3SHLA

Crystal structure of staphylococcal nuclease variant delta+phs v74kl25a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKAMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEKEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Redirection of internal ionizable residues by engineered cavities
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3shlA00
4K5VA 3TMEA 5C4HA 3EVQA 2SNMA 1SNMA 1KABA 1STHA 1SYDA 1TR5A 2EY5A 2KQ3A 2F0JA 2PW5A 2OXPA 1SYFA 4KTAA 3H6MA 1F2YA 3QB3A 5J22A 4N9TA 1EY8A 2EYHA 3D4WA 3S9WA 4S3SA 2EYJA 3SXHA 2F0VA 5CV4A 4TRDA 5I9OA 3VA5A 3MHBA 3TP7A 1EY5A 5KYLA 3OWFA 2M00A 3D8GA 5CV5A 1A3VA 2F0FA 4NP5A 2F0SA 4LAAA 5J1ZA 5KGUA 5KYIA 4K2LA 5KRUA 5C5LA 4KD4A 4B9XA 1EYDA 5M9OA 1SNOA 5JOBA 5IGFA 4K5XA 1JOKA 4R8NA 2PZUA 5JAVA 5J39A 2SOBA 2KHSA 3E5SA 2EYMA 1A3UA 4EQNA 3U9OA 5IIFA 4F8MA 5CV9A 1AEXA 2O4XA 4ZQ3A 4OL7A 2OEOA 4DU9A 4EQPA 2F0WA 2F3VA 1STNA 2F3WA 4WORA 4B9WA 1EY9A 1U9RA 5I9PA 3QOLA 3C1EA 5KIXA 2F0IA 4RKLA 2PYKA 1SYCA 4KD3A 2F0KA 1KDCA 5CV6A 5E1FA 3T13A 3C1FA 3DHQA 2F0PA 3NQTA 4KV6A 3LX0A 5IGGA 2F0QA 3RUZA 5I6WA 5CC4A 1STAA 4DFAA 3PMFA 1KDAA 5CR3A 2RKSA 2RBMA 4RKBA 5EKKA 5CGKA 5KEEA 4QF4A 2HQEA 1EY6A 1JOOA 4NKLA 5HGTA 4HTHA 5F2DA 5IGBA 3R3OA 4J1MA 1SYBA 1IHZA 1EY4A 1TQOA 4KY5A 4ID6A 3OSOA 1EZ8A 3EJIA 3NK9A 5NUCA 4F7XA 5C6AA 2PW7A 2QDBA 4G57A 3SK8A 2EY2A 4K2KA 5C4ZA 1EY7A 3V2TA 5IOCA 2SNSA 2EYLA 1JOQA 1SNPA 1KDBA 1TT2A 2OF1A 4K8IA 3TP5A 3QOJA 3SK4A 4EVOA 1EZ6A 1STYA 4HMIA 5IGEA 4MIUA 3T16A 1SNCA 4J6HA 4K8JA 4ME5A 2PZTA 5I6YA 2RDFA 5IGCA 5CV7A 4K5WA 1RKNA 4K6DA 4KY6A 4IZ8A 2LKVA 3SR1A 4YIJA 1F2ZA 2F0LA 2PQEA 4DGZA 4ZUIA 3NUCA 3MXPA 1KAAA 4KJOA 5CV8A 5C5MA 4E6IA 4H7BA 5HURA 2F0HA 1SYEA 1A2TA 2F0OA 4IALA 3BDCA 4K14A 3SK5A 1STBA 4I65A 5IODA 5ISRA 3ERQA 2F0TA 3ITPA 3BDLA 3D6CA 3P75A 1EYCA 2WACA 1A3TA 1EY0A 3HEJA 4HMJA 5E3FA 3MEHA 5IGDA 2PZWA 2EY6A 1JORA 2F0DA 1A2UA 4ZUJA 4WRDA 5EGTA 3HZXA 3P1HA 5EKLA 4NDXA 4N9PA 4NMZA 3EROA 5C3WA 2F0GA 3TP6A 2EYFA 4KJNA 5K5PA 1STGA 1SNQA 2F0UA 1EQVA 2EXZA 2F0MA 4ODGA 3D4DA 2EY1A 4PMCA 5C3XA 4DF7A 1NSNS 2NUCA 3MZ5A 4QB4A 5DAUA 1NUCA 3NHHA 1SNDA 1SYGA 4PMBA 3NXWA 4PNYA 2EYPA 2EYOA 3NP8A 3TP8A 4EQOA 3SHLA 2F0NA 2F0EA 3OMCA 4KY7A 4KHVA 1EYAA 1F2MA 2ENBA 1II3A 5DEHA 4QMGA 3MVVA 3OMGA 3SK6A 3DMUA 1ENCA 4IUNA 1ENAA
chains in the Genus database with same CATH superfamily
1MJCA 4LK1C 4MTKA 1TR5A 2KQ3A 5C44B 1SYDA 1PTOC 2AQ2B 4IFDH 4G7OC 1HUMA 2EYHA 2B8FA 1TWGB 4S3SA 5I9OA 5IYCG 2E2HB 2EPBA 3PUVA 2K75A 2BH2A 1U4LA 2RDHA 3M4QA 4K2LA 3FKIH 3KJPA 2NVQB 1ICWA 4OIJA 4U68A 4CDFC 2IPKD 1A3UA 3MFYA 2QDLA 1XNRQ 2Z9HA 3X3NA 3CC4A 2NN6H 4KMUC 1U9RA 1JC7A 1Q81C 4X3UA 2N3SA 3FDTA 1VQHA 4R4IA 4OX9L 2QGQA 2CW0C 2RDGA 1T5XD 5IGGA 4KV6A 4DR1L 3GTKH 1EEFD 3E6ZX 1NMFA 3BZCA 1RIPA 1TY2A 4DK3C 1VF7A 4O2DA 5EKKA 5IT9E 2KJXA 4RGOS 1PTOF 1JB3A 2NVXH 1ILQA 1J6QA 3S2DH 1H9MA 4ZK9B 2CH4W 5K36G 3UDIA 1S72A 1DD2A 5NUCA 1P16A 1I3QH 1FJGQ 1UE5A 2EJMA 4KKSA 2O5IC 3UDFA 1EIYB 4EVOA 1MSGA 2HCCA 2H4OA 5IY0A 1ML0D 3SVMA 3Q22A 3PO2B 1N34Q 2PZTA 1WTQA 1B44D 4K5WA 3PV0A 2UUAL 4ZUIA 1EU3A 2X6GA 2DJFC 2R7FA 3G6EA 2B2YC 3NPPA 4OIKA 4RG1A 1VF5C 1AE2A 1G2SA 3ITPA 1VQDA 4B3TQ 4A3GB 1TS2A 5IGDA 4GOPB 2PZWA 1I4GA 2AWOA 2E5LQ 1HZ9A 5EKLA 4N9PA 3NEMA 3K7AB 2R7DA 3S17H 1ZYRC 3NE5B 3KF8B 4ODGA 1XMQQ 2JA6B 1VQJA 4LF5Q 1K28A 1J5EL 2JSOA 4BY1H 1RJTA 3NP8A 1YNJC 4BBRG 1BR9A 4A3DB 3HOYB 2C9OA 3MVVA 4ILWA 1Z7TA 1IBLQ 4P2CB 1MIUA 1G6ZA 2F0JA 2XNAC 3STBC 2R92H 3IKJA 3U4VA 1YITA 2KENA 3QR8A 3I4NH 3I4OA 3T4AC 1FNWA 2M00A 1V8QA 4DAYB 2F0SA 1LT6D 2B8GA 2RF4A 3R2TA 5C4JB 4QIWB 4CDDC 3ND9A 3A74A 1C8CA 4OHJA 3GTGH 3CMAA 4C3HG 2I46A 4DV7Q 2F3VA 1G8ZD 1ASZA 1EY9A 4X64L 1PZKD 1X32A 1KXLA 3KJOA 1L1OB 1MSHA 1HNWL 4KK7A 3H3VH 3RZOB 1JT8A 1HA6A 1HPCA 1A6XA 4DK0A 3F2DA 3H0GB 4RKBA 4C3IH 1W6JA 2HIXA 4QF4A 3HG9A 5C0XJ 4L63B 3IFTA 4A4IA 2B29A 2A6EC 1QE6A 5TSSA 2CCZA 3H91A 3OOCA 1LUZA 4OO1G 4Z9CB 1CK1A 4P74A 5IOCA 1AP0A 2OF1A 3NBHB 4X65L 3PCOB 1QNUA 2XRSD 1GUNA 5IGCA 2YYZA 3PO2G 3S14H 4CJ0B 3FKIB 4ALPA 1T9HA 4FYDA 5C5MA 1A2TA 5KNDA 4XDXA 1AZPA 4QL5A 1QILA 1MI2A 5IE8A 1PH7A 4NPSA 1BNZA 4PG3A 1IKMA 1LTTD 3KLRA 2BA1A 5EGTA 3TREA 2L5TA 5JJZA 4ZAIA 4LF8Q 3RR5A 3TZUA 4FF2A 3OW2A 1HNZL 3KF6B 3MXNB 2D9UA 1H9JA 4ZRZA 4PV1C 3A5UA 3G7LA 4AQYL 3W2DA 3ULLA 4YWMA 3CQZH 3AU7A 1WTOA 4A3DG 3HOYG 3S2DB 1Y8OB 4K5VA 1ONLA 2ICEC 3E0JA 1I3QB 5JAVA 3CPWA 1SMYD 1GUGA 4DR5Q 1NJIC 1SMXA 5JVG3 3QIAA 3CPFA 4F88A 2NZ1D 4DN4M 3D8GA 1A3VA 4NP5A 2DGYA 5M3MB 3GD7A 1B2TA 1JJCB 4BWGB 1E3PA 3EBEA 1V1PB 4ME3A 3Q8DA 2WP8J 5CYUA 3L7ZC 5CV9A 1ILPA 3I56A 3TRZA 3K0XA 3C1EA 4IPDA 2IL8A 5GAEC 4DPGA 4KD3A 3GTPB 4IJHA 3NQIA 4GN4B 4K6LA 2F0QA 3WDNA 1BQQT 2G9DA 1IBKQ 5CC4A 1I4RA 5CGKA 1WTRA 3S17B 2RSOA 3H94A 3KLSA 1LLRD 3VR6A 1JB7A 4FF4A 3RN5A 2MP1A 1AW7A 5C0XH 5LL6S 2L12A 4BY1B 1PYBA 2RQXA 2XWJB 4F87A 5ELFA 1WTWA 2B2VC 4ID6A 2KCCA 4CKBA 3NK9A 3KBXA 1FJGL 1PXUA 4JVZA 3IAYA 5A35A 2JEBI 2H1EA 5C4ZA 4C56C 2F3IA 1VQKA 1IKLA 2FINB 1ENFA 1Q3LA 4OEMB 2R92B 2A5HA 3I8ZA 1CKNB 3I4NB 4HR7B 2YV5A 2JXMB 4JI1Q 2PMZE 4LF9Q 4GS3A 4HN7A 2JK8A 4AIMA 3VR4A 1UEBA 1PTOD 1HTLD 1SR3A 3K0YA 1A63A 2MJ8A 3CD6A 3GTGB 1L1OC 2BA0A 1B3AA 3K59A 5IYCH 2E5LL 5J3BA 3A8KE 3DEOA 3EROA 4QJFA 2WAQB 2F0GA 5GADC 4B3SL 1UNSA 2EYFA 4KKUA 1S5FD 4RWSC 5K5PA 1EYGA 4PMCA 2ZTEA 4LF5L 2M2LA 4PMBA 4C3IB 3M3YH 2EYOA 4P73A 4LFAQ 3TP8A 2N78A 4LF4Q 4KI0A 3OMGA 1ENCA 4IUNA 4LF7Q 2CW0D 3ZJYC 2SNMA 1IBLL 2ZM6L 4JC0A 1WJJA 3MXUA 2JJQA 1WFQA 1C4QA 1SXTA 5LMNL 3FHWA 3VA5A 4ZYSA 2CH4A 2B2UC 4LUOA 1X3GA 5KRUA 5M3MG 3R2IA 3KLSX 1HZAA 3CC7A 5HGQA 3CCUA 5K36H 1YHQA 5H1SE 2JE6I 4DAMA 3S14B 3MC0B 2IHEA 3EIVA 4OL7A 4JBMA 4DV7L 1X54A 2FJ2A 1XJVA 4RFBA 2MUYA 1V9PA 2VS1A 4JG2A 5LL6X 1KDCA 2AWNA 4GZYC 1Z47A 5BR8L 3CAMA 2Q8TA 4WFN3 1E2VA 1NNXA 1FYCA 3PUZA 4JCVE 5KEEA 3S15H 1NMGA 2HQEA 4GKKQ 4HJAA 1H9KA 1EIFA 4IPGA 1S5ED 3OPOA 4JI5Q 5C6AA 2PW7A 1EWCA 3CQZB 3UDXA 2EYLA 1TT2A 1Q1EA 1CI3M 4BY7G 2R92G 4A93G 1GUOA 2B2WA 2DJGC 2F4IA 3PUWA 3T16A 1YNJD 4RAUC 1K8GA 2KCNA 4BBRH 3SR1A 3U50C 4G7HC 3MEFA 3K5MA 5CV8A 3RLFA 1SYEA 3STBD 2AMCB 2WKCA 5A2QE 1JE4A 1EY0A 1PFSA 2Z1CA 1E1OA 2AQ1B 1M90C 3W5OA 1F2LA 1H9SA 5D3IB 2ASBA 5JEAG 4LF8L 5DNFA 5A2QL 2ZXPA 1VQ4A 2UUCQ 2CWAA 1BBXC 4QB4A 3NHHA 2K32A 2I5HA 4YWLA 3JAME 2F0NA 1XTDA 4C3HH 3M4YA 2A68C 2E75C 1LYLA 3EVQA 1QOHA 1P8LA 3NBHA 5AFWA 3J80E 2N55A 3JAML 3CW2C 4Y52H 1VQ6A 4DR5L 1IZ6A 1GJXA 2XIWA 1EOTA 5CV4A 2GA4B 3OWFA 5KGUA 3J81L 3J80L 4B9XA 1EFID 1HFNA 1SBBB 1X3EA 3MAQA 1V1OA 1V43A 2KEEA 4EQNA 1SE4A 5JVH3 2HD3A 3K5NA 3R93A 4OO1H 5D65A 2OEOA 1STNA 2C35B 1VQEA 2J4XA 2V1CC 1CKOA 4IFDJ 1YNNC 1LM0A 2F0PA 3H3VC 3I4MG 5IYDG 1LABA 1U4MA 1O7ZA 4AYBG 1FGUA 2Z6BA 3M4PA 3M3YB 1SLJA 4J1MA 2JA5G 1BF4A 3PQIA 4HCSA 1B8AA 3ND8A 4APVA 4IN3A 2LSSA 3R8BA 5C0XI 2FMMA 4X64Q 4QQBX 4I7ZC 3TS0A 2OQ0A 4L8JA 4M8AA 2A69C 4ME5A 2VL6A 1WTPA 2KVMA 3HOZG 1F2ZA 4JI1L 1F9PA 4A3DH 4IURA 1WI5A 1N36L 1QB5D 1HR0W 3A7AB 2WACA 5E3FA 1DCZA 2EY6A 1E2ZA 2N88A 3HZXA 4V0BA 2LFNA 3W3AA 2MO0A 3HOVG 3NTIA 3OWEB 4G4KA 1Q46A 2AKWB 3OTOQ 3S15B 1WYDA 4YCVA 1CSQA 2F0EA 2VUMG 2TMPA 4XQQA 3OMCA 1A15A 3SK6A 4UAIA 2WKDA 1KL9A 3DLLA 4LF7L 2UXCQ 2WB1E 2QILA 1F2YA 3M4OH 1SDFA 3I3CA 1AH9A 3HKZE 1VDZA 3A54A 3LWEA 3LGJA 1EY5A 4TSSA 1XWEA 4G7ZC 1KQSA 3E9IA 2ES2A 1R9TH 1VQAA 1JOKA 4R8NA 2PZUA 4BBRB 2L1BA 1EFWA 1LTGD 2WFWA 3BS1A 3F2UA 1DGSA 3G6JB 1NTGA 4TQUS 1G91A 1CUKA 1EWHA 2PYKA 1PH8A 1Q1BA 5I6WA 1YI2A 1UEAB 2K5NA 4POGA 2B63G 3BYTB 4GKKL 3AFQA 3T56B 1DOMA 1L2FA 2ID0A 4C3HB 4JI5L 2FFKB 2Z4IA 4FXGC 4HJ9A 4K2KA 5FLXc 3Q24A 1A0IA 2BDOA 3KLWA 4PQXA 1CFMA 1K9MC 2LS01 3FEWX 4J15A 4IPCA 4MIUA 1ESFA 1T5EA 3AB9A 3UE1A 4JI0L 4KY6A 1A62A 4YIJA 4DR3Q 1HZBA 3VDYA 3A55A 4KJOA 4P75A 4E6IA 1I6VC 4IALA 2Y0SG 5IODA 1X56A 1HCZA 1TU2B 5DM63 1Q12A 3BDLA 4DAVA 5IT9L 1B70B 3GTLH 3T1HQ 4N8FA 1W6KA 2B2TA 4DV2L 2UXBQ 3I90A 4UHVA 2YTXA 3TP6A 4JI7L 1HFGA 5M3MH 3MFGA 3D4DA 2UUCL 4A3JG 2OTJA 2FMCA 2K5HA 4ZKBB 2MPMA 3NXWA 3AEVA 3SHLA 3CP0A 4GLAC 1WTXA 4KY7A 1II3A 3PO3B 3DMUA 4KN4C 1HH2P 1TY0A 2B3GA 2MNAA 1STHA 4KTAA 1G51A 5FJ8G 4MHEA 1U0LA 3A8IE 4A76A 3GTPH 1MD2D 1VQMA 4BBSG 1WOCA 2JQOA 3IFDA 2ZT9C 3BG3A 4IUPA 3HOUB 4QCLA 1TS5A 1PV4A 4B3SQ 1KAWA 2NTTA 1S5CD 5GROA 2WAQE 4UP7A 1Y69U 4LF6L 3TQYA 5DLQE 4IUTA 1GXDC 2CKZB 1SNOA 2R3ZA 3BYYB 4DV1Q 4LW1A 4XYOA 5D3DA 1FNUA 1XX8A 2XRQD 2V4DA 3D6WA 1CSPA 5I9PA 2L9HA 5KIXA 4BY7H 2ZM6Q 4GNXB 4A93H 5E1FA 1CQFA 3CC2A 1SAPA 3NQTA 5LMNQ 3LX0A 3FP9A 4DR2L 1EIGA 3HGBA 1MJEA 1KDAA 3A0JA 3LNNA 1IYJB 3I72A 2YU9H 4DV3Q 5HGTA 2F52A 1PZID 2MHVA 3DWQA 3J81c 4DUZQ 4YCUA 5M3FG 1RTNA 5JEAH 4HIKA 4DR7L 1A8VA 3A8JE 3M4OB 1QVGA 4A3CG 1STYA 1Q90A 3AYHB 5BR8Q 5T1IA 1PH2A 2BE5C 5CV7A 1XXGA 3RN2A 2A68D 5KNCA 4XYQA 3DXJC 1YHBA 1PRTC 4DV0L 1R9TB 2VXWA 1CHPD 3RD4A 1JMCA 2NVYB 2MO1A 1X3FA 4HSVA 4I65A 5FO9B 5T1GA 3P75A 1VQGA 4P71A 2L55A 4B3MQ 2RSNA 2IX0A 1A2UA 3KDFB 2AQ3B 3FPPA 4NDXA 3JC66 1FD7D 4YY3L 1JJGA 1YJ9A 5JPMC 1QUQB 3BVMA 3OTOL 1UUPA 1U5KA 2B2YA 5EPJA 1YNND 1S40A 3PO3G 1LO5D 4FF1A 2UXCL 3PIP3 1SNMA 1Y14B 4UP9A 2BOSA 3I4MH 4R9WA 3H6MA 2CVRA 2R7ZG 5IYDH 3F1ZA 3DM3A 1O7YA 1I4HA 3HOUG 1Z6HA 4B3RL 1BKBA 5FLMH 1XPUA 2ALYB 4FP5D 1DJRD 2JA5H 3CCRA 1G2TA 2DNEA 4C3JG 1SJHD 2RA4A 3ER0A 1N32Q 2ZJQA 3WOFA 3DEPA 1WCMH 3GTLB 2Z4HA 4NXNL 2K33A 4QUCA 1FL0A 3HOZH 1EIHA 3BU2A 2WV6D 1MBYA 4XT1B 4IFDI 3F8TA 4Q0FA 4Y7NH 2A6HC 4RA8A 5F2DA 2KEDA 4V190 2PQAA 3N6RA 1ESRA 5EBCA 4LFBQ 5EAYA 5HY6A 1TKWB 2QDBA 3SK8A 1BO0A 1D1IA 1XTCD 1OXVA 3CCSA 1OXUA 5DM73 1CZGA 3URYA 3HOVH 1FVIA 2NN6I 1E7ZA 1JQYD 2K28A 4HMIA 4ABNA 3C2PA 3S24A 1PVOA 2KHIA 2L0CA 2PI2A 2YTVA 2VUMH 1OO9B 4DKAC 1U4RA 2HUGA 3MA2B 1IBML 4DR3L 1PFMA 3AQQA 2VB3X 4JK1C 3WOEA 2CQAA 1OXTA 1BDOA 1KC8C 1KRTA 1QJOA 1STBA 4GNXC 3OYYA 4DUYQ 3U58A 1F9SA 3T1HL 3T51B 1W2BA 1K0SA 2JA8G 3RZDH 4WRDA 1HQRD 2UXBL 4DV6Q 2D2CC 4BY7B 4OONA 2Z6KC 4A93B 4JOIC 5C3WA 2HCIA 1DOKA 1NAPA 1LTAD 3ULJA 1BVSA 4OWTB 4RCOA 4PNYA 4RMFA 2YU9B 2N8NA 2BDNA 4FNFA 3C3LA 1EYAA 1N36Q 3GP7A 4A3IG 1Q7YC 4JYAQ 4IQZA 1B9MA 1GVPA 2Q2IA 4LFCL 2MFIA 3SXHA 2FHTA 2J0TD 3O13A 2B63H 5CV5A 5IT9c 1BXTA 2F0FA 3QJYA 5J1ZA 1HUNA 4R1JA 4CJ1B 2LXKA 1STEA 2KUMA 4DV1L 2KHSA 3TDQA 2EOTA 2Z0SA 1TWFH 1PZJD 2WB1G 1YIJA 1K0RA 1N9WA 3KUPA 2HHHL 2MGSA 4BXXG 3X3MA 2DNCA 2MQHA 3T13A 2F0KA 3V96A 5M5XH 2Q2TA 2XWBB 5BN5A 3VR2A 1HRJA 2GVBA 1HXYD 1JICA 1R4QB 3OW7A 5FOBB 5L37A 3CRLC 1GHKA 5IP7G 4YCWA 4UP8A 4OWWB 1VQ7A 1KIXA 4DV3L 1V1QA 5E7NA 2PI2E 3TS2A 4KY5A 4DUZL 4GOPA 2J7ZA 1J9OA 1RDPD 3GO5A 5JJLA 1DOLA 2JA7H 4X3TA 1CHQD 3W1GA 4ZKCB 3I4MB 2KA7A 3TP5A 3KF8A 4HJ5A 3I70A 1EZ6A 4A3JH 1LT3D 1KLUD 2K5DA 3I2ZA 4K8JA 4AYBB 2PQEA 5ELCA 3UE0A 1VQOA 3TSSA 3H3VI 3MXPA 1KAAA 2JA5B 3TBIB 2F0OA 1U4PA 2A74C 2B2VA 2QA4A 5FJ8H 2F0TA 4L5RC 1NE3A 4GKJQ 3K57A 4BBSH 2NYZD 4JI8Q 4OGQC 3NTHA 1B9NA 4B3ML 1ZYRD 3S1NH 4OELB 4DV5L 1WCMB 3E3XA 4DAYA 4JPBW 2RHQB 2AUJD 3H15A 1ET9A 2TSSA 1XPRA 4UY8C 3HOZB 2JA9A 1KTKA 4P72A 4JI0Q 4HJ8A 5D14A 1EWIA 1RD9D 4KHZA 4Y7NB 1C9OA 1TXYA 1PFNA 4F8MA 5I4DA 2HIVA 1RCVD 4KHPL 1H95A 1VQFA 1QCBD 2PW5A 1L1OA 3NTKA 2IWHA 4DV2Q 1AZQA 5CMDA 3S9WA 2G5DA 3HKSA 3W1BA 1YEZA 3GTOB 4JI7Q 2UUBL 1N33Q 3HOVB 4LAAA 2IHFA 3U4ZA 1D7QA 2OCEA 5M9OA 5FK9C 4K5XA 2ZXOA 2VUMB 4DR6Q 2K04A 3FVQA 4MTNA 5M3FH 4JI3L 2GN5A 5I2YA 4GN3B 1N32L 3HOWB 1PA6A 4RKLA 1FNVA 1SYCA 1YNXA 4A3CH 4DK1A 1X55A 2A8VA 1UE7A 3RZDB 1N8RC 4RCNA 2B2UA 1OXXK 2EXDA 4LF6Q 1RHPA 3ONAB 2A6ED 5IGBA 2K7VA 4NXML 1SYBA 1S5BD 3EJIA 4BA1I 1QVFA 1ICFB 4LFBL 5GAGC 1AE3A 2OQKA 1B1ZA 4QY7A 3V2TA 5EJWA 2LMCB 1XMOQ 3SK4A 1YBYA 2B39A 3KF6A 3MXNA 4CGYB 1KLGD 4DR2Q 2K1BA 4C2MH 5IYBG 1B7YB 3NELA 3VR3A 2B63B 2ATWA 4DXGA 2R6GA 3SDZA 1E0BA 1QWYA 3ICEA 4X6AH 1L0XB 4NB3A 2K50A 5FLMG 4HCEA 2HT1A 3PO3H 4QIWE 1VS0A 5C3EG 5GQOA 3ERQA 4GN5A 1TWFB 2R7ZH 1I6HH 3KOJA 4DUYL 2DY8A 4CKEA 2QEXA 4CJ2C 1WD1A 4RGNA 1K83H 4DR7Q 3HOUH 2KECA 3P1HA 1Y1VG 4NMZA 2VQFL 4DV6L 2K05A 3F2BA 5M5XB 1WCMG 2R93G 3GTJH 2L15A 3BJUA 1ET6A 3K81C 3K8AA 1L0WA 3ZYYX 5DAUA 1V1PA 4C1NI 4C3JH 3EQLC 3T53B 1DXMA 2EYPA 2DY7A 4EQOA 4DV0Q 4A75A 2PO4A 5EBDA 1EU4A 2SDFA 2Y0SB 4M1UB 4XQJA 2VB2X 4HIOA 4A3LG 2E74C 5IP9G 4POFA 1L0YB 3HFZB 5C4HA 1PYSB 5AJ3Q 4JYAL 4JI4L 5LMUL 1MKHA 1RODA 3QB3A 5JPNC 3D4WA 2JA7B 3TN2A 2F0VA 1O7IA 4YY3Q 3MHBA 1GM5A 1BBWA 2PMZB 2A6HD 4A3JB 3RLOA 3L9AX 3GTMH 4KD4A 2K5QA 4XT3B 5C4XB 3E5SA 4GLVB 1HTPA 1I50H 3K5OA 5BN3A 4PZ7A 4EQPA 4AH6A 3J7A5 1Q86C 3HOWG 4BBSB 4A3MB 1TS3A 3G71A 1CKNA 3S1NB 3HOXG 1JJ2A 3S16H 3RUZA 1XYIA 4A3KH 4B3RQ 1WTVA 1M8AA 4KLKA 4A3FB 1EY6A 1JWUD 4NKLA 2NBFA 3Q23A 4X3SA 2NVYH 1AN8A 3MTSA 3U9SA 3IRBA 4JI2Q 1MHWC 1PRTB 4F7XA 1HHVA 2JA8H 3NENA 1BCPB 3DWAA 1D8LA 2EJFC 1QG7A 1GOZA 4NXNQ 3QOJA 1O78A 1KHIA 1WD0A 2CWPA 2K03A 1PH5A 4K6DA 1RKNA 3J81j 2D0OA 4DGZA 1XPOA 3ERSX 4IPHA 4A3IH 2F0HA 2QCPX 1SE8A 3BDCA 2EZVA 3J81i 1D1KA 5E4WC 5GAHC 5M3FB 2IY5B 3J80i 2O2LD 1R4PB 2RVLA 4X62L 3D6CA 4LMQD 4GKJL 3I4LA 4JI8L 1EUJA 2A73B 5JEAJ 3BDOA 5EPLA 1WTHA 2IJ0A 1F77A 3CU7A 1Y1WG 4FDBA 2EXZA 2F0MA 4A3BB 5C3XA 1UE1A 3BZKA 4RGTA 1B50A 3MZ5A 3NWSA 1IBMQ 1HQMC 3OIQA 4RHSA 3I7FA 4BXXH 2KBNA 1C0AA 3CHBD 1E2WA 3FPUB 3FMCA 4LUVA 4LWCA 5DEHA 3SGIA 2VW9A 1X9NA 5IWAQ 2EY5A 1RF2D 1D5ZC 4HIDA 3G48A 3CCQA 1LTRD 1PMRA 4K0KQ 1IYUA 1EQRA 3OIPA 2NB0A 5IP7H 2JA7G 1N33L 4X66Q 2I5MX 2L11A 4C2MB 3LWUA 3T1YQ 4O42A 3GDEA 1YVCA 5IGFA 2WINB 4IO9A 3E9HA 1LV9A 2D0PA 2DUDA 5C4XG 4OXPA 4DR6L 3M9BA 3M85A 2I5LX 1SEBD 4BA2I 4A3EB 4DU9A 4B9WA 1PH6A 1NR4A 1I6HB 2R7ZB 3VYSA 1NBWA 3CCJA 3TEHB 1K83B 4LFCQ 4A3MG 3C46A 1K8AC 3CXCA 1D2BA 3RMHA 4PMWA 3TZDA 2N49A 1STAA 4DFAA 3PMFA 2RBMA 1IL2A 3GTJB 2XGTA 1DYQA 2PCFB 1YJNA 1S4ZA 1GKHA 4A3FG 4C3JB 3Q0AA 1TQOA 1EY4A 1UE6A 2NZHA 2RCFA 1X65A 5ELEA 1HZCA 1EOVA 3A7LA 2HHHQ 2F03A 1B3QA 1MGSA 2KOLA 1KNEA 3K5LA 4GLXA 2RCNA 5M5WH 2E2JH 1G6PA 1KDBA 4K8IA 4OO1I 4DXFA 4HAEA 1XMOL 1HR0Q 1PFBA 1K3BC 1B53A 4HJ7A 2RDFA 4IZ8A 3JAMc 2PNHA 3GTMB 5I2XA 1RTOA 1GHJA 4LNQA 4H7BA 5JJIA 4JV5Q 1CM9A 1Z9FA 3J80c 2IT1A 4XTCS 1I50B 4DV4L 2WIIB 1VQ9A 1QZHA 4HMJA 1K73C 1VQLA 5C44G 3KFUA 4C1NK 3I91A 4IUUA 4JI6L 1SFOH 3BVGA 1LTID 3GQBA 2QEJC 3S16B 4A3KB 2NUCA 4A3BG 1NUCA 1SYGA 1RL2A 4TKOB 2E8GA 1VQPA 4AYBE 3CKIB 1JE5A 4ULLA 1BCPC 1IXRA 1F2MA 4RGMA 4DNTB 1JORA 3K7UC 2I0QA 1YHAA 5AJ3L 3K6OA 3ULPA 1K3RA 4XXEA 2JA8B 3GTQH 3M7GA 1K8MA 3CCVA 1IL8A 2JYOA 4MZ9A 4DV5Q 1QVCA 1HNXL 5G3LF 4MN3A 3PIO3 2QKIC 4B08A 1H9SB 1WVLA 1EYDA 1S3OA 2DN8A 1TWHH 2SOBA 5EQ0A 1DM0B 4HSPA 4L5SA 1PH3A 5IIFA 3MWYW 3K58A 2O4XA 1SN8A 4N8X1 4A3IB 4LJZC 1NCVA 1E24A 4WJ3M 4A3EG 4KHPQ 1PLFA 4CKCA 4FO2A 4KN7C 5CV6A 4QUFA 5IYBH 4L5TA 3DHQA 1PHJA 1PRTF 3VYTA 1E1TA 1BCPF 2UUBQ 2AUKA 4ZCKA 1CA6A 2F4VL 2NTSA 1SE2A 2K6AA 2CFMA 3G4SA 1VQ8A 1Y8PB 4HTHA 5C3EH 2ZTDA 3R3OA 2WB1B 5ELOA 1IHZA 4JI3Q 2UU9L 1I94L 1EZ8A 3EN2A 4JI2L 1D5XC 1NR2A 3S1MH 4LUZA 2EY2A 3HKZB 1Y1VH 5CBAE 4A3GG 2HDLA 2A69D 1EY7A 1I4PA 1OXSC 1TWAH 4YWKA 2R93H 4O0AA 3J7AV 1YZ6A 1I4QA 2XSCA 3KK7A 3GTKB 1Y8NB 3NSWA 1SNCA 4J6HA 1GD7A 2BH8A 2JA6G 2ZJRA 4YHHQ 1I5FA 1UAPA 1M4VA 4A3LH 5EPKA 3OHXC 5IP9H 1CQVA 2NVXB 4NXMQ 1GO3E 5CBEE 4OWXB 5COYA 3SK5A 1IW7C 3PUXA 1K8OA 5ISRA 3A5ZB 2K4KA 4CDCC 1XNQQ 2NVTH 3MEHA 2ZJPA 1X6OA 5ELNA 3GTOH 2JP1A 4Q5VA 2X69A 3S1QH 4FVMA 1STGA 4UDUC 1FGBD 2EY1A 3DWPA 4J8QA 3P7JA 1KD1C 2HQLA 5BN4A 2UXDQ 2XN9C 3QWNA 4A3KG 2C5CA 1EQQA 1JWMD 1O7LA 4XQNA 2VZAA 1XNRL 1TVXA 4GOPC 2E2IH 3HOWH 2EVBA 3H09A 1KABA 5IWAL 3HOXH 1Q82C 1PTOH 4N9TA 2NZOA 3UDGA 4HEDA 1LTBD 5M5WB 2VQFQ 2IX1A 2E2JB 1VCIA 4K0KL 4H0LC 1FR3A 1GUSA 5KYLA 3J7AF 4X66L 4JW0A 3H0GG 3T1YL 3AFPA 4RHRA 2K14A 1VQNA 4WJ4A 2Q8IB 4IUVA 3M7NA 1TIID 4FXKC 1AEXA 2JN4A 2Y0SE 4WORA 2F3WA 1D5MC 1SJED 2BCOA 2F0IA 5LMUQ 4JI4Q 3EFXD 3J7ZC 4R4QA 1VQCA 2RHSB 2B2WC 4IFDG 1TWCH 1SFOB 1N34L 4TVAB 2RKSA 1X3QA 1LACA 1G291 2A1AA 3EA6A 5FO8B 4DR4Q 3FKIG 2E76C 3E0EA 4HIMA 3OSOA 1EEID 4G57A 4B3TL 4KKTA 3NBIA 2NN6G 1Y1WH 3HKZG 1BBUA 1W3SA 4H02A 3S2HH 1SNPA 1VQBA 3GTQB 3VYUA 2G9HD 1HR0L 3L3OC 1XMQL 3DM1A 3PF4A 5M5YH 2LKVA 3L2PA 2QW7A 1JCKB 1JWSD 4MNOA 2ZTCA 1CKMA 3WWVA 1BUVT 5FO7B 1PH4A 1KRSA 1TWHB 1GUTA 4JV5L 1EL0A 1LT5D 1C48A 1DONA 2YTYA 1EYCA 3N52A 1ZEQX 1CA5A 3HEJA 1E22A 5FLXE 1D6EC 2VNUD 3I73A 2R61A 3CCEA 3IL8A 3HRZC 1EQVA 4DK6C 2VQEQ 5C4XH 1NSNS 4QGUA 3D4RA 5FLXL 3B6YA 3D31A 2K01A 2XVSA 2NWGA 4DA2A 1SRUA 3QG1A 4QMGA 5C3EB 3PUYA 5ELBA 4GNXA 1O80A 4X62Q 2P5ZX 4A3MH 1SYFA 1SE3A 3S1MB 1X3PA 4BS9A 4R4TA 1Y1VB 5J22A 1EY8A 2X6LA 2XTIA 2Z6KA 1Q8IA 5LHY1 4JOIA 1TWAB 2R93B 3BVZA 3L0OA 1ZKOA 1PDQA 5KYIA 4R4OA 1CZWA 2O5JC 3GV6A 5JJKA 5C5LA 4CBVA 4A3FH 4EQ5A 5JOBA 1IYVA 1PYWD 5J39A 4H44C 1F9RA 5E4XA 4BY1G 4ZLTF 1PH1A 3Q6SA 1VQ5A 2K5WA 2LY7A 1J8IA 2NVTB 4OX9Q 4RH6A 2HDMA 3C1FA 2FXQA 4DR1Q 3KYHC 3SEBA 2K52A 3S1QB 1S5DD 3I4NG 5G3LD 2ICIA 3S1RH 3HP3A 3UI2A 2E2DC 4R8IA 1C7YA 4DNIA 1F9QA 3RNUA 4JBJA 3KBGA 5C44H 4IOCA 1LTSD 4XIGS 3CCLA 2E2IB 3KDFA 2M9VA 1TWGH 1KNAA 1JOQA 3BZDB 4EX5A 3HOXB 3NWTA 2E2HH 1PTOB 2BE5D 1CTMA 2WAQG 4A3BH 1QUQA 1SSOA 2IW3A 1HA5A 1PRTD 2EQSA 2GVAA 2PNRC 3PSIA 2NVQH 1BCPD 5ELDA 3VA7A 2UUAQ 2F0LA 4YHHL 2CHBD 4C3IG 4DAPA 3A56A 4K14A 2Q2HA 4L5QA 3J81E 1NY4A 4U673 2CQOA 1XNQL 1JR0D 2QF7A 4ZUJA 4R4CA 3I55A 3K80C 4KJNA 3DUZA 1SNQA 2F0UA 3D0FA 3CMEA 1TWCB 1J5EQ 4DF7A 2UXDL 1SNDA 4X3KA 1PH9A 1OTCA 5IGEA 3RLNA 4FXDA 3D3RA 4CDEC 2KHJA 4A3EH 1H9RA 2ENBA 2Q8RE 3P20A 2IX3A 1QZGA 4IUQA 3TMEA 1VMPA 2F1MA 4L6TB 4WJWA 4DV4Q 2SNSA 3CRKC 2OXPA 3HS0C 3CCMA 1BOSA 2EYJA 3CF5A 1Y1WB 4JI6Q 2OT2A 4TRDA 1AFPA 3PO2H 3S2HB 1IBKL 3TP7A 1TS4A 2OWOA 1CT1D 5FKAC 1GUWA 5M5YB 2A19A 2EYMA 4NW2A 4PZ8A 3U9OA 2PPBC 4A3GH 4ZQ3A 5EKIA 3AMUA 2F0WA 1ZXTA 2I07B 3QOLA 2EDGA 1QNKA 3K7AH 2KCTA 1HNWQ 1HNXQ 2JA6H 1SMYC 5CR3A 2LXJA 4O1NA 1UWVA 4IOAA 2OTLA 1IW7D 4LF9L 1JOOA 3HOYH 3V05A 3GV3A 4DR4L 1SROA 4CHTB 2EE1A 2AHOB 3PIOA 5LMNW 4DNRB 2B2TC 1LTLA 4H13C 1ASYA 4UPAA 4X65Q 2JEAI 3PF5A 3SE0A 2F4VQ 5I6YA 5CORA 5C4JH 2K5VA 2SEBD 1DZ1A 4I7AA 4LFAL 3PIPA 4JBWA 3J7YW 3NUCA 3F2CA 2L4NA 5HURA 3VR5A 4LF4L 2UU9Q 2D62A 1YJWA 5C0XG 1I94Q 2Q2UA 4FF3A 2PQAB 1I4XA 3MXGA 1A3TA 4IJLA 4JBKA 2KCMA 3VYRA 1EQTA 2F0DA 3RZOH 4PZ6A 1HJPA 2ZXRA 3H0GH 1HNZQ 2D5DA 2Z8LA 1VMCA 2VQEL 2VY3A 3QO2A 3JAMi 3S1RB 3PGZA 5KNBA 1B4OA 1Q8KA 1VQIA 2H5XA 4EGVA 4AQYQ 4KHVA 1M1KC 3FRPB 2EIFA 2EJGC 1LT4D 1ENAA
chains in the Genus database with same CATH topology
4LK1C 1TR5A 2KQ3A 5C44B 1SYDA 1PTOC 2AQ2B 4IFDH 4G7OC 1HUMA 2EYHA 2B8FA 1TWGB 4S3SA 5I9OA 2E2HB 2EPBA 3PUVA 1U4LA 2RDHA 4K2LA 2NVQB 1ICWA 4OIJA 4U68A 2IPKD 1A3UA 3MFYA 3X3NA 2NN6H 4KMUC 1U9RA 1JC7A 4X3UA 3FDTA 2CW0C 2RDGA 1T5XD 5IGGA 4KV6A 1EEFD 3E6ZX 1TY2A 1VF7A 5EKKA 5IT9E 2KJXA 4RGOS 1PTOF 1JB3A 1ILQA 1H9MA 4ZK9B 5K36G 1DD2A 5NUCA 2EJMA 4KKSA 2O5IC 4EVOA 1MSGA 2HCCA 2H4OA 1ML0D 3SVMA 3Q22A 3PO2B 2PZTA 1WTQA 1B44D 4K5WA 3PV0A 4ZUIA 1EU3A 2X6GA 2B2YC 3NPPA 4OIKA 1VF5C 1G2SA 3ITPA 4A3GB 1TS2A 5IGDA 2PZWA 1I4GA 2AWOA 5EKLA 4N9PA 3K7AB 1ZYRC 3NE5B 4ODGA 2JA6B 2JSOA 1RJTA 3NP8A 1YNJC 1BR9A 4A3DB 3HOYB 2C9OA 3MVVA 4ILWA 1Z7TA 4P2CB 1G6ZA 2F0JA 2XNAC 3IKJA 3T4AC 1FNWA 2M00A 1V8QA 2F0SA 1LT6D 2B8GA 3R2TA 5C4JB 4QIWB 3ND9A 1C8CA 4OHJA 4C3HG 2I46A 2F3VA 1G8ZD 1EY9A 1PZKD 1X32A 1MSHA 4KK7A 3RZOB 1HA6A 1HPCA 1A6XA 4DK0A 3H0GB 4RKBA 1W6JA 4QF4A 3HG9A 5C0XJ 4L63B 3IFTA 2A6EC 1QE6A 5TSSA 3H91A 3OOCA 4OO1G 4Z9CB 1CK1A 5IOCA 1AP0A 2OF1A 1QNUA 2XRSD 1GUNA 5IGCA 2YYZA 4CJ0B 3FKIB 4FYDA 5C5MA 1A2TA 5KNDA 4XDXA 1AZPA 1QILA 1MI2A 1BNZA 1IKMA 1LTTD 3KLRA 2BA1A 5EGTA 2L5TA 5JJZA 4ZAIA 4FF2A 3TZUA 2D9UA 1H9JA 4ZRZA 4PV1C 3G7LA 3W2DA 3AU7A 1WTOA 3S2DB 1Y8OB 4K5VA 1ONLA 2ICEC 3E0JA 1I3QB 5JAVA 1SMYD 1GUGA 5JVG3 3QIAA 4F88A 2NZ1D 4DN4M 3D8GA 1A3VA 4NP5A 5M3MB 3GD7A 1B2TA 4BWGB 1V1PB 2WP8J 5CYUA 3L7ZC 5CV9A 1ILPA 3C1EA 2IL8A 4KD3A 3GTPB 3NQIA 4K6LA 2F0QA 3WDNA 1BQQT 2G9DA 5CC4A 1I4RA 5CGKA 1WTRA 3S17B 2RSOA 3H94A 3KLSA 1LLRD 3VR6A 4FF4A 2MP1A 1AW7A 5C0XH 5LL6S 2L12A 4BY1B 2RQXA 2XWJB 4F87A 5ELFA 1WTWA 2B2VC 4ID6A 2KCCA 4CKBA 3NK9A 3KBXA 1PXUA 3IAYA 5A35A 2JEBI 2H1EA 5C4ZA 4C56C 1IKLA 2FINB 1ENFA 1Q3LA 2R92B 2A5HA 3I8ZA 3I4NB 4HR7B 2JXMB 4HN7A 3VR4A 1PTOD 1HTLD 3K0YA 2MJ8A 3GTGB 2BA0A 1B3AA 3K59A 3A8KE 3DEOA 3EROA 2WAQB 2F0GA 1UNSA 2EYFA 4KKUA 1S5FD 4RWSC 5K5PA 4PMCA 2M2LA 4PMBA 4C3IB 2EYOA 3TP8A 4KI0A 3OMGA 1ENCA 4IUNA 2CW0D 2SNMA 3MXUA 1C4QA 1SXTA 3VA5A 4ZYSA 2B2UC 5KRUA 3R2IA 3KLSX 5K36H 2JE6I 3S14B 3MC0B 4OL7A 2FJ2A 4RFBA 2MUYA 5LL6X 1KDCA 2AWNA 4GZYC 1Z47A 2Q8TA 4WFN3 1E2VA 1FYCA 3PUZA 5KEEA 2HQEA 1H9KA 1S5ED 3OPOA 5C6AA 2PW7A 1EWCA 3CQZB 2EYLA 1TT2A 1Q1EA 1CI3M 1GUOA 2B2WA 2F4IA 3PUWA 3T16A 1YNJD 4RAUC 2KCNA 3SR1A 4G7HC 3K5MA 5CV8A 3RLFA 1SYEA 2WKCA 5A2QE 1JE4A 1EY0A 2Z1CA 2AQ1B 1F2LA 1H9SA 5D3IB 5JEAG 5DNFA 5A2QL 2ZXPA 1BBXC 4QB4A 3NHHA 2K32A 3JAME 2F0NA 3M4YA 2A68C 2E75C 3EVQA 1QOHA 3NBHA 5AFWA 3J80E 2N55A 3JAML 1GJXA 2XIWA 1EOTA 5CV4A 2GA4B 3OWFA 5KGUA 3J81L 3J80L 4B9XA 1EFID 1HFNA 1SBBB 3MAQA 1V1OA 1V43A 2KEEA 4EQNA 1SE4A 5JVH3 3K5NA 3R93A 4OO1H 5D65A 2OEOA 1STNA 2J4XA 4IFDJ 1YNNC 2F0PA 3H3VC 1LABA 1U4MA 1O7ZA 3M3YB 4J1MA 1BF4A 4HCSA 3ND8A 4IN3A 3R8BA 5C0XI 2FMMA 4I7ZC 4L8JA 4M8AA 2A69C 4ME5A 1WTPA 2KVMA 1F2ZA 1F9PA 4IURA 1QB5D 3A7AB 2WACA 5E3FA 1DCZA 2EY6A 1E2ZA 2N88A 3HZXA 4V0BA 2LFNA 3W3AA 3NTIA 3OWEB 4G4KA 3S15B 2F0EA 2TMPA 4XQQA 3OMCA 1A15A 3SK6A 4UAIA 2WKDA 2QILA 1F2YA 1SDFA 3I3CA 1VDZA 3A54A 3LWEA 1EY5A 4TSSA 1XWEA 4G7ZC 1JOKA 4R8NA 2PZUA 4BBRB 2L1BA 1LTGD 3BS1A 3F2UA 3G6JB 4TQUS 1G91A 1EWHA 2PYKA 1Q1BA 5I6WA 1UEAB 3BYTB 3T56B 1DOMA 2ID0A 4C3HB 2FFKB 2Z4IA 4FXGC 4K2KA 3Q24A 2BDOA 4PQXA 1CFMA 2LS01 3FEWX 4MIUA 1ESFA 1T5EA 3AB9A 4KY6A 4YIJA 3A55A 4KJOA 4E6IA 1I6VC 4IALA 5IODA 1HCZA 1TU2B 5DM63 1Q12A 3BDLA 4DAVA 5IT9L 1W6KA 2B2TA 3I90A 3TP6A 1HFGA 3MFGA 3D4DA 2FMCA 4ZKBB 2MPMA 3NXWA 3SHLA 1WTXA 4KY7A 1II3A 3PO3B 3DMUA 4KN4C 1TY0A 1STHA 4KTAA 4MHEA 3A8IE 1MD2D 3IFDA 4IUPA 2ZT9C 3BG3A 3HOUB 4QCLA 1TS5A 2NTTA 1S5CD 1Y69U 4IUTA 1GXDC 1SNOA 2R3ZA 3BYYB 4XYOA 5D3DA 1FNUA 1XX8A 2XRQD 2V4DA 3D6WA 5I9PA 2L9HA 5KIXA 5E1FA 1CQFA 1SAPA 3NQTA 3LX0A 1EIGA 3HGBA 1KDAA 3LNNA 3I72A 5HGTA 1PZID 2MHVA 3DWQA 1RTNA 5JEAH 3A8JE 3M4OB 1STYA 1Q90A 5T1IA 2BE5C 5CV7A 1XXGA 2A68D 5KNCA 4XYQA 3DXJC 1PRTC 1R9TB 2VXWA 1CHPD 3RD4A 2NVYB 4HSVA 4I65A 5FO9B 5T1GA 3P75A 2L55A 2RSNA 2IX0A 1A2UA 2AQ3B 3FPPA 4NDXA 1FD7D 5JPMC 3BVMA 1UUPA 2B2YA 5EPJA 1YNND 1LO5D 4FF1A 3PIP3 1SNMA 2BOSA 4R9WA 3H6MA 2CVRA 1O7YA 1I4HA 1Z6HA 4FP5D 1DJRD 1G2TA 2DNEA 4C3JG 1SJHD 2RA4A 3WOFA 3DEPA 3GTLB 2Z4HA 2K33A 4QUCA 1EIHA 2WV6D 1MBYA 4XT1B 4IFDI 4Q0FA 2A6HC 4RA8A 5F2DA 2KEDA 4V190 3N6RA 1ESRA 5EBCA 1TKWB 2QDBA 3SK8A 1BO0A 1D1IA 1XTCD 1OXVA 1OXUA 5DM73 1CZGA 3URYA 2NN6I 2K28A 1JQYD 4HMIA 3C2PA 4ABNA 2L0CA 1OO9B 1U4RA 2HUGA 3MA2B 1PFMA 2VB3X 4JK1C 3WOEA 2CQAA 1OXTA 1BDOA 1QJOA 1STBA 1F9SA 3T51B 4WRDA 1HQRD 2D2CC 4BY7B 4A93B 5C3WA 2HCIA 1DOKA 1NAPA 1LTAD 4RCOA 4PNYA 2YU9B 2BDNA 4FNFA 3C3LA 1EYAA 3GP7A 4IQZA 1B9MA 3SXHA 2FHTA 2J0TD 3O13A 5CV5A 1BXTA 2F0FA 3QJYA 5J1ZA 1HUNA 4CJ1B 1STEA 2KUMA 2KHSA 3TDQA 2EOTA 1PZJD 3KUPA 2MGSA 3X3MA 2DNCA 3T13A 2F0KA 3V96A 2XWBB 5BN5A 3VR2A 1HRJA 1HXYD 1JICA 1R4QB 3OW7A 5FOBB 3CRLC 1GHKA 4KY5A 2J7ZA 1J9OA 1RDPD 3GO5A 1DOLA 4X3TA 1CHQD 4ZKCB 3I4MB 2KA7A 3TP5A 3KF8A 1EZ6A 3I70A 1LT3D 1KLUD 2K5DA 4K8JA 4AYBB 2PQEA 5ELCA 3TSSA 3MXPA 1KAAA 2JA5B 3TBIB 2F0OA 1U4PA 2A74C 2B2VA 2F0TA 3K57A 2NYZD 4OGQC 3NTHA 1B9NA 1ZYRD 1WCMB 4DAYA 2AUJD 1ET9A 2TSSA 3HOZB 1KTKA 5D14A 1RD9D 4KHZA 4Y7NB 1PFNA 4F8MA 5I4DA 1RCVD 1QCBD 2PW5A 3NTKA 2IWHA 1AZQA 5CMDA 3S9WA 3GTOB 3HOVB 4LAAA 5M9OA 5FK9C 4K5XA 2ZXOA 2VUMB 2K04A 3FVQA 5I2YA 3HOWB 4RKLA 1FNVA 1SYCA 4DK1A 3RZDB 4RCNA 2B2UA 1OXXK 1RHPA 3ONAB 2A6ED 5IGBA 2K7VA 1SYBA 1S5BD 3EJIA 4BA1I 1B1ZA 3V2TA 5EJWA 2LMCB 3SK4A 2B39A 3MXNA 4CGYB 1KLGD 2K1BA 3VR3A 2B63B 4DXGA 2R6GA 3SDZA 1E0BA 1QWYA 1L0XB 4HCEA 3ERQA 1TWFB 2DY8A 4CKEA 4CJ2C 1WD1A 4RGNA 2KECA 3P1HA 4NMZA 2K05A 5M5XB 1ET6A 3ZYYX 5DAUA 4C1NI 1V1PA 3EQLC 3T53B 1DXMA 2EYPA 2DY7A 4EQOA 2PO4A 5EBDA 1EU4A 2SDFA 2Y0SB 4M1UB 4XQJA 2VB2X 2E74C 1L0YB 5C4HA 1RODA 3QB3A 5JPNC 3D4WA 2JA7B 3TN2A 2F0VA 3MHBA 2PMZB 2A6HD 4A3JB 3L9AX 4KD4A 2K5QA 4XT3B 5C4XB 3E5SA 1HTPA 3K5OA 5BN3A 4EQPA 4BBSB 4A3MB 1TS3A 3S1NB 3RUZA 1XYIA 1WTVA 1M8AA 4A3FB 1EY6A 1JWUD 4NKLA 2NBFA 3Q23A 4X3SA 1AN8A 3MTSA 3U9SA 1PRTB 4F7XA 1HHVA 1BCPB 3DWAA 2EJFC 1QG7A 1GOZA 3QOJA 1O78A 1WD0A 2K03A 4K6DA 1RKNA 4DGZA 2F0HA 2QCPX 3BDCA 2EZVA 5M3FB 1D1KA 5E4WC 2O2LD 1R4PB 2RVLA 3D6CA 4LMQD 3I4LA 2A73B 5JEAJ 3BDOA 5EPLA 2IJ0A 1F77A 3CU7A 2EXZA 2F0MA 4A3BB 5C3XA 4RGTA 1B50A 3MZ5A 3NWSA 1HQMC 3OIQA 4RHSA 3CHBD 1E2WA 3FPUB 3FMCA 5DEHA 2EY5A 1RF2D 1D5ZC 1LTRD 1PMRA 1IYUA 3OIPA 2NB0A 2L11A 4C2MB 3LWUA 4O42A 5IGFA 2WINB 1LV9A 3M85A 1SEBD 4BA2I 4A3EB 4DU9A 4B9WA 1NR4A 1I6HB 2R7ZB 3VYSA 1K83B 3C46A 1D2BA 3RMHA 4PMWA 3TZDA 1STAA 4DFAA 3PMFA 2RBMA 3GTJB 1DYQA 2PCFB 1S4ZA 4C3JB 3Q0AA 1TQOA 1EY4A 5ELEA 3A7LA 2F03A 1MGSA 2KOLA 1KNEA 3K5LA 1KDBA 4K8IA 4OO1I 4DXFA 4HAEA 1PFBA 1B53A 2RDFA 4IZ8A 3GTMB 5I2XA 1RTOA 1GHJA 4H7BA 1CM9A 2IT1A 4XTCS 1I50B 2WIIB 4HMJA 4C1NK 3I91A 4IUUA 3BVGA 1LTID 3GQBA 2QEJC 3S16B 4A3KB 2NUCA 1NUCA 1SYGA 4TKOB 3CKIB 4ULLA 1BCPC 1F2MA 4RGMA 4DNTB 1JORA 3K6OA 4XXEA 2JA8B 3M7GA 1K8MA 1IL8A 2JYOA 5G3LF 4MN3A 3PIO3 2QKIC 4B08A 1H9SB 1WVLA 1EYDA 2DN8A 5EQ0A 2SOBA 1DM0B 4HSPA 5IIFA 3MWYW 3K58A 2O4XA 4A3IB 4LJZC 1NCVA 1PLFA 4CKCA 4FO2A 4KN7C 5CV6A 4QUFA 3DHQA 1PRTF 3VYTA 1BCPF 2AUKA 1CA6A 2NTSA 1SE2A 2K6AA 1Y8PB 4HTHA 3R3OA 2WB1B 1IHZA 1EZ8A 1D5XC 1NR2A 5CBAE 2EY2A 3HKZB 2HDLA 2A69D 1EY7A 1I4PA 1OXSC 3J7AV 1I4QA 2XSCA 3KK7A 3GTKB 1Y8NB 3NSWA 1SNCA 4J6HA 1UAPA 1M4VA 5EPKA 3OHXC 1CQVA 2NVXB 5CBEE 5COYA 3SK5A 1IW7C 3PUXA 1K8OA 5ISRA 3MEHA 2JP1A 4Q5VA 2X69A 4FVMA 1STGA 4UDUC 1FGBD 2EY1A 3DWPA 4J8QA 3P7JA 5BN4A 2XN9C 3QWNA 2C5CA 1JWMD 1O7LA 4XQNA 1TVXA 2EVBA 3H09A 1KABA 1PTOH 4N9TA 4HEDA 1LTBD 5M5WB 2IX1A 2E2JB 1VCIA 4H0LC 1FR3A 1GUSA 5KYLA 3J7AF 4RHRA 2Q8IB 4IUVA 3M7NA 1TIID 4FXKC 1AEXA 4WORA 2F3WA 1D5MC 1SJED 2BCOA 2F0IA 3EFXD 2B2WC 4IFDG 1SFOB 2RKSA 1X3QA 1LACA 1G291 5FO8B 3EA6A 2E76C 3OSOA 1EEID 4G57A 4KKTA 3NBIA 2NN6G 1SNPA 3GTQB 3VYUA 2G9HD 3L3OC 3DM1A 2LKVA 1JCKB 1JWSD 1BUVT 5FO7B 1TWHB 1GUTA 1EL0A 1LT5D 1C48A 1DONA 1CA5A 1EYCA 3N52A 1ZEQX 3HEJA 5FLXE 1D6EC 2VNUD 3I73A 2R61A 3IL8A 3HRZC 1EQVA 1NSNS 3D4RA 5FLXL 3D31A 2K01A 2XVSA 2NWGA 4DA2A 5C3EB 3QG1A 4QMGA 3PUYA 5ELBA 1O80A 1SYFA 1SE3A 3S1MB 1X3PA 4BS9A 1Y1VB 5J22A 1EY8A 2X6LA 1Q8IA 5LHY1 1TWAB 2R93B 3BVZA 1ZKOA 1PDQA 5KYIA 1CZWA 2O5JC 3GV6A 5C5LA 4CBVA 5JOBA 1IYVA 1PYWD 5J39A 4H44C 1F9RA 5E4XA 4ZLTF 3Q6SA 2K5WA 2LY7A 1J8IA 2NVTB 4RH6A 2HDMA 3C1FA 3SEBA 3S1QB 1S5DD 5G3LD 2ICIA 3HP3A 3UI2A 2E2DC 4R8IA 1F9QA 3KBGA 1LTSD 4XIGS 2E2IB 2M9VA 1KNAA 1JOQA 3BZDB 3HOXB 3NWTA 1PTOB 2BE5D 1CTMA 1SSOA 2IW3A 1HA5A 1PRTD 2PNRC 1BCPD 5ELDA 3VA7A 2F0LA 2CHBD 4C3IG 4DAPA 3A56A 4K14A 3J81E 4U673 1JR0D 2QF7A 4ZUJA 4KJNA 3DUZA 1SNQA 2F0UA 1TWCB 4DF7A 1SNDA 4X3KA 5IGEA 4FXDA 3D3RA 1H9RA 2ENBA 2Q8RE 3P20A 2IX3A 4IUQA 3TMEA 1VMPA 2F1MA 4L6TB 4WJWA 2SNSA 3CRKC 2OXPA 3HS0C 1BOSA 2EYJA 1Y1WB 2OT2A 4TRDA 1AFPA 3S2HB 3TP7A 1TS4A 1CT1D 5FKAC 1GUWA 5M5YB 2EYMA 4NW2A 3U9OA 2PPBC 4ZQ3A 5EKIA 3AMUA 2F0WA 1ZXTA 2I07B 3QOLA 2EDGA 1QNKA 1SMYC 5CR3A 4O1NA 1IW7D 1JOOA 3V05A 3GV3A 4CHTB 2EE1A 4DNRB 2B2TC 4H13C 2JEAI 3SE0A 5I6YA 5CORA 2SEBD 1DZ1A 4JBWA 3J7YW 3NUCA 2L4NA 5HURA 3VR5A 2D62A 5C0XG 4FF3A 1I4XA 3MXGA 1A3TA 3VYRA 1EQTA 2F0DA 2ZXRA 2D5DA 2Z8LA 1VMCA 3QO2A 3S1RB 5KNBA 1B4OA 4EGVA 4KHVA 3FRPB 2EJGC 1LT4D 1ENAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5V A;  3TME A;  5C4H A;  3EVQ A;  2SNM A;  1SNM A;  1KAB A;  1STH A;  1SYD A;  1TR5 A;  2EY5 A;  2KQ3 A;  2F0J A;  2PW5 A;  2OXP A;  1SYF A;  4KTA A;  3H6M A;  1F2Y A;  3QB3 A;  5J22 A;  4N9T A;  1EY8 A;  2EYH A;  3D4W A;  3S9W A;  4S3S A;  2EYJ A;  3SXH A;  2F0V A;  5CV4 A;  4TRD A;  5I9O A;  3VA5 A;  3MHB A;  3TP7 A;  1EY5 A;  5KYL A;  3OWF A;  2M00 A;  3D8G A;  5CV5 A;  1A3V A;  2F0F A;  4NP5 A;  2F0S A;  4LAA A;  5J1Z A;  5KGU A;  5KYI A;  4K2L A;  5KRU A;  5C5L A;  4KD4 A;  4B9X A;  1EYD A;  5M9O A;  1SNO A;  5JOB A;  5IGF A;  4K5X A;  1JOK A;  4R8N A;  2PZU A;  5JAV A;  5J39 A;  2SOB A;  2KHS A;  3E5S A;  2EYM A;  1A3U A;  4EQN A;  3U9O A;  5IIF A;  4F8M A;  5CV9 A;  1AEX A;  2O4X A;  4ZQ3 A;  4OL7 A;  2OEO A;  4DU9 A;  4EQP A;  2F0W A;  2F3V A;  1STN A;  2F3W A;  4WOR A;  4B9W A;  1EY9 A;  1U9R A;  5I9P A;  3QOL A;  3C1E A;  5KIX A;  2F0I A;  4RKL A;  2PYK A;  1SYC A;  4KD3 A;  2F0K A;  1KDC A;  5CV6 A;  5E1F A;  3T13 A;  3C1F A;  3DHQ A;  2F0P A;  3NQT A;  4KV6 A;  3LX0 A;  5IGG A;  2F0Q A;  3RUZ A;  5I6W A;  5CC4 A;  1STA A;  4DFA A;  3PMF A;  1KDA A;  5CR3 A;  2RKS A;  2RBM A;  4RKB A;  5EKK A;  5CGK A;  5KEE A;  4QF4 A;  2HQE A;  1EY6 A;  1JOO A;  4NKL A;  5HGT A;  4HTH A;  5F2D A;  5IGB A;  3R3O A;  4J1M A;  1SYB A;  1IHZ A;  1EY4 A;  1TQO A;  4KY5 A;  4ID6 A;  3OSO A;  1EZ8 A;  3EJI A;  3NK9 A;  5NUC A;  4F7X A;  5C6A A;  2PW7 A;  2QDB A;  4G57 A;  3SK8 A;  2EY2 A;  4K2K A;  5C4Z A;  1EY7 A;  3V2T A;  5IOC A;  2SNS A;  2EYL A;  1JOQ A;  1SNP A;  1KDB A;  1TT2 A;  2OF1 A;  4K8I A;  3TP5 A;  3QOJ A;  3SK4 A;  4EVO A;  1EZ6 A;  1STY A;  4HMI A;  5IGE A;  4MIU A;  3T16 A;  1SNC A;  4J6H A;  4K8J A;  4ME5 A;  2PZT A;  5I6Y A;  2RDF A;  5IGC A;  5CV7 A;  4K5W A;  1RKN A;  4K6D A;  4KY6 A;  4IZ8 A;  2LKV A;  3SR1 A;  4YIJ A;  1F2Z A;  2F0L A;  2PQE A;  4DGZ A;  4ZUI A;  3NUC A;  3MXP A;  1KAA A;  4KJO A;  5CV8 A;  5C5M A;  4E6I A;  4H7B A;  5HUR A;  2F0H A;  1SYE A;  1A2T A;  2F0O A;  4IAL A;  3BDC A;  4K14 A;  3SK5 A;  1STB A;  4I65 A;  5IOD A;  5ISR A;  3ERQ A;  2F0T A;  3ITP A;  3BDL A;  3D6C A;  3P75 A;  1EYC A;  2WAC A;  1A3T A;  1EY0 A;  3HEJ A;  4HMJ A;  5E3F A;  3MEH A;  5IGD A;  2PZW A;  2EY6 A;  1JOR A;  2F0D A;  1A2U A;  4ZUJ A;  4WRD A;  5EGT A;  3HZX A;  3P1H A;  5EKL A;  4NDX A;  4N9P A;  4NMZ A;  3ERO A;  5C3W A;  2F0G A;  3TP6 A;  2EYF A;  4KJN A;  5K5P A;  1STG A;  1SNQ A;  2F0U A;  1EQV A;  2EXZ A;  2F0M A;  4ODG A;  3D4D A;  2EY1 A;  4PMC A;  5C3X A;  4DF7 A;  1NSN S;  2NUC A;  3MZ5 A;  4QB4 A;  5DAU A;  1NUC A;  3NHH A;  1SND A;  1SYG A;  4PMB A;  3NXW A;  4PNY A;  2EYP A;  2EYO A;  3NP8 A;  3TP8 A;  4EQO A;  3SHL A;  2F0N A;  2F0E A;  3OMC A;  4KY7 A;  4KHV A;  1EYA A;  1F2M A;  2ENB A;  1II3 A;  5DEH A;  4QMG A;  3MVV A;  3OMG A;  3SK6 A;  3DMU A;  1ENC A;  4IUN A;  1ENA A; 
#chains in the Genus database with same CATH topology
 1MJC A;  4LK1 C;  4MTK A;  1TR5 A;  2KQ3 A;  5C44 B;  1SYD A;  1PTO C;  2AQ2 B;  4IFD H;  4G7O C;  1HUM A;  2EYH A;  2B8F A;  1TWG B;  4S3S A;  5I9O A;  5IYC G;  2E2H B;  2EPB A;  3PUV A;  2K75 A;  2BH2 A;  1U4L A;  2RDH A;  3M4Q A;  4K2L A;  3FKI H;  3KJP A;  2NVQ B;  1ICW A;  4OIJ A;  4U68 A;  4CDF C;  2IPK D;  1A3U A;  3MFY A;  2QDL A;  1XNR Q;  2Z9H A;  3X3N A;  3CC4 A;  2NN6 H;  4KMU C;  1U9R A;  1JC7 A;  1Q81 C;  4X3U A;  2N3S A;  3FDT A;  1VQH A;  4R4I A;  4OX9 L;  2QGQ A;  2CW0 C;  2RDG A;  1T5X D;  5IGG A;  4KV6 A;  4DR1 L;  3GTK H;  1EEF D;  3E6Z X;  1NMF A;  3BZC A;  1RIP A;  1TY2 A;  4DK3 C;  1VF7 A;  4O2D A;  5EKK A;  5IT9 E;  2KJX A;  4RGO S;  1PTO F;  1JB3 A;  2NVX H;  1ILQ A;  1J6Q A;  3S2D H;  1H9M A;  4ZK9 B;  2CH4 W;  5K36 G;  3UDI A;  1S72 A;  1DD2 A;  5NUC A;  1P16 A;  1I3Q H;  1FJG Q;  1UE5 A;  2EJM A;  4KKS A;  2O5I C;  3UDF A;  1EIY B;  4EVO A;  1MSG A;  2HCC A;  2H4O A;  5IY0 A;  1ML0 D;  3SVM A;  3Q22 A;  3PO2 B;  1N34 Q;  2PZT A;  1WTQ A;  1B44 D;  4K5W A;  3PV0 A;  2UUA L;  4ZUI A;  1EU3 A;  2X6G A;  2DJF C;  2R7F A;  3G6E A;  2B2Y C;  3NPP A;  4OIK A;  4RG1 A;  1VF5 C;  1AE2 A;  1G2S A;  3ITP A;  1VQD A;  4B3T Q;  4A3G B;  1TS2 A;  5IGD A;  4GOP B;  2PZW A;  1I4G A;  2AWO A;  2E5L Q;  1HZ9 A;  5EKL A;  4N9P A;  3NEM A;  3K7A B;  2R7D A;  3S17 H;  1ZYR C;  3NE5 B;  3KF8 B;  4ODG A;  1XMQ Q;  2JA6 B;  1VQJ A;  4LF5 Q;  1K28 A;  1J5E L;  2JSO A;  4BY1 H;  1RJT A;  3NP8 A;  1YNJ C;  4BBR G;  1BR9 A;  4A3D B;  3HOY B;  2C9O A;  3MVV A;  4ILW A;  1Z7T A;  1IBL Q;  4P2C B;  1MIU A;  1G6Z A;  2F0J A;  2XNA C;  3STB C;  2R92 H;  3IKJ A;  3U4V A;  1YIT A;  2KEN A;  3QR8 A;  3I4N H;  3I4O A;  3T4A C;  1FNW A;  2M00 A;  1V8Q A;  4DAY B;  2F0S A;  1LT6 D;  2B8G A;  2RF4 A;  3R2T A;  5C4J B;  4QIW B;  4CDD C;  3ND9 A;  3A74 A;  1C8C A;  4OHJ A;  3GTG H;  3CMA A;  4C3H G;  2I46 A;  4DV7 Q;  2F3V A;  1G8Z D;  1ASZ A;  1EY9 A;  4X64 L;  1PZK D;  1X32 A;  1KXL A;  3KJO A;  1L1O B;  1MSH A;  1HNW L;  4KK7 A;  3H3V H;  3RZO B;  1JT8 A;  1HA6 A;  1HPC A;  1A6X A;  4DK0 A;  3F2D A;  3H0G B;  4RKB A;  4C3I H;  1W6J A;  2HIX A;  4QF4 A;  3HG9 A;  5C0X J;  4L63 B;  3IFT A;  4A4I A;  2B29 A;  2A6E C;  1QE6 A;  5TSS A;  2CCZ A;  3H91 A;  3OOC A;  1LUZ A;  4OO1 G;  4Z9C B;  1CK1 A;  4P74 A;  5IOC A;  1AP0 A;  2OF1 A;  3NBH B;  4X65 L;  3PCO B;  1QNU A;  2XRS D;  1GUN A;  5IGC A;  2YYZ A;  3PO2 G;  3S14 H;  4CJ0 B;  3FKI B;  4ALP A;  1T9H A;  4FYD A;  5C5M A;  1A2T A;  5KND A;  4XDX A;  1AZP A;  4QL5 A;  1QIL A;  1MI2 A;  5IE8 A;  1PH7 A;  4NPS A;  1BNZ A;  4PG3 A;  1IKM A;  1LTT D;  3KLR A;  2BA1 A;  5EGT A;  3TRE A;  2L5T A;  5JJZ A;  4ZAI A;  4LF8 Q;  3RR5 A;  3TZU A;  4FF2 A;  3OW2 A;  1HNZ L;  3KF6 B;  3MXN B;  2D9U A;  1H9J A;  4ZRZ A;  4PV1 C;  3A5U A;  3G7L A;  4AQY L;  3W2D A;  3ULL A;  4YWM A;  3CQZ H;  3AU7 A;  1WTO A;  4A3D G;  3HOY G;  3S2D B;  1Y8O B;  4K5V A;  1ONL A;  2ICE C;  3E0J A;  1I3Q B;  5JAV A;  3CPW A;  1SMY D;  1GUG A;  4DR5 Q;  1NJI C;  1SMX A;  5JVG 3;  3QIA A;  3CPF A;  4F88 A;  2NZ1 D;  4DN4 M;  3D8G A;  1A3V A;  4NP5 A;  2DGY A;  5M3M B;  3GD7 A;  1B2T A;  1JJC B;  4BWG B;  1E3P A;  3EBE A;  1V1P B;  4ME3 A;  3Q8D A;  2WP8 J;  5CYU A;  3L7Z C;  5CV9 A;  1ILP A;  3I56 A;  3TRZ A;  3K0X A;  3C1E A;  4IPD A;  2IL8 A;  5GAE C;  4DPG A;  4KD3 A;  3GTP B;  4IJH A;  3NQI A;  4GN4 B;  4K6L A;  2F0Q A;  3WDN A;  1BQQ T;  2G9D A;  1IBK Q;  5CC4 A;  1I4R A;  5CGK A;  1WTR A;  3S17 B;  2RSO A;  3H94 A;  3KLS A;  1LLR D;  3VR6 A;  1JB7 A;  4FF4 A;  3RN5 A;  2MP1 A;  1AW7 A;  5C0X H;  5LL6 S;  2L12 A;  4BY1 B;  1PYB A;  2RQX A;  2XWJ B;  4F87 A;  5ELF A;  1WTW A;  2B2V C;  4ID6 A;  2KCC A;  4CKB A;  3NK9 A;  3KBX A;  1FJG L;  1PXU A;  4JVZ A;  3IAY A;  5A35 A;  2JEB I;  2H1E A;  5C4Z A;  4C56 C;  2F3I A;  1VQK A;  1IKL A;  2FIN B;  1ENF A;  1Q3L A;  4OEM B;  2R92 B;  2A5H A;  3I8Z A;  1CKN B;  3I4N B;  4HR7 B;  2YV5 A;  2JXM B;  4JI1 Q;  2PMZ E;  4LF9 Q;  4GS3 A;  4HN7 A;  2JK8 A;  4AIM A;  3VR4 A;  1UEB A;  1PTO D;  1HTL D;  1SR3 A;  3K0Y A;  1A63 A;  2MJ8 A;  3CD6 A;  3GTG B;  1L1O C;  2BA0 A;  1B3A A;  3K59 A;  5IYC H;  2E5L L;  5J3B A;  3A8K E;  3DEO A;  3ERO A;  4QJF A;  2WAQ B;  2F0G A;  5GAD C;  4B3S L;  1UNS A;  2EYF A;  4KKU A;  1S5F D;  4RWS C;  5K5P A;  1EYG A;  4PMC A;  2ZTE A;  4LF5 L;  2M2L A;  4PMB A;  4C3I B;  3M3Y H;  2EYO A;  4P73 A;  4LFA Q;  3TP8 A;  2N78 A;  4LF4 Q;  4KI0 A;  3OMG A;  1ENC A;  4IUN A;  4LF7 Q;  2CW0 D;  3ZJY C;  2SNM A;  1IBL L;  2ZM6 L;  4JC0 A;  1WJJ A;  3MXU A;  2JJQ A;  1WFQ A;  1C4Q A;  1SXT A;  5LMN L;  3FHW A;  3VA5 A;  4ZYS A;  2CH4 A;  2B2U C;  4LUO A;  1X3G A;  5KRU A;  5M3M G;  3R2I A;  3KLS X;  1HZA A;  3CC7 A;  5HGQ A;  3CCU A;  5K36 H;  1YHQ A;  5H1S E;  2JE6 I;  4DAM A;  3S14 B;  3MC0 B;  2IHE A;  3EIV A;  4OL7 A;  4JBM A;  4DV7 L;  1X54 A;  2FJ2 A;  1XJV A;  4RFB A;  2MUY A;  1V9P A;  2VS1 A;  4JG2 A;  5LL6 X;  1KDC A;  2AWN A;  4GZY C;  1Z47 A;  5BR8 L;  3CAM A;  2Q8T A;  4WFN 3;  1E2V A;  1NNX A;  1FYC A;  3PUZ A;  4JCV E;  5KEE A;  3S15 H;  1NMG A;  2HQE A;  4GKK Q;  4HJA A;  1H9K A;  1EIF A;  4IPG A;  1S5E D;  3OPO A;  4JI5 Q;  5C6A A;  2PW7 A;  1EWC A;  3CQZ B;  3UDX A;  2EYL A;  1TT2 A;  1Q1E A;  1CI3 M;  4BY7 G;  2R92 G;  4A93 G;  1GUO A;  2B2W A;  2DJG C;  2F4I A;  3PUW A;  3T16 A;  1YNJ D;  4RAU C;  1K8G A;  2KCN A;  4BBR H;  3SR1 A;  3U50 C;  4G7H C;  3MEF A;  3K5M A;  5CV8 A;  3RLF A;  1SYE A;  3STB D;  2AMC B;  2WKC A;  5A2Q E;  1JE4 A;  1EY0 A;  1PFS A;  2Z1C A;  1E1O A;  2AQ1 B;  1M90 C;  3W5O A;  1F2L A;  1H9S A;  5D3I B;  2ASB A;  5JEA G;  4LF8 L;  5DNF A;  5A2Q L;  2ZXP A;  1VQ4 A;  2UUC Q;  2CWA A;  1BBX C;  4QB4 A;  3NHH A;  2K32 A;  2I5H A;  4YWL A;  3JAM E;  2F0N A;  1XTD A;  4C3H H;  3M4Y A;  2A68 C;  2E75 C;  1LYL A;  3EVQ A;  1QOH A;  1P8L A;  3NBH A;  5AFW A;  3J80 E;  2N55 A;  3JAM L;  3CW2 C;  4Y52 H;  1VQ6 A;  4DR5 L;  1IZ6 A;  1GJX A;  2XIW A;  1EOT A;  5CV4 A;  2GA4 B;  3OWF A;  5KGU A;  3J81 L;  3J80 L;  4B9X A;  1EFI D;  1HFN A;  1SBB B;  1X3E A;  3MAQ A;  1V1O A;  1V43 A;  2KEE A;  4EQN A;  1SE4 A;  5JVH 3;  2HD3 A;  3K5N A;  3R93 A;  4OO1 H;  5D65 A;  2OEO A;  1STN A;  2C35 B;  1VQE A;  2J4X A;  2V1C C;  1CKO A;  4IFD J;  1YNN C;  1LM0 A;  2F0P A;  3H3V C;  3I4M G;  5IYD G;  1LAB A;  1U4M A;  1O7Z A;  4AYB G;  1FGU A;  2Z6B A;  3M4P A;  3M3Y B;  1SLJ A;  4J1M A;  2JA5 G;  1BF4 A;  3PQI A;  4HCS A;  1B8A A;  3ND8 A;  4APV A;  4IN3 A;  2LSS A;  3R8B A;  5C0X I;  2FMM A;  4X64 Q;  4QQB X;  4I7Z C;  3TS0 A;  2OQ0 A;  4L8J A;  4M8A A;  2A69 C;  4ME5 A;  2VL6 A;  1WTP A;  2KVM A;  3HOZ G;  1F2Z A;  4JI1 L;  1F9P A;  4A3D H;  4IUR A;  1WI5 A;  1N36 L;  1QB5 D;  1HR0 W;  3A7A B;  2WAC A;  5E3F A;  1DCZ A;  2EY6 A;  1E2Z A;  2N88 A;  3HZX A;  4V0B A;  2LFN A;  3W3A A;  2MO0 A;  3HOV G;  3NTI A;  3OWE B;  4G4K A;  1Q46 A;  2AKW B;  3OTO Q;  3S15 B;  1WYD A;  4YCV A;  1CSQ A;  2F0E A;  2VUM G;  2TMP A;  4XQQ A;  3OMC A;  1A15 A;  3SK6 A;  4UAI A;  2WKD A;  1KL9 A;  3DLL A;  4LF7 L;  2UXC Q;  2WB1 E;  2QIL A;  1F2Y A;  3M4O H;  1SDF A;  3I3C A;  1AH9 A;  3HKZ E;  1VDZ A;  3A54 A;  3LWE A;  3LGJ A;  1EY5 A;  4TSS A;  1XWE A;  4G7Z C;  1KQS A;  3E9I A;  2ES2 A;  1R9T H;  1VQA A;  1JOK A;  4R8N A;  2PZU A;  4BBR B;  2L1B A;  1EFW A;  1LTG D;  2WFW A;  3BS1 A;  3F2U A;  1DGS A;  3G6J B;  1NTG A;  4TQU S;  1G91 A;  1CUK A;  1EWH A;  2PYK A;  1PH8 A;  1Q1B A;  5I6W A;  1YI2 A;  1UEA B;  2K5N A;  4POG A;  2B63 G;  3BYT B;  4GKK L;  3AFQ A;  3T56 B;  1DOM A;  1L2F A;  2ID0 A;  4C3H B;  4JI5 L;  2FFK B;  2Z4I A;  4FXG C;  4HJ9 A;  4K2K A;  5FLX c;  3Q24 A;  1A0I A;  2BDO A;  3KLW A;  4PQX A;  1CFM A;  1K9M C;  2LS0 1;  3FEW X;  4J15 A;  4IPC A;  4MIU A;  1ESF A;  1T5E A;  3AB9 A;  3UE1 A;  4JI0 L;  4KY6 A;  1A62 A;  4YIJ A;  4DR3 Q;  1HZB A;  3VDY A;  3A55 A;  4KJO A;  4P75 A;  4E6I A;  1I6V C;  4IAL A;  2Y0S G;  5IOD A;  1X56 A;  1HCZ A;  1TU2 B;  5DM6 3;  1Q12 A;  3BDL A;  4DAV A;  5IT9 L;  1B70 B;  3GTL H;  3T1H Q;  4N8F A;  1W6K A;  2B2T A;  4DV2 L;  2UXB Q;  3I90 A;  4UHV A;  2YTX A;  3TP6 A;  4JI7 L;  1HFG A;  5M3M H;  3MFG A;  3D4D A;  2UUC L;  4A3J G;  2OTJ A;  2FMC A;  2K5H A;  4ZKB B;  2MPM A;  3NXW A;  3AEV A;  3SHL A;  3CP0 A;  4GLA C;  1WTX A;  4KY7 A;  1II3 A;  3PO3 B;  3DMU A;  4KN4 C;  1HH2 P;  1TY0 A;  2B3G A;  2MNA A;  1STH A;  4KTA A;  1G51 A;  5FJ8 G;  4MHE A;  1U0L A;  3A8I E;  4A76 A;  3GTP H;  1MD2 D;  1VQM A;  4BBS G;  1WOC A;  2JQO A;  3IFD A;  2ZT9 C;  3BG3 A;  4IUP A;  3HOU B;  4QCL A;  1TS5 A;  1PV4 A;  4B3S Q;  1KAW A;  2NTT A;  1S5C D;  5GRO A;  2WAQ E;  4UP7 A;  1Y69 U;  4LF6 L;  3TQY A;  5DLQ E;  4IUT A;  1GXD C;  2CKZ B;  1SNO A;  2R3Z A;  3BYY B;  4DV1 Q;  4LW1 A;  4XYO A;  5D3D A;  1FNU A;  1XX8 A;  2XRQ D;  2V4D A;  3D6W A;  1CSP A;  5I9P A;  2L9H A;  5KIX A;  4BY7 H;  2ZM6 Q;  4GNX B;  4A93 H;  5E1F A;  1CQF A;  3CC2 A;  1SAP A;  3NQT A;  5LMN Q;  3LX0 A;  3FP9 A;  4DR2 L;  1EIG A;  3HGB A;  1MJE A;  1KDA A;  3A0J A;  3LNN A;  1IYJ B;  3I72 A;  2YU9 H;  4DV3 Q;  5HGT A;  2F52 A;  1PZI D;  2MHV A;  3DWQ A;  3J81 c;  4DUZ Q;  4YCU A;  5M3F G;  1RTN A;  5JEA H;  4HIK A;  4DR7 L;  1A8V A;  3A8J E;  3M4O B;  1QVG A;  4A3C G;  1STY A;  1Q90 A;  3AYH B;  5BR8 Q;  5T1I A;  1PH2 A;  2BE5 C;  5CV7 A;  1XXG A;  3RN2 A;  2A68 D;  5KNC A;  4XYQ A;  3DXJ C;  1YHB A;  1PRT C;  4DV0 L;  1R9T B;  2VXW A;  1CHP D;  3RD4 A;  1JMC A;  2NVY B;  2MO1 A;  1X3F A;  4HSV A;  4I65 A;  5FO9 B;  5T1G A;  3P75 A;  1VQG A;  4P71 A;  2L55 A;  4B3M Q;  2RSN A;  2IX0 A;  1A2U A;  3KDF B;  2AQ3 B;  3FPP A;  4NDX A;  3JC6 6;  1FD7 D;  4YY3 L;  1JJG A;  1YJ9 A;  5JPM C;  1QUQ B;  3BVM A;  3OTO L;  1UUP A;  1U5K A;  2B2Y A;  5EPJ A;  1YNN D;  1S40 A;  3PO3 G;  1LO5 D;  4FF1 A;  2UXC L;  3PIP 3;  1SNM A;  1Y14 B;  4UP9 A;  2BOS A;  3I4M H;  4R9W A;  3H6M A;  2CVR A;  2R7Z G;  5IYD H;  3F1Z A;  3DM3 A;  1O7Y A;  1I4H A;  3HOU G;  1Z6H A;  4B3R L;  1BKB A;  5FLM H;  1XPU A;  2ALY B;  4FP5 D;  1DJR D;  2JA5 H;  3CCR A;  1G2T A;  2DNE A;  4C3J G;  1SJH D;  2RA4 A;  3ER0 A;  1N32 Q;  2ZJQ A;  3WOF A;  3DEP A;  1WCM H;  3GTL B;  2Z4H A;  4NXN L;  2K33 A;  4QUC A;  1FL0 A;  3HOZ H;  1EIH A;  3BU2 A;  2WV6 D;  1MBY A;  4XT1 B;  4IFD I;  3F8T A;  4Q0F A;  4Y7N H;  2A6H C;  4RA8 A;  5F2D A;  2KED A;  4V19 0;  2PQA A;  3N6R A;  1ESR A;  5EBC A;  4LFB Q;  5EAY A;  5HY6 A;  1TKW B;  2QDB A;  3SK8 A;  1BO0 A;  1D1I A;  1XTC D;  1OXV A;  3CCS A;  1OXU A;  5DM7 3;  1CZG A;  3URY A;  3HOV H;  1FVI A;  2NN6 I;  1E7Z A;  1JQY D;  2K28 A;  4HMI A;  4ABN A;  3C2P A;  3S24 A;  1PVO A;  2KHI A;  2L0C A;  2PI2 A;  2YTV A;  2VUM H;  1OO9 B;  4DKA C;  1U4R A;  2HUG A;  3MA2 B;  1IBM L;  4DR3 L;  1PFM A;  3AQQ A;  2VB3 X;  4JK1 C;  3WOE A;  2CQA A;  1OXT A;  1BDO A;  1KC8 C;  1KRT A;  1QJO A;  1STB A;  4GNX C;  3OYY A;  4DUY Q;  3U58 A;  1F9S A;  3T1H L;  3T51 B;  1W2B A;  1K0S A;  2JA8 G;  3RZD H;  4WRD A;  1HQR D;  2UXB L;  4DV6 Q;  2D2C C;  4BY7 B;  4OON A;  2Z6K C;  4A93 B;  4JOI C;  5C3W A;  2HCI A;  1DOK A;  1NAP A;  1LTA D;  3ULJ A;  1BVS A;  4OWT B;  4RCO A;  4PNY A;  4RMF A;  2YU9 B;  2N8N A;  2BDN A;  4FNF A;  3C3L A;  1EYA A;  1N36 Q;  3GP7 A;  4A3I G;  1Q7Y C;  4JYA Q;  4IQZ A;  1B9M A;  1GVP A;  2Q2I A;  4LFC L;  2MFI A;  3SXH A;  2FHT A;  2J0T D;  3O13 A;  2B63 H;  5CV5 A;  5IT9 c;  1BXT A;  2F0F A;  3QJY A;  5J1Z A;  1HUN A;  4R1J A;  4CJ1 B;  2LXK A;  1STE A;  2KUM A;  4DV1 L;  2KHS A;  3TDQ A;  2EOT A;  2Z0S A;  1TWF H;  1PZJ D;  2WB1 G;  1YIJ A;  1K0R A;  1N9W A;  3KUP A;  2HHH L;  2MGS A;  4BXX G;  3X3M A;  2DNC A;  2MQH A;  3T13 A;  2F0K A;  3V96 A;  5M5X H;  2Q2T A;  2XWB B;  5BN5 A;  3VR2 A;  1HRJ A;  2GVB A;  1HXY D;  1JIC A;  1R4Q B;  3OW7 A;  5FOB B;  5L37 A;  3CRL C;  1GHK A;  5IP7 G;  4YCW A;  4UP8 A;  4OWW B;  1VQ7 A;  1KIX A;  4DV3 L;  1V1Q A;  5E7N A;  2PI2 E;  3TS2 A;  4KY5 A;  4DUZ L;  4GOP A;  2J7Z A;  1J9O A;  1RDP D;  3GO5 A;  5JJL A;  1DOL A;  2JA7 H;  4X3T A;  1CHQ D;  3W1G A;  4ZKC B;  3I4M B;  2KA7 A;  3TP5 A;  3KF8 A;  4HJ5 A;  3I70 A;  1EZ6 A;  4A3J H;  1LT3 D;  1KLU D;  2K5D A;  3I2Z A;  4K8J A;  4AYB B;  2PQE A;  5ELC A;  3UE0 A;  1VQO A;  3TSS A;  3H3V I;  3MXP A;  1KAA A;  2JA5 B;  3TBI B;  2F0O A;  1U4P A;  2A74 C;  2B2V A;  2QA4 A;  5FJ8 H;  2F0T A;  4L5R C;  1NE3 A;  4GKJ Q;  3K57 A;  4BBS H;  2NYZ D;  4JI8 Q;  4OGQ C;  3NTH A;  1B9N A;  4B3M L;  1ZYR D;  3S1N H;  4OEL B;  4DV5 L;  1WCM B;  3E3X A;  4DAY A;  4JPB W;  2RHQ B;  2AUJ D;  3H15 A;  1ET9 A;  2TSS A;  1XPR A;  4UY8 C;  3HOZ B;  2JA9 A;  1KTK A;  4P72 A;  4JI0 Q;  4HJ8 A;  5D14 A;  1EWI A;  1RD9 D;  4KHZ A;  4Y7N B;  1C9O A;  1TXY A;  1PFN A;  4F8M A;  5I4D A;  2HIV A;  1RCV D;  4KHP L;  1H95 A;  1VQF A;  1QCB D;  2PW5 A;  1L1O A;  3NTK A;  2IWH A;  4DV2 Q;  1AZQ A;  5CMD A;  3S9W A;  2G5D A;  3HKS A;  3W1B A;  1YEZ A;  3GTO B;  4JI7 Q;  2UUB L;  1N33 Q;  3HOV B;  4LAA A;  2IHF A;  3U4Z A;  1D7Q A;  2OCE A;  5M9O A;  5FK9 C;  4K5X A;  2ZXO A;  2VUM B;  4DR6 Q;  2K04 A;  3FVQ A;  4MTN A;  5M3F H;  4JI3 L;  2GN5 A;  5I2Y A;  4GN3 B;  1N32 L;  3HOW B;  1PA6 A;  4RKL A;  1FNV A;  1SYC A;  1YNX A;  4A3C H;  4DK1 A;  1X55 A;  2A8V A;  1UE7 A;  3RZD B;  1N8R C;  4RCN A;  2B2U A;  1OXX K;  2EXD A;  4LF6 Q;  1RHP A;  3ONA B;  2A6E D;  5IGB A;  2K7V A;  4NXM L;  1SYB A;  1S5B D;  3EJI A;  4BA1 I;  1QVF A;  1ICF B;  4LFB L;  5GAG C;  1AE3 A;  2OQK A;  1B1Z A;  4QY7 A;  3V2T A;  5EJW A;  2LMC B;  1XMO Q;  3SK4 A;  1YBY A;  2B39 A;  3KF6 A;  3MXN A;  4CGY B;  1KLG D;  4DR2 Q;  2K1B A;  4C2M H;  5IYB G;  1B7Y B;  3NEL A;  3VR3 A;  2B63 B;  2ATW A;  4DXG A;  2R6G A;  3SDZ A;  1E0B A;  1QWY A;  3ICE A;  4X6A H;  1L0X B;  4NB3 A;  2K50 A;  5FLM G;  4HCE A;  2HT1 A;  3PO3 H;  4QIW E;  1VS0 A;  5C3E G;  5GQO A;  3ERQ A;  4GN5 A;  1TWF B;  2R7Z H;  1I6H H;  3KOJ A;  4DUY L;  2DY8 A;  4CKE A;  2QEX A;  4CJ2 C;  1WD1 A;  4RGN A;  1K83 H;  4DR7 Q;  3HOU H;  2KEC A;  3P1H A;  1Y1V G;  4NMZ A;  2VQF L;  4DV6 L;  2K05 A;  3F2B A;  5M5X B;  1WCM G;  2R93 G;  3GTJ H;  2L15 A;  3BJU A;  1ET6 A;  3K81 C;  3K8A A;  1L0W A;  3ZYY X;  5DAU A;  1V1P A;  4C1N I;  4C3J H;  3EQL C;  3T53 B;  1DXM A;  2EYP A;  2DY7 A;  4EQO A;  4DV0 Q;  4A75 A;  2PO4 A;  5EBD A;  1EU4 A;  2SDF A;  2Y0S B;  4M1U B;  4XQJ A;  2VB2 X;  4HIO A;  4A3L G;  2E74 C;  5IP9 G;  4POF A;  1L0Y B;  3HFZ B;  5C4H A;  1PYS B;  5AJ3 Q;  4JYA L;  4JI4 L;  5LMU L;  1MKH A;  1ROD A;  3QB3 A;  5JPN C;  3D4W A;  2JA7 B;  3TN2 A;  2F0V A;  1O7I A;  4YY3 Q;  3MHB A;  1GM5 A;  1BBW A;  2PMZ B;  2A6H D;  4A3J B;  3RLO A;  3L9A X;  3GTM H;  4KD4 A;  2K5Q A;  4XT3 B;  5C4X B;  3E5S A;  4GLV B;  1HTP A;  1I50 H;  3K5O A;  5BN3 A;  4PZ7 A;  4EQP A;  4AH6 A;  3J7A 5;  1Q86 C;  3HOW G;  4BBS B;  4A3M B;  1TS3 A;  3G71 A;  1CKN A;  3S1N B;  3HOX G;  1JJ2 A;  3S16 H;  3RUZ A;  1XYI A;  4A3K H;  4B3R Q;  1WTV A;  1M8A A;  4KLK A;  4A3F B;  1EY6 A;  1JWU D;  4NKL A;  2NBF A;  3Q23 A;  4X3S A;  2NVY H;  1AN8 A;  3MTS A;  3U9S A;  3IRB A;  4JI2 Q;  1MHW C;  1PRT B;  4F7X A;  1HHV A;  2JA8 H;  3NEN A;  1BCP B;  3DWA A;  1D8L A;  2EJF C;  1QG7 A;  1GOZ A;  4NXN Q;  3QOJ A;  1O78 A;  1KHI A;  1WD0 A;  2CWP A;  2K03 A;  1PH5 A;  4K6D A;  1RKN A;  3J81 j;  2D0O A;  4DGZ A;  1XPO A;  3ERS X;  4IPH A;  4A3I H;  2F0H A;  2QCP X;  1SE8 A;  3BDC A;  2EZV A;  3J81 i;  1D1K A;  5E4W C;  5GAH C;  5M3F B;  2IY5 B;  3J80 i;  2O2L D;  1R4P B;  2RVL A;  4X62 L;  3D6C A;  4LMQ D;  4GKJ L;  3I4L A;  4JI8 L;  1EUJ A;  2A73 B;  5JEA J;  3BDO A;  5EPL A;  1WTH A;  2IJ0 A;  1F77 A;  3CU7 A;  1Y1W G;  4FDB A;  2EXZ A;  2F0M A;  4A3B B;  5C3X A;  1UE1 A;  3BZK A;  4RGT A;  1B50 A;  3MZ5 A;  3NWS A;  1IBM Q;  1HQM C;  3OIQ A;  4RHS A;  3I7F A;  4BXX H;  2KBN A;  1C0A A;  3CHB D;  1E2W A;  3FPU B;  3FMC A;  4LUV A;  4LWC A;  5DEH A;  3SGI A;  2VW9 A;  1X9N A;  5IWA Q;  2EY5 A;  1RF2 D;  1D5Z C;  4HID A;  3G48 A;  3CCQ A;  1LTR D;  1PMR A;  4K0K Q;  1IYU A;  1EQR A;  3OIP A;  2NB0 A;  5IP7 H;  2JA7 G;  1N33 L;  4X66 Q;  2I5M X;  2L11 A;  4C2M B;  3LWU A;  3T1Y Q;  4O42 A;  3GDE A;  1YVC A;  5IGF A;  2WIN B;  4IO9 A;  3E9H A;  1LV9 A;  2D0P A;  2DUD A;  5C4X G;  4OXP A;  4DR6 L;  3M9B A;  3M85 A;  2I5L X;  1SEB D;  4BA2 I;  4A3E B;  4DU9 A;  4B9W A;  1PH6 A;  1NR4 A;  1I6H B;  2R7Z B;  3VYS A;  1NBW A;  3CCJ A;  3TEH B;  1K83 B;  4LFC Q;  4A3M G;  3C46 A;  1K8A C;  3CXC A;  1D2B A;  3RMH A;  4PMW A;  3TZD A;  2N49 A;  1STA A;  4DFA A;  3PMF A;  2RBM A;  1IL2 A;  3GTJ B;  2XGT A;  1DYQ A;  2PCF B;  1YJN A;  1S4Z A;  1GKH A;  4A3F G;  4C3J B;  3Q0A A;  1TQO A;  1EY4 A;  1UE6 A;  2NZH A;  2RCF A;  1X65 A;  5ELE A;  1HZC A;  1EOV A;  3A7L A;  2HHH Q;  2F03 A;  1B3Q A;  1MGS A;  2KOL A;  1KNE A;  3K5L A;  4GLX A;  2RCN A;  5M5W H;  2E2J H;  1G6P A;  1KDB A;  4K8I A;  4OO1 I;  4DXF A;  4HAE A;  1XMO L;  1HR0 Q;  1PFB A;  1K3B C;  1B53 A;  4HJ7 A;  2RDF A;  4IZ8 A;  3JAM c;  2PNH A;  3GTM B;  5I2X A;  1RTO A;  1GHJ A;  4LNQ A;  4H7B A;  5JJI A;  4JV5 Q;  1CM9 A;  1Z9F A;  3J80 c;  2IT1 A;  4XTC S;  1I50 B;  4DV4 L;  2WII B;  1VQ9 A;  1QZH A;  4HMJ A;  1K73 C;  1VQL A;  5C44 G;  3KFU A;  4C1N K;  3I91 A;  4IUU A;  4JI6 L;  1SFO H;  3BVG A;  1LTI D;  3GQB A;  2QEJ C;  3S16 B;  4A3K B;  2NUC A;  4A3B G;  1NUC A;  1SYG A;  1RL2 A;  4TKO B;  2E8G A;  1VQP A;  4AYB E;  3CKI B;  1JE5 A;  4ULL A;  1BCP C;  1IXR A;  1F2M A;  4RGM A;  4DNT B;  1JOR A;  3K7U C;  2I0Q A;  1YHA A;  5AJ3 L;  3K6O A;  3ULP A;  1K3R A;  4XXE A;  2JA8 B;  3GTQ H;  3M7G A;  1K8M A;  3CCV A;  1IL8 A;  2JYO A;  4MZ9 A;  4DV5 Q;  1QVC A;  1HNX L;  5G3L F;  4MN3 A;  3PIO 3;  2QKI C;  4B08 A;  1H9S B;  1WVL A;  1EYD A;  1S3O A;  2DN8 A;  1TWH H;  2SOB A;  5EQ0 A;  1DM0 B;  4HSP A;  4L5S A;  1PH3 A;  5IIF A;  3MWY W;  3K58 A;  2O4X A;  1SN8 A;  4N8X 1;  4A3I B;  4LJZ C;  1NCV A;  1E24 A;  4WJ3 M;  4A3E G;  4KHP Q;  1PLF A;  4CKC A;  4FO2 A;  4KN7 C;  5CV6 A;  4QUF A;  5IYB H;  4L5T A;  3DHQ A;  1PHJ A;  1PRT F;  3VYT A;  1E1T A;  1BCP F;  2UUB Q;  2AUK A;  4ZCK A;  1CA6 A;  2F4V L;  2NTS A;  1SE2 A;  2K6A A;  2CFM A;  3G4S A;  1VQ8 A;  1Y8P B;  4HTH A;  5C3E H;  2ZTD A;  3R3O A;  2WB1 B;  5ELO A;  1IHZ A;  4JI3 Q;  2UU9 L;  1I94 L;  1EZ8 A;  3EN2 A;  4JI2 L;  1D5X C;  1NR2 A;  3S1M H;  4LUZ A;  2EY2 A;  3HKZ B;  1Y1V H;  5CBA E;  4A3G G;  2HDL A;  2A69 D;  1EY7 A;  1I4P A;  1OXS C;  1TWA H;  4YWK A;  2R93 H;  4O0A A;  3J7A V;  1YZ6 A;  1I4Q A;  2XSC A;  3KK7 A;  3GTK B;  1Y8N B;  3NSW A;  1SNC A;  4J6H A;  1GD7 A;  2BH8 A;  2JA6 G;  2ZJR A;  4YHH Q;  1I5F A;  1UAP A;  1M4V A;  4A3L H;  5EPK A;  3OHX C;  5IP9 H;  1CQV A;  2NVX B;  4NXM Q;  1GO3 E;  5CBE E;  4OWX B;  5COY A;  3SK5 A;  1IW7 C;  3PUX A;  1K8O A;  5ISR A;  3A5Z B;  2K4K A;  4CDC C;  1XNQ Q;  2NVT H;  3MEH A;  2ZJP A;  1X6O A;  5ELN A;  3GTO H;  2JP1 A;  4Q5V A;  2X69 A;  3S1Q H;  4FVM A;  1STG A;  4UDU C;  1FGB D;  2EY1 A;  3DWP A;  4J8Q A;  3P7J A;  1KD1 C;  2HQL A;  5BN4 A;  2UXD Q;  2XN9 C;  3QWN A;  4A3K G;  2C5C A;  1EQQ A;  1JWM D;  1O7L A;  4XQN A;  2VZA A;  1XNR L;  1TVX A;  4GOP C;  2E2I H;  3HOW H;  2EVB A;  3H09 A;  1KAB A;  5IWA L;  3HOX H;  1Q82 C;  1PTO H;  4N9T A;  2NZO A;  3UDG A;  4HED A;  1LTB D;  5M5W B;  2VQF Q;  2IX1 A;  2E2J B;  1VCI A;  4K0K L;  4H0L C;  1FR3 A;  1GUS A;  5KYL A;  3J7A F;  4X66 L;  4JW0 A;  3H0G G;  3T1Y L;  3AFP A;  4RHR A;  2K14 A;  1VQN A;  4WJ4 A;  2Q8I B;  4IUV A;  3M7N A;  1TII D;  4FXK C;  1AEX A;  2JN4 A;  2Y0S E;  4WOR A;  2F3W A;  1D5M C;  1SJE D;  2BCO A;  2F0I A;  5LMU Q;  4JI4 Q;  3EFX D;  3J7Z C;  4R4Q A;  1VQC A;  2RHS B;  2B2W C;  4IFD G;  1TWC H;  1SFO B;  1N34 L;  4TVA B;  2RKS A;  1X3Q A;  1LAC A;  1G29 1;  2A1A A;  3EA6 A;  5FO8 B;  4DR4 Q;  3FKI G;  2E76 C;  3E0E A;  4HIM A;  3OSO A;  1EEI D;  4G57 A;  4B3T L;  4KKT A;  3NBI A;  2NN6 G;  1Y1W H;  3HKZ G;  1BBU A;  1W3S A;  4H02 A;  3S2H H;  1SNP A;  1VQB A;  3GTQ B;  3VYU A;  2G9H D;  1HR0 L;  3L3O C;  1XMQ L;  3DM1 A;  3PF4 A;  5M5Y H;  2LKV A;  3L2P A;  2QW7 A;  1JCK B;  1JWS D;  4MNO A;  2ZTC A;  1CKM A;  3WWV A;  1BUV T;  5FO7 B;  1PH4 A;  1KRS A;  1TWH B;  1GUT A;  4JV5 L;  1EL0 A;  1LT5 D;  1C48 A;  1DON A;  2YTY A;  1EYC A;  3N52 A;  1ZEQ X;  1CA5 A;  3HEJ A;  1E22 A;  5FLX E;  1D6E C;  2VNU D;  3I73 A;  2R61 A;  3CCE A;  3IL8 A;  3HRZ C;  1EQV A;  4DK6 C;  2VQE Q;  5C4X H;  1NSN S;  4QGU A;  3D4R A;  5FLX L;  3B6Y A;  3D31 A;  2K01 A;  2XVS A;  2NWG A;  4DA2 A;  1SRU A;  3QG1 A;  4QMG A;  5C3E B;  3PUY A;  5ELB A;  4GNX A;  1O80 A;  4X62 Q;  2P5Z X;  4A3M H;  1SYF A;  1SE3 A;  3S1M B;  1X3P A;  4BS9 A;  4R4T A;  1Y1V B;  5J22 A;  1EY8 A;  2X6L A;  2XTI A;  2Z6K A;  1Q8I A;  5LHY 1;  4JOI A;  1TWA B;  2R93 B;  3BVZ A;  3L0O A;  1ZKO A;  1PDQ A;  5KYI A;  4R4O A;  1CZW A;  2O5J C;  3GV6 A;  5JJK A;  5C5L A;  4CBV A;  4A3F H;  4EQ5 A;  5JOB A;  1IYV A;  1PYW D;  5J39 A;  4H44 C;  1F9R A;  5E4X A;  4BY1 G;  4ZLT F;  1PH1 A;  3Q6S A;  1VQ5 A;  2K5W A;  2LY7 A;  1J8I A;  2NVT B;  4OX9 Q;  4RH6 A;  2HDM A;  3C1F A;  2FXQ A;  4DR1 Q;  3KYH C;  3SEB A;  2K52 A;  3S1Q B;  1S5D D;  3I4N G;  5G3L D;  2ICI A;  3S1R H;  3HP3 A;  3UI2 A;  2E2D C;  4R8I A;  1C7Y A;  4DNI A;  1F9Q A;  3RNU A;  4JBJ A;  3KBG A;  5C44 H;  4IOC A;  1LTS D;  4XIG S;  3CCL A;  2E2I B;  3KDF A;  2M9V A;  1TWG H;  1KNA A;  1JOQ A;  3BZD B;  4EX5 A;  3HOX B;  3NWT A;  2E2H H;  1PTO B;  2BE5 D;  1CTM A;  2WAQ G;  4A3B H;  1QUQ A;  1SSO A;  2IW3 A;  1HA5 A;  1PRT D;  2EQS A;  2GVA A;  2PNR C;  3PSI A;  2NVQ H;  1BCP D;  5ELD A;  3VA7 A;  2UUA Q;  2F0L A;  4YHH L;  2CHB D;  4C3I G;  4DAP A;  3A56 A;  4K14 A;  2Q2H A;  4L5Q A;  3J81 E;  1NY4 A;  4U67 3;  2CQO A;  1XNQ L;  1JR0 D;  2QF7 A;  4ZUJ A;  4R4C A;  3I55 A;  3K80 C;  4KJN A;  3DUZ A;  1SNQ A;  2F0U A;  3D0F A;  3CME A;  1TWC B;  1J5E Q;  4DF7 A;  2UXD L;  1SND A;  4X3K A;  1PH9 A;  1OTC A;  5IGE A;  3RLN A;  4FXD A;  3D3R A;  4CDE C;  2KHJ A;  4A3E H;  1H9R A;  2ENB A;  2Q8R E;  3P20 A;  2IX3 A;  1QZG A;  4IUQ A;  3TME A;  1VMP A;  2F1M A;  4L6T B;  4WJW A;  4DV4 Q;  2SNS A;  3CRK C;  2OXP A;  3HS0 C;  3CCM A;  1BOS A;  2EYJ A;  3CF5 A;  1Y1W B;  4JI6 Q;  2OT2 A;  4TRD A;  1AFP A;  3PO2 H;  3S2H B;  1IBK L;  3TP7 A;  1TS4 A;  2OWO A;  1CT1 D;  5FKA C;  1GUW A;  5M5Y B;  2A19 A;  2EYM A;  4NW2 A;  4PZ8 A;  3U9O A;  2PPB C;  4A3G H;  4ZQ3 A;  5EKI A;  3AMU A;  2F0W A;  1ZXT A;  2I07 B;  3QOL A;  2EDG A;  1QNK A;  3K7A H;  2KCT A;  1HNW Q;  1HNX Q;  2JA6 H;  1SMY C;  5CR3 A;  2LXJ A;  4O1N A;  1UWV A;  4IOA A;  2OTL A;  1IW7 D;  4LF9 L;  1JOO A;  3HOY H;  3V05 A;  3GV3 A;  4DR4 L;  1SRO A;  4CHT B;  2EE1 A;  2AHO B;  3PIO A;  5LMN W;  4DNR B;  2B2T C;  1LTL A;  4H13 C;  1ASY A;  4UPA A;  4X65 Q;  2JEA I;  3PF5 A;  3SE0 A;  2F4V Q;  5I6Y A;  5COR A;  5C4J H;  2K5V A;  2SEB D;  1DZ1 A;  4I7A A;  4LFA L;  3PIP A;  4JBW A;  3J7Y W;  3NUC A;  3F2C A;  2L4N A;  5HUR A;  3VR5 A;  4LF4 L;  2UU9 Q;  2D62 A;  1YJW A;  5C0X G;  1I94 Q;  2Q2U A;  4FF3 A;  2PQA B;  1I4X A;  3MXG A;  1A3T A;  4IJL A;  4JBK A;  2KCM A;  3VYR A;  1EQT A;  2F0D A;  3RZO H;  4PZ6 A;  1HJP A;  2ZXR A;  3H0G H;  1HNZ Q;  2D5D A;  2Z8L A;  1VMC A;  2VQE L;  2VY3 A;  3QO2 A;  3JAM i;  3S1R B;  3PGZ A;  5KNB A;  1B4O A;  1Q8K A;  1VQI A;  2H5X A;  4EGV A;  4AQY Q;  4KHV A;  1M1K C;  3FRP B;  2EIF A;  2EJG C;  1LT4 D;  1ENA A; 
#chains in the Genus database with same CATH homology
 4LK1 C;  1TR5 A;  2KQ3 A;  5C44 B;  1SYD A;  1PTO C;  2AQ2 B;  4IFD H;  4G7O C;  1HUM A;  2EYH A;  2B8F A;  1TWG B;  4S3S A;  5I9O A;  2E2H B;  2EPB A;  3PUV A;  1U4L A;  2RDH A;  4K2L A;  2NVQ B;  1ICW A;  4OIJ A;  4U68 A;  2IPK D;  1A3U A;  3MFY A;  3X3N A;  2NN6 H;  4KMU C;  1U9R A;  1JC7 A;  4X3U A;  3FDT A;  2CW0 C;  2RDG A;  1T5X D;  5IGG A;  4KV6 A;  1EEF D;  3E6Z X;  1TY2 A;  1VF7 A;  5EKK A;  5IT9 E;  2KJX A;  4RGO S;  1PTO F;  1JB3 A;  1ILQ A;  1H9M A;  4ZK9 B;  5K36 G;  1DD2 A;  5NUC A;  2EJM A;  4KKS A;  2O5I C;  4EVO A;  1MSG A;  2HCC A;  2H4O A;  1ML0 D;  3SVM A;  3Q22 A;  3PO2 B;  2PZT A;  1WTQ A;  1B44 D;  4K5W A;  3PV0 A;  4ZUI A;  1EU3 A;  2X6G A;  2B2Y C;  3NPP A;  4OIK A;  1VF5 C;  1G2S A;  3ITP A;  4A3G B;  1TS2 A;  5IGD A;  2PZW A;  1I4G A;  2AWO A;  5EKL A;  4N9P A;  3K7A B;  1ZYR C;  3NE5 B;  4ODG A;  2JA6 B;  2JSO A;  1RJT A;  3NP8 A;  1YNJ C;  1BR9 A;  4A3D B;  3HOY B;  2C9O A;  3MVV A;  4ILW A;  1Z7T A;  4P2C B;  1G6Z A;  2F0J A;  2XNA C;  3IKJ A;  3T4A C;  1FNW A;  2M00 A;  1V8Q A;  2F0S A;  1LT6 D;  2B8G A;  3R2T A;  5C4J B;  4QIW B;  3ND9 A;  1C8C A;  4OHJ A;  4C3H G;  2I46 A;  2F3V A;  1G8Z D;  1EY9 A;  1PZK D;  1X32 A;  1MSH A;  4KK7 A;  3RZO B;  1HA6 A;  1HPC A;  1A6X A;  4DK0 A;  3H0G B;  4RKB A;  1W6J A;  4QF4 A;  3HG9 A;  5C0X J;  4L63 B;  3IFT A;  2A6E C;  1QE6 A;  5TSS A;  3H91 A;  3OOC A;  4OO1 G;  4Z9C B;  1CK1 A;  5IOC A;  1AP0 A;  2OF1 A;  1QNU A;  2XRS D;  1GUN A;  5IGC A;  2YYZ A;  4CJ0 B;  3FKI B;  4FYD A;  5C5M A;  1A2T A;  5KND A;  4XDX A;  1AZP A;  1QIL A;  1MI2 A;  1BNZ A;  1IKM A;  1LTT D;  3KLR A;  2BA1 A;  5EGT A;  2L5T A;  5JJZ A;  4ZAI A;  4FF2 A;  3TZU A;  2D9U A;  1H9J A;  4ZRZ A;  4PV1 C;  3G7L A;  3W2D A;  3AU7 A;  1WTO A;  3S2D B;  1Y8O B;  4K5V A;  1ONL A;  2ICE C;  3E0J A;  1I3Q B;  5JAV A;  1SMY D;  1GUG A;  5JVG 3;  3QIA A;  4F88 A;  2NZ1 D;  4DN4 M;  3D8G A;  1A3V A;  4NP5 A;  5M3M B;  3GD7 A;  1B2T A;  4BWG B;  1V1P B;  2WP8 J;  5CYU A;  3L7Z C;  5CV9 A;  1ILP A;  3C1E A;  2IL8 A;  4KD3 A;  3GTP B;  3NQI A;  4K6L A;  2F0Q A;  3WDN A;  1BQQ T;  2G9D A;  5CC4 A;  1I4R A;  5CGK A;  1WTR A;  3S17 B;  2RSO A;  3H94 A;  3KLS A;  1LLR D;  3VR6 A;  4FF4 A;  2MP1 A;  1AW7 A;  5C0X H;  5LL6 S;  2L12 A;  4BY1 B;  2RQX A;  2XWJ B;  4F87 A;  5ELF A;  1WTW A;  2B2V C;  4ID6 A;  2KCC A;  4CKB A;  3NK9 A;  3KBX A;  1PXU A;  3IAY A;  5A35 A;  2JEB I;  2H1E A;  5C4Z A;  4C56 C;  1IKL A;  2FIN B;  1ENF A;  1Q3L A;  2R92 B;  2A5H A;  3I8Z A;  3I4N B;  4HR7 B;  2JXM B;  4HN7 A;  3VR4 A;  1PTO D;  1HTL D;  3K0Y A;  2MJ8 A;  3GTG B;  2BA0 A;  1B3A A;  3K59 A;  3A8K E;  3DEO A;  3ERO A;  2WAQ B;  2F0G A;  1UNS A;  2EYF A;  4KKU A;  1S5F D;  4RWS C;  5K5P A;  4PMC A;  2M2L A;  4PMB A;  4C3I B;  2EYO A;  3TP8 A;  4KI0 A;  3OMG A;  1ENC A;  4IUN A;  2CW0 D;  2SNM A;  3MXU A;  1C4Q A;  1SXT A;  3VA5 A;  4ZYS A;  2B2U C;  5KRU A;  3R2I A;  3KLS X;  5K36 H;  2JE6 I;  3S14 B;  3MC0 B;  4OL7 A;  2FJ2 A;  4RFB A;  2MUY A;  5LL6 X;  1KDC A;  2AWN A;  4GZY C;  1Z47 A;  2Q8T A;  4WFN 3;  1E2V A;  1FYC A;  3PUZ A;  5KEE A;  2HQE A;  1H9K A;  1S5E D;  3OPO A;  5C6A A;  2PW7 A;  1EWC A;  3CQZ B;  2EYL A;  1TT2 A;  1Q1E A;  1CI3 M;  1GUO A;  2B2W A;  2F4I A;  3PUW A;  3T16 A;  1YNJ D;  4RAU C;  2KCN A;  3SR1 A;  4G7H C;  3K5M A;  5CV8 A;  3RLF A;  1SYE A;  2WKC A;  5A2Q E;  1JE4 A;  1EY0 A;  2Z1C A;  2AQ1 B;  1F2L A;  1H9S A;  5D3I B;  5JEA G;  5DNF A;  5A2Q L;  2ZXP A;  1BBX C;  4QB4 A;  3NHH A;  2K32 A;  3JAM E;  2F0N A;  3M4Y A;  2A68 C;  2E75 C;  3EVQ A;  1QOH A;  3NBH A;  5AFW A;  3J80 E;  2N55 A;  3JAM L;  1GJX A;  2XIW A;  1EOT A;  5CV4 A;  2GA4 B;  3OWF A;  5KGU A;  3J81 L;  3J80 L;  4B9X A;  1EFI D;  1HFN A;  1SBB B;  3MAQ A;  1V1O A;  1V43 A;  2KEE A;  4EQN A;  1SE4 A;  5JVH 3;  3K5N A;  3R93 A;  4OO1 H;  5D65 A;  2OEO A;  1STN A;  2J4X A;  4IFD J;  1YNN C;  2F0P A;  3H3V C;  1LAB A;  1U4M A;  1O7Z A;  3M3Y B;  4J1M A;  1BF4 A;  4HCS A;  3ND8 A;  4IN3 A;  3R8B A;  5C0X I;  2FMM A;  4I7Z C;  4L8J A;  4M8A A;  2A69 C;  4ME5 A;  1WTP A;  2KVM A;  1F2Z A;  1F9P A;  4IUR A;  1QB5 D;  3A7A B;  2WAC A;  5E3F A;  1DCZ A;  2EY6 A;  1E2Z A;  2N88 A;  3HZX A;  4V0B A;  2LFN A;  3W3A A;  3NTI A;  3OWE B;  4G4K A;  3S15 B;  2F0E A;  2TMP A;  4XQQ A;  3OMC A;  1A15 A;  3SK6 A;  4UAI A;  2WKD A;  2QIL A;  1F2Y A;  1SDF A;  3I3C A;  1VDZ A;  3A54 A;  3LWE A;  1EY5 A;  4TSS A;  1XWE A;  4G7Z C;  1JOK A;  4R8N A;  2PZU A;  4BBR B;  2L1B A;  1LTG D;  3BS1 A;  3F2U A;  3G6J B;  4TQU S;  1G91 A;  1EWH A;  2PYK A;  1Q1B A;  5I6W A;  1UEA B;  3BYT B;  3T56 B;  1DOM A;  2ID0 A;  4C3H B;  2FFK B;  2Z4I A;  4FXG C;  4K2K A;  3Q24 A;  2BDO A;  4PQX A;  1CFM A;  2LS0 1;  3FEW X;  4MIU A;  1ESF A;  1T5E A;  3AB9 A;  4KY6 A;  4YIJ A;  3A55 A;  4KJO A;  4E6I A;  1I6V C;  4IAL A;  5IOD A;  1HCZ A;  1TU2 B;  5DM6 3;  1Q12 A;  3BDL A;  4DAV A;  5IT9 L;  1W6K A;  2B2T A;  3I90 A;  3TP6 A;  1HFG A;  3MFG A;  3D4D A;  2FMC A;  4ZKB B;  2MPM A;  3NXW A;  3SHL A;  1WTX A;  4KY7 A;  1II3 A;  3PO3 B;  3DMU A;  4KN4 C;  1TY0 A;  1STH A;  4KTA A;  4MHE A;  3A8I E;  1MD2 D;  3IFD A;  4IUP A;  2ZT9 C;  3BG3 A;  3HOU B;  4QCL A;  1TS5 A;  2NTT A;  1S5C D;  1Y69 U;  4IUT A;  1GXD C;  1SNO A;  2R3Z A;  3BYY B;  4XYO A;  5D3D A;  1FNU A;  1XX8 A;  2XRQ D;  2V4D A;  3D6W A;  5I9P A;  2L9H A;  5KIX A;  5E1F A;  1CQF A;  1SAP A;  3NQT A;  3LX0 A;  1EIG A;  3HGB A;  1KDA A;  3LNN A;  3I72 A;  5HGT A;  1PZI D;  2MHV A;  3DWQ A;  1RTN A;  5JEA H;  3A8J E;  3M4O B;  1STY A;  1Q90 A;  5T1I A;  2BE5 C;  5CV7 A;  1XXG A;  2A68 D;  5KNC A;  4XYQ A;  3DXJ C;  1PRT C;  1R9T B;  2VXW A;  1CHP D;  3RD4 A;  2NVY B;  4HSV A;  4I65 A;  5FO9 B;  5T1G A;  3P75 A;  2L55 A;  2RSN A;  2IX0 A;  1A2U A;  2AQ3 B;  3FPP A;  4NDX A;  1FD7 D;  5JPM C;  3BVM A;  1UUP A;  2B2Y A;  5EPJ A;  1YNN D;  1LO5 D;  4FF1 A;  3PIP 3;  1SNM A;  2BOS A;  4R9W A;  3H6M A;  2CVR A;  1O7Y A;  1I4H A;  1Z6H A;  4FP5 D;  1DJR D;  1G2T A;  2DNE A;  4C3J G;  1SJH D;  2RA4 A;  3WOF A;  3DEP A;  3GTL B;  2Z4H A;  2K33 A;  4QUC A;  1EIH A;  2WV6 D;  1MBY A;  4XT1 B;  4IFD I;  4Q0F A;  2A6H C;  4RA8 A;  5F2D A;  2KED A;  4V19 0;  3N6R A;  1ESR A;  5EBC A;  1TKW B;  2QDB A;  3SK8 A;  1BO0 A;  1D1I A;  1XTC D;  1OXV A;  1OXU A;  5DM7 3;  1CZG A;  3URY A;  2NN6 I;  2K28 A;  1JQY D;  4HMI A;  3C2P A;  4ABN A;  2L0C A;  1OO9 B;  1U4R A;  2HUG A;  3MA2 B;  1PFM A;  2VB3 X;  4JK1 C;  3WOE A;  2CQA A;  1OXT A;  1BDO A;  1QJO A;  1STB A;  1F9S A;  3T51 B;  4WRD A;  1HQR D;  2D2C C;  4BY7 B;  4A93 B;  5C3W A;  2HCI A;  1DOK A;  1NAP A;  1LTA D;  4RCO A;  4PNY A;  2YU9 B;  2BDN A;  4FNF A;  3C3L A;  1EYA A;  3GP7 A;  4IQZ A;  1B9M A;  3SXH A;  2FHT A;  2J0T D;  3O13 A;  5CV5 A;  1BXT A;  2F0F A;  3QJY A;  5J1Z A;  1HUN A;  4CJ1 B;  1STE A;  2KUM A;  2KHS A;  3TDQ A;  2EOT A;  1PZJ D;  3KUP A;  2MGS A;  3X3M A;  2DNC A;  3T13 A;  2F0K A;  3V96 A;  2XWB B;  5BN5 A;  3VR2 A;  1HRJ A;  1HXY D;  1JIC A;  1R4Q B;  3OW7 A;  5FOB B;  3CRL C;  1GHK A;  4KY5 A;  2J7Z A;  1J9O A;  1RDP D;  3GO5 A;  1DOL A;  4X3T A;  1CHQ D;  4ZKC B;  3I4M B;  2KA7 A;  3TP5 A;  3KF8 A;  1EZ6 A;  3I70 A;  1LT3 D;  1KLU D;  2K5D A;  4K8J A;  4AYB B;  2PQE A;  5ELC A;  3TSS A;  3MXP A;  1KAA A;  2JA5 B;  3TBI B;  2F0O A;  1U4P A;  2A74 C;  2B2V A;  2F0T A;  3K57 A;  2NYZ D;  4OGQ C;  3NTH A;  1B9N A;  1ZYR D;  1WCM B;  4DAY A;  2AUJ D;  1ET9 A;  2TSS A;  3HOZ B;  1KTK A;  5D14 A;  1RD9 D;  4KHZ A;  4Y7N B;  1PFN A;  4F8M A;  5I4D A;  1RCV D;  1QCB D;  2PW5 A;  3NTK A;  2IWH A;  1AZQ A;  5CMD A;  3S9W A;  3GTO B;  3HOV B;  4LAA A;  5M9O A;  5FK9 C;  4K5X A;  2ZXO A;  2VUM B;  2K04 A;  3FVQ A;  5I2Y A;  3HOW B;  4RKL A;  1FNV A;  1SYC A;  4DK1 A;  3RZD B;  4RCN A;  2B2U A;  1OXX K;  1RHP A;  3ONA B;  2A6E D;  5IGB A;  2K7V A;  1SYB A;  1S5B D;  3EJI A;  4BA1 I;  1B1Z A;  3V2T A;  5EJW A;  2LMC B;  3SK4 A;  2B39 A;  3MXN A;  4CGY B;  1KLG D;  2K1B A;  3VR3 A;  2B63 B;  4DXG A;  2R6G A;  3SDZ A;  1E0B A;  1QWY A;  1L0X B;  4HCE A;  3ERQ A;  1TWF B;  2DY8 A;  4CKE A;  4CJ2 C;  1WD1 A;  4RGN A;  2KEC A;  3P1H A;  4NMZ A;  2K05 A;  5M5X B;  1ET6 A;  3ZYY X;  5DAU A;  4C1N I;  1V1P A;  3EQL C;  3T53 B;  1DXM A;  2EYP A;  2DY7 A;  4EQO A;  2PO4 A;  5EBD A;  1EU4 A;  2SDF A;  2Y0S B;  4M1U B;  4XQJ A;  2VB2 X;  2E74 C;  1L0Y B;  5C4H A;  1ROD A;  3QB3 A;  5JPN C;  3D4W A;  2JA7 B;  3TN2 A;  2F0V A;  3MHB A;  2PMZ B;  2A6H D;  4A3J B;  3L9A X;  4KD4 A;  2K5Q A;  4XT3 B;  5C4X B;  3E5S A;  1HTP A;  3K5O A;  5BN3 A;  4EQP A;  4BBS B;  4A3M B;  1TS3 A;  3S1N B;  3RUZ A;  1XYI A;  1WTV A;  1M8A A;  4A3F B;  1EY6 A;  1JWU D;  4NKL A;  2NBF A;  3Q23 A;  4X3S A;  1AN8 A;  3MTS A;  3U9S A;  1PRT B;  4F7X A;  1HHV A;  1BCP B;  3DWA A;  2EJF C;  1QG7 A;  1GOZ A;  3QOJ A;  1O78 A;  1WD0 A;  2K03 A;  4K6D A;  1RKN A;  4DGZ A;  2F0H A;  2QCP X;  3BDC A;  2EZV A;  5M3F B;  1D1K A;  5E4W C;  2O2L D;  1R4P B;  2RVL A;  3D6C A;  4LMQ D;  3I4L A;  2A73 B;  5JEA J;  3BDO A;  5EPL A;  2IJ0 A;  1F77 A;  3CU7 A;  2EXZ A;  2F0M A;  4A3B B;  5C3X A;  4RGT A;  1B50 A;  3MZ5 A;  3NWS A;  1HQM C;  3OIQ A;  4RHS A;  3CHB D;  1E2W A;  3FPU B;  3FMC A;  5DEH A;  2EY5 A;  1RF2 D;  1D5Z C;  1LTR D;  1PMR A;  1IYU A;  3OIP A;  2NB0 A;  2L11 A;  4C2M B;  3LWU A;  4O42 A;  5IGF A;  2WIN B;  1LV9 A;  3M85 A;  1SEB D;  4BA2 I;  4A3E B;  4DU9 A;  4B9W A;  1NR4 A;  1I6H B;  2R7Z B;  3VYS A;  1K83 B;  3C46 A;  1D2B A;  3RMH A;  4PMW A;  3TZD A;  1STA A;  4DFA A;  3PMF A;  2RBM A;  3GTJ B;  1DYQ A;  2PCF B;  1S4Z A;  4C3J B;  3Q0A A;  1TQO A;  1EY4 A;  5ELE A;  3A7L A;  2F03 A;  1MGS A;  2KOL A;  1KNE A;  3K5L A;  1KDB A;  4K8I A;  4OO1 I;  4DXF A;  4HAE A;  1PFB A;  1B53 A;  2RDF A;  4IZ8 A;  3GTM B;  5I2X A;  1RTO A;  1GHJ A;  4H7B A;  1CM9 A;  2IT1 A;  4XTC S;  1I50 B;  2WII B;  4HMJ A;  4C1N K;  3I91 A;  4IUU A;  3BVG A;  1LTI D;  3GQB A;  2QEJ C;  3S16 B;  4A3K B;  2NUC A;  1NUC A;  1SYG A;  4TKO B;  3CKI B;  4ULL A;  1BCP C;  1F2M A;  4RGM A;  4DNT B;  1JOR A;  3K6O A;  4XXE A;  2JA8 B;  3M7G A;  1K8M A;  1IL8 A;  2JYO A;  5G3L F;  4MN3 A;  3PIO 3;  2QKI C;  4B08 A;  1H9S B;  1WVL A;  1EYD A;  2DN8 A;  5EQ0 A;  2SOB A;  1DM0 B;  4HSP A;  5IIF A;  3MWY W;  3K58 A;  2O4X A;  4A3I B;  4LJZ C;  1NCV A;  1PLF A;  4CKC A;  4FO2 A;  4KN7 C;  5CV6 A;  4QUF A;  3DHQ A;  1PRT F;  3VYT A;  1BCP F;  2AUK A;  1CA6 A;  2NTS A;  1SE2 A;  2K6A A;  1Y8P B;  4HTH A;  3R3O A;  2WB1 B;  1IHZ A;  1EZ8 A;  1D5X C;  1NR2 A;  5CBA E;  2EY2 A;  3HKZ B;  2HDL A;  2A69 D;  1EY7 A;  1I4P A;  1OXS C;  3J7A V;  1I4Q A;  2XSC A;  3KK7 A;  3GTK B;  1Y8N B;  3NSW A;  1SNC A;  4J6H A;  1UAP A;  1M4V A;  5EPK A;  3OHX C;  1CQV A;  2NVX B;  5CBE E;  5COY A;  3SK5 A;  1IW7 C;  3PUX A;  1K8O A;  5ISR A;  3MEH A;  2JP1 A;  4Q5V A;  2X69 A;  4FVM A;  1STG A;  4UDU C;  1FGB D;  2EY1 A;  3DWP A;  4J8Q A;  3P7J A;  5BN4 A;  2XN9 C;  3QWN A;  2C5C A;  1JWM D;  1O7L A;  4XQN A;  1TVX A;  2EVB A;  3H09 A;  1KAB A;  1PTO H;  4N9T A;  4HED A;  1LTB D;  5M5W B;  2IX1 A;  2E2J B;  1VCI A;  4H0L C;  1FR3 A;  1GUS A;  5KYL A;  3J7A F;  4RHR A;  2Q8I B;  4IUV A;  3M7N A;  1TII D;  4FXK C;  1AEX A;  4WOR A;  2F3W A;  1D5M C;  1SJE D;  2BCO A;  2F0I A;  3EFX D;  2B2W C;  4IFD G;  1SFO B;  2RKS A;  1X3Q A;  1LAC A;  1G29 1;  5FO8 B;  3EA6 A;  2E76 C;  3OSO A;  1EEI D;  4G57 A;  4KKT A;  3NBI A;  2NN6 G;  1SNP A;  3GTQ B;  3VYU A;  2G9H D;  3L3O C;  3DM1 A;  2LKV A;  1JCK B;  1JWS D;  1BUV T;  5FO7 B;  1TWH B;  1GUT A;  1EL0 A;  1LT5 D;  1C48 A;  1DON A;  1CA5 A;  1EYC A;  3N52 A;  1ZEQ X;  3HEJ A;  5FLX E;  1D6E C;  2VNU D;  3I73 A;  2R61 A;  3IL8 A;  3HRZ C;  1EQV A;  1NSN S;  3D4R A;  5FLX L;  3D31 A;  2K01 A;  2XVS A;  2NWG A;  4DA2 A;  5C3E B;  3QG1 A;  4QMG A;  3PUY A;  5ELB A;  1O80 A;  1SYF A;  1SE3 A;  3S1M B;  1X3P A;  4BS9 A;  1Y1V B;  5J22 A;  1EY8 A;  2X6L A;  1Q8I A;  5LHY 1;  1TWA B;  2R93 B;  3BVZ A;  1ZKO A;  1PDQ A;  5KYI A;  1CZW A;  2O5J C;  3GV6 A;  5C5L A;  4CBV A;  5JOB A;  1IYV A;  1PYW D;  5J39 A;  4H44 C;  1F9R A;  5E4X A;  4ZLT F;  3Q6S A;  2K5W A;  2LY7 A;  1J8I A;  2NVT B;  4RH6 A;  2HDM A;  3C1F A;  3SEB A;  3S1Q B;  1S5D D;  5G3L D;  2ICI A;  3HP3 A;  3UI2 A;  2E2D C;  4R8I A;  1F9Q A;  3KBG A;  1LTS D;  4XIG S;  2E2I B;  2M9V A;  1KNA A;  1JOQ A;  3BZD B;  3HOX B;  3NWT A;  1PTO B;  2BE5 D;  1CTM A;  1SSO A;  2IW3 A;  1HA5 A;  1PRT D;  2PNR C;  1BCP D;  5ELD A;  3VA7 A;  2F0L A;  2CHB D;  4C3I G;  4DAP A;  3A56 A;  4K14 A;  3J81 E;  4U67 3;  1JR0 D;  2QF7 A;  4ZUJ A;  4KJN A;  3DUZ A;  1SNQ A;  2F0U A;  1TWC B;  4DF7 A;  1SND A;  4X3K A;  5IGE A;  4FXD A;  3D3R A;  1H9R A;  2ENB A;  2Q8R E;  3P20 A;  2IX3 A;  4IUQ A;  3TME A;  1VMP A;  2F1M A;  4L6T B;  4WJW A;  2SNS A;  3CRK C;  2OXP A;  3HS0 C;  1BOS A;  2EYJ A;  1Y1W B;  2OT2 A;  4TRD A;  1AFP A;  3S2H B;  3TP7 A;  1TS4 A;  1CT1 D;  5FKA C;  1GUW A;  5M5Y B;  2EYM A;  4NW2 A;  3U9O A;  2PPB C;  4ZQ3 A;  5EKI A;  3AMU A;  2F0W A;  1ZXT A;  2I07 B;  3QOL A;  2EDG A;  1QNK A;  1SMY C;  5CR3 A;  4O1N A;  1IW7 D;  1JOO A;  3V05 A;  3GV3 A;  4CHT B;  2EE1 A;  4DNR B;  2B2T C;  4H13 C;  2JEA I;  3SE0 A;  5I6Y A;  5COR A;  2SEB D;  1DZ1 A;  4JBW A;  3J7Y W;  3NUC A;  2L4N A;  5HUR A;  3VR5 A;  2D62 A;  5C0X G;  4FF3 A;  1I4X A;  3MXG A;  1A3T A;  3VYR A;  1EQT A;  2F0D A;  2ZXR A;  2D5D A;  2Z8L A;  1VMC A;  3QO2 A;  3S1R B;  5KNB A;  1B4O A;  4EGV A;  4KHV A;  3FRP B;  2EJG C;  1LT4 D;  1ENA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...