4EQOA

Crystal structure of staphylococcal nuclease variant delta+phs v99d at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMDNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V99D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4eqoA00
4IUNA 5J39A 2M00A 3ERQA 1STYA 5J1ZA 3TP5A 5C5LA 1EY0A 1SNDA 1EY5A 4RKLA 1KDBA 3TP8A 4HMJA 4K8JA 4TRDA 2F0IA 3EROA 2SOBA 2PZWA 4QF4A 1AEXA 1SYDA 4PNYA 4K5WA 1EQVA 1STHA 3LX0A 5I6WA 3SK6A 4S3SA 1JORA 1F2YA 3D8GA 1II3A 3MHBA 2OF1A 5IGBA 2SNSA 1SYGA 5IGCA 4KD3A 1EY8A 3EJIA 4H7BA 1SNOA 5KEEA 3MEHA 3T16A 4B9WA 2ENBA 3PMFA 1F2ZA 2OEOA 1SNCA 3TP6A 5C6AA 1F2MA 5CV6A 3SXHA 1SNPA 3OWFA 5IGEA 4J1MA 3DHQA 4PMBA 4EQNA 1ENCA 3D4DA 3QOJA 4N9TA 1STNA 2EYFA 1A2TA 2F0QA 3S9WA 4YIJA 2F3WA 3OSOA 5E3FA 2F0SA 4KJOA 1A2UA 3NP8A 2F0NA 1SNMA 1JOQA 5DAUA 2F0VA 4ZUIA 2PW7A 1JOKA 4KY7A 3NK9A 5JAVA 4KD4A 5I9PA 4I65A 3V2TA 1A3VA 2F0WA 2EYHA 4K14A 5C4ZA 4WORA 5EGTA 4EQPA 5KIXA 5J22A 1SYEA 2PZTA 4PMCA 3DMUA 5C5MA 3MXPA 5IODA 2F0UA 3P1HA 4DGZA 3OMGA 2EYOA 3RUZA 5CV7A 4F8MA 1SYBA 1U9RA 2F3VA 4HTHA 4E6IA 5M9OA 4LAAA 2F0TA 3BDLA 1TQOA 2RDFA 2F0PA 5F2DA 1EYDA 5ISRA 5HGTA 2EYLA 4MIUA 1TT2A 4HMIA 1TR5A 2F0LA 5C3WA 4J6HA 2F0KA 3HZXA 5KYLA 3HEJA 5KRUA 2KHSA 1RKNA 3NHHA 1KAAA 2EYPA 4KY6A 1A3TA 5E1FA 1EYCA 2EYJA 4K5VA 2PW5A 4RKBA 4F7XA 3TP7A 5K5PA 1KABA 1KDAA 3NQTA 5IGGA 1EZ8A 2PQEA 3SK8A 4K5XA 3MZ5A 5CV5A 3H6MA 4NKLA 3MVVA 5DEHA 2EY6A 4ID6A 4N9PA 4KJNA 4EQOA 3OMCA 5KYIA 2F0JA 5CV9A 2F0FA 3T13A 1NSNS 1SYFA 5EKKA 5CV8A 3SK5A 2OXPA 4DU9A 1STBA 4ZQ3A 1NUCA 3QB3A 2F0MA 4QMGA 4B9XA 5C3XA 5I6YA 2O4XA 1EZ6A 3SHLA 2F0HA 2EY2A 3C1FA 1STAA 4NDXA 3SK4A 3U9OA 5I9OA 3SR1A 4KV6A 4QB4A 2WACA 4OL7A 5IGFA 4K8IA 1EY7A 1SYCA 2PYKA 4KHVA 4ME5A 2LKVA 1KDCA 4G57A 5NUCA 4EVOA 5CGKA 3D6CA 4NMZA 4WRDA 4IZ8A 4R8NA 5HURA 1A3UA 5KGUA 1SNQA 2PZUA 3BDCA 2F0GA 3NXWA 3TMEA 4K2LA 5CC4A 4K2KA 5CV4A 5EKLA 5IIFA 3EVQA 4ZUJA 1JOOA 4DF7A 1EY6A 4KTAA 3VA5A 3E5SA 4IALA 1ENAA 5IGDA 4K6DA 4KY5A 2HQEA 4DFAA 2EY5A 2F0DA 2F0OA 2SNMA 3D4WA 4ODGA 5C4HA 1EY4A 3QOLA 1EYAA 2KQ3A 2QDBA 3P75A 2EY1A 5CR3A 3NUCA 1IHZA 3R3OA 2RKSA 2EXZA 4NP5A 5JOBA 1EY9A 2EYMA 2F0EA 2NUCA 1STGA 3ITPA 5IOCA 3C1EA 2RBMA
chains in the Genus database with same CATH superfamily
1L0XB 1K0SA 4DA2A 3S2HB 1V1QA 1NNXA 2XSCA 1STYA 2E5LL 2E75C 1SMXA 4HMJA 4GKKL 1MJEA 2PZWA 1CKNB 4PNYA 4K0KL 5GROA 1YBYA 3SK6A 3EA6A 4L5TA 2JP1A 4DV6Q 1VQ8A 1SYGA 4CKBA 2I07B 1YNJD 4IPGA 4NW2A 2A6ED 3HOYH 3TS2A 4A3GB 5C6AA 2UUCL 3T1HL 2RHQB 3JAME 1SNPA 1N34L 1M8AA 1YITA 1O80A 3I4MH 4C1NK 3PO3B 1AN8A 4JI2L 1HNZQ 1MGSA 1QB5D 4LF4L 1KRSA 2Q8RE 2RSOA 3NSWA 4K14A 2QCPX 2B2VC 1S5BD 4OIJA 4IUVA 1DM0B 5GAGC 2EOTA 1HCZA 2PQAB 1FYCA 2YTYA 1ET9A 4Y7NB 4A3BG 4DR7L 3PIPA 4HMIA 1Q8IA 1G8ZD 3I8ZA 4GOPC 1RD9D 4KY6A 3ZJYC 4QGUA 5JJKA 4A93G 2R3ZA 1TIID 4JI5Q 3NQTA 1ENFA 2G9DA 4XT1B 5E4WC 1YNNC 3MXNA 4A3FG 4M8AA 1Y8PB 2D0PA 2JK8A 3UI2A 3UE1A 2VNUD 1VQMA 4DV4Q 2AMCB 4DV6L 1BCPC 5IODA 1NUCA 2LXKA 4A3MG 2RDHA 1MHWC 4KV6A 4QB4A 2MGSA 3O13A 3U9SA 1I94L 1Q12A 4BBSH 2LMCB 2Z1CA 3K7AH 5FLMG 4NMZA 3K5MA 1X3PA 2WB1E 1HNZL 5EPKA 2B2TC 3Q24A 3HFZB 3LWEA 4G7OC 3EN2A 3M3YH 1WTPA 1QOHA 1ENAA 3BJUA 2B39A 4AH6A 2FMMA 1EYAA 4IJLA 2K6AA 2N3SA 3V2TA 4X66Q 2A8VA 2AQ3B 2XRSD 2KHIA 3RZDB 4A3LH 1EFWA 1AH9A 4JI6Q 3FHWA 3FKIH 4FDBA 3AMUA 3H3VH 1JQYD 3FDTA 3SGIA 1C0AA 1VMPA 2D0OA 4JI5L 3D3RA 1U4LA 2OQKA 4FF3A 1GUNA 5JEAH 1F2YA 4OGQC 2EQSA 3S14H 1U4MA 2R7ZB 4KD3A 2WIIB 5ELOA 4C56C 4QCLA 3GO5A 3NTIA 2MFIA 2Z9HA 2DNCA 4FNFA 1A2TA 2Q2UA 2K04A 1QVFA 1NE3A 5E3FA 3PF4A 2KECA 2B63H 1N36L 5DAUA 1KHIA 4LF6Q 1DCZA 4OWWB 4PZ6A 4BY7B 4A3GG 2XWBB 1VQ6A 3N52A 2NVQH 4BA1I 3I90A 4DGZA 1H9MA 3CW2C 1SJHD 1U4PA 4F87A 1XMOQ 3G6JB 4FVMA 4IUTA 4LAAA 2CFMA 2ZM6L 4RAUC 2JQOA 4P75A 1EWIA 4X66L 1VQOA 5IP7H 5EQ0A 3FPPA 1I4QA 1A62A 3HZXA 2KHSA 4JI6L 4V190 2PNRC 2EJGC 1EEID 2B2WC 1BBWA 1BUVT 3GV3A 1YHBA 4IPHA 4X65Q 1WCMB 3W1GA 1QVGA 1XPRA 1PFBA 2F0JA 4C3JB 4CKCA 3EQLC 1U4RA 1TVXA 2RQXA 1OTCA 1DD2A 2WAQE 1WD0A 4K8IA 4ME5A 4JBMA 1QVCA 2J4XA 4HSVA 2RSNA 4BY1H 3K5OA 1MSGA 5KGUA 4GS3A 4CJ1B 1PDQA 2F4IA 4UAIA 3PIOA 1QILA 1TU2B 4R4CA 3T1YL 4LF6L 1S40A 4KKTA 3G4SA 3KUPA 2R93H 1CA6A 5CR3A 1VF5C 4DR5Q 3VA7A 2NUCA 2HQLA 1XYIA 3VYUA 5C4JB 2RCFA 5J39A 3S1QB 3H94A 1PH8A 3M4OB 3TZUA 3J81j 1KDBA 1PRTB 5C44B 3ULJA 3J80i 2V4DA 1EEFD 1STHA 3CQZB 1Q3LA 3U50C 1D2BA 4DR1L 3K7UC 3GTKB 2K32A 4YY3L 2FINB 1EY8A 2JN4A 3PMFA 4B9WA 3S15B 2R92H 4FF2A 3D6WA 2Z4HA 2OWOA 2KCTA 4J8QA 4DUZL 4LFBQ 2RHSB 1HZBA 1EIGA 3A8IE 3NWSA 1VQDA 1PA6A 1A2UA 3I3CA 3CD6A 2R7ZG 1JOQA 2CQAA 1SJED 1HQMC 4OX9Q 1TWAH 2LY7A 4HJ9A 4RFBA 2X6GA 4X6AH 2E2HB 1CQFA 1E0BA 1L0YB 2EYOA 3CMAA 3RUZA 3U4VA 2IX3A 3C3LA 2A6EC 4HTHA 4E6IA 2XVSA 2L55A 4A3DB 1K83B 3R8BA 4ZRZA 1Z7TA 1A6XA 4DR5L 1QCBD 1FJGQ 3HOUB 2F0LA 2EDGA 2ZXPA 3OWEB 3F2CA 4BY7G 3HGBA 5E7NA 4DAPA 1W2BA 2EIFA 1Y1VG 3EFXD 2YV5A 2HDMA 4HIMA 3F2DA 2E2DC 3MVVA 1QUQA 4L5QA 5CV9A 2N55A 4GKJL 5EKKA 1K28A 2Z4IA 2MUYA 3H3VC 3I91A 2Q2IA 1Q1BA 4RWSC 1KRTA 4C3IG 3IKJA 3WOEA 2JA8B 5IGFA 2O2LD 1TWCH 1WCMG 3IRBA 4A93H 2KCNA 4Z9CB 5HURA 5C3EB 3PIO3 4QIWB 2DNEA 4C3JG 4A3KH 2N8NA 3HOVG 3HOWB 4HR7B 5JVG3 3FVQA 1XX8A 1TWFB 3S2DB 1H9KA 1ZXTA 2A69C 2Z0SA 1B9NA 2MHVA 3E9HA 1IKLA 2BA0A 3G71A 2K5HA 2OQ0A 2F0DA 5IYCH 4OX9L 2Z8LA 4C2MH 1EY4A 4A3MH 3VYTA 2GVAA 3A74A 5M5XH 3NTKA 3A7AB 1STGA 1XXGA 5L37A 3X3MA 5IYDG 5C0XJ 2VY3A 5FLMH 1IBML 3NEMA 1FJGL 5C5LA 4L8JA 2R6GA 4ABNA 1LT3D 3AQQA 1V43A 4DR3Q 5FO9B 3HKZE 5C4XH 3T16A 3CCVA 4ZAIA 4J15A 3A0JA 1RDPD 4P74A 3TP6A 1HHVA 1YZ6A 5C44G 1EIHA 4EQNA 2E8GA 1Z47A 4DV3L 4QQBX 1IYUA 4AQYQ 1OO9B 3KBGA 4UP8A 4WFN3 1HNXQ 2C9OA 1ESRA 1CKMA 4OO1I 4ZUIA 5IYBH 3GTQH 2VQEQ 4RCOA 3QIAA 1P8LA 4CKEA 4WORA 1SYEA 3GTLH 4HIDA 4QUFA 4JC0A 3A5UA 3S2HH 2NVTB 1KAWA 1CKNA 1FGUA 2C35B 5G3LD 3K0XA 4YCWA 5C3WA 1R9TB 1EFID 3M85A 2HCIA 1RJTA 2SDFA 1YHQA 1VQ7A 3GTOB 4DR6Q 2YU9B 1LT5D 3SK8A 4HCEA 3W5OA 2JE6I 3Q0AA 4U68A 4A3DG 4N8X1 2R7DA 2K52A 5IP9G 3OW7A 4PMWA 3HOUG 4X62Q 3HKSA 1B1ZA 2F0MA 3PO3H 1IL8A 4ZKBB 1C7YA 2IW3A 2E74C 3SR1A 3PO2H 1VQ5A 1UUPA 3V96A 1UEAB 1SYCA 1JE4A 4JI1Q 1Q86C 2WKCA 5FK9C 2EZVA 4MN3A 4BXXG 5EKLA 4CDDC 1SSOA 4ZUJA 2ZTDA 5LL6S 4ME3A 4LK1C 1R4QB 4CBVA 2WKDA 2VQEL 1JT8A 1CK1A 3A55A 5IGDA 4L5RC 2EY5A 2F0OA 2SNMA 4CJ0B 3ND8A 1K0RA 1I4PA 3L2PA 3A7LA 5C3EG 2F0EA 3HOWG 1BCPF 4G7ZC 2IPKD 3CC4A 4RG1A 1N32Q 2Y0SB 1SE3A 5BN3A 2XN9C 3RLOA 3EROA 2UU9Q 1X3FA 2NVXB 1G51A 2X6LA 1ET6A 2CKZB 1XNRQ 4CDCC 1E1TA 1ZYRC 4L5SA 2DY8A 1SNCA 1E24A 4H13C 4A3IH 2KBNA 4X62L 1HXYD 3ONAB 4AYBG 1BF4A 4RMFA 2HT1A 1B2TA 1GOZA 5EBDA 2CH4A 3C46A 4KJOA 3NP8A 3URYA 1JOKA 5JAVA 4DK0A 2ZXOA 3MXUA 2PZTA 5IWAQ 1BOSA 1S3OA 4DUYL 3RZDH 2MO0A 3IFTA 4HIKA 1T5XD 1O7YA 3GQBA 3OW2A 1K8OA 1KL9A 1K8GA 2O5IC 1YIJA 3C2PA 1QG7A 4DK6C 2BE5D 2NN6H 4JI8L 4MIUA 4WJWA 2NBFA 3VR2A 3K6OA 4NXMQ 4MTKA 2K50A 1O7IA 3PUYA 1HR0Q 2B2YA 2C5CA 4QIWE 4EQOA 1TWGB 1DONA 3GTPB 1EU3A 3LWUA 1NSNS 1XNRL 5CV8A 3TS0A 2OXPA 2F0HA 1STAA 3J80E 2QF7A 4A3FB 1YJWA 4JI0L 3M7NA 2VXWA 1H9JA 2K5VA 3PUWA 3A5ZB 1VS0A 3J7AF 4GKKQ 1CTMA 5IIFA 4K0KQ 4K2KA 3M4YA 3WWVA 4GN4B 3HOZH 3CCJA 1X32A 3VR5A 4DFAA 1XWEA 5IWAL 4A3CH 4UPAA 3CHBD 5GAEC 2UUCQ 3T1HQ 1Y69U 1OXSC 5IGGA 1IBKL 1D5XC 3I73A 3CCEA 4KN4C 2M00A 3KJOA 3ERQA 3STBD 1LTRD 1AE2A 3TP5A 2CWPA 1I6HB 4WJ4A 1MKHA 1PH6A 4KI0A 4K5WA 4A3JB 1YI2A 1HR0L 3KF8A 4S3SA 5AFWA 3MHBA 1VF7A 2SNSA 1HH2P 2Y0SG 3CAMA 4C3HB 4OHJA 5KNDA 3MXGA 1SE2A 5M5YH 4GLXA 1VQNA 1TY0A 1BBUA 1NBWA 2IX0A 5DNFA 2DUDA 2PCFB 1ASZA 5IY0A 1Q82C 4TSSA 1Y1WH 1K3RA 2IL8A 3CRLC 4R9WA 2I5MX 5C4JH 3S1QH 1V1PB 4KLKA 5CMDA 2KHJA 5IT9E 2F0TA 1TQOA 2F0PA 1I94Q 5C44H 4OO1G 1VQAA 1KIXA 4ZK9B 3TDQA 2NZHA 3CQZH 1BDOA 3T51B 1DOLA 2ATWA 3I4NB 2PI2E 3K5LA 2IHEA 2ZJQA 4DR4Q 1EZ8A 3S1NB 3MEFA 3RR5A 3KLSX 1SBBB 3I4OA 1EYGA 4KJNA 3S15H 1RIPA 3OMCA 2B8FA 2F0FA 5COYA 4B3MQ 1PFNA 1PHJA 2GVBA 3E3XA 1E2VA 4ZQ3A 1JMCA 1I6VC 1S4ZA 1AZPA 3GTMB 1NR4A 1PVOA 4FP5D 4AIMA 2D9UA 1KDCA 5EAYA 3VR6A 4KHZA 1PTOB 4JW0A 3TMEA 2E2HH 2K5WA 3K0YA 3PUZA 2RCNA 2CH4W 2A69D 2JA7B 1K83H 1WJJA 2YTXA 1XTDA 3HOUH 4IUUA 4Q5VA 4XTCS 2KQ3A 1S5DD 5H1SE 2EY1A 3GD7A 4LW1A 3KFUA 1DGSA 3ITPA 1B3AA 2WINB 1EQQA 1LO5D 4RKLA 5DM73 1N36Q 1JWSD 1NR2A 3S1MB 2LFNA 3DEPA 4GLVB 2EE1A 1NTGA 4DR4L 4PG3A 3VDYA 4KK7A 1FL0A 3JC66 4QUCA 2JA8H 1BKBA 4B3SQ 1YNXA 5BN5A 1PXUA 3DEOA 2KCCA 4O1NA 4GOPB 4B3ML 1TWHB 1HR0W 2KENA 2ZM6Q 1GHJA 1KLUD 1GVPA 4IURA 1BVSA 3T4AC 1CKOA 1W3SA 4J1MA 1X3GA 4HN7A 4N9TA 4A3JG 3S2DH 2VUMB 2B2YC 1IW7C 4JOIA 4HIOA 2F3WA 2F0SA 3QG1A 1L0WA 4HJ5A 4C3HG 1BCPB 3NK9A 5JJZA 1E2ZA 1A3VA 1IL2A 5C4ZA 1ZEQX 5KIXA 2E2JH 1QNKA 1GO3E 5ELEA 1BQQT 3BDLA 3CMEA 1K8AC 5F2DA 4U673 5HGTA 5D14A 2N78A 2I5LX 2K01A 4H0LC 3AYHB 1N33L 1KDAA 2FFKB 3T1YQ 4LUZA 3E6ZX 2UUAL 1V8QA 4PZ8A 1M1KC 1VDZA 1FR3A 3I4LA 4Y52H 1V1OA 4JV5Q 3K81C 1SYFA 3K57A 1QE6A 4RGMA 1WFQA 1Y1VB 5C3XA 4QMGA 4B3SL 3PV0A 4DKAC 4G7HC 4R4QA 3I4NG 2E2IB 2BE5C 2PO4A 1X3EA 4LJZC 1HTLD 1HJPA 1KC8C 3DM3A 3H0GB 2GA4B 3J80L 3GV6A 4BBRB 4JG2A 4C3IB 3KF6B 2DN8A 1EY6A 4JPBW 3F8TA 4DR1Q 1TS3A 4CJ2C 4YY3Q 2N49A 1SFOH 3HOVB 4P73A 1R4PB 3AFPA 2K14A 1R9TH 2QDBA 3GTOH 5FKAC 2EXDA 4H44C 4YWKA 5JOBA 5IOCA 4DV5L 3KLRA 4DUZQ 2YU9H 3AB9A 2BOSA 2B29A 3L9AX 5M3MB 3NBHA 5M9OA 1EY0A 2JA7G 1I4HA 4TRDA 3IAYA 4EX5A 2J7ZA 3D4RA 5IT9c 1F9QA 4APVA 1LTTD 2ZJRA 2RF4A 4MZ9A 3JAMc 3DWQA 2ES2A 1ZYRD 5EJWA 2H4OA 3OHXC 2PI2A 1JB3A 1CHQD 3K8AA 4LF5Q 4JV5L 1QWYA 1B9MA 1EIYB 1JCKB 3SXHA 5FJ8G 1F2LA 3M7GA 2HUGA 1LT6D 2F52A 3D0FA 3DHQA 2NVYH 2YTVA 2F0QA 2V1CC 4A75A 3STBC 3GTJB 1J5EL 2JEBI 4CDEC 1D1IA 1Q81C 2ZTEA 4OONA 4POGA 3RZOH 1GHKA 1SE4A 4KD4A 3T53B 1RODA 1QJOA 1EU4A 1H9SB 5EGTA 2Q8TA 4EQPA 4GKJQ 5C0XH 1E2WA 1G6ZA 1FNUA 3M9BA 1CSPA 1D6EC 5GQOA 2VUMG 3OYYA 4IUPA 1KNEA 4HJAA 1NMFA 4OEMB 3QWNA 3I70A 4IQZA 2LSSA 4LF9Q 3BVZA 4PZ7A 2NVXH 2UXBQ 3CCUA 3TQYA 2WFWA 5IT9L 4A4IA 4F7XA 1Q8KA 3JAML 1WOCA 1VQIA 2HHHL 4X64Q 4LFBL 3I4MB 4HJ7A 5M3FG 1STBA 3QB3A 4LF5L 4NDXA 4HJ8A 1VQCA 3I7FA 4OO1H 3KK7A 3TEHB 2CHBD 1ILPA 4NB3A 3HRZC 1IBMQ 4EVOA 2LKVA 2L11A 3D6CA 1B44D 3PSIA 1YJ9A 5LL6X 5D3DA 1VQ4A 3FMCA 4XDXA 3NQIA 4JI3L 4XQJA 3QJYA 1N8RC 1CSQA 3H0GG 5FLXE 4JOIC 4X3KA 3RNUA 1LTAD 3CRKC 3CCSA 3R3OA 4BBRG 2VW9A 1EY9A 2YYZA 4A3BH 4UHVA 5CV6A 2OTJA 4DV3Q 2WV6D 1VQGA 4LF9L 1W6JA 3WOFA 1ZKOA 3WDNA 1SNDA 1EY5A 2UXBL 1EWCA 4KMUC 3PUXA 1LV9A 2MNAA 1PH1A 4BBSB 2L12A 1Q46A 3OIPA 1NMGA 3G48A 3LGJA 4A3FH 2Q2HA 4X64L 2OF1A 4OELB 4GN5A 3RD4A 3EJIA 4H7BA 5KEEA 2CVRA 5M3MG 2ENBA 5FOBB 2OEOA 4HCSA 5EPJA 3K59A 1HUNA 2KEEA 4GZYC 1CA5A 1ENCA 1IBLQ 4O2DA 4R4OA 3I72A 2LS01 1PFSA 2F0NA 1D1KA 1F9PA 2N88A 1QZHA 4AYBB 1K9MC 3TZDA 2F0WA 1XPUA 2FXQA 2GN5A 3BVGA 1RL2A 1PH2A 4DXFA 2A73B 4MHEA 4IFDI 1X54A 2F0UA 5HGQA 3OMGA 4IFDJ 3CF5A 1DYQA 2K03A 4TKOB 3KBXA 1SROA 2CWAA 4A3JH 4I7ZC 4GNXB 3Q8DA 5FO8B 4G4KA 1CZWA 3KDFA 2Z6BA 5D65A 1M4VA 3CCLA 4C3HH 1O78A 5DEHA 5KYIA 5LMNQ 3S1RB 1XPOA 3VYRA 5DLQE 3HOYG 1KTKA 3Q22A 2AUJD 1TY2A 3KJPA 4FO2A 5I2XA 3I4MG 5K36G 4WRDA 1IBLL 3SEBA 5T1GA 1IYJB 2VB3X 1JOOA 4DF7A 3VA5A 4A3GH 2H1EA 5T1IA 4K6DA 5LMUL 4OWTB 3M4QA 1PYBA 3J7YW 4NP5A 1C8CA 3S1NH 2HCCA 2Z6KA 5M5WB 2BH2A 4FYDA 2KA7A 2XIWA 4LUOA 5GADC 3UDFA 4K8JA 4C1NI 5G3LF 1TS4A 2BDNA 2PQAA 2MO1A 4DUYQ 1SDFA 4Y7NH 1K8MA 3J7ZC 5LMNL 1S5ED 3MEHA 2M2LA 3RN2A 4RA8A 3CCQA 3RN5A 1PTOH 4JI8Q 4IO9A 4ULLA 4TVAB 1G291 5IGEA 4BBSG 4P2CB 1B70B 1DOKA 1IW7D 2G9HD 2K28A 5BN4A 1QNUA 1X65A 2L15A 2F3IA 1WTRA 2OTLA 1E3PA 3H15A 1JB7A 3EIVA 1X3QA 4YWLA 4DNRB 3N6RA 2XNAC 3CPWA 4OWXB 5FO7B 4NXNL 2K1BA 3NPPA 1X56A 2UUBQ 4LF8L 1A8VA 3BDOA 2HIVA 1X6OA 4O42A 4JI0Q 3S1MH 2RDFA 3LNNA 1SR3A 3NTHA 4LUVA 4QY7A 4DV0L 2VQFL 3ER0A 2F0KA 3HEJA 2A68D 3NHHA 1KNAA 1TS2A 2EYJA 1CI3M 2XWJB 4KHPQ 5FLXc 3K58A 4CGYB 4K5XA 3MZ5A 1TWHH 1PH3A 3SVMA 1O7LA 5JEAG 3V05A 4UP7A 1OXXK 4XT3B 4YCVA 3FP9A 1NAPA 2DGYA 1IBKQ 1WI5A 3SHLA 3L0OA 1TWAB 1N9WA 2RA4A 4BS9A 4OL7A 2IHFA 2WB1B 1S72A 1MIUA 5A35A 1EY7A 4N8FA 4G57A 4IZ8A 1HZAA 1FNVA 1WTVA 1SNQA 1OXVA 3NXWA 1L1OB 2CW0D 1PMRA 2R7ZH 3F2UA 3MWYW 1UEBA 3IFDA 2DJFC 2XGTA 1Z9FA 1GJXA 2FMCA 4KY5A 3CPFA 4FXKC 4UDUC 1PLFA 1TKWB 2UUBL 1QUQB 4H02A 3Q6SA 3SK5A 3K5NA 2K5NA 2EYMA 1LTLA 1WD1A 2G5DA 2RBMA 4DN4M 5BR8L 5FLXL 4BY7H 5J1ZA 1EL0A 2UXDL 1EQTA 1SMYC 1SN8A 2NTTA 2D5DA 1Y1VH 1AEXA 1YHAA 2IY5B 3TBIB 4KHPL 1GUTA 2RDGA 5I6WA 1HPCA 4A3KB 3NE5B 1PRTD 3NBIA 4AYBE 4POFA 3CU7A 3PUVA 4A3EB 1ML0D 3BZKA 4DNIA 4IUQA 3J81i 2FHTA 4BBRH 2AUKA 4C3IH 3J7A5 5JJIA 3ICEA 5LMNW 3D4DA 2VS1A 3T56B 2JA6B 1D7QA 1VQKA 4MTNA 1WCMH 5M5XB 4FXGC 4JYAQ 1WTHA 3HOVH 4C3JH 1XNQQ 1GUGA 1GXDC 3PQIA 1J8IA 1B4OA 1V9PA 4ZCKA 1IZ6A 3SDZA 3I2ZA 5M3MH 4GLAC 1SYBA 4R4IA 1P16A 4RH6A 5IYDH 4IJHA 5KYLA 5KRUA 1WTXA 3J7AV 2EYPA 1DOMA 3DXJC 4IFDG 4RKBA 5K5PA 1JWUD 1KQSA 3IL8A 5CYUA 2QA4A 2AHOB 4DV7L 1ICWA 4BA2I 4ID6A 3S24A 2WAQB 4Q0FA 4QJFA 3P7JA 3BS1A 1J9OA 4B3RQ 3AFQA 1M90C 2Z6KC 1JE5A 2AQ2B 3M4OH 1S5CD 1I3QB 1CHPD 3C1FA 3HP3A 4LF7Q 3SK4A 2R92G 2WACA 3HOXB 5D3IB 4M1UB 1H9SA 3GTGB 5CORA 5CGKA 1IKMA 3OTOL 3K80C 1ICFB 3X3NA 4B08A 2NN6I 1U5KA 1OXTA 5CC4A 3GTKH 2F0GA 4ALPA 4JYAL 4L63B 3E5SA 1PTOC 1WTQA 4IALA 1XNQL 2WB1G 1EWHA 1JJ2A 3CKIB 3QOLA 2L1BA 2PMZB 4A76A 2LXJA 2RKSA 2ASBA 3QOJA 2B2UA 2EJFC 5KNBA 4IUNA 4KKSA 2B8GA 2AWOA 5K36H 2I46A 2VZAA 3D31A 4HSPA 5A2QE 1WTWA 3PO2B 2Y0SE 1SYDA 4TQUS 3MFYA 1B50A 2AKWB 5ELBA 1VCIA 4A3DH 1HNWQ 5IGBA 2OCEA 1ONLA 2A5HA 5IP9H 1XMQL 4B3RL 1A63A 4DNTB 5ELDA 4LF7L 4PV1C 3L7ZC 4JBKA 4XIGS 1UAPA 4FF1A 4YIJA 5JVH3 2IJ0A 2QILA 4A3KG 2ICEC 1N33Q 1HFNA 1IYVA 4BXXH 4A3EG 4FXDA 2UUAQ 3BG3A 1PH5A 5J22A 4IN3A 4PMCA 3DMUA 3PF5A 1A0IA 5IYCG 1E7ZA 4DK1A 3P1HA 1VQPA 2JA6G 5CV7A 2BA1A 2K33A 1G6PA 1U9RA 2ICIA 2MP1A 5C3EH 3HOWH 1JWMD 1LTSD 1TR5A 2X69A 3CP0A 1TWFH 2ID0A 4A3IB 2PW5A 4RCNA 3E9IA 1PH4A 3BZCA 3J80c 1FNWA 3MAQA 3T13A 3S16B 5C4XG 1HNWL 1B3QA 3AEVA 2L5TA 4B9XA 2R61A 1D5MC 2EY2A 1LYLA 1FVIA 4DV5Q 3U9OA 2JA5B 3R2IA 4O0AA 4JVZA 1UE6A 2PYKA 5M3FB 5NUCA 1TS5A 2BH8A 3ZYYX 2A68C 2WAQG 1C9OA 2JJQA 2QEXA 3B6YA 3KOJA 3R2TA 4LMQD 5IYBG 5CV4A 2KJXA 4DAYB 3EVQA 5AJ3Q 1RCVD 1RF2D 4XQQA 1GUWA 2K5QA 1CM9A 3HOXG 1HA6A 4GNXA 4HAEA 4DV4L 3DWAA 1PH7A 2QDLA 5CBAE 1WVLA 2EXZA 1MSHA 5EPLA 5I4DA 4IPDA 2F4VQ 1J5EQ 5IE8A 1PZKD 3S1RH 3FRPB 4RHRA 2UXCQ 3UDGA 2MJ8A 1T5EA 1I50B 1H95A 2CW0C 1EQVA 3HKZB 4RHSA 2A74C 3TRZA 2NVTH 1K3BC 1JORA 4ZYSA 4PQXA 1KD1C 2IWHA 5LHY1 1SNOA 1SLJA 1YEZA 3PO3G 4EQ5A 1F2ZA 3BYYB 3PIP3 1FGBD 4JK1C 1XJVA 3UDXA 1F2MA 3HOZB 3G7LA 3PO2G 1CT1D 1G91A 1WYDA 2SEBD 4PMBA 2D2CC 1STNA 2EYFA 1I4XA 3H09A 4F88A 5HY6A 1AW7A 1HQRD 3H91A 2NTSA 1SEBD 2HHHQ 1BNZA 1EOTA 1SNMA 1G2SA 4DAVA 2ZT9C 3PGZA 2WP8J 1B53A 5AJ3L 5EKIA 2EJMA 1PRTC 2DY7A 2JYOA 2TMPA 5M5WH 1DJRD 3TSSA 4ZKCB 3UE0A 4R1JA 2F3VA 4DPGA 1YVCA 1D5ZC 3GP7A 3KF8B 1SE8A 2I0QA 4LFCQ 1G2TA 5ISRA 2EYLA 3S17B 1TT2A 2O5JC 4J6HA 2P5ZX 1SAPA 5M5YB 3MFGA 2A6HC 5E1FA 1CUKA 5E4XA 2F4VL 3DUZA 3TP7A 1MJCA 4JI3Q 3TN2A 4XQNA 3NENA 1JC7A 2VL6A 2UXCL 4N9PA 3H3VI 1OXUA 1J6QA 3M4PA 2B2UC 3W2DA 5I6YA 3FEWX 1Y1WB 2O4XA 3OPOA 4A3IG 1XMOL 5I9OA 2K7VA 3BU2A 4FF4A 2PMZE 1C4QA 3F1ZA 5JEAJ 4IPCA 3HOYB 4IFDH 4R8NA 1A3UA 4WJ3M 2BCOA 1DZ1A 3J81E 1EOVA 1MD2D 3OOCA 2JA5G 3QO2A 3R93A 3VR3A 4DAMA 4X65L 3A8KE 4KKUA 4I7AA 2A19A 4IOCA 1CFMA 2K05A 3A54A 2FJ2A 1U0LA 4UY8C 3DWPA 2NN6G 2IX1A 3KLWA 1KXLA 3KLSA 4LFCL 3RLNA 4YWMA 4EGVA 3PCOB 3DLLA 1I4RA 1SMYD 3U58A 1PFMA 4QF4A 3CCMA 4X3TA 5A2QL 2K5DA 3D8GA 3CC2A 1YNJC 5IGCA 3EBEA 2L0CA 1B7YB 1RTNA 1I5FA 2JEAI 1VQ9A 2M9VA 3MXNB 3RLFA 1L1OA 4KN7C 2AWNA 3BYTB 3HKZG 1EIFA 1JJCB 3OIQA 1TWGH 3GTPH 3ULLA 2HDLA 5EBCA 4UP9A 1HUMA 2TSSA 3BZDB 4I65A 2Q2TA 3K7AB 3HOZG 2QKIC 5C5MA 3MXPA 2F1MA 1D8LA 2KCMA 4A3CG 4RGTA 4P72A 3I55A 4CDFC 5JPMC 3M3YB 2J0TD 1AP0A 1EYDA 1VQHA 3ULPA 2CCZA 5DM63 4IOAA 3QR8A 1CZGA 1KAAA 3CXCA 1JR0D 4A3EH 1KABA 2PQEA 4GNXC 1NCVA 5CV5A 3JAMi 2NWGA 3FKIB 1LTGD 3BVMA 1RHPA 5LMUQ 3FPUB 1TXYA 2A1AA 1EQRA 4DU9A 3G6EA 2JA6H 1BXTA 2E2JB 2NZOA 5CBEE 1T9HA 5C0XI 1I6HH 1Y8NB 3S14B 1PV4A 4KHVA 1ASYA 1O7ZA 4RGOS 4K2LA 1XTCD 1SXTA 3KYHC 1Y1WG 2ZXRA 1PTOD 3A56A 4V0BA 4XYQA 5ELNA 2RVLA 2HQEA 4OIKA 2B63B 3E0EA 1HZ9A 3P75A 1VQBA 2ZTCA 1EUJA 1F9SA 4B3TQ 1S5FD 1A15A 1VQLA 2IT1A 4X3SA 2R7FA 2NVQB 1B8AA 3MTSA 1VQJA 1GUOA 3TP8A 5ELFA 3Q23A 2F0IA 1V1PA 4QL5A 4L6TB 1KLGD 1I3QH 1AZQA 4JI4Q 4NXNQ 1II3A 4LFAQ 4CHTB 1E22A 1ESFA 3HOXH 1PH9A 4LF8Q 4DV1Q 3GTGH 1PTOF 2ZJPA 2KOLA 1BO0A 1Y14B 2CQOA 1SFOB 4DV0Q 3I4NH 1Q7YC 3OWFA 2VQFQ 1AFPA 1I4GA 4YCUA 4JBWA 2NZ1D 1VMCA 3OSOA 2BDOA 1NY4A 2KUMA 1LT4D 2F0VA 1YNND 3MA2B 2EYHA 3NBHB 4BY1B 2AQ1B 1JICA 3DM1A 3GTMH 2KEDA 4JI7Q 2F03A 1BCPD 3GDEA 4ZLTF 4DR3L 5GAHC 1GUSA 3L3OC 4LWCA 5J3BA 2OT2A 2QW7A 5I2YA 4JCVE 3J81c 1GM5A 2L4NA 4B3TL 2K75A 1IXRA 2HD3A 1HTPA 1RKNA 2R93B 1EYCA 4K5VA 2JA7H 4AQYL 1H9RA 1HNXL 5ELCA 3ND9A 2NVYB 4NKLA 2EPBA 2VB2X 2EY6A 4ILWA 5JPNC 2JA8G 2XRQD 1GD7A 4X3UA 4JI4L 4HEDA 1HZCA 3RZOB 1SRUA 4LFAL 1STEA 4DV1L 2B2VA 4DV2Q 2PPBC 1K73C 5FJ8H 1BBXC 5BR8Q 4A3LG 3FKIG 3VR4A 2UXDQ 1HFGA 2PZUA 2JSOA 2EVBA 3U4ZA 2R92B 4DR6L 3SE0A 4K6LA 1VQEA 4GOPA 4KTAA 1ILQA 4XYOA 1QZGA 1X9NA 3HS0C 3NELA 1L1OC 1NJIC 3J81L 4ODGA 5C4HA 3AU7A 2VUMH 4JI7L 1Q90A 1HA5A 2H5XA 1IHZA 5KNCA 3P20A 1GKHA 3C1EA 1HRJA 3CC7A 3UDIA 3E0JA 2MQHA 4BWGB 2MPMA 4P71A 4JI1L 3S16H 2B63G 1Z6HA 2SOBA 3HG9A 2I5HA 2KVMA 1BR9A 1Q1EA 3LX0A 4OXPA 2JA5H 4DXGA 1LUZA 1JJGA 2XTIA 5M3FH 2B2TA 2PNHA 1X55A 2QGQA 1C48A 1UNSA 1LM0A 1UE1A 4DAYA 2JA9A 2NB0A 3TREA 3S9WA 1RTOA 4DV2L 5IP7G 1LTBD 1N32L 1Y8OB 4A3BB 1E1OA 3I56A 4DV7Q 2PW7A 4KY7A 1F9RA 5I9PA 4YHHQ 1TWCB 2UU9L 1LACA 1W6KA 1UWVA 4JBJA 2E2IH 2DJGC 4A93B 1DXMA 4NPSA 4DR2L 1VQFA 4F8MA 3H0GH 4DR2Q 1FD7D 4RGNA 2E76C 2NYZD 1PYWD 4LNQA 5JJLA 1I50H 2K4KA 2E5LQ 3KF6A 3NWTA 3OTOQ 4C2MB 4A3MB 4BY1G 4R4TA 2A6HD 1A3TA 2L9HA 2B3GA 1F77A 1LABA 1LTID 1PZID 2Q8IB 3H6MA 1UE7A 1WTOA 4DK3C 2JXMB 3W3AA 3A8JE 1EZ6A 2R93G 1CQVA 1PRTF 1N34Q 1AE3A 4XXEA 1PYSB 4R8IA 4JI2Q 1UE5A 1L2FA 3W1BA 5C4XB 3VYSA 4LF4Q 4NXML 4MNOA 3BDCA 2D62A 3CCRA 3RMHA 1YJNA 4GN3B 1MBYA 3KDFB 5C0XG 3F2BA 4YHHL 2B2WA 3S17H 3D4WA 1XMQQ 3ERSX 3GTQB 1MI2A 2HIXA 4DR7Q 3MC0B 3GTJH 2ALYB 3NUCA 3GTLB 1LLRD 5TSSA 2QEJC 1PZJD
chains in the Genus database with same CATH topology
1L0XB 4DA2A 3S2HB 2XSCA 1STYA 2E75C 4HMJA 2PZWA 4PNYA 3SK6A 3EA6A 2JP1A 1SYGA 4CKBA 2I07B 1YNJD 4NW2A 2A6ED 4A3GB 5C6AA 3JAME 1SNPA 1M8AA 1O80A 4C1NK 3PO3B 1AN8A 1MGSA 1QB5D 2Q8RE 2RSOA 3NSWA 4K14A 2QCPX 2B2VC 1S5BD 4OIJA 4IUVA 1DM0B 2EOTA 1HCZA 1FYCA 1ET9A 4Y7NB 4HMIA 1Q8IA 1G8ZD 3I8ZA 1RD9D 4KY6A 2R3ZA 1TIID 3NQTA 1ENFA 2G9DA 4XT1B 5E4WC 1YNNC 3MXNA 4M8AA 1Y8PB 3UI2A 2VNUD 1BCPC 5IODA 1NUCA 2RDHA 4KV6A 4QB4A 2MGSA 3O13A 3U9SA 1Q12A 2LMCB 2Z1CA 4NMZA 3K5MA 1X3PA 5EPKA 2B2TC 3Q24A 4G7OC 3LWEA 1WTPA 1QOHA 1ENAA 2B39A 2FMMA 1EYAA 2K6AA 3V2TA 2AQ3B 2XRSD 3RZDB 3AMUA 1JQYD 3FDTA 1VMPA 3D3RA 1U4LA 4FF3A 1GUNA 5JEAH 1F2YA 4OGQC 1U4MA 2R7ZB 4KD3A 2WIIB 4C56C 4QCLA 3GO5A 3NTIA 2DNCA 4FNFA 1A2TA 2K04A 5E3FA 2KECA 5DAUA 1DCZA 4BY7B 2XWBB 3N52A 4BA1I 3I90A 4DGZA 1H9MA 4F87A 1SJHD 1U4PA 3G6JB 4FVMA 4IUTA 4LAAA 4RAUC 5EQ0A 3FPPA 1I4QA 3HZXA 2KHSA 4V190 2PNRC 2EJGC 1EEID 2B2WC 1BUVT 3GV3A 1WCMB 1PFBA 2F0JA 4C3JB 4CKCA 3EQLC 1U4RA 1TVXA 2RQXA 1DD2A 1WD0A 4K8IA 4ME5A 2J4XA 4HSVA 2RSNA 3K5OA 1MSGA 5KGUA 4CJ1B 1PDQA 2F4IA 4UAIA 1QILA 1TU2B 4KKTA 3KUPA 1CA6A 5CR3A 1VF5C 3VA7A 2NUCA 1XYIA 3VYUA 5C4JB 5J39A 3S1QB 3H94A 3M4OB 3TZUA 1KDBA 1PRTB 5C44B 2V4DA 1EEFD 1STHA 3CQZB 1Q3LA 1D2BA 3GTKB 2K32A 2FINB 1EY8A 4B9WA 3PMFA 3S15B 4FF2A 3D6WA 2Z4HA 4J8QA 3A8IE 1EIGA 3NWSA 1A2UA 3I3CA 1JOQA 2CQAA 1SJED 1HQMC 2LY7A 4RFBA 2X6GA 2E2HB 1CQFA 1E0BA 1L0YB 2EYOA 3RUZA 2IX3A 3C3LA 2A6EC 4HTHA 4E6IA 2XVSA 2L55A 4A3DB 1K83B 3R8BA 4ZRZA 1Z7TA 1A6XA 1QCBD 3HOUB 2F0LA 2EDGA 2ZXPA 3OWEB 3HGBA 4DAPA 3EFXD 2HDMA 2E2DC 3MVVA 5CV9A 2N55A 5EKKA 2Z4IA 2MUYA 3H3VC 3I91A 1Q1BA 4RWSC 4C3IG 3IKJA 3WOEA 2JA8B 5IGFA 2O2LD 2KCNA 4Z9CB 5HURA 5C3EB 3PIO3 4QIWB 2DNEA 4C3JG 3HOWB 4HR7B 5JVG3 3FVQA 1XX8A 1TWFB 3S2DB 1H9KA 1ZXTA 2A69C 1B9NA 2MHVA 1IKLA 2BA0A 2F0DA 2Z8LA 1EY4A 3VYTA 3NTKA 3A7AB 1STGA 1XXGA 3X3MA 5C0XJ 5C5LA 4L8JA 2R6GA 4ABNA 1LT3D 1V43A 5FO9B 3T16A 4ZAIA 1RDPD 1HHVA 3TP6A 1EIHA 4EQNA 1Z47A 1IYUA 1OO9B 3KBGA 4WFN3 2C9OA 1ESRA 4OO1I 4ZUIA 4RCOA 3QIAA 4CKEA 4WORA 1SYEA 4QUFA 2NVTB 5G3LD 5C3WA 1R9TB 1EFID 3M85A 2HCIA 1RJTA 2SDFA 3GTOB 2YU9B 1LT5D 3SK8A 4HCEA 2JE6I 3Q0AA 4U68A 3OW7A 4PMWA 1B1ZA 2F0MA 4ZKBB 1IL8A 2IW3A 2E74C 3SR1A 1UUPA 3V96A 1UEAB 1SYCA 1JE4A 2WKCA 5FK9C 2EZVA 4MN3A 5EKLA 1SSOA 4ZUJA 5LL6S 4LK1C 1R4QB 4CBVA 2WKDA 1CK1A 3A55A 5IGDA 2EY5A 2F0OA 2SNMA 4CJ0B 3ND8A 1I4PA 3A7LA 2F0EA 1BCPF 4G7ZC 2IPKD 2Y0SB 1SE3A 5BN3A 2XN9C 3EROA 2NVXB 2X6LA 1ET6A 1ZYRC 2DY8A 1SNCA 4H13C 1HXYD 3ONAB 1BF4A 1B2TA 1GOZA 5EBDA 3C46A 4KJOA 3NP8A 3URYA 1JOKA 5JAVA 4DK0A 2ZXOA 3MXUA 2PZTA 1BOSA 3IFTA 1T5XD 1O7YA 3GQBA 1K8OA 2O5IC 3C2PA 1QG7A 2BE5D 2NN6H 4MIUA 4WJWA 2NBFA 3VR2A 3K6OA 3PUYA 2B2YA 2C5CA 4EQOA 1TWGB 1DONA 3GTPB 1EU3A 3LWUA 1NSNS 5CV8A 2OXPA 2F0HA 1STAA 3J80E 2QF7A 4A3FB 3M7NA 2VXWA 1H9JA 3PUWA 3J7AF 1CTMA 5IIFA 4K2KA 3M4YA 1X32A 3VR5A 4DFAA 1XWEA 3CHBD 1Y69U 1OXSC 5IGGA 1D5XC 3I73A 4KN4C 2M00A 3ERQA 1LTRD 3TP5A 1I6HB 4KI0A 4K5WA 4A3JB 3KF8A 4S3SA 5AFWA 3MHBA 1VF7A 2SNSA 4C3HB 4OHJA 5KNDA 3MXGA 1SE2A 1TY0A 2IX0A 5DNFA 2PCFB 4TSSA 2IL8A 3CRLC 4R9WA 1V1PB 5CMDA 5IT9E 2F0TA 1TQOA 2F0PA 4OO1G 4ZK9B 3TDQA 1BDOA 3T51B 1DOLA 3I4NB 3K5LA 1EZ8A 3S1NB 3KLSX 1SBBB 4KJNA 3OMCA 2B8FA 2F0FA 5COYA 1PFNA 1E2VA 4ZQ3A 1I6VC 1S4ZA 1AZPA 3GTMB 1NR4A 4FP5D 2D9UA 1KDCA 3VR6A 4KHZA 1PTOB 3TMEA 2K5WA 3K0YA 3PUZA 2A69D 2JA7B 4IUUA 4Q5VA 4XTCS 2KQ3A 1S5DD 2EY1A 3GD7A 3ITPA 1B3AA 2WINB 1LO5D 4RKLA 5DM73 1JWSD 1NR2A 3S1MB 2LFNA 3DEPA 2EE1A 4KK7A 4QUCA 5BN5A 1PXUA 3DEOA 2KCCA 4O1NA 1TWHB 1GHJA 1KLUD 4IURA 3T4AC 4J1MA 4HN7A 4N9TA 2VUMB 2B2YC 1IW7C 2F3WA 2F0SA 3QG1A 4C3HG 1BCPB 3NK9A 5JJZA 1E2ZA 1A3VA 5C4ZA 1ZEQX 5KIXA 1QNKA 5ELEA 1BQQT 3BDLA 5F2DA 4U673 5HGTA 5D14A 2K01A 4H0LC 1KDAA 2FFKB 3E6ZX 1V8QA 1VDZA 1FR3A 3I4LA 1V1OA 1SYFA 3K57A 1QE6A 4RGMA 1Y1VB 5C3XA 4QMGA 3PV0A 4G7HC 2E2IB 2BE5C 2PO4A 4LJZC 1HTLD 3H0GB 2GA4B 3J80L 3GV6A 4BBRB 4C3IB 2DN8A 1EY6A 1TS3A 4CJ2C 3HOVB 1R4PB 2QDBA 5FKAC 4H44C 5JOBA 5IOCA 3KLRA 3AB9A 2BOSA 3L9AX 5M3MB 3NBHA 5M9OA 1EY0A 1I4HA 4TRDA 3IAYA 2J7ZA 3D4RA 1F9QA 1LTTD 3DWQA 1ZYRD 5EJWA 2H4OA 3OHXC 1JB3A 1CHQD 1QWYA 1B9MA 1JCKB 3SXHA 1F2LA 3M7GA 2HUGA 1LT6D 3DHQA 2F0QA 3GTJB 2JEBI 1D1IA 1GHKA 1SE4A 4KD4A 3T53B 1RODA 1QJOA 1EU4A 1H9SB 5EGTA 2Q8TA 4EQPA 5C0XH 1E2WA 1G6ZA 1FNUA 1D6EC 4IUPA 1KNEA 3QWNA 3I70A 4IQZA 3BVZA 5IT9L 4F7XA 3JAML 3I4MB 1STBA 3QB3A 4NDXA 4OO1H 3KK7A 2CHBD 1ILPA 3HRZC 4EVOA 2LKVA 2L11A 3D6CA 1B44D 5LL6X 5D3DA 3FMCA 4XDXA 3NQIA 4XQJA 3QJYA 5FLXE 4X3KA 1LTAD 3CRKC 3R3OA 1EY9A 2YYZA 5CV6A 2WV6D 1W6JA 3WOFA 1ZKOA 3WDNA 1SNDA 1EY5A 1EWCA 4KMUC 3PUXA 1LV9A 4BBSB 2L12A 3OIPA 2OF1A 3RD4A 3EJIA 4H7BA 5KEEA 2CVRA 2ENBA 5FOBB 2OEOA 4HCSA 5EPJA 3K59A 1HUNA 2KEEA 4GZYC 1CA5A 1ENCA 3I72A 2LS01 2F0NA 1D1KA 1F9PA 2N88A 4AYBB 3TZDA 2F0WA 3BVGA 4DXFA 2A73B 4MHEA 4IFDI 2F0UA 3OMGA 4IFDJ 1DYQA 2K03A 4TKOB 3KBXA 4I7ZC 5FO8B 4G4KA 1CZWA 5D65A 1M4VA 1O78A 5DEHA 5KYIA 3S1RB 3VYRA 1KTKA 3Q22A 2AUJD 1TY2A 4FO2A 5I2XA 5K36G 4WRDA 3SEBA 5T1GA 2VB3X 1JOOA 4DF7A 3VA5A 2H1EA 5T1IA 4K6DA 3J7YW 4NP5A 1C8CA 2HCCA 5M5WB 4FYDA 2KA7A 2XIWA 4C1NI 4K8JA 5G3LF 1TS4A 2BDNA 1SDFA 1K8MA 1S5ED 3MEHA 2M2LA 4RA8A 1PTOH 4ULLA 1G291 5IGEA 4P2CB 1DOKA 1IW7D 2G9HD 2K28A 5BN4A 1QNUA 1WTRA 1X3QA 4DNRB 3N6RA 2XNAC 5FO7B 2K1BA 3NPPA 3BDOA 4O42A 2RDFA 3LNNA 3NTHA 2F0KA 3HEJA 2A68D 3NHHA 1KNAA 1TS2A 2EYJA 1CI3M 2XWJB 3K58A 4CGYB 4K5XA 3MZ5A 3SVMA 1O7LA 5JEAG 3V05A 1OXXK 4XT3B 1NAPA 3SHLA 1TWAB 2RA4A 4BS9A 4OL7A 2WB1B 5A35A 1EY7A 4G57A 4IZ8A 1FNVA 1WTVA 1SNQA 1OXVA 3NXWA 2CW0D 1PMRA 3F2UA 3MWYW 3IFDA 1GJXA 2FMCA 4KY5A 4FXKC 4UDUC 1PLFA 1TKWB 3Q6SA 3SK5A 3K5NA 2EYMA 1WD1A 2RBMA 4DN4M 5FLXL 5J1ZA 1EL0A 1EQTA 1SMYC 2NTTA 2D5DA 1AEXA 3TBIB 1GUTA 2RDGA 5I6WA 1HPCA 4A3KB 1PRTD 3NE5B 3NBIA 3CU7A 3PUVA 4A3EB 1ML0D 4IUQA 2FHTA 2AUKA 3D4DA 3T56B 2JA6B 5M5XB 4FXGC 1GUGA 1GXDC 1J8IA 1B4OA 3SDZA 1SYBA 4RH6A 5KYLA 5KRUA 1WTXA 3J7AV 2EYPA 1DOMA 3DXJC 4IFDG 4RKBA 5K5PA 1JWUD 3IL8A 5CYUA 1ICWA 4BA2I 4ID6A 2WAQB 4Q0FA 3BS1A 3P7JA 1J9OA 2AQ2B 1S5CD 1I3QB 1CHPD 3C1FA 3HP3A 3SK4A 2WACA 3HOXB 5D3IB 4M1UB 1H9SA 3GTGB 5CORA 5CGKA 1IKMA 3X3NA 4B08A 2NN6I 1OXTA 5CC4A 2F0GA 4L63B 3E5SA 1PTOC 1WTQA 4IALA 1EWHA 3CKIB 3QOLA 2L1BA 2PMZB 2RKSA 3QOJA 2B2UA 2EJFC 5KNBA 4IUNA 4KKSA 2B8GA 2AWOA 5K36H 2I46A 5A2QE 3D31A 4HSPA 1WTWA 3PO2B 1SYDA 4TQUS 3MFYA 1B50A 5ELBA 1VCIA 5IGBA 1ONLA 2A5HA 4DNTB 5ELDA 4PV1C 3L7ZC 4XIGS 1UAPA 4FF1A 4YIJA 5JVH3 2IJ0A 2QILA 1HFNA 2ICEC 1IYVA 4FXDA 3BG3A 5J22A 4IN3A 4PMCA 3DMUA 4DK1A 3P1HA 5CV7A 2BA1A 2K33A 1U9RA 2ICIA 2MP1A 1JWMD 1LTSD 1TR5A 2X69A 2ID0A 4A3IB 2PW5A 4RCNA 1FNWA 3MAQA 3T13A 3S16B 2L5TA 4B9XA 2R61A 1D5MC 2EY2A 2JA5B 3U9OA 3R2IA 2PYKA 5M3FB 5NUCA 1TS5A 3ZYYX 2A68C 3R2TA 4LMQD 5CV4A 2KJXA 3EVQA 1RCVD 1RF2D 4XQQA 1GUWA 2K5QA 1CM9A 1HA6A 4HAEA 3DWAA 5CBAE 1WVLA 2EXZA 1MSHA 5EPLA 5I4DA 1PZKD 3FRPB 4RHRA 2MJ8A 1T5EA 1I50B 2CW0C 1EQVA 3HKZB 4RHSA 2A74C 1JORA 4ZYSA 4PQXA 2IWHA 5LHY1 1SNOA 1F2ZA 3BYYB 3PIP3 1FGBD 4JK1C 3HOZB 1F2MA 3G7LA 1CT1D 1G91A 2SEBD 4PMBA 2D2CC 1STNA 2EYFA 1I4XA 3H09A 4F88A 1AW7A 1HQRD 3H91A 2NTSA 1SEBD 1BNZA 1EOTA 1SNMA 1G2SA 4DAVA 2ZT9C 2WP8J 1B53A 5EKIA 2EJMA 1PRTC 2DY7A 2JYOA 2TMPA 1DJRD 3TSSA 4ZKCB 2F3VA 1D5ZC 3GP7A 1G2TA 5ISRA 2EYLA 3S17B 1TT2A 2O5JC 4J6HA 1SAPA 5M5YB 3MFGA 2A6HC 5E1FA 5E4XA 3DUZA 3TP7A 3TN2A 4XQNA 1JC7A 4N9PA 1OXUA 2B2UC 3W2DA 5I6YA 3FEWX 1Y1WB 2O4XA 3OPOA 5I9OA 2K7VA 4FF4A 1C4QA 5JEAJ 3HOYB 4IFDH 4R8NA 1A3UA 2BCOA 1DZ1A 3J81E 1MD2D 3OOCA 3QO2A 3R93A 3VR3A 3A8KE 4KKUA 1CFMA 2K05A 3A54A 2FJ2A 3DWPA 2NN6G 2IX1A 3KLSA 4EGVA 1I4RA 1SMYD 1PFMA 4QF4A 4X3TA 5A2QL 2K5DA 3D8GA 1YNJC 5IGCA 2L0CA 1RTNA 2JEAI 2M9VA 3RLFA 4KN7C 2AWNA 3BYTB 3OIQA 2HDLA 5EBCA 1HUMA 2TSSA 3BZDB 4I65A 3K7AB 2QKIC 5C5MA 3MXPA 2F1MA 4RGTA 5JPMC 3M3YB 2J0TD 1AP0A 1EYDA 5DM63 1CZGA 1KAAA 1JR0D 1KABA 2PQEA 1NCVA 5CV5A 2NWGA 3FKIB 1LTGD 3BVMA 1RHPA 3FPUB 4DU9A 1BXTA 2E2JB 5CBEE 5C0XI 1Y8NB 3S14B 4KHVA 1O7ZA 4RGOS 4K2LA 1XTCD 1SXTA 2ZXRA 1PTOD 3A56A 4V0BA 4XYQA 2RVLA 2HQEA 4OIKA 2B63B 3P75A 1F9SA 1S5FD 1A15A 2IT1A 4X3SA 2NVQB 3MTSA 1GUOA 3TP8A 5ELFA 3Q23A 2F0IA 1V1PA 4L6TB 1KLGD 1AZQA 1II3A 4CHTB 1ESFA 1PTOF 2KOLA 1BO0A 1SFOB 3OWFA 1AFPA 1I4GA 4JBWA 2NZ1D 1VMCA 3OSOA 2BDOA 2KUMA 1LT4D 2F0VA 1YNND 3MA2B 2EYHA 4BY1B 2AQ1B 1JICA 3DM1A 2KEDA 2F03A 1BCPD 4ZLTF 1GUSA 3L3OC 2OT2A 5I2YA 2L4NA 1HTPA 1RKNA 2R93B 1EYCA 4K5VA 1H9RA 5ELCA 3ND9A 2NVYB 4NKLA 2EPBA 2VB2X 2EY6A 4ILWA 5JPNC 2XRQD 4X3UA 4HEDA 3RZOB 1STEA 2B2VA 2PPBC 1BBXC 3VR4A 1HFGA 2PZUA 2JSOA 2EVBA 2R92B 3SE0A 4K6LA 4KTAA 1ILQA 4XYOA 3HS0C 3J81L 4ODGA 5C4HA 3AU7A 1Q90A 1HA5A 1IHZA 5KNCA 3P20A 3C1EA 1HRJA 3E0JA 4BWGB 2MPMA 1Z6HA 2SOBA 3HG9A 2KVMA 1BR9A 1Q1EA 3LX0A 4DXGA 2B2TA 1C48A 1UNSA 4DAYA 2NB0A 3S9WA 1RTOA 1LTBD 1Y8OB 4A3BB 2PW7A 4KY7A 1F9RA 5I9PA 1TWCB 1LACA 1W6KA 4A93B 1DXMA 4F8MA 1FD7D 4RGNA 2E76C 2NYZD 1PYWD 3NWTA 4C2MB 4A3MB 2A6HD 1A3TA 2L9HA 1F77A 1LABA 1LTID 1PZID 2Q8IB 3H6MA 1WTOA 2JXMB 3W3AA 3A8JE 1EZ6A 1CQVA 1PRTF 4XXEA 4R8IA 5C4XB 3VYSA 3BDCA 2D62A 3RMHA 1MBYA 5C0XG 2B2WA 3D4WA 3GTQB 1MI2A 3MC0B 3NUCA 3GTLB 1LLRD 5TSSA 2QEJC 1PZJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUN A;  5J39 A;  2M00 A;  3ERQ A;  1STY A;  5J1Z A;  3TP5 A;  5C5L A;  1EY0 A;  1SND A;  1EY5 A;  4RKL A;  1KDB A;  3TP8 A;  4HMJ A;  4K8J A;  4TRD A;  2F0I A;  3ERO A;  2SOB A;  2PZW A;  4QF4 A;  1AEX A;  1SYD A;  4PNY A;  4K5W A;  1EQV A;  1STH A;  3LX0 A;  5I6W A;  3SK6 A;  4S3S A;  1JOR A;  1F2Y A;  3D8G A;  1II3 A;  3MHB A;  2OF1 A;  5IGB A;  2SNS A;  1SYG A;  5IGC A;  4KD3 A;  1EY8 A;  3EJI A;  4H7B A;  1SNO A;  5KEE A;  3MEH A;  3T16 A;  4B9W A;  2ENB A;  3PMF A;  1F2Z A;  2OEO A;  1SNC A;  3TP6 A;  5C6A A;  1F2M A;  5CV6 A;  3SXH A;  1SNP A;  3OWF A;  5IGE A;  4J1M A;  3DHQ A;  4PMB A;  4EQN A;  1ENC A;  3D4D A;  3QOJ A;  4N9T A;  1STN A;  2EYF A;  1A2T A;  2F0Q A;  3S9W A;  4YIJ A;  2F3W A;  3OSO A;  5E3F A;  2F0S A;  4KJO A;  1A2U A;  3NP8 A;  2F0N A;  1SNM A;  1JOQ A;  5DAU A;  2F0V A;  4ZUI A;  2PW7 A;  1JOK A;  4KY7 A;  3NK9 A;  5JAV A;  4KD4 A;  5I9P A;  4I65 A;  3V2T A;  1A3V A;  2F0W A;  2EYH A;  4K14 A;  5C4Z A;  4WOR A;  5EGT A;  4EQP A;  5KIX A;  5J22 A;  1SYE A;  2PZT A;  4PMC A;  3DMU A;  5C5M A;  3MXP A;  5IOD A;  2F0U A;  3P1H A;  4DGZ A;  3OMG A;  2EYO A;  3RUZ A;  5CV7 A;  4F8M A;  1SYB A;  1U9R A;  2F3V A;  4HTH A;  4E6I A;  5M9O A;  4LAA A;  2F0T A;  3BDL A;  1TQO A;  2RDF A;  2F0P A;  5F2D A;  1EYD A;  5ISR A;  5HGT A;  2EYL A;  4MIU A;  1TT2 A;  4HMI A;  1TR5 A;  2F0L A;  5C3W A;  4J6H A;  2F0K A;  3HZX A;  5KYL A;  3HEJ A;  5KRU A;  2KHS A;  1RKN A;  3NHH A;  1KAA A;  2EYP A;  4KY6 A;  1A3T A;  5E1F A;  1EYC A;  2EYJ A;  4K5V A;  2PW5 A;  4RKB A;  4F7X A;  3TP7 A;  5K5P A;  1KAB A;  1KDA A;  3NQT A;  5IGG A;  1EZ8 A;  2PQE A;  3SK8 A;  4K5X A;  3MZ5 A;  5CV5 A;  3H6M A;  4NKL A;  3MVV A;  5DEH A;  2EY6 A;  4ID6 A;  4N9P A;  4KJN A;  4EQO A;  3OMC A;  5KYI A;  2F0J A;  5CV9 A;  2F0F A;  3T13 A;  1NSN S;  1SYF A;  5EKK A;  5CV8 A;  3SK5 A;  2OXP A;  4DU9 A;  1STB A;  4ZQ3 A;  1NUC A;  3QB3 A;  2F0M A;  4QMG A;  4B9X A;  5C3X A;  5I6Y A;  2O4X A;  1EZ6 A;  3SHL A;  2F0H A;  2EY2 A;  3C1F A;  1STA A;  4NDX A;  3SK4 A;  3U9O A;  5I9O A;  3SR1 A;  4KV6 A;  4QB4 A;  2WAC A;  4OL7 A;  5IGF A;  4K8I A;  1EY7 A;  1SYC A;  2PYK A;  4KHV A;  4ME5 A;  2LKV A;  1KDC A;  4G57 A;  5NUC A;  4EVO A;  5CGK A;  3D6C A;  4NMZ A;  4WRD A;  4IZ8 A;  4R8N A;  5HUR A;  1A3U A;  5KGU A;  1SNQ A;  2PZU A;  3BDC A;  2F0G A;  3NXW A;  3TME A;  4K2L A;  5CC4 A;  4K2K A;  5CV4 A;  5EKL A;  5IIF A;  3EVQ A;  4ZUJ A;  1JOO A;  4DF7 A;  1EY6 A;  4KTA A;  3VA5 A;  3E5S A;  4IAL A;  1ENA A;  5IGD A;  4K6D A;  4KY5 A;  2HQE A;  4DFA A;  2EY5 A;  2F0D A;  2F0O A;  2SNM A;  3D4W A;  4ODG A;  5C4H A;  1EY4 A;  3QOL A;  1EYA A;  2KQ3 A;  2QDB A;  3P75 A;  2EY1 A;  5CR3 A;  3NUC A;  1IHZ A;  3R3O A;  2RKS A;  2EXZ A;  4NP5 A;  5JOB A;  1EY9 A;  2EYM A;  2F0E A;  2NUC A;  1STG A;  3ITP A;  5IOC A;  3C1E A;  2RBM A; 
#chains in the Genus database with same CATH topology
 1L0X B;  1K0S A;  4DA2 A;  3S2H B;  1V1Q A;  1NNX A;  2XSC A;  1STY A;  2E5L L;  2E75 C;  1SMX A;  4HMJ A;  4GKK L;  1MJE A;  2PZW A;  1CKN B;  4PNY A;  4K0K L;  5GRO A;  1YBY A;  3SK6 A;  3EA6 A;  4L5T A;  2JP1 A;  4DV6 Q;  1VQ8 A;  1SYG A;  4CKB A;  2I07 B;  1YNJ D;  4IPG A;  4NW2 A;  2A6E D;  3HOY H;  3TS2 A;  4A3G B;  5C6A A;  2UUC L;  3T1H L;  2RHQ B;  3JAM E;  1SNP A;  1N34 L;  1M8A A;  1YIT A;  1O80 A;  3I4M H;  4C1N K;  3PO3 B;  1AN8 A;  4JI2 L;  1HNZ Q;  1MGS A;  1QB5 D;  4LF4 L;  1KRS A;  2Q8R E;  2RSO A;  3NSW A;  4K14 A;  2QCP X;  2B2V C;  1S5B D;  4OIJ A;  4IUV A;  1DM0 B;  5GAG C;  2EOT A;  1HCZ A;  2PQA B;  1FYC A;  2YTY A;  1ET9 A;  4Y7N B;  4A3B G;  4DR7 L;  3PIP A;  4HMI A;  1Q8I A;  1G8Z D;  3I8Z A;  4GOP C;  1RD9 D;  4KY6 A;  3ZJY C;  4QGU A;  5JJK A;  4A93 G;  2R3Z A;  1TII D;  4JI5 Q;  3NQT A;  1ENF A;  2G9D A;  4XT1 B;  5E4W C;  1YNN C;  3MXN A;  4A3F G;  4M8A A;  1Y8P B;  2D0P A;  2JK8 A;  3UI2 A;  3UE1 A;  2VNU D;  1VQM A;  4DV4 Q;  2AMC B;  4DV6 L;  1BCP C;  5IOD A;  1NUC A;  2LXK A;  4A3M G;  2RDH A;  1MHW C;  4KV6 A;  4QB4 A;  2MGS A;  3O13 A;  3U9S A;  1I94 L;  1Q12 A;  4BBS H;  2LMC B;  2Z1C A;  3K7A H;  5FLM G;  4NMZ A;  3K5M A;  1X3P A;  2WB1 E;  1HNZ L;  5EPK A;  2B2T C;  3Q24 A;  3HFZ B;  3LWE A;  4G7O C;  3EN2 A;  3M3Y H;  1WTP A;  1QOH A;  1ENA A;  3BJU A;  2B39 A;  4AH6 A;  2FMM A;  1EYA A;  4IJL A;  2K6A A;  2N3S A;  3V2T A;  4X66 Q;  2A8V A;  2AQ3 B;  2XRS D;  2KHI A;  3RZD B;  4A3L H;  1EFW A;  1AH9 A;  4JI6 Q;  3FHW A;  3FKI H;  4FDB A;  3AMU A;  3H3V H;  1JQY D;  3FDT A;  3SGI A;  1C0A A;  1VMP A;  2D0O A;  4JI5 L;  3D3R A;  1U4L A;  2OQK A;  4FF3 A;  1GUN A;  5JEA H;  1F2Y A;  4OGQ C;  2EQS A;  3S14 H;  1U4M A;  2R7Z B;  4KD3 A;  2WII B;  5ELO A;  4C56 C;  4QCL A;  3GO5 A;  3NTI A;  2MFI A;  2Z9H A;  2DNC A;  4FNF A;  1A2T A;  2Q2U A;  2K04 A;  1QVF A;  1NE3 A;  5E3F A;  3PF4 A;  2KEC A;  2B63 H;  1N36 L;  5DAU A;  1KHI A;  4LF6 Q;  1DCZ A;  4OWW B;  4PZ6 A;  4BY7 B;  4A3G G;  2XWB B;  1VQ6 A;  3N52 A;  2NVQ H;  4BA1 I;  3I90 A;  4DGZ A;  1H9M A;  3CW2 C;  1SJH D;  1U4P A;  4F87 A;  1XMO Q;  3G6J B;  4FVM A;  4IUT A;  4LAA A;  2CFM A;  2ZM6 L;  4RAU C;  2JQO A;  4P75 A;  1EWI A;  4X66 L;  1VQO A;  5IP7 H;  5EQ0 A;  3FPP A;  1I4Q A;  1A62 A;  3HZX A;  2KHS A;  4JI6 L;  4V19 0;  2PNR C;  2EJG C;  1EEI D;  2B2W C;  1BBW A;  1BUV T;  3GV3 A;  1YHB A;  4IPH A;  4X65 Q;  1WCM B;  3W1G A;  1QVG A;  1XPR A;  1PFB A;  2F0J A;  4C3J B;  4CKC A;  3EQL C;  1U4R A;  1TVX A;  2RQX A;  1OTC A;  1DD2 A;  2WAQ E;  1WD0 A;  4K8I A;  4ME5 A;  4JBM A;  1QVC A;  2J4X A;  4HSV A;  2RSN A;  4BY1 H;  3K5O A;  1MSG A;  5KGU A;  4GS3 A;  4CJ1 B;  1PDQ A;  2F4I A;  4UAI A;  3PIO A;  1QIL A;  1TU2 B;  4R4C A;  3T1Y L;  4LF6 L;  1S40 A;  4KKT A;  3G4S A;  3KUP A;  2R93 H;  1CA6 A;  5CR3 A;  1VF5 C;  4DR5 Q;  3VA7 A;  2NUC A;  2HQL A;  1XYI A;  3VYU A;  5C4J B;  2RCF A;  5J39 A;  3S1Q B;  3H94 A;  1PH8 A;  3M4O B;  3TZU A;  3J81 j;  1KDB A;  1PRT B;  5C44 B;  3ULJ A;  3J80 i;  2V4D A;  1EEF D;  1STH A;  3CQZ B;  1Q3L A;  3U50 C;  1D2B A;  4DR1 L;  3K7U C;  3GTK B;  2K32 A;  4YY3 L;  2FIN B;  1EY8 A;  2JN4 A;  3PMF A;  4B9W A;  3S15 B;  2R92 H;  4FF2 A;  3D6W A;  2Z4H A;  2OWO A;  2KCT A;  4J8Q A;  4DUZ L;  4LFB Q;  2RHS B;  1HZB A;  1EIG A;  3A8I E;  3NWS A;  1VQD A;  1PA6 A;  1A2U A;  3I3C A;  3CD6 A;  2R7Z G;  1JOQ A;  2CQA A;  1SJE D;  1HQM C;  4OX9 Q;  1TWA H;  2LY7 A;  4HJ9 A;  4RFB A;  2X6G A;  4X6A H;  2E2H B;  1CQF A;  1E0B A;  1L0Y B;  2EYO A;  3CMA A;  3RUZ A;  3U4V A;  2IX3 A;  3C3L A;  2A6E C;  4HTH A;  4E6I A;  2XVS A;  2L55 A;  4A3D B;  1K83 B;  3R8B A;  4ZRZ A;  1Z7T A;  1A6X A;  4DR5 L;  1QCB D;  1FJG Q;  3HOU B;  2F0L A;  2EDG A;  2ZXP A;  3OWE B;  3F2C A;  4BY7 G;  3HGB A;  5E7N A;  4DAP A;  1W2B A;  2EIF A;  1Y1V G;  3EFX D;  2YV5 A;  2HDM A;  4HIM A;  3F2D A;  2E2D C;  3MVV A;  1QUQ A;  4L5Q A;  5CV9 A;  2N55 A;  4GKJ L;  5EKK A;  1K28 A;  2Z4I A;  2MUY A;  3H3V C;  3I91 A;  2Q2I A;  1Q1B A;  4RWS C;  1KRT A;  4C3I G;  3IKJ A;  3WOE A;  2JA8 B;  5IGF A;  2O2L D;  1TWC H;  1WCM G;  3IRB A;  4A93 H;  2KCN A;  4Z9C B;  5HUR A;  5C3E B;  3PIO 3;  4QIW B;  2DNE A;  4C3J G;  4A3K H;  2N8N A;  3HOV G;  3HOW B;  4HR7 B;  5JVG 3;  3FVQ A;  1XX8 A;  1TWF B;  3S2D B;  1H9K A;  1ZXT A;  2A69 C;  2Z0S A;  1B9N A;  2MHV A;  3E9H A;  1IKL A;  2BA0 A;  3G71 A;  2K5H A;  2OQ0 A;  2F0D A;  5IYC H;  4OX9 L;  2Z8L A;  4C2M H;  1EY4 A;  4A3M H;  3VYT A;  2GVA A;  3A74 A;  5M5X H;  3NTK A;  3A7A B;  1STG A;  1XXG A;  5L37 A;  3X3M A;  5IYD G;  5C0X J;  2VY3 A;  5FLM H;  1IBM L;  3NEM A;  1FJG L;  5C5L A;  4L8J A;  2R6G A;  4ABN A;  1LT3 D;  3AQQ A;  1V43 A;  4DR3 Q;  5FO9 B;  3HKZ E;  5C4X H;  3T16 A;  3CCV A;  4ZAI A;  4J15 A;  3A0J A;  1RDP D;  4P74 A;  3TP6 A;  1HHV A;  1YZ6 A;  5C44 G;  1EIH A;  4EQN A;  2E8G A;  1Z47 A;  4DV3 L;  4QQB X;  1IYU A;  4AQY Q;  1OO9 B;  3KBG A;  4UP8 A;  4WFN 3;  1HNX Q;  2C9O A;  1ESR A;  1CKM A;  4OO1 I;  4ZUI A;  5IYB H;  3GTQ H;  2VQE Q;  4RCO A;  3QIA A;  1P8L A;  4CKE A;  4WOR A;  1SYE A;  3GTL H;  4HID A;  4QUF A;  4JC0 A;  3A5U A;  3S2H H;  2NVT B;  1KAW A;  1CKN A;  1FGU A;  2C35 B;  5G3L D;  3K0X A;  4YCW A;  5C3W A;  1R9T B;  1EFI D;  3M85 A;  2HCI A;  1RJT A;  2SDF A;  1YHQ A;  1VQ7 A;  3GTO B;  4DR6 Q;  2YU9 B;  1LT5 D;  3SK8 A;  4HCE A;  3W5O A;  2JE6 I;  3Q0A A;  4U68 A;  4A3D G;  4N8X 1;  2R7D A;  2K52 A;  5IP9 G;  3OW7 A;  4PMW A;  3HOU G;  4X62 Q;  3HKS A;  1B1Z A;  2F0M A;  3PO3 H;  1IL8 A;  4ZKB B;  1C7Y A;  2IW3 A;  2E74 C;  3SR1 A;  3PO2 H;  1VQ5 A;  1UUP A;  3V96 A;  1UEA B;  1SYC A;  1JE4 A;  4JI1 Q;  1Q86 C;  2WKC A;  5FK9 C;  2EZV A;  4MN3 A;  4BXX G;  5EKL A;  4CDD C;  1SSO A;  4ZUJ A;  2ZTD A;  5LL6 S;  4ME3 A;  4LK1 C;  1R4Q B;  4CBV A;  2WKD A;  2VQE L;  1JT8 A;  1CK1 A;  3A55 A;  5IGD A;  4L5R C;  2EY5 A;  2F0O A;  2SNM A;  4CJ0 B;  3ND8 A;  1K0R A;  1I4P A;  3L2P A;  3A7L A;  5C3E G;  2F0E A;  3HOW G;  1BCP F;  4G7Z C;  2IPK D;  3CC4 A;  4RG1 A;  1N32 Q;  2Y0S B;  1SE3 A;  5BN3 A;  2XN9 C;  3RLO A;  3ERO A;  2UU9 Q;  1X3F A;  2NVX B;  1G51 A;  2X6L A;  1ET6 A;  2CKZ B;  1XNR Q;  4CDC C;  1E1T A;  1ZYR C;  4L5S A;  2DY8 A;  1SNC A;  1E24 A;  4H13 C;  4A3I H;  2KBN A;  4X62 L;  1HXY D;  3ONA B;  4AYB G;  1BF4 A;  4RMF A;  2HT1 A;  1B2T A;  1GOZ A;  5EBD A;  2CH4 A;  3C46 A;  4KJO A;  3NP8 A;  3URY A;  1JOK A;  5JAV A;  4DK0 A;  2ZXO A;  3MXU A;  2PZT A;  5IWA Q;  1BOS A;  1S3O A;  4DUY L;  3RZD H;  2MO0 A;  3IFT A;  4HIK A;  1T5X D;  1O7Y A;  3GQB A;  3OW2 A;  1K8O A;  1KL9 A;  1K8G A;  2O5I C;  1YIJ A;  3C2P A;  1QG7 A;  4DK6 C;  2BE5 D;  2NN6 H;  4JI8 L;  4MIU A;  4WJW A;  2NBF A;  3VR2 A;  3K6O A;  4NXM Q;  4MTK A;  2K50 A;  1O7I A;  3PUY A;  1HR0 Q;  2B2Y A;  2C5C A;  4QIW E;  4EQO A;  1TWG B;  1DON A;  3GTP B;  1EU3 A;  3LWU A;  1NSN S;  1XNR L;  5CV8 A;  3TS0 A;  2OXP A;  2F0H A;  1STA A;  3J80 E;  2QF7 A;  4A3F B;  1YJW A;  4JI0 L;  3M7N A;  2VXW A;  1H9J A;  2K5V A;  3PUW A;  3A5Z B;  1VS0 A;  3J7A F;  4GKK Q;  1CTM A;  5IIF A;  4K0K Q;  4K2K A;  3M4Y A;  3WWV A;  4GN4 B;  3HOZ H;  3CCJ A;  1X32 A;  3VR5 A;  4DFA A;  1XWE A;  5IWA L;  4A3C H;  4UPA A;  3CHB D;  5GAE C;  2UUC Q;  3T1H Q;  1Y69 U;  1OXS C;  5IGG A;  1IBK L;  1D5X C;  3I73 A;  3CCE A;  4KN4 C;  2M00 A;  3KJO A;  3ERQ A;  3STB D;  1LTR D;  1AE2 A;  3TP5 A;  2CWP A;  1I6H B;  4WJ4 A;  1MKH A;  1PH6 A;  4KI0 A;  4K5W A;  4A3J B;  1YI2 A;  1HR0 L;  3KF8 A;  4S3S A;  5AFW A;  3MHB A;  1VF7 A;  2SNS A;  1HH2 P;  2Y0S G;  3CAM A;  4C3H B;  4OHJ A;  5KND A;  3MXG A;  1SE2 A;  5M5Y H;  4GLX A;  1VQN A;  1TY0 A;  1BBU A;  1NBW A;  2IX0 A;  5DNF A;  2DUD A;  2PCF B;  1ASZ A;  5IY0 A;  1Q82 C;  4TSS A;  1Y1W H;  1K3R A;  2IL8 A;  3CRL C;  4R9W A;  2I5M X;  5C4J H;  3S1Q H;  1V1P B;  4KLK A;  5CMD A;  2KHJ A;  5IT9 E;  2F0T A;  1TQO A;  2F0P A;  1I94 Q;  5C44 H;  4OO1 G;  1VQA A;  1KIX A;  4ZK9 B;  3TDQ A;  2NZH A;  3CQZ H;  1BDO A;  3T51 B;  1DOL A;  2ATW A;  3I4N B;  2PI2 E;  3K5L A;  2IHE A;  2ZJQ A;  4DR4 Q;  1EZ8 A;  3S1N B;  3MEF A;  3RR5 A;  3KLS X;  1SBB B;  3I4O A;  1EYG A;  4KJN A;  3S15 H;  1RIP A;  3OMC A;  2B8F A;  2F0F A;  5COY A;  4B3M Q;  1PFN A;  1PHJ A;  2GVB A;  3E3X A;  1E2V A;  4ZQ3 A;  1JMC A;  1I6V C;  1S4Z A;  1AZP A;  3GTM B;  1NR4 A;  1PVO A;  4FP5 D;  4AIM A;  2D9U A;  1KDC A;  5EAY A;  3VR6 A;  4KHZ A;  1PTO B;  4JW0 A;  3TME A;  2E2H H;  2K5W A;  3K0Y A;  3PUZ A;  2RCN A;  2CH4 W;  2A69 D;  2JA7 B;  1K83 H;  1WJJ A;  2YTX A;  1XTD A;  3HOU H;  4IUU A;  4Q5V A;  4XTC S;  2KQ3 A;  1S5D D;  5H1S E;  2EY1 A;  3GD7 A;  4LW1 A;  3KFU A;  1DGS A;  3ITP A;  1B3A A;  2WIN B;  1EQQ A;  1LO5 D;  4RKL A;  5DM7 3;  1N36 Q;  1JWS D;  1NR2 A;  3S1M B;  2LFN A;  3DEP A;  4GLV B;  2EE1 A;  1NTG A;  4DR4 L;  4PG3 A;  3VDY A;  4KK7 A;  1FL0 A;  3JC6 6;  4QUC A;  2JA8 H;  1BKB A;  4B3S Q;  1YNX A;  5BN5 A;  1PXU A;  3DEO A;  2KCC A;  4O1N A;  4GOP B;  4B3M L;  1TWH B;  1HR0 W;  2KEN A;  2ZM6 Q;  1GHJ A;  1KLU D;  1GVP A;  4IUR A;  1BVS A;  3T4A C;  1CKO A;  1W3S A;  4J1M A;  1X3G A;  4HN7 A;  4N9T A;  4A3J G;  3S2D H;  2VUM B;  2B2Y C;  1IW7 C;  4JOI A;  4HIO A;  2F3W A;  2F0S A;  3QG1 A;  1L0W A;  4HJ5 A;  4C3H G;  1BCP B;  3NK9 A;  5JJZ A;  1E2Z A;  1A3V A;  1IL2 A;  5C4Z A;  1ZEQ X;  5KIX A;  2E2J H;  1QNK A;  1GO3 E;  5ELE A;  1BQQ T;  3BDL A;  3CME A;  1K8A C;  5F2D A;  4U67 3;  5HGT A;  5D14 A;  2N78 A;  2I5L X;  2K01 A;  4H0L C;  3AYH B;  1N33 L;  1KDA A;  2FFK B;  3T1Y Q;  4LUZ A;  3E6Z X;  2UUA L;  1V8Q A;  4PZ8 A;  1M1K C;  1VDZ A;  1FR3 A;  3I4L A;  4Y52 H;  1V1O A;  4JV5 Q;  3K81 C;  1SYF A;  3K57 A;  1QE6 A;  4RGM A;  1WFQ A;  1Y1V B;  5C3X A;  4QMG A;  4B3S L;  3PV0 A;  4DKA C;  4G7H C;  4R4Q A;  3I4N G;  2E2I B;  2BE5 C;  2PO4 A;  1X3E A;  4LJZ C;  1HTL D;  1HJP A;  1KC8 C;  3DM3 A;  3H0G B;  2GA4 B;  3J80 L;  3GV6 A;  4BBR B;  4JG2 A;  4C3I B;  3KF6 B;  2DN8 A;  1EY6 A;  4JPB W;  3F8T A;  4DR1 Q;  1TS3 A;  4CJ2 C;  4YY3 Q;  2N49 A;  1SFO H;  3HOV B;  4P73 A;  1R4P B;  3AFP A;  2K14 A;  1R9T H;  2QDB A;  3GTO H;  5FKA C;  2EXD A;  4H44 C;  4YWK A;  5JOB A;  5IOC A;  4DV5 L;  3KLR A;  4DUZ Q;  2YU9 H;  3AB9 A;  2BOS A;  2B29 A;  3L9A X;  5M3M B;  3NBH A;  5M9O A;  1EY0 A;  2JA7 G;  1I4H A;  4TRD A;  3IAY A;  4EX5 A;  2J7Z A;  3D4R A;  5IT9 c;  1F9Q A;  4APV A;  1LTT D;  2ZJR A;  2RF4 A;  4MZ9 A;  3JAM c;  3DWQ A;  2ES2 A;  1ZYR D;  5EJW A;  2H4O A;  3OHX C;  2PI2 A;  1JB3 A;  1CHQ D;  3K8A A;  4LF5 Q;  4JV5 L;  1QWY A;  1B9M A;  1EIY B;  1JCK B;  3SXH A;  5FJ8 G;  1F2L A;  3M7G A;  2HUG A;  1LT6 D;  2F52 A;  3D0F A;  3DHQ A;  2NVY H;  2YTV A;  2F0Q A;  2V1C C;  4A75 A;  3STB C;  3GTJ B;  1J5E L;  2JEB I;  4CDE C;  1D1I A;  1Q81 C;  2ZTE A;  4OON A;  4POG A;  3RZO H;  1GHK A;  1SE4 A;  4KD4 A;  3T53 B;  1ROD A;  1QJO A;  1EU4 A;  1H9S B;  5EGT A;  2Q8T A;  4EQP A;  4GKJ Q;  5C0X H;  1E2W A;  1G6Z A;  1FNU A;  3M9B A;  1CSP A;  1D6E C;  5GQO A;  2VUM G;  3OYY A;  4IUP A;  1KNE A;  4HJA A;  1NMF A;  4OEM B;  3QWN A;  3I70 A;  4IQZ A;  2LSS A;  4LF9 Q;  3BVZ A;  4PZ7 A;  2NVX H;  2UXB Q;  3CCU A;  3TQY A;  2WFW A;  5IT9 L;  4A4I A;  4F7X A;  1Q8K A;  3JAM L;  1WOC A;  1VQI A;  2HHH L;  4X64 Q;  4LFB L;  3I4M B;  4HJ7 A;  5M3F G;  1STB A;  3QB3 A;  4LF5 L;  4NDX A;  4HJ8 A;  1VQC A;  3I7F A;  4OO1 H;  3KK7 A;  3TEH B;  2CHB D;  1ILP A;  4NB3 A;  3HRZ C;  1IBM Q;  4EVO A;  2LKV A;  2L11 A;  3D6C A;  1B44 D;  3PSI A;  1YJ9 A;  5LL6 X;  5D3D A;  1VQ4 A;  3FMC A;  4XDX A;  3NQI A;  4JI3 L;  4XQJ A;  3QJY A;  1N8R C;  1CSQ A;  3H0G G;  5FLX E;  4JOI C;  4X3K A;  3RNU A;  1LTA D;  3CRK C;  3CCS A;  3R3O A;  4BBR G;  2VW9 A;  1EY9 A;  2YYZ A;  4A3B H;  4UHV A;  5CV6 A;  2OTJ A;  4DV3 Q;  2WV6 D;  1VQG A;  4LF9 L;  1W6J A;  3WOF A;  1ZKO A;  3WDN A;  1SND A;  1EY5 A;  2UXB L;  1EWC A;  4KMU C;  3PUX A;  1LV9 A;  2MNA A;  1PH1 A;  4BBS B;  2L12 A;  1Q46 A;  3OIP A;  1NMG A;  3G48 A;  3LGJ A;  4A3F H;  2Q2H A;  4X64 L;  2OF1 A;  4OEL B;  4GN5 A;  3RD4 A;  3EJI A;  4H7B A;  5KEE A;  2CVR A;  5M3M G;  2ENB A;  5FOB B;  2OEO A;  4HCS A;  5EPJ A;  3K59 A;  1HUN A;  2KEE A;  4GZY C;  1CA5 A;  1ENC A;  1IBL Q;  4O2D A;  4R4O A;  3I72 A;  2LS0 1;  1PFS A;  2F0N A;  1D1K A;  1F9P A;  2N88 A;  1QZH A;  4AYB B;  1K9M C;  3TZD A;  2F0W A;  1XPU A;  2FXQ A;  2GN5 A;  3BVG A;  1RL2 A;  1PH2 A;  4DXF A;  2A73 B;  4MHE A;  4IFD I;  1X54 A;  2F0U A;  5HGQ A;  3OMG A;  4IFD J;  3CF5 A;  1DYQ A;  2K03 A;  4TKO B;  3KBX A;  1SRO A;  2CWA A;  4A3J H;  4I7Z C;  4GNX B;  3Q8D A;  5FO8 B;  4G4K A;  1CZW A;  3KDF A;  2Z6B A;  5D65 A;  1M4V A;  3CCL A;  4C3H H;  1O78 A;  5DEH A;  5KYI A;  5LMN Q;  3S1R B;  1XPO A;  3VYR A;  5DLQ E;  3HOY G;  1KTK A;  3Q22 A;  2AUJ D;  1TY2 A;  3KJP A;  4FO2 A;  5I2X A;  3I4M G;  5K36 G;  4WRD A;  1IBL L;  3SEB A;  5T1G A;  1IYJ B;  2VB3 X;  1JOO A;  4DF7 A;  3VA5 A;  4A3G H;  2H1E A;  5T1I A;  4K6D A;  5LMU L;  4OWT B;  3M4Q A;  1PYB A;  3J7Y W;  4NP5 A;  1C8C A;  3S1N H;  2HCC A;  2Z6K A;  5M5W B;  2BH2 A;  4FYD A;  2KA7 A;  2XIW A;  4LUO A;  5GAD C;  3UDF A;  4K8J A;  4C1N I;  5G3L F;  1TS4 A;  2BDN A;  2PQA A;  2MO1 A;  4DUY Q;  1SDF A;  4Y7N H;  1K8M A;  3J7Z C;  5LMN L;  1S5E D;  3MEH A;  2M2L A;  3RN2 A;  4RA8 A;  3CCQ A;  3RN5 A;  1PTO H;  4JI8 Q;  4IO9 A;  4ULL A;  4TVA B;  1G29 1;  5IGE A;  4BBS G;  4P2C B;  1B70 B;  1DOK A;  1IW7 D;  2G9H D;  2K28 A;  5BN4 A;  1QNU A;  1X65 A;  2L15 A;  2F3I A;  1WTR A;  2OTL A;  1E3P A;  3H15 A;  1JB7 A;  3EIV A;  1X3Q A;  4YWL A;  4DNR B;  3N6R A;  2XNA C;  3CPW A;  4OWX B;  5FO7 B;  4NXN L;  2K1B A;  3NPP A;  1X56 A;  2UUB Q;  4LF8 L;  1A8V A;  3BDO A;  2HIV A;  1X6O A;  4O42 A;  4JI0 Q;  3S1M H;  2RDF A;  3LNN A;  1SR3 A;  3NTH A;  4LUV A;  4QY7 A;  4DV0 L;  2VQF L;  3ER0 A;  2F0K A;  3HEJ A;  2A68 D;  3NHH A;  1KNA A;  1TS2 A;  2EYJ A;  1CI3 M;  2XWJ B;  4KHP Q;  5FLX c;  3K58 A;  4CGY B;  4K5X A;  3MZ5 A;  1TWH H;  1PH3 A;  3SVM A;  1O7L A;  5JEA G;  3V05 A;  4UP7 A;  1OXX K;  4XT3 B;  4YCV A;  3FP9 A;  1NAP A;  2DGY A;  1IBK Q;  1WI5 A;  3SHL A;  3L0O A;  1TWA B;  1N9W A;  2RA4 A;  4BS9 A;  4OL7 A;  2IHF A;  2WB1 B;  1S72 A;  1MIU A;  5A35 A;  1EY7 A;  4N8F A;  4G57 A;  4IZ8 A;  1HZA A;  1FNV A;  1WTV A;  1SNQ A;  1OXV A;  3NXW A;  1L1O B;  2CW0 D;  1PMR A;  2R7Z H;  3F2U A;  3MWY W;  1UEB A;  3IFD A;  2DJF C;  2XGT A;  1Z9F A;  1GJX A;  2FMC A;  4KY5 A;  3CPF A;  4FXK C;  4UDU C;  1PLF A;  1TKW B;  2UUB L;  1QUQ B;  4H02 A;  3Q6S A;  3SK5 A;  3K5N A;  2K5N A;  2EYM A;  1LTL A;  1WD1 A;  2G5D A;  2RBM A;  4DN4 M;  5BR8 L;  5FLX L;  4BY7 H;  5J1Z A;  1EL0 A;  2UXD L;  1EQT A;  1SMY C;  1SN8 A;  2NTT A;  2D5D A;  1Y1V H;  1AEX A;  1YHA A;  2IY5 B;  3TBI B;  4KHP L;  1GUT A;  2RDG A;  5I6W A;  1HPC A;  4A3K B;  3NE5 B;  1PRT D;  3NBI A;  4AYB E;  4POF A;  3CU7 A;  3PUV A;  4A3E B;  1ML0 D;  3BZK A;  4DNI A;  4IUQ A;  3J81 i;  2FHT A;  4BBR H;  2AUK A;  4C3I H;  3J7A 5;  5JJI A;  3ICE A;  5LMN W;  3D4D A;  2VS1 A;  3T56 B;  2JA6 B;  1D7Q A;  1VQK A;  4MTN A;  1WCM H;  5M5X B;  4FXG C;  4JYA Q;  1WTH A;  3HOV H;  4C3J H;  1XNQ Q;  1GUG A;  1GXD C;  3PQI A;  1J8I A;  1B4O A;  1V9P A;  4ZCK A;  1IZ6 A;  3SDZ A;  3I2Z A;  5M3M H;  4GLA C;  1SYB A;  4R4I A;  1P16 A;  4RH6 A;  5IYD H;  4IJH A;  5KYL A;  5KRU A;  1WTX A;  3J7A V;  2EYP A;  1DOM A;  3DXJ C;  4IFD G;  4RKB A;  5K5P A;  1JWU D;  1KQS A;  3IL8 A;  5CYU A;  2QA4 A;  2AHO B;  4DV7 L;  1ICW A;  4BA2 I;  4ID6 A;  3S24 A;  2WAQ B;  4Q0F A;  4QJF A;  3P7J A;  3BS1 A;  1J9O A;  4B3R Q;  3AFQ A;  1M90 C;  2Z6K C;  1JE5 A;  2AQ2 B;  3M4O H;  1S5C D;  1I3Q B;  1CHP D;  3C1F A;  3HP3 A;  4LF7 Q;  3SK4 A;  2R92 G;  2WAC A;  3HOX B;  5D3I B;  4M1U B;  1H9S A;  3GTG B;  5COR A;  5CGK A;  1IKM A;  3OTO L;  3K80 C;  1ICF B;  3X3N A;  4B08 A;  2NN6 I;  1U5K A;  1OXT A;  5CC4 A;  3GTK H;  2F0G A;  4ALP A;  4JYA L;  4L63 B;  3E5S A;  1PTO C;  1WTQ A;  4IAL A;  1XNQ L;  2WB1 G;  1EWH A;  1JJ2 A;  3CKI B;  3QOL A;  2L1B A;  2PMZ B;  4A76 A;  2LXJ A;  2RKS A;  2ASB A;  3QOJ A;  2B2U A;  2EJF C;  5KNB A;  4IUN A;  4KKS A;  2B8G A;  2AWO A;  5K36 H;  2I46 A;  2VZA A;  3D31 A;  4HSP A;  5A2Q E;  1WTW A;  3PO2 B;  2Y0S E;  1SYD A;  4TQU S;  3MFY A;  1B50 A;  2AKW B;  5ELB A;  1VCI A;  4A3D H;  1HNW Q;  5IGB A;  2OCE A;  1ONL A;  2A5H A;  5IP9 H;  1XMQ L;  4B3R L;  1A63 A;  4DNT B;  5ELD A;  4LF7 L;  4PV1 C;  3L7Z C;  4JBK A;  4XIG S;  1UAP A;  4FF1 A;  4YIJ A;  5JVH 3;  2IJ0 A;  2QIL A;  4A3K G;  2ICE C;  1N33 Q;  1HFN A;  1IYV A;  4BXX H;  4A3E G;  4FXD A;  2UUA Q;  3BG3 A;  1PH5 A;  5J22 A;  4IN3 A;  4PMC A;  3DMU A;  3PF5 A;  1A0I A;  5IYC G;  1E7Z A;  4DK1 A;  3P1H A;  1VQP A;  2JA6 G;  5CV7 A;  2BA1 A;  2K33 A;  1G6P A;  1U9R A;  2ICI A;  2MP1 A;  5C3E H;  3HOW H;  1JWM D;  1LTS D;  1TR5 A;  2X69 A;  3CP0 A;  1TWF H;  2ID0 A;  4A3I B;  2PW5 A;  4RCN A;  3E9I A;  1PH4 A;  3BZC A;  3J80 c;  1FNW A;  3MAQ A;  3T13 A;  3S16 B;  5C4X G;  1HNW L;  1B3Q A;  3AEV A;  2L5T A;  4B9X A;  2R61 A;  1D5M C;  2EY2 A;  1LYL A;  1FVI A;  4DV5 Q;  3U9O A;  2JA5 B;  3R2I A;  4O0A A;  4JVZ A;  1UE6 A;  2PYK A;  5M3F B;  5NUC A;  1TS5 A;  2BH8 A;  3ZYY X;  2A68 C;  2WAQ G;  1C9O A;  2JJQ A;  2QEX A;  3B6Y A;  3KOJ A;  3R2T A;  4LMQ D;  5IYB G;  5CV4 A;  2KJX A;  4DAY B;  3EVQ A;  5AJ3 Q;  1RCV D;  1RF2 D;  4XQQ A;  1GUW A;  2K5Q A;  1CM9 A;  3HOX G;  1HA6 A;  4GNX A;  4HAE A;  4DV4 L;  3DWA A;  1PH7 A;  2QDL A;  5CBA E;  1WVL A;  2EXZ A;  1MSH A;  5EPL A;  5I4D A;  4IPD A;  2F4V Q;  1J5E Q;  5IE8 A;  1PZK D;  3S1R H;  3FRP B;  4RHR A;  2UXC Q;  3UDG A;  2MJ8 A;  1T5E A;  1I50 B;  1H95 A;  2CW0 C;  1EQV A;  3HKZ B;  4RHS A;  2A74 C;  3TRZ A;  2NVT H;  1K3B C;  1JOR A;  4ZYS A;  4PQX A;  1KD1 C;  2IWH A;  5LHY 1;  1SNO A;  1SLJ A;  1YEZ A;  3PO3 G;  4EQ5 A;  1F2Z A;  3BYY B;  3PIP 3;  1FGB D;  4JK1 C;  1XJV A;  3UDX A;  1F2M A;  3HOZ B;  3G7L A;  3PO2 G;  1CT1 D;  1G91 A;  1WYD A;  2SEB D;  4PMB A;  2D2C C;  1STN A;  2EYF A;  1I4X A;  3H09 A;  4F88 A;  5HY6 A;  1AW7 A;  1HQR D;  3H91 A;  2NTS A;  1SEB D;  2HHH Q;  1BNZ A;  1EOT A;  1SNM A;  1G2S A;  4DAV A;  2ZT9 C;  3PGZ A;  2WP8 J;  1B53 A;  5AJ3 L;  5EKI A;  2EJM A;  1PRT C;  2DY7 A;  2JYO A;  2TMP A;  5M5W H;  1DJR D;  3TSS A;  4ZKC B;  3UE0 A;  4R1J A;  2F3V A;  4DPG A;  1YVC A;  1D5Z C;  3GP7 A;  3KF8 B;  1SE8 A;  2I0Q A;  4LFC Q;  1G2T A;  5ISR A;  2EYL A;  3S17 B;  1TT2 A;  2O5J C;  4J6H A;  2P5Z X;  1SAP A;  5M5Y B;  3MFG A;  2A6H C;  5E1F A;  1CUK A;  5E4X A;  2F4V L;  3DUZ A;  3TP7 A;  1MJC A;  4JI3 Q;  3TN2 A;  4XQN A;  3NEN A;  1JC7 A;  2VL6 A;  2UXC L;  4N9P A;  3H3V I;  1OXU A;  1J6Q A;  3M4P A;  2B2U C;  3W2D A;  5I6Y A;  3FEW X;  1Y1W B;  2O4X A;  3OPO A;  4A3I G;  1XMO L;  5I9O A;  2K7V A;  3BU2 A;  4FF4 A;  2PMZ E;  1C4Q A;  3F1Z A;  5JEA J;  4IPC A;  3HOY B;  4IFD H;  4R8N A;  1A3U A;  4WJ3 M;  2BCO A;  1DZ1 A;  3J81 E;  1EOV A;  1MD2 D;  3OOC A;  2JA5 G;  3QO2 A;  3R93 A;  3VR3 A;  4DAM A;  4X65 L;  3A8K E;  4KKU A;  4I7A A;  2A19 A;  4IOC A;  1CFM A;  2K05 A;  3A54 A;  2FJ2 A;  1U0L A;  4UY8 C;  3DWP A;  2NN6 G;  2IX1 A;  3KLW A;  1KXL A;  3KLS A;  4LFC L;  3RLN A;  4YWM A;  4EGV A;  3PCO B;  3DLL A;  1I4R A;  1SMY D;  3U58 A;  1PFM A;  4QF4 A;  3CCM A;  4X3T A;  5A2Q L;  2K5D A;  3D8G A;  3CC2 A;  1YNJ C;  5IGC A;  3EBE A;  2L0C A;  1B7Y B;  1RTN A;  1I5F A;  2JEA I;  1VQ9 A;  2M9V A;  3MXN B;  3RLF A;  1L1O A;  4KN7 C;  2AWN A;  3BYT B;  3HKZ G;  1EIF A;  1JJC B;  3OIQ A;  1TWG H;  3GTP H;  3ULL A;  2HDL A;  5EBC A;  4UP9 A;  1HUM A;  2TSS A;  3BZD B;  4I65 A;  2Q2T A;  3K7A B;  3HOZ G;  2QKI C;  5C5M A;  3MXP A;  2F1M A;  1D8L A;  2KCM A;  4A3C G;  4RGT A;  4P72 A;  3I55 A;  4CDF C;  5JPM C;  3M3Y B;  2J0T D;  1AP0 A;  1EYD A;  1VQH A;  3ULP A;  2CCZ A;  5DM6 3;  4IOA A;  3QR8 A;  1CZG A;  1KAA A;  3CXC A;  1JR0 D;  4A3E H;  1KAB A;  2PQE A;  4GNX C;  1NCV A;  5CV5 A;  3JAM i;  2NWG A;  3FKI B;  1LTG D;  3BVM A;  1RHP A;  5LMU Q;  3FPU B;  1TXY A;  2A1A A;  1EQR A;  4DU9 A;  3G6E A;  2JA6 H;  1BXT A;  2E2J B;  2NZO A;  5CBE E;  1T9H A;  5C0X I;  1I6H H;  1Y8N B;  3S14 B;  1PV4 A;  4KHV A;  1ASY A;  1O7Z A;  4RGO S;  4K2L A;  1XTC D;  1SXT A;  3KYH C;  1Y1W G;  2ZXR A;  1PTO D;  3A56 A;  4V0B A;  4XYQ A;  5ELN A;  2RVL A;  2HQE A;  4OIK A;  2B63 B;  3E0E A;  1HZ9 A;  3P75 A;  1VQB A;  2ZTC A;  1EUJ A;  1F9S A;  4B3T Q;  1S5F D;  1A15 A;  1VQL A;  2IT1 A;  4X3S A;  2R7F A;  2NVQ B;  1B8A A;  3MTS A;  1VQJ A;  1GUO A;  3TP8 A;  5ELF A;  3Q23 A;  2F0I A;  1V1P A;  4QL5 A;  4L6T B;  1KLG D;  1I3Q H;  1AZQ A;  4JI4 Q;  4NXN Q;  1II3 A;  4LFA Q;  4CHT B;  1E22 A;  1ESF A;  3HOX H;  1PH9 A;  4LF8 Q;  4DV1 Q;  3GTG H;  1PTO F;  2ZJP A;  2KOL A;  1BO0 A;  1Y14 B;  2CQO A;  1SFO B;  4DV0 Q;  3I4N H;  1Q7Y C;  3OWF A;  2VQF Q;  1AFP A;  1I4G A;  4YCU A;  4JBW A;  2NZ1 D;  1VMC A;  3OSO A;  2BDO A;  1NY4 A;  2KUM A;  1LT4 D;  2F0V A;  1YNN D;  3MA2 B;  2EYH A;  3NBH B;  4BY1 B;  2AQ1 B;  1JIC A;  3DM1 A;  3GTM H;  2KED A;  4JI7 Q;  2F03 A;  1BCP D;  3GDE A;  4ZLT F;  4DR3 L;  5GAH C;  1GUS A;  3L3O C;  4LWC A;  5J3B A;  2OT2 A;  2QW7 A;  5I2Y A;  4JCV E;  3J81 c;  1GM5 A;  2L4N A;  4B3T L;  2K75 A;  1IXR A;  2HD3 A;  1HTP A;  1RKN A;  2R93 B;  1EYC A;  4K5V A;  2JA7 H;  4AQY L;  1H9R A;  1HNX L;  5ELC A;  3ND9 A;  2NVY B;  4NKL A;  2EPB A;  2VB2 X;  2EY6 A;  4ILW A;  5JPN C;  2JA8 G;  2XRQ D;  1GD7 A;  4X3U A;  4JI4 L;  4HED A;  1HZC A;  3RZO B;  1SRU A;  4LFA L;  1STE A;  4DV1 L;  2B2V A;  4DV2 Q;  2PPB C;  1K73 C;  5FJ8 H;  1BBX C;  5BR8 Q;  4A3L G;  3FKI G;  3VR4 A;  2UXD Q;  1HFG A;  2PZU A;  2JSO A;  2EVB A;  3U4Z A;  2R92 B;  4DR6 L;  3SE0 A;  4K6L A;  1VQE A;  4GOP A;  4KTA A;  1ILQ A;  4XYO A;  1QZG A;  1X9N A;  3HS0 C;  3NEL A;  1L1O C;  1NJI C;  3J81 L;  4ODG A;  5C4H A;  3AU7 A;  2VUM H;  4JI7 L;  1Q90 A;  1HA5 A;  2H5X A;  1IHZ A;  5KNC A;  3P20 A;  1GKH A;  3C1E A;  1HRJ A;  3CC7 A;  3UDI A;  3E0J A;  2MQH A;  4BWG B;  2MPM A;  4P71 A;  4JI1 L;  3S16 H;  2B63 G;  1Z6H A;  2SOB A;  3HG9 A;  2I5H A;  2KVM A;  1BR9 A;  1Q1E A;  3LX0 A;  4OXP A;  2JA5 H;  4DXG A;  1LUZ A;  1JJG A;  2XTI A;  5M3F H;  2B2T A;  2PNH A;  1X55 A;  2QGQ A;  1C48 A;  1UNS A;  1LM0 A;  1UE1 A;  4DAY A;  2JA9 A;  2NB0 A;  3TRE A;  3S9W A;  1RTO A;  4DV2 L;  5IP7 G;  1LTB D;  1N32 L;  1Y8O B;  4A3B B;  1E1O A;  3I56 A;  4DV7 Q;  2PW7 A;  4KY7 A;  1F9R A;  5I9P A;  4YHH Q;  1TWC B;  2UU9 L;  1LAC A;  1W6K A;  1UWV A;  4JBJ A;  2E2I H;  2DJG C;  4A93 B;  1DXM A;  4NPS A;  4DR2 L;  1VQF A;  4F8M A;  3H0G H;  4DR2 Q;  1FD7 D;  4RGN A;  2E76 C;  2NYZ D;  1PYW D;  4LNQ A;  5JJL A;  1I50 H;  2K4K A;  2E5L Q;  3KF6 A;  3NWT A;  3OTO Q;  4C2M B;  4A3M B;  4BY1 G;  4R4T A;  2A6H D;  1A3T A;  2L9H A;  2B3G A;  1F77 A;  1LAB A;  1LTI D;  1PZI D;  2Q8I B;  3H6M A;  1UE7 A;  1WTO A;  4DK3 C;  2JXM B;  3W3A A;  3A8J E;  1EZ6 A;  2R93 G;  1CQV A;  1PRT F;  1N34 Q;  1AE3 A;  4XXE A;  1PYS B;  4R8I A;  4JI2 Q;  1UE5 A;  1L2F A;  3W1B A;  5C4X B;  3VYS A;  4LF4 Q;  4NXM L;  4MNO A;  3BDC A;  2D62 A;  3CCR A;  3RMH A;  1YJN A;  4GN3 B;  1MBY A;  3KDF B;  5C0X G;  3F2B A;  4YHH L;  2B2W A;  3S17 H;  3D4W A;  1XMQ Q;  3ERS X;  3GTQ B;  1MI2 A;  2HIX A;  4DR7 Q;  3MC0 B;  3GTJ H;  2ALY B;  3NUC A;  3GTL B;  1LLR D;  5TSS A;  2QEJ C;  1PZJ D; 
#chains in the Genus database with same CATH homology
 1L0X B;  4DA2 A;  3S2H B;  2XSC A;  1STY A;  2E75 C;  4HMJ A;  2PZW A;  4PNY A;  3SK6 A;  3EA6 A;  2JP1 A;  1SYG A;  4CKB A;  2I07 B;  1YNJ D;  4NW2 A;  2A6E D;  4A3G B;  5C6A A;  3JAM E;  1SNP A;  1M8A A;  1O80 A;  4C1N K;  3PO3 B;  1AN8 A;  1MGS A;  1QB5 D;  2Q8R E;  2RSO A;  3NSW A;  4K14 A;  2QCP X;  2B2V C;  1S5B D;  4OIJ A;  4IUV A;  1DM0 B;  2EOT A;  1HCZ A;  1FYC A;  1ET9 A;  4Y7N B;  4HMI A;  1Q8I A;  1G8Z D;  3I8Z A;  1RD9 D;  4KY6 A;  2R3Z A;  1TII D;  3NQT A;  1ENF A;  2G9D A;  4XT1 B;  5E4W C;  1YNN C;  3MXN A;  4M8A A;  1Y8P B;  3UI2 A;  2VNU D;  1BCP C;  5IOD A;  1NUC A;  2RDH A;  4KV6 A;  4QB4 A;  2MGS A;  3O13 A;  3U9S A;  1Q12 A;  2LMC B;  2Z1C A;  4NMZ A;  3K5M A;  1X3P A;  5EPK A;  2B2T C;  3Q24 A;  4G7O C;  3LWE A;  1WTP A;  1QOH A;  1ENA A;  2B39 A;  2FMM A;  1EYA A;  2K6A A;  3V2T A;  2AQ3 B;  2XRS D;  3RZD B;  3AMU A;  1JQY D;  3FDT A;  1VMP A;  3D3R A;  1U4L A;  4FF3 A;  1GUN A;  5JEA H;  1F2Y A;  4OGQ C;  1U4M A;  2R7Z B;  4KD3 A;  2WII B;  4C56 C;  4QCL A;  3GO5 A;  3NTI A;  2DNC A;  4FNF A;  1A2T A;  2K04 A;  5E3F A;  2KEC A;  5DAU A;  1DCZ A;  4BY7 B;  2XWB B;  3N52 A;  4BA1 I;  3I90 A;  4DGZ A;  1H9M A;  4F87 A;  1SJH D;  1U4P A;  3G6J B;  4FVM A;  4IUT A;  4LAA A;  4RAU C;  5EQ0 A;  3FPP A;  1I4Q A;  3HZX A;  2KHS A;  4V19 0;  2PNR C;  2EJG C;  1EEI D;  2B2W C;  1BUV T;  3GV3 A;  1WCM B;  1PFB A;  2F0J A;  4C3J B;  4CKC A;  3EQL C;  1U4R A;  1TVX A;  2RQX A;  1DD2 A;  1WD0 A;  4K8I A;  4ME5 A;  2J4X A;  4HSV A;  2RSN A;  3K5O A;  1MSG A;  5KGU A;  4CJ1 B;  1PDQ A;  2F4I A;  4UAI A;  1QIL A;  1TU2 B;  4KKT A;  3KUP A;  1CA6 A;  5CR3 A;  1VF5 C;  3VA7 A;  2NUC A;  1XYI A;  3VYU A;  5C4J B;  5J39 A;  3S1Q B;  3H94 A;  3M4O B;  3TZU A;  1KDB A;  1PRT B;  5C44 B;  2V4D A;  1EEF D;  1STH A;  3CQZ B;  1Q3L A;  1D2B A;  3GTK B;  2K32 A;  2FIN B;  1EY8 A;  4B9W A;  3PMF A;  3S15 B;  4FF2 A;  3D6W A;  2Z4H A;  4J8Q A;  3A8I E;  1EIG A;  3NWS A;  1A2U A;  3I3C A;  1JOQ A;  2CQA A;  1SJE D;  1HQM C;  2LY7 A;  4RFB A;  2X6G A;  2E2H B;  1CQF A;  1E0B A;  1L0Y B;  2EYO A;  3RUZ A;  2IX3 A;  3C3L A;  2A6E C;  4HTH A;  4E6I A;  2XVS A;  2L55 A;  4A3D B;  1K83 B;  3R8B A;  4ZRZ A;  1Z7T A;  1A6X A;  1QCB D;  3HOU B;  2F0L A;  2EDG A;  2ZXP A;  3OWE B;  3HGB A;  4DAP A;  3EFX D;  2HDM A;  2E2D C;  3MVV A;  5CV9 A;  2N55 A;  5EKK A;  2Z4I A;  2MUY A;  3H3V C;  3I91 A;  1Q1B A;  4RWS C;  4C3I G;  3IKJ A;  3WOE A;  2JA8 B;  5IGF A;  2O2L D;  2KCN A;  4Z9C B;  5HUR A;  5C3E B;  3PIO 3;  4QIW B;  2DNE A;  4C3J G;  3HOW B;  4HR7 B;  5JVG 3;  3FVQ A;  1XX8 A;  1TWF B;  3S2D B;  1H9K A;  1ZXT A;  2A69 C;  1B9N A;  2MHV A;  1IKL A;  2BA0 A;  2F0D A;  2Z8L A;  1EY4 A;  3VYT A;  3NTK A;  3A7A B;  1STG A;  1XXG A;  3X3M A;  5C0X J;  5C5L A;  4L8J A;  2R6G A;  4ABN A;  1LT3 D;  1V43 A;  5FO9 B;  3T16 A;  4ZAI A;  1RDP D;  1HHV A;  3TP6 A;  1EIH A;  4EQN A;  1Z47 A;  1IYU A;  1OO9 B;  3KBG A;  4WFN 3;  2C9O A;  1ESR A;  4OO1 I;  4ZUI A;  4RCO A;  3QIA A;  4CKE A;  4WOR A;  1SYE A;  4QUF A;  2NVT B;  5G3L D;  5C3W A;  1R9T B;  1EFI D;  3M85 A;  2HCI A;  1RJT A;  2SDF A;  3GTO B;  2YU9 B;  1LT5 D;  3SK8 A;  4HCE A;  2JE6 I;  3Q0A A;  4U68 A;  3OW7 A;  4PMW A;  1B1Z A;  2F0M A;  4ZKB B;  1IL8 A;  2IW3 A;  2E74 C;  3SR1 A;  1UUP A;  3V96 A;  1UEA B;  1SYC A;  1JE4 A;  2WKC A;  5FK9 C;  2EZV A;  4MN3 A;  5EKL A;  1SSO A;  4ZUJ A;  5LL6 S;  4LK1 C;  1R4Q B;  4CBV A;  2WKD A;  1CK1 A;  3A55 A;  5IGD A;  2EY5 A;  2F0O A;  2SNM A;  4CJ0 B;  3ND8 A;  1I4P A;  3A7L A;  2F0E A;  1BCP F;  4G7Z C;  2IPK D;  2Y0S B;  1SE3 A;  5BN3 A;  2XN9 C;  3ERO A;  2NVX B;  2X6L A;  1ET6 A;  1ZYR C;  2DY8 A;  1SNC A;  4H13 C;  1HXY D;  3ONA B;  1BF4 A;  1B2T A;  1GOZ A;  5EBD A;  3C46 A;  4KJO A;  3NP8 A;  3URY A;  1JOK A;  5JAV A;  4DK0 A;  2ZXO A;  3MXU A;  2PZT A;  1BOS A;  3IFT A;  1T5X D;  1O7Y A;  3GQB A;  1K8O A;  2O5I C;  3C2P A;  1QG7 A;  2BE5 D;  2NN6 H;  4MIU A;  4WJW A;  2NBF A;  3VR2 A;  3K6O A;  3PUY A;  2B2Y A;  2C5C A;  4EQO A;  1TWG B;  1DON A;  3GTP B;  1EU3 A;  3LWU A;  1NSN S;  5CV8 A;  2OXP A;  2F0H A;  1STA A;  3J80 E;  2QF7 A;  4A3F B;  3M7N A;  2VXW A;  1H9J A;  3PUW A;  3J7A F;  1CTM A;  5IIF A;  4K2K A;  3M4Y A;  1X32 A;  3VR5 A;  4DFA A;  1XWE A;  3CHB D;  1Y69 U;  1OXS C;  5IGG A;  1D5X C;  3I73 A;  4KN4 C;  2M00 A;  3ERQ A;  1LTR D;  3TP5 A;  1I6H B;  4KI0 A;  4K5W A;  4A3J B;  3KF8 A;  4S3S A;  5AFW A;  3MHB A;  1VF7 A;  2SNS A;  4C3H B;  4OHJ A;  5KND A;  3MXG A;  1SE2 A;  1TY0 A;  2IX0 A;  5DNF A;  2PCF B;  4TSS A;  2IL8 A;  3CRL C;  4R9W A;  1V1P B;  5CMD A;  5IT9 E;  2F0T A;  1TQO A;  2F0P A;  4OO1 G;  4ZK9 B;  3TDQ A;  1BDO A;  3T51 B;  1DOL A;  3I4N B;  3K5L A;  1EZ8 A;  3S1N B;  3KLS X;  1SBB B;  4KJN A;  3OMC A;  2B8F A;  2F0F A;  5COY A;  1PFN A;  1E2V A;  4ZQ3 A;  1I6V C;  1S4Z A;  1AZP A;  3GTM B;  1NR4 A;  4FP5 D;  2D9U A;  1KDC A;  3VR6 A;  4KHZ A;  1PTO B;  3TME A;  2K5W A;  3K0Y A;  3PUZ A;  2A69 D;  2JA7 B;  4IUU A;  4Q5V A;  4XTC S;  2KQ3 A;  1S5D D;  2EY1 A;  3GD7 A;  3ITP A;  1B3A A;  2WIN B;  1LO5 D;  4RKL A;  5DM7 3;  1JWS D;  1NR2 A;  3S1M B;  2LFN A;  3DEP A;  2EE1 A;  4KK7 A;  4QUC A;  5BN5 A;  1PXU A;  3DEO A;  2KCC A;  4O1N A;  1TWH B;  1GHJ A;  1KLU D;  4IUR A;  3T4A C;  4J1M A;  4HN7 A;  4N9T A;  2VUM B;  2B2Y C;  1IW7 C;  2F3W A;  2F0S A;  3QG1 A;  4C3H G;  1BCP B;  3NK9 A;  5JJZ A;  1E2Z A;  1A3V A;  5C4Z A;  1ZEQ X;  5KIX A;  1QNK A;  5ELE A;  1BQQ T;  3BDL A;  5F2D A;  4U67 3;  5HGT A;  5D14 A;  2K01 A;  4H0L C;  1KDA A;  2FFK B;  3E6Z X;  1V8Q A;  1VDZ A;  1FR3 A;  3I4L A;  1V1O A;  1SYF A;  3K57 A;  1QE6 A;  4RGM A;  1Y1V B;  5C3X A;  4QMG A;  3PV0 A;  4G7H C;  2E2I B;  2BE5 C;  2PO4 A;  4LJZ C;  1HTL D;  3H0G B;  2GA4 B;  3J80 L;  3GV6 A;  4BBR B;  4C3I B;  2DN8 A;  1EY6 A;  1TS3 A;  4CJ2 C;  3HOV B;  1R4P B;  2QDB A;  5FKA C;  4H44 C;  5JOB A;  5IOC A;  3KLR A;  3AB9 A;  2BOS A;  3L9A X;  5M3M B;  3NBH A;  5M9O A;  1EY0 A;  1I4H A;  4TRD A;  3IAY A;  2J7Z A;  3D4R A;  1F9Q A;  1LTT D;  3DWQ A;  1ZYR D;  5EJW A;  2H4O A;  3OHX C;  1JB3 A;  1CHQ D;  1QWY A;  1B9M A;  1JCK B;  3SXH A;  1F2L A;  3M7G A;  2HUG A;  1LT6 D;  3DHQ A;  2F0Q A;  3GTJ B;  2JEB I;  1D1I A;  1GHK A;  1SE4 A;  4KD4 A;  3T53 B;  1ROD A;  1QJO A;  1EU4 A;  1H9S B;  5EGT A;  2Q8T A;  4EQP A;  5C0X H;  1E2W A;  1G6Z A;  1FNU A;  1D6E C;  4IUP A;  1KNE A;  3QWN A;  3I70 A;  4IQZ A;  3BVZ A;  5IT9 L;  4F7X A;  3JAM L;  3I4M B;  1STB A;  3QB3 A;  4NDX A;  4OO1 H;  3KK7 A;  2CHB D;  1ILP A;  3HRZ C;  4EVO A;  2LKV A;  2L11 A;  3D6C A;  1B44 D;  5LL6 X;  5D3D A;  3FMC A;  4XDX A;  3NQI A;  4XQJ A;  3QJY A;  5FLX E;  4X3K A;  1LTA D;  3CRK C;  3R3O A;  1EY9 A;  2YYZ A;  5CV6 A;  2WV6 D;  1W6J A;  3WOF A;  1ZKO A;  3WDN A;  1SND A;  1EY5 A;  1EWC A;  4KMU C;  3PUX A;  1LV9 A;  4BBS B;  2L12 A;  3OIP A;  2OF1 A;  3RD4 A;  3EJI A;  4H7B A;  5KEE A;  2CVR A;  2ENB A;  5FOB B;  2OEO A;  4HCS A;  5EPJ A;  3K59 A;  1HUN A;  2KEE A;  4GZY C;  1CA5 A;  1ENC A;  3I72 A;  2LS0 1;  2F0N A;  1D1K A;  1F9P A;  2N88 A;  4AYB B;  3TZD A;  2F0W A;  3BVG A;  4DXF A;  2A73 B;  4MHE A;  4IFD I;  2F0U A;  3OMG A;  4IFD J;  1DYQ A;  2K03 A;  4TKO B;  3KBX A;  4I7Z C;  5FO8 B;  4G4K A;  1CZW A;  5D65 A;  1M4V A;  1O78 A;  5DEH A;  5KYI A;  3S1R B;  3VYR A;  1KTK A;  3Q22 A;  2AUJ D;  1TY2 A;  4FO2 A;  5I2X A;  5K36 G;  4WRD A;  3SEB A;  5T1G A;  2VB3 X;  1JOO A;  4DF7 A;  3VA5 A;  2H1E A;  5T1I A;  4K6D A;  3J7Y W;  4NP5 A;  1C8C A;  2HCC A;  5M5W B;  4FYD A;  2KA7 A;  2XIW A;  4C1N I;  4K8J A;  5G3L F;  1TS4 A;  2BDN A;  1SDF A;  1K8M A;  1S5E D;  3MEH A;  2M2L A;  4RA8 A;  1PTO H;  4ULL A;  1G29 1;  5IGE A;  4P2C B;  1DOK A;  1IW7 D;  2G9H D;  2K28 A;  5BN4 A;  1QNU A;  1WTR A;  1X3Q A;  4DNR B;  3N6R A;  2XNA C;  5FO7 B;  2K1B A;  3NPP A;  3BDO A;  4O42 A;  2RDF A;  3LNN A;  3NTH A;  2F0K A;  3HEJ A;  2A68 D;  3NHH A;  1KNA A;  1TS2 A;  2EYJ A;  1CI3 M;  2XWJ B;  3K58 A;  4CGY B;  4K5X A;  3MZ5 A;  3SVM A;  1O7L A;  5JEA G;  3V05 A;  1OXX K;  4XT3 B;  1NAP A;  3SHL A;  1TWA B;  2RA4 A;  4BS9 A;  4OL7 A;  2WB1 B;  5A35 A;  1EY7 A;  4G57 A;  4IZ8 A;  1FNV A;  1WTV A;  1SNQ A;  1OXV A;  3NXW A;  2CW0 D;  1PMR A;  3F2U A;  3MWY W;  3IFD A;  1GJX A;  2FMC A;  4KY5 A;  4FXK C;  4UDU C;  1PLF A;  1TKW B;  3Q6S A;  3SK5 A;  3K5N A;  2EYM A;  1WD1 A;  2RBM A;  4DN4 M;  5FLX L;  5J1Z A;  1EL0 A;  1EQT A;  1SMY C;  2NTT A;  2D5D A;  1AEX A;  3TBI B;  1GUT A;  2RDG A;  5I6W A;  1HPC A;  4A3K B;  1PRT D;  3NE5 B;  3NBI A;  3CU7 A;  3PUV A;  4A3E B;  1ML0 D;  4IUQ A;  2FHT A;  2AUK A;  3D4D A;  3T56 B;  2JA6 B;  5M5X B;  4FXG C;  1GUG A;  1GXD C;  1J8I A;  1B4O A;  3SDZ A;  1SYB A;  4RH6 A;  5KYL A;  5KRU A;  1WTX A;  3J7A V;  2EYP A;  1DOM A;  3DXJ C;  4IFD G;  4RKB A;  5K5P A;  1JWU D;  3IL8 A;  5CYU A;  1ICW A;  4BA2 I;  4ID6 A;  2WAQ B;  4Q0F A;  3BS1 A;  3P7J A;  1J9O A;  2AQ2 B;  1S5C D;  1I3Q B;  1CHP D;  3C1F A;  3HP3 A;  3SK4 A;  2WAC A;  3HOX B;  5D3I B;  4M1U B;  1H9S A;  3GTG B;  5COR A;  5CGK A;  1IKM A;  3X3N A;  4B08 A;  2NN6 I;  1OXT A;  5CC4 A;  2F0G A;  4L63 B;  3E5S A;  1PTO C;  1WTQ A;  4IAL A;  1EWH A;  3CKI B;  3QOL A;  2L1B A;  2PMZ B;  2RKS A;  3QOJ A;  2B2U A;  2EJF C;  5KNB A;  4IUN A;  4KKS A;  2B8G A;  2AWO A;  5K36 H;  2I46 A;  5A2Q E;  3D31 A;  4HSP A;  1WTW A;  3PO2 B;  1SYD A;  4TQU S;  3MFY A;  1B50 A;  5ELB A;  1VCI A;  5IGB A;  1ONL A;  2A5H A;  4DNT B;  5ELD A;  4PV1 C;  3L7Z C;  4XIG S;  1UAP A;  4FF1 A;  4YIJ A;  5JVH 3;  2IJ0 A;  2QIL A;  1HFN A;  2ICE C;  1IYV A;  4FXD A;  3BG3 A;  5J22 A;  4IN3 A;  4PMC A;  3DMU A;  4DK1 A;  3P1H A;  5CV7 A;  2BA1 A;  2K33 A;  1U9R A;  2ICI A;  2MP1 A;  1JWM D;  1LTS D;  1TR5 A;  2X69 A;  2ID0 A;  4A3I B;  2PW5 A;  4RCN A;  1FNW A;  3MAQ A;  3T13 A;  3S16 B;  2L5T A;  4B9X A;  2R61 A;  1D5M C;  2EY2 A;  2JA5 B;  3U9O A;  3R2I A;  2PYK A;  5M3F B;  5NUC A;  1TS5 A;  3ZYY X;  2A68 C;  3R2T A;  4LMQ D;  5CV4 A;  2KJX A;  3EVQ A;  1RCV D;  1RF2 D;  4XQQ A;  1GUW A;  2K5Q A;  1CM9 A;  1HA6 A;  4HAE A;  3DWA A;  5CBA E;  1WVL A;  2EXZ A;  1MSH A;  5EPL A;  5I4D A;  1PZK D;  3FRP B;  4RHR A;  2MJ8 A;  1T5E A;  1I50 B;  2CW0 C;  1EQV A;  3HKZ B;  4RHS A;  2A74 C;  1JOR A;  4ZYS A;  4PQX A;  2IWH A;  5LHY 1;  1SNO A;  1F2Z A;  3BYY B;  3PIP 3;  1FGB D;  4JK1 C;  3HOZ B;  1F2M A;  3G7L A;  1CT1 D;  1G91 A;  2SEB D;  4PMB A;  2D2C C;  1STN A;  2EYF A;  1I4X A;  3H09 A;  4F88 A;  1AW7 A;  1HQR D;  3H91 A;  2NTS A;  1SEB D;  1BNZ A;  1EOT A;  1SNM A;  1G2S A;  4DAV A;  2ZT9 C;  2WP8 J;  1B53 A;  5EKI A;  2EJM A;  1PRT C;  2DY7 A;  2JYO A;  2TMP A;  1DJR D;  3TSS A;  4ZKC B;  2F3V A;  1D5Z C;  3GP7 A;  1G2T A;  5ISR A;  2EYL A;  3S17 B;  1TT2 A;  2O5J C;  4J6H A;  1SAP A;  5M5Y B;  3MFG A;  2A6H C;  5E1F A;  5E4X A;  3DUZ A;  3TP7 A;  3TN2 A;  4XQN A;  1JC7 A;  4N9P A;  1OXU A;  2B2U C;  3W2D A;  5I6Y A;  3FEW X;  1Y1W B;  2O4X A;  3OPO A;  5I9O A;  2K7V A;  4FF4 A;  1C4Q A;  5JEA J;  3HOY B;  4IFD H;  4R8N A;  1A3U A;  2BCO A;  1DZ1 A;  3J81 E;  1MD2 D;  3OOC A;  3QO2 A;  3R93 A;  3VR3 A;  3A8K E;  4KKU A;  1CFM A;  2K05 A;  3A54 A;  2FJ2 A;  3DWP A;  2NN6 G;  2IX1 A;  3KLS A;  4EGV A;  1I4R A;  1SMY D;  1PFM A;  4QF4 A;  4X3T A;  5A2Q L;  2K5D A;  3D8G A;  1YNJ C;  5IGC A;  2L0C A;  1RTN A;  2JEA I;  2M9V A;  3RLF A;  4KN7 C;  2AWN A;  3BYT B;  3OIQ A;  2HDL A;  5EBC A;  1HUM A;  2TSS A;  3BZD B;  4I65 A;  3K7A B;  2QKI C;  5C5M A;  3MXP A;  2F1M A;  4RGT A;  5JPM C;  3M3Y B;  2J0T D;  1AP0 A;  1EYD A;  5DM6 3;  1CZG A;  1KAA A;  1JR0 D;  1KAB A;  2PQE A;  1NCV A;  5CV5 A;  2NWG A;  3FKI B;  1LTG D;  3BVM A;  1RHP A;  3FPU B;  4DU9 A;  1BXT A;  2E2J B;  5CBE E;  5C0X I;  1Y8N B;  3S14 B;  4KHV A;  1O7Z A;  4RGO S;  4K2L A;  1XTC D;  1SXT A;  2ZXR A;  1PTO D;  3A56 A;  4V0B A;  4XYQ A;  2RVL A;  2HQE A;  4OIK A;  2B63 B;  3P75 A;  1F9S A;  1S5F D;  1A15 A;  2IT1 A;  4X3S A;  2NVQ B;  3MTS A;  1GUO A;  3TP8 A;  5ELF A;  3Q23 A;  2F0I A;  1V1P A;  4L6T B;  1KLG D;  1AZQ A;  1II3 A;  4CHT B;  1ESF A;  1PTO F;  2KOL A;  1BO0 A;  1SFO B;  3OWF A;  1AFP A;  1I4G A;  4JBW A;  2NZ1 D;  1VMC A;  3OSO A;  2BDO A;  2KUM A;  1LT4 D;  2F0V A;  1YNN D;  3MA2 B;  2EYH A;  4BY1 B;  2AQ1 B;  1JIC A;  3DM1 A;  2KED A;  2F03 A;  1BCP D;  4ZLT F;  1GUS A;  3L3O C;  2OT2 A;  5I2Y A;  2L4N A;  1HTP A;  1RKN A;  2R93 B;  1EYC A;  4K5V A;  1H9R A;  5ELC A;  3ND9 A;  2NVY B;  4NKL A;  2EPB A;  2VB2 X;  2EY6 A;  4ILW A;  5JPN C;  2XRQ D;  4X3U A;  4HED A;  3RZO B;  1STE A;  2B2V A;  2PPB C;  1BBX C;  3VR4 A;  1HFG A;  2PZU A;  2JSO A;  2EVB A;  2R92 B;  3SE0 A;  4K6L A;  4KTA A;  1ILQ A;  4XYO A;  3HS0 C;  3J81 L;  4ODG A;  5C4H A;  3AU7 A;  1Q90 A;  1HA5 A;  1IHZ A;  5KNC A;  3P20 A;  3C1E A;  1HRJ A;  3E0J A;  4BWG B;  2MPM A;  1Z6H A;  2SOB A;  3HG9 A;  2KVM A;  1BR9 A;  1Q1E A;  3LX0 A;  4DXG A;  2B2T A;  1C48 A;  1UNS A;  4DAY A;  2NB0 A;  3S9W A;  1RTO A;  1LTB D;  1Y8O B;  4A3B B;  2PW7 A;  4KY7 A;  1F9R A;  5I9P A;  1TWC B;  1LAC A;  1W6K A;  4A93 B;  1DXM A;  4F8M A;  1FD7 D;  4RGN A;  2E76 C;  2NYZ D;  1PYW D;  3NWT A;  4C2M B;  4A3M B;  2A6H D;  1A3T A;  2L9H A;  1F77 A;  1LAB A;  1LTI D;  1PZI D;  2Q8I B;  3H6M A;  1WTO A;  2JXM B;  3W3A A;  3A8J E;  1EZ6 A;  1CQV A;  1PRT F;  4XXE A;  4R8I A;  5C4X B;  3VYS A;  3BDC A;  2D62 A;  3RMH A;  1MBY A;  5C0X G;  2B2W A;  3D4W A;  3GTQ B;  1MI2 A;  3MC0 B;  3NUC A;  3GTL B;  1LLR D;  5TSS A;  2QEJ C;  1PZJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...