1AZPA

Hyperthermophile chromosomal protein sac7d bound with kinked dna duplex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*GP*CP*GP*AP*TP*CP*GP*C)-3')
publication title The hyperthermophile chromosomal protein Sac7d sharply kinks DNA.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1997-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1azpA00
5D14A 5E4WC 3G7LA 1AP0A 1HUNA 3GV6A 4RWSC 4IUQA 5COYA 5EJWA 3FDTA 2Q8TA 1O7ZA 2RSNA 3GV3A 3QO2A 2KVMA 2KEDA 4MHEA 1F9PA 1PFBA 2B2VA 3DEOA 1NCVA 1O7YA 1B53A 1BF4A 1CM9A 2KEEA 2L11A 2MPMA 4U68A 2FFKB 3I3CA 4IURA 4XT1B 2K1BA 5D65A 1MI2A 2X6GA 1MSHA 2HDMA 4HAEA 1GUWA 3SVMA 3IFDA 4LMQD 1KNEA 1BO0A 1RODA 5CORA 2MJ8A 1ILPA 2KECA 2K05A 2HCCA 1M8AA 1B4OA 1HFGA 1VMCA 1PDQA 4NW2A 2B2TA 3HP3A 1IKMA 1WTPA 2B2VC 1QE6A 2D9UA 1IL8A 1EIGA 2IL8A 2K28A 2KUMA 2NWGA 3D6WA 3LWEA 3Q6SA 4RAUC 2M2LA 1G91A 2B2UA 2FINB 1F9RA 1LV9A 1X3PA 1BBXC 2N88A 3UI2A 1WD1A 1VMPA 2J7ZA 1A15A 1XX8A 2L1BA 1KNAA 3I90A 4HCSA 2NZ1D 1PFMA 1PLFA 3F2UA 2N55A 3N52A 1F9SA 4MN3A 3MTSA 5E4XA 5T1GA 1O80A 2MP1A 1MGSA 1WTWA 2B2TC 4CJ1B 1HUMA 1EQTA 4X3SA 5CMDA 1Q3LA 2SDFA 4RA8A 1EL0A 5EQ0A 2JYOA 4UAIA 5EKIA 2B2UC 3H91A 1ILQA 1E0BA 1ML0D 1WVLA 1WTVA 1DOKA 1DOMA 2B2YA 4CJ0B 1AZPA 1RTOA 2DY7A 4X3TA 4X3UA 4R8IA 2EOTA 4ZK9B 2B2WA 1G6ZA 4IUVA 4R9WA 1J8IA 1F9QA 1JE4A 2K01A 1WD0A 2Q8RE 1DONA 3R93A 3DM1A 1SSOA 2RVLA 4CJ2C 1U4MA 5DNFA 5AFWA 1C8CA 4ZLTF 1HHVA 2VXWA 3DEPA 4ZKBB 2DY8A 4HEDA 1QG7A 1ESRA 3IL8A 1NR2A 2L12A 1ICWA 4IUTA 4OIKA 1WTQA 2BDNA 1WTRA 1HA6A 1U4LA 1QNKA 1SDFA 2R3ZA 4OIJA 1XYIA 1B2TA 2FHTA 1U4RA 5CBEE 1F2LA 3I91A 2B2WC 1B3AA 1J9OA 3KBXA 2HCIA 1DZ1A 4QUFA 2K04A 4ZAIA 1SAPA 1CA6A 2CVRA 1X3QA 2HDLA 1RJTA 1RHPA 1X32A 1EOTA 1G2SA 2FMMA 3ONAB 1B50A 4IUPA 1S4ZA 1TVXA 3MWYW 1DOLA 1BNZA 1HRJA 3FPUB 1G2TA 2EPBA 4ZKCB 2EE1A 2MGSA 2JP1A 5EPKA 1WTOA 1RTNA 3KUPA 2L4NA 2X6LA 5CBAE 1U4PA 2X69A 1MSGA 2K03A 1PFNA 5T1IA 1ZXTA 2HUGA 1JICA 2RSOA 4DN4M 1IKLA 5EPJA 4XDXA 1AZQA 4XT3B 2L9HA 1NAPA 4IUUA 5EPLA 4HSVA 2B2YC 1NR4A 2NYZD 3TN2A 3TZDA 2RA4A 1EIHA 3P7JA 2FJ2A 2H1EA 4QUCA 4X3KA 1WTXA 2KOLA 5JJZA 1CA5A 1HFNA 3I8ZA 2XIWA 4O42A
chains in the Genus database with same CATH superfamily
4DAPA 5IYCG 4K8IA 3K7AB 1I4GA 1BVSA 1WOCA 1Y1VH 2Z6KA 3N6RA 4IZ8A 4QF4A 1FYCA 2ZTDA 2ZXPA 2B2VA 1NCVA 5HY6A 1Q1BA 2BDOA 2E2HB 2EVBA 4A3IG 4A93G 2RHSB 2EYFA 3U9SA 4LF7L 3E6ZX 1EFWA 1I4PA 3NPPA 3I4MG 3SK8A 3CQZH 1DM0B 3GTLB 2B63H 2Z8LA 1JB3A 1B1ZA 4K2LA 1YBYA 1B9NA 3EBEA 2MHVA 4DUZL 1AW7A 2VUMH 3UI2A 2IPKD 3W1BA 2YTYA 4JBWA 2VB2X 1AEXA 2Y0SE 5C4XH 3I90A 5JJIA 1EQQA 2XWBB 1O80A 4DNTB 4DV7Q 3RZDH 3HG9A 1K3RA 3W3AA 4KD4A 1PH2A 5CMDA 2WINB 4NXMQ 5CC4A 3E9IA 5EKIA 1B9MA 4CDCC 4DUYQ 3K5OA 5GQOA 3UDIA 4GOPA 1WTVA 4YWLA 4NMZA 2EOTA 3MXPA 5GAHC 3O13A 4GN5A 1WI5A 1JE4A 2F4VQ 4YHHL 4CJ2C 1ZEQX 1D1KA 3CCEA 4UPAA 4JV5Q 3KJOA 4ME5A 1JORA 1HZAA 1U4LA 1KL9A 1U4RA 1J9OA 5IGGA 1SAPA 5AJ3L 3NBHB 4JOIA 4LJZC 4J8QA 4V0BA 1SR3A 3G48A 2CKZB 2JA7H 4K5VA 2PYKA 3K5NA 1EYDA 2I5LX 2K03A 1TWGH 2F4IA 1EY7A 1NJIC 5C44G 1N32L 1K8OA 1SYFA 2ES2A 1CZWA 1CQFA 1Q12A 3S1MB 4OL7A 1B7YB 1CHQD 4PMCA 2PI2E 1IBKQ 4L63B 4M1UB 5KEEA 1OXXK 1RF2D 1YNJD 3C1FA 3G7LA 3I73A 4FYDA 3D4RA 5K5PA 2PO4A 1JCKB 1IW7D 4Y7NB 2NZOA 2L11A 3K0YA 3GTGB 1MSHA 3MFGA 4IFDG 1Z47A 3RZOH 1EU3A 2WP8J 2K05A 4F8MA 4A3BG 1ZKOA 3D31A 3CRLC 2B2TA 2AWOA 4JBMA 1QE6A 1TU2B 2D62A 2KUMA 1XXGA 3CKIB 1XNRQ 1VQJA 2ZJPA 1IBLL 3SK5A 2BA1A 3OMCA 1HNXQ 3J7AF 2NVXH 5ELBA 2J7ZA 2EY1A 2EY2A 4H44C 2NZ1D 3SEBA 4KI0A 1JT8A 4KJNA 1WTWA 2N3SA 4CJ1B 3HOVB 2RDHA 1EZ8A 5IYCH 4UAIA 1C48A 3HOYB 3QWNA 4LWCA 2Q2UA 4X3UA 2F0DA 1VQOA 1WD0A 3HOUG 3R93A 2BH2A 5IYDH 3AFQA 4A4IA 3L3OC 3AFPA 4A3IH 2OXPA 3IRBA 4K0KL 4L6TB 3CPWA 1PRTB 4R4CA 3T1HL 3HOWG 3I4MH 4AIMA 1KC8C 2R7DA 4IPCA 5K36H 2K04A 1X32A 2LS01 4YCUA 5IGCA 4HJ8A 2HHHQ 1EY4A 4CKEA 3UDXA 1KIXA 2E2JH 3FPUB 1PH6A 4PZ8A 4X6AH 3A8KE 1C0AA 3LNNA 1QOHA 3HOXH 1NNXA 2EYMA 4BS9A 3TP8A 3ULPA 2F3WA 2VNUD 1XTCD 3RN2A 3LWUA 3QOJA 4XT3B 4AQYQ 4HSVA 4CDFC 1EIHA 2B8GA 1QB5D 3I8ZA 4JI2L 4DU9A 4EQNA 3KJPA 4Z9CB 4BY1H 1EY5A 3VDYA 4Y52H 1IYJB 1H9MA 2JA6G 1EIFA 3BYYB 5FO8B 4LFAL 1B53A 3R2IA 2A6HC 3D6CA 3OHXC 3V2TA 1UEBA 2P5ZX 3FKIG 4HAEA 4DV3Q 1I3QH 2SNSA 3PIPA 2Q2IA 1FGBD 2EIFA 4GOPB 1BO0A 3VA5A 2Y0SG 1STHA 2V4DA 1H9RA 2B8FA 2R92G 2AQ2B 2Z1CA 5CV4A 1QNUA 2IHEA 4XTCS 3DMUA 3HFZB 3RLFA 1HQRD 2F0JA 3PUWA 5C44H 2K32A 1ESFA 3CCQA 4GS3A 3H6MA 1RKNA 1LT5D 3D0FA 4A3MG 1GUSA 4L5RC 4A3KB 1LTGD 4Q5VA 1QJOA 1PV4A 2F0GA 1G6PA 4PMWA 3PGZA 4FXGC 1QZGA 2QEJC 1HTLD 2N49A 4OELB 4DV7L 4P71A 4ZLTF 1J6QA 1YNNC 4CKCA 1FNUA 5FOBB 1QG7A 3RN5A 4IFDH 3H0GG 3GTOB 3OWFA 2R3ZA 1PTOD 4BWGB 2MNAA 5C3WA 2EY6A 2NZHA 3BVGA 3MVVA 2F4VL 1L1OC 2PMZE 2UUAQ 3ICEA 4DGZA 1UWVA 4IUPA 4M8AA 2XRSD 2M9VA 2SNMA 4JV5L 2D2CC 1BNZA 5ELDA 4YIJA 4FF3A 1WTOA 5ELNA 4JI8Q 2VS1A 4BY7B 2GVBA 1E22A 1HNWQ 1AZQA 1A3VA 3S14H 3K5LA 4X64L 4WORA 2FJ2A 1KD1C 3A8JE 4WFN3 3T1YQ 1VQ7A 2ASBA 3HOUH 1BBUA 2MO0A 2B29A 4IALA 5FO9B 4LF6Q 3NTIA 5CV6A 1HUNA 5COYA 1O7ZA 1TR5A 3MEFA 3KOJA 4KMUC 3HOWH 2Q2HA 3L9AX 1O7YA 1IXRA 4OWTB 4TQUS 2RCFA 4PNYA 1IBKL 1CHPD 3F2CA 3LX0A 4RGNA 2EYPA 3GQBA 1FJGQ 1M8AA 1V1PA 2UUCQ 1LUZA 4MZ9A 1IKMA 1WTPA 2PNHA 4RAUC 2LY7A 2E2IB 2D0PA 3TP5A 4XIGS 1F9RA 2R93B 3S24A 1VMPA 4LF8Q 1NBWA 2ICEC 4G7HC 2WB1E 3KBGA 4EGVA 3AEVA 3A7LA 1SYDA 1CKOA 5EQ0A 1XNRL 2LXJA 1B8AA 4WJ4A 2BA0A 1PH5A 4CDEC 1E0BA 1OTCA 5CV8A 1W2BA 1HZBA 1HNXL 5FK9C 2Z0SA 3A5UA 4NPSA 3DXJC 3VR6A 3QJYA 1SE3A 1K8AC 1F9QA 1XWEA 5L37A 3DLLA 2LXKA 2JEAI 4CDDC 1GM5A 2NN6G 3FKIH 1BCPB 1E1TA 4X65L 2AWNA 3IL8A 3PIOA 1ENFA 4JI1Q 1EY6A 2G5DA 1I50H 1GUGA 3CCUA 4B3RQ 5DM63 3KLRA 4DV1L 4LUVA 2EY5A 3TZUA 4DF7A 4QUFA 1XMOL 1Y1WB 3I4OA 3MZ5A 1GO3E 1PHJA 3Q24A 1FVIA 5NUCA 1PYSB 5IP9G 4DV5L 1D6EC 1D2BA 4ZKCB 4DR3Q 1Y1VG 3S1QH 4LF5Q 2NB0A 3RMHA 4JI5Q 3J80i 4A3MH 1I94Q 5IOCA 4Q0FA 3KF8A 1KRSA 2RA4A 1XPOA 1SYBA 3J7AV 2IX0A 4C3JB 4YCWA 1Y8OB 1X9NA 2KHIA 1OXVA 2L55A 3RR5A 5EBDA 4DPGA 3AB9A 1G8ZD 4L5SA 3S15H 3NWTA 3QO2A 4B08A 4A3FB 3H0GH 1YVCA 4ABNA 3PO2B 3CHBD 4JPBW 4U68A 2RQXA 1EUJA 2I0QA 4A3JH 2K5WA 3TDQA 1CKNA 1MKHA 3GTMB 1SLJA 5KNDA 2ZM6Q 1RIPA 1BOSA 3CP0A 1OO9B 2M2LA 4U673 4ME3A 4P72A 5M3FH 1JR0D 1ET9A 4G4KA 4DV3L 3C2PA 5M5XH 3T13A 2QDLA 2R61A 3F2BA 3A56A 4BBRH 2L1BA 4LK1C 5LMNL 5T1GA 4DV6Q 1SYCA 3PMFA 4X3SA 1STAA 2NVYB 1IHZA 4RA8A 5I6YA 3SR1A 1QILA 2B2UC 4EQ5A 3P1HA 1JE5A 2F0FA 5LMUL 3HOVG 1P8LA 1YNJC 1TWCB 3GD7A 3NELA 2RDFA 2AQ3B 3K7AH 4DV0Q 1U4MA 3J7ZC 3HOYG 2EJGC 1IW7C 3PIP3 3OIPA 1B70B 2SEBD 3TMEA 2BOSA 5C4HA 2JA7G 1XYIA 4GZYC 1K28A 2WKCA 1M1KC 2E2HH 1F2LA 1B3AA 2JEBI 2UXBL 1UEAB 4A3EB 4O2DA 1I6HB 3U4VA 4QIWE 1WJJA 1JMCA 2E76C 1G2SA 3VYSA 2WAQB 4WJ3M 1AN8A 1DYQA 1EQRA 1PTOF 1TVXA 5H1SE 4YY3Q 3GTLH 2ZTEA 1HRJA 3E3XA 1WTHA 4R1JA 4OHJA 2MGSA 2JP1A 1Q81C 2HQEA 1Q7YC 1KAWA 2HD3A 1ZXTA 2HUGA 2UUAL 1V1PB 2VW9A 1ASZA 1TS3A 2OQ0A 2MQHA 1DJRD 1SBBB 4GKJQ 4X3KA 3BS1A 1XPRA 4KKUA 1V9PA 1KAAA 4FF1A 4O42A 2PPBC 4JG2A 3M7NA 2Q8IB 4DV2Q 1QZHA 5D3DA 4JI8L 2F0EA 2NN6H 1JWUD 4HN7A 4X66Q 2VL6A 3ERQA 4I65A 1HNWL 3I4LA 1XNQL 3AQQA 2N8NA 2FFKB 3QIAA 3T1YL 2R7ZB 2XRQD 5GADC 1HR0L 4KD3A 2E5LQ 4OO1G 1STEA 2KECA 5C4JB 3MAQA 3MXGA 5JEAJ 5J39A 4JI6L 3CRKC 1PVOA 5IP9H 1BKBA 2WB1G 2A19A 1QVGA 4TSSA 3D6WA 4JI3Q 4UHVA 2FINB 4NXNQ 3F1ZA 4DR1Q 1DCZA 3TRZA 4KK7A 4K6DA 4LAAA 4RH6A 1VQ5A 2L15A 3V96A 4DAVA 1SE4A 5C5MA 3K8AA 5IYDG 1MJEA 1GHKA 1FJGL 3OMGA 4MN3A 4JCVE 2K4KA 2MP1A 3RD4A 5JJLA 3X3MA 3DUZA 1EYAA 3H3VI 4N9PA 1NMGA 3DM3A 1TT2A 3QG1A 3GTKB 3S1MH 3RLOA 3SDZA 1DOKA 4QL5A 1DOMA 4X3TA 5K36G 2AKWB 4A3KG 2F0QA 1L1OA 5DEHA 2K5DA 2F0NA 4EVOA 3S1NB 3KF8B 1ICFB 3ULJA 3KF6A 4B9XA 4Y7NH 3M4OB 4RKLA 3OPOA 4KKTA 1VQ9A 1EIYB 1QNKA 4BXXG 2F0IA 4OXPA 3HOXG 1SNOA 4LF4Q 3GTGH 3I91A 5CR3A 1ZYRD 3KBXA 3MC0B 2HCIA 2QCPX 5E1FA 1JJ2A 4FF4A 1I4RA 5DM73 2RBMA 2ICIA 4KY5A 1JJGA 2KENA 3ONAB 5KGUA 2EYJA 1JJCB 4JI0Q 4DR7Q 4B3RL 4BY1G 3C46A 2NVQB 4KKSA 2X69A 2WKDA 1PFNA 1L0WA 4H7BA 5M5YB 1CKNB 1ENCA 5IT9E 4OX9Q 5IT9L 5C0XI 3H15A 1SNPA 1SNMA 3EN2A 1YJWA 2KOLA 3HOVH 4DR3L 2LMCB 3FEWX 3HKZB 4JW0A 3R8BA 4X62L 3NWSA 4LF5L 1TWAB 3H94A 2WAQE 2JJQA 3KK7A 1R4PB 4L5QA 5IT9c 3VR2A 5EJWA 3HOYH 4JI5L 2Q8TA 1HA5A 3GV3A 1I94L 2H5XA 2BE5D 2C35B 4DV4Q 1PA6A 1G291 2Z4HA 1IYVA 3R3OA 5IP7G 1EQVA 1JQYD 1PTOC 1EY8A 5IIFA 1T5XD 1NY4A 3GP7A 3ER0A 1VMCA 5EAYA 3VA7A 4HIOA 1I4QA 1I4XA 1JOKA 3TP6A 1UNSA 3W5OA 4R4OA 1SEBD 3CC4A 3GDEA 1LV9A 1X3PA 1R9TB 1BBXC 2N88A 3VR3A 4ZUJA 2FMCA 3KLSX 3PO3B 5HGTA 3S17B 1VQHA 1KHIA 3CU7A 4F7XA 2R93G 4HJ5A 2ZM6L 3QR8A 2OEOA 1HZ9A 1HNZL 1IL2A 3T51B 1BUVT 3D4DA 2B2YA 4IPGA 2N78A 2UU9L 1K0SA 3K7UC 1KLUD 4DV6L 1C4QA 1EWHA 5M9OA 3L2PA 4RGMA 1YIJA 3I70A 1K9MC 4ZKBB 5JVH3 2JE6I 4HR7B 1NR2A 4DXGA 4OO1H 1HA6A 1P16A 4DKAC 3B6YA 4OWXB 2GA4B 4XYOA 5FJ8G 2J0TD 2IX3A 2O4XA 1B50A 4GKKQ 1A3UA 1TKWB 1Y1WG 2QA4A 3KYHC 1H9JA 4XQNA 1A2TA 3ND9A 2PW7A 4UY8C 2YTVA 1ENAA 2ENBA 2K5HA 1HH2P 4YY3L 4QUCA 2F0VA 2LKVA 1LTID 3EIVA 5LHY1 5KNBA 1TQOA 4G7ZC 4A3KH 4HMJA 3RLNA 4PG3A 1PZKD 4RCNA 3T53B 1E1OA 1KDCA 1N8RC 3SK4A 1A8VA 2RSNA 5C3EB 3I4NB 4TRDA 4MHEA 3BG3A 1LTLA 1SXTA 2C5CA 4C3JG 2QDBA 4BXXH 4KHPQ 4XT1B 1OXUA 1K8MA 3S2HB 1GUWA 1YJNA 2EQSA 2R6GA 1VQ8A 3GTOH 3SGIA 1KNEA 2K5VA 1EY0A 5GAEC 2HCCA 4TVAB 1ONLA 4X66L 4J6HA 1L1OB 3S16B 3HP3A 4APVA 5C5LA 1PZID 1AE3A 2D0OA 1SE8A 3TBIB 2B2UA 4HJ9A 2OT2A 3KF6B 5FLXE 3CCRA 3IAYA 1HTPA 5FLXL 2E5LL 2K5QA 5BN4A 2AMCB 4IJLA 4B3ML 3PUVA 4DK6C 1TY0A 4O1NA 1W6KA 1LTBD 4KHVA 3BVMA 4BY7H 5FLXc 2QEXA 3HKSA 2VY3A 1JOOA 1CTMA 2MO1A 4DR1L 4IJHA 1KTKA 4EQOA 4B9WA 4IUVA 1ASYA 4KN7C 2IT1A 2K01A 1UE7A 2PZTA 4XQJA 1SSOA 4C2MB 3DHQA 3I2ZA 3URYA 1C8CA 2RF4A 2F3VA 3VYUA 5IP7H 4QY7A 2NTTA 3K59A 1LYLA 2WV6D 1LABA 1SYGA 4BA2I 3AU7A 5D3IB 5IGEA 5CBEE 1GUNA 3FHWA 3NP8A 3WOFA 1MJCA 1FR3A 1NSNS 1VQIA 2CVRA 1RHPA 4YWKA 2KCCA 2A8VA 4P2CB 4CKBA 4A93B 1H9SA 5F2DA 2NVTB 2E2IH 4JC0A 5IGBA 1JWMD 2CQAA 2WAQG 1VQPA 1T9HA 1U4PA 4BBSB 2R93H 4NXML 1W3SA 2A69C 4DUYL 4C56C 1IKLA 2L9HA 1NAPA 2NYZD 3TP7A 1F2ZA 2H1EA 1CA5A 4DR7L 4A3JG 3PUYA 1VQGA 1KXLA 2VQEQ 4POFA 4DA2A 1KABA 1PZJD 3FP9A 4MIUA 2CWAA 1DD2A 1IZ6A 3F8TA 1PYBA 2L5TA 1CM9A 5M3FG 5LL6S 3J81L 5I2XA 3IFDA 4BBRG 5FJ8H 1Y8PB 4A3LH 1GVPA 1ILPA 3EA6A 1W6JA 2QGQA 3Q8DA 3MXNA 2R7ZG 2Z6BA 2AUJD 1Y1WH 1I6VC 2K28A 5E3FA 2VQFQ 1EFID 4ODGA 3L7ZC 4A3GB 3R2TA 1FNVA 1D1IA 1O7LA 1I3QB 1NUCA 1XPUA 3ULLA 3Q0AA 1CA6A 1EWCA 4KTAA 2TSSA 1D5XC 5TSSA 1BXTA 1V43A 4JI7Q 2VB3X 4RKBA 3PV0A 3K58A 2F0PA 4ZK9B 4C3JH 2O5IC 1Y8NB 1H95A 2FXQA 5FLMG 4P73A 4IO9A 1VQLA 2CH4W 5AFWA 5FO7B 1D7QA 4A3FH 3NEMA 4IUTA 4LW1A 4YWMA 5IE8A 3PO2H 1VF7A 3GTQB 1MHWC 2K14A 4XYQA 3AMUA 1Q86C 2K33A 1X3QA 5M5WB 1NTGA 5HGQA 1PH9A 3K57A 4WRDA 3VYRA 3GTMH 2PI2A 4P75A 2F3IA 2HQLA 2A5HA 1G2TA 3HGBA 3K6OA 1RTNA 4JK1C 1S72A 4A3BB 3M85A 4OEMB 4DUZQ 3E0JA 4LUZA 2K7VA 1LTTD 1GJXA 3DWAA 3CPFA 5EPJA 4GKKL 5G3LD 3C3LA 2B2YC 2F0OA 1WTXA 2ALYB 1K0RA 2NVYH 5I6WA 3TEHB 5C0XJ 2F0KA 2JXMB 3Q23A 2EXZA 1SJHD 1UE1A 4CHTB 3HKZG 1TWCH 2UXCQ 2DJGC 4NKLA 5BN3A 5IYBH 2EJMA 4DXFA 1U0LA 3LGJA 4IURA 4YHHQ 5JEAG 3OOCA 2DGYA 2CH4A 2JA8B 1N34Q 3CW2C 1VQ4A 2HHHL 3WWVA 1GKHA 2B39A 4KV6A 2WIIB 2YV5A 1ZYRC 2F1MA 3PCOB 4V190 5IY0A 2XWJB 1AH9A 4A3EH 1K73C 2IL8A 3HOWB 3Q6SA 4KHPL 2EJFC 1KDAA 5AJ3Q 1PH8A 2XTIA 1VQAA 2KQ3A 3M4QA 1AE2A 3KLSA 1A2UA 1WD1A 3OW7A 4J1MA 4AQYL 1HJPA 1RCVD 3F2UA 1PFMA 1B3QA 1YEZA 3MTSA 4IUNA 2F0SA 4PZ7A 1CT1D 3K5MA 1QVFA 3VR5A 3PO3G 3A74A 2K6AA 2F0LA 1H9SB 1WVLA 1N32Q 4MTNA 4LFCQ 3STBD 1G6ZA 1STGA 4R9WA 1TS5A 3JAME 3DM1A 2RCNA 4FF2A 3JAML 2F0UA 2BE5C 1PRTD 4ID6A 3I55A 5I9OA 1C7YA 1E3PA 1X56A 1WTRA 2BDNA 4JBJA 1S5DD 2AUKA 2A69D 3CF5A 1SFOB 2CW0D 2A6ED 4KJOA 3JAMc 2PZUA 1EEID 2R7ZH 5HURA 4PMBA 1X3FA 2JA6B 5C4JH 4UP9A 2FMMA 1DOLA 4C3IB 4A3DB 4WJWA 2A74C 1SRUA 5E7NA 1HXYD 2Y0SB 1RL2A 1L0YB 4PZ6A 2EDGA 3BZDB 5CBAE 1D5MC 3S2DB 3HOZB 2R92B 5BR8Q 2RKSA 1IBLQ 3NBIA 3C1EA 3F2DA 3MXNB 2KCNA 4ZCKA 5CV7A 4DNIA 1VQDA 3BJUA 5FLMH 3E9HA 1F2YA 5E4WC 4HIKA 3EFXD 3GTKH 1D5ZC 2KVMA 4A76A 3ERSX 4FP5D 4H02A 2I5HA 2UUBQ 3QOLA 2J4XA 5DLQE 4IFDI 4DR5Q 2MPMA 4JBKA 1PH3A 3I4NG 4G7OC 4RGOS 5I9PA 2VQEL 3M4OH 3H3VC 2G9HD 5CORA 3RNUA 1RODA 2I5MX 1LACA 5LL6X 1U5KA 1SN8A 4R4TA 4C1NK 1M90C 2Z4IA 2NUCA 1VF5C 2RDGA 4K5XA 4RMFA 3S15B 4NW2A 1LTSD 3G6EA 3GTJB 1IL8A 4XXEA 1PYWD 3HZXA 4MNOA 1Z9FA 3ND8A 2JN4A 3CMAA 1EY9A 2F0TA 4HIMA 2IX1A 5E4XA 2NVQH 1CKMA 1V8QA 1MGSA 1SJED 3EROA 4LF6L 2GN5A 5GROA 1Z6HA 1TWFB 5M5YH 1YZ6A 3PUZA 1CUKA 1SROA 1ML0D 2PCFB 1QCBD 2Q2TA 3M3YB 2HT1A 4HIDA 1DONA 2G9DA 1BR9A 1II3A 1E24A 1TWAH 3I72A 1HHVA 3S9WA 4JI7L 5JEAH 2L12A 1ICWA 3CMEA 1FD7D 1QUQA 3GTPB 1CZGA 2UUCL 4B3TQ 3OTOQ 1FGUA 1PTOB 1TWHB 2K50A 2EZVA 3TREA 2ZJRA 1KRTA 1VQMA 5ELOA 1AFPA 1E2ZA 4ULLA 2LFNA 4LF8L 2YU9B 1VQKA 1VCIA 3FMCA 2WACA 4L8JA 2IW3A 4RGTA 1R9TH 2ZXOA 3BYTB 5EKKA 4FXDA 1PMRA 1Q46A 2NTSA 1STNA 2F03A 3NK9A 3PO3H 3S17H 4XDXA 4IUUA 3TZDA 3FVQA 3A0JA 4BBSG 1EZ6A 2XIWA 1Q90A 5D14A 1BDOA 3MEHA 3OSOA 4IUQA 2A68D 5G3LF 2OF1A 4JI1L 2QILA 4NDXA 2EYHA 4PV1C 1F77A 1LM0A 1PH4A 4RFBA 1HZCA 1PH1A 4AH6A 4QGUA 3ZJYC 2Z9HA 1N36Q 3BDCA 4DR2Q 1K83B 1S5BD 4R8NA 3CCSA 4OWWB 2DUDA 4YCVA 2JA5B 2I46A 2QF7A 4BY7G 4GLAC 2UXCL 1PDQA 2EYLA 1S40A 3A8IE 1WCMB 4DK3C 3QB3A 1Y69U 2UXDQ 1XMQQ 3RUZA 4QQBX 1J5EQ 3IKJA 3PIO3 1N34L 3S1RB 2F0MA 1KNAA 1GUOA 1I4HA 1PLFA 3N52A 3SXHA 4ZUIA 4GLXA 1Z7TA 4DR6Q 4A3GG 2E74C 4FNFA 3BU2A 4C3HB 5M3MB 1WYDA 4UDUC 1UE6A 2XGTA 1VQCA 1Y1VB 2B3GA 1I5FA 1EEFD 2JSOA 1LT3D 3MA2B 4R8IA 3NHHA 4X64Q 3K80C 1TS4A 1BCPD 3NSWA 1HCZA 3T16A 5LMNW 4K5WA 4POGA 3A54A 2KHSA 2VXWA 3I7FA 5C3EH 4B3SQ 4AYBB 4HEDA 3I4NH 1WTQA 5ELCA 1GOZA 4N8X1 4PQXA 4LFCL 3CQZB 3CCVA 3S2HH 4LFBQ 3L0OA 1PRTF 2B63B 3D8GA 5ELEA 3UDGA 2HDLA 3OIQA 1YHBA 2VUMB 3S16H 2C9OA 1EU4A 2EE1A 5C4XB 1L2FA 4K14A 3G4SA 5EPKA 1H9KA 1UUPA 3RZDB 3OYYA 1HQMC 4FDBA 1CQVA 1X6OA 3KLWA 4JYAQ 4GN4B 4QMGA 3NTKA 5IODA 3P7JA 1DGSA 4DV0L 4KLKA 4A3LG 2IY5B 2E8GA 2YTXA 3U9OA 5BR8L 4IOCA 3CCJA 1JWSD 5DAUA 3KDFA 3M7GA 1PXUA 1O78A 4HTHA 4ALPA 3EQLC 5JPMC 3DWQA 1K3BC 2KEEA 4C2MH 2CHBD 3TSSA 5ISRA 2DJFC 3SE0A 1X3EA 4X65Q 2DN8A 3FPPA 2PMZB 1EWIA 1SMYD 2UUBL 4DV1Q 2JA8G 3MXUA 3NQTA 4DR5L 5CGKA 1VQ6A 1KLGD 1XMOQ 2JA7B 1QUQB 5GAGC 1KDBA 2IJ0A 4A93H 1TWGB 4IPDA 4DV5Q 3HRZC 1A15A 1HR0W 2NVTH 1XTDA 2CQOA 4GKJL 2ATWA 2ZT9C 4BBSH 1JOQA 3TQYA 4A3FG 4A75A 4DV2L 2OCEA 3HEJA 1EL0A 3PO2G 4K2KA 1X65A 1SMXA 1ILQA 3HKZE 4CJ0B 1YITA 2NN6I 3JC66 1A6XA 2YYZA 3A5ZB 4RG1A 4JVZA 1XJVA 2DY8A 1Q8IA 2XN9C 5JVG3 1E2VA 3RZOB 2JA9A 2L0CA 4OIJA 1B2TA 1JC7A 3NXWA 4KY7A 2F52A 1QVCA 2B2WC 3OW2A 4JI3L 3U58A 4ZAIA 1E2WA 3NE5B 4NXNL 4HMIA 1CSPA 4LF9Q 4J15A 3MWYW 2HIXA 2NVXB 1VQNA 2PZWA 4R4IA 4B3TL 1QWYA 3OTOL 3KUPA 5BN5A 4DAYA 4AYBE 4A3GH 4QB4A 4C3IG 5C3XA 4A3DG 2OTJA 2WB1B 5T1IA 3J81i 2RSOA 5IYBG 2MUYA 4DN4M 5LMNQ 3HOZG 5JJZA 1HFNA 5C0XG 3A55A 3BVZA 3CC7A 3STBC 4DR4Q 4RCOA 4A3IB 1U9RA 2KEDA 4A3EG 2CFMA 2WFWA 5LMUQ 1STYA 4LF4L 4A3CG 1PRTC 1V1QA 3I4MB 5CV9A 2KJXA 1X54A 2K1BA 1X3GA 2CW0C 2A6EC 4IQZA 3WOEA 4JI4Q 1A0IA 2AHOB 2MJ8A 2Z6KC 3GTQH 4IFDJ 4HSPA 4JI0L 1HFGA 4UP8A 5EKLA 1T5EA 3X3NA 1IBMQ 3UDFA 2B2VC 1STBA 2E2JB 2XNAC 1EIGA 3M4YA 2OWOA 3M9BA 5J3BA 5M5WH 2UXBQ 1VQFA 3D3RA 2TMPA 1N36L 3HOXB 4F87A 2XSCA 4DR2L 2GVAA 5A2QE 1VDZA 4OX9L 3P75A 5A2QL 5I2YA 4GNXA 1E7ZA 2ZTCA 3J81E 2BCOA 1TIID 3EJIA 4A3BH 4HJ7A 5ELFA 1CFMA 2UXDL 2SDFA 2HIVA 1XMQL 3PQIA 1YJ9A 2JYOA 5J22A 1L0XB 3H91A 5IWAQ 1J5EL 4BY1B 3BDOA 4I7ZC 3BZKA 3J81c 1MD2D 1RTOA 2DY7A 5CV5A 2O5JC 3PF4A 4DV4L 3HS0C 4H0LC 2Q8RE 3H09A 3PSIA 5EGTA 4XQQA 4DR6L 1UE5A 1MBYA 2RVLA 4FVMA 2K5NA 1NE3A 3DEPA 3E5SA 1Y14B 2JQOA 3T56B 1LO5D 1SNDA 4FO2A 4GOPC 1Q82C 2FHTA 1BCPF 1XNQQ 4C1NI 2VZAA 1DZ1A 2JA8H 3VR4A 2KCMA 1VQBA 4BA1I 4KN4C 1PFSA 1HR0Q 3KDFB 1N33Q 3NQIA 4B3SL 5J1ZA 4F88A 2I07B 2A73B 4JI6Q 3SK6A 4DAMA 2E2DC 5C4ZA 2K75A 1A62A 5C44B 4LFBL 3K81C 4DK1A 1Q1EA 2X6LA 1MSGA 3NTHA 4N9TA 1TXYA 3GO5A 4JOIC 1G51A 3ZYYX 3CXCA 3TN2A 3W1GA 1NR4A 2PNRC 3CCLA 3H3VH 2F0HA 4LF7Q 3UE0A 3Q22A 3D4WA 2A1AA 1F9PA 1C9OA 4OGQC 3DEOA 4JYAL 3TS0A 5JAVA 1BF4A 2V1CC 2E75C 3U50C 3I3CA 4HJAA 4OO1I 5D65A 1MI2A 2X6GA 4E6IA 4KHZA 5EBCA 2PQAA 1SFOH 4LMQD 4QIWB 2O2LD 3A7AB 1B4OA 3VYTA 1BQQT 1SNQA 4MTKA 2JA6H 1LT6D 3BDLA 2R7FA 4TKOB 1G91A 1S5CD 5JOBA 2JA5G 3J7YW 1F2MA 1YHAA 4IOAA 4CBVA 3JAMi 4C3IH 4A3DH 2CWPA 2DNCA 1WCMG 1VQEA 2EYOA 4LUOA 3CAMA 2AQ1B 2LSSA 4HCSA 3KFUA 1RDPD 3S14B 1CSQA 3S2DH 3HOZH 2B2TC 4HCEA 2R92H 3NENA 2JK8A 5C0XH 3HOUB 1S5FD 4I7AA 5KNCA 4C3HG 1I6HH 5M3MG 4DAYB 2A68C 5IGDA 2BH8A 4A3CH 3WDNA 4X62Q 1JB7A 4DK0A 5DNFA 1TY2A 1EOVA 2A6HD 3E0EA 1ESRA 1Q8KA 2SOBA 4OIKA 3P20A 2KBNA 1GXDC 4L5TA 4AYBG 2PW5A 2M00A 1DXMA 1YNXA 1LT4D 2KA7A 5FKAC 1EYCA 5C6AA 3DWPA 3FRPB 3MHBA 1RJTA 4K8JA 3U4ZA 2K52A 3G71A 4KY6A 4LNQA 3G6JB 1MIUA 2B63G 2DNEA 3GTJH 1LLRD 2EPBA 2QKIC 4ZQ3A 1HPCA 3AYHB 2L4NA 5JJKA 2IHFA 2VUMG 4P74A 1JICA 4LF9L 5C4XG 5EPLA 4DNRB 1SYEA 1GUTA 4O0AA 4RHSA 5I4DA 1TWFH 4FXKC 5JPNC 4K6LA 1AP0A 3GV6A 4RWSC 1A63A 3M3YH 3FDTA 4G57A 3NBHA 3FKIB 1HNZQ 4GNXB 1GD7A 1BCPC 3MFYA 1PFBA 2UU9Q 1YNND 4QCLA 1I50B 1UAPA 3CD6A 4IPHA 3J80E 1CK1A 3IFTA 3J80L 2HDMA 3W2DA 1K8GA 3SVMA 1OXTA 2NBFA 3GTPH 1FL0A 4NB3A 4DR4L 1S5ED 1GHJA 2ZJQA 3M4PA 3SHLA 3J80c 1D8LA 1PTOH 1TWHH 2EXDA 2QW7A 3J7A5 2KHJA 2D9UA 1VS0A 2NWGA 3LWEA 4S3SA 3UE1A 3BZCA 3S1QB 5CYUA 1YHQA 4GN3B 2YU9H 4JI4L 3NUCA 3EVQA 4A3MB 1XX8A 1EYGA 4OONA 2D5DA 2N55A 1V1OA 1F9SA 4H13C 1SE2A 5C3EG 1IBML 3S1NH 1HUMA 4DFAA 5KYIA 1EQTA 3ITPA 1YI2A 4K0KQ 1Q3LA 4EX5A 1R4QB 1A3TA 1RD9D 1TS2A 3T1HQ 1ET6A 1IYUA 1O7IA 5KRUA 1AZPA 3TS2A 2OQKA 2H4OA 2B2WA 1BBWA 3PUXA 1J8IA 1M4VA 3H0GB 3K0XA 5A35A 1OXSC 4R4QA 1NMFA 4GLVB 4ZYSA 1WFQA 4A3JB 4CGYB 3OWEB 5IWAL 1X55A 3CCMA 1SDFA 1B44D 5KIXA 4NP5A 2MFIA 1LTRD 1K83H 3I56A 1CI3M 2VQFL 2F0WA 1EOTA 1SMYC 3T4AC 2JA5H 2OTLA 5M3FB 1S4ZA 5M5XB 2PQEA 1WCMH 4GNXC 1LTAD 2RHQB 2KCTA 4RHRA 4JI2Q 4ILWA 4BBRB 2ZXRA 5IGFA 1N9WA 4UP7A 3V05A 3PF5A 2PQAB 1FNWA 2XVSA 5KYLA 3S1RH 2CCZA 1SNCA 4QJFA 1N33L 2IWHA 4LFAQ 4IN3A 4EQPA 4ZRZA 4B3MQ 1S3OA 3J81j 2ID0A 4C3HH 4N8FA 1KQSA 3CC2A 5M3MH 1PH7A
chains in the Genus database with same CATH topology
4DAPA 4K8IA 3K7AB 1I4GA 3N6RA 4IZ8A 4QF4A 1FYCA 2ZXPA 2B2VA 1NCVA 1Q1BA 2BDOA 2E2HB 2EVBA 2EYFA 3U9SA 3E6ZX 1I4PA 3NPPA 3SK8A 1DM0B 3GTLB 2Z8LA 1JB3A 1B1ZA 4K2LA 1B9NA 2MHVA 1AW7A 3UI2A 2IPKD 4JBWA 2VB2X 1AEXA 3I90A 2XWBB 1O80A 4DNTB 3HG9A 3W3AA 4KD4A 5CMDA 2WINB 5CC4A 5EKIA 1B9MA 3K5OA 1WTVA 4NMZA 2EOTA 3MXPA 3O13A 1JE4A 4CJ2C 1ZEQX 1D1KA 4ME5A 1JORA 1U4LA 1U4RA 1J9OA 5IGGA 1SAPA 4LJZC 4J8QA 4V0BA 4K5VA 2PYKA 3K5NA 1EYDA 2K03A 2F4IA 1EY7A 1K8OA 1SYFA 1CZWA 1CQFA 1Q12A 3S1MB 4OL7A 1CHQD 4PMCA 4L63B 4M1UB 5KEEA 1OXXK 1RF2D 1YNJD 3C1FA 3G7LA 3I73A 4FYDA 3D4RA 5K5PA 2PO4A 1JCKB 1IW7D 4Y7NB 2L11A 3K0YA 3GTGB 1MSHA 3MFGA 4IFDG 1Z47A 1EU3A 2WP8J 2K05A 4F8MA 1ZKOA 3D31A 3CRLC 2B2TA 2AWOA 1QE6A 1TU2B 2D62A 2KUMA 1XXGA 3CKIB 3SK5A 2BA1A 3OMCA 3J7AF 5ELBA 2J7ZA 2EY1A 2EY2A 4H44C 2NZ1D 3SEBA 4KI0A 4KJNA 1WTWA 4CJ1B 3HOVB 2RDHA 1EZ8A 4UAIA 1C48A 3HOYB 3QWNA 4X3UA 2F0DA 1WD0A 3R93A 3L3OC 2OXPA 4L6TB 1PRTB 5K36H 2K04A 1X32A 2LS01 5IGCA 1EY4A 4CKEA 3FPUB 3A8KE 3LNNA 1QOHA 2EYMA 4BS9A 3TP8A 2F3WA 2VNUD 1XTCD 3LWUA 3QOJA 4XT3B 4HSVA 1EIHA 2B8GA 1QB5D 3I8ZA 4DU9A 4EQNA 4Z9CB 1EY5A 1H9MA 3BYYB 5FO8B 1B53A 3R2IA 2A6HC 3D6CA 3OHXC 3V2TA 4HAEA 2SNSA 1FGBD 1BO0A 3VA5A 1STHA 2V4DA 1H9RA 2B8FA 2AQ2B 2Z1CA 5CV4A 1QNUA 4XTCS 3DMUA 3RLFA 1HQRD 2F0JA 3PUWA 2K32A 1ESFA 3H6MA 1RKNA 1LT5D 1GUSA 4A3KB 1LTGD 4Q5VA 1QJOA 2F0GA 4PMWA 4FXGC 2QEJC 1HTLD 4ZLTF 4CKCA 1YNNC 4IFDH 1FNUA 5FOBB 1QG7A 3GTOB 3OWFA 2R3ZA 1PTOD 4BWGB 5C3WA 2EY6A 3BVGA 3MVVA 4DGZA 4IUPA 4M8AA 2XRSD 2M9VA 2SNMA 2D2CC 1BNZA 5ELDA 4YIJA 4FF3A 1WTOA 4BY7B 1AZQA 1A3VA 3K5LA 4WORA 2FJ2A 3A8JE 4WFN3 4IALA 5FO9B 3NTIA 5CV6A 1HUNA 5COYA 1O7ZA 1TR5A 4KMUC 3L9AX 1O7YA 4TQUS 4PNYA 1CHPD 3LX0A 4RGNA 2EYPA 3GQBA 1M8AA 1V1PA 1IKMA 1WTPA 4RAUC 2LY7A 2E2IB 3TP5A 4XIGS 1F9RA 2R93B 1VMPA 2ICEC 4G7HC 3KBGA 4EGVA 3A7LA 1SYDA 5EQ0A 2BA0A 1E0BA 5CV8A 5FK9C 3DXJC 3VR6A 3QJYA 1SE3A 1F9QA 1XWEA 2JEAI 2NN6G 1BCPB 2AWNA 3IL8A 1ENFA 1EY6A 1GUGA 5DM63 3KLRA 2EY5A 3TZUA 4DF7A 4QUFA 1Y1WB 3MZ5A 3Q24A 5NUCA 1D6EC 1D2BA 4ZKCB 2NB0A 3RMHA 5IOCA 4Q0FA 3KF8A 2RA4A 1SYBA 3J7AV 2IX0A 4C3JB 1Y8OB 1OXVA 2L55A 5EBDA 3AB9A 1G8ZD 3NWTA 3QO2A 4B08A 4A3FB 4ABNA 3PO2B 3CHBD 4U68A 2RQXA 2K5WA 3TDQA 3GTMB 5KNDA 1BOSA 1OO9B 2M2LA 4U673 1JR0D 1ET9A 4G4KA 3C2PA 3T13A 2R61A 3A56A 2L1BA 4LK1C 5T1GA 1SYCA 3PMFA 4X3SA 1STAA 2NVYB 1IHZA 4RA8A 5I6YA 3SR1A 1QILA 2B2UC 3P1HA 2F0FA 1YNJC 1TWCB 3GD7A 2RDFA 2AQ3B 1U4MA 2EJGC 1IW7C 3PIP3 3OIPA 2SEBD 3TMEA 2BOSA 5C4HA 4GZYC 1XYIA 2WKCA 1F2LA 1B3AA 2JEBI 1UEAB 4A3EB 1I6HB 2E76C 1G2SA 3VYSA 2WAQB 1AN8A 1DYQA 1PTOF 1TVXA 1HRJA 4OHJA 2MGSA 2JP1A 2HQEA 1ZXTA 2HUGA 1V1PB 1TS3A 1DJRD 1SBBB 4X3KA 3BS1A 4KKUA 1KAAA 4FF1A 4O42A 2PPBC 3M7NA 2Q8IB 5D3DA 2F0EA 2NN6H 1JWUD 4HN7A 3ERQA 4I65A 3I4LA 2FFKB 3QIAA 2R7ZB 2XRQD 4KD3A 4OO1G 1STEA 2KECA 5C4JB 3MAQA 3MXGA 5JEAJ 5J39A 3CRKC 4TSSA 3D6WA 2FINB 1DCZA 4KK7A 4K6DA 4LAAA 4RH6A 3V96A 4DAVA 1SE4A 5C5MA 1GHKA 3OMGA 4MN3A 2MP1A 3RD4A 3X3MA 3DUZA 1EYAA 4N9PA 1TT2A 3QG1A 3GTKB 3SDZA 1DOKA 1DOMA 4X3TA 5K36G 2F0QA 5DEHA 2K5DA 2F0NA 4EVOA 3S1NB 4B9XA 3M4OB 4RKLA 3OPOA 4KKTA 1QNKA 2F0IA 1SNOA 3I91A 5CR3A 1ZYRD 3KBXA 3MC0B 2HCIA 2QCPX 5E1FA 4FF4A 1I4RA 5DM73 2RBMA 2ICIA 4KY5A 3ONAB 5KGUA 2EYJA 3C46A 2NVQB 4KKSA 2X69A 2WKDA 1PFNA 4H7BA 5M5YB 1ENCA 5IT9E 5IT9L 5C0XI 1SNPA 1SNMA 2KOLA 2LMCB 3FEWX 3HKZB 3R8BA 3NWSA 1TWAB 3H94A 3KK7A 1R4PB 3VR2A 5EJWA 2Q8TA 1HA5A 3GV3A 2BE5D 1G291 2Z4HA 1IYVA 3R3OA 1EQVA 1JQYD 1PTOC 1EY8A 5IIFA 1T5XD 3GP7A 1VMCA 3VA7A 1I4QA 1I4XA 1JOKA 3TP6A 1UNSA 1SEBD 1LV9A 1X3PA 1R9TB 1BBXC 2N88A 3VR3A 4ZUJA 2FMCA 3KLSX 3PO3B 5HGTA 3S17B 3CU7A 4F7XA 2OEOA 3T51B 1BUVT 3D4DA 2B2YA 1KLUD 1C4QA 1EWHA 5M9OA 4RGMA 3I70A 4ZKBB 5JVH3 2JE6I 4HR7B 1NR2A 4DXGA 4OO1H 1HA6A 2GA4B 4XYOA 2J0TD 2IX3A 2O4XA 1B50A 1A3UA 1TKWB 1H9JA 4XQNA 1A2TA 3ND9A 2PW7A 1ENAA 2ENBA 4QUCA 2F0VA 2LKVA 1LTID 5LHY1 5KNBA 1TQOA 4G7ZC 4HMJA 1PZKD 4RCNA 3T53B 1KDCA 3SK4A 2RSNA 5C3EB 3I4NB 4TRDA 4MHEA 3BG3A 2C5CA 1SXTA 4C3JG 2QDBA 4XT1B 1OXUA 1K8MA 3S2HB 1GUWA 2R6GA 1KNEA 1EY0A 2HCCA 1ONLA 4J6HA 3S16B 3HP3A 5C5LA 1PZID 3TBIB 2B2UA 2OT2A 5FLXE 3IAYA 1HTPA 5FLXL 2K5QA 5BN4A 3PUVA 1TY0A 4O1NA 1W6KA 1LTBD 4KHVA 3BVMA 1JOOA 1CTMA 1KTKA 4EQOA 4B9WA 4IUVA 4KN7C 2IT1A 2K01A 2PZTA 4XQJA 1SSOA 4C2MB 3DHQA 1C8CA 3URYA 2F3VA 3VYUA 2NTTA 3K59A 2WV6D 1LABA 1SYGA 4BA2I 3AU7A 5D3IB 5IGEA 5CBEE 1GUNA 3NP8A 3WOFA 1FR3A 1NSNS 2CVRA 1RHPA 2KCCA 4P2CB 4CKBA 4A93B 1H9SA 5F2DA 2NVTB 5IGBA 1JWMD 2CQAA 1U4PA 4BBSB 2A69C 4C56C 1IKLA 2L9HA 1NAPA 2NYZD 3TP7A 1F2ZA 2H1EA 1CA5A 3PUYA 4DA2A 1KABA 1PZJD 4MIUA 1DD2A 2L5TA 1CM9A 5LL6S 3J81L 5I2XA 3IFDA 1Y8PB 1ILPA 3EA6A 1W6JA 3MXNA 2AUJD 1I6VC 2K28A 5E3FA 1EFID 4ODGA 3L7ZC 4A3GB 3R2TA 1FNVA 1D1IA 1O7LA 1I3QB 1NUCA 3Q0AA 1CA6A 1EWCA 4KTAA 2TSSA 1D5XC 5TSSA 1BXTA 1V43A 2VB3X 4RKBA 3PV0A 3K58A 2F0PA 4ZK9B 2O5IC 1Y8NB 5AFWA 5FO7B 4IUTA 1VF7A 3GTQB 4XYQA 3AMUA 2K33A 1X3QA 5M5WB 3K57A 4WRDA 3VYRA 2A5HA 1G2TA 3HGBA 3K6OA 1RTNA 4JK1C 4A3BB 3M85A 3E0JA 2K7VA 1LTTD 1GJXA 3DWAA 5EPJA 5G3LD 3C3LA 2B2YC 2F0OA 1WTXA 5I6WA 5C0XJ 2F0KA 2JXMB 3Q23A 2EXZA 1SJHD 4CHTB 4NKLA 5BN3A 2EJMA 4DXFA 4IURA 5JEAG 3OOCA 2JA8B 2B39A 4KV6A 2WIIB 1ZYRC 2F1MA 4V190 2XWJB 2IL8A 3HOWB 3Q6SA 2EJFC 1KDAA 2KQ3A 3KLSA 1A2UA 1WD1A 3OW7A 4J1MA 1RCVD 3F2UA 1PFMA 3MTSA 4IUNA 2F0SA 1CT1D 3K5MA 3VR5A 2K6AA 2F0LA 1H9SB 1WVLA 1G6ZA 1STGA 4R9WA 1TS5A 3JAME 3DM1A 4FF2A 3JAML 2F0UA 2BE5C 1PRTD 4ID6A 5I9OA 1WTRA 2BDNA 1S5DD 2AUKA 2A69D 1SFOB 2CW0D 2A6ED 4KJOA 2PZUA 1EEID 5HURA 4PMBA 2JA6B 2FMMA 1DOLA 4C3IB 4A3DB 4WJWA 2A74C 1HXYD 2Y0SB 1L0YB 5CBAE 2EDGA 3BZDB 1D5MC 3S2DB 3HOZB 2R92B 2RKSA 3NBIA 3C1EA 2KCNA 5CV7A 5E4WC 1F2YA 3EFXD 1D5ZC 2KVMA 4FP5D 3QOLA 2J4XA 4IFDI 2MPMA 4G7OC 4RGOS 5I9PA 3H3VC 2G9HD 5CORA 1RODA 1LACA 5LL6X 4C1NK 2Z4IA 2NUCA 1VF5C 2RDGA 4K5XA 3S15B 4NW2A 1LTSD 3GTJB 1IL8A 4XXEA 1PYWD 3HZXA 3ND8A 1EY9A 2F0TA 2IX1A 5E4XA 1V8QA 1MGSA 1SJED 3EROA 1Z6HA 1TWFB 3PUZA 1ML0D 2PCFB 1QCBD 3M3YB 1DONA 2G9DA 1BR9A 1II3A 3I72A 1HHVA 3S9WA 5JEAH 2L12A 1ICWA 1FD7D 3GTPB 1CZGA 1PTOB 1TWHB 2EZVA 1AFPA 1E2ZA 4ULLA 2LFNA 2YU9B 1VCIA 3FMCA 2WACA 4L8JA 2IW3A 4RGTA 2ZXOA 3BYTB 5EKKA 4FXDA 1PMRA 2NTSA 1STNA 2F03A 3NK9A 4XDXA 4IUUA 3TZDA 3FVQA 1EZ6A 2XIWA 1Q90A 5D14A 1BDOA 3MEHA 3OSOA 4IUQA 2A68D 5G3LF 2OF1A 2QILA 4NDXA 2EYHA 4PV1C 1F77A 4RFBA 3BDCA 1K83B 1S5BD 4R8NA 2JA5B 2I46A 2QF7A 1PDQA 2EYLA 3A8IE 1WCMB 3QB3A 1Y69U 3RUZA 3IKJA 3PIO3 3S1RB 2F0MA 1KNAA 1GUOA 1I4HA 1PLFA 3N52A 3SXHA 4ZUIA 1Z7TA 2E74C 4FNFA 4C3HB 5M3MB 4UDUC 1Y1VB 1EEFD 2JSOA 1LT3D 3MA2B 4R8IA 3NHHA 1TS4A 1BCPD 3NSWA 1HCZA 3T16A 4K5WA 3A54A 2KHSA 2VXWA 4AYBB 4HEDA 1WTQA 5ELCA 1GOZA 4PQXA 3CQZB 1PRTF 2B63B 3D8GA 5ELEA 2HDLA 3OIQA 2VUMB 2C9OA 1EU4A 2EE1A 5C4XB 4K14A 5EPKA 1H9KA 1UUPA 3RZDB 1HQMC 1CQVA 4QMGA 3NTKA 5IODA 3P7JA 3U9OA 1JWSD 5DAUA 3M7GA 1PXUA 1O78A 4HTHA 3EQLC 5JPMC 3DWQA 2KEEA 2CHBD 3TSSA 5ISRA 3SE0A 2DN8A 3FPPA 2PMZB 1SMYD 3MXUA 3NQTA 5CGKA 1KLGD 2JA7B 1KDBA 2IJ0A 1TWGB 3HRZC 1A15A 2ZT9C 1JOQA 3HEJA 1EL0A 4K2KA 1ILQA 4CJ0B 2NN6I 1A6XA 2YYZA 2DY8A 1Q8IA 2XN9C 5JVG3 1E2VA 3RZOB 2L0CA 4OIJA 1B2TA 1JC7A 3NXWA 4KY7A 2B2WC 4ZAIA 1E2WA 3NE5B 4HMIA 3MWYW 2NVXB 2PZWA 1QWYA 3KUPA 5BN5A 4DAYA 4QB4A 4C3IG 5C3XA 2WB1B 5T1IA 2RSOA 2MUYA 4DN4M 5JJZA 1HFNA 5C0XG 3A55A 3BVZA 4RCOA 4A3IB 1U9RA 2KEDA 1STYA 1PRTC 3I4MB 5CV9A 2KJXA 2K1BA 2CW0C 2A6EC 4IQZA 3WOEA 2MJ8A 4IFDJ 4HSPA 1HFGA 5EKLA 1T5EA 3X3NA 2B2VC 1STBA 2E2JB 2XNAC 1EIGA 3M4YA 3D3RA 2TMPA 3HOXB 4F87A 2XSCA 5A2QE 1VDZA 3P75A 5A2QL 5I2YA 3J81E 2BCOA 1TIID 3EJIA 5ELFA 1CFMA 2SDFA 2JYOA 5J22A 1L0XB 3H91A 4BY1B 3BDOA 4I7ZC 1MD2D 1RTOA 2DY7A 5CV5A 2O5JC 3HS0C 4H0LC 2Q8RE 3H09A 4XQQA 5EGTA 4FVMA 1MBYA 2RVLA 3DEPA 3E5SA 3T56B 1LO5D 1SNDA 4FO2A 2FHTA 1BCPF 4C1NI 1DZ1A 3VR4A 4BA1I 4KN4C 3NQIA 5J1ZA 4F88A 2I07B 2A73B 3SK6A 2E2DC 5C4ZA 5C44B 4DK1A 1Q1EA 2X6LA 1MSGA 3NTHA 4N9TA 3GO5A 3ZYYX 3TN2A 1NR4A 2PNRC 2F0HA 3Q22A 3D4WA 1F9PA 4OGQC 3DEOA 5JAVA 1BF4A 2E75C 3I3CA 4OO1I 5D65A 1MI2A 2X6GA 4E6IA 4KHZA 5EBCA 4LMQD 4QIWB 2O2LD 3A7AB 1B4OA 3VYTA 1BQQT 1SNQA 1LT6D 3BDLA 4TKOB 1G91A 1S5CD 5JOBA 3J7YW 1F2MA 4CBVA 2DNCA 2EYOA 2AQ1B 4HCSA 1RDPD 3S14B 2B2TC 4HCEA 5C0XH 3HOUB 1S5FD 5KNCA 4C3HG 2A68C 5IGDA 3WDNA 4DK0A 5DNFA 1TY2A 2A6HD 1ESRA 2SOBA 4OIKA 3P20A 1GXDC 2M00A 2PW5A 1DXMA 1LT4D 2KA7A 5FKAC 1EYCA 5C6AA 3DWPA 3FRPB 3MHBA 1RJTA 4K8JA 4KY6A 3G6JB 2DNEA 1LLRD 2EPBA 2QKIC 4ZQ3A 1HPCA 2L4NA 1JICA 5EPLA 4DNRB 1SYEA 1GUTA 4RHSA 5I4DA 4FXKC 5JPNC 4K6LA 1AP0A 3GV6A 4RWSC 3FDTA 4G57A 3NBHA 3FKIB 1BCPC 3MFYA 1PFBA 1YNND 4QCLA 1I50B 1UAPA 3J80E 1CK1A 3IFTA 3J80L 2HDMA 3W2DA 3SVMA 1OXTA 2NBFA 1S5ED 1GHJA 3SHLA 1PTOH 2D9UA 2NWGA 3LWEA 4S3SA 3S1QB 5CYUA 3NUCA 3EVQA 4A3MB 1XX8A 2D5DA 2N55A 1V1OA 1F9SA 4H13C 1SE2A 1HUMA 4DFAA 5KYIA 1EQTA 3ITPA 1Q3LA 1R4QB 1A3TA 1RD9D 1TS2A 1ET6A 1IYUA 5KRUA 1AZPA 2H4OA 2B2WA 3PUXA 1J8IA 1M4VA 3H0GB 5A35A 1OXSC 4ZYSA 4A3JB 4CGYB 3OWEB 1SDFA 1B44D 5KIXA 4NP5A 1LTRD 1CI3M 2F0WA 1EOTA 1SMYC 3T4AC 5M3FB 1S4ZA 5M5XB 2PQEA 1LTAD 4RHRA 4ILWA 4BBRB 2ZXRA 5IGFA 3V05A 1FNWA 2XVSA 5KYLA 1SNCA 2IWHA 4IN3A 4EQPA 4ZRZA 2ID0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D14 A;  5E4W C;  3G7L A;  1AP0 A;  1HUN A;  3GV6 A;  4RWS C;  4IUQ A;  5COY A;  5EJW A;  3FDT A;  2Q8T A;  1O7Z A;  2RSN A;  3GV3 A;  3QO2 A;  2KVM A;  2KED A;  4MHE A;  1F9P A;  1PFB A;  2B2V A;  3DEO A;  1NCV A;  1O7Y A;  1B53 A;  1BF4 A;  1CM9 A;  2KEE A;  2L11 A;  2MPM A;  4U68 A;  2FFK B;  3I3C A;  4IUR A;  4XT1 B;  2K1B A;  5D65 A;  1MI2 A;  2X6G A;  1MSH A;  2HDM A;  4HAE A;  1GUW A;  3SVM A;  3IFD A;  4LMQ D;  1KNE A;  1BO0 A;  1ROD A;  5COR A;  2MJ8 A;  1ILP A;  2KEC A;  2K05 A;  2HCC A;  1M8A A;  1B4O A;  1HFG A;  1VMC A;  1PDQ A;  4NW2 A;  2B2T A;  3HP3 A;  1IKM A;  1WTP A;  2B2V C;  1QE6 A;  2D9U A;  1IL8 A;  1EIG A;  2IL8 A;  2K28 A;  2KUM A;  2NWG A;  3D6W A;  3LWE A;  3Q6S A;  4RAU C;  2M2L A;  1G91 A;  2B2U A;  2FIN B;  1F9R A;  1LV9 A;  1X3P A;  1BBX C;  2N88 A;  3UI2 A;  1WD1 A;  1VMP A;  2J7Z A;  1A15 A;  1XX8 A;  2L1B A;  1KNA A;  3I90 A;  4HCS A;  2NZ1 D;  1PFM A;  1PLF A;  3F2U A;  2N55 A;  3N52 A;  1F9S A;  4MN3 A;  3MTS A;  5E4X A;  5T1G A;  1O80 A;  2MP1 A;  1MGS A;  1WTW A;  2B2T C;  4CJ1 B;  1HUM A;  1EQT A;  4X3S A;  5CMD A;  1Q3L A;  2SDF A;  4RA8 A;  1EL0 A;  5EQ0 A;  2JYO A;  4UAI A;  5EKI A;  2B2U C;  3H91 A;  1ILQ A;  1E0B A;  1ML0 D;  1WVL A;  1WTV A;  1DOK A;  1DOM A;  2B2Y A;  4CJ0 B;  1AZP A;  1RTO A;  2DY7 A;  4X3T A;  4X3U A;  4R8I A;  2EOT A;  4ZK9 B;  2B2W A;  1G6Z A;  4IUV A;  4R9W A;  1J8I A;  1F9Q A;  1JE4 A;  2K01 A;  1WD0 A;  2Q8R E;  1DON A;  3R93 A;  3DM1 A;  1SSO A;  2RVL A;  4CJ2 C;  1U4M A;  5DNF A;  5AFW A;  1C8C A;  4ZLT F;  1HHV A;  2VXW A;  3DEP A;  4ZKB B;  2DY8 A;  4HED A;  1QG7 A;  1ESR A;  3IL8 A;  1NR2 A;  2L12 A;  1ICW A;  4IUT A;  4OIK A;  1WTQ A;  2BDN A;  1WTR A;  1HA6 A;  1U4L A;  1QNK A;  1SDF A;  2R3Z A;  4OIJ A;  1XYI A;  1B2T A;  2FHT A;  1U4R A;  5CBE E;  1F2L A;  3I91 A;  2B2W C;  1B3A A;  1J9O A;  3KBX A;  2HCI A;  1DZ1 A;  4QUF A;  2K04 A;  4ZAI A;  1SAP A;  1CA6 A;  2CVR A;  1X3Q A;  2HDL A;  1RJT A;  1RHP A;  1X32 A;  1EOT A;  1G2S A;  2FMM A;  3ONA B;  1B50 A;  4IUP A;  1S4Z A;  1TVX A;  3MWY W;  1DOL A;  1BNZ A;  1HRJ A;  3FPU B;  1G2T A;  2EPB A;  4ZKC B;  2EE1 A;  2MGS A;  2JP1 A;  5EPK A;  1WTO A;  1RTN A;  3KUP A;  2L4N A;  2X6L A;  5CBA E;  1U4P A;  2X69 A;  1MSG A;  2K03 A;  1PFN A;  5T1I A;  1ZXT A;  2HUG A;  1JIC A;  2RSO A;  4DN4 M;  1IKL A;  5EPJ A;  4XDX A;  1AZQ A;  4XT3 B;  2L9H A;  1NAP A;  4IUU A;  5EPL A;  4HSV A;  2B2Y C;  1NR4 A;  2NYZ D;  3TN2 A;  3TZD A;  2RA4 A;  1EIH A;  3P7J A;  2FJ2 A;  2H1E A;  4QUC A;  4X3K A;  1WTX A;  2KOL A;  5JJZ A;  1CA5 A;  1HFN A;  3I8Z A;  2XIW A;  4O42 A; 
#chains in the Genus database with same CATH topology
 4DAP A;  5IYC G;  4K8I A;  3K7A B;  1I4G A;  1BVS A;  1WOC A;  1Y1V H;  2Z6K A;  3N6R A;  4IZ8 A;  4QF4 A;  1FYC A;  2ZTD A;  2ZXP A;  2B2V A;  1NCV A;  5HY6 A;  1Q1B A;  2BDO A;  2E2H B;  2EVB A;  4A3I G;  4A93 G;  2RHS B;  2EYF A;  3U9S A;  4LF7 L;  3E6Z X;  1EFW A;  1I4P A;  3NPP A;  3I4M G;  3SK8 A;  3CQZ H;  1DM0 B;  3GTL B;  2B63 H;  2Z8L A;  1JB3 A;  1B1Z A;  4K2L A;  1YBY A;  1B9N A;  3EBE A;  2MHV A;  4DUZ L;  1AW7 A;  2VUM H;  3UI2 A;  2IPK D;  3W1B A;  2YTY A;  4JBW A;  2VB2 X;  1AEX A;  2Y0S E;  5C4X H;  3I90 A;  5JJI A;  1EQQ A;  2XWB B;  1O80 A;  4DNT B;  4DV7 Q;  3RZD H;  3HG9 A;  1K3R A;  3W3A A;  4KD4 A;  1PH2 A;  5CMD A;  2WIN B;  4NXM Q;  5CC4 A;  3E9I A;  5EKI A;  1B9M A;  4CDC C;  4DUY Q;  3K5O A;  5GQO A;  3UDI A;  4GOP A;  1WTV A;  4YWL A;  4NMZ A;  2EOT A;  3MXP A;  5GAH C;  3O13 A;  4GN5 A;  1WI5 A;  1JE4 A;  2F4V Q;  4YHH L;  4CJ2 C;  1ZEQ X;  1D1K A;  3CCE A;  4UPA A;  4JV5 Q;  3KJO A;  4ME5 A;  1JOR A;  1HZA A;  1U4L A;  1KL9 A;  1U4R A;  1J9O A;  5IGG A;  1SAP A;  5AJ3 L;  3NBH B;  4JOI A;  4LJZ C;  4J8Q A;  4V0B A;  1SR3 A;  3G48 A;  2CKZ B;  2JA7 H;  4K5V A;  2PYK A;  3K5N A;  1EYD A;  2I5L X;  2K03 A;  1TWG H;  2F4I A;  1EY7 A;  1NJI C;  5C44 G;  1N32 L;  1K8O A;  1SYF A;  2ES2 A;  1CZW A;  1CQF A;  1Q12 A;  3S1M B;  4OL7 A;  1B7Y B;  1CHQ D;  4PMC A;  2PI2 E;  1IBK Q;  4L63 B;  4M1U B;  5KEE A;  1OXX K;  1RF2 D;  1YNJ D;  3C1F A;  3G7L A;  3I73 A;  4FYD A;  3D4R A;  5K5P A;  2PO4 A;  1JCK B;  1IW7 D;  4Y7N B;  2NZO A;  2L11 A;  3K0Y A;  3GTG B;  1MSH A;  3MFG A;  4IFD G;  1Z47 A;  3RZO H;  1EU3 A;  2WP8 J;  2K05 A;  4F8M A;  4A3B G;  1ZKO A;  3D31 A;  3CRL C;  2B2T A;  2AWO A;  4JBM A;  1QE6 A;  1TU2 B;  2D62 A;  2KUM A;  1XXG A;  3CKI B;  1XNR Q;  1VQJ A;  2ZJP A;  1IBL L;  3SK5 A;  2BA1 A;  3OMC A;  1HNX Q;  3J7A F;  2NVX H;  5ELB A;  2J7Z A;  2EY1 A;  2EY2 A;  4H44 C;  2NZ1 D;  3SEB A;  4KI0 A;  1JT8 A;  4KJN A;  1WTW A;  2N3S A;  4CJ1 B;  3HOV B;  2RDH A;  1EZ8 A;  5IYC H;  4UAI A;  1C48 A;  3HOY B;  3QWN A;  4LWC A;  2Q2U A;  4X3U A;  2F0D A;  1VQO A;  1WD0 A;  3HOU G;  3R93 A;  2BH2 A;  5IYD H;  3AFQ A;  4A4I A;  3L3O C;  3AFP A;  4A3I H;  2OXP A;  3IRB A;  4K0K L;  4L6T B;  3CPW A;  1PRT B;  4R4C A;  3T1H L;  3HOW G;  3I4M H;  4AIM A;  1KC8 C;  2R7D A;  4IPC A;  5K36 H;  2K04 A;  1X32 A;  2LS0 1;  4YCU A;  5IGC A;  4HJ8 A;  2HHH Q;  1EY4 A;  4CKE A;  3UDX A;  1KIX A;  2E2J H;  3FPU B;  1PH6 A;  4PZ8 A;  4X6A H;  3A8K E;  1C0A A;  3LNN A;  1QOH A;  3HOX H;  1NNX A;  2EYM A;  4BS9 A;  3TP8 A;  3ULP A;  2F3W A;  2VNU D;  1XTC D;  3RN2 A;  3LWU A;  3QOJ A;  4XT3 B;  4AQY Q;  4HSV A;  4CDF C;  1EIH A;  2B8G A;  1QB5 D;  3I8Z A;  4JI2 L;  4DU9 A;  4EQN A;  3KJP A;  4Z9C B;  4BY1 H;  1EY5 A;  3VDY A;  4Y52 H;  1IYJ B;  1H9M A;  2JA6 G;  1EIF A;  3BYY B;  5FO8 B;  4LFA L;  1B53 A;  3R2I A;  2A6H C;  3D6C A;  3OHX C;  3V2T A;  1UEB A;  2P5Z X;  3FKI G;  4HAE A;  4DV3 Q;  1I3Q H;  2SNS A;  3PIP A;  2Q2I A;  1FGB D;  2EIF A;  4GOP B;  1BO0 A;  3VA5 A;  2Y0S G;  1STH A;  2V4D A;  1H9R A;  2B8F A;  2R92 G;  2AQ2 B;  2Z1C A;  5CV4 A;  1QNU A;  2IHE A;  4XTC S;  3DMU A;  3HFZ B;  3RLF A;  1HQR D;  2F0J A;  3PUW A;  5C44 H;  2K32 A;  1ESF A;  3CCQ A;  4GS3 A;  3H6M A;  1RKN A;  1LT5 D;  3D0F A;  4A3M G;  1GUS A;  4L5R C;  4A3K B;  1LTG D;  4Q5V A;  1QJO A;  1PV4 A;  2F0G A;  1G6P A;  4PMW A;  3PGZ A;  4FXG C;  1QZG A;  2QEJ C;  1HTL D;  2N49 A;  4OEL B;  4DV7 L;  4P71 A;  4ZLT F;  1J6Q A;  1YNN C;  4CKC A;  1FNU A;  5FOB B;  1QG7 A;  3RN5 A;  4IFD H;  3H0G G;  3GTO B;  3OWF A;  2R3Z A;  1PTO D;  4BWG B;  2MNA A;  5C3W A;  2EY6 A;  2NZH A;  3BVG A;  3MVV A;  2F4V L;  1L1O C;  2PMZ E;  2UUA Q;  3ICE A;  4DGZ A;  1UWV A;  4IUP A;  4M8A A;  2XRS D;  2M9V A;  2SNM A;  4JV5 L;  2D2C C;  1BNZ A;  5ELD A;  4YIJ A;  4FF3 A;  1WTO A;  5ELN A;  4JI8 Q;  2VS1 A;  4BY7 B;  2GVB A;  1E22 A;  1HNW Q;  1AZQ A;  1A3V A;  3S14 H;  3K5L A;  4X64 L;  4WOR A;  2FJ2 A;  1KD1 C;  3A8J E;  4WFN 3;  3T1Y Q;  1VQ7 A;  2ASB A;  3HOU H;  1BBU A;  2MO0 A;  2B29 A;  4IAL A;  5FO9 B;  4LF6 Q;  3NTI A;  5CV6 A;  1HUN A;  5COY A;  1O7Z A;  1TR5 A;  3MEF A;  3KOJ A;  4KMU C;  3HOW H;  2Q2H A;  3L9A X;  1O7Y A;  1IXR A;  4OWT B;  4TQU S;  2RCF A;  4PNY A;  1IBK L;  1CHP D;  3F2C A;  3LX0 A;  4RGN A;  2EYP A;  3GQB A;  1FJG Q;  1M8A A;  1V1P A;  2UUC Q;  1LUZ A;  4MZ9 A;  1IKM A;  1WTP A;  2PNH A;  4RAU C;  2LY7 A;  2E2I B;  2D0P A;  3TP5 A;  4XIG S;  1F9R A;  2R93 B;  3S24 A;  1VMP A;  4LF8 Q;  1NBW A;  2ICE C;  4G7H C;  2WB1 E;  3KBG A;  4EGV A;  3AEV A;  3A7L A;  1SYD A;  1CKO A;  5EQ0 A;  1XNR L;  2LXJ A;  1B8A A;  4WJ4 A;  2BA0 A;  1PH5 A;  4CDE C;  1E0B A;  1OTC A;  5CV8 A;  1W2B A;  1HZB A;  1HNX L;  5FK9 C;  2Z0S A;  3A5U A;  4NPS A;  3DXJ C;  3VR6 A;  3QJY A;  1SE3 A;  1K8A C;  1F9Q A;  1XWE A;  5L37 A;  3DLL A;  2LXK A;  2JEA I;  4CDD C;  1GM5 A;  2NN6 G;  3FKI H;  1BCP B;  1E1T A;  4X65 L;  2AWN A;  3IL8 A;  3PIO A;  1ENF A;  4JI1 Q;  1EY6 A;  2G5D A;  1I50 H;  1GUG A;  3CCU A;  4B3R Q;  5DM6 3;  3KLR A;  4DV1 L;  4LUV A;  2EY5 A;  3TZU A;  4DF7 A;  4QUF A;  1XMO L;  1Y1W B;  3I4O A;  3MZ5 A;  1GO3 E;  1PHJ A;  3Q24 A;  1FVI A;  5NUC A;  1PYS B;  5IP9 G;  4DV5 L;  1D6E C;  1D2B A;  4ZKC B;  4DR3 Q;  1Y1V G;  3S1Q H;  4LF5 Q;  2NB0 A;  3RMH A;  4JI5 Q;  3J80 i;  4A3M H;  1I94 Q;  5IOC A;  4Q0F A;  3KF8 A;  1KRS A;  2RA4 A;  1XPO A;  1SYB A;  3J7A V;  2IX0 A;  4C3J B;  4YCW A;  1Y8O B;  1X9N A;  2KHI A;  1OXV A;  2L55 A;  3RR5 A;  5EBD A;  4DPG A;  3AB9 A;  1G8Z D;  4L5S A;  3S15 H;  3NWT A;  3QO2 A;  4B08 A;  4A3F B;  3H0G H;  1YVC A;  4ABN A;  3PO2 B;  3CHB D;  4JPB W;  4U68 A;  2RQX A;  1EUJ A;  2I0Q A;  4A3J H;  2K5W A;  3TDQ A;  1CKN A;  1MKH A;  3GTM B;  1SLJ A;  5KND A;  2ZM6 Q;  1RIP A;  1BOS A;  3CP0 A;  1OO9 B;  2M2L A;  4U67 3;  4ME3 A;  4P72 A;  5M3F H;  1JR0 D;  1ET9 A;  4G4K A;  4DV3 L;  3C2P A;  5M5X H;  3T13 A;  2QDL A;  2R61 A;  3F2B A;  3A56 A;  4BBR H;  2L1B A;  4LK1 C;  5LMN L;  5T1G A;  4DV6 Q;  1SYC A;  3PMF A;  4X3S A;  1STA A;  2NVY B;  1IHZ A;  4RA8 A;  5I6Y A;  3SR1 A;  1QIL A;  2B2U C;  4EQ5 A;  3P1H A;  1JE5 A;  2F0F A;  5LMU L;  3HOV G;  1P8L A;  1YNJ C;  1TWC B;  3GD7 A;  3NEL A;  2RDF A;  2AQ3 B;  3K7A H;  4DV0 Q;  1U4M A;  3J7Z C;  3HOY G;  2EJG C;  1IW7 C;  3PIP 3;  3OIP A;  1B70 B;  2SEB D;  3TME A;  2BOS A;  5C4H A;  2JA7 G;  1XYI A;  4GZY C;  1K28 A;  2WKC A;  1M1K C;  2E2H H;  1F2L A;  1B3A A;  2JEB I;  2UXB L;  1UEA B;  4A3E B;  4O2D A;  1I6H B;  3U4V A;  4QIW E;  1WJJ A;  1JMC A;  2E76 C;  1G2S A;  3VYS A;  2WAQ B;  4WJ3 M;  1AN8 A;  1DYQ A;  1EQR A;  1PTO F;  1TVX A;  5H1S E;  4YY3 Q;  3GTL H;  2ZTE A;  1HRJ A;  3E3X A;  1WTH A;  4R1J A;  4OHJ A;  2MGS A;  2JP1 A;  1Q81 C;  2HQE A;  1Q7Y C;  1KAW A;  2HD3 A;  1ZXT A;  2HUG A;  2UUA L;  1V1P B;  2VW9 A;  1ASZ A;  1TS3 A;  2OQ0 A;  2MQH A;  1DJR D;  1SBB B;  4GKJ Q;  4X3K A;  3BS1 A;  1XPR A;  4KKU A;  1V9P A;  1KAA A;  4FF1 A;  4O42 A;  2PPB C;  4JG2 A;  3M7N A;  2Q8I B;  4DV2 Q;  1QZH A;  5D3D A;  4JI8 L;  2F0E A;  2NN6 H;  1JWU D;  4HN7 A;  4X66 Q;  2VL6 A;  3ERQ A;  4I65 A;  1HNW L;  3I4L A;  1XNQ L;  3AQQ A;  2N8N A;  2FFK B;  3QIA A;  3T1Y L;  2R7Z B;  2XRQ D;  5GAD C;  1HR0 L;  4KD3 A;  2E5L Q;  4OO1 G;  1STE A;  2KEC A;  5C4J B;  3MAQ A;  3MXG A;  5JEA J;  5J39 A;  4JI6 L;  3CRK C;  1PVO A;  5IP9 H;  1BKB A;  2WB1 G;  2A19 A;  1QVG A;  4TSS A;  3D6W A;  4JI3 Q;  4UHV A;  2FIN B;  4NXN Q;  3F1Z A;  4DR1 Q;  1DCZ A;  3TRZ A;  4KK7 A;  4K6D A;  4LAA A;  4RH6 A;  1VQ5 A;  2L15 A;  3V96 A;  4DAV A;  1SE4 A;  5C5M A;  3K8A A;  5IYD G;  1MJE A;  1GHK A;  1FJG L;  3OMG A;  4MN3 A;  4JCV E;  2K4K A;  2MP1 A;  3RD4 A;  5JJL A;  3X3M A;  3DUZ A;  1EYA A;  3H3V I;  4N9P A;  1NMG A;  3DM3 A;  1TT2 A;  3QG1 A;  3GTK B;  3S1M H;  3RLO A;  3SDZ A;  1DOK A;  4QL5 A;  1DOM A;  4X3T A;  5K36 G;  2AKW B;  4A3K G;  2F0Q A;  1L1O A;  5DEH A;  2K5D A;  2F0N A;  4EVO A;  3S1N B;  3KF8 B;  1ICF B;  3ULJ A;  3KF6 A;  4B9X A;  4Y7N H;  3M4O B;  4RKL A;  3OPO A;  4KKT A;  1VQ9 A;  1EIY B;  1QNK A;  4BXX G;  2F0I A;  4OXP A;  3HOX G;  1SNO A;  4LF4 Q;  3GTG H;  3I91 A;  5CR3 A;  1ZYR D;  3KBX A;  3MC0 B;  2HCI A;  2QCP X;  5E1F A;  1JJ2 A;  4FF4 A;  1I4R A;  5DM7 3;  2RBM A;  2ICI A;  4KY5 A;  1JJG A;  2KEN A;  3ONA B;  5KGU A;  2EYJ A;  1JJC B;  4JI0 Q;  4DR7 Q;  4B3R L;  4BY1 G;  3C46 A;  2NVQ B;  4KKS A;  2X69 A;  2WKD A;  1PFN A;  1L0W A;  4H7B A;  5M5Y B;  1CKN B;  1ENC A;  5IT9 E;  4OX9 Q;  5IT9 L;  5C0X I;  3H15 A;  1SNP A;  1SNM A;  3EN2 A;  1YJW A;  2KOL A;  3HOV H;  4DR3 L;  2LMC B;  3FEW X;  3HKZ B;  4JW0 A;  3R8B A;  4X62 L;  3NWS A;  4LF5 L;  1TWA B;  3H94 A;  2WAQ E;  2JJQ A;  3KK7 A;  1R4P B;  4L5Q A;  5IT9 c;  3VR2 A;  5EJW A;  3HOY H;  4JI5 L;  2Q8T A;  1HA5 A;  3GV3 A;  1I94 L;  2H5X A;  2BE5 D;  2C35 B;  4DV4 Q;  1PA6 A;  1G29 1;  2Z4H A;  1IYV A;  3R3O A;  5IP7 G;  1EQV A;  1JQY D;  1PTO C;  1EY8 A;  5IIF A;  1T5X D;  1NY4 A;  3GP7 A;  3ER0 A;  1VMC A;  5EAY A;  3VA7 A;  4HIO A;  1I4Q A;  1I4X A;  1JOK A;  3TP6 A;  1UNS A;  3W5O A;  4R4O A;  1SEB D;  3CC4 A;  3GDE A;  1LV9 A;  1X3P A;  1R9T B;  1BBX C;  2N88 A;  3VR3 A;  4ZUJ A;  2FMC A;  3KLS X;  3PO3 B;  5HGT A;  3S17 B;  1VQH A;  1KHI A;  3CU7 A;  4F7X A;  2R93 G;  4HJ5 A;  2ZM6 L;  3QR8 A;  2OEO A;  1HZ9 A;  1HNZ L;  1IL2 A;  3T51 B;  1BUV T;  3D4D A;  2B2Y A;  4IPG A;  2N78 A;  2UU9 L;  1K0S A;  3K7U C;  1KLU D;  4DV6 L;  1C4Q A;  1EWH A;  5M9O A;  3L2P A;  4RGM A;  1YIJ A;  3I70 A;  1K9M C;  4ZKB B;  5JVH 3;  2JE6 I;  4HR7 B;  1NR2 A;  4DXG A;  4OO1 H;  1HA6 A;  1P16 A;  4DKA C;  3B6Y A;  4OWX B;  2GA4 B;  4XYO A;  5FJ8 G;  2J0T D;  2IX3 A;  2O4X A;  1B50 A;  4GKK Q;  1A3U A;  1TKW B;  1Y1W G;  2QA4 A;  3KYH C;  1H9J A;  4XQN A;  1A2T A;  3ND9 A;  2PW7 A;  4UY8 C;  2YTV A;  1ENA A;  2ENB A;  2K5H A;  1HH2 P;  4YY3 L;  4QUC A;  2F0V A;  2LKV A;  1LTI D;  3EIV A;  5LHY 1;  5KNB A;  1TQO A;  4G7Z C;  4A3K H;  4HMJ A;  3RLN A;  4PG3 A;  1PZK D;  4RCN A;  3T53 B;  1E1O A;  1KDC A;  1N8R C;  3SK4 A;  1A8V A;  2RSN A;  5C3E B;  3I4N B;  4TRD A;  4MHE A;  3BG3 A;  1LTL A;  1SXT A;  2C5C A;  4C3J G;  2QDB A;  4BXX H;  4KHP Q;  4XT1 B;  1OXU A;  1K8M A;  3S2H B;  1GUW A;  1YJN A;  2EQS A;  2R6G A;  1VQ8 A;  3GTO H;  3SGI A;  1KNE A;  2K5V A;  1EY0 A;  5GAE C;  2HCC A;  4TVA B;  1ONL A;  4X66 L;  4J6H A;  1L1O B;  3S16 B;  3HP3 A;  4APV A;  5C5L A;  1PZI D;  1AE3 A;  2D0O A;  1SE8 A;  3TBI B;  2B2U A;  4HJ9 A;  2OT2 A;  3KF6 B;  5FLX E;  3CCR A;  3IAY A;  1HTP A;  5FLX L;  2E5L L;  2K5Q A;  5BN4 A;  2AMC B;  4IJL A;  4B3M L;  3PUV A;  4DK6 C;  1TY0 A;  4O1N A;  1W6K A;  1LTB D;  4KHV A;  3BVM A;  4BY7 H;  5FLX c;  2QEX A;  3HKS A;  2VY3 A;  1JOO A;  1CTM A;  2MO1 A;  4DR1 L;  4IJH A;  1KTK A;  4EQO A;  4B9W A;  4IUV A;  1ASY A;  4KN7 C;  2IT1 A;  2K01 A;  1UE7 A;  2PZT A;  4XQJ A;  1SSO A;  4C2M B;  3DHQ A;  3I2Z A;  3URY A;  1C8C A;  2RF4 A;  2F3V A;  3VYU A;  5IP7 H;  4QY7 A;  2NTT A;  3K59 A;  1LYL A;  2WV6 D;  1LAB A;  1SYG A;  4BA2 I;  3AU7 A;  5D3I B;  5IGE A;  5CBE E;  1GUN A;  3FHW A;  3NP8 A;  3WOF A;  1MJC A;  1FR3 A;  1NSN S;  1VQI A;  2CVR A;  1RHP A;  4YWK A;  2KCC A;  2A8V A;  4P2C B;  4CKB A;  4A93 B;  1H9S A;  5F2D A;  2NVT B;  2E2I H;  4JC0 A;  5IGB A;  1JWM D;  2CQA A;  2WAQ G;  1VQP A;  1T9H A;  1U4P A;  4BBS B;  2R93 H;  4NXM L;  1W3S A;  2A69 C;  4DUY L;  4C56 C;  1IKL A;  2L9H A;  1NAP A;  2NYZ D;  3TP7 A;  1F2Z A;  2H1E A;  1CA5 A;  4DR7 L;  4A3J G;  3PUY A;  1VQG A;  1KXL A;  2VQE Q;  4POF A;  4DA2 A;  1KAB A;  1PZJ D;  3FP9 A;  4MIU A;  2CWA A;  1DD2 A;  1IZ6 A;  3F8T A;  1PYB A;  2L5T A;  1CM9 A;  5M3F G;  5LL6 S;  3J81 L;  5I2X A;  3IFD A;  4BBR G;  5FJ8 H;  1Y8P B;  4A3L H;  1GVP A;  1ILP A;  3EA6 A;  1W6J A;  2QGQ A;  3Q8D A;  3MXN A;  2R7Z G;  2Z6B A;  2AUJ D;  1Y1W H;  1I6V C;  2K28 A;  5E3F A;  2VQF Q;  1EFI D;  4ODG A;  3L7Z C;  4A3G B;  3R2T A;  1FNV A;  1D1I A;  1O7L A;  1I3Q B;  1NUC A;  1XPU A;  3ULL A;  3Q0A A;  1CA6 A;  1EWC A;  4KTA A;  2TSS A;  1D5X C;  5TSS A;  1BXT A;  1V43 A;  4JI7 Q;  2VB3 X;  4RKB A;  3PV0 A;  3K58 A;  2F0P A;  4ZK9 B;  4C3J H;  2O5I C;  1Y8N B;  1H95 A;  2FXQ A;  5FLM G;  4P73 A;  4IO9 A;  1VQL A;  2CH4 W;  5AFW A;  5FO7 B;  1D7Q A;  4A3F H;  3NEM A;  4IUT A;  4LW1 A;  4YWM A;  5IE8 A;  3PO2 H;  1VF7 A;  3GTQ B;  1MHW C;  2K14 A;  4XYQ A;  3AMU A;  1Q86 C;  2K33 A;  1X3Q A;  5M5W B;  1NTG A;  5HGQ A;  1PH9 A;  3K57 A;  4WRD A;  3VYR A;  3GTM H;  2PI2 A;  4P75 A;  2F3I A;  2HQL A;  2A5H A;  1G2T A;  3HGB A;  3K6O A;  1RTN A;  4JK1 C;  1S72 A;  4A3B B;  3M85 A;  4OEM B;  4DUZ Q;  3E0J A;  4LUZ A;  2K7V A;  1LTT D;  1GJX A;  3DWA A;  3CPF A;  5EPJ A;  4GKK L;  5G3L D;  3C3L A;  2B2Y C;  2F0O A;  1WTX A;  2ALY B;  1K0R A;  2NVY H;  5I6W A;  3TEH B;  5C0X J;  2F0K A;  2JXM B;  3Q23 A;  2EXZ A;  1SJH D;  1UE1 A;  4CHT B;  3HKZ G;  1TWC H;  2UXC Q;  2DJG C;  4NKL A;  5BN3 A;  5IYB H;  2EJM A;  4DXF A;  1U0L A;  3LGJ A;  4IUR A;  4YHH Q;  5JEA G;  3OOC A;  2DGY A;  2CH4 A;  2JA8 B;  1N34 Q;  3CW2 C;  1VQ4 A;  2HHH L;  3WWV A;  1GKH A;  2B39 A;  4KV6 A;  2WII B;  2YV5 A;  1ZYR C;  2F1M A;  3PCO B;  4V19 0;  5IY0 A;  2XWJ B;  1AH9 A;  4A3E H;  1K73 C;  2IL8 A;  3HOW B;  3Q6S A;  4KHP L;  2EJF C;  1KDA A;  5AJ3 Q;  1PH8 A;  2XTI A;  1VQA A;  2KQ3 A;  3M4Q A;  1AE2 A;  3KLS A;  1A2U A;  1WD1 A;  3OW7 A;  4J1M A;  4AQY L;  1HJP A;  1RCV D;  3F2U A;  1PFM A;  1B3Q A;  1YEZ A;  3MTS A;  4IUN A;  2F0S A;  4PZ7 A;  1CT1 D;  3K5M A;  1QVF A;  3VR5 A;  3PO3 G;  3A74 A;  2K6A A;  2F0L A;  1H9S B;  1WVL A;  1N32 Q;  4MTN A;  4LFC Q;  3STB D;  1G6Z A;  1STG A;  4R9W A;  1TS5 A;  3JAM E;  3DM1 A;  2RCN A;  4FF2 A;  3JAM L;  2F0U A;  2BE5 C;  1PRT D;  4ID6 A;  3I55 A;  5I9O A;  1C7Y A;  1E3P A;  1X56 A;  1WTR A;  2BDN A;  4JBJ A;  1S5D D;  2AUK A;  2A69 D;  3CF5 A;  1SFO B;  2CW0 D;  2A6E D;  4KJO A;  3JAM c;  2PZU A;  1EEI D;  2R7Z H;  5HUR A;  4PMB A;  1X3F A;  2JA6 B;  5C4J H;  4UP9 A;  2FMM A;  1DOL A;  4C3I B;  4A3D B;  4WJW A;  2A74 C;  1SRU A;  5E7N A;  1HXY D;  2Y0S B;  1RL2 A;  1L0Y B;  4PZ6 A;  2EDG A;  3BZD B;  5CBA E;  1D5M C;  3S2D B;  3HOZ B;  2R92 B;  5BR8 Q;  2RKS A;  1IBL Q;  3NBI A;  3C1E A;  3F2D A;  3MXN B;  2KCN A;  4ZCK A;  5CV7 A;  4DNI A;  1VQD A;  3BJU A;  5FLM H;  3E9H A;  1F2Y A;  5E4W C;  4HIK A;  3EFX D;  3GTK H;  1D5Z C;  2KVM A;  4A76 A;  3ERS X;  4FP5 D;  4H02 A;  2I5H A;  2UUB Q;  3QOL A;  2J4X A;  5DLQ E;  4IFD I;  4DR5 Q;  2MPM A;  4JBK A;  1PH3 A;  3I4N G;  4G7O C;  4RGO S;  5I9P A;  2VQE L;  3M4O H;  3H3V C;  2G9H D;  5COR A;  3RNU A;  1ROD A;  2I5M X;  1LAC A;  5LL6 X;  1U5K A;  1SN8 A;  4R4T A;  4C1N K;  1M90 C;  2Z4I A;  2NUC A;  1VF5 C;  2RDG A;  4K5X A;  4RMF A;  3S15 B;  4NW2 A;  1LTS D;  3G6E A;  3GTJ B;  1IL8 A;  4XXE A;  1PYW D;  3HZX A;  4MNO A;  1Z9F A;  3ND8 A;  2JN4 A;  3CMA A;  1EY9 A;  2F0T A;  4HIM A;  2IX1 A;  5E4X A;  2NVQ H;  1CKM A;  1V8Q A;  1MGS A;  1SJE D;  3ERO A;  4LF6 L;  2GN5 A;  5GRO A;  1Z6H A;  1TWF B;  5M5Y H;  1YZ6 A;  3PUZ A;  1CUK A;  1SRO A;  1ML0 D;  2PCF B;  1QCB D;  2Q2T A;  3M3Y B;  2HT1 A;  4HID A;  1DON A;  2G9D A;  1BR9 A;  1II3 A;  1E24 A;  1TWA H;  3I72 A;  1HHV A;  3S9W A;  4JI7 L;  5JEA H;  2L12 A;  1ICW A;  3CME A;  1FD7 D;  1QUQ A;  3GTP B;  1CZG A;  2UUC L;  4B3T Q;  3OTO Q;  1FGU A;  1PTO B;  1TWH B;  2K50 A;  2EZV A;  3TRE A;  2ZJR A;  1KRT A;  1VQM A;  5ELO A;  1AFP A;  1E2Z A;  4ULL A;  2LFN A;  4LF8 L;  2YU9 B;  1VQK A;  1VCI A;  3FMC A;  2WAC A;  4L8J A;  2IW3 A;  4RGT A;  1R9T H;  2ZXO A;  3BYT B;  5EKK A;  4FXD A;  1PMR A;  1Q46 A;  2NTS A;  1STN A;  2F03 A;  3NK9 A;  3PO3 H;  3S17 H;  4XDX A;  4IUU A;  3TZD A;  3FVQ A;  3A0J A;  4BBS G;  1EZ6 A;  2XIW A;  1Q90 A;  5D14 A;  1BDO A;  3MEH A;  3OSO A;  4IUQ A;  2A68 D;  5G3L F;  2OF1 A;  4JI1 L;  2QIL A;  4NDX A;  2EYH A;  4PV1 C;  1F77 A;  1LM0 A;  1PH4 A;  4RFB A;  1HZC A;  1PH1 A;  4AH6 A;  4QGU A;  3ZJY C;  2Z9H A;  1N36 Q;  3BDC A;  4DR2 Q;  1K83 B;  1S5B D;  4R8N A;  3CCS A;  4OWW B;  2DUD A;  4YCV A;  2JA5 B;  2I46 A;  2QF7 A;  4BY7 G;  4GLA C;  2UXC L;  1PDQ A;  2EYL A;  1S40 A;  3A8I E;  1WCM B;  4DK3 C;  3QB3 A;  1Y69 U;  2UXD Q;  1XMQ Q;  3RUZ A;  4QQB X;  1J5E Q;  3IKJ A;  3PIO 3;  1N34 L;  3S1R B;  2F0M A;  1KNA A;  1GUO A;  1I4H A;  1PLF A;  3N52 A;  3SXH A;  4ZUI A;  4GLX A;  1Z7T A;  4DR6 Q;  4A3G G;  2E74 C;  4FNF A;  3BU2 A;  4C3H B;  5M3M B;  1WYD A;  4UDU C;  1UE6 A;  2XGT A;  1VQC A;  1Y1V B;  2B3G A;  1I5F A;  1EEF D;  2JSO A;  1LT3 D;  3MA2 B;  4R8I A;  3NHH A;  4X64 Q;  3K80 C;  1TS4 A;  1BCP D;  3NSW A;  1HCZ A;  3T16 A;  5LMN W;  4K5W A;  4POG A;  3A54 A;  2KHS A;  2VXW A;  3I7F A;  5C3E H;  4B3S Q;  4AYB B;  4HED A;  3I4N H;  1WTQ A;  5ELC A;  1GOZ A;  4N8X 1;  4PQX A;  4LFC L;  3CQZ B;  3CCV A;  3S2H H;  4LFB Q;  3L0O A;  1PRT F;  2B63 B;  3D8G A;  5ELE A;  3UDG A;  2HDL A;  3OIQ A;  1YHB A;  2VUM B;  3S16 H;  2C9O A;  1EU4 A;  2EE1 A;  5C4X B;  1L2F A;  4K14 A;  3G4S A;  5EPK A;  1H9K A;  1UUP A;  3RZD B;  3OYY A;  1HQM C;  4FDB A;  1CQV A;  1X6O A;  3KLW A;  4JYA Q;  4GN4 B;  4QMG A;  3NTK A;  5IOD A;  3P7J A;  1DGS A;  4DV0 L;  4KLK A;  4A3L G;  2IY5 B;  2E8G A;  2YTX A;  3U9O A;  5BR8 L;  4IOC A;  3CCJ A;  1JWS D;  5DAU A;  3KDF A;  3M7G A;  1PXU A;  1O78 A;  4HTH A;  4ALP A;  3EQL C;  5JPM C;  3DWQ A;  1K3B C;  2KEE A;  4C2M H;  2CHB D;  3TSS A;  5ISR A;  2DJF C;  3SE0 A;  1X3E A;  4X65 Q;  2DN8 A;  3FPP A;  2PMZ B;  1EWI A;  1SMY D;  2UUB L;  4DV1 Q;  2JA8 G;  3MXU A;  3NQT A;  4DR5 L;  5CGK A;  1VQ6 A;  1KLG D;  1XMO Q;  2JA7 B;  1QUQ B;  5GAG C;  1KDB A;  2IJ0 A;  4A93 H;  1TWG B;  4IPD A;  4DV5 Q;  3HRZ C;  1A15 A;  1HR0 W;  2NVT H;  1XTD A;  2CQO A;  4GKJ L;  2ATW A;  2ZT9 C;  4BBS H;  1JOQ A;  3TQY A;  4A3F G;  4A75 A;  4DV2 L;  2OCE A;  3HEJ A;  1EL0 A;  3PO2 G;  4K2K A;  1X65 A;  1SMX A;  1ILQ A;  3HKZ E;  4CJ0 B;  1YIT A;  2NN6 I;  3JC6 6;  1A6X A;  2YYZ A;  3A5Z B;  4RG1 A;  4JVZ A;  1XJV A;  2DY8 A;  1Q8I A;  2XN9 C;  5JVG 3;  1E2V A;  3RZO B;  2JA9 A;  2L0C A;  4OIJ A;  1B2T A;  1JC7 A;  3NXW A;  4KY7 A;  2F52 A;  1QVC A;  2B2W C;  3OW2 A;  4JI3 L;  3U58 A;  4ZAI A;  1E2W A;  3NE5 B;  4NXN L;  4HMI A;  1CSP A;  4LF9 Q;  4J15 A;  3MWY W;  2HIX A;  2NVX B;  1VQN A;  2PZW A;  4R4I A;  4B3T L;  1QWY A;  3OTO L;  3KUP A;  5BN5 A;  4DAY A;  4AYB E;  4A3G H;  4QB4 A;  4C3I G;  5C3X A;  4A3D G;  2OTJ A;  2WB1 B;  5T1I A;  3J81 i;  2RSO A;  5IYB G;  2MUY A;  4DN4 M;  5LMN Q;  3HOZ G;  5JJZ A;  1HFN A;  5C0X G;  3A55 A;  3BVZ A;  3CC7 A;  3STB C;  4DR4 Q;  4RCO A;  4A3I B;  1U9R A;  2KED A;  4A3E G;  2CFM A;  2WFW A;  5LMU Q;  1STY A;  4LF4 L;  4A3C G;  1PRT C;  1V1Q A;  3I4M B;  5CV9 A;  2KJX A;  1X54 A;  2K1B A;  1X3G A;  2CW0 C;  2A6E C;  4IQZ A;  3WOE A;  4JI4 Q;  1A0I A;  2AHO B;  2MJ8 A;  2Z6K C;  3GTQ H;  4IFD J;  4HSP A;  4JI0 L;  1HFG A;  4UP8 A;  5EKL A;  1T5E A;  3X3N A;  1IBM Q;  3UDF A;  2B2V C;  1STB A;  2E2J B;  2XNA C;  1EIG A;  3M4Y A;  2OWO A;  3M9B A;  5J3B A;  5M5W H;  2UXB Q;  1VQF A;  3D3R A;  2TMP A;  1N36 L;  3HOX B;  4F87 A;  2XSC A;  4DR2 L;  2GVA A;  5A2Q E;  1VDZ A;  4OX9 L;  3P75 A;  5A2Q L;  5I2Y A;  4GNX A;  1E7Z A;  2ZTC A;  3J81 E;  2BCO A;  1TII D;  3EJI A;  4A3B H;  4HJ7 A;  5ELF A;  1CFM A;  2UXD L;  2SDF A;  2HIV A;  1XMQ L;  3PQI A;  1YJ9 A;  2JYO A;  5J22 A;  1L0X B;  3H91 A;  5IWA Q;  1J5E L;  4BY1 B;  3BDO A;  4I7Z C;  3BZK A;  3J81 c;  1MD2 D;  1RTO A;  2DY7 A;  5CV5 A;  2O5J C;  3PF4 A;  4DV4 L;  3HS0 C;  4H0L C;  2Q8R E;  3H09 A;  3PSI A;  5EGT A;  4XQQ A;  4DR6 L;  1UE5 A;  1MBY A;  2RVL A;  4FVM A;  2K5N A;  1NE3 A;  3DEP A;  3E5S A;  1Y14 B;  2JQO A;  3T56 B;  1LO5 D;  1SND A;  4FO2 A;  4GOP C;  1Q82 C;  2FHT A;  1BCP F;  1XNQ Q;  4C1N I;  2VZA A;  1DZ1 A;  2JA8 H;  3VR4 A;  2KCM A;  1VQB A;  4BA1 I;  4KN4 C;  1PFS A;  1HR0 Q;  3KDF B;  1N33 Q;  3NQI A;  4B3S L;  5J1Z A;  4F88 A;  2I07 B;  2A73 B;  4JI6 Q;  3SK6 A;  4DAM A;  2E2D C;  5C4Z A;  2K75 A;  1A62 A;  5C44 B;  4LFB L;  3K81 C;  4DK1 A;  1Q1E A;  2X6L A;  1MSG A;  3NTH A;  4N9T A;  1TXY A;  3GO5 A;  4JOI C;  1G51 A;  3ZYY X;  3CXC A;  3TN2 A;  3W1G A;  1NR4 A;  2PNR C;  3CCL A;  3H3V H;  2F0H A;  4LF7 Q;  3UE0 A;  3Q22 A;  3D4W A;  2A1A A;  1F9P A;  1C9O A;  4OGQ C;  3DEO A;  4JYA L;  3TS0 A;  5JAV A;  1BF4 A;  2V1C C;  2E75 C;  3U50 C;  3I3C A;  4HJA A;  4OO1 I;  5D65 A;  1MI2 A;  2X6G A;  4E6I A;  4KHZ A;  5EBC A;  2PQA A;  1SFO H;  4LMQ D;  4QIW B;  2O2L D;  3A7A B;  1B4O A;  3VYT A;  1BQQ T;  1SNQ A;  4MTK A;  2JA6 H;  1LT6 D;  3BDL A;  2R7F A;  4TKO B;  1G91 A;  1S5C D;  5JOB A;  2JA5 G;  3J7Y W;  1F2M A;  1YHA A;  4IOA A;  4CBV A;  3JAM i;  4C3I H;  4A3D H;  2CWP A;  2DNC A;  1WCM G;  1VQE A;  2EYO A;  4LUO A;  3CAM A;  2AQ1 B;  2LSS A;  4HCS A;  3KFU A;  1RDP D;  3S14 B;  1CSQ A;  3S2D H;  3HOZ H;  2B2T C;  4HCE A;  2R92 H;  3NEN A;  2JK8 A;  5C0X H;  3HOU B;  1S5F D;  4I7A A;  5KNC A;  4C3H G;  1I6H H;  5M3M G;  4DAY B;  2A68 C;  5IGD A;  2BH8 A;  4A3C H;  3WDN A;  4X62 Q;  1JB7 A;  4DK0 A;  5DNF A;  1TY2 A;  1EOV A;  2A6H D;  3E0E A;  1ESR A;  1Q8K A;  2SOB A;  4OIK A;  3P20 A;  2KBN A;  1GXD C;  4L5T A;  4AYB G;  2PW5 A;  2M00 A;  1DXM A;  1YNX A;  1LT4 D;  2KA7 A;  5FKA C;  1EYC A;  5C6A A;  3DWP A;  3FRP B;  3MHB A;  1RJT A;  4K8J A;  3U4Z A;  2K52 A;  3G71 A;  4KY6 A;  4LNQ A;  3G6J B;  1MIU A;  2B63 G;  2DNE A;  3GTJ H;  1LLR D;  2EPB A;  2QKI C;  4ZQ3 A;  1HPC A;  3AYH B;  2L4N A;  5JJK A;  2IHF A;  2VUM G;  4P74 A;  1JIC A;  4LF9 L;  5C4X G;  5EPL A;  4DNR B;  1SYE A;  1GUT A;  4O0A A;  4RHS A;  5I4D A;  1TWF H;  4FXK C;  5JPN C;  4K6L A;  1AP0 A;  3GV6 A;  4RWS C;  1A63 A;  3M3Y H;  3FDT A;  4G57 A;  3NBH A;  3FKI B;  1HNZ Q;  4GNX B;  1GD7 A;  1BCP C;  3MFY A;  1PFB A;  2UU9 Q;  1YNN D;  4QCL A;  1I50 B;  1UAP A;  3CD6 A;  4IPH A;  3J80 E;  1CK1 A;  3IFT A;  3J80 L;  2HDM A;  3W2D A;  1K8G A;  3SVM A;  1OXT A;  2NBF A;  3GTP H;  1FL0 A;  4NB3 A;  4DR4 L;  1S5E D;  1GHJ A;  2ZJQ A;  3M4P A;  3SHL A;  3J80 c;  1D8L A;  1PTO H;  1TWH H;  2EXD A;  2QW7 A;  3J7A 5;  2KHJ A;  2D9U A;  1VS0 A;  2NWG A;  3LWE A;  4S3S A;  3UE1 A;  3BZC A;  3S1Q B;  5CYU A;  1YHQ A;  4GN3 B;  2YU9 H;  4JI4 L;  3NUC A;  3EVQ A;  4A3M B;  1XX8 A;  1EYG A;  4OON A;  2D5D A;  2N55 A;  1V1O A;  1F9S A;  4H13 C;  1SE2 A;  5C3E G;  1IBM L;  3S1N H;  1HUM A;  4DFA A;  5KYI A;  1EQT A;  3ITP A;  1YI2 A;  4K0K Q;  1Q3L A;  4EX5 A;  1R4Q B;  1A3T A;  1RD9 D;  1TS2 A;  3T1H Q;  1ET6 A;  1IYU A;  1O7I A;  5KRU A;  1AZP A;  3TS2 A;  2OQK A;  2H4O A;  2B2W A;  1BBW A;  3PUX A;  1J8I A;  1M4V A;  3H0G B;  3K0X A;  5A35 A;  1OXS C;  4R4Q A;  1NMF A;  4GLV B;  4ZYS A;  1WFQ A;  4A3J B;  4CGY B;  3OWE B;  5IWA L;  1X55 A;  3CCM A;  1SDF A;  1B44 D;  5KIX A;  4NP5 A;  2MFI A;  1LTR D;  1K83 H;  3I56 A;  1CI3 M;  2VQF L;  2F0W A;  1EOT A;  1SMY C;  3T4A C;  2JA5 H;  2OTL A;  5M3F B;  1S4Z A;  5M5X B;  2PQE A;  1WCM H;  4GNX C;  1LTA D;  2RHQ B;  2KCT A;  4RHR A;  4JI2 Q;  4ILW A;  4BBR B;  2ZXR A;  5IGF A;  1N9W A;  4UP7 A;  3V05 A;  3PF5 A;  2PQA B;  1FNW A;  2XVS A;  5KYL A;  3S1R H;  2CCZ A;  1SNC A;  4QJF A;  1N33 L;  2IWH A;  4LFA Q;  4IN3 A;  4EQP A;  4ZRZ A;  4B3M Q;  1S3O A;  3J81 j;  2ID0 A;  4C3H H;  4N8F A;  1KQS A;  3CC2 A;  5M3M H;  1PH7 A; 
#chains in the Genus database with same CATH homology
 4DAP A;  4K8I A;  3K7A B;  1I4G A;  3N6R A;  4IZ8 A;  4QF4 A;  1FYC A;  2ZXP A;  2B2V A;  1NCV A;  1Q1B A;  2BDO A;  2E2H B;  2EVB A;  2EYF A;  3U9S A;  3E6Z X;  1I4P A;  3NPP A;  3SK8 A;  1DM0 B;  3GTL B;  2Z8L A;  1JB3 A;  1B1Z A;  4K2L A;  1B9N A;  2MHV A;  1AW7 A;  3UI2 A;  2IPK D;  4JBW A;  2VB2 X;  1AEX A;  3I90 A;  2XWB B;  1O80 A;  4DNT B;  3HG9 A;  3W3A A;  4KD4 A;  5CMD A;  2WIN B;  5CC4 A;  5EKI A;  1B9M A;  3K5O A;  1WTV A;  4NMZ A;  2EOT A;  3MXP A;  3O13 A;  1JE4 A;  4CJ2 C;  1ZEQ X;  1D1K A;  4ME5 A;  1JOR A;  1U4L A;  1U4R A;  1J9O A;  5IGG A;  1SAP A;  4LJZ C;  4J8Q A;  4V0B A;  4K5V A;  2PYK A;  3K5N A;  1EYD A;  2K03 A;  2F4I A;  1EY7 A;  1K8O A;  1SYF A;  1CZW A;  1CQF A;  1Q12 A;  3S1M B;  4OL7 A;  1CHQ D;  4PMC A;  4L63 B;  4M1U B;  5KEE A;  1OXX K;  1RF2 D;  1YNJ D;  3C1F A;  3G7L A;  3I73 A;  4FYD A;  3D4R A;  5K5P A;  2PO4 A;  1JCK B;  1IW7 D;  4Y7N B;  2L11 A;  3K0Y A;  3GTG B;  1MSH A;  3MFG A;  4IFD G;  1Z47 A;  1EU3 A;  2WP8 J;  2K05 A;  4F8M A;  1ZKO A;  3D31 A;  3CRL C;  2B2T A;  2AWO A;  1QE6 A;  1TU2 B;  2D62 A;  2KUM A;  1XXG A;  3CKI B;  3SK5 A;  2BA1 A;  3OMC A;  3J7A F;  5ELB A;  2J7Z A;  2EY1 A;  2EY2 A;  4H44 C;  2NZ1 D;  3SEB A;  4KI0 A;  4KJN A;  1WTW A;  4CJ1 B;  3HOV B;  2RDH A;  1EZ8 A;  4UAI A;  1C48 A;  3HOY B;  3QWN A;  4X3U A;  2F0D A;  1WD0 A;  3R93 A;  3L3O C;  2OXP A;  4L6T B;  1PRT B;  5K36 H;  2K04 A;  1X32 A;  2LS0 1;  5IGC A;  1EY4 A;  4CKE A;  3FPU B;  3A8K E;  3LNN A;  1QOH A;  2EYM A;  4BS9 A;  3TP8 A;  2F3W A;  2VNU D;  1XTC D;  3LWU A;  3QOJ A;  4XT3 B;  4HSV A;  1EIH A;  2B8G A;  1QB5 D;  3I8Z A;  4DU9 A;  4EQN A;  4Z9C B;  1EY5 A;  1H9M A;  3BYY B;  5FO8 B;  1B53 A;  3R2I A;  2A6H C;  3D6C A;  3OHX C;  3V2T A;  4HAE A;  2SNS A;  1FGB D;  1BO0 A;  3VA5 A;  1STH A;  2V4D A;  1H9R A;  2B8F A;  2AQ2 B;  2Z1C A;  5CV4 A;  1QNU A;  4XTC S;  3DMU A;  3RLF A;  1HQR D;  2F0J A;  3PUW A;  2K32 A;  1ESF A;  3H6M A;  1RKN A;  1LT5 D;  1GUS A;  4A3K B;  1LTG D;  4Q5V A;  1QJO A;  2F0G A;  4PMW A;  4FXG C;  2QEJ C;  1HTL D;  4ZLT F;  4CKC A;  1YNN C;  4IFD H;  1FNU A;  5FOB B;  1QG7 A;  3GTO B;  3OWF A;  2R3Z A;  1PTO D;  4BWG B;  5C3W A;  2EY6 A;  3BVG A;  3MVV A;  4DGZ A;  4IUP A;  4M8A A;  2XRS D;  2M9V A;  2SNM A;  2D2C C;  1BNZ A;  5ELD A;  4YIJ A;  4FF3 A;  1WTO A;  4BY7 B;  1AZQ A;  1A3V A;  3K5L A;  4WOR A;  2FJ2 A;  3A8J E;  4WFN 3;  4IAL A;  5FO9 B;  3NTI A;  5CV6 A;  1HUN A;  5COY A;  1O7Z A;  1TR5 A;  4KMU C;  3L9A X;  1O7Y A;  4TQU S;  4PNY A;  1CHP D;  3LX0 A;  4RGN A;  2EYP A;  3GQB A;  1M8A A;  1V1P A;  1IKM A;  1WTP A;  4RAU C;  2LY7 A;  2E2I B;  3TP5 A;  4XIG S;  1F9R A;  2R93 B;  1VMP A;  2ICE C;  4G7H C;  3KBG A;  4EGV A;  3A7L A;  1SYD A;  5EQ0 A;  2BA0 A;  1E0B A;  5CV8 A;  5FK9 C;  3DXJ C;  3VR6 A;  3QJY A;  1SE3 A;  1F9Q A;  1XWE A;  2JEA I;  2NN6 G;  1BCP B;  2AWN A;  3IL8 A;  1ENF A;  1EY6 A;  1GUG A;  5DM6 3;  3KLR A;  2EY5 A;  3TZU A;  4DF7 A;  4QUF A;  1Y1W B;  3MZ5 A;  3Q24 A;  5NUC A;  1D6E C;  1D2B A;  4ZKC B;  2NB0 A;  3RMH A;  5IOC A;  4Q0F A;  3KF8 A;  2RA4 A;  1SYB A;  3J7A V;  2IX0 A;  4C3J B;  1Y8O B;  1OXV A;  2L55 A;  5EBD A;  3AB9 A;  1G8Z D;  3NWT A;  3QO2 A;  4B08 A;  4A3F B;  4ABN A;  3PO2 B;  3CHB D;  4U68 A;  2RQX A;  2K5W A;  3TDQ A;  3GTM B;  5KND A;  1BOS A;  1OO9 B;  2M2L A;  4U67 3;  1JR0 D;  1ET9 A;  4G4K A;  3C2P A;  3T13 A;  2R61 A;  3A56 A;  2L1B A;  4LK1 C;  5T1G A;  1SYC A;  3PMF A;  4X3S A;  1STA A;  2NVY B;  1IHZ A;  4RA8 A;  5I6Y A;  3SR1 A;  1QIL A;  2B2U C;  3P1H A;  2F0F A;  1YNJ C;  1TWC B;  3GD7 A;  2RDF A;  2AQ3 B;  1U4M A;  2EJG C;  1IW7 C;  3PIP 3;  3OIP A;  2SEB D;  3TME A;  2BOS A;  5C4H A;  4GZY C;  1XYI A;  2WKC A;  1F2L A;  1B3A A;  2JEB I;  1UEA B;  4A3E B;  1I6H B;  2E76 C;  1G2S A;  3VYS A;  2WAQ B;  1AN8 A;  1DYQ A;  1PTO F;  1TVX A;  1HRJ A;  4OHJ A;  2MGS A;  2JP1 A;  2HQE A;  1ZXT A;  2HUG A;  1V1P B;  1TS3 A;  1DJR D;  1SBB B;  4X3K A;  3BS1 A;  4KKU A;  1KAA A;  4FF1 A;  4O42 A;  2PPB C;  3M7N A;  2Q8I B;  5D3D A;  2F0E A;  2NN6 H;  1JWU D;  4HN7 A;  3ERQ A;  4I65 A;  3I4L A;  2FFK B;  3QIA A;  2R7Z B;  2XRQ D;  4KD3 A;  4OO1 G;  1STE A;  2KEC A;  5C4J B;  3MAQ A;  3MXG A;  5JEA J;  5J39 A;  3CRK C;  4TSS A;  3D6W A;  2FIN B;  1DCZ A;  4KK7 A;  4K6D A;  4LAA A;  4RH6 A;  3V96 A;  4DAV A;  1SE4 A;  5C5M A;  1GHK A;  3OMG A;  4MN3 A;  2MP1 A;  3RD4 A;  3X3M A;  3DUZ A;  1EYA A;  4N9P A;  1TT2 A;  3QG1 A;  3GTK B;  3SDZ A;  1DOK A;  1DOM A;  4X3T A;  5K36 G;  2F0Q A;  5DEH A;  2K5D A;  2F0N A;  4EVO A;  3S1N B;  4B9X A;  3M4O B;  4RKL A;  3OPO A;  4KKT A;  1QNK A;  2F0I A;  1SNO A;  3I91 A;  5CR3 A;  1ZYR D;  3KBX A;  3MC0 B;  2HCI A;  2QCP X;  5E1F A;  4FF4 A;  1I4R A;  5DM7 3;  2RBM A;  2ICI A;  4KY5 A;  3ONA B;  5KGU A;  2EYJ A;  3C46 A;  2NVQ B;  4KKS A;  2X69 A;  2WKD A;  1PFN A;  4H7B A;  5M5Y B;  1ENC A;  5IT9 E;  5IT9 L;  5C0X I;  1SNP A;  1SNM A;  2KOL A;  2LMC B;  3FEW X;  3HKZ B;  3R8B A;  3NWS A;  1TWA B;  3H94 A;  3KK7 A;  1R4P B;  3VR2 A;  5EJW A;  2Q8T A;  1HA5 A;  3GV3 A;  2BE5 D;  1G29 1;  2Z4H A;  1IYV A;  3R3O A;  1EQV A;  1JQY D;  1PTO C;  1EY8 A;  5IIF A;  1T5X D;  3GP7 A;  1VMC A;  3VA7 A;  1I4Q A;  1I4X A;  1JOK A;  3TP6 A;  1UNS A;  1SEB D;  1LV9 A;  1X3P A;  1R9T B;  1BBX C;  2N88 A;  3VR3 A;  4ZUJ A;  2FMC A;  3KLS X;  3PO3 B;  5HGT A;  3S17 B;  3CU7 A;  4F7X A;  2OEO A;  3T51 B;  1BUV T;  3D4D A;  2B2Y A;  1KLU D;  1C4Q A;  1EWH A;  5M9O A;  4RGM A;  3I70 A;  4ZKB B;  5JVH 3;  2JE6 I;  4HR7 B;  1NR2 A;  4DXG A;  4OO1 H;  1HA6 A;  2GA4 B;  4XYO A;  2J0T D;  2IX3 A;  2O4X A;  1B50 A;  1A3U A;  1TKW B;  1H9J A;  4XQN A;  1A2T A;  3ND9 A;  2PW7 A;  1ENA A;  2ENB A;  4QUC A;  2F0V A;  2LKV A;  1LTI D;  5LHY 1;  5KNB A;  1TQO A;  4G7Z C;  4HMJ A;  1PZK D;  4RCN A;  3T53 B;  1KDC A;  3SK4 A;  2RSN A;  5C3E B;  3I4N B;  4TRD A;  4MHE A;  3BG3 A;  2C5C A;  1SXT A;  4C3J G;  2QDB A;  4XT1 B;  1OXU A;  1K8M A;  3S2H B;  1GUW A;  2R6G A;  1KNE A;  1EY0 A;  2HCC A;  1ONL A;  4J6H A;  3S16 B;  3HP3 A;  5C5L A;  1PZI D;  3TBI B;  2B2U A;  2OT2 A;  5FLX E;  3IAY A;  1HTP A;  5FLX L;  2K5Q A;  5BN4 A;  3PUV A;  1TY0 A;  4O1N A;  1W6K A;  1LTB D;  4KHV A;  3BVM A;  1JOO A;  1CTM A;  1KTK A;  4EQO A;  4B9W A;  4IUV A;  4KN7 C;  2IT1 A;  2K01 A;  2PZT A;  4XQJ A;  1SSO A;  4C2M B;  3DHQ A;  1C8C A;  3URY A;  2F3V A;  3VYU A;  2NTT A;  3K59 A;  2WV6 D;  1LAB A;  1SYG A;  4BA2 I;  3AU7 A;  5D3I B;  5IGE A;  5CBE E;  1GUN A;  3NP8 A;  3WOF A;  1FR3 A;  1NSN S;  2CVR A;  1RHP A;  2KCC A;  4P2C B;  4CKB A;  4A93 B;  1H9S A;  5F2D A;  2NVT B;  5IGB A;  1JWM D;  2CQA A;  1U4P A;  4BBS B;  2A69 C;  4C56 C;  1IKL A;  2L9H A;  1NAP A;  2NYZ D;  3TP7 A;  1F2Z A;  2H1E A;  1CA5 A;  3PUY A;  4DA2 A;  1KAB A;  1PZJ D;  4MIU A;  1DD2 A;  2L5T A;  1CM9 A;  5LL6 S;  3J81 L;  5I2X A;  3IFD A;  1Y8P B;  1ILP A;  3EA6 A;  1W6J A;  3MXN A;  2AUJ D;  1I6V C;  2K28 A;  5E3F A;  1EFI D;  4ODG A;  3L7Z C;  4A3G B;  3R2T A;  1FNV A;  1D1I A;  1O7L A;  1I3Q B;  1NUC A;  3Q0A A;  1CA6 A;  1EWC A;  4KTA A;  2TSS A;  1D5X C;  5TSS A;  1BXT A;  1V43 A;  2VB3 X;  4RKB A;  3PV0 A;  3K58 A;  2F0P A;  4ZK9 B;  2O5I C;  1Y8N B;  5AFW A;  5FO7 B;  4IUT A;  1VF7 A;  3GTQ B;  4XYQ A;  3AMU A;  2K33 A;  1X3Q A;  5M5W B;  3K57 A;  4WRD A;  3VYR A;  2A5H A;  1G2T A;  3HGB A;  3K6O A;  1RTN A;  4JK1 C;  4A3B B;  3M85 A;  3E0J A;  2K7V A;  1LTT D;  1GJX A;  3DWA A;  5EPJ A;  5G3L D;  3C3L A;  2B2Y C;  2F0O A;  1WTX A;  5I6W A;  5C0X J;  2F0K A;  2JXM B;  3Q23 A;  2EXZ A;  1SJH D;  4CHT B;  4NKL A;  5BN3 A;  2EJM A;  4DXF A;  4IUR A;  5JEA G;  3OOC A;  2JA8 B;  2B39 A;  4KV6 A;  2WII B;  1ZYR C;  2F1M A;  4V19 0;  2XWJ B;  2IL8 A;  3HOW B;  3Q6S A;  2EJF C;  1KDA A;  2KQ3 A;  3KLS A;  1A2U A;  1WD1 A;  3OW7 A;  4J1M A;  1RCV D;  3F2U A;  1PFM A;  3MTS A;  4IUN A;  2F0S A;  1CT1 D;  3K5M A;  3VR5 A;  2K6A A;  2F0L A;  1H9S B;  1WVL A;  1G6Z A;  1STG A;  4R9W A;  1TS5 A;  3JAM E;  3DM1 A;  4FF2 A;  3JAM L;  2F0U A;  2BE5 C;  1PRT D;  4ID6 A;  5I9O A;  1WTR A;  2BDN A;  1S5D D;  2AUK A;  2A69 D;  1SFO B;  2CW0 D;  2A6E D;  4KJO A;  2PZU A;  1EEI D;  5HUR A;  4PMB A;  2JA6 B;  2FMM A;  1DOL A;  4C3I B;  4A3D B;  4WJW A;  2A74 C;  1HXY D;  2Y0S B;  1L0Y B;  5CBA E;  2EDG A;  3BZD B;  1D5M C;  3S2D B;  3HOZ B;  2R92 B;  2RKS A;  3NBI A;  3C1E A;  2KCN A;  5CV7 A;  5E4W C;  1F2Y A;  3EFX D;  1D5Z C;  2KVM A;  4FP5 D;  3QOL A;  2J4X A;  4IFD I;  2MPM A;  4G7O C;  4RGO S;  5I9P A;  3H3V C;  2G9H D;  5COR A;  1ROD A;  1LAC A;  5LL6 X;  4C1N K;  2Z4I A;  2NUC A;  1VF5 C;  2RDG A;  4K5X A;  3S15 B;  4NW2 A;  1LTS D;  3GTJ B;  1IL8 A;  4XXE A;  1PYW D;  3HZX A;  3ND8 A;  1EY9 A;  2F0T A;  2IX1 A;  5E4X A;  1V8Q A;  1MGS A;  1SJE D;  3ERO A;  1Z6H A;  1TWF B;  3PUZ A;  1ML0 D;  2PCF B;  1QCB D;  3M3Y B;  1DON A;  2G9D A;  1BR9 A;  1II3 A;  3I72 A;  1HHV A;  3S9W A;  5JEA H;  2L12 A;  1ICW A;  1FD7 D;  3GTP B;  1CZG A;  1PTO B;  1TWH B;  2EZV A;  1AFP A;  1E2Z A;  4ULL A;  2LFN A;  2YU9 B;  1VCI A;  3FMC A;  2WAC A;  4L8J A;  2IW3 A;  4RGT A;  2ZXO A;  3BYT B;  5EKK A;  4FXD A;  1PMR A;  2NTS A;  1STN A;  2F03 A;  3NK9 A;  4XDX A;  4IUU A;  3TZD A;  3FVQ A;  1EZ6 A;  2XIW A;  1Q90 A;  5D14 A;  1BDO A;  3MEH A;  3OSO A;  4IUQ A;  2A68 D;  5G3L F;  2OF1 A;  2QIL A;  4NDX A;  2EYH A;  4PV1 C;  1F77 A;  4RFB A;  3BDC A;  1K83 B;  1S5B D;  4R8N A;  2JA5 B;  2I46 A;  2QF7 A;  1PDQ A;  2EYL A;  3A8I E;  1WCM B;  3QB3 A;  1Y69 U;  3RUZ A;  3IKJ A;  3PIO 3;  3S1R B;  2F0M A;  1KNA A;  1GUO A;  1I4H A;  1PLF A;  3N52 A;  3SXH A;  4ZUI A;  1Z7T A;  2E74 C;  4FNF A;  4C3H B;  5M3M B;  4UDU C;  1Y1V B;  1EEF D;  2JSO A;  1LT3 D;  3MA2 B;  4R8I A;  3NHH A;  1TS4 A;  1BCP D;  3NSW A;  1HCZ A;  3T16 A;  4K5W A;  3A54 A;  2KHS A;  2VXW A;  4AYB B;  4HED A;  1WTQ A;  5ELC A;  1GOZ A;  4PQX A;  3CQZ B;  1PRT F;  2B63 B;  3D8G A;  5ELE A;  2HDL A;  3OIQ A;  2VUM B;  2C9O A;  1EU4 A;  2EE1 A;  5C4X B;  4K14 A;  5EPK A;  1H9K A;  1UUP A;  3RZD B;  1HQM C;  1CQV A;  4QMG A;  3NTK A;  5IOD A;  3P7J A;  3U9O A;  1JWS D;  5DAU A;  3M7G A;  1PXU A;  1O78 A;  4HTH A;  3EQL C;  5JPM C;  3DWQ A;  2KEE A;  2CHB D;  3TSS A;  5ISR A;  3SE0 A;  2DN8 A;  3FPP A;  2PMZ B;  1SMY D;  3MXU A;  3NQT A;  5CGK A;  1KLG D;  2JA7 B;  1KDB A;  2IJ0 A;  1TWG B;  3HRZ C;  1A15 A;  2ZT9 C;  1JOQ A;  3HEJ A;  1EL0 A;  4K2K A;  1ILQ A;  4CJ0 B;  2NN6 I;  1A6X A;  2YYZ A;  2DY8 A;  1Q8I A;  2XN9 C;  5JVG 3;  1E2V A;  3RZO B;  2L0C A;  4OIJ A;  1B2T A;  1JC7 A;  3NXW A;  4KY7 A;  2B2W C;  4ZAI A;  1E2W A;  3NE5 B;  4HMI A;  3MWY W;  2NVX B;  2PZW A;  1QWY A;  3KUP A;  5BN5 A;  4DAY A;  4QB4 A;  4C3I G;  5C3X A;  2WB1 B;  5T1I A;  2RSO A;  2MUY A;  4DN4 M;  5JJZ A;  1HFN A;  5C0X G;  3A55 A;  3BVZ A;  4RCO A;  4A3I B;  1U9R A;  2KED A;  1STY A;  1PRT C;  3I4M B;  5CV9 A;  2KJX A;  2K1B A;  2CW0 C;  2A6E C;  4IQZ A;  3WOE A;  2MJ8 A;  4IFD J;  4HSP A;  1HFG A;  5EKL A;  1T5E A;  3X3N A;  2B2V C;  1STB A;  2E2J B;  2XNA C;  1EIG A;  3M4Y A;  3D3R A;  2TMP A;  3HOX B;  4F87 A;  2XSC A;  5A2Q E;  1VDZ A;  3P75 A;  5A2Q L;  5I2Y A;  3J81 E;  2BCO A;  1TII D;  3EJI A;  5ELF A;  1CFM A;  2SDF A;  2JYO A;  5J22 A;  1L0X B;  3H91 A;  4BY1 B;  3BDO A;  4I7Z C;  1MD2 D;  1RTO A;  2DY7 A;  5CV5 A;  2O5J C;  3HS0 C;  4H0L C;  2Q8R E;  3H09 A;  4XQQ A;  5EGT A;  4FVM A;  1MBY A;  2RVL A;  3DEP A;  3E5S A;  3T56 B;  1LO5 D;  1SND A;  4FO2 A;  2FHT A;  1BCP F;  4C1N I;  1DZ1 A;  3VR4 A;  4BA1 I;  4KN4 C;  3NQI A;  5J1Z A;  4F88 A;  2I07 B;  2A73 B;  3SK6 A;  2E2D C;  5C4Z A;  5C44 B;  4DK1 A;  1Q1E A;  2X6L A;  1MSG A;  3NTH A;  4N9T A;  3GO5 A;  3ZYY X;  3TN2 A;  1NR4 A;  2PNR C;  2F0H A;  3Q22 A;  3D4W A;  1F9P A;  4OGQ C;  3DEO A;  5JAV A;  1BF4 A;  2E75 C;  3I3C A;  4OO1 I;  5D65 A;  1MI2 A;  2X6G A;  4E6I A;  4KHZ A;  5EBC A;  4LMQ D;  4QIW B;  2O2L D;  3A7A B;  1B4O A;  3VYT A;  1BQQ T;  1SNQ A;  1LT6 D;  3BDL A;  4TKO B;  1G91 A;  1S5C D;  5JOB A;  3J7Y W;  1F2M A;  4CBV A;  2DNC A;  2EYO A;  2AQ1 B;  4HCS A;  1RDP D;  3S14 B;  2B2T C;  4HCE A;  5C0X H;  3HOU B;  1S5F D;  5KNC A;  4C3H G;  2A68 C;  5IGD A;  3WDN A;  4DK0 A;  5DNF A;  1TY2 A;  2A6H D;  1ESR A;  2SOB A;  4OIK A;  3P20 A;  1GXD C;  2M00 A;  2PW5 A;  1DXM A;  1LT4 D;  2KA7 A;  5FKA C;  1EYC A;  5C6A A;  3DWP A;  3FRP B;  3MHB A;  1RJT A;  4K8J A;  4KY6 A;  3G6J B;  2DNE A;  1LLR D;  2EPB A;  2QKI C;  4ZQ3 A;  1HPC A;  2L4N A;  1JIC A;  5EPL A;  4DNR B;  1SYE A;  1GUT A;  4RHS A;  5I4D A;  4FXK C;  5JPN C;  4K6L A;  1AP0 A;  3GV6 A;  4RWS C;  3FDT A;  4G57 A;  3NBH A;  3FKI B;  1BCP C;  3MFY A;  1PFB A;  1YNN D;  4QCL A;  1I50 B;  1UAP A;  3J80 E;  1CK1 A;  3IFT A;  3J80 L;  2HDM A;  3W2D A;  3SVM A;  1OXT A;  2NBF A;  1S5E D;  1GHJ A;  3SHL A;  1PTO H;  2D9U A;  2NWG A;  3LWE A;  4S3S A;  3S1Q B;  5CYU A;  3NUC A;  3EVQ A;  4A3M B;  1XX8 A;  2D5D A;  2N55 A;  1V1O A;  1F9S A;  4H13 C;  1SE2 A;  1HUM A;  4DFA A;  5KYI A;  1EQT A;  3ITP A;  1Q3L A;  1R4Q B;  1A3T A;  1RD9 D;  1TS2 A;  1ET6 A;  1IYU A;  5KRU A;  1AZP A;  2H4O A;  2B2W A;  3PUX A;  1J8I A;  1M4V A;  3H0G B;  5A35 A;  1OXS C;  4ZYS A;  4A3J B;  4CGY B;  3OWE B;  1SDF A;  1B44 D;  5KIX A;  4NP5 A;  1LTR D;  1CI3 M;  2F0W A;  1EOT A;  1SMY C;  3T4A C;  5M3F B;  1S4Z A;  5M5X B;  2PQE A;  1LTA D;  4RHR A;  4ILW A;  4BBR B;  2ZXR A;  5IGF A;  3V05 A;  1FNW A;  2XVS A;  5KYL A;  1SNC A;  2IWH A;  4IN3 A;  4EQP A;  4ZRZ A;  2ID0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...