4KY6A

Crystal structure of staphylococcal nuclease variant delta+phs l25d at ph 6 and cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKDMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25D at pH 6 and cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky6A00
3T16A 5HURA 1TR5A 2SNMA 4K8JA 3HZXA 4KY6A 1STYA 2F3WA 4B9WA 1JOOA 5CGKA 5J1ZA 3HEJA 3U9OA 1SNDA 5ISRA 1F2MA 4IALA 5I9PA 5IGGA 3C1FA 1EY8A 1EYDA 2F0KA 2F0MA 5CR3A 1EYAA 1NSNS 2RKSA 1SNPA 2F0FA 4J6HA 5DAUA 5NUCA 3BDCA 3SXHA 5HGTA 5KRUA 4ZUIA 2KQ3A 2OXPA 5C4HA 5F2DA 2F0DA 5CV5A 1A3VA 4MIUA 4J1MA 1SNCA 4YIJA 2F0HA 1ENAA 3PMFA 4HTHA 2SNSA 5C6AA 5J39A 3V2TA 3TP7A 1A3TA 1SNQA 3C1EA 3LX0A 4WORA 5CC4A 3H6MA 4DU9A 1U9RA 1F2YA 1EZ8A 1A3UA 4H7BA 5CV8A 5CV4A 4E6IA 3OWFA 4OL7A 2SOBA 5JAVA 2WACA 1EY7A 1TT2A 2PW5A 3EJIA 4PMBA 4QB4A 3ERQA 4R8NA 5E3FA 3P1HA 4N9TA 5EKLA 3MXPA 3SR1A 1SYEA 4G57A 4NMZA 2EY5A 2F0LA 4IZ8A 4PNYA 1ENCA 5C3XA 2PYKA 4K5XA 4KJNA 1STBA 1SYDA 4ME5A 2F0QA 3MEHA 5CV7A 1KABA 1KAAA 4I65A 4ZQ3A 4EQNA 5IGFA 3E5SA 4F8MA 3NHHA 1IHZA 5IGEA 5KGUA 3TMEA 4NKLA 1A2UA 4RKBA 2QDBA 3SK8A 4DFAA 4DF7A 2EY6A 3OMGA 4DGZA 3MVVA 2F0IA 5C5MA 3SK5A 2EY1A 3TP6A 1RKNA 4LAAA 3NUCA 3EROA 4PMCA 5IOCA 1SNMA 1EZ6A 2F0PA 3D6CA 2F0EA 4IUNA 4B9XA 4KHVA 3R3OA 2ENBA 1KDBA 3BDLA 3DMUA 5J22A 2F0UA 1STHA 5EGTA 4KD3A 4ID6A 4NDXA 5JOBA 4RKLA 3SHLA 2EYFA 5CV6A 1TQOA 4K5WA 4K6DA 4TRDA 3VA5A 3SK6A 2PW7A 2EYMA 2OF1A 2M00A 3D4DA 3DHQA 5K5PA 1SNOA 2NUCA 2PZUA 1SYGA 1A2TA 4K5VA 5KYLA 3ITPA 3MZ5A 4EQOA 4WRDA 3D8GA 5I9OA 3D4WA 3QOJA 3T13A 4K8IA 2RDFA 4EQPA 2EYJA 4KY7A 2RBMA 2EYHA 3QB3A 3OSOA 3QOLA 5C5LA 5C4ZA 1EY4A 2F0OA 2F0NA 2F3VA 5E1FA 3TP5A 2PZTA 2F0JA 5IGDA 4KJOA 1EY0A 5EKKA 1KDCA 2EYLA 2EXZA 2EYPA 1EY9A 2OEOA 3NP8A 3OMCA 5DEHA 4ZUJA 5I6YA 5KIXA 3SK4A 4EVOA 1JOQA 4HMJA 3NQTA 5KYIA 2EY2A 1SYBA 2HQEA 5C3WA 1JOKA 5IIFA 1STAA 4KV6A 2LKVA 4KTAA 5CV9A 4F7XA 5M9OA 1II3A 3P75A 1EY6A 3NXWA 4K2LA 5KEEA 1SYCA 2F0TA 1SYFA 4KD4A 2O4XA 2KHSA 3MHBA 3NK9A 3EVQA 5IGBA 5IODA 1EQVA 2PQEA 2EYOA 4K14A 2F0GA 3RUZA 3TP8A 4N9PA 1F2ZA 1JORA 2F0VA 4NP5A 5IGCA 1AEXA 4S3SA 4QMGA 1NUCA 1STNA 2F0SA 2PZWA 4KY5A 5I6WA 1EY5A 1EYCA 2F0WA 4ODGA 4QF4A 1KDAA 3S9WA 1STGA 4K2KA 4HMIA
chains in the Genus database with same CATH superfamily
3A0JA 3T16A 5CYUA 3Q23A 1YJ9A 2Q8RE 2EDGA 2M9VA 1VQIA 4X62Q 2UUCQ 3TDQA 5I9PA 1EYDA 1HH2P 4OIJA 5I4DA 3K58A 1CHQD 3MEFA 1LLRD 1ENAA 5J39A 1EIHA 4GKKL 1WCMH 3KJOA 3OW7A 1VDZA 5LL6S 1HZAA 4GN3B 3S16H 3HOUH 2VQFQ 4IFDJ 3HFZB 5C4JH 2L1BA 4QB4A 3FMCA 3M9BA 3OW2A 2AMCB 2K05A 1LYLA 1SYEA 1G6ZA 4DR2Q 4JPBW 3TQYA 4B3SL 2KECA 4FYDA 5C3EB 1YITA 1WVLA 1N36L 3A74A 1KQSA 3KF8A 5JJIA 4I65A 1GKHA 3PIPA 2CQAA 4F8MA 1YJWA 2ZXPA 1IYJB 2IX0A 4KN7C 4LF7L 4U673 4DGZA 3MWYW 4LAAA 2WAQG 2JA8H 2K03A 4DAVA 1VQGA 1S3OA 3AMUA 1HFNA 3CPFA 2XTIA 3KBGA 3SHLA 3TZDA 2EYFA 1XMOL 2FFKB 4ABNA 3NWTA 1ZXTA 1TWHH 4DXFA 1LTSD 3HOYB 5M5XH 3KBXA 4XT1B 2B63H 3NBHB 4JYAQ 5IT9L 1C8CA 1O7YA 4RAUC 1FJGL 3CCSA 3QJYA 1M4VA 2JA7H 1ET6A 1N33Q 1GUWA 1SJHD 1PLFA 4QJFA 3OWEB 4HCSA 1NTGA 3CCQA 1LTGD 1IYVA 1IBKL 3K7AB 3B6YA 1Y8PB 3L0OA 3P75A 4OONA 1SR3A 1SYCA 3BU2A 1SYFA 4CDFC 2NTTA 4XDXA 1N34Q 1K28A 1VQ5A 4BBSG 2PQEA 2EYOA 3RZOH 1HQMC 4JI3Q 2R61A 5H1SE 2F0VA 2QDLA 3UDFA 3UDXA 2PZWA 3K80C 3J81i 3DXJC 3RLOA 1XNQL 1J5EL 3KDFA 3EROA 1YI2A 3N6RA 1GUGA 1L0WA 1J6QA 4X3TA 4JI8Q 2ZTEA 1W2BA 4YCUA 2WB1B 2JP1A 3RN5A 1ASYA 1BBWA 3KF8B 5D14A 1GO3E 4KKSA 3PO3B 2F0DA 1SN8A 2Q8TA 1IL2A 3E0JA 3NBIA 2K5VA 2RSOA 3C1EA 3LX0A 1WCMG 4DR4Q 1G51A 3RZDB 1J8IA 3GTLH 5JAVA 2WACA 3GTGB 1EIYB 1PFBA 1NR2A 3RMHA 3TSSA 4IQZA 2NZ1D 3PQIA 1TWFH 1K83H 1KABA 4HR7B 1DXMA 2VZAA 4BY1B 4GOPA 3TBIB 4YHHL 1WYDA 4KK7A 1HUMA 4APVA 3IRBA 2X69A 1WTOA 1BBUA 1PA6A 5CBEE 2HCCA 2JA8G 2PI2A 2QEJC 1PV4A 3BS1A 1JJGA 1VQJA 4K5WA 1LTRD 1S5DD 4DV3L 1QILA 5FO7B 1JWUD 1QVCA 2B29A 4DN4M 4RWSC 3PSIA 1UAPA 4K8IA 2UXBL 4EQPA 4KY7A 4P74A 3CPWA 3I4NB 4BXXG 1EWHA 2F0NA 1YVCA 1XWEA 3KDFB 1JOQA 1B8AA 5FO8B 1ONLA 2JA7G 3MXGA 2B2YC 3U4ZA 3LGJA 2R7FA 4POFA 3NXWA 2AWNA 2C9OA 2O4XA 1Z47A 2AUKA 4ZRZA 2ZJQA 1CSPA 1VQBA 3S1NH 3M7NA 1I50B 1CKOA 3P7JA 4WJ4A 1SDFA 1XMQQ 1AE3A 5IGCA 1HNZQ 1H9JA 4DK6C 1STNA 1CFMA 1EYCA 1BQQT 4ODGA 3G4SA 1HNZL 1TR5A 1LT3D 1HTLD 4KY6A 2NN6H 4X64Q 1F2LA 3HOVB 3EBEA 3W1BA 2Z8LA 1SNDA 1LM0A 2XN9C 2R7ZB 2E74C 1TIID 3LNNA 3I2ZA 1O7LA 2F4VQ 4DNTB 5HGTA 2YU9H 1HJPA 2XWJB 3HKZE 3VA7A 4B3RQ 4J1MA 1EU4A 1RHPA 4GOPB 1E2VA 2WKCA 2F4IA 2IHEA 2NYZD 4TSSA 2DJFC 1AZQA 1A3UA 1XPUA 4ULLA 2Z1CA 4ZCKA 5T1IA 1CA6A 3L7ZC 1YNXA 4HCEA 4RFBA 5IT9c 4ME5A 5JPNC 4LFCL 1X54A 3RR5A 2I0QA 4JV5Q 4XT3B 4RCNA 3MVVA 3UDGA 3CRLC 2UXCQ 2QW7A 1I4GA 2ZM6L 4BWGB 1K3RA 5EGTA 2IPKD 3V05A 4DR7L 1M8AA 3J81E 2R93H 3H3VH 3SVMA 3ERSX 2PW7A 4JI5Q 3P20A 5KYLA 3MXNA 4JI5L 1UEAB 2A74C 4TKOB 4EQOA 5I9OA 1JC7A 5FJ8H 2LS01 1RF2D 3CC2A 4JBKA 4X3KA 2NVTB 2EYHA 5GAEC 1EY4A 2J0TD 2F3VA 4NPSA 4IURA 2A6HD 3GTGH 4RA8A 4DV6Q 3GTOH 4YWMA 2DGYA 1AFPA 3J7AV 1TWCB 2B2WC 1MJEA 4DR6Q 1Y1VH 1IBMQ 3Q0AA 4HN7A 1K0SA 2UUBQ 1RDPD 5C3EG 5GAGC 1FNUA 1QZGA 1E2WA 5KEEA 4K2LA 3J7ZC 3CU7A 4LF4Q 3JC66 5K36H 3GTMB 3E9IA 4LK1C 2GN5A 2F0GA 1TWAH 4GKJL 3W2DA 1FYCA 1W6KA 4QMGA 1NUCA 4NXNL 4H02A 3DEOA 3A55A 1K8AC 1SXTA 1LO5D 3G71A 4KLKA 1H9SA 4CHTB 1X9NA 1STYA 3AFQA 2FMMA 4XXEA 3J7AF 4A3CH 2D9UA 1PZJD 2F0KA 2VUMB 2E2JB 2UU9L 4RHRA 3HOYG 3CW2C 1XPRA 3PUYA 3S2DB 5BN5A 4G7HC 1PRTD 3KLSX 3V2TA 5E7NA 2E5LQ 5C4XH 1U9RA 5GQOA 4RGOS 5FOBB 2VW9A 4IN3A 1B2TA 1X3GA 1BBXC 1I50H 4P75A 1XXGA 2Z0SA 3E5SA 4A75A 2K04A 3S2HH 5IY0A 1PTOF 3MXNB 3TMEA 4LUZA 2MUYA 3WOFA 3T1HQ 1Y1WB 4OO1G 1DD2A 2F0IA 2V4DA 1S5BD 2A73B 3K7UC 3PCOB 4OELB 2WB1G 2CFMA 1S5CD 3L9AX 3VA5A 5FLXL 4X66L 4B3MQ 1MIUA 3RLFA 4KN4C 1PH3A 4DV5Q 3PO3G 4EGVA 3FEWX 4LMQD 4IFDI 3S24A 5FJ8G 2H1EA 2XIWA 1SBBB 2F0JA 2L4NA 1QWYA 4YWLA 1S5ED 1YNND 4EVOA 5IWAL 3AEVA 1H9SB 3T4AC 2O2LD 3DWPA 2LKVA 2EQSA 4YY3Q 2IHFA 5I2XA 4KD4A 2JEBI 4BY1G 3EVQA 3VYTA 2Z4HA 2DNEA 4JC0A 4FVMA 4L5SA 4IUTA 2B2VC 1N9WA 2F0SA 1KDAA 1DONA 1HNXL 3HOUB 1SROA 4NXML 5BR8Q 3S1MH 3C1FA 3U4VA 3JAML 1EY8A 3J80c 4A3CG 1JE4A 1PH1A 3F1ZA 2F0FA 2MP1A 3D6WA 2K4KA 1PTOD 4GLVB 5KRUA 2X6LA 2HHHQ 1VQPA 3I4NG 5AJ3Q 2N49A 5ELCA 1SMYD 2F0HA 4JW0A 2K7VA 4GNXA 3U58A 1XJVA 4BA2I 2HHHL 1VQAA 3EA6A 5CV4A 5A2QL 1U5KA 4JCVE 1B1ZA 1UE6A 5JJKA 4QIWB 2MO1A 3ERQA 1PZKD 1V1PA 2K14A 1KD1C 2EOTA 2JA6B 4X6AH 3GTMH 4KJNA 1TS4A 4IUPA 4BS9A 1CKNA 1EYGA 1PHJA 2KOLA 4UP7A 4LF6Q 1VQEA 4CJ1B 1V9PA 1N32Q 2UUAQ 1QNUA 4GS3A 5AFWA 3SK8A 2EY6A 4CKEA 1KHIA 1BO0A 5M5XB 4OX9Q 1RKNA 2LY7A 1TS2A 1IZ6A 2N55A 2B63B 1ESFA 3CXCA 2B8FA 5J22A 3HOVG 2QKIC 2SDFA 4A3FH 4ID6A 5M5YB 2R7ZG 1ZKOA 2E2JH 2MQHA 4LUVA 2G9HD 4CGYB 2BCOA 3OTOQ 2TSSA 4C1NI 3ITPA 1BCPF 3T51B 4DV7Q 1T5EA 2JEAI 2F0OA 4A3BH 1PTOB 1JB3A 2Q2IA 3TP5A 3D0FA 2OWOA 4TQUS 3I4OA 3CMAA 2EYPA 2OEOA 2O5JC 1KLGD 4XYQA 3TS0A 3URYA 1IW7C 1LTID 2JQOA 4IJLA 1AH9A 5DM73 1QVFA 4PMWA 2RQXA 2R7DA 2Z6BA 1WTQA 3FKIH 3I72A 4JI7Q 5EPKA 4HEDA 4JI7L 2C5CA 3MC0B 4GNXB 4FDBA 1RD9D 2AQ1B 4C1NK 2F0WA 4QF4A 2IY5B 1WOCA 2N78A 4O0AA 4RHSA 5EBCA 1VS0A 4DPGA 2SNMA 3RD4A 1AE2A 1VQFA 4UP9A 3AQQA 2CW0C 4DR5L 4C2MB 3CMEA 1GUNA 3FVQA 1V1PB 3I73A 1SE8A 4X3UA 2A68D 2K28A 1SNPA 4J6HA 1CKNB 2NZOA 1I94Q 5C4HA 4OXPA 4LWCA 1H95A 1TWFB 3QWNA 3NBHA 1I94L 1LTBD 2DY7A 1STEA 5FLXc 4DNRB 3UE0A 4A3EH 1HRJA 1I6VC 2VB3X 5LHY1 1DJRD 3BYTB 3HRZC 1TXYA 1TT2A 5KNBA 1BOSA 4YWKA 1MGSA 3GV3A 1GUSA 1S72A 1UE5A 2JK8A 1V1QA 4LF9L 2VQEL 1VQ8A 2FHTA 1BCPD 4NKLA 1CZGA 1AN8A 2PO4A 4P2CB 4GKKQ 3OMGA 2L12A 2QA4A 1MBYA 1GD7A 3EIVA 1B50A 1Y8NB 1HZ9A 1T5XD 4F87A 5D3IB 4XQNA 1STHA 4JI4L 1ICWA 4B3SQ 4ZLTF 3NTIA 1TQOA 4UP8A 4H0LC 2VUMG 4PV1C 4JOIA 4EX5A 1N36Q 3C2PA 1KXLA 2PNHA 4KKUA 2M00A 2NUCA 4ZKCB 2ES2A 1NBWA 2Z6KA 3D8GA 4LF7Q 4IOAA 1K8GA 2Z9HA 2EYJA 2EJFC 1EOTA 1N8RC 3JAMc 3S1NB 5E1FA 2F52A 4DA2A 2DN8A 1BNZA 2I5LX 3HOZH 2JA6H 1F9RA 1XMOQ 1JB7A 1TWGB 4KV6A 4L5RC 3STBD 1MI2A 3HOXB 1I4PA 2C35B 2A8VA 1SJED 1EQVA 4BY7H 2J7ZA 3NQIA 1DOMA 4DV0L 1Y1WG 4FNFA 1C9OA 2YU9B 1EFID 1EOVA 2K5NA 1FJGQ 3S9WA 5M5YH 4K2KA 2HDMA 5HURA 1I6HH 2J4XA 2Y0SE 1F9SA 5CGKA 4KHPL 2ZJRA 1IBKQ 1F2MA 1MJCA 5CR3A 1WFQA 1VF7A 3U50C 3BDCA 2WV6D 4RG1A 1PTOH 3ND9A 1SNCA 1C7YA 3PMFA 5DNFA 4JI6L 3K0XA 3AB9A 3D3RA 1A3TA 4L6TB 4A3IG 1XNQQ 1J5EQ 3F2DA 1BKBA 1SE2A 1K8MA 1PZID 1XPOA 1GUOA 5LMUL 4HIMA 2E2IH 3W5OA 4A4IA 1CT1D 4R8NA 5EKLA 5J3BA 4DKAC 1OXXK 3MXPA 2EY5A 4DXGA 4A3MB 3T56B 3VR4A 3S1QB 5IYDH 2R93B 1L2FA 3GDEA 4ZQ3A 5C44H 1KL9A 4DK3C 2E76C 5EJWA 3V96A 3L2PA 3SEBA 1XNRL 4L63B 3Q22A 2KEDA 4PQXA 3Q8DA 4C2MH 2ENBA 3HOUG 2G9DA 1H9MA 2HT1A 3GTOB 1PFSA 2I5HA 2B2TA 5G3LF 3J7A5 1E3PA 1Y1VB 3CP0A 1SNOA 4FXDA 1A2TA 4IJHA 4K5VA 1G91A 4L8JA 1VQLA 4YHHQ 2XVSA 3MFGA 4HJ8A 4ZYSA 1VQNA 1QB5D 2GVBA 1TWAB 2WAQE 2EYLA 4IPDA 1EY9A 5DEHA 4R8IA 2OTLA 3J80E 2EPBA 1QNKA 3I3CA 4DV3Q 2H4OA 1A62A 4V0BA 5FLMH 1NE3A 4MTNA 4AYBB 3MXUA 2UXBQ 2A6EC 4ZKBB 2R6GA 5M3FH 2B63G 4GLXA 4C3IB 2AHOB 1R4QB 1JR0D 4ILWA 3I90A 1NJIC 4CJ2C 5C4XB 1EQQA 5GAHC 1JT8A 3HOWB 1U4LA 1TS5A 1LT4D 3G7LA 1IYUA 3CQZB 4X65L 1VQDA 1JJ2A 1HZCA 4FF2A 2KA7A 1YNJD 3RN2A 4A3GB 1ENFA 3DUZA 4HIOA 1FNWA 5JJZA 1QZHA 1CUKA 4GNXC 2A69C 3TP7A 4LFBL 1JWMD 3S2HB 1BR9A 4PZ8A 1KRSA 1P8LA 2EJMA 1O7IA 2F3IA 3QG1A 2VS1A 1E22A 1TWGH 4IUVA 5GADC 4DK0A 3HOXH 4OO1I 5G3LD 1PH6A 1M1KC 4KI0A 3SGIA 1NAPA 3ONAB 2ZTCA 4DAMA 1A2UA 2QF7A 1Z9FA 5EAYA 1NMGA 4G7OC 1UNSA 1IL8A 1EZ6A 2F0PA 4CKCA 2H5XA 3T53B 1TS3A 2JE6I 1YJNA 3E6ZX 4R4IA 4DV4L 4ME3A 4TRDA 3SK6A 2E2DC 4LFCQ 3H91A 3DHQA 2E8GA 4XQQA 1PH5A 1ESRA 4C56C 4O42A 2QGQA 2IJ0A 3X3MA 3CC7A 4AQYL 1LT5D 1PRTF 2PZTA 4B3TL 3K5OA 1EY0A 1E0BA 2ZM6Q 5M3MB 3I8ZA 1KRTA 2EY2A 2HQEA 2AQ3B 4U68A 3CCRA 4A3MH 4DR7Q 2LMCB 1TVXA 3K5LA 1STAA 2ASBA 3S1QH 5KNDA 2NVXB 1TY2A 1E1OA 3PIO3 1C0AA 1U4MA 2HDLA 1ZYRD 2SEBD 3S1MB 3DM1A 3UI2A 4LF5L 4GN5A 5COYA 4CJ0B 1SE4A 4Q5VA 4MNOA 1XX8A 4QUFA 4A3DB 2CQOA 3E0EA 2PQAA 2RF4A 2PMZE 2YYZA 2F3WA 3QO2A 4LFAL 3GD7A 1SMXA 3U9OA 2HQLA 2JSOA 3Q24A 2F0MA 5DM63 2B8GA 1PVOA 2KQ3A 4RGMA 2QCPX 1LTTD 4GKJQ 5CV5A 2M2LA 2LXKA 4YIJA 1GXDC 2SNSA 4YCVA 4NXNQ 1SNQA 2CHBD 4DK1A 4FF3A 4DAPA 3M4YA 2VB2X 1EZ8A 3M4OH 4OL7A 4JI0L 3TZUA 1D2BA 2SOBA 2RSNA 2OT2A 3W1GA 1AW7A 4PMBA 4N9TA 1YZ6A 4GN4B 3HOXG 4NMZA 2NN6G 2F0LA 1BVSA 4A3FB 2XWBB 2UU9Q 5EPJA 2B39A 1K73C 1PH4A 1JMCA 4JVZA 3FDTA 3LWUA 4UAIA 1X3QA 1Q7YC 4G7ZC 4C3IH 1EWIA 3N52A 1D8LA 4CDEC 5JJLA 3TP6A 1PXUA 4OWWB 3NUCA 4P71A 4I7AA 1XTDA 3WDNA 2Z4IA 1Q8KA 1IBLL 1MSGA 4A3BB 3HOWH 4OIKA 3S17H 4NDXA 3I70A 3CQZH 5JOBA 2WFWA 4RKLA 4LW1A 4BA1I 3H3VC 4A3GH 2PZUA 1X6OA 2DUDA 3IFDA 2DY8A 2RDGA 3OSOA 1B7YB 5DLQE 3FKIB 1LT6D 3E9HA 2IT1A 4KJOA 4ZAIA 3BJUA 4K0KL 1GUTA 3E3XA 1PH8A 1UE7A 4JBWA 4JBJA 5KYIA 2EJGC 2PQAB 1JJCB 4DR1L 4A3MG 4X66Q 5A35A 5M9OA 4RGNA 5GROA 3TRZA 2R93G 3A8IE 4IO9A 2ID0A 4JK1C 1HA5A 2A19A 4JI2L 5JEAH 3GTPH 1JORA 4DUYL 2KCMA 4DV1L 3DWAA 2K1BA 4ZK9B 5KIXA 3K5MA 4EQ5A 1A6XA 5IWAQ 4CBVA 3J81L 1PRTB 4DV2L 2KENA 1BDOA 4A3EB 3AYHB 1IXRA 3EFXD 1JOOA 5J1ZA 3U9SA 5EKIA 3Q6SA 3PO2B 1Y1VG 1VQ6A 4HJ9A 5EQ0A 5L37A 3CCJA 3H09A 5DAUA 4BBSB 1U4RA 2EXDA 5K36G 4RH6A 5C6AA 4HTHA 2Q8IB 2NVYB 2RHQB 5M3MH 1IKMA 3PIOA 2K75A 1VMCA 1HNXQ 4R4CA 2K01A 1HNWL 4QL5A 3VYSA 1V43A 3EJIA 3K57A 1KC8C 2NVXH 4NXMQ 2RVLA 2BOSA 4PNYA 4XYOA 1STBA 4AYBG 5IP9H 1S4ZA 3I4MH 1KAAA 2RCFA 1LUZA 4JG2A 1IHZA 1PH2A 5C0XH 3O13A 4MN3A 3HKZB 2JJQA 2XNAC 4DFAA 4A3DH 1JQYD 5ELBA 3SK5A 4JI1L 1YIJA 3D6CA 2F0EA 4IFDH 2JN4A 5C4XG 3OIQA 1EUJA 2MHVA 2B2YA 1W6JA 3HOWG 3AFPA 1A63A 2B2TC 2FMCA 3HOZB 5D65A 1FR3A 1Z7TA 1WJJA 3KJPA 4L5QA 1OTCA 4GOPC 1RTNA 3QOLA 1NR4A 3QB3A 5C4ZA 4BY7B 2DJGC 2LFNA 1G6PA 1EWCA 1Q81C 4DR3L 5I6YA 1LTLA 4X3SA 3D31A 2XRQD 4HMJA 3HP3A 1FGBD 1O78A 2ZXRA 4OGQC 1S5FD 1I6HB 4DUZL 4FO2A 1HR0W 1XTCD 5BN3A 2WB1E 1A0IA 1PMRA 1EY6A 2WKDA 3R2TA 1HTPA 1CHPD 4HSPA 5FK9C 2CCZA 1PH7A 3TP8A 1K3BC 3GTJH 1Z6HA 3TS2A 2IX1A 1GHKA 2MO0A 1T9HA 5I6WA 3IAYA 1EY5A 3K8AA 1E7ZA 5EPLA 2VXWA 3BG3A 4UHVA 1S40A 3GV6A 5JPMC 5ISRA 1CTMA 2D5DA 5IGGA 2UXDL 2E2IB 4CDCC 2JA5B 2RKSA 3MFYA 3TEHB 1NMFA 3EN2A 5IP7H 3OPOA 5F2DA 4OWXB 2CVRA 2OQKA 1L0XB 2K5WA 5C44B 3GP7A 1KNEA 5T1GA 4DU9A 5M3MG 1WI5A 1RODA 4H44C 5ELDA 4A93B 4K6LA 1QVGA 1HQRD 4DR5Q 2Q2TA 3BZDB 5IT9E 3ND8A 2K32A 4HSVA 1HXYD 2PYKA 2F0QA 1QE6A 1Y8OB 4Y7NB 3VR6A 5C0XG 3J80i 3S14B 4A76A 4A3DG 4IPHA 4PMCA 1HR0L 3BVMA 4PZ7A 4M1UB 2KCNA 3PO2H 1Q1BA 1HUNA 4KD3A 4YCWA 1VCIA 1Q82C 1XYIA 4A3KB 1V1OA 1YHAA 2E2HB 2X6GA 4BBSH 5K5PA 4LF9Q 2VQEQ 3J81c 1Q90A 2NVYH 3QOJA 3W3AA 3A7AB 1ZEQX 2RBMA 3A8KE 5C5LA 2BE5C 3A54A 1Q12A 2ATWA 1AZPA 2D0PA 1KDCA 5M3FB 4LF8L 1UWVA 4JI4Q 4BBRB 4HAEA 3KYHC 1VQ7A 1CK1A 1G291 2A6HC 2KJXA 5C3WA 1GHJA 2JYOA 4X62L 4KTAA 3TN2A 4A3FG 2UUCL 1HA6A 2B2UA 5C0XJ 3NK9A 4MHEA 4R4QA 3A5ZB 3WOEA 1U4PA 2KHIA 4N9PA 1F2ZA 3K6OA 3M7GA 1EL0A 1Q1EA 1JWSD 4HIDA 1BXTA 4A3BG 1X56A 5CV9A 3IKJA 3OHXC 2VQFL 1VQ9A 1OO9B 2PI2E 1K8OA 4B9WA 2ZT9C 4P73A 2F03A 1CZWA 4GZYC 3A8JE 4DR2L 1K0RA 1CM9A 3VR2A 3F2UA 2HUGA 2MPMA 1VQ4A 4DV0Q 2F1MA 1E24A 1A3VA 3M4QA 4MIUA 2WINB 5IP7G 1L1OA 1KIXA 2FINB 3FKIG 1L0YB 1ILQA 2CWAA 2RHSB 1NY4A 4J15A 1BCPB 2KCCA 1PRTC 4E6IA 1X3EA 2CH4A 4KHPQ 3BDOA 1Q8IA 2KUMA 3SR1A 3K0YA 2HIVA 4R4TA 2L0CA 3CF5A 4K5XA 1NNXA 3J7YW 2EZVA 2TMPA 2KEEA 5ELFA 1GM5A 1R9TH 5KGUA 1X32A 1B3AA 4BXXH 2MNAA 1X3PA 3OYYA 4JI6Q 1WTHA 4DF7A 1M90C 1QOHA 2G5DA 2IX3A 1SFOB 4IUNA 1TY0A 4TVAB 4JYAL 1D6EC 2R92B 5LMUQ 4A3EG 4QGUA 3TREA 1N33L 2F0UA 2LSSA 2MGSA 1Q86C 3PO2G 1EEID 1WTVA 1MSHA 2JA5H 2K6AA 4IOCA 4HJ7A 1UEBA 4PG3A 3QR8A 3D4DA 2MJ8A 2N3SA 4CKBA 4WRDA 1N34L 3PUWA 1XNRQ 2I5MX 4JI3L 2B2VA 3GTKB 3G48A 4A93H 3MAQA 1TU2B 2JXMB 1UUPA 3KUPA 5EKKA 5EBDA 4OHJA 4ZUJA 2EIFA 3DEPA 2K5HA 3FHWA 1H9RA 4JI8L 2D2CC 1HFGA 5TSSA 1YNNC 2ZJPA 4POGA 1PYWD 1P16A 2F0TA 4UPAA 4Y7NH 1U0LA 2KHSA 3S14H 3HKZG 2K52A 3RUZA 1LV9A 3NPPA 1CA5A 1SLJA 2LXJA 3VYRA 1L1OB 1WTPA 3ZJYC 3CCEA 4KY5A 4C3JB 4FXKC 4WFN3 4DR4L 1EFWA 3JAMi 4A3KH 2NVQB 1FVIA 2AQ2B 3HOZG 3GTQB 2E2HH 3HEJA 3MTSA 4A3JB 1PYSB 2JA6G 3M4OB 1RCVD 2WIIB 2HCIA 1B70B 2EVBA 3CC4A 1QUQA 1B9MA 2L11A 1CQVA 3CCVA 5NUCA 4LNQA 1KTKA 2BDNA 2OXPA 2RA4A 2VNUD 3GQBA 1HPCA 4BY7G 1I5FA 2NN6I 1PTOC 3VYUA 4KMUC 1SAPA 1I4QA 4WORA 5CC4A 4BBRH 5LL6X 3CRKC 1SMYC 2KVMA 4H7BA 3NTHA 3OWFA 5M5WB 1E1TA 1Y69U 3KOJA 1RJTA 5E3FA 5FKAC 3CCLA 2PCFB 3NELA 3P1HA 4IZ8A 4X65Q 1ENCA 4A3LH 1B9NA 3S17B 1SYDA 1V8QA 2XRSD 1YEZA 5CV7A 5IGFA 2A5HA 4JBMA 3PUVA 4LFBQ 1G2SA 3FRPB 1WTXA 5C5MA 3D4RA 1SNMA 2AKWB 3S1RB 4B9XA 2D0OA 3AU7A 1KDBA 1VF5C 1DGSA 3I7FA 5C3EH 1YBYA 2GA4B 2BH2A 2JA5G 4OEMB 3I55A 4HJ5A 4N8FA 1DCZA 3SDZA 3D4WA 1E2ZA 5IYDG 2YTVA 1EEFD 5C44G 3BVZA 5IYBH 1PYBA 2YV5A 2VY3A 4WJWA 3M3YB 5ELNA 3GTPB 1XMQL 4A93G 3H3VI 2K50A 1VQMA 4I7ZC 2I07B 3SXHA 3NP8A 2ICIA 3KK7A 3OMCA 1CI3M 4J8QA 4KHZA 4QCLA 1IW7D 3K59A 4DV4Q 5LMNW 1KLUD 1FL0A 4X64L 5I2YA 1II3A 3HOYH 3M4PA 4NW2A 4UY8C 1QUQB 3MHBA 5IODA 3C3LA 1Q46A 4O1NA 2F4VL 1PFMA 1LACA 2CKZB 4B3RL 1VQHA 2V1CC 4NP5A 4AQYQ 3HGBA 1KNAA 4C3HB 1SFOH 2R92H 1R4PB 1B53A 3A56A 4B3TQ 2CW0D 1VQCA 3LWEA 1STGA 1DOKA 2NB0A 1F9PA 3K7AH 1OXUA 3HZXA 1SEBD 2FXQA 2KCTA 2XSCA 4QIWE 1BUVT 3CAMA 4A3KG 1RL2A 3HS0C 4IALA 2BA0A 2BH8A 3GO5A 3PV0A 1C4QA 3CCMA 1B4OA 4OWTB 2Q2HA 4Z9CB 3T1YQ 1BF4A 5FLXE 3GTKH 4Y52H 5FLMG 4LF5Q 4OO1H 3C46A 2A68C 3T1YL 3I4MB 4JV5L 3ER0A 3J80L 4CDDC 5M3FG 4WJ3M 2UXCL 5CV8A 4BBRG 1K9MC 4DNIA 4LFAQ 1A15A 1HHVA 1EY7A 2NBFA 2PW5A 2Y0SB 1ASZA 1KAWA 3SE0A 2Q2UA 1D1IA 2MFIA 3A5UA 1F77A 2ZXOA 2OCEA 3PO3H 4XTCS 3WWVA 3VR3A 4A3LG 3VDYA 1D1KA 2L55A 3KLRA 2BE5D 4EQNA 3VR5A 1Q3LA 1X55A 5IGEA 1YHQA 3G6EA 3DLLA 4C3JH 5LMNQ 3ICEA 3RZDH 4H13C 3I91A 3QIAA 1BCPC 3H0GB 5LMNL 2K33A 4HJAA 4JI0Q 2NVQH 5D3DA 4KHVA 3GTQH 3R3OA 4DV6L 4A3JH 3CD6A 3RNUA 1DOLA 1FGUA 4DR6L 3M85A 3PF5A 1D5ZC 5CV6A 1IBML 2YTYA 2OQ0A 3PUXA 4K6DA 3MA2B 5HY6A 2UUBL 4BY1H 4GLAC 3RLNA 1ET9A 1OXTA 3JAME 4XQJA 4LF4L 1RIPA 1O7ZA 3T13A 1ML0D 2K5DA 4MTKA 2RDFA 5IYCH 2L9HA 5IYBG 2BA1A 5M5WH 2L15A 3GTJB 1IBLQ 1H9KA 2NTSA 1EU3A 4MZ9A 1ICFB 2I46A 3SK4A 1AP0A 3HKSA 4FXGC 1YHBA 1SYBA 5A2QE 1JOKA 4AIMA 4IUQA 3S15B 2NWGA 1EIFA 4JOIC 1IKLA 2HD3A 2B2UC 5IGBA 3NSWA 3NENA 3STBC 2ALYB 3F2BA 3I4NH 5E4WC 2Z6KC 1OXSC 2PPBC 1MHWC 4RMFA 3S1RH 1AEXA 4S3SA 1O80A 5JVG3 4R4OA 1VQKA 4RCOA 2D62A 2DNCA 4K0KQ 2R92G 3R93A 1DM0B 4F88A 1G2TA 2WAQB 2E5LL 2QILA 3F2CA 4K8JA 3KFUA 3CKIB 4DR1Q 1OXVA 1EIGA 1LABA 5CMDA 3IL8A 4JI2Q 1SSOA 4IUUA 4ZUIA 3M3YH 2RCNA 1F9QA 1L1OC 3G6JB 2FJ2A 4DUYQ 4DV1Q 3T1HL 2GVAA 3DM3A 1C48A 3R8BA 3BYYB 4R1JA 4DAYA 4DV2Q 3HOVH 2K5QA 1NCVA 2R7ZH 2A1AA 5C0XI 2N88A 5JVH3 1W3SA 5E4XA 4G57A 1I3QB 4LUOA 2AUJD 3H94A 5C3XA 4KKTA 4HIKA 4B3ML 1Y14B 4RGTA 3BZCA 4B08A 1FNVA 4C3HH 4DV5L 1VQOA 4RKBA 2QDBA 3ULPA 1D5MC 4C3JG 2AWOA 3KF6A 2EY1A 3OIPA 1GVPA 1QCBD 4A3IB 1HNWQ 1I4HA 3R2IA 2CWPA 3DMUA 4A3JG 1DZ1A 5ELEA 4YY3L 2OTJA 2EYMA 2OF1A 4Q0FA 2B3GA 2NZHA 4IPCA 2BDOA 1VMPA 2ICEC 5KNCA 2EE1A 3FP9A 5IYCG 4JI1Q 4L5TA 4C3IG 2RDHA 1X65A 2E75C 1G8ZD 5IGDA 1WCMB 1A8VA 4XIGS 3NE5B 1GOZA 3S16B 1D7QA 5IIFA 4QUCA 5C4JB 5BR8L 2A6ED 2NVTH 3I4LA 2O5IC 4A3GG 4K14A 1RTOA 1I4RA 3H0GH 2ZTDA 5AJ3L 3I56A 4V190 1TWCH 3K81C 4DR3Q 5FO9B 5IE8A 1WTRA 4DAYB 4PZ6A 3PIP3 4N8X1 2IW3A 2JA8B 1FD7D 3F8TA 4DUZQ 4G4KA 1D5XC 2QEXA 3PF4A 1I4XA 1EYAA 4FF4A 1NSNS 2IWHA 2A69D 1TWHB 4LF6L 1WD1A 5JEAG 1YNJC 4QQBX 3EQLC 2UUAL 1N32L 1JE5A 1R9TB 1MKHA 1SRUA 3HG9A 3H6MA 3KF6B 4OX9L 1F2YA 1PH9A 1B3QA 1HCZA 4FP5D 4O2DA 4ALPA 1UE1A 3FPUB 3S15H 5CORA 4LJZC 1CSQA 2VUMH 2PMZB 2KHJA 1J9OA 1X3FA 1TKWB 2JA7B 2UXDQ 3BZKA 1JICA 4UDUC 2R3ZA 3J81j 3MEHA 3S2DH 3OTOL 4M8AA 3PGZA 3NHHA 1WTWA 3A7LA 1HZBA 4C3HG 3RZOB 5CBAE 4DV7L 3NTKA 5IOCA 4FF1A 1EQTA 3NWSA 1LTAD 2P5ZX 3BDLA 1JCKB 1QJOA 2YTXA 3ULJA 3ZYYX 2PNRC 3NEMA 4R9WA 3OOCA 1WD0A 1ILPA 1SYGA 4AYBE 1Y1WH 3DWQA 3MZ5A 5JEAJ 1PDQA 5IP9G 3PUZA 3I4MG 3FPPA 1EQRA 3BVGA 3X3NA 3UDIA 2N8NA 2KBNA 2L5TA 1HR0Q 3H15A 3CHBD 2IL8A 3IFTA 2JA9A 1CKMA 5BN4A 2EXZA 4IPGA 2Y0SG 2B2WA 5ELOA 1I3QH 3UE1A 3KLWA 3NQTA 4IFDG 3L3OC 1QG7A 1DYQA 3GTLB 1MD2D 4AH6A 2CH4W 4F7XA 1PFNA 3CCUA 1SE3A 4P72A 3KLSA 4NB3A 1B44D 1K83B 4QY7A 4A3IH 1ZYRC 3H0GG 3ULLA 2XGTA 1GJXA 1CQFA 5HGQA 3K5NA 2WP8J 2VL6A 4LF8Q 2HIXA 4HMIA
chains in the Genus database with same CATH topology
3T16A 5CYUA 3Q23A 2Q8RE 2EDGA 2M9VA 3TDQA 5I9PA 1EYDA 4OIJA 5I4DA 3K58A 1CHQD 1LLRD 1ENAA 5J39A 1EIHA 3OW7A 1VDZA 5LL6S 4IFDJ 2L1BA 4QB4A 3FMCA 2K05A 1SYEA 1G6ZA 2KECA 4FYDA 5C3EB 1WVLA 3KF8A 4I65A 2CQAA 4F8MA 2ZXPA 2IX0A 4KN7C 4U673 4DGZA 3MWYW 4LAAA 2K03A 4DAVA 3AMUA 1HFNA 3KBGA 3SHLA 3TZDA 2EYFA 2FFKB 4ABNA 3NWTA 1ZXTA 4DXFA 1LTSD 3HOYB 3KBXA 4XT1B 5IT9L 1C8CA 1O7YA 4RAUC 3QJYA 1M4VA 1GUWA 1ET6A 1SJHD 1PLFA 3OWEB 4HCSA 1LTGD 1IYVA 3K7AB 1Y8PB 3P75A 1SYCA 1SYFA 2NTTA 4XDXA 2PQEA 2EYOA 1HQMC 2R61A 2F0VA 2PZWA 3DXJC 3EROA 3N6RA 1GUGA 4X3TA 2WB1B 2JP1A 5D14A 4KKSA 3PO3B 2F0DA 2Q8TA 3E0JA 3NBIA 2RSOA 3C1EA 3LX0A 3RZDB 1J8IA 5JAVA 2WACA 3GTGB 1PFBA 1NR2A 3RMHA 3TSSA 4IQZA 2NZ1D 1KABA 4HR7B 1DXMA 4BY1B 3TBIB 4KK7A 1HUMA 2X69A 1WTOA 5CBEE 2HCCA 2QEJC 3BS1A 4K5WA 1LTRD 1S5DD 1QILA 5FO7B 1JWUD 4DN4M 4RWSC 1UAPA 4K8IA 4EQPA 4KY7A 3I4NB 1EWHA 2F0NA 1XWEA 1JOQA 5FO8B 1ONLA 3MXGA 2B2YC 3NXWA 2AWNA 2C9OA 2O4XA 1Z47A 2AUKA 4ZRZA 3M7NA 1I50B 3P7JA 1SDFA 5IGCA 1H9JA 1STNA 1CFMA 1EYCA 1BQQT 4ODGA 1TR5A 1LT3D 1HTLD 4KY6A 2NN6H 1F2LA 3HOVB 2Z8LA 1SNDA 2XN9C 2R7ZB 2E74C 1TIID 3LNNA 1O7LA 4DNTB 5HGTA 2XWJB 3VA7A 4J1MA 1EU4A 1RHPA 1E2VA 2WKCA 2F4IA 2NYZD 4TSSA 1AZQA 1A3UA 4ULLA 2Z1CA 5T1IA 1CA6A 3L7ZC 4HCEA 4RFBA 4ME5A 5JPNC 4XT3B 4RCNA 3MVVA 3CRLC 1I4GA 4BWGB 5EGTA 2IPKD 3V05A 1M8AA 3J81E 3SVMA 2PW7A 3P20A 5KYLA 3MXNA 1UEAB 2A74C 5I9OA 4TKOB 4EQOA 1JC7A 2LS01 1RF2D 4X3KA 2NVTB 2EYHA 1EY4A 2J0TD 2F3VA 4IURA 2A6HD 4RA8A 1AFPA 3J7AV 1TWCB 2B2WC 3Q0AA 4HN7A 1RDPD 1FNUA 1E2WA 5KEEA 4K2LA 3CU7A 5K36H 3GTMB 4LK1C 2F0GA 3W2DA 1FYCA 1W6KA 4QMGA 1NUCA 3DEOA 3A55A 1SXTA 1LO5D 1H9SA 4CHTB 1STYA 2FMMA 4XXEA 3J7AF 2D9UA 1PZJD 2F0KA 2VUMB 2E2JB 4RHRA 3PUYA 3S2DB 5BN5A 4G7HC 1PRTD 3KLSX 3V2TA 1U9RA 4RGOS 5FOBB 4IN3A 1B2TA 1BBXC 1XXGA 3E5SA 2K04A 1PTOF 3TMEA 3WOFA 2MUYA 1Y1WB 4OO1G 1DD2A 2F0IA 2V4DA 1S5BD 2A73B 1S5CD 3L9AX 3VA5A 5FLXL 3RLFA 4KN4C 4EGVA 3FEWX 4LMQD 4IFDI 2H1EA 2XIWA 1SBBB 2F0JA 2L4NA 1QWYA 1S5ED 1YNND 4EVOA 1H9SB 3T4AC 2O2LD 3DWPA 2LKVA 5I2XA 4KD4A 2JEBI 3EVQA 3VYTA 2Z4HA 2DNEA 4FVMA 4IUTA 2B2VC 2F0SA 1KDAA 1DONA 3HOUB 3C1FA 3JAML 1EY8A 1JE4A 2F0FA 2MP1A 3D6WA 5KRUA 1PTOD 2X6LA 5ELCA 1SMYD 2F0HA 4BA2I 2K7VA 5A2QL 3EA6A 5CV4A 1B1ZA 4QIWB 3ERQA 1PZKD 1V1PA 2EOTA 2JA6B 4KJNA 1TS4A 4IUPA 4BS9A 2KOLA 4CJ1B 1QNUA 5AFWA 3SK8A 2EY6A 4CKEA 1BO0A 5M5XB 1RKNA 2LY7A 1TS2A 2N55A 2B63B 1ESFA 2B8FA 5J22A 5M5YB 2QKIC 2SDFA 4ID6A 1ZKOA 2G9HD 4CGYB 2BCOA 2TSSA 4C1NI 3ITPA 1BCPF 3T51B 1T5EA 2JEAI 2F0OA 1PTOB 1JB3A 3TP5A 4TQUS 2EYPA 2OEOA 2O5JC 1KLGD 4XYQA 3URYA 1IW7C 1LTID 5DM73 4PMWA 2RQXA 1WTQA 3I72A 5EPKA 4HEDA 2C5CA 3MC0B 1RD9D 2AQ1B 4C1NK 2F0WA 4QF4A 5EBCA 4RHSA 2SNMA 3RD4A 2CW0C 4C2MB 1GUNA 3FVQA 1V1PB 3I73A 4X3UA 2A68D 2K28A 1SNPA 4J6HA 5C4HA 1TWFB 3QWNA 3NBHA 1LTBD 2DY7A 1STEA 4DNRB 1HRJA 1I6VC 2VB3X 5LHY1 1DJRD 3BYTB 3HRZC 1TT2A 5KNBA 1BOSA 1MGSA 3GV3A 1GUSA 2FHTA 1BCPD 4NKLA 1CZGA 1AN8A 2PO4A 4P2CB 3OMGA 2L12A 1MBYA 1B50A 1Y8NB 1T5XD 4F87A 5D3IB 4XQNA 1STHA 1ICWA 4ZLTF 3NTIA 1TQOA 4H0LC 4PV1C 3C2PA 4KKUA 2M00A 2NUCA 4ZKCB 3D8GA 2EYJA 2EJFC 1EOTA 3S1NB 5E1FA 4DA2A 2DN8A 1BNZA 1F9RA 1TWGB 4KV6A 1MI2A 3HOXB 1I4PA 1SJED 1EQVA 2J7ZA 3NQIA 1DOMA 4FNFA 2YU9B 1EFID 3S9WA 4K2KA 2HDMA 5HURA 2J4XA 1F9SA 5CGKA 1F2MA 5CR3A 1VF7A 3BDCA 2WV6D 1PTOH 3ND9A 1SNCA 3PMFA 5DNFA 3AB9A 3D3RA 1A3TA 4L6TB 1SE2A 1K8MA 1PZID 1GUOA 1CT1D 4R8NA 5EKLA 1OXXK 3MXPA 2EY5A 4DXGA 4A3MB 3T56B 3VR4A 3S1QB 2R93B 4ZQ3A 2E76C 5EJWA 3V96A 3SEBA 4L63B 3Q22A 2KEDA 4PQXA 2ENBA 2G9DA 1H9MA 3GTOB 2B2TA 5G3LF 1Y1VB 1SNOA 4FXDA 1A2TA 4K5VA 1G91A 4L8JA 2XVSA 3MFGA 4ZYSA 1QB5D 1TWAB 2EYLA 1EY9A 5DEHA 4R8IA 3J80E 2EPBA 1QNKA 3I3CA 2H4OA 4V0BA 4AYBB 3MXUA 2A6EC 4ZKBB 2R6GA 4C3IB 1R4QB 1JR0D 4ILWA 3I90A 4CJ2C 5C4XB 3HOWB 1U4LA 1TS5A 1LT4D 3G7LA 1IYUA 3CQZB 4FF2A 2KA7A 1YNJD 4A3GB 1ENFA 3DUZA 1FNWA 5JJZA 2A69C 3TP7A 3S2HB 1JWMD 1BR9A 2EJMA 3QG1A 4IUVA 4DK0A 4OO1I 5G3LD 4KI0A 1NAPA 3ONAB 1A2UA 2QF7A 4G7OC 1UNSA 1IL8A 1EZ6A 2F0PA 4CKCA 3T53B 1TS3A 2JE6I 3E6ZX 4TRDA 3SK6A 2E2DC 3H91A 3DHQA 4XQQA 1ESRA 4C56C 4O42A 2IJ0A 3X3MA 1LT5D 1PRTF 2PZTA 3K5OA 1EY0A 1E0BA 5M3MB 3I8ZA 2EY2A 2HQEA 2AQ3B 4U68A 2LMCB 1TVXA 3K5LA 1STAA 5KNDA 2NVXB 1TY2A 3PIO3 1U4MA 2HDLA 1ZYRD 2SEBD 3S1MB 3DM1A 3UI2A 5COYA 4CJ0B 1SE4A 4Q5VA 1XX8A 4QUFA 4A3DB 2YYZA 2F3WA 3QO2A 3GD7A 3U9OA 2JSOA 3Q24A 2F0MA 5DM63 2B8GA 2KQ3A 4RGMA 2QCPX 1LTTD 5CV5A 2M2LA 4YIJA 1GXDC 2SNSA 1SNQA 2CHBD 4DK1A 4FF3A 4DAPA 3M4YA 2VB2X 1EZ8A 4OL7A 3TZUA 1D2BA 2SOBA 2RSNA 2OT2A 1AW7A 4PMBA 4N9TA 4NMZA 2NN6G 2F0LA 4A3FB 2XWBB 5EPJA 2B39A 3FDTA 3LWUA 4UAIA 1X3QA 4G7ZC 3N52A 3TP6A 1PXUA 3NUCA 3WDNA 2Z4IA 1MSGA 4A3BB 4OIKA 4NDXA 3I70A 5JOBA 4RKLA 4BA1I 3H3VC 2PZUA 3IFDA 2DY8A 2RDGA 3OSOA 3FKIB 1LT6D 2IT1A 4KJOA 4ZAIA 1GUTA 4JBWA 5KYIA 2EJGC 5A35A 5M9OA 4RGNA 3A8IE 2ID0A 4JK1C 1HA5A 5JEAH 1JORA 3DWAA 2K1BA 4ZK9B 5KIXA 3K5MA 1A6XA 4CBVA 3J81L 1PRTB 1BDOA 4A3EB 3EFXD 1JOOA 5J1ZA 3U9SA 5EKIA 3Q6SA 3PO2B 5EQ0A 3H09A 5DAUA 4BBSB 1U4RA 5K36G 4RH6A 5C6AA 4HTHA 2Q8IB 2NVYB 1IKMA 1VMCA 2K01A 3VYSA 1V43A 3EJIA 3K57A 2RVLA 2BOSA 4PNYA 4XYOA 1STBA 1S4ZA 1KAAA 1IHZA 5C0XH 3O13A 4MN3A 3HKZB 2XNAC 4DFAA 1JQYD 5ELBA 3SK5A 3D6CA 2F0EA 4IFDH 3OIQA 2MHVA 2B2YA 1W6JA 2B2TC 2FMCA 3HOZB 5D65A 1FR3A 1Z7TA 1RTNA 3QOLA 1NR4A 3QB3A 5C4ZA 4BY7B 2LFNA 1EWCA 5I6YA 4X3SA 3D31A 2XRQD 4HMJA 3HP3A 1FGBD 1O78A 2ZXRA 4OGQC 1S5FD 1I6HB 4FO2A 1XTCD 5BN3A 1PMRA 1EY6A 2WKDA 3R2TA 1HTPA 1CHPD 4HSPA 5FK9C 3TP8A 1Z6HA 2IX1A 1GHKA 5I6WA 3IAYA 1EY5A 5EPLA 2VXWA 3BG3A 3GV6A 5JPMC 5ISRA 1CTMA 2D5DA 5IGGA 2E2IB 2JA5B 2RKSA 3MFYA 3OPOA 5F2DA 2CVRA 1L0XB 2K5WA 5C44B 3GP7A 1KNEA 5T1GA 4DU9A 1RODA 4H44C 5ELDA 4A93B 4K6LA 1HQRD 3BZDB 5IT9E 3ND8A 2K32A 4HSVA 1HXYD 2PYKA 2F0QA 1QE6A 1Y8OB 4Y7NB 3VR6A 5C0XG 3S14B 4PMCA 3BVMA 4M1UB 2KCNA 1Q1BA 1HUNA 4KD3A 1VCIA 1XYIA 4A3KB 1V1OA 2E2HB 2X6GA 5K5PA 1Q90A 3QOJA 3W3AA 3A7AB 1ZEQX 2RBMA 3A8KE 5C5LA 2BE5C 3A54A 1Q12A 1AZPA 1KDCA 5M3FB 4BBRB 4HAEA 1CK1A 1G291 2A6HC 2KJXA 5C3WA 1GHJA 2JYOA 4KTAA 3TN2A 1HA6A 2B2UA 5C0XJ 3NK9A 4MHEA 3WOEA 1U4PA 4N9PA 1F2ZA 3K6OA 3M7GA 1EL0A 1Q1EA 1JWSD 1BXTA 5CV9A 3IKJA 3OHXC 1OO9B 1K8OA 4B9WA 2ZT9C 2F03A 1CZWA 4GZYC 3A8JE 1CM9A 3VR2A 3F2UA 2HUGA 2MPMA 2F1MA 1A3VA 4MIUA 2WINB 2FINB 1L0YB 1ILQA 1BCPB 2KCCA 1PRTC 4E6IA 3BDOA 1Q8IA 2KUMA 3SR1A 3K0YA 2L0CA 4K5XA 3J7YW 2EZVA 2TMPA 2KEEA 5ELFA 5KGUA 1X32A 1B3AA 1X3PA 4DF7A 1QOHA 2IX3A 1SFOB 4IUNA 1TY0A 1D6EC 2R92B 2F0UA 2MGSA 1EEID 1WTVA 1MSHA 2K6AA 3D4DA 2MJ8A 4CKBA 4WRDA 3PUWA 3GTKB 2B2VA 3MAQA 1TU2B 2JXMB 1UUPA 3KUPA 5EKKA 5EBDA 4OHJA 4ZUJA 3DEPA 1H9RA 2D2CC 1HFGA 5TSSA 1YNNC 1PYWD 2F0TA 2KHSA 3RUZA 1LV9A 3NPPA 1CA5A 3VYRA 1WTPA 4KY5A 4C3JB 4FXKC 4WFN3 2NVQB 2AQ2B 3GTQB 3HEJA 3MTSA 4A3JB 3M4OB 1RCVD 2WIIB 2HCIA 2EVBA 1B9MA 2L11A 1CQVA 5NUCA 1KTKA 2BDNA 2OXPA 2RA4A 2VNUD 3GQBA 1HPCA 2NN6I 1PTOC 3VYUA 4KMUC 1SAPA 1I4QA 4WORA 5CC4A 5LL6X 3CRKC 1SMYC 2KVMA 4H7BA 3NTHA 3OWFA 5M5WB 1Y69U 1RJTA 5E3FA 5FKAC 2PCFB 3P1HA 4IZ8A 1ENCA 1B9NA 3S17B 1SYDA 1V8QA 2XRSD 5CV7A 5IGFA 2A5HA 3PUVA 1G2SA 3FRPB 1WTXA 5C5MA 3D4RA 1SNMA 3S1RB 4B9XA 3AU7A 1KDBA 1VF5C 2GA4B 1DCZA 3SDZA 3D4WA 1E2ZA 1EEFD 3BVZA 4WJWA 3M3YB 3GTPB 4I7ZC 2I07B 3SXHA 3NP8A 2ICIA 3KK7A 3OMCA 1CI3M 4J8QA 4KHZA 4QCLA 1IW7D 3K59A 1KLUD 5I2YA 1II3A 4NW2A 3MHBA 5IODA 3C3LA 4O1NA 1PFMA 1LACA 4NP5A 3HGBA 1KNAA 4C3HB 1R4PB 1B53A 3A56A 2CW0D 3LWEA 1STGA 1DOKA 2NB0A 1F9PA 1OXUA 3HZXA 1SEBD 2XSCA 1BUVT 3HS0C 4IALA 2BA0A 3GO5A 3PV0A 1C4QA 1B4OA 4Z9CB 1BF4A 5FLXE 4OO1H 3C46A 2A68C 3I4MB 3J80L 5CV8A 1A15A 1HHVA 1EY7A 2NBFA 2PW5A 2Y0SB 3SE0A 1D1IA 1F77A 2ZXOA 4XTCS 3VR3A 1D1KA 2L55A 3KLRA 2BE5D 4EQNA 3VR5A 1Q3LA 5IGEA 4H13C 3I91A 3QIAA 1BCPC 3H0GB 2K33A 5D3DA 4KHVA 3R3OA 1DOLA 3M85A 1D5ZC 5CV6A 4K6DA 3PUXA 3MA2B 1ET9A 1OXTA 3JAME 4XQJA 1O7ZA 3T13A 1ML0D 2K5DA 2RDFA 2L9HA 2BA1A 3GTJB 1H9KA 2NTSA 1EU3A 2I46A 3SK4A 1AP0A 4FXGC 1SYBA 5A2QE 1JOKA 4IUQA 3S15B 2NWGA 1IKLA 2B2UC 5IGBA 3NSWA 5E4WC 1OXSC 2PPBC 1AEXA 4S3SA 1O80A 5JVG3 4RCOA 2D62A 2DNCA 3R93A 1DM0B 4F88A 1G2TA 2WAQB 2QILA 4K8JA 3CKIB 1OXVA 1EIGA 1LABA 5CMDA 3IL8A 1SSOA 4IUUA 4ZUIA 1F9QA 3G6JB 2FJ2A 1C48A 3R8BA 3BYYB 4DAYA 2K5QA 1NCVA 5C0XI 2N88A 5JVH3 5E4XA 4G57A 1I3QB 2AUJD 3H94A 5C3XA 4KKTA 4RGTA 4B08A 1FNVA 4RKBA 2QDBA 1D5MC 4C3JG 2AWOA 3OIPA 2EY1A 4A3IB 1QCBD 1I4HA 3R2IA 3DMUA 1DZ1A 5ELEA 2EYMA 2OF1A 4Q0FA 2BDOA 1VMPA 2ICEC 5KNCA 2EE1A 4C3IG 2RDHA 2E75C 1G8ZD 5IGDA 1WCMB 4XIGS 3NE5B 1GOZA 3S16B 5IIFA 4QUCA 5C4JB 2A6ED 3I4LA 2O5IC 4K14A 1RTOA 1I4RA 4V190 5FO9B 1WTRA 3PIP3 2IW3A 2JA8B 1FD7D 4G4KA 1D5XC 1I4XA 1EYAA 4FF4A 1NSNS 2IWHA 2A69D 1TWHB 1WD1A 5JEAG 1YNJC 3EQLC 1R9TB 3HG9A 3H6MA 1F2YA 1HCZA 4FP5D 3FPUB 5CORA 4LJZC 2PMZB 1J9OA 1TKWB 2JA7B 1JICA 4UDUC 2R3ZA 3MEHA 4M8AA 3NHHA 1WTWA 3A7LA 4C3HG 3RZOB 5CBAE 3NTKA 5IOCA 4FF1A 1EQTA 3NWSA 1LTAD 3BDLA 1JCKB 1QJOA 3ZYYX 2PNRC 4R9WA 3OOCA 1WD0A 1ILPA 1SYGA 3DWQA 3MZ5A 5JEAJ 1PDQA 3PUZA 3FPPA 3BVGA 3X3NA 2L5TA 3CHBD 2IL8A 3IFTA 5BN4A 2EXZA 2B2WA 3NQTA 4IFDG 3L3OC 1QG7A 1DYQA 3GTLB 1MD2D 4F7XA 1PFNA 1SE3A 3KLSA 1B44D 1K83B 1ZYRC 1GJXA 1CQFA 3K5NA 2WP8J 4HMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T16 A;  5HUR A;  1TR5 A;  2SNM A;  4K8J A;  3HZX A;  4KY6 A;  1STY A;  2F3W A;  4B9W A;  1JOO A;  5CGK A;  5J1Z A;  3HEJ A;  3U9O A;  1SND A;  5ISR A;  1F2M A;  4IAL A;  5I9P A;  5IGG A;  3C1F A;  1EY8 A;  1EYD A;  2F0K A;  2F0M A;  5CR3 A;  1EYA A;  1NSN S;  2RKS A;  1SNP A;  2F0F A;  4J6H A;  5DAU A;  5NUC A;  3BDC A;  3SXH A;  5HGT A;  5KRU A;  4ZUI A;  2KQ3 A;  2OXP A;  5C4H A;  5F2D A;  2F0D A;  5CV5 A;  1A3V A;  4MIU A;  4J1M A;  1SNC A;  4YIJ A;  2F0H A;  1ENA A;  3PMF A;  4HTH A;  2SNS A;  5C6A A;  5J39 A;  3V2T A;  3TP7 A;  1A3T A;  1SNQ A;  3C1E A;  3LX0 A;  4WOR A;  5CC4 A;  3H6M A;  4DU9 A;  1U9R A;  1F2Y A;  1EZ8 A;  1A3U A;  4H7B A;  5CV8 A;  5CV4 A;  4E6I A;  3OWF A;  4OL7 A;  2SOB A;  5JAV A;  2WAC A;  1EY7 A;  1TT2 A;  2PW5 A;  3EJI A;  4PMB A;  4QB4 A;  3ERQ A;  4R8N A;  5E3F A;  3P1H A;  4N9T A;  5EKL A;  3MXP A;  3SR1 A;  1SYE A;  4G57 A;  4NMZ A;  2EY5 A;  2F0L A;  4IZ8 A;  4PNY A;  1ENC A;  5C3X A;  2PYK A;  4K5X A;  4KJN A;  1STB A;  1SYD A;  4ME5 A;  2F0Q A;  3MEH A;  5CV7 A;  1KAB A;  1KAA A;  4I65 A;  4ZQ3 A;  4EQN A;  5IGF A;  3E5S A;  4F8M A;  3NHH A;  1IHZ A;  5IGE A;  5KGU A;  3TME A;  4NKL A;  1A2U A;  4RKB A;  2QDB A;  3SK8 A;  4DFA A;  4DF7 A;  2EY6 A;  3OMG A;  4DGZ A;  3MVV A;  2F0I A;  5C5M A;  3SK5 A;  2EY1 A;  3TP6 A;  1RKN A;  4LAA A;  3NUC A;  3ERO A;  4PMC A;  5IOC A;  1SNM A;  1EZ6 A;  2F0P A;  3D6C A;  2F0E A;  4IUN A;  4B9X A;  4KHV A;  3R3O A;  2ENB A;  1KDB A;  3BDL A;  3DMU A;  5J22 A;  2F0U A;  1STH A;  5EGT A;  4KD3 A;  4ID6 A;  4NDX A;  5JOB A;  4RKL A;  3SHL A;  2EYF A;  5CV6 A;  1TQO A;  4K5W A;  4K6D A;  4TRD A;  3VA5 A;  3SK6 A;  2PW7 A;  2EYM A;  2OF1 A;  2M00 A;  3D4D A;  3DHQ A;  5K5P A;  1SNO A;  2NUC A;  2PZU A;  1SYG A;  1A2T A;  4K5V A;  5KYL A;  3ITP A;  3MZ5 A;  4EQO A;  4WRD A;  3D8G A;  5I9O A;  3D4W A;  3QOJ A;  3T13 A;  4K8I A;  2RDF A;  4EQP A;  2EYJ A;  4KY7 A;  2RBM A;  2EYH A;  3QB3 A;  3OSO A;  3QOL A;  5C5L A;  5C4Z A;  1EY4 A;  2F0O A;  2F0N A;  2F3V A;  5E1F A;  3TP5 A;  2PZT A;  2F0J A;  5IGD A;  4KJO A;  1EY0 A;  5EKK A;  1KDC A;  2EYL A;  2EXZ A;  2EYP A;  1EY9 A;  2OEO A;  3NP8 A;  3OMC A;  5DEH A;  4ZUJ A;  5I6Y A;  5KIX A;  3SK4 A;  4EVO A;  1JOQ A;  4HMJ A;  3NQT A;  5KYI A;  2EY2 A;  1SYB A;  2HQE A;  5C3W A;  1JOK A;  5IIF A;  1STA A;  4KV6 A;  2LKV A;  4KTA A;  5CV9 A;  4F7X A;  5M9O A;  1II3 A;  3P75 A;  1EY6 A;  3NXW A;  4K2L A;  5KEE A;  1SYC A;  2F0T A;  1SYF A;  4KD4 A;  2O4X A;  2KHS A;  3MHB A;  3NK9 A;  3EVQ A;  5IGB A;  5IOD A;  1EQV A;  2PQE A;  2EYO A;  4K14 A;  2F0G A;  3RUZ A;  3TP8 A;  4N9P A;  1F2Z A;  1JOR A;  2F0V A;  4NP5 A;  5IGC A;  1AEX A;  4S3S A;  4QMG A;  1NUC A;  1STN A;  2F0S A;  2PZW A;  4KY5 A;  5I6W A;  1EY5 A;  1EYC A;  2F0W A;  4ODG A;  4QF4 A;  1KDA A;  3S9W A;  1STG A;  4K2K A;  4HMI A; 
#chains in the Genus database with same CATH topology
 3A0J A;  3T16 A;  5CYU A;  3Q23 A;  1YJ9 A;  2Q8R E;  2EDG A;  2M9V A;  1VQI A;  4X62 Q;  2UUC Q;  3TDQ A;  5I9P A;  1EYD A;  1HH2 P;  4OIJ A;  5I4D A;  3K58 A;  1CHQ D;  3MEF A;  1LLR D;  1ENA A;  5J39 A;  1EIH A;  4GKK L;  1WCM H;  3KJO A;  3OW7 A;  1VDZ A;  5LL6 S;  1HZA A;  4GN3 B;  3S16 H;  3HOU H;  2VQF Q;  4IFD J;  3HFZ B;  5C4J H;  2L1B A;  4QB4 A;  3FMC A;  3M9B A;  3OW2 A;  2AMC B;  2K05 A;  1LYL A;  1SYE A;  1G6Z A;  4DR2 Q;  4JPB W;  3TQY A;  4B3S L;  2KEC A;  4FYD A;  5C3E B;  1YIT A;  1WVL A;  1N36 L;  3A74 A;  1KQS A;  3KF8 A;  5JJI A;  4I65 A;  1GKH A;  3PIP A;  2CQA A;  4F8M A;  1YJW A;  2ZXP A;  1IYJ B;  2IX0 A;  4KN7 C;  4LF7 L;  4U67 3;  4DGZ A;  3MWY W;  4LAA A;  2WAQ G;  2JA8 H;  2K03 A;  4DAV A;  1VQG A;  1S3O A;  3AMU A;  1HFN A;  3CPF A;  2XTI A;  3KBG A;  3SHL A;  3TZD A;  2EYF A;  1XMO L;  2FFK B;  4ABN A;  3NWT A;  1ZXT A;  1TWH H;  4DXF A;  1LTS D;  3HOY B;  5M5X H;  3KBX A;  4XT1 B;  2B63 H;  3NBH B;  4JYA Q;  5IT9 L;  1C8C A;  1O7Y A;  4RAU C;  1FJG L;  3CCS A;  3QJY A;  1M4V A;  2JA7 H;  1ET6 A;  1N33 Q;  1GUW A;  1SJH D;  1PLF A;  4QJF A;  3OWE B;  4HCS A;  1NTG A;  3CCQ A;  1LTG D;  1IYV A;  1IBK L;  3K7A B;  3B6Y A;  1Y8P B;  3L0O A;  3P75 A;  4OON A;  1SR3 A;  1SYC A;  3BU2 A;  1SYF A;  4CDF C;  2NTT A;  4XDX A;  1N34 Q;  1K28 A;  1VQ5 A;  4BBS G;  2PQE A;  2EYO A;  3RZO H;  1HQM C;  4JI3 Q;  2R61 A;  5H1S E;  2F0V A;  2QDL A;  3UDF A;  3UDX A;  2PZW A;  3K80 C;  3J81 i;  3DXJ C;  3RLO A;  1XNQ L;  1J5E L;  3KDF A;  3ERO A;  1YI2 A;  3N6R A;  1GUG A;  1L0W A;  1J6Q A;  4X3T A;  4JI8 Q;  2ZTE A;  1W2B A;  4YCU A;  2WB1 B;  2JP1 A;  3RN5 A;  1ASY A;  1BBW A;  3KF8 B;  5D14 A;  1GO3 E;  4KKS A;  3PO3 B;  2F0D A;  1SN8 A;  2Q8T A;  1IL2 A;  3E0J A;  3NBI A;  2K5V A;  2RSO A;  3C1E A;  3LX0 A;  1WCM G;  4DR4 Q;  1G51 A;  3RZD B;  1J8I A;  3GTL H;  5JAV A;  2WAC A;  3GTG B;  1EIY B;  1PFB A;  1NR2 A;  3RMH A;  3TSS A;  4IQZ A;  2NZ1 D;  3PQI A;  1TWF H;  1K83 H;  1KAB A;  4HR7 B;  1DXM A;  2VZA A;  4BY1 B;  4GOP A;  3TBI B;  4YHH L;  1WYD A;  4KK7 A;  1HUM A;  4APV A;  3IRB A;  2X69 A;  1WTO A;  1BBU A;  1PA6 A;  5CBE E;  2HCC A;  2JA8 G;  2PI2 A;  2QEJ C;  1PV4 A;  3BS1 A;  1JJG A;  1VQJ A;  4K5W A;  1LTR D;  1S5D D;  4DV3 L;  1QIL A;  5FO7 B;  1JWU D;  1QVC A;  2B29 A;  4DN4 M;  4RWS C;  3PSI A;  1UAP A;  4K8I A;  2UXB L;  4EQP A;  4KY7 A;  4P74 A;  3CPW A;  3I4N B;  4BXX G;  1EWH A;  2F0N A;  1YVC A;  1XWE A;  3KDF B;  1JOQ A;  1B8A A;  5FO8 B;  1ONL A;  2JA7 G;  3MXG A;  2B2Y C;  3U4Z A;  3LGJ A;  2R7F A;  4POF A;  3NXW A;  2AWN A;  2C9O A;  2O4X A;  1Z47 A;  2AUK A;  4ZRZ A;  2ZJQ A;  1CSP A;  1VQB A;  3S1N H;  3M7N A;  1I50 B;  1CKO A;  3P7J A;  4WJ4 A;  1SDF A;  1XMQ Q;  1AE3 A;  5IGC A;  1HNZ Q;  1H9J A;  4DK6 C;  1STN A;  1CFM A;  1EYC A;  1BQQ T;  4ODG A;  3G4S A;  1HNZ L;  1TR5 A;  1LT3 D;  1HTL D;  4KY6 A;  2NN6 H;  4X64 Q;  1F2L A;  3HOV B;  3EBE A;  3W1B A;  2Z8L A;  1SND A;  1LM0 A;  2XN9 C;  2R7Z B;  2E74 C;  1TII D;  3LNN A;  3I2Z A;  1O7L A;  2F4V Q;  4DNT B;  5HGT A;  2YU9 H;  1HJP A;  2XWJ B;  3HKZ E;  3VA7 A;  4B3R Q;  4J1M A;  1EU4 A;  1RHP A;  4GOP B;  1E2V A;  2WKC A;  2F4I A;  2IHE A;  2NYZ D;  4TSS A;  2DJF C;  1AZQ A;  1A3U A;  1XPU A;  4ULL A;  2Z1C A;  4ZCK A;  5T1I A;  1CA6 A;  3L7Z C;  1YNX A;  4HCE A;  4RFB A;  5IT9 c;  4ME5 A;  5JPN C;  4LFC L;  1X54 A;  3RR5 A;  2I0Q A;  4JV5 Q;  4XT3 B;  4RCN A;  3MVV A;  3UDG A;  3CRL C;  2UXC Q;  2QW7 A;  1I4G A;  2ZM6 L;  4BWG B;  1K3R A;  5EGT A;  2IPK D;  3V05 A;  4DR7 L;  1M8A A;  3J81 E;  2R93 H;  3H3V H;  3SVM A;  3ERS X;  2PW7 A;  4JI5 Q;  3P20 A;  5KYL A;  3MXN A;  4JI5 L;  1UEA B;  2A74 C;  4TKO B;  4EQO A;  5I9O A;  1JC7 A;  5FJ8 H;  2LS0 1;  1RF2 D;  3CC2 A;  4JBK A;  4X3K A;  2NVT B;  2EYH A;  5GAE C;  1EY4 A;  2J0T D;  2F3V A;  4NPS A;  4IUR A;  2A6H D;  3GTG H;  4RA8 A;  4DV6 Q;  3GTO H;  4YWM A;  2DGY A;  1AFP A;  3J7A V;  1TWC B;  2B2W C;  1MJE A;  4DR6 Q;  1Y1V H;  1IBM Q;  3Q0A A;  4HN7 A;  1K0S A;  2UUB Q;  1RDP D;  5C3E G;  5GAG C;  1FNU A;  1QZG A;  1E2W A;  5KEE A;  4K2L A;  3J7Z C;  3CU7 A;  4LF4 Q;  3JC6 6;  5K36 H;  3GTM B;  3E9I A;  4LK1 C;  2GN5 A;  2F0G A;  1TWA H;  4GKJ L;  3W2D A;  1FYC A;  1W6K A;  4QMG A;  1NUC A;  4NXN L;  4H02 A;  3DEO A;  3A55 A;  1K8A C;  1SXT A;  1LO5 D;  3G71 A;  4KLK A;  1H9S A;  4CHT B;  1X9N A;  1STY A;  3AFQ A;  2FMM A;  4XXE A;  3J7A F;  4A3C H;  2D9U A;  1PZJ D;  2F0K A;  2VUM B;  2E2J B;  2UU9 L;  4RHR A;  3HOY G;  3CW2 C;  1XPR A;  3PUY A;  3S2D B;  5BN5 A;  4G7H C;  1PRT D;  3KLS X;  3V2T A;  5E7N A;  2E5L Q;  5C4X H;  1U9R A;  5GQO A;  4RGO S;  5FOB B;  2VW9 A;  4IN3 A;  1B2T A;  1X3G A;  1BBX C;  1I50 H;  4P75 A;  1XXG A;  2Z0S A;  3E5S A;  4A75 A;  2K04 A;  3S2H H;  5IY0 A;  1PTO F;  3MXN B;  3TME A;  4LUZ A;  2MUY A;  3WOF A;  3T1H Q;  1Y1W B;  4OO1 G;  1DD2 A;  2F0I A;  2V4D A;  1S5B D;  2A73 B;  3K7U C;  3PCO B;  4OEL B;  2WB1 G;  2CFM A;  1S5C D;  3L9A X;  3VA5 A;  5FLX L;  4X66 L;  4B3M Q;  1MIU A;  3RLF A;  4KN4 C;  1PH3 A;  4DV5 Q;  3PO3 G;  4EGV A;  3FEW X;  4LMQ D;  4IFD I;  3S24 A;  5FJ8 G;  2H1E A;  2XIW A;  1SBB B;  2F0J A;  2L4N A;  1QWY A;  4YWL A;  1S5E D;  1YNN D;  4EVO A;  5IWA L;  3AEV A;  1H9S B;  3T4A C;  2O2L D;  3DWP A;  2LKV A;  2EQS A;  4YY3 Q;  2IHF A;  5I2X A;  4KD4 A;  2JEB I;  4BY1 G;  3EVQ A;  3VYT A;  2Z4H A;  2DNE A;  4JC0 A;  4FVM A;  4L5S A;  4IUT A;  2B2V C;  1N9W A;  2F0S A;  1KDA A;  1DON A;  1HNX L;  3HOU B;  1SRO A;  4NXM L;  5BR8 Q;  3S1M H;  3C1F A;  3U4V A;  3JAM L;  1EY8 A;  3J80 c;  4A3C G;  1JE4 A;  1PH1 A;  3F1Z A;  2F0F A;  2MP1 A;  3D6W A;  2K4K A;  1PTO D;  4GLV B;  5KRU A;  2X6L A;  2HHH Q;  1VQP A;  3I4N G;  5AJ3 Q;  2N49 A;  5ELC A;  1SMY D;  2F0H A;  4JW0 A;  2K7V A;  4GNX A;  3U58 A;  1XJV A;  4BA2 I;  2HHH L;  1VQA A;  3EA6 A;  5CV4 A;  5A2Q L;  1U5K A;  4JCV E;  1B1Z A;  1UE6 A;  5JJK A;  4QIW B;  2MO1 A;  3ERQ A;  1PZK D;  1V1P A;  2K14 A;  1KD1 C;  2EOT A;  2JA6 B;  4X6A H;  3GTM H;  4KJN A;  1TS4 A;  4IUP A;  4BS9 A;  1CKN A;  1EYG A;  1PHJ A;  2KOL A;  4UP7 A;  4LF6 Q;  1VQE A;  4CJ1 B;  1V9P A;  1N32 Q;  2UUA Q;  1QNU A;  4GS3 A;  5AFW A;  3SK8 A;  2EY6 A;  4CKE A;  1KHI A;  1BO0 A;  5M5X B;  4OX9 Q;  1RKN A;  2LY7 A;  1TS2 A;  1IZ6 A;  2N55 A;  2B63 B;  1ESF A;  3CXC A;  2B8F A;  5J22 A;  3HOV G;  2QKI C;  2SDF A;  4A3F H;  4ID6 A;  5M5Y B;  2R7Z G;  1ZKO A;  2E2J H;  2MQH A;  4LUV A;  2G9H D;  4CGY B;  2BCO A;  3OTO Q;  2TSS A;  4C1N I;  3ITP A;  1BCP F;  3T51 B;  4DV7 Q;  1T5E A;  2JEA I;  2F0O A;  4A3B H;  1PTO B;  1JB3 A;  2Q2I A;  3TP5 A;  3D0F A;  2OWO A;  4TQU S;  3I4O A;  3CMA A;  2EYP A;  2OEO A;  2O5J C;  1KLG D;  4XYQ A;  3TS0 A;  3URY A;  1IW7 C;  1LTI D;  2JQO A;  4IJL A;  1AH9 A;  5DM7 3;  1QVF A;  4PMW A;  2RQX A;  2R7D A;  2Z6B A;  1WTQ A;  3FKI H;  3I72 A;  4JI7 Q;  5EPK A;  4HED A;  4JI7 L;  2C5C A;  3MC0 B;  4GNX B;  4FDB A;  1RD9 D;  2AQ1 B;  4C1N K;  2F0W A;  4QF4 A;  2IY5 B;  1WOC A;  2N78 A;  4O0A A;  4RHS A;  5EBC A;  1VS0 A;  4DPG A;  2SNM A;  3RD4 A;  1AE2 A;  1VQF A;  4UP9 A;  3AQQ A;  2CW0 C;  4DR5 L;  4C2M B;  3CME A;  1GUN A;  3FVQ A;  1V1P B;  3I73 A;  1SE8 A;  4X3U A;  2A68 D;  2K28 A;  1SNP A;  4J6H A;  1CKN B;  2NZO A;  1I94 Q;  5C4H A;  4OXP A;  4LWC A;  1H95 A;  1TWF B;  3QWN A;  3NBH A;  1I94 L;  1LTB D;  2DY7 A;  1STE A;  5FLX c;  4DNR B;  3UE0 A;  4A3E H;  1HRJ A;  1I6V C;  2VB3 X;  5LHY 1;  1DJR D;  3BYT B;  3HRZ C;  1TXY A;  1TT2 A;  5KNB A;  1BOS A;  4YWK A;  1MGS A;  3GV3 A;  1GUS A;  1S72 A;  1UE5 A;  2JK8 A;  1V1Q A;  4LF9 L;  2VQE L;  1VQ8 A;  2FHT A;  1BCP D;  4NKL A;  1CZG A;  1AN8 A;  2PO4 A;  4P2C B;  4GKK Q;  3OMG A;  2L12 A;  2QA4 A;  1MBY A;  1GD7 A;  3EIV A;  1B50 A;  1Y8N B;  1HZ9 A;  1T5X D;  4F87 A;  5D3I B;  4XQN A;  1STH A;  4JI4 L;  1ICW A;  4B3S Q;  4ZLT F;  3NTI A;  1TQO A;  4UP8 A;  4H0L C;  2VUM G;  4PV1 C;  4JOI A;  4EX5 A;  1N36 Q;  3C2P A;  1KXL A;  2PNH A;  4KKU A;  2M00 A;  2NUC A;  4ZKC B;  2ES2 A;  1NBW A;  2Z6K A;  3D8G A;  4LF7 Q;  4IOA A;  1K8G A;  2Z9H A;  2EYJ A;  2EJF C;  1EOT A;  1N8R C;  3JAM c;  3S1N B;  5E1F A;  2F52 A;  4DA2 A;  2DN8 A;  1BNZ A;  2I5L X;  3HOZ H;  2JA6 H;  1F9R A;  1XMO Q;  1JB7 A;  1TWG B;  4KV6 A;  4L5R C;  3STB D;  1MI2 A;  3HOX B;  1I4P A;  2C35 B;  2A8V A;  1SJE D;  1EQV A;  4BY7 H;  2J7Z A;  3NQI A;  1DOM A;  4DV0 L;  1Y1W G;  4FNF A;  1C9O A;  2YU9 B;  1EFI D;  1EOV A;  2K5N A;  1FJG Q;  3S9W A;  5M5Y H;  4K2K A;  2HDM A;  5HUR A;  1I6H H;  2J4X A;  2Y0S E;  1F9S A;  5CGK A;  4KHP L;  2ZJR A;  1IBK Q;  1F2M A;  1MJC A;  5CR3 A;  1WFQ A;  1VF7 A;  3U50 C;  3BDC A;  2WV6 D;  4RG1 A;  1PTO H;  3ND9 A;  1SNC A;  1C7Y A;  3PMF A;  5DNF A;  4JI6 L;  3K0X A;  3AB9 A;  3D3R A;  1A3T A;  4L6T B;  4A3I G;  1XNQ Q;  1J5E Q;  3F2D A;  1BKB A;  1SE2 A;  1K8M A;  1PZI D;  1XPO A;  1GUO A;  5LMU L;  4HIM A;  2E2I H;  3W5O A;  4A4I A;  1CT1 D;  4R8N A;  5EKL A;  5J3B A;  4DKA C;  1OXX K;  3MXP A;  2EY5 A;  4DXG A;  4A3M B;  3T56 B;  3VR4 A;  3S1Q B;  5IYD H;  2R93 B;  1L2F A;  3GDE A;  4ZQ3 A;  5C44 H;  1KL9 A;  4DK3 C;  2E76 C;  5EJW A;  3V96 A;  3L2P A;  3SEB A;  1XNR L;  4L63 B;  3Q22 A;  2KED A;  4PQX A;  3Q8D A;  4C2M H;  2ENB A;  3HOU G;  2G9D A;  1H9M A;  2HT1 A;  3GTO B;  1PFS A;  2I5H A;  2B2T A;  5G3L F;  3J7A 5;  1E3P A;  1Y1V B;  3CP0 A;  1SNO A;  4FXD A;  1A2T A;  4IJH A;  4K5V A;  1G91 A;  4L8J A;  1VQL A;  4YHH Q;  2XVS A;  3MFG A;  4HJ8 A;  4ZYS A;  1VQN A;  1QB5 D;  2GVB A;  1TWA B;  2WAQ E;  2EYL A;  4IPD A;  1EY9 A;  5DEH A;  4R8I A;  2OTL A;  3J80 E;  2EPB A;  1QNK A;  3I3C A;  4DV3 Q;  2H4O A;  1A62 A;  4V0B A;  5FLM H;  1NE3 A;  4MTN A;  4AYB B;  3MXU A;  2UXB Q;  2A6E C;  4ZKB B;  2R6G A;  5M3F H;  2B63 G;  4GLX A;  4C3I B;  2AHO B;  1R4Q B;  1JR0 D;  4ILW A;  3I90 A;  1NJI C;  4CJ2 C;  5C4X B;  1EQQ A;  5GAH C;  1JT8 A;  3HOW B;  1U4L A;  1TS5 A;  1LT4 D;  3G7L A;  1IYU A;  3CQZ B;  4X65 L;  1VQD A;  1JJ2 A;  1HZC A;  4FF2 A;  2KA7 A;  1YNJ D;  3RN2 A;  4A3G B;  1ENF A;  3DUZ A;  4HIO A;  1FNW A;  5JJZ A;  1QZH A;  1CUK A;  4GNX C;  2A69 C;  3TP7 A;  4LFB L;  1JWM D;  3S2H B;  1BR9 A;  4PZ8 A;  1KRS A;  1P8L A;  2EJM A;  1O7I A;  2F3I A;  3QG1 A;  2VS1 A;  1E22 A;  1TWG H;  4IUV A;  5GAD C;  4DK0 A;  3HOX H;  4OO1 I;  5G3L D;  1PH6 A;  1M1K C;  4KI0 A;  3SGI A;  1NAP A;  3ONA B;  2ZTC A;  4DAM A;  1A2U A;  2QF7 A;  1Z9F A;  5EAY A;  1NMG A;  4G7O C;  1UNS A;  1IL8 A;  1EZ6 A;  2F0P A;  4CKC A;  2H5X A;  3T53 B;  1TS3 A;  2JE6 I;  1YJN A;  3E6Z X;  4R4I A;  4DV4 L;  4ME3 A;  4TRD A;  3SK6 A;  2E2D C;  4LFC Q;  3H91 A;  3DHQ A;  2E8G A;  4XQQ A;  1PH5 A;  1ESR A;  4C56 C;  4O42 A;  2QGQ A;  2IJ0 A;  3X3M A;  3CC7 A;  4AQY L;  1LT5 D;  1PRT F;  2PZT A;  4B3T L;  3K5O A;  1EY0 A;  1E0B A;  2ZM6 Q;  5M3M B;  3I8Z A;  1KRT A;  2EY2 A;  2HQE A;  2AQ3 B;  4U68 A;  3CCR A;  4A3M H;  4DR7 Q;  2LMC B;  1TVX A;  3K5L A;  1STA A;  2ASB A;  3S1Q H;  5KND A;  2NVX B;  1TY2 A;  1E1O A;  3PIO 3;  1C0A A;  1U4M A;  2HDL A;  1ZYR D;  2SEB D;  3S1M B;  3DM1 A;  3UI2 A;  4LF5 L;  4GN5 A;  5COY A;  4CJ0 B;  1SE4 A;  4Q5V A;  4MNO A;  1XX8 A;  4QUF A;  4A3D B;  2CQO A;  3E0E A;  2PQA A;  2RF4 A;  2PMZ E;  2YYZ A;  2F3W A;  3QO2 A;  4LFA L;  3GD7 A;  1SMX A;  3U9O A;  2HQL A;  2JSO A;  3Q24 A;  2F0M A;  5DM6 3;  2B8G A;  1PVO A;  2KQ3 A;  4RGM A;  2QCP X;  1LTT D;  4GKJ Q;  5CV5 A;  2M2L A;  2LXK A;  4YIJ A;  1GXD C;  2SNS A;  4YCV A;  4NXN Q;  1SNQ A;  2CHB D;  4DK1 A;  4FF3 A;  4DAP A;  3M4Y A;  2VB2 X;  1EZ8 A;  3M4O H;  4OL7 A;  4JI0 L;  3TZU A;  1D2B A;  2SOB A;  2RSN A;  2OT2 A;  3W1G A;  1AW7 A;  4PMB A;  4N9T A;  1YZ6 A;  4GN4 B;  3HOX G;  4NMZ A;  2NN6 G;  2F0L A;  1BVS A;  4A3F B;  2XWB B;  2UU9 Q;  5EPJ A;  2B39 A;  1K73 C;  1PH4 A;  1JMC A;  4JVZ A;  3FDT A;  3LWU A;  4UAI A;  1X3Q A;  1Q7Y C;  4G7Z C;  4C3I H;  1EWI A;  3N52 A;  1D8L A;  4CDE C;  5JJL A;  3TP6 A;  1PXU A;  4OWW B;  3NUC A;  4P71 A;  4I7A A;  1XTD A;  3WDN A;  2Z4I A;  1Q8K A;  1IBL L;  1MSG A;  4A3B B;  3HOW H;  4OIK A;  3S17 H;  4NDX A;  3I70 A;  3CQZ H;  5JOB A;  2WFW A;  4RKL A;  4LW1 A;  4BA1 I;  3H3V C;  4A3G H;  2PZU A;  1X6O A;  2DUD A;  3IFD A;  2DY8 A;  2RDG A;  3OSO A;  1B7Y B;  5DLQ E;  3FKI B;  1LT6 D;  3E9H A;  2IT1 A;  4KJO A;  4ZAI A;  3BJU A;  4K0K L;  1GUT A;  3E3X A;  1PH8 A;  1UE7 A;  4JBW A;  4JBJ A;  5KYI A;  2EJG C;  2PQA B;  1JJC B;  4DR1 L;  4A3M G;  4X66 Q;  5A35 A;  5M9O A;  4RGN A;  5GRO A;  3TRZ A;  2R93 G;  3A8I E;  4IO9 A;  2ID0 A;  4JK1 C;  1HA5 A;  2A19 A;  4JI2 L;  5JEA H;  3GTP H;  1JOR A;  4DUY L;  2KCM A;  4DV1 L;  3DWA A;  2K1B A;  4ZK9 B;  5KIX A;  3K5M A;  4EQ5 A;  1A6X A;  5IWA Q;  4CBV A;  3J81 L;  1PRT B;  4DV2 L;  2KEN A;  1BDO A;  4A3E B;  3AYH B;  1IXR A;  3EFX D;  1JOO A;  5J1Z A;  3U9S A;  5EKI A;  3Q6S A;  3PO2 B;  1Y1V G;  1VQ6 A;  4HJ9 A;  5EQ0 A;  5L37 A;  3CCJ A;  3H09 A;  5DAU A;  4BBS B;  1U4R A;  2EXD A;  5K36 G;  4RH6 A;  5C6A A;  4HTH A;  2Q8I B;  2NVY B;  2RHQ B;  5M3M H;  1IKM A;  3PIO A;  2K75 A;  1VMC A;  1HNX Q;  4R4C A;  2K01 A;  1HNW L;  4QL5 A;  3VYS A;  1V43 A;  3EJI A;  3K57 A;  1KC8 C;  2NVX H;  4NXM Q;  2RVL A;  2BOS A;  4PNY A;  4XYO A;  1STB A;  4AYB G;  5IP9 H;  1S4Z A;  3I4M H;  1KAA A;  2RCF A;  1LUZ A;  4JG2 A;  1IHZ A;  1PH2 A;  5C0X H;  3O13 A;  4MN3 A;  3HKZ B;  2JJQ A;  2XNA C;  4DFA A;  4A3D H;  1JQY D;  5ELB A;  3SK5 A;  4JI1 L;  1YIJ A;  3D6C A;  2F0E A;  4IFD H;  2JN4 A;  5C4X G;  3OIQ A;  1EUJ A;  2MHV A;  2B2Y A;  1W6J A;  3HOW G;  3AFP A;  1A63 A;  2B2T C;  2FMC A;  3HOZ B;  5D65 A;  1FR3 A;  1Z7T A;  1WJJ A;  3KJP A;  4L5Q A;  1OTC A;  4GOP C;  1RTN A;  3QOL A;  1NR4 A;  3QB3 A;  5C4Z A;  4BY7 B;  2DJG C;  2LFN A;  1G6P A;  1EWC A;  1Q81 C;  4DR3 L;  5I6Y A;  1LTL A;  4X3S A;  3D31 A;  2XRQ D;  4HMJ A;  3HP3 A;  1FGB D;  1O78 A;  2ZXR A;  4OGQ C;  1S5F D;  1I6H B;  4DUZ L;  4FO2 A;  1HR0 W;  1XTC D;  5BN3 A;  2WB1 E;  1A0I A;  1PMR A;  1EY6 A;  2WKD A;  3R2T A;  1HTP A;  1CHP D;  4HSP A;  5FK9 C;  2CCZ A;  1PH7 A;  3TP8 A;  1K3B C;  3GTJ H;  1Z6H A;  3TS2 A;  2IX1 A;  1GHK A;  2MO0 A;  1T9H A;  5I6W A;  3IAY A;  1EY5 A;  3K8A A;  1E7Z A;  5EPL A;  2VXW A;  3BG3 A;  4UHV A;  1S40 A;  3GV6 A;  5JPM C;  5ISR A;  1CTM A;  2D5D A;  5IGG A;  2UXD L;  2E2I B;  4CDC C;  2JA5 B;  2RKS A;  3MFY A;  3TEH B;  1NMF A;  3EN2 A;  5IP7 H;  3OPO A;  5F2D A;  4OWX B;  2CVR A;  2OQK A;  1L0X B;  2K5W A;  5C44 B;  3GP7 A;  1KNE A;  5T1G A;  4DU9 A;  5M3M G;  1WI5 A;  1ROD A;  4H44 C;  5ELD A;  4A93 B;  4K6L A;  1QVG A;  1HQR D;  4DR5 Q;  2Q2T A;  3BZD B;  5IT9 E;  3ND8 A;  2K32 A;  4HSV A;  1HXY D;  2PYK A;  2F0Q A;  1QE6 A;  1Y8O B;  4Y7N B;  3VR6 A;  5C0X G;  3J80 i;  3S14 B;  4A76 A;  4A3D G;  4IPH A;  4PMC A;  1HR0 L;  3BVM A;  4PZ7 A;  4M1U B;  2KCN A;  3PO2 H;  1Q1B A;  1HUN A;  4KD3 A;  4YCW A;  1VCI A;  1Q82 C;  1XYI A;  4A3K B;  1V1O A;  1YHA A;  2E2H B;  2X6G A;  4BBS H;  5K5P A;  4LF9 Q;  2VQE Q;  3J81 c;  1Q90 A;  2NVY H;  3QOJ A;  3W3A A;  3A7A B;  1ZEQ X;  2RBM A;  3A8K E;  5C5L A;  2BE5 C;  3A54 A;  1Q12 A;  2ATW A;  1AZP A;  2D0P A;  1KDC A;  5M3F B;  4LF8 L;  1UWV A;  4JI4 Q;  4BBR B;  4HAE A;  3KYH C;  1VQ7 A;  1CK1 A;  1G29 1;  2A6H C;  2KJX A;  5C3W A;  1GHJ A;  2JYO A;  4X62 L;  4KTA A;  3TN2 A;  4A3F G;  2UUC L;  1HA6 A;  2B2U A;  5C0X J;  3NK9 A;  4MHE A;  4R4Q A;  3A5Z B;  3WOE A;  1U4P A;  2KHI A;  4N9P A;  1F2Z A;  3K6O A;  3M7G A;  1EL0 A;  1Q1E A;  1JWS D;  4HID A;  1BXT A;  4A3B G;  1X56 A;  5CV9 A;  3IKJ A;  3OHX C;  2VQF L;  1VQ9 A;  1OO9 B;  2PI2 E;  1K8O A;  4B9W A;  2ZT9 C;  4P73 A;  2F03 A;  1CZW A;  4GZY C;  3A8J E;  4DR2 L;  1K0R A;  1CM9 A;  3VR2 A;  3F2U A;  2HUG A;  2MPM A;  1VQ4 A;  4DV0 Q;  2F1M A;  1E24 A;  1A3V A;  3M4Q A;  4MIU A;  2WIN B;  5IP7 G;  1L1O A;  1KIX A;  2FIN B;  3FKI G;  1L0Y B;  1ILQ A;  2CWA A;  2RHS B;  1NY4 A;  4J15 A;  1BCP B;  2KCC A;  1PRT C;  4E6I A;  1X3E A;  2CH4 A;  4KHP Q;  3BDO A;  1Q8I A;  2KUM A;  3SR1 A;  3K0Y A;  2HIV A;  4R4T A;  2L0C A;  3CF5 A;  4K5X A;  1NNX A;  3J7Y W;  2EZV A;  2TMP A;  2KEE A;  5ELF A;  1GM5 A;  1R9T H;  5KGU A;  1X32 A;  1B3A A;  4BXX H;  2MNA A;  1X3P A;  3OYY A;  4JI6 Q;  1WTH A;  4DF7 A;  1M90 C;  1QOH A;  2G5D A;  2IX3 A;  1SFO B;  4IUN A;  1TY0 A;  4TVA B;  4JYA L;  1D6E C;  2R92 B;  5LMU Q;  4A3E G;  4QGU A;  3TRE A;  1N33 L;  2F0U A;  2LSS A;  2MGS A;  1Q86 C;  3PO2 G;  1EEI D;  1WTV A;  1MSH A;  2JA5 H;  2K6A A;  4IOC A;  4HJ7 A;  1UEB A;  4PG3 A;  3QR8 A;  3D4D A;  2MJ8 A;  2N3S A;  4CKB A;  4WRD A;  1N34 L;  3PUW A;  1XNR Q;  2I5M X;  4JI3 L;  2B2V A;  3GTK B;  3G48 A;  4A93 H;  3MAQ A;  1TU2 B;  2JXM B;  1UUP A;  3KUP A;  5EKK A;  5EBD A;  4OHJ A;  4ZUJ A;  2EIF A;  3DEP A;  2K5H A;  3FHW A;  1H9R A;  4JI8 L;  2D2C C;  1HFG A;  5TSS A;  1YNN C;  2ZJP A;  4POG A;  1PYW D;  1P16 A;  2F0T A;  4UPA A;  4Y7N H;  1U0L A;  2KHS A;  3S14 H;  3HKZ G;  2K52 A;  3RUZ A;  1LV9 A;  3NPP A;  1CA5 A;  1SLJ A;  2LXJ A;  3VYR A;  1L1O B;  1WTP A;  3ZJY C;  3CCE A;  4KY5 A;  4C3J B;  4FXK C;  4WFN 3;  4DR4 L;  1EFW A;  3JAM i;  4A3K H;  2NVQ B;  1FVI A;  2AQ2 B;  3HOZ G;  3GTQ B;  2E2H H;  3HEJ A;  3MTS A;  4A3J B;  1PYS B;  2JA6 G;  3M4O B;  1RCV D;  2WII B;  2HCI A;  1B70 B;  2EVB A;  3CC4 A;  1QUQ A;  1B9M A;  2L11 A;  1CQV A;  3CCV A;  5NUC A;  4LNQ A;  1KTK A;  2BDN A;  2OXP A;  2RA4 A;  2VNU D;  3GQB A;  1HPC A;  4BY7 G;  1I5F A;  2NN6 I;  1PTO C;  3VYU A;  4KMU C;  1SAP A;  1I4Q A;  4WOR A;  5CC4 A;  4BBR H;  5LL6 X;  3CRK C;  1SMY C;  2KVM A;  4H7B A;  3NTH A;  3OWF A;  5M5W B;  1E1T A;  1Y69 U;  3KOJ A;  1RJT A;  5E3F A;  5FKA C;  3CCL A;  2PCF B;  3NEL A;  3P1H A;  4IZ8 A;  4X65 Q;  1ENC A;  4A3L H;  1B9N A;  3S17 B;  1SYD A;  1V8Q A;  2XRS D;  1YEZ A;  5CV7 A;  5IGF A;  2A5H A;  4JBM A;  3PUV A;  4LFB Q;  1G2S A;  3FRP B;  1WTX A;  5C5M A;  3D4R A;  1SNM A;  2AKW B;  3S1R B;  4B9X A;  2D0O A;  3AU7 A;  1KDB A;  1VF5 C;  1DGS A;  3I7F A;  5C3E H;  1YBY A;  2GA4 B;  2BH2 A;  2JA5 G;  4OEM B;  3I55 A;  4HJ5 A;  4N8F A;  1DCZ A;  3SDZ A;  3D4W A;  1E2Z A;  5IYD G;  2YTV A;  1EEF D;  5C44 G;  3BVZ A;  5IYB H;  1PYB A;  2YV5 A;  2VY3 A;  4WJW A;  3M3Y B;  5ELN A;  3GTP B;  1XMQ L;  4A93 G;  3H3V I;  2K50 A;  1VQM A;  4I7Z C;  2I07 B;  3SXH A;  3NP8 A;  2ICI A;  3KK7 A;  3OMC A;  1CI3 M;  4J8Q A;  4KHZ A;  4QCL A;  1IW7 D;  3K59 A;  4DV4 Q;  5LMN W;  1KLU D;  1FL0 A;  4X64 L;  5I2Y A;  1II3 A;  3HOY H;  3M4P A;  4NW2 A;  4UY8 C;  1QUQ B;  3MHB A;  5IOD A;  3C3L A;  1Q46 A;  4O1N A;  2F4V L;  1PFM A;  1LAC A;  2CKZ B;  4B3R L;  1VQH A;  2V1C C;  4NP5 A;  4AQY Q;  3HGB A;  1KNA A;  4C3H B;  1SFO H;  2R92 H;  1R4P B;  1B53 A;  3A56 A;  4B3T Q;  2CW0 D;  1VQC A;  3LWE A;  1STG A;  1DOK A;  2NB0 A;  1F9P A;  3K7A H;  1OXU A;  3HZX A;  1SEB D;  2FXQ A;  2KCT A;  2XSC A;  4QIW E;  1BUV T;  3CAM A;  4A3K G;  1RL2 A;  3HS0 C;  4IAL A;  2BA0 A;  2BH8 A;  3GO5 A;  3PV0 A;  1C4Q A;  3CCM A;  1B4O A;  4OWT B;  2Q2H A;  4Z9C B;  3T1Y Q;  1BF4 A;  5FLX E;  3GTK H;  4Y52 H;  5FLM G;  4LF5 Q;  4OO1 H;  3C46 A;  2A68 C;  3T1Y L;  3I4M B;  4JV5 L;  3ER0 A;  3J80 L;  4CDD C;  5M3F G;  4WJ3 M;  2UXC L;  5CV8 A;  4BBR G;  1K9M C;  4DNI A;  4LFA Q;  1A15 A;  1HHV A;  1EY7 A;  2NBF A;  2PW5 A;  2Y0S B;  1ASZ A;  1KAW A;  3SE0 A;  2Q2U A;  1D1I A;  2MFI A;  3A5U A;  1F77 A;  2ZXO A;  2OCE A;  3PO3 H;  4XTC S;  3WWV A;  3VR3 A;  4A3L G;  3VDY A;  1D1K A;  2L55 A;  3KLR A;  2BE5 D;  4EQN A;  3VR5 A;  1Q3L A;  1X55 A;  5IGE A;  1YHQ A;  3G6E A;  3DLL A;  4C3J H;  5LMN Q;  3ICE A;  3RZD H;  4H13 C;  3I91 A;  3QIA A;  1BCP C;  3H0G B;  5LMN L;  2K33 A;  4HJA A;  4JI0 Q;  2NVQ H;  5D3D A;  4KHV A;  3GTQ H;  3R3O A;  4DV6 L;  4A3J H;  3CD6 A;  3RNU A;  1DOL A;  1FGU A;  4DR6 L;  3M85 A;  3PF5 A;  1D5Z C;  5CV6 A;  1IBM L;  2YTY A;  2OQ0 A;  3PUX A;  4K6D A;  3MA2 B;  5HY6 A;  2UUB L;  4BY1 H;  4GLA C;  3RLN A;  1ET9 A;  1OXT A;  3JAM E;  4XQJ A;  4LF4 L;  1RIP A;  1O7Z A;  3T13 A;  1ML0 D;  2K5D A;  4MTK A;  2RDF A;  5IYC H;  2L9H A;  5IYB G;  2BA1 A;  5M5W H;  2L15 A;  3GTJ B;  1IBL Q;  1H9K A;  2NTS A;  1EU3 A;  4MZ9 A;  1ICF B;  2I46 A;  3SK4 A;  1AP0 A;  3HKS A;  4FXG C;  1YHB A;  1SYB A;  5A2Q E;  1JOK A;  4AIM A;  4IUQ A;  3S15 B;  2NWG A;  1EIF A;  4JOI C;  1IKL A;  2HD3 A;  2B2U C;  5IGB A;  3NSW A;  3NEN A;  3STB C;  2ALY B;  3F2B A;  3I4N H;  5E4W C;  2Z6K C;  1OXS C;  2PPB C;  1MHW C;  4RMF A;  3S1R H;  1AEX A;  4S3S A;  1O80 A;  5JVG 3;  4R4O A;  1VQK A;  4RCO A;  2D62 A;  2DNC A;  4K0K Q;  2R92 G;  3R93 A;  1DM0 B;  4F88 A;  1G2T A;  2WAQ B;  2E5L L;  2QIL A;  3F2C A;  4K8J A;  3KFU A;  3CKI B;  4DR1 Q;  1OXV A;  1EIG A;  1LAB A;  5CMD A;  3IL8 A;  4JI2 Q;  1SSO A;  4IUU A;  4ZUI A;  3M3Y H;  2RCN A;  1F9Q A;  1L1O C;  3G6J B;  2FJ2 A;  4DUY Q;  4DV1 Q;  3T1H L;  2GVA A;  3DM3 A;  1C48 A;  3R8B A;  3BYY B;  4R1J A;  4DAY A;  4DV2 Q;  3HOV H;  2K5Q A;  1NCV A;  2R7Z H;  2A1A A;  5C0X I;  2N88 A;  5JVH 3;  1W3S A;  5E4X A;  4G57 A;  1I3Q B;  4LUO A;  2AUJ D;  3H94 A;  5C3X A;  4KKT A;  4HIK A;  4B3M L;  1Y14 B;  4RGT A;  3BZC A;  4B08 A;  1FNV A;  4C3H H;  4DV5 L;  1VQO A;  4RKB A;  2QDB A;  3ULP A;  1D5M C;  4C3J G;  2AWO A;  3KF6 A;  2EY1 A;  3OIP A;  1GVP A;  1QCB D;  4A3I B;  1HNW Q;  1I4H A;  3R2I A;  2CWP A;  3DMU A;  4A3J G;  1DZ1 A;  5ELE A;  4YY3 L;  2OTJ A;  2EYM A;  2OF1 A;  4Q0F A;  2B3G A;  2NZH A;  4IPC A;  2BDO A;  1VMP A;  2ICE C;  5KNC A;  2EE1 A;  3FP9 A;  5IYC G;  4JI1 Q;  4L5T A;  4C3I G;  2RDH A;  1X65 A;  2E75 C;  1G8Z D;  5IGD A;  1WCM B;  1A8V A;  4XIG S;  3NE5 B;  1GOZ A;  3S16 B;  1D7Q A;  5IIF A;  4QUC A;  5C4J B;  5BR8 L;  2A6E D;  2NVT H;  3I4L A;  2O5I C;  4A3G G;  4K14 A;  1RTO A;  1I4R A;  3H0G H;  2ZTD A;  5AJ3 L;  3I56 A;  4V19 0;  1TWC H;  3K81 C;  4DR3 Q;  5FO9 B;  5IE8 A;  1WTR A;  4DAY B;  4PZ6 A;  3PIP 3;  4N8X 1;  2IW3 A;  2JA8 B;  1FD7 D;  3F8T A;  4DUZ Q;  4G4K A;  1D5X C;  2QEX A;  3PF4 A;  1I4X A;  1EYA A;  4FF4 A;  1NSN S;  2IWH A;  2A69 D;  1TWH B;  4LF6 L;  1WD1 A;  5JEA G;  1YNJ C;  4QQB X;  3EQL C;  2UUA L;  1N32 L;  1JE5 A;  1R9T B;  1MKH A;  1SRU A;  3HG9 A;  3H6M A;  3KF6 B;  4OX9 L;  1F2Y A;  1PH9 A;  1B3Q A;  1HCZ A;  4FP5 D;  4O2D A;  4ALP A;  1UE1 A;  3FPU B;  3S15 H;  5COR A;  4LJZ C;  1CSQ A;  2VUM H;  2PMZ B;  2KHJ A;  1J9O A;  1X3F A;  1TKW B;  2JA7 B;  2UXD Q;  3BZK A;  1JIC A;  4UDU C;  2R3Z A;  3J81 j;  3MEH A;  3S2D H;  3OTO L;  4M8A A;  3PGZ A;  3NHH A;  1WTW A;  3A7L A;  1HZB A;  4C3H G;  3RZO B;  5CBA E;  4DV7 L;  3NTK A;  5IOC A;  4FF1 A;  1EQT A;  3NWS A;  1LTA D;  2P5Z X;  3BDL A;  1JCK B;  1QJO A;  2YTX A;  3ULJ A;  3ZYY X;  2PNR C;  3NEM A;  4R9W A;  3OOC A;  1WD0 A;  1ILP A;  1SYG A;  4AYB E;  1Y1W H;  3DWQ A;  3MZ5 A;  5JEA J;  1PDQ A;  5IP9 G;  3PUZ A;  3I4M G;  3FPP A;  1EQR A;  3BVG A;  3X3N A;  3UDI A;  2N8N A;  2KBN A;  2L5T A;  1HR0 Q;  3H15 A;  3CHB D;  2IL8 A;  3IFT A;  2JA9 A;  1CKM A;  5BN4 A;  2EXZ A;  4IPG A;  2Y0S G;  2B2W A;  5ELO A;  1I3Q H;  3UE1 A;  3KLW A;  3NQT A;  4IFD G;  3L3O C;  1QG7 A;  1DYQ A;  3GTL B;  1MD2 D;  4AH6 A;  2CH4 W;  4F7X A;  1PFN A;  3CCU A;  1SE3 A;  4P72 A;  3KLS A;  4NB3 A;  1B44 D;  1K83 B;  4QY7 A;  4A3I H;  1ZYR C;  3H0G G;  3ULL A;  2XGT A;  1GJX A;  1CQF A;  5HGQ A;  3K5N A;  2WP8 J;  2VL6 A;  4LF8 Q;  2HIX A;  4HMI A; 
#chains in the Genus database with same CATH homology
 3T16 A;  5CYU A;  3Q23 A;  2Q8R E;  2EDG A;  2M9V A;  3TDQ A;  5I9P A;  1EYD A;  4OIJ A;  5I4D A;  3K58 A;  1CHQ D;  1LLR D;  1ENA A;  5J39 A;  1EIH A;  3OW7 A;  1VDZ A;  5LL6 S;  4IFD J;  2L1B A;  4QB4 A;  3FMC A;  2K05 A;  1SYE A;  1G6Z A;  2KEC A;  4FYD A;  5C3E B;  1WVL A;  3KF8 A;  4I65 A;  2CQA A;  4F8M A;  2ZXP A;  2IX0 A;  4KN7 C;  4U67 3;  4DGZ A;  3MWY W;  4LAA A;  2K03 A;  4DAV A;  3AMU A;  1HFN A;  3KBG A;  3SHL A;  3TZD A;  2EYF A;  2FFK B;  4ABN A;  3NWT A;  1ZXT A;  4DXF A;  1LTS D;  3HOY B;  3KBX A;  4XT1 B;  5IT9 L;  1C8C A;  1O7Y A;  4RAU C;  3QJY A;  1M4V A;  1GUW A;  1ET6 A;  1SJH D;  1PLF A;  3OWE B;  4HCS A;  1LTG D;  1IYV A;  3K7A B;  1Y8P B;  3P75 A;  1SYC A;  1SYF A;  2NTT A;  4XDX A;  2PQE A;  2EYO A;  1HQM C;  2R61 A;  2F0V A;  2PZW A;  3DXJ C;  3ERO A;  3N6R A;  1GUG A;  4X3T A;  2WB1 B;  2JP1 A;  5D14 A;  4KKS A;  3PO3 B;  2F0D A;  2Q8T A;  3E0J A;  3NBI A;  2RSO A;  3C1E A;  3LX0 A;  3RZD B;  1J8I A;  5JAV A;  2WAC A;  3GTG B;  1PFB A;  1NR2 A;  3RMH A;  3TSS A;  4IQZ A;  2NZ1 D;  1KAB A;  4HR7 B;  1DXM A;  4BY1 B;  3TBI B;  4KK7 A;  1HUM A;  2X69 A;  1WTO A;  5CBE E;  2HCC A;  2QEJ C;  3BS1 A;  4K5W A;  1LTR D;  1S5D D;  1QIL A;  5FO7 B;  1JWU D;  4DN4 M;  4RWS C;  1UAP A;  4K8I A;  4EQP A;  4KY7 A;  3I4N B;  1EWH A;  2F0N A;  1XWE A;  1JOQ A;  5FO8 B;  1ONL A;  3MXG A;  2B2Y C;  3NXW A;  2AWN A;  2C9O A;  2O4X A;  1Z47 A;  2AUK A;  4ZRZ A;  3M7N A;  1I50 B;  3P7J A;  1SDF A;  5IGC A;  1H9J A;  1STN A;  1CFM A;  1EYC A;  1BQQ T;  4ODG A;  1TR5 A;  1LT3 D;  1HTL D;  4KY6 A;  2NN6 H;  1F2L A;  3HOV B;  2Z8L A;  1SND A;  2XN9 C;  2R7Z B;  2E74 C;  1TII D;  3LNN A;  1O7L A;  4DNT B;  5HGT A;  2XWJ B;  3VA7 A;  4J1M A;  1EU4 A;  1RHP A;  1E2V A;  2WKC A;  2F4I A;  2NYZ D;  4TSS A;  1AZQ A;  1A3U A;  4ULL A;  2Z1C A;  5T1I A;  1CA6 A;  3L7Z C;  4HCE A;  4RFB A;  4ME5 A;  5JPN C;  4XT3 B;  4RCN A;  3MVV A;  3CRL C;  1I4G A;  4BWG B;  5EGT A;  2IPK D;  3V05 A;  1M8A A;  3J81 E;  3SVM A;  2PW7 A;  3P20 A;  5KYL A;  3MXN A;  1UEA B;  2A74 C;  5I9O A;  4TKO B;  4EQO A;  1JC7 A;  2LS0 1;  1RF2 D;  4X3K A;  2NVT B;  2EYH A;  1EY4 A;  2J0T D;  2F3V A;  4IUR A;  2A6H D;  4RA8 A;  1AFP A;  3J7A V;  1TWC B;  2B2W C;  3Q0A A;  4HN7 A;  1RDP D;  1FNU A;  1E2W A;  5KEE A;  4K2L A;  3CU7 A;  5K36 H;  3GTM B;  4LK1 C;  2F0G A;  3W2D A;  1FYC A;  1W6K A;  4QMG A;  1NUC A;  3DEO A;  3A55 A;  1SXT A;  1LO5 D;  1H9S A;  4CHT B;  1STY A;  2FMM A;  4XXE A;  3J7A F;  2D9U A;  1PZJ D;  2F0K A;  2VUM B;  2E2J B;  4RHR A;  3PUY A;  3S2D B;  5BN5 A;  4G7H C;  1PRT D;  3KLS X;  3V2T A;  1U9R A;  4RGO S;  5FOB B;  4IN3 A;  1B2T A;  1BBX C;  1XXG A;  3E5S A;  2K04 A;  1PTO F;  3TME A;  3WOF A;  2MUY A;  1Y1W B;  4OO1 G;  1DD2 A;  2F0I A;  2V4D A;  1S5B D;  2A73 B;  1S5C D;  3L9A X;  3VA5 A;  5FLX L;  3RLF A;  4KN4 C;  4EGV A;  3FEW X;  4LMQ D;  4IFD I;  2H1E A;  2XIW A;  1SBB B;  2F0J A;  2L4N A;  1QWY A;  1S5E D;  1YNN D;  4EVO A;  1H9S B;  3T4A C;  2O2L D;  3DWP A;  2LKV A;  5I2X A;  4KD4 A;  2JEB I;  3EVQ A;  3VYT A;  2Z4H A;  2DNE A;  4FVM A;  4IUT A;  2B2V C;  2F0S A;  1KDA A;  1DON A;  3HOU B;  3C1F A;  3JAM L;  1EY8 A;  1JE4 A;  2F0F A;  2MP1 A;  3D6W A;  5KRU A;  1PTO D;  2X6L A;  5ELC A;  1SMY D;  2F0H A;  4BA2 I;  2K7V A;  5A2Q L;  3EA6 A;  5CV4 A;  1B1Z A;  4QIW B;  3ERQ A;  1PZK D;  1V1P A;  2EOT A;  2JA6 B;  4KJN A;  1TS4 A;  4IUP A;  4BS9 A;  2KOL A;  4CJ1 B;  1QNU A;  5AFW A;  3SK8 A;  2EY6 A;  4CKE A;  1BO0 A;  5M5X B;  1RKN A;  2LY7 A;  1TS2 A;  2N55 A;  2B63 B;  1ESF A;  2B8F A;  5J22 A;  5M5Y B;  2QKI C;  2SDF A;  4ID6 A;  1ZKO A;  2G9H D;  4CGY B;  2BCO A;  2TSS A;  4C1N I;  3ITP A;  1BCP F;  3T51 B;  1T5E A;  2JEA I;  2F0O A;  1PTO B;  1JB3 A;  3TP5 A;  4TQU S;  2EYP A;  2OEO A;  2O5J C;  1KLG D;  4XYQ A;  3URY A;  1IW7 C;  1LTI D;  5DM7 3;  4PMW A;  2RQX A;  1WTQ A;  3I72 A;  5EPK A;  4HED A;  2C5C A;  3MC0 B;  1RD9 D;  2AQ1 B;  4C1N K;  2F0W A;  4QF4 A;  5EBC A;  4RHS A;  2SNM A;  3RD4 A;  2CW0 C;  4C2M B;  1GUN A;  3FVQ A;  1V1P B;  3I73 A;  4X3U A;  2A68 D;  2K28 A;  1SNP A;  4J6H A;  5C4H A;  1TWF B;  3QWN A;  3NBH A;  1LTB D;  2DY7 A;  1STE A;  4DNR B;  1HRJ A;  1I6V C;  2VB3 X;  5LHY 1;  1DJR D;  3BYT B;  3HRZ C;  1TT2 A;  5KNB A;  1BOS A;  1MGS A;  3GV3 A;  1GUS A;  2FHT A;  1BCP D;  4NKL A;  1CZG A;  1AN8 A;  2PO4 A;  4P2C B;  3OMG A;  2L12 A;  1MBY A;  1B50 A;  1Y8N B;  1T5X D;  4F87 A;  5D3I B;  4XQN A;  1STH A;  1ICW A;  4ZLT F;  3NTI A;  1TQO A;  4H0L C;  4PV1 C;  3C2P A;  4KKU A;  2M00 A;  2NUC A;  4ZKC B;  3D8G A;  2EYJ A;  2EJF C;  1EOT A;  3S1N B;  5E1F A;  4DA2 A;  2DN8 A;  1BNZ A;  1F9R A;  1TWG B;  4KV6 A;  1MI2 A;  3HOX B;  1I4P A;  1SJE D;  1EQV A;  2J7Z A;  3NQI A;  1DOM A;  4FNF A;  2YU9 B;  1EFI D;  3S9W A;  4K2K A;  2HDM A;  5HUR A;  2J4X A;  1F9S A;  5CGK A;  1F2M A;  5CR3 A;  1VF7 A;  3BDC A;  2WV6 D;  1PTO H;  3ND9 A;  1SNC A;  3PMF A;  5DNF A;  3AB9 A;  3D3R A;  1A3T A;  4L6T B;  1SE2 A;  1K8M A;  1PZI D;  1GUO A;  1CT1 D;  4R8N A;  5EKL A;  1OXX K;  3MXP A;  2EY5 A;  4DXG A;  4A3M B;  3T56 B;  3VR4 A;  3S1Q B;  2R93 B;  4ZQ3 A;  2E76 C;  5EJW A;  3V96 A;  3SEB A;  4L63 B;  3Q22 A;  2KED A;  4PQX A;  2ENB A;  2G9D A;  1H9M A;  3GTO B;  2B2T A;  5G3L F;  1Y1V B;  1SNO A;  4FXD A;  1A2T A;  4K5V A;  1G91 A;  4L8J A;  2XVS A;  3MFG A;  4ZYS A;  1QB5 D;  1TWA B;  2EYL A;  1EY9 A;  5DEH A;  4R8I A;  3J80 E;  2EPB A;  1QNK A;  3I3C A;  2H4O A;  4V0B A;  4AYB B;  3MXU A;  2A6E C;  4ZKB B;  2R6G A;  4C3I B;  1R4Q B;  1JR0 D;  4ILW A;  3I90 A;  4CJ2 C;  5C4X B;  3HOW B;  1U4L A;  1TS5 A;  1LT4 D;  3G7L A;  1IYU A;  3CQZ B;  4FF2 A;  2KA7 A;  1YNJ D;  4A3G B;  1ENF A;  3DUZ A;  1FNW A;  5JJZ A;  2A69 C;  3TP7 A;  3S2H B;  1JWM D;  1BR9 A;  2EJM A;  3QG1 A;  4IUV A;  4DK0 A;  4OO1 I;  5G3L D;  4KI0 A;  1NAP A;  3ONA B;  1A2U A;  2QF7 A;  4G7O C;  1UNS A;  1IL8 A;  1EZ6 A;  2F0P A;  4CKC A;  3T53 B;  1TS3 A;  2JE6 I;  3E6Z X;  4TRD A;  3SK6 A;  2E2D C;  3H91 A;  3DHQ A;  4XQQ A;  1ESR A;  4C56 C;  4O42 A;  2IJ0 A;  3X3M A;  1LT5 D;  1PRT F;  2PZT A;  3K5O A;  1EY0 A;  1E0B A;  5M3M B;  3I8Z A;  2EY2 A;  2HQE A;  2AQ3 B;  4U68 A;  2LMC B;  1TVX A;  3K5L A;  1STA A;  5KND A;  2NVX B;  1TY2 A;  3PIO 3;  1U4M A;  2HDL A;  1ZYR D;  2SEB D;  3S1M B;  3DM1 A;  3UI2 A;  5COY A;  4CJ0 B;  1SE4 A;  4Q5V A;  1XX8 A;  4QUF A;  4A3D B;  2YYZ A;  2F3W A;  3QO2 A;  3GD7 A;  3U9O A;  2JSO A;  3Q24 A;  2F0M A;  5DM6 3;  2B8G A;  2KQ3 A;  4RGM A;  2QCP X;  1LTT D;  5CV5 A;  2M2L A;  4YIJ A;  1GXD C;  2SNS A;  1SNQ A;  2CHB D;  4DK1 A;  4FF3 A;  4DAP A;  3M4Y A;  2VB2 X;  1EZ8 A;  4OL7 A;  3TZU A;  1D2B A;  2SOB A;  2RSN A;  2OT2 A;  1AW7 A;  4PMB A;  4N9T A;  4NMZ A;  2NN6 G;  2F0L A;  4A3F B;  2XWB B;  5EPJ A;  2B39 A;  3FDT A;  3LWU A;  4UAI A;  1X3Q A;  4G7Z C;  3N52 A;  3TP6 A;  1PXU A;  3NUC A;  3WDN A;  2Z4I A;  1MSG A;  4A3B B;  4OIK A;  4NDX A;  3I70 A;  5JOB A;  4RKL A;  4BA1 I;  3H3V C;  2PZU A;  3IFD A;  2DY8 A;  2RDG A;  3OSO A;  3FKI B;  1LT6 D;  2IT1 A;  4KJO A;  4ZAI A;  1GUT A;  4JBW A;  5KYI A;  2EJG C;  5A35 A;  5M9O A;  4RGN A;  3A8I E;  2ID0 A;  4JK1 C;  1HA5 A;  5JEA H;  1JOR A;  3DWA A;  2K1B A;  4ZK9 B;  5KIX A;  3K5M A;  1A6X A;  4CBV A;  3J81 L;  1PRT B;  1BDO A;  4A3E B;  3EFX D;  1JOO A;  5J1Z A;  3U9S A;  5EKI A;  3Q6S A;  3PO2 B;  5EQ0 A;  3H09 A;  5DAU A;  4BBS B;  1U4R A;  5K36 G;  4RH6 A;  5C6A A;  4HTH A;  2Q8I B;  2NVY B;  1IKM A;  1VMC A;  2K01 A;  3VYS A;  1V43 A;  3EJI A;  3K57 A;  2RVL A;  2BOS A;  4PNY A;  4XYO A;  1STB A;  1S4Z A;  1KAA A;  1IHZ A;  5C0X H;  3O13 A;  4MN3 A;  3HKZ B;  2XNA C;  4DFA A;  1JQY D;  5ELB A;  3SK5 A;  3D6C A;  2F0E A;  4IFD H;  3OIQ A;  2MHV A;  2B2Y A;  1W6J A;  2B2T C;  2FMC A;  3HOZ B;  5D65 A;  1FR3 A;  1Z7T A;  1RTN A;  3QOL A;  1NR4 A;  3QB3 A;  5C4Z A;  4BY7 B;  2LFN A;  1EWC A;  5I6Y A;  4X3S A;  3D31 A;  2XRQ D;  4HMJ A;  3HP3 A;  1FGB D;  1O78 A;  2ZXR A;  4OGQ C;  1S5F D;  1I6H B;  4FO2 A;  1XTC D;  5BN3 A;  1PMR A;  1EY6 A;  2WKD A;  3R2T A;  1HTP A;  1CHP D;  4HSP A;  5FK9 C;  3TP8 A;  1Z6H A;  2IX1 A;  1GHK A;  5I6W A;  3IAY A;  1EY5 A;  5EPL A;  2VXW A;  3BG3 A;  3GV6 A;  5JPM C;  5ISR A;  1CTM A;  2D5D A;  5IGG A;  2E2I B;  2JA5 B;  2RKS A;  3MFY A;  3OPO A;  5F2D A;  2CVR A;  1L0X B;  2K5W A;  5C44 B;  3GP7 A;  1KNE A;  5T1G A;  4DU9 A;  1ROD A;  4H44 C;  5ELD A;  4A93 B;  4K6L A;  1HQR D;  3BZD B;  5IT9 E;  3ND8 A;  2K32 A;  4HSV A;  1HXY D;  2PYK A;  2F0Q A;  1QE6 A;  1Y8O B;  4Y7N B;  3VR6 A;  5C0X G;  3S14 B;  4PMC A;  3BVM A;  4M1U B;  2KCN A;  1Q1B A;  1HUN A;  4KD3 A;  1VCI A;  1XYI A;  4A3K B;  1V1O A;  2E2H B;  2X6G A;  5K5P A;  1Q90 A;  3QOJ A;  3W3A A;  3A7A B;  1ZEQ X;  2RBM A;  3A8K E;  5C5L A;  2BE5 C;  3A54 A;  1Q12 A;  1AZP A;  1KDC A;  5M3F B;  4BBR B;  4HAE A;  1CK1 A;  1G29 1;  2A6H C;  2KJX A;  5C3W A;  1GHJ A;  2JYO A;  4KTA A;  3TN2 A;  1HA6 A;  2B2U A;  5C0X J;  3NK9 A;  4MHE A;  3WOE A;  1U4P A;  4N9P A;  1F2Z A;  3K6O A;  3M7G A;  1EL0 A;  1Q1E A;  1JWS D;  1BXT A;  5CV9 A;  3IKJ A;  3OHX C;  1OO9 B;  1K8O A;  4B9W A;  2ZT9 C;  2F03 A;  1CZW A;  4GZY C;  3A8J E;  1CM9 A;  3VR2 A;  3F2U A;  2HUG A;  2MPM A;  2F1M A;  1A3V A;  4MIU A;  2WIN B;  2FIN B;  1L0Y B;  1ILQ A;  1BCP B;  2KCC A;  1PRT C;  4E6I A;  3BDO A;  1Q8I A;  2KUM A;  3SR1 A;  3K0Y A;  2L0C A;  4K5X A;  3J7Y W;  2EZV A;  2TMP A;  2KEE A;  5ELF A;  5KGU A;  1X32 A;  1B3A A;  1X3P A;  4DF7 A;  1QOH A;  2IX3 A;  1SFO B;  4IUN A;  1TY0 A;  1D6E C;  2R92 B;  2F0U A;  2MGS A;  1EEI D;  1WTV A;  1MSH A;  2K6A A;  3D4D A;  2MJ8 A;  4CKB A;  4WRD A;  3PUW A;  3GTK B;  2B2V A;  3MAQ A;  1TU2 B;  2JXM B;  1UUP A;  3KUP A;  5EKK A;  5EBD A;  4OHJ A;  4ZUJ A;  3DEP A;  1H9R A;  2D2C C;  1HFG A;  5TSS A;  1YNN C;  1PYW D;  2F0T A;  2KHS A;  3RUZ A;  1LV9 A;  3NPP A;  1CA5 A;  3VYR A;  1WTP A;  4KY5 A;  4C3J B;  4FXK C;  4WFN 3;  2NVQ B;  2AQ2 B;  3GTQ B;  3HEJ A;  3MTS A;  4A3J B;  3M4O B;  1RCV D;  2WII B;  2HCI A;  2EVB A;  1B9M A;  2L11 A;  1CQV A;  5NUC A;  1KTK A;  2BDN A;  2OXP A;  2RA4 A;  2VNU D;  3GQB A;  1HPC A;  2NN6 I;  1PTO C;  3VYU A;  4KMU C;  1SAP A;  1I4Q A;  4WOR A;  5CC4 A;  5LL6 X;  3CRK C;  1SMY C;  2KVM A;  4H7B A;  3NTH A;  3OWF A;  5M5W B;  1Y69 U;  1RJT A;  5E3F A;  5FKA C;  2PCF B;  3P1H A;  4IZ8 A;  1ENC A;  1B9N A;  3S17 B;  1SYD A;  1V8Q A;  2XRS D;  5CV7 A;  5IGF A;  2A5H A;  3PUV A;  1G2S A;  3FRP B;  1WTX A;  5C5M A;  3D4R A;  1SNM A;  3S1R B;  4B9X A;  3AU7 A;  1KDB A;  1VF5 C;  2GA4 B;  1DCZ A;  3SDZ A;  3D4W A;  1E2Z A;  1EEF D;  3BVZ A;  4WJW A;  3M3Y B;  3GTP B;  4I7Z C;  2I07 B;  3SXH A;  3NP8 A;  2ICI A;  3KK7 A;  3OMC A;  1CI3 M;  4J8Q A;  4KHZ A;  4QCL A;  1IW7 D;  3K59 A;  1KLU D;  5I2Y A;  1II3 A;  4NW2 A;  3MHB A;  5IOD A;  3C3L A;  4O1N A;  1PFM A;  1LAC A;  4NP5 A;  3HGB A;  1KNA A;  4C3H B;  1R4P B;  1B53 A;  3A56 A;  2CW0 D;  3LWE A;  1STG A;  1DOK A;  2NB0 A;  1F9P A;  1OXU A;  3HZX A;  1SEB D;  2XSC A;  1BUV T;  3HS0 C;  4IAL A;  2BA0 A;  3GO5 A;  3PV0 A;  1C4Q A;  1B4O A;  4Z9C B;  1BF4 A;  5FLX E;  4OO1 H;  3C46 A;  2A68 C;  3I4M B;  3J80 L;  5CV8 A;  1A15 A;  1HHV A;  1EY7 A;  2NBF A;  2PW5 A;  2Y0S B;  3SE0 A;  1D1I A;  1F77 A;  2ZXO A;  4XTC S;  3VR3 A;  1D1K A;  2L55 A;  3KLR A;  2BE5 D;  4EQN A;  3VR5 A;  1Q3L A;  5IGE A;  4H13 C;  3I91 A;  3QIA A;  1BCP C;  3H0G B;  2K33 A;  5D3D A;  4KHV A;  3R3O A;  1DOL A;  3M85 A;  1D5Z C;  5CV6 A;  4K6D A;  3PUX A;  3MA2 B;  1ET9 A;  1OXT A;  3JAM E;  4XQJ A;  1O7Z A;  3T13 A;  1ML0 D;  2K5D A;  2RDF A;  2L9H A;  2BA1 A;  3GTJ B;  1H9K A;  2NTS A;  1EU3 A;  2I46 A;  3SK4 A;  1AP0 A;  4FXG C;  1SYB A;  5A2Q E;  1JOK A;  4IUQ A;  3S15 B;  2NWG A;  1IKL A;  2B2U C;  5IGB A;  3NSW A;  5E4W C;  1OXS C;  2PPB C;  1AEX A;  4S3S A;  1O80 A;  5JVG 3;  4RCO A;  2D62 A;  2DNC A;  3R93 A;  1DM0 B;  4F88 A;  1G2T A;  2WAQ B;  2QIL A;  4K8J A;  3CKI B;  1OXV A;  1EIG A;  1LAB A;  5CMD A;  3IL8 A;  1SSO A;  4IUU A;  4ZUI A;  1F9Q A;  3G6J B;  2FJ2 A;  1C48 A;  3R8B A;  3BYY B;  4DAY A;  2K5Q A;  1NCV A;  5C0X I;  2N88 A;  5JVH 3;  5E4X A;  4G57 A;  1I3Q B;  2AUJ D;  3H94 A;  5C3X A;  4KKT A;  4RGT A;  4B08 A;  1FNV A;  4RKB A;  2QDB A;  1D5M C;  4C3J G;  2AWO A;  3OIP A;  2EY1 A;  4A3I B;  1QCB D;  1I4H A;  3R2I A;  3DMU A;  1DZ1 A;  5ELE A;  2EYM A;  2OF1 A;  4Q0F A;  2BDO A;  1VMP A;  2ICE C;  5KNC A;  2EE1 A;  4C3I G;  2RDH A;  2E75 C;  1G8Z D;  5IGD A;  1WCM B;  4XIG S;  3NE5 B;  1GOZ A;  3S16 B;  5IIF A;  4QUC A;  5C4J B;  2A6E D;  3I4L A;  2O5I C;  4K14 A;  1RTO A;  1I4R A;  4V19 0;  5FO9 B;  1WTR A;  3PIP 3;  2IW3 A;  2JA8 B;  1FD7 D;  4G4K A;  1D5X C;  1I4X A;  1EYA A;  4FF4 A;  1NSN S;  2IWH A;  2A69 D;  1TWH B;  1WD1 A;  5JEA G;  1YNJ C;  3EQL C;  1R9T B;  3HG9 A;  3H6M A;  1F2Y A;  1HCZ A;  4FP5 D;  3FPU B;  5COR A;  4LJZ C;  2PMZ B;  1J9O A;  1TKW B;  2JA7 B;  1JIC A;  4UDU C;  2R3Z A;  3MEH A;  4M8A A;  3NHH A;  1WTW A;  3A7L A;  4C3H G;  3RZO B;  5CBA E;  3NTK A;  5IOC A;  4FF1 A;  1EQT A;  3NWS A;  1LTA D;  3BDL A;  1JCK B;  1QJO A;  3ZYY X;  2PNR C;  4R9W A;  3OOC A;  1WD0 A;  1ILP A;  1SYG A;  3DWQ A;  3MZ5 A;  5JEA J;  1PDQ A;  3PUZ A;  3FPP A;  3BVG A;  3X3N A;  2L5T A;  3CHB D;  2IL8 A;  3IFT A;  5BN4 A;  2EXZ A;  2B2W A;  3NQT A;  4IFD G;  3L3O C;  1QG7 A;  1DYQ A;  3GTL B;  1MD2 D;  4F7X A;  1PFN A;  1SE3 A;  3KLS A;  1B44 D;  1K83 B;  1ZYR C;  1GJX A;  1CQF A;  3K5N A;  2WP8 J;  4HMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...