2N49A 4YHHL 4X66L 1FJGL 4X6AH 1XPOA 1IXRA 4A93G 5IYDH 3CCQA 4GN4B 1VQCA 5IP7G 2UU9L 1XMOQ 2VQFL 1Q7YC 2NN6G 4DV6Q 4IPDA 3T1YL 1VQAA 5IYBG 1OXVA 4GOPC 4BA2I 2PI2A 4A3BH 1EQRA 4JYAQ 4DR7L 2XGTA 1VQKA 1RIPA 4BBSG 4A3IH 2D0PA 2ZJQA 4DR2L 5E7NA 1U0LA 1JJGA 4B3ML 2UUCQ 4PZ6A 3D31A 4NXNQ 3HOWG 2Q2UA 1K0RA 3JC66 2ZTEA 3KF6B 4JI2Q 3UE1A 4AYBG 4Y7NH 3PF5A 2EIFA 3M3YH 4JBWA 2RCNA 1J5EL 3KDFB 1EFWA 4GOPA 1NE3A 3Q8DA 2UXDQ 2E8GA 1MJCA 1BBWA 1HZCA 1PYBA 3F2DA 2YYZA 2Q2HA 1X55A 4IJLA 2I5HA 4UP9A 3UE0A 1VQLA 1IBKL 2MFIA 2WAQG 5JEAJ 1N32L 2R7ZG 4P75A 1WYDA 4B3SQ 4LUZA 2VQEQ 3M4QA 1K9MC 5JJIA 1TWFH 1XNQQ 4K0KL 4X64Q 1Z47A 1YHBA 1TWCH 4A3MG 1Y1VG 1UWVA 3E9HA 3AFPA 1HNZL 3I4NG 1HNWQ 1GKHA 2A19A 2N8NA 1VQBA 5GROA 1L1OB 5LMUQ 3RZDH 1JJ2A 4TVAB 1YI2A 4MNOA 1EYGA 1HR0W 2K75A 3PIPA 4IFDI 4A3KG 1X9NA 4LUVA 2BA0A 3G48A 3RNUA 4A3JG 1I94L 3STBD 3T1YQ 4BBRH 1S72A 5M3MG 1VQIA 1CKNA 2Y0SG 2MQHA 4DK6C 2C35B 4XTCS 5C44H 2NZOA 1D7QA 4MZ9A 2UUBQ 1IBML 5AJ3Q 4YCWA
chains in the Genus database with same CATH superfamily
1VQEA 3Q23A 2D9UA 2ICEC 1D8LA 4O1NA 3UDXA 4CDEC 4BY7B 3CXCA 1AZPA 2HT1A 4HJ8A 4R4QA 4DAYA 2EY5A 4X3UA 3CCEA 4KI0A 4UDUC 4KMUC 4P73A 1WTWA 3PUWA 5D65A 4BY1H 2ZTCA 1VQOA 1AP0A 5I2XA 2QA4A 4C56C 4ZUIA 2LMCB 2WB1G 1FVIA 2K5DA 5FLXL 1QWYA 2ZM6L 1DXMA 1I6HB 2KUMA 4P71A 3ND9A 2KOLA 5C4XH 1JOOA 2Z4HA 3PO2H 4UPAA 1EWIA 5IGCA 3KK7A 5JPNC 4A3DH 4NW2A 1DYQA 1XTDA 2BOSA 4IALA 4YCVA 1A62A 2KECA 3GTMB 2XIWA 3GTLB 1Y8OB 4OO1H 1PZKD 2O4XA 3S1QH 3KJPA 1U4RA 3OMCA 2EY6A 1VQ8A 1QILA 2YTXA 5CYUA 1PHJA 3K7UC 2E2HH 1HZ9A 2N3SA 5CV4A 1HUMA 2A6EC 2H5XA 5IWAQ 3S17B 3SVMA 3H94A 4FDBA 1FL0A 4FF3A 4V190 5CC4A 1HRJA 2FJ2A 1I5FA 3UDIA 4A93B 1NMGA 5A2QL 2K5QA 4CJ1B 3MEHA 1SLJA 2PYKA 1M1KC 1JE4A 1UEAB 3R8BA 5BR8Q 4C3HB 4DUYQ 1Q46A 4CKCA 2JEBI 2JA7H 4RWSC 4DXGA 4K2KA 2XWJB 3AU7A 3OWFA 1I4QA 1SNOA 4C1NI 4J8QA 1T5EA 2XRQD 2HQEA 4UP7A 3NQIA 2B63B 2KHIA 3CP0A 2ENBA 2EVBA 1EY9A 1TS4A 3OWEB 2F0KA 4IN3A 2RBMA 3MVVA 3I2ZA 5FLMG 4IFDJ 1LT3D 2CH4W 3F2UA 3TEHB 5CV5A 4X62L 2HCCA 2M2LA 4A3MB 1STNA 2F4VQ 1PH9A 3LWEA 1HTLD 2EJGC 2RF4A 4EQOA 2JA8B 4JI1Q 5C5MA 2I07B 3I56A 5TSSA 1KAAA 3C1FA 4KY7A 4LF9L 1YNXA 4A3JB 1RDPD 1JICA 4JI5L 1PXUA 1N9WA 2FINB 3OMGA 4DR7Q 4A3KH 3CU7A 4JBKA 5KYLA 1PFBA 4XDXA 1N34L 3S1NH 1EWCA 5LL6S 4DR2Q 1TY0A 2D0OA 2IX0A 2VB3X 4AYBE 1JB3A 3KYHC 5M3MH 1KC8C 2BA1A 3N52A 4L8JA 1J5EQ 3J7ZC 2B29A 2QCPX 1HA5A 1KABA 1CUKA 4F8MA 2Z0SA 4FXGC 1XX8A 3GTPB 1E2VA 1N32Q 2RSOA 4MTNA 5EPKA 1KLGD 5C4HA 1KAWA 1GUWA 1EU4A 2RDHA 3E9IA 4U68A 4K5XA 3H15A 1VQPA 1PTOF 2K50A 3AMUA 2NZHA 4IPHA 1SNPA 1TY2A 1STYA 3S1MH 4DXFA 4R4IA 3HOYH 4A3GB 1EZ6A 2KCTA 5A35A 1DCZA 2NYZD 2F0OA 3NPPA 4NXMQ 3GO5A 5C3EB 4K6LA 3PO2G 1R9TB 4QF4A 4UHVA 3QO2A 3GTLH 4I7ZC 4HJAA 2B2VC 3KDFA 1DONA 2K32A 4QJFA 2VUMB 2RHQB 1Y14B 2RKSA 1S5CD 4ZAIA 4R4OA 3S14B 1TS3A 2ICIA 2F0VA 5KGUA 3DLLA 1PH3A 1KQSA 3CC2A 3OHXC 1LT6D 3GQBA 3I72A 4KKSA 2WB1E 2HCIA 1B53A 2B2VA 2C5CA 3NBHB 4G4KA 4MTKA 3CCJA 5IGGA 4JI7Q 3S17H 3PIO3 1VQFA 3DM1A 1XPUA 2JYOA 3TS2A 4R9WA 1A2UA 1RJTA 5CR3A 3J81L 2ZM6Q 1TVXA 4IQZA 3CPFA 1E22A 1ZYRC 4OHJA 1NY4A 4PZ7A 1VQDA 2F0HA 2FMMA 1B4OA 1EIGA 3J80L 4AYBB 1PV4A 1RF2D 5F2DA 3BJUA 1G6PA 2UUAQ 3CD6A 3AYHB 2NVYB 3D4WA 4A3IB 1N36Q 1PYWD 2E2IH 3TRZA 1D6EC 2EYHA 2JA7G 1Q8IA 1K28A 2N78A 5KYIA 4DV7L 2IHEA 3H3VC 1EL0A 1LO5D 2NVTH 3S2HB 4HIMA 2JA5B 4H13C 1UE1A 3K7AH 4DV0L 1IZ6A 1SMXA 2KQ3A 1KRTA 4IURA 1Y1VB 5FKAC 3MZ5A 4B3RQ 3E5SA 3TP7A 3D6WA 3RLFA 3AQQA 4Y52H 5C4JH 4A3MH 1P8LA 2PPBC 5IT9c 1E0BA 1A3VA 3PUVA 3I4NH 3JAML 1AZQA 1PMRA 3WWVA 3J7AF 1QZGA 2R3ZA 1TWCB 1PFSA 1O7IA 3HGBA 3S16B 4NP5A 4JBMA 3L7ZC 3RZDB 2OXPA 4LF4L 1HNXL 1NCVA 5ELFA 4BBRG 4KD4A 1PH1A 4CGYB 2CFMA 2XNAC 3TP6A 1F2MA 3FRPB 5JJLA 4IPCA 3AEVA 1K8MA 3RD4A 2JE6I 4PZ8A 5I6WA 2EXZA 2LKVA 2DNEA 3H3VI 1GUNA 3ONAB 4JV5L 5IOCA 1V1OA 3FHWA 4A3CG 5L37A 3GTPH 3NK9A 3I7FA 2HIVA 3RN2A 3A56A 1G2SA 1RTNA 1HNWL 1WD1A 2JJQA 3TMEA 4WJWA 4LF9Q 5EBDA 2GVBA 1B7YB 5DEHA 4JI5Q 1VF7A 1E1OA 3QOJA 1N34Q 4C3IB 4A3GH 2OF1A 1SFOH 1WOCA 2F0WA 4QCLA 2JXMB 5LL6X 4H7BA 4QUFA 2KHJA 3A5UA 2A8VA 3MA2B 4DV5L 2HDMA 4P72A 1A6XA 5M5WH 2YTVA 2PCFB 3G7LA 3Q24A 4JC0A 1VQJA 1LABA 1I4PA 5C0XJ 4LF5L 4OXPA 2VUMH 2PZUA 4NXNL 2KEDA 2DNCA 2NVXH 3SHLA 3TP5A 4JI2L 5IE8A 3I3CA 1WTPA 5ELOA 4A76A 5FOBB 1NR2A 4RGTA 2HD3A 4YWLA 4DAVA 1YBYA 2A69C 2VQEL 1GUOA 1A3TA 4ABNA 3NUCA 4DA2A 2K33A 3KBGA 3T56B 5JPMC 1JOKA 2L9HA 4ZK9B 3OTOL 1NUCA 3MXNA 4NB3A 1YNNC 3UI2A 3KBXA 2HDLA 1FJGL 4KD3A 1D2BA 3K6OA 2OT2A 1LACA 4A93G 4GN4B 1WTRA 2A68C 1G91A 1VQAA 4BA2I 2XN9C 2PI2A 4UAIA 2QDBA 1VQKA 5CV8A 3IL8A 4A3IH 3MHBA 2ZJQA 4C3HG 4B3ML 4PZ6A 4IUVA 1K0RA 1SYDA 1JCKB 3JC66 1HUNA 2KA7A 2Z4IA 4N9TA 5IT9E 1NE3A 1BBWA 1X55A 3DEPA 3UE0A 3FEWX 1VQLA 1IBKL 2WAQG 3RUZA 2F0GA 3P75A 1BNZA 3BVGA 4H0LC 1KLUD 1IYUA 1XNQQ 4K0KL 1F9SA 4FF2A 4M1UB 5J1ZA 4TSSA 1TWCH 2TMPA 4A3MG 1DOMA 3I4NG 1GKHA 2KJXA 2N8NA 1JOQA 5GROA 3RZDH 5FO9B 4TVAB 5I9OA 4MNOA 1EYGA 2EE1A 3K57A 5NUCA 3MAQA 4LUVA 3RNUA 4A3JG 5E3FA 1S72A 1VQIA 2DN8A 4XTCS 5C44H 2F03A 2DY7A 1ICFB 4K2LA 4QUCA 2EZVA 1MIUA 3MFGA 2XTIA 3H09A 5IP9H 2F0NA 3S1RB 2EYFA 4DV0Q 4A3EH 1LTID 4RAUC 4BY1B 2EYLA 1EUJA 2VNUD 2NTSA 2AQ1B 5IWAL 3F2CA 3VA5A 2QEXA 5DLQE 1M4VA 5J22A 4I65A 4G7HC 4A3FH 3PMFA 4GLVB 1RCVD 2E76C 5C4XB 1TWHH 1NR4A 2K52A 2QKIC 3OYYA 1SR3A 3LGJA 1CA6A 3T53B 1BO0A 4LF4Q 4A3DB 4C3IH 2K5NA 3D3RA 3PGZA 3S24A 5BN3A 1PH4A 4ZYSA 4CBVA 2MJ8A 1IBLL 3E6ZX 4LK1C 1PH6A 4KHZA 4A3GG 2F0FA 1C48A 3CMAA 3S1QB 2Z8LA 1UE6A 1XMQL 4F7XA 4JV5Q 1RTOA 3M4YA 2E2HB 3Q22A 1Y1WH 3C3LA 1WJJA 1SYFA 3VYRA 2VUMG 2JA9A 3ITPA 5CBAE 4DNIA 1CQFA 1HNWQ 4ALPA 4IJHA 1YITA 1MJEA 4CDFC 1PH7A 1LV9A 2N88A 3FDTA 3GV6A 4LNQA 1Y8PB 5KIXA 1OXXK 1HHVA 1QUQB 4K8JA 3ULPA 2F4VL 2Z1CA 4JI1L 4QMGA 4JOIA 2BE5C 4LFBL 1JORA 1D5XC 2C9OA 3I8ZA 4DV5Q 2OEOA 1SNQA 5EBCA 2JA7B 5IP7H 2PQAA 4JI4L 4LF5Q 4HMIA 5EKLA 3FPUB 3KUPA 1M8AA 2LS01 3HOWB 2HIXA 4OONA 5I9PA 1V1PB 2K5HA 1CTMA 2B2TC 3T51B 1ZEQX 3NWTA 3GTJH 4A3IG 1QVFA 1GHKA 3F2BA 2I5MX 5ELDA 2G9HD 3NEMA 4XT3B 1S40A 1B9MA 2KENA 5M5XH 1VQNA 2A1AA 3BDLA 2CW0D 2O2LD 2JA5G 1VQGA 2B2TA 3OTOQ 3PIP3 1FYCA 1SRUA 2DJGC 2WIIB 2B2YC 2RDGA 5ELNA 1N8RC 1OXSC 1FJGQ 1EYCA 5G3LD 4B3TQ 3A5ZB 4A3KB 1V43A 3MXUA 3VYSA 2RCFA 3OW7A 2OQ0A 2R61A 5M3MB 2Y0SB 2R7DA 4L5QA 4DAMA 2KEEA 4NXML 2KCCA 4WJ3M 3QB3A 5IIFA 2B2YA 3V05A 4B3MQ 2IL8A 2OTJA 1JR0D 1Y8NB 3R2TA 4ILWA 2E2JH 2B3GA 4GNXC 3DM3A 3Q6SA 3HG9A 5C44G 4H02A 5GAHC 2WAQE 4GS3A 3S1RH 4KJOA 3K5LA 2KBNA 5HY6A 3FVQA 3CW2C 1IBKQ 5IP9G 3PQIA 4ULLA 4HN7A 1QNKA 2V1CC 1A2TA 2ZTDA 2LXJA 3ND8A 1QOHA 4GNXA 4JI7L 1EY8A 2JQOA 3RR5A 4K0KQ 1II3A 3HKSA 4KY6A 5FLXc 1E2WA 3R3OA 1OTCA 1EEFD 3P1HA 3S1MB 3HOYB 3DWQA 1JMCA 3MTSA 4A3FG 2QW7A 3URYA 4B9XA 1K8OA 4LFCL 1BF4A 3TS0A 5KRUA 4LJZC 4IOCA 1OXTA 3HOXB 3X3MA 4LF6Q 2UXCL 1LTTD 4C3IG 4OL7A 3W2DA 3P7JA 1X65A 3I4OA 3NWSA 2AUKA 3KF6A 5H1SE 2UUAL 1FD7D 1D5MC 1U9RA 3NTIA 4DV6L 1N36L 1VQHA 3EROA 1X3GA 1TS2A 1G51A 4OIJA 4QY7A 4JG2A 2DUDA 3IKJA 1Q8KA 4ZCKA 5ELBA 1BBXC 2AWOA 1PTOH 2AMCB 4FF4A 2CQOA 3PF4A 4KLKA 4YWKA 2O5JC 3DEOA 2K5VA 1WCMB 2VB2X 4B3RL 2UXDL 3IRBA 4R8IA 3OSOA 3CCMA 2WACA 2E2DC 1T9HA 3WOFA 2F0LA 1SE8A 2L11A 1SJED 2F4IA 1SROA 1L0XB 3A8KE 3GDEA 1H95A 1IBLQ 1PRTF 5BN5A 4KKTA 1WTXA 4C3JH 4X64L 4F88A 1JT8A 5IYBH 3ULJA 1XPRA 3OIPA 3ERSX 2D2CC 1XMQQ 2K6AA 4EVOA 4DPGA 2MGSA 2E2IB 3HOVH 1I4HA 3MWYW 3HOWH 2AHOB 3G71A 1HCZA 3SK8A 3A54A 3M85A 1W6KA 1HZAA 1HQRD 4HJ9A 2NVTB 2WAQB 1G2TA 2UUBL 3J7AV 4OEMB 3K7AB 1GM5A 4PV1C 1UNSA 5C0XG 1A15A 5E4XA 1I4RA 5C4JB 2PNRC 1AE2A 5C4ZA 3I4NB 3F8TA 1STGA 4RG1A 1ET6A 1AE3A 4GKKQ 4HIOA 4LFBQ 3AFQA 1STAA 2A6ED 5D14A 1XJVA 1E3PA 1F2ZA 2D5DA 4J15A 5K36H 3P20A 2P5ZX 2IY5B 4JI4Q 2FFKB 5I4DA 2KCMA 3OOCA 1DJRD 4OWXB 1L0WA 3K80C 3EIVA 2RVLA 2HUGA 1GO3E 1IYJB 2RA4A 1IL2A 2AWNA 1F9RA 4OGQC 3KLSA 3K81C 3SK4A 5IGFA 2R7FA 1X54A 3NHHA 5FLXE 4AQYL 2AKWB 1B70B 1ASYA 1MSHA 2K28A 3S2DH 3BU2A 4BY1G 3OW2A 1NJIC 4TRDA 2DGYA 1PH8A 4M8AA 1SFOB 3TREA 3T1HQ 1VQ4A 5C4XG 4DF7A 3GD7A 1K8AC 5M5WB 1GJXA 4A3DG 5LHY1 3HOXH 4XQQA 2A6HC 3NELA 1KDCA 3A8JE 2IWHA 4ZUJA 3EN2A 1EEID 2NVXB 4PQXA 4R4TA 4IUPA 2NN6I 3D4RA 1RD9D 1X3EA 4RKLA 4OO1G 3TSSA 3GTGH 3M7GA 4C2MH 5C5LA 1AW7A 1YHQA 1B3QA 1CM9A 2EOTA 1KRSA 5M3FH 2B2UC 4RGNA 4NPSA 1K83B 3A74A 1LTSD 5E1FA 3CC4A 4ID6A 1JWUD 1WCMH 4TKOB 3S15H 4A75A 2Q2IA 1IKLA 3TQYA 2BH8A 1GXDC 2B2UA 3SE0A 1XNQL 4LFCQ 1B44D 3VR3A 3KF8A 3M9BA 4O0AA 2UXCQ 2F0TA 1PYSB 1FNVA 2N49A 1CHPD 4YHHL 4X66L 5EPJA 1SYBA 1IXRA 5IYDH 1SNMA 1B3AA 2VQFL 4DV6Q 1ML0D 1LTAD 5IYBG 4GOPC 1O78A 2CHBD 2RQXA 1RIPA 1B2TA 2D0PA 1TT2A 5E7NA 4P2CB 2K01A 3BZDB 3HOWG 2LFNA 3L9AX 1D1IA 3VR2A 4B08A 1YNJC 3PF5A 4Y7NH 2EIFA 3M3YH 5I6YA 2EYPA 3KDFB 3EVQA 4GOPA 3Q8DA 4KTAA 2UXDQ 4WORA 1BCPF 1PYBA 4FP5D 2YYZA 1Z6HA 2Q2HA 4FO2A 1S5DD 1EIHA 2PZWA 3WOEA 1EU3A 2F0PA 3CRKC 5JJIA 3SXHA 5IGEA 4X64Q 1SE2A 1YHBA 1XYIA 2QF7A 1QG7A 3AFPA 4Q0FA 1IKMA 1WD0A 5DNFA 4LAAA 4OIKA 1L1OB 5IT9L 5C3XA 1SYEA 4A3KG 2BA0A 5C44B 1ZYRD 3STBD 4JK1C 5M3MG 4C1NK 2Y0SG 1CKNA 4DK6C 2C35B 2NZOA 2DJFC 1D7QA 2UUBQ 1IBML 4YCWA 4AH6A 4QGUA 4A3EB 1PVOA 3H0GB 3GV3A 2Q8RE 1FNUA 2V4DA 3I73A 2TSSA 3FP9A 1BUVT 3K59A 1NSNS 3HRZC 3GTKH 2KHSA 4A3FB 1HZBA 1TWHB 4X3TA 5EJWA 2J0TD 4HMJA 2F0QA 5IYCH 3BYYB 2SNMA 5AFWA 2XRSD 4Q5VA 2R93H 4HEDA 5FJ8H 1S5BD 4LFAL 3HOUB 1PRTC 3HOYG 1IW7D 1ENAA 2GVAA 5D3DA 2F52A 3CCVA 3HZXA 1GUSA 1Q1BA 2R92B 3VR6A 2EJFC 4X3SA 3HOXG 3RZOH 1FNWA 1Y1WB 4DR6L 2PW7A 5JVH3 2MP1A 2VS1A 3RLNA 4XT1B 5CBEE 1XNRL 3CQZH 4POFA 4AQYQ 5CV6A 1EQTA 1STEA 2LSSA 2QDLA 1Z9FA 5T1GA 4KK7A 2IT1A 2G9DA 1K83H 5M3FG 4KHPL 1AH9A 1SMYD 4HSVA 3TZUA 2F3VA 3CF5A 3FMCA 2KCNA 2JA6H 3PO3B 4LMQD 3GTQH 1RL2A 1KIXA 2IHFA 2J4XA 1WCMG 4PNYA 2MHVA 3SEBA 3MEFA 5DM73 1UE7A 1STBA 1VDZA 4HAEA 1M90C 1AFPA 1EOTA 2K7VA 3UDFA 4B3TL 1LM0A 2Z6KC 3GTOH 4DR1L 1A0IA 3U4VA 2EYOA 1BKBA 3U4ZA 3PIOA 3CRLC 4HCEA 4OX9L 5EGTA 1U4MA 2HHHQ 2NN6H 3PUXA 4KN7C 2JN4A 5IYDG 1HFNA 4IOAA 3GTJB 3HKZG 3Q0AA 4BBSH 1ENFA 3L2PA 1QZHA 1CHQD 4IO9A 2YU9H 1H9MA 1KDBA 3B6YA 4HTHA 5EAYA 4LW1A 1LUZA 4EQPA 5M5XB 1E1TA 3E0EA 1EY4A 4JI0Q 1WTQA 3ZYYX 1SDFA 1PFNA 1K3RA 4LWCA 2R7ZH 3KOJA 5JOBA 1E7ZA 1DZ1A 4RHSA 4YHHQ 4X66Q 3BDCA 1ZKOA 1Q3LA 1BQQT 2A69D 1MHWC 3VR4A 2YV5A 2VQFQ 4RKBA 1G291 4ZKBB 4UY8C 3BZCA 1O80A 3BVMA 2F0DA 2QILA 2CKZB 2OCEA 4XQJA 4LF6L 1H9SA 2E2JB 4LUOA 5KEEA 3MXNB 1FGUA 1YNND 2SDFA 3I55A 4DNRB 3EJIA 3CC7A 5LMNL 4EGVA 2MNAA 4J6HA 1G8ZD 4KJNA 4R4CA 2BCOA 2A68D 2L55A 3I4MH 3H0GH 1QJOA 3HOZB 4FXDA 1YJNA 2Z9HA 2L5TA 3NBIA 4CKBA 2ZT9C 2FMCA 5IODA 1DGSA 4ZRZA 4EQ5A 1XTCD 1CKMA 5HURA 2ES2A 5E4WC 3DWAA 3K5MA 1JQYD 3LNNA 1X3QA 1V1QA 4K14A 2N55A 4JI3L 5ELCA 3HOUH 2Y0SE 1PTOD 2O5IC 1NMFA 2ZXPA 5FJ8G 3CCSA 3RMHA 3H3VH 2K03A 1B9NA 2R92H 3A8IE 4L5SA 1IBMQ 2M00A 1JJCB 1HR0Q 5M9OA 2JK8A 1V1PA 1XMOL 4KY5A 4A3LH 2L15A 4RA8A 1F9QA 2CVRA 1MBYA 3MFYA 1CKOA 1YZ6A 1PTOB 1U4LA 1K0SA 3G6JB 4YWMA 1UE5A 5JJZA 1C4QA 1VQMA 2IJ0A 1J9OA 4IUQA 4I7AA 1QVGA 3QR8A 4GKJQ 1AN8A 1GUGA 1BCPC 2I0QA 1V9PA 5FO7B 1RODA 2K05A 2LXKA 3PO3H 4NMZA 1D5ZC 4DN4M 2MPMA 1U5KA 4TQUS 4GKKL 3E3XA 3ER0A 4LFAQ 1X3FA 4C3JB 1TQOA 2JA6G 4B3SL 4R1JA 4XIGS 2L1BA 1DD2A 3O13A 3MC0B 2NBFA 3BZKA 2K5WA 4EX5A 3HOVB 2F1MA 1C7YA 4O42A 4DR6Q 1VMPA 2QEJC 4F87A 3J81i 1I50H 3CAMA 3LWUA 5C3WA 4G7ZC 4A3BB 1EIYB 1XNRQ 1TIID 2XSCA 1UUPA 1Q12A 1B50A 1SE4A 4KHPQ 1EIFA 2JEAI 5AJ3L 4DV1Q 2UUCL 2PZTA 4XQNA 3TZDA 1PH2A 1S5FD 3J80i 2J7ZA 1NBWA 4LF8L 2F0IA 5DM63 5FLMH 4JI6L 1LLRD 3L0OA 3NSWA 2WFWA 2ALYB 4ODGA 4N9PA 2I46A 4DR1Q 2SOBA 4OX9Q 2L0CA 4DUZL 3T1HL 1FGBD 1VS0A 3F1ZA 4POGA 1WTVA 3HKZE 2Q8TA 4QL5A 4RCNA 3CCLA 4YY3L 1LT5D 1FR3A 2AUJD 5EPLA 3JAMi 1F9PA 1CA5A 2PQAB 2RSNA 1SYGA 3HOZH 1JWSD 2NUCA 1CZWA 4A3EG 3I4MG 3H0GG 3S2DB 1HXYD 1S5ED 2F3IA 1R4QB 4DV3L 2PNHA 1Y69U 4MN3A 3OPOA 2ATWA 2EY1A 3DMUA 1KNEA 3IFTA 4CDCC 5I2YA 5M5YH 5COYA 3BG3A 2CQAA 2Q2TA 1DOLA 3HOUG 1KHIA 3GP7A 5LMNQ 4K6DA 4BS9A 2NVQH 2D62A 3GTGB 2IPKD 3J7A5 4C2MB 2NTTA 4PMCA 3NP8A 3FKIB 2R92G 5M3FB 4DGZA 3WDNA 4IPGA 1VQ5A 1YJWA 3V2TA 4A3LG 1Y1WG 1KXLA 3OIQA 1SAPA 2BH2A 4GN5A 3BYTB 2CWPA 3KLSX 2IX3A 1N33Q 3S15B 3QOLA 1WVLA 1I3QB 4DAYB 2X6GA 3CCUA 1LTGD 4JI3Q 3MXPA 3A7LA 1EY0A 1H9KA 4RMFA 1VQ9A 2ZXOA 3PO3G 4HJ7A 4GNXB 3EA6A 3NENA 5KNDA 1ICWA 3HEJA 3HKZB 3I91A 5J39A 1L0YB 4X6AH 3BS1A 1TWAB 4GZYC 5IP7G 2UU9L 1B1ZA 2PQEA 1XMOQ 4IPDA 2BDOA 1OXVA 2GA4B 4A3BH 2XGTA 4MHEA 3U9SA 3NTKA 4Y7NB 3M3YB 1U0LA 5FK9C 3D31A 2ZTEA 2M9VA 3KF6B 3UE1A 3K5NA 2RCNA 3I4LA 1PZID 4IUNA 2MUYA 2RDFA 4G7OC 4K5VA 3F2DA 4ZQ3A 2I5HA 4UP9A 5BN4A 2MFIA 4P75A 1WYDA 4B3SQ 3SK5A 4LUZA 3M4QA 4DAPA 1TWFH 1HQMC 3A7AB 5EKIA 3DWPA 1UWVA 2SNSA 2A19A 4KV6A 1G6ZA 1HR0W 2K75A 3PIPA 4IFDI 4IUTA 3G48A 1I94L 2JP1A 3T1YQ 4BBRH 4N8X1 1BDOA 1CFMA 5CV7A 5AJ3Q 2F0JA 1W3SA 2UUCQ 1GD7A 4LF7L 1LYLA 1QE6A 3NBHA 3PCOB 4KHVA 4DNTB 4LF8Q 1SSOA 4K8IA 3GTKB 4A3CH 3W5OA 3HOZG 4L63B 4JI6Q 3NE5B 3C46A 2UXBL 1EQVA 4BY7H 5KNCA 2WKDA 3D0FA 4E6IA 5CV9A 3R93A 4DR5L 2VZAA 3D4DA 3KFUA 4JI8L 2R93B 2NWGA 3SK6A 4DUZQ 4HR7B 1K8GA 1YJ9A 4DK1A 3T16A 1LTBD 3TDQA 3A55A 1QVCA 1KDAA 4X3KA 1Q81C 3W1GA 2A73B 5JEAH 2OQKA 4YY3Q 1HNZQ 1SEBD 4DR4L 1PLFA 2CWAA 3RZOB 1I6HH 2HHHL 4DK3C 4FXKC 4DK0A 1ONLA 3PV0A 4DV4L 1BR9A 1SNDA 1TXYA 3CQZB 1W2BA 4BXXH 3FKIH 3VR5A 3KLWA 2XVSA 1QNUA 4RH6A 4UP8A 5IGBA 1J6QA 3GTMH 5EQ0A 1SBBB 4DV3Q 4OWTB 1EY5A 5A2QE 4CJ2C 1SN8A 3M7NA 3J81c 1E24A 2JA6B 1K73C 2PMZE 1BVSA 3W3AA 3GTQB 1L1OC 4RGMA 1I3QH 4JI0L 1Q86C 1RKNA 4JW0A 3E0JA 1A8VA 1LTRD 1S3OA 3GTOB 2EDGA 2EXDA 2B8FA 2AQ3B 3J80c 5JVG3 3X3NA 2Z6BA 1L1OA 3MXGA 4C3JG 5GAGC 1I4XA 4QQBX 1TWAH 3W1BA 4A93H 3STBC 2F3WA 1IL8A 3PUYA 4BBSB 3TBIB 3HOVG 2CCZA 2YU9B 1OXUA 3RN5A 1CSQA 1X6OA 1BXTA 3D6CA 4APVA 4YCUA 2A6HD 4A3BG 4C3HH 3K8AA 3G6EA 3QIAA 1GVPA 2ZXRA 4JPBW 3TN2A 3VYTA 3EFXD 2R7ZB 3K0XA 2B63H 3JAMc 2Q8IB 2K4KA 4CKEA 5G3LF 1TR5A 3CPWA 5CMDA 1YVCA 1CZGA 5K5PA 4DU9A 1KL9A 1ILPA 1TWGB 3U58A 1EWHA 1MGSA 5K36G 1IW7C 2UU9Q 5LMNW 1WTHA 1QB5D 2JA8H 1PH5A 1K3BC 3KF8B 3VYUA 4DFAA 1WFQA 3HP3A 4A3JH 1I6VC 2YTYA 1HR0L 1EQQA 3I4MB 2RHSB 1KNAA 2EQSA 1BBUA 1ENCA 4CDDC 3QG1A 2F0EA 1SNCA 4L5RC 4X65L 4WFN3 5C6AA 3M4OB 3ERQA 1MD2D 4H44C 3A0JA 5T1IA 1SMYC 2PMZB 4GKJL 2VL6A 2K1BA 4JBJA 1AEXA 1PZJD 2MO1A 1YNJD 2H1EA 2OTLA 2WB1B 3KJOA 1EYDA 4BY7G 4DR3L 4GOPB 2ID0A 4DV2L 4X62Q 2G5DA 4FNFA 3M4PA 2L4NA 3C1EA 1D1KA 3U9OA 3ZJYC 5JJKA 4S3SA 4IFDH 2SEBD 1I94Q 4PMWA 3TP8A 3DHQA 4IUUA 4RGOS 2E5LL 1O7YA 1HTPA 3U50C 5JEAG 1JC7A 1GHJA 2ZJPA 4FVMA 4RCOA 1Q82C 4LF7Q 4MIUA 3J81E 2IW3A 2PI2E 5C3EH 2L12A 4FYDA 4HSPA 2OWOA 4JYAL 1WTOA 1R9TH 4BXXG 3FKIG 1STHA 1EZ8A 4JCVE 4CJ0B 1X56A 4DV1L 1CKNB 2UXBQ 5KNBA 3C2PA 4RHRA 4DR5Q 1HPCA 3PUZA 3S14H 4L5TA 1XWEA 1CT1D 4JI8Q 3FPPA 2EY2A 3J80E 1KTKA 1X32A 1MSGA 1HJPA 1Q90A 3K0YA 5C0XI 1H9RA 1TU2B 3QWNA 3IAYA 4GN3B 2F0SA 4QB4A 2WKCA 1T5XD 4DR4Q 4O2DA 2B2WC 4XXEA 5EKKA 1EY6A 2NB0A 3G4SA 1TS5A 5JAVA 1JWMD 4PMBA 4RFBA 1I50B 3EQLC 1VQ6A 2GN5A 3BVZA 3SGIA 4ZKCB 4DV4Q 1NNXA 5CORA 1L2FA 2VXWA 2Z6KA 2QGQA 5GQOA 1C0AA 5CGKA 5LMUL 4DKAC 3CMEA 4U673 2EYMA 1PRTD 2B2WA 2K04A 3PSIA 3JAME 1X3PA 2F0UA 3NXWA 2NVYH 3CCRA 3D8GA 4PG3A 5HGTA 2R6GA 1IYVA 1PRTB 4YIJA 2VW9A 1IHZA 1JB7A 1DM0B 3S2HH 2JA5H 5DAUA 2B63G 1HH2P 3HFZB 1O7ZA 1HFGA 1Y1VH 1KD1C 1TWGH 1GOZA 1YEZA 1F77A 2VY3A 1PTOC 1CK1A 1LTLA 3ULLA 2EJMA 4Z9CB 5GADC 2X6LA 1O7LA 3CKIB 4KN4C 3K58A 1C8CA 1PA6A 2H4OA 3S16H 1CI3M 1XXGA 2FXQA 3T13A 2JA8G 1DOKA 1F2YA 4NKLA 2MO0A 2E75C 4HJ5A 5J3BA 1MI2A 4HIDA 4QIWE 2CH4A 1P16A 3VDYA 3M4OH 2A74C 2JSOA 4OO1I 3H6MA 3N6RA 4DV7Q 4L6TB 3BDOA 1N33L 1QUQA 1PFMA 1VCIA 5IY0A 2IX1A 1EFID 3AB9A 4R8NA 4N8FA 1LT4D 4P74A 1ESRA 5ISRA 4V0BA 2PW5A 1YIJA 2FHTA 4CHTB 4WJ4A 2K14A 5M5YB 4AIMA 2B8GA 1I4GA 2I5LX 5IYCG 1J8IA 1SE3A 1MKHA 2LY7A 4XYOA 4A4IA 1A63A 2R93G 3L3OC 1C9OA 1EOVA 1Q1EA 5HGQA 4OWWB 2AQ2B 1YHAA 4XYQA 3ICEA 4GLXA 4ZLTF 2NVQB 1B8AA 3J81j 4JVZA 3PO2B 4HIKA 3SDZA 3I70A 3UDGA 4IFDG 1NTGA 1CSPA 1EYAA 1ZXTA 1HNXQ 3H91A 3V96A 2HQLA 2ASBA 1VQ7A 4X65Q 2WP8J 2XWBB 3EBEA 1WI5A 1V8QA 1H9SB 1ESFA 3HS0C 5BR8L 1EY7A 4DUYL 1CQVA 4J1MA 4GLAC 2A5HA 1R4PB 4G57A 1UAPA 2CW0C 5C3EG 2EPBA 2ZJRA 3J7YW 2NZ1D 3RLOA 1H9JA 4DR3Q 4BA1I 1W6JA 5D3IB 4DV2Q 4KKUA 1UEBA 1Z7TA 1ASZA 2F0MA 4JOIC 4WRDA 1NAPA 4ME3A 1SJHD 3NTHA 5GAEC 2E5LQ 5ELEA 1JE5A 1XPOA 1TKWB 3R2IA 3CCQA 3NQTA 1VQCA 3KLRA 1Q7YC 2NN6G 3T1YL 1SYCA 1S4ZA 5IGDA 3T4AC 1EQRA 4JYAQ 3QJYA 4DR7L 4QIWB 1SXTA 4HCSA 4BBSG 1A3UA 4DR2L 4OELB 3IFDA 3S9WA 1BOSA 1JJGA 2EYJA 4NXNQ 3DXJC 2Q2UA 3DUZA 4B9WA 3SR1A 4JI2Q 4AYBG 4JBWA 1J5EL 1EFWA 1PDQA 5FO8B 2E8GA 1MJCA 5C0XH 2X69A 1HA6A 1HZCA 1VMCA 1VF5C 3K5OA 2B39A 4IJLA 1QCBD 1TWFB 5JEAJ 1N32L 2R7ZG 2VQEQ 1E2ZA 4ME5A 3VA7A 2DY8A 1K9MC 1OO9B 1BCPD 3I90A 1Z47A 4EQNA 1Y1VG 1ILQA 3E9HA 1HNZL 1VQBA 2PO4A 2BDNA 2BE5D 3CHBD 4BBRB 5LMUQ 1YI2A 1JJ2A 1U4PA 1GUTA 1X9NA 2WV6D 3LX0A 3S1NB 1ET9A 1BCPB 4FF1A 4BWGB 2WINB 1RHPA 2MQHA 2E74C 4NDXA 4IZ8A 4MZ9A 4K5WA 1F2LA 2KVMA
chains in the Genus database with same CATH topology
1W3SA 4AH6A 4QGUA 1GD7A 1PVOA 1VQEA 1MIUA 4LF7L 1LYLA 1D8LA 2XTIA 3UDXA 5IP9H 3PCOB 4LF8Q 4DV0Q 3CXCA 4A3EH 2HT1A 4HJ8A 4R4QA 4A3CH 3W5OA 3FP9A 3HOZG 4JI6Q 2UXBL 1EUJA 3CCEA 4BY7H 2VNUD 4KI0A 3GTKH 3D0FA 4P73A 5IWAL 3PUWA 3F2CA 1HZBA 4DR5L 2VZAA 2QEXA 2ZTCA 1VQOA 4BY1H 3KFUA 5DLQE 2QA4A 4JI8L 4DUZQ 4A3FH 4GLVB 1K8GA 1YJ9A 5IYCH 1TWHH 3OYYA 2K52A 2WB1G 1FVIA 1SR3A 3LGJA 2R93H 2ZM6L 1QVCA 1Q81C 3W1GA 4LF4Q 5FJ8H 4LFAL 4P71A 2OQKA 4YY3Q 1HNZQ 5C4XH 4C3IH 3HOYG 4DR4L 2K5NA 3PGZA 1PH4A 3S24A 3PO2H 2GVAA 4UPAA 2CWAA 1EWIA 2F52A 3CCVA 1IBLL 1I6HH 4A3DH 2HHHL 4DK3C 1PH6A 1Q1BA 1XTDA 4KHZA 4A3GG 3PV0A 4YCVA 4DV4L 1A62A 1TXYA 3HOXG 3CMAA 1W2BA 3RZOH 4BXXH 1UE6A 3FKIH 3KLWA 4DR6L 1XMQL 2VS1A 4UP8A 4JV5Q 3RLNA 1J6QA 1XNRL 3CQZH 3S1QH 3GTMH 3KJPA 4POFA 4AQYQ 4DV3Q 1Y1WH 1VQ8A 2LSSA 1WJJA 2VUMG 2JA9A 4OWTB 1Z9FA 2YTXA 4DNIA 1PHJA 1SN8A 3M7NA 3K7UC 3J81c 1E24A 1HZ9A 2IT1A 4ALPA 1K83H 2N3SA 5M3FG 2PMZE 1K73C 1BVSA 4KHPL 1AH9A 1L1OC 4IJHA 1I3QH 1YITA 1MJEA 4JI0L 3CF5A 1Q86C 2H5XA 5IWAQ 1PH7A 2JA6H 4LNQA 3GTQH 1RL2A 1KIXA 2IHFA 1OXXK 4FDBA 1FL0A 1QUQB 1A8VA 3ULPA 2F4VL 1S3OA 1WCMG 3MEFA 1UE7A 2EXDA 1I5FA 1M90C 4JI1L 3UDIA 3UDFA 3J80c 4B3TL 1LM0A 2Z6KC 4JOIA 1L1OA 4LFBL 3GTOH 4DR1L 5GAGC 1A0IA 3U4VA 3U4ZA 1BKBA 1NMGA 3PIOA 4DV5Q 4QQBX 4OX9L 1TWAH 3W1BA 1SLJA 1M1KC 4A93H 3STBC 5IP7H 2PQAA 3PUYA 2HHHQ 4JI4L 4LF5Q 3PUXA 5IYDG 3HOVG 2CCZA 5BR8Q 4DUYQ 1Q46A 1OXUA 2HIXA 1CSQA 1X6OA 4OONA 3RN5A 4IOAA 2JEBI 2JA7H 3HKZG 4BBSH 4APVA 3L2PA 1QZHA 2K5HA 4YCUA 4IO9A 4A3BG 2YU9H 4C3HH 3K8AA 3G6EA 1GVPA 4A3IG 4UP7A 3GTJH 2KHIA 1QVFA 3CP0A 3B6YA 5EAYA 4LW1A 1LUZA 3F2BA 2I5MX 3NEMA 1E1TA 3E0EA 3K0XA 2B63H 1S40A 3JAMc 4JI0Q 2K4KA 2KENA 5M5XH 1VQNA 2A1AA 3CPWA 1K3RA 3I2ZA 4LWCA 5FLMG 2JA5G 1VQGA 1YVCA 4IFDJ 3TEHB 2R7ZH 3OTOQ 3KOJA 4X62L 1SRUA 1E7ZA 1KL9A 2F4VQ 1PH9A 5ELNA 4YHHQ 1OXSC 2RF4A 4X66Q 3U58A 1N8RC 1FJGQ 4JI1Q 5K36G 4B3TQ 3I56A 3A5ZB 1V43A 2UU9Q 2YV5A 5LMNW 4LF9L 2VQFQ 1G291 4UY8C 1YNXA 2OQ0A 4DR7Q 3BZCA 4JI5L 2JA8H 1PH5A 1N9WA 2CKZB 2OCEA 4LF6L 2R7DA 4L5QA 4A3KH 3KF8B 4LUOA 4DAMA 4NXML 1WFQA 1N34L 4JBKA 4WJ3M 3S1NH 3MXNB 4DR2Q 1FGUA 2YTYA 4A3JH 1HR0L 3I55A 1EQQA 2D0OA 2IX0A 4AYBE 5M3MH 4B3MQ 3KYHC 2RHSB 1KC8C 2OTJA 2EQSA 3CC7A 1BBUA 2E2JH 5LMNL 2B3GA 2MNAA 2BA1A 4GNXC 3DM3A 4R4CA 4L5RC 1J5EQ 3I4MH 3H0GH 4X65L 3J7ZC 2B29A 5C44G 4H02A 5GAHC 2WAQE 4GS3A 3S1RH 1YJNA 2KBNA 1CUKA 3A0JA 2Z0SA 3HOUG 5HY6A 1IBKQ 1DGSA 3CW2C 4GKJL 4EQ5A 5IP9G 1N32Q 1CKMA 2VL6A 4MTNA 2V1CC 4JBJA 2ZTDA 1KAWA 2LXJA 2MO1A 4GNXA 2ES2A 4JI7L 2JQOA 3RR5A 3E9IA 2OTLA 3H15A 1VQPA 4K0KQ 3HKSA 3KJOA 4BY7G 4DR3L 4GOPB 2K50A 2ID0A 4DV2L 4X62Q 5FLXc 1OTCA 2NZHA 1V1QA 3M4PA 4IPHA 4JI3L 1JMCA 5JJKA 3ZJYC 4A3FG 3HOUH 3S1MH 2Y0SE 4LFCL 3TS0A 1I94Q 4R4IA 3HOYH 2KCTA 4IOCA 1OXTA 4PMWA 1NMFA 2E5LL 5FJ8G 3CCSA 3H3VH 3U50C 5JEAG 4LF6Q 2UXCL 2R92H 4NXMQ 4L5SA 1IBMQ 3GO5A 3PO2G 1JJCB 1X65A 3I4OA 2ZJPA 1HR0Q 2UUAL 3KF6A 5H1SE 2JK8A 1Q82C 4LF7Q 3GTLH 1XMOL 4A3LH 2L15A 4HJAA 3KDFA 4DV6L 1N36L 1CKOA 1VQHA 1YZ6A 2PI2E 1X3GA 2RHQB 1Y14B 4QJFA 5C3EH 1G51A 2OWOA 4JYAL 4YWMA 1R9TH 1UE5A 4BXXG 4QY7A 4JG2A 3FKIG 1VQMA 2DUDA 4JCVE 4R4OA 1Q8KA 1X56A 3DLLA 1CKNB 4DV1L 1PH3A 1KQSA 3CC2A 2AWOA 2UXBQ 1QVGA 2AMCB 4DR5Q 2CQOA 4GKJQ 3PF4A 3PUZA 3S14H 4L5TA 4KLKA 2WB1E 4JI8Q 2I0QA 4YWKA 1V9PA 3NBHB 4JI7Q 1HJPA 2K5VA 3CCJA 3S17H 4B3RL 5C0XI 2UXDL 3IRBA 1VQFA 3CCMA 1XPUA 2LXKA 3PO3H 3TS2A 1T9HA 1U5KA 4TQUS 2ZM6Q 4GN3B 4GKKL 3ER0A 4LFAQ 1X3FA 1SE8A 2JA6G 4DR4Q 4O2DA 4R1JA 4B3SL 3CPFA 1E22A 4XIGS 1SROA 3G4SA 3GDEA 1NY4A 1H95A 1IBLQ 4PZ7A 4C3JH 3BZKA 4X64L 4EX5A 1VQDA 5IYBH 2GN5A 1VQ6A 1JT8A 3ULJA 3SGIA 4DV4Q 1XPRA 1L2FA 5GQOA 2Z6KA 2QGQA 3ERSX 1C7YA 4DR6Q 1XMQQ 1C0AA 5LMUL 4DPGA 3J81i 1PV4A 4DKAC 1I50H 3CAMA 3CMEA 1G6PA 3BJUA 3HOVH 1EIYB 2UUAQ 3AYHB 1XNRQ 3CD6A 3HOWH 2AHOB 3G71A 1N36Q 3PSIA 1Q12A 3M85A 2E2IH 3TRZA 1HZAA 4HJ9A 2NVYH 3CCRA 2JA7G 2N78A 4KHPQ 1EIFA 2UUBL 2JEAI 5AJ3L 4PG3A 4DV1Q 2IHEA 4DV7L 1GM5A 2UUCL 1PH2A 2R6GA 3J80i 5C0XG 2NVTH 4HIMA 1NBWA 1UE1A 2VW9A 4LF8L 3K7AH 4DV0L 1JB7A 1IZ6A 1SMXA 1KRTA 1AE2A 3F8TA 4B3RQ 5FLMH 4JI6L 3S2HH 2JA5H 3L0OA 2B63G 1HH2P 3HFZB 3AQQA 4RG1A 3RLFA 4Y52H 2WFWA 2ALYB 4GKKQ 1AE3A 5C4JH 1P8LA 4HIOA 1Y1VH 5IT9c 4A3MH 4LFBQ 3I4NH 3PUVA 3AFQA 4DR1Q 1KD1C 1TWGH 3WWVA 1XJVA 1E3PA 1YEZA 2VY3A 4J15A 1QZGA 3ULLA 1LTLA 4DUZL 3T1HL 4OX9Q 1PFSA 1O7IA 1VS0A 3F1ZA 4POGA 2IY5B 4JI4Q 4JBMA 3L7ZC 3HKZE 5GADC 2KCMA 4QL5A 4LF4L 4OWXB 1HNXL 3CCLA 1PA6A 1L0WA 4YY3L 3S16H 3K80C 4BBRG 2FXQA 1PH1A 2JA8G 3EIVA 2CFMA 2MO0A 3JAMi 4HJ5A 5JJLA 5J3BA 1GO3E 1IYJB 4IPCA 4QIWE 4HIDA 3AEVA 2JE6I 1IL2A 2PQAB 4PZ8A 3H3VI 2AWNA 1P16A 3VDYA 3HOZH 3M4OH 3K81C 4JV5L 4OO1I 2R7FA 2E2HH 4DV7Q 4A3EG 1X54A 3I4MG 3FHWA 3H0GG 4A3CG 1N33L 2F3IA 3GTPH 1QUQA 1VCIA 2AKWB 1B70B 5IY0A 4DV3L 4AQYL 1ASYA 2IX1A 2PNHA 3I7FA 2HIVA 4P74A 3RN2A 3S2DH 1HNWL 3BU2A 4BY1G 3OW2A 1YIJA 2JJQA 2ATWA 1NJIC 4WJ4A 2K14A 4AIMA 5IYCG 2I5LX 4LF9Q 1MKHA 2GVBA 2DGYA 4A4IA 1B7YB 1PH8A 1A63A 2R93G 4JI5Q 5M5YH 3TREA 3T1HQ 1C9OA 1EOVA 1Q1EA 5HGQA 1E1OA 1VQ4A 4OWWB 5C4XG 1YHAA 3ICEA 4GLXA 1N34Q 2Q2TA 1B8AA 3GD7A 3J81j 4A3GH 1K8AC 1SFOH 4HIKA 1WOCA 4A3DG 3HOXH 3UDGA 4IFDG 1NTGA 1CSPA 2KHJA 1KHIA 3A5UA 1HNXQ 3NELA 5LMNQ 2A8VA 2NVQH 2HQLA 2ASBA 4DV5L 2D62A 3EN2A 3J7A5 4P72A 1VQ7A 5M5WH 2YTVA 4R4TA 4X65Q 2R92G 2WP8J 4JC0A 1VQJA 1WI5A 2NN6I 1X3EA 3EBEA 4OXPA 5C0XJ 4LF5L 2VUMH 3GTGH 4OO1G 4C2MH 5BR8L 4NXNL 4DUYL 4IPGA 1VQ5A 2NVXH 1YJWA 4GLAC 1YHQA 4A3LG 1Y1WG 1KXLA 1KRSA 4JI2L 5M3FH 5C3EG 2BH2A 5IE8A 2ZJRA 4GN5A 2CWPA 4NPSA 5ELOA 1N33Q 4A76A 3RLOA 3A74A 3CC4A 4DR3Q 4BA1I 4DV2Q 4DAYB 4YWLA 1UEBA 1YBYA 1WCMH 3CCUA 3S15H 4A75A 2Q2IA 3TQYA 1ASZA 4JI3Q 2VQEL 4JOIC 2BH8A 4RMFA 1XNQL 1VQ9A 4ME3A 4LFCQ 3PO3G 4HJ7A 4GNXB 3OTOL 3NENA 5GAEC 2E5LQ 4NB3A 3M9BA 4O0AA 2UXCQ 1JE5A 1PYSB 2N49A 4YHHL 4X66L 1FJGL 4X6AH 1XPOA 1IXRA 4A93G 5IYDH 3CCQA 4GN4B 1VQCA 5IP7G 2UU9L 1XMOQ 2VQFL 1Q7YC 2NN6G 4DV6Q 4IPDA 3T1YL 1VQAA 5IYBG 1OXVA 4GOPC 4BA2I 2PI2A 4A3BH 1EQRA 4JYAQ 4DR7L 2XGTA 1VQKA 1RIPA 4BBSG 4A3IH 2D0PA 2ZJQA 4DR2L 5E7NA 1U0LA 1JJGA 4B3ML 2UUCQ 4PZ6A 3D31A 4NXNQ 3HOWG 2Q2UA 1K0RA 3JC66 2ZTEA 3KF6B 4JI2Q 3UE1A 4AYBG 4Y7NH 3PF5A 2EIFA 3M3YH 4JBWA 2RCNA 1J5EL 3KDFB 1EFWA 4GOPA 1NE3A 3Q8DA 2UXDQ 2E8GA 1MJCA 1BBWA 1HZCA 1PYBA 3F2DA 2YYZA 2Q2HA 1X55A 4IJLA 2I5HA 4UP9A 3UE0A 1VQLA 1IBKL 2MFIA 2WAQG 5JEAJ 1N32L 2R7ZG 4P75A 1WYDA 4B3SQ 4LUZA 2VQEQ 3M4QA 1K9MC 5JJIA 1TWFH 1XNQQ 4K0KL 4X64Q 1Z47A 1YHBA 1TWCH 4A3MG 1Y1VG 1UWVA 3E9HA 3AFPA 1HNZL 3I4NG 1HNWQ 1GKHA 2A19A 2N8NA 1VQBA 5GROA 1L1OB 5LMUQ 3RZDH 1JJ2A 4TVAB 1YI2A 4MNOA 1EYGA 1HR0W 2K75A 3PIPA 4IFDI 4A3KG 1X9NA 4LUVA 2BA0A 3G48A 3RNUA 4A3JG 1I94L 3STBD 3T1YQ 4BBRH 1S72A 5M3MG 1VQIA 1CKNA 2Y0SG 2MQHA 4DK6C 2C35B 4XTCS 5C44H 2NZOA 1D7QA 4MZ9A 2UUBQ 1IBML 5AJ3Q 4YCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3S A;  4AH6 A;  4QGU A;  1GD7 A;  1PVO A;  1VQE A;  1MIU A;  4LF7 L;  1LYL A;  1D8L A;  2XTI A;  3UDX A;  5IP9 H;  3PCO B;  4LF8 Q;  4DV0 Q;  3CXC A;  4A3E H;  2HT1 A;  4HJ8 A;  4R4Q A;  4A3C H;  3W5O A;  3FP9 A;  3HOZ G;  4JI6 Q;  2UXB L;  1EUJ A;  3CCE A;  4BY7 H;  2VNU D;  4KI0 A;  3GTK H;  3D0F A;  4P73 A;  5IWA L;  3PUW A;  3F2C A;  1HZB A;  4DR5 L;  2VZA A;  2QEX A;  2ZTC A;  1VQO A;  4BY1 H;  3KFU A;  5DLQ E;  2QA4 A;  4JI8 L;  4DUZ Q;  4A3F H;  4GLV B;  1K8G A;  1YJ9 A;  5IYC H;  1TWH H;  3OYY A;  2K52 A;  2WB1 G;  1FVI A;  1SR3 A;  3LGJ A;  2R93 H;  2ZM6 L;  1QVC A;  1Q81 C;  3W1G A;  4LF4 Q;  5FJ8 H;  4LFA L;  4P71 A;  2OQK A;  4YY3 Q;  1HNZ Q;  5C4X H;  4C3I H;  3HOY G;  4DR4 L;  2K5N A;  3PGZ A;  1PH4 A;  3S24 A;  3PO2 H;  2GVA A;  4UPA A;  2CWA A;  1EWI A;  2F52 A;  3CCV A;  1IBL L;  1I6H H;  4A3D H;  2HHH L;  4DK3 C;  1PH6 A;  1Q1B A;  1XTD A;  4KHZ A;  4A3G G;  3PV0 A;  4YCV A;  4DV4 L;  1A62 A;  1TXY A;  3HOX G;  3CMA A;  1W2B A;  3RZO H;  4BXX H;  1UE6 A;  3FKI H;  3KLW A;  4DR6 L;  1XMQ L;  2VS1 A;  4UP8 A;  4JV5 Q;  3RLN A;  1J6Q A;  1XNR L;  3CQZ H;  3S1Q H;  3GTM H;  3KJP A;  4POF A;  4AQY Q;  4DV3 Q;  1Y1W H;  1VQ8 A;  2LSS A;  1WJJ A;  2VUM G;  2JA9 A;  4OWT B;  1Z9F A;  2YTX A;  4DNI A;  1PHJ A;  1SN8 A;  3M7N A;  3K7U C;  3J81 c;  1E24 A;  1HZ9 A;  2IT1 A;  4ALP A;  1K83 H;  2N3S A;  5M3F G;  2PMZ E;  1K73 C;  1BVS A;  4KHP L;  1AH9 A;  1L1O C;  4IJH A;  1I3Q H;  1YIT A;  1MJE A;  4JI0 L;  3CF5 A;  1Q86 C;  2H5X A;  5IWA Q;  1PH7 A;  2JA6 H;  4LNQ A;  3GTQ H;  1RL2 A;  1KIX A;  2IHF A;  1OXX K;  4FDB A;  1FL0 A;  1QUQ B;  1A8V A;  3ULP A;  2F4V L;  1S3O A;  1WCM G;  3MEF A;  1UE7 A;  2EXD A;  1I5F A;  1M90 C;  4JI1 L;  3UDI A;  3UDF A;  3J80 c;  4B3T L;  1LM0 A;  2Z6K C;  4JOI A;  1L1O A;  4LFB L;  3GTO H;  4DR1 L;  5GAG C;  1A0I A;  3U4V A;  3U4Z A;  1BKB A;  1NMG A;  3PIO A;  4DV5 Q;  4QQB X;  4OX9 L;  1TWA H;  3W1B A;  1SLJ A;  1M1K C;  4A93 H;  3STB C;  5IP7 H;  2PQA A;  3PUY A;  2HHH Q;  4JI4 L;  4LF5 Q;  3PUX A;  5IYD G;  3HOV G;  2CCZ A;  5BR8 Q;  4DUY Q;  1Q46 A;  1OXU A;  2HIX A;  1CSQ A;  1X6O A;  4OON A;  3RN5 A;  4IOA A;  2JEB I;  2JA7 H;  3HKZ G;  4BBS H;  4APV A;  3L2P A;  1QZH A;  2K5H A;  4YCU A;  4IO9 A;  4A3B G;  2YU9 H;  4C3H H;  3K8A A;  3G6E A;  1GVP A;  4A3I G;  4UP7 A;  3GTJ H;  2KHI A;  1QVF A;  3CP0 A;  3B6Y A;  5EAY A;  4LW1 A;  1LUZ A;  3F2B A;  2I5M X;  3NEM A;  1E1T A;  3E0E A;  3K0X A;  2B63 H;  1S40 A;  3JAM c;  4JI0 Q;  2K4K A;  2KEN A;  5M5X H;  1VQN A;  2A1A A;  3CPW A;  1K3R A;  3I2Z A;  4LWC A;  5FLM G;  2JA5 G;  1VQG A;  1YVC A;  4IFD J;  3TEH B;  2R7Z H;  3OTO Q;  3KOJ A;  4X62 L;  1SRU A;  1E7Z A;  1KL9 A;  2F4V Q;  1PH9 A;  5ELN A;  4YHH Q;  1OXS C;  2RF4 A;  4X66 Q;  3U58 A;  1N8R C;  1FJG Q;  4JI1 Q;  5K36 G;  4B3T Q;  3I56 A;  3A5Z B;  1V43 A;  2UU9 Q;  2YV5 A;  5LMN W;  4LF9 L;  2VQF Q;  1G29 1;  4UY8 C;  1YNX A;  2OQ0 A;  4DR7 Q;  3BZC A;  4JI5 L;  2JA8 H;  1PH5 A;  1N9W A;  2CKZ B;  2OCE A;  4LF6 L;  2R7D A;  4L5Q A;  4A3K H;  3KF8 B;  4LUO A;  4DAM A;  4NXM L;  1WFQ A;  1N34 L;  4JBK A;  4WJ3 M;  3S1N H;  3MXN B;  4DR2 Q;  1FGU A;  2YTY A;  4A3J H;  1HR0 L;  3I55 A;  1EQQ A;  2D0O A;  2IX0 A;  4AYB E;  5M3M H;  4B3M Q;  3KYH C;  2RHS B;  1KC8 C;  2OTJ A;  2EQS A;  3CC7 A;  1BBU A;  2E2J H;  5LMN L;  2B3G A;  2MNA A;  2BA1 A;  4GNX C;  3DM3 A;  4R4C A;  4L5R C;  1J5E Q;  3I4M H;  3H0G H;  4X65 L;  3J7Z C;  2B29 A;  5C44 G;  4H02 A;  5GAH C;  2WAQ E;  4GS3 A;  3S1R H;  1YJN A;  2KBN A;  1CUK A;  3A0J A;  2Z0S A;  3HOU G;  5HY6 A;  1IBK Q;  1DGS A;  3CW2 C;  4GKJ L;  4EQ5 A;  5IP9 G;  1N32 Q;  1CKM A;  2VL6 A;  4MTN A;  2V1C C;  4JBJ A;  2ZTD A;  1KAW A;  2LXJ A;  2MO1 A;  4GNX A;  2ES2 A;  4JI7 L;  2JQO A;  3RR5 A;  3E9I A;  2OTL A;  3H15 A;  1VQP A;  4K0K Q;  3HKS A;  3KJO A;  4BY7 G;  4DR3 L;  4GOP B;  2K50 A;  2ID0 A;  4DV2 L;  4X62 Q;  5FLX c;  1OTC A;  2NZH A;  1V1Q A;  3M4P A;  4IPH A;  4JI3 L;  1JMC A;  5JJK A;  3ZJY C;  4A3F G;  3HOU H;  3S1M H;  2Y0S E;  4LFC L;  3TS0 A;  1I94 Q;  4R4I A;  3HOY H;  2KCT A;  4IOC A;  1OXT A;  4PMW A;  1NMF A;  2E5L L;  5FJ8 G;  3CCS A;  3H3V H;  3U50 C;  5JEA G;  4LF6 Q;  2UXC L;  2R92 H;  4NXM Q;  4L5S A;  1IBM Q;  3GO5 A;  3PO2 G;  1JJC B;  1X65 A;  3I4O A;  2ZJP A;  1HR0 Q;  2UUA L;  3KF6 A;  5H1S E;  2JK8 A;  1Q82 C;  4LF7 Q;  3GTL H;  1XMO L;  4A3L H;  2L15 A;  4HJA A;  3KDF A;  4DV6 L;  1N36 L;  1CKO A;  1VQH A;  1YZ6 A;  2PI2 E;  1X3G A;  2RHQ B;  1Y14 B;  4QJF A;  5C3E H;  1G51 A;  2OWO A;  4JYA L;  4YWM A;  1R9T H;  1UE5 A;  4BXX G;  4QY7 A;  4JG2 A;  3FKI G;  1VQM A;  2DUD A;  4JCV E;  4R4O A;  1Q8K A;  1X56 A;  3DLL A;  1CKN B;  4DV1 L;  1PH3 A;  1KQS A;  3CC2 A;  2AWO A;  2UXB Q;  1QVG A;  2AMC B;  4DR5 Q;  2CQO A;  4GKJ Q;  3PF4 A;  3PUZ A;  3S14 H;  4L5T A;  4KLK A;  2WB1 E;  4JI8 Q;  2I0Q A;  4YWK A;  1V9P A;  3NBH B;  4JI7 Q;  1HJP A;  2K5V A;  3CCJ A;  3S17 H;  4B3R L;  5C0X I;  2UXD L;  3IRB A;  1VQF A;  3CCM A;  1XPU A;  2LXK A;  3PO3 H;  3TS2 A;  1T9H A;  1U5K A;  4TQU S;  2ZM6 Q;  4GN3 B;  4GKK L;  3ER0 A;  4LFA Q;  1X3F A;  1SE8 A;  2JA6 G;  4DR4 Q;  4O2D A;  4R1J A;  4B3S L;  3CPF A;  1E22 A;  4XIG S;  1SRO A;  3G4S A;  3GDE A;  1NY4 A;  1H95 A;  1IBL Q;  4PZ7 A;  4C3J H;  3BZK A;  4X64 L;  4EX5 A;  1VQD A;  5IYB H;  2GN5 A;  1VQ6 A;  1JT8 A;  3ULJ A;  3SGI A;  4DV4 Q;  1XPR A;  1L2F A;  5GQO A;  2Z6K A;  2QGQ A;  3ERS X;  1C7Y A;  4DR6 Q;  1XMQ Q;  1C0A A;  5LMU L;  4DPG A;  3J81 i;  1PV4 A;  4DKA C;  1I50 H;  3CAM A;  3CME A;  1G6P A;  3BJU A;  3HOV H;  1EIY B;  2UUA Q;  3AYH B;  1XNR Q;  3CD6 A;  3HOW H;  2AHO B;  3G71 A;  1N36 Q;  3PSI A;  1Q12 A;  3M85 A;  2E2I H;  3TRZ A;  1HZA A;  4HJ9 A;  2NVY H;  3CCR A;  2JA7 G;  2N78 A;  4KHP Q;  1EIF A;  2UUB L;  2JEA I;  5AJ3 L;  4PG3 A;  4DV1 Q;  2IHE A;  4DV7 L;  1GM5 A;  2UUC L;  1PH2 A;  2R6G A;  3J80 i;  5C0X G;  2NVT H;  4HIM A;  1NBW A;  1UE1 A;  2VW9 A;  4LF8 L;  3K7A H;  4DV0 L;  1JB7 A;  1IZ6 A;  1SMX A;  1KRT A;  1AE2 A;  3F8T A;  4B3R Q;  5FLM H;  4JI6 L;  3S2H H;  2JA5 H;  3L0O A;  2B63 G;  1HH2 P;  3HFZ B;  3AQQ A;  4RG1 A;  3RLF A;  4Y52 H;  2WFW A;  2ALY B;  4GKK Q;  1AE3 A;  5C4J H;  1P8L A;  4HIO A;  1Y1V H;  5IT9 c;  4A3M H;  4LFB Q;  3I4N H;  3PUV A;  3AFQ A;  4DR1 Q;  1KD1 C;  1TWG H;  3WWV A;  1XJV A;  1E3P A;  1YEZ A;  2VY3 A;  4J15 A;  1QZG A;  3ULL A;  1LTL A;  4DUZ L;  3T1H L;  4OX9 Q;  1PFS A;  1O7I A;  1VS0 A;  3F1Z A;  4POG A;  2IY5 B;  4JI4 Q;  4JBM A;  3L7Z C;  3HKZ E;  5GAD C;  2KCM A;  4QL5 A;  4LF4 L;  4OWX B;  1HNX L;  3CCL A;  1PA6 A;  1L0W A;  4YY3 L;  3S16 H;  3K80 C;  4BBR G;  2FXQ A;  1PH1 A;  2JA8 G;  3EIV A;  2CFM A;  2MO0 A;  3JAM i;  4HJ5 A;  5JJL A;  5J3B A;  1GO3 E;  1IYJ B;  4IPC A;  4QIW E;  4HID A;  3AEV A;  2JE6 I;  1IL2 A;  2PQA B;  4PZ8 A;  3H3V I;  2AWN A;  1P16 A;  3VDY A;  3HOZ H;  3M4O H;  3K81 C;  4JV5 L;  4OO1 I;  2R7F A;  2E2H H;  4DV7 Q;  4A3E G;  1X54 A;  3I4M G;  3FHW A;  3H0G G;  4A3C G;  1N33 L;  2F3I A;  3GTP H;  1QUQ A;  1VCI A;  2AKW B;  1B70 B;  5IY0 A;  4DV3 L;  4AQY L;  1ASY A;  2IX1 A;  2PNH A;  3I7F A;  2HIV A;  4P74 A;  3RN2 A;  3S2D H;  1HNW L;  3BU2 A;  4BY1 G;  3OW2 A;  1YIJ A;  2JJQ A;  2ATW A;  1NJI C;  4WJ4 A;  2K14 A;  4AIM A;  5IYC G;  2I5L X;  4LF9 Q;  1MKH A;  2GVB A;  2DGY A;  4A4I A;  1B7Y B;  1PH8 A;  1A63 A;  2R93 G;  4JI5 Q;  5M5Y H;  3TRE A;  3T1H Q;  1C9O A;  1EOV A;  1Q1E A;  5HGQ A;  1E1O A;  1VQ4 A;  4OWW B;  5C4X G;  1YHA A;  3ICE A;  4GLX A;  1N34 Q;  2Q2T A;  1B8A A;  3GD7 A;  3J81 j;  4A3G H;  1K8A C;  1SFO H;  4HIK A;  1WOC A;  4A3D G;  3HOX H;  3UDG A;  4IFD G;  1NTG A;  1CSP A;  2KHJ A;  1KHI A;  3A5U A;  1HNX Q;  3NEL A;  5LMN Q;  2A8V A;  2NVQ H;  2HQL A;  2ASB A;  4DV5 L;  2D62 A;  3EN2 A;  3J7A 5;  4P72 A;  1VQ7 A;  5M5W H;  2YTV A;  4R4T A;  4X65 Q;  2R92 G;  2WP8 J;  4JC0 A;  1VQJ A;  1WI5 A;  2NN6 I;  1X3E A;  3EBE A;  4OXP A;  5C0X J;  4LF5 L;  2VUM H;  3GTG H;  4OO1 G;  4C2M H;  5BR8 L;  4NXN L;  4DUY L;  4IPG A;  1VQ5 A;  2NVX H;  1YJW A;  4GLA C;  1YHQ A;  4A3L G;  1Y1W G;  1KXL A;  1KRS A;  4JI2 L;  5M3F H;  5C3E G;  2BH2 A;  5IE8 A;  2ZJR A;  4GN5 A;  2CWP A;  4NPS A;  5ELO A;  1N33 Q;  4A76 A;  3RLO A;  3A74 A;  3CC4 A;  4DR3 Q;  4BA1 I;  4DV2 Q;  4DAY B;  4YWL A;  1UEB A;  1YBY A;  1WCM H;  3CCU A;  3S15 H;  4A75 A;  2Q2I A;  3TQY A;  1ASZ A;  4JI3 Q;  2VQE L;  4JOI C;  2BH8 A;  4RMF A;  1XNQ L;  1VQ9 A;  4ME3 A;  4LFC Q;  3PO3 G;  4HJ7 A;  4GNX B;  3OTO L;  3NEN A;  5GAE C;  2E5L Q;  4NB3 A;  3M9B A;  4O0A A;  2UXC Q;  1JE5 A;  1PYS B;  2N49 A;  4YHH L;  4X66 L;  1FJG L;  4X6A H;  1XPO A;  1IXR A;  4A93 G;  5IYD H;  3CCQ A;  4GN4 B;  1VQC A;  5IP7 G;  2UU9 L;  1XMO Q;  2VQF L;  1Q7Y C;  2NN6 G;  4DV6 Q;  4IPD A;  3T1Y L;  1VQA A;  5IYB G;  1OXV A;  4GOP C;  4BA2 I;  2PI2 A;  4A3B H;  1EQR A;  4JYA Q;  4DR7 L;  2XGT A;  1VQK A;  1RIP A;  4BBS G;  4A3I H;  2D0P A;  2ZJQ A;  4DR2 L;  5E7N A;  1U0L A;  1JJG A;  4B3M L;  2UUC Q;  4PZ6 A;  3D31 A;  4NXN Q;  3HOW G;  2Q2U A;  1K0R A;  3JC6 6;  2ZTE A;  3KF6 B;  4JI2 Q;  3UE1 A;  4AYB G;  4Y7N H;  3PF5 A;  2EIF A;  3M3Y H;  4JBW A;  2RCN A;  1J5E L;  3KDF B;  1EFW A;  4GOP A;  1NE3 A;  3Q8D A;  2UXD Q;  2E8G A;  1MJC A;  1BBW A;  1HZC A;  1PYB A;  3F2D A;  2YYZ A;  2Q2H A;  1X55 A;  4IJL A;  2I5H A;  4UP9 A;  3UE0 A;  1VQL A;  1IBK L;  2MFI A;  2WAQ G;  5JEA J;  1N32 L;  2R7Z G;  4P75 A;  1WYD A;  4B3S Q;  4LUZ A;  2VQE Q;  3M4Q A;  1K9M C;  5JJI A;  1TWF H;  1XNQ Q;  4K0K L;  4X64 Q;  1Z47 A;  1YHB A;  1TWC H;  4A3M G;  1Y1V G;  1UWV A;  3E9H A;  3AFP A;  1HNZ L;  3I4N G;  1HNW Q;  1GKH A;  2A19 A;  2N8N A;  1VQB A;  5GRO A;  1L1O B;  5LMU Q;  3RZD H;  1JJ2 A;  4TVA B;  1YI2 A;  4MNO A;  1EYG A;  1HR0 W;  2K75 A;  3PIP A;  4IFD I;  4A3K G;  1X9N A;  4LUV A;  2BA0 A;  3G48 A;  3RNU A;  4A3J G;  1I94 L;  3STB D;  3T1Y Q;  4BBR H;  1S72 A;  5M3M G;  1VQI A;  1CKN A;  2Y0S G;  2MQH A;  4DK6 C;  2C35 B;  4XTC S;  5C44 H;  2NZO A;  1D7Q A;  4MZ9 A;  2UUB Q;  1IBM L;  5AJ3 Q;  4YCW A; 
#chains in the Genus database with same CATH topology
 1VQE A;  3Q23 A;  2D9U A;  2ICE C;  1D8L A;  4O1N A;  3UDX A;  4CDE C;  4BY7 B;  3CXC A;  1AZP A;  2HT1 A;  4HJ8 A;  4R4Q A;  4DAY A;  2EY5 A;  4X3U A;  3CCE A;  4KI0 A;  4UDU C;  4KMU C;  4P73 A;  1WTW A;  3PUW A;  5D65 A;  4BY1 H;  2ZTC A;  1VQO A;  1AP0 A;  5I2X A;  2QA4 A;  4C56 C;  4ZUI A;  2LMC B;  2WB1 G;  1FVI A;  2K5D A;  5FLX L;  1QWY A;  2ZM6 L;  1DXM A;  1I6H B;  2KUM A;  4P71 A;  3ND9 A;  2KOL A;  5C4X H;  1JOO A;  2Z4H A;  3PO2 H;  4UPA A;  1EWI A;  5IGC A;  3KK7 A;  5JPN C;  4A3D H;  4NW2 A;  1DYQ A;  1XTD A;  2BOS A;  4IAL A;  4YCV A;  1A62 A;  2KEC A;  3GTM B;  2XIW A;  3GTL B;  1Y8O B;  4OO1 H;  1PZK D;  2O4X A;  3S1Q H;  3KJP A;  1U4R A;  3OMC A;  2EY6 A;  1VQ8 A;  1QIL A;  2YTX A;  5CYU A;  1PHJ A;  3K7U C;  2E2H H;  1HZ9 A;  2N3S A;  5CV4 A;  1HUM A;  2A6E C;  2H5X A;  5IWA Q;  3S17 B;  3SVM A;  3H94 A;  4FDB A;  1FL0 A;  4FF3 A;  4V19 0;  5CC4 A;  1HRJ A;  2FJ2 A;  1I5F A;  3UDI A;  4A93 B;  1NMG A;  5A2Q L;  2K5Q A;  4CJ1 B;  3MEH A;  1SLJ A;  2PYK A;  1M1K C;  1JE4 A;  1UEA B;  3R8B A;  5BR8 Q;  4C3H B;  4DUY Q;  1Q46 A;  4CKC A;  2JEB I;  2JA7 H;  4RWS C;  4DXG A;  4K2K A;  2XWJ B;  3AU7 A;  3OWF A;  1I4Q A;  1SNO A;  4C1N I;  4J8Q A;  1T5E A;  2XRQ D;  2HQE A;  4UP7 A;  3NQI A;  2B63 B;  2KHI A;  3CP0 A;  2ENB A;  2EVB A;  1EY9 A;  1TS4 A;  3OWE B;  2F0K A;  4IN3 A;  2RBM A;  3MVV A;  3I2Z A;  5FLM G;  4IFD J;  1LT3 D;  2CH4 W;  3F2U A;  3TEH B;  5CV5 A;  4X62 L;  2HCC A;  2M2L A;  4A3M B;  1STN A;  2F4V Q;  1PH9 A;  3LWE A;  1HTL D;  2EJG C;  2RF4 A;  4EQO A;  2JA8 B;  4JI1 Q;  5C5M A;  2I07 B;  3I56 A;  5TSS A;  1KAA A;  3C1F A;  4KY7 A;  4LF9 L;  1YNX A;  4A3J B;  1RDP D;  1JIC A;  4JI5 L;  1PXU A;  1N9W A;  2FIN B;  3OMG A;  4DR7 Q;  4A3K H;  3CU7 A;  4JBK A;  5KYL A;  1PFB A;  4XDX A;  1N34 L;  3S1N H;  1EWC A;  5LL6 S;  4DR2 Q;  1TY0 A;  2D0O A;  2IX0 A;  2VB3 X;  4AYB E;  1JB3 A;  3KYH C;  5M3M H;  1KC8 C;  2BA1 A;  3N52 A;  4L8J A;  1J5E Q;  3J7Z C;  2B29 A;  2QCP X;  1HA5 A;  1KAB A;  1CUK A;  4F8M A;  2Z0S A;  4FXG C;  1XX8 A;  3GTP B;  1E2V A;  1N32 Q;  2RSO A;  4MTN A;  5EPK A;  1KLG D;  5C4H A;  1KAW A;  1GUW A;  1EU4 A;  2RDH A;  3E9I A;  4U68 A;  4K5X A;  3H15 A;  1VQP A;  1PTO F;  2K50 A;  3AMU A;  2NZH A;  4IPH A;  1SNP A;  1TY2 A;  1STY A;  3S1M H;  4DXF A;  4R4I A;  3HOY H;  4A3G B;  1EZ6 A;  2KCT A;  5A35 A;  1DCZ A;  2NYZ D;  2F0O A;  3NPP A;  4NXM Q;  3GO5 A;  5C3E B;  4K6L A;  3PO2 G;  1R9T B;  4QF4 A;  4UHV A;  3QO2 A;  3GTL H;  4I7Z C;  4HJA A;  2B2V C;  3KDF A;  1DON A;  2K32 A;  4QJF A;  2VUM B;  2RHQ B;  1Y14 B;  2RKS A;  1S5C D;  4ZAI A;  4R4O A;  3S14 B;  1TS3 A;  2ICI A;  2F0V A;  5KGU A;  3DLL A;  1PH3 A;  1KQS A;  3CC2 A;  3OHX C;  1LT6 D;  3GQB A;  3I72 A;  4KKS A;  2WB1 E;  2HCI A;  1B53 A;  2B2V A;  2C5C A;  3NBH B;  4G4K A;  4MTK A;  3CCJ A;  5IGG A;  4JI7 Q;  3S17 H;  3PIO 3;  1VQF A;  3DM1 A;  1XPU A;  2JYO A;  3TS2 A;  4R9W A;  1A2U A;  1RJT A;  5CR3 A;  3J81 L;  2ZM6 Q;  1TVX A;  4IQZ A;  3CPF A;  1E22 A;  1ZYR C;  4OHJ A;  1NY4 A;  4PZ7 A;  1VQD A;  2F0H A;  2FMM A;  1B4O A;  1EIG A;  3J80 L;  4AYB B;  1PV4 A;  1RF2 D;  5F2D A;  3BJU A;  1G6P A;  2UUA Q;  3CD6 A;  3AYH B;  2NVY B;  3D4W A;  4A3I B;  1N36 Q;  1PYW D;  2E2I H;  3TRZ A;  1D6E C;  2EYH A;  2JA7 G;  1Q8I A;  1K28 A;  2N78 A;  5KYI A;  4DV7 L;  2IHE A;  3H3V C;  1EL0 A;  1LO5 D;  2NVT H;  3S2H B;  4HIM A;  2JA5 B;  4H13 C;  1UE1 A;  3K7A H;  4DV0 L;  1IZ6 A;  1SMX A;  2KQ3 A;  1KRT A;  4IUR A;  1Y1V B;  5FKA C;  3MZ5 A;  4B3R Q;  3E5S A;  3TP7 A;  3D6W A;  3RLF A;  3AQQ A;  4Y52 H;  5C4J H;  4A3M H;  1P8L A;  2PPB C;  5IT9 c;  1E0B A;  1A3V A;  3PUV A;  3I4N H;  3JAM L;  1AZQ A;  1PMR A;  3WWV A;  3J7A F;  1QZG A;  2R3Z A;  1TWC B;  1PFS A;  1O7I A;  3HGB A;  3S16 B;  4NP5 A;  4JBM A;  3L7Z C;  3RZD B;  2OXP A;  4LF4 L;  1HNX L;  1NCV A;  5ELF A;  4BBR G;  4KD4 A;  1PH1 A;  4CGY B;  2CFM A;  2XNA C;  3TP6 A;  1F2M A;  3FRP B;  5JJL A;  4IPC A;  3AEV A;  1K8M A;  3RD4 A;  2JE6 I;  4PZ8 A;  5I6W A;  2EXZ A;  2LKV A;  2DNE A;  3H3V I;  1GUN A;  3ONA B;  4JV5 L;  5IOC A;  1V1O A;  3FHW A;  4A3C G;  5L37 A;  3GTP H;  3NK9 A;  3I7F A;  2HIV A;  3RN2 A;  3A56 A;  1G2S A;  1RTN A;  1HNW L;  1WD1 A;  2JJQ A;  3TME A;  4WJW A;  4LF9 Q;  5EBD A;  2GVB A;  1B7Y B;  5DEH A;  4JI5 Q;  1VF7 A;  1E1O A;  3QOJ A;  1N34 Q;  4C3I B;  4A3G H;  2OF1 A;  1SFO H;  1WOC A;  2F0W A;  4QCL A;  2JXM B;  5LL6 X;  4H7B A;  4QUF A;  2KHJ A;  3A5U A;  2A8V A;  3MA2 B;  4DV5 L;  2HDM A;  4P72 A;  1A6X A;  5M5W H;  2YTV A;  2PCF B;  3G7L A;  3Q24 A;  4JC0 A;  1VQJ A;  1LAB A;  1I4P A;  5C0X J;  4LF5 L;  4OXP A;  2VUM H;  2PZU A;  4NXN L;  2KED A;  2DNC A;  2NVX H;  3SHL A;  3TP5 A;  4JI2 L;  5IE8 A;  3I3C A;  1WTP A;  5ELO A;  4A76 A;  5FOB B;  1NR2 A;  4RGT A;  2HD3 A;  4YWL A;  4DAV A;  1YBY A;  2A69 C;  2VQE L;  1GUO A;  1A3T A;  4ABN A;  3NUC A;  4DA2 A;  2K33 A;  3KBG A;  3T56 B;  5JPM C;  1JOK A;  2L9H A;  4ZK9 B;  3OTO L;  1NUC A;  3MXN A;  4NB3 A;  1YNN C;  3UI2 A;  3KBX A;  2HDL A;  1FJG L;  4KD3 A;  1D2B A;  3K6O A;  2OT2 A;  1LAC A;  4A93 G;  4GN4 B;  1WTR A;  2A68 C;  1G91 A;  1VQA A;  4BA2 I;  2XN9 C;  2PI2 A;  4UAI A;  2QDB A;  1VQK A;  5CV8 A;  3IL8 A;  4A3I H;  3MHB A;  2ZJQ A;  4C3H G;  4B3M L;  4PZ6 A;  4IUV A;  1K0R A;  1SYD A;  1JCK B;  3JC6 6;  1HUN A;  2KA7 A;  2Z4I A;  4N9T A;  5IT9 E;  1NE3 A;  1BBW A;  1X55 A;  3DEP A;  3UE0 A;  3FEW X;  1VQL A;  1IBK L;  2WAQ G;  3RUZ A;  2F0G A;  3P75 A;  1BNZ A;  3BVG A;  4H0L C;  1KLU D;  1IYU A;  1XNQ Q;  4K0K L;  1F9S A;  4FF2 A;  4M1U B;  5J1Z A;  4TSS A;  1TWC H;  2TMP A;  4A3M G;  1DOM A;  3I4N G;  1GKH A;  2KJX A;  2N8N A;  1JOQ A;  5GRO A;  3RZD H;  5FO9 B;  4TVA B;  5I9O A;  4MNO A;  1EYG A;  2EE1 A;  3K57 A;  5NUC A;  3MAQ A;  4LUV A;  3RNU A;  4A3J G;  5E3F A;  1S72 A;  1VQI A;  2DN8 A;  4XTC S;  5C44 H;  2F03 A;  2DY7 A;  1ICF B;  4K2L A;  4QUC A;  2EZV A;  1MIU A;  3MFG A;  2XTI A;  3H09 A;  5IP9 H;  2F0N A;  3S1R B;  2EYF A;  4DV0 Q;  4A3E H;  1LTI D;  4RAU C;  4BY1 B;  2EYL A;  1EUJ A;  2VNU D;  2NTS A;  2AQ1 B;  5IWA L;  3F2C A;  3VA5 A;  2QEX A;  5DLQ E;  1M4V A;  5J22 A;  4I65 A;  4G7H C;  4A3F H;  3PMF A;  4GLV B;  1RCV D;  2E76 C;  5C4X B;  1TWH H;  1NR4 A;  2K52 A;  2QKI C;  3OYY A;  1SR3 A;  3LGJ A;  1CA6 A;  3T53 B;  1BO0 A;  4LF4 Q;  4A3D B;  4C3I H;  2K5N A;  3D3R A;  3PGZ A;  3S24 A;  5BN3 A;  1PH4 A;  4ZYS A;  4CBV A;  2MJ8 A;  1IBL L;  3E6Z X;  4LK1 C;  1PH6 A;  4KHZ A;  4A3G G;  2F0F A;  1C48 A;  3CMA A;  3S1Q B;  2Z8L A;  1UE6 A;  1XMQ L;  4F7X A;  4JV5 Q;  1RTO A;  3M4Y A;  2E2H B;  3Q22 A;  1Y1W H;  3C3L A;  1WJJ A;  1SYF A;  3VYR A;  2VUM G;  2JA9 A;  3ITP A;  5CBA E;  4DNI A;  1CQF A;  1HNW Q;  4ALP A;  4IJH A;  1YIT A;  1MJE A;  4CDF C;  1PH7 A;  1LV9 A;  2N88 A;  3FDT A;  3GV6 A;  4LNQ A;  1Y8P B;  5KIX A;  1OXX K;  1HHV A;  1QUQ B;  4K8J A;  3ULP A;  2F4V L;  2Z1C A;  4JI1 L;  4QMG A;  4JOI A;  2BE5 C;  4LFB L;  1JOR A;  1D5X C;  2C9O A;  3I8Z A;  4DV5 Q;  2OEO A;  1SNQ A;  5EBC A;  2JA7 B;  5IP7 H;  2PQA A;  4JI4 L;  4LF5 Q;  4HMI A;  5EKL A;  3FPU B;  3KUP A;  1M8A A;  2LS0 1;  3HOW B;  2HIX A;  4OON A;  5I9P A;  1V1P B;  2K5H A;  1CTM A;  2B2T C;  3T51 B;  1ZEQ X;  3NWT A;  3GTJ H;  4A3I G;  1QVF A;  1GHK A;  3F2B A;  2I5M X;  5ELD A;  2G9H D;  3NEM A;  4XT3 B;  1S40 A;  1B9M A;  2KEN A;  5M5X H;  1VQN A;  2A1A A;  3BDL A;  2CW0 D;  2O2L D;  2JA5 G;  1VQG A;  2B2T A;  3OTO Q;  3PIP 3;  1FYC A;  1SRU A;  2DJG C;  2WII B;  2B2Y C;  2RDG A;  5ELN A;  1N8R C;  1OXS C;  1FJG Q;  1EYC A;  5G3L D;  4B3T Q;  3A5Z B;  4A3K B;  1V43 A;  3MXU A;  3VYS A;  2RCF A;  3OW7 A;  2OQ0 A;  2R61 A;  5M3M B;  2Y0S B;  2R7D A;  4L5Q A;  4DAM A;  2KEE A;  4NXM L;  2KCC A;  4WJ3 M;  3QB3 A;  5IIF A;  2B2Y A;  3V05 A;  4B3M Q;  2IL8 A;  2OTJ A;  1JR0 D;  1Y8N B;  3R2T A;  4ILW A;  2E2J H;  2B3G A;  4GNX C;  3DM3 A;  3Q6S A;  3HG9 A;  5C44 G;  4H02 A;  5GAH C;  2WAQ E;  4GS3 A;  3S1R H;  4KJO A;  3K5L A;  2KBN A;  5HY6 A;  3FVQ A;  3CW2 C;  1IBK Q;  5IP9 G;  3PQI A;  4ULL A;  4HN7 A;  1QNK A;  2V1C C;  1A2T A;  2ZTD A;  2LXJ A;  3ND8 A;  1QOH A;  4GNX A;  4JI7 L;  1EY8 A;  2JQO A;  3RR5 A;  4K0K Q;  1II3 A;  3HKS A;  4KY6 A;  5FLX c;  1E2W A;  3R3O A;  1OTC A;  1EEF D;  3P1H A;  3S1M B;  3HOY B;  3DWQ A;  1JMC A;  3MTS A;  4A3F G;  2QW7 A;  3URY A;  4B9X A;  1K8O A;  4LFC L;  1BF4 A;  3TS0 A;  5KRU A;  4LJZ C;  4IOC A;  1OXT A;  3HOX B;  3X3M A;  4LF6 Q;  2UXC L;  1LTT D;  4C3I G;  4OL7 A;  3W2D A;  3P7J A;  1X65 A;  3I4O A;  3NWS A;  2AUK A;  3KF6 A;  5H1S E;  2UUA L;  1FD7 D;  1D5M C;  1U9R A;  3NTI A;  4DV6 L;  1N36 L;  1VQH A;  3ERO A;  1X3G A;  1TS2 A;  1G51 A;  4OIJ A;  4QY7 A;  4JG2 A;  2DUD A;  3IKJ A;  1Q8K A;  4ZCK A;  5ELB A;  1BBX C;  2AWO A;  1PTO H;  2AMC B;  4FF4 A;  2CQO A;  3PF4 A;  4KLK A;  4YWK A;  2O5J C;  3DEO A;  2K5V A;  1WCM B;  2VB2 X;  4B3R L;  2UXD L;  3IRB A;  4R8I A;  3OSO A;  3CCM A;  2WAC A;  2E2D C;  1T9H A;  3WOF A;  2F0L A;  1SE8 A;  2L11 A;  1SJE D;  2F4I A;  1SRO A;  1L0X B;  3A8K E;  3GDE A;  1H95 A;  1IBL Q;  1PRT F;  5BN5 A;  4KKT A;  1WTX A;  4C3J H;  4X64 L;  4F88 A;  1JT8 A;  5IYB H;  3ULJ A;  1XPR A;  3OIP A;  3ERS X;  2D2C C;  1XMQ Q;  2K6A A;  4EVO A;  4DPG A;  2MGS A;  2E2I B;  3HOV H;  1I4H A;  3MWY W;  3HOW H;  2AHO B;  3G71 A;  1HCZ A;  3SK8 A;  3A54 A;  3M85 A;  1W6K A;  1HZA A;  1HQR D;  4HJ9 A;  2NVT B;  2WAQ B;  1G2T A;  2UUB L;  3J7A V;  4OEM B;  3K7A B;  1GM5 A;  4PV1 C;  1UNS A;  5C0X G;  1A15 A;  5E4X A;  1I4R A;  5C4J B;  2PNR C;  1AE2 A;  5C4Z A;  3I4N B;  3F8T A;  1STG A;  4RG1 A;  1ET6 A;  1AE3 A;  4GKK Q;  4HIO A;  4LFB Q;  3AFQ A;  1STA A;  2A6E D;  5D14 A;  1XJV A;  1E3P A;  1F2Z A;  2D5D A;  4J15 A;  5K36 H;  3P20 A;  2P5Z X;  2IY5 B;  4JI4 Q;  2FFK B;  5I4D A;  2KCM A;  3OOC A;  1DJR D;  4OWX B;  1L0W A;  3K80 C;  3EIV A;  2RVL A;  2HUG A;  1GO3 E;  1IYJ B;  2RA4 A;  1IL2 A;  2AWN A;  1F9R A;  4OGQ C;  3KLS A;  3K81 C;  3SK4 A;  5IGF A;  2R7F A;  1X54 A;  3NHH A;  5FLX E;  4AQY L;  2AKW B;  1B70 B;  1ASY A;  1MSH A;  2K28 A;  3S2D H;  3BU2 A;  4BY1 G;  3OW2 A;  1NJI C;  4TRD A;  2DGY A;  1PH8 A;  4M8A A;  1SFO B;  3TRE A;  3T1H Q;  1VQ4 A;  5C4X G;  4DF7 A;  3GD7 A;  1K8A C;  5M5W B;  1GJX A;  4A3D G;  5LHY 1;  3HOX H;  4XQQ A;  2A6H C;  3NEL A;  1KDC A;  3A8J E;  2IWH A;  4ZUJ A;  3EN2 A;  1EEI D;  2NVX B;  4PQX A;  4R4T A;  4IUP A;  2NN6 I;  3D4R A;  1RD9 D;  1X3E A;  4RKL A;  4OO1 G;  3TSS A;  3GTG H;  3M7G A;  4C2M H;  5C5L A;  1AW7 A;  1YHQ A;  1B3Q A;  1CM9 A;  2EOT A;  1KRS A;  5M3F H;  2B2U C;  4RGN A;  4NPS A;  1K83 B;  3A74 A;  1LTS D;  5E1F A;  3CC4 A;  4ID6 A;  1JWU D;  1WCM H;  4TKO B;  3S15 H;  4A75 A;  2Q2I A;  1IKL A;  3TQY A;  2BH8 A;  1GXD C;  2B2U A;  3SE0 A;  1XNQ L;  4LFC Q;  1B44 D;  3VR3 A;  3KF8 A;  3M9B A;  4O0A A;  2UXC Q;  2F0T A;  1PYS B;  1FNV A;  2N49 A;  1CHP D;  4YHH L;  4X66 L;  5EPJ A;  1SYB A;  1IXR A;  5IYD H;  1SNM A;  1B3A A;  2VQF L;  4DV6 Q;  1ML0 D;  1LTA D;  5IYB G;  4GOP C;  1O78 A;  2CHB D;  2RQX A;  1RIP A;  1B2T A;  2D0P A;  1TT2 A;  5E7N A;  4P2C B;  2K01 A;  3BZD B;  3HOW G;  2LFN A;  3L9A X;  1D1I A;  3VR2 A;  4B08 A;  1YNJ C;  3PF5 A;  4Y7N H;  2EIF A;  3M3Y H;  5I6Y A;  2EYP A;  3KDF B;  3EVQ A;  4GOP A;  3Q8D A;  4KTA A;  2UXD Q;  4WOR A;  1BCP F;  1PYB A;  4FP5 D;  2YYZ A;  1Z6H A;  2Q2H A;  4FO2 A;  1S5D D;  1EIH A;  2PZW A;  3WOE A;  1EU3 A;  2F0P A;  3CRK C;  5JJI A;  3SXH A;  5IGE A;  4X64 Q;  1SE2 A;  1YHB A;  1XYI A;  2QF7 A;  1QG7 A;  3AFP A;  4Q0F A;  1IKM A;  1WD0 A;  5DNF A;  4LAA A;  4OIK A;  1L1O B;  5IT9 L;  5C3X A;  1SYE A;  4A3K G;  2BA0 A;  5C44 B;  1ZYR D;  3STB D;  4JK1 C;  5M3M G;  4C1N K;  2Y0S G;  1CKN A;  4DK6 C;  2C35 B;  2NZO A;  2DJF C;  1D7Q A;  2UUB Q;  1IBM L;  4YCW A;  4AH6 A;  4QGU A;  4A3E B;  1PVO A;  3H0G B;  3GV3 A;  2Q8R E;  1FNU A;  2V4D A;  3I73 A;  2TSS A;  3FP9 A;  1BUV T;  3K59 A;  1NSN S;  3HRZ C;  3GTK H;  2KHS A;  4A3F B;  1HZB A;  1TWH B;  4X3T A;  5EJW A;  2J0T D;  4HMJ A;  2F0Q A;  5IYC H;  3BYY B;  2SNM A;  5AFW A;  2XRS D;  4Q5V A;  2R93 H;  4HED A;  5FJ8 H;  1S5B D;  4LFA L;  3HOU B;  1PRT C;  3HOY G;  1IW7 D;  1ENA A;  2GVA A;  5D3D A;  2F52 A;  3CCV A;  3HZX A;  1GUS A;  1Q1B A;  2R92 B;  3VR6 A;  2EJF C;  4X3S A;  3HOX G;  3RZO H;  1FNW A;  1Y1W B;  4DR6 L;  2PW7 A;  5JVH 3;  2MP1 A;  2VS1 A;  3RLN A;  4XT1 B;  5CBE E;  1XNR L;  3CQZ H;  4POF A;  4AQY Q;  5CV6 A;  1EQT A;  1STE A;  2LSS A;  2QDL A;  1Z9F A;  5T1G A;  4KK7 A;  2IT1 A;  2G9D A;  1K83 H;  5M3F G;  4KHP L;  1AH9 A;  1SMY D;  4HSV A;  3TZU A;  2F3V A;  3CF5 A;  3FMC A;  2KCN A;  2JA6 H;  3PO3 B;  4LMQ D;  3GTQ H;  1RL2 A;  1KIX A;  2IHF A;  2J4X A;  1WCM G;  4PNY A;  2MHV A;  3SEB A;  3MEF A;  5DM7 3;  1UE7 A;  1STB A;  1VDZ A;  4HAE A;  1M90 C;  1AFP A;  1EOT A;  2K7V A;  3UDF A;  4B3T L;  1LM0 A;  2Z6K C;  3GTO H;  4DR1 L;  1A0I A;  3U4V A;  2EYO A;  1BKB A;  3U4Z A;  3PIO A;  3CRL C;  4HCE A;  4OX9 L;  5EGT A;  1U4M A;  2HHH Q;  2NN6 H;  3PUX A;  4KN7 C;  2JN4 A;  5IYD G;  1HFN A;  4IOA A;  3GTJ B;  3HKZ G;  3Q0A A;  4BBS H;  1ENF A;  3L2P A;  1QZH A;  1CHQ D;  4IO9 A;  2YU9 H;  1H9M A;  1KDB A;  3B6Y A;  4HTH A;  5EAY A;  4LW1 A;  1LUZ A;  4EQP A;  5M5X B;  1E1T A;  3E0E A;  1EY4 A;  4JI0 Q;  1WTQ A;  3ZYY X;  1SDF A;  1PFN A;  1K3R A;  4LWC A;  2R7Z H;  3KOJ A;  5JOB A;  1E7Z A;  1DZ1 A;  4RHS A;  4YHH Q;  4X66 Q;  3BDC A;  1ZKO A;  1Q3L A;  1BQQ T;  2A69 D;  1MHW C;  3VR4 A;  2YV5 A;  2VQF Q;  4RKB A;  1G29 1;  4ZKB B;  4UY8 C;  3BZC A;  1O80 A;  3BVM A;  2F0D A;  2QIL A;  2CKZ B;  2OCE A;  4XQJ A;  4LF6 L;  1H9S A;  2E2J B;  4LUO A;  5KEE A;  3MXN B;  1FGU A;  1YNN D;  2SDF A;  3I55 A;  4DNR B;  3EJI A;  3CC7 A;  5LMN L;  4EGV A;  2MNA A;  4J6H A;  1G8Z D;  4KJN A;  4R4C A;  2BCO A;  2A68 D;  2L55 A;  3I4M H;  3H0G H;  1QJO A;  3HOZ B;  4FXD A;  1YJN A;  2Z9H A;  2L5T A;  3NBI A;  4CKB A;  2ZT9 C;  2FMC A;  5IOD A;  1DGS A;  4ZRZ A;  4EQ5 A;  1XTC D;  1CKM A;  5HUR A;  2ES2 A;  5E4W C;  3DWA A;  3K5M A;  1JQY D;  3LNN A;  1X3Q A;  1V1Q A;  4K14 A;  2N55 A;  4JI3 L;  5ELC A;  3HOU H;  2Y0S E;  1PTO D;  2O5I C;  1NMF A;  2ZXP A;  5FJ8 G;  3CCS A;  3RMH A;  3H3V H;  2K03 A;  1B9N A;  2R92 H;  3A8I E;  4L5S A;  1IBM Q;  2M00 A;  1JJC B;  1HR0 Q;  5M9O A;  2JK8 A;  1V1P A;  1XMO L;  4KY5 A;  4A3L H;  2L15 A;  4RA8 A;  1F9Q A;  2CVR A;  1MBY A;  3MFY A;  1CKO A;  1YZ6 A;  1PTO B;  1U4L A;  1K0S A;  3G6J B;  4YWM A;  1UE5 A;  5JJZ A;  1C4Q A;  1VQM A;  2IJ0 A;  1J9O A;  4IUQ A;  4I7A A;  1QVG A;  3QR8 A;  4GKJ Q;  1AN8 A;  1GUG A;  1BCP C;  2I0Q A;  1V9P A;  5FO7 B;  1ROD A;  2K05 A;  2LXK A;  3PO3 H;  4NMZ A;  1D5Z C;  4DN4 M;  2MPM A;  1U5K A;  4TQU S;  4GKK L;  3E3X A;  3ER0 A;  4LFA Q;  1X3F A;  4C3J B;  1TQO A;  2JA6 G;  4B3S L;  4R1J A;  4XIG S;  2L1B A;  1DD2 A;  3O13 A;  3MC0 B;  2NBF A;  3BZK A;  2K5W A;  4EX5 A;  3HOV B;  2F1M A;  1C7Y A;  4O42 A;  4DR6 Q;  1VMP A;  2QEJ C;  4F87 A;  3J81 i;  1I50 H;  3CAM A;  3LWU A;  5C3W A;  4G7Z C;  4A3B B;  1EIY B;  1XNR Q;  1TII D;  2XSC A;  1UUP A;  1Q12 A;  1B50 A;  1SE4 A;  4KHP Q;  1EIF A;  2JEA I;  5AJ3 L;  4DV1 Q;  2UUC L;  2PZT A;  4XQN A;  3TZD A;  1PH2 A;  1S5F D;  3J80 i;  2J7Z A;  1NBW A;  4LF8 L;  2F0I A;  5DM6 3;  5FLM H;  4JI6 L;  1LLR D;  3L0O A;  3NSW A;  2WFW A;  2ALY B;  4ODG A;  4N9P A;  2I46 A;  4DR1 Q;  2SOB A;  4OX9 Q;  2L0C A;  4DUZ L;  3T1H L;  1FGB D;  1VS0 A;  3F1Z A;  4POG A;  1WTV A;  3HKZ E;  2Q8T A;  4QL5 A;  4RCN A;  3CCL A;  4YY3 L;  1LT5 D;  1FR3 A;  2AUJ D;  5EPL A;  3JAM i;  1F9P A;  1CA5 A;  2PQA B;  2RSN A;  1SYG A;  3HOZ H;  1JWS D;  2NUC A;  1CZW A;  4A3E G;  3I4M G;  3H0G G;  3S2D B;  1HXY D;  1S5E D;  2F3I A;  1R4Q B;  4DV3 L;  2PNH A;  1Y69 U;  4MN3 A;  3OPO A;  2ATW A;  2EY1 A;  3DMU A;  1KNE A;  3IFT A;  4CDC C;  5I2Y A;  5M5Y H;  5COY A;  3BG3 A;  2CQA A;  2Q2T A;  1DOL A;  3HOU G;  1KHI A;  3GP7 A;  5LMN Q;  4K6D A;  4BS9 A;  2NVQ H;  2D62 A;  3GTG B;  2IPK D;  3J7A 5;  4C2M B;  2NTT A;  4PMC A;  3NP8 A;  3FKI B;  2R92 G;  5M3F B;  4DGZ A;  3WDN A;  4IPG A;  1VQ5 A;  1YJW A;  3V2T A;  4A3L G;  1Y1W G;  1KXL A;  3OIQ A;  1SAP A;  2BH2 A;  4GN5 A;  3BYT B;  2CWP A;  3KLS X;  2IX3 A;  1N33 Q;  3S15 B;  3QOL A;  1WVL A;  1I3Q B;  4DAY B;  2X6G A;  3CCU A;  1LTG D;  4JI3 Q;  3MXP A;  3A7L A;  1EY0 A;  1H9K A;  4RMF A;  1VQ9 A;  2ZXO A;  3PO3 G;  4HJ7 A;  4GNX B;  3EA6 A;  3NEN A;  5KND A;  1ICW A;  3HEJ A;  3HKZ B;  3I91 A;  5J39 A;  1L0Y B;  4X6A H;  3BS1 A;  1TWA B;  4GZY C;  5IP7 G;  2UU9 L;  1B1Z A;  2PQE A;  1XMO Q;  4IPD A;  2BDO A;  1OXV A;  2GA4 B;  4A3B H;  2XGT A;  4MHE A;  3U9S A;  3NTK A;  4Y7N B;  3M3Y B;  1U0L A;  5FK9 C;  3D31 A;  2ZTE A;  2M9V A;  3KF6 B;  3UE1 A;  3K5N A;  2RCN A;  3I4L A;  1PZI D;  4IUN A;  2MUY A;  2RDF A;  4G7O C;  4K5V A;  3F2D A;  4ZQ3 A;  2I5H A;  4UP9 A;  5BN4 A;  2MFI A;  4P75 A;  1WYD A;  4B3S Q;  3SK5 A;  4LUZ A;  3M4Q A;  4DAP A;  1TWF H;  1HQM C;  3A7A B;  5EKI A;  3DWP A;  1UWV A;  2SNS A;  2A19 A;  4KV6 A;  1G6Z A;  1HR0 W;  2K75 A;  3PIP A;  4IFD I;  4IUT A;  3G48 A;  1I94 L;  2JP1 A;  3T1Y Q;  4BBR H;  4N8X 1;  1BDO A;  1CFM A;  5CV7 A;  5AJ3 Q;  2F0J A;  1W3S A;  2UUC Q;  1GD7 A;  4LF7 L;  1LYL A;  1QE6 A;  3NBH A;  3PCO B;  4KHV A;  4DNT B;  4LF8 Q;  1SSO A;  4K8I A;  3GTK B;  4A3C H;  3W5O A;  3HOZ G;  4L63 B;  4JI6 Q;  3NE5 B;  3C46 A;  2UXB L;  1EQV A;  4BY7 H;  5KNC A;  2WKD A;  3D0F A;  4E6I A;  5CV9 A;  3R93 A;  4DR5 L;  2VZA A;  3D4D A;  3KFU A;  4JI8 L;  2R93 B;  2NWG A;  3SK6 A;  4DUZ Q;  4HR7 B;  1K8G A;  1YJ9 A;  4DK1 A;  3T16 A;  1LTB D;  3TDQ A;  3A55 A;  1QVC A;  1KDA A;  4X3K A;  1Q81 C;  3W1G A;  2A73 B;  5JEA H;  2OQK A;  4YY3 Q;  1HNZ Q;  1SEB D;  4DR4 L;  1PLF A;  2CWA A;  3RZO B;  1I6H H;  2HHH L;  4DK3 C;  4FXK C;  4DK0 A;  1ONL A;  3PV0 A;  4DV4 L;  1BR9 A;  1SND A;  1TXY A;  3CQZ B;  1W2B A;  4BXX H;  3FKI H;  3VR5 A;  3KLW A;  2XVS A;  1QNU A;  4RH6 A;  4UP8 A;  5IGB A;  1J6Q A;  3GTM H;  5EQ0 A;  1SBB B;  4DV3 Q;  4OWT B;  1EY5 A;  5A2Q E;  4CJ2 C;  1SN8 A;  3M7N A;  3J81 c;  1E24 A;  2JA6 B;  1K73 C;  2PMZ E;  1BVS A;  3W3A A;  3GTQ B;  1L1O C;  4RGM A;  1I3Q H;  4JI0 L;  1Q86 C;  1RKN A;  4JW0 A;  3E0J A;  1A8V A;  1LTR D;  1S3O A;  3GTO B;  2EDG A;  2EXD A;  2B8F A;  2AQ3 B;  3J80 c;  5JVG 3;  3X3N A;  2Z6B A;  1L1O A;  3MXG A;  4C3J G;  5GAG C;  1I4X A;  4QQB X;  1TWA H;  3W1B A;  4A93 H;  3STB C;  2F3W A;  1IL8 A;  3PUY A;  4BBS B;  3TBI B;  3HOV G;  2CCZ A;  2YU9 B;  1OXU A;  3RN5 A;  1CSQ A;  1X6O A;  1BXT A;  3D6C A;  4APV A;  4YCU A;  2A6H D;  4A3B G;  4C3H H;  3K8A A;  3G6E A;  3QIA A;  1GVP A;  2ZXR A;  4JPB W;  3TN2 A;  3VYT A;  3EFX D;  2R7Z B;  3K0X A;  2B63 H;  3JAM c;  2Q8I B;  2K4K A;  4CKE A;  5G3L F;  1TR5 A;  3CPW A;  5CMD A;  1YVC A;  1CZG A;  5K5P A;  4DU9 A;  1KL9 A;  1ILP A;  1TWG B;  3U58 A;  1EWH A;  1MGS A;  5K36 G;  1IW7 C;  2UU9 Q;  5LMN W;  1WTH A;  1QB5 D;  2JA8 H;  1PH5 A;  1K3B C;  3KF8 B;  3VYU A;  4DFA A;  1WFQ A;  3HP3 A;  4A3J H;  1I6V C;  2YTY A;  1HR0 L;  1EQQ A;  3I4M B;  2RHS B;  1KNA A;  2EQS A;  1BBU A;  1ENC A;  4CDD C;  3QG1 A;  2F0E A;  1SNC A;  4L5R C;  4X65 L;  4WFN 3;  5C6A A;  3M4O B;  3ERQ A;  1MD2 D;  4H44 C;  3A0J A;  5T1I A;  1SMY C;  2PMZ B;  4GKJ L;  2VL6 A;  2K1B A;  4JBJ A;  1AEX A;  1PZJ D;  2MO1 A;  1YNJ D;  2H1E A;  2OTL A;  2WB1 B;  3KJO A;  1EYD A;  4BY7 G;  4DR3 L;  4GOP B;  2ID0 A;  4DV2 L;  4X62 Q;  2G5D A;  4FNF A;  3M4P A;  2L4N A;  3C1E A;  1D1K A;  3U9O A;  3ZJY C;  5JJK A;  4S3S A;  4IFD H;  2SEB D;  1I94 Q;  4PMW A;  3TP8 A;  3DHQ A;  4IUU A;  4RGO S;  2E5L L;  1O7Y A;  1HTP A;  3U50 C;  5JEA G;  1JC7 A;  1GHJ A;  2ZJP A;  4FVM A;  4RCO A;  1Q82 C;  4LF7 Q;  4MIU A;  3J81 E;  2IW3 A;  2PI2 E;  5C3E H;  2L12 A;  4FYD A;  4HSP A;  2OWO A;  4JYA L;  1WTO A;  1R9T H;  4BXX G;  3FKI G;  1STH A;  1EZ8 A;  4JCV E;  4CJ0 B;  1X56 A;  4DV1 L;  1CKN B;  2UXB Q;  5KNB A;  3C2P A;  4RHR A;  4DR5 Q;  1HPC A;  3PUZ A;  3S14 H;  4L5T A;  1XWE A;  1CT1 D;  4JI8 Q;  3FPP A;  2EY2 A;  3J80 E;  1KTK A;  1X32 A;  1MSG A;  1HJP A;  1Q90 A;  3K0Y A;  5C0X I;  1H9R A;  1TU2 B;  3QWN A;  3IAY A;  4GN3 B;  2F0S A;  4QB4 A;  2WKC A;  1T5X D;  4DR4 Q;  4O2D A;  2B2W C;  4XXE A;  5EKK A;  1EY6 A;  2NB0 A;  3G4S A;  1TS5 A;  5JAV A;  1JWM D;  4PMB A;  4RFB A;  1I50 B;  3EQL C;  1VQ6 A;  2GN5 A;  3BVZ A;  3SGI A;  4ZKC B;  4DV4 Q;  1NNX A;  5COR A;  1L2F A;  2VXW A;  2Z6K A;  2QGQ A;  5GQO A;  1C0A A;  5CGK A;  5LMU L;  4DKA C;  3CME A;  4U67 3;  2EYM A;  1PRT D;  2B2W A;  2K04 A;  3PSI A;  3JAM E;  1X3P A;  2F0U A;  3NXW A;  2NVY H;  3CCR A;  3D8G A;  4PG3 A;  5HGT A;  2R6G A;  1IYV A;  1PRT B;  4YIJ A;  2VW9 A;  1IHZ A;  1JB7 A;  1DM0 B;  3S2H H;  2JA5 H;  5DAU A;  2B63 G;  1HH2 P;  3HFZ B;  1O7Z A;  1HFG A;  1Y1V H;  1KD1 C;  1TWG H;  1GOZ A;  1YEZ A;  1F77 A;  2VY3 A;  1PTO C;  1CK1 A;  1LTL A;  3ULL A;  2EJM A;  4Z9C B;  5GAD C;  2X6L A;  1O7L A;  3CKI B;  4KN4 C;  3K58 A;  1C8C A;  1PA6 A;  2H4O A;  3S16 H;  1CI3 M;  1XXG A;  2FXQ A;  3T13 A;  2JA8 G;  1DOK A;  1F2Y A;  4NKL A;  2MO0 A;  2E75 C;  4HJ5 A;  5J3B A;  1MI2 A;  4HID A;  4QIW E;  2CH4 A;  1P16 A;  3VDY A;  3M4O H;  2A74 C;  2JSO A;  4OO1 I;  3H6M A;  3N6R A;  4DV7 Q;  4L6T B;  3BDO A;  1N33 L;  1QUQ A;  1PFM A;  1VCI A;  5IY0 A;  2IX1 A;  1EFI D;  3AB9 A;  4R8N A;  4N8F A;  1LT4 D;  4P74 A;  1ESR A;  5ISR A;  4V0B A;  2PW5 A;  1YIJ A;  2FHT A;  4CHT B;  4WJ4 A;  2K14 A;  5M5Y B;  4AIM A;  2B8G A;  1I4G A;  2I5L X;  5IYC G;  1J8I A;  1SE3 A;  1MKH A;  2LY7 A;  4XYO A;  4A4I A;  1A63 A;  2R93 G;  3L3O C;  1C9O A;  1EOV A;  1Q1E A;  5HGQ A;  4OWW B;  2AQ2 B;  1YHA A;  4XYQ A;  3ICE A;  4GLX A;  4ZLT F;  2NVQ B;  1B8A A;  3J81 j;  4JVZ A;  3PO2 B;  4HIK A;  3SDZ A;  3I70 A;  3UDG A;  4IFD G;  1NTG A;  1CSP A;  1EYA A;  1ZXT A;  1HNX Q;  3H91 A;  3V96 A;  2HQL A;  2ASB A;  1VQ7 A;  4X65 Q;  2WP8 J;  2XWB B;  3EBE A;  1WI5 A;  1V8Q A;  1H9S B;  1ESF A;  3HS0 C;  5BR8 L;  1EY7 A;  4DUY L;  1CQV A;  4J1M A;  4GLA C;  2A5H A;  1R4P B;  4G57 A;  1UAP A;  2CW0 C;  5C3E G;  2EPB A;  2ZJR A;  3J7Y W;  2NZ1 D;  3RLO A;  1H9J A;  4DR3 Q;  4BA1 I;  1W6J A;  5D3I B;  4DV2 Q;  4KKU A;  1UEB A;  1Z7T A;  1ASZ A;  2F0M A;  4JOI C;  4WRD A;  1NAP A;  4ME3 A;  1SJH D;  3NTH A;  5GAE C;  2E5L Q;  5ELE A;  1JE5 A;  1XPO A;  1TKW B;  3R2I A;  3CCQ A;  3NQT A;  1VQC A;  3KLR A;  1Q7Y C;  2NN6 G;  3T1Y L;  1SYC A;  1S4Z A;  5IGD A;  3T4A C;  1EQR A;  4JYA Q;  3QJY A;  4DR7 L;  4QIW B;  1SXT A;  4HCS A;  4BBS G;  1A3U A;  4DR2 L;  4OEL B;  3IFD A;  3S9W A;  1BOS A;  1JJG A;  2EYJ A;  4NXN Q;  3DXJ C;  2Q2U A;  3DUZ A;  4B9W A;  3SR1 A;  4JI2 Q;  4AYB G;  4JBW A;  1J5E L;  1EFW A;  1PDQ A;  5FO8 B;  2E8G A;  1MJC A;  5C0X H;  2X69 A;  1HA6 A;  1HZC A;  1VMC A;  1VF5 C;  3K5O A;  2B39 A;  4IJL A;  1QCB D;  1TWF B;  5JEA J;  1N32 L;  2R7Z G;  2VQE Q;  1E2Z A;  4ME5 A;  3VA7 A;  2DY8 A;  1K9M C;  1OO9 B;  1BCP D;  3I90 A;  1Z47 A;  4EQN A;  1Y1V G;  1ILQ A;  3E9H A;  1HNZ L;  1VQB A;  2PO4 A;  2BDN A;  2BE5 D;  3CHB D;  4BBR B;  5LMU Q;  1YI2 A;  1JJ2 A;  1U4P A;  1GUT A;  1X9N A;  2WV6 D;  3LX0 A;  3S1N B;  1ET9 A;  1BCP B;  4FF1 A;  4BWG B;  2WIN B;  1RHP A;  2MQH A;  2E74 C;  4NDX A;  4IZ8 A;  4MZ9 A;  4K5W A;  1F2L A;  2KVM A; 
#chains in the Genus database with same CATH homology
 1W3S A;  4AH6 A;  4QGU A;  1GD7 A;  1PVO A;  1VQE A;  1MIU A;  4LF7 L;  1LYL A;  1D8L A;  2XTI A;  3UDX A;  5IP9 H;  3PCO B;  4LF8 Q;  4DV0 Q;  3CXC A;  4A3E H;  2HT1 A;  4HJ8 A;  4R4Q A;  4A3C H;  3W5O A;  3FP9 A;  3HOZ G;  4JI6 Q;  2UXB L;  1EUJ A;  3CCE A;  4BY7 H;  2VNU D;  4KI0 A;  3GTK H;  3D0F A;  4P73 A;  5IWA L;  3PUW A;  3F2C A;  1HZB A;  4DR5 L;  2VZA A;  2QEX A;  2ZTC A;  1VQO A;  4BY1 H;  3KFU A;  5DLQ E;  2QA4 A;  4JI8 L;  4DUZ Q;  4A3F H;  4GLV B;  1K8G A;  1YJ9 A;  5IYC H;  1TWH H;  3OYY A;  2K52 A;  2WB1 G;  1FVI A;  1SR3 A;  3LGJ A;  2R93 H;  2ZM6 L;  1QVC A;  1Q81 C;  3W1G A;  4LF4 Q;  5FJ8 H;  4LFA L;  4P71 A;  2OQK A;  4YY3 Q;  1HNZ Q;  5C4X H;  4C3I H;  3HOY G;  4DR4 L;  2K5N A;  3PGZ A;  1PH4 A;  3S24 A;  3PO2 H;  2GVA A;  4UPA A;  2CWA A;  1EWI A;  2F52 A;  3CCV A;  1IBL L;  1I6H H;  4A3D H;  2HHH L;  4DK3 C;  1PH6 A;  1Q1B A;  1XTD A;  4KHZ A;  4A3G G;  3PV0 A;  4YCV A;  4DV4 L;  1A62 A;  1TXY A;  3HOX G;  3CMA A;  1W2B A;  3RZO H;  4BXX H;  1UE6 A;  3FKI H;  3KLW A;  4DR6 L;  1XMQ L;  2VS1 A;  4UP8 A;  4JV5 Q;  3RLN A;  1J6Q A;  1XNR L;  3CQZ H;  3S1Q H;  3GTM H;  3KJP A;  4POF A;  4AQY Q;  4DV3 Q;  1Y1W H;  1VQ8 A;  2LSS A;  1WJJ A;  2VUM G;  2JA9 A;  4OWT B;  1Z9F A;  2YTX A;  4DNI A;  1PHJ A;  1SN8 A;  3M7N A;  3K7U C;  3J81 c;  1E24 A;  1HZ9 A;  2IT1 A;  4ALP A;  1K83 H;  2N3S A;  5M3F G;  2PMZ E;  1K73 C;  1BVS A;  4KHP L;  1AH9 A;  1L1O C;  4IJH A;  1I3Q H;  1YIT A;  1MJE A;  4JI0 L;  3CF5 A;  1Q86 C;  2H5X A;  5IWA Q;  1PH7 A;  2JA6 H;  4LNQ A;  3GTQ H;  1RL2 A;  1KIX A;  2IHF A;  1OXX K;  4FDB A;  1FL0 A;  1QUQ B;  1A8V A;  3ULP A;  2F4V L;  1S3O A;  1WCM G;  3MEF A;  1UE7 A;  2EXD A;  1I5F A;  1M90 C;  4JI1 L;  3UDI A;  3UDF A;  3J80 c;  4B3T L;  1LM0 A;  2Z6K C;  4JOI A;  1L1O A;  4LFB L;  3GTO H;  4DR1 L;  5GAG C;  1A0I A;  3U4V A;  3U4Z A;  1BKB A;  1NMG A;  3PIO A;  4DV5 Q;  4QQB X;  4OX9 L;  1TWA H;  3W1B A;  1SLJ A;  1M1K C;  4A93 H;  3STB C;  5IP7 H;  2PQA A;  3PUY A;  2HHH Q;  4JI4 L;  4LF5 Q;  3PUX A;  5IYD G;  3HOV G;  2CCZ A;  5BR8 Q;  4DUY Q;  1Q46 A;  1OXU A;  2HIX A;  1CSQ A;  1X6O A;  4OON A;  3RN5 A;  4IOA A;  2JEB I;  2JA7 H;  3HKZ G;  4BBS H;  4APV A;  3L2P A;  1QZH A;  2K5H A;  4YCU A;  4IO9 A;  4A3B G;  2YU9 H;  4C3H H;  3K8A A;  3G6E A;  1GVP A;  4A3I G;  4UP7 A;  3GTJ H;  2KHI A;  1QVF A;  3CP0 A;  3B6Y A;  5EAY A;  4LW1 A;  1LUZ A;  3F2B A;  2I5M X;  3NEM A;  1E1T A;  3E0E A;  3K0X A;  2B63 H;  1S40 A;  3JAM c;  4JI0 Q;  2K4K A;  2KEN A;  5M5X H;  1VQN A;  2A1A A;  3CPW A;  1K3R A;  3I2Z A;  4LWC A;  5FLM G;  2JA5 G;  1VQG A;  1YVC A;  4IFD J;  3TEH B;  2R7Z H;  3OTO Q;  3KOJ A;  4X62 L;  1SRU A;  1E7Z A;  1KL9 A;  2F4V Q;  1PH9 A;  5ELN A;  4YHH Q;  1OXS C;  2RF4 A;  4X66 Q;  3U58 A;  1N8R C;  1FJG Q;  4JI1 Q;  5K36 G;  4B3T Q;  3I56 A;  3A5Z B;  1V43 A;  2UU9 Q;  2YV5 A;  5LMN W;  4LF9 L;  2VQF Q;  1G29 1;  4UY8 C;  1YNX A;  2OQ0 A;  4DR7 Q;  3BZC A;  4JI5 L;  2JA8 H;  1PH5 A;  1N9W A;  2CKZ B;  2OCE A;  4LF6 L;  2R7D A;  4L5Q A;  4A3K H;  3KF8 B;  4LUO A;  4DAM A;  4NXM L;  1WFQ A;  1N34 L;  4JBK A;  4WJ3 M;  3S1N H;  3MXN B;  4DR2 Q;  1FGU A;  2YTY A;  4A3J H;  1HR0 L;  3I55 A;  1EQQ A;  2D0O A;  2IX0 A;  4AYB E;  5M3M H;  4B3M Q;  3KYH C;  2RHS B;  1KC8 C;  2OTJ A;  2EQS A;  3CC7 A;  1BBU A;  2E2J H;  5LMN L;  2B3G A;  2MNA A;  2BA1 A;  4GNX C;  3DM3 A;  4R4C A;  4L5R C;  1J5E Q;  3I4M H;  3H0G H;  4X65 L;  3J7Z C;  2B29 A;  5C44 G;  4H02 A;  5GAH C;  2WAQ E;  4GS3 A;  3S1R H;  1YJN A;  2KBN A;  1CUK A;  3A0J A;  2Z0S A;  3HOU G;  5HY6 A;  1IBK Q;  1DGS A;  3CW2 C;  4GKJ L;  4EQ5 A;  5IP9 G;  1N32 Q;  1CKM A;  2VL6 A;  4MTN A;  2V1C C;  4JBJ A;  2ZTD A;  1KAW A;  2LXJ A;  2MO1 A;  4GNX A;  2ES2 A;  4JI7 L;  2JQO A;  3RR5 A;  3E9I A;  2OTL A;  3H15 A;  1VQP A;  4K0K Q;  3HKS A;  3KJO A;  4BY7 G;  4DR3 L;  4GOP B;  2K50 A;  2ID0 A;  4DV2 L;  4X62 Q;  5FLX c;  1OTC A;  2NZH A;  1V1Q A;  3M4P A;  4IPH A;  4JI3 L;  1JMC A;  5JJK A;  3ZJY C;  4A3F G;  3HOU H;  3S1M H;  2Y0S E;  4LFC L;  3TS0 A;  1I94 Q;  4R4I A;  3HOY H;  2KCT A;  4IOC A;  1OXT A;  4PMW A;  1NMF A;  2E5L L;  5FJ8 G;  3CCS A;  3H3V H;  3U50 C;  5JEA G;  4LF6 Q;  2UXC L;  2R92 H;  4NXM Q;  4L5S A;  1IBM Q;  3GO5 A;  3PO2 G;  1JJC B;  1X65 A;  3I4O A;  2ZJP A;  1HR0 Q;  2UUA L;  3KF6 A;  5H1S E;  2JK8 A;  1Q82 C;  4LF7 Q;  3GTL H;  1XMO L;  4A3L H;  2L15 A;  4HJA A;  3KDF A;  4DV6 L;  1N36 L;  1CKO A;  1VQH A;  1YZ6 A;  2PI2 E;  1X3G A;  2RHQ B;  1Y14 B;  4QJF A;  5C3E H;  1G51 A;  2OWO A;  4JYA L;  4YWM A;  1R9T H;  1UE5 A;  4BXX G;  4QY7 A;  4JG2 A;  3FKI G;  1VQM A;  2DUD A;  4JCV E;  4R4O A;  1Q8K A;  1X56 A;  3DLL A;  1CKN B;  4DV1 L;  1PH3 A;  1KQS A;  3CC2 A;  2AWO A;  2UXB Q;  1QVG A;  2AMC B;  4DR5 Q;  2CQO A;  4GKJ Q;  3PF4 A;  3PUZ A;  3S14 H;  4L5T A;  4KLK A;  2WB1 E;  4JI8 Q;  2I0Q A;  4YWK A;  1V9P A;  3NBH B;  4JI7 Q;  1HJP A;  2K5V A;  3CCJ A;  3S17 H;  4B3R L;  5C0X I;  2UXD L;  3IRB A;  1VQF A;  3CCM A;  1XPU A;  2LXK A;  3PO3 H;  3TS2 A;  1T9H A;  1U5K A;  4TQU S;  2ZM6 Q;  4GN3 B;  4GKK L;  3ER0 A;  4LFA Q;  1X3F A;  1SE8 A;  2JA6 G;  4DR4 Q;  4O2D A;  4R1J A;  4B3S L;  3CPF A;  1E22 A;  4XIG S;  1SRO A;  3G4S A;  3GDE A;  1NY4 A;  1H95 A;  1IBL Q;  4PZ7 A;  4C3J H;  3BZK A;  4X64 L;  4EX5 A;  1VQD A;  5IYB H;  2GN5 A;  1VQ6 A;  1JT8 A;  3ULJ A;  3SGI A;  4DV4 Q;  1XPR A;  1L2F A;  5GQO A;  2Z6K A;  2QGQ A;  3ERS X;  1C7Y A;  4DR6 Q;  1XMQ Q;  1C0A A;  5LMU L;  4DPG A;  3J81 i;  1PV4 A;  4DKA C;  1I50 H;  3CAM A;  3CME A;  1G6P A;  3BJU A;  3HOV H;  1EIY B;  2UUA Q;  3AYH B;  1XNR Q;  3CD6 A;  3HOW H;  2AHO B;  3G71 A;  1N36 Q;  3PSI A;  1Q12 A;  3M85 A;  2E2I H;  3TRZ A;  1HZA A;  4HJ9 A;  2NVY H;  3CCR A;  2JA7 G;  2N78 A;  4KHP Q;  1EIF A;  2UUB L;  2JEA I;  5AJ3 L;  4PG3 A;  4DV1 Q;  2IHE A;  4DV7 L;  1GM5 A;  2UUC L;  1PH2 A;  2R6G A;  3J80 i;  5C0X G;  2NVT H;  4HIM A;  1NBW A;  1UE1 A;  2VW9 A;  4LF8 L;  3K7A H;  4DV0 L;  1JB7 A;  1IZ6 A;  1SMX A;  1KRT A;  1AE2 A;  3F8T A;  4B3R Q;  5FLM H;  4JI6 L;  3S2H H;  2JA5 H;  3L0O A;  2B63 G;  1HH2 P;  3HFZ B;  3AQQ A;  4RG1 A;  3RLF A;  4Y52 H;  2WFW A;  2ALY B;  4GKK Q;  1AE3 A;  5C4J H;  1P8L A;  4HIO A;  1Y1V H;  5IT9 c;  4A3M H;  4LFB Q;  3I4N H;  3PUV A;  3AFQ A;  4DR1 Q;  1KD1 C;  1TWG H;  3WWV A;  1XJV A;  1E3P A;  1YEZ A;  2VY3 A;  4J15 A;  1QZG A;  3ULL A;  1LTL A;  4DUZ L;  3T1H L;  4OX9 Q;  1PFS A;  1O7I A;  1VS0 A;  3F1Z A;  4POG A;  2IY5 B;  4JI4 Q;  4JBM A;  3L7Z C;  3HKZ E;  5GAD C;  2KCM A;  4QL5 A;  4LF4 L;  4OWX B;  1HNX L;  3CCL A;  1PA6 A;  1L0W A;  4YY3 L;  3S16 H;  3K80 C;  4BBR G;  2FXQ A;  1PH1 A;  2JA8 G;  3EIV A;  2CFM A;  2MO0 A;  3JAM i;  4HJ5 A;  5JJL A;  5J3B A;  1GO3 E;  1IYJ B;  4IPC A;  4QIW E;  4HID A;  3AEV A;  2JE6 I;  1IL2 A;  2PQA B;  4PZ8 A;  3H3V I;  2AWN A;  1P16 A;  3VDY A;  3HOZ H;  3M4O H;  3K81 C;  4JV5 L;  4OO1 I;  2R7F A;  2E2H H;  4DV7 Q;  4A3E G;  1X54 A;  3I4M G;  3FHW A;  3H0G G;  4A3C G;  1N33 L;  2F3I A;  3GTP H;  1QUQ A;  1VCI A;  2AKW B;  1B70 B;  5IY0 A;  4DV3 L;  4AQY L;  1ASY A;  2IX1 A;  2PNH A;  3I7F A;  2HIV A;  4P74 A;  3RN2 A;  3S2D H;  1HNW L;  3BU2 A;  4BY1 G;  3OW2 A;  1YIJ A;  2JJQ A;  2ATW A;  1NJI C;  4WJ4 A;  2K14 A;  4AIM A;  5IYC G;  2I5L X;  4LF9 Q;  1MKH A;  2GVB A;  2DGY A;  4A4I A;  1B7Y B;  1PH8 A;  1A63 A;  2R93 G;  4JI5 Q;  5M5Y H;  3TRE A;  3T1H Q;  1C9O A;  1EOV A;  1Q1E A;  5HGQ A;  1E1O A;  1VQ4 A;  4OWW B;  5C4X G;  1YHA A;  3ICE A;  4GLX A;  1N34 Q;  2Q2T A;  1B8A A;  3GD7 A;  3J81 j;  4A3G H;  1K8A C;  1SFO H;  4HIK A;  1WOC A;  4A3D G;  3HOX H;  3UDG A;  4IFD G;  1NTG A;  1CSP A;  2KHJ A;  1KHI A;  3A5U A;  1HNX Q;  3NEL A;  5LMN Q;  2A8V A;  2NVQ H;  2HQL A;  2ASB A;  4DV5 L;  2D62 A;  3EN2 A;  3J7A 5;  4P72 A;  1VQ7 A;  5M5W H;  2YTV A;  4R4T A;  4X65 Q;  2R92 G;  2WP8 J;  4JC0 A;  1VQJ A;  1WI5 A;  2NN6 I;  1X3E A;  3EBE A;  4OXP A;  5C0X J;  4LF5 L;  2VUM H;  3GTG H;  4OO1 G;  4C2M H;  5BR8 L;  4NXN L;  4DUY L;  4IPG A;  1VQ5 A;  2NVX H;  1YJW A;  4GLA C;  1YHQ A;  4A3L G;  1Y1W G;  1KXL A;  1KRS A;  4JI2 L;  5M3F H;  5C3E G;  2BH2 A;  5IE8 A;  2ZJR A;  4GN5 A;  2CWP A;  4NPS A;  5ELO A;  1N33 Q;  4A76 A;  3RLO A;  3A74 A;  3CC4 A;  4DR3 Q;  4BA1 I;  4DV2 Q;  4DAY B;  4YWL A;  1UEB A;  1YBY A;  1WCM H;  3CCU A;  3S15 H;  4A75 A;  2Q2I A;  3TQY A;  1ASZ A;  4JI3 Q;  2VQE L;  4JOI C;  2BH8 A;  4RMF A;  1XNQ L;  1VQ9 A;  4ME3 A;  4LFC Q;  3PO3 G;  4HJ7 A;  4GNX B;  3OTO L;  3NEN A;  5GAE C;  2E5L Q;  4NB3 A;  3M9B A;  4O0A A;  2UXC Q;  1JE5 A;  1PYS B;  2N49 A;  4YHH L;  4X66 L;  1FJG L;  4X6A H;  1XPO A;  1IXR A;  4A93 G;  5IYD H;  3CCQ A;  4GN4 B;  1VQC A;  5IP7 G;  2UU9 L;  1XMO Q;  2VQF L;  1Q7Y C;  2NN6 G;  4DV6 Q;  4IPD A;  3T1Y L;  1VQA A;  5IYB G;  1OXV A;  4GOP C;  4BA2 I;  2PI2 A;  4A3B H;  1EQR A;  4JYA Q;  4DR7 L;  2XGT A;  1VQK A;  1RIP A;  4BBS G;  4A3I H;  2D0P A;  2ZJQ A;  4DR2 L;  5E7N A;  1U0L A;  1JJG A;  4B3M L;  2UUC Q;  4PZ6 A;  3D31 A;  4NXN Q;  3HOW G;  2Q2U A;  1K0R A;  3JC6 6;  2ZTE A;  3KF6 B;  4JI2 Q;  3UE1 A;  4AYB G;  4Y7N H;  3PF5 A;  2EIF A;  3M3Y H;  4JBW A;  2RCN A;  1J5E L;  3KDF B;  1EFW A;  4GOP A;  1NE3 A;  3Q8D A;  2UXD Q;  2E8G A;  1MJC A;  1BBW A;  1HZC A;  1PYB A;  3F2D A;  2YYZ A;  2Q2H A;  1X55 A;  4IJL A;  2I5H A;  4UP9 A;  3UE0 A;  1VQL A;  1IBK L;  2MFI A;  2WAQ G;  5JEA J;  1N32 L;  2R7Z G;  4P75 A;  1WYD A;  4B3S Q;  4LUZ A;  2VQE Q;  3M4Q A;  1K9M C;  5JJI A;  1TWF H;  1XNQ Q;  4K0K L;  4X64 Q;  1Z47 A;  1YHB A;  1TWC H;  4A3M G;  1Y1V G;  1UWV A;  3E9H A;  3AFP A;  1HNZ L;  3I4N G;  1HNW Q;  1GKH A;  2A19 A;  2N8N A;  1VQB A;  5GRO A;  1L1O B;  5LMU Q;  3RZD H;  1JJ2 A;  4TVA B;  1YI2 A;  4MNO A;  1EYG A;  1HR0 W;  2K75 A;  3PIP A;  4IFD I;  4A3K G;  1X9N A;  4LUV A;  2BA0 A;  3G48 A;  3RNU A;  4A3J G;  1I94 L;  3STB D;  3T1Y Q;  4BBR H;  1S72 A;  5M3M G;  1VQI A;  1CKN A;  2Y0S G;  2MQH A;  4DK6 C;  2C35 B;  4XTC S;  5C44 H;  2NZO A;  1D7Q A;  4MZ9 A;  2UUB Q;  1IBM L;  5AJ3 Q;  4YCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...