1RTNA

Proton nmr assignments and solution conformation of rantes, a chemokine of the cc type
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RANTES
publication title Proton NMR assignments and solution conformation of RANTES, a chemokine of the C-C type.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
total genus 8
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rtnA00
1U4MA 5T1IA 1BF4A 1QE6A 2K04A 3IL8A 1WTVA 2J7ZA 2EE1A 4ZKBB 1PFMA 1RJTA 1AZQA 1U4LA 1EQTA 4O42A 3H91A 1EOTA 1G2SA 5E4WC 1WTQA 2CVRA 1F2LA 2KVMA 4HCSA 1WTWA 1J9OA 3I8ZA 3I91A 1DONA 2FMMA 4X3KA 1NAPA 1B4OA 1RTNA 3I90A 2M2LA 4IUPA 1ICWA 3P7JA 1X3QA 2KEDA 4U68A 1CM9A 1X32A 2RSNA 1XYIA 2MP1A 4X3UA 2FHTA 2HUGA 5CMDA 1G2TA 2B2WC 2NWGA 1GUWA 2HDLA 2EPBA 5D65A 1AP0A 2X6LA 1ML0D 1F9SA 2RSOA 2B2UC 1RHPA 1Q3LA 1C8CA 1ILPA 1DZ1A 1KNAA 1IKLA 2D9UA 2Q8TA 4CJ2C 2B2VA 1XX8A 2L9HA 2KEEA 1ILQA 1KNEA 2XIWA 2L12A 5CBAE 2JYOA 2B2YA 4IUUA 5AFWA 1A15A 1U4RA 1B53A 2EOTA 2KUMA 3KBXA 2RA4A 3GV3A 5E4XA 1MGSA 1CA5A 3N52A 1CA6A 2JP1A 2B2TA 2K05A 1DOLA 4LMQD 1HFNA 4ZK9B 1BBXC 3UI2A 1F9QA 1F9RA 2X69A 5EKIA 1MSHA 2VXWA 3MWYW 3FDTA 3I3CA 2Q8RE 3TZDA 3ONAB 4HEDA 4QUFA 1HRJA 4RWSC 3G7LA 1WTXA 1O7YA 5EPKA 2N55A 2X6GA 4ZLTF 4R8IA 4RA8A 4X3SA 4NW2A 1LV9A 4QUCA 4RAUC 3R93A 5JJZA 2L4NA 1SAPA 1IL8A 4ZKCB 2B2VC 4OIJA 1WTPA 1ESRA 1SDFA 1HA6A 4XDXA 1B50A 1DOMA 1E0BA 2B2YC 2BDNA 3Q6SA 1WD0A 1VMPA 2NYZD 2K1BA 1BNZA 2MJ8A 2FINB 1NR4A 1NR2A 1WD1A 4ZAIA 1ZXTA 2B2TC 3KUPA 4IUVA 3GV6A 5CORA 5DNFA 5EPJA 4UAIA 1WTRA 1F9PA 4CJ0B 4OIKA 4X3TA 2H1EA 1JE4A 1EIHA 1RTOA 1PLFA 3F2UA 1PDQA 1O7ZA 1RODA 1B2TA 2K28A 4XT1B 1G6ZA 5CBEE 3FPUB 2K01A 2HCIA 4IURA 1HFGA 4HSVA 3HP3A 2MPMA 1SSOA 4R9WA 4CJ1B 1IKMA 2N88A 4MHEA 1AZPA 2DY8A 5D14A 2L1BA 2K03A 3IFDA 3DEOA 2DY7A 2KECA 4IUQA 1HHVA 1EL0A 3LWEA 1S4ZA 2NZ1D 4IUTA 1WVLA 1MI2A 1WTOA 3TN2A 1MSGA 2HCCA 1QNKA 4HAEA 4DN4M 1NCVA 3SVMA 1VMCA 2MGSA 3D6WA 1J8IA 1EIGA 4XT3B 3QO2A 1HUMA 2KOLA 2L11A 5EJWA 1TVXA 2HDMA 1PFNA 1U4PA 2FJ2A 2RVLA 5COYA 2R3ZA 1B3AA 2IL8A 2FFKB 5EPLA 1JICA 1G91A 3DM1A 1HUNA 1DOKA 3MTSA 2B2WA 1BO0A 1M8AA 1PFBA 3DEPA 5EQ0A 5T1GA 1QG7A 2SDFA 1O80A 4MN3A 2B2UA 1X3PA
chains in the Genus database with same CATH superfamily
3LWUA 1RL2A 4J6HA 4KHVA 1VQGA 4IFDJ 1LYLA 2K4KA 2JEAI 1X54A 2NVQH 2GVAA 3NE5B 1PFMA 3FHWA 4P72A 3KF8A 2O5IC 3R3OA 3L7ZC 5GAHC 1SE2A 2K33A 4HCSA 5K36H 1H9JA 1J9OA 3L9AX 5M5WB 4LFCL 2WP8J 3F2DA 1KQSA 1UEBA 1NJIC 4KKUA 5ELDA 1ZYRC 3I70A 3CXCA 1XJVA 1VQ9A 3C46A 3TQYA 1IYJB 4UP8A 1EWIA 3PUYA 3A74A 1Q1BA 1CA5A 3HOUB 3GTMB 3RZDH 1FL0A 4JBWA 2JXMB 3K81C 3MWYW 2Q8RE 4KHPQ 3A0JA 4YCWA 3BU2A 1AFPA 4F87A 4C3IH 1EY8A 3R93A 5ELBA 1YBYA 3M4OB 4CBVA 1EY0A 1AW7A 5E3FA 4DA2A 1Q82C 4UP9A 4OEMB 5TSSA 4JBKA 2ZXOA 2JA6B 3CCVA 4OONA 4DR5Q 1JOOA 1ENCA 1A62A 3S17B 1JT8A 3CC4A 3EA6A 2RQXA 2QW7A 3JAME 4X3TA 5DM63 1GO3E 2F3IA 1O7ZA 2WB1E 1UAPA 2TSSA 2V4DA 4NXML 1N34Q 1TS4A 2WV6D 2LY7A 4GKJQ 4X62Q 2NVYH 2CQAA 3DEOA 5KEEA 3NK9A 5FLXc 2YYZA 4GKKL 2HCCA 4O0AA 5KYLA 4QCLA 2KOLA 2Z9HA 1GVPA 4XXEA 2FJ2A 3ND8A 5D3DA 5JJLA 5A2QE 1PTOF 4UPAA 2UU9L 4X64Q 1YNNC 2C9OA 1MKHA 2NVTH 1EY7A 2IY5B 3R2IA 3RLOA 2EVBA 1HXYD 2BE5C 4P71A 5IYDG 1LTID 2UUCQ 1U9RA 4QGUA 3UDFA 1KDAA 2EY6A 1EOVA 2F0TA 2ZTCA 3T56B 4BBSB 1DONA 4X3KA 1Z6HA 4YWKA 5GAGC 3HOUG 1TS2A 1D1IA 3BVZA 1E1TA 1NTGA 4PMWA 1CM9A 1BUVT 5LMNW 2E2IH 2Z6BA 3IKJA 2JA5G 4RKBA 3D8GA 1MD2D 4BA1I 3OWFA 4L5RC 1JCKB 1DM0B 2Q8TA 3W3AA 3OIPA 2XIWA 3JAML 2E2JB 2B2YA 3H6MA 1R9TH 3TP5A 3A8IE 3T1YQ 4OL7A 4OO1I 4DR3Q 1VQCA 1YVCA 3FEWX 2JP1A 1KL9A 4HIOA 1QCBD 2JA6G 3NTKA 3J7YW 3S14B 2RDFA 1XNQQ 2LXJA 2P5ZX 4PMBA 1MSHA 2K32A 4RWSC 3HOWH 2D0OA 2WFWA 4DV3L 1T5EA 2X6GA 4ZLTF 4RA8A 4XTCS 4DR4L 2OEOA 1IBLL 1SDFA 1CHQD 3NPPA 4XDXA 4GZYC 1B50A 4X65Q 3ICEA 5A2QL 1E0BA 3RN2A 1TWCB 2A73B 3D0FA 2IT1A 4DAVA 1FNWA 2AKWB 3E5SA 2WKCA 1EIHA 1K8GA 3PO3H 1WCMH 3RR5A 5CBEE 4KKSA 2XSCA 3NTHA 4DUYQ 3HOYH 1W3SA 3FP9A 5IGBA 2K03A 3E9IA 1QUQB 1WTHA 2H5XA 1LTGD 3TN2A 4HJ8A 1U0LA 1T5XD 4K0KL 1Y1VB 4DR6Q 1A3VA 4V0BA 3MXNA 3AYHB 4KY5A 4DAYB 1A2UA 4YY3L 4JPBW 4DNTB 5LMNQ 2A6HC 3HKSA 1GJXA 4C3HB 4LF6L 2EYOA 1JQYD 1M8AA 2A5HA 4YWLA 3I4NB 1HNZQ 4GS3A 2NVXB 3BYTB 2K75A 4IPCA 3H91A 4O42A 4NXNL 1JORA 1H95A 3I8ZA 4K6LA 3I91A 3SR1A 3H3VH 3I90A 3EVQA 3RZOB 2VQEQ 3TREA 1HH2P 3DLLA 1H9KA 1XXGA 1KRTA 3OIQA 4LWCA 3W1GA 5I4DA 4A3EG 1PRTC 1BBWA 1F9SA 1KAAA 1DZ1A 2ID0A 2QEJC 3QR8A 1EEID 5AFWA 2UXCL 1U4RA 3KK7A 4ALPA 3HRZC 1K8MA 1PH2A 5C4JB 1FD7D 1CFMA 1FNVA 4LMQD 1E24A 4DK3C 3OTOQ 3LX0A 4JI5Q 2EYHA 1F9RA 5FKAC 2WAQB 4IPDA 5C6AA 2QDLA 2EJMA 3AFPA 2N55A 3BVGA 3AEVA 2HQLA 3OPOA 4B3TL 4R8IA 4NW2A 1Z7TA 1SMYC 1HZCA 1I4PA 1SAPA 1VS0A 4QIWE 3VYSA 4CKEA 5A35A 2F4VL 4JV5Q 2NVQB 1UE7A 3SE0A 1YNJD 1Y69U 2NYZD 4DNRB 2YTYA 3A8KE 1WD1A 4UHVA 2B2TC 4FYDA 4CDDC 2BA1A 1LTBD 1Y1VG 4G7ZC 5LL6X 4R8NA 1JOQA 1S5DD 2C35B 1LT4D 1SJED 1SYFA 2LMCB 3HKZB 3GTPH 2R61A 1D7QA 1PTOD 4C3HG 4KHPL 1IBML 1YITA 3GTKB 3V2TA 3MFGA 1RIPA 3CRKC 2NN6G 3I4NG 3VR6A 2Q2HA 3CMAA 1EY5A 5JJKA 4A3KH 3VYTA 2MHVA 2PQAA 3GTJH 3Q24A 1HNXQ 1ZKOA 2NB0A 1PZID 4N8FA 3RZDB 4DR5L 2RVLA 4CKBA 3TP8A 2IX3A 1B3AA 2PW5A 4KHZA 2E74C 1SYDA 2F0PA 1PH6A 4DV2Q 2B2WA 1L0WA 1I4HA 4MTNA 4CDFC 4C3IB 1Y1WG 2HQEA 3PUVA 5FLXE 1LTTD 1B9NA 1XMQQ 2OTLA 3AFQA 4GKJL 3W2DA 4X62L 4L6TB 2EE1A 2JA7G 2K5VA 3DHQA 3E0JA 3CCMA 4GLAC 1EWCA 2CVRA 1F2LA 2RHSB 3KLSX 4LFCQ 2F0LA 3GTMH 3P7JA 1EQQA 1HZBA 1I5FA 1EUJA 1NY4A 1SNDA 2JA5H 2PCFB 1C48A 1STBA 4RG1A 3CC7A 1MHWC 2NVYB 1A3UA 5GAEC 1STHA 5H1SE 4BA2I 1LTAD 2LFNA 2KEEA 1KNEA 4LF7L 4IN3A 4A3MB 4K6DA 3MEHA 3QB3A 1VQ7A 3H15A 3KBXA 4IZ8A 3N52A 2OWOA 1BQQT 5IP9H 1STYA 1DOLA 1X3FA 3ER0A 2OT2A 4WJ4A 3L0OA 3UI2A 2VXWA 2NVTB 3PF5A 2VS1A 1NBWA 3PIOA 4UY8C 4K5WA 3J81c 5EPKA 1C7YA 2AQ3B 3S24A 2PI2A 1DGSA 3HKZG 1LV9A 2JA8G 5J22A 2ZJRA 1DOMA 3J81i 1X56A 1W6JA 5M9OA 3GTOB 1K83H 1X65A 2GVBA 3D31A 3U9SA 3T1YL 3RN5A 5FLXL 4DR3L 1LM0A 1XTDA 2KA7A 4WRDA 5IYCG 1JE4A 2E2IB 1IYUA 3NHHA 3ULPA 4NXMQ 4OGQC 3JAMc 3K5LA 1XNQL 4L8JA 2HD3A 1SSOA 1IKMA 3PMFA 4GKKQ 4C3IG 2BH2A 1WI5A 2N8NA 1DXMA 1R9TB 2NTTA 4C56C 5C44H 3KLSA 1ZYRD 3SK5A 1PH8A 3S2DH 1S72A 4X65L 3SVMA 4JI6Q 3TP7A 4R1JA 2UU9Q 3TEHB 2UXDL 4XQNA 5C4XG 4HJ5A 1KXLA 2FMCA 3DM1A 1DD2A 1TR5A 3HOWB 3EROA 1R4QB 1PRTF 1V1OA 1JJCB 2GN5A 2RDHA 1LUZA 4ZKBB 3G6EA 4A3MG 1JMCA 3PO2G 1DYQA 5C0XI 4GNXC 3BZDB 1LT3D 4GNXA 1CT1D 3C1EA 1B4OA 4GOPB 4DR6L 3PO3B 1WCMB 2Z4IA 1E2WA 1IBKL 4A3BG 4G7HC 3S15H 4BY7B 1D5MC 4X3UA 1L1OB 5LMNL 2FHTA 2F0FA 4A3EH 3HOYB 1YNJC 1NMFA 2B2UC 3D6CA 1KNAA 1KRSA 2F0OA 3C2PA 1KDBA 4JI2Q 1D8LA 3A5ZB 4QY7A 1HNZL 2B39A 1PH4A 2I5HA 3G6JB 3J81j 3GV3A 1JWUD 1L0XB 4Q5VA 4AYBB 5J3BA 5CV8A 1GOZA 4LK1C 1F9QA 3R8BA 1EQVA 2F0JA 1K28A 3G4SA 1CUKA 1B44D 4DR4Q 5JVH3 2VQEL 1IBLQ 2AWOA 2EXZA 2Z1CA 3G71A 3N6RA 2VW9A 3KF8B 2MJ8A 4PV1C 4KKTA 4DK6C 5DEHA 1XPUA 4POGA 4A3DG 3DXJC 1UE6A 1ZXTA 2AHOB 2BE5D 4OIKA 3FVQA 4XT1B 3VR5A 3OTOL 4JI5L 4KY6A 2MPMA 4R9WA 2F03A 2KCTA 2PZUA 1PH3A 3CC2A 5BN3A 4A93H 3S1MH 4WJ3M 3I72A 4QL5A 2NN6H 1JJ2A 3M4QA 4K14A 5JPMC 1IZ6A 3VR2A 4DN4M 3IAYA 1NCVA 4TQUS 4YY3Q 4IQZA 4G57A 2HDMA 1PFNA 3T16A 1VQNA 3NBHB 3OWEB 2QGQA 1WCMG 4EQPA 1JWSD 1Y1WH 4BY7G 1HA5A 3TMEA 2MQHA 1BCPB 1RDPD 4FF4A 2BH8A 5ELCA 1QE6A 1JC7A 1PYWD 3L2PA 2C5CA 1LLRD 2JA7H 2VUMG 1XMOQ 3F1ZA 2JN4A 4JI3L 4IJHA 1HQMC 2OXPA 2RBMA 3K59A 3VR3A 1IL2A 5C3WA 1RTNA 4AYBG 1F77A 1FYCA 2KEDA 1HNXL 2PI2E 2MP1A 1M90C 3GTPB 1AP0A 2LXKA 1D5ZC 1ML0D 4O2DA 1ILPA 3WOEA 1AEXA 4CJ2C 2B2VA 1D1KA 5ELNA 2UXCQ 4N8X1 1XMQL 3CPFA 3PIPA 4A3JG 4ME3A 4A3KB 2EOTA 5JEAG 4N9TA 4I65A 3HOXG 2CW0C 5E4XA 3GTJB 4G7OC 3H0GG 2KCMA 3CF5A 1CTMA 5CV5A 3OW7A 1K3BC 2K6AA 4PZ6A 5J1ZA 3J7A5 3GTQH 4LAAA 2XWBB 4ZRZA 2OF1A 4QUFA 1BXTA 3NQTA 4B3TQ 1WTXA 1PH9A 2UUBQ 5D3IB 1D2BA 2R7DA 3NQIA 1GUOA 2F52A 1XTCD 4X3SA 1PHJA 2F4VQ 2JA8H 2A6HD 4KI0A 2ATWA 2QCPX 5FO8B 2E2HB 5KNCA 3GTKH 3NUCA 1JB7A 3K8AA 3A56A 2K1BA 4ID6A 1VDZA 1VQKA 5IYCH 1FNUA 2JA5B 2Z8LA 2Q2UA 1PLFA 2KCCA 3J81E 3MVVA 1K8OA 1IBMQ 3E9HA 3A7LA 4RGMA 1H9SA 2J0TD 4E6IA 1ENFA 2F0SA 1SMXA 1AZPA 4HN7A 5D14A 3CCEA 4LF9Q 4JI4L 1GUGA 4R4TA 4HCEA 5JPNC 2NZ1D 4DUZQ 4MTKA 1FR3A 3QOJA 3VYRA 1PRTD 3GP7A 3DWQA 4XT3B 1EFID 5K5PA 4LW1A 4IFDI 2H4OA 2F0EA 1EU3A 4R4IA 1P8LA 4JBJA 5C4XH 5IY0A 1EYCA 2ASBA 3I7FA 3EN2A 5FOBB 3ITPA 2QEXA 1KC8C 3E3XA 4KN7C 1TU2B 4DV4Q 1EY6A 3Q22A 2HHHQ 1WOCA 4EQNA 2QILA 1AZQA 3M4PA 1AH9A 4A3MH 3PO2H 1SMYD 3J7AF 1K83B 4JC0A 1CKMA 4A3KG 5G3LF 2G9HD 4A3BH 2M9VA 4JI6L 4OO1H 1PZKD 2PPBC 1WJJA 1RF2D 2YV5A 3FPPA 3K0YA 3ND9A 2EPBA 2O4XA 4G4KA 5C3XA 2ICIA 4IALA 1Q3LA 3PSIA 4HTHA 4LF7Q 2E75C 4KTAA 2QF7A 4GLXA 1GUSA 1SR3A 3K80C 3S1RH 5C44B 5CBAE 1BR9A 1BDOA 3S2DB 3J81L 4LUOA 3M3YH 4C1NK 3UDGA 3M7NA 1K0SA 3GTOH 3MXNB 4MIUA 4ZK9B 1EYAA 3QWNA 1UUPA 2PMZE 3HOVB 3I3CA 1X55A 4HEDA 2DNEA 4LFAL 1HRJA 1PTOH 4X66Q 4ZQ3A 5CGKA 3GDEA 4NB3A 3H94A 4GN5A 5JJZA 3MZ5A 2I5LX 2IWHA 4M1UB 3TZUA 1AN8A 1TWAH 2NZOA 1YNXA 1QILA 2B2YC 2XRQD 4JI2L 2AWNA 4A3DH 4IJLA 1SNMA 2OTJA 3D4DA 1UE1A 3M4YA 2DNCA 5IP9G 3S15B 1HR0W 4RFBA 2K28A 4A3EB 1YEZA 1OXUA 3SXHA 3NWTA 1HFGA 1BBUA 5M5XH 1L2FA 2B8GA 3SEBA 1JE5A 5J39A 1S3OA 1U5KA 1I4XA 1STNA 3BG3A 1JB3A 2AUJD 1J8IA 5M3MG 4LJZC 2UXDQ 3UDXA 5COYA 2AQ1B 1Q8IA 3GTGH 4JI7Q 4BY7H 5KRUA 4FF3A 1SYGA 4J15A 1SNPA 4APVA 3X3NA 2K04A 2VUMH 1WTVA 2EXDA 1EQTA 1G2SA 2F0WA 5C44G 1SBBB 2CHBD 4DK0A 1IBKQ 3KLWA 2R7ZH 2KHSA 1ICWA 3ULJA 2F0UA 2WINB 4K8IA 2QA4A 1CQVA 1EY9A 2HIVA 3KJOA 2UXBQ 4KV6A 3F2CA 4AQYQ 3HOVG 1QVGA 2L0CA 1II3A 1C8CA 1X6OA 3SK4A 2LS01 3S1MB 4A93B 1I94Q 1I6HB 3T1HL 4A3JH 5FO9B 1EYGA 5JEAH 5I9OA 3HOXH 4Y52H 3VA5A 5C5LA 3H0GH 1Q81C 1XMOL 2ZTDA 1TWGH 1VF7A 3BYYB 3ULLA 1YZ6A 2PQAB 5JEAJ 1PZJD 1EZ8A 1Z47A 2ENBA 2X69A 2KQ3A 1Y1WB 4OXPA 2L55A 3CQZH 3A5UA 3CCRA 4JI0L 1N9WA 4HR7B 4DNIA 4ULLA 1I3QB 1YIJA 2JA7B 1O7IA 2E5LQ 5CV4A 3I2ZA 1N8RC 3O13A 1V1PA 3VA7A 1ET9A 2F0DA 5C4ZA 1VMPA 2A69D 5CC4A 4UDUC 2ZXRA 5IP7G 1PH5A 2K01A 4C3JG 4IURA 5I9PA 4K2LA 4RCNA 4Q0FA 4DV1L 3U4VA 5M5YH 2UUBL 3IFTA 2DY7A 1QWYA 1S4ZA 2IJ0A 4F88A 1MI2A 4U673 4O1NA 4A3GH 4HJ9A 3MXUA 3RLFA 1CKNB 4DGZA 4HJAA 4DPGA 2M00A 1HUMA 3HEJA 2Y0SE 2Z6KC 3PIP3 4CHTB 1ENAA 2Z6KA 3GTQB 1KLGD 3FKIG 2IL8A 3A55A 3A7AB 1TIID 5JAVA 5G3LD 2I0QA 1DJRD 1BO0A 1J6QA 1QUQA 2JA8B 2HCIA 1OXSC 1NUCA 2CCZA 4A76A 1E2VA 4JI3Q 1CZGA 3H3VI 4QMGA 2ZT9C 1LO5D 4LF9L 4A93G 4C1NI 2N3SA 5E4WC 3GD7A 4J1MA 4DUZL 2PQEA 4DAYA 3T53B 2F3WA 4A3CG 3PCOB 4EVOA 2JJQA 2VQFL 2AMCB 4JOIA 2EYLA 2KCNA 4L5TA 1G2TA 2B2WC 5LL6S 2HIXA 4DR7L 2X6LA 1FGUA 5CV7A 1BOSA 4IOAA 5HGTA 4DV6Q 1V8QA 3NEMA 4ZCKA 4DV4L 3CRLC 2E2HH 1QVFA 2HHHL 1GHJA 1R4PB 3RMHA 3DUZA 4F8MA 1UEAB 1OXXK 1TWHH 5C4XB 3U50C 2RKSA 2F0QA 2F4IA 1HTPA 1PFSA 2OQKA 5C3EG 2XTIA 2K5HA 1TXYA 1O7LA 1F2MA 3NENA 3S2HH 1RCVD 5EKLA 3T51B 3D3RA 4Y7NH 3I56A 1MIUA 2EJFC 4PNYA 4FF2A 3C3LA 4Z9CB 4WORA 2RCFA 3PO2B 2WACA 3Q6SA 3Q23A 1WD0A 3CCSA 5LHY1 2XRSD 2ALYB 1YJ9A 4A3BB 1VQHA 4A3IB 2IW3A 4GNXB 1KDCA 3BDOA 2BOSA 4RMFA 5GADC 2JEBI 3VR4A 4A3LG 1G6ZA 4IFDG 2D2CC 2MO1A 5EBCA 4CJ1B 5JOBA 5C5MA 4JI4Q 2B63H 2N88A 3V05A 4X66L 2D0PA 3KJPA 1HHVA 2WB1B 3S1RB 4ZUJA 1WVLA 3M3YB 3KDFB 5M3MH 1EIGA 1N36L 4HIDA 1SROA 2L11A 2JSOA 2EDGA 3ZJYC 1Q1EA 1U4PA 2B3GA 3KF6B 2CW0D 5C0XH 1PTOB 5HGQA 1B9MA 1E2ZA 4BXXH 1LTLA 4MN3A 3K57A 2KECA 1D6EC 1UE5A 3IL8A 1TWAB 3J7AV 1G6PA 5JJIA 2R93G 3RNUA 4OHJA 3PV0A 1Q90A 1RJTA 1WYDA 4A3DB 1CZWA 2ZTEA 4CDCC 1YHBA 2VNUD 3K7UC 1G51A 4EQ5A 2J4XA 1SE3A 4EGVA 5I6WA 3HOVH 1N32L 1M1KC 2D5DA 4FNFA 1EQRA 4JI7L 4LF4Q 5M5XB 1I50H 2D9UA 2I46A 1XPRA 2A69C 2ZM6L 4DKAC 3TRZA 4JW0A 4DU9A 1VQIA 4KN4C 2CH4W 1A15A 2QKIC 1HZAA 2F3VA 2LSSA 2RA4A 3CCJA 1STGA 3NTIA 3QG1A 2K05A 1J5EQ 4B3SQ 3U58A 3U4ZA 3HZXA 4DV5Q 1HFNA 4L5SA 1E3PA 2K50A 2K52A 1FJGL 3GTGB 4LFAQ 2BCOA 4RKLA 4A3IG 1C0AA 3MXGA 4OO1G 3S1NH 3W5OA 4DFAA 1JOKA 1XNRL 1I6VC 2UXBL 4JK1C 4AQYL 2JE6I 2NBFA 2VUMB 3HGBA 1EIYB 1FGBD 4B9WA 1I94L 2WB1G 3VYUA 1GHKA 3HFZB 1B1ZA 1S5ED 3ZYYX 4HIMA 1HPCA 3I4LA 2R7ZB 2L5TA 2SNMA 1RD9D 1KIXA 1VQEA 1VQOA 1HJPA 5IP7H 3D4RA 1Q86C 4K8JA 1VQLA 1PDQA 2PNHA 2V1CC 3P20A 4C3JH 2EIFA 2Z0SA 4KK7A 3UE1A 4BBRG 2K7VA 4IPHA 1PMRA 1WFQA 4KD4A 2L1BA 3G48A 1H9MA 1BVSA 4IUTA 4A3FG 4MZ9A 4A3JB 5EKKA 2PW7A 2EYJA 3SK6A 1VQ8A 2RHQB 1Q7YC 3HOXB 3H0GB 4J8QA 3K0XA 3F8TA 2E5LL 1TWGB 1LTRD 2R6GA 4KLKA 2R92G 1HTLD 4I7AA 2EY2A 2KJXA 1QZGA 1TVXA 3FKIH 4P75A 1QZHA 3S16H 2XNAC 2RF4A 5EPLA 1VQBA 4OX9L 3CQZB 1IYVA 3SGIA 4NKLA 1HQRD 1QG7A 4NP5A 1O80A 1W6KA 4FDBA 3I55A 2EY1A 1VCIA 3E6ZX 3WOFA 1I6HH 1WTQA 4OWWB 4A3CH 4POFA 1RKNA 2FMMA 4TVAB 1F2YA 1G291 4DXGA 1X3QA 1GUNA 2ZJQA 3NP8A 4H0LC 2O2LD 3PUZA 2NWGA 3UDIA 4LFBQ 4B3RL 2VB3X 5M5YB 3GTLH 1H9SB 1B3QA 3DMUA 4H44C 4KJOA 4BY1G 3T1HQ 1I3QH 2OQ0A 1ILQA 2JK8A 2A74C 1JR0D 4KMUC 3BS1A 1A63A 2JYOA 4A3GB 1SYCA 3STBC 2WAQE 3K5NA 4GOPA 4WFN3 4KD3A 4QQBX 1SEBD 1L1OC 3CW2C 4DAPA 1L1OA 5C3EH 2R7ZG 1OXVA 4JI0Q 1CI3M 4FO2A 4FVMA 1K9MC 4JYAL 1JWMD 2KBNA 5BR8L 1IL8A 2B2VC 2F0HA 1ESRA 5HY6A 1E1OA 3OSOA 4DV6L 2ES2A 1TKWB 3PGZA 1BNZA 3JC66 5AJ3L 3HKZE 3I73A 4QIWB 1C9OA 2IX0A 2KHIA 1T9HA 3D4WA 5DNFA 2ZXPA 1F9PA 1HCZA 4QB4A 4B3ML 1Y8NB 1H9RA 4A3LH 1LT5D 2A68D 5IWAQ 4IFDH 4DV1Q 2NN6I 4V190 3PQIA 2F0GA 2K5WA 2MFIA 2MO0A 1PXUA 2DY8A 1JJGA 3QOLA 3IFDA 2O5JC 4IUQA 3EIVA 1TT2A 3H3VC 1HNWQ 3P75A 3SK8A 2K5QA 2MGSA 4P73A 1TWHB 4RGNA 3I4MB 1S5CD 3X3MA 2B29A 1QB5D 2CWAA 1CSQA 3MTSA 3S2HB 4TKOB 1LABA 4Y7NB 2PO4A 3FRPB 1KTKA 3W1BA 1X3PA 5E1FA 1EWHA 1U4MA 5GROA 1BF4A 2R93H 2IX1A 5IT9c 3T4AC 1EEFD 2UUAL 3NBIA 1IW7C 1X3GA 2D62A 4A3GG 3GO5A 1QNUA 3LGJA 2M2LA 3NBHA 2VQFQ 2EYPA 2RSNA 2F0NA 3NELA 4I7ZC 5IOCA 4BWGB 4DV0L 4DR7Q 1BCPC 2HUGA 2KENA 2RCNA 3U9OA 5CMDA 4R4OA 2XN9C 2HDLA 5FJ8G 2B63B 2RSOA 4P74A 1RHPA 2YU9H 4GN4B 1IKLA 1NNXA 2HT1A 5JVG3 3PIO3 4RH6A 3K7AH 1SFOB 2WIIB 4M8AA 2WKDA 5LMUL 2XWJB 5M3MB 1AE3A 4DV7Q 2K5DA 2BA0A 5ISRA 3UE0A 2SNSA 4A3IH 3NSWA 4ODGA 1VQJA 1GKHA 1O7YA 1YI2A 3KLRA 1Y14B 3DM3A 2Y0SG 1GD7A 1WTPA 4LF4L 1SLJA 4DR2Q 5IGFA 5GQOA 4PQXA 1EYDA 3S9WA 4NMZA 4YCVA 1A8VA 1TY2A 1GUTA 4UAIA 1J5EL 4B3SL 3I4MG 5IIFA 4DV5L 4BBRH 5FK9C 3NWSA 1Q12A 1VQ6A 2SOBA 4LF8Q 1I50B 1TWFH 2Q8IB 3Q0AA 4JG2A 4A3FH 1IXRA 1NE3A 3SDZA 4UP7A 1GM5A 4JVZA 2CQOA 1MSGA 2R92H 1N36Q 1BKBA 5DAUA 1IHZA 2AUKA 1TQOA 2JA9A 2RDGA 2FFKB 1JICA 1KAWA 3S1NB 3URYA 1LACA 5EQ0A 5T1GA 3AQQA 1A3TA 4YIJA 2CWPA 3QO2A 4HMIA 3C1FA 5T1IA 1PRTB 2B63G 3HG9A 1E22A 1U4LA 4EX5A 1CK1A 1X9NA 1V1PB 4FXKC 3TBIB 1SNOA 1S5FD 4EQOA 1I4GA 1WTWA 5CR3A 4YHHQ 4IUPA 1ET6A 1N32Q 3F2BA 1QVCA 3CD6A 4C3JB 2F0MA 2SEBD 1NSNS 1E7ZA 3TDQA 5C0XG 2EZVA 1VQPA 3FMCA 3KOJA 2ZM6Q 4BY1H 5CYUA 4AYBE 4BXXG 3B6YA 2E2DC 3S1QH 1I4QA 4HMJA 2ZJPA 1F2ZA 5NUCA 2KHJA 1Q46A 2G5DA 2KUMA 5ELFA 5I6YA 1A0IA 1B7YB 2A68C 3J80c 1FJGQ 3FKIB 4DK1A 3S16B 3KBGA 2K5NA 3BJUA 2VL6A 1UNSA 4PG3A 1XNRQ 3G7LA 4DAMA 3J80i 5IGCA 2YTVA 3HS0C 4JCVE 4A4IA 2IHEA 4JBMA 1VQMA 4LFBL 4IPGA 2A6ED 4RHSA 2Q2IA 3HOZH 3TP6A 5CV9A 5KIXA 1K0RA 1B8AA 1NMGA 3RUZA 3KYHC 5CORA 5L37A 4BBSG 1HR0Q 1V1QA 1Y8OB 2H1EA 3H09A 2B8FA 1MJCA 3BZCA 1B2TA 4JI1L 4AIMA 3OMGA 3J7ZC 3GTLB 2F1MA 1VQFA 2PZTA 3MXPA 4H13C 3LWEA 3K5OA 2K14A 4L63B 5M3FB 4JI8L 1D5XC 4R4QA 3OYYA 5ELEA 1VMCA 5DLQE 1QJOA 4NPSA 3CMEA 4OX9Q 5C3EB 4DR1L 5KNDA 1YHAA 5IGEA 3MHBA 3BDLA 1HUNA 1EU4A 1BCPF 5IWAL 4LF5L 2L15A 1TS3A 2VZAA 4F7XA 4CKCA 2OCEA 2KVMA 2DGYA 2I07B 2Z4HA 5FLMG 3M85A 1VQ4A 1HNWL 1NAPA 4LNQA 1KD1C 4MNOA 4U68A 1X32A 3OW2A 1Z9FA 4PZ7A 2BDOA 4B3RQ 5FJ8H 2NUCA 4B9XA 2PYKA 4K2KA 1V9PA 4FXGC 5KNBA 2VB2X 3E0EA 3BVMA 1SN8A 5E7NA 5IGGA 5IODA 5IT9E 3L3OC 4TSSA 4XIGS 1CHPD 1MBYA 2L12A 3LNNA 1S40A 3DWAA 4H7BA 1B53A 1VQAA 1CA6A 2B2TA 1PH1A 3MEFA 1N33Q 5EKIA 3QJYA 2F0IA 3FDTA 4JOIC 3TZDA 4JYAQ 2EQSA 3ONAB 5IYBG 1KLUD 1KHIA 4C2MH 3TSSA 1A2TA 5BR8Q 3WWVA 4RAUC 5IE8A 3ERQA 2R93B 3P1HA 4ZKCB 4RGOS 4QF4A 5BN5A 1YHQA 2NTSA 3CCLA 5AJ3Q 5M3FG 5KGUA 1FVIA 1KABA 3RLNA 4L5QA 4IUVA 4B3MQ 2MNAA 4DV7L 5M5WH 3I4MH 1XPOA 3F2UA 1RODA 4ABNA 4BS9A 1STEA 3FPUB 3MFYA 3K58A 2MUYA 2YU9B 2IPKD 4MHEA 4FP5D 1N34L 5IYDH 1O78A 3R2TA 3K7AB 2TMPA 1G8ZD 1PH7A 1SNCA 4DR2L 3T13A 4N9PA 3ERSX 3HOUH 2GA4B 4ZUIA 5EAYA 1K73C 1MJEA 5IT9L 1TY0A 5I2XA 3A54A 3STBD 1PVOA 5KYIA 3BDCA 2EY5A 4X64L 1PFBA 2WAQG 2G9DA 4LF8L 2UUAQ 3M4OH 3AB9A 1ICFB 5BN4A 2NZHA 1CKNA 4P2CB 1SFOH 2UUCL 1EOTA 2JA6H 3KFUA 1SRUA 1V43A 2JQOA 3CP0A 4GN3B 3VDYA 5K36G 3CAMA 3S17H 4DV0Q 3RD4A 1XYIA 4BBRB 1YJNA 4KJNA 4FXDA 2A6EC 1K8AC 1GUWA 1LTSD 1PYSB 2YTXA 1GXDC 1OO9B 1TWFB 3QIAA 5C0XJ 4A3FB 4K5XA 2L9HA 4LUVA 1VQ5A 2F0KA 5LMUQ 3AMUA 2R92B 4IUNA 2XVSA 4IUUA 5DM73 5EGTA 1CKOA 3I4OA 1SYEA 1ASYA 1QOHA 4R4CA 3SHLA 1OTCA 4HIKA 4WJWA 1SNQA 1BBXC 3A8JE 4YHHL 2E8GA 1K3RA 3EJIA 3IRBA 4DF7A 2VY3A 2PZWA 3AU7A 3Q8DA 4X6AH 2PNRC 2PMZB 4RCOA 1HA6A 2AQ2B 3JAMi 4HSPA 5HURA 2BDNA 3OMCA 5IGDA 3J80E 4AH6A 3CCUA 4IOCA 2N49A 3CU7A 3KUPA 4BBSH 3TS2A 4S3SA 4HJ7A 1IW7D 1EIFA 4CJ0B 3MA2B 1RTOA 3M9BA 1CQFA 1UWVA 4HSVA 3MC0B 1EY4A 3PUWA 4DUYL 4BY1B 2A8VA 4ME5A 3S1QB 1BCPD 1EL0A 4XQJA 1QNKA 4IO9A 2E2JH 4HAEA 4TRDA 3D6WA 1Y8PB 3NXWA 5C4HA 2CFMA 3S14H 4KY7A 3OOCA 1HR0L 1DOKA 1PV4A 3MAQA 2SDFA 5FO7B 2B2UA 1CSPA 1I4RA 4XQQA 3HOZB 1ASZA 1AE2A 2J7ZA 3KDFA 3K5MA 2F0VA 4YCUA 1ZEQX 1TWCH 5FLMH 1PYBA 2EJGC 4B08A 3KF6A 2DJGC 1PTOC 1TS5A 4DV3Q 3BZKA 2EYMA 2DUDA 3DWPA 2I5MX 3CPWA 5D65A 3J80L 2N78A 1YNND 3OHXC 4NDXA 4YWMA 2R7FA 4CGYB 2CH4A 1XX8A 1LT6D 1L0YB 5ELOA 5I2YA 1SE8A 4QJFA 4PZ8A 1HZ9A 1MGSA 4RHRA 1Y1VH 3EQLC 3EBEA 1VF5C 5F2DA 2A1AA 2IHFA 4GLVB 1SE4A 5IYBH 1Q8KA 3CCQA 1SYBA 4C3HH 2XGTA 2LKVA 1EZ6A 3HOWG 1SJHD 1ESFA 1C4QA 4QUCA 2L4NA 3CHBD 4OIJA 3PF4A 3I4NH 4K0KQ 1SXTA 2CKZB 4JV5L 4FF1A 1DCZA 4PMCA 5M3FH 4OWTB 2NVXH 4XYOA 1ONLA 2FINB 1NR4A 4LUZA 1NR2A 1PA6A 3M7GA 4ZAIA 4ZYSA 4GOPC 1XWEA 3GV6A 2FXQA 4LF6Q 5EPJA 4OWXB 1WTRA 3RZOH 4CDEC 1OXTA 4K5VA 2QDBA 5CV6A 4JI1Q 2Q2TA 3TS0A 3PO3G 4A75A 1N33L 1YJWA 1W2BA 3HP3A 3HOYG 3WDNA 1EFWA 1S5BD 2DJFC 3V96A 2ICEC 1M4VA 4JI8Q 1X3EA 4XYQA 4NXNQ 1WTOA 1B70B 4OELB 2DN8A 3HOZG 3K6OA 1STAA 4RGTA 3PUXA 4DXFA 3EFXD 5C4JH 2A19A 4DR1Q 2E76C 2EYFA 4ILWA 5EJWA 2R3ZA 1G91A 1P16A 4C2MB 1A6XA 5EBDA 3CKIB 3GQBA 4LF5Q 3DEPA 4H02A 2Y0SB 1VQDA 4DV2L
chains in the Genus database with same CATH topology
3LWUA 4J6HA 4KHVA 4IFDJ 2JEAI 3NE5B 1PFMA 3KF8A 2O5IC 3R3OA 3L7ZC 1SE2A 2K33A 4HCSA 5K36H 1H9JA 1J9OA 3L9AX 5M5WB 2WP8J 4KKUA 5ELDA 1ZYRC 3I70A 3C46A 3PUYA 1Q1BA 1CA5A 3HOUB 3GTMB 4JBWA 2JXMB 3MWYW 2Q8RE 1AFPA 4F87A 1EY8A 3R93A 5ELBA 3M4OB 4CBVA 1EY0A 1AW7A 5E3FA 4DA2A 5TSSA 2ZXOA 2JA6B 1JOOA 1ENCA 3S17B 3EA6A 2RQXA 3JAME 4X3TA 5DM63 1O7ZA 1UAPA 2TSSA 2V4DA 1TS4A 2WV6D 2LY7A 2CQAA 3DEOA 5KEEA 3NK9A 2YYZA 2HCCA 5KYLA 4QCLA 2KOLA 4XXEA 2FJ2A 3ND8A 5D3DA 5A2QE 1PTOF 1YNNC 2C9OA 1EY7A 3R2IA 2EVBA 1HXYD 2BE5C 1LTID 1U9RA 1KDAA 2EY6A 2F0TA 3T56B 4BBSB 1DONA 4X3KA 1Z6HA 1TS2A 1D1IA 3BVZA 4PMWA 1CM9A 1BUVT 3IKJA 4RKBA 3D8GA 1MD2D 4BA1I 3OWFA 1JCKB 1DM0B 2Q8TA 3W3AA 3OIPA 2XIWA 3JAML 2E2JB 2B2YA 3H6MA 3TP5A 3A8IE 4OL7A 4OO1I 3FEWX 2JP1A 1QCBD 3NTKA 3J7YW 3S14B 2RDFA 4PMBA 1MSHA 2K32A 4RWSC 1T5EA 2X6GA 4ZLTF 4RA8A 4XTCS 2OEOA 1SDFA 1CHQD 3NPPA 4XDXA 4GZYC 1B50A 5A2QL 1E0BA 1TWCB 2A73B 2IT1A 4DAVA 1FNWA 3E5SA 2WKCA 1EIHA 5CBEE 4KKSA 2XSCA 3NTHA 5IGBA 2K03A 1LTGD 3TN2A 1T5XD 1Y1VB 1A3VA 4V0BA 3MXNA 4KY5A 1A2UA 4DNTB 2A6HC 1GJXA 4C3HB 2EYOA 1JQYD 1M8AA 2A5HA 3I4NB 2NVXB 3BYTB 4O42A 3H91A 1JORA 3I8ZA 4K6LA 3I91A 3SR1A 3I90A 3EVQA 3RZOB 1H9KA 1XXGA 5I4DA 3OIQA 1PRTC 1F9SA 1KAAA 1DZ1A 2ID0A 2QEJC 1EEID 5AFWA 1U4RA 3KK7A 3HRZC 1K8MA 5C4JB 1FD7D 1CFMA 1FNVA 4LMQD 3LX0A 2EYHA 1F9RA 5FKAC 2WAQB 5C6AA 3BVGA 2EJMA 2N55A 3OPOA 4R8IA 4NW2A 1Z7TA 1SMYC 1I4PA 1SAPA 3VYSA 4CKEA 5A35A 2NVQB 3SE0A 1YNJD 1Y69U 2NYZD 4DNRB 3A8KE 1WD1A 2B2TC 4FYDA 2BA1A 1LTBD 4G7ZC 5LL6X 4R8NA 1JOQA 1S5DD 1LT4D 1SJED 1SYFA 2LMCB 3HKZB 2R61A 1PTOD 4C3HG 3GTKB 3V2TA 3MFGA 3CRKC 2NN6G 3VR6A 1EY5A 3VYTA 2MHVA 3Q24A 1ZKOA 2NB0A 1PZID 3RZDB 2RVLA 4CKBA 3TP8A 2IX3A 1B3AA 2PW5A 4KHZA 2E74C 1SYDA 2F0PA 2B2WA 1I4HA 4C3IB 2HQEA 3PUVA 5FLXE 1LTTD 1B9NA 3W2DA 4L6TB 2EE1A 3E0JA 3DHQA 1EWCA 2CVRA 1F2LA 3KLSX 2F0LA 3P7JA 1SNDA 2PCFB 1C48A 1STBA 2NVYB 1A3UA 1STHA 4BA2I 1LTAD 2LFNA 2KEEA 1KNEA 4IN3A 4A3MB 4K6DA 3MEHA 3QB3A 3KBXA 4IZ8A 3N52A 1BQQT 1STYA 1DOLA 2OT2A 3UI2A 2VXWA 2NVTB 4K5WA 5EPKA 2AQ3B 1LV9A 5J22A 1DOMA 1W6JA 5M9OA 3GTOB 3D31A 3U9SA 5FLXL 2KA7A 4WRDA 1JE4A 2E2IB 1IYUA 3NHHA 4OGQC 3K5LA 4L8JA 1SSOA 1IKMA 3PMFA 4C3IG 1DXMA 1R9TB 2NTTA 4C56C 3KLSA 1ZYRD 3SK5A 3SVMA 3TP7A 4XQNA 2FMCA 3DM1A 1DD2A 1TR5A 3HOWB 3EROA 1R4QB 1PRTF 1V1OA 2RDHA 4ZKBB 1DYQA 5C0XI 3BZDB 1LT3D 1CT1D 3C1EA 1B4OA 3PO3B 1WCMB 2Z4IA 1E2WA 4G7HC 4BY7B 1D5MC 4X3UA 2FHTA 2F0FA 3HOYB 1YNJC 2B2UC 3D6CA 1KNAA 2F0OA 3C2PA 1KDBA 2B39A 3G6JB 3GV3A 1JWUD 1L0XB 4Q5VA 4AYBB 5CV8A 1GOZA 4LK1C 1F9QA 3R8BA 1EQVA 2F0JA 1B44D 5JVH3 2AWOA 2EXZA 2Z1CA 3N6RA 4PV1C 2MJ8A 4KKTA 5DEHA 3DXJC 1ZXTA 2BE5D 4OIKA 3FVQA 4XT1B 3VR5A 4KY6A 2MPMA 4R9WA 2F03A 2PZUA 5BN3A 3I72A 2NN6H 4K14A 5JPMC 3VR2A 4DN4M 3IAYA 1NCVA 4TQUS 4IQZA 4G57A 2HDMA 1PFNA 3T16A 3OWEB 4EQPA 1JWSD 1HA5A 3TMEA 1BCPB 1RDPD 4FF4A 5ELCA 1QE6A 1JC7A 1PYWD 2C5CA 1LLRD 1HQMC 2OXPA 2RBMA 3K59A 3VR3A 5C3WA 1RTNA 1F77A 1FYCA 2KEDA 2MP1A 3GTPB 1AP0A 1D5ZC 1ML0D 1ILPA 3WOEA 1AEXA 4CJ2C 2B2VA 1D1KA 4A3KB 2EOTA 5JEAG 4N9TA 4I65A 4G7OC 2CW0C 5E4XA 3GTJB 1CTMA 5CV5A 3OW7A 2K6AA 5J1ZA 4LAAA 2XWBB 4ZRZA 2OF1A 4QUFA 1BXTA 3NQTA 1WTXA 5D3IB 1D2BA 3NQIA 1GUOA 1XTCD 4X3SA 2A6HD 4KI0A 2QCPX 5FO8B 2E2HB 5KNCA 3NUCA 3A56A 2K1BA 4ID6A 1VDZA 1FNUA 2JA5B 2Z8LA 1PLFA 2KCCA 3J81E 3MVVA 1K8OA 3A7LA 4RGMA 1H9SA 2J0TD 4E6IA 1ENFA 2F0SA 1AZPA 4HN7A 5D14A 1GUGA 4HCEA 5JPNC 2NZ1D 1FR3A 3VYRA 3QOJA 1PRTD 3GP7A 3DWQA 4XT3B 1EFID 5K5PA 4IFDI 2H4OA 2F0EA 1EU3A 1EYCA 5FOBB 3ITPA 4KN7C 1TU2B 1EY6A 3Q22A 4EQNA 2QILA 1AZQA 1SMYD 3J7AF 1K83B 5G3LF 2G9HD 2M9VA 4OO1H 1PZKD 2PPBC 1RF2D 3FPPA 3K0YA 3ND9A 2EPBA 2O4XA 4G4KA 5C3XA 2ICIA 4IALA 1Q3LA 4HTHA 2E75C 4KTAA 2QF7A 1GUSA 5C44B 5CBAE 1BR9A 1BDOA 3S2DB 3J81L 4C1NK 3M7NA 4MIUA 4ZK9B 1EYAA 3QWNA 1UUPA 3HOVB 3I3CA 4HEDA 2DNEA 1HRJA 1PTOH 4ZQ3A 5CGKA 3H94A 5JJZA 3MZ5A 2IWHA 4M1UB 3TZUA 1AN8A 1QILA 2B2YC 2XRQD 2AWNA 1SNMA 3D4DA 3M4YA 2DNCA 3S15B 4RFBA 2K28A 4A3EB 1OXUA 3SXHA 3NWTA 1HFGA 2B8GA 3SEBA 5J39A 1I4XA 1STNA 3BG3A 1JB3A 2AUJD 1J8IA 4LJZC 5COYA 2AQ1B 1Q8IA 5KRUA 4FF3A 1SYGA 1SNPA 3X3NA 2K04A 1WTVA 1EQTA 1G2SA 2F0WA 1SBBB 2CHBD 4DK0A 2KHSA 1ICWA 2F0UA 2WINB 4K8IA 1CQVA 1EY9A 4KV6A 2L0CA 1II3A 1C8CA 3SK4A 2LS01 3S1MB 4A93B 1I6HB 5FO9B 5JEAH 5I9OA 3VA5A 5C5LA 1VF7A 3BYYB 5JEAJ 1PZJD 1EZ8A 1Z47A 2ENBA 2X69A 2KQ3A 1Y1WB 2L55A 4HR7B 4ULLA 1I3QB 2JA7B 5CV4A 3O13A 1V1PA 3VA7A 1ET9A 2F0DA 5C4ZA 1VMPA 2A69D 5CC4A 4UDUC 2ZXRA 2K01A 4C3JG 4IURA 5I9PA 4K2LA 4RCNA 4Q0FA 3IFTA 2DY7A 1QWYA 1S4ZA 2IJ0A 4F88A 1MI2A 4U673 4O1NA 3MXUA 3RLFA 4DGZA 2M00A 1HUMA 3HEJA 3PIP3 4CHTB 1ENAA 3GTQB 1KLGD 2IL8A 3A55A 3A7AB 1TIID 5JAVA 5G3LD 1DJRD 1BO0A 2JA8B 2HCIA 1OXSC 1NUCA 1E2VA 1CZGA 4QMGA 2ZT9C 1LO5D 4C1NI 5E4WC 3GD7A 4J1MA 2PQEA 4DAYA 3T53B 2F3WA 4EVOA 2EYLA 2KCNA 1G2TA 2B2WC 5LL6S 2X6LA 5CV7A 1BOSA 5HGTA 1V8QA 3CRLC 1GHJA 1R4PB 3RMHA 3DUZA 4F8MA 1UEAB 1OXXK 5C4XB 2RKSA 2F0QA 2F4IA 1HTPA 1O7LA 1F2MA 1RCVD 5EKLA 3T51B 3D3RA 2EJFC 4PNYA 4FF2A 3C3LA 4Z9CB 4WORA 3PO2B 2WACA 3Q6SA 3Q23A 1WD0A 5LHY1 2XRSD 4A3BB 4A3IB 2IW3A 1KDCA 3BDOA 2BOSA 2JEBI 3VR4A 1G6ZA 4IFDG 2D2CC 5EBCA 4CJ1B 5JOBA 5C5MA 2N88A 3V05A 1HHVA 2WB1B 3S1RB 4ZUJA 1WVLA 3M3YB 1EIGA 2L11A 2JSOA 2EDGA 1Q1EA 1U4PA 2CW0D 5C0XH 1PTOB 1B9MA 1E2ZA 4MN3A 3K57A 2KECA 1D6EC 3IL8A 1TWAB 3J7AV 4OHJA 3PV0A 1Q90A 1RJTA 4A3DB 1CZWA 2VNUD 2J4XA 1SE3A 4EGVA 5I6WA 2D5DA 4FNFA 5M5XB 2D9UA 2I46A 2A69C 4DU9A 4KN4C 1A15A 2QKIC 2F3VA 2RA4A 1STGA 3NTIA 3QG1A 2K05A 3HZXA 1HFNA 3GTGB 2BCOA 4RKLA 3MXGA 4OO1G 4DFAA 1JOKA 1I6VC 4JK1C 2JE6I 2NBFA 2VUMB 3HGBA 1FGBD 4B9WA 3VYUA 1GHKA 1B1ZA 1S5ED 3ZYYX 1HPCA 3I4LA 2R7ZB 2L5TA 2SNMA 1RD9D 3D4RA 4K8JA 1PDQA 3P20A 4KK7A 2K7VA 1PMRA 4KD4A 2L1BA 1H9MA 4IUTA 4A3JB 5EKKA 2PW7A 2EYJA 3SK6A 3HOXB 3H0GB 4J8QA 1TWGB 1LTRD 2R6GA 1HTLD 2EY2A 2KJXA 1TVXA 2XNAC 5EPLA 3CQZB 1IYVA 4NKLA 1HQRD 1QG7A 4NP5A 1O80A 1W6KA 2EY1A 1VCIA 3E6ZX 3WOFA 1WTQA 1RKNA 2FMMA 1F2YA 1G291 4DXGA 1X3QA 1GUNA 3NP8A 4H0LC 2O2LD 3PUZA 2NWGA 2VB3X 5M5YB 1H9SB 3DMUA 4H44C 4KJOA 4KMUC 1ILQA 3BS1A 2A74C 1JR0D 2JYOA 4A3GB 1SYCA 3K5NA 4WFN3 4KD3A 1SEBD 4DAPA 1OXVA 1CI3M 4FO2A 4FVMA 1JWMD 1IL8A 2B2VC 2F0HA 1ESRA 3OSOA 1TKWB 1BNZA 3I73A 4QIWB 2IX0A 3D4WA 5DNFA 2ZXPA 1F9PA 1HCZA 4QB4A 1Y8NB 1H9RA 1LT5D 2A68D 4IFDH 2NN6I 4V190 2F0GA 2K5WA 1PXUA 2DY8A 3QOLA 3IFDA 2O5JC 4IUQA 1TT2A 3H3VC 3P75A 3SK8A 2K5QA 2MGSA 1TWHB 4RGNA 3I4MB 1S5CD 3X3MA 1QB5D 3MTSA 3S2HB 4TKOB 1LABA 4Y7NB 2PO4A 3FRPB 1KTKA 1X3PA 5E1FA 1EWHA 1U4MA 1BF4A 2IX1A 3T4AC 1EEFD 1IW7C 3NBIA 2D62A 3GO5A 1QNUA 2M2LA 3NBHA 2EYPA 2RSNA 2F0NA 4I7ZC 5IOCA 4BWGB 1BCPC 2HUGA 5CMDA 3U9OA 2XN9C 2HDLA 2B63B 2RSOA 1RHPA 1IKLA 5JVG3 3PIO3 4RH6A 1SFOB 2WIIB 4M8AA 2WKDA 2XWJB 5M3MB 2K5DA 2BA0A 5ISRA 2SNSA 3NSWA 4ODGA 1O7YA 3KLRA 1WTPA 5IGFA 4PQXA 1EYDA 3S9WA 4NMZA 1TY2A 1GUTA 4UAIA 5IIFA 5FK9C 3NWSA 1Q12A 2SOBA 1I50B 2Q8IB 3Q0AA 3SDZA 1MSGA 5DAUA 1IHZA 2AUKA 1TQOA 2RDGA 2FFKB 1JICA 3S1NB 3URYA 1LACA 5EQ0A 5T1GA 1A3TA 4YIJA 3QO2A 4HMIA 3C1FA 5T1IA 1PRTB 3HG9A 1U4LA 1CK1A 1V1PB 4FXKC 3TBIB 1SNOA 1S5FD 4EQOA 1I4GA 1WTWA 5CR3A 4IUPA 1ET6A 4C3JB 2F0MA 2SEBD 1NSNS 3TDQA 5C0XG 2EZVA 3FMCA 5CYUA 2E2DC 1I4QA 4HMJA 1F2ZA 5NUCA 2KUMA 5ELFA 5I6YA 2A68C 3FKIB 4DK1A 3S16B 3KBGA 1UNSA 3G7LA 5IGCA 3HS0C 2A6ED 4RHSA 3TP6A 5CV9A 5KIXA 3RUZA 5CORA 1Y8OB 2H1EA 3H09A 2B8FA 1B2TA 3OMGA 3GTLB 2F1MA 2PZTA 3MXPA 4H13C 3LWEA 3K5OA 4L63B 5M3FB 1D5XC 5ELEA 1VMCA 1QJOA 5C3EB 5KNDA 5IGEA 3MHBA 3BDLA 1HUNA 1EU4A 1BCPF 1TS3A 4F7XA 4CKCA 2KVMA 2Z4HA 2I07B 3M85A 1NAPA 4U68A 1X32A 2BDOA 2NUCA 4B9XA 2PYKA 4K2KA 4FXGC 5KNBA 2VB2X 3BVMA 5IT9E 5IGGA 5IODA 3L3OC 4TSSA 4XIGS 1CHPD 1MBYA 2L12A 3LNNA 3DWAA 4H7BA 1B53A 1CA6A 2B2TA 5EKIA 3QJYA 2F0IA 3FDTA 3TZDA 3ONAB 1KLUD 3TSSA 1A2TA 4RAUC 3ERQA 2R93B 3P1HA 4ZKCB 4RGOS 4QF4A 5BN5A 2NTSA 5KGUA 1KABA 4IUVA 3F2UA 1RODA 4ABNA 4BS9A 1STEA 3FPUB 3MFYA 3K58A 2MUYA 2YU9B 2IPKD 4MHEA 4FP5D 1O78A 3R2TA 3K7AB 2TMPA 1G8ZD 1SNCA 3T13A 4N9PA 2GA4B 4ZUIA 5IT9L 1TY0A 5I2XA 3A54A 5KYIA 3BDCA 2EY5A 1PFBA 2G9DA 3AB9A 5BN4A 4P2CB 1EOTA 1V43A 5K36G 3RD4A 1XYIA 4BBRB 4KJNA 4FXDA 2A6EC 1GUWA 1LTSD 1GXDC 1OO9B 1TWFB 3QIAA 5C0XJ 4A3FB 4K5XA 2L9HA 2F0KA 3AMUA 2R92B 4IUNA 2XVSA 4IUUA 5DM73 5EGTA 1SYEA 1QOHA 3SHLA 4WJWA 1SNQA 1BBXC 3A8JE 3EJIA 4DF7A 2PZWA 3AU7A 2PNRC 2PMZB 4RCOA 1HA6A 2AQ2B 4HSPA 5HURA 2BDNA 3OMCA 5IGDA 3J80E 3CU7A 3KUPA 4S3SA 1IW7D 4CJ0B 3MA2B 1RTOA 1CQFA 4HSVA 3MC0B 1EY4A 3PUWA 4BY1B 4ME5A 3S1QB 1BCPD 1EL0A 4XQJA 1QNKA 4HAEA 4TRDA 3D6WA 1Y8PB 3NXWA 5C4HA 4KY7A 3OOCA 1DOKA 3MAQA 2SDFA 5FO7B 2B2UA 1I4RA 4XQQA 3HOZB 2J7ZA 3K5MA 2F0VA 1ZEQX 2EJGC 4B08A 1PTOC 1TS5A 2EYMA 3DWPA 5D65A 3J80L 1YNND 3OHXC 4NDXA 4CGYB 1XX8A 1LT6D 1L0YB 5I2YA 1MGSA 4RHRA 3EQLC 1VF5C 5F2DA 1SE4A 1SYBA 2LKVA 1EZ6A 1SJHD 1ESFA 1C4QA 4QUCA 2L4NA 3CHBD 4OIJA 1SXTA 4FF1A 1DCZA 4PMCA 4XYOA 1ONLA 2FINB 1NR4A 1NR2A 3M7GA 4ZAIA 4ZYSA 1XWEA 3GV6A 5EPJA 1WTRA 1OXTA 4K5VA 2QDBA 5CV6A 3HP3A 3WDNA 1S5BD 3V96A 2ICEC 1M4VA 4XYQA 1WTOA 2DN8A 3K6OA 1STAA 4RGTA 3PUXA 4DXFA 3EFXD 2E76C 2EYFA 4ILWA 5EJWA 2R3ZA 1G91A 4C2MB 1A6XA 5EBDA 3CKIB 3GQBA 3DEPA 2Y0SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4M A;  5T1I A;  1BF4 A;  1QE6 A;  2K04 A;  3IL8 A;  1WTV A;  2J7Z A;  2EE1 A;  4ZKB B;  1PFM A;  1RJT A;  1AZQ A;  1U4L A;  1EQT A;  4O42 A;  3H91 A;  1EOT A;  1G2S A;  5E4W C;  1WTQ A;  2CVR A;  1F2L A;  2KVM A;  4HCS A;  1WTW A;  1J9O A;  3I8Z A;  3I91 A;  1DON A;  2FMM A;  4X3K A;  1NAP A;  1B4O A;  1RTN A;  3I90 A;  2M2L A;  4IUP A;  1ICW A;  3P7J A;  1X3Q A;  2KED A;  4U68 A;  1CM9 A;  1X32 A;  2RSN A;  1XYI A;  2MP1 A;  4X3U A;  2FHT A;  2HUG A;  5CMD A;  1G2T A;  2B2W C;  2NWG A;  1GUW A;  2HDL A;  2EPB A;  5D65 A;  1AP0 A;  2X6L A;  1ML0 D;  1F9S A;  2RSO A;  2B2U C;  1RHP A;  1Q3L A;  1C8C A;  1ILP A;  1DZ1 A;  1KNA A;  1IKL A;  2D9U A;  2Q8T A;  4CJ2 C;  2B2V A;  1XX8 A;  2L9H A;  2KEE A;  1ILQ A;  1KNE A;  2XIW A;  2L12 A;  5CBA E;  2JYO A;  2B2Y A;  4IUU A;  5AFW A;  1A15 A;  1U4R A;  1B53 A;  2EOT A;  2KUM A;  3KBX A;  2RA4 A;  3GV3 A;  5E4X A;  1MGS A;  1CA5 A;  3N52 A;  1CA6 A;  2JP1 A;  2B2T A;  2K05 A;  1DOL A;  4LMQ D;  1HFN A;  4ZK9 B;  1BBX C;  3UI2 A;  1F9Q A;  1F9R A;  2X69 A;  5EKI A;  1MSH A;  2VXW A;  3MWY W;  3FDT A;  3I3C A;  2Q8R E;  3TZD A;  3ONA B;  4HED A;  4QUF A;  1HRJ A;  4RWS C;  3G7L A;  1WTX A;  1O7Y A;  5EPK A;  2N55 A;  2X6G A;  4ZLT F;  4R8I A;  4RA8 A;  4X3S A;  4NW2 A;  1LV9 A;  4QUC A;  4RAU C;  3R93 A;  5JJZ A;  2L4N A;  1SAP A;  1IL8 A;  4ZKC B;  2B2V C;  4OIJ A;  1WTP A;  1ESR A;  1SDF A;  1HA6 A;  4XDX A;  1B50 A;  1DOM A;  1E0B A;  2B2Y C;  2BDN A;  3Q6S A;  1WD0 A;  1VMP A;  2NYZ D;  2K1B A;  1BNZ A;  2MJ8 A;  2FIN B;  1NR4 A;  1NR2 A;  1WD1 A;  4ZAI A;  1ZXT A;  2B2T C;  3KUP A;  4IUV A;  3GV6 A;  5COR A;  5DNF A;  5EPJ A;  4UAI A;  1WTR A;  1F9P A;  4CJ0 B;  4OIK A;  4X3T A;  2H1E A;  1JE4 A;  1EIH A;  1RTO A;  1PLF A;  3F2U A;  1PDQ A;  1O7Z A;  1ROD A;  1B2T A;  2K28 A;  4XT1 B;  1G6Z A;  5CBE E;  3FPU B;  2K01 A;  2HCI A;  4IUR A;  1HFG A;  4HSV A;  3HP3 A;  2MPM A;  1SSO A;  4R9W A;  4CJ1 B;  1IKM A;  2N88 A;  4MHE A;  1AZP A;  2DY8 A;  5D14 A;  2L1B A;  2K03 A;  3IFD A;  3DEO A;  2DY7 A;  2KEC A;  4IUQ A;  1HHV A;  1EL0 A;  3LWE A;  1S4Z A;  2NZ1 D;  4IUT A;  1WVL A;  1MI2 A;  1WTO A;  3TN2 A;  1MSG A;  2HCC A;  1QNK A;  4HAE A;  4DN4 M;  1NCV A;  3SVM A;  1VMC A;  2MGS A;  3D6W A;  1J8I A;  1EIG A;  4XT3 B;  3QO2 A;  1HUM A;  2KOL A;  2L11 A;  5EJW A;  1TVX A;  2HDM A;  1PFN A;  1U4P A;  2FJ2 A;  2RVL A;  5COY A;  2R3Z A;  1B3A A;  2IL8 A;  2FFK B;  5EPL A;  1JIC A;  1G91 A;  3DM1 A;  1HUN A;  1DOK A;  3MTS A;  2B2W A;  1BO0 A;  1M8A A;  1PFB A;  3DEP A;  5EQ0 A;  5T1G A;  1QG7 A;  2SDF A;  1O80 A;  4MN3 A;  2B2U A;  1X3P A; 
#chains in the Genus database with same CATH topology
 3LWU A;  1RL2 A;  4J6H A;  4KHV A;  1VQG A;  4IFD J;  1LYL A;  2K4K A;  2JEA I;  1X54 A;  2NVQ H;  2GVA A;  3NE5 B;  1PFM A;  3FHW A;  4P72 A;  3KF8 A;  2O5I C;  3R3O A;  3L7Z C;  5GAH C;  1SE2 A;  2K33 A;  4HCS A;  5K36 H;  1H9J A;  1J9O A;  3L9A X;  5M5W B;  4LFC L;  2WP8 J;  3F2D A;  1KQS A;  1UEB A;  1NJI C;  4KKU A;  5ELD A;  1ZYR C;  3I70 A;  3CXC A;  1XJV A;  1VQ9 A;  3C46 A;  3TQY A;  1IYJ B;  4UP8 A;  1EWI A;  3PUY A;  3A74 A;  1Q1B A;  1CA5 A;  3HOU B;  3GTM B;  3RZD H;  1FL0 A;  4JBW A;  2JXM B;  3K81 C;  3MWY W;  2Q8R E;  4KHP Q;  3A0J A;  4YCW A;  3BU2 A;  1AFP A;  4F87 A;  4C3I H;  1EY8 A;  3R93 A;  5ELB A;  1YBY A;  3M4O B;  4CBV A;  1EY0 A;  1AW7 A;  5E3F A;  4DA2 A;  1Q82 C;  4UP9 A;  4OEM B;  5TSS A;  4JBK A;  2ZXO A;  2JA6 B;  3CCV A;  4OON A;  4DR5 Q;  1JOO A;  1ENC A;  1A62 A;  3S17 B;  1JT8 A;  3CC4 A;  3EA6 A;  2RQX A;  2QW7 A;  3JAM E;  4X3T A;  5DM6 3;  1GO3 E;  2F3I A;  1O7Z A;  2WB1 E;  1UAP A;  2TSS A;  2V4D A;  4NXM L;  1N34 Q;  1TS4 A;  2WV6 D;  2LY7 A;  4GKJ Q;  4X62 Q;  2NVY H;  2CQA A;  3DEO A;  5KEE A;  3NK9 A;  5FLX c;  2YYZ A;  4GKK L;  2HCC A;  4O0A A;  5KYL A;  4QCL A;  2KOL A;  2Z9H A;  1GVP A;  4XXE A;  2FJ2 A;  3ND8 A;  5D3D A;  5JJL A;  5A2Q E;  1PTO F;  4UPA A;  2UU9 L;  4X64 Q;  1YNN C;  2C9O A;  1MKH A;  2NVT H;  1EY7 A;  2IY5 B;  3R2I A;  3RLO A;  2EVB A;  1HXY D;  2BE5 C;  4P71 A;  5IYD G;  1LTI D;  2UUC Q;  1U9R A;  4QGU A;  3UDF A;  1KDA A;  2EY6 A;  1EOV A;  2F0T A;  2ZTC A;  3T56 B;  4BBS B;  1DON A;  4X3K A;  1Z6H A;  4YWK A;  5GAG C;  3HOU G;  1TS2 A;  1D1I A;  3BVZ A;  1E1T A;  1NTG A;  4PMW A;  1CM9 A;  1BUV T;  5LMN W;  2E2I H;  2Z6B A;  3IKJ A;  2JA5 G;  4RKB A;  3D8G A;  1MD2 D;  4BA1 I;  3OWF A;  4L5R C;  1JCK B;  1DM0 B;  2Q8T A;  3W3A A;  3OIP A;  2XIW A;  3JAM L;  2E2J B;  2B2Y A;  3H6M A;  1R9T H;  3TP5 A;  3A8I E;  3T1Y Q;  4OL7 A;  4OO1 I;  4DR3 Q;  1VQC A;  1YVC A;  3FEW X;  2JP1 A;  1KL9 A;  4HIO A;  1QCB D;  2JA6 G;  3NTK A;  3J7Y W;  3S14 B;  2RDF A;  1XNQ Q;  2LXJ A;  2P5Z X;  4PMB A;  1MSH A;  2K32 A;  4RWS C;  3HOW H;  2D0O A;  2WFW A;  4DV3 L;  1T5E A;  2X6G A;  4ZLT F;  4RA8 A;  4XTC S;  4DR4 L;  2OEO A;  1IBL L;  1SDF A;  1CHQ D;  3NPP A;  4XDX A;  4GZY C;  1B50 A;  4X65 Q;  3ICE A;  5A2Q L;  1E0B A;  3RN2 A;  1TWC B;  2A73 B;  3D0F A;  2IT1 A;  4DAV A;  1FNW A;  2AKW B;  3E5S A;  2WKC A;  1EIH A;  1K8G A;  3PO3 H;  1WCM H;  3RR5 A;  5CBE E;  4KKS A;  2XSC A;  3NTH A;  4DUY Q;  3HOY H;  1W3S A;  3FP9 A;  5IGB A;  2K03 A;  3E9I A;  1QUQ B;  1WTH A;  2H5X A;  1LTG D;  3TN2 A;  4HJ8 A;  1U0L A;  1T5X D;  4K0K L;  1Y1V B;  4DR6 Q;  1A3V A;  4V0B A;  3MXN A;  3AYH B;  4KY5 A;  4DAY B;  1A2U A;  4YY3 L;  4JPB W;  4DNT B;  5LMN Q;  2A6H C;  3HKS A;  1GJX A;  4C3H B;  4LF6 L;  2EYO A;  1JQY D;  1M8A A;  2A5H A;  4YWL A;  3I4N B;  1HNZ Q;  4GS3 A;  2NVX B;  3BYT B;  2K75 A;  4IPC A;  3H91 A;  4O42 A;  4NXN L;  1JOR A;  1H95 A;  3I8Z A;  4K6L A;  3I91 A;  3SR1 A;  3H3V H;  3I90 A;  3EVQ A;  3RZO B;  2VQE Q;  3TRE A;  1HH2 P;  3DLL A;  1H9K A;  1XXG A;  1KRT A;  3OIQ A;  4LWC A;  3W1G A;  5I4D A;  4A3E G;  1PRT C;  1BBW A;  1F9S A;  1KAA A;  1DZ1 A;  2ID0 A;  2QEJ C;  3QR8 A;  1EEI D;  5AFW A;  2UXC L;  1U4R A;  3KK7 A;  4ALP A;  3HRZ C;  1K8M A;  1PH2 A;  5C4J B;  1FD7 D;  1CFM A;  1FNV A;  4LMQ D;  1E24 A;  4DK3 C;  3OTO Q;  3LX0 A;  4JI5 Q;  2EYH A;  1F9R A;  5FKA C;  2WAQ B;  4IPD A;  5C6A A;  2QDL A;  2EJM A;  3AFP A;  2N55 A;  3BVG A;  3AEV A;  2HQL A;  3OPO A;  4B3T L;  4R8I A;  4NW2 A;  1Z7T A;  1SMY C;  1HZC A;  1I4P A;  1SAP A;  1VS0 A;  4QIW E;  3VYS A;  4CKE A;  5A35 A;  2F4V L;  4JV5 Q;  2NVQ B;  1UE7 A;  3SE0 A;  1YNJ D;  1Y69 U;  2NYZ D;  4DNR B;  2YTY A;  3A8K E;  1WD1 A;  4UHV A;  2B2T C;  4FYD A;  4CDD C;  2BA1 A;  1LTB D;  1Y1V G;  4G7Z C;  5LL6 X;  4R8N A;  1JOQ A;  1S5D D;  2C35 B;  1LT4 D;  1SJE D;  1SYF A;  2LMC B;  3HKZ B;  3GTP H;  2R61 A;  1D7Q A;  1PTO D;  4C3H G;  4KHP L;  1IBM L;  1YIT A;  3GTK B;  3V2T A;  3MFG A;  1RIP A;  3CRK C;  2NN6 G;  3I4N G;  3VR6 A;  2Q2H A;  3CMA A;  1EY5 A;  5JJK A;  4A3K H;  3VYT A;  2MHV A;  2PQA A;  3GTJ H;  3Q24 A;  1HNX Q;  1ZKO A;  2NB0 A;  1PZI D;  4N8F A;  3RZD B;  4DR5 L;  2RVL A;  4CKB A;  3TP8 A;  2IX3 A;  1B3A A;  2PW5 A;  4KHZ A;  2E74 C;  1SYD A;  2F0P A;  1PH6 A;  4DV2 Q;  2B2W A;  1L0W A;  1I4H A;  4MTN A;  4CDF C;  4C3I B;  1Y1W G;  2HQE A;  3PUV A;  5FLX E;  1LTT D;  1B9N A;  1XMQ Q;  2OTL A;  3AFQ A;  4GKJ L;  3W2D A;  4X62 L;  4L6T B;  2EE1 A;  2JA7 G;  2K5V A;  3DHQ A;  3E0J A;  3CCM A;  4GLA C;  1EWC A;  2CVR A;  1F2L A;  2RHS B;  3KLS X;  4LFC Q;  2F0L A;  3GTM H;  3P7J A;  1EQQ A;  1HZB A;  1I5F A;  1EUJ A;  1NY4 A;  1SND A;  2JA5 H;  2PCF B;  1C48 A;  1STB A;  4RG1 A;  3CC7 A;  1MHW C;  2NVY B;  1A3U A;  5GAE C;  1STH A;  5H1S E;  4BA2 I;  1LTA D;  2LFN A;  2KEE A;  1KNE A;  4LF7 L;  4IN3 A;  4A3M B;  4K6D A;  3MEH A;  3QB3 A;  1VQ7 A;  3H15 A;  3KBX A;  4IZ8 A;  3N52 A;  2OWO A;  1BQQ T;  5IP9 H;  1STY A;  1DOL A;  1X3F A;  3ER0 A;  2OT2 A;  4WJ4 A;  3L0O A;  3UI2 A;  2VXW A;  2NVT B;  3PF5 A;  2VS1 A;  1NBW A;  3PIO A;  4UY8 C;  4K5W A;  3J81 c;  5EPK A;  1C7Y A;  2AQ3 B;  3S24 A;  2PI2 A;  1DGS A;  3HKZ G;  1LV9 A;  2JA8 G;  5J22 A;  2ZJR A;  1DOM A;  3J81 i;  1X56 A;  1W6J A;  5M9O A;  3GTO B;  1K83 H;  1X65 A;  2GVB A;  3D31 A;  3U9S A;  3T1Y L;  3RN5 A;  5FLX L;  4DR3 L;  1LM0 A;  1XTD A;  2KA7 A;  4WRD A;  5IYC G;  1JE4 A;  2E2I B;  1IYU A;  3NHH A;  3ULP A;  4NXM Q;  4OGQ C;  3JAM c;  3K5L A;  1XNQ L;  4L8J A;  2HD3 A;  1SSO A;  1IKM A;  3PMF A;  4GKK Q;  4C3I G;  2BH2 A;  1WI5 A;  2N8N A;  1DXM A;  1R9T B;  2NTT A;  4C56 C;  5C44 H;  3KLS A;  1ZYR D;  3SK5 A;  1PH8 A;  3S2D H;  1S72 A;  4X65 L;  3SVM A;  4JI6 Q;  3TP7 A;  4R1J A;  2UU9 Q;  3TEH B;  2UXD L;  4XQN A;  5C4X G;  4HJ5 A;  1KXL A;  2FMC A;  3DM1 A;  1DD2 A;  1TR5 A;  3HOW B;  3ERO A;  1R4Q B;  1PRT F;  1V1O A;  1JJC B;  2GN5 A;  2RDH A;  1LUZ A;  4ZKB B;  3G6E A;  4A3M G;  1JMC A;  3PO2 G;  1DYQ A;  5C0X I;  4GNX C;  3BZD B;  1LT3 D;  4GNX A;  1CT1 D;  3C1E A;  1B4O A;  4GOP B;  4DR6 L;  3PO3 B;  1WCM B;  2Z4I A;  1E2W A;  1IBK L;  4A3B G;  4G7H C;  3S15 H;  4BY7 B;  1D5M C;  4X3U A;  1L1O B;  5LMN L;  2FHT A;  2F0F A;  4A3E H;  3HOY B;  1YNJ C;  1NMF A;  2B2U C;  3D6C A;  1KNA A;  1KRS A;  2F0O A;  3C2P A;  1KDB A;  4JI2 Q;  1D8L A;  3A5Z B;  4QY7 A;  1HNZ L;  2B39 A;  1PH4 A;  2I5H A;  3G6J B;  3J81 j;  3GV3 A;  1JWU D;  1L0X B;  4Q5V A;  4AYB B;  5J3B A;  5CV8 A;  1GOZ A;  4LK1 C;  1F9Q A;  3R8B A;  1EQV A;  2F0J A;  1K28 A;  3G4S A;  1CUK A;  1B44 D;  4DR4 Q;  5JVH 3;  2VQE L;  1IBL Q;  2AWO A;  2EXZ A;  2Z1C A;  3G71 A;  3N6R A;  2VW9 A;  3KF8 B;  2MJ8 A;  4PV1 C;  4KKT A;  4DK6 C;  5DEH A;  1XPU A;  4POG A;  4A3D G;  3DXJ C;  1UE6 A;  1ZXT A;  2AHO B;  2BE5 D;  4OIK A;  3FVQ A;  4XT1 B;  3VR5 A;  3OTO L;  4JI5 L;  4KY6 A;  2MPM A;  4R9W A;  2F03 A;  2KCT A;  2PZU A;  1PH3 A;  3CC2 A;  5BN3 A;  4A93 H;  3S1M H;  4WJ3 M;  3I72 A;  4QL5 A;  2NN6 H;  1JJ2 A;  3M4Q A;  4K14 A;  5JPM C;  1IZ6 A;  3VR2 A;  4DN4 M;  3IAY A;  1NCV A;  4TQU S;  4YY3 Q;  4IQZ A;  4G57 A;  2HDM A;  1PFN A;  3T16 A;  1VQN A;  3NBH B;  3OWE B;  2QGQ A;  1WCM G;  4EQP A;  1JWS D;  1Y1W H;  4BY7 G;  1HA5 A;  3TME A;  2MQH A;  1BCP B;  1RDP D;  4FF4 A;  2BH8 A;  5ELC A;  1QE6 A;  1JC7 A;  1PYW D;  3L2P A;  2C5C A;  1LLR D;  2JA7 H;  2VUM G;  1XMO Q;  3F1Z A;  2JN4 A;  4JI3 L;  4IJH A;  1HQM C;  2OXP A;  2RBM A;  3K59 A;  3VR3 A;  1IL2 A;  5C3W A;  1RTN A;  4AYB G;  1F77 A;  1FYC A;  2KED A;  1HNX L;  2PI2 E;  2MP1 A;  1M90 C;  3GTP B;  1AP0 A;  2LXK A;  1D5Z C;  1ML0 D;  4O2D A;  1ILP A;  3WOE A;  1AEX A;  4CJ2 C;  2B2V A;  1D1K A;  5ELN A;  2UXC Q;  4N8X 1;  1XMQ L;  3CPF A;  3PIP A;  4A3J G;  4ME3 A;  4A3K B;  2EOT A;  5JEA G;  4N9T A;  4I65 A;  3HOX G;  2CW0 C;  5E4X A;  3GTJ B;  4G7O C;  3H0G G;  2KCM A;  3CF5 A;  1CTM A;  5CV5 A;  3OW7 A;  1K3B C;  2K6A A;  4PZ6 A;  5J1Z A;  3J7A 5;  3GTQ H;  4LAA A;  2XWB B;  4ZRZ A;  2OF1 A;  4QUF A;  1BXT A;  3NQT A;  4B3T Q;  1WTX A;  1PH9 A;  2UUB Q;  5D3I B;  1D2B A;  2R7D A;  3NQI A;  1GUO A;  2F52 A;  1XTC D;  4X3S A;  1PHJ A;  2F4V Q;  2JA8 H;  2A6H D;  4KI0 A;  2ATW A;  2QCP X;  5FO8 B;  2E2H B;  5KNC A;  3GTK H;  3NUC A;  1JB7 A;  3K8A A;  3A56 A;  2K1B A;  4ID6 A;  1VDZ A;  1VQK A;  5IYC H;  1FNU A;  2JA5 B;  2Z8L A;  2Q2U A;  1PLF A;  2KCC A;  3J81 E;  3MVV A;  1K8O A;  1IBM Q;  3E9H A;  3A7L A;  4RGM A;  1H9S A;  2J0T D;  4E6I A;  1ENF A;  2F0S A;  1SMX A;  1AZP A;  4HN7 A;  5D14 A;  3CCE A;  4LF9 Q;  4JI4 L;  1GUG A;  4R4T A;  4HCE A;  5JPN C;  2NZ1 D;  4DUZ Q;  4MTK A;  1FR3 A;  3QOJ A;  3VYR A;  1PRT D;  3GP7 A;  3DWQ A;  4XT3 B;  1EFI D;  5K5P A;  4LW1 A;  4IFD I;  2H4O A;  2F0E A;  1EU3 A;  4R4I A;  1P8L A;  4JBJ A;  5C4X H;  5IY0 A;  1EYC A;  2ASB A;  3I7F A;  3EN2 A;  5FOB B;  3ITP A;  2QEX A;  1KC8 C;  3E3X A;  4KN7 C;  1TU2 B;  4DV4 Q;  1EY6 A;  3Q22 A;  2HHH Q;  1WOC A;  4EQN A;  2QIL A;  1AZQ A;  3M4P A;  1AH9 A;  4A3M H;  3PO2 H;  1SMY D;  3J7A F;  1K83 B;  4JC0 A;  1CKM A;  4A3K G;  5G3L F;  2G9H D;  4A3B H;  2M9V A;  4JI6 L;  4OO1 H;  1PZK D;  2PPB C;  1WJJ A;  1RF2 D;  2YV5 A;  3FPP A;  3K0Y A;  3ND9 A;  2EPB A;  2O4X A;  4G4K A;  5C3X A;  2ICI A;  4IAL A;  1Q3L A;  3PSI A;  4HTH A;  4LF7 Q;  2E75 C;  4KTA A;  2QF7 A;  4GLX A;  1GUS A;  1SR3 A;  3K80 C;  3S1R H;  5C44 B;  5CBA E;  1BR9 A;  1BDO A;  3S2D B;  3J81 L;  4LUO A;  3M3Y H;  4C1N K;  3UDG A;  3M7N A;  1K0S A;  3GTO H;  3MXN B;  4MIU A;  4ZK9 B;  1EYA A;  3QWN A;  1UUP A;  2PMZ E;  3HOV B;  3I3C A;  1X55 A;  4HED A;  2DNE A;  4LFA L;  1HRJ A;  1PTO H;  4X66 Q;  4ZQ3 A;  5CGK A;  3GDE A;  4NB3 A;  3H94 A;  4GN5 A;  5JJZ A;  3MZ5 A;  2I5L X;  2IWH A;  4M1U B;  3TZU A;  1AN8 A;  1TWA H;  2NZO A;  1YNX A;  1QIL A;  2B2Y C;  2XRQ D;  4JI2 L;  2AWN A;  4A3D H;  4IJL A;  1SNM A;  2OTJ A;  3D4D A;  1UE1 A;  3M4Y A;  2DNC A;  5IP9 G;  3S15 B;  1HR0 W;  4RFB A;  2K28 A;  4A3E B;  1YEZ A;  1OXU A;  3SXH A;  3NWT A;  1HFG A;  1BBU A;  5M5X H;  1L2F A;  2B8G A;  3SEB A;  1JE5 A;  5J39 A;  1S3O A;  1U5K A;  1I4X A;  1STN A;  3BG3 A;  1JB3 A;  2AUJ D;  1J8I A;  5M3M G;  4LJZ C;  2UXD Q;  3UDX A;  5COY A;  2AQ1 B;  1Q8I A;  3GTG H;  4JI7 Q;  4BY7 H;  5KRU A;  4FF3 A;  1SYG A;  4J15 A;  1SNP A;  4APV A;  3X3N A;  2K04 A;  2VUM H;  1WTV A;  2EXD A;  1EQT A;  1G2S A;  2F0W A;  5C44 G;  1SBB B;  2CHB D;  4DK0 A;  1IBK Q;  3KLW A;  2R7Z H;  2KHS A;  1ICW A;  3ULJ A;  2F0U A;  2WIN B;  4K8I A;  2QA4 A;  1CQV A;  1EY9 A;  2HIV A;  3KJO A;  2UXB Q;  4KV6 A;  3F2C A;  4AQY Q;  3HOV G;  1QVG A;  2L0C A;  1II3 A;  1C8C A;  1X6O A;  3SK4 A;  2LS0 1;  3S1M B;  4A93 B;  1I94 Q;  1I6H B;  3T1H L;  4A3J H;  5FO9 B;  1EYG A;  5JEA H;  5I9O A;  3HOX H;  4Y52 H;  3VA5 A;  5C5L A;  3H0G H;  1Q81 C;  1XMO L;  2ZTD A;  1TWG H;  1VF7 A;  3BYY B;  3ULL A;  1YZ6 A;  2PQA B;  5JEA J;  1PZJ D;  1EZ8 A;  1Z47 A;  2ENB A;  2X69 A;  2KQ3 A;  1Y1W B;  4OXP A;  2L55 A;  3CQZ H;  3A5U A;  3CCR A;  4JI0 L;  1N9W A;  4HR7 B;  4DNI A;  4ULL A;  1I3Q B;  1YIJ A;  2JA7 B;  1O7I A;  2E5L Q;  5CV4 A;  3I2Z A;  1N8R C;  3O13 A;  1V1P A;  3VA7 A;  1ET9 A;  2F0D A;  5C4Z A;  1VMP A;  2A69 D;  5CC4 A;  4UDU C;  2ZXR A;  5IP7 G;  1PH5 A;  2K01 A;  4C3J G;  4IUR A;  5I9P A;  4K2L A;  4RCN A;  4Q0F A;  4DV1 L;  3U4V A;  5M5Y H;  2UUB L;  3IFT A;  2DY7 A;  1QWY A;  1S4Z A;  2IJ0 A;  4F88 A;  1MI2 A;  4U67 3;  4O1N A;  4A3G H;  4HJ9 A;  3MXU A;  3RLF A;  1CKN B;  4DGZ A;  4HJA A;  4DPG A;  2M00 A;  1HUM A;  3HEJ A;  2Y0S E;  2Z6K C;  3PIP 3;  4CHT B;  1ENA A;  2Z6K A;  3GTQ B;  1KLG D;  3FKI G;  2IL8 A;  3A55 A;  3A7A B;  1TII D;  5JAV A;  5G3L D;  2I0Q A;  1DJR D;  1BO0 A;  1J6Q A;  1QUQ A;  2JA8 B;  2HCI A;  1OXS C;  1NUC A;  2CCZ A;  4A76 A;  1E2V A;  4JI3 Q;  1CZG A;  3H3V I;  4QMG A;  2ZT9 C;  1LO5 D;  4LF9 L;  4A93 G;  4C1N I;  2N3S A;  5E4W C;  3GD7 A;  4J1M A;  4DUZ L;  2PQE A;  4DAY A;  3T53 B;  2F3W A;  4A3C G;  3PCO B;  4EVO A;  2JJQ A;  2VQF L;  2AMC B;  4JOI A;  2EYL A;  2KCN A;  4L5T A;  1G2T A;  2B2W C;  5LL6 S;  2HIX A;  4DR7 L;  2X6L A;  1FGU A;  5CV7 A;  1BOS A;  4IOA A;  5HGT A;  4DV6 Q;  1V8Q A;  3NEM A;  4ZCK A;  4DV4 L;  3CRL C;  2E2H H;  1QVF A;  2HHH L;  1GHJ A;  1R4P B;  3RMH A;  3DUZ A;  4F8M A;  1UEA B;  1OXX K;  1TWH H;  5C4X B;  3U50 C;  2RKS A;  2F0Q A;  2F4I A;  1HTP A;  1PFS A;  2OQK A;  5C3E G;  2XTI A;  2K5H A;  1TXY A;  1O7L A;  1F2M A;  3NEN A;  3S2H H;  1RCV D;  5EKL A;  3T51 B;  3D3R A;  4Y7N H;  3I56 A;  1MIU A;  2EJF C;  4PNY A;  4FF2 A;  3C3L A;  4Z9C B;  4WOR A;  2RCF A;  3PO2 B;  2WAC A;  3Q6S A;  3Q23 A;  1WD0 A;  3CCS A;  5LHY 1;  2XRS D;  2ALY B;  1YJ9 A;  4A3B B;  1VQH A;  4A3I B;  2IW3 A;  4GNX B;  1KDC A;  3BDO A;  2BOS A;  4RMF A;  5GAD C;  2JEB I;  3VR4 A;  4A3L G;  1G6Z A;  4IFD G;  2D2C C;  2MO1 A;  5EBC A;  4CJ1 B;  5JOB A;  5C5M A;  4JI4 Q;  2B63 H;  2N88 A;  3V05 A;  4X66 L;  2D0P A;  3KJP A;  1HHV A;  2WB1 B;  3S1R B;  4ZUJ A;  1WVL A;  3M3Y B;  3KDF B;  5M3M H;  1EIG A;  1N36 L;  4HID A;  1SRO A;  2L11 A;  2JSO A;  2EDG A;  3ZJY C;  1Q1E A;  1U4P A;  2B3G A;  3KF6 B;  2CW0 D;  5C0X H;  1PTO B;  5HGQ A;  1B9M A;  1E2Z A;  4BXX H;  1LTL A;  4MN3 A;  3K57 A;  2KEC A;  1D6E C;  1UE5 A;  3IL8 A;  1TWA B;  3J7A V;  1G6P A;  5JJI A;  2R93 G;  3RNU A;  4OHJ A;  3PV0 A;  1Q90 A;  1RJT A;  1WYD A;  4A3D B;  1CZW A;  2ZTE A;  4CDC C;  1YHB A;  2VNU D;  3K7U C;  1G51 A;  4EQ5 A;  2J4X A;  1SE3 A;  4EGV A;  5I6W A;  3HOV H;  1N32 L;  1M1K C;  2D5D A;  4FNF A;  1EQR A;  4JI7 L;  4LF4 Q;  5M5X B;  1I50 H;  2D9U A;  2I46 A;  1XPR A;  2A69 C;  2ZM6 L;  4DKA C;  3TRZ A;  4JW0 A;  4DU9 A;  1VQI A;  4KN4 C;  2CH4 W;  1A15 A;  2QKI C;  1HZA A;  2F3V A;  2LSS A;  2RA4 A;  3CCJ A;  1STG A;  3NTI A;  3QG1 A;  2K05 A;  1J5E Q;  4B3S Q;  3U58 A;  3U4Z A;  3HZX A;  4DV5 Q;  1HFN A;  4L5S A;  1E3P A;  2K50 A;  2K52 A;  1FJG L;  3GTG B;  4LFA Q;  2BCO A;  4RKL A;  4A3I G;  1C0A A;  3MXG A;  4OO1 G;  3S1N H;  3W5O A;  4DFA A;  1JOK A;  1XNR L;  1I6V C;  2UXB L;  4JK1 C;  4AQY L;  2JE6 I;  2NBF A;  2VUM B;  3HGB A;  1EIY B;  1FGB D;  4B9W A;  1I94 L;  2WB1 G;  3VYU A;  1GHK A;  3HFZ B;  1B1Z A;  1S5E D;  3ZYY X;  4HIM A;  1HPC A;  3I4L A;  2R7Z B;  2L5T A;  2SNM A;  1RD9 D;  1KIX A;  1VQE A;  1VQO A;  1HJP A;  5IP7 H;  3D4R A;  1Q86 C;  4K8J A;  1VQL A;  1PDQ A;  2PNH A;  2V1C C;  3P20 A;  4C3J H;  2EIF A;  2Z0S A;  4KK7 A;  3UE1 A;  4BBR G;  2K7V A;  4IPH A;  1PMR A;  1WFQ A;  4KD4 A;  2L1B A;  3G48 A;  1H9M A;  1BVS A;  4IUT A;  4A3F G;  4MZ9 A;  4A3J B;  5EKK A;  2PW7 A;  2EYJ A;  3SK6 A;  1VQ8 A;  2RHQ B;  1Q7Y C;  3HOX B;  3H0G B;  4J8Q A;  3K0X A;  3F8T A;  2E5L L;  1TWG B;  1LTR D;  2R6G A;  4KLK A;  2R92 G;  1HTL D;  4I7A A;  2EY2 A;  2KJX A;  1QZG A;  1TVX A;  3FKI H;  4P75 A;  1QZH A;  3S16 H;  2XNA C;  2RF4 A;  5EPL A;  1VQB A;  4OX9 L;  3CQZ B;  1IYV A;  3SGI A;  4NKL A;  1HQR D;  1QG7 A;  4NP5 A;  1O80 A;  1W6K A;  4FDB A;  3I55 A;  2EY1 A;  1VCI A;  3E6Z X;  3WOF A;  1I6H H;  1WTQ A;  4OWW B;  4A3C H;  4POF A;  1RKN A;  2FMM A;  4TVA B;  1F2Y A;  1G29 1;  4DXG A;  1X3Q A;  1GUN A;  2ZJQ A;  3NP8 A;  4H0L C;  2O2L D;  3PUZ A;  2NWG A;  3UDI A;  4LFB Q;  4B3R L;  2VB3 X;  5M5Y B;  3GTL H;  1H9S B;  1B3Q A;  3DMU A;  4H44 C;  4KJO A;  4BY1 G;  3T1H Q;  1I3Q H;  2OQ0 A;  1ILQ A;  2JK8 A;  2A74 C;  1JR0 D;  4KMU C;  3BS1 A;  1A63 A;  2JYO A;  4A3G B;  1SYC A;  3STB C;  2WAQ E;  3K5N A;  4GOP A;  4WFN 3;  4KD3 A;  4QQB X;  1SEB D;  1L1O C;  3CW2 C;  4DAP A;  1L1O A;  5C3E H;  2R7Z G;  1OXV A;  4JI0 Q;  1CI3 M;  4FO2 A;  4FVM A;  1K9M C;  4JYA L;  1JWM D;  2KBN A;  5BR8 L;  1IL8 A;  2B2V C;  2F0H A;  1ESR A;  5HY6 A;  1E1O A;  3OSO A;  4DV6 L;  2ES2 A;  1TKW B;  3PGZ A;  1BNZ A;  3JC6 6;  5AJ3 L;  3HKZ E;  3I73 A;  4QIW B;  1C9O A;  2IX0 A;  2KHI A;  1T9H A;  3D4W A;  5DNF A;  2ZXP A;  1F9P A;  1HCZ A;  4QB4 A;  4B3M L;  1Y8N B;  1H9R A;  4A3L H;  1LT5 D;  2A68 D;  5IWA Q;  4IFD H;  4DV1 Q;  2NN6 I;  4V19 0;  3PQI A;  2F0G A;  2K5W A;  2MFI A;  2MO0 A;  1PXU A;  2DY8 A;  1JJG A;  3QOL A;  3IFD A;  2O5J C;  4IUQ A;  3EIV A;  1TT2 A;  3H3V C;  1HNW Q;  3P75 A;  3SK8 A;  2K5Q A;  2MGS A;  4P73 A;  1TWH B;  4RGN A;  3I4M B;  1S5C D;  3X3M A;  2B29 A;  1QB5 D;  2CWA A;  1CSQ A;  3MTS A;  3S2H B;  4TKO B;  1LAB A;  4Y7N B;  2PO4 A;  3FRP B;  1KTK A;  3W1B A;  1X3P A;  5E1F A;  1EWH A;  1U4M A;  5GRO A;  1BF4 A;  2R93 H;  2IX1 A;  5IT9 c;  3T4A C;  1EEF D;  2UUA L;  3NBI A;  1IW7 C;  1X3G A;  2D62 A;  4A3G G;  3GO5 A;  1QNU A;  3LGJ A;  2M2L A;  3NBH A;  2VQF Q;  2EYP A;  2RSN A;  2F0N A;  3NEL A;  4I7Z C;  5IOC A;  4BWG B;  4DV0 L;  4DR7 Q;  1BCP C;  2HUG A;  2KEN A;  2RCN A;  3U9O A;  5CMD A;  4R4O A;  2XN9 C;  2HDL A;  5FJ8 G;  2B63 B;  2RSO A;  4P74 A;  1RHP A;  2YU9 H;  4GN4 B;  1IKL A;  1NNX A;  2HT1 A;  5JVG 3;  3PIO 3;  4RH6 A;  3K7A H;  1SFO B;  2WII B;  4M8A A;  2WKD A;  5LMU L;  2XWJ B;  5M3M B;  1AE3 A;  4DV7 Q;  2K5D A;  2BA0 A;  5ISR A;  3UE0 A;  2SNS A;  4A3I H;  3NSW A;  4ODG A;  1VQJ A;  1GKH A;  1O7Y A;  1YI2 A;  3KLR A;  1Y14 B;  3DM3 A;  2Y0S G;  1GD7 A;  1WTP A;  4LF4 L;  1SLJ A;  4DR2 Q;  5IGF A;  5GQO A;  4PQX A;  1EYD A;  3S9W A;  4NMZ A;  4YCV A;  1A8V A;  1TY2 A;  1GUT A;  4UAI A;  1J5E L;  4B3S L;  3I4M G;  5IIF A;  4DV5 L;  4BBR H;  5FK9 C;  3NWS A;  1Q12 A;  1VQ6 A;  2SOB A;  4LF8 Q;  1I50 B;  1TWF H;  2Q8I B;  3Q0A A;  4JG2 A;  4A3F H;  1IXR A;  1NE3 A;  3SDZ A;  4UP7 A;  1GM5 A;  4JVZ A;  2CQO A;  1MSG A;  2R92 H;  1N36 Q;  1BKB A;  5DAU A;  1IHZ A;  2AUK A;  1TQO A;  2JA9 A;  2RDG A;  2FFK B;  1JIC A;  1KAW A;  3S1N B;  3URY A;  1LAC A;  5EQ0 A;  5T1G A;  3AQQ A;  1A3T A;  4YIJ A;  2CWP A;  3QO2 A;  4HMI A;  3C1F A;  5T1I A;  1PRT B;  2B63 G;  3HG9 A;  1E22 A;  1U4L A;  4EX5 A;  1CK1 A;  1X9N A;  1V1P B;  4FXK C;  3TBI B;  1SNO A;  1S5F D;  4EQO A;  1I4G A;  1WTW A;  5CR3 A;  4YHH Q;  4IUP A;  1ET6 A;  1N32 Q;  3F2B A;  1QVC A;  3CD6 A;  4C3J B;  2F0M A;  2SEB D;  1NSN S;  1E7Z A;  3TDQ A;  5C0X G;  2EZV A;  1VQP A;  3FMC A;  3KOJ A;  2ZM6 Q;  4BY1 H;  5CYU A;  4AYB E;  4BXX G;  3B6Y A;  2E2D C;  3S1Q H;  1I4Q A;  4HMJ A;  2ZJP A;  1F2Z A;  5NUC A;  2KHJ A;  1Q46 A;  2G5D A;  2KUM A;  5ELF A;  5I6Y A;  1A0I A;  1B7Y B;  2A68 C;  3J80 c;  1FJG Q;  3FKI B;  4DK1 A;  3S16 B;  3KBG A;  2K5N A;  3BJU A;  2VL6 A;  1UNS A;  4PG3 A;  1XNR Q;  3G7L A;  4DAM A;  3J80 i;  5IGC A;  2YTV A;  3HS0 C;  4JCV E;  4A4I A;  2IHE A;  4JBM A;  1VQM A;  4LFB L;  4IPG A;  2A6E D;  4RHS A;  2Q2I A;  3HOZ H;  3TP6 A;  5CV9 A;  5KIX A;  1K0R A;  1B8A A;  1NMG A;  3RUZ A;  3KYH C;  5COR A;  5L37 A;  4BBS G;  1HR0 Q;  1V1Q A;  1Y8O B;  2H1E A;  3H09 A;  2B8F A;  1MJC A;  3BZC A;  1B2T A;  4JI1 L;  4AIM A;  3OMG A;  3J7Z C;  3GTL B;  2F1M A;  1VQF A;  2PZT A;  3MXP A;  4H13 C;  3LWE A;  3K5O A;  2K14 A;  4L63 B;  5M3F B;  4JI8 L;  1D5X C;  4R4Q A;  3OYY A;  5ELE A;  1VMC A;  5DLQ E;  1QJO A;  4NPS A;  3CME A;  4OX9 Q;  5C3E B;  4DR1 L;  5KND A;  1YHA A;  5IGE A;  3MHB A;  3BDL A;  1HUN A;  1EU4 A;  1BCP F;  5IWA L;  4LF5 L;  2L15 A;  1TS3 A;  2VZA A;  4F7X A;  4CKC A;  2OCE A;  2KVM A;  2DGY A;  2I07 B;  2Z4H A;  5FLM G;  3M85 A;  1VQ4 A;  1HNW L;  1NAP A;  4LNQ A;  1KD1 C;  4MNO A;  4U68 A;  1X32 A;  3OW2 A;  1Z9F A;  4PZ7 A;  2BDO A;  4B3R Q;  5FJ8 H;  2NUC A;  4B9X A;  2PYK A;  4K2K A;  1V9P A;  4FXG C;  5KNB A;  2VB2 X;  3E0E A;  3BVM A;  1SN8 A;  5E7N A;  5IGG A;  5IOD A;  5IT9 E;  3L3O C;  4TSS A;  4XIG S;  1CHP D;  1MBY A;  2L12 A;  3LNN A;  1S40 A;  3DWA A;  4H7B A;  1B53 A;  1VQA A;  1CA6 A;  2B2T A;  1PH1 A;  3MEF A;  1N33 Q;  5EKI A;  3QJY A;  2F0I A;  3FDT A;  4JOI C;  3TZD A;  4JYA Q;  2EQS A;  3ONA B;  5IYB G;  1KLU D;  1KHI A;  4C2M H;  3TSS A;  1A2T A;  5BR8 Q;  3WWV A;  4RAU C;  5IE8 A;  3ERQ A;  2R93 B;  3P1H A;  4ZKC B;  4RGO S;  4QF4 A;  5BN5 A;  1YHQ A;  2NTS A;  3CCL A;  5AJ3 Q;  5M3F G;  5KGU A;  1FVI A;  1KAB A;  3RLN A;  4L5Q A;  4IUV A;  4B3M Q;  2MNA A;  4DV7 L;  5M5W H;  3I4M H;  1XPO A;  3F2U A;  1ROD A;  4ABN A;  4BS9 A;  1STE A;  3FPU B;  3MFY A;  3K58 A;  2MUY A;  2YU9 B;  2IPK D;  4MHE A;  4FP5 D;  1N34 L;  5IYD H;  1O78 A;  3R2T A;  3K7A B;  2TMP A;  1G8Z D;  1PH7 A;  1SNC A;  4DR2 L;  3T13 A;  4N9P A;  3ERS X;  3HOU H;  2GA4 B;  4ZUI A;  5EAY A;  1K73 C;  1MJE A;  5IT9 L;  1TY0 A;  5I2X A;  3A54 A;  3STB D;  1PVO A;  5KYI A;  3BDC A;  2EY5 A;  4X64 L;  1PFB A;  2WAQ G;  2G9D A;  4LF8 L;  2UUA Q;  3M4O H;  3AB9 A;  1ICF B;  5BN4 A;  2NZH A;  1CKN A;  4P2C B;  1SFO H;  2UUC L;  1EOT A;  2JA6 H;  3KFU A;  1SRU A;  1V43 A;  2JQO A;  3CP0 A;  4GN3 B;  3VDY A;  5K36 G;  3CAM A;  3S17 H;  4DV0 Q;  3RD4 A;  1XYI A;  4BBR B;  1YJN A;  4KJN A;  4FXD A;  2A6E C;  1K8A C;  1GUW A;  1LTS D;  1PYS B;  2YTX A;  1GXD C;  1OO9 B;  1TWF B;  3QIA A;  5C0X J;  4A3F B;  4K5X A;  2L9H A;  4LUV A;  1VQ5 A;  2F0K A;  5LMU Q;  3AMU A;  2R92 B;  4IUN A;  2XVS A;  4IUU A;  5DM7 3;  5EGT A;  1CKO A;  3I4O A;  1SYE A;  1ASY A;  1QOH A;  4R4C A;  3SHL A;  1OTC A;  4HIK A;  4WJW A;  1SNQ A;  1BBX C;  3A8J E;  4YHH L;  2E8G A;  1K3R A;  3EJI A;  3IRB A;  4DF7 A;  2VY3 A;  2PZW A;  3AU7 A;  3Q8D A;  4X6A H;  2PNR C;  2PMZ B;  4RCO A;  1HA6 A;  2AQ2 B;  3JAM i;  4HSP A;  5HUR A;  2BDN A;  3OMC A;  5IGD A;  3J80 E;  4AH6 A;  3CCU A;  4IOC A;  2N49 A;  3CU7 A;  3KUP A;  4BBS H;  3TS2 A;  4S3S A;  4HJ7 A;  1IW7 D;  1EIF A;  4CJ0 B;  3MA2 B;  1RTO A;  3M9B A;  1CQF A;  1UWV A;  4HSV A;  3MC0 B;  1EY4 A;  3PUW A;  4DUY L;  4BY1 B;  2A8V A;  4ME5 A;  3S1Q B;  1BCP D;  1EL0 A;  4XQJ A;  1QNK A;  4IO9 A;  2E2J H;  4HAE A;  4TRD A;  3D6W A;  1Y8P B;  3NXW A;  5C4H A;  2CFM A;  3S14 H;  4KY7 A;  3OOC A;  1HR0 L;  1DOK A;  1PV4 A;  3MAQ A;  2SDF A;  5FO7 B;  2B2U A;  1CSP A;  1I4R A;  4XQQ A;  3HOZ B;  1ASZ A;  1AE2 A;  2J7Z A;  3KDF A;  3K5M A;  2F0V A;  4YCU A;  1ZEQ X;  1TWC H;  5FLM H;  1PYB A;  2EJG C;  4B08 A;  3KF6 A;  2DJG C;  1PTO C;  1TS5 A;  4DV3 Q;  3BZK A;  2EYM A;  2DUD A;  3DWP A;  2I5M X;  3CPW A;  5D65 A;  3J80 L;  2N78 A;  1YNN D;  3OHX C;  4NDX A;  4YWM A;  2R7F A;  4CGY B;  2CH4 A;  1XX8 A;  1LT6 D;  1L0Y B;  5ELO A;  5I2Y A;  1SE8 A;  4QJF A;  4PZ8 A;  1HZ9 A;  1MGS A;  4RHR A;  1Y1V H;  3EQL C;  3EBE A;  1VF5 C;  5F2D A;  2A1A A;  2IHF A;  4GLV B;  1SE4 A;  5IYB H;  1Q8K A;  3CCQ A;  1SYB A;  4C3H H;  2XGT A;  2LKV A;  1EZ6 A;  3HOW G;  1SJH D;  1ESF A;  1C4Q A;  4QUC A;  2L4N A;  3CHB D;  4OIJ A;  3PF4 A;  3I4N H;  4K0K Q;  1SXT A;  2CKZ B;  4JV5 L;  4FF1 A;  1DCZ A;  4PMC A;  5M3F H;  4OWT B;  2NVX H;  4XYO A;  1ONL A;  2FIN B;  1NR4 A;  4LUZ A;  1NR2 A;  1PA6 A;  3M7G A;  4ZAI A;  4ZYS A;  4GOP C;  1XWE A;  3GV6 A;  2FXQ A;  4LF6 Q;  5EPJ A;  4OWX B;  1WTR A;  3RZO H;  4CDE C;  1OXT A;  4K5V A;  2QDB A;  5CV6 A;  4JI1 Q;  2Q2T A;  3TS0 A;  3PO3 G;  4A75 A;  1N33 L;  1YJW A;  1W2B A;  3HP3 A;  3HOY G;  3WDN A;  1EFW A;  1S5B D;  2DJF C;  3V96 A;  2ICE C;  1M4V A;  4JI8 Q;  1X3E A;  4XYQ A;  4NXN Q;  1WTO A;  1B70 B;  4OEL B;  2DN8 A;  3HOZ G;  3K6O A;  1STA A;  4RGT A;  3PUX A;  4DXF A;  3EFX D;  5C4J H;  2A19 A;  4DR1 Q;  2E76 C;  2EYF A;  4ILW A;  5EJW A;  2R3Z A;  1G91 A;  1P16 A;  4C2M B;  1A6X A;  5EBD A;  3CKI B;  3GQB A;  4LF5 Q;  3DEP A;  4H02 A;  2Y0S B;  1VQD A;  4DV2 L; 
#chains in the Genus database with same CATH homology
 3LWU A;  4J6H A;  4KHV A;  4IFD J;  2JEA I;  3NE5 B;  1PFM A;  3KF8 A;  2O5I C;  3R3O A;  3L7Z C;  1SE2 A;  2K33 A;  4HCS A;  5K36 H;  1H9J A;  1J9O A;  3L9A X;  5M5W B;  2WP8 J;  4KKU A;  5ELD A;  1ZYR C;  3I70 A;  3C46 A;  3PUY A;  1Q1B A;  1CA5 A;  3HOU B;  3GTM B;  4JBW A;  2JXM B;  3MWY W;  2Q8R E;  1AFP A;  4F87 A;  1EY8 A;  3R93 A;  5ELB A;  3M4O B;  4CBV A;  1EY0 A;  1AW7 A;  5E3F A;  4DA2 A;  5TSS A;  2ZXO A;  2JA6 B;  1JOO A;  1ENC A;  3S17 B;  3EA6 A;  2RQX A;  3JAM E;  4X3T A;  5DM6 3;  1O7Z A;  1UAP A;  2TSS A;  2V4D A;  1TS4 A;  2WV6 D;  2LY7 A;  2CQA A;  3DEO A;  5KEE A;  3NK9 A;  2YYZ A;  2HCC A;  5KYL A;  4QCL A;  2KOL A;  4XXE A;  2FJ2 A;  3ND8 A;  5D3D A;  5A2Q E;  1PTO F;  1YNN C;  2C9O A;  1EY7 A;  3R2I A;  2EVB A;  1HXY D;  2BE5 C;  1LTI D;  1U9R A;  1KDA A;  2EY6 A;  2F0T A;  3T56 B;  4BBS B;  1DON A;  4X3K A;  1Z6H A;  1TS2 A;  1D1I A;  3BVZ A;  4PMW A;  1CM9 A;  1BUV T;  3IKJ A;  4RKB A;  3D8G A;  1MD2 D;  4BA1 I;  3OWF A;  1JCK B;  1DM0 B;  2Q8T A;  3W3A A;  3OIP A;  2XIW A;  3JAM L;  2E2J B;  2B2Y A;  3H6M A;  3TP5 A;  3A8I E;  4OL7 A;  4OO1 I;  3FEW X;  2JP1 A;  1QCB D;  3NTK A;  3J7Y W;  3S14 B;  2RDF A;  4PMB A;  1MSH A;  2K32 A;  4RWS C;  1T5E A;  2X6G A;  4ZLT F;  4RA8 A;  4XTC S;  2OEO A;  1SDF A;  1CHQ D;  3NPP A;  4XDX A;  4GZY C;  1B50 A;  5A2Q L;  1E0B A;  1TWC B;  2A73 B;  2IT1 A;  4DAV A;  1FNW A;  3E5S A;  2WKC A;  1EIH A;  5CBE E;  4KKS A;  2XSC A;  3NTH A;  5IGB A;  2K03 A;  1LTG D;  3TN2 A;  1T5X D;  1Y1V B;  1A3V A;  4V0B A;  3MXN A;  4KY5 A;  1A2U A;  4DNT B;  2A6H C;  1GJX A;  4C3H B;  2EYO A;  1JQY D;  1M8A A;  2A5H A;  3I4N B;  2NVX B;  3BYT B;  4O42 A;  3H91 A;  1JOR A;  3I8Z A;  4K6L A;  3I91 A;  3SR1 A;  3I90 A;  3EVQ A;  3RZO B;  1H9K A;  1XXG A;  5I4D A;  3OIQ A;  1PRT C;  1F9S A;  1KAA A;  1DZ1 A;  2ID0 A;  2QEJ C;  1EEI D;  5AFW A;  1U4R A;  3KK7 A;  3HRZ C;  1K8M A;  5C4J B;  1FD7 D;  1CFM A;  1FNV A;  4LMQ D;  3LX0 A;  2EYH A;  1F9R A;  5FKA C;  2WAQ B;  5C6A A;  3BVG A;  2EJM A;  2N55 A;  3OPO A;  4R8I A;  4NW2 A;  1Z7T A;  1SMY C;  1I4P A;  1SAP A;  3VYS A;  4CKE A;  5A35 A;  2NVQ B;  3SE0 A;  1YNJ D;  1Y69 U;  2NYZ D;  4DNR B;  3A8K E;  1WD1 A;  2B2T C;  4FYD A;  2BA1 A;  1LTB D;  4G7Z C;  5LL6 X;  4R8N A;  1JOQ A;  1S5D D;  1LT4 D;  1SJE D;  1SYF A;  2LMC B;  3HKZ B;  2R61 A;  1PTO D;  4C3H G;  3GTK B;  3V2T A;  3MFG A;  3CRK C;  2NN6 G;  3VR6 A;  1EY5 A;  3VYT A;  2MHV A;  3Q24 A;  1ZKO A;  2NB0 A;  1PZI D;  3RZD B;  2RVL A;  4CKB A;  3TP8 A;  2IX3 A;  1B3A A;  2PW5 A;  4KHZ A;  2E74 C;  1SYD A;  2F0P A;  2B2W A;  1I4H A;  4C3I B;  2HQE A;  3PUV A;  5FLX E;  1LTT D;  1B9N A;  3W2D A;  4L6T B;  2EE1 A;  3E0J A;  3DHQ A;  1EWC A;  2CVR A;  1F2L A;  3KLS X;  2F0L A;  3P7J A;  1SND A;  2PCF B;  1C48 A;  1STB A;  2NVY B;  1A3U A;  1STH A;  4BA2 I;  1LTA D;  2LFN A;  2KEE A;  1KNE A;  4IN3 A;  4A3M B;  4K6D A;  3MEH A;  3QB3 A;  3KBX A;  4IZ8 A;  3N52 A;  1BQQ T;  1STY A;  1DOL A;  2OT2 A;  3UI2 A;  2VXW A;  2NVT B;  4K5W A;  5EPK A;  2AQ3 B;  1LV9 A;  5J22 A;  1DOM A;  1W6J A;  5M9O A;  3GTO B;  3D31 A;  3U9S A;  5FLX L;  2KA7 A;  4WRD A;  1JE4 A;  2E2I B;  1IYU A;  3NHH A;  4OGQ C;  3K5L A;  4L8J A;  1SSO A;  1IKM A;  3PMF A;  4C3I G;  1DXM A;  1R9T B;  2NTT A;  4C56 C;  3KLS A;  1ZYR D;  3SK5 A;  3SVM A;  3TP7 A;  4XQN A;  2FMC A;  3DM1 A;  1DD2 A;  1TR5 A;  3HOW B;  3ERO A;  1R4Q B;  1PRT F;  1V1O A;  2RDH A;  4ZKB B;  1DYQ A;  5C0X I;  3BZD B;  1LT3 D;  1CT1 D;  3C1E A;  1B4O A;  3PO3 B;  1WCM B;  2Z4I A;  1E2W A;  4G7H C;  4BY7 B;  1D5M C;  4X3U A;  2FHT A;  2F0F A;  3HOY B;  1YNJ C;  2B2U C;  3D6C A;  1KNA A;  2F0O A;  3C2P A;  1KDB A;  2B39 A;  3G6J B;  3GV3 A;  1JWU D;  1L0X B;  4Q5V A;  4AYB B;  5CV8 A;  1GOZ A;  4LK1 C;  1F9Q A;  3R8B A;  1EQV A;  2F0J A;  1B44 D;  5JVH 3;  2AWO A;  2EXZ A;  2Z1C A;  3N6R A;  4PV1 C;  2MJ8 A;  4KKT A;  5DEH A;  3DXJ C;  1ZXT A;  2BE5 D;  4OIK A;  3FVQ A;  4XT1 B;  3VR5 A;  4KY6 A;  2MPM A;  4R9W A;  2F03 A;  2PZU A;  5BN3 A;  3I72 A;  2NN6 H;  4K14 A;  5JPM C;  3VR2 A;  4DN4 M;  3IAY A;  1NCV A;  4TQU S;  4IQZ A;  4G57 A;  2HDM A;  1PFN A;  3T16 A;  3OWE B;  4EQP A;  1JWS D;  1HA5 A;  3TME A;  1BCP B;  1RDP D;  4FF4 A;  5ELC A;  1QE6 A;  1JC7 A;  1PYW D;  2C5C A;  1LLR D;  1HQM C;  2OXP A;  2RBM A;  3K59 A;  3VR3 A;  5C3W A;  1RTN A;  1F77 A;  1FYC A;  2KED A;  2MP1 A;  3GTP B;  1AP0 A;  1D5Z C;  1ML0 D;  1ILP A;  3WOE A;  1AEX A;  4CJ2 C;  2B2V A;  1D1K A;  4A3K B;  2EOT A;  5JEA G;  4N9T A;  4I65 A;  4G7O C;  2CW0 C;  5E4X A;  3GTJ B;  1CTM A;  5CV5 A;  3OW7 A;  2K6A A;  5J1Z A;  4LAA A;  2XWB B;  4ZRZ A;  2OF1 A;  4QUF A;  1BXT A;  3NQT A;  1WTX A;  5D3I B;  1D2B A;  3NQI A;  1GUO A;  1XTC D;  4X3S A;  2A6H D;  4KI0 A;  2QCP X;  5FO8 B;  2E2H B;  5KNC A;  3NUC A;  3A56 A;  2K1B A;  4ID6 A;  1VDZ A;  1FNU A;  2JA5 B;  2Z8L A;  1PLF A;  2KCC A;  3J81 E;  3MVV A;  1K8O A;  3A7L A;  4RGM A;  1H9S A;  2J0T D;  4E6I A;  1ENF A;  2F0S A;  1AZP A;  4HN7 A;  5D14 A;  1GUG A;  4HCE A;  5JPN C;  2NZ1 D;  1FR3 A;  3VYR A;  3QOJ A;  1PRT D;  3GP7 A;  3DWQ A;  4XT3 B;  1EFI D;  5K5P A;  4IFD I;  2H4O A;  2F0E A;  1EU3 A;  1EYC A;  5FOB B;  3ITP A;  4KN7 C;  1TU2 B;  1EY6 A;  3Q22 A;  4EQN A;  2QIL A;  1AZQ A;  1SMY D;  3J7A F;  1K83 B;  5G3L F;  2G9H D;  2M9V A;  4OO1 H;  1PZK D;  2PPB C;  1RF2 D;  3FPP A;  3K0Y A;  3ND9 A;  2EPB A;  2O4X A;  4G4K A;  5C3X A;  2ICI A;  4IAL A;  1Q3L A;  4HTH A;  2E75 C;  4KTA A;  2QF7 A;  1GUS A;  5C44 B;  5CBA E;  1BR9 A;  1BDO A;  3S2D B;  3J81 L;  4C1N K;  3M7N A;  4MIU A;  4ZK9 B;  1EYA A;  3QWN A;  1UUP A;  3HOV B;  3I3C A;  4HED A;  2DNE A;  1HRJ A;  1PTO H;  4ZQ3 A;  5CGK A;  3H94 A;  5JJZ A;  3MZ5 A;  2IWH A;  4M1U B;  3TZU A;  1AN8 A;  1QIL A;  2B2Y C;  2XRQ D;  2AWN A;  1SNM A;  3D4D A;  3M4Y A;  2DNC A;  3S15 B;  4RFB A;  2K28 A;  4A3E B;  1OXU A;  3SXH A;  3NWT A;  1HFG A;  2B8G A;  3SEB A;  5J39 A;  1I4X A;  1STN A;  3BG3 A;  1JB3 A;  2AUJ D;  1J8I A;  4LJZ C;  5COY A;  2AQ1 B;  1Q8I A;  5KRU A;  4FF3 A;  1SYG A;  1SNP A;  3X3N A;  2K04 A;  1WTV A;  1EQT A;  1G2S A;  2F0W A;  1SBB B;  2CHB D;  4DK0 A;  2KHS A;  1ICW A;  2F0U A;  2WIN B;  4K8I A;  1CQV A;  1EY9 A;  4KV6 A;  2L0C A;  1II3 A;  1C8C A;  3SK4 A;  2LS0 1;  3S1M B;  4A93 B;  1I6H B;  5FO9 B;  5JEA H;  5I9O A;  3VA5 A;  5C5L A;  1VF7 A;  3BYY B;  5JEA J;  1PZJ D;  1EZ8 A;  1Z47 A;  2ENB A;  2X69 A;  2KQ3 A;  1Y1W B;  2L55 A;  4HR7 B;  4ULL A;  1I3Q B;  2JA7 B;  5CV4 A;  3O13 A;  1V1P A;  3VA7 A;  1ET9 A;  2F0D A;  5C4Z A;  1VMP A;  2A69 D;  5CC4 A;  4UDU C;  2ZXR A;  2K01 A;  4C3J G;  4IUR A;  5I9P A;  4K2L A;  4RCN A;  4Q0F A;  3IFT A;  2DY7 A;  1QWY A;  1S4Z A;  2IJ0 A;  4F88 A;  1MI2 A;  4U67 3;  4O1N A;  3MXU A;  3RLF A;  4DGZ A;  2M00 A;  1HUM A;  3HEJ A;  3PIP 3;  4CHT B;  1ENA A;  3GTQ B;  1KLG D;  2IL8 A;  3A55 A;  3A7A B;  1TII D;  5JAV A;  5G3L D;  1DJR D;  1BO0 A;  2JA8 B;  2HCI A;  1OXS C;  1NUC A;  1E2V A;  1CZG A;  4QMG A;  2ZT9 C;  1LO5 D;  4C1N I;  5E4W C;  3GD7 A;  4J1M A;  2PQE A;  4DAY A;  3T53 B;  2F3W A;  4EVO A;  2EYL A;  2KCN A;  1G2T A;  2B2W C;  5LL6 S;  2X6L A;  5CV7 A;  1BOS A;  5HGT A;  1V8Q A;  3CRL C;  1GHJ A;  1R4P B;  3RMH A;  3DUZ A;  4F8M A;  1UEA B;  1OXX K;  5C4X B;  2RKS A;  2F0Q A;  2F4I A;  1HTP A;  1O7L A;  1F2M A;  1RCV D;  5EKL A;  3T51 B;  3D3R A;  2EJF C;  4PNY A;  4FF2 A;  3C3L A;  4Z9C B;  4WOR A;  3PO2 B;  2WAC A;  3Q6S A;  3Q23 A;  1WD0 A;  5LHY 1;  2XRS D;  4A3B B;  4A3I B;  2IW3 A;  1KDC A;  3BDO A;  2BOS A;  2JEB I;  3VR4 A;  1G6Z A;  4IFD G;  2D2C C;  5EBC A;  4CJ1 B;  5JOB A;  5C5M A;  2N88 A;  3V05 A;  1HHV A;  2WB1 B;  3S1R B;  4ZUJ A;  1WVL A;  3M3Y B;  1EIG A;  2L11 A;  2JSO A;  2EDG A;  1Q1E A;  1U4P A;  2CW0 D;  5C0X H;  1PTO B;  1B9M A;  1E2Z A;  4MN3 A;  3K57 A;  2KEC A;  1D6E C;  3IL8 A;  1TWA B;  3J7A V;  4OHJ A;  3PV0 A;  1Q90 A;  1RJT A;  4A3D B;  1CZW A;  2VNU D;  2J4X A;  1SE3 A;  4EGV A;  5I6W A;  2D5D A;  4FNF A;  5M5X B;  2D9U A;  2I46 A;  2A69 C;  4DU9 A;  4KN4 C;  1A15 A;  2QKI C;  2F3V A;  2RA4 A;  1STG A;  3NTI A;  3QG1 A;  2K05 A;  3HZX A;  1HFN A;  3GTG B;  2BCO A;  4RKL A;  3MXG A;  4OO1 G;  4DFA A;  1JOK A;  1I6V C;  4JK1 C;  2JE6 I;  2NBF A;  2VUM B;  3HGB A;  1FGB D;  4B9W A;  3VYU A;  1GHK A;  1B1Z A;  1S5E D;  3ZYY X;  1HPC A;  3I4L A;  2R7Z B;  2L5T A;  2SNM A;  1RD9 D;  3D4R A;  4K8J A;  1PDQ A;  3P20 A;  4KK7 A;  2K7V A;  1PMR A;  4KD4 A;  2L1B A;  1H9M A;  4IUT A;  4A3J B;  5EKK A;  2PW7 A;  2EYJ A;  3SK6 A;  3HOX B;  3H0G B;  4J8Q A;  1TWG B;  1LTR D;  2R6G A;  1HTL D;  2EY2 A;  2KJX A;  1TVX A;  2XNA C;  5EPL A;  3CQZ B;  1IYV A;  4NKL A;  1HQR D;  1QG7 A;  4NP5 A;  1O80 A;  1W6K A;  2EY1 A;  1VCI A;  3E6Z X;  3WOF A;  1WTQ A;  1RKN A;  2FMM A;  1F2Y A;  1G29 1;  4DXG A;  1X3Q A;  1GUN A;  3NP8 A;  4H0L C;  2O2L D;  3PUZ A;  2NWG A;  2VB3 X;  5M5Y B;  1H9S B;  3DMU A;  4H44 C;  4KJO A;  4KMU C;  1ILQ A;  3BS1 A;  2A74 C;  1JR0 D;  2JYO A;  4A3G B;  1SYC A;  3K5N A;  4WFN 3;  4KD3 A;  1SEB D;  4DAP A;  1OXV A;  1CI3 M;  4FO2 A;  4FVM A;  1JWM D;  1IL8 A;  2B2V C;  2F0H A;  1ESR A;  3OSO A;  1TKW B;  1BNZ A;  3I73 A;  4QIW B;  2IX0 A;  3D4W A;  5DNF A;  2ZXP A;  1F9P A;  1HCZ A;  4QB4 A;  1Y8N B;  1H9R A;  1LT5 D;  2A68 D;  4IFD H;  2NN6 I;  4V19 0;  2F0G A;  2K5W A;  1PXU A;  2DY8 A;  3QOL A;  3IFD A;  2O5J C;  4IUQ A;  1TT2 A;  3H3V C;  3P75 A;  3SK8 A;  2K5Q A;  2MGS A;  1TWH B;  4RGN A;  3I4M B;  1S5C D;  3X3M A;  1QB5 D;  3MTS A;  3S2H B;  4TKO B;  1LAB A;  4Y7N B;  2PO4 A;  3FRP B;  1KTK A;  1X3P A;  5E1F A;  1EWH A;  1U4M A;  1BF4 A;  2IX1 A;  3T4A C;  1EEF D;  1IW7 C;  3NBI A;  2D62 A;  3GO5 A;  1QNU A;  2M2L A;  3NBH A;  2EYP A;  2RSN A;  2F0N A;  4I7Z C;  5IOC A;  4BWG B;  1BCP C;  2HUG A;  5CMD A;  3U9O A;  2XN9 C;  2HDL A;  2B63 B;  2RSO A;  1RHP A;  1IKL A;  5JVG 3;  3PIO 3;  4RH6 A;  1SFO B;  2WII B;  4M8A A;  2WKD A;  2XWJ B;  5M3M B;  2K5D A;  2BA0 A;  5ISR A;  2SNS A;  3NSW A;  4ODG A;  1O7Y A;  3KLR A;  1WTP A;  5IGF A;  4PQX A;  1EYD A;  3S9W A;  4NMZ A;  1TY2 A;  1GUT A;  4UAI A;  5IIF A;  5FK9 C;  3NWS A;  1Q12 A;  2SOB A;  1I50 B;  2Q8I B;  3Q0A A;  3SDZ A;  1MSG A;  5DAU A;  1IHZ A;  2AUK A;  1TQO A;  2RDG A;  2FFK B;  1JIC A;  3S1N B;  3URY A;  1LAC A;  5EQ0 A;  5T1G A;  1A3T A;  4YIJ A;  3QO2 A;  4HMI A;  3C1F A;  5T1I A;  1PRT B;  3HG9 A;  1U4L A;  1CK1 A;  1V1P B;  4FXK C;  3TBI B;  1SNO A;  1S5F D;  4EQO A;  1I4G A;  1WTW A;  5CR3 A;  4IUP A;  1ET6 A;  4C3J B;  2F0M A;  2SEB D;  1NSN S;  3TDQ A;  5C0X G;  2EZV A;  3FMC A;  5CYU A;  2E2D C;  1I4Q A;  4HMJ A;  1F2Z A;  5NUC A;  2KUM A;  5ELF A;  5I6Y A;  2A68 C;  3FKI B;  4DK1 A;  3S16 B;  3KBG A;  1UNS A;  3G7L A;  5IGC A;  3HS0 C;  2A6E D;  4RHS A;  3TP6 A;  5CV9 A;  5KIX A;  3RUZ A;  5COR A;  1Y8O B;  2H1E A;  3H09 A;  2B8F A;  1B2T A;  3OMG A;  3GTL B;  2F1M A;  2PZT A;  3MXP A;  4H13 C;  3LWE A;  3K5O A;  4L63 B;  5M3F B;  1D5X C;  5ELE A;  1VMC A;  1QJO A;  5C3E B;  5KND A;  5IGE A;  3MHB A;  3BDL A;  1HUN A;  1EU4 A;  1BCP F;  1TS3 A;  4F7X A;  4CKC A;  2KVM A;  2Z4H A;  2I07 B;  3M85 A;  1NAP A;  4U68 A;  1X32 A;  2BDO A;  2NUC A;  4B9X A;  2PYK A;  4K2K A;  4FXG C;  5KNB A;  2VB2 X;  3BVM A;  5IT9 E;  5IGG A;  5IOD A;  3L3O C;  4TSS A;  4XIG S;  1CHP D;  1MBY A;  2L12 A;  3LNN A;  3DWA A;  4H7B A;  1B53 A;  1CA6 A;  2B2T A;  5EKI A;  3QJY A;  2F0I A;  3FDT A;  3TZD A;  3ONA B;  1KLU D;  3TSS A;  1A2T A;  4RAU C;  3ERQ A;  2R93 B;  3P1H A;  4ZKC B;  4RGO S;  4QF4 A;  5BN5 A;  2NTS A;  5KGU A;  1KAB A;  4IUV A;  3F2U A;  1ROD A;  4ABN A;  4BS9 A;  1STE A;  3FPU B;  3MFY A;  3K58 A;  2MUY A;  2YU9 B;  2IPK D;  4MHE A;  4FP5 D;  1O78 A;  3R2T A;  3K7A B;  2TMP A;  1G8Z D;  1SNC A;  3T13 A;  4N9P A;  2GA4 B;  4ZUI A;  5IT9 L;  1TY0 A;  5I2X A;  3A54 A;  5KYI A;  3BDC A;  2EY5 A;  1PFB A;  2G9D A;  3AB9 A;  5BN4 A;  4P2C B;  1EOT A;  1V43 A;  5K36 G;  3RD4 A;  1XYI A;  4BBR B;  4KJN A;  4FXD A;  2A6E C;  1GUW A;  1LTS D;  1GXD C;  1OO9 B;  1TWF B;  3QIA A;  5C0X J;  4A3F B;  4K5X A;  2L9H A;  2F0K A;  3AMU A;  2R92 B;  4IUN A;  2XVS A;  4IUU A;  5DM7 3;  5EGT A;  1SYE A;  1QOH A;  3SHL A;  4WJW A;  1SNQ A;  1BBX C;  3A8J E;  3EJI A;  4DF7 A;  2PZW A;  3AU7 A;  2PNR C;  2PMZ B;  4RCO A;  1HA6 A;  2AQ2 B;  4HSP A;  5HUR A;  2BDN A;  3OMC A;  5IGD A;  3J80 E;  3CU7 A;  3KUP A;  4S3S A;  1IW7 D;  4CJ0 B;  3MA2 B;  1RTO A;  1CQF A;  4HSV A;  3MC0 B;  1EY4 A;  3PUW A;  4BY1 B;  4ME5 A;  3S1Q B;  1BCP D;  1EL0 A;  4XQJ A;  1QNK A;  4HAE A;  4TRD A;  3D6W A;  1Y8P B;  3NXW A;  5C4H A;  4KY7 A;  3OOC A;  1DOK A;  3MAQ A;  2SDF A;  5FO7 B;  2B2U A;  1I4R A;  4XQQ A;  3HOZ B;  2J7Z A;  3K5M A;  2F0V A;  1ZEQ X;  2EJG C;  4B08 A;  1PTO C;  1TS5 A;  2EYM A;  3DWP A;  5D65 A;  3J80 L;  1YNN D;  3OHX C;  4NDX A;  4CGY B;  1XX8 A;  1LT6 D;  1L0Y B;  5I2Y A;  1MGS A;  4RHR A;  3EQL C;  1VF5 C;  5F2D A;  1SE4 A;  1SYB A;  2LKV A;  1EZ6 A;  1SJH D;  1ESF A;  1C4Q A;  4QUC A;  2L4N A;  3CHB D;  4OIJ A;  1SXT A;  4FF1 A;  1DCZ A;  4PMC A;  4XYO A;  1ONL A;  2FIN B;  1NR4 A;  1NR2 A;  3M7G A;  4ZAI A;  4ZYS A;  1XWE A;  3GV6 A;  5EPJ A;  1WTR A;  1OXT A;  4K5V A;  2QDB A;  5CV6 A;  3HP3 A;  3WDN A;  1S5B D;  3V96 A;  2ICE C;  1M4V A;  4XYQ A;  1WTO A;  2DN8 A;  3K6O A;  1STA A;  4RGT A;  3PUX A;  4DXF A;  3EFX D;  2E76 C;  2EYF A;  4ILW A;  5EJW A;  2R3Z A;  1G91 A;  4C2M B;  1A6X A;  5EBD A;  3CKI B;  3GQB A;  3DEP A;  2Y0S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...