5COYA

Crystal structure of cc chemokine 5 (ccl5)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords C-C motif chemokine 5
publication title Structural basis for oligomerization and glycosaminoglycan binding of CCL5 and CCL3.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5coyA00
2KEDA 2N55A 2SDFA 1RJTA 2HCIA 5CMDA 1ESRA 1ILPA 1HRJA 4X3KA 2KVMA 2VXWA 1HFGA 1IL8A 2B2VA 4O42A 4CJ0B 1RTOA 1EL0A 1DOMA 3MTSA 4XDXA 2NWGA 2K1BA 4RAUC 4CJ2C 1S4ZA 2D9UA 2IL8A 5CBAE 3UI2A 2EOTA 1B2TA 2B2VC 2J7ZA 3IL8A 2FINB 3DEPA 3H91A 4UAIA 5CBEE 4IUQA 1E0BA 3N52A 1WTXA 2R3ZA 3Q6SA 1SDFA 1AZQA 5CORA 5EPKA 1RODA 1B4OA 2BDNA 2CVRA 4QUCA 2X6GA 1WVLA 2RSNA 1HUNA 4XT1B 2B2TA 1ZXTA 1BF4A 3TZDA 1PDQA 2K28A 1HHVA 1O7ZA 1M8AA 2RVLA 1SAPA 1RTNA 1MI2A 1VMPA 2FFKB 1HUMA 1X3QA 1F9PA 2HDLA 1U4PA 2JYOA 2MJ8A 2NYZD 4MHEA 2B2TC 2XIWA 1WTOA 1WD0A 1B53A 5T1IA 1O80A 3MWYW 1ICWA 1NAPA 5D65A 2DY7A 1EIGA 2B2YA 3HP3A 5DNFA 4QUFA 3SVMA 4MN3A 1WTWA 1IKMA 1F9QA 2K04A 1G91A 4HCSA 1AP0A 1MSHA 2KOLA 2B2YC 2L1BA 1U4LA 3G7LA 2L4NA 4U68A 1HFNA 3ONAB 1AZPA 1GUWA 3I3CA 1DZ1A 1G2TA 1Q3LA 4IURA 3GV3A 4IUTA 2KEEA 1WTRA 2HCCA 2L9HA 1C8CA 1QNKA 3LWEA 2HDMA 1X3PA 4X3UA 2Q8TA 1F9RA 4X3TA 1G6ZA 1JICA 1A15A 4IUVA 1G2SA 1CA5A 3P7JA 1CM9A 1PFMA 1LV9A 2M2LA 4IUPA 4HAEA 3F2UA 4HSVA 1TVXA 4NW2A 5D14A 1EOTA 2KECA 2X69A 3QO2A 4HEDA 5COYA 5T1GA 5JJZA 1HA6A 2Q8RE 1F2LA 2KUMA 1JE4A 1BNZA 1IKLA 1U4MA 2B2UA 5AFWA 1NCVA 4ZKBB 1CA6A 1ML0D 2K01A 2RSOA 2MP1A 4CJ1B 4R9WA 1B50A 1WTQA 2N88A 2B2UC 1PFBA 2JP1A 1MGSA 2X6LA 4XT3B 5E4WC 1EQTA 1DONA 3TN2A 4ZK9B 1SSOA 3I8ZA 1NR2A 4ZAIA 1VMCA 1WTPA 1WTVA 1EIHA 4ZKCB 5EPJA 1MSGA 1O7YA 1XX8A 2B2WA 4R8IA 1DOKA 2RA4A 3DM1A 4RWSC 1QE6A 3KUPA 2NZ1D 3GV6A 2L11A 2L12A 1ILQA 3I90A 2EE1A 1U4RA 2EPBA 2B2WC 2K05A 2FHTA 4X3SA 1J8IA 4DN4M 2H1EA 2FMMA 2HUGA 3R93A 3I91A 1KNEA 3FPUB 1BBXC 1X32A 5EQ0A 4LMQD 4ZLTF 1F9SA 1NR4A 2MPMA 1PFNA 3DEOA 3KBXA 1XYIA 4IUUA 1WD1A 1DOLA 1B3AA 2MGSA 4OIJA 5E4XA 1BO0A 3D6WA 5EKIA 2DY8A 5EJWA 1J9OA 1PLFA 2K03A 2FJ2A 5EPLA 1RHPA 1QG7A 4RA8A 1KNAA 3IFDA 4OIKA 3FDTA
chains in the Genus database with same CATH superfamily
1Q81C 2R61A 2WB1E 3J81c 1HRJA 2Z4IA 3AFQA 3GTKH 5FO7B 4C2MH 2DGYA 3W5OA 5M3MG 1ONLA 3U58A 4XDXA 3RZDH 3OHXC 5FLMH 2NN6H 1CKOA 4AYBG 3K5LA 1WTHA 4PZ7A 3U50C 5CV8A 2YTXA 3PIP3 4PMWA 1AZQA 1LACA 1STNA 1RODA 1W6JA 1YNXA 4DAPA 1GHJA 1H9KA 3OIPA 1EU3A 4K8JA 4R4IA 1Z6HA 1HXYD 1EQRA 1MI2A 4DKAC 1PH4A 3ULJA 2NVQH 1KAWA 5IP9H 1NAPA 1C7YA 1EIGA 1B7YB 1QCBD 1JJ2A 2B2YA 4LF7Q 4JVZA 4HCEA 1TWGB 3BVMA 2JA5B 2ENBA 1U4LA 3KLSX 1Q8KA 5FLXc 3I3CA 5C44B 1X9NA 3BU2A 4A76A 1EIYB 2E2IB 3OYYA 1HNWL 3CKIB 4DV2L 5IT9E 4H0LC 1N8RC 3S16H 4C1NK 2HDMA 1WCMG 4X3TA 5C5LA 3CRKC 2VNUD 1Q46A 3KK7A 1LT6D 1Q8IA 1YITA 2C35B 5C4JB 2KECA 1PA6A 1B3QA 3SR1A 2Q8RE 2A6ED 5FK9C 1KRTA 2VUMG 1BNZA 1X3EA 1PH5A 3KF8B 4IQZA 1BBUA 1QNUA 4KKSA 4NXMQ 1WTQA 1GUTA 1PFBA 2BDOA 2YU9B 2JP1A 2X6LA 4KY7A 1MD2D 1GUNA 3RN2A 3CCLA 4PMBA 3PQIA 4GKJL 2EJFC 2XSCA 2CW0D 4IJLA 4KHVA 5CV7A 1PRTB 4K6LA 4P2CB 4JI0L 3TS0A 1SYDA 1KQSA 4OX9L 2H1EA 2Z9HA 4XQJA 5M5YB 4QQBX 3KBXA 3DUZA 2NVTH 1EY8A 1XMQQ 2E2HB 1CHQD 4G7OC 1ESFA 2CKZB 3RR5A 1SMYC 5EPLA 5JPMC 2FJ2A 5LL6X 3K58A 3SXHA 5I9PA 3GTMH 5J22A 3F2BA 1CZGA 3I73A 4A4IA 5CV9A 3I72A 5CMDA 3QOJA 3LNNA 2Q2UA 2OTLA 2H5XA 1SYBA 4PZ8A 4YCVA 3S17B 1K73C 1VQHA 2K1BA 1S4ZA 4BXXG 4CBVA 2J7ZA 1Q90A 3K8AA 3BJUA 1RCVD 2QW7A 1ZYRC 1SNMA 4IPDA 1VQAA 1I6HB 5C3EB 3TQYA 1B70B 3E0JA 3DXJC 5HURA 1RL2A 1PTOD 4R4OA 2XWJB 2JA8B 1SNPA 4DXGA 3K6OA 5L37A 4MHEA 2B2TC 3I2ZA 5HGTA 2JA5H 4IPHA 4DR3L 4BBSB 3CCMA 4MN3A 1T5XD 5C44H 2K33A 4ID6A 4X65L 3P75A 1HR0L 2MO1A 3K5OA 4JI4Q 2IX0A 2ICEC 3T1YQ 2F0IA 4X64Q 1N36L 2JA9A 3HFZB 3NP8A 1BKBA 4AH6A 2WKCA 3CRLC 4DV0Q 1CHPD 3PO3H 4ODGA 1BBWA 4DV7L 2EXZA 5M5WH 4Y52H 1LT5D 3MXNA 1HCZA 3NELA 1AE2A 1NMGA 2EYLA 2RBMA 2KHJA 5CV5A 2YU9H 2K5VA 3MAQA 5IYDH 5LMUQ 4CJ1B 5J39A 3PGZA 1Z47A 4A3JB 3HOYG 4A3FB 2F4VL 1WI5A 2LY7A 3EBEA 4JBMA 4HIDA 2D0PA 2LFNA 4JK1C 4A3DG 1WTPA 4QGUA 2VY3A 4DR5Q 2UXBQ 4B3SQ 4UP7A 1ILQA 3I90A 2EE1A 2EPBA 3NBIA 1TS4A 1L0XB 3VYSA 1X32A 2UUAL 3H0GB 3DEOA 1TIID 1H9MA 5IGEA 5GAHC 5G3LD 1G51A 4H7BA 1WD1A 3G48A 1BO0A 1VQ4A 2I07B 3K0YA 4LFCL 3M9BA 3RD4A 2K5NA 3MEHA 3U9OA 3I4NG 3M4YA 2IPKD 5A2QE 2PMZB 4MTKA 4QF4A 1W3SA 3S14H 2N55A 4FF3A 2HCIA 3KJOA 4LF6L 1ESRA 1P16A 3F2CA 1VQ7A 1NNXA 3MTSA 2PMZE 4IOCA 2NWGA 1JR0D 1PRTC 1PYWD 1IYJB 1SNOA 1VS0A 4NMZA 5CGKA 1WTXA 1NSNS 2N8NA 5CORA 1B4OA 1OXSC 5GQOA 1YNJC 1GD7A 4DXFA 4KN4C 2A1AA 5TSSA 2R93H 2DNEA 5C0XH 2UXCQ 1HA5A 3GTJH 1DZ1A 4RHSA 1PXUA 1EY4A 1B53A 4G7ZC 5D65A 2UXDQ 4TRDA 3M3YB 1IYUA 5DNFA 3HOWG 2ZJRA 3HOVH 5BN4A 2JA6B 4DUYQ 4HJ7A 4HCSA 4G57A 1CFMA 4YHHQ 4K0KL 3I70A 4DV5L 1VQOA 3R2TA 4A3CH 1IW7D 3X3MA 4F87A 4BA1I 2NZOA 1VQPA 3LWEA 4J8QA 3HOXB 2CQOA 2BOSA 2GN5A 1SRUA 5D14A 4A93H 3CF5A 3H3VI 3OPOA 5J3BA 3WDNA 4OEMB 1IBMQ 1Y1VG 1HA6A 3VA5A 2B3GA 3HOUH 1MBYA 1YNNC 1NJIC 4A3KG 4B9XA 3A5ZB 4H44C 3I55A 3TS2A 4RKBA 2K5WA 2N88A 3TSSA 1YHAA 2ASBA 1B1ZA 1EQTA 4NPSA 4HMJA 1GHKA 1JT8A 5C0XJ 4ZK9B 1VQMA 1VMCA 3H3VC 5M5XB 3PUZA 4OWTB 4ZKCB 2RDHA 3FHWA 4RWSC 1QZGA 5K5PA 1V8QA 4F8MA 4POGA 1II3A 2D5DA 4LFBL 4X3SA 4A3GG 4A3LH 2FMMA 1F9SA 4CDFC 3U9SA 4A3MH 4LF4L 1WJJA 4TQUS 3MC0B 1BQQT 5LHY1 5EJWA 3FVQA 2HHHL 1J9OA 5C4HA 1VQ8A 3S1MB 2R92B 3GTQB 2E5LL 2OT2A 2CH4A 2KHIA 3NHHA 4XYOA 5FLMG 2NN6G 3GTLB 1PTOH 4DK6C 1ASZA 1LO5D 1PH2A 5KIXA 4ALPA 1N34Q 1HQMC 1PTOF 2EYPA 3CCUA 4IPCA 3S9WA 3CCVA 3AQQA 2VB3X 2AWNA 3J80L 3QG1A 4JI8Q 1HNZQ 2B2VC 4L63B 1TXYA 4YWMA 5M3FB 3ITPA 1JWSD 4LFAQ 2JEAI 3B6YA 5IYCH 5IP9G 2HIVA 3NPPA 3KDFA 1HNXQ 3TRZA 2ZTEA 1F2ZA 1SAPA 4IURA 1XNRL 1QVCA 2XIWA 2GA4B 2IT1A 4QMGA 3MWYW 2A6HD 1UE6A 2UUCQ 3P20A 2QEXA 4UPAA 2Q2HA 1E2ZA 3J81L 3S24A 5IODA 1CUKA 1FYCA 2MO0A 4X66Q 4RGTA 1WTRA 4GZYC 3S1NH 4A3IB 4DR7L 3FMCA 4JI2Q 2XVSA 3ULLA 1GOZA 4DPGA 1D5MC 5JJZA 2KUMA 5IYBH 3NBHA 3NWTA 4BY1G 1CA6A 4GN4B 1PH7A 2K01A 1SNCA 1C0AA 2NUCA 2Z6KA 5EKKA 1H9SB 1I4RA 4A3BB 3F1ZA 3DHQA 1VQKA 3TP8A 4B3TL 4XT3B 1CKMA 1MGSA 3VDYA 5CYUA 2PZWA 3M4QA 5G3LF 4CKBA 4C3HB 1FJGQ 2OXPA 4V0BA 3RZOH 1DD2A 1XPOA 4HN7A 4DAYA 1EIHA 1VQ5A 4DR1L 2KCNA 1CSPA 5FLXL 3DM1A 4J15A 2F0NA 3T13A 1OXTA 5LMNQ 3J7AF 1LABA 1TR5A 4DV4L 1SXTA 4LMQD 1NR4A 1GUSA 1PFNA 4J1MA 5BN3A 4LK1C 2A68D 4NXNQ 3D6WA 1VQFA 1H95A 2ZM6L 1RHPA 3G4SA 2F0HA 3JC66 3NWSA 1V1OA 1KNAA 3K0XA 2DJGC 3TBIB 1SMXA 2C9OA 1LLRD 2QKIC 4YWKA 3TZUA 4DAVA 4FF4A 1RJTA 4PNYA 2WV6D 2F0QA 2F0PA 1L1OB 4ZUJA 2D62A 4LF8Q 2MFIA 3HOZH 3RMHA 1EYGA 4LF9Q 2O2LD 1HZCA 5E7NA 3ND8A 2E74C 2EYMA 5I6WA 4GNXA 4LJZC 4B3RQ 5IWAL 2VL6A 2R3ZA 3DWAA 4JC0A 1PFSA 4KKUA 1P8LA 2BDNA 2JA5G 4JI5Q 1ZYRD 2YTVA 5C44G 1LTRD 2JYOA 3NTIA 4J6HA 4JW0A 1CZWA 4L5TA 3W2DA 1U9RA 1M90C 3RLOA 2FXQA 2F0DA 2DY7A 1XMOL 1K3RA 5I9OA 5CV4A 1AP0A 4K2LA 4BY7B 3PO3G 1TY2A 1RD9D 1N33Q 3CC2A 2UUBQ 3GTPB 1A62A 1PVOA 4EGVA 2L9HA 2K5HA 5IYDG 5C4XB 2VQEL 1D7QA 1LV9A 5LL6S 4YWLA 5T1GA 3E5SA 4PG3A 1F2LA 2IJ0A 4GKKQ 4DUZL 1V43A 4IALA 4C3HH 3EVQA 2EDGA 1GO3E 1QWYA 4JI3L 2UU9Q 5IIFA 2CH4W 1DYQA 2CFMA 2M9VA 1EFWA 2WFWA 3E6ZX 1MHWC 3PMFA 4DR4L 2NZ1D 3J80i 3J81j 2B2WC 4JOIC 3GTGH 3EA6A 1EIFA 1DXMA 1XYIA 1PV4A 4NDXA 3S1QB 1Y8NB 4GN5A 5E4XA 3FKIB 3JAMi 3I4MB 2K50A 5EBDA 1A3UA 2K03A 1CKNB 5IGDA 5BR8Q 4IFDH 1Y1WH 4I7ZC 3J80c 2KEDA 2BH8A 2SDFA 3SEBA 1X54A 2XN9C 4M1UB 4WJ3M 3BYYB 1EYAA 2VXWA 2IY5B 3A8KE 1PZJD 1DOMA 2QILA 3BS1A 3KOJA 1E7ZA 4C3IH 4IZ8A 3JAMc 2F0TA 2R93G 5D3DA 5C0XG 1LT3D 4FXKC 1Y8OB 1D8LA 3PIO3 1E0BA 3HS0C 1PRTD 4ZCKA 2CVRA 2F0SA 4JI7Q 3VR5A 3IKJA 2BE5C 1L0WA 1ZEQX 4HJ8A 3HOVG 2YYZA 1VMPA 1L0YB 5I2YA 1WTOA 4X62Q 3KYHC 4DV3Q 2TMPA 1XXGA 2A69D 3VYUA 2Y0SB 4QUFA 4AQYL 3OMCA 1L1OC 2J0TD 2JA7B 4X6AH 1SEBD 1HFNA 4LUOA 4IFDJ 1I4QA 4A93G 3DLLA 3KLRA 1B9MA 1V9PA 4CDCC 1T5EA 2Y0SE 4EQ5A 4H13C 3HOUG 1LTTD 1JORA 3Q8DA 3HKZB 1E22A 2ZTDA 4R8NA 1CM9A 1PFMA 1Z7TA 3I4OA 1KD1C 2KHSA 1KAAA 2RF4A 1V1QA 1UNSA 1PMRA 4DR6L 1DM0B 4OGQC 1K83B 4O0AA 4P74A 2B2UA 1EU4A 3HKZE 4FF1A 3VYRA 1TQOA 5I2XA 1R9TB 4JYAQ 3DM3A 4KK7A 4FF2A 1Q82C 1YNND 1DGSA 3SK5A 1YJNA 4A3LG 3ERSX 2F0VA 2B63B 4A3MG 5CV6A 1I6VC 1S40A 4DR2Q 2Z0SA 3PV0A 2NN6I 2K52A 3P1HA 4A3EB 3TMEA 4WORA 3KJPA 4CDEC 3FPUB 2MPMA 1HH2P 4HSPA 2F0OA 4N9TA 2NVYB 4RCOA 1K3BC 2VZAA 4C3JB 3NQTA 4B3ML 1E2VA 4GOPC 3W1GA 5KYIA 2E2JH 2D2CC 1I94Q 1MKHA 1LTID 2F4IA 5IP7H 1YIJA 3EQLC 2PZUA 1PYBA 3NSWA 2ZJPA 1XJVA 1CQFA 1A2TA 2F0LA 1SROA 5IYCG 5ELDA 1JQYD 1EY5A 3S15B 1SJHD 1IZ6A 1TWFB 4JCVE 4EQOA 3PUYA 2VQFQ 1XNQL 2KBNA 1D5XC 4DAMA 3E0EA 5IGBA 3ND9A 1HNWQ 5IOCA 4DV2Q 1TS3A 4L5RC 3TP6A 4DV6L 1SN8A 5DEHA 3ZJYC 1EQQA 4RGMA 4KD3A 2AKWB 4MNOA 5T1IA 2R7ZB 4OELB 4DU9A 1FVIA 4C56C 1G91A 2WAQG 3M4PA 2F1MA 4YCUA 3R8BA 3MZ5A 4LF5L 1AEXA 2Q8IB 1X56A 4HIOA 3PO2B 3T1YL 2G9HD 3E9HA 5IY0A 3RUZA 3L0OA 4ILWA 5IYBG 4GKJQ 1HTLD 2N78A 2ES2A 1A15A 3HRZC 4JI0Q 1HQRD 3CQZB 4PZ6A 4DK3C 4DK1A 1TWGH 4CKEA 4OX9Q 1ET6A 3HZXA 3L9AX 2NVXB 4RHRA 4QB4A 1QB5D 2YV5A 4ZQ3A 2RSOA 2XTIA 2E2IH 1TS5A 5GROA 4G4KA 1NUCA 2QDBA 4IJHA 2F03A 2DJFC 2OCEA 1JB3A 3UDGA 1SE2A 4A3EH 4KTAA 4JV5L 5C4JH 2UXBL 4FO2A 1QUQA 2Z4HA 4XQNA 1XPUA 4ZLTF 1STYA 2YTYA 2EQSA 4UP9A 1EWCA 2LXKA 2RHSB 1X6OA 1B3AA 3MFGA 2ZTCA 1VQ9A 5DLQE 3STBD 2Z1CA 1QG7A 3HOZG 1ET9A 1UEAB 4P72A 3FDTA 1Y8PB 5M3MB 1PRTF 1JWUD 1JOKA 1Q12A 3CC7A 1XWEA 2EY1A 5M5YH 4DR3Q 2EVBA 1JJGA 1J5EL 4AYBB 2E2HH 5CR3A 5K36H 1STBA 3CPFA 1SYFA 4X65Q 4JBWA 2RCFA 1HR0Q 1Z9FA 1SYEA 4AYBE 1GXDC 3BZCA 1N36Q 2CCZA 2A73B 1X65A 4K14A 4DV7Q 3S17H 3MXNB 4Y7NB 1WD0A 4CGYB 1XTDA 1SYCA 2NBFA 3SVMA 2IWHA 1I6HH 1F9QA 1I4PA 1V1PA 5C3EH 1GM5A 1AW7A 1MSHA 4XTCS 2B2YC 2AUJD 1A8VA 3NK9A 4HR7B 3K80C 1KIXA 1A2UA 1WCMB 2F4VQ 2JA8H 3A8IE 4CHTB 4IUNA 3MFYA 2FMCA 4JI1L 1VQBA 5C5MA 2Q8TA 4DNTB 1Q1BA 1CA5A 2VUMB 4BBSH 4C3HG 2IHEA 2LMCB 5A35A 2A74C 2NVXH 2K5QA 1D5ZC 1J6QA 1IBML 2UUAQ 2KENA 2F52A 3H3VH 4S3SA 1NCVA 2SOBA 2RHQB 3QJYA 4KY6A 5JAVA 2PPBC 4E6IA 1F77A 1S5DD 5ELEA 1B44D 1B8AA 1I4GA 3FPPA 3J80E 1WYDA 4ZUIA 4LFCQ 3TDQA 4RH6A 2OEOA 2EIFA 4XXEA 3C2PA 3W3AA 1KLUD 3H94A 5IGGA 1O78A 1E3PA 3U4VA 1WOCA 4EX5A 2JEBI 4DN4M 3HKSA 1PH3A 4IFDG 1YBYA 1M1KC 4A3JH 2EYHA 1C4QA 4A3FH 2MUYA 3K7AB 1Y1WG 4KHPL 5JVH3 2M00A 4WJ4A 1I3QB 1YHBA 5C0XI 4UY8C 3URYA 3J81E 4C3IG 5C3WA 4B9WA 4DA2A 1FNVA 2J4XA 1RF2D 2ZXRA 1ILPA 3H0GH 4CKCA 3C1EA 4OO1H 3K5NA 4OONA 1A63A 5AJ3L 1EEFD 3IAYA 3PIOA 1GUOA 3BZDB 4K0KQ 4XIGS 4DV5Q 3E9IA 2H4OA 1SDFA 5ELBA 1JCKB 2F0GA 2LKVA 3RLNA 1Q1EA 2AQ3B 2A6EC 2TSSA 3VA7A 2FFKB 1F9PA 2SEBD 4DV1Q 2IX3A 3OTOQ 3L2PA 1IBKQ 1PHJA 4U673 2ZT9C 2EJMA 4BWGB 5FLXE 4UP8A 1OXUA 2EY6A 1E1TA 3AEVA 1N32L 2KCTA 2CW0C 3OOCA 1Q3LA 3JAML 1CK1A 2G5DA 2B29A 5EKLA 1U5KA 3QIAA 4X3UA 1G6ZA 1F9RA 1G2SA 3KBGA 4LNQA 3M3YH 4TSSA 4LFBQ 2JA6H 3M4OB 4KHZA 2CWPA 4M8AA 2ICIA 3HOYB 5F2DA 1OXXK 4LF4Q 3WWVA 1JB7A 1VQNA 4A3DB 1H9SA 3BYTB 5I4DA 2HHHQ 4DFAA 4F7XA 3HOXH 5KGUA 1K8GA 2E5LQ 1FJGL 4ZAIA 1F2YA 4LUZA 3ERQA 4JG2A 2VB2X 1STAA 1O7YA 1H9RA 3SK4A 1SFOB 1PH1A 1EYDA 3T1HQ 2ZXPA 4IPGA 3TP5A 2ALYB 2K05A 3PUXA 1KDCA 1R4PB 1S5BD 5FJ8H 1SNQA 5C3XA 4GLAC 3I4NB 4KV6A 3T51B 5IP7G 1DOLA 4UHVA 2O5JC 1S5FD 5M5XH 2WP8J 3NENA 3S2HB 4LW1A 1FNWA 5FO8B 3CC4A 1PZKD 2PZTA 1KC8C 3T56B 2WB1G 1JMCA 1XNRQ 3CW2C 5JOBA 1GUGA 4O42A 1L2FA 1VDZA 4CJ2C 2D9UA 1BUVT 2B39A 3VYTA 2R92H 3S1MH 1LTSD 3PUWA 3GTQH 2OQKA 2EJGC 1QJOA 4FDBA 3Q22A 2R7FA 1KLGD 2ID0A 5EPKA 3GTLH 1XTCD 2R6GA 3GD7A 1Y69U 2RSNA 4DR7Q 3C46A 1ZXTA 1A0IA 1VCIA 1EY6A 1SMYD 5LMNW 3OIQA 1ICFB 4RKLA 1FNUA 2K4KA 2I46A 3VR3A 1RIPA 5M3FH 1NY4A 2K7VA 4MIUA 4IN3A 1GVPA 3SDZA 3LGJA 2MQHA 2L1BA 1ENAA 3G7LA 4B3TQ 4HJ5A 4JI6L 4RMFA 4KMUC 4MZ9A 1CSQA 3Q23A 4DAYB 3UE0A 3E3XA 4DR1Q 1Y1VB 1JICA 3D31A 1BCPB 3OW7A 4RG1A 4A3KB 4GLVB 4ULLA 4QIWB 1PYSB 4DV4Q 1VQJA 3QOLA 2R7DA 1I5FA 5JJIA 4WJWA 2PI2A 2QCPX 3K81C 2JQOA 3S2DB 4QIWE 1ZKOA 5E4WC 4A3IH 1PH8A 1NTGA 1WTVA 4A3GB 3KF6B 4BS9A 4IOAA 3TREA 3AB9A 3IRBA 4GN3B 4OWXB 1GJXA 3GP7A 3PUVA 2CQAA 1BBXC 2F0MA 4A3BH 3GTKB 3J7AV 4LWCA 4C2MB 3S2HH 2IW3A 3RZDB 5IWAQ 4GOPB 1EWHA 2AUKA 4BA2I 3O13A 1D2BA 1CKNA 2OTJA 3VR2A 5K36G 1IBLL 1VQEA 3OWEB 1HTPA 1Y14B 1IHZA 1VQDA 2ZXOA 1XMOQ 1JJCB 1SYGA 2F3VA 3CCRA 1OTCA 2ZJQA 3GTOB 1E24A 2NVQB 5EGTA 3UI2A 2L55A 4BBRB 2LS01 4QY7A 5M9OA 4G7HC 2HQLA 1G291 4YY3L 4IUQA 2EY5A 1M4VA 3Q6SA 1K0SA 1SLJA 1B9NA 3I56A 1EFID 1SE8A 2B2TA 1EEID 2PO4A 5IGFA 5C3EG 2I0QA 1M8AA 2VQEQ 1X3QA 2NYZD 1UAPA 3S16B 1FD7D 2JA8G 3QB3A 1YEZA 2DN8A 2PQAB 1WTWA 5E3FA 4DUZQ 3FEWX 4O2DA 2EZVA 4R1JA 4IO9A 4JI3Q 2KJXA 3W1BA 4FYDA 4BBSG 3ONAB 2L5TA 3FP9A 1I50B 1WFQA 3GV3A 2HCCA 1HJPA 1QNKA 4DR4Q 4APVA 3D4DA 1EYCA 1C48A 4PMCA 3P7JA 4BY1B 5IE8A 1TVXA 1YNJD 4L6TB 1NMFA 3QO2A 1EY9A 4BY7H 1EY7A 3D8GA 1JE4A 4LF7L 4A3CG 2Q2TA 3CD6A 3TEHB 3H6MA 4H02A 3GTPH 5I6YA 3K59A 2NVTB 1LM0A 4K5VA 2E75C 1RKNA 2BA1A 1PH6A 2Z6KC 3GO5A 2BCOA 3SK8A 3K5MA 5C4XH 4HJ9A 1VQCA 4A3JG 2K14A 4A3FG 3DWQA 1VQ6A 2WIIB 3CCQA 3GTMB 3ICEA 4DR2L 1IL2A 2QF7A 3R93A 1BCPC 1G8ZD 3I91A 5EQ0A 3UDIA 2PNHA 1KXLA 5GAEC 3KF8A 1TY0A 4HIMA 2DNCA 3NTHA 3CMEA 1ASYA 4NXML 2DY8A 4L5QA 4R4CA 3H0GG 3NE5B 1X3FA 4N8X1 4OO1G 2XRSD 5H1SE 2A6HC 1I94L 4GLXA 2Q2IA 2NZHA 2I5HA 3G71A 3GTOH 4BBRH 1W2BA 3A55A 4RFBA 1ENFA 2XNAC 3LX0A 1DJRD 1RTOA 4AQYQ 3S1QH 3N6RA 2F0JA 1UE1A 3FKIH 2IL8A 3I4MH 2VQFL 3NTKA 1XMQL 1VQIA 3R2IA 1TWAB 4GNXC 1S5CD 4CDDC 1I4HA 4DF7A 4ZYSA 4QJFA 1O7ZA 3MHBA 4JBJA 2A19A 4MTNA 3H15A 4FXDA 4FP5D 1EZ6A 1JC7A 3T16A 4DR6Q 1O80A 3PO3B 3A54A 4Q0FA 1IKMA 3F2DA 5M5WB 1I50H 1LUZA 1NE3A 2RQXA 3DWPA 4AIMA 3F8TA 2JA6G 1G2TA 1RDPD 2I5MX 4BY1H 3A0JA 2K6AA 1LTLA 1C8CA 3WOFA 5ELOA 4K6DA 2NTSA 1SJED 3A56A 4KLKA 2M2LA 4HAEA 1X3GA 3HOXG 2A68C 2JA7H 1EWIA 2Z6BA 1VF7A 3A7AB 3J7ZC 1CT1D 4TKOB 3TP7A 2GVBA 4JI4L 4B3MQ 5GAGC 1YZ6A 1JOOA 4X64L 5FJ8G 3G6JB 1HPCA 2KQ3A 4I7AA 4R8IA 4DV0L 1K83H 2JN4A 5IGCA 2L12A 3FRPB 1CI3M 3CCSA 3S14B 2FHTA 1R9TH 3MXUA 1XNQQ 2CHBD 3KLSA 5IT9L 4IUUA 4L5SA 5LMUL 1TT2A 5KRUA 4DNIA 4RCNA 1PLFA 2B63H 4DV6Q 3IFDA 1N9WA 1YI2A 1JWMD 3T4AC 4K8IA 1E2WA 2R92G 1S3OA 3MXGA 4DR5L 4X3KA 4LAAA 2R93B 4B3SL 2B2VA 3GTJB 1EL0A 1LYLA 2NVYH 4PQXA 1TWAH 1SE4A 2D0OA 2FINB 4C3JH 4C1NI 4LF5Q 4KD4A 2PCFB 3N52A 3HOVB 4RGOS 2K75A 1WVLA 1QVFA 3Q24A 5M3FG 2QGQA 4XT1B 1BF4A 5JEAH 3GQBA 3S15H 1TWFH 3EN2A 2DUDA 4ABNA 1A6XA 3DMUA 2C5CA 2JE6I 1CTMA 4A93B 4FNFA 4YCWA 2OWOA 3A5UA 3CU7A 1IYVA 2F0KA 3HOUB 4TVAB 4KI0A 3G6EA 4ZRZA 1LTGD 2KEEA 1KTKA 1KABA 2WINB 4JV5Q 1X3PA 4XQQA 1Q7YC 1D1KA 4IUVA 2R7ZH 1A3TA 1QUQB 2UXCL 4NP5A 3CXCA 1R4QB 1O7IA 4A3IG 2P5ZX 1XPRA 3PSIA 1HR0W 2UXDL 1U4MA 4ZKBB 5AFWA 1K8OA 2EYOA 2AMCB 3MA2B 3R3OA 3MVVA 4DUYL 3PO2H 4DNRB 1JE5A 2B2UC 2PQEA 3EJIA 4O1NA 4YHHL 3CCJA 1QOHA 2IHFA 4A3MB 2JK8A 5JEAJ 3BDCA 3L3OC 3CQZH 5C4ZA 4A3BG 1OXVA 1MSGA 1QILA 4OL7A 2F3WA 1S72A 1QE6A 2XWBB 1EUJA 4K5XA 1J5EQ 2PYKA 4NKLA 1PTOB 1BVSA 4FXGC 3RNUA 5DM73 4WRDA 4FVMA 4R4TA 1VQLA 1SR3A 1S5ED 2ATWA 5EKIA 4EQNA 5HGQA 4LUVA 3V2TA 3SK6A 3QR8A 5EBCA 5DAUA 1YJ9A 4OWWB 3S1RB 5D3IB 2A69C 2RDGA 4LF6Q 4DK0A 1YJWA 2BA0A 3JAME 1IL8A 1BOSA 3KFUA 4OXPA 1MJCA 2F0UA 1V1PB 3AYHB 5ELCA 3VR6A 2EOTA 2K5DA 3KLWA 3HG9A 3H91A 2WKDA 4UAIA 1C9OA 3BDOA 5M3MH 4JI1Q 2I5LX 1K28A 2X6GA 3PF4A 3CHBD 1PDQA 3SHLA 3MXPA 1U4PA 4DV1L 2F0WA 2L0CA 3OTOL 2WAQB 3M85A 1KHIA 1N34L 1IBKL 3NQIA 1TWHB 1FGBD 1IXRA 2GVAA 3H09A 4P71A 1KDBA 4JI8L 1HNZL 3ER0A 5A2QL 3D4RA 2WAQE 4U68A 2L4NA 2QEJC 1AZPA 1BXTA 3A7LA 2V1CC 4LFAL 1HZ9A 4N8FA 4IUTA 4BY7G 2O4XA 4POFA 4Y7NH 1NBWA 1HNXL 4DGZA 4I65A 2KCCA 3RZOB 4IUPA 1KRSA 3OW2A 1EOTA 1QZHA 2BE5D 1AH9A 4V190 5C4XG 2PW5A 2UUCL 1WCMH 1O7LA 3I4LA 4KHPQ 4JPBW 2Z8LA 2IX1A 1ENCA 2MP1A 5JJKA 4R9WA 3CCEA 3NXWA 4F88A 4X66L 2F3IA 2JJQA 2VUMH 4KJNA 1SSOA 1A3VA 3EFXD 2B2WA 2B8FA 4JOIA 4JI2L 3BVGA 4OO1I 3KUPA 1F2MA 3T1HL 1HZAA 5IT9c 1EZ8A 1G6PA 3SGIA 5AJ3Q 2AHOB 2XGTA 2EY2A 3PIPA 2MNAA 4HJAA 1TWCB 1U0LA 4EQPA 1YHQA 3HOZB 2LXJA 3S1RH 3CP0A 1BCPD 3A74A 4BBRG 2QA4A 1K8AC 4R4QA 2A5HA 3Q0AA 5E1FA 2AWOA 3J7YW 3FKIG 3I4MG 2RKSA 2AQ2B 2KVMA 5KNDA 1HFGA 3K7AH 5LMNL 1STHA 4RAUC 1YVCA 1AE3A 5CBAE 5NUCA 1I3QH 2B8GA 3IL8A 4L8JA 3C3LA 4JBKA 1TS2A 1PTOC 1N32Q 3DEPA 2N49A 5CBEE 2SNMA 5CC4A 2QDLA 4NXNL 1FGUA 4P73A 5JJLA 1STEA 3KDFB 1KDAA 3RN5A 4BXXH 3D4WA 1EY0A 1TWHH 2V4DA 4KN7C 3TZDA 2A8VA 1HHVA 1RTNA 2HDLA 2E8GA 2MJ8A 3UDFA 1Q86C 2HQEA 3J7A5 1LTBD 2EYJA 1BR9A 1L1OA 3BDLA 1ICWA 4LF8L 3HP3A 4N9PA 1JOQA 2CWAA 4LF9L 1SBBB 4K2KA 2KOLA 5JPNC 1QVGA 2O5IC 5GADC 1GKHA 2Y0SG 1GUWA 5FKAC 3V96A 4B3RL 3CPWA 1K8MA 2JA7G 3QWNA 3NUCA 4JI5L 4P75A 2F0FA 3X3NA 2L15A 1MJEA 2WACA 2G9DA 2VS1A 3HOWB 5HY6A 4HEDA 3K7UC 5COYA 2BH2A 3MEFA 3HKZG 3NBHB 4GS3A 3STBC 1IKLA 1K0RA 3IFTA 4OHJA 3EROA 1W6KA 3GTGB 3UE1A 4YIJA 1EQVA 2HD3A 3UDXA 5FOBB 5KNCA 3PCOB 2AQ1B 4B08A 1N33L 5JVG3 2SNSA 2UUBL 4K5WA 3TN2A 4ME3A 3M4OH 5EPJA 3KF6A 1XX8A 3HGBA 2RA4A 3HOYH 3GV6A 2L11A 3NEMA 1Y1WB 2OF1A 2LSSA 1U4RA 1TWCH 3AU7A 1AFPA 3K57A 2B63G 2HUGA 1SNDA 4A3DH 5C6AA 3CAMA 4GKKL 4HTHA 4A3EG 2KA7A 2NTTA 4GOPA 5EAYA 4C3IB 5KNBA 4WFN3 3D3RA 2UU9L 2ZM6Q 4RA8A 1SFOH 2XRQD 1I4XA 1BDOA 3M7GA 3PF5A 1OO9B 1VF5C 4C3JG 3SE0A 1D6EC 3AFPA 4CJ0B 3I4NH 4UDUC 3WOEA 3I7FA 1B2TA 3L7ZC 4EVOA 2EYFA 5JEAG 1UUPA 2RDFA 4GNXB 4HIKA 3HEJA 3U4ZA 4JI6Q 1TKWB 1CQVA 1UE5A 4Z9CB 1E1OA 2HT1A 1LTAD 3ZYYX 4QUCA 1K9MC 2N3SA 5BR8L 1X55A 2KCMA 2K28A 3OSOA 2MHVA 2RVLA 1HZBA 1HUMA 4XYQA 3LWUA 3D0FA 2RCNA 4NB3A 2PQAA 1KL9A 2K04A 1IW7C 1TU2B 2R7ZG 3S1NB 4KKTA 4RGNA 2PI2E 1UWVA 3D6CA 5BN5A 2PW7A 1EOVA 3HOWH 4JI7L 2NB0A 5J1ZA 3BG3A 1FR3A 2PNRC 3A8JE 4QCLA 1D1IA 1SE3A 3PO2G 2E76C 4NW2A 1PZID 3F2UA 4HSVA 5ELNA 4X62L 4KJOA 2X69A 3OMGA 4DV3L 1STGA 1PH9A 2EXDA 1FL0A 1ML0D 3GDEA 4KY5A 1DCZA 2JXMB 1B50A 1H9JA 3OWFA 3C1FA 1UEBA 1Y1VH 3EIVA 4QL5A 1IBLQ 3M7NA 1DONA 1VQGA 3AMUA 2OQ0A 1NR2A 3I8ZA 4A3KH 2JSOA 1BCPF 3V05A 3CMAA 3VR4A 1T9HA 1DOKA 3ULPA 2E2JB 2E2DC 3RLFA 5KYLA 1J8IA 2VW9A 3S2DH 4HMIA 3J81i 4Q5VA 1KNEA 1HUNA 4ME5A 5ISRA 1LT4D 2F0EA 2K32A 5ELFA 5DM63 5KEEA 4YY3Q 4JYAL 3BZKA 2MGSA 4OIJA 4IFDI 2WB1B 3BVZA 1AN8A 3T53B 4A3GH 4PV1C 2HIXA 4A75A 5FO9B 1UE7A 4OIKA 1MIUA
chains in the Genus database with same CATH topology
2R61A 1HRJA 2Z4IA 5FO7B 1ONLA 4XDXA 3OHXC 2NN6H 3K5LA 5CV8A 3PIP3 4PMWA 1AZQA 1LACA 1STNA 1RODA 1W6JA 4DAPA 1GHJA 1H9KA 3OIPA 1EU3A 4K8JA 1Z6HA 1HXYD 1MI2A 1NAPA 1EIGA 1QCBD 2B2YA 4HCEA 1TWGB 3BVMA 2JA5B 2ENBA 1U4LA 3KLSX 3I3CA 5C44B 2E2IB 3CKIB 5IT9E 4H0LC 4C1NK 2HDMA 4X3TA 5C5LA 3CRKC 2VNUD 3KK7A 1LT6D 1Q8IA 5C4JB 2KECA 3SR1A 2Q8RE 2A6ED 5FK9C 1BNZA 4IQZA 1QNUA 4KKSA 1WTQA 1GUTA 1PFBA 2BDOA 2YU9B 2JP1A 2X6LA 4KY7A 1MD2D 1GUNA 4PMBA 2EJFC 2XSCA 2CW0D 4KHVA 5CV7A 1PRTB 4K6LA 4P2CB 1SYDA 2H1EA 4XQJA 5M5YB 3KBXA 3DUZA 1EY8A 2E2HB 1CHQD 4G7OC 1ESFA 1SMYC 5EPLA 5JPMC 2FJ2A 5LL6X 3K58A 3SXHA 5I9PA 5J22A 1CZGA 3I73A 5CV9A 3I72A 5CMDA 3QOJA 3LNNA 1SYBA 3S17B 2K1BA 1S4ZA 4CBVA 2J7ZA 1Q90A 1RCVD 1ZYRC 1SNMA 1I6HB 5C3EB 3DXJC 3E0JA 5HURA 1PTOD 2XWJB 2JA8B 1SNPA 4DXGA 3K6OA 4MHEA 2B2TC 5HGTA 4BBSB 4MN3A 1T5XD 2K33A 4ID6A 3P75A 3K5OA 2IX0A 2ICEC 2F0IA 3NP8A 2WKCA 3CRLC 1CHPD 4ODGA 2EXZA 1LT5D 3MXNA 1HCZA 2RBMA 2EYLA 5CV5A 3MAQA 4CJ1B 5J39A 1Z47A 4A3JB 4A3FB 2LY7A 2LFNA 4JK1C 1WTPA 1ILQA 3I90A 2EE1A 2EPBA 3NBIA 1TS4A 1L0XB 3VYSA 1X32A 3H0GB 3DEOA 1TIID 1H9MA 5IGEA 5G3LD 4H7BA 1WD1A 1BO0A 2I07B 3K0YA 3RD4A 3MEHA 3U9OA 3M4YA 2IPKD 5A2QE 2PMZB 4QF4A 2N55A 4FF3A 2HCIA 1ESRA 3MTSA 2NWGA 1JR0D 1PRTC 1PYWD 1SNOA 4NMZA 5CGKA 1WTXA 1NSNS 5CORA 1B4OA 1OXSC 1YNJC 4DXFA 4KN4C 5TSSA 2DNEA 5C0XH 1HA5A 1DZ1A 4RHSA 1PXUA 1EY4A 1B53A 4G7ZC 5D65A 4TRDA 3M3YB 1IYUA 5DNFA 5BN4A 2JA6B 4HCSA 4G57A 1CFMA 3I70A 3R2TA 1IW7D 3X3MA 4F87A 4BA1I 3LWEA 4J8QA 3HOXB 2BOSA 5D14A 3OPOA 3WDNA 1HA6A 3VA5A 1MBYA 1YNNC 4B9XA 4H44C 4RKBA 2K5WA 2N88A 3TSSA 1B1ZA 1EQTA 4HMJA 1GHKA 5C0XJ 4ZK9B 1VMCA 3H3VC 5M5XB 3PUZA 4ZKCB 2RDHA 4RWSC 5K5PA 1V8QA 4F8MA 1II3A 2D5DA 4X3SA 2FMMA 1F9SA 3U9SA 4TQUS 3MC0B 1BQQT 5LHY1 5EJWA 3FVQA 1J9OA 5C4HA 3S1MB 2R92B 3GTQB 2OT2A 3NHHA 4XYOA 2NN6G 3GTLB 1PTOH 1LO5D 5KIXA 1HQMC 1PTOF 2EYPA 3S9WA 2VB3X 2AWNA 3J80L 3QG1A 2B2VC 4L63B 5M3FB 3ITPA 1JWSD 2JEAI 3NPPA 1F2ZA 1SAPA 4IURA 2XIWA 2GA4B 2IT1A 4QMGA 3MWYW 2A6HD 3P20A 1E2ZA 3J81L 5IODA 1FYCA 4RGTA 1WTRA 4GZYC 4A3IB 3FMCA 2XVSA 1GOZA 1D5MC 5JJZA 2KUMA 3NBHA 3NWTA 1CA6A 2K01A 1SNCA 2NUCA 5EKKA 1H9SB 1I4RA 4A3BB 3DHQA 3TP8A 4XT3B 1MGSA 5CYUA 2PZWA 5G3LF 4CKBA 4C3HB 2OXPA 4V0BA 1DD2A 4HN7A 4DAYA 1EIHA 2KCNA 5FLXL 3DM1A 2F0NA 3T13A 1OXTA 3J7AF 1LABA 1TR5A 1SXTA 4LMQD 1NR4A 1GUSA 1PFNA 4J1MA 5BN3A 4LK1C 2A68D 3D6WA 1RHPA 2F0HA 3NWSA 1V1OA 1KNAA 3TBIB 3TZUA 2C9OA 1LLRD 2QKIC 4DAVA 4FF4A 1RJTA 4PNYA 2WV6D 2F0QA 2F0PA 4ZUJA 2D62A 3RMHA 2O2LD 3ND8A 2E74C 2EYMA 5I6WA 4LJZC 2R3ZA 3DWAA 4KKUA 2BDNA 1ZYRD 1LTRD 2JYOA 3NTIA 4J6HA 1CZWA 3W2DA 1U9RA 2F0DA 2DY7A 5I9OA 5CV4A 1AP0A 4K2LA 4BY7B 1TY2A 1RD9D 3GTPB 4EGVA 2L9HA 5C4XB 1LV9A 5LL6S 5T1GA 3E5SA 1F2LA 2IJ0A 1V43A 4IALA 3EVQA 2EDGA 1QWYA 5IIFA 1DYQA 2M9VA 3E6ZX 3PMFA 2NZ1D 2B2WC 3EA6A 1DXMA 1XYIA 4NDXA 3S1QB 1Y8NB 5E4XA 3FKIB 3I4MB 5EBDA 1A3UA 2K03A 5IGDA 4IFDH 4I7ZC 2KEDA 2SDFA 3SEBA 2XN9C 4M1UB 3BYYB 1EYAA 2VXWA 3A8KE 1PZJD 1DOMA 2QILA 3BS1A 4IZ8A 2F0TA 5D3DA 5C0XG 1LT3D 4FXKC 1Y8OB 3PIO3 1E0BA 3HS0C 1PRTD 2CVRA 2F0SA 3VR5A 3IKJA 2BE5C 1ZEQX 2YYZA 1VMPA 1L0YB 5I2YA 1WTOA 2TMPA 1XXGA 2A69D 3VYUA 2Y0SB 4QUFA 3OMCA 2J0TD 2JA7B 1SEBD 1HFNA 4IFDJ 1I4QA 3KLRA 1B9MA 1T5EA 4H13C 1LTTD 1JORA 3HKZB 4R8NA 1CM9A 1PFMA 1Z7TA 2KHSA 1KAAA 1UNSA 1PMRA 1DM0B 4OGQC 1K83B 2B2UA 1EU4A 4FF1A 3VYRA 1TQOA 5I2XA 1R9TB 4KK7A 4FF2A 1YNND 3SK5A 2F0VA 2B63B 5CV6A 1I6VC 3PV0A 2NN6I 3P1HA 4A3EB 3TMEA 4WORA 3FPUB 2MPMA 4HSPA 2F0OA 4N9TA 2NVYB 4RCOA 4C3JB 3NQTA 1E2VA 5KYIA 2D2CC 1LTID 2F4IA 3EQLC 2PZUA 3NSWA 1CQFA 1A2TA 2F0LA 5ELDA 1JQYD 1EY5A 3S15B 1SJHD 1TWFB 4EQOA 3PUYA 1D5XC 5IGBA 3ND9A 5IOCA 1TS3A 3TP6A 5DEHA 4RGMA 4KD3A 5T1IA 2R7ZB 4DU9A 4C56C 1G91A 2F1MA 3R8BA 3MZ5A 1AEXA 2Q8IB 3PO2B 2G9HD 3RUZA 4ILWA 1HTLD 1A15A 3HRZC 1HQRD 3CQZB 4DK1A 4CKEA 1ET6A 3HZXA 3L9AX 2NVXB 4RHRA 4QB4A 1QB5D 4ZQ3A 2RSOA 1TS5A 4G4KA 1NUCA 2QDBA 2F03A 1JB3A 1SE2A 4KTAA 4FO2A 2Z4HA 4XQNA 4ZLTF 1STYA 1EWCA 1B3AA 3MFGA 2Z1CA 1QG7A 1ET9A 1UEAB 3FDTA 1Y8PB 5M3MB 1PRTF 1JWUD 1JOKA 1Q12A 1XWEA 2EY1A 2EVBA 4AYBB 5CR3A 5K36H 1STBA 1SYFA 4JBWA 1SYEA 1GXDC 2A73B 4K14A 1WD0A 4Y7NB 4CGYB 1SYCA 2NBFA 3SVMA 2IWHA 1F9QA 1I4PA 1V1PA 1AW7A 1MSHA 4XTCS 2B2YC 2AUJD 3NK9A 4HR7B 1A2UA 1WCMB 3A8IE 4CHTB 4IUNA 3MFYA 2FMCA 5C5MA 2Q8TA 4DNTB 1Q1BA 1CA5A 2VUMB 4C3HG 2LMCB 5A35A 2A74C 2K5QA 1D5ZC 4S3SA 1NCVA 2SOBA 3QJYA 4KY6A 5JAVA 2PPBC 4E6IA 1F77A 1S5DD 5ELEA 1B44D 1I4GA 3FPPA 3J80E 4ZUIA 3TDQA 4RH6A 2OEOA 4XXEA 3C2PA 3W3AA 1KLUD 3H94A 5IGGA 1O78A 2JEBI 4DN4M 4IFDG 2EYHA 1C4QA 2MUYA 3K7AB 5JVH3 2M00A 1I3QB 5C0XI 3URYA 3J81E 4C3IG 5C3WA 4B9WA 4DA2A 1FNVA 2J4XA 1RF2D 2ZXRA 1ILPA 4CKCA 3C1EA 4OO1H 3K5NA 1EEFD 3IAYA 1GUOA 3BZDB 4XIGS 2H4OA 1SDFA 5ELBA 1JCKB 2F0GA 2LKVA 1Q1EA 2AQ3B 2A6EC 2TSSA 3VA7A 2FFKB 1F9PA 2SEBD 2IX3A 4U673 2ZT9C 2EJMA 4BWGB 5FLXE 1OXUA 2EY6A 2CW0C 3OOCA 1Q3LA 3JAML 1CK1A 5EKLA 3QIAA 4X3UA 1G6ZA 1F9RA 1G2SA 3KBGA 4TSSA 3M4OB 4KHZA 4M8AA 2ICIA 3HOYB 5F2DA 1OXXK 4A3DB 1H9SA 3BYTB 5I4DA 4DFAA 4F7XA 5KGUA 4ZAIA 1F2YA 3ERQA 2VB2X 1STAA 1O7YA 1H9RA 3SK4A 1SFOB 1EYDA 2ZXPA 3TP5A 2K05A 3PUXA 1KDCA 1R4PB 1S5BD 1SNQA 5C3XA 3I4NB 4KV6A 3T51B 1DOLA 2O5JC 1S5FD 2WP8J 3S2HB 1FNWA 5FO8B 1PZKD 2PZTA 3T56B 5JOBA 1GUGA 4O42A 1VDZA 4CJ2C 2D9UA 1BUVT 2B39A 3VYTA 1LTSD 3PUWA 2EJGC 1QJOA 3Q22A 1KLGD 2ID0A 5EPKA 1XTCD 2R6GA 3GD7A 1Y69U 2RSNA 3C46A 1ZXTA 1VCIA 1EY6A 1SMYD 3OIQA 4RKLA 1FNUA 3VR3A 2I46A 2K7VA 4MIUA 4IN3A 3SDZA 2L1BA 1ENAA 3G7LA 4KMUC 3Q23A 1Y1VB 1JICA 3D31A 1BCPB 3OW7A 4A3KB 4ULLA 4QIWB 3QOLA 4WJWA 2QCPX 3S2DB 1ZKOA 5E4WC 1WTVA 4A3GB 4BS9A 3AB9A 1GJXA 3GP7A 3PUVA 2CQAA 1BBXC 2F0MA 3GTKB 3J7AV 4C2MB 2IW3A 3RZDB 1EWHA 2AUKA 4BA2I 3O13A 1D2BA 3VR2A 5K36G 3OWEB 1HTPA 1IHZA 2ZXOA 1SYGA 2F3VA 3GTOB 2NVQB 5EGTA 3UI2A 2L55A 4BBRB 2LS01 5M9OA 4G7HC 1G291 4IUQA 2EY5A 1M4VA 3Q6SA 1B9NA 1EFID 2B2TA 1EEID 2PO4A 5IGFA 1M8AA 1X3QA 2NYZD 1UAPA 3S16B 1FD7D 3QB3A 2DN8A 1WTWA 5E3FA 3FEWX 2EZVA 4FYDA 2KJXA 3ONAB 2L5TA 1I50B 3GV3A 2HCCA 1QNKA 3D4DA 1EYCA 1C48A 4PMCA 3P7JA 4BY1B 1TVXA 1YNJD 4L6TB 3QO2A 1EY9A 1EY7A 3D8GA 1JE4A 3H6MA 5I6YA 3K59A 2NVTB 4K5VA 2E75C 1RKNA 2BA1A 3GO5A 3SK8A 2BCOA 3K5MA 3DWQA 2WIIB 3GTMB 2QF7A 3R93A 1BCPC 1G8ZD 3I91A 5EQ0A 3KF8A 1TY0A 2DNCA 3NTHA 2DY8A 3NE5B 4OO1G 2XRSD 2A6HC 3A55A 4RFBA 1ENFA 2XNAC 3LX0A 1DJRD 1RTOA 3N6RA 2F0JA 2IL8A 3NTKA 3R2IA 1TWAB 1S5CD 1I4HA 4DF7A 4ZYSA 1O7ZA 3MHBA 4FXDA 4FP5D 1EZ6A 1JC7A 3T16A 1O80A 3PO3B 3A54A 4Q0FA 1IKMA 5M5WB 2RQXA 3DWPA 1G2TA 1RDPD 2K6AA 1C8CA 3WOFA 4K6DA 2NTSA 1SJED 3A56A 2M2LA 4HAEA 2A68C 1VF7A 3A7AB 1CT1D 4TKOB 3TP7A 1JOOA 3G6JB 1HPCA 2KQ3A 4R8IA 5IGCA 2L12A 3FRPB 1CI3M 3S14B 2FHTA 3MXUA 2CHBD 3KLSA 5IT9L 4IUUA 1TT2A 5KRUA 4RCNA 1PLFA 3IFDA 1JWMD 3T4AC 4K8IA 1E2WA 3MXGA 4X3KA 4LAAA 2R93B 2B2VA 3GTJB 1EL0A 4PQXA 1SE4A 2FINB 4C1NI 4KD4A 2PCFB 3N52A 3HOVB 4RGOS 1WVLA 3Q24A 4XT1B 1BF4A 5JEAH 3GQBA 4ABNA 1A6XA 3DMUA 2C5CA 2JE6I 1CTMA 4A93B 4FNFA 3CU7A 1IYVA 2F0KA 3HOUB 4KI0A 4ZRZA 1LTGD 2KEEA 1KTKA 1KABA 2WINB 1X3PA 4XQQA 1D1KA 4IUVA 1A3TA 4NP5A 1R4QB 1U4MA 4ZKBB 5AFWA 1K8OA 2EYOA 3MA2B 3R3OA 3MVVA 4DNRB 2B2UC 2PQEA 3EJIA 4O1NA 1QOHA 4A3MB 5JEAJ 3BDCA 3L3OC 5C4ZA 1OXVA 1MSGA 1QILA 4OL7A 2F3WA 1QE6A 2XWBB 4K5XA 2PYKA 4NKLA 1PTOB 4FXGC 5DM73 4WRDA 4FVMA 1S5ED 5EKIA 4EQNA 3V2TA 3SK6A 5EBCA 5DAUA 3S1RB 5D3IB 2A69C 2RDGA 4DK0A 2BA0A 3JAME 1IL8A 1BOSA 2F0UA 1V1PB 5ELCA 3VR6A 2EOTA 2K5DA 3HG9A 3H91A 2WKDA 4UAIA 3BDOA 2X6GA 3CHBD 1PDQA 3SHLA 3MXPA 1U4PA 2F0WA 2L0CA 3M85A 2WAQB 3S1NB 3NQIA 1TWHB 1FGBD 3H09A 1KDBA 5A2QL 3D4RA 4U68A 2L4NA 2QEJC 1AZPA 1BXTA 3A7LA 4IUTA 2O4XA 4DGZA 4I65A 2KCCA 3RZOB 4IUPA 1EOTA 2BE5D 4V190 2PW5A 1O7LA 3I4LA 2IX1A 2Z8LA 1ENCA 2MP1A 4R9WA 3NXWA 4F88A 4KJNA 1SSOA 1A3VA 3EFXD 2B2WA 2B8FA 4OO1I 3BVGA 3KUPA 1F2MA 1EZ8A 2EY2A 3HOZB 1TWCB 4EQPA 1BCPD 2A5HA 3Q0AA 5E1FA 2AWOA 3J7YW 2RKSA 2AQ2B 2KVMA 5KNDA 1HFGA 1STHA 4RAUC 5CBAE 5NUCA 2B8GA 3IL8A 4L8JA 3C3LA 1TS2A 1PTOC 3DEPA 5CBEE 2SNMA 5CC4A 1STEA 1KDAA 3D4WA 1EY0A 2V4DA 4KN7C 3TZDA 1HHVA 1RTNA 2HDLA 2MJ8A 2HQEA 1LTBD 2EYJA 1BR9A 3BDLA 1ICWA 3HP3A 4N9PA 1JOQA 1SBBB 4K2KA 2KOLA 5JPNC 2O5IC 1GUWA 5FKAC 3V96A 1K8MA 3QWNA 3NUCA 2F0FA 3X3NA 2WACA 2G9DA 3HOWB 4HEDA 5COYA 1IKLA 3IFTA 4OHJA 3EROA 1W6KA 3GTGB 4YIJA 1EQVA 5FOBB 5KNCA 2AQ1B 4B08A 5JVG3 2SNSA 4K5WA 3TN2A 5EPJA 1XX8A 3HGBA 2RA4A 3GV6A 2L11A 1Y1WB 2OF1A 1U4RA 3AU7A 1AFPA 3K57A 2HUGA 1SNDA 5C6AA 4HTHA 2KA7A 2NTTA 4C3IB 5KNBA 4WFN3 3D3RA 4RA8A 2XRQD 1I4XA 1BDOA 3M7GA 1OO9B 1VF5C 4C3JG 3SE0A 1D6EC 4CJ0B 4UDUC 3WOEA 1B2TA 3L7ZC 4EVOA 2EYFA 5JEAG 1UUPA 2RDFA 3HEJA 1TKWB 1CQVA 4Z9CB 1LTAD 3ZYYX 4QUCA 2K28A 3OSOA 2MHVA 2RVLA 1HUMA 4XYQA 3LWUA 2K04A 1IW7C 1TU2B 4KKTA 4RGNA 3D6CA 5BN5A 2PW7A 2NB0A 5J1ZA 3BG3A 1FR3A 2PNRC 3A8JE 4QCLA 1D1IA 1SE3A 2E76C 4NW2A 1PZID 3F2UA 4HSVA 4KJOA 2X69A 3OMGA 1STGA 1ML0D 4KY5A 1DCZA 2JXMB 1B50A 1H9JA 3OWFA 3C1FA 3M7NA 1DONA 3AMUA 3I8ZA 1NR2A 2JSOA 1BCPF 3V05A 3VR4A 1DOKA 2E2JB 2E2DC 3RLFA 5KYLA 1J8IA 4HMIA 4Q5VA 1KNEA 1HUNA 4ME5A 5ISRA 5ELFA 1LT4D 2F0EA 2K32A 5DM63 5KEEA 2MGSA 4OIJA 4IFDI 2WB1B 3BVZA 1AN8A 3T53B 4PV1C 5FO9B 4OIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KED A;  2N55 A;  2SDF A;  1RJT A;  2HCI A;  5CMD A;  1ESR A;  1ILP A;  1HRJ A;  4X3K A;  2KVM A;  2VXW A;  1HFG A;  1IL8 A;  2B2V A;  4O42 A;  4CJ0 B;  1RTO A;  1EL0 A;  1DOM A;  3MTS A;  4XDX A;  2NWG A;  2K1B A;  4RAU C;  4CJ2 C;  1S4Z A;  2D9U A;  2IL8 A;  5CBA E;  3UI2 A;  2EOT A;  1B2T A;  2B2V C;  2J7Z A;  3IL8 A;  2FIN B;  3DEP A;  3H91 A;  4UAI A;  5CBE E;  4IUQ A;  1E0B A;  3N52 A;  1WTX A;  2R3Z A;  3Q6S A;  1SDF A;  1AZQ A;  5COR A;  5EPK A;  1ROD A;  1B4O A;  2BDN A;  2CVR A;  4QUC A;  2X6G A;  1WVL A;  2RSN A;  1HUN A;  4XT1 B;  2B2T A;  1ZXT A;  1BF4 A;  3TZD A;  1PDQ A;  2K28 A;  1HHV A;  1O7Z A;  1M8A A;  2RVL A;  1SAP A;  1RTN A;  1MI2 A;  1VMP A;  2FFK B;  1HUM A;  1X3Q A;  1F9P A;  2HDL A;  1U4P A;  2JYO A;  2MJ8 A;  2NYZ D;  4MHE A;  2B2T C;  2XIW A;  1WTO A;  1WD0 A;  1B53 A;  5T1I A;  1O80 A;  3MWY W;  1ICW A;  1NAP A;  5D65 A;  2DY7 A;  1EIG A;  2B2Y A;  3HP3 A;  5DNF A;  4QUF A;  3SVM A;  4MN3 A;  1WTW A;  1IKM A;  1F9Q A;  2K04 A;  1G91 A;  4HCS A;  1AP0 A;  1MSH A;  2KOL A;  2B2Y C;  2L1B A;  1U4L A;  3G7L A;  2L4N A;  4U68 A;  1HFN A;  3ONA B;  1AZP A;  1GUW A;  3I3C A;  1DZ1 A;  1G2T A;  1Q3L A;  4IUR A;  3GV3 A;  4IUT A;  2KEE A;  1WTR A;  2HCC A;  2L9H A;  1C8C A;  1QNK A;  3LWE A;  2HDM A;  1X3P A;  4X3U A;  2Q8T A;  1F9R A;  4X3T A;  1G6Z A;  1JIC A;  1A15 A;  4IUV A;  1G2S A;  1CA5 A;  3P7J A;  1CM9 A;  1PFM A;  1LV9 A;  2M2L A;  4IUP A;  4HAE A;  3F2U A;  4HSV A;  1TVX A;  4NW2 A;  5D14 A;  1EOT A;  2KEC A;  2X69 A;  3QO2 A;  4HED A;  5COY A;  5T1G A;  5JJZ A;  1HA6 A;  2Q8R E;  1F2L A;  2KUM A;  1JE4 A;  1BNZ A;  1IKL A;  1U4M A;  2B2U A;  5AFW A;  1NCV A;  4ZKB B;  1CA6 A;  1ML0 D;  2K01 A;  2RSO A;  2MP1 A;  4CJ1 B;  4R9W A;  1B50 A;  1WTQ A;  2N88 A;  2B2U C;  1PFB A;  2JP1 A;  1MGS A;  2X6L A;  4XT3 B;  5E4W C;  1EQT A;  1DON A;  3TN2 A;  4ZK9 B;  1SSO A;  3I8Z A;  1NR2 A;  4ZAI A;  1VMC A;  1WTP A;  1WTV A;  1EIH A;  4ZKC B;  5EPJ A;  1MSG A;  1O7Y A;  1XX8 A;  2B2W A;  4R8I A;  1DOK A;  2RA4 A;  3DM1 A;  4RWS C;  1QE6 A;  3KUP A;  2NZ1 D;  3GV6 A;  2L11 A;  2L12 A;  1ILQ A;  3I90 A;  2EE1 A;  1U4R A;  2EPB A;  2B2W C;  2K05 A;  2FHT A;  4X3S A;  1J8I A;  4DN4 M;  2H1E A;  2FMM A;  2HUG A;  3R93 A;  3I91 A;  1KNE A;  3FPU B;  1BBX C;  1X32 A;  5EQ0 A;  4LMQ D;  4ZLT F;  1F9S A;  1NR4 A;  2MPM A;  1PFN A;  3DEO A;  3KBX A;  1XYI A;  4IUU A;  1WD1 A;  1DOL A;  1B3A A;  2MGS A;  4OIJ A;  5E4X A;  1BO0 A;  3D6W A;  5EKI A;  2DY8 A;  5EJW A;  1J9O A;  1PLF A;  2K03 A;  2FJ2 A;  5EPL A;  1RHP A;  1QG7 A;  4RA8 A;  1KNA A;  3IFD A;  4OIK A;  3FDT A; 
#chains in the Genus database with same CATH topology
 1Q81 C;  2R61 A;  2WB1 E;  3J81 c;  1HRJ A;  2Z4I A;  3AFQ A;  3GTK H;  5FO7 B;  4C2M H;  2DGY A;  3W5O A;  5M3M G;  1ONL A;  3U58 A;  4XDX A;  3RZD H;  3OHX C;  5FLM H;  2NN6 H;  1CKO A;  4AYB G;  3K5L A;  1WTH A;  4PZ7 A;  3U50 C;  5CV8 A;  2YTX A;  3PIP 3;  4PMW A;  1AZQ A;  1LAC A;  1STN A;  1ROD A;  1W6J A;  1YNX A;  4DAP A;  1GHJ A;  1H9K A;  3OIP A;  1EU3 A;  4K8J A;  4R4I A;  1Z6H A;  1HXY D;  1EQR A;  1MI2 A;  4DKA C;  1PH4 A;  3ULJ A;  2NVQ H;  1KAW A;  5IP9 H;  1NAP A;  1C7Y A;  1EIG A;  1B7Y B;  1QCB D;  1JJ2 A;  2B2Y A;  4LF7 Q;  4JVZ A;  4HCE A;  1TWG B;  3BVM A;  2JA5 B;  2ENB A;  1U4L A;  3KLS X;  1Q8K A;  5FLX c;  3I3C A;  5C44 B;  1X9N A;  3BU2 A;  4A76 A;  1EIY B;  2E2I B;  3OYY A;  1HNW L;  3CKI B;  4DV2 L;  5IT9 E;  4H0L C;  1N8R C;  3S16 H;  4C1N K;  2HDM A;  1WCM G;  4X3T A;  5C5L A;  3CRK C;  2VNU D;  1Q46 A;  3KK7 A;  1LT6 D;  1Q8I A;  1YIT A;  2C35 B;  5C4J B;  2KEC A;  1PA6 A;  1B3Q A;  3SR1 A;  2Q8R E;  2A6E D;  5FK9 C;  1KRT A;  2VUM G;  1BNZ A;  1X3E A;  1PH5 A;  3KF8 B;  4IQZ A;  1BBU A;  1QNU A;  4KKS A;  4NXM Q;  1WTQ A;  1GUT A;  1PFB A;  2BDO A;  2YU9 B;  2JP1 A;  2X6L A;  4KY7 A;  1MD2 D;  1GUN A;  3RN2 A;  3CCL A;  4PMB A;  3PQI A;  4GKJ L;  2EJF C;  2XSC A;  2CW0 D;  4IJL A;  4KHV A;  5CV7 A;  1PRT B;  4K6L A;  4P2C B;  4JI0 L;  3TS0 A;  1SYD A;  1KQS A;  4OX9 L;  2H1E A;  2Z9H A;  4XQJ A;  5M5Y B;  4QQB X;  3KBX A;  3DUZ A;  2NVT H;  1EY8 A;  1XMQ Q;  2E2H B;  1CHQ D;  4G7O C;  1ESF A;  2CKZ B;  3RR5 A;  1SMY C;  5EPL A;  5JPM C;  2FJ2 A;  5LL6 X;  3K58 A;  3SXH A;  5I9P A;  3GTM H;  5J22 A;  3F2B A;  1CZG A;  3I73 A;  4A4I A;  5CV9 A;  3I72 A;  5CMD A;  3QOJ A;  3LNN A;  2Q2U A;  2OTL A;  2H5X A;  1SYB A;  4PZ8 A;  4YCV A;  3S17 B;  1K73 C;  1VQH A;  2K1B A;  1S4Z A;  4BXX G;  4CBV A;  2J7Z A;  1Q90 A;  3K8A A;  3BJU A;  1RCV D;  2QW7 A;  1ZYR C;  1SNM A;  4IPD A;  1VQA A;  1I6H B;  5C3E B;  3TQY A;  1B70 B;  3E0J A;  3DXJ C;  5HUR A;  1RL2 A;  1PTO D;  4R4O A;  2XWJ B;  2JA8 B;  1SNP A;  4DXG A;  3K6O A;  5L37 A;  4MHE A;  2B2T C;  3I2Z A;  5HGT A;  2JA5 H;  4IPH A;  4DR3 L;  4BBS B;  3CCM A;  4MN3 A;  1T5X D;  5C44 H;  2K33 A;  4ID6 A;  4X65 L;  3P75 A;  1HR0 L;  2MO1 A;  3K5O A;  4JI4 Q;  2IX0 A;  2ICE C;  3T1Y Q;  2F0I A;  4X64 Q;  1N36 L;  2JA9 A;  3HFZ B;  3NP8 A;  1BKB A;  4AH6 A;  2WKC A;  3CRL C;  4DV0 Q;  1CHP D;  3PO3 H;  4ODG A;  1BBW A;  4DV7 L;  2EXZ A;  5M5W H;  4Y52 H;  1LT5 D;  3MXN A;  1HCZ A;  3NEL A;  1AE2 A;  1NMG A;  2EYL A;  2RBM A;  2KHJ A;  5CV5 A;  2YU9 H;  2K5V A;  3MAQ A;  5IYD H;  5LMU Q;  4CJ1 B;  5J39 A;  3PGZ A;  1Z47 A;  4A3J B;  3HOY G;  4A3F B;  2F4V L;  1WI5 A;  2LY7 A;  3EBE A;  4JBM A;  4HID A;  2D0P A;  2LFN A;  4JK1 C;  4A3D G;  1WTP A;  4QGU A;  2VY3 A;  4DR5 Q;  2UXB Q;  4B3S Q;  4UP7 A;  1ILQ A;  3I90 A;  2EE1 A;  2EPB A;  3NBI A;  1TS4 A;  1L0X B;  3VYS A;  1X32 A;  2UUA L;  3H0G B;  3DEO A;  1TII D;  1H9M A;  5IGE A;  5GAH C;  5G3L D;  1G51 A;  4H7B A;  1WD1 A;  3G48 A;  1BO0 A;  1VQ4 A;  2I07 B;  3K0Y A;  4LFC L;  3M9B A;  3RD4 A;  2K5N A;  3MEH A;  3U9O A;  3I4N G;  3M4Y A;  2IPK D;  5A2Q E;  2PMZ B;  4MTK A;  4QF4 A;  1W3S A;  3S14 H;  2N55 A;  4FF3 A;  2HCI A;  3KJO A;  4LF6 L;  1ESR A;  1P16 A;  3F2C A;  1VQ7 A;  1NNX A;  3MTS A;  2PMZ E;  4IOC A;  2NWG A;  1JR0 D;  1PRT C;  1PYW D;  1IYJ B;  1SNO A;  1VS0 A;  4NMZ A;  5CGK A;  1WTX A;  1NSN S;  2N8N A;  5COR A;  1B4O A;  1OXS C;  5GQO A;  1YNJ C;  1GD7 A;  4DXF A;  4KN4 C;  2A1A A;  5TSS A;  2R93 H;  2DNE A;  5C0X H;  2UXC Q;  1HA5 A;  3GTJ H;  1DZ1 A;  4RHS A;  1PXU A;  1EY4 A;  1B53 A;  4G7Z C;  5D65 A;  2UXD Q;  4TRD A;  3M3Y B;  1IYU A;  5DNF A;  3HOW G;  2ZJR A;  3HOV H;  5BN4 A;  2JA6 B;  4DUY Q;  4HJ7 A;  4HCS A;  4G57 A;  1CFM A;  4YHH Q;  4K0K L;  3I70 A;  4DV5 L;  1VQO A;  3R2T A;  4A3C H;  1IW7 D;  3X3M A;  4F87 A;  4BA1 I;  2NZO A;  1VQP A;  3LWE A;  4J8Q A;  3HOX B;  2CQO A;  2BOS A;  2GN5 A;  1SRU A;  5D14 A;  4A93 H;  3CF5 A;  3H3V I;  3OPO A;  5J3B A;  3WDN A;  4OEM B;  1IBM Q;  1Y1V G;  1HA6 A;  3VA5 A;  2B3G A;  3HOU H;  1MBY A;  1YNN C;  1NJI C;  4A3K G;  4B9X A;  3A5Z B;  4H44 C;  3I55 A;  3TS2 A;  4RKB A;  2K5W A;  2N88 A;  3TSS A;  1YHA A;  2ASB A;  1B1Z A;  1EQT A;  4NPS A;  4HMJ A;  1GHK A;  1JT8 A;  5C0X J;  4ZK9 B;  1VQM A;  1VMC A;  3H3V C;  5M5X B;  3PUZ A;  4OWT B;  4ZKC B;  2RDH A;  3FHW A;  4RWS C;  1QZG A;  5K5P A;  1V8Q A;  4F8M A;  4POG A;  1II3 A;  2D5D A;  4LFB L;  4X3S A;  4A3G G;  4A3L H;  2FMM A;  1F9S A;  4CDF C;  3U9S A;  4A3M H;  4LF4 L;  1WJJ A;  4TQU S;  3MC0 B;  1BQQ T;  5LHY 1;  5EJW A;  3FVQ A;  2HHH L;  1J9O A;  5C4H A;  1VQ8 A;  3S1M B;  2R92 B;  3GTQ B;  2E5L L;  2OT2 A;  2CH4 A;  2KHI A;  3NHH A;  4XYO A;  5FLM G;  2NN6 G;  3GTL B;  1PTO H;  4DK6 C;  1ASZ A;  1LO5 D;  1PH2 A;  5KIX A;  4ALP A;  1N34 Q;  1HQM C;  1PTO F;  2EYP A;  3CCU A;  4IPC A;  3S9W A;  3CCV A;  3AQQ A;  2VB3 X;  2AWN A;  3J80 L;  3QG1 A;  4JI8 Q;  1HNZ Q;  2B2V C;  4L63 B;  1TXY A;  4YWM A;  5M3F B;  3ITP A;  1JWS D;  4LFA Q;  2JEA I;  3B6Y A;  5IYC H;  5IP9 G;  2HIV A;  3NPP A;  3KDF A;  1HNX Q;  3TRZ A;  2ZTE A;  1F2Z A;  1SAP A;  4IUR A;  1XNR L;  1QVC A;  2XIW A;  2GA4 B;  2IT1 A;  4QMG A;  3MWY W;  2A6H D;  1UE6 A;  2UUC Q;  3P20 A;  2QEX A;  4UPA A;  2Q2H A;  1E2Z A;  3J81 L;  3S24 A;  5IOD A;  1CUK A;  1FYC A;  2MO0 A;  4X66 Q;  4RGT A;  1WTR A;  4GZY C;  3S1N H;  4A3I B;  4DR7 L;  3FMC A;  4JI2 Q;  2XVS A;  3ULL A;  1GOZ A;  4DPG A;  1D5M C;  5JJZ A;  2KUM A;  5IYB H;  3NBH A;  3NWT A;  4BY1 G;  1CA6 A;  4GN4 B;  1PH7 A;  2K01 A;  1SNC A;  1C0A A;  2NUC A;  2Z6K A;  5EKK A;  1H9S B;  1I4R A;  4A3B B;  3F1Z A;  3DHQ A;  1VQK A;  3TP8 A;  4B3T L;  4XT3 B;  1CKM A;  1MGS A;  3VDY A;  5CYU A;  2PZW A;  3M4Q A;  5G3L F;  4CKB A;  4C3H B;  1FJG Q;  2OXP A;  4V0B A;  3RZO H;  1DD2 A;  1XPO A;  4HN7 A;  4DAY A;  1EIH A;  1VQ5 A;  4DR1 L;  2KCN A;  1CSP A;  5FLX L;  3DM1 A;  4J15 A;  2F0N A;  3T13 A;  1OXT A;  5LMN Q;  3J7A F;  1LAB A;  1TR5 A;  4DV4 L;  1SXT A;  4LMQ D;  1NR4 A;  1GUS A;  1PFN A;  4J1M A;  5BN3 A;  4LK1 C;  2A68 D;  4NXN Q;  3D6W A;  1VQF A;  1H95 A;  2ZM6 L;  1RHP A;  3G4S A;  2F0H A;  3JC6 6;  3NWS A;  1V1O A;  1KNA A;  3K0X A;  2DJG C;  3TBI B;  1SMX A;  2C9O A;  1LLR D;  2QKI C;  4YWK A;  3TZU A;  4DAV A;  4FF4 A;  1RJT A;  4PNY A;  2WV6 D;  2F0Q A;  2F0P A;  1L1O B;  4ZUJ A;  2D62 A;  4LF8 Q;  2MFI A;  3HOZ H;  3RMH A;  1EYG A;  4LF9 Q;  2O2L D;  1HZC A;  5E7N A;  3ND8 A;  2E74 C;  2EYM A;  5I6W A;  4GNX A;  4LJZ C;  4B3R Q;  5IWA L;  2VL6 A;  2R3Z A;  3DWA A;  4JC0 A;  1PFS A;  4KKU A;  1P8L A;  2BDN A;  2JA5 G;  4JI5 Q;  1ZYR D;  2YTV A;  5C44 G;  1LTR D;  2JYO A;  3NTI A;  4J6H A;  4JW0 A;  1CZW A;  4L5T A;  3W2D A;  1U9R A;  1M90 C;  3RLO A;  2FXQ A;  2F0D A;  2DY7 A;  1XMO L;  1K3R A;  5I9O A;  5CV4 A;  1AP0 A;  4K2L A;  4BY7 B;  3PO3 G;  1TY2 A;  1RD9 D;  1N33 Q;  3CC2 A;  2UUB Q;  3GTP B;  1A62 A;  1PVO A;  4EGV A;  2L9H A;  2K5H A;  5IYD G;  5C4X B;  2VQE L;  1D7Q A;  1LV9 A;  5LL6 S;  4YWL A;  5T1G A;  3E5S A;  4PG3 A;  1F2L A;  2IJ0 A;  4GKK Q;  4DUZ L;  1V43 A;  4IAL A;  4C3H H;  3EVQ A;  2EDG A;  1GO3 E;  1QWY A;  4JI3 L;  2UU9 Q;  5IIF A;  2CH4 W;  1DYQ A;  2CFM A;  2M9V A;  1EFW A;  2WFW A;  3E6Z X;  1MHW C;  3PMF A;  4DR4 L;  2NZ1 D;  3J80 i;  3J81 j;  2B2W C;  4JOI C;  3GTG H;  3EA6 A;  1EIF A;  1DXM A;  1XYI A;  1PV4 A;  4NDX A;  3S1Q B;  1Y8N B;  4GN5 A;  5E4X A;  3FKI B;  3JAM i;  3I4M B;  2K50 A;  5EBD A;  1A3U A;  2K03 A;  1CKN B;  5IGD A;  5BR8 Q;  4IFD H;  1Y1W H;  4I7Z C;  3J80 c;  2KED A;  2BH8 A;  2SDF A;  3SEB A;  1X54 A;  2XN9 C;  4M1U B;  4WJ3 M;  3BYY B;  1EYA A;  2VXW A;  2IY5 B;  3A8K E;  1PZJ D;  1DOM A;  2QIL A;  3BS1 A;  3KOJ A;  1E7Z A;  4C3I H;  4IZ8 A;  3JAM c;  2F0T A;  2R93 G;  5D3D A;  5C0X G;  1LT3 D;  4FXK C;  1Y8O B;  1D8L A;  3PIO 3;  1E0B A;  3HS0 C;  1PRT D;  4ZCK A;  2CVR A;  2F0S A;  4JI7 Q;  3VR5 A;  3IKJ A;  2BE5 C;  1L0W A;  1ZEQ X;  4HJ8 A;  3HOV G;  2YYZ A;  1VMP A;  1L0Y B;  5I2Y A;  1WTO A;  4X62 Q;  3KYH C;  4DV3 Q;  2TMP A;  1XXG A;  2A69 D;  3VYU A;  2Y0S B;  4QUF A;  4AQY L;  3OMC A;  1L1O C;  2J0T D;  2JA7 B;  4X6A H;  1SEB D;  1HFN A;  4LUO A;  4IFD J;  1I4Q A;  4A93 G;  3DLL A;  3KLR A;  1B9M A;  1V9P A;  4CDC C;  1T5E A;  2Y0S E;  4EQ5 A;  4H13 C;  3HOU G;  1LTT D;  1JOR A;  3Q8D A;  3HKZ B;  1E22 A;  2ZTD A;  4R8N A;  1CM9 A;  1PFM A;  1Z7T A;  3I4O A;  1KD1 C;  2KHS A;  1KAA A;  2RF4 A;  1V1Q A;  1UNS A;  1PMR A;  4DR6 L;  1DM0 B;  4OGQ C;  1K83 B;  4O0A A;  4P74 A;  2B2U A;  1EU4 A;  3HKZ E;  4FF1 A;  3VYR A;  1TQO A;  5I2X A;  1R9T B;  4JYA Q;  3DM3 A;  4KK7 A;  4FF2 A;  1Q82 C;  1YNN D;  1DGS A;  3SK5 A;  1YJN A;  4A3L G;  3ERS X;  2F0V A;  2B63 B;  4A3M G;  5CV6 A;  1I6V C;  1S40 A;  4DR2 Q;  2Z0S A;  3PV0 A;  2NN6 I;  2K52 A;  3P1H A;  4A3E B;  3TME A;  4WOR A;  3KJP A;  4CDE C;  3FPU B;  2MPM A;  1HH2 P;  4HSP A;  2F0O A;  4N9T A;  2NVY B;  4RCO A;  1K3B C;  2VZA A;  4C3J B;  3NQT A;  4B3M L;  1E2V A;  4GOP C;  3W1G A;  5KYI A;  2E2J H;  2D2C C;  1I94 Q;  1MKH A;  1LTI D;  2F4I A;  5IP7 H;  1YIJ A;  3EQL C;  2PZU A;  1PYB A;  3NSW A;  2ZJP A;  1XJV A;  1CQF A;  1A2T A;  2F0L A;  1SRO A;  5IYC G;  5ELD A;  1JQY D;  1EY5 A;  3S15 B;  1SJH D;  1IZ6 A;  1TWF B;  4JCV E;  4EQO A;  3PUY A;  2VQF Q;  1XNQ L;  2KBN A;  1D5X C;  4DAM A;  3E0E A;  5IGB A;  3ND9 A;  1HNW Q;  5IOC A;  4DV2 Q;  1TS3 A;  4L5R C;  3TP6 A;  4DV6 L;  1SN8 A;  5DEH A;  3ZJY C;  1EQQ A;  4RGM A;  4KD3 A;  2AKW B;  4MNO A;  5T1I A;  2R7Z B;  4OEL B;  4DU9 A;  1FVI A;  4C56 C;  1G91 A;  2WAQ G;  3M4P A;  2F1M A;  4YCU A;  3R8B A;  3MZ5 A;  4LF5 L;  1AEX A;  2Q8I B;  1X56 A;  4HIO A;  3PO2 B;  3T1Y L;  2G9H D;  3E9H A;  5IY0 A;  3RUZ A;  3L0O A;  4ILW A;  5IYB G;  4GKJ Q;  1HTL D;  2N78 A;  2ES2 A;  1A15 A;  3HRZ C;  4JI0 Q;  1HQR D;  3CQZ B;  4PZ6 A;  4DK3 C;  4DK1 A;  1TWG H;  4CKE A;  4OX9 Q;  1ET6 A;  3HZX A;  3L9A X;  2NVX B;  4RHR A;  4QB4 A;  1QB5 D;  2YV5 A;  4ZQ3 A;  2RSO A;  2XTI A;  2E2I H;  1TS5 A;  5GRO A;  4G4K A;  1NUC A;  2QDB A;  4IJH A;  2F03 A;  2DJF C;  2OCE A;  1JB3 A;  3UDG A;  1SE2 A;  4A3E H;  4KTA A;  4JV5 L;  5C4J H;  2UXB L;  4FO2 A;  1QUQ A;  2Z4H A;  4XQN A;  1XPU A;  4ZLT F;  1STY A;  2YTY A;  2EQS A;  4UP9 A;  1EWC A;  2LXK A;  2RHS B;  1X6O A;  1B3A A;  3MFG A;  2ZTC A;  1VQ9 A;  5DLQ E;  3STB D;  2Z1C A;  1QG7 A;  3HOZ G;  1ET9 A;  1UEA B;  4P72 A;  3FDT A;  1Y8P B;  5M3M B;  1PRT F;  1JWU D;  1JOK A;  1Q12 A;  3CC7 A;  1XWE A;  2EY1 A;  5M5Y H;  4DR3 Q;  2EVB A;  1JJG A;  1J5E L;  4AYB B;  2E2H H;  5CR3 A;  5K36 H;  1STB A;  3CPF A;  1SYF A;  4X65 Q;  4JBW A;  2RCF A;  1HR0 Q;  1Z9F A;  1SYE A;  4AYB E;  1GXD C;  3BZC A;  1N36 Q;  2CCZ A;  2A73 B;  1X65 A;  4K14 A;  4DV7 Q;  3S17 H;  3MXN B;  4Y7N B;  1WD0 A;  4CGY B;  1XTD A;  1SYC A;  2NBF A;  3SVM A;  2IWH A;  1I6H H;  1F9Q A;  1I4P A;  1V1P A;  5C3E H;  1GM5 A;  1AW7 A;  1MSH A;  4XTC S;  2B2Y C;  2AUJ D;  1A8V A;  3NK9 A;  4HR7 B;  3K80 C;  1KIX A;  1A2U A;  1WCM B;  2F4V Q;  2JA8 H;  3A8I E;  4CHT B;  4IUN A;  3MFY A;  2FMC A;  4JI1 L;  1VQB A;  5C5M A;  2Q8T A;  4DNT B;  1Q1B A;  1CA5 A;  2VUM B;  4BBS H;  4C3H G;  2IHE A;  2LMC B;  5A35 A;  2A74 C;  2NVX H;  2K5Q A;  1D5Z C;  1J6Q A;  1IBM L;  2UUA Q;  2KEN A;  2F52 A;  3H3V H;  4S3S A;  1NCV A;  2SOB A;  2RHQ B;  3QJY A;  4KY6 A;  5JAV A;  2PPB C;  4E6I A;  1F77 A;  1S5D D;  5ELE A;  1B44 D;  1B8A A;  1I4G A;  3FPP A;  3J80 E;  1WYD A;  4ZUI A;  4LFC Q;  3TDQ A;  4RH6 A;  2OEO A;  2EIF A;  4XXE A;  3C2P A;  3W3A A;  1KLU D;  3H94 A;  5IGG A;  1O78 A;  1E3P A;  3U4V A;  1WOC A;  4EX5 A;  2JEB I;  4DN4 M;  3HKS A;  1PH3 A;  4IFD G;  1YBY A;  1M1K C;  4A3J H;  2EYH A;  1C4Q A;  4A3F H;  2MUY A;  3K7A B;  1Y1W G;  4KHP L;  5JVH 3;  2M00 A;  4WJ4 A;  1I3Q B;  1YHB A;  5C0X I;  4UY8 C;  3URY A;  3J81 E;  4C3I G;  5C3W A;  4B9W A;  4DA2 A;  1FNV A;  2J4X A;  1RF2 D;  2ZXR A;  1ILP A;  3H0G H;  4CKC A;  3C1E A;  4OO1 H;  3K5N A;  4OON A;  1A63 A;  5AJ3 L;  1EEF D;  3IAY A;  3PIO A;  1GUO A;  3BZD B;  4K0K Q;  4XIG S;  4DV5 Q;  3E9I A;  2H4O A;  1SDF A;  5ELB A;  1JCK B;  2F0G A;  2LKV A;  3RLN A;  1Q1E A;  2AQ3 B;  2A6E C;  2TSS A;  3VA7 A;  2FFK B;  1F9P A;  2SEB D;  4DV1 Q;  2IX3 A;  3OTO Q;  3L2P A;  1IBK Q;  1PHJ A;  4U67 3;  2ZT9 C;  2EJM A;  4BWG B;  5FLX E;  4UP8 A;  1OXU A;  2EY6 A;  1E1T A;  3AEV A;  1N32 L;  2KCT A;  2CW0 C;  3OOC A;  1Q3L A;  3JAM L;  1CK1 A;  2G5D A;  2B29 A;  5EKL A;  1U5K A;  3QIA A;  4X3U A;  1G6Z A;  1F9R A;  1G2S A;  3KBG A;  4LNQ A;  3M3Y H;  4TSS A;  4LFB Q;  2JA6 H;  3M4O B;  4KHZ A;  2CWP A;  4M8A A;  2ICI A;  3HOY B;  5F2D A;  1OXX K;  4LF4 Q;  3WWV A;  1JB7 A;  1VQN A;  4A3D B;  1H9S A;  3BYT B;  5I4D A;  2HHH Q;  4DFA A;  4F7X A;  3HOX H;  5KGU A;  1K8G A;  2E5L Q;  1FJG L;  4ZAI A;  1F2Y A;  4LUZ A;  3ERQ A;  4JG2 A;  2VB2 X;  1STA A;  1O7Y A;  1H9R A;  3SK4 A;  1SFO B;  1PH1 A;  1EYD A;  3T1H Q;  2ZXP A;  4IPG A;  3TP5 A;  2ALY B;  2K05 A;  3PUX A;  1KDC A;  1R4P B;  1S5B D;  5FJ8 H;  1SNQ A;  5C3X A;  4GLA C;  3I4N B;  4KV6 A;  3T51 B;  5IP7 G;  1DOL A;  4UHV A;  2O5J C;  1S5F D;  5M5X H;  2WP8 J;  3NEN A;  3S2H B;  4LW1 A;  1FNW A;  5FO8 B;  3CC4 A;  1PZK D;  2PZT A;  1KC8 C;  3T56 B;  2WB1 G;  1JMC A;  1XNR Q;  3CW2 C;  5JOB A;  1GUG A;  4O42 A;  1L2F A;  1VDZ A;  4CJ2 C;  2D9U A;  1BUV T;  2B39 A;  3VYT A;  2R92 H;  3S1M H;  1LTS D;  3PUW A;  3GTQ H;  2OQK A;  2EJG C;  1QJO A;  4FDB A;  3Q22 A;  2R7F A;  1KLG D;  2ID0 A;  5EPK A;  3GTL H;  1XTC D;  2R6G A;  3GD7 A;  1Y69 U;  2RSN A;  4DR7 Q;  3C46 A;  1ZXT A;  1A0I A;  1VCI A;  1EY6 A;  1SMY D;  5LMN W;  3OIQ A;  1ICF B;  4RKL A;  1FNU A;  2K4K A;  2I46 A;  3VR3 A;  1RIP A;  5M3F H;  1NY4 A;  2K7V A;  4MIU A;  4IN3 A;  1GVP A;  3SDZ A;  3LGJ A;  2MQH A;  2L1B A;  1ENA A;  3G7L A;  4B3T Q;  4HJ5 A;  4JI6 L;  4RMF A;  4KMU C;  4MZ9 A;  1CSQ A;  3Q23 A;  4DAY B;  3UE0 A;  3E3X A;  4DR1 Q;  1Y1V B;  1JIC A;  3D31 A;  1BCP B;  3OW7 A;  4RG1 A;  4A3K B;  4GLV B;  4ULL A;  4QIW B;  1PYS B;  4DV4 Q;  1VQJ A;  3QOL A;  2R7D A;  1I5F A;  5JJI A;  4WJW A;  2PI2 A;  2QCP X;  3K81 C;  2JQO A;  3S2D B;  4QIW E;  1ZKO A;  5E4W C;  4A3I H;  1PH8 A;  1NTG A;  1WTV A;  4A3G B;  3KF6 B;  4BS9 A;  4IOA A;  3TRE A;  3AB9 A;  3IRB A;  4GN3 B;  4OWX B;  1GJX A;  3GP7 A;  3PUV A;  2CQA A;  1BBX C;  2F0M A;  4A3B H;  3GTK B;  3J7A V;  4LWC A;  4C2M B;  3S2H H;  2IW3 A;  3RZD B;  5IWA Q;  4GOP B;  1EWH A;  2AUK A;  4BA2 I;  3O13 A;  1D2B A;  1CKN A;  2OTJ A;  3VR2 A;  5K36 G;  1IBL L;  1VQE A;  3OWE B;  1HTP A;  1Y14 B;  1IHZ A;  1VQD A;  2ZXO A;  1XMO Q;  1JJC B;  1SYG A;  2F3V A;  3CCR A;  1OTC A;  2ZJQ A;  3GTO B;  1E24 A;  2NVQ B;  5EGT A;  3UI2 A;  2L55 A;  4BBR B;  2LS0 1;  4QY7 A;  5M9O A;  4G7H C;  2HQL A;  1G29 1;  4YY3 L;  4IUQ A;  2EY5 A;  1M4V A;  3Q6S A;  1K0S A;  1SLJ A;  1B9N A;  3I56 A;  1EFI D;  1SE8 A;  2B2T A;  1EEI D;  2PO4 A;  5IGF A;  5C3E G;  2I0Q A;  1M8A A;  2VQE Q;  1X3Q A;  2NYZ D;  1UAP A;  3S16 B;  1FD7 D;  2JA8 G;  3QB3 A;  1YEZ A;  2DN8 A;  2PQA B;  1WTW A;  5E3F A;  4DUZ Q;  3FEW X;  4O2D A;  2EZV A;  4R1J A;  4IO9 A;  4JI3 Q;  2KJX A;  3W1B A;  4FYD A;  4BBS G;  3ONA B;  2L5T A;  3FP9 A;  1I50 B;  1WFQ A;  3GV3 A;  2HCC A;  1HJP A;  1QNK A;  4DR4 Q;  4APV A;  3D4D A;  1EYC A;  1C48 A;  4PMC A;  3P7J A;  4BY1 B;  5IE8 A;  1TVX A;  1YNJ D;  4L6T B;  1NMF A;  3QO2 A;  1EY9 A;  4BY7 H;  1EY7 A;  3D8G A;  1JE4 A;  4LF7 L;  4A3C G;  2Q2T A;  3CD6 A;  3TEH B;  3H6M A;  4H02 A;  3GTP H;  5I6Y A;  3K59 A;  2NVT B;  1LM0 A;  4K5V A;  2E75 C;  1RKN A;  2BA1 A;  1PH6 A;  2Z6K C;  3GO5 A;  2BCO A;  3SK8 A;  3K5M A;  5C4X H;  4HJ9 A;  1VQC A;  4A3J G;  2K14 A;  4A3F G;  3DWQ A;  1VQ6 A;  2WII B;  3CCQ A;  3GTM B;  3ICE A;  4DR2 L;  1IL2 A;  2QF7 A;  3R93 A;  1BCP C;  1G8Z D;  3I91 A;  5EQ0 A;  3UDI A;  2PNH A;  1KXL A;  5GAE C;  3KF8 A;  1TY0 A;  4HIM A;  2DNC A;  3NTH A;  3CME A;  1ASY A;  4NXM L;  2DY8 A;  4L5Q A;  4R4C A;  3H0G G;  3NE5 B;  1X3F A;  4N8X 1;  4OO1 G;  2XRS D;  5H1S E;  2A6H C;  1I94 L;  4GLX A;  2Q2I A;  2NZH A;  2I5H A;  3G71 A;  3GTO H;  4BBR H;  1W2B A;  3A55 A;  4RFB A;  1ENF A;  2XNA C;  3LX0 A;  1DJR D;  1RTO A;  4AQY Q;  3S1Q H;  3N6R A;  2F0J A;  1UE1 A;  3FKI H;  2IL8 A;  3I4M H;  2VQF L;  3NTK A;  1XMQ L;  1VQI A;  3R2I A;  1TWA B;  4GNX C;  1S5C D;  4CDD C;  1I4H A;  4DF7 A;  4ZYS A;  4QJF A;  1O7Z A;  3MHB A;  4JBJ A;  2A19 A;  4MTN A;  3H15 A;  4FXD A;  4FP5 D;  1EZ6 A;  1JC7 A;  3T16 A;  4DR6 Q;  1O80 A;  3PO3 B;  3A54 A;  4Q0F A;  1IKM A;  3F2D A;  5M5W B;  1I50 H;  1LUZ A;  1NE3 A;  2RQX A;  3DWP A;  4AIM A;  3F8T A;  2JA6 G;  1G2T A;  1RDP D;  2I5M X;  4BY1 H;  3A0J A;  2K6A A;  1LTL A;  1C8C A;  3WOF A;  5ELO A;  4K6D A;  2NTS A;  1SJE D;  3A56 A;  4KLK A;  2M2L A;  4HAE A;  1X3G A;  3HOX G;  2A68 C;  2JA7 H;  1EWI A;  2Z6B A;  1VF7 A;  3A7A B;  3J7Z C;  1CT1 D;  4TKO B;  3TP7 A;  2GVB A;  4JI4 L;  4B3M Q;  5GAG C;  1YZ6 A;  1JOO A;  4X64 L;  5FJ8 G;  3G6J B;  1HPC A;  2KQ3 A;  4I7A A;  4R8I A;  4DV0 L;  1K83 H;  2JN4 A;  5IGC A;  2L12 A;  3FRP B;  1CI3 M;  3CCS A;  3S14 B;  2FHT A;  1R9T H;  3MXU A;  1XNQ Q;  2CHB D;  3KLS A;  5IT9 L;  4IUU A;  4L5S A;  5LMU L;  1TT2 A;  5KRU A;  4DNI A;  4RCN A;  1PLF A;  2B63 H;  4DV6 Q;  3IFD A;  1N9W A;  1YI2 A;  1JWM D;  3T4A C;  4K8I A;  1E2W A;  2R92 G;  1S3O A;  3MXG A;  4DR5 L;  4X3K A;  4LAA A;  2R93 B;  4B3S L;  2B2V A;  3GTJ B;  1EL0 A;  1LYL A;  2NVY H;  4PQX A;  1TWA H;  1SE4 A;  2D0O A;  2FIN B;  4C3J H;  4C1N I;  4LF5 Q;  4KD4 A;  2PCF B;  3N52 A;  3HOV B;  4RGO S;  2K75 A;  1WVL A;  1QVF A;  3Q24 A;  5M3F G;  2QGQ A;  4XT1 B;  1BF4 A;  5JEA H;  3GQB A;  3S15 H;  1TWF H;  3EN2 A;  2DUD A;  4ABN A;  1A6X A;  3DMU A;  2C5C A;  2JE6 I;  1CTM A;  4A93 B;  4FNF A;  4YCW A;  2OWO A;  3A5U A;  3CU7 A;  1IYV A;  2F0K A;  3HOU B;  4TVA B;  4KI0 A;  3G6E A;  4ZRZ A;  1LTG D;  2KEE A;  1KTK A;  1KAB A;  2WIN B;  4JV5 Q;  1X3P A;  4XQQ A;  1Q7Y C;  1D1K A;  4IUV A;  2R7Z H;  1A3T A;  1QUQ B;  2UXC L;  4NP5 A;  3CXC A;  1R4Q B;  1O7I A;  4A3I G;  2P5Z X;  1XPR A;  3PSI A;  1HR0 W;  2UXD L;  1U4M A;  4ZKB B;  5AFW A;  1K8O A;  2EYO A;  2AMC B;  3MA2 B;  3R3O A;  3MVV A;  4DUY L;  3PO2 H;  4DNR B;  1JE5 A;  2B2U C;  2PQE A;  3EJI A;  4O1N A;  4YHH L;  3CCJ A;  1QOH A;  2IHF A;  4A3M B;  2JK8 A;  5JEA J;  3BDC A;  3L3O C;  3CQZ H;  5C4Z A;  4A3B G;  1OXV A;  1MSG A;  1QIL A;  4OL7 A;  2F3W A;  1S72 A;  1QE6 A;  2XWB B;  1EUJ A;  4K5X A;  1J5E Q;  2PYK A;  4NKL A;  1PTO B;  1BVS A;  4FXG C;  3RNU A;  5DM7 3;  4WRD A;  4FVM A;  4R4T A;  1VQL A;  1SR3 A;  1S5E D;  2ATW A;  5EKI A;  4EQN A;  5HGQ A;  4LUV A;  3V2T A;  3SK6 A;  3QR8 A;  5EBC A;  5DAU A;  1YJ9 A;  4OWW B;  3S1R B;  5D3I B;  2A69 C;  2RDG A;  4LF6 Q;  4DK0 A;  1YJW A;  2BA0 A;  3JAM E;  1IL8 A;  1BOS A;  3KFU A;  4OXP A;  1MJC A;  2F0U A;  1V1P B;  3AYH B;  5ELC A;  3VR6 A;  2EOT A;  2K5D A;  3KLW A;  3HG9 A;  3H91 A;  2WKD A;  4UAI A;  1C9O A;  3BDO A;  5M3M H;  4JI1 Q;  2I5L X;  1K28 A;  2X6G A;  3PF4 A;  3CHB D;  1PDQ A;  3SHL A;  3MXP A;  1U4P A;  4DV1 L;  2F0W A;  2L0C A;  3OTO L;  2WAQ B;  3M85 A;  1KHI A;  1N34 L;  1IBK L;  3NQI A;  1TWH B;  1FGB D;  1IXR A;  2GVA A;  3H09 A;  4P71 A;  1KDB A;  4JI8 L;  1HNZ L;  3ER0 A;  5A2Q L;  3D4R A;  2WAQ E;  4U68 A;  2L4N A;  2QEJ C;  1AZP A;  1BXT A;  3A7L A;  2V1C C;  4LFA L;  1HZ9 A;  4N8F A;  4IUT A;  4BY7 G;  2O4X A;  4POF A;  4Y7N H;  1NBW A;  1HNX L;  4DGZ A;  4I65 A;  2KCC A;  3RZO B;  4IUP A;  1KRS A;  3OW2 A;  1EOT A;  1QZH A;  2BE5 D;  1AH9 A;  4V19 0;  5C4X G;  2PW5 A;  2UUC L;  1WCM H;  1O7L A;  3I4L A;  4KHP Q;  4JPB W;  2Z8L A;  2IX1 A;  1ENC A;  2MP1 A;  5JJK A;  4R9W A;  3CCE A;  3NXW A;  4F88 A;  4X66 L;  2F3I A;  2JJQ A;  2VUM H;  4KJN A;  1SSO A;  1A3V A;  3EFX D;  2B2W A;  2B8F A;  4JOI A;  4JI2 L;  3BVG A;  4OO1 I;  3KUP A;  1F2M A;  3T1H L;  1HZA A;  5IT9 c;  1EZ8 A;  1G6P A;  3SGI A;  5AJ3 Q;  2AHO B;  2XGT A;  2EY2 A;  3PIP A;  2MNA A;  4HJA A;  1TWC B;  1U0L A;  4EQP A;  1YHQ A;  3HOZ B;  2LXJ A;  3S1R H;  3CP0 A;  1BCP D;  3A74 A;  4BBR G;  2QA4 A;  1K8A C;  4R4Q A;  2A5H A;  3Q0A A;  5E1F A;  2AWO A;  3J7Y W;  3FKI G;  3I4M G;  2RKS A;  2AQ2 B;  2KVM A;  5KND A;  1HFG A;  3K7A H;  5LMN L;  1STH A;  4RAU C;  1YVC A;  1AE3 A;  5CBA E;  5NUC A;  1I3Q H;  2B8G A;  3IL8 A;  4L8J A;  3C3L A;  4JBK A;  1TS2 A;  1PTO C;  1N32 Q;  3DEP A;  2N49 A;  5CBE E;  2SNM A;  5CC4 A;  2QDL A;  4NXN L;  1FGU A;  4P73 A;  5JJL A;  1STE A;  3KDF B;  1KDA A;  3RN5 A;  4BXX H;  3D4W A;  1EY0 A;  1TWH H;  2V4D A;  4KN7 C;  3TZD A;  2A8V A;  1HHV A;  1RTN A;  2HDL A;  2E8G A;  2MJ8 A;  3UDF A;  1Q86 C;  2HQE A;  3J7A 5;  1LTB D;  2EYJ A;  1BR9 A;  1L1O A;  3BDL A;  1ICW A;  4LF8 L;  3HP3 A;  4N9P A;  1JOQ A;  2CWA A;  4LF9 L;  1SBB B;  4K2K A;  2KOL A;  5JPN C;  1QVG A;  2O5I C;  5GAD C;  1GKH A;  2Y0S G;  1GUW A;  5FKA C;  3V96 A;  4B3R L;  3CPW A;  1K8M A;  2JA7 G;  3QWN A;  3NUC A;  4JI5 L;  4P75 A;  2F0F A;  3X3N A;  2L15 A;  1MJE A;  2WAC A;  2G9D A;  2VS1 A;  3HOW B;  5HY6 A;  4HED A;  3K7U C;  5COY A;  2BH2 A;  3MEF A;  3HKZ G;  3NBH B;  4GS3 A;  3STB C;  1IKL A;  1K0R A;  3IFT A;  4OHJ A;  3ERO A;  1W6K A;  3GTG B;  3UE1 A;  4YIJ A;  1EQV A;  2HD3 A;  3UDX A;  5FOB B;  5KNC A;  3PCO B;  2AQ1 B;  4B08 A;  1N33 L;  5JVG 3;  2SNS A;  2UUB L;  4K5W A;  3TN2 A;  4ME3 A;  3M4O H;  5EPJ A;  3KF6 A;  1XX8 A;  3HGB A;  2RA4 A;  3HOY H;  3GV6 A;  2L11 A;  3NEM A;  1Y1W B;  2OF1 A;  2LSS A;  1U4R A;  1TWC H;  3AU7 A;  1AFP A;  3K57 A;  2B63 G;  2HUG A;  1SND A;  4A3D H;  5C6A A;  3CAM A;  4GKK L;  4HTH A;  4A3E G;  2KA7 A;  2NTT A;  4GOP A;  5EAY A;  4C3I B;  5KNB A;  4WFN 3;  3D3R A;  2UU9 L;  2ZM6 Q;  4RA8 A;  1SFO H;  2XRQ D;  1I4X A;  1BDO A;  3M7G A;  3PF5 A;  1OO9 B;  1VF5 C;  4C3J G;  3SE0 A;  1D6E C;  3AFP A;  4CJ0 B;  3I4N H;  4UDU C;  3WOE A;  3I7F A;  1B2T A;  3L7Z C;  4EVO A;  2EYF A;  5JEA G;  1UUP A;  2RDF A;  4GNX B;  4HIK A;  3HEJ A;  3U4Z A;  4JI6 Q;  1TKW B;  1CQV A;  1UE5 A;  4Z9C B;  1E1O A;  2HT1 A;  1LTA D;  3ZYY X;  4QUC A;  1K9M C;  2N3S A;  5BR8 L;  1X55 A;  2KCM A;  2K28 A;  3OSO A;  2MHV A;  2RVL A;  1HZB A;  1HUM A;  4XYQ A;  3LWU A;  3D0F A;  2RCN A;  4NB3 A;  2PQA A;  1KL9 A;  2K04 A;  1IW7 C;  1TU2 B;  2R7Z G;  3S1N B;  4KKT A;  4RGN A;  2PI2 E;  1UWV A;  3D6C A;  5BN5 A;  2PW7 A;  1EOV A;  3HOW H;  4JI7 L;  2NB0 A;  5J1Z A;  3BG3 A;  1FR3 A;  2PNR C;  3A8J E;  4QCL A;  1D1I A;  1SE3 A;  3PO2 G;  2E76 C;  4NW2 A;  1PZI D;  3F2U A;  4HSV A;  5ELN A;  4X62 L;  4KJO A;  2X69 A;  3OMG A;  4DV3 L;  1STG A;  1PH9 A;  2EXD A;  1FL0 A;  1ML0 D;  3GDE A;  4KY5 A;  1DCZ A;  2JXM B;  1B50 A;  1H9J A;  3OWF A;  3C1F A;  1UEB A;  1Y1V H;  3EIV A;  4QL5 A;  1IBL Q;  3M7N A;  1DON A;  1VQG A;  3AMU A;  2OQ0 A;  1NR2 A;  3I8Z A;  4A3K H;  2JSO A;  1BCP F;  3V05 A;  3CMA A;  3VR4 A;  1T9H A;  1DOK A;  3ULP A;  2E2J B;  2E2D C;  3RLF A;  5KYL A;  1J8I A;  2VW9 A;  3S2D H;  4HMI A;  3J81 i;  4Q5V A;  1KNE A;  1HUN A;  4ME5 A;  5ISR A;  1LT4 D;  2F0E A;  2K32 A;  5ELF A;  5DM6 3;  5KEE A;  4YY3 Q;  4JYA L;  3BZK A;  2MGS A;  4OIJ A;  4IFD I;  2WB1 B;  3BVZ A;  1AN8 A;  3T53 B;  4A3G H;  4PV1 C;  2HIX A;  4A75 A;  5FO9 B;  1UE7 A;  4OIK A;  1MIU A; 
#chains in the Genus database with same CATH homology
 2R61 A;  1HRJ A;  2Z4I A;  5FO7 B;  1ONL A;  4XDX A;  3OHX C;  2NN6 H;  3K5L A;  5CV8 A;  3PIP 3;  4PMW A;  1AZQ A;  1LAC A;  1STN A;  1ROD A;  1W6J A;  4DAP A;  1GHJ A;  1H9K A;  3OIP A;  1EU3 A;  4K8J A;  1Z6H A;  1HXY D;  1MI2 A;  1NAP A;  1EIG A;  1QCB D;  2B2Y A;  4HCE A;  1TWG B;  3BVM A;  2JA5 B;  2ENB A;  1U4L A;  3KLS X;  3I3C A;  5C44 B;  2E2I B;  3CKI B;  5IT9 E;  4H0L C;  4C1N K;  2HDM A;  4X3T A;  5C5L A;  3CRK C;  2VNU D;  3KK7 A;  1LT6 D;  1Q8I A;  5C4J B;  2KEC A;  3SR1 A;  2Q8R E;  2A6E D;  5FK9 C;  1BNZ A;  4IQZ A;  1QNU A;  4KKS A;  1WTQ A;  1GUT A;  1PFB A;  2BDO A;  2YU9 B;  2JP1 A;  2X6L A;  4KY7 A;  1MD2 D;  1GUN A;  4PMB A;  2EJF C;  2XSC A;  2CW0 D;  4KHV A;  5CV7 A;  1PRT B;  4K6L A;  4P2C B;  1SYD A;  2H1E A;  4XQJ A;  5M5Y B;  3KBX A;  3DUZ A;  1EY8 A;  2E2H B;  1CHQ D;  4G7O C;  1ESF A;  1SMY C;  5EPL A;  5JPM C;  2FJ2 A;  5LL6 X;  3K58 A;  3SXH A;  5I9P A;  5J22 A;  1CZG A;  3I73 A;  5CV9 A;  3I72 A;  5CMD A;  3QOJ A;  3LNN A;  1SYB A;  3S17 B;  2K1B A;  1S4Z A;  4CBV A;  2J7Z A;  1Q90 A;  1RCV D;  1ZYR C;  1SNM A;  1I6H B;  5C3E B;  3DXJ C;  3E0J A;  5HUR A;  1PTO D;  2XWJ B;  2JA8 B;  1SNP A;  4DXG A;  3K6O A;  4MHE A;  2B2T C;  5HGT A;  4BBS B;  4MN3 A;  1T5X D;  2K33 A;  4ID6 A;  3P75 A;  3K5O A;  2IX0 A;  2ICE C;  2F0I A;  3NP8 A;  2WKC A;  3CRL C;  1CHP D;  4ODG A;  2EXZ A;  1LT5 D;  3MXN A;  1HCZ A;  2RBM A;  2EYL A;  5CV5 A;  3MAQ A;  4CJ1 B;  5J39 A;  1Z47 A;  4A3J B;  4A3F B;  2LY7 A;  2LFN A;  4JK1 C;  1WTP A;  1ILQ A;  3I90 A;  2EE1 A;  2EPB A;  3NBI A;  1TS4 A;  1L0X B;  3VYS A;  1X32 A;  3H0G B;  3DEO A;  1TII D;  1H9M A;  5IGE A;  5G3L D;  4H7B A;  1WD1 A;  1BO0 A;  2I07 B;  3K0Y A;  3RD4 A;  3MEH A;  3U9O A;  3M4Y A;  2IPK D;  5A2Q E;  2PMZ B;  4QF4 A;  2N55 A;  4FF3 A;  2HCI A;  1ESR A;  3MTS A;  2NWG A;  1JR0 D;  1PRT C;  1PYW D;  1SNO A;  4NMZ A;  5CGK A;  1WTX A;  1NSN S;  5COR A;  1B4O A;  1OXS C;  1YNJ C;  4DXF A;  4KN4 C;  5TSS A;  2DNE A;  5C0X H;  1HA5 A;  1DZ1 A;  4RHS A;  1PXU A;  1EY4 A;  1B53 A;  4G7Z C;  5D65 A;  4TRD A;  3M3Y B;  1IYU A;  5DNF A;  5BN4 A;  2JA6 B;  4HCS A;  4G57 A;  1CFM A;  3I70 A;  3R2T A;  1IW7 D;  3X3M A;  4F87 A;  4BA1 I;  3LWE A;  4J8Q A;  3HOX B;  2BOS A;  5D14 A;  3OPO A;  3WDN A;  1HA6 A;  3VA5 A;  1MBY A;  1YNN C;  4B9X A;  4H44 C;  4RKB A;  2K5W A;  2N88 A;  3TSS A;  1B1Z A;  1EQT A;  4HMJ A;  1GHK A;  5C0X J;  4ZK9 B;  1VMC A;  3H3V C;  5M5X B;  3PUZ A;  4ZKC B;  2RDH A;  4RWS C;  5K5P A;  1V8Q A;  4F8M A;  1II3 A;  2D5D A;  4X3S A;  2FMM A;  1F9S A;  3U9S A;  4TQU S;  3MC0 B;  1BQQ T;  5LHY 1;  5EJW A;  3FVQ A;  1J9O A;  5C4H A;  3S1M B;  2R92 B;  3GTQ B;  2OT2 A;  3NHH A;  4XYO A;  2NN6 G;  3GTL B;  1PTO H;  1LO5 D;  5KIX A;  1HQM C;  1PTO F;  2EYP A;  3S9W A;  2VB3 X;  2AWN A;  3J80 L;  3QG1 A;  2B2V C;  4L63 B;  5M3F B;  3ITP A;  1JWS D;  2JEA I;  3NPP A;  1F2Z A;  1SAP A;  4IUR A;  2XIW A;  2GA4 B;  2IT1 A;  4QMG A;  3MWY W;  2A6H D;  3P20 A;  1E2Z A;  3J81 L;  5IOD A;  1FYC A;  4RGT A;  1WTR A;  4GZY C;  4A3I B;  3FMC A;  2XVS A;  1GOZ A;  1D5M C;  5JJZ A;  2KUM A;  3NBH A;  3NWT A;  1CA6 A;  2K01 A;  1SNC A;  2NUC A;  5EKK A;  1H9S B;  1I4R A;  4A3B B;  3DHQ A;  3TP8 A;  4XT3 B;  1MGS A;  5CYU A;  2PZW A;  5G3L F;  4CKB A;  4C3H B;  2OXP A;  4V0B A;  1DD2 A;  4HN7 A;  4DAY A;  1EIH A;  2KCN A;  5FLX L;  3DM1 A;  2F0N A;  3T13 A;  1OXT A;  3J7A F;  1LAB A;  1TR5 A;  1SXT A;  4LMQ D;  1NR4 A;  1GUS A;  1PFN A;  4J1M A;  5BN3 A;  4LK1 C;  2A68 D;  3D6W A;  1RHP A;  2F0H A;  3NWS A;  1V1O A;  1KNA A;  3TBI B;  3TZU A;  2C9O A;  1LLR D;  2QKI C;  4DAV A;  4FF4 A;  1RJT A;  4PNY A;  2WV6 D;  2F0Q A;  2F0P A;  4ZUJ A;  2D62 A;  3RMH A;  2O2L D;  3ND8 A;  2E74 C;  2EYM A;  5I6W A;  4LJZ C;  2R3Z A;  3DWA A;  4KKU A;  2BDN A;  1ZYR D;  1LTR D;  2JYO A;  3NTI A;  4J6H A;  1CZW A;  3W2D A;  1U9R A;  2F0D A;  2DY7 A;  5I9O A;  5CV4 A;  1AP0 A;  4K2L A;  4BY7 B;  1TY2 A;  1RD9 D;  3GTP B;  4EGV A;  2L9H A;  5C4X B;  1LV9 A;  5LL6 S;  5T1G A;  3E5S A;  1F2L A;  2IJ0 A;  1V43 A;  4IAL A;  3EVQ A;  2EDG A;  1QWY A;  5IIF A;  1DYQ A;  2M9V A;  3E6Z X;  3PMF A;  2NZ1 D;  2B2W C;  3EA6 A;  1DXM A;  1XYI A;  4NDX A;  3S1Q B;  1Y8N B;  5E4X A;  3FKI B;  3I4M B;  5EBD A;  1A3U A;  2K03 A;  5IGD A;  4IFD H;  4I7Z C;  2KED A;  2SDF A;  3SEB A;  2XN9 C;  4M1U B;  3BYY B;  1EYA A;  2VXW A;  3A8K E;  1PZJ D;  1DOM A;  2QIL A;  3BS1 A;  4IZ8 A;  2F0T A;  5D3D A;  5C0X G;  1LT3 D;  4FXK C;  1Y8O B;  3PIO 3;  1E0B A;  3HS0 C;  1PRT D;  2CVR A;  2F0S A;  3VR5 A;  3IKJ A;  2BE5 C;  1ZEQ X;  2YYZ A;  1VMP A;  1L0Y B;  5I2Y A;  1WTO A;  2TMP A;  1XXG A;  2A69 D;  3VYU A;  2Y0S B;  4QUF A;  3OMC A;  2J0T D;  2JA7 B;  1SEB D;  1HFN A;  4IFD J;  1I4Q A;  3KLR A;  1B9M A;  1T5E A;  4H13 C;  1LTT D;  1JOR A;  3HKZ B;  4R8N A;  1CM9 A;  1PFM A;  1Z7T A;  2KHS A;  1KAA A;  1UNS A;  1PMR A;  1DM0 B;  4OGQ C;  1K83 B;  2B2U A;  1EU4 A;  4FF1 A;  3VYR A;  1TQO A;  5I2X A;  1R9T B;  4KK7 A;  4FF2 A;  1YNN D;  3SK5 A;  2F0V A;  2B63 B;  5CV6 A;  1I6V C;  3PV0 A;  2NN6 I;  3P1H A;  4A3E B;  3TME A;  4WOR A;  3FPU B;  2MPM A;  4HSP A;  2F0O A;  4N9T A;  2NVY B;  4RCO A;  4C3J B;  3NQT A;  1E2V A;  5KYI A;  2D2C C;  1LTI D;  2F4I A;  3EQL C;  2PZU A;  3NSW A;  1CQF A;  1A2T A;  2F0L A;  5ELD A;  1JQY D;  1EY5 A;  3S15 B;  1SJH D;  1TWF B;  4EQO A;  3PUY A;  1D5X C;  5IGB A;  3ND9 A;  5IOC A;  1TS3 A;  3TP6 A;  5DEH A;  4RGM A;  4KD3 A;  5T1I A;  2R7Z B;  4DU9 A;  4C56 C;  1G91 A;  2F1M A;  3R8B A;  3MZ5 A;  1AEX A;  2Q8I B;  3PO2 B;  2G9H D;  3RUZ A;  4ILW A;  1HTL D;  1A15 A;  3HRZ C;  1HQR D;  3CQZ B;  4DK1 A;  4CKE A;  1ET6 A;  3HZX A;  3L9A X;  2NVX B;  4RHR A;  4QB4 A;  1QB5 D;  4ZQ3 A;  2RSO A;  1TS5 A;  4G4K A;  1NUC A;  2QDB A;  2F03 A;  1JB3 A;  1SE2 A;  4KTA A;  4FO2 A;  2Z4H A;  4XQN A;  4ZLT F;  1STY A;  1EWC A;  1B3A A;  3MFG A;  2Z1C A;  1QG7 A;  1ET9 A;  1UEA B;  3FDT A;  1Y8P B;  5M3M B;  1PRT F;  1JWU D;  1JOK A;  1Q12 A;  1XWE A;  2EY1 A;  2EVB A;  4AYB B;  5CR3 A;  5K36 H;  1STB A;  1SYF A;  4JBW A;  1SYE A;  1GXD C;  2A73 B;  4K14 A;  1WD0 A;  4Y7N B;  4CGY B;  1SYC A;  2NBF A;  3SVM A;  2IWH A;  1F9Q A;  1I4P A;  1V1P A;  1AW7 A;  1MSH A;  4XTC S;  2B2Y C;  2AUJ D;  3NK9 A;  4HR7 B;  1A2U A;  1WCM B;  3A8I E;  4CHT B;  4IUN A;  3MFY A;  2FMC A;  5C5M A;  2Q8T A;  4DNT B;  1Q1B A;  1CA5 A;  2VUM B;  4C3H G;  2LMC B;  5A35 A;  2A74 C;  2K5Q A;  1D5Z C;  4S3S A;  1NCV A;  2SOB A;  3QJY A;  4KY6 A;  5JAV A;  2PPB C;  4E6I A;  1F77 A;  1S5D D;  5ELE A;  1B44 D;  1I4G A;  3FPP A;  3J80 E;  4ZUI A;  3TDQ A;  4RH6 A;  2OEO A;  4XXE A;  3C2P A;  3W3A A;  1KLU D;  3H94 A;  5IGG A;  1O78 A;  2JEB I;  4DN4 M;  4IFD G;  2EYH A;  1C4Q A;  2MUY A;  3K7A B;  5JVH 3;  2M00 A;  1I3Q B;  5C0X I;  3URY A;  3J81 E;  4C3I G;  5C3W A;  4B9W A;  4DA2 A;  1FNV A;  2J4X A;  1RF2 D;  2ZXR A;  1ILP A;  4CKC A;  3C1E A;  4OO1 H;  3K5N A;  1EEF D;  3IAY A;  1GUO A;  3BZD B;  4XIG S;  2H4O A;  1SDF A;  5ELB A;  1JCK B;  2F0G A;  2LKV A;  1Q1E A;  2AQ3 B;  2A6E C;  2TSS A;  3VA7 A;  2FFK B;  1F9P A;  2SEB D;  2IX3 A;  4U67 3;  2ZT9 C;  2EJM A;  4BWG B;  5FLX E;  1OXU A;  2EY6 A;  2CW0 C;  3OOC A;  1Q3L A;  3JAM L;  1CK1 A;  5EKL A;  3QIA A;  4X3U A;  1G6Z A;  1F9R A;  1G2S A;  3KBG A;  4TSS A;  3M4O B;  4KHZ A;  4M8A A;  2ICI A;  3HOY B;  5F2D A;  1OXX K;  4A3D B;  1H9S A;  3BYT B;  5I4D A;  4DFA A;  4F7X A;  5KGU A;  4ZAI A;  1F2Y A;  3ERQ A;  2VB2 X;  1STA A;  1O7Y A;  1H9R A;  3SK4 A;  1SFO B;  1EYD A;  2ZXP A;  3TP5 A;  2K05 A;  3PUX A;  1KDC A;  1R4P B;  1S5B D;  1SNQ A;  5C3X A;  3I4N B;  4KV6 A;  3T51 B;  1DOL A;  2O5J C;  1S5F D;  2WP8 J;  3S2H B;  1FNW A;  5FO8 B;  1PZK D;  2PZT A;  3T56 B;  5JOB A;  1GUG A;  4O42 A;  1VDZ A;  4CJ2 C;  2D9U A;  1BUV T;  2B39 A;  3VYT A;  1LTS D;  3PUW A;  2EJG C;  1QJO A;  3Q22 A;  1KLG D;  2ID0 A;  5EPK A;  1XTC D;  2R6G A;  3GD7 A;  1Y69 U;  2RSN A;  3C46 A;  1ZXT A;  1VCI A;  1EY6 A;  1SMY D;  3OIQ A;  4RKL A;  1FNU A;  3VR3 A;  2I46 A;  2K7V A;  4MIU A;  4IN3 A;  3SDZ A;  2L1B A;  1ENA A;  3G7L A;  4KMU C;  3Q23 A;  1Y1V B;  1JIC A;  3D31 A;  1BCP B;  3OW7 A;  4A3K B;  4ULL A;  4QIW B;  3QOL A;  4WJW A;  2QCP X;  3S2D B;  1ZKO A;  5E4W C;  1WTV A;  4A3G B;  4BS9 A;  3AB9 A;  1GJX A;  3GP7 A;  3PUV A;  2CQA A;  1BBX C;  2F0M A;  3GTK B;  3J7A V;  4C2M B;  2IW3 A;  3RZD B;  1EWH A;  2AUK A;  4BA2 I;  3O13 A;  1D2B A;  3VR2 A;  5K36 G;  3OWE B;  1HTP A;  1IHZ A;  2ZXO A;  1SYG A;  2F3V A;  3GTO B;  2NVQ B;  5EGT A;  3UI2 A;  2L55 A;  4BBR B;  2LS0 1;  5M9O A;  4G7H C;  1G29 1;  4IUQ A;  2EY5 A;  1M4V A;  3Q6S A;  1B9N A;  1EFI D;  2B2T A;  1EEI D;  2PO4 A;  5IGF A;  1M8A A;  1X3Q A;  2NYZ D;  1UAP A;  3S16 B;  1FD7 D;  3QB3 A;  2DN8 A;  1WTW A;  5E3F A;  3FEW X;  2EZV A;  4FYD A;  2KJX A;  3ONA B;  2L5T A;  1I50 B;  3GV3 A;  2HCC A;  1QNK A;  3D4D A;  1EYC A;  1C48 A;  4PMC A;  3P7J A;  4BY1 B;  1TVX A;  1YNJ D;  4L6T B;  3QO2 A;  1EY9 A;  1EY7 A;  3D8G A;  1JE4 A;  3H6M A;  5I6Y A;  3K59 A;  2NVT B;  4K5V A;  2E75 C;  1RKN A;  2BA1 A;  3GO5 A;  3SK8 A;  2BCO A;  3K5M A;  3DWQ A;  2WII B;  3GTM B;  2QF7 A;  3R93 A;  1BCP C;  1G8Z D;  3I91 A;  5EQ0 A;  3KF8 A;  1TY0 A;  2DNC A;  3NTH A;  2DY8 A;  3NE5 B;  4OO1 G;  2XRS D;  2A6H C;  3A55 A;  4RFB A;  1ENF A;  2XNA C;  3LX0 A;  1DJR D;  1RTO A;  3N6R A;  2F0J A;  2IL8 A;  3NTK A;  3R2I A;  1TWA B;  1S5C D;  1I4H A;  4DF7 A;  4ZYS A;  1O7Z A;  3MHB A;  4FXD A;  4FP5 D;  1EZ6 A;  1JC7 A;  3T16 A;  1O80 A;  3PO3 B;  3A54 A;  4Q0F A;  1IKM A;  5M5W B;  2RQX A;  3DWP A;  1G2T A;  1RDP D;  2K6A A;  1C8C A;  3WOF A;  4K6D A;  2NTS A;  1SJE D;  3A56 A;  2M2L A;  4HAE A;  2A68 C;  1VF7 A;  3A7A B;  1CT1 D;  4TKO B;  3TP7 A;  1JOO A;  3G6J B;  1HPC A;  2KQ3 A;  4R8I A;  5IGC A;  2L12 A;  3FRP B;  1CI3 M;  3S14 B;  2FHT A;  3MXU A;  2CHB D;  3KLS A;  5IT9 L;  4IUU A;  1TT2 A;  5KRU A;  4RCN A;  1PLF A;  3IFD A;  1JWM D;  3T4A C;  4K8I A;  1E2W A;  3MXG A;  4X3K A;  4LAA A;  2R93 B;  2B2V A;  3GTJ B;  1EL0 A;  4PQX A;  1SE4 A;  2FIN B;  4C1N I;  4KD4 A;  2PCF B;  3N52 A;  3HOV B;  4RGO S;  1WVL A;  3Q24 A;  4XT1 B;  1BF4 A;  5JEA H;  3GQB A;  4ABN A;  1A6X A;  3DMU A;  2C5C A;  2JE6 I;  1CTM A;  4A93 B;  4FNF A;  3CU7 A;  1IYV A;  2F0K A;  3HOU B;  4KI0 A;  4ZRZ A;  1LTG D;  2KEE A;  1KTK A;  1KAB A;  2WIN B;  1X3P A;  4XQQ A;  1D1K A;  4IUV A;  1A3T A;  4NP5 A;  1R4Q B;  1U4M A;  4ZKB B;  5AFW A;  1K8O A;  2EYO A;  3MA2 B;  3R3O A;  3MVV A;  4DNR B;  2B2U C;  2PQE A;  3EJI A;  4O1N A;  1QOH A;  4A3M B;  5JEA J;  3BDC A;  3L3O C;  5C4Z A;  1OXV A;  1MSG A;  1QIL A;  4OL7 A;  2F3W A;  1QE6 A;  2XWB B;  4K5X A;  2PYK A;  4NKL A;  1PTO B;  4FXG C;  5DM7 3;  4WRD A;  4FVM A;  1S5E D;  5EKI A;  4EQN A;  3V2T A;  3SK6 A;  5EBC A;  5DAU A;  3S1R B;  5D3I B;  2A69 C;  2RDG A;  4DK0 A;  2BA0 A;  3JAM E;  1IL8 A;  1BOS A;  2F0U A;  1V1P B;  5ELC A;  3VR6 A;  2EOT A;  2K5D A;  3HG9 A;  3H91 A;  2WKD A;  4UAI A;  3BDO A;  2X6G A;  3CHB D;  1PDQ A;  3SHL A;  3MXP A;  1U4P A;  2F0W A;  2L0C A;  3M85 A;  2WAQ B;  3S1N B;  3NQI A;  1TWH B;  1FGB D;  3H09 A;  1KDB A;  5A2Q L;  3D4R A;  4U68 A;  2L4N A;  2QEJ C;  1AZP A;  1BXT A;  3A7L A;  4IUT A;  2O4X A;  4DGZ A;  4I65 A;  2KCC A;  3RZO B;  4IUP A;  1EOT A;  2BE5 D;  4V19 0;  2PW5 A;  1O7L A;  3I4L A;  2IX1 A;  2Z8L A;  1ENC A;  2MP1 A;  4R9W A;  3NXW A;  4F88 A;  4KJN A;  1SSO A;  1A3V A;  3EFX D;  2B2W A;  2B8F A;  4OO1 I;  3BVG A;  3KUP A;  1F2M A;  1EZ8 A;  2EY2 A;  3HOZ B;  1TWC B;  4EQP A;  1BCP D;  2A5H A;  3Q0A A;  5E1F A;  2AWO A;  3J7Y W;  2RKS A;  2AQ2 B;  2KVM A;  5KND A;  1HFG A;  1STH A;  4RAU C;  5CBA E;  5NUC A;  2B8G A;  3IL8 A;  4L8J A;  3C3L A;  1TS2 A;  1PTO C;  3DEP A;  5CBE E;  2SNM A;  5CC4 A;  1STE A;  1KDA A;  3D4W A;  1EY0 A;  2V4D A;  4KN7 C;  3TZD A;  1HHV A;  1RTN A;  2HDL A;  2MJ8 A;  2HQE A;  1LTB D;  2EYJ A;  1BR9 A;  3BDL A;  1ICW A;  3HP3 A;  4N9P A;  1JOQ A;  1SBB B;  4K2K A;  2KOL A;  5JPN C;  2O5I C;  1GUW A;  5FKA C;  3V96 A;  1K8M A;  3QWN A;  3NUC A;  2F0F A;  3X3N A;  2WAC A;  2G9D A;  3HOW B;  4HED A;  5COY A;  1IKL A;  3IFT A;  4OHJ A;  3ERO A;  1W6K A;  3GTG B;  4YIJ A;  1EQV A;  5FOB B;  5KNC A;  2AQ1 B;  4B08 A;  5JVG 3;  2SNS A;  4K5W A;  3TN2 A;  5EPJ A;  1XX8 A;  3HGB A;  2RA4 A;  3GV6 A;  2L11 A;  1Y1W B;  2OF1 A;  1U4R A;  3AU7 A;  1AFP A;  3K57 A;  2HUG A;  1SND A;  5C6A A;  4HTH A;  2KA7 A;  2NTT A;  4C3I B;  5KNB A;  4WFN 3;  3D3R A;  4RA8 A;  2XRQ D;  1I4X A;  1BDO A;  3M7G A;  1OO9 B;  1VF5 C;  4C3J G;  3SE0 A;  1D6E C;  4CJ0 B;  4UDU C;  3WOE A;  1B2T A;  3L7Z C;  4EVO A;  2EYF A;  5JEA G;  1UUP A;  2RDF A;  3HEJ A;  1TKW B;  1CQV A;  4Z9C B;  1LTA D;  3ZYY X;  4QUC A;  2K28 A;  3OSO A;  2MHV A;  2RVL A;  1HUM A;  4XYQ A;  3LWU A;  2K04 A;  1IW7 C;  1TU2 B;  4KKT A;  4RGN A;  3D6C A;  5BN5 A;  2PW7 A;  2NB0 A;  5J1Z A;  3BG3 A;  1FR3 A;  2PNR C;  3A8J E;  4QCL A;  1D1I A;  1SE3 A;  2E76 C;  4NW2 A;  1PZI D;  3F2U A;  4HSV A;  4KJO A;  2X69 A;  3OMG A;  1STG A;  1ML0 D;  4KY5 A;  1DCZ A;  2JXM B;  1B50 A;  1H9J A;  3OWF A;  3C1F A;  3M7N A;  1DON A;  3AMU A;  3I8Z A;  1NR2 A;  2JSO A;  1BCP F;  3V05 A;  3VR4 A;  1DOK A;  2E2J B;  2E2D C;  3RLF A;  5KYL A;  1J8I A;  4HMI A;  4Q5V A;  1KNE A;  1HUN A;  4ME5 A;  5ISR A;  5ELF A;  1LT4 D;  2F0E A;  2K32 A;  5DM6 3;  5KEE A;  2MGS A;  4OIJ A;  4IFD I;  2WB1 B;  3BVZ A;  1AN8 A;  3T53 B;  4PV1 C;  5FO9 B;  4OIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...