4EQOA

Crystal structure of staphylococcal nuclease variant delta+phs v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4eqoA00
1IHZA 1F2ZA 1RKNA 4S3SA 1SNMA 4EQPA 2HQEA 2F0QA 3DMUA 3R3OA 3OMCA 3D6CA 2EYOA 3SHLA 4KD3A 1NUCA 4KJOA 2F0GA 2PQEA 2EY6A 2F0PA 4KY5A 5CV5A 4HMIA 2PZWA 3BDCA 2EY5A 1II3A 2F0IA 2O4XA 3BDLA 1SYFA 2EYFA 4ZUIA 5K5PA 2NUCA 2EXZA 2EY1A 3E5SA 2M00A 5CV8A 3T16A 2PZUA 2F0FA 3MVVA 3NUCA 3OWFA 4DU9A 2EYPA 5J39A 3NP8A 3QB3A 4KTAA 1EYAA 4K8JA 1KDCA 5C3XA 2F0WA 4H7BA 4IALA 1JOKA 2EYLA 3DHQA 3HEJA 2KHSA 5CR3A 3LX0A 1F2MA 4WORA 5IGGA 5IGFA 2F0HA 2EYJA 4K5VA 4KY7A 3U9OA 3NHHA 5C6AA 3NK9A 1F2YA 1SNOA 1SYBA 4NDXA 3D4DA 4OL7A 1EZ6A 2QDBA 2EYHA 1SYEA 4NMZA 5C4ZA 5JAVA 4HTHA 5KEEA 5KIXA 1JOOA 5C5MA 3EJIA 5I9PA 3C1EA 4KD4A 3PMFA 1EQVA 3SR1A 5C5LA 1ENAA 4EQNA 4J6HA 4K6DA 4KY6A 1NSNS 1AEXA 3NQTA 4IUNA 4PNYA 5CV4A 1SNQA 4N9PA 2F0OA 5EKKA 1EY8A 5J1ZA 5CGKA 1SNCA 1ENCA 2F0LA 2PYKA 1A3VA 4I65A 4NP5A 1STYA 1EY6A 4ODGA 5IGDA 4J1MA 4KJNA 2OEOA 4ID6A 4QB4A 5IOCA 1EZ8A 4LAAA 4B9XA 5JOBA 3TP5A 1STAA 2F0NA 1A3UA 3VA5A 1EYCA 4YIJA 2F0KA 3QOLA 4DFAA 5ISRA 3S9WA 2PW5A 3T13A 5IGBA 3SK8A 5E3FA 2KQ3A 3SK4A 5F2DA 5I9OA 5KYIA 1TT2A 2F0TA 5DAUA 4ZQ3A 1EY4A 1SYDA 1A3TA 1KDBA 4IZ8A 3HZXA 1U9RA 4MIUA 4DGZA 5HURA 3SXHA 5EGTA 4EVOA 2PZTA 2F3VA 2F0VA 2RDFA 4K2LA 4N9TA 5I6YA 1SYGA 2RBMA 2F3WA 5C4HA 2WACA 3EVQA 3ERQA 1SNPA 1KDAA 3RUZA 4K14A 1STGA 5M9OA 1EY5A 2F0EA 3OMGA 4F8MA 3H6MA 4ZUJA 2ENBA 2SNSA 1EY9A 4K2KA 4NKLA 4F7XA 2OXPA 5CV9A 4TRDA 3TP8A 3TP6A 5KYLA 4ME5A 3MEHA 4G57A 4WRDA 2F0JA 5IGEA 4E6IA 5HGTA 3C1FA 5CV6A 4EQOA 2LKVA 5E1FA 2SOBA 2RKSA 4QMGA 1STNA 1EY7A 3ITPA 3SK5A 3V2TA 1SNDA 1TR5A 3P1HA 4QF4A 5CC4A 5J22A 2OF1A 1STHA 1A2TA 5KGUA 4DF7A 4PMCA 4R8NA 5KRUA 5IGCA 1SYCA 4B9WA 1JOQA 2F0SA 5IIFA 1EYDA 3TMEA 4K5WA 1KABA 2EYMA 2F0DA 3D4WA 4K5XA 5C3WA 1STBA 1KAAA 5DEHA 3MXPA 3D8GA 3OSOA 5IODA 3QOJA 1A2UA 4K8IA 2EY2A 3EROA 4KHVA 4PMBA 3NXWA 2F0UA 4RKLA 4RKBA 5EKLA 3SK6A 1TQOA 3MZ5A 2PW7A 1JORA 1EY0A 2SNMA 5NUCA 4KV6A 2F0MA 3P75A 4HMJA 5I6WA 5CV7A 3MHBA 3TP7A
chains in the Genus database with same CATH superfamily
4S3SA 4A3EG 3RD4A 3CP0A 2BH8A 1Y14B 2A68D 3ICEA 1G51A 4LUVA 4JI5Q 1R4PB 3I4OA 1BQQT 4J8QA 1AN8A 2YV5A 4H7BA 1DXMA 1QB5D 4MZ9A 4WORA 5M3MB 3LWUA 2L55A 2K4KA 3CHBD 1VMPA 3U9SA 1YITA 5M5YB 3CXCA 1PYSB 1U4MA 4DR1Q 1SLJA 1C0AA 4C56C 1VQFA 1K8MA 4J6HA 2NVXB 3GV6A 5EKKA 2JA7B 4PMWA 1UWVA 3SE0A 1H9KA 2K50A 1NY4A 4M1UB 3TZUA 3E0JA 4UPAA 2B2TC 3BVZA 1HNXQ 1YJNA 1UE6A 4QB4A 5IOCA 2BCOA 5KNBA 1XNQQ 2R7ZB 1AFPA 5C4XH 5M3MG 4NW2A 1GUNA 1BNZA 2KQ3A 5F2DA 1WTRA 3JAME 5C4JH 1LT4D 2B2UC 3KF8B 1CKNA 4JK1C 2L9HA 3DM1A 4BXXG 3VYRA 1X65A 2E8GA 2L11A 2MPMA 4L5TA 2JA7G 4X64Q 2EIFA 1V1QA 5CBAE 4B3RL 3L0OA 4PZ7A 5M3FB 3TRZA 4E6IA 4ME3A 3HFZB 5J22A 3L3OC 1T9HA 3DEPA 2R7ZG 1AW7A 1HPCA 1BBWA 3FVQA 1HZAA 4R8NA 4BBRH 3NSWA 1KABA 5JJLA 2K5WA 4N8X1 4EQ5A 1PH9A 4EX5A 4KHVA 4RKBA 4DR3L 3F1ZA 1W3SA 3G6JB 1FJGQ 3PUZA 3CMAA 5EPJA 4BS9A 4G7ZC 1F2ZA 3GTGH 2F0QA 4LF8L 4JI1L 1V8QA 1EFWA 5M3FG 4DXGA 4BBSB 1TWFH 2EY6A 3UI2A 1WOCA 3X3MA 1NJIC 1GVPA 4DR4L 4A3EH 1XWEA 1HH2P 2WFWA 3HOUH 2XWJB 3NTHA 5C44G 4IALA 2ES2A 4F88A 1A63A 2HIXA 1XTCD 3RZOH 3MAQA 4DAMA 1CZWA 3I2ZA 1ESFA 4HSPA 5COYA 1MJCA 5M5WH 5C5MA 4OO1G 4JBWA 3F2UA 4AYBE 2JEAI 4LUZA 1CQFA 4BBSG 5C5LA 1R4QB 2XRQD 1MKHA 3GTMH 3TQYA 1LTAD 3WWVA 2FFKB 4RGNA 4JBMA 3E9HA 2OQ0A 4DK6C 1A3UA 4QIWE 3STBC 3OWEB 4PV1C 4DNTB 1LTLA 3VR6A 2WAQB 3BVMA 3TEHB 5E7NA 3HZXA 5EPKA 4GKJL 4A3DB 4X66Q 1SE2A 5M3MH 1YNJC 1K8OA 1X3GA 1NR2A 3E9IA 4HSVA 5M5YH 4X6AH 5EKIA 5DLQE 5BN4A 4BXXH 1NMFA 2H1EA 2QA4A 3I56A 1XMQL 1HNZL 3EA6A 4AQYQ 1O7IA 2NVXH 2JA7H 1SNDA 1GXDC 4OGQC 3L9AX 3W2DA 1IL2A 1PVOA 4DF7A 4PMCA 2HDLA 2WAQG 2WKCA 1JJ2A 4A75A 2Q2UA 3A54A 3KLSX 4V190 4J15A 3D8GA 3OSOA 4A3DG 2R7ZH 1KC8C 1ET6A 4ZLTF 3CCRA 1AE3A 4JI6L 4QJFA 2EJFC 2RCNA 4A3GB 3FRPB 1Q8IA 2HCCA 1SMXA 2NZ1D 4M8AA 1FL0A 3R3OA 1VQ4A 4XDXA 1Z7TA 4KD3A 1E24A 4KY5A 2Z6BA 3MXNA 3UE1A 2K33A 1VF5C 2F03A 5FK9C 5IT9c 1HUNA 4GKKL 1HZBA 2SDFA 3QB3A 3I4NB 1GM5A 2EYLA 2GN5A 1UEAB 5IGFA 1DD2A 4A3CG 3GP7A 1B9NA 4X62L 4JVZA 4EGVA 4RHRA 4FO2A 3TBIB 1SYBA 3IFTA 2VL6A 1SJED 1SXTA 2EYHA 4CDFC 4YWLA 1BCPC 3PMFA 4FF4A 2A6HD 2WB1E 1NAPA 1SAPA 1IZ6A 2VW9A 2JA5B 4CJ2C 4B3TL 3TS0A 1GHJA 2IY5B 4OO1H 2RA4A 2Z9HA 1FYCA 3P7JA 3PF4A 1K0SA 2J7ZA 2UU9Q 4DR2Q 3BDOA 1PH2A 1KAWA 1E2VA 1K8GA 3PO2B 1E3PA 2KECA 3I4NG 1B3QA 1STAA 2R93B 3C46A 1I5FA 1N33L 2B8GA 5LMUL 3M3YB 2I07B 5KYIA 1T5XD 1SE4A 4IFDJ 1A6XA 4EVOA 4FVMA 4B3RQ 4N9TA 1SYGA 2A69D 3H0GB 1ONLA 3EVQA 2YYZA 1SNPA 1UEBA 5M9OA 3OMGA 2JA5G 3MC0B 4BY7B 3F8TA 4HCEA 4OHJA 3AYHB 2CQOA 2QILA 4O42A 4OWXB 3FHWA 4PZ6A 3J7ZC 1DJRD 3S17B 4DNIA 3QG1A 3S15B 1JICA 1BOSA 2ZTEA 1H9SB 3P1HA 1EWCA 2OF1A 1VDZA 1CK1A 1EIYB 2R93G 2HD3A 4DR3Q 3I70A 5E4XA 1X55A 2F0SA 2K7VA 1CQVA 4JI3L 3TMEA 3SEBA 1IL8A 1YNND 3QOJA 4PMBA 4LF8Q 5DM73 4JI1Q 4RKLA 2D0PA 4QGUA 4DV7L 3H0GG 3MZ5A 4DK1A 1VQMA 2BE5D 2A8VA 4I7AA 5NUCA 4YY3L 3PO3G 4BY7G 4DR4Q 4A3DH 4A3KH 1JCKB 1WYDA 1VQOA 3GDEA 1L0YB 2Y0SB 2E74C 2EY5A 2ZM6Q 1SYFA 2EYFA 3ERSX 2M00A 5IE8A 5IYBG 1Q3LA 1CI3M 4R1JA 5C3XA 5CR3A 2D0OA 2F4IA 3VDYA 3KOJA 4DV0L 2EYJA 1D1IA 2KCMA 4IPCA 4TQUS 5CORA 5C6AA 3EBEA 1QILA 2CHBD 2CWPA 1E7ZA 3BZCA 3R93A 2E2DC 2OT2A 1WTPA 4A3CH 4FXDA 3I8ZA 3AFQA 4A3GH 2Y0SG 4R4TA 1X32A 4RHSA 2XTIA 2CW0C 2M2LA 2R61A 1S5FD 1TIID 4JI5L 3M9BA 2IJ0A 4KJNA 4A3BB 1TVXA 3J81L 4GKJQ 3GTLB 3TP5A 1RD9D 1G8ZD 3GTQH 1TKWB 2PCFB 3SK4A 5I9OA 2DJFC 4DK0A 3OTOQ 3A5UA 4IZ8A 1A3TA 1KDBA 2IX0A 3I4NH 1G91A 3I91A 1EQTA 2WV6D 1BCPB 1TWGB 1F9RA 1K83B 2BDNA 1XMQQ 4Y52H 3RUZA 2F4VL 5FKAC 1U0LA 1D7QA 5JVH3 4DR1L 1GKHA 4ZCKA 2SNSA 1PYBA 1BVSA 4RMFA 2DY7A 4ME5A 4A3BG 1JMCA 2JA5H 4UP9A 5EBDA 2OCEA 3K5NA 3F2DA 1STHA 2IWHA 5KGUA 3N52A 1CA6A 1ZYRD 1HNXL 2AQ3B 3JAMi 3PO2H 1XNQL 4G7HC 4OELB 2P5ZX 2O2LD 4HJ8A 2PQAB 2R93H 2RDHA 4DV2Q 2WP8J 4RA8A 3M3YH 1EY0A 3S14B 4KV6A 2VNUD 3BZDB 1SNMA 5EBCA 1LTGD 4P72A 2PNHA 3H0GH 3J80E 3L7ZC 3CW2C 4QUFA 4GKKQ 1QUQB 4X64L 2PZWA 4BY7H 4BA2I 1X3EA 1II3A 3Q0AA 1BBUA 4X62Q 3KF8A 2AMCB 2NVTB 5CV8A 1SROA 3AU7A 2B2YA 4ABNA 3A56A 1IXRA 2GVBA 1J8IA 1EYGA 1JOKA 2NZOA 5AJ3L 1F2MA 3K0YA 3PV0A 4POFA 2G9DA 2NVQB 1BXTA 4DAYB 4NDXA 2BA0A 4QCLA 3ND8A 4B3TQ 1X3PA 3KDFB 2HDMA 2QDBA 4ZRZA 5GAGC 5KEEA 1EIGA 4RGTA 5I9PA 5KNCA 1HA6A 2WIIB 3T53B 1PH7A 1ENAA 3T1YL 4ALPA 2C5CA 2NTTA 2BH2A 1RIPA 4IUNA 4R4OA 4LNQA 1I4QA 1B7YB 1V1PA 3GTKH 4A3LG 1N33Q 1STYA 1E2ZA 1M8AA 2L5TA 5D3IB 2K52A 3CRLC 1JR0D 1QZGA 4IPHA 1JWUD 2OTLA 1O7LA 4IUTA 4GN5A 2DNEA 1HCZA 2QDLA 3S9WA 4HCSA 1RTOA 2RQXA 3LGJA 4A4IA 1CKMA 2Q2TA 1F9QA 4GLAC 1U9RA 5TSSA 5JPMC 4JC0A 3FDTA 1I3QB 1GUTA 2MO0A 1QZHA 1E0BA 4IUQA 1U4RA 4DV6L 1K3BC 4DR7L 1RL2A 1RJTA 3RMHA 1EY9A 1Q1BA 2OXPA 1KLUD 1YBYA 3HOZB 2C9OA 3OIQA 1D6EC 2F0JA 5HGTA 1NNXA 1PZID 4HAEA 4JI3Q 2EQSA 2D5DA 2VZAA 2CH4A 1PH1A 4QF4A 1EFID 3NENA 3H94A 2Z0SA 3VYSA 4DAPA 4DV7Q 2WAQE 2D9UA 3ND9A 3ZJYC 3CC7A 4A3BH 4OWTB 4YY3Q 1EYDA 2JA8H 5I4DA 4X3UA 1E22A 1MI2A 2PMZB 1TQOA 1S3OA 2DN8A 1FR3A 4RWSC 1JORA 3KJOA 1ET9A 4XQQA 2HIVA 4IN3A 3K57A 3HOUB 1WCMB 3DMUA 3K8AA 5ELOA 2QEXA 4DV3Q 1TWGH 3HOZG 3CMEA 2Q2IA 1K83H 4MHEA 2F0GA 2B2VA 2O4XA 1I4GA 4AQYL 2I5HA 3W3AA 4G4KA 3NQIA 5BR8Q 4P73A 4QUCA 1BCPF 1L0WA 4GNXB 1HXYD 2UUBL 1DONA 3GTPB 1PFMA 4I7ZC 1KRTA 1GUGA 3CCMA 4OIJA 3GTMB 3BYTB 2KENA 2B2TA 3KUPA 4B3SL 2JSOA 3HOUG 1WCMG 3Q24A 1VQDA 1VQHA 3ZYYX 1EQVA 4X65Q 3S14H 1WD0A 3PSIA 2E2IB 3CCUA 2KOLA 3HRZC 5J1ZA 2KHJA 5ELDA 5IT9E 2B8FA 2L0CA 3HP3A 1ENCA 1JQYD 4NP5A 4X3KA 1EY6A 4AIMA 3RZDB 1PRTF 3J7A5 2TSSA 3GD7A 1EZ8A 3BJUA 5BN5A 3K6OA 4CJ0B 1VQ5A 1ZKOA 3FP9A 4A3LH 2NVTH 5FOBB 1QE6A 2K1BA 3IL8A 2F4VQ 5EQ0A 1EY4A 4CBVA 4MIUA 2A6ED 1TS2A 1PH8A 2RBMA 2NVQH 2VXWA 1WTOA 4IUVA 4DN4M 4L5RC 1CHPD 3KLWA 3K5LA 4CDCC 5K36G 1DZ1A 2E2JB 1TS4A 5DM63 4DNRB 1QVGA 2MQHA 2EJMA 3WDNA 2ZXRA 4JI8L 5E1FA 2NB0A 3UE0A 1PTOD 3QO2A 4DR2L 2UU9L 1A2TA 1W6JA 5I2XA 2RHQB 1JOQA 2XGTA 2Z1CA 2EYMA 1OXVA 1VQKA 1KAAA 3MXPA 1R9TB 1A2UA 2JP1A 2EY2A 4FDBA 3OW2A 1VQJA 2PNRC 3HKZB 2JEBI 1K28A 4GOPC 4LFAQ 4HMJA 5I6WA 1MSGA 1RKNA 1I3QH 3OMCA 2D62A 3EIVA 3J80c 4IOAA 4HIKA 4KKSA 1B2TA 5AJ3Q 4JYAL 3S24A 3HOZH 1ICFB 2EXZA 1B50A 4U68A 3PIOA 2B63B 5J3BA 3NUCA 4KHPL 2EYPA 4DUYQ 4PQXA 2K5QA 3HEJA 3MFYA 1Y1WB 3T1HL 3J81c 4A3FB 3HKZG 1QVFA 1ESRA 3T1YQ 2IPKD 1RDPD 4DUZL 4OO1I 1QNUA 4DKAC 5JPNC 1EZ6A 1O7ZA 5A2QL 1H9SA 1KTKA 3TN2A 2F3IA 1HQMC 2AUJD 1I50H 2Y0SE 1ZEQX 4UY8C 1WVLA 1AZQA 2I0QA 3T4AC 5CGKA 1L1OA 1YNNC 1WCMH 1YEZA 4MTNA 1KLGD 3I3CA 2B63G 3FEWX 1SBBB 2Q8IB 1KL9A 1QVCA 2ZM6L 1BO0A 1Y1WG 2EOTA 1OXUA 5ISRA 4OONA 5HGQA 3QOLA 4DV5L 2A1AA 4A3FG 1N32Q 1V43A 3G4SA 4OIKA 4DV6Q 4DR7Q 2Z4IA 5JJKA 4NB3A 1LTSD 3GTPH 4DR6Q 2L4NA 3EN2A 3GV3A 1KRSA 3C2PA 3OOCA 1PMRA 2F3WA 3NTKA 3R8BA 1YJWA 4LF9L 4KHZA 3CU7A 2VQEQ 4K14A 5IP7H 4HIOA 3H6MA 1PLFA 5CV9A 4WJ4A 4JG2A 3S1RB 3D31A 3C1FA 4FP5D 1SN8A 2FMMA 2E2IH 2KBNA 3I90A 1EU3A 5K36H 1HFNA 2YTYA 1LABA 4IUUA 4U673 2L15A 1HA5A 2N49A 1QNKA 1YIJA 3RZDH 2LXJA 4A3KB 3EQLC 3HG9A 1D5MC 1UAPA 4K5WA 2F0DA 4V0BA 1FNWA 1HJPA 1STBA 4R4IA 5JEAJ 2MUYA 5LL6X 3OTOL 4IO9A 4F87A 1NCVA 3IRBA 4UHVA 4A76A 1EIFA 1LTID 4OX9L 4L8JA 2PQEA 3PIP3 5A35A 2UUBQ 4HMIA 1BKBA 1MSHA 2F0IA 2E2JH 1X6OA 3M4QA 1S5BD 2EY1A 3T16A 4DU9A 4A3KG 3NP8A 1KQSA 4B3SQ 2KHSA 5JEAG 1FVIA 2VB2X 1PH3A 2K5VA 4GOPB 4IQZA 1F2YA 2FJ2A 4A3MB 2B39A 4OL7A 4DV2L 1R9TH 1LYLA 2ZJQA 5L37A 1XNRQ 3CAMA 1MIUA 4UP8A 2B3GA 2GVAA 1XJVA 3GTJB 1CUKA 3BG3A 2ATWA 4H13C 1WI5A 4YCWA 3GTQB 3J7YW 1KNAA 2PQAA 1A3VA 1YHAA 5FO7B 4KK7A 4ZAIA 1HQRD 1FGBD 4YHHL 1WTQA 1B1ZA 2XWBB 4DA2A 5IYCG 1A62A 4B9XA 2HQLA 3RNUA 4A3GG 2B63H 5DAUA 4A3MG 1XPOA 1SYDA 5HURA 1Q46A 1Y1WH 4K2LA 4R4CA 1JWMD 4A3FH 5C4HA 4HIMA 4HJ7A 2O5IC 4JI7Q 3ERQA 1CSPA 1STGA 4JI8Q 5FO9B 3AEVA 4FXKC 3OYYA 5FJ8H 3OHXC 4C3HH 3D6WA 1S4ZA 2MO1A 5IGEA 1AZPA 2QF7A 4DAYA 3UDGA 1F9PA 5CC4A 1TR5A 2FMCA 4JV5L 1DM0B 2J0TD 1YI2A 2V1CC 5IIFA 4OXPA 3S2HB 5G3LF 3KF6B 1PRTC 4K8IA 3IFDA 3DWQA 2MHVA 1KD1C 2HT1A 5C0XJ 2KEDA 1YJ9A 2I5MX 3P75A 2K28A 5CV7A 4JYAQ 1IHZA 4PZ8A 1VQIA 2NZHA 1W2BA 4H44C 3PO2G 3A7LA 4DPGA 2Z8LA 4KHPQ 1SMYD 1DGSA 2MGSA 2MJ8A 4XIGS 5CV5A 1G6PA 2K14A 4JW0A 4LW1A 1GO3E 2EZVA 2I46A 2JXMB 3T1HQ 3BDLA 3HOXB 2CFMA 3A8KE 4IFDG 3J81j 2DJGC 3S1RH 4DUZQ 4C3IB 2JN4A 3Q6SA 2RDGA 2PMZE 5GADC 2F0HA 4NPSA 1AE2A 1VQ9A 4RAUC 5LHY1 4JI4L 4RGOS 3K0XA 1HZCA 2UXBL 2QEJC 3GTKB 5JVG3 2EDGA 3NBIA 5JEAH 1TS5A 2NVYB 2B2WA 1G2TA 1B9MA 2KCNA 3Q8DA 2JK8A 2ASBA 4DAVA 3MA2B 4LF7Q 3ONAB 4KY6A 3K80C 4DV3L 2ZJRA 3F2BA 3HOXG 2F0OA 2X6GA 4DV5Q 4XT3B 1MJEA 1HR0W 2IHEA 2WINB 1C7YA 3KBGA 4C3IG 1BF4A 1PZJD 4OWWB 5BR8L 3FMCA 4DFAA 2KCCA 2PW5A 2VQFL 1BBXC 2UXCL 4LF9Q 4X3SA 2X6LA 5GQOA 4JI2Q 2CVRA 2RHSB 2LS01 5IYCH 1QOHA 2PZTA 1QG7A 2QW7A 1X3FA 3AFPA 3R2IA 5GAHC 2E5LL 3ULJA 1KDAA 4A3MH 3KLSA 3FKIB 3O13A 5ELBA 4X65L 1JJGA 3MWYW 5KYLA 2JA8B 3GTJH 2R92B 4FF1A 3S2DB 3STBD 3SGIA 2E2HB 2LKVA 2A68C 3DM3A 2A74C 1Q12A 2K5HA 4HN7A 1S72A 4JOIA 4C1NI 3ULPA 3AMUA 4IURA 1B4OA 2OTJA 1PYWD 3TSSA 1MD2D 4OX9Q 2ALYB 3KYHC 2Q2HA 4XQJA 4CGYB 2CWAA 2DY8A 3TP7A 3FKIG 4ULLA 2K6AA 1HFGA 1OXXK 2NBFA 3D6CA 2JA8G 2KUMA 3CCSA 2R92G 2AKWB 4IJLA 4JPBW 3CC4A 2ICEC 1OO9B 2IX3A 2A6EC 3K58A 4ZUIA 2A5HA 3DWPA 3CC2A 4GNXC 2F0FA 4BWGB 1TXYA 1AP0A 3W5OA 1PRTB 1SE8A 3DXJC 1PV4A 4TSSA 1EOVA 3K59A 4IFDH 2NN6G 2K5NA 1HRJA 3S2HH 3J7AF 3D4DA 1IW7D 3A7AB 3MXNB 2RF4A 3PQIA 4UP7A 4LFAL 5C0XH 4YHHQ 3G7LA 2JA6B 1NSNS 1AEXA 1CTMA 4CDDC 2ZTCA 1ASZA 4WJWA 1SNCA 1VQCA 3A55A 4C1NK 3V05A 1EOTA 3J81E 1SSOA 4YWKA 5LMNW 3T56B 3HOXH 4YIJA 1MGSA 1E1TA 3A8IE 3SK8A 5E3FA 1X3QA 3S1QB 4DUYL 1ILQA 4C3IH 1UE1A 4L63B 2IX1A 1W6KA 1Z6HA 1K0RA 4RGMA 4YCVA 4APVA 3HOVB 1MBYA 5FLXL 5JJIA 1B8AA 1ICWA 1D8LA 1XYIA 2JA6G 3SDZA 1OTCA 1EY5A 1PFBA 3M7NA 1S40A 4K2KA 4NKLA 3MEFA 2K03A 2NVYH 2N3SA 2RCFA 3OIPA 4JV5Q 1ILPA 4WRDA 3MEHA 1K8AC 3JC66 2I5LX 3RN2A 1I4XA 4QMGA 2RKSA 3ITPA 4HJAA 1XXGA 2WB1B 4A3IB 4B3ML 4BY1B 4X3TA 3PUYA 3Q22A 3I73A 4KKUA 4B9WA 1YZ6A 1L2FA 2MFIA 5DEHA 4B08A 1JJCB 3HOVG 2FHTA 1N32L 2Z6KC 1D5ZC 2PO4A 3CCJA 3GTOB 1LACA 1LV9A 4DR6L 1TWCH 2F0MA 4FF2A 2QCPX 2EJGC 1J5EQ 3SK5A 1I6HB 4DK3C 4EQPA 5CYUA 4NXML 3CPFA 2VQEL 4RG1A 1Y8NB 4KJOA 4A93H 3NEMA 4Y7NB 4LMQD 2B2YC 3FKIH 4XQNA 2WB1G 4A3IG 4BY1G 1YNXA 2NUCA 2XNAC 2PZUA 2R92H 3E6ZX 4JI4Q 3CKIB 2ZJPA 3S2DH 5I2YA 2E2HH 2UXBQ 3LNNA 2Z4HA 4K8JA 3VR4A 4QQBX 5IGGA 1GUOA 1I50B 4HR7B 2K04A 1P16A 3U9OA 2N55A 4HJ9A 4GLXA 5FLMH 2M9VA 3DUZA 1D2BA 3DLLA 1SYEA 3PGZA 1VQ6A 1JOOA 3EJIA 3BS1A 1G2SA 4XXEA 2IW3A 4CHTB 2NN6H 3IKJA 2HCIA 4LFBQ 4K6DA 1JB3A 2L1BA 4DV4Q 1IKMA 1RHPA 1D5XC 2K75A 1NE3A 2F0LA 2R7FA 1H95A 1P8LA 2VQFQ 2VUMB 2B29A 2UXCQ 3H3VH 4A3JB 1V1OA 3CQZB 1LTTD 1IKLA 4ID6A 4P71A 1BR9A 5JOBA 2F0NA 2KJXA 4MN3A 4K0KL 1VCIA 2X69A 1TY0A 4ILWA 3L2PA 2E5LQ 1K9MC 2ID0A 2KHIA 2N78A 4DR5L 1ASYA 2G5DA 3JAML 4JI0L 1PFSA 1EWHA 3NTIA 1ML0D 2C35B 5IP9G 1NR4A 2B2UA 1I4PA 3M85A 4JBJA 3LWEA 1SJHD 4NXNL 1XNRL 2BDOA 3IAYA 1JB7A 1VQAA 4LF5L 1EL0A 2VUMG 4CKCA 1QCBD 2JQOA 4G7OC 1KXLA 4GOPA 4A3JG 4ZKBB 2JA6H 2SOBA 1EY7A 3GO5A 1XPRA 1HUMA 2AQ2B 1I4RA 5IP7G 4QY7A 1SYCA 1RCVD 2NWGA 4KLKA 4GN3B 1CKOA 1LT6D 2NYZD 3D4WA 4LFCL 1A8VA 4K5XA 2JJQA 4P2CB 1TU2B 2F1MA 4FYDA 1CT1D 4CJ1B 5ELNA 1XPUA 3S1QH 2SNMA 1XX8A 2FINB 1M4VA 2KCTA 1F77A 1UE5A 1DCZA 3HOVH 1BUVT 2B2VC 3NE5B 4JI7L 1B53A 2LMCB 4HJ5A 1I94L 1NBWA 1EEID 5IYDG 1B44D 3WOEA 1J9OA 2AWNA 3ER0A 1SEBD 4CKBA 2A6HC 5K5PA 4R8IA 1O78A 1GOZA 4KMUC 3U4ZA 2LSSA 4KTAA 4LF6L 3EFXD 3G71A 4A3IH 3LX0A 4BY1H 3R2TA 4LF4L 3SVMA 1DOLA 3NPPA 2FXQA 1VQPA 1VQLA 4XYOA 3GTOH 4XTCS 2SEBD 4EQNA 3OW7A 1IBLQ 1I6HH 3S16B 2LY7A 4PNYA 3KF6A 1SNQA 2A69C 5IWAQ 1PH4A 2UUCL 3E0EA 2IL8A 4J1MA 5EAYA 4Y7NH 1HR0L 4C3JB 1XMOL 2MP1A 1N36L 1F2LA 1VQBA 3KK7A 2UUAQ 1K3RA 1SMYC 2CH4W 1NTGA 1XTDA 5H1SE 2V4DA 4C3HB 5C44B 3SXHA 1B70B 5EGTA 4IUPA 4TVAB 3VA7A 2IHFA 1V1PB 4LUOA 2F0EA 4RH6A 2ENBA 1Q82C 1EUJA 4B3MQ 3S1NB 4FXGC 3VR5A 4F7XA 2BE5C 2ZXOA 3D3RA 3TP6A 3S1MB 4LF7L 4KKTA 5IP9H 2D2CC 1JE5A 5CV6A 3G6EA 2CKZB 4C3JG 1F9SA 1H9JA 3TREA 2QKIC 3CRKC 2VUMH 4IOCA 1U5KA 4A3JH 1Q81C 2HHHL 2PPBC 3CQZH 3AQQA 1PDQA 5FJ8G 4C3HG 2EE1A 1Q1EA 4NXMQ 1PZKD 1VF7A 3URYA 4JI2L 2AQ1B 2PW7A 3UDFA 4DXFA 2KVMA 1KHIA 3NELA 3DWAA 3SR1A 4UAIA 1PTOH 2HQEA 3KBXA 3M4YA 1TWHH 1YHBA 4R4QA 5CBEE 2EPBA 3TS2A 1WTWA 1VQEA 1LO5D 1HTPA 4KI0A 2ZT9C 4GLVB 3AB9A 4XT1B 1PTOF 1LUZA 3OWFA 3RR5A 3QIAA 5IYDH 1VQNA 5D14A 3T51B 4GS3A 4KY7A 2YTXA 1U4PA 1T5EA 5ELEA 3D0FA 4O2DA 3W1BA 3NK9A 5A2QE 5G3LD 2A73B 5E4WC 3D4RA 1CZGA 2RSNA 2WKDA 4N8FA 4BA1I 1GUWA 1L1OC 4H02A 1PH5A 2JA9A 4Q5VA 1Y1VB 2EXDA 5FLXc 1MHWC 1SE3A 2EVBA 2O5JC 1EIHA 4P74A 4R9WA 2DGYA 1K73C 3MXUA 4K0KQ 2A19A 3HKSA 4ODGA 3NBHB 1J6QA 4ZYSA 1V9PA 5M5XB 4DR5Q 4JI0Q 2VS1A 4LAAA 3I7FA 2VY3A 2XRSD 1EYCA 2HUGA 2F0KA 3CCEA 4KN7C 5LMNL 4NXNQ 2XN9C 3I4MB 1M1KC 1IBML 4LF5Q 1ZYRC 2F0VA 3V96A 5I6YA 3J80i 1WD1A 3PCOB 1E1OA 5CMDA 1Y1VG 4H0LC 1IBKL 1EWIA 1QWYA 4F8MA 2R7DA 1KNEA 1GJXA 1I4HA 3PUWA 2ZTDA 1HTLD 1FNUA 3UDIA 3N6RA 3J81i 1HNZQ 4LFCQ 2UXDL 3S16H 1NMGA 3RLFA 1IW7C 4O0AA 3MTSA 5IY0A 1Q90A 1QUQA 2TMPA 1RF2D 2KEEA 5BN3A 1STEA 4C3JH 5M3FH 3I4MG 3H09A 1DOMA 1IYUA 2F0UA 3KLRA 3PUXA 2OWOA 1I94Q 4HEDA 1WTVA 5C44H 1Q7YC 3HOWB 1ZXTA 3H3VC 3MXGA 1C48A 4RCNA 4FF3A 3SHLA 2G9HD 1Q8KA 3KDFA 1C8CA 4IFDI 2R6GA 4L5SA 4LF6Q 1CKNB 1AH9A 3S1NH 3VR3A 4LF4Q 3E3XA 2K01A 3S1MH 1C4QA 3MVVA 1I6VC 2E75C 3F2CA 1LTRD 5AFWA 4BBSH 2F0WA 5C0XI 3DHQA 2XIWA 4IPGA 4CKEA 1YVCA 1VQ7A 3NHHA 3KFUA 1WTHA 5C3EB 3HOWG 4LWCA 5C4ZA 1FNVA 1HZ9A 4IPDA 3JAMc 3J7AV 2NTSA 2H4OA 2UUCQ 5D65A 4JBKA 3K5MA 1J5EL 1Q86C 1HR0Q 2AHOB 3KJPA 1XMOQ 2BOSA 4N9PA 1N36Q 1JWSD 3PO3B 2N8NA 2PYKA 3M4OB 1HNWL 3BZKA 1GUSA 4ZK9B 1CA5A 5C0XG 3H15A 3T13A 5IGBA 3FPUB 4LJZC 4ZQ3A 5C3EG 2RDFA 5KNDA 2AWOA 1L1OB 3CCQA 1IYVA 3I72A 3OPOA 4ZUJA 3K7AB 3H91A 3UDXA 1Y8PB 1LLRD 3K5OA 4LFBL 4C2MB 2HHHQ 1Y1VH 4DV4L 4EQOA 1A0IA 4O1NA 4RFBA 4XYQA 2AUKA 1TWCB 3A74A 2VB3X 4DV1L 5IGCA 5M5XH 1WJJA 5T1IA 3DEOA 4P75A 1LTBD 3VR2A 3P20A 4A93B 4GNXA 1PHJA 1ENFA 4GN4B 2YU9B 2R3ZA 2XVSA 3QWNA 1FGUA 3I4MH 1N34L 4L6TB 1QJOA 1CM9A 1OXSC 3A5ZB 3B6YA 4TKOB 2EYOA 4AYBB 1TWAB 1Z9FA 2BA1A 3BU2A 2F0PA 2ICIA 2MNAA 3BDCA 3J80L 3U4VA 5HY6A 4K6LA 3WOFA 5FO8B 1VS0A 2DUDA 1YNJD 4UDUC 3M7GA 3BYYB 5LL6S 4FNFA 3PIO3 1SDFA 3PF5A 1S5ED 2LXKA 1GHKA 5J39A 1YHQA 1EYAA 2NN6I 3HOYB 2K32A 4POGA 1SFOB 4A93G 1Y8OB 2E76C 4QIWB 3M4PA 1UE7A 4LK1C 1WFQA 2B2WC 2KA7A 1SNOA 3H3VI 3U50C 1O7YA 5JAVA 1IYJB 5KIXA 2QGQA 1JC7A 4AYBG 3TZDA 4Q0FA 4QL5A 3K7UC 4L5QA 3NQTA 3SK6A 3HOWH 1E2WA 1EY8A 5LMNQ 2CQAA 3X3NA 5FLMG 3CD6A 1GD7A 1O80A 2OEOA 3G48A 2YTVA 3HKZE 5EPLA 1IBMQ 1Y69U 3HOYG 2N88A 1WTXA 4PG3A 1X9NA 4MTKA 3GQBA 1LM0A 1IBKQ 1TT2A 4YWMA 4JI6Q 1PTOC 3CCVA 4DGZA 2K5DA 1PA6A 2IT1A 1N9WA 2RSOA 2WACA 4IJHA 3A0JA 1BDOA 5T1GA 3ULLA 2Q8RE 2UXDQ 5C3EH 1LT5D 1RODA 1FD7D 3RLOA 1PFNA 2Z6KA 3TP8A 1M90C 1IBLL 1TS3A 4JOIC 3W1GA 5IWAL 5IODA 3V2TA 4AH6A 3PO3H 1BCPD 1H9MA 1D1KA 3M4OH 3RLNA 2ZXPA 4ZKCB 5KRUA 1JT8A 1S5DD 2L12A 1SRUA 3S17H 3HS0C 3S15H 2UUAL 4OEMB 3NXWA 5EKLA 2XSCA 5IYBH 2JYOA 3C3LA 3MHBA 2F52A 2RVLA 1Z47A 1CFMA 5DNFA 1VMCA 1NUCA 3PIPA 1FJGL 2CCZA 3K7AH 5ELFA 5C4XB 1UUPA 1PRTD 4C2MH 3E5SA 1DYQA 1U4LA 5JJZA 2H5XA 5C4JB 4YCUA 5LMUQ 1KDCA 4MNOA 4KN4C 3BVGA 4K5VA 3K81C 3CF5A 1LT3D 1B3AA 5GROA 5D3DA 2JE6I 1PH6A 4WJ3M 4NMZA 4HTHA 1EU4A 3C1EA 1HNWQ 1G6ZA 4KD4A 4JCVE 2YU9H 3CPWA 1OXTA 1HHVA 4CDEC 5CV4A 1CHQD 3I55A 5C4XG 2J4XA 2K05A 4I65A 1A15A 1TWAH 1TY2A 5IT9L 1EQQA 4BBRB 4GZYC 5IGDA 4WFN3 2PI2E 1X56A 3QR8A 2GA4B 2Q8TA 1PXUA 3VA5A 1KIXA 4HIDA 1RTNA 1EEFD 2F0TA 3Q23A 1S5CD 3HOYH 1H9RA 5FLXE 2LFNA 3GTGB 2F3VA 1SFOH 1DOKA 3MFGA 3GTLH 1C9OA 1TWFB 3NWSA 1JE4A 2PI2A 1G291 3U58A 3I4LA 4A3EB 3QJYA 4X66L 4TRDA 4Z9CB 5ELCA 5EJWA 4DV1Q 3NWTA 4BBRG 4G57A 1N8RC 3VYUA 1VQ8A 3FPPA 1STNA 1EQRA 1SR3A 4RCOA 4DV0Q 1X54A 3RZOB 1L0XB 2OQKA 1CSQA 3CCLA 1PTOB 5GAEC 3PUVA 5C3WA 2CW0D 1N34Q 1VQGA 3VYTA 5M5WB 3HGBA 3EROA 1TWHB 3RN5A 3NBHA 3A8JE 1UNSA 2DNCA 3TDQA
chains in the Genus database with same CATH topology
4S3SA 3RD4A 2A68D 1R4PB 1BQQT 4J8QA 1AN8A 4H7BA 1DXMA 1QB5D 4WORA 5M3MB 3LWUA 2L55A 3CHBD 1VMPA 3U9SA 5M5YB 1U4MA 4C56C 1K8MA 4J6HA 2NVXB 3GV6A 5EKKA 2JA7B 4PMWA 3SE0A 1H9KA 4M1UB 3TZUA 3E0JA 2B2TC 3BVZA 4QB4A 5IOCA 2BCOA 5KNBA 1AFPA 2R7ZB 4NW2A 1GUNA 1BNZA 2KQ3A 5F2DA 1WTRA 3JAME 1LT4D 2B2UC 4JK1C 2L9HA 3DM1A 3VYRA 2L11A 2MPMA 5CBAE 5M3FB 4E6IA 5J22A 3L3OC 3DEPA 1AW7A 1HPCA 3FVQA 4R8NA 3NSWA 1KABA 2K5WA 4KHVA 4RKBA 3G6JB 3PUZA 5EPJA 4BS9A 4G7ZC 1F2ZA 2F0QA 1V8QA 4DXGA 4BBSB 2EY6A 3UI2A 3X3MA 1XWEA 2XWJB 3NTHA 4IALA 4F88A 1XTCD 3MAQA 1CZWA 1ESFA 4HSPA 5COYA 5C5MA 4OO1G 4JBWA 3F2UA 2JEAI 1CQFA 5C5LA 1R4QB 2XRQD 1LTAD 2FFKB 4RGNA 1A3UA 3OWEB 4PV1C 4DNTB 3VR6A 2WAQB 3BVMA 3HZXA 5EPKA 4A3DB 1SE2A 1YNJC 1K8OA 1NR2A 4HSVA 5EKIA 5BN4A 2H1EA 3EA6A 1SNDA 1GXDC 4OGQC 3L9AX 3W2DA 4DF7A 4PMCA 2HDLA 2WKCA 3A54A 3KLSX 4V190 3D8GA 3OSOA 1ET6A 4ZLTF 2EJFC 4A3GB 3FRPB 1Q8IA 2HCCA 2NZ1D 4M8AA 3R3OA 4XDXA 1Z7TA 4KD3A 4KY5A 3MXNA 2K33A 1VF5C 2F03A 5FK9C 1HUNA 2SDFA 3QB3A 3I4NB 2EYLA 1DD2A 1UEAB 5IGFA 3GP7A 1B9NA 4EGVA 4RHRA 4FO2A 3TBIB 1SYBA 3IFTA 1SJED 1SXTA 2EYHA 1BCPC 3PMFA 4FF4A 2A6HD 1NAPA 1SAPA 2JA5B 4CJ2C 1GHJA 4OO1H 2RA4A 3P7JA 1FYCA 2J7ZA 3BDOA 1E2VA 3PO2B 2KECA 1STAA 2R93B 3C46A 2B8GA 3M3YB 2I07B 5KYIA 1T5XD 1SE4A 4IFDJ 1A6XA 4EVOA 4FVMA 4N9TA 1SYGA 2A69D 3H0GB 1ONLA 3EVQA 2YYZA 1SNPA 5M9OA 3OMGA 3MC0B 4BY7B 4HCEA 4OHJA 2QILA 4O42A 3S17B 1DJRD 3S15B 3QG1A 1JICA 1BOSA 1H9SB 3P1HA 1EWCA 1VDZA 2OF1A 1CK1A 3I70A 5E4XA 2F0SA 2K7VA 1CQVA 3TMEA 3SEBA 1IL8A 1YNND 3QOJA 4PMBA 5DM73 4RKLA 3MZ5A 4DK1A 2BE5D 5NUCA 1JCKB 1L0YB 2Y0SB 2E74C 2EY5A 1SYFA 2EYFA 2M00A 1Q3LA 1CI3M 5C3XA 5CR3A 2F4IA 2EYJA 1D1IA 4TQUS 5CORA 5C6AA 1QILA 2CHBD 3R93A 2E2DC 2OT2A 1WTPA 4FXDA 3I8ZA 1X32A 4RHSA 2CW0C 2M2LA 2R61A 1S5FD 1TIID 2IJ0A 4KJNA 4A3BB 1TVXA 3J81L 3GTLB 3TP5A 1RD9D 1G8ZD 1TKWB 2PCFB 3SK4A 5I9OA 4DK0A 4IZ8A 1A3TA 1KDBA 2IX0A 1G91A 3I91A 1EQTA 2WV6D 1BCPB 1TWGB 1F9RA 1K83B 2BDNA 3RUZA 5FKAC 5JVH3 2SNSA 2DY7A 4ME5A 5EBDA 3K5NA 1STHA 2IWHA 5KGUA 3N52A 1CA6A 1ZYRD 2AQ3B 4G7HC 2O2LD 2RDHA 2WP8J 4RA8A 1EY0A 3S14B 4KV6A 2VNUD 3BZDB 1SNMA 5EBCA 1LTGD 3J80E 3L7ZC 4QUFA 2PZWA 4BA2I 1II3A 3Q0AA 3KF8A 2NVTB 5CV8A 3AU7A 4ABNA 2B2YA 3A56A 1J8IA 1JOKA 1F2MA 3K0YA 3PV0A 2G9DA 2NVQB 1BXTA 4NDXA 2BA0A 4QCLA 3ND8A 1X3PA 2HDMA 2QDBA 4ZRZA 5KEEA 1EIGA 4RGTA 5I9PA 5KNCA 1HA6A 2WIIB 3T53B 1ENAA 2C5CA 2NTTA 4IUNA 1I4QA 1V1PA 1STYA 1E2ZA 1M8AA 2L5TA 5D3IB 3CRLC 1JR0D 1JWUD 1O7LA 4IUTA 2DNEA 1HCZA 3S9WA 4HCSA 1RTOA 2RQXA 1F9QA 1U9RA 5TSSA 5JPMC 3FDTA 1I3QB 1GUTA 1E0BA 4IUQA 1U4RA 1RJTA 3RMHA 1EY9A 1Q1BA 2OXPA 1KLUD 3HOZB 2C9OA 3OIQA 1D6EC 2F0JA 5HGTA 1PZID 4HAEA 2D5DA 4QF4A 1EFID 3H94A 3VYSA 4DAPA 2D9UA 3ND9A 1EYDA 5I4DA 4X3UA 1MI2A 2PMZB 1TQOA 4RWSC 2DN8A 1FR3A 1JORA 1ET9A 4XQQA 4IN3A 3K57A 3HOUB 1WCMB 3DMUA 4MHEA 2F0GA 2B2VA 2O4XA 1I4GA 3W3AA 4G4KA 3NQIA 4QUCA 1BCPF 1HXYD 1DONA 3GTPB 1PFMA 4I7ZC 1GUGA 4OIJA 3GTMB 3BYTB 2B2TA 3KUPA 2JSOA 3Q24A 3ZYYX 1EQVA 1WD0A 2E2IB 2KOLA 3HRZC 5J1ZA 5ELDA 5IT9E 2B8FA 2L0CA 3HP3A 1ENCA 1JQYD 4NP5A 4X3KA 1EY6A 3RZDB 1PRTF 2TSSA 3GD7A 1EZ8A 5BN5A 3K6OA 4CJ0B 1ZKOA 5FOBB 1QE6A 2K1BA 3IL8A 5EQ0A 1EY4A 4CBVA 4MIUA 2A6ED 1TS2A 2RBMA 2VXWA 1WTOA 4IUVA 4DN4M 1CHPD 3K5LA 5K36G 1DZ1A 2E2JB 1TS4A 5DM63 4DNRB 2EJMA 3WDNA 2ZXRA 5E1FA 2NB0A 1PTOD 3QO2A 1A2TA 1W6JA 5I2XA 1JOQA 2Z1CA 2EYMA 1OXVA 1KAAA 3MXPA 1R9TB 1A2UA 2JP1A 2EY2A 2PNRC 3HKZB 2JEBI 4HMJA 5I6WA 1MSGA 1RKNA 3OMCA 2D62A 4KKSA 1B2TA 2EXZA 1B50A 4U68A 2B63B 3NUCA 2EYPA 4PQXA 2K5QA 3HEJA 3MFYA 1Y1WB 4A3FB 1ESRA 2IPKD 1RDPD 4OO1I 1QNUA 5JPNC 1EZ6A 1O7ZA 5A2QL 1H9SA 1KTKA 3TN2A 1HQMC 2AUJD 1ZEQX 1WVLA 1AZQA 3T4AC 5CGKA 1YNNC 1KLGD 3I3CA 3FEWX 1SBBB 2Q8IB 1BO0A 2EOTA 1OXUA 5ISRA 3QOLA 1V43A 4OIKA 2Z4IA 1LTSD 2L4NA 3GV3A 3C2PA 1PMRA 2F3WA 3NTKA 3OOCA 3R8BA 4KHZA 3CU7A 4K14A 3H6MA 1PLFA 5CV9A 3S1RB 3D31A 3C1FA 4FP5D 2FMMA 3I90A 1EU3A 5K36H 1HFNA 1LABA 4IUUA 4U673 1HA5A 1QNKA 4A3KB 3EQLC 3HG9A 1D5MC 4V0BA 1UAPA 2F0DA 4K5WA 1FNWA 1STBA 5JEAJ 2MUYA 5LL6X 4F87A 1NCVA 1LTID 4L8JA 2PQEA 3PIP3 5A35A 4HMIA 1MSHA 2F0IA 1S5BD 2EY1A 3T16A 4DU9A 3NP8A 2KHSA 5JEAG 2VB2X 4IQZA 1F2YA 2FJ2A 4A3MB 2B39A 4OL7A 3GTJB 3BG3A 4H13C 3GTQB 3J7YW 1KNAA 1A3VA 5FO7B 4KK7A 4ZAIA 1HQRD 1FGBD 1WTQA 1B1ZA 2XWBB 4DA2A 4B9XA 5DAUA 1SYDA 5HURA 4K2LA 1JWMD 5C4HA 2O5IC 3ERQA 1STGA 5FO9B 4FXKC 3OHXC 3D6WA 1S4ZA 5IGEA 1AZPA 2QF7A 4DAYA 1F9PA 5CC4A 1TR5A 2FMCA 1DM0B 2J0TD 5IIFA 3S2HB 5G3LF 1PRTC 4K8IA 3IFDA 3DWQA 2MHVA 5C0XJ 2KEDA 3P75A 2K28A 5CV7A 1IHZA 4H44C 3A7LA 2Z8LA 1SMYD 2MGSA 2MJ8A 4XIGS 5CV5A 2EZVA 2I46A 2JXMB 3HOXB 3BDLA 3A8KE 4IFDG 4C3IB 3Q6SA 2RDGA 2F0HA 4RAUC 5LHY1 4RGOS 2QEJC 3GTKB 5JVG3 2EDGA 3NBIA 5JEAH 1TS5A 2NVYB 2B2WA 1G2TA 1B9MA 2KCNA 4DAVA 3MA2B 3ONAB 4KY6A 2F0OA 2X6GA 4XT3B 2WINB 3KBGA 4C3IG 1BF4A 1PZJD 3FMCA 4DFAA 2KCCA 2PW5A 1BBXC 4X3SA 2X6LA 2CVRA 2LS01 1QOHA 2PZTA 1QG7A 3R2IA 1KDAA 3KLSA 3FKIB 3O13A 5ELBA 3MWYW 5KYLA 2JA8B 2R92B 4FF1A 3S2DB 2E2HB 2LKVA 2A68C 2A74C 1Q12A 4HN7A 4C1NI 3AMUA 4IURA 1B4OA 1PYWD 3TSSA 1MD2D 4XQJA 4CGYB 2DY8A 3TP7A 4ULLA 2K6AA 1HFGA 1OXXK 2NBFA 3D6CA 2KUMA 2ICEC 1OO9B 2IX3A 2A6EC 3K58A 4ZUIA 2A5HA 3DWPA 2F0FA 4BWGB 1AP0A 1PRTB 3DXJC 4TSSA 3K59A 4IFDH 2NN6G 1HRJA 3J7AF 3D4DA 1IW7D 3A7AB 5C0XH 3G7LA 2JA6B 1NSNS 1AEXA 1CTMA 4WJWA 1SNCA 3A55A 4C1NK 3V05A 1EOTA 3J81E 1SSOA 3T56B 4YIJA 1MGSA 3A8IE 3SK8A 5E3FA 1X3QA 3S1QB 1ILQA 4L63B 2IX1A 1W6KA 1Z6HA 4RGMA 3HOVB 1MBYA 5FLXL 1ICWA 1XYIA 3SDZA 1EY5A 1PFBA 3M7NA 4K2KA 4NKLA 2K03A 3OIPA 1ILPA 4WRDA 3MEHA 1I4XA 4QMGA 2RKSA 3ITPA 4A3IB 1XXGA 2WB1B 4BY1B 4X3TA 3PUYA 3Q22A 3I73A 4KKUA 4B9WA 5DEHA 4B08A 2FHTA 1D5ZC 2PO4A 3GTOB 1LACA 1LV9A 2F0MA 4FF2A 2QCPX 2EJGC 3SK5A 1I6HB 4EQPA 5CYUA 1Y8NB 4KJOA 4Y7NB 4LMQD 2B2YC 4XQNA 2NUCA 2XNAC 2PZUA 3E6ZX 3CKIB 5I2YA 3LNNA 2Z4HA 4K8JA 3VR4A 5IGGA 1GUOA 1I50B 4HR7B 2K04A 3U9OA 2N55A 2M9VA 3DUZA 1D2BA 1SYEA 1JOOA 3EJIA 3BS1A 1G2SA 4XXEA 2IW3A 4CHTB 2NN6H 3IKJA 2HCIA 4K6DA 1JB3A 2L1BA 1IKMA 1RHPA 1D5XC 2F0LA 2VUMB 4A3JB 1V1OA 3CQZB 1LTTD 1IKLA 4ID6A 1BR9A 5JOBA 2F0NA 2KJXA 4MN3A 1VCIA 2X69A 1TY0A 4ILWA 2ID0A 3JAML 1EWHA 3NTIA 1ML0D 1NR4A 2B2UA 1I4PA 3M85A 3LWEA 1SJHD 2BDOA 3IAYA 1EL0A 4CKCA 1QCBD 4G7OC 4ZKBB 2SOBA 1EY7A 3GO5A 1HUMA 2AQ2B 1I4RA 1SYCA 1RCVD 2NWGA 1LT6D 2NYZD 3D4WA 4K5XA 4P2CB 4FYDA 1TU2B 2F1MA 1CT1D 4CJ1B 2SNMA 1XX8A 2FINB 1M4VA 1F77A 1DCZA 1BUVT 2B2VC 3NE5B 1B53A 2LMCB 1EEID 1B44D 3WOEA 1J9OA 2AWNA 1SEBD 4CKBA 2A6HC 5K5PA 4R8IA 1O78A 1GOZA 4KMUC 4KTAA 3EFXD 3LX0A 3R2TA 3SVMA 1DOLA 3NPPA 4XYOA 4XTCS 2SEBD 4EQNA 3OW7A 3S16B 2LY7A 4PNYA 1SNQA 2A69C 2IL8A 4J1MA 4C3JB 2MP1A 1F2LA 3KK7A 1SMYC 2V4DA 4C3HB 5C44B 3SXHA 5EGTA 4IUPA 3VA7A 1V1PB 2F0EA 4RH6A 2ENBA 3S1NB 4FXGC 3VR5A 4F7XA 2BE5C 2ZXOA 3D3RA 3TP6A 3S1MB 4KKTA 2D2CC 5CV6A 4C3JG 1F9SA 1H9JA 2QKIC 3CRKC 2PPBC 1PDQA 4C3HG 2EE1A 1Q1EA 1PZKD 1VF7A 3URYA 2AQ1B 2PW7A 4DXFA 2KVMA 3DWAA 3SR1A 4UAIA 1PTOH 2HQEA 3KBXA 3M4YA 5CBEE 2EPBA 1WTWA 1LO5D 1HTPA 4KI0A 2ZT9C 3AB9A 4XT1B 1PTOF 3OWFA 3QIAA 5D14A 3T51B 4KY7A 1U4PA 1T5EA 5ELEA 3NK9A 5A2QE 5G3LD 2A73B 5E4WC 3D4RA 1CZGA 2RSNA 2WKDA 4BA1I 1GUWA 4Q5VA 1Y1VB 2EVBA 1SE3A 2O5JC 1EIHA 4R9WA 3MXUA 4ODGA 4ZYSA 5M5XB 4LAAA 2XRSD 1EYCA 2HUGA 2F0KA 4KN7C 2XN9C 3I4MB 1ZYRC 2F0VA 3V96A 5I6YA 1WD1A 5CMDA 4H0LC 1QWYA 4F8MA 1KNEA 1GJXA 1I4HA 3PUWA 1HTLD 1FNUA 3N6RA 3RLFA 1IW7C 3MTSA 1Q90A 2TMPA 1RF2D 2KEEA 5BN3A 1STEA 3H09A 1DOMA 1IYUA 2F0UA 3KLRA 3PUXA 4HEDA 1WTVA 3HOWB 1ZXTA 3H3VC 3MXGA 1C48A 4RCNA 4FF3A 3SHLA 2G9HD 1C8CA 4IFDI 2R6GA 3VR3A 2K01A 1C4QA 3MVVA 1I6VC 2E75C 1LTRD 5AFWA 2F0WA 5C0XI 3DHQA 2XIWA 4CKEA 3NHHA 5C3EB 5C4ZA 1FNVA 3J7AV 2NTSA 2H4OA 5D65A 3K5MA 2BOSA 4N9PA 1JWSD 3PO3B 2PYKA 3M4OB 1GUSA 4ZK9B 1CA5A 5C0XG 3T13A 5IGBA 3FPUB 4LJZC 4ZQ3A 2RDFA 5KNDA 2AWOA 1IYVA 3I72A 3OPOA 4ZUJA 3K7AB 3H91A 1Y8PB 1LLRD 3K5OA 4C2MB 4EQOA 4O1NA 4RFBA 4XYQA 2AUKA 1TWCB 2VB3X 5IGCA 5T1IA 3DEOA 1LTBD 3VR2A 3P20A 4A93B 1ENFA 2YU9B 2R3ZA 2XVSA 3QWNA 4L6TB 1QJOA 1CM9A 1OXSC 4TKOB 2EYOA 4AYBB 1TWAB 2BA1A 2F0PA 2ICIA 3BDCA 3J80L 4K6LA 3WOFA 5FO8B 4UDUC 1YNJD 3M7GA 3BYYB 5LL6S 4FNFA 3PIO3 1SDFA 1S5ED 1GHKA 5J39A 1EYAA 2NN6I 3HOYB 2K32A 1SFOB 1Y8OB 2E76C 4QIWB 4LK1C 2B2WC 2KA7A 1SNOA 1O7YA 5JAVA 5KIXA 1JC7A 3TZDA 4Q0FA 3NQTA 3SK6A 1E2WA 1EY8A 2CQAA 3X3NA 1O80A 2OEOA 5EPLA 1Y69U 2N88A 1WTXA 3GQBA 1TT2A 1PTOC 4DGZA 2K5DA 2IT1A 2RSOA 2WACA 1BDOA 5T1GA 2Q8RE 1LT5D 1RODA 1FD7D 1PFNA 3TP8A 1TS3A 5IODA 3V2TA 1BCPD 1H9MA 1D1KA 2ZXPA 4ZKCB 5KRUA 1S5DD 2L12A 3HS0C 3NXWA 5EKLA 2XSCA 2JYOA 3C3LA 3MHBA 2RVLA 1Z47A 1CFMA 5DNFA 1VMCA 1NUCA 5ELFA 5C4XB 1UUPA 1PRTD 3E5SA 1DYQA 1U4LA 5JJZA 5C4JB 1KDCA 4KN4C 3BVGA 4K5VA 1LT3D 1B3AA 5D3DA 2JE6I 4NMZA 4HTHA 1EU4A 3C1EA 1G6ZA 4KD4A 1OXTA 1HHVA 5CV4A 1CHQD 2J4XA 2K05A 4I65A 1A15A 1TY2A 5IT9L 4BBRB 4GZYC 5IGDA 4WFN3 2GA4B 2Q8TA 1PXUA 3VA5A 1RTNA 1EEFD 2F0TA 3Q23A 1S5CD 1H9RA 5FLXE 2LFNA 3GTGB 2F3VA 1DOKA 3MFGA 1TWFB 3NWSA 1JE4A 1G291 3I4LA 4A3EB 3QJYA 4TRDA 4Z9CB 5ELCA 5EJWA 3NWTA 4G57A 3VYUA 3FPPA 1STNA 4RCOA 3RZOB 1L0XB 1PTOB 3PUVA 5C3WA 2CW0D 3VYTA 5M5WB 3HGBA 3EROA 1TWHB 3NBHA 3A8JE 1UNSA 2DNCA 3TDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHZ A;  1F2Z A;  1RKN A;  4S3S A;  1SNM A;  4EQP A;  2HQE A;  2F0Q A;  3DMU A;  3R3O A;  3OMC A;  3D6C A;  2EYO A;  3SHL A;  4KD3 A;  1NUC A;  4KJO A;  2F0G A;  2PQE A;  2EY6 A;  2F0P A;  4KY5 A;  5CV5 A;  4HMI A;  2PZW A;  3BDC A;  2EY5 A;  1II3 A;  2F0I A;  2O4X A;  3BDL A;  1SYF A;  2EYF A;  4ZUI A;  5K5P A;  2NUC A;  2EXZ A;  2EY1 A;  3E5S A;  2M00 A;  5CV8 A;  3T16 A;  2PZU A;  2F0F A;  3MVV A;  3NUC A;  3OWF A;  4DU9 A;  2EYP A;  5J39 A;  3NP8 A;  3QB3 A;  4KTA A;  1EYA A;  4K8J A;  1KDC A;  5C3X A;  2F0W A;  4H7B A;  4IAL A;  1JOK A;  2EYL A;  3DHQ A;  3HEJ A;  2KHS A;  5CR3 A;  3LX0 A;  1F2M A;  4WOR A;  5IGG A;  5IGF A;  2F0H A;  2EYJ A;  4K5V A;  4KY7 A;  3U9O A;  3NHH A;  5C6A A;  3NK9 A;  1F2Y A;  1SNO A;  1SYB A;  4NDX A;  3D4D A;  4OL7 A;  1EZ6 A;  2QDB A;  2EYH A;  1SYE A;  4NMZ A;  5C4Z A;  5JAV A;  4HTH A;  5KEE A;  5KIX A;  1JOO A;  5C5M A;  3EJI A;  5I9P A;  3C1E A;  4KD4 A;  3PMF A;  1EQV A;  3SR1 A;  5C5L A;  1ENA A;  4EQN A;  4J6H A;  4K6D A;  4KY6 A;  1NSN S;  1AEX A;  3NQT A;  4IUN A;  4PNY A;  5CV4 A;  1SNQ A;  4N9P A;  2F0O A;  5EKK A;  1EY8 A;  5J1Z A;  5CGK A;  1SNC A;  1ENC A;  2F0L A;  2PYK A;  1A3V A;  4I65 A;  4NP5 A;  1STY A;  1EY6 A;  4ODG A;  5IGD A;  4J1M A;  4KJN A;  2OEO A;  4ID6 A;  4QB4 A;  5IOC A;  1EZ8 A;  4LAA A;  4B9X A;  5JOB A;  3TP5 A;  1STA A;  2F0N A;  1A3U A;  3VA5 A;  1EYC A;  4YIJ A;  2F0K A;  3QOL A;  4DFA A;  5ISR A;  3S9W A;  2PW5 A;  3T13 A;  5IGB A;  3SK8 A;  5E3F A;  2KQ3 A;  3SK4 A;  5F2D A;  5I9O A;  5KYI A;  1TT2 A;  2F0T A;  5DAU A;  4ZQ3 A;  1EY4 A;  1SYD A;  1A3T A;  1KDB A;  4IZ8 A;  3HZX A;  1U9R A;  4MIU A;  4DGZ A;  5HUR A;  3SXH A;  5EGT A;  4EVO A;  2PZT A;  2F3V A;  2F0V A;  2RDF A;  4K2L A;  4N9T A;  5I6Y A;  1SYG A;  2RBM A;  2F3W A;  5C4H A;  2WAC A;  3EVQ A;  3ERQ A;  1SNP A;  1KDA A;  3RUZ A;  4K14 A;  1STG A;  5M9O A;  1EY5 A;  2F0E A;  3OMG A;  4F8M A;  3H6M A;  4ZUJ A;  2ENB A;  2SNS A;  1EY9 A;  4K2K A;  4NKL A;  4F7X A;  2OXP A;  5CV9 A;  4TRD A;  3TP8 A;  3TP6 A;  5KYL A;  4ME5 A;  3MEH A;  4G57 A;  4WRD A;  2F0J A;  5IGE A;  4E6I A;  5HGT A;  3C1F A;  5CV6 A;  4EQO A;  2LKV A;  5E1F A;  2SOB A;  2RKS A;  4QMG A;  1STN A;  1EY7 A;  3ITP A;  3SK5 A;  3V2T A;  1SND A;  1TR5 A;  3P1H A;  4QF4 A;  5CC4 A;  5J22 A;  2OF1 A;  1STH A;  1A2T A;  5KGU A;  4DF7 A;  4PMC A;  4R8N A;  5KRU A;  5IGC A;  1SYC A;  4B9W A;  1JOQ A;  2F0S A;  5IIF A;  1EYD A;  3TME A;  4K5W A;  1KAB A;  2EYM A;  2F0D A;  3D4W A;  4K5X A;  5C3W A;  1STB A;  1KAA A;  5DEH A;  3MXP A;  3D8G A;  3OSO A;  5IOD A;  3QOJ A;  1A2U A;  4K8I A;  2EY2 A;  3ERO A;  4KHV A;  4PMB A;  3NXW A;  2F0U A;  4RKL A;  4RKB A;  5EKL A;  3SK6 A;  1TQO A;  3MZ5 A;  2PW7 A;  1JOR A;  1EY0 A;  2SNM A;  5NUC A;  4KV6 A;  2F0M A;  3P75 A;  4HMJ A;  5I6W A;  5CV7 A;  3MHB A;  3TP7 A; 
#chains in the Genus database with same CATH topology
 4S3S A;  4A3E G;  3RD4 A;  3CP0 A;  2BH8 A;  1Y14 B;  2A68 D;  3ICE A;  1G51 A;  4LUV A;  4JI5 Q;  1R4P B;  3I4O A;  1BQQ T;  4J8Q A;  1AN8 A;  2YV5 A;  4H7B A;  1DXM A;  1QB5 D;  4MZ9 A;  4WOR A;  5M3M B;  3LWU A;  2L55 A;  2K4K A;  3CHB D;  1VMP A;  3U9S A;  1YIT A;  5M5Y B;  3CXC A;  1PYS B;  1U4M A;  4DR1 Q;  1SLJ A;  1C0A A;  4C56 C;  1VQF A;  1K8M A;  4J6H A;  2NVX B;  3GV6 A;  5EKK A;  2JA7 B;  4PMW A;  1UWV A;  3SE0 A;  1H9K A;  2K50 A;  1NY4 A;  4M1U B;  3TZU A;  3E0J A;  4UPA A;  2B2T C;  3BVZ A;  1HNX Q;  1YJN A;  1UE6 A;  4QB4 A;  5IOC A;  2BCO A;  5KNB A;  1XNQ Q;  2R7Z B;  1AFP A;  5C4X H;  5M3M G;  4NW2 A;  1GUN A;  1BNZ A;  2KQ3 A;  5F2D A;  1WTR A;  3JAM E;  5C4J H;  1LT4 D;  2B2U C;  3KF8 B;  1CKN A;  4JK1 C;  2L9H A;  3DM1 A;  4BXX G;  3VYR A;  1X65 A;  2E8G A;  2L11 A;  2MPM A;  4L5T A;  2JA7 G;  4X64 Q;  2EIF A;  1V1Q A;  5CBA E;  4B3R L;  3L0O A;  4PZ7 A;  5M3F B;  3TRZ A;  4E6I A;  4ME3 A;  3HFZ B;  5J22 A;  3L3O C;  1T9H A;  3DEP A;  2R7Z G;  1AW7 A;  1HPC A;  1BBW A;  3FVQ A;  1HZA A;  4R8N A;  4BBR H;  3NSW A;  1KAB A;  5JJL A;  2K5W A;  4N8X 1;  4EQ5 A;  1PH9 A;  4EX5 A;  4KHV A;  4RKB A;  4DR3 L;  3F1Z A;  1W3S A;  3G6J B;  1FJG Q;  3PUZ A;  3CMA A;  5EPJ A;  4BS9 A;  4G7Z C;  1F2Z A;  3GTG H;  2F0Q A;  4LF8 L;  4JI1 L;  1V8Q A;  1EFW A;  5M3F G;  4DXG A;  4BBS B;  1TWF H;  2EY6 A;  3UI2 A;  1WOC A;  3X3M A;  1NJI C;  1GVP A;  4DR4 L;  4A3E H;  1XWE A;  1HH2 P;  2WFW A;  3HOU H;  2XWJ B;  3NTH A;  5C44 G;  4IAL A;  2ES2 A;  4F88 A;  1A63 A;  2HIX A;  1XTC D;  3RZO H;  3MAQ A;  4DAM A;  1CZW A;  3I2Z A;  1ESF A;  4HSP A;  5COY A;  1MJC A;  5M5W H;  5C5M A;  4OO1 G;  4JBW A;  3F2U A;  4AYB E;  2JEA I;  4LUZ A;  1CQF A;  4BBS G;  5C5L A;  1R4Q B;  2XRQ D;  1MKH A;  3GTM H;  3TQY A;  1LTA D;  3WWV A;  2FFK B;  4RGN A;  4JBM A;  3E9H A;  2OQ0 A;  4DK6 C;  1A3U A;  4QIW E;  3STB C;  3OWE B;  4PV1 C;  4DNT B;  1LTL A;  3VR6 A;  2WAQ B;  3BVM A;  3TEH B;  5E7N A;  3HZX A;  5EPK A;  4GKJ L;  4A3D B;  4X66 Q;  1SE2 A;  5M3M H;  1YNJ C;  1K8O A;  1X3G A;  1NR2 A;  3E9I A;  4HSV A;  5M5Y H;  4X6A H;  5EKI A;  5DLQ E;  5BN4 A;  4BXX H;  1NMF A;  2H1E A;  2QA4 A;  3I56 A;  1XMQ L;  1HNZ L;  3EA6 A;  4AQY Q;  1O7I A;  2NVX H;  2JA7 H;  1SND A;  1GXD C;  4OGQ C;  3L9A X;  3W2D A;  1IL2 A;  1PVO A;  4DF7 A;  4PMC A;  2HDL A;  2WAQ G;  2WKC A;  1JJ2 A;  4A75 A;  2Q2U A;  3A54 A;  3KLS X;  4V19 0;  4J15 A;  3D8G A;  3OSO A;  4A3D G;  2R7Z H;  1KC8 C;  1ET6 A;  4ZLT F;  3CCR A;  1AE3 A;  4JI6 L;  4QJF A;  2EJF C;  2RCN A;  4A3G B;  3FRP B;  1Q8I A;  2HCC A;  1SMX A;  2NZ1 D;  4M8A A;  1FL0 A;  3R3O A;  1VQ4 A;  4XDX A;  1Z7T A;  4KD3 A;  1E24 A;  4KY5 A;  2Z6B A;  3MXN A;  3UE1 A;  2K33 A;  1VF5 C;  2F03 A;  5FK9 C;  5IT9 c;  1HUN A;  4GKK L;  1HZB A;  2SDF A;  3QB3 A;  3I4N B;  1GM5 A;  2EYL A;  2GN5 A;  1UEA B;  5IGF A;  1DD2 A;  4A3C G;  3GP7 A;  1B9N A;  4X62 L;  4JVZ A;  4EGV A;  4RHR A;  4FO2 A;  3TBI B;  1SYB A;  3IFT A;  2VL6 A;  1SJE D;  1SXT A;  2EYH A;  4CDF C;  4YWL A;  1BCP C;  3PMF A;  4FF4 A;  2A6H D;  2WB1 E;  1NAP A;  1SAP A;  1IZ6 A;  2VW9 A;  2JA5 B;  4CJ2 C;  4B3T L;  3TS0 A;  1GHJ A;  2IY5 B;  4OO1 H;  2RA4 A;  2Z9H A;  1FYC A;  3P7J A;  3PF4 A;  1K0S A;  2J7Z A;  2UU9 Q;  4DR2 Q;  3BDO A;  1PH2 A;  1KAW A;  1E2V A;  1K8G A;  3PO2 B;  1E3P A;  2KEC A;  3I4N G;  1B3Q A;  1STA A;  2R93 B;  3C46 A;  1I5F A;  1N33 L;  2B8G A;  5LMU L;  3M3Y B;  2I07 B;  5KYI A;  1T5X D;  1SE4 A;  4IFD J;  1A6X A;  4EVO A;  4FVM A;  4B3R Q;  4N9T A;  1SYG A;  2A69 D;  3H0G B;  1ONL A;  3EVQ A;  2YYZ A;  1SNP A;  1UEB A;  5M9O A;  3OMG A;  2JA5 G;  3MC0 B;  4BY7 B;  3F8T A;  4HCE A;  4OHJ A;  3AYH B;  2CQO A;  2QIL A;  4O42 A;  4OWX B;  3FHW A;  4PZ6 A;  3J7Z C;  1DJR D;  3S17 B;  4DNI A;  3QG1 A;  3S15 B;  1JIC A;  1BOS A;  2ZTE A;  1H9S B;  3P1H A;  1EWC A;  2OF1 A;  1VDZ A;  1CK1 A;  1EIY B;  2R93 G;  2HD3 A;  4DR3 Q;  3I70 A;  5E4X A;  1X55 A;  2F0S A;  2K7V A;  1CQV A;  4JI3 L;  3TME A;  3SEB A;  1IL8 A;  1YNN D;  3QOJ A;  4PMB A;  4LF8 Q;  5DM7 3;  4JI1 Q;  4RKL A;  2D0P A;  4QGU A;  4DV7 L;  3H0G G;  3MZ5 A;  4DK1 A;  1VQM A;  2BE5 D;  2A8V A;  4I7A A;  5NUC A;  4YY3 L;  3PO3 G;  4BY7 G;  4DR4 Q;  4A3D H;  4A3K H;  1JCK B;  1WYD A;  1VQO A;  3GDE A;  1L0Y B;  2Y0S B;  2E74 C;  2EY5 A;  2ZM6 Q;  1SYF A;  2EYF A;  3ERS X;  2M00 A;  5IE8 A;  5IYB G;  1Q3L A;  1CI3 M;  4R1J A;  5C3X A;  5CR3 A;  2D0O A;  2F4I A;  3VDY A;  3KOJ A;  4DV0 L;  2EYJ A;  1D1I A;  2KCM A;  4IPC A;  4TQU S;  5COR A;  5C6A A;  3EBE A;  1QIL A;  2CHB D;  2CWP A;  1E7Z A;  3BZC A;  3R93 A;  2E2D C;  2OT2 A;  1WTP A;  4A3C H;  4FXD A;  3I8Z A;  3AFQ A;  4A3G H;  2Y0S G;  4R4T A;  1X32 A;  4RHS A;  2XTI A;  2CW0 C;  2M2L A;  2R61 A;  1S5F D;  1TII D;  4JI5 L;  3M9B A;  2IJ0 A;  4KJN A;  4A3B B;  1TVX A;  3J81 L;  4GKJ Q;  3GTL B;  3TP5 A;  1RD9 D;  1G8Z D;  3GTQ H;  1TKW B;  2PCF B;  3SK4 A;  5I9O A;  2DJF C;  4DK0 A;  3OTO Q;  3A5U A;  4IZ8 A;  1A3T A;  1KDB A;  2IX0 A;  3I4N H;  1G91 A;  3I91 A;  1EQT A;  2WV6 D;  1BCP B;  1TWG B;  1F9R A;  1K83 B;  2BDN A;  1XMQ Q;  4Y52 H;  3RUZ A;  2F4V L;  5FKA C;  1U0L A;  1D7Q A;  5JVH 3;  4DR1 L;  1GKH A;  4ZCK A;  2SNS A;  1PYB A;  1BVS A;  4RMF A;  2DY7 A;  4ME5 A;  4A3B G;  1JMC A;  2JA5 H;  4UP9 A;  5EBD A;  2OCE A;  3K5N A;  3F2D A;  1STH A;  2IWH A;  5KGU A;  3N52 A;  1CA6 A;  1ZYR D;  1HNX L;  2AQ3 B;  3JAM i;  3PO2 H;  1XNQ L;  4G7H C;  4OEL B;  2P5Z X;  2O2L D;  4HJ8 A;  2PQA B;  2R93 H;  2RDH A;  4DV2 Q;  2WP8 J;  4RA8 A;  3M3Y H;  1EY0 A;  3S14 B;  4KV6 A;  2VNU D;  3BZD B;  1SNM A;  5EBC A;  1LTG D;  4P72 A;  2PNH A;  3H0G H;  3J80 E;  3L7Z C;  3CW2 C;  4QUF A;  4GKK Q;  1QUQ B;  4X64 L;  2PZW A;  4BY7 H;  4BA2 I;  1X3E A;  1II3 A;  3Q0A A;  1BBU A;  4X62 Q;  3KF8 A;  2AMC B;  2NVT B;  5CV8 A;  1SRO A;  3AU7 A;  2B2Y A;  4ABN A;  3A56 A;  1IXR A;  2GVB A;  1J8I A;  1EYG A;  1JOK A;  2NZO A;  5AJ3 L;  1F2M A;  3K0Y A;  3PV0 A;  4POF A;  2G9D A;  2NVQ B;  1BXT A;  4DAY B;  4NDX A;  2BA0 A;  4QCL A;  3ND8 A;  4B3T Q;  1X3P A;  3KDF B;  2HDM A;  2QDB A;  4ZRZ A;  5GAG C;  5KEE A;  1EIG A;  4RGT A;  5I9P A;  5KNC A;  1HA6 A;  2WII B;  3T53 B;  1PH7 A;  1ENA A;  3T1Y L;  4ALP A;  2C5C A;  2NTT A;  2BH2 A;  1RIP A;  4IUN A;  4R4O A;  4LNQ A;  1I4Q A;  1B7Y B;  1V1P A;  3GTK H;  4A3L G;  1N33 Q;  1STY A;  1E2Z A;  1M8A A;  2L5T A;  5D3I B;  2K52 A;  3CRL C;  1JR0 D;  1QZG A;  4IPH A;  1JWU D;  2OTL A;  1O7L A;  4IUT A;  4GN5 A;  2DNE A;  1HCZ A;  2QDL A;  3S9W A;  4HCS A;  1RTO A;  2RQX A;  3LGJ A;  4A4I A;  1CKM A;  2Q2T A;  1F9Q A;  4GLA C;  1U9R A;  5TSS A;  5JPM C;  4JC0 A;  3FDT A;  1I3Q B;  1GUT A;  2MO0 A;  1QZH A;  1E0B A;  4IUQ A;  1U4R A;  4DV6 L;  1K3B C;  4DR7 L;  1RL2 A;  1RJT A;  3RMH A;  1EY9 A;  1Q1B A;  2OXP A;  1KLU D;  1YBY A;  3HOZ B;  2C9O A;  3OIQ A;  1D6E C;  2F0J A;  5HGT A;  1NNX A;  1PZI D;  4HAE A;  4JI3 Q;  2EQS A;  2D5D A;  2VZA A;  2CH4 A;  1PH1 A;  4QF4 A;  1EFI D;  3NEN A;  3H94 A;  2Z0S A;  3VYS A;  4DAP A;  4DV7 Q;  2WAQ E;  2D9U A;  3ND9 A;  3ZJY C;  3CC7 A;  4A3B H;  4OWT B;  4YY3 Q;  1EYD A;  2JA8 H;  5I4D A;  4X3U A;  1E22 A;  1MI2 A;  2PMZ B;  1TQO A;  1S3O A;  2DN8 A;  1FR3 A;  4RWS C;  1JOR A;  3KJO A;  1ET9 A;  4XQQ A;  2HIV A;  4IN3 A;  3K57 A;  3HOU B;  1WCM B;  3DMU A;  3K8A A;  5ELO A;  2QEX A;  4DV3 Q;  1TWG H;  3HOZ G;  3CME A;  2Q2I A;  1K83 H;  4MHE A;  2F0G A;  2B2V A;  2O4X A;  1I4G A;  4AQY L;  2I5H A;  3W3A A;  4G4K A;  3NQI A;  5BR8 Q;  4P73 A;  4QUC A;  1BCP F;  1L0W A;  4GNX B;  1HXY D;  2UUB L;  1DON A;  3GTP B;  1PFM A;  4I7Z C;  1KRT A;  1GUG A;  3CCM A;  4OIJ A;  3GTM B;  3BYT B;  2KEN A;  2B2T A;  3KUP A;  4B3S L;  2JSO A;  3HOU G;  1WCM G;  3Q24 A;  1VQD A;  1VQH A;  3ZYY X;  1EQV A;  4X65 Q;  3S14 H;  1WD0 A;  3PSI A;  2E2I B;  3CCU A;  2KOL A;  3HRZ C;  5J1Z A;  2KHJ A;  5ELD A;  5IT9 E;  2B8F A;  2L0C A;  3HP3 A;  1ENC A;  1JQY D;  4NP5 A;  4X3K A;  1EY6 A;  4AIM A;  3RZD B;  1PRT F;  3J7A 5;  2TSS A;  3GD7 A;  1EZ8 A;  3BJU A;  5BN5 A;  3K6O A;  4CJ0 B;  1VQ5 A;  1ZKO A;  3FP9 A;  4A3L H;  2NVT H;  5FOB B;  1QE6 A;  2K1B A;  3IL8 A;  2F4V Q;  5EQ0 A;  1EY4 A;  4CBV A;  4MIU A;  2A6E D;  1TS2 A;  1PH8 A;  2RBM A;  2NVQ H;  2VXW A;  1WTO A;  4IUV A;  4DN4 M;  4L5R C;  1CHP D;  3KLW A;  3K5L A;  4CDC C;  5K36 G;  1DZ1 A;  2E2J B;  1TS4 A;  5DM6 3;  4DNR B;  1QVG A;  2MQH A;  2EJM A;  3WDN A;  2ZXR A;  4JI8 L;  5E1F A;  2NB0 A;  3UE0 A;  1PTO D;  3QO2 A;  4DR2 L;  2UU9 L;  1A2T A;  1W6J A;  5I2X A;  2RHQ B;  1JOQ A;  2XGT A;  2Z1C A;  2EYM A;  1OXV A;  1VQK A;  1KAA A;  3MXP A;  1R9T B;  1A2U A;  2JP1 A;  2EY2 A;  4FDB A;  3OW2 A;  1VQJ A;  2PNR C;  3HKZ B;  2JEB I;  1K28 A;  4GOP C;  4LFA Q;  4HMJ A;  5I6W A;  1MSG A;  1RKN A;  1I3Q H;  3OMC A;  2D62 A;  3EIV A;  3J80 c;  4IOA A;  4HIK A;  4KKS A;  1B2T A;  5AJ3 Q;  4JYA L;  3S24 A;  3HOZ H;  1ICF B;  2EXZ A;  1B50 A;  4U68 A;  3PIO A;  2B63 B;  5J3B A;  3NUC A;  4KHP L;  2EYP A;  4DUY Q;  4PQX A;  2K5Q A;  3HEJ A;  3MFY A;  1Y1W B;  3T1H L;  3J81 c;  4A3F B;  3HKZ G;  1QVF A;  1ESR A;  3T1Y Q;  2IPK D;  1RDP D;  4DUZ L;  4OO1 I;  1QNU A;  4DKA C;  5JPN C;  1EZ6 A;  1O7Z A;  5A2Q L;  1H9S A;  1KTK A;  3TN2 A;  2F3I A;  1HQM C;  2AUJ D;  1I50 H;  2Y0S E;  1ZEQ X;  4UY8 C;  1WVL A;  1AZQ A;  2I0Q A;  3T4A C;  5CGK A;  1L1O A;  1YNN C;  1WCM H;  1YEZ A;  4MTN A;  1KLG D;  3I3C A;  2B63 G;  3FEW X;  1SBB B;  2Q8I B;  1KL9 A;  1QVC A;  2ZM6 L;  1BO0 A;  1Y1W G;  2EOT A;  1OXU A;  5ISR A;  4OON A;  5HGQ A;  3QOL A;  4DV5 L;  2A1A A;  4A3F G;  1N32 Q;  1V43 A;  3G4S A;  4OIK A;  4DV6 Q;  4DR7 Q;  2Z4I A;  5JJK A;  4NB3 A;  1LTS D;  3GTP H;  4DR6 Q;  2L4N A;  3EN2 A;  3GV3 A;  1KRS A;  3C2P A;  3OOC A;  1PMR A;  2F3W A;  3NTK A;  3R8B A;  1YJW A;  4LF9 L;  4KHZ A;  3CU7 A;  2VQE Q;  4K14 A;  5IP7 H;  4HIO A;  3H6M A;  1PLF A;  5CV9 A;  4WJ4 A;  4JG2 A;  3S1R B;  3D31 A;  3C1F A;  4FP5 D;  1SN8 A;  2FMM A;  2E2I H;  2KBN A;  3I90 A;  1EU3 A;  5K36 H;  1HFN A;  2YTY A;  1LAB A;  4IUU A;  4U67 3;  2L15 A;  1HA5 A;  2N49 A;  1QNK A;  1YIJ A;  3RZD H;  2LXJ A;  4A3K B;  3EQL C;  3HG9 A;  1D5M C;  1UAP A;  4K5W A;  2F0D A;  4V0B A;  1FNW A;  1HJP A;  1STB A;  4R4I A;  5JEA J;  2MUY A;  5LL6 X;  3OTO L;  4IO9 A;  4F87 A;  1NCV A;  3IRB A;  4UHV A;  4A76 A;  1EIF A;  1LTI D;  4OX9 L;  4L8J A;  2PQE A;  3PIP 3;  5A35 A;  2UUB Q;  4HMI A;  1BKB A;  1MSH A;  2F0I A;  2E2J H;  1X6O A;  3M4Q A;  1S5B D;  2EY1 A;  3T16 A;  4DU9 A;  4A3K G;  3NP8 A;  1KQS A;  4B3S Q;  2KHS A;  5JEA G;  1FVI A;  2VB2 X;  1PH3 A;  2K5V A;  4GOP B;  4IQZ A;  1F2Y A;  2FJ2 A;  4A3M B;  2B39 A;  4OL7 A;  4DV2 L;  1R9T H;  1LYL A;  2ZJQ A;  5L37 A;  1XNR Q;  3CAM A;  1MIU A;  4UP8 A;  2B3G A;  2GVA A;  1XJV A;  3GTJ B;  1CUK A;  3BG3 A;  2ATW A;  4H13 C;  1WI5 A;  4YCW A;  3GTQ B;  3J7Y W;  1KNA A;  2PQA A;  1A3V A;  1YHA A;  5FO7 B;  4KK7 A;  4ZAI A;  1HQR D;  1FGB D;  4YHH L;  1WTQ A;  1B1Z A;  2XWB B;  4DA2 A;  5IYC G;  1A62 A;  4B9X A;  2HQL A;  3RNU A;  4A3G G;  2B63 H;  5DAU A;  4A3M G;  1XPO A;  1SYD A;  5HUR A;  1Q46 A;  1Y1W H;  4K2L A;  4R4C A;  1JWM D;  4A3F H;  5C4H A;  4HIM A;  4HJ7 A;  2O5I C;  4JI7 Q;  3ERQ A;  1CSP A;  1STG A;  4JI8 Q;  5FO9 B;  3AEV A;  4FXK C;  3OYY A;  5FJ8 H;  3OHX C;  4C3H H;  3D6W A;  1S4Z A;  2MO1 A;  5IGE A;  1AZP A;  2QF7 A;  4DAY A;  3UDG A;  1F9P A;  5CC4 A;  1TR5 A;  2FMC A;  4JV5 L;  1DM0 B;  2J0T D;  1YI2 A;  2V1C C;  5IIF A;  4OXP A;  3S2H B;  5G3L F;  3KF6 B;  1PRT C;  4K8I A;  3IFD A;  3DWQ A;  2MHV A;  1KD1 C;  2HT1 A;  5C0X J;  2KED A;  1YJ9 A;  2I5M X;  3P75 A;  2K28 A;  5CV7 A;  4JYA Q;  1IHZ A;  4PZ8 A;  1VQI A;  2NZH A;  1W2B A;  4H44 C;  3PO2 G;  3A7L A;  4DPG A;  2Z8L A;  4KHP Q;  1SMY D;  1DGS A;  2MGS A;  2MJ8 A;  4XIG S;  5CV5 A;  1G6P A;  2K14 A;  4JW0 A;  4LW1 A;  1GO3 E;  2EZV A;  2I46 A;  2JXM B;  3T1H Q;  3BDL A;  3HOX B;  2CFM A;  3A8K E;  4IFD G;  3J81 j;  2DJG C;  3S1R H;  4DUZ Q;  4C3I B;  2JN4 A;  3Q6S A;  2RDG A;  2PMZ E;  5GAD C;  2F0H A;  4NPS A;  1AE2 A;  1VQ9 A;  4RAU C;  5LHY 1;  4JI4 L;  4RGO S;  3K0X A;  1HZC A;  2UXB L;  2QEJ C;  3GTK B;  5JVG 3;  2EDG A;  3NBI A;  5JEA H;  1TS5 A;  2NVY B;  2B2W A;  1G2T A;  1B9M A;  2KCN A;  3Q8D A;  2JK8 A;  2ASB A;  4DAV A;  3MA2 B;  4LF7 Q;  3ONA B;  4KY6 A;  3K80 C;  4DV3 L;  2ZJR A;  3F2B A;  3HOX G;  2F0O A;  2X6G A;  4DV5 Q;  4XT3 B;  1MJE A;  1HR0 W;  2IHE A;  2WIN B;  1C7Y A;  3KBG A;  4C3I G;  1BF4 A;  1PZJ D;  4OWW B;  5BR8 L;  3FMC A;  4DFA A;  2KCC A;  2PW5 A;  2VQF L;  1BBX C;  2UXC L;  4LF9 Q;  4X3S A;  2X6L A;  5GQO A;  4JI2 Q;  2CVR A;  2RHS B;  2LS0 1;  5IYC H;  1QOH A;  2PZT A;  1QG7 A;  2QW7 A;  1X3F A;  3AFP A;  3R2I A;  5GAH C;  2E5L L;  3ULJ A;  1KDA A;  4A3M H;  3KLS A;  3FKI B;  3O13 A;  5ELB A;  4X65 L;  1JJG A;  3MWY W;  5KYL A;  2JA8 B;  3GTJ H;  2R92 B;  4FF1 A;  3S2D B;  3STB D;  3SGI A;  2E2H B;  2LKV A;  2A68 C;  3DM3 A;  2A74 C;  1Q12 A;  2K5H A;  4HN7 A;  1S72 A;  4JOI A;  4C1N I;  3ULP A;  3AMU A;  4IUR A;  1B4O A;  2OTJ A;  1PYW D;  3TSS A;  1MD2 D;  4OX9 Q;  2ALY B;  3KYH C;  2Q2H A;  4XQJ A;  4CGY B;  2CWA A;  2DY8 A;  3TP7 A;  3FKI G;  4ULL A;  2K6A A;  1HFG A;  1OXX K;  2NBF A;  3D6C A;  2JA8 G;  2KUM A;  3CCS A;  2R92 G;  2AKW B;  4IJL A;  4JPB W;  3CC4 A;  2ICE C;  1OO9 B;  2IX3 A;  2A6E C;  3K58 A;  4ZUI A;  2A5H A;  3DWP A;  3CC2 A;  4GNX C;  2F0F A;  4BWG B;  1TXY A;  1AP0 A;  3W5O A;  1PRT B;  1SE8 A;  3DXJ C;  1PV4 A;  4TSS A;  1EOV A;  3K59 A;  4IFD H;  2NN6 G;  2K5N A;  1HRJ A;  3S2H H;  3J7A F;  3D4D A;  1IW7 D;  3A7A B;  3MXN B;  2RF4 A;  3PQI A;  4UP7 A;  4LFA L;  5C0X H;  4YHH Q;  3G7L A;  2JA6 B;  1NSN S;  1AEX A;  1CTM A;  4CDD C;  2ZTC A;  1ASZ A;  4WJW A;  1SNC A;  1VQC A;  3A55 A;  4C1N K;  3V05 A;  1EOT A;  3J81 E;  1SSO A;  4YWK A;  5LMN W;  3T56 B;  3HOX H;  4YIJ A;  1MGS A;  1E1T A;  3A8I E;  3SK8 A;  5E3F A;  1X3Q A;  3S1Q B;  4DUY L;  1ILQ A;  4C3I H;  1UE1 A;  4L63 B;  2IX1 A;  1W6K A;  1Z6H A;  1K0R A;  4RGM A;  4YCV A;  4APV A;  3HOV B;  1MBY A;  5FLX L;  5JJI A;  1B8A A;  1ICW A;  1D8L A;  1XYI A;  2JA6 G;  3SDZ A;  1OTC A;  1EY5 A;  1PFB A;  3M7N A;  1S40 A;  4K2K A;  4NKL A;  3MEF A;  2K03 A;  2NVY H;  2N3S A;  2RCF A;  3OIP A;  4JV5 Q;  1ILP A;  4WRD A;  3MEH A;  1K8A C;  3JC6 6;  2I5L X;  3RN2 A;  1I4X A;  4QMG A;  2RKS A;  3ITP A;  4HJA A;  1XXG A;  2WB1 B;  4A3I B;  4B3M L;  4BY1 B;  4X3T A;  3PUY A;  3Q22 A;  3I73 A;  4KKU A;  4B9W A;  1YZ6 A;  1L2F A;  2MFI A;  5DEH A;  4B08 A;  1JJC B;  3HOV G;  2FHT A;  1N32 L;  2Z6K C;  1D5Z C;  2PO4 A;  3CCJ A;  3GTO B;  1LAC A;  1LV9 A;  4DR6 L;  1TWC H;  2F0M A;  4FF2 A;  2QCP X;  2EJG C;  1J5E Q;  3SK5 A;  1I6H B;  4DK3 C;  4EQP A;  5CYU A;  4NXM L;  3CPF A;  2VQE L;  4RG1 A;  1Y8N B;  4KJO A;  4A93 H;  3NEM A;  4Y7N B;  4LMQ D;  2B2Y C;  3FKI H;  4XQN A;  2WB1 G;  4A3I G;  4BY1 G;  1YNX A;  2NUC A;  2XNA C;  2PZU A;  2R92 H;  3E6Z X;  4JI4 Q;  3CKI B;  2ZJP A;  3S2D H;  5I2Y A;  2E2H H;  2UXB Q;  3LNN A;  2Z4H A;  4K8J A;  3VR4 A;  4QQB X;  5IGG A;  1GUO A;  1I50 B;  4HR7 B;  2K04 A;  1P16 A;  3U9O A;  2N55 A;  4HJ9 A;  4GLX A;  5FLM H;  2M9V A;  3DUZ A;  1D2B A;  3DLL A;  1SYE A;  3PGZ A;  1VQ6 A;  1JOO A;  3EJI A;  3BS1 A;  1G2S A;  4XXE A;  2IW3 A;  4CHT B;  2NN6 H;  3IKJ A;  2HCI A;  4LFB Q;  4K6D A;  1JB3 A;  2L1B A;  4DV4 Q;  1IKM A;  1RHP A;  1D5X C;  2K75 A;  1NE3 A;  2F0L A;  2R7F A;  1H95 A;  1P8L A;  2VQF Q;  2VUM B;  2B29 A;  2UXC Q;  3H3V H;  4A3J B;  1V1O A;  3CQZ B;  1LTT D;  1IKL A;  4ID6 A;  4P71 A;  1BR9 A;  5JOB A;  2F0N A;  2KJX A;  4MN3 A;  4K0K L;  1VCI A;  2X69 A;  1TY0 A;  4ILW A;  3L2P A;  2E5L Q;  1K9M C;  2ID0 A;  2KHI A;  2N78 A;  4DR5 L;  1ASY A;  2G5D A;  3JAM L;  4JI0 L;  1PFS A;  1EWH A;  3NTI A;  1ML0 D;  2C35 B;  5IP9 G;  1NR4 A;  2B2U A;  1I4P A;  3M85 A;  4JBJ A;  3LWE A;  1SJH D;  4NXN L;  1XNR L;  2BDO A;  3IAY A;  1JB7 A;  1VQA A;  4LF5 L;  1EL0 A;  2VUM G;  4CKC A;  1QCB D;  2JQO A;  4G7O C;  1KXL A;  4GOP A;  4A3J G;  4ZKB B;  2JA6 H;  2SOB A;  1EY7 A;  3GO5 A;  1XPR A;  1HUM A;  2AQ2 B;  1I4R A;  5IP7 G;  4QY7 A;  1SYC A;  1RCV D;  2NWG A;  4KLK A;  4GN3 B;  1CKO A;  1LT6 D;  2NYZ D;  3D4W A;  4LFC L;  1A8V A;  4K5X A;  2JJQ A;  4P2C B;  1TU2 B;  2F1M A;  4FYD A;  1CT1 D;  4CJ1 B;  5ELN A;  1XPU A;  3S1Q H;  2SNM A;  1XX8 A;  2FIN B;  1M4V A;  2KCT A;  1F77 A;  1UE5 A;  1DCZ A;  3HOV H;  1BUV T;  2B2V C;  3NE5 B;  4JI7 L;  1B53 A;  2LMC B;  4HJ5 A;  1I94 L;  1NBW A;  1EEI D;  5IYD G;  1B44 D;  3WOE A;  1J9O A;  2AWN A;  3ER0 A;  1SEB D;  4CKB A;  2A6H C;  5K5P A;  4R8I A;  1O78 A;  1GOZ A;  4KMU C;  3U4Z A;  2LSS A;  4KTA A;  4LF6 L;  3EFX D;  3G71 A;  4A3I H;  3LX0 A;  4BY1 H;  3R2T A;  4LF4 L;  3SVM A;  1DOL A;  3NPP A;  2FXQ A;  1VQP A;  1VQL A;  4XYO A;  3GTO H;  4XTC S;  2SEB D;  4EQN A;  3OW7 A;  1IBL Q;  1I6H H;  3S16 B;  2LY7 A;  4PNY A;  3KF6 A;  1SNQ A;  2A69 C;  5IWA Q;  1PH4 A;  2UUC L;  3E0E A;  2IL8 A;  4J1M A;  5EAY A;  4Y7N H;  1HR0 L;  4C3J B;  1XMO L;  2MP1 A;  1N36 L;  1F2L A;  1VQB A;  3KK7 A;  2UUA Q;  1K3R A;  1SMY C;  2CH4 W;  1NTG A;  1XTD A;  5H1S E;  2V4D A;  4C3H B;  5C44 B;  3SXH A;  1B70 B;  5EGT A;  4IUP A;  4TVA B;  3VA7 A;  2IHF A;  1V1P B;  4LUO A;  2F0E A;  4RH6 A;  2ENB A;  1Q82 C;  1EUJ A;  4B3M Q;  3S1N B;  4FXG C;  3VR5 A;  4F7X A;  2BE5 C;  2ZXO A;  3D3R A;  3TP6 A;  3S1M B;  4LF7 L;  4KKT A;  5IP9 H;  2D2C C;  1JE5 A;  5CV6 A;  3G6E A;  2CKZ B;  4C3J G;  1F9S A;  1H9J A;  3TRE A;  2QKI C;  3CRK C;  2VUM H;  4IOC A;  1U5K A;  4A3J H;  1Q81 C;  2HHH L;  2PPB C;  3CQZ H;  3AQQ A;  1PDQ A;  5FJ8 G;  4C3H G;  2EE1 A;  1Q1E A;  4NXM Q;  1PZK D;  1VF7 A;  3URY A;  4JI2 L;  2AQ1 B;  2PW7 A;  3UDF A;  4DXF A;  2KVM A;  1KHI A;  3NEL A;  3DWA A;  3SR1 A;  4UAI A;  1PTO H;  2HQE A;  3KBX A;  3M4Y A;  1TWH H;  1YHB A;  4R4Q A;  5CBE E;  2EPB A;  3TS2 A;  1WTW A;  1VQE A;  1LO5 D;  1HTP A;  4KI0 A;  2ZT9 C;  4GLV B;  3AB9 A;  4XT1 B;  1PTO F;  1LUZ A;  3OWF A;  3RR5 A;  3QIA A;  5IYD H;  1VQN A;  5D14 A;  3T51 B;  4GS3 A;  4KY7 A;  2YTX A;  1U4P A;  1T5E A;  5ELE A;  3D0F A;  4O2D A;  3W1B A;  3NK9 A;  5A2Q E;  5G3L D;  2A73 B;  5E4W C;  3D4R A;  1CZG A;  2RSN A;  2WKD A;  4N8F A;  4BA1 I;  1GUW A;  1L1O C;  4H02 A;  1PH5 A;  2JA9 A;  4Q5V A;  1Y1V B;  2EXD A;  5FLX c;  1MHW C;  1SE3 A;  2EVB A;  2O5J C;  1EIH A;  4P74 A;  4R9W A;  2DGY A;  1K73 C;  3MXU A;  4K0K Q;  2A19 A;  3HKS A;  4ODG A;  3NBH B;  1J6Q A;  4ZYS A;  1V9P A;  5M5X B;  4DR5 Q;  4JI0 Q;  2VS1 A;  4LAA A;  3I7F A;  2VY3 A;  2XRS D;  1EYC A;  2HUG A;  2F0K A;  3CCE A;  4KN7 C;  5LMN L;  4NXN Q;  2XN9 C;  3I4M B;  1M1K C;  1IBM L;  4LF5 Q;  1ZYR C;  2F0V A;  3V96 A;  5I6Y A;  3J80 i;  1WD1 A;  3PCO B;  1E1O A;  5CMD A;  1Y1V G;  4H0L C;  1IBK L;  1EWI A;  1QWY A;  4F8M A;  2R7D A;  1KNE A;  1GJX A;  1I4H A;  3PUW A;  2ZTD A;  1HTL D;  1FNU A;  3UDI A;  3N6R A;  3J81 i;  1HNZ Q;  4LFC Q;  2UXD L;  3S16 H;  1NMG A;  3RLF A;  1IW7 C;  4O0A A;  3MTS A;  5IY0 A;  1Q90 A;  1QUQ A;  2TMP A;  1RF2 D;  2KEE A;  5BN3 A;  1STE A;  4C3J H;  5M3F H;  3I4M G;  3H09 A;  1DOM A;  1IYU A;  2F0U A;  3KLR A;  3PUX A;  2OWO A;  1I94 Q;  4HED A;  1WTV A;  5C44 H;  1Q7Y C;  3HOW B;  1ZXT A;  3H3V C;  3MXG A;  1C48 A;  4RCN A;  4FF3 A;  3SHL A;  2G9H D;  1Q8K A;  3KDF A;  1C8C A;  4IFD I;  2R6G A;  4L5S A;  4LF6 Q;  1CKN B;  1AH9 A;  3S1N H;  3VR3 A;  4LF4 Q;  3E3X A;  2K01 A;  3S1M H;  1C4Q A;  3MVV A;  1I6V C;  2E75 C;  3F2C A;  1LTR D;  5AFW A;  4BBS H;  2F0W A;  5C0X I;  3DHQ A;  2XIW A;  4IPG A;  4CKE A;  1YVC A;  1VQ7 A;  3NHH A;  3KFU A;  1WTH A;  5C3E B;  3HOW G;  4LWC A;  5C4Z A;  1FNV A;  1HZ9 A;  4IPD A;  3JAM c;  3J7A V;  2NTS A;  2H4O A;  2UUC Q;  5D65 A;  4JBK A;  3K5M A;  1J5E L;  1Q86 C;  1HR0 Q;  2AHO B;  3KJP A;  1XMO Q;  2BOS A;  4N9P A;  1N36 Q;  1JWS D;  3PO3 B;  2N8N A;  2PYK A;  3M4O B;  1HNW L;  3BZK A;  1GUS A;  4ZK9 B;  1CA5 A;  5C0X G;  3H15 A;  3T13 A;  5IGB A;  3FPU B;  4LJZ C;  4ZQ3 A;  5C3E G;  2RDF A;  5KND A;  2AWO A;  1L1O B;  3CCQ A;  1IYV A;  3I72 A;  3OPO A;  4ZUJ A;  3K7A B;  3H91 A;  3UDX A;  1Y8P B;  1LLR D;  3K5O A;  4LFB L;  4C2M B;  2HHH Q;  1Y1V H;  4DV4 L;  4EQO A;  1A0I A;  4O1N A;  4RFB A;  4XYQ A;  2AUK A;  1TWC B;  3A74 A;  2VB3 X;  4DV1 L;  5IGC A;  5M5X H;  1WJJ A;  5T1I A;  3DEO A;  4P75 A;  1LTB D;  3VR2 A;  3P20 A;  4A93 B;  4GNX A;  1PHJ A;  1ENF A;  4GN4 B;  2YU9 B;  2R3Z A;  2XVS A;  3QWN A;  1FGU A;  3I4M H;  1N34 L;  4L6T B;  1QJO A;  1CM9 A;  1OXS C;  3A5Z B;  3B6Y A;  4TKO B;  2EYO A;  4AYB B;  1TWA B;  1Z9F A;  2BA1 A;  3BU2 A;  2F0P A;  2ICI A;  2MNA A;  3BDC A;  3J80 L;  3U4V A;  5HY6 A;  4K6L A;  3WOF A;  5FO8 B;  1VS0 A;  2DUD A;  1YNJ D;  4UDU C;  3M7G A;  3BYY B;  5LL6 S;  4FNF A;  3PIO 3;  1SDF A;  3PF5 A;  1S5E D;  2LXK A;  1GHK A;  5J39 A;  1YHQ A;  1EYA A;  2NN6 I;  3HOY B;  2K32 A;  4POG A;  1SFO B;  4A93 G;  1Y8O B;  2E76 C;  4QIW B;  3M4P A;  1UE7 A;  4LK1 C;  1WFQ A;  2B2W C;  2KA7 A;  1SNO A;  3H3V I;  3U50 C;  1O7Y A;  5JAV A;  1IYJ B;  5KIX A;  2QGQ A;  1JC7 A;  4AYB G;  3TZD A;  4Q0F A;  4QL5 A;  3K7U C;  4L5Q A;  3NQT A;  3SK6 A;  3HOW H;  1E2W A;  1EY8 A;  5LMN Q;  2CQA A;  3X3N A;  5FLM G;  3CD6 A;  1GD7 A;  1O80 A;  2OEO A;  3G48 A;  2YTV A;  3HKZ E;  5EPL A;  1IBM Q;  1Y69 U;  3HOY G;  2N88 A;  1WTX A;  4PG3 A;  1X9N A;  4MTK A;  3GQB A;  1LM0 A;  1IBK Q;  1TT2 A;  4YWM A;  4JI6 Q;  1PTO C;  3CCV A;  4DGZ A;  2K5D A;  1PA6 A;  2IT1 A;  1N9W A;  2RSO A;  2WAC A;  4IJH A;  3A0J A;  1BDO A;  5T1G A;  3ULL A;  2Q8R E;  2UXD Q;  5C3E H;  1LT5 D;  1ROD A;  1FD7 D;  3RLO A;  1PFN A;  2Z6K A;  3TP8 A;  1M90 C;  1IBL L;  1TS3 A;  4JOI C;  3W1G A;  5IWA L;  5IOD A;  3V2T A;  4AH6 A;  3PO3 H;  1BCP D;  1H9M A;  1D1K A;  3M4O H;  3RLN A;  2ZXP A;  4ZKC B;  5KRU A;  1JT8 A;  1S5D D;  2L12 A;  1SRU A;  3S17 H;  3HS0 C;  3S15 H;  2UUA L;  4OEM B;  3NXW A;  5EKL A;  2XSC A;  5IYB H;  2JYO A;  3C3L A;  3MHB A;  2F52 A;  2RVL A;  1Z47 A;  1CFM A;  5DNF A;  1VMC A;  1NUC A;  3PIP A;  1FJG L;  2CCZ A;  3K7A H;  5ELF A;  5C4X B;  1UUP A;  1PRT D;  4C2M H;  3E5S A;  1DYQ A;  1U4L A;  5JJZ A;  2H5X A;  5C4J B;  4YCU A;  5LMU Q;  1KDC A;  4MNO A;  4KN4 C;  3BVG A;  4K5V A;  3K81 C;  3CF5 A;  1LT3 D;  1B3A A;  5GRO A;  5D3D A;  2JE6 I;  1PH6 A;  4WJ3 M;  4NMZ A;  4HTH A;  1EU4 A;  3C1E A;  1HNW Q;  1G6Z A;  4KD4 A;  4JCV E;  2YU9 H;  3CPW A;  1OXT A;  1HHV A;  4CDE C;  5CV4 A;  1CHQ D;  3I55 A;  5C4X G;  2J4X A;  2K05 A;  4I65 A;  1A15 A;  1TWA H;  1TY2 A;  5IT9 L;  1EQQ A;  4BBR B;  4GZY C;  5IGD A;  4WFN 3;  2PI2 E;  1X56 A;  3QR8 A;  2GA4 B;  2Q8T A;  1PXU A;  3VA5 A;  1KIX A;  4HID A;  1RTN A;  1EEF D;  2F0T A;  3Q23 A;  1S5C D;  3HOY H;  1H9R A;  5FLX E;  2LFN A;  3GTG B;  2F3V A;  1SFO H;  1DOK A;  3MFG A;  3GTL H;  1C9O A;  1TWF B;  3NWS A;  1JE4 A;  2PI2 A;  1G29 1;  3U58 A;  3I4L A;  4A3E B;  3QJY A;  4X66 L;  4TRD A;  4Z9C B;  5ELC A;  5EJW A;  4DV1 Q;  3NWT A;  4BBR G;  4G57 A;  1N8R C;  3VYU A;  1VQ8 A;  3FPP A;  1STN A;  1EQR A;  1SR3 A;  4RCO A;  4DV0 Q;  1X54 A;  3RZO B;  1L0X B;  2OQK A;  1CSQ A;  3CCL A;  1PTO B;  5GAE C;  3PUV A;  5C3W A;  2CW0 D;  1N34 Q;  1VQG A;  3VYT A;  5M5W B;  3HGB A;  3ERO A;  1TWH B;  3RN5 A;  3NBH A;  3A8J E;  1UNS A;  2DNC A;  3TDQ A; 
#chains in the Genus database with same CATH homology
 4S3S A;  3RD4 A;  2A68 D;  1R4P B;  1BQQ T;  4J8Q A;  1AN8 A;  4H7B A;  1DXM A;  1QB5 D;  4WOR A;  5M3M B;  3LWU A;  2L55 A;  3CHB D;  1VMP A;  3U9S A;  5M5Y B;  1U4M A;  4C56 C;  1K8M A;  4J6H A;  2NVX B;  3GV6 A;  5EKK A;  2JA7 B;  4PMW A;  3SE0 A;  1H9K A;  4M1U B;  3TZU A;  3E0J A;  2B2T C;  3BVZ A;  4QB4 A;  5IOC A;  2BCO A;  5KNB A;  1AFP A;  2R7Z B;  4NW2 A;  1GUN A;  1BNZ A;  2KQ3 A;  5F2D A;  1WTR A;  3JAM E;  1LT4 D;  2B2U C;  4JK1 C;  2L9H A;  3DM1 A;  3VYR A;  2L11 A;  2MPM A;  5CBA E;  5M3F B;  4E6I A;  5J22 A;  3L3O C;  3DEP A;  1AW7 A;  1HPC A;  3FVQ A;  4R8N A;  3NSW A;  1KAB A;  2K5W A;  4KHV A;  4RKB A;  3G6J B;  3PUZ A;  5EPJ A;  4BS9 A;  4G7Z C;  1F2Z A;  2F0Q A;  1V8Q A;  4DXG A;  4BBS B;  2EY6 A;  3UI2 A;  3X3M A;  1XWE A;  2XWJ B;  3NTH A;  4IAL A;  4F88 A;  1XTC D;  3MAQ A;  1CZW A;  1ESF A;  4HSP A;  5COY A;  5C5M A;  4OO1 G;  4JBW A;  3F2U A;  2JEA I;  1CQF A;  5C5L A;  1R4Q B;  2XRQ D;  1LTA D;  2FFK B;  4RGN A;  1A3U A;  3OWE B;  4PV1 C;  4DNT B;  3VR6 A;  2WAQ B;  3BVM A;  3HZX A;  5EPK A;  4A3D B;  1SE2 A;  1YNJ C;  1K8O A;  1NR2 A;  4HSV A;  5EKI A;  5BN4 A;  2H1E A;  3EA6 A;  1SND A;  1GXD C;  4OGQ C;  3L9A X;  3W2D A;  4DF7 A;  4PMC A;  2HDL A;  2WKC A;  3A54 A;  3KLS X;  4V19 0;  3D8G A;  3OSO A;  1ET6 A;  4ZLT F;  2EJF C;  4A3G B;  3FRP B;  1Q8I A;  2HCC A;  2NZ1 D;  4M8A A;  3R3O A;  4XDX A;  1Z7T A;  4KD3 A;  4KY5 A;  3MXN A;  2K33 A;  1VF5 C;  2F03 A;  5FK9 C;  1HUN A;  2SDF A;  3QB3 A;  3I4N B;  2EYL A;  1DD2 A;  1UEA B;  5IGF A;  3GP7 A;  1B9N A;  4EGV A;  4RHR A;  4FO2 A;  3TBI B;  1SYB A;  3IFT A;  1SJE D;  1SXT A;  2EYH A;  1BCP C;  3PMF A;  4FF4 A;  2A6H D;  1NAP A;  1SAP A;  2JA5 B;  4CJ2 C;  1GHJ A;  4OO1 H;  2RA4 A;  3P7J A;  1FYC A;  2J7Z A;  3BDO A;  1E2V A;  3PO2 B;  2KEC A;  1STA A;  2R93 B;  3C46 A;  2B8G A;  3M3Y B;  2I07 B;  5KYI A;  1T5X D;  1SE4 A;  4IFD J;  1A6X A;  4EVO A;  4FVM A;  4N9T A;  1SYG A;  2A69 D;  3H0G B;  1ONL A;  3EVQ A;  2YYZ A;  1SNP A;  5M9O A;  3OMG A;  3MC0 B;  4BY7 B;  4HCE A;  4OHJ A;  2QIL A;  4O42 A;  3S17 B;  1DJR D;  3S15 B;  3QG1 A;  1JIC A;  1BOS A;  1H9S B;  3P1H A;  1EWC A;  1VDZ A;  2OF1 A;  1CK1 A;  3I70 A;  5E4X A;  2F0S A;  2K7V A;  1CQV A;  3TME A;  3SEB A;  1IL8 A;  1YNN D;  3QOJ A;  4PMB A;  5DM7 3;  4RKL A;  3MZ5 A;  4DK1 A;  2BE5 D;  5NUC A;  1JCK B;  1L0Y B;  2Y0S B;  2E74 C;  2EY5 A;  1SYF A;  2EYF A;  2M00 A;  1Q3L A;  1CI3 M;  5C3X A;  5CR3 A;  2F4I A;  2EYJ A;  1D1I A;  4TQU S;  5COR A;  5C6A A;  1QIL A;  2CHB D;  3R93 A;  2E2D C;  2OT2 A;  1WTP A;  4FXD A;  3I8Z A;  1X32 A;  4RHS A;  2CW0 C;  2M2L A;  2R61 A;  1S5F D;  1TII D;  2IJ0 A;  4KJN A;  4A3B B;  1TVX A;  3J81 L;  3GTL B;  3TP5 A;  1RD9 D;  1G8Z D;  1TKW B;  2PCF B;  3SK4 A;  5I9O A;  4DK0 A;  4IZ8 A;  1A3T A;  1KDB A;  2IX0 A;  1G91 A;  3I91 A;  1EQT A;  2WV6 D;  1BCP B;  1TWG B;  1F9R A;  1K83 B;  2BDN A;  3RUZ A;  5FKA C;  5JVH 3;  2SNS A;  2DY7 A;  4ME5 A;  5EBD A;  3K5N A;  1STH A;  2IWH A;  5KGU A;  3N52 A;  1CA6 A;  1ZYR D;  2AQ3 B;  4G7H C;  2O2L D;  2RDH A;  2WP8 J;  4RA8 A;  1EY0 A;  3S14 B;  4KV6 A;  2VNU D;  3BZD B;  1SNM A;  5EBC A;  1LTG D;  3J80 E;  3L7Z C;  4QUF A;  2PZW A;  4BA2 I;  1II3 A;  3Q0A A;  3KF8 A;  2NVT B;  5CV8 A;  3AU7 A;  4ABN A;  2B2Y A;  3A56 A;  1J8I A;  1JOK A;  1F2M A;  3K0Y A;  3PV0 A;  2G9D A;  2NVQ B;  1BXT A;  4NDX A;  2BA0 A;  4QCL A;  3ND8 A;  1X3P A;  2HDM A;  2QDB A;  4ZRZ A;  5KEE A;  1EIG A;  4RGT A;  5I9P A;  5KNC A;  1HA6 A;  2WII B;  3T53 B;  1ENA A;  2C5C A;  2NTT A;  4IUN A;  1I4Q A;  1V1P A;  1STY A;  1E2Z A;  1M8A A;  2L5T A;  5D3I B;  3CRL C;  1JR0 D;  1JWU D;  1O7L A;  4IUT A;  2DNE A;  1HCZ A;  3S9W A;  4HCS A;  1RTO A;  2RQX A;  1F9Q A;  1U9R A;  5TSS A;  5JPM C;  3FDT A;  1I3Q B;  1GUT A;  1E0B A;  4IUQ A;  1U4R A;  1RJT A;  3RMH A;  1EY9 A;  1Q1B A;  2OXP A;  1KLU D;  3HOZ B;  2C9O A;  3OIQ A;  1D6E C;  2F0J A;  5HGT A;  1PZI D;  4HAE A;  2D5D A;  4QF4 A;  1EFI D;  3H94 A;  3VYS A;  4DAP A;  2D9U A;  3ND9 A;  1EYD A;  5I4D A;  4X3U A;  1MI2 A;  2PMZ B;  1TQO A;  4RWS C;  2DN8 A;  1FR3 A;  1JOR A;  1ET9 A;  4XQQ A;  4IN3 A;  3K57 A;  3HOU B;  1WCM B;  3DMU A;  4MHE A;  2F0G A;  2B2V A;  2O4X A;  1I4G A;  3W3A A;  4G4K A;  3NQI A;  4QUC A;  1BCP F;  1HXY D;  1DON A;  3GTP B;  1PFM A;  4I7Z C;  1GUG A;  4OIJ A;  3GTM B;  3BYT B;  2B2T A;  3KUP A;  2JSO A;  3Q24 A;  3ZYY X;  1EQV A;  1WD0 A;  2E2I B;  2KOL A;  3HRZ C;  5J1Z A;  5ELD A;  5IT9 E;  2B8F A;  2L0C A;  3HP3 A;  1ENC A;  1JQY D;  4NP5 A;  4X3K A;  1EY6 A;  3RZD B;  1PRT F;  2TSS A;  3GD7 A;  1EZ8 A;  5BN5 A;  3K6O A;  4CJ0 B;  1ZKO A;  5FOB B;  1QE6 A;  2K1B A;  3IL8 A;  5EQ0 A;  1EY4 A;  4CBV A;  4MIU A;  2A6E D;  1TS2 A;  2RBM A;  2VXW A;  1WTO A;  4IUV A;  4DN4 M;  1CHP D;  3K5L A;  5K36 G;  1DZ1 A;  2E2J B;  1TS4 A;  5DM6 3;  4DNR B;  2EJM A;  3WDN A;  2ZXR A;  5E1F A;  2NB0 A;  1PTO D;  3QO2 A;  1A2T A;  1W6J A;  5I2X A;  1JOQ A;  2Z1C A;  2EYM A;  1OXV A;  1KAA A;  3MXP A;  1R9T B;  1A2U A;  2JP1 A;  2EY2 A;  2PNR C;  3HKZ B;  2JEB I;  4HMJ A;  5I6W A;  1MSG A;  1RKN A;  3OMC A;  2D62 A;  4KKS A;  1B2T A;  2EXZ A;  1B50 A;  4U68 A;  2B63 B;  3NUC A;  2EYP A;  4PQX A;  2K5Q A;  3HEJ A;  3MFY A;  1Y1W B;  4A3F B;  1ESR A;  2IPK D;  1RDP D;  4OO1 I;  1QNU A;  5JPN C;  1EZ6 A;  1O7Z A;  5A2Q L;  1H9S A;  1KTK A;  3TN2 A;  1HQM C;  2AUJ D;  1ZEQ X;  1WVL A;  1AZQ A;  3T4A C;  5CGK A;  1YNN C;  1KLG D;  3I3C A;  3FEW X;  1SBB B;  2Q8I B;  1BO0 A;  2EOT A;  1OXU A;  5ISR A;  3QOL A;  1V43 A;  4OIK A;  2Z4I A;  1LTS D;  2L4N A;  3GV3 A;  3C2P A;  1PMR A;  2F3W A;  3NTK A;  3OOC A;  3R8B A;  4KHZ A;  3CU7 A;  4K14 A;  3H6M A;  1PLF A;  5CV9 A;  3S1R B;  3D31 A;  3C1F A;  4FP5 D;  2FMM A;  3I90 A;  1EU3 A;  5K36 H;  1HFN A;  1LAB A;  4IUU A;  4U67 3;  1HA5 A;  1QNK A;  4A3K B;  3EQL C;  3HG9 A;  1D5M C;  4V0B A;  1UAP A;  2F0D A;  4K5W A;  1FNW A;  1STB A;  5JEA J;  2MUY A;  5LL6 X;  4F87 A;  1NCV A;  1LTI D;  4L8J A;  2PQE A;  3PIP 3;  5A35 A;  4HMI A;  1MSH A;  2F0I A;  1S5B D;  2EY1 A;  3T16 A;  4DU9 A;  3NP8 A;  2KHS A;  5JEA G;  2VB2 X;  4IQZ A;  1F2Y A;  2FJ2 A;  4A3M B;  2B39 A;  4OL7 A;  3GTJ B;  3BG3 A;  4H13 C;  3GTQ B;  3J7Y W;  1KNA A;  1A3V A;  5FO7 B;  4KK7 A;  4ZAI A;  1HQR D;  1FGB D;  1WTQ A;  1B1Z A;  2XWB B;  4DA2 A;  4B9X A;  5DAU A;  1SYD A;  5HUR A;  4K2L A;  1JWM D;  5C4H A;  2O5I C;  3ERQ A;  1STG A;  5FO9 B;  4FXK C;  3OHX C;  3D6W A;  1S4Z A;  5IGE A;  1AZP A;  2QF7 A;  4DAY A;  1F9P A;  5CC4 A;  1TR5 A;  2FMC A;  1DM0 B;  2J0T D;  5IIF A;  3S2H B;  5G3L F;  1PRT C;  4K8I A;  3IFD A;  3DWQ A;  2MHV A;  5C0X J;  2KED A;  3P75 A;  2K28 A;  5CV7 A;  1IHZ A;  4H44 C;  3A7L A;  2Z8L A;  1SMY D;  2MGS A;  2MJ8 A;  4XIG S;  5CV5 A;  2EZV A;  2I46 A;  2JXM B;  3HOX B;  3BDL A;  3A8K E;  4IFD G;  4C3I B;  3Q6S A;  2RDG A;  2F0H A;  4RAU C;  5LHY 1;  4RGO S;  2QEJ C;  3GTK B;  5JVG 3;  2EDG A;  3NBI A;  5JEA H;  1TS5 A;  2NVY B;  2B2W A;  1G2T A;  1B9M A;  2KCN A;  4DAV A;  3MA2 B;  3ONA B;  4KY6 A;  2F0O A;  2X6G A;  4XT3 B;  2WIN B;  3KBG A;  4C3I G;  1BF4 A;  1PZJ D;  3FMC A;  4DFA A;  2KCC A;  2PW5 A;  1BBX C;  4X3S A;  2X6L A;  2CVR A;  2LS0 1;  1QOH A;  2PZT A;  1QG7 A;  3R2I A;  1KDA A;  3KLS A;  3FKI B;  3O13 A;  5ELB A;  3MWY W;  5KYL A;  2JA8 B;  2R92 B;  4FF1 A;  3S2D B;  2E2H B;  2LKV A;  2A68 C;  2A74 C;  1Q12 A;  4HN7 A;  4C1N I;  3AMU A;  4IUR A;  1B4O A;  1PYW D;  3TSS A;  1MD2 D;  4XQJ A;  4CGY B;  2DY8 A;  3TP7 A;  4ULL A;  2K6A A;  1HFG A;  1OXX K;  2NBF A;  3D6C A;  2KUM A;  2ICE C;  1OO9 B;  2IX3 A;  2A6E C;  3K58 A;  4ZUI A;  2A5H A;  3DWP A;  2F0F A;  4BWG B;  1AP0 A;  1PRT B;  3DXJ C;  4TSS A;  3K59 A;  4IFD H;  2NN6 G;  1HRJ A;  3J7A F;  3D4D A;  1IW7 D;  3A7A B;  5C0X H;  3G7L A;  2JA6 B;  1NSN S;  1AEX A;  1CTM A;  4WJW A;  1SNC A;  3A55 A;  4C1N K;  3V05 A;  1EOT A;  3J81 E;  1SSO A;  3T56 B;  4YIJ A;  1MGS A;  3A8I E;  3SK8 A;  5E3F A;  1X3Q A;  3S1Q B;  1ILQ A;  4L63 B;  2IX1 A;  1W6K A;  1Z6H A;  4RGM A;  3HOV B;  1MBY A;  5FLX L;  1ICW A;  1XYI A;  3SDZ A;  1EY5 A;  1PFB A;  3M7N A;  4K2K A;  4NKL A;  2K03 A;  3OIP A;  1ILP A;  4WRD A;  3MEH A;  1I4X A;  4QMG A;  2RKS A;  3ITP A;  4A3I B;  1XXG A;  2WB1 B;  4BY1 B;  4X3T A;  3PUY A;  3Q22 A;  3I73 A;  4KKU A;  4B9W A;  5DEH A;  4B08 A;  2FHT A;  1D5Z C;  2PO4 A;  3GTO B;  1LAC A;  1LV9 A;  2F0M A;  4FF2 A;  2QCP X;  2EJG C;  3SK5 A;  1I6H B;  4EQP A;  5CYU A;  1Y8N B;  4KJO A;  4Y7N B;  4LMQ D;  2B2Y C;  4XQN A;  2NUC A;  2XNA C;  2PZU A;  3E6Z X;  3CKI B;  5I2Y A;  3LNN A;  2Z4H A;  4K8J A;  3VR4 A;  5IGG A;  1GUO A;  1I50 B;  4HR7 B;  2K04 A;  3U9O A;  2N55 A;  2M9V A;  3DUZ A;  1D2B A;  1SYE A;  1JOO A;  3EJI A;  3BS1 A;  1G2S A;  4XXE A;  2IW3 A;  4CHT B;  2NN6 H;  3IKJ A;  2HCI A;  4K6D A;  1JB3 A;  2L1B A;  1IKM A;  1RHP A;  1D5X C;  2F0L A;  2VUM B;  4A3J B;  1V1O A;  3CQZ B;  1LTT D;  1IKL A;  4ID6 A;  1BR9 A;  5JOB A;  2F0N A;  2KJX A;  4MN3 A;  1VCI A;  2X69 A;  1TY0 A;  4ILW A;  2ID0 A;  3JAM L;  1EWH A;  3NTI A;  1ML0 D;  1NR4 A;  2B2U A;  1I4P A;  3M85 A;  3LWE A;  1SJH D;  2BDO A;  3IAY A;  1EL0 A;  4CKC A;  1QCB D;  4G7O C;  4ZKB B;  2SOB A;  1EY7 A;  3GO5 A;  1HUM A;  2AQ2 B;  1I4R A;  1SYC A;  1RCV D;  2NWG A;  1LT6 D;  2NYZ D;  3D4W A;  4K5X A;  4P2C B;  4FYD A;  1TU2 B;  2F1M A;  1CT1 D;  4CJ1 B;  2SNM A;  1XX8 A;  2FIN B;  1M4V A;  1F77 A;  1DCZ A;  1BUV T;  2B2V C;  3NE5 B;  1B53 A;  2LMC B;  1EEI D;  1B44 D;  3WOE A;  1J9O A;  2AWN A;  1SEB D;  4CKB A;  2A6H C;  5K5P A;  4R8I A;  1O78 A;  1GOZ A;  4KMU C;  4KTA A;  3EFX D;  3LX0 A;  3R2T A;  3SVM A;  1DOL A;  3NPP A;  4XYO A;  4XTC S;  2SEB D;  4EQN A;  3OW7 A;  3S16 B;  2LY7 A;  4PNY A;  1SNQ A;  2A69 C;  2IL8 A;  4J1M A;  4C3J B;  2MP1 A;  1F2L A;  3KK7 A;  1SMY C;  2V4D A;  4C3H B;  5C44 B;  3SXH A;  5EGT A;  4IUP A;  3VA7 A;  1V1P B;  2F0E A;  4RH6 A;  2ENB A;  3S1N B;  4FXG C;  3VR5 A;  4F7X A;  2BE5 C;  2ZXO A;  3D3R A;  3TP6 A;  3S1M B;  4KKT A;  2D2C C;  5CV6 A;  4C3J G;  1F9S A;  1H9J A;  2QKI C;  3CRK C;  2PPB C;  1PDQ A;  4C3H G;  2EE1 A;  1Q1E A;  1PZK D;  1VF7 A;  3URY A;  2AQ1 B;  2PW7 A;  4DXF A;  2KVM A;  3DWA A;  3SR1 A;  4UAI A;  1PTO H;  2HQE A;  3KBX A;  3M4Y A;  5CBE E;  2EPB A;  1WTW A;  1LO5 D;  1HTP A;  4KI0 A;  2ZT9 C;  3AB9 A;  4XT1 B;  1PTO F;  3OWF A;  3QIA A;  5D14 A;  3T51 B;  4KY7 A;  1U4P A;  1T5E A;  5ELE A;  3NK9 A;  5A2Q E;  5G3L D;  2A73 B;  5E4W C;  3D4R A;  1CZG A;  2RSN A;  2WKD A;  4BA1 I;  1GUW A;  4Q5V A;  1Y1V B;  2EVB A;  1SE3 A;  2O5J C;  1EIH A;  4R9W A;  3MXU A;  4ODG A;  4ZYS A;  5M5X B;  4LAA A;  2XRS D;  1EYC A;  2HUG A;  2F0K A;  4KN7 C;  2XN9 C;  3I4M B;  1ZYR C;  2F0V A;  3V96 A;  5I6Y A;  1WD1 A;  5CMD A;  4H0L C;  1QWY A;  4F8M A;  1KNE A;  1GJX A;  1I4H A;  3PUW A;  1HTL D;  1FNU A;  3N6R A;  3RLF A;  1IW7 C;  3MTS A;  1Q90 A;  2TMP A;  1RF2 D;  2KEE A;  5BN3 A;  1STE A;  3H09 A;  1DOM A;  1IYU A;  2F0U A;  3KLR A;  3PUX A;  4HED A;  1WTV A;  3HOW B;  1ZXT A;  3H3V C;  3MXG A;  1C48 A;  4RCN A;  4FF3 A;  3SHL A;  2G9H D;  1C8C A;  4IFD I;  2R6G A;  3VR3 A;  2K01 A;  1C4Q A;  3MVV A;  1I6V C;  2E75 C;  1LTR D;  5AFW A;  2F0W A;  5C0X I;  3DHQ A;  2XIW A;  4CKE A;  3NHH A;  5C3E B;  5C4Z A;  1FNV A;  3J7A V;  2NTS A;  2H4O A;  5D65 A;  3K5M A;  2BOS A;  4N9P A;  1JWS D;  3PO3 B;  2PYK A;  3M4O B;  1GUS A;  4ZK9 B;  1CA5 A;  5C0X G;  3T13 A;  5IGB A;  3FPU B;  4LJZ C;  4ZQ3 A;  2RDF A;  5KND A;  2AWO A;  1IYV A;  3I72 A;  3OPO A;  4ZUJ A;  3K7A B;  3H91 A;  1Y8P B;  1LLR D;  3K5O A;  4C2M B;  4EQO A;  4O1N A;  4RFB A;  4XYQ A;  2AUK A;  1TWC B;  2VB3 X;  5IGC A;  5T1I A;  3DEO A;  1LTB D;  3VR2 A;  3P20 A;  4A93 B;  1ENF A;  2YU9 B;  2R3Z A;  2XVS A;  3QWN A;  4L6T B;  1QJO A;  1CM9 A;  1OXS C;  4TKO B;  2EYO A;  4AYB B;  1TWA B;  2BA1 A;  2F0P A;  2ICI A;  3BDC A;  3J80 L;  4K6L A;  3WOF A;  5FO8 B;  4UDU C;  1YNJ D;  3M7G A;  3BYY B;  5LL6 S;  4FNF A;  3PIO 3;  1SDF A;  1S5E D;  1GHK A;  5J39 A;  1EYA A;  2NN6 I;  3HOY B;  2K32 A;  1SFO B;  1Y8O B;  2E76 C;  4QIW B;  4LK1 C;  2B2W C;  2KA7 A;  1SNO A;  1O7Y A;  5JAV A;  5KIX A;  1JC7 A;  3TZD A;  4Q0F A;  3NQT A;  3SK6 A;  1E2W A;  1EY8 A;  2CQA A;  3X3N A;  1O80 A;  2OEO A;  5EPL A;  1Y69 U;  2N88 A;  1WTX A;  3GQB A;  1TT2 A;  1PTO C;  4DGZ A;  2K5D A;  2IT1 A;  2RSO A;  2WAC A;  1BDO A;  5T1G A;  2Q8R E;  1LT5 D;  1ROD A;  1FD7 D;  1PFN A;  3TP8 A;  1TS3 A;  5IOD A;  3V2T A;  1BCP D;  1H9M A;  1D1K A;  2ZXP A;  4ZKC B;  5KRU A;  1S5D D;  2L12 A;  3HS0 C;  3NXW A;  5EKL A;  2XSC A;  2JYO A;  3C3L A;  3MHB A;  2RVL A;  1Z47 A;  1CFM A;  5DNF A;  1VMC A;  1NUC A;  5ELF A;  5C4X B;  1UUP A;  1PRT D;  3E5S A;  1DYQ A;  1U4L A;  5JJZ A;  5C4J B;  1KDC A;  4KN4 C;  3BVG A;  4K5V A;  1LT3 D;  1B3A A;  5D3D A;  2JE6 I;  4NMZ A;  4HTH A;  1EU4 A;  3C1E A;  1G6Z A;  4KD4 A;  1OXT A;  1HHV A;  5CV4 A;  1CHQ D;  2J4X A;  2K05 A;  4I65 A;  1A15 A;  1TY2 A;  5IT9 L;  4BBR B;  4GZY C;  5IGD A;  4WFN 3;  2GA4 B;  2Q8T A;  1PXU A;  3VA5 A;  1RTN A;  1EEF D;  2F0T A;  3Q23 A;  1S5C D;  1H9R A;  5FLX E;  2LFN A;  3GTG B;  2F3V A;  1DOK A;  3MFG A;  1TWF B;  3NWS A;  1JE4 A;  1G29 1;  3I4L A;  4A3E B;  3QJY A;  4TRD A;  4Z9C B;  5ELC A;  5EJW A;  3NWT A;  4G57 A;  3VYU A;  3FPP A;  1STN A;  4RCO A;  3RZO B;  1L0X B;  1PTO B;  3PUV A;  5C3W A;  2CW0 D;  3VYT A;  5M5W B;  3HGB A;  3ERO A;  1TWH B;  3NBH A;  3A8J E;  1UNS A;  2DNC A;  3TDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...