4KY6A

Crystal structure of staphylococcal nuclease variant delta+phs l25d at ph 6 and cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKDMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25D at pH 6 and cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky6A00
1KABA 5I9PA 1SNQA 4QMGA 5CV4A 5KYLA 2F0EA 4MIUA 4DFAA 3EROA 1SYDA 2EY5A 4HTHA 1EZ6A 5I6WA 3QB3A 4ME5A 2F0IA 3TP6A 2PZTA 2SNMA 3ERQA 3MVVA 5F2DA 4B9WA 2EYOA 3EVQA 3NUCA 1U9RA 4NDXA 3P1HA 4K5WA 3RUZA 5KEEA 1A3UA 3VA5A 5IOCA 1EY7A 1STNA 3D4DA 1F2ZA 4K5VA 3P75A 4J6HA 2M00A 1EY5A 2F0FA 3HEJA 5CV8A 4DU9A 2EYHA 5IGDA 5EKKA 2QDBA 1EQVA 3ITPA 4K8JA 4ZUJA 1RKNA 3TP5A 4EQPA 5HGTA 4F8MA 1EY9A 4DGZA 4EVOA 1JOQA 3E5SA 5CC4A 3C1FA 3BDLA 4ZUIA 1KDCA 2PYKA 1EY0A 2F0DA 4NKLA 2LKVA 1SNPA 2PW5A 5CV5A 3MEHA 5JAVA 1JORA 3NHHA 4PNYA 5C5LA 1TR5A 2F0JA 2F0GA 1AEXA 3SHLA 1A2TA 1EYCA 3R3OA 4K8IA 2SOBA 2F3VA 2PZWA 4QB4A 4B9XA 4EQNA 5I9OA 4F7XA 2RKSA 3SXHA 4R8NA 2EYMA 2OEOA 1ENAA 4IALA 4IUNA 2EYFA 3D8GA 5J22A 4KV6A 1STAA 5I6YA 1TT2A 2F0OA 3DHQA 4WORA 5IGFA 1IHZA 4ODGA 5IGCA 4ID6A 3SK6A 2KQ3A 3EJIA 1SNDA 1JOOA 3TP7A 3SR1A 3QOLA 2F0HA 4DF7A 2PZUA 1EYAA 2EXZA 2NUCA 1TQOA 2EYLA 3SK5A 5C6AA 5J39A 1KDBA 5CGKA 3C1EA 3S9WA 4E6IA 4WRDA 5J1ZA 1JOKA 4K2KA 5NUCA 5C3XA 2EY6A 4LAAA 1NSNS 1SYGA 4QF4A 1KDAA 3TMEA 2PW7A 3OSOA 5C4ZA 4KJNA 4K14A 5CV6A 2F3WA 2F0MA 3NQTA 4IZ8A 5M9OA 5K5PA 2F0LA 3T16A 2EY1A 1A2UA 5C3WA 1F2MA 1SYCA 2EYJA 1F2YA 5CR3A 5IIFA 3H6MA 2KHSA 3OWFA 4KY7A 4RKLA 2WACA 3TP8A 3PMFA 3MZ5A 5ISRA 3QOJA 4G57A 1SNCA 4K5XA 2F0TA 5E3FA 2F0PA 3T13A 5KGUA 2F0KA 3OMGA 2PQEA 1EY4A 4KY5A 4NMZA 5IGEA 1STGA 1STYA 4HMIA 4KY6A 3LX0A 2RBMA 4J1MA 5CV7A 4KHVA 4S3SA 5KRUA 5KYIA 1EY6A 4KTAA 3V2TA 5EGTA 3BDCA 1STBA 2O4XA 4K2LA 1EYDA 5E1FA 2EYPA 3U9OA 4RKBA 4PMBA 1EZ8A 4ZQ3A 2F0SA 5HURA 5JOBA 5C5MA 4EQOA 2ENBA 2OXPA 1EY8A 1SYEA 3DMUA 3NP8A 3SK8A 5IGBA 2F0QA 4N9PA 2RDFA 5DEHA 4I65A 4PMCA 5IODA 4H7BA 3NK9A 1KAAA 4K6DA 4KD4A 1SNMA 3SK4A 2F0NA 5KIXA 1A3VA 5EKLA 2HQEA 4NP5A 3D4WA 4KD3A 5DAUA 2F0VA 1SNOA 1SYFA 4KJOA 1ENCA 4HMJA 3HZXA 4TRDA 3D6CA 3OMCA 5C4HA 1STHA 2EY2A 2F0UA 3MXPA 4N9TA 2SNSA 3MHBA 1SYBA 5CV9A 3NXWA 1NUCA 5IGGA 2OF1A 1A3TA 4OL7A 4YIJA 1II3A 2F0WA
chains in the Genus database with same CATH superfamily
1KABA 2WIIB 2F4VL 5E4WC 4JBKA 3CU7A 1PA6A 1VQNA 2QILA 2JEAI 1S4ZA 5C4XG 5IP7G 2O5IC 4O1NA 1M90C 1R9TH 2GVAA 5IOCA 1B3QA 3CCUA 2WFWA 1JJ2A 2OQKA 1PFBA 3CHBD 2M00A 2GVBA 1KL9A 3PUZA 5IGDA 4RMFA 2NVQB 3OWEB 1RKNA 2JA5G 3E5SA 1W3SA 5C3EH 3ZYYX 3OW2A 1YI2A 4NXMQ 2H1EA 2F0JA 1G6ZA 1QG7A 2A6EC 4IUPA 2FHTA 2HDMA 4LJZC 3SXHA 3S1QH 2OEOA 4OELB 4BWGB 3S15B 2RQXA 5TSSA 1PFSA 5JJKA 1HZAA 2PO4A 4R4IA 1FD7D 1PTOH 5DLQE 2NUCA 3FDTA 2R93H 1KNEA 1YHAA 4OO1I 1BOSA 2ALYB 2K28A 5BR8L 1LTGD 1VQFA 1Q8KA 3L2PA 2UXCQ 1LACA 2K50A 3S1MH 4OONA 3CXCA 2A69D 4FXKC 3H6MA 3KFUA 2G5DA 2M9VA 1Q86C 4NMZA 3G71A 4DF7A 3K80C 4HAEA 5KYIA 4S3SA 2DNCA 4JC0A 3FP9A 1LO5D 2CHBD 4KN4C 4UY8C 1I50H 4DAVA 5ELEA 3PF4A 5JOBA 1DZ1A 3CD6A 4RWSC 4OIKA 5CMDA 4NXNQ 2EQSA 2F4IA 2HIXA 1LV9A 5KIXA 1H9KA 1BO0A 3SGIA 4XQJA 4HMJA 4TRDA 4C1NK 4DUZQ 2A73B 2K05A 1CSQA 5CYUA 1G2SA 1NY4A 5J1ZA 1II3A 2D5DA 3DWQA 1K8OA 5KYLA 4DFAA 4CHTB 4JCVE 1VQAA 4DUYQ 4RGOS 4OO1G 4MN3A 3EVQA 3A74A 2OTJA 5KEEA 3RUZA 5C4JH 2XWBB 1EY7A 1JE4A 3PQIA 4KKTA 2E8GA 4X62Q 4V0BA 3KJPA 3SEBA 3U9SA 1FL0A 1O78A 2Z6KC 3FRPB 4LUOA 3ITPA 4DR5Q 1RD9D 1IL2A 2R7ZB 2PYKA 3BZCA 4A3GB 2Z6BA 3K59A 2OTLA 2IHFA 2IW3A 5ELFA 5AJ3L 1SBBB 3DLLA 1JORA 5HY6A 5BR8Q 1GXDC 4N8FA 3SHLA 1B7YB 1CTMA 2Z9HA 2KENA 3S1QB 4QQBX 4BY7B 3D8GA 2CFMA 2QCPX 4DN4M 1LTID 2NB0A 5IGCA 5GAEC 1YJNA 4QUFA 3SK6A 1IL8A 2K6AA 3HOVB 4AQYL 4I7ZC 1P16A 3K8AA 2H5XA 4BBRB 3CPWA 1B2TA 1HA6A 5GAGC 1Z47A 2ICIA 2K5NA 3QR8A 1HNZL 2VW9A 5C0XI 3LWEA 1VQ7A 3M85A 1ILPA 2BH2A 3UE0A 3GTQB 2TSSA 1S40A 2CQOA 3SVMA 3OWFA 2WACA 3K5LA 4DUYL 3FPPA 4H0LC 2F0TA 4YHHQ 2RSNA 1XYIA 4LF5Q 1HNXQ 4MTNA 1EY6A 1FGUA 1CKOA 1EFWA 2EDGA 4K2LA 1EYDA 4DNTB 1JQYD 1CKMA 1ILQA 2EJGC 4BS9A 4EQOA 2E2JH 5M5WB 2B2UA 1H9RA 1OXVA 3Q8DA 1KHIA 4EGVA 5M3FH 4KD4A 1PH2A 2D0PA 4YCVA 2HQEA 4HJ7A 4IOCA 1YIJA 3M9BA 4KD3A 1V1PA 5KNCA 3MAQA 4X66L 2LXKA 2EJFC 3GTJH 3GTPH 3HOWB 2BOSA 1U4MA 5EBDA 1N36Q 1STHA 2BA1A 4PZ6A 5CV9A 3NXWA 3K5NA 5EBCA 1JC7A 1H95A 4DV3L 1ML0D 3DXJC 1DOKA 1WD0A 3GP7A 2F0EA 1VQMA 3BJUA 3PO3B 3T4AC 2SNMA 3OIPA 1EIGA 1H9MA 3AB9A 5C0XG 5C4JB 3D4RA 1KQSA 3D4DA 2E5LL 3K7UC 4JVZA 2N8NA 3PUWA 4ZUJA 2MNAA 4NB3A 4ZKCB 4NKLA 4A3GH 4OO1H 4FF1A 1NE3A 1B9NA 2BDOA 3MEHA 2HCIA 1BF4A 5G3LD 3MXUA 4YCUA 2I0QA 5I2YA 1WD1A 1VQGA 2A6HC 3PIP3 3K5MA 1JB7A 2VY3A 1Q8IA 4F7XA 2RKSA 4POGA 1JWSD 1BBXC 4NPSA 1TY2A 4DUZL 2B2VA 4JI8Q 4B08A 2F3IA 1QVCA 1S72A 4OIJA 3EA6A 1B1ZA 1I3QB 1JOOA 1SNDA 4QL5A 3QOLA 4G7HC 1QZGA 1NMGA 5ELOA 1TQOA 4DV2L 2PCFB 3W3AA 1FJGQ 3BG3A 2NN6G 4L5RC 2E76C 3J81c 3ULJA 4K14A 1BKBA 2V1CC 3GTLB 3H0GB 3GTQH 5GADC 5C3WA 5JEAH 5JPNC 1GVPA 1Y8NB 2CVRA 4HEDA 4DR7Q 2B2YC 3D31A 2DNEA 3HRZC 1TS2A 4GN4B 5ISRA 5IT9c 3HOUH 2O5JC 2KUMA 3RZDB 3NSWA 1IYJB 3H91A 1BVSA 4J1MA 2JN4A 1BUVT 1QB5D 5JEAG 2A19A 3DM3A 4RG1A 1JB3A 3FVQA 2Q2HA 2KEEA 3QJYA 2AWOA 1F9RA 4A3FB 5M5WH 3CW2C 4P2CB 5FKAC 1VQ9A 2NVTB 2Q8TA 5L37A 4JI0Q 1PTOF 1TKWB 5M3FB 1O7ZA 1I4GA 4A3EH 4LMQD 3NEMA 1HH2P 2KEDA 3I4LA 1VCIA 3S17H 4GNXA 3HZXA 3GTJB 5EJWA 3GTPB 3OMCA 4IFDI 3A5ZB 3MXPA 2HCCA 1PMRA 4QY7A 1KTKA 1B4OA 1A8VA 4GKKQ 2PPBC 4DXFA 4A3KB 3PO3H 3B6YA 5M5YB 1WFQA 4ME5A 1GD7A 2F0IA 4DV5L 1HUMA 2IX3A 4JI5Q 1LTAD 3A8JE 1PH7A 1ZYRD 1RIPA 3V96A 1STNA 3I3CA 4X3KA 3KDFA 4DNRB 3G6EA 1SMYD 1QWYA 2OCEA 1EY9A 4DGZA 5IYCG 1N32L 2CQAA 3OHXC 4Z9CB 1SNPA 4C3JH 1SE3A 3RZOB 2X6LA 2NZOA 3K5OA 1PZID 1X3GA 3F2DA 2K5QA 4A3KG 1PHJA 4K8IA 1D1IA 4BBSB 4R8IA 2I5LX 1ENAA 5J22A 4LF4Q 1BQQT 3QIAA 1L0XB 1TT2A 4ZCKA 1L1OC 1GO3E 3CF5A 4KKSA 1IZ6A 3TP7A 2A6ED 1QVFA 4XT3B 1IBKQ 4C56C 1DGSA 4ULLA 3S1RB 5J39A 5EPLA 2VQEL 1PTOC 5CGKA 3S2DB 1EIFA 3J81L 1HFGA 4P74A 3M3YB 4KJNA 5FJ8G 3BVGA 2JA7H 3STBD 2L12A 1NNXA 3T16A 4LFAQ 2EY1A 4KHZA 4IPDA 2R92G 4L5SA 4IN3A 4DV6L 1U4PA 2X69A 2H4OA 1B50A 2B39A 1X54A 5IGEA 3VA7A 3L7ZC 5CV7A 3UI2A 5IYDG 3GTKH 1VQDA 3HOYH 1YZ6A 1STBA 1HCZA 4GS3A 5JEAJ 3T1HQ 1K3RA 4CGYB 4A75A 2MO0A 1VQPA 1JJCB 1TWFH 2MHVA 2NVXB 3BVMA 1W6JA 3H94A 1LTBD 4RH6A 1KLUD 4OX9L 3S17B 4CJ2C 2B2WA 1Q1BA 3KF8A 3FPUB 4R9WA 4IUTA 4GNXC 4OL7A 4XT1B 1LT4D 4DR6L 3MC0B 1EWIA 4JI7L 1D5XC 3EROA 1M1KC 5M5YH 3ERQA 1K0SA 5F2DA 1ENFA 4JOIA 1BNZA 1HNXL 3J80E 1WJJA 5GQOA 2B8GA 2X6GA 3P75A 2AWNA 3I4MB 1EU3A 4KHPQ 4GN5A 1H9SB 4EQPA 2AUJD 5FO9B 4EVOA 1G8ZD 3HOZG 3KF6A 1N8RC 1EQRA 4JI5L 2A69C 4DV2Q 3W1BA 3GO5A 3RD4A 4DR4Q 4HIKA 3P20A 3HFZB 3UE1A 3CC7A 4RHRA 4R8NA 1I4PA 2LS01 5GROA 3NTKA 2F0OA 1Y8PB 5FLXc 1GJXA 1JWUD 2UUCL 1L0WA 1ZEQX 1MBYA 3HOXH 4L5TA 4LWCA 2KCMA 1D5MC 1AW7A 4A3MG 3HOWG 1A62A 2VB2X 2QF7A 2JA7B 4X64Q 1JJGA 4KY7A 2KHSA 3TP8A 3TS0A 3HS0C 3QOJA 3MFGA 1Z9FA 2F0PA 1NR2A 4EQ5A 2F0KA 3OMGA 4Y7NH 2ICEC 2FMMA 3IL8A 2YTVA 1V8QA 1NBWA 1WCMB 3V05A 4PZ7A 4X66Q 3QO2A 1VF7A 2E2IB 2L1BA 1I5FA 3HGBA 4N9PA 1TWFB 1CHQD 4IO9A 1XNQQ 1G2TA 1XMOL 2UUAQ 2R93G 2RHSB 1KAAA 3VR2A 1EL0A 1R4PB 1QUQB 3KDFB 1WVLA 3CAMA 2F03A 5T1GA 5I4DA 4LF9L 3KJOA 5K36H 3HOZB 1ET6A 2N55A 3S2HB 2NN6I 4CDDC 4KLKA 1VQ4A 2NTTA 1UUPA 3G4SA 4PZ8A 1BCPC 3F8TA 3CCMA 1QILA 2YU9H 5EPJA 3CMEA 2WB1B 3MVVA 2ZM6L 2KJXA 1Q12A 4JPBW 1VMCA 2EYOA 3CMAA 1K8GA 2WAQE 3A56A 1EWCA 4DV1L 1L1OA 3VA5A 2VQFL 3CC2A 1AP0A 1HNWQ 1TWHB 1A0IA 2AHOB 5EKKA 1JOQA 3VYUA 5LMNL 2PQAA 1PDQA 4RGTA 4KN7C 1EFID 1QJOA 1KRTA 2R92B 1EYCA 1DJRD 2CH4W 4POFA 3PUYA 4R4QA 1XPUA 1OXTA 1TWGB 4IUNA 2D62A 1TIID 2EYFA 4BA2I 1AE2A 1CT1D 1HXYD 3K0YA 2GA4B 1WOCA 3S1NH 4I7AA 2ASBA 2BA0A 4ODGA 3ERSX 3OOCA 4DAMA 2Q2UA 4ID6A 2KQ3A 2KCCA 1NMFA 3I4OA 1PH5A 3KLSX 2V4DA 4JV5L 3SK5A 2ZJRA 1LUZA 2I5MX 2Z0SA 3HOXB 3BVZA 1CFMA 4A3JG 3F2CA 5LMNQ 3PF5A 2VB3X 3J80c 4JBMA 3M4PA 3HOVG 1S5DD 5IYCH 3I7FA 2JA8G 4JBWA 4XQQA 1F2LA 2MPMA 3NELA 4GOPB 3TRZA 1A6XA 1UE6A 3KOJA 2ATWA 2F0LA 4M1UB 1MJEA 2VQFQ 1EEFD 4DKAC 2G9DA 5CR3A 3E0EA 2K14A 1H9JA 3PMFA 1FVIA 5JJZA 3FKIG 5EKIA 2ZM6Q 4LF7L 4BXXH 3GDEA 4KK7A 3Q23A 2AMCB 3K58A 4B3TL 1W2BA 3KLWA 5A2QE 5FO7B 1SJHD 4KTAA 4YY3L 3ICEA 2NN6H 3M7NA 4A3DB 2JA8H 2O4XA 3KLRA 4QJFA 1I4HA 3I56A 1FGBD 3H09A 1UNSA 5IGBA 4IFDH 1PLFA 1T5EA 1GUNA 4JOIC 4H02A 5E4XA 3OTOL 2JA6H 1QZHA 4P75A 1E1TA 3GV3A 3MXNA 3FKIH 3CCLA 4IPGA 4G7ZC 1JT8A 3TREA 4KI0A 3HOZH 3S2HH 1UEAB 3O13A 3G48A 2BE5D 2F0UA 1CZGA 2K5HA 1Q3LA 1X9NA 2IHEA 5EPKA 2LFNA 1A3TA 1PH1A 2B63G 1B44D 3HG9A 4K8JA 2XWJB 2B8FA 5M5XH 2YU9B 1HR0L 4A3BG 1HFNA 3H3VI 4HSVA 2ZXOA 5AJ3Q 4AIMA 1BXTA 2CCZA 1V1PB 4YWMA 2UU9L 4JI6Q 2SEBD 1YBYA 3CCRA 1EY5A 1AE3A 1L2FA 1WYDA 1E3PA 1HHVA 2RCFA 2R3ZA 5DNFA 1JR0D 1KNAA 3C3LA 1HR0Q 2KHIA 1KDCA 2K1BA 2PMZB 1JICA 4GLVB 1YJWA 1YITA 4AH6A 5C5LA 1FR3A 5IYBG 2R92H 3U4VA 4LNQA 1N36L 3G7LA 1N9WA 4L8JA 5I9OA 2XNAC 3TQYA 4QUCA 1HQMC 4IJLA 3CCVA 2JE6I 3S14H 4JI1L 3S1NB 1O7YA 3PIO3 1XTDA 1PH9A 4BXXG 1V1QA 2K33A 3QWNA 3RMHA 2EYLA 4U673 2VL6A 2GN5A 2JA5H 4A4IA 3C1EA 3A0JA 4DV1Q 5JPMC 3MTSA 4M8AA 1DONA 1SFOH 1SYGA 3GV6A 2PW7A 3CCQA 4IJHA 5C4ZA 1E2ZA 3L9AX 4G7OC 4O42A 2JJQA 1BCPB 3ND8A 1TWCH 3KLSA 2JK8A 3MZ5A 4IUUA 1AFPA 1K73C 2A5HA 1D8LA 2OQ0A 3AYHB 2F4VQ 1XJVA 1Y1WB 5FLMH 1ICWA 4MZ9A 5EGTA 4RFBA 2ZJQA 1RHPA 1TXYA 2NVYB 3IRBA 5IGGA 1CA6A 4A3MH 4A93G 1EZ8A 2F0SA 1DCZA 2OXPA 1VQKA 3HOXG 4OWTB 4RAUC 2BDNA 4DA2A 5IODA 2WB1E 3NK9A 2B29A 1EIHA 1ASYA 4C3JG 3M4OH 2ID0A 4FF2A 2JP1A 1CK1A 1ONLA 1SYFA 5I2XA 1TS5A 3IFTA 3ONAB 2N49A 4IFDJ 5IP9G 1WTVA 3TS2A 2XN9C 4DV5Q 1G6PA 3J7A5 1ET9A 2EY5A 4DR5L 4LF8L 2E74C 3A7LA 3VR5A 5H1SE 1GUTA 1B9MA 2KA7A 3IFDA 2B2TA 5D3IB 2B63B 4HJAA 2HHHQ 2QEJC 4K5VA 4BY7G 5FOBB 1XXGA 2UUBL 4HN7A 5C0XH 1ZYRC 4IOAA 3STBC 4DR3Q 2B2UC 1O80A 4L5QA 3PIPA 2SOBA 2PZWA 4JI7Q 1KLGD 4UPAA 4DR6Q 3UDGA 3S15H 1STAA 2XTIA 1X6OA 3T53B 1IHZA 4Q5VA 1CSPA 1BBUA 1SN8A 1HJPA 4JI2L 1K83B 3J81E 3TSSA 4B3MQ 4C3HG 5T1IA 4DR7L 2R93B 2NZHA 1XMQL 3D3RA 2CKZB 3S9WA 3I91A 1WTPA 4A3FG 3I4MG 3I73A 1NSNS 3RN5A 2IX1A 5IYDH 1D2BA 4FYDA 2F52A 1PRTB 3RN2A 3HKSA 4LUVA 4A76A 1GUSA 4TKOB 1J5EQ 4LF8Q 2AKWB 3S16B 5IYBH 4K5XA 1I4RA 5HGQA 4BY1B 5E3FA 2CW0D 1Y1WH 4KY6A 1VQOA 1Q7YC 2Q8IB 4U68A 4MTKA 1EOTA 2CH4A 2NBFA 5IP9H 3U9OA 1G51A 2EYPA 4A3MB 1EY8A 1SAPA 4LFBL 4A3LH 5DEHA 2HUGA 4H7BA 4HCEA 2WINB 5FLXL 2VQEQ 3LWUA 4WFN3 4RA8A 3MA2B 4WJWA 3M4OB 3D4WA 2F0VA 3Q22A 4B3RL 4ILWA 1CKNA 2Y0SE 5FJ8H 5JVG3 3EN2A 2K01A 5IP7H 3NWTA 1VMPA 5CORA 1U4LA 1SNQA 1Y14B 2VUMH 1EZ6A 1GHJA 4XXEA 1LT5D 4FXDA 2D9UA 3F2UA 1ESFA 3IKJA 1F9PA 1BBWA 1RF2D 3NUCA 3EIVA 4X3UA 4DV4Q 1O7LA 4LF7Q 2MO1A 3HEJA 2CWPA 1SE8A 3A8KE 1XPRA 3AQQA 2UXDL 3C1FA 3BDLA 4ZUIA 1VQ6A 4C3HB 2C9OA 4IPHA 1X55A 2WAQB 4OXPA 1JMCA 3OTOQ 3BZDB 3NTHA 2MQHA 3UDFA 3R2IA 1J9OA 1EUJA 1X56A 4FDBA 1B53A 3TEHB 1VQ8A 4BY7H 1PXUA 5KNDA 2Q2IA 4WORA 2ZTEA 3J81i 5C0XJ 3HOVH 3SR1A 2EJMA 3T1YQ 1EYAA 1SXTA 3R2TA 2UXBQ 5ELDA 3J7AF 4HIDA 4UAIA 4E6IA 3AMUA 4HCSA 3H15A 3BYYB 3PCOB 3QG1A 5COYA 1PZJD 2N3SA 1QUQA 2RSOA 5CBAE 4JI6L 4P71A 3OIQA 2K75A 4OWWB 2K5WA 1PTOD 2NYZD 2EYJA 1BDOA 1F2YA 3WWVA 4PQXA 3E0JA 2LMCB 1P8LA 3EFXD 3KK7A 2L4NA 5EQ0A 4XIGS 2Z6KA 3I4NB 4FVMA 5E1FA 2EXDA 3FMCA 2OWOA 2E2JB 2FXQA 4B3ML 3TBIB 1SRUA 3NBHB 4ALPA 2R61A 2M2LA 1N34L 4F87A 1VQHA 5EKLA 3DWAA 2ZT9C 5DAUA 2Q8RE 1IBML 4RHSA 2AUKA 1I6HB 3HOWH 1XNRL 3D6CA 1MGSA 3W2DA 2K5VA 1Y1WG 1YNXA 1OXXK 5I9PA 1KRSA 4MIUA 2VUMB 3PO2G 1MD2D 2WKDA 4NDXA 2JEBI 4K0KL 2HHHL 1D1KA 2SDFA 1R9TB 3I4NG 4C3IG 4YCWA 1DYQA 2NVQH 4HIOA 1DXMA 5K36G 4AYBG 3J7ZC 3KUPA 5HGTA 3NBHA 5CC4A 4O2DA 3U58A 3PO2B 5CV5A 5C4XH 2N88A 3K0XA 4GN3B 2ZJPA 3CC4A 4JI3Q 1VQIA 1A2TA 4FF3A 5A2QL 1KXLA 3NPPA 4DR1L 5LMNW 5IY0A 1A15A 1OXUA 3CRKC 3DHQA 1UAPA 2R6GA 2KECA 5FK9C 3T1HL 3GQBA 3TZUA 2DY7A 2XIWA 1QE6A 4JI3L 1KAWA 1WTRA 2EXZA 4OWXB 2PNRC 2E5LQ 4FO2A 5GAHC 1TWAB 2K32A 3R93A 2RVLA 3CRLC 4BA1I 4IQZA 3TMEA 4B3SQ 2E2DC 1IKLA 1DD2A 4MNOA 2UXDQ 3NQTA 3VR6A 4K0KQ 4X62L 5K5PA 3OW7A 1ASZA 5IIFA 4B3TQ 1YHBA 4UHVA 4JK1C 2I07B 1SNCA 1K3BC 1HZBA 4GKJL 3RZDH 1STYA 1TY0A 4LFCQ 4CDEC 3HKZB 3JAME 4PMBA 3I70A 3SK8A 2Z8LA 1DOLA 3DMUA 1SROA 4PG3A 3PGZA 2IX0A 1YEZA 4PMCA 2JYOA 2VS1A 4FF4A 3Q6SA 2J0TD 1B70B 4CKEA 1IYUA 1I94L 3WOFA 3NBIA 3GTGH 1I6HH 5C4HA 2SNSA 2C5CA 1JCKB 4GKJQ 3A5UA 3MWYW 1CZWA 1RODA 4DR2Q 1U4RA 1GKHA 1SYDA 4DAYA 2DN8A 4HTHA 1QCBD 4HR7B 3TP6A 5ELBA 1U9RA 1HPCA 1SEBD 1G91A 4DV6Q 4K6LA 2E2HH 3T51B 1C0AA 1ZXTA 1C7YA 5CV8A 4DU9A 5M3MG 5G3LF 1HTLD 2Q2TA 4B3RQ 2HD3A 1EQVA 2K4KA 2R7ZH 3FHWA 1MJCA 1TVXA 2DJFC 4UP9A 5ELNA 2C35B 4LUZA 4DV0L 3PO2H 4DAPA 1CUKA 3T1YL 4C3JB 3EQLC 1CQFA 5C4XB 4PNYA 1F9QA 4TQUS 1Z7TA 4QB4A 4OHJA 4EQNA 4BBSH 3BYTB 2FINB 1D5ZC 4GZYC 4MHEA 5I6YA 1HZ9A 1RL2A 4JYAL 1V43A 3LGJA 3MFYA 4RGNA 4A3DG 1DOMA 1CHPD 1LTLA 4BBRH 1N33Q 4YWKA 2I5HA 4A3GG 3AFPA 3S1RH 1FNWA 1S5FD 1S5CD 1N34Q 3N6RA 3S2DH 2O2LD 4AYBB 1TWAH 2WV6D 4YY3Q 2KCTA 4L63B 1K9MC 1SLJA 2A68D 3OSOA 3TDQA 3M3YH 1N32Q 2ZTDA 2F3WA 4IZ8A 5M9OA 4CBVA 3NQIA 1I4XA 4JG2A 1F77A 1YNNC 3A7AB 4RKLA 3H3VC 1RJTA 1MIUA 2MJ8A 1PRTF 4LF6Q 5KRUA 4DK6C 5CBEE 4JBJA 3HOYB 1GHKA 2RDGA 1Y1VH 1XWEA 3WOEA 5C5MA 5IE8A 1GM5A 2ENBA 4A3JB 4APVA 4RCNA 1OTCA 1VQ5A 2RDFA 4I65A 1CQVA 3JC66 4C1NI 2R7FA 4H44C 2NVXH 2B2WC 2WKCA 3ZJYC 3GTGB 4R4CA 4KMUC 2BCOA 1A63A 4FP5D 3A55A 1S5BD 1IBLL 4H13C 1SYBA 3GTMB 5AFWA 3HOYG 4P72A 4YIJA 4DK3C 1LTTD 4Y52H 2XVSA 2A6HD 5CV4A 3T56B 1STEA 4DK0A 2A68C 5I6WA 2PZTA 2A8VA 2JQOA 2ZXPA 1X32A 2E2HB 1SE4A 4EX5A 3R8BA 3I4MH 5IWAL 2QEXA 1EQTA 4J15A 2XSCA 1LT6D 2LKVA 1GUOA 1XMQQ 3PV0A 4HSPA 1HZCA 3DEPA 3NHHA 1IKMA 2KHJA 3J7YW 1PH6A 1V9PA 1IBMQ 1PRTC 4CJ1B 2TMPA 4LF4L 2XRQD 3D6WA 3MEFA 4HJ9A 1I3QH 3H3VH 3W1GA 1CKNB 1VQJA 3E3XA 3D0FA 3FEWX 1JWMD 4ZYSA 1C4QA 2JA9A 1IW7D 2F1MA 4LAAA 2IJ0A 1KDAA 5LL6X 3RLNA 1XX8A 1V1OA 2EZVA 2L15A 4XDXA 4OGQC 2AQ1B 3GTLH 3H0GH 3VR4A 3ND9A 1F2MA 1KD1C 2N78A 4ZRZA 2KBNA 3HOUB 3JAML 3RLFA 1PH3A 1HNZQ 5KGUA 4G4KA 2PQEA 3VYTA 1MI2A 4DK1A 4X65Q 1VF5C 3V2TA 3AFQA 4JV5Q 3BDCA 5FLXE 1SMXA 3VDYA 1WTQA 2UXBL 4RKBA 1Y1VB 1J6QA 1FYCA 4A3FH 5C44G 4A3JH 3NP8A 5LMUL 2NVTH 5DM63 3OYYA 1PRTD 2WB1G 2LXJA 4A3EB 3C46A 2VZAA 1D7QA 2KOLA 2F0NA 3GD7A 1I94Q 2HT1A 1LTRD 2KVMA 3DM1A 2MUYA 1U5KA 1SDFA 3MHBA 3DWPA 3GTMH 2PNHA 1ICFB 4YWLA 2J7ZA 1ZKOA 3X3MA 2F0WA 4QMGA 4A3KH 2QKIC 3GTOB 2NZ1D 2R7DA 2DY8A 4XYOA 2AQ3B 4B9WA 4DR3L 5M3FG 4QIWB 1CM9A 4C2MH 5BN3A 1W6KA 1AZQA 4HJ8A 1E2WA 3F2BA 3VR3A 1F2ZA 1X3EA 3U4ZA 1TWHH 3MXNB 4O0AA 3VYSA 4A3CG 1I6VC 4F8MA 1SE2A 1FJGL 1B8AA 1EY0A 4OEMB 3CQZH 1UE1A 1T5XD 1N33L 2HQLA 4JW0A 3RZOH 1RTOA 1TR5A 1Z6HA 4A3BB 2F3VA 2EE1A 2L11A 2YV5A 2Z4HA 2JA7G 3UDXA 4XQNA 1LYLA 1WTWA 3BZKA 4A3CH 1R4QB 4YHHL 4LF5L 5D14A 1FNVA 2L5TA 2RCNA 3URYA 2F0HA 3CCSA 1F9SA 5FO8B 4DR1Q 5C6AA 2NWGA 3Q24A 1PVOA 2OT2A 1PH4A 1J8IA 1M4VA 2FMCA 2D2CC 2EY6A 4QF4A 4CKBA 3RR5A 1SR3A 1UEBA 2KCNA 2MP1A 3NTIA 1Q82C 1U0LA 1LABA 4HIMA 2WP8J 5D3DA 1J5EL 2UXCL 4LFAL 3NWSA 4G57A 4AYBE 3J80i 3WDNA 4HJ5A 2RA4A 3J7AV 1SJED 3T13A 2HIVA 4KHVA 3GTKB 4A3DH 4LW1A 1BCPD 4FNFA 3MXGA 4QGUA 5HURA 2PI2E 1NTGA 4R1JA 5M3MB 2F0QA 1PV4A 2JA6B 1M8AA 2Z4IA 3A8IE 4JI2Q 2QDLA 4K6DA 2PI2A 1XNRQ 3SK4A 1HR0W 3E6ZX 4LF9Q 2K52A 1L1OB 2I46A 1SNOA 3J80L 1BR9A 4JI8L 1GOZA 1LLRD 2OF1A 2A1AA 2WAQG 5M5XB 5LL6S 3F1ZA 3GTOH 1HQRD 2JA6G 3QB3A 1EQQA 1NJIC 5C44H 4C2MB 4DV0Q 3CCEA 3P1HA 4K5WA 3SDZA 3J81j 3X3NA 3TZDA 2B2TC 4JI4L 1ESRA 1C48A 1MKHA 3TP5A 3E9HA 4XTCS 2ZXRA 1VS0A 1E24A 4X64L 2UU9Q 1AN8A 5IT9L 3RLOA 1HA5A 1Q1EA 4JYAQ 2PW5A 3CQZB 1VDZA 4UDUC 5JAVA 1YNJD 2B2YA 1K8MA 1AEXA 3R3OA 4B9XA 4A3BH 1PYSB 4DR2L 3L3OC 2JSOA 2QW7A 4TVAB 4X6AH 3EBEA 2IPKD 3I8ZA 1RDPD 5KNBA 2L9HA 4JI0L 5FLMG 2K04A 4DNIA 1EEID 1RTNA 4ZKBB 2LY7A 2CWAA 1EWHA 4A93H 1Y8OB 5DM73 2L0CA 3JAMc 1WTXA 1IXRA 1YVCA 2LSSA 1K0RA 4CKCA 2YTYA 2F0MA 1E0BA 1LTSD 1A2UA 2IY5B 1SYCA 1X3PA 4LFCL 5ELCA 4DV3Q 4BBRG 5D65A 2UUCQ 1O7IA 4ZLTF 1Q81C 4GOPC 3NE5B 2BE5C 4Y7NB 4DV4L 3LX0A 2IT1A 1KIXA 1RCVD 5JJLA 1VQEA 4GLAC 1WCMH 1YNJC 4ZQ3A 5M3MH 3KF6B 1SYEA 2E2IH 4RCOA 3G6JB 4GOPA 1H9SA 2E75C 2RF4A 1SNMA 4TSSA 1S3OA 3KBGA 1XNQL 4R4OA 4PV1C 5C3EG 1Y69U 4KJOA 4NXNL 1DM0B 1AZPA 3H0GG 3K81C 4N9TA 1NUCA 2UUBQ 4DAYB 4PMWA 3A54A 1X3FA 4WJ3M 5IWAQ 3PSIA 5BN4A 2XRSD 1SMYC 2K7VA 3PUVA 3KF8B 5C44B 1T9HA 3CP0A 3ULLA 4A3IH 1TU2B 4DPGA 2B63H 2QGQA 3L0OA 1XPOA 3K7AB 1PH8A 2ZTCA 4CJ0B 4ZAIA 2F0FA 2Y0SB 1VQBA 2PQAB 2QDBA 1X65A 1MSHA 1C8CA 1HNWL 2B3GA 3KYHC 2F0DA 2JXMB 2K5DA 1NR4A 2FJ2A 1IYVA 3PO3G 1HUNA 3RNUA 3AEVA 2DJGC 4ZK9B 1JE5A 2G9HD 2EIFA 5IGFA 4WJ4A 4QIWE 4CDCC 2EYMA 2IL8A 1TWGH 2P5ZX 4IALA 4IUVA 4DXGA 1K8AC 1X3QA 1MHWC 4FXGC 2D0OA 3EJIA 4UP8A 4ABNA 4C3IB 1YHQA 1GUWA 1K83H 2L55A 1XTCD 4DR4L 2PZUA 2J4XA 2FFKB 1VQLA 4A93B 4GLXA 1KDBA 4WRDA 5BN5A 1JOKA 4J8QA 1XMOQ 4K2KA 5LHY1 1S5ED 4XYQA 3SE0A 3LNNA 4KHPL 4BBSG 1CI3M 1Q90A 3BDOA 1WTHA 3I72A 1HRJA 1G291 3IAYA 3M7GA 1IBKL 3S16H 2VUMG 4BY1H 1EY4A 1PYBA 1STGA 4HMIA 2MFIA 3DEOA 3K6OA 3I90A 3TN2A 2JA8B 2VNUD 2B2VC 2MGSA 3W5OA 2UUAL 3AU7A 3NENA 2QA4A 2DGYA 1E1OA 1SSOA 3FKIB 3PUXA 3VYRA 1PZKD 2YYZA 2Z1CA 1A3VA 5E7NA 1L0YB 1ENCA 1WCMG 2RHQB 2EY2A 2Y0SG 3U50C 2NTSA 3CKIB 4N8X1 5EAYA 1PFNA 1PYWD 4IPCA 2HDLA 4X65L 3E9IA 4R4TA 5JJIA 3JAMi 4IURA 4A3LG 1Q46A 4NXML 4GNXB 2ES2A 4LF6L 2AQ2B 3P7JA 4A3IB 3BU2A 1HTPA 1A3UA 4DV7L 2XGTA 3K7AH 5IT9E 4J6HA 1Y1VG 1IW7C 2EYHA 2EOTA 3HP3A 1C9OA 3ULPA 1EOVA 2IWHA 3M4YA 1LT3D 1OO9B 5C3EB 1I4QA 3CCJA 4C3HH 4A3EG 3ER0A 4X3TA 3PIOA 2EPBA 1E2VA 2F0GA 1FNUA 1GUGA 1OXSC 3M4QA 4Q0FA 1WTOA 1QOHA 2R7ZG 1D6EC 1EIYB 2A74C 4KV6A 3C2PA 4P73A 1QVGA 3S14B 2K03A 1UWVA 3N52A 4BY1G 1B3AA 1NCVA 4C3IH 1QNKA 5JVH3 2CW0C 3HOUG 1PTOB 4V190 1E22A 1VQCA 1NAPA 2JA5B 5J3BA 4ME3A 5NUCA 5C3XA 4IFDG 1UE5A 1MSGA 5LMUQ 1SFOB 3CPFA 1TS4A 1UE7A 2RDHA 5A35A 5CV6A 3S1MB 4X3SA 4F88A 3HKZE 2BH8A 4DV7Q 4RGMA 4IUQA 1TWCB 1EYGA 4B3SL 1LM0A 3OPOA 2YTXA 1AH9A 4UP7A 1BCPF 4KY5A 2VXWA 4JI1Q 2RBMA 1YJ9A 2EVBA 4OX9Q 4GKKL 3I2ZA 1PFMA 4CDFC 1YNND 3K57A 3I4NH 2NVYH 4AQYQ 1I50B 2DUDA 1IBLQ 1K28A 1E7ZA 4QCLA 4L6TB 3S24A 4KKUA 4A3IG 4LFBQ 4LK1C 3Q0AA 2PMZE 4NP5A 1CA5A 3DUZA 4NW2A 1QNUA 3I55A 1EU4A 1TS3A 3BS1A 1KC8C 3KBXA 3UDIA 3HKZG 1WI5A 4JI4Q
chains in the Genus database with same CATH topology
1KABA 2WIIB 5E4WC 3CU7A 2QILA 2JEAI 1S4ZA 2O5IC 4O1NA 5IOCA 1PFBA 3CHBD 2M00A 3PUZA 5IGDA 2NVQB 3OWEB 1RKNA 3E5SA 3ZYYX 2H1EA 2F0JA 1G6ZA 1QG7A 2A6EC 4IUPA 2FHTA 2HDMA 4LJZC 3SXHA 2OEOA 4BWGB 3S15B 2RQXA 5TSSA 2PO4A 1FD7D 1PTOH 2NUCA 3FDTA 1KNEA 4OO1I 1BOSA 2K28A 1LTGD 1LACA 2A69D 4FXKC 3H6MA 2M9VA 4NMZA 4DF7A 4HAEA 5KYIA 4S3SA 2DNCA 1LO5D 2CHBD 4KN4C 4DAVA 5ELEA 5JOBA 1DZ1A 4RWSC 4OIKA 5CMDA 2F4IA 1LV9A 5KIXA 1H9KA 1BO0A 4XQJA 4HMJA 4TRDA 4C1NK 2A73B 2K05A 5CYUA 1G2SA 5J1ZA 1II3A 2D5DA 3DWQA 1K8OA 5KYLA 4DFAA 4CHTB 4RGOS 4OO1G 4MN3A 3EVQA 5KEEA 3RUZA 2XWBB 1EY7A 1JE4A 4KKTA 4V0BA 3SEBA 3U9SA 1O78A 3ITPA 3FRPB 2R7ZB 1RD9D 2PYKA 4A3GB 3K59A 2IW3A 5ELFA 1SBBB 1JORA 1GXDC 3SHLA 1CTMA 3S1QB 4BY7B 3D8GA 2QCPX 4DN4M 1LTID 2NB0A 5IGCA 4QUFA 3SK6A 1IL8A 2K6AA 3HOVB 4I7ZC 4BBRB 1B2TA 1HA6A 1Z47A 2ICIA 5C0XI 3LWEA 3M85A 1ILPA 3GTQB 2TSSA 3SVMA 3OWFA 2WACA 3K5LA 3FPPA 4H0LC 2F0TA 2RSNA 1XYIA 1EY6A 2EDGA 4K2LA 1EYDA 4DNTB 1JQYD 1ILQA 2EJGC 4BS9A 4EQOA 5M5WB 2B2UA 1H9RA 1OXVA 4EGVA 4KD4A 2HQEA 4KD3A 1V1PA 5KNCA 3MAQA 2EJFC 3HOWB 2BOSA 1U4MA 5EBDA 1STHA 2BA1A 5CV9A 3NXWA 3K5NA 5EBCA 1JC7A 1ML0D 3DXJC 1WD0A 1DOKA 3GP7A 2F0EA 3PO3B 3T4AC 2SNMA 3OIPA 1EIGA 1H9MA 3AB9A 5C0XG 5C4JB 3D4RA 3D4DA 3PUWA 4ZUJA 4ZKCB 4NKLA 4OO1H 4FF1A 1B9NA 2BDOA 3MEHA 2HCIA 1BF4A 5G3LD 3MXUA 5I2YA 1WD1A 2A6HC 3PIP3 3K5MA 1Q8IA 4F7XA 2RKSA 1JWSD 1BBXC 1TY2A 2B2VA 4B08A 4OIJA 1B1ZA 3EA6A 1I3QB 1JOOA 1SNDA 3QOLA 4G7HC 1TQOA 2PCFB 3W3AA 3BG3A 2NN6G 2E76C 4K14A 3GTLB 3H0GB 5C3WA 5JEAH 5JPNC 1Y8NB 2CVRA 4HEDA 2B2YC 3D31A 2DNEA 3HRZC 1TS2A 5ISRA 2O5JC 2KUMA 3RZDB 3NSWA 3H91A 4J1MA 1BUVT 1QB5D 5JEAG 1JB3A 3FVQA 2KEEA 3QJYA 2AWOA 1F9RA 4A3FB 4P2CB 2NVTB 5FKAC 2Q8TA 1PTOF 1TKWB 5M3FB 1O7ZA 1I4GA 4LMQD 2KEDA 3I4LA 1VCIA 3HZXA 3GTJB 5EJWA 3GTPB 3OMCA 4IFDI 3MXPA 2HCCA 1PMRA 1KTKA 1B4OA 2PPBC 4DXFA 4A3KB 5M5YB 4ME5A 2F0IA 1HUMA 2IX3A 1LTAD 3A8JE 1ZYRD 3V96A 1STNA 3I3CA 4X3KA 4DNRB 1SMYD 1QWYA 1EY9A 4DGZA 2CQAA 3OHXC 4Z9CB 1SNPA 1SE3A 3RZOB 2X6LA 3K5OA 1PZID 2K5QA 4K8IA 1D1IA 4BBSB 4R8IA 1ENAA 5J22A 1BQQT 3QIAA 1L0XB 1TT2A 4KKSA 3TP7A 2A6ED 4XT3B 4C56C 4ULLA 3S1RB 5J39A 5EPLA 1PTOC 5CGKA 3S2DB 3J81L 1HFGA 3M3YB 4KJNA 3BVGA 2L12A 3T16A 2EY1A 4KHZA 4IN3A 1U4PA 2X69A 2H4OA 1B50A 2B39A 5IGEA 3VA7A 3L7ZC 5CV7A 3UI2A 1STBA 1HCZA 5JEAJ 4CGYB 2MHVA 2NVXB 3BVMA 1W6JA 3H94A 1LTBD 4RH6A 1KLUD 3S17B 4CJ2C 2B2WA 1Q1BA 3KF8A 3FPUB 4R9WA 4IUTA 4OL7A 4XT1B 1LT4D 3MC0B 1D5XC 3EROA 3ERQA 5F2DA 1ENFA 1BNZA 3J80E 2B8GA 2X6GA 3P75A 2AWNA 3I4MB 1EU3A 1H9SB 4EQPA 2AUJD 5FO9B 4EVOA 1G8ZD 2A69C 3GO5A 3RD4A 3P20A 4RHRA 4R8NA 1I4PA 2LS01 3NTKA 2F0OA 1Y8PB 1GJXA 1JWUD 1ZEQX 1MBYA 1D5MC 1AW7A 2VB2X 2QF7A 2JA7B 4KY7A 2KHSA 3TP8A 3HS0C 3QOJA 3MFGA 2F0PA 1NR2A 2F0KA 3OMGA 2ICEC 2FMMA 3IL8A 1V8QA 1WCMB 3V05A 3QO2A 1VF7A 2E2IB 2L1BA 3HGBA 4N9PA 1TWFB 1CHQD 1G2TA 1KAAA 3VR2A 1EL0A 1R4PB 1WVLA 2F03A 5T1GA 5I4DA 5K36H 3HOZB 1ET6A 2N55A 3S2HB 2NN6I 2NTTA 1UUPA 1BCPC 1QILA 5EPJA 2WB1B 3MVVA 2KJXA 1Q12A 1VMCA 2EYOA 3A56A 1EWCA 1AP0A 3VA5A 1TWHB 5EKKA 1JOQA 3VYUA 1PDQA 4RGTA 4KN7C 1EFID 1QJOA 2R92B 1EYCA 1DJRD 3PUYA 1OXTA 1TWGB 4IUNA 2D62A 1TIID 2EYFA 4BA2I 1CT1D 1HXYD 3K0YA 2GA4B 2BA0A 4ODGA 3OOCA 4ID6A 2KQ3A 2KCCA 3KLSX 2V4DA 3SK5A 3HOXB 3BVZA 1CFMA 2VB3X 1S5DD 4JBWA 4XQQA 1F2LA 2MPMA 1A6XA 2F0LA 4M1UB 1EEFD 2G9DA 5CR3A 1H9JA 3PMFA 5JJZA 5EKIA 4KK7A 3Q23A 3K58A 5A2QE 5FO7B 1SJHD 4KTAA 2NN6H 3M7NA 4A3DB 2O4XA 3KLRA 1I4HA 1FGBD 3H09A 1UNSA 5IGBA 4IFDH 1PLFA 1T5EA 1GUNA 5E4XA 3GV3A 3MXNA 4G7ZC 4KI0A 1UEAB 3O13A 2BE5D 2F0UA 1CZGA 1Q3LA 5EPKA 2LFNA 1A3TA 1B44D 3HG9A 2XWJB 4K8JA 2B8FA 2YU9B 1HFNA 4HSVA 2ZXOA 1BXTA 1V1PB 2SEBD 1EY5A 1HHVA 2R3ZA 5DNFA 1JR0D 1KNAA 3C3LA 1KDCA 2K1BA 2PMZB 1JICA 5C5LA 1FR3A 3G7LA 4L8JA 5I9OA 2XNAC 4QUCA 1HQMC 2JE6I 3S1NB 1O7YA 3PIO3 3QWNA 2K33A 3RMHA 2EYLA 4U673 3C1EA 5JPMC 3MTSA 4M8AA 1DONA 1SYGA 3GV6A 2PW7A 5C4ZA 1E2ZA 3L9AX 4G7OC 4O42A 1BCPB 3ND8A 3KLSA 3MZ5A 4IUUA 1AFPA 2A5HA 1Y1WB 1ICWA 5EGTA 4RFBA 1RHPA 2NVYB 5IGGA 1CA6A 1EZ8A 2F0SA 1DCZA 2OXPA 4RAUC 5IODA 4DA2A 2BDNA 3NK9A 1EIHA 4C3JG 2ID0A 4FF2A 2JP1A 1CK1A 1ONLA 1SYFA 5I2XA 1TS5A 3IFTA 3ONAB 4IFDJ 1WTVA 2XN9C 1ET9A 2EY5A 2E74C 3A7LA 3VR5A 1GUTA 1B9MA 2KA7A 3IFDA 2B2TA 5D3IB 2B63B 2QEJC 4K5VA 5FOBB 1XXGA 4HN7A 5C0XH 1ZYRC 2B2UC 1O80A 2SOBA 2PZWA 1KLGD 1STAA 3T53B 1IHZA 4Q5VA 1K83B 3J81E 3TSSA 4C3HG 5T1IA 2R93B 3D3RA 3S9WA 3I91A 1WTPA 3I73A 1NSNS 2IX1A 1D2BA 4FYDA 1PRTB 1GUSA 4TKOB 3S16B 4K5XA 1I4RA 4BY1B 5E3FA 2CW0D 4KY6A 2Q8IB 4U68A 1EOTA 2NBFA 3U9OA 2EYPA 4A3MB 1EY8A 1SAPA 5DEHA 2HUGA 4H7BA 4HCEA 2WINB 5FLXL 3LWUA 4WFN3 4RA8A 3MA2B 4WJWA 3M4OB 3D4WA 2F0VA 3Q22A 4ILWA 5JVG3 2K01A 3NWTA 1VMPA 5CORA 1U4LA 1SNQA 1EZ6A 1GHJA 4XXEA 1LT5D 4FXDA 2D9UA 3F2UA 1ESFA 3IKJA 1F9PA 1RF2D 3NUCA 4X3UA 1O7LA 3HEJA 3A8KE 3C1FA 3BDLA 4ZUIA 4C3HB 2C9OA 2WAQB 3BZDB 3NTHA 3R2IA 1J9OA 1B53A 1PXUA 5KNDA 4WORA 5C0XJ 3SR1A 2EJMA 1EYAA 1SXTA 3R2TA 5ELDA 3J7AF 4UAIA 4E6IA 3AMUA 4HCSA 3BYYB 3QG1A 5COYA 1PZJD 2RSOA 5CBAE 3OIQA 2K5WA 1PTOD 2NYZD 2EYJA 1BDOA 1F2YA 4PQXA 3E0JA 2LMCB 3EFXD 3KK7A 2L4NA 5EQ0A 4XIGS 3I4NB 4FVMA 5E1FA 3FMCA 2E2JB 3TBIB 2R61A 2M2LA 4F87A 5EKLA 3DWAA 2ZT9C 5DAUA 2Q8RE 4RHSA 2AUKA 1I6HB 3D6CA 1MGSA 3W2DA 1OXXK 5I9PA 2VUMB 4MIUA 1MD2D 2WKDA 4NDXA 2JEBI 1R9TB 1D1KA 2SDFA 4C3IG 1DYQA 1DXMA 5K36G 3KUPA 5HGTA 3NBHA 5CC4A 3PO2B 5CV5A 2N88A 1A2TA 4FF3A 5A2QL 3NPPA 1A15A 1OXUA 3CRKC 3DHQA 1UAPA 2R6GA 2KECA 5FK9C 3GQBA 3TZUA 2DY7A 2XIWA 1QE6A 1WTRA 2EXZA 2PNRC 4FO2A 1TWAB 2K32A 3R93A 2RVLA 3CRLC 4BA1I 4IQZA 3TMEA 2E2DC 1IKLA 1DD2A 3NQTA 3VR6A 5K5PA 3OW7A 5IIFA 4JK1C 2I07B 1SNCA 1STYA 1TY0A 3HKZB 3JAME 4PMBA 3I70A 3SK8A 2Z8LA 1DOLA 3DMUA 2IX0A 4PMCA 2JYOA 4FF4A 3Q6SA 2J0TD 4CKEA 1IYUA 3WOFA 3NBIA 5C4HA 2SNSA 2C5CA 1JCKB 3MWYW 1RODA 1CZWA 1U4RA 1SYDA 4DAYA 2DN8A 4HTHA 1QCBD 4HR7B 3TP6A 5ELBA 1U9RA 1HPCA 1SEBD 1G91A 4K6LA 3T51B 1ZXTA 5CV8A 4DU9A 5G3LF 1HTLD 1EQVA 1TVXA 4DAPA 4C3JB 3EQLC 1CQFA 5C4XB 4PNYA 1F9QA 4TQUS 1Z7TA 4QB4A 4OHJA 4EQNA 3BYTB 2FINB 1D5ZC 4GZYC 4MHEA 5I6YA 1V43A 3MFYA 4RGNA 1DOMA 1CHPD 1FNWA 1S5FD 1S5CD 3N6RA 2O2LD 4AYBB 2WV6D 4L63B 2A68D 3OSOA 3TDQA 2F3WA 4IZ8A 5M9OA 4CBVA 3NQIA 1I4XA 1F77A 1YNNC 3A7AB 4RKLA 3H3VC 1RJTA 2MJ8A 1PRTF 5KRUA 5CBEE 3HOYB 1GHKA 2RDGA 1XWEA 3WOEA 5C5MA 2ENBA 4A3JB 4RCNA 2RDFA 4I65A 1CQVA 4C1NI 4H44C 2B2WC 2WKCA 3GTGB 4KMUC 2BCOA 4FP5D 3A55A 1S5BD 4H13C 1SYBA 3GTMB 5AFWA 4YIJA 1LTTD 2XVSA 2A6HD 5CV4A 3T56B 1STEA 4DK0A 2A68C 5I6WA 2PZTA 2ZXPA 1X32A 2E2HB 1SE4A 3R8BA 1EQTA 2XSCA 1LT6D 2LKVA 1GUOA 3PV0A 4HSPA 3DEPA 3NHHA 1IKMA 3J7YW 1PRTC 4CJ1B 2TMPA 2XRQD 3D6WA 3FEWX 1JWMD 4ZYSA 1C4QA 1IW7D 2F1MA 4LAAA 2IJ0A 1KDAA 5LL6X 1XX8A 1V1OA 2EZVA 4XDXA 4OGQC 2AQ1B 3VR4A 3ND9A 1F2MA 4ZRZA 3HOUB 3JAML 3RLFA 5KGUA 4G4KA 2PQEA 3VYTA 1MI2A 4DK1A 1VF5C 3V2TA 3BDCA 5FLXE 1WTQA 4RKBA 1Y1VB 1FYCA 3NP8A 5DM63 1PRTD 4A3EB 3C46A 2KOLA 2F0NA 3GD7A 1LTRD 2KVMA 3DM1A 2MUYA 1SDFA 3MHBA 3DWPA 2J7ZA 1ZKOA 3X3MA 2F0WA 4QMGA 2QKIC 3GTOB 2NZ1D 2DY8A 4XYOA 2AQ3B 4B9WA 4QIWB 1CM9A 5BN3A 1W6KA 1AZQA 1E2WA 3VR3A 1F2ZA 3VYSA 1I6VC 4F8MA 1SE2A 1EY0A 1T5XD 1RTOA 1TR5A 1Z6HA 4A3BB 2F3VA 2EE1A 2L11A 2Z4HA 4XQNA 1WTWA 1R4QB 5D14A 1FNVA 2L5TA 3URYA 2F0HA 1F9SA 5FO8B 5C6AA 2NWGA 3Q24A 2OT2A 1J8IA 1M4VA 2FMCA 2D2CC 2EY6A 4QF4A 4CKBA 2KCNA 2MP1A 3NTIA 1LABA 2WP8J 5D3DA 3NWSA 4G57A 3WDNA 3J7AV 2RA4A 1SJED 3T13A 4KHVA 3GTKB 1BCPD 4FNFA 3MXGA 5HURA 5M3MB 2F0QA 2JA6B 1M8AA 2Z4IA 3A8IE 4K6DA 3SK4A 3E6ZX 2I46A 1SNOA 3J80L 1BR9A 1GOZA 1LLRD 2OF1A 5M5XB 5LL6S 1HQRD 3QB3A 4C2MB 3P1HA 4K5WA 3SDZA 3X3NA 3TZDA 2B2TC 1ESRA 1C48A 3TP5A 4XTCS 2ZXRA 1AN8A 5IT9L 1HA5A 1Q1EA 2PW5A 3CQZB 1VDZA 4UDUC 5JAVA 1YNJD 2B2YA 1K8MA 1AEXA 3R3OA 4B9XA 3L3OC 2JSOA 2IPKD 3I8ZA 1RDPD 5KNBA 2L9HA 2K04A 1EEID 1RTNA 4ZKBB 2LY7A 1EWHA 1Y8OB 5DM73 2L0CA 1WTXA 4CKCA 2F0MA 1E0BA 1LTSD 1A2UA 1SYCA 1X3PA 5ELCA 5D65A 4ZLTF 3NE5B 2BE5C 4Y7NB 3LX0A 2IT1A 1RCVD 1YNJC 4ZQ3A 1SYEA 4RCOA 3G6JB 1H9SA 2E75C 4TSSA 1SNMA 3KBGA 4PV1C 1Y69U 4KJOA 1DM0B 1AZPA 4N9TA 1NUCA 4PMWA 3A54A 5BN4A 2XRSD 1SMYC 2K7VA 3PUVA 5C44B 1TU2B 3K7AB 4CJ0B 4ZAIA 2F0FA 2Y0SB 2QDBA 1MSHA 1C8CA 2F0DA 2JXMB 2K5DA 1NR4A 2FJ2A 1IYVA 1HUNA 4ZK9B 2G9HD 5IGFA 2EYMA 2IL8A 4IALA 4IUVA 4DXGA 1X3QA 4FXGC 3EJIA 1GUWA 4C3IB 4ABNA 2L55A 1XTCD 2PZUA 2J4XA 2FFKB 4A93B 1KDBA 4WRDA 5BN5A 1JOKA 4J8QA 4K2KA 5LHY1 1S5ED 4XYQA 3SE0A 3LNNA 1CI3M 1Q90A 3BDOA 3I72A 1HRJA 1G291 3IAYA 3M7GA 1EY4A 1STGA 4HMIA 3DEOA 3K6OA 3I90A 3TN2A 2JA8B 2VNUD 2B2VC 2MGSA 3AU7A 1SSOA 3FKIB 3PUXA 3VYRA 1PZKD 2YYZA 2Z1CA 1A3VA 1L0YB 1ENCA 2EY2A 2NTSA 3CKIB 1PFNA 1PYWD 2HDLA 4IURA 2AQ2B 3P7JA 4A3IB 1HTPA 1A3UA 5IT9E 4J6HA 1IW7C 2EYHA 2EOTA 3HP3A 2IWHA 3M4YA 1LT3D 1OO9B 5C3EB 1I4QA 4X3TA 2EPBA 1E2VA 2F0GA 1FNUA 1GUGA 1OXSC 4Q0FA 1WTOA 1QOHA 1D6EC 2A74C 4KV6A 3C2PA 3S14B 2K03A 3N52A 1B3AA 1NCVA 1QNKA 5JVH3 2CW0C 1PTOB 4V190 1NAPA 2JA5B 5NUCA 5C3XA 4IFDG 1MSGA 1SFOB 1TS4A 2RDHA 5A35A 5CV6A 3S1MB 4X3SA 4F88A 4RGMA 4IUQA 1TWCB 3OPOA 1BCPF 4KY5A 2VXWA 2RBMA 2EVBA 1PFMA 3K57A 1YNND 1I50B 4QCLA 4L6TB 4KKUA 4LK1C 3Q0AA 4NP5A 1CA5A 3DUZA 4NW2A 1QNUA 1EU4A 1TS3A 3BS1A 3KBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAB A;  5I9P A;  1SNQ A;  4QMG A;  5CV4 A;  5KYL A;  2F0E A;  4MIU A;  4DFA A;  3ERO A;  1SYD A;  2EY5 A;  4HTH A;  1EZ6 A;  5I6W A;  3QB3 A;  4ME5 A;  2F0I A;  3TP6 A;  2PZT A;  2SNM A;  3ERQ A;  3MVV A;  5F2D A;  4B9W A;  2EYO A;  3EVQ A;  3NUC A;  1U9R A;  4NDX A;  3P1H A;  4K5W A;  3RUZ A;  5KEE A;  1A3U A;  3VA5 A;  5IOC A;  1EY7 A;  1STN A;  3D4D A;  1F2Z A;  4K5V A;  3P75 A;  4J6H A;  2M00 A;  1EY5 A;  2F0F A;  3HEJ A;  5CV8 A;  4DU9 A;  2EYH A;  5IGD A;  5EKK A;  2QDB A;  1EQV A;  3ITP A;  4K8J A;  4ZUJ A;  1RKN A;  3TP5 A;  4EQP A;  5HGT A;  4F8M A;  1EY9 A;  4DGZ A;  4EVO A;  1JOQ A;  3E5S A;  5CC4 A;  3C1F A;  3BDL A;  4ZUI A;  1KDC A;  2PYK A;  1EY0 A;  2F0D A;  4NKL A;  2LKV A;  1SNP A;  2PW5 A;  5CV5 A;  3MEH A;  5JAV A;  1JOR A;  3NHH A;  4PNY A;  5C5L A;  1TR5 A;  2F0J A;  2F0G A;  1AEX A;  3SHL A;  1A2T A;  1EYC A;  3R3O A;  4K8I A;  2SOB A;  2F3V A;  2PZW A;  4QB4 A;  4B9X A;  4EQN A;  5I9O A;  4F7X A;  2RKS A;  3SXH A;  4R8N A;  2EYM A;  2OEO A;  1ENA A;  4IAL A;  4IUN A;  2EYF A;  3D8G A;  5J22 A;  4KV6 A;  1STA A;  5I6Y A;  1TT2 A;  2F0O A;  3DHQ A;  4WOR A;  5IGF A;  1IHZ A;  4ODG A;  5IGC A;  4ID6 A;  3SK6 A;  2KQ3 A;  3EJI A;  1SND A;  1JOO A;  3TP7 A;  3SR1 A;  3QOL A;  2F0H A;  4DF7 A;  2PZU A;  1EYA A;  2EXZ A;  2NUC A;  1TQO A;  2EYL A;  3SK5 A;  5C6A A;  5J39 A;  1KDB A;  5CGK A;  3C1E A;  3S9W A;  4E6I A;  4WRD A;  5J1Z A;  1JOK A;  4K2K A;  5NUC A;  5C3X A;  2EY6 A;  4LAA A;  1NSN S;  1SYG A;  4QF4 A;  1KDA A;  3TME A;  2PW7 A;  3OSO A;  5C4Z A;  4KJN A;  4K14 A;  5CV6 A;  2F3W A;  2F0M A;  3NQT A;  4IZ8 A;  5M9O A;  5K5P A;  2F0L A;  3T16 A;  2EY1 A;  1A2U A;  5C3W A;  1F2M A;  1SYC A;  2EYJ A;  1F2Y A;  5CR3 A;  5IIF A;  3H6M A;  2KHS A;  3OWF A;  4KY7 A;  4RKL A;  2WAC A;  3TP8 A;  3PMF A;  3MZ5 A;  5ISR A;  3QOJ A;  4G57 A;  1SNC A;  4K5X A;  2F0T A;  5E3F A;  2F0P A;  3T13 A;  5KGU A;  2F0K A;  3OMG A;  2PQE A;  1EY4 A;  4KY5 A;  4NMZ A;  5IGE A;  1STG A;  1STY A;  4HMI A;  4KY6 A;  3LX0 A;  2RBM A;  4J1M A;  5CV7 A;  4KHV A;  4S3S A;  5KRU A;  5KYI A;  1EY6 A;  4KTA A;  3V2T A;  5EGT A;  3BDC A;  1STB A;  2O4X A;  4K2L A;  1EYD A;  5E1F A;  2EYP A;  3U9O A;  4RKB A;  4PMB A;  1EZ8 A;  4ZQ3 A;  2F0S A;  5HUR A;  5JOB A;  5C5M A;  4EQO A;  2ENB A;  2OXP A;  1EY8 A;  1SYE A;  3DMU A;  3NP8 A;  3SK8 A;  5IGB A;  2F0Q A;  4N9P A;  2RDF A;  5DEH A;  4I65 A;  4PMC A;  5IOD A;  4H7B A;  3NK9 A;  1KAA A;  4K6D A;  4KD4 A;  1SNM A;  3SK4 A;  2F0N A;  5KIX A;  1A3V A;  5EKL A;  2HQE A;  4NP5 A;  3D4W A;  4KD3 A;  5DAU A;  2F0V A;  1SNO A;  1SYF A;  4KJO A;  1ENC A;  4HMJ A;  3HZX A;  4TRD A;  3D6C A;  3OMC A;  5C4H A;  1STH A;  2EY2 A;  2F0U A;  3MXP A;  4N9T A;  2SNS A;  3MHB A;  1SYB A;  5CV9 A;  3NXW A;  1NUC A;  5IGG A;  2OF1 A;  1A3T A;  4OL7 A;  4YIJ A;  1II3 A;  2F0W A; 
#chains in the Genus database with same CATH topology
 1KAB A;  2WII B;  2F4V L;  5E4W C;  4JBK A;  3CU7 A;  1PA6 A;  1VQN A;  2QIL A;  2JEA I;  1S4Z A;  5C4X G;  5IP7 G;  2O5I C;  4O1N A;  1M90 C;  1R9T H;  2GVA A;  5IOC A;  1B3Q A;  3CCU A;  2WFW A;  1JJ2 A;  2OQK A;  1PFB A;  3CHB D;  2M00 A;  2GVB A;  1KL9 A;  3PUZ A;  5IGD A;  4RMF A;  2NVQ B;  3OWE B;  1RKN A;  2JA5 G;  3E5S A;  1W3S A;  5C3E H;  3ZYY X;  3OW2 A;  1YI2 A;  4NXM Q;  2H1E A;  2F0J A;  1G6Z A;  1QG7 A;  2A6E C;  4IUP A;  2FHT A;  2HDM A;  4LJZ C;  3SXH A;  3S1Q H;  2OEO A;  4OEL B;  4BWG B;  3S15 B;  2RQX A;  5TSS A;  1PFS A;  5JJK A;  1HZA A;  2PO4 A;  4R4I A;  1FD7 D;  1PTO H;  5DLQ E;  2NUC A;  3FDT A;  2R93 H;  1KNE A;  1YHA A;  4OO1 I;  1BOS A;  2ALY B;  2K28 A;  5BR8 L;  1LTG D;  1VQF A;  1Q8K A;  3L2P A;  2UXC Q;  1LAC A;  2K50 A;  3S1M H;  4OON A;  3CXC A;  2A69 D;  4FXK C;  3H6M A;  3KFU A;  2G5D A;  2M9V A;  1Q86 C;  4NMZ A;  3G71 A;  4DF7 A;  3K80 C;  4HAE A;  5KYI A;  4S3S A;  2DNC A;  4JC0 A;  3FP9 A;  1LO5 D;  2CHB D;  4KN4 C;  4UY8 C;  1I50 H;  4DAV A;  5ELE A;  3PF4 A;  5JOB A;  1DZ1 A;  3CD6 A;  4RWS C;  4OIK A;  5CMD A;  4NXN Q;  2EQS A;  2F4I A;  2HIX A;  1LV9 A;  5KIX A;  1H9K A;  1BO0 A;  3SGI A;  4XQJ A;  4HMJ A;  4TRD A;  4C1N K;  4DUZ Q;  2A73 B;  2K05 A;  1CSQ A;  5CYU A;  1G2S A;  1NY4 A;  5J1Z A;  1II3 A;  2D5D A;  3DWQ A;  1K8O A;  5KYL A;  4DFA A;  4CHT B;  4JCV E;  1VQA A;  4DUY Q;  4RGO S;  4OO1 G;  4MN3 A;  3EVQ A;  3A74 A;  2OTJ A;  5KEE A;  3RUZ A;  5C4J H;  2XWB B;  1EY7 A;  1JE4 A;  3PQI A;  4KKT A;  2E8G A;  4X62 Q;  4V0B A;  3KJP A;  3SEB A;  3U9S A;  1FL0 A;  1O78 A;  2Z6K C;  3FRP B;  4LUO A;  3ITP A;  4DR5 Q;  1RD9 D;  1IL2 A;  2R7Z B;  2PYK A;  3BZC A;  4A3G B;  2Z6B A;  3K59 A;  2OTL A;  2IHF A;  2IW3 A;  5ELF A;  5AJ3 L;  1SBB B;  3DLL A;  1JOR A;  5HY6 A;  5BR8 Q;  1GXD C;  4N8F A;  3SHL A;  1B7Y B;  1CTM A;  2Z9H A;  2KEN A;  3S1Q B;  4QQB X;  4BY7 B;  3D8G A;  2CFM A;  2QCP X;  4DN4 M;  1LTI D;  2NB0 A;  5IGC A;  5GAE C;  1YJN A;  4QUF A;  3SK6 A;  1IL8 A;  2K6A A;  3HOV B;  4AQY L;  4I7Z C;  1P16 A;  3K8A A;  2H5X A;  4BBR B;  3CPW A;  1B2T A;  1HA6 A;  5GAG C;  1Z47 A;  2ICI A;  2K5N A;  3QR8 A;  1HNZ L;  2VW9 A;  5C0X I;  3LWE A;  1VQ7 A;  3M85 A;  1ILP A;  2BH2 A;  3UE0 A;  3GTQ B;  2TSS A;  1S40 A;  2CQO A;  3SVM A;  3OWF A;  2WAC A;  3K5L A;  4DUY L;  3FPP A;  4H0L C;  2F0T A;  4YHH Q;  2RSN A;  1XYI A;  4LF5 Q;  1HNX Q;  4MTN A;  1EY6 A;  1FGU A;  1CKO A;  1EFW A;  2EDG A;  4K2L A;  1EYD A;  4DNT B;  1JQY D;  1CKM A;  1ILQ A;  2EJG C;  4BS9 A;  4EQO A;  2E2J H;  5M5W B;  2B2U A;  1H9R A;  1OXV A;  3Q8D A;  1KHI A;  4EGV A;  5M3F H;  4KD4 A;  1PH2 A;  2D0P A;  4YCV A;  2HQE A;  4HJ7 A;  4IOC A;  1YIJ A;  3M9B A;  4KD3 A;  1V1P A;  5KNC A;  3MAQ A;  4X66 L;  2LXK A;  2EJF C;  3GTJ H;  3GTP H;  3HOW B;  2BOS A;  1U4M A;  5EBD A;  1N36 Q;  1STH A;  2BA1 A;  4PZ6 A;  5CV9 A;  3NXW A;  3K5N A;  5EBC A;  1JC7 A;  1H95 A;  4DV3 L;  1ML0 D;  3DXJ C;  1DOK A;  1WD0 A;  3GP7 A;  2F0E A;  1VQM A;  3BJU A;  3PO3 B;  3T4A C;  2SNM A;  3OIP A;  1EIG A;  1H9M A;  3AB9 A;  5C0X G;  5C4J B;  3D4R A;  1KQS A;  3D4D A;  2E5L L;  3K7U C;  4JVZ A;  2N8N A;  3PUW A;  4ZUJ A;  2MNA A;  4NB3 A;  4ZKC B;  4NKL A;  4A3G H;  4OO1 H;  4FF1 A;  1NE3 A;  1B9N A;  2BDO A;  3MEH A;  2HCI A;  1BF4 A;  5G3L D;  3MXU A;  4YCU A;  2I0Q A;  5I2Y A;  1WD1 A;  1VQG A;  2A6H C;  3PIP 3;  3K5M A;  1JB7 A;  2VY3 A;  1Q8I A;  4F7X A;  2RKS A;  4POG A;  1JWS D;  1BBX C;  4NPS A;  1TY2 A;  4DUZ L;  2B2V A;  4JI8 Q;  4B08 A;  2F3I A;  1QVC A;  1S72 A;  4OIJ A;  3EA6 A;  1B1Z A;  1I3Q B;  1JOO A;  1SND A;  4QL5 A;  3QOL A;  4G7H C;  1QZG A;  1NMG A;  5ELO A;  1TQO A;  4DV2 L;  2PCF B;  3W3A A;  1FJG Q;  3BG3 A;  2NN6 G;  4L5R C;  2E76 C;  3J81 c;  3ULJ A;  4K14 A;  1BKB A;  2V1C C;  3GTL B;  3H0G B;  3GTQ H;  5GAD C;  5C3W A;  5JEA H;  5JPN C;  1GVP A;  1Y8N B;  2CVR A;  4HED A;  4DR7 Q;  2B2Y C;  3D31 A;  2DNE A;  3HRZ C;  1TS2 A;  4GN4 B;  5ISR A;  5IT9 c;  3HOU H;  2O5J C;  2KUM A;  3RZD B;  3NSW A;  1IYJ B;  3H91 A;  1BVS A;  4J1M A;  2JN4 A;  1BUV T;  1QB5 D;  5JEA G;  2A19 A;  3DM3 A;  4RG1 A;  1JB3 A;  3FVQ A;  2Q2H A;  2KEE A;  3QJY A;  2AWO A;  1F9R A;  4A3F B;  5M5W H;  3CW2 C;  4P2C B;  5FKA C;  1VQ9 A;  2NVT B;  2Q8T A;  5L37 A;  4JI0 Q;  1PTO F;  1TKW B;  5M3F B;  1O7Z A;  1I4G A;  4A3E H;  4LMQ D;  3NEM A;  1HH2 P;  2KED A;  3I4L A;  1VCI A;  3S17 H;  4GNX A;  3HZX A;  3GTJ B;  5EJW A;  3GTP B;  3OMC A;  4IFD I;  3A5Z B;  3MXP A;  2HCC A;  1PMR A;  4QY7 A;  1KTK A;  1B4O A;  1A8V A;  4GKK Q;  2PPB C;  4DXF A;  4A3K B;  3PO3 H;  3B6Y A;  5M5Y B;  1WFQ A;  4ME5 A;  1GD7 A;  2F0I A;  4DV5 L;  1HUM A;  2IX3 A;  4JI5 Q;  1LTA D;  3A8J E;  1PH7 A;  1ZYR D;  1RIP A;  3V96 A;  1STN A;  3I3C A;  4X3K A;  3KDF A;  4DNR B;  3G6E A;  1SMY D;  1QWY A;  2OCE A;  1EY9 A;  4DGZ A;  5IYC G;  1N32 L;  2CQA A;  3OHX C;  4Z9C B;  1SNP A;  4C3J H;  1SE3 A;  3RZO B;  2X6L A;  2NZO A;  3K5O A;  1PZI D;  1X3G A;  3F2D A;  2K5Q A;  4A3K G;  1PHJ A;  4K8I A;  1D1I A;  4BBS B;  4R8I A;  2I5L X;  1ENA A;  5J22 A;  4LF4 Q;  1BQQ T;  3QIA A;  1L0X B;  1TT2 A;  4ZCK A;  1L1O C;  1GO3 E;  3CF5 A;  4KKS A;  1IZ6 A;  3TP7 A;  2A6E D;  1QVF A;  4XT3 B;  1IBK Q;  4C56 C;  1DGS A;  4ULL A;  3S1R B;  5J39 A;  5EPL A;  2VQE L;  1PTO C;  5CGK A;  3S2D B;  1EIF A;  3J81 L;  1HFG A;  4P74 A;  3M3Y B;  4KJN A;  5FJ8 G;  3BVG A;  2JA7 H;  3STB D;  2L12 A;  1NNX A;  3T16 A;  4LFA Q;  2EY1 A;  4KHZ A;  4IPD A;  2R92 G;  4L5S A;  4IN3 A;  4DV6 L;  1U4P A;  2X69 A;  2H4O A;  1B50 A;  2B39 A;  1X54 A;  5IGE A;  3VA7 A;  3L7Z C;  5CV7 A;  3UI2 A;  5IYD G;  3GTK H;  1VQD A;  3HOY H;  1YZ6 A;  1STB A;  1HCZ A;  4GS3 A;  5JEA J;  3T1H Q;  1K3R A;  4CGY B;  4A75 A;  2MO0 A;  1VQP A;  1JJC B;  1TWF H;  2MHV A;  2NVX B;  3BVM A;  1W6J A;  3H94 A;  1LTB D;  4RH6 A;  1KLU D;  4OX9 L;  3S17 B;  4CJ2 C;  2B2W A;  1Q1B A;  3KF8 A;  3FPU B;  4R9W A;  4IUT A;  4GNX C;  4OL7 A;  4XT1 B;  1LT4 D;  4DR6 L;  3MC0 B;  1EWI A;  4JI7 L;  1D5X C;  3ERO A;  1M1K C;  5M5Y H;  3ERQ A;  1K0S A;  5F2D A;  1ENF A;  4JOI A;  1BNZ A;  1HNX L;  3J80 E;  1WJJ A;  5GQO A;  2B8G A;  2X6G A;  3P75 A;  2AWN A;  3I4M B;  1EU3 A;  4KHP Q;  4GN5 A;  1H9S B;  4EQP A;  2AUJ D;  5FO9 B;  4EVO A;  1G8Z D;  3HOZ G;  3KF6 A;  1N8R C;  1EQR A;  4JI5 L;  2A69 C;  4DV2 Q;  3W1B A;  3GO5 A;  3RD4 A;  4DR4 Q;  4HIK A;  3P20 A;  3HFZ B;  3UE1 A;  3CC7 A;  4RHR A;  4R8N A;  1I4P A;  2LS0 1;  5GRO A;  3NTK A;  2F0O A;  1Y8P B;  5FLX c;  1GJX A;  1JWU D;  2UUC L;  1L0W A;  1ZEQ X;  1MBY A;  3HOX H;  4L5T A;  4LWC A;  2KCM A;  1D5M C;  1AW7 A;  4A3M G;  3HOW G;  1A62 A;  2VB2 X;  2QF7 A;  2JA7 B;  4X64 Q;  1JJG A;  4KY7 A;  2KHS A;  3TP8 A;  3TS0 A;  3HS0 C;  3QOJ A;  3MFG A;  1Z9F A;  2F0P A;  1NR2 A;  4EQ5 A;  2F0K A;  3OMG A;  4Y7N H;  2ICE C;  2FMM A;  3IL8 A;  2YTV A;  1V8Q A;  1NBW A;  1WCM B;  3V05 A;  4PZ7 A;  4X66 Q;  3QO2 A;  1VF7 A;  2E2I B;  2L1B A;  1I5F A;  3HGB A;  4N9P A;  1TWF B;  1CHQ D;  4IO9 A;  1XNQ Q;  1G2T A;  1XMO L;  2UUA Q;  2R93 G;  2RHS B;  1KAA A;  3VR2 A;  1EL0 A;  1R4P B;  1QUQ B;  3KDF B;  1WVL A;  3CAM A;  2F03 A;  5T1G A;  5I4D A;  4LF9 L;  3KJO A;  5K36 H;  3HOZ B;  1ET6 A;  2N55 A;  3S2H B;  2NN6 I;  4CDD C;  4KLK A;  1VQ4 A;  2NTT A;  1UUP A;  3G4S A;  4PZ8 A;  1BCP C;  3F8T A;  3CCM A;  1QIL A;  2YU9 H;  5EPJ A;  3CME A;  2WB1 B;  3MVV A;  2ZM6 L;  2KJX A;  1Q12 A;  4JPB W;  1VMC A;  2EYO A;  3CMA A;  1K8G A;  2WAQ E;  3A56 A;  1EWC A;  4DV1 L;  1L1O A;  3VA5 A;  2VQF L;  3CC2 A;  1AP0 A;  1HNW Q;  1TWH B;  1A0I A;  2AHO B;  5EKK A;  1JOQ A;  3VYU A;  5LMN L;  2PQA A;  1PDQ A;  4RGT A;  4KN7 C;  1EFI D;  1QJO A;  1KRT A;  2R92 B;  1EYC A;  1DJR D;  2CH4 W;  4POF A;  3PUY A;  4R4Q A;  1XPU A;  1OXT A;  1TWG B;  4IUN A;  2D62 A;  1TII D;  2EYF A;  4BA2 I;  1AE2 A;  1CT1 D;  1HXY D;  3K0Y A;  2GA4 B;  1WOC A;  3S1N H;  4I7A A;  2ASB A;  2BA0 A;  4ODG A;  3ERS X;  3OOC A;  4DAM A;  2Q2U A;  4ID6 A;  2KQ3 A;  2KCC A;  1NMF A;  3I4O A;  1PH5 A;  3KLS X;  2V4D A;  4JV5 L;  3SK5 A;  2ZJR A;  1LUZ A;  2I5M X;  2Z0S A;  3HOX B;  3BVZ A;  1CFM A;  4A3J G;  3F2C A;  5LMN Q;  3PF5 A;  2VB3 X;  3J80 c;  4JBM A;  3M4P A;  3HOV G;  1S5D D;  5IYC H;  3I7F A;  2JA8 G;  4JBW A;  4XQQ A;  1F2L A;  2MPM A;  3NEL A;  4GOP B;  3TRZ A;  1A6X A;  1UE6 A;  3KOJ A;  2ATW A;  2F0L A;  4M1U B;  1MJE A;  2VQF Q;  1EEF D;  4DKA C;  2G9D A;  5CR3 A;  3E0E A;  2K14 A;  1H9J A;  3PMF A;  1FVI A;  5JJZ A;  3FKI G;  5EKI A;  2ZM6 Q;  4LF7 L;  4BXX H;  3GDE A;  4KK7 A;  3Q23 A;  2AMC B;  3K58 A;  4B3T L;  1W2B A;  3KLW A;  5A2Q E;  5FO7 B;  1SJH D;  4KTA A;  4YY3 L;  3ICE A;  2NN6 H;  3M7N A;  4A3D B;  2JA8 H;  2O4X A;  3KLR A;  4QJF A;  1I4H A;  3I56 A;  1FGB D;  3H09 A;  1UNS A;  5IGB A;  4IFD H;  1PLF A;  1T5E A;  1GUN A;  4JOI C;  4H02 A;  5E4X A;  3OTO L;  2JA6 H;  1QZH A;  4P75 A;  1E1T A;  3GV3 A;  3MXN A;  3FKI H;  3CCL A;  4IPG A;  4G7Z C;  1JT8 A;  3TRE A;  4KI0 A;  3HOZ H;  3S2H H;  1UEA B;  3O13 A;  3G48 A;  2BE5 D;  2F0U A;  1CZG A;  2K5H A;  1Q3L A;  1X9N A;  2IHE A;  5EPK A;  2LFN A;  1A3T A;  1PH1 A;  2B63 G;  1B44 D;  3HG9 A;  4K8J A;  2XWJ B;  2B8F A;  5M5X H;  2YU9 B;  1HR0 L;  4A3B G;  1HFN A;  3H3V I;  4HSV A;  2ZXO A;  5AJ3 Q;  4AIM A;  1BXT A;  2CCZ A;  1V1P B;  4YWM A;  2UU9 L;  4JI6 Q;  2SEB D;  1YBY A;  3CCR A;  1EY5 A;  1AE3 A;  1L2F A;  1WYD A;  1E3P A;  1HHV A;  2RCF A;  2R3Z A;  5DNF A;  1JR0 D;  1KNA A;  3C3L A;  1HR0 Q;  2KHI A;  1KDC A;  2K1B A;  2PMZ B;  1JIC A;  4GLV B;  1YJW A;  1YIT A;  4AH6 A;  5C5L A;  1FR3 A;  5IYB G;  2R92 H;  3U4V A;  4LNQ A;  1N36 L;  3G7L A;  1N9W A;  4L8J A;  5I9O A;  2XNA C;  3TQY A;  4QUC A;  1HQM C;  4IJL A;  3CCV A;  2JE6 I;  3S14 H;  4JI1 L;  3S1N B;  1O7Y A;  3PIO 3;  1XTD A;  1PH9 A;  4BXX G;  1V1Q A;  2K33 A;  3QWN A;  3RMH A;  2EYL A;  4U67 3;  2VL6 A;  2GN5 A;  2JA5 H;  4A4I A;  3C1E A;  3A0J A;  4DV1 Q;  5JPM C;  3MTS A;  4M8A A;  1DON A;  1SFO H;  1SYG A;  3GV6 A;  2PW7 A;  3CCQ A;  4IJH A;  5C4Z A;  1E2Z A;  3L9A X;  4G7O C;  4O42 A;  2JJQ A;  1BCP B;  3ND8 A;  1TWC H;  3KLS A;  2JK8 A;  3MZ5 A;  4IUU A;  1AFP A;  1K73 C;  2A5H A;  1D8L A;  2OQ0 A;  3AYH B;  2F4V Q;  1XJV A;  1Y1W B;  5FLM H;  1ICW A;  4MZ9 A;  5EGT A;  4RFB A;  2ZJQ A;  1RHP A;  1TXY A;  2NVY B;  3IRB A;  5IGG A;  1CA6 A;  4A3M H;  4A93 G;  1EZ8 A;  2F0S A;  1DCZ A;  2OXP A;  1VQK A;  3HOX G;  4OWT B;  4RAU C;  2BDN A;  4DA2 A;  5IOD A;  2WB1 E;  3NK9 A;  2B29 A;  1EIH A;  1ASY A;  4C3J G;  3M4O H;  2ID0 A;  4FF2 A;  2JP1 A;  1CK1 A;  1ONL A;  1SYF A;  5I2X A;  1TS5 A;  3IFT A;  3ONA B;  2N49 A;  4IFD J;  5IP9 G;  1WTV A;  3TS2 A;  2XN9 C;  4DV5 Q;  1G6P A;  3J7A 5;  1ET9 A;  2EY5 A;  4DR5 L;  4LF8 L;  2E74 C;  3A7L A;  3VR5 A;  5H1S E;  1GUT A;  1B9M A;  2KA7 A;  3IFD A;  2B2T A;  5D3I B;  2B63 B;  4HJA A;  2HHH Q;  2QEJ C;  4K5V A;  4BY7 G;  5FOB B;  1XXG A;  2UUB L;  4HN7 A;  5C0X H;  1ZYR C;  4IOA A;  3STB C;  4DR3 Q;  2B2U C;  1O80 A;  4L5Q A;  3PIP A;  2SOB A;  2PZW A;  4JI7 Q;  1KLG D;  4UPA A;  4DR6 Q;  3UDG A;  3S15 H;  1STA A;  2XTI A;  1X6O A;  3T53 B;  1IHZ A;  4Q5V A;  1CSP A;  1BBU A;  1SN8 A;  1HJP A;  4JI2 L;  1K83 B;  3J81 E;  3TSS A;  4B3M Q;  4C3H G;  5T1I A;  4DR7 L;  2R93 B;  2NZH A;  1XMQ L;  3D3R A;  2CKZ B;  3S9W A;  3I91 A;  1WTP A;  4A3F G;  3I4M G;  3I73 A;  1NSN S;  3RN5 A;  2IX1 A;  5IYD H;  1D2B A;  4FYD A;  2F52 A;  1PRT B;  3RN2 A;  3HKS A;  4LUV A;  4A76 A;  1GUS A;  4TKO B;  1J5E Q;  4LF8 Q;  2AKW B;  3S16 B;  5IYB H;  4K5X A;  1I4R A;  5HGQ A;  4BY1 B;  5E3F A;  2CW0 D;  1Y1W H;  4KY6 A;  1VQO A;  1Q7Y C;  2Q8I B;  4U68 A;  4MTK A;  1EOT A;  2CH4 A;  2NBF A;  5IP9 H;  3U9O A;  1G51 A;  2EYP A;  4A3M B;  1EY8 A;  1SAP A;  4LFB L;  4A3L H;  5DEH A;  2HUG A;  4H7B A;  4HCE A;  2WIN B;  5FLX L;  2VQE Q;  3LWU A;  4WFN 3;  4RA8 A;  3MA2 B;  4WJW A;  3M4O B;  3D4W A;  2F0V A;  3Q22 A;  4B3R L;  4ILW A;  1CKN A;  2Y0S E;  5FJ8 H;  5JVG 3;  3EN2 A;  2K01 A;  5IP7 H;  3NWT A;  1VMP A;  5COR A;  1U4L A;  1SNQ A;  1Y14 B;  2VUM H;  1EZ6 A;  1GHJ A;  4XXE A;  1LT5 D;  4FXD A;  2D9U A;  3F2U A;  1ESF A;  3IKJ A;  1F9P A;  1BBW A;  1RF2 D;  3NUC A;  3EIV A;  4X3U A;  4DV4 Q;  1O7L A;  4LF7 Q;  2MO1 A;  3HEJ A;  2CWP A;  1SE8 A;  3A8K E;  1XPR A;  3AQQ A;  2UXD L;  3C1F A;  3BDL A;  4ZUI A;  1VQ6 A;  4C3H B;  2C9O A;  4IPH A;  1X55 A;  2WAQ B;  4OXP A;  1JMC A;  3OTO Q;  3BZD B;  3NTH A;  2MQH A;  3UDF A;  3R2I A;  1J9O A;  1EUJ A;  1X56 A;  4FDB A;  1B53 A;  3TEH B;  1VQ8 A;  4BY7 H;  1PXU A;  5KND A;  2Q2I A;  4WOR A;  2ZTE A;  3J81 i;  5C0X J;  3HOV H;  3SR1 A;  2EJM A;  3T1Y Q;  1EYA A;  1SXT A;  3R2T A;  2UXB Q;  5ELD A;  3J7A F;  4HID A;  4UAI A;  4E6I A;  3AMU A;  4HCS A;  3H15 A;  3BYY B;  3PCO B;  3QG1 A;  5COY A;  1PZJ D;  2N3S A;  1QUQ A;  2RSO A;  5CBA E;  4JI6 L;  4P71 A;  3OIQ A;  2K75 A;  4OWW B;  2K5W A;  1PTO D;  2NYZ D;  2EYJ A;  1BDO A;  1F2Y A;  3WWV A;  4PQX A;  3E0J A;  2LMC B;  1P8L A;  3EFX D;  3KK7 A;  2L4N A;  5EQ0 A;  4XIG S;  2Z6K A;  3I4N B;  4FVM A;  5E1F A;  2EXD A;  3FMC A;  2OWO A;  2E2J B;  2FXQ A;  4B3M L;  3TBI B;  1SRU A;  3NBH B;  4ALP A;  2R61 A;  2M2L A;  1N34 L;  4F87 A;  1VQH A;  5EKL A;  3DWA A;  2ZT9 C;  5DAU A;  2Q8R E;  1IBM L;  4RHS A;  2AUK A;  1I6H B;  3HOW H;  1XNR L;  3D6C A;  1MGS A;  3W2D A;  2K5V A;  1Y1W G;  1YNX A;  1OXX K;  5I9P A;  1KRS A;  4MIU A;  2VUM B;  3PO2 G;  1MD2 D;  2WKD A;  4NDX A;  2JEB I;  4K0K L;  2HHH L;  1D1K A;  2SDF A;  1R9T B;  3I4N G;  4C3I G;  4YCW A;  1DYQ A;  2NVQ H;  4HIO A;  1DXM A;  5K36 G;  4AYB G;  3J7Z C;  3KUP A;  5HGT A;  3NBH A;  5CC4 A;  4O2D A;  3U58 A;  3PO2 B;  5CV5 A;  5C4X H;  2N88 A;  3K0X A;  4GN3 B;  2ZJP A;  3CC4 A;  4JI3 Q;  1VQI A;  1A2T A;  4FF3 A;  5A2Q L;  1KXL A;  3NPP A;  4DR1 L;  5LMN W;  5IY0 A;  1A15 A;  1OXU A;  3CRK C;  3DHQ A;  1UAP A;  2R6G A;  2KEC A;  5FK9 C;  3T1H L;  3GQB A;  3TZU A;  2DY7 A;  2XIW A;  1QE6 A;  4JI3 L;  1KAW A;  1WTR A;  2EXZ A;  4OWX B;  2PNR C;  2E5L Q;  4FO2 A;  5GAH C;  1TWA B;  2K32 A;  3R93 A;  2RVL A;  3CRL C;  4BA1 I;  4IQZ A;  3TME A;  4B3S Q;  2E2D C;  1IKL A;  1DD2 A;  4MNO A;  2UXD Q;  3NQT A;  3VR6 A;  4K0K Q;  4X62 L;  5K5P A;  3OW7 A;  1ASZ A;  5IIF A;  4B3T Q;  1YHB A;  4UHV A;  4JK1 C;  2I07 B;  1SNC A;  1K3B C;  1HZB A;  4GKJ L;  3RZD H;  1STY A;  1TY0 A;  4LFC Q;  4CDE C;  3HKZ B;  3JAM E;  4PMB A;  3I70 A;  3SK8 A;  2Z8L A;  1DOL A;  3DMU A;  1SRO A;  4PG3 A;  3PGZ A;  2IX0 A;  1YEZ A;  4PMC A;  2JYO A;  2VS1 A;  4FF4 A;  3Q6S A;  2J0T D;  1B70 B;  4CKE A;  1IYU A;  1I94 L;  3WOF A;  3NBI A;  3GTG H;  1I6H H;  5C4H A;  2SNS A;  2C5C A;  1JCK B;  4GKJ Q;  3A5U A;  3MWY W;  1CZW A;  1ROD A;  4DR2 Q;  1U4R A;  1GKH A;  1SYD A;  4DAY A;  2DN8 A;  4HTH A;  1QCB D;  4HR7 B;  3TP6 A;  5ELB A;  1U9R A;  1HPC A;  1SEB D;  1G91 A;  4DV6 Q;  4K6L A;  2E2H H;  3T51 B;  1C0A A;  1ZXT A;  1C7Y A;  5CV8 A;  4DU9 A;  5M3M G;  5G3L F;  1HTL D;  2Q2T A;  4B3R Q;  2HD3 A;  1EQV A;  2K4K A;  2R7Z H;  3FHW A;  1MJC A;  1TVX A;  2DJF C;  4UP9 A;  5ELN A;  2C35 B;  4LUZ A;  4DV0 L;  3PO2 H;  4DAP A;  1CUK A;  3T1Y L;  4C3J B;  3EQL C;  1CQF A;  5C4X B;  4PNY A;  1F9Q A;  4TQU S;  1Z7T A;  4QB4 A;  4OHJ A;  4EQN A;  4BBS H;  3BYT B;  2FIN B;  1D5Z C;  4GZY C;  4MHE A;  5I6Y A;  1HZ9 A;  1RL2 A;  4JYA L;  1V43 A;  3LGJ A;  3MFY A;  4RGN A;  4A3D G;  1DOM A;  1CHP D;  1LTL A;  4BBR H;  1N33 Q;  4YWK A;  2I5H A;  4A3G G;  3AFP A;  3S1R H;  1FNW A;  1S5F D;  1S5C D;  1N34 Q;  3N6R A;  3S2D H;  2O2L D;  4AYB B;  1TWA H;  2WV6 D;  4YY3 Q;  2KCT A;  4L63 B;  1K9M C;  1SLJ A;  2A68 D;  3OSO A;  3TDQ A;  3M3Y H;  1N32 Q;  2ZTD A;  2F3W A;  4IZ8 A;  5M9O A;  4CBV A;  3NQI A;  1I4X A;  4JG2 A;  1F77 A;  1YNN C;  3A7A B;  4RKL A;  3H3V C;  1RJT A;  1MIU A;  2MJ8 A;  1PRT F;  4LF6 Q;  5KRU A;  4DK6 C;  5CBE E;  4JBJ A;  3HOY B;  1GHK A;  2RDG A;  1Y1V H;  1XWE A;  3WOE A;  5C5M A;  5IE8 A;  1GM5 A;  2ENB A;  4A3J B;  4APV A;  4RCN A;  1OTC A;  1VQ5 A;  2RDF A;  4I65 A;  1CQV A;  3JC6 6;  4C1N I;  2R7F A;  4H44 C;  2NVX H;  2B2W C;  2WKC A;  3ZJY C;  3GTG B;  4R4C A;  4KMU C;  2BCO A;  1A63 A;  4FP5 D;  3A55 A;  1S5B D;  1IBL L;  4H13 C;  1SYB A;  3GTM B;  5AFW A;  3HOY G;  4P72 A;  4YIJ A;  4DK3 C;  1LTT D;  4Y52 H;  2XVS A;  2A6H D;  5CV4 A;  3T56 B;  1STE A;  4DK0 A;  2A68 C;  5I6W A;  2PZT A;  2A8V A;  2JQO A;  2ZXP A;  1X32 A;  2E2H B;  1SE4 A;  4EX5 A;  3R8B A;  3I4M H;  5IWA L;  2QEX A;  1EQT A;  4J15 A;  2XSC A;  1LT6 D;  2LKV A;  1GUO A;  1XMQ Q;  3PV0 A;  4HSP A;  1HZC A;  3DEP A;  3NHH A;  1IKM A;  2KHJ A;  3J7Y W;  1PH6 A;  1V9P A;  1IBM Q;  1PRT C;  4CJ1 B;  2TMP A;  4LF4 L;  2XRQ D;  3D6W A;  3MEF A;  4HJ9 A;  1I3Q H;  3H3V H;  3W1G A;  1CKN B;  1VQJ A;  3E3X A;  3D0F A;  3FEW X;  1JWM D;  4ZYS A;  1C4Q A;  2JA9 A;  1IW7 D;  2F1M A;  4LAA A;  2IJ0 A;  1KDA A;  5LL6 X;  3RLN A;  1XX8 A;  1V1O A;  2EZV A;  2L15 A;  4XDX A;  4OGQ C;  2AQ1 B;  3GTL H;  3H0G H;  3VR4 A;  3ND9 A;  1F2M A;  1KD1 C;  2N78 A;  4ZRZ A;  2KBN A;  3HOU B;  3JAM L;  3RLF A;  1PH3 A;  1HNZ Q;  5KGU A;  4G4K A;  2PQE A;  3VYT A;  1MI2 A;  4DK1 A;  4X65 Q;  1VF5 C;  3V2T A;  3AFQ A;  4JV5 Q;  3BDC A;  5FLX E;  1SMX A;  3VDY A;  1WTQ A;  2UXB L;  4RKB A;  1Y1V B;  1J6Q A;  1FYC A;  4A3F H;  5C44 G;  4A3J H;  3NP8 A;  5LMU L;  2NVT H;  5DM6 3;  3OYY A;  1PRT D;  2WB1 G;  2LXJ A;  4A3E B;  3C46 A;  2VZA A;  1D7Q A;  2KOL A;  2F0N A;  3GD7 A;  1I94 Q;  2HT1 A;  1LTR D;  2KVM A;  3DM1 A;  2MUY A;  1U5K A;  1SDF A;  3MHB A;  3DWP A;  3GTM H;  2PNH A;  1ICF B;  4YWL A;  2J7Z A;  1ZKO A;  3X3M A;  2F0W A;  4QMG A;  4A3K H;  2QKI C;  3GTO B;  2NZ1 D;  2R7D A;  2DY8 A;  4XYO A;  2AQ3 B;  4B9W A;  4DR3 L;  5M3F G;  4QIW B;  1CM9 A;  4C2M H;  5BN3 A;  1W6K A;  1AZQ A;  4HJ8 A;  1E2W A;  3F2B A;  3VR3 A;  1F2Z A;  1X3E A;  3U4Z A;  1TWH H;  3MXN B;  4O0A A;  3VYS A;  4A3C G;  1I6V C;  4F8M A;  1SE2 A;  1FJG L;  1B8A A;  1EY0 A;  4OEM B;  3CQZ H;  1UE1 A;  1T5X D;  1N33 L;  2HQL A;  4JW0 A;  3RZO H;  1RTO A;  1TR5 A;  1Z6H A;  4A3B B;  2F3V A;  2EE1 A;  2L11 A;  2YV5 A;  2Z4H A;  2JA7 G;  3UDX A;  4XQN A;  1LYL A;  1WTW A;  3BZK A;  4A3C H;  1R4Q B;  4YHH L;  4LF5 L;  5D14 A;  1FNV A;  2L5T A;  2RCN A;  3URY A;  2F0H A;  3CCS A;  1F9S A;  5FO8 B;  4DR1 Q;  5C6A A;  2NWG A;  3Q24 A;  1PVO A;  2OT2 A;  1PH4 A;  1J8I A;  1M4V A;  2FMC A;  2D2C C;  2EY6 A;  4QF4 A;  4CKB A;  3RR5 A;  1SR3 A;  1UEB A;  2KCN A;  2MP1 A;  3NTI A;  1Q82 C;  1U0L A;  1LAB A;  4HIM A;  2WP8 J;  5D3D A;  1J5E L;  2UXC L;  4LFA L;  3NWS A;  4G57 A;  4AYB E;  3J80 i;  3WDN A;  4HJ5 A;  2RA4 A;  3J7A V;  1SJE D;  3T13 A;  2HIV A;  4KHV A;  3GTK B;  4A3D H;  4LW1 A;  1BCP D;  4FNF A;  3MXG A;  4QGU A;  5HUR A;  2PI2 E;  1NTG A;  4R1J A;  5M3M B;  2F0Q A;  1PV4 A;  2JA6 B;  1M8A A;  2Z4I A;  3A8I E;  4JI2 Q;  2QDL A;  4K6D A;  2PI2 A;  1XNR Q;  3SK4 A;  1HR0 W;  3E6Z X;  4LF9 Q;  2K52 A;  1L1O B;  2I46 A;  1SNO A;  3J80 L;  1BR9 A;  4JI8 L;  1GOZ A;  1LLR D;  2OF1 A;  2A1A A;  2WAQ G;  5M5X B;  5LL6 S;  3F1Z A;  3GTO H;  1HQR D;  2JA6 G;  3QB3 A;  1EQQ A;  1NJI C;  5C44 H;  4C2M B;  4DV0 Q;  3CCE A;  3P1H A;  4K5W A;  3SDZ A;  3J81 j;  3X3N A;  3TZD A;  2B2T C;  4JI4 L;  1ESR A;  1C48 A;  1MKH A;  3TP5 A;  3E9H A;  4XTC S;  2ZXR A;  1VS0 A;  1E24 A;  4X64 L;  2UU9 Q;  1AN8 A;  5IT9 L;  3RLO A;  1HA5 A;  1Q1E A;  4JYA Q;  2PW5 A;  3CQZ B;  1VDZ A;  4UDU C;  5JAV A;  1YNJ D;  2B2Y A;  1K8M A;  1AEX A;  3R3O A;  4B9X A;  4A3B H;  1PYS B;  4DR2 L;  3L3O C;  2JSO A;  2QW7 A;  4TVA B;  4X6A H;  3EBE A;  2IPK D;  3I8Z A;  1RDP D;  5KNB A;  2L9H A;  4JI0 L;  5FLM G;  2K04 A;  4DNI A;  1EEI D;  1RTN A;  4ZKB B;  2LY7 A;  2CWA A;  1EWH A;  4A93 H;  1Y8O B;  5DM7 3;  2L0C A;  3JAM c;  1WTX A;  1IXR A;  1YVC A;  2LSS A;  1K0R A;  4CKC A;  2YTY A;  2F0M A;  1E0B A;  1LTS D;  1A2U A;  2IY5 B;  1SYC A;  1X3P A;  4LFC L;  5ELC A;  4DV3 Q;  4BBR G;  5D65 A;  2UUC Q;  1O7I A;  4ZLT F;  1Q81 C;  4GOP C;  3NE5 B;  2BE5 C;  4Y7N B;  4DV4 L;  3LX0 A;  2IT1 A;  1KIX A;  1RCV D;  5JJL A;  1VQE A;  4GLA C;  1WCM H;  1YNJ C;  4ZQ3 A;  5M3M H;  3KF6 B;  1SYE A;  2E2I H;  4RCO A;  3G6J B;  4GOP A;  1H9S A;  2E75 C;  2RF4 A;  1SNM A;  4TSS A;  1S3O A;  3KBG A;  1XNQ L;  4R4O A;  4PV1 C;  5C3E G;  1Y69 U;  4KJO A;  4NXN L;  1DM0 B;  1AZP A;  3H0G G;  3K81 C;  4N9T A;  1NUC A;  2UUB Q;  4DAY B;  4PMW A;  3A54 A;  1X3F A;  4WJ3 M;  5IWA Q;  3PSI A;  5BN4 A;  2XRS D;  1SMY C;  2K7V A;  3PUV A;  3KF8 B;  5C44 B;  1T9H A;  3CP0 A;  3ULL A;  4A3I H;  1TU2 B;  4DPG A;  2B63 H;  2QGQ A;  3L0O A;  1XPO A;  3K7A B;  1PH8 A;  2ZTC A;  4CJ0 B;  4ZAI A;  2F0F A;  2Y0S B;  1VQB A;  2PQA B;  2QDB A;  1X65 A;  1MSH A;  1C8C A;  1HNW L;  2B3G A;  3KYH C;  2F0D A;  2JXM B;  2K5D A;  1NR4 A;  2FJ2 A;  1IYV A;  3PO3 G;  1HUN A;  3RNU A;  3AEV A;  2DJG C;  4ZK9 B;  1JE5 A;  2G9H D;  2EIF A;  5IGF A;  4WJ4 A;  4QIW E;  4CDC C;  2EYM A;  2IL8 A;  1TWG H;  2P5Z X;  4IAL A;  4IUV A;  4DXG A;  1K8A C;  1X3Q A;  1MHW C;  4FXG C;  2D0O A;  3EJI A;  4UP8 A;  4ABN A;  4C3I B;  1YHQ A;  1GUW A;  1K83 H;  2L55 A;  1XTC D;  4DR4 L;  2PZU A;  2J4X A;  2FFK B;  1VQL A;  4A93 B;  4GLX A;  1KDB A;  4WRD A;  5BN5 A;  1JOK A;  4J8Q A;  1XMO Q;  4K2K A;  5LHY 1;  1S5E D;  4XYQ A;  3SE0 A;  3LNN A;  4KHP L;  4BBS G;  1CI3 M;  1Q90 A;  3BDO A;  1WTH A;  3I72 A;  1HRJ A;  1G29 1;  3IAY A;  3M7G A;  1IBK L;  3S16 H;  2VUM G;  4BY1 H;  1EY4 A;  1PYB A;  1STG A;  4HMI A;  2MFI A;  3DEO A;  3K6O A;  3I90 A;  3TN2 A;  2JA8 B;  2VNU D;  2B2V C;  2MGS A;  3W5O A;  2UUA L;  3AU7 A;  3NEN A;  2QA4 A;  2DGY A;  1E1O A;  1SSO A;  3FKI B;  3PUX A;  3VYR A;  1PZK D;  2YYZ A;  2Z1C A;  1A3V A;  5E7N A;  1L0Y B;  1ENC A;  1WCM G;  2RHQ B;  2EY2 A;  2Y0S G;  3U50 C;  2NTS A;  3CKI B;  4N8X 1;  5EAY A;  1PFN A;  1PYW D;  4IPC A;  2HDL A;  4X65 L;  3E9I A;  4R4T A;  5JJI A;  3JAM i;  4IUR A;  4A3L G;  1Q46 A;  4NXM L;  4GNX B;  2ES2 A;  4LF6 L;  2AQ2 B;  3P7J A;  4A3I B;  3BU2 A;  1HTP A;  1A3U A;  4DV7 L;  2XGT A;  3K7A H;  5IT9 E;  4J6H A;  1Y1V G;  1IW7 C;  2EYH A;  2EOT A;  3HP3 A;  1C9O A;  3ULP A;  1EOV A;  2IWH A;  3M4Y A;  1LT3 D;  1OO9 B;  5C3E B;  1I4Q A;  3CCJ A;  4C3H H;  4A3E G;  3ER0 A;  4X3T A;  3PIO A;  2EPB A;  1E2V A;  2F0G A;  1FNU A;  1GUG A;  1OXS C;  3M4Q A;  4Q0F A;  1WTO A;  1QOH A;  2R7Z G;  1D6E C;  1EIY B;  2A74 C;  4KV6 A;  3C2P A;  4P73 A;  1QVG A;  3S14 B;  2K03 A;  1UWV A;  3N52 A;  4BY1 G;  1B3A A;  1NCV A;  4C3I H;  1QNK A;  5JVH 3;  2CW0 C;  3HOU G;  1PTO B;  4V19 0;  1E22 A;  1VQC A;  1NAP A;  2JA5 B;  5J3B A;  4ME3 A;  5NUC A;  5C3X A;  4IFD G;  1UE5 A;  1MSG A;  5LMU Q;  1SFO B;  3CPF A;  1TS4 A;  1UE7 A;  2RDH A;  5A35 A;  5CV6 A;  3S1M B;  4X3S A;  4F88 A;  3HKZ E;  2BH8 A;  4DV7 Q;  4RGM A;  4IUQ A;  1TWC B;  1EYG A;  4B3S L;  1LM0 A;  3OPO A;  2YTX A;  1AH9 A;  4UP7 A;  1BCP F;  4KY5 A;  2VXW A;  4JI1 Q;  2RBM A;  1YJ9 A;  2EVB A;  4OX9 Q;  4GKK L;  3I2Z A;  1PFM A;  4CDF C;  1YNN D;  3K57 A;  3I4N H;  2NVY H;  4AQY Q;  1I50 B;  2DUD A;  1IBL Q;  1K28 A;  1E7Z A;  4QCL A;  4L6T B;  3S24 A;  4KKU A;  4A3I G;  4LFB Q;  4LK1 C;  3Q0A A;  2PMZ E;  4NP5 A;  1CA5 A;  3DUZ A;  4NW2 A;  1QNU A;  3I55 A;  1EU4 A;  1TS3 A;  3BS1 A;  1KC8 C;  3KBX A;  3UDI A;  3HKZ G;  1WI5 A;  4JI4 Q; 
#chains in the Genus database with same CATH homology
 1KAB A;  2WII B;  5E4W C;  3CU7 A;  2QIL A;  2JEA I;  1S4Z A;  2O5I C;  4O1N A;  5IOC A;  1PFB A;  3CHB D;  2M00 A;  3PUZ A;  5IGD A;  2NVQ B;  3OWE B;  1RKN A;  3E5S A;  3ZYY X;  2H1E A;  2F0J A;  1G6Z A;  1QG7 A;  2A6E C;  4IUP A;  2FHT A;  2HDM A;  4LJZ C;  3SXH A;  2OEO A;  4BWG B;  3S15 B;  2RQX A;  5TSS A;  2PO4 A;  1FD7 D;  1PTO H;  2NUC A;  3FDT A;  1KNE A;  4OO1 I;  1BOS A;  2K28 A;  1LTG D;  1LAC A;  2A69 D;  4FXK C;  3H6M A;  2M9V A;  4NMZ A;  4DF7 A;  4HAE A;  5KYI A;  4S3S A;  2DNC A;  1LO5 D;  2CHB D;  4KN4 C;  4DAV A;  5ELE A;  5JOB A;  1DZ1 A;  4RWS C;  4OIK A;  5CMD A;  2F4I A;  1LV9 A;  5KIX A;  1H9K A;  1BO0 A;  4XQJ A;  4HMJ A;  4TRD A;  4C1N K;  2A73 B;  2K05 A;  5CYU A;  1G2S A;  5J1Z A;  1II3 A;  2D5D A;  3DWQ A;  1K8O A;  5KYL A;  4DFA A;  4CHT B;  4RGO S;  4OO1 G;  4MN3 A;  3EVQ A;  5KEE A;  3RUZ A;  2XWB B;  1EY7 A;  1JE4 A;  4KKT A;  4V0B A;  3SEB A;  3U9S A;  1O78 A;  3ITP A;  3FRP B;  2R7Z B;  1RD9 D;  2PYK A;  4A3G B;  3K59 A;  2IW3 A;  5ELF A;  1SBB B;  1JOR A;  1GXD C;  3SHL A;  1CTM A;  3S1Q B;  4BY7 B;  3D8G A;  2QCP X;  4DN4 M;  1LTI D;  2NB0 A;  5IGC A;  4QUF A;  3SK6 A;  1IL8 A;  2K6A A;  3HOV B;  4I7Z C;  4BBR B;  1B2T A;  1HA6 A;  1Z47 A;  2ICI A;  5C0X I;  3LWE A;  3M85 A;  1ILP A;  3GTQ B;  2TSS A;  3SVM A;  3OWF A;  2WAC A;  3K5L A;  3FPP A;  4H0L C;  2F0T A;  2RSN A;  1XYI A;  1EY6 A;  2EDG A;  4K2L A;  1EYD A;  4DNT B;  1JQY D;  1ILQ A;  2EJG C;  4BS9 A;  4EQO A;  5M5W B;  2B2U A;  1H9R A;  1OXV A;  4EGV A;  4KD4 A;  2HQE A;  4KD3 A;  1V1P A;  5KNC A;  3MAQ A;  2EJF C;  3HOW B;  2BOS A;  1U4M A;  5EBD A;  1STH A;  2BA1 A;  5CV9 A;  3NXW A;  3K5N A;  5EBC A;  1JC7 A;  1ML0 D;  3DXJ C;  1WD0 A;  1DOK A;  3GP7 A;  2F0E A;  3PO3 B;  3T4A C;  2SNM A;  3OIP A;  1EIG A;  1H9M A;  3AB9 A;  5C0X G;  5C4J B;  3D4R A;  3D4D A;  3PUW A;  4ZUJ A;  4ZKC B;  4NKL A;  4OO1 H;  4FF1 A;  1B9N A;  2BDO A;  3MEH A;  2HCI A;  1BF4 A;  5G3L D;  3MXU A;  5I2Y A;  1WD1 A;  2A6H C;  3PIP 3;  3K5M A;  1Q8I A;  4F7X A;  2RKS A;  1JWS D;  1BBX C;  1TY2 A;  2B2V A;  4B08 A;  4OIJ A;  1B1Z A;  3EA6 A;  1I3Q B;  1JOO A;  1SND A;  3QOL A;  4G7H C;  1TQO A;  2PCF B;  3W3A A;  3BG3 A;  2NN6 G;  2E76 C;  4K14 A;  3GTL B;  3H0G B;  5C3W A;  5JEA H;  5JPN C;  1Y8N B;  2CVR A;  4HED A;  2B2Y C;  3D31 A;  2DNE A;  3HRZ C;  1TS2 A;  5ISR A;  2O5J C;  2KUM A;  3RZD B;  3NSW A;  3H91 A;  4J1M A;  1BUV T;  1QB5 D;  5JEA G;  1JB3 A;  3FVQ A;  2KEE A;  3QJY A;  2AWO A;  1F9R A;  4A3F B;  4P2C B;  2NVT B;  5FKA C;  2Q8T A;  1PTO F;  1TKW B;  5M3F B;  1O7Z A;  1I4G A;  4LMQ D;  2KED A;  3I4L A;  1VCI A;  3HZX A;  3GTJ B;  5EJW A;  3GTP B;  3OMC A;  4IFD I;  3MXP A;  2HCC A;  1PMR A;  1KTK A;  1B4O A;  2PPB C;  4DXF A;  4A3K B;  5M5Y B;  4ME5 A;  2F0I A;  1HUM A;  2IX3 A;  1LTA D;  3A8J E;  1ZYR D;  3V96 A;  1STN A;  3I3C A;  4X3K A;  4DNR B;  1SMY D;  1QWY A;  1EY9 A;  4DGZ A;  2CQA A;  3OHX C;  4Z9C B;  1SNP A;  1SE3 A;  3RZO B;  2X6L A;  3K5O A;  1PZI D;  2K5Q A;  4K8I A;  1D1I A;  4BBS B;  4R8I A;  1ENA A;  5J22 A;  1BQQ T;  3QIA A;  1L0X B;  1TT2 A;  4KKS A;  3TP7 A;  2A6E D;  4XT3 B;  4C56 C;  4ULL A;  3S1R B;  5J39 A;  5EPL A;  1PTO C;  5CGK A;  3S2D B;  3J81 L;  1HFG A;  3M3Y B;  4KJN A;  3BVG A;  2L12 A;  3T16 A;  2EY1 A;  4KHZ A;  4IN3 A;  1U4P A;  2X69 A;  2H4O A;  1B50 A;  2B39 A;  5IGE A;  3VA7 A;  3L7Z C;  5CV7 A;  3UI2 A;  1STB A;  1HCZ A;  5JEA J;  4CGY B;  2MHV A;  2NVX B;  3BVM A;  1W6J A;  3H94 A;  1LTB D;  4RH6 A;  1KLU D;  3S17 B;  4CJ2 C;  2B2W A;  1Q1B A;  3KF8 A;  3FPU B;  4R9W A;  4IUT A;  4OL7 A;  4XT1 B;  1LT4 D;  3MC0 B;  1D5X C;  3ERO A;  3ERQ A;  5F2D A;  1ENF A;  1BNZ A;  3J80 E;  2B8G A;  2X6G A;  3P75 A;  2AWN A;  3I4M B;  1EU3 A;  1H9S B;  4EQP A;  2AUJ D;  5FO9 B;  4EVO A;  1G8Z D;  2A69 C;  3GO5 A;  3RD4 A;  3P20 A;  4RHR A;  4R8N A;  1I4P A;  2LS0 1;  3NTK A;  2F0O A;  1Y8P B;  1GJX A;  1JWU D;  1ZEQ X;  1MBY A;  1D5M C;  1AW7 A;  2VB2 X;  2QF7 A;  2JA7 B;  4KY7 A;  2KHS A;  3TP8 A;  3HS0 C;  3QOJ A;  3MFG A;  2F0P A;  1NR2 A;  2F0K A;  3OMG A;  2ICE C;  2FMM A;  3IL8 A;  1V8Q A;  1WCM B;  3V05 A;  3QO2 A;  1VF7 A;  2E2I B;  2L1B A;  3HGB A;  4N9P A;  1TWF B;  1CHQ D;  1G2T A;  1KAA A;  3VR2 A;  1EL0 A;  1R4P B;  1WVL A;  2F03 A;  5T1G A;  5I4D A;  5K36 H;  3HOZ B;  1ET6 A;  2N55 A;  3S2H B;  2NN6 I;  2NTT A;  1UUP A;  1BCP C;  1QIL A;  5EPJ A;  2WB1 B;  3MVV A;  2KJX A;  1Q12 A;  1VMC A;  2EYO A;  3A56 A;  1EWC A;  1AP0 A;  3VA5 A;  1TWH B;  5EKK A;  1JOQ A;  3VYU A;  1PDQ A;  4RGT A;  4KN7 C;  1EFI D;  1QJO A;  2R92 B;  1EYC A;  1DJR D;  3PUY A;  1OXT A;  1TWG B;  4IUN A;  2D62 A;  1TII D;  2EYF A;  4BA2 I;  1CT1 D;  1HXY D;  3K0Y A;  2GA4 B;  2BA0 A;  4ODG A;  3OOC A;  4ID6 A;  2KQ3 A;  2KCC A;  3KLS X;  2V4D A;  3SK5 A;  3HOX B;  3BVZ A;  1CFM A;  2VB3 X;  1S5D D;  4JBW A;  4XQQ A;  1F2L A;  2MPM A;  1A6X A;  2F0L A;  4M1U B;  1EEF D;  2G9D A;  5CR3 A;  1H9J A;  3PMF A;  5JJZ A;  5EKI A;  4KK7 A;  3Q23 A;  3K58 A;  5A2Q E;  5FO7 B;  1SJH D;  4KTA A;  2NN6 H;  3M7N A;  4A3D B;  2O4X A;  3KLR A;  1I4H A;  1FGB D;  3H09 A;  1UNS A;  5IGB A;  4IFD H;  1PLF A;  1T5E A;  1GUN A;  5E4X A;  3GV3 A;  3MXN A;  4G7Z C;  4KI0 A;  1UEA B;  3O13 A;  2BE5 D;  2F0U A;  1CZG A;  1Q3L A;  5EPK A;  2LFN A;  1A3T A;  1B44 D;  3HG9 A;  2XWJ B;  4K8J A;  2B8F A;  2YU9 B;  1HFN A;  4HSV A;  2ZXO A;  1BXT A;  1V1P B;  2SEB D;  1EY5 A;  1HHV A;  2R3Z A;  5DNF A;  1JR0 D;  1KNA A;  3C3L A;  1KDC A;  2K1B A;  2PMZ B;  1JIC A;  5C5L A;  1FR3 A;  3G7L A;  4L8J A;  5I9O A;  2XNA C;  4QUC A;  1HQM C;  2JE6 I;  3S1N B;  1O7Y A;  3PIO 3;  3QWN A;  2K33 A;  3RMH A;  2EYL A;  4U67 3;  3C1E A;  5JPM C;  3MTS A;  4M8A A;  1DON A;  1SYG A;  3GV6 A;  2PW7 A;  5C4Z A;  1E2Z A;  3L9A X;  4G7O C;  4O42 A;  1BCP B;  3ND8 A;  3KLS A;  3MZ5 A;  4IUU A;  1AFP A;  2A5H A;  1Y1W B;  1ICW A;  5EGT A;  4RFB A;  1RHP A;  2NVY B;  5IGG A;  1CA6 A;  1EZ8 A;  2F0S A;  1DCZ A;  2OXP A;  4RAU C;  5IOD A;  4DA2 A;  2BDN A;  3NK9 A;  1EIH A;  4C3J G;  2ID0 A;  4FF2 A;  2JP1 A;  1CK1 A;  1ONL A;  1SYF A;  5I2X A;  1TS5 A;  3IFT A;  3ONA B;  4IFD J;  1WTV A;  2XN9 C;  1ET9 A;  2EY5 A;  2E74 C;  3A7L A;  3VR5 A;  1GUT A;  1B9M A;  2KA7 A;  3IFD A;  2B2T A;  5D3I B;  2B63 B;  2QEJ C;  4K5V A;  5FOB B;  1XXG A;  4HN7 A;  5C0X H;  1ZYR C;  2B2U C;  1O80 A;  2SOB A;  2PZW A;  1KLG D;  1STA A;  3T53 B;  1IHZ A;  4Q5V A;  1K83 B;  3J81 E;  3TSS A;  4C3H G;  5T1I A;  2R93 B;  3D3R A;  3S9W A;  3I91 A;  1WTP A;  3I73 A;  1NSN S;  2IX1 A;  1D2B A;  4FYD A;  1PRT B;  1GUS A;  4TKO B;  3S16 B;  4K5X A;  1I4R A;  4BY1 B;  5E3F A;  2CW0 D;  4KY6 A;  2Q8I B;  4U68 A;  1EOT A;  2NBF A;  3U9O A;  2EYP A;  4A3M B;  1EY8 A;  1SAP A;  5DEH A;  2HUG A;  4H7B A;  4HCE A;  2WIN B;  5FLX L;  3LWU A;  4WFN 3;  4RA8 A;  3MA2 B;  4WJW A;  3M4O B;  3D4W A;  2F0V A;  3Q22 A;  4ILW A;  5JVG 3;  2K01 A;  3NWT A;  1VMP A;  5COR A;  1U4L A;  1SNQ A;  1EZ6 A;  1GHJ A;  4XXE A;  1LT5 D;  4FXD A;  2D9U A;  3F2U A;  1ESF A;  3IKJ A;  1F9P A;  1RF2 D;  3NUC A;  4X3U A;  1O7L A;  3HEJ A;  3A8K E;  3C1F A;  3BDL A;  4ZUI A;  4C3H B;  2C9O A;  2WAQ B;  3BZD B;  3NTH A;  3R2I A;  1J9O A;  1B53 A;  1PXU A;  5KND A;  4WOR A;  5C0X J;  3SR1 A;  2EJM A;  1EYA A;  1SXT A;  3R2T A;  5ELD A;  3J7A F;  4UAI A;  4E6I A;  3AMU A;  4HCS A;  3BYY B;  3QG1 A;  5COY A;  1PZJ D;  2RSO A;  5CBA E;  3OIQ A;  2K5W A;  1PTO D;  2NYZ D;  2EYJ A;  1BDO A;  1F2Y A;  4PQX A;  3E0J A;  2LMC B;  3EFX D;  3KK7 A;  2L4N A;  5EQ0 A;  4XIG S;  3I4N B;  4FVM A;  5E1F A;  3FMC A;  2E2J B;  3TBI B;  2R61 A;  2M2L A;  4F87 A;  5EKL A;  3DWA A;  2ZT9 C;  5DAU A;  2Q8R E;  4RHS A;  2AUK A;  1I6H B;  3D6C A;  1MGS A;  3W2D A;  1OXX K;  5I9P A;  2VUM B;  4MIU A;  1MD2 D;  2WKD A;  4NDX A;  2JEB I;  1R9T B;  1D1K A;  2SDF A;  4C3I G;  1DYQ A;  1DXM A;  5K36 G;  3KUP A;  5HGT A;  3NBH A;  5CC4 A;  3PO2 B;  5CV5 A;  2N88 A;  1A2T A;  4FF3 A;  5A2Q L;  3NPP A;  1A15 A;  1OXU A;  3CRK C;  3DHQ A;  1UAP A;  2R6G A;  2KEC A;  5FK9 C;  3GQB A;  3TZU A;  2DY7 A;  2XIW A;  1QE6 A;  1WTR A;  2EXZ A;  2PNR C;  4FO2 A;  1TWA B;  2K32 A;  3R93 A;  2RVL A;  3CRL C;  4BA1 I;  4IQZ A;  3TME A;  2E2D C;  1IKL A;  1DD2 A;  3NQT A;  3VR6 A;  5K5P A;  3OW7 A;  5IIF A;  4JK1 C;  2I07 B;  1SNC A;  1STY A;  1TY0 A;  3HKZ B;  3JAM E;  4PMB A;  3I70 A;  3SK8 A;  2Z8L A;  1DOL A;  3DMU A;  2IX0 A;  4PMC A;  2JYO A;  4FF4 A;  3Q6S A;  2J0T D;  4CKE A;  1IYU A;  3WOF A;  3NBI A;  5C4H A;  2SNS A;  2C5C A;  1JCK B;  3MWY W;  1ROD A;  1CZW A;  1U4R A;  1SYD A;  4DAY A;  2DN8 A;  4HTH A;  1QCB D;  4HR7 B;  3TP6 A;  5ELB A;  1U9R A;  1HPC A;  1SEB D;  1G91 A;  4K6L A;  3T51 B;  1ZXT A;  5CV8 A;  4DU9 A;  5G3L F;  1HTL D;  1EQV A;  1TVX A;  4DAP A;  4C3J B;  3EQL C;  1CQF A;  5C4X B;  4PNY A;  1F9Q A;  4TQU S;  1Z7T A;  4QB4 A;  4OHJ A;  4EQN A;  3BYT B;  2FIN B;  1D5Z C;  4GZY C;  4MHE A;  5I6Y A;  1V43 A;  3MFY A;  4RGN A;  1DOM A;  1CHP D;  1FNW A;  1S5F D;  1S5C D;  3N6R A;  2O2L D;  4AYB B;  2WV6 D;  4L63 B;  2A68 D;  3OSO A;  3TDQ A;  2F3W A;  4IZ8 A;  5M9O A;  4CBV A;  3NQI A;  1I4X A;  1F77 A;  1YNN C;  3A7A B;  4RKL A;  3H3V C;  1RJT A;  2MJ8 A;  1PRT F;  5KRU A;  5CBE E;  3HOY B;  1GHK A;  2RDG A;  1XWE A;  3WOE A;  5C5M A;  2ENB A;  4A3J B;  4RCN A;  2RDF A;  4I65 A;  1CQV A;  4C1N I;  4H44 C;  2B2W C;  2WKC A;  3GTG B;  4KMU C;  2BCO A;  4FP5 D;  3A55 A;  1S5B D;  4H13 C;  1SYB A;  3GTM B;  5AFW A;  4YIJ A;  1LTT D;  2XVS A;  2A6H D;  5CV4 A;  3T56 B;  1STE A;  4DK0 A;  2A68 C;  5I6W A;  2PZT A;  2ZXP A;  1X32 A;  2E2H B;  1SE4 A;  3R8B A;  1EQT A;  2XSC A;  1LT6 D;  2LKV A;  1GUO A;  3PV0 A;  4HSP A;  3DEP A;  3NHH A;  1IKM A;  3J7Y W;  1PRT C;  4CJ1 B;  2TMP A;  2XRQ D;  3D6W A;  3FEW X;  1JWM D;  4ZYS A;  1C4Q A;  1IW7 D;  2F1M A;  4LAA A;  2IJ0 A;  1KDA A;  5LL6 X;  1XX8 A;  1V1O A;  2EZV A;  4XDX A;  4OGQ C;  2AQ1 B;  3VR4 A;  3ND9 A;  1F2M A;  4ZRZ A;  3HOU B;  3JAM L;  3RLF A;  5KGU A;  4G4K A;  2PQE A;  3VYT A;  1MI2 A;  4DK1 A;  1VF5 C;  3V2T A;  3BDC A;  5FLX E;  1WTQ A;  4RKB A;  1Y1V B;  1FYC A;  3NP8 A;  5DM6 3;  1PRT D;  4A3E B;  3C46 A;  2KOL A;  2F0N A;  3GD7 A;  1LTR D;  2KVM A;  3DM1 A;  2MUY A;  1SDF A;  3MHB A;  3DWP A;  2J7Z A;  1ZKO A;  3X3M A;  2F0W A;  4QMG A;  2QKI C;  3GTO B;  2NZ1 D;  2DY8 A;  4XYO A;  2AQ3 B;  4B9W A;  4QIW B;  1CM9 A;  5BN3 A;  1W6K A;  1AZQ A;  1E2W A;  3VR3 A;  1F2Z A;  3VYS A;  1I6V C;  4F8M A;  1SE2 A;  1EY0 A;  1T5X D;  1RTO A;  1TR5 A;  1Z6H A;  4A3B B;  2F3V A;  2EE1 A;  2L11 A;  2Z4H A;  4XQN A;  1WTW A;  1R4Q B;  5D14 A;  1FNV A;  2L5T A;  3URY A;  2F0H A;  1F9S A;  5FO8 B;  5C6A A;  2NWG A;  3Q24 A;  2OT2 A;  1J8I A;  1M4V A;  2FMC A;  2D2C C;  2EY6 A;  4QF4 A;  4CKB A;  2KCN A;  2MP1 A;  3NTI A;  1LAB A;  2WP8 J;  5D3D A;  3NWS A;  4G57 A;  3WDN A;  3J7A V;  2RA4 A;  1SJE D;  3T13 A;  4KHV A;  3GTK B;  1BCP D;  4FNF A;  3MXG A;  5HUR A;  5M3M B;  2F0Q A;  2JA6 B;  1M8A A;  2Z4I A;  3A8I E;  4K6D A;  3SK4 A;  3E6Z X;  2I46 A;  1SNO A;  3J80 L;  1BR9 A;  1GOZ A;  1LLR D;  2OF1 A;  5M5X B;  5LL6 S;  1HQR D;  3QB3 A;  4C2M B;  3P1H A;  4K5W A;  3SDZ A;  3X3N A;  3TZD A;  2B2T C;  1ESR A;  1C48 A;  3TP5 A;  4XTC S;  2ZXR A;  1AN8 A;  5IT9 L;  1HA5 A;  1Q1E A;  2PW5 A;  3CQZ B;  1VDZ A;  4UDU C;  5JAV A;  1YNJ D;  2B2Y A;  1K8M A;  1AEX A;  3R3O A;  4B9X A;  3L3O C;  2JSO A;  2IPK D;  3I8Z A;  1RDP D;  5KNB A;  2L9H A;  2K04 A;  1EEI D;  1RTN A;  4ZKB B;  2LY7 A;  1EWH A;  1Y8O B;  5DM7 3;  2L0C A;  1WTX A;  4CKC A;  2F0M A;  1E0B A;  1LTS D;  1A2U A;  1SYC A;  1X3P A;  5ELC A;  5D65 A;  4ZLT F;  3NE5 B;  2BE5 C;  4Y7N B;  3LX0 A;  2IT1 A;  1RCV D;  1YNJ C;  4ZQ3 A;  1SYE A;  4RCO A;  3G6J B;  1H9S A;  2E75 C;  4TSS A;  1SNM A;  3KBG A;  4PV1 C;  1Y69 U;  4KJO A;  1DM0 B;  1AZP A;  4N9T A;  1NUC A;  4PMW A;  3A54 A;  5BN4 A;  2XRS D;  1SMY C;  2K7V A;  3PUV A;  5C44 B;  1TU2 B;  3K7A B;  4CJ0 B;  4ZAI A;  2F0F A;  2Y0S B;  2QDB A;  1MSH A;  1C8C A;  2F0D A;  2JXM B;  2K5D A;  1NR4 A;  2FJ2 A;  1IYV A;  1HUN A;  4ZK9 B;  2G9H D;  5IGF A;  2EYM A;  2IL8 A;  4IAL A;  4IUV A;  4DXG A;  1X3Q A;  4FXG C;  3EJI A;  1GUW A;  4C3I B;  4ABN A;  2L55 A;  1XTC D;  2PZU A;  2J4X A;  2FFK B;  4A93 B;  1KDB A;  4WRD A;  5BN5 A;  1JOK A;  4J8Q A;  4K2K A;  5LHY 1;  1S5E D;  4XYQ A;  3SE0 A;  3LNN A;  1CI3 M;  1Q90 A;  3BDO A;  3I72 A;  1HRJ A;  1G29 1;  3IAY A;  3M7G A;  1EY4 A;  1STG A;  4HMI A;  3DEO A;  3K6O A;  3I90 A;  3TN2 A;  2JA8 B;  2VNU D;  2B2V C;  2MGS A;  3AU7 A;  1SSO A;  3FKI B;  3PUX A;  3VYR A;  1PZK D;  2YYZ A;  2Z1C A;  1A3V A;  1L0Y B;  1ENC A;  2EY2 A;  2NTS A;  3CKI B;  1PFN A;  1PYW D;  2HDL A;  4IUR A;  2AQ2 B;  3P7J A;  4A3I B;  1HTP A;  1A3U A;  5IT9 E;  4J6H A;  1IW7 C;  2EYH A;  2EOT A;  3HP3 A;  2IWH A;  3M4Y A;  1LT3 D;  1OO9 B;  5C3E B;  1I4Q A;  4X3T A;  2EPB A;  1E2V A;  2F0G A;  1FNU A;  1GUG A;  1OXS C;  4Q0F A;  1WTO A;  1QOH A;  1D6E C;  2A74 C;  4KV6 A;  3C2P A;  3S14 B;  2K03 A;  3N52 A;  1B3A A;  1NCV A;  1QNK A;  5JVH 3;  2CW0 C;  1PTO B;  4V19 0;  1NAP A;  2JA5 B;  5NUC A;  5C3X A;  4IFD G;  1MSG A;  1SFO B;  1TS4 A;  2RDH A;  5A35 A;  5CV6 A;  3S1M B;  4X3S A;  4F88 A;  4RGM A;  4IUQ A;  1TWC B;  3OPO A;  1BCP F;  4KY5 A;  2VXW A;  2RBM A;  2EVB A;  1PFM A;  3K57 A;  1YNN D;  1I50 B;  4QCL A;  4L6T B;  4KKU A;  4LK1 C;  3Q0A A;  4NP5 A;  1CA5 A;  3DUZ A;  4NW2 A;  1QNU A;  1EU4 A;  1TS3 A;  3BS1 A;  3KBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...