4QQBX

Structural basis for the assembly of the sxl-unr translation regulatory complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
GAMATRETGIIEKLLHSYGFIQCCERQARLFFHFSQFSGNIDHLKIGDPVEFEMTYDRRTGKPIASQVSKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords msl2 mRNA
publication title Structural basis for the assembly of the Sxl-Unr translation regulatory complex.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Tranlation/rna
total genus 12
structure length 72
sequence length 72
chains with identical sequence Y
ec nomenclature
pdb deposition date 2014-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qqbX01
1XJVA 3CC4A 1WOCA 2VQFL 1KC8C 4JI4L 1U5KA 4LFAL 1L1OB 3RLOA 1Q86C 1I94Q 1V9PA 1GVPA 1WJJA 2B3GA 2UXCQ 2K5NA 4DR5L 2OTJA 4YY3Q 5LMNW 5IYDH 4WJ4A 3EN2A 2IHEA 2I5MX 5IYDG 1TWFH 2C35B 1LYLA 2PI2E 3EIVA 3CF5A 4GN4B 2VQEL 1QZHA 1HNWL 5JJKA 2R92H 1IBMQ 4IPCA 3I4OA 5IP9H 1L2FA 3A0JA 1YJWA 4YWLA 4JI2Q 5C3EG 2R92G 4GNXC 1KQSA 1NBWA 4DV0L 1PA6A 2NVXH 2CFMA 4LF8L 2PI2A 1Q7YC 4LF9Q 1A62A 4B3RQ 4A3KH 2CCZA 4OX9L 3GTQH 4DV7Q 1YBYA 1HNZL 2IX0A 1VQJA 4A3KG 2YV5A 2BA1A 4P74A 3RLFA 1TWHH 3GTKH 3S17H 2K5VA 5BR8L 1GM5A 2MO0A 3CXCA 2R6GA 1UWVA 3M9BA 4BBRG 1YEZA 1R9TH 2BH8A 3HKSA 1XMQQ 3ULLA 2WAQE 1KIXA 5DLQE 3A74A 2KENA 4PZ7A 1XNRQ 4A93H 4POFA 3PO2H 4OO1I 2JA6G 1KL9A 1HZBA 2FXQA 4A93G 5M5WH 4HJ7A 3AQQA 4JCVE 3CPFA 3MXNB 4UP8A 3RR5A 2YYZA 2VL6A 3GTOH 4LF4L 5JJIA 1PH4A 1AH9A 3RLNA 3CCQA 1GO3E 1XPUA 2IX1A 1P8LA 5IY0A 4YHHQ 1O7IA 3CCRA 1HNXL 2ASBA 2BA0A 5GADC 2ZJPA 1QUQB 4DR3Q 1N34L 1XPRA 2LXKA 4A3MH 2E8GA 1EFWA 4NXMQ 1EWIA 1IZ6A 1Q1BA 5K36G 5GAGC 2UXCL 4YY3L 5M3MH 3SGIA 1T9HA 1W2BA 1VQLA 2NZOA 1G291 4AH6A 3KF6B 2KCTA 4TQUS 4IJHA 3J81i 1VQ5A 2UU9L 4B3MQ 1K83H 2L15A 1FJGL 4OWTB 1SN8A 1CSPA 4IFDJ 3W5OA 5EAYA 4O0AA 1QVFA 3G4SA 4DUZL 4OO1G 4L5QA 4C3IH 2RCNA 1VQDA 5IWAQ 4X66Q 1YITA 4JI2L 1A8VA 2IT1A 1VQ6A 5IP7G 4DKAC 4DR2Q 4JI5Q 4DV2L 4JV5Q 5C4XH 3HOUH 1YVCA 1EQRA 3PUWA 4LF9L 4PZ8A 4B3RL 2ZJRA 1HZ9A 1S72A 5C4XG 4JG2A 3ULJA 5LMUQ 4O2DA 1IBKL 4A76A 2HHHQ 3ICEA 2MFIA 2WB1E 1P16A 3BZCA 4KHZA 4JI1Q 3HFZB 1Q8KA 1XNQQ 1YZ6A 5M3FH 1E22A 4KLKA 1UEBA 5ELNA 5ELOA 4X64Q 2JA8H 1XMOQ 3K7AH 1NY4A 2MO1A 2NVQH 1Y14B 2KHIA 1LM0A 3HKZE 1SFOH 2JA8G 2DGYA 1OXSC 1HH2P 4HIMA 4HJ9A 3F2CA 3PF5A 1MJEA 1XNRL 2R7FA 1UE5A 3ER0A 1X65A 4J15A 3CMEA 3HOYH 2LXJA 3G48A 4R4CA 1EOVA 1I5FA 3HOZH 2E2IH 4GNXB 3HOYG 3M4OH 1N9WA 1UE7A 2D62A 3CCUA 3GTLH 3OYYA 1I6HH 1SLJA 4R4IA 3U50C 2ZTDA 2E5LQ 3F1ZA 1VQPA 4DK3C 2OCEA 5J3BA 1J5EQ 1VCIA 2R7DA 4DR3L 2NN6G 1NMFA 1VQBA 3F8TA 3UDFA 5FLMH 3H15A 2OWOA 3GDEA 4A3CG 1HJPA 1V1QA 3JAMi 2B63G 4BBSG 1LUZA 3CW2C 3FHWA 3UDIA 1KD1C 4UP9A 1VQNA 4NXML 4LW1A 3H0GH 4JBWA 1OTCA 2A19A 1FGUA 4DNIA 3K8AA 1S3OA 1AE3A 3UDGA 5M5XH 4NXNL 2RHQB 3CCMA 1QVGA 2K52A 2VUMH 3M4QA 3J80i 3T1HL 4B3ML 4LFBQ 2YTYA 2OQ0A 1VQ4A 2VUMG 1N32L 4BA1I 1B7YB 2R93H 1X55A 3UE1A 4KHPQ 2IY5B 4B3SQ 4XIGS 4YWKA 4A75A 2R93G 1E7ZA 3STBD 2Z0SA 1D8LA 4X66L 3KOJA 4DV1Q 1JB7A 1SMXA 4DR2L 4JV5L 1TWAH 1EIYB 5GAHC 2E2JH 3MEFA 3H3VI 5C3EH 1Z47A 2JEBI 4GLVB 3M7NA 1X54A 4LNQA 1VQGA 3HOXG 1B8AA 4OWXB 5M5YH 2UXDQ 1Q12A 1JE5A 4IPDA 4JI1L 1YHQA 2LSSA 2HHHL 1X3EA 4C2MH 1Q81C 1XNQL 1PH2A 1L1OA 1M90C 4GKKL 4X64L 3M4PA 2KBNA 1PH7A 4LF5Q 3KYHC 4LUZA 1JJCB 1XMOL 2Z6KC 4DV3Q 4L5RC 1AE2A 2JEAI 1CKMA 1C0AA 4TVAB 4HIOA 4DUYQ 2PMZE 3KFUA 1Q46A 5IE8A 3S1RH 4BBRH 1X3GA 3S2HH 4K0KL 4A3IG 3UDXA 3PO3G 1RL2A 2AWOA 2PQAB 1WCMG 2N8NA 5JJLA 5IYCH 4YCUA 3PIPA 1IBLQ 4HJ5A 4IOCA 1Y1WG 3KDFB 2AHOB 2JA6H 1VQAA 5IYCG 4YCVA 2WB1G 3S1QH 3I7FA 3S24A 1I3QH 1Q1EA 4FDBA 3STBC 3BZKA 3CQZH 3PUVA 3CCVA 3K80C 2E5LL 3H3VH 4AYBE 1MKHA 4DAYB 2UUBL 2F4VL 2HQLA 3NELA 4JI7Q 1N36Q 3CPWA 2HIXA 4DR7Q 4P71A 3HKZG 1YNXA 4IO9A 5JEAG 4DK6C 4KI0A 1TWCH 1XTDA 5GROA 2GVBA 2YTXA 4X65L 4UY8C 1K8GA 1TXYA 2HT1A 1GKHA 3S1NH 3UE0A 5E7NA 3E0EA 4HIKA 3I4MG 4DR6Q 4OONA 4R1JA 1I94L 5H1SE 2V1CC 3DM3A 3CP0A 3FP9A 3CCJA 1VQ9A 2YU9H 2N3SA 2K75A 3BU2A 2N49A 1PH8A 4JBKA 2VW9A 3M3YH 3WWVA 4LFBL 5C0XI 4A3EH 4R4QA 3VDYA 3TRZA 4KHPL 4B3SL 2CQOA 4POGA 4A3EG 1YI2A 3GTPH 2XTIA 3E9HA 4P75A 1MJCA 3PGZA 3L0OA 3CC2A 3AFQA 4DR4Q 4JBMA 4LUVA 4RMFA 3I55A 5LMNQ 3TS2A 4HIDA 1IBML 2I5LX 3PF4A 5IP7H 1C7YA 4L5SA 4LF6Q 1KAWA 1JMCA 2UXDL 1QUQA 4GOPA 2N78A 1SR3A 1Y1VG 1TWGH 4LF7Q 4A3GH 2ZJQA 2NN6I 2JE6I 3KF8B 4DV5Q 3G6EA 4C3HH 4DV7L 4A3GG 2A1AA 3F2DA 4LF5L 2MQHA 3AFPA 4LFAQ 3PV0A 1YHBA 4GN3B 4ALPA 4EX5A 5IT9c 3KJOA 4DUYL 3W1BA 3I4NG 3ULPA 1KHIA 1V43A 1VQ7A 4BXXG 3KF6A 2KCMA 4MZ9A 1PYSB 4PZ6A 1G51A 5C0XG 2H5XA 4A3DG 3IRBA 1XMQL 1SRUA 1NE3A 2MNAA 2ZTEA 2WP8J 1VQKA 1K3RA 1A0IA 1VQHA 4JI8Q 1HNWQ 4OXPA 3Q8DA 3TS0A 1EYGA 2E2HH 4JYAQ 2Y0SE 2F52A 1N36L 1L0WA 3EBEA 3PUXA 4LFCQ 3KJPA 4Y7NH 1YJNA 4DV6Q 4LF8Q 1QZGA 4A3CH 4YHHL 1H95A 1EIFA 1HR0Q 3OW2A 4GLAC 4BY1G 1M1KC 1PH1A 3D31A 4R4OA 4A3LG 3U4VA 4DR6L 1X6OA 4GOPC 1NTGA 4DAMA 4JBJA 1E24A 2JA9A 2JK8A 1FL0A 1LTLA 3LGJA 4GN5A 1N33Q 3S2DH 4DV4Q 2ZM6Q 4AYBG 3NBHB 3BJUA 4XTCS 3KLWA 2I0QA 1BBWA 2VZAA 2Q2UA 4GNXA 4A3JH 2EXDA 4QY7A 4DR4L 1D7QA 2K5HA 2VY3A 4JOIA 1PH3A 3I56A 4A3JG 1OXUA 3CCSA 4LF6L 5IWAL 3PUZA 1DGSA 4APVA 5FLXc 4LF4Q 2JA7H 1OXTA 4JI5L 1XPOA 1B70B 1K73C 3AYHB 4NB3A 4LF7L 1N8RC 2JA7G 2QGQA 3L7ZC 1CKNA 3HOXH 4DV5L 4JI0Q 2K14A 5LMUL 3A5ZB 1HZCA 1PFSA 1Z9FA 2OQKA 4RG1A 4MTNA 3OTOQ 2ATWA 1PV4A 1KRSA 2JJQA 1E3PA 2RF4A 4OWWB 2PNHA 1NMGA 1X3FA 2GN5A 4LWCA 3S15H 3CCEA 4IOAA 4A3IH 3PO3H 1FJGQ 2UU9Q 1EQQA 1WCMH 2D0OA 2YTVA 1A63A 2BH2A 2DUDA 2JQOA 4JI8L 1U0LA 4P72A 1Y1WH 3ERSX 3CCLA 4B3TQ 4DUZQ 1JJGA 4AIMA 2OTLA 1J6QA 4JI3Q 4JYAL 1G6PA 3PCOB 5FJ8H 1VQMA 2UXBQ 2ID0A 5HGQA 4PMWA 5IP9G 4LFCL 4DV2Q 3G71A 2UUAL 2UUBQ 1PVOA 5FJ8G 2RHSB 4DV6L 2CWPA 4AQYQ 2AWNA 4JOIC 4R4TA 1VQEA 3CAMA 1J5EL 1HR0L 1IYJB 1X56A 2Q2TA 4IFDI 1K9MC 3GO5A 4BY7H 4JC0A 1IBKQ 4A4IA 5IYBH 3U58A 3J81j 4BY7G 1OXVA 3T1YQ 1YIJA 1JT8A 3FKIH 5IYBG 2UUCQ 3I4MH 1N33L 4DV4L 2ZM6L 4BBSH 4X62Q 3K0XA 2Y0SG 3FKIG 3J7ZC 2QEXA 3RZOH 1UE6A 3GTGH 2KHJA 2PQAA 1IXRA 5JEAJ 3J81c 1QVCA 2NZHA 2IHFA 1L1OC 4IJLA 5HY6A 1PH6A 3AEVA 3KDFA 1HR0W 5C44H 2ALYB 1FVIA 4X6AH 3D0FA 3PO2G 1OXXK 2NVYH 5C44G 4GKJQ 1HZAA 4DV1L 2K4KA 3GTMH 1BKBA 2EQSA 3HOWH 4A3FH 1ASYA 3PIOA 1PHJA 3HOWG 4GOPB 5AJ3Q 1ASZA 4QGUA 4A3FG 1YJ9A 1Y1VH 3GTJH 4IPHA 4JI0L 4DR1Q 1C9OA 3L2PA 4HJAA 1PH5A 1EUJA 3OTOL 4JI6Q 4IFDG 4A3MG 2HIVA 1KXLA 1JJ2A 3U4ZA 1BVSA 2UUAQ 4P73A 4NXNQ 2NVTH 3TEHB 3K7UC 2VQFQ 4DV3L 4EQ5A 4JI4Q 3I4NH 5M3MG 4PG3A 3F2BA 4BXXH 2ES2A 2R7ZH 3S16H 3T1HQ 2D0PA 1SROA 3W1GA 1VQOA 4DR5Q 1N32Q 2ZTCA 1GD7A 4A3DH 2R7ZG 4LUOA 4QJFA 4YCWA 4GS3A 1BBUA 4B3TL 3S1MH 2VS1A 4C3JH 4JI3L 1IBLL 3S14H 4QQBX 4ME3A 1S40A 3CD6A 1CUKA 2UXBL 1PH9A 2K50A 3ZJYC 2VQEQ 1IL2A 3RNUA 4AQYL 1WYDA 2EIFA 5GQOA 2B63H 1YHAA 3RN2A 3HOUG 2AMCB 4H02A 3RZDH 4QL5A 5C0XJ 1NJIC 1RIPA 1K8AC 2GVAA 2JA5H 4JI7L 4DR7L 4NPSA 3JAMc 4DV0Q 3I2ZA 3DLLA 1VQFA 2JA5G 3PUYA 1K0RA 3HOVH 4A3BH 1I50H 1CKOA 1VQCA 4BY1H 3T1YL 3CC7A 4OX9Q 3HOVG 1SE8A 4A3BG 2I5HA 4IPGA 3M85A 2UUCL 4GKKQ 4A3LH 1HNZQ 2Q2HA 3JC66 4UPAA 1CSQA 4X62L 5M3FG 3TQYA 2F3IA 3CMAA 4Y52H 2CKZB 2F4VQ 1PYBA 4DPGA 3J80c 2XGTA 3J7A5 4YWMA 1VQIA 5BR8Q 4K0KQ 2AKWB 4WJ3M 3GD7A 4BA2I 2CWAA 2Q2IA 4L5TA 4HJ8A 1E1TA 2WFWA 2QA4A 4GKJL 1W3SA 1E1OA 2A8VA 4MNOA 3HOZG 4UP7A 3B6YA 3NEMA 5GAEC 5LMNL 1VQ8A 1VS0A 5AJ3L 1WI5A 1WFQA 3A5UA 1UE1A 1X9NA 1MIUA 1KRTA 2Z6KA 2WAQG 3NENA 4DR1L 3RN5A 1CKNB 1Q82C 5FLMG 4JI6L 4QIWE 4X65Q 3TREA 1HNXQ 2VNUD 4GLXA 3E9IA 2B29A 3PSIA 5C4JH 1N34Q 3K81C 3H0GG
chains in the Genus database with same CATH superfamily
1XJVA 5DEHA 5IT9E 4JI4L 1EY7A 1FNWA 2EYMA 2B3GA 2Z9HA 3I3CA 4DR5L 2OTJA 4YY3Q 4XT3B 1WTWA 3EN2A 1QG7A 3EJIA 1LTRD 3EQLC 4IZ8A 2C35B 1LYLA 3BDOA 3U9OA 1I4XA 4ZQ3A 2Q8TA 4QF4A 1HNWL 1QNUA 2R92H 5JJKA 4IPCA 1D1KA 1STEA 4JK1C 1ZYRD 4YWLA 4JI2Q 5J22A 3R2TA 1PTOH 4A3KH 4DV7Q 1YBYA 1VQJA 1Y8OB 4ZKBB 3QR8A 1WTXA 2B2WC 2K5VA 3M7GA 4G4KA 1QWYA 1UWVA 3S9WA 4S3SA 4IUUA 3ULLA 2WAQE 2VUMB 5DLQE 1JC7A 4K8JA 4POFA 1HZBA 2FXQA 2R93B 1R4QB 4HJ7A 3AQQA 4UP8A 3RR5A 1LTGD 2VL6A 3A56A 4LF4L 1PH4A 4FF4A 3CCQA 1EYDA 3H91A 5IY0A 5ELDA 1O7IA 2ASBA 3URYA 1XPRA 3CKIB 1T5EA 3KLSX 2RA4A 4A3MH 3CRKC 2EYFA 1BBXC 2HDMA 3K0YA 5ISRA 2C9OA 4X3KA 4YY3L 1T9HA 3TP8A 1I4HA 1VQLA 4AH6A 5BN3A 3KF6B 1VQ5A 3PO3B 4OWTB 1CSPA 4OO1H 4CDDC 4O0AA 2DY7A 2EYOA 1YITA 4JI2L 4FP5D 1A8VA 4L8JA 3G7LA 4DR2Q 4JV5Q 4DV2L 3HOUH 4F88A 2F0UA 2K28A 3PUWA 5E4WC 1CFMA 1S72A 4K5VA 2LS01 4FF3A 1HHVA 4O2DA 3KF8A 2F0VA 4EQPA 3DEOA 3ICEA 3NQIA 4KY5A 1Q8KA 1XNQQ 5C3WA 4X64Q 4KLKA 1UEBA 2XSCA 3I4MB 5J1ZA 1EYCA 1NY4A 2K32A 3WOEA 2A68C 1HCZA 4J1MA 1LV9A 1SFOH 2DGYA 4HJ9A 4HIMA 1MJEA 2R7FA 5KYIA 3ER0A 1U4PA 3L3OC 4J15A 3G48A 3I73A 1B44D 1EOVA 1I5FA 3HOZH 1DZ1A 3C1EA 2D62A 2NVYB 2G5DA 1I6HH 1D5XC 1SLJA 3U50C 2F1MA 1HQMC 3I72A 1RD9D 1VQPA 4DK3C 5J3BA 1BOSA 3H15A 4EQOA 1VMCA 1HJPA 1V1QA 3JAMi 3CW2C 1B4OA 2CW0D 3H0GH 2L12A 1FGUA 5E4XA 2NVTB 5CBAE 2KA7A 1QVGA 1MHWC 3HS0C 2VUMH 3M4QA 3X3MA 4B08A 1F2LA 1EY0A 2OQ0A 1VQ4A 3NBHA 2EYLA 1B7YB 2R93H 4B3SQ 4XIGS 1SNCA 4FXDA 5IGGA 3S1MB 3HEJA 3S14B 1D8LA 1UEAB 3PIP3 3ND8A 4DR2L 4JV5L 5IIFA 1TWAH 1EIYB 5IGBA 2E2JH 4GLVB 4ZCKA 5F2DA 1VQGA 1SDFA 3V05A 3VR6A 3HOXG 2UXDQ 1B9MA 4LAAA 1X3EA 1XNQL 1L1OA 4X64L 2QF7A 1JB3A 3KYHC 4DV3Q 4DNRB 1AE2A 4N9PA 1CKMA 3J80E 1C0AA 2F0FA 2HCCA 4TVAB 3KFUA 1Q46A 4LK1C 4A3IG 2PNRC 4WORA 2N8NA 4IUVA 4HJ5A 4IOCA 1VQAA 5IYCG 4YCVA 2WB1G 3S1QH 3STBC 3KLRA 3KBGA 4DAYB 3VYTA 3NELA 4DNTB 4DA2A 1N36Q 4P71A 1PZJD 4DK6C 4KI0A 1K8GA 2FMMA 4G7HC 3UE0A 1ICWA 3E0EA 5EKKA 4H0LC 2F0NA 4R1JA 5H1SE 2N3SA 2DNCA 2N49A 3BU2A 2HD3A 1STYA 1ESFA 1BNZA 1UNSA 2AQ1B 4R4QA 3K57A 4B3SL 4A3EG 2XTIA 4P75A 3PGZA 3L0OA 3CC2A 3AFQA 5EPKA 2Z8LA 4DR4Q 3TP6A 1TKWB 4JBMA 1IBML 1YNND 2EJGC 4LF6Q 2O5JC 5K5PA 2UXDL 4LF7Q 1TWGH 2HDLA 2NVXB 5I4DA 2F0PA 1SYDA 2JE6I 2A1AA 5E1FA 2KEEA 1EL0A 3A54A 1EZ8A 1JOQA 3MC0B 5COYA 1YHBA 4ALPA 4EX5A 3HRZC 3KJOA 1J9OA 4J6HA 4MZ9A 2B2TA 4ZUJA 2H5XA 3NQTA 2B39A 1SRUA 2ZTEA 5IGFA 2AQ3B 2K5DA 2QILA 1VQHA 3BVMA 3Q8DA 4JYAQ 3A7AB 2Y0SE 5DM73 3GTOB 2F3VA 2FHTA 1N36L 3KJPA 1YJNA 4RH6A 4YHHL 2EYHA 1EIFA 4G7OC 2H1EA 3OW2A 1TVXA 4BY1G 1ILQA 4L6TB 4R9WA 3E0JA 1X6OA 4DAMA 4HMIA 4JBJA 2IX3A 2JA9A 2QCPX 4RGOS 4DV4Q 4AYBG 5LHY1 1YNJC 1EFID 4DXFA 3X3NA 4QIWB 2F0KA 2MJ8A 4XTCS 3KLWA 1TS2A 1BBWA 2VZAA 4CDCC 2Q2UA 3BG3A 3L9AX 1RCVD 4K5XA 4RGMA 4A3JH 4DR4L 2RVLA 1PH3A 3I56A 1NNXA 3CCSA 4LF6L 3TZUA 1AFPA 5FLXc 1CT1D 1OXTA 4JI5L 2ZT9C 2GA4B 4LF7L 3FDTA 1K8OA 1K8MA 3HOXH 2PW7A 1S5FD 4NP5A 3A5ZB 1HZCA 2ATWA 4RG1A 2MP1A 4K2LA 2JJQA 2JA8B 3SK6A 1SNPA 3S15H 4KHVA 2RKSA 4A3IH 1F9QA 1CA5A 1FJGQ 1NCVA 1E0BA 1NR2A 1U0LA 3HOYB 3ERSX 4QB4A 2SEBD 1G6PA 3KBXA 1J6QA 2EDGA 4JYAL 4TSSA 4DGZA 2ID0A 4PMWA 3I8ZA 5IP9G 2F0TA 2UUAL 3HGBA 2LFNA 3D6CA 4HEDA 2AWNA 4KN7C 1VQEA 3CAMA 2WAQB 4XQNA 4K8IA 1X56A 4O42A 4BBSB 1KNEA 1JT8A 3T1YQ 2UUCQ 1B3QA 4DV4L 3OHXC 4X62Q 3FKIG 1HXYD 1F2YA 5DM63 3NPPA 1L1OC 3ERQA 2V4DA 1S5ED 1X3PA 5C44H 1LT4D 1TS4A 2EXZA 3D0FA 1OXXK 1JICA 3FPUB 5CV7A 4GKJQ 1WTOA 3GTMH 1ZEQX 3HOWH 5CV9A 1LO5D 2QW7A 3HG9A 4RCOA 5IGDA 3LX0A 3PIOA 3K59A 2A6ED 1ASZA 2MGSA 4IUTA 3E6ZX 2ENBA 4IPHA 4DR1Q 4RAUC 3U9SA 4JI6Q 3LNNA 1JJ2A 2PZWA 3MWYW 2NZ1D 3N52A 4ILWA 4WFN3 3GTQB 4NXNQ 2K7VA 1F2MA 3SE0A 1EZ6A 2VQFQ 4K6DA 5M3MG 2F0HA 3P20A 2ES2A 3T1HQ 3GTKB 1SROA 3AU7A 1VQOA 1N32Q 3S1RB 2ZTCA 4DF7A 1GD7A 1BBUA 5C3XA 1S40A 2K01A 2JA6B 4C3IG 1JE4A 1S5DD 2VQEQ 3OMCA 1I3QB 3NTIA 1YHAA 2KVMA 1NJIC 2JA5H 4L63B 4DR7L 2VB3X 1PRTF 4OHJA 4PV1C 3HOVH 3DLLA 4HCEA 1TWCB 4BY1H 3T1YL 4IPGA 3M85A 2UUCL 1CA6A 2L11A 2Q2HA 4X62L 2F3IA 3CMAA 2CKZB 5CV8A 1PYBA 3RMHA 3TDQA 2YU9B 1VQIA 4K0KQ 3M3YB 4WJ3M 2RDFA 4YIJA 4HJ8A 2QA4A 4GKJL 1W3SA 2I07B 3F2UA 2DJFC 1BXTA 2B2TC 5EPJA 3FEWX 1WFQA 1X9NA 1TT2A 1CK1A 2Z6KA 4DR1L 1CKNB 3LWEA 4JI6L 1EEID 3SHLA 3TREA 1HA6A 1V1OA 1N34Q 3V96A 5GADC 1F9RA 2VQFL 1KC8C 1U5KA 1L1OB 5IYDH 5LMNW 1JOOA 3T4AC 1BO0A 2IHEA 2I5MX 3NHHA 1DOKA 4GN4B 2VQEL 4MTKA 4OIJA 5IP9H 4IUQA 2BDNA 1YJWA 2R92G 5C3EG 3I70A 5C4HA 4LF8L 4Y7NB 4LF9Q 1A62A 5D3IB 2CCZA 3GTQH 1B1ZA 1IYUA 1PXUA 4FO2A 3J7AV 4A3KG 2BA1A 4P74A 3D4RA 3RLFA 3GTKH 2A69D 2E76C 1GM5A 3T51B 1L0XB 1QB5D 1YEZA 1R9TH 1JWUD 2BH8A 4KY6A 1XMQQ 2RDGA 1Z7TA 1ENFA 4PZ7A 1XNRQ 2XVSA 1LT5D 4WJWA 4QMGA 5M5WH 1SMYD 1PLFA 3ITPA 1CZGA 3RLNA 4V190 2JA7B 4DAYA 1GO3E 1XPUA 1EOTA 1QOHA 3CCRA 1ZYRC 5EKLA 2ZJPA 4DR3Q 1N34L 1TS3A 2E8GA 2VB2X 2QEJC 3P1HA 3FMCA 3M4YA 5M5YB 1STBA 4XYQA 4U68A 2EZVA 1IZ6A 4NXMQ 5GAGC 4B9WA 2NB0A 1RHPA 5M3MH 2FJ2A 4B3MQ 4IFDJ 1K83H 2L15A 4IN3A 1WCMB 1GUNA 4I7ZC 1Y1WB 4OO1G 4IALA 2EPBA 4C3IH 1SEBD 2RCNA 1VQDA 5IWAQ 2IT1A 4CBVA 1B53A 1YVCA 2XIWA 4LF9L 1D5MC 3VR3A 1PTOF 3ULJA 5LMUQ 4KJOA 4ZAIA 4C3HG 1GHKA 4BY7B 2WB1E 1P16A 1PTOD 3BZCA 4KHZA 2KUMA 2O5IC 1SYBA 3R2IA 3K7AH 2MO1A 4U673 2KHIA 1OXSC 1HH2P 4DXGA 3F2CA 3PF5A 1XNRL 1IW7D 4BS9A 1LT6D 1UE5A 4M1UB 4EVOA 4PMCA 1MGSA 5EBCA 5JVG3 1XXGA 2KOLA 3KUPA 2PZTA 3WDNA 4ZLTF 5I6YA 4X3UA 5KIXA 1Z6HA 3HZXA 2E5LQ 4FYDA 4A3FB 1KDBA 1TU2B 2OCEA 1J5EQ 2UUBQ 4DR3L 2D5DA 1LTTD 5DAUA 3GDEA 1TIID 1Y1VB 3BVGA 3FHWA 4NXML 4LW1A 4JBWA 3K6OA 1OTCA 4FVMA 4DNIA 1AE3A 5M5XH 1EY4A 4RCNA 4ZK9B 2K52A 4CJ0B 1BCPF 4B3ML 4LFBQ 2YTYA 3OIQA 2VUMG 1HUNA 2JSOA 1BCPD 1QE6A 4IUNA 4YWKA 2R93G 5ELEA 3IKJA 3KOJA 1JB7A 2KJXA 4JVZA 4NW2A 3BS1A 2KHSA 3J81L 5C3EH 2WACA 1M8AA 1X54A 3VYUA 3RZDB 4LNQA 1B8AA 5M5YH 1Q12A 2Z4HA 1JE5A 2LSSA 2EJFC 1M90C 4LF5Q 3T16A 2Z6KC 1DXMA 2CW0C 3Q22A 4FNFA 3SK4A 4HIOA 2PMZE 3S2HH 5IE8A 4V0BA 2PW5A 3PO3G 3LWUA 3UDXA 2F4IA 1IBLQ 2PZUA 4DFAA 1O7YA 1CQFA 2ZXPA 2E5LL 3PUVA 1MSHA 2EJMA 2AUKA 4AYBE 2UUBL 1FNUA 2BCOA 1FR3A 5JEAG 1XTDA 4X65L 4IURA 4UY8C 1QCBD 1I4QA 5CV6A 1Q90A 5C4JB 3I4MG 4DR6Q 4WRDA 4CKEA 2V1CC 3DM3A 2K75A 4LFBL 1PH8A 3WWVA 3VDYA 5TSSA 2CQOA 5EJWA 1YI2A 3DWQA 2F0SA 1EQTA 4X3TA 3RUZA 4LUVA 4C1NI 3I55A 3J80L 3SEBA 4K6LA 1JMCA 4CKBA 3N6RA 1RJTA 1DM0B 4A3GH 2ZJQA 1C4QA 2NN6I 1GJXA 1G2SA 1U4LA 4C3HH 4DV7L 2EYPA 1VDZA 4LF5L 3AFPA 2XN9C 4LFAQ 1STAA 4GN3B 4FXGC 3NWSA 1TWHB 5IT9c 3W1BA 3ULPA 4BXXG 3I4LA 3S17B 1ZKOA 1G51A 5C0XG 3J81E 4FF2A 4XQQA 3GTGB 2ZXOA 5D65A 3W2DA 1D5ZC 2CHBD 1A0IA 4KKSA 3C46A 3PO2B 3MTSA 4OXPA 2OEOA 1EYGA 1K28A 3T53B 2FINB 1HA5A 3EBEA 5AFWA 1STNA 2K5QA 4DV6Q 1HR0Q 1AW7A 3VA7A 3U4VA 4DR6L 4GOPC 1NTGA 1EU3A 1F2ZA 1LACA 1HFNA 4KD3A 3ZYYX 5A35A 1N33Q 5EQ0A 4C56C 1A3TA 1PFBA 2B8FA 3J7AF 1F9PA 3BJUA 2R7ZB 4KKUA 2EXDA 1B3AA 1MBYA 4A3JG 1OXUA 5KYLA 4H7BA 3PUZA 2R61A 2ZXRA 1B70B 2K6AA 2NYZD 3AYHB 1CKNA 2O2LD 3TSSA 4MN3A 1M4VA 4A3BB 1KRSA 1C8CA 3BZDB 5M3FB 5CV5A 4XDXA 1G6ZA 2GN5A 4EQNA 3CCEA 3PO3H 2UU9Q 3MHBA 1GUWA 2D0OA 2YTVA 4QUCA 2BH2A 2DUDA 2JQOA 5IGEA 4DUZQ 4JPBW 2E2IB 5FJ8H 3M4OB 3GP7A 1VQMA 1D2BA 1NUCA 1JR0D 1SE3A 2RBMA 3G71A 3GTLB 1PVOA 4DV6L 1SAPA 1WTQA 1IYVA 3Q0AA 1HR0L 2F0JA 5JEAH 1ONLA 3I90A 4IFDI 1K9MC 1IBKQ 4A4IA 2Z4IA 1O80A 1H9JA 2DNEA 3J81j 5I6WA 1YIJA 3I4MH 2EY1A 5CGKA 1N33L 1EY6A 3GTGH 2PPBC 4OEMB 3J81c 2QDLA 3AEVA 5EBDA 3KDFA 3MFGA 1LABA 3BYTB 4G7ZC 2ALYB 2D9UA 1SNMA 2NVYH 5C44G 3EROA 1BKBA 4G57A 2RSOA 1WTPA 1SYFA 2XRQD 1ASYA 3HOWG 4KY7A 4GOPB 3MAQA 1YJ9A 1C48A 1C9OA 3T13A 4HJAA 1EUJA 2KQ3A 1KXLA 4C2MB 1KDAA 2X6LA 2NVTH 4P73A 3TEHB 3K7UC 4KTAA 4DV3L 4BXXH 5DNFA 2R7ZH 1KNAA 4ULLA 5D3DA 5C0XH 4BBRB 4LUOA 3S1MH 3OIPA 1RDPD 3S14H 2WB1B 5KEEA 2M00A 1PH9A 5A2QL 2K50A 4A93B 1FYCA 2WV6D 2EIFA 3CQZB 1S5CD 2AMCB 2GVAA 1GHJA 3MXUA 3P7JA 4NPSA 4DV0Q 1UUPA 4A3BH 2JA5G 3PUYA 1K0RA 2A6EC 1HTPA 4OX9Q 3HOVG 4GKKQ 2I5HA 4DU9A 1HNZQ 3JC66 4UPAA 2CH4A 1EWCA 3S1NB 5KNDA 3C3LA 2O4XA 3J80c 3J7A5 2AKWB 5KNBA 2G9HD 4JW0A 4A3EB 4EGVA 2Q2IA 3GTPB 2A6HD 2B2YA 4MNOA 2TMPA 3SDZA 3DXJC 3B6YA 5GAEC 2EYJA 1S4ZA 3FRPB 5KNCA 5ELFA 1WI5A 3OWEB 3VYSA 1KRTA 2WAQG 1Q82C 5FLMG 1Q8IA 5C4XB 3DUZA 4OIKA 1EQVA 4GLXA 3C1FA 1WOCA 2G9DA 2DY8A 3RLOA 1Q86C 1I94Q 3NUCA 1GVPA 1PRTC 1WJJA 2K5NA 4RFBA 5IYDG 1PYWD 4B9XA 5FKAC 3EIVA 3D8GA 2AQ2B 1RODA 1B50A 3A0JA 2E2HB 1LLRD 1I6VC 2NVXH 1NBWA 4DV0L 1PA6A 4C1NK 2CFMA 2OT2A 4B3RQ 5G3LF 3H09A 4OX9L 1GUTA 1K0SA 1HNZL 2B63B 1WD1A 2LY7A 3BYYB 5G3LD 2N88A 2F0OA 2DN8A 4AYBB 3I91A 5A2QE 3CXCA 2R6GA 3M9BA 3S2DB 2F0QA 2R3ZA 2NUCA 3TMEA 3A74A 4A93H 2JA6G 1KL9A 4HTHA 4JCVE 3GTOH 3CPFA 3MXNB 1WTRA 1AH9A 1H9SA 3A8JE 1NR4A 1PMRA 2IX1A 5CMDA 2BDOA 3FVQA 1JOKA 2LXKA 2BOSA 1EFWA 3G6JB 1EWIA 1Q1BA 3CHBD 5K36G 1ILPA 4ZYSA 3SGIA 1W2BA 2NZOA 4MIUA 4IJHA 3J81i 1FJGL 1DONA 3OW7A 1QVFA 3G4SA 1LTSD 5I9PA 1U4MA 4N8X1 2J0TD 4R8NA 3E5SA 3E3XA 1ET9A 1S5BD 5C4XH 1EQRA 4PZ8A 4B3RL 3NTHA 2ZJRA 2PYKA 1SMYC 5CYUA 1MSGA 3VR2A 3D4WA 1PRTB 4I7AA 1PFNA 4A76A 2HHHQ 2MFIA 2F0EA 4JI1Q 1IKMA 1PDQA 3HFZB 1PFMA 1E22A 2PO4A 1HPCA 3FKIB 2JA8H 1XMOQ 3QOLA 1LM0A 1B2TA 3MVVA 5CORA 3CMEA 3HOYH 1E2ZA 2X69A 1SXTA 1MI2A 2Z6BA 1N9WA 1UE7A 5IGCA 5ELBA 1D6EC 2MUYA 3MFYA 2B63H 1CTMA 2NN6G 1KAAA 5FLMH 2OWOA 4BBSH 1KD1C 1VQNA 4UP9A 1RF2D 1ENAA 1U4RA 2A19A 3Q23A 3VR5A 1GUSA 4NXNL 2RHQB 1PTOC 1BQQT 3I4NB 4ME5A 3OWFA 3J80i 3T1HL 1N32L 4BA1I 2K05A 1X55A 3UE1A 4A3DB 3MZ5A 4A75A 1IW7C 1E7ZA 2Z0SA 4DV1Q 1SMXA 2AUJD 4Q0FA 3VA5A 5CBEE 3H3VI 1Z47A 2JEBI 1TY0A 1UAPA 3PQIA 2B2YC 5EKIA 4OWXB 1K3BC 2A5HA 2HHHL 4IPDA 4JI1L 1YHQA 1I50B 4QCLA 3DHQA 2E74C 1II3A 4J8QA 2K03A 1XMOL 4L5RC 4ABNA 3S1RH 1X3GA 4K0KL 4E6IA 1RL2A 3BDCA 1WCMG 4HMJA 1Y1WG 3KDFB 2AHOB 2JA6H 1BCPC 3K58A 3I7FA 3S24A 1I3QH 4F87A 1Q1EA 2HUGA 4FDBA 3BZKA 3QG1A 3K80C 2EY6A 5IOCA 1MKHA 4A3CG 4JI7Q 1A3VA 3HKZG 1YNXA 4IO9A 1TWCH 3HP3A 1TQOA 2GVBA 2YTXA 4HSVA 5CV4A 1TXYA 2HT1A 1RTOA 3MA2B 1GKHA 3R93A 2F03A 4OONA 5K36H 1VQ9A 4X6AH 2YU9H 4JBKA 3M3YH 1A2UA 4HSPA 4MHEA 4POGA 5CR3A 3E9HA 2SOBA 2K04A 1O7ZA 4RKLA 1I4RA 1U9RA 1KDCA 5LMNQ 3TS2A 4HIDA 2Q8RE 2I5LX 3PF4A 2R92B 4L5SA 1MD2D 4OELB 1QUQA 4GOPA 1CQVA 1Y1VG 1PTOB 3G6EA 4A3KB 4A3GG 1TS5A 3F2DA 2MQHA 1XTCD 1GOZA 5ELCA 1H9RA 2NTTA 1F9SA 3ONAB 1KHIA 1V43A 2IJ0A 3DMUA 2MHVA 3TN2A 1ET6A 2KCMA 2Y0SB 2SNSA 2JXMB 2L1BA 3IRBA 2K1BA 1XMQL 3RZOB 1NE3A 2MNAA 1AZQA 2WP8J 1K3RA 2M2LA 1HNWQ 4N8FA 1I4PA 3TS0A 2F52A 2L0CA 3CU7A 1XX8A 4LFCQ 1EU4A 1STGA 1Q3LA 4Y7NH 2NN6H 3IL8A 1H95A 1H9MA 1L0YB 2BE5D 1WD0A 4GLAC 1M1KC 4R4OA 4A3MB 2F0GA 1FL0A 2JK8A 4GN5A 3A55A 1BCPB 4PNYA 1I4GA 2J7ZA 3AMUA 1A2TA 1PZKD 4M8AA 3S16B 3QOJA 4GNXA 4QY7A 4IUPA 4ZKCB 3D3RA 3SXHA 4C3JB 4PQXA 5IWAL 2C5CA 4LF4Q 2JA7H 1WVLA 3BVZA 1HFGA 4CDFC 1N8RC 3HOUB 3L7ZC 2OF1A 1EIHA 2SDFA 1JQYD 2K14A 5LMUL 2KECA 1EIGA 2KEDA 1SNQA 2OQKA 2M9VA 1VMPA 4XYOA 1IKLA 1E3PA 2RF4A 4K14A 4OWWB 4X3SA 2FFKB 4F8MA 3J7YW 3QJYA 1SFOB 1EQQA 1WCMH 1A63A 1LTAD 4P72A 1Y1WH 3HOZB 2CH4W 3PMFA 5NUCA 2D2CC 2RDHA 5HGQA 4LFCL 4DV2Q 5FJ8G 1I6HB 3GV6A 2CWPA 4JOIC 4R4TA 2J4XA 1H9SB 3R8BA 1J5EL 3GO5A 2F0MA 3SVMA 1RKNA 4JC0A 4BY7H 1G2TA 3NWTA 5IYBH 3U58A 2TSSA 3CRLC 3D6WA 3H0GB 2K5WA 3NE5B 3IFDA 3RZOH 3WOFA 1SYCA 4BWGB 2PQAA 1IXRA 1QJOA 5JEAJ 1QVCA 4TKOB 1PH6A 4DK0A 5HURA 3GQBA 1HR0W 4KD4A 3PO2G 1TWFB 4LMQD 1HZAA 5JPMC 1FNVA 1HQRD 2EQSA 4XQJA 3MXNA 1Y8PB 1TWAB 2L9HA 4A3FH 1FGBD 2E2JB 1PHJA 4DK1A 5AJ3Q 4QGUA 5JPNC 4IFDH 1Y1VH 1CZWA 2WKDA 5C4ZA 1DCZA 2A74C 1JWMD 2WIIB 3U4ZA 1BVSA 1E2WA 2F0WA 4PG3A 1ZXTA 3S16H 2D0PA 1BR9A 2XRSD 1EEFD 2R7ZG 4QJFA 4YCWA 3NSWA 4GS3A 3K5MA 4ZUIA 4C3JH 1IBLL 4QQBX 1LTBD 4ME3A 1ML0D 5BN5A 3OMGA 3ZJYC 3S1QB 1G91A 3RNUA 1WYDA 1WTVA 1BDOA 2B2VA 1VF5C 2MPMA 2F0IA 3RN2A 3RZDH 5JJZA 1SNDA 3DWPA 4QL5A 5C0XJ 1K8AC 4RHSA 3I2ZA 1VQFA 1YNNC 1CKOA 1AEXA 5FLXL 3CC7A 4Y52H 1SE4A 1SE8A 4A3BG 1SYEA 4KKTA 3QWNA 1DJRD 5M3FG 1R4PB 1CHQD 3NTKA 4DPGA 4GZYC 3SK5A 2XGTA 5BR8Q 2E2DC 4CGYB 1J8IA 5LL6S 2L55A 4NMZA 1E1TA 3NBIA 1E1OA 2A8VA 4UP7A 5EGTA 1VQ8A 1VS0A 2HQEA 1T5XD 4OL7A 5AJ3L 1UE1A 4CKCA 2OXPA 3RN5A 1W6KA 4K2KA 1KTKA 1TWGB 1HNXQ 2VNUD 3E9IA 2B29A 3PSIA 5C4JH 3K81C 4DKAC 1SBBB 3DWAA 5FO8B 3CC4A 3H3VC 4K5WA 3IAYA 4LFAL 4RGTA 1VF7A 1V9PA 2EE1A 2UXCQ 2Z1CA 4WJ4A 1QILA 4KK7A 1TWFH 2WKCA 2NVQB 4I65A 2PI2E 1SJHD 1DOMA 3GV3A 1JCKB 4RHRA 3CF5A 1QZHA 2CVRA 2A6HC 1BUVT 2PQEA 5I2YA 3I4OA 2XWBB 1IBMQ 5FO7B 1L2FA 4RWSC 4XXEA 2B8GA 1G8ZD 4GNXC 1KQSA 3TP5A 4NKLA 2PI2A 1Q7YC 2RCFA 3TBIB 4H13C 3EVQA 3VYRA 2IX0A 5FO9B 2YV5A 3PIO3 5HGTA 1TWHH 3AB9A 3S17H 5BR8L 4CHTB 2MO0A 3A7LA 4BBRG 3MEHA 3HKSA 1KIXA 4FF1A 2KENA 4Q5VA 1EY5A 3PO2H 4OO1I 4A3JB 4A93G 2HCIA 5FLXE 5JJIA 2YYZA 3K5OA 2JP1A 1P8LA 1RTNA 4YHHQ 1BF4A 1HNXL 1EWHA 4IQZA 2BA0A 3Q24A 3SK8A 3HOXB 1QUQB 5C6AA 3UI2A 1DOLA 2A68D 2IPKD 2UXCL 2NWGA 2NTSA 1QNKA 1G291 4TQUS 2KCTA 3S15B 4A3IB 2UU9L 1SN8A 3W5OA 5EAYA 1OO9B 2XWJB 4DUZL 4L5QA 4X66Q 1VQ6A 5IP7G 4JI5Q 1EY8A 1CI3M 1HZ9A 5C4XG 2QKIC 4JG2A 5EPLA 1B9NA 3O13A 1ENCA 1IBKL 1EYAA 1V1PA 1YZ6A 5M3FH 5ELNA 2LKVA 5ELOA 1JWSD 1F77A 2NVQH 1Y14B 3NK9A 5E3FA 3HKZE 1Y8NB 2JA8G 1X65A 4UHVA 2LXJA 4R4CA 5L37A 5C44B 5I2XA 4GNXB 2E2IH 3HOYG 3M4OH 1A15A 3CCUA 3GTLH 3OYYA 4R4IA 3GTMB 3HOWB 2ZTDA 5C5LA 3F1ZA 1VCIA 2R7DA 1XYIA 2F4VQ 1NMFA 1VQBA 2IW3A 3F8TA 5JOBA 1EY9A 3UDFA 1Y69U 2JYOA 4O1NA 4DAVA 2B63G 4BBSG 1LUZA 3UDIA 2B2VC 3K8AA 2RQXA 1S3OA 5JAVA 3UDGA 1KABA 3CCMA 5D14A 4RKBA 5KGUA 3KK7A 4R8IA 2IL8A 1GUGA 4KHPQ 2IY5B 3STBD 1SYGA 1X3QA 4X66L 1GXDC 1HRJA 4RA8A 5GAHC 3MEFA 3M7NA 5FK9C 2A73B 1GUOA 1AN8A 2PMZB 2JA5B 1A6XA 3HOVB 1O78A 3QIAA 4C2MH 1Q81C 1PH2A 1ICFB 4DN4M 4BY1B 2KCCA 3M4PA 4GKKL 2KBNA 1PH7A 4LUZA 3A8KE 1JJCB 2JEAI 2XNAC 4DUYQ 4BBRH 2N55A 2AWOA 3H6MA 1JORA 2PQAB 2F3WA 5JJLA 5IYCH 4YCUA 3PIPA 3MXPA 3MXGA 3BDLA 5CC4A 3VR4A 3H3VH 3CQZH 4XT1B 3CCVA 3V2TA 2F4VL 2HQLA 1X32A 4DR7Q 3CPWA 2HIXA 2RSNA 5GROA 2WINB 3S1NH 5E7NA 1SE2A 4HIKA 1O7LA 4RGNA 1I94L 2EVBA 3CP0A 3FP9A 3CCJA 2FMCA 4OGQC 2VW9A 3JAML 2B2UA 5C0XI 4HN7A 4A3EH 1W6JA 3TRZA 4KHPL 2A69C 2L4NA 2KCNA 3GTPH 5BN4A 1MJCA 3EA6A 4RMFA 1HTLD 5IP7H 1C7YA 1KAWA 4ZRZA 2EOTA 4CJ2C 2N78A 1SR3A 1TY2A 3KF8B 4DV5Q 3KLSA 2P5ZX 2L5TA 1WTHA 5J39A 3PV0A 4DUYL 1YNJD 3I4NG 1VQ7A 1KLUD 3KF6A 1PYSB 3EFXD 4PZ6A 4HR7B 2NBFA 5I9OA 3QO2A 4A3DG 1R9TB 3OSOA 1AZPA 1VQKA 1PZID 4JI8Q 4KN4C 5IODA 2E2HH 5LL6X 5M5WB 1DYQA 1L0WA 3PUXA 3C2PA 4LF8Q 1QZGA 4A3CH 1STHA 2QDBA 3DEPA 1PRTD 4PMBA 1PH1A 3D31A 4A3LG 3GTJB 1KLGD 1E24A 3LGJA 3T56B 1LTLA 3S2DH 2ZM6Q 5M3MB 4H44C 2PCFB 3K5LA 3NBHB 2EY2A 2I0QA 3D4DA 4UAIA 1K83B 1D7QA 2K5HA 2VY3A 4JOIA 1SJED 4C3IB 1DGSA 4APVA 2IWHA 1K73C 1XPOA 2ICEC 4NB3A 2B2WA 2JA7G 2QGQA 5M9OA 4DV5L 2F0DA 4FXKC 4JI0Q 3JAME 2CQAA 1PFSA 1Z9FA 3OTOQ 4MTNA 1PV4A 2BE5C 4CJ1B 2PNHA 1NMGA 4ID6A 2H4OA 1AP0A 3K7AB 1X3FA 4LWCA 4IOAA 1SNOA 2JN4A 2I46A 1CHPD 2VXWA 4DAPA 3IFTA 4JI8L 3CCLA 3DM1A 4B3TQ 1JJGA 4AIMA 2F0LA 2OTLA 4JI3Q 3PCOB 2UXBQ 3TP7A 2RHSB 3RD4A 4N9TA 4AQYQ 1IHZA 2DJGC 1IYJB 5FOBB 4KJNA 1H9KA 2Q2TA 2SNMA 1HUMA 4BY7G 1OXVA 2X6GA 3FKIH 5IYBG 1ESRA 2ZM6L 1NSNS 5M5XB 3K0XA 2Y0SG 3J7ZC 2QEXA 1UE6A 2KHJA 2NZHA 2IHFA 4IJLA 5HY6A 4F7XA 5IT9L 3SR1A 1FVIA 1NAPA 3QB3A 5C5MA 4DV1L 2K4KA 5T1GA 2LMCB 1IL8A 1V8QA 5C3EB 5JVH3 4A3FG 4JI0L 3GTJH 2Q8IB 4CDEC 3H94A 3L2PA 1PH5A 3OTOL 4IFDG 1CM9A 4A3MG 2HIVA 4HAEA 1FD7D 1LT3D 2UUAQ 1V1PB 4EQ5A 4JI4Q 3I4NH 3W1GA 4DR5Q 3S2HB 4LJZC 4A3DH 3OOCA 4B3TL 2VS1A 3A8IE 4JI3L 1D1IA 3CD6A 1CUKA 2UXBL 4C3JG 2K33A 5KRUA 2B2UC 3R3OA 3W3AA 3ND9A 1IL2A 4AQYL 5GQOA 3HOUG 4H02A 3HKZB 1RIPA 4JI7L 4TRDA 5T1IA 3NP8A 2ICIA 3JAMc 4QUFA 3TZDA 1I50H 1VQCA 1XWEA 4A3LH 1TR5A 3NXWA 2EY5A 4Z9CB 1CSQA 1DD2A 3TQYA 1E2VA 3OPOA 4UDUC 4KMUC 4YWMA 3Q6SA 3GD7A 4HCSA 4BA2I 1SSOA 2CWAA 4KV6A 4L5TA 2WFWA 3K5NA 3HOZG 2E75C 3FPPA 1LTID 3NEMA 5LMNL 4NDXA 4ODGA 3A5UA 1A3UA 1MIUA 3NENA 3P75A 4QIWE 4X65Q 4A3GB 4P2CB 3F2BA 4C3HB 3H0GG
chains in the Genus database with same CATH topology
1XJVA 3CC4A 1WOCA 2VQFL 1KC8C 4JI4L 1U5KA 4LFAL 1L1OB 3RLOA 1Q86C 1I94Q 1V9PA 1GVPA 1WJJA 2B3GA 2UXCQ 2K5NA 4DR5L 2OTJA 4YY3Q 5LMNW 5IYDH 4WJ4A 3EN2A 2IHEA 2I5MX 5IYDG 1TWFH 2C35B 1LYLA 2PI2E 3EIVA 3CF5A 4GN4B 2VQEL 1QZHA 1HNWL 5JJKA 2R92H 1IBMQ 4IPCA 3I4OA 5IP9H 1L2FA 3A0JA 1YJWA 4YWLA 4JI2Q 5C3EG 2R92G 4GNXC 1KQSA 1NBWA 4DV0L 1PA6A 2NVXH 2CFMA 4LF8L 2PI2A 1Q7YC 4LF9Q 1A62A 4B3RQ 4A3KH 2CCZA 4OX9L 3GTQH 4DV7Q 1YBYA 1HNZL 2IX0A 1VQJA 4A3KG 2YV5A 2BA1A 4P74A 3RLFA 1TWHH 3GTKH 3S17H 2K5VA 5BR8L 1GM5A 2MO0A 3CXCA 2R6GA 1UWVA 3M9BA 4BBRG 1YEZA 1R9TH 2BH8A 3HKSA 1XMQQ 3ULLA 2WAQE 1KIXA 5DLQE 3A74A 2KENA 4PZ7A 1XNRQ 4A93H 4POFA 3PO2H 4OO1I 2JA6G 1KL9A 1HZBA 2FXQA 4A93G 5M5WH 4HJ7A 3AQQA 4JCVE 3CPFA 3MXNB 4UP8A 3RR5A 2YYZA 2VL6A 3GTOH 4LF4L 5JJIA 1PH4A 1AH9A 3RLNA 3CCQA 1GO3E 1XPUA 2IX1A 1P8LA 5IY0A 4YHHQ 1O7IA 3CCRA 1HNXL 2ASBA 2BA0A 5GADC 2ZJPA 1QUQB 4DR3Q 1N34L 1XPRA 2LXKA 4A3MH 2E8GA 1EFWA 4NXMQ 1EWIA 1IZ6A 1Q1BA 5K36G 5GAGC 2UXCL 4YY3L 5M3MH 3SGIA 1T9HA 1W2BA 1VQLA 2NZOA 1G291 4AH6A 3KF6B 2KCTA 4TQUS 4IJHA 3J81i 1VQ5A 2UU9L 4B3MQ 1K83H 2L15A 1FJGL 4OWTB 1SN8A 1CSPA 4IFDJ 3W5OA 5EAYA 4O0AA 1QVFA 3G4SA 4DUZL 4OO1G 4L5QA 4C3IH 2RCNA 1VQDA 5IWAQ 4X66Q 1YITA 4JI2L 1A8VA 2IT1A 1VQ6A 5IP7G 4DKAC 4DR2Q 4JI5Q 4DV2L 4JV5Q 5C4XH 3HOUH 1YVCA 1EQRA 3PUWA 4LF9L 4PZ8A 4B3RL 2ZJRA 1HZ9A 1S72A 5C4XG 4JG2A 3ULJA 5LMUQ 4O2DA 1IBKL 4A76A 2HHHQ 3ICEA 2MFIA 2WB1E 1P16A 3BZCA 4KHZA 4JI1Q 3HFZB 1Q8KA 1XNQQ 1YZ6A 5M3FH 1E22A 4KLKA 1UEBA 5ELNA 5ELOA 4X64Q 2JA8H 1XMOQ 3K7AH 1NY4A 2MO1A 2NVQH 1Y14B 2KHIA 1LM0A 3HKZE 1SFOH 2JA8G 2DGYA 1OXSC 1HH2P 4HIMA 4HJ9A 3F2CA 3PF5A 1MJEA 1XNRL 2R7FA 1UE5A 3ER0A 1X65A 4J15A 3CMEA 3HOYH 2LXJA 3G48A 4R4CA 1EOVA 1I5FA 3HOZH 2E2IH 4GNXB 3HOYG 3M4OH 1N9WA 1UE7A 2D62A 3CCUA 3GTLH 3OYYA 1I6HH 1SLJA 4R4IA 3U50C 2ZTDA 2E5LQ 3F1ZA 1VQPA 4DK3C 2OCEA 5J3BA 1J5EQ 1VCIA 2R7DA 4DR3L 2NN6G 1NMFA 1VQBA 3F8TA 3UDFA 5FLMH 3H15A 2OWOA 3GDEA 4A3CG 1HJPA 1V1QA 3JAMi 2B63G 4BBSG 1LUZA 3CW2C 3FHWA 3UDIA 1KD1C 4UP9A 1VQNA 4NXML 4LW1A 3H0GH 4JBWA 1OTCA 2A19A 1FGUA 4DNIA 3K8AA 1S3OA 1AE3A 3UDGA 5M5XH 4NXNL 2RHQB 3CCMA 1QVGA 2K52A 2VUMH 3M4QA 3J80i 3T1HL 4B3ML 4LFBQ 2YTYA 2OQ0A 1VQ4A 2VUMG 1N32L 4BA1I 1B7YB 2R93H 1X55A 3UE1A 4KHPQ 2IY5B 4B3SQ 4XIGS 4YWKA 4A75A 2R93G 1E7ZA 3STBD 2Z0SA 1D8LA 4X66L 3KOJA 4DV1Q 1JB7A 1SMXA 4DR2L 4JV5L 1TWAH 1EIYB 5GAHC 2E2JH 3MEFA 3H3VI 5C3EH 1Z47A 2JEBI 4GLVB 3M7NA 1X54A 4LNQA 1VQGA 3HOXG 1B8AA 4OWXB 5M5YH 2UXDQ 1Q12A 1JE5A 4IPDA 4JI1L 1YHQA 2LSSA 2HHHL 1X3EA 4C2MH 1Q81C 1XNQL 1PH2A 1L1OA 1M90C 4GKKL 4X64L 3M4PA 2KBNA 1PH7A 4LF5Q 3KYHC 4LUZA 1JJCB 1XMOL 2Z6KC 4DV3Q 4L5RC 1AE2A 2JEAI 1CKMA 1C0AA 4TVAB 4HIOA 4DUYQ 2PMZE 3KFUA 1Q46A 5IE8A 3S1RH 4BBRH 1X3GA 3S2HH 4K0KL 4A3IG 3UDXA 3PO3G 1RL2A 2AWOA 2PQAB 1WCMG 2N8NA 5JJLA 5IYCH 4YCUA 3PIPA 1IBLQ 4HJ5A 4IOCA 1Y1WG 3KDFB 2AHOB 2JA6H 1VQAA 5IYCG 4YCVA 2WB1G 3S1QH 3I7FA 3S24A 1I3QH 1Q1EA 4FDBA 3STBC 3BZKA 3CQZH 3PUVA 3CCVA 3K80C 2E5LL 3H3VH 4AYBE 1MKHA 4DAYB 2UUBL 2F4VL 2HQLA 3NELA 4JI7Q 1N36Q 3CPWA 2HIXA 4DR7Q 4P71A 3HKZG 1YNXA 4IO9A 5JEAG 4DK6C 4KI0A 1TWCH 1XTDA 5GROA 2GVBA 2YTXA 4X65L 4UY8C 1K8GA 1TXYA 2HT1A 1GKHA 3S1NH 3UE0A 5E7NA 3E0EA 4HIKA 3I4MG 4DR6Q 4OONA 4R1JA 1I94L 5H1SE 2V1CC 3DM3A 3CP0A 3FP9A 3CCJA 1VQ9A 2YU9H 2N3SA 2K75A 3BU2A 2N49A 1PH8A 4JBKA 2VW9A 3M3YH 3WWVA 4LFBL 5C0XI 4A3EH 4R4QA 3VDYA 3TRZA 4KHPL 4B3SL 2CQOA 4POGA 4A3EG 1YI2A 3GTPH 2XTIA 3E9HA 4P75A 1MJCA 3PGZA 3L0OA 3CC2A 3AFQA 4DR4Q 4JBMA 4LUVA 4RMFA 3I55A 5LMNQ 3TS2A 4HIDA 1IBML 2I5LX 3PF4A 5IP7H 1C7YA 4L5SA 4LF6Q 1KAWA 1JMCA 2UXDL 1QUQA 4GOPA 2N78A 1SR3A 1Y1VG 1TWGH 4LF7Q 4A3GH 2ZJQA 2NN6I 2JE6I 3KF8B 4DV5Q 3G6EA 4C3HH 4DV7L 4A3GG 2A1AA 3F2DA 4LF5L 2MQHA 3AFPA 4LFAQ 3PV0A 1YHBA 4GN3B 4ALPA 4EX5A 5IT9c 3KJOA 4DUYL 3W1BA 3I4NG 3ULPA 1KHIA 1V43A 1VQ7A 4BXXG 3KF6A 2KCMA 4MZ9A 1PYSB 4PZ6A 1G51A 5C0XG 2H5XA 4A3DG 3IRBA 1XMQL 1SRUA 1NE3A 2MNAA 2ZTEA 2WP8J 1VQKA 1K3RA 1A0IA 1VQHA 4JI8Q 1HNWQ 4OXPA 3Q8DA 3TS0A 1EYGA 2E2HH 4JYAQ 2Y0SE 2F52A 1N36L 1L0WA 3EBEA 3PUXA 4LFCQ 3KJPA 4Y7NH 1YJNA 4DV6Q 4LF8Q 1QZGA 4A3CH 4YHHL 1H95A 1EIFA 1HR0Q 3OW2A 4GLAC 4BY1G 1M1KC 1PH1A 3D31A 4R4OA 4A3LG 3U4VA 4DR6L 1X6OA 4GOPC 1NTGA 4DAMA 4JBJA 1E24A 2JA9A 2JK8A 1FL0A 1LTLA 3LGJA 4GN5A 1N33Q 3S2DH 4DV4Q 2ZM6Q 4AYBG 3NBHB 3BJUA 4XTCS 3KLWA 2I0QA 1BBWA 2VZAA 2Q2UA 4GNXA 4A3JH 2EXDA 4QY7A 4DR4L 1D7QA 2K5HA 2VY3A 4JOIA 1PH3A 3I56A 4A3JG 1OXUA 3CCSA 4LF6L 5IWAL 3PUZA 1DGSA 4APVA 5FLXc 4LF4Q 2JA7H 1OXTA 4JI5L 1XPOA 1B70B 1K73C 3AYHB 4NB3A 4LF7L 1N8RC 2JA7G 2QGQA 3L7ZC 1CKNA 3HOXH 4DV5L 4JI0Q 2K14A 5LMUL 3A5ZB 1HZCA 1PFSA 1Z9FA 2OQKA 4RG1A 4MTNA 3OTOQ 2ATWA 1PV4A 1KRSA 2JJQA 1E3PA 2RF4A 4OWWB 2PNHA 1NMGA 1X3FA 2GN5A 4LWCA 3S15H 3CCEA 4IOAA 4A3IH 3PO3H 1FJGQ 2UU9Q 1EQQA 1WCMH 2D0OA 2YTVA 1A63A 2BH2A 2DUDA 2JQOA 4JI8L 1U0LA 4P72A 1Y1WH 3ERSX 3CCLA 4B3TQ 4DUZQ 1JJGA 4AIMA 2OTLA 1J6QA 4JI3Q 4JYAL 1G6PA 3PCOB 5FJ8H 1VQMA 2UXBQ 2ID0A 5HGQA 4PMWA 5IP9G 4LFCL 4DV2Q 3G71A 2UUAL 2UUBQ 1PVOA 5FJ8G 2RHSB 4DV6L 2CWPA 4AQYQ 2AWNA 4JOIC 4R4TA 1VQEA 3CAMA 1J5EL 1HR0L 1IYJB 1X56A 2Q2TA 4IFDI 1K9MC 3GO5A 4BY7H 4JC0A 1IBKQ 4A4IA 5IYBH 3U58A 3J81j 4BY7G 1OXVA 3T1YQ 1YIJA 1JT8A 3FKIH 5IYBG 2UUCQ 3I4MH 1N33L 4DV4L 2ZM6L 4BBSH 4X62Q 3K0XA 2Y0SG 3FKIG 3J7ZC 2QEXA 3RZOH 1UE6A 3GTGH 2KHJA 2PQAA 1IXRA 5JEAJ 3J81c 1QVCA 2NZHA 2IHFA 1L1OC 4IJLA 5HY6A 1PH6A 3AEVA 3KDFA 1HR0W 5C44H 2ALYB 1FVIA 4X6AH 3D0FA 3PO2G 1OXXK 2NVYH 5C44G 4GKJQ 1HZAA 4DV1L 2K4KA 3GTMH 1BKBA 2EQSA 3HOWH 4A3FH 1ASYA 3PIOA 1PHJA 3HOWG 4GOPB 5AJ3Q 1ASZA 4QGUA 4A3FG 1YJ9A 1Y1VH 3GTJH 4IPHA 4JI0L 4DR1Q 1C9OA 3L2PA 4HJAA 1PH5A 1EUJA 3OTOL 4JI6Q 4IFDG 4A3MG 2HIVA 1KXLA 1JJ2A 3U4ZA 1BVSA 2UUAQ 4P73A 4NXNQ 2NVTH 3TEHB 3K7UC 2VQFQ 4DV3L 4EQ5A 4JI4Q 3I4NH 5M3MG 4PG3A 3F2BA 4BXXH 2ES2A 2R7ZH 3S16H 3T1HQ 2D0PA 1SROA 3W1GA 1VQOA 4DR5Q 1N32Q 2ZTCA 1GD7A 4A3DH 2R7ZG 4LUOA 4QJFA 4YCWA 4GS3A 1BBUA 4B3TL 3S1MH 2VS1A 4C3JH 4JI3L 1IBLL 3S14H 4QQBX 4ME3A 1S40A 3CD6A 1CUKA 2UXBL 1PH9A 2K50A 3ZJYC 2VQEQ 1IL2A 3RNUA 4AQYL 1WYDA 2EIFA 5GQOA 2B63H 1YHAA 3RN2A 3HOUG 2AMCB 4H02A 3RZDH 4QL5A 5C0XJ 1NJIC 1RIPA 1K8AC 2GVAA 2JA5H 4JI7L 4DR7L 4NPSA 3JAMc 4DV0Q 3I2ZA 3DLLA 1VQFA 2JA5G 3PUYA 1K0RA 3HOVH 4A3BH 1I50H 1CKOA 1VQCA 4BY1H 3T1YL 3CC7A 4OX9Q 3HOVG 1SE8A 4A3BG 2I5HA 4IPGA 3M85A 2UUCL 4GKKQ 4A3LH 1HNZQ 2Q2HA 3JC66 4UPAA 1CSQA 4X62L 5M3FG 3TQYA 2F3IA 3CMAA 4Y52H 2CKZB 2F4VQ 1PYBA 4DPGA 3J80c 2XGTA 3J7A5 4YWMA 1VQIA 5BR8Q 4K0KQ 2AKWB 4WJ3M 3GD7A 4BA2I 2CWAA 2Q2IA 4L5TA 4HJ8A 1E1TA 2WFWA 2QA4A 4GKJL 1W3SA 1E1OA 2A8VA 4MNOA 3HOZG 4UP7A 3B6YA 3NEMA 5GAEC 5LMNL 1VQ8A 1VS0A 5AJ3L 1WI5A 1WFQA 3A5UA 1UE1A 1X9NA 1MIUA 1KRTA 2Z6KA 2WAQG 3NENA 4DR1L 3RN5A 1CKNB 1Q82C 5FLMG 4JI6L 4QIWE 4X65Q 3TREA 1HNXQ 2VNUD 4GLXA 3E9IA 2B29A 3PSIA 5C4JH 1N34Q 3K81C 3H0GG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJV A;  3CC4 A;  1WOC A;  2VQF L;  1KC8 C;  4JI4 L;  1U5K A;  4LFA L;  1L1O B;  3RLO A;  1Q86 C;  1I94 Q;  1V9P A;  1GVP A;  1WJJ A;  2B3G A;  2UXC Q;  2K5N A;  4DR5 L;  2OTJ A;  4YY3 Q;  5LMN W;  5IYD H;  4WJ4 A;  3EN2 A;  2IHE A;  2I5M X;  5IYD G;  1TWF H;  2C35 B;  1LYL A;  2PI2 E;  3EIV A;  3CF5 A;  4GN4 B;  2VQE L;  1QZH A;  1HNW L;  5JJK A;  2R92 H;  1IBM Q;  4IPC A;  3I4O A;  5IP9 H;  1L2F A;  3A0J A;  1YJW A;  4YWL A;  4JI2 Q;  5C3E G;  2R92 G;  4GNX C;  1KQS A;  1NBW A;  4DV0 L;  1PA6 A;  2NVX H;  2CFM A;  4LF8 L;  2PI2 A;  1Q7Y C;  4LF9 Q;  1A62 A;  4B3R Q;  4A3K H;  2CCZ A;  4OX9 L;  3GTQ H;  4DV7 Q;  1YBY A;  1HNZ L;  2IX0 A;  1VQJ A;  4A3K G;  2YV5 A;  2BA1 A;  4P74 A;  3RLF A;  1TWH H;  3GTK H;  3S17 H;  2K5V A;  5BR8 L;  1GM5 A;  2MO0 A;  3CXC A;  2R6G A;  1UWV A;  3M9B A;  4BBR G;  1YEZ A;  1R9T H;  2BH8 A;  3HKS A;  1XMQ Q;  3ULL A;  2WAQ E;  1KIX A;  5DLQ E;  3A74 A;  2KEN A;  4PZ7 A;  1XNR Q;  4A93 H;  4POF A;  3PO2 H;  4OO1 I;  2JA6 G;  1KL9 A;  1HZB A;  2FXQ A;  4A93 G;  5M5W H;  4HJ7 A;  3AQQ A;  4JCV E;  3CPF A;  3MXN B;  4UP8 A;  3RR5 A;  2YYZ A;  2VL6 A;  3GTO H;  4LF4 L;  5JJI A;  1PH4 A;  1AH9 A;  3RLN A;  3CCQ A;  1GO3 E;  1XPU A;  2IX1 A;  1P8L A;  5IY0 A;  4YHH Q;  1O7I A;  3CCR A;  1HNX L;  2ASB A;  2BA0 A;  5GAD C;  2ZJP A;  1QUQ B;  4DR3 Q;  1N34 L;  1XPR A;  2LXK A;  4A3M H;  2E8G A;  1EFW A;  4NXM Q;  1EWI A;  1IZ6 A;  1Q1B A;  5K36 G;  5GAG C;  2UXC L;  4YY3 L;  5M3M H;  3SGI A;  1T9H A;  1W2B A;  1VQL A;  2NZO A;  1G29 1;  4AH6 A;  3KF6 B;  2KCT A;  4TQU S;  4IJH A;  3J81 i;  1VQ5 A;  2UU9 L;  4B3M Q;  1K83 H;  2L15 A;  1FJG L;  4OWT B;  1SN8 A;  1CSP A;  4IFD J;  3W5O A;  5EAY A;  4O0A A;  1QVF A;  3G4S A;  4DUZ L;  4OO1 G;  4L5Q A;  4C3I H;  2RCN A;  1VQD A;  5IWA Q;  4X66 Q;  1YIT A;  4JI2 L;  1A8V A;  2IT1 A;  1VQ6 A;  5IP7 G;  4DKA C;  4DR2 Q;  4JI5 Q;  4DV2 L;  4JV5 Q;  5C4X H;  3HOU H;  1YVC A;  1EQR A;  3PUW A;  4LF9 L;  4PZ8 A;  4B3R L;  2ZJR A;  1HZ9 A;  1S72 A;  5C4X G;  4JG2 A;  3ULJ A;  5LMU Q;  4O2D A;  1IBK L;  4A76 A;  2HHH Q;  3ICE A;  2MFI A;  2WB1 E;  1P16 A;  3BZC A;  4KHZ A;  4JI1 Q;  3HFZ B;  1Q8K A;  1XNQ Q;  1YZ6 A;  5M3F H;  1E22 A;  4KLK A;  1UEB A;  5ELN A;  5ELO A;  4X64 Q;  2JA8 H;  1XMO Q;  3K7A H;  1NY4 A;  2MO1 A;  2NVQ H;  1Y14 B;  2KHI A;  1LM0 A;  3HKZ E;  1SFO H;  2JA8 G;  2DGY A;  1OXS C;  1HH2 P;  4HIM A;  4HJ9 A;  3F2C A;  3PF5 A;  1MJE A;  1XNR L;  2R7F A;  1UE5 A;  3ER0 A;  1X65 A;  4J15 A;  3CME A;  3HOY H;  2LXJ A;  3G48 A;  4R4C A;  1EOV A;  1I5F A;  3HOZ H;  2E2I H;  4GNX B;  3HOY G;  3M4O H;  1N9W A;  1UE7 A;  2D62 A;  3CCU A;  3GTL H;  3OYY A;  1I6H H;  1SLJ A;  4R4I A;  3U50 C;  2ZTD A;  2E5L Q;  3F1Z A;  1VQP A;  4DK3 C;  2OCE A;  5J3B A;  1J5E Q;  1VCI A;  2R7D A;  4DR3 L;  2NN6 G;  1NMF A;  1VQB A;  3F8T A;  3UDF A;  5FLM H;  3H15 A;  2OWO A;  3GDE A;  4A3C G;  1HJP A;  1V1Q A;  3JAM i;  2B63 G;  4BBS G;  1LUZ A;  3CW2 C;  3FHW A;  3UDI A;  1KD1 C;  4UP9 A;  1VQN A;  4NXM L;  4LW1 A;  3H0G H;  4JBW A;  1OTC A;  2A19 A;  1FGU A;  4DNI A;  3K8A A;  1S3O A;  1AE3 A;  3UDG A;  5M5X H;  4NXN L;  2RHQ B;  3CCM A;  1QVG A;  2K52 A;  2VUM H;  3M4Q A;  3J80 i;  3T1H L;  4B3M L;  4LFB Q;  2YTY A;  2OQ0 A;  1VQ4 A;  2VUM G;  1N32 L;  4BA1 I;  1B7Y B;  2R93 H;  1X55 A;  3UE1 A;  4KHP Q;  2IY5 B;  4B3S Q;  4XIG S;  4YWK A;  4A75 A;  2R93 G;  1E7Z A;  3STB D;  2Z0S A;  1D8L A;  4X66 L;  3KOJ A;  4DV1 Q;  1JB7 A;  1SMX A;  4DR2 L;  4JV5 L;  1TWA H;  1EIY B;  5GAH C;  2E2J H;  3MEF A;  3H3V I;  5C3E H;  1Z47 A;  2JEB I;  4GLV B;  3M7N A;  1X54 A;  4LNQ A;  1VQG A;  3HOX G;  1B8A A;  4OWX B;  5M5Y H;  2UXD Q;  1Q12 A;  1JE5 A;  4IPD A;  4JI1 L;  1YHQ A;  2LSS A;  2HHH L;  1X3E A;  4C2M H;  1Q81 C;  1XNQ L;  1PH2 A;  1L1O A;  1M90 C;  4GKK L;  4X64 L;  3M4P A;  2KBN A;  1PH7 A;  4LF5 Q;  3KYH C;  4LUZ A;  1JJC B;  1XMO L;  2Z6K C;  4DV3 Q;  4L5R C;  1AE2 A;  2JEA I;  1CKM A;  1C0A A;  4TVA B;  4HIO A;  4DUY Q;  2PMZ E;  3KFU A;  1Q46 A;  5IE8 A;  3S1R H;  4BBR H;  1X3G A;  3S2H H;  4K0K L;  4A3I G;  3UDX A;  3PO3 G;  1RL2 A;  2AWO A;  2PQA B;  1WCM G;  2N8N A;  5JJL A;  5IYC H;  4YCU A;  3PIP A;  1IBL Q;  4HJ5 A;  4IOC A;  1Y1W G;  3KDF B;  2AHO B;  2JA6 H;  1VQA A;  5IYC G;  4YCV A;  2WB1 G;  3S1Q H;  3I7F A;  3S24 A;  1I3Q H;  1Q1E A;  4FDB A;  3STB C;  3BZK A;  3CQZ H;  3PUV A;  3CCV A;  3K80 C;  2E5L L;  3H3V H;  4AYB E;  1MKH A;  4DAY B;  2UUB L;  2F4V L;  2HQL A;  3NEL A;  4JI7 Q;  1N36 Q;  3CPW A;  2HIX A;  4DR7 Q;  4P71 A;  3HKZ G;  1YNX A;  4IO9 A;  5JEA G;  4DK6 C;  4KI0 A;  1TWC H;  1XTD A;  5GRO A;  2GVB A;  2YTX A;  4X65 L;  4UY8 C;  1K8G A;  1TXY A;  2HT1 A;  1GKH A;  3S1N H;  3UE0 A;  5E7N A;  3E0E A;  4HIK A;  3I4M G;  4DR6 Q;  4OON A;  4R1J A;  1I94 L;  5H1S E;  2V1C C;  3DM3 A;  3CP0 A;  3FP9 A;  3CCJ A;  1VQ9 A;  2YU9 H;  2N3S A;  2K75 A;  3BU2 A;  2N49 A;  1PH8 A;  4JBK A;  2VW9 A;  3M3Y H;  3WWV A;  4LFB L;  5C0X I;  4A3E H;  4R4Q A;  3VDY A;  3TRZ A;  4KHP L;  4B3S L;  2CQO A;  4POG A;  4A3E G;  1YI2 A;  3GTP H;  2XTI A;  3E9H A;  4P75 A;  1MJC A;  3PGZ A;  3L0O A;  3CC2 A;  3AFQ A;  4DR4 Q;  4JBM A;  4LUV A;  4RMF A;  3I55 A;  5LMN Q;  3TS2 A;  4HID A;  1IBM L;  2I5L X;  3PF4 A;  5IP7 H;  1C7Y A;  4L5S A;  4LF6 Q;  1KAW A;  1JMC A;  2UXD L;  1QUQ A;  4GOP A;  2N78 A;  1SR3 A;  1Y1V G;  1TWG H;  4LF7 Q;  4A3G H;  2ZJQ A;  2NN6 I;  2JE6 I;  3KF8 B;  4DV5 Q;  3G6E A;  4C3H H;  4DV7 L;  4A3G G;  2A1A A;  3F2D A;  4LF5 L;  2MQH A;  3AFP A;  4LFA Q;  3PV0 A;  1YHB A;  4GN3 B;  4ALP A;  4EX5 A;  5IT9 c;  3KJO A;  4DUY L;  3W1B A;  3I4N G;  3ULP A;  1KHI A;  1V43 A;  1VQ7 A;  4BXX G;  3KF6 A;  2KCM A;  4MZ9 A;  1PYS B;  4PZ6 A;  1G51 A;  5C0X G;  2H5X A;  4A3D G;  3IRB A;  1XMQ L;  1SRU A;  1NE3 A;  2MNA A;  2ZTE A;  2WP8 J;  1VQK A;  1K3R A;  1A0I A;  1VQH A;  4JI8 Q;  1HNW Q;  4OXP A;  3Q8D A;  3TS0 A;  1EYG A;  2E2H H;  4JYA Q;  2Y0S E;  2F52 A;  1N36 L;  1L0W A;  3EBE A;  3PUX A;  4LFC Q;  3KJP A;  4Y7N H;  1YJN A;  4DV6 Q;  4LF8 Q;  1QZG A;  4A3C H;  4YHH L;  1H95 A;  1EIF A;  1HR0 Q;  3OW2 A;  4GLA C;  4BY1 G;  1M1K C;  1PH1 A;  3D31 A;  4R4O A;  4A3L G;  3U4V A;  4DR6 L;  1X6O A;  4GOP C;  1NTG A;  4DAM A;  4JBJ A;  1E24 A;  2JA9 A;  2JK8 A;  1FL0 A;  1LTL A;  3LGJ A;  4GN5 A;  1N33 Q;  3S2D H;  4DV4 Q;  2ZM6 Q;  4AYB G;  3NBH B;  3BJU A;  4XTC S;  3KLW A;  2I0Q A;  1BBW A;  2VZA A;  2Q2U A;  4GNX A;  4A3J H;  2EXD A;  4QY7 A;  4DR4 L;  1D7Q A;  2K5H A;  2VY3 A;  4JOI A;  1PH3 A;  3I56 A;  4A3J G;  1OXU A;  3CCS A;  4LF6 L;  5IWA L;  3PUZ A;  1DGS A;  4APV A;  5FLX c;  4LF4 Q;  2JA7 H;  1OXT A;  4JI5 L;  1XPO A;  1B70 B;  1K73 C;  3AYH B;  4NB3 A;  4LF7 L;  1N8R C;  2JA7 G;  2QGQ A;  3L7Z C;  1CKN A;  3HOX H;  4DV5 L;  4JI0 Q;  2K14 A;  5LMU L;  3A5Z B;  1HZC A;  1PFS A;  1Z9F A;  2OQK A;  4RG1 A;  4MTN A;  3OTO Q;  2ATW A;  1PV4 A;  1KRS A;  2JJQ A;  1E3P A;  2RF4 A;  4OWW B;  2PNH A;  1NMG A;  1X3F A;  2GN5 A;  4LWC A;  3S15 H;  3CCE A;  4IOA A;  4A3I H;  3PO3 H;  1FJG Q;  2UU9 Q;  1EQQ A;  1WCM H;  2D0O A;  2YTV A;  1A63 A;  2BH2 A;  2DUD A;  2JQO A;  4JI8 L;  1U0L A;  4P72 A;  1Y1W H;  3ERS X;  3CCL A;  4B3T Q;  4DUZ Q;  1JJG A;  4AIM A;  2OTL A;  1J6Q A;  4JI3 Q;  4JYA L;  1G6P A;  3PCO B;  5FJ8 H;  1VQM A;  2UXB Q;  2ID0 A;  5HGQ A;  4PMW A;  5IP9 G;  4LFC L;  4DV2 Q;  3G71 A;  2UUA L;  2UUB Q;  1PVO A;  5FJ8 G;  2RHS B;  4DV6 L;  2CWP A;  4AQY Q;  2AWN A;  4JOI C;  4R4T A;  1VQE A;  3CAM A;  1J5E L;  1HR0 L;  1IYJ B;  1X56 A;  2Q2T A;  4IFD I;  1K9M C;  3GO5 A;  4BY7 H;  4JC0 A;  1IBK Q;  4A4I A;  5IYB H;  3U58 A;  3J81 j;  4BY7 G;  1OXV A;  3T1Y Q;  1YIJ A;  1JT8 A;  3FKI H;  5IYB G;  2UUC Q;  3I4M H;  1N33 L;  4DV4 L;  2ZM6 L;  4BBS H;  4X62 Q;  3K0X A;  2Y0S G;  3FKI G;  3J7Z C;  2QEX A;  3RZO H;  1UE6 A;  3GTG H;  2KHJ A;  2PQA A;  1IXR A;  5JEA J;  3J81 c;  1QVC A;  2NZH A;  2IHF A;  1L1O C;  4IJL A;  5HY6 A;  1PH6 A;  3AEV A;  3KDF A;  1HR0 W;  5C44 H;  2ALY B;  1FVI A;  4X6A H;  3D0F A;  3PO2 G;  1OXX K;  2NVY H;  5C44 G;  4GKJ Q;  1HZA A;  4DV1 L;  2K4K A;  3GTM H;  1BKB A;  2EQS A;  3HOW H;  4A3F H;  1ASY A;  3PIO A;  1PHJ A;  3HOW G;  4GOP B;  5AJ3 Q;  1ASZ A;  4QGU A;  4A3F G;  1YJ9 A;  1Y1V H;  3GTJ H;  4IPH A;  4JI0 L;  4DR1 Q;  1C9O A;  3L2P A;  4HJA A;  1PH5 A;  1EUJ A;  3OTO L;  4JI6 Q;  4IFD G;  4A3M G;  2HIV A;  1KXL A;  1JJ2 A;  3U4Z A;  1BVS A;  2UUA Q;  4P73 A;  4NXN Q;  2NVT H;  3TEH B;  3K7U C;  2VQF Q;  4DV3 L;  4EQ5 A;  4JI4 Q;  3I4N H;  5M3M G;  4PG3 A;  3F2B A;  4BXX H;  2ES2 A;  2R7Z H;  3S16 H;  3T1H Q;  2D0P A;  1SRO A;  3W1G A;  1VQO A;  4DR5 Q;  1N32 Q;  2ZTC A;  1GD7 A;  4A3D H;  2R7Z G;  4LUO A;  4QJF A;  4YCW A;  4GS3 A;  1BBU A;  4B3T L;  3S1M H;  2VS1 A;  4C3J H;  4JI3 L;  1IBL L;  3S14 H;  4QQB X;  4ME3 A;  1S40 A;  3CD6 A;  1CUK A;  2UXB L;  1PH9 A;  2K50 A;  3ZJY C;  2VQE Q;  1IL2 A;  3RNU A;  4AQY L;  1WYD A;  2EIF A;  5GQO A;  2B63 H;  1YHA A;  3RN2 A;  3HOU G;  2AMC B;  4H02 A;  3RZD H;  4QL5 A;  5C0X J;  1NJI C;  1RIP A;  1K8A C;  2GVA A;  2JA5 H;  4JI7 L;  4DR7 L;  4NPS A;  3JAM c;  4DV0 Q;  3I2Z A;  3DLL A;  1VQF A;  2JA5 G;  3PUY A;  1K0R A;  3HOV H;  4A3B H;  1I50 H;  1CKO A;  1VQC A;  4BY1 H;  3T1Y L;  3CC7 A;  4OX9 Q;  3HOV G;  1SE8 A;  4A3B G;  2I5H A;  4IPG A;  3M85 A;  2UUC L;  4GKK Q;  4A3L H;  1HNZ Q;  2Q2H A;  3JC6 6;  4UPA A;  1CSQ A;  4X62 L;  5M3F G;  3TQY A;  2F3I A;  3CMA A;  4Y52 H;  2CKZ B;  2F4V Q;  1PYB A;  4DPG A;  3J80 c;  2XGT A;  3J7A 5;  4YWM A;  1VQI A;  5BR8 Q;  4K0K Q;  2AKW B;  4WJ3 M;  3GD7 A;  4BA2 I;  2CWA A;  2Q2I A;  4L5T A;  4HJ8 A;  1E1T A;  2WFW A;  2QA4 A;  4GKJ L;  1W3S A;  1E1O A;  2A8V A;  4MNO A;  3HOZ G;  4UP7 A;  3B6Y A;  3NEM A;  5GAE C;  5LMN L;  1VQ8 A;  1VS0 A;  5AJ3 L;  1WI5 A;  1WFQ A;  3A5U A;  1UE1 A;  1X9N A;  1MIU A;  1KRT A;  2Z6K A;  2WAQ G;  3NEN A;  4DR1 L;  3RN5 A;  1CKN B;  1Q82 C;  5FLM G;  4JI6 L;  4QIW E;  4X65 Q;  3TRE A;  1HNX Q;  2VNU D;  4GLX A;  3E9I A;  2B29 A;  3PSI A;  5C4J H;  1N34 Q;  3K81 C;  3H0G G; 
#chains in the Genus database with same CATH topology
 1XJV A;  5DEH A;  5IT9 E;  4JI4 L;  1EY7 A;  1FNW A;  2EYM A;  2B3G A;  2Z9H A;  3I3C A;  4DR5 L;  2OTJ A;  4YY3 Q;  4XT3 B;  1WTW A;  3EN2 A;  1QG7 A;  3EJI A;  1LTR D;  3EQL C;  4IZ8 A;  2C35 B;  1LYL A;  3BDO A;  3U9O A;  1I4X A;  4ZQ3 A;  2Q8T A;  4QF4 A;  1HNW L;  1QNU A;  2R92 H;  5JJK A;  4IPC A;  1D1K A;  1STE A;  4JK1 C;  1ZYR D;  4YWL A;  4JI2 Q;  5J22 A;  3R2T A;  1PTO H;  4A3K H;  4DV7 Q;  1YBY A;  1VQJ A;  1Y8O B;  4ZKB B;  3QR8 A;  1WTX A;  2B2W C;  2K5V A;  3M7G A;  4G4K A;  1QWY A;  1UWV A;  3S9W A;  4S3S A;  4IUU A;  3ULL A;  2WAQ E;  2VUM B;  5DLQ E;  1JC7 A;  4K8J A;  4POF A;  1HZB A;  2FXQ A;  2R93 B;  1R4Q B;  4HJ7 A;  3AQQ A;  4UP8 A;  3RR5 A;  1LTG D;  2VL6 A;  3A56 A;  4LF4 L;  1PH4 A;  4FF4 A;  3CCQ A;  1EYD A;  3H91 A;  5IY0 A;  5ELD A;  1O7I A;  2ASB A;  3URY A;  1XPR A;  3CKI B;  1T5E A;  3KLS X;  2RA4 A;  4A3M H;  3CRK C;  2EYF A;  1BBX C;  2HDM A;  3K0Y A;  5ISR A;  2C9O A;  4X3K A;  4YY3 L;  1T9H A;  3TP8 A;  1I4H A;  1VQL A;  4AH6 A;  5BN3 A;  3KF6 B;  1VQ5 A;  3PO3 B;  4OWT B;  1CSP A;  4OO1 H;  4CDD C;  4O0A A;  2DY7 A;  2EYO A;  1YIT A;  4JI2 L;  4FP5 D;  1A8V A;  4L8J A;  3G7L A;  4DR2 Q;  4JV5 Q;  4DV2 L;  3HOU H;  4F88 A;  2F0U A;  2K28 A;  3PUW A;  5E4W C;  1CFM A;  1S72 A;  4K5V A;  2LS0 1;  4FF3 A;  1HHV A;  4O2D A;  3KF8 A;  2F0V A;  4EQP A;  3DEO A;  3ICE A;  3NQI A;  4KY5 A;  1Q8K A;  1XNQ Q;  5C3W A;  4X64 Q;  4KLK A;  1UEB A;  2XSC A;  3I4M B;  5J1Z A;  1EYC A;  1NY4 A;  2K32 A;  3WOE A;  2A68 C;  1HCZ A;  4J1M A;  1LV9 A;  1SFO H;  2DGY A;  4HJ9 A;  4HIM A;  1MJE A;  2R7F A;  5KYI A;  3ER0 A;  1U4P A;  3L3O C;  4J15 A;  3G48 A;  3I73 A;  1B44 D;  1EOV A;  1I5F A;  3HOZ H;  1DZ1 A;  3C1E A;  2D62 A;  2NVY B;  2G5D A;  1I6H H;  1D5X C;  1SLJ A;  3U50 C;  2F1M A;  1HQM C;  3I72 A;  1RD9 D;  1VQP A;  4DK3 C;  5J3B A;  1BOS A;  3H15 A;  4EQO A;  1VMC A;  1HJP A;  1V1Q A;  3JAM i;  3CW2 C;  1B4O A;  2CW0 D;  3H0G H;  2L12 A;  1FGU A;  5E4X A;  2NVT B;  5CBA E;  2KA7 A;  1QVG A;  1MHW C;  3HS0 C;  2VUM H;  3M4Q A;  3X3M A;  4B08 A;  1F2L A;  1EY0 A;  2OQ0 A;  1VQ4 A;  3NBH A;  2EYL A;  1B7Y B;  2R93 H;  4B3S Q;  4XIG S;  1SNC A;  4FXD A;  5IGG A;  3S1M B;  3HEJ A;  3S14 B;  1D8L A;  1UEA B;  3PIP 3;  3ND8 A;  4DR2 L;  4JV5 L;  5IIF A;  1TWA H;  1EIY B;  5IGB A;  2E2J H;  4GLV B;  4ZCK A;  5F2D A;  1VQG A;  1SDF A;  3V05 A;  3VR6 A;  3HOX G;  2UXD Q;  1B9M A;  4LAA A;  1X3E A;  1XNQ L;  1L1O A;  4X64 L;  2QF7 A;  1JB3 A;  3KYH C;  4DV3 Q;  4DNR B;  1AE2 A;  4N9P A;  1CKM A;  3J80 E;  1C0A A;  2F0F A;  2HCC A;  4TVA B;  3KFU A;  1Q46 A;  4LK1 C;  4A3I G;  2PNR C;  4WOR A;  2N8N A;  4IUV A;  4HJ5 A;  4IOC A;  1VQA A;  5IYC G;  4YCV A;  2WB1 G;  3S1Q H;  3STB C;  3KLR A;  3KBG A;  4DAY B;  3VYT A;  3NEL A;  4DNT B;  4DA2 A;  1N36 Q;  4P71 A;  1PZJ D;  4DK6 C;  4KI0 A;  1K8G A;  2FMM A;  4G7H C;  3UE0 A;  1ICW A;  3E0E A;  5EKK A;  4H0L C;  2F0N A;  4R1J A;  5H1S E;  2N3S A;  2DNC A;  2N49 A;  3BU2 A;  2HD3 A;  1STY A;  1ESF A;  1BNZ A;  1UNS A;  2AQ1 B;  4R4Q A;  3K57 A;  4B3S L;  4A3E G;  2XTI A;  4P75 A;  3PGZ A;  3L0O A;  3CC2 A;  3AFQ A;  5EPK A;  2Z8L A;  4DR4 Q;  3TP6 A;  1TKW B;  4JBM A;  1IBM L;  1YNN D;  2EJG C;  4LF6 Q;  2O5J C;  5K5P A;  2UXD L;  4LF7 Q;  1TWG H;  2HDL A;  2NVX B;  5I4D A;  2F0P A;  1SYD A;  2JE6 I;  2A1A A;  5E1F A;  2KEE A;  1EL0 A;  3A54 A;  1EZ8 A;  1JOQ A;  3MC0 B;  5COY A;  1YHB A;  4ALP A;  4EX5 A;  3HRZ C;  3KJO A;  1J9O A;  4J6H A;  4MZ9 A;  2B2T A;  4ZUJ A;  2H5X A;  3NQT A;  2B39 A;  1SRU A;  2ZTE A;  5IGF A;  2AQ3 B;  2K5D A;  2QIL A;  1VQH A;  3BVM A;  3Q8D A;  4JYA Q;  3A7A B;  2Y0S E;  5DM7 3;  3GTO B;  2F3V A;  2FHT A;  1N36 L;  3KJP A;  1YJN A;  4RH6 A;  4YHH L;  2EYH A;  1EIF A;  4G7O C;  2H1E A;  3OW2 A;  1TVX A;  4BY1 G;  1ILQ A;  4L6T B;  4R9W A;  3E0J A;  1X6O A;  4DAM A;  4HMI A;  4JBJ A;  2IX3 A;  2JA9 A;  2QCP X;  4RGO S;  4DV4 Q;  4AYB G;  5LHY 1;  1YNJ C;  1EFI D;  4DXF A;  3X3N A;  4QIW B;  2F0K A;  2MJ8 A;  4XTC S;  3KLW A;  1TS2 A;  1BBW A;  2VZA A;  4CDC C;  2Q2U A;  3BG3 A;  3L9A X;  1RCV D;  4K5X A;  4RGM A;  4A3J H;  4DR4 L;  2RVL A;  1PH3 A;  3I56 A;  1NNX A;  3CCS A;  4LF6 L;  3TZU A;  1AFP A;  5FLX c;  1CT1 D;  1OXT A;  4JI5 L;  2ZT9 C;  2GA4 B;  4LF7 L;  3FDT A;  1K8O A;  1K8M A;  3HOX H;  2PW7 A;  1S5F D;  4NP5 A;  3A5Z B;  1HZC A;  2ATW A;  4RG1 A;  2MP1 A;  4K2L A;  2JJQ A;  2JA8 B;  3SK6 A;  1SNP A;  3S15 H;  4KHV A;  2RKS A;  4A3I H;  1F9Q A;  1CA5 A;  1FJG Q;  1NCV A;  1E0B A;  1NR2 A;  1U0L A;  3HOY B;  3ERS X;  4QB4 A;  2SEB D;  1G6P A;  3KBX A;  1J6Q A;  2EDG A;  4JYA L;  4TSS A;  4DGZ A;  2ID0 A;  4PMW A;  3I8Z A;  5IP9 G;  2F0T A;  2UUA L;  3HGB A;  2LFN A;  3D6C A;  4HED A;  2AWN A;  4KN7 C;  1VQE A;  3CAM A;  2WAQ B;  4XQN A;  4K8I A;  1X56 A;  4O42 A;  4BBS B;  1KNE A;  1JT8 A;  3T1Y Q;  2UUC Q;  1B3Q A;  4DV4 L;  3OHX C;  4X62 Q;  3FKI G;  1HXY D;  1F2Y A;  5DM6 3;  3NPP A;  1L1O C;  3ERQ A;  2V4D A;  1S5E D;  1X3P A;  5C44 H;  1LT4 D;  1TS4 A;  2EXZ A;  3D0F A;  1OXX K;  1JIC A;  3FPU B;  5CV7 A;  4GKJ Q;  1WTO A;  3GTM H;  1ZEQ X;  3HOW H;  5CV9 A;  1LO5 D;  2QW7 A;  3HG9 A;  4RCO A;  5IGD A;  3LX0 A;  3PIO A;  3K59 A;  2A6E D;  1ASZ A;  2MGS A;  4IUT A;  3E6Z X;  2ENB A;  4IPH A;  4DR1 Q;  4RAU C;  3U9S A;  4JI6 Q;  3LNN A;  1JJ2 A;  2PZW A;  3MWY W;  2NZ1 D;  3N52 A;  4ILW A;  4WFN 3;  3GTQ B;  4NXN Q;  2K7V A;  1F2M A;  3SE0 A;  1EZ6 A;  2VQF Q;  4K6D A;  5M3M G;  2F0H A;  3P20 A;  2ES2 A;  3T1H Q;  3GTK B;  1SRO A;  3AU7 A;  1VQO A;  1N32 Q;  3S1R B;  2ZTC A;  4DF7 A;  1GD7 A;  1BBU A;  5C3X A;  1S40 A;  2K01 A;  2JA6 B;  4C3I G;  1JE4 A;  1S5D D;  2VQE Q;  3OMC A;  1I3Q B;  3NTI A;  1YHA A;  2KVM A;  1NJI C;  2JA5 H;  4L63 B;  4DR7 L;  2VB3 X;  1PRT F;  4OHJ A;  4PV1 C;  3HOV H;  3DLL A;  4HCE A;  1TWC B;  4BY1 H;  3T1Y L;  4IPG A;  3M85 A;  2UUC L;  1CA6 A;  2L11 A;  2Q2H A;  4X62 L;  2F3I A;  3CMA A;  2CKZ B;  5CV8 A;  1PYB A;  3RMH A;  3TDQ A;  2YU9 B;  1VQI A;  4K0K Q;  3M3Y B;  4WJ3 M;  2RDF A;  4YIJ A;  4HJ8 A;  2QA4 A;  4GKJ L;  1W3S A;  2I07 B;  3F2U A;  2DJF C;  1BXT A;  2B2T C;  5EPJ A;  3FEW X;  1WFQ A;  1X9N A;  1TT2 A;  1CK1 A;  2Z6K A;  4DR1 L;  1CKN B;  3LWE A;  4JI6 L;  1EEI D;  3SHL A;  3TRE A;  1HA6 A;  1V1O A;  1N34 Q;  3V96 A;  5GAD C;  1F9R A;  2VQF L;  1KC8 C;  1U5K A;  1L1O B;  5IYD H;  5LMN W;  1JOO A;  3T4A C;  1BO0 A;  2IHE A;  2I5M X;  3NHH A;  1DOK A;  4GN4 B;  2VQE L;  4MTK A;  4OIJ A;  5IP9 H;  4IUQ A;  2BDN A;  1YJW A;  2R92 G;  5C3E G;  3I70 A;  5C4H A;  4LF8 L;  4Y7N B;  4LF9 Q;  1A62 A;  5D3I B;  2CCZ A;  3GTQ H;  1B1Z A;  1IYU A;  1PXU A;  4FO2 A;  3J7A V;  4A3K G;  2BA1 A;  4P74 A;  3D4R A;  3RLF A;  3GTK H;  2A69 D;  2E76 C;  1GM5 A;  3T51 B;  1L0X B;  1QB5 D;  1YEZ A;  1R9T H;  1JWU D;  2BH8 A;  4KY6 A;  1XMQ Q;  2RDG A;  1Z7T A;  1ENF A;  4PZ7 A;  1XNR Q;  2XVS A;  1LT5 D;  4WJW A;  4QMG A;  5M5W H;  1SMY D;  1PLF A;  3ITP A;  1CZG A;  3RLN A;  4V19 0;  2JA7 B;  4DAY A;  1GO3 E;  1XPU A;  1EOT A;  1QOH A;  3CCR A;  1ZYR C;  5EKL A;  2ZJP A;  4DR3 Q;  1N34 L;  1TS3 A;  2E8G A;  2VB2 X;  2QEJ C;  3P1H A;  3FMC A;  3M4Y A;  5M5Y B;  1STB A;  4XYQ A;  4U68 A;  2EZV A;  1IZ6 A;  4NXM Q;  5GAG C;  4B9W A;  2NB0 A;  1RHP A;  5M3M H;  2FJ2 A;  4B3M Q;  4IFD J;  1K83 H;  2L15 A;  4IN3 A;  1WCM B;  1GUN A;  4I7Z C;  1Y1W B;  4OO1 G;  4IAL A;  2EPB A;  4C3I H;  1SEB D;  2RCN A;  1VQD A;  5IWA Q;  2IT1 A;  4CBV A;  1B53 A;  1YVC A;  2XIW A;  4LF9 L;  1D5M C;  3VR3 A;  1PTO F;  3ULJ A;  5LMU Q;  4KJO A;  4ZAI A;  4C3H G;  1GHK A;  4BY7 B;  2WB1 E;  1P16 A;  1PTO D;  3BZC A;  4KHZ A;  2KUM A;  2O5I C;  1SYB A;  3R2I A;  3K7A H;  2MO1 A;  4U67 3;  2KHI A;  1OXS C;  1HH2 P;  4DXG A;  3F2C A;  3PF5 A;  1XNR L;  1IW7 D;  4BS9 A;  1LT6 D;  1UE5 A;  4M1U B;  4EVO A;  4PMC A;  1MGS A;  5EBC A;  5JVG 3;  1XXG A;  2KOL A;  3KUP A;  2PZT A;  3WDN A;  4ZLT F;  5I6Y A;  4X3U A;  5KIX A;  1Z6H A;  3HZX A;  2E5L Q;  4FYD A;  4A3F B;  1KDB A;  1TU2 B;  2OCE A;  1J5E Q;  2UUB Q;  4DR3 L;  2D5D A;  1LTT D;  5DAU A;  3GDE A;  1TII D;  1Y1V B;  3BVG A;  3FHW A;  4NXM L;  4LW1 A;  4JBW A;  3K6O A;  1OTC A;  4FVM A;  4DNI A;  1AE3 A;  5M5X H;  1EY4 A;  4RCN A;  4ZK9 B;  2K52 A;  4CJ0 B;  1BCP F;  4B3M L;  4LFB Q;  2YTY A;  3OIQ A;  2VUM G;  1HUN A;  2JSO A;  1BCP D;  1QE6 A;  4IUN A;  4YWK A;  2R93 G;  5ELE A;  3IKJ A;  3KOJ A;  1JB7 A;  2KJX A;  4JVZ A;  4NW2 A;  3BS1 A;  2KHS A;  3J81 L;  5C3E H;  2WAC A;  1M8A A;  1X54 A;  3VYU A;  3RZD B;  4LNQ A;  1B8A A;  5M5Y H;  1Q12 A;  2Z4H A;  1JE5 A;  2LSS A;  2EJF C;  1M90 C;  4LF5 Q;  3T16 A;  2Z6K C;  1DXM A;  2CW0 C;  3Q22 A;  4FNF A;  3SK4 A;  4HIO A;  2PMZ E;  3S2H H;  5IE8 A;  4V0B A;  2PW5 A;  3PO3 G;  3LWU A;  3UDX A;  2F4I A;  1IBL Q;  2PZU A;  4DFA A;  1O7Y A;  1CQF A;  2ZXP A;  2E5L L;  3PUV A;  1MSH A;  2EJM A;  2AUK A;  4AYB E;  2UUB L;  1FNU A;  2BCO A;  1FR3 A;  5JEA G;  1XTD A;  4X65 L;  4IUR A;  4UY8 C;  1QCB D;  1I4Q A;  5CV6 A;  1Q90 A;  5C4J B;  3I4M G;  4DR6 Q;  4WRD A;  4CKE A;  2V1C C;  3DM3 A;  2K75 A;  4LFB L;  1PH8 A;  3WWV A;  3VDY A;  5TSS A;  2CQO A;  5EJW A;  1YI2 A;  3DWQ A;  2F0S A;  1EQT A;  4X3T A;  3RUZ A;  4LUV A;  4C1N I;  3I55 A;  3J80 L;  3SEB A;  4K6L A;  1JMC A;  4CKB A;  3N6R A;  1RJT A;  1DM0 B;  4A3G H;  2ZJQ A;  1C4Q A;  2NN6 I;  1GJX A;  1G2S A;  1U4L A;  4C3H H;  4DV7 L;  2EYP A;  1VDZ A;  4LF5 L;  3AFP A;  2XN9 C;  4LFA Q;  1STA A;  4GN3 B;  4FXG C;  3NWS A;  1TWH B;  5IT9 c;  3W1B A;  3ULP A;  4BXX G;  3I4L A;  3S17 B;  1ZKO A;  1G51 A;  5C0X G;  3J81 E;  4FF2 A;  4XQQ A;  3GTG B;  2ZXO A;  5D65 A;  3W2D A;  1D5Z C;  2CHB D;  1A0I A;  4KKS A;  3C46 A;  3PO2 B;  3MTS A;  4OXP A;  2OEO A;  1EYG A;  1K28 A;  3T53 B;  2FIN B;  1HA5 A;  3EBE A;  5AFW A;  1STN A;  2K5Q A;  4DV6 Q;  1HR0 Q;  1AW7 A;  3VA7 A;  3U4V A;  4DR6 L;  4GOP C;  1NTG A;  1EU3 A;  1F2Z A;  1LAC A;  1HFN A;  4KD3 A;  3ZYY X;  5A35 A;  1N33 Q;  5EQ0 A;  4C56 C;  1A3T A;  1PFB A;  2B8F A;  3J7A F;  1F9P A;  3BJU A;  2R7Z B;  4KKU A;  2EXD A;  1B3A A;  1MBY A;  4A3J G;  1OXU A;  5KYL A;  4H7B A;  3PUZ A;  2R61 A;  2ZXR A;  1B70 B;  2K6A A;  2NYZ D;  3AYH B;  1CKN A;  2O2L D;  3TSS A;  4MN3 A;  1M4V A;  4A3B B;  1KRS A;  1C8C A;  3BZD B;  5M3F B;  5CV5 A;  4XDX A;  1G6Z A;  2GN5 A;  4EQN A;  3CCE A;  3PO3 H;  2UU9 Q;  3MHB A;  1GUW A;  2D0O A;  2YTV A;  4QUC A;  2BH2 A;  2DUD A;  2JQO A;  5IGE A;  4DUZ Q;  4JPB W;  2E2I B;  5FJ8 H;  3M4O B;  3GP7 A;  1VQM A;  1D2B A;  1NUC A;  1JR0 D;  1SE3 A;  2RBM A;  3G71 A;  3GTL B;  1PVO A;  4DV6 L;  1SAP A;  1WTQ A;  1IYV A;  3Q0A A;  1HR0 L;  2F0J A;  5JEA H;  1ONL A;  3I90 A;  4IFD I;  1K9M C;  1IBK Q;  4A4I A;  2Z4I A;  1O80 A;  1H9J A;  2DNE A;  3J81 j;  5I6W A;  1YIJ A;  3I4M H;  2EY1 A;  5CGK A;  1N33 L;  1EY6 A;  3GTG H;  2PPB C;  4OEM B;  3J81 c;  2QDL A;  3AEV A;  5EBD A;  3KDF A;  3MFG A;  1LAB A;  3BYT B;  4G7Z C;  2ALY B;  2D9U A;  1SNM A;  2NVY H;  5C44 G;  3ERO A;  1BKB A;  4G57 A;  2RSO A;  1WTP A;  1SYF A;  2XRQ D;  1ASY A;  3HOW G;  4KY7 A;  4GOP B;  3MAQ A;  1YJ9 A;  1C48 A;  1C9O A;  3T13 A;  4HJA A;  1EUJ A;  2KQ3 A;  1KXL A;  4C2M B;  1KDA A;  2X6L A;  2NVT H;  4P73 A;  3TEH B;  3K7U C;  4KTA A;  4DV3 L;  4BXX H;  5DNF A;  2R7Z H;  1KNA A;  4ULL A;  5D3D A;  5C0X H;  4BBR B;  4LUO A;  3S1M H;  3OIP A;  1RDP D;  3S14 H;  2WB1 B;  5KEE A;  2M00 A;  1PH9 A;  5A2Q L;  2K50 A;  4A93 B;  1FYC A;  2WV6 D;  2EIF A;  3CQZ B;  1S5C D;  2AMC B;  2GVA A;  1GHJ A;  3MXU A;  3P7J A;  4NPS A;  4DV0 Q;  1UUP A;  4A3B H;  2JA5 G;  3PUY A;  1K0R A;  2A6E C;  1HTP A;  4OX9 Q;  3HOV G;  4GKK Q;  2I5H A;  4DU9 A;  1HNZ Q;  3JC6 6;  4UPA A;  2CH4 A;  1EWC A;  3S1N B;  5KND A;  3C3L A;  2O4X A;  3J80 c;  3J7A 5;  2AKW B;  5KNB A;  2G9H D;  4JW0 A;  4A3E B;  4EGV A;  2Q2I A;  3GTP B;  2A6H D;  2B2Y A;  4MNO A;  2TMP A;  3SDZ A;  3DXJ C;  3B6Y A;  5GAE C;  2EYJ A;  1S4Z A;  3FRP B;  5KNC A;  5ELF A;  1WI5 A;  3OWE B;  3VYS A;  1KRT A;  2WAQ G;  1Q82 C;  5FLM G;  1Q8I A;  5C4X B;  3DUZ A;  4OIK A;  1EQV A;  4GLX A;  3C1F A;  1WOC A;  2G9D A;  2DY8 A;  3RLO A;  1Q86 C;  1I94 Q;  3NUC A;  1GVP A;  1PRT C;  1WJJ A;  2K5N A;  4RFB A;  5IYD G;  1PYW D;  4B9X A;  5FKA C;  3EIV A;  3D8G A;  2AQ2 B;  1ROD A;  1B50 A;  3A0J A;  2E2H B;  1LLR D;  1I6V C;  2NVX H;  1NBW A;  4DV0 L;  1PA6 A;  4C1N K;  2CFM A;  2OT2 A;  4B3R Q;  5G3L F;  3H09 A;  4OX9 L;  1GUT A;  1K0S A;  1HNZ L;  2B63 B;  1WD1 A;  2LY7 A;  3BYY B;  5G3L D;  2N88 A;  2F0O A;  2DN8 A;  4AYB B;  3I91 A;  5A2Q E;  3CXC A;  2R6G A;  3M9B A;  3S2D B;  2F0Q A;  2R3Z A;  2NUC A;  3TME A;  3A74 A;  4A93 H;  2JA6 G;  1KL9 A;  4HTH A;  4JCV E;  3GTO H;  3CPF A;  3MXN B;  1WTR A;  1AH9 A;  1H9S A;  3A8J E;  1NR4 A;  1PMR A;  2IX1 A;  5CMD A;  2BDO A;  3FVQ A;  1JOK A;  2LXK A;  2BOS A;  1EFW A;  3G6J B;  1EWI A;  1Q1B A;  3CHB D;  5K36 G;  1ILP A;  4ZYS A;  3SGI A;  1W2B A;  2NZO A;  4MIU A;  4IJH A;  3J81 i;  1FJG L;  1DON A;  3OW7 A;  1QVF A;  3G4S A;  1LTS D;  5I9P A;  1U4M A;  4N8X 1;  2J0T D;  4R8N A;  3E5S A;  3E3X A;  1ET9 A;  1S5B D;  5C4X H;  1EQR A;  4PZ8 A;  4B3R L;  3NTH A;  2ZJR A;  2PYK A;  1SMY C;  5CYU A;  1MSG A;  3VR2 A;  3D4W A;  1PRT B;  4I7A A;  1PFN A;  4A76 A;  2HHH Q;  2MFI A;  2F0E A;  4JI1 Q;  1IKM A;  1PDQ A;  3HFZ B;  1PFM A;  1E22 A;  2PO4 A;  1HPC A;  3FKI B;  2JA8 H;  1XMO Q;  3QOL A;  1LM0 A;  1B2T A;  3MVV A;  5COR A;  3CME A;  3HOY H;  1E2Z A;  2X69 A;  1SXT A;  1MI2 A;  2Z6B A;  1N9W A;  1UE7 A;  5IGC A;  5ELB A;  1D6E C;  2MUY A;  3MFY A;  2B63 H;  1CTM A;  2NN6 G;  1KAA A;  5FLM H;  2OWO A;  4BBS H;  1KD1 C;  1VQN A;  4UP9 A;  1RF2 D;  1ENA A;  1U4R A;  2A19 A;  3Q23 A;  3VR5 A;  1GUS A;  4NXN L;  2RHQ B;  1PTO C;  1BQQ T;  3I4N B;  4ME5 A;  3OWF A;  3J80 i;  3T1H L;  1N32 L;  4BA1 I;  2K05 A;  1X55 A;  3UE1 A;  4A3D B;  3MZ5 A;  4A75 A;  1IW7 C;  1E7Z A;  2Z0S A;  4DV1 Q;  1SMX A;  2AUJ D;  4Q0F A;  3VA5 A;  5CBE E;  3H3V I;  1Z47 A;  2JEB I;  1TY0 A;  1UAP A;  3PQI A;  2B2Y C;  5EKI A;  4OWX B;  1K3B C;  2A5H A;  2HHH L;  4IPD A;  4JI1 L;  1YHQ A;  1I50 B;  4QCL A;  3DHQ A;  2E74 C;  1II3 A;  4J8Q A;  2K03 A;  1XMO L;  4L5R C;  4ABN A;  3S1R H;  1X3G A;  4K0K L;  4E6I A;  1RL2 A;  3BDC A;  1WCM G;  4HMJ A;  1Y1W G;  3KDF B;  2AHO B;  2JA6 H;  1BCP C;  3K58 A;  3I7F A;  3S24 A;  1I3Q H;  4F87 A;  1Q1E A;  2HUG A;  4FDB A;  3BZK A;  3QG1 A;  3K80 C;  2EY6 A;  5IOC A;  1MKH A;  4A3C G;  4JI7 Q;  1A3V A;  3HKZ G;  1YNX A;  4IO9 A;  1TWC H;  3HP3 A;  1TQO A;  2GVB A;  2YTX A;  4HSV A;  5CV4 A;  1TXY A;  2HT1 A;  1RTO A;  3MA2 B;  1GKH A;  3R93 A;  2F03 A;  4OON A;  5K36 H;  1VQ9 A;  4X6A H;  2YU9 H;  4JBK A;  3M3Y H;  1A2U A;  4HSP A;  4MHE A;  4POG A;  5CR3 A;  3E9H A;  2SOB A;  2K04 A;  1O7Z A;  4RKL A;  1I4R A;  1U9R A;  1KDC A;  5LMN Q;  3TS2 A;  4HID A;  2Q8R E;  2I5L X;  3PF4 A;  2R92 B;  4L5S A;  1MD2 D;  4OEL B;  1QUQ A;  4GOP A;  1CQV A;  1Y1V G;  1PTO B;  3G6E A;  4A3K B;  4A3G G;  1TS5 A;  3F2D A;  2MQH A;  1XTC D;  1GOZ A;  5ELC A;  1H9R A;  2NTT A;  1F9S A;  3ONA B;  1KHI A;  1V43 A;  2IJ0 A;  3DMU A;  2MHV A;  3TN2 A;  1ET6 A;  2KCM A;  2Y0S B;  2SNS A;  2JXM B;  2L1B A;  3IRB A;  2K1B A;  1XMQ L;  3RZO B;  1NE3 A;  2MNA A;  1AZQ A;  2WP8 J;  1K3R A;  2M2L A;  1HNW Q;  4N8F A;  1I4P A;  3TS0 A;  2F52 A;  2L0C A;  3CU7 A;  1XX8 A;  4LFC Q;  1EU4 A;  1STG A;  1Q3L A;  4Y7N H;  2NN6 H;  3IL8 A;  1H95 A;  1H9M A;  1L0Y B;  2BE5 D;  1WD0 A;  4GLA C;  1M1K C;  4R4O A;  4A3M B;  2F0G A;  1FL0 A;  2JK8 A;  4GN5 A;  3A55 A;  1BCP B;  4PNY A;  1I4G A;  2J7Z A;  3AMU A;  1A2T A;  1PZK D;  4M8A A;  3S16 B;  3QOJ A;  4GNX A;  4QY7 A;  4IUP A;  4ZKC B;  3D3R A;  3SXH A;  4C3J B;  4PQX A;  5IWA L;  2C5C A;  4LF4 Q;  2JA7 H;  1WVL A;  3BVZ A;  1HFG A;  4CDF C;  1N8R C;  3HOU B;  3L7Z C;  2OF1 A;  1EIH A;  2SDF A;  1JQY D;  2K14 A;  5LMU L;  2KEC A;  1EIG A;  2KED A;  1SNQ A;  2OQK A;  2M9V A;  1VMP A;  4XYO A;  1IKL A;  1E3P A;  2RF4 A;  4K14 A;  4OWW B;  4X3S A;  2FFK B;  4F8M A;  3J7Y W;  3QJY A;  1SFO B;  1EQQ A;  1WCM H;  1A63 A;  1LTA D;  4P72 A;  1Y1W H;  3HOZ B;  2CH4 W;  3PMF A;  5NUC A;  2D2C C;  2RDH A;  5HGQ A;  4LFC L;  4DV2 Q;  5FJ8 G;  1I6H B;  3GV6 A;  2CWP A;  4JOI C;  4R4T A;  2J4X A;  1H9S B;  3R8B A;  1J5E L;  3GO5 A;  2F0M A;  3SVM A;  1RKN A;  4JC0 A;  4BY7 H;  1G2T A;  3NWT A;  5IYB H;  3U58 A;  2TSS A;  3CRL C;  3D6W A;  3H0G B;  2K5W A;  3NE5 B;  3IFD A;  3RZO H;  3WOF A;  1SYC A;  4BWG B;  2PQA A;  1IXR A;  1QJO A;  5JEA J;  1QVC A;  4TKO B;  1PH6 A;  4DK0 A;  5HUR A;  3GQB A;  1HR0 W;  4KD4 A;  3PO2 G;  1TWF B;  4LMQ D;  1HZA A;  5JPM C;  1FNV A;  1HQR D;  2EQS A;  4XQJ A;  3MXN A;  1Y8P B;  1TWA B;  2L9H A;  4A3F H;  1FGB D;  2E2J B;  1PHJ A;  4DK1 A;  5AJ3 Q;  4QGU A;  5JPN C;  4IFD H;  1Y1V H;  1CZW A;  2WKD A;  5C4Z A;  1DCZ A;  2A74 C;  1JWM D;  2WII B;  3U4Z A;  1BVS A;  1E2W A;  2F0W A;  4PG3 A;  1ZXT A;  3S16 H;  2D0P A;  1BR9 A;  2XRS D;  1EEF D;  2R7Z G;  4QJF A;  4YCW A;  3NSW A;  4GS3 A;  3K5M A;  4ZUI A;  4C3J H;  1IBL L;  4QQB X;  1LTB D;  4ME3 A;  1ML0 D;  5BN5 A;  3OMG A;  3ZJY C;  3S1Q B;  1G91 A;  3RNU A;  1WYD A;  1WTV A;  1BDO A;  2B2V A;  1VF5 C;  2MPM A;  2F0I A;  3RN2 A;  3RZD H;  5JJZ A;  1SND A;  3DWP A;  4QL5 A;  5C0X J;  1K8A C;  4RHS A;  3I2Z A;  1VQF A;  1YNN C;  1CKO A;  1AEX A;  5FLX L;  3CC7 A;  4Y52 H;  1SE4 A;  1SE8 A;  4A3B G;  1SYE A;  4KKT A;  3QWN A;  1DJR D;  5M3F G;  1R4P B;  1CHQ D;  3NTK A;  4DPG A;  4GZY C;  3SK5 A;  2XGT A;  5BR8 Q;  2E2D C;  4CGY B;  1J8I A;  5LL6 S;  2L55 A;  4NMZ A;  1E1T A;  3NBI A;  1E1O A;  2A8V A;  4UP7 A;  5EGT A;  1VQ8 A;  1VS0 A;  2HQE A;  1T5X D;  4OL7 A;  5AJ3 L;  1UE1 A;  4CKC A;  2OXP A;  3RN5 A;  1W6K A;  4K2K A;  1KTK A;  1TWG B;  1HNX Q;  2VNU D;  3E9I A;  2B29 A;  3PSI A;  5C4J H;  3K81 C;  4DKA C;  1SBB B;  3DWA A;  5FO8 B;  3CC4 A;  3H3V C;  4K5W A;  3IAY A;  4LFA L;  4RGT A;  1VF7 A;  1V9P A;  2EE1 A;  2UXC Q;  2Z1C A;  4WJ4 A;  1QIL A;  4KK7 A;  1TWF H;  2WKC A;  2NVQ B;  4I65 A;  2PI2 E;  1SJH D;  1DOM A;  3GV3 A;  1JCK B;  4RHR A;  3CF5 A;  1QZH A;  2CVR A;  2A6H C;  1BUV T;  2PQE A;  5I2Y A;  3I4O A;  2XWB B;  1IBM Q;  5FO7 B;  1L2F A;  4RWS C;  4XXE A;  2B8G A;  1G8Z D;  4GNX C;  1KQS A;  3TP5 A;  4NKL A;  2PI2 A;  1Q7Y C;  2RCF A;  3TBI B;  4H13 C;  3EVQ A;  3VYR A;  2IX0 A;  5FO9 B;  2YV5 A;  3PIO 3;  5HGT A;  1TWH H;  3AB9 A;  3S17 H;  5BR8 L;  4CHT B;  2MO0 A;  3A7L A;  4BBR G;  3MEH A;  3HKS A;  1KIX A;  4FF1 A;  2KEN A;  4Q5V A;  1EY5 A;  3PO2 H;  4OO1 I;  4A3J B;  4A93 G;  2HCI A;  5FLX E;  5JJI A;  2YYZ A;  3K5O A;  2JP1 A;  1P8L A;  1RTN A;  4YHH Q;  1BF4 A;  1HNX L;  1EWH A;  4IQZ A;  2BA0 A;  3Q24 A;  3SK8 A;  3HOX B;  1QUQ B;  5C6A A;  3UI2 A;  1DOL A;  2A68 D;  2IPK D;  2UXC L;  2NWG A;  2NTS A;  1QNK A;  1G29 1;  4TQU S;  2KCT A;  3S15 B;  4A3I B;  2UU9 L;  1SN8 A;  3W5O A;  5EAY A;  1OO9 B;  2XWJ B;  4DUZ L;  4L5Q A;  4X66 Q;  1VQ6 A;  5IP7 G;  4JI5 Q;  1EY8 A;  1CI3 M;  1HZ9 A;  5C4X G;  2QKI C;  4JG2 A;  5EPL A;  1B9N A;  3O13 A;  1ENC A;  1IBK L;  1EYA A;  1V1P A;  1YZ6 A;  5M3F H;  5ELN A;  2LKV A;  5ELO A;  1JWS D;  1F77 A;  2NVQ H;  1Y14 B;  3NK9 A;  5E3F A;  3HKZ E;  1Y8N B;  2JA8 G;  1X65 A;  4UHV A;  2LXJ A;  4R4C A;  5L37 A;  5C44 B;  5I2X A;  4GNX B;  2E2I H;  3HOY G;  3M4O H;  1A15 A;  3CCU A;  3GTL H;  3OYY A;  4R4I A;  3GTM B;  3HOW B;  2ZTD A;  5C5L A;  3F1Z A;  1VCI A;  2R7D A;  1XYI A;  2F4V Q;  1NMF A;  1VQB A;  2IW3 A;  3F8T A;  5JOB A;  1EY9 A;  3UDF A;  1Y69 U;  2JYO A;  4O1N A;  4DAV A;  2B63 G;  4BBS G;  1LUZ A;  3UDI A;  2B2V C;  3K8A A;  2RQX A;  1S3O A;  5JAV A;  3UDG A;  1KAB A;  3CCM A;  5D14 A;  4RKB A;  5KGU A;  3KK7 A;  4R8I A;  2IL8 A;  1GUG A;  4KHP Q;  2IY5 B;  3STB D;  1SYG A;  1X3Q A;  4X66 L;  1GXD C;  1HRJ A;  4RA8 A;  5GAH C;  3MEF A;  3M7N A;  5FK9 C;  2A73 B;  1GUO A;  1AN8 A;  2PMZ B;  2JA5 B;  1A6X A;  3HOV B;  1O78 A;  3QIA A;  4C2M H;  1Q81 C;  1PH2 A;  1ICF B;  4DN4 M;  4BY1 B;  2KCC A;  3M4P A;  4GKK L;  2KBN A;  1PH7 A;  4LUZ A;  3A8K E;  1JJC B;  2JEA I;  2XNA C;  4DUY Q;  4BBR H;  2N55 A;  2AWO A;  3H6M A;  1JOR A;  2PQA B;  2F3W A;  5JJL A;  5IYC H;  4YCU A;  3PIP A;  3MXP A;  3MXG A;  3BDL A;  5CC4 A;  3VR4 A;  3H3V H;  3CQZ H;  4XT1 B;  3CCV A;  3V2T A;  2F4V L;  2HQL A;  1X32 A;  4DR7 Q;  3CPW A;  2HIX A;  2RSN A;  5GRO A;  2WIN B;  3S1N H;  5E7N A;  1SE2 A;  4HIK A;  1O7L A;  4RGN A;  1I94 L;  2EVB A;  3CP0 A;  3FP9 A;  3CCJ A;  2FMC A;  4OGQ C;  2VW9 A;  3JAM L;  2B2U A;  5C0X I;  4HN7 A;  4A3E H;  1W6J A;  3TRZ A;  4KHP L;  2A69 C;  2L4N A;  2KCN A;  3GTP H;  5BN4 A;  1MJC A;  3EA6 A;  4RMF A;  1HTL D;  5IP7 H;  1C7Y A;  1KAW A;  4ZRZ A;  2EOT A;  4CJ2 C;  2N78 A;  1SR3 A;  1TY2 A;  3KF8 B;  4DV5 Q;  3KLS A;  2P5Z X;  2L5T A;  1WTH A;  5J39 A;  3PV0 A;  4DUY L;  1YNJ D;  3I4N G;  1VQ7 A;  1KLU D;  3KF6 A;  1PYS B;  3EFX D;  4PZ6 A;  4HR7 B;  2NBF A;  5I9O A;  3QO2 A;  4A3D G;  1R9T B;  3OSO A;  1AZP A;  1VQK A;  1PZI D;  4JI8 Q;  4KN4 C;  5IOD A;  2E2H H;  5LL6 X;  5M5W B;  1DYQ A;  1L0W A;  3PUX A;  3C2P A;  4LF8 Q;  1QZG A;  4A3C H;  1STH A;  2QDB A;  3DEP A;  1PRT D;  4PMB A;  1PH1 A;  3D31 A;  4A3L G;  3GTJ B;  1KLG D;  1E24 A;  3LGJ A;  3T56 B;  1LTL A;  3S2D H;  2ZM6 Q;  5M3M B;  4H44 C;  2PCF B;  3K5L A;  3NBH B;  2EY2 A;  2I0Q A;  3D4D A;  4UAI A;  1K83 B;  1D7Q A;  2K5H A;  2VY3 A;  4JOI A;  1SJE D;  4C3I B;  1DGS A;  4APV A;  2IWH A;  1K73 C;  1XPO A;  2ICE C;  4NB3 A;  2B2W A;  2JA7 G;  2QGQ A;  5M9O A;  4DV5 L;  2F0D A;  4FXK C;  4JI0 Q;  3JAM E;  2CQA A;  1PFS A;  1Z9F A;  3OTO Q;  4MTN A;  1PV4 A;  2BE5 C;  4CJ1 B;  2PNH A;  1NMG A;  4ID6 A;  2H4O A;  1AP0 A;  3K7A B;  1X3F A;  4LWC A;  4IOA A;  1SNO A;  2JN4 A;  2I46 A;  1CHP D;  2VXW A;  4DAP A;  3IFT A;  4JI8 L;  3CCL A;  3DM1 A;  4B3T Q;  1JJG A;  4AIM A;  2F0L A;  2OTL A;  4JI3 Q;  3PCO B;  2UXB Q;  3TP7 A;  2RHS B;  3RD4 A;  4N9T A;  4AQY Q;  1IHZ A;  2DJG C;  1IYJ B;  5FOB B;  4KJN A;  1H9K A;  2Q2T A;  2SNM A;  1HUM A;  4BY7 G;  1OXV A;  2X6G A;  3FKI H;  5IYB G;  1ESR A;  2ZM6 L;  1NSN S;  5M5X B;  3K0X A;  2Y0S G;  3J7Z C;  2QEX A;  1UE6 A;  2KHJ A;  2NZH A;  2IHF A;  4IJL A;  5HY6 A;  4F7X A;  5IT9 L;  3SR1 A;  1FVI A;  1NAP A;  3QB3 A;  5C5M A;  4DV1 L;  2K4K A;  5T1G A;  2LMC B;  1IL8 A;  1V8Q A;  5C3E B;  5JVH 3;  4A3F G;  4JI0 L;  3GTJ H;  2Q8I B;  4CDE C;  3H94 A;  3L2P A;  1PH5 A;  3OTO L;  4IFD G;  1CM9 A;  4A3M G;  2HIV A;  4HAE A;  1FD7 D;  1LT3 D;  2UUA Q;  1V1P B;  4EQ5 A;  4JI4 Q;  3I4N H;  3W1G A;  4DR5 Q;  3S2H B;  4LJZ C;  4A3D H;  3OOC A;  4B3T L;  2VS1 A;  3A8I E;  4JI3 L;  1D1I A;  3CD6 A;  1CUK A;  2UXB L;  4C3J G;  2K33 A;  5KRU A;  2B2U C;  3R3O A;  3W3A A;  3ND9 A;  1IL2 A;  4AQY L;  5GQO A;  3HOU G;  4H02 A;  3HKZ B;  1RIP A;  4JI7 L;  4TRD A;  5T1I A;  3NP8 A;  2ICI A;  3JAM c;  4QUF A;  3TZD A;  1I50 H;  1VQC A;  1XWE A;  4A3L H;  1TR5 A;  3NXW A;  2EY5 A;  4Z9C B;  1CSQ A;  1DD2 A;  3TQY A;  1E2V A;  3OPO A;  4UDU C;  4KMU C;  4YWM A;  3Q6S A;  3GD7 A;  4HCS A;  4BA2 I;  1SSO A;  2CWA A;  4KV6 A;  4L5T A;  2WFW A;  3K5N A;  3HOZ G;  2E75 C;  3FPP A;  1LTI D;  3NEM A;  5LMN L;  4NDX A;  4ODG A;  3A5U A;  1A3U A;  1MIU A;  3NEN A;  3P75 A;  4QIW E;  4X65 Q;  4A3G B;  4P2C B;  3F2B A;  4C3H B;  3H0G G; 
#chains in the Genus database with same CATH homology
 1XJV A;  3CC4 A;  1WOC A;  2VQF L;  1KC8 C;  4JI4 L;  1U5K A;  4LFA L;  1L1O B;  3RLO A;  1Q86 C;  1I94 Q;  1V9P A;  1GVP A;  1WJJ A;  2B3G A;  2UXC Q;  2K5N A;  4DR5 L;  2OTJ A;  4YY3 Q;  5LMN W;  5IYD H;  4WJ4 A;  3EN2 A;  2IHE A;  2I5M X;  5IYD G;  1TWF H;  2C35 B;  1LYL A;  2PI2 E;  3EIV A;  3CF5 A;  4GN4 B;  2VQE L;  1QZH A;  1HNW L;  5JJK A;  2R92 H;  1IBM Q;  4IPC A;  3I4O A;  5IP9 H;  1L2F A;  3A0J A;  1YJW A;  4YWL A;  4JI2 Q;  5C3E G;  2R92 G;  4GNX C;  1KQS A;  1NBW A;  4DV0 L;  1PA6 A;  2NVX H;  2CFM A;  4LF8 L;  2PI2 A;  1Q7Y C;  4LF9 Q;  1A62 A;  4B3R Q;  4A3K H;  2CCZ A;  4OX9 L;  3GTQ H;  4DV7 Q;  1YBY A;  1HNZ L;  2IX0 A;  1VQJ A;  4A3K G;  2YV5 A;  2BA1 A;  4P74 A;  3RLF A;  1TWH H;  3GTK H;  3S17 H;  2K5V A;  5BR8 L;  1GM5 A;  2MO0 A;  3CXC A;  2R6G A;  1UWV A;  3M9B A;  4BBR G;  1YEZ A;  1R9T H;  2BH8 A;  3HKS A;  1XMQ Q;  3ULL A;  2WAQ E;  1KIX A;  5DLQ E;  3A74 A;  2KEN A;  4PZ7 A;  1XNR Q;  4A93 H;  4POF A;  3PO2 H;  4OO1 I;  2JA6 G;  1KL9 A;  1HZB A;  2FXQ A;  4A93 G;  5M5W H;  4HJ7 A;  3AQQ A;  4JCV E;  3CPF A;  3MXN B;  4UP8 A;  3RR5 A;  2YYZ A;  2VL6 A;  3GTO H;  4LF4 L;  5JJI A;  1PH4 A;  1AH9 A;  3RLN A;  3CCQ A;  1GO3 E;  1XPU A;  2IX1 A;  1P8L A;  5IY0 A;  4YHH Q;  1O7I A;  3CCR A;  1HNX L;  2ASB A;  2BA0 A;  5GAD C;  2ZJP A;  1QUQ B;  4DR3 Q;  1N34 L;  1XPR A;  2LXK A;  4A3M H;  2E8G A;  1EFW A;  4NXM Q;  1EWI A;  1IZ6 A;  1Q1B A;  5K36 G;  5GAG C;  2UXC L;  4YY3 L;  5M3M H;  3SGI A;  1T9H A;  1W2B A;  1VQL A;  2NZO A;  1G29 1;  4AH6 A;  3KF6 B;  2KCT A;  4TQU S;  4IJH A;  3J81 i;  1VQ5 A;  2UU9 L;  4B3M Q;  1K83 H;  2L15 A;  1FJG L;  4OWT B;  1SN8 A;  1CSP A;  4IFD J;  3W5O A;  5EAY A;  4O0A A;  1QVF A;  3G4S A;  4DUZ L;  4OO1 G;  4L5Q A;  4C3I H;  2RCN A;  1VQD A;  5IWA Q;  4X66 Q;  1YIT A;  4JI2 L;  1A8V A;  2IT1 A;  1VQ6 A;  5IP7 G;  4DKA C;  4DR2 Q;  4JI5 Q;  4DV2 L;  4JV5 Q;  5C4X H;  3HOU H;  1YVC A;  1EQR A;  3PUW A;  4LF9 L;  4PZ8 A;  4B3R L;  2ZJR A;  1HZ9 A;  1S72 A;  5C4X G;  4JG2 A;  3ULJ A;  5LMU Q;  4O2D A;  1IBK L;  4A76 A;  2HHH Q;  3ICE A;  2MFI A;  2WB1 E;  1P16 A;  3BZC A;  4KHZ A;  4JI1 Q;  3HFZ B;  1Q8K A;  1XNQ Q;  1YZ6 A;  5M3F H;  1E22 A;  4KLK A;  1UEB A;  5ELN A;  5ELO A;  4X64 Q;  2JA8 H;  1XMO Q;  3K7A H;  1NY4 A;  2MO1 A;  2NVQ H;  1Y14 B;  2KHI A;  1LM0 A;  3HKZ E;  1SFO H;  2JA8 G;  2DGY A;  1OXS C;  1HH2 P;  4HIM A;  4HJ9 A;  3F2C A;  3PF5 A;  1MJE A;  1XNR L;  2R7F A;  1UE5 A;  3ER0 A;  1X65 A;  4J15 A;  3CME A;  3HOY H;  2LXJ A;  3G48 A;  4R4C A;  1EOV A;  1I5F A;  3HOZ H;  2E2I H;  4GNX B;  3HOY G;  3M4O H;  1N9W A;  1UE7 A;  2D62 A;  3CCU A;  3GTL H;  3OYY A;  1I6H H;  1SLJ A;  4R4I A;  3U50 C;  2ZTD A;  2E5L Q;  3F1Z A;  1VQP A;  4DK3 C;  2OCE A;  5J3B A;  1J5E Q;  1VCI A;  2R7D A;  4DR3 L;  2NN6 G;  1NMF A;  1VQB A;  3F8T A;  3UDF A;  5FLM H;  3H15 A;  2OWO A;  3GDE A;  4A3C G;  1HJP A;  1V1Q A;  3JAM i;  2B63 G;  4BBS G;  1LUZ A;  3CW2 C;  3FHW A;  3UDI A;  1KD1 C;  4UP9 A;  1VQN A;  4NXM L;  4LW1 A;  3H0G H;  4JBW A;  1OTC A;  2A19 A;  1FGU A;  4DNI A;  3K8A A;  1S3O A;  1AE3 A;  3UDG A;  5M5X H;  4NXN L;  2RHQ B;  3CCM A;  1QVG A;  2K52 A;  2VUM H;  3M4Q A;  3J80 i;  3T1H L;  4B3M L;  4LFB Q;  2YTY A;  2OQ0 A;  1VQ4 A;  2VUM G;  1N32 L;  4BA1 I;  1B7Y B;  2R93 H;  1X55 A;  3UE1 A;  4KHP Q;  2IY5 B;  4B3S Q;  4XIG S;  4YWK A;  4A75 A;  2R93 G;  1E7Z A;  3STB D;  2Z0S A;  1D8L A;  4X66 L;  3KOJ A;  4DV1 Q;  1JB7 A;  1SMX A;  4DR2 L;  4JV5 L;  1TWA H;  1EIY B;  5GAH C;  2E2J H;  3MEF A;  3H3V I;  5C3E H;  1Z47 A;  2JEB I;  4GLV B;  3M7N A;  1X54 A;  4LNQ A;  1VQG A;  3HOX G;  1B8A A;  4OWX B;  5M5Y H;  2UXD Q;  1Q12 A;  1JE5 A;  4IPD A;  4JI1 L;  1YHQ A;  2LSS A;  2HHH L;  1X3E A;  4C2M H;  1Q81 C;  1XNQ L;  1PH2 A;  1L1O A;  1M90 C;  4GKK L;  4X64 L;  3M4P A;  2KBN A;  1PH7 A;  4LF5 Q;  3KYH C;  4LUZ A;  1JJC B;  1XMO L;  2Z6K C;  4DV3 Q;  4L5R C;  1AE2 A;  2JEA I;  1CKM A;  1C0A A;  4TVA B;  4HIO A;  4DUY Q;  2PMZ E;  3KFU A;  1Q46 A;  5IE8 A;  3S1R H;  4BBR H;  1X3G A;  3S2H H;  4K0K L;  4A3I G;  3UDX A;  3PO3 G;  1RL2 A;  2AWO A;  2PQA B;  1WCM G;  2N8N A;  5JJL A;  5IYC H;  4YCU A;  3PIP A;  1IBL Q;  4HJ5 A;  4IOC A;  1Y1W G;  3KDF B;  2AHO B;  2JA6 H;  1VQA A;  5IYC G;  4YCV A;  2WB1 G;  3S1Q H;  3I7F A;  3S24 A;  1I3Q H;  1Q1E A;  4FDB A;  3STB C;  3BZK A;  3CQZ H;  3PUV A;  3CCV A;  3K80 C;  2E5L L;  3H3V H;  4AYB E;  1MKH A;  4DAY B;  2UUB L;  2F4V L;  2HQL A;  3NEL A;  4JI7 Q;  1N36 Q;  3CPW A;  2HIX A;  4DR7 Q;  4P71 A;  3HKZ G;  1YNX A;  4IO9 A;  5JEA G;  4DK6 C;  4KI0 A;  1TWC H;  1XTD A;  5GRO A;  2GVB A;  2YTX A;  4X65 L;  4UY8 C;  1K8G A;  1TXY A;  2HT1 A;  1GKH A;  3S1N H;  3UE0 A;  5E7N A;  3E0E A;  4HIK A;  3I4M G;  4DR6 Q;  4OON A;  4R1J A;  1I94 L;  5H1S E;  2V1C C;  3DM3 A;  3CP0 A;  3FP9 A;  3CCJ A;  1VQ9 A;  2YU9 H;  2N3S A;  2K75 A;  3BU2 A;  2N49 A;  1PH8 A;  4JBK A;  2VW9 A;  3M3Y H;  3WWV A;  4LFB L;  5C0X I;  4A3E H;  4R4Q A;  3VDY A;  3TRZ A;  4KHP L;  4B3S L;  2CQO A;  4POG A;  4A3E G;  1YI2 A;  3GTP H;  2XTI A;  3E9H A;  4P75 A;  1MJC A;  3PGZ A;  3L0O A;  3CC2 A;  3AFQ A;  4DR4 Q;  4JBM A;  4LUV A;  4RMF A;  3I55 A;  5LMN Q;  3TS2 A;  4HID A;  1IBM L;  2I5L X;  3PF4 A;  5IP7 H;  1C7Y A;  4L5S A;  4LF6 Q;  1KAW A;  1JMC A;  2UXD L;  1QUQ A;  4GOP A;  2N78 A;  1SR3 A;  1Y1V G;  1TWG H;  4LF7 Q;  4A3G H;  2ZJQ A;  2NN6 I;  2JE6 I;  3KF8 B;  4DV5 Q;  3G6E A;  4C3H H;  4DV7 L;  4A3G G;  2A1A A;  3F2D A;  4LF5 L;  2MQH A;  3AFP A;  4LFA Q;  3PV0 A;  1YHB A;  4GN3 B;  4ALP A;  4EX5 A;  5IT9 c;  3KJO A;  4DUY L;  3W1B A;  3I4N G;  3ULP A;  1KHI A;  1V43 A;  1VQ7 A;  4BXX G;  3KF6 A;  2KCM A;  4MZ9 A;  1PYS B;  4PZ6 A;  1G51 A;  5C0X G;  2H5X A;  4A3D G;  3IRB A;  1XMQ L;  1SRU A;  1NE3 A;  2MNA A;  2ZTE A;  2WP8 J;  1VQK A;  1K3R A;  1A0I A;  1VQH A;  4JI8 Q;  1HNW Q;  4OXP A;  3Q8D A;  3TS0 A;  1EYG A;  2E2H H;  4JYA Q;  2Y0S E;  2F52 A;  1N36 L;  1L0W A;  3EBE A;  3PUX A;  4LFC Q;  3KJP A;  4Y7N H;  1YJN A;  4DV6 Q;  4LF8 Q;  1QZG A;  4A3C H;  4YHH L;  1H95 A;  1EIF A;  1HR0 Q;  3OW2 A;  4GLA C;  4BY1 G;  1M1K C;  1PH1 A;  3D31 A;  4R4O A;  4A3L G;  3U4V A;  4DR6 L;  1X6O A;  4GOP C;  1NTG A;  4DAM A;  4JBJ A;  1E24 A;  2JA9 A;  2JK8 A;  1FL0 A;  1LTL A;  3LGJ A;  4GN5 A;  1N33 Q;  3S2D H;  4DV4 Q;  2ZM6 Q;  4AYB G;  3NBH B;  3BJU A;  4XTC S;  3KLW A;  2I0Q A;  1BBW A;  2VZA A;  2Q2U A;  4GNX A;  4A3J H;  2EXD A;  4QY7 A;  4DR4 L;  1D7Q A;  2K5H A;  2VY3 A;  4JOI A;  1PH3 A;  3I56 A;  4A3J G;  1OXU A;  3CCS A;  4LF6 L;  5IWA L;  3PUZ A;  1DGS A;  4APV A;  5FLX c;  4LF4 Q;  2JA7 H;  1OXT A;  4JI5 L;  1XPO A;  1B70 B;  1K73 C;  3AYH B;  4NB3 A;  4LF7 L;  1N8R C;  2JA7 G;  2QGQ A;  3L7Z C;  1CKN A;  3HOX H;  4DV5 L;  4JI0 Q;  2K14 A;  5LMU L;  3A5Z B;  1HZC A;  1PFS A;  1Z9F A;  2OQK A;  4RG1 A;  4MTN A;  3OTO Q;  2ATW A;  1PV4 A;  1KRS A;  2JJQ A;  1E3P A;  2RF4 A;  4OWW B;  2PNH A;  1NMG A;  1X3F A;  2GN5 A;  4LWC A;  3S15 H;  3CCE A;  4IOA A;  4A3I H;  3PO3 H;  1FJG Q;  2UU9 Q;  1EQQ A;  1WCM H;  2D0O A;  2YTV A;  1A63 A;  2BH2 A;  2DUD A;  2JQO A;  4JI8 L;  1U0L A;  4P72 A;  1Y1W H;  3ERS X;  3CCL A;  4B3T Q;  4DUZ Q;  1JJG A;  4AIM A;  2OTL A;  1J6Q A;  4JI3 Q;  4JYA L;  1G6P A;  3PCO B;  5FJ8 H;  1VQM A;  2UXB Q;  2ID0 A;  5HGQ A;  4PMW A;  5IP9 G;  4LFC L;  4DV2 Q;  3G71 A;  2UUA L;  2UUB Q;  1PVO A;  5FJ8 G;  2RHS B;  4DV6 L;  2CWP A;  4AQY Q;  2AWN A;  4JOI C;  4R4T A;  1VQE A;  3CAM A;  1J5E L;  1HR0 L;  1IYJ B;  1X56 A;  2Q2T A;  4IFD I;  1K9M C;  3GO5 A;  4BY7 H;  4JC0 A;  1IBK Q;  4A4I A;  5IYB H;  3U58 A;  3J81 j;  4BY7 G;  1OXV A;  3T1Y Q;  1YIJ A;  1JT8 A;  3FKI H;  5IYB G;  2UUC Q;  3I4M H;  1N33 L;  4DV4 L;  2ZM6 L;  4BBS H;  4X62 Q;  3K0X A;  2Y0S G;  3FKI G;  3J7Z C;  2QEX A;  3RZO H;  1UE6 A;  3GTG H;  2KHJ A;  2PQA A;  1IXR A;  5JEA J;  3J81 c;  1QVC A;  2NZH A;  2IHF A;  1L1O C;  4IJL A;  5HY6 A;  1PH6 A;  3AEV A;  3KDF A;  1HR0 W;  5C44 H;  2ALY B;  1FVI A;  4X6A H;  3D0F A;  3PO2 G;  1OXX K;  2NVY H;  5C44 G;  4GKJ Q;  1HZA A;  4DV1 L;  2K4K A;  3GTM H;  1BKB A;  2EQS A;  3HOW H;  4A3F H;  1ASY A;  3PIO A;  1PHJ A;  3HOW G;  4GOP B;  5AJ3 Q;  1ASZ A;  4QGU A;  4A3F G;  1YJ9 A;  1Y1V H;  3GTJ H;  4IPH A;  4JI0 L;  4DR1 Q;  1C9O A;  3L2P A;  4HJA A;  1PH5 A;  1EUJ A;  3OTO L;  4JI6 Q;  4IFD G;  4A3M G;  2HIV A;  1KXL A;  1JJ2 A;  3U4Z A;  1BVS A;  2UUA Q;  4P73 A;  4NXN Q;  2NVT H;  3TEH B;  3K7U C;  2VQF Q;  4DV3 L;  4EQ5 A;  4JI4 Q;  3I4N H;  5M3M G;  4PG3 A;  3F2B A;  4BXX H;  2ES2 A;  2R7Z H;  3S16 H;  3T1H Q;  2D0P A;  1SRO A;  3W1G A;  1VQO A;  4DR5 Q;  1N32 Q;  2ZTC A;  1GD7 A;  4A3D H;  2R7Z G;  4LUO A;  4QJF A;  4YCW A;  4GS3 A;  1BBU A;  4B3T L;  3S1M H;  2VS1 A;  4C3J H;  4JI3 L;  1IBL L;  3S14 H;  4QQB X;  4ME3 A;  1S40 A;  3CD6 A;  1CUK A;  2UXB L;  1PH9 A;  2K50 A;  3ZJY C;  2VQE Q;  1IL2 A;  3RNU A;  4AQY L;  1WYD A;  2EIF A;  5GQO A;  2B63 H;  1YHA A;  3RN2 A;  3HOU G;  2AMC B;  4H02 A;  3RZD H;  4QL5 A;  5C0X J;  1NJI C;  1RIP A;  1K8A C;  2GVA A;  2JA5 H;  4JI7 L;  4DR7 L;  4NPS A;  3JAM c;  4DV0 Q;  3I2Z A;  3DLL A;  1VQF A;  2JA5 G;  3PUY A;  1K0R A;  3HOV H;  4A3B H;  1I50 H;  1CKO A;  1VQC A;  4BY1 H;  3T1Y L;  3CC7 A;  4OX9 Q;  3HOV G;  1SE8 A;  4A3B G;  2I5H A;  4IPG A;  3M85 A;  2UUC L;  4GKK Q;  4A3L H;  1HNZ Q;  2Q2H A;  3JC6 6;  4UPA A;  1CSQ A;  4X62 L;  5M3F G;  3TQY A;  2F3I A;  3CMA A;  4Y52 H;  2CKZ B;  2F4V Q;  1PYB A;  4DPG A;  3J80 c;  2XGT A;  3J7A 5;  4YWM A;  1VQI A;  5BR8 Q;  4K0K Q;  2AKW B;  4WJ3 M;  3GD7 A;  4BA2 I;  2CWA A;  2Q2I A;  4L5T A;  4HJ8 A;  1E1T A;  2WFW A;  2QA4 A;  4GKJ L;  1W3S A;  1E1O A;  2A8V A;  4MNO A;  3HOZ G;  4UP7 A;  3B6Y A;  3NEM A;  5GAE C;  5LMN L;  1VQ8 A;  1VS0 A;  5AJ3 L;  1WI5 A;  1WFQ A;  3A5U A;  1UE1 A;  1X9N A;  1MIU A;  1KRT A;  2Z6K A;  2WAQ G;  3NEN A;  4DR1 L;  3RN5 A;  1CKN B;  1Q82 C;  5FLM G;  4JI6 L;  4QIW E;  4X65 Q;  3TRE A;  1HNX Q;  2VNU D;  4GLX A;  3E9I A;  2B29 A;  3PSI A;  5C4J H;  1N34 Q;  3K81 C;  3H0G G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...