1RTNA

Proton nmr assignments and solution conformation of rantes, a chemokine of the cc type
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chemokine
molecule keywords RANTES
publication title Proton NMR assignments and solution conformation of RANTES, a chemokine of the C-C type.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rtnA00
1PFBA 4ZK9B 3D6WA 1WTXA 1ML0D 1JE4A 1F9PA 3FDTA 2B2TC 5COYA 1BF4A 2B2UA 2DY7A 2HCIA 1MSHA 4ZKCB 2RA4A 4X3UA 4XDXA 1DOMA 2B2YC 3GV3A 2X6GA 1RHPA 2EOTA 1X32A 2Q8TA 2CVRA 1BBXC 1CA6A 1WVLA 1WD1A 2X69A 2KECA 2B2UC 1RJTA 4RA8A 1G2TA 1B4OA 4RWSC 5EJWA 2J7ZA 3MWYW 1G91A 5EQ0A 1VMPA 4DN4M 2RSNA 3F2UA 3G7LA 4IURA 2N55A 2NZ1D 5E4XA 5DNFA 1HFGA 2IL8A 4ZLTF 2MJ8A 1CM9A 5CBEE 4ZAIA 1NAPA 4R8IA 1WTQA 1O7YA 3LWEA 1WTPA 1WD0A 1WTVA 2EPBA 3I8ZA 1QG7A 1HUNA 1RTOA 5AFWA 1A15A 1F2LA 2HDLA 2L1BA 1NR2A 2K05A 5EKIA 2FJ2A 2MPMA 1EOTA 1EQTA 1MI2A 4HEDA 1Q3LA 2K28A 1X3PA 2MP1A 1PDQA 2HCCA 5T1GA 2M2LA 1PFMA 1ESRA 1DOKA 3P7JA 3Q6SA 1LV9A 1PFNA 2L11A 4X3TA 5EPLA 3I3CA 4O42A 2FFKB 2K1BA 3DEPA 1G6ZA 3R93A 4CJ1B 1ZXTA 4IUVA 3FPUB 1DOLA 2HUGA 1U4PA 5CMDA 2Q8RE 4MN3A 1PLFA 1SSOA 3TN2A 1E0BA 1MGSA 1U4MA 1AZPA 2K03A 4ZKBB 1F9RA 3IFDA 4CJ2C 3I91A 1ILQA 1J9OA 1XYIA 1AP0A 1JICA 2L9HA 2RSOA 2KVMA 5JJZA 1IKMA 1HHVA 5D14A 5CBAE 1EIGA 1WTWA 3N52A 2FINB 4QUFA 3MTSA 1O7ZA 2N88A 4CJ0B 1QE6A 4U68A 1O80A 1U4RA 1HA6A 2R3ZA 1C8CA 2X6LA 4XT3B 1KNAA 1B3AA 3ONAB 2VXWA 1IL8A 1IKLA 2D9UA 5D65A 1HUMA 5EPKA 1CA5A 4QUCA 1TVXA 2KUMA 1DZ1A 4X3SA 3IL8A 4LMQD 3GV6A 2EE1A 2L4NA 1NR4A 2L12A 3I90A 2RVLA 1F9SA 1ICWA 1BNZA 1DONA 4XT1B 1HRJA 2FHTA 4HSVA 1EL0A 3UI2A 1SAPA 1M8AA 4R9WA 2MGSA 3KBXA 5T1IA 3DM1A 1BO0A 4IUPA 4RAUC 1VMCA 1J8IA 1KNEA 4HAEA 2B2WA 1GUWA 2B2VA 3KUPA 1B2TA 1AZQA 2KOLA 4NW2A 2H1EA 2KEEA 3DEOA 1MSGA 2K01A 3QO2A 3TZDA 4OIKA 4OIJA 1QNKA 2K04A 4IUQA 2JP1A 1X3QA 2BDNA 2HDMA 4HCSA 2B2WC 1B53A 2B2VC 4X3KA 1RODA 2NYZD 4IUUA 4UAIA 1WTRA 2XIWA 1F9QA 1EIHA 4MHEA 3H91A 1U4LA 1B50A 5E4WC 1XX8A 3SVMA 2NWGA 1NCVA 2B2TA 1G2SA 2KEDA 1SDFA 3HP3A 2SDFA 4IUTA 2FMMA 1S4ZA 2DY8A 5CORA 5EPJA 1HFNA 2B2YA 1ILPA 1RTNA 2JYOA 1WTOA
chains in the Genus database with same CATH superfamily
3R2TA 1EU3A 1PTOH 5DEHA 5IGDA 1VQBA 4LFAQ 3LWUA 5FOBB 2R7ZB 2B8GA 1CT1D 3VA5A 4B3RL 3K7AB 2VUMH 2F0LA 5FKAC 5A35A 1JWUD 1SLJA 3K6OA 2UUAQ 3A8JE 3STBC 3RLOA 4LF5Q 1VQCA 2EYLA 4A4IA 1Z6HA 4K0KQ 3NENA 1T9HA 2GVBA 5DNFA 1MHWC 1FNWA 5H1SE 2NVQB 1XNRQ 5IWAL 3J80L 1JWSD 2F0OA 1TS3A 2K5DA 3GTKB 4UP9A 4C3HG 3JAMc 3FMCA 1ENCA 4HEDA 1IXRA 4HJ5A 3J7AF 2RDGA 3BDLA 1IZ6A 1PFSA 2QEXA 1NNXA 3ZYYX 2Z8LA 4G57A 1LV9A 1HR0L 3DEPA 2A6EC 3S16B 3S24A 1RD9D 4DR6Q 3KF8B 3BVZA 4A3IH 1EFID 4A3DH 4JI4Q 4N8FA 4UY8C 2HT1A 3I91A 1F77A 1GUSA 1HHVA 5CYUA 5D14A 4QIWE 1NMFA 4YCVA 2N88A 3I7FA 1IBMQ 3PO2B 1VQIA 1TWHH 1V1PB 4PQXA 1HCZA 1DZ1A 1XPUA 3GTGH 3AFQA 3R2IA 4IPHA 1SNOA 2KCMA 2UU9L 3E9IA 4K6LA 1AW7A 1KLUD 1BBWA 1K28A 2G5DA 1K8GA 1KNEA 2B2WA 3H0GH 3PUZA 4IN3A 1VQLA 1AZQA 2BE5D 4JV5L 1FYCA 3OMCA 1F2ZA 4OIKA 2BDNA 2I5HA 2R7ZG 1L1OC 2YYZA 5G3LF 1EIHA 4FF4A 1A63A 1D5MC 4IJLA 4L63B 4DV2Q 2Q2TA 2SDFA 1S4ZA 4LK1C 5BR8L 4KMUC 3AEVA 1CHQD 3TP5A 5ELEA 4K6DA 3ULPA 2LMCB 1QJOA 1SNMA 4LF7Q 4JBJA 1LLRD 2F3IA 2C5CA 1HXYD 2NTTA 4LUZA 1CA6A 5JEAG 1PH3A 4GN4B 1SMXA 3EVQA 3HOZB 4B3MQ 4NPSA 4RWSC 5EJWA 4P75A 1OO9B 4P71A 1TWGB 3TS2A 4LNQA 3GTJB 2JEBI 2Z9HA 5M5WB 1PRTD 1F2LA 4CHTB 1EQTA 5FLXE 5ELOA 2E8GA 5FJ8H 3WOFA 1JOQA 2AUKA 5T1GA 1R9TH 3T16A 2DNCA 3D6CA 3W1GA 3MAQA 4ID6A 2IWHA 3PO2G 2RKSA 3BG3A 3G6EA 2XN9C 3RN2A 1MGSA 2Z0SA 4CKBA 1KHIA 3K7AH 4R8NA 2PI2E 1J9OA 4RGOS 2A6HD 3T51B 4QUFA 3QWNA 4DUYQ 4DR6L 3G48A 4Q0FA 4HIKA 1H9MA 1KNAA 2CW0C 4JI4L 1XPOA 4Q5VA 3J80E 2D9UA 1LTBD 5EPKA 4JYAL 2CWPA 3FHWA 3D8GA 1SE2A 5IP7G 3GTKH 1FL0A 2VQEQ 1I4XA 2RHSB 4TKOB 3K57A 1YVCA 1BCPC 1J8IA 5J39A 3P75A 3ZJYC 2KQ3A 4DK1A 1PH8A 1I5FA 2KEEA 1SRUA 5AJ3L 3S16H 4DV3Q 1M4VA 3UE0A 1PH1A 2F0QA 4KTAA 1EWCA 1SYEA 3C1FA 2UXDL 4DV0Q 2H5XA 2RQXA 3E9HA 3T1YL 3GO5A 3ULLA 2KHIA 4DR5Q 1N33Q 2KCNA 3OSOA 5LMUQ 1GUGA 2JE6I 1I4RA 1VQHA 3KOJA 1PRTB 3PCOB 4IFDG 1VQMA 3HOZG 2A1AA 1Q1BA 3MFYA 3WWVA 4LF6L 4OO1G 1DJRD 1UWVA 1VS0A 1UE7A 3CCVA 3CPFA 4MIUA 5C4JB 2B2UA 2UUBQ 1WOCA 1KABA 4ZKCB 1LT6D 4DV2L 3FPPA 4XTCS 2RA4A 4N8X1 1EFWA 4P73A 2IPKD 1H9RA 5EGTA 4J15A 5JJKA 5EKLA 2Q8TA 1LM0A 2K6AA 3K58A 5M3MH 4RFBA 2CH4A 3SEBA 4YIJA 3VDYA 4EX5A 1K8AC 1KQSA 5I6YA 4A93H 1E2ZA 2QDBA 3F2UA 3M4YA 3C46A 1W2BA 2MJ8A 3J7ZC 4ZAIA 3T56B 3GTMH 3HOXB 3BYYB 3D0FA 1EY4A 4O1NA 1E7ZA 1RTOA 3HG9A 4B3ML 3M85A 1Y69U 3GTLB 3CCQA 1MI2A 4LAAA 1KLGD 3UDIA 2OCEA 3SDZA 2ICEC 3IFTA 4KHPL 1PH4A 1SN8A 1ZYRC 1FD7D 1MIUA 3A5ZB 2KHSA 3Q24A 4DV4Q 5DM73 3X3NA 1VQKA 1EIYB 2KJXA 3A56A 2KCTA 1ET9A 1JICA 1CZWA 3O13A 3MZ5A 2E76C 3ONAB 1GHJA 3Q23A 4OWTB 5M5WH 5C4ZA 2J4XA 2VY3A 4TQUS 3D31A 1NR4A 3A0JA 1CSPA 1JORA 1Y14B 3K8AA 2UUCL 1Z7TA 1K3RA 2EDGA 2AWNA 4DR2Q 3HOWG 2PW5A 2R93B 1TR5A 4LF9Q 2VW9A 2OQ0A 3KF6A 4J8QA 1Q81C 3CCLA 3I55A 2R6GA 1CUKA 4ZQ3A 2VQEL 1X3QA 2MUYA 2EJMA 3I4OA 4HCSA 3RD4A 3W1BA 3CCRA 1XNQL 2AKWB 3FP9A 1SE4A 3ND8A 2WB1B 3H94A 4U673 4JOIC 1K83B 4ME3A 4L5RC 1WTXA 4JI2Q 3RLFA 1PH5A 4R4CA 3CC4A 1LTLA 4DR5L 1N36Q 5LMUL 1BBUA 2Q2IA 3HOXG 3D4DA 4LW1A 1QVCA 1B8AA 1UEBA 1L0XB 3RUZA 4BA1I 3P1HA 1VF7A 2K5HA 2CVRA 3NTKA 3TZUA 5I6WA 4B3SL 4RA8A 1RJTA 4AQYQ 4C3JB 1CKOA 2LXKA 4CDEC 2UUBL 2ZJPA 2VQFQ 2IJ0A 2ZT9C 4ZYSA 3G7LA 4A3JH 3HOVH 2PNRC 2PMZE 3L3OC 3S15B 1CM9A 1TKWB 1O7YA 1I94Q 1NUCA 5CGKA 2JA5B 1QG7A 2ASBA 3HOWH 2K28A 2JJQA 3BZKA 4QMGA 3I73A 2YU9H 1B7YB 4F88A 1Y1WH 2BH2A 1LT4D 3H09A 1PFNA 5K36G 1G6ZA 3GTQH 4A75A 5IGBA 4FF2A 5M5XH 2OWOA 4QIWB 1I6VC 4XYQA 2EYJA 3Q0AA 1LTSD 3HFZB 1IKMA 2WP8J 5IYBH 2PI2A 4QCLA 3AU7A 4YY3Q 2R93G 1QE6A 1H9JA 5LMNW 3SK8A 3HZXA 4LF8Q 3KYHC 5IYCG 1HJPA 3OMGA 2A69C 3KF6B 1B9MA 1EEID 4A3CG 3K0YA 4DV7Q 1X3GA 2WB1G 2SOBA 2F0PA 1HQRD 1SNDA 5FLMG 4NXNQ 3N6RA 1YJ9A 3PO3B 1PHJA 1XMQL 1FGUA 2EYPA 4NB3A 5CV8A 5M3FB 1V1OA 2JP1A 3MC0B 3UDXA 1E2VA 3P20A 1RODA 4LF9L 3BJUA 4KKSA 1KTKA 4DU9A 1CTMA 3DMUA 2NUCA 1STYA 2VUMB 3NUCA 5K36H 4C3JG 1WTOA 3MEFA 2SNMA 2JA6B 2QKIC 1Q7YC 1Z9FA 1HNXQ 4P2CB 1SR3A 1SMYC 4YWKA 3CMEA 1PH2A 3DXJC 1PH7A 4FNFA 1A2UA 5KNCA 5C4XH 2JA5G 3DM3A 3CCUA 4JI2L 1Z47A 3MXNA 1E3PA 3S1MB 1X6OA 3HS0C 5FO9B 3S17H 4WJ4A 2RDFA 1QWYA 4A76A 4B3RQ 3ER0A 3KLRA 1JCKB 3S2DB 1WTQA 3LWEA 2F52A 1VQAA 5KNDA 4NP5A 1PYWD 1TWCB 1BOSA 2RCNA 1IBKL 4DF7A 4A3IB 5FLMH 1VQ8A 3NEMA 1Q3LA 1SXTA 5GROA 3NQTA 2IY5B 3P7JA 1H95A 3T53B 1HZAA 5EPLA 4O42A 5IWAQ 2NN6H 2F3WA 5M5YH 4CJ1B 3T13A 3H15A 3PQIA 5GADC 5CMDA 2D62A 3TN2A 4HJ8A 3HOUH 1TWHB 3GTGB 2F0NA 3PO3G 4GNXA 5IP9H 5KYIA 4C3JH 1XPRA 2C9OA 4C1NK 3H0GB 5M3FG 3K5NA 1EZ6A 1YI2A 2JA9A 1B9NA 3I90A 1HZBA 2E2JH 2JA5H 1EY6A 2EYMA 4R9WA 1P16A 3KBXA 5T1IA 3SK4A 3NK9A 3GD7A 1FNUA 3PUXA 3G6JB 1WYDA 2CQOA 2VUMG 4ZCKA 1VQGA 3DUZA 2QF7A 1HNZL 3QO2A 4KK7A 2JA6G 1CKMA 1K8MA 2UU9Q 3RNUA 4B08A 4GLXA 1L0YB 1HTPA 3AFPA 2AQ2B 2OQKA 1PXUA 4JI3L 2C35B 2ZJQA 5JJLA 1SDFA 4JBWA 3CCJA 1IW7C 1X55A 3KK7A 2QCPX 4JW0A 5CV9A 2K5VA 1PRTF 4ZK9B 1SYDA 5ISRA 2IX1A 4RG1A 3FEWX 4IPCA 4APVA 1F9PA 4MZ9A 3F2CA 5FLXc 2Y0SE 1AE2A 1L2FA 1W6KA 2K4KA 2L15A 2TSSA 1MD2D 5KIXA 3GV3A 2V4DA 4PV1C 4A3IG 1HZCA 1IYUA 2DNEA 3MA2B 4L5TA 3E3XA 2HHHL 1HNXL 4I7AA 2J7ZA 3EIVA 1G91A 2WAQE 1K3BC 5M3FH 3G71A 1VF5C 4HIDA 3U4ZA 3GTPB 1R9TB 5GQOA 4DUZQ 2Q8IB 3STBD 4JI6L 1QZHA 4K2LA 1EIFA 4EQPA 1VQ7A 1UE1A 3BU2A 3J80c 4OL7A 2OTLA 3KLSA 1F2MA 1W6JA 1GKHA 2XWBB 4X62Q 2JA6H 1WFQA 1EY8A 1MBYA 1NBWA 3H0GG 5CC4A 3Q22A 5ELCA 4GNXB 1X9NA 2DJFC 1LT3D 5CR3A 4UP7A 4ZKBB 3S2HH 1SE8A 1XYIA 1KAWA 5JJZA 2Z6KC 3S1MH 4CJ0B 1TWAH 3G4SA 4U68A 1BKBA 4ZUJA 1HA6A 3U58A 2X6LA 1ZEQX 2EJGC 4G4KA 3I70A 4ALPA 3PIP3 1CA5A 1HUMA 3S2DH 2IX3A 1TT2A 3U9OA 4DV1L 1SFOH 2L12A 4GKKQ 1ICWA 2XNAC 2FHTA 3E6ZX 1TWCH 3FKIH 4A3EH 3BVGA 5IOCA 2N8NA 4KN4C 1TQOA 5HGTA 1HQMC 1GUWA 2PO4A 3I2ZA 1L1OA 1NE3A 3VYRA 4JYAQ 4DXGA 2P5ZX 3PIO3 3RZOH 1AH9A 3VR4A 2NN6I 3NTHA 1QUQA 4DKAC 4G7OC 4X3KA 4R1JA 3CW2C 1WTRA 3CQZB 1EUJA 4HJAA 4CDFC 5AJ3Q 4WJ3M 1U9RA 2I5MX 1IL2A 3T4AC 2PPBC 3PV0A 2KCCA 5FK9C 1FR3A 5M3MB 1YHQA 2UXDQ 5FJ8G 3T1YQ 1Q82C 2F0VA 1M1KC 4RKBA 2CCZA 5L37A 2F0SA 1BR9A 4A93B 3PMFA 3B6YA 2B2YC 5D3DA 2D2CC 3GTMB 1X32A 4LF6Q 2XGTA 1SNPA 2E75C 4N9TA 1WD1A 1B44D 2PMZB 2KECA 1DXMA 1NJIC 1NMGA 3M7NA 1RL2A 5C4HA 4X64Q 1VQOA 4EGVA 1LYLA 3HEJA 4DN4M 3NBHA 1Q90A 1HNWL 1HFGA 2A8VA 2F03A 1EWHA 1B50A 3W3AA 4HMJA 1WD0A 4KD3A 5CV6A 4YCUA 5EBDA 2NVTB 1TS2A 5AFWA 4X6AH 2ICIA 1NSNS 5E1FA 2XTIA 4R4IA 4DUZL 2DUDA 1CQFA 1QVFA 1BVSA 5J3BA 3M7GA 2DGYA 4MNOA 3QR8A 5JJIA 3KBGA 3S1NH 5KNBA 1E0BA 4A3BH 1RF2D 4FXKC 5I4DA 5C0XI 1AP0A 4KHPQ 1HUNA 4X62L 3I72A 4PMBA 3NBIA 3SE0A 4HR7B 2F0HA 3F2DA 2JA7H 4A3LH 1JJ2A 2K5NA 3Q8DA 3V2TA 5IGGA 3NWTA 5JVG3 1IKLA 5JAVA 5CV5A 3GTPH 4QUCA 2VB3X 2ENBA 1L1OB 1JC7A 1KD1C 2RVLA 1JB7A 4XT1B 1A3VA 3R8BA 3K59A 3KJPA 3BDCA 4IUPA 1VMCA 1QUQB 1TY0A 2K75A 3KUPA 1BUVT 2LY7A 3F1ZA 2LSSA 4GKKL 4TVAB 1KDBA 4KY6A 1TS4A 1PYSB 5M3MG 2NTSA 1BCPD 1YNJC 2UUCQ 4X66L 1D1KA 3D4RA 4A93G 3W2DA 1PRTC 4BA2I 1PTOF 1SROA 3ULJA 1SBBB 1OTCA 3S1QH 1E24A 4KHVA 2JYOA 1YZ6A 1GUNA 2SNSA 1XNQQ 1ML0D 4GOPC 4WJWA 1BF4A 2CQAA 1PYBA 2BA1A 3J7AV 4A3JB 3HOVB 1S5BD 1DOMA 4PZ7A 3K7UC 3NBHB 4JI5L 2EOTA 4R4OA 4JG2A 4DV6L 3PIOA 2X69A 4LUVA 3HOWB 1YEZA 5CV7A 2N3SA 3OPOA 2NZ1D 2YU9B 4GKJL 4RH6A 2F0FA 4QB4A 1QOHA 4A3MH 1Y1WB 2O4XA 2K5WA 4J6HA 4TSSA 3KLSX 1XWEA 4A3FH 4IOAA 4B3SQ 1S40A 3GTQB 3CQZH 4X64L 5M5XB 1TWFH 2JK8A 2N49A 3M3YH 5FO8B 4BBRH 2HCCA 2CFMA 2M2LA 2F4IA 4KLKA 1YNND 4CKEA 4UP8A 1CKNA 2FFKB 3OW7A 3H3VC 1JOOA 2R92H 3S14H 3SK6A 1K0SA 3TBIB 3HGBA 3HKZB 2PZTA 1ZYRD 3CRKC 5IT9L 1GOZA 2GVAA 1BCPB 3OWFA 4GS3A 3MTSA 4KHZA 1RCVD 1UE5A 1RDPD 3VR3A 3BYTB 2K32A 3DLLA 2CH4W 4HJ7A 4UHVA 2E5LL 2F3VA 1LTID 4IZ8A 2NVTH 5E7NA 2OT2A 2QDLA 4DGZA 2PCFB 2EZVA 3FVQA 2UXCQ 1E1TA 1JJGA 1Q46A 2KOLA 2EQSA 4JOIA 4XQNA 2K04A 2OEOA 2HDMA 2K5QA 3JC66 3IKJA 1XXGA 4A3JG 3HOVG 1XMQQ 1A6XA 2PYKA 4BY7B 4TRDA 2EY1A 2KEDA 4C56C 4L5QA 4AH6A 5C4XB 1M90C 2F0EA 1SNQA 1EQQA 1ILPA 4FP5D 2Y0SB 1XMOL 1PFBA 3S17B 4AYBE 1JE4A 3TEHB 1YJNA 2RCFA 1Y1WG 2HCIA 1PZJD 3ERSX 2RBMA 1UNSA 4H44C 3UDGA 2MO0A 4L6TB 4QJFA 4HIOA 2EYHA 1I4HA 5IYBG 3HKSA 3GP7A 2UXBL 4R8IA 1DGSA 2K50A 2AUJD 3H6MA 2KENA 1Q8IA 1D5ZC 5LL6X 3S1RH 3QOJA 4IPGA 5M5YB 3HKZG 1LO5D 1LACA 2AHOB 2HDLA 1C48A 1I3QH 2L1BA 1WTHA 2EVBA 2MPMA 3J81c 4YWMA 4RMFA 1X3PA 3HOUB 1PDQA 2GN5A 4BBSH 1G291 1LABA 5CV4A 2AQ3B 3R93A 3GTOB 4ME5A 3A74A 4IUVA 4X65L 4C3IB 1IBKQ 3DWPA 4Y7NH 3V05A 2ZJRA 1AZPA 4NXML 2HQLA 5F2DA 3VYUA 3C2PA 4B3TL 2E2JB 4QF4A 5ELNA 4KD4A 4JPBW 1OXTA 2ZXRA 2F0KA 3V96A 2RF4A 3NXWA 2LXJA 3CD6A 2O5JC 1HRJA 3CCSA 4WORA 4PZ8A 3BS1A 3M4QA 1VQDA 5C3WA 2G9DA 3BZDB 1EWIA 2WACA 1YITA 4BY7G 4LF4Q 2F0JA 1CFMA 1JR0D 2A69D 5C4XG 3VYTA 2CHBD 2Y0SG 4DR3Q 1OXSC 4WRDA 1N32L 1IYVA 1H9SA 3RN5A 4K8JA 5J1ZA 1PTOC 2UXCL 5IT9E 2WFWA 1ET6A 1F9QA 4ZUIA 1N8RC 1SYBA 1IHZA 1SYCA 1HNZQ 2K14A 1H9KA 3J80i 2WKCA 3K5OA 3L2PA 3OWEB 3SXHA 1PMRA 3NP8A 3RMHA 4JI3Q 3FRPB 4KI0A 4UDUC 1SEBD 3FDTA 1VQ6A 2B2TC 4EQNA 2IT1A 2A73B 2E2HH 1MSHA 2QA4A 1FJGQ 1BQQT 2NN6G 1MKHA 1STHA 3A8KE 4JBMA 2IW3A 1RHPA 1A3UA 2ZM6L 4JCVE 2XRQD 4XYOA 3HOUG 1SMYD 4OWXB 5KEEA 2JA8B 2K7VA 1GD7A 1DD2A 4DFAA 3JAMi 4DR7Q 3DWQA 5IP9G 2Z6BA 4B9WA 1PVOA 4C3IG 1HR0W 1ASYA 2EPBA 3RR5A 3LX0A 5DAUA 2HHHQ 3AYHB 1NY4A 4FF3A 4BY7H 3SHLA 2NVYH 3PUYA 1GJXA 1HZ9A 1X3EA 3S2HB 4LUOA 2E2IH 4KY7A 3QJYA 4FYDA 4PMCA 1GUOA 4RKLA 5HY6A 4A3GH 2PW7A 2KBNA 4DAPA 1BXTA 2JN4A 1TWAB 4JI6Q 4FF1A 2NVXH 3GQBA 1ZXTA 3CU7A 5C5MA 1JJCB 3EN2A 1QVGA 2PQEA 4IFDI 2F0IA 1SSOA 4S3SA 1A0IA 1KDCA 3OHXC 4F8MA 2K03A 4OO1I 1R4QB 1Y1VH 4DK0A 1SFOB 3KLWA 2G9HD 1O7ZA 1O80A 1Y8PB 3FKIB 4KV6A 4A3EB 2E74C 3ITPA 1WJJA 3K80C 4XQJA 4KN7C 2KUMA 4LMQD 1G6PA 4JI1Q 5JOBA 2JEAI 4DV5Q 3RZOB 3K0XA 5HURA 2A68C 1H9SB 4IJHA 2EIFA 1EY7A 1SE3A 2I46A 4ABNA 4DV1Q 4LFCQ 1J5EL 1AFPA 2L5TA 2A5HA 3GTOH 3CCEA 1ENFA 2Z1CA 3D3RA 4LJZC 4C3IH 4L8JA 3U4VA 5IGEA 4LF4L 1U0LA 1I6HB 4IUUA 1PH9A 2F0TA 2KHJA 4BWGB 4OX9L 2TMPA 4DR3L 1G2SA 3NSWA 2DY8A 2JA8G 3CMAA 4XXEA 2WV6D 3QG1A 2K33A 4HCEA 4I65A 4DR4Q 5COYA 3E0EA 1O7LA 1IW7D 2B39A 4H02A 2B8FA 3M4OH 4HTHA 1WCMH 1Q12A 3WOEA 1WVLA 4RGNA 1VQ5A 3MHBA 1UEAB 1FJGL 1LT5D 1P8LA 2RSNA 2ATWA 4HSPA 2N55A 5E4XA 1LTAD 4DA2A 2EYFA 3CCMA 3NHHA 1QCBD 3MXNB 4K8IA 4GN3B 3J7YW 1B1ZA 2I5LX 1T5XD 3S1NB 1PV4A 2EJFC 5C0XH 4A3KH 4HIMA 3RLNA 4DR7L 4A3BB 5JPMC 4QGUA 3FKIG 1HNWQ 4C1NI 4A3EG 1DOKA 3K81C 5I2XA 4GNXC 2Z6KA 4DAMA 5D3IB 2JA7B 2PZWA 3A54A 2MFIA 3FPUB 1DCZA 2Q8RE 1V1PA 1U4MA 4BS9A 1AEXA 4CJ2C 4K5XA 2RSOA 5K5PA 2EY2A 4O2DA 1FNVA 1U4RA 2OF1A 1C8CA 2JA8H 1GHKA 3AQQA 4V190 1IL8A 4CBVA 1EQRA 1EYCA 1EY9A 2ZTDA 2R61A 4X3SA 1VDZA 2EE1A 1STGA 4YHHL 3E0JA 4EQ5A 3T1HQ 2WB1E 1S5FD 1EY0A 3S9WA 4K14A 1B2TA 3OW2A 5BN3A 1VQEA 4NW2A 1AN8A 1KC8C 3EFXD 2A6ED 3H3VI 4JI1L 4DV5L 5I2YA 1PA6A 3S1QB 1STAA 4BY1H 1CSQA 2VZAA 3CAMA 5KRUA 2B2VC 2XRSD 3TQYA 4LFCL 2HD3A 4DXFA 1QNUA 4KJNA 4FXDA 1NCVA 4PG3A 3MXPA 1TU2B 3HP3A 2FMMA 2FMCA 4OONA 4AYBB 1HFNA 2B2YA 1RTNA 4X66Q 4YCWA 2D5DA 1HTLD 1D6EC 1CI3M 4R4QA 3AB9A 1VQFA 2H4OA 1X54A 4KKUA 5C44H 2ZXPA 2VL6A 5C3EH 4A3MB 3A7AB 4XQQA 2L0CA 2YTXA 4A3FB 4DNIA 3I4NH 4A3BG 4DR4L 1JWMD 1G2TA 3W5OA 3MWYW 4PMWA 1TS5A 1TWFB 4FO2A 3M3YB 4DPGA 2F4VL 4NMZA 4BBRB 2JA7G 3JAML 4A3LG 1EYDA 4JI5Q 1E1OA 1I6HH 4JC0A 3I8ZA 5GAHC 4DV6Q 5I9PA 1JE5A 2R92B 3S14B 5EKIA 2FJ2A 1EOTA 1SJHD 4GLAC 4J1MA 4JK1C 2D0PA 1YIJA 1HA5A 4GKJQ 1I50H 1CK1A 4DK6C 4HJ9A 4IPDA 4R4TA 4IOCA 1JOKA 1V9PA 3OTOL 2OXPA 4POGA 4H0LC 4LWCA 3PUWA 2ES2A 4M8AA 3CRLC 2V1CC 1RKNA 2IHEA 4GZYC 4DR1L 2D0OA 2L9HA 2FINB 1E2WA 2R7DA 2PQAA 5TSSA 3EJIA 1ZKOA 2GA4B 1W3SA 5DLQE 5FO7B 4C3HH 1MJCA 5IE8A 3KDFA 3GV6A 1I4GA 2BE5C 5IY0A 2IX0A 1Q8KA 4Y52H 1M8AA 1BO0A 3D4WA 2AQ1B 5C0XJ 1YJWA 5KGUA 4RGMA 4AYBG 2E5LQ 1HH2P 3DEOA 2I0QA 4CDCC 1MSGA 3TZDA 4XIGS 3NPPA 3U9SA 3T1HL 1VCIA 5C6AA 5BN5A 5IYDG 1AE3A 2B2WC 1GUTA 1FGBD 3TDQA 3H91A 5IGFA 3PUVA 1D5XC 1VQ4A 4LFAL 2B3GA 4A3MG 4GOPA 2F0UA 1K8OA 1YNJD 4A3FG 2CW0D 3J81i 5A2QL 5CORA 4OHJA 2O5IC 2LS01 2UUAL 3I4MB 2EXDA 4LF5L 2N78A 1EYGA 4BBRG 1LUZA 1XTCD 4K0KL 2XVSA 4ILWA 2F1MA 1XNRL 4CGYB 2R92G 1J6QA 1I4QA 1BBXC 1XMOQ 2KA7A 3UDFA 3VA7A 3S1RB 5JVH3 1B4OA 2MNAA 1I3QB 2R7ZH 3R3OA 5C3XA 2BH8A 1V8QA 1S5ED 3PIPA 1TIID 1JB3A 2IL8A 2K52A 3LNNA 4BBSB 2F0MA 5EBCA 1GO3E 2IHFA 1PZID 1A15A 4OWWB 4JI8Q 2RHQB 1EU4A 4Y7NB 4FDBA 2MP1A 5LHY1 5HGQA 5ELDA 2VNUD 1PFMA 2Z4IA 2UXBQ 2NVQH 2SEBD 3Q6SA 4NDXA 2DN8A 2E2DC 2K1BA 2M9VA 1E22A 2A6HC 1CHPD 3TSSA 5IYDH 1VQ9A 1IBML 5GAGC 2HUGA 1U4PA 2PQAB 4MN3A 4DK3C 5JEAH 1EQVA 1KIXA 3VR5A 1GVPA 1STBA 2B63B 1ASZA 1I4PA 1SNCA 2JQOA 2ALYB 3LGJA 5CBAE 1BDOA 3DWAA 3KDFB 2NBFA 3PSIA 1DYQA 3MVVA 5IT9c 2JSOA 4X65Q 1YHBA 3QB3A 3JAME 5E3FA 1X3FA 1MJEA 1KDAA 4NXMQ 1JQYD 1EOVA 3I4LA 3X3MA 4B3TQ 1DONA 4HSVA 3CPWA 2YV5A 3PO2H 3DM1A 2YTVA 4M1UB 5J22A 1SYGA 2MQHA 4OIJA 3I4MG 1UUPA 2RDHA 4GOPB 3PF5A 2ID0A 1V1QA 2BA0A 1RIPA 5NUCA 1U4LA 4LF7L 1ENAA 3F8TA 2E2HB 5IIFA 1N32Q 2CKZB 5EPJA 3A7LA 3QIAA 3IRBA 1C9OA 3NQIA 3F2BA 5IP7H 4K5WA 2YTYA 1YNNC 1TXYA 3TREA 3WDNA 2EXZA 5BN4A 3EA6A 4BBSG 4EQOA 2QEJC 3URYA 4X3UA 4XDXA 4KY5A 3GDEA 1IBLQ 3VR6A 4O0AA 3K5MA 2B2UC 5G3LD 1JMCA 2BDOA 4G7HC 2NVYB 1D1IA 1GXDC 2HIVA 2E2IB 4ZLTF 1UAPA 5CBEE 3TMEA 2ZM6Q 4A3GB 3VYSA 2LFNA 4IFDH 1II3A 2NVXB 4QL5A 3HOZH 2B63G 2K05A 1Y8OB 5A2QE 4OO1H 1C7YA 3J7A5 1TWGH 3ERQA 5GAEC 3GTJH 1QZGA 4KKTA 1Y1VB 2WAQB 4X3TA 2L11A 4DUYL 2A19A 3I3CA 3I4MH 3SR1A 4CDDC 1KXLA 4JI8L 2L55A 4HMIA 4PZ6A 2ZTCA 3C3LA 4AIMA 1F9RA 1O7IA 3IFDA 1D2BA 1XTDA 2KVMA 1S5DD 1IYJB 3UE1A 3HOYB 3N52A 3EQLC 4QQBX 1CKNB 3SK5A 1KRSA 2A74C 5JPNC 1A62A 4RHRA 3OYYA 1S5CD 4ODGA 1QILA 3IL8A 3NTIA 4C2MB 2R7FA 1WI5A 1BNZA 4DV3L 4N9PA 1SJED 1EL0A 3UI2A 4MTKA 1UE6A 3TP8A 4DV0L 1EY5A 3PF4A 1STEA 3CC7A 1N33L 2F0DA 2K01A 1N9WA 1QNKA 5M9OA 1VQPA 3VR2A 1A8VA 4OGQC 4UAIA 3U50C 2B63H 4F7XA 5JEAJ 1XX8A 3SVMA 1STNA 3CXCA 1J5EQ 2B2TA 1PTOD 4JI0Q 4RCNA 4ULLA 3J81L 3M4OB 1WCMB 3DHQA 4JVZA 4I7ZC 3D6WA 2EY6A 1VQNA 3CC2A 2O2LD 2PNHA 2XSCA 4OX9Q 1ONLA 3KJOA 4A3GG 1ICFB 3NELA 2QW7A 3K5LA 4DAYA 1TY2A 3RZDB 4FVMA 1KAAA 4GLVB 3CHBD 5C4JH 5IGCA 5EQ0A 2PZUA 4LFBQ 1Y1VG 1VMPA 2WAQG 4P74A 4A3KB 3A55A 3I56A 1IBLL 3L9AX 1A2TA 1HPCA 1NAPA 1SYFA 1WTPA 2VS1A 4DV4L 2EYOA 2HIXA 4K2KA 5EAYA 1NR2A 1T5EA 2Z4HA 1VQJA 1EZ8A 5KYLA 3HOYG 1DM0B 1OXVA 2OTJA 3NWSA 1S3OA 3M4PA 1ESRA 3HOXH 1L0WA 4GN5A 1LTGD 3OIPA 3GTLH 3ND9A 1PLFA 1B3QA 2DJGC 1O78A 1KL9A 4NKLA 4RCOA 2QGQA 1ILQA 4DAVA 4DNTB 2F0WA 3L0OA 3CKIB 4RGTA 2EY5A 2JXMB 2J0TD 2R3ZA 4JI7Q 1YHAA 4DR2L 4XT3B 1B3AA 4E6IA 2CWAA 1V43A 3H3VH 2WINB 1PTOB 5D65A 3C1EA 1G8ZD 1N34Q 3TRZA 2FXQA 1F9SA 4BY1B 1SAPA 5LL6S 2MHVA 4RAUC 1LTRD 4IFDJ 4POFA 2AMCB 2ZTEA 3A5UA 1FVIA 2M00A 2NZOA 2VB2X 1X56A 4ZRZA 1WCMG 4YHHQ 4OEMB 4EVOA 2Q2UA 1Q1EA 2A68D 1R4PB 5LMNQ 3OTOQ 1C0AA 2NYZD 2R93H 4PNYA 4BXXG 1N36L 1JT8A 2F0GA 5I9OA 3HOYH 4V0BA 5IYCH 3QOLA 4IUTA 4K5VA 5C44B 1K9MC 4H7BA 5C3EB 4OXPA 4YWLA 3MXUA 4JBKA 4DAYB 4OELB 5C0XG 4A3KG 4A3CH 3I4NB 4AQYL 4C2MH 2Q2HA 2VQFL 4G7ZC 2WKDA 2DY7A 1K83H 4A3DB 4JI0L 1OXUA 1K0RA 2X6GA 4Z9CB 2AWOA 3BDOA 1I94L 1U5KA 3E5SA 1Q86C 1KRTA 3TS0A 4KJOA 4FXGC 2XWJB 2QILA 3TP6A 1YNXA 4IURA 3BZCA 1D8LA 2B29A 1EEFD 3BVMA 1I50B 4UPAA 2I07B 3SGIA 1WTVA 1EYAA 1HR0Q 3HKZE 1CQVA 1OXXK 3PGZA 1CZGA 3CP0A 4H13C 4IO9A 4LFBL 1K73C 3J81j 3J81E 4IALA 3A8IE 1PZKD 4L5SA 3MEHA 3HRZC 3S15H 2F4VQ 4CKCA 5IODA 3EBEA 1A3TA 3NE5B 4YY3L 1B70B 4IUNA 1ESFA 1DOLA 4F87A 2ZXOA 4LF8L 3MFGA 4BXXH 4B9XA 3CF5A 1Y8NB 4IQZA 2MO1A 4BY1G 4C3HB 4HN7A 3RZDH 3TP7A 5ELBA 1EIGA 1WTWA 3KF8A 2BOSA 1F2YA 4DV7L 2WIIB 1LTTD 1PH6A 3EROA 1D7QA 4NXNL 2VXWA 5ELFA 5DM63 1TVXA 4DR1Q 2L4NA 4JV5Q 4JI7L 2MGSA 3L7ZC 1G51A 5EKKA 4HAEA 3M9BA 2B2VA 1N34L 1GM5A 5C44G 2LKVA 2NB0A 2H1EA 5C3EG 1C4QA 3AMUA 1YBYA 3ICEA 1BCPF 3IAYA 4IUQA 1QB5D 3I4NG 1S72A 5BR8Q 3MXGA 1B53A 4RHSA 4A3DG 3PO3H 2XIWA 5C5LA 4MHEA 3OIQA 2BCOA 1XJVA 1X65A 4WFN3 5E4WC 2HQEA 2NWGA 3OOCA 4MTNA 2NZHA 4QY7A 3KFUA 4DNRB 5LMNL 5FLXL 1NTGA 4P72A
chains in the Genus database with same CATH topology
3R2TA 1EU3A 1PTOH 5DEHA 5IGDA 3LWUA 5FOBB 2R7ZB 2B8GA 1CT1D 3VA5A 3K7AB 2F0LA 5FKAC 5A35A 1JWUD 3K6OA 3A8JE 2EYLA 1Z6HA 5DNFA 1FNWA 2NVQB 3J80L 1JWSD 2F0OA 1TS3A 2K5DA 3GTKB 4C3HG 3FMCA 1ENCA 4HEDA 3J7AF 2RDGA 3BDLA 3ZYYX 2Z8LA 4G57A 1LV9A 3DEPA 2A6EC 3S16B 1RD9D 3BVZA 1EFID 3I91A 1F77A 1GUSA 1HHVA 5CYUA 5D14A 2N88A 3PO2B 1V1PB 4PQXA 1HCZA 1DZ1A 3R2IA 1SNOA 4K6LA 1AW7A 1KLUD 1KNEA 2B2WA 3PUZA 4IN3A 1AZQA 2BE5D 1FYCA 3OMCA 1F2ZA 4OIKA 2BDNA 2YYZA 5G3LF 1EIHA 4FF4A 1D5MC 4L63B 2SDFA 1S4ZA 4LK1C 4KMUC 1CHQD 3TP5A 5ELEA 4K6DA 2LMCB 1QJOA 1SNMA 1LLRD 2C5CA 1HXYD 2NTTA 1CA6A 5JEAG 3EVQA 3HOZB 5EJWA 4RWSC 1OO9B 1TWGB 3GTJB 2JEBI 5M5WB 1PRTD 1F2LA 4CHTB 1EQTA 5FLXE 3WOFA 1JOQA 2AUKA 5T1GA 3T16A 2DNCA 3D6CA 3MAQA 4ID6A 2IWHA 2RKSA 3BG3A 2XN9C 1MGSA 4CKBA 4R8NA 1J9OA 4RGOS 2A6HD 3T51B 4QUFA 3QWNA 4Q0FA 1H9MA 1KNAA 2CW0C 4Q5VA 3J80E 2D9UA 1LTBD 5EPKA 3D8GA 1SE2A 1I4XA 4TKOB 3K57A 1BCPC 1J8IA 5J39A 3P75A 2KQ3A 4DK1A 2KEEA 1M4VA 2F0QA 4KTAA 1EWCA 1SYEA 3C1FA 2RQXA 3GO5A 2KCNA 3OSOA 1GUGA 2JE6I 1I4RA 1PRTB 4IFDG 1Q1BA 3MFYA 4OO1G 1DJRD 4MIUA 5C4JB 2B2UA 1KABA 4ZKCB 1LT6D 3FPPA 4XTCS 2RA4A 2IPKD 1H9RA 5EGTA 5EKLA 2Q8TA 2K6AA 3K58A 4RFBA 3SEBA 4YIJA 5I6YA 1E2ZA 2QDBA 3F2UA 3M4YA 3C46A 2MJ8A 3T56B 4ZAIA 3HOXB 3BYYB 1EY4A 4O1NA 3HG9A 1RTOA 3M85A 1Y69U 3GTLB 1MI2A 4LAAA 1KLGD 3SDZA 2ICEC 3IFTA 1ZYRC 1FD7D 2KHSA 3Q24A 5DM73 3X3NA 2KJXA 3A56A 1ET9A 1JICA 1CZWA 3O13A 3MZ5A 2E76C 3ONAB 1GHJA 3Q23A 5C4ZA 2J4XA 4TQUS 3D31A 1NR4A 1JORA 1Z7TA 2EDGA 2AWNA 2PW5A 2R93B 1TR5A 4J8QA 2R6GA 4ZQ3A 1X3QA 2MUYA 2EJMA 4HCSA 3RD4A 1SE4A 3ND8A 2WB1B 3H94A 4U673 1K83B 1WTXA 3RLFA 3D4DA 1L0XB 3RUZA 4BA1I 3P1HA 1VF7A 3NTKA 2CVRA 3TZUA 5I6WA 4RA8A 1RJTA 4C3JB 2IJ0A 2ZT9C 4ZYSA 3G7LA 2PNRC 3L3OC 3S15B 1CM9A 1TKWB 1O7YA 1NUCA 5CGKA 2JA5B 1QG7A 2K28A 4QMGA 3I73A 4F88A 1LT4D 3H09A 1PFNA 5K36G 1G6ZA 5IGBA 4FF2A 4QIWB 1I6VC 4XYQA 2EYJA 3Q0AA 1LTSD 1IKMA 2WP8J 4QCLA 3AU7A 1QE6A 1H9JA 3SK8A 3HZXA 3OMGA 2A69C 1B9MA 1EEID 3K0YA 2SOBA 2F0PA 1HQRD 1SNDA 3N6RA 3PO3B 2EYPA 5CV8A 5M3FB 1V1OA 2JP1A 3MC0B 1E2VA 3P20A 1RODA 4KKSA 1KTKA 4DU9A 1CTMA 3DMUA 2NUCA 1STYA 2VUMB 3NUCA 5K36H 4C3JG 1WTOA 2SNMA 2JA6B 2QKIC 4P2CB 1SMYC 3DXJC 4FNFA 1A2UA 5KNCA 1Z47A 3MXNA 3S1MB 3HS0C 5FO9B 2RDFA 1QWYA 3KLRA 1JCKB 3S2DB 1WTQA 3LWEA 5KNDA 4NP5A 1PYWD 1TWCB 1BOSA 4DF7A 4A3IB 1Q3LA 1SXTA 3NQTA 3P7JA 3T53B 5EPLA 4O42A 2NN6H 2F3WA 4CJ1B 3T13A 5CMDA 2D62A 3TN2A 1TWHB 3GTGB 2F0NA 5KYIA 2C9OA 4C1NK 3H0GB 3K5NA 1EZ6A 1B9NA 3I90A 1EY6A 2EYMA 4R9WA 3SK4A 3KBXA 5T1IA 3NK9A 3GD7A 1FNUA 3PUXA 3G6JB 3DUZA 2QF7A 3QO2A 4KK7A 1K8MA 4B08A 1L0YB 1HTPA 2AQ2B 1PXUA 1SDFA 4JBWA 1IW7C 3KK7A 2QCPX 5CV9A 1PRTF 4ZK9B 1SYDA 5ISRA 2IX1A 3FEWX 1F9PA 2TSSA 1W6KA 5KIXA 1MD2D 3GV3A 2V4DA 4PV1C 1IYUA 2DNEA 3MA2B 2J7ZA 1G91A 1VF5C 3GTPB 1R9TB 2Q8IB 4K2LA 4EQPA 4OL7A 3KLSA 1F2MA 1W6JA 2XWBB 1EY8A 1MBYA 5CC4A 3Q22A 5ELCA 1LT3D 5CR3A 4ZKBB 1XYIA 5JJZA 4CJ0B 4U68A 1HA6A 4ZUJA 2X6LA 1ZEQX 2EJGC 4G4KA 3I70A 3PIP3 1CA5A 1HUMA 2IX3A 1TT2A 3U9OA 2L12A 1ICWA 2XNAC 2FHTA 3E6ZX 3BVGA 5IOCA 4KN4C 1TQOA 5HGTA 1HQMC 1GUWA 2PO4A 3VYRA 4DXGA 3PIO3 3VR4A 2NN6I 3NTHA 4G7OC 4X3KA 1WTRA 3CQZB 1U9RA 3T4AC 2PPBC 3PV0A 2KCCA 5FK9C 1FR3A 5M3MB 2F0VA 4RKBA 2F0SA 1BR9A 4A93B 3PMFA 2B2YC 5D3DA 2D2CC 3GTMB 1X32A 1SNPA 2E75C 4N9TA 1WD1A 1B44D 2PMZB 2KECA 1DXMA 3M7NA 5C4HA 4EGVA 3HEJA 4DN4M 3NBHA 1Q90A 1HFGA 2F03A 1EWHA 1B50A 3W3AA 4HMJA 1WD0A 4KD3A 5CV6A 5EBDA 2NVTB 1TS2A 5AFWA 2ICIA 1NSNS 5E1FA 1CQFA 3M7GA 3KBGA 5KNBA 1E0BA 1RF2D 4FXKC 5I4DA 5C0XI 1AP0A 1HUNA 3I72A 4PMBA 3NBIA 3SE0A 4HR7B 2F0HA 3V2TA 5IGGA 3NWTA 5JVG3 1IKLA 5JAVA 5CV5A 4QUCA 2VB3X 2ENBA 1JC7A 2RVLA 4XT1B 1A3VA 3R8BA 3K59A 3BDCA 4IUPA 1VMCA 1TY0A 3KUPA 1BUVT 2LY7A 1KDBA 4KY6A 1TS4A 2NTSA 1BCPD 1YNJC 1D1KA 3D4RA 3W2DA 1PRTC 4BA2I 1PTOF 1SBBB 4KHVA 2JYOA 1GUNA 2SNSA 1ML0D 4WJWA 1BF4A 2CQAA 2BA1A 3J7AV 4A3JB 3HOVB 1S5BD 1DOMA 2EOTA 2X69A 3HOWB 5CV7A 3OPOA 2NZ1D 2YU9B 4RH6A 2F0FA 4QB4A 1QOHA 1Y1WB 2O4XA 2K5WA 4J6HA 4TSSA 3KLSX 1XWEA 3GTQB 5M5XB 5FO8B 2HCCA 2M2LA 2F4IA 1YNND 4CKEA 2FFKB 3OW7A 3H3VC 1JOOA 3SK6A 3TBIB 3HGBA 3HKZB 2PZTA 1ZYRD 3CRKC 5IT9L 1GOZA 1BCPB 3OWFA 3MTSA 4KHZA 1RCVD 1RDPD 3VR3A 3BYTB 2K32A 2F3VA 1LTID 4IZ8A 2OT2A 2EZVA 4DGZA 2PCFB 3FVQA 2KOLA 4XQNA 2K04A 2OEOA 2HDMA 2K5QA 3IKJA 1XXGA 1A6XA 2PYKA 4BY7B 4TRDA 2EY1A 2KEDA 4C56C 5C4XB 2F0EA 1SNQA 1ILPA 4FP5D 2Y0SB 1PFBA 3S17B 1JE4A 2HCIA 1PZJD 2RBMA 1UNSA 4H44C 4L6TB 2EYHA 1I4HA 3GP7A 4R8IA 3H6MA 2AUJD 1Q8IA 1D5ZC 5LL6X 3QOJA 5M5YB 1LACA 1LO5D 2HDLA 1C48A 2L1BA 2EVBA 2MPMA 1X3PA 3HOUB 1PDQA 1G291 1LABA 5CV4A 2AQ3B 3R93A 3GTOB 4ME5A 4IUVA 4C3IB 3DWPA 3V05A 1AZPA 5F2DA 3VYUA 3C2PA 2E2JB 4QF4A 4KD4A 1OXTA 2ZXRA 2F0KA 3V96A 3NXWA 2O5JC 1HRJA 4WORA 3BS1A 5C3WA 2G9DA 3BZDB 2WACA 2F0JA 1CFMA 1JR0D 2A69D 3VYTA 2CHBD 1OXSC 4WRDA 1IYVA 1H9SA 4K8JA 5J1ZA 1PTOC 5IT9E 1ET6A 1F9QA 4ZUIA 1SYBA 1IHZA 1SYCA 1H9KA 2WKCA 3K5OA 3OWEB 3SXHA 1PMRA 3NP8A 3RMHA 3FRPB 4UDUC 4KI0A 1SEBD 3FDTA 2B2TC 4EQNA 2IT1A 2A73B 1MSHA 1BQQT 2NN6G 1STHA 3A8KE 2IW3A 1RHPA 1A3UA 2XRQD 4XYOA 1SMYD 5KEEA 2JA8B 2K7VA 1DD2A 4DFAA 3DWQA 4B9WA 4C3IG 2EPBA 3LX0A 5DAUA 4FF3A 3SHLA 3PUYA 1GJXA 3S2HB 4KY7A 3QJYA 4FYDA 4PMCA 1GUOA 4RKLA 2PW7A 4DAPA 1BXTA 1TWAB 4FF1A 3GQBA 1ZXTA 3CU7A 5C5MA 2PQEA 4IFDI 2F0IA 1SSOA 4S3SA 1KDCA 3OHXC 4F8MA 2K03A 4OO1I 1R4QB 4DK0A 1SFOB 2G9HD 1O7ZA 1O80A 1Y8PB 3FKIB 4KV6A 4A3EB 2E74C 3ITPA 4XQJA 4KN7C 2KUMA 4LMQD 5JOBA 2JEAI 3RZOB 5HURA 2A68C 1H9SB 1EY7A 1SE3A 2I46A 4ABNA 1AFPA 2L5TA 2A5HA 1ENFA 2Z1CA 3D3RA 4LJZC 4L8JA 5IGEA 1I6HB 4IUUA 2F0TA 4BWGB 2TMPA 1G2SA 3NSWA 2DY8A 4XXEA 2WV6D 3QG1A 2K33A 4HCEA 4I65A 5COYA 1O7LA 1IW7D 2B39A 2B8FA 4HTHA 1Q12A 3WOEA 1WVLA 4RGNA 3MHBA 1UEAB 1LT5D 2RSNA 4HSPA 2N55A 5E4XA 1LTAD 4DA2A 2EYFA 3NHHA 1QCBD 4K8IA 3J7YW 1B1ZA 1T5XD 3S1NB 2EJFC 5C0XH 4A3BB 5JPMC 4C1NI 1DOKA 5I2XA 5D3IB 2JA7B 2PZWA 3A54A 3FPUB 1DCZA 2Q8RE 1V1PA 1U4MA 4BS9A 1AEXA 4CJ2C 4K5XA 2RSOA 5K5PA 2EY2A 1FNVA 1U4RA 2OF1A 1C8CA 1GHKA 4V190 1IL8A 4CBVA 1EYCA 1EY9A 2R61A 4X3SA 1VDZA 2EE1A 1STGA 3E0JA 1S5FD 1EY0A 3S9WA 4K14A 1B2TA 5BN3A 4NW2A 1AN8A 3EFXD 2A6ED 5I2YA 3S1QB 1STAA 5KRUA 2B2VC 2XRSD 4DXFA 1QNUA 4KJNA 4FXDA 1NCVA 3MXPA 1TU2B 3HP3A 2FMMA 2FMCA 4AYBB 1HFNA 2B2YA 1RTNA 2D5DA 1HTLD 1D6EC 1CI3M 3AB9A 2H4OA 4KKUA 2ZXPA 4A3MB 3A7AB 4XQQA 2L0CA 4A3FB 1JWMD 1G2TA 3MWYW 4PMWA 1TS5A 1TWFB 4FO2A 3M3YB 4NMZA 4BBRB 3JAML 1EYDA 3I8ZA 5I9PA 2R92B 3S14B 5EKIA 2FJ2A 1EOTA 1SJHD 4JK1C 4J1MA 1HA5A 1CK1A 1JOKA 2OXPA 4H0LC 3PUWA 4M8AA 3CRLC 1RKNA 4GZYC 2L9HA 2FINB 1E2WA 5TSSA 3EJIA 1ZKOA 2GA4B 5FO7B 3GV6A 1I4GA 2BE5C 2IX0A 1M8AA 1BO0A 3D4WA 2AQ1B 5C0XJ 5KGUA 4RGMA 3DEOA 1MSGA 3TZDA 4XIGS 3NPPA 3U9SA 1VCIA 5C6AA 5BN5A 2B2WC 1GUTA 1FGBD 3TDQA 3H91A 5IGFA 3PUVA 1D5XC 2F0UA 1K8OA 1YNJD 2CW0D 5A2QL 5CORA 4OHJA 2O5IC 2LS01 3I4MB 1XTCD 2XVSA 4ILWA 2F1MA 4CGYB 1I4QA 1BBXC 2KA7A 3VA7A 3S1RB 5JVH3 1B4OA 1I3QB 3R3OA 5C3XA 1V8QA 1S5ED 1TIID 1JB3A 2IL8A 3LNNA 4BBSB 2F0MA 5EBCA 1PZID 1A15A 1EU4A 4Y7NB 2MP1A 5LHY1 5ELDA 2VNUD 1PFMA 2Z4IA 2SEBD 3Q6SA 4NDXA 2DN8A 2E2DC 2K1BA 2M9VA 2A6HC 1CHPD 3TSSA 2HUGA 1U4PA 4MN3A 5JEAH 1EQVA 3VR5A 1STBA 2B63B 1I4PA 1SNCA 5CBAE 1BDOA 3DWAA 2NBFA 1DYQA 3MVVA 2JSOA 3QB3A 3JAME 5E3FA 1KDAA 1JQYD 3I4LA 3X3MA 1DONA 4HSVA 3DM1A 4M1UB 5J22A 1SYGA 4OIJA 1UUPA 2RDHA 2ID0A 2BA0A 5NUCA 1U4LA 1ENAA 2E2HB 5IIFA 5EPJA 3A7LA 3QIAA 3NQIA 4K5WA 1YNNC 3WDNA 2EXZA 5BN4A 3EA6A 4EQOA 2QEJC 3URYA 4X3UA 4XDXA 4KY5A 3VR6A 3K5MA 2B2UC 5G3LD 2BDOA 4G7HC 2NVYB 1D1IA 1GXDC 2E2IB 4ZLTF 1UAPA 5CBEE 3TMEA 4A3GB 3VYSA 2LFNA 4IFDH 1II3A 2NVXB 2K05A 1Y8OB 5A2QE 4OO1H 3ERQA 4KKTA 1Y1VB 2WAQB 4X3TA 2L11A 3I3CA 3SR1A 2L55A 4HMIA 3C3LA 1F9RA 3IFDA 1D2BA 2KVMA 1S5DD 3HOYB 3N52A 3EQLC 3SK5A 2A74C 5JPNC 4RHRA 1S5CD 4ODGA 1QILA 3IL8A 3NTIA 4C2MB 1BNZA 4N9PA 1SJED 1EL0A 3UI2A 3TP8A 1EY5A 1STEA 2F0DA 2K01A 1QNKA 5M9OA 3VR2A 4OGQC 4UAIA 4F7XA 5JEAJ 1XX8A 3SVMA 1STNA 2B2TA 1PTOD 4RCNA 4ULLA 3J81L 3M4OB 1WCMB 3DHQA 4I7ZC 3D6WA 2EY6A 2O2LD 2XSCA 1ONLA 3K5LA 4DAYA 1TY2A 3RZDB 4FVMA 1KAAA 3CHBD 5IGCA 5EQ0A 2PZUA 1VMPA 4A3KB 3A55A 3L9AX 1A2TA 1HPCA 1NAPA 1SYFA 1WTPA 2EYOA 4K2KA 1NR2A 1T5EA 2Z4HA 1EZ8A 5KYLA 1DM0B 1OXVA 3NWSA 1ESRA 1LTGD 3OIPA 3ND9A 1PLFA 1O78A 4NKLA 4RCOA 1ILQA 4DAVA 4DNTB 2F0WA 3CKIB 4RGTA 2EY5A 2JXMB 2J0TD 2R3ZA 4XT3B 1B3AA 4E6IA 1V43A 2WINB 1PTOB 5D65A 3C1EA 1G8ZD 1F9SA 4BY1B 1SAPA 5LL6S 2MHVA 4RAUC 1LTRD 4IFDJ 2M00A 2VB2X 4ZRZA 4EVOA 1Q1EA 2A68D 1R4PB 2NYZD 4PNYA 2F0GA 5I9OA 4V0BA 3QOLA 4IUTA 4K5VA 5C44B 4H7BA 5C3EB 3MXUA 5C0XG 3I4NB 4G7ZC 2WKDA 2DY7A 4A3DB 1OXUA 2X6GA 4Z9CB 2AWOA 3BDOA 3E5SA 4KJOA 4FXGC 2XWJB 2QILA 3TP6A 4IURA 1EEFD 3BVMA 1I50B 2I07B 1WTVA 1EYAA 1CQVA 1OXXK 1CZGA 4H13C 3J81E 4IALA 3A8IE 1PZKD 3MEHA 3HRZC 4CKCA 5IODA 1A3TA 3NE5B 4IUNA 1ESFA 1DOLA 4F87A 2ZXOA 3MFGA 4B9XA 1Y8NB 4IQZA 4C3HB 4HN7A 3TP7A 5ELBA 1EIGA 1WTWA 3KF8A 2BOSA 1F2YA 2WIIB 1LTTD 3EROA 2VXWA 5ELFA 5DM63 1TVXA 2L4NA 2MGSA 3L7ZC 5EKKA 4HAEA 2B2VA 2LKVA 2NB0A 2H1EA 1C4QA 3AMUA 1BCPF 3IAYA 4IUQA 1QB5D 3MXGA 1B53A 4RHSA 2XIWA 5C5LA 4MHEA 3OIQA 2BCOA 4WFN3 5E4WC 2HQEA 2NWGA 3OOCA 4DNRB 5FLXL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFB A;  4ZK9 B;  3D6W A;  1WTX A;  1ML0 D;  1JE4 A;  1F9P A;  3FDT A;  2B2T C;  5COY A;  1BF4 A;  2B2U A;  2DY7 A;  2HCI A;  1MSH A;  4ZKC B;  2RA4 A;  4X3U A;  4XDX A;  1DOM A;  2B2Y C;  3GV3 A;  2X6G A;  1RHP A;  2EOT A;  1X32 A;  2Q8T A;  2CVR A;  1BBX C;  1CA6 A;  1WVL A;  1WD1 A;  2X69 A;  2KEC A;  2B2U C;  1RJT A;  4RA8 A;  1G2T A;  1B4O A;  4RWS C;  5EJW A;  2J7Z A;  3MWY W;  1G91 A;  5EQ0 A;  1VMP A;  4DN4 M;  2RSN A;  3F2U A;  3G7L A;  4IUR A;  2N55 A;  2NZ1 D;  5E4X A;  5DNF A;  1HFG A;  2IL8 A;  4ZLT F;  2MJ8 A;  1CM9 A;  5CBE E;  4ZAI A;  1NAP A;  4R8I A;  1WTQ A;  1O7Y A;  3LWE A;  1WTP A;  1WD0 A;  1WTV A;  2EPB A;  3I8Z A;  1QG7 A;  1HUN A;  1RTO A;  5AFW A;  1A15 A;  1F2L A;  2HDL A;  2L1B A;  1NR2 A;  2K05 A;  5EKI A;  2FJ2 A;  2MPM A;  1EOT A;  1EQT A;  1MI2 A;  4HED A;  1Q3L A;  2K28 A;  1X3P A;  2MP1 A;  1PDQ A;  2HCC A;  5T1G A;  2M2L A;  1PFM A;  1ESR A;  1DOK A;  3P7J A;  3Q6S A;  1LV9 A;  1PFN A;  2L11 A;  4X3T A;  5EPL A;  3I3C A;  4O42 A;  2FFK B;  2K1B A;  3DEP A;  1G6Z A;  3R93 A;  4CJ1 B;  1ZXT A;  4IUV A;  3FPU B;  1DOL A;  2HUG A;  1U4P A;  5CMD A;  2Q8R E;  4MN3 A;  1PLF A;  1SSO A;  3TN2 A;  1E0B A;  1MGS A;  1U4M A;  1AZP A;  2K03 A;  4ZKB B;  1F9R A;  3IFD A;  4CJ2 C;  3I91 A;  1ILQ A;  1J9O A;  1XYI A;  1AP0 A;  1JIC A;  2L9H A;  2RSO A;  2KVM A;  5JJZ A;  1IKM A;  1HHV A;  5D14 A;  5CBA E;  1EIG A;  1WTW A;  3N52 A;  2FIN B;  4QUF A;  3MTS A;  1O7Z A;  2N88 A;  4CJ0 B;  1QE6 A;  4U68 A;  1O80 A;  1U4R A;  1HA6 A;  2R3Z A;  1C8C A;  2X6L A;  4XT3 B;  1KNA A;  1B3A A;  3ONA B;  2VXW A;  1IL8 A;  1IKL A;  2D9U A;  5D65 A;  1HUM A;  5EPK A;  1CA5 A;  4QUC A;  1TVX A;  2KUM A;  1DZ1 A;  4X3S A;  3IL8 A;  4LMQ D;  3GV6 A;  2EE1 A;  2L4N A;  1NR4 A;  2L12 A;  3I90 A;  2RVL A;  1F9S A;  1ICW A;  1BNZ A;  1DON A;  4XT1 B;  1HRJ A;  2FHT A;  4HSV A;  1EL0 A;  3UI2 A;  1SAP A;  1M8A A;  4R9W A;  2MGS A;  3KBX A;  5T1I A;  3DM1 A;  1BO0 A;  4IUP A;  4RAU C;  1VMC A;  1J8I A;  1KNE A;  4HAE A;  2B2W A;  1GUW A;  2B2V A;  3KUP A;  1B2T A;  1AZQ A;  2KOL A;  4NW2 A;  2H1E A;  2KEE A;  3DEO A;  1MSG A;  2K01 A;  3QO2 A;  3TZD A;  4OIK A;  4OIJ A;  1QNK A;  2K04 A;  4IUQ A;  2JP1 A;  1X3Q A;  2BDN A;  2HDM A;  4HCS A;  2B2W C;  1B53 A;  2B2V C;  4X3K A;  1ROD A;  2NYZ D;  4IUU A;  4UAI A;  1WTR A;  2XIW A;  1F9Q A;  1EIH A;  4MHE A;  3H91 A;  1U4L A;  1B50 A;  5E4W C;  1XX8 A;  3SVM A;  2NWG A;  1NCV A;  2B2T A;  1G2S A;  2KED A;  1SDF A;  3HP3 A;  2SDF A;  4IUT A;  2FMM A;  1S4Z A;  2DY8 A;  5COR A;  5EPJ A;  1HFN A;  2B2Y A;  1ILP A;  1RTN A;  2JYO A;  1WTO A; 
#chains in the Genus database with same CATH topology
 3R2T A;  1EU3 A;  1PTO H;  5DEH A;  5IGD A;  1VQB A;  4LFA Q;  3LWU A;  5FOB B;  2R7Z B;  2B8G A;  1CT1 D;  3VA5 A;  4B3R L;  3K7A B;  2VUM H;  2F0L A;  5FKA C;  5A35 A;  1JWU D;  1SLJ A;  3K6O A;  2UUA Q;  3A8J E;  3STB C;  3RLO A;  4LF5 Q;  1VQC A;  2EYL A;  4A4I A;  1Z6H A;  4K0K Q;  3NEN A;  1T9H A;  2GVB A;  5DNF A;  1MHW C;  1FNW A;  5H1S E;  2NVQ B;  1XNR Q;  5IWA L;  3J80 L;  1JWS D;  2F0O A;  1TS3 A;  2K5D A;  3GTK B;  4UP9 A;  4C3H G;  3JAM c;  3FMC A;  1ENC A;  4HED A;  1IXR A;  4HJ5 A;  3J7A F;  2RDG A;  3BDL A;  1IZ6 A;  1PFS A;  2QEX A;  1NNX A;  3ZYY X;  2Z8L A;  4G57 A;  1LV9 A;  1HR0 L;  3DEP A;  2A6E C;  3S16 B;  3S24 A;  1RD9 D;  4DR6 Q;  3KF8 B;  3BVZ A;  4A3I H;  1EFI D;  4A3D H;  4JI4 Q;  4N8F A;  4UY8 C;  2HT1 A;  3I91 A;  1F77 A;  1GUS A;  1HHV A;  5CYU A;  5D14 A;  4QIW E;  1NMF A;  4YCV A;  2N88 A;  3I7F A;  1IBM Q;  3PO2 B;  1VQI A;  1TWH H;  1V1P B;  4PQX A;  1HCZ A;  1DZ1 A;  1XPU A;  3GTG H;  3AFQ A;  3R2I A;  4IPH A;  1SNO A;  2KCM A;  2UU9 L;  3E9I A;  4K6L A;  1AW7 A;  1KLU D;  1BBW A;  1K28 A;  2G5D A;  1K8G A;  1KNE A;  2B2W A;  3H0G H;  3PUZ A;  4IN3 A;  1VQL A;  1AZQ A;  2BE5 D;  4JV5 L;  1FYC A;  3OMC A;  1F2Z A;  4OIK A;  2BDN A;  2I5H A;  2R7Z G;  1L1O C;  2YYZ A;  5G3L F;  1EIH A;  4FF4 A;  1A63 A;  1D5M C;  4IJL A;  4L63 B;  4DV2 Q;  2Q2T A;  2SDF A;  1S4Z A;  4LK1 C;  5BR8 L;  4KMU C;  3AEV A;  1CHQ D;  3TP5 A;  5ELE A;  4K6D A;  3ULP A;  2LMC B;  1QJO A;  1SNM A;  4LF7 Q;  4JBJ A;  1LLR D;  2F3I A;  2C5C A;  1HXY D;  2NTT A;  4LUZ A;  1CA6 A;  5JEA G;  1PH3 A;  4GN4 B;  1SMX A;  3EVQ A;  3HOZ B;  4B3M Q;  4NPS A;  4RWS C;  5EJW A;  4P75 A;  1OO9 B;  4P71 A;  1TWG B;  3TS2 A;  4LNQ A;  3GTJ B;  2JEB I;  2Z9H A;  5M5W B;  1PRT D;  1F2L A;  4CHT B;  1EQT A;  5FLX E;  5ELO A;  2E8G A;  5FJ8 H;  3WOF A;  1JOQ A;  2AUK A;  5T1G A;  1R9T H;  3T16 A;  2DNC A;  3D6C A;  3W1G A;  3MAQ A;  4ID6 A;  2IWH A;  3PO2 G;  2RKS A;  3BG3 A;  3G6E A;  2XN9 C;  3RN2 A;  1MGS A;  2Z0S A;  4CKB A;  1KHI A;  3K7A H;  4R8N A;  2PI2 E;  1J9O A;  4RGO S;  2A6H D;  3T51 B;  4QUF A;  3QWN A;  4DUY Q;  4DR6 L;  3G48 A;  4Q0F A;  4HIK A;  1H9M A;  1KNA A;  2CW0 C;  4JI4 L;  1XPO A;  4Q5V A;  3J80 E;  2D9U A;  1LTB D;  5EPK A;  4JYA L;  2CWP A;  3FHW A;  3D8G A;  1SE2 A;  5IP7 G;  3GTK H;  1FL0 A;  2VQE Q;  1I4X A;  2RHS B;  4TKO B;  3K57 A;  1YVC A;  1BCP C;  1J8I A;  5J39 A;  3P75 A;  3ZJY C;  2KQ3 A;  4DK1 A;  1PH8 A;  1I5F A;  2KEE A;  1SRU A;  5AJ3 L;  3S16 H;  4DV3 Q;  1M4V A;  3UE0 A;  1PH1 A;  2F0Q A;  4KTA A;  1EWC A;  1SYE A;  3C1F A;  2UXD L;  4DV0 Q;  2H5X A;  2RQX A;  3E9H A;  3T1Y L;  3GO5 A;  3ULL A;  2KHI A;  4DR5 Q;  1N33 Q;  2KCN A;  3OSO A;  5LMU Q;  1GUG A;  2JE6 I;  1I4R A;  1VQH A;  3KOJ A;  1PRT B;  3PCO B;  4IFD G;  1VQM A;  3HOZ G;  2A1A A;  1Q1B A;  3MFY A;  3WWV A;  4LF6 L;  4OO1 G;  1DJR D;  1UWV A;  1VS0 A;  1UE7 A;  3CCV A;  3CPF A;  4MIU A;  5C4J B;  2B2U A;  2UUB Q;  1WOC A;  1KAB A;  4ZKC B;  1LT6 D;  4DV2 L;  3FPP A;  4XTC S;  2RA4 A;  4N8X 1;  1EFW A;  4P73 A;  2IPK D;  1H9R A;  5EGT A;  4J15 A;  5JJK A;  5EKL A;  2Q8T A;  1LM0 A;  2K6A A;  3K58 A;  5M3M H;  4RFB A;  2CH4 A;  3SEB A;  4YIJ A;  3VDY A;  4EX5 A;  1K8A C;  1KQS A;  5I6Y A;  4A93 H;  1E2Z A;  2QDB A;  3F2U A;  3M4Y A;  3C46 A;  1W2B A;  2MJ8 A;  3J7Z C;  4ZAI A;  3T56 B;  3GTM H;  3HOX B;  3BYY B;  3D0F A;  1EY4 A;  4O1N A;  1E7Z A;  1RTO A;  3HG9 A;  4B3M L;  3M85 A;  1Y69 U;  3GTL B;  3CCQ A;  1MI2 A;  4LAA A;  1KLG D;  3UDI A;  2OCE A;  3SDZ A;  2ICE C;  3IFT A;  4KHP L;  1PH4 A;  1SN8 A;  1ZYR C;  1FD7 D;  1MIU A;  3A5Z B;  2KHS A;  3Q24 A;  4DV4 Q;  5DM7 3;  3X3N A;  1VQK A;  1EIY B;  2KJX A;  3A56 A;  2KCT A;  1ET9 A;  1JIC A;  1CZW A;  3O13 A;  3MZ5 A;  2E76 C;  3ONA B;  1GHJ A;  3Q23 A;  4OWT B;  5M5W H;  5C4Z A;  2J4X A;  2VY3 A;  4TQU S;  3D31 A;  1NR4 A;  3A0J A;  1CSP A;  1JOR A;  1Y14 B;  3K8A A;  2UUC L;  1Z7T A;  1K3R A;  2EDG A;  2AWN A;  4DR2 Q;  3HOW G;  2PW5 A;  2R93 B;  1TR5 A;  4LF9 Q;  2VW9 A;  2OQ0 A;  3KF6 A;  4J8Q A;  1Q81 C;  3CCL A;  3I55 A;  2R6G A;  1CUK A;  4ZQ3 A;  2VQE L;  1X3Q A;  2MUY A;  2EJM A;  3I4O A;  4HCS A;  3RD4 A;  3W1B A;  3CCR A;  1XNQ L;  2AKW B;  3FP9 A;  1SE4 A;  3ND8 A;  2WB1 B;  3H94 A;  4U67 3;  4JOI C;  1K83 B;  4ME3 A;  4L5R C;  1WTX A;  4JI2 Q;  3RLF A;  1PH5 A;  4R4C A;  3CC4 A;  1LTL A;  4DR5 L;  1N36 Q;  5LMU L;  1BBU A;  2Q2I A;  3HOX G;  3D4D A;  4LW1 A;  1QVC A;  1B8A A;  1UEB A;  1L0X B;  3RUZ A;  4BA1 I;  3P1H A;  1VF7 A;  2K5H A;  2CVR A;  3NTK A;  3TZU A;  5I6W A;  4B3S L;  4RA8 A;  1RJT A;  4AQY Q;  4C3J B;  1CKO A;  2LXK A;  4CDE C;  2UUB L;  2ZJP A;  2VQF Q;  2IJ0 A;  2ZT9 C;  4ZYS A;  3G7L A;  4A3J H;  3HOV H;  2PNR C;  2PMZ E;  3L3O C;  3S15 B;  1CM9 A;  1TKW B;  1O7Y A;  1I94 Q;  1NUC A;  5CGK A;  2JA5 B;  1QG7 A;  2ASB A;  3HOW H;  2K28 A;  2JJQ A;  3BZK A;  4QMG A;  3I73 A;  2YU9 H;  1B7Y B;  4F88 A;  1Y1W H;  2BH2 A;  1LT4 D;  3H09 A;  1PFN A;  5K36 G;  1G6Z A;  3GTQ H;  4A75 A;  5IGB A;  4FF2 A;  5M5X H;  2OWO A;  4QIW B;  1I6V C;  4XYQ A;  2EYJ A;  3Q0A A;  1LTS D;  3HFZ B;  1IKM A;  2WP8 J;  5IYB H;  2PI2 A;  4QCL A;  3AU7 A;  4YY3 Q;  2R93 G;  1QE6 A;  1H9J A;  5LMN W;  3SK8 A;  3HZX A;  4LF8 Q;  3KYH C;  5IYC G;  1HJP A;  3OMG A;  2A69 C;  3KF6 B;  1B9M A;  1EEI D;  4A3C G;  3K0Y A;  4DV7 Q;  1X3G A;  2WB1 G;  2SOB A;  2F0P A;  1HQR D;  1SND A;  5FLM G;  4NXN Q;  3N6R A;  1YJ9 A;  3PO3 B;  1PHJ A;  1XMQ L;  1FGU A;  2EYP A;  4NB3 A;  5CV8 A;  5M3F B;  1V1O A;  2JP1 A;  3MC0 B;  3UDX A;  1E2V A;  3P20 A;  1ROD A;  4LF9 L;  3BJU A;  4KKS A;  1KTK A;  4DU9 A;  1CTM A;  3DMU A;  2NUC A;  1STY A;  2VUM B;  3NUC A;  5K36 H;  4C3J G;  1WTO A;  3MEF A;  2SNM A;  2JA6 B;  2QKI C;  1Q7Y C;  1Z9F A;  1HNX Q;  4P2C B;  1SR3 A;  1SMY C;  4YWK A;  3CME A;  1PH2 A;  3DXJ C;  1PH7 A;  4FNF A;  1A2U A;  5KNC A;  5C4X H;  2JA5 G;  3DM3 A;  3CCU A;  4JI2 L;  1Z47 A;  3MXN A;  1E3P A;  3S1M B;  1X6O A;  3HS0 C;  5FO9 B;  3S17 H;  4WJ4 A;  2RDF A;  1QWY A;  4A76 A;  4B3R Q;  3ER0 A;  3KLR A;  1JCK B;  3S2D B;  1WTQ A;  3LWE A;  2F52 A;  1VQA A;  5KND A;  4NP5 A;  1PYW D;  1TWC B;  1BOS A;  2RCN A;  1IBK L;  4DF7 A;  4A3I B;  5FLM H;  1VQ8 A;  3NEM A;  1Q3L A;  1SXT A;  5GRO A;  3NQT A;  2IY5 B;  3P7J A;  1H95 A;  3T53 B;  1HZA A;  5EPL A;  4O42 A;  5IWA Q;  2NN6 H;  2F3W A;  5M5Y H;  4CJ1 B;  3T13 A;  3H15 A;  3PQI A;  5GAD C;  5CMD A;  2D62 A;  3TN2 A;  4HJ8 A;  3HOU H;  1TWH B;  3GTG B;  2F0N A;  3PO3 G;  4GNX A;  5IP9 H;  5KYI A;  4C3J H;  1XPR A;  2C9O A;  4C1N K;  3H0G B;  5M3F G;  3K5N A;  1EZ6 A;  1YI2 A;  2JA9 A;  1B9N A;  3I90 A;  1HZB A;  2E2J H;  2JA5 H;  1EY6 A;  2EYM A;  4R9W A;  1P16 A;  3KBX A;  5T1I A;  3SK4 A;  3NK9 A;  3GD7 A;  1FNU A;  3PUX A;  3G6J B;  1WYD A;  2CQO A;  2VUM G;  4ZCK A;  1VQG A;  3DUZ A;  2QF7 A;  1HNZ L;  3QO2 A;  4KK7 A;  2JA6 G;  1CKM A;  1K8M A;  2UU9 Q;  3RNU A;  4B08 A;  4GLX A;  1L0Y B;  1HTP A;  3AFP A;  2AQ2 B;  2OQK A;  1PXU A;  4JI3 L;  2C35 B;  2ZJQ A;  5JJL A;  1SDF A;  4JBW A;  3CCJ A;  1IW7 C;  1X55 A;  3KK7 A;  2QCP X;  4JW0 A;  5CV9 A;  2K5V A;  1PRT F;  4ZK9 B;  1SYD A;  5ISR A;  2IX1 A;  4RG1 A;  3FEW X;  4IPC A;  4APV A;  1F9P A;  4MZ9 A;  3F2C A;  5FLX c;  2Y0S E;  1AE2 A;  1L2F A;  1W6K A;  2K4K A;  2L15 A;  2TSS A;  1MD2 D;  5KIX A;  3GV3 A;  2V4D A;  4PV1 C;  4A3I G;  1HZC A;  1IYU A;  2DNE A;  3MA2 B;  4L5T A;  3E3X A;  2HHH L;  1HNX L;  4I7A A;  2J7Z A;  3EIV A;  1G91 A;  2WAQ E;  1K3B C;  5M3F H;  3G71 A;  1VF5 C;  4HID A;  3U4Z A;  3GTP B;  1R9T B;  5GQO A;  4DUZ Q;  2Q8I B;  3STB D;  4JI6 L;  1QZH A;  4K2L A;  1EIF A;  4EQP A;  1VQ7 A;  1UE1 A;  3BU2 A;  3J80 c;  4OL7 A;  2OTL A;  3KLS A;  1F2M A;  1W6J A;  1GKH A;  2XWB B;  4X62 Q;  2JA6 H;  1WFQ A;  1EY8 A;  1MBY A;  1NBW A;  3H0G G;  5CC4 A;  3Q22 A;  5ELC A;  4GNX B;  1X9N A;  2DJF C;  1LT3 D;  5CR3 A;  4UP7 A;  4ZKB B;  3S2H H;  1SE8 A;  1XYI A;  1KAW A;  5JJZ A;  2Z6K C;  3S1M H;  4CJ0 B;  1TWA H;  3G4S A;  4U68 A;  1BKB A;  4ZUJ A;  1HA6 A;  3U58 A;  2X6L A;  1ZEQ X;  2EJG C;  4G4K A;  3I70 A;  4ALP A;  3PIP 3;  1CA5 A;  1HUM A;  3S2D H;  2IX3 A;  1TT2 A;  3U9O A;  4DV1 L;  1SFO H;  2L12 A;  4GKK Q;  1ICW A;  2XNA C;  2FHT A;  3E6Z X;  1TWC H;  3FKI H;  4A3E H;  3BVG A;  5IOC A;  2N8N A;  4KN4 C;  1TQO A;  5HGT A;  1HQM C;  1GUW A;  2PO4 A;  3I2Z A;  1L1O A;  1NE3 A;  3VYR A;  4JYA Q;  4DXG A;  2P5Z X;  3PIO 3;  3RZO H;  1AH9 A;  3VR4 A;  2NN6 I;  3NTH A;  1QUQ A;  4DKA C;  4G7O C;  4X3K A;  4R1J A;  3CW2 C;  1WTR A;  3CQZ B;  1EUJ A;  4HJA A;  4CDF C;  5AJ3 Q;  4WJ3 M;  1U9R A;  2I5M X;  1IL2 A;  3T4A C;  2PPB C;  3PV0 A;  2KCC A;  5FK9 C;  1FR3 A;  5M3M B;  1YHQ A;  2UXD Q;  5FJ8 G;  3T1Y Q;  1Q82 C;  2F0V A;  1M1K C;  4RKB A;  2CCZ A;  5L37 A;  2F0S A;  1BR9 A;  4A93 B;  3PMF A;  3B6Y A;  2B2Y C;  5D3D A;  2D2C C;  3GTM B;  1X32 A;  4LF6 Q;  2XGT A;  1SNP A;  2E75 C;  4N9T A;  1WD1 A;  1B44 D;  2PMZ B;  2KEC A;  1DXM A;  1NJI C;  1NMG A;  3M7N A;  1RL2 A;  5C4H A;  4X64 Q;  1VQO A;  4EGV A;  1LYL A;  3HEJ A;  4DN4 M;  3NBH A;  1Q90 A;  1HNW L;  1HFG A;  2A8V A;  2F03 A;  1EWH A;  1B50 A;  3W3A A;  4HMJ A;  1WD0 A;  4KD3 A;  5CV6 A;  4YCU A;  5EBD A;  2NVT B;  1TS2 A;  5AFW A;  4X6A H;  2ICI A;  1NSN S;  5E1F A;  2XTI A;  4R4I A;  4DUZ L;  2DUD A;  1CQF A;  1QVF A;  1BVS A;  5J3B A;  3M7G A;  2DGY A;  4MNO A;  3QR8 A;  5JJI A;  3KBG A;  3S1N H;  5KNB A;  1E0B A;  4A3B H;  1RF2 D;  4FXK C;  5I4D A;  5C0X I;  1AP0 A;  4KHP Q;  1HUN A;  4X62 L;  3I72 A;  4PMB A;  3NBI A;  3SE0 A;  4HR7 B;  2F0H A;  3F2D A;  2JA7 H;  4A3L H;  1JJ2 A;  2K5N A;  3Q8D A;  3V2T A;  5IGG A;  3NWT A;  5JVG 3;  1IKL A;  5JAV A;  5CV5 A;  3GTP H;  4QUC A;  2VB3 X;  2ENB A;  1L1O B;  1JC7 A;  1KD1 C;  2RVL A;  1JB7 A;  4XT1 B;  1A3V A;  3R8B A;  3K59 A;  3KJP A;  3BDC A;  4IUP A;  1VMC A;  1QUQ B;  1TY0 A;  2K75 A;  3KUP A;  1BUV T;  2LY7 A;  3F1Z A;  2LSS A;  4GKK L;  4TVA B;  1KDB A;  4KY6 A;  1TS4 A;  1PYS B;  5M3M G;  2NTS A;  1BCP D;  1YNJ C;  2UUC Q;  4X66 L;  1D1K A;  3D4R A;  4A93 G;  3W2D A;  1PRT C;  4BA2 I;  1PTO F;  1SRO A;  3ULJ A;  1SBB B;  1OTC A;  3S1Q H;  1E24 A;  4KHV A;  2JYO A;  1YZ6 A;  1GUN A;  2SNS A;  1XNQ Q;  1ML0 D;  4GOP C;  4WJW A;  1BF4 A;  2CQA A;  1PYB A;  2BA1 A;  3J7A V;  4A3J B;  3HOV B;  1S5B D;  1DOM A;  4PZ7 A;  3K7U C;  3NBH B;  4JI5 L;  2EOT A;  4R4O A;  4JG2 A;  4DV6 L;  3PIO A;  2X69 A;  4LUV A;  3HOW B;  1YEZ A;  5CV7 A;  2N3S A;  3OPO A;  2NZ1 D;  2YU9 B;  4GKJ L;  4RH6 A;  2F0F A;  4QB4 A;  1QOH A;  4A3M H;  1Y1W B;  2O4X A;  2K5W A;  4J6H A;  4TSS A;  3KLS X;  1XWE A;  4A3F H;  4IOA A;  4B3S Q;  1S40 A;  3GTQ B;  3CQZ H;  4X64 L;  5M5X B;  1TWF H;  2JK8 A;  2N49 A;  3M3Y H;  5FO8 B;  4BBR H;  2HCC A;  2CFM A;  2M2L A;  2F4I A;  4KLK A;  1YNN D;  4CKE A;  4UP8 A;  1CKN A;  2FFK B;  3OW7 A;  3H3V C;  1JOO A;  2R92 H;  3S14 H;  3SK6 A;  1K0S A;  3TBI B;  3HGB A;  3HKZ B;  2PZT A;  1ZYR D;  3CRK C;  5IT9 L;  1GOZ A;  2GVA A;  1BCP B;  3OWF A;  4GS3 A;  3MTS A;  4KHZ A;  1RCV D;  1UE5 A;  1RDP D;  3VR3 A;  3BYT B;  2K32 A;  3DLL A;  2CH4 W;  4HJ7 A;  4UHV A;  2E5L L;  2F3V A;  1LTI D;  4IZ8 A;  2NVT H;  5E7N A;  2OT2 A;  2QDL A;  4DGZ A;  2PCF B;  2EZV A;  3FVQ A;  2UXC Q;  1E1T A;  1JJG A;  1Q46 A;  2KOL A;  2EQS A;  4JOI A;  4XQN A;  2K04 A;  2OEO A;  2HDM A;  2K5Q A;  3JC6 6;  3IKJ A;  1XXG A;  4A3J G;  3HOV G;  1XMQ Q;  1A6X A;  2PYK A;  4BY7 B;  4TRD A;  2EY1 A;  2KED A;  4C56 C;  4L5Q A;  4AH6 A;  5C4X B;  1M90 C;  2F0E A;  1SNQ A;  1EQQ A;  1ILP A;  4FP5 D;  2Y0S B;  1XMO L;  1PFB A;  3S17 B;  4AYB E;  1JE4 A;  3TEH B;  1YJN A;  2RCF A;  1Y1W G;  2HCI A;  1PZJ D;  3ERS X;  2RBM A;  1UNS A;  4H44 C;  3UDG A;  2MO0 A;  4L6T B;  4QJF A;  4HIO A;  2EYH A;  1I4H A;  5IYB G;  3HKS A;  3GP7 A;  2UXB L;  4R8I A;  1DGS A;  2K50 A;  2AUJ D;  3H6M A;  2KEN A;  1Q8I A;  1D5Z C;  5LL6 X;  3S1R H;  3QOJ A;  4IPG A;  5M5Y B;  3HKZ G;  1LO5 D;  1LAC A;  2AHO B;  2HDL A;  1C48 A;  1I3Q H;  2L1B A;  1WTH A;  2EVB A;  2MPM A;  3J81 c;  4YWM A;  4RMF A;  1X3P A;  3HOU B;  1PDQ A;  2GN5 A;  4BBS H;  1G29 1;  1LAB A;  5CV4 A;  2AQ3 B;  3R93 A;  3GTO B;  4ME5 A;  3A74 A;  4IUV A;  4X65 L;  4C3I B;  1IBK Q;  3DWP A;  4Y7N H;  3V05 A;  2ZJR A;  1AZP A;  4NXM L;  2HQL A;  5F2D A;  3VYU A;  3C2P A;  4B3T L;  2E2J B;  4QF4 A;  5ELN A;  4KD4 A;  4JPB W;  1OXT A;  2ZXR A;  2F0K A;  3V96 A;  2RF4 A;  3NXW A;  2LXJ A;  3CD6 A;  2O5J C;  1HRJ A;  3CCS A;  4WOR A;  4PZ8 A;  3BS1 A;  3M4Q A;  1VQD A;  5C3W A;  2G9D A;  3BZD B;  1EWI A;  2WAC A;  1YIT A;  4BY7 G;  4LF4 Q;  2F0J A;  1CFM A;  1JR0 D;  2A69 D;  5C4X G;  3VYT A;  2CHB D;  2Y0S G;  4DR3 Q;  1OXS C;  4WRD A;  1N32 L;  1IYV A;  1H9S A;  3RN5 A;  4K8J A;  5J1Z A;  1PTO C;  2UXC L;  5IT9 E;  2WFW A;  1ET6 A;  1F9Q A;  4ZUI A;  1N8R C;  1SYB A;  1IHZ A;  1SYC A;  1HNZ Q;  2K14 A;  1H9K A;  3J80 i;  2WKC A;  3K5O A;  3L2P A;  3OWE B;  3SXH A;  1PMR A;  3NP8 A;  3RMH A;  4JI3 Q;  3FRP B;  4KI0 A;  4UDU C;  1SEB D;  3FDT A;  1VQ6 A;  2B2T C;  4EQN A;  2IT1 A;  2A73 B;  2E2H H;  1MSH A;  2QA4 A;  1FJG Q;  1BQQ T;  2NN6 G;  1MKH A;  1STH A;  3A8K E;  4JBM A;  2IW3 A;  1RHP A;  1A3U A;  2ZM6 L;  4JCV E;  2XRQ D;  4XYO A;  3HOU G;  1SMY D;  4OWX B;  5KEE A;  2JA8 B;  2K7V A;  1GD7 A;  1DD2 A;  4DFA A;  3JAM i;  4DR7 Q;  3DWQ A;  5IP9 G;  2Z6B A;  4B9W A;  1PVO A;  4C3I G;  1HR0 W;  1ASY A;  2EPB A;  3RR5 A;  3LX0 A;  5DAU A;  2HHH Q;  3AYH B;  1NY4 A;  4FF3 A;  4BY7 H;  3SHL A;  2NVY H;  3PUY A;  1GJX A;  1HZ9 A;  1X3E A;  3S2H B;  4LUO A;  2E2I H;  4KY7 A;  3QJY A;  4FYD A;  4PMC A;  1GUO A;  4RKL A;  5HY6 A;  4A3G H;  2PW7 A;  2KBN A;  4DAP A;  1BXT A;  2JN4 A;  1TWA B;  4JI6 Q;  4FF1 A;  2NVX H;  3GQB A;  1ZXT A;  3CU7 A;  5C5M A;  1JJC B;  3EN2 A;  1QVG A;  2PQE A;  4IFD I;  2F0I A;  1SSO A;  4S3S A;  1A0I A;  1KDC A;  3OHX C;  4F8M A;  2K03 A;  4OO1 I;  1R4Q B;  1Y1V H;  4DK0 A;  1SFO B;  3KLW A;  2G9H D;  1O7Z A;  1O80 A;  1Y8P B;  3FKI B;  4KV6 A;  4A3E B;  2E74 C;  3ITP A;  1WJJ A;  3K80 C;  4XQJ A;  4KN7 C;  2KUM A;  4LMQ D;  1G6P A;  4JI1 Q;  5JOB A;  2JEA I;  4DV5 Q;  3RZO B;  3K0X A;  5HUR A;  2A68 C;  1H9S B;  4IJH A;  2EIF A;  1EY7 A;  1SE3 A;  2I46 A;  4ABN A;  4DV1 Q;  4LFC Q;  1J5E L;  1AFP A;  2L5T A;  2A5H A;  3GTO H;  3CCE A;  1ENF A;  2Z1C A;  3D3R A;  4LJZ C;  4C3I H;  4L8J A;  3U4V A;  5IGE A;  4LF4 L;  1U0L A;  1I6H B;  4IUU A;  1PH9 A;  2F0T A;  2KHJ A;  4BWG B;  4OX9 L;  2TMP A;  4DR3 L;  1G2S A;  3NSW A;  2DY8 A;  2JA8 G;  3CMA A;  4XXE A;  2WV6 D;  3QG1 A;  2K33 A;  4HCE A;  4I65 A;  4DR4 Q;  5COY A;  3E0E A;  1O7L A;  1IW7 D;  2B39 A;  4H02 A;  2B8F A;  3M4O H;  4HTH A;  1WCM H;  1Q12 A;  3WOE A;  1WVL A;  4RGN A;  1VQ5 A;  3MHB A;  1UEA B;  1FJG L;  1LT5 D;  1P8L A;  2RSN A;  2ATW A;  4HSP A;  2N55 A;  5E4X A;  1LTA D;  4DA2 A;  2EYF A;  3CCM A;  3NHH A;  1QCB D;  3MXN B;  4K8I A;  4GN3 B;  3J7Y W;  1B1Z A;  2I5L X;  1T5X D;  3S1N B;  1PV4 A;  2EJF C;  5C0X H;  4A3K H;  4HIM A;  3RLN A;  4DR7 L;  4A3B B;  5JPM C;  4QGU A;  3FKI G;  1HNW Q;  4C1N I;  4A3E G;  1DOK A;  3K81 C;  5I2X A;  4GNX C;  2Z6K A;  4DAM A;  5D3I B;  2JA7 B;  2PZW A;  3A54 A;  2MFI A;  3FPU B;  1DCZ A;  2Q8R E;  1V1P A;  1U4M A;  4BS9 A;  1AEX A;  4CJ2 C;  4K5X A;  2RSO A;  5K5P A;  2EY2 A;  4O2D A;  1FNV A;  1U4R A;  2OF1 A;  1C8C A;  2JA8 H;  1GHK A;  3AQQ A;  4V19 0;  1IL8 A;  4CBV A;  1EQR A;  1EYC A;  1EY9 A;  2ZTD A;  2R61 A;  4X3S A;  1VDZ A;  2EE1 A;  1STG A;  4YHH L;  3E0J A;  4EQ5 A;  3T1H Q;  2WB1 E;  1S5F D;  1EY0 A;  3S9W A;  4K14 A;  1B2T A;  3OW2 A;  5BN3 A;  1VQE A;  4NW2 A;  1AN8 A;  1KC8 C;  3EFX D;  2A6E D;  3H3V I;  4JI1 L;  4DV5 L;  5I2Y A;  1PA6 A;  3S1Q B;  1STA A;  4BY1 H;  1CSQ A;  2VZA A;  3CAM A;  5KRU A;  2B2V C;  2XRS D;  3TQY A;  4LFC L;  2HD3 A;  4DXF A;  1QNU A;  4KJN A;  4FXD A;  1NCV A;  4PG3 A;  3MXP A;  1TU2 B;  3HP3 A;  2FMM A;  2FMC A;  4OON A;  4AYB B;  1HFN A;  2B2Y A;  1RTN A;  4X66 Q;  4YCW A;  2D5D A;  1HTL D;  1D6E C;  1CI3 M;  4R4Q A;  3AB9 A;  1VQF A;  2H4O A;  1X54 A;  4KKU A;  5C44 H;  2ZXP A;  2VL6 A;  5C3E H;  4A3M B;  3A7A B;  4XQQ A;  2L0C A;  2YTX A;  4A3F B;  4DNI A;  3I4N H;  4A3B G;  4DR4 L;  1JWM D;  1G2T A;  3W5O A;  3MWY W;  4PMW A;  1TS5 A;  1TWF B;  4FO2 A;  3M3Y B;  4DPG A;  2F4V L;  4NMZ A;  4BBR B;  2JA7 G;  3JAM L;  4A3L G;  1EYD A;  4JI5 Q;  1E1O A;  1I6H H;  4JC0 A;  3I8Z A;  5GAH C;  4DV6 Q;  5I9P A;  1JE5 A;  2R92 B;  3S14 B;  5EKI A;  2FJ2 A;  1EOT A;  1SJH D;  4GLA C;  4J1M A;  4JK1 C;  2D0P A;  1YIJ A;  1HA5 A;  4GKJ Q;  1I50 H;  1CK1 A;  4DK6 C;  4HJ9 A;  4IPD A;  4R4T A;  4IOC A;  1JOK A;  1V9P A;  3OTO L;  2OXP A;  4POG A;  4H0L C;  4LWC A;  3PUW A;  2ES2 A;  4M8A A;  3CRL C;  2V1C C;  1RKN A;  2IHE A;  4GZY C;  4DR1 L;  2D0O A;  2L9H A;  2FIN B;  1E2W A;  2R7D A;  2PQA A;  5TSS A;  3EJI A;  1ZKO A;  2GA4 B;  1W3S A;  5DLQ E;  5FO7 B;  4C3H H;  1MJC A;  5IE8 A;  3KDF A;  3GV6 A;  1I4G A;  2BE5 C;  5IY0 A;  2IX0 A;  1Q8K A;  4Y52 H;  1M8A A;  1BO0 A;  3D4W A;  2AQ1 B;  5C0X J;  1YJW A;  5KGU A;  4RGM A;  4AYB G;  2E5L Q;  1HH2 P;  3DEO A;  2I0Q A;  4CDC C;  1MSG A;  3TZD A;  4XIG S;  3NPP A;  3U9S A;  3T1H L;  1VCI A;  5C6A A;  5BN5 A;  5IYD G;  1AE3 A;  2B2W C;  1GUT A;  1FGB D;  3TDQ A;  3H91 A;  5IGF A;  3PUV A;  1D5X C;  1VQ4 A;  4LFA L;  2B3G A;  4A3M G;  4GOP A;  2F0U A;  1K8O A;  1YNJ D;  4A3F G;  2CW0 D;  3J81 i;  5A2Q L;  5COR A;  4OHJ A;  2O5I C;  2LS0 1;  2UUA L;  3I4M B;  2EXD A;  4LF5 L;  2N78 A;  1EYG A;  4BBR G;  1LUZ A;  1XTC D;  4K0K L;  2XVS A;  4ILW A;  2F1M A;  1XNR L;  4CGY B;  2R92 G;  1J6Q A;  1I4Q A;  1BBX C;  1XMO Q;  2KA7 A;  3UDF A;  3VA7 A;  3S1R B;  5JVH 3;  1B4O A;  2MNA A;  1I3Q B;  2R7Z H;  3R3O A;  5C3X A;  2BH8 A;  1V8Q A;  1S5E D;  3PIP A;  1TII D;  1JB3 A;  2IL8 A;  2K52 A;  3LNN A;  4BBS B;  2F0M A;  5EBC A;  1GO3 E;  2IHF A;  1PZI D;  1A15 A;  4OWW B;  4JI8 Q;  2RHQ B;  1EU4 A;  4Y7N B;  4FDB A;  2MP1 A;  5LHY 1;  5HGQ A;  5ELD A;  2VNU D;  1PFM A;  2Z4I A;  2UXB Q;  2NVQ H;  2SEB D;  3Q6S A;  4NDX A;  2DN8 A;  2E2D C;  2K1B A;  2M9V A;  1E22 A;  2A6H C;  1CHP D;  3TSS A;  5IYD H;  1VQ9 A;  1IBM L;  5GAG C;  2HUG A;  1U4P A;  2PQA B;  4MN3 A;  4DK3 C;  5JEA H;  1EQV A;  1KIX A;  3VR5 A;  1GVP A;  1STB A;  2B63 B;  1ASZ A;  1I4P A;  1SNC A;  2JQO A;  2ALY B;  3LGJ A;  5CBA E;  1BDO A;  3DWA A;  3KDF B;  2NBF A;  3PSI A;  1DYQ A;  3MVV A;  5IT9 c;  2JSO A;  4X65 Q;  1YHB A;  3QB3 A;  3JAM E;  5E3F A;  1X3F A;  1MJE A;  1KDA A;  4NXM Q;  1JQY D;  1EOV A;  3I4L A;  3X3M A;  4B3T Q;  1DON A;  4HSV A;  3CPW A;  2YV5 A;  3PO2 H;  3DM1 A;  2YTV A;  4M1U B;  5J22 A;  1SYG A;  2MQH A;  4OIJ A;  3I4M G;  1UUP A;  2RDH A;  4GOP B;  3PF5 A;  2ID0 A;  1V1Q A;  2BA0 A;  1RIP A;  5NUC A;  1U4L A;  4LF7 L;  1ENA A;  3F8T A;  2E2H B;  5IIF A;  1N32 Q;  2CKZ B;  5EPJ A;  3A7L A;  3QIA A;  3IRB A;  1C9O A;  3NQI A;  3F2B A;  5IP7 H;  4K5W A;  2YTY A;  1YNN C;  1TXY A;  3TRE A;  3WDN A;  2EXZ A;  5BN4 A;  3EA6 A;  4BBS G;  4EQO A;  2QEJ C;  3URY A;  4X3U A;  4XDX A;  4KY5 A;  3GDE A;  1IBL Q;  3VR6 A;  4O0A A;  3K5M A;  2B2U C;  5G3L D;  1JMC A;  2BDO A;  4G7H C;  2NVY B;  1D1I A;  1GXD C;  2HIV A;  2E2I B;  4ZLT F;  1UAP A;  5CBE E;  3TME A;  2ZM6 Q;  4A3G B;  3VYS A;  2LFN A;  4IFD H;  1II3 A;  2NVX B;  4QL5 A;  3HOZ H;  2B63 G;  2K05 A;  1Y8O B;  5A2Q E;  4OO1 H;  1C7Y A;  3J7A 5;  1TWG H;  3ERQ A;  5GAE C;  3GTJ H;  1QZG A;  4KKT A;  1Y1V B;  2WAQ B;  4X3T A;  2L11 A;  4DUY L;  2A19 A;  3I3C A;  3I4M H;  3SR1 A;  4CDD C;  1KXL A;  4JI8 L;  2L55 A;  4HMI A;  4PZ6 A;  2ZTC A;  3C3L A;  4AIM A;  1F9R A;  1O7I A;  3IFD A;  1D2B A;  1XTD A;  2KVM A;  1S5D D;  1IYJ B;  3UE1 A;  3HOY B;  3N52 A;  3EQL C;  4QQB X;  1CKN B;  3SK5 A;  1KRS A;  2A74 C;  5JPN C;  1A62 A;  4RHR A;  3OYY A;  1S5C D;  4ODG A;  1QIL A;  3IL8 A;  3NTI A;  4C2M B;  2R7F A;  1WI5 A;  1BNZ A;  4DV3 L;  4N9P A;  1SJE D;  1EL0 A;  3UI2 A;  4MTK A;  1UE6 A;  3TP8 A;  4DV0 L;  1EY5 A;  3PF4 A;  1STE A;  3CC7 A;  1N33 L;  2F0D A;  2K01 A;  1N9W A;  1QNK A;  5M9O A;  1VQP A;  3VR2 A;  1A8V A;  4OGQ C;  4UAI A;  3U50 C;  2B63 H;  4F7X A;  5JEA J;  1XX8 A;  3SVM A;  1STN A;  3CXC A;  1J5E Q;  2B2T A;  1PTO D;  4JI0 Q;  4RCN A;  4ULL A;  3J81 L;  3M4O B;  1WCM B;  3DHQ A;  4JVZ A;  4I7Z C;  3D6W A;  2EY6 A;  1VQN A;  3CC2 A;  2O2L D;  2PNH A;  2XSC A;  4OX9 Q;  1ONL A;  3KJO A;  4A3G G;  1ICF B;  3NEL A;  2QW7 A;  3K5L A;  4DAY A;  1TY2 A;  3RZD B;  4FVM A;  1KAA A;  4GLV B;  3CHB D;  5C4J H;  5IGC A;  5EQ0 A;  2PZU A;  4LFB Q;  1Y1V G;  1VMP A;  2WAQ G;  4P74 A;  4A3K B;  3A55 A;  3I56 A;  1IBL L;  3L9A X;  1A2T A;  1HPC A;  1NAP A;  1SYF A;  1WTP A;  2VS1 A;  4DV4 L;  2EYO A;  2HIX A;  4K2K A;  5EAY A;  1NR2 A;  1T5E A;  2Z4H A;  1VQJ A;  1EZ8 A;  5KYL A;  3HOY G;  1DM0 B;  1OXV A;  2OTJ A;  3NWS A;  1S3O A;  3M4P A;  1ESR A;  3HOX H;  1L0W A;  4GN5 A;  1LTG D;  3OIP A;  3GTL H;  3ND9 A;  1PLF A;  1B3Q A;  2DJG C;  1O78 A;  1KL9 A;  4NKL A;  4RCO A;  2QGQ A;  1ILQ A;  4DAV A;  4DNT B;  2F0W A;  3L0O A;  3CKI B;  4RGT A;  2EY5 A;  2JXM B;  2J0T D;  2R3Z A;  4JI7 Q;  1YHA A;  4DR2 L;  4XT3 B;  1B3A A;  4E6I A;  2CWA A;  1V43 A;  3H3V H;  2WIN B;  1PTO B;  5D65 A;  3C1E A;  1G8Z D;  1N34 Q;  3TRZ A;  2FXQ A;  1F9S A;  4BY1 B;  1SAP A;  5LL6 S;  2MHV A;  4RAU C;  1LTR D;  4IFD J;  4POF A;  2AMC B;  2ZTE A;  3A5U A;  1FVI A;  2M00 A;  2NZO A;  2VB2 X;  1X56 A;  4ZRZ A;  1WCM G;  4YHH Q;  4OEM B;  4EVO A;  2Q2U A;  1Q1E A;  2A68 D;  1R4P B;  5LMN Q;  3OTO Q;  1C0A A;  2NYZ D;  2R93 H;  4PNY A;  4BXX G;  1N36 L;  1JT8 A;  2F0G A;  5I9O A;  3HOY H;  4V0B A;  5IYC H;  3QOL A;  4IUT A;  4K5V A;  5C44 B;  1K9M C;  4H7B A;  5C3E B;  4OXP A;  4YWL A;  3MXU A;  4JBK A;  4DAY B;  4OEL B;  5C0X G;  4A3K G;  4A3C H;  3I4N B;  4AQY L;  4C2M H;  2Q2H A;  2VQF L;  4G7Z C;  2WKD A;  2DY7 A;  1K83 H;  4A3D B;  4JI0 L;  1OXU A;  1K0R A;  2X6G A;  4Z9C B;  2AWO A;  3BDO A;  1I94 L;  1U5K A;  3E5S A;  1Q86 C;  1KRT A;  3TS0 A;  4KJO A;  4FXG C;  2XWJ B;  2QIL A;  3TP6 A;  1YNX A;  4IUR A;  3BZC A;  1D8L A;  2B29 A;  1EEF D;  3BVM A;  1I50 B;  4UPA A;  2I07 B;  3SGI A;  1WTV A;  1EYA A;  1HR0 Q;  3HKZ E;  1CQV A;  1OXX K;  3PGZ A;  1CZG A;  3CP0 A;  4H13 C;  4IO9 A;  4LFB L;  1K73 C;  3J81 j;  3J81 E;  4IAL A;  3A8I E;  1PZK D;  4L5S A;  3MEH A;  3HRZ C;  3S15 H;  2F4V Q;  4CKC A;  5IOD A;  3EBE A;  1A3T A;  3NE5 B;  4YY3 L;  1B70 B;  4IUN A;  1ESF A;  1DOL A;  4F87 A;  2ZXO A;  4LF8 L;  3MFG A;  4BXX H;  4B9X A;  3CF5 A;  1Y8N B;  4IQZ A;  2MO1 A;  4BY1 G;  4C3H B;  4HN7 A;  3RZD H;  3TP7 A;  5ELB A;  1EIG A;  1WTW A;  3KF8 A;  2BOS A;  1F2Y A;  4DV7 L;  2WII B;  1LTT D;  1PH6 A;  3ERO A;  1D7Q A;  4NXN L;  2VXW A;  5ELF A;  5DM6 3;  1TVX A;  4DR1 Q;  2L4N A;  4JV5 Q;  4JI7 L;  2MGS A;  3L7Z C;  1G51 A;  5EKK A;  4HAE A;  3M9B A;  2B2V A;  1N34 L;  1GM5 A;  5C44 G;  2LKV A;  2NB0 A;  2H1E A;  5C3E G;  1C4Q A;  3AMU A;  1YBY A;  3ICE A;  1BCP F;  3IAY A;  4IUQ A;  1QB5 D;  3I4N G;  1S72 A;  5BR8 Q;  3MXG A;  1B53 A;  4RHS A;  4A3D G;  3PO3 H;  2XIW A;  5C5L A;  4MHE A;  3OIQ A;  2BCO A;  1XJV A;  1X65 A;  4WFN 3;  5E4W C;  2HQE A;  2NWG A;  3OOC A;  4MTN A;  2NZH A;  4QY7 A;  3KFU A;  4DNR B;  5LMN L;  5FLX L;  1NTG A;  4P72 A; 
#chains in the Genus database with same CATH homology
 3R2T A;  1EU3 A;  1PTO H;  5DEH A;  5IGD A;  3LWU A;  5FOB B;  2R7Z B;  2B8G A;  1CT1 D;  3VA5 A;  3K7A B;  2F0L A;  5FKA C;  5A35 A;  1JWU D;  3K6O A;  3A8J E;  2EYL A;  1Z6H A;  5DNF A;  1FNW A;  2NVQ B;  3J80 L;  1JWS D;  2F0O A;  1TS3 A;  2K5D A;  3GTK B;  4C3H G;  3FMC A;  1ENC A;  4HED A;  3J7A F;  2RDG A;  3BDL A;  3ZYY X;  2Z8L A;  4G57 A;  1LV9 A;  3DEP A;  2A6E C;  3S16 B;  1RD9 D;  3BVZ A;  1EFI D;  3I91 A;  1F77 A;  1GUS A;  1HHV A;  5CYU A;  5D14 A;  2N88 A;  3PO2 B;  1V1P B;  4PQX A;  1HCZ A;  1DZ1 A;  3R2I A;  1SNO A;  4K6L A;  1AW7 A;  1KLU D;  1KNE A;  2B2W A;  3PUZ A;  4IN3 A;  1AZQ A;  2BE5 D;  1FYC A;  3OMC A;  1F2Z A;  4OIK A;  2BDN A;  2YYZ A;  5G3L F;  1EIH A;  4FF4 A;  1D5M C;  4L63 B;  2SDF A;  1S4Z A;  4LK1 C;  4KMU C;  1CHQ D;  3TP5 A;  5ELE A;  4K6D A;  2LMC B;  1QJO A;  1SNM A;  1LLR D;  2C5C A;  1HXY D;  2NTT A;  1CA6 A;  5JEA G;  3EVQ A;  3HOZ B;  5EJW A;  4RWS C;  1OO9 B;  1TWG B;  3GTJ B;  2JEB I;  5M5W B;  1PRT D;  1F2L A;  4CHT B;  1EQT A;  5FLX E;  3WOF A;  1JOQ A;  2AUK A;  5T1G A;  3T16 A;  2DNC A;  3D6C A;  3MAQ A;  4ID6 A;  2IWH A;  2RKS A;  3BG3 A;  2XN9 C;  1MGS A;  4CKB A;  4R8N A;  1J9O A;  4RGO S;  2A6H D;  3T51 B;  4QUF A;  3QWN A;  4Q0F A;  1H9M A;  1KNA A;  2CW0 C;  4Q5V A;  3J80 E;  2D9U A;  1LTB D;  5EPK A;  3D8G A;  1SE2 A;  1I4X A;  4TKO B;  3K57 A;  1BCP C;  1J8I A;  5J39 A;  3P75 A;  2KQ3 A;  4DK1 A;  2KEE A;  1M4V A;  2F0Q A;  4KTA A;  1EWC A;  1SYE A;  3C1F A;  2RQX A;  3GO5 A;  2KCN A;  3OSO A;  1GUG A;  2JE6 I;  1I4R A;  1PRT B;  4IFD G;  1Q1B A;  3MFY A;  4OO1 G;  1DJR D;  4MIU A;  5C4J B;  2B2U A;  1KAB A;  4ZKC B;  1LT6 D;  3FPP A;  4XTC S;  2RA4 A;  2IPK D;  1H9R A;  5EGT A;  5EKL A;  2Q8T A;  2K6A A;  3K58 A;  4RFB A;  3SEB A;  4YIJ A;  5I6Y A;  1E2Z A;  2QDB A;  3F2U A;  3M4Y A;  3C46 A;  2MJ8 A;  3T56 B;  4ZAI A;  3HOX B;  3BYY B;  1EY4 A;  4O1N A;  3HG9 A;  1RTO A;  3M85 A;  1Y69 U;  3GTL B;  1MI2 A;  4LAA A;  1KLG D;  3SDZ A;  2ICE C;  3IFT A;  1ZYR C;  1FD7 D;  2KHS A;  3Q24 A;  5DM7 3;  3X3N A;  2KJX A;  3A56 A;  1ET9 A;  1JIC A;  1CZW A;  3O13 A;  3MZ5 A;  2E76 C;  3ONA B;  1GHJ A;  3Q23 A;  5C4Z A;  2J4X A;  4TQU S;  3D31 A;  1NR4 A;  1JOR A;  1Z7T A;  2EDG A;  2AWN A;  2PW5 A;  2R93 B;  1TR5 A;  4J8Q A;  2R6G A;  4ZQ3 A;  1X3Q A;  2MUY A;  2EJM A;  4HCS A;  3RD4 A;  1SE4 A;  3ND8 A;  2WB1 B;  3H94 A;  4U67 3;  1K83 B;  1WTX A;  3RLF A;  3D4D A;  1L0X B;  3RUZ A;  4BA1 I;  3P1H A;  1VF7 A;  3NTK A;  2CVR A;  3TZU A;  5I6W A;  4RA8 A;  1RJT A;  4C3J B;  2IJ0 A;  2ZT9 C;  4ZYS A;  3G7L A;  2PNR C;  3L3O C;  3S15 B;  1CM9 A;  1TKW B;  1O7Y A;  1NUC A;  5CGK A;  2JA5 B;  1QG7 A;  2K28 A;  4QMG A;  3I73 A;  4F88 A;  1LT4 D;  3H09 A;  1PFN A;  5K36 G;  1G6Z A;  5IGB A;  4FF2 A;  4QIW B;  1I6V C;  4XYQ A;  2EYJ A;  3Q0A A;  1LTS D;  1IKM A;  2WP8 J;  4QCL A;  3AU7 A;  1QE6 A;  1H9J A;  3SK8 A;  3HZX A;  3OMG A;  2A69 C;  1B9M A;  1EEI D;  3K0Y A;  2SOB A;  2F0P A;  1HQR D;  1SND A;  3N6R A;  3PO3 B;  2EYP A;  5CV8 A;  5M3F B;  1V1O A;  2JP1 A;  3MC0 B;  1E2V A;  3P20 A;  1ROD A;  4KKS A;  1KTK A;  4DU9 A;  1CTM A;  3DMU A;  2NUC A;  1STY A;  2VUM B;  3NUC A;  5K36 H;  4C3J G;  1WTO A;  2SNM A;  2JA6 B;  2QKI C;  4P2C B;  1SMY C;  3DXJ C;  4FNF A;  1A2U A;  5KNC A;  1Z47 A;  3MXN A;  3S1M B;  3HS0 C;  5FO9 B;  2RDF A;  1QWY A;  3KLR A;  1JCK B;  3S2D B;  1WTQ A;  3LWE A;  5KND A;  4NP5 A;  1PYW D;  1TWC B;  1BOS A;  4DF7 A;  4A3I B;  1Q3L A;  1SXT A;  3NQT A;  3P7J A;  3T53 B;  5EPL A;  4O42 A;  2NN6 H;  2F3W A;  4CJ1 B;  3T13 A;  5CMD A;  2D62 A;  3TN2 A;  1TWH B;  3GTG B;  2F0N A;  5KYI A;  2C9O A;  4C1N K;  3H0G B;  3K5N A;  1EZ6 A;  1B9N A;  3I90 A;  1EY6 A;  2EYM A;  4R9W A;  3SK4 A;  3KBX A;  5T1I A;  3NK9 A;  3GD7 A;  1FNU A;  3PUX A;  3G6J B;  3DUZ A;  2QF7 A;  3QO2 A;  4KK7 A;  1K8M A;  4B08 A;  1L0Y B;  1HTP A;  2AQ2 B;  1PXU A;  1SDF A;  4JBW A;  1IW7 C;  3KK7 A;  2QCP X;  5CV9 A;  1PRT F;  4ZK9 B;  1SYD A;  5ISR A;  2IX1 A;  3FEW X;  1F9P A;  2TSS A;  1W6K A;  5KIX A;  1MD2 D;  3GV3 A;  2V4D A;  4PV1 C;  1IYU A;  2DNE A;  3MA2 B;  2J7Z A;  1G91 A;  1VF5 C;  3GTP B;  1R9T B;  2Q8I B;  4K2L A;  4EQP A;  4OL7 A;  3KLS A;  1F2M A;  1W6J A;  2XWB B;  1EY8 A;  1MBY A;  5CC4 A;  3Q22 A;  5ELC A;  1LT3 D;  5CR3 A;  4ZKB B;  1XYI A;  5JJZ A;  4CJ0 B;  4U68 A;  1HA6 A;  4ZUJ A;  2X6L A;  1ZEQ X;  2EJG C;  4G4K A;  3I70 A;  3PIP 3;  1CA5 A;  1HUM A;  2IX3 A;  1TT2 A;  3U9O A;  2L12 A;  1ICW A;  2XNA C;  2FHT A;  3E6Z X;  3BVG A;  5IOC A;  4KN4 C;  1TQO A;  5HGT A;  1HQM C;  1GUW A;  2PO4 A;  3VYR A;  4DXG A;  3PIO 3;  3VR4 A;  2NN6 I;  3NTH A;  4G7O C;  4X3K A;  1WTR A;  3CQZ B;  1U9R A;  3T4A C;  2PPB C;  3PV0 A;  2KCC A;  5FK9 C;  1FR3 A;  5M3M B;  2F0V A;  4RKB A;  2F0S A;  1BR9 A;  4A93 B;  3PMF A;  2B2Y C;  5D3D A;  2D2C C;  3GTM B;  1X32 A;  1SNP A;  2E75 C;  4N9T A;  1WD1 A;  1B44 D;  2PMZ B;  2KEC A;  1DXM A;  3M7N A;  5C4H A;  4EGV A;  3HEJ A;  4DN4 M;  3NBH A;  1Q90 A;  1HFG A;  2F03 A;  1EWH A;  1B50 A;  3W3A A;  4HMJ A;  1WD0 A;  4KD3 A;  5CV6 A;  5EBD A;  2NVT B;  1TS2 A;  5AFW A;  2ICI A;  1NSN S;  5E1F A;  1CQF A;  3M7G A;  3KBG A;  5KNB A;  1E0B A;  1RF2 D;  4FXK C;  5I4D A;  5C0X I;  1AP0 A;  1HUN A;  3I72 A;  4PMB A;  3NBI A;  3SE0 A;  4HR7 B;  2F0H A;  3V2T A;  5IGG A;  3NWT A;  5JVG 3;  1IKL A;  5JAV A;  5CV5 A;  4QUC A;  2VB3 X;  2ENB A;  1JC7 A;  2RVL A;  4XT1 B;  1A3V A;  3R8B A;  3K59 A;  3BDC A;  4IUP A;  1VMC A;  1TY0 A;  3KUP A;  1BUV T;  2LY7 A;  1KDB A;  4KY6 A;  1TS4 A;  2NTS A;  1BCP D;  1YNJ C;  1D1K A;  3D4R A;  3W2D A;  1PRT C;  4BA2 I;  1PTO F;  1SBB B;  4KHV A;  2JYO A;  1GUN A;  2SNS A;  1ML0 D;  4WJW A;  1BF4 A;  2CQA A;  2BA1 A;  3J7A V;  4A3J B;  3HOV B;  1S5B D;  1DOM A;  2EOT A;  2X69 A;  3HOW B;  5CV7 A;  3OPO A;  2NZ1 D;  2YU9 B;  4RH6 A;  2F0F A;  4QB4 A;  1QOH A;  1Y1W B;  2O4X A;  2K5W A;  4J6H A;  4TSS A;  3KLS X;  1XWE A;  3GTQ B;  5M5X B;  5FO8 B;  2HCC A;  2M2L A;  2F4I A;  1YNN D;  4CKE A;  2FFK B;  3OW7 A;  3H3V C;  1JOO A;  3SK6 A;  3TBI B;  3HGB A;  3HKZ B;  2PZT A;  1ZYR D;  3CRK C;  5IT9 L;  1GOZ A;  1BCP B;  3OWF A;  3MTS A;  4KHZ A;  1RCV D;  1RDP D;  3VR3 A;  3BYT B;  2K32 A;  2F3V A;  1LTI D;  4IZ8 A;  2OT2 A;  2EZV A;  4DGZ A;  2PCF B;  3FVQ A;  2KOL A;  4XQN A;  2K04 A;  2OEO A;  2HDM A;  2K5Q A;  3IKJ A;  1XXG A;  1A6X A;  2PYK A;  4BY7 B;  4TRD A;  2EY1 A;  2KED A;  4C56 C;  5C4X B;  2F0E A;  1SNQ A;  1ILP A;  4FP5 D;  2Y0S B;  1PFB A;  3S17 B;  1JE4 A;  2HCI A;  1PZJ D;  2RBM A;  1UNS A;  4H44 C;  4L6T B;  2EYH A;  1I4H A;  3GP7 A;  4R8I A;  3H6M A;  2AUJ D;  1Q8I A;  1D5Z C;  5LL6 X;  3QOJ A;  5M5Y B;  1LAC A;  1LO5 D;  2HDL A;  1C48 A;  2L1B A;  2EVB A;  2MPM A;  1X3P A;  3HOU B;  1PDQ A;  1G29 1;  1LAB A;  5CV4 A;  2AQ3 B;  3R93 A;  3GTO B;  4ME5 A;  4IUV A;  4C3I B;  3DWP A;  3V05 A;  1AZP A;  5F2D A;  3VYU A;  3C2P A;  2E2J B;  4QF4 A;  4KD4 A;  1OXT A;  2ZXR A;  2F0K A;  3V96 A;  3NXW A;  2O5J C;  1HRJ A;  4WOR A;  3BS1 A;  5C3W A;  2G9D A;  3BZD B;  2WAC A;  2F0J A;  1CFM A;  1JR0 D;  2A69 D;  3VYT A;  2CHB D;  1OXS C;  4WRD A;  1IYV A;  1H9S A;  4K8J A;  5J1Z A;  1PTO C;  5IT9 E;  1ET6 A;  1F9Q A;  4ZUI A;  1SYB A;  1IHZ A;  1SYC A;  1H9K A;  2WKC A;  3K5O A;  3OWE B;  3SXH A;  1PMR A;  3NP8 A;  3RMH A;  3FRP B;  4UDU C;  4KI0 A;  1SEB D;  3FDT A;  2B2T C;  4EQN A;  2IT1 A;  2A73 B;  1MSH A;  1BQQ T;  2NN6 G;  1STH A;  3A8K E;  2IW3 A;  1RHP A;  1A3U A;  2XRQ D;  4XYO A;  1SMY D;  5KEE A;  2JA8 B;  2K7V A;  1DD2 A;  4DFA A;  3DWQ A;  4B9W A;  4C3I G;  2EPB A;  3LX0 A;  5DAU A;  4FF3 A;  3SHL A;  3PUY A;  1GJX A;  3S2H B;  4KY7 A;  3QJY A;  4FYD A;  4PMC A;  1GUO A;  4RKL A;  2PW7 A;  4DAP A;  1BXT A;  1TWA B;  4FF1 A;  3GQB A;  1ZXT A;  3CU7 A;  5C5M A;  2PQE A;  4IFD I;  2F0I A;  1SSO A;  4S3S A;  1KDC A;  3OHX C;  4F8M A;  2K03 A;  4OO1 I;  1R4Q B;  4DK0 A;  1SFO B;  2G9H D;  1O7Z A;  1O80 A;  1Y8P B;  3FKI B;  4KV6 A;  4A3E B;  2E74 C;  3ITP A;  4XQJ A;  4KN7 C;  2KUM A;  4LMQ D;  5JOB A;  2JEA I;  3RZO B;  5HUR A;  2A68 C;  1H9S B;  1EY7 A;  1SE3 A;  2I46 A;  4ABN A;  1AFP A;  2L5T A;  2A5H A;  1ENF A;  2Z1C A;  3D3R A;  4LJZ C;  4L8J A;  5IGE A;  1I6H B;  4IUU A;  2F0T A;  4BWG B;  2TMP A;  1G2S A;  3NSW A;  2DY8 A;  4XXE A;  2WV6 D;  3QG1 A;  2K33 A;  4HCE A;  4I65 A;  5COY A;  1O7L A;  1IW7 D;  2B39 A;  2B8F A;  4HTH A;  1Q12 A;  3WOE A;  1WVL A;  4RGN A;  3MHB A;  1UEA B;  1LT5 D;  2RSN A;  4HSP A;  2N55 A;  5E4X A;  1LTA D;  4DA2 A;  2EYF A;  3NHH A;  1QCB D;  4K8I A;  3J7Y W;  1B1Z A;  1T5X D;  3S1N B;  2EJF C;  5C0X H;  4A3B B;  5JPM C;  4C1N I;  1DOK A;  5I2X A;  5D3I B;  2JA7 B;  2PZW A;  3A54 A;  3FPU B;  1DCZ A;  2Q8R E;  1V1P A;  1U4M A;  4BS9 A;  1AEX A;  4CJ2 C;  4K5X A;  2RSO A;  5K5P A;  2EY2 A;  1FNV A;  1U4R A;  2OF1 A;  1C8C A;  1GHK A;  4V19 0;  1IL8 A;  4CBV A;  1EYC A;  1EY9 A;  2R61 A;  4X3S A;  1VDZ A;  2EE1 A;  1STG A;  3E0J A;  1S5F D;  1EY0 A;  3S9W A;  4K14 A;  1B2T A;  5BN3 A;  4NW2 A;  1AN8 A;  3EFX D;  2A6E D;  5I2Y A;  3S1Q B;  1STA A;  5KRU A;  2B2V C;  2XRS D;  4DXF A;  1QNU A;  4KJN A;  4FXD A;  1NCV A;  3MXP A;  1TU2 B;  3HP3 A;  2FMM A;  2FMC A;  4AYB B;  1HFN A;  2B2Y A;  1RTN A;  2D5D A;  1HTL D;  1D6E C;  1CI3 M;  3AB9 A;  2H4O A;  4KKU A;  2ZXP A;  4A3M B;  3A7A B;  4XQQ A;  2L0C A;  4A3F B;  1JWM D;  1G2T A;  3MWY W;  4PMW A;  1TS5 A;  1TWF B;  4FO2 A;  3M3Y B;  4NMZ A;  4BBR B;  3JAM L;  1EYD A;  3I8Z A;  5I9P A;  2R92 B;  3S14 B;  5EKI A;  2FJ2 A;  1EOT A;  1SJH D;  4JK1 C;  4J1M A;  1HA5 A;  1CK1 A;  1JOK A;  2OXP A;  4H0L C;  3PUW A;  4M8A A;  3CRL C;  1RKN A;  4GZY C;  2L9H A;  2FIN B;  1E2W A;  5TSS A;  3EJI A;  1ZKO A;  2GA4 B;  5FO7 B;  3GV6 A;  1I4G A;  2BE5 C;  2IX0 A;  1M8A A;  1BO0 A;  3D4W A;  2AQ1 B;  5C0X J;  5KGU A;  4RGM A;  3DEO A;  1MSG A;  3TZD A;  4XIG S;  3NPP A;  3U9S A;  1VCI A;  5C6A A;  5BN5 A;  2B2W C;  1GUT A;  1FGB D;  3TDQ A;  3H91 A;  5IGF A;  3PUV A;  1D5X C;  2F0U A;  1K8O A;  1YNJ D;  2CW0 D;  5A2Q L;  5COR A;  4OHJ A;  2O5I C;  2LS0 1;  3I4M B;  1XTC D;  2XVS A;  4ILW A;  2F1M A;  4CGY B;  1I4Q A;  1BBX C;  2KA7 A;  3VA7 A;  3S1R B;  5JVH 3;  1B4O A;  1I3Q B;  3R3O A;  5C3X A;  1V8Q A;  1S5E D;  1TII D;  1JB3 A;  2IL8 A;  3LNN A;  4BBS B;  2F0M A;  5EBC A;  1PZI D;  1A15 A;  1EU4 A;  4Y7N B;  2MP1 A;  5LHY 1;  5ELD A;  2VNU D;  1PFM A;  2Z4I A;  2SEB D;  3Q6S A;  4NDX A;  2DN8 A;  2E2D C;  2K1B A;  2M9V A;  2A6H C;  1CHP D;  3TSS A;  2HUG A;  1U4P A;  4MN3 A;  5JEA H;  1EQV A;  3VR5 A;  1STB A;  2B63 B;  1I4P A;  1SNC A;  5CBA E;  1BDO A;  3DWA A;  2NBF A;  1DYQ A;  3MVV A;  2JSO A;  3QB3 A;  3JAM E;  5E3F A;  1KDA A;  1JQY D;  3I4L A;  3X3M A;  1DON A;  4HSV A;  3DM1 A;  4M1U B;  5J22 A;  1SYG A;  4OIJ A;  1UUP A;  2RDH A;  2ID0 A;  2BA0 A;  5NUC A;  1U4L A;  1ENA A;  2E2H B;  5IIF A;  5EPJ A;  3A7L A;  3QIA A;  3NQI A;  4K5W A;  1YNN C;  3WDN A;  2EXZ A;  5BN4 A;  3EA6 A;  4EQO A;  2QEJ C;  3URY A;  4X3U A;  4XDX A;  4KY5 A;  3VR6 A;  3K5M A;  2B2U C;  5G3L D;  2BDO A;  4G7H C;  2NVY B;  1D1I A;  1GXD C;  2E2I B;  4ZLT F;  1UAP A;  5CBE E;  3TME A;  4A3G B;  3VYS A;  2LFN A;  4IFD H;  1II3 A;  2NVX B;  2K05 A;  1Y8O B;  5A2Q E;  4OO1 H;  3ERQ A;  4KKT A;  1Y1V B;  2WAQ B;  4X3T A;  2L11 A;  3I3C A;  3SR1 A;  2L55 A;  4HMI A;  3C3L A;  1F9R A;  3IFD A;  1D2B A;  2KVM A;  1S5D D;  3HOY B;  3N52 A;  3EQL C;  3SK5 A;  2A74 C;  5JPN C;  4RHR A;  1S5C D;  4ODG A;  1QIL A;  3IL8 A;  3NTI A;  4C2M B;  1BNZ A;  4N9P A;  1SJE D;  1EL0 A;  3UI2 A;  3TP8 A;  1EY5 A;  1STE A;  2F0D A;  2K01 A;  1QNK A;  5M9O A;  3VR2 A;  4OGQ C;  4UAI A;  4F7X A;  5JEA J;  1XX8 A;  3SVM A;  1STN A;  2B2T A;  1PTO D;  4RCN A;  4ULL A;  3J81 L;  3M4O B;  1WCM B;  3DHQ A;  4I7Z C;  3D6W A;  2EY6 A;  2O2L D;  2XSC A;  1ONL A;  3K5L A;  4DAY A;  1TY2 A;  3RZD B;  4FVM A;  1KAA A;  3CHB D;  5IGC A;  5EQ0 A;  2PZU A;  1VMP A;  4A3K B;  3A55 A;  3L9A X;  1A2T A;  1HPC A;  1NAP A;  1SYF A;  1WTP A;  2EYO A;  4K2K A;  1NR2 A;  1T5E A;  2Z4H A;  1EZ8 A;  5KYL A;  1DM0 B;  1OXV A;  3NWS A;  1ESR A;  1LTG D;  3OIP A;  3ND9 A;  1PLF A;  1O78 A;  4NKL A;  4RCO A;  1ILQ A;  4DAV A;  4DNT B;  2F0W A;  3CKI B;  4RGT A;  2EY5 A;  2JXM B;  2J0T D;  2R3Z A;  4XT3 B;  1B3A A;  4E6I A;  1V43 A;  2WIN B;  1PTO B;  5D65 A;  3C1E A;  1G8Z D;  1F9S A;  4BY1 B;  1SAP A;  5LL6 S;  2MHV A;  4RAU C;  1LTR D;  4IFD J;  2M00 A;  2VB2 X;  4ZRZ A;  4EVO A;  1Q1E A;  2A68 D;  1R4P B;  2NYZ D;  4PNY A;  2F0G A;  5I9O A;  4V0B A;  3QOL A;  4IUT A;  4K5V A;  5C44 B;  4H7B A;  5C3E B;  3MXU A;  5C0X G;  3I4N B;  4G7Z C;  2WKD A;  2DY7 A;  4A3D B;  1OXU A;  2X6G A;  4Z9C B;  2AWO A;  3BDO A;  3E5S A;  4KJO A;  4FXG C;  2XWJ B;  2QIL A;  3TP6 A;  4IUR A;  1EEF D;  3BVM A;  1I50 B;  2I07 B;  1WTV A;  1EYA A;  1CQV A;  1OXX K;  1CZG A;  4H13 C;  3J81 E;  4IAL A;  3A8I E;  1PZK D;  3MEH A;  3HRZ C;  4CKC A;  5IOD A;  1A3T A;  3NE5 B;  4IUN A;  1ESF A;  1DOL A;  4F87 A;  2ZXO A;  3MFG A;  4B9X A;  1Y8N B;  4IQZ A;  4C3H B;  4HN7 A;  3TP7 A;  5ELB A;  1EIG A;  1WTW A;  3KF8 A;  2BOS A;  1F2Y A;  2WII B;  1LTT D;  3ERO A;  2VXW A;  5ELF A;  5DM6 3;  1TVX A;  2L4N A;  2MGS A;  3L7Z C;  5EKK A;  4HAE A;  2B2V A;  2LKV A;  2NB0 A;  2H1E A;  1C4Q A;  3AMU A;  1BCP F;  3IAY A;  4IUQ A;  1QB5 D;  3MXG A;  1B53 A;  4RHS A;  2XIW A;  5C5L A;  4MHE A;  3OIQ A;  2BCO A;  4WFN 3;  5E4W C;  2HQE A;  2NWG A;  3OOC A;  4DNR B;  5FLX L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...