4KY6A

Crystal structure of staphylococcal nuclease variant delta+phs l25d at ph 6 and cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKDMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L25D at pH 6 and cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ky6A00
1SNMA 4ID6A 2QDBA 4ZUJA 3S9WA 1EYCA 5EKKA 3EJIA 1SNDA 4K8IA 4KTAA 5CV7A 1EY0A 1SNOA 3DHQA 4J6HA 5CV4A 1EY9A 2OEOA 5IODA 4ME5A 3NXWA 3QOLA 5C3XA 4EQPA 2F0NA 3MEHA 4KJNA 5IIFA 3NUCA 1TR5A 5C5LA 2PZUA 2HQEA 2F0FA 2F0QA 4KD3A 4K8JA 3TMEA 1A2TA 4K5WA 3PMFA 3TP6A 3ITPA 3D4WA 2EYOA 2F0JA 5IGEA 1JOQA 2F0VA 3SK5A 4F8MA 3SXHA 1KDBA 4B9WA 2F0LA 4QF4A 5HURA 5K5PA 1SYFA 2F0DA 3NP8A 5E1FA 4DF7A 5CV6A 1EY5A 3BDLA 2F0WA 3ERQA 4IALA 5KEEA 4ZUIA 1SYDA 4B9XA 1A3TA 3TP5A 1EY7A 1EZ6A 1KDCA 4NKLA 3SK6A 4EVOA 5IGBA 1SNPA 1JOOA 2F3VA 2WACA 4WRDA 4K2KA 4YIJA 1EZ8A 2PQEA 3R3OA 4KJOA 5IGCA 3OMCA 3OWFA 2F0PA 3SK4A 2EYHA 2EXZA 3H6MA 5CR3A 4PNYA 3SR1A 5ISRA 5DAUA 3HZXA 4J1MA 4KY7A 4ZQ3A 4IUNA 5E3FA 5F2DA 5KGUA 2SOBA 4ODGA 3QB3A 3C1EA 3OMGA 2EYLA 3BDCA 1A2UA 5NUCA 1TQOA 4K14A 3SHLA 4HTHA 4HMJA 1EYAA 3MZ5A 1EY6A 5JOBA 4K2LA 4PMCA 3D8GA 1EY4A 1A3VA 2RDFA 3E5SA 2F0SA 4IZ8A 2KQ3A 1EY8A 5C5MA 5KYIA 3OSOA 4LAAA 1U9RA 3P75A 2F0GA 3LX0A 4K6DA 4DFAA 2RBMA 5I6YA 4EQOA 1EYDA 4R8NA 5J1ZA 3MVVA 5M9OA 4K5VA 2PZTA 1ENAA 4KY5A 4NDXA 5HGTA 1SYBA 1NUCA 2F3WA 2OF1A 2PW5A 4KV6A 4QMGA 2EY6A 4KD4A 4KHVA 3NQTA 4I65A 4NMZA 4H7BA 2O4XA 3RUZA 4EQNA 5C4ZA 1JORA 1II3A 1SNQA 3QOJA 3V2TA 1SYCA 1TT2A 5I9OA 5KIXA 2F0OA 1SNCA 2KHSA 3D6CA 2EYMA 2PZWA 5DEHA 5IOCA 4NP5A 5CV9A 1F2MA 2F0UA 2F0TA 3TP7A 2PYKA 3DMUA 5CV5A 2SNMA 1KAAA 1F2YA 1STHA 2EY5A 5IGDA 2F0HA 3P1HA 2M00A 4G57A 5EGTA 5J39A 5KRUA 2F0EA 5IGGA 5J22A 1RKNA 2EYJA 2RKSA 1STYA 5CV8A 5I6WA 4MIUA 2F0KA 1STAA 3SK8A 2EY1A 1STBA 1A3UA 4RKBA 1KDAA 2OXPA 3C1FA 1STNA 5C4HA 5I9PA 4RKLA 4PMBA 2PW7A 2F0IA 5C6AA 2NUCA 1F2ZA 3D4DA 2EYFA 5JAVA 2SNSA 4K5XA 1NSNS 3NHHA 3T13A 4F7XA 5EKLA 3T16A 4OL7A 3MHBA 4WORA 4QB4A 1AEXA 3NK9A 2EY2A 5CGKA 5KYLA 1JOKA 1SYEA 4E6IA 4HMIA 3VA5A 1IHZA 1SYGA 3MXPA 4DGZA 4S3SA 1KABA 2LKVA 3EVQA 4N9PA 3TP8A 1STGA 5C3WA 2F0MA 3HEJA 1EQVA 5IGFA 2EYPA 1ENCA 3EROA 4KY6A 4DU9A 2ENBA 3U9OA 5CC4A 4TRDA 4N9TA
chains in the Genus database with same CATH superfamily
4C1NK 1K28A 4ID6A 3S14B 1GOZA 1MJCA 4J6HA 2NVQH 3GTQB 4QJFA 4TSSA 4IUUA 1WTWA 2I46A 4AYBE 4A3EH 2F0LA 4QF4A 4APVA 4DAVA 1E3PA 5L37A 1I3QH 1UUPA 2JE6I 4ZUIA 1PTOF 1GXDC 4B3SQ 3GTQH 3SK6A 3ND9A 1JE4A 4P72A 2IX1A 1D5MC 1UE1A 3RLNA 3K59A 2UXCQ 4HJ7A 1CI3M 3QB3A 3A7LA 5JEAJ 4OIJA 2KBNA 2KECA 4K14A 4R4TA 4HTHA 1N8RC 2KCNA 4PMCA 4Z9CB 2ZT9C 3E5SA 1I4XA 5D14A 4JK1C 3Q23A 4A3LG 3LX0A 4K6DA 3KDFB 2NZ1D 2MO0A 4DNTB 4A3FG 2B2YC 1GUNA 3CU7A 3DWAA 1L0WA 3VR5A 4A3JG 4YHHQ 4GLXA 2LXKA 1ET6A 2AQ2B 4BY1B 1HFNA 2JA7B 3W2DA 1D5XC 2RHSB 1ICFB 3BVGA 4JI4L 2M00A 4JI4Q 2ZM6Q 4BS9A 3A56A 3HOZB 1JWSD 1KNEA 1VCIA 5IE8A 2PMZB 4X6AH 4RCNA 1O7YA 4QL5A 1HNXQ 2C9OA 3JAMc 3C1FA 3NWTA 1VF5C 1VQJA 2I07B 3K57A 2X6GA 4NXNL 2F0IA 1Y1WG 4PZ7A 4K6LA 1F2ZA 4BY1H 3HOUH 4UAIA 2JA7H 3S24A 4CJ0B 3HKSA 4BXXG 2GN5A 3KJOA 4DAYB 1F2LA 1K3RA 3HOZH 3PUYA 1IHZA 1WVLA 3HKZE 1PYWD 2SDFA 4KMUC 1BO0A 1SR3A 3PGZA 2I0QA 2MGSA 2VQEL 2K52A 2Q2HA 2VQEQ 5CV7A 5CBEE 4MHEA 1CKNA 1EUJA 1X3FA 1Y8OB 4HSPA 1PRTC 2KOLA 2ZXOA 2HIXA 2PZUA 4RAUC 3GTMH 5C0XH 1GUWA 2F0JA 3M7GA 2R61A 4DR3Q 3V05A 2QA4A 3HOVG 5M3FG 1QG7A 4XT1B 2K5HA 2F4IA 3GTJH 5EPKA 1PHJA 3ND8A 4DAYA 1KD1C 3UDXA 4DV5Q 1KLUD 2K28A 4R1JA 1CFMA 2GVBA 4JOIC 2KCMA 2KHJA 4A4IA 1TWAB 3SR1A 5COYA 1K0SA 2IX0A 2SOBA 5C4JH 2K01A 2B2WA 3NE5B 2L1BA 3E0EA 4MTKA 2N88A 3MZ5A 5BN3A 2B29A 2R6GA 4CDDC 5DLQE 4BBSB 1CHPD 5JVH3 1H9MA 1IL8A 1HXYD 3S2DB 2HQLA 3GV3A 1JQYD 3MVVA 4K5VA 1CKMA 1TWAH 5HGTA 4YY3L 1X55A 4YY3Q 5EKIA 1ILPA 3UE1A 1BR9A 4IQZA 3V2TA 4GNXC 4KI0A 1K8GA 2WAQE 2YV5A 5CV9A 2JYOA 3TP7A 1QILA 5JJLA 3CCSA 3I70A 5TSSA 3MC0B 1SFOH 4DNRB 1PDQA 4LK1C 1A8VA 5J39A 5D3IB 1Z9FA 3AEVA 2L5TA 1DCZA 1SMYC 4U673 1N34Q 3RLOA 2RDHA 1QNUA 1LM0A 4JG2A 2JJQA 3HS0C 4LUVA 2F1MA 1MIUA 2AMCB 1XYIA 3URYA 4Y7NB 2R92B 4K5XA 4X3KA 2IHFA 1SN8A 4A3GB 5IYCG 3QIAA 2NN6H 4R4OA 5KYLA 3BS1A 4HMIA 3HP3A 3RR5A 2F3IA 2NVYB 2VS1A 2QGQA 3T51B 4IFDG 5BR8L 4OO1G 1VQHA 5BR8Q 5LMUQ 3ICEA 4Y7NH 4H44C 1HRJA 2X6LA 4IUTA 3SEBA 4HEDA 2Q8TA 5LMNQ 2PO4A 2E8GA 2R93B 5A35A 4HAEA 3UDGA 3CF5A 4K8JA 1FD7D 4IO9A 3FMCA 4FP5D 5C4XB 2NVYH 5K36G 2PNRC 1F9RA 1AE3A 3M4QA 1EY5A 1ZKOA 1SYDA 3AFQA 4OX9L 1EZ6A 4OX9Q 1Q90A 2R93H 4HJAA 1V1QA 3SDZA 3KF6B 5C4XH 4OWXB 3SK4A 3CMEA 1HCZA 2EXDA 3U4ZA 1WJJA 5M3MG 3IL8A 3C3LA 4JV5L 1H9SA 4IUNA 4JV5Q 4EGVA 3BDCA 2EZVA 3WWVA 2HDMA 1I4QA 4DXGA 1LTAD 1NR4A 1A3VA 1NAPA 3GDEA 2KCTA 3GQBA 3IFDA 3NTHA 3ONAB 3BYTB 1X9NA 4C2MB 2PCFB 4G7OC 1NJIC 2B2VA 5HGQA 3H15A 3UDIA 3PSIA 4XDXA 4JI3Q 3R2IA 2ID0A 1SYBA 1SSOA 1ENFA 3ULJA 4QMGA 4KHVA 2B8FA 3PO3G 4GOPB 3D6CA 1IKMA 3EQLC 2BDNA 4RA8A 1I4RA 1KRTA 1E22A 2PYKA 3DMUA 2MQHA 4C2MH 2SNMA 3I3CA 4G57A 1EWIA 3CCVA 4ZRZA 1VS0A 2SEBD 2EYJA 1BCPF 1D1IA 2EY1A 2MJ8A 1Y14B 3PIO3 4B3MQ 4UPAA 1FGBD 3S16B 2N8NA 3T16A 2WINB 2H1EA 1TWCB 4F88A 1BOSA 1CKOA 2K5WA 1B7YB 4JYAL 4JYAQ 1FVIA 3W5OA 4GOPA 4XT3B 2ENBA 3IRBA 5DM73 2ZXPA 3GP7A 1OXTA 4JBKA 1SBBB 4L63B 3S16H 3EJIA 2RQXA 1LTTD 5IYBH 1TWCH 3VA7A 1PH9A 2I5LX 2FMCA 2VW9A 4ALPA 1Q82C 1HTPA 1SYFA 3KYHC 2H4OA 1EEID 3S2HH 4P2CB 3R93A 1L1OA 1HNZQ 1GUGA 4XQJA 5ELBA 4CJ2C 3HOXG 5IGCA 3OMCA 2P5ZX 1PRTD 1LTLA 5C0XI 2VZAA 5DM63 3NELA 2C35B 3CW2C 3HZXA 3K7UC 1BVSA 3CAMA 2EPBA 4XIGS 4B3RQ 1EYAA 3FPUB 1EY6A 3STBC 3PIP3 1BBXC 2JA5B 4G7ZC 1VQAA 2F0SA 3BZKA 3S15B 4LF6Q 4R4IA 2VXWA 3F2DA 2E2HB 3DWPA 2NYZD 2E2IB 3U50C 2PW5A 2NWGA 4KD4A 3RUZA 4B08A 2O4XA 2RDGA 1VQLA 1V1PB 2YTVA 4UY8C 4BWGB 2UXDL 1SRUA 1CSQA 1BKBA 1Z47A 2UXDQ 2JXMB 3Q24A 2WFWA 2XNAC 1VQKA 1F2YA 2E2HH 4X66Q 3WDNA 5EGTA 1WCMG 3CCMA 1SEBD 5FO7B 1RTOA 1STYA 2XRQD 5I6WA 1PZJD 5BN4A 2N49A 4DUYL 2EQSA 4DUYQ 1XMQQ 4HJ8A 4PMBA 4PMWA 3ER0A 4BA1I 4A3DB 3HOYG 5IP7G 2IY5B 1E1OA 4QIWE 1PRTB 4OXPA 5I4DA 2EY2A 4X3TA 5DNFA 2NB0A 2TMPA 3IAYA 1HA6A 1SMYD 5IGFA 1G291 2X69A 5D3DA 1H9JA 1I4PA 3D0FA 4IFDI 4OO1I 1YNXA 1SDFA 2PQAA 1C9OA 2E75C 4KD3A 1N32L 4CKCA 1N32Q 3EFXD 1U4PA 1CSPA 3NEMA 3SK5A 3R2TA 4DR2L 2D0OA 1B2TA 2F0DA 3BG3A 2WB1B 4DF7A 1TWGB 4LFAQ 2XWJB 1G8ZD 3J80E 1A3TA 3I72A 3TP5A 1EY7A 5J3BA 3U4VA 2JK8A 3GTLB 1B3AA 4RH6A 3KF8B 2VUMB 4XQNA 5AFWA 2ALYB 2Q2TA 3E9IA 2EYHA 1FR3A 1NY4A 1H9KA 5DAUA 3A7AB 2EJFC 3U58A 3L2PA 1TWGH 4A3IG 1KXLA 5FJ8G 4WJ4A 2EIFA 3GTLH 2KQ3A 1EY8A 1HZBA 2IJ0A 3VDYA 3NENA 2UUCQ 3BJUA 2MO1A 4ZKBB 3AYHB 4JOIA 2KA7A 2F3WA 4P75A 2A8VA 2MUYA 1O78A 3QOJA 1N36L 2KHSA 1N36Q 5C3EG 1X3GA 4NP5A 2Q8IB 2KENA 1ONLA 4K0KL 4K0KQ 1EU4A 3MA2B 1TS4A 4AYBG 2Z6KA 3OWEB 2JA6G 4OHJA 3TZDA 3KF8A 3FVQA 1S3OA 1B50A 3FHWA 2DNEA 1CHQD 5IGGA 4JBMA 1QVFA 1K8AC 4C3HB 2NBFA 1LT3D 1S5DD 4PQXA 4C1NI 2BCOA 5G3LD 2OCEA 5EJWA 1U0LA 2HUGA 1B44D 4GKKQ 4I7ZC 3BZDB 3RLFA 1CT1D 2GA4B 1YHBA 3BYYB 1DD2A 4CBVA 4C3HH 4DV7L 1SYEA 2IL8A 3SGIA 4DV7Q 3MXPA 1VMCA 5C3WA 3HEJA 1EQVA 1ENCA 1BF4A 2LXJA 3PO2B 3TS0A 4ILWA 2QDBA 4RGMA 4K8IA 3I4NH 1N33Q 3U9SA 3QOLA 2NVXB 4YWMA 3J81i 1CA6A 1A2TA 5A2QL 1TKWB 4XTCS 2EYOA 3N52A 1DXMA 2XVSA 3HOWG 4KK7A 4DV3Q 4CDEC 4C56C 3GO5A 4EQ5A 2NVXH 3AQQA 1JOOA 4X62L 4JI1Q 4X62Q 1Y8PB 3G48A 1I3QB 2CW0C 3PCOB 5T1IA 2JN4A 2O5IC 1QCBD 1GUSA 1P16A 2MPMA 1LACA 1QZGA 3I4LA 3KBXA 1G2SA 4OGQC 1H95A 3CCLA 2NVTB 1PH4A 1XWEA 2R3ZA 4A93G 3M9BA 4LAAA 4A3FB 3GD7A 4DK1A 2F0GA 3HKZG 3T1YL 3T1YQ 1UEBA 5GAEC 2N3SA 1RL2A 4LF8L 2K05A 3G6EA 1Q8KA 4LF8Q 4A3LH 2OQKA 2Q8RE 1K73C 1PV4A 1DGSA 1WD1A 3J7YW 2WKDA 4OWTB 2CCZA 2NVTH 2F0OA 3OIQA 2EYMA 2CVRA 1D5ZC 1PFMA 1VF7A 2WKCA 4A3FH 4C3IG 3I73A 1BQQT 3STBD 1LTID 5LMNW 4A3JH 5H1SE 3P1HA 1Y1WB 3VYTA 1K0RA 2RKSA 1B70B 3H91A 1HUMA 5JEAG 3QJYA 1I4GA 1JJCB 4DV6L 4A3MG 4DV6Q 1B3QA 2DN8A 3KFUA 5JAVA 1NSNS 1OXXK 3OPOA 3ZJYC 1WI5A 2R7ZG 2B63G 1YVCA 1Y1WH 2B2UC 4DNIA 1M90C 4CGYB 3HOUB 3MTSA 2XTIA 3CPFA 4BXXH 1ET9A 3S1NH 4HSVA 2F0MA 1TS3A 4O1NA 1N9WA 4N9TA 4ZUJA 5JVG3 1G2TA 1IW7C 1PMRA 2BH8A 4DR6L 3M85A 4PZ8A 5M3FB 4NXNQ 3HOVB 3H3VI 1GHKA 1CQFA 3CCUA 1A6XA 3TMEA 3DM3A 1E24A 2YYZA 3H3VC 4BY7G 4DK0A 1B4OA 3KDFA 3K8AA 3SXHA 5EPJA 2WAQG 3LNNA 3GTMB 3CC2A 5CV6A 4DR4L 2F0WA 3ERQA 1XPRA 4DR4Q 1HQRD 4EVOA 5IGBA 3L0OA 3CRKC 2F3VA 3HOVH 5M3FH 1X3PA 4HR7B 4V190 4CKBA 2MP1A 1D6EC 4OIKA 1AZPA 3GTJB 3OWFA 2OTLA 1R4QB 1CUKA 1FNUA 1X65A 3RZOB 1JE5A 1RHPA 1WFQA 4ODGA 2UU9L 3E6ZX 2UU9Q 2ICEC 1PH1A 1W6KA 3S17H 2F52A 1EY4A 2RDFA 3TS2A 3M4YA 5C4JB 1X54A 1ZXTA 4KN4C 1YHAA 2IW3A 2OQ0A 4R8NA 5M9OA 2B2TA 2PZTA 3RZOH 3J7A5 1NNXA 4NMZA 2D0PA 3L3OC 4RGOS 4EQNA 2AWOA 1LTBD 1TS5A 2DY7A 1C8CA 4JI0L 4DV1L 4JI0Q 1Y1VG 4DV1Q 4KKUA 1G91A 2K5QA 3KK7A 4L6TB 2PI2A 5GROA 4JBJA 4YCUA 1SFOB 5CORA 3A5UA 3QO2A 1YIJA 1QE6A 4IPCA 4WJ3M 2CWPA 1ML0D 1ESRA 2ZTEA 5E7NA 5JPNC 1VQ5A 1IL2A 1Q46A 1JB7A 3J7AV 4UP8A 2K5NA 2G9HD 4YWLA 1TWHB 3J7AF 3NBIA 4DR7L 3TN2A 1YHQA 1XNQL 1XPUA 4GN4B 2LS01 2R7FA 4X64L 4LUOA 1V8QA 3Q0AA 2KVMA 1JOKA 2XSCA 2RCNA 4DGZA 2K50A 4GN3B 5IYCH 2J0TD 4LUZA 3X3NA 3KLWA 5I2XA 1TWHH 3JAML 2GVAA 5FLXE 3FP9A 1SNOA 5IP9G 1PLFA 2XN9C 4IFDH 2Z8LA 1VQFA 4ME5A 4OO1H 3TZUA 3JAMi 2CQOA 1WTQA 4DR1L 3CCJA 3MWYW 1OTCA 1AFPA 3PMFA 2A69C 3TP6A 1A63A 4FXGC 1QOHA 1Q3LA 4L5SA 1HHVA 1PTOC 5K36H 5E4WC 1O7ZA 1PVOA 3PF5A 1YNJC 4BA2I 1Q8IA 1YZ6A 4OONA 1Y69U 2JQOA 2PMZE 1D8LA 1RJTA 1K9MC 4BBSG 1EWCA 1HZCA 4CDCC 4MTNA 3E3XA 1E7ZA 5E3FA 1HUNA 1WTXA 1CZGA 3F2BA 2EYLA 4NXML 2MFIA 4DV2L 5M3MH 1MBYA 1TU2B 1KL9A 3PIPA 5JPMC 1TY2A 5BN5A 1DOKA 1RDPD 1U9RA 3M4PA 3PO3B 4A3KG 1CQVA 3RN5A 2ZJPA 4IOCA 4JI7L 2RBMA 1M1KC 4XXEA 2JEAI 2CW0D 1IYVA 2OF1A 3PUWA 1AN8A 4KV6A 2VY3A 2E2JH 1SNQA 1SYCA 2PI2E 3KOJA 2HDLA 4PV1C 3CC4A 5DEHA 2RSOA 1JWMD 1TIID 3PO3H 1GO3E 5FLXL 2QEJC 1BDOA 1IBML 2Y0SB 2R92G 1UAPA 3K5OA 2RVLA 3AB9A 4A3GG 3HG9A 3UE0A 4ZYSA 1STAA 3SK8A 3OIPA 4FYDA 5C44G 1XXGA 1M8AA 4PZ6A 4GZYC 4XYQA 2TSSA 3EBEA 4F7XA 1S5CD 3L9AX 1QNKA 3NTKA 1H9RA 3BVZA 1NR2A 1WTRA 3K80C 3CCRA 3KF6A 2LKVA 5ELFA 5HY6A 1XTCD 4U68A 2O5JC 3P7JA 1ESFA 3EROA 3K5LA 4J8QA 2Z9HA 4L5RC 1VQCA 3A8JE 1EY0A 4LF9L 1X56A 3DHQA 1HQMC 4LF9Q 3A8IE 4EQPA 4KJNA 2AHOB 4F87A 1K8MA 5M5XH 1CA5A 1RIPA 1B9NA 2K5DA 2CH4A 4QQBX 2BA1A 4TQUS 3I8ZA 4UP7A 2OT2A 1OXSC 1SLJA 3HOXB 1UE5A 4DK6C 1NMGA 2K7VA 1W3SA 4NKLA 3EN2A 2Z4IA 1DONA 2WACA 3CHBD 1VDZA 3FDTA 3NBHB 1IW7D 2HCCA 3EIVA 2JA8G 3S2HB 1FL0A 2K33A 2D5DA 2EOTA 4EX5A 2JSOA 5KGUA 3K7AB 3HOXH 1HA5A 1LO5D 1EOVA 1W2BA 1TWFB 1MI2A 5CBAE 4MZ9A 3CC7A 1PXUA 4IPDA 4P71A 2KHIA 1TVXA 5I6YA 3T1HL 4P73A 3T1HQ 1QB5D 4KY5A 1LTGD 2EY6A 3K7AH 5FO8B 4H7BA 2EDGA 1JORA 3DWQA 1WCMB 2CWAA 1D1KA 2AQ1B 1TWFH 1D2BA 1WD0A 2K5VA 1F2MA 2F0UA 1ASZA 4QUFA 4LF7L 3P20A 5JJIA 2HT1A 1RKNA 3H0GG 1KLGD 3HOYB 4CKEA 1J8IA 4LFCL 1A3UA 1Z7TA 1WCMH 2LSSA 2WP8J 4RKLA 2AUKA 4FF1A 1VQNA 1MJEA 1JJ2A 3AFPA 1EFID 2L0CA 4H02A 4LF4L 2UXBL 1J5EL 2UXBQ 1J5EQ 3C2PA 2L12A 1AEXA 3NK9A 1YJWA 4E6IA 5IP7H 3HOYH 3M3YB 2B2WC 4S3SA 2ICIA 3E0JA 1XJVA 1SE2A 3D3RA 3U9OA 4POGA 2QF7A 3MXNB 3CXCA 5CMDA 1L0XB 5FOBB 1KRSA 5IODA 5CV4A 2B2YA 2QDLA 3NXWA 5C3XA 1TS2A 3C46A 1TR5A 1DJRD 2VQFL 2VQFQ 4FF4A 4M1UB 3M3YH 3H3VH 4DK3C 2L9HA 5IGEA 1XMOL 1JOQA 1Q7YC 1XMOQ 2FFKB 1K3BC 4IURA 2VNUD 2BOSA 4GLAC 1FYCA 3X3MA 4DR5L 4IALA 4HIKA 3KUPA 1V1PA 4FF3A 4QCLA 3NSWA 1EQRA 4FXKC 2JA5G 1RODA 4A3IB 1IBKL 1HNWL 1HNWQ 1M4VA 3J80c 4FF2A 4O42A 3H6MA 1LT6D 1NCVA 4Q5VA 3G4SA 1VQEA 5ELNA 3QR8A 4RGNA 2A69D 1T9HA 3C1EA 1JB3A 2FJ2A 3MXGA 1BNZA 3SHLA 4DR2Q 4KHZA 2LMCB 1PTOD 2A74C 5IT9E 4A3IH 3GTOB 4ABNA 5FJ8H 5C3EB 3OTOL 1YNJD 2UUBL 3I4MG 2UUBQ 1KIXA 4O0AA 2Z4HA 2A1AA 1B1ZA 1I4HA 4AYBB 2JA6B 1B9MA 1MGSA 2KJXA 3I56A 2F03A 3A54A 3FPPA 4C3JG 3SVMA 2AQ3B 4UP9A 1PA6A 1GM5A 1BBWA 1Q1BA 2J4XA 2ZJRA 3GTOH 1NE3A 1TXYA 3J81E 4GNXB 5C3EH 3BDOA 1Q1EA 1FJGL 4A3DG 5KNBA 1BCPC 5LHY1 1FJGQ 2KUMA 2Q2UA 1MSGA 2EE1A 2JA6H 4LF5L 1VQ7A 1P8LA 5A2QE 4LF5Q 4RKBA 1STNA 3RD4A 1ILQA 1D7QA 1RTNA 2NUCA 2AKWB 1G6ZA 2EYFA 2JA9A 3NHHA 3Q6SA 2K6AA 2E76C 4KKSA 3I2ZA 4B3TL 2QILA 1PH2A 1STEA 4A3CG 1VQGA 4G7HC 1ASYA 4PG3A 5T1GA 2E74C 2IHEA 1HFGA 1I6HB 2EJMA 3KJPA 4FDBA 3E9HA 3ULLA 4FXDA 1ICWA 1EYCA 1CTMA 1PTOB 4KTAA 1OXUA 4I7AA 1EY9A 1EU3A 2WB1G 1E0BA 3HOWB 4MNOA 4GNXA 1GHJA 5C5LA 5IT9L 1PRTF 2F0QA 4K5WA 3I4NB 3ITPA 5LL6X 3D4WA 2MNAA 1IKLA 4H13C 2VUMG 1I6HH 3KBGA 5K5PA 4J15A 3NP8A 5E1FA 3BZCA 1GVPA 2NTTA 4A3BG 3BDLA 3CKIB 1PTOH 5KNCA 1MHWC 2IT1A 4TKOB 4X65L 3HOWH 1SNPA 1EWHA 1MKHA 3GTKB 3ZYYX 2EVBA 3J81L 1MSHA 2DNCA 2EXZA 4BBRG 1YJNA 4A93B 4CDFC 4ZQ3A 4HCSA 3HKZB 3OMGA 2RA4A 5FLMG 1VQDA 3MEFA 2R7DA 4K2LA 5IYDG 4IZ8A 2K03A 1ZEQX 5M5WH 3GTKH 1QVCA 2ZTCA 1DM0B 2L11A 4O2DA 4RHRA 5FO9B 1EYGA 3RNUA 4A93H 2M9VA 1PFNA 2CQAA 2CKZB 4C3IB 5C4ZA 4DV0L 1VQ9A 1B53A 2DJFC 2DY8A 4JI2L 2VB2X 3RZDB 1E2VA 1T5XD 2RF4A 3K6OA 5AJ3L 5FKAC 3NWSA 2F0HA 1VQPA 2K4KA 3F2UA 5CV8A 1XX8A 4C3IH 1PFSA 2R7ZB 2B63B 4A3JB 2WB1E 2K14A 2F4VL 2PW7A 1L1OC 2F4VQ 3RZDH 1VQIA 5JEAH 3T53B 1KAWA 5CYUA 5EKLA 4A3MH 3PO2G 4WORA 3F8TA 3HFZB 3FKIG 2IWHA 5GADC 1SMXA 1CK1A 2R7ZH 2B63H 3S14H 3EVQA 4LJZC 4B3SL 2EYPA 4DU9A 1F9PA 2L15A 3ERSX 5CC4A 4GKJL 4GKJQ 4BY7B 3S1NB 5EKKA 3D31A 1GUTA 2WAQB 4NW2A 3I7FA 4ZKCB 1I6VC 2BE5C 1XNRL 4XQQA 4A3EG 2UXCL 1XNRQ 3G6JB 4JW0A 2HQEA 2F0FA 3CP0A 3NTIA 3J81j 3A74A 4LNQA 4RG1A 1S5BD 1UE6A 4JCVE 5HURA 4NPSA 1QUQB 3TBIB 2JP1A 4BY7H 3G71A 1PH3A 1JJGA 1KDCA 2E2DC 3LWEA 3D6WA 2MHVA 4RCOA 4AIMA 4OELB 2F0PA 1L0YB 3I55A 3IKJA 4DR6Q 4YHHL 2BA0A 1G51A 4FO2A 1KC8C 3RMHA 1B8AA 3BU2A 1IXRA 1CKNB 1TQOA 3EA6A 1WOCA 1EL0A 3G7LA 2ZM6L 4ZCKA 1VQBA 4LFBL 1LT4D 5KYIA 4LFBQ 1NBWA 5JJKA 4DN4M 1RF2D 1NMFA 3VYRA 1HNXL 3OW7A 3S17B 5EQ0A 1ENAA 1HR0L 1Y1VB 1NUCA 4IPGA 1HR0Q 5D65A 5G3LF 1C48A 1CM9A 1QUQA 4LWCA 1JMCA 4ULLA 4XYOA 2PZWA 4WJWA 2ASBA 4Q0FA 2D62A 3WOFA 5EBDA 3W1GA 3JAME 1U5KA 5IGDA 2QW7A 3S1QB 3GV6A 5ELOA 3K5NA 1V43A 1Y1VH 5EAYA 1KTKA 2F0KA 4BY1G 1STBA 3HOUG 2JA7G 5I9PA 4L8JA 4ZK9B 2QEXA 2PNHA 3HOZG 3PUXA 2RSNA 4DUZL 2WIIB 4LW1A 4DUZQ 1Q86C 3TEHB 3OW2A 3S1QH 4DR3L 1AH9A 5C0XJ 3PF4A 4DXFA 1BCPD 4N9PA 3OHXC 2RHQB 4RHSA 2CHBD 4DV5L 3S9WA 3D4RA 5C0XG 1JWUD 3PIOA 3ULPA 1X32A 3NUCA 3KLSA 4QGUA 4WFN3 3I4OA 5IP9H 4L5QA 3T4AC 2HHHL 4DR7Q 5FLXc 2HHHQ 4DV4L 2F0VA 4DV4Q 1XNQQ 4F8MA 2JA5H 3DXJC 2ES2A 1JR0D 4YCWA 4X64Q 2V4DA 1HZ9A 3QWNA 3WOEA 1O7LA 2Z6KC 3OYYA 2K1BA 1VQ6A 1XPOA 5GAGC 1R4PB 1SJHD 4K2KA 4A76A 1EZ8A 1EEFD 1QVGA 1WTOA 4JVZA 1YNNC 4A3KB 4KY7A 1EQTA 4HIOA 2XRSD 1T5EA 4JPBW 4BBSH 4DR1Q 4RGTA 3S2DH 2D2CC 2XGTA 2FINB 3D8GA 5IWAL 5IWAQ 1IYJB 1VQMA 1N34L 5C5MA 1JCKB 2YTYA 2LY7A 2PPBC 5M3MB 3GTGB 3I91A 1SJED 3PV0A 1EYDA 3W3AA 1EIYB 1BCPB 2AWNA 4A3KH 1DOLA 1UEAB 1GKHA 4KLKA 5I9OA 1SE4A 1QWYA 4LMQD 3H09A 4IFDJ 3DEPA 4V0BA 1WTHA 3CPWA 2E5LL 2YU9B 5C44B 2E5LQ 1OXVA 2AUJD 2E2JB 1EIHA 4NXMQ 2BH2A 3GTGH 4DV2Q 2YTXA 4OEMB 1VQ4A 3MFGA 1EFWA 2VL6A 4ZAIA 1H9SB 1PZKD 5J22A 5LMUL 2I5HA 1X6OA 1HZAA 2XWBB 4JI7Q 2R92H 2OXPA 4GLVB 5C4HA 1O80A 3A0JA 1J9OA 5LMNL 4A3GH 2K75A 4N8X1 2NN6G 3D4DA 2B39A 1PYSB 1DOMA 5C44H 2YU9H 2SNSA 1SROA 3J7ZC 5EPLA 1AZQA 2Z6BA 1EOTA 5CGKA 1LT5D 1K8OA 3MXUA 1SAPA 1IBMQ 1KABA 3IFTA 1STGA 4IOAA 4KY6A 1OO9B 1SNMA 3OOCA 1SNDA 2DUDA 1FNVA 5IIFA 4IUQA 1GUOA 2A68C 3TDQA 1V1OA 2A73B 3UI2A 2FMMA 4JC0A 5M5XB 2JA8B 1LTRD 2R93G 2A6EC 1YBYA 5M5YB 4YWKA 1F9QA 2DJGC 4JI3L 5C4XG 3T56B 4WRDA 4FVMA 4Y52H 4YIJA 3SE0A 2KEEA 4KKTA 2CH4W 1MD2D 1PH5A 2BE5D 4N8FA 4QIWB 1QZHA 2N55A 1EIFA 1S5ED 1Z6HA 2QCPX 4PNYA 1RD9D 1BUVT 4DAMA 4DKAC 4J1MA 2JA8H 5FK9C 1YITA 2NZHA 5NUCA 1SE3A 5M5YH 2HD3A 1PFBA 3K0XA 4RMFA 1A62A 1BXTA 3S1MB 2IPKD 1HH2P 2A6HC 3OSOA 5I2YA 2A19A 3MFYA 4DFAA 4IUVA 4R8IA 2NZOA 4HCEA 5J1ZA 3K58A 4B3ML 1LYLA 3K81C 2Y0SG 3KLRA 1YI2A 1F9SA 1ZYRC 1PH7A 1HPCA 1II3A 1BBUA 3H0GB 3S1MH 1L1OB 5E4XA 1U4LA 4HJ5A 2G9DA 4RWSC 3TSSA 2G5DA 1JC7A 3KLSX 3VYSA 1E1TA 4DA2A 3RN2A 2K32A 2H5XA 4IJHA 4UDUC 2J7ZA 4MIUA 3Q8DA 1UWVA 2B8GA 1PYBA 4POFA 3PUZA 3H0GH 1JICA 1NTGA 3T13A 1VQ8A 4QB4A 2IX3A 1C7YA 3NBHA 1C0AA 4LF7Q 1AE2A 2D9UA 1EQQA 4ZLTF 4OWWB 3HGBA 4AQYL 4TRDA 5IYBG 4AQYQ 1HNZL 2OTJA 2N78A 4LFCQ 1F77A 2OEOA 2B2TC 2F0NA 3VR6A 2FHTA 2Z1CA 2ZJQA 3TRZA 3K0YA 3N6RA 1VQOA 4LF4Q 4B3RL 3BVMA 1QJOA 4B9WA 1LTSD 1YEZA 1LLRD 4KHPL 4LF6L 3VR4A 4KHPQ 1U4RA 4B9XA 2Y0SE 2HCIA 4DPGA 1KHIA 3L7ZC 2L4NA 1J6QA 3CCQA 2PQEA 4FNFA 4KJOA 5IY0A 3B6YA 1WYDA 2B2UA 4QUCA 2QKIC 4R4QA 2I5MX 5F2DA 1C4QA 2Z0SA 2DGYA 4A75A 3S15H 1Y8NB 3I4MB 2PQAB 2JEBI 4X66L 3A55A 4ME3A 5EBCA 1JT8A 3K5MA 1IYUA 3M7NA 1X3QA 2E2IH 3CD6A 3VR2A 1R9TB 4C3JB 3S1RB 4DR5Q 4IJLA 1I50B 4EQOA 5KNDA 4DAPA 1XMQL 1UNSA 4RFBA 1IBKQ 5IT9c 3I4MH 1YNND 1TT2A 1PZID 1SNCA 2F0TA 1SXTA 3GTPB 3Q22A 3MXNA 1R9TH 4C3JH 3S1RH 1DYQA 2ZTDA 1KAAA 1I50H 1U4MA 3DEOA 5KRUA 3F1ZA 4GS3A 1GD7A 4AH6A 1IZ6A 2OWOA 2ZXRA 4A3DH 1KDAA 3J81c 3FEWX 3OTOQ 1S40A 3M4OB 2A5HA 1I5FA 3VR3A 3CMAA 1HTLD 4YCVA 3GTPH 1LABA 2NN6I 2V1CC 3FRPB 3O13A 5ELCA 4L5TA 4OL7A 1LV9A 3MHBA 3H94A 1A15A 3LWUA 2B3GA 4CJ1B 1VMPA 3UDFA 1XTDA 2NTSA 3VA5A 4LFAL 4JI8L 4JI8Q 3TP8A 1YJ9A 4A3CH 3M4OH 4M8AA 1E2ZA 3R8BA 1A0IA 4R9WA 3JC66 3QG1A 1S4ZA 4IN3A 1CZWA 3MEHA 1O7IA 3V96A 1G6PA 4A3BB 3TQYA 1S72A 1Q81C 1WTVA 1L2FA 2WV6D 1PH6A 2K04A 1KDBA 5LL6S 4CHTB 4B3TQ 4R4CA 3CCEA 1RCVD 1HR0W 3F2CA 1S5FD 2KCCA 2UUCL 4JI6L 3VYUA 4BBRB 4JI6Q 5KEEA 2UUAL 2VUMH 1FNWA 2UUAQ 4IUPA 4HIDA 1EIGA 5GQOA 1WTPA 4A3BH 4KN7C 2B2VC 3R3OA 4JBWA 3DUZA 1DZ1A 5CR3A 3TREA 1Q12A 3A8KE 4H0LC 5ISRA 2A68D 4G4KA 3I90A 1A2UA 4IPHA 4BBRH 2L55A 4HMJA 5JJZA 1E2WA 5JOBA 2CFMA 4TVAB 1UE7A 2A6ED 1I94L 4P74A 1I94Q 5FLMH 1AP0A 1PH8A 3P75A 2M2LA 1IBLL 2ATWA 1IBLQ 5IYDH 4X3UA 4X65Q 1X3EA 4GN5A 4NDXA 3NPPA 5M5WB 4GKKL 2FXQA 1KQSA 3NQTA 4I65A 4JI5L 4JI5Q 4UHVA 3J80L 5KIXA 2RCFA 1K83B 5IOCA 1GJXA 3J80i 2C5CA 4HJ9A 2O2LD 3W1BA 5CV5A 1STHA 3DLLA 3DM1A 2EY5A 1TY0A 2A6HD 4HIMA 2F0EA 2BDOA 5ELDA 3CQZB 2LFNA 3LGJA 1LUZA 4X3SA 1SE8A 3HRZC 4GOPC 4NB3A 1N33L 3FKIB 1K83H 3PUVA 5C6AA 1ZYRD 2XIWA 3A5ZB 3AMUA 5GAHC 4C3HG 4DV0Q 1W6JA 3CRLC 3NQIA 1V9PA 4MN3A 2NVQB 2KEDA 2Q2IA 3MAQA 1FGUA 4JI2Q 1HJPA 2EJGC 4DV3L 3PQIA 2HIVA 3CQZH 3PO2H 1SYGA 3AU7A 4A3MB 1AW7A 5ELEA 5AJ3Q 2VB3X 4A3EB 1KNAA 3FKIH 3I4NG 4HN7A 4QY7A 4JI1L
chains in the Genus database with same CATH topology
4C1NK 4ID6A 3S14B 1GOZA 4J6HA 3GTQB 4TSSA 4IUUA 1WTWA 2I46A 2F0LA 4QF4A 4DAVA 1UUPA 2JE6I 4ZUIA 1PTOF 1GXDC 3SK6A 3ND9A 1JE4A 2IX1A 1D5MC 3K59A 1CI3M 3QB3A 3A7LA 5JEAJ 4OIJA 2KECA 4K14A 4HTHA 2KCNA 4PMCA 4Z9CB 2ZT9C 3E5SA 1I4XA 5D14A 4JK1C 3Q23A 3LX0A 4K6DA 2NZ1D 4DNTB 2B2YC 1GUNA 3CU7A 3DWAA 3VR5A 1ET6A 2AQ2B 4BY1B 1HFNA 2JA7B 3W2DA 1D5XC 3BVGA 2M00A 4BS9A 3A56A 3HOZB 1JWSD 1KNEA 1VCIA 2PMZB 4RCNA 1O7YA 2C9OA 3C1FA 3NWTA 1VF5C 2I07B 3K57A 2X6GA 2F0IA 4K6LA 1F2ZA 4UAIA 4CJ0B 1F2LA 3PUYA 1IHZA 1WVLA 1PYWD 2SDFA 4KMUC 1BO0A 2MGSA 5CV7A 5CBEE 4MHEA 1Y8OB 4HSPA 1PRTC 2KOLA 2ZXOA 2PZUA 4RAUC 5C0XH 1GUWA 2F0JA 3M7GA 2R61A 3V05A 1QG7A 4XT1B 2F4IA 5EPKA 3ND8A 4DAYA 1KLUD 2K28A 1CFMA 1TWAB 3SR1A 5COYA 2IX0A 2SOBA 2K01A 2B2WA 3NE5B 2L1BA 2N88A 3MZ5A 5BN3A 2R6GA 4BBSB 1CHPD 5JVH3 1H9MA 1IL8A 1HXYD 3S2DB 3GV3A 1JQYD 3MVVA 4K5VA 5HGTA 5EKIA 1ILPA 1BR9A 4IQZA 3V2TA 4KI0A 5CV9A 2JYOA 3TP7A 1QILA 3I70A 5TSSA 3MC0B 4DNRB 1PDQA 4LK1C 5J39A 5D3IB 2L5TA 1DCZA 1SMYC 4U673 2RDHA 1QNUA 3HS0C 2F1MA 1XYIA 3URYA 4Y7NB 2R92B 4K5XA 4X3KA 4A3GB 3QIAA 2NN6H 5KYLA 3BS1A 4HMIA 3HP3A 2NVYB 3T51B 4IFDG 4OO1G 4H44C 1HRJA 2X6LA 4IUTA 3SEBA 4HEDA 2Q8TA 2PO4A 2R93B 5A35A 4HAEA 4K8JA 1FD7D 3FMCA 4FP5D 5C4XB 5K36G 2PNRC 1F9RA 1EY5A 1ZKOA 1SYDA 1EZ6A 1Q90A 3SDZA 3SK4A 1HCZA 3IL8A 3C3LA 1H9SA 4IUNA 4EGVA 3BDCA 2EZVA 2HDMA 1I4QA 4DXGA 1LTAD 1NR4A 1A3VA 1NAPA 3GQBA 3IFDA 3NTHA 3ONAB 3BYTB 4C2MB 2PCFB 4G7OC 2B2VA 4XDXA 3R2IA 2ID0A 1SYBA 1SSOA 1ENFA 4QMGA 4KHVA 2B8FA 3D6CA 1IKMA 3EQLC 2BDNA 4RA8A 1I4RA 2PYKA 3DMUA 2SNMA 3I3CA 4G57A 4ZRZA 2SEBD 2EYJA 1BCPF 1D1IA 2EY1A 2MJ8A 3PIO3 1FGBD 3S16B 3T16A 2WINB 2H1EA 1TWCB 4F88A 1BOSA 2K5WA 4XT3B 2ENBA 5DM73 2ZXPA 3GP7A 1OXTA 1SBBB 4L63B 3EJIA 2RQXA 1LTTD 3VA7A 2FMCA 1HTPA 1SYFA 2H4OA 1EEID 4P2CB 3R93A 1GUGA 4XQJA 5ELBA 4CJ2C 5IGCA 3OMCA 1PRTD 5C0XI 5DM63 3HZXA 2EPBA 4XIGS 1EYAA 3FPUB 1EY6A 3PIP3 1BBXC 2JA5B 4G7ZC 2F0SA 3S15B 2VXWA 2E2HB 3DWPA 2NYZD 2E2IB 2PW5A 2NWGA 4KD4A 3RUZA 4B08A 2O4XA 2RDGA 1V1PB 4BWGB 1Z47A 2JXMB 3Q24A 2XNAC 1F2YA 3WDNA 5EGTA 1SEBD 5FO7B 5I6WA 1RTOA 1STYA 2XRQD 1PZJD 5BN4A 4PMBA 4PMWA 4BA1I 4A3DB 1PRTB 5I4DA 2EY2A 4X3TA 5DNFA 2NB0A 2TMPA 3IAYA 1HA6A 1SMYD 5IGFA 1G291 2X69A 5D3DA 1H9JA 1I4PA 4IFDI 4OO1I 1SDFA 2E75C 4KD3A 4CKCA 3EFXD 1U4PA 3SK5A 3R2TA 1B2TA 2F0DA 3BG3A 2WB1B 4DF7A 1TWGB 2XWJB 1G8ZD 3J80E 1A3TA 3I72A 3TP5A 1EY7A 3GTLB 1B3AA 4RH6A 2VUMB 4XQNA 5AFWA 2EYHA 1FR3A 1H9KA 5DAUA 3A7AB 2EJFC 2KQ3A 1EY8A 2IJ0A 4ZKBB 2KA7A 2F3WA 2MUYA 1O78A 3QOJA 2KHSA 4NP5A 2Q8IB 1ONLA 1EU4A 3MA2B 1TS4A 3OWEB 4OHJA 3TZDA 3KF8A 3FVQA 1B50A 2DNEA 1CHQD 5IGGA 4C3HB 2NBFA 1LT3D 1S5DD 4PQXA 4C1NI 2BCOA 5G3LD 5EJWA 2HUGA 1B44D 4I7ZC 3BZDB 3RLFA 1CT1D 2GA4B 3BYYB 1DD2A 4CBVA 1SYEA 2IL8A 3MXPA 1VMCA 5C3WA 3HEJA 1EQVA 1ENCA 1BF4A 3PO2B 4ILWA 2QDBA 4RGMA 4K8IA 3U9SA 3QOLA 2NVXB 1CA6A 1A2TA 5A2QL 1TKWB 4XTCS 2EYOA 3N52A 1DXMA 2XVSA 4KK7A 4C56C 3GO5A 1JOOA 1Y8PB 1I3QB 2CW0C 5T1IA 2O5IC 1QCBD 1GUSA 2MPMA 1LACA 3I4LA 3KBXA 1G2SA 4OGQC 2NVTB 1XWEA 2R3ZA 4LAAA 4A3FB 3GD7A 4DK1A 2F0GA 2K05A 2Q8RE 1WD1A 3J7YW 2WKDA 2F0OA 3OIQA 2EYMA 2CVRA 1D5ZC 1PFMA 1VF7A 2WKCA 4C3IG 3I73A 1BQQT 1LTID 3P1HA 1Y1WB 3VYTA 2RKSA 3H91A 1HUMA 5JEAG 3QJYA 1I4GA 2DN8A 5JAVA 1NSNS 1OXXK 3OPOA 2B2UC 4CGYB 3HOUB 3MTSA 1ET9A 4HSVA 2F0MA 1TS3A 4O1NA 4N9TA 4ZUJA 5JVG3 1G2TA 1IW7C 1PMRA 3M85A 3HOVB 5M3FB 1GHKA 1CQFA 1A6XA 3TMEA 2YYZA 3H3VC 4DK0A 1B4OA 3SXHA 5EPJA 3LNNA 3GTMB 5CV6A 2F0WA 3ERQA 1HQRD 4EVOA 5IGBA 3CRKC 2F3VA 1X3PA 4HR7B 4V190 4CKBA 2MP1A 1D6EC 4OIKA 1AZPA 3GTJB 3OWFA 1R4QB 1FNUA 3RZOB 1RHPA 4ODGA 3E6ZX 2ICEC 1W6KA 1EY4A 2RDFA 3M4YA 5C4JB 1ZXTA 4KN4C 2IW3A 4R8NA 5M9OA 2B2TA 2PZTA 4NMZA 4RGOS 3L3OC 4EQNA 2AWOA 1LTBD 1TS5A 2DY7A 1C8CA 4KKUA 1G91A 2K5QA 3KK7A 4L6TB 1SFOB 5CORA 3QO2A 1QE6A 1ML0D 1ESRA 5JPNC 3J7AV 2G9HD 1TWHB 3J7AF 3NBIA 3TN2A 2LS01 1V8QA 3Q0AA 2KVMA 1JOKA 2XSCA 4DGZA 2J0TD 3X3NA 5I2XA 3JAML 5FLXE 1SNOA 1PLFA 2XN9C 4IFDH 2Z8LA 4ME5A 4OO1H 3TZUA 1WTQA 3MWYW 1AFPA 3PMFA 2A69C 3TP6A 4FXGC 1QOHA 1Q3LA 1HHVA 1PTOC 5K36H 5E4WC 1O7ZA 1YNJC 4BA2I 1Q8IA 1Y69U 1RJTA 1EWCA 5E3FA 1HUNA 1WTXA 1CZGA 2EYLA 1MBYA 1TU2B 5JPMC 1TY2A 5BN5A 1DOKA 1RDPD 1U9RA 3PO3B 1CQVA 2RBMA 4XXEA 2JEAI 2CW0D 1IYVA 4KV6A 2OF1A 1AN8A 3PUWA 1SNQA 1SYCA 2HDLA 4PV1C 5DEHA 2RSOA 1JWMD 1TIID 5FLXL 2QEJC 1BDOA 2Y0SB 1UAPA 3K5OA 2RVLA 3AB9A 3HG9A 4ZYSA 1STAA 3SK8A 3OIPA 4FYDA 1XXGA 1M8AA 4GZYC 4XYQA 2TSSA 4F7XA 1S5CD 3L9AX 1QNKA 3NTKA 1H9RA 3BVZA 1NR2A 1WTRA 2LKVA 5ELFA 1XTCD 4U68A 2O5JC 3P7JA 1ESFA 3EROA 3K5LA 4J8QA 3A8JE 1EY0A 3DHQA 1HQMC 3A8IE 4EQPA 4KJNA 4F87A 1K8MA 1CA5A 1B9NA 2K5DA 2BA1A 4TQUS 3I8ZA 2OT2A 1OXSC 3HOXB 2K7VA 4NKLA 1DONA 2Z4IA 2WACA 3CHBD 1VDZA 3FDTA 1IW7D 2HCCA 3S2HB 2K33A 2D5DA 2EOTA 2JSOA 5KGUA 3K7AB 1HA5A 1LO5D 1TWFB 1MI2A 5CBAE 1PXUA 1TVXA 5I6YA 1QB5D 4KY5A 1LTGD 2EY6A 5FO8B 4H7BA 2EDGA 1JORA 3DWQA 1WCMB 1D1KA 2AQ1B 1D2BA 1WD0A 1F2MA 2F0UA 4QUFA 3P20A 1RKNA 1KLGD 3HOYB 4CKEA 1J8IA 1A3UA 1Z7TA 2WP8J 4RKLA 2AUKA 4FF1A 1EFID 2L0CA 3C2PA 2L12A 1AEXA 3NK9A 4E6IA 3M3YB 2B2WC 4S3SA 2ICIA 3E0JA 1SE2A 3D3RA 3U9OA 2QF7A 5CMDA 1L0XB 5FOBB 5IODA 5CV4A 2B2YA 3NXWA 5C3XA 1TS2A 3C46A 1TR5A 1DJRD 4FF4A 4M1UB 2L9HA 5IGEA 1JOQA 2FFKB 4IURA 2VNUD 2BOSA 1FYCA 3X3MA 4IALA 3KUPA 1V1PA 4FF3A 4QCLA 3NSWA 4FXKC 1RODA 4A3IB 1M4VA 4FF2A 4O42A 3H6MA 1LT6D 1NCVA 4Q5VA 4RGNA 2A69D 3C1EA 1JB3A 2FJ2A 3MXGA 1BNZA 3SHLA 4KHZA 2LMCB 1PTOD 2A74C 5IT9E 3GTOB 4ABNA 5C3EB 1YNJD 2Z4HA 1B1ZA 1I4HA 4AYBB 2JA6B 1B9MA 1MGSA 2KJXA 2F03A 3A54A 3FPPA 4C3JG 3SVMA 2AQ3B 1Q1BA 2J4XA 3J81E 3BDOA 1Q1EA 5KNBA 1BCPC 5LHY1 2KUMA 1MSGA 2EE1A 5A2QE 4RKBA 1STNA 3RD4A 1ILQA 1RTNA 2NUCA 1G6ZA 2EYFA 3NHHA 3Q6SA 2K6AA 2E76C 4KKSA 2QILA 1STEA 4G7HC 5T1GA 2E74C 1HFGA 1I6HB 2EJMA 4FXDA 1ICWA 1EYCA 1CTMA 1PTOB 4KTAA 1OXUA 1EY9A 1EU3A 1E0BA 3HOWB 1GHJA 5C5LA 5IT9L 1PRTF 2F0QA 4K5WA 3I4NB 3ITPA 5LL6X 3D4WA 1IKLA 4H13C 3KBGA 5K5PA 3NP8A 5E1FA 2NTTA 3BDLA 3CKIB 1PTOH 5KNCA 2IT1A 4TKOB 1SNPA 1EWHA 3GTKB 3ZYYX 2EVBA 3J81L 1MSHA 2DNCA 2EXZA 4A93B 4ZQ3A 4HCSA 3HKZB 3OMGA 2RA4A 4K2LA 4IZ8A 2K03A 1ZEQX 1DM0B 2L11A 4RHRA 5FO9B 2M9VA 1PFNA 2CQAA 4C3IB 5C4ZA 1B53A 2DY8A 2VB2X 3RZDB 1E2VA 1T5XD 3K6OA 5FKAC 3NWSA 2F0HA 3F2UA 5CV8A 1XX8A 2R7ZB 2B63B 4A3JB 2PW7A 5JEAH 3T53B 5CYUA 5EKLA 4WORA 2IWHA 1CK1A 3EVQA 4LJZC 2EYPA 4DU9A 1F9PA 5CC4A 4BY7B 3S1NB 5EKKA 3D31A 1GUTA 2WAQB 4NW2A 4ZKCB 1I6VC 2BE5C 4XQQA 3G6JB 2HQEA 2F0FA 3NTIA 1S5BD 5HURA 3TBIB 2JP1A 1KDCA 2E2DC 3LWEA 3D6WA 2MHVA 4RCOA 2F0PA 1L0YB 3IKJA 2BA0A 4FO2A 3RMHA 1TQOA 3EA6A 1EL0A 3G7LA 1LT4D 5KYIA 4DN4M 1RF2D 3VYRA 3OW7A 3S17B 5EQ0A 1ENAA 1Y1VB 1NUCA 5G3LF 5D65A 1C48A 1CM9A 4ULLA 4XYOA 2PZWA 4WJWA 4Q0FA 2D62A 3WOFA 5EBDA 3JAME 5IGDA 3S1QB 3GV6A 3K5NA 1V43A 1KTKA 2F0KA 1STBA 5I9PA 4L8JA 4ZK9B 3PUXA 2RSNA 2WIIB 5C0XJ 4DXFA 1BCPD 4N9PA 3OHXC 4RHSA 2CHBD 3S9WA 3D4RA 5C0XG 1JWUD 1X32A 3NUCA 3KLSA 4WFN3 3T4AC 2F0VA 4F8MA 3DXJC 1JR0D 2V4DA 3QWNA 3WOEA 1O7LA 2K1BA 1R4PB 1SJHD 4K2KA 1EZ8A 1EEFD 1WTOA 1YNNC 4A3KB 4KY7A 1EQTA 2XRSD 1T5EA 4RGTA 2D2CC 2FINB 3D8GA 5C5MA 1JCKB 2LY7A 2PPBC 5M3MB 3GTGB 3I91A 1SJED 3PV0A 1EYDA 3W3AA 1BCPB 2AWNA 1DOLA 1UEAB 5I9OA 1SE4A 1QWYA 4LMQD 3H09A 4IFDJ 3DEPA 4V0BA 2YU9B 5C44B 1OXVA 2AUJD 2E2JB 1EIHA 3MFGA 4ZAIA 1H9SB 1PZKD 5J22A 2XWBB 2OXPA 5C4HA 1O80A 1J9OA 2NN6G 3D4DA 2B39A 1DOMA 2SNSA 5EPLA 1AZQA 1EOTA 5CGKA 1LT5D 1K8OA 3MXUA 1SAPA 1KABA 3IFTA 1STGA 4KY6A 1OO9B 1SNMA 3OOCA 1SNDA 1FNVA 5IIFA 4IUQA 1GUOA 2A68C 3TDQA 1V1OA 2A73B 3UI2A 2FMMA 5M5XB 2JA8B 1LTRD 2A6EC 5M5YB 1F9QA 3T56B 4WRDA 4FVMA 4YIJA 3SE0A 2KEEA 4KKTA 1MD2D 2BE5D 4QIWB 2N55A 1S5ED 1Z6HA 2QCPX 4PNYA 1RD9D 1BUVT 4J1MA 5FK9C 5NUCA 1SE3A 1PFBA 1BXTA 3S1MB 2IPKD 2A6HC 3OSOA 5I2YA 3MFYA 4DFAA 4IUVA 4R8IA 4HCEA 5J1ZA 3K58A 3KLRA 1F9SA 1ZYRC 1HPCA 1II3A 3H0GB 5E4XA 1U4LA 2G9DA 4RWSC 3TSSA 1JC7A 3KLSX 3VYSA 4DA2A 2K32A 4UDUC 2J7ZA 4MIUA 2B8GA 3PUZA 1JICA 3T13A 4QB4A 2IX3A 3NBHA 2D9UA 4ZLTF 3HGBA 4TRDA 1F77A 2OEOA 2B2TC 2F0NA 3VR6A 2FHTA 2Z1CA 3K0YA 3N6RA 3BVMA 1QJOA 4B9WA 1LTSD 1LLRD 3VR4A 1U4RA 4B9XA 2HCIA 3L7ZC 2L4NA 2PQEA 4FNFA 4KJOA 2B2UA 4QUCA 2QKIC 5F2DA 1C4QA 1Y8NB 3I4MB 2JEBI 3A55A 5EBCA 3K5MA 1IYUA 3M7NA 1X3QA 3VR2A 1R9TB 4C3JB 3S1RB 1I50B 4EQOA 5KNDA 4DAPA 1UNSA 4RFBA 1YNND 1TT2A 1PZID 1SNCA 2F0TA 1SXTA 3GTPB 3Q22A 3MXNA 1DYQA 1KAAA 1U4MA 3DEOA 5KRUA 2ZXRA 1KDAA 3FEWX 3M4OB 2A5HA 3VR3A 1HTLD 1LABA 2NN6I 3O13A 3FRPB 5ELCA 4OL7A 1LV9A 3MHBA 3H94A 1A15A 3LWUA 4CJ1B 1VMPA 2NTSA 3VA5A 3TP8A 4M8AA 1E2ZA 3R8BA 4R9WA 3QG1A 1S4ZA 4IN3A 1CZWA 3MEHA 3V96A 4A3BB 1WTVA 2WV6D 2K04A 1KDBA 5LL6S 4CHTB 1RCVD 1S5FD 2KCCA 3VYUA 4BBRB 5KEEA 1FNWA 4IUPA 1EIGA 1WTPA 4KN7C 2B2VC 3R3OA 4JBWA 3DUZA 1DZ1A 5CR3A 1Q12A 3A8KE 4H0LC 5ISRA 2A68D 4G4KA 3I90A 1A2UA 2L55A 4HMJA 5JJZA 1E2WA 5JOBA 2A6ED 1AP0A 3P75A 2M2LA 4X3UA 4NDXA 3NPPA 5M5WB 3NQTA 4I65A 3J80L 5KIXA 1K83B 5IOCA 1GJXA 2C5CA 2O2LD 5CV5A 1STHA 3DM1A 2EY5A 1TY0A 2A6HD 2F0EA 2BDOA 5ELDA 3CQZB 2LFNA 4X3SA 3HRZC 3FKIB 3PUVA 5C6AA 1ZYRD 2XIWA 3AMUA 4C3HG 1W6JA 3CRLC 3NQIA 4MN3A 2NVQB 2KEDA 3MAQA 2EJGC 1SYGA 3AU7A 4A3MB 1AW7A 5ELEA 2VB3X 4A3EB 1KNAA 4HN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNM A;  4ID6 A;  2QDB A;  4ZUJ A;  3S9W A;  1EYC A;  5EKK A;  3EJI A;  1SND A;  4K8I A;  4KTA A;  5CV7 A;  1EY0 A;  1SNO A;  3DHQ A;  4J6H A;  5CV4 A;  1EY9 A;  2OEO A;  5IOD A;  4ME5 A;  3NXW A;  3QOL A;  5C3X A;  4EQP A;  2F0N A;  3MEH A;  4KJN A;  5IIF A;  3NUC A;  1TR5 A;  5C5L A;  2PZU A;  2HQE A;  2F0F A;  2F0Q A;  4KD3 A;  4K8J A;  3TME A;  1A2T A;  4K5W A;  3PMF A;  3TP6 A;  3ITP A;  3D4W A;  2EYO A;  2F0J A;  5IGE A;  1JOQ A;  2F0V A;  3SK5 A;  4F8M A;  3SXH A;  1KDB A;  4B9W A;  2F0L A;  4QF4 A;  5HUR A;  5K5P A;  1SYF A;  2F0D A;  3NP8 A;  5E1F A;  4DF7 A;  5CV6 A;  1EY5 A;  3BDL A;  2F0W A;  3ERQ A;  4IAL A;  5KEE A;  4ZUI A;  1SYD A;  4B9X A;  1A3T A;  3TP5 A;  1EY7 A;  1EZ6 A;  1KDC A;  4NKL A;  3SK6 A;  4EVO A;  5IGB A;  1SNP A;  1JOO A;  2F3V A;  2WAC A;  4WRD A;  4K2K A;  4YIJ A;  1EZ8 A;  2PQE A;  3R3O A;  4KJO A;  5IGC A;  3OMC A;  3OWF A;  2F0P A;  3SK4 A;  2EYH A;  2EXZ A;  3H6M A;  5CR3 A;  4PNY A;  3SR1 A;  5ISR A;  5DAU A;  3HZX A;  4J1M A;  4KY7 A;  4ZQ3 A;  4IUN A;  5E3F A;  5F2D A;  5KGU A;  2SOB A;  4ODG A;  3QB3 A;  3C1E A;  3OMG A;  2EYL A;  3BDC A;  1A2U A;  5NUC A;  1TQO A;  4K14 A;  3SHL A;  4HTH A;  4HMJ A;  1EYA A;  3MZ5 A;  1EY6 A;  5JOB A;  4K2L A;  4PMC A;  3D8G A;  1EY4 A;  1A3V A;  2RDF A;  3E5S A;  2F0S A;  4IZ8 A;  2KQ3 A;  1EY8 A;  5C5M A;  5KYI A;  3OSO A;  4LAA A;  1U9R A;  3P75 A;  2F0G A;  3LX0 A;  4K6D A;  4DFA A;  2RBM A;  5I6Y A;  4EQO A;  1EYD A;  4R8N A;  5J1Z A;  3MVV A;  5M9O A;  4K5V A;  2PZT A;  1ENA A;  4KY5 A;  4NDX A;  5HGT A;  1SYB A;  1NUC A;  2F3W A;  2OF1 A;  2PW5 A;  4KV6 A;  4QMG A;  2EY6 A;  4KD4 A;  4KHV A;  3NQT A;  4I65 A;  4NMZ A;  4H7B A;  2O4X A;  3RUZ A;  4EQN A;  5C4Z A;  1JOR A;  1II3 A;  1SNQ A;  3QOJ A;  3V2T A;  1SYC A;  1TT2 A;  5I9O A;  5KIX A;  2F0O A;  1SNC A;  2KHS A;  3D6C A;  2EYM A;  2PZW A;  5DEH A;  5IOC A;  4NP5 A;  5CV9 A;  1F2M A;  2F0U A;  2F0T A;  3TP7 A;  2PYK A;  3DMU A;  5CV5 A;  2SNM A;  1KAA A;  1F2Y A;  1STH A;  2EY5 A;  5IGD A;  2F0H A;  3P1H A;  2M00 A;  4G57 A;  5EGT A;  5J39 A;  5KRU A;  2F0E A;  5IGG A;  5J22 A;  1RKN A;  2EYJ A;  2RKS A;  1STY A;  5CV8 A;  5I6W A;  4MIU A;  2F0K A;  1STA A;  3SK8 A;  2EY1 A;  1STB A;  1A3U A;  4RKB A;  1KDA A;  2OXP A;  3C1F A;  1STN A;  5C4H A;  5I9P A;  4RKL A;  4PMB A;  2PW7 A;  2F0I A;  5C6A A;  2NUC A;  1F2Z A;  3D4D A;  2EYF A;  5JAV A;  2SNS A;  4K5X A;  1NSN S;  3NHH A;  3T13 A;  4F7X A;  5EKL A;  3T16 A;  4OL7 A;  3MHB A;  4WOR A;  4QB4 A;  1AEX A;  3NK9 A;  2EY2 A;  5CGK A;  5KYL A;  1JOK A;  1SYE A;  4E6I A;  4HMI A;  3VA5 A;  1IHZ A;  1SYG A;  3MXP A;  4DGZ A;  4S3S A;  1KAB A;  2LKV A;  3EVQ A;  4N9P A;  3TP8 A;  1STG A;  5C3W A;  2F0M A;  3HEJ A;  1EQV A;  5IGF A;  2EYP A;  1ENC A;  3ERO A;  4KY6 A;  4DU9 A;  2ENB A;  3U9O A;  5CC4 A;  4TRD A;  4N9T A; 
#chains in the Genus database with same CATH topology
 4C1N K;  1K28 A;  4ID6 A;  3S14 B;  1GOZ A;  1MJC A;  4J6H A;  2NVQ H;  3GTQ B;  4QJF A;  4TSS A;  4IUU A;  1WTW A;  2I46 A;  4AYB E;  4A3E H;  2F0L A;  4QF4 A;  4APV A;  4DAV A;  1E3P A;  5L37 A;  1I3Q H;  1UUP A;  2JE6 I;  4ZUI A;  1PTO F;  1GXD C;  4B3S Q;  3GTQ H;  3SK6 A;  3ND9 A;  1JE4 A;  4P72 A;  2IX1 A;  1D5M C;  1UE1 A;  3RLN A;  3K59 A;  2UXC Q;  4HJ7 A;  1CI3 M;  3QB3 A;  3A7L A;  5JEA J;  4OIJ A;  2KBN A;  2KEC A;  4K14 A;  4R4T A;  4HTH A;  1N8R C;  2KCN A;  4PMC A;  4Z9C B;  2ZT9 C;  3E5S A;  1I4X A;  5D14 A;  4JK1 C;  3Q23 A;  4A3L G;  3LX0 A;  4K6D A;  3KDF B;  2NZ1 D;  2MO0 A;  4DNT B;  4A3F G;  2B2Y C;  1GUN A;  3CU7 A;  3DWA A;  1L0W A;  3VR5 A;  4A3J G;  4YHH Q;  4GLX A;  2LXK A;  1ET6 A;  2AQ2 B;  4BY1 B;  1HFN A;  2JA7 B;  3W2D A;  1D5X C;  2RHS B;  1ICF B;  3BVG A;  4JI4 L;  2M00 A;  4JI4 Q;  2ZM6 Q;  4BS9 A;  3A56 A;  3HOZ B;  1JWS D;  1KNE A;  1VCI A;  5IE8 A;  2PMZ B;  4X6A H;  4RCN A;  1O7Y A;  4QL5 A;  1HNX Q;  2C9O A;  3JAM c;  3C1F A;  3NWT A;  1VF5 C;  1VQJ A;  2I07 B;  3K57 A;  2X6G A;  4NXN L;  2F0I A;  1Y1W G;  4PZ7 A;  4K6L A;  1F2Z A;  4BY1 H;  3HOU H;  4UAI A;  2JA7 H;  3S24 A;  4CJ0 B;  3HKS A;  4BXX G;  2GN5 A;  3KJO A;  4DAY B;  1F2L A;  1K3R A;  3HOZ H;  3PUY A;  1IHZ A;  1WVL A;  3HKZ E;  1PYW D;  2SDF A;  4KMU C;  1BO0 A;  1SR3 A;  3PGZ A;  2I0Q A;  2MGS A;  2VQE L;  2K52 A;  2Q2H A;  2VQE Q;  5CV7 A;  5CBE E;  4MHE A;  1CKN A;  1EUJ A;  1X3F A;  1Y8O B;  4HSP A;  1PRT C;  2KOL A;  2ZXO A;  2HIX A;  2PZU A;  4RAU C;  3GTM H;  5C0X H;  1GUW A;  2F0J A;  3M7G A;  2R61 A;  4DR3 Q;  3V05 A;  2QA4 A;  3HOV G;  5M3F G;  1QG7 A;  4XT1 B;  2K5H A;  2F4I A;  3GTJ H;  5EPK A;  1PHJ A;  3ND8 A;  4DAY A;  1KD1 C;  3UDX A;  4DV5 Q;  1KLU D;  2K28 A;  4R1J A;  1CFM A;  2GVB A;  4JOI C;  2KCM A;  2KHJ A;  4A4I A;  1TWA B;  3SR1 A;  5COY A;  1K0S A;  2IX0 A;  2SOB A;  5C4J H;  2K01 A;  2B2W A;  3NE5 B;  2L1B A;  3E0E A;  4MTK A;  2N88 A;  3MZ5 A;  5BN3 A;  2B29 A;  2R6G A;  4CDD C;  5DLQ E;  4BBS B;  1CHP D;  5JVH 3;  1H9M A;  1IL8 A;  1HXY D;  3S2D B;  2HQL A;  3GV3 A;  1JQY D;  3MVV A;  4K5V A;  1CKM A;  1TWA H;  5HGT A;  4YY3 L;  1X55 A;  4YY3 Q;  5EKI A;  1ILP A;  3UE1 A;  1BR9 A;  4IQZ A;  3V2T A;  4GNX C;  4KI0 A;  1K8G A;  2WAQ E;  2YV5 A;  5CV9 A;  2JYO A;  3TP7 A;  1QIL A;  5JJL A;  3CCS A;  3I70 A;  5TSS A;  3MC0 B;  1SFO H;  4DNR B;  1PDQ A;  4LK1 C;  1A8V A;  5J39 A;  5D3I B;  1Z9F A;  3AEV A;  2L5T A;  1DCZ A;  1SMY C;  4U67 3;  1N34 Q;  3RLO A;  2RDH A;  1QNU A;  1LM0 A;  4JG2 A;  2JJQ A;  3HS0 C;  4LUV A;  2F1M A;  1MIU A;  2AMC B;  1XYI A;  3URY A;  4Y7N B;  2R92 B;  4K5X A;  4X3K A;  2IHF A;  1SN8 A;  4A3G B;  5IYC G;  3QIA A;  2NN6 H;  4R4O A;  5KYL A;  3BS1 A;  4HMI A;  3HP3 A;  3RR5 A;  2F3I A;  2NVY B;  2VS1 A;  2QGQ A;  3T51 B;  4IFD G;  5BR8 L;  4OO1 G;  1VQH A;  5BR8 Q;  5LMU Q;  3ICE A;  4Y7N H;  4H44 C;  1HRJ A;  2X6L A;  4IUT A;  3SEB A;  4HED A;  2Q8T A;  5LMN Q;  2PO4 A;  2E8G A;  2R93 B;  5A35 A;  4HAE A;  3UDG A;  3CF5 A;  4K8J A;  1FD7 D;  4IO9 A;  3FMC A;  4FP5 D;  5C4X B;  2NVY H;  5K36 G;  2PNR C;  1F9R A;  1AE3 A;  3M4Q A;  1EY5 A;  1ZKO A;  1SYD A;  3AFQ A;  4OX9 L;  1EZ6 A;  4OX9 Q;  1Q90 A;  2R93 H;  4HJA A;  1V1Q A;  3SDZ A;  3KF6 B;  5C4X H;  4OWX B;  3SK4 A;  3CME A;  1HCZ A;  2EXD A;  3U4Z A;  1WJJ A;  5M3M G;  3IL8 A;  3C3L A;  4JV5 L;  1H9S A;  4IUN A;  4JV5 Q;  4EGV A;  3BDC A;  2EZV A;  3WWV A;  2HDM A;  1I4Q A;  4DXG A;  1LTA D;  1NR4 A;  1A3V A;  1NAP A;  3GDE A;  2KCT A;  3GQB A;  3IFD A;  3NTH A;  3ONA B;  3BYT B;  1X9N A;  4C2M B;  2PCF B;  4G7O C;  1NJI C;  2B2V A;  5HGQ A;  3H15 A;  3UDI A;  3PSI A;  4XDX A;  4JI3 Q;  3R2I A;  2ID0 A;  1SYB A;  1SSO A;  1ENF A;  3ULJ A;  4QMG A;  4KHV A;  2B8F A;  3PO3 G;  4GOP B;  3D6C A;  1IKM A;  3EQL C;  2BDN A;  4RA8 A;  1I4R A;  1KRT A;  1E22 A;  2PYK A;  3DMU A;  2MQH A;  4C2M H;  2SNM A;  3I3C A;  4G57 A;  1EWI A;  3CCV A;  4ZRZ A;  1VS0 A;  2SEB D;  2EYJ A;  1BCP F;  1D1I A;  2EY1 A;  2MJ8 A;  1Y14 B;  3PIO 3;  4B3M Q;  4UPA A;  1FGB D;  3S16 B;  2N8N A;  3T16 A;  2WIN B;  2H1E A;  1TWC B;  4F88 A;  1BOS A;  1CKO A;  2K5W A;  1B7Y B;  4JYA L;  4JYA Q;  1FVI A;  3W5O A;  4GOP A;  4XT3 B;  2ENB A;  3IRB A;  5DM7 3;  2ZXP A;  3GP7 A;  1OXT A;  4JBK A;  1SBB B;  4L63 B;  3S16 H;  3EJI A;  2RQX A;  1LTT D;  5IYB H;  1TWC H;  3VA7 A;  1PH9 A;  2I5L X;  2FMC A;  2VW9 A;  4ALP A;  1Q82 C;  1HTP A;  1SYF A;  3KYH C;  2H4O A;  1EEI D;  3S2H H;  4P2C B;  3R93 A;  1L1O A;  1HNZ Q;  1GUG A;  4XQJ A;  5ELB A;  4CJ2 C;  3HOX G;  5IGC A;  3OMC A;  2P5Z X;  1PRT D;  1LTL A;  5C0X I;  2VZA A;  5DM6 3;  3NEL A;  2C35 B;  3CW2 C;  3HZX A;  3K7U C;  1BVS A;  3CAM A;  2EPB A;  4XIG S;  4B3R Q;  1EYA A;  3FPU B;  1EY6 A;  3STB C;  3PIP 3;  1BBX C;  2JA5 B;  4G7Z C;  1VQA A;  2F0S A;  3BZK A;  3S15 B;  4LF6 Q;  4R4I A;  2VXW A;  3F2D A;  2E2H B;  3DWP A;  2NYZ D;  2E2I B;  3U50 C;  2PW5 A;  2NWG A;  4KD4 A;  3RUZ A;  4B08 A;  2O4X A;  2RDG A;  1VQL A;  1V1P B;  2YTV A;  4UY8 C;  4BWG B;  2UXD L;  1SRU A;  1CSQ A;  1BKB A;  1Z47 A;  2UXD Q;  2JXM B;  3Q24 A;  2WFW A;  2XNA C;  1VQK A;  1F2Y A;  2E2H H;  4X66 Q;  3WDN A;  5EGT A;  1WCM G;  3CCM A;  1SEB D;  5FO7 B;  1RTO A;  1STY A;  2XRQ D;  5I6W A;  1PZJ D;  5BN4 A;  2N49 A;  4DUY L;  2EQS A;  4DUY Q;  1XMQ Q;  4HJ8 A;  4PMB A;  4PMW A;  3ER0 A;  4BA1 I;  4A3D B;  3HOY G;  5IP7 G;  2IY5 B;  1E1O A;  4QIW E;  1PRT B;  4OXP A;  5I4D A;  2EY2 A;  4X3T A;  5DNF A;  2NB0 A;  2TMP A;  3IAY A;  1HA6 A;  1SMY D;  5IGF A;  1G29 1;  2X69 A;  5D3D A;  1H9J A;  1I4P A;  3D0F A;  4IFD I;  4OO1 I;  1YNX A;  1SDF A;  2PQA A;  1C9O A;  2E75 C;  4KD3 A;  1N32 L;  4CKC A;  1N32 Q;  3EFX D;  1U4P A;  1CSP A;  3NEM A;  3SK5 A;  3R2T A;  4DR2 L;  2D0O A;  1B2T A;  2F0D A;  3BG3 A;  2WB1 B;  4DF7 A;  1TWG B;  4LFA Q;  2XWJ B;  1G8Z D;  3J80 E;  1A3T A;  3I72 A;  3TP5 A;  1EY7 A;  5J3B A;  3U4V A;  2JK8 A;  3GTL B;  1B3A A;  4RH6 A;  3KF8 B;  2VUM B;  4XQN A;  5AFW A;  2ALY B;  2Q2T A;  3E9I A;  2EYH A;  1FR3 A;  1NY4 A;  1H9K A;  5DAU A;  3A7A B;  2EJF C;  3U58 A;  3L2P A;  1TWG H;  4A3I G;  1KXL A;  5FJ8 G;  4WJ4 A;  2EIF A;  3GTL H;  2KQ3 A;  1EY8 A;  1HZB A;  2IJ0 A;  3VDY A;  3NEN A;  2UUC Q;  3BJU A;  2MO1 A;  4ZKB B;  3AYH B;  4JOI A;  2KA7 A;  2F3W A;  4P75 A;  2A8V A;  2MUY A;  1O78 A;  3QOJ A;  1N36 L;  2KHS A;  1N36 Q;  5C3E G;  1X3G A;  4NP5 A;  2Q8I B;  2KEN A;  1ONL A;  4K0K L;  4K0K Q;  1EU4 A;  3MA2 B;  1TS4 A;  4AYB G;  2Z6K A;  3OWE B;  2JA6 G;  4OHJ A;  3TZD A;  3KF8 A;  3FVQ A;  1S3O A;  1B50 A;  3FHW A;  2DNE A;  1CHQ D;  5IGG A;  4JBM A;  1QVF A;  1K8A C;  4C3H B;  2NBF A;  1LT3 D;  1S5D D;  4PQX A;  4C1N I;  2BCO A;  5G3L D;  2OCE A;  5EJW A;  1U0L A;  2HUG A;  1B44 D;  4GKK Q;  4I7Z C;  3BZD B;  3RLF A;  1CT1 D;  2GA4 B;  1YHB A;  3BYY B;  1DD2 A;  4CBV A;  4C3H H;  4DV7 L;  1SYE A;  2IL8 A;  3SGI A;  4DV7 Q;  3MXP A;  1VMC A;  5C3W A;  3HEJ A;  1EQV A;  1ENC A;  1BF4 A;  2LXJ A;  3PO2 B;  3TS0 A;  4ILW A;  2QDB A;  4RGM A;  4K8I A;  3I4N H;  1N33 Q;  3U9S A;  3QOL A;  2NVX B;  4YWM A;  3J81 i;  1CA6 A;  1A2T A;  5A2Q L;  1TKW B;  4XTC S;  2EYO A;  3N52 A;  1DXM A;  2XVS A;  3HOW G;  4KK7 A;  4DV3 Q;  4CDE C;  4C56 C;  3GO5 A;  4EQ5 A;  2NVX H;  3AQQ A;  1JOO A;  4X62 L;  4JI1 Q;  4X62 Q;  1Y8P B;  3G48 A;  1I3Q B;  2CW0 C;  3PCO B;  5T1I A;  2JN4 A;  2O5I C;  1QCB D;  1GUS A;  1P16 A;  2MPM A;  1LAC A;  1QZG A;  3I4L A;  3KBX A;  1G2S A;  4OGQ C;  1H95 A;  3CCL A;  2NVT B;  1PH4 A;  1XWE A;  2R3Z A;  4A93 G;  3M9B A;  4LAA A;  4A3F B;  3GD7 A;  4DK1 A;  2F0G A;  3HKZ G;  3T1Y L;  3T1Y Q;  1UEB A;  5GAE C;  2N3S A;  1RL2 A;  4LF8 L;  2K05 A;  3G6E A;  1Q8K A;  4LF8 Q;  4A3L H;  2OQK A;  2Q8R E;  1K73 C;  1PV4 A;  1DGS A;  1WD1 A;  3J7Y W;  2WKD A;  4OWT B;  2CCZ A;  2NVT H;  2F0O A;  3OIQ A;  2EYM A;  2CVR A;  1D5Z C;  1PFM A;  1VF7 A;  2WKC A;  4A3F H;  4C3I G;  3I73 A;  1BQQ T;  3STB D;  1LTI D;  5LMN W;  4A3J H;  5H1S E;  3P1H A;  1Y1W B;  3VYT A;  1K0R A;  2RKS A;  1B70 B;  3H91 A;  1HUM A;  5JEA G;  3QJY A;  1I4G A;  1JJC B;  4DV6 L;  4A3M G;  4DV6 Q;  1B3Q A;  2DN8 A;  3KFU A;  5JAV A;  1NSN S;  1OXX K;  3OPO A;  3ZJY C;  1WI5 A;  2R7Z G;  2B63 G;  1YVC A;  1Y1W H;  2B2U C;  4DNI A;  1M90 C;  4CGY B;  3HOU B;  3MTS A;  2XTI A;  3CPF A;  4BXX H;  1ET9 A;  3S1N H;  4HSV A;  2F0M A;  1TS3 A;  4O1N A;  1N9W A;  4N9T A;  4ZUJ A;  5JVG 3;  1G2T A;  1IW7 C;  1PMR A;  2BH8 A;  4DR6 L;  3M85 A;  4PZ8 A;  5M3F B;  4NXN Q;  3HOV B;  3H3V I;  1GHK A;  1CQF A;  3CCU A;  1A6X A;  3TME A;  3DM3 A;  1E24 A;  2YYZ A;  3H3V C;  4BY7 G;  4DK0 A;  1B4O A;  3KDF A;  3K8A A;  3SXH A;  5EPJ A;  2WAQ G;  3LNN A;  3GTM B;  3CC2 A;  5CV6 A;  4DR4 L;  2F0W A;  3ERQ A;  1XPR A;  4DR4 Q;  1HQR D;  4EVO A;  5IGB A;  3L0O A;  3CRK C;  2F3V A;  3HOV H;  5M3F H;  1X3P A;  4HR7 B;  4V19 0;  4CKB A;  2MP1 A;  1D6E C;  4OIK A;  1AZP A;  3GTJ B;  3OWF A;  2OTL A;  1R4Q B;  1CUK A;  1FNU A;  1X65 A;  3RZO B;  1JE5 A;  1RHP A;  1WFQ A;  4ODG A;  2UU9 L;  3E6Z X;  2UU9 Q;  2ICE C;  1PH1 A;  1W6K A;  3S17 H;  2F52 A;  1EY4 A;  2RDF A;  3TS2 A;  3M4Y A;  5C4J B;  1X54 A;  1ZXT A;  4KN4 C;  1YHA A;  2IW3 A;  2OQ0 A;  4R8N A;  5M9O A;  2B2T A;  2PZT A;  3RZO H;  3J7A 5;  1NNX A;  4NMZ A;  2D0P A;  3L3O C;  4RGO S;  4EQN A;  2AWO A;  1LTB D;  1TS5 A;  2DY7 A;  1C8C A;  4JI0 L;  4DV1 L;  4JI0 Q;  1Y1V G;  4DV1 Q;  4KKU A;  1G91 A;  2K5Q A;  3KK7 A;  4L6T B;  2PI2 A;  5GRO A;  4JBJ A;  4YCU A;  1SFO B;  5COR A;  3A5U A;  3QO2 A;  1YIJ A;  1QE6 A;  4IPC A;  4WJ3 M;  2CWP A;  1ML0 D;  1ESR A;  2ZTE A;  5E7N A;  5JPN C;  1VQ5 A;  1IL2 A;  1Q46 A;  1JB7 A;  3J7A V;  4UP8 A;  2K5N A;  2G9H D;  4YWL A;  1TWH B;  3J7A F;  3NBI A;  4DR7 L;  3TN2 A;  1YHQ A;  1XNQ L;  1XPU A;  4GN4 B;  2LS0 1;  2R7F A;  4X64 L;  4LUO A;  1V8Q A;  3Q0A A;  2KVM A;  1JOK A;  2XSC A;  2RCN A;  4DGZ A;  2K50 A;  4GN3 B;  5IYC H;  2J0T D;  4LUZ A;  3X3N A;  3KLW A;  5I2X A;  1TWH H;  3JAM L;  2GVA A;  5FLX E;  3FP9 A;  1SNO A;  5IP9 G;  1PLF A;  2XN9 C;  4IFD H;  2Z8L A;  1VQF A;  4ME5 A;  4OO1 H;  3TZU A;  3JAM i;  2CQO A;  1WTQ A;  4DR1 L;  3CCJ A;  3MWY W;  1OTC A;  1AFP A;  3PMF A;  2A69 C;  3TP6 A;  1A63 A;  4FXG C;  1QOH A;  1Q3L A;  4L5S A;  1HHV A;  1PTO C;  5K36 H;  5E4W C;  1O7Z A;  1PVO A;  3PF5 A;  1YNJ C;  4BA2 I;  1Q8I A;  1YZ6 A;  4OON A;  1Y69 U;  2JQO A;  2PMZ E;  1D8L A;  1RJT A;  1K9M C;  4BBS G;  1EWC A;  1HZC A;  4CDC C;  4MTN A;  3E3X A;  1E7Z A;  5E3F A;  1HUN A;  1WTX A;  1CZG A;  3F2B A;  2EYL A;  4NXM L;  2MFI A;  4DV2 L;  5M3M H;  1MBY A;  1TU2 B;  1KL9 A;  3PIP A;  5JPM C;  1TY2 A;  5BN5 A;  1DOK A;  1RDP D;  1U9R A;  3M4P A;  3PO3 B;  4A3K G;  1CQV A;  3RN5 A;  2ZJP A;  4IOC A;  4JI7 L;  2RBM A;  1M1K C;  4XXE A;  2JEA I;  2CW0 D;  1IYV A;  2OF1 A;  3PUW A;  1AN8 A;  4KV6 A;  2VY3 A;  2E2J H;  1SNQ A;  1SYC A;  2PI2 E;  3KOJ A;  2HDL A;  4PV1 C;  3CC4 A;  5DEH A;  2RSO A;  1JWM D;  1TII D;  3PO3 H;  1GO3 E;  5FLX L;  2QEJ C;  1BDO A;  1IBM L;  2Y0S B;  2R92 G;  1UAP A;  3K5O A;  2RVL A;  3AB9 A;  4A3G G;  3HG9 A;  3UE0 A;  4ZYS A;  1STA A;  3SK8 A;  3OIP A;  4FYD A;  5C44 G;  1XXG A;  1M8A A;  4PZ6 A;  4GZY C;  4XYQ A;  2TSS A;  3EBE A;  4F7X A;  1S5C D;  3L9A X;  1QNK A;  3NTK A;  1H9R A;  3BVZ A;  1NR2 A;  1WTR A;  3K80 C;  3CCR A;  3KF6 A;  2LKV A;  5ELF A;  5HY6 A;  1XTC D;  4U68 A;  2O5J C;  3P7J A;  1ESF A;  3ERO A;  3K5L A;  4J8Q A;  2Z9H A;  4L5R C;  1VQC A;  3A8J E;  1EY0 A;  4LF9 L;  1X56 A;  3DHQ A;  1HQM C;  4LF9 Q;  3A8I E;  4EQP A;  4KJN A;  2AHO B;  4F87 A;  1K8M A;  5M5X H;  1CA5 A;  1RIP A;  1B9N A;  2K5D A;  2CH4 A;  4QQB X;  2BA1 A;  4TQU S;  3I8Z A;  4UP7 A;  2OT2 A;  1OXS C;  1SLJ A;  3HOX B;  1UE5 A;  4DK6 C;  1NMG A;  2K7V A;  1W3S A;  4NKL A;  3EN2 A;  2Z4I A;  1DON A;  2WAC A;  3CHB D;  1VDZ A;  3FDT A;  3NBH B;  1IW7 D;  2HCC A;  3EIV A;  2JA8 G;  3S2H B;  1FL0 A;  2K33 A;  2D5D A;  2EOT A;  4EX5 A;  2JSO A;  5KGU A;  3K7A B;  3HOX H;  1HA5 A;  1LO5 D;  1EOV A;  1W2B A;  1TWF B;  1MI2 A;  5CBA E;  4MZ9 A;  3CC7 A;  1PXU A;  4IPD A;  4P71 A;  2KHI A;  1TVX A;  5I6Y A;  3T1H L;  4P73 A;  3T1H Q;  1QB5 D;  4KY5 A;  1LTG D;  2EY6 A;  3K7A H;  5FO8 B;  4H7B A;  2EDG A;  1JOR A;  3DWQ A;  1WCM B;  2CWA A;  1D1K A;  2AQ1 B;  1TWF H;  1D2B A;  1WD0 A;  2K5V A;  1F2M A;  2F0U A;  1ASZ A;  4QUF A;  4LF7 L;  3P20 A;  5JJI A;  2HT1 A;  1RKN A;  3H0G G;  1KLG D;  3HOY B;  4CKE A;  1J8I A;  4LFC L;  1A3U A;  1Z7T A;  1WCM H;  2LSS A;  2WP8 J;  4RKL A;  2AUK A;  4FF1 A;  1VQN A;  1MJE A;  1JJ2 A;  3AFP A;  1EFI D;  2L0C A;  4H02 A;  4LF4 L;  2UXB L;  1J5E L;  2UXB Q;  1J5E Q;  3C2P A;  2L12 A;  1AEX A;  3NK9 A;  1YJW A;  4E6I A;  5IP7 H;  3HOY H;  3M3Y B;  2B2W C;  4S3S A;  2ICI A;  3E0J A;  1XJV A;  1SE2 A;  3D3R A;  3U9O A;  4POG A;  2QF7 A;  3MXN B;  3CXC A;  5CMD A;  1L0X B;  5FOB B;  1KRS A;  5IOD A;  5CV4 A;  2B2Y A;  2QDL A;  3NXW A;  5C3X A;  1TS2 A;  3C46 A;  1TR5 A;  1DJR D;  2VQF L;  2VQF Q;  4FF4 A;  4M1U B;  3M3Y H;  3H3V H;  4DK3 C;  2L9H A;  5IGE A;  1XMO L;  1JOQ A;  1Q7Y C;  1XMO Q;  2FFK B;  1K3B C;  4IUR A;  2VNU D;  2BOS A;  4GLA C;  1FYC A;  3X3M A;  4DR5 L;  4IAL A;  4HIK A;  3KUP A;  1V1P A;  4FF3 A;  4QCL A;  3NSW A;  1EQR A;  4FXK C;  2JA5 G;  1ROD A;  4A3I B;  1IBK L;  1HNW L;  1HNW Q;  1M4V A;  3J80 c;  4FF2 A;  4O42 A;  3H6M A;  1LT6 D;  1NCV A;  4Q5V A;  3G4S A;  1VQE A;  5ELN A;  3QR8 A;  4RGN A;  2A69 D;  1T9H A;  3C1E A;  1JB3 A;  2FJ2 A;  3MXG A;  1BNZ A;  3SHL A;  4DR2 Q;  4KHZ A;  2LMC B;  1PTO D;  2A74 C;  5IT9 E;  4A3I H;  3GTO B;  4ABN A;  5FJ8 H;  5C3E B;  3OTO L;  1YNJ D;  2UUB L;  3I4M G;  2UUB Q;  1KIX A;  4O0A A;  2Z4H A;  2A1A A;  1B1Z A;  1I4H A;  4AYB B;  2JA6 B;  1B9M A;  1MGS A;  2KJX A;  3I56 A;  2F03 A;  3A54 A;  3FPP A;  4C3J G;  3SVM A;  2AQ3 B;  4UP9 A;  1PA6 A;  1GM5 A;  1BBW A;  1Q1B A;  2J4X A;  2ZJR A;  3GTO H;  1NE3 A;  1TXY A;  3J81 E;  4GNX B;  5C3E H;  3BDO A;  1Q1E A;  1FJG L;  4A3D G;  5KNB A;  1BCP C;  5LHY 1;  1FJG Q;  2KUM A;  2Q2U A;  1MSG A;  2EE1 A;  2JA6 H;  4LF5 L;  1VQ7 A;  1P8L A;  5A2Q E;  4LF5 Q;  4RKB A;  1STN A;  3RD4 A;  1ILQ A;  1D7Q A;  1RTN A;  2NUC A;  2AKW B;  1G6Z A;  2EYF A;  2JA9 A;  3NHH A;  3Q6S A;  2K6A A;  2E76 C;  4KKS A;  3I2Z A;  4B3T L;  2QIL A;  1PH2 A;  1STE A;  4A3C G;  1VQG A;  4G7H C;  1ASY A;  4PG3 A;  5T1G A;  2E74 C;  2IHE A;  1HFG A;  1I6H B;  2EJM A;  3KJP A;  4FDB A;  3E9H A;  3ULL A;  4FXD A;  1ICW A;  1EYC A;  1CTM A;  1PTO B;  4KTA A;  1OXU A;  4I7A A;  1EY9 A;  1EU3 A;  2WB1 G;  1E0B A;  3HOW B;  4MNO A;  4GNX A;  1GHJ A;  5C5L A;  5IT9 L;  1PRT F;  2F0Q A;  4K5W A;  3I4N B;  3ITP A;  5LL6 X;  3D4W A;  2MNA A;  1IKL A;  4H13 C;  2VUM G;  1I6H H;  3KBG A;  5K5P A;  4J15 A;  3NP8 A;  5E1F A;  3BZC A;  1GVP A;  2NTT A;  4A3B G;  3BDL A;  3CKI B;  1PTO H;  5KNC A;  1MHW C;  2IT1 A;  4TKO B;  4X65 L;  3HOW H;  1SNP A;  1EWH A;  1MKH A;  3GTK B;  3ZYY X;  2EVB A;  3J81 L;  1MSH A;  2DNC A;  2EXZ A;  4BBR G;  1YJN A;  4A93 B;  4CDF C;  4ZQ3 A;  4HCS A;  3HKZ B;  3OMG A;  2RA4 A;  5FLM G;  1VQD A;  3MEF A;  2R7D A;  4K2L A;  5IYD G;  4IZ8 A;  2K03 A;  1ZEQ X;  5M5W H;  3GTK H;  1QVC A;  2ZTC A;  1DM0 B;  2L11 A;  4O2D A;  4RHR A;  5FO9 B;  1EYG A;  3RNU A;  4A93 H;  2M9V A;  1PFN A;  2CQA A;  2CKZ B;  4C3I B;  5C4Z A;  4DV0 L;  1VQ9 A;  1B53 A;  2DJF C;  2DY8 A;  4JI2 L;  2VB2 X;  3RZD B;  1E2V A;  1T5X D;  2RF4 A;  3K6O A;  5AJ3 L;  5FKA C;  3NWS A;  2F0H A;  1VQP A;  2K4K A;  3F2U A;  5CV8 A;  1XX8 A;  4C3I H;  1PFS A;  2R7Z B;  2B63 B;  4A3J B;  2WB1 E;  2K14 A;  2F4V L;  2PW7 A;  1L1O C;  2F4V Q;  3RZD H;  1VQI A;  5JEA H;  3T53 B;  1KAW A;  5CYU A;  5EKL A;  4A3M H;  3PO2 G;  4WOR A;  3F8T A;  3HFZ B;  3FKI G;  2IWH A;  5GAD C;  1SMX A;  1CK1 A;  2R7Z H;  2B63 H;  3S14 H;  3EVQ A;  4LJZ C;  4B3S L;  2EYP A;  4DU9 A;  1F9P A;  2L15 A;  3ERS X;  5CC4 A;  4GKJ L;  4GKJ Q;  4BY7 B;  3S1N B;  5EKK A;  3D31 A;  1GUT A;  2WAQ B;  4NW2 A;  3I7F A;  4ZKC B;  1I6V C;  2BE5 C;  1XNR L;  4XQQ A;  4A3E G;  2UXC L;  1XNR Q;  3G6J B;  4JW0 A;  2HQE A;  2F0F A;  3CP0 A;  3NTI A;  3J81 j;  3A74 A;  4LNQ A;  4RG1 A;  1S5B D;  1UE6 A;  4JCV E;  5HUR A;  4NPS A;  1QUQ B;  3TBI B;  2JP1 A;  4BY7 H;  3G71 A;  1PH3 A;  1JJG A;  1KDC A;  2E2D C;  3LWE A;  3D6W A;  2MHV A;  4RCO A;  4AIM A;  4OEL B;  2F0P A;  1L0Y B;  3I55 A;  3IKJ A;  4DR6 Q;  4YHH L;  2BA0 A;  1G51 A;  4FO2 A;  1KC8 C;  3RMH A;  1B8A A;  3BU2 A;  1IXR A;  1CKN B;  1TQO A;  3EA6 A;  1WOC A;  1EL0 A;  3G7L A;  2ZM6 L;  4ZCK A;  1VQB A;  4LFB L;  1LT4 D;  5KYI A;  4LFB Q;  1NBW A;  5JJK A;  4DN4 M;  1RF2 D;  1NMF A;  3VYR A;  1HNX L;  3OW7 A;  3S17 B;  5EQ0 A;  1ENA A;  1HR0 L;  1Y1V B;  1NUC A;  4IPG A;  1HR0 Q;  5D65 A;  5G3L F;  1C48 A;  1CM9 A;  1QUQ A;  4LWC A;  1JMC A;  4ULL A;  4XYO A;  2PZW A;  4WJW A;  2ASB A;  4Q0F A;  2D62 A;  3WOF A;  5EBD A;  3W1G A;  3JAM E;  1U5K A;  5IGD A;  2QW7 A;  3S1Q B;  3GV6 A;  5ELO A;  3K5N A;  1V43 A;  1Y1V H;  5EAY A;  1KTK A;  2F0K A;  4BY1 G;  1STB A;  3HOU G;  2JA7 G;  5I9P A;  4L8J A;  4ZK9 B;  2QEX A;  2PNH A;  3HOZ G;  3PUX A;  2RSN A;  4DUZ L;  2WII B;  4LW1 A;  4DUZ Q;  1Q86 C;  3TEH B;  3OW2 A;  3S1Q H;  4DR3 L;  1AH9 A;  5C0X J;  3PF4 A;  4DXF A;  1BCP D;  4N9P A;  3OHX C;  2RHQ B;  4RHS A;  2CHB D;  4DV5 L;  3S9W A;  3D4R A;  5C0X G;  1JWU D;  3PIO A;  3ULP A;  1X32 A;  3NUC A;  3KLS A;  4QGU A;  4WFN 3;  3I4O A;  5IP9 H;  4L5Q A;  3T4A C;  2HHH L;  4DR7 Q;  5FLX c;  2HHH Q;  4DV4 L;  2F0V A;  4DV4 Q;  1XNQ Q;  4F8M A;  2JA5 H;  3DXJ C;  2ES2 A;  1JR0 D;  4YCW A;  4X64 Q;  2V4D A;  1HZ9 A;  3QWN A;  3WOE A;  1O7L A;  2Z6K C;  3OYY A;  2K1B A;  1VQ6 A;  1XPO A;  5GAG C;  1R4P B;  1SJH D;  4K2K A;  4A76 A;  1EZ8 A;  1EEF D;  1QVG A;  1WTO A;  4JVZ A;  1YNN C;  4A3K B;  4KY7 A;  1EQT A;  4HIO A;  2XRS D;  1T5E A;  4JPB W;  4BBS H;  4DR1 Q;  4RGT A;  3S2D H;  2D2C C;  2XGT A;  2FIN B;  3D8G A;  5IWA L;  5IWA Q;  1IYJ B;  1VQM A;  1N34 L;  5C5M A;  1JCK B;  2YTY A;  2LY7 A;  2PPB C;  5M3M B;  3GTG B;  3I91 A;  1SJE D;  3PV0 A;  1EYD A;  3W3A A;  1EIY B;  1BCP B;  2AWN A;  4A3K H;  1DOL A;  1UEA B;  1GKH A;  4KLK A;  5I9O A;  1SE4 A;  1QWY A;  4LMQ D;  3H09 A;  4IFD J;  3DEP A;  4V0B A;  1WTH A;  3CPW A;  2E5L L;  2YU9 B;  5C44 B;  2E5L Q;  1OXV A;  2AUJ D;  2E2J B;  1EIH A;  4NXM Q;  2BH2 A;  3GTG H;  4DV2 Q;  2YTX A;  4OEM B;  1VQ4 A;  3MFG A;  1EFW A;  2VL6 A;  4ZAI A;  1H9S B;  1PZK D;  5J22 A;  5LMU L;  2I5H A;  1X6O A;  1HZA A;  2XWB B;  4JI7 Q;  2R92 H;  2OXP A;  4GLV B;  5C4H A;  1O80 A;  3A0J A;  1J9O A;  5LMN L;  4A3G H;  2K75 A;  4N8X 1;  2NN6 G;  3D4D A;  2B39 A;  1PYS B;  1DOM A;  5C44 H;  2YU9 H;  2SNS A;  1SRO A;  3J7Z C;  5EPL A;  1AZQ A;  2Z6B A;  1EOT A;  5CGK A;  1LT5 D;  1K8O A;  3MXU A;  1SAP A;  1IBM Q;  1KAB A;  3IFT A;  1STG A;  4IOA A;  4KY6 A;  1OO9 B;  1SNM A;  3OOC A;  1SND A;  2DUD A;  1FNV A;  5IIF A;  4IUQ A;  1GUO A;  2A68 C;  3TDQ A;  1V1O A;  2A73 B;  3UI2 A;  2FMM A;  4JC0 A;  5M5X B;  2JA8 B;  1LTR D;  2R93 G;  2A6E C;  1YBY A;  5M5Y B;  4YWK A;  1F9Q A;  2DJG C;  4JI3 L;  5C4X G;  3T56 B;  4WRD A;  4FVM A;  4Y52 H;  4YIJ A;  3SE0 A;  2KEE A;  4KKT A;  2CH4 W;  1MD2 D;  1PH5 A;  2BE5 D;  4N8F A;  4QIW B;  1QZH A;  2N55 A;  1EIF A;  1S5E D;  1Z6H A;  2QCP X;  4PNY A;  1RD9 D;  1BUV T;  4DAM A;  4DKA C;  4J1M A;  2JA8 H;  5FK9 C;  1YIT A;  2NZH A;  5NUC A;  1SE3 A;  5M5Y H;  2HD3 A;  1PFB A;  3K0X A;  4RMF A;  1A62 A;  1BXT A;  3S1M B;  2IPK D;  1HH2 P;  2A6H C;  3OSO A;  5I2Y A;  2A19 A;  3MFY A;  4DFA A;  4IUV A;  4R8I A;  2NZO A;  4HCE A;  5J1Z A;  3K58 A;  4B3M L;  1LYL A;  3K81 C;  2Y0S G;  3KLR A;  1YI2 A;  1F9S A;  1ZYR C;  1PH7 A;  1HPC A;  1II3 A;  1BBU A;  3H0G B;  3S1M H;  1L1O B;  5E4X A;  1U4L A;  4HJ5 A;  2G9D A;  4RWS C;  3TSS A;  2G5D A;  1JC7 A;  3KLS X;  3VYS A;  1E1T A;  4DA2 A;  3RN2 A;  2K32 A;  2H5X A;  4IJH A;  4UDU C;  2J7Z A;  4MIU A;  3Q8D A;  1UWV A;  2B8G A;  1PYB A;  4POF A;  3PUZ A;  3H0G H;  1JIC A;  1NTG A;  3T13 A;  1VQ8 A;  4QB4 A;  2IX3 A;  1C7Y A;  3NBH A;  1C0A A;  4LF7 Q;  1AE2 A;  2D9U A;  1EQQ A;  4ZLT F;  4OWW B;  3HGB A;  4AQY L;  4TRD A;  5IYB G;  4AQY Q;  1HNZ L;  2OTJ A;  2N78 A;  4LFC Q;  1F77 A;  2OEO A;  2B2T C;  2F0N A;  3VR6 A;  2FHT A;  2Z1C A;  2ZJQ A;  3TRZ A;  3K0Y A;  3N6R A;  1VQO A;  4LF4 Q;  4B3R L;  3BVM A;  1QJO A;  4B9W A;  1LTS D;  1YEZ A;  1LLR D;  4KHP L;  4LF6 L;  3VR4 A;  4KHP Q;  1U4R A;  4B9X A;  2Y0S E;  2HCI A;  4DPG A;  1KHI A;  3L7Z C;  2L4N A;  1J6Q A;  3CCQ A;  2PQE A;  4FNF A;  4KJO A;  5IY0 A;  3B6Y A;  1WYD A;  2B2U A;  4QUC A;  2QKI C;  4R4Q A;  2I5M X;  5F2D A;  1C4Q A;  2Z0S A;  2DGY A;  4A75 A;  3S15 H;  1Y8N B;  3I4M B;  2PQA B;  2JEB I;  4X66 L;  3A55 A;  4ME3 A;  5EBC A;  1JT8 A;  3K5M A;  1IYU A;  3M7N A;  1X3Q A;  2E2I H;  3CD6 A;  3VR2 A;  1R9T B;  4C3J B;  3S1R B;  4DR5 Q;  4IJL A;  1I50 B;  4EQO A;  5KND A;  4DAP A;  1XMQ L;  1UNS A;  4RFB A;  1IBK Q;  5IT9 c;  3I4M H;  1YNN D;  1TT2 A;  1PZI D;  1SNC A;  2F0T A;  1SXT A;  3GTP B;  3Q22 A;  3MXN A;  1R9T H;  4C3J H;  3S1R H;  1DYQ A;  2ZTD A;  1KAA A;  1I50 H;  1U4M A;  3DEO A;  5KRU A;  3F1Z A;  4GS3 A;  1GD7 A;  4AH6 A;  1IZ6 A;  2OWO A;  2ZXR A;  4A3D H;  1KDA A;  3J81 c;  3FEW X;  3OTO Q;  1S40 A;  3M4O B;  2A5H A;  1I5F A;  3VR3 A;  3CMA A;  1HTL D;  4YCV A;  3GTP H;  1LAB A;  2NN6 I;  2V1C C;  3FRP B;  3O13 A;  5ELC A;  4L5T A;  4OL7 A;  1LV9 A;  3MHB A;  3H94 A;  1A15 A;  3LWU A;  2B3G A;  4CJ1 B;  1VMP A;  3UDF A;  1XTD A;  2NTS A;  3VA5 A;  4LFA L;  4JI8 L;  4JI8 Q;  3TP8 A;  1YJ9 A;  4A3C H;  3M4O H;  4M8A A;  1E2Z A;  3R8B A;  1A0I A;  4R9W A;  3JC6 6;  3QG1 A;  1S4Z A;  4IN3 A;  1CZW A;  3MEH A;  1O7I A;  3V96 A;  1G6P A;  4A3B B;  3TQY A;  1S72 A;  1Q81 C;  1WTV A;  1L2F A;  2WV6 D;  1PH6 A;  2K04 A;  1KDB A;  5LL6 S;  4CHT B;  4B3T Q;  4R4C A;  3CCE A;  1RCV D;  1HR0 W;  3F2C A;  1S5F D;  2KCC A;  2UUC L;  4JI6 L;  3VYU A;  4BBR B;  4JI6 Q;  5KEE A;  2UUA L;  2VUM H;  1FNW A;  2UUA Q;  4IUP A;  4HID A;  1EIG A;  5GQO A;  1WTP A;  4A3B H;  4KN7 C;  2B2V C;  3R3O A;  4JBW A;  3DUZ A;  1DZ1 A;  5CR3 A;  3TRE A;  1Q12 A;  3A8K E;  4H0L C;  5ISR A;  2A68 D;  4G4K A;  3I90 A;  1A2U A;  4IPH A;  4BBR H;  2L55 A;  4HMJ A;  5JJZ A;  1E2W A;  5JOB A;  2CFM A;  4TVA B;  1UE7 A;  2A6E D;  1I94 L;  4P74 A;  1I94 Q;  5FLM H;  1AP0 A;  1PH8 A;  3P75 A;  2M2L A;  1IBL L;  2ATW A;  1IBL Q;  5IYD H;  4X3U A;  4X65 Q;  1X3E A;  4GN5 A;  4NDX A;  3NPP A;  5M5W B;  4GKK L;  2FXQ A;  1KQS A;  3NQT A;  4I65 A;  4JI5 L;  4JI5 Q;  4UHV A;  3J80 L;  5KIX A;  2RCF A;  1K83 B;  5IOC A;  1GJX A;  3J80 i;  2C5C A;  4HJ9 A;  2O2L D;  3W1B A;  5CV5 A;  1STH A;  3DLL A;  3DM1 A;  2EY5 A;  1TY0 A;  2A6H D;  4HIM A;  2F0E A;  2BDO A;  5ELD A;  3CQZ B;  2LFN A;  3LGJ A;  1LUZ A;  4X3S A;  1SE8 A;  3HRZ C;  4GOP C;  4NB3 A;  1N33 L;  3FKI B;  1K83 H;  3PUV A;  5C6A A;  1ZYR D;  2XIW A;  3A5Z B;  3AMU A;  5GAH C;  4C3H G;  4DV0 Q;  1W6J A;  3CRL C;  3NQI A;  1V9P A;  4MN3 A;  2NVQ B;  2KED A;  2Q2I A;  3MAQ A;  1FGU A;  4JI2 Q;  1HJP A;  2EJG C;  4DV3 L;  3PQI A;  2HIV A;  3CQZ H;  3PO2 H;  1SYG A;  3AU7 A;  4A3M B;  1AW7 A;  5ELE A;  5AJ3 Q;  2VB3 X;  4A3E B;  1KNA A;  3FKI H;  3I4N G;  4HN7 A;  4QY7 A;  4JI1 L; 
#chains in the Genus database with same CATH homology
 4C1N K;  4ID6 A;  3S14 B;  1GOZ A;  4J6H A;  3GTQ B;  4TSS A;  4IUU A;  1WTW A;  2I46 A;  2F0L A;  4QF4 A;  4DAV A;  1UUP A;  2JE6 I;  4ZUI A;  1PTO F;  1GXD C;  3SK6 A;  3ND9 A;  1JE4 A;  2IX1 A;  1D5M C;  3K59 A;  1CI3 M;  3QB3 A;  3A7L A;  5JEA J;  4OIJ A;  2KEC A;  4K14 A;  4HTH A;  2KCN A;  4PMC A;  4Z9C B;  2ZT9 C;  3E5S A;  1I4X A;  5D14 A;  4JK1 C;  3Q23 A;  3LX0 A;  4K6D A;  2NZ1 D;  4DNT B;  2B2Y C;  1GUN A;  3CU7 A;  3DWA A;  3VR5 A;  1ET6 A;  2AQ2 B;  4BY1 B;  1HFN A;  2JA7 B;  3W2D A;  1D5X C;  3BVG A;  2M00 A;  4BS9 A;  3A56 A;  3HOZ B;  1JWS D;  1KNE A;  1VCI A;  2PMZ B;  4RCN A;  1O7Y A;  2C9O A;  3C1F A;  3NWT A;  1VF5 C;  2I07 B;  3K57 A;  2X6G A;  2F0I A;  4K6L A;  1F2Z A;  4UAI A;  4CJ0 B;  1F2L A;  3PUY A;  1IHZ A;  1WVL A;  1PYW D;  2SDF A;  4KMU C;  1BO0 A;  2MGS A;  5CV7 A;  5CBE E;  4MHE A;  1Y8O B;  4HSP A;  1PRT C;  2KOL A;  2ZXO A;  2PZU A;  4RAU C;  5C0X H;  1GUW A;  2F0J A;  3M7G A;  2R61 A;  3V05 A;  1QG7 A;  4XT1 B;  2F4I A;  5EPK A;  3ND8 A;  4DAY A;  1KLU D;  2K28 A;  1CFM A;  1TWA B;  3SR1 A;  5COY A;  2IX0 A;  2SOB A;  2K01 A;  2B2W A;  3NE5 B;  2L1B A;  2N88 A;  3MZ5 A;  5BN3 A;  2R6G A;  4BBS B;  1CHP D;  5JVH 3;  1H9M A;  1IL8 A;  1HXY D;  3S2D B;  3GV3 A;  1JQY D;  3MVV A;  4K5V A;  5HGT A;  5EKI A;  1ILP A;  1BR9 A;  4IQZ A;  3V2T A;  4KI0 A;  5CV9 A;  2JYO A;  3TP7 A;  1QIL A;  3I70 A;  5TSS A;  3MC0 B;  4DNR B;  1PDQ A;  4LK1 C;  5J39 A;  5D3I B;  2L5T A;  1DCZ A;  1SMY C;  4U67 3;  2RDH A;  1QNU A;  3HS0 C;  2F1M A;  1XYI A;  3URY A;  4Y7N B;  2R92 B;  4K5X A;  4X3K A;  4A3G B;  3QIA A;  2NN6 H;  5KYL A;  3BS1 A;  4HMI A;  3HP3 A;  2NVY B;  3T51 B;  4IFD G;  4OO1 G;  4H44 C;  1HRJ A;  2X6L A;  4IUT A;  3SEB A;  4HED A;  2Q8T A;  2PO4 A;  2R93 B;  5A35 A;  4HAE A;  4K8J A;  1FD7 D;  3FMC A;  4FP5 D;  5C4X B;  5K36 G;  2PNR C;  1F9R A;  1EY5 A;  1ZKO A;  1SYD A;  1EZ6 A;  1Q90 A;  3SDZ A;  3SK4 A;  1HCZ A;  3IL8 A;  3C3L A;  1H9S A;  4IUN A;  4EGV A;  3BDC A;  2EZV A;  2HDM A;  1I4Q A;  4DXG A;  1LTA D;  1NR4 A;  1A3V A;  1NAP A;  3GQB A;  3IFD A;  3NTH A;  3ONA B;  3BYT B;  4C2M B;  2PCF B;  4G7O C;  2B2V A;  4XDX A;  3R2I A;  2ID0 A;  1SYB A;  1SSO A;  1ENF A;  4QMG A;  4KHV A;  2B8F A;  3D6C A;  1IKM A;  3EQL C;  2BDN A;  4RA8 A;  1I4R A;  2PYK A;  3DMU A;  2SNM A;  3I3C A;  4G57 A;  4ZRZ A;  2SEB D;  2EYJ A;  1BCP F;  1D1I A;  2EY1 A;  2MJ8 A;  3PIO 3;  1FGB D;  3S16 B;  3T16 A;  2WIN B;  2H1E A;  1TWC B;  4F88 A;  1BOS A;  2K5W A;  4XT3 B;  2ENB A;  5DM7 3;  2ZXP A;  3GP7 A;  1OXT A;  1SBB B;  4L63 B;  3EJI A;  2RQX A;  1LTT D;  3VA7 A;  2FMC A;  1HTP A;  1SYF A;  2H4O A;  1EEI D;  4P2C B;  3R93 A;  1GUG A;  4XQJ A;  5ELB A;  4CJ2 C;  5IGC A;  3OMC A;  1PRT D;  5C0X I;  5DM6 3;  3HZX A;  2EPB A;  4XIG S;  1EYA A;  3FPU B;  1EY6 A;  3PIP 3;  1BBX C;  2JA5 B;  4G7Z C;  2F0S A;  3S15 B;  2VXW A;  2E2H B;  3DWP A;  2NYZ D;  2E2I B;  2PW5 A;  2NWG A;  4KD4 A;  3RUZ A;  4B08 A;  2O4X A;  2RDG A;  1V1P B;  4BWG B;  1Z47 A;  2JXM B;  3Q24 A;  2XNA C;  1F2Y A;  3WDN A;  5EGT A;  1SEB D;  5FO7 B;  5I6W A;  1RTO A;  1STY A;  2XRQ D;  1PZJ D;  5BN4 A;  4PMB A;  4PMW A;  4BA1 I;  4A3D B;  1PRT B;  5I4D A;  2EY2 A;  4X3T A;  5DNF A;  2NB0 A;  2TMP A;  3IAY A;  1HA6 A;  1SMY D;  5IGF A;  1G29 1;  2X69 A;  5D3D A;  1H9J A;  1I4P A;  4IFD I;  4OO1 I;  1SDF A;  2E75 C;  4KD3 A;  4CKC A;  3EFX D;  1U4P A;  3SK5 A;  3R2T A;  1B2T A;  2F0D A;  3BG3 A;  2WB1 B;  4DF7 A;  1TWG B;  2XWJ B;  1G8Z D;  3J80 E;  1A3T A;  3I72 A;  3TP5 A;  1EY7 A;  3GTL B;  1B3A A;  4RH6 A;  2VUM B;  4XQN A;  5AFW A;  2EYH A;  1FR3 A;  1H9K A;  5DAU A;  3A7A B;  2EJF C;  2KQ3 A;  1EY8 A;  2IJ0 A;  4ZKB B;  2KA7 A;  2F3W A;  2MUY A;  1O78 A;  3QOJ A;  2KHS A;  4NP5 A;  2Q8I B;  1ONL A;  1EU4 A;  3MA2 B;  1TS4 A;  3OWE B;  4OHJ A;  3TZD A;  3KF8 A;  3FVQ A;  1B50 A;  2DNE A;  1CHQ D;  5IGG A;  4C3H B;  2NBF A;  1LT3 D;  1S5D D;  4PQX A;  4C1N I;  2BCO A;  5G3L D;  5EJW A;  2HUG A;  1B44 D;  4I7Z C;  3BZD B;  3RLF A;  1CT1 D;  2GA4 B;  3BYY B;  1DD2 A;  4CBV A;  1SYE A;  2IL8 A;  3MXP A;  1VMC A;  5C3W A;  3HEJ A;  1EQV A;  1ENC A;  1BF4 A;  3PO2 B;  4ILW A;  2QDB A;  4RGM A;  4K8I A;  3U9S A;  3QOL A;  2NVX B;  1CA6 A;  1A2T A;  5A2Q L;  1TKW B;  4XTC S;  2EYO A;  3N52 A;  1DXM A;  2XVS A;  4KK7 A;  4C56 C;  3GO5 A;  1JOO A;  1Y8P B;  1I3Q B;  2CW0 C;  5T1I A;  2O5I C;  1QCB D;  1GUS A;  2MPM A;  1LAC A;  3I4L A;  3KBX A;  1G2S A;  4OGQ C;  2NVT B;  1XWE A;  2R3Z A;  4LAA A;  4A3F B;  3GD7 A;  4DK1 A;  2F0G A;  2K05 A;  2Q8R E;  1WD1 A;  3J7Y W;  2WKD A;  2F0O A;  3OIQ A;  2EYM A;  2CVR A;  1D5Z C;  1PFM A;  1VF7 A;  2WKC A;  4C3I G;  3I73 A;  1BQQ T;  1LTI D;  3P1H A;  1Y1W B;  3VYT A;  2RKS A;  3H91 A;  1HUM A;  5JEA G;  3QJY A;  1I4G A;  2DN8 A;  5JAV A;  1NSN S;  1OXX K;  3OPO A;  2B2U C;  4CGY B;  3HOU B;  3MTS A;  1ET9 A;  4HSV A;  2F0M A;  1TS3 A;  4O1N A;  4N9T A;  4ZUJ A;  5JVG 3;  1G2T A;  1IW7 C;  1PMR A;  3M85 A;  3HOV B;  5M3F B;  1GHK A;  1CQF A;  1A6X A;  3TME A;  2YYZ A;  3H3V C;  4DK0 A;  1B4O A;  3SXH A;  5EPJ A;  3LNN A;  3GTM B;  5CV6 A;  2F0W A;  3ERQ A;  1HQR D;  4EVO A;  5IGB A;  3CRK C;  2F3V A;  1X3P A;  4HR7 B;  4V19 0;  4CKB A;  2MP1 A;  1D6E C;  4OIK A;  1AZP A;  3GTJ B;  3OWF A;  1R4Q B;  1FNU A;  3RZO B;  1RHP A;  4ODG A;  3E6Z X;  2ICE C;  1W6K A;  1EY4 A;  2RDF A;  3M4Y A;  5C4J B;  1ZXT A;  4KN4 C;  2IW3 A;  4R8N A;  5M9O A;  2B2T A;  2PZT A;  4NMZ A;  4RGO S;  3L3O C;  4EQN A;  2AWO A;  1LTB D;  1TS5 A;  2DY7 A;  1C8C A;  4KKU A;  1G91 A;  2K5Q A;  3KK7 A;  4L6T B;  1SFO B;  5COR A;  3QO2 A;  1QE6 A;  1ML0 D;  1ESR A;  5JPN C;  3J7A V;  2G9H D;  1TWH B;  3J7A F;  3NBI A;  3TN2 A;  2LS0 1;  1V8Q A;  3Q0A A;  2KVM A;  1JOK A;  2XSC A;  4DGZ A;  2J0T D;  3X3N A;  5I2X A;  3JAM L;  5FLX E;  1SNO A;  1PLF A;  2XN9 C;  4IFD H;  2Z8L A;  4ME5 A;  4OO1 H;  3TZU A;  1WTQ A;  3MWY W;  1AFP A;  3PMF A;  2A69 C;  3TP6 A;  4FXG C;  1QOH A;  1Q3L A;  1HHV A;  1PTO C;  5K36 H;  5E4W C;  1O7Z A;  1YNJ C;  4BA2 I;  1Q8I A;  1Y69 U;  1RJT A;  1EWC A;  5E3F A;  1HUN A;  1WTX A;  1CZG A;  2EYL A;  1MBY A;  1TU2 B;  5JPM C;  1TY2 A;  5BN5 A;  1DOK A;  1RDP D;  1U9R A;  3PO3 B;  1CQV A;  2RBM A;  4XXE A;  2JEA I;  2CW0 D;  1IYV A;  4KV6 A;  2OF1 A;  1AN8 A;  3PUW A;  1SNQ A;  1SYC A;  2HDL A;  4PV1 C;  5DEH A;  2RSO A;  1JWM D;  1TII D;  5FLX L;  2QEJ C;  1BDO A;  2Y0S B;  1UAP A;  3K5O A;  2RVL A;  3AB9 A;  3HG9 A;  4ZYS A;  1STA A;  3SK8 A;  3OIP A;  4FYD A;  1XXG A;  1M8A A;  4GZY C;  4XYQ A;  2TSS A;  4F7X A;  1S5C D;  3L9A X;  1QNK A;  3NTK A;  1H9R A;  3BVZ A;  1NR2 A;  1WTR A;  2LKV A;  5ELF A;  1XTC D;  4U68 A;  2O5J C;  3P7J A;  1ESF A;  3ERO A;  3K5L A;  4J8Q A;  3A8J E;  1EY0 A;  3DHQ A;  1HQM C;  3A8I E;  4EQP A;  4KJN A;  4F87 A;  1K8M A;  1CA5 A;  1B9N A;  2K5D A;  2BA1 A;  4TQU S;  3I8Z A;  2OT2 A;  1OXS C;  3HOX B;  2K7V A;  4NKL A;  1DON A;  2Z4I A;  2WAC A;  3CHB D;  1VDZ A;  3FDT A;  1IW7 D;  2HCC A;  3S2H B;  2K33 A;  2D5D A;  2EOT A;  2JSO A;  5KGU A;  3K7A B;  1HA5 A;  1LO5 D;  1TWF B;  1MI2 A;  5CBA E;  1PXU A;  1TVX A;  5I6Y A;  1QB5 D;  4KY5 A;  1LTG D;  2EY6 A;  5FO8 B;  4H7B A;  2EDG A;  1JOR A;  3DWQ A;  1WCM B;  1D1K A;  2AQ1 B;  1D2B A;  1WD0 A;  1F2M A;  2F0U A;  4QUF A;  3P20 A;  1RKN A;  1KLG D;  3HOY B;  4CKE A;  1J8I A;  1A3U A;  1Z7T A;  2WP8 J;  4RKL A;  2AUK A;  4FF1 A;  1EFI D;  2L0C A;  3C2P A;  2L12 A;  1AEX A;  3NK9 A;  4E6I A;  3M3Y B;  2B2W C;  4S3S A;  2ICI A;  3E0J A;  1SE2 A;  3D3R A;  3U9O A;  2QF7 A;  5CMD A;  1L0X B;  5FOB B;  5IOD A;  5CV4 A;  2B2Y A;  3NXW A;  5C3X A;  1TS2 A;  3C46 A;  1TR5 A;  1DJR D;  4FF4 A;  4M1U B;  2L9H A;  5IGE A;  1JOQ A;  2FFK B;  4IUR A;  2VNU D;  2BOS A;  1FYC A;  3X3M A;  4IAL A;  3KUP A;  1V1P A;  4FF3 A;  4QCL A;  3NSW A;  4FXK C;  1ROD A;  4A3I B;  1M4V A;  4FF2 A;  4O42 A;  3H6M A;  1LT6 D;  1NCV A;  4Q5V A;  4RGN A;  2A69 D;  3C1E A;  1JB3 A;  2FJ2 A;  3MXG A;  1BNZ A;  3SHL A;  4KHZ A;  2LMC B;  1PTO D;  2A74 C;  5IT9 E;  3GTO B;  4ABN A;  5C3E B;  1YNJ D;  2Z4H A;  1B1Z A;  1I4H A;  4AYB B;  2JA6 B;  1B9M A;  1MGS A;  2KJX A;  2F03 A;  3A54 A;  3FPP A;  4C3J G;  3SVM A;  2AQ3 B;  1Q1B A;  2J4X A;  3J81 E;  3BDO A;  1Q1E A;  5KNB A;  1BCP C;  5LHY 1;  2KUM A;  1MSG A;  2EE1 A;  5A2Q E;  4RKB A;  1STN A;  3RD4 A;  1ILQ A;  1RTN A;  2NUC A;  1G6Z A;  2EYF A;  3NHH A;  3Q6S A;  2K6A A;  2E76 C;  4KKS A;  2QIL A;  1STE A;  4G7H C;  5T1G A;  2E74 C;  1HFG A;  1I6H B;  2EJM A;  4FXD A;  1ICW A;  1EYC A;  1CTM A;  1PTO B;  4KTA A;  1OXU A;  1EY9 A;  1EU3 A;  1E0B A;  3HOW B;  1GHJ A;  5C5L A;  5IT9 L;  1PRT F;  2F0Q A;  4K5W A;  3I4N B;  3ITP A;  5LL6 X;  3D4W A;  1IKL A;  4H13 C;  3KBG A;  5K5P A;  3NP8 A;  5E1F A;  2NTT A;  3BDL A;  3CKI B;  1PTO H;  5KNC A;  2IT1 A;  4TKO B;  1SNP A;  1EWH A;  3GTK B;  3ZYY X;  2EVB A;  3J81 L;  1MSH A;  2DNC A;  2EXZ A;  4A93 B;  4ZQ3 A;  4HCS A;  3HKZ B;  3OMG A;  2RA4 A;  4K2L A;  4IZ8 A;  2K03 A;  1ZEQ X;  1DM0 B;  2L11 A;  4RHR A;  5FO9 B;  2M9V A;  1PFN A;  2CQA A;  4C3I B;  5C4Z A;  1B53 A;  2DY8 A;  2VB2 X;  3RZD B;  1E2V A;  1T5X D;  3K6O A;  5FKA C;  3NWS A;  2F0H A;  3F2U A;  5CV8 A;  1XX8 A;  2R7Z B;  2B63 B;  4A3J B;  2PW7 A;  5JEA H;  3T53 B;  5CYU A;  5EKL A;  4WOR A;  2IWH A;  1CK1 A;  3EVQ A;  4LJZ C;  2EYP A;  4DU9 A;  1F9P A;  5CC4 A;  4BY7 B;  3S1N B;  5EKK A;  3D31 A;  1GUT A;  2WAQ B;  4NW2 A;  4ZKC B;  1I6V C;  2BE5 C;  4XQQ A;  3G6J B;  2HQE A;  2F0F A;  3NTI A;  1S5B D;  5HUR A;  3TBI B;  2JP1 A;  1KDC A;  2E2D C;  3LWE A;  3D6W A;  2MHV A;  4RCO A;  2F0P A;  1L0Y B;  3IKJ A;  2BA0 A;  4FO2 A;  3RMH A;  1TQO A;  3EA6 A;  1EL0 A;  3G7L A;  1LT4 D;  5KYI A;  4DN4 M;  1RF2 D;  3VYR A;  3OW7 A;  3S17 B;  5EQ0 A;  1ENA A;  1Y1V B;  1NUC A;  5G3L F;  5D65 A;  1C48 A;  1CM9 A;  4ULL A;  4XYO A;  2PZW A;  4WJW A;  4Q0F A;  2D62 A;  3WOF A;  5EBD A;  3JAM E;  5IGD A;  3S1Q B;  3GV6 A;  3K5N A;  1V43 A;  1KTK A;  2F0K A;  1STB A;  5I9P A;  4L8J A;  4ZK9 B;  3PUX A;  2RSN A;  2WII B;  5C0X J;  4DXF A;  1BCP D;  4N9P A;  3OHX C;  4RHS A;  2CHB D;  3S9W A;  3D4R A;  5C0X G;  1JWU D;  1X32 A;  3NUC A;  3KLS A;  4WFN 3;  3T4A C;  2F0V A;  4F8M A;  3DXJ C;  1JR0 D;  2V4D A;  3QWN A;  3WOE A;  1O7L A;  2K1B A;  1R4P B;  1SJH D;  4K2K A;  1EZ8 A;  1EEF D;  1WTO A;  1YNN C;  4A3K B;  4KY7 A;  1EQT A;  2XRS D;  1T5E A;  4RGT A;  2D2C C;  2FIN B;  3D8G A;  5C5M A;  1JCK B;  2LY7 A;  2PPB C;  5M3M B;  3GTG B;  3I91 A;  1SJE D;  3PV0 A;  1EYD A;  3W3A A;  1BCP B;  2AWN A;  1DOL A;  1UEA B;  5I9O A;  1SE4 A;  1QWY A;  4LMQ D;  3H09 A;  4IFD J;  3DEP A;  4V0B A;  2YU9 B;  5C44 B;  1OXV A;  2AUJ D;  2E2J B;  1EIH A;  3MFG A;  4ZAI A;  1H9S B;  1PZK D;  5J22 A;  2XWB B;  2OXP A;  5C4H A;  1O80 A;  1J9O A;  2NN6 G;  3D4D A;  2B39 A;  1DOM A;  2SNS A;  5EPL A;  1AZQ A;  1EOT A;  5CGK A;  1LT5 D;  1K8O A;  3MXU A;  1SAP A;  1KAB A;  3IFT A;  1STG A;  4KY6 A;  1OO9 B;  1SNM A;  3OOC A;  1SND A;  1FNV A;  5IIF A;  4IUQ A;  1GUO A;  2A68 C;  3TDQ A;  1V1O A;  2A73 B;  3UI2 A;  2FMM A;  5M5X B;  2JA8 B;  1LTR D;  2A6E C;  5M5Y B;  1F9Q A;  3T56 B;  4WRD A;  4FVM A;  4YIJ A;  3SE0 A;  2KEE A;  4KKT A;  1MD2 D;  2BE5 D;  4QIW B;  2N55 A;  1S5E D;  1Z6H A;  2QCP X;  4PNY A;  1RD9 D;  1BUV T;  4J1M A;  5FK9 C;  5NUC A;  1SE3 A;  1PFB A;  1BXT A;  3S1M B;  2IPK D;  2A6H C;  3OSO A;  5I2Y A;  3MFY A;  4DFA A;  4IUV A;  4R8I A;  4HCE A;  5J1Z A;  3K58 A;  3KLR A;  1F9S A;  1ZYR C;  1HPC A;  1II3 A;  3H0G B;  5E4X A;  1U4L A;  2G9D A;  4RWS C;  3TSS A;  1JC7 A;  3KLS X;  3VYS A;  4DA2 A;  2K32 A;  4UDU C;  2J7Z A;  4MIU A;  2B8G A;  3PUZ A;  1JIC A;  3T13 A;  4QB4 A;  2IX3 A;  3NBH A;  2D9U A;  4ZLT F;  3HGB A;  4TRD A;  1F77 A;  2OEO A;  2B2T C;  2F0N A;  3VR6 A;  2FHT A;  2Z1C A;  3K0Y A;  3N6R A;  3BVM A;  1QJO A;  4B9W A;  1LTS D;  1LLR D;  3VR4 A;  1U4R A;  4B9X A;  2HCI A;  3L7Z C;  2L4N A;  2PQE A;  4FNF A;  4KJO A;  2B2U A;  4QUC A;  2QKI C;  5F2D A;  1C4Q A;  1Y8N B;  3I4M B;  2JEB I;  3A55 A;  5EBC A;  3K5M A;  1IYU A;  3M7N A;  1X3Q A;  3VR2 A;  1R9T B;  4C3J B;  3S1R B;  1I50 B;  4EQO A;  5KND A;  4DAP A;  1UNS A;  4RFB A;  1YNN D;  1TT2 A;  1PZI D;  1SNC A;  2F0T A;  1SXT A;  3GTP B;  3Q22 A;  3MXN A;  1DYQ A;  1KAA A;  1U4M A;  3DEO A;  5KRU A;  2ZXR A;  1KDA A;  3FEW X;  3M4O B;  2A5H A;  3VR3 A;  1HTL D;  1LAB A;  2NN6 I;  3O13 A;  3FRP B;  5ELC A;  4OL7 A;  1LV9 A;  3MHB A;  3H94 A;  1A15 A;  3LWU A;  4CJ1 B;  1VMP A;  2NTS A;  3VA5 A;  3TP8 A;  4M8A A;  1E2Z A;  3R8B A;  4R9W A;  3QG1 A;  1S4Z A;  4IN3 A;  1CZW A;  3MEH A;  3V96 A;  4A3B B;  1WTV A;  2WV6 D;  2K04 A;  1KDB A;  5LL6 S;  4CHT B;  1RCV D;  1S5F D;  2KCC A;  3VYU A;  4BBR B;  5KEE A;  1FNW A;  4IUP A;  1EIG A;  1WTP A;  4KN7 C;  2B2V C;  3R3O A;  4JBW A;  3DUZ A;  1DZ1 A;  5CR3 A;  1Q12 A;  3A8K E;  4H0L C;  5ISR A;  2A68 D;  4G4K A;  3I90 A;  1A2U A;  2L55 A;  4HMJ A;  5JJZ A;  1E2W A;  5JOB A;  2A6E D;  1AP0 A;  3P75 A;  2M2L A;  4X3U A;  4NDX A;  3NPP A;  5M5W B;  3NQT A;  4I65 A;  3J80 L;  5KIX A;  1K83 B;  5IOC A;  1GJX A;  2C5C A;  2O2L D;  5CV5 A;  1STH A;  3DM1 A;  2EY5 A;  1TY0 A;  2A6H D;  2F0E A;  2BDO A;  5ELD A;  3CQZ B;  2LFN A;  4X3S A;  3HRZ C;  3FKI B;  3PUV A;  5C6A A;  1ZYR D;  2XIW A;  3AMU A;  4C3H G;  1W6J A;  3CRL C;  3NQI A;  4MN3 A;  2NVQ B;  2KED A;  3MAQ A;  2EJG C;  1SYG A;  3AU7 A;  4A3M B;  1AW7 A;  5ELE A;  2VB3 X;  4A3E B;  1KNA A;  4HN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...