4KY6A

Crystal structure of staphylococcal nuclease variant delta+phs l25d at ph 6 and cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKDMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25D at pH 6 and cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky6A00
1KDCA 3ITPA 2SNMA 3NQTA 1EYAA 5E1FA 1EZ6A 2ENBA 5CC4A 3TMEA 1EZ8A 4KTAA 2LKVA 2F3VA 3HEJA 3NUCA 3QOJA 3D4DA 5I6WA 4K2KA 3EROA 5JAVA 5M9OA 4DU9A 5C6AA 1TT2A 4ZUIA 5EKLA 4QF4A 5J39A 1SNCA 2RDFA 4HMJA 4KY5A 1SYGA 3SK6A 4K14A 4DFAA 1U9RA 3C1FA 1II3A 1AEXA 2F0NA 2M00A 2PZTA 1EYDA 3OMGA 4WORA 5C4HA 2F0FA 3D4WA 3NP8A 2F0HA 2F0EA 5C3WA 4HMIA 1IHZA 4N9PA 1SYFA 2F0OA 1A3UA 1EYCA 2SNSA 5IGBA 3LX0A 4KD3A 1KDAA 5KYLA 5J1ZA 2EY5A 2EYLA 2RKSA 4K6DA 5I9PA 1SYCA 1SYBA 5IOCA 3P1HA 4ZQ3A 4WRDA 1JOOA 1SNQA 2F3WA 2SOBA 3MZ5A 4HTHA 2F0IA 1STBA 2EYHA 1SNPA 3SR1A 2EYJA 5IGGA 4RKLA 1F2MA 1ENAA 4K8JA 5C4ZA 5IGCA 4KJNA 3NHHA 3D8GA 4NMZA 1F2ZA 1ENCA 3C1EA 4TRDA 5JOBA 1SNMA 2F0JA 2PQEA 2EY6A 5C3XA 5HGTA 2EYFA 3SHLA 4H7BA 3RUZA 5IGDA 2EYPA 4KD4A 1EY6A 3SXHA 2EYMA 4NKLA 5CV8A 3V2TA 4IZ8A 4J6HA 4K5XA 2KQ3A 3OWFA 3SK8A 5I9OA 3NXWA 2PYKA 3R3OA 3OSOA 2F0DA 4NP5A 5DEHA 5HURA 2QDBA 5K5PA 5E3FA 2F0QA 1STNA 4QMGA 5EKKA 4DF7A 3BDLA 4K8IA 1EY9A 2F0GA 1A3TA 4IUNA 4K5VA 5CV9A 4OL7A 2EXZA 2PW7A 1F2YA 5IODA 1STYA 2EY1A 2F0VA 4KY6A 3T13A 4NDXA 4RKBA 4J1MA 5IIFA 3D6CA 3EVQA 4S3SA 3ERQA 5ISRA 1STGA 1KABA 3H6MA 3QOLA 5CV7A 4MIUA 4ODGA 4B9XA 1KAAA 1A2TA 1EY5A 4EQPA 2HQEA 3PMFA 3DHQA 2PW5A 4LAAA 2OEOA 1A3VA 5F2DA 4KY7A 4EVOA 1STHA 4ME5A 3EJIA 1A2UA 5KRUA 4E6IA 1NUCA 2EYOA 4I65A 3TP8A 2PZWA 1TR5A 3T16A 4EQNA 1JORA 3TP6A 5I6YA 5KYIA 1NSNS 4PMBA 5CV6A 3HZXA 5C5LA 3TP5A 3MHBA 1STAA 1EY0A 3QB3A 4K5WA 2OF1A 1EY7A 3MEHA 5KIXA 2PZUA 4N9TA 2RBMA 3MXPA 5CGKA 3U9OA 4G57A 1EY4A 4YIJA 5KEEA 1JOQA 3SK5A 2WACA 5C5MA 2KHSA 2F0WA 3DMUA 4ZUJA 3S9WA 3VA5A 4KV6A 3SK4A 2F0MA 1SNOA 5DAUA 5CV5A 3TP7A 2F0SA 2NUCA 5IGFA 1SYDA 3E5SA 4R8NA 4B9WA 5KGUA 2O4XA 5J22A 2EY2A 2F0TA 4F8MA 2F0KA 4IALA 2F0UA 4KJOA 1RKNA 4PNYA 1KDBA 1TQOA 4ID6A 2F0PA 5CR3A 5NUCA 1EQVA 2F0LA 1SYEA 4F7XA 3NK9A 4EQOA 5EGTA 3OMCA 4DGZA 5CV4A 5IGEA 4QB4A 4K2LA 4KHVA 1JOKA 2OXPA 4PMCA 3BDCA 3P75A 1EY8A 1SNDA 3MVVA
chains in the Genus database with same CATH superfamily
2FJ2A 1KDCA 1O7IA 3NPPA 3VR2A 2MFIA 2AMCB 2SNMA 3M7NA 3KF8A 3Q0AA 4C3HH 1JC7A 5C6AA 1TT2A 3I4NB 1FYCA 3T56B 1BXTA 3FMCA 1SYGA 1QNKA 2AWOA 2DNCA 1S3OA 1X56A 5C4HA 2M00A 2BE5C 3VYUA 4DR5Q 1HA5A 4CDCC 4DR5L 2NVYB 4KK7A 5IGBA 1QE6A 5IP7H 1VQOA 2EYLA 2F4IA 1B4OA 1DM0B 1DOLA 4WRDA 1JOOA 1KHIA 3GV3A 1YBYA 3DWQA 2RVLA 1IBKL 3CCVA 1K0RA 2IHFA 3HOYG 3P7JA 3G6JB 3NHHA 1VQ5A 3GO5A 1YNNC 2RQXA 3M4PA 2GN5A 1VQKA 4RWSC 4RFBA 2K5NA 2TMPA 4K0KL 2K05A 3Q24A 5CV8A 1I6HH 1JCKB 3OWFA 3S14H 1PH6A 2IL8A 4PG3A 1RL2A 3A8JE 3I70A 1STNA 2HDMA 3M3YB 4C3JG 1TWHB 3AQQA 1DCZA 5JJLA 2K5DA 1Y14B 4KY6A 4CDFC 3EVQA 5M5WB 1KABA 4TQUS 4LF9Q 1Q1BA 1UNSA 4UP8A 4U673 4YWMA 1XYIA 3D4RA 2OEOA 3O13A 2NYZD 5AFWA 2E2IH 1H9SA 4AYBG 4LF6Q 4NXNQ 3AEVA 2OTLA 4PMBA 1SLJA 1EY7A 5GQOA 2QW7A 3F1ZA 3JAMi 1R9TH 1CKMA 2EJFC 4RG1A 1H95A 1S4ZA 2WACA 5GAEC 3K7AH 5C5MA 3HOXG 3CCQA 4GOPC 3RN5A 1JWMD 1K8AC 1BOSA 3CAMA 4B9WA 4N8FA 1PXUA 2HUGA 1UE6A 5LMNW 1L0YB 4TVAB 3DWPA 4QY7A 4A3MG 2EDGA 2F0LA 3HOUB 2ZTEA 4R4TA 3I3CA 5CV4A 2IX3A 5D3IB 4QB4A 3MC0B 3HOUG 3RR5A 4OELB 4PMCA 4XXEA 3GTMH 4ZCKA 3CC4A 2Q8IB 4QUFA 2B8FA 5M3MG 3S1QB 1E2ZA 2F3VA 1F9SA 2PQAA 2B39A 5JAVA 4JI1Q 1FGBD 2OQKA 2NB0A 2RDFA 3SK6A 3Q23A 4K14A 2F0NA 1ICFB 3V96A 1B9MA 3RZDB 3ULLA 1CT1D 4A3CH 4HMIA 1K28A 1SYFA 1A0IA 1VF5C 1SMYC 2LFNA 1HNZL 1K8MA 4K6DA 3C3LA 3D31A 1PH2A 1NBWA 3BYYB 1SEBD 2NWGA 5CYUA 1PTOC 4DK1A 4X65Q 2R93H 5JPNC 3HOWB 2Z6KA 1TS3A 2F0JA 3GP7A 2O2LD 2WAQB 1N36Q 2VZAA 1G6PA 4IJHA 1GUGA 4K5XA 3SK8A 3CF5A 1I4RA 1O7ZA 5K5PA 4HIOA 1CI3M 2SEBD 2ZTCA 1STYA 1V1OA 4IPCA 1PH5A 1E24A 4S3SA 4DPGA 2MJ8A 4OX9Q 1QVFA 3S1NB 5LMNL 1OXUA 2M9VA 4LF5Q 1KLGD 1IXRA 1RCVD 4KY7A 3DM1A 1CSPA 2L5TA 2ZXPA 4ABNA 3MXUA 5C5LA 1SE8A 3HZXA 3BG3A 3ERSX 4DAVA 3CPFA 1OXXK 3DXJC 4FXKC 1CQVA 1TWFB 1QNUA 4HIDA 2R7ZG 2WB1G 1IKMA 4CKCA 3A54A 3S9WA 3S16H 3SK4A 2F0MA 1A63A 2XNAC 5JVH3 4YWKA 4DV4L 1JB3A 1CZGA 1LTRD 2Q8RE 2B2UC 3TREA 4KHVA 4XT3B 1XNRQ 1K3BC 2Y0SG 3BDCA 2B2UA 1EY8A 3V05A 5C4XH 1LACA 2YTXA 1CZWA 1S5FD 2WIIB 3ITPA 3EBEA 4A3CG 2B63G 4ZUIA 2HHHL 4B3TL 2A6HD 3CQZB 2DNEA 2IX1A 4WJ4A 1BCPC 1KTKA 3R2IA 3BZKA 1TS5A 1D5MC 3K0XA 1Q46A 1QB5D 3A74A 2JEBI 2JQOA 1K73C 2G9HD 3KDFA 1KNEA 1IHZA 5M3FH 2KHJA 4BBSG 1V1PA 1ZYRD 4JOIA 5JEAH 2JA6G 1SE4A 5FLMH 1KDAA 1B50A 4A4IA 3CC2A 1G2SA 4ZQ3A 2JA8G 4CKBA 1WD1A 3T53B 4C3IH 2ALYB 5FO8B 1QCBD 5IYCG 2JP1A 3GTKH 1SNMA 4HSPA 4IPGA 1ILPA 1IYUA 4QL5A 5IT9E 5IP9G 2D62A 2PI2E 4CHTB 3V2TA 1V1QA 1W6KA 1R4PB 1DD2A 4L5QA 4IFDG 4L5SA 1VQHA 1E2WA 3HOVB 2KVMA 4M8AA 2F0GA 2KJXA 4BY7H 3G4SA 3WOFA 3ULPA 3L3OC 4MIUA 4B9XA 3PUZA 4OHJA 1D1KA 3KF6A 2QCPX 4OO1I 4EVOA 2A74C 2PNRC 3KFUA 2WKDA 2EYOA 2PZWA 5FO9B 4UHVA 3T16A 2FHTA 2HDLA 2CCZA 3KYHC 2VUMH 1W2BA 4KKUA 4X65L 4FVMA 3QB3A 2AKWB 2BOSA 3VDYA 4JI7L 1N32Q 2K5VA 3J80i 5CGKA 4JI2L 1WJJA 4YIJA 3T1HQ 4ME3A 3PIO3 3CXCA 5DAUA 1MHWC 3HFZB 5IGFA 3W3AA 1JE5A 1H9KA 4CKEA 4LJZC 1D5ZC 3KBXA 3I55A 3A5UA 3X3NA 1NR4A 3PO2G 3RMHA 5C44H 1LM0A 2ZTDA 4XQJA 1X3QA 2DN8A 1SR3A 3CW2C 1JOKA 1PFMA 3S16B 4DV5Q 1PFSA 5IP7G 4ZK9B 2VQEL 2K28A 2NTTA 2R61A 4HCEA 2UUCQ 2E74C 1ZXTA 1J8IA 5C4JH 1VQDA 1ML0D 1SMXA 3NBIA 3I4MH 1LT5D 4HMJA 1Y8OB 3GTKB 4NXNL 3R2TA 3NWTA 3SDZA 3AFPA 3ZYYX 2A6ED 3JAML 2EJMA 1IL8A 1YEZA 4OEMB 2AQ3B 5IYDG 3G7LA 3IFDA 2SNSA 3LX0A 4N8X1 4CDDC 1NE3A 1JWSD 2EY5A 1I4PA 1WCMG 2AUKA 3QWNA 1EL0A 1EQRA 1VF7A 2EYJA 5IWAL 4ULLA 3KF8B 3HKSA 1ENCA 4L8JA 1CUKA 4WFN3 1X3GA 1ZEQX 3RUZA 5JJIA 1I4XA 1BKBA 4A3DH 3RZDH 2J0TD 4QIWE 4A3EH 5LMUQ 5EPLA 3H91A 2QEJC 3E0JA 3L9AX 3BDLA 5LL6S 2F4VQ 4IJLA 4RCNA 3HOZH 1O7YA 4NDXA 1E0BA 2A68C 3HRZC 1STGA 4KN7C 1N34L 4AQYL 1B9NA 4DXGA 1ESFA 2I5LX 2WAQG 3HGBA 4Y7NB 2IT1A 4A3DG 1GUWA 1Y1VG 4OGQC 3J81L 3OWEB 4KHPQ 1FD7D 1GUSA 4LFAQ 2E2JH 2L0CA 1Q90A 1U0LA 5D65A 4ZRZA 5K36H 2KOLA 3PUWA 3UE0A 1K83B 4G57A 1T5EA 4CJ2C 1YITA 2KHSA 4BS9A 4JI5Q 4R8NA 4A3FG 1L0XB 3GDEA 3HKZG 1G291 3C2PA 2L9HA 2RHSB 4LWCA 4X64Q 1WTRA 1J6QA 1G51A 1MSHA 3NK9A 4QIWB 2PMZB 2H5XA 4DGZA 3I4MG 5IGEA 2CWAA 1RTOA 3I8ZA 2PI2A 3J7ZC 3K7AB 1T9HA 3J7AV 2O5JC 4L63B 3M9BA 2R7ZB 3A55A 1F9QA 5A35A 4OWTB 5M9OA 4CGYB 1VQ9A 1H9JA 1G2TA 4F88A 5COYA 5TSSA 4KY5A 3GTPH 2K5WA 1WTOA 2MNAA 1AEXA 2X6LA 4WORA 4G7ZC 2HCCA 2MP1A 4C2MB 1HTLD 1WTPA 2F0HA 1I6HB 4PZ6A 3URYA 1UE1A 2KCMA 5FK9C 5KYLA 4C3JB 2HQLA 1XJVA 1WOCA 4LFAL 3EN2A 4POGA 4KHPL 3AU7A 5IGCA 2R6GA 3GQBA 4A3KG 2QF7A 2KA7A 1OTCA 2IX0A 2Z9HA 2EYMA 4JI6Q 1DZ1A 2NZHA 4AYBB 2VY3A 3DEOA 5M5YB 1AW7A 3QR8A 2QDBA 3GTMB 4QMGA 1S72A 5EKKA 4A3GB 2NVTH 1VQBA 1SN8A 1BCPD 3HOZG 1EFID 4Z9CB 1KAAA 3PMFA 1ASZA 2K33A 1A2UA 3OTOL 5BR8Q 3TP8A 2XIWA 5A2QE 2B2WA 2PZUA 3KF6B 2VNUD 3J81c 1KAWA 4FDBA 1EY4A 4DV2Q 3TRZA 1U4PA 3HS0C 2K03A 1OO9B 5DLQE 3K5OA 4DNRB 3A8KE 3CHBD 3FVQA 4H02A 1VQNA 3RNUA 4X6AH 2YTVA 1Z9FA 1WYDA 3WOEA 3EA6A 4PZ7A 2Q2IA 4P75A 4PNYA 1GVPA 1EQVA 1VCIA 4IFDI 1QVCA 1FL0A 2E75C 4DK6C 4EQOA 4JI0Q 1NCVA 2PPBC 3W2DA 4JK1C 3J7A5 4UY8C 3E6ZX 3G71A 2EOTA 2VQFQ 4BA1I 2XWBB 4U68A 1YNJC 3HEJA 1L1OA 3Q8DA 2VB2X 4DNIA 1VQEA 4JOIC 3TEHB 1EFWA 3HOUH 1PLFA 4KLKA 3D4WA 4DAMA 2TSSA 2BA1A 2IJ0A 3J81i 1BCPF 4YWLA 4HJ9A 4HR7B 2IHEA 4X66L 5G3LF 3JAMc 1HNWQ 1QG7A 1IL2A 2SOBA 2EYHA 2JSOA 1EUJA 1HQRD 5C4ZA 1HJPA 3CD6A 1I3QB 4A3BB 1JB7A 4DAPA 4NMZA 3GTPB 5HGTA 3S1NH 5IGDA 2XRQD 3PCOB 4A3JG 1I94Q 4NKLA 2CKZB 1TU2B 2EQSA 4A76A 1VQLA 3E0EA 3ND8A 1DYQA 2F0QA 4R8IA 1IBMQ 3M4OH 4OO1H 3S2HH 4K8IA 3BS1A 1IZ6A 4WJWA 4DV0Q 2EY1A 2ZM6L 1U4RA 4B3RQ 1GXDC 3M3YH 4DAYB 3QOLA 1X55A 4YHHL 2HQEA 3DHQA 2PW5A 3KLRA 3S14B 4JVZA 2JA7B 1NMFA 2CHBD 4IFDJ 1TR5A 4YCWA 4IFDH 2EVBA 3PF5A 2R93G 1EY0A 4JI3Q 1FGUA 4LF7Q 2Y0SB 2EE1A 2RBMA 1HFNA 1YNXA 3IRBA 3M7GA 1VMCA 1JWUD 2C35B 3ND9A 2WKCA 4GLVB 4C3IG 4H0LC 1TY0A 1YJNA 3GTOH 4Y7NH 1Y8PB 3RD4A 3J80E 2ICIA 4A93H 4IALA 1X32A 2CFMA 1KDBA 1TQOA 5FLMG 1TVXA 1JJGA 2K01A 3K6OA 4P2CB 5IYCH 3CC7A 1C8CA 4LF4Q 2JK8A 3MVVA 4YY3Q 4RGTA 5CC4A 4QJFA 4A3EB 4A3IH 4LMQD 2LKVA 3NUCA 2B63H 3PO3B 5I4DA 3E9HA 3GTLB 3SVMA 4GLAC 4TSSA 2PZTA 1RJTA 3VYTA 5C0XJ 1F2LA 1PYWD 4DV2L 4V190 1I4HA 2JA9A 2K6AA 4GN5A 2N3SA 1LT4D 2N55A 3DEPA 4UP7A 1X9NA 2B8GA 1PDQA 2P5ZX 1KC8C 2FMCA 4IPHA 4FF1A 4NXMQ 2R3ZA 1WTQA 3GTJB 1K0SA 1SNQA 1BDOA 3MZ5A 1TS2A 3J81j 1SNPA 3VR4A 1Z6HA 3DM3A 1C48A 2O5IC 3MFGA 5FJ8G 1YNND 1BBWA 3PQIA 4H7BA 3NELA 3KBGA 3CCSA 5C4JB 2C5CA 2GVBA 4LF4L 3H0GG 1XNQQ 4PQXA 2B2YA 5E4XA 3D0FA 1Y69U 2E2DC 1C7YA 2RCFA 1O78A 4NB3A 5IYBG 2PW7A 1PYBA 1QUQA 5IODA 5C44B 2CQOA 2RDGA 2I46A 5IIFA 4J1MA 4AH6A 1IBLL 4ODGA 2QKIC 3S1RB 1Q3LA 1G6ZA 1L2FA 1XPRA 4XTCS 1BF4A 4HCSA 3T1YL 3OW7A 4GS3A 3CU7A 2BDNA 3TP6A 1WTWA 4GZYC 3TP5A 2NBFA 1HA6A 1ET6A 3MFYA 5JPMC 3ICEA 1STAA 2B3GA 1AZPA 3SEBA 2EZVA 4A3GG 4IUTA 1HQMC 4TKOB 4XDXA 3H0GH 4MTNA 2Z8LA 4AQYQ 2XVSA 1S5BD 2MGSA 4DR7Q 4X3KA 2LSSA 3H09A 2D2CC 3OOCA 4APVA 1YVCA 3I2ZA 1SYEA 3GTQB 4MZ9A 3CMAA 4G7HC 4DR6L 4YCUA 5ELNA 4K2LA 1DONA 3R8BA 4JI4Q 1JT8A 2K75A 1KD1C 2ZXRA 5GROA 2L1BA 2CH4A 3TMEA 1XMOQ 4FF2A 1M4VA 3QOJA 2G9DA 3WWVA 1PMRA 1R4QB 1CA6A 2ZXOA 3A7LA 1I5FA 4DFAA 1SJED 1H9RA 4GNXC 5C3EG 4ZLTF 3FEWX 3PIP3 3KJPA 4A3IG 5C3EH 3VR6A 3VR3A 2OWOA 1A3UA 1RDPD 2X69A 1PTOH 1K83H 2VL6A 4C1NK 1PVOA 5IOCA 1SYCA 3M4YA 4K6LA 1H9SB 2K32A 2IY5B 1IW7D 4AYBE 3NTKA 5ELEA 1IW7C 4KHZA 2NZ1D 2YU9H 4AIMA 3MXNB 3T51B 1E2VA 4LF9L 4HN7A 1N33L 4YY3L 1EY6A 1SE2A 1Y1VB 1ET9A 2LY7A 1V43A 3SXHA 1TWAB 4R4IA 4J6HA 4A3MH 1HR0Q 1QZHA 3R3OA 1RTNA 3I90A 4DV1L 2UXCL 1F77A 5LMUL 3QO2A 3K8AA 1TXYA 2B29A 5ELDA 1E22A 1PFBA 1UAPA 1HCZA 4RHRA 2WB1E 4IUNA 3HOXH 3S17B 3BZDB 3Q6SA 1XTCD 2F0VA 4C1NI 3ERQA 5JJKA 1CK1A 3X3MA 1EY5A 3HOWG 5EPJA 3J7AF 2JJQA 4C3JH 4A3JB 4A3JH 5FLXL 4EQNA 1EU4A 1LTID 2CW0C 1YI2A 1U5KA 4R9WA 1BVSA 3FKIH 1WVLA 1EU3A 2OF1A 2JA5B 4A75A 5HY6A 4X62Q 2UUBL 4OO1G 3W5OA 1HH2P 2UXBQ 2C9OA 5JEAJ 2XGTA 3K7UC 1UEBA 1AE3A 3I4NG 4JI1L 1YIJA 4IPDA 5EQ0A 1HZ9A 1CHPD 5NUCA 3BZCA 3T4AC 1W6JA 4JCVE 3I7FA 4H44C 2R7FA 4KKSA 1M90C 1YHAA 1OXTA 4O42A 1Z7TA 2KENA 1I94L 3HOYH 1V8QA 1EIHA 2BDOA 3LWEA 1PTOD 1CQFA 2DJGC 4L5TA 4IQZA 4A3KB 4C3HG 3AFQA 4QF4A 1PFNA 2B2TC 4DR4L 2RSOA 1MGSA 2D5DA 2UU9L 4I7ZC 3T1HL 3NP8A 1FJGL 2F0EA 3HG9A 1GHKA 1Q8IA 2J7ZA 3MXNA 5J1ZA 1SYBA 1VQAA 4BY1B 4X3SA 1B70B 4IUUA 2B63B 1VMPA 2E2HH 2YV5A 3RZOB 4WJ3M 3S17H 1E3PA 4B3RL 4UPAA 1WI5A 1S5DD 1SE3A 3A0JA 2VQFL 4DV6Q 4JBJA 4UDUC 3F2DA 1XMOL 2EPBA 1G8ZD 4RGOS 3QG1A 2KQ3A 3BVMA 5GAGC 2Z6KC 2UUAQ 2PYKA 4JYAQ 3OSOA 4GKJQ 1PH7A 1BR9A 4DF7A 1HNXL 2L15A 3TN2A 2JA8B 4O1NA 1HNXQ 2E5LQ 2PO4A 1VQCA 5CBEE 3UDFA 1KRSA 4B3ML 4FP5D 3VA7A 2ATWA 2KCTA 2B2VC 1D6EC 3OW2A 1TWFH 2YTYA 2Y0SE 1A3VA 4H13C 1PRTB 1NR2A 4ME5A 4ZAIA 1QWYA 1O7LA 4MN3A 2XWJB 1Q8KA 4A3KH 1B2TA 3HOVG 4DV7L 4BBRH 1CA5A 1JOQA 5KEEA 2PNHA 2NZOA 4IUPA 5M3FB 2I07B 2AQ1B 3S2DH 3NQIA 3QIAA 3TP7A 4B3SQ 5FKAC 2WFWA 3OIQA 2A6HC 1Y1WG 4EGVA 2RHQB 3LNNA 2Z4IA 4JG2A 1L1OC 4LF8L 4NW2A 4RMFA 3CKIB 5C4XB 1Q7YC 2V1CC 3NENA 1QILA 5KNBA 3GTJH 2A5HA 4DA2A 1WD0A 4V0BA 2R92H 3UDXA 5I6WA 4DU9A 4JBWA 4KMUC 3W1GA 1GM5A 1EIGA 4JPBW 1AH9A 1MJEA 4GOPB 1RF2D 3C1FA 5IWAQ 1EYDA 3K59A 1TS4A 4DV3L 2A6EC 3PO3H 3IAYA 2NTSA 1PH9A 2ZJRA 1D2BA 3S2DB 3CRLC 4DN4M 1HZAA 5EAYA 2ZJPA 3CCMA 4X3TA 2UXDQ 4RKLA 1G91A 4BY7B 4PMWA 5JJZA 3U9SA 1RIPA 1WTVA 4BBRB 1X54A 4CDEC 2WAQE 4TRDA 2EYFA 4QGUA 1PH1A 1Y1VH 4LFBQ 5C3EB 3CCRA 4OIKA 1A8VA 2JA7G 1A6XA 1CFMA 1X3EA 4NP5A 1JQYD 1NY4A 1X6OA 3BJUA 1KXLA 3A8IE 1EY9A 1LTLA 3FP9A 4K5VA 1QZGA 1DOKA 3TBIB 2EXZA 1F2YA 5EBDA 3KLWA 4PZ8A 1K9MC 1BNZA 2Z6BA 1T5XD 3FPUB 3MWYW 3E9IA 3FRPB 5F2DA 2GVAA 2WP8J 4L6TB 1L0WA 2XTIA 2K5QA 2AUJD 1EWIA 1PH4A 1FJGQ 1LTBD 4N9TA 3ZJYC 1S5CD 4ILWA 3OHXC 1CHQD 2A68D 1WCMH 3OYYA 4A3EG 3M85A 5M5WH 5CV5A 4GKJL 2DY7A 4HEDA 2O4XA 3S24A 2UUAL 5IYDH 2I5MX 4B08A 3CCLA 2F0UA 1M8AA 1VQ4A 4UAIA 4MHEA 1HUMA 4B3MQ 3J7YW 4A3BH 3CPWA 3PUXA 5EKIA 2BH8A 2OXPA 4DNTB 4A93B 5BN5A 1EZ6A 2LS01 2E8GA 1I4QA 4K2KA 3FHWA 4F87A 1A62A 4OONA 4DV1Q 3EQLC 1Q1EA 2VB3X 3KK7A 1II3A 3K5LA 4LFCQ 4GKKQ 2M2LA 5T1GA 4IN3A 1C0AA 1RODA 1DJRD 1EYCA 3R93A 2MQHA 4Q5VA 4KD3A 2A69C 4B3SL 4YHHQ 2HIXA 3L2PA 4QUCA 1PH3A 3RN2A 4HTHA 1P8LA 4BA2I 3I4NH 5C44G 3NTHA 1Y1WH 1MBYA 1V9PA 4JI3L 5AJ3Q 1C4QA 3S2HB 3SHLA 1JICA 3M4OB 2N8NA 4DV5L 5CMDA 3FDTA 5I9OA 1LABA 5HURA 1O80A 2JA6B 2F52A 3GTLH 5IY0A 3BDOA 2KEDA 1KLUD 3HOWH 4KN4C 5CV9A 2FXQA 4OL7A 4R4QA 4FO2A 4GNXB 2E5LL 5ELOA 3EFXD 1B3QA 1E1OA 1A2TA 1CKNB 1WTHA 3PF4A 4PV1C 4IOCA 3TS2A 5HGQA 3EJIA 1NUCA 2MO0A 1U4MA 5IP9H 3PO2B 1Q12A 2F3IA 4IURA 1B53A 1LTAD 2UXDL 2YYZA 4J15A 2IW3A 1IBLQ 1VS0A 3ULJA 1BCPB 4LF5L 4OWWB 4RAUC 5LMNQ 1TWGH 4G4KA 2F0KA 1SFOB 4JI8Q 5FOBB 1VQMA 1AZQA 1XNQL 1IBML 4JI0L 4JV5Q 1Q81C 1U4LA 4HIKA 2K04A 1D1IA 5AJ3L 3RZOH 1FR3A 2E2HB 3Q22A 2A69D 4OIJA 3PGZA 1VQJA 1WCMB 3STBC 5JEAG 2JA6H 4BY1H 4JI6L 1MI2A 2ENBA 5E1FA 4JYAL 5M3FG 4JI8L 3K58A 4KTAA 3U50C 4EX5A 4DR2Q 4GN3B 4O0AA 1TY2A 1B7YB 5EKLA 5J39A 3KUPA 1PV4A 2Q2UA 1IKLA 2UUBQ 3H3VI 1R9TB 1FNWA 4XQNA 3HP3A 4OWXB 2VW9A 3GTGH 3H3VC 2V4DA 1TWCH 5C3WA 1Z47A 2F0OA 3A7AB 5C4XG 1WFQA 2R7ZH 4FYDA 3SR1A 3I4OA 4LF7L 5IGGA 4BXXH 4KKTA 4DUZL 2XSCA 3SE0A 5FLXc 3MAQA 3VYSA 1GHJA 1AFPA 2B2VA 2LXJA 3D8GA 3K81C 5T1IA 1LYLA 3C46A 4GKKL 2EY6A 4LFCL 1EIFA 4A3GH 1XMQL 1SBBB 3BVZA 3PO2H 2I5HA 3I56A 3G6EA 2F03A 1HR0L 1YJWA 3NXWA 3MEFA 5M5YH 3S1RH 5CBAE 2KBNA 4I7AA 3E3XA 5FO7B 1YZ6A 1ASYA 2RSNA 4J8QA 2ES2A 5C0XI 1XTDA 4CJ0B 2R92B 2PQAB 2N88A 4IOAA 1EYGA 2GA4B 1K3RA 1BBUA 4DR6Q 2Z0SA 2ASBA 5IYBH 1SJHD 4A3FB 1ZKOA 3J81E 4C56C 3OIPA 2NVQH 2JE6I 3OPOA 3CCEA 2VUMG 4FF4A 4GN4B 3A5ZB 3NEMA 1KRTA 1LT6D 4K5WA 4XYQA 3NE5B 4JW0A 5IT9L 2AQ2B 4DR2L 4R4CA 3TSSA 3A56A 1LT3D 5EBCA 2E76C 2QILA 1J5EL 1JJ2A 5FJ8H 1HFGA 4DV3Q 2D0OA 4X66Q 3GTGB 2G5DA 2NN6I 2F0SA 4EQ5A 3E5SA 1PRTD 5ELFA 1GD7A 3PV0A 3FPPA 4F8MA 1SROA 1LTTD 2K52A 2K14A 1HTPA 2F0PA 4OXPA 4RGMA 2PMZE 4P73A 2YU9B 2VS1A 1XNRL 4YCVA 3PSIA 2QDLA 1AE2A 3P75A 4XIGS 4BY1G 2IPKD 3NQTA 1SAPA 1YJ9A 4DV4Q 1HR0W 2EJGC 1KIXA 2JA8H 3D4DA 1SSOA 1GKHA 4C3IB 2K1BA 3NTIA 3UDIA 5E4WC 2WV6D 2KCNA 1SFOH 2F1MA 3HKZB 1EWCA 1YHBA 1FNUA 1CM9A 2WINB 3DUZA 3H15A 3UE1A 3PUYA 2Q8TA 5M3MH 3N52A 4FF3A 4P72A 2VXWA 1OXSC 1BO0A 4DR7L 4LW1A 1HZCA 3I73A 2EIFA 4A93G 2JEAI 4P74A 3K5NA 2QA4A 2MHVA 1BUVT 1EEFD 3VYRA 4DKAC 5DM63 2F4VL 3HOZB 3P20A 2FINB 4ZYSA 1K8GA 4HJ7A 2PQEA 5G3LD 1B1ZA 5GAHC 1GJXA 4KD4A 3CCUA 4C2MH 3G48A 1LTSD 5IE8A 2Z1CA 1PA6A 1KQSA 1BBXC 3I4LA 3F2BA 1BQQT 3NSWA 5DEHA 3PUVA 2DJFC 1E7ZA 1I6VC 3IKJA 5M5XH 2OQ0A 4X64L 1VQ7A 1XXGA 3SGIA 1JMCA 1C9OA 2UXBL 4X3UA 5ISRA 2KUMA 4RHSA 1Y8NB 1XMQQ 3NBHA 4FXGC 5I2YA 3S15H 4LAAA 1PZID 4HAEA 4BWGB 4GOPA 4DUZQ 3U4VA 3GV6A 1B3AA 1B8AA 5KYIA 5H1SE 1N32L 5J3BA 1I3QH 1QJOA 4DV0L 2KHIA 5EJWA 2L55A 4GNXA 5LHY1 3K80C 3VA5A 1ENFA 4XYOA 5ELBA 1ILQA 4BXXG 5KGUA 4QCLA 3MA2B 4CBVA 1LTGD 1EIYB 4GLXA 3KJOA 2L4NA 3OMCA 1N8RC 4XT1B 4KJOA 1NMGA 2OCEA 1JJCB 5A2QL 1UE7A 1VQ6A 1H9MA 2QEXA 1EZ8A 3TZUA 1XPUA 1VDZA 1MIUA 3FKIB 2KECA 1IBKQ 2JA5H 3TQYA 4A3BG 2E2JB 1JR0D 2K7VA 2BH2A 2IWHA 4MNOA 2D0PA 1S5ED 2QGQA 4RCOA 4A3MB 1J9OA 1SDFA 1MKHA 2ZJQA 1MD2D 2MUYA 3CMEA 2FFKB 1GUNA 1XWEA 1E1TA 3OTOQ 2DGYA 5BN3A 1CSQA 3NWSA 4K8JA 1EQQA 1IYJB 2JXMB 4IUVA 1LLRD 4JI7Q 3H3VH 4RGNA 3IL8A 1CKNA 3GD7A 1NTGA 1VQFA 4A3DB 2Q2TA 3U4ZA 5KNDA 3GTOB 2H4OA 2UXCQ 1AN8A 3UDGA 1RD9D 1P16A 5DM73 4RKBA 3D6CA 1SXTA 2CVRA 2EXDA 1EWHA 3CCJA 1STHA 1UUPA 2JA7H 1SMYD 4I65A 3K57A 1JORA 3WDNA 2A73B 2CWPA 5CV6A 5I2XA 4QQBX 3I4MB 3MHBA 3MEHA 2Z4HA 2BE5D 2FMMA 1X3PA 1N34Q 3TS0A 3S15B 2ID0A 3J80L 2X6GA 2F0WA 1EEID 2CH4W 4ZUJA 3PO3G 1HNWL 1CKOA 1SYDA 2NVQB 1TWHH 1NJIC 5L37A 5M5XB 1CTMA 4LF6L 3L7ZC 2VUMB 4ID6A 2BA0A 3BU2A 2K5HA 1ONLA 3BYTB 2R93B 2AWNA 3STBD 2AHOB 4DAYA 2L12A 2K50A 5DNFA 3KOJA 1VQ8A 4JBKA 3PIOA 3D3RA 4A3LH 1Q86C 2WB1B 1F9RA 1VQPA 3VR5A 3EROA 4HSVA 1ESRA 3HOYB 4DV7Q 3H94A 2RA4A 2LMCB 2XN9C 4LUVA 3N6RA 1LO5D 4DUYL 3BVGA 1SNCA 4XQQA 3HKZE 3OMGA 2F0FA 1HXYD 1GUOA 3CP0A 4P71A 5LL6X 2LXKA 4X62L 3LWUA 4N9PA 2N49A 1KL9A 4IUQA 4IO9A 1DXMA 3TZDA 1EQTA 3P1HA 5D3DA 2F0IA 3MTSA 1YHQA 2UU9Q 3AB9A 3HOVH 4KJNA 1TIID 5GADC 2MPMA 5KNCA 5JOBA 5C3XA 5C0XH 4HIMA 1B44D 3PIPA 2EYPA 1NNXA 4DV6L 3I72A 2B2YC 2CW0D 5FLXE 2A8VA 2D9UA 2N78A 4O2DA 2F0DA 1EOTA 4JI5L 4Y52H 1HZBA 5E3FA 4LF8Q 4LUZA 3AYHB 3CRKC 4FXDA 4JI4L 2ZT9C 3JAME 3HOXB 3GTQH 2VQEQ 2NN6G 1XX8A 4DR1Q 3TDQA 4G7OC 3H6MA 4LFBL 5CV7A 3UI2A 1I4GA 1UWVA 1HNZQ 1D8LA 2H1EA 4JC0A 4EQPA 4LNQA 1TWGB 1S40A 4M1UB 3T1YQ 2E2IB 2R7DA 5KRUA 1HHVA 1TWAH 2NN6H 4ZKBB 1STEA 1NSNS 3H0GB 1WTXA 2CQAA 4MTKA 3KLSA 5KIXA 1FNVA 2L11A 2HIVA 3DLLA 3U9OA 3JC66 2NVTB 2KCCA 3SK5A 2ZM6Q 3RLFA 5M3MB 2JN4A 4HJAA 1I50H 5BR8L 1YNJD 3D6WA 4ALPA 1PYSB 2B2TA 2DUDA 1UE5A 5J22A 2F0TA 2UUCL 5C0XG 1PH8A 1OXVA 1MJCA 4DR3Q 1RKNA 3ONAB 5CORA 2RF4A 3AMUA 3K0YA 2MO1A 3F2UA 1SRUA 1LUZA 1Q82C 1RHPA 3QJYA 1LV9A 3KDFB 2Q2HA 1V1PB 4DK3C 2HT1A 2DY8A 5E7NA 1EYAA 4K0KQ 4NXML 4DR3L 2XRSD 2SDFA 1EOVA 4LUOA 2BCOA 3DWAA 3M4QA 4Q0FA 1L1OB 1JE4A 1UEAB 2A1AA 1NAPA 1U9RA 5BN4A 3MXGA 3F8TA 1Y1WB 1PRTF 4HJ8A 3J80c 4CJ1B 1J5EQ 4A3LG 1TWCB 1MSGA 2JYOA 1X65A 3W1BA 1KNAA 1HUNA 2B2WC 5IT9c 2RKSA 5I9PA 4RH6A 1DGSA 2R92G 2F3WA 4RA8A 1W3SA 1STBA 1VQGA 2I0QA 1DOMA 3F2CA 4POFA 4DUYQ 1ICWA 1F2MA 1ENAA 4DR4Q 1VQIA 5JVG3 3FKIG 1GOZA 4KI0A 1F2ZA 2NVXH 3C1EA 4DR1L 3NBHB 4A3FH 2OTJA 1XPOA 2RDHA 3RLOA 1PRTC 1N33Q 4IZ8A 5D14A 4A3IB 1A15A 1IYVA 2HHHQ 4B3TQ 2HCIA 5K36G 4JV5L 2KEEA 4FNFA 3S1QH 1A3TA 2A19A 1HRJA 4JI2Q 3K5MA 2K4KA 3T13A 1N9WA 1I50B 4BY7G 1F9PA 4BBRG 1PHJA 1QVGA 1M1KC 3L0OA 4LK1C 4E6IA 1FVIA 1D7QA 2NVYH 3U58A 4JBMA 4ZKCB 1X3FA 1GUTA 5I6YA 4R4OA 3LGJA 3ER0A 1PTOF 2OT2A 4UP9A 4NPSA 4OX9L 3MXPA 1PTOB 1HPCA 1ZYRC 3B6YA 5EPKA 2PCFB 1PZJD 1D5XC 1PZKD 3DMUA 4KV6A 1SNOA 4HJ5A 5ELCA 2NUCA 4C3HB 2J4XA 1QUQB 3I91A 2HD3A 1GO3E 2ICEC 2EY2A 3S1MB 5CR3A 3EIVA 1AP0A 3IFTA 4DK0A 4F7XA 1QOHA 1TKWB 5EGTA 3RLNA 4DXFA 4BBSH 4BBSB 2NVXB 3CQZH 4R1JA 2JA5G 3KLSX 1N36L 4L5RC 2RCNA 3S1MH 1K8OA 1SNDA
chains in the Genus database with same CATH topology
2FJ2A 1KDCA 3NPPA 3VR2A 2SNMA 3M7NA 3KF8A 3Q0AA 1JC7A 5C6AA 1TT2A 3I4NB 1FYCA 3T56B 1BXTA 3FMCA 1SYGA 1QNKA 2AWOA 2DNCA 5C4HA 2M00A 2BE5C 3VYUA 1HA5A 2NVYB 4KK7A 5IGBA 1QE6A 2EYLA 2F4IA 1B4OA 1DM0B 1DOLA 4WRDA 1JOOA 3GV3A 3DWQA 2RVLA 3P7JA 3G6JB 3NHHA 3GO5A 1YNNC 2RQXA 4RWSC 4RFBA 2TMPA 2K05A 3Q24A 5CV8A 1JCKB 3OWFA 2IL8A 3A8JE 3I70A 1STNA 2HDMA 3M3YB 4C3JG 1TWHB 1DCZA 2K5DA 4KY6A 3EVQA 5M5WB 1KABA 4TQUS 1Q1BA 1UNSA 4U673 1XYIA 3D4RA 2OEOA 3O13A 2NYZD 5AFWA 1H9SA 4PMBA 1EY7A 2EJFC 1S4ZA 2WACA 5C5MA 1JWMD 1BOSA 4B9WA 1PXUA 2HUGA 1L0YB 3DWPA 2EDGA 2F0LA 3HOUB 3I3CA 5CV4A 2IX3A 5D3IB 4QB4A 3MC0B 4PMCA 4XXEA 2Q8IB 4QUFA 2B8FA 3S1QB 1E2ZA 2F3VA 1F9SA 2B39A 5JAVA 1FGBD 2NB0A 2RDFA 3SK6A 3Q23A 4K14A 2F0NA 3V96A 1B9MA 3RZDB 1CT1D 4HMIA 1SYFA 1VF5C 1SMYC 2LFNA 1K8MA 4K6DA 3C3LA 3D31A 3BYYB 1SEBD 2NWGA 5CYUA 1PTOC 4DK1A 5JPNC 3HOWB 1TS3A 2F0JA 3GP7A 2O2LD 2WAQB 1GUGA 4K5XA 3SK8A 1I4RA 1O7ZA 5K5PA 1CI3M 2SEBD 1STYA 1V1OA 4S3SA 2MJ8A 3S1NB 1OXUA 2M9VA 1KLGD 1RCVD 4KY7A 3DM1A 2L5TA 2ZXPA 4ABNA 3MXUA 5C5LA 3HZXA 3BG3A 4DAVA 1OXXK 3DXJC 4FXKC 1CQVA 1TWFB 1QNUA 1IKMA 4CKCA 3A54A 3S9WA 3SK4A 2F0MA 2XNAC 5JVH3 1JB3A 1CZGA 1LTRD 2Q8RE 2B2UC 4KHVA 4XT3B 3BDCA 2B2UA 1EY8A 3V05A 1LACA 1CZWA 1S5FD 2WIIB 3ITPA 4ZUIA 2A6HD 3CQZB 2DNEA 2IX1A 1BCPC 1KTKA 3R2IA 1TS5A 1D5MC 1QB5D 2JEBI 2G9HD 1KNEA 1IHZA 1V1PA 1ZYRD 5JEAH 1SE4A 1KDAA 1B50A 1G2SA 4ZQ3A 4CKBA 1WD1A 3T53B 5FO8B 1QCBD 2JP1A 1SNMA 4HSPA 1ILPA 1IYUA 5IT9E 2D62A 4CHTB 3V2TA 1W6KA 1R4PB 1DD2A 4IFDG 1E2WA 3HOVB 2KVMA 4M8AA 2F0GA 2KJXA 3WOFA 3L3OC 4MIUA 4B9XA 3PUZA 4OHJA 1D1KA 2QCPX 4OO1I 4EVOA 2A74C 2PNRC 2WKDA 2EYOA 2PZWA 5FO9B 3T16A 2FHTA 2HDLA 4KKUA 4FVMA 3QB3A 2BOSA 5CGKA 4YIJA 3PIO3 5DAUA 5IGFA 3W3AA 1H9KA 4CKEA 4LJZC 1D5ZC 3KBXA 3X3NA 1NR4A 3RMHA 4XQJA 1X3QA 2DN8A 1JOKA 1PFMA 3S16B 4ZK9B 2K28A 2NTTA 2R61A 4HCEA 2E74C 1ZXTA 1J8IA 1ML0D 3NBIA 1LT5D 4HMJA 1Y8OB 3GTKB 3R2TA 3NWTA 3SDZA 3ZYYX 3JAML 2A6ED 2EJMA 1IL8A 2AQ3B 3G7LA 3IFDA 2SNSA 3LX0A 1JWSD 2EY5A 1I4PA 1EL0A 2AUKA 3QWNA 1VF7A 2EYJA 4ULLA 1ENCA 4L8JA 4WFN3 1ZEQX 3RUZA 1I4XA 2J0TD 5EPLA 3H91A 2QEJC 3E0JA 3L9AX 3BDLA 5LL6S 4RCNA 1O7YA 4NDXA 1E0BA 2A68C 3HRZC 1STGA 4KN7C 1B9NA 4DXGA 1ESFA 3HGBA 4Y7NB 2IT1A 1GUWA 3J81L 4OGQC 3OWEB 1FD7D 1GUSA 2L0CA 1Q90A 5D65A 4ZRZA 5K36H 2KOLA 3PUWA 1K83B 4G57A 1T5EA 4CJ2C 2KHSA 4BS9A 4R8NA 1L0XB 1G291 3C2PA 2L9HA 1WTRA 1MSHA 3NK9A 4QIWB 2PMZB 4DGZA 5IGEA 1RTOA 3I8ZA 3J7AV 3K7AB 2O5JC 4L63B 2R7ZB 3A55A 1F9QA 5A35A 5M9OA 4CGYB 1H9JA 1G2TA 4F88A 5COYA 5TSSA 4KY5A 2K5WA 1WTOA 1AEXA 2X6LA 4WORA 4G7ZC 2HCCA 2MP1A 4C2MB 1HTLD 1WTPA 2F0HA 1I6HB 3URYA 5FK9C 5KYLA 4C3JB 3AU7A 5IGCA 2R6GA 3GQBA 2QF7A 2KA7A 2IX0A 2EYMA 1DZ1A 4AYBB 3DEOA 5M5YB 1AW7A 2QDBA 3GTMB 4QMGA 5EKKA 4A3GB 1BCPD 1EFID 4Z9CB 1KAAA 3PMFA 2K33A 1A2UA 3TP8A 2XIWA 5A2QE 2B2WA 2PZUA 2VNUD 1EY4A 1U4PA 3HS0C 2K03A 1OO9B 3K5OA 4DNRB 3A8KE 3CHBD 3FVQA 3WOEA 3EA6A 4PNYA 1EQVA 1VCIA 4IFDI 2E75C 4EQOA 1NCVA 2PPBC 3W2DA 4JK1C 3E6ZX 2EOTA 4BA1I 2XWBB 4U68A 1YNJC 3HEJA 2VB2X 1PLFA 3D4WA 2TSSA 2BA1A 2IJ0A 1BCPF 4HR7B 5G3LF 1QG7A 2SOBA 2EYHA 2JSOA 1HQRD 5C4ZA 1I3QB 4A3BB 4DAPA 4NMZA 3GTPB 5HGTA 5IGDA 2XRQD 4NKLA 1TU2B 3ND8A 1DYQA 2F0QA 4R8IA 4OO1H 4K8IA 3BS1A 4WJWA 2EY1A 1U4RA 1GXDC 3QOLA 2HQEA 3DHQA 2PW5A 3KLRA 3S14B 2JA7B 2CHBD 4IFDJ 1TR5A 4IFDH 2EVBA 1EY0A 2Y0SB 2EE1A 2RBMA 1HFNA 3M7GA 1VMCA 1JWUD 3ND9A 2WKCA 4C3IG 4H0LC 1TY0A 1Y8PB 3RD4A 3J80E 2ICIA 4IALA 1X32A 1KDBA 1TQOA 1TVXA 2K01A 3K6OA 4P2CB 1C8CA 3MVVA 4RGTA 5CC4A 4A3EB 4LMQD 2LKVA 3NUCA 3PO3B 5I4DA 3GTLB 3SVMA 4TSSA 2PZTA 1RJTA 3VYTA 5C0XJ 1F2LA 1PYWD 4V190 1I4HA 2K6AA 1LT4D 2N55A 3DEPA 2B8GA 1PDQA 2FMCA 4FF1A 2R3ZA 1WTQA 3GTJB 1SNQA 1BDOA 3MZ5A 1TS2A 1SNPA 3VR4A 1Z6HA 1C48A 2O5IC 3MFGA 1YNND 4H7BA 3KBGA 5C4JB 2C5CA 4PQXA 2B2YA 5E4XA 1Y69U 2E2DC 1O78A 2PW7A 5IODA 5C44B 2RDGA 2I46A 5IIFA 4J1MA 4ODGA 2QKIC 3S1RB 1Q3LA 1G6ZA 4XTCS 1BF4A 4HCSA 3OW7A 3CU7A 2BDNA 3TP6A 1WTWA 4GZYC 3TP5A 2NBFA 1HA6A 1ET6A 3MFYA 5JPMC 1STAA 1AZPA 3SEBA 2EZVA 4IUTA 1HQMC 4TKOB 4XDXA 2Z8LA 2XVSA 1S5BD 2MGSA 4X3KA 3H09A 2D2CC 3OOCA 1SYEA 3GTQB 4G7HC 4K2LA 1DONA 3R8BA 2ZXRA 2L1BA 3TMEA 4FF2A 1M4VA 3QOJA 2G9DA 1PMRA 1R4QB 1CA6A 2ZXOA 3A7LA 4DFAA 1SJED 1H9RA 4ZLTF 3FEWX 3PIP3 3VR6A 3VR3A 1A3UA 1RDPD 2X69A 1PTOH 4C1NK 5IOCA 1SYCA 3M4YA 4K6LA 1H9SB 2K32A 1IW7D 3NTKA 5ELEA 1IW7C 4KHZA 2NZ1D 3T51B 1E2VA 4HN7A 1EY6A 1SE2A 1Y1VB 1ET9A 2LY7A 1V43A 3SXHA 1TWAB 4J6HA 3R3OA 1RTNA 3I90A 1F77A 3QO2A 5ELDA 1PFBA 1UAPA 1HCZA 4RHRA 3S17B 4IUNA 3BZDB 3Q6SA 1XTCD 2F0VA 4C1NI 3ERQA 1CK1A 3X3MA 1EY5A 5EPJA 3J7AF 4A3JB 5FLXL 4EQNA 1EU4A 1LTID 2CW0C 4R9WA 2JA5B 1WVLA 1EU3A 2OF1A 4OO1G 2C9OA 5JEAJ 5EQ0A 1CHPD 5NUCA 3T4AC 1W6JA 4H44C 4KKSA 4O42A 1OXTA 1Z7TA 1V8QA 1EIHA 2BDOA 3LWEA 1PTOD 1CQFA 4IQZA 4A3KB 4C3HG 4QF4A 1PFNA 2B2TC 2RSOA 1MGSA 2D5DA 4I7ZC 3NP8A 2F0EA 3HG9A 1GHKA 1Q8IA 2J7ZA 3MXNA 5J1ZA 1SYBA 4BY1B 4X3SA 4IUUA 2B63B 1VMPA 3RZOB 1S5DD 1SE3A 4UDUC 2EPBA 1G8ZD 4RGOS 3QG1A 2KQ3A 3BVMA 2PYKA 3OSOA 1BR9A 4DF7A 3TN2A 2JA8B 4O1NA 2PO4A 5CBEE 4FP5D 3VA7A 2B2VC 1D6EC 1A3VA 4H13C 1PRTB 1NR2A 4ME5A 4ZAIA 1QWYA 1O7LA 4MN3A 2XWJB 1B2TA 1CA5A 1JOQA 5KEEA 4IUPA 5M3FB 2I07B 2AQ1B 3NQIA 3QIAA 3TP7A 5FKAC 3OIQA 2A6HC 4EGVA 3LNNA 2Z4IA 4NW2A 3CKIB 5C4XB 1QILA 5KNBA 2A5HA 4DA2A 1WD0A 4V0BA 5I6WA 4DU9A 4JBWA 4KMUC 1EIGA 1RF2D 3C1FA 1EYDA 3K59A 1TS4A 2A6EC 3IAYA 2NTSA 1D2BA 3S2DB 3CRLC 4DN4M 4X3TA 4RKLA 1G91A 4BY7B 4PMWA 5JJZA 3U9SA 1WTVA 4BBRB 4TRDA 2EYFA 5C3EB 4OIKA 1A6XA 1CFMA 4NP5A 1JQYD 3A8IE 1EY9A 4K5VA 1DOKA 3TBIB 2EXZA 1F2YA 5EBDA 1BNZA 1T5XD 3FPUB 3MWYW 3FRPB 5F2DA 2WP8J 4L6TB 2K5QA 2AUJD 1LTBD 4N9TA 1S5CD 4ILWA 3OHXC 1CHQD 2A68D 3M85A 5CV5A 2DY7A 4HEDA 2O4XA 4B08A 2F0UA 1M8AA 4UAIA 4MHEA 1HUMA 3J7YW 3PUXA 5EKIA 2OXPA 4DNTB 4A93B 5BN5A 1EZ6A 2LS01 1I4QA 4K2KA 4F87A 3EQLC 1Q1EA 2VB3X 3KK7A 1II3A 3K5LA 2M2LA 5T1GA 4IN3A 1RODA 1DJRD 1EYCA 3R93A 4Q5VA 4KD3A 2A69C 4QUCA 4HTHA 4BA2I 3NTHA 1MBYA 1C4QA 3S2HB 3SHLA 1JICA 3M4OB 5CMDA 3FDTA 5I9OA 1LABA 5HURA 1O80A 2JA6B 3BDOA 2KEDA 1KLUD 4KN4C 5CV9A 4OL7A 4FO2A 3EFXD 1A2TA 4PV1C 3EJIA 1NUCA 3PO2B 1U4MA 1Q12A 4IURA 1B53A 1LTAD 2YYZA 2IW3A 1BCPB 4RAUC 4G4KA 2F0KA 1SFOB 5FOBB 1AZQA 1U4LA 2K04A 1D1IA 1FR3A 2E2HB 3Q22A 2A69D 4OIJA 1WCMB 5JEAG 1MI2A 2ENBA 5E1FA 3K58A 4KTAA 1TY2A 5EKLA 5J39A 3KUPA 1IKLA 1R9TB 1FNWA 4XQNA 3HP3A 3H3VC 2V4DA 5C3WA 1Z47A 2F0OA 3A7AB 4FYDA 3SR1A 5IGGA 4KKTA 2XSCA 3MAQA 3SE0A 3VYSA 1GHJA 1AFPA 2B2VA 3D8GA 3C46A 5T1IA 2EY6A 1SBBB 3BVZA 2F03A 3NXWA 5CBAE 5FO7B 2RSNA 4J8QA 5C0XI 4CJ0B 2R92B 2N88A 2GA4B 1SJHD 4A3FB 1ZKOA 3J81E 4C56C 3OIPA 2JE6I 3OPOA 4FF4A 1LT6D 4K5WA 4XYQA 3NE5B 5IT9L 2AQ2B 3TSSA 3A56A 1LT3D 5EBCA 2E76C 2QILA 1HFGA 3GTGB 2NN6I 2F0SA 3E5SA 1PRTD 5ELFA 3PV0A 3FPPA 4F8MA 1LTTD 1HTPA 2F0PA 4RGMA 2YU9B 4XIGS 3P75A 2IPKD 3NQTA 1SAPA 2EJGC 3D4DA 1SSOA 4C3IB 2K1BA 3NTIA 5E4WC 2WV6D 2KCNA 2F1MA 3HKZB 1EWCA 1FNUA 1CM9A 2WINB 3DUZA 3PUYA 2Q8TA 3N52A 4FF3A 2VXWA 1OXSC 1BO0A 3I73A 2JEAI 3K5NA 2MHVA 1BUVT 1EEFD 3VYRA 5DM63 3HOZB 3P20A 2FINB 4ZYSA 2PQEA 5G3LD 1B1ZA 1GJXA 4KD4A 1LTSD 2Z1CA 1BBXC 3I4LA 1BQQT 3NSWA 5DEHA 3PUVA 1I6VC 3IKJA 1XXGA 4X3UA 5ISRA 2KUMA 4RHSA 1Y8NB 3NBHA 4FXGC 5I2YA 4LAAA 1PZID 4HAEA 4BWGB 3GV6A 1B3AA 5KYIA 1QJOA 5EJWA 2L55A 5LHY1 3VA5A 1ENFA 4XYOA 5ELBA 1ILQA 5KGUA 4QCLA 3MA2B 4CBVA 1LTGD 2L4NA 3OMCA 4XT1B 4KJOA 5A2QL 1H9MA 1EZ8A 3TZUA 1VDZA 3FKIB 2KECA 2E2JB 1JR0D 2K7VA 2IWHA 1S5ED 4RCOA 4A3MB 1J9OA 1SDFA 1MD2D 2MUYA 2FFKB 1GUNA 1XWEA 5BN3A 3NWSA 4K8JA 2JXMB 4IUVA 1LLRD 4RGNA 3GD7A 3IL8A 4A3DB 5KNDA 3GTOB 2H4OA 1AN8A 1RD9D 5DM73 4RKBA 3D6CA 1SXTA 2CVRA 1EWHA 1STHA 1UUPA 1SMYD 4I65A 3K57A 1JORA 3WDNA 2A73B 5CV6A 5I2XA 3I4MB 3MHBA 3MEHA 2Z4HA 2BE5D 2FMMA 1X3PA 3S15B 2ID0A 3J80L 2X6GA 2F0WA 1EEID 4ZUJA 1SYDA 2NVQB 5M5XB 1CTMA 3L7ZC 2VUMB 4ID6A 2BA0A 1ONLA 3BYTB 2R93B 2AWNA 4DAYA 2L12A 5DNFA 3D3RA 2WB1B 1F9RA 3VR5A 3EROA 4HSVA 1ESRA 3HOYB 3H94A 2RA4A 2LMCB 2XN9C 3N6RA 1LO5D 3BVGA 1SNCA 4XQQA 3OMGA 2F0FA 1HXYD 1GUOA 5LL6X 3LWUA 4N9PA 4IUQA 1DXMA 3TZDA 1EQTA 3P1HA 5D3DA 2F0IA 3MTSA 3AB9A 4KJNA 1TIID 2MPMA 5KNCA 5JOBA 5C3XA 5C0XH 1B44D 2EYPA 3I72A 2B2YC 2CW0D 5FLXE 2D9UA 2F0DA 1EOTA 5E3FA 3CRKC 4FXDA 2ZT9C 3JAME 3HOXB 2NN6G 1XX8A 3TDQA 4G7OC 3H6MA 5CV7A 3UI2A 1I4GA 2H1EA 4EQPA 1TWGB 4M1UB 2E2IB 5KRUA 1HHVA 2NN6H 4ZKBB 1STEA 1NSNS 1WTXA 3H0GB 2CQAA 3KLSA 5KIXA 1FNVA 2L11A 3U9OA 2NVTB 2KCCA 3SK5A 3RLFA 5M3MB 1YNJD 3D6WA 2B2TA 5J22A 2F0TA 5C0XG 1OXVA 1RKNA 3ONAB 5CORA 3AMUA 3K0YA 3F2UA 1RHPA 3QJYA 1LV9A 1V1PB 2DY8A 1EYAA 2XRSD 2SDFA 2BCOA 3DWAA 4Q0FA 1JE4A 1UEAB 1NAPA 1U9RA 5BN4A 3MXGA 1Y1WB 1PRTF 4CJ1B 1TWCB 1MSGA 2JYOA 1KNAA 1HUNA 2B2WC 2RKSA 5I9PA 4RH6A 2F3WA 4RA8A 1STBA 1DOMA 1ICWA 1F2MA 1ENAA 5JVG3 1GOZA 4KI0A 1F2ZA 3C1EA 2RDHA 1PRTC 4IZ8A 5D14A 4A3IB 1A15A 1IYVA 2HCIA 5K36G 2KEEA 4FNFA 1A3TA 1HRJA 3K5MA 3T13A 1I50B 1F9PA 4LK1C 4E6IA 4ZKCB 5I6YA 1GUTA 1PTOF 2OT2A 3MXPA 1PTOB 1HPCA 1ZYRC 5EPKA 2PCFB 1PZJD 1D5XC 1PZKD 3DMUA 4KV6A 1SNOA 5ELCA 2NUCA 4C3HB 2J4XA 3I91A 2ICEC 2EY2A 3S1MB 5CR3A 1AP0A 3IFTA 4DK0A 4F7XA 1QOHA 1TKWB 5EGTA 2NVXB 4DXFA 4BBSB 3KLSX 1K8OA 1SNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KDC A;  3ITP A;  2SNM A;  3NQT A;  1EYA A;  5E1F A;  1EZ6 A;  2ENB A;  5CC4 A;  3TME A;  1EZ8 A;  4KTA A;  2LKV A;  2F3V A;  3HEJ A;  3NUC A;  3QOJ A;  3D4D A;  5I6W A;  4K2K A;  3ERO A;  5JAV A;  5M9O A;  4DU9 A;  5C6A A;  1TT2 A;  4ZUI A;  5EKL A;  4QF4 A;  5J39 A;  1SNC A;  2RDF A;  4HMJ A;  4KY5 A;  1SYG A;  3SK6 A;  4K14 A;  4DFA A;  1U9R A;  3C1F A;  1II3 A;  1AEX A;  2F0N A;  2M00 A;  2PZT A;  1EYD A;  3OMG A;  4WOR A;  5C4H A;  2F0F A;  3D4W A;  3NP8 A;  2F0H A;  2F0E A;  5C3W A;  4HMI A;  1IHZ A;  4N9P A;  1SYF A;  2F0O A;  1A3U A;  1EYC A;  2SNS A;  5IGB A;  3LX0 A;  4KD3 A;  1KDA A;  5KYL A;  5J1Z A;  2EY5 A;  2EYL A;  2RKS A;  4K6D A;  5I9P A;  1SYC A;  1SYB A;  5IOC A;  3P1H A;  4ZQ3 A;  4WRD A;  1JOO A;  1SNQ A;  2F3W A;  2SOB A;  3MZ5 A;  4HTH A;  2F0I A;  1STB A;  2EYH A;  1SNP A;  3SR1 A;  2EYJ A;  5IGG A;  4RKL A;  1F2M A;  1ENA A;  4K8J A;  5C4Z A;  5IGC A;  4KJN A;  3NHH A;  3D8G A;  4NMZ A;  1F2Z A;  1ENC A;  3C1E A;  4TRD A;  5JOB A;  1SNM A;  2F0J A;  2PQE A;  2EY6 A;  5C3X A;  5HGT A;  2EYF A;  3SHL A;  4H7B A;  3RUZ A;  5IGD A;  2EYP A;  4KD4 A;  1EY6 A;  3SXH A;  2EYM A;  4NKL A;  5CV8 A;  3V2T A;  4IZ8 A;  4J6H A;  4K5X A;  2KQ3 A;  3OWF A;  3SK8 A;  5I9O A;  3NXW A;  2PYK A;  3R3O A;  3OSO A;  2F0D A;  4NP5 A;  5DEH A;  5HUR A;  2QDB A;  5K5P A;  5E3F A;  2F0Q A;  1STN A;  4QMG A;  5EKK A;  4DF7 A;  3BDL A;  4K8I A;  1EY9 A;  2F0G A;  1A3T A;  4IUN A;  4K5V A;  5CV9 A;  4OL7 A;  2EXZ A;  2PW7 A;  1F2Y A;  5IOD A;  1STY A;  2EY1 A;  2F0V A;  4KY6 A;  3T13 A;  4NDX A;  4RKB A;  4J1M A;  5IIF A;  3D6C A;  3EVQ A;  4S3S A;  3ERQ A;  5ISR A;  1STG A;  1KAB A;  3H6M A;  3QOL A;  5CV7 A;  4MIU A;  4ODG A;  4B9X A;  1KAA A;  1A2T A;  1EY5 A;  4EQP A;  2HQE A;  3PMF A;  3DHQ A;  2PW5 A;  4LAA A;  2OEO A;  1A3V A;  5F2D A;  4KY7 A;  4EVO A;  1STH A;  4ME5 A;  3EJI A;  1A2U A;  5KRU A;  4E6I A;  1NUC A;  2EYO A;  4I65 A;  3TP8 A;  2PZW A;  1TR5 A;  3T16 A;  4EQN A;  1JOR A;  3TP6 A;  5I6Y A;  5KYI A;  1NSN S;  4PMB A;  5CV6 A;  3HZX A;  5C5L A;  3TP5 A;  3MHB A;  1STA A;  1EY0 A;  3QB3 A;  4K5W A;  2OF1 A;  1EY7 A;  3MEH A;  5KIX A;  2PZU A;  4N9T A;  2RBM A;  3MXP A;  5CGK A;  3U9O A;  4G57 A;  1EY4 A;  4YIJ A;  5KEE A;  1JOQ A;  3SK5 A;  2WAC A;  5C5M A;  2KHS A;  2F0W A;  3DMU A;  4ZUJ A;  3S9W A;  3VA5 A;  4KV6 A;  3SK4 A;  2F0M A;  1SNO A;  5DAU A;  5CV5 A;  3TP7 A;  2F0S A;  2NUC A;  5IGF A;  1SYD A;  3E5S A;  4R8N A;  4B9W A;  5KGU A;  2O4X A;  5J22 A;  2EY2 A;  2F0T A;  4F8M A;  2F0K A;  4IAL A;  2F0U A;  4KJO A;  1RKN A;  4PNY A;  1KDB A;  1TQO A;  4ID6 A;  2F0P A;  5CR3 A;  5NUC A;  1EQV A;  2F0L A;  1SYE A;  4F7X A;  3NK9 A;  4EQO A;  5EGT A;  3OMC A;  4DGZ A;  5CV4 A;  5IGE A;  4QB4 A;  4K2L A;  4KHV A;  1JOK A;  2OXP A;  4PMC A;  3BDC A;  3P75 A;  1EY8 A;  1SND A;  3MVV A; 
#chains in the Genus database with same CATH topology
 2FJ2 A;  1KDC A;  1O7I A;  3NPP A;  3VR2 A;  2MFI A;  2AMC B;  2SNM A;  3M7N A;  3KF8 A;  3Q0A A;  4C3H H;  1JC7 A;  5C6A A;  1TT2 A;  3I4N B;  1FYC A;  3T56 B;  1BXT A;  3FMC A;  1SYG A;  1QNK A;  2AWO A;  2DNC A;  1S3O A;  1X56 A;  5C4H A;  2M00 A;  2BE5 C;  3VYU A;  4DR5 Q;  1HA5 A;  4CDC C;  4DR5 L;  2NVY B;  4KK7 A;  5IGB A;  1QE6 A;  5IP7 H;  1VQO A;  2EYL A;  2F4I A;  1B4O A;  1DM0 B;  1DOL A;  4WRD A;  1JOO A;  1KHI A;  3GV3 A;  1YBY A;  3DWQ A;  2RVL A;  1IBK L;  3CCV A;  1K0R A;  2IHF A;  3HOY G;  3P7J A;  3G6J B;  3NHH A;  1VQ5 A;  3GO5 A;  1YNN C;  2RQX A;  3M4P A;  2GN5 A;  1VQK A;  4RWS C;  4RFB A;  2K5N A;  2TMP A;  4K0K L;  2K05 A;  3Q24 A;  5CV8 A;  1I6H H;  1JCK B;  3OWF A;  3S14 H;  1PH6 A;  2IL8 A;  4PG3 A;  1RL2 A;  3A8J E;  3I70 A;  1STN A;  2HDM A;  3M3Y B;  4C3J G;  1TWH B;  3AQQ A;  1DCZ A;  5JJL A;  2K5D A;  1Y14 B;  4KY6 A;  4CDF C;  3EVQ A;  5M5W B;  1KAB A;  4TQU S;  4LF9 Q;  1Q1B A;  1UNS A;  4UP8 A;  4U67 3;  4YWM A;  1XYI A;  3D4R A;  2OEO A;  3O13 A;  2NYZ D;  5AFW A;  2E2I H;  1H9S A;  4AYB G;  4LF6 Q;  4NXN Q;  3AEV A;  2OTL A;  4PMB A;  1SLJ A;  1EY7 A;  5GQO A;  2QW7 A;  3F1Z A;  3JAM i;  1R9T H;  1CKM A;  2EJF C;  4RG1 A;  1H95 A;  1S4Z A;  2WAC A;  5GAE C;  3K7A H;  5C5M A;  3HOX G;  3CCQ A;  4GOP C;  3RN5 A;  1JWM D;  1K8A C;  1BOS A;  3CAM A;  4B9W A;  4N8F A;  1PXU A;  2HUG A;  1UE6 A;  5LMN W;  1L0Y B;  4TVA B;  3DWP A;  4QY7 A;  4A3M G;  2EDG A;  2F0L A;  3HOU B;  2ZTE A;  4R4T A;  3I3C A;  5CV4 A;  2IX3 A;  5D3I B;  4QB4 A;  3MC0 B;  3HOU G;  3RR5 A;  4OEL B;  4PMC A;  4XXE A;  3GTM H;  4ZCK A;  3CC4 A;  2Q8I B;  4QUF A;  2B8F A;  5M3M G;  3S1Q B;  1E2Z A;  2F3V A;  1F9S A;  2PQA A;  2B39 A;  5JAV A;  4JI1 Q;  1FGB D;  2OQK A;  2NB0 A;  2RDF A;  3SK6 A;  3Q23 A;  4K14 A;  2F0N A;  1ICF B;  3V96 A;  1B9M A;  3RZD B;  3ULL A;  1CT1 D;  4A3C H;  4HMI A;  1K28 A;  1SYF A;  1A0I A;  1VF5 C;  1SMY C;  2LFN A;  1HNZ L;  1K8M A;  4K6D A;  3C3L A;  3D31 A;  1PH2 A;  1NBW A;  3BYY B;  1SEB D;  2NWG A;  5CYU A;  1PTO C;  4DK1 A;  4X65 Q;  2R93 H;  5JPN C;  3HOW B;  2Z6K A;  1TS3 A;  2F0J A;  3GP7 A;  2O2L D;  2WAQ B;  1N36 Q;  2VZA A;  1G6P A;  4IJH A;  1GUG A;  4K5X A;  3SK8 A;  3CF5 A;  1I4R A;  1O7Z A;  5K5P A;  4HIO A;  1CI3 M;  2SEB D;  2ZTC A;  1STY A;  1V1O A;  4IPC A;  1PH5 A;  1E24 A;  4S3S A;  4DPG A;  2MJ8 A;  4OX9 Q;  1QVF A;  3S1N B;  5LMN L;  1OXU A;  2M9V A;  4LF5 Q;  1KLG D;  1IXR A;  1RCV D;  4KY7 A;  3DM1 A;  1CSP A;  2L5T A;  2ZXP A;  4ABN A;  3MXU A;  5C5L A;  1SE8 A;  3HZX A;  3BG3 A;  3ERS X;  4DAV A;  3CPF A;  1OXX K;  3DXJ C;  4FXK C;  1CQV A;  1TWF B;  1QNU A;  4HID A;  2R7Z G;  2WB1 G;  1IKM A;  4CKC A;  3A54 A;  3S9W A;  3S16 H;  3SK4 A;  2F0M A;  1A63 A;  2XNA C;  5JVH 3;  4YWK A;  4DV4 L;  1JB3 A;  1CZG A;  1LTR D;  2Q8R E;  2B2U C;  3TRE A;  4KHV A;  4XT3 B;  1XNR Q;  1K3B C;  2Y0S G;  3BDC A;  2B2U A;  1EY8 A;  3V05 A;  5C4X H;  1LAC A;  2YTX A;  1CZW A;  1S5F D;  2WII B;  3ITP A;  3EBE A;  4A3C G;  2B63 G;  4ZUI A;  2HHH L;  4B3T L;  2A6H D;  3CQZ B;  2DNE A;  2IX1 A;  4WJ4 A;  1BCP C;  1KTK A;  3R2I A;  3BZK A;  1TS5 A;  1D5M C;  3K0X A;  1Q46 A;  1QB5 D;  3A74 A;  2JEB I;  2JQO A;  1K73 C;  2G9H D;  3KDF A;  1KNE A;  1IHZ A;  5M3F H;  2KHJ A;  4BBS G;  1V1P A;  1ZYR D;  4JOI A;  5JEA H;  2JA6 G;  1SE4 A;  5FLM H;  1KDA A;  1B50 A;  4A4I A;  3CC2 A;  1G2S A;  4ZQ3 A;  2JA8 G;  4CKB A;  1WD1 A;  3T53 B;  4C3I H;  2ALY B;  5FO8 B;  1QCB D;  5IYC G;  2JP1 A;  3GTK H;  1SNM A;  4HSP A;  4IPG A;  1ILP A;  1IYU A;  4QL5 A;  5IT9 E;  5IP9 G;  2D62 A;  2PI2 E;  4CHT B;  3V2T A;  1V1Q A;  1W6K A;  1R4P B;  1DD2 A;  4L5Q A;  4IFD G;  4L5S A;  1VQH A;  1E2W A;  3HOV B;  2KVM A;  4M8A A;  2F0G A;  2KJX A;  4BY7 H;  3G4S A;  3WOF A;  3ULP A;  3L3O C;  4MIU A;  4B9X A;  3PUZ A;  4OHJ A;  1D1K A;  3KF6 A;  2QCP X;  4OO1 I;  4EVO A;  2A74 C;  2PNR C;  3KFU A;  2WKD A;  2EYO A;  2PZW A;  5FO9 B;  4UHV A;  3T16 A;  2FHT A;  2HDL A;  2CCZ A;  3KYH C;  2VUM H;  1W2B A;  4KKU A;  4X65 L;  4FVM A;  3QB3 A;  2AKW B;  2BOS A;  3VDY A;  4JI7 L;  1N32 Q;  2K5V A;  3J80 i;  5CGK A;  4JI2 L;  1WJJ A;  4YIJ A;  3T1H Q;  4ME3 A;  3PIO 3;  3CXC A;  5DAU A;  1MHW C;  3HFZ B;  5IGF A;  3W3A A;  1JE5 A;  1H9K A;  4CKE A;  4LJZ C;  1D5Z C;  3KBX A;  3I55 A;  3A5U A;  3X3N A;  1NR4 A;  3PO2 G;  3RMH A;  5C44 H;  1LM0 A;  2ZTD A;  4XQJ A;  1X3Q A;  2DN8 A;  1SR3 A;  3CW2 C;  1JOK A;  1PFM A;  3S16 B;  4DV5 Q;  1PFS A;  5IP7 G;  4ZK9 B;  2VQE L;  2K28 A;  2NTT A;  2R61 A;  4HCE A;  2UUC Q;  2E74 C;  1ZXT A;  1J8I A;  5C4J H;  1VQD A;  1ML0 D;  1SMX A;  3NBI A;  3I4M H;  1LT5 D;  4HMJ A;  1Y8O B;  3GTK B;  4NXN L;  3R2T A;  3NWT A;  3SDZ A;  3AFP A;  3ZYY X;  2A6E D;  3JAM L;  2EJM A;  1IL8 A;  1YEZ A;  4OEM B;  2AQ3 B;  5IYD G;  3G7L A;  3IFD A;  2SNS A;  3LX0 A;  4N8X 1;  4CDD C;  1NE3 A;  1JWS D;  2EY5 A;  1I4P A;  1WCM G;  2AUK A;  3QWN A;  1EL0 A;  1EQR A;  1VF7 A;  2EYJ A;  5IWA L;  4ULL A;  3KF8 B;  3HKS A;  1ENC A;  4L8J A;  1CUK A;  4WFN 3;  1X3G A;  1ZEQ X;  3RUZ A;  5JJI A;  1I4X A;  1BKB A;  4A3D H;  3RZD H;  2J0T D;  4QIW E;  4A3E H;  5LMU Q;  5EPL A;  3H91 A;  2QEJ C;  3E0J A;  3L9A X;  3BDL A;  5LL6 S;  2F4V Q;  4IJL A;  4RCN A;  3HOZ H;  1O7Y A;  4NDX A;  1E0B A;  2A68 C;  3HRZ C;  1STG A;  4KN7 C;  1N34 L;  4AQY L;  1B9N A;  4DXG A;  1ESF A;  2I5L X;  2WAQ G;  3HGB A;  4Y7N B;  2IT1 A;  4A3D G;  1GUW A;  1Y1V G;  4OGQ C;  3J81 L;  3OWE B;  4KHP Q;  1FD7 D;  1GUS A;  4LFA Q;  2E2J H;  2L0C A;  1Q90 A;  1U0L A;  5D65 A;  4ZRZ A;  5K36 H;  2KOL A;  3PUW A;  3UE0 A;  1K83 B;  4G57 A;  1T5E A;  4CJ2 C;  1YIT A;  2KHS A;  4BS9 A;  4JI5 Q;  4R8N A;  4A3F G;  1L0X B;  3GDE A;  3HKZ G;  1G29 1;  3C2P A;  2L9H A;  2RHS B;  4LWC A;  4X64 Q;  1WTR A;  1J6Q A;  1G51 A;  1MSH A;  3NK9 A;  4QIW B;  2PMZ B;  2H5X A;  4DGZ A;  3I4M G;  5IGE A;  2CWA A;  1RTO A;  3I8Z A;  2PI2 A;  3J7Z C;  3K7A B;  1T9H A;  3J7A V;  2O5J C;  4L63 B;  3M9B A;  2R7Z B;  3A55 A;  1F9Q A;  5A35 A;  4OWT B;  5M9O A;  4CGY B;  1VQ9 A;  1H9J A;  1G2T A;  4F88 A;  5COY A;  5TSS A;  4KY5 A;  3GTP H;  2K5W A;  1WTO A;  2MNA A;  1AEX A;  2X6L A;  4WOR A;  4G7Z C;  2HCC A;  2MP1 A;  4C2M B;  1HTL D;  1WTP A;  2F0H A;  1I6H B;  4PZ6 A;  3URY A;  1UE1 A;  2KCM A;  5FK9 C;  5KYL A;  4C3J B;  2HQL A;  1XJV A;  1WOC A;  4LFA L;  3EN2 A;  4POG A;  4KHP L;  3AU7 A;  5IGC A;  2R6G A;  3GQB A;  4A3K G;  2QF7 A;  2KA7 A;  1OTC A;  2IX0 A;  2Z9H A;  2EYM A;  4JI6 Q;  1DZ1 A;  2NZH A;  4AYB B;  2VY3 A;  3DEO A;  5M5Y B;  1AW7 A;  3QR8 A;  2QDB A;  3GTM B;  4QMG A;  1S72 A;  5EKK A;  4A3G B;  2NVT H;  1VQB A;  1SN8 A;  1BCP D;  3HOZ G;  1EFI D;  4Z9C B;  1KAA A;  3PMF A;  1ASZ A;  2K33 A;  1A2U A;  3OTO L;  5BR8 Q;  3TP8 A;  2XIW A;  5A2Q E;  2B2W A;  2PZU A;  3KF6 B;  2VNU D;  3J81 c;  1KAW A;  4FDB A;  1EY4 A;  4DV2 Q;  3TRZ A;  1U4P A;  3HS0 C;  2K03 A;  1OO9 B;  5DLQ E;  3K5O A;  4DNR B;  3A8K E;  3CHB D;  3FVQ A;  4H02 A;  1VQN A;  3RNU A;  4X6A H;  2YTV A;  1Z9F A;  1WYD A;  3WOE A;  3EA6 A;  4PZ7 A;  2Q2I A;  4P75 A;  4PNY A;  1GVP A;  1EQV A;  1VCI A;  4IFD I;  1QVC A;  1FL0 A;  2E75 C;  4DK6 C;  4EQO A;  4JI0 Q;  1NCV A;  2PPB C;  3W2D A;  4JK1 C;  3J7A 5;  4UY8 C;  3E6Z X;  3G71 A;  2EOT A;  2VQF Q;  4BA1 I;  2XWB B;  4U68 A;  1YNJ C;  3HEJ A;  1L1O A;  3Q8D A;  2VB2 X;  4DNI A;  1VQE A;  4JOI C;  3TEH B;  1EFW A;  3HOU H;  1PLF A;  4KLK A;  3D4W A;  4DAM A;  2TSS A;  2BA1 A;  2IJ0 A;  3J81 i;  1BCP F;  4YWL A;  4HJ9 A;  4HR7 B;  2IHE A;  4X66 L;  5G3L F;  3JAM c;  1HNW Q;  1QG7 A;  1IL2 A;  2SOB A;  2EYH A;  2JSO A;  1EUJ A;  1HQR D;  5C4Z A;  1HJP A;  3CD6 A;  1I3Q B;  4A3B B;  1JB7 A;  4DAP A;  4NMZ A;  3GTP B;  5HGT A;  3S1N H;  5IGD A;  2XRQ D;  3PCO B;  4A3J G;  1I94 Q;  4NKL A;  2CKZ B;  1TU2 B;  2EQS A;  4A76 A;  1VQL A;  3E0E A;  3ND8 A;  1DYQ A;  2F0Q A;  4R8I A;  1IBM Q;  3M4O H;  4OO1 H;  3S2H H;  4K8I A;  3BS1 A;  1IZ6 A;  4WJW A;  4DV0 Q;  2EY1 A;  2ZM6 L;  1U4R A;  4B3R Q;  1GXD C;  3M3Y H;  4DAY B;  3QOL A;  1X55 A;  4YHH L;  2HQE A;  3DHQ A;  2PW5 A;  3KLR A;  3S14 B;  4JVZ A;  2JA7 B;  1NMF A;  2CHB D;  4IFD J;  1TR5 A;  4YCW A;  4IFD H;  2EVB A;  3PF5 A;  2R93 G;  1EY0 A;  4JI3 Q;  1FGU A;  4LF7 Q;  2Y0S B;  2EE1 A;  2RBM A;  1HFN A;  1YNX A;  3IRB A;  3M7G A;  1VMC A;  1JWU D;  2C35 B;  3ND9 A;  2WKC A;  4GLV B;  4C3I G;  4H0L C;  1TY0 A;  1YJN A;  3GTO H;  4Y7N H;  1Y8P B;  3RD4 A;  3J80 E;  2ICI A;  4A93 H;  4IAL A;  1X32 A;  2CFM A;  1KDB A;  1TQO A;  5FLM G;  1TVX A;  1JJG A;  2K01 A;  3K6O A;  4P2C B;  5IYC H;  3CC7 A;  1C8C A;  4LF4 Q;  2JK8 A;  3MVV A;  4YY3 Q;  4RGT A;  5CC4 A;  4QJF A;  4A3E B;  4A3I H;  4LMQ D;  2LKV A;  3NUC A;  2B63 H;  3PO3 B;  5I4D A;  3E9H A;  3GTL B;  3SVM A;  4GLA C;  4TSS A;  2PZT A;  1RJT A;  3VYT A;  5C0X J;  1F2L A;  1PYW D;  4DV2 L;  4V19 0;  1I4H A;  2JA9 A;  2K6A A;  4GN5 A;  2N3S A;  1LT4 D;  2N55 A;  3DEP A;  4UP7 A;  1X9N A;  2B8G A;  1PDQ A;  2P5Z X;  1KC8 C;  2FMC A;  4IPH A;  4FF1 A;  4NXM Q;  2R3Z A;  1WTQ A;  3GTJ B;  1K0S A;  1SNQ A;  1BDO A;  3MZ5 A;  1TS2 A;  3J81 j;  1SNP A;  3VR4 A;  1Z6H A;  3DM3 A;  1C48 A;  2O5I C;  3MFG A;  5FJ8 G;  1YNN D;  1BBW A;  3PQI A;  4H7B A;  3NEL A;  3KBG A;  3CCS A;  5C4J B;  2C5C A;  2GVB A;  4LF4 L;  3H0G G;  1XNQ Q;  4PQX A;  2B2Y A;  5E4X A;  3D0F A;  1Y69 U;  2E2D C;  1C7Y A;  2RCF A;  1O78 A;  4NB3 A;  5IYB G;  2PW7 A;  1PYB A;  1QUQ A;  5IOD A;  5C44 B;  2CQO A;  2RDG A;  2I46 A;  5IIF A;  4J1M A;  4AH6 A;  1IBL L;  4ODG A;  2QKI C;  3S1R B;  1Q3L A;  1G6Z A;  1L2F A;  1XPR A;  4XTC S;  1BF4 A;  4HCS A;  3T1Y L;  3OW7 A;  4GS3 A;  3CU7 A;  2BDN A;  3TP6 A;  1WTW A;  4GZY C;  3TP5 A;  2NBF A;  1HA6 A;  1ET6 A;  3MFY A;  5JPM C;  3ICE A;  1STA A;  2B3G A;  1AZP A;  3SEB A;  2EZV A;  4A3G G;  4IUT A;  1HQM C;  4TKO B;  4XDX A;  3H0G H;  4MTN A;  2Z8L A;  4AQY Q;  2XVS A;  1S5B D;  2MGS A;  4DR7 Q;  4X3K A;  2LSS A;  3H09 A;  2D2C C;  3OOC A;  4APV A;  1YVC A;  3I2Z A;  1SYE A;  3GTQ B;  4MZ9 A;  3CMA A;  4G7H C;  4DR6 L;  4YCU A;  5ELN A;  4K2L A;  1DON A;  3R8B A;  4JI4 Q;  1JT8 A;  2K75 A;  1KD1 C;  2ZXR A;  5GRO A;  2L1B A;  2CH4 A;  3TME A;  1XMO Q;  4FF2 A;  1M4V A;  3QOJ A;  2G9D A;  3WWV A;  1PMR A;  1R4Q B;  1CA6 A;  2ZXO A;  3A7L A;  1I5F A;  4DFA A;  1SJE D;  1H9R A;  4GNX C;  5C3E G;  4ZLT F;  3FEW X;  3PIP 3;  3KJP A;  4A3I G;  5C3E H;  3VR6 A;  3VR3 A;  2OWO A;  1A3U A;  1RDP D;  2X69 A;  1PTO H;  1K83 H;  2VL6 A;  4C1N K;  1PVO A;  5IOC A;  1SYC A;  3M4Y A;  4K6L A;  1H9S B;  2K32 A;  2IY5 B;  1IW7 D;  4AYB E;  3NTK A;  5ELE A;  1IW7 C;  4KHZ A;  2NZ1 D;  2YU9 H;  4AIM A;  3MXN B;  3T51 B;  1E2V A;  4LF9 L;  4HN7 A;  1N33 L;  4YY3 L;  1EY6 A;  1SE2 A;  1Y1V B;  1ET9 A;  2LY7 A;  1V43 A;  3SXH A;  1TWA B;  4R4I A;  4J6H A;  4A3M H;  1HR0 Q;  1QZH A;  3R3O A;  1RTN A;  3I90 A;  4DV1 L;  2UXC L;  1F77 A;  5LMU L;  3QO2 A;  3K8A A;  1TXY A;  2B29 A;  5ELD A;  1E22 A;  1PFB A;  1UAP A;  1HCZ A;  4RHR A;  2WB1 E;  4IUN A;  3HOX H;  3S17 B;  3BZD B;  3Q6S A;  1XTC D;  2F0V A;  4C1N I;  3ERQ A;  5JJK A;  1CK1 A;  3X3M A;  1EY5 A;  3HOW G;  5EPJ A;  3J7A F;  2JJQ A;  4C3J H;  4A3J B;  4A3J H;  5FLX L;  4EQN A;  1EU4 A;  1LTI D;  2CW0 C;  1YI2 A;  1U5K A;  4R9W A;  1BVS A;  3FKI H;  1WVL A;  1EU3 A;  2OF1 A;  2JA5 B;  4A75 A;  5HY6 A;  4X62 Q;  2UUB L;  4OO1 G;  3W5O A;  1HH2 P;  2UXB Q;  2C9O A;  5JEA J;  2XGT A;  3K7U C;  1UEB A;  1AE3 A;  3I4N G;  4JI1 L;  1YIJ A;  4IPD A;  5EQ0 A;  1HZ9 A;  1CHP D;  5NUC A;  3BZC A;  3T4A C;  1W6J A;  4JCV E;  3I7F A;  4H44 C;  2R7F A;  4KKS A;  1M90 C;  1YHA A;  1OXT A;  4O42 A;  1Z7T A;  2KEN A;  1I94 L;  3HOY H;  1V8Q A;  1EIH A;  2BDO A;  3LWE A;  1PTO D;  1CQF A;  2DJG C;  4L5T A;  4IQZ A;  4A3K B;  4C3H G;  3AFQ A;  4QF4 A;  1PFN A;  2B2T C;  4DR4 L;  2RSO A;  1MGS A;  2D5D A;  2UU9 L;  4I7Z C;  3T1H L;  3NP8 A;  1FJG L;  2F0E A;  3HG9 A;  1GHK A;  1Q8I A;  2J7Z A;  3MXN A;  5J1Z A;  1SYB A;  1VQA A;  4BY1 B;  4X3S A;  1B70 B;  4IUU A;  2B63 B;  1VMP A;  2E2H H;  2YV5 A;  3RZO B;  4WJ3 M;  3S17 H;  1E3P A;  4B3R L;  4UPA A;  1WI5 A;  1S5D D;  1SE3 A;  3A0J A;  2VQF L;  4DV6 Q;  4JBJ A;  4UDU C;  3F2D A;  1XMO L;  2EPB A;  1G8Z D;  4RGO S;  3QG1 A;  2KQ3 A;  3BVM A;  5GAG C;  2Z6K C;  2UUA Q;  2PYK A;  4JYA Q;  3OSO A;  4GKJ Q;  1PH7 A;  1BR9 A;  4DF7 A;  1HNX L;  2L15 A;  3TN2 A;  2JA8 B;  4O1N A;  1HNX Q;  2E5L Q;  2PO4 A;  1VQC A;  5CBE E;  3UDF A;  1KRS A;  4B3M L;  4FP5 D;  3VA7 A;  2ATW A;  2KCT A;  2B2V C;  1D6E C;  3OW2 A;  1TWF H;  2YTY A;  2Y0S E;  1A3V A;  4H13 C;  1PRT B;  1NR2 A;  4ME5 A;  4ZAI A;  1QWY A;  1O7L A;  4MN3 A;  2XWJ B;  1Q8K A;  4A3K H;  1B2T A;  3HOV G;  4DV7 L;  4BBR H;  1CA5 A;  1JOQ A;  5KEE A;  2PNH A;  2NZO A;  4IUP A;  5M3F B;  2I07 B;  2AQ1 B;  3S2D H;  3NQI A;  3QIA A;  3TP7 A;  4B3S Q;  5FKA C;  2WFW A;  3OIQ A;  2A6H C;  1Y1W G;  4EGV A;  2RHQ B;  3LNN A;  2Z4I A;  4JG2 A;  1L1O C;  4LF8 L;  4NW2 A;  4RMF A;  3CKI B;  5C4X B;  1Q7Y C;  2V1C C;  3NEN A;  1QIL A;  5KNB A;  3GTJ H;  2A5H A;  4DA2 A;  1WD0 A;  4V0B A;  2R92 H;  3UDX A;  5I6W A;  4DU9 A;  4JBW A;  4KMU C;  3W1G A;  1GM5 A;  1EIG A;  4JPB W;  1AH9 A;  1MJE A;  4GOP B;  1RF2 D;  3C1F A;  5IWA Q;  1EYD A;  3K59 A;  1TS4 A;  4DV3 L;  2A6E C;  3PO3 H;  3IAY A;  2NTS A;  1PH9 A;  2ZJR A;  1D2B A;  3S2D B;  3CRL C;  4DN4 M;  1HZA A;  5EAY A;  2ZJP A;  3CCM A;  4X3T A;  2UXD Q;  4RKL A;  1G91 A;  4BY7 B;  4PMW A;  5JJZ A;  3U9S A;  1RIP A;  1WTV A;  4BBR B;  1X54 A;  4CDE C;  2WAQ E;  4TRD A;  2EYF A;  4QGU A;  1PH1 A;  1Y1V H;  4LFB Q;  5C3E B;  3CCR A;  4OIK A;  1A8V A;  2JA7 G;  1A6X A;  1CFM A;  1X3E A;  4NP5 A;  1JQY D;  1NY4 A;  1X6O A;  3BJU A;  1KXL A;  3A8I E;  1EY9 A;  1LTL A;  3FP9 A;  4K5V A;  1QZG A;  1DOK A;  3TBI B;  2EXZ A;  1F2Y A;  5EBD A;  3KLW A;  4PZ8 A;  1K9M C;  1BNZ A;  2Z6B A;  1T5X D;  3FPU B;  3MWY W;  3E9I A;  3FRP B;  5F2D A;  2GVA A;  2WP8 J;  4L6T B;  1L0W A;  2XTI A;  2K5Q A;  2AUJ D;  1EWI A;  1PH4 A;  1FJG Q;  1LTB D;  4N9T A;  3ZJY C;  1S5C D;  4ILW A;  3OHX C;  1CHQ D;  2A68 D;  1WCM H;  3OYY A;  4A3E G;  3M85 A;  5M5W H;  5CV5 A;  4GKJ L;  2DY7 A;  4HED A;  2O4X A;  3S24 A;  2UUA L;  5IYD H;  2I5M X;  4B08 A;  3CCL A;  2F0U A;  1M8A A;  1VQ4 A;  4UAI A;  4MHE A;  1HUM A;  4B3M Q;  3J7Y W;  4A3B H;  3CPW A;  3PUX A;  5EKI A;  2BH8 A;  2OXP A;  4DNT B;  4A93 B;  5BN5 A;  1EZ6 A;  2LS0 1;  2E8G A;  1I4Q A;  4K2K A;  3FHW A;  4F87 A;  1A62 A;  4OON A;  4DV1 Q;  3EQL C;  1Q1E A;  2VB3 X;  3KK7 A;  1II3 A;  3K5L A;  4LFC Q;  4GKK Q;  2M2L A;  5T1G A;  4IN3 A;  1C0A A;  1ROD A;  1DJR D;  1EYC A;  3R93 A;  2MQH A;  4Q5V A;  4KD3 A;  2A69 C;  4B3S L;  4YHH Q;  2HIX A;  3L2P A;  4QUC A;  1PH3 A;  3RN2 A;  4HTH A;  1P8L A;  4BA2 I;  3I4N H;  5C44 G;  3NTH A;  1Y1W H;  1MBY A;  1V9P A;  4JI3 L;  5AJ3 Q;  1C4Q A;  3S2H B;  3SHL A;  1JIC A;  3M4O B;  2N8N A;  4DV5 L;  5CMD A;  3FDT A;  5I9O A;  1LAB A;  5HUR A;  1O80 A;  2JA6 B;  2F52 A;  3GTL H;  5IY0 A;  3BDO A;  2KED A;  1KLU D;  3HOW H;  4KN4 C;  5CV9 A;  2FXQ A;  4OL7 A;  4R4Q A;  4FO2 A;  4GNX B;  2E5L L;  5ELO A;  3EFX D;  1B3Q A;  1E1O A;  1A2T A;  1CKN B;  1WTH A;  3PF4 A;  4PV1 C;  4IOC A;  3TS2 A;  5HGQ A;  3EJI A;  1NUC A;  2MO0 A;  1U4M A;  5IP9 H;  3PO2 B;  1Q12 A;  2F3I A;  4IUR A;  1B53 A;  1LTA D;  2UXD L;  2YYZ A;  4J15 A;  2IW3 A;  1IBL Q;  1VS0 A;  3ULJ A;  1BCP B;  4LF5 L;  4OWW B;  4RAU C;  5LMN Q;  1TWG H;  4G4K A;  2F0K A;  1SFO B;  4JI8 Q;  5FOB B;  1VQM A;  1AZQ A;  1XNQ L;  1IBM L;  4JI0 L;  4JV5 Q;  1Q81 C;  1U4L A;  4HIK A;  2K04 A;  1D1I A;  5AJ3 L;  3RZO H;  1FR3 A;  2E2H B;  3Q22 A;  2A69 D;  4OIJ A;  3PGZ A;  1VQJ A;  1WCM B;  3STB C;  5JEA G;  2JA6 H;  4BY1 H;  4JI6 L;  1MI2 A;  2ENB A;  5E1F A;  4JYA L;  5M3F G;  4JI8 L;  3K58 A;  4KTA A;  3U50 C;  4EX5 A;  4DR2 Q;  4GN3 B;  4O0A A;  1TY2 A;  1B7Y B;  5EKL A;  5J39 A;  3KUP A;  1PV4 A;  2Q2U A;  1IKL A;  2UUB Q;  3H3V I;  1R9T B;  1FNW A;  4XQN A;  3HP3 A;  4OWX B;  2VW9 A;  3GTG H;  3H3V C;  2V4D A;  1TWC H;  5C3W A;  1Z47 A;  2F0O A;  3A7A B;  5C4X G;  1WFQ A;  2R7Z H;  4FYD A;  3SR1 A;  3I4O A;  4LF7 L;  5IGG A;  4BXX H;  4KKT A;  4DUZ L;  2XSC A;  3SE0 A;  5FLX c;  3MAQ A;  3VYS A;  1GHJ A;  1AFP A;  2B2V A;  2LXJ A;  3D8G A;  3K81 C;  5T1I A;  1LYL A;  3C46 A;  4GKK L;  2EY6 A;  4LFC L;  1EIF A;  4A3G H;  1XMQ L;  1SBB B;  3BVZ A;  3PO2 H;  2I5H A;  3I56 A;  3G6E A;  2F03 A;  1HR0 L;  1YJW A;  3NXW A;  3MEF A;  5M5Y H;  3S1R H;  5CBA E;  2KBN A;  4I7A A;  3E3X A;  5FO7 B;  1YZ6 A;  1ASY A;  2RSN A;  4J8Q A;  2ES2 A;  5C0X I;  1XTD A;  4CJ0 B;  2R92 B;  2PQA B;  2N88 A;  4IOA A;  1EYG A;  2GA4 B;  1K3R A;  1BBU A;  4DR6 Q;  2Z0S A;  2ASB A;  5IYB H;  1SJH D;  4A3F B;  1ZKO A;  3J81 E;  4C56 C;  3OIP A;  2NVQ H;  2JE6 I;  3OPO A;  3CCE A;  2VUM G;  4FF4 A;  4GN4 B;  3A5Z B;  3NEM A;  1KRT A;  1LT6 D;  4K5W A;  4XYQ A;  3NE5 B;  4JW0 A;  5IT9 L;  2AQ2 B;  4DR2 L;  4R4C A;  3TSS A;  3A56 A;  1LT3 D;  5EBC A;  2E76 C;  2QIL A;  1J5E L;  1JJ2 A;  5FJ8 H;  1HFG A;  4DV3 Q;  2D0O A;  4X66 Q;  3GTG B;  2G5D A;  2NN6 I;  2F0S A;  4EQ5 A;  3E5S A;  1PRT D;  5ELF A;  1GD7 A;  3PV0 A;  3FPP A;  4F8M A;  1SRO A;  1LTT D;  2K52 A;  2K14 A;  1HTP A;  2F0P A;  4OXP A;  4RGM A;  2PMZ E;  4P73 A;  2YU9 B;  2VS1 A;  1XNR L;  4YCV A;  3PSI A;  2QDL A;  1AE2 A;  3P75 A;  4XIG S;  4BY1 G;  2IPK D;  3NQT A;  1SAP A;  1YJ9 A;  4DV4 Q;  1HR0 W;  2EJG C;  1KIX A;  2JA8 H;  3D4D A;  1SSO A;  1GKH A;  4C3I B;  2K1B A;  3NTI A;  3UDI A;  5E4W C;  2WV6 D;  2KCN A;  1SFO H;  2F1M A;  3HKZ B;  1EWC A;  1YHB A;  1FNU A;  1CM9 A;  2WIN B;  3DUZ A;  3H15 A;  3UE1 A;  3PUY A;  2Q8T A;  5M3M H;  3N52 A;  4FF3 A;  4P72 A;  2VXW A;  1OXS C;  1BO0 A;  4DR7 L;  4LW1 A;  1HZC A;  3I73 A;  2EIF A;  4A93 G;  2JEA I;  4P74 A;  3K5N A;  2QA4 A;  2MHV A;  1BUV T;  1EEF D;  3VYR A;  4DKA C;  5DM6 3;  2F4V L;  3HOZ B;  3P20 A;  2FIN B;  4ZYS A;  1K8G A;  4HJ7 A;  2PQE A;  5G3L D;  1B1Z A;  5GAH C;  1GJX A;  4KD4 A;  3CCU A;  4C2M H;  3G48 A;  1LTS D;  5IE8 A;  2Z1C A;  1PA6 A;  1KQS A;  1BBX C;  3I4L A;  3F2B A;  1BQQ T;  3NSW A;  5DEH A;  3PUV A;  2DJF C;  1E7Z A;  1I6V C;  3IKJ A;  5M5X H;  2OQ0 A;  4X64 L;  1VQ7 A;  1XXG A;  3SGI A;  1JMC A;  1C9O A;  2UXB L;  4X3U A;  5ISR A;  2KUM A;  4RHS A;  1Y8N B;  1XMQ Q;  3NBH A;  4FXG C;  5I2Y A;  3S15 H;  4LAA A;  1PZI D;  4HAE A;  4BWG B;  4GOP A;  4DUZ Q;  3U4V A;  3GV6 A;  1B3A A;  1B8A A;  5KYI A;  5H1S E;  1N32 L;  5J3B A;  1I3Q H;  1QJO A;  4DV0 L;  2KHI A;  5EJW A;  2L55 A;  4GNX A;  5LHY 1;  3K80 C;  3VA5 A;  1ENF A;  4XYO A;  5ELB A;  1ILQ A;  4BXX G;  5KGU A;  4QCL A;  3MA2 B;  4CBV A;  1LTG D;  1EIY B;  4GLX A;  3KJO A;  2L4N A;  3OMC A;  1N8R C;  4XT1 B;  4KJO A;  1NMG A;  2OCE A;  1JJC B;  5A2Q L;  1UE7 A;  1VQ6 A;  1H9M A;  2QEX A;  1EZ8 A;  3TZU A;  1XPU A;  1VDZ A;  1MIU A;  3FKI B;  2KEC A;  1IBK Q;  2JA5 H;  3TQY A;  4A3B G;  2E2J B;  1JR0 D;  2K7V A;  2BH2 A;  2IWH A;  4MNO A;  2D0P A;  1S5E D;  2QGQ A;  4RCO A;  4A3M B;  1J9O A;  1SDF A;  1MKH A;  2ZJQ A;  1MD2 D;  2MUY A;  3CME A;  2FFK B;  1GUN A;  1XWE A;  1E1T A;  3OTO Q;  2DGY A;  5BN3 A;  1CSQ A;  3NWS A;  4K8J A;  1EQQ A;  1IYJ B;  2JXM B;  4IUV A;  1LLR D;  4JI7 Q;  3H3V H;  4RGN A;  3IL8 A;  1CKN A;  3GD7 A;  1NTG A;  1VQF A;  4A3D B;  2Q2T A;  3U4Z A;  5KND A;  3GTO B;  2H4O A;  2UXC Q;  1AN8 A;  3UDG A;  1RD9 D;  1P16 A;  5DM7 3;  4RKB A;  3D6C A;  1SXT A;  2CVR A;  2EXD A;  1EWH A;  3CCJ A;  1STH A;  1UUP A;  2JA7 H;  1SMY D;  4I65 A;  3K57 A;  1JOR A;  3WDN A;  2A73 B;  2CWP A;  5CV6 A;  5I2X A;  4QQB X;  3I4M B;  3MHB A;  3MEH A;  2Z4H A;  2BE5 D;  2FMM A;  1X3P A;  1N34 Q;  3TS0 A;  3S15 B;  2ID0 A;  3J80 L;  2X6G A;  2F0W A;  1EEI D;  2CH4 W;  4ZUJ A;  3PO3 G;  1HNW L;  1CKO A;  1SYD A;  2NVQ B;  1TWH H;  1NJI C;  5L37 A;  5M5X B;  1CTM A;  4LF6 L;  3L7Z C;  2VUM B;  4ID6 A;  2BA0 A;  3BU2 A;  2K5H A;  1ONL A;  3BYT B;  2R93 B;  2AWN A;  3STB D;  2AHO B;  4DAY A;  2L12 A;  2K50 A;  5DNF A;  3KOJ A;  1VQ8 A;  4JBK A;  3PIO A;  3D3R A;  4A3L H;  1Q86 C;  2WB1 B;  1F9R A;  1VQP A;  3VR5 A;  3ERO A;  4HSV A;  1ESR A;  3HOY B;  4DV7 Q;  3H94 A;  2RA4 A;  2LMC B;  2XN9 C;  4LUV A;  3N6R A;  1LO5 D;  4DUY L;  3BVG A;  1SNC A;  4XQQ A;  3HKZ E;  3OMG A;  2F0F A;  1HXY D;  1GUO A;  3CP0 A;  4P71 A;  5LL6 X;  2LXK A;  4X62 L;  3LWU A;  4N9P A;  2N49 A;  1KL9 A;  4IUQ A;  4IO9 A;  1DXM A;  3TZD A;  1EQT A;  3P1H A;  5D3D A;  2F0I A;  3MTS A;  1YHQ A;  2UU9 Q;  3AB9 A;  3HOV H;  4KJN A;  1TII D;  5GAD C;  2MPM A;  5KNC A;  5JOB A;  5C3X A;  5C0X H;  4HIM A;  1B44 D;  3PIP A;  2EYP A;  1NNX A;  4DV6 L;  3I72 A;  2B2Y C;  2CW0 D;  5FLX E;  2A8V A;  2D9U A;  2N78 A;  4O2D A;  2F0D A;  1EOT A;  4JI5 L;  4Y52 H;  1HZB A;  5E3F A;  4LF8 Q;  4LUZ A;  3AYH B;  3CRK C;  4FXD A;  4JI4 L;  2ZT9 C;  3JAM E;  3HOX B;  3GTQ H;  2VQE Q;  2NN6 G;  1XX8 A;  4DR1 Q;  3TDQ A;  4G7O C;  3H6M A;  4LFB L;  5CV7 A;  3UI2 A;  1I4G A;  1UWV A;  1HNZ Q;  1D8L A;  2H1E A;  4JC0 A;  4EQP A;  4LNQ A;  1TWG B;  1S40 A;  4M1U B;  3T1Y Q;  2E2I B;  2R7D A;  5KRU A;  1HHV A;  1TWA H;  2NN6 H;  4ZKB B;  1STE A;  1NSN S;  3H0G B;  1WTX A;  2CQA A;  4MTK A;  3KLS A;  5KIX A;  1FNV A;  2L11 A;  2HIV A;  3DLL A;  3U9O A;  3JC6 6;  2NVT B;  2KCC A;  3SK5 A;  2ZM6 Q;  3RLF A;  5M3M B;  2JN4 A;  4HJA A;  1I50 H;  5BR8 L;  1YNJ D;  3D6W A;  4ALP A;  1PYS B;  2B2T A;  2DUD A;  1UE5 A;  5J22 A;  2F0T A;  2UUC L;  5C0X G;  1PH8 A;  1OXV A;  1MJC A;  4DR3 Q;  1RKN A;  3ONA B;  5COR A;  2RF4 A;  3AMU A;  3K0Y A;  2MO1 A;  3F2U A;  1SRU A;  1LUZ A;  1Q82 C;  1RHP A;  3QJY A;  1LV9 A;  3KDF B;  2Q2H A;  1V1P B;  4DK3 C;  2HT1 A;  2DY8 A;  5E7N A;  1EYA A;  4K0K Q;  4NXM L;  4DR3 L;  2XRS D;  2SDF A;  1EOV A;  4LUO A;  2BCO A;  3DWA A;  3M4Q A;  4Q0F A;  1L1O B;  1JE4 A;  1UEA B;  2A1A A;  1NAP A;  1U9R A;  5BN4 A;  3MXG A;  3F8T A;  1Y1W B;  1PRT F;  4HJ8 A;  3J80 c;  4CJ1 B;  1J5E Q;  4A3L G;  1TWC B;  1MSG A;  2JYO A;  1X65 A;  3W1B A;  1KNA A;  1HUN A;  2B2W C;  5IT9 c;  2RKS A;  5I9P A;  4RH6 A;  1DGS A;  2R92 G;  2F3W A;  4RA8 A;  1W3S A;  1STB A;  1VQG A;  2I0Q A;  1DOM A;  3F2C A;  4POF A;  4DUY Q;  1ICW A;  1F2M A;  1ENA A;  4DR4 Q;  1VQI A;  5JVG 3;  3FKI G;  1GOZ A;  4KI0 A;  1F2Z A;  2NVX H;  3C1E A;  4DR1 L;  3NBH B;  4A3F H;  2OTJ A;  1XPO A;  2RDH A;  3RLO A;  1PRT C;  1N33 Q;  4IZ8 A;  5D14 A;  4A3I B;  1A15 A;  1IYV A;  2HHH Q;  4B3T Q;  2HCI A;  5K36 G;  4JV5 L;  2KEE A;  4FNF A;  3S1Q H;  1A3T A;  2A19 A;  1HRJ A;  4JI2 Q;  3K5M A;  2K4K A;  3T13 A;  1N9W A;  1I50 B;  4BY7 G;  1F9P A;  4BBR G;  1PHJ A;  1QVG A;  1M1K C;  3L0O A;  4LK1 C;  4E6I A;  1FVI A;  1D7Q A;  2NVY H;  3U58 A;  4JBM A;  4ZKC B;  1X3F A;  1GUT A;  5I6Y A;  4R4O A;  3LGJ A;  3ER0 A;  1PTO F;  2OT2 A;  4UP9 A;  4NPS A;  4OX9 L;  3MXP A;  1PTO B;  1HPC A;  1ZYR C;  3B6Y A;  5EPK A;  2PCF B;  1PZJ D;  1D5X C;  1PZK D;  3DMU A;  4KV6 A;  1SNO A;  4HJ5 A;  5ELC A;  2NUC A;  4C3H B;  2J4X A;  1QUQ B;  3I91 A;  2HD3 A;  1GO3 E;  2ICE C;  2EY2 A;  3S1M B;  5CR3 A;  3EIV A;  1AP0 A;  3IFT A;  4DK0 A;  4F7X A;  1QOH A;  1TKW B;  5EGT A;  3RLN A;  4DXF A;  4BBS H;  4BBS B;  2NVX B;  3CQZ H;  4R1J A;  2JA5 G;  3KLS X;  1N36 L;  4L5R C;  2RCN A;  3S1M H;  1K8O A;  1SND A; 
#chains in the Genus database with same CATH homology
 2FJ2 A;  1KDC A;  3NPP A;  3VR2 A;  2SNM A;  3M7N A;  3KF8 A;  3Q0A A;  1JC7 A;  5C6A A;  1TT2 A;  3I4N B;  1FYC A;  3T56 B;  1BXT A;  3FMC A;  1SYG A;  1QNK A;  2AWO A;  2DNC A;  5C4H A;  2M00 A;  2BE5 C;  3VYU A;  1HA5 A;  2NVY B;  4KK7 A;  5IGB A;  1QE6 A;  2EYL A;  2F4I A;  1B4O A;  1DM0 B;  1DOL A;  4WRD A;  1JOO A;  3GV3 A;  3DWQ A;  2RVL A;  3P7J A;  3G6J B;  3NHH A;  3GO5 A;  1YNN C;  2RQX A;  4RWS C;  4RFB A;  2TMP A;  2K05 A;  3Q24 A;  5CV8 A;  1JCK B;  3OWF A;  2IL8 A;  3A8J E;  3I70 A;  1STN A;  2HDM A;  3M3Y B;  4C3J G;  1TWH B;  1DCZ A;  2K5D A;  4KY6 A;  3EVQ A;  5M5W B;  1KAB A;  4TQU S;  1Q1B A;  1UNS A;  4U67 3;  1XYI A;  3D4R A;  2OEO A;  3O13 A;  2NYZ D;  5AFW A;  1H9S A;  4PMB A;  1EY7 A;  2EJF C;  1S4Z A;  2WAC A;  5C5M A;  1JWM D;  1BOS A;  4B9W A;  1PXU A;  2HUG A;  1L0Y B;  3DWP A;  2EDG A;  2F0L A;  3HOU B;  3I3C A;  5CV4 A;  2IX3 A;  5D3I B;  4QB4 A;  3MC0 B;  4PMC A;  4XXE A;  2Q8I B;  4QUF A;  2B8F A;  3S1Q B;  1E2Z A;  2F3V A;  1F9S A;  2B39 A;  5JAV A;  1FGB D;  2NB0 A;  2RDF A;  3SK6 A;  3Q23 A;  4K14 A;  2F0N A;  3V96 A;  1B9M A;  3RZD B;  1CT1 D;  4HMI A;  1SYF A;  1VF5 C;  1SMY C;  2LFN A;  1K8M A;  4K6D A;  3C3L A;  3D31 A;  3BYY B;  1SEB D;  2NWG A;  5CYU A;  1PTO C;  4DK1 A;  5JPN C;  3HOW B;  1TS3 A;  2F0J A;  3GP7 A;  2O2L D;  2WAQ B;  1GUG A;  4K5X A;  3SK8 A;  1I4R A;  1O7Z A;  5K5P A;  1CI3 M;  2SEB D;  1STY A;  1V1O A;  4S3S A;  2MJ8 A;  3S1N B;  1OXU A;  2M9V A;  1KLG D;  1RCV D;  4KY7 A;  3DM1 A;  2L5T A;  2ZXP A;  4ABN A;  3MXU A;  5C5L A;  3HZX A;  3BG3 A;  4DAV A;  1OXX K;  3DXJ C;  4FXK C;  1CQV A;  1TWF B;  1QNU A;  1IKM A;  4CKC A;  3A54 A;  3S9W A;  3SK4 A;  2F0M A;  2XNA C;  5JVH 3;  1JB3 A;  1CZG A;  1LTR D;  2Q8R E;  2B2U C;  4KHV A;  4XT3 B;  3BDC A;  2B2U A;  1EY8 A;  3V05 A;  1LAC A;  1CZW A;  1S5F D;  2WII B;  3ITP A;  4ZUI A;  2A6H D;  3CQZ B;  2DNE A;  2IX1 A;  1BCP C;  1KTK A;  3R2I A;  1TS5 A;  1D5M C;  1QB5 D;  2JEB I;  2G9H D;  1KNE A;  1IHZ A;  1V1P A;  1ZYR D;  5JEA H;  1SE4 A;  1KDA A;  1B50 A;  1G2S A;  4ZQ3 A;  4CKB A;  1WD1 A;  3T53 B;  5FO8 B;  1QCB D;  2JP1 A;  1SNM A;  4HSP A;  1ILP A;  1IYU A;  5IT9 E;  2D62 A;  4CHT B;  3V2T A;  1W6K A;  1R4P B;  1DD2 A;  4IFD G;  1E2W A;  3HOV B;  2KVM A;  4M8A A;  2F0G A;  2KJX A;  3WOF A;  3L3O C;  4MIU A;  4B9X A;  3PUZ A;  4OHJ A;  1D1K A;  2QCP X;  4OO1 I;  4EVO A;  2A74 C;  2PNR C;  2WKD A;  2EYO A;  2PZW A;  5FO9 B;  3T16 A;  2FHT A;  2HDL A;  4KKU A;  4FVM A;  3QB3 A;  2BOS A;  5CGK A;  4YIJ A;  3PIO 3;  5DAU A;  5IGF A;  3W3A A;  1H9K A;  4CKE A;  4LJZ C;  1D5Z C;  3KBX A;  3X3N A;  1NR4 A;  3RMH A;  4XQJ A;  1X3Q A;  2DN8 A;  1JOK A;  1PFM A;  3S16 B;  4ZK9 B;  2K28 A;  2NTT A;  2R61 A;  4HCE A;  2E74 C;  1ZXT A;  1J8I A;  1ML0 D;  3NBI A;  1LT5 D;  4HMJ A;  1Y8O B;  3GTK B;  3R2T A;  3NWT A;  3SDZ A;  3ZYY X;  3JAM L;  2A6E D;  2EJM A;  1IL8 A;  2AQ3 B;  3G7L A;  3IFD A;  2SNS A;  3LX0 A;  1JWS D;  2EY5 A;  1I4P A;  1EL0 A;  2AUK A;  3QWN A;  1VF7 A;  2EYJ A;  4ULL A;  1ENC A;  4L8J A;  4WFN 3;  1ZEQ X;  3RUZ A;  1I4X A;  2J0T D;  5EPL A;  3H91 A;  2QEJ C;  3E0J A;  3L9A X;  3BDL A;  5LL6 S;  4RCN A;  1O7Y A;  4NDX A;  1E0B A;  2A68 C;  3HRZ C;  1STG A;  4KN7 C;  1B9N A;  4DXG A;  1ESF A;  3HGB A;  4Y7N B;  2IT1 A;  1GUW A;  3J81 L;  4OGQ C;  3OWE B;  1FD7 D;  1GUS A;  2L0C A;  1Q90 A;  5D65 A;  4ZRZ A;  5K36 H;  2KOL A;  3PUW A;  1K83 B;  4G57 A;  1T5E A;  4CJ2 C;  2KHS A;  4BS9 A;  4R8N A;  1L0X B;  1G29 1;  3C2P A;  2L9H A;  1WTR A;  1MSH A;  3NK9 A;  4QIW B;  2PMZ B;  4DGZ A;  5IGE A;  1RTO A;  3I8Z A;  3J7A V;  3K7A B;  2O5J C;  4L63 B;  2R7Z B;  3A55 A;  1F9Q A;  5A35 A;  5M9O A;  4CGY B;  1H9J A;  1G2T A;  4F88 A;  5COY A;  5TSS A;  4KY5 A;  2K5W A;  1WTO A;  1AEX A;  2X6L A;  4WOR A;  4G7Z C;  2HCC A;  2MP1 A;  4C2M B;  1HTL D;  1WTP A;  2F0H A;  1I6H B;  3URY A;  5FK9 C;  5KYL A;  4C3J B;  3AU7 A;  5IGC A;  2R6G A;  3GQB A;  2QF7 A;  2KA7 A;  2IX0 A;  2EYM A;  1DZ1 A;  4AYB B;  3DEO A;  5M5Y B;  1AW7 A;  2QDB A;  3GTM B;  4QMG A;  5EKK A;  4A3G B;  1BCP D;  1EFI D;  4Z9C B;  1KAA A;  3PMF A;  2K33 A;  1A2U A;  3TP8 A;  2XIW A;  5A2Q E;  2B2W A;  2PZU A;  2VNU D;  1EY4 A;  1U4P A;  3HS0 C;  2K03 A;  1OO9 B;  3K5O A;  4DNR B;  3A8K E;  3CHB D;  3FVQ A;  3WOE A;  3EA6 A;  4PNY A;  1EQV A;  1VCI A;  4IFD I;  2E75 C;  4EQO A;  1NCV A;  2PPB C;  3W2D A;  4JK1 C;  3E6Z X;  2EOT A;  4BA1 I;  2XWB B;  4U68 A;  1YNJ C;  3HEJ A;  2VB2 X;  1PLF A;  3D4W A;  2TSS A;  2BA1 A;  2IJ0 A;  1BCP F;  4HR7 B;  5G3L F;  1QG7 A;  2SOB A;  2EYH A;  2JSO A;  1HQR D;  5C4Z A;  1I3Q B;  4A3B B;  4DAP A;  4NMZ A;  3GTP B;  5HGT A;  5IGD A;  2XRQ D;  4NKL A;  1TU2 B;  3ND8 A;  1DYQ A;  2F0Q A;  4R8I A;  4OO1 H;  4K8I A;  3BS1 A;  4WJW A;  2EY1 A;  1U4R A;  1GXD C;  3QOL A;  2HQE A;  3DHQ A;  2PW5 A;  3KLR A;  3S14 B;  2JA7 B;  2CHB D;  4IFD J;  1TR5 A;  4IFD H;  2EVB A;  1EY0 A;  2Y0S B;  2EE1 A;  2RBM A;  1HFN A;  3M7G A;  1VMC A;  1JWU D;  3ND9 A;  2WKC A;  4C3I G;  4H0L C;  1TY0 A;  1Y8P B;  3RD4 A;  3J80 E;  2ICI A;  4IAL A;  1X32 A;  1KDB A;  1TQO A;  1TVX A;  2K01 A;  3K6O A;  4P2C B;  1C8C A;  3MVV A;  4RGT A;  5CC4 A;  4A3E B;  4LMQ D;  2LKV A;  3NUC A;  3PO3 B;  5I4D A;  3GTL B;  3SVM A;  4TSS A;  2PZT A;  1RJT A;  3VYT A;  5C0X J;  1F2L A;  1PYW D;  4V19 0;  1I4H A;  2K6A A;  1LT4 D;  2N55 A;  3DEP A;  2B8G A;  1PDQ A;  2FMC A;  4FF1 A;  2R3Z A;  1WTQ A;  3GTJ B;  1SNQ A;  1BDO A;  3MZ5 A;  1TS2 A;  1SNP A;  3VR4 A;  1Z6H A;  1C48 A;  2O5I C;  3MFG A;  1YNN D;  4H7B A;  3KBG A;  5C4J B;  2C5C A;  4PQX A;  2B2Y A;  5E4X A;  1Y69 U;  2E2D C;  1O78 A;  2PW7 A;  5IOD A;  5C44 B;  2RDG A;  2I46 A;  5IIF A;  4J1M A;  4ODG A;  2QKI C;  3S1R B;  1Q3L A;  1G6Z A;  4XTC S;  1BF4 A;  4HCS A;  3OW7 A;  3CU7 A;  2BDN A;  3TP6 A;  1WTW A;  4GZY C;  3TP5 A;  2NBF A;  1HA6 A;  1ET6 A;  3MFY A;  5JPM C;  1STA A;  1AZP A;  3SEB A;  2EZV A;  4IUT A;  1HQM C;  4TKO B;  4XDX A;  2Z8L A;  2XVS A;  1S5B D;  2MGS A;  4X3K A;  3H09 A;  2D2C C;  3OOC A;  1SYE A;  3GTQ B;  4G7H C;  4K2L A;  1DON A;  3R8B A;  2ZXR A;  2L1B A;  3TME A;  4FF2 A;  1M4V A;  3QOJ A;  2G9D A;  1PMR A;  1R4Q B;  1CA6 A;  2ZXO A;  3A7L A;  4DFA A;  1SJE D;  1H9R A;  4ZLT F;  3FEW X;  3PIP 3;  3VR6 A;  3VR3 A;  1A3U A;  1RDP D;  2X69 A;  1PTO H;  4C1N K;  5IOC A;  1SYC A;  3M4Y A;  4K6L A;  1H9S B;  2K32 A;  1IW7 D;  3NTK A;  5ELE A;  1IW7 C;  4KHZ A;  2NZ1 D;  3T51 B;  1E2V A;  4HN7 A;  1EY6 A;  1SE2 A;  1Y1V B;  1ET9 A;  2LY7 A;  1V43 A;  3SXH A;  1TWA B;  4J6H A;  3R3O A;  1RTN A;  3I90 A;  1F77 A;  3QO2 A;  5ELD A;  1PFB A;  1UAP A;  1HCZ A;  4RHR A;  3S17 B;  4IUN A;  3BZD B;  3Q6S A;  1XTC D;  2F0V A;  4C1N I;  3ERQ A;  1CK1 A;  3X3M A;  1EY5 A;  5EPJ A;  3J7A F;  4A3J B;  5FLX L;  4EQN A;  1EU4 A;  1LTI D;  2CW0 C;  4R9W A;  2JA5 B;  1WVL A;  1EU3 A;  2OF1 A;  4OO1 G;  2C9O A;  5JEA J;  5EQ0 A;  1CHP D;  5NUC A;  3T4A C;  1W6J A;  4H44 C;  4KKS A;  4O42 A;  1OXT A;  1Z7T A;  1V8Q A;  1EIH A;  2BDO A;  3LWE A;  1PTO D;  1CQF A;  4IQZ A;  4A3K B;  4C3H G;  4QF4 A;  1PFN A;  2B2T C;  2RSO A;  1MGS A;  2D5D A;  4I7Z C;  3NP8 A;  2F0E A;  3HG9 A;  1GHK A;  1Q8I A;  2J7Z A;  3MXN A;  5J1Z A;  1SYB A;  4BY1 B;  4X3S A;  4IUU A;  2B63 B;  1VMP A;  3RZO B;  1S5D D;  1SE3 A;  4UDU C;  2EPB A;  1G8Z D;  4RGO S;  3QG1 A;  2KQ3 A;  3BVM A;  2PYK A;  3OSO A;  1BR9 A;  4DF7 A;  3TN2 A;  2JA8 B;  4O1N A;  2PO4 A;  5CBE E;  4FP5 D;  3VA7 A;  2B2V C;  1D6E C;  1A3V A;  4H13 C;  1PRT B;  1NR2 A;  4ME5 A;  4ZAI A;  1QWY A;  1O7L A;  4MN3 A;  2XWJ B;  1B2T A;  1CA5 A;  1JOQ A;  5KEE A;  4IUP A;  5M3F B;  2I07 B;  2AQ1 B;  3NQI A;  3QIA A;  3TP7 A;  5FKA C;  3OIQ A;  2A6H C;  4EGV A;  3LNN A;  2Z4I A;  4NW2 A;  3CKI B;  5C4X B;  1QIL A;  5KNB A;  2A5H A;  4DA2 A;  1WD0 A;  4V0B A;  5I6W A;  4DU9 A;  4JBW A;  4KMU C;  1EIG A;  1RF2 D;  3C1F A;  1EYD A;  3K59 A;  1TS4 A;  2A6E C;  3IAY A;  2NTS A;  1D2B A;  3S2D B;  3CRL C;  4DN4 M;  4X3T A;  4RKL A;  1G91 A;  4BY7 B;  4PMW A;  5JJZ A;  3U9S A;  1WTV A;  4BBR B;  4TRD A;  2EYF A;  5C3E B;  4OIK A;  1A6X A;  1CFM A;  4NP5 A;  1JQY D;  3A8I E;  1EY9 A;  4K5V A;  1DOK A;  3TBI B;  2EXZ A;  1F2Y A;  5EBD A;  1BNZ A;  1T5X D;  3FPU B;  3MWY W;  3FRP B;  5F2D A;  2WP8 J;  4L6T B;  2K5Q A;  2AUJ D;  1LTB D;  4N9T A;  1S5C D;  4ILW A;  3OHX C;  1CHQ D;  2A68 D;  3M85 A;  5CV5 A;  2DY7 A;  4HED A;  2O4X A;  4B08 A;  2F0U A;  1M8A A;  4UAI A;  4MHE A;  1HUM A;  3J7Y W;  3PUX A;  5EKI A;  2OXP A;  4DNT B;  4A93 B;  5BN5 A;  1EZ6 A;  2LS0 1;  1I4Q A;  4K2K A;  4F87 A;  3EQL C;  1Q1E A;  2VB3 X;  3KK7 A;  1II3 A;  3K5L A;  2M2L A;  5T1G A;  4IN3 A;  1ROD A;  1DJR D;  1EYC A;  3R93 A;  4Q5V A;  4KD3 A;  2A69 C;  4QUC A;  4HTH A;  4BA2 I;  3NTH A;  1MBY A;  1C4Q A;  3S2H B;  3SHL A;  1JIC A;  3M4O B;  5CMD A;  3FDT A;  5I9O A;  1LAB A;  5HUR A;  1O80 A;  2JA6 B;  3BDO A;  2KED A;  1KLU D;  4KN4 C;  5CV9 A;  4OL7 A;  4FO2 A;  3EFX D;  1A2T A;  4PV1 C;  3EJI A;  1NUC A;  3PO2 B;  1U4M A;  1Q12 A;  4IUR A;  1B53 A;  1LTA D;  2YYZ A;  2IW3 A;  1BCP B;  4RAU C;  4G4K A;  2F0K A;  1SFO B;  5FOB B;  1AZQ A;  1U4L A;  2K04 A;  1D1I A;  1FR3 A;  2E2H B;  3Q22 A;  2A69 D;  4OIJ A;  1WCM B;  5JEA G;  1MI2 A;  2ENB A;  5E1F A;  3K58 A;  4KTA A;  1TY2 A;  5EKL A;  5J39 A;  3KUP A;  1IKL A;  1R9T B;  1FNW A;  4XQN A;  3HP3 A;  3H3V C;  2V4D A;  5C3W A;  1Z47 A;  2F0O A;  3A7A B;  4FYD A;  3SR1 A;  5IGG A;  4KKT A;  2XSC A;  3MAQ A;  3SE0 A;  3VYS A;  1GHJ A;  1AFP A;  2B2V A;  3D8G A;  3C46 A;  5T1I A;  2EY6 A;  1SBB B;  3BVZ A;  2F03 A;  3NXW A;  5CBA E;  5FO7 B;  2RSN A;  4J8Q A;  5C0X I;  4CJ0 B;  2R92 B;  2N88 A;  2GA4 B;  1SJH D;  4A3F B;  1ZKO A;  3J81 E;  4C56 C;  3OIP A;  2JE6 I;  3OPO A;  4FF4 A;  1LT6 D;  4K5W A;  4XYQ A;  3NE5 B;  5IT9 L;  2AQ2 B;  3TSS A;  3A56 A;  1LT3 D;  5EBC A;  2E76 C;  2QIL A;  1HFG A;  3GTG B;  2NN6 I;  2F0S A;  3E5S A;  1PRT D;  5ELF A;  3PV0 A;  3FPP A;  4F8M A;  1LTT D;  1HTP A;  2F0P A;  4RGM A;  2YU9 B;  4XIG S;  3P75 A;  2IPK D;  3NQT A;  1SAP A;  2EJG C;  3D4D A;  1SSO A;  4C3I B;  2K1B A;  3NTI A;  5E4W C;  2WV6 D;  2KCN A;  2F1M A;  3HKZ B;  1EWC A;  1FNU A;  1CM9 A;  2WIN B;  3DUZ A;  3PUY A;  2Q8T A;  3N52 A;  4FF3 A;  2VXW A;  1OXS C;  1BO0 A;  3I73 A;  2JEA I;  3K5N A;  2MHV A;  1BUV T;  1EEF D;  3VYR A;  5DM6 3;  3HOZ B;  3P20 A;  2FIN B;  4ZYS A;  2PQE A;  5G3L D;  1B1Z A;  1GJX A;  4KD4 A;  1LTS D;  2Z1C A;  1BBX C;  3I4L A;  1BQQ T;  3NSW A;  5DEH A;  3PUV A;  1I6V C;  3IKJ A;  1XXG A;  4X3U A;  5ISR A;  2KUM A;  4RHS A;  1Y8N B;  3NBH A;  4FXG C;  5I2Y A;  4LAA A;  1PZI D;  4HAE A;  4BWG B;  3GV6 A;  1B3A A;  5KYI A;  1QJO A;  5EJW A;  2L55 A;  5LHY 1;  3VA5 A;  1ENF A;  4XYO A;  5ELB A;  1ILQ A;  5KGU A;  4QCL A;  3MA2 B;  4CBV A;  1LTG D;  2L4N A;  3OMC A;  4XT1 B;  4KJO A;  5A2Q L;  1H9M A;  1EZ8 A;  3TZU A;  1VDZ A;  3FKI B;  2KEC A;  2E2J B;  1JR0 D;  2K7V A;  2IWH A;  1S5E D;  4RCO A;  4A3M B;  1J9O A;  1SDF A;  1MD2 D;  2MUY A;  2FFK B;  1GUN A;  1XWE A;  5BN3 A;  3NWS A;  4K8J A;  2JXM B;  4IUV A;  1LLR D;  4RGN A;  3GD7 A;  3IL8 A;  4A3D B;  5KND A;  3GTO B;  2H4O A;  1AN8 A;  1RD9 D;  5DM7 3;  4RKB A;  3D6C A;  1SXT A;  2CVR A;  1EWH A;  1STH A;  1UUP A;  1SMY D;  4I65 A;  3K57 A;  1JOR A;  3WDN A;  2A73 B;  5CV6 A;  5I2X A;  3I4M B;  3MHB A;  3MEH A;  2Z4H A;  2BE5 D;  2FMM A;  1X3P A;  3S15 B;  2ID0 A;  3J80 L;  2X6G A;  2F0W A;  1EEI D;  4ZUJ A;  1SYD A;  2NVQ B;  5M5X B;  1CTM A;  3L7Z C;  2VUM B;  4ID6 A;  2BA0 A;  1ONL A;  3BYT B;  2R93 B;  2AWN A;  4DAY A;  2L12 A;  5DNF A;  3D3R A;  2WB1 B;  1F9R A;  3VR5 A;  3ERO A;  4HSV A;  1ESR A;  3HOY B;  3H94 A;  2RA4 A;  2LMC B;  2XN9 C;  3N6R A;  1LO5 D;  3BVG A;  1SNC A;  4XQQ A;  3OMG A;  2F0F A;  1HXY D;  1GUO A;  5LL6 X;  3LWU A;  4N9P A;  4IUQ A;  1DXM A;  3TZD A;  1EQT A;  3P1H A;  5D3D A;  2F0I A;  3MTS A;  3AB9 A;  4KJN A;  1TII D;  2MPM A;  5KNC A;  5JOB A;  5C3X A;  5C0X H;  1B44 D;  2EYP A;  3I72 A;  2B2Y C;  2CW0 D;  5FLX E;  2D9U A;  2F0D A;  1EOT A;  5E3F A;  3CRK C;  4FXD A;  2ZT9 C;  3JAM E;  3HOX B;  2NN6 G;  1XX8 A;  3TDQ A;  4G7O C;  3H6M A;  5CV7 A;  3UI2 A;  1I4G A;  2H1E A;  4EQP A;  1TWG B;  4M1U B;  2E2I B;  5KRU A;  1HHV A;  2NN6 H;  4ZKB B;  1STE A;  1NSN S;  1WTX A;  3H0G B;  2CQA A;  3KLS A;  5KIX A;  1FNV A;  2L11 A;  3U9O A;  2NVT B;  2KCC A;  3SK5 A;  3RLF A;  5M3M B;  1YNJ D;  3D6W A;  2B2T A;  5J22 A;  2F0T A;  5C0X G;  1OXV A;  1RKN A;  3ONA B;  5COR A;  3AMU A;  3K0Y A;  3F2U A;  1RHP A;  3QJY A;  1LV9 A;  1V1P B;  2DY8 A;  1EYA A;  2XRS D;  2SDF A;  2BCO A;  3DWA A;  4Q0F A;  1JE4 A;  1UEA B;  1NAP A;  1U9R A;  5BN4 A;  3MXG A;  1Y1W B;  1PRT F;  4CJ1 B;  1TWC B;  1MSG A;  2JYO A;  1KNA A;  1HUN A;  2B2W C;  2RKS A;  5I9P A;  4RH6 A;  2F3W A;  4RA8 A;  1STB A;  1DOM A;  1ICW A;  1F2M A;  1ENA A;  5JVG 3;  1GOZ A;  4KI0 A;  1F2Z A;  3C1E A;  2RDH A;  1PRT C;  4IZ8 A;  5D14 A;  4A3I B;  1A15 A;  1IYV A;  2HCI A;  5K36 G;  2KEE A;  4FNF A;  1A3T A;  1HRJ A;  3K5M A;  3T13 A;  1I50 B;  1F9P A;  4LK1 C;  4E6I A;  4ZKC B;  5I6Y A;  1GUT A;  1PTO F;  2OT2 A;  3MXP A;  1PTO B;  1HPC A;  1ZYR C;  5EPK A;  2PCF B;  1PZJ D;  1D5X C;  1PZK D;  3DMU A;  4KV6 A;  1SNO A;  5ELC A;  2NUC A;  4C3H B;  2J4X A;  3I91 A;  2ICE C;  2EY2 A;  3S1M B;  5CR3 A;  1AP0 A;  3IFT A;  4DK0 A;  4F7X A;  1QOH A;  1TKW B;  5EGT A;  2NVX B;  4DXF A;  4BBS B;  3KLS X;  1K8O A;  1SND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...