4KY6A

Crystal structure of staphylococcal nuclease variant delta+phs l25d at ph 6 and cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKDMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25D at pH 6 and cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky6A00
1SYDA 5KYLA 5IIFA 4KJOA 2EYHA 3NQTA 4K14A 3R3OA 4RKBA 5E3FA 1U9RA 3QOLA 3PMFA 1STBA 3OMCA 4EVOA 3NP8A 4HMIA 4K8IA 5EGTA 4ZUJA 4ZUIA 1A3TA 2EY2A 2F3VA 5CV6A 3SK6A 2F0OA 3TP8A 5IOCA 1EQVA 2HQEA 2OXPA 5C3WA 3D4DA 3SR1A 2PZTA 3H6MA 4QF4A 2OEOA 3LX0A 4KHVA 1SYCA 4KY7A 4RKLA 5KGUA 4E6IA 4F8MA 1NUCA 4K2LA 3ERQA 3VA5A 5M9OA 1KAAA 3MHBA 5CV8A 3OSOA 2F0PA 3D6CA 5E1FA 3NXWA 3E5SA 1IHZA 3C1FA 1EY9A 1SNPA 2SNMA 5J1ZA 1SYFA 1EZ6A 2F0FA 1EY4A 1STHA 2SNSA 3TP5A 1STNA 3SXHA 1SYEA 4KY5A 4NKLA 3ITPA 5C6AA 2F0QA 1STAA 3NHHA 1EYDA 4IZ8A 4NP5A 4PNYA 1SNQA 4H7BA 1A2TA 1RKNA 2F0UA 5IGBA 2F0WA 4J1MA 2EYMA 5IODA 4NDXA 3MZ5A 4R8NA 5CV9A 5JAVA 2KQ3A 5J39A 5C4HA 1KABA 2F0TA 5KYIA 1F2ZA 1EY6A 4G57A 4J6HA 1SNOA 2F0IA 3P75A 2OF1A 3D8GA 4DF7A 4HMJA 5C5LA 4K8JA 5KRUA 5IGGA 4K5XA 3V2TA 2EYJA 2LKVA 5IGEA 4MIUA 3T16A 3EVQA 1A3VA 4EQOA 2F0NA 5EKKA 4IALA 1SYGA 1ENAA 5J22A 1TR5A 2SOBA 1KDBA 1EYCA 4KV6A 1JOOA 4B9XA 5HGTA 1JORA 5I9OA 5HURA 4ID6A 4OL7A 4N9TA 3RUZA 3SK8A 1EY7A 4ODGA 2F0GA 5NUCA 2RDFA 3S9WA 2KHSA 2PW5A 2EYLA 2F0DA 1EZ8A 1STYA 4K5VA 3NK9A 5DEHA 5KEEA 2O4XA 3TMEA 3EJIA 2F0SA 3P1HA 1F2MA 4DFAA 1A2UA 2PQEA 5I6WA 2EY1A 2F0LA 2F0HA 3SK4A 1F2YA 2F0KA 1JOKA 2EY5A 3C1EA 3MXPA 2RKSA 2M00A 2PZWA 3QB3A 4KTAA 2QDBA 4YIJA 4K6DA 3SHLA 4F7XA 4PMCA 2F3WA 4KD4A 4I65A 1EY0A 2PYKA 2EYPA 3OMGA 1STGA 5JOBA 5C4ZA 4K5WA 3SK5A 3TP7A 1EY5A 3TP6A 4S3SA 5I9PA 5IGFA 1SNDA 1EYAA 2EXZA 1SNMA 2F0MA 2NUCA 3OWFA 3T13A 4WRDA 4HTHA 4EQNA 5CV5A 4IUNA 3BDLA 5IGDA 4N9PA 2F0VA 2PZUA 3DMUA 5CV7A 3HEJA 4LAAA 4B9WA 4KY6A 4PMBA 3EROA 4ZQ3A 2RBMA 2EYOA 3MVVA 5I6YA 1TQOA 2ENBA 4TRDA 1SYBA 5DAUA 3MEHA 1KDCA 2EYFA 4ME5A 3BDCA 4KD3A 4DGZA 4DU9A 5C5MA 5CV4A 2F0JA 1NSNS 5CC4A 5CR3A 5C3XA 3HZXA 5IGCA 3U9OA 5F2DA 5KIXA 3QOJA 4KJNA 2PW7A 4QMGA 5ISRA 1TT2A 1II3A 1A3UA 3D4WA 4EQPA 5K5PA 2WACA 1SNCA 3NUCA 4WORA 4NMZA 4QB4A 1AEXA 3DHQA 5EKLA 1KDAA 2F0EA 4K2KA 5CGKA 1EY8A 1JOQA 1ENCA 2EY6A
chains in the Genus database with same CATH superfamily
5KYLA 4FDBA 5LMUQ 3SE0A 3NQTA 2IX3A 5COYA 2VZAA 3CRKC 3NEMA 3F8TA 1OXSC 3CMEA 3ZYYX 4DPGA 1PH3A 3HOYG 4QF4A 4KHVA 1SYCA 1D2BA 2ZXPA 3BZDB 1BO0A 3E5SA 2CWPA 1CQFA 1SMYD 2A68C 3H91A 2K5QA 2QCPX 4NKLA 2QKIC 1EYDA 1SNQA 5LL6S 1Q90A 1YHAA 2ZT9C 4FXDA 4J1MA 3GTQH 3A5UA 3C2PA 4YCWA 2NVQH 1IBLL 4JI7L 1Q12A 3CW2C 1SLJA 1GXDC 1HTPA 1MHWC 2A1AA 2D0PA 3M3YB 3PO2B 3PO3G 1EQTA 2XIWA 2DY8A 4JI3Q 2B2YA 3FVQA 1EYCA 1LABA 3NWTA 2VNUD 3PUZA 1D6EC 2A6EC 3E6ZX 2R92B 2PW5A 4CGYB 1NR4A 1EZ8A 2X69A 1EWCA 1F2MA 2JXMB 2JA6G 3I91A 2M00A 1HQRD 2JEBI 2N88A 2AMCB 1YNXA 1VMCA 3A8JE 4HSPA 3UDIA 2XWJB 1SN8A 1IBMQ 1VQ4A 1K3RA 5ELNA 4RCNA 2O5JC 5C4XB 4DR5Q 2F4IA 3PO2H 2OTLA 2M2LA 3D3RA 2E2IB 2Z4IA 3ER0A 4JI5Q 5E7NA 4DUYQ 1SROA 5CORA 3CCVA 1X54A 1PXUA 4C2MB 3VYSA 4FF1A 4QL5A 1N34L 2VS1A 3E0EA 4L6TB 3W2DA 1AP0A 2KOLA 3HKZB 1VQLA 2G9HD 3MA2B 5CGKA 2LY7A 2BDNA 2MQHA 2B3GA 1FD7D 4A3BB 1PTOB 3Q8DA 4QGUA 1U9RA 1YIJA 5FLMH 2EJFC 4LF7L 4UP8A 1C7YA 5G3LD 5EPJA 3TREA 4LF4Q 1EQVA 1PTOC 2HQEA 3SR1A 5C4XH 2B63G 1WI5A 2JA7B 1LTGD 3CCEA 4XQJA 3OTOL 4IPGA 2E2IH 4JI0L 2F0PA 1IHZA 1O7LA 1PFBA 1PH9A 2JK8A 4DV4L 3J80E 2Y0SE 1EZ6A 1B7YB 1YJWA 2HIVA 1KD1C 4C2MH 4DV0Q 4ME3A 5GAHC 1STAA 2N55A 1TWFB 4HJAA 1HR0Q 3HOZG 3M7NA 4KLKA 3NENA 4C3JB 3TQYA 1VQGA 4TSSA 3R2IA 1YNJC 4JI2Q 1RJTA 4A3BH 1PTOH 2L12A 1YI2A 4G57A 5KRUA 1B3QA 4KI0A 1VQOA 3CAMA 3T16A 3KJOA 2MP1A 1SYGA 1DYQA 5IT9L 2SOBA 5IP7G 2MO1A 1G51A 3SK8A 1T5XD 3J81L 5GAEC 3KLSA 1A6XA 4HCEA 4F87A 2CKZB 1SFOB 5KEEA 2F4VQ 2HDLA 4DNTB 4X6AH 2F0LA 1PLFA 2F3IA 3SK5A 2PNRC 2A8VA 3RR5A 1TWFH 2R7DA 1QWYA 3K8AA 2FMMA 4BY7G 4C3JH 1MSHA 4UY8C 3NQIA 4JV5Q 3QIAA 2VQEQ 2CWAA 3RZOB 3TP7A 4DV7Q 1AW7A 1EQQA 2ZJPA 2X6LA 5HY6A 3HGBA 2R3ZA 2E8GA 2L4NA 4XDXA 2KVMA 3STBD 5IYCH 5M5YB 2IPKD 3RD4A 3E3XA 5L37A 1JJCB 2TMPA 4I7ZC 3KF6A 4A3DB 1B1ZA 1G8ZD 1CQVA 1QZGA 1SXTA 4OWWB 3CCJA 1VQ6A 4CKEA 1SMYC 4A4IA 1ENFA 3JAMc 5JPNC 1V1QA 1JR0D 4IUVA 3PO3H 5ELCA 4P71A 1XNQL 5FO8B 1HJPA 1Y69U 2BE5D 2CVRA 2BDOA 3KDFA 1PZJD 3RZOH 2V4DA 1I4HA 1YHQA 2NN6G 2YV5A 2Q2HA 2BCOA 1HXYD 2P5ZX 3WOFA 4E6IA 2K50A 3IFTA 4RGOS 4C3HG 4GZYC 2JA6H 4A3DH 1I4RA 2IHFA 4LFBL 1GUOA 3E9IA 1SYEA 4JBMA 1E22A 1N32Q 1AZPA 4O0AA 3AYHB 5C6AA 3E9HA 1WCMB 2F0QA 3NHHA 3FKIG 1GM5A 3KF6B 3I90A 4DAMA 2B63B 5IY0A 1LTSD 2CW0C 5ELFA 4CJ0B 1EY6A 4DV5Q 4A3EB 3GV6A 4RGTA 3OW7A 4CJ2C 1PH6A 1Y8OB 5EJWA 3T53B 3CCSA 1RD9D 1TR5A 2VB3X 5T1IA 1KAWA 1JOOA 4OL7A 3RUZA 2LFNA 2JQOA 5NUCA 2EYLA 4CDEC 5IP9G 3QR8A 4IOAA 5IWAL 1WCMH 5ELOA 4A3IG 4F7XA 2R7ZG 5EBCA 2UXCQ 1PRTF 4QIWB 4PMCA 1J8IA 1H9SA 1TU2B 4R9WA 2B63H 4A93G 2EYPA 1IZ6A 3AEVA 1KL9A 4AYBG 1GKHA 2I5LX 4A3EH 1Y14B 2WAQB 4CDCC 1B50A 4RFBA 1NTGA 2D9UA 4X64L 4PMBA 1A62A 1CI3M 3T1YQ 2FINB 1ILPA 3PQIA 1D5XC 1XPOA 1HUNA 5CC4A 4OO1H 1I94Q 4BY7B 2J7ZA 5KIXA 2JA9A 4X65Q 1RDPD 4QMGA 1WTVA 3FP9A 2R7FA 1VQJA 1DOMA 3M4YA 1XMQQ 2X6GA 3U9SA 2VUMB 4QQBX 2JA5G 1IYUA 4DV1Q 5EAYA 3AFPA 5JJKA 2Z0SA 4EVOA 3M4PA 4BXXH 4HMIA 1KQSA 1MI2A 5A2QE 4BY1B 4IPHA 3H15A 4LWCA 3WWVA 4JI6L 3D4DA 5AFWA 1E1OA 1X55A 2FFKB 2ZM6Q 4ZAIA 2AKWB 4KY7A 2BA0A 2KEEA 2NBFA 1ILQA 4A3FB 1VQAA 4YY3L 3A0JA 5LHY1 1OXTA 1O7ZA 4MNOA 4G7HC 3G6EA 5FLXc 4BY7H 3IFDA 4BWGB 1LM0A 4X66L 2EIFA 4IZ8A 5J3BA 2K5VA 1QJOA 4B3SL 5JJIA 2A19A 1EOVA 3BZKA 1WD1A 5M3MB 3A8KE 1YNND 2E76C 4R8NA 2WKDA 4NXML 4IJHA 5J39A 3SGIA 3G7LA 1J5EL 3S2DB 5FK9C 2H4OA 2A6HC 1JJ2A 1AN8A 1FGUA 3BZCA 2JYOA 2D2CC 3BG3A 4DXFA 1DD2A 4BY1H 4KHPL 2Z4HA 4CJ1B 1D1KA 1A3VA 5LL6X 3K0YA 3KLSX 4RHSA 1SEBD 1Y1VG 1JWUD 2RCFA 3TZDA 1JORA 2PMZB 4A3FH 4ZLTF 1AZQA 2A5HA 1R4QB 1E2WA 5C4JB 4A3JB 1VQNA 3HP3A 2YTVA 1HNXQ 2F0DA 4XT3B 3S1MB 4DAYB 5D3IB 2NZ1D 1CZGA 1DJRD 3ULPA 1VQBA 4HN7A 3NPPA 1EIYB 4YIJA 1ICFB 2XRSD 2NN6H 5M3MH 1TWHB 2F1MA 1LT5D 2HHHQ 4UAIA 3AFQA 3S2DH 4NPSA 4DR3L 3D6WA 2MO0A 4N8FA 1AE3A 1W6JA 4IUNA 2A73B 3DMUA 2ID0A 1GUSA 1XPUA 3JAMi 1RIPA 3W1BA 4CKBA 2R7ZB 1NSNS 5IGCA 5F2DA 3RMHA 4A3JH 2ATWA 1GUNA 1EYGA 1A3UA 3S1MH 1FL0A 3PIO3 1X65A 2HIXA 4QY7A 2UU9L 4C1NK 5M3FG 4HEDA 2JJQA 5IIFA 1IKMA 4C3IB 1HNWL 1TWHH 1VF7A 2DUDA 3JC66 4PZ7A 4B08A 2VQFL 3NP8A 4ZUJA 4BA1I 2OXPA 4TKOB 2A6ED 4DUZQ 5KGUA 4NXNQ 3M7GA 2UXDQ 1EEID 2ASBA 5BN5A 3B6YA 1NUCA 1QB5D 3DEOA 3L9AX 1MJCA 3K5LA 4AH6A 3C1FA 1EY9A 2R7ZH 2K32A 2JA5B 4X62L 1S4ZA 3OHXC 1PFSA 4M8AA 1PH8A 1VQDA 3EQLC 1EOTA 4U68A 5CBEE 2B8FA 5CV9A 2LXKA 1JT8A 1XMOQ 1BOSA 4C3IH 1QILA 4L5QA 4LFAL 4J6HA 4IFDH 2AWNA 1ICWA 5C3EB 4DF7A 5C5LA 4JI4L 2FMCA 4LUVA 2OQKA 3ICEA 3J80c 3IAYA 4B3MQ 1B3AA 1M90C 2BA1A 4AYBE 3PO2G 3G48A 5C0XI 4LF9L 2XN9C 5AJ3Q 5DM63 3S2HB 4H0LC 1K0RA 2JA5H 1JE5A 3OW2A 2R92G 3HOUG 3CU7A 2F0HA 5GAGC 4IQZA 1Y1VB 4TQUS 1PTOD 2Q2UA 3T4AC 1KLGD 5EKIA 4R4OA 4K0KL 1SE3A 4OX9Q 5M5WB 1CM9A 1W3SA 5C3EH 2HT1A 2PZUA 3CCUA 1EWIA 4RAUC 3CXCA 4RGNA 2UXBQ 2A69D 3KBGA 5C4XG 4DV3Q 1G6ZA 3MEHA 2UUCQ 2DN8A 3BDCA 3MFYA 2QDLA 4DV2Q 3CQZB 1NCVA 3G4SA 1HPCA 3CC2A 3BJUA 3CPFA 2NVXB 3S2HH 4JI8Q 1FJGQ 1SDFA 4XIGS 4DR4L 1YNJD 1WTQA 1IL8A 4ZRZA 3OYYA 2RSOA 4AIMA 1XTCD 1ET6A 1WVLA 1XNRL 3HKZG 3RZDB 4IFDJ 1Y1VH 1UE7A 1B8AA 3I4LA 3UDXA 4A3BG 3K80C 2WV6D 4ZCKA 2KHIA 2NB0A 5M5WH 3NE5B 5T1GA 3I4NB 3LWEA 1U5KA 4UPAA 1SJED 3P7JA 3OSOA 3NXWA 4YHHQ 5M3FB 2JA7G 4OWXB 2SNMA 4IUUA 3CQZH 3LNNA 3L3OC 1LTBD 4DR1Q 1A0IA 3SXHA 2B2TA 2BOSA 4DR7L 5FLXE 2NVXH 1UEAB 3S14B 1GOZA 2ICIA 3RLNA 2RSNA 2F0WA 2EE1A 1TS3A 3Q6SA 1QNKA 4V190 4C3JG 3GDEA 1HFGA 1S5FD 3RZDH 2OCEA 2LXJA 3D8GA 4GKJQ 5BR8L 5G3LF 3V2TA 1BR9A 4JYAQ 4JCVE 3KJPA 4EQOA 3BYTB 3M9BA 3LGJA 5IYCG 3I4NH 2GVBA 4ID6A 3K81C 3I3CA 1I50B 2F0GA 4RHRA 4LFCL 1D5ZC 1MKHA 5M3FH 2R6GA 3SEBA 1STYA 3DWAA 4F88A 2FXQA 1Q82C 4GKKL 2SEBD 3W1GA 4QUFA 5LMUL 2RA4A 2XWBB 3SK4A 2F0KA 3S14H 2CQAA 1P16A 4OIKA 2B2UA 3FPUB 1S40A 1S5ED 4GLXA 2KENA 4DK3C 4AQYQ 1C48A 3BS1A 1VQ9A 3CC7A 1EY5A 3TP6A 1IW7C 2D0OA 1PH1A 2E2DC 2GVAA 3BVZA 5FOBB 1BCPD 1C8CA 5K36G 3HOUB 4ZQ3A 3HS0C 2AQ3B 5I6YA 1E0BA 3NTKA 1GJXA 3K5NA 4DGZA 1PH4A 3F2BA 1YVCA 2G5DA 3NTIA 3S1QB 1A15A 3CMAA 4A3DG 4GOPA 3G71A 5ISRA 1VQ8A 1AE2A 2CW0D 1GHKA 2F0EA 1KHIA 1EIHA 1RCVD 1VMPA 3GTKB 3OWEB 1I3QB 3PUWA 3AQQA 1STEA 1G2TA 3JAML 4XYQA 1FR3A 3M3YH 2LMCB 1Y8NB 1J9OA 4JI3L 4OHJA 3X3MA 1SMXA 2PO4A 2F0OA 1WTOA 2CFMA 3KLWA 2IHEA 2R92H 3HOUH 1HNZQ 2MFIA 4RH6A 4R4TA 5E1FA 4JBWA 2DGYA 1JB7A 1YEZA 1C0AA 4KN4C 3W3AA 1CT1D 3TDQA 1BF4A 1STNA 1I5FA 3S1QH 1Q86C 1PH5A 2EQSA 4X3UA 4EX5A 4NB3A 3FRPB 4B3TQ 1A2TA 1L0XB 1TS5A 5ELEA 1TWAB 1WD0A 2B2YC 1GUWA 2ICEC 1IBML 1WCMG 1M8AA 4JPBW 4JW0A 2KQ3A 3J80i 1KABA 2EVBA 3GTJB 3KBXA 1HTLD 1GO3E 4GOPB 3GTKH 1I3QH 2WIIB 4DR5L 5BN4A 3H94A 2N49A 1M1KC 2LKVA 2K01A 4JI5L 4A3EG 4DUYL 5JEAH 4FO2A 4GOPC 2A69C 1ASYA 2ALYB 4BA2I 2RDFA 1VQHA 4OO1G 1OXUA 4OGQC 4KHZA 5DEHA 3ULJA 2DNEA 3AU7A 1A2UA 2MHVA 5KYIA 1F2YA 4KTAA 2WB1B 1GD7A 1CSPA 2RQXA 4KD4A 2D62A 1GVPA 1UNSA 4DNRB 1SE8A 3GTJH 4LF4L 2IX0A 4DV6L 1EQRA 1AH9A 5IGFA 3HKZE 1SNDA 2EXZA 4BXXG 3I7FA 3OPOA 2JA7H 4JI1Q 4DK0A 3R8BA 2RHQB 2LS01 3H3VI 3MVVA 3D31A 2ENBA 5DAUA 4L8JA 1B4OA 1KDCA 2WAQG 4DU9A 1PA6A 1NE3A 2K5WA 3J7AV 4DV0L 4HJ7A 2IL8A 2N8NA 1Q81C 5IE8A 1L1OA 1EEFD 2QILA 1VF5C 2PW7A 3SDZA 1K73C 1HR0L 3R2TA 4Q0FA 3TS2A 4A3MB 1N36Q 3J7A5 2A6HD 1BVSA 4JI2L 1ASZA 5EBDA 3R93A 3ZJYC 1Q8IA 1YBYA 3VYTA 1I6VC 4XQQA 1QZHA 1FNVA 3PIOA 5E3FA 4BBRB 1WTWA 5FJ8G 2VUMG 1CHPD 4HAEA 2RF4A 3SK6A 4DK6C 3VA7A 5JEAJ 2IWHA 4BY1G 5M5XB 2JP1A 2WINB 4K2LA 5JJLA 5CV8A 4N8X1 2Z1CA 4LF8Q 1MBYA 1SFOH 2F4VL 1LYLA 1CTMA 1I4XA 1SYFA 4A3FG 1EY4A 2NN6I 2Z6KA 1ZYRC 1I4PA 4A3MH 5KNBA 4JV5L 2F0UA 2Q8TA 4R4CA 5FLXL 2VQEL 2MUYA 4DV7L 2N3SA 1BCPB 5K36H 1IBKL 5M3MG 3S17B 5DLQE 4BBRH 5M5YH 1GUTA 4KMUC 1WYDA 4DAPA 1VDZA 2OT2A 4ULLA 4IALA 1BCPC 2AWOA 1NAPA 2ZTCA 5M5XH 5HURA 1YJ9A 4ILWA 1R9TB 1EY7A 1D7QA 1PZID 2L5TA 5CMDA 4OELB 3CCMA 3ULLA 3BYYB 4A3JG 3S16B 1TY2A 1KC8C 5I6WA 2DY7A 2R93B 5EQ0A 2EY5A 3MXPA 3A8IE 1K9MC 1UE5A 1FYCA 4K6LA 1FVIA 1WOCA 1H9MA 1XWEA 3J81j 5FO9B 3OWFA 1LACA 1SAPA 2ZTDA 1B9MA 1BKBA 1LTTD 1EWHA 2VB2X 3KDFB 3HEJA 4LAAA 5IODA 1VQFA 1PHJA 3I72A 2DJGC 1F77A 2EYFA 3ND9A 4GLAC 2NVTB 1N32L 2E75C 4FXKC 1NY4A 1X3EA 1R9TH 2YTYA 3PIPA 1II3A 1SNCA 2QF7A 4POGA 3K59A 3S16H 5D3DA 1CSQA 1TWCB 4DV5L 3I2ZA 1PYBA 3HG9A 5D14A 3DUZA 5JVH3 1STBA 1SE2A 4C3IG 5ELBA 2UUBQ 1U4LA 3GTPB 4IFDG 1N9WA 2PZTA 2OQ0A 3S15B 1UUPA 1X9NA 5M9OA 3H09A 3A55A 4HSVA 2SDFA 2NVTH 3V96A 2K03A 3GTMB 3ITPA 2UXCL 2IY5B 4GN4B 2HCIA 5IGBA 2AHOB 4ABNA 1TY0A 3MZ5A 1TWCH 1XJVA 3M4OB 1X3PA 4H13C 3GV3A 1LO5D 1PZKD 2Q2TA 1H9SB 1LLRD 3T1YL 5IGEA 2K1BA 2GA4B 5TSSA 3CCRA 2K33A 4QIWE 4P73A 1WTHA 4IURA 5C3EG 1K0SA 2L15A 1HA5A 3T1HQ 1KDBA 4X65L 1UE6A 1LTID 4IJLA 3TN2A 3BVMA 2J0TD 2JN4A 1UE1A 4PQXA 3J80L 2PI2E 2WAQE 1XMQL 3GTGB 4Y52H 1SE4A 3OIQA 1PFMA 4LF5L 3GTMH 4JOIA 5FJ8H 4A3GG 3D4RA 4JBJA 2VUMH 2GN5A 1O80A 4DV1L 4JVZA 4IPCA 4X3KA 4JK1C 1ML0D 2F3WA 1B44D 1VQEA 5E4WC 3T51B 2ZJRA 4MTNA 4FP5D 4KKTA 4CHTB 3IRBA 1TS2A 2ZM6L 1K8OA 2F52A 5I2YA 4WRDA 1BBXC 1C9OA 3GO5A 4POFA 1EU4A 2K4KA 2G9DA 3EROA 1ZKOA 1EFWA 1U4RA 3NELA 1SYBA 3PF5A 3EBEA 3PV0A 1B2TA 5CR3A 3CRLC 2EPBA 1PH2A 3RN2A 5EPKA 4UP9A 2WACA 3GTGH 4LJZC 4CKCA 3MTSA 1LT3D 2QEJC 3VDYA 1ENCA 3RNUA 3NSWA 2EYHA 4PZ6A 4MHEA 3KF8A 2O5IC 3Q22A 4RKBA 1E2VA 2HCCA 1MGSA 1PTOF 2K14A 3PMFA 4XT1B 1DZ1A 3HKSA 5EGTA 1WTXA 1S5CD 2NTSA 2FHTA 2NTTA 4HR7B 1T9HA 1EFID 5C3WA 4A3CH 1Z9FA 4F8MA 5C4JH 2ZJQA 1F9QA 1HNXL 1Q1EA 3I4MB 4JOIC 3F1ZA 3I4NG 4A75A 2AQ2B 2I5HA 2MNAA 4V0BA 2A74C 4YWKA 1STHA 3Q24A 4FF4A 5C44B 4GLVB 4IUTA 3N6RA 3G6JB 2OTJA 1NR2A 1VQCA 1RKNA 2OWOA 1PVOA 3LWUA 1QVCA 2HHHL 2PMZE 1IW7D 1TXYA 4YWLA 5LMNQ 1K3BC 3RLFA 1JWMD 4K8JA 2L0CA 2AUKA 3A54A 3A7AB 1VQIA 3K7AB 4DR6Q 5EKKA 4MTKA 1ENAA 2UUAQ 4B9XA 2VW9A 4PZ8A 4O42A 4C1NI 3I4MH 3KYHC 3NBIA 1K83B 2QW7A 4CBVA 3Q0AA 4LF6Q 1K8MA 5C44H 2E5LQ 2ES2A 3AMUA 2EY1A 2WP8J 4DR2L 1Q3LA 1FNUA 4OXPA 2EXDA 2CQOA 3S1NB 3M85A 1FNWA 4M1UB 5JOBA 4LK1C 2KUMA 5JVG3 1HZCA 4S3SA 5I9PA 4DUZL 4NXNL 1YITA 2UXDL 2N78A 3QG1A 2IT1A 1CZWA 3PCOB 4A3GB 1BUVT 4B3RQ 4DA2A 4ZYSA 2BH2A 4Y7NB 5IYBH 5C3XA 4HJ5A 1YZ6A 1JICA 3NBHA 1K83H 1N33Q 4WORA 1AEXA 2YTXA 3DHQA 5EKLA 1XMOL 4L5RC 2Z8LA 4P75A 1S3OA 1F9RA 2E74C 3U58A 1Z7TA 1RTNA 1QUQA 3S1NH 4L5SA 1G91A 4QUCA 4B3ML 1QOHA 2F3VA 3PIP3 1MD2D 3M4QA 3VR5A 3MXNA 3IKJA 1XNRQ 5AJ3L 1BDOA 1VCIA 2XNAC 1SJHD 4A3GH 5JEAG 4Y7NH 1DCZA 1HH2P 4G7OC 4FVMA 1PH7A 2JE6I 2SNSA 2EJGC 1MJEA 1X32A 2EYMA 2AUJD 4X3SA 3UE0A 4OEMB 2L11A 2EOTA 4OX9L 4QCLA 3K57A 1T5EA 1IL2A 1G6PA 5A2QL 5H1SE 4HMJA 4ZKCB 2UXBL 2D5DA 4DV3L 3K7UC 4MIUA 2UUCL 4WJ4A 4DV2L 3ND8A 5J22A 4FNFA 4HJ9A 1VQPA 1QUQB 4JI8L 1F9SA 1WFQA 4ODGA 1FJGL 1H95A 5BR8Q 3QWNA 2E2JB 2Q2IA 4K5VA 4NW2A 1PMRA 2Z6BA 1IYVA 3L7ZC 3MXNB 2HQLA 2B2VA 2LSSA 3U4VA 4A3KB 1PRTB 1QG7A 1TWGB 4DN4M 1JOKA 4J8QA 3C46A 2O2LD 2RKSA 2PZWA 1DGSA 3SHLA 3GTOB 1E24A 3CKIB 4I65A 1STGA 1IBLQ 2WB1G 4JI7Q 1RF2D 2QEXA 3GTLB 4BBSB 3T13A 1VQMA 1I6HB 3OOCA 1IKLA 4YHHL 5HGQA 2EYOA 1EIGA 1ZYRD 2WKCA 4DR1L 5CV4A 1ESFA 1LV9A 1A8VA 2MPMA 3HZXA 3VR6A 1RTOA 3EA6A 1XXGA 2E2JH 4CDDC 4R4QA 3D4WA 3HOXG 2XGTA 1UWVA 1KDAA 4K2KA 4A3KH 4A3MG 1TWGH 1B70B 1SYDA 2KCNA 4KJOA 3GTOH 2KCTA 4GKJL 2B2WA 2IX1A 1X6OA 1Q1BA 2BH8A 1P8LA 1VQ5A 4JYAL 1V9PA 2B2TC 1OTCA 2EY2A 4BBRG 3GTLH 1TKWB 4BBSH 1S5BD 1EL0A 1E1TA 3LX0A 4H44C 1I6HH 4RKLA 2KCCA 4KKSA 1I50H 1DOLA 2RCNA 2B2VC 2K5HA 1CKMA 2M9VA 1RL2A 1SNPA 2F0FA 1EU3A 3VR2A 1G291 1KNAA 1JQYD 2PQAA 3Q23A 4PNYA 3N52A 4H7BA 4WJWA 2C5CA 4XQNA 1N34Q 1D8LA 4AQYL 1D5MC 1E7ZA 4FYDA 1HRJA 2VL6A 1DXMA 4PV1C 3VR4A 4CDFC 1XYIA 3CD6A 2RVLA 2Y0SB 3VYUA 2K75A 4H02A 4IOCA 1RHPA 4LF7Q 1KNEA 2F0NA 1U4PA 1NMGA 2C9OA 3A56A 5HGTA 3EFXD 1LTLA 3GP7A 3I70A 2B2UC 3K5OA 4N9TA 3UE1A 1Q46A 1TVXA 3H0GB 1HR0W 3S9WA 3OTOQ 3FMCA 4JI0Q 1A63A 4HIOA 4YCUA 4DV4Q 2B2WC 3BVGA 5KNCA 3CC4A 1L0YB 1HZ9A 2K5NA 4K6DA 1O7IA 4P72A 1HHVA 4OO1I 5C0XH 2R93G 1WTPA 5C4ZA 3S24A 1CUKA 1K8GA 2F0MA 2NUCA 2PQAB 2JEAI 4EQNA 1JCKB 3FPPA 3FHWA 4HTHA 3DEPA 1NBWA 1HNZL 4N9PA 1B9NA 4LMQD 4B9WA 3UDFA 1I4GA 4MZ9A 4TRDA 5C5MA 4DV6Q 5CYUA 3H0GH 4RA8A 1S72A 4KJNA 3ONAB 1UAPA 1BXTA 1MSGA 4B3TL 4R8IA 3DM1A 5GADC 1TWAH 3RN5A 1EY8A 4YCVA 4HJ8A 2EY6A 4OWTB 1KLUD 3R3OA 1WJJA 2V1CC 3HOYB 3U4ZA 4A3LH 3OIPA 2Q8IB 3UDGA 1JJGA 5CV6A 4ZK9B 3TEHB 1M4VA 1V43A 3HOXB 2OEOA 3DLLA 1SRUA 3F2DA 1BQQT 1KAAA 3PUVA 5A35A 1CKNA 1Z6HA 3K6OA 3MXUA 4Q5VA 1O78A 2K28A 4O1NA 1PYWD 2MJ8A 2IW3A 2CH4A 4WFN3 2Z9HA 3I56A 1NJIC 3MEFA 1KTKA 2RHSB 3V05A 5C0XJ 4LUOA 2ZXRA 4NDXA 5GROA 1V8QA 4APVA 3MFGA 2F0TA 1N8RC 3PO3B 2ZTEA 4JI1L 4XXEA 1XNQQ 3P75A 3HOWG 2KECA 4I7AA 5I4DA 3HOYH 4K5XA 2PPBC 4RWSC 3PUYA 3EVQA 2WB1E 1CKOA 3VR3A 2JA8G 3HOXH 1IBKQ 4RG1A 4O2DA 1Q7YC 1HFNA 3J7ZC 4PMWA 2L55A 4ZKBB 2KHSA 1JE4A 1N36L 1HCZA 2EJMA 3W5OA 3C3LA 2JA6B 4U673 2XSCA 3EJIA 2F0SA 2K7VA 1V1PA 1SR3A 1Z47A 1HA6A 4LFBQ 3WOEA 1L1OB 1F9PA 4HIDA 3A5ZB 1CKNB 5JPMC 1OXVA 5D65A 2PYKA 3MWYW 1JB3A 3KOJA 5FO7B 3TZUA 1L1OC 3K58A 3E0JA 3KUPA 3PSIA 1GUGA 4L63B 1Y1WG 2I0QA 4ALPA 1SNMA 3AB9A 3CP0A 5IGDA 2F0VA 4LF8L 4KY6A 4KKUA 4A3CG 1YHBA 2I46A 2L9HA 1E3PA 2B39A 1O7YA 3TSSA 2QA4A 3I73A 2VXWA 4QB4A 3S1RB 1TIID 5IWAQ 1CA5A 2C35B 3S17H 1IYJB 2PI2A 3CHBD 1CA6A 1KRTA 2AQ1B 3TRZA 1V1PB 4JG2A 4X3TA 2Z6KC 3TP8A 4HIKA 3CF5A 1VQKA 1LT6D 4X64Q 5FKAC 3WDNA 4IFDI 3HOZB 3I4MG 4KY5A 2R93H 1C4QA 1PYSB 2PNHA 2CCZA 5C44G 5KNDA 3J7AF 3PF4A 4P2CB 4JC0A 1K8AC 3S1RH 4UHVA 1DOKA 4GS3A 5ELDA 4Z9CB 3EN2A 4KN7C 5IT9c 4IO9A 3CCQA 1QVGA 2E2HB 3J81c 3BU2A 3X3NA 2WFWA 2FJ2A 3KK7A 1XTDA 2XVSA 2H5XA 4YWMA 4JI6Q 1DM0B 1RODA 3DM3A 1CHQD 2YYZA 1LT4D 4YY3Q 5IYBG 1SSOA 4KK7A 2O4XA 5E4XA 3HOZH 2Q8RE 3T56B 4P74A 3HOWB 3C1EA 1X3GA 4GNXA 4IUQA 2QDBA 4R4IA 4X66Q 2YU9B 4B3SQ 1G2SA 4OIJA 2JA8B 4FXGC 3BDOA 2UUBL 4OONA 3GTPH 4K5WA 4NXMQ 4LF5Q 3DWQA 2I5MX 3H3VC 1EIFA 1I94L 1J5EQ 1E2ZA 3S15H 3I4OA 4JBKA 1KRSA 2E2HH 3HOVG 5IP7H 5K5PA 5CV7A 4LW1A 2KEDA 2KCMA 1J6QA 1QE6A 4KHPQ 4DAYA 3I8ZA 1IXRA 2F0JA 1AFPA 1V1OA 3GQBA 3L2PA 1NMFA 2NWGA 4EQPA 4DXGA 5BN3A 3P20A 1Y1WB 3CPWA 1BBUA 4FF3A 1JOQA 1F2LA 5CBAE 3HOWH 3M4OH 3H3VH 1R4PB 1KXLA 4EQ5A 3I55A 4K14A 2YU9H 2NVYB 3QJYA 2JA8H 4K8IA 2B29A 4MN3A 3F2UA 4ZUIA 1A3TA 1ET9A 4HIMA 5IYDG 3KLRA 3T1HL 2RDGA 4C3HB 1GHJA 4DKAC 4GNXB 4DR3Q 4IN3A 1HZBA 3VA5A 3ERQA 3CCLA 3MHBA 3PUXA 2R61A 3D6CA 3STBC 1X56A 5J1ZA 4GNXC 3FKIB 5I2XA 3J7YW 2NZOA 5GQOA 1MIUA 4QJFA 5EPLA 1U0LA 1PRTD 1Y1WH 4RCOA 3TS0A 1BNZA 5LMNW 1OXXK 1JMCA 3IL8A 2UU9Q 1H9RA 4HCSA 1ONLA 2JSOA 1HQMC 1F2ZA 2NVYH 2PCFB 3HFZB 1SNOA 2ZXOA 5DNFA 1BBWA 1HNWQ 3HRZC 3MXGA 1PFNA 4GN5A 2VQFQ 1OO9B 1D1IA 2BE5C 4C3HH 2KJXA 2CH4W 3SVMA 2F03A 2A68D 2CHBD 2MGSA 3NK9A 4A3IB 3FKIH 1X3QA 4DFAA 4X62Q 4PG3A 4A93B 3QB3A 1Q8KA 1FGBD 3TBIB 2NZHA 2K05A 2L1BA 4A3KG 4AYBB 3UI2A 1LTRD 4LNQA 3JAME 2K04A 3O13A 4IPDA 2I07B 4DR2Q 4LFAQ 1LUZA 3KF8B 3BDLA 4XTCS 1CFMA 4BBSG 4JI4Q 3PGZA 2RBMA 1QCBD 3RLOA 1DONA 4ME5A 1VQ7A 2DNCA 3MAQA 1XPRA 1Y8PB 1W6KA 5IP9H 1JC7A 3MC0B 3QOJA 4LF9Q 2QGQA 1EUJA 1TS4A 4A3IH 1K28A 3NUCA 1CK1A 4NMZA 3EIVA 2NYZD 3DXJC 5LMNL 4A93H 3HOVB 3ERSX 1ZEQX 2IJ0A 2EZVA 2TSSA 3QOLA 1ZXTA 3OMCA 3K7AH 4DR6L 2UUAL 2H1EA 5IOCA 4K0KQ 1I4QA 1PDQA 1QNUA 1HZAA 3H6MA 4DAVA 1VS0A 3GD7A 1H9JA 4TVAB 3FEWX 4LF6L 4DK1A 3L0OA 3F2CA 2E5LL 2VY3A 3TP5A 2B8GA 5DM73 4G4KA 4NP5A 1NNXA 2K52A 4DR4Q 3J81i 1PV4A 5JAVA 4IUPA 1L0WA 5C4HA 3HOVH 3VYRA 1ESRA 5C0XG 1BCPF 1LTAD 2F0IA 5IT9E 2OF1A 3K5MA 1WTRA 2XRQD 1L2FA 4G7ZC 3A7LA 5IGGA 3URYA 2EYJA 4B3RL 4UP7A 3NTHA 2K5DA 3D0FA 3J81E 4LUZA 2Y0SG 4FF2A 4KV6A 5FLMG 5I9OA 4DNIA 1JWSD 2KBNA 1N33L 4XYOA 2K6AA 2KHJA 4A76A 3H0GG 3TMEA 5JJZA 3P1HA 3U50C 2PQEA 3A74A 2HUGA 4DR7Q 4L5TA 2HD3A 1SBBB 5IYDH 3NBHB 3KFUA 1UEBA 2HDMA 1EY0A 3NWSA 3OMGA 2DJFC 4RGMA 2KA7A 3FDTA 2RDHA 4GN3B 1YNNC 1EYAA 4WJ3M 1B53A 1XX8A 5CV5A 4A3LG 1S5DD 4C56C 1X3FA 2EDGA 1KIXA 1TQOA 4UDUC 4KD3A 1QVFA 3QO2A 4J15A 4EGVA 1YJNA 3U9OA 4BS9A 1U4MA 2XTIA 1TT2A 3DWPA 1W2BA 4LFCQ 1HUMA 4R1JA 4RMFA 2J4XA 1H9KA 3GTQB 2NVQB 3K0XA 1PRTC 4GKKQ
chains in the Genus database with same CATH topology
5KYLA 3SE0A 3NQTA 2IX3A 5COYA 3CRKC 1OXSC 3ZYYX 4QF4A 4KHVA 1SYCA 1D2BA 2ZXPA 3BZDB 1BO0A 3E5SA 1CQFA 1SMYD 2A68C 3H91A 2K5QA 2QCPX 4NKLA 2QKIC 1EYDA 1SNQA 5LL6S 1Q90A 2ZT9C 4FXDA 4J1MA 3C2PA 1Q12A 1GXDC 1HTPA 3M3YB 3PO2B 1EQTA 2XIWA 2DY8A 2B2YA 3FVQA 1EYCA 1LABA 3NWTA 2VNUD 3PUZA 1D6EC 2A6EC 3E6ZX 2R92B 2PW5A 4CGYB 1NR4A 1EZ8A 2X69A 1EWCA 1F2MA 2JXMB 3I91A 2M00A 1HQRD 2JEBI 2N88A 1VMCA 3A8JE 4HSPA 2XWJB 4RCNA 2O5JC 5C4XB 2F4IA 2M2LA 3D3RA 2E2IB 2Z4IA 5CORA 1PXUA 4C2MB 3VYSA 4FF1A 4L6TB 3W2DA 1AP0A 2KOLA 3HKZB 2G9HD 3MA2B 5CGKA 2LY7A 2BDNA 1FD7D 4A3BB 1PTOB 1U9RA 2EJFC 5G3LD 5EPJA 1EQVA 1PTOC 2HQEA 3SR1A 2JA7B 1LTGD 4XQJA 2F0PA 1IHZA 1O7LA 1PFBA 3J80E 1EZ6A 1STAA 2N55A 1TWFB 3M7NA 4C3JB 4TSSA 3R2IA 1YNJC 1RJTA 1PTOH 2L12A 4G57A 5KRUA 4KI0A 3T16A 2MP1A 1SYGA 1DYQA 5IT9L 2SOBA 3SK8A 1T5XD 3J81L 3KLSA 1A6XA 4HCEA 4F87A 1SFOB 5KEEA 2HDLA 4DNTB 2F0LA 1PLFA 3SK5A 2PNRC 1QWYA 2FMMA 1MSHA 3NQIA 3QIAA 3RZOB 3TP7A 1AW7A 2X6LA 3HGBA 2R3ZA 4XDXA 2L4NA 2KVMA 5M5YB 2IPKD 3RD4A 2TMPA 4I7ZC 4A3DB 1B1ZA 1G8ZD 1CQVA 1SXTA 4CKEA 1SMYC 1ENFA 5JPNC 1JR0D 4IUVA 5ELCA 5FO8B 1Y69U 2BE5D 2CVRA 2BDOA 1PZJD 2V4DA 1I4HA 2NN6G 2BCOA 1HXYD 3WOFA 4E6IA 3IFTA 4RGOS 4C3HG 4GZYC 1I4RA 1GUOA 1SYEA 1AZPA 5C6AA 1WCMB 2F0QA 3NHHA 3I90A 2B63B 1LTSD 2CW0C 5ELFA 4CJ0B 1EY6A 4A3EB 3GV6A 4RGTA 3OW7A 4CJ2C 1Y8OB 5EJWA 3T53B 1RD9D 1TR5A 2VB3X 5T1IA 1JOOA 4OL7A 3RUZA 2LFNA 5NUCA 2EYLA 4F7XA 5EBCA 1PRTF 4QIWB 4PMCA 1J8IA 1H9SA 1TU2B 4R9WA 2EYPA 1B50A 2WAQB 4RFBA 2D9UA 4PMBA 1CI3M 2FINB 1ILPA 1D5XC 1HUNA 5CC4A 4OO1H 4BY7B 2J7ZA 5KIXA 1RDPD 4QMGA 1WTVA 1DOMA 3M4YA 2X6GA 3U9SA 2VUMB 1IYUA 4EVOA 4HMIA 1MI2A 5A2QE 4BY1B 3D4DA 5AFWA 2FFKB 4ZAIA 4KY7A 2BA0A 2KEEA 2NBFA 1ILQA 4A3FB 5LHY1 1OXTA 1O7ZA 4G7HC 3IFDA 4BWGB 4IZ8A 1QJOA 1WD1A 5M3MB 3A8KE 1YNND 2E76C 4R8NA 2WKDA 5J39A 3G7LA 3S2DB 5FK9C 2H4OA 2A6HC 1AN8A 2JYOA 2D2CC 3BG3A 4DXFA 1DD2A 2Z4HA 4CJ1B 1D1KA 1A3VA 5LL6X 3K0YA 4RHSA 3KLSX 1SEBD 1JWUD 3TZDA 1JORA 2PMZB 1AZQA 4ZLTF 2A5HA 1R4QB 1E2WA 5C4JB 4A3JB 3HP3A 2F0DA 4XT3B 3S1MB 5D3IB 2NZ1D 1CZGA 1DJRD 4HN7A 3NPPA 4YIJA 2XRSD 2NN6H 1TWHB 2F1MA 1LT5D 4UAIA 3D6WA 1W6JA 4IUNA 2A73B 3DMUA 2ID0A 1GUSA 4CKBA 2R7ZB 1NSNS 5IGCA 5F2DA 3RMHA 1GUNA 1A3UA 3PIO3 4C1NK 4HEDA 5IIFA 1IKMA 4C3IB 1VF7A 4B08A 3NP8A 4ZUJA 4BA1I 2OXPA 4TKOB 2A6ED 5KGUA 3M7GA 1EEID 5BN5A 1NUCA 1QB5D 3DEOA 3L9AX 3K5LA 3C1FA 1EY9A 2JA5B 2K32A 1S4ZA 3OHXC 4M8AA 3EQLC 1EOTA 4U68A 5CBEE 2B8FA 5CV9A 1BOSA 1QILA 4J6HA 4IFDH 2AWNA 1ICWA 5C3EB 4DF7A 5C5LA 2FMCA 3IAYA 1B3AA 2BA1A 5C0XI 2XN9C 5DM63 3S2HB 4H0LC 3CU7A 2F0HA 4IQZA 1Y1VB 4TQUS 1PTOD 3T4AC 1KLGD 5EKIA 1SE3A 5M5WB 1CM9A 2PZUA 4RAUC 4RGNA 2A69D 3KBGA 1G6ZA 3MEHA 2DN8A 3BDCA 3MFYA 3CQZB 1NCVA 1HPCA 2NVXB 1SDFA 4XIGS 1YNJD 1WTQA 1IL8A 4ZRZA 2RSOA 1XTCD 1ET6A 1WVLA 3RZDB 4IFDJ 3I4LA 2WV6D 2NB0A 3NE5B 5T1GA 3I4NB 3LWEA 1SJED 3P7JA 3OSOA 3NXWA 5M3FB 2SNMA 4IUUA 3LNNA 3L3OC 1LTBD 3SXHA 2B2TA 2BOSA 5FLXE 1UEAB 3S14B 1GOZA 2ICIA 2RSNA 2F0WA 2EE1A 1TS3A 3Q6SA 1QNKA 4V190 4C3JG 1HFGA 1S5FD 3D8GA 5G3LF 3V2TA 1BR9A 4EQOA 3BYTB 4ID6A 3I3CA 1I50B 2F0GA 4RHRA 1D5ZC 2R6GA 3SEBA 1STYA 3DWAA 4F88A 2SEBD 4QUFA 2RA4A 2XWBB 3SK4A 2F0KA 2CQAA 4OIKA 2B2UA 3FPUB 1S5ED 1C48A 3BS1A 1EY5A 3TP6A 1IW7C 2E2DC 3BVZA 5FOBB 1BCPD 1C8CA 5K36G 3HOUB 4ZQ3A 3HS0C 2AQ3B 5I6YA 1E0BA 3NTKA 1GJXA 3K5NA 4DGZA 3NTIA 3S1QB 1A15A 5ISRA 2CW0D 1GHKA 2F0EA 1EIHA 1RCVD 1VMPA 3GTKB 3OWEB 1I3QB 3PUWA 1G2TA 1STEA 3JAML 4XYQA 1FR3A 2LMCB 1Y8NB 1J9OA 3X3MA 4OHJA 2PO4A 2F0OA 1WTOA 4RH6A 5E1FA 4JBWA 4KN4C 3W3AA 1CT1D 3TDQA 1BF4A 1STNA 4X3UA 3FRPB 1A2TA 1L0XB 1TS5A 5ELEA 1TWAB 1WD0A 2B2YC 1GUWA 2ICEC 1M8AA 2KQ3A 1KABA 2EVBA 3GTJB 3KBXA 1HTLD 2WIIB 5BN4A 3H94A 2LKVA 2K01A 5JEAH 4FO2A 2A69C 4BA2I 2RDFA 4OO1G 1OXUA 4OGQC 4KHZA 5DEHA 2DNEA 3AU7A 1A2UA 2MHVA 5KYIA 1F2YA 4KTAA 2WB1B 2RQXA 4KD4A 2D62A 1UNSA 4DNRB 2IX0A 5IGFA 1SNDA 2EXZA 3OPOA 4DK0A 3R8BA 2LS01 3MVVA 3D31A 5DAUA 2ENBA 4L8JA 1B4OA 1KDCA 4DU9A 3J7AV 2K5WA 2IL8A 1EEFD 2QILA 1VF5C 2PW7A 3SDZA 3R2TA 4Q0FA 4A3MB 2A6HD 5EBDA 3R93A 1Q8IA 3VYTA 1I6VC 4XQQA 1FNVA 5E3FA 4BBRB 1WTWA 1CHPD 4HAEA 3SK6A 3VA7A 5JEAJ 2IWHA 5M5XB 2JP1A 2WINB 4K2LA 5CV8A 2Z1CA 1MBYA 1CTMA 1I4XA 1SYFA 1EY4A 2NN6I 1ZYRC 1I4PA 5KNBA 2F0UA 2Q8TA 5FLXL 2MUYA 1BCPB 5K36H 3S17B 1GUTA 4KMUC 4DAPA 4ULLA 1VDZA 2OT2A 4IALA 1BCPC 2AWOA 1NAPA 5HURA 4ILWA 1R9TB 1EY7A 1PZID 2L5TA 5CMDA 3BYYB 3S16B 1TY2A 5I6WA 2DY7A 2R93B 5EQ0A 2EY5A 3MXPA 3A8IE 1FYCA 4K6LA 1H9MA 1XWEA 5FO9B 3OWFA 1LACA 1SAPA 1B9MA 1LTTD 1EWHA 2VB2X 3HEJA 4LAAA 5IODA 3I72A 1F77A 2EYFA 3ND9A 2NVTB 2E75C 4FXKC 1II3A 1SNCA 2QF7A 3K59A 5D3DA 1TWCB 3HG9A 5D14A 3DUZA 5JVH3 1STBA 1SE2A 4C3IG 5ELBA 3GTPB 1U4LA 4IFDG 2PZTA 3S15B 1UUPA 5M9OA 3H09A 3A55A 4HSVA 2SDFA 3V96A 2K03A 3GTMB 3ITPA 2HCIA 5IGBA 4ABNA 1TY0A 3MZ5A 3M4OB 1X3PA 4H13C 3GV3A 1LO5D 1PZKD 1H9SB 1LLRD 5IGEA 2K1BA 2GA4B 5TSSA 2K33A 4IURA 1HA5A 1KDBA 1LTID 3TN2A 3BVMA 2J0TD 4PQXA 3J80L 3GTGB 1SE4A 3OIQA 1PFMA 3D4RA 1O80A 4X3KA 4JK1C 1ML0D 2F3WA 1B44D 5E4WC 3T51B 4FP5D 4KKTA 4CHTB 1TS2A 1K8OA 5I2YA 4WRDA 1BBXC 3GO5A 1EU4A 2G9DA 3EROA 1ZKOA 1U4RA 1SYBA 3PV0A 1B2TA 5CR3A 3CRLC 2EPBA 5EPKA 2WACA 4LJZC 4CKCA 3MTSA 1LT3D 2QEJC 1PRTC 1ENCA 3NSWA 2EYHA 4MHEA 3KF8A 2O5IC 3Q22A 4RKBA 1E2VA 2HCCA 1MGSA 1PTOF 3PMFA 4XT1B 1DZ1A 5EGTA 1WTXA 1S5CD 2NTSA 2FHTA 2NTTA 4HR7B 5C3WA 1EFID 4F8MA 1F9QA 1Q1EA 3I4MB 2AQ2B 4V0BA 2A74C 3Q24A 1STHA 4FF4A 5C44B 4IUTA 3N6RA 3G6JB 1NR2A 1RKNA 3LWUA 1IW7D 3RLFA 1JWMD 4K8JA 2L0CA 2AUKA 3A54A 3A7AB 3K7AB 5EKKA 1ENAA 4B9XA 4O42A 4C1NI 3NBIA 1K83B 4CBVA 3Q0AA 1K8MA 3AMUA 2EY1A 2WP8J 1Q3LA 1FNUA 3S1NB 3M85A 1FNWA 4M1UB 5JOBA 4LK1C 2KUMA 5JVG3 4S3SA 5I9PA 3QG1A 2IT1A 1CZWA 4A3GB 1BUVT 4DA2A 4ZYSA 4Y7NB 5C3XA 1JICA 3NBHA 4WORA 1AEXA 3DHQA 5EKLA 2Z8LA 1F9RA 2E74C 1Z7TA 1RTNA 1G91A 4QUCA 1QOHA 2F3VA 3PIP3 1MD2D 3VR5A 3MXNA 3IKJA 1BDOA 1VCIA 2XNAC 1SJHD 5JEAG 1DCZA 4G7OC 4FVMA 2JE6I 2SNSA 2EJGC 1X32A 2EYMA 2AUJD 4X3SA 2L11A 2EOTA 4QCLA 3K57A 1T5EA 5A2QL 4HMJA 4ZKCB 2D5DA 4MIUA 3ND8A 5J22A 4FNFA 1F9SA 4ODGA 3QWNA 2E2JB 4K5VA 4NW2A 1PMRA 1IYVA 3L7ZC 2B2VA 4A3KB 1PRTB 1QG7A 1TWGB 4DN4M 1JOKA 4J8QA 3C46A 2O2LD 2RKSA 2PZWA 3SHLA 3GTOB 3CKIB 4I65A 1STGA 1RF2D 3GTLB 4BBSB 3T13A 1I6HB 3OOCA 1IKLA 2EYOA 1EIGA 1ZYRD 2WKCA 5CV4A 1ESFA 1LV9A 2MPMA 3HZXA 3VR6A 1RTOA 3EA6A 1XXGA 3D4WA 1KDAA 4K2KA 1SYDA 2KCNA 4KJOA 2B2WA 2IX1A 1Q1BA 2B2TC 2EY2A 1TKWB 1S5BD 1EL0A 3LX0A 4H44C 4RKLA 2KCCA 4KKSA 1DOLA 2B2VC 2M9VA 1SNPA 2F0FA 1EU3A 3VR2A 1G291 1KNAA 1JQYD 3Q23A 4PNYA 3N52A 4H7BA 4WJWA 2C5CA 4XQNA 1D5MC 4FYDA 1HRJA 1DXMA 4PV1C 3VR4A 1XYIA 2RVLA 2Y0SB 3VYUA 1RHPA 1KNEA 2F0NA 1U4PA 2C9OA 3A56A 5HGTA 3EFXD 3GP7A 3I70A 2B2UC 3K5OA 4N9TA 1TVXA 3H0GB 3S9WA 3FMCA 2B2WC 3BVGA 5KNCA 1L0YB 4K6DA 1HHVA 4OO1I 5C0XH 1WTPA 5C4ZA 2F0MA 2NUCA 2JEAI 4EQNA 1JCKB 3FPPA 4HTHA 3DEPA 4N9PA 1B9NA 4LMQD 4B9WA 1I4GA 4TRDA 5C5MA 5CYUA 4RA8A 4KJNA 3ONAB 1UAPA 1BXTA 1MSGA 4R8IA 3DM1A 1EY8A 2EY6A 1KLUD 3R3OA 3HOYB 3OIPA 2Q8IB 5CV6A 4ZK9B 1M4VA 1V43A 3HOXB 2OEOA 1BQQT 1KAAA 3PUVA 5A35A 1Z6HA 3K6OA 3MXUA 4Q5VA 1O78A 2K28A 4O1NA 1PYWD 2MJ8A 2IW3A 4WFN3 1KTKA 3V05A 5C0XJ 2ZXRA 4NDXA 1V8QA 3MFGA 2F0TA 3PO3B 4XXEA 3P75A 2KECA 5I4DA 4K5XA 2PPBC 4RWSC 3PUYA 3EVQA 3VR3A 1HFNA 4PMWA 2L55A 4ZKBB 2KHSA 1JE4A 1HCZA 2EJMA 3C3LA 2JA6B 4U673 2XSCA 3EJIA 2F0SA 2K7VA 1V1PA 1Z47A 1HA6A 3WOEA 1F9PA 5JPMC 1OXVA 5D65A 2PYKA 3MWYW 1JB3A 5FO7B 3TZUA 3K58A 3E0JA 3KUPA 1GUGA 4L63B 1SNMA 3AB9A 5IGDA 2F0VA 4KY6A 4KKUA 2I46A 2L9HA 2B39A 1O7YA 3TSSA 3I73A 2VXWA 4QB4A 3S1RB 1TIID 1CA5A 3CHBD 1CA6A 2AQ1B 1V1PB 4X3TA 3TP8A 1LT6D 5FKAC 3WDNA 4IFDI 3HOZB 4KY5A 1C4QA 5KNDA 3J7AF 4P2CB 1DOKA 5ELDA 4Z9CB 4KN7C 2E2HB 2FJ2A 3KK7A 2XVSA 1DM0B 1RODA 1CHQD 2YYZA 1LT4D 1SSOA 4KK7A 2O4XA 5E4XA 2Q8RE 3T56B 3HOWB 3C1EA 4IUQA 2QDBA 2YU9B 1G2SA 4OIJA 2JA8B 4FXGC 3BDOA 4K5WA 3DWQA 3H3VC 1E2ZA 5K5PA 5CV7A 2KEDA 1QE6A 4DAYA 3I8ZA 2F0JA 1AFPA 1V1OA 3GQBA 2NWGA 4EQPA 4DXGA 5BN3A 3P20A 1Y1WB 4FF3A 1JOQA 1F2LA 5CBAE 1R4PB 4K14A 2NVYB 3QJYA 4K8IA 4MN3A 3F2UA 4ZUIA 1A3TA 1ET9A 3KLRA 2RDGA 4C3HB 1GHJA 4IN3A 3VA5A 3ERQA 3MHBA 3PUXA 2R61A 3D6CA 5J1ZA 3FKIB 5I2XA 3J7YW 5EPLA 1PRTD 4RCOA 1BNZA 1OXXK 3IL8A 1H9RA 4HCSA 1ONLA 2JSOA 1HQMC 1F2ZA 2PCFB 1SNOA 2ZXOA 5DNFA 3HRZC 3MXGA 1PFNA 1OO9B 1D1IA 2BE5C 2KJXA 3SVMA 2F03A 2A68D 2CHBD 2MGSA 3NK9A 4A3IB 1X3QA 4DFAA 4A93B 3QB3A 1FGBD 3TBIB 2K05A 2L1BA 4AYBB 3UI2A 1LTRD 3JAME 2K04A 3O13A 2I07B 3BDLA 4XTCS 1CFMA 2RBMA 1QCBD 1DONA 4ME5A 2DNCA 3MAQA 1Y8PB 1W6KA 1JC7A 3MC0B 3QOJA 1TS4A 3NUCA 1CK1A 4NMZA 2NYZD 3DXJC 3HOVB 1ZEQX 2IJ0A 2EZVA 2TSSA 3QOLA 1ZXTA 3OMCA 2H1EA 5IOCA 1I4QA 1PDQA 1QNUA 3H6MA 4DAVA 3GD7A 1H9JA 3FEWX 4DK1A 3TP5A 2B8GA 5DM73 4G4KA 4NP5A 5JAVA 4IUPA 5C4HA 3VYRA 1ESRA 5C0XG 1BCPF 1LTAD 2F0IA 5IT9E 2OF1A 3K5MA 1WTRA 2XRQD 4G7ZC 3A7LA 5IGGA 3URYA 2EYJA 2K5DA 3NTHA 3J81E 4FF2A 4KV6A 5I9OA 1JWSD 4XYOA 2K6AA 3TMEA 5JJZA 3P1HA 2PQEA 2HUGA 1SBBB 2HDMA 1EY0A 3NWSA 3OMGA 4RGMA 2KA7A 3FDTA 2RDHA 1YNNC 1EYAA 1B53A 5CV5A 1XX8A 1S5DD 4C56C 2EDGA 1TQOA 4UDUC 4KD3A 3QO2A 4EGVA 3U9OA 4BS9A 1U4MA 1TT2A 3DWPA 1HUMA 2J4XA 1H9KA 3GTQB 2NVQB 3X3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYD A;  5KYL A;  5IIF A;  4KJO A;  2EYH A;  3NQT A;  4K14 A;  3R3O A;  4RKB A;  5E3F A;  1U9R A;  3QOL A;  3PMF A;  1STB A;  3OMC A;  4EVO A;  3NP8 A;  4HMI A;  4K8I A;  5EGT A;  4ZUJ A;  4ZUI A;  1A3T A;  2EY2 A;  2F3V A;  5CV6 A;  3SK6 A;  2F0O A;  3TP8 A;  5IOC A;  1EQV A;  2HQE A;  2OXP A;  5C3W A;  3D4D A;  3SR1 A;  2PZT A;  3H6M A;  4QF4 A;  2OEO A;  3LX0 A;  4KHV A;  1SYC A;  4KY7 A;  4RKL A;  5KGU A;  4E6I A;  4F8M A;  1NUC A;  4K2L A;  3ERQ A;  3VA5 A;  5M9O A;  1KAA A;  3MHB A;  5CV8 A;  3OSO A;  2F0P A;  3D6C A;  5E1F A;  3NXW A;  3E5S A;  1IHZ A;  3C1F A;  1EY9 A;  1SNP A;  2SNM A;  5J1Z A;  1SYF A;  1EZ6 A;  2F0F A;  1EY4 A;  1STH A;  2SNS A;  3TP5 A;  1STN A;  3SXH A;  1SYE A;  4KY5 A;  4NKL A;  3ITP A;  5C6A A;  2F0Q A;  1STA A;  3NHH A;  1EYD A;  4IZ8 A;  4NP5 A;  4PNY A;  1SNQ A;  4H7B A;  1A2T A;  1RKN A;  2F0U A;  5IGB A;  2F0W A;  4J1M A;  2EYM A;  5IOD A;  4NDX A;  3MZ5 A;  4R8N A;  5CV9 A;  5JAV A;  2KQ3 A;  5J39 A;  5C4H A;  1KAB A;  2F0T A;  5KYI A;  1F2Z A;  1EY6 A;  4G57 A;  4J6H A;  1SNO A;  2F0I A;  3P75 A;  2OF1 A;  3D8G A;  4DF7 A;  4HMJ A;  5C5L A;  4K8J A;  5KRU A;  5IGG A;  4K5X A;  3V2T A;  2EYJ A;  2LKV A;  5IGE A;  4MIU A;  3T16 A;  3EVQ A;  1A3V A;  4EQO A;  2F0N A;  5EKK A;  4IAL A;  1SYG A;  1ENA A;  5J22 A;  1TR5 A;  2SOB A;  1KDB A;  1EYC A;  4KV6 A;  1JOO A;  4B9X A;  5HGT A;  1JOR A;  5I9O A;  5HUR A;  4ID6 A;  4OL7 A;  4N9T A;  3RUZ A;  3SK8 A;  1EY7 A;  4ODG A;  2F0G A;  5NUC A;  2RDF A;  3S9W A;  2KHS A;  2PW5 A;  2EYL A;  2F0D A;  1EZ8 A;  1STY A;  4K5V A;  3NK9 A;  5DEH A;  5KEE A;  2O4X A;  3TME A;  3EJI A;  2F0S A;  3P1H A;  1F2M A;  4DFA A;  1A2U A;  2PQE A;  5I6W A;  2EY1 A;  2F0L A;  2F0H A;  3SK4 A;  1F2Y A;  2F0K A;  1JOK A;  2EY5 A;  3C1E A;  3MXP A;  2RKS A;  2M00 A;  2PZW A;  3QB3 A;  4KTA A;  2QDB A;  4YIJ A;  4K6D A;  3SHL A;  4F7X A;  4PMC A;  2F3W A;  4KD4 A;  4I65 A;  1EY0 A;  2PYK A;  2EYP A;  3OMG A;  1STG A;  5JOB A;  5C4Z A;  4K5W A;  3SK5 A;  3TP7 A;  1EY5 A;  3TP6 A;  4S3S A;  5I9P A;  5IGF A;  1SND A;  1EYA A;  2EXZ A;  1SNM A;  2F0M A;  2NUC A;  3OWF A;  3T13 A;  4WRD A;  4HTH A;  4EQN A;  5CV5 A;  4IUN A;  3BDL A;  5IGD A;  4N9P A;  2F0V A;  2PZU A;  3DMU A;  5CV7 A;  3HEJ A;  4LAA A;  4B9W A;  4KY6 A;  4PMB A;  3ERO A;  4ZQ3 A;  2RBM A;  2EYO A;  3MVV A;  5I6Y A;  1TQO A;  2ENB A;  4TRD A;  1SYB A;  5DAU A;  3MEH A;  1KDC A;  2EYF A;  4ME5 A;  3BDC A;  4KD3 A;  4DGZ A;  4DU9 A;  5C5M A;  5CV4 A;  2F0J A;  1NSN S;  5CC4 A;  5CR3 A;  5C3X A;  3HZX A;  5IGC A;  3U9O A;  5F2D A;  5KIX A;  3QOJ A;  4KJN A;  2PW7 A;  4QMG A;  5ISR A;  1TT2 A;  1II3 A;  1A3U A;  3D4W A;  4EQP A;  5K5P A;  2WAC A;  1SNC A;  3NUC A;  4WOR A;  4NMZ A;  4QB4 A;  1AEX A;  3DHQ A;  5EKL A;  1KDA A;  2F0E A;  4K2K A;  5CGK A;  1EY8 A;  1JOQ A;  1ENC A;  2EY6 A; 
#chains in the Genus database with same CATH topology
 5KYL A;  4FDB A;  5LMU Q;  3SE0 A;  3NQT A;  2IX3 A;  5COY A;  2VZA A;  3CRK C;  3NEM A;  3F8T A;  1OXS C;  3CME A;  3ZYY X;  4DPG A;  1PH3 A;  3HOY G;  4QF4 A;  4KHV A;  1SYC A;  1D2B A;  2ZXP A;  3BZD B;  1BO0 A;  3E5S A;  2CWP A;  1CQF A;  1SMY D;  2A68 C;  3H91 A;  2K5Q A;  2QCP X;  4NKL A;  2QKI C;  1EYD A;  1SNQ A;  5LL6 S;  1Q90 A;  1YHA A;  2ZT9 C;  4FXD A;  4J1M A;  3GTQ H;  3A5U A;  3C2P A;  4YCW A;  2NVQ H;  1IBL L;  4JI7 L;  1Q12 A;  3CW2 C;  1SLJ A;  1GXD C;  1HTP A;  1MHW C;  2A1A A;  2D0P A;  3M3Y B;  3PO2 B;  3PO3 G;  1EQT A;  2XIW A;  2DY8 A;  4JI3 Q;  2B2Y A;  3FVQ A;  1EYC A;  1LAB A;  3NWT A;  2VNU D;  3PUZ A;  1D6E C;  2A6E C;  3E6Z X;  2R92 B;  2PW5 A;  4CGY B;  1NR4 A;  1EZ8 A;  2X69 A;  1EWC A;  1F2M A;  2JXM B;  2JA6 G;  3I91 A;  2M00 A;  1HQR D;  2JEB I;  2N88 A;  2AMC B;  1YNX A;  1VMC A;  3A8J E;  4HSP A;  3UDI A;  2XWJ B;  1SN8 A;  1IBM Q;  1VQ4 A;  1K3R A;  5ELN A;  4RCN A;  2O5J C;  5C4X B;  4DR5 Q;  2F4I A;  3PO2 H;  2OTL A;  2M2L A;  3D3R A;  2E2I B;  2Z4I A;  3ER0 A;  4JI5 Q;  5E7N A;  4DUY Q;  1SRO A;  5COR A;  3CCV A;  1X54 A;  1PXU A;  4C2M B;  3VYS A;  4FF1 A;  4QL5 A;  1N34 L;  2VS1 A;  3E0E A;  4L6T B;  3W2D A;  1AP0 A;  2KOL A;  3HKZ B;  1VQL A;  2G9H D;  3MA2 B;  5CGK A;  2LY7 A;  2BDN A;  2MQH A;  2B3G A;  1FD7 D;  4A3B B;  1PTO B;  3Q8D A;  4QGU A;  1U9R A;  1YIJ A;  5FLM H;  2EJF C;  4LF7 L;  4UP8 A;  1C7Y A;  5G3L D;  5EPJ A;  3TRE A;  4LF4 Q;  1EQV A;  1PTO C;  2HQE A;  3SR1 A;  5C4X H;  2B63 G;  1WI5 A;  2JA7 B;  1LTG D;  3CCE A;  4XQJ A;  3OTO L;  4IPG A;  2E2I H;  4JI0 L;  2F0P A;  1IHZ A;  1O7L A;  1PFB A;  1PH9 A;  2JK8 A;  4DV4 L;  3J80 E;  2Y0S E;  1EZ6 A;  1B7Y B;  1YJW A;  2HIV A;  1KD1 C;  4C2M H;  4DV0 Q;  4ME3 A;  5GAH C;  1STA A;  2N55 A;  1TWF B;  4HJA A;  1HR0 Q;  3HOZ G;  3M7N A;  4KLK A;  3NEN A;  4C3J B;  3TQY A;  1VQG A;  4TSS A;  3R2I A;  1YNJ C;  4JI2 Q;  1RJT A;  4A3B H;  1PTO H;  2L12 A;  1YI2 A;  4G57 A;  5KRU A;  1B3Q A;  4KI0 A;  1VQO A;  3CAM A;  3T16 A;  3KJO A;  2MP1 A;  1SYG A;  1DYQ A;  5IT9 L;  2SOB A;  5IP7 G;  2MO1 A;  1G51 A;  3SK8 A;  1T5X D;  3J81 L;  5GAE C;  3KLS A;  1A6X A;  4HCE A;  4F87 A;  2CKZ B;  1SFO B;  5KEE A;  2F4V Q;  2HDL A;  4DNT B;  4X6A H;  2F0L A;  1PLF A;  2F3I A;  3SK5 A;  2PNR C;  2A8V A;  3RR5 A;  1TWF H;  2R7D A;  1QWY A;  3K8A A;  2FMM A;  4BY7 G;  4C3J H;  1MSH A;  4UY8 C;  3NQI A;  4JV5 Q;  3QIA A;  2VQE Q;  2CWA A;  3RZO B;  3TP7 A;  4DV7 Q;  1AW7 A;  1EQQ A;  2ZJP A;  2X6L A;  5HY6 A;  3HGB A;  2R3Z A;  2E8G A;  2L4N A;  4XDX A;  2KVM A;  3STB D;  5IYC H;  5M5Y B;  2IPK D;  3RD4 A;  3E3X A;  5L37 A;  1JJC B;  2TMP A;  4I7Z C;  3KF6 A;  4A3D B;  1B1Z A;  1G8Z D;  1CQV A;  1QZG A;  1SXT A;  4OWW B;  3CCJ A;  1VQ6 A;  4CKE A;  1SMY C;  4A4I A;  1ENF A;  3JAM c;  5JPN C;  1V1Q A;  1JR0 D;  4IUV A;  3PO3 H;  5ELC A;  4P71 A;  1XNQ L;  5FO8 B;  1HJP A;  1Y69 U;  2BE5 D;  2CVR A;  2BDO A;  3KDF A;  1PZJ D;  3RZO H;  2V4D A;  1I4H A;  1YHQ A;  2NN6 G;  2YV5 A;  2Q2H A;  2BCO A;  1HXY D;  2P5Z X;  3WOF A;  4E6I A;  2K50 A;  3IFT A;  4RGO S;  4C3H G;  4GZY C;  2JA6 H;  4A3D H;  1I4R A;  2IHF A;  4LFB L;  1GUO A;  3E9I A;  1SYE A;  4JBM A;  1E22 A;  1N32 Q;  1AZP A;  4O0A A;  3AYH B;  5C6A A;  3E9H A;  1WCM B;  2F0Q A;  3NHH A;  3FKI G;  1GM5 A;  3KF6 B;  3I90 A;  4DAM A;  2B63 B;  5IY0 A;  1LTS D;  2CW0 C;  5ELF A;  4CJ0 B;  1EY6 A;  4DV5 Q;  4A3E B;  3GV6 A;  4RGT A;  3OW7 A;  4CJ2 C;  1PH6 A;  1Y8O B;  5EJW A;  3T53 B;  3CCS A;  1RD9 D;  1TR5 A;  2VB3 X;  5T1I A;  1KAW A;  1JOO A;  4OL7 A;  3RUZ A;  2LFN A;  2JQO A;  5NUC A;  2EYL A;  4CDE C;  5IP9 G;  3QR8 A;  4IOA A;  5IWA L;  1WCM H;  5ELO A;  4A3I G;  4F7X A;  2R7Z G;  5EBC A;  2UXC Q;  1PRT F;  4QIW B;  4PMC A;  1J8I A;  1H9S A;  1TU2 B;  4R9W A;  2B63 H;  4A93 G;  2EYP A;  1IZ6 A;  3AEV A;  1KL9 A;  4AYB G;  1GKH A;  2I5L X;  4A3E H;  1Y14 B;  2WAQ B;  4CDC C;  1B50 A;  4RFB A;  1NTG A;  2D9U A;  4X64 L;  4PMB A;  1A62 A;  1CI3 M;  3T1Y Q;  2FIN B;  1ILP A;  3PQI A;  1D5X C;  1XPO A;  1HUN A;  5CC4 A;  4OO1 H;  1I94 Q;  4BY7 B;  2J7Z A;  5KIX A;  2JA9 A;  4X65 Q;  1RDP D;  4QMG A;  1WTV A;  3FP9 A;  2R7F A;  1VQJ A;  1DOM A;  3M4Y A;  1XMQ Q;  2X6G A;  3U9S A;  2VUM B;  4QQB X;  2JA5 G;  1IYU A;  4DV1 Q;  5EAY A;  3AFP A;  5JJK A;  2Z0S A;  4EVO A;  3M4P A;  4BXX H;  4HMI A;  1KQS A;  1MI2 A;  5A2Q E;  4BY1 B;  4IPH A;  3H15 A;  4LWC A;  3WWV A;  4JI6 L;  3D4D A;  5AFW A;  1E1O A;  1X55 A;  2FFK B;  2ZM6 Q;  4ZAI A;  2AKW B;  4KY7 A;  2BA0 A;  2KEE A;  2NBF A;  1ILQ A;  4A3F B;  1VQA A;  4YY3 L;  3A0J A;  5LHY 1;  1OXT A;  1O7Z A;  4MNO A;  4G7H C;  3G6E A;  5FLX c;  4BY7 H;  3IFD A;  4BWG B;  1LM0 A;  4X66 L;  2EIF A;  4IZ8 A;  5J3B A;  2K5V A;  1QJO A;  4B3S L;  5JJI A;  2A19 A;  1EOV A;  3BZK A;  1WD1 A;  5M3M B;  3A8K E;  1YNN D;  2E76 C;  4R8N A;  2WKD A;  4NXM L;  4IJH A;  5J39 A;  3SGI A;  3G7L A;  1J5E L;  3S2D B;  5FK9 C;  2H4O A;  2A6H C;  1JJ2 A;  1AN8 A;  1FGU A;  3BZC A;  2JYO A;  2D2C C;  3BG3 A;  4DXF A;  1DD2 A;  4BY1 H;  4KHP L;  2Z4H A;  4CJ1 B;  1D1K A;  1A3V A;  5LL6 X;  3K0Y A;  3KLS X;  4RHS A;  1SEB D;  1Y1V G;  1JWU D;  2RCF A;  3TZD A;  1JOR A;  2PMZ B;  4A3F H;  4ZLT F;  1AZQ A;  2A5H A;  1R4Q B;  1E2W A;  5C4J B;  4A3J B;  1VQN A;  3HP3 A;  2YTV A;  1HNX Q;  2F0D A;  4XT3 B;  3S1M B;  4DAY B;  5D3I B;  2NZ1 D;  1CZG A;  1DJR D;  3ULP A;  1VQB A;  4HN7 A;  3NPP A;  1EIY B;  4YIJ A;  1ICF B;  2XRS D;  2NN6 H;  5M3M H;  1TWH B;  2F1M A;  1LT5 D;  2HHH Q;  4UAI A;  3AFQ A;  3S2D H;  4NPS A;  4DR3 L;  3D6W A;  2MO0 A;  4N8F A;  1AE3 A;  1W6J A;  4IUN A;  2A73 B;  3DMU A;  2ID0 A;  1GUS A;  1XPU A;  3JAM i;  1RIP A;  3W1B A;  4CKB A;  2R7Z B;  1NSN S;  5IGC A;  5F2D A;  3RMH A;  4A3J H;  2ATW A;  1GUN A;  1EYG A;  1A3U A;  3S1M H;  1FL0 A;  3PIO 3;  1X65 A;  2HIX A;  4QY7 A;  2UU9 L;  4C1N K;  5M3F G;  4HED A;  2JJQ A;  5IIF A;  1IKM A;  4C3I B;  1HNW L;  1TWH H;  1VF7 A;  2DUD A;  3JC6 6;  4PZ7 A;  4B08 A;  2VQF L;  3NP8 A;  4ZUJ A;  4BA1 I;  2OXP A;  4TKO B;  2A6E D;  4DUZ Q;  5KGU A;  4NXN Q;  3M7G A;  2UXD Q;  1EEI D;  2ASB A;  5BN5 A;  3B6Y A;  1NUC A;  1QB5 D;  3DEO A;  3L9A X;  1MJC A;  3K5L A;  4AH6 A;  3C1F A;  1EY9 A;  2R7Z H;  2K32 A;  2JA5 B;  4X62 L;  1S4Z A;  3OHX C;  1PFS A;  4M8A A;  1PH8 A;  1VQD A;  3EQL C;  1EOT A;  4U68 A;  5CBE E;  2B8F A;  5CV9 A;  2LXK A;  1JT8 A;  1XMO Q;  1BOS A;  4C3I H;  1QIL A;  4L5Q A;  4LFA L;  4J6H A;  4IFD H;  2AWN A;  1ICW A;  5C3E B;  4DF7 A;  5C5L A;  4JI4 L;  2FMC A;  4LUV A;  2OQK A;  3ICE A;  3J80 c;  3IAY A;  4B3M Q;  1B3A A;  1M90 C;  2BA1 A;  4AYB E;  3PO2 G;  3G48 A;  5C0X I;  4LF9 L;  2XN9 C;  5AJ3 Q;  5DM6 3;  3S2H B;  4H0L C;  1K0R A;  2JA5 H;  1JE5 A;  3OW2 A;  2R92 G;  3HOU G;  3CU7 A;  2F0H A;  5GAG C;  4IQZ A;  1Y1V B;  4TQU S;  1PTO D;  2Q2U A;  3T4A C;  1KLG D;  5EKI A;  4R4O A;  4K0K L;  1SE3 A;  4OX9 Q;  5M5W B;  1CM9 A;  1W3S A;  5C3E H;  2HT1 A;  2PZU A;  3CCU A;  1EWI A;  4RAU C;  3CXC A;  4RGN A;  2UXB Q;  2A69 D;  3KBG A;  5C4X G;  4DV3 Q;  1G6Z A;  3MEH A;  2UUC Q;  2DN8 A;  3BDC A;  3MFY A;  2QDL A;  4DV2 Q;  3CQZ B;  1NCV A;  3G4S A;  1HPC A;  3CC2 A;  3BJU A;  3CPF A;  2NVX B;  3S2H H;  4JI8 Q;  1FJG Q;  1SDF A;  4XIG S;  4DR4 L;  1YNJ D;  1WTQ A;  1IL8 A;  4ZRZ A;  3OYY A;  2RSO A;  4AIM A;  1XTC D;  1ET6 A;  1WVL A;  1XNR L;  3HKZ G;  3RZD B;  4IFD J;  1Y1V H;  1UE7 A;  1B8A A;  3I4L A;  3UDX A;  4A3B G;  3K80 C;  2WV6 D;  4ZCK A;  2KHI A;  2NB0 A;  5M5W H;  3NE5 B;  5T1G A;  3I4N B;  3LWE A;  1U5K A;  4UPA A;  1SJE D;  3P7J A;  3OSO A;  3NXW A;  4YHH Q;  5M3F B;  2JA7 G;  4OWX B;  2SNM A;  4IUU A;  3CQZ H;  3LNN A;  3L3O C;  1LTB D;  4DR1 Q;  1A0I A;  3SXH A;  2B2T A;  2BOS A;  4DR7 L;  5FLX E;  2NVX H;  1UEA B;  3S14 B;  1GOZ A;  2ICI A;  3RLN A;  2RSN A;  2F0W A;  2EE1 A;  1TS3 A;  3Q6S A;  1QNK A;  4V19 0;  4C3J G;  3GDE A;  1HFG A;  1S5F D;  3RZD H;  2OCE A;  2LXJ A;  3D8G A;  4GKJ Q;  5BR8 L;  5G3L F;  3V2T A;  1BR9 A;  4JYA Q;  4JCV E;  3KJP A;  4EQO A;  3BYT B;  3M9B A;  3LGJ A;  5IYC G;  3I4N H;  2GVB A;  4ID6 A;  3K81 C;  3I3C A;  1I50 B;  2F0G A;  4RHR A;  4LFC L;  1D5Z C;  1MKH A;  5M3F H;  2R6G A;  3SEB A;  1STY A;  3DWA A;  4F88 A;  2FXQ A;  1Q82 C;  4GKK L;  2SEB D;  3W1G A;  4QUF A;  5LMU L;  2RA4 A;  2XWB B;  3SK4 A;  2F0K A;  3S14 H;  2CQA A;  1P16 A;  4OIK A;  2B2U A;  3FPU B;  1S40 A;  1S5E D;  4GLX A;  2KEN A;  4DK3 C;  4AQY Q;  1C48 A;  3BS1 A;  1VQ9 A;  3CC7 A;  1EY5 A;  3TP6 A;  1IW7 C;  2D0O A;  1PH1 A;  2E2D C;  2GVA A;  3BVZ A;  5FOB B;  1BCP D;  1C8C A;  5K36 G;  3HOU B;  4ZQ3 A;  3HS0 C;  2AQ3 B;  5I6Y A;  1E0B A;  3NTK A;  1GJX A;  3K5N A;  4DGZ A;  1PH4 A;  3F2B A;  1YVC A;  2G5D A;  3NTI A;  3S1Q B;  1A15 A;  3CMA A;  4A3D G;  4GOP A;  3G71 A;  5ISR A;  1VQ8 A;  1AE2 A;  2CW0 D;  1GHK A;  2F0E A;  1KHI A;  1EIH A;  1RCV D;  1VMP A;  3GTK B;  3OWE B;  1I3Q B;  3PUW A;  3AQQ A;  1STE A;  1G2T A;  3JAM L;  4XYQ A;  1FR3 A;  3M3Y H;  2LMC B;  1Y8N B;  1J9O A;  4JI3 L;  4OHJ A;  3X3M A;  1SMX A;  2PO4 A;  2F0O A;  1WTO A;  2CFM A;  3KLW A;  2IHE A;  2R92 H;  3HOU H;  1HNZ Q;  2MFI A;  4RH6 A;  4R4T A;  5E1F A;  4JBW A;  2DGY A;  1JB7 A;  1YEZ A;  1C0A A;  4KN4 C;  3W3A A;  1CT1 D;  3TDQ A;  1BF4 A;  1STN A;  1I5F A;  3S1Q H;  1Q86 C;  1PH5 A;  2EQS A;  4X3U A;  4EX5 A;  4NB3 A;  3FRP B;  4B3T Q;  1A2T A;  1L0X B;  1TS5 A;  5ELE A;  1TWA B;  1WD0 A;  2B2Y C;  1GUW A;  2ICE C;  1IBM L;  1WCM G;  1M8A A;  4JPB W;  4JW0 A;  2KQ3 A;  3J80 i;  1KAB A;  2EVB A;  3GTJ B;  3KBX A;  1HTL D;  1GO3 E;  4GOP B;  3GTK H;  1I3Q H;  2WII B;  4DR5 L;  5BN4 A;  3H94 A;  2N49 A;  1M1K C;  2LKV A;  2K01 A;  4JI5 L;  4A3E G;  4DUY L;  5JEA H;  4FO2 A;  4GOP C;  2A69 C;  1ASY A;  2ALY B;  4BA2 I;  2RDF A;  1VQH A;  4OO1 G;  1OXU A;  4OGQ C;  4KHZ A;  5DEH A;  3ULJ A;  2DNE A;  3AU7 A;  1A2U A;  2MHV A;  5KYI A;  1F2Y A;  4KTA A;  2WB1 B;  1GD7 A;  1CSP A;  2RQX A;  4KD4 A;  2D62 A;  1GVP A;  1UNS A;  4DNR B;  1SE8 A;  3GTJ H;  4LF4 L;  2IX0 A;  4DV6 L;  1EQR A;  1AH9 A;  5IGF A;  3HKZ E;  1SND A;  2EXZ A;  4BXX G;  3I7F A;  3OPO A;  2JA7 H;  4JI1 Q;  4DK0 A;  3R8B A;  2RHQ B;  2LS0 1;  3H3V I;  3MVV A;  3D31 A;  2ENB A;  5DAU A;  4L8J A;  1B4O A;  1KDC A;  2WAQ G;  4DU9 A;  1PA6 A;  1NE3 A;  2K5W A;  3J7A V;  4DV0 L;  4HJ7 A;  2IL8 A;  2N8N A;  1Q81 C;  5IE8 A;  1L1O A;  1EEF D;  2QIL A;  1VF5 C;  2PW7 A;  3SDZ A;  1K73 C;  1HR0 L;  3R2T A;  4Q0F A;  3TS2 A;  4A3M B;  1N36 Q;  3J7A 5;  2A6H D;  1BVS A;  4JI2 L;  1ASZ A;  5EBD A;  3R93 A;  3ZJY C;  1Q8I A;  1YBY A;  3VYT A;  1I6V C;  4XQQ A;  1QZH A;  1FNV A;  3PIO A;  5E3F A;  4BBR B;  1WTW A;  5FJ8 G;  2VUM G;  1CHP D;  4HAE A;  2RF4 A;  3SK6 A;  4DK6 C;  3VA7 A;  5JEA J;  2IWH A;  4BY1 G;  5M5X B;  2JP1 A;  2WIN B;  4K2L A;  5JJL A;  5CV8 A;  4N8X 1;  2Z1C A;  4LF8 Q;  1MBY A;  1SFO H;  2F4V L;  1LYL A;  1CTM A;  1I4X A;  1SYF A;  4A3F G;  1EY4 A;  2NN6 I;  2Z6K A;  1ZYR C;  1I4P A;  4A3M H;  5KNB A;  4JV5 L;  2F0U A;  2Q8T A;  4R4C A;  5FLX L;  2VQE L;  2MUY A;  4DV7 L;  2N3S A;  1BCP B;  5K36 H;  1IBK L;  5M3M G;  3S17 B;  5DLQ E;  4BBR H;  5M5Y H;  1GUT A;  4KMU C;  1WYD A;  4DAP A;  1VDZ A;  2OT2 A;  4ULL A;  4IAL A;  1BCP C;  2AWO A;  1NAP A;  2ZTC A;  5M5X H;  5HUR A;  1YJ9 A;  4ILW A;  1R9T B;  1EY7 A;  1D7Q A;  1PZI D;  2L5T A;  5CMD A;  4OEL B;  3CCM A;  3ULL A;  3BYY B;  4A3J G;  3S16 B;  1TY2 A;  1KC8 C;  5I6W A;  2DY7 A;  2R93 B;  5EQ0 A;  2EY5 A;  3MXP A;  3A8I E;  1K9M C;  1UE5 A;  1FYC A;  4K6L A;  1FVI A;  1WOC A;  1H9M A;  1XWE A;  3J81 j;  5FO9 B;  3OWF A;  1LAC A;  1SAP A;  2ZTD A;  1B9M A;  1BKB A;  1LTT D;  1EWH A;  2VB2 X;  3KDF B;  3HEJ A;  4LAA A;  5IOD A;  1VQF A;  1PHJ A;  3I72 A;  2DJG C;  1F77 A;  2EYF A;  3ND9 A;  4GLA C;  2NVT B;  1N32 L;  2E75 C;  4FXK C;  1NY4 A;  1X3E A;  1R9T H;  2YTY A;  3PIP A;  1II3 A;  1SNC A;  2QF7 A;  4POG A;  3K59 A;  3S16 H;  5D3D A;  1CSQ A;  1TWC B;  4DV5 L;  3I2Z A;  1PYB A;  3HG9 A;  5D14 A;  3DUZ A;  5JVH 3;  1STB A;  1SE2 A;  4C3I G;  5ELB A;  2UUB Q;  1U4L A;  3GTP B;  4IFD G;  1N9W A;  2PZT A;  2OQ0 A;  3S15 B;  1UUP A;  1X9N A;  5M9O A;  3H09 A;  3A55 A;  4HSV A;  2SDF A;  2NVT H;  3V96 A;  2K03 A;  3GTM B;  3ITP A;  2UXC L;  2IY5 B;  4GN4 B;  2HCI A;  5IGB A;  2AHO B;  4ABN A;  1TY0 A;  3MZ5 A;  1TWC H;  1XJV A;  3M4O B;  1X3P A;  4H13 C;  3GV3 A;  1LO5 D;  1PZK D;  2Q2T A;  1H9S B;  1LLR D;  3T1Y L;  5IGE A;  2K1B A;  2GA4 B;  5TSS A;  3CCR A;  2K33 A;  4QIW E;  4P73 A;  1WTH A;  4IUR A;  5C3E G;  1K0S A;  2L15 A;  1HA5 A;  3T1H Q;  1KDB A;  4X65 L;  1UE6 A;  1LTI D;  4IJL A;  3TN2 A;  3BVM A;  2J0T D;  2JN4 A;  1UE1 A;  4PQX A;  3J80 L;  2PI2 E;  2WAQ E;  1XMQ L;  3GTG B;  4Y52 H;  1SE4 A;  3OIQ A;  1PFM A;  4LF5 L;  3GTM H;  4JOI A;  5FJ8 H;  4A3G G;  3D4R A;  4JBJ A;  2VUM H;  2GN5 A;  1O80 A;  4DV1 L;  4JVZ A;  4IPC A;  4X3K A;  4JK1 C;  1ML0 D;  2F3W A;  1B44 D;  1VQE A;  5E4W C;  3T51 B;  2ZJR A;  4MTN A;  4FP5 D;  4KKT A;  4CHT B;  3IRB A;  1TS2 A;  2ZM6 L;  1K8O A;  2F52 A;  5I2Y A;  4WRD A;  1BBX C;  1C9O A;  3GO5 A;  4POF A;  1EU4 A;  2K4K A;  2G9D A;  3ERO A;  1ZKO A;  1EFW A;  1U4R A;  3NEL A;  1SYB A;  3PF5 A;  3EBE A;  3PV0 A;  1B2T A;  5CR3 A;  3CRL C;  2EPB A;  1PH2 A;  3RN2 A;  5EPK A;  4UP9 A;  2WAC A;  3GTG H;  4LJZ C;  4CKC A;  3MTS A;  1LT3 D;  2QEJ C;  3VDY A;  1ENC A;  3RNU A;  3NSW A;  2EYH A;  4PZ6 A;  4MHE A;  3KF8 A;  2O5I C;  3Q22 A;  4RKB A;  1E2V A;  2HCC A;  1MGS A;  1PTO F;  2K14 A;  3PMF A;  4XT1 B;  1DZ1 A;  3HKS A;  5EGT A;  1WTX A;  1S5C D;  2NTS A;  2FHT A;  2NTT A;  4HR7 B;  1T9H A;  1EFI D;  5C3W A;  4A3C H;  1Z9F A;  4F8M A;  5C4J H;  2ZJQ A;  1F9Q A;  1HNX L;  1Q1E A;  3I4M B;  4JOI C;  3F1Z A;  3I4N G;  4A75 A;  2AQ2 B;  2I5H A;  2MNA A;  4V0B A;  2A74 C;  4YWK A;  1STH A;  3Q24 A;  4FF4 A;  5C44 B;  4GLV B;  4IUT A;  3N6R A;  3G6J B;  2OTJ A;  1NR2 A;  1VQC A;  1RKN A;  2OWO A;  1PVO A;  3LWU A;  1QVC A;  2HHH L;  2PMZ E;  1IW7 D;  1TXY A;  4YWL A;  5LMN Q;  1K3B C;  3RLF A;  1JWM D;  4K8J A;  2L0C A;  2AUK A;  3A54 A;  3A7A B;  1VQI A;  3K7A B;  4DR6 Q;  5EKK A;  4MTK A;  1ENA A;  2UUA Q;  4B9X A;  2VW9 A;  4PZ8 A;  4O42 A;  4C1N I;  3I4M H;  3KYH C;  3NBI A;  1K83 B;  2QW7 A;  4CBV A;  3Q0A A;  4LF6 Q;  1K8M A;  5C44 H;  2E5L Q;  2ES2 A;  3AMU A;  2EY1 A;  2WP8 J;  4DR2 L;  1Q3L A;  1FNU A;  4OXP A;  2EXD A;  2CQO A;  3S1N B;  3M85 A;  1FNW A;  4M1U B;  5JOB A;  4LK1 C;  2KUM A;  5JVG 3;  1HZC A;  4S3S A;  5I9P A;  4DUZ L;  4NXN L;  1YIT A;  2UXD L;  2N78 A;  3QG1 A;  2IT1 A;  1CZW A;  3PCO B;  4A3G B;  1BUV T;  4B3R Q;  4DA2 A;  4ZYS A;  2BH2 A;  4Y7N B;  5IYB H;  5C3X A;  4HJ5 A;  1YZ6 A;  1JIC A;  3NBH A;  1K83 H;  1N33 Q;  4WOR A;  1AEX A;  2YTX A;  3DHQ A;  5EKL A;  1XMO L;  4L5R C;  2Z8L A;  4P75 A;  1S3O A;  1F9R A;  2E74 C;  3U58 A;  1Z7T A;  1RTN A;  1QUQ A;  3S1N H;  4L5S A;  1G91 A;  4QUC A;  4B3M L;  1QOH A;  2F3V A;  3PIP 3;  1MD2 D;  3M4Q A;  3VR5 A;  3MXN A;  3IKJ A;  1XNR Q;  5AJ3 L;  1BDO A;  1VCI A;  2XNA C;  1SJH D;  4A3G H;  5JEA G;  4Y7N H;  1DCZ A;  1HH2 P;  4G7O C;  4FVM A;  1PH7 A;  2JE6 I;  2SNS A;  2EJG C;  1MJE A;  1X32 A;  2EYM A;  2AUJ D;  4X3S A;  3UE0 A;  4OEM B;  2L11 A;  2EOT A;  4OX9 L;  4QCL A;  3K57 A;  1T5E A;  1IL2 A;  1G6P A;  5A2Q L;  5H1S E;  4HMJ A;  4ZKC B;  2UXB L;  2D5D A;  4DV3 L;  3K7U C;  4MIU A;  2UUC L;  4WJ4 A;  4DV2 L;  3ND8 A;  5J22 A;  4FNF A;  4HJ9 A;  1VQP A;  1QUQ B;  4JI8 L;  1F9S A;  1WFQ A;  4ODG A;  1FJG L;  1H95 A;  5BR8 Q;  3QWN A;  2E2J B;  2Q2I A;  4K5V A;  4NW2 A;  1PMR A;  2Z6B A;  1IYV A;  3L7Z C;  3MXN B;  2HQL A;  2B2V A;  2LSS A;  3U4V A;  4A3K B;  1PRT B;  1QG7 A;  1TWG B;  4DN4 M;  1JOK A;  4J8Q A;  3C46 A;  2O2L D;  2RKS A;  2PZW A;  1DGS A;  3SHL A;  3GTO B;  1E24 A;  3CKI B;  4I65 A;  1STG A;  1IBL Q;  2WB1 G;  4JI7 Q;  1RF2 D;  2QEX A;  3GTL B;  4BBS B;  3T13 A;  1VQM A;  1I6H B;  3OOC A;  1IKL A;  4YHH L;  5HGQ A;  2EYO A;  1EIG A;  1ZYR D;  2WKC A;  4DR1 L;  5CV4 A;  1ESF A;  1LV9 A;  1A8V A;  2MPM A;  3HZX A;  3VR6 A;  1RTO A;  3EA6 A;  1XXG A;  2E2J H;  4CDD C;  4R4Q A;  3D4W A;  3HOX G;  2XGT A;  1UWV A;  1KDA A;  4K2K A;  4A3K H;  4A3M G;  1TWG H;  1B70 B;  1SYD A;  2KCN A;  4KJO A;  3GTO H;  2KCT A;  4GKJ L;  2B2W A;  2IX1 A;  1X6O A;  1Q1B A;  2BH8 A;  1P8L A;  1VQ5 A;  4JYA L;  1V9P A;  2B2T C;  1OTC A;  2EY2 A;  4BBR G;  3GTL H;  1TKW B;  4BBS H;  1S5B D;  1EL0 A;  1E1T A;  3LX0 A;  4H44 C;  1I6H H;  4RKL A;  2KCC A;  4KKS A;  1I50 H;  1DOL A;  2RCN A;  2B2V C;  2K5H A;  1CKM A;  2M9V A;  1RL2 A;  1SNP A;  2F0F A;  1EU3 A;  3VR2 A;  1G29 1;  1KNA A;  1JQY D;  2PQA A;  3Q23 A;  4PNY A;  3N52 A;  4H7B A;  4WJW A;  2C5C A;  4XQN A;  1N34 Q;  1D8L A;  4AQY L;  1D5M C;  1E7Z A;  4FYD A;  1HRJ A;  2VL6 A;  1DXM A;  4PV1 C;  3VR4 A;  4CDF C;  1XYI A;  3CD6 A;  2RVL A;  2Y0S B;  3VYU A;  2K75 A;  4H02 A;  4IOC A;  1RHP A;  4LF7 Q;  1KNE A;  2F0N A;  1U4P A;  1NMG A;  2C9O A;  3A56 A;  5HGT A;  3EFX D;  1LTL A;  3GP7 A;  3I70 A;  2B2U C;  3K5O A;  4N9T A;  3UE1 A;  1Q46 A;  1TVX A;  3H0G B;  1HR0 W;  3S9W A;  3OTO Q;  3FMC A;  4JI0 Q;  1A63 A;  4HIO A;  4YCU A;  4DV4 Q;  2B2W C;  3BVG A;  5KNC A;  3CC4 A;  1L0Y B;  1HZ9 A;  2K5N A;  4K6D A;  1O7I A;  4P72 A;  1HHV A;  4OO1 I;  5C0X H;  2R93 G;  1WTP A;  5C4Z A;  3S24 A;  1CUK A;  1K8G A;  2F0M A;  2NUC A;  2PQA B;  2JEA I;  4EQN A;  1JCK B;  3FPP A;  3FHW A;  4HTH A;  3DEP A;  1NBW A;  1HNZ L;  4N9P A;  1B9N A;  4LMQ D;  4B9W A;  3UDF A;  1I4G A;  4MZ9 A;  4TRD A;  5C5M A;  4DV6 Q;  5CYU A;  3H0G H;  4RA8 A;  1S72 A;  4KJN A;  3ONA B;  1UAP A;  1BXT A;  1MSG A;  4B3T L;  4R8I A;  3DM1 A;  5GAD C;  1TWA H;  3RN5 A;  1EY8 A;  4YCV A;  4HJ8 A;  2EY6 A;  4OWT B;  1KLU D;  3R3O A;  1WJJ A;  2V1C C;  3HOY B;  3U4Z A;  4A3L H;  3OIP A;  2Q8I B;  3UDG A;  1JJG A;  5CV6 A;  4ZK9 B;  3TEH B;  1M4V A;  1V43 A;  3HOX B;  2OEO A;  3DLL A;  1SRU A;  3F2D A;  1BQQ T;  1KAA A;  3PUV A;  5A35 A;  1CKN A;  1Z6H A;  3K6O A;  3MXU A;  4Q5V A;  1O78 A;  2K28 A;  4O1N A;  1PYW D;  2MJ8 A;  2IW3 A;  2CH4 A;  4WFN 3;  2Z9H A;  3I56 A;  1NJI C;  3MEF A;  1KTK A;  2RHS B;  3V05 A;  5C0X J;  4LUO A;  2ZXR A;  4NDX A;  5GRO A;  1V8Q A;  4APV A;  3MFG A;  2F0T A;  1N8R C;  3PO3 B;  2ZTE A;  4JI1 L;  4XXE A;  1XNQ Q;  3P75 A;  3HOW G;  2KEC A;  4I7A A;  5I4D A;  3HOY H;  4K5X A;  2PPB C;  4RWS C;  3PUY A;  3EVQ A;  2WB1 E;  1CKO A;  3VR3 A;  2JA8 G;  3HOX H;  1IBK Q;  4RG1 A;  4O2D A;  1Q7Y C;  1HFN A;  3J7Z C;  4PMW A;  2L55 A;  4ZKB B;  2KHS A;  1JE4 A;  1N36 L;  1HCZ A;  2EJM A;  3W5O A;  3C3L A;  2JA6 B;  4U67 3;  2XSC A;  3EJI A;  2F0S A;  2K7V A;  1V1P A;  1SR3 A;  1Z47 A;  1HA6 A;  4LFB Q;  3WOE A;  1L1O B;  1F9P A;  4HID A;  3A5Z B;  1CKN B;  5JPM C;  1OXV A;  5D65 A;  2PYK A;  3MWY W;  1JB3 A;  3KOJ A;  5FO7 B;  3TZU A;  1L1O C;  3K58 A;  3E0J A;  3KUP A;  3PSI A;  1GUG A;  4L63 B;  1Y1W G;  2I0Q A;  4ALP A;  1SNM A;  3AB9 A;  3CP0 A;  5IGD A;  2F0V A;  4LF8 L;  4KY6 A;  4KKU A;  4A3C G;  1YHB A;  2I46 A;  2L9H A;  1E3P A;  2B39 A;  1O7Y A;  3TSS A;  2QA4 A;  3I73 A;  2VXW A;  4QB4 A;  3S1R B;  1TII D;  5IWA Q;  1CA5 A;  2C35 B;  3S17 H;  1IYJ B;  2PI2 A;  3CHB D;  1CA6 A;  1KRT A;  2AQ1 B;  3TRZ A;  1V1P B;  4JG2 A;  4X3T A;  2Z6K C;  3TP8 A;  4HIK A;  3CF5 A;  1VQK A;  1LT6 D;  4X64 Q;  5FKA C;  3WDN A;  4IFD I;  3HOZ B;  3I4M G;  4KY5 A;  2R93 H;  1C4Q A;  1PYS B;  2PNH A;  2CCZ A;  5C44 G;  5KND A;  3J7A F;  3PF4 A;  4P2C B;  4JC0 A;  1K8A C;  3S1R H;  4UHV A;  1DOK A;  4GS3 A;  5ELD A;  4Z9C B;  3EN2 A;  4KN7 C;  5IT9 c;  4IO9 A;  3CCQ A;  1QVG A;  2E2H B;  3J81 c;  3BU2 A;  3X3N A;  2WFW A;  2FJ2 A;  3KK7 A;  1XTD A;  2XVS A;  2H5X A;  4YWM A;  4JI6 Q;  1DM0 B;  1ROD A;  3DM3 A;  1CHQ D;  2YYZ A;  1LT4 D;  4YY3 Q;  5IYB G;  1SSO A;  4KK7 A;  2O4X A;  5E4X A;  3HOZ H;  2Q8R E;  3T56 B;  4P74 A;  3HOW B;  3C1E A;  1X3G A;  4GNX A;  4IUQ A;  2QDB A;  4R4I A;  4X66 Q;  2YU9 B;  4B3S Q;  1G2S A;  4OIJ A;  2JA8 B;  4FXG C;  3BDO A;  2UUB L;  4OON A;  3GTP H;  4K5W A;  4NXM Q;  4LF5 Q;  3DWQ A;  2I5M X;  3H3V C;  1EIF A;  1I94 L;  1J5E Q;  1E2Z A;  3S15 H;  3I4O A;  4JBK A;  1KRS A;  2E2H H;  3HOV G;  5IP7 H;  5K5P A;  5CV7 A;  4LW1 A;  2KED A;  2KCM A;  1J6Q A;  1QE6 A;  4KHP Q;  4DAY A;  3I8Z A;  1IXR A;  2F0J A;  1AFP A;  1V1O A;  3GQB A;  3L2P A;  1NMF A;  2NWG A;  4EQP A;  4DXG A;  5BN3 A;  3P20 A;  1Y1W B;  3CPW A;  1BBU A;  4FF3 A;  1JOQ A;  1F2L A;  5CBA E;  3HOW H;  3M4O H;  3H3V H;  1R4P B;  1KXL A;  4EQ5 A;  3I55 A;  4K14 A;  2YU9 H;  2NVY B;  3QJY A;  2JA8 H;  4K8I A;  2B29 A;  4MN3 A;  3F2U A;  4ZUI A;  1A3T A;  1ET9 A;  4HIM A;  5IYD G;  3KLR A;  3T1H L;  2RDG A;  4C3H B;  1GHJ A;  4DKA C;  4GNX B;  4DR3 Q;  4IN3 A;  1HZB A;  3VA5 A;  3ERQ A;  3CCL A;  3MHB A;  3PUX A;  2R61 A;  3D6C A;  3STB C;  1X56 A;  5J1Z A;  4GNX C;  3FKI B;  5I2X A;  3J7Y W;  2NZO A;  5GQO A;  1MIU A;  4QJF A;  5EPL A;  1U0L A;  1PRT D;  1Y1W H;  4RCO A;  3TS0 A;  1BNZ A;  5LMN W;  1OXX K;  1JMC A;  3IL8 A;  2UU9 Q;  1H9R A;  4HCS A;  1ONL A;  2JSO A;  1HQM C;  1F2Z A;  2NVY H;  2PCF B;  3HFZ B;  1SNO A;  2ZXO A;  5DNF A;  1BBW A;  1HNW Q;  3HRZ C;  3MXG A;  1PFN A;  4GN5 A;  2VQF Q;  1OO9 B;  1D1I A;  2BE5 C;  4C3H H;  2KJX A;  2CH4 W;  3SVM A;  2F03 A;  2A68 D;  2CHB D;  2MGS A;  3NK9 A;  4A3I B;  3FKI H;  1X3Q A;  4DFA A;  4X62 Q;  4PG3 A;  4A93 B;  3QB3 A;  1Q8K A;  1FGB D;  3TBI B;  2NZH A;  2K05 A;  2L1B A;  4A3K G;  4AYB B;  3UI2 A;  1LTR D;  4LNQ A;  3JAM E;  2K04 A;  3O13 A;  4IPD A;  2I07 B;  4DR2 Q;  4LFA Q;  1LUZ A;  3KF8 B;  3BDL A;  4XTC S;  1CFM A;  4BBS G;  4JI4 Q;  3PGZ A;  2RBM A;  1QCB D;  3RLO A;  1DON A;  4ME5 A;  1VQ7 A;  2DNC A;  3MAQ A;  1XPR A;  1Y8P B;  1W6K A;  5IP9 H;  1JC7 A;  3MC0 B;  3QOJ A;  4LF9 Q;  2QGQ A;  1EUJ A;  1TS4 A;  4A3I H;  1K28 A;  3NUC A;  1CK1 A;  4NMZ A;  3EIV A;  2NYZ D;  3DXJ C;  5LMN L;  4A93 H;  3HOV B;  3ERS X;  1ZEQ X;  2IJ0 A;  2EZV A;  2TSS A;  3QOL A;  1ZXT A;  3OMC A;  3K7A H;  4DR6 L;  2UUA L;  2H1E A;  5IOC A;  4K0K Q;  1I4Q A;  1PDQ A;  1QNU A;  1HZA A;  3H6M A;  4DAV A;  1VS0 A;  3GD7 A;  1H9J A;  4TVA B;  3FEW X;  4LF6 L;  4DK1 A;  3L0O A;  3F2C A;  2E5L L;  2VY3 A;  3TP5 A;  2B8G A;  5DM7 3;  4G4K A;  4NP5 A;  1NNX A;  2K52 A;  4DR4 Q;  3J81 i;  1PV4 A;  5JAV A;  4IUP A;  1L0W A;  5C4H A;  3HOV H;  3VYR A;  1ESR A;  5C0X G;  1BCP F;  1LTA D;  2F0I A;  5IT9 E;  2OF1 A;  3K5M A;  1WTR A;  2XRQ D;  1L2F A;  4G7Z C;  3A7L A;  5IGG A;  3URY A;  2EYJ A;  4B3R L;  4UP7 A;  3NTH A;  2K5D A;  3D0F A;  3J81 E;  4LUZ A;  2Y0S G;  4FF2 A;  4KV6 A;  5FLM G;  5I9O A;  4DNI A;  1JWS D;  2KBN A;  1N33 L;  4XYO A;  2K6A A;  2KHJ A;  4A76 A;  3H0G G;  3TME A;  5JJZ A;  3P1H A;  3U50 C;  2PQE A;  3A74 A;  2HUG A;  4DR7 Q;  4L5T A;  2HD3 A;  1SBB B;  5IYD H;  3NBH B;  3KFU A;  1UEB A;  2HDM A;  1EY0 A;  3NWS A;  3OMG A;  2DJF C;  4RGM A;  2KA7 A;  3FDT A;  2RDH A;  4GN3 B;  1YNN C;  1EYA A;  4WJ3 M;  1B53 A;  1XX8 A;  5CV5 A;  4A3L G;  1S5D D;  4C56 C;  1X3F A;  2EDG A;  1KIX A;  1TQO A;  4UDU C;  4KD3 A;  1QVF A;  3QO2 A;  4J15 A;  4EGV A;  1YJN A;  3U9O A;  4BS9 A;  1U4M A;  2XTI A;  1TT2 A;  3DWP A;  1W2B A;  4LFC Q;  1HUM A;  4R1J A;  4RMF A;  2J4X A;  1H9K A;  3GTQ B;  2NVQ B;  3K0X A;  1PRT C;  4GKK Q; 
#chains in the Genus database with same CATH homology
 5KYL A;  3SE0 A;  3NQT A;  2IX3 A;  5COY A;  3CRK C;  1OXS C;  3ZYY X;  4QF4 A;  4KHV A;  1SYC A;  1D2B A;  2ZXP A;  3BZD B;  1BO0 A;  3E5S A;  1CQF A;  1SMY D;  2A68 C;  3H91 A;  2K5Q A;  2QCP X;  4NKL A;  2QKI C;  1EYD A;  1SNQ A;  5LL6 S;  1Q90 A;  2ZT9 C;  4FXD A;  4J1M A;  3C2P A;  1Q12 A;  1GXD C;  1HTP A;  3M3Y B;  3PO2 B;  1EQT A;  2XIW A;  2DY8 A;  2B2Y A;  3FVQ A;  1EYC A;  1LAB A;  3NWT A;  2VNU D;  3PUZ A;  1D6E C;  2A6E C;  3E6Z X;  2R92 B;  2PW5 A;  4CGY B;  1NR4 A;  1EZ8 A;  2X69 A;  1EWC A;  1F2M A;  2JXM B;  3I91 A;  2M00 A;  1HQR D;  2JEB I;  2N88 A;  1VMC A;  3A8J E;  4HSP A;  2XWJ B;  4RCN A;  2O5J C;  5C4X B;  2F4I A;  2M2L A;  3D3R A;  2E2I B;  2Z4I A;  5COR A;  1PXU A;  4C2M B;  3VYS A;  4FF1 A;  4L6T B;  3W2D A;  1AP0 A;  2KOL A;  3HKZ B;  2G9H D;  3MA2 B;  5CGK A;  2LY7 A;  2BDN A;  1FD7 D;  4A3B B;  1PTO B;  1U9R A;  2EJF C;  5G3L D;  5EPJ A;  1EQV A;  1PTO C;  2HQE A;  3SR1 A;  2JA7 B;  1LTG D;  4XQJ A;  2F0P A;  1IHZ A;  1O7L A;  1PFB A;  3J80 E;  1EZ6 A;  1STA A;  2N55 A;  1TWF B;  3M7N A;  4C3J B;  4TSS A;  3R2I A;  1YNJ C;  1RJT A;  1PTO H;  2L12 A;  4G57 A;  5KRU A;  4KI0 A;  3T16 A;  2MP1 A;  1SYG A;  1DYQ A;  5IT9 L;  2SOB A;  3SK8 A;  1T5X D;  3J81 L;  3KLS A;  1A6X A;  4HCE A;  4F87 A;  1SFO B;  5KEE A;  2HDL A;  4DNT B;  2F0L A;  1PLF A;  3SK5 A;  2PNR C;  1QWY A;  2FMM A;  1MSH A;  3NQI A;  3QIA A;  3RZO B;  3TP7 A;  1AW7 A;  2X6L A;  3HGB A;  2R3Z A;  4XDX A;  2L4N A;  2KVM A;  5M5Y B;  2IPK D;  3RD4 A;  2TMP A;  4I7Z C;  4A3D B;  1B1Z A;  1G8Z D;  1CQV A;  1SXT A;  4CKE A;  1SMY C;  1ENF A;  5JPN C;  1JR0 D;  4IUV A;  5ELC A;  5FO8 B;  1Y69 U;  2BE5 D;  2CVR A;  2BDO A;  1PZJ D;  2V4D A;  1I4H A;  2NN6 G;  2BCO A;  1HXY D;  3WOF A;  4E6I A;  3IFT A;  4RGO S;  4C3H G;  4GZY C;  1I4R A;  1GUO A;  1SYE A;  1AZP A;  5C6A A;  1WCM B;  2F0Q A;  3NHH A;  3I90 A;  2B63 B;  1LTS D;  2CW0 C;  5ELF A;  4CJ0 B;  1EY6 A;  4A3E B;  3GV6 A;  4RGT A;  3OW7 A;  4CJ2 C;  1Y8O B;  5EJW A;  3T53 B;  1RD9 D;  1TR5 A;  2VB3 X;  5T1I A;  1JOO A;  4OL7 A;  3RUZ A;  2LFN A;  5NUC A;  2EYL A;  4F7X A;  5EBC A;  1PRT F;  4QIW B;  4PMC A;  1J8I A;  1H9S A;  1TU2 B;  4R9W A;  2EYP A;  1B50 A;  2WAQ B;  4RFB A;  2D9U A;  4PMB A;  1CI3 M;  2FIN B;  1ILP A;  1D5X C;  1HUN A;  5CC4 A;  4OO1 H;  4BY7 B;  2J7Z A;  5KIX A;  1RDP D;  4QMG A;  1WTV A;  1DOM A;  3M4Y A;  2X6G A;  3U9S A;  2VUM B;  1IYU A;  4EVO A;  4HMI A;  1MI2 A;  5A2Q E;  4BY1 B;  3D4D A;  5AFW A;  2FFK B;  4ZAI A;  4KY7 A;  2BA0 A;  2KEE A;  2NBF A;  1ILQ A;  4A3F B;  5LHY 1;  1OXT A;  1O7Z A;  4G7H C;  3IFD A;  4BWG B;  4IZ8 A;  1QJO A;  1WD1 A;  5M3M B;  3A8K E;  1YNN D;  2E76 C;  4R8N A;  2WKD A;  5J39 A;  3G7L A;  3S2D B;  5FK9 C;  2H4O A;  2A6H C;  1AN8 A;  2JYO A;  2D2C C;  3BG3 A;  4DXF A;  1DD2 A;  2Z4H A;  4CJ1 B;  1D1K A;  1A3V A;  5LL6 X;  3K0Y A;  4RHS A;  3KLS X;  1SEB D;  1JWU D;  3TZD A;  1JOR A;  2PMZ B;  1AZQ A;  4ZLT F;  2A5H A;  1R4Q B;  1E2W A;  5C4J B;  4A3J B;  3HP3 A;  2F0D A;  4XT3 B;  3S1M B;  5D3I B;  2NZ1 D;  1CZG A;  1DJR D;  4HN7 A;  3NPP A;  4YIJ A;  2XRS D;  2NN6 H;  1TWH B;  2F1M A;  1LT5 D;  4UAI A;  3D6W A;  1W6J A;  4IUN A;  2A73 B;  3DMU A;  2ID0 A;  1GUS A;  4CKB A;  2R7Z B;  1NSN S;  5IGC A;  5F2D A;  3RMH A;  1GUN A;  1A3U A;  3PIO 3;  4C1N K;  4HED A;  5IIF A;  1IKM A;  4C3I B;  1VF7 A;  4B08 A;  3NP8 A;  4ZUJ A;  4BA1 I;  2OXP A;  4TKO B;  2A6E D;  5KGU A;  3M7G A;  1EEI D;  5BN5 A;  1NUC A;  1QB5 D;  3DEO A;  3L9A X;  3K5L A;  3C1F A;  1EY9 A;  2JA5 B;  2K32 A;  1S4Z A;  3OHX C;  4M8A A;  3EQL C;  1EOT A;  4U68 A;  5CBE E;  2B8F A;  5CV9 A;  1BOS A;  1QIL A;  4J6H A;  4IFD H;  2AWN A;  1ICW A;  5C3E B;  4DF7 A;  5C5L A;  2FMC A;  3IAY A;  1B3A A;  2BA1 A;  5C0X I;  2XN9 C;  5DM6 3;  3S2H B;  4H0L C;  3CU7 A;  2F0H A;  4IQZ A;  1Y1V B;  4TQU S;  1PTO D;  3T4A C;  1KLG D;  5EKI A;  1SE3 A;  5M5W B;  1CM9 A;  2PZU A;  4RAU C;  4RGN A;  2A69 D;  3KBG A;  1G6Z A;  3MEH A;  2DN8 A;  3BDC A;  3MFY A;  3CQZ B;  1NCV A;  1HPC A;  2NVX B;  1SDF A;  4XIG S;  1YNJ D;  1WTQ A;  1IL8 A;  4ZRZ A;  2RSO A;  1XTC D;  1ET6 A;  1WVL A;  3RZD B;  4IFD J;  3I4L A;  2WV6 D;  2NB0 A;  3NE5 B;  5T1G A;  3I4N B;  3LWE A;  1SJE D;  3P7J A;  3OSO A;  3NXW A;  5M3F B;  2SNM A;  4IUU A;  3LNN A;  3L3O C;  1LTB D;  3SXH A;  2B2T A;  2BOS A;  5FLX E;  1UEA B;  3S14 B;  1GOZ A;  2ICI A;  2RSN A;  2F0W A;  2EE1 A;  1TS3 A;  3Q6S A;  1QNK A;  4V19 0;  4C3J G;  1HFG A;  1S5F D;  3D8G A;  5G3L F;  3V2T A;  1BR9 A;  4EQO A;  3BYT B;  4ID6 A;  3I3C A;  1I50 B;  2F0G A;  4RHR A;  1D5Z C;  2R6G A;  3SEB A;  1STY A;  3DWA A;  4F88 A;  2SEB D;  4QUF A;  2RA4 A;  2XWB B;  3SK4 A;  2F0K A;  2CQA A;  4OIK A;  2B2U A;  3FPU B;  1S5E D;  1C48 A;  3BS1 A;  1EY5 A;  3TP6 A;  1IW7 C;  2E2D C;  3BVZ A;  5FOB B;  1BCP D;  1C8C A;  5K36 G;  3HOU B;  4ZQ3 A;  3HS0 C;  2AQ3 B;  5I6Y A;  1E0B A;  3NTK A;  1GJX A;  3K5N A;  4DGZ A;  3NTI A;  3S1Q B;  1A15 A;  5ISR A;  2CW0 D;  1GHK A;  2F0E A;  1EIH A;  1RCV D;  1VMP A;  3GTK B;  3OWE B;  1I3Q B;  3PUW A;  1G2T A;  1STE A;  3JAM L;  4XYQ A;  1FR3 A;  2LMC B;  1Y8N B;  1J9O A;  3X3M A;  4OHJ A;  2PO4 A;  2F0O A;  1WTO A;  4RH6 A;  5E1F A;  4JBW A;  4KN4 C;  3W3A A;  1CT1 D;  3TDQ A;  1BF4 A;  1STN A;  4X3U A;  3FRP B;  1A2T A;  1L0X B;  1TS5 A;  5ELE A;  1TWA B;  1WD0 A;  2B2Y C;  1GUW A;  2ICE C;  1M8A A;  2KQ3 A;  1KAB A;  2EVB A;  3GTJ B;  3KBX A;  1HTL D;  2WII B;  5BN4 A;  3H94 A;  2LKV A;  2K01 A;  5JEA H;  4FO2 A;  2A69 C;  4BA2 I;  2RDF A;  4OO1 G;  1OXU A;  4OGQ C;  4KHZ A;  5DEH A;  2DNE A;  3AU7 A;  1A2U A;  2MHV A;  5KYI A;  1F2Y A;  4KTA A;  2WB1 B;  2RQX A;  4KD4 A;  2D62 A;  1UNS A;  4DNR B;  2IX0 A;  5IGF A;  1SND A;  2EXZ A;  3OPO A;  4DK0 A;  3R8B A;  2LS0 1;  3MVV A;  3D31 A;  5DAU A;  2ENB A;  4L8J A;  1B4O A;  1KDC A;  4DU9 A;  3J7A V;  2K5W A;  2IL8 A;  1EEF D;  2QIL A;  1VF5 C;  2PW7 A;  3SDZ A;  3R2T A;  4Q0F A;  4A3M B;  2A6H D;  5EBD A;  3R93 A;  1Q8I A;  3VYT A;  1I6V C;  4XQQ A;  1FNV A;  5E3F A;  4BBR B;  1WTW A;  1CHP D;  4HAE A;  3SK6 A;  3VA7 A;  5JEA J;  2IWH A;  5M5X B;  2JP1 A;  2WIN B;  4K2L A;  5CV8 A;  2Z1C A;  1MBY A;  1CTM A;  1I4X A;  1SYF A;  1EY4 A;  2NN6 I;  1ZYR C;  1I4P A;  5KNB A;  2F0U A;  2Q8T A;  5FLX L;  2MUY A;  1BCP B;  5K36 H;  3S17 B;  1GUT A;  4KMU C;  4DAP A;  4ULL A;  1VDZ A;  2OT2 A;  4IAL A;  1BCP C;  2AWO A;  1NAP A;  5HUR A;  4ILW A;  1R9T B;  1EY7 A;  1PZI D;  2L5T A;  5CMD A;  3BYY B;  3S16 B;  1TY2 A;  5I6W A;  2DY7 A;  2R93 B;  5EQ0 A;  2EY5 A;  3MXP A;  3A8I E;  1FYC A;  4K6L A;  1H9M A;  1XWE A;  5FO9 B;  3OWF A;  1LAC A;  1SAP A;  1B9M A;  1LTT D;  1EWH A;  2VB2 X;  3HEJ A;  4LAA A;  5IOD A;  3I72 A;  1F77 A;  2EYF A;  3ND9 A;  2NVT B;  2E75 C;  4FXK C;  1II3 A;  1SNC A;  2QF7 A;  3K59 A;  5D3D A;  1TWC B;  3HG9 A;  5D14 A;  3DUZ A;  5JVH 3;  1STB A;  1SE2 A;  4C3I G;  5ELB A;  3GTP B;  1U4L A;  4IFD G;  2PZT A;  3S15 B;  1UUP A;  5M9O A;  3H09 A;  3A55 A;  4HSV A;  2SDF A;  3V96 A;  2K03 A;  3GTM B;  3ITP A;  2HCI A;  5IGB A;  4ABN A;  1TY0 A;  3MZ5 A;  3M4O B;  1X3P A;  4H13 C;  3GV3 A;  1LO5 D;  1PZK D;  1H9S B;  1LLR D;  5IGE A;  2K1B A;  2GA4 B;  5TSS A;  2K33 A;  4IUR A;  1HA5 A;  1KDB A;  1LTI D;  3TN2 A;  3BVM A;  2J0T D;  4PQX A;  3J80 L;  3GTG B;  1SE4 A;  3OIQ A;  1PFM A;  3D4R A;  1O80 A;  4X3K A;  4JK1 C;  1ML0 D;  2F3W A;  1B44 D;  5E4W C;  3T51 B;  4FP5 D;  4KKT A;  4CHT B;  1TS2 A;  1K8O A;  5I2Y A;  4WRD A;  1BBX C;  3GO5 A;  1EU4 A;  2G9D A;  3ERO A;  1ZKO A;  1U4R A;  1SYB A;  3PV0 A;  1B2T A;  5CR3 A;  3CRL C;  2EPB A;  5EPK A;  2WAC A;  4LJZ C;  4CKC A;  3MTS A;  1LT3 D;  2QEJ C;  1PRT C;  1ENC A;  3NSW A;  2EYH A;  4MHE A;  3KF8 A;  2O5I C;  3Q22 A;  4RKB A;  1E2V A;  2HCC A;  1MGS A;  1PTO F;  3PMF A;  4XT1 B;  1DZ1 A;  5EGT A;  1WTX A;  1S5C D;  2NTS A;  2FHT A;  2NTT A;  4HR7 B;  5C3W A;  1EFI D;  4F8M A;  1F9Q A;  1Q1E A;  3I4M B;  2AQ2 B;  4V0B A;  2A74 C;  3Q24 A;  1STH A;  4FF4 A;  5C44 B;  4IUT A;  3N6R A;  3G6J B;  1NR2 A;  1RKN A;  3LWU A;  1IW7 D;  3RLF A;  1JWM D;  4K8J A;  2L0C A;  2AUK A;  3A54 A;  3A7A B;  3K7A B;  5EKK A;  1ENA A;  4B9X A;  4O42 A;  4C1N I;  3NBI A;  1K83 B;  4CBV A;  3Q0A A;  1K8M A;  3AMU A;  2EY1 A;  2WP8 J;  1Q3L A;  1FNU A;  3S1N B;  3M85 A;  1FNW A;  4M1U B;  5JOB A;  4LK1 C;  2KUM A;  5JVG 3;  4S3S A;  5I9P A;  3QG1 A;  2IT1 A;  1CZW A;  4A3G B;  1BUV T;  4DA2 A;  4ZYS A;  4Y7N B;  5C3X A;  1JIC A;  3NBH A;  4WOR A;  1AEX A;  3DHQ A;  5EKL A;  2Z8L A;  1F9R A;  2E74 C;  1Z7T A;  1RTN A;  1G91 A;  4QUC A;  1QOH A;  2F3V A;  3PIP 3;  1MD2 D;  3VR5 A;  3MXN A;  3IKJ A;  1BDO A;  1VCI A;  2XNA C;  1SJH D;  5JEA G;  1DCZ A;  4G7O C;  4FVM A;  2JE6 I;  2SNS A;  2EJG C;  1X32 A;  2EYM A;  2AUJ D;  4X3S A;  2L11 A;  2EOT A;  4QCL A;  3K57 A;  1T5E A;  5A2Q L;  4HMJ A;  4ZKC B;  2D5D A;  4MIU A;  3ND8 A;  5J22 A;  4FNF A;  1F9S A;  4ODG A;  3QWN A;  2E2J B;  4K5V A;  4NW2 A;  1PMR A;  1IYV A;  3L7Z C;  2B2V A;  4A3K B;  1PRT B;  1QG7 A;  1TWG B;  4DN4 M;  1JOK A;  4J8Q A;  3C46 A;  2O2L D;  2RKS A;  2PZW A;  3SHL A;  3GTO B;  3CKI B;  4I65 A;  1STG A;  1RF2 D;  3GTL B;  4BBS B;  3T13 A;  1I6H B;  3OOC A;  1IKL A;  2EYO A;  1EIG A;  1ZYR D;  2WKC A;  5CV4 A;  1ESF A;  1LV9 A;  2MPM A;  3HZX A;  3VR6 A;  1RTO A;  3EA6 A;  1XXG A;  3D4W A;  1KDA A;  4K2K A;  1SYD A;  2KCN A;  4KJO A;  2B2W A;  2IX1 A;  1Q1B A;  2B2T C;  2EY2 A;  1TKW B;  1S5B D;  1EL0 A;  3LX0 A;  4H44 C;  4RKL A;  2KCC A;  4KKS A;  1DOL A;  2B2V C;  2M9V A;  1SNP A;  2F0F A;  1EU3 A;  3VR2 A;  1G29 1;  1KNA A;  1JQY D;  3Q23 A;  4PNY A;  3N52 A;  4H7B A;  4WJW A;  2C5C A;  4XQN A;  1D5M C;  4FYD A;  1HRJ A;  1DXM A;  4PV1 C;  3VR4 A;  1XYI A;  2RVL A;  2Y0S B;  3VYU A;  1RHP A;  1KNE A;  2F0N A;  1U4P A;  2C9O A;  3A56 A;  5HGT A;  3EFX D;  3GP7 A;  3I70 A;  2B2U C;  3K5O A;  4N9T A;  1TVX A;  3H0G B;  3S9W A;  3FMC A;  2B2W C;  3BVG A;  5KNC A;  1L0Y B;  4K6D A;  1HHV A;  4OO1 I;  5C0X H;  1WTP A;  5C4Z A;  2F0M A;  2NUC A;  2JEA I;  4EQN A;  1JCK B;  3FPP A;  4HTH A;  3DEP A;  4N9P A;  1B9N A;  4LMQ D;  4B9W A;  1I4G A;  4TRD A;  5C5M A;  5CYU A;  4RA8 A;  4KJN A;  3ONA B;  1UAP A;  1BXT A;  1MSG A;  4R8I A;  3DM1 A;  1EY8 A;  2EY6 A;  1KLU D;  3R3O A;  3HOY B;  3OIP A;  2Q8I B;  5CV6 A;  4ZK9 B;  1M4V A;  1V43 A;  3HOX B;  2OEO A;  1BQQ T;  1KAA A;  3PUV A;  5A35 A;  1Z6H A;  3K6O A;  3MXU A;  4Q5V A;  1O78 A;  2K28 A;  4O1N A;  1PYW D;  2MJ8 A;  2IW3 A;  4WFN 3;  1KTK A;  3V05 A;  5C0X J;  2ZXR A;  4NDX A;  1V8Q A;  3MFG A;  2F0T A;  3PO3 B;  4XXE A;  3P75 A;  2KEC A;  5I4D A;  4K5X A;  2PPB C;  4RWS C;  3PUY A;  3EVQ A;  3VR3 A;  1HFN A;  4PMW A;  2L55 A;  4ZKB B;  2KHS A;  1JE4 A;  1HCZ A;  2EJM A;  3C3L A;  2JA6 B;  4U67 3;  2XSC A;  3EJI A;  2F0S A;  2K7V A;  1V1P A;  1Z47 A;  1HA6 A;  3WOE A;  1F9P A;  5JPM C;  1OXV A;  5D65 A;  2PYK A;  3MWY W;  1JB3 A;  5FO7 B;  3TZU A;  3K58 A;  3E0J A;  3KUP A;  1GUG A;  4L63 B;  1SNM A;  3AB9 A;  5IGD A;  2F0V A;  4KY6 A;  4KKU A;  2I46 A;  2L9H A;  2B39 A;  1O7Y A;  3TSS A;  3I73 A;  2VXW A;  4QB4 A;  3S1R B;  1TII D;  1CA5 A;  3CHB D;  1CA6 A;  2AQ1 B;  1V1P B;  4X3T A;  3TP8 A;  1LT6 D;  5FKA C;  3WDN A;  4IFD I;  3HOZ B;  4KY5 A;  1C4Q A;  5KND A;  3J7A F;  4P2C B;  1DOK A;  5ELD A;  4Z9C B;  4KN7 C;  2E2H B;  2FJ2 A;  3KK7 A;  2XVS A;  1DM0 B;  1ROD A;  1CHQ D;  2YYZ A;  1LT4 D;  1SSO A;  4KK7 A;  2O4X A;  5E4X A;  2Q8R E;  3T56 B;  3HOW B;  3C1E A;  4IUQ A;  2QDB A;  2YU9 B;  1G2S A;  4OIJ A;  2JA8 B;  4FXG C;  3BDO A;  4K5W A;  3DWQ A;  3H3V C;  1E2Z A;  5K5P A;  5CV7 A;  2KED A;  1QE6 A;  4DAY A;  3I8Z A;  2F0J A;  1AFP A;  1V1O A;  3GQB A;  2NWG A;  4EQP A;  4DXG A;  5BN3 A;  3P20 A;  1Y1W B;  4FF3 A;  1JOQ A;  1F2L A;  5CBA E;  1R4P B;  4K14 A;  2NVY B;  3QJY A;  4K8I A;  4MN3 A;  3F2U A;  4ZUI A;  1A3T A;  1ET9 A;  3KLR A;  2RDG A;  4C3H B;  1GHJ A;  4IN3 A;  3VA5 A;  3ERQ A;  3MHB A;  3PUX A;  2R61 A;  3D6C A;  5J1Z A;  3FKI B;  5I2X A;  3J7Y W;  5EPL A;  1PRT D;  4RCO A;  1BNZ A;  1OXX K;  3IL8 A;  1H9R A;  4HCS A;  1ONL A;  2JSO A;  1HQM C;  1F2Z A;  2PCF B;  1SNO A;  2ZXO A;  5DNF A;  3HRZ C;  3MXG A;  1PFN A;  1OO9 B;  1D1I A;  2BE5 C;  2KJX A;  3SVM A;  2F03 A;  2A68 D;  2CHB D;  2MGS A;  3NK9 A;  4A3I B;  1X3Q A;  4DFA A;  4A93 B;  3QB3 A;  1FGB D;  3TBI B;  2K05 A;  2L1B A;  4AYB B;  3UI2 A;  1LTR D;  3JAM E;  2K04 A;  3O13 A;  2I07 B;  3BDL A;  4XTC S;  1CFM A;  2RBM A;  1QCB D;  1DON A;  4ME5 A;  2DNC A;  3MAQ A;  1Y8P B;  1W6K A;  1JC7 A;  3MC0 B;  3QOJ A;  1TS4 A;  3NUC A;  1CK1 A;  4NMZ A;  2NYZ D;  3DXJ C;  3HOV B;  1ZEQ X;  2IJ0 A;  2EZV A;  2TSS A;  3QOL A;  1ZXT A;  3OMC A;  2H1E A;  5IOC A;  1I4Q A;  1PDQ A;  1QNU A;  3H6M A;  4DAV A;  3GD7 A;  1H9J A;  3FEW X;  4DK1 A;  3TP5 A;  2B8G A;  5DM7 3;  4G4K A;  4NP5 A;  5JAV A;  4IUP A;  5C4H A;  3VYR A;  1ESR A;  5C0X G;  1BCP F;  1LTA D;  2F0I A;  5IT9 E;  2OF1 A;  3K5M A;  1WTR A;  2XRQ D;  4G7Z C;  3A7L A;  5IGG A;  3URY A;  2EYJ A;  2K5D A;  3NTH A;  3J81 E;  4FF2 A;  4KV6 A;  5I9O A;  1JWS D;  4XYO A;  2K6A A;  3TME A;  5JJZ A;  3P1H A;  2PQE A;  2HUG A;  1SBB B;  2HDM A;  1EY0 A;  3NWS A;  3OMG A;  4RGM A;  2KA7 A;  3FDT A;  2RDH A;  1YNN C;  1EYA A;  1B53 A;  5CV5 A;  1XX8 A;  1S5D D;  4C56 C;  2EDG A;  1TQO A;  4UDU C;  4KD3 A;  3QO2 A;  4EGV A;  3U9O A;  4BS9 A;  1U4M A;  1TT2 A;  3DWP A;  1HUM A;  2J4X A;  1H9K A;  3GTQ B;  2NVQ B;  3X3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...