3SHLA

Crystal structure of staphylococcal nuclease variant delta+phs v74kl25a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEKEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Redirection of internal ionizable residues by engineered cavities
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3shlA00
1EY9A 1SYFA 3MVVA 5CV6A 5C3XA 5J22A 2F0JA 3C1FA 1JOOA 5C6AA 2SNSA 2F0LA 4IUNA 3SK8A 3LX0A 4K5XA 2F0UA 2EYFA 3OMGA 4R8NA 1A2TA 3D4DA 4PNYA 5DEHA 3TP8A 1TR5A 5KRUA 4QMGA 4KD4A 1SNCA 1KDBA 3HEJA 1A3TA 4KY6A 3NXWA 3P75A 3QB3A 4DFAA 3NHHA 5I6YA 3NQTA 5DAUA 1EYCA 5M9OA 1SNQA 2F0DA 4K8JA 5IGGA 4B9WA 4K14A 4HMJA 4IALA 3BDLA 1SNOA 5IOCA 4ZUIA 2EYHA 5C4ZA 3DMUA 1EQVA 4K8IA 4ZUJA 1SYEA 1ENAA 5CR3A 2F0FA 1EY5A 1EY0A 2NUCA 5JOBA 2F0IA 2F0QA 4KY5A 5CV5A 2F0SA 3NUCA 3S9WA 3D4WA 1EY4A 5I6WA 3NK9A 5EKKA 5NUCA 2QDBA 1F2YA 4ME5A 3SR1A 1A2UA 5HGTA 3ITPA 3MZ5A 5E3FA 3RUZA 1EY8A 2F0KA 1SYDA 1TT2A 5C5MA 5KYIA 2KQ3A 2EYPA 1JOQA 5E1FA 1F2MA 4NDXA 5EKLA 4RKLA 3H6MA 2OF1A 4ODGA 2F0NA 2F0EA 3QOJA 4OL7A 4TRDA 2F0OA 3E5SA 5CV4A 3TP7A 3SXHA 2RDFA 3MEHA 5J39A 1ENCA 2EY5A 4K2LA 2EYJA 4PMCA 1IHZA 3OWFA 1EY6A 2SNMA 2EYMA 2KHSA 4NKLA 3TP6A 3D6CA 3PMFA 1STGA 4KD3A 5CV7A 1SNPA 1JORA 2HQEA 3SK5A 1A3VA 4IZ8A 5C5LA 3TP5A 4EQOA 4KV6A 5KIXA 1U9RA 1NUCA 2EY6A 4N9PA 2PW5A 4YIJA 4E6IA 4DGZA 1EYAA 5IGDA 3OMCA 1EYDA 5KEEA 2F0PA 3EJIA 4HTHA 4G57A 2OXPA 1STHA 2OEOA 3NP8A 4KJNA 5CV9A 3TMEA 2EY2A 5CC4A 4KJOA 5I9OA 1RKNA 3MHBA 2EYOA 1SYGA 3D8GA 3MXPA 4NP5A 4WORA 4H7BA 2RBMA 4J1MA 1KAAA 2F0HA 1SYCA 1EZ8A 1A3UA 4PMBA 3DHQA 3SK6A 4B9XA 3U9OA 5EGTA 4DU9A 5K5PA 1STBA 4HMIA 5CV8A 2F0WA 1JOKA 3V2TA 5C4HA 1II3A 2PW7A 2EXZA 4NMZA 4DF7A 5IGCA 1F2ZA 2EYLA 1STNA 4F8MA 4K2KA 1NSNS 4QB4A 1TQOA 1EZ6A 3HZXA 2WACA 2EY1A 2PZTA 4ID6A 5IODA 3T13A 2F3VA 5KYLA 3EROA 3SHLA 3SK4A 4EVOA 2M00A 4ZQ3A 4MIUA 1AEXA 4J6HA 2F0GA 4I65A 4K5VA 1KABA 1SYBA 2F0VA 4KHVA 4K5WA 4EQNA 4WRDA 5IGEA 5JAVA 2PZUA 2RKSA 4EQPA 2SOBA 3QOLA 4RKBA 2ENBA 5IIFA 3BDCA 3R3OA 5IGFA 2PQEA 3C1EA 3OSOA 2F3WA 3P1HA 4K6DA 2PZWA 4QF4A 3T16A 4F7XA 3VA5A 5C3WA 4S3SA 5CGKA 5HURA 1KDAA 5F2DA 4N9TA 2O4XA 5ISRA 3ERQA 1STAA 1KDCA 1STYA 2F0MA 1SNMA 2LKVA 3EVQA 5J1ZA 5I9PA 1EY7A 1SNDA 2PYKA 5KGUA 2F0TA 4KTAA 4LAAA 5IGBA 4KY7A
chains in the Genus database with same CATH superfamily
1Y1WB 4GKKQ 4OX9L 1IKLA 1PXUA 1B7YB 1KD1C 1PDQA 4XTCS 4K5XA 1PFBA 3MXNB 4FVMA 4CKEA 1HQMC 4OGQC 2E5LQ 1KDBA 2B8FA 4DN4M 4RGNA 1JWSD 4BBSG 2E2HB 1I4RA 2E74C 2BA1A 2D0PA 2QF7A 2C5CA 3DLLA 2QKIC 2E2IB 1BDOA 3GDEA 3NWSA 1SYEA 3HOUB 3I4NB 2Q2HA 2F0IA 3VR2A 4NXNQ 3PO2G 3OIQA 3CRLC 1CZGA 5KYIA 1TT2A 3MEFA 5E1FA 5BN5A 2DGYA 1PFMA 3PUXA 3W2DA 1I4PA 2RDFA 3GQBA 4JPBW 2EY5A 1GKHA 2VY3A 1VQ5A 3GD7A 2EYMA 2NZOA 2K4KA 1HNZL 1YVCA 1PTOB 1I6HH 4PMWA 1TWFH 5M3FG 1U9RA 1VMPA 4LFCQ 4DGZA 4IUVA 2D2CC 2VUMB 2F0PA 2WFWA 3W1BA 3M7NA 1HR0W 3GTQH 4L63B 4U68A 1IBKL 2WAQG 2B2WC 4H7BA 4J1MA 1KAAA 1HNWL 3PO2H 1IZ6A 4NPSA 4JI3Q 2A6ED 2N55A 3K80C 1GUGA 1LT4D 5K36G 2MP1A 3MA2B 1Q7YC 1JOKA 2CH4A 2PW7A 1A62A 1RD9D 3PV0A 3HKZB 1NSNS 2EIFA 1V43A 5AJ3L 4BY7B 1KTKA 1E3PA 3S1MH 3CXCA 1YIJA 4EVOA 2WINB 1J8IA 3BZDB 4LFBQ 4A3CG 3F2DA 5EPLA 1H9SB 3QOLA 5IWAL 4BS9A 5E7NA 3ND8A 2A69D 1K83H 2B63B 2ZM6L 3PUVA 2R7DA 1V1QA 1M4VA 1YJ9A 1PTOF 4X3TA 3I4MB 4DPGA 3A54A 2L9HA 5K36H 3ND9A 1GUSA 1AN8A 3KDFA 1Q1EA 4TKOB 2L11A 1EEID 3T1YQ 1XPOA 2XGTA 3CF5A 3J81c 4WJWA 1N34L 4K0KQ 4HIDA 4G4KA 2J0TD 5GAHC 2LFNA 2V4DA 5BN4A 1R9TH 2VL6A 1WTWA 5M3MB 4DK3C 2LXJA 3KFUA 1SNQA 1L0WA 5M5WB 5ELBA 1NY4A 2OTLA 1LTSD 3FPPA 2E2JH 2F0FA 2LMCB 1E1OA 5JEAG 1K8GA 1UNSA 1LT6D 4C3HB 1JWMD 2UXBL 2A6EC 1D5XC 2EOTA 4PQXA 4FDBA 3HOXH 1WOCA 2D5DA 4AYBB 3BS1A 1I6VC 3HOWB 2JA9A 3E5SA 4RMFA 5I2XA 3FDTA 3PIOA 3PUZA 1X3QA 3LGJA 1PH7A 3PMFA 1IBLQ 4KD3A 2YYZA 4FNFA 1S3OA 1C48A 3SK5A 3S1RH 2NVTB 4YCWA 3S14B 5D3IB 5IGDA 4A93H 4EQ5A 4Y52H 1EYDA 3DUZA 1AW7A 2JN4A 4IUQA 5IE8A 5LL6X 4LF8Q 3IL8A 3K0XA 4A3DB 1VQKA 2A69C 2F3IA 1RKNA 2MPMA 2PI2E 1YZ6A 3D8GA 4DV4L 2NVQH 1O7YA 1EZ8A 3GTPH 1SRUA 3U9OA 1PFNA 1S5BD 3A55A 1SFOH 1HH2P 4JI5L 5FLXc 3D4RA 1BOSA 5C3EG 2ZT9C 1A8VA 5EJWA 4L8JA 4O0AA 4GNXA 4JC0A 4BY1G 1CTMA 2K52A 1HZAA 2Z9HA 2Z6BA 3K58A 4JI0L 4LMQD 5EQ0A 3A5UA 4WJ4A 5FO9B 1TVXA 4J6HA 2JA7B 1XJVA 1KXLA 4K5WA 2PZUA 1LACA 4RG1A 3PQIA 4JK1C 4LK1C 3IFTA 2CWPA 1B1ZA 3M3YH 3DWAA 3FP9A 4TQUS 2N88A 3T56B 1LTBD 2K33A 4CGYB 1EIYB 2IX3A 2PZWA 3E0EA 4KKTA 3PGZA 3A74A 2Y0SB 1OXVA 3TZDA 1EY7A 1SNDA 1C4QA 4R1JA 4QGUA 5CC4A 2KHIA 1SYFA 2XRSD 2NWGA 4KN7C 5C3EH 1O78A 2TMPA 4HCSA 4YY3L 1XTDA 2ES2A 4BY1H 1Z6HA 4LF4Q 4Z9CB 3S24A 1LYLA 4QIWE 3KBXA 4X3KA 1SEBD 4O2DA 4A3EB 4DR7Q 2JA6H 1M90C 4JYAL 4Q5VA 1UE6A 1D2BA 4HMJA 5CBEE 4L6TB 2XWBB 5EBCA 3G6EA 1N8RC 3KBGA 2F0SA 3NUCA 5DNFA 4JI2L 5JVG3 5EKKA 2LSSA 1F2YA 3KYHC 2DY8A 4B3RQ 5IWAQ 1HNXQ 1WTHA 2ICIA 3CPWA 2EYPA 2ZM6Q 4JI8L 4NDXA 1CHPD 3H6MA 4CBVA 2F0NA 2L15A 3C3LA 1J5EQ 5J39A 2WAQE 3CAMA 2G5DA 1L1OA 4AQYQ 2PPBC 5C5LA 2E2DC 4DR3L 1XNQL 1U4MA 1TXYA 2IPKD 4DK6C 1QVFA 3PUYA 3OMCA 3FKIB 4GNXC 4H0LC 1IXRA 1Z47A 3GTLB 1KAWA 1QUQA 4C2MB 3MXPA 1WJJA 4X66L 3CPFA 4DV0L 1PH1A 2KCTA 4PMBA 1I94L 1NTGA 1AFPA 3STBD 3SE0A 3S1QB 1VDZA 4OXPA 5IODA 1HPCA 3M7GA 1GO3E 2ATWA 2O2LD 1KLUD 4P72A 3FVQA 4DV1Q 1VQ4A 4C1NK 4DR4Q 3HG9A 1E1TA 1DD2A 1SE4A 4LF6Q 3GTGH 3K5NA 4C3IG 4R4IA 4ZKCB 3GTJH 1GUOA 5AFWA 3UI2A 5FJ8G 1D7QA 5BR8Q 1PH8A 2Q2UA 1K3BC 1EQRA 4FXDA 1HA5A 3LNNA 2WB1E 1IBMQ 3HOVB 1JOOA 3I72A 5T1IA 5EAYA 2Z0SA 3OMGA 5DEHA 1TS4A 3ULLA 2B3GA 2XVSA 4K6LA 3I56A 1VQNA 3AU7A 2RA4A 2NZ1D 3FMCA 1QG7A 3KDFB 4OO1I 4A3GB 1W2BA 1CKNB 4C3IH 1JE5A 1H95A 3G4SA 1VS0A 2F52A 1NE3A 3QWNA 1KRTA 3S2DB 1ESFA 1Y1WH 4NB3A 2NN6I 1A2UA 5GAEC 5E3FA 3RUZA 1EY8A 3RR5A 3BG3A 3OTOQ 1JJCB 2Q2TA 4JI7L 1M8AA 1EUJA 3STBC 1AZPA 2LY7A 2F0EA 1UEBA 4QUFA 1B50A 1BKBA 1HZBA 3MEHA 3CCRA 2HQLA 1SSOA 5T1GA 4BA1I 4PG3A 1PHJA 1VQ7A 2E2HH 4NXML 4DV7Q 3S1RB 3S15B 3KK7A 2KCNA 1RTNA 2UUAQ 2VUMG 1FD7D 2E2IH 2RF4A 4YY3Q 1B8AA 1SN8A 3VYTA 3CRKC 2Z1CA 3HOUH 3I4NH 4DAPA 2KA7A 1TS5A 3BYTB 1F9RA 1U5KA 2IW3A 1LUZA 2B2TA 4JYAQ 4JV5L 1S5DD 1XMQQ 1LTID 1TWAB 5CYUA 3G7LA 1NR4A 4KLKA 3G6JB 5BN3A 1XYIA 4M8AA 2FMCA 5C4HA 4MN3A 1DXMA 1KIXA 4BY7G 1F2ZA 5ELNA 2FINB 2PCFB 4B3SL 1LTAD 5CMDA 1CA5A 1PTOH 4A3KB 1C0AA 1G51A 4JI8Q 3SK4A 4FYDA 4GN5A 2QILA 2VUMH 2ZJPA 2V1CC 1FGUA 1OXXK 2B63G 1HZCA 3DWPA 4GKKL 4OO1G 2SOBA 3BVMA 4IPDA 2X6GA 3H15A 1XX8A 3E9IA 3CCVA 4IOAA 5IIFA 2RDHA 4GNXB 4P75A 2PQEA 3I4MG 3C1EA 3P1HA 2BCOA 1MBYA 3C2PA 1AP0A 2JA5G 1J9OA 1KDAA 2RSOA 4N9TA 3F2UA 4FXGC 1OXUA 3RD4A 1CUKA 3H09A 1EWHA 2K5WA 1DJRD 2FXQA 1VQ9A 4BY7H 4IUNA 3VDYA 1UAPA 4KHPQ 1TR5A 5M3MG 3HOYB 4NXNL 1MHWC 3AQQA 3I4OA 3NQTA 4N8X1 1EYCA 4DXFA 4K8JA 1IL2A 2E75C 2B63H 3P20A 3BDLA 1Q86C 4OO1H 2MGSA 4ME3A 1PZKD 4C3HG 1X65A 3I4MH 1D1IA 5FO7B 1ET9A 2B2YC 1O80A 1TWCB 3NBIA 3VYUA 5I6WA 1EQTA 1BBXC 4AYBG 1U4RA 2NN6H 3AFQA 3CP0A 4DR5Q 3HOWG 4CJ1B 3EQLC 4LFCL 1D5MC 1GM5A 2I07B 4KI0A 2B2TC 2YTYA 4QJFA 1LABA 1PFSA 1X3PA 1ONLA 3D6CA 1DM0B 4JI3L 1X32A 3TSSA 5M5WH 1JORA 3BYYB 2ZTEA 4A3DG 1EIGA 5C4XH 1K73C 1MSGA 1TS2A 3RZOB 3NEMA 4KJOA 2QW7A 2Q2IA 3H0GB 4LF9Q 2L5TA 2B2VA 3PCOB 3J80E 1L1OB 1MJEA 2QCPX 4IPGA 2FJ2A 2RQXA 5K5PA 2QDLA 4LFBL 3HOWH 3I55A 2EYLA 4APVA 2I5HA 2IY5B 4XIGS 1MKHA 1Q46A 2AQ1B 2KECA 5A2QE 4J8QA 4HR7B 1PZJD 2JA7G 5KYLA 2NVTH 3SHLA 3GTMB 3B6YA 2K5VA 3S14H 1SR3A 1ASYA 1O7ZA 1UE5A 5J3BA 5JAVA 4A3DH 4BXXG 1SMXA 1BF4A 3NPPA 2FMMA 2CW0D 2I46A 2OQKA 1DOMA 1JJ2A 1BO0A 4JI1Q 4NXMQ 1C9OA 1JQYD 3A0JA 3T1YL 4OWTB 3CU7A 2MFIA 2Y0SG 5LMNQ 1YNJD 4K0KL 1GHJA 2RCFA 3VYRA 1TU2B 2JJQA 2D62A 3T4AC 4FF3A 3VR4A 1Z9FA 4KTAA 1FJGL 2UXDQ 2R92B 1OXSC 1EY9A 4J15A 4JV5Q 2NBFA 3C1FA 2DY7A 2F0LA 3E6ZX 3JAME 2KHJA 1KC8C 2JA7H 1PRTD 4Q0FA 1LTTD 5JPMC 1GXDC 5I6YA 3J7YW 3CCJA 3MXGA 1KRSA 1FL0A 3GV3A 4I7AA 5IGGA 4IALA 4IJLA 4LF5Q 1U4LA 1VQCA 1VQGA 1TY0A 1YHBA 2NUCA 4XYOA 2KUMA 3D4WA 1IBLL 1VQAA 2GA4B 3H3VI 4A3JH 5IYBG 3MZ5A 1UE7A 2PI2A 2L12A 1F2MA 1PV4A 2A19A 4LF8L 2NVXB 1B4OA 2OCEA 4A3EH 1EY6A 2B2VC 2WKCA 4ZK9B 1JJGA 4H13C 4IN3A 4WFN3 3I70A 2MQHA 1HTPA 3IFDA 3J80L 5KEEA 2PW5A 1EEFD 4E6IA 2CW0C 4KJNA 1AZQA 1YNJC 1RJTA 1DYQA 5A2QL 1X9NA 2R93B 4DK0A 1UUPA 5IYBH 3DM3A 4DV5Q 3VA7A 4MZ9A 4F8MA 1N32Q 5EKIA 4RFBA 2I0QA 3WDNA 2WACA 2KOLA 3Q0AA 1PRTC 4MIUA 4RGOS 4A3MB 3FKIH 1RDPD 4EQNA 1B44D 1H9MA 4KHVA 1E2ZA 3GTLH 1D5ZC 5C0XJ 4C2MH 2K5QA 1RCVD 1XNRQ 5H1SE 4LF4L 3CCSA 1QZHA 4HJ9A 4DR7L 1WI5A 3HGBA 5I9PA 3S1QH 4L5RC 5ELEA 1LT5D 4LAAA 4A3FB 4DR1Q 1A0IA 2IWHA 4IQZA 4UP7A 4Y7NB 2A6HD 1EWCA 3HEJA 4B3RL 4WJ3M 1X56A 3NHHA 1HNXL 5DAUA 4A3GG 3CCQA 3BZCA 4ZKBB 2R7FA 4K14A 3PO3B 3ZJYC 3CCMA 1D1KA 1J5EL 2NYZD 1VF7A 5D14A 3HOXG 4V0BA 3MC0B 4KY5A 2F0QA 3S17B 1KHIA 3F8TA 1EY4A 3H3VH 4AQYL 4FP5D 4B3TL 3TS2A 3HOVH 4ULLA 3CC7A 1JMCA 4RKLA 5GADC 4B08A 2BA0A 3J80i 2VNUD 3OWFA 1YI2A 3ULPA 1FJGQ 4NKLA 4A93G 4N8FA 4IZ8A 4YWMA 4A3GH 3S16B 2EY6A 5C4XB 1O7LA 3EJIA 1B53A 2EY2A 1ICWA 2IHEA 3S2DH 1UE1A 1LTLA 2H4OA 1A3UA 2JXMB 4DV1L 1I4HA 1BBWA 1Q12A 1Q3LA 2H5XA 1JC7A 2ID0A 2QGQA 4DR4L 3NE5B 4GZYC 5C44B 1NMGA 2ALYB 4LF6L 1P8LA 5LMUQ 2PZTA 4ID6A 3NQIA 1BNZA 3S15H 1OTCA 4YWKA 4IFDJ 2A6HC 1QVCA 2NTSA 3EROA 5IT9c 5BR8L 1H9RA 1HR0Q 1SJHD 4ALPA 4DV3Q 2TSSA 4WRDA 4H02A 3PSIA 5IP7H 1IBML 3T51B 2JP1A 3NTIA 3F1ZA 2ENBA 1VQEA 5EPKA 1X55A 1QOHA 4RWSC 4XXEA 3M85A 1TWAH 2HUGA 1GJXA 2M2LA 4F88A 3MXUA 4HIMA 3U58A 3QIAA 2ZXOA 3PIPA 5F2DA 4HSVA 2Z4IA 2ASBA 1R4QB 2F0DA 5IYCG 2JE6I 5C3XA 1PH3A 4GN3B 1SLJA 2F0JA 3HOYG 1G2TA 4A3KH 2B29A 2JA6G 3K57A 3AFPA 4DAYA 3I4LA 2VW9A 4QMGA 2K7VA 4HJ5A 1PRTB 4UPAA 3J81E 3K7AH 3OTOL 1IL8A 1K8AC 4HSPA 5G3LF 2KJXA 3HOZB 1SNOA 3OOCA 1B70B 4YHHQ 5M5XB 1YEZA 1WTXA 1E2VA 2F1MA 2G9HD 4A3JB 1B3AA 4HEDA 4CDDC 2NZHA 4UP8A 5A35A 4C3JB 4DV7L 2XNAC 2PMZE 2UUAL 4L5TA 2EQSA 2K32A 3E9HA 2F0KA 5JEAJ 2F03A 3CCEA 5IYCH 1RIPA 4OL7A 3A7AB 1TWHB 3ZYYX 3RNUA 3HOYH 2NB0A 2EYJA 2Q8IB 1AH9A 4BBRB 1XMQL 2K05A 2QA4A 1JE4A 1SNPA 2R61A 3L2PA 1PH5A 3TDQA 1XMOQ 4X64L 5LL6S 4IJHA 3H0GG 1ZYRD 4LF7Q 2IJ0A 4G57A 3TN2A 1ZXTA 1TWCH 4ZLTF 1LM0A 3L7ZC 4UHVA 2PO4A 1SYCA 1PRTF 4G7OC 4RH6A 1RTOA 3CC2A 1WCMB 4OHJA 4LFAQ 3MFYA 4IURA 5FLXE 4B3TQ 3CMAA 3KF6A 1V1PA 2KEDA 2HIXA 3KLRA 4R9WA 2RHQB 3ER0A 3NELA 1Z7TA 1I50B 3L0OA 4ABNA 3RZOH 2RKSA 1LTGD 4RHSA 1DZ1A 5GQOA 3H0GH 5ELDA 1WTVA 1QNUA 4FXKC 4KHPL 3SDZA 3QG1A 5C3WA 4BBSB 4HAEA 4U673 3R8BA 2QEXA 5M5YB 2LKVA 3TS0A 1SNMA 2CQAA 3I8ZA 3AEVA 2RHSB 2RSNA 1SMYD 3K8AA 1CHQD 4BA2I 5J22A 2IX1A 2L0CA 3K81C 4QIWB 2PNHA 3T53B 2EJGC 2A5HA 3NTKA 3N52A 3TP8A 3GTMH 3X3NA 1B2TA 3AB9A 4GKJQ 4KD4A 1SNCA 4JBJA 1WD1A 4DR5L 2E76C 2ZTCA 1Y14B 2KVMA 2HDMA 1ZYRC 1EQQA 3A8JE 1Y1WG 5I4DA 2K1BA 5M3FB 4CJ0B 2R92H 1CA6A 2DNCA 1JOQA 1TWGB 4TRDA 4DV6Q 2WAQB 3CKIB 1WYDA 3GTOB 3K7UC 4DK1A 1SE3A 1NMFA 4LF9L 1DOLA 3UDFA 2CCZA 3FRPB 2XWJB 4G7HC 3HOUG 3I4NG 3GO5A 1K8OA 1HHVA 5IP9G 3KF8A 2Z6KA 4JW0A 4HTHA 4ZRZA 2OWOA 2EYOA 1LO5D 4YCUA 2F0HA 2R3ZA 4POFA 1E0BA 4X65Q 5FLXL 4DUZQ 2K6AA 3DHQA 3AYHB 3BVGA 1STEA 3MXNA 1S4ZA 4G7ZC 3DWQA 3E3XA 1SMYC 2NVXH 4R4QA 3H94A 4HIOA 4DAVA 3FPUB 3GP7A 2B2YA 4JI1L 1HUMA 1SROA 2Q8RE 2HHHQ 5LMNL 3HZXA 3W3AA 2AMCB 2F3VA 2FHTA 5HY6A 4A3IB 3GTKB 1LTRD 2JYOA 1JICA 4ZQ3A 1ESRA 4JBKA 2K5HA 2ZXPA 3BZKA 2L4NA 3VR6A 2UXDL 5IP9H 4JBMA 5IGEA 1HRJA 4AH6A 4MTKA 1Q8KA 4RKBA 2K28A 2ICEC 2B39A 1O7IA 3I2ZA 5CORA 3U4ZA 4OONA 2R93H 2WIIB 4QF4A 3HKZG 3UDIA 2C35B 5ISRA 3R2TA 4A3FG 4X64Q 1EFWA 3ERQA 2WB1B 4IUUA 1G2SA 1PMRA 2A68D 3OWEB 2CH4W 1WVLA 1OO9B 2IL8A 3FEWX 4LF5L 2XSCA 1BBUA 4A3MH 4RGMA 2VQEL 3K7AB 3CMEA 3NWTA 3R93A 5IY0A 4CKCA 2PNRC 4RA8A 1YITA 4DV2Q 3IAYA 2EYHA 1K0RA 5JJLA 1YNND 1W6JA 5C4JB 1LLRD 2NN6G 5IYDH 4DAYB 2OT2A 3V05A 5JOBA 1XPRA 2XN9C 5COYA 1U0LA 1MD2D 1TY2A 4HIKA 4A3FH 3PF5A 2VZAA 3MWYW 2Z6KC 2F4VQ 3EIVA 2OF1A 1NJIC 4KMUC 4OWXB 1Y1VB 4Y7NH 2P5ZX 4PMCA 1H9SA 2C9OA 3D0FA 2ZJRA 1Q8IA 4CHTB 5C4XG 5CV7A 3PO3H 1A3VA 2FFKB 3NENA 4LUZA 4DV5L 3K6OA 1Q90A 3U4VA 3Q24A 1FR3A 1N32L 5FLMH 3S17H 1VQDA 3F2BA 5D3DA 4TVAB 1F77A 1L0YB 4X3UA 1SYGA 2EJMA 4JI6Q 2HT1A 4LNQA 3S2HH 3TQYA 1Q81C 5C44G 1MJCA 1RHPA 2A68C 4JI4Q 1II3A 1PVOA 3EBEA 4NMZA 5IGCA 1CKMA 2MUYA 3RLFA 2K03A 3M4OB 3CC4A 3NBHA 1Q1BA 1XNRL 3EFXD 4LW1A 3T13A 1V9PA 4X6AH 3S16H 3Q6SA 1AEXA 3UE1A 5FK9C 3IRBA 3PIP3 3P7JA 2EZVA 5JPNC 1VMCA 3OW7A 1A15A 1K28A 4DR1L 1N9WA 1BVSA 1YNNC 1EOTA 5C0XI 4CJ2C 2EVBA 4LWCA 3KF6B 1I3QB 2F3WA 1T5XD 3VA5A 5HURA 3Q8DA 3DEPA 3WOEA 1WTOA 2KBNA 5C44H 4OIJA 1QUQB 4X62Q 4B3MQ 1G6PA 1CZWA 3KLSX 3FHWA 5FO8B 4XYQA 3J7AV 4C56C 4DKAC 1VQIA 3D4DA 3HS0C 3D31A 4KY6A 1TS3A 3OW2A 3EA6A 4QL5A 5M9OA 5EBDA 1Y69U 3DEOA 4MNOA 1GVPA 3CHBD 1ZKOA 4A3JG 1IKMA 3QR8A 4OEMB 1EY0A 4DR2Q 2YV5A 1S40A 2MO1A 2A1AA 4JVZA 4JBWA 1BUVT 4IUPA 1DGSA 2EXDA 4A3EG 1CQVA 3QOJA 3RN2A 4BBRG 2F0OA 2KEEA 5ELCA 3K5MA 1ENCA 2GVAA 4P73A 1IHZA 1NAPA 3HFZB 2H1EA 2ZTDA 1PH9A 2SDFA 2HQEA 3HOZH 1E22A 2R7ZB 1XTCD 4L5QA 5M5XH 3M9BA 3KJPA 2VQEQ 2OXPA 3TMEA 4DR6Q 5LMUL 3PUWA 2BOSA 4C3JH 4DAMA 1DCZA 2DJGC 2HDLA 4IPCA 1HR0L 1X3EA 4DV3L 3TBIB 3SEBA 2AUJD 4DU9A 4GN4B 3V2TA 4JG2A 1TWHH 1QCBD 4GLVB 3KF8B 1GD7A 1S72A 3U9SA 4RCNA 1STNA 4BBRH 4K2KA 3FKIG 3UE0A 5TSSA 1Y8NB 3HKZE 4IFDI 2VQFQ 2DNEA 4QQBX 4I65A 4GLXA 1GUWA 1F9PA 4JCVE 1E2WA 2XTIA 4QUCA 4DNIA 1KLGD 3O13A 5C0XH 3D6WA 2K50A 4HN7A 2BH8A 3T16A 4F7XA 4S3SA 1WCMH 5J1ZA 4UDUC 3RLNA 4C1NI 2YU9B 1PH2A 4V190 3MVVA 4YHHL 2SNSA 1C7YA 2BE5D 2K75A 2NVYB 1BXTA 5LHY1 3MFGA 1I50H 1PH6A 1KNEA 3NXWA 2BDNA 3QB3A 1YHQA 3KOJA 4DNRB 1VF5C 4A4IA 2WP8J 3N6RA 1F9QA 1VQJA 3JAML 4BBSH 4ZUJA 3HOVG 2OQ0A 5M5YH 5I2YA 4HJ7A 1BCPD 2KENA 2UXCL 3J81j 2JA8B 3ICEA 4YCVA 1XMOL 2UUBQ 2PQAA 2AUKA 4LF7L 1VCIA 4ZCKA 3UDGA 1FVIA 3KUPA 1VQ6A 3TZUA 2EPBA 4AYBE 3RZDB 4LJZC 1QWYA 2B2UA 3WOFA 4IFDG 2VXWA 4P74A 1B9MA 3M4PA 1N36Q 2JEAI 4QCLA 4RCOA 4LFAL 1UWVA 3CQZB 4YWLA 3NTHA 3C46A 5M3FH 3S2HB 3BDOA 4NP5A 2AHOB 3HRZC 3K5LA 2I5LX 2K01A 1PZID 4PZ8A 1E7ZA 5CV8A 1TWGH 2D0OA 1T9HA 3GTOH 3VYSA 1QE6A 4A3IG 1IW7D 3I7FA 1N33Q 1VQFA 2I5MX 2JA5B 1FNVA 2L1BA 4X3SA 2BE5C 3Q22A 4DUYL 2EE1A 1MGSA 5IP7G 2M00A 2Z4HA 1X3GA 2VB3X 3CCUA 3M4YA 1CKNA 1HFGA 4IFDH 2MJ8A 1HA6A 4CDCC 4FF4A 1W6KA 1KABA 1PYWD 1X6OA 2UUCQ 3F2CA 1I4GA 5ELOA 3S1NB 3W1GA 2X69A 4R8IA 3NBHB 3I90A 1MSHA 2WB1G 4XQQA 2BH2A 4A3CH 1BCPC 1QILA 4GKJL 1YJNA 3MAQA 1STYA 4A3KG 2JSOA 2XIWA 1HFNA 2Y0SE 4FF2A 1R4PB 2HD3A 5C6AA 3KLWA 2YTXA 3PF4A 4A3IH 2K04A 3GTKH 2CVRA 2IT1A 3BVZA 3L3OC 2KCMA 3Q23A 3JAMi 3T1HQ 5DM63 1RODA 4IUTA 1MI2A 4KKSA 4BWGB 1NNXA 2CHBD 2N49A 1ML0D 3HKSA 1Q82C 1VQLA 4A75A 1BR9A 4O42A 1S5ED 4DV6L 4OX9Q 2NTTA 4A3BB 2A73B 2AWNA 4K8IA 1ENAA 3SK8A 4MHEA 5CV5A 2N3SA 2HCIA 2B2UC 4LUOA 1JB7A 2ZJQA 3V96A 3WWVA 3VR3A 4CKBA 4GS3A 1Y1VG 1OXTA 1HJPA 1CSQA 5JEAH 4JOIA 4ODGA 1GUTA 4IO9A 1EU4A 3ERSX 3H3VC 1IW7C 3A8KE 1F9SA 5CV4A 3TP7A 4KKUA 1M1KC 4MTNA 5CBAE 1VQPA 3VR5A 4X65L 3UDXA 1JWUD 3TP6A 4DUZL 4PV1C 1NUCA 3TRZA 4N9PA 5C4JH 1EYAA 4A3LG 5HGQA 1G6ZA 1S5CD 1SJED 2HHHL 5CV9A 5I9OA 3RLOA 1HQRD 4ZAIA 1HNZQ 4B9XA 2YTVA 1AE2A 5EGTA 1K0SA 3JC66 4HJ8A 3SVMA 2WV6D 1Y1VH 1PA6A 3TREA 2RVLA 3OIPA 4EX5A 2MHVA 2UXCQ 3L9AX 3ULJA 1A63A 4M1UB 4QB4A 1EZ6A 1I5FA 2EY1A 1CFMA 1IBKQ 4A76A 1YJWA 1IYVA 1HNWQ 3K0YA 2CQOA 1G8ZD 2F4IA 4K5VA 1KQSA 2F0VA 4TSSA 5IT9E 5JVH3 1A6XA 2O5IC 3DM1A 4A3LH 1K8MA 3H91A 1CSPA 3G48A 1EWIA 5AJ3Q 2CWAA 3CW2C 4KK7A 2F0MA 4NW2A 2BDOA 1WFQA 5KGUA 2F0TA 1NCVA 4KY7A 5KNBA 3M4OH 4DV2L 3ONAB 2SEBD 1H9JA 2RDGA 3LX0A 2F0UA 1A2TA 1X54A 4GOPA 2ZXRA 1FGBD 4DFAA 5DLQE 3K5OA 1FNUA 2X6LA 4JOIC 1I6HB 4B9WA 2F4VL 1GHKA 4DUYQ 1TWFB 4FF1A 2CFMA 5C4ZA 1I3QH 2R92G 1ILPA 2PMZB 3DMUA 1Y8OB 1EY5A 1N34Q 4FO2A 3NK9A 3GTQB 3K59A 1BCPB 1CQFA 3SR1A 3J81L 1H9KA 4OWWB 1G291 4XDXA 1HXYD 5DM73 3PO2B 2KQ3A 1EYGA 4UY8C 2MO0A 4IPHA 4KN4C 5EKLA 3I73A 1L2FA 3SXHA 2GN5A 2L55A 4K2LA 4RAUC 4JI6L 1IYUA 2KHSA 2R7ZG 1DOKA 1JCKB 3S1MB 2UXBQ 1B9NA 3TP5A 3GV6A 2E8GA 2N8NA 4XQJA 4JI4L 2R6GA 5FKAC 2PQAB 1EU3A 1S5FD 1GUNA 2AQ3B 1ILQA 1K3RA 1WTPA 4R4CA 4WORA 2UU9L 3URYA 1HCZA 1K83B 5E4XA 1ASZA 1I4XA 3SGIA 3J7AF 2KCCA 4HMIA 2F0WA 3X3MA 4DF7A 4PZ7A 4UAIA 1TIID 2DN8A 5IT9L 4OELB 3RN5A 1D8LA 3DXJC 4H44C 4DV4Q 1U4PA 3U50C 1PH4A 1BCPF 1FNWA 2R7ZH 1JB3A 2JK8A 4UP9A 1G91A 5FOBB 2B8GA 4X62L 4B3ML 1R9TB 4JI5Q 4LUVA 2R93G 4F87A 4EQPA 4AIMA 3A56A 3I3CA 1QJOA 4K6DA 4GOPC 1PLFA 4HCEA 1VQ8A 5L37A 2E2JB 1IYJB 1J6QA 2O4XA 4GLAC 1XWEA 4JI0Q 3QO2A 1LT3D 3A5ZB 3A7LA 5IGBA 2D9UA 1L1OC 3BU2A 4A3MG 5FJ8H 4L5SA 1YBYA 3HOXB 1D6EC 2EYFA 4PNYA 4POGA 4DR2L 2A8VA 3LWEA 4I7ZC 1VQHA 1A3TA 3CD6A 2AKWB 2M9VA 3E0JA 5IYDG 1HUNA 3J81i 4ZYSA 2CKZB 5KNCA 4A93B 1L0XB 2JA8G 1WTQA 1T5EA 3EN2A 2RCNA 4R4TA 5NUCA 1W3SA 2QDBA 2YU9H 2NVQB 1NBWA 3BJUA 3ITPA 1SYDA 5C5MA 4XQNA 3GTPB 1Y8PB 4QY7A 3G71A 1CI3M 1SFOB 2NVYH 2JQOA 3LWUA 4DR6L 3PO3G 3KJOA 5GROA 1SXTA 1PTOD 5JJIA 4JI2Q 4P2CB 1STGA 3TEHB 4HJAA 5FLMG 1SDFA 4XT1B 1VQOA 2A74C 2K5DA 4KV6A 1JT8A 1EIHA 3OYYA 5D65A 3CCLA 4OIKA 1SBBB 3NP8A 1LV9A 3OPOA 3J80c 3M3YB 1TKWB 2JA8H 2RBMA 1HZ9A 2VQFL 1STBA 4DR3Q 1XNQQ 2Z8LA 5LMNW 2EXZA 2E5LL 1VQMA 3RZDH 1WD0A 1TQOA 4O1NA 1P16A 5C3EB 3W5OA 4X66Q 1EL0A 1F2LA 4DV0Q 1EFID 1I94Q 4BY1B 3CQZH 4PZ6A 2HIVA 1SYBA 4XT3B 2JA6B 2DUDA 2XRQD 1CKOA 3BDCA 3R3OA 5IGFA 5KNDA 1NR2A 2WKDA 1CK1A 3OSOA 2GVBA 1RL2A 1SE8A 1ICFB 3EVQA 1HTLD 2HCCA 4RHRA 3JAMc 5CV6A 2JA5H 3NSWA 3PIO3 2UU9Q 2Q8TA 1RF2D 1QVGA 3D3RA 1CM9A 5ELFA 4R8NA 2VS1A 5KRUA 1JR0D 1DONA 1PTOC 2MNAA 4ILWA 3P75A 2AQ2B 5JJZA 4A3BG 4IOCA 3S1NH 2OTJA 1QNKA 2UUBL 5GAGC 5M3MH 4DA2A 5IOCA 1V1PB 2DJFC 4ZUIA 1ET6A 1EQVA 2IHFA 5CR3A 1BQQT 2G9DA 3S9WA 1CT1D 3HP3A 4CDFC 4GOPB 2LXKA 1C8CA 4ME5A 1MIUA 3R2IA 4DXGA 5HGTA 1N36L 4C3HH 1PYBA 1QB5D 1ZEQX 2EDGA 3QJYA 1FYCA 1XPUA 5G3LD 3HOZG 3IKJA 1YHAA 3M4QA 2SNMA 1AE3A 2AWOA 4CDEC 2QEJC 3I91A 4EQOA 2J7ZA 4JI7Q 4A3BH 5KIXA 4C3JG 2O5JC 4YIJA 2JEBI 1X3FA 1STHA 2OEOA 1N33L 4R4OA 1QZGA 1UEAB 3MHBA 1V1OA 4DNTB 3KLSA 2LS01 3AMUA 2J4XA 1EIFA 3GTGB 1V8QA 3GTJB 2K14A 1ENFA 3SK6A 2VB2X 1SAPA 2UUCL 5JJKA 1SE2A 1PYSB 1XXGA 1EOVA 1VQBA 3RMHA 2B2WA 3OHXC 2EJFC 2IX0A 4KHZA 5C0XG 2F0GA 3J7ZC 1B3QA 3A8IE 1K9MC 1I4QA 1E24A 1WCMG 4RGTA 1KNAA 4P71A 4B3SQ 3J7A5 2N78A 3T1HL 1WTRA 5CGKA 4BXXH 5E4WC 4C3IB 1YNXA 1GOZA 1STAA 1KDCA 5EPJA 1KL9A 3MTSA 2K5NA 2PYKA 4EGVA
chains in the Genus database with same CATH topology
1Y1WB 1IKLA 1PXUA 1PDQA 4XTCS 4K5XA 1PFBA 4FVMA 4CKEA 1HQMC 4OGQC 1KDBA 2B8FA 4DN4M 4RGNA 1JWSD 2E2HB 1I4RA 2E74C 2BA1A 2QF7A 2C5CA 2QKIC 2E2IB 1BDOA 3NWSA 1SYEA 3HOUB 3I4NB 2F0IA 3VR2A 3OIQA 3CRLC 1CZGA 5KYIA 1TT2A 5E1FA 5BN5A 1PFMA 3PUXA 3W2DA 1I4PA 2RDFA 3GQBA 2EY5A 3GD7A 2EYMA 1PTOB 4PMWA 1U9RA 1VMPA 4DGZA 4IUVA 2D2CC 2VUMB 2F0PA 3M7NA 4L63B 4U68A 2B2WC 4H7BA 4J1MA 1KAAA 2A6ED 2N55A 1GUGA 1LT4D 5K36G 2MP1A 3MA2B 1JOKA 2PW7A 1RD9D 3PV0A 3HKZB 1NSNS 1V43A 4BY7B 1KTKA 4EVOA 2WINB 1J8IA 3BZDB 5EPLA 1H9SB 3QOLA 4BS9A 3ND8A 2A69D 2B63B 3PUVA 1M4VA 1PTOF 4X3TA 3I4MB 3A54A 2L9HA 5K36H 3ND9A 1GUSA 1AN8A 1Q1EA 4TKOB 2L11A 1EEID 4WJWA 4G4KA 2J0TD 2LFNA 2V4DA 5BN4A 1WTWA 5M3MB 1SNQA 5M5WB 5ELBA 1LTSD 3FPPA 2F0FA 2LMCB 5JEAG 1UNSA 1LT6D 4C3HB 1JWMD 2A6EC 1D5XC 2EOTA 4PQXA 2D5DA 4AYBB 3BS1A 1I6VC 3HOWB 3E5SA 5I2XA 3FDTA 3PUZA 1X3QA 3PMFA 4KD3A 2YYZA 4FNFA 1C48A 3SK5A 2NVTB 3S14B 5D3IB 5IGDA 1EYDA 3DUZA 1AW7A 4IUQA 4A3DB 5LL6X 3IL8A 2A69C 1RKNA 2MPMA 3D8GA 1O7YA 1EZ8A 3U9OA 1PFNA 1S5BD 3A55A 3D4RA 1BOSA 2ZT9C 5EJWA 4L8JA 1CTMA 3K58A 4LMQD 5EQ0A 5FO9B 1TVXA 4J6HA 2JA7B 4K5WA 2PZUA 1LACA 4JK1C 4LK1C 3IFTA 1B1ZA 3DWAA 4TQUS 2N88A 3T56B 1LTBD 2K33A 4CGYB 2IX3A 2PZWA 4KKTA 2Y0SB 1OXVA 3TZDA 1EY7A 1SNDA 1C4QA 5CC4A 1SYFA 2XRSD 2NWGA 4KN7C 1O78A 2TMPA 4HCSA 1Z6HA 4Z9CB 3KBXA 4X3KA 1SEBD 4A3EB 4Q5VA 1D2BA 4HMJA 5CBEE 4L6TB 2XWBB 5EBCA 3KBGA 2F0SA 3NUCA 5DNFA 5JVG3 5EKKA 1F2YA 2DY8A 2ICIA 2EYPA 4NDXA 1CHPD 3H6MA 4CBVA 2F0NA 3C3LA 5J39A 2PPBC 5C5LA 2E2DC 1U4MA 2IPKD 3PUYA 3OMCA 3FKIB 4H0LC 1Z47A 3GTLB 4C2MB 3MXPA 4PMBA 1AFPA 3S1QB 3SE0A 1VDZA 5IODA 1HPCA 3M7GA 2O2LD 1KLUD 3FVQA 4C1NK 3HG9A 1DD2A 1SE4A 3K5NA 4C3IG 4ZKCB 1GUOA 5AFWA 3UI2A 4FXDA 1HA5A 3LNNA 3HOVB 1JOOA 3I72A 5T1IA 3OMGA 5DEHA 1TS4A 2XVSA 4K6LA 3AU7A 2RA4A 2NZ1D 3FMCA 1QG7A 4OO1I 4A3GB 3QWNA 3S2DB 1ESFA 2NN6I 1A2UA 5E3FA 3RUZA 1EY8A 3BG3A 1M8AA 1AZPA 2LY7A 2F0EA 4QUFA 1B50A 3MEHA 1SSOA 5T1GA 4BA1I 3S1RB 3S15B 3KK7A 2KCNA 1RTNA 1FD7D 3VYTA 3CRKC 2Z1CA 4DAPA 2KA7A 1TS5A 3BYTB 1F9RA 2IW3A 2B2TA 1S5DD 1LTID 1TWAB 5CYUA 3G7LA 1NR4A 5BN3A 3G6JB 1XYIA 4M8AA 2FMCA 5C4HA 4MN3A 1DXMA 1F2ZA 2FINB 2PCFB 1LTAD 5CMDA 1CA5A 1PTOH 4A3KB 3SK4A 4FYDA 2QILA 1OXXK 3DWPA 4OO1G 2SOBA 3BVMA 2X6GA 1XX8A 5IIFA 2RDHA 2PQEA 3C1EA 3P1HA 2BCOA 1MBYA 3C2PA 1AP0A 1J9OA 1KDAA 2RSOA 4N9TA 3F2UA 4FXGC 1OXUA 3RD4A 3H09A 1EWHA 2K5WA 1DJRD 4IUNA 1UAPA 1TR5A 3HOYB 3NQTA 1EYCA 4DXFA 4K8JA 2E75C 3P20A 3BDLA 4OO1H 2MGSA 1PZKD 4C3HG 1D1IA 5FO7B 1ET9A 2B2YC 1O80A 1TWCB 3NBIA 3VYUA 5I6WA 1EQTA 1BBXC 1U4RA 2NN6H 4CJ1B 3EQLC 1D5MC 2I07B 4KI0A 2B2TC 1LABA 1X3PA 1ONLA 3D6CA 1DM0B 1X32A 3TSSA 1JORA 3BYYB 1EIGA 1MSGA 1TS2A 3RZOB 4KJOA 3H0GB 2L5TA 2B2VA 3J80E 2QCPX 2FJ2A 2RQXA 5K5PA 2EYLA 4XIGS 2AQ1B 2KECA 5A2QE 4J8QA 4HR7B 1PZJD 5KYLA 3SHLA 3GTMB 1O7ZA 5JAVA 1BF4A 3NPPA 2FMMA 2CW0D 2I46A 1DOMA 1BO0A 1JQYD 3CU7A 1YNJD 1GHJA 3VYRA 1TU2B 2D62A 3T4AC 4FF3A 3VR4A 4KTAA 2R92B 1OXSC 1EY9A 2NBFA 3C1FA 2DY7A 2F0LA 3E6ZX 3JAME 1PRTD 4Q0FA 1LTTD 5JPMC 1GXDC 5I6YA 3J7YW 3MXGA 3GV3A 5IGGA 4IALA 1U4LA 1TY0A 2NUCA 4XYOA 2KUMA 3D4WA 2GA4B 3MZ5A 2L12A 1F2MA 2NVXB 1B4OA 1EY6A 2B2VC 2WKCA 4ZK9B 4H13C 4IN3A 4WFN3 3I70A 1HTPA 3IFDA 3J80L 5KEEA 2PW5A 1EEFD 4E6IA 2CW0C 4KJNA 1AZQA 1YNJC 1RJTA 1DYQA 5A2QL 2R93B 4DK0A 1UUPA 3VA7A 4F8MA 5EKIA 4RFBA 3WDNA 2WACA 2KOLA 3Q0AA 1PRTC 4MIUA 4RGOS 4A3MB 1RDPD 4EQNA 1B44D 1H9MA 4KHVA 1E2ZA 1D5ZC 5C0XJ 2K5QA 1RCVD 3HGBA 5I9PA 5ELEA 1LT5D 4LAAA 4A3FB 2IWHA 4IQZA 4Y7NB 2A6HD 1EWCA 3HEJA 3NHHA 5DAUA 4ZKBB 4K14A 3PO3B 1D1KA 2NYZD 1VF7A 5D14A 4V0BA 3MC0B 4KY5A 2F0QA 3S17B 1EY4A 4FP5D 4ULLA 4RKLA 4B08A 2BA0A 2VNUD 3OWFA 4NKLA 4IZ8A 3S16B 2EY6A 5C4XB 1O7LA 3EJIA 1B53A 2EY2A 1ICWA 2H4OA 1A3UA 2JXMB 1I4HA 1Q12A 1Q3LA 1JC7A 2ID0A 3NE5B 4GZYC 5C44B 2PZTA 4ID6A 3NQIA 1BNZA 4IFDJ 2A6HC 2NTSA 3EROA 1H9RA 1SJHD 2TSSA 4WRDA 3T51B 2JP1A 3NTIA 2ENBA 5EPKA 3M85A 1QOHA 4RWSC 4XXEA 1GJXA 2HUGA 2M2LA 4F88A 3MXUA 3QIAA 2ZXOA 5F2DA 4HSVA 2Z4IA 1R4QB 2F0DA 2JE6I 5C3XA 2F0JA 1G2TA 3K57A 4DAYA 3I4LA 4QMGA 2K7VA 1PRTB 3J81E 1IL8A 4HSPA 5G3LF 2KJXA 3HOZB 1SNOA 3OOCA 5M5XB 1WTXA 1E2VA 2F1MA 2G9HD 4A3JB 1B3AA 4HEDA 5A35A 4C3JB 2XNAC 2K32A 2F0KA 5JEAJ 2F03A 4OL7A 3A7AB 1TWHB 3ZYYX 2NB0A 2EYJA 2Q8IB 4BBRB 2K05A 1JE4A 1SNPA 2R61A 3TDQA 5LL6S 1ZYRD 2IJ0A 4G57A 3TN2A 1ZXTA 4ZLTF 3L7ZC 2PO4A 1SYCA 1PRTF 4G7OC 4RH6A 1RTOA 1WCMB 4OHJA 3MFYA 4IURA 5FLXE 1V1PA 2KEDA 3KLRA 4R9WA 1Z7TA 1I50B 4ABNA 2RKSA 1LTGD 4RHSA 1DZ1A 5ELDA 1WTVA 1QNUA 4FXKC 3SDZA 3QG1A 5C3WA 4BBSB 4HAEA 4U673 3R8BA 5M5YB 2LKVA 1SNMA 2CQAA 3I8ZA 2RSNA 1CHQD 1SMYD 4BA2I 5J22A 2IX1A 2L0CA 4QIWB 3T53B 2EJGC 2A5HA 3NTKA 3N52A 3TP8A 3X3NA 1B2TA 3AB9A 4KD4A 1SNCA 1WD1A 2E76C 2KVMA 2HDMA 1ZYRC 3A8JE 5I4DA 2K1BA 5M3FB 4CJ0B 1CA6A 2DNCA 1JOQA 1TWGB 4TRDA 2WAQB 3CKIB 3GTOB 4DK1A 1SE3A 1DOLA 3FRPB 2XWJB 4G7HC 3GO5A 1K8OA 1HHVA 3KF8A 4HTHA 4ZRZA 2EYOA 1LO5D 2F0HA 2R3ZA 1E0BA 5FLXL 2K6AA 3DHQA 3BVGA 1STEA 3MXNA 1S4ZA 4G7ZC 3DWQA 1SMYC 3H94A 4DAVA 3FPUB 3GP7A 2B2YA 1HUMA 2Q8RE 3HZXA 3W3AA 2F3VA 2FHTA 4A3IB 3GTKB 1LTRD 2JYOA 1JICA 4ZQ3A 1ESRA 2ZXPA 2L4NA 3VR6A 5IGEA 1HRJA 4RKBA 2K28A 2ICEC 2B39A 5CORA 2WIIB 4QF4A 5ISRA 3R2TA 3ERQA 2WB1B 4IUUA 1G2SA 1PMRA 2A68D 3OWEB 1WVLA 1OO9B 2IL8A 3FEWX 2XSCA 4RGMA 3K7AB 3NWTA 3R93A 4CKCA 2PNRC 4RA8A 3IAYA 2EYHA 1YNND 1W6JA 5C4JB 1LLRD 2NN6G 2OT2A 3V05A 5JOBA 2XN9C 5COYA 1MD2D 1TY2A 3MWYW 2OF1A 4KMUC 1Y1VB 4PMCA 1H9SA 2C9OA 1Q8IA 4CHTB 5CV7A 1A3VA 2FFKB 3K6OA 1Q90A 3Q24A 1FR3A 5D3DA 1F77A 1L0YB 4X3UA 1SYGA 2EJMA 1RHPA 2A68C 1II3A 4NMZA 5IGCA 2MUYA 3RLFA 2K03A 3M4OB 3NBHA 1Q1BA 3EFXD 3T13A 3Q6SA 1AEXA 5FK9C 3PIP3 3P7JA 2EZVA 5JPNC 1VMCA 3OW7A 1A15A 1YNNC 1EOTA 5C0XI 4CJ2C 2EVBA 1I3QB 2F3WA 1T5XD 3VA5A 5HURA 3DEPA 3WOEA 1WTOA 4OIJA 1CZWA 3KLSX 5FO8B 4XYQA 3J7AV 4C56C 3D4DA 3HS0C 3D31A 4KY6A 1TS3A 3EA6A 5M9OA 5EBDA 1Y69U 3DEOA 3CHBD 1ZKOA 1IKMA 1EY0A 4JBWA 1BUVT 4IUPA 1CQVA 3QOJA 2F0OA 2KEEA 5ELCA 3K5MA 1ENCA 1IHZA 1NAPA 2H1EA 2SDFA 2HQEA 2R7ZB 1XTCD 2OXPA 3TMEA 3PUWA 2BOSA 1DCZA 2HDLA 3TBIB 3SEBA 2AUJD 4DU9A 3V2TA 1QCBD 3U9SA 4RCNA 1STNA 4K2KA 5TSSA 1Y8NB 4IFDI 2DNEA 4I65A 1GUWA 1F9PA 1E2WA 4QUCA 1KLGD 3O13A 5C0XH 3D6WA 4HN7A 3T16A 4F7XA 4S3SA 5J1ZA 4UDUC 4C1NI 2YU9B 4V190 3MVVA 2SNSA 2BE5D 2NVYB 1BXTA 5LHY1 3MFGA 1KNEA 3NXWA 2BDNA 3QB3A 4DNRB 1VF5C 2WP8J 3N6RA 1F9QA 3JAML 4ZUJA 5I2YA 1BCPD 2JA8B 2AUKA 1VCIA 3KUPA 3TZUA 2EPBA 3RZDB 4LJZC 1QWYA 2B2UA 3WOFA 4IFDG 2VXWA 1B9MA 2JEAI 4QCLA 4RCOA 3CQZB 3NTHA 3C46A 3S2HB 3BDOA 4NP5A 3HRZC 3K5LA 2K01A 1PZID 5CV8A 3VYSA 1QE6A 1IW7D 2JA5B 1FNVA 2L1BA 4X3SA 2BE5C 3Q22A 2EE1A 1MGSA 2M00A 2Z4HA 2VB3X 4IFDH 3M4YA 1HFGA 2MJ8A 1HA6A 4FF4A 1W6KA 1KABA 1PYWD 1I4GA 3S1NB 2X69A 4R8IA 3I90A 1MSHA 4XQQA 1BCPC 1QILA 3MAQA 1STYA 2JSOA 2XIWA 1HFNA 4FF2A 1R4PB 5C6AA 2K04A 2CVRA 2IT1A 3BVZA 3L3OC 3Q23A 5DM63 1RODA 4IUTA 1MI2A 4KKSA 4BWGB 2CHBD 1ML0D 1BR9A 4O42A 1S5ED 2NTTA 4A3BB 2A73B 2AWNA 4K8IA 1ENAA 3SK8A 4MHEA 5CV5A 2HCIA 2B2UC 3V96A 3VR3A 4CKBA 1OXTA 5JEAH 4ODGA 1GUTA 1EU4A 3H3VC 1IW7C 3A8KE 1F9SA 3TP7A 5CV4A 4KKUA 5CBAE 3VR5A 1JWUD 3TP6A 4PV1C 1NUCA 4N9PA 1EYAA 1G6ZA 1S5CD 1SJED 5CV9A 5I9OA 1HQRD 4ZAIA 4B9XA 5EGTA 3SVMA 2WV6D 2RVLA 3OIPA 2MHVA 3L9AX 4M1UB 4QB4A 1EZ6A 2EY1A 1CFMA 1IYVA 3K0YA 1G8ZD 2F4IA 4K5VA 2F0VA 4TSSA 5IT9E 5JVH3 1A6XA 2O5IC 3DM1A 1K8MA 3H91A 4KK7A 2F0MA 4NW2A 2BDOA 5KGUA 2F0TA 1NCVA 4KY7A 5KNBA 3ONAB 2SEBD 1H9JA 2RDGA 3LX0A 2F0UA 1A2TA 2ZXRA 1FGBD 4DFAA 3K5OA 1FNUA 2X6LA 1I6HB 4B9WA 1GHKA 1TWFB 4FF1A 5C4ZA 1ILPA 2PMZB 3DMUA 1Y8OB 1EY5A 4FO2A 3NK9A 3GTQB 3K59A 1BCPB 1CQFA 3SR1A 3J81L 1H9KA 1G291 4XDXA 1HXYD 5DM73 3PO2B 2KQ3A 4KN4C 5EKLA 3I73A 3SXHA 2L55A 4K2LA 4RAUC 1IYUA 2KHSA 1DOKA 1JCKB 3S1MB 1B9NA 3TP5A 3GV6A 4XQJA 2R6GA 5FKAC 1EU3A 1S5FD 1GUNA 2AQ3B 1ILQA 1WTPA 4WORA 3URYA 1HCZA 1K83B 5E4XA 1I4XA 3J7AF 2KCCA 4HMIA 2F0WA 3X3MA 4DF7A 4UAIA 1TIID 2DN8A 5IT9L 3DXJC 4H44C 1U4PA 1BCPF 1FNWA 1JB3A 1G91A 5FOBB 2B8GA 1R9TB 4F87A 4EQPA 3A56A 3I3CA 1QJOA 4K6DA 1PLFA 4HCEA 2E2JB 2O4XA 1XWEA 3QO2A 1LT3D 3A7LA 5IGBA 2D9UA 3HOXB 1D6EC 2EYFA 4PNYA 3LWEA 4I7ZC 1A3TA 2M9VA 3E0JA 1HUNA 4ZYSA 5KNCA 4A93B 1L0XB 1WTQA 1T5EA 5NUCA 2QDBA 2NVQB 3ITPA 1SYDA 5C5MA 4XQNA 3GTPB 1Y8PB 1CI3M 1SFOB 3LWUA 1SXTA 1PTOD 4P2CB 1STGA 1SDFA 4XT1B 2A74C 2K5DA 4KV6A 1EIHA 5D65A 4OIKA 1SBBB 3NP8A 1LV9A 3OPOA 3M3YB 1TKWB 2RBMA 1STBA 2Z8LA 2EXZA 1WD0A 1TQOA 4O1NA 5C3EB 1EL0A 1F2LA 1EFID 4BY1B 1SYBA 4XT3B 2JA6B 2XRQD 3BDCA 3R3OA 5IGFA 5KNDA 1NR2A 2WKDA 1CK1A 3OSOA 3EVQA 1HTLD 2HCCA 4RHRA 5CV6A 3NSWA 3PIO3 2Q8TA 1RF2D 3D3RA 1CM9A 5ELFA 4R8NA 5KRUA 1JR0D 1DONA 1PTOC 4ILWA 3P75A 2AQ2B 5JJZA 1QNKA 4DA2A 5IOCA 1V1PB 4ZUIA 1ET6A 1EQVA 5CR3A 1BQQT 2G9DA 3S9WA 1CT1D 3HP3A 1C8CA 4ME5A 3R2IA 4DXGA 5HGTA 1QB5D 1ZEQX 2EDGA 3QJYA 1FYCA 5G3LD 3IKJA 2SNMA 2AWOA 2QEJC 3I91A 4EQOA 2J7ZA 5KIXA 4C3JG 2O5JC 4YIJA 2JEBI 1STHA 2OEOA 1UEAB 3MHBA 1V1OA 4DNTB 2LS01 3KLSA 3AMUA 2J4XA 3GTGB 1V8QA 3GTJB 1ENFA 3SK6A 2VB2X 1SAPA 1SE2A 1XXGA 3RMHA 2B2WA 3OHXC 2EJFC 2IX0A 4KHZA 5C0XG 2F0GA 3A8IE 1I4QA 4RGTA 1KNAA 1WTRA 5CGKA 5E4WC 4C3IB 1GOZA 1STAA 1KDCA 5EPJA 3MTSA 2PYKA 4EGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY9 A;  1SYF A;  3MVV A;  5CV6 A;  5C3X A;  5J22 A;  2F0J A;  3C1F A;  1JOO A;  5C6A A;  2SNS A;  2F0L A;  4IUN A;  3SK8 A;  3LX0 A;  4K5X A;  2F0U A;  2EYF A;  3OMG A;  4R8N A;  1A2T A;  3D4D A;  4PNY A;  5DEH A;  3TP8 A;  1TR5 A;  5KRU A;  4QMG A;  4KD4 A;  1SNC A;  1KDB A;  3HEJ A;  1A3T A;  4KY6 A;  3NXW A;  3P75 A;  3QB3 A;  4DFA A;  3NHH A;  5I6Y A;  3NQT A;  5DAU A;  1EYC A;  5M9O A;  1SNQ A;  2F0D A;  4K8J A;  5IGG A;  4B9W A;  4K14 A;  4HMJ A;  4IAL A;  3BDL A;  1SNO A;  5IOC A;  4ZUI A;  2EYH A;  5C4Z A;  3DMU A;  1EQV A;  4K8I A;  4ZUJ A;  1SYE A;  1ENA A;  5CR3 A;  2F0F A;  1EY5 A;  1EY0 A;  2NUC A;  5JOB A;  2F0I A;  2F0Q A;  4KY5 A;  5CV5 A;  2F0S A;  3NUC A;  3S9W A;  3D4W A;  1EY4 A;  5I6W A;  3NK9 A;  5EKK A;  5NUC A;  2QDB A;  1F2Y A;  4ME5 A;  3SR1 A;  1A2U A;  5HGT A;  3ITP A;  3MZ5 A;  5E3F A;  3RUZ A;  1EY8 A;  2F0K A;  1SYD A;  1TT2 A;  5C5M A;  5KYI A;  2KQ3 A;  2EYP A;  1JOQ A;  5E1F A;  1F2M A;  4NDX A;  5EKL A;  4RKL A;  3H6M A;  2OF1 A;  4ODG A;  2F0N A;  2F0E A;  3QOJ A;  4OL7 A;  4TRD A;  2F0O A;  3E5S A;  5CV4 A;  3TP7 A;  3SXH A;  2RDF A;  3MEH A;  5J39 A;  1ENC A;  2EY5 A;  4K2L A;  2EYJ A;  4PMC A;  1IHZ A;  3OWF A;  1EY6 A;  2SNM A;  2EYM A;  2KHS A;  4NKL A;  3TP6 A;  3D6C A;  3PMF A;  1STG A;  4KD3 A;  5CV7 A;  1SNP A;  1JOR A;  2HQE A;  3SK5 A;  1A3V A;  4IZ8 A;  5C5L A;  3TP5 A;  4EQO A;  4KV6 A;  5KIX A;  1U9R A;  1NUC A;  2EY6 A;  4N9P A;  2PW5 A;  4YIJ A;  4E6I A;  4DGZ A;  1EYA A;  5IGD A;  3OMC A;  1EYD A;  5KEE A;  2F0P A;  3EJI A;  4HTH A;  4G57 A;  2OXP A;  1STH A;  2OEO A;  3NP8 A;  4KJN A;  5CV9 A;  3TME A;  2EY2 A;  5CC4 A;  4KJO A;  5I9O A;  1RKN A;  3MHB A;  2EYO A;  1SYG A;  3D8G A;  3MXP A;  4NP5 A;  4WOR A;  4H7B A;  2RBM A;  4J1M A;  1KAA A;  2F0H A;  1SYC A;  1EZ8 A;  1A3U A;  4PMB A;  3DHQ A;  3SK6 A;  4B9X A;  3U9O A;  5EGT A;  4DU9 A;  5K5P A;  1STB A;  4HMI A;  5CV8 A;  2F0W A;  1JOK A;  3V2T A;  5C4H A;  1II3 A;  2PW7 A;  2EXZ A;  4NMZ A;  4DF7 A;  5IGC A;  1F2Z A;  2EYL A;  1STN A;  4F8M A;  4K2K A;  1NSN S;  4QB4 A;  1TQO A;  1EZ6 A;  3HZX A;  2WAC A;  2EY1 A;  2PZT A;  4ID6 A;  5IOD A;  3T13 A;  2F3V A;  5KYL A;  3ERO A;  3SHL A;  3SK4 A;  4EVO A;  2M00 A;  4ZQ3 A;  4MIU A;  1AEX A;  4J6H A;  2F0G A;  4I65 A;  4K5V A;  1KAB A;  1SYB A;  2F0V A;  4KHV A;  4K5W A;  4EQN A;  4WRD A;  5IGE A;  5JAV A;  2PZU A;  2RKS A;  4EQP A;  2SOB A;  3QOL A;  4RKB A;  2ENB A;  5IIF A;  3BDC A;  3R3O A;  5IGF A;  2PQE A;  3C1E A;  3OSO A;  2F3W A;  3P1H A;  4K6D A;  2PZW A;  4QF4 A;  3T16 A;  4F7X A;  3VA5 A;  5C3W A;  4S3S A;  5CGK A;  5HUR A;  1KDA A;  5F2D A;  4N9T A;  2O4X A;  5ISR A;  3ERQ A;  1STA A;  1KDC A;  1STY A;  2F0M A;  1SNM A;  2LKV A;  3EVQ A;  5J1Z A;  5I9P A;  1EY7 A;  1SND A;  2PYK A;  5KGU A;  2F0T A;  4KTA A;  4LAA A;  5IGB A;  4KY7 A; 
#chains in the Genus database with same CATH topology
 1Y1W B;  4GKK Q;  4OX9 L;  1IKL A;  1PXU A;  1B7Y B;  1KD1 C;  1PDQ A;  4XTC S;  4K5X A;  1PFB A;  3MXN B;  4FVM A;  4CKE A;  1HQM C;  4OGQ C;  2E5L Q;  1KDB A;  2B8F A;  4DN4 M;  4RGN A;  1JWS D;  4BBS G;  2E2H B;  1I4R A;  2E74 C;  2BA1 A;  2D0P A;  2QF7 A;  2C5C A;  3DLL A;  2QKI C;  2E2I B;  1BDO A;  3GDE A;  3NWS A;  1SYE A;  3HOU B;  3I4N B;  2Q2H A;  2F0I A;  3VR2 A;  4NXN Q;  3PO2 G;  3OIQ A;  3CRL C;  1CZG A;  5KYI A;  1TT2 A;  3MEF A;  5E1F A;  5BN5 A;  2DGY A;  1PFM A;  3PUX A;  3W2D A;  1I4P A;  2RDF A;  3GQB A;  4JPB W;  2EY5 A;  1GKH A;  2VY3 A;  1VQ5 A;  3GD7 A;  2EYM A;  2NZO A;  2K4K A;  1HNZ L;  1YVC A;  1PTO B;  1I6H H;  4PMW A;  1TWF H;  5M3F G;  1U9R A;  1VMP A;  4LFC Q;  4DGZ A;  4IUV A;  2D2C C;  2VUM B;  2F0P A;  2WFW A;  3W1B A;  3M7N A;  1HR0 W;  3GTQ H;  4L63 B;  4U68 A;  1IBK L;  2WAQ G;  2B2W C;  4H7B A;  4J1M A;  1KAA A;  1HNW L;  3PO2 H;  1IZ6 A;  4NPS A;  4JI3 Q;  2A6E D;  2N55 A;  3K80 C;  1GUG A;  1LT4 D;  5K36 G;  2MP1 A;  3MA2 B;  1Q7Y C;  1JOK A;  2CH4 A;  2PW7 A;  1A62 A;  1RD9 D;  3PV0 A;  3HKZ B;  1NSN S;  2EIF A;  1V43 A;  5AJ3 L;  4BY7 B;  1KTK A;  1E3P A;  3S1M H;  3CXC A;  1YIJ A;  4EVO A;  2WIN B;  1J8I A;  3BZD B;  4LFB Q;  4A3C G;  3F2D A;  5EPL A;  1H9S B;  3QOL A;  5IWA L;  4BS9 A;  5E7N A;  3ND8 A;  2A69 D;  1K83 H;  2B63 B;  2ZM6 L;  3PUV A;  2R7D A;  1V1Q A;  1M4V A;  1YJ9 A;  1PTO F;  4X3T A;  3I4M B;  4DPG A;  3A54 A;  2L9H A;  5K36 H;  3ND9 A;  1GUS A;  1AN8 A;  3KDF A;  1Q1E A;  4TKO B;  2L11 A;  1EEI D;  3T1Y Q;  1XPO A;  2XGT A;  3CF5 A;  3J81 c;  4WJW A;  1N34 L;  4K0K Q;  4HID A;  4G4K A;  2J0T D;  5GAH C;  2LFN A;  2V4D A;  5BN4 A;  1R9T H;  2VL6 A;  1WTW A;  5M3M B;  4DK3 C;  2LXJ A;  3KFU A;  1SNQ A;  1L0W A;  5M5W B;  5ELB A;  1NY4 A;  2OTL A;  1LTS D;  3FPP A;  2E2J H;  2F0F A;  2LMC B;  1E1O A;  5JEA G;  1K8G A;  1UNS A;  1LT6 D;  4C3H B;  1JWM D;  2UXB L;  2A6E C;  1D5X C;  2EOT A;  4PQX A;  4FDB A;  3HOX H;  1WOC A;  2D5D A;  4AYB B;  3BS1 A;  1I6V C;  3HOW B;  2JA9 A;  3E5S A;  4RMF A;  5I2X A;  3FDT A;  3PIO A;  3PUZ A;  1X3Q A;  3LGJ A;  1PH7 A;  3PMF A;  1IBL Q;  4KD3 A;  2YYZ A;  4FNF A;  1S3O A;  1C48 A;  3SK5 A;  3S1R H;  2NVT B;  4YCW A;  3S14 B;  5D3I B;  5IGD A;  4A93 H;  4EQ5 A;  4Y52 H;  1EYD A;  3DUZ A;  1AW7 A;  2JN4 A;  4IUQ A;  5IE8 A;  5LL6 X;  4LF8 Q;  3IL8 A;  3K0X A;  4A3D B;  1VQK A;  2A69 C;  2F3I A;  1RKN A;  2MPM A;  2PI2 E;  1YZ6 A;  3D8G A;  4DV4 L;  2NVQ H;  1O7Y A;  1EZ8 A;  3GTP H;  1SRU A;  3U9O A;  1PFN A;  1S5B D;  3A55 A;  1SFO H;  1HH2 P;  4JI5 L;  5FLX c;  3D4R A;  1BOS A;  5C3E G;  2ZT9 C;  1A8V A;  5EJW A;  4L8J A;  4O0A A;  4GNX A;  4JC0 A;  4BY1 G;  1CTM A;  2K52 A;  1HZA A;  2Z9H A;  2Z6B A;  3K58 A;  4JI0 L;  4LMQ D;  5EQ0 A;  3A5U A;  4WJ4 A;  5FO9 B;  1TVX A;  4J6H A;  2JA7 B;  1XJV A;  1KXL A;  4K5W A;  2PZU A;  1LAC A;  4RG1 A;  3PQI A;  4JK1 C;  4LK1 C;  3IFT A;  2CWP A;  1B1Z A;  3M3Y H;  3DWA A;  3FP9 A;  4TQU S;  2N88 A;  3T56 B;  1LTB D;  2K33 A;  4CGY B;  1EIY B;  2IX3 A;  2PZW A;  3E0E A;  4KKT A;  3PGZ A;  3A74 A;  2Y0S B;  1OXV A;  3TZD A;  1EY7 A;  1SND A;  1C4Q A;  4R1J A;  4QGU A;  5CC4 A;  2KHI A;  1SYF A;  2XRS D;  2NWG A;  4KN7 C;  5C3E H;  1O78 A;  2TMP A;  4HCS A;  4YY3 L;  1XTD A;  2ES2 A;  4BY1 H;  1Z6H A;  4LF4 Q;  4Z9C B;  3S24 A;  1LYL A;  4QIW E;  3KBX A;  4X3K A;  1SEB D;  4O2D A;  4A3E B;  4DR7 Q;  2JA6 H;  1M90 C;  4JYA L;  4Q5V A;  1UE6 A;  1D2B A;  4HMJ A;  5CBE E;  4L6T B;  2XWB B;  5EBC A;  3G6E A;  1N8R C;  3KBG A;  2F0S A;  3NUC A;  5DNF A;  4JI2 L;  5JVG 3;  5EKK A;  2LSS A;  1F2Y A;  3KYH C;  2DY8 A;  4B3R Q;  5IWA Q;  1HNX Q;  1WTH A;  2ICI A;  3CPW A;  2EYP A;  2ZM6 Q;  4JI8 L;  4NDX A;  1CHP D;  3H6M A;  4CBV A;  2F0N A;  2L15 A;  3C3L A;  1J5E Q;  5J39 A;  2WAQ E;  3CAM A;  2G5D A;  1L1O A;  4AQY Q;  2PPB C;  5C5L A;  2E2D C;  4DR3 L;  1XNQ L;  1U4M A;  1TXY A;  2IPK D;  4DK6 C;  1QVF A;  3PUY A;  3OMC A;  3FKI B;  4GNX C;  4H0L C;  1IXR A;  1Z47 A;  3GTL B;  1KAW A;  1QUQ A;  4C2M B;  3MXP A;  1WJJ A;  4X66 L;  3CPF A;  4DV0 L;  1PH1 A;  2KCT A;  4PMB A;  1I94 L;  1NTG A;  1AFP A;  3STB D;  3SE0 A;  3S1Q B;  1VDZ A;  4OXP A;  5IOD A;  1HPC A;  3M7G A;  1GO3 E;  2ATW A;  2O2L D;  1KLU D;  4P72 A;  3FVQ A;  4DV1 Q;  1VQ4 A;  4C1N K;  4DR4 Q;  3HG9 A;  1E1T A;  1DD2 A;  1SE4 A;  4LF6 Q;  3GTG H;  3K5N A;  4C3I G;  4R4I A;  4ZKC B;  3GTJ H;  1GUO A;  5AFW A;  3UI2 A;  5FJ8 G;  1D7Q A;  5BR8 Q;  1PH8 A;  2Q2U A;  1K3B C;  1EQR A;  4FXD A;  1HA5 A;  3LNN A;  2WB1 E;  1IBM Q;  3HOV B;  1JOO A;  3I72 A;  5T1I A;  5EAY A;  2Z0S A;  3OMG A;  5DEH A;  1TS4 A;  3ULL A;  2B3G A;  2XVS A;  4K6L A;  3I56 A;  1VQN A;  3AU7 A;  2RA4 A;  2NZ1 D;  3FMC A;  1QG7 A;  3KDF B;  4OO1 I;  4A3G B;  1W2B A;  1CKN B;  4C3I H;  1JE5 A;  1H95 A;  3G4S A;  1VS0 A;  2F52 A;  1NE3 A;  3QWN A;  1KRT A;  3S2D B;  1ESF A;  1Y1W H;  4NB3 A;  2NN6 I;  1A2U A;  5GAE C;  5E3F A;  3RUZ A;  1EY8 A;  3RR5 A;  3BG3 A;  3OTO Q;  1JJC B;  2Q2T A;  4JI7 L;  1M8A A;  1EUJ A;  3STB C;  1AZP A;  2LY7 A;  2F0E A;  1UEB A;  4QUF A;  1B50 A;  1BKB A;  1HZB A;  3MEH A;  3CCR A;  2HQL A;  1SSO A;  5T1G A;  4BA1 I;  4PG3 A;  1PHJ A;  1VQ7 A;  2E2H H;  4NXM L;  4DV7 Q;  3S1R B;  3S15 B;  3KK7 A;  2KCN A;  1RTN A;  2UUA Q;  2VUM G;  1FD7 D;  2E2I H;  2RF4 A;  4YY3 Q;  1B8A A;  1SN8 A;  3VYT A;  3CRK C;  2Z1C A;  3HOU H;  3I4N H;  4DAP A;  2KA7 A;  1TS5 A;  3BYT B;  1F9R A;  1U5K A;  2IW3 A;  1LUZ A;  2B2T A;  4JYA Q;  4JV5 L;  1S5D D;  1XMQ Q;  1LTI D;  1TWA B;  5CYU A;  3G7L A;  1NR4 A;  4KLK A;  3G6J B;  5BN3 A;  1XYI A;  4M8A A;  2FMC A;  5C4H A;  4MN3 A;  1DXM A;  1KIX A;  4BY7 G;  1F2Z A;  5ELN A;  2FIN B;  2PCF B;  4B3S L;  1LTA D;  5CMD A;  1CA5 A;  1PTO H;  4A3K B;  1C0A A;  1G51 A;  4JI8 Q;  3SK4 A;  4FYD A;  4GN5 A;  2QIL A;  2VUM H;  2ZJP A;  2V1C C;  1FGU A;  1OXX K;  2B63 G;  1HZC A;  3DWP A;  4GKK L;  4OO1 G;  2SOB A;  3BVM A;  4IPD A;  2X6G A;  3H15 A;  1XX8 A;  3E9I A;  3CCV A;  4IOA A;  5IIF A;  2RDH A;  4GNX B;  4P75 A;  2PQE A;  3I4M G;  3C1E A;  3P1H A;  2BCO A;  1MBY A;  3C2P A;  1AP0 A;  2JA5 G;  1J9O A;  1KDA A;  2RSO A;  4N9T A;  3F2U A;  4FXG C;  1OXU A;  3RD4 A;  1CUK A;  3H09 A;  1EWH A;  2K5W A;  1DJR D;  2FXQ A;  1VQ9 A;  4BY7 H;  4IUN A;  3VDY A;  1UAP A;  4KHP Q;  1TR5 A;  5M3M G;  3HOY B;  4NXN L;  1MHW C;  3AQQ A;  3I4O A;  3NQT A;  4N8X 1;  1EYC A;  4DXF A;  4K8J A;  1IL2 A;  2E75 C;  2B63 H;  3P20 A;  3BDL A;  1Q86 C;  4OO1 H;  2MGS A;  4ME3 A;  1PZK D;  4C3H G;  1X65 A;  3I4M H;  1D1I A;  5FO7 B;  1ET9 A;  2B2Y C;  1O80 A;  1TWC B;  3NBI A;  3VYU A;  5I6W A;  1EQT A;  1BBX C;  4AYB G;  1U4R A;  2NN6 H;  3AFQ A;  3CP0 A;  4DR5 Q;  3HOW G;  4CJ1 B;  3EQL C;  4LFC L;  1D5M C;  1GM5 A;  2I07 B;  4KI0 A;  2B2T C;  2YTY A;  4QJF A;  1LAB A;  1PFS A;  1X3P A;  1ONL A;  3D6C A;  1DM0 B;  4JI3 L;  1X32 A;  3TSS A;  5M5W H;  1JOR A;  3BYY B;  2ZTE A;  4A3D G;  1EIG A;  5C4X H;  1K73 C;  1MSG A;  1TS2 A;  3RZO B;  3NEM A;  4KJO A;  2QW7 A;  2Q2I A;  3H0G B;  4LF9 Q;  2L5T A;  2B2V A;  3PCO B;  3J80 E;  1L1O B;  1MJE A;  2QCP X;  4IPG A;  2FJ2 A;  2RQX A;  5K5P A;  2QDL A;  4LFB L;  3HOW H;  3I55 A;  2EYL A;  4APV A;  2I5H A;  2IY5 B;  4XIG S;  1MKH A;  1Q46 A;  2AQ1 B;  2KEC A;  5A2Q E;  4J8Q A;  4HR7 B;  1PZJ D;  2JA7 G;  5KYL A;  2NVT H;  3SHL A;  3GTM B;  3B6Y A;  2K5V A;  3S14 H;  1SR3 A;  1ASY A;  1O7Z A;  1UE5 A;  5J3B A;  5JAV A;  4A3D H;  4BXX G;  1SMX A;  1BF4 A;  3NPP A;  2FMM A;  2CW0 D;  2I46 A;  2OQK A;  1DOM A;  1JJ2 A;  1BO0 A;  4JI1 Q;  4NXM Q;  1C9O A;  1JQY D;  3A0J A;  3T1Y L;  4OWT B;  3CU7 A;  2MFI A;  2Y0S G;  5LMN Q;  1YNJ D;  4K0K L;  1GHJ A;  2RCF A;  3VYR A;  1TU2 B;  2JJQ A;  2D62 A;  3T4A C;  4FF3 A;  3VR4 A;  1Z9F A;  4KTA A;  1FJG L;  2UXD Q;  2R92 B;  1OXS C;  1EY9 A;  4J15 A;  4JV5 Q;  2NBF A;  3C1F A;  2DY7 A;  2F0L A;  3E6Z X;  3JAM E;  2KHJ A;  1KC8 C;  2JA7 H;  1PRT D;  4Q0F A;  1LTT D;  5JPM C;  1GXD C;  5I6Y A;  3J7Y W;  3CCJ A;  3MXG A;  1KRS A;  1FL0 A;  3GV3 A;  4I7A A;  5IGG A;  4IAL A;  4IJL A;  4LF5 Q;  1U4L A;  1VQC A;  1VQG A;  1TY0 A;  1YHB A;  2NUC A;  4XYO A;  2KUM A;  3D4W A;  1IBL L;  1VQA A;  2GA4 B;  3H3V I;  4A3J H;  5IYB G;  3MZ5 A;  1UE7 A;  2PI2 A;  2L12 A;  1F2M A;  1PV4 A;  2A19 A;  4LF8 L;  2NVX B;  1B4O A;  2OCE A;  4A3E H;  1EY6 A;  2B2V C;  2WKC A;  4ZK9 B;  1JJG A;  4H13 C;  4IN3 A;  4WFN 3;  3I70 A;  2MQH A;  1HTP A;  3IFD A;  3J80 L;  5KEE A;  2PW5 A;  1EEF D;  4E6I A;  2CW0 C;  4KJN A;  1AZQ A;  1YNJ C;  1RJT A;  1DYQ A;  5A2Q L;  1X9N A;  2R93 B;  4DK0 A;  1UUP A;  5IYB H;  3DM3 A;  4DV5 Q;  3VA7 A;  4MZ9 A;  4F8M A;  1N32 Q;  5EKI A;  4RFB A;  2I0Q A;  3WDN A;  2WAC A;  2KOL A;  3Q0A A;  1PRT C;  4MIU A;  4RGO S;  4A3M B;  3FKI H;  1RDP D;  4EQN A;  1B44 D;  1H9M A;  4KHV A;  1E2Z A;  3GTL H;  1D5Z C;  5C0X J;  4C2M H;  2K5Q A;  1RCV D;  1XNR Q;  5H1S E;  4LF4 L;  3CCS A;  1QZH A;  4HJ9 A;  4DR7 L;  1WI5 A;  3HGB A;  5I9P A;  3S1Q H;  4L5R C;  5ELE A;  1LT5 D;  4LAA A;  4A3F B;  4DR1 Q;  1A0I A;  2IWH A;  4IQZ A;  4UP7 A;  4Y7N B;  2A6H D;  1EWC A;  3HEJ A;  4B3R L;  4WJ3 M;  1X56 A;  3NHH A;  1HNX L;  5DAU A;  4A3G G;  3CCQ A;  3BZC A;  4ZKB B;  2R7F A;  4K14 A;  3PO3 B;  3ZJY C;  3CCM A;  1D1K A;  1J5E L;  2NYZ D;  1VF7 A;  5D14 A;  3HOX G;  4V0B A;  3MC0 B;  4KY5 A;  2F0Q A;  3S17 B;  1KHI A;  3F8T A;  1EY4 A;  3H3V H;  4AQY L;  4FP5 D;  4B3T L;  3TS2 A;  3HOV H;  4ULL A;  3CC7 A;  1JMC A;  4RKL A;  5GAD C;  4B08 A;  2BA0 A;  3J80 i;  2VNU D;  3OWF A;  1YI2 A;  3ULP A;  1FJG Q;  4NKL A;  4A93 G;  4N8F A;  4IZ8 A;  4YWM A;  4A3G H;  3S16 B;  2EY6 A;  5C4X B;  1O7L A;  3EJI A;  1B53 A;  2EY2 A;  1ICW A;  2IHE A;  3S2D H;  1UE1 A;  1LTL A;  2H4O A;  1A3U A;  2JXM B;  4DV1 L;  1I4H A;  1BBW A;  1Q12 A;  1Q3L A;  2H5X A;  1JC7 A;  2ID0 A;  2QGQ A;  4DR4 L;  3NE5 B;  4GZY C;  5C44 B;  1NMG A;  2ALY B;  4LF6 L;  1P8L A;  5LMU Q;  2PZT A;  4ID6 A;  3NQI A;  1BNZ A;  3S15 H;  1OTC A;  4YWK A;  4IFD J;  2A6H C;  1QVC A;  2NTS A;  3ERO A;  5IT9 c;  5BR8 L;  1H9R A;  1HR0 Q;  1SJH D;  4ALP A;  4DV3 Q;  2TSS A;  4WRD A;  4H02 A;  3PSI A;  5IP7 H;  1IBM L;  3T51 B;  2JP1 A;  3NTI A;  3F1Z A;  2ENB A;  1VQE A;  5EPK A;  1X55 A;  1QOH A;  4RWS C;  4XXE A;  3M85 A;  1TWA H;  2HUG A;  1GJX A;  2M2L A;  4F88 A;  3MXU A;  4HIM A;  3U58 A;  3QIA A;  2ZXO A;  3PIP A;  5F2D A;  4HSV A;  2Z4I A;  2ASB A;  1R4Q B;  2F0D A;  5IYC G;  2JE6 I;  5C3X A;  1PH3 A;  4GN3 B;  1SLJ A;  2F0J A;  3HOY G;  1G2T A;  4A3K H;  2B29 A;  2JA6 G;  3K57 A;  3AFP A;  4DAY A;  3I4L A;  2VW9 A;  4QMG A;  2K7V A;  4HJ5 A;  1PRT B;  4UPA A;  3J81 E;  3K7A H;  3OTO L;  1IL8 A;  1K8A C;  4HSP A;  5G3L F;  2KJX A;  3HOZ B;  1SNO A;  3OOC A;  1B70 B;  4YHH Q;  5M5X B;  1YEZ A;  1WTX A;  1E2V A;  2F1M A;  2G9H D;  4A3J B;  1B3A A;  4HED A;  4CDD C;  2NZH A;  4UP8 A;  5A35 A;  4C3J B;  4DV7 L;  2XNA C;  2PMZ E;  2UUA L;  4L5T A;  2EQS A;  2K32 A;  3E9H A;  2F0K A;  5JEA J;  2F03 A;  3CCE A;  5IYC H;  1RIP A;  4OL7 A;  3A7A B;  1TWH B;  3ZYY X;  3RNU A;  3HOY H;  2NB0 A;  2EYJ A;  2Q8I B;  1AH9 A;  4BBR B;  1XMQ L;  2K05 A;  2QA4 A;  1JE4 A;  1SNP A;  2R61 A;  3L2P A;  1PH5 A;  3TDQ A;  1XMO Q;  4X64 L;  5LL6 S;  4IJH A;  3H0G G;  1ZYR D;  4LF7 Q;  2IJ0 A;  4G57 A;  3TN2 A;  1ZXT A;  1TWC H;  4ZLT F;  1LM0 A;  3L7Z C;  4UHV A;  2PO4 A;  1SYC A;  1PRT F;  4G7O C;  4RH6 A;  1RTO A;  3CC2 A;  1WCM B;  4OHJ A;  4LFA Q;  3MFY A;  4IUR A;  5FLX E;  4B3T Q;  3CMA A;  3KF6 A;  1V1P A;  2KED A;  2HIX A;  3KLR A;  4R9W A;  2RHQ B;  3ER0 A;  3NEL A;  1Z7T A;  1I50 B;  3L0O A;  4ABN A;  3RZO H;  2RKS A;  1LTG D;  4RHS A;  1DZ1 A;  5GQO A;  3H0G H;  5ELD A;  1WTV A;  1QNU A;  4FXK C;  4KHP L;  3SDZ A;  3QG1 A;  5C3W A;  4BBS B;  4HAE A;  4U67 3;  3R8B A;  2QEX A;  5M5Y B;  2LKV A;  3TS0 A;  1SNM A;  2CQA A;  3I8Z A;  3AEV A;  2RHS B;  2RSN A;  1SMY D;  3K8A A;  1CHQ D;  4BA2 I;  5J22 A;  2IX1 A;  2L0C A;  3K81 C;  4QIW B;  2PNH A;  3T53 B;  2EJG C;  2A5H A;  3NTK A;  3N52 A;  3TP8 A;  3GTM H;  3X3N A;  1B2T A;  3AB9 A;  4GKJ Q;  4KD4 A;  1SNC A;  4JBJ A;  1WD1 A;  4DR5 L;  2E76 C;  2ZTC A;  1Y14 B;  2KVM A;  2HDM A;  1ZYR C;  1EQQ A;  3A8J E;  1Y1W G;  5I4D A;  2K1B A;  5M3F B;  4CJ0 B;  2R92 H;  1CA6 A;  2DNC A;  1JOQ A;  1TWG B;  4TRD A;  4DV6 Q;  2WAQ B;  3CKI B;  1WYD A;  3GTO B;  3K7U C;  4DK1 A;  1SE3 A;  1NMF A;  4LF9 L;  1DOL A;  3UDF A;  2CCZ A;  3FRP B;  2XWJ B;  4G7H C;  3HOU G;  3I4N G;  3GO5 A;  1K8O A;  1HHV A;  5IP9 G;  3KF8 A;  2Z6K A;  4JW0 A;  4HTH A;  4ZRZ A;  2OWO A;  2EYO A;  1LO5 D;  4YCU A;  2F0H A;  2R3Z A;  4POF A;  1E0B A;  4X65 Q;  5FLX L;  4DUZ Q;  2K6A A;  3DHQ A;  3AYH B;  3BVG A;  1STE A;  3MXN A;  1S4Z A;  4G7Z C;  3DWQ A;  3E3X A;  1SMY C;  2NVX H;  4R4Q A;  3H94 A;  4HIO A;  4DAV A;  3FPU B;  3GP7 A;  2B2Y A;  4JI1 L;  1HUM A;  1SRO A;  2Q8R E;  2HHH Q;  5LMN L;  3HZX A;  3W3A A;  2AMC B;  2F3V A;  2FHT A;  5HY6 A;  4A3I B;  3GTK B;  1LTR D;  2JYO A;  1JIC A;  4ZQ3 A;  1ESR A;  4JBK A;  2K5H A;  2ZXP A;  3BZK A;  2L4N A;  3VR6 A;  2UXD L;  5IP9 H;  4JBM A;  5IGE A;  1HRJ A;  4AH6 A;  4MTK A;  1Q8K A;  4RKB A;  2K28 A;  2ICE C;  2B39 A;  1O7I A;  3I2Z A;  5COR A;  3U4Z A;  4OON A;  2R93 H;  2WII B;  4QF4 A;  3HKZ G;  3UDI A;  2C35 B;  5ISR A;  3R2T A;  4A3F G;  4X64 Q;  1EFW A;  3ERQ A;  2WB1 B;  4IUU A;  1G2S A;  1PMR A;  2A68 D;  3OWE B;  2CH4 W;  1WVL A;  1OO9 B;  2IL8 A;  3FEW X;  4LF5 L;  2XSC A;  1BBU A;  4A3M H;  4RGM A;  2VQE L;  3K7A B;  3CME A;  3NWT A;  3R93 A;  5IY0 A;  4CKC A;  2PNR C;  4RA8 A;  1YIT A;  4DV2 Q;  3IAY A;  2EYH A;  1K0R A;  5JJL A;  1YNN D;  1W6J A;  5C4J B;  1LLR D;  2NN6 G;  5IYD H;  4DAY B;  2OT2 A;  3V05 A;  5JOB A;  1XPR A;  2XN9 C;  5COY A;  1U0L A;  1MD2 D;  1TY2 A;  4HIK A;  4A3F H;  3PF5 A;  2VZA A;  3MWY W;  2Z6K C;  2F4V Q;  3EIV A;  2OF1 A;  1NJI C;  4KMU C;  4OWX B;  1Y1V B;  4Y7N H;  2P5Z X;  4PMC A;  1H9S A;  2C9O A;  3D0F A;  2ZJR A;  1Q8I A;  4CHT B;  5C4X G;  5CV7 A;  3PO3 H;  1A3V A;  2FFK B;  3NEN A;  4LUZ A;  4DV5 L;  3K6O A;  1Q90 A;  3U4V A;  3Q24 A;  1FR3 A;  1N32 L;  5FLM H;  3S17 H;  1VQD A;  3F2B A;  5D3D A;  4TVA B;  1F77 A;  1L0Y B;  4X3U A;  1SYG A;  2EJM A;  4JI6 Q;  2HT1 A;  4LNQ A;  3S2H H;  3TQY A;  1Q81 C;  5C44 G;  1MJC A;  1RHP A;  2A68 C;  4JI4 Q;  1II3 A;  1PVO A;  3EBE A;  4NMZ A;  5IGC A;  1CKM A;  2MUY A;  3RLF A;  2K03 A;  3M4O B;  3CC4 A;  3NBH A;  1Q1B A;  1XNR L;  3EFX D;  4LW1 A;  3T13 A;  1V9P A;  4X6A H;  3S16 H;  3Q6S A;  1AEX A;  3UE1 A;  5FK9 C;  3IRB A;  3PIP 3;  3P7J A;  2EZV A;  5JPN C;  1VMC A;  3OW7 A;  1A15 A;  1K28 A;  4DR1 L;  1N9W A;  1BVS A;  1YNN C;  1EOT A;  5C0X I;  4CJ2 C;  2EVB A;  4LWC A;  3KF6 B;  1I3Q B;  2F3W A;  1T5X D;  3VA5 A;  5HUR A;  3Q8D A;  3DEP A;  3WOE A;  1WTO A;  2KBN A;  5C44 H;  4OIJ A;  1QUQ B;  4X62 Q;  4B3M Q;  1G6P A;  1CZW A;  3KLS X;  3FHW A;  5FO8 B;  4XYQ A;  3J7A V;  4C56 C;  4DKA C;  1VQI A;  3D4D A;  3HS0 C;  3D31 A;  4KY6 A;  1TS3 A;  3OW2 A;  3EA6 A;  4QL5 A;  5M9O A;  5EBD A;  1Y69 U;  3DEO A;  4MNO A;  1GVP A;  3CHB D;  1ZKO A;  4A3J G;  1IKM A;  3QR8 A;  4OEM B;  1EY0 A;  4DR2 Q;  2YV5 A;  1S40 A;  2MO1 A;  2A1A A;  4JVZ A;  4JBW A;  1BUV T;  4IUP A;  1DGS A;  2EXD A;  4A3E G;  1CQV A;  3QOJ A;  3RN2 A;  4BBR G;  2F0O A;  2KEE A;  5ELC A;  3K5M A;  1ENC A;  2GVA A;  4P73 A;  1IHZ A;  1NAP A;  3HFZ B;  2H1E A;  2ZTD A;  1PH9 A;  2SDF A;  2HQE A;  3HOZ H;  1E22 A;  2R7Z B;  1XTC D;  4L5Q A;  5M5X H;  3M9B A;  3KJP A;  2VQE Q;  2OXP A;  3TME A;  4DR6 Q;  5LMU L;  3PUW A;  2BOS A;  4C3J H;  4DAM A;  1DCZ A;  2DJG C;  2HDL A;  4IPC A;  1HR0 L;  1X3E A;  4DV3 L;  3TBI B;  3SEB A;  2AUJ D;  4DU9 A;  4GN4 B;  3V2T A;  4JG2 A;  1TWH H;  1QCB D;  4GLV B;  3KF8 B;  1GD7 A;  1S72 A;  3U9S A;  4RCN A;  1STN A;  4BBR H;  4K2K A;  3FKI G;  3UE0 A;  5TSS A;  1Y8N B;  3HKZ E;  4IFD I;  2VQF Q;  2DNE A;  4QQB X;  4I65 A;  4GLX A;  1GUW A;  1F9P A;  4JCV E;  1E2W A;  2XTI A;  4QUC A;  4DNI A;  1KLG D;  3O13 A;  5C0X H;  3D6W A;  2K50 A;  4HN7 A;  2BH8 A;  3T16 A;  4F7X A;  4S3S A;  1WCM H;  5J1Z A;  4UDU C;  3RLN A;  4C1N I;  2YU9 B;  1PH2 A;  4V19 0;  3MVV A;  4YHH L;  2SNS A;  1C7Y A;  2BE5 D;  2K75 A;  2NVY B;  1BXT A;  5LHY 1;  3MFG A;  1I50 H;  1PH6 A;  1KNE A;  3NXW A;  2BDN A;  3QB3 A;  1YHQ A;  3KOJ A;  4DNR B;  1VF5 C;  4A4I A;  2WP8 J;  3N6R A;  1F9Q A;  1VQJ A;  3JAM L;  4BBS H;  4ZUJ A;  3HOV G;  2OQ0 A;  5M5Y H;  5I2Y A;  4HJ7 A;  1BCP D;  2KEN A;  2UXC L;  3J81 j;  2JA8 B;  3ICE A;  4YCV A;  1XMO L;  2UUB Q;  2PQA A;  2AUK A;  4LF7 L;  1VCI A;  4ZCK A;  3UDG A;  1FVI A;  3KUP A;  1VQ6 A;  3TZU A;  2EPB A;  4AYB E;  3RZD B;  4LJZ C;  1QWY A;  2B2U A;  3WOF A;  4IFD G;  2VXW A;  4P74 A;  1B9M A;  3M4P A;  1N36 Q;  2JEA I;  4QCL A;  4RCO A;  4LFA L;  1UWV A;  3CQZ B;  4YWL A;  3NTH A;  3C46 A;  5M3F H;  3S2H B;  3BDO A;  4NP5 A;  2AHO B;  3HRZ C;  3K5L A;  2I5L X;  2K01 A;  1PZI D;  4PZ8 A;  1E7Z A;  5CV8 A;  1TWG H;  2D0O A;  1T9H A;  3GTO H;  3VYS A;  1QE6 A;  4A3I G;  1IW7 D;  3I7F A;  1N33 Q;  1VQF A;  2I5M X;  2JA5 B;  1FNV A;  2L1B A;  4X3S A;  2BE5 C;  3Q22 A;  4DUY L;  2EE1 A;  1MGS A;  5IP7 G;  2M00 A;  2Z4H A;  1X3G A;  2VB3 X;  3CCU A;  3M4Y A;  1CKN A;  1HFG A;  4IFD H;  2MJ8 A;  1HA6 A;  4CDC C;  4FF4 A;  1W6K A;  1KAB A;  1PYW D;  1X6O A;  2UUC Q;  3F2C A;  1I4G A;  5ELO A;  3S1N B;  3W1G A;  2X69 A;  4R8I A;  3NBH B;  3I90 A;  1MSH A;  2WB1 G;  4XQQ A;  2BH2 A;  4A3C H;  1BCP C;  1QIL A;  4GKJ L;  1YJN A;  3MAQ A;  1STY A;  4A3K G;  2JSO A;  2XIW A;  1HFN A;  2Y0S E;  4FF2 A;  1R4P B;  2HD3 A;  5C6A A;  3KLW A;  2YTX A;  3PF4 A;  4A3I H;  2K04 A;  3GTK H;  2CVR A;  2IT1 A;  3BVZ A;  3L3O C;  2KCM A;  3Q23 A;  3JAM i;  3T1H Q;  5DM6 3;  1ROD A;  4IUT A;  1MI2 A;  4KKS A;  4BWG B;  1NNX A;  2CHB D;  2N49 A;  1ML0 D;  3HKS A;  1Q82 C;  1VQL A;  4A75 A;  1BR9 A;  4O42 A;  1S5E D;  4DV6 L;  4OX9 Q;  2NTT A;  4A3B B;  2A73 B;  2AWN A;  4K8I A;  1ENA A;  3SK8 A;  4MHE A;  5CV5 A;  2N3S A;  2HCI A;  2B2U C;  4LUO A;  1JB7 A;  2ZJQ A;  3V96 A;  3WWV A;  3VR3 A;  4CKB A;  4GS3 A;  1Y1V G;  1OXT A;  1HJP A;  1CSQ A;  5JEA H;  4JOI A;  4ODG A;  1GUT A;  4IO9 A;  1EU4 A;  3ERS X;  3H3V C;  1IW7 C;  3A8K E;  1F9S A;  5CV4 A;  3TP7 A;  4KKU A;  1M1K C;  4MTN A;  5CBA E;  1VQP A;  3VR5 A;  4X65 L;  3UDX A;  1JWU D;  3TP6 A;  4DUZ L;  4PV1 C;  1NUC A;  3TRZ A;  4N9P A;  5C4J H;  1EYA A;  4A3L G;  5HGQ A;  1G6Z A;  1S5C D;  1SJE D;  2HHH L;  5CV9 A;  5I9O A;  3RLO A;  1HQR D;  4ZAI A;  1HNZ Q;  4B9X A;  2YTV A;  1AE2 A;  5EGT A;  1K0S A;  3JC6 6;  4HJ8 A;  3SVM A;  2WV6 D;  1Y1V H;  1PA6 A;  3TRE A;  2RVL A;  3OIP A;  4EX5 A;  2MHV A;  2UXC Q;  3L9A X;  3ULJ A;  1A63 A;  4M1U B;  4QB4 A;  1EZ6 A;  1I5F A;  2EY1 A;  1CFM A;  1IBK Q;  4A76 A;  1YJW A;  1IYV A;  1HNW Q;  3K0Y A;  2CQO A;  1G8Z D;  2F4I A;  4K5V A;  1KQS A;  2F0V A;  4TSS A;  5IT9 E;  5JVH 3;  1A6X A;  2O5I C;  3DM1 A;  4A3L H;  1K8M A;  3H91 A;  1CSP A;  3G48 A;  1EWI A;  5AJ3 Q;  2CWA A;  3CW2 C;  4KK7 A;  2F0M A;  4NW2 A;  2BDO A;  1WFQ A;  5KGU A;  2F0T A;  1NCV A;  4KY7 A;  5KNB A;  3M4O H;  4DV2 L;  3ONA B;  2SEB D;  1H9J A;  2RDG A;  3LX0 A;  2F0U A;  1A2T A;  1X54 A;  4GOP A;  2ZXR A;  1FGB D;  4DFA A;  5DLQ E;  3K5O A;  1FNU A;  2X6L A;  4JOI C;  1I6H B;  4B9W A;  2F4V L;  1GHK A;  4DUY Q;  1TWF B;  4FF1 A;  2CFM A;  5C4Z A;  1I3Q H;  2R92 G;  1ILP A;  2PMZ B;  3DMU A;  1Y8O B;  1EY5 A;  1N34 Q;  4FO2 A;  3NK9 A;  3GTQ B;  3K59 A;  1BCP B;  1CQF A;  3SR1 A;  3J81 L;  1H9K A;  4OWW B;  1G29 1;  4XDX A;  1HXY D;  5DM7 3;  3PO2 B;  2KQ3 A;  1EYG A;  4UY8 C;  2MO0 A;  4IPH A;  4KN4 C;  5EKL A;  3I73 A;  1L2F A;  3SXH A;  2GN5 A;  2L55 A;  4K2L A;  4RAU C;  4JI6 L;  1IYU A;  2KHS A;  2R7Z G;  1DOK A;  1JCK B;  3S1M B;  2UXB Q;  1B9N A;  3TP5 A;  3GV6 A;  2E8G A;  2N8N A;  4XQJ A;  4JI4 L;  2R6G A;  5FKA C;  2PQA B;  1EU3 A;  1S5F D;  1GUN A;  2AQ3 B;  1ILQ A;  1K3R A;  1WTP A;  4R4C A;  4WOR A;  2UU9 L;  3URY A;  1HCZ A;  1K83 B;  5E4X A;  1ASZ A;  1I4X A;  3SGI A;  3J7A F;  2KCC A;  4HMI A;  2F0W A;  3X3M A;  4DF7 A;  4PZ7 A;  4UAI A;  1TII D;  2DN8 A;  5IT9 L;  4OEL B;  3RN5 A;  1D8L A;  3DXJ C;  4H44 C;  4DV4 Q;  1U4P A;  3U50 C;  1PH4 A;  1BCP F;  1FNW A;  2R7Z H;  1JB3 A;  2JK8 A;  4UP9 A;  1G91 A;  5FOB B;  2B8G A;  4X62 L;  4B3M L;  1R9T B;  4JI5 Q;  4LUV A;  2R93 G;  4F87 A;  4EQP A;  4AIM A;  3A56 A;  3I3C A;  1QJO A;  4K6D A;  4GOP C;  1PLF A;  4HCE A;  1VQ8 A;  5L37 A;  2E2J B;  1IYJ B;  1J6Q A;  2O4X A;  4GLA C;  1XWE A;  4JI0 Q;  3QO2 A;  1LT3 D;  3A5Z B;  3A7L A;  5IGB A;  2D9U A;  1L1O C;  3BU2 A;  4A3M G;  5FJ8 H;  4L5S A;  1YBY A;  3HOX B;  1D6E C;  2EYF A;  4PNY A;  4POG A;  4DR2 L;  2A8V A;  3LWE A;  4I7Z C;  1VQH A;  1A3T A;  3CD6 A;  2AKW B;  2M9V A;  3E0J A;  5IYD G;  1HUN A;  3J81 i;  4ZYS A;  2CKZ B;  5KNC A;  4A93 B;  1L0X B;  2JA8 G;  1WTQ A;  1T5E A;  3EN2 A;  2RCN A;  4R4T A;  5NUC A;  1W3S A;  2QDB A;  2YU9 H;  2NVQ B;  1NBW A;  3BJU A;  3ITP A;  1SYD A;  5C5M A;  4XQN A;  3GTP B;  1Y8P B;  4QY7 A;  3G71 A;  1CI3 M;  1SFO B;  2NVY H;  2JQO A;  3LWU A;  4DR6 L;  3PO3 G;  3KJO A;  5GRO A;  1SXT A;  1PTO D;  5JJI A;  4JI2 Q;  4P2C B;  1STG A;  3TEH B;  4HJA A;  5FLM G;  1SDF A;  4XT1 B;  1VQO A;  2A74 C;  2K5D A;  4KV6 A;  1JT8 A;  1EIH A;  3OYY A;  5D65 A;  3CCL A;  4OIK A;  1SBB B;  3NP8 A;  1LV9 A;  3OPO A;  3J80 c;  3M3Y B;  1TKW B;  2JA8 H;  2RBM A;  1HZ9 A;  2VQF L;  1STB A;  4DR3 Q;  1XNQ Q;  2Z8L A;  5LMN W;  2EXZ A;  2E5L L;  1VQM A;  3RZD H;  1WD0 A;  1TQO A;  4O1N A;  1P16 A;  5C3E B;  3W5O A;  4X66 Q;  1EL0 A;  1F2L A;  4DV0 Q;  1EFI D;  1I94 Q;  4BY1 B;  3CQZ H;  4PZ6 A;  2HIV A;  1SYB A;  4XT3 B;  2JA6 B;  2DUD A;  2XRQ D;  1CKO A;  3BDC A;  3R3O A;  5IGF A;  5KND A;  1NR2 A;  2WKD A;  1CK1 A;  3OSO A;  2GVB A;  1RL2 A;  1SE8 A;  1ICF B;  3EVQ A;  1HTL D;  2HCC A;  4RHR A;  3JAM c;  5CV6 A;  2JA5 H;  3NSW A;  3PIO 3;  2UU9 Q;  2Q8T A;  1RF2 D;  1QVG A;  3D3R A;  1CM9 A;  5ELF A;  4R8N A;  2VS1 A;  5KRU A;  1JR0 D;  1DON A;  1PTO C;  2MNA A;  4ILW A;  3P75 A;  2AQ2 B;  5JJZ A;  4A3B G;  4IOC A;  3S1N H;  2OTJ A;  1QNK A;  2UUB L;  5GAG C;  5M3M H;  4DA2 A;  5IOC A;  1V1P B;  2DJF C;  4ZUI A;  1ET6 A;  1EQV A;  2IHF A;  5CR3 A;  1BQQ T;  2G9D A;  3S9W A;  1CT1 D;  3HP3 A;  4CDF C;  4GOP B;  2LXK A;  1C8C A;  4ME5 A;  1MIU A;  3R2I A;  4DXG A;  5HGT A;  1N36 L;  4C3H H;  1PYB A;  1QB5 D;  1ZEQ X;  2EDG A;  3QJY A;  1FYC A;  1XPU A;  5G3L D;  3HOZ G;  3IKJ A;  1YHA A;  3M4Q A;  2SNM A;  1AE3 A;  2AWO A;  4CDE C;  2QEJ C;  3I91 A;  4EQO A;  2J7Z A;  4JI7 Q;  4A3B H;  5KIX A;  4C3J G;  2O5J C;  4YIJ A;  2JEB I;  1X3F A;  1STH A;  2OEO A;  1N33 L;  4R4O A;  1QZG A;  1UEA B;  3MHB A;  1V1O A;  4DNT B;  3KLS A;  2LS0 1;  3AMU A;  2J4X A;  1EIF A;  3GTG B;  1V8Q A;  3GTJ B;  2K14 A;  1ENF A;  3SK6 A;  2VB2 X;  1SAP A;  2UUC L;  5JJK A;  1SE2 A;  1PYS B;  1XXG A;  1EOV A;  1VQB A;  3RMH A;  2B2W A;  3OHX C;  2EJF C;  2IX0 A;  4KHZ A;  5C0X G;  2F0G A;  3J7Z C;  1B3Q A;  3A8I E;  1K9M C;  1I4Q A;  1E24 A;  1WCM G;  4RGT A;  1KNA A;  4P71 A;  4B3S Q;  3J7A 5;  2N78 A;  3T1H L;  1WTR A;  5CGK A;  4BXX H;  5E4W C;  4C3I B;  1YNX A;  1GOZ A;  1STA A;  1KDC A;  5EPJ A;  1KL9 A;  3MTS A;  2K5N A;  2PYK A;  4EGV A; 
#chains in the Genus database with same CATH homology
 1Y1W B;  1IKL A;  1PXU A;  1PDQ A;  4XTC S;  4K5X A;  1PFB A;  4FVM A;  4CKE A;  1HQM C;  4OGQ C;  1KDB A;  2B8F A;  4DN4 M;  4RGN A;  1JWS D;  2E2H B;  1I4R A;  2E74 C;  2BA1 A;  2QF7 A;  2C5C A;  2QKI C;  2E2I B;  1BDO A;  3NWS A;  1SYE A;  3HOU B;  3I4N B;  2F0I A;  3VR2 A;  3OIQ A;  3CRL C;  1CZG A;  5KYI A;  1TT2 A;  5E1F A;  5BN5 A;  1PFM A;  3PUX A;  3W2D A;  1I4P A;  2RDF A;  3GQB A;  2EY5 A;  3GD7 A;  2EYM A;  1PTO B;  4PMW A;  1U9R A;  1VMP A;  4DGZ A;  4IUV A;  2D2C C;  2VUM B;  2F0P A;  3M7N A;  4L63 B;  4U68 A;  2B2W C;  4H7B A;  4J1M A;  1KAA A;  2A6E D;  2N55 A;  1GUG A;  1LT4 D;  5K36 G;  2MP1 A;  3MA2 B;  1JOK A;  2PW7 A;  1RD9 D;  3PV0 A;  3HKZ B;  1NSN S;  1V43 A;  4BY7 B;  1KTK A;  4EVO A;  2WIN B;  1J8I A;  3BZD B;  5EPL A;  1H9S B;  3QOL A;  4BS9 A;  3ND8 A;  2A69 D;  2B63 B;  3PUV A;  1M4V A;  1PTO F;  4X3T A;  3I4M B;  3A54 A;  2L9H A;  5K36 H;  3ND9 A;  1GUS A;  1AN8 A;  1Q1E A;  4TKO B;  2L11 A;  1EEI D;  4WJW A;  4G4K A;  2J0T D;  2LFN A;  2V4D A;  5BN4 A;  1WTW A;  5M3M B;  1SNQ A;  5M5W B;  5ELB A;  1LTS D;  3FPP A;  2F0F A;  2LMC B;  5JEA G;  1UNS A;  1LT6 D;  4C3H B;  1JWM D;  2A6E C;  1D5X C;  2EOT A;  4PQX A;  2D5D A;  4AYB B;  3BS1 A;  1I6V C;  3HOW B;  3E5S A;  5I2X A;  3FDT A;  3PUZ A;  1X3Q A;  3PMF A;  4KD3 A;  2YYZ A;  4FNF A;  1C48 A;  3SK5 A;  2NVT B;  3S14 B;  5D3I B;  5IGD A;  1EYD A;  3DUZ A;  1AW7 A;  4IUQ A;  4A3D B;  5LL6 X;  3IL8 A;  2A69 C;  1RKN A;  2MPM A;  3D8G A;  1O7Y A;  1EZ8 A;  3U9O A;  1PFN A;  1S5B D;  3A55 A;  3D4R A;  1BOS A;  2ZT9 C;  5EJW A;  4L8J A;  1CTM A;  3K58 A;  4LMQ D;  5EQ0 A;  5FO9 B;  1TVX A;  4J6H A;  2JA7 B;  4K5W A;  2PZU A;  1LAC A;  4JK1 C;  4LK1 C;  3IFT A;  1B1Z A;  3DWA A;  4TQU S;  2N88 A;  3T56 B;  1LTB D;  2K33 A;  4CGY B;  2IX3 A;  2PZW A;  4KKT A;  2Y0S B;  1OXV A;  3TZD A;  1EY7 A;  1SND A;  1C4Q A;  5CC4 A;  1SYF A;  2XRS D;  2NWG A;  4KN7 C;  1O78 A;  2TMP A;  4HCS A;  1Z6H A;  4Z9C B;  3KBX A;  4X3K A;  1SEB D;  4A3E B;  4Q5V A;  1D2B A;  4HMJ A;  5CBE E;  4L6T B;  2XWB B;  5EBC A;  3KBG A;  2F0S A;  3NUC A;  5DNF A;  5JVG 3;  5EKK A;  1F2Y A;  2DY8 A;  2ICI A;  2EYP A;  4NDX A;  1CHP D;  3H6M A;  4CBV A;  2F0N A;  3C3L A;  5J39 A;  2PPB C;  5C5L A;  2E2D C;  1U4M A;  2IPK D;  3PUY A;  3OMC A;  3FKI B;  4H0L C;  1Z47 A;  3GTL B;  4C2M B;  3MXP A;  4PMB A;  1AFP A;  3S1Q B;  3SE0 A;  1VDZ A;  5IOD A;  1HPC A;  3M7G A;  2O2L D;  1KLU D;  3FVQ A;  4C1N K;  3HG9 A;  1DD2 A;  1SE4 A;  3K5N A;  4C3I G;  4ZKC B;  1GUO A;  5AFW A;  3UI2 A;  4FXD A;  1HA5 A;  3LNN A;  3HOV B;  1JOO A;  3I72 A;  5T1I A;  3OMG A;  5DEH A;  1TS4 A;  2XVS A;  4K6L A;  3AU7 A;  2RA4 A;  2NZ1 D;  3FMC A;  1QG7 A;  4OO1 I;  4A3G B;  3QWN A;  3S2D B;  1ESF A;  2NN6 I;  1A2U A;  5E3F A;  3RUZ A;  1EY8 A;  3BG3 A;  1M8A A;  1AZP A;  2LY7 A;  2F0E A;  4QUF A;  1B50 A;  3MEH A;  1SSO A;  5T1G A;  4BA1 I;  3S1R B;  3S15 B;  3KK7 A;  2KCN A;  1RTN A;  1FD7 D;  3VYT A;  3CRK C;  2Z1C A;  4DAP A;  2KA7 A;  1TS5 A;  3BYT B;  1F9R A;  2IW3 A;  2B2T A;  1S5D D;  1LTI D;  1TWA B;  5CYU A;  3G7L A;  1NR4 A;  5BN3 A;  3G6J B;  1XYI A;  4M8A A;  2FMC A;  5C4H A;  4MN3 A;  1DXM A;  1F2Z A;  2FIN B;  2PCF B;  1LTA D;  5CMD A;  1CA5 A;  1PTO H;  4A3K B;  3SK4 A;  4FYD A;  2QIL A;  1OXX K;  3DWP A;  4OO1 G;  2SOB A;  3BVM A;  2X6G A;  1XX8 A;  5IIF A;  2RDH A;  2PQE A;  3C1E A;  3P1H A;  2BCO A;  1MBY A;  3C2P A;  1AP0 A;  1J9O A;  1KDA A;  2RSO A;  4N9T A;  3F2U A;  4FXG C;  1OXU A;  3RD4 A;  3H09 A;  1EWH A;  2K5W A;  1DJR D;  4IUN A;  1UAP A;  1TR5 A;  3HOY B;  3NQT A;  1EYC A;  4DXF A;  4K8J A;  2E75 C;  3P20 A;  3BDL A;  4OO1 H;  2MGS A;  1PZK D;  4C3H G;  1D1I A;  5FO7 B;  1ET9 A;  2B2Y C;  1O80 A;  1TWC B;  3NBI A;  3VYU A;  5I6W A;  1EQT A;  1BBX C;  1U4R A;  2NN6 H;  4CJ1 B;  3EQL C;  1D5M C;  2I07 B;  4KI0 A;  2B2T C;  1LAB A;  1X3P A;  1ONL A;  3D6C A;  1DM0 B;  1X32 A;  3TSS A;  1JOR A;  3BYY B;  1EIG A;  1MSG A;  1TS2 A;  3RZO B;  4KJO A;  3H0G B;  2L5T A;  2B2V A;  3J80 E;  2QCP X;  2FJ2 A;  2RQX A;  5K5P A;  2EYL A;  4XIG S;  2AQ1 B;  2KEC A;  5A2Q E;  4J8Q A;  4HR7 B;  1PZJ D;  5KYL A;  3SHL A;  3GTM B;  1O7Z A;  5JAV A;  1BF4 A;  3NPP A;  2FMM A;  2CW0 D;  2I46 A;  1DOM A;  1BO0 A;  1JQY D;  3CU7 A;  1YNJ D;  1GHJ A;  3VYR A;  1TU2 B;  2D62 A;  3T4A C;  4FF3 A;  3VR4 A;  4KTA A;  2R92 B;  1OXS C;  1EY9 A;  2NBF A;  3C1F A;  2DY7 A;  2F0L A;  3E6Z X;  3JAM E;  1PRT D;  4Q0F A;  1LTT D;  5JPM C;  1GXD C;  5I6Y A;  3J7Y W;  3MXG A;  3GV3 A;  5IGG A;  4IAL A;  1U4L A;  1TY0 A;  2NUC A;  4XYO A;  2KUM A;  3D4W A;  2GA4 B;  3MZ5 A;  2L12 A;  1F2M A;  2NVX B;  1B4O A;  1EY6 A;  2B2V C;  2WKC A;  4ZK9 B;  4H13 C;  4IN3 A;  4WFN 3;  3I70 A;  1HTP A;  3IFD A;  3J80 L;  5KEE A;  2PW5 A;  1EEF D;  4E6I A;  2CW0 C;  4KJN A;  1AZQ A;  1YNJ C;  1RJT A;  1DYQ A;  5A2Q L;  2R93 B;  4DK0 A;  1UUP A;  3VA7 A;  4F8M A;  5EKI A;  4RFB A;  3WDN A;  2WAC A;  2KOL A;  3Q0A A;  1PRT C;  4MIU A;  4RGO S;  4A3M B;  1RDP D;  4EQN A;  1B44 D;  1H9M A;  4KHV A;  1E2Z A;  1D5Z C;  5C0X J;  2K5Q A;  1RCV D;  3HGB A;  5I9P A;  5ELE A;  1LT5 D;  4LAA A;  4A3F B;  2IWH A;  4IQZ A;  4Y7N B;  2A6H D;  1EWC A;  3HEJ A;  3NHH A;  5DAU A;  4ZKB B;  4K14 A;  3PO3 B;  1D1K A;  2NYZ D;  1VF7 A;  5D14 A;  4V0B A;  3MC0 B;  4KY5 A;  2F0Q A;  3S17 B;  1EY4 A;  4FP5 D;  4ULL A;  4RKL A;  4B08 A;  2BA0 A;  2VNU D;  3OWF A;  4NKL A;  4IZ8 A;  3S16 B;  2EY6 A;  5C4X B;  1O7L A;  3EJI A;  1B53 A;  2EY2 A;  1ICW A;  2H4O A;  1A3U A;  2JXM B;  1I4H A;  1Q12 A;  1Q3L A;  1JC7 A;  2ID0 A;  3NE5 B;  4GZY C;  5C44 B;  2PZT A;  4ID6 A;  3NQI A;  1BNZ A;  4IFD J;  2A6H C;  2NTS A;  3ERO A;  1H9R A;  1SJH D;  2TSS A;  4WRD A;  3T51 B;  2JP1 A;  3NTI A;  2ENB A;  5EPK A;  3M85 A;  1QOH A;  4RWS C;  4XXE A;  1GJX A;  2HUG A;  2M2L A;  4F88 A;  3MXU A;  3QIA A;  2ZXO A;  5F2D A;  4HSV A;  2Z4I A;  1R4Q B;  2F0D A;  2JE6 I;  5C3X A;  2F0J A;  1G2T A;  3K57 A;  4DAY A;  3I4L A;  4QMG A;  2K7V A;  1PRT B;  3J81 E;  1IL8 A;  4HSP A;  5G3L F;  2KJX A;  3HOZ B;  1SNO A;  3OOC A;  5M5X B;  1WTX A;  1E2V A;  2F1M A;  2G9H D;  4A3J B;  1B3A A;  4HED A;  5A35 A;  4C3J B;  2XNA C;  2K32 A;  2F0K A;  5JEA J;  2F03 A;  4OL7 A;  3A7A B;  1TWH B;  3ZYY X;  2NB0 A;  2EYJ A;  2Q8I B;  4BBR B;  2K05 A;  1JE4 A;  1SNP A;  2R61 A;  3TDQ A;  5LL6 S;  1ZYR D;  2IJ0 A;  4G57 A;  3TN2 A;  1ZXT A;  4ZLT F;  3L7Z C;  2PO4 A;  1SYC A;  1PRT F;  4G7O C;  4RH6 A;  1RTO A;  1WCM B;  4OHJ A;  3MFY A;  4IUR A;  5FLX E;  1V1P A;  2KED A;  3KLR A;  4R9W A;  1Z7T A;  1I50 B;  4ABN A;  2RKS A;  1LTG D;  4RHS A;  1DZ1 A;  5ELD A;  1WTV A;  1QNU A;  4FXK C;  3SDZ A;  3QG1 A;  5C3W A;  4BBS B;  4HAE A;  4U67 3;  3R8B A;  5M5Y B;  2LKV A;  1SNM A;  2CQA A;  3I8Z A;  2RSN A;  1CHQ D;  1SMY D;  4BA2 I;  5J22 A;  2IX1 A;  2L0C A;  4QIW B;  3T53 B;  2EJG C;  2A5H A;  3NTK A;  3N52 A;  3TP8 A;  3X3N A;  1B2T A;  3AB9 A;  4KD4 A;  1SNC A;  1WD1 A;  2E76 C;  2KVM A;  2HDM A;  1ZYR C;  3A8J E;  5I4D A;  2K1B A;  5M3F B;  4CJ0 B;  1CA6 A;  2DNC A;  1JOQ A;  1TWG B;  4TRD A;  2WAQ B;  3CKI B;  3GTO B;  4DK1 A;  1SE3 A;  1DOL A;  3FRP B;  2XWJ B;  4G7H C;  3GO5 A;  1K8O A;  1HHV A;  3KF8 A;  4HTH A;  4ZRZ A;  2EYO A;  1LO5 D;  2F0H A;  2R3Z A;  1E0B A;  5FLX L;  2K6A A;  3DHQ A;  3BVG A;  1STE A;  3MXN A;  1S4Z A;  4G7Z C;  3DWQ A;  1SMY C;  3H94 A;  4DAV A;  3FPU B;  3GP7 A;  2B2Y A;  1HUM A;  2Q8R E;  3HZX A;  3W3A A;  2F3V A;  2FHT A;  4A3I B;  3GTK B;  1LTR D;  2JYO A;  1JIC A;  4ZQ3 A;  1ESR A;  2ZXP A;  2L4N A;  3VR6 A;  5IGE A;  1HRJ A;  4RKB A;  2K28 A;  2ICE C;  2B39 A;  5COR A;  2WII B;  4QF4 A;  5ISR A;  3R2T A;  3ERQ A;  2WB1 B;  4IUU A;  1G2S A;  1PMR A;  2A68 D;  3OWE B;  1WVL A;  1OO9 B;  2IL8 A;  3FEW X;  2XSC A;  4RGM A;  3K7A B;  3NWT A;  3R93 A;  4CKC A;  2PNR C;  4RA8 A;  3IAY A;  2EYH A;  1YNN D;  1W6J A;  5C4J B;  1LLR D;  2NN6 G;  2OT2 A;  3V05 A;  5JOB A;  2XN9 C;  5COY A;  1MD2 D;  1TY2 A;  3MWY W;  2OF1 A;  4KMU C;  1Y1V B;  4PMC A;  1H9S A;  2C9O A;  1Q8I A;  4CHT B;  5CV7 A;  1A3V A;  2FFK B;  3K6O A;  1Q90 A;  3Q24 A;  1FR3 A;  5D3D A;  1F77 A;  1L0Y B;  4X3U A;  1SYG A;  2EJM A;  1RHP A;  2A68 C;  1II3 A;  4NMZ A;  5IGC A;  2MUY A;  3RLF A;  2K03 A;  3M4O B;  3NBH A;  1Q1B A;  3EFX D;  3T13 A;  3Q6S A;  1AEX A;  5FK9 C;  3PIP 3;  3P7J A;  2EZV A;  5JPN C;  1VMC A;  3OW7 A;  1A15 A;  1YNN C;  1EOT A;  5C0X I;  4CJ2 C;  2EVB A;  1I3Q B;  2F3W A;  1T5X D;  3VA5 A;  5HUR A;  3DEP A;  3WOE A;  1WTO A;  4OIJ A;  1CZW A;  3KLS X;  5FO8 B;  4XYQ A;  3J7A V;  4C56 C;  3D4D A;  3HS0 C;  3D31 A;  4KY6 A;  1TS3 A;  3EA6 A;  5M9O A;  5EBD A;  1Y69 U;  3DEO A;  3CHB D;  1ZKO A;  1IKM A;  1EY0 A;  4JBW A;  1BUV T;  4IUP A;  1CQV A;  3QOJ A;  2F0O A;  2KEE A;  5ELC A;  3K5M A;  1ENC A;  1IHZ A;  1NAP A;  2H1E A;  2SDF A;  2HQE A;  2R7Z B;  1XTC D;  2OXP A;  3TME A;  3PUW A;  2BOS A;  1DCZ A;  2HDL A;  3TBI B;  3SEB A;  2AUJ D;  4DU9 A;  3V2T A;  1QCB D;  3U9S A;  4RCN A;  1STN A;  4K2K A;  5TSS A;  1Y8N B;  4IFD I;  2DNE A;  4I65 A;  1GUW A;  1F9P A;  1E2W A;  4QUC A;  1KLG D;  3O13 A;  5C0X H;  3D6W A;  4HN7 A;  3T16 A;  4F7X A;  4S3S A;  5J1Z A;  4UDU C;  4C1N I;  2YU9 B;  4V19 0;  3MVV A;  2SNS A;  2BE5 D;  2NVY B;  1BXT A;  5LHY 1;  3MFG A;  1KNE A;  3NXW A;  2BDN A;  3QB3 A;  4DNR B;  1VF5 C;  2WP8 J;  3N6R A;  1F9Q A;  3JAM L;  4ZUJ A;  5I2Y A;  1BCP D;  2JA8 B;  2AUK A;  1VCI A;  3KUP A;  3TZU A;  2EPB A;  3RZD B;  4LJZ C;  1QWY A;  2B2U A;  3WOF A;  4IFD G;  2VXW A;  1B9M A;  2JEA I;  4QCL A;  4RCO A;  3CQZ B;  3NTH A;  3C46 A;  3S2H B;  3BDO A;  4NP5 A;  3HRZ C;  3K5L A;  2K01 A;  1PZI D;  5CV8 A;  3VYS A;  1QE6 A;  1IW7 D;  2JA5 B;  1FNV A;  2L1B A;  4X3S A;  2BE5 C;  3Q22 A;  2EE1 A;  1MGS A;  2M00 A;  2Z4H A;  2VB3 X;  4IFD H;  3M4Y A;  1HFG A;  2MJ8 A;  1HA6 A;  4FF4 A;  1W6K A;  1KAB A;  1PYW D;  1I4G A;  3S1N B;  2X69 A;  4R8I A;  3I90 A;  1MSH A;  4XQQ A;  1BCP C;  1QIL A;  3MAQ A;  1STY A;  2JSO A;  2XIW A;  1HFN A;  4FF2 A;  1R4P B;  5C6A A;  2K04 A;  2CVR A;  2IT1 A;  3BVZ A;  3L3O C;  3Q23 A;  5DM6 3;  1ROD A;  4IUT A;  1MI2 A;  4KKS A;  4BWG B;  2CHB D;  1ML0 D;  1BR9 A;  4O42 A;  1S5E D;  2NTT A;  4A3B B;  2A73 B;  2AWN A;  4K8I A;  1ENA A;  3SK8 A;  4MHE A;  5CV5 A;  2HCI A;  2B2U C;  3V96 A;  3VR3 A;  4CKB A;  1OXT A;  5JEA H;  4ODG A;  1GUT A;  1EU4 A;  3H3V C;  1IW7 C;  3A8K E;  1F9S A;  3TP7 A;  5CV4 A;  4KKU A;  5CBA E;  3VR5 A;  1JWU D;  3TP6 A;  4PV1 C;  1NUC A;  4N9P A;  1EYA A;  1G6Z A;  1S5C D;  1SJE D;  5CV9 A;  5I9O A;  1HQR D;  4ZAI A;  4B9X A;  5EGT A;  3SVM A;  2WV6 D;  2RVL A;  3OIP A;  2MHV A;  3L9A X;  4M1U B;  4QB4 A;  1EZ6 A;  2EY1 A;  1CFM A;  1IYV A;  3K0Y A;  1G8Z D;  2F4I A;  4K5V A;  2F0V A;  4TSS A;  5IT9 E;  5JVH 3;  1A6X A;  2O5I C;  3DM1 A;  1K8M A;  3H91 A;  4KK7 A;  2F0M A;  4NW2 A;  2BDO A;  5KGU A;  2F0T A;  1NCV A;  4KY7 A;  5KNB A;  3ONA B;  2SEB D;  1H9J A;  2RDG A;  3LX0 A;  2F0U A;  1A2T A;  2ZXR A;  1FGB D;  4DFA A;  3K5O A;  1FNU A;  2X6L A;  1I6H B;  4B9W A;  1GHK A;  1TWF B;  4FF1 A;  5C4Z A;  1ILP A;  2PMZ B;  3DMU A;  1Y8O B;  1EY5 A;  4FO2 A;  3NK9 A;  3GTQ B;  3K59 A;  1BCP B;  1CQF A;  3SR1 A;  3J81 L;  1H9K A;  1G29 1;  4XDX A;  1HXY D;  5DM7 3;  3PO2 B;  2KQ3 A;  4KN4 C;  5EKL A;  3I73 A;  3SXH A;  2L55 A;  4K2L A;  4RAU C;  1IYU A;  2KHS A;  1DOK A;  1JCK B;  3S1M B;  1B9N A;  3TP5 A;  3GV6 A;  4XQJ A;  2R6G A;  5FKA C;  1EU3 A;  1S5F D;  1GUN A;  2AQ3 B;  1ILQ A;  1WTP A;  4WOR A;  3URY A;  1HCZ A;  1K83 B;  5E4X A;  1I4X A;  3J7A F;  2KCC A;  4HMI A;  2F0W A;  3X3M A;  4DF7 A;  4UAI A;  1TII D;  2DN8 A;  5IT9 L;  3DXJ C;  4H44 C;  1U4P A;  1BCP F;  1FNW A;  1JB3 A;  1G91 A;  5FOB B;  2B8G A;  1R9T B;  4F87 A;  4EQP A;  3A56 A;  3I3C A;  1QJO A;  4K6D A;  1PLF A;  4HCE A;  2E2J B;  2O4X A;  1XWE A;  3QO2 A;  1LT3 D;  3A7L A;  5IGB A;  2D9U A;  3HOX B;  1D6E C;  2EYF A;  4PNY A;  3LWE A;  4I7Z C;  1A3T A;  2M9V A;  3E0J A;  1HUN A;  4ZYS A;  5KNC A;  4A93 B;  1L0X B;  1WTQ A;  1T5E A;  5NUC A;  2QDB A;  2NVQ B;  3ITP A;  1SYD A;  5C5M A;  4XQN A;  3GTP B;  1Y8P B;  1CI3 M;  1SFO B;  3LWU A;  1SXT A;  1PTO D;  4P2C B;  1STG A;  1SDF A;  4XT1 B;  2A74 C;  2K5D A;  4KV6 A;  1EIH A;  5D65 A;  4OIK A;  1SBB B;  3NP8 A;  1LV9 A;  3OPO A;  3M3Y B;  1TKW B;  2RBM A;  1STB A;  2Z8L A;  2EXZ A;  1WD0 A;  1TQO A;  4O1N A;  5C3E B;  1EL0 A;  1F2L A;  1EFI D;  4BY1 B;  1SYB A;  4XT3 B;  2JA6 B;  2XRQ D;  3BDC A;  3R3O A;  5IGF A;  5KND A;  1NR2 A;  2WKD A;  1CK1 A;  3OSO A;  3EVQ A;  1HTL D;  2HCC A;  4RHR A;  5CV6 A;  3NSW A;  3PIO 3;  2Q8T A;  1RF2 D;  3D3R A;  1CM9 A;  5ELF A;  4R8N A;  5KRU A;  1JR0 D;  1DON A;  1PTO C;  4ILW A;  3P75 A;  2AQ2 B;  5JJZ A;  1QNK A;  4DA2 A;  5IOC A;  1V1P B;  4ZUI A;  1ET6 A;  1EQV A;  5CR3 A;  1BQQ T;  2G9D A;  3S9W A;  1CT1 D;  3HP3 A;  1C8C A;  4ME5 A;  3R2I A;  4DXG A;  5HGT A;  1QB5 D;  1ZEQ X;  2EDG A;  3QJY A;  1FYC A;  5G3L D;  3IKJ A;  2SNM A;  2AWO A;  2QEJ C;  3I91 A;  4EQO A;  2J7Z A;  5KIX A;  4C3J G;  2O5J C;  4YIJ A;  2JEB I;  1STH A;  2OEO A;  1UEA B;  3MHB A;  1V1O A;  4DNT B;  2LS0 1;  3KLS A;  3AMU A;  2J4X A;  3GTG B;  1V8Q A;  3GTJ B;  1ENF A;  3SK6 A;  2VB2 X;  1SAP A;  1SE2 A;  1XXG A;  3RMH A;  2B2W A;  3OHX C;  2EJF C;  2IX0 A;  4KHZ A;  5C0X G;  2F0G A;  3A8I E;  1I4Q A;  4RGT A;  1KNA A;  1WTR A;  5CGK A;  5E4W C;  4C3I B;  1GOZ A;  1STA A;  1KDC A;  5EPJ A;  3MTS A;  2PYK A;  4EGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...