1RTNA

Proton nmr assignments and solution conformation of rantes, a chemokine of the cc type
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proton NMR assignments and solution conformation of RANTES, a chemokine of the C-C type.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chemokine
molecule keywords RANTES
total genus 8
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rtnA00
2KUMA 4HAEA 5E4XA 1HUMA 1U4LA 3TN2A 4CJ0B 4R8IA 1B50A 5EKIA 1DZ1A 1ICWA 2B2WA 1GUWA 2L1BA 4XT1B 2CVRA 1HUNA 1EQTA 5CORA 4X3TA 1J9OA 4IUTA 2J7ZA 2B2VA 2R3ZA 1PLFA 1RTNA 4X3SA 1WTPA 1CM9A 2FHTA 2XIWA 1B53A 1XYIA 1CA6A 2B2YA 4QUFA 1F9QA 5T1IA 3N52A 5D65A 1E0BA 3GV3A 1HHVA 4UAIA 4XT3B 1AZQA 4IUPA 1EIHA 3I91A 1JICA 1BO0A 1VMPA 2X6GA 3MWYW 5EPLA 1XX8A 2B2TC 3I8ZA 4CJ1B 3ONAB 2B2UC 2DY8A 1B3AA 1DOMA 5CMDA 1LV9A 1MSGA 1NR4A 1EL0A 4RA8A 2EPBA 5JJZA 3R93A 2N88A 2SDFA 4MHEA 4U68A 5AFWA 1HFGA 1MGSA 1ILQA 2IL8A 2KOLA 2K01A 1HA6A 1X3PA 1M8AA 4XDXA 4RAUC 1BNZA 1IL8A 2K04A 2MGSA 4RWSC 1SSOA 1BBXC 5EJWA 3MTSA 1G2TA 2L11A 1J8IA 1HRJA 1EIGA 1DOLA 3G7LA 2K28A 1QNKA 3FDTA 2FJ2A 1HFNA 1PFMA 1IKLA 2B2TA 1RJTA 2FMMA 2H1EA 2JP1A 3I90A 4NW2A 5COYA 1WTOA 1Q3LA 1SDFA 2L4NA 2N55A 4OIKA 2FFKB 2HCIA 2HUGA 5T1GA 1RTOA 1WTWA 2DY7A 2KEEA 1EOTA 2B2YC 2NZ1D 2BDNA 2M2LA 4IUVA 4DN4M 1ILPA 4ZKBB 3I3CA 5EPJA 5EQ0A 4X3KA 1WTVA 1G2SA 2HDLA 1BF4A 3KUPA 1B2TA 3DEOA 1ESRA 1QG7A 3P7JA 4OIJA 1WTXA 2B2WC 2MP1A 4LMQD 1O7ZA 4X3UA 1WVLA 1ZXTA 1X32A 2K1BA 2KEDA 4ZAIA 4R9WA 2L9HA 2X6LA 2EE1A 2EOTA 1O7YA 2Q8RE 3DEPA 1F9RA 2RA4A 1WD1A 3D6WA 1DOKA 1KNAA 4O42A 1B4OA 1TVXA 2HDMA 3UI2A 3H91A 1F2LA 2K03A 3GV6A 1AZPA 2JYOA 5D14A 3LWEA 2NWGA 1NAPA 1F9SA 1O80A 2D9UA 1QE6A 1RODA 5CBEE 1NR2A 2L12A 4ZKCB 3IFDA 1WTRA 3SVMA 2MJ8A 1NCVA 3QO2A 1PFNA 2KVMA 1CA5A 4IUQA 1U4MA 4HEDA 2NYZD 2MPMA 2K05A 1C8CA 2B2UA 2FINB 4HCSA 2VXWA 3IL8A 5EPKA 1WTQA 1WD0A 1F9PA 1SAPA 1X3QA 1JE4A 4ZLTF 1KNEA 1PFBA 1PDQA 1IKMA 1MI2A 2RSOA 3KBXA 3FPUB 3HP3A 5DNFA 3F2UA 1RHPA 1G6ZA 1DONA 2Q8TA 2X69A 4HSVA 1S4ZA 2KECA 3TZDA 4ZK9B 1G91A 1MSHA 4MN3A 4QUCA 5E4WC 1AP0A 1U4PA 4CJ2C 3DM1A 4IURA 5CBAE 2RVLA 4IUUA 1ML0D 1A15A 2HCCA 2B2VC 1U4RA 2RSNA 3Q6SA 1VMCA
chains in the Genus database with same CATH superfamily
1HUMA 1ENCA 1RKNA 4DV7Q 2YTVA 3VA5A 4HSPA 1I50H 5C3EG 3BS1A 1D5XC 4BBSH 4GOPA 4HJAA 2CKZB 4G57A 3PMFA 4Y7NH 4H7BA 2E2HB 3HKZB 3RLOA 1X9NA 3TSSA 4Q0FA 2B2UC 4C3JH 2J4XA 1LTBD 3AYHB 2V1CC 3TP7A 4P71A 2G9DA 3HRZC 3WOFA 2TSSA 1PRTC 5ELDA 2D2CC 4BY1G 4XQQA 4KY6A 4A3MG 1BNZA 1BOSA 2F0FA 2LY7A 4RWSC 4A3KH 3H0GH 2L11A 1TS4A 2R61A 3HOUH 5IP9H 2EYLA 2B2TA 3CRKC 1TWGH 1A2TA 3LNNA 3K5OA 2EZVA 1ENFA 4YIJA 5M5WH 1PH2A 3I55A 4OGQC 1S72A 2F0GA 1NY4A 2NB0A 5CV7A 3CC2A 2XRQD 4X3UA 4DK1A 2L9HA 2ENBA 5J3BA 4A3EG 3SK8A 4DR5L 1NSNS 2HDMA 3TS0A 2IT1A 5IWAL 2F0JA 3EQLC 2D9UA 1NR2A 1SNDA 4ZUJA 3CCUA 1I6VC 4WFN3 3CXCA 3QJYA 1C0AA 1PTOC 3L0OA 1GUNA 3PO3G 2GVAA 2B2UA 2FINB 4GKJL 3K57A 3IL8A 3TREA 2JA8G 2JQOA 1GO3E 4NDXA 4I65A 1C9OA 2C9OA 3FHWA 1SNOA 3CPFA 1IBLL 1B70B 4X62Q 1KLUD 5C44B 2VQEQ 3J7ZC 1XPRA 4OELB 2Q2UA 1EY8A 5IGDA 1GXDC 1L2FA 4H44C 5G3LD 4LF6Q 4OO1H 4KV6A 4MN3A 3RZOH 4LFBL 4RGNA 5C3WA 3A5ZB 1A15A 4POFA 3Q8DA 2A68D 2Z6KC 4K5VA 1DGSA 3ERQA 3TN2A 4P72A 3MXUA 5CGKA 3VYSA 1CHPD 3PO3B 4DGZA 4L63B 1J9OA 4GLAC 2QEXA 1I3QB 1I94Q 4BBRG 4RFBA 4TRDA 2E74C 2E2DC 3S24A 1ZYRC 2E2JH 4DR3L 4DUZQ 3UE1A 4QF4A 3NBIA 4IUPA 1EIHA 2I5HA 1Q46A 3MWYW 4IZ8A 5ELFA 2PCFB 2WP8J 3UDIA 2MNAA 1P8LA 4YWLA 3R93A 3HOUG 3HOXB 1XNRL 2DN8A 3NBHB 4K6LA 4BY1H 4E6IA 5JAVA 1VQPA 1GKHA 3M4YA 3GTJH 3T1HQ 5BN5A 2K4KA 2QDBA 1FD7D 3HGBA 1F2ZA 1GVPA 2N55A 4C3HB 4IOAA 5DM73 2JXMB 3HOXG 4GNXA 2Z1CA 3K7AH 4DV3Q 1Y1WH 2HT1A 4A3LG 1AE3A 1XWEA 1SFOB 1A62A 1G51A 2SEBD 3P7JA 2I5MX 2AHOB 5LHY1 1ASYA 1LACA 1WVLA 3A54A 3E0EA 2KEDA 2MO0A 1NTGA 2RA4A 3E9HA 2OTLA 2XNAC 2JA8B 1TVXA 5K36H 3UI2A 2CWPA 4X66Q 3H3VH 2E5LL 4JI5L 1PH6A 2QA4A 5M3MG 3R3OA 1WTRA 3QO2A 4HIMA 1HPCA 1SYFA 4JI0L 2NTTA 4A3MH 1H9RA 4DNIA 2K50A 2VXWA 1B3QA 2NN6I 4L5RC 1NMFA 3NE5B 1G8ZD 5ELOA 2VQFQ 1H9SB 1I4XA 4JI2L 4UP9A 1MI2A 1TS2A 3FPUB 2D0PA 1BQQT 1G6ZA 2L15A 2Y0SG 3ZYYX 1IBLQ 1VCIA 2A74C 4EQOA 2R7ZH 3D8GA 3KOJA 1WCMB 3MXPA 4LW1A 4I7AA 5ELCA 3D4WA 1R4PB 5K5PA 4IUTA 1EQRA 1CZGA 2WAQB 1PHJA 2FHTA 3KLRA 5TSSA 2WB1B 3J7YW 1PZKD 4YCVA 4RKBA 1PYSB 1SYCA 5IYBG 2J0TD 3K7AB 1PYBA 1VQ6A 4DV5Q 2ALYB 2XSCA 2XTIA 1LV9A 1HNWL 4F7XA 1I6HB 4OONA 2SDFA 1EYDA 1OTCA 1U5KA 4JOIC 1EYAA 1A3TA 2K01A 2KCMA 2C5CA 5D3DA 4DV1L 4C2MH 3AQQA 2F4VL 4A3GB 4XIGS 3CCSA 3BDOA 4KKSA 3HOZH 1DOLA 1L1OA 3DWAA 2ICEC 1VQAA 2F0TA 3QOLA 4O0AA 1HFNA 3UDFA 3GTGH 3S9WA 1SXTA 3I90A 1KTKA 2HUGA 5T1GA 4B3RL 1CKNB 1JMCA 2LS01 4GKKQ 2WAQE 3WWVA 2NZ1D 3BU2A 4ZKBB 3R8BA 5LL6X 2EXZA 1KRSA 5M3MB 1SYGA 1Y14B 3HKZG 1EY9A 5FLXE 1W2BA 3HOVH 3A5UA 3TEHB 1FGUA 4OX9Q 1L1OB 5C4JH 2K1BA 2K5WA 4XYQA 3J81j 3CMEA 1TWFB 3CCLA 5HURA 1ZEQX 3CQZH 5C3EB 4A3FH 3L2PA 5CR3A 5LMNW 1FNWA 1PMRA 1GUTA 3CCEA 3HS0C 5CV6A 1N9WA 4HEDA 2NYZD 1KXLA 1ET9A 1GHKA 3PO3H 4R1JA 4A3GH 4DAYB 1E7ZA 5JJLA 4MTKA 3VYTA 4NXMQ 2JA9A 1PTOD 4LUVA 3V05A 1XMOL 1VMCA 5KIXA 2BE5D 1YJNA 4FF1A 1NE3A 2IX1A 1QJOA 2PO4A 3QOJA 2O2LD 1PV4A 5M9OA 1CQVA 2XWBB 4DFAA 3S14H 4IPHA 1HXYD 4BY1B 1CA6A 1I6HH 4JI5Q 4A3BH 4UAIA 2EY2A 3PV0A 5IYDG 4A3DG 5IYCG 1JJCB 2OF1A 3RLNA 4LF7Q 3CW2C 5CMDA 3CU7A 1MSGA 1V1PB 4B9WA 3IAYA 1EUJA 4YWKA 3G4SA 1STEA 3NTIA 4KJNA 1H9MA 2M9VA 5IT9L 1ESFA 3DM3A 4NPSA 2E2HH 1HA6A 1I94L 3I4MG 1B8AA 4RAUC 1SMYD 2Q2HA 3AMUA 3W2DA 2XGTA 5EJWA 4DKAC 2F3WA 3VR3A 1J8IA 5FO9B 1A3UA 2PQAA 2HHHL 4A4IA 5J22A 4LNQA 2UUAL 1QNKA 4KY7A 2G9HD 5EGTA 3T1YL 1QUQB 1LTID 1SJED 1KDCA 4PQXA 1TKWB 4JBJA 2Z0SA 4PZ8A 2O4XA 3S1RH 1BF4A 4LFAQ 3OTOQ 3DLLA 5FLMG 1VQ8A 3MXGA 1E1TA 1FR3A 1SEBD 5AJ3L 2PZUA 2UUBL 3HOYG 4MIUA 1PH7A 2EOTA 2Q8RE 3AFPA 3HOYH 3PSIA 3K8AA 3S16B 1DOKA 3PUYA 1V1QA 4QY7A 2WACA 2K03A 2B8FA 2SNSA 5M5XH 1SN8A 1QE6A 4B08A 4ME3A 5M3FH 3T1YQ 1VQHA 1JB3A 1E2ZA 1E2VA 4P74A 1BBWA 1LT6D 4B9XA 2I0QA 1CSPA 1II3A 1PH8A 2Z4IA 4OL7A 1Y69U 1IBML 1FVIA 1STNA 1X56A 4JK1C 4I7ZC 1QZHA 2RCNA 1YNJC 4KJOA 1VQMA 5CBAE 4KTAA 1JR0D 3R2IA 1WTHA 4JI1Q 4J15A 1TWHH 2VUMB 1U4LA 1EEID 1PXUA 2K52A 1STAA 2B2WA 2ZXPA 2EIFA 4XT1B 1HUNA 3RZOB 4OHJA 4AQYQ 4QB4A 4C3IH 2B39A 1JWSD 3DWQA 3F2CA 1TS5A 3CRLC 1X55A 2F4IA 1JJ2A 3ERSX 4DAYA 5C44H 4Q5VA 2K33A 4FF2A 3FKIB 3BVZA 5IE8A 1Y1WG 4A3LH 3PGZA 1IW7C 3KBGA 1EFID 4RHRA 5KRUA 2EJGC 1TQOA 2PW5A 2OCEA 2VZAA 3SHLA 1Q12A 1OXVA 3J81E 3G7LA 1O78A 3UE0A 4JI6Q 3Q23A 3HOWB 4IPGA 1I4QA 1UE1A 2A73B 2JP1A 1D2BA 4AYBB 2PZWA 5GADC 3I56A 3KJOA 3C1EA 3EA6A 3E3XA 2MUYA 5KGUA 2ASBA 5FO7B 4L5SA 4CKBA 2N49A 4DV1Q 4JI7L 4JI3Q 5CV9A 2ZJPA 5FJ8G 2XVSA 3S2DH 4EX5A 1VQ7A 4OX9L 5FO8B 5C6AA 3HOUB 5M3FB 2ZXOA 4HJ5A 1EY4A 3H6MA 1NBWA 3TZUA 2EJMA 1XMOQ 2F0SA 1F2LA 4HTHA 2E76C 4B3RQ 2RDGA 3PUXA 2PI2E 1Q90A 2ZM6L 4LAAA 1RD9D 1RODA 2BH2A 2L12A 4R4IA 1VQ4A 5JEAG 5JJIA 2KVMA 1UAPA 1J5EL 3MZ5A 3D31A 2MPMA 3H3VC 5EPKA 4GN3B 1QVFA 3I4NH 1JE4A 1SYEA 1M1KC 1Q8KA 2VNUD 4N8X1 1FYCA 2K75A 1PRTD 4AIMA 4K2LA 3FP9A 4NB3A 3P20A 4IPDA 3TMEA 4L5QA 4IUNA 3NQTA 3UDGA 4ABNA 3KDFB 1U4RA 4LFCQ 1RF2D 2PW7A 1R9TB 4GLVB 1S5BD 1TR5A 4APVA 3U4ZA 1HNXQ 1VQOA 1X3FA 2J7ZA 5C5LA 1RTNA 4X3SA 1D1IA 4A3BG 1Y1VG 3KLWA 2CQOA 1S5CD 4YHHL 4X66L 5D65A 1E0BA 3W1GA 1DXMA 4GKKL 2EYPA 4H02A 1NJIC 3GP7A 4LF5L 3S1QH 3U4VA 2OQKA 1P16A 1X6OA 3H15A 1I4HA 1CZWA 1B44D 2EPBA 2MQHA 3PIP3 2R7ZG 5JVH3 2JA6B 4U68A 4C3HG 1LT4D 3R2TA 1AFPA 1M8AA 3G6JB 4KY5A 3A56A 2F4VQ 5FKAC 3I4NB 3OHXC 4V0BA 3MFYA 5E1FA 3VR5A 1HNWQ 3H94A 1Q3LA 1SDFA 1HQRD 1IYUA 4TKOB 4AYBG 1F77A 1RTOA 1N32L 1I50B 3JAML 3GTJB 1XNQQ 5M3MH 1HJPA 2ID0A 3HOVB 4KKTA 2OEOA 3OOCA 3MAQA 1ESRA 4OIJA 1H9SA 5CV5A 1I3QH 3I72A 4F87A 4C3HH 3FVQA 4DK6C 1YITA 2VW9A 2BA0A 1O7YA 2R93B 4A3JB 4BBRB 1CKMA 3H91A 2NVYH 2FMCA 4JI6L 3X3NA 3S1QB 1EZ6A 1JWUD 5GROA 1PTOH 1N8RC 1KABA 1N33Q 2EYJA 3KLSA 3NBHA 1IBMQ 3HOXH 3GTQB 2VUMH 4WJ4A 3J81L 1C8CA 2D62A 4YCUA 3X3MA 4AH6A 4ZLTF 1K83B 4HIDA 2LFNA 1F2YA 1K0SA 3T51B 1R9TH 4N9PA 1LO5D 1KLGD 1RDPD 1FL0A 1GUOA 4QIWE 2JA6H 4R4TA 5I9OA 2VQEL 5KEEA 1H9KA 3HKZE 2UUCQ 2A6EC 2JEBI 4QQBX 2CFMA 4WJ3M 4FF3A 4RMFA 5HGQA 4R4QA 2BA1A 4IPCA 4NP5A 2MHVA 4S3SA 3GO5A 4LJZC 1WCMH 2AQ3B 1E22A 4LFCL 1VMPA 4N8FA 3BZDB 3K0YA 1XX8A 3A8KE 3ONAB 1O7LA 1YZ6A 2HIVA 3KYHC 4DF7A 4LFBQ 2WINB 1HR0L 3OW2A 4DAVA 1VQ9A 1IYJB 1MGSA 2JJQA 4DR6L 2SOBA 5KNDA 5FJ8H 2UXCQ 4OO1G 3D4RA 1SSOA 3MTSA 1XNRQ 2KA7A 1HRJA 1JORA 3MC0B 4QL5A 2EXDA 2F0KA 4P2CB 3NTHA 3URYA 1UNSA 3MXNA 3NWSA 1K3BC 4IALA 2DY7A 3I73A 5BR8L 1ENAA 5FK9C 2RHSB 2H4OA 2A19A 4HJ7A 4L8JA 2Q2TA 4K8IA 2HDLA 1B2TA 1BXTA 4KN4C 4F88A 1U9RA 4OEMB 4BY7G 1EQVA 1K8AC 4GZYC 2F03A 3FMCA 1MJEA 3A74A 3VYUA 3K59A 4BBSG 2K5DA 3K5MA 2DNCA 1JWMD 5M5YH 2UXBL 4DAMA 2HHHQ 2FXQA 1I4RA 2NWGA 5C0XH 3HFZB 1GHJA 3DXJC 3SK6A 4OWWB 3M4OH 2EDGA 1VQNA 5CYUA 4YCWA 2OWOA 4FXGC 2JA7B 3SXHA 3STBC 4DR4L 1PVOA 1IKMA 1AH9A 1A8VA 3NK9A 4K14A 1B9MA 3E0JA 3F2UA 3STBD 4LF7L 1X54A 1JC7A 3SGIA 3KF6B 1AP0A 1PA6A 2RVLA 4FYDA 2QW7A 2RSNA 2X6GA 2YTYA 4HAEA 3EROA 3TP6A 1HNZL 1DZ1A 5EKIA 1ICWA 2RDFA 1SNQA 5J39A 3HEJA 1GUGA 4DV0L 4X3TA 5GAHC 3RMHA 1PLFA 4TQUS 5C4HA 2B63B 3S1MH 5JEAH 3JC66 1STHA 2A69D 3NQIA 4DR1L 2Z6BA 1AZQA 3T53B 1VQIA 4XQNA 1PH9A 1JICA 3CQZB 4JI1L 5C3EH 3VDYA 2LMCB 3V96A 2VB3X 5JPMC 5IOCA 1B3AA 2QKIC 1NR4A 4EQNA 2NVTH 1LTAD 4L5TA 2QDLA 4A75A 3J80L 1KDAA 1QNUA 3GTPB 4B3TL 4OWXB 4A3IH 4KD4A 1HR0Q 1CTMA 5EKLA 1VS0A 1HZAA 3S17B 4DV5L 1SNPA 1BCPC 2H1EA 3TP8A 4F8MA 5JVG3 3PIOA 1WTWA 3GTOB 3FPPA 2BDNA 4IUVA 4DN4M 4MZ9A 2PQEA 1RCVD 2NTSA 1SROA 4A3GG 1N34Q 2PI2A 2ZT9C 3MVVA 1O7ZA 4PZ7A 5GAGC 3I4LA 3D0FA 2HIXA 2EYOA 3M4OB 1S5FD 4OXPA 2QF7A 4G7HC 2CH4A 4K8JA 4O42A 5HGTA 3Q24A 5CV8A 3U9OA 2OTJA 4G4KA 4ZCKA 1IW7D 2CH4W 2F0PA 1LTSD 2KHSA 2BOSA 3LWEA 5D14A 5IYCH 1YIJA 1XPUA 3IFDA 2WB1G 2AQ2B 2VY3A 2RCFA 2MJ8A 2EY1A 1LTTD 3FRPB 3T56B 1BBUA 1LT5D 1K73C 3M4PA 4JCVE 5IP9G 3A8JE 3GTMH 1WCMG 1Z6HA 2F3VA 3ND9A 4JI4L 1DONA 2Q8TA 1MD2D 3Q6SA 3IKJA 4KD3A 4QUCA 5KNCA 3RR5A 2JA5G 3HOWG 3J7AV 4OO1I 1TWCB 1KL9A 1VQFA 2IX3A 1EWHA 4FP5D 5IY0A 4Y7NB 1PH4A 1Z47A 2A69C 4HMIA 3CCMA 2UXCL 4CDCC 4GN4B 2B2VA 2G5DA 3JAMi 3C1FA 1Y1WB 4X6AH 4RCOA 3RLFA 1B53A 1DM0B 1F9QA 2K5QA 2F0DA 4RKLA 4GNXC 2SNMA 2DUDA 1ZYRD 1ONLA 1BO0A 1Q86C 1I4GA 3H0GB 3TS2A 1CI3M 4RA8A 1Y8NB 4EGVA 4N9TA 4MTNA 1YI2A 1X3GA 4WORA 3B6YA 5IODA 3S17H 4JBKA 4KI0A 5FLMH 3HOVG 4P75A 3F1ZA 1IL8A 1HR0W 3BZCA 1G2TA 4Y52H 3K6OA 1V8QA 2F1MA 4YY3L 3PO2H 4YY3Q 3EVQA 1RL2A 3IRBA 1UE6A 5IGCA 1O7IA 2F0WA 1Q81C 1EOTA 4A3FB 3RD4A 1Q7YC 1BUVT 5KNBA 1YNJD 3NPPA 4FVMA 1WTVA 2R6GA 2F0LA 3I4MH 4JV5L 2BDOA 4HN7A 3ND8A 1TY2A 3D4DA 4LMQD 2EY6A 4ID6A 3GTLB 4C3IB 4ZAIA 1OXTA 1XTDA 3DUZA 4KMUC 2AWNA 1MKHA 5BN4A 2ZTDA 2RDHA 2GA4B 3EBEA 4K6DA 5IYDH 1O80A 3G48A 5EBDA 1UEBA 2F0UA 4ZKCB 4J6HA 4C1NK 2R93H 2AKWB 2KJXA 5NUCA 1KAWA 1EY5A 1CA5A 3A55A 4UDUC 3PIO3 4LF8Q 4GKJQ 1SMXA 4LF4L 2L55A 3ER0A 3NENA 1CK1A 2NVXB 4ZYSA 2O5IC 4A76A 2R93G 3TRZA 3V2TA 5BN3A 4XTCS 3J7AF 5DNFA 1RHPA 4HSVA 1XNQL 3K5LA 5E4WC 4IUUA 2HCCA 3WOEA 2JEAI 2GVBA 1BCPB 2E2JB 1I5FA 5E4XA 3KK7A 4R8IA 2JN4A 1B50A 3TDQA 2NVYB 3H0GG 3W3AA 4RGOS 1IYVA 2ES2A 1BR9A 1D1KA 1C4QA 1HTLD 2Z9HA 4KK7A 4A93G 1CSQA 2ZTEA 5CC4A 3QWNA 1LTRD 4OWTB 1CM9A 4M8AA 2DJFC 2KENA 3P1HA 3A8IE 1PH1A 5DAUA 1SE8A 3DHQA 5IGEA 4CGYB 3I4NG 1PRTF 1VQCA 3SR1A 1FJGQ 5E7NA 3TP5A 1SNMA 2A6HD 1WOCA 1SJHD 3I8ZA 3M3YH 1YJ9A 2YV5A 4A3CG 4DXGA 1TS3A 2F0IA 1EQQA 5LMNQ 3KDFA 1EYCA 5M3FG 2F0VA 5ELBA 4EQPA 4DUYQ 4BXXH 3M7NA 2ATWA 4UHVA 1EU4A 1SLJA 1R4QB 3WDNA 1CQFA 1QVCA 1S5DD 2ZM6Q 1HNZQ 1YVCA 3ULLA 5IT9c 1VQLA 4A93B 3D6CA 2QCPX 4HIOA 4TSSA 3PUVA 3QG1A 4K5WA 1GOZA 1UE7A 4IJLA 3PIPA 2B29A 3I4OA 2N8NA 1SRUA 1YHBA 2QEJC 2JA8H 5M5WB 4B3TQ 4JI3L 3K7UC 2VS1A 3DEOA 3PUWA 2PNRC 1WTXA 1A6XA 2B2WC 1CUKA 2RF4A 2A68C 2Q2IA 4BWGB 4R9WA 4IFDI 2F52A 4AYBE 4LF9L 5LMUQ 2PNHA 3S1NH 4B3SL 1Q8IA 3L7ZC 2IX0A 2LSSA 2UXBQ 4BA1I 3J7A5 4JYAL 5CBEE 2NVQH 3HZXA 1V9PA 4J1MA 1A0IA 1UEAB 4JI2Q 5EBCA 4IUQA 1TWAB 3T1HL 2CW0D 2NZOA 2BH8A 3PQIA 4XYOA 2IWHA 4POGA 1UUPA 1F9PA 3VA7A 3AB9A 1KNEA 4ZRZA 4JV5Q 2B63G 3OMGA 3TQYA 4CBVA 5KYIA 2WKCA 1XPOA 3TZDA 4ZK9B 1MSHA 3AU7A 2F0HA 2C35B 1VF7A 1JOKA 4JBWA 5IGGA 2UXDL 1G6PA 1PTOB 3L9AX 1E1OA 1C7YA 3K58A 2GN5A 4A3KG 3S2HH 2P5ZX 2PYKA 3CAMA 5A2QE 4JPBW 4DUZL 4XXEA 4ULLA 2KBNA 4DV4Q 2CVRA 3S15B 4LFAL 2A6ED 4A93H 4CHTB 4C2MB 3RN2A 2IW3A 1MBYA 1GM5A 1D8LA 1TY0A 1TIID 4ZQ3A 3Q22A 3HOWH 3CHBD 5D3IB 4CKEA 1QVGA 3M7GA 3S16H 5HY6A 3NHHA 2NZHA 5JJZA 1KRTA 2N88A 1L1OC 1EFWA 1T9HA 1CKOA 1IZ6A 2O5JC 1JQYD 5ELEA 3J80c 4J8QA 2K04A 2NVTB 1EIYB 1EWIA 1GJXA 3VYRA 4K0KL 2K28A 1TXYA 1IKLA 4A3CH 4TVAB 5I6YA 4CDFC 1MIUA 4A3IB 1B7YB 1LUZA 3CKIB 1ILPA 5I2YA 4K2KA 4DR3Q 2NUCA 4H0LC 5EPJA 3SK5A 1IL2A 4X3KA 1ICFB 1TT2A 4FF4A 1I4PA 1V1PA 4MNOA 1ZXTA 1OXSC 3HOZB 1UE5A 2A1AA 4KHPL 1DCZA 3DEPA 4DV6L 3H3VI 2CQAA 4X64L 3NUCA 1XTCD 2Z6KA 3MEFA 3GV6A 4HCEA 4NXML 1AE2A 3L3OC 1YHQA 3VR2A 4LF9Q 2RKSA 4X62L 5IIFA 1VQKA 3F8TA 3W1BA 5C0XI 1VDZA 3T16A 1F2MA 2OXPA 3CCVA 1A63A 4A3IG 3ICEA 4RH6A 1EU3A 1X3QA 3LGJA 4RGMA 4HMJA 1BKBA 4QGUA 3PCOB 3J81c 1KQSA 3M4QA 1LABA 1S4ZA 4PG3A 1G91A 4IURA 1NUCA 3A7LA 4GOPB 3GD7A 3DWPA 3GQBA 2XRSD 3M85A 3G71A 2IJ0A 2EYMA 4DV2Q 3M9BA 4BY7H 1TWGB 3BDCA 4GN5A 2R7ZB 5A2QL 3K81C 4IJHA 2CCZA 3J80E 4IO9A 3NWTA 2F0NA 4DUYL 2PZTA 3PF4A 2ZJRA 1EWCA 4DV7L 1PTOF 2R92G 2K32A 3I91A 2JA5H 1JOOA 1OXUA 2F0MA 5G3LF 4LF5Q 1DJRD 2DY8A 1L0WA 4DU9A 3KF8B 4IFDG 1SMYC 3E9IA 3EN2A 4NXNQ 1A2UA 2HD3A 1SE2A 1IBKL 1X65A 5K36G 2CHBD 1JE5A 4DV0Q 4A3DH 2DJGC 3ULJA 3K80C 3E5SA 1S5ED 4C3IG 3FDTA 1PFMA 1S3OA 4B3MQ 1Q1BA 5JOBA 4B3ML 3EJIA 1Z9FA 1WTOA 3QIAA 5C4XH 2OQ0A 2K7VA 2YYZA 3U50C 3BDLA 2I5LX 5JEAJ 1KAAA 3S2DB 2K5NA 3SDZA 3PF5A 4HJ9A 1G2SA 3PO2B 1YHAA 2UU9Q 1HCZA 4IQZA 4DR4Q 1TWAH 1FGBD 5C4ZA 1J5EQ 2ZJQA 3OYYA 1SYDA 1L0XB 1PRTB 1V1OA 3AFQA 1M4VA 4C3JG 3OSOA 1KNAA 5ELNA 3NEMA 5DEHA 2QGQA 2JA6G 2RHQB 3NSWA 2JYOA 1K3RA 2TMPA 4CDEC 1K8GA 3NELA 4DR1Q 1PH5A 3GTOH 1EIFA 4DXFA 5IP7G 1ASZA 4PV1C 4YHHQ 1Q82C 2HQEA 3KFUA 2EY5A 3C46A 2E8GA 3A7AB 2JE6I 2L5TA 4L6TB 3KF8A 4PMWA 1WTQA 1M90C 1LTLA 1PYWD 4R8NA 1PFBA 1PDQA 2K5VA 3VR4A 2D0OA 2RSOA 4CDDC 1YJWA 4JBMA 2X69A 4KKUA 1T5XD 3BVGA 4CJ2C 2NVXH 4FXKC 4KLKA 3QB3A 2KHIA 3BYTB 1W6KA 3OW7A 2NBFA 1GUWA 3E6ZX 4CKCA 3F2DA 5JPNC 1TWFH 4LF8L 4QJFA 3CC7A 1STYA 4XT3B 4RCNA 3M3YB 2R7FA 3QR8A 2NN6G 1LLRD 1DOMA 5DM63 4A3JH 2VQFL 1AEXA 1VQJA 3ZJYC 2IL8A 2YTXA 1K28A 2Z4HA 1X3PA 2QILA 1AN8A 3CP0A 2WB1E 1VQDA 2ZTCA 1E2WA 3Q0AA 2MGSA 2VB2X 3TBIB 2VUMG 2K6AA 3FKIH 2KCTA 2N3SA 1EIGA 1OXXK 1KDBA 3SK4A 4BS9A 5EAYA 1QB5D 5C0XG 3OWFA 4DR2Q 4NKLA 2FFKB 4ILWA 1AW7A 5M5YB 2KEEA 4O2DA 2B2YC 5IGFA 3BZKA 3KF6A 4RGTA 1BCPF 1W6JA 1CHQD 3I3CA 5IP7H 4X65Q 4IFDJ 4KHPQ 4H13C 2PMZB 4EVOA 3KJPA 4DV3L 4R4CA 5J1ZA 3ULPA 4DV2L 2EE1A 4JI8L 3CC4A 3GTGB 4WRDA 1B4OA 2OT2A 1YNXA 2F0EA 2Z8LA 4GNXB 1DYQA 1HTPA 1QILA 2F0OA 3NXWA 4GS3A 4G7OC 2I07B 3SVMA 1N36Q 5AJ3Q 1U4MA 3W5OA 1EEFD 4DV4L 2K05A 2KHJA 4JVZA 1QOHA 3RZDH 1N36L 5GAEC 3N6RA 2CW0C 4LK1C 1EZ8A 3HP3A 2B63H 3S1MB 4DR7L 1LM0A 1U4PA 2A5HA 1W3SA 4FDBA 3C3LA 2PMZE 3J81i 1JJGA 3S1NB 2YU9H 3S15H 1HZCA 3D3RA 4ODGA 3FKIG 2XN9C 2E75C 2MO1A 4ZUIA 2N78A 2F3IA 4HJ8A 1Q1EA 4ME5A 4R4OA 1XMQQ 1PFSA 1C48A 3OMCA 1WTPA 2XIWA 2V4DA 3CPWA 2R92H 2BCOA 5EKKA 5T1IA 3N52A 4IN3A 3GV3A 1OO9B 2LXJA 5I6WA 3PUZA 2JA7G 1EY6A 2KCCA 2L0CA 5IGBA 5A35A 4C3JB 1B1ZA 4MHEA 1ILQA 3S14B 1K9MC 3I7FA 3EFXD 4KHZA 1HZ9A 4HIKA 1N34L 4XDXA 1WI5A 4A3BB 4A3EH 4LWCA 1HNXL 3GDEA 1SE4A 2Q8IB 1N32Q 1G291 3SE0A 2Y0SE 1TU2B 2JSOA 1TWHB 3A0JA 2FJ2A 3HKSA 4PZ6A 2HQLA 1Y8OB 1IHZA 4BBRH 4NW2A 4RHSA 1SR3A 4DR5Q 1KC8C 2WKDA 1VQEA 2ZXRA 4DK0A 3BVMA 3DMUA 1CT1D 2F0QA 2E2IB 1Z7TA 2EVBA 3MA2B 1EYGA 4LF6L 2DNEA 5FOBB 3KUPA 3HG9A 4A3MB 1J6QA 1QG7A 3K5NA 1FNUA 5L37A 1B9NA 1LTGD 1PH3A 2PQAB 2XWJB 3GTMB 1F9RA 2CWAA 1WD1A 1L0YB 4QMGA 1FJGL 4HR7B 2UXDQ 1HH2P 2AUKA 5IWAQ 1K83H 5C5MA 1F9SA 1STBA 2B3GA 4U673 1XXGA 4NMZA 3LX0A 2A6HC 3OIPA 2R92B 1FNVA 5IT9E 1WFQA 3MXNB 1SAPA 2WV6D 3C2PA 1VQ5A 4A3EB 3O13A 4LUOA 2RQXA 3OWEB 3KBXA 1H95A 5BR8Q 2YU9B 3GTPH 2KECA 1HQMC 2WAQG 5H1SE 5LMNL 4JW0A 1NMGA 2VL6A 2NVQB 4JOIA 3CCJA 2E2IH 1Y1VH 1STGA 5E3FA 4LF4Q 1WYDA 1GD7A 2BE5C 2AQ1B 4DR6Q 1LYLA 3U58A 1XYIA 4QUFA 4PMBA 3CMAA 3S1RB 4IFDH 1V43A 1JB7A 4C56C 3S2HB 5FLXc 3JAMc 1SFOH 1JCKB 5F2DA 1D5ZC 1GUSA 1K8OA 3KLSX 3HOYB 3I2ZA 2MFIA 4FNFA 5GQOA 4FO2A 4WJWA 1KIXA 4RG1A 1CFMA 4DR7Q 1JT8A 2KOLA 1RIPA 5C3XA 4BBSB 4DPGA 3PO2G 5C0XJ 3RUZA 3F2BA 3RN5A 4BY7B 2B8GA 2AWOA 2Y0SB 5DLQE 2UUCL 1QUQA 4XQJA 2R7DA 5C4XB 4UP7A 1RJTA 1KD1C 1YBYA 5COYA 4YWMA 4DNRB 2L4NA 2HCIA 1HZBA 2AUJD 5I9PA 4FXDA 1IXRA 3MFGA 2M2LA 1CKNA 2K14A 3AEVA 4UY8C 5JJKA 2JA5B 2M00A 3H09A 3IFTA 4JI8Q 5FLXL 5EQ0A 1BCPD 2UU9L 2DGYA 1QZGA 1XMQL 1H9JA 2MP1A 4C1NI 4JI0Q 2LXKA 1SNCA 1X32A 1K8MA 2AMCB 2H5XA 3CD6A 3RZDB 4DA2A 1N33L 4X65L 1BDOA 4K5XA 4O1NA 3D6WA 2E5LQ 4A3JG 2EJFC 2JA7H 5I2XA 4A3DB 1EY0A 2LKVA 5LL6S 5KYLA 4GLXA 2IY5B 4AQYL 1E3PA 1KHIA 1NCVA 1PFNA 4PMCA 1YNND 1VF5C 4NXNL 1D5MC 1SYBA 4HCSA 3U9SA 3BG3A 3OTOL 4Z9CB 1Y1VB 1JOQA 1T5EA 3T13A 3OPOA 4A3FG 2EQSA 1D7QA 3DM1A 3GTKB 1ML0D 4BXXG 3UDXA 4QCLA 2KUMA 1BVSA 1MJCA 3P75A 4CJ0B 2UUAQ 1YEZA 2L1BA 1X3EA 1EQTA 1HA5A 1SE3A 5CORA 4PNYA 2R3ZA 4KN7C 1XJVA 3CF5A 1WJJA 2B2YA 1DD2A 4JC0A 5I4DA 3I4MB 1HHVA 2JK8A 5ISRA 3GTLH 1ET6A 5EPLA 5CV4A 3VR6A 4CJ1B 2B2TC 3OIQA 5M5XB 3GTQH 4DR2L 1UWVA 1EL0A 1ZKOA 3RNUA 2UUBQ 1EY7A 3HOZG 1NNXA 5C4JB 1Y8PB 4JI4Q 1A3VA 5AFWA 1HFGA 4KHVA 2IPKD 3BJUA 2KCNA 4QIWB 3CCQA 1BBXC 1E24A 2A8VA 2IHEA 4LUZA 1YNNC 5C44G 2FMMA 5C4XG 1QCBD 4X64Q 4DV6Q 4OIKA 3NTKA 5IYBH 2D5DA 3J80i 4UP8A 4ALPA 1QWYA 3BYYB 2EYHA 2WIIB 3G6EA 3I70A 3K0XA 2ICIA 1D6EC 3LWUA 4P73A 4DNTB 4DAPA 3JAME 2WFWA 1VQBA 3GTKH 4DK3C 2X6LA 4GOPC 1MHWC 1VQGA 1U0LA 2NN6H 1AZPA 4IOCA 4K0KQ 3ITPA 3NP8A 1NAPA 1SBBB 1TWCH 3SEBA 3CCRA 4BA2I 2RBMA 1EOVA 4EQ5A 3EIVA 1WD0A 3FEWX 1IBKQ 3MHBA 2K5HA 4V190 2IHFA 4A3KB 4JI7Q 1K0RA 4JG2A 1LT3D 3T4AC 4JYAQ 2KQ3A 3MEHA 4M1UB 2PPBC 4G7ZC 1PZID 4UPAA 2EYFA 1S40A 4B3SQ 2B2VC 2I46A 5LMUL 1PZJD
chains in the Genus database with same CATH topology
1HUMA 1ENCA 1RKNA 3VA5A 4HSPA 3BS1A 1D5XC 4G57A 3PMFA 4H7BA 2E2HB 3HKZB 3TSSA 4Q0FA 2B2UC 2J4XA 1LTBD 3TP7A 2G9DA 3HRZC 3WOFA 2TSSA 1PRTC 5ELDA 2D2CC 4XQQA 4KY6A 1BNZA 1BOSA 2F0FA 2LY7A 4RWSC 2L11A 1TS4A 2R61A 2EYLA 2B2TA 3CRKC 1A2TA 3LNNA 3K5OA 2EZVA 1ENFA 4YIJA 4OGQC 2F0GA 2NB0A 5CV7A 2XRQD 4X3UA 4DK1A 2L9HA 2ENBA 3SK8A 1NSNS 2HDMA 2IT1A 2F0JA 3EQLC 2D9UA 1NR2A 1SNDA 4ZUJA 1I6VC 4WFN3 3QJYA 1PTOC 1GUNA 2B2UA 2FINB 3K57A 3IL8A 4NDXA 4I65A 2C9OA 1SNOA 1KLUD 5C44B 1EY8A 5IGDA 1GXDC 4H44C 5G3LD 4OO1H 4KV6A 4MN3A 4RGNA 5C3WA 1A15A 2A68D 4K5VA 3ERQA 3TN2A 3MXUA 5CGKA 3VYSA 1CHPD 3PO3B 4DGZA 4L63B 1J9OA 1I3QB 4RFBA 4TRDA 2E74C 2E2DC 1ZYRC 4QF4A 3NBIA 4IUPA 1EIHA 3MWYW 4IZ8A 5ELFA 2PCFB 2WP8J 3R93A 3HOXB 2DN8A 4K6LA 4E6IA 5JAVA 3M4YA 5BN5A 2QDBA 1FD7D 3HGBA 1F2ZA 2N55A 4C3HB 5DM73 2JXMB 2Z1CA 1XWEA 1SFOB 2SEBD 3P7JA 5LHY1 1LACA 1WVLA 3A54A 2KEDA 2RA4A 2XNAC 2JA8B 1TVXA 5K36H 3UI2A 3R3OA 1WTRA 3QO2A 1HPCA 1SYFA 2NTTA 1H9RA 2VXWA 2NN6I 3NE5B 1G8ZD 1H9SB 1I4XA 1MI2A 1TS2A 3FPUB 1BQQT 1G6ZA 3ZYYX 1VCIA 2A74C 4EQOA 3D8GA 1WCMB 3MXPA 5ELCA 3D4WA 1R4PB 5K5PA 4IUTA 1CZGA 2WAQB 2FHTA 3KLRA 5TSSA 2WB1B 3J7YW 1PZKD 4RKBA 1SYCA 2J0TD 3K7AB 2XSCA 1LV9A 4F7XA 1I6HB 2SDFA 1EYDA 1EYAA 1A3TA 2K01A 2C5CA 5D3DA 4A3GB 4XIGS 3BDOA 4KKSA 1DOLA 3DWAA 2ICEC 2F0TA 3QOLA 1HFNA 3S9WA 1SXTA 3I90A 1KTKA 2HUGA 5T1GA 2LS01 2NZ1D 4ZKBB 3R8BA 5LL6X 2EXZA 5M3MB 1SYGA 1EY9A 5FLXE 2K1BA 2K5WA 4XYQA 1TWFB 5HURA 1ZEQX 5C3EB 5CR3A 1FNWA 1PMRA 1GUTA 3HS0C 5CV6A 4HEDA 2NYZD 1ET9A 1GHKA 3VYTA 1PTOD 3V05A 1VMCA 5KIXA 2BE5D 4FF1A 2IX1A 1QJOA 2PO4A 3QOJA 2O2LD 5M9OA 1CQVA 2XWBB 4DFAA 1HXYD 4BY1B 1CA6A 4UAIA 2EY2A 3PV0A 2OF1A 5CMDA 3CU7A 1MSGA 1V1PB 4B9WA 3IAYA 1STEA 3NTIA 4KJNA 1H9MA 2M9VA 5IT9L 1ESFA 1HA6A 4RAUC 1SMYD 3AMUA 3W2DA 5EJWA 2F3WA 3VR3A 1J8IA 5FO9B 1A3UA 5J22A 1QNKA 4KY7A 2G9HD 5EGTA 1LTID 1SJED 1KDCA 4PQXA 1TKWB 2O4XA 1BF4A 3MXGA 1FR3A 1SEBD 2PZUA 4MIUA 2EOTA 2Q8RE 3S16B 1DOKA 3PUYA 2WACA 2K03A 2B8FA 2SNSA 1QE6A 4B08A 1JB3A 1E2ZA 1E2VA 1LT6D 4B9XA 1II3A 2Z4IA 4OL7A 1Y69U 1STNA 4JK1C 4I7ZC 1YNJC 4KJOA 5CBAE 4KTAA 1JR0D 3R2IA 2VUMB 1U4LA 1EEID 1PXUA 2ZXPA 1STAA 2B2WA 4XT1B 1HUNA 3RZOB 4OHJA 4QB4A 2B39A 1JWSD 3DWQA 1TS5A 3CRLC 2F4IA 4DAYA 4Q5VA 2K33A 4FF2A 3FKIB 3BVZA 1IW7C 3KBGA 1EFID 4RHRA 5KRUA 2EJGC 1TQOA 2PW5A 3SHLA 1Q12A 1OXVA 3J81E 3G7LA 1O78A 3HOWB 3Q23A 1I4QA 2A73B 2JP1A 1D2BA 4AYBB 2PZWA 3C1EA 3EA6A 2MUYA 5KGUA 5FO7B 4CKBA 5CV9A 2XVSA 5FO8B 5C6AA 3HOUB 5M3FB 2ZXOA 1EY4A 3H6MA 3TZUA 2EJMA 2F0SA 1F2LA 4HTHA 2E76C 2RDGA 3PUXA 1Q90A 4LAAA 1RD9D 1RODA 2L12A 5JEAG 2KVMA 1UAPA 3MZ5A 3D31A 2MPMA 3H3VC 5EPKA 1JE4A 1SYEA 2VNUD 1FYCA 1PRTD 4K2LA 3P20A 3TMEA 4IUNA 3NQTA 4ABNA 1U4RA 1RF2D 2PW7A 1R9TB 1S5BD 1TR5A 2J7ZA 5C5LA 1RTNA 4X3SA 1D1IA 1S5CD 5D65A 1E0BA 1DXMA 2EYPA 3GP7A 1I4HA 1CZWA 1B44D 2EPBA 3PIP3 5JVH3 2JA6B 4U68A 4C3HG 1LT4D 3R2TA 1AFPA 1M8AA 3G6JB 4KY5A 3A56A 5FKAC 3I4NB 3OHXC 4V0BA 3MFYA 5E1FA 3VR5A 3H94A 1Q3LA 1SDFA 1HQRD 1IYUA 4TKOB 1F77A 1RTOA 1I50B 3JAML 3GTJB 2ID0A 3HOVB 4KKTA 2OEOA 3OOCA 3MAQA 1ESRA 4OIJA 1H9SA 5CV5A 3I72A 4F87A 3FVQA 2BA0A 1O7YA 2R93B 4A3JB 4BBRB 3H91A 2FMCA 3X3NA 3S1QB 1EZ6A 1JWUD 1PTOH 1KABA 2EYJA 3KLSA 3NBHA 3GTQB 3J81L 1C8CA 2D62A 3X3MA 4ZLTF 1K83B 2LFNA 1F2YA 3T51B 4N9PA 1LO5D 1KLGD 1RDPD 1GUOA 5I9OA 5KEEA 1H9KA 2A6EC 2JEBI 4FF3A 2BA1A 4NP5A 2MHVA 4S3SA 3GO5A 4LJZC 2AQ3B 1VMPA 3BZDB 3K0YA 1XX8A 3A8KE 3ONAB 1O7LA 4DF7A 2WINB 4DAVA 1MGSA 2SOBA 5KNDA 4OO1G 3D4RA 1SSOA 3MTSA 2KA7A 1HRJA 1JORA 3MC0B 2F0KA 4P2CB 3NTHA 3URYA 1UNSA 3MXNA 3NWSA 2DY7A 4IALA 3I73A 1ENAA 5FK9C 2H4OA 4L8JA 4K8IA 2HDLA 1B2TA 1BXTA 4KN4C 4F88A 1U9RA 1EQVA 4GZYC 2F03A 3FMCA 3VYUA 3K59A 2K5DA 3K5MA 2DNCA 1JWMD 1I4RA 2NWGA 5C0XH 1GHJA 3DXJC 3SK6A 2EDGA 5CYUA 4FXGC 2JA7B 3SXHA 1IKMA 3NK9A 4K14A 1B9MA 3E0JA 3F2UA 1JC7A 1AP0A 2RVLA 4FYDA 2RSNA 2X6GA 4HAEA 3EROA 3TP6A 1DZ1A 5EKIA 1ICWA 2RDFA 1SNQA 5J39A 3HEJA 1GUGA 4X3TA 3RMHA 1PLFA 4TQUS 5C4HA 2B63B 5JEAH 1STHA 2A69D 3NQIA 1AZQA 3T53B 4XQNA 1JICA 3CQZB 2LMCB 3V96A 2VB3X 5JPMC 5IOCA 1B3AA 2QKIC 1NR4A 4EQNA 1LTAD 3J80L 1KDAA 1QNUA 3GTPB 4KD4A 1CTMA 5EKLA 3S17B 1SNPA 1BCPC 2H1EA 3TP8A 4F8MA 5JVG3 1WTWA 3GTOB 3FPPA 2BDNA 4IUVA 4DN4M 2PQEA 1RCVD 2NTSA 2ZT9C 3MVVA 1O7ZA 3I4LA 2EYOA 3M4OB 1S5FD 2QF7A 4G7HC 4K8JA 4O42A 5HGTA 3Q24A 5CV8A 3U9OA 4G4KA 1IW7D 2F0PA 2KHSA 1LTSD 3LWEA 2BOSA 5D14A 3IFDA 2AQ2B 2MJ8A 2EY1A 1LTTD 3FRPB 3T56B 1LT5D 3A8JE 1Z6HA 2F3VA 3ND9A 1DONA 2Q8TA 1MD2D 3IKJA 4KD3A 4QUCA 5KNCA 3J7AV 4OO1I 1TWCB 2IX3A 1EWHA 4FP5D 4Y7NB 1Z47A 2A69C 4HMIA 2B2VA 3C1FA 1Y1WB 4RCOA 3RLFA 1B53A 1DM0B 1F9QA 2K5QA 2F0DA 4RKLA 2SNMA 1ZYRD 1ONLA 1BO0A 1I4GA 3H0GB 1CI3M 4RA8A 1Y8NB 4EGVA 4N9TA 4WORA 5IODA 4KI0A 1IL8A 1G2TA 3K6OA 1V8QA 2F1MA 3EVQA 5IGCA 2F0WA 1EOTA 4A3FB 3RD4A 1BUVT 5KNBA 1YNJD 3NPPA 4FVMA 1WTVA 2R6GA 2F0LA 2BDOA 4HN7A 3ND8A 1TY2A 3D4DA 4LMQD 2EY6A 4ID6A 3GTLB 4C3IB 4ZAIA 1OXTA 3DUZA 4KMUC 2AWNA 5BN4A 2RDHA 2GA4B 4K6DA 1O80A 5EBDA 2F0UA 4ZKCB 4J6HA 4C1NK 1CA5A 2KJXA 5NUCA 1EY5A 3A55A 4UDUC 3PIO3 2L55A 1CK1A 2NVXB 4ZYSA 2O5IC 3V2TA 5BN3A 4XTCS 3J7AF 5DNFA 1RHPA 4HSVA 3K5LA 5E4WC 4IUUA 2HCCA 3WOEA 2JEAI 1BCPB 2E2JB 5E4XA 3KK7A 4R8IA 1B50A 3TDQA 2NVYB 3W3AA 4RGOS 1IYVA 1BR9A 1D1KA 1C4QA 1HTLD 4KK7A 5CC4A 3QWNA 1LTRD 1CM9A 4M8AA 3P1HA 3A8IE 5DAUA 3DHQA 5IGEA 4CGYB 1PRTF 3SR1A 3TP5A 1SNMA 2A6HD 1SJHD 3I8ZA 4DXGA 1TS3A 2F0IA 1EYCA 2F0VA 5ELBA 4EQPA 3M7NA 1EU4A 1R4QB 3WDNA 1CQFA 1S5DD 4A93B 3D6CA 2QCPX 4TSSA 3PUVA 3QG1A 4K5WA 1GOZA 2QEJC 5M5WB 3DEOA 3PUWA 2PNRC 1WTXA 1A6XA 2B2WC 2A68C 4BWGB 4R9WA 4IFDI 1Q8IA 3L7ZC 2IX0A 4BA1I 5CBEE 3HZXA 4J1MA 1UEAB 5EBCA 4IUQA 1TWAB 2CW0D 2IWHA 4XYOA 1UUPA 1F9PA 3VA7A 3AB9A 1KNEA 4ZRZA 3OMGA 4CBVA 5KYIA 2WKCA 3TZDA 4ZK9B 1MSHA 3AU7A 2F0HA 1VF7A 1JOKA 4JBWA 5IGGA 1PTOB 3L9AX 3K58A 2PYKA 5A2QE 4XXEA 4ULLA 2CVRA 3S15B 2A6ED 4CHTB 4C2MB 2IW3A 1MBYA 1TY0A 1TIID 4ZQ3A 3Q22A 3CHBD 5D3IB 4CKEA 3M7GA 3NHHA 5JJZA 2N88A 2O5JC 1JQYD 5ELEA 4J8QA 2K04A 2NVTB 1GJXA 3VYRA 2K28A 1IKLA 5I6YA 4A3IB 3CKIB 1ILPA 5I2YA 4K2KA 2NUCA 3SK5A 4H0LC 5EPJA 4X3KA 1TT2A 4FF4A 1I4PA 1V1PA 1ZXTA 1OXSC 3HOZB 1DCZA 3DEPA 2CQAA 3NUCA 1XTCD 3GV6A 4HCEA 3L3OC 3VR2A 2RKSA 5IIFA 5C0XI 1VDZA 3T16A 1F2MA 2OXPA 4RH6A 1EU3A 1X3QA 4RGMA 4HMJA 1LABA 1S4ZA 1G91A 4IURA 1NUCA 3A7LA 3GD7A 3DWPA 3GQBA 2XRSD 3M85A 2IJ0A 2EYMA 1TWGB 3BDCA 2R7ZB 5A2QL 3J80E 3NWTA 2F0NA 2PZTA 1EWCA 1PTOF 2K32A 3I91A 1JOOA 1OXUA 2F0MA 5G3LF 1DJRD 2DY8A 4DU9A 4IFDG 1SMYC 1A2UA 1SE2A 5K36G 2CHBD 3E5SA 1S5ED 4C3IG 3FDTA 1PFMA 1Q1BA 5JOBA 3EJIA 1WTOA 3QIAA 2K7VA 2YYZA 3BDLA 5JEAJ 1KAAA 3S2DB 3SDZA 1G2SA 3PO2B 1HCZA 4IQZA 1FGBD 5C4ZA 1SYDA 1L0XB 1PRTB 1V1OA 1M4VA 4C3JG 3OSOA 1KNAA 5DEHA 3NSWA 2JYOA 2TMPA 4DXFA 4PV1C 2HQEA 2EY5A 3C46A 3A7AB 2JE6I 2L5TA 4L6TB 3KF8A 4PMWA 1WTQA 1PYWD 4R8NA 1PFBA 1PDQA 3VR4A 2RSOA 2X69A 2I46A 4KKUA 1T5XD 3BVGA 4CJ2C 4FXKC 3QB3A 3BYTB 1W6KA 3OW7A 2NBFA 1GUWA 3E6ZX 4CKCA 5JPNC 1STYA 4XT3B 4RCNA 3M3YB 2NN6G 1LLRD 1DOMA 5DM63 1AEXA 2IL8A 2Z4HA 1X3PA 2QILA 1AN8A 1E2WA 3Q0AA 2MGSA 2VB2X 3TBIB 2K6AA 1EIGA 1OXXK 1KDBA 3SK4A 4BS9A 1QB5D 5C0XG 3OWFA 4NKLA 2FFKB 4ILWA 1AW7A 5M5YB 2KEEA 2B2YC 5IGFA 4RGTA 1BCPF 1W6JA 1CHQD 3I3CA 4IFDJ 4H13C 2PMZB 4EVOA 5J1ZA 2EE1A 3GTGB 4WRDA 1B4OA 2OT2A 2F0EA 2Z8LA 1DYQA 1HTPA 1QILA 2F0OA 3NXWA 4G7OC 2I07B 3SVMA 1U4MA 1EEFD 2K05A 1QOHA 3N6RA 2CW0C 4LK1C 1EZ8A 3HP3A 3S1MB 1U4PA 2A5HA 3C3LA 3S1NB 3D3RA 4ODGA 2XN9C 2E75C 4ZUIA 1Q1EA 4ME5A 1C48A 3OMCA 1WTPA 2XIWA 2V4DA 2BCOA 5EKKA 5T1IA 3N52A 4IN3A 3GV3A 1OO9B 5I6WA 3PUZA 1EY6A 2KCCA 2L0CA 5IGBA 5A35A 4C3JB 1B1ZA 4MHEA 1ILQA 3S14B 3EFXD 4KHZA 4XDXA 4A3BB 1SE4A 2Q8IB 1G291 3SE0A 1TU2B 2JSOA 1TWHB 2FJ2A 1Y8OB 1IHZA 4NW2A 4RHSA 2WKDA 2ZXRA 4DK0A 3BVMA 3DMUA 1CT1D 2F0QA 2E2IB 1Z7TA 2EVBA 3MA2B 2DNEA 5FOBB 3KUPA 3HG9A 4A3MB 1QG7A 3K5NA 1FNUA 1B9NA 1LTGD 2XWJB 3GTMB 1F9RA 1WD1A 1L0YB 4QMGA 4HR7B 2AUKA 5C5MA 1F9SA 1STBA 4U673 1XXGA 4NMZA 3LX0A 2A6HC 3OIPA 2R92B 1FNVA 5IT9E 1SAPA 2WV6D 3C2PA 4A3EB 3O13A 2RQXA 3OWEB 3KBXA 2YU9B 2KECA 1HQMC 2NVQB 1STGA 5E3FA 2BE5C 2AQ1B 1XYIA 4QUFA 4PMBA 3S1RB 4IFDH 1V43A 4C56C 3S2HB 1JCKB 5F2DA 1D5ZC 1GUSA 1K8OA 3KLSX 3HOYB 4FNFA 4FO2A 4WJWA 1CFMA 2KOLA 4BBSB 5C3XA 5C0XJ 3RUZA 4BY7B 2B8GA 2AWOA 2Y0SB 4XQJA 5C4XB 1RJTA 5COYA 4DNRB 2L4NA 2HCIA 2AUJD 5I9PA 4FXDA 3MFGA 2M2LA 2JA5B 5FLXL 2M00A 3H09A 3IFTA 5EQ0A 1BCPD 1H9JA 2MP1A 4C1NI 1SNCA 1X32A 1K8MA 3RZDB 4DA2A 1BDOA 4K5XA 4O1NA 3D6WA 2EJFC 5I2XA 4A3DB 1EY0A 2LKVA 5LL6S 5KYLA 1NCVA 1PFNA 4PMCA 1YNND 1VF5C 1D5MC 1SYBA 4HCSA 3U9SA 3BG3A 4Z9CB 1Y1VB 1JOQA 1T5EA 3T13A 3OPOA 3DM1A 3GTKB 1ML0D 4QCLA 2KUMA 3P75A 4CJ0B 2L1BA 1EQTA 1HA5A 1SE3A 5CORA 4PNYA 2R3ZA 4KN7C 2B2YA 1DD2A 5I4DA 1HHVA 3I4MB 5ISRA 1ET6A 5EPLA 5M5XB 4CJ1B 5CV4A 3VR6A 2B2TC 3OIQA 1EL0A 1ZKOA 1EY7A 5C4JB 1Y8PB 1A3VA 5AFWA 1HFGA 4KHVA 2IPKD 2KCNA 4QIWB 1BBXC 1YNNC 2FMMA 1QCBD 4OIKA 3NTKA 2D5DA 1QWYA 3BYYB 2EYHA 2WIIB 3I70A 2ICIA 1D6EC 3LWUA 4DNTB 4DAPA 3JAME 2X6LA 2NN6H 1AZPA 3ITPA 1NAPA 3NP8A 1SBBB 3SEBA 4BA2I 2RBMA 1WD0A 3FEWX 3MHBA 4V190 4A3KB 1LT3D 3T4AC 2KQ3A 3MEHA 4M1UB 2PPBC 4G7ZC 1PZID 2EYFA 2B2VC 3Q6SA 1PZJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KUM A;  4HAE A;  5E4X A;  1HUM A;  1U4L A;  3TN2 A;  4CJ0 B;  4R8I A;  1B50 A;  5EKI A;  1DZ1 A;  1ICW A;  2B2W A;  1GUW A;  2L1B A;  4XT1 B;  2CVR A;  1HUN A;  1EQT A;  5COR A;  4X3T A;  1J9O A;  4IUT A;  2J7Z A;  2B2V A;  2R3Z A;  1PLF A;  1RTN A;  4X3S A;  1WTP A;  1CM9 A;  2FHT A;  2XIW A;  1B53 A;  1XYI A;  1CA6 A;  2B2Y A;  4QUF A;  1F9Q A;  5T1I A;  3N52 A;  5D65 A;  1E0B A;  3GV3 A;  1HHV A;  4UAI A;  4XT3 B;  1AZQ A;  4IUP A;  1EIH A;  3I91 A;  1JIC A;  1BO0 A;  1VMP A;  2X6G A;  3MWY W;  5EPL A;  1XX8 A;  2B2T C;  3I8Z A;  4CJ1 B;  3ONA B;  2B2U C;  2DY8 A;  1B3A A;  1DOM A;  5CMD A;  1LV9 A;  1MSG A;  1NR4 A;  1EL0 A;  4RA8 A;  2EPB A;  5JJZ A;  3R93 A;  2N88 A;  2SDF A;  4MHE A;  4U68 A;  5AFW A;  1HFG A;  1MGS A;  1ILQ A;  2IL8 A;  2KOL A;  2K01 A;  1HA6 A;  1X3P A;  1M8A A;  4XDX A;  4RAU C;  1BNZ A;  1IL8 A;  2K04 A;  2MGS A;  4RWS C;  1SSO A;  1BBX C;  5EJW A;  3MTS A;  1G2T A;  2L11 A;  1J8I A;  1HRJ A;  1EIG A;  1DOL A;  3G7L A;  2K28 A;  1QNK A;  3FDT A;  2FJ2 A;  1HFN A;  1PFM A;  1IKL A;  2B2T A;  1RJT A;  2FMM A;  2H1E A;  2JP1 A;  3I90 A;  4NW2 A;  5COY A;  1WTO A;  1Q3L A;  1SDF A;  2L4N A;  2N55 A;  4OIK A;  2FFK B;  2HCI A;  2HUG A;  5T1G A;  1RTO A;  1WTW A;  2DY7 A;  2KEE A;  1EOT A;  2B2Y C;  2NZ1 D;  2BDN A;  2M2L A;  4IUV A;  4DN4 M;  1ILP A;  4ZKB B;  3I3C A;  5EPJ A;  5EQ0 A;  4X3K A;  1WTV A;  1G2S A;  2HDL A;  1BF4 A;  3KUP A;  1B2T A;  3DEO A;  1ESR A;  1QG7 A;  3P7J A;  4OIJ A;  1WTX A;  2B2W C;  2MP1 A;  4LMQ D;  1O7Z A;  4X3U A;  1WVL A;  1ZXT A;  1X32 A;  2K1B A;  2KED A;  4ZAI A;  4R9W A;  2L9H A;  2X6L A;  2EE1 A;  2EOT A;  1O7Y A;  2Q8R E;  3DEP A;  1F9R A;  2RA4 A;  1WD1 A;  3D6W A;  1DOK A;  1KNA A;  4O42 A;  1B4O A;  1TVX A;  2HDM A;  3UI2 A;  3H91 A;  1F2L A;  2K03 A;  3GV6 A;  1AZP A;  2JYO A;  5D14 A;  3LWE A;  2NWG A;  1NAP A;  1F9S A;  1O80 A;  2D9U A;  1QE6 A;  1ROD A;  5CBE E;  1NR2 A;  2L12 A;  4ZKC B;  3IFD A;  1WTR A;  3SVM A;  2MJ8 A;  1NCV A;  3QO2 A;  1PFN A;  2KVM A;  1CA5 A;  4IUQ A;  1U4M A;  4HED A;  2NYZ D;  2MPM A;  2K05 A;  1C8C A;  2B2U A;  2FIN B;  4HCS A;  2VXW A;  3IL8 A;  5EPK A;  1WTQ A;  1WD0 A;  1F9P A;  1SAP A;  1X3Q A;  1JE4 A;  4ZLT F;  1KNE A;  1PFB A;  1PDQ A;  1IKM A;  1MI2 A;  2RSO A;  3KBX A;  3FPU B;  3HP3 A;  5DNF A;  3F2U A;  1RHP A;  1G6Z A;  1DON A;  2Q8T A;  2X69 A;  4HSV A;  1S4Z A;  2KEC A;  3TZD A;  4ZK9 B;  1G91 A;  1MSH A;  4MN3 A;  4QUC A;  5E4W C;  1AP0 A;  1U4P A;  4CJ2 C;  3DM1 A;  4IUR A;  5CBA E;  2RVL A;  4IUU A;  1ML0 D;  1A15 A;  2HCC A;  2B2V C;  1U4R A;  2RSN A;  3Q6S A;  1VMC A; 
#chains in the Genus database with same CATH topology
 1HUM A;  1ENC A;  1RKN A;  4DV7 Q;  2YTV A;  3VA5 A;  4HSP A;  1I50 H;  5C3E G;  3BS1 A;  1D5X C;  4BBS H;  4GOP A;  4HJA A;  2CKZ B;  4G57 A;  3PMF A;  4Y7N H;  4H7B A;  2E2H B;  3HKZ B;  3RLO A;  1X9N A;  3TSS A;  4Q0F A;  2B2U C;  4C3J H;  2J4X A;  1LTB D;  3AYH B;  2V1C C;  3TP7 A;  4P71 A;  2G9D A;  3HRZ C;  3WOF A;  2TSS A;  1PRT C;  5ELD A;  2D2C C;  4BY1 G;  4XQQ A;  4KY6 A;  4A3M G;  1BNZ A;  1BOS A;  2F0F A;  2LY7 A;  4RWS C;  4A3K H;  3H0G H;  2L11 A;  1TS4 A;  2R61 A;  3HOU H;  5IP9 H;  2EYL A;  2B2T A;  3CRK C;  1TWG H;  1A2T A;  3LNN A;  3K5O A;  2EZV A;  1ENF A;  4YIJ A;  5M5W H;  1PH2 A;  3I55 A;  4OGQ C;  1S72 A;  2F0G A;  1NY4 A;  2NB0 A;  5CV7 A;  3CC2 A;  2XRQ D;  4X3U A;  4DK1 A;  2L9H A;  2ENB A;  5J3B A;  4A3E G;  3SK8 A;  4DR5 L;  1NSN S;  2HDM A;  3TS0 A;  2IT1 A;  5IWA L;  2F0J A;  3EQL C;  2D9U A;  1NR2 A;  1SND A;  4ZUJ A;  3CCU A;  1I6V C;  4WFN 3;  3CXC A;  3QJY A;  1C0A A;  1PTO C;  3L0O A;  1GUN A;  3PO3 G;  2GVA A;  2B2U A;  2FIN B;  4GKJ L;  3K57 A;  3IL8 A;  3TRE A;  2JA8 G;  2JQO A;  1GO3 E;  4NDX A;  4I65 A;  1C9O A;  2C9O A;  3FHW A;  1SNO A;  3CPF A;  1IBL L;  1B70 B;  4X62 Q;  1KLU D;  5C44 B;  2VQE Q;  3J7Z C;  1XPR A;  4OEL B;  2Q2U A;  1EY8 A;  5IGD A;  1GXD C;  1L2F A;  4H44 C;  5G3L D;  4LF6 Q;  4OO1 H;  4KV6 A;  4MN3 A;  3RZO H;  4LFB L;  4RGN A;  5C3W A;  3A5Z B;  1A15 A;  4POF A;  3Q8D A;  2A68 D;  2Z6K C;  4K5V A;  1DGS A;  3ERQ A;  3TN2 A;  4P72 A;  3MXU A;  5CGK A;  3VYS A;  1CHP D;  3PO3 B;  4DGZ A;  4L63 B;  1J9O A;  4GLA C;  2QEX A;  1I3Q B;  1I94 Q;  4BBR G;  4RFB A;  4TRD A;  2E74 C;  2E2D C;  3S24 A;  1ZYR C;  2E2J H;  4DR3 L;  4DUZ Q;  3UE1 A;  4QF4 A;  3NBI A;  4IUP A;  1EIH A;  2I5H A;  1Q46 A;  3MWY W;  4IZ8 A;  5ELF A;  2PCF B;  2WP8 J;  3UDI A;  2MNA A;  1P8L A;  4YWL A;  3R93 A;  3HOU G;  3HOX B;  1XNR L;  2DN8 A;  3NBH B;  4K6L A;  4BY1 H;  4E6I A;  5JAV A;  1VQP A;  1GKH A;  3M4Y A;  3GTJ H;  3T1H Q;  5BN5 A;  2K4K A;  2QDB A;  1FD7 D;  3HGB A;  1F2Z A;  1GVP A;  2N55 A;  4C3H B;  4IOA A;  5DM7 3;  2JXM B;  3HOX G;  4GNX A;  2Z1C A;  3K7A H;  4DV3 Q;  1Y1W H;  2HT1 A;  4A3L G;  1AE3 A;  1XWE A;  1SFO B;  1A62 A;  1G51 A;  2SEB D;  3P7J A;  2I5M X;  2AHO B;  5LHY 1;  1ASY A;  1LAC A;  1WVL A;  3A54 A;  3E0E A;  2KED A;  2MO0 A;  1NTG A;  2RA4 A;  3E9H A;  2OTL A;  2XNA C;  2JA8 B;  1TVX A;  5K36 H;  3UI2 A;  2CWP A;  4X66 Q;  3H3V H;  2E5L L;  4JI5 L;  1PH6 A;  2QA4 A;  5M3M G;  3R3O A;  1WTR A;  3QO2 A;  4HIM A;  1HPC A;  1SYF A;  4JI0 L;  2NTT A;  4A3M H;  1H9R A;  4DNI A;  2K50 A;  2VXW A;  1B3Q A;  2NN6 I;  4L5R C;  1NMF A;  3NE5 B;  1G8Z D;  5ELO A;  2VQF Q;  1H9S B;  1I4X A;  4JI2 L;  4UP9 A;  1MI2 A;  1TS2 A;  3FPU B;  2D0P A;  1BQQ T;  1G6Z A;  2L15 A;  2Y0S G;  3ZYY X;  1IBL Q;  1VCI A;  2A74 C;  4EQO A;  2R7Z H;  3D8G A;  3KOJ A;  1WCM B;  3MXP A;  4LW1 A;  4I7A A;  5ELC A;  3D4W A;  1R4P B;  5K5P A;  4IUT A;  1EQR A;  1CZG A;  2WAQ B;  1PHJ A;  2FHT A;  3KLR A;  5TSS A;  2WB1 B;  3J7Y W;  1PZK D;  4YCV A;  4RKB A;  1PYS B;  1SYC A;  5IYB G;  2J0T D;  3K7A B;  1PYB A;  1VQ6 A;  4DV5 Q;  2ALY B;  2XSC A;  2XTI A;  1LV9 A;  1HNW L;  4F7X A;  1I6H B;  4OON A;  2SDF A;  1EYD A;  1OTC A;  1U5K A;  4JOI C;  1EYA A;  1A3T A;  2K01 A;  2KCM A;  2C5C A;  5D3D A;  4DV1 L;  4C2M H;  3AQQ A;  2F4V L;  4A3G B;  4XIG S;  3CCS A;  3BDO A;  4KKS A;  3HOZ H;  1DOL A;  1L1O A;  3DWA A;  2ICE C;  1VQA A;  2F0T A;  3QOL A;  4O0A A;  1HFN A;  3UDF A;  3GTG H;  3S9W A;  1SXT A;  3I90 A;  1KTK A;  2HUG A;  5T1G A;  4B3R L;  1CKN B;  1JMC A;  2LS0 1;  4GKK Q;  2WAQ E;  3WWV A;  2NZ1 D;  3BU2 A;  4ZKB B;  3R8B A;  5LL6 X;  2EXZ A;  1KRS A;  5M3M B;  1SYG A;  1Y14 B;  3HKZ G;  1EY9 A;  5FLX E;  1W2B A;  3HOV H;  3A5U A;  3TEH B;  1FGU A;  4OX9 Q;  1L1O B;  5C4J H;  2K1B A;  2K5W A;  4XYQ A;  3J81 j;  3CME A;  1TWF B;  3CCL A;  5HUR A;  1ZEQ X;  3CQZ H;  5C3E B;  4A3F H;  3L2P A;  5CR3 A;  5LMN W;  1FNW A;  1PMR A;  1GUT A;  3CCE A;  3HS0 C;  5CV6 A;  1N9W A;  4HED A;  2NYZ D;  1KXL A;  1ET9 A;  1GHK A;  3PO3 H;  4R1J A;  4A3G H;  4DAY B;  1E7Z A;  5JJL A;  4MTK A;  3VYT A;  4NXM Q;  2JA9 A;  1PTO D;  4LUV A;  3V05 A;  1XMO L;  1VMC A;  5KIX A;  2BE5 D;  1YJN A;  4FF1 A;  1NE3 A;  2IX1 A;  1QJO A;  2PO4 A;  3QOJ A;  2O2L D;  1PV4 A;  5M9O A;  1CQV A;  2XWB B;  4DFA A;  3S14 H;  4IPH A;  1HXY D;  4BY1 B;  1CA6 A;  1I6H H;  4JI5 Q;  4A3B H;  4UAI A;  2EY2 A;  3PV0 A;  5IYD G;  4A3D G;  5IYC G;  1JJC B;  2OF1 A;  3RLN A;  4LF7 Q;  3CW2 C;  5CMD A;  3CU7 A;  1MSG A;  1V1P B;  4B9W A;  3IAY A;  1EUJ A;  4YWK A;  3G4S A;  1STE A;  3NTI A;  4KJN A;  1H9M A;  2M9V A;  5IT9 L;  1ESF A;  3DM3 A;  4NPS A;  2E2H H;  1HA6 A;  1I94 L;  3I4M G;  1B8A A;  4RAU C;  1SMY D;  2Q2H A;  3AMU A;  3W2D A;  2XGT A;  5EJW A;  4DKA C;  2F3W A;  3VR3 A;  1J8I A;  5FO9 B;  1A3U A;  2PQA A;  2HHH L;  4A4I A;  5J22 A;  4LNQ A;  2UUA L;  1QNK A;  4KY7 A;  2G9H D;  5EGT A;  3T1Y L;  1QUQ B;  1LTI D;  1SJE D;  1KDC A;  4PQX A;  1TKW B;  4JBJ A;  2Z0S A;  4PZ8 A;  2O4X A;  3S1R H;  1BF4 A;  4LFA Q;  3OTO Q;  3DLL A;  5FLM G;  1VQ8 A;  3MXG A;  1E1T A;  1FR3 A;  1SEB D;  5AJ3 L;  2PZU A;  2UUB L;  3HOY G;  4MIU A;  1PH7 A;  2EOT A;  2Q8R E;  3AFP A;  3HOY H;  3PSI A;  3K8A A;  3S16 B;  1DOK A;  3PUY A;  1V1Q A;  4QY7 A;  2WAC A;  2K03 A;  2B8F A;  2SNS A;  5M5X H;  1SN8 A;  1QE6 A;  4B08 A;  4ME3 A;  5M3F H;  3T1Y Q;  1VQH A;  1JB3 A;  1E2Z A;  1E2V A;  4P74 A;  1BBW A;  1LT6 D;  4B9X A;  2I0Q A;  1CSP A;  1II3 A;  1PH8 A;  2Z4I A;  4OL7 A;  1Y69 U;  1IBM L;  1FVI A;  1STN A;  1X56 A;  4JK1 C;  4I7Z C;  1QZH A;  2RCN A;  1YNJ C;  4KJO A;  1VQM A;  5CBA E;  4KTA A;  1JR0 D;  3R2I A;  1WTH A;  4JI1 Q;  4J15 A;  1TWH H;  2VUM B;  1U4L A;  1EEI D;  1PXU A;  2K52 A;  1STA A;  2B2W A;  2ZXP A;  2EIF A;  4XT1 B;  1HUN A;  3RZO B;  4OHJ A;  4AQY Q;  4QB4 A;  4C3I H;  2B39 A;  1JWS D;  3DWQ A;  3F2C A;  1TS5 A;  3CRL C;  1X55 A;  2F4I A;  1JJ2 A;  3ERS X;  4DAY A;  5C44 H;  4Q5V A;  2K33 A;  4FF2 A;  3FKI B;  3BVZ A;  5IE8 A;  1Y1W G;  4A3L H;  3PGZ A;  1IW7 C;  3KBG A;  1EFI D;  4RHR A;  5KRU A;  2EJG C;  1TQO A;  2PW5 A;  2OCE A;  2VZA A;  3SHL A;  1Q12 A;  1OXV A;  3J81 E;  3G7L A;  1O78 A;  3UE0 A;  4JI6 Q;  3Q23 A;  3HOW B;  4IPG A;  1I4Q A;  1UE1 A;  2A73 B;  2JP1 A;  1D2B A;  4AYB B;  2PZW A;  5GAD C;  3I56 A;  3KJO A;  3C1E A;  3EA6 A;  3E3X A;  2MUY A;  5KGU A;  2ASB A;  5FO7 B;  4L5S A;  4CKB A;  2N49 A;  4DV1 Q;  4JI7 L;  4JI3 Q;  5CV9 A;  2ZJP A;  5FJ8 G;  2XVS A;  3S2D H;  4EX5 A;  1VQ7 A;  4OX9 L;  5FO8 B;  5C6A A;  3HOU B;  5M3F B;  2ZXO A;  4HJ5 A;  1EY4 A;  3H6M A;  1NBW A;  3TZU A;  2EJM A;  1XMO Q;  2F0S A;  1F2L A;  4HTH A;  2E76 C;  4B3R Q;  2RDG A;  3PUX A;  2PI2 E;  1Q90 A;  2ZM6 L;  4LAA A;  1RD9 D;  1ROD A;  2BH2 A;  2L12 A;  4R4I A;  1VQ4 A;  5JEA G;  5JJI A;  2KVM A;  1UAP A;  1J5E L;  3MZ5 A;  3D31 A;  2MPM A;  3H3V C;  5EPK A;  4GN3 B;  1QVF A;  3I4N H;  1JE4 A;  1SYE A;  1M1K C;  1Q8K A;  2VNU D;  4N8X 1;  1FYC A;  2K75 A;  1PRT D;  4AIM A;  4K2L A;  3FP9 A;  4NB3 A;  3P20 A;  4IPD A;  3TME A;  4L5Q A;  4IUN A;  3NQT A;  3UDG A;  4ABN A;  3KDF B;  1U4R A;  4LFC Q;  1RF2 D;  2PW7 A;  1R9T B;  4GLV B;  1S5B D;  1TR5 A;  4APV A;  3U4Z A;  1HNX Q;  1VQO A;  1X3F A;  2J7Z A;  5C5L A;  1RTN A;  4X3S A;  1D1I A;  4A3B G;  1Y1V G;  3KLW A;  2CQO A;  1S5C D;  4YHH L;  4X66 L;  5D65 A;  1E0B A;  3W1G A;  1DXM A;  4GKK L;  2EYP A;  4H02 A;  1NJI C;  3GP7 A;  4LF5 L;  3S1Q H;  3U4V A;  2OQK A;  1P16 A;  1X6O A;  3H15 A;  1I4H A;  1CZW A;  1B44 D;  2EPB A;  2MQH A;  3PIP 3;  2R7Z G;  5JVH 3;  2JA6 B;  4U68 A;  4C3H G;  1LT4 D;  3R2T A;  1AFP A;  1M8A A;  3G6J B;  4KY5 A;  3A56 A;  2F4V Q;  5FKA C;  3I4N B;  3OHX C;  4V0B A;  3MFY A;  5E1F A;  3VR5 A;  1HNW Q;  3H94 A;  1Q3L A;  1SDF A;  1HQR D;  1IYU A;  4TKO B;  4AYB G;  1F77 A;  1RTO A;  1N32 L;  1I50 B;  3JAM L;  3GTJ B;  1XNQ Q;  5M3M H;  1HJP A;  2ID0 A;  3HOV B;  4KKT A;  2OEO A;  3OOC A;  3MAQ A;  1ESR A;  4OIJ A;  1H9S A;  5CV5 A;  1I3Q H;  3I72 A;  4F87 A;  4C3H H;  3FVQ A;  4DK6 C;  1YIT A;  2VW9 A;  2BA0 A;  1O7Y A;  2R93 B;  4A3J B;  4BBR B;  1CKM A;  3H91 A;  2NVY H;  2FMC A;  4JI6 L;  3X3N A;  3S1Q B;  1EZ6 A;  1JWU D;  5GRO A;  1PTO H;  1N8R C;  1KAB A;  1N33 Q;  2EYJ A;  3KLS A;  3NBH A;  1IBM Q;  3HOX H;  3GTQ B;  2VUM H;  4WJ4 A;  3J81 L;  1C8C A;  2D62 A;  4YCU A;  3X3M A;  4AH6 A;  4ZLT F;  1K83 B;  4HID A;  2LFN A;  1F2Y A;  1K0S A;  3T51 B;  1R9T H;  4N9P A;  1LO5 D;  1KLG D;  1RDP D;  1FL0 A;  1GUO A;  4QIW E;  2JA6 H;  4R4T A;  5I9O A;  2VQE L;  5KEE A;  1H9K A;  3HKZ E;  2UUC Q;  2A6E C;  2JEB I;  4QQB X;  2CFM A;  4WJ3 M;  4FF3 A;  4RMF A;  5HGQ A;  4R4Q A;  2BA1 A;  4IPC A;  4NP5 A;  2MHV A;  4S3S A;  3GO5 A;  4LJZ C;  1WCM H;  2AQ3 B;  1E22 A;  4LFC L;  1VMP A;  4N8F A;  3BZD B;  3K0Y A;  1XX8 A;  3A8K E;  3ONA B;  1O7L A;  1YZ6 A;  2HIV A;  3KYH C;  4DF7 A;  4LFB Q;  2WIN B;  1HR0 L;  3OW2 A;  4DAV A;  1VQ9 A;  1IYJ B;  1MGS A;  2JJQ A;  4DR6 L;  2SOB A;  5KND A;  5FJ8 H;  2UXC Q;  4OO1 G;  3D4R A;  1SSO A;  3MTS A;  1XNR Q;  2KA7 A;  1HRJ A;  1JOR A;  3MC0 B;  4QL5 A;  2EXD A;  2F0K A;  4P2C B;  3NTH A;  3URY A;  1UNS A;  3MXN A;  3NWS A;  1K3B C;  4IAL A;  2DY7 A;  3I73 A;  5BR8 L;  1ENA A;  5FK9 C;  2RHS B;  2H4O A;  2A19 A;  4HJ7 A;  4L8J A;  2Q2T A;  4K8I A;  2HDL A;  1B2T A;  1BXT A;  4KN4 C;  4F88 A;  1U9R A;  4OEM B;  4BY7 G;  1EQV A;  1K8A C;  4GZY C;  2F03 A;  3FMC A;  1MJE A;  3A74 A;  3VYU A;  3K59 A;  4BBS G;  2K5D A;  3K5M A;  2DNC A;  1JWM D;  5M5Y H;  2UXB L;  4DAM A;  2HHH Q;  2FXQ A;  1I4R A;  2NWG A;  5C0X H;  3HFZ B;  1GHJ A;  3DXJ C;  3SK6 A;  4OWW B;  3M4O H;  2EDG A;  1VQN A;  5CYU A;  4YCW A;  2OWO A;  4FXG C;  2JA7 B;  3SXH A;  3STB C;  4DR4 L;  1PVO A;  1IKM A;  1AH9 A;  1A8V A;  3NK9 A;  4K14 A;  1B9M A;  3E0J A;  3F2U A;  3STB D;  4LF7 L;  1X54 A;  1JC7 A;  3SGI A;  3KF6 B;  1AP0 A;  1PA6 A;  2RVL A;  4FYD A;  2QW7 A;  2RSN A;  2X6G A;  2YTY A;  4HAE A;  3ERO A;  3TP6 A;  1HNZ L;  1DZ1 A;  5EKI A;  1ICW A;  2RDF A;  1SNQ A;  5J39 A;  3HEJ A;  1GUG A;  4DV0 L;  4X3T A;  5GAH C;  3RMH A;  1PLF A;  4TQU S;  5C4H A;  2B63 B;  3S1M H;  5JEA H;  3JC6 6;  1STH A;  2A69 D;  3NQI A;  4DR1 L;  2Z6B A;  1AZQ A;  3T53 B;  1VQI A;  4XQN A;  1PH9 A;  1JIC A;  3CQZ B;  4JI1 L;  5C3E H;  3VDY A;  2LMC B;  3V96 A;  2VB3 X;  5JPM C;  5IOC A;  1B3A A;  2QKI C;  1NR4 A;  4EQN A;  2NVT H;  1LTA D;  4L5T A;  2QDL A;  4A75 A;  3J80 L;  1KDA A;  1QNU A;  3GTP B;  4B3T L;  4OWX B;  4A3I H;  4KD4 A;  1HR0 Q;  1CTM A;  5EKL A;  1VS0 A;  1HZA A;  3S17 B;  4DV5 L;  1SNP A;  1BCP C;  2H1E A;  3TP8 A;  4F8M A;  5JVG 3;  3PIO A;  1WTW A;  3GTO B;  3FPP A;  2BDN A;  4IUV A;  4DN4 M;  4MZ9 A;  2PQE A;  1RCV D;  2NTS A;  1SRO A;  4A3G G;  1N34 Q;  2PI2 A;  2ZT9 C;  3MVV A;  1O7Z A;  4PZ7 A;  5GAG C;  3I4L A;  3D0F A;  2HIX A;  2EYO A;  3M4O B;  1S5F D;  4OXP A;  2QF7 A;  4G7H C;  2CH4 A;  4K8J A;  4O42 A;  5HGT A;  3Q24 A;  5CV8 A;  3U9O A;  2OTJ A;  4G4K A;  4ZCK A;  1IW7 D;  2CH4 W;  2F0P A;  1LTS D;  2KHS A;  2BOS A;  3LWE A;  5D14 A;  5IYC H;  1YIJ A;  1XPU A;  3IFD A;  2WB1 G;  2AQ2 B;  2VY3 A;  2RCF A;  2MJ8 A;  2EY1 A;  1LTT D;  3FRP B;  3T56 B;  1BBU A;  1LT5 D;  1K73 C;  3M4P A;  4JCV E;  5IP9 G;  3A8J E;  3GTM H;  1WCM G;  1Z6H A;  2F3V A;  3ND9 A;  4JI4 L;  1DON A;  2Q8T A;  1MD2 D;  3Q6S A;  3IKJ A;  4KD3 A;  4QUC A;  5KNC A;  3RR5 A;  2JA5 G;  3HOW G;  3J7A V;  4OO1 I;  1TWC B;  1KL9 A;  1VQF A;  2IX3 A;  1EWH A;  4FP5 D;  5IY0 A;  4Y7N B;  1PH4 A;  1Z47 A;  2A69 C;  4HMI A;  3CCM A;  2UXC L;  4CDC C;  4GN4 B;  2B2V A;  2G5D A;  3JAM i;  3C1F A;  1Y1W B;  4X6A H;  4RCO A;  3RLF A;  1B53 A;  1DM0 B;  1F9Q A;  2K5Q A;  2F0D A;  4RKL A;  4GNX C;  2SNM A;  2DUD A;  1ZYR D;  1ONL A;  1BO0 A;  1Q86 C;  1I4G A;  3H0G B;  3TS2 A;  1CI3 M;  4RA8 A;  1Y8N B;  4EGV A;  4N9T A;  4MTN A;  1YI2 A;  1X3G A;  4WOR A;  3B6Y A;  5IOD A;  3S17 H;  4JBK A;  4KI0 A;  5FLM H;  3HOV G;  4P75 A;  3F1Z A;  1IL8 A;  1HR0 W;  3BZC A;  1G2T A;  4Y52 H;  3K6O A;  1V8Q A;  2F1M A;  4YY3 L;  3PO2 H;  4YY3 Q;  3EVQ A;  1RL2 A;  3IRB A;  1UE6 A;  5IGC A;  1O7I A;  2F0W A;  1Q81 C;  1EOT A;  4A3F B;  3RD4 A;  1Q7Y C;  1BUV T;  5KNB A;  1YNJ D;  3NPP A;  4FVM A;  1WTV A;  2R6G A;  2F0L A;  3I4M H;  4JV5 L;  2BDO A;  4HN7 A;  3ND8 A;  1TY2 A;  3D4D A;  4LMQ D;  2EY6 A;  4ID6 A;  3GTL B;  4C3I B;  4ZAI A;  1OXT A;  1XTD A;  3DUZ A;  4KMU C;  2AWN A;  1MKH A;  5BN4 A;  2ZTD A;  2RDH A;  2GA4 B;  3EBE A;  4K6D A;  5IYD H;  1O80 A;  3G48 A;  5EBD A;  1UEB A;  2F0U A;  4ZKC B;  4J6H A;  4C1N K;  2R93 H;  2AKW B;  2KJX A;  5NUC A;  1KAW A;  1EY5 A;  1CA5 A;  3A55 A;  4UDU C;  3PIO 3;  4LF8 Q;  4GKJ Q;  1SMX A;  4LF4 L;  2L55 A;  3ER0 A;  3NEN A;  1CK1 A;  2NVX B;  4ZYS A;  2O5I C;  4A76 A;  2R93 G;  3TRZ A;  3V2T A;  5BN3 A;  4XTC S;  3J7A F;  5DNF A;  1RHP A;  4HSV A;  1XNQ L;  3K5L A;  5E4W C;  4IUU A;  2HCC A;  3WOE A;  2JEA I;  2GVB A;  1BCP B;  2E2J B;  1I5F A;  5E4X A;  3KK7 A;  4R8I A;  2JN4 A;  1B50 A;  3TDQ A;  2NVY B;  3H0G G;  3W3A A;  4RGO S;  1IYV A;  2ES2 A;  1BR9 A;  1D1K A;  1C4Q A;  1HTL D;  2Z9H A;  4KK7 A;  4A93 G;  1CSQ A;  2ZTE A;  5CC4 A;  3QWN A;  1LTR D;  4OWT B;  1CM9 A;  4M8A A;  2DJF C;  2KEN A;  3P1H A;  3A8I E;  1PH1 A;  5DAU A;  1SE8 A;  3DHQ A;  5IGE A;  4CGY B;  3I4N G;  1PRT F;  1VQC A;  3SR1 A;  1FJG Q;  5E7N A;  3TP5 A;  1SNM A;  2A6H D;  1WOC A;  1SJH D;  3I8Z A;  3M3Y H;  1YJ9 A;  2YV5 A;  4A3C G;  4DXG A;  1TS3 A;  2F0I A;  1EQQ A;  5LMN Q;  3KDF A;  1EYC A;  5M3F G;  2F0V A;  5ELB A;  4EQP A;  4DUY Q;  4BXX H;  3M7N A;  2ATW A;  4UHV A;  1EU4 A;  1SLJ A;  1R4Q B;  3WDN A;  1CQF A;  1QVC A;  1S5D D;  2ZM6 Q;  1HNZ Q;  1YVC A;  3ULL A;  5IT9 c;  1VQL A;  4A93 B;  3D6C A;  2QCP X;  4HIO A;  4TSS A;  3PUV A;  3QG1 A;  4K5W A;  1GOZ A;  1UE7 A;  4IJL A;  3PIP A;  2B29 A;  3I4O A;  2N8N A;  1SRU A;  1YHB A;  2QEJ C;  2JA8 H;  5M5W B;  4B3T Q;  4JI3 L;  3K7U C;  2VS1 A;  3DEO A;  3PUW A;  2PNR C;  1WTX A;  1A6X A;  2B2W C;  1CUK A;  2RF4 A;  2A68 C;  2Q2I A;  4BWG B;  4R9W A;  4IFD I;  2F52 A;  4AYB E;  4LF9 L;  5LMU Q;  2PNH A;  3S1N H;  4B3S L;  1Q8I A;  3L7Z C;  2IX0 A;  2LSS A;  2UXB Q;  4BA1 I;  3J7A 5;  4JYA L;  5CBE E;  2NVQ H;  3HZX A;  1V9P A;  4J1M A;  1A0I A;  1UEA B;  4JI2 Q;  5EBC A;  4IUQ A;  1TWA B;  3T1H L;  2CW0 D;  2NZO A;  2BH8 A;  3PQI A;  4XYO A;  2IWH A;  4POG A;  1UUP A;  1F9P A;  3VA7 A;  3AB9 A;  1KNE A;  4ZRZ A;  4JV5 Q;  2B63 G;  3OMG A;  3TQY A;  4CBV A;  5KYI A;  2WKC A;  1XPO A;  3TZD A;  4ZK9 B;  1MSH A;  3AU7 A;  2F0H A;  2C35 B;  1VF7 A;  1JOK A;  4JBW A;  5IGG A;  2UXD L;  1G6P A;  1PTO B;  3L9A X;  1E1O A;  1C7Y A;  3K58 A;  2GN5 A;  4A3K G;  3S2H H;  2P5Z X;  2PYK A;  3CAM A;  5A2Q E;  4JPB W;  4DUZ L;  4XXE A;  4ULL A;  2KBN A;  4DV4 Q;  2CVR A;  3S15 B;  4LFA L;  2A6E D;  4A93 H;  4CHT B;  4C2M B;  3RN2 A;  2IW3 A;  1MBY A;  1GM5 A;  1D8L A;  1TY0 A;  1TII D;  4ZQ3 A;  3Q22 A;  3HOW H;  3CHB D;  5D3I B;  4CKE A;  1QVG A;  3M7G A;  3S16 H;  5HY6 A;  3NHH A;  2NZH A;  5JJZ A;  1KRT A;  2N88 A;  1L1O C;  1EFW A;  1T9H A;  1CKO A;  1IZ6 A;  2O5J C;  1JQY D;  5ELE A;  3J80 c;  4J8Q A;  2K04 A;  2NVT B;  1EIY B;  1EWI A;  1GJX A;  3VYR A;  4K0K L;  2K28 A;  1TXY A;  1IKL A;  4A3C H;  4TVA B;  5I6Y A;  4CDF C;  1MIU A;  4A3I B;  1B7Y B;  1LUZ A;  3CKI B;  1ILP A;  5I2Y A;  4K2K A;  4DR3 Q;  2NUC A;  4H0L C;  5EPJ A;  3SK5 A;  1IL2 A;  4X3K A;  1ICF B;  1TT2 A;  4FF4 A;  1I4P A;  1V1P A;  4MNO A;  1ZXT A;  1OXS C;  3HOZ B;  1UE5 A;  2A1A A;  4KHP L;  1DCZ A;  3DEP A;  4DV6 L;  3H3V I;  2CQA A;  4X64 L;  3NUC A;  1XTC D;  2Z6K A;  3MEF A;  3GV6 A;  4HCE A;  4NXM L;  1AE2 A;  3L3O C;  1YHQ A;  3VR2 A;  4LF9 Q;  2RKS A;  4X62 L;  5IIF A;  1VQK A;  3F8T A;  3W1B A;  5C0X I;  1VDZ A;  3T16 A;  1F2M A;  2OXP A;  3CCV A;  1A63 A;  4A3I G;  3ICE A;  4RH6 A;  1EU3 A;  1X3Q A;  3LGJ A;  4RGM A;  4HMJ A;  1BKB A;  4QGU A;  3PCO B;  3J81 c;  1KQS A;  3M4Q A;  1LAB A;  1S4Z A;  4PG3 A;  1G91 A;  4IUR A;  1NUC A;  3A7L A;  4GOP B;  3GD7 A;  3DWP A;  3GQB A;  2XRS D;  3M85 A;  3G71 A;  2IJ0 A;  2EYM A;  4DV2 Q;  3M9B A;  4BY7 H;  1TWG B;  3BDC A;  4GN5 A;  2R7Z B;  5A2Q L;  3K81 C;  4IJH A;  2CCZ A;  3J80 E;  4IO9 A;  3NWT A;  2F0N A;  4DUY L;  2PZT A;  3PF4 A;  2ZJR A;  1EWC A;  4DV7 L;  1PTO F;  2R92 G;  2K32 A;  3I91 A;  2JA5 H;  1JOO A;  1OXU A;  2F0M A;  5G3L F;  4LF5 Q;  1DJR D;  2DY8 A;  1L0W A;  4DU9 A;  3KF8 B;  4IFD G;  1SMY C;  3E9I A;  3EN2 A;  4NXN Q;  1A2U A;  2HD3 A;  1SE2 A;  1IBK L;  1X65 A;  5K36 G;  2CHB D;  1JE5 A;  4DV0 Q;  4A3D H;  2DJG C;  3ULJ A;  3K80 C;  3E5S A;  1S5E D;  4C3I G;  3FDT A;  1PFM A;  1S3O A;  4B3M Q;  1Q1B A;  5JOB A;  4B3M L;  3EJI A;  1Z9F A;  1WTO A;  3QIA A;  5C4X H;  2OQ0 A;  2K7V A;  2YYZ A;  3U50 C;  3BDL A;  2I5L X;  5JEA J;  1KAA A;  3S2D B;  2K5N A;  3SDZ A;  3PF5 A;  4HJ9 A;  1G2S A;  3PO2 B;  1YHA A;  2UU9 Q;  1HCZ A;  4IQZ A;  4DR4 Q;  1TWA H;  1FGB D;  5C4Z A;  1J5E Q;  2ZJQ A;  3OYY A;  1SYD A;  1L0X B;  1PRT B;  1V1O A;  3AFQ A;  1M4V A;  4C3J G;  3OSO A;  1KNA A;  5ELN A;  3NEM A;  5DEH A;  2QGQ A;  2JA6 G;  2RHQ B;  3NSW A;  2JYO A;  1K3R A;  2TMP A;  4CDE C;  1K8G A;  3NEL A;  4DR1 Q;  1PH5 A;  3GTO H;  1EIF A;  4DXF A;  5IP7 G;  1ASZ A;  4PV1 C;  4YHH Q;  1Q82 C;  2HQE A;  3KFU A;  2EY5 A;  3C46 A;  2E8G A;  3A7A B;  2JE6 I;  2L5T A;  4L6T B;  3KF8 A;  4PMW A;  1WTQ A;  1M90 C;  1LTL A;  1PYW D;  4R8N A;  1PFB A;  1PDQ A;  2K5V A;  3VR4 A;  2D0O A;  2RSO A;  4CDD C;  1YJW A;  4JBM A;  2X69 A;  4KKU A;  1T5X D;  3BVG A;  4CJ2 C;  2NVX H;  4FXK C;  4KLK A;  3QB3 A;  2KHI A;  3BYT B;  1W6K A;  3OW7 A;  2NBF A;  1GUW A;  3E6Z X;  4CKC A;  3F2D A;  5JPN C;  1TWF H;  4LF8 L;  4QJF A;  3CC7 A;  1STY A;  4XT3 B;  4RCN A;  3M3Y B;  2R7F A;  3QR8 A;  2NN6 G;  1LLR D;  1DOM A;  5DM6 3;  4A3J H;  2VQF L;  1AEX A;  1VQJ A;  3ZJY C;  2IL8 A;  2YTX A;  1K28 A;  2Z4H A;  1X3P A;  2QIL A;  1AN8 A;  3CP0 A;  2WB1 E;  1VQD A;  2ZTC A;  1E2W A;  3Q0A A;  2MGS A;  2VB2 X;  3TBI B;  2VUM G;  2K6A A;  3FKI H;  2KCT A;  2N3S A;  1EIG A;  1OXX K;  1KDB A;  3SK4 A;  4BS9 A;  5EAY A;  1QB5 D;  5C0X G;  3OWF A;  4DR2 Q;  4NKL A;  2FFK B;  4ILW A;  1AW7 A;  5M5Y B;  2KEE A;  4O2D A;  2B2Y C;  5IGF A;  3BZK A;  3KF6 A;  4RGT A;  1BCP F;  1W6J A;  1CHQ D;  3I3C A;  5IP7 H;  4X65 Q;  4IFD J;  4KHP Q;  4H13 C;  2PMZ B;  4EVO A;  3KJP A;  4DV3 L;  4R4C A;  5J1Z A;  3ULP A;  4DV2 L;  2EE1 A;  4JI8 L;  3CC4 A;  3GTG B;  4WRD A;  1B4O A;  2OT2 A;  1YNX A;  2F0E A;  2Z8L A;  4GNX B;  1DYQ A;  1HTP A;  1QIL A;  2F0O A;  3NXW A;  4GS3 A;  4G7O C;  2I07 B;  3SVM A;  1N36 Q;  5AJ3 Q;  1U4M A;  3W5O A;  1EEF D;  4DV4 L;  2K05 A;  2KHJ A;  4JVZ A;  1QOH A;  3RZD H;  1N36 L;  5GAE C;  3N6R A;  2CW0 C;  4LK1 C;  1EZ8 A;  3HP3 A;  2B63 H;  3S1M B;  4DR7 L;  1LM0 A;  1U4P A;  2A5H A;  1W3S A;  4FDB A;  3C3L A;  2PMZ E;  3J81 i;  1JJG A;  3S1N B;  2YU9 H;  3S15 H;  1HZC A;  3D3R A;  4ODG A;  3FKI G;  2XN9 C;  2E75 C;  2MO1 A;  4ZUI A;  2N78 A;  2F3I A;  4HJ8 A;  1Q1E A;  4ME5 A;  4R4O A;  1XMQ Q;  1PFS A;  1C48 A;  3OMC A;  1WTP A;  2XIW A;  2V4D A;  3CPW A;  2R92 H;  2BCO A;  5EKK A;  5T1I A;  3N52 A;  4IN3 A;  3GV3 A;  1OO9 B;  2LXJ A;  5I6W A;  3PUZ A;  2JA7 G;  1EY6 A;  2KCC A;  2L0C A;  5IGB A;  5A35 A;  4C3J B;  1B1Z A;  4MHE A;  1ILQ A;  3S14 B;  1K9M C;  3I7F A;  3EFX D;  4KHZ A;  1HZ9 A;  4HIK A;  1N34 L;  4XDX A;  1WI5 A;  4A3B B;  4A3E H;  4LWC A;  1HNX L;  3GDE A;  1SE4 A;  2Q8I B;  1N32 Q;  1G29 1;  3SE0 A;  2Y0S E;  1TU2 B;  2JSO A;  1TWH B;  3A0J A;  2FJ2 A;  3HKS A;  4PZ6 A;  2HQL A;  1Y8O B;  1IHZ A;  4BBR H;  4NW2 A;  4RHS A;  1SR3 A;  4DR5 Q;  1KC8 C;  2WKD A;  1VQE A;  2ZXR A;  4DK0 A;  3BVM A;  3DMU A;  1CT1 D;  2F0Q A;  2E2I B;  1Z7T A;  2EVB A;  3MA2 B;  1EYG A;  4LF6 L;  2DNE A;  5FOB B;  3KUP A;  3HG9 A;  4A3M B;  1J6Q A;  1QG7 A;  3K5N A;  1FNU A;  5L37 A;  1B9N A;  1LTG D;  1PH3 A;  2PQA B;  2XWJ B;  3GTM B;  1F9R A;  2CWA A;  1WD1 A;  1L0Y B;  4QMG A;  1FJG L;  4HR7 B;  2UXD Q;  1HH2 P;  2AUK A;  5IWA Q;  1K83 H;  5C5M A;  1F9S A;  1STB A;  2B3G A;  4U67 3;  1XXG A;  4NMZ A;  3LX0 A;  2A6H C;  3OIP A;  2R92 B;  1FNV A;  5IT9 E;  1WFQ A;  3MXN B;  1SAP A;  2WV6 D;  3C2P A;  1VQ5 A;  4A3E B;  3O13 A;  4LUO A;  2RQX A;  3OWE B;  3KBX A;  1H95 A;  5BR8 Q;  2YU9 B;  3GTP H;  2KEC A;  1HQM C;  2WAQ G;  5H1S E;  5LMN L;  4JW0 A;  1NMG A;  2VL6 A;  2NVQ B;  4JOI A;  3CCJ A;  2E2I H;  1Y1V H;  1STG A;  5E3F A;  4LF4 Q;  1WYD A;  1GD7 A;  2BE5 C;  2AQ1 B;  4DR6 Q;  1LYL A;  3U58 A;  1XYI A;  4QUF A;  4PMB A;  3CMA A;  3S1R B;  4IFD H;  1V43 A;  1JB7 A;  4C56 C;  3S2H B;  5FLX c;  3JAM c;  1SFO H;  1JCK B;  5F2D A;  1D5Z C;  1GUS A;  1K8O A;  3KLS X;  3HOY B;  3I2Z A;  2MFI A;  4FNF A;  5GQO A;  4FO2 A;  4WJW A;  1KIX A;  4RG1 A;  1CFM A;  4DR7 Q;  1JT8 A;  2KOL A;  1RIP A;  5C3X A;  4BBS B;  4DPG A;  3PO2 G;  5C0X J;  3RUZ A;  3F2B A;  3RN5 A;  4BY7 B;  2B8G A;  2AWO A;  2Y0S B;  5DLQ E;  2UUC L;  1QUQ A;  4XQJ A;  2R7D A;  5C4X B;  4UP7 A;  1RJT A;  1KD1 C;  1YBY A;  5COY A;  4YWM A;  4DNR B;  2L4N A;  2HCI A;  1HZB A;  2AUJ D;  5I9P A;  4FXD A;  1IXR A;  3MFG A;  2M2L A;  1CKN A;  2K14 A;  3AEV A;  4UY8 C;  5JJK A;  2JA5 B;  2M00 A;  3H09 A;  3IFT A;  4JI8 Q;  5FLX L;  5EQ0 A;  1BCP D;  2UU9 L;  2DGY A;  1QZG A;  1XMQ L;  1H9J A;  2MP1 A;  4C1N I;  4JI0 Q;  2LXK A;  1SNC A;  1X32 A;  1K8M A;  2AMC B;  2H5X A;  3CD6 A;  3RZD B;  4DA2 A;  1N33 L;  4X65 L;  1BDO A;  4K5X A;  4O1N A;  3D6W A;  2E5L Q;  4A3J G;  2EJF C;  2JA7 H;  5I2X A;  4A3D B;  1EY0 A;  2LKV A;  5LL6 S;  5KYL A;  4GLX A;  2IY5 B;  4AQY L;  1E3P A;  1KHI A;  1NCV A;  1PFN A;  4PMC A;  1YNN D;  1VF5 C;  4NXN L;  1D5M C;  1SYB A;  4HCS A;  3U9S A;  3BG3 A;  3OTO L;  4Z9C B;  1Y1V B;  1JOQ A;  1T5E A;  3T13 A;  3OPO A;  4A3F G;  2EQS A;  1D7Q A;  3DM1 A;  3GTK B;  1ML0 D;  4BXX G;  3UDX A;  4QCL A;  2KUM A;  1BVS A;  1MJC A;  3P75 A;  4CJ0 B;  2UUA Q;  1YEZ A;  2L1B A;  1X3E A;  1EQT A;  1HA5 A;  1SE3 A;  5COR A;  4PNY A;  2R3Z A;  4KN7 C;  1XJV A;  3CF5 A;  1WJJ A;  2B2Y A;  1DD2 A;  4JC0 A;  5I4D A;  3I4M B;  1HHV A;  2JK8 A;  5ISR A;  3GTL H;  1ET6 A;  5EPL A;  5CV4 A;  3VR6 A;  4CJ1 B;  2B2T C;  3OIQ A;  5M5X B;  3GTQ H;  4DR2 L;  1UWV A;  1EL0 A;  1ZKO A;  3RNU A;  2UUB Q;  1EY7 A;  3HOZ G;  1NNX A;  5C4J B;  1Y8P B;  4JI4 Q;  1A3V A;  5AFW A;  1HFG A;  4KHV A;  2IPK D;  3BJU A;  2KCN A;  4QIW B;  3CCQ A;  1BBX C;  1E24 A;  2A8V A;  2IHE A;  4LUZ A;  1YNN C;  5C44 G;  2FMM A;  5C4X G;  1QCB D;  4X64 Q;  4DV6 Q;  4OIK A;  3NTK A;  5IYB H;  2D5D A;  3J80 i;  4UP8 A;  4ALP A;  1QWY A;  3BYY B;  2EYH A;  2WII B;  3G6E A;  3I70 A;  3K0X A;  2ICI A;  1D6E C;  3LWU A;  4P73 A;  4DNT B;  4DAP A;  3JAM E;  2WFW A;  1VQB A;  3GTK H;  4DK3 C;  2X6L A;  4GOP C;  1MHW C;  1VQG A;  1U0L A;  2NN6 H;  1AZP A;  4IOC A;  4K0K Q;  3ITP A;  3NP8 A;  1NAP A;  1SBB B;  1TWC H;  3SEB A;  3CCR A;  4BA2 I;  2RBM A;  1EOV A;  4EQ5 A;  3EIV A;  1WD0 A;  3FEW X;  1IBK Q;  3MHB A;  2K5H A;  4V19 0;  2IHF A;  4A3K B;  4JI7 Q;  1K0R A;  4JG2 A;  1LT3 D;  3T4A C;  4JYA Q;  2KQ3 A;  3MEH A;  4M1U B;  2PPB C;  4G7Z C;  1PZI D;  4UPA A;  2EYF A;  1S40 A;  4B3S Q;  2B2V C;  2I46 A;  5LMU L;  1PZJ D; 
#chains in the Genus database with same CATH homology
 1HUM A;  1ENC A;  1RKN A;  3VA5 A;  4HSP A;  3BS1 A;  1D5X C;  4G57 A;  3PMF A;  4H7B A;  2E2H B;  3HKZ B;  3TSS A;  4Q0F A;  2B2U C;  2J4X A;  1LTB D;  3TP7 A;  2G9D A;  3HRZ C;  3WOF A;  2TSS A;  1PRT C;  5ELD A;  2D2C C;  4XQQ A;  4KY6 A;  1BNZ A;  1BOS A;  2F0F A;  2LY7 A;  4RWS C;  2L11 A;  1TS4 A;  2R61 A;  2EYL A;  2B2T A;  3CRK C;  1A2T A;  3LNN A;  3K5O A;  2EZV A;  1ENF A;  4YIJ A;  4OGQ C;  2F0G A;  2NB0 A;  5CV7 A;  2XRQ D;  4X3U A;  4DK1 A;  2L9H A;  2ENB A;  3SK8 A;  1NSN S;  2HDM A;  2IT1 A;  2F0J A;  3EQL C;  2D9U A;  1NR2 A;  1SND A;  4ZUJ A;  1I6V C;  4WFN 3;  3QJY A;  1PTO C;  1GUN A;  2B2U A;  2FIN B;  3K57 A;  3IL8 A;  4NDX A;  4I65 A;  2C9O A;  1SNO A;  1KLU D;  5C44 B;  1EY8 A;  5IGD A;  1GXD C;  4H44 C;  5G3L D;  4OO1 H;  4KV6 A;  4MN3 A;  4RGN A;  5C3W A;  1A15 A;  2A68 D;  4K5V A;  3ERQ A;  3TN2 A;  3MXU A;  5CGK A;  3VYS A;  1CHP D;  3PO3 B;  4DGZ A;  4L63 B;  1J9O A;  1I3Q B;  4RFB A;  4TRD A;  2E74 C;  2E2D C;  1ZYR C;  4QF4 A;  3NBI A;  4IUP A;  1EIH A;  3MWY W;  4IZ8 A;  5ELF A;  2PCF B;  2WP8 J;  3R93 A;  3HOX B;  2DN8 A;  4K6L A;  4E6I A;  5JAV A;  3M4Y A;  5BN5 A;  2QDB A;  1FD7 D;  3HGB A;  1F2Z A;  2N55 A;  4C3H B;  5DM7 3;  2JXM B;  2Z1C A;  1XWE A;  1SFO B;  2SEB D;  3P7J A;  5LHY 1;  1LAC A;  1WVL A;  3A54 A;  2KED A;  2RA4 A;  2XNA C;  2JA8 B;  1TVX A;  5K36 H;  3UI2 A;  3R3O A;  1WTR A;  3QO2 A;  1HPC A;  1SYF A;  2NTT A;  1H9R A;  2VXW A;  2NN6 I;  3NE5 B;  1G8Z D;  1H9S B;  1I4X A;  1MI2 A;  1TS2 A;  3FPU B;  1BQQ T;  1G6Z A;  3ZYY X;  1VCI A;  2A74 C;  4EQO A;  3D8G A;  1WCM B;  3MXP A;  5ELC A;  3D4W A;  1R4P B;  5K5P A;  4IUT A;  1CZG A;  2WAQ B;  2FHT A;  3KLR A;  5TSS A;  2WB1 B;  3J7Y W;  1PZK D;  4RKB A;  1SYC A;  2J0T D;  3K7A B;  2XSC A;  1LV9 A;  4F7X A;  1I6H B;  2SDF A;  1EYD A;  1EYA A;  1A3T A;  2K01 A;  2C5C A;  5D3D A;  4A3G B;  4XIG S;  3BDO A;  4KKS A;  1DOL A;  3DWA A;  2ICE C;  2F0T A;  3QOL A;  1HFN A;  3S9W A;  1SXT A;  3I90 A;  1KTK A;  2HUG A;  5T1G A;  2LS0 1;  2NZ1 D;  4ZKB B;  3R8B A;  5LL6 X;  2EXZ A;  5M3M B;  1SYG A;  1EY9 A;  5FLX E;  2K1B A;  2K5W A;  4XYQ A;  1TWF B;  5HUR A;  1ZEQ X;  5C3E B;  5CR3 A;  1FNW A;  1PMR A;  1GUT A;  3HS0 C;  5CV6 A;  4HED A;  2NYZ D;  1ET9 A;  1GHK A;  3VYT A;  1PTO D;  3V05 A;  1VMC A;  5KIX A;  2BE5 D;  4FF1 A;  2IX1 A;  1QJO A;  2PO4 A;  3QOJ A;  2O2L D;  5M9O A;  1CQV A;  2XWB B;  4DFA A;  1HXY D;  4BY1 B;  1CA6 A;  4UAI A;  2EY2 A;  3PV0 A;  2OF1 A;  5CMD A;  3CU7 A;  1MSG A;  1V1P B;  4B9W A;  3IAY A;  1STE A;  3NTI A;  4KJN A;  1H9M A;  2M9V A;  5IT9 L;  1ESF A;  1HA6 A;  4RAU C;  1SMY D;  3AMU A;  3W2D A;  5EJW A;  2F3W A;  3VR3 A;  1J8I A;  5FO9 B;  1A3U A;  5J22 A;  1QNK A;  4KY7 A;  2G9H D;  5EGT A;  1LTI D;  1SJE D;  1KDC A;  4PQX A;  1TKW B;  2O4X A;  1BF4 A;  3MXG A;  1FR3 A;  1SEB D;  2PZU A;  4MIU A;  2EOT A;  2Q8R E;  3S16 B;  1DOK A;  3PUY A;  2WAC A;  2K03 A;  2B8F A;  2SNS A;  1QE6 A;  4B08 A;  1JB3 A;  1E2Z A;  1E2V A;  1LT6 D;  4B9X A;  1II3 A;  2Z4I A;  4OL7 A;  1Y69 U;  1STN A;  4JK1 C;  4I7Z C;  1YNJ C;  4KJO A;  5CBA E;  4KTA A;  1JR0 D;  3R2I A;  2VUM B;  1U4L A;  1EEI D;  1PXU A;  2ZXP A;  1STA A;  2B2W A;  4XT1 B;  1HUN A;  3RZO B;  4OHJ A;  4QB4 A;  2B39 A;  1JWS D;  3DWQ A;  1TS5 A;  3CRL C;  2F4I A;  4DAY A;  4Q5V A;  2K33 A;  4FF2 A;  3FKI B;  3BVZ A;  1IW7 C;  3KBG A;  1EFI D;  4RHR A;  5KRU A;  2EJG C;  1TQO A;  2PW5 A;  3SHL A;  1Q12 A;  1OXV A;  3J81 E;  3G7L A;  1O78 A;  3HOW B;  3Q23 A;  1I4Q A;  2A73 B;  2JP1 A;  1D2B A;  4AYB B;  2PZW A;  3C1E A;  3EA6 A;  2MUY A;  5KGU A;  5FO7 B;  4CKB A;  5CV9 A;  2XVS A;  5FO8 B;  5C6A A;  3HOU B;  5M3F B;  2ZXO A;  1EY4 A;  3H6M A;  3TZU A;  2EJM A;  2F0S A;  1F2L A;  4HTH A;  2E76 C;  2RDG A;  3PUX A;  1Q90 A;  4LAA A;  1RD9 D;  1ROD A;  2L12 A;  5JEA G;  2KVM A;  1UAP A;  3MZ5 A;  3D31 A;  2MPM A;  3H3V C;  5EPK A;  1JE4 A;  1SYE A;  2VNU D;  1FYC A;  1PRT D;  4K2L A;  3P20 A;  3TME A;  4IUN A;  3NQT A;  4ABN A;  1U4R A;  1RF2 D;  2PW7 A;  1R9T B;  1S5B D;  1TR5 A;  2J7Z A;  5C5L A;  1RTN A;  4X3S A;  1D1I A;  1S5C D;  5D65 A;  1E0B A;  1DXM A;  2EYP A;  3GP7 A;  1I4H A;  1CZW A;  1B44 D;  2EPB A;  3PIP 3;  5JVH 3;  2JA6 B;  4U68 A;  4C3H G;  1LT4 D;  3R2T A;  1AFP A;  1M8A A;  3G6J B;  4KY5 A;  3A56 A;  5FKA C;  3I4N B;  3OHX C;  4V0B A;  3MFY A;  5E1F A;  3VR5 A;  3H94 A;  1Q3L A;  1SDF A;  1HQR D;  1IYU A;  4TKO B;  1F77 A;  1RTO A;  1I50 B;  3JAM L;  3GTJ B;  2ID0 A;  3HOV B;  4KKT A;  2OEO A;  3OOC A;  3MAQ A;  1ESR A;  4OIJ A;  1H9S A;  5CV5 A;  3I72 A;  4F87 A;  3FVQ A;  2BA0 A;  1O7Y A;  2R93 B;  4A3J B;  4BBR B;  3H91 A;  2FMC A;  3X3N A;  3S1Q B;  1EZ6 A;  1JWU D;  1PTO H;  1KAB A;  2EYJ A;  3KLS A;  3NBH A;  3GTQ B;  3J81 L;  1C8C A;  2D62 A;  3X3M A;  4ZLT F;  1K83 B;  2LFN A;  1F2Y A;  3T51 B;  4N9P A;  1LO5 D;  1KLG D;  1RDP D;  1GUO A;  5I9O A;  5KEE A;  1H9K A;  2A6E C;  2JEB I;  4FF3 A;  2BA1 A;  4NP5 A;  2MHV A;  4S3S A;  3GO5 A;  4LJZ C;  2AQ3 B;  1VMP A;  3BZD B;  3K0Y A;  1XX8 A;  3A8K E;  3ONA B;  1O7L A;  4DF7 A;  2WIN B;  4DAV A;  1MGS A;  2SOB A;  5KND A;  4OO1 G;  3D4R A;  1SSO A;  3MTS A;  2KA7 A;  1HRJ A;  1JOR A;  3MC0 B;  2F0K A;  4P2C B;  3NTH A;  3URY A;  1UNS A;  3MXN A;  3NWS A;  2DY7 A;  4IAL A;  3I73 A;  1ENA A;  5FK9 C;  2H4O A;  4L8J A;  4K8I A;  2HDL A;  1B2T A;  1BXT A;  4KN4 C;  4F88 A;  1U9R A;  1EQV A;  4GZY C;  2F03 A;  3FMC A;  3VYU A;  3K59 A;  2K5D A;  3K5M A;  2DNC A;  1JWM D;  1I4R A;  2NWG A;  5C0X H;  1GHJ A;  3DXJ C;  3SK6 A;  2EDG A;  5CYU A;  4FXG C;  2JA7 B;  3SXH A;  1IKM A;  3NK9 A;  4K14 A;  1B9M A;  3E0J A;  3F2U A;  1JC7 A;  1AP0 A;  2RVL A;  4FYD A;  2RSN A;  2X6G A;  4HAE A;  3ERO A;  3TP6 A;  1DZ1 A;  5EKI A;  1ICW A;  2RDF A;  1SNQ A;  5J39 A;  3HEJ A;  1GUG A;  4X3T A;  3RMH A;  1PLF A;  4TQU S;  5C4H A;  2B63 B;  5JEA H;  1STH A;  2A69 D;  3NQI A;  1AZQ A;  3T53 B;  4XQN A;  1JIC A;  3CQZ B;  2LMC B;  3V96 A;  2VB3 X;  5JPM C;  5IOC A;  1B3A A;  2QKI C;  1NR4 A;  4EQN A;  1LTA D;  3J80 L;  1KDA A;  1QNU A;  3GTP B;  4KD4 A;  1CTM A;  5EKL A;  3S17 B;  1SNP A;  1BCP C;  2H1E A;  3TP8 A;  4F8M A;  5JVG 3;  1WTW A;  3GTO B;  3FPP A;  2BDN A;  4IUV A;  4DN4 M;  2PQE A;  1RCV D;  2NTS A;  2ZT9 C;  3MVV A;  1O7Z A;  3I4L A;  2EYO A;  3M4O B;  1S5F D;  2QF7 A;  4G7H C;  4K8J A;  4O42 A;  5HGT A;  3Q24 A;  5CV8 A;  3U9O A;  4G4K A;  1IW7 D;  2F0P A;  2KHS A;  1LTS D;  3LWE A;  2BOS A;  5D14 A;  3IFD A;  2AQ2 B;  2MJ8 A;  2EY1 A;  1LTT D;  3FRP B;  3T56 B;  1LT5 D;  3A8J E;  1Z6H A;  2F3V A;  3ND9 A;  1DON A;  2Q8T A;  1MD2 D;  3IKJ A;  4KD3 A;  4QUC A;  5KNC A;  3J7A V;  4OO1 I;  1TWC B;  2IX3 A;  1EWH A;  4FP5 D;  4Y7N B;  1Z47 A;  2A69 C;  4HMI A;  2B2V A;  3C1F A;  1Y1W B;  4RCO A;  3RLF A;  1B53 A;  1DM0 B;  1F9Q A;  2K5Q A;  2F0D A;  4RKL A;  2SNM A;  1ZYR D;  1ONL A;  1BO0 A;  1I4G A;  3H0G B;  1CI3 M;  4RA8 A;  1Y8N B;  4EGV A;  4N9T A;  4WOR A;  5IOD A;  4KI0 A;  1IL8 A;  1G2T A;  3K6O A;  1V8Q A;  2F1M A;  3EVQ A;  5IGC A;  2F0W A;  1EOT A;  4A3F B;  3RD4 A;  1BUV T;  5KNB A;  1YNJ D;  3NPP A;  4FVM A;  1WTV A;  2R6G A;  2F0L A;  2BDO A;  4HN7 A;  3ND8 A;  1TY2 A;  3D4D A;  4LMQ D;  2EY6 A;  4ID6 A;  3GTL B;  4C3I B;  4ZAI A;  1OXT A;  3DUZ A;  4KMU C;  2AWN A;  5BN4 A;  2RDH A;  2GA4 B;  4K6D A;  1O80 A;  5EBD A;  2F0U A;  4ZKC B;  4J6H A;  4C1N K;  1CA5 A;  2KJX A;  5NUC A;  1EY5 A;  3A55 A;  4UDU C;  3PIO 3;  2L55 A;  1CK1 A;  2NVX B;  4ZYS A;  2O5I C;  3V2T A;  5BN3 A;  4XTC S;  3J7A F;  5DNF A;  1RHP A;  4HSV A;  3K5L A;  5E4W C;  4IUU A;  2HCC A;  3WOE A;  2JEA I;  1BCP B;  2E2J B;  5E4X A;  3KK7 A;  4R8I A;  1B50 A;  3TDQ A;  2NVY B;  3W3A A;  4RGO S;  1IYV A;  1BR9 A;  1D1K A;  1C4Q A;  1HTL D;  4KK7 A;  5CC4 A;  3QWN A;  1LTR D;  1CM9 A;  4M8A A;  3P1H A;  3A8I E;  5DAU A;  3DHQ A;  5IGE A;  4CGY B;  1PRT F;  3SR1 A;  3TP5 A;  1SNM A;  2A6H D;  1SJH D;  3I8Z A;  4DXG A;  1TS3 A;  2F0I A;  1EYC A;  2F0V A;  5ELB A;  4EQP A;  3M7N A;  1EU4 A;  1R4Q B;  3WDN A;  1CQF A;  1S5D D;  4A93 B;  3D6C A;  2QCP X;  4TSS A;  3PUV A;  3QG1 A;  4K5W A;  1GOZ A;  2QEJ C;  5M5W B;  3DEO A;  3PUW A;  2PNR C;  1WTX A;  1A6X A;  2B2W C;  2A68 C;  4BWG B;  4R9W A;  4IFD I;  1Q8I A;  3L7Z C;  2IX0 A;  4BA1 I;  5CBE E;  3HZX A;  4J1M A;  1UEA B;  5EBC A;  4IUQ A;  1TWA B;  2CW0 D;  2IWH A;  4XYO A;  1UUP A;  1F9P A;  3VA7 A;  3AB9 A;  1KNE A;  4ZRZ A;  3OMG A;  4CBV A;  5KYI A;  2WKC A;  3TZD A;  4ZK9 B;  1MSH A;  3AU7 A;  2F0H A;  1VF7 A;  1JOK A;  4JBW A;  5IGG A;  1PTO B;  3L9A X;  3K58 A;  2PYK A;  5A2Q E;  4XXE A;  4ULL A;  2CVR A;  3S15 B;  2A6E D;  4CHT B;  4C2M B;  2IW3 A;  1MBY A;  1TY0 A;  1TII D;  4ZQ3 A;  3Q22 A;  3CHB D;  5D3I B;  4CKE A;  3M7G A;  3NHH A;  5JJZ A;  2N88 A;  2O5J C;  1JQY D;  5ELE A;  4J8Q A;  2K04 A;  2NVT B;  1GJX A;  3VYR A;  2K28 A;  1IKL A;  5I6Y A;  4A3I B;  3CKI B;  1ILP A;  5I2Y A;  4K2K A;  2NUC A;  3SK5 A;  4H0L C;  5EPJ A;  4X3K A;  1TT2 A;  4FF4 A;  1I4P A;  1V1P A;  1ZXT A;  1OXS C;  3HOZ B;  1DCZ A;  3DEP A;  2CQA A;  3NUC A;  1XTC D;  3GV6 A;  4HCE A;  3L3O C;  3VR2 A;  2RKS A;  5IIF A;  5C0X I;  1VDZ A;  3T16 A;  1F2M A;  2OXP A;  4RH6 A;  1EU3 A;  1X3Q A;  4RGM A;  4HMJ A;  1LAB A;  1S4Z A;  1G91 A;  4IUR A;  1NUC A;  3A7L A;  3GD7 A;  3DWP A;  3GQB A;  2XRS D;  3M85 A;  2IJ0 A;  2EYM A;  1TWG B;  3BDC A;  2R7Z B;  5A2Q L;  3J80 E;  3NWT A;  2F0N A;  2PZT A;  1EWC A;  1PTO F;  2K32 A;  3I91 A;  1JOO A;  1OXU A;  2F0M A;  5G3L F;  1DJR D;  2DY8 A;  4DU9 A;  4IFD G;  1SMY C;  1A2U A;  1SE2 A;  5K36 G;  2CHB D;  3E5S A;  1S5E D;  4C3I G;  3FDT A;  1PFM A;  1Q1B A;  5JOB A;  3EJI A;  1WTO A;  3QIA A;  2K7V A;  2YYZ A;  3BDL A;  5JEA J;  1KAA A;  3S2D B;  3SDZ A;  1G2S A;  3PO2 B;  1HCZ A;  4IQZ A;  1FGB D;  5C4Z A;  1SYD A;  1L0X B;  1PRT B;  1V1O A;  1M4V A;  4C3J G;  3OSO A;  1KNA A;  5DEH A;  3NSW A;  2JYO A;  2TMP A;  4DXF A;  4PV1 C;  2HQE A;  2EY5 A;  3C46 A;  3A7A B;  2JE6 I;  2L5T A;  4L6T B;  3KF8 A;  4PMW A;  1WTQ A;  1PYW D;  4R8N A;  1PFB A;  1PDQ A;  3VR4 A;  2RSO A;  2X69 A;  2I46 A;  4KKU A;  1T5X D;  3BVG A;  4CJ2 C;  4FXK C;  3QB3 A;  3BYT B;  1W6K A;  3OW7 A;  2NBF A;  1GUW A;  3E6Z X;  4CKC A;  5JPN C;  1STY A;  4XT3 B;  4RCN A;  3M3Y B;  2NN6 G;  1LLR D;  1DOM A;  5DM6 3;  1AEX A;  2IL8 A;  2Z4H A;  1X3P A;  2QIL A;  1AN8 A;  1E2W A;  3Q0A A;  2MGS A;  2VB2 X;  3TBI B;  2K6A A;  1EIG A;  1OXX K;  1KDB A;  3SK4 A;  4BS9 A;  1QB5 D;  5C0X G;  3OWF A;  4NKL A;  2FFK B;  4ILW A;  1AW7 A;  5M5Y B;  2KEE A;  2B2Y C;  5IGF A;  4RGT A;  1BCP F;  1W6J A;  1CHQ D;  3I3C A;  4IFD J;  4H13 C;  2PMZ B;  4EVO A;  5J1Z A;  2EE1 A;  3GTG B;  4WRD A;  1B4O A;  2OT2 A;  2F0E A;  2Z8L A;  1DYQ A;  1HTP A;  1QIL A;  2F0O A;  3NXW A;  4G7O C;  2I07 B;  3SVM A;  1U4M A;  1EEF D;  2K05 A;  1QOH A;  3N6R A;  2CW0 C;  4LK1 C;  1EZ8 A;  3HP3 A;  3S1M B;  1U4P A;  2A5H A;  3C3L A;  3S1N B;  3D3R A;  4ODG A;  2XN9 C;  2E75 C;  4ZUI A;  1Q1E A;  4ME5 A;  1C48 A;  3OMC A;  1WTP A;  2XIW A;  2V4D A;  2BCO A;  5EKK A;  5T1I A;  3N52 A;  4IN3 A;  3GV3 A;  1OO9 B;  5I6W A;  3PUZ A;  1EY6 A;  2KCC A;  2L0C A;  5IGB A;  5A35 A;  4C3J B;  1B1Z A;  4MHE A;  1ILQ A;  3S14 B;  3EFX D;  4KHZ A;  4XDX A;  4A3B B;  1SE4 A;  2Q8I B;  1G29 1;  3SE0 A;  1TU2 B;  2JSO A;  1TWH B;  2FJ2 A;  1Y8O B;  1IHZ A;  4NW2 A;  4RHS A;  2WKD A;  2ZXR A;  4DK0 A;  3BVM A;  3DMU A;  1CT1 D;  2F0Q A;  2E2I B;  1Z7T A;  2EVB A;  3MA2 B;  2DNE A;  5FOB B;  3KUP A;  3HG9 A;  4A3M B;  1QG7 A;  3K5N A;  1FNU A;  1B9N A;  1LTG D;  2XWJ B;  3GTM B;  1F9R A;  1WD1 A;  1L0Y B;  4QMG A;  4HR7 B;  2AUK A;  5C5M A;  1F9S A;  1STB A;  4U67 3;  1XXG A;  4NMZ A;  3LX0 A;  2A6H C;  3OIP A;  2R92 B;  1FNV A;  5IT9 E;  1SAP A;  2WV6 D;  3C2P A;  4A3E B;  3O13 A;  2RQX A;  3OWE B;  3KBX A;  2YU9 B;  2KEC A;  1HQM C;  2NVQ B;  1STG A;  5E3F A;  2BE5 C;  2AQ1 B;  1XYI A;  4QUF A;  4PMB A;  3S1R B;  4IFD H;  1V43 A;  4C56 C;  3S2H B;  1JCK B;  5F2D A;  1D5Z C;  1GUS A;  1K8O A;  3KLS X;  3HOY B;  4FNF A;  4FO2 A;  4WJW A;  1CFM A;  2KOL A;  4BBS B;  5C3X A;  5C0X J;  3RUZ A;  4BY7 B;  2B8G A;  2AWO A;  2Y0S B;  4XQJ A;  5C4X B;  1RJT A;  5COY A;  4DNR B;  2L4N A;  2HCI A;  2AUJ D;  5I9P A;  4FXD A;  3MFG A;  2M2L A;  2JA5 B;  5FLX L;  2M00 A;  3H09 A;  3IFT A;  5EQ0 A;  1BCP D;  1H9J A;  2MP1 A;  4C1N I;  1SNC A;  1X32 A;  1K8M A;  3RZD B;  4DA2 A;  1BDO A;  4K5X A;  4O1N A;  3D6W A;  2EJF C;  5I2X A;  4A3D B;  1EY0 A;  2LKV A;  5LL6 S;  5KYL A;  1NCV A;  1PFN A;  4PMC A;  1YNN D;  1VF5 C;  1D5M C;  1SYB A;  4HCS A;  3U9S A;  3BG3 A;  4Z9C B;  1Y1V B;  1JOQ A;  1T5E A;  3T13 A;  3OPO A;  3DM1 A;  3GTK B;  1ML0 D;  4QCL A;  2KUM A;  3P75 A;  4CJ0 B;  2L1B A;  1EQT A;  1HA5 A;  1SE3 A;  5COR A;  4PNY A;  2R3Z A;  4KN7 C;  2B2Y A;  1DD2 A;  5I4D A;  1HHV A;  3I4M B;  5ISR A;  1ET6 A;  5EPL A;  5M5X B;  4CJ1 B;  5CV4 A;  3VR6 A;  2B2T C;  3OIQ A;  1EL0 A;  1ZKO A;  1EY7 A;  5C4J B;  1Y8P B;  1A3V A;  5AFW A;  1HFG A;  4KHV A;  2IPK D;  2KCN A;  4QIW B;  1BBX C;  1YNN C;  2FMM A;  1QCB D;  4OIK A;  3NTK A;  2D5D A;  1QWY A;  3BYY B;  2EYH A;  2WII B;  3I70 A;  2ICI A;  1D6E C;  3LWU A;  4DNT B;  4DAP A;  3JAM E;  2X6L A;  2NN6 H;  1AZP A;  3ITP A;  1NAP A;  3NP8 A;  1SBB B;  3SEB A;  4BA2 I;  2RBM A;  1WD0 A;  3FEW X;  3MHB A;  4V19 0;  4A3K B;  1LT3 D;  3T4A C;  2KQ3 A;  3MEH A;  4M1U B;  2PPB C;  4G7Z C;  1PZI D;  2EYF A;  2B2V C;  3Q6S A;  1PZJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...