3SHLA

Crystal structure of staphylococcal nuclease variant delta+phs v74kl25a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEKEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Redirection of internal ionizable residues by engineered cavities
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3shlA00
4S3SA 2LKVA 4ODGA 1KABA 2EY1A 2OXPA 2PZTA 1EY6A 3D8GA 3H6MA 2QDBA 4N9PA 4DGZA 4KD4A 4ME5A 5EKKA 4MIUA 5KYLA 1KDAA 5JAVA 1A2UA 3SK5A 1EYCA 2F0LA 2F3VA 2PYKA 3OMCA 1TQOA 3OSOA 1EYDA 2F0WA 4NP5A 2F0EA 1EY9A 4K5WA 4EQPA 5IGFA 1EZ6A 4J1MA 2F0TA 4EQOA 3SK6A 3DHQA 3MEHA 1EYAA 1A3VA 3D4DA 2F0GA 3TMEA 3LX0A 3MZ5A 1U9RA 2F0IA 1STHA 2EY6A 3HZXA 2EYLA 5KRUA 2F3WA 4HTHA 4K6DA 2F0KA 4KHVA 5CV4A 5J39A 1F2MA 4QF4A 2EYOA 1STBA 2NUCA 2EYJA 3EJIA 3QOLA 1STYA 2EXZA 4N9TA 5CV9A 2RKSA 3V2TA 5ISRA 3VA5A 3DMUA 2F0HA 2EY2A 3C1FA 4K2LA 3NHHA 5F2DA 4QMGA 5E1FA 4ZUJA 2SNSA 5I6YA 5CV8A 5CC4A 5IGDA 3R3OA 4RKLA 5KYIA 1STAA 1A2TA 4KJOA 4K2KA 1F2YA 1STNA 3U9OA 2F0MA 3EROA 4DF7A 1EY7A 1F2ZA 5IGEA 1KAAA 5I9OA 4DFAA 1KDBA 2RBMA 3TP5A 4K5XA 4ZQ3A 4IZ8A 5I9PA 4YIJA 3D4WA 4R8NA 5EGTA 4PNYA 1TR5A 1EY4A 3MHBA 2F0SA 1STGA 5C5LA 4NMZA 4K8IA 3QB3A 1SNOA 2EYHA 5C3XA 1NSNS 1ENCA 4EVOA 2F0UA 4PMBA 2EYPA 2F0VA 2O4XA 2PW5A 3NUCA 3P75A 3PMFA 1II3A 2EYFA 3MVVA 4B9XA 4OL7A 1SYGA 5IIFA 3NQTA 5E3FA 5KGUA 1EY0A 3QOJA 3NK9A 2F0FA 3C1EA 5JOBA 1JORA 1JOQA 3P1HA 3ITPA 3SK4A 4PMCA 3HEJA 3T16A 3T13A 1SNQA 2F0QA 4IALA 5C3WA 5IGBA 2PW7A 4K5VA 2HQEA 4HMJA 5M9OA 5IODA 4E6IA 3SK8A 2OEOA 2PZUA 3RUZA 2EYMA 1SYDA 4ID6A 3EVQA 4TRDA 5J22A 4K14A 2WACA 1SNDA 3S9WA 4KTAA 4NKLA 4F7XA 1EQVA 1AEXA 3SHLA 1A3TA 4KV6A 1A3UA 1SYFA 1SYEA 1SYCA 2SNMA 3TP8A 2F0DA 3TP6A 5CR3A 2PQEA 4LAAA 5DAUA 1EY8A 1EZ8A 5CV5A 3E5SA 4I65A 4IUNA 5K5PA 4NDXA 1SYBA 1SNMA 4RKBA 1EY5A 2OF1A 3BDLA 3ERQA 1SNCA 3MXPA 5C4HA 5C5MA 1IHZA 4F8MA 3BDCA 2F0OA 5HGTA 3OWFA 4WORA 5KEEA 4HMIA 5I6WA 1JOKA 5C6AA 5KIXA 4KY7A 5J1ZA 4KD3A 5NUCA 3SXHA 2EY5A 5CV6A 3TP7A 1JOOA 1RKNA 1TT2A 5IGCA 1SNPA 2KHSA 4KJNA 3OMGA 4KY6A 3SR1A 4EQNA 2KQ3A 2ENBA 1NUCA 1ENAA 4DU9A 5IGGA 5DEHA 4H7BA 3D6CA 4KY5A 2F0NA 2SOBA 2F0PA 4B9WA 4G57A 4QB4A 4J6HA 1KDCA 3NXWA 5C4ZA 5HURA 4ZUIA 2PZWA 2F0JA 2M00A 5CGKA 5EKLA 4WRDA 2RDFA 4K8JA 5CV7A 5IOCA 3NP8A
chains in the Genus database with same CATH superfamily
1EEID 1J5EQ 2UUAL 2JJQA 2QDBA 2I5LX 4DR3Q 1KQSA 4JC0A 1A2UA 5IYCH 5C44H 3B6YA 4I7AA 4EQOA 2UXBQ 1TWGB 5IYDG 1GXDC 2RVLA 4B3TL 1SLJA 1WOCA 1AZPA 1N34Q 2EXZA 4JI8Q 5M3FB 1YHQA 1A8VA 1E7ZA 3HRZC 4TKOB 3DEOA 1UE6A 1JJ2A 1X3FA 4DR5L 2XN9C 2AQ2B 4XQNA 1WD0A 1RCVD 1PFNA 2WB1G 2JA5G 4IPHA 3WOFA 1TS2A 2A8VA 1HA6A 4JI3L 4RHRA 3A55A 1FR3A 2K33A 4NXMQ 2RCFA 4Y7NB 1PLFA 1Z6HA 5EKIA 4JI4Q 3CCVA 1FJGL 1ENCA 4A3BH 4PMWA 3M4QA 3MVVA 3E9IA 1GM5A 1MBYA 2KEEA 1HFGA 2AKWB 1T5XD 3A8JE 4X64L 4JV5Q 3PV0A 3QOJA 3C1EA 3U9SA 1SE8A 5JJZA 3TBIB 3FEWX 4X6AH 3IKJA 2ES2A 2OEOA 2EYMA 4GKJQ 4TRDA 1WCMB 1SNDA 4LF4Q 1EQVA 4DUYL 1C9OA 2JK8A 1AN8A 1VQ6A 1QOHA 3TP8A 2JA5B 4DV2L 4NXNL 4DR2L 3ZJYC 1K83H 3STBC 4R4TA 4RMFA 4X62L 3G6JB 3EA6A 4BWGB 3G71A 3I72A 4HN7A 4P75A 1F2LA 1S5BD 3KBXA 4UAIA 4HMIA 4PZ6A 4HJAA 1B50A 4ZK9B 3T56B 2BA0A 2EY5A 2HIVA 3UDIA 4DV0Q 5IGCA 2EJGC 2KHSA 4KLKA 2K6AA 4DNTB 4DV1Q 3I56A 4QQBX 4H7BA 1B3AA 2EOTA 3CCMA 2SOBA 2KUMA 1SMYD 5FOBB 2ZTEA 2LY7A 5CGKA 1WTQA 1SDFA 4LF6L 3NP8A 1KL9A 1NR2A 1EIYB 5C0XJ 1SE3A 4DGZA 3KLWA 2Q2UA 1KNAA 1KDAA 4X66L 1EYGA 3GTOB 1ESFA 2HDMA 3T1HL 1A3VA 3K8AA 1STEA 3NSWA 1HHVA 3EJIA 1O7LA 5CV9A 2RKSA 1F9SA 3HOXG 1CA6A 1OXSC 4C1NI 1SE2A 2JN4A 4CDFC 1Z47A 3QR8A 3T51B 3SEBA 1YBYA 2K5VA 1MKHA 2KA7A 1TWAB 5T1GA 5FJ8G 4UHVA 4A3FG 1EY7A 3MFYA 1EQTA 4IZ8A 3M4OH 3S1RB 2MNAA 1KD1C 2B2TC 2XRQD 1EY4A 1WFQA 2VS1A 4KN4C 2NVXB 2X6LA 5BR8L 3GTPH 1C7YA 2PCFB 4A3EH 4BXXG 1HFNA 3M4PA 3GTKH 2EYFA 4OL7A 1SYGA 4LF8L 3NQTA 1EWCA 3S15H 3H3VI 4FO2A 2IWHA 5E4WC 5IY0A 3GTJB 3OPOA 3IFDA 1SNQA 4DV6Q 1Y1VG 2N8NA 1NBWA 3T4AC 3URYA 3HOXB 4QUFA 3I4MH 5KNCA 3G7LA 2HHHQ 3PO3G 3A74A 1SFOB 1XWEA 1ZYRD 4IJLA 4A3FB 1PZJD 2B2VC 5ELNA 2RF4A 2A1AA 3K7AH 5EQ0A 4A3LH 4G7HC 1KC8C 1YJNA 3D3RA 1X9NA 1EY8A 3VYSA 5C3EH 3BDOA 2WB1E 1GHJA 4HIDA 2R93G 1SNCA 2LXJA 5JVH3 1J8IA 2E74C 3GTMH 4C2MH 3CC7A 1W3SA 1EWHA 5KNDA 2PPBC 2J0TD 1SAPA 4FYDA 1TKWB 3D31A 5C4JB 1QZGA 4CGYB 1N32Q 4IPCA 1MJEA 1HNXL 4YWLA 4A3GH 1TVXA 1Y1VB 3KDFB 1WTRA 2QDLA 4A3IB 4DXFA 5CV7A 1OTCA 5IOCA 5IYBG 3PO3B 1A0IA 1XNQL 1G91A 2NZOA 2F4VL 2E2IH 3OMCA 1TQOA 2F0EA 2YTYA 4QY7A 3MWYW 2F0TA 4LFBQ 3A7LA 3QG1A 3QWNA 1YNNC 1U9RA 2MGSA 3J81L 2R93B 2GVAA 1H9JA 1NMFA 1LTGD 3GO5A 2EQSA 3JAML 2VB2X 4GOPB 1IBMQ 1WTHA 2EJMA 3HFZB 1I6HB 4DV3L 5E1FA 5CC4A 4A3JG 1TWFH 4OO1G 1SSOA 3I55A 2QGQA 2K75A 4DF7A 3A5UA 4DV4Q 3BU2A 4IQZA 1FGUA 4CKEA 1Q1EA 3D4WA 3A56A 1X32A 4J8QA 1TR5A 4UY8C 4GOPC 1HNZQ 1Y8NB 2NVQH 1FYCA 1JE5A 1V8QA 4LF7L 3RLNA 3F2DA 2KENA 2CWAA 4PMBA 2EYPA 1PH6A 4G4KA 3LWEA 2KCMA 4C3IH 4LF5L 3SGIA 4JBMA 2ATWA 1NMGA 1GO3E 3ITPA 1L1OC 2B8FA 4A4IA 5C3WA 4B3SQ 4HMJA 3HOVH 4E6IA 3F2BA 4ID6A 4WJ4A 5BN3A 2QW7A 1B3QA 1SYCA 2NVTB 3M4YA 3S1NH 2PQEA 1WVLA 1OO9B 2IHEA 1Q12A 1ML0D 4DR1Q 2PNRC 3CCRA 1LM0A 1AFPA 1HZ9A 1Q8IA 4B3MQ 2FHTA 3A5ZB 2B2UC 2OTJA 3DWAA 3ULPA 1H9SA 5EBDA 1V43A 1AZQA 1X3EA 2ENBA 1R4QB 5IP9H 1NR4A 2DGYA 1U4LA 5EBCA 4KY5A 2TMPA 3STBD 1DONA 3NE5B 3PO2H 4FXGC 1N36Q 4JBKA 1EQRA 4A3CG 2JA9A 5M5WB 1TWCH 4IFDI 3IL8A 1CFMA 4L6TB 4DA2A 2R92G 4A93H 3D8GA 2ICEC 3LGJA 2DN8A 1X65A 2QEJC 5CORA 4K5WA 1ESRA 4XYOA 1QVFA 4IUQA 2F0KA 2VNUD 3S2HB 2NZ1D 4WJ3M 3W5OA 3NTKA 3ONAB 4UP8A 3CQZB 4JBJA 1PH1A 1BKBA 2NN6G 2EY2A 5E4XA 3X3NA 5FKAC 4ZUJA 1QG7A 2PI2A 4N8X1 4L5QA 4JI1L 1NJIC 3DLLA 1B9MA 2UUCL 3CCSA 3DWQA 4B3RL 2UUBQ 2K03A 2A69C 1MD2D 1PXUA 3MHBA 4GLXA 1STGA 4JYAQ 2IJ0A 2K7VA 4MN3A 2R92B 2RDGA 4MTNA 4A3DG 4CJ0B 4RH6A 3W1BA 4DAVA 4IOCA 2YU9B 1QILA 2GVBA 2CH4A 4IO9A 2F0FA 3HOUG 2R7ZG 1ZEQX 3TREA 2N78A 1ICFB 3IFTA 4U673 2MHVA 1LYLA 3EVQA 3AFPA 5GAHC 3S9WA 2FJ2A 4OX9Q 5LMUL 5DM73 1P16A 4KV6A 3M9BA 1IL2A 2J4XA 2KEDA 5FLXc 2WP8J 4XXEA 1EUJA 2R61A 3SDZA 2HD3A 3KF6A 2JA8H 3PIP3 4NDXA 1SNMA 3PIPA 4RFBA 1HR0W 2OF1A 2K5DA 3QJYA 3BG3A 5CYUA 1I94L 3BDCA 1B44D 1XJVA 4A3DB 3HOWG 3I4LA 5T1IA 3EBEA 3S24A 3Q0AA 1PRTF 2O5IC 5EAYA 3H3VH 3ICEA 4P74A 2F0PA 3HOUB 2R7ZB 3CCJA 2GN5A 1S4ZA 2MFIA 3GTLB 2AHOB 4L5RC 3QO2A 4RA8A 3KLRA 4LFCQ 3BJUA 5EKKA 4MIUA 5KYLA 1UEAB 4OO1I 2JSOA 2B39A 4JI5Q 4LF9L 5HGQA 1STHA 3NEMA 1H95A 2EYLA 3C3LA 4RCOA 1DOLA 1VQKA 3HOWB 5BN4A 1CHPD 1IW7C 5KYIA 4I7ZC 2AWOA 3S14H 4YHHQ 4XQQA 1U4MA 3OWEB 3K57A 1NTGA 2D9UA 1TS3A 4QUCA 1G2SA 1DCZA 1KTKA 5IYDH 5C4XG 1M4VA 2ZXRA 2X69A 4DK3C 4K0KQ 4P72A 1L0YB 3MFGA 2F0SA 1M8AA 1QB5D 2ZM6Q 2X6GA 2NBFA 3BVGA 5M5YB 4DR6Q 5COYA 1WCMH 3CC4A 3PGZA 2F0VA 3NUCA 1E2ZA 3AEVA 3J81c 1X3GA 1ONLA 3PUYA 4XIGS 2HT1A 4JI2L 4AH6A 5FLMG 4JI0Q 2E76C 1Y1WG 1TXYA 3U4VA 1G2TA 4PQXA 1SN8A 5G3LF 1I4PA 5IT9L 5ISRA 1SR3A 3FDTA 5CBAE 2OCEA 3CPFA 3KYHC 4DN4M 3OTOQ 1ASZA 3K5OA 4MHEA 2F0DA 4BY7G 1S72A 2V4DA 5CR3A 1GUNA 5C4XB 2E2JH 1EZ8A 4C1NK 4I65A 3M3YB 4ULLA 1PH8A 1G6ZA 3ND8A 4LFAQ 2P5ZX 4JI7L 3J80i 1EIHA 3NWSA 4U68A 1D1KA 1EIGA 3L2PA 1VQAA 5KIXA 2ICIA 2OWOA 2Q8IB 2JA7G 2UXDL 4DV5L 5JEAG 1QCBD 3I8ZA 4ZKBB 1ENAA 3MEFA 1Y1WB 4DR7Q 3UI2A 5IWAQ 2PZWA 1RF2D 1K9MC 2FMMA 1TU2B 3KJPA 1LT4D 3J7AV 2NN6I 4S3SA 1EFID 1I50H 4IJHA 2L5TA 4JCVE 3PUXA 4PZ8A 1VQMA 2ZXPA 5JAVA 4CBVA 1EYCA 1M90C 4BY7B 4IPGA 3A7AB 2B8GA 5A2QL 2XSCA 2NWGA 3FMCA 1WTOA 1ASYA 4DK1A 3S1RH 2JEBI 1STBA 2ZJPA 4L8JA 1NCVA 4B08A 2WKCA 4RGNA 4WFN3 2JA7B 1QE6A 1DD2A 2SNSA 2KECA 3CRLC 3J81i 2OT2A 4BBSG 3EROA 1FVIA 2MO0A 4AQYL 2Z1CA 3JAMi 4DFAA 2RBMA 5HY6A 4CJ1B 5TSSA 1I3QB 4CDDC 3GTJH 1YJWA 3FRPB 1I5FA 1SE4A 4IPDA 1D5XC 1CK1A 3NELA 1HR0Q 4IFDH 4GKKL 1XXGA 2XVSA 4GLAC 5E7NA 1Y8OB 1JJGA 1K8AC 1NSNS 4DV7Q 5D3IB 1HQRD 3ULLA 4LF4L 1F9PA 1SFOH 2DY8A 3TS2A 4HJ9A 1CT1D 1U4RA 5BN5A 1M1KC 2A74C 1S40A 2BH2A 2ZT9C 2BDNA 4YCWA 5H1SE 4NB3A 3CAMA 2B2WC 1BNZA 4KTAA 4F7XA 1LTID 4OHJA 4HEDA 1G6PA 3BZCA 4BBSB 3A8IE 4DV0L 1EQQA 4KMUC 1I4HA 3TP6A 2G9DA 2K28A 3M7GA 3ERQA 1CKNA 5C4HA 5C5MA 1QNKA 4A3IH 2WIIB 5IE8A 2FXQA 4A3KG 2GA4B 1KXLA 1LT3D 1T9HA 3NBHB 4KJNA 4EQNA 3KF8B 1KNEA 5IGGA 1Q82C 2HUGA 5M3MG 2L1BA 2KCCA 1QZHA 1JT8A 2A6EC 1YITA 3NXWA 3GV6A 4N8FA 3I4NG 2WB1B 1RTNA 4BY1H 1K8GA 4WRDA 2BCOA 5ELBA 1JQYD 4HJ5A 3Q8DA 2K5HA 2XNAC 1I6HH 2VY3A 4LMQD 1PTOB 1PTOF 5C0XI 2PYKA 2C5CA 1EYDA 4B3TQ 3WOEA 3HOZG 3TSSA 1Q7YC 1LTSD 1TWHH 1EYAA 3CCUA 5FLXE 2YV5A 2K1BA 3S17B 1V1PB 4DNIA 3DWPA 3M7NA 4XDXA 3RZDH 3DM1A 4QF4A 2EYOA 1SEBD 1HJPA 2CWPA 5IYBH 1XNRL 4A3KB 2NB0A 2BE5C 1PTOC 3EQLC 3S16B 2NVYB 1PRTD 5FO9B 4RKLA 1A2TA 4HCEA 4JI3Q 2B63G 1N33L 3PUVA 5M3MB 2FFKB 2VQEL 1YNXA 3W3AA 4K5XA 2LSSA 3I4NB 2JA6H 1FJGQ 4DKAC 3EN2A 1RJTA 3PF4A 1YZ6A 1SNOA 1IW7D 1AH9A 4FF2A 1PMRA 2Z8LA 3LNNA 3OIQA 5DNFA 4NPSA 4C3HG 1JJCB 5JPNC 4OO1H 3K0XA 2EPBA 3PMFA 4FNFA 3HOZB 1B1ZA 2EDGA 4MNOA 5LL6S 1HNWQ 1HZCA 1GUSA 2D0PA 3MXGA 4DUYQ 1OXXK 3O13A 2BOSA 2CVRA 3PUWA 4DR4Q 4IALA 4X3TA 1YVCA 1UE1A 4X3UA 1PFSA 3RUZA 3JC66 5IYCG 1LTLA 1VF7A 3GV3A 5C44G 4DV2Q 4NXNQ 4DR2Q 1PZKD 2KHIA 2B63B 1PDQA 3CU7A 2RHSB 4X62Q 3FPPA 4RG1A 1B4OA 5DAUA 4XYQA 4HAEA 5CV5A 1C48A 2KVMA 4UP7A 3S2DH 2N3SA 3C2PA 2B29A 2CW0C 3H09A 1Q86C 5K36H 5I6WA 2DNCA 4JOIA 1K28A 4C3HB 2DJFC 1IYVA 1VQFA 3BVMA 4FXDA 1MIUA 5JEAJ 4RGMA 1A6XA 1NUCA 3CKIB 3K58A 3J80L 4LF6Q 3KF6B 2G5DA 3J81E 4X65L 1NE3A 5HURA 1E2VA 4ME3A 5G3LD 2MO1A 1B2TA 3JAME 5EKLA 4GNXA 1HTPA 1ZXTA 4HR7B 5KRUA 5C44B 2Q2TA 1FL0A 3CQZH 3CCLA 5D14A 2LKVA 2YYZA 1Q46A 1NY4A 4JK1C 4ME5A 4O2DA 1A15A 2F3IA 2Z6BA 3GTGH 5M5XH 3TMEA 5FO7B 3VYTA 4AYBG 1MSGA 2C35B 5J39A 4A3CH 4LUZA 3E9HA 1VDZA 4IURA 3TDQA 3H15A 2EIFA 5I6YA 4R1JA 1CSPA 2EZVA 1F2YA 2K04A 4MZ9A 3CC2A 3E3XA 1KAAA 4M1UB 3MXNA 5BR8Q 3IRBA 5C5LA 4F87A 1HCZA 4JW0A 4GN4B 4LF8Q 2UXCL 3MC0B 2F0UA 3F2UA 3PCOB 1XMOL 1UUPA 1TIID 4BA1I 2ASBA 4AYBB 4HIOA 2PI2E 1PV4A 1JORA 1L2FA 2HIXA 3BZDB 4OONA 3SK8A 3G48A 3LWUA 4B3ML 4K14A 3K5NA 1CI3M 2A68C 1A3TA 1L1OB 2HQLA 3R93A 3CCEA 2SNMA 4L63B 3A8KE 2NTTA 4J15A 4LAAA 4IOAA 4HIMA 4IUNA 3HOUH 3CP0A 4XQJA 2R7ZH 5JPMC 5GQOA 2N49A 3MXPA 1EIFA 1PFBA 1MGSA 1N9WA 4KKUA 3J7ZC 4FDBA 1HNXQ 2C9OA 1D7QA 3SR1A 1VS0A 3AU7A 1PH4A 1AW7A 1JE4A 4LW1A 4A3JB 1IBLL 1LACA 4H0LC 3D6CA 4X3SA 1EEFD 2DNEA 1S5CD 1KDCA 4P73A 2CQOA 1XNQQ 1XTCD 2F4VQ 4MTKA 2HCCA 4A3EG 3BS1A 2QA4A 1R9TH 3HOWH 2QILA 1F77A 1VQHA 2NZHA 2AWNA 2B2YA 2DY7A 3MXUA 4BBRG 5IGFA 5AFWA 1FNUA 4IUUA 3SK6A 3MEHA 5ELFA 1XMQQ 3MZ5A 1DYQA 3HZXA 2KBNA 1QVGA 4K6DA 4DV3Q 4KHVA 4KN7C 1JMCA 5LMNL 4V0BA 4A3MG 3HG9A 1VQLA 3VA5A 3DMUA 1U5KA 5JJIA 4L5TA 3OHXC 1QUQB 1LO5D 3E0JA 4LF7Q 5I9PA 4HJ7A 2NTSA 3GTPB 3FKIH 1P8LA 1EOVA 4A3EB 3W2DA 1CKMA 5JJLA 1PTOD 1E0BA 3GTKB 2CCZA 1JWUD 4C56C 4EVOA 2K05A 3AQQA 1BDOA 2XGTA 4BBRB 4ZRZA 5C0XH 4Q5VA 3P75A 1II3A 1WTWA 2XIWA 4C3JH 2EE1A 3VR5A 2EVBA 2Z4HA 5C4XH 1XPRA 3M3YH 1JOQA 1H9RA 2R3ZA 3P1HA 4AYBE 4EQ5A 2F0QA 3NBIA 4A3MB 2HDLA 2NYZD 1D2BA 1I6VC 2D0OA 3K7AB 3P7JA 4NKLA 4KHPL 2RSNA 1O7YA 2VQFL 4R8IA 1GVPA 4R4IA 2N88A 1WJJA 3NWTA 1BF4A 2B2TA 2L55A 1Q1BA 5FLMH 3GTMB 4DNRB 3S1MB 1Y1WH 4LUOA 1E2WA 1R4PB 1SMXA 3BDLA 3H0GH 1VQGA 5HGTA 4JI6L 4WORA 3RZOH 3G6EA 4IUPA 5NUCA 5CV6A 1KHIA 4LFCL 3QIAA 1BOSA 1E1OA 3VYUA 1C4QA 1VQ4A 4LNQA 2RQXA 2Y0SE 1VQEA 4QB4A 1Q3LA 4PZ7A 4HIKA 2G9HD 2UU9Q 2CW0D 1CKNB 5ELCA 2ZTCA 2B2VA 2JA7H 2EY1A 2BH8A 1IBKQ 1KRSA 1GUTA 4O1NA 4C3IG 2SDFA 2IX1A 4QIWB 1JB3A 3DHQA 4FF1A 3HOVG 2O5JC 2ID0A 2F4IA 1TWFB 2NUCA 2JYOA 4JI1Q 1TWGH 3HOYG 1B9NA 4R4QA 2Q8TA 1E22A 3J80c 4KJOA 4B3RQ 5M3FH 1GUOA 1VQJA 1CM9A 5AJ3L 3KFUA 3KBGA 4TSSA 1PH7A 1O7ZA 2NVQB 4CHTB 1MHWC 3TS0A 3A54A 3I90A 4PNYA 1X3QA 1KIXA 3R8BA 2ZTDA 5EPKA 5IP7H 1VMCA 1CZGA 3RLOA 3VR6A 4K8IA 4OXPA 1PH9A 5IT9E 1XTDA 5IP9G 2BA1A 1B8AA 4C3IB 4Y7NH 4RCNA 3UDGA 1GJXA 5E3FA 3HOVB 2PMZE 5JOBA 3PQIA 1KLUD 5LMUQ 3TRZA 1F9RA 4ZLTF 2ZJQA 1YNND 3U58A 4A93G 1SJED 2HQEA 5M9OA 3HOYB 4DXGA 3S1QB 1PYBA 1AE3A 4GS3A 3SHLA 2E5LL 2L4NA 1SYEA 2RA4A 3J7YW 4ABNA 4M8AA 3GQBA 1KRTA 1PYWD 2MPMA 5DM63 4GOPA 1AP0A 3HKSA 3KUPA 2A6HC 3DEPA 3VR3A 2JA5H 1VQPA 2RSOA 3JAMc 4F8MA 5GAEC 3GTQB 3FHWA 3K5MA 1SNPA 4OELB 3ND9A 2KQ3A 1SRUA 5A2QE 2A5HA 1UAPA 1S5DD 4DU9A 3VR4A 3CMAA 3DUZA 2RCNA 2WKDA 1TWCB 4V190 1VMPA 4A76A 4A93B 3RR5A 4CJ2C 1LT6D 4DK0A 5D3DA 4CDEC 2OXPA 1D5MC 2PZTA 4LF9Q 4N9PA 4DUZL 3S16H 1K8MA 4XTCS 1JCKB 3R2TA 4ILWA 4DAYA 3BZKA 1S5ED 5FO8B 1HA5A 2XWJB 4J1MA 1J5EL 3K81C 4DR3L 1SJHD 4QIWE 3CHBD 1K8OA 3GTOH 3K0YA 3ERSX 3OW2A 4BS9A 4XT3B 2EYJA 3V2TA 1D8LA 1E1TA 1YJ9A 2UXBL 4JOIC 3C1FA 4HJ8A 2L11A 1HR0L 4QMGA 3L3OC 3D6WA 1N34L 1UE5A 4JI8L 3U9OA 1HZAA 3N6RA 1F2ZA 1GKHA 4QCLA 4ZQ3A 2KOLA 1JWMD 2QKIC 1X56A 1TWAH 5EGTA 1PH5A 3AYHB 1BUVT 4YY3Q 1NNXA 4JI2Q 4Z9CB 2K32A 3MTSA 4NW2A 1ILPA 2NVXH 4NXML 2B63H 2CHBD 2WAQG 2M9VA 4B9XA 2VUMG 4JI4L 1Y8PB 1WTXA 4YWMA 1FGBD 2F1MA 3MXNB 3V05A 5FK9C 1VQ9A 1XPOA 3SK4A 1VQIA 2PQAA 3T13A 4H44C 1GOZA 1I4RA 1HUMA 4JV5L 4RGOS 2K5NA 2WACA 4JG2A 4OGQC 4OWTB 4UP9A 1O7IA 3T1YQ 1A3UA 3J81j 3HOXH 3CMEA 3J7AF 1RL2A 1IXRA 2VZAA 3VR2A 4JI7Q 1PH3A 2F52A 4GKJL 1RTOA 1PA6A 2K5QA 3E5SA 1B7YB 5FJ8H 4A3FH 1FNWA 3TEHB 4OWWB 1F9QA 1Y69U 2UXDQ 1V1QA 4DV5Q 2Q2HA 5J3BA 2VL6A 1UE7A 2A69D 2VXWA 1JOKA 1E3PA 2K5WA 2I5MX 2WV6D 1Q81C 2K14A 3I7FA 2WAQB 2VUMB 3I3CA 4TQUS 1E24A 3FVQA 2Z6KA 4BXXH 2F0NA 4G7ZC 1WD1A 2EJFC 3U4ZA 4G57A 4J6HA 5C4JH 3TN2A 2ZJRA 4DV1L 3HGBA 1WCMG 2E75C 2M00A 3F8TA 3HP3A 1CUKA 1IZ6A 1DM0B 2A19A 4ODGA 3H3VC 1Y1VH 3HKZG 4UPAA 3RD4A 3SK5A 2F3VA 1O80A 2JE6I 2N55A 3A0JA 3PO3H 4P2CB 4GN5A 1LTAD 4H13C 1EU3A 1QWYA 1S5FD 1C0AA 5GAGC 3H94A 1STYA 1W6KA 2MP1A 3S14B 4OIJA 1RODA 4AQYQ 1IKLA 2UUAQ 2I5HA 2FMCA 5LL6X 2R93H 1GUWA 4POGA 3F2CA 4K2KA 3F1ZA 4O0AA 1LTRD 2F0MA 1PH2A 4GKKQ 1VQ7A 1H9SB 1HNWL 1QJOA 3RMHA 4QL5A 1BXTA 3NTHA 3FP9A 4CKBA 4DR4L 2LS01 5I2XA 5DLQE 1PZID 5CMDA 1TS5A 3K59A 3HKZB 4DR5Q 3RN5A 2KCNA 2XWBB 1K0RA 4JPBW 2B2YC 1K0SA 5I2YA 1FNVA 5EJWA 2MQHA 4WJWA 3VA7A 1BBWA 4K5VA 1CA5A 3KLSX 5KNBA 4HSPA 1HQMC 1AEXA 2E2JB 1H9MA 4DV6L 1TY0A 4X64Q 4A3JH 3J80E 2HHHL 2OQ0A 4G7OC 3P20A 2WINB 1LABA 2NVTH 1EY5A 3RLFA 4FF3A 4LUVA 1LTTD 3KK7A 1BQQT 1TT2A 4R4OA 2CQAA 1OXVA 2DJGC 2MJ8A 3T53B 2WAQE 2Z4IA 5EPJA 3UE1A 3K5LA 4QGUA 2V1CC 3PF5A 2AUKA 2A6HD 4ZCKA 4IFDG 3I4OA 5C4ZA 1LTBD 1I50B 3K7UC 4FF4A 1N32L 4ALPA 1SROA 2J7ZA 4ZKCB 2QEXA 1WI5A 4KHZA 3AMUA 1PFMA 1G291 4R4CA 5M5WH 1SBBB 1T5EA 4BA2I 5FLXL 3V96A 2F0WA 4EQPA 5JVG3 1BCPB 1BCPF 3D4DA 1XNRQ 2K52A 2IY5B 1QVCA 2JXMB 4YWKA 1HPCA 1A63A 2H1EA 2E2HB 3QOLA 4LFBL 2QCPX 1RHPA 1N33Q 5IT9c 4KKSA 2VQEQ 1PHJA 4X3KA 3S2HH 3PUZA 4A3BG 4X66Q 4BBRH 1MSHA 1YEZA 1BCPC 3MA2B 5ELOA 3T1HQ 1IBML 2K50A 1DOKA 1G8ZD 3NPPA 4A3IG 5D65A 4KI0A 4YIJA 1YNJC 2ALYB 2Q8RE 4DV4L 4H02A 2KJXA 4A3MH 1OXTA 2Z0SA 4YCUA 3H91A 2EYHA 3Q22A 2YTXA 5C3XA 4GZYC 1TY2A 5LMNW 1IYJB 3GDEA 1HNZL 1X54A 3HKZE 1CQVA 2F03A 2OTLA 2R92H 2CH4W 4BY1G 3ZYYX 5CBEE 1JB7A 4DPGA 3S1MH 2YU9H 2I07B 2L0CA 4EX5A 1SXTA 4CKCA 4LWCA 5IODA 1SYDA 2YTVA 4YCVA 3KJOA 2Z9HA 4A3BB 4DAPA 1SYFA 4B3SL 2NN6H 3L0OA 1GD7A 3PSIA 2CKZB 1A62A 3DXJC 2E8GA 3L7ZC 1GHKA 2Y0SG 2RHQB 2F0OA 1PVOA 5C6AA 4KY7A 4DR1L 3TP7A 1HTLD 1ENFA 4KY6A 4X65Q 2EXDA 2JA6G 4A3DH 1JR0D 4BY1B 1BVSA 2A73B 1UEBA 1K83B 1XMQL 4JBWA 2K4KA 2LMCB 3GP7A 2B2WA 4KKTA 1J9OA 4K8JA 4TVAB 1Q8KA 1IKMA 4Q0FA 1N36L 2ZXOA 5A35A 3H6MA 1TWHB 1VQCA 3GTLH 3MAQA 1VQ5A 1AE2A 1LT5D 3RZDB 1EZ6A 1WTPA 1L0XB 2R7FA 1HRJA 2F0GA 3LX0A 1DZ1A 2F0IA 2Y0SB 2F3WA 4HTHA 2O2LD 2RDHA 1V1OA 4A75A 1EOTA 3VYRA 2IPKD 1STAA 2JA6B 2L15A 4DAYB 3CRKC 2HCIA 4HCSA 1TS4A 3TP5A 3IAYA 2SEBD 1YHAA 5K36G 3TZUA 2UXCQ 3RNUA 2A6ED 2R6GA 3NBHA 3NENA 1U4PA 1I4XA 3HOYH 3QB3A 4OWXB 1ICWA 3KF8A 1XMOQ 2E2DC 3I4MG 3S1QH 2UUBL 1KAWA 2L9HA 4O42A 1GUGA 2O4XA 1XX8A 5GADC 4JYAL 5M5YH 5I4DA 1I4GA 4A3LG 1JICA 3OOCA 2LXKA 1EY0A 5C3EG 3M4OB 3Q23A 3RN2A 1VF5C 2IX3A 3T16A 1IL8A 2B3GA 4UDUC 3G4SA 2PW7A 3GTQH 2M2LA 1LLRD 2L12A 1N8RC 3TQYA 1EWIA 2BE5D 1CKOA 1V1PA 3S2DB 3NQIA 4R9WA 2XRSD 4OX9L 3S15B 3CXCA 4LF5Q 4RHSA 1RD9D 2AUJD 5K5PA 1SYBA 2PMZB 3X3MA 4A3GG 2PQAB 4DAMA 2UU9L 1YI2A 4OIKA 1IHZA 3I4MB 4Y52H 1IBLQ 1VQDA 4IUVA 3SXHA 3K80C 1QNUA 1RKNA 1IBKL 1ILQA 4FXKC 5C3EB 4B9WA 1MI2A 4PG3A 2CFMA 4ZYSA 4IFDJ 1BO0A 1H9KA 1VCIA 1S3OA 2DUDA 2RDFA 3Q6SA 4FVMA 4C2MB 1U0LA 1CSQA 3GTGB 4K6LA 1KABA 5M5XB 1CTMA 1Z7TA 4POFA 2F0LA 4QJFA 5LMNQ 3L9AX 3AB9A 1B70B 1ZKOA 2AQ1B 3N52A 1EFWA 3U50C 2KHJA 4A3GB 2EY6A 4BY7H 1C8CA 4IN3A 5CV4A 1F2MA 2KCTA 4JI5L 1L0WA 1XYIA 4K2LA 5F2DA 4HSVA 4FP5D 5CV8A 4GN3B 4F88A 5IGDA 2E2IB 3BVZA 2D5DA 1STNA 2BDOA 5IGEA 5I9OA 2IX0A 3TZDA 2Z6KC 1K3RA 1KDBA 5JEAH 1DOMA 4R8NA 1CHQD 5ELEA 4YHHL 3NTIA 3WWVA 1G51A 1I3QH 1EL0A 1PYSB 5EPLA 4K0KL 1BCPD 3OIPA 2D2CC 3M85A 1W2BA 2R7DA 2ZM6L 3I91A 2UUCQ 3WDNA 2IHFA 4DR6L 1LV9A 5KGUA 1YNJD 3NK9A 3BYYB 2IL8A 3OYYA 4KHPQ 2VQFQ 1VQBA 1XPUA 5L37A 5IGBA 1D5ZC 2PZUA 2PO4A 1PRTB 3VDYA 5J22A 2H4OA 4JI0L 2TSSA 3GD7A 4GLVB 1J6QA 2JP1A 1I4QA 3SVMA 2VUMH 3CCQA 3BYTB 1D1IA 1HXYD 4JI6Q 4BBSH 3OTOL 3PO2G 5ELDA 3W1GA 3KDFA 2OQKA 1LUZA 1SMYC 2WFWA 3R2IA 1VQ8A 2PNHA 1HH2P 1IYUA 1PRTC 4LK1C 2JEAI 4JVZA 1RIPA 5J1ZA 4KD3A 4AIMA 4LFAL 4DK6C 3S1NB 3UDFA 3FKIG 3UDXA 3D0FA 1BBUA 1VQNA 2VB3X 1FD7D 1R9TB 1X55A 2I0QA 4RAUC 1I94Q 4RWSC 1JC7A 2IT1A 5C0XG 5LHY1 2MUYA 3CPWA 4DR7L 4C3JG 1JWSD 1EY6A 5IWAL 4KD4A 1CQFA 3OSOA 4OEMB 2VW9A 2A68D 1DXMA 1B53A 1EY9A 3CW2C 3D4RA 4NP5A 1WTVA 1K73C 1BBXC 1PTOH 1ET9A 4EGVA 3CD6A 3ULJA 4RGTA 1DGSA 3PO2B 1VQOA 4P71A 2AQ3B 1L1OA 4N9TA 5AJ3Q 4PV1C 3S17H 2F0HA 3NHHA 4YY3L 1NAPA 3R3OA 3C46A 1X3PA 1Y14B 3FKIB 4A3KH 2H5XA 2NVYH 3AFQA 4APVA 3H0GG 1CZWA 1EU4A 5M3MH 1HZBA 4NMZA 3CF5A 1ET6A 3I4NH 1YIJA 2B2UA 4C3JB 1YHBA 4L5SA 4ZAIA 3E0EA 1UWVA 3K6OA 4GNXB 3T1YL 2PW5A 3PIO3 1ZYRC 3PIOA 5IIFA 4DV7L 1WYDA 1W6JA 3I73A 2JA8G 1Z9FA 4CDCC 3HOZH 1OXUA 1UNSA 4PMCA 3HEJA 4IUTA 2E5LQ 3I70A 1Q90A 2QF7A 2FINB 2I46A 3ER0A 4GNXC 3J7A5 1K3BC 5GROA 3SE0A 3H0GB 4KK7A 1DJRD 1KLGD 2D62A 2AMCB 2K01A 1D6EC 3RZOB 4RKBA 3EFXD 2Q2IA 3EIVA 5KEEA 3I2ZA 3OWFA 5M3FG 1O78A 1QUQA 1HUNA 1BR9A 1JOOA 3FPUB 4LJZC 3KLSA 3DM3A 3OMGA 1MJCA 1V9PA 3HS0C 5DEHA 3Q24A 1X6OA 2IW3A 4C3HH 2XTIA 3OW7A 2JA8B 5IP7G 5JJKA 3E6ZX 3UE0A 4DUZQ 4ZUIA 3KOJA 1RDPD 2F0JA 2JQOA 4XT1B 2E2HH 2LFNA
chains in the Genus database with same CATH topology
1EEID 2QDBA 1A2UA 4EQOA 1TWGB 1GXDC 2RVLA 1AZPA 2EXZA 5M3FB 3HRZC 4TKOB 3DEOA 2XN9C 2AQ2B 4XQNA 1WD0A 1RCVD 1PFNA 3WOFA 1TS2A 1HA6A 4RHRA 3A55A 1FR3A 2K33A 4Y7NB 1PLFA 1Z6HA 5EKIA 1ENCA 4PMWA 3MVVA 1MBYA 2KEEA 1HFGA 1T5XD 3A8JE 3PV0A 3QOJA 3C1EA 3U9SA 5JJZA 3TBIB 3FEWX 3IKJA 2OEOA 2EYMA 4TRDA 1WCMB 1SNDA 1EQVA 1AN8A 1QOHA 3TP8A 2JA5B 3G6JB 3EA6A 4BWGB 3I72A 4HN7A 1F2LA 1S5BD 3KBXA 4UAIA 4HMIA 1B50A 4ZK9B 3T56B 2BA0A 2EY5A 5IGCA 2EJGC 2KHSA 2K6AA 4DNTB 4H7BA 1B3AA 2EOTA 2SOBA 2KUMA 1SMYD 5FOBB 2LY7A 5CGKA 1WTQA 1SDFA 3NP8A 1NR2A 5C0XJ 1SE3A 4DGZA 1KNAA 1KDAA 3GTOB 1ESFA 2HDMA 1A3VA 1STEA 3NSWA 1HHVA 3EJIA 1O7LA 5CV9A 2RKSA 1F9SA 1CA6A 1OXSC 4C1NI 1SE2A 1Z47A 3T51B 3SEBA 2KA7A 5T1GA 1TWAB 1EY7A 3MFYA 1EQTA 4IZ8A 3S1RB 2B2TC 2XRQD 1EY4A 4KN4C 2NVXB 2X6LA 2PCFB 1HFNA 2EYFA 4OL7A 1SYGA 3NQTA 1EWCA 4FO2A 2IWHA 5E4WC 3GTJB 3OPOA 3IFDA 1SNQA 3T4AC 3URYA 3HOXB 4QUFA 5KNCA 3G7LA 1SFOB 1XWEA 1ZYRD 4A3FB 1PZJD 2B2VC 5EQ0A 4G7HC 3D3RA 1EY8A 3VYSA 3BDOA 1GHJA 1SNCA 5JVH3 1J8IA 2E74C 1EWHA 5KNDA 2PPBC 2J0TD 1SAPA 4FYDA 1TKWB 3D31A 5C4JB 4CGYB 1TVXA 1Y1VB 1WTRA 4A3IB 4DXFA 5CV7A 5IOCA 3PO3B 1G91A 3OMCA 1TQOA 2F0EA 3MWYW 2F0TA 3A7LA 3QG1A 3QWNA 1YNNC 1U9RA 2MGSA 3J81L 2R93B 1H9JA 1LTGD 3GO5A 3JAML 2VB2X 2EJMA 1I6HB 5E1FA 5CC4A 4OO1G 1SSOA 4DF7A 4IQZA 4CKEA 1Q1EA 3D4WA 3A56A 1X32A 4J8QA 1TR5A 1Y8NB 1FYCA 1V8QA 4PMBA 2EYPA 4G4KA 3LWEA 3ITPA 5C3WA 2B8FA 4HMJA 4E6IA 4ID6A 5BN3A 1SYCA 2NVTB 3M4YA 2PQEA 1WVLA 1OO9B 1Q12A 1ML0D 2PNRC 1AFPA 1Q8IA 2FHTA 2B2UC 3DWAA 1H9SA 5EBDA 1V43A 1AZQA 2ENBA 1R4QB 1NR4A 1U4LA 5EBCA 4KY5A 2TMPA 1DONA 3NE5B 4FXGC 5M5WB 4IFDI 3IL8A 1CFMA 4L6TB 4DA2A 3D8GA 2ICEC 2DN8A 2QEJC 5CORA 4K5WA 1ESRA 4XYOA 4IUQA 2F0KA 2VNUD 3S2HB 2NZ1D 3NTKA 3ONAB 3CQZB 2NN6G 2EY2A 5E4XA 3X3NA 5FKAC 4ZUJA 1QG7A 1B9MA 3DWQA 2K03A 2A69C 1MD2D 1PXUA 3MHBA 1STGA 2IJ0A 2K7VA 4MN3A 2R92B 2RDGA 4CJ0B 4RH6A 4DAVA 2YU9B 1QILA 2F0FA 1ZEQX 3IFTA 4U673 2MHVA 3EVQA 3S9WA 2FJ2A 5DM73 4KV6A 2J4XA 2KEDA 2WP8J 4XXEA 2R61A 3SDZA 3PIP3 4NDXA 1SNMA 4RFBA 2OF1A 2K5DA 3QJYA 3BG3A 5CYUA 3BDCA 1B44D 4A3DB 3I4LA 5T1IA 3Q0AA 1PRTF 2O5IC 3HOUB 2F0PA 2R7ZB 1S4ZA 3GTLB 3QO2A 4RA8A 3KLRA 5EKKA 4MIUA 5KYLA 1UEAB 4OO1I 2JSOA 2B39A 1STHA 2EYLA 3C3LA 4RCOA 1DOLA 3HOWB 5BN4A 1CHPD 1IW7C 5KYIA 4I7ZC 2AWOA 4XQQA 1U4MA 3OWEB 3K57A 2D9UA 4QUCA 1TS3A 1G2SA 1DCZA 1KTKA 1M4VA 2ZXRA 2X69A 1L0YB 3MFGA 2F0SA 1M8AA 1QB5D 2X6GA 2NBFA 3BVGA 5M5YB 5COYA 2F0VA 3NUCA 1E2ZA 1ONLA 3PUYA 4XIGS 2E76C 1G2TA 4PQXA 5G3LF 1I4PA 5IT9L 5ISRA 3FDTA 5CBAE 4DN4M 3K5OA 4MHEA 2F0DA 2V4DA 5CR3A 1GUNA 5C4XB 1EZ8A 4C1NK 4I65A 3M3YB 4ULLA 1G6ZA 3ND8A 1EIHA 3NWSA 4U68A 1D1KA 1EIGA 5KIXA 2ICIA 2Q8IB 5JEAG 1QCBD 3I8ZA 4ZKBB 1ENAA 1Y1WB 3UI2A 2PZWA 1RF2D 2FMMA 1TU2B 3J7AV 1LT4D 2NN6I 4S3SA 1EFID 2L5TA 3PUXA 2ZXPA 5JAVA 4CBVA 1EYCA 4BY7B 3A7AB 2B8GA 5A2QL 2XSCA 2NWGA 3FMCA 1WTOA 4DK1A 2JEBI 1STBA 4L8JA 1NCVA 4B08A 2WKCA 4RGNA 4WFN3 2JA7B 1QE6A 1DD2A 2SNSA 2KECA 3CRLC 2OT2A 3EROA 2Z1CA 4DFAA 2RBMA 4CJ1B 5TSSA 1I3QB 3FRPB 1SE4A 1D5XC 1CK1A 4IFDH 1XXGA 2XVSA 1Y8OB 1NSNS 5D3IB 1HQRD 1F9PA 2DY8A 1CT1D 1U4RA 5BN5A 2A74C 2ZT9C 2BDNA 2B2WC 1BNZA 4KTAA 4F7XA 1LTID 4OHJA 4HEDA 4BBSB 3A8IE 4KMUC 1I4HA 3TP6A 2G9DA 2K28A 3M7GA 3ERQA 5C4HA 5C5MA 1QNKA 2WIIB 2GA4B 1LT3D 4KJNA 4EQNA 5IGGA 1KNEA 2HUGA 2L1BA 2KCCA 2A6EC 3NXWA 3GV6A 2WB1B 1RTNA 4WRDA 2BCOA 5ELBA 1JQYD 2XNAC 4LMQD 1PTOB 1PTOF 5C0XI 2PYKA 2C5CA 1EYDA 3WOEA 3TSSA 1LTSD 1EYAA 5FLXE 2K1BA 3S17B 1V1PB 3DWPA 3M7NA 4XDXA 3DM1A 4QF4A 2EYOA 1SEBD 4A3KB 2NB0A 2BE5C 1PTOC 3EQLC 3S16B 2NVYB 1PRTD 5FO9B 4RKLA 1A2TA 4HCEA 3PUVA 5M3MB 2FFKB 3W3AA 4K5XA 3I4NB 1RJTA 1SNOA 1IW7D 4FF2A 1PMRA 2Z8LA 3LNNA 3OIQA 5DNFA 4C3HG 4OO1H 5JPNC 2EPBA 3PMFA 4FNFA 3HOZB 1B1ZA 2EDGA 5LL6S 1GUSA 3MXGA 1OXXK 3O13A 2BOSA 2CVRA 3PUWA 4IALA 4X3TA 4X3UA 3RUZA 1VF7A 3GV3A 1PZKD 2B63B 1PDQA 3CU7A 3FPPA 1B4OA 5DAUA 4XYQA 4HAEA 5CV5A 1C48A 2KVMA 3C2PA 2CW0C 3H09A 5K36H 5I6WA 2DNCA 4C3HB 1IYVA 3BVMA 4FXDA 5JEAJ 4RGMA 1A6XA 1NUCA 3CKIB 3K58A 3J80L 3J81E 5HURA 1E2VA 5G3LD 1B2TA 3JAME 5EKLA 1HTPA 1ZXTA 4HR7B 5KRUA 5C44B 5D14A 2LKVA 2YYZA 4JK1C 4ME5A 1A15A 3TMEA 5FO7B 3VYTA 1MSGA 5J39A 1VDZA 4IURA 3TDQA 5I6YA 2EZVA 1F2YA 2K04A 1KAAA 4M1UB 3MXNA 5C5LA 4F87A 1HCZA 3MC0B 2F0UA 3F2UA 1UUPA 1TIID 4BA1I 4AYBB 1JORA 3BZDB 3SK8A 3LWUA 4K14A 3K5NA 1CI3M 2A68C 1A3TA 3R93A 2SNMA 4L63B 3A8KE 2NTTA 4LAAA 4IUNA 4XQJA 5JPMC 3MXPA 1PFBA 1MGSA 4KKUA 2C9OA 3SR1A 3AU7A 1AW7A 1JE4A 4A3JB 1LACA 4H0LC 3D6CA 4X3SA 1EEFD 2DNEA 1S5CD 1KDCA 1XTCD 2HCCA 3BS1A 2QILA 1F77A 2AWNA 2B2YA 2DY7A 3MXUA 5IGFA 5AFWA 1FNUA 4IUUA 3SK6A 3MEHA 5ELFA 3MZ5A 1DYQA 3HZXA 4K6DA 4KHVA 4KN7C 4V0BA 3HG9A 3VA5A 3DMUA 3OHXC 1LO5D 3E0JA 5I9PA 2NTSA 3GTPB 4A3EB 3W2DA 1PTOD 1E0BA 3GTKB 1JWUD 4C56C 4EVOA 2K05A 1BDOA 4BBRB 5C0XH 4ZRZA 4Q5VA 3P75A 1II3A 1WTWA 2XIWA 2EE1A 3VR5A 2EVBA 2Z4HA 1JOQA 1H9RA 2R3ZA 3P1HA 2F0QA 3NBIA 4A3MB 2HDLA 2NYZD 1D2BA 1I6VC 3K7AB 3P7JA 4NKLA 2RSNA 1O7YA 4R8IA 2N88A 3NWTA 1BF4A 2B2TA 2L55A 1Q1BA 3GTMB 4DNRB 3S1MB 1E2WA 1R4PB 3BDLA 5HGTA 4WORA 4IUPA 5NUCA 5CV6A 3QIAA 1BOSA 3VYUA 1C4QA 2RQXA 4QB4A 1Q3LA 2G9HD 2CW0D 5ELCA 2B2VA 2EY1A 1GUTA 4O1NA 4C3IG 2SDFA 2IX1A 4QIWB 1JB3A 3DHQA 4FF1A 2O5JC 2ID0A 2F4IA 1TWFB 2NUCA 2JYOA 1B9NA 2Q8TA 4KJOA 1GUOA 1CM9A 3KBGA 4TSSA 1O7ZA 2NVQB 4CHTB 3A54A 3I90A 4PNYA 1X3QA 3R8BA 5EPKA 1VMCA 1CZGA 3VR6A 4K8IA 5IT9E 2BA1A 4C3IB 4RCNA 1GJXA 5E3FA 3HOVB 5JOBA 1KLUD 4ZLTF 1F9RA 1YNND 1SJED 2HQEA 5M9OA 3HOYB 4DXGA 3S1QB 3SHLA 2L4NA 1SYEA 2RA4A 3J7YW 4ABNA 4M8AA 3GQBA 1PYWD 2MPMA 5DM63 1AP0A 3KUPA 2A6HC 3DEPA 3VR3A 2RSOA 4F8MA 3GTQB 3K5MA 1SNPA 3ND9A 2KQ3A 5A2QE 2A5HA 1UAPA 1S5DD 4DU9A 3VR4A 3DUZA 2WKDA 1TWCB 4V190 1VMPA 4A93B 4CJ2C 1LT6D 4DK0A 5D3DA 2OXPA 1D5MC 2PZTA 4N9PA 1K8MA 4XTCS 1JCKB 3R2TA 4ILWA 4DAYA 5FO8B 1S5ED 1HA5A 2XWJB 4J1MA 1SJHD 3CHBD 1K8OA 3K0YA 4BS9A 4XT3B 2EYJA 3V2TA 3C1FA 2L11A 4QMGA 3L3OC 3D6WA 3U9OA 3N6RA 1F2ZA 4QCLA 4ZQ3A 2KOLA 1JWMD 2QKIC 5EGTA 1BUVT 4Z9CB 2K32A 3MTSA 4NW2A 1ILPA 2CHBD 2M9VA 4B9XA 1Y8PB 1WTXA 1FGBD 2F1MA 3V05A 5FK9C 3SK4A 3T13A 4H44C 1GOZA 1I4RA 1HUMA 4RGOS 2WACA 4OGQC 1A3UA 3J7AF 3VR2A 1RTOA 2K5QA 3E5SA 1FNWA 1F9QA 1Y69U 2A69D 2VXWA 1JOKA 2K5WA 2WV6D 2WAQB 2VUMB 3I3CA 4TQUS 3FVQA 2F0NA 4G7ZC 1WD1A 2EJFC 4G57A 4J6HA 3TN2A 3HGBA 2M00A 2E75C 3HP3A 1DM0B 4ODGA 3H3VC 3RD4A 3SK5A 2F3VA 1O80A 2JE6I 2N55A 4P2CB 1LTAD 4H13C 1EU3A 1QWYA 1S5FD 3H94A 1STYA 1W6KA 2MP1A 3S14B 4OIJA 1RODA 1IKLA 2FMCA 5LL6X 1GUWA 4K2KA 1LTRD 2F0MA 1H9SB 1QJOA 3RMHA 1BXTA 3NTHA 4CKBA 2LS01 5I2XA 1PZID 5CMDA 1TS5A 3K59A 3HKZB 2KCNA 2XWBB 2B2YC 5I2YA 1FNVA 5EJWA 4WJWA 3VA7A 4K5VA 1CA5A 3KLSX 5KNBA 4HSPA 1HQMC 1AEXA 2E2JB 1H9MA 1TY0A 3J80E 4G7OC 3P20A 2WINB 1LABA 1EY5A 3RLFA 4FF3A 1LTTD 3KK7A 1BQQT 1TT2A 2CQAA 1OXVA 2MJ8A 3T53B 3K5LA 2Z4IA 5EPJA 2AUKA 2A6HD 4IFDG 5C4ZA 1LTBD 1I50B 4FF4A 4ZKCB 2J7ZA 4KHZA 3AMUA 1PFMA 1G291 1SBBB 1T5EA 4BA2I 5FLXL 3V96A 2F0WA 4EQPA 5JVG3 1BCPB 1BCPF 3D4DA 2JXMB 1HPCA 2H1EA 2E2HB 3QOLA 2QCPX 1RHPA 4KKSA 4X3KA 3PUZA 1MSHA 1BCPC 3MA2B 1DOKA 1G8ZD 3NPPA 5D65A 4KI0A 4YIJA 1YNJC 2Q8RE 2KJXA 1OXTA 3H91A 2EYHA 3Q22A 5C3XA 4GZYC 1TY2A 1CQVA 2F03A 3ZYYX 5CBEE 2I07B 2L0CA 1SXTA 4CKCA 5IODA 1SYDA 4A3BB 4DAPA 1SYFA 2NN6H 3DXJC 3L7ZC 1GHKA 2F0OA 5C6AA 4KY7A 3TP7A 1HTLD 1ENFA 4KY6A 1JR0D 4BY1B 2A73B 1K83B 4JBWA 2LMCB 3GP7A 2B2WA 4KKTA 1J9OA 4K8JA 1IKMA 4Q0FA 2ZXOA 5A35A 3H6MA 1TWHB 3MAQA 1LT5D 3RZDB 1EZ6A 1WTPA 1L0XB 1HRJA 2F0GA 3LX0A 1DZ1A 2F0IA 2Y0SB 2F3WA 4HTHA 2O2LD 2RDHA 1V1OA 1EOTA 3VYRA 2IPKD 1STAA 2JA6B 3CRKC 2HCIA 4HCSA 1TS4A 3TP5A 3IAYA 2SEBD 5K36G 3TZUA 2A6ED 2R6GA 3NBHA 1U4PA 1I4XA 3QB3A 1ICWA 3KF8A 2E2DC 2L9HA 4O42A 1GUGA 2O4XA 1XX8A 5I4DA 1I4GA 1JICA 3OOCA 1EY0A 3M4OB 3Q23A 1VF5C 2IX3A 3T16A 1IL8A 4UDUC 2PW7A 2M2LA 1LLRD 2L12A 2BE5D 1V1PA 3S2DB 3NQIA 4R9WA 2XRSD 3S15B 4RHSA 1RD9D 2AUJD 5K5PA 1SYBA 2PMZB 3X3MA 4OIKA 1IHZA 3I4MB 4IUVA 3SXHA 1QNUA 1RKNA 1ILQA 4FXKC 5C3EB 4B9WA 1MI2A 4ZYSA 4IFDJ 1BO0A 1H9KA 1VCIA 4FVMA 2RDFA 3Q6SA 4C2MB 3GTGB 4K6LA 1KABA 5M5XB 1CTMA 1Z7TA 2F0LA 3L9AX 3AB9A 1ZKOA 2AQ1B 3N52A 4A3GB 2EY6A 1C8CA 4IN3A 5CV4A 1F2MA 1XYIA 4K2LA 5F2DA 4HSVA 4FP5D 5CV8A 4F88A 5IGDA 2E2IB 3BVZA 2D5DA 1STNA 2BDOA 5IGEA 5I9OA 2IX0A 3TZDA 1KDBA 5JEAH 1DOMA 4R8NA 1CHQD 5ELEA 3NTIA 1EL0A 5EPLA 1BCPD 3OIPA 2D2CC 3M85A 3I91A 3WDNA 1LV9A 5KGUA 1YNJD 3NK9A 3BYYB 2IL8A 5IGBA 1D5ZC 2PZUA 2PO4A 1PRTB 5J22A 2H4OA 2TSSA 3GD7A 2JP1A 1I4QA 3SVMA 3BYTB 1D1IA 1HXYD 5ELDA 1SMYC 3R2IA 1IYUA 1PRTC 4LK1C 2JEAI 5J1ZA 4KD3A 3S1NB 2VB3X 1FD7D 1R9TB 4RAUC 4RWSC 1JC7A 2IT1A 5C0XG 5LHY1 2MUYA 4C3JG 1JWSD 1EY6A 4KD4A 1CQFA 3OSOA 2A68D 1DXMA 1B53A 1EY9A 3D4RA 4NP5A 1WTVA 1BBXC 1PTOH 1ET9A 4EGVA 4RGTA 3PO2B 2AQ3B 4N9TA 4PV1C 2F0HA 3NHHA 1NAPA 3R3OA 3C46A 1X3PA 3FKIB 1CZWA 1EU4A 4NMZA 1ET6A 2B2UA 4C3JB 4ZAIA 3K6OA 2PW5A 3PIO3 1ZYRC 5IIFA 1W6JA 3I73A 1OXUA 1UNSA 4PMCA 3HEJA 4IUTA 3I70A 1Q90A 2QF7A 2FINB 2I46A 3SE0A 3H0GB 4KK7A 1DJRD 1KLGD 2D62A 2K01A 1D6EC 3RZOB 4RKBA 3EFXD 5KEEA 3OWFA 1O78A 1HUNA 1BR9A 1JOOA 3FPUB 4LJZC 3KLSA 3OMGA 3HS0C 5DEHA 3Q24A 2IW3A 3OW7A 2JA8B 3E6ZX 4ZUIA 1RDPD 2F0JA 4XT1B 2LFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S3S A;  2LKV A;  4ODG A;  1KAB A;  2EY1 A;  2OXP A;  2PZT A;  1EY6 A;  3D8G A;  3H6M A;  2QDB A;  4N9P A;  4DGZ A;  4KD4 A;  4ME5 A;  5EKK A;  4MIU A;  5KYL A;  1KDA A;  5JAV A;  1A2U A;  3SK5 A;  1EYC A;  2F0L A;  2F3V A;  2PYK A;  3OMC A;  1TQO A;  3OSO A;  1EYD A;  2F0W A;  4NP5 A;  2F0E A;  1EY9 A;  4K5W A;  4EQP A;  5IGF A;  1EZ6 A;  4J1M A;  2F0T A;  4EQO A;  3SK6 A;  3DHQ A;  3MEH A;  1EYA A;  1A3V A;  3D4D A;  2F0G A;  3TME A;  3LX0 A;  3MZ5 A;  1U9R A;  2F0I A;  1STH A;  2EY6 A;  3HZX A;  2EYL A;  5KRU A;  2F3W A;  4HTH A;  4K6D A;  2F0K A;  4KHV A;  5CV4 A;  5J39 A;  1F2M A;  4QF4 A;  2EYO A;  1STB A;  2NUC A;  2EYJ A;  3EJI A;  3QOL A;  1STY A;  2EXZ A;  4N9T A;  5CV9 A;  2RKS A;  3V2T A;  5ISR A;  3VA5 A;  3DMU A;  2F0H A;  2EY2 A;  3C1F A;  4K2L A;  3NHH A;  5F2D A;  4QMG A;  5E1F A;  4ZUJ A;  2SNS A;  5I6Y A;  5CV8 A;  5CC4 A;  5IGD A;  3R3O A;  4RKL A;  5KYI A;  1STA A;  1A2T A;  4KJO A;  4K2K A;  1F2Y A;  1STN A;  3U9O A;  2F0M A;  3ERO A;  4DF7 A;  1EY7 A;  1F2Z A;  5IGE A;  1KAA A;  5I9O A;  4DFA A;  1KDB A;  2RBM A;  3TP5 A;  4K5X A;  4ZQ3 A;  4IZ8 A;  5I9P A;  4YIJ A;  3D4W A;  4R8N A;  5EGT A;  4PNY A;  1TR5 A;  1EY4 A;  3MHB A;  2F0S A;  1STG A;  5C5L A;  4NMZ A;  4K8I A;  3QB3 A;  1SNO A;  2EYH A;  5C3X A;  1NSN S;  1ENC A;  4EVO A;  2F0U A;  4PMB A;  2EYP A;  2F0V A;  2O4X A;  2PW5 A;  3NUC A;  3P75 A;  3PMF A;  1II3 A;  2EYF A;  3MVV A;  4B9X A;  4OL7 A;  1SYG A;  5IIF A;  3NQT A;  5E3F A;  5KGU A;  1EY0 A;  3QOJ A;  3NK9 A;  2F0F A;  3C1E A;  5JOB A;  1JOR A;  1JOQ A;  3P1H A;  3ITP A;  3SK4 A;  4PMC A;  3HEJ A;  3T16 A;  3T13 A;  1SNQ A;  2F0Q A;  4IAL A;  5C3W A;  5IGB A;  2PW7 A;  4K5V A;  2HQE A;  4HMJ A;  5M9O A;  5IOD A;  4E6I A;  3SK8 A;  2OEO A;  2PZU A;  3RUZ A;  2EYM A;  1SYD A;  4ID6 A;  3EVQ A;  4TRD A;  5J22 A;  4K14 A;  2WAC A;  1SND A;  3S9W A;  4KTA A;  4NKL A;  4F7X A;  1EQV A;  1AEX A;  3SHL A;  1A3T A;  4KV6 A;  1A3U A;  1SYF A;  1SYE A;  1SYC A;  2SNM A;  3TP8 A;  2F0D A;  3TP6 A;  5CR3 A;  2PQE A;  4LAA A;  5DAU A;  1EY8 A;  1EZ8 A;  5CV5 A;  3E5S A;  4I65 A;  4IUN A;  5K5P A;  4NDX A;  1SYB A;  1SNM A;  4RKB A;  1EY5 A;  2OF1 A;  3BDL A;  3ERQ A;  1SNC A;  3MXP A;  5C4H A;  5C5M A;  1IHZ A;  4F8M A;  3BDC A;  2F0O A;  5HGT A;  3OWF A;  4WOR A;  5KEE A;  4HMI A;  5I6W A;  1JOK A;  5C6A A;  5KIX A;  4KY7 A;  5J1Z A;  4KD3 A;  5NUC A;  3SXH A;  2EY5 A;  5CV6 A;  3TP7 A;  1JOO A;  1RKN A;  1TT2 A;  5IGC A;  1SNP A;  2KHS A;  4KJN A;  3OMG A;  4KY6 A;  3SR1 A;  4EQN A;  2KQ3 A;  2ENB A;  1NUC A;  1ENA A;  4DU9 A;  5IGG A;  5DEH A;  4H7B A;  3D6C A;  4KY5 A;  2F0N A;  2SOB A;  2F0P A;  4B9W A;  4G57 A;  4QB4 A;  4J6H A;  1KDC A;  3NXW A;  5C4Z A;  5HUR A;  4ZUI A;  2PZW A;  2F0J A;  2M00 A;  5CGK A;  5EKL A;  4WRD A;  2RDF A;  4K8J A;  5CV7 A;  5IOC A;  3NP8 A; 
#chains in the Genus database with same CATH topology
 1EEI D;  1J5E Q;  2UUA L;  2JJQ A;  2QDB A;  2I5L X;  4DR3 Q;  1KQS A;  4JC0 A;  1A2U A;  5IYC H;  5C44 H;  3B6Y A;  4I7A A;  4EQO A;  2UXB Q;  1TWG B;  5IYD G;  1GXD C;  2RVL A;  4B3T L;  1SLJ A;  1WOC A;  1AZP A;  1N34 Q;  2EXZ A;  4JI8 Q;  5M3F B;  1YHQ A;  1A8V A;  1E7Z A;  3HRZ C;  4TKO B;  3DEO A;  1UE6 A;  1JJ2 A;  1X3F A;  4DR5 L;  2XN9 C;  2AQ2 B;  4XQN A;  1WD0 A;  1RCV D;  1PFN A;  2WB1 G;  2JA5 G;  4IPH A;  3WOF A;  1TS2 A;  2A8V A;  1HA6 A;  4JI3 L;  4RHR A;  3A55 A;  1FR3 A;  2K33 A;  4NXM Q;  2RCF A;  4Y7N B;  1PLF A;  1Z6H A;  5EKI A;  4JI4 Q;  3CCV A;  1FJG L;  1ENC A;  4A3B H;  4PMW A;  3M4Q A;  3MVV A;  3E9I A;  1GM5 A;  1MBY A;  2KEE A;  1HFG A;  2AKW B;  1T5X D;  3A8J E;  4X64 L;  4JV5 Q;  3PV0 A;  3QOJ A;  3C1E A;  3U9S A;  1SE8 A;  5JJZ A;  3TBI B;  3FEW X;  4X6A H;  3IKJ A;  2ES2 A;  2OEO A;  2EYM A;  4GKJ Q;  4TRD A;  1WCM B;  1SND A;  4LF4 Q;  1EQV A;  4DUY L;  1C9O A;  2JK8 A;  1AN8 A;  1VQ6 A;  1QOH A;  3TP8 A;  2JA5 B;  4DV2 L;  4NXN L;  4DR2 L;  3ZJY C;  1K83 H;  3STB C;  4R4T A;  4RMF A;  4X62 L;  3G6J B;  3EA6 A;  4BWG B;  3G71 A;  3I72 A;  4HN7 A;  4P75 A;  1F2L A;  1S5B D;  3KBX A;  4UAI A;  4HMI A;  4PZ6 A;  4HJA A;  1B50 A;  4ZK9 B;  3T56 B;  2BA0 A;  2EY5 A;  2HIV A;  3UDI A;  4DV0 Q;  5IGC A;  2EJG C;  2KHS A;  4KLK A;  2K6A A;  4DNT B;  4DV1 Q;  3I56 A;  4QQB X;  4H7B A;  1B3A A;  2EOT A;  3CCM A;  2SOB A;  2KUM A;  1SMY D;  5FOB B;  2ZTE A;  2LY7 A;  5CGK A;  1WTQ A;  1SDF A;  4LF6 L;  3NP8 A;  1KL9 A;  1NR2 A;  1EIY B;  5C0X J;  1SE3 A;  4DGZ A;  3KLW A;  2Q2U A;  1KNA A;  1KDA A;  4X66 L;  1EYG A;  3GTO B;  1ESF A;  2HDM A;  3T1H L;  1A3V A;  3K8A A;  1STE A;  3NSW A;  1HHV A;  3EJI A;  1O7L A;  5CV9 A;  2RKS A;  1F9S A;  3HOX G;  1CA6 A;  1OXS C;  4C1N I;  1SE2 A;  2JN4 A;  4CDF C;  1Z47 A;  3QR8 A;  3T51 B;  3SEB A;  1YBY A;  2K5V A;  1MKH A;  2KA7 A;  1TWA B;  5T1G A;  5FJ8 G;  4UHV A;  4A3F G;  1EY7 A;  3MFY A;  1EQT A;  4IZ8 A;  3M4O H;  3S1R B;  2MNA A;  1KD1 C;  2B2T C;  2XRQ D;  1EY4 A;  1WFQ A;  2VS1 A;  4KN4 C;  2NVX B;  2X6L A;  5BR8 L;  3GTP H;  1C7Y A;  2PCF B;  4A3E H;  4BXX G;  1HFN A;  3M4P A;  3GTK H;  2EYF A;  4OL7 A;  1SYG A;  4LF8 L;  3NQT A;  1EWC A;  3S15 H;  3H3V I;  4FO2 A;  2IWH A;  5E4W C;  5IY0 A;  3GTJ B;  3OPO A;  3IFD A;  1SNQ A;  4DV6 Q;  1Y1V G;  2N8N A;  1NBW A;  3T4A C;  3URY A;  3HOX B;  4QUF A;  3I4M H;  5KNC A;  3G7L A;  2HHH Q;  3PO3 G;  3A74 A;  1SFO B;  1XWE A;  1ZYR D;  4IJL A;  4A3F B;  1PZJ D;  2B2V C;  5ELN A;  2RF4 A;  2A1A A;  3K7A H;  5EQ0 A;  4A3L H;  4G7H C;  1KC8 C;  1YJN A;  3D3R A;  1X9N A;  1EY8 A;  3VYS A;  5C3E H;  3BDO A;  2WB1 E;  1GHJ A;  4HID A;  2R93 G;  1SNC A;  2LXJ A;  5JVH 3;  1J8I A;  2E74 C;  3GTM H;  4C2M H;  3CC7 A;  1W3S A;  1EWH A;  5KND A;  2PPB C;  2J0T D;  1SAP A;  4FYD A;  1TKW B;  3D31 A;  5C4J B;  1QZG A;  4CGY B;  1N32 Q;  4IPC A;  1MJE A;  1HNX L;  4YWL A;  4A3G H;  1TVX A;  1Y1V B;  3KDF B;  1WTR A;  2QDL A;  4A3I B;  4DXF A;  5CV7 A;  1OTC A;  5IOC A;  5IYB G;  3PO3 B;  1A0I A;  1XNQ L;  1G91 A;  2NZO A;  2F4V L;  2E2I H;  3OMC A;  1TQO A;  2F0E A;  2YTY A;  4QY7 A;  3MWY W;  2F0T A;  4LFB Q;  3A7L A;  3QG1 A;  3QWN A;  1YNN C;  1U9R A;  2MGS A;  3J81 L;  2R93 B;  2GVA A;  1H9J A;  1NMF A;  1LTG D;  3GO5 A;  2EQS A;  3JAM L;  2VB2 X;  4GOP B;  1IBM Q;  1WTH A;  2EJM A;  3HFZ B;  1I6H B;  4DV3 L;  5E1F A;  5CC4 A;  4A3J G;  1TWF H;  4OO1 G;  1SSO A;  3I55 A;  2QGQ A;  2K75 A;  4DF7 A;  3A5U A;  4DV4 Q;  3BU2 A;  4IQZ A;  1FGU A;  4CKE A;  1Q1E A;  3D4W A;  3A56 A;  1X32 A;  4J8Q A;  1TR5 A;  4UY8 C;  4GOP C;  1HNZ Q;  1Y8N B;  2NVQ H;  1FYC A;  1JE5 A;  1V8Q A;  4LF7 L;  3RLN A;  3F2D A;  2KEN A;  2CWA A;  4PMB A;  2EYP A;  1PH6 A;  4G4K A;  3LWE A;  2KCM A;  4C3I H;  4LF5 L;  3SGI A;  4JBM A;  2ATW A;  1NMG A;  1GO3 E;  3ITP A;  1L1O C;  2B8F A;  4A4I A;  5C3W A;  4B3S Q;  4HMJ A;  3HOV H;  4E6I A;  3F2B A;  4ID6 A;  4WJ4 A;  5BN3 A;  2QW7 A;  1B3Q A;  1SYC A;  2NVT B;  3M4Y A;  3S1N H;  2PQE A;  1WVL A;  1OO9 B;  2IHE A;  1Q12 A;  1ML0 D;  4DR1 Q;  2PNR C;  3CCR A;  1LM0 A;  1AFP A;  1HZ9 A;  1Q8I A;  4B3M Q;  2FHT A;  3A5Z B;  2B2U C;  2OTJ A;  3DWA A;  3ULP A;  1H9S A;  5EBD A;  1V43 A;  1AZQ A;  1X3E A;  2ENB A;  1R4Q B;  5IP9 H;  1NR4 A;  2DGY A;  1U4L A;  5EBC A;  4KY5 A;  2TMP A;  3STB D;  1DON A;  3NE5 B;  3PO2 H;  4FXG C;  1N36 Q;  4JBK A;  1EQR A;  4A3C G;  2JA9 A;  5M5W B;  1TWC H;  4IFD I;  3IL8 A;  1CFM A;  4L6T B;  4DA2 A;  2R92 G;  4A93 H;  3D8G A;  2ICE C;  3LGJ A;  2DN8 A;  1X65 A;  2QEJ C;  5COR A;  4K5W A;  1ESR A;  4XYO A;  1QVF A;  4IUQ A;  2F0K A;  2VNU D;  3S2H B;  2NZ1 D;  4WJ3 M;  3W5O A;  3NTK A;  3ONA B;  4UP8 A;  3CQZ B;  4JBJ A;  1PH1 A;  1BKB A;  2NN6 G;  2EY2 A;  5E4X A;  3X3N A;  5FKA C;  4ZUJ A;  1QG7 A;  2PI2 A;  4N8X 1;  4L5Q A;  4JI1 L;  1NJI C;  3DLL A;  1B9M A;  2UUC L;  3CCS A;  3DWQ A;  4B3R L;  2UUB Q;  2K03 A;  2A69 C;  1MD2 D;  1PXU A;  3MHB A;  4GLX A;  1STG A;  4JYA Q;  2IJ0 A;  2K7V A;  4MN3 A;  2R92 B;  2RDG A;  4MTN A;  4A3D G;  4CJ0 B;  4RH6 A;  3W1B A;  4DAV A;  4IOC A;  2YU9 B;  1QIL A;  2GVB A;  2CH4 A;  4IO9 A;  2F0F A;  3HOU G;  2R7Z G;  1ZEQ X;  3TRE A;  2N78 A;  1ICF B;  3IFT A;  4U67 3;  2MHV A;  1LYL A;  3EVQ A;  3AFP A;  5GAH C;  3S9W A;  2FJ2 A;  4OX9 Q;  5LMU L;  5DM7 3;  1P16 A;  4KV6 A;  3M9B A;  1IL2 A;  2J4X A;  2KED A;  5FLX c;  2WP8 J;  4XXE A;  1EUJ A;  2R61 A;  3SDZ A;  2HD3 A;  3KF6 A;  2JA8 H;  3PIP 3;  4NDX A;  1SNM A;  3PIP A;  4RFB A;  1HR0 W;  2OF1 A;  2K5D A;  3QJY A;  3BG3 A;  5CYU A;  1I94 L;  3BDC A;  1B44 D;  1XJV A;  4A3D B;  3HOW G;  3I4L A;  5T1I A;  3EBE A;  3S24 A;  3Q0A A;  1PRT F;  2O5I C;  5EAY A;  3H3V H;  3ICE A;  4P74 A;  2F0P A;  3HOU B;  2R7Z B;  3CCJ A;  2GN5 A;  1S4Z A;  2MFI A;  3GTL B;  2AHO B;  4L5R C;  3QO2 A;  4RA8 A;  3KLR A;  4LFC Q;  3BJU A;  5EKK A;  4MIU A;  5KYL A;  1UEA B;  4OO1 I;  2JSO A;  2B39 A;  4JI5 Q;  4LF9 L;  5HGQ A;  1STH A;  3NEM A;  1H95 A;  2EYL A;  3C3L A;  4RCO A;  1DOL A;  1VQK A;  3HOW B;  5BN4 A;  1CHP D;  1IW7 C;  5KYI A;  4I7Z C;  2AWO A;  3S14 H;  4YHH Q;  4XQQ A;  1U4M A;  3OWE B;  3K57 A;  1NTG A;  2D9U A;  1TS3 A;  4QUC A;  1G2S A;  1DCZ A;  1KTK A;  5IYD H;  5C4X G;  1M4V A;  2ZXR A;  2X69 A;  4DK3 C;  4K0K Q;  4P72 A;  1L0Y B;  3MFG A;  2F0S A;  1M8A A;  1QB5 D;  2ZM6 Q;  2X6G A;  2NBF A;  3BVG A;  5M5Y B;  4DR6 Q;  5COY A;  1WCM H;  3CC4 A;  3PGZ A;  2F0V A;  3NUC A;  1E2Z A;  3AEV A;  3J81 c;  1X3G A;  1ONL A;  3PUY A;  4XIG S;  2HT1 A;  4JI2 L;  4AH6 A;  5FLM G;  4JI0 Q;  2E76 C;  1Y1W G;  1TXY A;  3U4V A;  1G2T A;  4PQX A;  1SN8 A;  5G3L F;  1I4P A;  5IT9 L;  5ISR A;  1SR3 A;  3FDT A;  5CBA E;  2OCE A;  3CPF A;  3KYH C;  4DN4 M;  3OTO Q;  1ASZ A;  3K5O A;  4MHE A;  2F0D A;  4BY7 G;  1S72 A;  2V4D A;  5CR3 A;  1GUN A;  5C4X B;  2E2J H;  1EZ8 A;  4C1N K;  4I65 A;  3M3Y B;  4ULL A;  1PH8 A;  1G6Z A;  3ND8 A;  4LFA Q;  2P5Z X;  4JI7 L;  3J80 i;  1EIH A;  3NWS A;  4U68 A;  1D1K A;  1EIG A;  3L2P A;  1VQA A;  5KIX A;  2ICI A;  2OWO A;  2Q8I B;  2JA7 G;  2UXD L;  4DV5 L;  5JEA G;  1QCB D;  3I8Z A;  4ZKB B;  1ENA A;  3MEF A;  1Y1W B;  4DR7 Q;  3UI2 A;  5IWA Q;  2PZW A;  1RF2 D;  1K9M C;  2FMM A;  1TU2 B;  3KJP A;  1LT4 D;  3J7A V;  2NN6 I;  4S3S A;  1EFI D;  1I50 H;  4IJH A;  2L5T A;  4JCV E;  3PUX A;  4PZ8 A;  1VQM A;  2ZXP A;  5JAV A;  4CBV A;  1EYC A;  1M90 C;  4BY7 B;  4IPG A;  3A7A B;  2B8G A;  5A2Q L;  2XSC A;  2NWG A;  3FMC A;  1WTO A;  1ASY A;  4DK1 A;  3S1R H;  2JEB I;  1STB A;  2ZJP A;  4L8J A;  1NCV A;  4B08 A;  2WKC A;  4RGN A;  4WFN 3;  2JA7 B;  1QE6 A;  1DD2 A;  2SNS A;  2KEC A;  3CRL C;  3J81 i;  2OT2 A;  4BBS G;  3ERO A;  1FVI A;  2MO0 A;  4AQY L;  2Z1C A;  3JAM i;  4DFA A;  2RBM A;  5HY6 A;  4CJ1 B;  5TSS A;  1I3Q B;  4CDD C;  3GTJ H;  1YJW A;  3FRP B;  1I5F A;  1SE4 A;  4IPD A;  1D5X C;  1CK1 A;  3NEL A;  1HR0 Q;  4IFD H;  4GKK L;  1XXG A;  2XVS A;  4GLA C;  5E7N A;  1Y8O B;  1JJG A;  1K8A C;  1NSN S;  4DV7 Q;  5D3I B;  1HQR D;  3ULL A;  4LF4 L;  1F9P A;  1SFO H;  2DY8 A;  3TS2 A;  4HJ9 A;  1CT1 D;  1U4R A;  5BN5 A;  1M1K C;  2A74 C;  1S40 A;  2BH2 A;  2ZT9 C;  2BDN A;  4YCW A;  5H1S E;  4NB3 A;  3CAM A;  2B2W C;  1BNZ A;  4KTA A;  4F7X A;  1LTI D;  4OHJ A;  4HED A;  1G6P A;  3BZC A;  4BBS B;  3A8I E;  4DV0 L;  1EQQ A;  4KMU C;  1I4H A;  3TP6 A;  2G9D A;  2K28 A;  3M7G A;  3ERQ A;  1CKN A;  5C4H A;  5C5M A;  1QNK A;  4A3I H;  2WII B;  5IE8 A;  2FXQ A;  4A3K G;  2GA4 B;  1KXL A;  1LT3 D;  1T9H A;  3NBH B;  4KJN A;  4EQN A;  3KF8 B;  1KNE A;  5IGG A;  1Q82 C;  2HUG A;  5M3M G;  2L1B A;  2KCC A;  1QZH A;  1JT8 A;  2A6E C;  1YIT A;  3NXW A;  3GV6 A;  4N8F A;  3I4N G;  2WB1 B;  1RTN A;  4BY1 H;  1K8G A;  4WRD A;  2BCO A;  5ELB A;  1JQY D;  4HJ5 A;  3Q8D A;  2K5H A;  2XNA C;  1I6H H;  2VY3 A;  4LMQ D;  1PTO B;  1PTO F;  5C0X I;  2PYK A;  2C5C A;  1EYD A;  4B3T Q;  3WOE A;  3HOZ G;  3TSS A;  1Q7Y C;  1LTS D;  1TWH H;  1EYA A;  3CCU A;  5FLX E;  2YV5 A;  2K1B A;  3S17 B;  1V1P B;  4DNI A;  3DWP A;  3M7N A;  4XDX A;  3RZD H;  3DM1 A;  4QF4 A;  2EYO A;  1SEB D;  1HJP A;  2CWP A;  5IYB H;  1XNR L;  4A3K B;  2NB0 A;  2BE5 C;  1PTO C;  3EQL C;  3S16 B;  2NVY B;  1PRT D;  5FO9 B;  4RKL A;  1A2T A;  4HCE A;  4JI3 Q;  2B63 G;  1N33 L;  3PUV A;  5M3M B;  2FFK B;  2VQE L;  1YNX A;  3W3A A;  4K5X A;  2LSS A;  3I4N B;  2JA6 H;  1FJG Q;  4DKA C;  3EN2 A;  1RJT A;  3PF4 A;  1YZ6 A;  1SNO A;  1IW7 D;  1AH9 A;  4FF2 A;  1PMR A;  2Z8L A;  3LNN A;  3OIQ A;  5DNF A;  4NPS A;  4C3H G;  1JJC B;  5JPN C;  4OO1 H;  3K0X A;  2EPB A;  3PMF A;  4FNF A;  3HOZ B;  1B1Z A;  2EDG A;  4MNO A;  5LL6 S;  1HNW Q;  1HZC A;  1GUS A;  2D0P A;  3MXG A;  4DUY Q;  1OXX K;  3O13 A;  2BOS A;  2CVR A;  3PUW A;  4DR4 Q;  4IAL A;  4X3T A;  1YVC A;  1UE1 A;  4X3U A;  1PFS A;  3RUZ A;  3JC6 6;  5IYC G;  1LTL A;  1VF7 A;  3GV3 A;  5C44 G;  4DV2 Q;  4NXN Q;  4DR2 Q;  1PZK D;  2KHI A;  2B63 B;  1PDQ A;  3CU7 A;  2RHS B;  4X62 Q;  3FPP A;  4RG1 A;  1B4O A;  5DAU A;  4XYQ A;  4HAE A;  5CV5 A;  1C48 A;  2KVM A;  4UP7 A;  3S2D H;  2N3S A;  3C2P A;  2B29 A;  2CW0 C;  3H09 A;  1Q86 C;  5K36 H;  5I6W A;  2DNC A;  4JOI A;  1K28 A;  4C3H B;  2DJF C;  1IYV A;  1VQF A;  3BVM A;  4FXD A;  1MIU A;  5JEA J;  4RGM A;  1A6X A;  1NUC A;  3CKI B;  3K58 A;  3J80 L;  4LF6 Q;  3KF6 B;  2G5D A;  3J81 E;  4X65 L;  1NE3 A;  5HUR A;  1E2V A;  4ME3 A;  5G3L D;  2MO1 A;  1B2T A;  3JAM E;  5EKL A;  4GNX A;  1HTP A;  1ZXT A;  4HR7 B;  5KRU A;  5C44 B;  2Q2T A;  1FL0 A;  3CQZ H;  3CCL A;  5D14 A;  2LKV A;  2YYZ A;  1Q46 A;  1NY4 A;  4JK1 C;  4ME5 A;  4O2D A;  1A15 A;  2F3I A;  2Z6B A;  3GTG H;  5M5X H;  3TME A;  5FO7 B;  3VYT A;  4AYB G;  1MSG A;  2C35 B;  5J39 A;  4A3C H;  4LUZ A;  3E9H A;  1VDZ A;  4IUR A;  3TDQ A;  3H15 A;  2EIF A;  5I6Y A;  4R1J A;  1CSP A;  2EZV A;  1F2Y A;  2K04 A;  4MZ9 A;  3CC2 A;  3E3X A;  1KAA A;  4M1U B;  3MXN A;  5BR8 Q;  3IRB A;  5C5L A;  4F87 A;  1HCZ A;  4JW0 A;  4GN4 B;  4LF8 Q;  2UXC L;  3MC0 B;  2F0U A;  3F2U A;  3PCO B;  1XMO L;  1UUP A;  1TII D;  4BA1 I;  2ASB A;  4AYB B;  4HIO A;  2PI2 E;  1PV4 A;  1JOR A;  1L2F A;  2HIX A;  3BZD B;  4OON A;  3SK8 A;  3G48 A;  3LWU A;  4B3M L;  4K14 A;  3K5N A;  1CI3 M;  2A68 C;  1A3T A;  1L1O B;  2HQL A;  3R93 A;  3CCE A;  2SNM A;  4L63 B;  3A8K E;  2NTT A;  4J15 A;  4LAA A;  4IOA A;  4HIM A;  4IUN A;  3HOU H;  3CP0 A;  4XQJ A;  2R7Z H;  5JPM C;  5GQO A;  2N49 A;  3MXP A;  1EIF A;  1PFB A;  1MGS A;  1N9W A;  4KKU A;  3J7Z C;  4FDB A;  1HNX Q;  2C9O A;  1D7Q A;  3SR1 A;  1VS0 A;  3AU7 A;  1PH4 A;  1AW7 A;  1JE4 A;  4LW1 A;  4A3J B;  1IBL L;  1LAC A;  4H0L C;  3D6C A;  4X3S A;  1EEF D;  2DNE A;  1S5C D;  1KDC A;  4P73 A;  2CQO A;  1XNQ Q;  1XTC D;  2F4V Q;  4MTK A;  2HCC A;  4A3E G;  3BS1 A;  2QA4 A;  1R9T H;  3HOW H;  2QIL A;  1F77 A;  1VQH A;  2NZH A;  2AWN A;  2B2Y A;  2DY7 A;  3MXU A;  4BBR G;  5IGF A;  5AFW A;  1FNU A;  4IUU A;  3SK6 A;  3MEH A;  5ELF A;  1XMQ Q;  3MZ5 A;  1DYQ A;  3HZX A;  2KBN A;  1QVG A;  4K6D A;  4DV3 Q;  4KHV A;  4KN7 C;  1JMC A;  5LMN L;  4V0B A;  4A3M G;  3HG9 A;  1VQL A;  3VA5 A;  3DMU A;  1U5K A;  5JJI A;  4L5T A;  3OHX C;  1QUQ B;  1LO5 D;  3E0J A;  4LF7 Q;  5I9P A;  4HJ7 A;  2NTS A;  3GTP B;  3FKI H;  1P8L A;  1EOV A;  4A3E B;  3W2D A;  1CKM A;  5JJL A;  1PTO D;  1E0B A;  3GTK B;  2CCZ A;  1JWU D;  4C56 C;  4EVO A;  2K05 A;  3AQQ A;  1BDO A;  2XGT A;  4BBR B;  4ZRZ A;  5C0X H;  4Q5V A;  3P75 A;  1II3 A;  1WTW A;  2XIW A;  4C3J H;  2EE1 A;  3VR5 A;  2EVB A;  2Z4H A;  5C4X H;  1XPR A;  3M3Y H;  1JOQ A;  1H9R A;  2R3Z A;  3P1H A;  4AYB E;  4EQ5 A;  2F0Q A;  3NBI A;  4A3M B;  2HDL A;  2NYZ D;  1D2B A;  1I6V C;  2D0O A;  3K7A B;  3P7J A;  4NKL A;  4KHP L;  2RSN A;  1O7Y A;  2VQF L;  4R8I A;  1GVP A;  4R4I A;  2N88 A;  1WJJ A;  3NWT A;  1BF4 A;  2B2T A;  2L55 A;  1Q1B A;  5FLM H;  3GTM B;  4DNR B;  3S1M B;  1Y1W H;  4LUO A;  1E2W A;  1R4P B;  1SMX A;  3BDL A;  3H0G H;  1VQG A;  5HGT A;  4JI6 L;  4WOR A;  3RZO H;  3G6E A;  4IUP A;  5NUC A;  5CV6 A;  1KHI A;  4LFC L;  3QIA A;  1BOS A;  1E1O A;  3VYU A;  1C4Q A;  1VQ4 A;  4LNQ A;  2RQX A;  2Y0S E;  1VQE A;  4QB4 A;  1Q3L A;  4PZ7 A;  4HIK A;  2G9H D;  2UU9 Q;  2CW0 D;  1CKN B;  5ELC A;  2ZTC A;  2B2V A;  2JA7 H;  2EY1 A;  2BH8 A;  1IBK Q;  1KRS A;  1GUT A;  4O1N A;  4C3I G;  2SDF A;  2IX1 A;  4QIW B;  1JB3 A;  3DHQ A;  4FF1 A;  3HOV G;  2O5J C;  2ID0 A;  2F4I A;  1TWF B;  2NUC A;  2JYO A;  4JI1 Q;  1TWG H;  3HOY G;  1B9N A;  4R4Q A;  2Q8T A;  1E22 A;  3J80 c;  4KJO A;  4B3R Q;  5M3F H;  1GUO A;  1VQJ A;  1CM9 A;  5AJ3 L;  3KFU A;  3KBG A;  4TSS A;  1PH7 A;  1O7Z A;  2NVQ B;  4CHT B;  1MHW C;  3TS0 A;  3A54 A;  3I90 A;  4PNY A;  1X3Q A;  1KIX A;  3R8B A;  2ZTD A;  5EPK A;  5IP7 H;  1VMC A;  1CZG A;  3RLO A;  3VR6 A;  4K8I A;  4OXP A;  1PH9 A;  5IT9 E;  1XTD A;  5IP9 G;  2BA1 A;  1B8A A;  4C3I B;  4Y7N H;  4RCN A;  3UDG A;  1GJX A;  5E3F A;  3HOV B;  2PMZ E;  5JOB A;  3PQI A;  1KLU D;  5LMU Q;  3TRZ A;  1F9R A;  4ZLT F;  2ZJQ A;  1YNN D;  3U58 A;  4A93 G;  1SJE D;  2HQE A;  5M9O A;  3HOY B;  4DXG A;  3S1Q B;  1PYB A;  1AE3 A;  4GS3 A;  3SHL A;  2E5L L;  2L4N A;  1SYE A;  2RA4 A;  3J7Y W;  4ABN A;  4M8A A;  3GQB A;  1KRT A;  1PYW D;  2MPM A;  5DM6 3;  4GOP A;  1AP0 A;  3HKS A;  3KUP A;  2A6H C;  3DEP A;  3VR3 A;  2JA5 H;  1VQP A;  2RSO A;  3JAM c;  4F8M A;  5GAE C;  3GTQ B;  3FHW A;  3K5M A;  1SNP A;  4OEL B;  3ND9 A;  2KQ3 A;  1SRU A;  5A2Q E;  2A5H A;  1UAP A;  1S5D D;  4DU9 A;  3VR4 A;  3CMA A;  3DUZ A;  2RCN A;  2WKD A;  1TWC B;  4V19 0;  1VMP A;  4A76 A;  4A93 B;  3RR5 A;  4CJ2 C;  1LT6 D;  4DK0 A;  5D3D A;  4CDE C;  2OXP A;  1D5M C;  2PZT A;  4LF9 Q;  4N9P A;  4DUZ L;  3S16 H;  1K8M A;  4XTC S;  1JCK B;  3R2T A;  4ILW A;  4DAY A;  3BZK A;  1S5E D;  5FO8 B;  1HA5 A;  2XWJ B;  4J1M A;  1J5E L;  3K81 C;  4DR3 L;  1SJH D;  4QIW E;  3CHB D;  1K8O A;  3GTO H;  3K0Y A;  3ERS X;  3OW2 A;  4BS9 A;  4XT3 B;  2EYJ A;  3V2T A;  1D8L A;  1E1T A;  1YJ9 A;  2UXB L;  4JOI C;  3C1F A;  4HJ8 A;  2L11 A;  1HR0 L;  4QMG A;  3L3O C;  3D6W A;  1N34 L;  1UE5 A;  4JI8 L;  3U9O A;  1HZA A;  3N6R A;  1F2Z A;  1GKH A;  4QCL A;  4ZQ3 A;  2KOL A;  1JWM D;  2QKI C;  1X56 A;  1TWA H;  5EGT A;  1PH5 A;  3AYH B;  1BUV T;  4YY3 Q;  1NNX A;  4JI2 Q;  4Z9C B;  2K32 A;  3MTS A;  4NW2 A;  1ILP A;  2NVX H;  4NXM L;  2B63 H;  2CHB D;  2WAQ G;  2M9V A;  4B9X A;  2VUM G;  4JI4 L;  1Y8P B;  1WTX A;  4YWM A;  1FGB D;  2F1M A;  3MXN B;  3V05 A;  5FK9 C;  1VQ9 A;  1XPO A;  3SK4 A;  1VQI A;  2PQA A;  3T13 A;  4H44 C;  1GOZ A;  1I4R A;  1HUM A;  4JV5 L;  4RGO S;  2K5N A;  2WAC A;  4JG2 A;  4OGQ C;  4OWT B;  4UP9 A;  1O7I A;  3T1Y Q;  1A3U A;  3J81 j;  3HOX H;  3CME A;  3J7A F;  1RL2 A;  1IXR A;  2VZA A;  3VR2 A;  4JI7 Q;  1PH3 A;  2F52 A;  4GKJ L;  1RTO A;  1PA6 A;  2K5Q A;  3E5S A;  1B7Y B;  5FJ8 H;  4A3F H;  1FNW A;  3TEH B;  4OWW B;  1F9Q A;  1Y69 U;  2UXD Q;  1V1Q A;  4DV5 Q;  2Q2H A;  5J3B A;  2VL6 A;  1UE7 A;  2A69 D;  2VXW A;  1JOK A;  1E3P A;  2K5W A;  2I5M X;  2WV6 D;  1Q81 C;  2K14 A;  3I7F A;  2WAQ B;  2VUM B;  3I3C A;  4TQU S;  1E24 A;  3FVQ A;  2Z6K A;  4BXX H;  2F0N A;  4G7Z C;  1WD1 A;  2EJF C;  3U4Z A;  4G57 A;  4J6H A;  5C4J H;  3TN2 A;  2ZJR A;  4DV1 L;  3HGB A;  1WCM G;  2E75 C;  2M00 A;  3F8T A;  3HP3 A;  1CUK A;  1IZ6 A;  1DM0 B;  2A19 A;  4ODG A;  3H3V C;  1Y1V H;  3HKZ G;  4UPA A;  3RD4 A;  3SK5 A;  2F3V A;  1O80 A;  2JE6 I;  2N55 A;  3A0J A;  3PO3 H;  4P2C B;  4GN5 A;  1LTA D;  4H13 C;  1EU3 A;  1QWY A;  1S5F D;  1C0A A;  5GAG C;  3H94 A;  1STY A;  1W6K A;  2MP1 A;  3S14 B;  4OIJ A;  1ROD A;  4AQY Q;  1IKL A;  2UUA Q;  2I5H A;  2FMC A;  5LL6 X;  2R93 H;  1GUW A;  4POG A;  3F2C A;  4K2K A;  3F1Z A;  4O0A A;  1LTR D;  2F0M A;  1PH2 A;  4GKK Q;  1VQ7 A;  1H9S B;  1HNW L;  1QJO A;  3RMH A;  4QL5 A;  1BXT A;  3NTH A;  3FP9 A;  4CKB A;  4DR4 L;  2LS0 1;  5I2X A;  5DLQ E;  1PZI D;  5CMD A;  1TS5 A;  3K59 A;  3HKZ B;  4DR5 Q;  3RN5 A;  2KCN A;  2XWB B;  1K0R A;  4JPB W;  2B2Y C;  1K0S A;  5I2Y A;  1FNV A;  5EJW A;  2MQH A;  4WJW A;  3VA7 A;  1BBW A;  4K5V A;  1CA5 A;  3KLS X;  5KNB A;  4HSP A;  1HQM C;  1AEX A;  2E2J B;  1H9M A;  4DV6 L;  1TY0 A;  4X64 Q;  4A3J H;  3J80 E;  2HHH L;  2OQ0 A;  4G7O C;  3P20 A;  2WIN B;  1LAB A;  2NVT H;  1EY5 A;  3RLF A;  4FF3 A;  4LUV A;  1LTT D;  3KK7 A;  1BQQ T;  1TT2 A;  4R4O A;  2CQA A;  1OXV A;  2DJG C;  2MJ8 A;  3T53 B;  2WAQ E;  2Z4I A;  5EPJ A;  3UE1 A;  3K5L A;  4QGU A;  2V1C C;  3PF5 A;  2AUK A;  2A6H D;  4ZCK A;  4IFD G;  3I4O A;  5C4Z A;  1LTB D;  1I50 B;  3K7U C;  4FF4 A;  1N32 L;  4ALP A;  1SRO A;  2J7Z A;  4ZKC B;  2QEX A;  1WI5 A;  4KHZ A;  3AMU A;  1PFM A;  1G29 1;  4R4C A;  5M5W H;  1SBB B;  1T5E A;  4BA2 I;  5FLX L;  3V96 A;  2F0W A;  4EQP A;  5JVG 3;  1BCP B;  1BCP F;  3D4D A;  1XNR Q;  2K52 A;  2IY5 B;  1QVC A;  2JXM B;  4YWK A;  1HPC A;  1A63 A;  2H1E A;  2E2H B;  3QOL A;  4LFB L;  2QCP X;  1RHP A;  1N33 Q;  5IT9 c;  4KKS A;  2VQE Q;  1PHJ A;  4X3K A;  3S2H H;  3PUZ A;  4A3B G;  4X66 Q;  4BBR H;  1MSH A;  1YEZ A;  1BCP C;  3MA2 B;  5ELO A;  3T1H Q;  1IBM L;  2K50 A;  1DOK A;  1G8Z D;  3NPP A;  4A3I G;  5D65 A;  4KI0 A;  4YIJ A;  1YNJ C;  2ALY B;  2Q8R E;  4DV4 L;  4H02 A;  2KJX A;  4A3M H;  1OXT A;  2Z0S A;  4YCU A;  3H91 A;  2EYH A;  3Q22 A;  2YTX A;  5C3X A;  4GZY C;  1TY2 A;  5LMN W;  1IYJ B;  3GDE A;  1HNZ L;  1X54 A;  3HKZ E;  1CQV A;  2F03 A;  2OTL A;  2R92 H;  2CH4 W;  4BY1 G;  3ZYY X;  5CBE E;  1JB7 A;  4DPG A;  3S1M H;  2YU9 H;  2I07 B;  2L0C A;  4EX5 A;  1SXT A;  4CKC A;  4LWC A;  5IOD A;  1SYD A;  2YTV A;  4YCV A;  3KJO A;  2Z9H A;  4A3B B;  4DAP A;  1SYF A;  4B3S L;  2NN6 H;  3L0O A;  1GD7 A;  3PSI A;  2CKZ B;  1A62 A;  3DXJ C;  2E8G A;  3L7Z C;  1GHK A;  2Y0S G;  2RHQ B;  2F0O A;  1PVO A;  5C6A A;  4KY7 A;  4DR1 L;  3TP7 A;  1HTL D;  1ENF A;  4KY6 A;  4X65 Q;  2EXD A;  2JA6 G;  4A3D H;  1JR0 D;  4BY1 B;  1BVS A;  2A73 B;  1UEB A;  1K83 B;  1XMQ L;  4JBW A;  2K4K A;  2LMC B;  3GP7 A;  2B2W A;  4KKT A;  1J9O A;  4K8J A;  4TVA B;  1Q8K A;  1IKM A;  4Q0F A;  1N36 L;  2ZXO A;  5A35 A;  3H6M A;  1TWH B;  1VQC A;  3GTL H;  3MAQ A;  1VQ5 A;  1AE2 A;  1LT5 D;  3RZD B;  1EZ6 A;  1WTP A;  1L0X B;  2R7F A;  1HRJ A;  2F0G A;  3LX0 A;  1DZ1 A;  2F0I A;  2Y0S B;  2F3W A;  4HTH A;  2O2L D;  2RDH A;  1V1O A;  4A75 A;  1EOT A;  3VYR A;  2IPK D;  1STA A;  2JA6 B;  2L15 A;  4DAY B;  3CRK C;  2HCI A;  4HCS A;  1TS4 A;  3TP5 A;  3IAY A;  2SEB D;  1YHA A;  5K36 G;  3TZU A;  2UXC Q;  3RNU A;  2A6E D;  2R6G A;  3NBH A;  3NEN A;  1U4P A;  1I4X A;  3HOY H;  3QB3 A;  4OWX B;  1ICW A;  3KF8 A;  1XMO Q;  2E2D C;  3I4M G;  3S1Q H;  2UUB L;  1KAW A;  2L9H A;  4O42 A;  1GUG A;  2O4X A;  1XX8 A;  5GAD C;  4JYA L;  5M5Y H;  5I4D A;  1I4G A;  4A3L G;  1JIC A;  3OOC A;  2LXK A;  1EY0 A;  5C3E G;  3M4O B;  3Q23 A;  3RN2 A;  1VF5 C;  2IX3 A;  3T16 A;  1IL8 A;  2B3G A;  4UDU C;  3G4S A;  2PW7 A;  3GTQ H;  2M2L A;  1LLR D;  2L12 A;  1N8R C;  3TQY A;  1EWI A;  2BE5 D;  1CKO A;  1V1P A;  3S2D B;  3NQI A;  4R9W A;  2XRS D;  4OX9 L;  3S15 B;  3CXC A;  4LF5 Q;  4RHS A;  1RD9 D;  2AUJ D;  5K5P A;  1SYB A;  2PMZ B;  3X3M A;  4A3G G;  2PQA B;  4DAM A;  2UU9 L;  1YI2 A;  4OIK A;  1IHZ A;  3I4M B;  4Y52 H;  1IBL Q;  1VQD A;  4IUV A;  3SXH A;  3K80 C;  1QNU A;  1RKN A;  1IBK L;  1ILQ A;  4FXK C;  5C3E B;  4B9W A;  1MI2 A;  4PG3 A;  2CFM A;  4ZYS A;  4IFD J;  1BO0 A;  1H9K A;  1VCI A;  1S3O A;  2DUD A;  2RDF A;  3Q6S A;  4FVM A;  4C2M B;  1U0L A;  1CSQ A;  3GTG B;  4K6L A;  1KAB A;  5M5X B;  1CTM A;  1Z7T A;  4POF A;  2F0L A;  4QJF A;  5LMN Q;  3L9A X;  3AB9 A;  1B70 B;  1ZKO A;  2AQ1 B;  3N52 A;  1EFW A;  3U50 C;  2KHJ A;  4A3G B;  2EY6 A;  4BY7 H;  1C8C A;  4IN3 A;  5CV4 A;  1F2M A;  2KCT A;  4JI5 L;  1L0W A;  1XYI A;  4K2L A;  5F2D A;  4HSV A;  4FP5 D;  5CV8 A;  4GN3 B;  4F88 A;  5IGD A;  2E2I B;  3BVZ A;  2D5D A;  1STN A;  2BDO A;  5IGE A;  5I9O A;  2IX0 A;  3TZD A;  2Z6K C;  1K3R A;  1KDB A;  5JEA H;  1DOM A;  4R8N A;  1CHQ D;  5ELE A;  4YHH L;  3NTI A;  3WWV A;  1G51 A;  1I3Q H;  1EL0 A;  1PYS B;  5EPL A;  4K0K L;  1BCP D;  3OIP A;  2D2C C;  3M85 A;  1W2B A;  2R7D A;  2ZM6 L;  3I91 A;  2UUC Q;  3WDN A;  2IHF A;  4DR6 L;  1LV9 A;  5KGU A;  1YNJ D;  3NK9 A;  3BYY B;  2IL8 A;  3OYY A;  4KHP Q;  2VQF Q;  1VQB A;  1XPU A;  5L37 A;  5IGB A;  1D5Z C;  2PZU A;  2PO4 A;  1PRT B;  3VDY A;  5J22 A;  2H4O A;  4JI0 L;  2TSS A;  3GD7 A;  4GLV B;  1J6Q A;  2JP1 A;  1I4Q A;  3SVM A;  2VUM H;  3CCQ A;  3BYT B;  1D1I A;  1HXY D;  4JI6 Q;  4BBS H;  3OTO L;  3PO2 G;  5ELD A;  3W1G A;  3KDF A;  2OQK A;  1LUZ A;  1SMY C;  2WFW A;  3R2I A;  1VQ8 A;  2PNH A;  1HH2 P;  1IYU A;  1PRT C;  4LK1 C;  2JEA I;  4JVZ A;  1RIP A;  5J1Z A;  4KD3 A;  4AIM A;  4LFA L;  4DK6 C;  3S1N B;  3UDF A;  3FKI G;  3UDX A;  3D0F A;  1BBU A;  1VQN A;  2VB3 X;  1FD7 D;  1R9T B;  1X55 A;  2I0Q A;  4RAU C;  1I94 Q;  4RWS C;  1JC7 A;  2IT1 A;  5C0X G;  5LHY 1;  2MUY A;  3CPW A;  4DR7 L;  4C3J G;  1JWS D;  1EY6 A;  5IWA L;  4KD4 A;  1CQF A;  3OSO A;  4OEM B;  2VW9 A;  2A68 D;  1DXM A;  1B53 A;  1EY9 A;  3CW2 C;  3D4R A;  4NP5 A;  1WTV A;  1K73 C;  1BBX C;  1PTO H;  1ET9 A;  4EGV A;  3CD6 A;  3ULJ A;  4RGT A;  1DGS A;  3PO2 B;  1VQO A;  4P71 A;  2AQ3 B;  1L1O A;  4N9T A;  5AJ3 Q;  4PV1 C;  3S17 H;  2F0H A;  3NHH A;  4YY3 L;  1NAP A;  3R3O A;  3C46 A;  1X3P A;  1Y14 B;  3FKI B;  4A3K H;  2H5X A;  2NVY H;  3AFQ A;  4APV A;  3H0G G;  1CZW A;  1EU4 A;  5M3M H;  1HZB A;  4NMZ A;  3CF5 A;  1ET6 A;  3I4N H;  1YIJ A;  2B2U A;  4C3J B;  1YHB A;  4L5S A;  4ZAI A;  3E0E A;  1UWV A;  3K6O A;  4GNX B;  3T1Y L;  2PW5 A;  3PIO 3;  1ZYR C;  3PIO A;  5IIF A;  4DV7 L;  1WYD A;  1W6J A;  3I73 A;  2JA8 G;  1Z9F A;  4CDC C;  3HOZ H;  1OXU A;  1UNS A;  4PMC A;  3HEJ A;  4IUT A;  2E5L Q;  3I70 A;  1Q90 A;  2QF7 A;  2FIN B;  2I46 A;  3ER0 A;  4GNX C;  3J7A 5;  1K3B C;  5GRO A;  3SE0 A;  3H0G B;  4KK7 A;  1DJR D;  1KLG D;  2D62 A;  2AMC B;  2K01 A;  1D6E C;  3RZO B;  4RKB A;  3EFX D;  2Q2I A;  3EIV A;  5KEE A;  3I2Z A;  3OWF A;  5M3F G;  1O78 A;  1QUQ A;  1HUN A;  1BR9 A;  1JOO A;  3FPU B;  4LJZ C;  3KLS A;  3DM3 A;  3OMG A;  1MJC A;  1V9P A;  3HS0 C;  5DEH A;  3Q24 A;  1X6O A;  2IW3 A;  4C3H H;  2XTI A;  3OW7 A;  2JA8 B;  5IP7 G;  5JJK A;  3E6Z X;  3UE0 A;  4DUZ Q;  4ZUI A;  3KOJ A;  1RDP D;  2F0J A;  2JQO A;  4XT1 B;  2E2H H;  2LFN A; 
#chains in the Genus database with same CATH homology
 1EEI D;  2QDB A;  1A2U A;  4EQO A;  1TWG B;  1GXD C;  2RVL A;  1AZP A;  2EXZ A;  5M3F B;  3HRZ C;  4TKO B;  3DEO A;  2XN9 C;  2AQ2 B;  4XQN A;  1WD0 A;  1RCV D;  1PFN A;  3WOF A;  1TS2 A;  1HA6 A;  4RHR A;  3A55 A;  1FR3 A;  2K33 A;  4Y7N B;  1PLF A;  1Z6H A;  5EKI A;  1ENC A;  4PMW A;  3MVV A;  1MBY A;  2KEE A;  1HFG A;  1T5X D;  3A8J E;  3PV0 A;  3QOJ A;  3C1E A;  3U9S A;  5JJZ A;  3TBI B;  3FEW X;  3IKJ A;  2OEO A;  2EYM A;  4TRD A;  1WCM B;  1SND A;  1EQV A;  1AN8 A;  1QOH A;  3TP8 A;  2JA5 B;  3G6J B;  3EA6 A;  4BWG B;  3I72 A;  4HN7 A;  1F2L A;  1S5B D;  3KBX A;  4UAI A;  4HMI A;  1B50 A;  4ZK9 B;  3T56 B;  2BA0 A;  2EY5 A;  5IGC A;  2EJG C;  2KHS A;  2K6A A;  4DNT B;  4H7B A;  1B3A A;  2EOT A;  2SOB A;  2KUM A;  1SMY D;  5FOB B;  2LY7 A;  5CGK A;  1WTQ A;  1SDF A;  3NP8 A;  1NR2 A;  5C0X J;  1SE3 A;  4DGZ A;  1KNA A;  1KDA A;  3GTO B;  1ESF A;  2HDM A;  1A3V A;  1STE A;  3NSW A;  1HHV A;  3EJI A;  1O7L A;  5CV9 A;  2RKS A;  1F9S A;  1CA6 A;  1OXS C;  4C1N I;  1SE2 A;  1Z47 A;  3T51 B;  3SEB A;  2KA7 A;  5T1G A;  1TWA B;  1EY7 A;  3MFY A;  1EQT A;  4IZ8 A;  3S1R B;  2B2T C;  2XRQ D;  1EY4 A;  4KN4 C;  2NVX B;  2X6L A;  2PCF B;  1HFN A;  2EYF A;  4OL7 A;  1SYG A;  3NQT A;  1EWC A;  4FO2 A;  2IWH A;  5E4W C;  3GTJ B;  3OPO A;  3IFD A;  1SNQ A;  3T4A C;  3URY A;  3HOX B;  4QUF A;  5KNC A;  3G7L A;  1SFO B;  1XWE A;  1ZYR D;  4A3F B;  1PZJ D;  2B2V C;  5EQ0 A;  4G7H C;  3D3R A;  1EY8 A;  3VYS A;  3BDO A;  1GHJ A;  1SNC A;  5JVH 3;  1J8I A;  2E74 C;  1EWH A;  5KND A;  2PPB C;  2J0T D;  1SAP A;  4FYD A;  1TKW B;  3D31 A;  5C4J B;  4CGY B;  1TVX A;  1Y1V B;  1WTR A;  4A3I B;  4DXF A;  5CV7 A;  5IOC A;  3PO3 B;  1G91 A;  3OMC A;  1TQO A;  2F0E A;  3MWY W;  2F0T A;  3A7L A;  3QG1 A;  3QWN A;  1YNN C;  1U9R A;  2MGS A;  3J81 L;  2R93 B;  1H9J A;  1LTG D;  3GO5 A;  3JAM L;  2VB2 X;  2EJM A;  1I6H B;  5E1F A;  5CC4 A;  4OO1 G;  1SSO A;  4DF7 A;  4IQZ A;  4CKE A;  1Q1E A;  3D4W A;  3A56 A;  1X32 A;  4J8Q A;  1TR5 A;  1Y8N B;  1FYC A;  1V8Q A;  4PMB A;  2EYP A;  4G4K A;  3LWE A;  3ITP A;  5C3W A;  2B8F A;  4HMJ A;  4E6I A;  4ID6 A;  5BN3 A;  1SYC A;  2NVT B;  3M4Y A;  2PQE A;  1WVL A;  1OO9 B;  1Q12 A;  1ML0 D;  2PNR C;  1AFP A;  1Q8I A;  2FHT A;  2B2U C;  3DWA A;  1H9S A;  5EBD A;  1V43 A;  1AZQ A;  2ENB A;  1R4Q B;  1NR4 A;  1U4L A;  5EBC A;  4KY5 A;  2TMP A;  1DON A;  3NE5 B;  4FXG C;  5M5W B;  4IFD I;  3IL8 A;  1CFM A;  4L6T B;  4DA2 A;  3D8G A;  2ICE C;  2DN8 A;  2QEJ C;  5COR A;  4K5W A;  1ESR A;  4XYO A;  4IUQ A;  2F0K A;  2VNU D;  3S2H B;  2NZ1 D;  3NTK A;  3ONA B;  3CQZ B;  2NN6 G;  2EY2 A;  5E4X A;  3X3N A;  5FKA C;  4ZUJ A;  1QG7 A;  1B9M A;  3DWQ A;  2K03 A;  2A69 C;  1MD2 D;  1PXU A;  3MHB A;  1STG A;  2IJ0 A;  2K7V A;  4MN3 A;  2R92 B;  2RDG A;  4CJ0 B;  4RH6 A;  4DAV A;  2YU9 B;  1QIL A;  2F0F A;  1ZEQ X;  3IFT A;  4U67 3;  2MHV A;  3EVQ A;  3S9W A;  2FJ2 A;  5DM7 3;  4KV6 A;  2J4X A;  2KED A;  2WP8 J;  4XXE A;  2R61 A;  3SDZ A;  3PIP 3;  4NDX A;  1SNM A;  4RFB A;  2OF1 A;  2K5D A;  3QJY A;  3BG3 A;  5CYU A;  3BDC A;  1B44 D;  4A3D B;  3I4L A;  5T1I A;  3Q0A A;  1PRT F;  2O5I C;  3HOU B;  2F0P A;  2R7Z B;  1S4Z A;  3GTL B;  3QO2 A;  4RA8 A;  3KLR A;  5EKK A;  4MIU A;  5KYL A;  1UEA B;  4OO1 I;  2JSO A;  2B39 A;  1STH A;  2EYL A;  3C3L A;  4RCO A;  1DOL A;  3HOW B;  5BN4 A;  1CHP D;  1IW7 C;  5KYI A;  4I7Z C;  2AWO A;  4XQQ A;  1U4M A;  3OWE B;  3K57 A;  2D9U A;  4QUC A;  1TS3 A;  1G2S A;  1DCZ A;  1KTK A;  1M4V A;  2ZXR A;  2X69 A;  1L0Y B;  3MFG A;  2F0S A;  1M8A A;  1QB5 D;  2X6G A;  2NBF A;  3BVG A;  5M5Y B;  5COY A;  2F0V A;  3NUC A;  1E2Z A;  1ONL A;  3PUY A;  4XIG S;  2E76 C;  1G2T A;  4PQX A;  5G3L F;  1I4P A;  5IT9 L;  5ISR A;  3FDT A;  5CBA E;  4DN4 M;  3K5O A;  4MHE A;  2F0D A;  2V4D A;  5CR3 A;  1GUN A;  5C4X B;  1EZ8 A;  4C1N K;  4I65 A;  3M3Y B;  4ULL A;  1G6Z A;  3ND8 A;  1EIH A;  3NWS A;  4U68 A;  1D1K A;  1EIG A;  5KIX A;  2ICI A;  2Q8I B;  5JEA G;  1QCB D;  3I8Z A;  4ZKB B;  1ENA A;  1Y1W B;  3UI2 A;  2PZW A;  1RF2 D;  2FMM A;  1TU2 B;  3J7A V;  1LT4 D;  2NN6 I;  4S3S A;  1EFI D;  2L5T A;  3PUX A;  2ZXP A;  5JAV A;  4CBV A;  1EYC A;  4BY7 B;  3A7A B;  2B8G A;  5A2Q L;  2XSC A;  2NWG A;  3FMC A;  1WTO A;  4DK1 A;  2JEB I;  1STB A;  4L8J A;  1NCV A;  4B08 A;  2WKC A;  4RGN A;  4WFN 3;  2JA7 B;  1QE6 A;  1DD2 A;  2SNS A;  2KEC A;  3CRL C;  2OT2 A;  3ERO A;  2Z1C A;  4DFA A;  2RBM A;  4CJ1 B;  5TSS A;  1I3Q B;  3FRP B;  1SE4 A;  1D5X C;  1CK1 A;  4IFD H;  1XXG A;  2XVS A;  1Y8O B;  1NSN S;  5D3I B;  1HQR D;  1F9P A;  2DY8 A;  1CT1 D;  1U4R A;  5BN5 A;  2A74 C;  2ZT9 C;  2BDN A;  2B2W C;  1BNZ A;  4KTA A;  4F7X A;  1LTI D;  4OHJ A;  4HED A;  4BBS B;  3A8I E;  4KMU C;  1I4H A;  3TP6 A;  2G9D A;  2K28 A;  3M7G A;  3ERQ A;  5C4H A;  5C5M A;  1QNK A;  2WII B;  2GA4 B;  1LT3 D;  4KJN A;  4EQN A;  5IGG A;  1KNE A;  2HUG A;  2L1B A;  2KCC A;  2A6E C;  3NXW A;  3GV6 A;  2WB1 B;  1RTN A;  4WRD A;  2BCO A;  5ELB A;  1JQY D;  2XNA C;  4LMQ D;  1PTO B;  1PTO F;  5C0X I;  2PYK A;  2C5C A;  1EYD A;  3WOE A;  3TSS A;  1LTS D;  1EYA A;  5FLX E;  2K1B A;  3S17 B;  1V1P B;  3DWP A;  3M7N A;  4XDX A;  3DM1 A;  4QF4 A;  2EYO A;  1SEB D;  4A3K B;  2NB0 A;  2BE5 C;  1PTO C;  3EQL C;  3S16 B;  2NVY B;  1PRT D;  5FO9 B;  4RKL A;  1A2T A;  4HCE A;  3PUV A;  5M3M B;  2FFK B;  3W3A A;  4K5X A;  3I4N B;  1RJT A;  1SNO A;  1IW7 D;  4FF2 A;  1PMR A;  2Z8L A;  3LNN A;  3OIQ A;  5DNF A;  4C3H G;  4OO1 H;  5JPN C;  2EPB A;  3PMF A;  4FNF A;  3HOZ B;  1B1Z A;  2EDG A;  5LL6 S;  1GUS A;  3MXG A;  1OXX K;  3O13 A;  2BOS A;  2CVR A;  3PUW A;  4IAL A;  4X3T A;  4X3U A;  3RUZ A;  1VF7 A;  3GV3 A;  1PZK D;  2B63 B;  1PDQ A;  3CU7 A;  3FPP A;  1B4O A;  5DAU A;  4XYQ A;  4HAE A;  5CV5 A;  1C48 A;  2KVM A;  3C2P A;  2CW0 C;  3H09 A;  5K36 H;  5I6W A;  2DNC A;  4C3H B;  1IYV A;  3BVM A;  4FXD A;  5JEA J;  4RGM A;  1A6X A;  1NUC A;  3CKI B;  3K58 A;  3J80 L;  3J81 E;  5HUR A;  1E2V A;  5G3L D;  1B2T A;  3JAM E;  5EKL A;  1HTP A;  1ZXT A;  4HR7 B;  5KRU A;  5C44 B;  5D14 A;  2LKV A;  2YYZ A;  4JK1 C;  4ME5 A;  1A15 A;  3TME A;  5FO7 B;  3VYT A;  1MSG A;  5J39 A;  1VDZ A;  4IUR A;  3TDQ A;  5I6Y A;  2EZV A;  1F2Y A;  2K04 A;  1KAA A;  4M1U B;  3MXN A;  5C5L A;  4F87 A;  1HCZ A;  3MC0 B;  2F0U A;  3F2U A;  1UUP A;  1TII D;  4BA1 I;  4AYB B;  1JOR A;  3BZD B;  3SK8 A;  3LWU A;  4K14 A;  3K5N A;  1CI3 M;  2A68 C;  1A3T A;  3R93 A;  2SNM A;  4L63 B;  3A8K E;  2NTT A;  4LAA A;  4IUN A;  4XQJ A;  5JPM C;  3MXP A;  1PFB A;  1MGS A;  4KKU A;  2C9O A;  3SR1 A;  3AU7 A;  1AW7 A;  1JE4 A;  4A3J B;  1LAC A;  4H0L C;  3D6C A;  4X3S A;  1EEF D;  2DNE A;  1S5C D;  1KDC A;  1XTC D;  2HCC A;  3BS1 A;  2QIL A;  1F77 A;  2AWN A;  2B2Y A;  2DY7 A;  3MXU A;  5IGF A;  5AFW A;  1FNU A;  4IUU A;  3SK6 A;  3MEH A;  5ELF A;  3MZ5 A;  1DYQ A;  3HZX A;  4K6D A;  4KHV A;  4KN7 C;  4V0B A;  3HG9 A;  3VA5 A;  3DMU A;  3OHX C;  1LO5 D;  3E0J A;  5I9P A;  2NTS A;  3GTP B;  4A3E B;  3W2D A;  1PTO D;  1E0B A;  3GTK B;  1JWU D;  4C56 C;  4EVO A;  2K05 A;  1BDO A;  4BBR B;  5C0X H;  4ZRZ A;  4Q5V A;  3P75 A;  1II3 A;  1WTW A;  2XIW A;  2EE1 A;  3VR5 A;  2EVB A;  2Z4H A;  1JOQ A;  1H9R A;  2R3Z A;  3P1H A;  2F0Q A;  3NBI A;  4A3M B;  2HDL A;  2NYZ D;  1D2B A;  1I6V C;  3K7A B;  3P7J A;  4NKL A;  2RSN A;  1O7Y A;  4R8I A;  2N88 A;  3NWT A;  1BF4 A;  2B2T A;  2L55 A;  1Q1B A;  3GTM B;  4DNR B;  3S1M B;  1E2W A;  1R4P B;  3BDL A;  5HGT A;  4WOR A;  4IUP A;  5NUC A;  5CV6 A;  3QIA A;  1BOS A;  3VYU A;  1C4Q A;  2RQX A;  4QB4 A;  1Q3L A;  2G9H D;  2CW0 D;  5ELC A;  2B2V A;  2EY1 A;  1GUT A;  4O1N A;  4C3I G;  2SDF A;  2IX1 A;  4QIW B;  1JB3 A;  3DHQ A;  4FF1 A;  2O5J C;  2ID0 A;  2F4I A;  1TWF B;  2NUC A;  2JYO A;  1B9N A;  2Q8T A;  4KJO A;  1GUO A;  1CM9 A;  3KBG A;  4TSS A;  1O7Z A;  2NVQ B;  4CHT B;  3A54 A;  3I90 A;  4PNY A;  1X3Q A;  3R8B A;  5EPK A;  1VMC A;  1CZG A;  3VR6 A;  4K8I A;  5IT9 E;  2BA1 A;  4C3I B;  4RCN A;  1GJX A;  5E3F A;  3HOV B;  5JOB A;  1KLU D;  4ZLT F;  1F9R A;  1YNN D;  1SJE D;  2HQE A;  5M9O A;  3HOY B;  4DXG A;  3S1Q B;  3SHL A;  2L4N A;  1SYE A;  2RA4 A;  3J7Y W;  4ABN A;  4M8A A;  3GQB A;  1PYW D;  2MPM A;  5DM6 3;  1AP0 A;  3KUP A;  2A6H C;  3DEP A;  3VR3 A;  2RSO A;  4F8M A;  3GTQ B;  3K5M A;  1SNP A;  3ND9 A;  2KQ3 A;  5A2Q E;  2A5H A;  1UAP A;  1S5D D;  4DU9 A;  3VR4 A;  3DUZ A;  2WKD A;  1TWC B;  4V19 0;  1VMP A;  4A93 B;  4CJ2 C;  1LT6 D;  4DK0 A;  5D3D A;  2OXP A;  1D5M C;  2PZT A;  4N9P A;  1K8M A;  4XTC S;  1JCK B;  3R2T A;  4ILW A;  4DAY A;  5FO8 B;  1S5E D;  1HA5 A;  2XWJ B;  4J1M A;  1SJH D;  3CHB D;  1K8O A;  3K0Y A;  4BS9 A;  4XT3 B;  2EYJ A;  3V2T A;  3C1F A;  2L11 A;  4QMG A;  3L3O C;  3D6W A;  3U9O A;  3N6R A;  1F2Z A;  4QCL A;  4ZQ3 A;  2KOL A;  1JWM D;  2QKI C;  5EGT A;  1BUV T;  4Z9C B;  2K32 A;  3MTS A;  4NW2 A;  1ILP A;  2CHB D;  2M9V A;  4B9X A;  1Y8P B;  1WTX A;  1FGB D;  2F1M A;  3V05 A;  5FK9 C;  3SK4 A;  3T13 A;  4H44 C;  1GOZ A;  1I4R A;  1HUM A;  4RGO S;  2WAC A;  4OGQ C;  1A3U A;  3J7A F;  3VR2 A;  1RTO A;  2K5Q A;  3E5S A;  1FNW A;  1F9Q A;  1Y69 U;  2A69 D;  2VXW A;  1JOK A;  2K5W A;  2WV6 D;  2WAQ B;  2VUM B;  3I3C A;  4TQU S;  3FVQ A;  2F0N A;  4G7Z C;  1WD1 A;  2EJF C;  4G57 A;  4J6H A;  3TN2 A;  3HGB A;  2M00 A;  2E75 C;  3HP3 A;  1DM0 B;  4ODG A;  3H3V C;  3RD4 A;  3SK5 A;  2F3V A;  1O80 A;  2JE6 I;  2N55 A;  4P2C B;  1LTA D;  4H13 C;  1EU3 A;  1QWY A;  1S5F D;  3H94 A;  1STY A;  1W6K A;  2MP1 A;  3S14 B;  4OIJ A;  1ROD A;  1IKL A;  2FMC A;  5LL6 X;  1GUW A;  4K2K A;  1LTR D;  2F0M A;  1H9S B;  1QJO A;  3RMH A;  1BXT A;  3NTH A;  4CKB A;  2LS0 1;  5I2X A;  1PZI D;  5CMD A;  1TS5 A;  3K59 A;  3HKZ B;  2KCN A;  2XWB B;  2B2Y C;  5I2Y A;  1FNV A;  5EJW A;  4WJW A;  3VA7 A;  4K5V A;  1CA5 A;  3KLS X;  5KNB A;  4HSP A;  1HQM C;  1AEX A;  2E2J B;  1H9M A;  1TY0 A;  3J80 E;  4G7O C;  3P20 A;  2WIN B;  1LAB A;  1EY5 A;  3RLF A;  4FF3 A;  1LTT D;  3KK7 A;  1BQQ T;  1TT2 A;  2CQA A;  1OXV A;  2MJ8 A;  3T53 B;  3K5L A;  2Z4I A;  5EPJ A;  2AUK A;  2A6H D;  4IFD G;  5C4Z A;  1LTB D;  1I50 B;  4FF4 A;  4ZKC B;  2J7Z A;  4KHZ A;  3AMU A;  1PFM A;  1G29 1;  1SBB B;  1T5E A;  4BA2 I;  5FLX L;  3V96 A;  2F0W A;  4EQP A;  5JVG 3;  1BCP B;  1BCP F;  3D4D A;  2JXM B;  1HPC A;  2H1E A;  2E2H B;  3QOL A;  2QCP X;  1RHP A;  4KKS A;  4X3K A;  3PUZ A;  1MSH A;  1BCP C;  3MA2 B;  1DOK A;  1G8Z D;  3NPP A;  5D65 A;  4KI0 A;  4YIJ A;  1YNJ C;  2Q8R E;  2KJX A;  1OXT A;  3H91 A;  2EYH A;  3Q22 A;  5C3X A;  4GZY C;  1TY2 A;  1CQV A;  2F03 A;  3ZYY X;  5CBE E;  2I07 B;  2L0C A;  1SXT A;  4CKC A;  5IOD A;  1SYD A;  4A3B B;  4DAP A;  1SYF A;  2NN6 H;  3DXJ C;  3L7Z C;  1GHK A;  2F0O A;  5C6A A;  4KY7 A;  3TP7 A;  1HTL D;  1ENF A;  4KY6 A;  1JR0 D;  4BY1 B;  2A73 B;  1K83 B;  4JBW A;  2LMC B;  3GP7 A;  2B2W A;  4KKT A;  1J9O A;  4K8J A;  1IKM A;  4Q0F A;  2ZXO A;  5A35 A;  3H6M A;  1TWH B;  3MAQ A;  1LT5 D;  3RZD B;  1EZ6 A;  1WTP A;  1L0X B;  1HRJ A;  2F0G A;  3LX0 A;  1DZ1 A;  2F0I A;  2Y0S B;  2F3W A;  4HTH A;  2O2L D;  2RDH A;  1V1O A;  1EOT A;  3VYR A;  2IPK D;  1STA A;  2JA6 B;  3CRK C;  2HCI A;  4HCS A;  1TS4 A;  3TP5 A;  3IAY A;  2SEB D;  5K36 G;  3TZU A;  2A6E D;  2R6G A;  3NBH A;  1U4P A;  1I4X A;  3QB3 A;  1ICW A;  3KF8 A;  2E2D C;  2L9H A;  4O42 A;  1GUG A;  2O4X A;  1XX8 A;  5I4D A;  1I4G A;  1JIC A;  3OOC A;  1EY0 A;  3M4O B;  3Q23 A;  1VF5 C;  2IX3 A;  3T16 A;  1IL8 A;  4UDU C;  2PW7 A;  2M2L A;  1LLR D;  2L12 A;  2BE5 D;  1V1P A;  3S2D B;  3NQI A;  4R9W A;  2XRS D;  3S15 B;  4RHS A;  1RD9 D;  2AUJ D;  5K5P A;  1SYB A;  2PMZ B;  3X3M A;  4OIK A;  1IHZ A;  3I4M B;  4IUV A;  3SXH A;  1QNU A;  1RKN A;  1ILQ A;  4FXK C;  5C3E B;  4B9W A;  1MI2 A;  4ZYS A;  4IFD J;  1BO0 A;  1H9K A;  1VCI A;  4FVM A;  2RDF A;  3Q6S A;  4C2M B;  3GTG B;  4K6L A;  1KAB A;  5M5X B;  1CTM A;  1Z7T A;  2F0L A;  3L9A X;  3AB9 A;  1ZKO A;  2AQ1 B;  3N52 A;  4A3G B;  2EY6 A;  1C8C A;  4IN3 A;  5CV4 A;  1F2M A;  1XYI A;  4K2L A;  5F2D A;  4HSV A;  4FP5 D;  5CV8 A;  4F88 A;  5IGD A;  2E2I B;  3BVZ A;  2D5D A;  1STN A;  2BDO A;  5IGE A;  5I9O A;  2IX0 A;  3TZD A;  1KDB A;  5JEA H;  1DOM A;  4R8N A;  1CHQ D;  5ELE A;  3NTI A;  1EL0 A;  5EPL A;  1BCP D;  3OIP A;  2D2C C;  3M85 A;  3I91 A;  3WDN A;  1LV9 A;  5KGU A;  1YNJ D;  3NK9 A;  3BYY B;  2IL8 A;  5IGB A;  1D5Z C;  2PZU A;  2PO4 A;  1PRT B;  5J22 A;  2H4O A;  2TSS A;  3GD7 A;  2JP1 A;  1I4Q A;  3SVM A;  3BYT B;  1D1I A;  1HXY D;  5ELD A;  1SMY C;  3R2I A;  1IYU A;  1PRT C;  4LK1 C;  2JEA I;  5J1Z A;  4KD3 A;  3S1N B;  2VB3 X;  1FD7 D;  1R9T B;  4RAU C;  4RWS C;  1JC7 A;  2IT1 A;  5C0X G;  5LHY 1;  2MUY A;  4C3J G;  1JWS D;  1EY6 A;  4KD4 A;  1CQF A;  3OSO A;  2A68 D;  1DXM A;  1B53 A;  1EY9 A;  3D4R A;  4NP5 A;  1WTV A;  1BBX C;  1PTO H;  1ET9 A;  4EGV A;  4RGT A;  3PO2 B;  2AQ3 B;  4N9T A;  4PV1 C;  2F0H A;  3NHH A;  1NAP A;  3R3O A;  3C46 A;  1X3P A;  3FKI B;  1CZW A;  1EU4 A;  4NMZ A;  1ET6 A;  2B2U A;  4C3J B;  4ZAI A;  3K6O A;  2PW5 A;  3PIO 3;  1ZYR C;  5IIF A;  1W6J A;  3I73 A;  1OXU A;  1UNS A;  4PMC A;  3HEJ A;  4IUT A;  3I70 A;  1Q90 A;  2QF7 A;  2FIN B;  2I46 A;  3SE0 A;  3H0G B;  4KK7 A;  1DJR D;  1KLG D;  2D62 A;  2K01 A;  1D6E C;  3RZO B;  4RKB A;  3EFX D;  5KEE A;  3OWF A;  1O78 A;  1HUN A;  1BR9 A;  1JOO A;  3FPU B;  4LJZ C;  3KLS A;  3OMG A;  3HS0 C;  5DEH A;  3Q24 A;  2IW3 A;  3OW7 A;  2JA8 B;  3E6Z X;  4ZUI A;  1RDP D;  2F0J A;  4XT1 B;  2LFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...