4QQBX

Structural basis for the assembly of the sxl-unr translation regulatory complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
GAMATRETGIIEKLLHSYGFIQCCERQARLFFHFSQFSGNIDHLKIGDPVEFEMTYDRRTGKPIASQVSKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Tranlation/rna
molecule keywords msl2 mRNA
publication title Structural basis for the assembly of the Sxl-Unr translation regulatory complex.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 12
structure length 72
sequence length 72
chains with identical sequence Y
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qqbX01
1AE2A 3TREA 5M3MH 4A3DG 2Q2IA 2JA7G 2I0QA 3EBEA 5IP9G 2YTYA 1OXXK 4C2MH 2JA5H 3H3VH 4BY1H 3HOYG 3UDFA 2LXKA 4P71A 1N36Q 3M85A 2ZTDA 2UXCL 1QZHA 2FXQA 4BBSG 3PUVA 5EAYA 4IO9A 4A4IA 3CCSA 1TWCH 4LFAL 4L5RC 1PVOA 1E24A 2E8GA 4FDBA 2R7FA 1K73C 3I4MH 1IL2A 1PHJA 1R9TH 3S1MH 1E3PA 2WB1E 1SLJA 4JI2Q 5C0XG 2E5LL 4JI7L 2VS1A 4LF5L 1VQGA 1WOCA 2PI2E 3I4NG 3G4SA 5LMNW 1SRUA 4DV7L 3JAMc 3CCJA 4NPSA 1EFWA 4LF9Q 4QIWE 4GKKQ 5IY0A 5DLQE 4A3JG 1V9PA 3TS0A 1XNRQ 1PYSB 2EIFA 1IBKQ 3I55A 1VQ6A 2ZJPA 1FL0A 1S72A 3A5ZB 3WWVA 3S2DH 4X65Q 1YBYA 1UWVA 3HKSA 2PQAA 1YI2A 1VQ7A 3S1NH 3BZCA 2DUDA 3HOZH 3S17H 5IYDH 1KL9A 2Q2HA 4DV2L 4L5TA 2MQHA 1J5EL 3GTQH 1FGUA 2EXDA 2K14A 4JV5Q 4YY3Q 4HJ8A 4B3SL 3GO5A 2JA7H 1V43A 2BA0A 3M4OH 5M5XH 1OXUA 4A3FG 4X64Q 5BR8Q 1D8LA 5AJ3Q 5FJ8H 4JI4Q 4K0KQ 1ASYA 1WJJA 4LFBL 1GVPA 5IP7G 1Y1VG 3AFQA 3STBD 1VQ5A 4BBSH 2RHQB 4IPDA 1VQ9A 3BU2A 1N8RC 5GROA 1B8AA 4DV6L 2NVXH 4A3GH 1LYLA 3HOXH 1Y1WG 3CD6A 4B3TL 2K52A 1VQEA 3CQZH 3ERSX 4X62L 2BA1A 3ULJA 5IYCG 1PH1A 1HR0L 3PIOA 2UXCQ 4MNOA 1L0WA 1G51A 2C35B 3J80c 3H15A 4LF4L 3KFUA 3STBC 4JI0L 4LFAQ 4JCVE 1VQAA 2D0PA 1QVGA 2N3SA 2RF4A 2OWOA 2UUBL 1XPUA 2DGYA 2E5LQ 4JI7Q 4LF5Q 1KHIA 3CP0A 2NN6G 5C4JH 4DV7Q 4DR4L 2BH8A 2UUAL 1OXVA 4LNQA 4TQUS 1AH9A 4EX5A 4DV1L 5C44G 2PI2A 3SGIA 1U0LA 3J7ZC 2IX1A 2VQFL 3GTLH 2WB1G 1CSPA 5GQOA 1CKNB 4KHZA 1TXYA 4QL5A 3I2ZA 3KF6B 1TWAH 1SMXA 1S40A 3ICEA 2B29A 5M3FG 2KENA 2WFWA 4HJ7A 4AQYL 1HZ9A 4YWKA 2AMCB 2UXBL 4EQ5A 3J7A5 4DV2Q 4WJ3M 4LWCA 4P73A 2IX0A 1J5EQ 1VQDA 1Y14B 4HJ5A 1X56A 4UPAA 2AKWB 4C3IH 5C3EH 4DKAC 4L5QA 2ALYB 1Y1VH 2A1AA 4B3SQ 2RHSB 4GNXB 4YHHL 4HIMA 4A3KG 4R1JA 3PO2H 4DV3L 2F4VL 3AQQA 1W3SA 3E9IA 4LFBQ 2Y0SG 4R4TA 1V1QA 3EIVA 4A3LG 1YITA 3PO3H 1Q8KA 4YWLA 1CSQA 4MTNA 3A74A 1UEBA 1C9OA 4DV6Q 4ME3A 3GTOH 4X66L 3J81i 1XPOA 4B3TQ 1RIPA 1HZCA 1MJCA 4X62Q 1HR0Q 1NE3A 1WFQA 2NVTH 3NEMA 3LGJA 2GVAA 3H0GH 5IE8A 5IYBH 4LF4Q 4JI0Q 4GLAC 3E9HA 2UUCL 4XIGS 4HIDA 5C44H 1H95A 4YCVA 2ZM6L 4GKJL 4JYAL 1RL2A 2UUBQ 2QEXA 2MO1A 2VQEL 4DR3L 1XPRA 3S14H 2VY3A 3M9BA 4DR4Q 1VQBA 1EQRA 4GLXA 2UUAQ 2F52A 4KLKA 2H5XA 4JBMA 4A3BH 4AYBE 4DV1Q 1E1OA 3RZDH 5JJKA 1VQJA 1Q12A 2VQFQ 3RZOH 1TWFH 3TQYA 3PUXA 1CKMA 1JE5A 5GADC 2Z0SA 1VQMA 5GAGC 4DR5L 3K7UC 2N78A 1PYBA 2OQ0A 1HZBA 3DM3A 2HIXA 4A3EG 1XMOL 1IBML 5K36G 3HFZB 4AQYQ 4GLVB 3S16H 4B3RL 2UXBQ 2B63G 4A3KH 2JA6G 4PMWA 4POGA 4APVA 2NZHA 4PZ6A 4Y52H 3I56A 4A75A 4LUZA 4JBJA 4BBRG 3F2DA 3NBHB 4P74A 2NN6I 4AH6A 3HOUH 3RLFA 4KHPL 1JT8A 1K8GA 1P8LA 4YHHQ 3CF5A 2LSSA 5C0XJ 3TS2A 4DV0L 1YZ6A 4DV3Q 2F4VQ 3HOWH 2JA9A 1U5KA 4A3MG 1PH8A 2JQOA 1B7YB 1MIUA 1NMFA 3JC66 4JOIA 4R4OA 3UDGA 1HNZL 1MJEA 1QVCA 3RN5A 3CCEA 5IWAL 2K5NA 3HOVG 3T1YL 1M1KC 4DUZL 4X66Q 1X6OA 4JBWA 4JI8L 1Z47A 1VQOA 1PH5A 1MKHA 4RMFA 1TWGH 1HNXL 1WCMH 4GN4B 2Y0SE 5J3BA 4DNIA 4R4CA 4OWWB 4A3DH 3F2CA 3HKZE 1I3QH 4MZ9A 2UUCQ 1X54A 3MEFA 1EYGA 4DAMA 1KRTA 2JEAI 4WJ4A 5IP9H 4IFDG 1EIFA 2ZM6Q 2R92G 4GKJQ 1OXSC 4JYAQ 3CMAA 4BXXG 1A8VA 1UE6A 2CKZB 3CPFA 3D0FA 2VQEQ 4DR3Q 1I94L 3HOYH 3U58A 1VQCA 4JC0A 3KDFA 3FHWA 1GM5A 2R7DA 2Q2UA 3UDXA 1SN8A 2D62A 2HQLA 4TVAB 1VQLA 1A0IA 4UP8A 1VQHA 1SFOH 3F8TA 4P72A 1KC8C 1O7IA 4YCWA 5JJLA 4NXNL 3J81c 4QJFA 3PUYA 4A3IG 2OQKA 4DR5Q 1QUQB 1XMOQ 1L1OA 1OXTA 3I4NH 1P16A 4AYBG 1KXLA 4JI5L 1IBMQ 2ZJRA 1QVFA 3AEVA 4B3RQ 4H02A 3PSIA 1Q86C 2OTLA 4LF8L 4R4QA 2R7ZG 3G71A 4A3JH 1SROA 1E1TA 4GOPA 1Q81C 3AYHB 3FKIG 1N32L 4KHPQ 1KAWA 1PFSA 4A3CG 1G291 3L7ZC 2AHOB 4KI0A 2CWAA 2D0OA 3EN2A 2E2IH 2CWPA 3ZJYC 4DV0Q 4IPCA 2HHHL 1NMGA 3I7FA 2ATWA 1LTLA 2UXDL 1HNZQ 2JEBI 1PH2A 3CCUA 5E7NA 1Q1BA 3GTKH 5IT9c 5IWAQ 3K8AA 4HIOA 3T1YQ 2KCMA 4JOIC 4DUZQ 2A19A 4O0AA 2RCNA 5LMUL 4DV5L 4JI8Q 1XJVA 1K0RA 3AFPA 1X3FA 3A0JA 3RLNA 4A3FH 1VQPA 4DUYL 2R92H 5C4XG 2WAQG 1HNXQ 3GDEA 2K5VA 3VDYA 1HR0W 1YIJA 1X3EA 2NVYH 5IP7H 1FJGL 2K75A 2VUMG 1B70B 1UE1A 2R93G 4Y7NH 1BKBA 1L2FA 1GD7A 2PQAB 4A93G 1I94Q 3CMEA 2IT1A 2N49A 4OWTB 1Y1WH 2CQOA 3KLWA 3RNUA 4QY7A 5IYCH 5JEAG 1EUJA 3HKZG 2XGTA 1OTCA 3BZKA 4LW1A 2YTXA 3OYYA 3PCOB 1YJWA 1YJNA 1N34L 3CCLA 2JA5G 3CXCA 2ES2A 3TRZA 4NXNQ 4QQBX 2YV5A 4LF6L 3RLOA 1VQ8A 4DR2L 3S24A 1X55A 3CAMA 3K7AH 4OWXB 3KDFB 1FVIA 1GO3E 4JI5Q 2MFIA 1D7QA 4C3HH 4IFDI 2XTIA 2JK8A 4LF8Q 1JJ2A 1L1OC 3M3YH 1YJ9A 2Z6KA 3NELA 4LF7L 3ER0A 4OONA 1KQSA 1N32Q 4IJHA 3K80C 1VQKA 1VQNA 3S15H 5HY6A 4GOPC 2NZOA 2KBNA 5M3FH 3FP9A 2YU9H 3M4QA 2HIVA 2HHHQ 1YHBA 2YYZA 4OX9L 2ASBA 2UXDQ 1DGSA 5LMNL 1I6HH 1NY4A 3NENA 4JI3L 2R6GA 5ELNA 1YHAA 1HNWL 3CCMA 3GD7A 4GN3B 5LMUQ 4DV5Q 1IBLL 3HOZG 5IYDG 5FLMG 1KIXA 2I5LX 3I4OA 4DUYQ 2JJQA 1K9MC 1YVCA 2PMZE 3W5OA 3W1GA 5FLXc 2VW9A 2HT1A 1G6PA 4YWMA 1JJCB 1SR3A 2KCTA 4A3LH 1FJGQ 1VQFA 3F2BA 2A8VA 2L15A 5GAHC 3ULPA 3F1ZA 1PV4A 4BY7G 3U50C 5FJ8G 5M5YH 2AWOA 2B3GA 2WAQE 4L5SA 2K4KA 1C0AA 1A62A 4LUOA 2CFMA 1J6QA 4NXML 1N34Q 1HJPA 3D31A 4A3GG 1IXRA 1Q1EA 3HOXG 1CKNA 2ZJQA 3IRBA 1E22A 1EWIA 2Q2TA 1VQIA 2GVBA 4LF6Q 4DR2Q 1XNQL 1Z9FA 3MXNB 3KF6A 4O2DA 3S2HH 3W1BA 3OTOL 4DR1L 3UE0A 3K81C 3CPWA 4B3ML 3G48A 3GTMH 2I5HA 2AWNA 1NJIC 3T1HL 2ZTCA 4P75A 4IOAA 2VNUD 4JBKA 1N33L 1Q46A 4LF7Q 1AE3A 2JA8G 4DR7L 4JG2A 2ZTEA 5JJIA 2WP8J 3PUZA 4POFA 5M5WH 2Z6KC 4IFDJ 4GNXA 4A3EH 1KRSA 5HGQA 4GS3A 4DK3C 3CC7A 4JI1L 1Q82C 1I50H 2QGQA 3H3VI 3CCVA 1NTGA 5FLMH 4OX9Q 2B63H 2JA6H 3GTJH 2OTJA 2IY5B 2JE6I 4RG1A 3J81j 1E7ZA 3UE1A 5LMNQ 4BBRH 4OXPA 1YNXA 3CC4A 4JI3Q 2V1CC 1HNWQ 1PA6A 1PH7A 1IBLQ 1X3GA 3CCQA 4JI6L 4DR6L 3TEHB 1VS0A 1Q7YC 3CCRA 4BY7H 1GKHA 1PH9A 4LFCL 4LUVA 4DV4L 4A3MH 3A5UA 5C3EG 1W2BA 1HZAA 1QZGA 2KHJA 2YTVA 2QA4A 4A76A 4YCUA 1YHQA 3GTPH 4BA2I 1I5FA 1SE8A 3HOVH 1IZ6A 4IJLA 1KD1C 2GN5A 2VL6A 2BH2A 3PIPA 2UU9L 3PO2G 1A63A 2ID0A 1JB7A 1EQQA 2I5MX 4OO1I 4PZ7A 3PO3G 3CW2C 3RR5A 1XMQL 4NXMQ 3M4PA 1VCIA 4IPGA 1JMCA 1NBWA 3PF5A 1X65A 1YEZA 1XNQQ 2OCEA 4BXXH 3OW2A 3Q8DA 2JA8H 4UY8C 2K50A 4C3JH 3PV0A 3OTOQ 3H0GG 2IHFA 5IYBG 4HIKA 4DR1Q 4B3MQ 1CKOA 3JAMi 2E2JH 3T1HQ 1M90C 1XTDA 3BJUA 4R4IA 1PH4A 1N33Q 3K0XA 1JJGA 1PH6A 2N8NA 3PF4A 4DR7Q 4UP9A 4PG3A 5M3MG 4A3IH 1PH3A 1N36L 1WYDA 4A3BG 3DLLA 4ALPA 4PZ8A 2F3IA 4JI1Q 2K5HA 1CUKA 1IYJB 4BY1G 3PUWA 3G6EA 4GNXC 5JEAJ 4DPGA 2R7ZH 1N9WA 5C0XI 1UE5A 2CCZA 3KJPA 4NB3A 4IOCA 3CC2A 3FKIH 4JI2L 4DK6C 3KJOA 5GAEC 1HH2P 5ELOA 4BA1I 1T9HA 4A3CH 1X9NA 4JI6Q 1S3OA 1BBWA 1TWHH 1VQ4A 1ASZA 4IPHA 4LF9L 3I4MG 4DR6Q 4GKKL 4X6AH 3KOJA 5H1SE 4LFCQ 1XNRL 4QGUA 3L2PA 3KYHC 4DV4Q 3HOUG 2KHIA 1IBKL 4AIMA 3S1RH 3B6YA 2E2HH 4J15A 3KF8B 1L1OB 2IHEA 3UDIA 2VZAA 3M7NA 4X65L 1EIYB 3GTGH 1LUZA 2UU9Q 4XTCS 2NVQH 5C4XH 2PNHA 3RN2A 3U4VA 1BVSA 3HOWG 1UE7A 1C7YA 3PGZA 2EQSA 2MNAA 4GOPB 1WI5A 4OO1G 4JV5L 4GN5A 3J80i 4DAYB 4YY3L 4UP7A 4HJ9A 1XMQQ 1EOVA 1BBUA 2LXJA 1LM0A 3E0EA 3ULLA 2VUMH 2R93H 2MO0A 3L0OA 4HJAA 3U4ZA 4X64L 4A93H 5BR8L 1K3RA 5AJ3L 3S1QH 4JI4L 1QUQA 4K0KL 1WCMG 1K83H 1K8AC
chains in the Genus database with same CATH superfamily
1AE2A 1QNUA 2HQEA 2NVQB 2JA7G 3EBEA 4ZKBB 1OXXK 4RHRA 2K33A 1O78A 1R4PB 2PZTA 4IO9A 4A4IA 3CCSA 2I07B 1LTSD 1E24A 2E8GA 3VA7A 1K73C 1ML0D 3DEOA 1R9TH 1E3PA 4LF5L 1C8CA 1WOCA 2F0LA 3I4LA 4JPBW 3BYTB 2JA5B 3CCJA 1LT5D 3TZDA 3HEJA 2LMCB 4F8MA 5IY0A 5DLQE 1V9PA 3TS0A 1TIID 2EIFA 2NUCA 2D2CC 1J8IA 1FL0A 1S72A 2RDGA 3A5ZB 3WWVA 2K28A 2DUDA 2EYMA 3BZCA 1B9NA 1YNJC 1KL9A 3RD4A 3GTQH 4KHVA 4XQNA 1IW7D 1VF7A 1V43A 1I4PA 2NZ1D 4A3FG 5BR8Q 4JI4Q 4A3EB 1WJJA 2BOSA 1BCPB 3S1NB 5IP7G 1VDZA 3GTJB 4IPDA 3BU2A 2RSOA 1LT3D 3T51B 3HOXH 3Q23A 3CQZH 3KBXA 5IYCG 2L9HA 1L0WA 4KJOA 1PRTC 2C35B 3KFUA 4JI0L 1GOZA 4LFAQ 4BY7B 4JCVE 1VQAA 2CVRA 2OWOA 1EY9A 1TS5A 1A6XA 2UUBL 4FYDA 1ICFB 1PRTB 1B1ZA 2AQ2B 3ONAB 1FR3A 1DD2A 2B2UA 3CP0A 4A3GB 2NVXB 2BH8A 3K59A 4C3HG 1BBXC 4DV1L 3K6OA 5C44G 2PI2A 1SE2A 1CA5A 5GQOA 2EY2A 3X3MA 2DJGC 1LTBD 4QL5A 1SMXA 1S40A 3EA6A 2KENA 4IURA 2WFWA 2JA8B 1HZ9A 4YWKA 2F0QA 2N55A 4EQ5A 4LWCA 4P73A 2L0CA 2L11A 1Y14B 2P5ZX 1X56A 4C3IH 1M8AA 1SE4A 3FMCA 1SYGA 1QG7A 4ZYSA 4YHHL 4HIMA 4R1JA 3MXNA 2IL8A 3AQQA 4KTAA 4FF4A 4R4TA 1ILPA 3QIAA 1Q8KA 4YWLA 2A68D 3QJYA 4DV6Q 4H7BA 2E2DC 4RKLA 4UHVA 5C3EB 2HDLA 1NE3A 5CGKA 2AUJD 2NVTH 5F2DA 2C5CA 4OHJA 5IYBH 4LF4Q 4UAIA 1PLFA 4XIGS 5NUCA 1PMRA 4JYAL 2VQEL 3S14H 3M9BA 2B2WC 1EQRA 4A3BH 1E1OA 1HHVA 4XQJA 2F0NA 2KEEA 2VQFQ 2H1EA 5GADC 2VUMB 5GAGC 1T5XD 2A6EC 2J0TD 1IBML 5K36G 4GLVB 1PFNA 2UXBQ 4A3KH 2MUYA 1WTOA 1JC7A 4LUZA 4JBJA 4BBRG 4P74A 4AH6A 3HOUH 1HRJA 4KHPL 1JT8A 1ICWA 2ZT9C 1H9JA 4NW2A 5TSSA 2LSSA 4KK7A 5G3LD 2F4VQ 5E1FA 1F9QA 1MIUA 1HNZL 3UDGA 1TWCB 1MJEA 1AEXA 4XXEA 3HOVG 3T1YL 3CU7A 4XYOA 1RTNA 5DM63 1X6OA 1SDFA 4KKTA 5C5LA 1VQOA 1BDOA 3AMUA 1LTTD 4DAPA 1HNXL 1QNKA 4R4CA 4G7OC 2OXPA 5IGBA 2R92G 4GKJQ 5CV5A 1I4XA 1A8VA 2CKZB 1I94L 5EKLA 2IW3A 4C3JG 5KNBA 2R7DA 3OMCA 2PW7A 2HQLA 1VQLA 4UP8A 3SK4A 1TWGB 2E76C 1KC8C 4A3DB 2B2VC 4A3IG 3M4OB 4OL7A 2K32A 3KF8A 4DNTB 1J9OA 1IKMA 4B3RQ 4H02A 2JXMB 3K58A 5IOCA 4R4QA 2R7ZG 3G71A 4FF3A 5KIXA 2CW0C 1E1TA 4F88A 4CJ0B 1Q81C 4BBSB 1N32L 3QG1A 1KAWA 2B39A 1HPCA 1G291 1JB3A 5FLXE 1Z7TA 2F1MA 2CWPA 4IPCA 3I7FA 1O7YA 1GUOA 2JEBI 1Q8IA 1SBBB 1E2VA 4DGZA 3OMGA 3BVZA 3K8AA 1TS3A 2RCNA 5D3IB 1K0RA 3AFPA 5C4XG 4A3FH 4DUYL 5ELEA 3A8JE 2WAQG 3EROA 1KAAA 1HR0W 1X3EA 5IP7H 1ZYRD 1FJGL 2C9OA 3TP7A 4TRDA 2K75A 3T16A 1BKBA 1L2FA 1GD7A 4A93G 3CMEA 1EYAA 2N49A 2DY8A 3GTKB 3P20A 1D5ZC 3J7YW 4CHTB 5IYCH 1EUJA 3OIQA 3HKZG 5ELDA 1OTCA 1S5FD 1N34L 1YJNA 3NK9A 4WFN3 3C1FA 4NXNQ 4QQBX 4K14A 3H91A 4LF6L 3CAMA 5I4DA 2IPKD 4KV6A 4OWXB 2JYOA 2JN4A 3KDFB 2MFIA 3PO2B 1B2TA 1D7QA 4C3HH 5CV6A 1NR2A 2JK8A 2AQ1B 2F0GA 1JJ2A 1G2SA 3PO3B 3NELA 4LF7L 1ONLA 4X3TA 3U9OA 1LTAD 1STBA 3S15H 3K5OA 2K03A 2KBNA 2ZXOA 3MZ5A 1KTKA 5CR3A 3FP9A 2F0VA 3I72A 1F2ZA 4LAAA 2CHBD 3NENA 3R2IA 3BVGA 5DAUA 3GD7A 5LMUQ 3HOZG 1B3AA 1K8OA 2Z4IA 1Y8OB 2I5LX 3I4OA 4TSSA 2E75C 2JJQA 2HT1A 2VW9A 4RKBA 1JCKB 1SR3A 1VQFA 3RZOB 4Z9CB 1EY0A 3F1ZA 4J1MA 1II3A 2CQAA 2O5JC 3N6RA 4PMBA 1DJRD 2K4KA 3S16B 1A62A 3UI2A 4NXML 1EQVA 3D31A 4B9WA 2PZUA 1E2WA 2Y0SB 2ZJQA 1Z9FA 5AFWA 3UE0A 3K81C 4B3ML 3G48A 1A3VA 1BOSA 2F0OA 2NYZD 4LJZC 4DR7L 4JG2A 3PUZA 4IFDJ 5J1ZA 2RBMA 4G7HC 5K36H 3S2HB 3H94A 4OX9Q 3A7AB 1JWSD 2K6AA 5CORA 4M1UB 4BBRH 1K0SA 1YNXA 3CC4A 4FXDA 1G6ZA 2Z4HA 1IHZA 1EQTA 4ZLTF 3Q24A 1VS0A 5FKAC 1PH9A 4LFCL 4LUVA 4DV4L 5EPJA 1W2BA 2QDBA 1SFOB 1ZXTA 2B63B 4BA2I 2JA6B 1I5FA 5CV9A 3HOVH 1KD1C 1PXUA 2B2YA 4CDFC 2FFKB 1A63A 1JB7A 3I4NB 2I5MX 1MI2A 1PFBA 1B44D 5JJZA 2F3VA 4XQQA 3CW2C 4KY6A 1AW7A 3MXGA 3SVMA 4KMUC 1JMCA 2SDFA 4CDDC 4A3MB 1NUCA 3Q8DA 4H13C 3GTPB 4C3JH 3OTOQ 3H0GG 1Y8PB 2KJXA 2KA7A 3JAMi 2E2JH 1M90C 1PH4A 2A6HD 3K0XA 1U4MA 4RWSC 1A2TA 2PQEA 3JAME 3PF4A 4UP9A 4A3IH 2I46A 5KNCA 1WYDA 2Z6BA 5IGDA 5IIFA 4NP5A 2MHVA 4GNXC 2R7ZH 1N9WA 2CCZA 4NB3A 4IOCA 2EJFC 1T9HA 2D9UA 1RTOA 1X9NA 4JI6Q 4DR6Q 3KOJA 3H09A 2KCCA 2K7VA 3T4AC 2EYFA 3S1RH 4ZAIA 2E2HH 1BF4A 1L1OB 3UDIA 2QW7A 4DXGA 5C4XH 3K7AB 3HOWG 1BVSA 1UE7A 3PGZA 2R61A 1DXMA 4RCNA 2MNAA 1K28A 3K5MA 1CT1D 1R4QB 1EOVA 4X3KA 1STHA 4A93H 5BR8L 4JI4L 1WCMG 1ENCA 1K83H 5M3MH 4R8IA 2B2TA 2F0HA 2KEDA 2Q2IA 4E6IA 1SYEA 3FPUB 5IP9G 5JPMC 4C2MH 1G2TA 3UDFA 5I9PA 1N36Q 3J7AF 4ULLA 2R93B 1F2YA 4JK1C 3PUVA 1H9SB 4LFAL 3S1QB 3V96A 2FINB 2M00A 4FDBA 2R7FA 2A69D 4ZUJA 1TY2A 2RVLA 4CGYB 1SRUA 3G4SA 5LMNW 1S5DD 4LF9Q 4GKKQ 1EEFD 3T53B 1AP0A 1PYSB 1H9KA 4PQXA 1IBKQ 1VQ6A 2ZJPA 4OO1H 1FNUA 4X65Q 3BDLA 1LO5D 2PQAA 1R9TB 3HOZH 3S17H 4L5TA 1ZEQX 2K14A 1CA6A 4HEDA 4JV5Q 2XSCA 2SOBA 4HJ8A 1STAA 2EYHA 2BA0A 5M5XH 3GQBA 1PTOB 4X64Q 5AJ3Q 4K0KQ 1ASYA 2KQ3A 5C4HA 1GVPA 3AFQA 2NWGA 3STBD 1VQ5A 1VQ9A 3BVMA 1B8AA 4RHSA 4BWGB 4DV6L 5C6AA 1Y1WG 2L4NA 1VQEA 3ULJA 1ET9A 2UXCQ 1LABA 3FRPB 3J80c 3H15A 2F0DA 1H9MA 4LF4L 2D0PA 2N3SA 1SYDA 1X3PA 2RF4A 5LL6X 2DGYA 2X6GA 3Q22A 2NN6G 5A2QL 4DV7Q 1EIHA 1LLRD 1SJHD 4EVOA 1OXVA 4LNQA 3CQZB 4QB4A 3J7ZC 1CZWA 2VQFL 2WB1G 1CKNB 4DFAA 1GUSA 2K01A 3G7LA 3KF6B 3ICEA 4L63B 4ZQ3A 4DU9A 5M3FG 3TP6A 1TKWB 3MXUA 4XYQA 2UXBL 4J6HA 2BE5D 1J5EQ 1U4RA 1F2LA 1Y1VH 5T1GA 3VYTA 3I90A 2RHSB 4A3KG 3I73A 4FNFA 2BDNA 2F4VL 1W3SA 4LFBQ 5DNFA 1V1QA 4A3LG 4F7XA 1CSQA 3A74A 3GTOH 3M7GA 4S3SA 1TR5A 4C3IB 4KN4C 1AFPA 4X62Q 1HR0Q 4FF2A 2XNAC 2KVMA 1WFQA 3EVQA 4DK0A 3SE0A 2WINB 3H0GH 4ODGA 5IE8A 3VA5A 1DM0B 2A68C 1WTWA 4GKJL 2MO1A 1GHKA 3GTGB 4DR4Q 2A5HA 2UUAQ 4KLKA 4JBMA 2QEJC 3IKJA 1BXTA 2B2UC 5JJKA 1BCPF 1Q12A 3HGBA 5LHY1 1TWFH 2F0PA 3PUXA 1CKMA 5ISRA 1JE5A 2EYOA 2Z0SA 3NHHA 3K7UC 1PYBA 4A3EG 1HZBA 2RDHA 4LK1C 4AQYQ 4B3RL 1HXYD 2NZHA 2M9VA 2TMPA 3I56A 3OOCA 4K8IA 3SK5A 4A3BB 1G8ZD 4RAUC 3F2DA 3I8ZA 1MGSA 2NBFA 4OIKA 3O13A 4BY1B 4DV3Q 3MEHA 3HOWH 3MVVA 4JOIA 4KY7A 3WOFA 3I4MB 3OWFA 5BN4A 5C4ZA 1Z47A 2EZVA 1IYUA 1MKHA 1SXTA 1WCMH 1U4LA 2Y0SE 4OWWB 4QUFA 3I91A 3HKZE 2Q8IB 2UUCQ 1EYGA 1KRTA 2JEAI 4WJ4A 5IP9H 4IFDG 2ZM6Q 1OXSC 3CMAA 1UE6A 4DR3Q 4CDCC 3U58A 3S2DB 4JC0A 3E3XA 5HGTA 3FHWA 3UDXA 2F0FA 3MC0B 1SN8A 2D62A 5D14A 4C1NI 1HFGA 3F8TA 1O7IA 4YCWA 4NXNL 2IX3A 3PUYA 2OQKA 4YIJA 4DR5Q 2JA7B 1XMOQ 4AYBG 3QB3A 1QVFA 3A54A 4ME5A 4X3SA 1CI3M 1SNOA 1Q86C 4ABNA 3AB9A 4GOPA 1SYBA 4FXKC 2EXZA 4V0BA 2L1BA 3J80L 1HTLD 3GV3A 2AHOB 4KI0A 2D0OA 3DEPA 3EN2A 1SMYD 2ATWA 1LTLA 2ZXPA 1WTVA 4WRDA 3CCUA 5COYA 5E7NA 4ILWA 1Q1BA 2BDOA 3KK7A 5IWAQ 2KCMA 5BN5A 4DUZQ 5LMUL 4OGQC 1XJVA 1VQPA 3RLNA 2F0KA 2M2LA 5C4JB 3GDEA 2K5VA 1YIJA 4ID6A 1MSGA 4M8AA 3GTLB 2VUMG 4EQPA 1UE1A 5JPNC 1F77A 1PDQA 4OWTB 1Y1WH 2CQOA 3RNUA 1E0BA 1IKLA 1ZYRC 3BZKA 4A3FB 2YTXA 1YJWA 3CCLA 2ES2A 1NR4A 2EDGA 3RLOA 3S24A 3LX0A 1CHPD 4KY5A 2NN6H 1GO3E 4JI5Q 4I7ZC 2RCFA 4LF8Q 1MBYA 4V190 3WOEA 4IJHA 3K80C 1VMPA 2NZOA 5M3FH 3M4QA 2HIVA 2HHHQ 4OX9L 2ASBA 1UEAB 2A74C 1I6HH 1NY4A 4DK1A 4C3HB 4PNYA 5C44B 3BZDB 1YHAA 2O4XA 1KIXA 3R2TA 1EEID 5CMDA 5FLXc 3W1GA 3DWQA 1F9SA 4A3LH 2A8VA 5CV4A 2QKIC 1WTRA 4B08A 1SNPA 3D4RA 1KNEA 3TP8A 4QUCA 3TDQA 3NP8A 4L5SA 2AUKA 1J6QA 1F2MA 1Q1EA 4N9PA 2Z8LA 4N9TA 1EWIA 2NTSA 2GVBA 3T13A 3VYRA 1CK1A 3W1BA 3OTOL 3GTMH 4K2LA 1NJIC 4P75A 2OEOA 4QCLA 2VNUD 3LWEA 1L0XB 1AE3A 3NE5B 2Q8RE 5JJIA 4HCSA 1BCPD 4A3EH 4DK3C 3FDTA 1KDBA 2L12A 2IY5B 1B4OA 4C1NK 3GTJH 1I4RA 1E7ZA 5LMNQ 1I3QB 1WD1A 4JI3Q 3GP7A 3A8KE 1LT6D 3D3RA 4JI6L 4DR6L 1EZ6A 1VF5C 1Q7YC 3CCRA 4BY7H 3VR6A 5C3WA 1PRTD 1AZQA 1HZAA 1QZGA 3KLSA 1YHQA 2DNCA 3H6MA 1IZ6A 2BH2A 2KECA 2VL6A 3DXJC 4BBRB 3PO2G 2ID0A 4L8JA 1EQQA 4IUVA 3BYYB 4IQZA 3PO3G 2WACA 1ILQA 2RKSA 5FO8B 1UUPA 1OO9B 2XN9C 4IFDH 3PF5A 2OCEA 3A8IE 1WTPA 2JA8H 2K50A 4HR7B 3PV0A 2JP1A 4HIKA 1CKOA 2F0WA 3T1HQ 1QWYA 1N33Q 2V4DA 2CH4A 5M3MG 1N36L 1JOKA 3DLLA 2X6LA 4PZ8A 4RGTA 2R92B 4C3JB 2A6HC 3PUWA 3G6EA 5JEAJ 1STYA 2NVYB 1UE5A 3LWUA 1SAPA 1C4QA 1RJTA 3KJOA 4Y7NB 1HH2P 5ELOA 1S4ZA 4IUQA 4G7ZC 1S3OA 1VQ4A 4LF9L 1DYQA 4IPHA 4GKKL 4X6AH 4A3IB 2DJFC 5H1SE 4QGUA 3L2PA 1EY8A 2KHIA 4N8X1 4P2CB 1IBKL 4AIMA 3X3NA 2R7ZB 4X65L 1EIYB 1LUZA 2DY7A 1D2BA 1EWCA 3A55A 2PNHA 3RN2A 1V8QA 2EQSA 1EY6A 1WI5A 2B2YC 4OO1G 4JV5L 2OT2A 5D65A 4DAYB 1GJXA 3MWYW 3HP3A 4UP7A 3SK8A 1XMQQ 2VUMH 3L0OA 4HJAA 3U4ZA 4X64L 5AJ3L 3CHBD 1AN8A 4K0KL 1HUMA 4DN4M 2FHTA 3TREA 2A6ED 5C4XB 5J39A 1STGA 4DA2A 3BS1A 3H3VH 3HOYG 1TVXA 4P71A 4CJ1B 1RCVD 3M85A 2UXCL 5CV8A 4KD4A 4A93B 1NSNS 1TWCH 2KOLA 1IL2A 1PHJA 3S1MH 2WB1E 3HKZB 1SLJA 4JI2Q 3DWPA 1WTHA 1WD0A 2PI2E 3I4NG 1MD2D 4DV7L 3JAMc 1EU4A 4NPSA 1HTPA 5CV7A 3VR2A 4QIWE 5M5YB 1UAPA 2WKDA 4A3JG 2FJ2A 4HSVA 2HCIA 2A73B 3V2TA 3I55A 2A69C 2O5IC 2K5QA 1VQ7A 4KN7C 4IN3A 2MQHA 1J5EL 1QJOA 1FGUA 5E3FA 2EXDA 3M4OH 1OXUA 2HDMA 2K04A 1MHWC 1V1PB 4LFBL 5IGFA 5I6YA 4K2KA 1Y1VG 3S17B 4BBSH 2EY1A 2D5DA 1N8RC 5GROA 2B2TC 4L6TB 1LYLA 1G91A 4X62L 4HCEA 1HR0L 1JICA 5JVG3 5LL6S 5M5XB 1QILA 3STBC 5A35A 1SSOA 1QVGA 2E5LQ 4JI7Q 1JR0D 1SYFA 1KHIA 3A56A 4DR4L 2UUAL 2QILA 1AH9A 2PCFB 3I3CA 3SGIA 3HRZC 3TZUA 1CSPA 3DMUA 1DCZA 1TXYA 3D4DA 1K3BC 1TWAH 2B29A 4OIJA 2RDFA 4AQYL 4CBVA 4TKOB 1RDPD 3J7A5 4WJ3M 4DV2Q 4PMCA 3TP5A 1VQDA 4UPAA 2BCOA 1SYCA 3K5LA 1JOQA 4DKAC 2EYLA 2A1AA 4B3SQ 4DNRB 4GNXB 1FYCA 1GUTA 3A7LA 3PO2H 4DV3L 2EPBA 1JORA 2BE5C 1HA6A 2XWBB 3PO3H 5K5PA 4MTNA 4ZKCB 1CTMA 3HS0C 1C9OA 4ME3A 3FKIB 3J81i 1XPOA 4B3TQ 3E0JA 1ENFA 1HZCA 1RHPA 4B9XA 3LGJA 2GVAA 3MHBA 4IUUA 1EFID 3J81E 4GLAC 3E9HA 5I2XA 4K6LA 2UUCL 3K57A 2LY7A 4G57A 2ZM6L 4UDUC 5ELBA 3FVQA 4DR3L 3T56B 2PNRC 3OPOA 4XDXA 3C3LA 1PTOF 5ELCA 3GTOB 4GLXA 4FO2A 2F52A 4AYBE 1TT2A 4HAEA 3RZDH 1VQJA 3RZOH 2F0SA 3H0GB 5C5MA 3URYA 1VQMA 4DR5L 2Z1CA 1XMOL 2HIXA 2ENBA 3HFZB 3S16H 1RF2D 2NTTA 1LTID 4PMWA 4POGA 4Y52H 5A2QE 4A75A 5IT9E 3R93A 3NBHB 3RLFA 2F0MA 4N8FA 1P8LA 2ICEC 3CKIB 5C0XJ 1YZ6A 4ZUIA 2JA9A 1PH8A 3JC66 4NKLA 4R4OA 4QMGA 1QVCA 2VXWA 3JAML 2IJ0A 1DZ1A 5IWAL 2K5NA 4DUZL 4X66Q 4IALA 2Z9HA 2HCCA 2LKVA 2QCPX 4K5WA 1QCBD 1DONA 3MEFA 1HFNA 3SK6A 1EIFA 2NB0A 1TU2B 1XTCD 4BXXG 3HOYH 1Q90A 3NSWA 1VQCA 4JVZA 1H9RA 1QE6A 4RCOA 1IL8A 1IW7C 5ELFA 3SDZA 4TVAB 1A0IA 1VQHA 1SFOH 3GTQB 1WCMB 1SEBD 4QJFA 1PFMA 3D4WA 3ND8A 4I7AA 1A3TA 1EL0A 1QUQB 2SNMA 1ZKOA 4I65A 1KXLA 1L1OA 3I4NH 4JI5L 5KEEA 2IWHA 2ZJRA 3AEVA 3C1EA 5KYIA 4CKBA 4LF8L 1SNMA 2F0UA 4A3JH 3RUZA 1SROA 2EJMA 4IUTA 4CKCA 3DWAA 3L7ZC 3HOXB 3PIO3 4U673 2AQ3B 1CFMA 2CWAA 2E2IH 3ND9A 4DV0Q 2HHHL 1KDAA 5M9OA 1PH2A 1BUVT 4HIOA 4JOIC 3SEBA 3FPPA 4JI8Q 1O80A 2F03A 1SMYC 1SE3A 4FP5D 3OW7A 3W2DA 1ESRA 1H9SA 2EY5A 4FXGC 1FNVA 5BN3A 2IT1A 3NQIA 3KLWA 5JEAG 2GA4B 1SNCA 4NMZA 4WJWA 2JA5G 1DOKA 3NQTA 2YV5A 1VQ8A 3EFXD 1X55A 3K7AH 5DEHA 1FVIA 3TSSA 1Y1WB 5I9OA 2XTIA 3V05A 1EY4A 2LFNA 1CHQD 3M3YH 1V1OA 2Z6KA 3RMHA 3ZYYX 1KQSA 1LTGD 2XVSA 3D6CA 4GOPC 2K5WA 1AZPA 2YU9H 4EQNA 2NVTB 3ITPA 2UXDQ 5LMNL 1U4PA 4JI3L 3PMFA 5ELNA 3WDNA 2PYKA 4GN3B 2WB1B 2G9HD 4DV5Q 5IYDG 1YNND 3SR1A 3MFYA 3S14B 1S5ED 2MGSA 2PMZE 3W5OA 1CQFA 1G6PA 5M3FB 1Y69U 1JJCB 4QIWB 2KCTA 5EBCA 3OHXC 4RGNA 5GAHC 1PRTF 3ULPA 1LV9A 2Q8TA 2EOTA 1I6HB 1I4HA 1PV4A 4BY7G 3U50C 5FJ8G 1FD7D 2B3GA 2WAQE 1C0AA 4RGOS 4A3KB 2CFMA 1HJPA 4A3GG 1WTQA 4MTKA 1CKNA 3HOUB 2Q2TA 2G5DA 4RGMA 4DR2Q 3MXNB 3KF6A 1EYCA 4WORA 2RQXA 4IOAA 5I6WA 3T1HL 2ZTCA 1EU3A 1O7ZA 1I4GA 4JBKA 1N33L 1Q46A 3P7JA 1PTOD 5FOBB 3CRKC 1TS4A 3GV6A 2JA8G 4KKSA 1PTOH 2ZTEA 3SXHA 2WP8J 5M5WH 4FF1A 4FVMA 5HGQA 3CC7A 1Q82C 1I50H 2QGQA 3CCVA 5FLMH 5EJWA 4RG1A 3GTMB 3J81j 2RSNA 1EZ8A 4OXPA 2V1CC 4XT3B 1HNWQ 1WVLA 1PA6A 1F9PA 1BCPC 1IBLQ 5EPKA 3HG9A 3CCQA 1GUGA 2F0JA 2QDLA 5FO7B 4EQOA 1GKHA 2B8GA 3M4YA 3A5UA 5C3EG 1PZJD 2YTVA 2QA4A 4O42A 4K6DA 3OWEB 4IZ8A 1SE8A 4IJLA 3VR4A 2GN5A 2EJGC 5EGTA 4OO1I 4PZ7A 1D5XC 3RR5A 1XMQL 3KLRA 3M4PA 1VCIA 4H0LC 1CZGA 1NBWA 1UNSA 1XNQQ 4BXXH 4UY8C 4DR1Q 2WV6D 1KLUD 4DAVA 1XTDA 3BJUA 1PH6A 2KUMA 2N8NA 3ERQA 4R8NA 2F3IA 4JI1Q 1CUKA 4CKEA 1XXGA 4JI2L 4DK6C 5GAEC 1A15A 2F0EA 4DXFA 4HTHA 1GUWA 3MA2B 2K05A 1BBWA 1TWHH 2F0IA 1ASZA 1BR9A 4GZYC 4OEMB 2EY6A 4AYBB 5EKKA 5EKIA 1NCVA 1PYWD 2IHEA 3KF8B 3M7NA 2VZAA 3GTGH 2UU9Q 3LNNA 2NVQH 3U4VA 2R3ZA 1C7YA 3NWSA 1A2UA 3W3AA 2N88A 4GN5A 2J7ZA 5EQ0A 1ESFA 1BBUA 2LXJA 1LM0A 3E0EA 3Q6SA 3ULLA 4ZCKA 2LS01 3D6WA 3S15B 1K3RA 4KJNA 4IUPA 4KHZA 3TQYA 3KUPA 1TY0A 5JEAH 4A3DG 3DHQA 3MTSA 2I0QA 2YTYA 2JA5H 4BY1H 4K5VA 2LXKA 5IGEA 2JSOA 2ZTDA 1QZHA 2FXQA 4BBSG 5EAYA 2SEBD 4CJ2C 4L5RC 3H3VC 2FMMA 3I4MH 1PVOA 2DNEA 5C0XG 4J8QA 2E5LL 2VS1A 4JI7L 1VQGA 3NTIA 5JAVA 3Q0AA 3BG3A 3IAYA 1BQQT 1EFWA 1YNJD 1XNRQ 1QB5D 5IGCA 2F0TA 4Q5VA 3MFGA 2ICIA 3S2DH 4NDXA 1YBYA 1UWVA 3HKSA 3QOLA 1XWEA 1YI2A 3S1NH 3S1MB 4F87A 3P1HA 3AU7A 5IYDH 2Q2HA 3QWNA 1Y8NB 4DV2L 1T5EA 3BDCA 1Q3LA 3TMEA 2VB3X 4YY3Q 4B3SL 3GO5A 2JA7H 1I6VC 3L9AX 1D8LA 5FJ8H 1I4QA 1NNXA 4XT1B 1DOMA 1HA5A 2XWJB 1EY5A 2RA4A 2RHQB 1JOOA 2TSSA 5J22A 5DM73 2NVXH 4A3GH 3CD6A 4B3TL 2K52A 3ERSX 2PZWA 2BA1A 4PV1C 1PH1A 3PIOA 4MNOA 1G51A 4U68A 2B2WA 1XPUA 3QR8A 4LF5Q 1Z6HA 4HMIA 3PIP3 3HOVB 5C4JH 4TQUS 3K0YA 4EX5A 1BNZA 1U0LA 5E4XA 2IX1A 2EE1A 3BDOA 3GTLH 3MXPA 3I2ZA 3S9WA 4HJ7A 2HD3A 1HUNA 2AMCB 5JVH3 2IX0A 1RODA 2MJ8A 1KABA 2E2JB 3MAQA 4HJ5A 2AKWB 5C3EH 4L5QA 1MSHA 2ALYB 3VR3A 1S5BD 1F9RA 1TWAB 1EOTA 3E9IA 2Y0SG 5C3XA 3EIVA 1YITA 2FMCA 1UEBA 1SNQA 4X66L 3QOJA 2OF1A 1RIPA 2F3WA 1LTRD 1MJCA 1X32A 3SHLA 3NEMA 2WKCA 4JI0Q 2PMZB 4HIDA 1XX8A 5C44H 4HN7A 1H95A 4YCVA 1SNDA 2WIIB 4HMJA 3J7AV 1RL2A 3EQLC 3NBIA 2QEXA 3S1RB 2UUBQ 1XPRA 2E2HB 3KBGA 2VY3A 2ZXRA 1VQBA 5KYLA 4ZK9B 2H5XA 4DV1Q 2B2VA 2WAQB 4R9WA 5KRUA 5FLXL 2O2LD 4QF4A 1M4VA 2N78A 2OQ0A 3DM3A 4Q0FA 2KCNA 3VYSA 5FK9C 2B63G 1K83B 2JA6G 1E2ZA 5CYUA 4APVA 4PZ6A 5M3MB 4MIUA 2HUGA 1KDCA 2NN6I 5CBAE 3RZDB 4C2MB 1K8GA 4YHHQ 1CM9A 3CF5A 3TS2A 2VB2X 4DV0L 1X3QA 1U5KA 5EBDA 4A3MG 2JQOA 1B7YB 1NMFA 3RN5A 3CCEA 1IYVA 1WTXA 1M1KC 4JBWA 4JI8L 5IODA 4RA8A 2EYPA 4HSPA 1PH5A 5E4WC 1DOLA 1EIGA 4RMFA 1TWGH 4GN4B 5J3BA 4DNIA 5CBEE 4A3DH 3F2CA 1I3QH 4MZ9A 1X54A 4DAMA 4JW0A 2F4IA 4RH6A 4JYAQ 3D0FA 2VQEQ 3CPFA 2B8FA 1ET6A 3NPPA 3KDFA 2PPBC 1GM5A 3HOZB 2Q2UA 4P72A 3K5NA 1PZID 2CW0D 5JJLA 4X3UA 3J81c 2SNSA 1B9MA 2QF7A 5C0XH 3IL8A 1OXTA 1P16A 3IFDA 1IBMQ 4CDEC 3HOYB 3PSIA 5T1IA 3AYHB 3FKIG 4DAYA 4KHPQ 1PFSA 4A3CG 1EWHA 5IGGA 5L37A 1GXDC 3ZJYC 1NMGA 5JOBA 2UXDL 1HNZQ 3PQIA 3G6JB 1JE4A 3GTKH 5IT9c 4A3JB 3T1YQ 2A19A 4O0AA 4DV5L 2R92H 1X3FA 3A0JA 1HNXQ 1D1IA 3VDYA 2E2IB 2NVYH 1B70B 2R93G 4Y7NH 1STNA 2PQAB 4K5XA 1I94Q 4QY7A 5EPLA 3OSOA 2XGTA 4K8JA 4KKUA 4LW1A 3PCOB 1HCZA 3OYYA 1HQRD 3CXCA 3TRZA 1XYIA 5I2YA 1Y1VB 2MPMA 2KHSA 4DR2L 2J4XA 1L0YB 1BO0A 4IFDI 3TBIB 5FO9B 1L1OC 1YJ9A 4IUNA 3ER0A 1RD9D 4OONA 1N32Q 4EGVA 1VQKA 1FNWA 1VQNA 3NTKA 5HY6A 3R3OA 1YHBA 1V1PA 2YYZA 2DN8A 1DGSA 2CH4W 2PW5A 3U9SA 2R6GA 1HNWL 3M3YB 4KD3A 2XIWA 3CCMA 1IBLL 3TN2A 1JWMD 5FLMG 4DUYQ 1K9MC 1W6KA 1YVCA 4YWMA 3I70A 2YU9B 1FJGQ 3F2BA 1TWFB 2L15A 4DF7A 3KLSX 3C46A 1YNNC 2L55A 3NXWA 1FGBD 5M5YH 2AWOA 4LMQD 3N52A 4LUOA 1N34Q 3HZXA 1STEA 1IXRA 3DM1A 3HOXG 3IRBA 1E22A 3VYUA 1VQIA 4LF6Q 4G4KA 1XNQL 3S2HH 4O2DA 4DR1L 3CPWA 2I5HA 2AWNA 3L3OC 1A3UA 4MHEA 3HOWB 5KGUA 1B53A 4LF7Q 1SJED 1TS2A 2E74C 2PO4A 4POFA 2Z6KC 4GNXA 1KRSA 1JWUD 4GS3A 2XRSD 5HURA 4JI1L 3H3VI 2MP1A 1NTGA 2EYJA 2B63H 2JA6H 2OTJA 2JE6I 1PTOC 3E5SA 3UE1A 4MN3A 1PH7A 1X3GA 1RKNA 1CQVA 1EY7A 3TEHB 3J81L 2K1BA 1B3QA 5M5WB 1LT4D 1TQOA 4C3IG 4A3MH 2KHJA 1I50B 2K5DA 4A76A 4YCUA 2L5TA 3GTPH 4RFBA 3VR5A 1PZKD 3PIPA 3EJIA 2UU9L 3E6ZX 1NAPA 4NXMQ 1LACA 1U9RA 4IPGA 1X65A 1YEZA 1GHJA 3OW2A 1ENAA 3QO2A 4C56C 1W6JA 5IYBG 2IHFA 1S5CD 4B3MQ 5IT9L 1QOHA 3D8GA 4R4IA 4O1NA 1JQYD 1GUNA 1VMCA 1JJGA 4H44C 5KNDA 1EYDA 1D1KA 3NBHA 4DR7Q 2EVBA 4PG3A 1PH3A 4BS9A 1HQMC 4A3BG 4ALPA 2K5HA 3NUCA 1IYJB 4BY1G 4DPGA 1C48A 3FEWX 5C0XI 3KJPA 3CC2A 3FKIH 1K8MA 3CRLC 4BA1I 4A3CH 1O7LA 1D5MC 3OIPA 3NTHA 2XRQD 3I4MG 1KNAA 5D3DA 4LFCQ 1XNRL 3KYHC 4DV4Q 2X69A 3HOUG 1B50A 3DUZA 3NWTA 5G3LF 3B6YA 4J15A 3F2UA 4OELB 4XTCS 3R8BA 1D6EC 1KLGD 2G9DA 3IFTA 4ZRZA 4GOPB 3C2PA 1TWHB 3J80i 2H4OA 4HJ9A 4YY3L 2R93H 5CC4A 2MO0A 3P75A 3J80E 3S1QH 1QUQA 2OTLA 1K8AC
chains in the Genus database with same CATH topology
1AE2A 3TREA 5M3MH 4A3DG 2Q2IA 2JA7G 2I0QA 3EBEA 5IP9G 2YTYA 1OXXK 4C2MH 2JA5H 3H3VH 4BY1H 3HOYG 3UDFA 2LXKA 4P71A 1N36Q 3M85A 2ZTDA 2UXCL 1QZHA 2FXQA 4BBSG 3PUVA 5EAYA 4IO9A 4A4IA 3CCSA 1TWCH 4LFAL 4L5RC 1PVOA 1E24A 2E8GA 4FDBA 2R7FA 1K73C 3I4MH 1IL2A 1PHJA 1R9TH 3S1MH 1E3PA 2WB1E 1SLJA 4JI2Q 5C0XG 2E5LL 4JI7L 2VS1A 4LF5L 1VQGA 1WOCA 2PI2E 3I4NG 3G4SA 5LMNW 1SRUA 4DV7L 3JAMc 3CCJA 4NPSA 1EFWA 4LF9Q 4QIWE 4GKKQ 5IY0A 5DLQE 4A3JG 1V9PA 3TS0A 1XNRQ 1PYSB 2EIFA 1IBKQ 3I55A 1VQ6A 2ZJPA 1FL0A 1S72A 3A5ZB 3WWVA 3S2DH 4X65Q 1YBYA 1UWVA 3HKSA 2PQAA 1YI2A 1VQ7A 3S1NH 3BZCA 2DUDA 3HOZH 3S17H 5IYDH 1KL9A 2Q2HA 4DV2L 4L5TA 2MQHA 1J5EL 3GTQH 1FGUA 2EXDA 2K14A 4JV5Q 4YY3Q 4HJ8A 4B3SL 3GO5A 2JA7H 1V43A 2BA0A 3M4OH 5M5XH 1OXUA 4A3FG 4X64Q 5BR8Q 1D8LA 5AJ3Q 5FJ8H 4JI4Q 4K0KQ 1ASYA 1WJJA 4LFBL 1GVPA 5IP7G 1Y1VG 3AFQA 3STBD 1VQ5A 4BBSH 2RHQB 4IPDA 1VQ9A 3BU2A 1N8RC 5GROA 1B8AA 4DV6L 2NVXH 4A3GH 1LYLA 3HOXH 1Y1WG 3CD6A 4B3TL 2K52A 1VQEA 3CQZH 3ERSX 4X62L 2BA1A 3ULJA 5IYCG 1PH1A 1HR0L 3PIOA 2UXCQ 4MNOA 1L0WA 1G51A 2C35B 3J80c 3H15A 4LF4L 3KFUA 3STBC 4JI0L 4LFAQ 4JCVE 1VQAA 2D0PA 1QVGA 2N3SA 2RF4A 2OWOA 2UUBL 1XPUA 2DGYA 2E5LQ 4JI7Q 4LF5Q 1KHIA 3CP0A 2NN6G 5C4JH 4DV7Q 4DR4L 2BH8A 2UUAL 1OXVA 4LNQA 4TQUS 1AH9A 4EX5A 4DV1L 5C44G 2PI2A 3SGIA 1U0LA 3J7ZC 2IX1A 2VQFL 3GTLH 2WB1G 1CSPA 5GQOA 1CKNB 4KHZA 1TXYA 4QL5A 3I2ZA 3KF6B 1TWAH 1SMXA 1S40A 3ICEA 2B29A 5M3FG 2KENA 2WFWA 4HJ7A 4AQYL 1HZ9A 4YWKA 2AMCB 2UXBL 4EQ5A 3J7A5 4DV2Q 4WJ3M 4LWCA 4P73A 2IX0A 1J5EQ 1VQDA 1Y14B 4HJ5A 1X56A 4UPAA 2AKWB 4C3IH 5C3EH 4DKAC 4L5QA 2ALYB 1Y1VH 2A1AA 4B3SQ 2RHSB 4GNXB 4YHHL 4HIMA 4A3KG 4R1JA 3PO2H 4DV3L 2F4VL 3AQQA 1W3SA 3E9IA 4LFBQ 2Y0SG 4R4TA 1V1QA 3EIVA 4A3LG 1YITA 3PO3H 1Q8KA 4YWLA 1CSQA 4MTNA 3A74A 1UEBA 1C9OA 4DV6Q 4ME3A 3GTOH 4X66L 3J81i 1XPOA 4B3TQ 1RIPA 1HZCA 1MJCA 4X62Q 1HR0Q 1NE3A 1WFQA 2NVTH 3NEMA 3LGJA 2GVAA 3H0GH 5IE8A 5IYBH 4LF4Q 4JI0Q 4GLAC 3E9HA 2UUCL 4XIGS 4HIDA 5C44H 1H95A 4YCVA 2ZM6L 4GKJL 4JYAL 1RL2A 2UUBQ 2QEXA 2MO1A 2VQEL 4DR3L 1XPRA 3S14H 2VY3A 3M9BA 4DR4Q 1VQBA 1EQRA 4GLXA 2UUAQ 2F52A 4KLKA 2H5XA 4JBMA 4A3BH 4AYBE 4DV1Q 1E1OA 3RZDH 5JJKA 1VQJA 1Q12A 2VQFQ 3RZOH 1TWFH 3TQYA 3PUXA 1CKMA 1JE5A 5GADC 2Z0SA 1VQMA 5GAGC 4DR5L 3K7UC 2N78A 1PYBA 2OQ0A 1HZBA 3DM3A 2HIXA 4A3EG 1XMOL 1IBML 5K36G 3HFZB 4AQYQ 4GLVB 3S16H 4B3RL 2UXBQ 2B63G 4A3KH 2JA6G 4PMWA 4POGA 4APVA 2NZHA 4PZ6A 4Y52H 3I56A 4A75A 4LUZA 4JBJA 4BBRG 3F2DA 3NBHB 4P74A 2NN6I 4AH6A 3HOUH 3RLFA 4KHPL 1JT8A 1K8GA 1P8LA 4YHHQ 3CF5A 2LSSA 5C0XJ 3TS2A 4DV0L 1YZ6A 4DV3Q 2F4VQ 3HOWH 2JA9A 1U5KA 4A3MG 1PH8A 2JQOA 1B7YB 1MIUA 1NMFA 3JC66 4JOIA 4R4OA 3UDGA 1HNZL 1MJEA 1QVCA 3RN5A 3CCEA 5IWAL 2K5NA 3HOVG 3T1YL 1M1KC 4DUZL 4X66Q 1X6OA 4JBWA 4JI8L 1Z47A 1VQOA 1PH5A 1MKHA 4RMFA 1TWGH 1HNXL 1WCMH 4GN4B 2Y0SE 5J3BA 4DNIA 4R4CA 4OWWB 4A3DH 3F2CA 3HKZE 1I3QH 4MZ9A 2UUCQ 1X54A 3MEFA 1EYGA 4DAMA 1KRTA 2JEAI 4WJ4A 5IP9H 4IFDG 1EIFA 2ZM6Q 2R92G 4GKJQ 1OXSC 4JYAQ 3CMAA 4BXXG 1A8VA 1UE6A 2CKZB 3CPFA 3D0FA 2VQEQ 4DR3Q 1I94L 3HOYH 3U58A 1VQCA 4JC0A 3KDFA 3FHWA 1GM5A 2R7DA 2Q2UA 3UDXA 1SN8A 2D62A 2HQLA 4TVAB 1VQLA 1A0IA 4UP8A 1VQHA 1SFOH 3F8TA 4P72A 1KC8C 1O7IA 4YCWA 5JJLA 4NXNL 3J81c 4QJFA 3PUYA 4A3IG 2OQKA 4DR5Q 1QUQB 1XMOQ 1L1OA 1OXTA 3I4NH 1P16A 4AYBG 1KXLA 4JI5L 1IBMQ 2ZJRA 1QVFA 3AEVA 4B3RQ 4H02A 3PSIA 1Q86C 2OTLA 4LF8L 4R4QA 2R7ZG 3G71A 4A3JH 1SROA 1E1TA 4GOPA 1Q81C 3AYHB 3FKIG 1N32L 4KHPQ 1KAWA 1PFSA 4A3CG 1G291 3L7ZC 2AHOB 4KI0A 2CWAA 2D0OA 3EN2A 2E2IH 2CWPA 3ZJYC 4DV0Q 4IPCA 2HHHL 1NMGA 3I7FA 2ATWA 1LTLA 2UXDL 1HNZQ 2JEBI 1PH2A 3CCUA 5E7NA 1Q1BA 3GTKH 5IT9c 5IWAQ 3K8AA 4HIOA 3T1YQ 2KCMA 4JOIC 4DUZQ 2A19A 4O0AA 2RCNA 5LMUL 4DV5L 4JI8Q 1XJVA 1K0RA 3AFPA 1X3FA 3A0JA 3RLNA 4A3FH 1VQPA 4DUYL 2R92H 5C4XG 2WAQG 1HNXQ 3GDEA 2K5VA 3VDYA 1HR0W 1YIJA 1X3EA 2NVYH 5IP7H 1FJGL 2K75A 2VUMG 1B70B 1UE1A 2R93G 4Y7NH 1BKBA 1L2FA 1GD7A 2PQAB 4A93G 1I94Q 3CMEA 2IT1A 2N49A 4OWTB 1Y1WH 2CQOA 3KLWA 3RNUA 4QY7A 5IYCH 5JEAG 1EUJA 3HKZG 2XGTA 1OTCA 3BZKA 4LW1A 2YTXA 3OYYA 3PCOB 1YJWA 1YJNA 1N34L 3CCLA 2JA5G 3CXCA 2ES2A 3TRZA 4NXNQ 4QQBX 2YV5A 4LF6L 3RLOA 1VQ8A 4DR2L 3S24A 1X55A 3CAMA 3K7AH 4OWXB 3KDFB 1FVIA 1GO3E 4JI5Q 2MFIA 1D7QA 4C3HH 4IFDI 2XTIA 2JK8A 4LF8Q 1JJ2A 1L1OC 3M3YH 1YJ9A 2Z6KA 3NELA 4LF7L 3ER0A 4OONA 1KQSA 1N32Q 4IJHA 3K80C 1VQKA 1VQNA 3S15H 5HY6A 4GOPC 2NZOA 2KBNA 5M3FH 3FP9A 2YU9H 3M4QA 2HIVA 2HHHQ 1YHBA 2YYZA 4OX9L 2ASBA 2UXDQ 1DGSA 5LMNL 1I6HH 1NY4A 3NENA 4JI3L 2R6GA 5ELNA 1YHAA 1HNWL 3CCMA 3GD7A 4GN3B 5LMUQ 4DV5Q 1IBLL 3HOZG 5IYDG 5FLMG 1KIXA 2I5LX 3I4OA 4DUYQ 2JJQA 1K9MC 1YVCA 2PMZE 3W5OA 3W1GA 5FLXc 2VW9A 2HT1A 1G6PA 4YWMA 1JJCB 1SR3A 2KCTA 4A3LH 1FJGQ 1VQFA 3F2BA 2A8VA 2L15A 5GAHC 3ULPA 3F1ZA 1PV4A 4BY7G 3U50C 5FJ8G 5M5YH 2AWOA 2B3GA 2WAQE 4L5SA 2K4KA 1C0AA 1A62A 4LUOA 2CFMA 1J6QA 4NXML 1N34Q 1HJPA 3D31A 4A3GG 1IXRA 1Q1EA 3HOXG 1CKNA 2ZJQA 3IRBA 1E22A 1EWIA 2Q2TA 1VQIA 2GVBA 4LF6Q 4DR2Q 1XNQL 1Z9FA 3MXNB 3KF6A 4O2DA 3S2HH 3W1BA 3OTOL 4DR1L 3UE0A 3K81C 3CPWA 4B3ML 3G48A 3GTMH 2I5HA 2AWNA 1NJIC 3T1HL 2ZTCA 4P75A 4IOAA 2VNUD 4JBKA 1N33L 1Q46A 4LF7Q 1AE3A 2JA8G 4DR7L 4JG2A 2ZTEA 5JJIA 2WP8J 3PUZA 4POFA 5M5WH 2Z6KC 4IFDJ 4GNXA 4A3EH 1KRSA 5HGQA 4GS3A 4DK3C 3CC7A 4JI1L 1Q82C 1I50H 2QGQA 3H3VI 3CCVA 1NTGA 5FLMH 4OX9Q 2B63H 2JA6H 3GTJH 2OTJA 2IY5B 2JE6I 4RG1A 3J81j 1E7ZA 3UE1A 5LMNQ 4BBRH 4OXPA 1YNXA 3CC4A 4JI3Q 2V1CC 1HNWQ 1PA6A 1PH7A 1IBLQ 1X3GA 3CCQA 4JI6L 4DR6L 3TEHB 1VS0A 1Q7YC 3CCRA 4BY7H 1GKHA 1PH9A 4LFCL 4LUVA 4DV4L 4A3MH 3A5UA 5C3EG 1W2BA 1HZAA 1QZGA 2KHJA 2YTVA 2QA4A 4A76A 4YCUA 1YHQA 3GTPH 4BA2I 1I5FA 1SE8A 3HOVH 1IZ6A 4IJLA 1KD1C 2GN5A 2VL6A 2BH2A 3PIPA 2UU9L 3PO2G 1A63A 2ID0A 1JB7A 1EQQA 2I5MX 4OO1I 4PZ7A 3PO3G 3CW2C 3RR5A 1XMQL 4NXMQ 3M4PA 1VCIA 4IPGA 1JMCA 1NBWA 3PF5A 1X65A 1YEZA 1XNQQ 2OCEA 4BXXH 3OW2A 3Q8DA 2JA8H 4UY8C 2K50A 4C3JH 3PV0A 3OTOQ 3H0GG 2IHFA 5IYBG 4HIKA 4DR1Q 4B3MQ 1CKOA 3JAMi 2E2JH 3T1HQ 1M90C 1XTDA 3BJUA 4R4IA 1PH4A 1N33Q 3K0XA 1JJGA 1PH6A 2N8NA 3PF4A 4DR7Q 4UP9A 4PG3A 5M3MG 4A3IH 1PH3A 1N36L 1WYDA 4A3BG 3DLLA 4ALPA 4PZ8A 2F3IA 4JI1Q 2K5HA 1CUKA 1IYJB 4BY1G 3PUWA 3G6EA 4GNXC 5JEAJ 4DPGA 2R7ZH 1N9WA 5C0XI 1UE5A 2CCZA 3KJPA 4NB3A 4IOCA 3CC2A 3FKIH 4JI2L 4DK6C 3KJOA 5GAEC 1HH2P 5ELOA 4BA1I 1T9HA 4A3CH 1X9NA 4JI6Q 1S3OA 1BBWA 1TWHH 1VQ4A 1ASZA 4IPHA 4LF9L 3I4MG 4DR6Q 4GKKL 4X6AH 3KOJA 5H1SE 4LFCQ 1XNRL 4QGUA 3L2PA 3KYHC 4DV4Q 3HOUG 2KHIA 1IBKL 4AIMA 3S1RH 3B6YA 2E2HH 4J15A 3KF8B 1L1OB 2IHEA 3UDIA 2VZAA 3M7NA 4X65L 1EIYB 3GTGH 1LUZA 2UU9Q 4XTCS 2NVQH 5C4XH 2PNHA 3RN2A 3U4VA 1BVSA 3HOWG 1UE7A 1C7YA 3PGZA 2EQSA 2MNAA 4GOPB 1WI5A 4OO1G 4JV5L 4GN5A 3J80i 4DAYB 4YY3L 4UP7A 4HJ9A 1XMQQ 1EOVA 1BBUA 2LXJA 1LM0A 3E0EA 3ULLA 2VUMH 2R93H 2MO0A 3L0OA 4HJAA 3U4ZA 4X64L 4A93H 5BR8L 1K3RA 5AJ3L 3S1QH 4JI4L 1QUQA 4K0KL 1WCMG 1K83H 1K8AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AE2 A;  3TRE A;  5M3M H;  4A3D G;  2Q2I A;  2JA7 G;  2I0Q A;  3EBE A;  5IP9 G;  2YTY A;  1OXX K;  4C2M H;  2JA5 H;  3H3V H;  4BY1 H;  3HOY G;  3UDF A;  2LXK A;  4P71 A;  1N36 Q;  3M85 A;  2ZTD A;  2UXC L;  1QZH A;  2FXQ A;  4BBS G;  3PUV A;  5EAY A;  4IO9 A;  4A4I A;  3CCS A;  1TWC H;  4LFA L;  4L5R C;  1PVO A;  1E24 A;  2E8G A;  4FDB A;  2R7F A;  1K73 C;  3I4M H;  1IL2 A;  1PHJ A;  1R9T H;  3S1M H;  1E3P A;  2WB1 E;  1SLJ A;  4JI2 Q;  5C0X G;  2E5L L;  4JI7 L;  2VS1 A;  4LF5 L;  1VQG A;  1WOC A;  2PI2 E;  3I4N G;  3G4S A;  5LMN W;  1SRU A;  4DV7 L;  3JAM c;  3CCJ A;  4NPS A;  1EFW A;  4LF9 Q;  4QIW E;  4GKK Q;  5IY0 A;  5DLQ E;  4A3J G;  1V9P A;  3TS0 A;  1XNR Q;  1PYS B;  2EIF A;  1IBK Q;  3I55 A;  1VQ6 A;  2ZJP A;  1FL0 A;  1S72 A;  3A5Z B;  3WWV A;  3S2D H;  4X65 Q;  1YBY A;  1UWV A;  3HKS A;  2PQA A;  1YI2 A;  1VQ7 A;  3S1N H;  3BZC A;  2DUD A;  3HOZ H;  3S17 H;  5IYD H;  1KL9 A;  2Q2H A;  4DV2 L;  4L5T A;  2MQH A;  1J5E L;  3GTQ H;  1FGU A;  2EXD A;  2K14 A;  4JV5 Q;  4YY3 Q;  4HJ8 A;  4B3S L;  3GO5 A;  2JA7 H;  1V43 A;  2BA0 A;  3M4O H;  5M5X H;  1OXU A;  4A3F G;  4X64 Q;  5BR8 Q;  1D8L A;  5AJ3 Q;  5FJ8 H;  4JI4 Q;  4K0K Q;  1ASY A;  1WJJ A;  4LFB L;  1GVP A;  5IP7 G;  1Y1V G;  3AFQ A;  3STB D;  1VQ5 A;  4BBS H;  2RHQ B;  4IPD A;  1VQ9 A;  3BU2 A;  1N8R C;  5GRO A;  1B8A A;  4DV6 L;  2NVX H;  4A3G H;  1LYL A;  3HOX H;  1Y1W G;  3CD6 A;  4B3T L;  2K52 A;  1VQE A;  3CQZ H;  3ERS X;  4X62 L;  2BA1 A;  3ULJ A;  5IYC G;  1PH1 A;  1HR0 L;  3PIO A;  2UXC Q;  4MNO A;  1L0W A;  1G51 A;  2C35 B;  3J80 c;  3H15 A;  4LF4 L;  3KFU A;  3STB C;  4JI0 L;  4LFA Q;  4JCV E;  1VQA A;  2D0P A;  1QVG A;  2N3S A;  2RF4 A;  2OWO A;  2UUB L;  1XPU A;  2DGY A;  2E5L Q;  4JI7 Q;  4LF5 Q;  1KHI A;  3CP0 A;  2NN6 G;  5C4J H;  4DV7 Q;  4DR4 L;  2BH8 A;  2UUA L;  1OXV A;  4LNQ A;  4TQU S;  1AH9 A;  4EX5 A;  4DV1 L;  5C44 G;  2PI2 A;  3SGI A;  1U0L A;  3J7Z C;  2IX1 A;  2VQF L;  3GTL H;  2WB1 G;  1CSP A;  5GQO A;  1CKN B;  4KHZ A;  1TXY A;  4QL5 A;  3I2Z A;  3KF6 B;  1TWA H;  1SMX A;  1S40 A;  3ICE A;  2B29 A;  5M3F G;  2KEN A;  2WFW A;  4HJ7 A;  4AQY L;  1HZ9 A;  4YWK A;  2AMC B;  2UXB L;  4EQ5 A;  3J7A 5;  4DV2 Q;  4WJ3 M;  4LWC A;  4P73 A;  2IX0 A;  1J5E Q;  1VQD A;  1Y14 B;  4HJ5 A;  1X56 A;  4UPA A;  2AKW B;  4C3I H;  5C3E H;  4DKA C;  4L5Q A;  2ALY B;  1Y1V H;  2A1A A;  4B3S Q;  2RHS B;  4GNX B;  4YHH L;  4HIM A;  4A3K G;  4R1J A;  3PO2 H;  4DV3 L;  2F4V L;  3AQQ A;  1W3S A;  3E9I A;  4LFB Q;  2Y0S G;  4R4T A;  1V1Q A;  3EIV A;  4A3L G;  1YIT A;  3PO3 H;  1Q8K A;  4YWL A;  1CSQ A;  4MTN A;  3A74 A;  1UEB A;  1C9O A;  4DV6 Q;  4ME3 A;  3GTO H;  4X66 L;  3J81 i;  1XPO A;  4B3T Q;  1RIP A;  1HZC A;  1MJC A;  4X62 Q;  1HR0 Q;  1NE3 A;  1WFQ A;  2NVT H;  3NEM A;  3LGJ A;  2GVA A;  3H0G H;  5IE8 A;  5IYB H;  4LF4 Q;  4JI0 Q;  4GLA C;  3E9H A;  2UUC L;  4XIG S;  4HID A;  5C44 H;  1H95 A;  4YCV A;  2ZM6 L;  4GKJ L;  4JYA L;  1RL2 A;  2UUB Q;  2QEX A;  2MO1 A;  2VQE L;  4DR3 L;  1XPR A;  3S14 H;  2VY3 A;  3M9B A;  4DR4 Q;  1VQB A;  1EQR A;  4GLX A;  2UUA Q;  2F52 A;  4KLK A;  2H5X A;  4JBM A;  4A3B H;  4AYB E;  4DV1 Q;  1E1O A;  3RZD H;  5JJK A;  1VQJ A;  1Q12 A;  2VQF Q;  3RZO H;  1TWF H;  3TQY A;  3PUX A;  1CKM A;  1JE5 A;  5GAD C;  2Z0S A;  1VQM A;  5GAG C;  4DR5 L;  3K7U C;  2N78 A;  1PYB A;  2OQ0 A;  1HZB A;  3DM3 A;  2HIX A;  4A3E G;  1XMO L;  1IBM L;  5K36 G;  3HFZ B;  4AQY Q;  4GLV B;  3S16 H;  4B3R L;  2UXB Q;  2B63 G;  4A3K H;  2JA6 G;  4PMW A;  4POG A;  4APV A;  2NZH A;  4PZ6 A;  4Y52 H;  3I56 A;  4A75 A;  4LUZ A;  4JBJ A;  4BBR G;  3F2D A;  3NBH B;  4P74 A;  2NN6 I;  4AH6 A;  3HOU H;  3RLF A;  4KHP L;  1JT8 A;  1K8G A;  1P8L A;  4YHH Q;  3CF5 A;  2LSS A;  5C0X J;  3TS2 A;  4DV0 L;  1YZ6 A;  4DV3 Q;  2F4V Q;  3HOW H;  2JA9 A;  1U5K A;  4A3M G;  1PH8 A;  2JQO A;  1B7Y B;  1MIU A;  1NMF A;  3JC6 6;  4JOI A;  4R4O A;  3UDG A;  1HNZ L;  1MJE A;  1QVC A;  3RN5 A;  3CCE A;  5IWA L;  2K5N A;  3HOV G;  3T1Y L;  1M1K C;  4DUZ L;  4X66 Q;  1X6O A;  4JBW A;  4JI8 L;  1Z47 A;  1VQO A;  1PH5 A;  1MKH A;  4RMF A;  1TWG H;  1HNX L;  1WCM H;  4GN4 B;  2Y0S E;  5J3B A;  4DNI A;  4R4C A;  4OWW B;  4A3D H;  3F2C A;  3HKZ E;  1I3Q H;  4MZ9 A;  2UUC Q;  1X54 A;  3MEF A;  1EYG A;  4DAM A;  1KRT A;  2JEA I;  4WJ4 A;  5IP9 H;  4IFD G;  1EIF A;  2ZM6 Q;  2R92 G;  4GKJ Q;  1OXS C;  4JYA Q;  3CMA A;  4BXX G;  1A8V A;  1UE6 A;  2CKZ B;  3CPF A;  3D0F A;  2VQE Q;  4DR3 Q;  1I94 L;  3HOY H;  3U58 A;  1VQC A;  4JC0 A;  3KDF A;  3FHW A;  1GM5 A;  2R7D A;  2Q2U A;  3UDX A;  1SN8 A;  2D62 A;  2HQL A;  4TVA B;  1VQL A;  1A0I A;  4UP8 A;  1VQH A;  1SFO H;  3F8T A;  4P72 A;  1KC8 C;  1O7I A;  4YCW A;  5JJL A;  4NXN L;  3J81 c;  4QJF A;  3PUY A;  4A3I G;  2OQK A;  4DR5 Q;  1QUQ B;  1XMO Q;  1L1O A;  1OXT A;  3I4N H;  1P16 A;  4AYB G;  1KXL A;  4JI5 L;  1IBM Q;  2ZJR A;  1QVF A;  3AEV A;  4B3R Q;  4H02 A;  3PSI A;  1Q86 C;  2OTL A;  4LF8 L;  4R4Q A;  2R7Z G;  3G71 A;  4A3J H;  1SRO A;  1E1T A;  4GOP A;  1Q81 C;  3AYH B;  3FKI G;  1N32 L;  4KHP Q;  1KAW A;  1PFS A;  4A3C G;  1G29 1;  3L7Z C;  2AHO B;  4KI0 A;  2CWA A;  2D0O A;  3EN2 A;  2E2I H;  2CWP A;  3ZJY C;  4DV0 Q;  4IPC A;  2HHH L;  1NMG A;  3I7F A;  2ATW A;  1LTL A;  2UXD L;  1HNZ Q;  2JEB I;  1PH2 A;  3CCU A;  5E7N A;  1Q1B A;  3GTK H;  5IT9 c;  5IWA Q;  3K8A A;  4HIO A;  3T1Y Q;  2KCM A;  4JOI C;  4DUZ Q;  2A19 A;  4O0A A;  2RCN A;  5LMU L;  4DV5 L;  4JI8 Q;  1XJV A;  1K0R A;  3AFP A;  1X3F A;  3A0J A;  3RLN A;  4A3F H;  1VQP A;  4DUY L;  2R92 H;  5C4X G;  2WAQ G;  1HNX Q;  3GDE A;  2K5V A;  3VDY A;  1HR0 W;  1YIJ A;  1X3E A;  2NVY H;  5IP7 H;  1FJG L;  2K75 A;  2VUM G;  1B70 B;  1UE1 A;  2R93 G;  4Y7N H;  1BKB A;  1L2F A;  1GD7 A;  2PQA B;  4A93 G;  1I94 Q;  3CME A;  2IT1 A;  2N49 A;  4OWT B;  1Y1W H;  2CQO A;  3KLW A;  3RNU A;  4QY7 A;  5IYC H;  5JEA G;  1EUJ A;  3HKZ G;  2XGT A;  1OTC A;  3BZK A;  4LW1 A;  2YTX A;  3OYY A;  3PCO B;  1YJW A;  1YJN A;  1N34 L;  3CCL A;  2JA5 G;  3CXC A;  2ES2 A;  3TRZ A;  4NXN Q;  4QQB X;  2YV5 A;  4LF6 L;  3RLO A;  1VQ8 A;  4DR2 L;  3S24 A;  1X55 A;  3CAM A;  3K7A H;  4OWX B;  3KDF B;  1FVI A;  1GO3 E;  4JI5 Q;  2MFI A;  1D7Q A;  4C3H H;  4IFD I;  2XTI A;  2JK8 A;  4LF8 Q;  1JJ2 A;  1L1O C;  3M3Y H;  1YJ9 A;  2Z6K A;  3NEL A;  4LF7 L;  3ER0 A;  4OON A;  1KQS A;  1N32 Q;  4IJH A;  3K80 C;  1VQK A;  1VQN A;  3S15 H;  5HY6 A;  4GOP C;  2NZO A;  2KBN A;  5M3F H;  3FP9 A;  2YU9 H;  3M4Q A;  2HIV A;  2HHH Q;  1YHB A;  2YYZ A;  4OX9 L;  2ASB A;  2UXD Q;  1DGS A;  5LMN L;  1I6H H;  1NY4 A;  3NEN A;  4JI3 L;  2R6G A;  5ELN A;  1YHA A;  1HNW L;  3CCM A;  3GD7 A;  4GN3 B;  5LMU Q;  4DV5 Q;  1IBL L;  3HOZ G;  5IYD G;  5FLM G;  1KIX A;  2I5L X;  3I4O A;  4DUY Q;  2JJQ A;  1K9M C;  1YVC A;  2PMZ E;  3W5O A;  3W1G A;  5FLX c;  2VW9 A;  2HT1 A;  1G6P A;  4YWM A;  1JJC B;  1SR3 A;  2KCT A;  4A3L H;  1FJG Q;  1VQF A;  3F2B A;  2A8V A;  2L15 A;  5GAH C;  3ULP A;  3F1Z A;  1PV4 A;  4BY7 G;  3U50 C;  5FJ8 G;  5M5Y H;  2AWO A;  2B3G A;  2WAQ E;  4L5S A;  2K4K A;  1C0A A;  1A62 A;  4LUO A;  2CFM A;  1J6Q A;  4NXM L;  1N34 Q;  1HJP A;  3D31 A;  4A3G G;  1IXR A;  1Q1E A;  3HOX G;  1CKN A;  2ZJQ A;  3IRB A;  1E22 A;  1EWI A;  2Q2T A;  1VQI A;  2GVB A;  4LF6 Q;  4DR2 Q;  1XNQ L;  1Z9F A;  3MXN B;  3KF6 A;  4O2D A;  3S2H H;  3W1B A;  3OTO L;  4DR1 L;  3UE0 A;  3K81 C;  3CPW A;  4B3M L;  3G48 A;  3GTM H;  2I5H A;  2AWN A;  1NJI C;  3T1H L;  2ZTC A;  4P75 A;  4IOA A;  2VNU D;  4JBK A;  1N33 L;  1Q46 A;  4LF7 Q;  1AE3 A;  2JA8 G;  4DR7 L;  4JG2 A;  2ZTE A;  5JJI A;  2WP8 J;  3PUZ A;  4POF A;  5M5W H;  2Z6K C;  4IFD J;  4GNX A;  4A3E H;  1KRS A;  5HGQ A;  4GS3 A;  4DK3 C;  3CC7 A;  4JI1 L;  1Q82 C;  1I50 H;  2QGQ A;  3H3V I;  3CCV A;  1NTG A;  5FLM H;  4OX9 Q;  2B63 H;  2JA6 H;  3GTJ H;  2OTJ A;  2IY5 B;  2JE6 I;  4RG1 A;  3J81 j;  1E7Z A;  3UE1 A;  5LMN Q;  4BBR H;  4OXP A;  1YNX A;  3CC4 A;  4JI3 Q;  2V1C C;  1HNW Q;  1PA6 A;  1PH7 A;  1IBL Q;  1X3G A;  3CCQ A;  4JI6 L;  4DR6 L;  3TEH B;  1VS0 A;  1Q7Y C;  3CCR A;  4BY7 H;  1GKH A;  1PH9 A;  4LFC L;  4LUV A;  4DV4 L;  4A3M H;  3A5U A;  5C3E G;  1W2B A;  1HZA A;  1QZG A;  2KHJ A;  2YTV A;  2QA4 A;  4A76 A;  4YCU A;  1YHQ A;  3GTP H;  4BA2 I;  1I5F A;  1SE8 A;  3HOV H;  1IZ6 A;  4IJL A;  1KD1 C;  2GN5 A;  2VL6 A;  2BH2 A;  3PIP A;  2UU9 L;  3PO2 G;  1A63 A;  2ID0 A;  1JB7 A;  1EQQ A;  2I5M X;  4OO1 I;  4PZ7 A;  3PO3 G;  3CW2 C;  3RR5 A;  1XMQ L;  4NXM Q;  3M4P A;  1VCI A;  4IPG A;  1JMC A;  1NBW A;  3PF5 A;  1X65 A;  1YEZ A;  1XNQ Q;  2OCE A;  4BXX H;  3OW2 A;  3Q8D A;  2JA8 H;  4UY8 C;  2K50 A;  4C3J H;  3PV0 A;  3OTO Q;  3H0G G;  2IHF A;  5IYB G;  4HIK A;  4DR1 Q;  4B3M Q;  1CKO A;  3JAM i;  2E2J H;  3T1H Q;  1M90 C;  1XTD A;  3BJU A;  4R4I A;  1PH4 A;  1N33 Q;  3K0X A;  1JJG A;  1PH6 A;  2N8N A;  3PF4 A;  4DR7 Q;  4UP9 A;  4PG3 A;  5M3M G;  4A3I H;  1PH3 A;  1N36 L;  1WYD A;  4A3B G;  3DLL A;  4ALP A;  4PZ8 A;  2F3I A;  4JI1 Q;  2K5H A;  1CUK A;  1IYJ B;  4BY1 G;  3PUW A;  3G6E A;  4GNX C;  5JEA J;  4DPG A;  2R7Z H;  1N9W A;  5C0X I;  1UE5 A;  2CCZ A;  3KJP A;  4NB3 A;  4IOC A;  3CC2 A;  3FKI H;  4JI2 L;  4DK6 C;  3KJO A;  5GAE C;  1HH2 P;  5ELO A;  4BA1 I;  1T9H A;  4A3C H;  1X9N A;  4JI6 Q;  1S3O A;  1BBW A;  1TWH H;  1VQ4 A;  1ASZ A;  4IPH A;  4LF9 L;  3I4M G;  4DR6 Q;  4GKK L;  4X6A H;  3KOJ A;  5H1S E;  4LFC Q;  1XNR L;  4QGU A;  3L2P A;  3KYH C;  4DV4 Q;  3HOU G;  2KHI A;  1IBK L;  4AIM A;  3S1R H;  3B6Y A;  2E2H H;  4J15 A;  3KF8 B;  1L1O B;  2IHE A;  3UDI A;  2VZA A;  3M7N A;  4X65 L;  1EIY B;  3GTG H;  1LUZ A;  2UU9 Q;  4XTC S;  2NVQ H;  5C4X H;  2PNH A;  3RN2 A;  3U4V A;  1BVS A;  3HOW G;  1UE7 A;  1C7Y A;  3PGZ A;  2EQS A;  2MNA A;  4GOP B;  1WI5 A;  4OO1 G;  4JV5 L;  4GN5 A;  3J80 i;  4DAY B;  4YY3 L;  4UP7 A;  4HJ9 A;  1XMQ Q;  1EOV A;  1BBU A;  2LXJ A;  1LM0 A;  3E0E A;  3ULL A;  2VUM H;  2R93 H;  2MO0 A;  3L0O A;  4HJA A;  3U4Z A;  4X64 L;  4A93 H;  5BR8 L;  1K3R A;  5AJ3 L;  3S1Q H;  4JI4 L;  1QUQ A;  4K0K L;  1WCM G;  1K83 H;  1K8A C; 
#chains in the Genus database with same CATH topology
 1AE2 A;  1QNU A;  2HQE A;  2NVQ B;  2JA7 G;  3EBE A;  4ZKB B;  1OXX K;  4RHR A;  2K33 A;  1O78 A;  1R4P B;  2PZT A;  4IO9 A;  4A4I A;  3CCS A;  2I07 B;  1LTS D;  1E24 A;  2E8G A;  3VA7 A;  1K73 C;  1ML0 D;  3DEO A;  1R9T H;  1E3P A;  4LF5 L;  1C8C A;  1WOC A;  2F0L A;  3I4L A;  4JPB W;  3BYT B;  2JA5 B;  3CCJ A;  1LT5 D;  3TZD A;  3HEJ A;  2LMC B;  4F8M A;  5IY0 A;  5DLQ E;  1V9P A;  3TS0 A;  1TII D;  2EIF A;  2NUC A;  2D2C C;  1J8I A;  1FL0 A;  1S72 A;  2RDG A;  3A5Z B;  3WWV A;  2K28 A;  2DUD A;  2EYM A;  3BZC A;  1B9N A;  1YNJ C;  1KL9 A;  3RD4 A;  3GTQ H;  4KHV A;  4XQN A;  1IW7 D;  1VF7 A;  1V43 A;  1I4P A;  2NZ1 D;  4A3F G;  5BR8 Q;  4JI4 Q;  4A3E B;  1WJJ A;  2BOS A;  1BCP B;  3S1N B;  5IP7 G;  1VDZ A;  3GTJ B;  4IPD A;  3BU2 A;  2RSO A;  1LT3 D;  3T51 B;  3HOX H;  3Q23 A;  3CQZ H;  3KBX A;  5IYC G;  2L9H A;  1L0W A;  4KJO A;  1PRT C;  2C35 B;  3KFU A;  4JI0 L;  1GOZ A;  4LFA Q;  4BY7 B;  4JCV E;  1VQA A;  2CVR A;  2OWO A;  1EY9 A;  1TS5 A;  1A6X A;  2UUB L;  4FYD A;  1ICF B;  1PRT B;  1B1Z A;  2AQ2 B;  3ONA B;  1FR3 A;  1DD2 A;  2B2U A;  3CP0 A;  4A3G B;  2NVX B;  2BH8 A;  3K59 A;  4C3H G;  1BBX C;  4DV1 L;  3K6O A;  5C44 G;  2PI2 A;  1SE2 A;  1CA5 A;  5GQO A;  2EY2 A;  3X3M A;  2DJG C;  1LTB D;  4QL5 A;  1SMX A;  1S40 A;  3EA6 A;  2KEN A;  4IUR A;  2WFW A;  2JA8 B;  1HZ9 A;  4YWK A;  2F0Q A;  2N55 A;  4EQ5 A;  4LWC A;  4P73 A;  2L0C A;  2L11 A;  1Y14 B;  2P5Z X;  1X56 A;  4C3I H;  1M8A A;  1SE4 A;  3FMC A;  1SYG A;  1QG7 A;  4ZYS A;  4YHH L;  4HIM A;  4R1J A;  3MXN A;  2IL8 A;  3AQQ A;  4KTA A;  4FF4 A;  4R4T A;  1ILP A;  3QIA A;  1Q8K A;  4YWL A;  2A68 D;  3QJY A;  4DV6 Q;  4H7B A;  2E2D C;  4RKL A;  4UHV A;  5C3E B;  2HDL A;  1NE3 A;  5CGK A;  2AUJ D;  2NVT H;  5F2D A;  2C5C A;  4OHJ A;  5IYB H;  4LF4 Q;  4UAI A;  1PLF A;  4XIG S;  5NUC A;  1PMR A;  4JYA L;  2VQE L;  3S14 H;  3M9B A;  2B2W C;  1EQR A;  4A3B H;  1E1O A;  1HHV A;  4XQJ A;  2F0N A;  2KEE A;  2VQF Q;  2H1E A;  5GAD C;  2VUM B;  5GAG C;  1T5X D;  2A6E C;  2J0T D;  1IBM L;  5K36 G;  4GLV B;  1PFN A;  2UXB Q;  4A3K H;  2MUY A;  1WTO A;  1JC7 A;  4LUZ A;  4JBJ A;  4BBR G;  4P74 A;  4AH6 A;  3HOU H;  1HRJ A;  4KHP L;  1JT8 A;  1ICW A;  2ZT9 C;  1H9J A;  4NW2 A;  5TSS A;  2LSS A;  4KK7 A;  5G3L D;  2F4V Q;  5E1F A;  1F9Q A;  1MIU A;  1HNZ L;  3UDG A;  1TWC B;  1MJE A;  1AEX A;  4XXE A;  3HOV G;  3T1Y L;  3CU7 A;  4XYO A;  1RTN A;  5DM6 3;  1X6O A;  1SDF A;  4KKT A;  5C5L A;  1VQO A;  1BDO A;  3AMU A;  1LTT D;  4DAP A;  1HNX L;  1QNK A;  4R4C A;  4G7O C;  2OXP A;  5IGB A;  2R92 G;  4GKJ Q;  5CV5 A;  1I4X A;  1A8V A;  2CKZ B;  1I94 L;  5EKL A;  2IW3 A;  4C3J G;  5KNB A;  2R7D A;  3OMC A;  2PW7 A;  2HQL A;  1VQL A;  4UP8 A;  3SK4 A;  1TWG B;  2E76 C;  1KC8 C;  4A3D B;  2B2V C;  4A3I G;  3M4O B;  4OL7 A;  2K32 A;  3KF8 A;  4DNT B;  1J9O A;  1IKM A;  4B3R Q;  4H02 A;  2JXM B;  3K58 A;  5IOC A;  4R4Q A;  2R7Z G;  3G71 A;  4FF3 A;  5KIX A;  2CW0 C;  1E1T A;  4F88 A;  4CJ0 B;  1Q81 C;  4BBS B;  1N32 L;  3QG1 A;  1KAW A;  2B39 A;  1HPC A;  1G29 1;  1JB3 A;  5FLX E;  1Z7T A;  2F1M A;  2CWP A;  4IPC A;  3I7F A;  1O7Y A;  1GUO A;  2JEB I;  1Q8I A;  1SBB B;  1E2V A;  4DGZ A;  3OMG A;  3BVZ A;  3K8A A;  1TS3 A;  2RCN A;  5D3I B;  1K0R A;  3AFP A;  5C4X G;  4A3F H;  4DUY L;  5ELE A;  3A8J E;  2WAQ G;  3ERO A;  1KAA A;  1HR0 W;  1X3E A;  5IP7 H;  1ZYR D;  1FJG L;  2C9O A;  3TP7 A;  4TRD A;  2K75 A;  3T16 A;  1BKB A;  1L2F A;  1GD7 A;  4A93 G;  3CME A;  1EYA A;  2N49 A;  2DY8 A;  3GTK B;  3P20 A;  1D5Z C;  3J7Y W;  4CHT B;  5IYC H;  1EUJ A;  3OIQ A;  3HKZ G;  5ELD A;  1OTC A;  1S5F D;  1N34 L;  1YJN A;  3NK9 A;  4WFN 3;  3C1F A;  4NXN Q;  4QQB X;  4K14 A;  3H91 A;  4LF6 L;  3CAM A;  5I4D A;  2IPK D;  4KV6 A;  4OWX B;  2JYO A;  2JN4 A;  3KDF B;  2MFI A;  3PO2 B;  1B2T A;  1D7Q A;  4C3H H;  5CV6 A;  1NR2 A;  2JK8 A;  2AQ1 B;  2F0G A;  1JJ2 A;  1G2S A;  3PO3 B;  3NEL A;  4LF7 L;  1ONL A;  4X3T A;  3U9O A;  1LTA D;  1STB A;  3S15 H;  3K5O A;  2K03 A;  2KBN A;  2ZXO A;  3MZ5 A;  1KTK A;  5CR3 A;  3FP9 A;  2F0V A;  3I72 A;  1F2Z A;  4LAA A;  2CHB D;  3NEN A;  3R2I A;  3BVG A;  5DAU A;  3GD7 A;  5LMU Q;  3HOZ G;  1B3A A;  1K8O A;  2Z4I A;  1Y8O B;  2I5L X;  3I4O A;  4TSS A;  2E75 C;  2JJQ A;  2HT1 A;  2VW9 A;  4RKB A;  1JCK B;  1SR3 A;  1VQF A;  3RZO B;  4Z9C B;  1EY0 A;  3F1Z A;  4J1M A;  1II3 A;  2CQA A;  2O5J C;  3N6R A;  4PMB A;  1DJR D;  2K4K A;  3S16 B;  1A62 A;  3UI2 A;  4NXM L;  1EQV A;  3D31 A;  4B9W A;  2PZU A;  1E2W A;  2Y0S B;  2ZJQ A;  1Z9F A;  5AFW A;  3UE0 A;  3K81 C;  4B3M L;  3G48 A;  1A3V A;  1BOS A;  2F0O A;  2NYZ D;  4LJZ C;  4DR7 L;  4JG2 A;  3PUZ A;  4IFD J;  5J1Z A;  2RBM A;  4G7H C;  5K36 H;  3S2H B;  3H94 A;  4OX9 Q;  3A7A B;  1JWS D;  2K6A A;  5COR A;  4M1U B;  4BBR H;  1K0S A;  1YNX A;  3CC4 A;  4FXD A;  1G6Z A;  2Z4H A;  1IHZ A;  1EQT A;  4ZLT F;  3Q24 A;  1VS0 A;  5FKA C;  1PH9 A;  4LFC L;  4LUV A;  4DV4 L;  5EPJ A;  1W2B A;  2QDB A;  1SFO B;  1ZXT A;  2B63 B;  4BA2 I;  2JA6 B;  1I5F A;  5CV9 A;  3HOV H;  1KD1 C;  1PXU A;  2B2Y A;  4CDF C;  2FFK B;  1A63 A;  1JB7 A;  3I4N B;  2I5M X;  1MI2 A;  1PFB A;  1B44 D;  5JJZ A;  2F3V A;  4XQQ A;  3CW2 C;  4KY6 A;  1AW7 A;  3MXG A;  3SVM A;  4KMU C;  1JMC A;  2SDF A;  4CDD C;  4A3M B;  1NUC A;  3Q8D A;  4H13 C;  3GTP B;  4C3J H;  3OTO Q;  3H0G G;  1Y8P B;  2KJX A;  2KA7 A;  3JAM i;  2E2J H;  1M90 C;  1PH4 A;  2A6H D;  3K0X A;  1U4M A;  4RWS C;  1A2T A;  2PQE A;  3JAM E;  3PF4 A;  4UP9 A;  4A3I H;  2I46 A;  5KNC A;  1WYD A;  2Z6B A;  5IGD A;  5IIF A;  4NP5 A;  2MHV A;  4GNX C;  2R7Z H;  1N9W A;  2CCZ A;  4NB3 A;  4IOC A;  2EJF C;  1T9H A;  2D9U A;  1RTO A;  1X9N A;  4JI6 Q;  4DR6 Q;  3KOJ A;  3H09 A;  2KCC A;  2K7V A;  3T4A C;  2EYF A;  3S1R H;  4ZAI A;  2E2H H;  1BF4 A;  1L1O B;  3UDI A;  2QW7 A;  4DXG A;  5C4X H;  3K7A B;  3HOW G;  1BVS A;  1UE7 A;  3PGZ A;  2R61 A;  1DXM A;  4RCN A;  2MNA A;  1K28 A;  3K5M A;  1CT1 D;  1R4Q B;  1EOV A;  4X3K A;  1STH A;  4A93 H;  5BR8 L;  4JI4 L;  1WCM G;  1ENC A;  1K83 H;  5M3M H;  4R8I A;  2B2T A;  2F0H A;  2KED A;  2Q2I A;  4E6I A;  1SYE A;  3FPU B;  5IP9 G;  5JPM C;  4C2M H;  1G2T A;  3UDF A;  5I9P A;  1N36 Q;  3J7A F;  4ULL A;  2R93 B;  1F2Y A;  4JK1 C;  3PUV A;  1H9S B;  4LFA L;  3S1Q B;  3V96 A;  2FIN B;  2M00 A;  4FDB A;  2R7F A;  2A69 D;  4ZUJ A;  1TY2 A;  2RVL A;  4CGY B;  1SRU A;  3G4S A;  5LMN W;  1S5D D;  4LF9 Q;  4GKK Q;  1EEF D;  3T53 B;  1AP0 A;  1PYS B;  1H9K A;  4PQX A;  1IBK Q;  1VQ6 A;  2ZJP A;  4OO1 H;  1FNU A;  4X65 Q;  3BDL A;  1LO5 D;  2PQA A;  1R9T B;  3HOZ H;  3S17 H;  4L5T A;  1ZEQ X;  2K14 A;  1CA6 A;  4HED A;  4JV5 Q;  2XSC A;  2SOB A;  4HJ8 A;  1STA A;  2EYH A;  2BA0 A;  5M5X H;  3GQB A;  1PTO B;  4X64 Q;  5AJ3 Q;  4K0K Q;  1ASY A;  2KQ3 A;  5C4H A;  1GVP A;  3AFQ A;  2NWG A;  3STB D;  1VQ5 A;  1VQ9 A;  3BVM A;  1B8A A;  4RHS A;  4BWG B;  4DV6 L;  5C6A A;  1Y1W G;  2L4N A;  1VQE A;  3ULJ A;  1ET9 A;  2UXC Q;  1LAB A;  3FRP B;  3J80 c;  3H15 A;  2F0D A;  1H9M A;  4LF4 L;  2D0P A;  2N3S A;  1SYD A;  1X3P A;  2RF4 A;  5LL6 X;  2DGY A;  2X6G A;  3Q22 A;  2NN6 G;  5A2Q L;  4DV7 Q;  1EIH A;  1LLR D;  1SJH D;  4EVO A;  1OXV A;  4LNQ A;  3CQZ B;  4QB4 A;  3J7Z C;  1CZW A;  2VQF L;  2WB1 G;  1CKN B;  4DFA A;  1GUS A;  2K01 A;  3G7L A;  3KF6 B;  3ICE A;  4L63 B;  4ZQ3 A;  4DU9 A;  5M3F G;  3TP6 A;  1TKW B;  3MXU A;  4XYQ A;  2UXB L;  4J6H A;  2BE5 D;  1J5E Q;  1U4R A;  1F2L A;  1Y1V H;  5T1G A;  3VYT A;  3I90 A;  2RHS B;  4A3K G;  3I73 A;  4FNF A;  2BDN A;  2F4V L;  1W3S A;  4LFB Q;  5DNF A;  1V1Q A;  4A3L G;  4F7X A;  1CSQ A;  3A74 A;  3GTO H;  3M7G A;  4S3S A;  1TR5 A;  4C3I B;  4KN4 C;  1AFP A;  4X62 Q;  1HR0 Q;  4FF2 A;  2XNA C;  2KVM A;  1WFQ A;  3EVQ A;  4DK0 A;  3SE0 A;  2WIN B;  3H0G H;  4ODG A;  5IE8 A;  3VA5 A;  1DM0 B;  2A68 C;  1WTW A;  4GKJ L;  2MO1 A;  1GHK A;  3GTG B;  4DR4 Q;  2A5H A;  2UUA Q;  4KLK A;  4JBM A;  2QEJ C;  3IKJ A;  1BXT A;  2B2U C;  5JJK A;  1BCP F;  1Q12 A;  3HGB A;  5LHY 1;  1TWF H;  2F0P A;  3PUX A;  1CKM A;  5ISR A;  1JE5 A;  2EYO A;  2Z0S A;  3NHH A;  3K7U C;  1PYB A;  4A3E G;  1HZB A;  2RDH A;  4LK1 C;  4AQY Q;  4B3R L;  1HXY D;  2NZH A;  2M9V A;  2TMP A;  3I56 A;  3OOC A;  4K8I A;  3SK5 A;  4A3B B;  1G8Z D;  4RAU C;  3F2D A;  3I8Z A;  1MGS A;  2NBF A;  4OIK A;  3O13 A;  4BY1 B;  4DV3 Q;  3MEH A;  3HOW H;  3MVV A;  4JOI A;  4KY7 A;  3WOF A;  3I4M B;  3OWF A;  5BN4 A;  5C4Z A;  1Z47 A;  2EZV A;  1IYU A;  1MKH A;  1SXT A;  1WCM H;  1U4L A;  2Y0S E;  4OWW B;  4QUF A;  3I91 A;  3HKZ E;  2Q8I B;  2UUC Q;  1EYG A;  1KRT A;  2JEA I;  4WJ4 A;  5IP9 H;  4IFD G;  2ZM6 Q;  1OXS C;  3CMA A;  1UE6 A;  4DR3 Q;  4CDC C;  3U58 A;  3S2D B;  4JC0 A;  3E3X A;  5HGT A;  3FHW A;  3UDX A;  2F0F A;  3MC0 B;  1SN8 A;  2D62 A;  5D14 A;  4C1N I;  1HFG A;  3F8T A;  1O7I A;  4YCW A;  4NXN L;  2IX3 A;  3PUY A;  2OQK A;  4YIJ A;  4DR5 Q;  2JA7 B;  1XMO Q;  4AYB G;  3QB3 A;  1QVF A;  3A54 A;  4ME5 A;  4X3S A;  1CI3 M;  1SNO A;  1Q86 C;  4ABN A;  3AB9 A;  4GOP A;  1SYB A;  4FXK C;  2EXZ A;  4V0B A;  2L1B A;  3J80 L;  1HTL D;  3GV3 A;  2AHO B;  4KI0 A;  2D0O A;  3DEP A;  3EN2 A;  1SMY D;  2ATW A;  1LTL A;  2ZXP A;  1WTV A;  4WRD A;  3CCU A;  5COY A;  5E7N A;  4ILW A;  1Q1B A;  2BDO A;  3KK7 A;  5IWA Q;  2KCM A;  5BN5 A;  4DUZ Q;  5LMU L;  4OGQ C;  1XJV A;  1VQP A;  3RLN A;  2F0K A;  2M2L A;  5C4J B;  3GDE A;  2K5V A;  1YIJ A;  4ID6 A;  1MSG A;  4M8A A;  3GTL B;  2VUM G;  4EQP A;  1UE1 A;  5JPN C;  1F77 A;  1PDQ A;  4OWT B;  1Y1W H;  2CQO A;  3RNU A;  1E0B A;  1IKL A;  1ZYR C;  3BZK A;  4A3F B;  2YTX A;  1YJW A;  3CCL A;  2ES2 A;  1NR4 A;  2EDG A;  3RLO A;  3S24 A;  3LX0 A;  1CHP D;  4KY5 A;  2NN6 H;  1GO3 E;  4JI5 Q;  4I7Z C;  2RCF A;  4LF8 Q;  1MBY A;  4V19 0;  3WOE A;  4IJH A;  3K80 C;  1VMP A;  2NZO A;  5M3F H;  3M4Q A;  2HIV A;  2HHH Q;  4OX9 L;  2ASB A;  1UEA B;  2A74 C;  1I6H H;  1NY4 A;  4DK1 A;  4C3H B;  4PNY A;  5C44 B;  3BZD B;  1YHA A;  2O4X A;  1KIX A;  3R2T A;  1EEI D;  5CMD A;  5FLX c;  3W1G A;  3DWQ A;  1F9S A;  4A3L H;  2A8V A;  5CV4 A;  2QKI C;  1WTR A;  4B08 A;  1SNP A;  3D4R A;  1KNE A;  3TP8 A;  4QUC A;  3TDQ A;  3NP8 A;  4L5S A;  2AUK A;  1J6Q A;  1F2M A;  1Q1E A;  4N9P A;  2Z8L A;  4N9T A;  1EWI A;  2NTS A;  2GVB A;  3T13 A;  3VYR A;  1CK1 A;  3W1B A;  3OTO L;  3GTM H;  4K2L A;  1NJI C;  4P75 A;  2OEO A;  4QCL A;  2VNU D;  3LWE A;  1L0X B;  1AE3 A;  3NE5 B;  2Q8R E;  5JJI A;  4HCS A;  1BCP D;  4A3E H;  4DK3 C;  3FDT A;  1KDB A;  2L12 A;  2IY5 B;  1B4O A;  4C1N K;  3GTJ H;  1I4R A;  1E7Z A;  5LMN Q;  1I3Q B;  1WD1 A;  4JI3 Q;  3GP7 A;  3A8K E;  1LT6 D;  3D3R A;  4JI6 L;  4DR6 L;  1EZ6 A;  1VF5 C;  1Q7Y C;  3CCR A;  4BY7 H;  3VR6 A;  5C3W A;  1PRT D;  1AZQ A;  1HZA A;  1QZG A;  3KLS A;  1YHQ A;  2DNC A;  3H6M A;  1IZ6 A;  2BH2 A;  2KEC A;  2VL6 A;  3DXJ C;  4BBR B;  3PO2 G;  2ID0 A;  4L8J A;  1EQQ A;  4IUV A;  3BYY B;  4IQZ A;  3PO3 G;  2WAC A;  1ILQ A;  2RKS A;  5FO8 B;  1UUP A;  1OO9 B;  2XN9 C;  4IFD H;  3PF5 A;  2OCE A;  3A8I E;  1WTP A;  2JA8 H;  2K50 A;  4HR7 B;  3PV0 A;  2JP1 A;  4HIK A;  1CKO A;  2F0W A;  3T1H Q;  1QWY A;  1N33 Q;  2V4D A;  2CH4 A;  5M3M G;  1N36 L;  1JOK A;  3DLL A;  2X6L A;  4PZ8 A;  4RGT A;  2R92 B;  4C3J B;  2A6H C;  3PUW A;  3G6E A;  5JEA J;  1STY A;  2NVY B;  1UE5 A;  3LWU A;  1SAP A;  1C4Q A;  1RJT A;  3KJO A;  4Y7N B;  1HH2 P;  5ELO A;  1S4Z A;  4IUQ A;  4G7Z C;  1S3O A;  1VQ4 A;  4LF9 L;  1DYQ A;  4IPH A;  4GKK L;  4X6A H;  4A3I B;  2DJF C;  5H1S E;  4QGU A;  3L2P A;  1EY8 A;  2KHI A;  4N8X 1;  4P2C B;  1IBK L;  4AIM A;  3X3N A;  2R7Z B;  4X65 L;  1EIY B;  1LUZ A;  2DY7 A;  1D2B A;  1EWC A;  3A55 A;  2PNH A;  3RN2 A;  1V8Q A;  2EQS A;  1EY6 A;  1WI5 A;  2B2Y C;  4OO1 G;  4JV5 L;  2OT2 A;  5D65 A;  4DAY B;  1GJX A;  3MWY W;  3HP3 A;  4UP7 A;  3SK8 A;  1XMQ Q;  2VUM H;  3L0O A;  4HJA A;  3U4Z A;  4X64 L;  5AJ3 L;  3CHB D;  1AN8 A;  4K0K L;  1HUM A;  4DN4 M;  2FHT A;  3TRE A;  2A6E D;  5C4X B;  5J39 A;  1STG A;  4DA2 A;  3BS1 A;  3H3V H;  3HOY G;  1TVX A;  4P71 A;  4CJ1 B;  1RCV D;  3M85 A;  2UXC L;  5CV8 A;  4KD4 A;  4A93 B;  1NSN S;  1TWC H;  2KOL A;  1IL2 A;  1PHJ A;  3S1M H;  2WB1 E;  3HKZ B;  1SLJ A;  4JI2 Q;  3DWP A;  1WTH A;  1WD0 A;  2PI2 E;  3I4N G;  1MD2 D;  4DV7 L;  3JAM c;  1EU4 A;  4NPS A;  1HTP A;  5CV7 A;  3VR2 A;  4QIW E;  5M5Y B;  1UAP A;  2WKD A;  4A3J G;  2FJ2 A;  4HSV A;  2HCI A;  2A73 B;  3V2T A;  3I55 A;  2A69 C;  2O5I C;  2K5Q A;  1VQ7 A;  4KN7 C;  4IN3 A;  2MQH A;  1J5E L;  1QJO A;  1FGU A;  5E3F A;  2EXD A;  3M4O H;  1OXU A;  2HDM A;  2K04 A;  1MHW C;  1V1P B;  4LFB L;  5IGF A;  5I6Y A;  4K2K A;  1Y1V G;  3S17 B;  4BBS H;  2EY1 A;  2D5D A;  1N8R C;  5GRO A;  2B2T C;  4L6T B;  1LYL A;  1G91 A;  4X62 L;  4HCE A;  1HR0 L;  1JIC A;  5JVG 3;  5LL6 S;  5M5X B;  1QIL A;  3STB C;  5A35 A;  1SSO A;  1QVG A;  2E5L Q;  4JI7 Q;  1JR0 D;  1SYF A;  1KHI A;  3A56 A;  4DR4 L;  2UUA L;  2QIL A;  1AH9 A;  2PCF B;  3I3C A;  3SGI A;  3HRZ C;  3TZU A;  1CSP A;  3DMU A;  1DCZ A;  1TXY A;  3D4D A;  1K3B C;  1TWA H;  2B29 A;  4OIJ A;  2RDF A;  4AQY L;  4CBV A;  4TKO B;  1RDP D;  3J7A 5;  4WJ3 M;  4DV2 Q;  4PMC A;  3TP5 A;  1VQD A;  4UPA A;  2BCO A;  1SYC A;  3K5L A;  1JOQ A;  4DKA C;  2EYL A;  2A1A A;  4B3S Q;  4DNR B;  4GNX B;  1FYC A;  1GUT A;  3A7L A;  3PO2 H;  4DV3 L;  2EPB A;  1JOR A;  2BE5 C;  1HA6 A;  2XWB B;  3PO3 H;  5K5P A;  4MTN A;  4ZKC B;  1CTM A;  3HS0 C;  1C9O A;  4ME3 A;  3FKI B;  3J81 i;  1XPO A;  4B3T Q;  3E0J A;  1ENF A;  1HZC A;  1RHP A;  4B9X A;  3LGJ A;  2GVA A;  3MHB A;  4IUU A;  1EFI D;  3J81 E;  4GLA C;  3E9H A;  5I2X A;  4K6L A;  2UUC L;  3K57 A;  2LY7 A;  4G57 A;  2ZM6 L;  4UDU C;  5ELB A;  3FVQ A;  4DR3 L;  3T56 B;  2PNR C;  3OPO A;  4XDX A;  3C3L A;  1PTO F;  5ELC A;  3GTO B;  4GLX A;  4FO2 A;  2F52 A;  4AYB E;  1TT2 A;  4HAE A;  3RZD H;  1VQJ A;  3RZO H;  2F0S A;  3H0G B;  5C5M A;  3URY A;  1VQM A;  4DR5 L;  2Z1C A;  1XMO L;  2HIX A;  2ENB A;  3HFZ B;  3S16 H;  1RF2 D;  2NTT A;  1LTI D;  4PMW A;  4POG A;  4Y52 H;  5A2Q E;  4A75 A;  5IT9 E;  3R93 A;  3NBH B;  3RLF A;  2F0M A;  4N8F A;  1P8L A;  2ICE C;  3CKI B;  5C0X J;  1YZ6 A;  4ZUI A;  2JA9 A;  1PH8 A;  3JC6 6;  4NKL A;  4R4O A;  4QMG A;  1QVC A;  2VXW A;  3JAM L;  2IJ0 A;  1DZ1 A;  5IWA L;  2K5N A;  4DUZ L;  4X66 Q;  4IAL A;  2Z9H A;  2HCC A;  2LKV A;  2QCP X;  4K5W A;  1QCB D;  1DON A;  3MEF A;  1HFN A;  3SK6 A;  1EIF A;  2NB0 A;  1TU2 B;  1XTC D;  4BXX G;  3HOY H;  1Q90 A;  3NSW A;  1VQC A;  4JVZ A;  1H9R A;  1QE6 A;  4RCO A;  1IL8 A;  1IW7 C;  5ELF A;  3SDZ A;  4TVA B;  1A0I A;  1VQH A;  1SFO H;  3GTQ B;  1WCM B;  1SEB D;  4QJF A;  1PFM A;  3D4W A;  3ND8 A;  4I7A A;  1A3T A;  1EL0 A;  1QUQ B;  2SNM A;  1ZKO A;  4I65 A;  1KXL A;  1L1O A;  3I4N H;  4JI5 L;  5KEE A;  2IWH A;  2ZJR A;  3AEV A;  3C1E A;  5KYI A;  4CKB A;  4LF8 L;  1SNM A;  2F0U A;  4A3J H;  3RUZ A;  1SRO A;  2EJM A;  4IUT A;  4CKC A;  3DWA A;  3L7Z C;  3HOX B;  3PIO 3;  4U67 3;  2AQ3 B;  1CFM A;  2CWA A;  2E2I H;  3ND9 A;  4DV0 Q;  2HHH L;  1KDA A;  5M9O A;  1PH2 A;  1BUV T;  4HIO A;  4JOI C;  3SEB A;  3FPP A;  4JI8 Q;  1O80 A;  2F03 A;  1SMY C;  1SE3 A;  4FP5 D;  3OW7 A;  3W2D A;  1ESR A;  1H9S A;  2EY5 A;  4FXG C;  1FNV A;  5BN3 A;  2IT1 A;  3NQI A;  3KLW A;  5JEA G;  2GA4 B;  1SNC A;  4NMZ A;  4WJW A;  2JA5 G;  1DOK A;  3NQT A;  2YV5 A;  1VQ8 A;  3EFX D;  1X55 A;  3K7A H;  5DEH A;  1FVI A;  3TSS A;  1Y1W B;  5I9O A;  2XTI A;  3V05 A;  1EY4 A;  2LFN A;  1CHQ D;  3M3Y H;  1V1O A;  2Z6K A;  3RMH A;  3ZYY X;  1KQS A;  1LTG D;  2XVS A;  3D6C A;  4GOP C;  2K5W A;  1AZP A;  2YU9 H;  4EQN A;  2NVT B;  3ITP A;  2UXD Q;  5LMN L;  1U4P A;  4JI3 L;  3PMF A;  5ELN A;  3WDN A;  2PYK A;  4GN3 B;  2WB1 B;  2G9H D;  4DV5 Q;  5IYD G;  1YNN D;  3SR1 A;  3MFY A;  3S14 B;  1S5E D;  2MGS A;  2PMZ E;  3W5O A;  1CQF A;  1G6P A;  5M3F B;  1Y69 U;  1JJC B;  4QIW B;  2KCT A;  5EBC A;  3OHX C;  4RGN A;  5GAH C;  1PRT F;  3ULP A;  1LV9 A;  2Q8T A;  2EOT A;  1I6H B;  1I4H A;  1PV4 A;  4BY7 G;  3U50 C;  5FJ8 G;  1FD7 D;  2B3G A;  2WAQ E;  1C0A A;  4RGO S;  4A3K B;  2CFM A;  1HJP A;  4A3G G;  1WTQ A;  4MTK A;  1CKN A;  3HOU B;  2Q2T A;  2G5D A;  4RGM A;  4DR2 Q;  3MXN B;  3KF6 A;  1EYC A;  4WOR A;  2RQX A;  4IOA A;  5I6W A;  3T1H L;  2ZTC A;  1EU3 A;  1O7Z A;  1I4G A;  4JBK A;  1N33 L;  1Q46 A;  3P7J A;  1PTO D;  5FOB B;  3CRK C;  1TS4 A;  3GV6 A;  2JA8 G;  4KKS A;  1PTO H;  2ZTE A;  3SXH A;  2WP8 J;  5M5W H;  4FF1 A;  4FVM A;  5HGQ A;  3CC7 A;  1Q82 C;  1I50 H;  2QGQ A;  3CCV A;  5FLM H;  5EJW A;  4RG1 A;  3GTM B;  3J81 j;  2RSN A;  1EZ8 A;  4OXP A;  2V1C C;  4XT3 B;  1HNW Q;  1WVL A;  1PA6 A;  1F9P A;  1BCP C;  1IBL Q;  5EPK A;  3HG9 A;  3CCQ A;  1GUG A;  2F0J A;  2QDL A;  5FO7 B;  4EQO A;  1GKH A;  2B8G A;  3M4Y A;  3A5U A;  5C3E G;  1PZJ D;  2YTV A;  2QA4 A;  4O42 A;  4K6D A;  3OWE B;  4IZ8 A;  1SE8 A;  4IJL A;  3VR4 A;  2GN5 A;  2EJG C;  5EGT A;  4OO1 I;  4PZ7 A;  1D5X C;  3RR5 A;  1XMQ L;  3KLR A;  3M4P A;  1VCI A;  4H0L C;  1CZG A;  1NBW A;  1UNS A;  1XNQ Q;  4BXX H;  4UY8 C;  4DR1 Q;  2WV6 D;  1KLU D;  4DAV A;  1XTD A;  3BJU A;  1PH6 A;  2KUM A;  2N8N A;  3ERQ A;  4R8N A;  2F3I A;  4JI1 Q;  1CUK A;  4CKE A;  1XXG A;  4JI2 L;  4DK6 C;  5GAE C;  1A15 A;  2F0E A;  4DXF A;  4HTH A;  1GUW A;  3MA2 B;  2K05 A;  1BBW A;  1TWH H;  2F0I A;  1ASZ A;  1BR9 A;  4GZY C;  4OEM B;  2EY6 A;  4AYB B;  5EKK A;  5EKI A;  1NCV A;  1PYW D;  2IHE A;  3KF8 B;  3M7N A;  2VZA A;  3GTG H;  2UU9 Q;  3LNN A;  2NVQ H;  3U4V A;  2R3Z A;  1C7Y A;  3NWS A;  1A2U A;  3W3A A;  2N88 A;  4GN5 A;  2J7Z A;  5EQ0 A;  1ESF A;  1BBU A;  2LXJ A;  1LM0 A;  3E0E A;  3Q6S A;  3ULL A;  4ZCK A;  2LS0 1;  3D6W A;  3S15 B;  1K3R A;  4KJN A;  4IUP A;  4KHZ A;  3TQY A;  3KUP A;  1TY0 A;  5JEA H;  4A3D G;  3DHQ A;  3MTS A;  2I0Q A;  2YTY A;  2JA5 H;  4BY1 H;  4K5V A;  2LXK A;  5IGE A;  2JSO A;  2ZTD A;  1QZH A;  2FXQ A;  4BBS G;  5EAY A;  2SEB D;  4CJ2 C;  4L5R C;  3H3V C;  2FMM A;  3I4M H;  1PVO A;  2DNE A;  5C0X G;  4J8Q A;  2E5L L;  2VS1 A;  4JI7 L;  1VQG A;  3NTI A;  5JAV A;  3Q0A A;  3BG3 A;  3IAY A;  1BQQ T;  1EFW A;  1YNJ D;  1XNR Q;  1QB5 D;  5IGC A;  2F0T A;  4Q5V A;  3MFG A;  2ICI A;  3S2D H;  4NDX A;  1YBY A;  1UWV A;  3HKS A;  3QOL A;  1XWE A;  1YI2 A;  3S1N H;  3S1M B;  4F87 A;  3P1H A;  3AU7 A;  5IYD H;  2Q2H A;  3QWN A;  1Y8N B;  4DV2 L;  1T5E A;  3BDC A;  1Q3L A;  3TME A;  2VB3 X;  4YY3 Q;  4B3S L;  3GO5 A;  2JA7 H;  1I6V C;  3L9A X;  1D8L A;  5FJ8 H;  1I4Q A;  1NNX A;  4XT1 B;  1DOM A;  1HA5 A;  2XWJ B;  1EY5 A;  2RA4 A;  2RHQ B;  1JOO A;  2TSS A;  5J22 A;  5DM7 3;  2NVX H;  4A3G H;  3CD6 A;  4B3T L;  2K52 A;  3ERS X;  2PZW A;  2BA1 A;  4PV1 C;  1PH1 A;  3PIO A;  4MNO A;  1G51 A;  4U68 A;  2B2W A;  1XPU A;  3QR8 A;  4LF5 Q;  1Z6H A;  4HMI A;  3PIP 3;  3HOV B;  5C4J H;  4TQU S;  3K0Y A;  4EX5 A;  1BNZ A;  1U0L A;  5E4X A;  2IX1 A;  2EE1 A;  3BDO A;  3GTL H;  3MXP A;  3I2Z A;  3S9W A;  4HJ7 A;  2HD3 A;  1HUN A;  2AMC B;  5JVH 3;  2IX0 A;  1ROD A;  2MJ8 A;  1KAB A;  2E2J B;  3MAQ A;  4HJ5 A;  2AKW B;  5C3E H;  4L5Q A;  1MSH A;  2ALY B;  3VR3 A;  1S5B D;  1F9R A;  1TWA B;  1EOT A;  3E9I A;  2Y0S G;  5C3X A;  3EIV A;  1YIT A;  2FMC A;  1UEB A;  1SNQ A;  4X66 L;  3QOJ A;  2OF1 A;  1RIP A;  2F3W A;  1LTR D;  1MJC A;  1X32 A;  3SHL A;  3NEM A;  2WKC A;  4JI0 Q;  2PMZ B;  4HID A;  1XX8 A;  5C44 H;  4HN7 A;  1H95 A;  4YCV A;  1SND A;  2WII B;  4HMJ A;  3J7A V;  1RL2 A;  3EQL C;  3NBI A;  2QEX A;  3S1R B;  2UUB Q;  1XPR A;  2E2H B;  3KBG A;  2VY3 A;  2ZXR A;  1VQB A;  5KYL A;  4ZK9 B;  2H5X A;  4DV1 Q;  2B2V A;  2WAQ B;  4R9W A;  5KRU A;  5FLX L;  2O2L D;  4QF4 A;  1M4V A;  2N78 A;  2OQ0 A;  3DM3 A;  4Q0F A;  2KCN A;  3VYS A;  5FK9 C;  2B63 G;  1K83 B;  2JA6 G;  1E2Z A;  5CYU A;  4APV A;  4PZ6 A;  5M3M B;  4MIU A;  2HUG A;  1KDC A;  2NN6 I;  5CBA E;  3RZD B;  4C2M B;  1K8G A;  4YHH Q;  1CM9 A;  3CF5 A;  3TS2 A;  2VB2 X;  4DV0 L;  1X3Q A;  1U5K A;  5EBD A;  4A3M G;  2JQO A;  1B7Y B;  1NMF A;  3RN5 A;  3CCE A;  1IYV A;  1WTX A;  1M1K C;  4JBW A;  4JI8 L;  5IOD A;  4RA8 A;  2EYP A;  4HSP A;  1PH5 A;  5E4W C;  1DOL A;  1EIG A;  4RMF A;  1TWG H;  4GN4 B;  5J3B A;  4DNI A;  5CBE E;  4A3D H;  3F2C A;  1I3Q H;  4MZ9 A;  1X54 A;  4DAM A;  4JW0 A;  2F4I A;  4RH6 A;  4JYA Q;  3D0F A;  2VQE Q;  3CPF A;  2B8F A;  1ET6 A;  3NPP A;  3KDF A;  2PPB C;  1GM5 A;  3HOZ B;  2Q2U A;  4P72 A;  3K5N A;  1PZI D;  2CW0 D;  5JJL A;  4X3U A;  3J81 c;  2SNS A;  1B9M A;  2QF7 A;  5C0X H;  3IL8 A;  1OXT A;  1P16 A;  3IFD A;  1IBM Q;  4CDE C;  3HOY B;  3PSI A;  5T1I A;  3AYH B;  3FKI G;  4DAY A;  4KHP Q;  1PFS A;  4A3C G;  1EWH A;  5IGG A;  5L37 A;  1GXD C;  3ZJY C;  1NMG A;  5JOB A;  2UXD L;  1HNZ Q;  3PQI A;  3G6J B;  1JE4 A;  3GTK H;  5IT9 c;  4A3J B;  3T1Y Q;  2A19 A;  4O0A A;  4DV5 L;  2R92 H;  1X3F A;  3A0J A;  1HNX Q;  1D1I A;  3VDY A;  2E2I B;  2NVY H;  1B70 B;  2R93 G;  4Y7N H;  1STN A;  2PQA B;  4K5X A;  1I94 Q;  4QY7 A;  5EPL A;  3OSO A;  2XGT A;  4K8J A;  4KKU A;  4LW1 A;  3PCO B;  1HCZ A;  3OYY A;  1HQR D;  3CXC A;  3TRZ A;  1XYI A;  5I2Y A;  1Y1V B;  2MPM A;  2KHS A;  4DR2 L;  2J4X A;  1L0Y B;  1BO0 A;  4IFD I;  3TBI B;  5FO9 B;  1L1O C;  1YJ9 A;  4IUN A;  3ER0 A;  1RD9 D;  4OON A;  1N32 Q;  4EGV A;  1VQK A;  1FNW A;  1VQN A;  3NTK A;  5HY6 A;  3R3O A;  1YHB A;  1V1P A;  2YYZ A;  2DN8 A;  1DGS A;  2CH4 W;  2PW5 A;  3U9S A;  2R6G A;  1HNW L;  3M3Y B;  4KD3 A;  2XIW A;  3CCM A;  1IBL L;  3TN2 A;  1JWM D;  5FLM G;  4DUY Q;  1K9M C;  1W6K A;  1YVC A;  4YWM A;  3I70 A;  2YU9 B;  1FJG Q;  3F2B A;  1TWF B;  2L15 A;  4DF7 A;  3KLS X;  3C46 A;  1YNN C;  2L55 A;  3NXW A;  1FGB D;  5M5Y H;  2AWO A;  4LMQ D;  3N52 A;  4LUO A;  1N34 Q;  3HZX A;  1STE A;  1IXR A;  3DM1 A;  3HOX G;  3IRB A;  1E22 A;  3VYU A;  1VQI A;  4LF6 Q;  4G4K A;  1XNQ L;  3S2H H;  4O2D A;  4DR1 L;  3CPW A;  2I5H A;  2AWN A;  3L3O C;  1A3U A;  4MHE A;  3HOW B;  5KGU A;  1B53 A;  4LF7 Q;  1SJE D;  1TS2 A;  2E74 C;  2PO4 A;  4POF A;  2Z6K C;  4GNX A;  1KRS A;  1JWU D;  4GS3 A;  2XRS D;  5HUR A;  4JI1 L;  3H3V I;  2MP1 A;  1NTG A;  2EYJ A;  2B63 H;  2JA6 H;  2OTJ A;  2JE6 I;  1PTO C;  3E5S A;  3UE1 A;  4MN3 A;  1PH7 A;  1X3G A;  1RKN A;  1CQV A;  1EY7 A;  3TEH B;  3J81 L;  2K1B A;  1B3Q A;  5M5W B;  1LT4 D;  1TQO A;  4C3I G;  4A3M H;  2KHJ A;  1I50 B;  2K5D A;  4A76 A;  4YCU A;  2L5T A;  3GTP H;  4RFB A;  3VR5 A;  1PZK D;  3PIP A;  3EJI A;  2UU9 L;  3E6Z X;  1NAP A;  4NXM Q;  1LAC A;  1U9R A;  4IPG A;  1X65 A;  1YEZ A;  1GHJ A;  3OW2 A;  1ENA A;  3QO2 A;  4C56 C;  1W6J A;  5IYB G;  2IHF A;  1S5C D;  4B3M Q;  5IT9 L;  1QOH A;  3D8G A;  4R4I A;  4O1N A;  1JQY D;  1GUN A;  1VMC A;  1JJG A;  4H44 C;  5KND A;  1EYD A;  1D1K A;  3NBH A;  4DR7 Q;  2EVB A;  4PG3 A;  1PH3 A;  4BS9 A;  1HQM C;  4A3B G;  4ALP A;  2K5H A;  3NUC A;  1IYJ B;  4BY1 G;  4DPG A;  1C48 A;  3FEW X;  5C0X I;  3KJP A;  3CC2 A;  3FKI H;  1K8M A;  3CRL C;  4BA1 I;  4A3C H;  1O7L A;  1D5M C;  3OIP A;  3NTH A;  2XRQ D;  3I4M G;  1KNA A;  5D3D A;  4LFC Q;  1XNR L;  3KYH C;  4DV4 Q;  2X69 A;  3HOU G;  1B50 A;  3DUZ A;  3NWT A;  5G3L F;  3B6Y A;  4J15 A;  3F2U A;  4OEL B;  4XTC S;  3R8B A;  1D6E C;  1KLG D;  2G9D A;  3IFT A;  4ZRZ A;  4GOP B;  3C2P A;  1TWH B;  3J80 i;  2H4O A;  4HJ9 A;  4YY3 L;  2R93 H;  5CC4 A;  2MO0 A;  3P75 A;  3J80 E;  3S1Q H;  1QUQ A;  2OTL A;  1K8A C; 
#chains in the Genus database with same CATH homology
 1AE2 A;  3TRE A;  5M3M H;  4A3D G;  2Q2I A;  2JA7 G;  2I0Q A;  3EBE A;  5IP9 G;  2YTY A;  1OXX K;  4C2M H;  2JA5 H;  3H3V H;  4BY1 H;  3HOY G;  3UDF A;  2LXK A;  4P71 A;  1N36 Q;  3M85 A;  2ZTD A;  2UXC L;  1QZH A;  2FXQ A;  4BBS G;  3PUV A;  5EAY A;  4IO9 A;  4A4I A;  3CCS A;  1TWC H;  4LFA L;  4L5R C;  1PVO A;  1E24 A;  2E8G A;  4FDB A;  2R7F A;  1K73 C;  3I4M H;  1IL2 A;  1PHJ A;  1R9T H;  3S1M H;  1E3P A;  2WB1 E;  1SLJ A;  4JI2 Q;  5C0X G;  2E5L L;  4JI7 L;  2VS1 A;  4LF5 L;  1VQG A;  1WOC A;  2PI2 E;  3I4N G;  3G4S A;  5LMN W;  1SRU A;  4DV7 L;  3JAM c;  3CCJ A;  4NPS A;  1EFW A;  4LF9 Q;  4QIW E;  4GKK Q;  5IY0 A;  5DLQ E;  4A3J G;  1V9P A;  3TS0 A;  1XNR Q;  1PYS B;  2EIF A;  1IBK Q;  3I55 A;  1VQ6 A;  2ZJP A;  1FL0 A;  1S72 A;  3A5Z B;  3WWV A;  3S2D H;  4X65 Q;  1YBY A;  1UWV A;  3HKS A;  2PQA A;  1YI2 A;  1VQ7 A;  3S1N H;  3BZC A;  2DUD A;  3HOZ H;  3S17 H;  5IYD H;  1KL9 A;  2Q2H A;  4DV2 L;  4L5T A;  2MQH A;  1J5E L;  3GTQ H;  1FGU A;  2EXD A;  2K14 A;  4JV5 Q;  4YY3 Q;  4HJ8 A;  4B3S L;  3GO5 A;  2JA7 H;  1V43 A;  2BA0 A;  3M4O H;  5M5X H;  1OXU A;  4A3F G;  4X64 Q;  5BR8 Q;  1D8L A;  5AJ3 Q;  5FJ8 H;  4JI4 Q;  4K0K Q;  1ASY A;  1WJJ A;  4LFB L;  1GVP A;  5IP7 G;  1Y1V G;  3AFQ A;  3STB D;  1VQ5 A;  4BBS H;  2RHQ B;  4IPD A;  1VQ9 A;  3BU2 A;  1N8R C;  5GRO A;  1B8A A;  4DV6 L;  2NVX H;  4A3G H;  1LYL A;  3HOX H;  1Y1W G;  3CD6 A;  4B3T L;  2K52 A;  1VQE A;  3CQZ H;  3ERS X;  4X62 L;  2BA1 A;  3ULJ A;  5IYC G;  1PH1 A;  1HR0 L;  3PIO A;  2UXC Q;  4MNO A;  1L0W A;  1G51 A;  2C35 B;  3J80 c;  3H15 A;  4LF4 L;  3KFU A;  3STB C;  4JI0 L;  4LFA Q;  4JCV E;  1VQA A;  2D0P A;  1QVG A;  2N3S A;  2RF4 A;  2OWO A;  2UUB L;  1XPU A;  2DGY A;  2E5L Q;  4JI7 Q;  4LF5 Q;  1KHI A;  3CP0 A;  2NN6 G;  5C4J H;  4DV7 Q;  4DR4 L;  2BH8 A;  2UUA L;  1OXV A;  4LNQ A;  4TQU S;  1AH9 A;  4EX5 A;  4DV1 L;  5C44 G;  2PI2 A;  3SGI A;  1U0L A;  3J7Z C;  2IX1 A;  2VQF L;  3GTL H;  2WB1 G;  1CSP A;  5GQO A;  1CKN B;  4KHZ A;  1TXY A;  4QL5 A;  3I2Z A;  3KF6 B;  1TWA H;  1SMX A;  1S40 A;  3ICE A;  2B29 A;  5M3F G;  2KEN A;  2WFW A;  4HJ7 A;  4AQY L;  1HZ9 A;  4YWK A;  2AMC B;  2UXB L;  4EQ5 A;  3J7A 5;  4DV2 Q;  4WJ3 M;  4LWC A;  4P73 A;  2IX0 A;  1J5E Q;  1VQD A;  1Y14 B;  4HJ5 A;  1X56 A;  4UPA A;  2AKW B;  4C3I H;  5C3E H;  4DKA C;  4L5Q A;  2ALY B;  1Y1V H;  2A1A A;  4B3S Q;  2RHS B;  4GNX B;  4YHH L;  4HIM A;  4A3K G;  4R1J A;  3PO2 H;  4DV3 L;  2F4V L;  3AQQ A;  1W3S A;  3E9I A;  4LFB Q;  2Y0S G;  4R4T A;  1V1Q A;  3EIV A;  4A3L G;  1YIT A;  3PO3 H;  1Q8K A;  4YWL A;  1CSQ A;  4MTN A;  3A74 A;  1UEB A;  1C9O A;  4DV6 Q;  4ME3 A;  3GTO H;  4X66 L;  3J81 i;  1XPO A;  4B3T Q;  1RIP A;  1HZC A;  1MJC A;  4X62 Q;  1HR0 Q;  1NE3 A;  1WFQ A;  2NVT H;  3NEM A;  3LGJ A;  2GVA A;  3H0G H;  5IE8 A;  5IYB H;  4LF4 Q;  4JI0 Q;  4GLA C;  3E9H A;  2UUC L;  4XIG S;  4HID A;  5C44 H;  1H95 A;  4YCV A;  2ZM6 L;  4GKJ L;  4JYA L;  1RL2 A;  2UUB Q;  2QEX A;  2MO1 A;  2VQE L;  4DR3 L;  1XPR A;  3S14 H;  2VY3 A;  3M9B A;  4DR4 Q;  1VQB A;  1EQR A;  4GLX A;  2UUA Q;  2F52 A;  4KLK A;  2H5X A;  4JBM A;  4A3B H;  4AYB E;  4DV1 Q;  1E1O A;  3RZD H;  5JJK A;  1VQJ A;  1Q12 A;  2VQF Q;  3RZO H;  1TWF H;  3TQY A;  3PUX A;  1CKM A;  1JE5 A;  5GAD C;  2Z0S A;  1VQM A;  5GAG C;  4DR5 L;  3K7U C;  2N78 A;  1PYB A;  2OQ0 A;  1HZB A;  3DM3 A;  2HIX A;  4A3E G;  1XMO L;  1IBM L;  5K36 G;  3HFZ B;  4AQY Q;  4GLV B;  3S16 H;  4B3R L;  2UXB Q;  2B63 G;  4A3K H;  2JA6 G;  4PMW A;  4POG A;  4APV A;  2NZH A;  4PZ6 A;  4Y52 H;  3I56 A;  4A75 A;  4LUZ A;  4JBJ A;  4BBR G;  3F2D A;  3NBH B;  4P74 A;  2NN6 I;  4AH6 A;  3HOU H;  3RLF A;  4KHP L;  1JT8 A;  1K8G A;  1P8L A;  4YHH Q;  3CF5 A;  2LSS A;  5C0X J;  3TS2 A;  4DV0 L;  1YZ6 A;  4DV3 Q;  2F4V Q;  3HOW H;  2JA9 A;  1U5K A;  4A3M G;  1PH8 A;  2JQO A;  1B7Y B;  1MIU A;  1NMF A;  3JC6 6;  4JOI A;  4R4O A;  3UDG A;  1HNZ L;  1MJE A;  1QVC A;  3RN5 A;  3CCE A;  5IWA L;  2K5N A;  3HOV G;  3T1Y L;  1M1K C;  4DUZ L;  4X66 Q;  1X6O A;  4JBW A;  4JI8 L;  1Z47 A;  1VQO A;  1PH5 A;  1MKH A;  4RMF A;  1TWG H;  1HNX L;  1WCM H;  4GN4 B;  2Y0S E;  5J3B A;  4DNI A;  4R4C A;  4OWW B;  4A3D H;  3F2C A;  3HKZ E;  1I3Q H;  4MZ9 A;  2UUC Q;  1X54 A;  3MEF A;  1EYG A;  4DAM A;  1KRT A;  2JEA I;  4WJ4 A;  5IP9 H;  4IFD G;  1EIF A;  2ZM6 Q;  2R92 G;  4GKJ Q;  1OXS C;  4JYA Q;  3CMA A;  4BXX G;  1A8V A;  1UE6 A;  2CKZ B;  3CPF A;  3D0F A;  2VQE Q;  4DR3 Q;  1I94 L;  3HOY H;  3U58 A;  1VQC A;  4JC0 A;  3KDF A;  3FHW A;  1GM5 A;  2R7D A;  2Q2U A;  3UDX A;  1SN8 A;  2D62 A;  2HQL A;  4TVA B;  1VQL A;  1A0I A;  4UP8 A;  1VQH A;  1SFO H;  3F8T A;  4P72 A;  1KC8 C;  1O7I A;  4YCW A;  5JJL A;  4NXN L;  3J81 c;  4QJF A;  3PUY A;  4A3I G;  2OQK A;  4DR5 Q;  1QUQ B;  1XMO Q;  1L1O A;  1OXT A;  3I4N H;  1P16 A;  4AYB G;  1KXL A;  4JI5 L;  1IBM Q;  2ZJR A;  1QVF A;  3AEV A;  4B3R Q;  4H02 A;  3PSI A;  1Q86 C;  2OTL A;  4LF8 L;  4R4Q A;  2R7Z G;  3G71 A;  4A3J H;  1SRO A;  1E1T A;  4GOP A;  1Q81 C;  3AYH B;  3FKI G;  1N32 L;  4KHP Q;  1KAW A;  1PFS A;  4A3C G;  1G29 1;  3L7Z C;  2AHO B;  4KI0 A;  2CWA A;  2D0O A;  3EN2 A;  2E2I H;  2CWP A;  3ZJY C;  4DV0 Q;  4IPC A;  2HHH L;  1NMG A;  3I7F A;  2ATW A;  1LTL A;  2UXD L;  1HNZ Q;  2JEB I;  1PH2 A;  3CCU A;  5E7N A;  1Q1B A;  3GTK H;  5IT9 c;  5IWA Q;  3K8A A;  4HIO A;  3T1Y Q;  2KCM A;  4JOI C;  4DUZ Q;  2A19 A;  4O0A A;  2RCN A;  5LMU L;  4DV5 L;  4JI8 Q;  1XJV A;  1K0R A;  3AFP A;  1X3F A;  3A0J A;  3RLN A;  4A3F H;  1VQP A;  4DUY L;  2R92 H;  5C4X G;  2WAQ G;  1HNX Q;  3GDE A;  2K5V A;  3VDY A;  1HR0 W;  1YIJ A;  1X3E A;  2NVY H;  5IP7 H;  1FJG L;  2K75 A;  2VUM G;  1B70 B;  1UE1 A;  2R93 G;  4Y7N H;  1BKB A;  1L2F A;  1GD7 A;  2PQA B;  4A93 G;  1I94 Q;  3CME A;  2IT1 A;  2N49 A;  4OWT B;  1Y1W H;  2CQO A;  3KLW A;  3RNU A;  4QY7 A;  5IYC H;  5JEA G;  1EUJ A;  3HKZ G;  2XGT A;  1OTC A;  3BZK A;  4LW1 A;  2YTX A;  3OYY A;  3PCO B;  1YJW A;  1YJN A;  1N34 L;  3CCL A;  2JA5 G;  3CXC A;  2ES2 A;  3TRZ A;  4NXN Q;  4QQB X;  2YV5 A;  4LF6 L;  3RLO A;  1VQ8 A;  4DR2 L;  3S24 A;  1X55 A;  3CAM A;  3K7A H;  4OWX B;  3KDF B;  1FVI A;  1GO3 E;  4JI5 Q;  2MFI A;  1D7Q A;  4C3H H;  4IFD I;  2XTI A;  2JK8 A;  4LF8 Q;  1JJ2 A;  1L1O C;  3M3Y H;  1YJ9 A;  2Z6K A;  3NEL A;  4LF7 L;  3ER0 A;  4OON A;  1KQS A;  1N32 Q;  4IJH A;  3K80 C;  1VQK A;  1VQN A;  3S15 H;  5HY6 A;  4GOP C;  2NZO A;  2KBN A;  5M3F H;  3FP9 A;  2YU9 H;  3M4Q A;  2HIV A;  2HHH Q;  1YHB A;  2YYZ A;  4OX9 L;  2ASB A;  2UXD Q;  1DGS A;  5LMN L;  1I6H H;  1NY4 A;  3NEN A;  4JI3 L;  2R6G A;  5ELN A;  1YHA A;  1HNW L;  3CCM A;  3GD7 A;  4GN3 B;  5LMU Q;  4DV5 Q;  1IBL L;  3HOZ G;  5IYD G;  5FLM G;  1KIX A;  2I5L X;  3I4O A;  4DUY Q;  2JJQ A;  1K9M C;  1YVC A;  2PMZ E;  3W5O A;  3W1G A;  5FLX c;  2VW9 A;  2HT1 A;  1G6P A;  4YWM A;  1JJC B;  1SR3 A;  2KCT A;  4A3L H;  1FJG Q;  1VQF A;  3F2B A;  2A8V A;  2L15 A;  5GAH C;  3ULP A;  3F1Z A;  1PV4 A;  4BY7 G;  3U50 C;  5FJ8 G;  5M5Y H;  2AWO A;  2B3G A;  2WAQ E;  4L5S A;  2K4K A;  1C0A A;  1A62 A;  4LUO A;  2CFM A;  1J6Q A;  4NXM L;  1N34 Q;  1HJP A;  3D31 A;  4A3G G;  1IXR A;  1Q1E A;  3HOX G;  1CKN A;  2ZJQ A;  3IRB A;  1E22 A;  1EWI A;  2Q2T A;  1VQI A;  2GVB A;  4LF6 Q;  4DR2 Q;  1XNQ L;  1Z9F A;  3MXN B;  3KF6 A;  4O2D A;  3S2H H;  3W1B A;  3OTO L;  4DR1 L;  3UE0 A;  3K81 C;  3CPW A;  4B3M L;  3G48 A;  3GTM H;  2I5H A;  2AWN A;  1NJI C;  3T1H L;  2ZTC A;  4P75 A;  4IOA A;  2VNU D;  4JBK A;  1N33 L;  1Q46 A;  4LF7 Q;  1AE3 A;  2JA8 G;  4DR7 L;  4JG2 A;  2ZTE A;  5JJI A;  2WP8 J;  3PUZ A;  4POF A;  5M5W H;  2Z6K C;  4IFD J;  4GNX A;  4A3E H;  1KRS A;  5HGQ A;  4GS3 A;  4DK3 C;  3CC7 A;  4JI1 L;  1Q82 C;  1I50 H;  2QGQ A;  3H3V I;  3CCV A;  1NTG A;  5FLM H;  4OX9 Q;  2B63 H;  2JA6 H;  3GTJ H;  2OTJ A;  2IY5 B;  2JE6 I;  4RG1 A;  3J81 j;  1E7Z A;  3UE1 A;  5LMN Q;  4BBR H;  4OXP A;  1YNX A;  3CC4 A;  4JI3 Q;  2V1C C;  1HNW Q;  1PA6 A;  1PH7 A;  1IBL Q;  1X3G A;  3CCQ A;  4JI6 L;  4DR6 L;  3TEH B;  1VS0 A;  1Q7Y C;  3CCR A;  4BY7 H;  1GKH A;  1PH9 A;  4LFC L;  4LUV A;  4DV4 L;  4A3M H;  3A5U A;  5C3E G;  1W2B A;  1HZA A;  1QZG A;  2KHJ A;  2YTV A;  2QA4 A;  4A76 A;  4YCU A;  1YHQ A;  3GTP H;  4BA2 I;  1I5F A;  1SE8 A;  3HOV H;  1IZ6 A;  4IJL A;  1KD1 C;  2GN5 A;  2VL6 A;  2BH2 A;  3PIP A;  2UU9 L;  3PO2 G;  1A63 A;  2ID0 A;  1JB7 A;  1EQQ A;  2I5M X;  4OO1 I;  4PZ7 A;  3PO3 G;  3CW2 C;  3RR5 A;  1XMQ L;  4NXM Q;  3M4P A;  1VCI A;  4IPG A;  1JMC A;  1NBW A;  3PF5 A;  1X65 A;  1YEZ A;  1XNQ Q;  2OCE A;  4BXX H;  3OW2 A;  3Q8D A;  2JA8 H;  4UY8 C;  2K50 A;  4C3J H;  3PV0 A;  3OTO Q;  3H0G G;  2IHF A;  5IYB G;  4HIK A;  4DR1 Q;  4B3M Q;  1CKO A;  3JAM i;  2E2J H;  3T1H Q;  1M90 C;  1XTD A;  3BJU A;  4R4I A;  1PH4 A;  1N33 Q;  3K0X A;  1JJG A;  1PH6 A;  2N8N A;  3PF4 A;  4DR7 Q;  4UP9 A;  4PG3 A;  5M3M G;  4A3I H;  1PH3 A;  1N36 L;  1WYD A;  4A3B G;  3DLL A;  4ALP A;  4PZ8 A;  2F3I A;  4JI1 Q;  2K5H A;  1CUK A;  1IYJ B;  4BY1 G;  3PUW A;  3G6E A;  4GNX C;  5JEA J;  4DPG A;  2R7Z H;  1N9W A;  5C0X I;  1UE5 A;  2CCZ A;  3KJP A;  4NB3 A;  4IOC A;  3CC2 A;  3FKI H;  4JI2 L;  4DK6 C;  3KJO A;  5GAE C;  1HH2 P;  5ELO A;  4BA1 I;  1T9H A;  4A3C H;  1X9N A;  4JI6 Q;  1S3O A;  1BBW A;  1TWH H;  1VQ4 A;  1ASZ A;  4IPH A;  4LF9 L;  3I4M G;  4DR6 Q;  4GKK L;  4X6A H;  3KOJ A;  5H1S E;  4LFC Q;  1XNR L;  4QGU A;  3L2P A;  3KYH C;  4DV4 Q;  3HOU G;  2KHI A;  1IBK L;  4AIM A;  3S1R H;  3B6Y A;  2E2H H;  4J15 A;  3KF8 B;  1L1O B;  2IHE A;  3UDI A;  2VZA A;  3M7N A;  4X65 L;  1EIY B;  3GTG H;  1LUZ A;  2UU9 Q;  4XTC S;  2NVQ H;  5C4X H;  2PNH A;  3RN2 A;  3U4V A;  1BVS A;  3HOW G;  1UE7 A;  1C7Y A;  3PGZ A;  2EQS A;  2MNA A;  4GOP B;  1WI5 A;  4OO1 G;  4JV5 L;  4GN5 A;  3J80 i;  4DAY B;  4YY3 L;  4UP7 A;  4HJ9 A;  1XMQ Q;  1EOV A;  1BBU A;  2LXJ A;  1LM0 A;  3E0E A;  3ULL A;  2VUM H;  2R93 H;  2MO0 A;  3L0O A;  4HJA A;  3U4Z A;  4X64 L;  4A93 H;  5BR8 L;  1K3R A;  5AJ3 L;  3S1Q H;  4JI4 L;  1QUQ A;  4K0K L;  1WCM G;  1K83 H;  1K8A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...