5COYA

Crystal structure of cc chemokine 5 (ccl5)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords C-C motif chemokine 5
total genus 15
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5coyA00
2MJ8A 1SDFA 1HFNA 1PFNA 2IL8A 2FMMA 1U4PA 2HCIA 4HAEA 4IUUA 2HCCA 4X3UA 3ONAB 1EQTA 3R93A 3MWYW 1JE4A 1J8IA 3P7JA 2KECA 1TVXA 3HP3A 3IFDA 1CA5A 4OIJA 1G6ZA 2B2YC 4QUCA 1Q3LA 2EOTA 1BNZA 1HA6A 1M8AA 1O7ZA 1B4OA 2X6LA 5E4WC 1WD1A 1IL8A 1PLFA 1MSHA 4HSVA 2N55A 2K01A 4DN4M 4OIKA 1WTOA 3I90A 2B2TA 2B2WA 3G7LA 2JYOA 1RHPA 1F2LA 1XYIA 3QO2A 1PFMA 4UAIA 2SDFA 1WD0A 1ILPA 1ML0D 3I91A 3Q6SA 1KNAA 2EPBA 5EQ0A 2B2VA 4IUQA 3SVMA 3IL8A 3H91A 2BDNA 2K04A 2L11A 4X3KA 1VMCA 1KNEA 1F9RA 1VMPA 5T1IA 1ILQA 2NWGA 4R9WA 2FHTA 4ZLTF 1WTQA 1SAPA 1X3PA 4CJ2C 1AP0A 1HUNA 2HDMA 5DNFA 2B2YA 3KUPA 1ESRA 2HUGA 1MGSA 2FJ2A 1F9PA 1O7YA 4U68A 5EPJA 3DEPA 1CM9A 1RTOA 4CJ1B 2KUMA 2R3ZA 4XT3B 3TN2A 2XIWA 1X32A 1NR2A 3LWEA 5T1GA 1G2SA 1LV9A 2DY8A 1DONA 2RSOA 1BBXC 2CVRA 4ZKCB 4ZKBB 1WTVA 2K1BA 1X3QA 3GV6A 5CBAE 4X3SA 1B50A 1E0BA 3DM1A 5CMDA 3DEOA 4RWSC 1IKMA 2L9HA 2RA4A 5COYA 4X3TA 2B2VC 2X69A 5D65A 1NR4A 1G91A 1F9SA 2FFKB 2Q8RE 2RSNA 2L12A 4IUPA 1AZQA 3GV3A 1U4LA 2B2UA 2KEDA 5EPLA 4QUFA 2MGSA 1QE6A 1RJTA 3TZDA 2B2UC 1U4RA 1PDQA 4IUTA 4MHEA 5EKIA 4O42A 4MN3A 1B3AA 1J9OA 1JICA 1EIHA 1WTPA 1MI2A 3N52A 4NW2A 1HUMA 4IURA 1ZXTA 4RAUC 1G2TA 3D6WA 4RA8A 4R8IA 2MP1A 1RTNA 2N88A 1BF4A 1MSGA 3MTSA 1WTXA 1NCVA 1EOTA 2H1EA 2MPMA 1QNKA 2M2LA 3I8ZA 2X6GA 5EJWA 2K03A 1WVLA 2K28A 3UI2A 4ZK9B 4IUVA 1WTWA 4ZAIA 1CA6A 2KEEA 2NYZD 1DOLA 1B2TA 2D9UA 2HDLA 4LMQD 1PFBA 5EPKA 1BO0A 1B53A 1RODA 3KBXA 5AFWA 1DOMA 1WTRA 1EL0A 1C8CA 3I3CA 4CJ0B 1IKLA 2K05A 1SSOA 1U4MA 2L4NA 2VXWA 1HFGA 1A15A 1EIGA 4XT1B 3FDTA 2Q8TA 3F2UA 5CORA 1HRJA 2KVMA 5CBEE 2B2WC 2B2TC 3FPUB 1NAPA 2DY7A 2J7ZA 5JJZA 1F9QA 2L1BA 4XDXA 1HHVA 5D14A 1ICWA 1XX8A 1O80A 1QG7A 2NZ1D 2KOLA 2RVLA 2FINB 2JP1A 4HEDA 1AZPA 1GUWA 1DZ1A 1S4ZA 2EE1A 5E4XA 1DOKA 4HCSA
chains in the Genus database with same CATH superfamily
4NXNQ 1K3BC 3T1YQ 4X3UA 4R8NA 1Q12A 4DV6Q 1K83B 1RDPD 3TREA 1DXMA 2KECA 3GO5A 4H02A 1OXVA 1QILA 1EU3A 2LY7A 1WD1A 4ME3A 3K5NA 4DK6C 3NK9A 3NWTA 2B2TA 3PUYA 4DNIA 4BXXG 1NMGA 3ND9A 1LYLA 2ENBA 5M5XB 1EYCA 3U9OA 3G71A 4RH6A 1NSNS 1JR0D 3GTJB 1CT1D 2VNUD 3CC2A 2JA7B 1B8AA 3TDQA 1JC7A 4RCOA 3AU7A 4A3MG 4A93G 1CHQD 1G51A 2RQXA 4A3MB 4CBVA 3M3YH 1NY4A 4DV3L 4K2KA 4K8JA 3AQQA 1HCZA 1UE7A 3EN2A 3VYSA 3I70A 1PRTB 4JI7Q 1CKMA 1X3QA 5DEHA 4U673 3FVQA 2CQOA 3G48A 1E24A 2I0QA 4OO1I 3KBGA 2I5HA 1G91A 4ZRZA 2ICIA 4IOAA 2F0FA 1RJTA 1PH4A 4LWCA 3NWSA 4DUZQ 5IT9E 4YWMA 1OXTA 5IYCG 5IGFA 4GLVB 1NE3A 4RAUC 5GROA 2VUMH 1K0SA 1HZAA 1K28A 1STYA 2OQKA 4JI5Q 2UXDL 1Y8PB 1F2MA 2M2LA 2N8NA 4MTNA 3NTIA 3D6CA 5LMUQ 4I7AA 1CA6A 3UE0A 4HN7A 1EY7A 1SFOH 3H94A 4AQYQ 3BJUA 4WRDA 1C0AA 2B3GA 3S14H 4R4IA 4RG1A 2F52A 4BY7B 3DWQA 1HFGA 3D8GA 3FP9A 1EIGA 3S15B 1VQPA 2HIXA 2B2TC 3BVGA 4M1UB 3BVMA 3G4SA 4A3FB 2JA6G 4JI2Q 2IHEA 2QILA 1JOOA 5C3EG 3PUWA 1P8LA 2A73B 1N34L 4DAPA 3S2DH 4QJFA 3PF5A 4IUUA 2HCCA 4JOIC 1AH9A 3KJOA 5I9OA 4KY7A 5DAUA 3PMFA 2JEAI 2C35B 2QA4A 3CXCA 5C4ZA 2JA8B 4A93H 1I6VC 1B7YB 1Z9FA 4A3EB 5IIFA 5F2DA 2ZXOA 1OXSC 1U0LA 3OWEB 3GTGB 4UAIA 5M3FH 3ZJYC 3NE5B 3OIQA 1ML0D 3EJIA 1YI2A 4KK7A 2F3IA 5M5WH 3GTJH 1Q1BA 2ZT9C 4LF7L 1KNEA 2R7ZH 4YWLA 4Z9CB 5IYCH 1YZ6A 1B9MA 5EBCA 5DNFA 3KUPA 2R6GA 5IP7G 2F0NA 2GA4B 2WAQE 2VQFL 1MJEA 1YNJD 1M1KC 5ELOA 3QJYA 3EIVA 3PSIA 4JI4Q 2ICEC 2RSNA 5CV4A 1Q8IA 3MAQA 1IBML 1EY6A 3RMHA 3T1HL 4DAYA 3K5LA 4IUTA 2EYFA 5EKIA 2ATWA 2OXPA 3TP8A 3ERQA 3J81L 1A3TA 1DM0B 5C44G 1SMYC 1Q7YC 4B3MQ 4OELB 2H1EA 2MPMA 4JYAQ 2NVYB 4IUVA 1Q46A 2HIVA 1HNZL 4DAYB 2D9UA 2CH4A 2HDLA 5EPKA 2ZJPA 2XTIA 2EZVA 1MKHA 3VR3A 3HOYG 2F0UA 3I3CA 2EYHA 4DV7Q 1FVIA 4G57A 3CCUA 3BDOA 2PQEA 2RHSB 2F0LA 2K5HA 1H9JA 2KVMA 3J7YW 4A3LH 3QOLA 1U5KA 3JC66 2F3WA 4XQJA 1K8AC 1FL0A 3TP5A 4DR3L 4JI7L 1LO5D 3KLRA 4RWSC 4DR1L 4FF4A 2NN6H 4A3JG 3J7AF 3HKZE 5BR8Q 1EWCA 1BCPD 4HSPA 4PNYA 4IPCA 2AKWB 3OYYA 4PZ6A 1TVXA 4YCUA 3C1EA 3A5UA 3AEVA 4OIJA 4FF3A 1GUGA 2MQHA 3EBEA 3I73A 4N8FA 2YU9B 2MO0A 3VYTA 4Q5VA 4GKKQ 4K0KL 2NTTA 3VR4A 2RCFA 4IO9A 3HOVH 1JJCB 1R9TB 4HR7B 4M8AA 2A1AA 3K5MA 5JVH3 4GNXC 2UUCL 2NTSA 3MEHA 3PUXA 1YJ9A 1GM5A 1WCMG 4A3JH 1O7YA 1YNJC 2WB1B 2D5DA 1PMRA 3GTMH 1HTLD 4PMWA 5JAVA 1X6OA 3IFTA 3HOUH 2PCFB 4J6HA 5IGDA 1EEFD 2WFWA 5DLQE 4JI1Q 2CWPA 3X3NA 4X65Q 1A6XA 4X64Q 3PIP3 4C3HG 4S3SA 5COYA 5D65A 1CTMA 3I4LA 2L12A 2KQ3A 3J80c 3GTPB 4JI0L 5J22A 4LFAL 2R7FA 2MO1A 3M4YA 2L5TA 2VB2X 1B3AA 4AYBG 4A4IA 3PV0A 4JYAL 4TSSA 1VQBA 2N88A 1MSGA 5EJWA 2Z6BA 1LACA 3M4OH 4N9TA 5C3EH 1BBWA 2B8GA 2IHFA 3CCJA 2UXCL 4JV5Q 3T53B 5I6YA 4DV2L 1BO0A 4RKLA 4AIMA 2N49A 3KBXA 5LMNL 2QEXA 2E2IH 5JJKA 2K05A 5BN4A 2WB1E 4DNTB 1KABA 2Q8TA 2KCNA 2Z6KC 4L8JA 1SNCA 3I4MH 2DN8A 3KDFB 3GTOB 2CWAA 1KLUD 2ZJRA 1D1KA 5M3FG 2FINB 3PF4A 5E4XA 3R2TA 2MFIA 3S1MB 3E5SA 1TU2B 3M85A 4PZ7A 3P7JA 3PCOB 3NBHB 5AJ3L 3AB9A 3LGJA 3CCSA 5LMNQ 3H3VI 4JI8L 2C9OA 1G6ZA 3D3RA 4OONA 2YV5A 1DCZA 5FOBB 1R9TH 1QNUA 1FNVA 1O7LA 4KTAA 3TS0A 2K5VA 4A3BH 2K01A 3H3VC 1WTOA 2HHHL 1HZCA 3CCQA 4H7BA 1PFMA 5C4XG 3OSOA 1WD0A 1XNRQ 1JORA 4KHPL 4RHRA 3CQZH 1BXTA 3STBD 1PZJD 4B3RQ 4YY3L 1PH2A 1ILQA 1KXLA 1MD2D 3K0YA 1CK1A 5FK9C 3GTGH 2K5NA 3UDGA 4GOPB 2LS01 2O4XA 3UDFA 2UU9Q 4X64L 2A74C 3MXUA 4KN4C 2QEJC 3AMUA 3I4OA 3LWEA 3OW2A 2E5LL 1DONA 4DKAC 1YNXA 3KJPA 3T13A 5IP9H 3I56A 1JMCA 5ELDA 1EFWA 1CFMA 2E2JH 3OMCA 4B9XA 2F0SA 2K14A 4IFDG 3BU2A 3I72A 5DM73 1TWAH 2F0GA 1STGA 3TSSA 4QUFA 4H44C 1I50H 1SJED 3RUZA 4BY7G 2EIFA 3NUCA 1NUCA 2NVYH 1HUMA 3T51B 1VQ8A 1ZXTA 1PYWD 4P2CB 2XSCA 1A8VA 1QNKA 1YHAA 4HJ7A 3KLWA 4XYOA 2B63B 3I7FA 1Q8KA 2K50A 2AQ1B 3OTOL 5J39A 4RFBA 1PTOD 2PQAA 3J81c 3PO3G 2JQOA 2Y0SE 3GTOH 3I4MB 3CCLA 4K14A 4UY8C 2GVBA 4AYBE 4ODGA 2XVSA 4I7ZC 4KHPQ 3K59A 3EFXD 1EFID 1F9QA 2VL6A 4QL5A 5D14A 4NP5A 2RVLA 2JP1A 2QKIC 3CD6A 3M7GA 1EY0A 3FPPA 1S4ZA 2MJ8A 1ENFA 4JI8Q 3R93A 1D2BA 1MHWC 1VF5C 3S24A 3A5ZB 4KHZA 1V8QA 2OWOA 3IFDA 4LFBL 4LFCL 1A3VA 1BNZA 1HA6A 2EOTA 2E2IB 2X6LA 4NKLA 5G3LF 2R92H 4LF7Q 2BA0A 2F0TA 3L2PA 2JYOA 3GTPH 4CDFC 5M3MB 3K6OA 5C3EB 4Q0FA 5IYDG 3GTQH 1JT8A 1ENCA 5IODA 2F0PA 1KNAA 1R4PB 1SLJA 5IP9G 1BCPB 2K04A 3F8TA 2R61A 5FLMH 4BA2I 4L5SA 3HOUB 1F9RA 1VQ4A 5M5XH 1KIXA 4B3TL 1SYGA 1SAPA 4DV2Q 3G6EA 4LFBQ 4BY1G 4OXPA 2B2YA 1RF2D 4HJAA 1VQJA 4JOIA 3K81C 3S17H 1YEZA 1ONLA 4L5QA 1BBXC 3J7ZC 4KKUA 4HJ8A 2A68C 1B50A 5J3BA 1U4LA 5GAEC 1GO3E 2MHVA 4H13C 5CV7A 5CV9A 2PZWA 4FVMA 1TWFB 2KA7A 1JICA 2UXCQ 3J7AV 4OO1G 3NBIA 4X65L 1VQIA 2JJQA 3QB3A 4R4OA 5JOBA 4XQQA 1K0RA 1RTNA 1PV4A 1GUTA 3MTSA 3M7NA 1LM0A 4JBJA 2JN4A 3X3MA 4JI5L 3SK5A 5A2QL 1SE2A 3JAML 4GN4B 5C4JB 1E3PA 1VDZA 1N33L 3DXJC 4DU9A 2MUYA 1IHZA 5BN5A 4FO2A 2EJMA 1EWIA 4KLKA 4LF5L 1S5DD 4BA1I 1I4XA 2A6HC 1LTTD 1FNWA 1STAA 1U4MA 1SE3A 2J0TD 2EVBA 2ZXRA 5CORA 4KN7C 5CBEE 2WAQB 2EXZA 2J7ZA 4N9PA 2K33A 4ZUJA 4O0AA 2R93B 3D4RA 2F0MA 1PTOH 1PTOB 2SEBD 4K6LA 5ELFA 2GVAA 2D62A 3URYA 3BS1A 1HPCA 2L15A 3M4QA 2CKZB 3MFYA 1SYDA 2FMMA 4YHHQ 4BS9A 5C0XH 4OGQC 1NMFA 1SYEA 3BYTB 4J1MA 5I2YA 1I6HH 1EWHA 4B3SL 4YY3Q 3NTHA 4ID6A 1Y69U 1V1PB 4BY1H 3SK4A 1XPRA 3ZYYX 3Q23A 1RHPA 3MFGA 2SDFA 1CUKA 3FKIB 5CR3A 1H9SA 2K5QA 4KJOA 1SEBD 3B6YA 2O2LD 3SVMA 2HHHQ 1BCPF 4EGVA 2E74C 3W3AA 4F7XA 2TSSA 1TWHB 1FGUA 5K36H 2F4IA 1V1OA 4IJLA 1H9SB 1X3GA 4DK1A 2LFNA 5LL6S 2EDGA 1HR0Q 4DGZA 1I3QB 4POGA 3RLOA 2AWOA 3ICEA 1S72A 2PO4A 2R7ZG 3S1NB 3FHWA 3DLLA 4H0LC 2DJGC 1S5ED 2VQFQ 2B29A 3ITPA 1PA6A 1E0BA 1F2ZA 2DNCA 5HURA 2VS1A 2RA4A 2E2HH 4OHJA 1C7YA 2VW9A 2NVTB 5TSSA 1LTRD 1T9HA 4K8IA 4LFCQ 1HNXQ 3HS0C 1Y1VH 1GHKA 4C3JB 3N52A 5M5WB 3D6WA 3PGZA 4RGOS 1S5FD 4B08A 4A3FG 3A8KE 3I8ZA 2K5DA 3HKZG 1WTWA 1BDOA 2WKCA 4LF6Q 1GD7A 5IYBG 1VQAA 4LMQD 2K75A 5D3DA 2BOSA 3SEBA 1AEXA 3J80E 3CU7A 4G7HC 3MEFA 4YIJA 4XT1B 3CMEA 4LF8L 2WP8J 1CSPA 3ERSX 4UP9A 2NBFA 2Q8IB 1N34Q 1HH2P 1EQRA 1O80A 4RGTA 3D31A 4JBKA 3HOWH 1QVFA 1DZ1A 4K6DA 4A3IB 2B8FA 1O7IA 1ICFB 2VB3X 5JEAH 2NVTH 1SJHD 1QUQA 2VQEQ 3LX0A 2K5WA 1LTLA 1CQFA 3J81j 3S9WA 3Q22A 4OEMB 4X6AH 2EY1A 1KC8C 2CH4W 1QB5D 1Y1WH 4A3CG 3HP3A 1Z7TA 1XMOQ 4F8MA 3S1NH 1EIYB 1GOZA 1HTPA 3MXGA 3E9HA 1N36Q 2B39A 2YTYA 4P73A 2B63H 1VF7A 3RN5A 5ISRA 1CSQA 1ILPA 2WINB 1I94Q 3F1ZA 5FLXE 3OWFA 4HJ5A 2UUCQ 2ZJQA 4GZYC 1N32Q 1UE5A 2FHTA 4GOPC 3S1RB 2F3VA 3PIO3 4AQYL 3SDZA 1S3OA 2NUCA 5EGTA 1WCMB 2FJ2A 5C4XH 3DEPA 1TXYA 4XT3B 2DY8A 1GUNA 2RDHA 2RSOA 1Y1WG 3O13A 3JAMi 3GV6A 1SNQA 1EY4A 1U9RA 2B2VC 2XRQD 2X69A 2ID0A 2NVXH 1SE4A 2NZHA 4R4QA 3J81E 1L1OA 3SE0A 1UNSA 4JC0A 1IYUA 1HQMC 3GQBA 4IUNA 3CMAA 3KLSX 1U4RA 5ELBA 4FF1A 4YHHL 1M4VA 4TVAB 5EKLA 3N6RA 4DR5Q 4GLXA 4NW2A 3MXNB 2Q2IA 2WKDA 1Y8NB 5ELEA 1XTCD 2Y0SG 1G2TA 4BBRB 3ND8A 3U58A 2X6GA 3BYYB 1PFSA 4NXML 2KEEA 1KHIA 1DOLA 3DHQA 5C0XG 1PRTC 1MBYA 3HFZB 1SBBB 1B53A 1X55A 3I2ZA 3F2DA 3E0EA 3MVVA 5E1FA 3D4DA 3HEJA 1NJIC 4CJ0B 4XYQA 4DAMA 4QCLA 1KLGD 1XNRL 3SGIA 2WAQG 2I07B 3QWNA 4LF6L 4DV5Q 4DV0Q 1SMYD 5I2XA 3HOWB 2EE1A 1NTGA 3K80C 4J8QA 1HA5A 4LF9Q 1XPUA 3BDCA 2KCTA 2NVQH 4K2LA 1LTSD 1X65A 3MWYW 4GNXA 1TS3A 3BZKA 4KY5A 3KF8B 3RD4A 2BCOA 4CDDC 2PNHA 2N55A 4A3EG 1Y14B 3KYHC 1WI5A 3M9BA 1JCKB 1F2LA 3D4WA 1XYIA 1AE3A 4FXDA 1YJWA 3GP7A 4N8X1 4DK0A 2F4VL 4WJ4A 2BE5C 4XXEA 2MNAA 5CV5A 3H91A 5C0XJ 2BDNA 4FNFA 3UE1A 4DR5L 4X3KA 1V1QA 4JBMA 2L55A 4P71A 2IT1A 4R9WA 1WTQA 1X3PA 1DD2A 3T1YL 2HDMA 2K32A 5L37A 4ABNA 2CCZA 4AYBB 4CJ1B 4QF4A 2RKSA 2KHSA 2XIWA 3K0XA 2LKVA 4IALA 4A3FH 1LV9A 3V2TA 1JJGA 3ER0A 1Q81C 3VYUA 3S1QB 5IGBA 2UXDQ 2XN9C 4GKJL 1HZBA 4HIKA 3NBHA 4KY6A 3F2CA 4X3TA 1W6JA 4LFAQ 1IXRA 1EY8A 5GAHC 2FFKB 1ET9A 2CHBD 3I55A 2EYJA 1VQFA 2UUAQ 4O42A 5EBDA 1IW7C 2WB1G 3ULLA 2HD3A 4KD4A 5I6WA 2SNSA 1Q82C 3T56B 4JI2L 2PPBC 2G9HD 1TIID 2N3SA 1EOTA 2E75C 1M90C 3UDIA 3A74A 1PH1A 1VQKA 1PFBA 1XXGA 5FO7B 3KDFA 1ET6A 4DA2A 4DFAA 2IX0A 2VY3A 1EL0A 1S40A 1TWAB 3NXWA 1HNWL 1EU4A 2Z9HA 3CPWA 2F0WA 4MNOA 5C5LA 4LF5Q 3FDTA 4OO1H 1RCVD 2XWBB 1JWSD 4HIOA 1VQHA 1PYBA 2F0HA 2DY7A 5JJZA 1EIFA 5JPMC 1NNXA 1VQ6A 1HNZQ 5DM63 4C2MB 1LT6D 2ZTCA 1VQDA 4FXKC 5C4XB 2PW5A 4HCSA 3FKIG 1WCMH 4WORA 1SDFA 3KF6A 3ULPA 2AUJD 4E6IA 3IKJA 1G291 1EQTA 4ALPA 1KRTA 1YIJA 1E2WA 4NDXA 3T1HQ 3JAME 4HIDA 1M8AA 4XQNA 4Y7NB 5M5YB 1LTBD 3NSWA 4X66L 1KL9A 4HSVA 3SXHA 3RR5A 5K36G 3D0FA 3LWUA 1IBLL 5LMNW 1VQMA 3U9SA 1EYAA 1SRUA 1FNUA 4G4KA 4DPGA 4DV1L 3CQZB 4DV7L 2F1MA 3H3VH 3MZ5A 4DR7L 3VYRA 2IW3A 1KD1C 4ZLTF 1TWFH 1AE2A 1CKNA 4B9WA 1YITA 1A0IA 5GAGC 4JI6Q 3TP7A 3HOXB 4A3BB 4APVA 5IE8A 4A3BG 5C44B 5T1GA 4R4CA 1YHBA 2JK8A 1BUVT 1WTVA 3L7ZC 5KYIA 4QIWE 4P75A 4X3SA 3NTKA 4UDUC 4EX5A 5CMDA 3DM1A 1VQCA 3GD7A 1D7QA 1NR4A 3TRZA 1K9MC 2OCEA 4NPSA 4XTCS 1AZQA 3HOYH 2BDOA 5IYDH 1PH6A 4KV6A 4KI0A 4G7ZC 4NB3A 1F77A 4MHEA 2KCCA 4MN3A 4A3GH 4Y7NH 3J80L 2F0QA 1TWGH 3TS2A 4A3LG 1TQOA 3GTQB 2NZOA 1I4PA 3OOCA 2NN6G 2EYLA 2R7DA 3CP0A 4C2MH 1IZ6A 4PZ8A 2E2HB 2OEOA 3M4OB 4HMJA 1BBUA 4JV5L 3F2UA 4BY7H 2A6HD 1LT3D 1Y1VB 2D0OA 3MXPA 2NVQB 2LMCB 1A63A 3NELA 1GUWA 4HEDA 3WDNA 4JI6L 5C3XA 3W1BA 4CKCA 4HJ9A 1TWHH 4FDBA 3P1HA 1YNNC 2Z8LA 4ILWA 2PYKA 2B2YC 2DJFC 5I9PA 3QR8A 4L6TB 1XMQQ 4K5XA 4NXMQ 1MSHA 4WJ3M 3BZDB 2PI2E 5K5PA 2QDBA 5HGQA 2UXBL 1LLRD 4LUZA 2QCPX 4R4TA 3RLFA 4DV3Q 4C3HH 2L11A 4ZCKA 1RIPA 2KHIA 4UPAA 2Q2HA 3OTOQ 2WACA 1CQVA 1HUNA 1ESRA 2HUGA 3E0JA 2R3ZA 1EZ8A 3CCMA 5IGGA 2CVRA 2Z4HA 4ZKCB 5CGKA 3CF5A 3CAMA 1IKMA 1QVGA 1FJGQ 1I4HA 5CC4A 1N8RC 2IJ0A 3EQLC 4RGMA 2MGSA 4CHTB 4TRDA 5KYLA 1NBWA 4DAVA 2R93H 4B3TQ 1PDQA 1CKNB 5C4JH 4NMZA 4IFDI 3GTKB 1E1OA 3V05A 2MP1A 2VQEL 2XWJB 3K5OA 1G8ZD 4GOPA 2CFMA 2I46A 1WVLA 2K28A 3C46A 4ZAIA 3FMCA 1TS4A 5JJLA 4DNRB 1VQNA 4DUYL 2IX3A 2RF4A 1WTRA 1OTCA 3PO3B 5ELCA 2FXQA 2KCMA 1QVCA 2VUMG 1EOVA 1SXTA 1HHVA 1Q90A 1KRSA 1D1IA 2BE5D 3SHLA 4A3IG 1YNND 3KLSA 1U4PA 2HCIA 2EYMA 2I5LX 4FXGC 3CKIB 1G6PA 1R4QB 1SNOA 3WWVA 2I5MX 1CA5A 4XIGS 1RKNA 4QUCA 1MJCA 1VQGA 4ME5A 1YHQA 1B4OA 5NUCA 1PLFA 4P74A 4A3DH 5IT9L 1XJVA 1Z6HA 4C3IH 2E76C 1SN8A 4RHSA 3TBIB 3P75A 1FD7D 4DR2Q 2LXKA 2KENA 4CKEA 5EKKA 3QIAA 1GUOA 4EQOA 1V43A 2YTVA 3I91A 4O2DA 4BWGB 3A7AB 4BBSB 2B2VA 3A8IE 4IUQA 1B1ZA 4EQNA 1HR0L 1STBA 1HJPA 4X66Q 1STEA 2NWGA 1BCPC 3GDEA 4YWKA 1I4GA 5M9OA 4CJ2C 1LUZA 4P72A 4FP5D 1V1PA 3HOZG 1X54A 2FMCA 1L2FA 4Y52H 4U68A 3PO2B 4A3EH 1CM9A 4OL7A 3RZDH 1X32A 1EUJA 3J7A5 2F03A 4DV4L 2JA5B 5C6AA 2AWNA 2E5LQ 3TP6A 1D5MC 3H0GG 3KK7A 3CW2C 1BKBA 4JBWA 3H6MA 1F9SA 2Q8RE 5IWAQ 3TQYA 1DYQA 3S16B 2BH2A 2OQ0A 3QG1A 3U50C 4L5TA 1SYCA 1N32L 4IURA 4DR6Q 4J15A 4IN3A 2UUBQ 1DGSA 3RLNA 3S14B 2ZTDA 4A3IH 3TZUA 1DOMA 1H9MA 1SFOB 1C8CA 1I6HB 3OHXC 2V4DA 4GN5A 5LL6X 4C3JG 4L63B 3A54A 3HZXA 2JA5H 4EQPA 1JQYD 1NAPA 3VR2A 1Y1VG 2EY2A 4LUOA 4XDXA 3BG3A 3W5OA 3M4PA 3RZDB 1QZGA 3IAYA 1GJXA 2CW0D 1EYGA 2IX1A 3E9IA 2DUDA 1O78A 2K4KA 1JWUD 4HAEA 1WYDA 2Z1CA 3C1FA 3T4AC 4JK1C 1WFQA 1L0YB 4PG3A 5G3LD 5FLMG 2PMZE 4KJNA 2JA7H 2O5IC 3F2BA 3EVQA 2J4XA 1Q3LA 1YVCA 5CYUA 4BBSH 1O7ZA 1IBMQ 1IL8A 3I4NB 5HGTA 4OWXB 1KTKA 1UE6A 1Y8OB 3LNNA 4DV6L 4OIKA 2XRSD 3I90A 2EYPA 4YCVA 2VZAA 1XNQL 2B2WA 3HOXG 4X62L 1ZYRC 4IZ8A 4PMCA 1T5XD 2XNAC 5KEEA 4UP8A 2F4VQ 1JB7A 4POFA 2Q2TA 1KAAA 4C3HB 5BN3A 3PUVA 4HMIA 1L1OC 2PMZB 1IBKQ 1VMPA 1I3QH 3KF6B 4JI4L 3CC4A 1E2ZA 3NHHA 3S1MH 1UAPA 1GKHA 3W2DA 5KGUA 1F9PA 1E2VA 1L1OB 2NN6I 2KUMA 1QJOA 1TS2A 2JEBI 4DV4Q 5IGEA 4OX9L 1SNMA 3GTLH 1UE1A 4YCWA 1K8OA 4LF8Q 3K7UC 1DJRD 1K83H 3S17B 3CRKC 3NQTA 4ZYSA 3OW7A 3K57A 2B2UA 1A3UA 1IYJB 4KKTA 2ES2A 4BY1B 3NEMA 1EIHA 4RKBA 5M5YH 1D5XC 3SK6A 2EY5A 4K5VA 5KNCA 1W6KA 4QY7A 4MTKA 3TEHB 5JEAJ 5M3FB 1J6QA 5M3MH 4CDCC 4X62Q 5IP7H 2A5HA 3MC0B 1K3RA 4IFDH 2DNEA 5AFWA 4A75A 3HG9A 1HXYD 3VR6A 1II3A 1WOCA 2B2WC 3A55A 4C56C 1EQQA 2L1BA 3PIPA 4QQBX 4AH6A 1D8LA 1PTOF 1QUQB 3U4VA 3DWPA 1AZPA 2OF1A 1TKWB 2EQSA 1V9PA 4A3JB 2BA1A 3DM3A 4EQ5A 1K73C 1B3QA 3VA7A 2F0JA 4DR4L 4IPGA 1PTOC 5C4HA 1JOQA 1HNWQ 2IPKD 1FGBD 1PZID 4DR4Q 2N78A 3CC7A 2XGTA 4PQXA 3GTMB 2PI2A 5CV8A 5BR8L 3RN2A 3VR5A 2E2DC 4PV1C 1W2BA 2UXBQ 2KJXA 2JSOA 3P20A 1SYBA 2LSSA 3IL8A 3K58A 3MHBA 4GNXB 1A2TA 4FYDA 1VMCA 3FKIH 3NP8A 3CHBD 1AP0A 3W1GA 3S16H 4L5RC 4HIMA 4LK1C 1EYDA 3PO2H 5IWAL 5EPJA 4KMUC 5C0XI 5EAYA 1AW7A 4DR3Q 4IJHA 2F0KA 1EEID 2QGQA 3TN2A 4WJWA 1ASYA 2AUKA 4GKJQ 1YJNA 2OTJA 1CHPD 2DGYA 1UEAB 1XMQL 1ZKOA 2A8VA 2PW7A 1OO9B 1P16A 4B3RL 2RDGA 1VQEA 1QE6A 3TZDA 2B2UC 3EA6A 2LXJA 2JA6H 3CCRA 1J9OA 1D5ZC 2RBMA 4CGYB 1H9KA 4LF4L 1I5FA 4RA8A 2H4OA 1S5CD 5I4DA 1BVSA 1TWGB 1D6EC 3SK8A 3MXNA 1A2UA 1IL2A 4JCVE 4QGUA 3C3LA 2K6AA 4DK3C 5FLXL 4A3GB 2NYZD 5GADC 5KRUA 4A3GG 1B2TA 4LUVA 3L3OC 2A68D 2CQAA 2F0VA 5H1SE 3RNUA 1GVPA 1Q1EA 3K7AB 1LABA 1N9WA 2HT1A 2EXDA 1LTID 3OPOA 3FEWX 3S2HH 3S2HB 2RHQB 4NXNL 1PH7A 3FPUB 1IYVA 2A6EC 2F0IA 2ZM6L 3J80i 4IPDA 5JPNC 3HOVG 3HKZB 4LJZC 2B63G 3Q0AA 1SE8A 2IL8A 3U4ZA 4F88A 1BQQT 2HQEA 2L0CA 1J5EQ 1H95A 2E8GA 1JE4A 3BDLA 1VQLA 4V190 3KFUA 3A8JE 2ZTEA 1K8MA 3MA2B 2G5DA 3K7AH 4WFN3 5E4WC 1MIUA 2Z4IA 5FKAC 1IBKL 2JA8G 1JOKA 2QW7A 4DUYQ 4DN4M 3PO2G 3AFQA 1EY5A 4HCEA 4LNQA 1E7ZA 3J81i 2ZM6Q 2R92B 3HGBA 3NQIA 2YTXA 3R3OA 4GKKL 4K0KQ 2E2JB 1TWCH 1HR0W 2AMCB 1HNXL 1XNQQ 1CKOA 4IQZA 1KDCA 3GTKH 1ASZA 3QOJA 5HY6A 1BOSA 1Q86C 3S2DB 1E22A 4RMFA 2F0DA 4DV0L 1EQVA 1PYSB 4ZQ3A 4JVZA 4OWWB 1E1TA 1G2SA 2A69D 1HQRD 2K1BA 3DWAA 2UUBL 2IWHA 1TY0A 1ENAA 3DEOA 2L9HA 1JE5A 4TKOB 2UU9L 4LAAA 4DR7Q 1XTDA 1LTGD 1PXUA 1GHJA 5KNDA 5CV6A 1KQSA 1N33Q 3S15H 1BF4A 1A62A 1RL2A 1Y1WB 3A0JA 1NCVA 1QWYA 1IBLQ 4KD3A 3V96A 5FO9B 1ESFA 3HOVB 2AQ2B 5ELNA 2R93G 3L9AX 1PRTF 4ZK9B 5JEAG 1X3EA 4KHVA 1FYCA 2A69C 5KIXA 3A7LA 5JJIA 4DR6L 1RODA 1JWMD 1X56A 1I4RA 2KHJA 2M00A 5FJ8H 4UP7A 1SSOA 4RCNA 2L4NA 2JA9A 4K5WA 3R2IA 5AJ3Q 4R1JA 4QIWB 4BBRH 3S1QH 2GN5A 2IY5B 2VUMB 4RGNA 3I4NG 3SR1A 3CPFA 1PH8A 3EROA 3PUZA 2Q2UA 1ICWA 5J1ZA 3T16A 1VQ5A 1QG7A 2EY6A 1GXDC 1I50B 4MZ9A 3STBC 2R92G 1DOKA 2YYZA 2QF7A 4GS3A 3M3YB 1PVOA 5IYBH 2NVXB 4JW0A 3ONAB 5IGCA 2AQ3B 1CZWA 3A56A 3UDXA 1J8IA 2ALYB 1TWCB 2Z0SA 4C3JH 4CDEC 4C1NK 3PQIA 2NB0A 1S5BD 2Z6KA 3G7LA 4JI3L 1QZHA 1N36L 4C3IB 1L0WA 3HOWG 4I65A 1STHA 4KKSA 4EVOA 4DR2L 4A3DB 3Q6SA 3Q24A 1XPOA 3VA5A 4A3DG 1L0XB 2PNRC 1VQ7A 2K7VA 4BBSG 4ULLA 2SOBA 2OTLA 2EJFC 1TT2A 2JA7G 3TMEA 3HOUG 1VS0A 3HOXH 5A2QE 1RD9D 1VCIA 3HOZB 5LHY1 1RTOA 4A3KH 4DF7A 4LF9L 1NR2A 1PH3A 5FO8B 1XWEA 1B44D 1UUPA 4ZKBB 5FLXc 3K8AA 2WIIB 3H09A 5C44H 1FR3A 4IFDJ 5KNBA 2A19A 4LF4Q 3CRLC 3PO3H 1ZEQX 2SNMA 4JPBW 2ASBA 4IUPA 4JG2A 2KEDA 5EPLA 4V0BA 3I4MG 4GN3B 3NPPA 1OXUA 1SNPA 3I4NH 2YU9H 3H0GH 1B70B 5GQOA 4MIUA 1PZKD 4BBRG 4R8IA 4DV5L 2Y0SB 3WOFA 1K8GA 3IRBA 4A76A 1WTXA 2PZTA 3KF8A 2D2CC 3UI2A 3OMGA 1UWVA 3E6ZX 1H9RA 3BVZA 3DMUA 4DXFA 4FF2A 1PH5A 1JB3A 2JA8H 1GUSA 5JVG3 5A35A 1IKLA 2HQLA 3CCEA 5E7NA 1X3FA 2RDFA 4CKBA 4IOCA 1KDAA 1A15A 4LW1A 1LT4D 1HRJA 2CW0C 2K52A 2EYOA 2JA6B 2NZ1D 2KOLA 1T5EA 1VQOA 1CZGA 5M3MG 2KBNA 2H5XA 5C3WA 1HFNA 1PFNA 4ZUIA 1AN8A 3S1RH 4PMBA 1STNA 5IOCA 4DUZL 1FJGL 2BH8A 4DV1Q 3R8BA 4G7OC 1QCBD 1EZ6A 1ZYRD 1I4QA 4C1NI 1SMXA 5LMUL 1SYFA 1JJ2A 3RZOB 1WTHA 2D0PA 1I94L 3QO2A 4A3KG 4DR1Q 2V1CC 2JXMB 3JAMc 2JA5G 1Z47A 4UHVA 4B3SQ 2EPBA 5EQ0A 3E3XA 2WV6D 1TR5A 1AFPA 1C4QA 4A3CH 5T1IA 3WOEA 5IY0A 2UUAL 1IW7D 4IPHA 1XMOL 1MGSA 4BXXH 1TS5A 3RZOH 1W3SA 3HKSA 2AHOB 1HZ9A 3DUZA 2ZXPA 1B9NA 2TMPA 2R7ZB 4C3IG 3BZCA 1WJJA 3C2PA 3NENA 5CBAE 1X9NA 5C5MA 1LTAD 4O1NA 4DXGA 4B3ML 3CCVA 4TQUS 3OIPA 1VQ9A 2PQAB 2RCNA 3GV3A 3KOJA 4A3MH 3ULJA 2O5JC 4GLAC 4A93B 1C48A 1PH9A 5E3FA 2A6ED 3L0OA 1WTPA 2PZUA 1MI2A 1TY2A 4OWTB 3G6JB 2G9DA 2JE6I 1QOHA 1PRTD 3HRZC 4QMGA 2EJGC 5FJ8G 2K03A 3AFPA 2F0EA 4OX9Q 2F0OA 3H0GB 2QDLA 2P5ZX 1OXXK 4QB4A 4JI3Q 2M9VA 3PIOA 2C5CA 1BR9A 1EY9A 3HOYB 1CI3M 1KAWA 1LT5D 1J5EL 4HTHA 5D3IB 4JI0Q 1YBYA 1SR3A 1F2YA 2VXWA 2OT2A 3H15A 1SNDA 3FRPB 3AYHB 1PHJA 3GTLB 1KDBA 1C9OA 3VDYA 4F87A 5IT9c 1XX8A 3Q8DA 4A3KB 1UEBA 4JI1L 1SROA 3HOZH
chains in the Genus database with same CATH topology
4X3UA 4R8NA 1Q12A 1K83B 1RDPD 1DXMA 2KECA 3GO5A 1OXVA 1QILA 1EU3A 2LY7A 1WD1A 3K5NA 3NK9A 3NWTA 2B2TA 3PUYA 3ND9A 2ENBA 5M5XB 1EYCA 3U9OA 4RH6A 1NSNS 1JR0D 3GTJB 1CT1D 2VNUD 2JA7B 3TDQA 1JC7A 4RCOA 3AU7A 1CHQD 4A3MB 2RQXA 4CBVA 4K2KA 4K8JA 1HCZA 3VYSA 3I70A 1PRTB 1X3QA 5DEHA 4U673 3FVQA 4OO1I 3KBGA 1G91A 4ZRZA 2ICIA 2F0FA 1RJTA 3NWSA 5IT9E 1OXTA 5IGFA 4RAUC 1STYA 1Y8PB 1F2MA 2M2LA 1CA6A 3NTIA 3D6CA 4HN7A 1EY7A 3H94A 4WRDA 4BY7B 3DWQA 1HFGA 3D8GA 1EIGA 3S15B 3BVGA 2B2TC 4M1UB 3BVMA 4A3FB 2QILA 1JOOA 3PUWA 2A73B 4DAPA 4IUUA 2HCCA 5I9OA 4KY7A 5DAUA 3PMFA 2JEAI 5C4ZA 2JA8B 1I6VC 4A3EB 5IIFA 5F2DA 2ZXOA 1OXSC 3OWEB 3GTGB 4UAIA 3NE5B 3OIQA 1ML0D 3EJIA 4KK7A 1Q1BA 2ZT9C 1KNEA 4Z9CB 1B9MA 5EBCA 5DNFA 3KUPA 2R6GA 2F0NA 2GA4B 1YNJD 3QJYA 2ICEC 2RSNA 5CV4A 1Q8IA 3MAQA 1EY6A 3RMHA 4DAYA 3K5LA 4IUTA 2EYFA 5EKIA 2OXPA 3TP8A 3ERQA 3J81L 1A3TA 1DM0B 1SMYC 2H1EA 2MPMA 2NVYB 4IUVA 2D9UA 2HDLA 5EPKA 2EZVA 3VR3A 2F0UA 3I3CA 2EYHA 4G57A 3BDOA 2PQEA 2F0LA 1H9JA 2KVMA 3J7YW 3QOLA 2F3WA 4XQJA 3TP5A 1LO5D 3KLRA 4RWSC 4FF4A 2NN6H 3J7AF 1EWCA 1BCPD 4HSPA 4PNYA 1TVXA 3C1EA 4OIJA 4FF3A 1GUGA 3I73A 2YU9B 3VYTA 4Q5VA 2NTTA 3VR4A 1R9TB 4HR7B 4M8AA 3K5MA 5JVH3 2NTSA 3MEHA 3PUXA 1O7YA 1YNJC 2WB1B 2D5DA 1PMRA 1HTLD 4PMWA 5JAVA 3IFTA 2PCFB 4J6HA 5IGDA 1EEFD 3X3NA 1A6XA 3PIP3 4C3HG 4S3SA 5COYA 5D65A 1CTMA 3I4LA 2L12A 2KQ3A 3GTPB 5J22A 3M4YA 2L5TA 2VB2X 1B3AA 3PV0A 4TSSA 2N88A 1MSGA 5EJWA 1LACA 4N9TA 2B8GA 3T53B 5I6YA 1BO0A 4RKLA 3KBXA 2K05A 5BN4A 4DNTB 1KABA 2Q8TA 2KCNA 4L8JA 1SNCA 3GTOB 2DN8A 1KLUD 1D1KA 2FINB 5E4XA 3R2TA 3S1MB 3E5SA 1TU2B 3M85A 3P7JA 3AB9A 2C9OA 1G6ZA 3D3RA 1DCZA 5FOBB 1QNUA 1FNVA 1O7LA 4KTAA 2K01A 3H3VC 1WTOA 4H7BA 1PFMA 3OSOA 1WD0A 1JORA 4RHRA 1BXTA 1PZJD 1ILQA 1MD2D 3K0YA 1CK1A 5FK9C 2LS01 2O4XA 2A74C 3MXUA 4KN4C 2QEJC 3AMUA 3LWEA 1DONA 3T13A 5ELDA 1CFMA 3OMCA 4B9XA 2F0SA 4IFDG 5DM73 3I72A 2F0GA 1STGA 3TSSA 4QUFA 4H44C 1SJED 3RUZA 3NUCA 1NUCA 1HUMA 3T51B 1ZXTA 1PYWD 4P2CB 2XSCA 1QNKA 4XYOA 2B63B 2AQ1B 5J39A 4RFBA 1PTOD 3I4MB 4K14A 4ODGA 2XVSA 4I7ZC 3K59A 3EFXD 1EFID 1F9QA 5D14A 4NP5A 2QKIC 2JP1A 2RVLA 3M7GA 1EY0A 3FPPA 1S4ZA 2MJ8A 1ENFA 3R93A 1D2BA 1VF5C 4KHZA 1V8QA 3IFDA 1A3VA 1BNZA 1HA6A 2EOTA 2E2IB 2X6LA 4NKLA 5G3LF 2BA0A 2F0TA 2JYOA 5M3MB 3K6OA 5C3EB 4Q0FA 1ENCA 5IODA 2F0PA 1KNAA 1R4PB 1BCPB 2K04A 2R61A 4BA2I 3HOUB 1F9RA 1SYGA 1SAPA 2B2YA 1RF2D 1ONLA 1BBXC 4KKUA 2A68C 1B50A 1U4LA 2MHVA 5CV9A 4H13C 5CV7A 2PZWA 4FVMA 1TWFB 2KA7A 1JICA 3J7AV 4OO1G 3NBIA 3QB3A 5JOBA 4XQQA 1RTNA 1GUTA 3MTSA 3M7NA 3X3MA 3SK5A 5A2QL 1SE2A 3JAML 5C4JB 1VDZA 3DXJC 4DU9A 2MUYA 1IHZA 5BN5A 4FO2A 2EJMA 1S5DD 4BA1I 1I4XA 2A6HC 1LTTD 1FNWA 1STAA 1U4MA 1SE3A 2J0TD 2EVBA 2ZXRA 5CORA 4KN7C 5CBEE 2WAQB 2EXZA 2J7ZA 4N9PA 2K33A 4ZUJA 2R93B 3D4RA 2F0MA 1PTOH 1PTOB 2SEBD 4K6LA 5ELFA 2D62A 3URYA 3BS1A 1HPCA 3MFYA 1SYDA 2FMMA 4BS9A 5C0XH 4OGQC 1SYEA 3BYTB 4J1MA 5I2YA 1EWHA 3NTHA 4ID6A 1Y69U 1V1PB 3SK4A 3ZYYX 3Q23A 1RHPA 3MFGA 2SDFA 3FKIB 5CR3A 1H9SA 2K5QA 4KJOA 1SEBD 2O2LD 3SVMA 1BCPF 4EGVA 2E74C 3W3AA 4F7XA 2TSSA 1TWHB 5K36H 2F4IA 1V1OA 1H9SB 4DK1A 2LFNA 5LL6S 2EDGA 4DGZA 1I3QB 2AWOA 2PO4A 3S1NB 4H0LC 1S5ED 3ITPA 1E0BA 1F2ZA 2DNCA 5HURA 2RA4A 4OHJA 2NVTB 5TSSA 1LTRD 4K8IA 3HS0C 1GHKA 4C3JB 3N52A 5M5WB 3D6WA 4RGOS 1S5FD 4B08A 3A8KE 3I8ZA 2K5DA 1WTWA 1BDOA 2WKCA 4LMQD 5D3DA 2BOSA 3SEBA 1AEXA 3J80E 3CU7A 4G7HC 4YIJA 4XT1B 2WP8J 2NBFA 2Q8IB 1O80A 4RGTA 3D31A 1DZ1A 4A3IB 4K6DA 5JEAH 2B8FA 2VB3X 1SJHD 3LX0A 2K5WA 1CQFA 3S9WA 3Q22A 2EY1A 1QB5D 3HP3A 1Z7TA 4F8MA 1GOZA 1HTPA 3MXGA 2B39A 1VF7A 5ISRA 1ILPA 2WINB 5FLXE 3OWFA 4GZYC 2FHTA 3S1RB 2F3VA 3PIO3 3SDZA 2NUCA 5EGTA 1WCMB 2FJ2A 3DEPA 4XT3B 2DY8A 1GUNA 2RDHA 2RSOA 3O13A 3GV6A 1SNQA 1EY4A 1U9RA 2B2VC 2X69A 2XRQD 2ID0A 1SE4A 3J81E 3SE0A 1UNSA 1IYUA 1HQMC 3GQBA 4IUNA 3KLSX 1U4RA 5ELBA 4FF1A 1M4VA 5EKLA 3N6RA 4NW2A 2WKDA 1Y8NB 5ELEA 1XTCD 1G2TA 4BBRB 3ND8A 2X6GA 3BYYB 2KEEA 1DOLA 3DHQA 5C0XG 1PRTC 1MBYA 1SBBB 1B53A 3MVVA 5E1FA 3D4DA 3HEJA 4CJ0B 4XYQA 4QCLA 1KLGD 2I07B 3QWNA 1SMYD 5I2XA 3HOWB 2EE1A 4J8QA 1HA5A 3BDCA 4K2LA 1LTSD 3MWYW 1TS3A 4KY5A 3RD4A 2BCOA 2N55A 1JCKB 1F2LA 3D4WA 1XYIA 4FXDA 3GP7A 4DK0A 2BE5C 4XXEA 5CV5A 3H91A 5C0XJ 2BDNA 4FNFA 4X3KA 2L55A 2IT1A 4R9WA 1WTQA 1X3PA 1DD2A 2HDMA 2K32A 4ABNA 4AYBB 4CJ1B 4QF4A 2RKSA 2KHSA 2XIWA 2LKVA 4IALA 1LV9A 3V2TA 3VYUA 3S1QB 5IGBA 2XN9C 3NBHA 4KY6A 4X3TA 1W6JA 1EY8A 2FFKB 1ET9A 2CHBD 2EYJA 4O42A 5EBDA 1IW7C 4KD4A 5I6WA 2SNSA 3T56B 2PPBC 2G9HD 1TIID 1EOTA 2E75C 1PFBA 1XXGA 5FO7B 1ET6A 4DA2A 4DFAA 2IX0A 1EL0A 1TWAB 3NXWA 1EU4A 2F0WA 5C5LA 3FDTA 4OO1H 1RCVD 2XWBB 1JWSD 2F0HA 2DY7A 5JJZA 5JPMC 5DM63 4C2MB 1LT6D 4FXKC 5C4XB 4WORA 2PW5A 4HCSA 1SDFA 2AUJD 4E6IA 3IKJA 1G291 1EQTA 1E2WA 4NDXA 3JAME 1M8AA 4XQNA 4Y7NB 5M5YB 1LTBD 3NSWA 4HSVA 3SXHA 5K36G 3LWUA 3U9SA 1EYAA 1FNUA 4G4KA 3CQZB 2F1MA 3MZ5A 3VYRA 2IW3A 4ZLTF 4B9WA 3TP7A 3HOXB 4A3BB 5C44B 5T1GA 1BUVT 1WTVA 3L7ZC 5KYIA 4X3SA 3NTKA 4UDUC 5CMDA 3DM1A 3GD7A 1NR4A 4XTCS 1AZQA 2BDOA 4KV6A 4KI0A 4G7ZC 1F77A 4MHEA 2KCCA 4MN3A 3J80L 2F0QA 1TQOA 3GTQB 1I4PA 3OOCA 2NN6G 2EYLA 2E2HB 2OEOA 3M4OB 4HMJA 3F2UA 2A6HD 1LT3D 1Y1VB 3MXPA 2NVQB 2LMCB 1GUWA 3WDNA 4HEDA 5C3XA 4CKCA 3P1HA 1YNNC 2Z8LA 4ILWA 2PYKA 2B2YC 5I9PA 4L6TB 4K5XA 1MSHA 3BZDB 5K5PA 2QDBA 1LLRD 2QCPX 3RLFA 2L11A 2WACA 1CQVA 1HUNA 1ESRA 2HUGA 3E0JA 2R3ZA 1EZ8A 5IGGA 2CVRA 2Z4HA 4ZKCB 5CGKA 1IKMA 1I4HA 5CC4A 2IJ0A 3EQLC 4RGMA 2MGSA 4CHTB 4TRDA 5KYLA 4DAVA 1PDQA 4NMZA 4IFDI 3GTKB 3V05A 2MP1A 2XWJB 3K5OA 1G8ZD 2I46A 3C46A 2K28A 1WVLA 4ZAIA 3FMCA 1TS4A 4DNRB 2IX3A 1WTRA 3PO3B 5ELCA 1SXTA 1HHVA 1Q90A 1D1IA 2BE5D 3SHLA 1YNND 3KLSA 1U4PA 2HCIA 2EYMA 4FXGC 3CKIB 1R4QB 1SNOA 1CA5A 4XIGS 1RKNA 4QUCA 4ME5A 1B4OA 5NUCA 1PLFA 5IT9L 1Z6HA 2E76C 4RHSA 3TBIB 3P75A 1FD7D 4CKEA 5EKKA 3QIAA 1GUOA 4EQOA 1V43A 3I91A 4BWGB 3A7AB 4BBSB 2B2VA 3A8IE 4IUQA 1B1ZA 4EQNA 1STBA 1STEA 2NWGA 1BCPC 1I4GA 5M9OA 4CJ2C 4FP5D 1V1PA 2FMCA 4U68A 3PO2B 1CM9A 4OL7A 1X32A 2F03A 2JA5B 5C6AA 2AWNA 3TP6A 1D5MC 3KK7A 4JBWA 3H6MA 1F9SA 2Q8RE 1DYQA 3S16B 3QG1A 1SYCA 4IURA 4IN3A 3S14B 3TZUA 1DOMA 1H9MA 1SFOB 1C8CA 1I6HB 3OHXC 2V4DA 5LL6X 4C3JG 4L63B 3A54A 3HZXA 4EQPA 1JQYD 1NAPA 3VR2A 2EY2A 4XDXA 3BG3A 3RZDB 3IAYA 1GJXA 2CW0D 2IX1A 1O78A 1JWUD 4HAEA 3C1FA 2Z1CA 3T4AC 4JK1C 1L0YB 5G3LD 4KJNA 2O5IC 3EVQA 2J4XA 1Q3LA 5CYUA 1O7ZA 1IL8A 3I4NB 5HGTA 1KTKA 1Y8OB 3LNNA 4OIKA 2XRSD 3I90A 2EYPA 2B2WA 1ZYRC 4IZ8A 4PMCA 1T5XD 2XNAC 5KEEA 1KAAA 4C3HB 5BN3A 3PUVA 4HMIA 2PMZB 1VMPA 1E2ZA 3NHHA 1UAPA 3W2DA 5KGUA 1F9PA 1E2VA 2NN6I 2KUMA 1QJOA 1TS2A 2JEBI 5IGEA 1SNMA 1K8OA 1DJRD 3S17B 3CRKC 3NQTA 4ZYSA 3OW7A 3K57A 2B2UA 1A3UA 4KKTA 4BY1B 1EIHA 4RKBA 1D5XC 3SK6A 2EY5A 4K5VA 5KNCA 1W6KA 5JEAJ 5M3FB 2A5HA 3MC0B 4IFDH 2DNEA 5AFWA 3HG9A 1HXYD 3VR6A 1II3A 2B2WC 3A55A 4C56C 2L1BA 1PTOF 1AZPA 3DWPA 2OF1A 1TKWB 4A3JB 2BA1A 3VA7A 2F0JA 1PTOC 5C4HA 1JOQA 2IPKD 1FGBD 1PZID 4PQXA 3GTMB 5CV8A 3VR5A 2E2DC 4PV1C 2KJXA 2JSOA 3P20A 1SYBA 3K58A 3IL8A 3MHBA 1A2TA 4FYDA 1VMCA 3NP8A 3CHBD 1AP0A 4LK1C 1EYDA 5EPJA 4KMUC 5C0XI 1AW7A 2F0KA 1EEID 3TN2A 4WJWA 2AUKA 1CHPD 1UEAB 1ZKOA 2PW7A 1OO9B 2RDGA 1QE6A 3TZDA 2B2UC 3EA6A 1J9OA 1D5ZC 2RBMA 4CGYB 1H9KA 4RA8A 2H4OA 1S5CD 5I4DA 1TWGB 1D6EC 3SK8A 3MXNA 1A2UA 3C3LA 2K6AA 5FLXL 4A3GB 2NYZD 5KRUA 1B2TA 3L3OC 2A68D 2CQAA 2F0VA 1Q1EA 3K7AB 1LABA 1LTID 3OPOA 3FEWX 3S2HB 3FPUB 1IYVA 2A6EC 2F0IA 5JPNC 3HKZB 4LJZC 3Q0AA 2IL8A 4F88A 1BQQT 2HQEA 2L0CA 1JE4A 3BDLA 4V190 3A8JE 1K8MA 3MA2B 4WFN3 5E4WC 2Z4IA 5FKAC 1JOKA 4DN4M 1EY5A 4HCEA 2R92B 3HGBA 3NQIA 3R3OA 2E2JB 4IQZA 1KDCA 3QOJA 1BOSA 3S2DB 2F0DA 1EQVA 4ZQ3A 1G2SA 2A69D 1HQRD 2K1BA 3DWAA 2IWHA 1TY0A 1ENAA 3DEOA 2L9HA 4TKOB 4LAAA 1LTGD 1PXUA 1GHJA 5KNDA 5CV6A 1BF4A 1Y1WB 1NCVA 1QWYA 4KD3A 3V96A 5FO9B 3HOVB 1ESFA 2AQ2B 3L9AX 1PRTF 4ZK9B 5JEAG 4KHVA 1FYCA 2A69C 5KIXA 3A7LA 1RODA 1JWMD 1I4RA 2M00A 1SSOA 4RCNA 2L4NA 4K5WA 3R2IA 4QIWB 2VUMB 4RGNA 3SR1A 3EROA 3PUZA 1ICWA 5J1ZA 3T16A 1QG7A 2EY6A 1GXDC 1I50B 1DOKA 2YYZA 2QF7A 3M3YB 2NVXB 3ONAB 5IGCA 2AQ3B 1CZWA 3A56A 1J8IA 1TWCB 4C1NK 2NB0A 1S5BD 3G7LA 4C3IB 4I65A 1STHA 4KKSA 4EVOA 4A3DB 3Q6SA 3Q24A 3VA5A 1L0XB 2PNRC 2K7VA 4ULLA 2SOBA 2EJFC 1TT2A 3TMEA 5A2QE 1RD9D 1VCIA 3HOZB 5LHY1 1RTOA 4DF7A 1NR2A 5FO8B 1XWEA 1B44D 1UUPA 4ZKBB 2WIIB 3H09A 1FR3A 4IFDJ 5KNBA 3CRLC 1ZEQX 2SNMA 4IUPA 2KEDA 5EPLA 4V0BA 3NPPA 1OXUA 1SNPA 4MIUA 1PZKD 4R8IA 2Y0SB 3WOFA 1WTXA 2PZTA 3KF8A 2D2CC 3UI2A 3OMGA 3E6ZX 1H9RA 3BVZA 3DMUA 4DXFA 4FF2A 1JB3A 1GUSA 5JVG3 5A35A 1IKLA 2RDFA 4CKBA 1KDAA 1A15A 1LT4D 1HRJA 2CW0C 2EYOA 2JA6B 2NZ1D 2KOLA 1T5EA 1CZGA 5C3WA 1HFNA 1PFNA 4ZUIA 1AN8A 4PMBA 1STNA 5IOCA 3R8BA 4G7OC 1QCBD 1EZ6A 1ZYRD 1I4QA 4C1NI 3RZOB 1SYFA 3QO2A 2JXMB 1Z47A 2EPBA 5EQ0A 2WV6D 1TR5A 1AFPA 1C4QA 5T1IA 3WOEA 1IW7D 1MGSA 1TS5A 3DUZA 2ZXPA 1B9NA 2TMPA 2R7ZB 4C3IG 3C2PA 5CBAE 5C5MA 1LTAD 4O1NA 4DXGA 4TQUS 3OIPA 3GV3A 2O5JC 4A93B 1C48A 5E3FA 2A6ED 1WTPA 2PZUA 1MI2A 1TY2A 3G6JB 2G9DA 2JE6I 1QOHA 1PRTD 3HRZC 4QMGA 2EJGC 2K03A 2F0EA 2F0OA 3H0GB 1OXXK 4QB4A 2M9VA 2C5CA 1BR9A 1EY9A 3HOYB 1CI3M 1LT5D 4HTHA 5D3IB 2VXWA 1F2YA 2OT2A 1SNDA 3FRPB 3GTLB 1KDBA 4F87A 1XX8A 4A3KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ8 A;  1SDF A;  1HFN A;  1PFN A;  2IL8 A;  2FMM A;  1U4P A;  2HCI A;  4HAE A;  4IUU A;  2HCC A;  4X3U A;  3ONA B;  1EQT A;  3R93 A;  3MWY W;  1JE4 A;  1J8I A;  3P7J A;  2KEC A;  1TVX A;  3HP3 A;  3IFD A;  1CA5 A;  4OIJ A;  1G6Z A;  2B2Y C;  4QUC A;  1Q3L A;  2EOT A;  1BNZ A;  1HA6 A;  1M8A A;  1O7Z A;  1B4O A;  2X6L A;  5E4W C;  1WD1 A;  1IL8 A;  1PLF A;  1MSH A;  4HSV A;  2N55 A;  2K01 A;  4DN4 M;  4OIK A;  1WTO A;  3I90 A;  2B2T A;  2B2W A;  3G7L A;  2JYO A;  1RHP A;  1F2L A;  1XYI A;  3QO2 A;  1PFM A;  4UAI A;  2SDF A;  1WD0 A;  1ILP A;  1ML0 D;  3I91 A;  3Q6S A;  1KNA A;  2EPB A;  5EQ0 A;  2B2V A;  4IUQ A;  3SVM A;  3IL8 A;  3H91 A;  2BDN A;  2K04 A;  2L11 A;  4X3K A;  1VMC A;  1KNE A;  1F9R A;  1VMP A;  5T1I A;  1ILQ A;  2NWG A;  4R9W A;  2FHT A;  4ZLT F;  1WTQ A;  1SAP A;  1X3P A;  4CJ2 C;  1AP0 A;  1HUN A;  2HDM A;  5DNF A;  2B2Y A;  3KUP A;  1ESR A;  2HUG A;  1MGS A;  2FJ2 A;  1F9P A;  1O7Y A;  4U68 A;  5EPJ A;  3DEP A;  1CM9 A;  1RTO A;  4CJ1 B;  2KUM A;  2R3Z A;  4XT3 B;  3TN2 A;  2XIW A;  1X32 A;  1NR2 A;  3LWE A;  5T1G A;  1G2S A;  1LV9 A;  2DY8 A;  1DON A;  2RSO A;  1BBX C;  2CVR A;  4ZKC B;  4ZKB B;  1WTV A;  2K1B A;  1X3Q A;  3GV6 A;  5CBA E;  4X3S A;  1B50 A;  1E0B A;  3DM1 A;  5CMD A;  3DEO A;  4RWS C;  1IKM A;  2L9H A;  2RA4 A;  5COY A;  4X3T A;  2B2V C;  2X69 A;  5D65 A;  1NR4 A;  1G91 A;  1F9S A;  2FFK B;  2Q8R E;  2RSN A;  2L12 A;  4IUP A;  1AZQ A;  3GV3 A;  1U4L A;  2B2U A;  2KED A;  5EPL A;  4QUF A;  2MGS A;  1QE6 A;  1RJT A;  3TZD A;  2B2U C;  1U4R A;  1PDQ A;  4IUT A;  4MHE A;  5EKI A;  4O42 A;  4MN3 A;  1B3A A;  1J9O A;  1JIC A;  1EIH A;  1WTP A;  1MI2 A;  3N52 A;  4NW2 A;  1HUM A;  4IUR A;  1ZXT A;  4RAU C;  1G2T A;  3D6W A;  4RA8 A;  4R8I A;  2MP1 A;  1RTN A;  2N88 A;  1BF4 A;  1MSG A;  3MTS A;  1WTX A;  1NCV A;  1EOT A;  2H1E A;  2MPM A;  1QNK A;  2M2L A;  3I8Z A;  2X6G A;  5EJW A;  2K03 A;  1WVL A;  2K28 A;  3UI2 A;  4ZK9 B;  4IUV A;  1WTW A;  4ZAI A;  1CA6 A;  2KEE A;  2NYZ D;  1DOL A;  1B2T A;  2D9U A;  2HDL A;  4LMQ D;  1PFB A;  5EPK A;  1BO0 A;  1B53 A;  1ROD A;  3KBX A;  5AFW A;  1DOM A;  1WTR A;  1EL0 A;  1C8C A;  3I3C A;  4CJ0 B;  1IKL A;  2K05 A;  1SSO A;  1U4M A;  2L4N A;  2VXW A;  1HFG A;  1A15 A;  1EIG A;  4XT1 B;  3FDT A;  2Q8T A;  3F2U A;  5COR A;  1HRJ A;  2KVM A;  5CBE E;  2B2W C;  2B2T C;  3FPU B;  1NAP A;  2DY7 A;  2J7Z A;  5JJZ A;  1F9Q A;  2L1B A;  4XDX A;  1HHV A;  5D14 A;  1ICW A;  1XX8 A;  1O80 A;  1QG7 A;  2NZ1 D;  2KOL A;  2RVL A;  2FIN B;  2JP1 A;  4HED A;  1AZP A;  1GUW A;  1DZ1 A;  1S4Z A;  2EE1 A;  5E4X A;  1DOK A;  4HCS A; 
#chains in the Genus database with same CATH topology
 4NXN Q;  1K3B C;  3T1Y Q;  4X3U A;  4R8N A;  1Q12 A;  4DV6 Q;  1K83 B;  1RDP D;  3TRE A;  1DXM A;  2KEC A;  3GO5 A;  4H02 A;  1OXV A;  1QIL A;  1EU3 A;  2LY7 A;  1WD1 A;  4ME3 A;  3K5N A;  4DK6 C;  3NK9 A;  3NWT A;  2B2T A;  3PUY A;  4DNI A;  4BXX G;  1NMG A;  3ND9 A;  1LYL A;  2ENB A;  5M5X B;  1EYC A;  3U9O A;  3G71 A;  4RH6 A;  1NSN S;  1JR0 D;  3GTJ B;  1CT1 D;  2VNU D;  3CC2 A;  2JA7 B;  1B8A A;  3TDQ A;  1JC7 A;  4RCO A;  3AU7 A;  4A3M G;  4A93 G;  1CHQ D;  1G51 A;  2RQX A;  4A3M B;  4CBV A;  3M3Y H;  1NY4 A;  4DV3 L;  4K2K A;  4K8J A;  3AQQ A;  1HCZ A;  1UE7 A;  3EN2 A;  3VYS A;  3I70 A;  1PRT B;  4JI7 Q;  1CKM A;  1X3Q A;  5DEH A;  4U67 3;  3FVQ A;  2CQO A;  3G48 A;  1E24 A;  2I0Q A;  4OO1 I;  3KBG A;  2I5H A;  1G91 A;  4ZRZ A;  2ICI A;  4IOA A;  2F0F A;  1RJT A;  1PH4 A;  4LWC A;  3NWS A;  4DUZ Q;  5IT9 E;  4YWM A;  1OXT A;  5IYC G;  5IGF A;  4GLV B;  1NE3 A;  4RAU C;  5GRO A;  2VUM H;  1K0S A;  1HZA A;  1K28 A;  1STY A;  2OQK A;  4JI5 Q;  2UXD L;  1Y8P B;  1F2M A;  2M2L A;  2N8N A;  4MTN A;  3NTI A;  3D6C A;  5LMU Q;  4I7A A;  1CA6 A;  3UE0 A;  4HN7 A;  1EY7 A;  1SFO H;  3H94 A;  4AQY Q;  3BJU A;  4WRD A;  1C0A A;  2B3G A;  3S14 H;  4R4I A;  4RG1 A;  2F52 A;  4BY7 B;  3DWQ A;  1HFG A;  3D8G A;  3FP9 A;  1EIG A;  3S15 B;  1VQP A;  2HIX A;  2B2T C;  3BVG A;  4M1U B;  3BVM A;  3G4S A;  4A3F B;  2JA6 G;  4JI2 Q;  2IHE A;  2QIL A;  1JOO A;  5C3E G;  3PUW A;  1P8L A;  2A73 B;  1N34 L;  4DAP A;  3S2D H;  4QJF A;  3PF5 A;  4IUU A;  2HCC A;  4JOI C;  1AH9 A;  3KJO A;  5I9O A;  4KY7 A;  5DAU A;  3PMF A;  2JEA I;  2C35 B;  2QA4 A;  3CXC A;  5C4Z A;  2JA8 B;  4A93 H;  1I6V C;  1B7Y B;  1Z9F A;  4A3E B;  5IIF A;  5F2D A;  2ZXO A;  1OXS C;  1U0L A;  3OWE B;  3GTG B;  4UAI A;  5M3F H;  3ZJY C;  3NE5 B;  3OIQ A;  1ML0 D;  3EJI A;  1YI2 A;  4KK7 A;  2F3I A;  5M5W H;  3GTJ H;  1Q1B A;  2ZT9 C;  4LF7 L;  1KNE A;  2R7Z H;  4YWL A;  4Z9C B;  5IYC H;  1YZ6 A;  1B9M A;  5EBC A;  5DNF A;  3KUP A;  2R6G A;  5IP7 G;  2F0N A;  2GA4 B;  2WAQ E;  2VQF L;  1MJE A;  1YNJ D;  1M1K C;  5ELO A;  3QJY A;  3EIV A;  3PSI A;  4JI4 Q;  2ICE C;  2RSN A;  5CV4 A;  1Q8I A;  3MAQ A;  1IBM L;  1EY6 A;  3RMH A;  3T1H L;  4DAY A;  3K5L A;  4IUT A;  2EYF A;  5EKI A;  2ATW A;  2OXP A;  3TP8 A;  3ERQ A;  3J81 L;  1A3T A;  1DM0 B;  5C44 G;  1SMY C;  1Q7Y C;  4B3M Q;  4OEL B;  2H1E A;  2MPM A;  4JYA Q;  2NVY B;  4IUV A;  1Q46 A;  2HIV A;  1HNZ L;  4DAY B;  2D9U A;  2CH4 A;  2HDL A;  5EPK A;  2ZJP A;  2XTI A;  2EZV A;  1MKH A;  3VR3 A;  3HOY G;  2F0U A;  3I3C A;  2EYH A;  4DV7 Q;  1FVI A;  4G57 A;  3CCU A;  3BDO A;  2PQE A;  2RHS B;  2F0L A;  2K5H A;  1H9J A;  2KVM A;  3J7Y W;  4A3L H;  3QOL A;  1U5K A;  3JC6 6;  2F3W A;  4XQJ A;  1K8A C;  1FL0 A;  3TP5 A;  4DR3 L;  4JI7 L;  1LO5 D;  3KLR A;  4RWS C;  4DR1 L;  4FF4 A;  2NN6 H;  4A3J G;  3J7A F;  3HKZ E;  5BR8 Q;  1EWC A;  1BCP D;  4HSP A;  4PNY A;  4IPC A;  2AKW B;  3OYY A;  4PZ6 A;  1TVX A;  4YCU A;  3C1E A;  3A5U A;  3AEV A;  4OIJ A;  4FF3 A;  1GUG A;  2MQH A;  3EBE A;  3I73 A;  4N8F A;  2YU9 B;  2MO0 A;  3VYT A;  4Q5V A;  4GKK Q;  4K0K L;  2NTT A;  3VR4 A;  2RCF A;  4IO9 A;  3HOV H;  1JJC B;  1R9T B;  4HR7 B;  4M8A A;  2A1A A;  3K5M A;  5JVH 3;  4GNX C;  2UUC L;  2NTS A;  3MEH A;  3PUX A;  1YJ9 A;  1GM5 A;  1WCM G;  4A3J H;  1O7Y A;  1YNJ C;  2WB1 B;  2D5D A;  1PMR A;  3GTM H;  1HTL D;  4PMW A;  5JAV A;  1X6O A;  3IFT A;  3HOU H;  2PCF B;  4J6H A;  5IGD A;  1EEF D;  2WFW A;  5DLQ E;  4JI1 Q;  2CWP A;  3X3N A;  4X65 Q;  1A6X A;  4X64 Q;  3PIP 3;  4C3H G;  4S3S A;  5COY A;  5D65 A;  1CTM A;  3I4L A;  2L12 A;  2KQ3 A;  3J80 c;  3GTP B;  4JI0 L;  5J22 A;  4LFA L;  2R7F A;  2MO1 A;  3M4Y A;  2L5T A;  2VB2 X;  1B3A A;  4AYB G;  4A4I A;  3PV0 A;  4JYA L;  4TSS A;  1VQB A;  2N88 A;  1MSG A;  5EJW A;  2Z6B A;  1LAC A;  3M4O H;  4N9T A;  5C3E H;  1BBW A;  2B8G A;  2IHF A;  3CCJ A;  2UXC L;  4JV5 Q;  3T53 B;  5I6Y A;  4DV2 L;  1BO0 A;  4RKL A;  4AIM A;  2N49 A;  3KBX A;  5LMN L;  2QEX A;  2E2I H;  5JJK A;  2K05 A;  5BN4 A;  2WB1 E;  4DNT B;  1KAB A;  2Q8T A;  2KCN A;  2Z6K C;  4L8J A;  1SNC A;  3I4M H;  2DN8 A;  3KDF B;  3GTO B;  2CWA A;  1KLU D;  2ZJR A;  1D1K A;  5M3F G;  2FIN B;  3PF4 A;  5E4X A;  3R2T A;  2MFI A;  3S1M B;  3E5S A;  1TU2 B;  3M85 A;  4PZ7 A;  3P7J A;  3PCO B;  3NBH B;  5AJ3 L;  3AB9 A;  3LGJ A;  3CCS A;  5LMN Q;  3H3V I;  4JI8 L;  2C9O A;  1G6Z A;  3D3R A;  4OON A;  2YV5 A;  1DCZ A;  5FOB B;  1R9T H;  1QNU A;  1FNV A;  1O7L A;  4KTA A;  3TS0 A;  2K5V A;  4A3B H;  2K01 A;  3H3V C;  1WTO A;  2HHH L;  1HZC A;  3CCQ A;  4H7B A;  1PFM A;  5C4X G;  3OSO A;  1WD0 A;  1XNR Q;  1JOR A;  4KHP L;  4RHR A;  3CQZ H;  1BXT A;  3STB D;  1PZJ D;  4B3R Q;  4YY3 L;  1PH2 A;  1ILQ A;  1KXL A;  1MD2 D;  3K0Y A;  1CK1 A;  5FK9 C;  3GTG H;  2K5N A;  3UDG A;  4GOP B;  2LS0 1;  2O4X A;  3UDF A;  2UU9 Q;  4X64 L;  2A74 C;  3MXU A;  4KN4 C;  2QEJ C;  3AMU A;  3I4O A;  3LWE A;  3OW2 A;  2E5L L;  1DON A;  4DKA C;  1YNX A;  3KJP A;  3T13 A;  5IP9 H;  3I56 A;  1JMC A;  5ELD A;  1EFW A;  1CFM A;  2E2J H;  3OMC A;  4B9X A;  2F0S A;  2K14 A;  4IFD G;  3BU2 A;  3I72 A;  5DM7 3;  1TWA H;  2F0G A;  1STG A;  3TSS A;  4QUF A;  4H44 C;  1I50 H;  1SJE D;  3RUZ A;  4BY7 G;  2EIF A;  3NUC A;  1NUC A;  2NVY H;  1HUM A;  3T51 B;  1VQ8 A;  1ZXT A;  1PYW D;  4P2C B;  2XSC A;  1A8V A;  1QNK A;  1YHA A;  4HJ7 A;  3KLW A;  4XYO A;  2B63 B;  3I7F A;  1Q8K A;  2K50 A;  2AQ1 B;  3OTO L;  5J39 A;  4RFB A;  1PTO D;  2PQA A;  3J81 c;  3PO3 G;  2JQO A;  2Y0S E;  3GTO H;  3I4M B;  3CCL A;  4K14 A;  4UY8 C;  2GVB A;  4AYB E;  4ODG A;  2XVS A;  4I7Z C;  4KHP Q;  3K59 A;  3EFX D;  1EFI D;  1F9Q A;  2VL6 A;  4QL5 A;  5D14 A;  4NP5 A;  2RVL A;  2JP1 A;  2QKI C;  3CD6 A;  3M7G A;  1EY0 A;  3FPP A;  1S4Z A;  2MJ8 A;  1ENF A;  4JI8 Q;  3R93 A;  1D2B A;  1MHW C;  1VF5 C;  3S24 A;  3A5Z B;  4KHZ A;  1V8Q A;  2OWO A;  3IFD A;  4LFB L;  4LFC L;  1A3V A;  1BNZ A;  1HA6 A;  2EOT A;  2E2I B;  2X6L A;  4NKL A;  5G3L F;  2R92 H;  4LF7 Q;  2BA0 A;  2F0T A;  3L2P A;  2JYO A;  3GTP H;  4CDF C;  5M3M B;  3K6O A;  5C3E B;  4Q0F A;  5IYD G;  3GTQ H;  1JT8 A;  1ENC A;  5IOD A;  2F0P A;  1KNA A;  1R4P B;  1SLJ A;  5IP9 G;  1BCP B;  2K04 A;  3F8T A;  2R61 A;  5FLM H;  4BA2 I;  4L5S A;  3HOU B;  1F9R A;  1VQ4 A;  5M5X H;  1KIX A;  4B3T L;  1SYG A;  1SAP A;  4DV2 Q;  3G6E A;  4LFB Q;  4BY1 G;  4OXP A;  2B2Y A;  1RF2 D;  4HJA A;  1VQJ A;  4JOI A;  3K81 C;  3S17 H;  1YEZ A;  1ONL A;  4L5Q A;  1BBX C;  3J7Z C;  4KKU A;  4HJ8 A;  2A68 C;  1B50 A;  5J3B A;  1U4L A;  5GAE C;  1GO3 E;  2MHV A;  4H13 C;  5CV7 A;  5CV9 A;  2PZW A;  4FVM A;  1TWF B;  2KA7 A;  1JIC A;  2UXC Q;  3J7A V;  4OO1 G;  3NBI A;  4X65 L;  1VQI A;  2JJQ A;  3QB3 A;  4R4O A;  5JOB A;  4XQQ A;  1K0R A;  1RTN A;  1PV4 A;  1GUT A;  3MTS A;  3M7N A;  1LM0 A;  4JBJ A;  2JN4 A;  3X3M A;  4JI5 L;  3SK5 A;  5A2Q L;  1SE2 A;  3JAM L;  4GN4 B;  5C4J B;  1E3P A;  1VDZ A;  1N33 L;  3DXJ C;  4DU9 A;  2MUY A;  1IHZ A;  5BN5 A;  4FO2 A;  2EJM A;  1EWI A;  4KLK A;  4LF5 L;  1S5D D;  4BA1 I;  1I4X A;  2A6H C;  1LTT D;  1FNW A;  1STA A;  1U4M A;  1SE3 A;  2J0T D;  2EVB A;  2ZXR A;  5COR A;  4KN7 C;  5CBE E;  2WAQ B;  2EXZ A;  2J7Z A;  4N9P A;  2K33 A;  4ZUJ A;  4O0A A;  2R93 B;  3D4R A;  2F0M A;  1PTO H;  1PTO B;  2SEB D;  4K6L A;  5ELF A;  2GVA A;  2D62 A;  3URY A;  3BS1 A;  1HPC A;  2L15 A;  3M4Q A;  2CKZ B;  3MFY A;  1SYD A;  2FMM A;  4YHH Q;  4BS9 A;  5C0X H;  4OGQ C;  1NMF A;  1SYE A;  3BYT B;  4J1M A;  5I2Y A;  1I6H H;  1EWH A;  4B3S L;  4YY3 Q;  3NTH A;  4ID6 A;  1Y69 U;  1V1P B;  4BY1 H;  3SK4 A;  1XPR A;  3ZYY X;  3Q23 A;  1RHP A;  3MFG A;  2SDF A;  1CUK A;  3FKI B;  5CR3 A;  1H9S A;  2K5Q A;  4KJO A;  1SEB D;  3B6Y A;  2O2L D;  3SVM A;  2HHH Q;  1BCP F;  4EGV A;  2E74 C;  3W3A A;  4F7X A;  2TSS A;  1TWH B;  1FGU A;  5K36 H;  2F4I A;  1V1O A;  4IJL A;  1H9S B;  1X3G A;  4DK1 A;  2LFN A;  5LL6 S;  2EDG A;  1HR0 Q;  4DGZ A;  1I3Q B;  4POG A;  3RLO A;  2AWO A;  3ICE A;  1S72 A;  2PO4 A;  2R7Z G;  3S1N B;  3FHW A;  3DLL A;  4H0L C;  2DJG C;  1S5E D;  2VQF Q;  2B29 A;  3ITP A;  1PA6 A;  1E0B A;  1F2Z A;  2DNC A;  5HUR A;  2VS1 A;  2RA4 A;  2E2H H;  4OHJ A;  1C7Y A;  2VW9 A;  2NVT B;  5TSS A;  1LTR D;  1T9H A;  4K8I A;  4LFC Q;  1HNX Q;  3HS0 C;  1Y1V H;  1GHK A;  4C3J B;  3N52 A;  5M5W B;  3D6W A;  3PGZ A;  4RGO S;  1S5F D;  4B08 A;  4A3F G;  3A8K E;  3I8Z A;  2K5D A;  3HKZ G;  1WTW A;  1BDO A;  2WKC A;  4LF6 Q;  1GD7 A;  5IYB G;  1VQA A;  4LMQ D;  2K75 A;  5D3D A;  2BOS A;  3SEB A;  1AEX A;  3J80 E;  3CU7 A;  4G7H C;  3MEF A;  4YIJ A;  4XT1 B;  3CME A;  4LF8 L;  2WP8 J;  1CSP A;  3ERS X;  4UP9 A;  2NBF A;  2Q8I B;  1N34 Q;  1HH2 P;  1EQR A;  1O80 A;  4RGT A;  3D31 A;  4JBK A;  3HOW H;  1QVF A;  1DZ1 A;  4K6D A;  4A3I B;  2B8F A;  1O7I A;  1ICF B;  2VB3 X;  5JEA H;  2NVT H;  1SJH D;  1QUQ A;  2VQE Q;  3LX0 A;  2K5W A;  1LTL A;  1CQF A;  3J81 j;  3S9W A;  3Q22 A;  4OEM B;  4X6A H;  2EY1 A;  1KC8 C;  2CH4 W;  1QB5 D;  1Y1W H;  4A3C G;  3HP3 A;  1Z7T A;  1XMO Q;  4F8M A;  3S1N H;  1EIY B;  1GOZ A;  1HTP A;  3MXG A;  3E9H A;  1N36 Q;  2B39 A;  2YTY A;  4P73 A;  2B63 H;  1VF7 A;  3RN5 A;  5ISR A;  1CSQ A;  1ILP A;  2WIN B;  1I94 Q;  3F1Z A;  5FLX E;  3OWF A;  4HJ5 A;  2UUC Q;  2ZJQ A;  4GZY C;  1N32 Q;  1UE5 A;  2FHT A;  4GOP C;  3S1R B;  2F3V A;  3PIO 3;  4AQY L;  3SDZ A;  1S3O A;  2NUC A;  5EGT A;  1WCM B;  2FJ2 A;  5C4X H;  3DEP A;  1TXY A;  4XT3 B;  2DY8 A;  1GUN A;  2RDH A;  2RSO A;  1Y1W G;  3O13 A;  3JAM i;  3GV6 A;  1SNQ A;  1EY4 A;  1U9R A;  2B2V C;  2XRQ D;  2X69 A;  2ID0 A;  2NVX H;  1SE4 A;  2NZH A;  4R4Q A;  3J81 E;  1L1O A;  3SE0 A;  1UNS A;  4JC0 A;  1IYU A;  1HQM C;  3GQB A;  4IUN A;  3CMA A;  3KLS X;  1U4R A;  5ELB A;  4FF1 A;  4YHH L;  1M4V A;  4TVA B;  5EKL A;  3N6R A;  4DR5 Q;  4GLX A;  4NW2 A;  3MXN B;  2Q2I A;  2WKD A;  1Y8N B;  5ELE A;  1XTC D;  2Y0S G;  1G2T A;  4BBR B;  3ND8 A;  3U58 A;  2X6G A;  3BYY B;  1PFS A;  4NXM L;  2KEE A;  1KHI A;  1DOL A;  3DHQ A;  5C0X G;  1PRT C;  1MBY A;  3HFZ B;  1SBB B;  1B53 A;  1X55 A;  3I2Z A;  3F2D A;  3E0E A;  3MVV A;  5E1F A;  3D4D A;  3HEJ A;  1NJI C;  4CJ0 B;  4XYQ A;  4DAM A;  4QCL A;  1KLG D;  1XNR L;  3SGI A;  2WAQ G;  2I07 B;  3QWN A;  4LF6 L;  4DV5 Q;  4DV0 Q;  1SMY D;  5I2X A;  3HOW B;  2EE1 A;  1NTG A;  3K80 C;  4J8Q A;  1HA5 A;  4LF9 Q;  1XPU A;  3BDC A;  2KCT A;  2NVQ H;  4K2L A;  1LTS D;  1X65 A;  3MWY W;  4GNX A;  1TS3 A;  3BZK A;  4KY5 A;  3KF8 B;  3RD4 A;  2BCO A;  4CDD C;  2PNH A;  2N55 A;  4A3E G;  1Y14 B;  3KYH C;  1WI5 A;  3M9B A;  1JCK B;  1F2L A;  3D4W A;  1XYI A;  1AE3 A;  4FXD A;  1YJW A;  3GP7 A;  4N8X 1;  4DK0 A;  2F4V L;  4WJ4 A;  2BE5 C;  4XXE A;  2MNA A;  5CV5 A;  3H91 A;  5C0X J;  2BDN A;  4FNF A;  3UE1 A;  4DR5 L;  4X3K A;  1V1Q A;  4JBM A;  2L55 A;  4P71 A;  2IT1 A;  4R9W A;  1WTQ A;  1X3P A;  1DD2 A;  3T1Y L;  2HDM A;  2K32 A;  5L37 A;  4ABN A;  2CCZ A;  4AYB B;  4CJ1 B;  4QF4 A;  2RKS A;  2KHS A;  2XIW A;  3K0X A;  2LKV A;  4IAL A;  4A3F H;  1LV9 A;  3V2T A;  1JJG A;  3ER0 A;  1Q81 C;  3VYU A;  3S1Q B;  5IGB A;  2UXD Q;  2XN9 C;  4GKJ L;  1HZB A;  4HIK A;  3NBH A;  4KY6 A;  3F2C A;  4X3T A;  1W6J A;  4LFA Q;  1IXR A;  1EY8 A;  5GAH C;  2FFK B;  1ET9 A;  2CHB D;  3I55 A;  2EYJ A;  1VQF A;  2UUA Q;  4O42 A;  5EBD A;  1IW7 C;  2WB1 G;  3ULL A;  2HD3 A;  4KD4 A;  5I6W A;  2SNS A;  1Q82 C;  3T56 B;  4JI2 L;  2PPB C;  2G9H D;  1TII D;  2N3S A;  1EOT A;  2E75 C;  1M90 C;  3UDI A;  3A74 A;  1PH1 A;  1VQK A;  1PFB A;  1XXG A;  5FO7 B;  3KDF A;  1ET6 A;  4DA2 A;  4DFA A;  2IX0 A;  2VY3 A;  1EL0 A;  1S40 A;  1TWA B;  3NXW A;  1HNW L;  1EU4 A;  2Z9H A;  3CPW A;  2F0W A;  4MNO A;  5C5L A;  4LF5 Q;  3FDT A;  4OO1 H;  1RCV D;  2XWB B;  1JWS D;  4HIO A;  1VQH A;  1PYB A;  2F0H A;  2DY7 A;  5JJZ A;  1EIF A;  5JPM C;  1NNX A;  1VQ6 A;  1HNZ Q;  5DM6 3;  4C2M B;  1LT6 D;  2ZTC A;  1VQD A;  4FXK C;  5C4X B;  2PW5 A;  4HCS A;  3FKI G;  1WCM H;  4WOR A;  1SDF A;  3KF6 A;  3ULP A;  2AUJ D;  4E6I A;  3IKJ A;  1G29 1;  1EQT A;  4ALP A;  1KRT A;  1YIJ A;  1E2W A;  4NDX A;  3T1H Q;  3JAM E;  4HID A;  1M8A A;  4XQN A;  4Y7N B;  5M5Y B;  1LTB D;  3NSW A;  4X66 L;  1KL9 A;  4HSV A;  3SXH A;  3RR5 A;  5K36 G;  3D0F A;  3LWU A;  1IBL L;  5LMN W;  1VQM A;  3U9S A;  1EYA A;  1SRU A;  1FNU A;  4G4K A;  4DPG A;  4DV1 L;  3CQZ B;  4DV7 L;  2F1M A;  3H3V H;  3MZ5 A;  4DR7 L;  3VYR A;  2IW3 A;  1KD1 C;  4ZLT F;  1TWF H;  1AE2 A;  1CKN A;  4B9W A;  1YIT A;  1A0I A;  5GAG C;  4JI6 Q;  3TP7 A;  3HOX B;  4A3B B;  4APV A;  5IE8 A;  4A3B G;  5C44 B;  5T1G A;  4R4C A;  1YHB A;  2JK8 A;  1BUV T;  1WTV A;  3L7Z C;  5KYI A;  4QIW E;  4P75 A;  4X3S A;  3NTK A;  4UDU C;  4EX5 A;  5CMD A;  3DM1 A;  1VQC A;  3GD7 A;  1D7Q A;  1NR4 A;  3TRZ A;  1K9M C;  2OCE A;  4NPS A;  4XTC S;  1AZQ A;  3HOY H;  2BDO A;  5IYD H;  1PH6 A;  4KV6 A;  4KI0 A;  4G7Z C;  4NB3 A;  1F77 A;  4MHE A;  2KCC A;  4MN3 A;  4A3G H;  4Y7N H;  3J80 L;  2F0Q A;  1TWG H;  3TS2 A;  4A3L G;  1TQO A;  3GTQ B;  2NZO A;  1I4P A;  3OOC A;  2NN6 G;  2EYL A;  2R7D A;  3CP0 A;  4C2M H;  1IZ6 A;  4PZ8 A;  2E2H B;  2OEO A;  3M4O B;  4HMJ A;  1BBU A;  4JV5 L;  3F2U A;  4BY7 H;  2A6H D;  1LT3 D;  1Y1V B;  2D0O A;  3MXP A;  2NVQ B;  2LMC B;  1A63 A;  3NEL A;  1GUW A;  4HED A;  3WDN A;  4JI6 L;  5C3X A;  3W1B A;  4CKC A;  4HJ9 A;  1TWH H;  4FDB A;  3P1H A;  1YNN C;  2Z8L A;  4ILW A;  2PYK A;  2B2Y C;  2DJF C;  5I9P A;  3QR8 A;  4L6T B;  1XMQ Q;  4K5X A;  4NXM Q;  1MSH A;  4WJ3 M;  3BZD B;  2PI2 E;  5K5P A;  2QDB A;  5HGQ A;  2UXB L;  1LLR D;  4LUZ A;  2QCP X;  4R4T A;  3RLF A;  4DV3 Q;  4C3H H;  2L11 A;  4ZCK A;  1RIP A;  2KHI A;  4UPA A;  2Q2H A;  3OTO Q;  2WAC A;  1CQV A;  1HUN A;  1ESR A;  2HUG A;  3E0J A;  2R3Z A;  1EZ8 A;  3CCM A;  5IGG A;  2CVR A;  2Z4H A;  4ZKC B;  5CGK A;  3CF5 A;  3CAM A;  1IKM A;  1QVG A;  1FJG Q;  1I4H A;  5CC4 A;  1N8R C;  2IJ0 A;  3EQL C;  4RGM A;  2MGS A;  4CHT B;  4TRD A;  5KYL A;  1NBW A;  4DAV A;  2R93 H;  4B3T Q;  1PDQ A;  1CKN B;  5C4J H;  4NMZ A;  4IFD I;  3GTK B;  1E1O A;  3V05 A;  2MP1 A;  2VQE L;  2XWJ B;  3K5O A;  1G8Z D;  4GOP A;  2CFM A;  2I46 A;  1WVL A;  2K28 A;  3C46 A;  4ZAI A;  3FMC A;  1TS4 A;  5JJL A;  4DNR B;  1VQN A;  4DUY L;  2IX3 A;  2RF4 A;  1WTR A;  1OTC A;  3PO3 B;  5ELC A;  2FXQ A;  2KCM A;  1QVC A;  2VUM G;  1EOV A;  1SXT A;  1HHV A;  1Q90 A;  1KRS A;  1D1I A;  2BE5 D;  3SHL A;  4A3I G;  1YNN D;  3KLS A;  1U4P A;  2HCI A;  2EYM A;  2I5L X;  4FXG C;  3CKI B;  1G6P A;  1R4Q B;  1SNO A;  3WWV A;  2I5M X;  1CA5 A;  4XIG S;  1RKN A;  4QUC A;  1MJC A;  1VQG A;  4ME5 A;  1YHQ A;  1B4O A;  5NUC A;  1PLF A;  4P74 A;  4A3D H;  5IT9 L;  1XJV A;  1Z6H A;  4C3I H;  2E76 C;  1SN8 A;  4RHS A;  3TBI B;  3P75 A;  1FD7 D;  4DR2 Q;  2LXK A;  2KEN A;  4CKE A;  5EKK A;  3QIA A;  1GUO A;  4EQO A;  1V43 A;  2YTV A;  3I91 A;  4O2D A;  4BWG B;  3A7A B;  4BBS B;  2B2V A;  3A8I E;  4IUQ A;  1B1Z A;  4EQN A;  1HR0 L;  1STB A;  1HJP A;  4X66 Q;  1STE A;  2NWG A;  1BCP C;  3GDE A;  4YWK A;  1I4G A;  5M9O A;  4CJ2 C;  1LUZ A;  4P72 A;  4FP5 D;  1V1P A;  3HOZ G;  1X54 A;  2FMC A;  1L2F A;  4Y52 H;  4U68 A;  3PO2 B;  4A3E H;  1CM9 A;  4OL7 A;  3RZD H;  1X32 A;  1EUJ A;  3J7A 5;  2F03 A;  4DV4 L;  2JA5 B;  5C6A A;  2AWN A;  2E5L Q;  3TP6 A;  1D5M C;  3H0G G;  3KK7 A;  3CW2 C;  1BKB A;  4JBW A;  3H6M A;  1F9S A;  2Q8R E;  5IWA Q;  3TQY A;  1DYQ A;  3S16 B;  2BH2 A;  2OQ0 A;  3QG1 A;  3U50 C;  4L5T A;  1SYC A;  1N32 L;  4IUR A;  4DR6 Q;  4J15 A;  4IN3 A;  2UUB Q;  1DGS A;  3RLN A;  3S14 B;  2ZTD A;  4A3I H;  3TZU A;  1DOM A;  1H9M A;  1SFO B;  1C8C A;  1I6H B;  3OHX C;  2V4D A;  4GN5 A;  5LL6 X;  4C3J G;  4L63 B;  3A54 A;  3HZX A;  2JA5 H;  4EQP A;  1JQY D;  1NAP A;  3VR2 A;  1Y1V G;  2EY2 A;  4LUO A;  4XDX A;  3BG3 A;  3W5O A;  3M4P A;  3RZD B;  1QZG A;  3IAY A;  1GJX A;  2CW0 D;  1EYG A;  2IX1 A;  3E9I A;  2DUD A;  1O78 A;  2K4K A;  1JWU D;  4HAE A;  1WYD A;  2Z1C A;  3C1F A;  3T4A C;  4JK1 C;  1WFQ A;  1L0Y B;  4PG3 A;  5G3L D;  5FLM G;  2PMZ E;  4KJN A;  2JA7 H;  2O5I C;  3F2B A;  3EVQ A;  2J4X A;  1Q3L A;  1YVC A;  5CYU A;  4BBS H;  1O7Z A;  1IBM Q;  1IL8 A;  3I4N B;  5HGT A;  4OWX B;  1KTK A;  1UE6 A;  1Y8O B;  3LNN A;  4DV6 L;  4OIK A;  2XRS D;  3I90 A;  2EYP A;  4YCV A;  2VZA A;  1XNQ L;  2B2W A;  3HOX G;  4X62 L;  1ZYR C;  4IZ8 A;  4PMC A;  1T5X D;  2XNA C;  5KEE A;  4UP8 A;  2F4V Q;  1JB7 A;  4POF A;  2Q2T A;  1KAA A;  4C3H B;  5BN3 A;  3PUV A;  4HMI A;  1L1O C;  2PMZ B;  1IBK Q;  1VMP A;  1I3Q H;  3KF6 B;  4JI4 L;  3CC4 A;  1E2Z A;  3NHH A;  3S1M H;  1UAP A;  1GKH A;  3W2D A;  5KGU A;  1F9P A;  1E2V A;  1L1O B;  2NN6 I;  2KUM A;  1QJO A;  1TS2 A;  2JEB I;  4DV4 Q;  5IGE A;  4OX9 L;  1SNM A;  3GTL H;  1UE1 A;  4YCW A;  1K8O A;  4LF8 Q;  3K7U C;  1DJR D;  1K83 H;  3S17 B;  3CRK C;  3NQT A;  4ZYS A;  3OW7 A;  3K57 A;  2B2U A;  1A3U A;  1IYJ B;  4KKT A;  2ES2 A;  4BY1 B;  3NEM A;  1EIH A;  4RKB A;  5M5Y H;  1D5X C;  3SK6 A;  2EY5 A;  4K5V A;  5KNC A;  1W6K A;  4QY7 A;  4MTK A;  3TEH B;  5JEA J;  5M3F B;  1J6Q A;  5M3M H;  4CDC C;  4X62 Q;  5IP7 H;  2A5H A;  3MC0 B;  1K3R A;  4IFD H;  2DNE A;  5AFW A;  4A75 A;  3HG9 A;  1HXY D;  3VR6 A;  1II3 A;  1WOC A;  2B2W C;  3A55 A;  4C56 C;  1EQQ A;  2L1B A;  3PIP A;  4QQB X;  4AH6 A;  1D8L A;  1PTO F;  1QUQ B;  3U4V A;  3DWP A;  1AZP A;  2OF1 A;  1TKW B;  2EQS A;  1V9P A;  4A3J B;  2BA1 A;  3DM3 A;  4EQ5 A;  1K73 C;  1B3Q A;  3VA7 A;  2F0J A;  4DR4 L;  4IPG A;  1PTO C;  5C4H A;  1JOQ A;  1HNW Q;  2IPK D;  1FGB D;  1PZI D;  4DR4 Q;  2N78 A;  3CC7 A;  2XGT A;  4PQX A;  3GTM B;  2PI2 A;  5CV8 A;  5BR8 L;  3RN2 A;  3VR5 A;  2E2D C;  4PV1 C;  1W2B A;  2UXB Q;  2KJX A;  2JSO A;  3P20 A;  1SYB A;  2LSS A;  3IL8 A;  3K58 A;  3MHB A;  4GNX B;  1A2T A;  4FYD A;  1VMC A;  3FKI H;  3NP8 A;  3CHB D;  1AP0 A;  3W1G A;  3S16 H;  4L5R C;  4HIM A;  4LK1 C;  1EYD A;  3PO2 H;  5IWA L;  5EPJ A;  4KMU C;  5C0X I;  5EAY A;  1AW7 A;  4DR3 Q;  4IJH A;  2F0K A;  1EEI D;  2QGQ A;  3TN2 A;  4WJW A;  1ASY A;  2AUK A;  4GKJ Q;  1YJN A;  2OTJ A;  1CHP D;  2DGY A;  1UEA B;  1XMQ L;  1ZKO A;  2A8V A;  2PW7 A;  1OO9 B;  1P16 A;  4B3R L;  2RDG A;  1VQE A;  1QE6 A;  3TZD A;  2B2U C;  3EA6 A;  2LXJ A;  2JA6 H;  3CCR A;  1J9O A;  1D5Z C;  2RBM A;  4CGY B;  1H9K A;  4LF4 L;  1I5F A;  4RA8 A;  2H4O A;  1S5C D;  5I4D A;  1BVS A;  1TWG B;  1D6E C;  3SK8 A;  3MXN A;  1A2U A;  1IL2 A;  4JCV E;  4QGU A;  3C3L A;  2K6A A;  4DK3 C;  5FLX L;  4A3G B;  2NYZ D;  5GAD C;  5KRU A;  4A3G G;  1B2T A;  4LUV A;  3L3O C;  2A68 D;  2CQA A;  2F0V A;  5H1S E;  3RNU A;  1GVP A;  1Q1E A;  3K7A B;  1LAB A;  1N9W A;  2HT1 A;  2EXD A;  1LTI D;  3OPO A;  3FEW X;  3S2H H;  3S2H B;  2RHQ B;  4NXN L;  1PH7 A;  3FPU B;  1IYV A;  2A6E C;  2F0I A;  2ZM6 L;  3J80 i;  4IPD A;  5JPN C;  3HOV G;  3HKZ B;  4LJZ C;  2B63 G;  3Q0A A;  1SE8 A;  2IL8 A;  3U4Z A;  4F88 A;  1BQQ T;  2HQE A;  2L0C A;  1J5E Q;  1H95 A;  2E8G A;  1JE4 A;  3BDL A;  1VQL A;  4V19 0;  3KFU A;  3A8J E;  2ZTE A;  1K8M A;  3MA2 B;  2G5D A;  3K7A H;  4WFN 3;  5E4W C;  1MIU A;  2Z4I A;  5FKA C;  1IBK L;  2JA8 G;  1JOK A;  2QW7 A;  4DUY Q;  4DN4 M;  3PO2 G;  3AFQ A;  1EY5 A;  4HCE A;  4LNQ A;  1E7Z A;  3J81 i;  2ZM6 Q;  2R92 B;  3HGB A;  3NQI A;  2YTX A;  3R3O A;  4GKK L;  4K0K Q;  2E2J B;  1TWC H;  1HR0 W;  2AMC B;  1HNX L;  1XNQ Q;  1CKO A;  4IQZ A;  1KDC A;  3GTK H;  1ASZ A;  3QOJ A;  5HY6 A;  1BOS A;  1Q86 C;  3S2D B;  1E22 A;  4RMF A;  2F0D A;  4DV0 L;  1EQV A;  1PYS B;  4ZQ3 A;  4JVZ A;  4OWW B;  1E1T A;  1G2S A;  2A69 D;  1HQR D;  2K1B A;  3DWA A;  2UUB L;  2IWH A;  1TY0 A;  1ENA A;  3DEO A;  2L9H A;  1JE5 A;  4TKO B;  2UU9 L;  4LAA A;  4DR7 Q;  1XTD A;  1LTG D;  1PXU A;  1GHJ A;  5KND A;  5CV6 A;  1KQS A;  1N33 Q;  3S15 H;  1BF4 A;  1A62 A;  1RL2 A;  1Y1W B;  3A0J A;  1NCV A;  1QWY A;  1IBL Q;  4KD3 A;  3V96 A;  5FO9 B;  1ESF A;  3HOV B;  2AQ2 B;  5ELN A;  2R93 G;  3L9A X;  1PRT F;  4ZK9 B;  5JEA G;  1X3E A;  4KHV A;  1FYC A;  2A69 C;  5KIX A;  3A7L A;  5JJI A;  4DR6 L;  1ROD A;  1JWM D;  1X56 A;  1I4R A;  2KHJ A;  2M00 A;  5FJ8 H;  4UP7 A;  1SSO A;  4RCN A;  2L4N A;  2JA9 A;  4K5W A;  3R2I A;  5AJ3 Q;  4R1J A;  4QIW B;  4BBR H;  3S1Q H;  2GN5 A;  2IY5 B;  2VUM B;  4RGN A;  3I4N G;  3SR1 A;  3CPF A;  1PH8 A;  3ERO A;  3PUZ A;  2Q2U A;  1ICW A;  5J1Z A;  3T16 A;  1VQ5 A;  1QG7 A;  2EY6 A;  1GXD C;  1I50 B;  4MZ9 A;  3STB C;  2R92 G;  1DOK A;  2YYZ A;  2QF7 A;  4GS3 A;  3M3Y B;  1PVO A;  5IYB H;  2NVX B;  4JW0 A;  3ONA B;  5IGC A;  2AQ3 B;  1CZW A;  3A56 A;  3UDX A;  1J8I A;  2ALY B;  1TWC B;  2Z0S A;  4C3J H;  4CDE C;  4C1N K;  3PQI A;  2NB0 A;  1S5B D;  2Z6K A;  3G7L A;  4JI3 L;  1QZH A;  1N36 L;  4C3I B;  1L0W A;  3HOW G;  4I65 A;  1STH A;  4KKS A;  4EVO A;  4DR2 L;  4A3D B;  3Q6S A;  3Q24 A;  1XPO A;  3VA5 A;  4A3D G;  1L0X B;  2PNR C;  1VQ7 A;  2K7V A;  4BBS G;  4ULL A;  2SOB A;  2OTL A;  2EJF C;  1TT2 A;  2JA7 G;  3TME A;  3HOU G;  1VS0 A;  3HOX H;  5A2Q E;  1RD9 D;  1VCI A;  3HOZ B;  5LHY 1;  1RTO A;  4A3K H;  4DF7 A;  4LF9 L;  1NR2 A;  1PH3 A;  5FO8 B;  1XWE A;  1B44 D;  1UUP A;  4ZKB B;  5FLX c;  3K8A A;  2WII B;  3H09 A;  5C44 H;  1FR3 A;  4IFD J;  5KNB A;  2A19 A;  4LF4 Q;  3CRL C;  3PO3 H;  1ZEQ X;  2SNM A;  4JPB W;  2ASB A;  4IUP A;  4JG2 A;  2KED A;  5EPL A;  4V0B A;  3I4M G;  4GN3 B;  3NPP A;  1OXU A;  1SNP A;  3I4N H;  2YU9 H;  3H0G H;  1B70 B;  5GQO A;  4MIU A;  1PZK D;  4BBR G;  4R8I A;  4DV5 L;  2Y0S B;  3WOF A;  1K8G A;  3IRB A;  4A76 A;  1WTX A;  2PZT A;  3KF8 A;  2D2C C;  3UI2 A;  3OMG A;  1UWV A;  3E6Z X;  1H9R A;  3BVZ A;  3DMU A;  4DXF A;  4FF2 A;  1PH5 A;  1JB3 A;  2JA8 H;  1GUS A;  5JVG 3;  5A35 A;  1IKL A;  2HQL A;  3CCE A;  5E7N A;  1X3F A;  2RDF A;  4CKB A;  4IOC A;  1KDA A;  1A15 A;  4LW1 A;  1LT4 D;  1HRJ A;  2CW0 C;  2K52 A;  2EYO A;  2JA6 B;  2NZ1 D;  2KOL A;  1T5E A;  1VQO A;  1CZG A;  5M3M G;  2KBN A;  2H5X A;  5C3W A;  1HFN A;  1PFN A;  4ZUI A;  1AN8 A;  3S1R H;  4PMB A;  1STN A;  5IOC A;  4DUZ L;  1FJG L;  2BH8 A;  4DV1 Q;  3R8B A;  4G7O C;  1QCB D;  1EZ6 A;  1ZYR D;  1I4Q A;  4C1N I;  1SMX A;  5LMU L;  1SYF A;  1JJ2 A;  3RZO B;  1WTH A;  2D0P A;  1I94 L;  3QO2 A;  4A3K G;  4DR1 Q;  2V1C C;  2JXM B;  3JAM c;  2JA5 G;  1Z47 A;  4UHV A;  4B3S Q;  2EPB A;  5EQ0 A;  3E3X A;  2WV6 D;  1TR5 A;  1AFP A;  1C4Q A;  4A3C H;  5T1I A;  3WOE A;  5IY0 A;  2UUA L;  1IW7 D;  4IPH A;  1XMO L;  1MGS A;  4BXX H;  1TS5 A;  3RZO H;  1W3S A;  3HKS A;  2AHO B;  1HZ9 A;  3DUZ A;  2ZXP A;  1B9N A;  2TMP A;  2R7Z B;  4C3I G;  3BZC A;  1WJJ A;  3C2P A;  3NEN A;  5CBA E;  1X9N A;  5C5M A;  1LTA D;  4O1N A;  4DXG A;  4B3M L;  3CCV A;  4TQU S;  3OIP A;  1VQ9 A;  2PQA B;  2RCN A;  3GV3 A;  3KOJ A;  4A3M H;  3ULJ A;  2O5J C;  4GLA C;  4A93 B;  1C48 A;  1PH9 A;  5E3F A;  2A6E D;  3L0O A;  1WTP A;  2PZU A;  1MI2 A;  1TY2 A;  4OWT B;  3G6J B;  2G9D A;  2JE6 I;  1QOH A;  1PRT D;  3HRZ C;  4QMG A;  2EJG C;  5FJ8 G;  2K03 A;  3AFP A;  2F0E A;  4OX9 Q;  2F0O A;  3H0G B;  2QDL A;  2P5Z X;  1OXX K;  4QB4 A;  4JI3 Q;  2M9V A;  3PIO A;  2C5C A;  1BR9 A;  1EY9 A;  3HOY B;  1CI3 M;  1KAW A;  1LT5 D;  1J5E L;  4HTH A;  5D3I B;  4JI0 Q;  1YBY A;  1SR3 A;  1F2Y A;  2VXW A;  2OT2 A;  3H15 A;  1SND A;  3FRP B;  3AYH B;  1PHJ A;  3GTL B;  1KDB A;  1C9O A;  3VDY A;  4F87 A;  5IT9 c;  1XX8 A;  3Q8D A;  4A3K B;  1UEB A;  4JI1 L;  1SRO A;  3HOZ H; 
#chains in the Genus database with same CATH homology
 4X3U A;  4R8N A;  1Q12 A;  1K83 B;  1RDP D;  1DXM A;  2KEC A;  3GO5 A;  1OXV A;  1QIL A;  1EU3 A;  2LY7 A;  1WD1 A;  3K5N A;  3NK9 A;  3NWT A;  2B2T A;  3PUY A;  3ND9 A;  2ENB A;  5M5X B;  1EYC A;  3U9O A;  4RH6 A;  1NSN S;  1JR0 D;  3GTJ B;  1CT1 D;  2VNU D;  2JA7 B;  3TDQ A;  1JC7 A;  4RCO A;  3AU7 A;  1CHQ D;  4A3M B;  2RQX A;  4CBV A;  4K2K A;  4K8J A;  1HCZ A;  3VYS A;  3I70 A;  1PRT B;  1X3Q A;  5DEH A;  4U67 3;  3FVQ A;  4OO1 I;  3KBG A;  1G91 A;  4ZRZ A;  2ICI A;  2F0F A;  1RJT A;  3NWS A;  5IT9 E;  1OXT A;  5IGF A;  4RAU C;  1STY A;  1Y8P B;  1F2M A;  2M2L A;  1CA6 A;  3NTI A;  3D6C A;  4HN7 A;  1EY7 A;  3H94 A;  4WRD A;  4BY7 B;  3DWQ A;  1HFG A;  3D8G A;  1EIG A;  3S15 B;  3BVG A;  2B2T C;  4M1U B;  3BVM A;  4A3F B;  2QIL A;  1JOO A;  3PUW A;  2A73 B;  4DAP A;  4IUU A;  2HCC A;  5I9O A;  4KY7 A;  5DAU A;  3PMF A;  2JEA I;  5C4Z A;  2JA8 B;  1I6V C;  4A3E B;  5IIF A;  5F2D A;  2ZXO A;  1OXS C;  3OWE B;  3GTG B;  4UAI A;  3NE5 B;  3OIQ A;  1ML0 D;  3EJI A;  4KK7 A;  1Q1B A;  2ZT9 C;  1KNE A;  4Z9C B;  1B9M A;  5EBC A;  5DNF A;  3KUP A;  2R6G A;  2F0N A;  2GA4 B;  1YNJ D;  3QJY A;  2ICE C;  2RSN A;  5CV4 A;  1Q8I A;  3MAQ A;  1EY6 A;  3RMH A;  4DAY A;  3K5L A;  4IUT A;  2EYF A;  5EKI A;  2OXP A;  3TP8 A;  3ERQ A;  3J81 L;  1A3T A;  1DM0 B;  1SMY C;  2H1E A;  2MPM A;  2NVY B;  4IUV A;  2D9U A;  2HDL A;  5EPK A;  2EZV A;  3VR3 A;  2F0U A;  3I3C A;  2EYH A;  4G57 A;  3BDO A;  2PQE A;  2F0L A;  1H9J A;  2KVM A;  3J7Y W;  3QOL A;  2F3W A;  4XQJ A;  3TP5 A;  1LO5 D;  3KLR A;  4RWS C;  4FF4 A;  2NN6 H;  3J7A F;  1EWC A;  1BCP D;  4HSP A;  4PNY A;  1TVX A;  3C1E A;  4OIJ A;  4FF3 A;  1GUG A;  3I73 A;  2YU9 B;  3VYT A;  4Q5V A;  2NTT A;  3VR4 A;  1R9T B;  4HR7 B;  4M8A A;  3K5M A;  5JVH 3;  2NTS A;  3MEH A;  3PUX A;  1O7Y A;  1YNJ C;  2WB1 B;  2D5D A;  1PMR A;  1HTL D;  4PMW A;  5JAV A;  3IFT A;  2PCF B;  4J6H A;  5IGD A;  1EEF D;  3X3N A;  1A6X A;  3PIP 3;  4C3H G;  4S3S A;  5COY A;  5D65 A;  1CTM A;  3I4L A;  2L12 A;  2KQ3 A;  3GTP B;  5J22 A;  3M4Y A;  2L5T A;  2VB2 X;  1B3A A;  3PV0 A;  4TSS A;  2N88 A;  1MSG A;  5EJW A;  1LAC A;  4N9T A;  2B8G A;  3T53 B;  5I6Y A;  1BO0 A;  4RKL A;  3KBX A;  2K05 A;  5BN4 A;  4DNT B;  1KAB A;  2Q8T A;  2KCN A;  4L8J A;  1SNC A;  3GTO B;  2DN8 A;  1KLU D;  1D1K A;  2FIN B;  5E4X A;  3R2T A;  3S1M B;  3E5S A;  1TU2 B;  3M85 A;  3P7J A;  3AB9 A;  2C9O A;  1G6Z A;  3D3R A;  1DCZ A;  5FOB B;  1QNU A;  1FNV A;  1O7L A;  4KTA A;  2K01 A;  3H3V C;  1WTO A;  4H7B A;  1PFM A;  3OSO A;  1WD0 A;  1JOR A;  4RHR A;  1BXT A;  1PZJ D;  1ILQ A;  1MD2 D;  3K0Y A;  1CK1 A;  5FK9 C;  2LS0 1;  2O4X A;  2A74 C;  3MXU A;  4KN4 C;  2QEJ C;  3AMU A;  3LWE A;  1DON A;  3T13 A;  5ELD A;  1CFM A;  3OMC A;  4B9X A;  2F0S A;  4IFD G;  5DM7 3;  3I72 A;  2F0G A;  1STG A;  3TSS A;  4QUF A;  4H44 C;  1SJE D;  3RUZ A;  3NUC A;  1NUC A;  1HUM A;  3T51 B;  1ZXT A;  1PYW D;  4P2C B;  2XSC A;  1QNK A;  4XYO A;  2B63 B;  2AQ1 B;  5J39 A;  4RFB A;  1PTO D;  3I4M B;  4K14 A;  4ODG A;  2XVS A;  4I7Z C;  3K59 A;  3EFX D;  1EFI D;  1F9Q A;  5D14 A;  4NP5 A;  2QKI C;  2JP1 A;  2RVL A;  3M7G A;  1EY0 A;  3FPP A;  1S4Z A;  2MJ8 A;  1ENF A;  3R93 A;  1D2B A;  1VF5 C;  4KHZ A;  1V8Q A;  3IFD A;  1A3V A;  1BNZ A;  1HA6 A;  2EOT A;  2E2I B;  2X6L A;  4NKL A;  5G3L F;  2BA0 A;  2F0T A;  2JYO A;  5M3M B;  3K6O A;  5C3E B;  4Q0F A;  1ENC A;  5IOD A;  2F0P A;  1KNA A;  1R4P B;  1BCP B;  2K04 A;  2R61 A;  4BA2 I;  3HOU B;  1F9R A;  1SYG A;  1SAP A;  2B2Y A;  1RF2 D;  1ONL A;  1BBX C;  4KKU A;  2A68 C;  1B50 A;  1U4L A;  2MHV A;  5CV9 A;  4H13 C;  5CV7 A;  2PZW A;  4FVM A;  1TWF B;  2KA7 A;  1JIC A;  3J7A V;  4OO1 G;  3NBI A;  3QB3 A;  5JOB A;  4XQQ A;  1RTN A;  1GUT A;  3MTS A;  3M7N A;  3X3M A;  3SK5 A;  5A2Q L;  1SE2 A;  3JAM L;  5C4J B;  1VDZ A;  3DXJ C;  4DU9 A;  2MUY A;  1IHZ A;  5BN5 A;  4FO2 A;  2EJM A;  1S5D D;  4BA1 I;  1I4X A;  2A6H C;  1LTT D;  1FNW A;  1STA A;  1U4M A;  1SE3 A;  2J0T D;  2EVB A;  2ZXR A;  5COR A;  4KN7 C;  5CBE E;  2WAQ B;  2EXZ A;  2J7Z A;  4N9P A;  2K33 A;  4ZUJ A;  2R93 B;  3D4R A;  2F0M A;  1PTO H;  1PTO B;  2SEB D;  4K6L A;  5ELF A;  2D62 A;  3URY A;  3BS1 A;  1HPC A;  3MFY A;  1SYD A;  2FMM A;  4BS9 A;  5C0X H;  4OGQ C;  1SYE A;  3BYT B;  4J1M A;  5I2Y A;  1EWH A;  3NTH A;  4ID6 A;  1Y69 U;  1V1P B;  3SK4 A;  3ZYY X;  3Q23 A;  1RHP A;  3MFG A;  2SDF A;  3FKI B;  5CR3 A;  1H9S A;  2K5Q A;  4KJO A;  1SEB D;  2O2L D;  3SVM A;  1BCP F;  4EGV A;  2E74 C;  3W3A A;  4F7X A;  2TSS A;  1TWH B;  5K36 H;  2F4I A;  1V1O A;  1H9S B;  4DK1 A;  2LFN A;  5LL6 S;  2EDG A;  4DGZ A;  1I3Q B;  2AWO A;  2PO4 A;  3S1N B;  4H0L C;  1S5E D;  3ITP A;  1E0B A;  1F2Z A;  2DNC A;  5HUR A;  2RA4 A;  4OHJ A;  2NVT B;  5TSS A;  1LTR D;  4K8I A;  3HS0 C;  1GHK A;  4C3J B;  3N52 A;  5M5W B;  3D6W A;  4RGO S;  1S5F D;  4B08 A;  3A8K E;  3I8Z A;  2K5D A;  1WTW A;  1BDO A;  2WKC A;  4LMQ D;  5D3D A;  2BOS A;  3SEB A;  1AEX A;  3J80 E;  3CU7 A;  4G7H C;  4YIJ A;  4XT1 B;  2WP8 J;  2NBF A;  2Q8I B;  1O80 A;  4RGT A;  3D31 A;  1DZ1 A;  4A3I B;  4K6D A;  5JEA H;  2B8F A;  2VB3 X;  1SJH D;  3LX0 A;  2K5W A;  1CQF A;  3S9W A;  3Q22 A;  2EY1 A;  1QB5 D;  3HP3 A;  1Z7T A;  4F8M A;  1GOZ A;  1HTP A;  3MXG A;  2B39 A;  1VF7 A;  5ISR A;  1ILP A;  2WIN B;  5FLX E;  3OWF A;  4GZY C;  2FHT A;  3S1R B;  2F3V A;  3PIO 3;  3SDZ A;  2NUC A;  5EGT A;  1WCM B;  2FJ2 A;  3DEP A;  4XT3 B;  2DY8 A;  1GUN A;  2RDH A;  2RSO A;  3O13 A;  3GV6 A;  1SNQ A;  1EY4 A;  1U9R A;  2B2V C;  2X69 A;  2XRQ D;  2ID0 A;  1SE4 A;  3J81 E;  3SE0 A;  1UNS A;  1IYU A;  1HQM C;  3GQB A;  4IUN A;  3KLS X;  1U4R A;  5ELB A;  4FF1 A;  1M4V A;  5EKL A;  3N6R A;  4NW2 A;  2WKD A;  1Y8N B;  5ELE A;  1XTC D;  1G2T A;  4BBR B;  3ND8 A;  2X6G A;  3BYY B;  2KEE A;  1DOL A;  3DHQ A;  5C0X G;  1PRT C;  1MBY A;  1SBB B;  1B53 A;  3MVV A;  5E1F A;  3D4D A;  3HEJ A;  4CJ0 B;  4XYQ A;  4QCL A;  1KLG D;  2I07 B;  3QWN A;  1SMY D;  5I2X A;  3HOW B;  2EE1 A;  4J8Q A;  1HA5 A;  3BDC A;  4K2L A;  1LTS D;  3MWY W;  1TS3 A;  4KY5 A;  3RD4 A;  2BCO A;  2N55 A;  1JCK B;  1F2L A;  3D4W A;  1XYI A;  4FXD A;  3GP7 A;  4DK0 A;  2BE5 C;  4XXE A;  5CV5 A;  3H91 A;  5C0X J;  2BDN A;  4FNF A;  4X3K A;  2L55 A;  2IT1 A;  4R9W A;  1WTQ A;  1X3P A;  1DD2 A;  2HDM A;  2K32 A;  4ABN A;  4AYB B;  4CJ1 B;  4QF4 A;  2RKS A;  2KHS A;  2XIW A;  2LKV A;  4IAL A;  1LV9 A;  3V2T A;  3VYU A;  3S1Q B;  5IGB A;  2XN9 C;  3NBH A;  4KY6 A;  4X3T A;  1W6J A;  1EY8 A;  2FFK B;  1ET9 A;  2CHB D;  2EYJ A;  4O42 A;  5EBD A;  1IW7 C;  4KD4 A;  5I6W A;  2SNS A;  3T56 B;  2PPB C;  2G9H D;  1TII D;  1EOT A;  2E75 C;  1PFB A;  1XXG A;  5FO7 B;  1ET6 A;  4DA2 A;  4DFA A;  2IX0 A;  1EL0 A;  1TWA B;  3NXW A;  1EU4 A;  2F0W A;  5C5L A;  3FDT A;  4OO1 H;  1RCV D;  2XWB B;  1JWS D;  2F0H A;  2DY7 A;  5JJZ A;  5JPM C;  5DM6 3;  4C2M B;  1LT6 D;  4FXK C;  5C4X B;  4WOR A;  2PW5 A;  4HCS A;  1SDF A;  2AUJ D;  4E6I A;  3IKJ A;  1G29 1;  1EQT A;  1E2W A;  4NDX A;  3JAM E;  1M8A A;  4XQN A;  4Y7N B;  5M5Y B;  1LTB D;  3NSW A;  4HSV A;  3SXH A;  5K36 G;  3LWU A;  3U9S A;  1EYA A;  1FNU A;  4G4K A;  3CQZ B;  2F1M A;  3MZ5 A;  3VYR A;  2IW3 A;  4ZLT F;  4B9W A;  3TP7 A;  3HOX B;  4A3B B;  5C44 B;  5T1G A;  1BUV T;  1WTV A;  3L7Z C;  5KYI A;  4X3S A;  3NTK A;  4UDU C;  5CMD A;  3DM1 A;  3GD7 A;  1NR4 A;  4XTC S;  1AZQ A;  2BDO A;  4KV6 A;  4KI0 A;  4G7Z C;  1F77 A;  4MHE A;  2KCC A;  4MN3 A;  3J80 L;  2F0Q A;  1TQO A;  3GTQ B;  1I4P A;  3OOC A;  2NN6 G;  2EYL A;  2E2H B;  2OEO A;  3M4O B;  4HMJ A;  3F2U A;  2A6H D;  1LT3 D;  1Y1V B;  3MXP A;  2NVQ B;  2LMC B;  1GUW A;  3WDN A;  4HED A;  5C3X A;  4CKC A;  3P1H A;  1YNN C;  2Z8L A;  4ILW A;  2PYK A;  2B2Y C;  5I9P A;  4L6T B;  4K5X A;  1MSH A;  3BZD B;  5K5P A;  2QDB A;  1LLR D;  2QCP X;  3RLF A;  2L11 A;  2WAC A;  1CQV A;  1HUN A;  1ESR A;  2HUG A;  3E0J A;  2R3Z A;  1EZ8 A;  5IGG A;  2CVR A;  2Z4H A;  4ZKC B;  5CGK A;  1IKM A;  1I4H A;  5CC4 A;  2IJ0 A;  3EQL C;  4RGM A;  2MGS A;  4CHT B;  4TRD A;  5KYL A;  4DAV A;  1PDQ A;  4NMZ A;  4IFD I;  3GTK B;  3V05 A;  2MP1 A;  2XWJ B;  3K5O A;  1G8Z D;  2I46 A;  3C46 A;  2K28 A;  1WVL A;  4ZAI A;  3FMC A;  1TS4 A;  4DNR B;  2IX3 A;  1WTR A;  3PO3 B;  5ELC A;  1SXT A;  1HHV A;  1Q90 A;  1D1I A;  2BE5 D;  3SHL A;  1YNN D;  3KLS A;  1U4P A;  2HCI A;  2EYM A;  4FXG C;  3CKI B;  1R4Q B;  1SNO A;  1CA5 A;  4XIG S;  1RKN A;  4QUC A;  4ME5 A;  1B4O A;  5NUC A;  1PLF A;  5IT9 L;  1Z6H A;  2E76 C;  4RHS A;  3TBI B;  3P75 A;  1FD7 D;  4CKE A;  5EKK A;  3QIA A;  1GUO A;  4EQO A;  1V43 A;  3I91 A;  4BWG B;  3A7A B;  4BBS B;  2B2V A;  3A8I E;  4IUQ A;  1B1Z A;  4EQN A;  1STB A;  1STE A;  2NWG A;  1BCP C;  1I4G A;  5M9O A;  4CJ2 C;  4FP5 D;  1V1P A;  2FMC A;  4U68 A;  3PO2 B;  1CM9 A;  4OL7 A;  1X32 A;  2F03 A;  2JA5 B;  5C6A A;  2AWN A;  3TP6 A;  1D5M C;  3KK7 A;  4JBW A;  3H6M A;  1F9S A;  2Q8R E;  1DYQ A;  3S16 B;  3QG1 A;  1SYC A;  4IUR A;  4IN3 A;  3S14 B;  3TZU A;  1DOM A;  1H9M A;  1SFO B;  1C8C A;  1I6H B;  3OHX C;  2V4D A;  5LL6 X;  4C3J G;  4L63 B;  3A54 A;  3HZX A;  4EQP A;  1JQY D;  1NAP A;  3VR2 A;  2EY2 A;  4XDX A;  3BG3 A;  3RZD B;  3IAY A;  1GJX A;  2CW0 D;  2IX1 A;  1O78 A;  1JWU D;  4HAE A;  3C1F A;  2Z1C A;  3T4A C;  4JK1 C;  1L0Y B;  5G3L D;  4KJN A;  2O5I C;  3EVQ A;  2J4X A;  1Q3L A;  5CYU A;  1O7Z A;  1IL8 A;  3I4N B;  5HGT A;  1KTK A;  1Y8O B;  3LNN A;  4OIK A;  2XRS D;  3I90 A;  2EYP A;  2B2W A;  1ZYR C;  4IZ8 A;  4PMC A;  1T5X D;  2XNA C;  5KEE A;  1KAA A;  4C3H B;  5BN3 A;  3PUV A;  4HMI A;  2PMZ B;  1VMP A;  1E2Z A;  3NHH A;  1UAP A;  3W2D A;  5KGU A;  1F9P A;  1E2V A;  2NN6 I;  2KUM A;  1QJO A;  1TS2 A;  2JEB I;  5IGE A;  1SNM A;  1K8O A;  1DJR D;  3S17 B;  3CRK C;  3NQT A;  4ZYS A;  3OW7 A;  3K57 A;  2B2U A;  1A3U A;  4KKT A;  4BY1 B;  1EIH A;  4RKB A;  1D5X C;  3SK6 A;  2EY5 A;  4K5V A;  5KNC A;  1W6K A;  5JEA J;  5M3F B;  2A5H A;  3MC0 B;  4IFD H;  2DNE A;  5AFW A;  3HG9 A;  1HXY D;  3VR6 A;  1II3 A;  2B2W C;  3A55 A;  4C56 C;  2L1B A;  1PTO F;  1AZP A;  3DWP A;  2OF1 A;  1TKW B;  4A3J B;  2BA1 A;  3VA7 A;  2F0J A;  1PTO C;  5C4H A;  1JOQ A;  2IPK D;  1FGB D;  1PZI D;  4PQX A;  3GTM B;  5CV8 A;  3VR5 A;  2E2D C;  4PV1 C;  2KJX A;  2JSO A;  3P20 A;  1SYB A;  3K58 A;  3IL8 A;  3MHB A;  1A2T A;  4FYD A;  1VMC A;  3NP8 A;  3CHB D;  1AP0 A;  4LK1 C;  1EYD A;  5EPJ A;  4KMU C;  5C0X I;  1AW7 A;  2F0K A;  1EEI D;  3TN2 A;  4WJW A;  2AUK A;  1CHP D;  1UEA B;  1ZKO A;  2PW7 A;  1OO9 B;  2RDG A;  1QE6 A;  3TZD A;  2B2U C;  3EA6 A;  1J9O A;  1D5Z C;  2RBM A;  4CGY B;  1H9K A;  4RA8 A;  2H4O A;  1S5C D;  5I4D A;  1TWG B;  1D6E C;  3SK8 A;  3MXN A;  1A2U A;  3C3L A;  2K6A A;  5FLX L;  4A3G B;  2NYZ D;  5KRU A;  1B2T A;  3L3O C;  2A68 D;  2CQA A;  2F0V A;  1Q1E A;  3K7A B;  1LAB A;  1LTI D;  3OPO A;  3FEW X;  3S2H B;  3FPU B;  1IYV A;  2A6E C;  2F0I A;  5JPN C;  3HKZ B;  4LJZ C;  3Q0A A;  2IL8 A;  4F88 A;  1BQQ T;  2HQE A;  2L0C A;  1JE4 A;  3BDL A;  4V19 0;  3A8J E;  1K8M A;  3MA2 B;  4WFN 3;  5E4W C;  2Z4I A;  5FKA C;  1JOK A;  4DN4 M;  1EY5 A;  4HCE A;  2R92 B;  3HGB A;  3NQI A;  3R3O A;  2E2J B;  4IQZ A;  1KDC A;  3QOJ A;  1BOS A;  3S2D B;  2F0D A;  1EQV A;  4ZQ3 A;  1G2S A;  2A69 D;  1HQR D;  2K1B A;  3DWA A;  2IWH A;  1TY0 A;  1ENA A;  3DEO A;  2L9H A;  4TKO B;  4LAA A;  1LTG D;  1PXU A;  1GHJ A;  5KND A;  5CV6 A;  1BF4 A;  1Y1W B;  1NCV A;  1QWY A;  4KD3 A;  3V96 A;  5FO9 B;  3HOV B;  1ESF A;  2AQ2 B;  3L9A X;  1PRT F;  4ZK9 B;  5JEA G;  4KHV A;  1FYC A;  2A69 C;  5KIX A;  3A7L A;  1ROD A;  1JWM D;  1I4R A;  2M00 A;  1SSO A;  4RCN A;  2L4N A;  4K5W A;  3R2I A;  4QIW B;  2VUM B;  4RGN A;  3SR1 A;  3ERO A;  3PUZ A;  1ICW A;  5J1Z A;  3T16 A;  1QG7 A;  2EY6 A;  1GXD C;  1I50 B;  1DOK A;  2YYZ A;  2QF7 A;  3M3Y B;  2NVX B;  3ONA B;  5IGC A;  2AQ3 B;  1CZW A;  3A56 A;  1J8I A;  1TWC B;  4C1N K;  2NB0 A;  1S5B D;  3G7L A;  4C3I B;  4I65 A;  1STH A;  4KKS A;  4EVO A;  4A3D B;  3Q6S A;  3Q24 A;  3VA5 A;  1L0X B;  2PNR C;  2K7V A;  4ULL A;  2SOB A;  2EJF C;  1TT2 A;  3TME A;  5A2Q E;  1RD9 D;  1VCI A;  3HOZ B;  5LHY 1;  1RTO A;  4DF7 A;  1NR2 A;  5FO8 B;  1XWE A;  1B44 D;  1UUP A;  4ZKB B;  2WII B;  3H09 A;  1FR3 A;  4IFD J;  5KNB A;  3CRL C;  1ZEQ X;  2SNM A;  4IUP A;  2KED A;  5EPL A;  4V0B A;  3NPP A;  1OXU A;  1SNP A;  4MIU A;  1PZK D;  4R8I A;  2Y0S B;  3WOF A;  1WTX A;  2PZT A;  3KF8 A;  2D2C C;  3UI2 A;  3OMG A;  3E6Z X;  1H9R A;  3BVZ A;  3DMU A;  4DXF A;  4FF2 A;  1JB3 A;  1GUS A;  5JVG 3;  5A35 A;  1IKL A;  2RDF A;  4CKB A;  1KDA A;  1A15 A;  1LT4 D;  1HRJ A;  2CW0 C;  2EYO A;  2JA6 B;  2NZ1 D;  2KOL A;  1T5E A;  1CZG A;  5C3W A;  1HFN A;  1PFN A;  4ZUI A;  1AN8 A;  4PMB A;  1STN A;  5IOC A;  3R8B A;  4G7O C;  1QCB D;  1EZ6 A;  1ZYR D;  1I4Q A;  4C1N I;  3RZO B;  1SYF A;  3QO2 A;  2JXM B;  1Z47 A;  2EPB A;  5EQ0 A;  2WV6 D;  1TR5 A;  1AFP A;  1C4Q A;  5T1I A;  3WOE A;  1IW7 D;  1MGS A;  1TS5 A;  3DUZ A;  2ZXP A;  1B9N A;  2TMP A;  2R7Z B;  4C3I G;  3C2P A;  5CBA E;  5C5M A;  1LTA D;  4O1N A;  4DXG A;  4TQU S;  3OIP A;  3GV3 A;  2O5J C;  4A93 B;  1C48 A;  5E3F A;  2A6E D;  1WTP A;  2PZU A;  1MI2 A;  1TY2 A;  3G6J B;  2G9D A;  2JE6 I;  1QOH A;  1PRT D;  3HRZ C;  4QMG A;  2EJG C;  2K03 A;  2F0E A;  2F0O A;  3H0G B;  1OXX K;  4QB4 A;  2M9V A;  2C5C A;  1BR9 A;  1EY9 A;  3HOY B;  1CI3 M;  1LT5 D;  4HTH A;  5D3I B;  2VXW A;  1F2Y A;  2OT2 A;  1SND A;  3FRP B;  3GTL B;  1KDB A;  4F87 A;  1XX8 A;  4A3K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...