4KY6A

Crystal structure of staphylococcal nuclease variant delta+phs l25d at ph 6 and cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKDMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25D at pH 6 and cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky6A00
4J1MA 5J1ZA 1TT2A 1SNQA 4KTAA 2F0JA 3DHQA 5K5PA 5DAUA 5JAVA 3D6CA 3E5SA 2SOBA 3PMFA 3NHHA 5F2DA 5E1FA 5IGBA 2F0HA 4EQNA 5KEEA 3OMGA 5C5MA 1SNOA 3MVVA 5EKKA 3SK6A 4HMJA 1SNCA 5KIXA 3MZ5A 5CV8A 5HGTA 5NUCA 4EQPA 2SNSA 1TR5A 1RKNA 1SYCA 2KQ3A 1STGA 3NP8A 1F2YA 4KJNA 1STAA 1EY6A 5IGGA 3S9WA 4KD4A 4F8MA 1EY9A 5C4ZA 1ENCA 2F0IA 1KDBA 3C1EA 1STBA 4KD3A 5IGDA 1IHZA 3NXWA 4ZUIA 3SR1A 2EYHA 2EYOA 2RKSA 2OEOA 2F3VA 2PW7A 3TP5A 5C5LA 5CC4A 4PMBA 2EY1A 4NDXA 4IALA 3ERQA 2WACA 1KAAA 4K14A 4H7BA 4KY7A 4NP5A 1SYBA 3U9OA 1F2MA 5JOBA 1EZ6A 5CGKA 5I6YA 3SK5A 3NK9A 4EVOA 2O4XA 3R3OA 4K5WA 2F0SA 2F0VA 3P1HA 3TMEA 4ZQ3A 1KDCA 2PW5A 2ENBA 3NQTA 4K6DA 2RDFA 2EYMA 2OF1A 3BDLA 4K2LA 3TP6A 1AEXA 2F0PA 4N9PA 4S3SA 4KJOA 2KHSA 5IGFA 1TQOA 4J6HA 1A3VA 2EYFA 1JORA 1SYFA 2EYPA 3EVQA 1F2ZA 3H6MA 4QMGA 4B9WA 3P75A 5C4HA 2OXPA 3T16A 4K5XA 4PMCA 5C3XA 5IGCA 2F0GA 2HQEA 5C3WA 3BDCA 1STHA 3MEHA 3SXHA 1STNA 1EYDA 5CV9A 1A3TA 5I6WA 2EY6A 4I65A 5IODA 4ODGA 3EROA 2PYKA 5CV5A 2PZTA 5IGEA 2EY5A 2F0OA 4DGZA 2M00A 4ME5A 4WORA 4DFAA 5C6AA 4WRDA 4N9TA 5CV7A 1EZ8A 1SNMA 1SYDA 5ISRA 1JOQA 5CV4A 1SYGA 1EY0A 2F0FA 4NMZA 1SYEA 4B9XA 4DF7A 4EQOA 4TRDA 4HTHA 2EYJA 4K8JA 2PZWA 4KY6A 3D8GA 3MHBA 2F0KA 3TP7A 3OWFA 2F0EA 3D4WA 1SNDA 3SK4A 3QOLA 1EYCA 1JOKA 4KV6A 1II3A 4K8IA 4KHVA 1EY4A 1STYA 3T13A 2SNMA 5DEHA 5J22A 1A3UA 1EY8A 2F0NA 3HZXA 3QOJA 1NSNS 5E3FA 2F0WA 3SK8A 4E6IA 4IUNA 5I9PA 5CR3A 2EY2A 3EJIA 3SHLA 3VA5A 5I9OA 2RBMA 3RUZA 2EXZA 5IOCA 2F0MA 5M9OA 2F0TA 2F0DA 4KY5A 1EYAA 3ITPA 4PNYA 5EGTA 2EYLA 2F0LA 3HEJA 3OMCA 3QB3A 4RKLA 1EQVA 4F7XA 5KGUA 4G57A 3V2TA 1ENAA 4HMIA 5KYIA 3TP8A 5J39A 5CV6A 1A2UA 4K2KA 5IIFA 2PQEA 3NUCA 2F0UA 1KDAA 5EKLA 4LAAA 1EY7A 4MIUA 1EY5A 3OSOA 4R8NA 1SNPA 4IZ8A 4YIJA 5HURA 2F3WA 2LKVA 1A2TA 3C1FA 2F0QA 3MXPA 4NKLA 4QB4A 4RKBA 4QF4A 3LX0A 5KRUA 4ID6A 5KYLA 2NUCA 1JOOA 3D4DA 1KABA 3DMUA 2PZUA 4DU9A 1NUCA 4K5VA 1U9RA 2QDBA 4OL7A 4ZUJA
chains in the Genus database with same CATH superfamily
4HIKA 3RLOA 4LF8Q 3UDXA 1BBUA 3LWUA 1Y8OB 1NAPA 1X3EA 2EVBA 2DY8A 1UE7A 4YY3L 2QF7A 3NEMA 3KYHC 2MUYA 1JC7A 1PH7A 1QB5D 2G5DA 4EQNA 1I5FA 2JJQA 2Z9HA 3T1YL 3OPOA 2C9OA 4Y7NB 1X3FA 4UP9A 3A8IE 2D0PA 3G6EA 4A76A 4A3IB 3S15B 3NP8A 4HJ5A 2ZXPA 1DCZA 4H02A 1BBXC 4F8MA 1Z47A 4IUTA 5IGDA 5IWAQ 2RQXA 5FLMG 1PTOB 4N8FA 1GUTA 2CHBD 1K8AC 3U9OA 2HDLA 5GROA 2PMZE 2EJGC 1TS5A 1D8LA 1QWYA 1HCZA 4XYQA 5IGFA 4OHJA 3JAME 3HOWG 2KEDA 4A3FG 5FLXE 1YI2A 2L0CA 4K5XA 3J80i 1CK1A 4HSVA 1K9MC 1B4OA 1WTRA 1CHPD 4O2DA 4ODGA 3EQLC 2P5ZX 5IGEA 4DR3L 4KKSA 1SAPA 5CV7A 3CCJA 4UAIA 5ISRA 4I7AA 5CV4A 2VQFL 2B39A 1N32Q 4CDEC 1B9NA 1PRTB 3V96A 2RA4A 4EGVA 4K8IA 4P74A 1EY4A 1UEBA 1RHPA 5M5WH 1K8OA 2F52A 5I9PA 4FF4A 4C3HH 3FEWX 3M4YA 4DR6Q 2B2VA 4DK6C 2K52A 1CA5A 3N6RA 3GTKH 3S1QH 3PV0A 5IIFA 3KJPA 1F77A 1PH2A 1LTRD 4LW1A 2NYZD 4NXMQ 3I70A 3CCEA 3NBIA 1IKMA 3RZDB 2R92G 4ID6A 1HRJA 2CH4A 3J81L 1EQRA 2QEXA 1PFSA 1XMQQ 3VR2A 4C1NI 1LTBD 3F2UA 2OT2A 4A93H 1LABA 3DEPA 2YU9B 3CCQA 4X3UA 1HZCA 4TKOB 2F0HA 4JI3L 1J5EQ 1YNNC 1SDFA 1U0LA 1LT5D 3NENA 1F9QA 4B3SQ 2KCNA 1IZ6A 3PF5A 5NUCA 3TEHB 5K36G 3EFXD 3CHBD 1ICWA 2H4OA 4RCOA 5IGGA 3GTLB 1SE4A 2FMCA 1RCVD 4CKEA 4FF3A 4IPCA 3CC7A 1NMFA 1TKWB 3OHXC 1GHJA 1BNZA 5ELBA 2RKSA 3WOFA 3FDTA 2OEOA 4X64Q 2EXDA 1ESFA 2K5QA 5E7NA 4H7BA 4KY7A 2IY5B 1MJEA 4DAVA 4FDBA 1G6PA 1U5KA 3HOZH 3VDYA 4OX9L 1EEID 4DR2L 4MZ9A 3GV6A 1Q7YC 5T1GA 2NVYB 4LNQA 4WJ3M 1LTGD 3BJUA 1AZPA 3GTPH 1AP0A 2ZTCA 3HOYH 4DV6L 3G48A 3NPPA 3H0GG 4IFDJ 4QGUA 3S1RB 1TWAH 4QIWB 2Q8TA 1WCMH 2OCEA 4JI0L 1I4PA 3MEFA 2KCCA 1VQEA 3HOWB 2UU9Q 1R4PB 1Q1BA 1HPCA 2M9VA 3KLRA 5EBCA 3WDNA 5C44H 2K50A 3DUZA 3K7AH 3CMAA 1EY8A 1BR9A 3I91A 2OQ0A 2MP1A 3SHLA 4A3DB 5IOCA 1CM9A 3CQZH 3KF8A 1EYAA 1AE2A 1HFGA 3HKZG 1HA5A 1PA6A 1QNKA 3VA7A 4C2MH 3AMUA 3LWEA 5IT9c 3SDZA 1Q1EA 1E22A 5M3FH 3Q23A 2MJ8A 1X32A 3MWYW 1NR4A 4P75A 4XT3B 2UXBQ 1JT8A 2AQ2B 3E9HA 1QE6A 4B3ML 5T1IA 1PYWD 1QVFA 4I7ZC 5C0XG 5J1ZA 1P16A 2LSSA 4X62L 3WWVA 4QL5A 4G7OC 2EJMA 3NHHA 2Y0SE 1EWCA 4LFAQ 2B29A 2CQAA 3PO2G 1I6VC 1SNOA 2R92B 1X9NA 3VYUA 1ZKOA 4KHPQ 3NBHA 5IYCH 1RKNA 4ZRZA 1EY6A 2PPBC 4DR7L 2Z1CA 3Q6SA 2IL8A 1K83H 2I46A 3RLFA 5E4WC 4X3KA 3D31A 3M7GA 3S16B 4NDXA 4IALA 2MFIA 3D6WA 1B50A 3CMEA 4YY3Q 1VQLA 3F2CA 3TMEA 4DK1A 4BBRH 2JK8A 4OO1G 3VYTA 3GTOB 3K7UC 4JW0A 3T1YQ 4KJOA 2IHFA 3I4NH 4ZYSA 4IQZA 1LLRD 2EZVA 1EIYB 3IL8A 3BDCA 1SLJA 1LTLA 2E8GA 1H9SB 3BVZA 3MEHA 4HN7A 1A3TA 4GNXB 1VQPA 1GUSA 4LF6Q 5IYBH 4BBSG 3I4MG 2ZM6L 4TSSA 1WTPA 3MHBA 5IT9E 2XRQD 4IUVA 1UEAB 2Z6KA 3HG9A 4QQBX 2NVQB 4JYAL 1IXRA 1LYLA 2BA0A 4XDXA 5DEHA 3H0GB 1S5DD 1H9SA 2MO1A 1TU2B 4HJ7A 4GNXA 1HZBA 2EY2A 2YU9H 4L5QA 4BXXG 4V0BA 1HUMA 1UE5A 3QB3A 1DZ1A 2Q2IA 4IUQA 4G57A 2JA8G 5J39A 3U4VA 3I8ZA 3K5LA 1E1TA 4DUYL 4KMUC 1XMOL 4DR3Q 2D5DA 4LAAA 4H44C 1XXGA 1SE3A 3OSOA 2VQFQ 3J81j 4NKLA 1A2TA 3QWNA 5KRUA 1RL2A 2KHIA 3BYTB 1H9RA 5EKIA 3S24A 2RVLA 4X3SA 3R2TA 3HKZB 5G3LF 3ZJYC 1VQGA 4NB3A 2SOBA 5F2DA 4A3CH 2QCPX 1EWHA 3CAMA 3I55A 4FVMA 2VB2X 3MVVA 5EKKA 1Q90A 2R7DA 2OTJA 2NVYH 1VCIA 4L5RC 5FLMH 1O80A 1LT4D 2K05A 4DXFA 1TVXA 1AN8A 2F0IA 3W3AA 3M85A 1OO9B 1V8QA 1JJ2A 1JR0D 2XWJB 3Q0AA 1I4XA 1FYCA 2BH2A 3PO2B 1MKHA 4XQJA 1EU4A 2KVMA 4DA2A 3ERQA 1G8ZD 2FJ2A 3ER0A 3VYSA 3R3OA 4A3FH 1Q8KA 2Z6BA 4ZQ3A 2XTIA 4JI3Q 3M3YB 2OF1A 4LFCL 5A2QE 2J4XA 1CKMA 1H9KA 3OWEB 4S3SA 1FL0A 3KLWA 4BY1G 4QIWE 4DV1L 3GTGH 1STHA 2A6HD 5LL6S 1CQVA 5DNFA 1CSPA 4LF4L 4PZ6A 4HCSA 4DGZA 4LF9L 3BG3A 2FINB 5G3LD 2GVBA 1SYDA 4QUCA 1D5XC 5LMUL 2F0FA 4JI2L 1S4ZA 1ESRA 3CD6A 2PCFB 3GD7A 4JI5L 3GDEA 2L55A 3RZOH 1GO3E 5C4JH 3CP0A 4OX9Q 5M5YH 1E3PA 2K01A 4DR2Q 1G2TA 2E2DC 4OEMB 3ND8A 3QOJA 4OWXB 3WOEA 4GS3A 1KXLA 3KFUA 3A54A 1PRTD 1PFMA 2MQHA 3RUZA 4GOPA 3I4MB 2XVSA 1VQ8A 4EQPA 1VQIA 3OMCA 4OONA 4A3GG 1UE6A 4DV6Q 3OYYA 2EE1A 4JI1L 1TY2A 4CGYB 2AWOA 2F4VQ 2I07B 1PFNA 1WJJA 3R8BA 5KYLA 2SDFA 4IJHA 4F87A 2K33A 4UP7A 2YV5A 4KKTA 1QVCA 1VQMA 2JA8B 2D2CC 3VR5A 2DNCA 2C35B 1A62A 1F2LA 1OXXK 3J80L 3GTMH 3GTOH 1O7LA 5CORA 5BR8L 3MZ5A 4CKBA 2K5HA 5FJ8G 1MJCA 1STAA 1GVPA 2LS01 3HFZB 4AYBG 2KECA 4LWCA 2JA6G 4DAPA 2HHHL 2YYZA 1N9WA 1IHZA 2EIFA 1FNWA 2E75C 2WAQB 1JB7A 4C3IG 1EQQA 2F3VA 2JA9A 5CC4A 3S17B 4JI8L 3I2ZA 4X62Q 4K14A 1Y69U 3NK9A 2YTVA 2PI2E 4P71A 3L3OC 5IYDG 2LY7A 2ICIA 3JC66 2D62A 2F3IA 3PUXA 4AIMA 1HNZL 3T1HQ 1SYFA 1JB3A 3H6MA 3UI2A 2K6AA 4EQ5A 2FXQA 2G9DA 4NPSA 2JA7G 2E5LL 1JCKB 4DR7Q 3SXHA 5M5XH 5JJKA 4K0KL 2PZTA 1T5XD 4JBKA 1SMXA 1I3QB 5IP9H 4DFAA 5DM73 4N9TA 5JJZA 1GHKA 3CF5A 4PV1C 4CJ2C 4JBWA 1DOMA 1TS2A 4UY8C 3BU2A 1DOKA 4RHSA 3RMHA 2N8NA 1STYA 4L6TB 3CC2A 3A5UA 3BZDB 1K0SA 4DV7L 4R8IA 3FPUB 2ZXRA 2BOSA 4YWMA 3VA5A 2F0MA 5M9OA 3A7AB 4KY5A 4ILWA 1VQOA 3I72A 3MA2B 1PH4A 1ENFA 3J7AV 1EWIA 3SE0A 2PQEA 1KDAA 3EBEA 1ONLA 3HKZE 5C0XH 3J81c 1X3QA 3FRPB 2ZM6Q 4POFA 5AFWA 4XXEA 4A3KG 2QA4A 1LUZA 2GN5A 3GO5A 3K8AA 4JYAQ 2F4IA 1PTOC 4UPAA 1VQDA 1RF2D 3VR3A 5DAUA 1TWGH 2J0TD 5E1FA 4A3BG 2JA5B 1KL9A 1VQ6A 1V9PA 4A3LG 3NWSA 3SK6A 2A6HC 2N49A 1Q46A 2R61A 3UDFA 1I4HA 2D0OA 3RN2A 4KJNA 4DUYQ 3GTQH 2A68D 4KD4A 1RD9D 5JJLA 2K4KA 2QDLA 5JPMC 1Q86C 3SR1A 1ZEQX 2X6LA 3GQBA 1FD7D 4OO1H 3TP5A 3NWTA 4DV0L 3TZDA 1K28A 1FVIA 3A56A 1KAAA 2PNHA 5I6YA 1LTAD 3SVMA 2F0VA 3P1HA 4A3EG 4B3RL 4AYBB 2ENBA 1PRTC 2JA6B 1PYBA 3BDLA 1Z6HA 1B3QA 4JI7Q 2KUMA 5ELFA 1YHBA 3CRKC 1RTNA 4C3IB 1D1KA 4BBSH 1PH3A 2R93H 5CV9A 4I65A 3URYA 2R7ZG 1N33L 2A74C 4NXNL 2DNEA 4YCVA 4B9XA 1VMPA 5BN5A 1NE3A 4K8JA 1V43A 3I4OA 5C4XH 3J81E 4FO2A 1GKHA 3DWPA 2JA7B 1L0WA 3X3NA 3QOLA 3J7AF 1EIHA 1XWEA 3J7YW 2DUDA 1V1QA 3T13A 4LFCQ 2JA8H 4LUOA 5ELOA 1A0IA 4POGA 1YJNA 3A74A 2RBMA 4FF1A 1VQJA 4DNRB 2WB1B 4DV1Q 2AMCB 3ITPA 1SMYC 5LL6X 4A4IA 1SXTA 4IJLA 1DOLA 2Q2UA 4IO9A 3KLSX 1AH9A 3F8TA 4A3DG 1WTHA 1TWFB 4LF9Q 1KC8C 2HCIA 2VQEL 1NY4A 1PH8A 4JI2Q 4G4KA 3PIO3 4H13C 2QGQA 3R2IA 1SE2A 3ONAB 4JI5Q 2JEAI 2I5LX 1BKBA 2VY3A 2PZWA 2QDBA 3S1MB 3MXUA 1NJIC 3S17H 2C5CA 3K57A 3KBXA 2N88A 5ELNA 1DXMA 3QJYA 1KIXA 1B2TA 2QW7A 3ULPA 1ET9A 1L0YB 5FO7B 4A3KB 1I50B 3Q8DA 1VQCA 3BVMA 4JI1Q 1STGA 3GP7A 4NW2A 4OXPA 1JE5A 2DN8A 2RSOA 1KDBA 3M7NA 4KD3A 4A3BB 4LK1C 4ZUIA 1I3QH 1VQFA 3CC4A 3UDIA 1V1OA 1LM0A 1SE8A 1SYBA 1I6HH 1EZ6A 4PMWA 4RGNA 4U68A 4BY1H 1ZXTA 4X66Q 1GUWA 3TN2A 4PZ8A 1BCPF 4K2LA 1YNJC 3UE1A 1SROA 2PO4A 3MXGA 1TQOA 2EYFA 5BR8Q 2EYPA 3ND9A 1OXTA 3T51B 2OXPA 3T16A 3T56B 1NCVA 3HOVG 2WP8J 4DAYB 1X3GA 4R4CA 4MNOA 4FXDA 5I2XA 3H3VH 1PMRA 2HHHQ 3KLSA 4A3EB 1WTVA 5C6AA 3K81C 5EPLA 5FKAC 2E2HB 4DV4L 4O0AA 5IE8A 2E2IB 4JI8Q 1C7YA 2Q2TA 1VS0A 3VR4A 1W6KA 1S5ED 4IFDG 2VB3X 3OOCA 4A3MG 2ICEC 2NVTB 5GADC 2R7ZB 4HJ9A 4A3GH 2F0NA 4DAYA 4X3TA 1VQ4A 1XPOA 4TVAB 1HNZQ 5IY0A 1RTOA 1SN8A 5IP7H 3DLLA 1UAPA 5J3BA 2F0TA 3QIAA 2J7ZA 3EIVA 3S14H 1Q12A 1DGSA 2A68C 3KF8B 2E5LQ 1EQVA 4JI4L 2AWNA 3J7A5 5FOBB 1R9TH 4OIJA 3NSWA 3L7ZC 4YCUA 4ALPA 1D6EC 2NVXH 1EEFD 1AE3A 2Q8RE 3MXPA 4JOIC 4KHZA 3CCVA 4KN7C 4GKKL 5TSSA 1RDPD 1EQTA 1KABA 4OWTB 1AZQA 2E74C 1BCPD 1BDOA 1YBYA 2B2UC 5K5PA 2MPMA 3CCSA 3S1NB 2JE6I 3W2DA 3D6CA 4YHHL 5FJ8H 1MGSA 4IPGA 1VQNA 1C0AA 5IGBA 4FNFA 1N36Q 2JP1A 3E0EA 4BA1I 2R7FA 5C3EB 1JE4A 2CKZB 1HTPA 4Y7NH 2JA6H 3S2HB 4A3IH 5FO8B 3S15H 3M9BA 4CDDC 3NBHB 4HJ8A 4C3IH 4QUFA 1E24A 2D9UA 3LNNA 1ILQA 5CYUA 1ENCA 1FR3A 3H09A 1ZYRD 1WVLA 4GNXC 1MD2D 4AYBE 1PTOH 4RAUC 1S5BD 4DAMA 4LF5Q 1X6OA 2JXMB 3STBD 4YWKA 3SK5A 4LUVA 5JVH3 1JJCB 1CKOA 2CVRA 2RDFA 4LF7Q 3W1GA 4ZKBB 1VMCA 2V4DA 4TQUS 2KHSA 3G6JB 2GA4B 4ABNA 2XWBB 3A8JE 1YEZA 3OTOQ 2PYKA 2H1EA 1S5FD 3X3MA 5KNCA 3F2BA 2B2YA 1EZ8A 1MHWC 1SNMA 4DF7A 4NMZA 4DV0Q 1B53A 1V1PB 1DONA 2HQLA 1IBML 3U58A 3D4WA 3HOVB 4DNIA 4LFBL 4B3RQ 4UDUC 4L5TA 1ML0D 5E3FA 1MSGA 3E9IA 3SK8A 1KD1C 4RA8A 5JPNC 3AB9A 3Q24A 3MAQA 1IYVA 1EYGA 3CRLC 3W1BA 1QUQA 2UUAL 4DUZL 1A2UA 1N33Q 3NTHA 2RDGA 1I50H 4A3KH 4HIMA 4NXNQ 2VUMB 4A3MB 1V1PA 2QILA 1LTSD 2Z0SA 4HR7B 4IZ8A 4OWWB 4V190 3RZDH 4RWSC 2F0QA 3KOJA 2CH4W 3CCMA 2KJXA 1F9PA 1XJVA 2B63G 1SSOA 1CSQA 4DV5L 1LT6D 3J80c 5M3MB 4A3LH 4CBVA 1S3OA 2L1BA 3I3CA 3O13A 1BOSA 3PSIA 3E5SA 1D1IA 1PTOF 1Y1WB 4DR4L 4UHVA 1Y8NB 4A3JB 1IBLL 5CV8A 3JAMi 2SNSA 2NTSA 1B3AA 4IOCA 3HOUB 3HOXB 3GTLH 1WI5A 2DJFC 2PI2A 2VQEQ 2JSOA 4B3TL 1SFOB 1CZGA 2IJ0A 2IHEA 1K8GA 3M4OB 1B9MA 2EYOA 1U4LA 4K6LA 3I73A 2RCNA 2KENA 2I5MX 5GAGC 5C5LA 4HIDA 1HR0L 1A63A 1OXUA 4EVOA 2WAQG 2EQSA 2F0SA 2XIWA 2BE5D 2IPKD 4ME3A 2WKDA 3NQIA 3MFGA 1R4QB 3TDQA 4DPGA 4QJFA 4LF8L 1PRTF 1M4VA 4M1UB 1XX8A 3RD4A 1STNA 1EYDA 2O5JC 2LFNA 1W2BA 5EPKA 3S1RH 4WRDA 2DY7A 2AUKA 2IT1A 3U9SA 1HQRD 4B08A 1BCPC 4C3HG 3K5MA 1HXYD 3HOWH 2EYJA 1PTOD 1L0XB 5AJ3L 1P8LA 1HZAA 2NZOA 2F0EA 3TQYA 1SNDA 1Y1VB 4R4OA 4RGMA 4GN4B 4N8X1 1Z7TA 2YTXA 1FGBD 3E0JA 1WYDA 2YTYA 5J22A 1HZ9A 2DGYA 1WTQA 4GLVB 5D65A 3J80E 4A3DH 3PF4A 1HUNA 2LMCB 3HS0C 5BN4A 5C0XI 5EGTA 4GN3B 3G4SA 4GOPB 4RKLA 1C8CA 4HMIA 3S2HH 1PHJA 1ZYRC 2AKWB 1PZJD 4JG2A 1O7YA 2WINB 1SNPA 1CQFA 2LKVA 4C3JB 3C1FA 4IUUA 2PQAB 1YIJA 3D4DA 2A8VA 3STBC 2NN6G 4K5VA 5ELEA 1JMCA 3UE0A 3LGJA 2CW0D 2L11A 5JAVA 1KHIA 2R92H 2K5DA 1TY0A 3FHWA 3NTIA 4M8AA 4Z9CB 2K03A 4JI4Q 1L1OB 3CCUA 2JA5G 1PH9A 2B63B 2PQAA 2F03A 1CA6A 4JI0Q 1QOHA 4OO1I 2K1BA 1E2VA 1YITA 5CBAE 2Q8IB 1I94L 2B2WA 4GKKQ 3NXWA 2NZHA 2Z4IA 2X69A 2ZTDA 4FXKC 4P2CB 1LACA 4Y52H 3S16H 5K36H 3J7ZC 1XYIA 1EU3A 4EX5A 4YHHQ 1L1OA 1L2FA 4R4IA 4K6DA 3RLNA 4XYOA 3F1ZA 1XMQL 1JORA 1WCMG 1XTCD 3B6YA 1SMYD 2HIXA 2VXWA 1WTOA 1BVSA 2HQEA 3BDOA 1XTDA 5E4XA 1D5ZC 1GJXA 4B3MQ 3H3VC 2ES2A 2F0OA 4GLAC 4IFDH 4R1JA 1TWHB 1STEA 2F1MA 2K5WA 3M4QA 3K0YA 4A3MH 1X3PA 1IYUA 5JVG3 1QZGA 2ALYB 4RHRA 3D8GA 2NVQH 2B2TC 2DJGC 4FF2A 1II3A 2N78A 3AQQA 4KHVA 1C9OA 1IYJB 3H0GH 4KLKA 3T4AC 5M5WB 4IUNA 4L5SA 4C3HB 1MBYA 4XTCS 4LJZC 4PNYA 5KNDA 2UXCL 2EYLA 1VQHA 3PUZA 1BUVT 3E6ZX 3GTKB 4K2KA 1O7IA 1X55A 2BA1A 2WB1G 3S2DB 1D2BA 1Y14B 5I4DA 2GVAA 4X65L 3C2PA 1MSHA 1IBMQ 2PZUA 3FKIG 4XT1B 1TWCB 1FGUA 4ZUJA 1J8IA 1EIFA 2H5XA 1XPRA 2BE5C 4A93B 4JBMA 1YNJD 3I4LA 2VL6A 5KEEA 3FP9A 1EOTA 2A69D 3BVGA 1WTXA 1SNCA 1ET6A 4DUZQ 2UUAQ 1B70B 4LMQD 3KJOA 1Q81C 5C4ZA 1GXDC 1QNUA 3VR6A 4BBRG 1ASYA 1JJGA 3PO2H 3K59A 2PW7A 4DV5Q 2ZT9C 1F2MA 5JOBA 3H94A 3KDFA 3HOZB 1JQYD 3M3YH 3KK7A 2K7VA 4DR4Q 1U4RA 1I4QA 2EYMA 1Z9FA 3BZCA 1QJOA 3CCLA 1I4RA 5FK9C 3H3VI 1XMOQ 1IBLQ 2ID0A 3N52A 2MHVA 4XQNA 1LV9A 2ZJRA 1PLFA 5C3XA 4PMCA 2QEJC 3BZKA 4JPBW 4B3TQ 3HOYB 1WOCA 5CV5A 5BN3A 2B2VC 4IN3A 5KNBA 1QCBD 2N55A 2VW9A 3MC0B 3BYYB 4HSPA 4ZAIA 1SYEA 2UUCL 1TWAB 4ZLTF 1MI2A 1WCMB 2JN4A 2MO0A 4A75A 1B44D 2OQKA 1HR0Q 2CQOA 2CW0C 2OWOA 1NNXA 3PGZA 1YNXA 2WIIB 5C44B 2FMMA 2K14A 3I90A 1VF7A 3K7AB 1HJPA 3L2PA 1GD7A 2O2LD 4MTKA 3I4MH 3A8KE 4R4TA 1CT1D 3CQZB 1N34L 1BF4A 2E2JB 1SJED 2SEBD 1A8VA 1JICA 3CPFA 4C2MB 2B63H 4A3CG 3H15A 1ILPA 2AHOB 4AQYL 4QB4A 3CPWA 4HJAA 5M3FB 2Y0SB 4BXXH 2KBNA 5AJ3Q 3C3LA 1HTLD 5I9OA 1AFPA 1C4QA 4LF6L 3TZUA 4YWLA 2EPBA 2R3ZA 3RN5A 5LMNW 1G91A 1WTWA 2ZTEA 3OIPA 3ICEA 1IKLA 2G9HD 4RH6A 1NR2A 2NZ1D 3OMGA 3ERSX 4LF4Q 2Z4HA 3IFDA 1M8AA 4HMJA 1SRUA 3FKIB 1DM0B 4IOAA 5LMUQ 2IW3A 3FPPA 4DNTB 5C3EG 4DR1L 1XPUA 1YJWA 1M90C 1TIID 4R9WA 5ELCA 2RHQB 1K83B 1G6ZA 1IW7D 1TWHH 2NTTA 4PZ7A 4OL7A 2WACA 3PO3G 1HHVA 1OTCA 3DWAA 1GUGA 5CGKA 2IX1A 2PNRC 4K5WA 5EAYA 4BBRB 1EOVA 3EN2A 2WAQE 2AUJD 3TREA 3I4NB 2MGSA 2WFWA 2NBFA 4G7HC 1KTKA 3C46A 1RJTA 3QO2A 1E2ZA 5LMNL 1I94Q 3AFQA 1WD1A 2EY5A 5JJIA 4JC0A 4ZCKA 1CZWA 4R4QA 3S2DH 4IPDA 3K58A 3A55A 4C56C 3K5OA 4XIGS 1TWCH 2MNAA 1EFWA 1BBWA 2A69C 4HCEA 4GKJL 4LUZA 1HQMC 1PDQA 3EA6A 3JAML 5EQ0A 5H1SE 4JV5L 2EXZA 5FLXL 1GUOA 5GQOA 1MIUA 4FXGC 4JK1C 1M1KC 5COYA 3DM3A 2V1CC 4WJWA 3L0OA 2NN6H 2HDMA 1U4MA 1GUNA 4RGOS 1QILA 3A5ZB 5DLQE 4GLXA 2I0QA 2A5HA 1JOOA 2ZXOA 2AQ1B 2VUMG 3GV3A 5KGUA 1HNXL 2IX0A 1YZ6A 4JI6L 3RR5A 2HUGA 2XRSD 3I7FA 1HH2P 4DK3C 2JA5H 4BA2I 2B2YC 4DXGA 4K0KQ 5M3MG 1KQSA 5C5MA 2HD3A 2A1AA 2UXCQ 1PV4A 1CHQD 5KIXA 2CFMA 1Y1WG 1SYCA 2KQ3A 3PUVA 3QG1A 5ELDA 1SBBB 3AEVA 2TMPA 4YCWA 4AH6A 4A3JG 3ZYYX 5HY6A 1STBA 1TXYA 1KRSA 4X65Q 5JEAG 2RSNA 3HOXG 3HOUG 3HRZC 2EYHA 1G2SA 1RIPA 1B1ZA 1Q3LA 1QVGA 4KI0A 4XQQA 4DV7Q 2EY1A 4BWGB 2JEBI 3R93A 1VDZA 2KHJA 3G71A 2F4VL 3CU7A 4IURA 2O4XA 1U4PA 2BDNA 4KKUA 4A3FB 4DK0A 3PIPA 2AQ3B 3L9AX 5IP9G 4HAEA 2XSCA 2OTLA 3TP6A 1AEXA 4N9PA 4OGQC 2Z6KC 3M4PA 5JEAJ 1A3VA 3EVQA 1PZKD 3P75A 1FNUA 5IGCA 1VQ5A 2F0GA 5GAEC 3GTGB 3PO3B 1CUKA 3TS0A 3F2DA 1XNRL 4JVZA 2M00A 4U673 2E2JH 3IKJA 4WORA 5IYDH 2CWPA 1JOQA 1SYGA 3IAYA 5D3DA 1F9SA 1OXVA 4KY6A 4RCNA 2KOLA 1VQKA 2JA7H 3RZOB 5C4JB 2M2LA 5M5YB 4CDCC 1A3UA 1OXSC 2F0WA 1NBWA 5D14A 1E7ZA 1Y1VG 3FVQA 3NE5B 2XN9C 3U50C 1DD2A 1PXUA 1FJGL 1XNQL 1QUQB 1KNEA 1TWFH 1B7YB 2A73B 4IPHA 3NUCA 3ULJA 3I56A 3T1HL 3GTJB 3FKIH 2RDHA 4JBJA 4MIUA 2FFKB 4BY7G 5C0XJ 2HT1A 1E2WA 5HURA 2UUCQ 1IW7C 1D5MC 2F3WA 2WB1E 5I2YA 4QF4A 5EPJA 1W3SA 1G51A 1X54A 3DMUA 1CKNB 1TS4A 1NUCA 3S1MH 2FHTA 4C3JG 1LO5D 5CMDA 4KTAA 3DHQA 1HA6A 2L4NA 4G7ZC 2UUBL 2L12A 3OIQA 5HGQA 4OIKA 1HR0W 4KK7A 3GTMB 1N34Q 3A0JA 1GOZA 1Q82C 3HGBA 1D7QA 1UUPA 4MTNA 2Q2HA 3V05A 1F2YA 4JOIA 1PZID 1IBKL 1CKNA 1EY9A 1O78A 2RF4A 3T53B 4AQYQ 4A3BH 2ATWA 4OELB 1LTID 2B2UA 1IL2A 1KLGD 3SEBA 4DV2L 2UXDL 1JWUD 2LXKA 1PVOA 4QY7A 2ASBA 4NP5A 4WFN3 2R93G 1LT3D 4ULLA 3J81i 3AYHB 1EFID 1PH6A 2BH8A 2PW5A 2CCZA 1K0RA 2B3GA 1YHAA 2F0PA 1E0BA 1PYSB 2K28A 5FO9B 4DV3L 1F2ZA 4QMGA 2A6ED 4DR5L 4IFDI 3TBIB 5C4XG 3TSSA 1HNWL 3E3XA 4DR1Q 4GOPC 5M5XB 2WV6D 3QR8A 3AFPA 4A3EH 2E2HH 3PIP3 4APVA 4RMFA 2K32A 1EY0A 3D4RA 2RHSB 2E2IH 4TRDA 3RNUA 2F0KA 4GZYC 2K04A 3PQIA 3OW2A 3SK4A 2NVTH 1H9MA 3HKSA 2R7ZH 4X6AH 5CBEE 1UNSA 2B2WC 3HZXA 3MTSA 1NSNS 1VF5C 2NWGA 5CR3A 4O42A 3TRZA 2K5NA 3H91A 4GN5A 1W6JA 4F7XA 2F0LA 1BO0A 3DWQA 3U4ZA 5LHY1 4Q5VA 4JI7L 1H9JA 5KYIA 2JYOA 1NMGA 5LMNQ 1A6XA 1L1OC 2F0UA 4H0LC 5EKLA 4Q0FA 4MHEA 4CHTB 2LXJA 3VYRA 2VS1A 3MFYA 5EBDA 3LX0A 1ICFB 5IWAL 2NUCA 3G7LA 4C1NK 1JWMD 1VQAA 5IT9L 4FYDA 4DU9A 3D0FA 2XNAC 3KUPA 3DM1A 1S72A 1TT2A 2F0JA 3S1NH 4FP5D 2BCOA 4O1NA 4GKJQ 1TWGB 3PMFA 1YVCA 4BY7B 4JV5Q 3NTKA 2XGTA 5C3EH 2JQOA 2EOTA 1K8MA 4A93G 1ASZA 2WKCA 1TR5A 1K73C 1SJHD 1FNVA 3DEOA 4DV4Q 3TS2A 3S9WA 3IFTA 1Q8IA 1J6QA 1K3BC 3GTQB 1TS3A 3CW2C 4J15A 4P72A 4ZK9B 3PO3H 2VZAA 4UP8A 2L15A 2B8FA 3D3RA 4WJ4A 1HNXQ 4JI6Q 4P73A 1EL0A 3K0XA 4RFBA 1N32L 1CFMA 1QG7A 1KDCA 3NQTA 1UWVA 1KAWA 4PQXA 4J6HA 1VQ7A 4ZKCB 5C4HA 3HOZG 4DR6L 2L5TA 5C3WA 2PMZB 1DJRD 1E1OA 1YHQA 4BBSB 1RODA 2R93B 3CKIB 5I6WA 2EY6A 5IODA 3CXCA 2L9HA 4F88A 1X65A 1KNAA 3P7JA 4NXML 3GTJH 2ZJQA 4EQOA 5IP7G 3PUYA 1BCPB 4CJ0B 4HTHA 3HOYG 1J9OA 2TSSA 3HOVH 5D3IB 3TP7A 3FMCA 5C4XB 1GM5A 3NELA 1JOKA 3KF6B 4KV6A 2IWHA 2SNMA 2RCFA 5A2QL 1NTGA 1N8RC 3A7LA 2KA7A 1EUJA 5C44G 1J5EL 2K75A 2F0DA 2R6GA 2E76C 4X66L 1QZHA 2Z8LA 4B3SL 1K3RA 2B8GA 2KCTA 1ENAA 4MN3A 5CV6A 1XNRQ 2VUMH 3K5NA 1EY7A 4YIJA 1AW7A 3KF6A 1BXTA 4HIOA 3IRBA 1LTTD 1UE1A 2KCMA 4A3IG 1U9RA 4HEDA 4DN4M 4J1MA 4X64L 5M3MH 1SNQA 3ULLA 5M3FG 2Y0SG 4RG1A 4J8QA 2QKIC 3K80C 4BS9A 4KN4C 4DKAC 1Y1WH 2A6EC 2I5HA 3OW7A 1Y8PB 1JWSD 5GAHC 4A3JH 3S1QB 1IL8A 2NB0A 4CDFC 1PH1A 5HGTA 1FJGQ 5EJWA 1XNQQ 1VQ9A 5JEAH 3HOXH 3HOUH 3KBGA 3BS1A 1B8AA 1VQBA 3PUWA 1G291 1I4GA 1SFOH 3C1EA 3P20A 5IYCG 1BQQT 3M4OH 2ZJPA 4LFBQ 2EDGA 3Q22A 3MXNB 4PMBA 2VNUD 1H95A 2UU9L 1SEBD 4L63B 2UUBQ 1I6HB 4BY1B 1T9HA 3KDFB 1O7ZA 2A19A 1KRTA 3AU7A 3PCOB 3HP3A 4B9WA 1DYQA 3PIOA 1YNND 4CKCA 5L37A 1IBKQ 3UDGA 3MXNA 1N36L 1CI3M 4L8JA 3I4NG 2N3SA 3EROA 3DXJC 2HIVA 4ME5A 1PFBA 4RGTA 1KLUD 4DV2Q 1PH5A 2EJFC 2UXDQ 3K6OA 1WFQA 2HCCA 2UXBL 3OWFA 1T5EA 1Y1VH 1EYCA 5IYBG 1A15A 3JAMc 5DM63 3CCRA 1HFNA 5FLXc 4LF5L 4QCLA 4A3GB 4E6IA 4IUPA 1X56A 3GTPB 1S5CD 3EJIA 4DV3Q 5A35A 1EIGA 4DR5Q 4LFAL 2NN6I 4JCVE 4BY7H 3HEJA 3S14B 1HNWQ 1WD0A 4CJ1B 4LF7L 3V2TA 4KHPL 3TP8A 2CWAA 2X6GA 2IX3A 1R9TB 2BDOA 1EY5A 1SR3A 4PG3A 4R8NA 4C3JH 2NVXB 2B2TA 2KEEA 2K5VA 4RKBA 2O5IC 3W5OA 3SGIA 1YJ9A 3OTOL 1C48A 1F9RA 1S40A 1CTMA
chains in the Genus database with same CATH topology
2DY8A 1Y8OB 1NAPA 2EVBA 3LWUA 2QF7A 2MUYA 1JC7A 1QB5D 4EQNA 3OPOA 2C9OA 4Y7NB 3A8IE 4A3IB 3S15B 3NP8A 2ZXPA 1DCZA 1BBXC 4F8MA 1Z47A 4IUTA 5IGDA 2RQXA 1PTOB 1GUTA 2CHBD 3U9OA 2HDLA 2EJGC 1TS5A 1QWYA 1HCZA 4XYQA 5IGFA 4OHJA 3JAME 2KEDA 5FLXE 2L0CA 4K5XA 1CK1A 4HSVA 1B4OA 1WTRA 1CHPD 4ODGA 3EQLC 5IGEA 4KKSA 1SAPA 5CV7A 4UAIA 5ISRA 5CV4A 2B39A 1B9NA 1PRTB 3V96A 2RA4A 4EGVA 4K8IA 1EY4A 1RHPA 1K8OA 5I9PA 4FF4A 3FEWX 3M4YA 2B2VA 1CA5A 3N6RA 3PV0A 5IIFA 1F77A 1LTRD 2NYZD 3I70A 3NBIA 1IKMA 3RZDB 4ID6A 1HRJA 3J81L 3VR2A 4C1NI 1LTBD 3F2UA 2OT2A 1LABA 3DEPA 2YU9B 4X3UA 4TKOB 2F0HA 1YNNC 1SDFA 1LT5D 1F9QA 2KCNA 5NUCA 5K36G 3EFXD 3CHBD 1ICWA 2H4OA 4RCOA 5IGGA 3GTLB 1SE4A 2FMCA 1RCVD 4CKEA 4FF3A 1TKWB 3OHXC 1GHJA 1BNZA 5ELBA 2RKSA 3WOFA 3FDTA 2OEOA 1ESFA 2K5QA 4H7BA 4KY7A 4DAVA 1EEID 3GV6A 5T1GA 2NVYB 1LTGD 1AZPA 1AP0A 3NPPA 4IFDJ 3S1RB 4QIWB 2Q8TA 1I4PA 2KCCA 3HOWB 1R4PB 1Q1BA 1HPCA 2M9VA 3KLRA 5EBCA 3WDNA 3DUZA 1EY8A 1BR9A 3I91A 2MP1A 3SHLA 4A3DB 5IOCA 1CM9A 3KF8A 1EYAA 1HFGA 1HA5A 1QNKA 3VA7A 3AMUA 3LWEA 3SDZA 1Q1EA 3Q23A 2MJ8A 1X32A 3MWYW 1NR4A 4XT3B 2AQ2B 1QE6A 5T1IA 1PYWD 4I7ZC 5C0XG 5J1ZA 4G7OC 2EJMA 3NHHA 1EWCA 2CQAA 1I6VC 1SNOA 2R92B 3VYUA 1ZKOA 3NBHA 1RKNA 4ZRZA 1EY6A 2PPBC 2Z1CA 3Q6SA 2IL8A 2I46A 3RLFA 5E4WC 4X3KA 3D31A 3M7GA 3S16B 4NDXA 4IALA 3D6WA 1B50A 3TMEA 4DK1A 4OO1G 3VYTA 3GTOB 4KJOA 4ZYSA 4IQZA 1LLRD 2EZVA 3IL8A 3BDCA 1H9SB 3BVZA 3MEHA 4HN7A 1A3TA 1GUSA 4TSSA 1WTPA 3MHBA 5IT9E 2XRQD 4IUVA 1UEAB 3HG9A 2NVQB 2BA0A 4XDXA 5DEHA 3H0GB 1S5DD 1H9SA 1TU2B 2EY2A 4V0BA 1HUMA 3QB3A 1DZ1A 4IUQA 4G57A 5J39A 3I8ZA 3K5LA 4KMUC 2D5DA 4LAAA 4H44C 1XXGA 1SE3A 3OSOA 4NKLA 1A2TA 3QWNA 5KRUA 3BYTB 1H9RA 5EKIA 2RVLA 4X3SA 3R2TA 3HKZB 5G3LF 2SOBA 5F2DA 2QCPX 1EWHA 4FVMA 2VB2X 3MVVA 5EKKA 1Q90A 1VCIA 1O80A 1LT4D 2K05A 4DXFA 1TVXA 1AN8A 2F0IA 3W3AA 3M85A 1OO9B 1V8QA 1JR0D 2XWJB 3Q0AA 1I4XA 1FYCA 3PO2B 4XQJA 1EU4A 2KVMA 4DA2A 3ERQA 1G8ZD 2FJ2A 3VYSA 3R3OA 4ZQ3A 3M3YB 2OF1A 5A2QE 2J4XA 1H9KA 3OWEB 4S3SA 1STHA 2A6HD 5LL6S 1CQVA 5DNFA 4HCSA 4DGZA 3BG3A 2FINB 5G3LD 1SYDA 4QUCA 1D5XC 2F0FA 1S4ZA 1ESRA 2PCFB 3GD7A 2L55A 2K01A 1G2TA 2E2DC 3ND8A 3QOJA 3WOEA 3A54A 1PRTD 1PFMA 3RUZA 3I4MB 2XVSA 4EQPA 3OMCA 2EE1A 1TY2A 4CGYB 2AWOA 2I07B 1PFNA 3R8BA 5KYLA 2SDFA 4F87A 2K33A 4KKTA 2JA8B 2D2CC 3VR5A 2DNCA 1F2LA 1OXXK 3J80L 1O7LA 5CORA 3MZ5A 4CKBA 1STAA 2LS01 2KECA 4DAPA 2YYZA 1IHZA 1FNWA 2E75C 2WAQB 4C3IG 2F3VA 5CC4A 3S17B 4K14A 1Y69U 3NK9A 3L3OC 2LY7A 2ICIA 2D62A 3PUXA 1SYFA 1JB3A 3H6MA 3UI2A 2K6AA 2G9DA 1JCKB 3SXHA 2PZTA 1T5XD 1I3QB 4DFAA 5DM73 4N9TA 5JJZA 1GHKA 4PV1C 4CJ2C 4JBWA 1DOMA 1TS2A 1DOKA 4RHSA 3RMHA 1STYA 4L6TB 3BZDB 4R8IA 3FPUB 2ZXRA 2BOSA 3VA5A 2F0MA 5M9OA 3A7AB 4KY5A 4ILWA 3I72A 3MA2B 1ENFA 3J7AV 3SE0A 2PQEA 1KDAA 1ONLA 5C0XH 1X3QA 3FRPB 5AFWA 4XXEA 3GO5A 2F4IA 1PTOC 1RF2D 3VR3A 5DAUA 2J0TD 5E1FA 2JA5B 3NWSA 3SK6A 2A6HC 2R61A 1I4HA 4KJNA 2A68D 4KD4A 1RD9D 5JPMC 3SR1A 1ZEQX 2X6LA 3GQBA 1FD7D 4OO1H 3TP5A 3NWTA 3TZDA 3A56A 1KAAA 5I6YA 1LTAD 3SVMA 2F0VA 3P1HA 4AYBB 2ENBA 1PRTC 2JA6B 3BDLA 1Z6HA 2KUMA 5ELFA 3CRKC 1RTNA 4C3IB 1D1KA 5CV9A 4I65A 3URYA 2A74C 2DNEA 4B9XA 1VMPA 5BN5A 4K8JA 1V43A 3J81E 4FO2A 3DWPA 2JA7B 3X3NA 3QOLA 3J7AF 1EIHA 1XWEA 3J7YW 3T13A 2RBMA 4FF1A 4DNRB 2WB1B 3ITPA 1SMYC 5LL6X 1SXTA 1DOLA 3KLSX 1TWFB 2HCIA 4G4KA 3PIO3 4H13C 3R2IA 1SE2A 3ONAB 2JEAI 2PZWA 2QDBA 3S1MB 3MXUA 2C5CA 3K57A 3KBXA 2N88A 1DXMA 3QJYA 1B2TA 1ET9A 1L0YB 5FO7B 4A3KB 1I50B 3BVMA 1STGA 3GP7A 4NW2A 2DN8A 2RSOA 1KDBA 3M7NA 4KD3A 4A3BB 4LK1C 4ZUIA 1V1OA 1SYBA 1EZ6A 4PMWA 4RGNA 4U68A 1ZXTA 1GUWA 3TN2A 1BCPF 4K2LA 1YNJC 2PO4A 3MXGA 1TQOA 2EYFA 2EYPA 3ND9A 1OXTA 3T51B 2OXPA 3T16A 3T56B 1NCVA 2WP8J 4FXDA 5I2XA 1PMRA 3KLSA 4A3EB 1WTVA 5C6AA 5EPLA 5FKAC 2E2HB 2E2IB 3VR4A 1W6KA 1S5ED 4IFDG 2VB3X 3OOCA 2ICEC 2NVTB 2R7ZB 2F0NA 4DAYA 4X3TA 1RTOA 1UAPA 2F0TA 3QIAA 2J7ZA 1Q12A 2A68C 1EQVA 2AWNA 5FOBB 4OIJA 3NSWA 3L7ZC 1D6EC 1EEFD 2Q8RE 3MXPA 4KHZA 4KN7C 5TSSA 1RDPD 1EQTA 1KABA 1AZQA 2E74C 1BCPD 1BDOA 2B2UC 5K5PA 2MPMA 3S1NB 2JE6I 3W2DA 3D6CA 1MGSA 5IGBA 4FNFA 2JP1A 4BA1I 5C3EB 1JE4A 3S2HB 1HTPA 5FO8B 4QUFA 2D9UA 3LNNA 1ILQA 5CYUA 1ENCA 1FR3A 3H09A 1ZYRD 1WVLA 1MD2D 1PTOH 4RAUC 1S5BD 2JXMB 3SK5A 5JVH3 2CVRA 2RDFA 4ZKBB 1VMCA 2V4DA 4TQUS 2KHSA 3G6JB 2GA4B 4ABNA 2XWBB 3A8JE 2PYKA 2H1EA 1S5FD 3X3MA 5KNCA 2B2YA 1EZ8A 1SNMA 4DF7A 4NMZA 1B53A 1V1PB 1DONA 3D4WA 3HOVB 4UDUC 1ML0D 5E3FA 1MSGA 3SK8A 4RA8A 5JPNC 3AB9A 3Q24A 3MAQA 1IYVA 3CRLC 1A2UA 3NTHA 2RDGA 2VUMB 4A3MB 1V1PA 2QILA 1LTSD 4HR7B 4IZ8A 4V190 4RWSC 2F0QA 2KJXA 1F9PA 1SSOA 1LT6D 5M3MB 4CBVA 2L1BA 3I3CA 3O13A 1BOSA 3E5SA 1D1IA 1PTOF 1Y1WB 1Y8NB 4A3JB 5CV8A 2SNSA 2NTSA 1B3AA 3HOUB 3HOXB 2JSOA 1SFOB 1CZGA 2IJ0A 3M4OB 1B9MA 4K6LA 1U4LA 2EYOA 3I73A 5C5LA 1OXUA 4EVOA 2F0SA 2XIWA 2BE5D 2IPKD 2WKDA 3NQIA 3MFGA 1R4QB 3TDQA 1PRTF 1M4VA 4M1UB 1XX8A 3RD4A 1STNA 1EYDA 2O5JC 2LFNA 5EPKA 4WRDA 2DY7A 2AUKA 2IT1A 3U9SA 1HQRD 4B08A 1BCPC 4C3HG 3K5MA 1HXYD 2EYJA 1PTOD 1L0XB 2F0EA 1SNDA 1Y1VB 4RGMA 1Z7TA 1FGBD 3E0JA 1WTQA 5J22A 5D65A 3J80E 1HUNA 2LMCB 3HS0C 5BN4A 5C0XI 5EGTA 4RKLA 1C8CA 4HMIA 1ZYRC 1PZJD 1O7YA 2WINB 1SNPA 1CQFA 2LKVA 4C3JB 3C1FA 4IUUA 3D4DA 2NN6G 4K5VA 5ELEA 2CW0D 2L11A 5JAVA 2K5DA 1TY0A 3NTIA 4M8AA 4Z9CB 2K03A 2B63B 2F03A 1CA6A 1QOHA 4OO1I 2K1BA 1E2VA 5CBAE 2Q8IB 2B2WA 3NXWA 2Z4IA 2X69A 4FXKC 4P2CB 1LACA 5K36H 1XYIA 1EU3A 4K6DA 4XYOA 1JORA 1XTCD 1SMYD 2VXWA 1WTOA 2HQEA 3BDOA 5E4XA 1D5ZC 1GJXA 3H3VC 2F0OA 4IFDH 1TWHB 1STEA 2F1MA 2K5WA 3K0YA 1X3PA 1IYUA 5JVG3 4RHRA 3D8GA 2B2TC 4FF2A 1II3A 4KHVA 3T4AC 5M5WB 4IUNA 4C3HB 1MBYA 4XTCS 5KNDA 4LJZC 4PNYA 2EYLA 3PUZA 1BUVT 3E6ZX 3GTKB 4K2KA 2BA1A 3S2DB 1D2BA 5I4DA 3C2PA 1MSHA 2PZUA 4XT1B 1TWCB 4ZUJA 1J8IA 2BE5C 4A93B 1YNJD 3I4LA 5KEEA 1EOTA 2A69D 3BVGA 1WTXA 1SNCA 1ET6A 4LMQD 5C4ZA 1GXDC 1QNUA 3VR6A 3K59A 2PW7A 2ZT9C 1F2MA 5JOBA 3H94A 3HOZB 1JQYD 3KK7A 2K7VA 1U4RA 1I4QA 2EYMA 1QJOA 1I4RA 5FK9C 2ID0A 3N52A 2MHVA 4XQNA 1LV9A 1PLFA 5C3XA 4PMCA 2QEJC 3HOYB 5CV5A 5BN3A 2B2VC 4IN3A 5KNBA 1QCBD 2N55A 3MC0B 3BYYB 4HSPA 4ZAIA 1SYEA 1TWAB 4ZLTF 1MI2A 1WCMB 1B44D 2CW0C 2WIIB 5C44B 2FMMA 3I90A 1VF7A 3K7AB 2O2LD 3A8KE 1CT1D 3CQZB 1BF4A 2E2JB 1SJED 2SEBD 1JICA 4C2MB 1ILPA 4QB4A 5M3FB 2Y0SB 3C3LA 1HTLD 5I9OA 1AFPA 1C4QA 3TZUA 2EPBA 2R3ZA 1G91A 1WTWA 3OIPA 1IKLA 2G9HD 4RH6A 1NR2A 2NZ1D 3OMGA 2Z4HA 3IFDA 1M8AA 4HMJA 3FKIB 1DM0B 2IW3A 3FPPA 4DNTB 1TIID 4R9WA 5ELCA 1K83B 1G6ZA 1IW7D 2NTTA 4OL7A 2WACA 1HHVA 3DWAA 1GUGA 5CGKA 2IX1A 2PNRC 4K5WA 4BBRB 2AUJD 3I4NB 2MGSA 2NBFA 4G7HC 1KTKA 3C46A 1RJTA 3QO2A 1E2ZA 1WD1A 2EY5A 1CZWA 3K58A 3A55A 4C56C 3K5OA 4XIGS 2A69C 4HCEA 1HQMC 1PDQA 3EA6A 3JAML 5EQ0A 2EXZA 5FLXL 1GUOA 4FXGC 4JK1C 5COYA 4WJWA 2NN6H 2HDMA 1U4MA 1GUNA 4RGOS 1QILA 2A5HA 1JOOA 2ZXOA 2AQ1B 3GV3A 5KGUA 2IX0A 2HUGA 2XRSD 4BA2I 2B2YC 4DXGA 5C5MA 1CHQD 5KIXA 1SYCA 2KQ3A 3PUVA 3QG1A 5ELDA 1SBBB 2TMPA 3ZYYX 1STBA 5JEAG 2RSNA 3HRZC 2EYHA 1G2SA 1B1ZA 1Q3LA 4KI0A 4XQQA 2EY1A 4BWGB 2JEBI 3R93A 1VDZA 3CU7A 4IURA 2O4XA 1U4PA 2BDNA 4KKUA 4A3FB 4DK0A 2AQ3B 3L9AX 4HAEA 2XSCA 3TP6A 1AEXA 4N9PA 4OGQC 5JEAJ 1A3VA 3EVQA 1PZKD 3P75A 1FNUA 5IGCA 2F0GA 3GTGB 3PO3B 4U673 2M00A 3IKJA 4WORA 1JOQA 1SYGA 3IAYA 5D3DA 1F9SA 1OXVA 4KY6A 4RCNA 2KOLA 3RZOB 5C4JB 2M2LA 5M5YB 1A3UA 1OXSC 2F0WA 5D14A 3FVQA 3NE5B 2XN9C 1DD2A 1PXUA 1KNEA 2A73B 3NUCA 3GTJB 2RDHA 4MIUA 2FFKB 5C0XJ 1E2WA 5HURA 1IW7C 1D5MC 2F3WA 5I2YA 4QF4A 5EPJA 3DMUA 1TS4A 1NUCA 2FHTA 4C3JG 1LO5D 5CMDA 4KTAA 3DHQA 1HA6A 2L4NA 4G7ZC 2L12A 3OIQA 4OIKA 4KK7A 3GTMB 1GOZA 3HGBA 1UUPA 3V05A 1F2YA 1PZID 1EY9A 1O78A 3T53B 1LTID 2B2UA 1KLGD 3SEBA 1JWUD 4NP5A 4WFN3 1LT3D 4ULLA 1EFID 2PW5A 2F0PA 1E0BA 2K28A 5FO9B 1F2ZA 4QMGA 2A6ED 4IFDI 3TBIB 3TSSA 5M5XB 2WV6D 3PIP3 2K32A 1EY0A 3D4RA 4TRDA 2F0KA 4GZYC 2K04A 3SK4A 1H9MA 5CBEE 1UNSA 2B2WC 3HZXA 3MTSA 1NSNS 1VF5C 2NWGA 5CR3A 4O42A 3H91A 1W6JA 4F7XA 2F0LA 1BO0A 3DWQA 5LHY1 4Q5VA 1H9JA 5KYIA 2JYOA 1A6XA 2F0UA 4H0LC 5EKLA 4Q0FA 4MHEA 4CHTB 3VYRA 3MFYA 5EBDA 3LX0A 2NUCA 3G7LA 4C1NK 1JWMD 4FYDA 5IT9L 4DU9A 2XNAC 3KUPA 3DM1A 1TT2A 2F0JA 4FP5D 2BCOA 4O1NA 1TWGB 3PMFA 4BY7B 3NTKA 2EOTA 1K8MA 2WKCA 1TR5A 1SJHD 1FNVA 3DEOA 3S9WA 3IFTA 1Q8IA 3GTQB 1TS3A 4ZK9B 2B8FA 3D3RA 1EL0A 4RFBA 1CFMA 1QG7A 1KDCA 3NQTA 4PQXA 4J6HA 4ZKCB 5C4HA 2L5TA 5C3WA 2PMZB 1DJRD 4BBSB 1RODA 2R93B 3CKIB 5I6WA 2EY6A 5IODA 2L9HA 4F88A 1KNAA 3P7JA 4EQOA 3PUYA 1BCPB 4CJ0B 4HTHA 1J9OA 2TSSA 5D3IB 3TP7A 3FMCA 5C4XB 1JOKA 4KV6A 2IWHA 2SNMA 5A2QL 3A7LA 2KA7A 2F0DA 2R6GA 2E76C 2Z8LA 2B8GA 1ENAA 4MN3A 5CV6A 3K5NA 1EY7A 4YIJA 1AW7A 1BXTA 1LTTD 1U9RA 4HEDA 4DN4M 4J1MA 1SNQA 4J8QA 2QKIC 4BS9A 4KN4C 2A6EC 3OW7A 1Y8PB 1JWSD 3S1QB 1IL8A 2NB0A 5HGTA 5EJWA 5JEAH 3KBGA 3BS1A 3PUWA 1G291 1I4GA 3C1EA 3P20A 1BQQT 2EDGA 3Q22A 4PMBA 2VNUD 1SEBD 4L63B 1I6HB 4BY1B 1O7ZA 3AU7A 3HP3A 4B9WA 1DYQA 1YNND 4CKCA 3MXNA 1CI3M 4L8JA 3EROA 3DXJC 4ME5A 1PFBA 4RGTA 1KLUD 2EJFC 3K6OA 2HCCA 3OWFA 1T5EA 1EYCA 1A15A 5DM63 1HFNA 4QCLA 4A3GB 4E6IA 4IUPA 3GTPB 1S5CD 3EJIA 5A35A 1EIGA 2NN6I 3HEJA 3S14B 1WD0A 4CJ1B 3V2TA 3TP8A 2X6GA 2IX3A 1R9TB 2BDOA 1EY5A 4R8NA 2NVXB 2B2TA 2KEEA 4RKBA 2O5IC 1C48A 1F9RA 1CTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J1M A;  5J1Z A;  1TT2 A;  1SNQ A;  4KTA A;  2F0J A;  3DHQ A;  5K5P A;  5DAU A;  5JAV A;  3D6C A;  3E5S A;  2SOB A;  3PMF A;  3NHH A;  5F2D A;  5E1F A;  5IGB A;  2F0H A;  4EQN A;  5KEE A;  3OMG A;  5C5M A;  1SNO A;  3MVV A;  5EKK A;  3SK6 A;  4HMJ A;  1SNC A;  5KIX A;  3MZ5 A;  5CV8 A;  5HGT A;  5NUC A;  4EQP A;  2SNS A;  1TR5 A;  1RKN A;  1SYC A;  2KQ3 A;  1STG A;  3NP8 A;  1F2Y A;  4KJN A;  1STA A;  1EY6 A;  5IGG A;  3S9W A;  4KD4 A;  4F8M A;  1EY9 A;  5C4Z A;  1ENC A;  2F0I A;  1KDB A;  3C1E A;  1STB A;  4KD3 A;  5IGD A;  1IHZ A;  3NXW A;  4ZUI A;  3SR1 A;  2EYH A;  2EYO A;  2RKS A;  2OEO A;  2F3V A;  2PW7 A;  3TP5 A;  5C5L A;  5CC4 A;  4PMB A;  2EY1 A;  4NDX A;  4IAL A;  3ERQ A;  2WAC A;  1KAA A;  4K14 A;  4H7B A;  4KY7 A;  4NP5 A;  1SYB A;  3U9O A;  1F2M A;  5JOB A;  1EZ6 A;  5CGK A;  5I6Y A;  3SK5 A;  3NK9 A;  4EVO A;  2O4X A;  3R3O A;  4K5W A;  2F0S A;  2F0V A;  3P1H A;  3TME A;  4ZQ3 A;  1KDC A;  2PW5 A;  2ENB A;  3NQT A;  4K6D A;  2RDF A;  2EYM A;  2OF1 A;  3BDL A;  4K2L A;  3TP6 A;  1AEX A;  2F0P A;  4N9P A;  4S3S A;  4KJO A;  2KHS A;  5IGF A;  1TQO A;  4J6H A;  1A3V A;  2EYF A;  1JOR A;  1SYF A;  2EYP A;  3EVQ A;  1F2Z A;  3H6M A;  4QMG A;  4B9W A;  3P75 A;  5C4H A;  2OXP A;  3T16 A;  4K5X A;  4PMC A;  5C3X A;  5IGC A;  2F0G A;  2HQE A;  5C3W A;  3BDC A;  1STH A;  3MEH A;  3SXH A;  1STN A;  1EYD A;  5CV9 A;  1A3T A;  5I6W A;  2EY6 A;  4I65 A;  5IOD A;  4ODG A;  3ERO A;  2PYK A;  5CV5 A;  2PZT A;  5IGE A;  2EY5 A;  2F0O A;  4DGZ A;  2M00 A;  4ME5 A;  4WOR A;  4DFA A;  5C6A A;  4WRD A;  4N9T A;  5CV7 A;  1EZ8 A;  1SNM A;  1SYD A;  5ISR A;  1JOQ A;  5CV4 A;  1SYG A;  1EY0 A;  2F0F A;  4NMZ A;  1SYE A;  4B9X A;  4DF7 A;  4EQO A;  4TRD A;  4HTH A;  2EYJ A;  4K8J A;  2PZW A;  4KY6 A;  3D8G A;  3MHB A;  2F0K A;  3TP7 A;  3OWF A;  2F0E A;  3D4W A;  1SND A;  3SK4 A;  3QOL A;  1EYC A;  1JOK A;  4KV6 A;  1II3 A;  4K8I A;  4KHV A;  1EY4 A;  1STY A;  3T13 A;  2SNM A;  5DEH A;  5J22 A;  1A3U A;  1EY8 A;  2F0N A;  3HZX A;  3QOJ A;  1NSN S;  5E3F A;  2F0W A;  3SK8 A;  4E6I A;  4IUN A;  5I9P A;  5CR3 A;  2EY2 A;  3EJI A;  3SHL A;  3VA5 A;  5I9O A;  2RBM A;  3RUZ A;  2EXZ A;  5IOC A;  2F0M A;  5M9O A;  2F0T A;  2F0D A;  4KY5 A;  1EYA A;  3ITP A;  4PNY A;  5EGT A;  2EYL A;  2F0L A;  3HEJ A;  3OMC A;  3QB3 A;  4RKL A;  1EQV A;  4F7X A;  5KGU A;  4G57 A;  3V2T A;  1ENA A;  4HMI A;  5KYI A;  3TP8 A;  5J39 A;  5CV6 A;  1A2U A;  4K2K A;  5IIF A;  2PQE A;  3NUC A;  2F0U A;  1KDA A;  5EKL A;  4LAA A;  1EY7 A;  4MIU A;  1EY5 A;  3OSO A;  4R8N A;  1SNP A;  4IZ8 A;  4YIJ A;  5HUR A;  2F3W A;  2LKV A;  1A2T A;  3C1F A;  2F0Q A;  3MXP A;  4NKL A;  4QB4 A;  4RKB A;  4QF4 A;  3LX0 A;  5KRU A;  4ID6 A;  5KYL A;  2NUC A;  1JOO A;  3D4D A;  1KAB A;  3DMU A;  2PZU A;  4DU9 A;  1NUC A;  4K5V A;  1U9R A;  2QDB A;  4OL7 A;  4ZUJ A; 
#chains in the Genus database with same CATH topology
 4HIK A;  3RLO A;  4LF8 Q;  3UDX A;  1BBU A;  3LWU A;  1Y8O B;  1NAP A;  1X3E A;  2EVB A;  2DY8 A;  1UE7 A;  4YY3 L;  2QF7 A;  3NEM A;  3KYH C;  2MUY A;  1JC7 A;  1PH7 A;  1QB5 D;  2G5D A;  4EQN A;  1I5F A;  2JJQ A;  2Z9H A;  3T1Y L;  3OPO A;  2C9O A;  4Y7N B;  1X3F A;  4UP9 A;  3A8I E;  2D0P A;  3G6E A;  4A76 A;  4A3I B;  3S15 B;  3NP8 A;  4HJ5 A;  2ZXP A;  1DCZ A;  4H02 A;  1BBX C;  4F8M A;  1Z47 A;  4IUT A;  5IGD A;  5IWA Q;  2RQX A;  5FLM G;  1PTO B;  4N8F A;  1GUT A;  2CHB D;  1K8A C;  3U9O A;  2HDL A;  5GRO A;  2PMZ E;  2EJG C;  1TS5 A;  1D8L A;  1QWY A;  1HCZ A;  4XYQ A;  5IGF A;  4OHJ A;  3JAM E;  3HOW G;  2KED A;  4A3F G;  5FLX E;  1YI2 A;  2L0C A;  4K5X A;  3J80 i;  1CK1 A;  4HSV A;  1K9M C;  1B4O A;  1WTR A;  1CHP D;  4O2D A;  4ODG A;  3EQL C;  2P5Z X;  5IGE A;  4DR3 L;  4KKS A;  1SAP A;  5CV7 A;  3CCJ A;  4UAI A;  5ISR A;  4I7A A;  5CV4 A;  2VQF L;  2B39 A;  1N32 Q;  4CDE C;  1B9N A;  1PRT B;  3V96 A;  2RA4 A;  4EGV A;  4K8I A;  4P74 A;  1EY4 A;  1UEB A;  1RHP A;  5M5W H;  1K8O A;  2F52 A;  5I9P A;  4FF4 A;  4C3H H;  3FEW X;  3M4Y A;  4DR6 Q;  2B2V A;  4DK6 C;  2K52 A;  1CA5 A;  3N6R A;  3GTK H;  3S1Q H;  3PV0 A;  5IIF A;  3KJP A;  1F77 A;  1PH2 A;  1LTR D;  4LW1 A;  2NYZ D;  4NXM Q;  3I70 A;  3CCE A;  3NBI A;  1IKM A;  3RZD B;  2R92 G;  4ID6 A;  1HRJ A;  2CH4 A;  3J81 L;  1EQR A;  2QEX A;  1PFS A;  1XMQ Q;  3VR2 A;  4C1N I;  1LTB D;  3F2U A;  2OT2 A;  4A93 H;  1LAB A;  3DEP A;  2YU9 B;  3CCQ A;  4X3U A;  1HZC A;  4TKO B;  2F0H A;  4JI3 L;  1J5E Q;  1YNN C;  1SDF A;  1U0L A;  1LT5 D;  3NEN A;  1F9Q A;  4B3S Q;  2KCN A;  1IZ6 A;  3PF5 A;  5NUC A;  3TEH B;  5K36 G;  3EFX D;  3CHB D;  1ICW A;  2H4O A;  4RCO A;  5IGG A;  3GTL B;  1SE4 A;  2FMC A;  1RCV D;  4CKE A;  4FF3 A;  4IPC A;  3CC7 A;  1NMF A;  1TKW B;  3OHX C;  1GHJ A;  1BNZ A;  5ELB A;  2RKS A;  3WOF A;  3FDT A;  2OEO A;  4X64 Q;  2EXD A;  1ESF A;  2K5Q A;  5E7N A;  4H7B A;  4KY7 A;  2IY5 B;  1MJE A;  4DAV A;  4FDB A;  1G6P A;  1U5K A;  3HOZ H;  3VDY A;  4OX9 L;  1EEI D;  4DR2 L;  4MZ9 A;  3GV6 A;  1Q7Y C;  5T1G A;  2NVY B;  4LNQ A;  4WJ3 M;  1LTG D;  3BJU A;  1AZP A;  3GTP H;  1AP0 A;  2ZTC A;  3HOY H;  4DV6 L;  3G48 A;  3NPP A;  3H0G G;  4IFD J;  4QGU A;  3S1R B;  1TWA H;  4QIW B;  2Q8T A;  1WCM H;  2OCE A;  4JI0 L;  1I4P A;  3MEF A;  2KCC A;  1VQE A;  3HOW B;  2UU9 Q;  1R4P B;  1Q1B A;  1HPC A;  2M9V A;  3KLR A;  5EBC A;  3WDN A;  5C44 H;  2K50 A;  3DUZ A;  3K7A H;  3CMA A;  1EY8 A;  1BR9 A;  3I91 A;  2OQ0 A;  2MP1 A;  3SHL A;  4A3D B;  5IOC A;  1CM9 A;  3CQZ H;  3KF8 A;  1EYA A;  1AE2 A;  1HFG A;  3HKZ G;  1HA5 A;  1PA6 A;  1QNK A;  3VA7 A;  4C2M H;  3AMU A;  3LWE A;  5IT9 c;  3SDZ A;  1Q1E A;  1E22 A;  5M3F H;  3Q23 A;  2MJ8 A;  1X32 A;  3MWY W;  1NR4 A;  4P75 A;  4XT3 B;  2UXB Q;  1JT8 A;  2AQ2 B;  3E9H A;  1QE6 A;  4B3M L;  5T1I A;  1PYW D;  1QVF A;  4I7Z C;  5C0X G;  5J1Z A;  1P16 A;  2LSS A;  4X62 L;  3WWV A;  4QL5 A;  4G7O C;  2EJM A;  3NHH A;  2Y0S E;  1EWC A;  4LFA Q;  2B29 A;  2CQA A;  3PO2 G;  1I6V C;  1SNO A;  2R92 B;  1X9N A;  3VYU A;  1ZKO A;  4KHP Q;  3NBH A;  5IYC H;  1RKN A;  4ZRZ A;  1EY6 A;  2PPB C;  4DR7 L;  2Z1C A;  3Q6S A;  2IL8 A;  1K83 H;  2I46 A;  3RLF A;  5E4W C;  4X3K A;  3D31 A;  3M7G A;  3S16 B;  4NDX A;  4IAL A;  2MFI A;  3D6W A;  1B50 A;  3CME A;  4YY3 Q;  1VQL A;  3F2C A;  3TME A;  4DK1 A;  4BBR H;  2JK8 A;  4OO1 G;  3VYT A;  3GTO B;  3K7U C;  4JW0 A;  3T1Y Q;  4KJO A;  2IHF A;  3I4N H;  4ZYS A;  4IQZ A;  1LLR D;  2EZV A;  1EIY B;  3IL8 A;  3BDC A;  1SLJ A;  1LTL A;  2E8G A;  1H9S B;  3BVZ A;  3MEH A;  4HN7 A;  1A3T A;  4GNX B;  1VQP A;  1GUS A;  4LF6 Q;  5IYB H;  4BBS G;  3I4M G;  2ZM6 L;  4TSS A;  1WTP A;  3MHB A;  5IT9 E;  2XRQ D;  4IUV A;  1UEA B;  2Z6K A;  3HG9 A;  4QQB X;  2NVQ B;  4JYA L;  1IXR A;  1LYL A;  2BA0 A;  4XDX A;  5DEH A;  3H0G B;  1S5D D;  1H9S A;  2MO1 A;  1TU2 B;  4HJ7 A;  4GNX A;  1HZB A;  2EY2 A;  2YU9 H;  4L5Q A;  4BXX G;  4V0B A;  1HUM A;  1UE5 A;  3QB3 A;  1DZ1 A;  2Q2I A;  4IUQ A;  4G57 A;  2JA8 G;  5J39 A;  3U4V A;  3I8Z A;  3K5L A;  1E1T A;  4DUY L;  4KMU C;  1XMO L;  4DR3 Q;  2D5D A;  4LAA A;  4H44 C;  1XXG A;  1SE3 A;  3OSO A;  2VQF Q;  3J81 j;  4NKL A;  1A2T A;  3QWN A;  5KRU A;  1RL2 A;  2KHI A;  3BYT B;  1H9R A;  5EKI A;  3S24 A;  2RVL A;  4X3S A;  3R2T A;  3HKZ B;  5G3L F;  3ZJY C;  1VQG A;  4NB3 A;  2SOB A;  5F2D A;  4A3C H;  2QCP X;  1EWH A;  3CAM A;  3I55 A;  4FVM A;  2VB2 X;  3MVV A;  5EKK A;  1Q90 A;  2R7D A;  2OTJ A;  2NVY H;  1VCI A;  4L5R C;  5FLM H;  1O80 A;  1LT4 D;  2K05 A;  4DXF A;  1TVX A;  1AN8 A;  2F0I A;  3W3A A;  3M85 A;  1OO9 B;  1V8Q A;  1JJ2 A;  1JR0 D;  2XWJ B;  3Q0A A;  1I4X A;  1FYC A;  2BH2 A;  3PO2 B;  1MKH A;  4XQJ A;  1EU4 A;  2KVM A;  4DA2 A;  3ERQ A;  1G8Z D;  2FJ2 A;  3ER0 A;  3VYS A;  3R3O A;  4A3F H;  1Q8K A;  2Z6B A;  4ZQ3 A;  2XTI A;  4JI3 Q;  3M3Y B;  2OF1 A;  4LFC L;  5A2Q E;  2J4X A;  1CKM A;  1H9K A;  3OWE B;  4S3S A;  1FL0 A;  3KLW A;  4BY1 G;  4QIW E;  4DV1 L;  3GTG H;  1STH A;  2A6H D;  5LL6 S;  1CQV A;  5DNF A;  1CSP A;  4LF4 L;  4PZ6 A;  4HCS A;  4DGZ A;  4LF9 L;  3BG3 A;  2FIN B;  5G3L D;  2GVB A;  1SYD A;  4QUC A;  1D5X C;  5LMU L;  2F0F A;  4JI2 L;  1S4Z A;  1ESR A;  3CD6 A;  2PCF B;  3GD7 A;  4JI5 L;  3GDE A;  2L55 A;  3RZO H;  1GO3 E;  5C4J H;  3CP0 A;  4OX9 Q;  5M5Y H;  1E3P A;  2K01 A;  4DR2 Q;  1G2T A;  2E2D C;  4OEM B;  3ND8 A;  3QOJ A;  4OWX B;  3WOE A;  4GS3 A;  1KXL A;  3KFU A;  3A54 A;  1PRT D;  1PFM A;  2MQH A;  3RUZ A;  4GOP A;  3I4M B;  2XVS A;  1VQ8 A;  4EQP A;  1VQI A;  3OMC A;  4OON A;  4A3G G;  1UE6 A;  4DV6 Q;  3OYY A;  2EE1 A;  4JI1 L;  1TY2 A;  4CGY B;  2AWO A;  2F4V Q;  2I07 B;  1PFN A;  1WJJ A;  3R8B A;  5KYL A;  2SDF A;  4IJH A;  4F87 A;  2K33 A;  4UP7 A;  2YV5 A;  4KKT A;  1QVC A;  1VQM A;  2JA8 B;  2D2C C;  3VR5 A;  2DNC A;  2C35 B;  1A62 A;  1F2L A;  1OXX K;  3J80 L;  3GTM H;  3GTO H;  1O7L A;  5COR A;  5BR8 L;  3MZ5 A;  4CKB A;  2K5H A;  5FJ8 G;  1MJC A;  1STA A;  1GVP A;  2LS0 1;  3HFZ B;  4AYB G;  2KEC A;  4LWC A;  2JA6 G;  4DAP A;  2HHH L;  2YYZ A;  1N9W A;  1IHZ A;  2EIF A;  1FNW A;  2E75 C;  2WAQ B;  1JB7 A;  4C3I G;  1EQQ A;  2F3V A;  2JA9 A;  5CC4 A;  3S17 B;  4JI8 L;  3I2Z A;  4X62 Q;  4K14 A;  1Y69 U;  3NK9 A;  2YTV A;  2PI2 E;  4P71 A;  3L3O C;  5IYD G;  2LY7 A;  2ICI A;  3JC6 6;  2D62 A;  2F3I A;  3PUX A;  4AIM A;  1HNZ L;  3T1H Q;  1SYF A;  1JB3 A;  3H6M A;  3UI2 A;  2K6A A;  4EQ5 A;  2FXQ A;  2G9D A;  4NPS A;  2JA7 G;  2E5L L;  1JCK B;  4DR7 Q;  3SXH A;  5M5X H;  5JJK A;  4K0K L;  2PZT A;  1T5X D;  4JBK A;  1SMX A;  1I3Q B;  5IP9 H;  4DFA A;  5DM7 3;  4N9T A;  5JJZ A;  1GHK A;  3CF5 A;  4PV1 C;  4CJ2 C;  4JBW A;  1DOM A;  1TS2 A;  4UY8 C;  3BU2 A;  1DOK A;  4RHS A;  3RMH A;  2N8N A;  1STY A;  4L6T B;  3CC2 A;  3A5U A;  3BZD B;  1K0S A;  4DV7 L;  4R8I A;  3FPU B;  2ZXR A;  2BOS A;  4YWM A;  3VA5 A;  2F0M A;  5M9O A;  3A7A B;  4KY5 A;  4ILW A;  1VQO A;  3I72 A;  3MA2 B;  1PH4 A;  1ENF A;  3J7A V;  1EWI A;  3SE0 A;  2PQE A;  1KDA A;  3EBE A;  1ONL A;  3HKZ E;  5C0X H;  3J81 c;  1X3Q A;  3FRP B;  2ZM6 Q;  4POF A;  5AFW A;  4XXE A;  4A3K G;  2QA4 A;  1LUZ A;  2GN5 A;  3GO5 A;  3K8A A;  4JYA Q;  2F4I A;  1PTO C;  4UPA A;  1VQD A;  1RF2 D;  3VR3 A;  5DAU A;  1TWG H;  2J0T D;  5E1F A;  4A3B G;  2JA5 B;  1KL9 A;  1VQ6 A;  1V9P A;  4A3L G;  3NWS A;  3SK6 A;  2A6H C;  2N49 A;  1Q46 A;  2R61 A;  3UDF A;  1I4H A;  2D0O A;  3RN2 A;  4KJN A;  4DUY Q;  3GTQ H;  2A68 D;  4KD4 A;  1RD9 D;  5JJL A;  2K4K A;  2QDL A;  5JPM C;  1Q86 C;  3SR1 A;  1ZEQ X;  2X6L A;  3GQB A;  1FD7 D;  4OO1 H;  3TP5 A;  3NWT A;  4DV0 L;  3TZD A;  1K28 A;  1FVI A;  3A56 A;  1KAA A;  2PNH A;  5I6Y A;  1LTA D;  3SVM A;  2F0V A;  3P1H A;  4A3E G;  4B3R L;  4AYB B;  2ENB A;  1PRT C;  2JA6 B;  1PYB A;  3BDL A;  1Z6H A;  1B3Q A;  4JI7 Q;  2KUM A;  5ELF A;  1YHB A;  3CRK C;  1RTN A;  4C3I B;  1D1K A;  4BBS H;  1PH3 A;  2R93 H;  5CV9 A;  4I65 A;  3URY A;  2R7Z G;  1N33 L;  2A74 C;  4NXN L;  2DNE A;  4YCV A;  4B9X A;  1VMP A;  5BN5 A;  1NE3 A;  4K8J A;  1V43 A;  3I4O A;  5C4X H;  3J81 E;  4FO2 A;  1GKH A;  3DWP A;  2JA7 B;  1L0W A;  3X3N A;  3QOL A;  3J7A F;  1EIH A;  1XWE A;  3J7Y W;  2DUD A;  1V1Q A;  3T13 A;  4LFC Q;  2JA8 H;  4LUO A;  5ELO A;  1A0I A;  4POG A;  1YJN A;  3A74 A;  2RBM A;  4FF1 A;  1VQJ A;  4DNR B;  2WB1 B;  4DV1 Q;  2AMC B;  3ITP A;  1SMY C;  5LL6 X;  4A4I A;  1SXT A;  4IJL A;  1DOL A;  2Q2U A;  4IO9 A;  3KLS X;  1AH9 A;  3F8T A;  4A3D G;  1WTH A;  1TWF B;  4LF9 Q;  1KC8 C;  2HCI A;  2VQE L;  1NY4 A;  1PH8 A;  4JI2 Q;  4G4K A;  3PIO 3;  4H13 C;  2QGQ A;  3R2I A;  1SE2 A;  3ONA B;  4JI5 Q;  2JEA I;  2I5L X;  1BKB A;  2VY3 A;  2PZW A;  2QDB A;  3S1M B;  3MXU A;  1NJI C;  3S17 H;  2C5C A;  3K57 A;  3KBX A;  2N88 A;  5ELN A;  1DXM A;  3QJY A;  1KIX A;  1B2T A;  2QW7 A;  3ULP A;  1ET9 A;  1L0Y B;  5FO7 B;  4A3K B;  1I50 B;  3Q8D A;  1VQC A;  3BVM A;  4JI1 Q;  1STG A;  3GP7 A;  4NW2 A;  4OXP A;  1JE5 A;  2DN8 A;  2RSO A;  1KDB A;  3M7N A;  4KD3 A;  4A3B B;  4LK1 C;  4ZUI A;  1I3Q H;  1VQF A;  3CC4 A;  3UDI A;  1V1O A;  1LM0 A;  1SE8 A;  1SYB A;  1I6H H;  1EZ6 A;  4PMW A;  4RGN A;  4U68 A;  4BY1 H;  1ZXT A;  4X66 Q;  1GUW A;  3TN2 A;  4PZ8 A;  1BCP F;  4K2L A;  1YNJ C;  3UE1 A;  1SRO A;  2PO4 A;  3MXG A;  1TQO A;  2EYF A;  5BR8 Q;  2EYP A;  3ND9 A;  1OXT A;  3T51 B;  2OXP A;  3T16 A;  3T56 B;  1NCV A;  3HOV G;  2WP8 J;  4DAY B;  1X3G A;  4R4C A;  4MNO A;  4FXD A;  5I2X A;  3H3V H;  1PMR A;  2HHH Q;  3KLS A;  4A3E B;  1WTV A;  5C6A A;  3K81 C;  5EPL A;  5FKA C;  2E2H B;  4DV4 L;  4O0A A;  5IE8 A;  2E2I B;  4JI8 Q;  1C7Y A;  2Q2T A;  1VS0 A;  3VR4 A;  1W6K A;  1S5E D;  4IFD G;  2VB3 X;  3OOC A;  4A3M G;  2ICE C;  2NVT B;  5GAD C;  2R7Z B;  4HJ9 A;  4A3G H;  2F0N A;  4DAY A;  4X3T A;  1VQ4 A;  1XPO A;  4TVA B;  1HNZ Q;  5IY0 A;  1RTO A;  1SN8 A;  5IP7 H;  3DLL A;  1UAP A;  5J3B A;  2F0T A;  3QIA A;  2J7Z A;  3EIV A;  3S14 H;  1Q12 A;  1DGS A;  2A68 C;  3KF8 B;  2E5L Q;  1EQV A;  4JI4 L;  2AWN A;  3J7A 5;  5FOB B;  1R9T H;  4OIJ A;  3NSW A;  3L7Z C;  4YCU A;  4ALP A;  1D6E C;  2NVX H;  1EEF D;  1AE3 A;  2Q8R E;  3MXP A;  4JOI C;  4KHZ A;  3CCV A;  4KN7 C;  4GKK L;  5TSS A;  1RDP D;  1EQT A;  1KAB A;  4OWT B;  1AZQ A;  2E74 C;  1BCP D;  1BDO A;  1YBY A;  2B2U C;  5K5P A;  2MPM A;  3CCS A;  3S1N B;  2JE6 I;  3W2D A;  3D6C A;  4YHH L;  5FJ8 H;  1MGS A;  4IPG A;  1VQN A;  1C0A A;  5IGB A;  4FNF A;  1N36 Q;  2JP1 A;  3E0E A;  4BA1 I;  2R7F A;  5C3E B;  1JE4 A;  2CKZ B;  1HTP A;  4Y7N H;  2JA6 H;  3S2H B;  4A3I H;  5FO8 B;  3S15 H;  3M9B A;  4CDD C;  3NBH B;  4HJ8 A;  4C3I H;  4QUF A;  1E24 A;  2D9U A;  3LNN A;  1ILQ A;  5CYU A;  1ENC A;  1FR3 A;  3H09 A;  1ZYR D;  1WVL A;  4GNX C;  1MD2 D;  4AYB E;  1PTO H;  4RAU C;  1S5B D;  4DAM A;  4LF5 Q;  1X6O A;  2JXM B;  3STB D;  4YWK A;  3SK5 A;  4LUV A;  5JVH 3;  1JJC B;  1CKO A;  2CVR A;  2RDF A;  4LF7 Q;  3W1G A;  4ZKB B;  1VMC A;  2V4D A;  4TQU S;  2KHS A;  3G6J B;  2GA4 B;  4ABN A;  2XWB B;  3A8J E;  1YEZ A;  3OTO Q;  2PYK A;  2H1E A;  1S5F D;  3X3M A;  5KNC A;  3F2B A;  2B2Y A;  1EZ8 A;  1MHW C;  1SNM A;  4DF7 A;  4NMZ A;  4DV0 Q;  1B53 A;  1V1P B;  1DON A;  2HQL A;  1IBM L;  3U58 A;  3D4W A;  3HOV B;  4DNI A;  4LFB L;  4B3R Q;  4UDU C;  4L5T A;  1ML0 D;  5E3F A;  1MSG A;  3E9I A;  3SK8 A;  1KD1 C;  4RA8 A;  5JPN C;  3AB9 A;  3Q24 A;  3MAQ A;  1IYV A;  1EYG A;  3CRL C;  3W1B A;  1QUQ A;  2UUA L;  4DUZ L;  1A2U A;  1N33 Q;  3NTH A;  2RDG A;  1I50 H;  4A3K H;  4HIM A;  4NXN Q;  2VUM B;  4A3M B;  1V1P A;  2QIL A;  1LTS D;  2Z0S A;  4HR7 B;  4IZ8 A;  4OWW B;  4V19 0;  3RZD H;  4RWS C;  2F0Q A;  3KOJ A;  2CH4 W;  3CCM A;  2KJX A;  1F9P A;  1XJV A;  2B63 G;  1SSO A;  1CSQ A;  4DV5 L;  1LT6 D;  3J80 c;  5M3M B;  4A3L H;  4CBV A;  1S3O A;  2L1B A;  3I3C A;  3O13 A;  1BOS A;  3PSI A;  3E5S A;  1D1I A;  1PTO F;  1Y1W B;  4DR4 L;  4UHV A;  1Y8N B;  4A3J B;  1IBL L;  5CV8 A;  3JAM i;  2SNS A;  2NTS A;  1B3A A;  4IOC A;  3HOU B;  3HOX B;  3GTL H;  1WI5 A;  2DJF C;  2PI2 A;  2VQE Q;  2JSO A;  4B3T L;  1SFO B;  1CZG A;  2IJ0 A;  2IHE A;  1K8G A;  3M4O B;  1B9M A;  2EYO A;  1U4L A;  4K6L A;  3I73 A;  2RCN A;  2KEN A;  2I5M X;  5GAG C;  5C5L A;  4HID A;  1HR0 L;  1A63 A;  1OXU A;  4EVO A;  2WAQ G;  2EQS A;  2F0S A;  2XIW A;  2BE5 D;  2IPK D;  4ME3 A;  2WKD A;  3NQI A;  3MFG A;  1R4Q B;  3TDQ A;  4DPG A;  4QJF A;  4LF8 L;  1PRT F;  1M4V A;  4M1U B;  1XX8 A;  3RD4 A;  1STN A;  1EYD A;  2O5J C;  2LFN A;  1W2B A;  5EPK A;  3S1R H;  4WRD A;  2DY7 A;  2AUK A;  2IT1 A;  3U9S A;  1HQR D;  4B08 A;  1BCP C;  4C3H G;  3K5M A;  1HXY D;  3HOW H;  2EYJ A;  1PTO D;  1L0X B;  5AJ3 L;  1P8L A;  1HZA A;  2NZO A;  2F0E A;  3TQY A;  1SND A;  1Y1V B;  4R4O A;  4RGM A;  4GN4 B;  4N8X 1;  1Z7T A;  2YTX A;  1FGB D;  3E0J A;  1WYD A;  2YTY A;  5J22 A;  1HZ9 A;  2DGY A;  1WTQ A;  4GLV B;  5D65 A;  3J80 E;  4A3D H;  3PF4 A;  1HUN A;  2LMC B;  3HS0 C;  5BN4 A;  5C0X I;  5EGT A;  4GN3 B;  3G4S A;  4GOP B;  4RKL A;  1C8C A;  4HMI A;  3S2H H;  1PHJ A;  1ZYR C;  2AKW B;  1PZJ D;  4JG2 A;  1O7Y A;  2WIN B;  1SNP A;  1CQF A;  2LKV A;  4C3J B;  3C1F A;  4IUU A;  2PQA B;  1YIJ A;  3D4D A;  2A8V A;  3STB C;  2NN6 G;  4K5V A;  5ELE A;  1JMC A;  3UE0 A;  3LGJ A;  2CW0 D;  2L11 A;  5JAV A;  1KHI A;  2R92 H;  2K5D A;  1TY0 A;  3FHW A;  3NTI A;  4M8A A;  4Z9C B;  2K03 A;  4JI4 Q;  1L1O B;  3CCU A;  2JA5 G;  1PH9 A;  2B63 B;  2PQA A;  2F03 A;  1CA6 A;  4JI0 Q;  1QOH A;  4OO1 I;  2K1B A;  1E2V A;  1YIT A;  5CBA E;  2Q8I B;  1I94 L;  2B2W A;  4GKK Q;  3NXW A;  2NZH A;  2Z4I A;  2X69 A;  2ZTD A;  4FXK C;  4P2C B;  1LAC A;  4Y52 H;  3S16 H;  5K36 H;  3J7Z C;  1XYI A;  1EU3 A;  4EX5 A;  4YHH Q;  1L1O A;  1L2F A;  4R4I A;  4K6D A;  3RLN A;  4XYO A;  3F1Z A;  1XMQ L;  1JOR A;  1WCM G;  1XTC D;  3B6Y A;  1SMY D;  2HIX A;  2VXW A;  1WTO A;  1BVS A;  2HQE A;  3BDO A;  1XTD A;  5E4X A;  1D5Z C;  1GJX A;  4B3M Q;  3H3V C;  2ES2 A;  2F0O A;  4GLA C;  4IFD H;  4R1J A;  1TWH B;  1STE A;  2F1M A;  2K5W A;  3M4Q A;  3K0Y A;  4A3M H;  1X3P A;  1IYU A;  5JVG 3;  1QZG A;  2ALY B;  4RHR A;  3D8G A;  2NVQ H;  2B2T C;  2DJG C;  4FF2 A;  1II3 A;  2N78 A;  3AQQ A;  4KHV A;  1C9O A;  1IYJ B;  3H0G H;  4KLK A;  3T4A C;  5M5W B;  4IUN A;  4L5S A;  4C3H B;  1MBY A;  4XTC S;  4LJZ C;  4PNY A;  5KND A;  2UXC L;  2EYL A;  1VQH A;  3PUZ A;  1BUV T;  3E6Z X;  3GTK B;  4K2K A;  1O7I A;  1X55 A;  2BA1 A;  2WB1 G;  3S2D B;  1D2B A;  1Y14 B;  5I4D A;  2GVA A;  4X65 L;  3C2P A;  1MSH A;  1IBM Q;  2PZU A;  3FKI G;  4XT1 B;  1TWC B;  1FGU A;  4ZUJ A;  1J8I A;  1EIF A;  2H5X A;  1XPR A;  2BE5 C;  4A93 B;  4JBM A;  1YNJ D;  3I4L A;  2VL6 A;  5KEE A;  3FP9 A;  1EOT A;  2A69 D;  3BVG A;  1WTX A;  1SNC A;  1ET6 A;  4DUZ Q;  2UUA Q;  1B70 B;  4LMQ D;  3KJO A;  1Q81 C;  5C4Z A;  1GXD C;  1QNU A;  3VR6 A;  4BBR G;  1ASY A;  1JJG A;  3PO2 H;  3K59 A;  2PW7 A;  4DV5 Q;  2ZT9 C;  1F2M A;  5JOB A;  3H94 A;  3KDF A;  3HOZ B;  1JQY D;  3M3Y H;  3KK7 A;  2K7V A;  4DR4 Q;  1U4R A;  1I4Q A;  2EYM A;  1Z9F A;  3BZC A;  1QJO A;  3CCL A;  1I4R A;  5FK9 C;  3H3V I;  1XMO Q;  1IBL Q;  2ID0 A;  3N52 A;  2MHV A;  4XQN A;  1LV9 A;  2ZJR A;  1PLF A;  5C3X A;  4PMC A;  2QEJ C;  3BZK A;  4JPB W;  4B3T Q;  3HOY B;  1WOC A;  5CV5 A;  5BN3 A;  2B2V C;  4IN3 A;  5KNB A;  1QCB D;  2N55 A;  2VW9 A;  3MC0 B;  3BYY B;  4HSP A;  4ZAI A;  1SYE A;  2UUC L;  1TWA B;  4ZLT F;  1MI2 A;  1WCM B;  2JN4 A;  2MO0 A;  4A75 A;  1B44 D;  2OQK A;  1HR0 Q;  2CQO A;  2CW0 C;  2OWO A;  1NNX A;  3PGZ A;  1YNX A;  2WII B;  5C44 B;  2FMM A;  2K14 A;  3I90 A;  1VF7 A;  3K7A B;  1HJP A;  3L2P A;  1GD7 A;  2O2L D;  4MTK A;  3I4M H;  3A8K E;  4R4T A;  1CT1 D;  3CQZ B;  1N34 L;  1BF4 A;  2E2J B;  1SJE D;  2SEB D;  1A8V A;  1JIC A;  3CPF A;  4C2M B;  2B63 H;  4A3C G;  3H15 A;  1ILP A;  2AHO B;  4AQY L;  4QB4 A;  3CPW A;  4HJA A;  5M3F B;  2Y0S B;  4BXX H;  2KBN A;  5AJ3 Q;  3C3L A;  1HTL D;  5I9O A;  1AFP A;  1C4Q A;  4LF6 L;  3TZU A;  4YWL A;  2EPB A;  2R3Z A;  3RN5 A;  5LMN W;  1G91 A;  1WTW A;  2ZTE A;  3OIP A;  3ICE A;  1IKL A;  2G9H D;  4RH6 A;  1NR2 A;  2NZ1 D;  3OMG A;  3ERS X;  4LF4 Q;  2Z4H A;  3IFD A;  1M8A A;  4HMJ A;  1SRU A;  3FKI B;  1DM0 B;  4IOA A;  5LMU Q;  2IW3 A;  3FPP A;  4DNT B;  5C3E G;  4DR1 L;  1XPU A;  1YJW A;  1M90 C;  1TII D;  4R9W A;  5ELC A;  2RHQ B;  1K83 B;  1G6Z A;  1IW7 D;  1TWH H;  2NTT A;  4PZ7 A;  4OL7 A;  2WAC A;  3PO3 G;  1HHV A;  1OTC A;  3DWA A;  1GUG A;  5CGK A;  2IX1 A;  2PNR C;  4K5W A;  5EAY A;  4BBR B;  1EOV A;  3EN2 A;  2WAQ E;  2AUJ D;  3TRE A;  3I4N B;  2MGS A;  2WFW A;  2NBF A;  4G7H C;  1KTK A;  3C46 A;  1RJT A;  3QO2 A;  1E2Z A;  5LMN L;  1I94 Q;  3AFQ A;  1WD1 A;  2EY5 A;  5JJI A;  4JC0 A;  4ZCK A;  1CZW A;  4R4Q A;  3S2D H;  4IPD A;  3K58 A;  3A55 A;  4C56 C;  3K5O A;  4XIG S;  1TWC H;  2MNA A;  1EFW A;  1BBW A;  2A69 C;  4HCE A;  4GKJ L;  4LUZ A;  1HQM C;  1PDQ A;  3EA6 A;  3JAM L;  5EQ0 A;  5H1S E;  4JV5 L;  2EXZ A;  5FLX L;  1GUO A;  5GQO A;  1MIU A;  4FXG C;  4JK1 C;  1M1K C;  5COY A;  3DM3 A;  2V1C C;  4WJW A;  3L0O A;  2NN6 H;  2HDM A;  1U4M A;  1GUN A;  4RGO S;  1QIL A;  3A5Z B;  5DLQ E;  4GLX A;  2I0Q A;  2A5H A;  1JOO A;  2ZXO A;  2AQ1 B;  2VUM G;  3GV3 A;  5KGU A;  1HNX L;  2IX0 A;  1YZ6 A;  4JI6 L;  3RR5 A;  2HUG A;  2XRS D;  3I7F A;  1HH2 P;  4DK3 C;  2JA5 H;  4BA2 I;  2B2Y C;  4DXG A;  4K0K Q;  5M3M G;  1KQS A;  5C5M A;  2HD3 A;  2A1A A;  2UXC Q;  1PV4 A;  1CHQ D;  5KIX A;  2CFM A;  1Y1W G;  1SYC A;  2KQ3 A;  3PUV A;  3QG1 A;  5ELD A;  1SBB B;  3AEV A;  2TMP A;  4YCW A;  4AH6 A;  4A3J G;  3ZYY X;  5HY6 A;  1STB A;  1TXY A;  1KRS A;  4X65 Q;  5JEA G;  2RSN A;  3HOX G;  3HOU G;  3HRZ C;  2EYH A;  1G2S A;  1RIP A;  1B1Z A;  1Q3L A;  1QVG A;  4KI0 A;  4XQQ A;  4DV7 Q;  2EY1 A;  4BWG B;  2JEB I;  3R93 A;  1VDZ A;  2KHJ A;  3G71 A;  2F4V L;  3CU7 A;  4IUR A;  2O4X A;  1U4P A;  2BDN A;  4KKU A;  4A3F B;  4DK0 A;  3PIP A;  2AQ3 B;  3L9A X;  5IP9 G;  4HAE A;  2XSC A;  2OTL A;  3TP6 A;  1AEX A;  4N9P A;  4OGQ C;  2Z6K C;  3M4P A;  5JEA J;  1A3V A;  3EVQ A;  1PZK D;  3P75 A;  1FNU A;  5IGC A;  1VQ5 A;  2F0G A;  5GAE C;  3GTG B;  3PO3 B;  1CUK A;  3TS0 A;  3F2D A;  1XNR L;  4JVZ A;  2M00 A;  4U67 3;  2E2J H;  3IKJ A;  4WOR A;  5IYD H;  2CWP A;  1JOQ A;  1SYG A;  3IAY A;  5D3D A;  1F9S A;  1OXV A;  4KY6 A;  4RCN A;  2KOL A;  1VQK A;  2JA7 H;  3RZO B;  5C4J B;  2M2L A;  5M5Y B;  4CDC C;  1A3U A;  1OXS C;  2F0W A;  1NBW A;  5D14 A;  1E7Z A;  1Y1V G;  3FVQ A;  3NE5 B;  2XN9 C;  3U50 C;  1DD2 A;  1PXU A;  1FJG L;  1XNQ L;  1QUQ B;  1KNE A;  1TWF H;  1B7Y B;  2A73 B;  4IPH A;  3NUC A;  3ULJ A;  3I56 A;  3T1H L;  3GTJ B;  3FKI H;  2RDH A;  4JBJ A;  4MIU A;  2FFK B;  4BY7 G;  5C0X J;  2HT1 A;  1E2W A;  5HUR A;  2UUC Q;  1IW7 C;  1D5M C;  2F3W A;  2WB1 E;  5I2Y A;  4QF4 A;  5EPJ A;  1W3S A;  1G51 A;  1X54 A;  3DMU A;  1CKN B;  1TS4 A;  1NUC A;  3S1M H;  2FHT A;  4C3J G;  1LO5 D;  5CMD A;  4KTA A;  3DHQ A;  1HA6 A;  2L4N A;  4G7Z C;  2UUB L;  2L12 A;  3OIQ A;  5HGQ A;  4OIK A;  1HR0 W;  4KK7 A;  3GTM B;  1N34 Q;  3A0J A;  1GOZ A;  1Q82 C;  3HGB A;  1D7Q A;  1UUP A;  4MTN A;  2Q2H A;  3V05 A;  1F2Y A;  4JOI A;  1PZI D;  1IBK L;  1CKN A;  1EY9 A;  1O78 A;  2RF4 A;  3T53 B;  4AQY Q;  4A3B H;  2ATW A;  4OEL B;  1LTI D;  2B2U A;  1IL2 A;  1KLG D;  3SEB A;  4DV2 L;  2UXD L;  1JWU D;  2LXK A;  1PVO A;  4QY7 A;  2ASB A;  4NP5 A;  4WFN 3;  2R93 G;  1LT3 D;  4ULL A;  3J81 i;  3AYH B;  1EFI D;  1PH6 A;  2BH8 A;  2PW5 A;  2CCZ A;  1K0R A;  2B3G A;  1YHA A;  2F0P A;  1E0B A;  1PYS B;  2K28 A;  5FO9 B;  4DV3 L;  1F2Z A;  4QMG A;  2A6E D;  4DR5 L;  4IFD I;  3TBI B;  5C4X G;  3TSS A;  1HNW L;  3E3X A;  4DR1 Q;  4GOP C;  5M5X B;  2WV6 D;  3QR8 A;  3AFP A;  4A3E H;  2E2H H;  3PIP 3;  4APV A;  4RMF A;  2K32 A;  1EY0 A;  3D4R A;  2RHS B;  2E2I H;  4TRD A;  3RNU A;  2F0K A;  4GZY C;  2K04 A;  3PQI A;  3OW2 A;  3SK4 A;  2NVT H;  1H9M A;  3HKS A;  2R7Z H;  4X6A H;  5CBE E;  1UNS A;  2B2W C;  3HZX A;  3MTS A;  1NSN S;  1VF5 C;  2NWG A;  5CR3 A;  4O42 A;  3TRZ A;  2K5N A;  3H91 A;  4GN5 A;  1W6J A;  4F7X A;  2F0L A;  1BO0 A;  3DWQ A;  3U4Z A;  5LHY 1;  4Q5V A;  4JI7 L;  1H9J A;  5KYI A;  2JYO A;  1NMG A;  5LMN Q;  1A6X A;  1L1O C;  2F0U A;  4H0L C;  5EKL A;  4Q0F A;  4MHE A;  4CHT B;  2LXJ A;  3VYR A;  2VS1 A;  3MFY A;  5EBD A;  3LX0 A;  1ICF B;  5IWA L;  2NUC A;  3G7L A;  4C1N K;  1JWM D;  1VQA A;  5IT9 L;  4FYD A;  4DU9 A;  3D0F A;  2XNA C;  3KUP A;  3DM1 A;  1S72 A;  1TT2 A;  2F0J A;  3S1N H;  4FP5 D;  2BCO A;  4O1N A;  4GKJ Q;  1TWG B;  3PMF A;  1YVC A;  4BY7 B;  4JV5 Q;  3NTK A;  2XGT A;  5C3E H;  2JQO A;  2EOT A;  1K8M A;  4A93 G;  1ASZ A;  2WKC A;  1TR5 A;  1K73 C;  1SJH D;  1FNV A;  3DEO A;  4DV4 Q;  3TS2 A;  3S9W A;  3IFT A;  1Q8I A;  1J6Q A;  1K3B C;  3GTQ B;  1TS3 A;  3CW2 C;  4J15 A;  4P72 A;  4ZK9 B;  3PO3 H;  2VZA A;  4UP8 A;  2L15 A;  2B8F A;  3D3R A;  4WJ4 A;  1HNX Q;  4JI6 Q;  4P73 A;  1EL0 A;  3K0X A;  4RFB A;  1N32 L;  1CFM A;  1QG7 A;  1KDC A;  3NQT A;  1UWV A;  1KAW A;  4PQX A;  4J6H A;  1VQ7 A;  4ZKC B;  5C4H A;  3HOZ G;  4DR6 L;  2L5T A;  5C3W A;  2PMZ B;  1DJR D;  1E1O A;  1YHQ A;  4BBS B;  1ROD A;  2R93 B;  3CKI B;  5I6W A;  2EY6 A;  5IOD A;  3CXC A;  2L9H A;  4F88 A;  1X65 A;  1KNA A;  3P7J A;  4NXM L;  3GTJ H;  2ZJQ A;  4EQO A;  5IP7 G;  3PUY A;  1BCP B;  4CJ0 B;  4HTH A;  3HOY G;  1J9O A;  2TSS A;  3HOV H;  5D3I B;  3TP7 A;  3FMC A;  5C4X B;  1GM5 A;  3NEL A;  1JOK A;  3KF6 B;  4KV6 A;  2IWH A;  2SNM A;  2RCF A;  5A2Q L;  1NTG A;  1N8R C;  3A7L A;  2KA7 A;  1EUJ A;  5C44 G;  1J5E L;  2K75 A;  2F0D A;  2R6G A;  2E76 C;  4X66 L;  1QZH A;  2Z8L A;  4B3S L;  1K3R A;  2B8G A;  2KCT A;  1ENA A;  4MN3 A;  5CV6 A;  1XNR Q;  2VUM H;  3K5N A;  1EY7 A;  4YIJ A;  1AW7 A;  3KF6 A;  1BXT A;  4HIO A;  3IRB A;  1LTT D;  1UE1 A;  2KCM A;  4A3I G;  1U9R A;  4HED A;  4DN4 M;  4J1M A;  4X64 L;  5M3M H;  1SNQ A;  3ULL A;  5M3F G;  2Y0S G;  4RG1 A;  4J8Q A;  2QKI C;  3K80 C;  4BS9 A;  4KN4 C;  4DKA C;  1Y1W H;  2A6E C;  2I5H A;  3OW7 A;  1Y8P B;  1JWS D;  5GAH C;  4A3J H;  3S1Q B;  1IL8 A;  2NB0 A;  4CDF C;  1PH1 A;  5HGT A;  1FJG Q;  5EJW A;  1XNQ Q;  1VQ9 A;  5JEA H;  3HOX H;  3HOU H;  3KBG A;  3BS1 A;  1B8A A;  1VQB A;  3PUW A;  1G29 1;  1I4G A;  1SFO H;  3C1E A;  3P20 A;  5IYC G;  1BQQ T;  3M4O H;  2ZJP A;  4LFB Q;  2EDG A;  3Q22 A;  3MXN B;  4PMB A;  2VNU D;  1H95 A;  2UU9 L;  1SEB D;  4L63 B;  2UUB Q;  1I6H B;  4BY1 B;  1T9H A;  3KDF B;  1O7Z A;  2A19 A;  1KRT A;  3AU7 A;  3PCO B;  3HP3 A;  4B9W A;  1DYQ A;  3PIO A;  1YNN D;  4CKC A;  5L37 A;  1IBK Q;  3UDG A;  3MXN A;  1N36 L;  1CI3 M;  4L8J A;  3I4N G;  2N3S A;  3ERO A;  3DXJ C;  2HIV A;  4ME5 A;  1PFB A;  4RGT A;  1KLU D;  4DV2 Q;  1PH5 A;  2EJF C;  2UXD Q;  3K6O A;  1WFQ A;  2HCC A;  2UXB L;  3OWF A;  1T5E A;  1Y1V H;  1EYC A;  5IYB G;  1A15 A;  3JAM c;  5DM6 3;  3CCR A;  1HFN A;  5FLX c;  4LF5 L;  4QCL A;  4A3G B;  4E6I A;  4IUP A;  1X56 A;  3GTP B;  1S5C D;  3EJI A;  4DV3 Q;  5A35 A;  1EIG A;  4DR5 Q;  4LFA L;  2NN6 I;  4JCV E;  4BY7 H;  3HEJ A;  3S14 B;  1HNW Q;  1WD0 A;  4CJ1 B;  4LF7 L;  3V2T A;  4KHP L;  3TP8 A;  2CWA A;  2X6G A;  2IX3 A;  1R9T B;  2BDO A;  1EY5 A;  1SR3 A;  4PG3 A;  4R8N A;  4C3J H;  2NVX B;  2B2T A;  2KEE A;  2K5V A;  4RKB A;  2O5I C;  3W5O A;  3SGI A;  1YJ9 A;  3OTO L;  1C48 A;  1F9R A;  1S40 A;  1CTM A; 
#chains in the Genus database with same CATH homology
 2DY8 A;  1Y8O B;  1NAP A;  2EVB A;  3LWU A;  2QF7 A;  2MUY A;  1JC7 A;  1QB5 D;  4EQN A;  3OPO A;  2C9O A;  4Y7N B;  3A8I E;  4A3I B;  3S15 B;  3NP8 A;  2ZXP A;  1DCZ A;  1BBX C;  4F8M A;  1Z47 A;  4IUT A;  5IGD A;  2RQX A;  1PTO B;  1GUT A;  2CHB D;  3U9O A;  2HDL A;  2EJG C;  1TS5 A;  1QWY A;  1HCZ A;  4XYQ A;  5IGF A;  4OHJ A;  3JAM E;  2KED A;  5FLX E;  2L0C A;  4K5X A;  1CK1 A;  4HSV A;  1B4O A;  1WTR A;  1CHP D;  4ODG A;  3EQL C;  5IGE A;  4KKS A;  1SAP A;  5CV7 A;  4UAI A;  5ISR A;  5CV4 A;  2B39 A;  1B9N A;  1PRT B;  3V96 A;  2RA4 A;  4EGV A;  4K8I A;  1EY4 A;  1RHP A;  1K8O A;  5I9P A;  4FF4 A;  3FEW X;  3M4Y A;  2B2V A;  1CA5 A;  3N6R A;  3PV0 A;  5IIF A;  1F77 A;  1LTR D;  2NYZ D;  3I70 A;  3NBI A;  1IKM A;  3RZD B;  4ID6 A;  1HRJ A;  3J81 L;  3VR2 A;  4C1N I;  1LTB D;  3F2U A;  2OT2 A;  1LAB A;  3DEP A;  2YU9 B;  4X3U A;  4TKO B;  2F0H A;  1YNN C;  1SDF A;  1LT5 D;  1F9Q A;  2KCN A;  5NUC A;  5K36 G;  3EFX D;  3CHB D;  1ICW A;  2H4O A;  4RCO A;  5IGG A;  3GTL B;  1SE4 A;  2FMC A;  1RCV D;  4CKE A;  4FF3 A;  1TKW B;  3OHX C;  1GHJ A;  1BNZ A;  5ELB A;  2RKS A;  3WOF A;  3FDT A;  2OEO A;  1ESF A;  2K5Q A;  4H7B A;  4KY7 A;  4DAV A;  1EEI D;  3GV6 A;  5T1G A;  2NVY B;  1LTG D;  1AZP A;  1AP0 A;  3NPP A;  4IFD J;  3S1R B;  4QIW B;  2Q8T A;  1I4P A;  2KCC A;  3HOW B;  1R4P B;  1Q1B A;  1HPC A;  2M9V A;  3KLR A;  5EBC A;  3WDN A;  3DUZ A;  1EY8 A;  1BR9 A;  3I91 A;  2MP1 A;  3SHL A;  4A3D B;  5IOC A;  1CM9 A;  3KF8 A;  1EYA A;  1HFG A;  1HA5 A;  1QNK A;  3VA7 A;  3AMU A;  3LWE A;  3SDZ A;  1Q1E A;  3Q23 A;  2MJ8 A;  1X32 A;  3MWY W;  1NR4 A;  4XT3 B;  2AQ2 B;  1QE6 A;  5T1I A;  1PYW D;  4I7Z C;  5C0X G;  5J1Z A;  4G7O C;  2EJM A;  3NHH A;  1EWC A;  2CQA A;  1I6V C;  1SNO A;  2R92 B;  3VYU A;  1ZKO A;  3NBH A;  1RKN A;  4ZRZ A;  1EY6 A;  2PPB C;  2Z1C A;  3Q6S A;  2IL8 A;  2I46 A;  3RLF A;  5E4W C;  4X3K A;  3D31 A;  3M7G A;  3S16 B;  4NDX A;  4IAL A;  3D6W A;  1B50 A;  3TME A;  4DK1 A;  4OO1 G;  3VYT A;  3GTO B;  4KJO A;  4ZYS A;  4IQZ A;  1LLR D;  2EZV A;  3IL8 A;  3BDC A;  1H9S B;  3BVZ A;  3MEH A;  4HN7 A;  1A3T A;  1GUS A;  4TSS A;  1WTP A;  3MHB A;  5IT9 E;  2XRQ D;  4IUV A;  1UEA B;  3HG9 A;  2NVQ B;  2BA0 A;  4XDX A;  5DEH A;  3H0G B;  1S5D D;  1H9S A;  1TU2 B;  2EY2 A;  4V0B A;  1HUM A;  3QB3 A;  1DZ1 A;  4IUQ A;  4G57 A;  5J39 A;  3I8Z A;  3K5L A;  4KMU C;  2D5D A;  4LAA A;  4H44 C;  1XXG A;  1SE3 A;  3OSO A;  4NKL A;  1A2T A;  3QWN A;  5KRU A;  3BYT B;  1H9R A;  5EKI A;  2RVL A;  4X3S A;  3R2T A;  3HKZ B;  5G3L F;  2SOB A;  5F2D A;  2QCP X;  1EWH A;  4FVM A;  2VB2 X;  3MVV A;  5EKK A;  1Q90 A;  1VCI A;  1O80 A;  1LT4 D;  2K05 A;  4DXF A;  1TVX A;  1AN8 A;  2F0I A;  3W3A A;  3M85 A;  1OO9 B;  1V8Q A;  1JR0 D;  2XWJ B;  3Q0A A;  1I4X A;  1FYC A;  3PO2 B;  4XQJ A;  1EU4 A;  2KVM A;  4DA2 A;  3ERQ A;  1G8Z D;  2FJ2 A;  3VYS A;  3R3O A;  4ZQ3 A;  3M3Y B;  2OF1 A;  5A2Q E;  2J4X A;  1H9K A;  3OWE B;  4S3S A;  1STH A;  2A6H D;  5LL6 S;  1CQV A;  5DNF A;  4HCS A;  4DGZ A;  3BG3 A;  2FIN B;  5G3L D;  1SYD A;  4QUC A;  1D5X C;  2F0F A;  1S4Z A;  1ESR A;  2PCF B;  3GD7 A;  2L55 A;  2K01 A;  1G2T A;  2E2D C;  3ND8 A;  3QOJ A;  3WOE A;  3A54 A;  1PRT D;  1PFM A;  3RUZ A;  3I4M B;  2XVS A;  4EQP A;  3OMC A;  2EE1 A;  1TY2 A;  4CGY B;  2AWO A;  2I07 B;  1PFN A;  3R8B A;  5KYL A;  2SDF A;  4F87 A;  2K33 A;  4KKT A;  2JA8 B;  2D2C C;  3VR5 A;  2DNC A;  1F2L A;  1OXX K;  3J80 L;  1O7L A;  5COR A;  3MZ5 A;  4CKB A;  1STA A;  2LS0 1;  2KEC A;  4DAP A;  2YYZ A;  1IHZ A;  1FNW A;  2E75 C;  2WAQ B;  4C3I G;  2F3V A;  5CC4 A;  3S17 B;  4K14 A;  1Y69 U;  3NK9 A;  3L3O C;  2LY7 A;  2ICI A;  2D62 A;  3PUX A;  1SYF A;  1JB3 A;  3H6M A;  3UI2 A;  2K6A A;  2G9D A;  1JCK B;  3SXH A;  2PZT A;  1T5X D;  1I3Q B;  4DFA A;  5DM7 3;  4N9T A;  5JJZ A;  1GHK A;  4PV1 C;  4CJ2 C;  4JBW A;  1DOM A;  1TS2 A;  1DOK A;  4RHS A;  3RMH A;  1STY A;  4L6T B;  3BZD B;  4R8I A;  3FPU B;  2ZXR A;  2BOS A;  3VA5 A;  2F0M A;  5M9O A;  3A7A B;  4KY5 A;  4ILW A;  3I72 A;  3MA2 B;  1ENF A;  3J7A V;  3SE0 A;  2PQE A;  1KDA A;  1ONL A;  5C0X H;  1X3Q A;  3FRP B;  5AFW A;  4XXE A;  3GO5 A;  2F4I A;  1PTO C;  1RF2 D;  3VR3 A;  5DAU A;  2J0T D;  5E1F A;  2JA5 B;  3NWS A;  3SK6 A;  2A6H C;  2R61 A;  1I4H A;  4KJN A;  2A68 D;  4KD4 A;  1RD9 D;  5JPM C;  3SR1 A;  1ZEQ X;  2X6L A;  3GQB A;  1FD7 D;  4OO1 H;  3TP5 A;  3NWT A;  3TZD A;  3A56 A;  1KAA A;  5I6Y A;  1LTA D;  3SVM A;  2F0V A;  3P1H A;  4AYB B;  2ENB A;  1PRT C;  2JA6 B;  3BDL A;  1Z6H A;  2KUM A;  5ELF A;  3CRK C;  1RTN A;  4C3I B;  1D1K A;  5CV9 A;  4I65 A;  3URY A;  2A74 C;  2DNE A;  4B9X A;  1VMP A;  5BN5 A;  4K8J A;  1V43 A;  3J81 E;  4FO2 A;  3DWP A;  2JA7 B;  3X3N A;  3QOL A;  3J7A F;  1EIH A;  1XWE A;  3J7Y W;  3T13 A;  2RBM A;  4FF1 A;  4DNR B;  2WB1 B;  3ITP A;  1SMY C;  5LL6 X;  1SXT A;  1DOL A;  3KLS X;  1TWF B;  2HCI A;  4G4K A;  3PIO 3;  4H13 C;  3R2I A;  1SE2 A;  3ONA B;  2JEA I;  2PZW A;  2QDB A;  3S1M B;  3MXU A;  2C5C A;  3K57 A;  3KBX A;  2N88 A;  1DXM A;  3QJY A;  1B2T A;  1ET9 A;  1L0Y B;  5FO7 B;  4A3K B;  1I50 B;  3BVM A;  1STG A;  3GP7 A;  4NW2 A;  2DN8 A;  2RSO A;  1KDB A;  3M7N A;  4KD3 A;  4A3B B;  4LK1 C;  4ZUI A;  1V1O A;  1SYB A;  1EZ6 A;  4PMW A;  4RGN A;  4U68 A;  1ZXT A;  1GUW A;  3TN2 A;  1BCP F;  4K2L A;  1YNJ C;  2PO4 A;  3MXG A;  1TQO A;  2EYF A;  2EYP A;  3ND9 A;  1OXT A;  3T51 B;  2OXP A;  3T16 A;  3T56 B;  1NCV A;  2WP8 J;  4FXD A;  5I2X A;  1PMR A;  3KLS A;  4A3E B;  1WTV A;  5C6A A;  5EPL A;  5FKA C;  2E2H B;  2E2I B;  3VR4 A;  1W6K A;  1S5E D;  4IFD G;  2VB3 X;  3OOC A;  2ICE C;  2NVT B;  2R7Z B;  2F0N A;  4DAY A;  4X3T A;  1RTO A;  1UAP A;  2F0T A;  3QIA A;  2J7Z A;  1Q12 A;  2A68 C;  1EQV A;  2AWN A;  5FOB B;  4OIJ A;  3NSW A;  3L7Z C;  1D6E C;  1EEF D;  2Q8R E;  3MXP A;  4KHZ A;  4KN7 C;  5TSS A;  1RDP D;  1EQT A;  1KAB A;  1AZQ A;  2E74 C;  1BCP D;  1BDO A;  2B2U C;  5K5P A;  2MPM A;  3S1N B;  2JE6 I;  3W2D A;  3D6C A;  1MGS A;  5IGB A;  4FNF A;  2JP1 A;  4BA1 I;  5C3E B;  1JE4 A;  3S2H B;  1HTP A;  5FO8 B;  4QUF A;  2D9U A;  3LNN A;  1ILQ A;  5CYU A;  1ENC A;  1FR3 A;  3H09 A;  1ZYR D;  1WVL A;  1MD2 D;  1PTO H;  4RAU C;  1S5B D;  2JXM B;  3SK5 A;  5JVH 3;  2CVR A;  2RDF A;  4ZKB B;  1VMC A;  2V4D A;  4TQU S;  2KHS A;  3G6J B;  2GA4 B;  4ABN A;  2XWB B;  3A8J E;  2PYK A;  2H1E A;  1S5F D;  3X3M A;  5KNC A;  2B2Y A;  1EZ8 A;  1SNM A;  4DF7 A;  4NMZ A;  1B53 A;  1V1P B;  1DON A;  3D4W A;  3HOV B;  4UDU C;  1ML0 D;  5E3F A;  1MSG A;  3SK8 A;  4RA8 A;  5JPN C;  3AB9 A;  3Q24 A;  3MAQ A;  1IYV A;  3CRL C;  1A2U A;  3NTH A;  2RDG A;  2VUM B;  4A3M B;  1V1P A;  2QIL A;  1LTS D;  4HR7 B;  4IZ8 A;  4V19 0;  4RWS C;  2F0Q A;  2KJX A;  1F9P A;  1SSO A;  1LT6 D;  5M3M B;  4CBV A;  2L1B A;  3I3C A;  3O13 A;  1BOS A;  3E5S A;  1D1I A;  1PTO F;  1Y1W B;  1Y8N B;  4A3J B;  5CV8 A;  2SNS A;  2NTS A;  1B3A A;  3HOU B;  3HOX B;  2JSO A;  1SFO B;  1CZG A;  2IJ0 A;  3M4O B;  1B9M A;  4K6L A;  1U4L A;  2EYO A;  3I73 A;  5C5L A;  1OXU A;  4EVO A;  2F0S A;  2XIW A;  2BE5 D;  2IPK D;  2WKD A;  3NQI A;  3MFG A;  1R4Q B;  3TDQ A;  1PRT F;  1M4V A;  4M1U B;  1XX8 A;  3RD4 A;  1STN A;  1EYD A;  2O5J C;  2LFN A;  5EPK A;  4WRD A;  2DY7 A;  2AUK A;  2IT1 A;  3U9S A;  1HQR D;  4B08 A;  1BCP C;  4C3H G;  3K5M A;  1HXY D;  2EYJ A;  1PTO D;  1L0X B;  2F0E A;  1SND A;  1Y1V B;  4RGM A;  1Z7T A;  1FGB D;  3E0J A;  1WTQ A;  5J22 A;  5D65 A;  3J80 E;  1HUN A;  2LMC B;  3HS0 C;  5BN4 A;  5C0X I;  5EGT A;  4RKL A;  1C8C A;  4HMI A;  1ZYR C;  1PZJ D;  1O7Y A;  2WIN B;  1SNP A;  1CQF A;  2LKV A;  4C3J B;  3C1F A;  4IUU A;  3D4D A;  2NN6 G;  4K5V A;  5ELE A;  2CW0 D;  2L11 A;  5JAV A;  2K5D A;  1TY0 A;  3NTI A;  4M8A A;  4Z9C B;  2K03 A;  2B63 B;  2F03 A;  1CA6 A;  1QOH A;  4OO1 I;  2K1B A;  1E2V A;  5CBA E;  2Q8I B;  2B2W A;  3NXW A;  2Z4I A;  2X69 A;  4FXK C;  4P2C B;  1LAC A;  5K36 H;  1XYI A;  1EU3 A;  4K6D A;  4XYO A;  1JOR A;  1XTC D;  1SMY D;  2VXW A;  1WTO A;  2HQE A;  3BDO A;  5E4X A;  1D5Z C;  1GJX A;  3H3V C;  2F0O A;  4IFD H;  1TWH B;  1STE A;  2F1M A;  2K5W A;  3K0Y A;  1X3P A;  1IYU A;  5JVG 3;  4RHR A;  3D8G A;  2B2T C;  4FF2 A;  1II3 A;  4KHV A;  3T4A C;  5M5W B;  4IUN A;  4C3H B;  1MBY A;  4XTC S;  5KND A;  4LJZ C;  4PNY A;  2EYL A;  3PUZ A;  1BUV T;  3E6Z X;  3GTK B;  4K2K A;  2BA1 A;  3S2D B;  1D2B A;  5I4D A;  3C2P A;  1MSH A;  2PZU A;  4XT1 B;  1TWC B;  4ZUJ A;  1J8I A;  2BE5 C;  4A93 B;  1YNJ D;  3I4L A;  5KEE A;  1EOT A;  2A69 D;  3BVG A;  1WTX A;  1SNC A;  1ET6 A;  4LMQ D;  5C4Z A;  1GXD C;  1QNU A;  3VR6 A;  3K59 A;  2PW7 A;  2ZT9 C;  1F2M A;  5JOB A;  3H94 A;  3HOZ B;  1JQY D;  3KK7 A;  2K7V A;  1U4R A;  1I4Q A;  2EYM A;  1QJO A;  1I4R A;  5FK9 C;  2ID0 A;  3N52 A;  2MHV A;  4XQN A;  1LV9 A;  1PLF A;  5C3X A;  4PMC A;  2QEJ C;  3HOY B;  5CV5 A;  5BN3 A;  2B2V C;  4IN3 A;  5KNB A;  1QCB D;  2N55 A;  3MC0 B;  3BYY B;  4HSP A;  4ZAI A;  1SYE A;  1TWA B;  4ZLT F;  1MI2 A;  1WCM B;  1B44 D;  2CW0 C;  2WII B;  5C44 B;  2FMM A;  3I90 A;  1VF7 A;  3K7A B;  2O2L D;  3A8K E;  1CT1 D;  3CQZ B;  1BF4 A;  2E2J B;  1SJE D;  2SEB D;  1JIC A;  4C2M B;  1ILP A;  4QB4 A;  5M3F B;  2Y0S B;  3C3L A;  1HTL D;  5I9O A;  1AFP A;  1C4Q A;  3TZU A;  2EPB A;  2R3Z A;  1G91 A;  1WTW A;  3OIP A;  1IKL A;  2G9H D;  4RH6 A;  1NR2 A;  2NZ1 D;  3OMG A;  2Z4H A;  3IFD A;  1M8A A;  4HMJ A;  3FKI B;  1DM0 B;  2IW3 A;  3FPP A;  4DNT B;  1TII D;  4R9W A;  5ELC A;  1K83 B;  1G6Z A;  1IW7 D;  2NTT A;  4OL7 A;  2WAC A;  1HHV A;  3DWA A;  1GUG A;  5CGK A;  2IX1 A;  2PNR C;  4K5W A;  4BBR B;  2AUJ D;  3I4N B;  2MGS A;  2NBF A;  4G7H C;  1KTK A;  3C46 A;  1RJT A;  3QO2 A;  1E2Z A;  1WD1 A;  2EY5 A;  1CZW A;  3K58 A;  3A55 A;  4C56 C;  3K5O A;  4XIG S;  2A69 C;  4HCE A;  1HQM C;  1PDQ A;  3EA6 A;  3JAM L;  5EQ0 A;  2EXZ A;  5FLX L;  1GUO A;  4FXG C;  4JK1 C;  5COY A;  4WJW A;  2NN6 H;  2HDM A;  1U4M A;  1GUN A;  4RGO S;  1QIL A;  2A5H A;  1JOO A;  2ZXO A;  2AQ1 B;  3GV3 A;  5KGU A;  2IX0 A;  2HUG A;  2XRS D;  4BA2 I;  2B2Y C;  4DXG A;  5C5M A;  1CHQ D;  5KIX A;  1SYC A;  2KQ3 A;  3PUV A;  3QG1 A;  5ELD A;  1SBB B;  2TMP A;  3ZYY X;  1STB A;  5JEA G;  2RSN A;  3HRZ C;  2EYH A;  1G2S A;  1B1Z A;  1Q3L A;  4KI0 A;  4XQQ A;  2EY1 A;  4BWG B;  2JEB I;  3R93 A;  1VDZ A;  3CU7 A;  4IUR A;  2O4X A;  1U4P A;  2BDN A;  4KKU A;  4A3F B;  4DK0 A;  2AQ3 B;  3L9A X;  4HAE A;  2XSC A;  3TP6 A;  1AEX A;  4N9P A;  4OGQ C;  5JEA J;  1A3V A;  3EVQ A;  1PZK D;  3P75 A;  1FNU A;  5IGC A;  2F0G A;  3GTG B;  3PO3 B;  4U67 3;  2M00 A;  3IKJ A;  4WOR A;  1JOQ A;  1SYG A;  3IAY A;  5D3D A;  1F9S A;  1OXV A;  4KY6 A;  4RCN A;  2KOL A;  3RZO B;  5C4J B;  2M2L A;  5M5Y B;  1A3U A;  1OXS C;  2F0W A;  5D14 A;  3FVQ A;  3NE5 B;  2XN9 C;  1DD2 A;  1PXU A;  1KNE A;  2A73 B;  3NUC A;  3GTJ B;  2RDH A;  4MIU A;  2FFK B;  5C0X J;  1E2W A;  5HUR A;  1IW7 C;  1D5M C;  2F3W A;  5I2Y A;  4QF4 A;  5EPJ A;  3DMU A;  1TS4 A;  1NUC A;  2FHT A;  4C3J G;  1LO5 D;  5CMD A;  4KTA A;  3DHQ A;  1HA6 A;  2L4N A;  4G7Z C;  2L12 A;  3OIQ A;  4OIK A;  4KK7 A;  3GTM B;  1GOZ A;  3HGB A;  1UUP A;  3V05 A;  1F2Y A;  1PZI D;  1EY9 A;  1O78 A;  3T53 B;  1LTI D;  2B2U A;  1KLG D;  3SEB A;  1JWU D;  4NP5 A;  4WFN 3;  1LT3 D;  4ULL A;  1EFI D;  2PW5 A;  2F0P A;  1E0B A;  2K28 A;  5FO9 B;  1F2Z A;  4QMG A;  2A6E D;  4IFD I;  3TBI B;  3TSS A;  5M5X B;  2WV6 D;  3PIP 3;  2K32 A;  1EY0 A;  3D4R A;  4TRD A;  2F0K A;  4GZY C;  2K04 A;  3SK4 A;  1H9M A;  5CBE E;  1UNS A;  2B2W C;  3HZX A;  3MTS A;  1NSN S;  1VF5 C;  2NWG A;  5CR3 A;  4O42 A;  3H91 A;  1W6J A;  4F7X A;  2F0L A;  1BO0 A;  3DWQ A;  5LHY 1;  4Q5V A;  1H9J A;  5KYI A;  2JYO A;  1A6X A;  2F0U A;  4H0L C;  5EKL A;  4Q0F A;  4MHE A;  4CHT B;  3VYR A;  3MFY A;  5EBD A;  3LX0 A;  2NUC A;  3G7L A;  4C1N K;  1JWM D;  4FYD A;  5IT9 L;  4DU9 A;  2XNA C;  3KUP A;  3DM1 A;  1TT2 A;  2F0J A;  4FP5 D;  2BCO A;  4O1N A;  1TWG B;  3PMF A;  4BY7 B;  3NTK A;  2EOT A;  1K8M A;  2WKC A;  1TR5 A;  1SJH D;  1FNV A;  3DEO A;  3S9W A;  3IFT A;  1Q8I A;  3GTQ B;  1TS3 A;  4ZK9 B;  2B8F A;  3D3R A;  1EL0 A;  4RFB A;  1CFM A;  1QG7 A;  1KDC A;  3NQT A;  4PQX A;  4J6H A;  4ZKC B;  5C4H A;  2L5T A;  5C3W A;  2PMZ B;  1DJR D;  4BBS B;  1ROD A;  2R93 B;  3CKI B;  5I6W A;  2EY6 A;  5IOD A;  2L9H A;  4F88 A;  1KNA A;  3P7J A;  4EQO A;  3PUY A;  1BCP B;  4CJ0 B;  4HTH A;  1J9O A;  2TSS A;  5D3I B;  3TP7 A;  3FMC A;  5C4X B;  1JOK A;  4KV6 A;  2IWH A;  2SNM A;  5A2Q L;  3A7L A;  2KA7 A;  2F0D A;  2R6G A;  2E76 C;  2Z8L A;  2B8G A;  1ENA A;  4MN3 A;  5CV6 A;  3K5N A;  1EY7 A;  4YIJ A;  1AW7 A;  1BXT A;  1LTT D;  1U9R A;  4HED A;  4DN4 M;  4J1M A;  1SNQ A;  4J8Q A;  2QKI C;  4BS9 A;  4KN4 C;  2A6E C;  3OW7 A;  1Y8P B;  1JWS D;  3S1Q B;  1IL8 A;  2NB0 A;  5HGT A;  5EJW A;  5JEA H;  3KBG A;  3BS1 A;  3PUW A;  1G29 1;  1I4G A;  3C1E A;  3P20 A;  1BQQ T;  2EDG A;  3Q22 A;  4PMB A;  2VNU D;  1SEB D;  4L63 B;  1I6H B;  4BY1 B;  1O7Z A;  3AU7 A;  3HP3 A;  4B9W A;  1DYQ A;  1YNN D;  4CKC A;  3MXN A;  1CI3 M;  4L8J A;  3ERO A;  3DXJ C;  4ME5 A;  1PFB A;  4RGT A;  1KLU D;  2EJF C;  3K6O A;  2HCC A;  3OWF A;  1T5E A;  1EYC A;  1A15 A;  5DM6 3;  1HFN A;  4QCL A;  4A3G B;  4E6I A;  4IUP A;  3GTP B;  1S5C D;  3EJI A;  5A35 A;  1EIG A;  2NN6 I;  3HEJ A;  3S14 B;  1WD0 A;  4CJ1 B;  3V2T A;  3TP8 A;  2X6G A;  2IX3 A;  1R9T B;  2BDO A;  1EY5 A;  4R8N A;  2NVX B;  2B2T A;  2KEE A;  4RKB A;  2O5I C;  1C48 A;  1F9R A;  1CTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...