4K5WA

Crystal structure of staphylococcal nuclease variant v23m/l25f/t62f at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTMKFMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFFKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k5wA00
4PNYA 4K2LA 4QF4A 3T16A 5EKLA 1EY0A 1STGA 4K8IA 2F0HA 4NMZA 4ZUIA 4K2KA 1F2YA 2F0SA 5IGEA 3NXWA 3DHQA 3ERQA 4HMIA 4YIJA 5HGTA 2EYOA 3MVVA 4R8NA 1SYDA 2EY1A 5CR3A 1EZ6A 4HMJA 3R3OA 5C5LA 2F0TA 5I6WA 3D6CA 2F0MA 1EY9A 1EYCA 3TMEA 2PZWA 5KYIA 1ENAA 2EYJA 5J39A 3TP6A 4K5XA 4WRDA 4B9WA 5KIXA 4LAAA 2EYFA 3C1EA 5ISRA 1SNCA 4N9PA 4NDXA 2RKSA 2SNMA 2F0OA 1A2TA 3QOJA 4RKBA 3SK4A 1STHA 2F0KA 5F2DA 5C4ZA 2EY5A 5K5PA 4KY7A 4QB4A 1STYA 2F0PA 3H6MA 4PMBA 3QB3A 4J6HA 5NUCA 2EY6A 3MHBA 3PMFA 3D4DA 2EYMA 2HQEA 4IZ8A 4K5VA 5CV8A 3RUZA 2PQEA 3V2TA 5CV9A 4F8MA 3OWFA 3SK5A 4PMCA 2OF1A 4HTHA 1SNMA 3TP7A 4MIUA 2PZTA 2EYHA 2F0UA 3MXPA 1A3TA 3DMUA 1EYAA 5IGBA 2F0EA 5CC4A 1TQOA 3TP8A 5KYLA 3QOLA 2F0WA 5E1FA 5IGCA 1II3A 4RKLA 5C3XA 2RBMA 4KJNA 3NHHA 3NUCA 2F0NA 3D8GA 2F0FA 3SHLA 1SYGA 1SYCA 2PW5A 2KQ3A 2PW7A 5DAUA 4NKLA 4DFAA 1KDCA 1SNOA 5E3FA 4ME5A 5CV4A 1EZ8A 3SK6A 4B9XA 5KEEA 4QMGA 3LX0A 4K8JA 1JOOA 1EY4A 5CV5A 1SYFA 3E5SA 1STAA 4KD3A 1A3VA 4KY5A 3NQTA 5IIFA 2RDFA 4EQPA 1KAAA 3VA5A 5IGDA 2ENBA 4IALA 2EY2A 1KABA 3ITPA 1KDAA 3NP8A 2OXPA 4EQOA 5HURA 2NUCA 3OMCA 5CGKA 1EY5A 2PZUA 1F2MA 3MEHA 4J1MA 4ZQ3A 4DU9A 5IGFA 1U9RA 5C4HA 5DEHA 2QDBA 1NUCA 1F2ZA 1EY7A 3HZXA 4ID6A 1RKNA 5JOBA 3BDCA 3SK8A 2F0JA 2LKVA 3C1FA 4E6IA 5IGGA 5C3WA 3T13A 2F0IA 2EXZA 2F0DA 3OMGA 1STBA 2EYLA 5J1ZA 2F3VA 2OEOA 3BDLA 3P75A 5EKKA 4KTAA 3U9OA 5I9OA 2F0LA 4I65A 5JAVA 1SYEA 4EQNA 2EYPA 5EGTA 5CV6A 1TR5A 1EQVA 4G57A 4DF7A 1EY6A 2PYKA 3SXHA 5I9PA 4EVOA 1SYBA 5CV7A 2SNSA 3OSOA 3SR1A 3NK9A 4ODGA 1NSNS 5C5MA 4F7XA 1KDBA 1TT2A 4K5WA 3EROA 2O4XA 2F3WA 1A3UA 1JOKA 3MZ5A 2F0GA 4KD4A 5IODA 1SNDA 4KHVA 2KHSA 4TRDA 1EY8A 5I6YA 5KRUA 1ENCA 4KV6A 4NP5A 1EYDA 4S3SA 3HEJA 1IHZA 4KY6A 3S9WA 2WACA 1JORA 5J22A 1A2UA 2F0VA 5IOCA 5KGUA 2F0QA 4ZUJA 1AEXA 5C6AA 3D4WA 1STNA 3EJIA 2SOBA 3EVQA 2M00A 3P1HA 4H7BA 4OL7A 4WORA 1JOQA 4KJOA 4N9TA 4DGZA 1SNQA 4K14A 3TP5A 4K6DA 5M9OA 1SNPA 4IUNA
chains in the Genus database with same CATH superfamily
4DV6Q 4L5RC 5EPLA 1TS4A 4ZUIA 4LF8L 1LABA 1FD7D 1QB5D 2BA1A 2NVQH 2ZTEA 1CK1A 1K8GA 5C5LA 4R4CA 5LMNL 1BCPC 4BY7G 4B9WA 5CYUA 4P75A 4A3LH 2VNUD 3U4ZA 1STHA 3ICEA 1S5BD 3Q23A 2EY5A 2E76C 4IFDJ 1CUKA 3K0XA 4QB4A 1DOMA 2L4NA 3H6MA 5J22A 4A3IH 4F8MA 4DR5Q 2B2WA 1PDQA 1I6HB 4POGA 2CKZB 1XNQQ 2PZTA 4DAYB 4GOPA 2F0UA 3IAYA 1D8LA 1EYAA 1DONA 5CC4A 2ZTDA 1ENFA 4FF3A 2DNEA 2WIIB 2TSSA 1XMOL 5EPKA 4CDFC 2KUMA 2KQ3A 3UDXA 1OXVA 2EJFC 4B9XA 4FXKC 2MO1A 1L0YB 1N36Q 1EY4A 1TWCH 1YHQA 4BY1G 3S1QB 4RGNA 4O1NA 3OTOQ 5TSSA 2PZUA 4APVA 2A73B 1TWAB 2AUKA 5EKIA 2XTIA 4JI1Q 4L5SA 3TEHB 5FKAC 4JBMA 3DEPA 3AEVA 2R92B 2FXQA 3QIAA 1VQMA 1SSOA 5LL6X 4DAVA 1HCZA 1EQVA 1TR5A 4DUYQ 5JEAG 2NN6G 4JI3L 4JBKA 1SE4A 4JVZA 1TS5A 2N78A 1XXGA 4UP7A 4A3EH 2K52A 4KV6A 4S3SA 2QF7A 1G6ZA 1UE5A 1JORA 1Z6HA 2QCPX 3GTJB 2F0VA 4IJLA 3T51B 1C0AA 2ZXOA 2M00A 4ZCKA 3HOVB 4Z9CB 3CF5A 1F9RA 2EJGC 1OXSC 5GAEC 4K6DA 3J7A5 4X65Q 2QKIC 1MHWC 1R4PB 1IKMA 5A2QL 5L37A 1TWGH 2AMCB 3F1ZA 4QIWB 1IBLL 5M5WB 1K83B 1PYSB 2JEBI 4C2MB 4WJWA 4BS9A 3URYA 2UUAL 2KCMA 3CQZB 5KYIA 5LMUL 2PZWA 2IX0A 2AKWB 4X64L 2F0OA 2VQFQ 1CTMA 2WAQB 2R7ZH 3K80C 4UDUC 3S1RB 4X62Q 1QWYA 5C6AA 5CV8A 1B50A 2NZOA 2JK8A 5BR8L 3SK5A 1F9SA 2LS01 3A56A 1EWHA 1S5CD 3KLSA 1DD2A 4A3GG 4LUVA 4DA2A 1EEFD 4DV5L 2K75A 2KHIA 1YJ9A 4P71A 2PW5A 2PW7A 5M5YB 4JI8L 1EEID 2XWJB 4JI6L 1SFOH 2K05A 4XYOA 1V9PA 2NTSA 2M9VA 1BF4A 4AH6A 5FO8B 3CCMA 1FVIA 3L7ZC 2ENBA 1DOLA 1KDAA 2JA8G 4EQOA 1ZKOA 4EX5A 1UEBA 1PH6A 1L0XB 3MEHA 4HIDA 5C4HA 5A2QE 1Q7YC 2JA6G 4ID6A 5IGGA 1SMYC 4B3RL 3K58A 1QNUA 5I2YA 1RDPD 5T1IA 5C4JH 4ZKBB 2FJ2A 2OT2A 5IP9H 3U9OA 4P72A 2NVYH 3VR5A 1FNUA 1OO9B 4DV2L 4A4IA 5CV6A 1HNZL 1EL0A 2PYKA 1RHPA 3TDQA 1IL2A 2KJXA 3RR5A 4A3BG 2VUMG 3K5OA 4C3HG 1LTSD 4DR7Q 3MC0B 4F7XA 1TT2A 3BZCA 4PZ8A 2IWHA 1VQGA 2KBNA 5M3FH 3G7LA 3P20A 2VQEL 1BBXC 1C4QA 5I6YA 1Y14B 3S9WA 1JE4A 1HZ9A 3FP9A 4DR2Q 1LTBD 4RGTA 1N32L 1STNA 3S2HH 1LUZA 4KJOA 4P74A 4N9TA 2KCTA 3ZYYX 1DXMA 1EU4A 5K36G 5EKLA 1EY0A 4A3LG 2ZM6L 1NTGA 5CBEE 2IJ0A 3VYTA 1KIXA 3I2ZA 3JAME 4IFDG 2UXBL 1Q1EA 4KI0A 3J7AF 3U50C 2A5HA 2N55A 4C1NI 2XIWA 1I3QH 3Q22A 4MTKA 1PRTB 5FO9B 3CMAA 3TP6A 3SE0A 4LAAA 3C1EA 4QCLA 5FO7B 1Y1WH 1A2TA 2DJFC 3GP7A 3E0EA 1BBUA 1I4RA 4IUUA 3HGBA 3QJYA 2F4VL 3GTKH 3K7AB 3J7YW 3HOUH 3OPOA 1KNEA 1UWVA 2I5HA 1U4LA 1IKLA 1UAPA 1B53A 1H9SA 4FXDA 1C48A 2B3GA 1JE5A 1XTDA 1PH3A 2E2IH 1H9SB 2MHVA 2B63H 2E2HB 4DFAA 4PZ7A 4A3FB 4YWKA 1JOOA 4OO1G 1SYFA 3ULLA 1S72A 1AZPA 4DV4Q 1G51A 1PFSA 3N6RA 4FVMA 1SE3A 3HOWH 2J0TD 2J4XA 4YY3Q 1BKBA 1GUNA 3I4MB 4HSPA 4A3DB 1BDOA 1QVGA 3FKIG 3FMCA 1TIID 4RGOS 3CHBD 1JWUD 2F0IA 3L2PA 5JVG3 3KDFA 1M8AA 3CAMA 4I7ZC 1L0WA 4A3MG 3S16H 2K5WA 4C3JB 3KDFB 2KHJA 1F9PA 5E4XA 5AJ3L 4C56C 4HCSA 5GROA 1W3SA 4CHTB 5M3MH 4QQBX 4KN4C 4LK1C 4X66L 4A76A 2RCFA 1O7IA 2BH2A 3CCVA 4JV5L 4KHPL 4Q0FA 5C4XH 2EIFA 2PNHA 5I4DA 5IOCA 2K5QA 2OTLA 2NVXB 1X3PA 3LNNA 3MAQA 3HOXB 1PLFA 3CW2C 2VL6A 1I50B 4MNOA 3N52A 5C3EH 1LTAD 3GTOH 4JOIA 2E2JB 1YEZA 3PO3B 4RH6A 1SRUA 3VA7A 4HMJA 3QR8A 5C4JB 2DY7A 3CCRA 1TS2A 1CQVA 1PXUA 3NTHA 1R4QB 2OQ0A 5LMNQ 4H13C 3QOJA 1UE1A 1NBWA 2PI2E 1PA6A 5D65A 1VQ4A 5NUCA 3IFTA 3H09A 1EUJA 4JW0A 4PMCA 4IPHA 1FNVA 4GLAC 3DMUA 1QUQB 1TQOA 4B3SQ 4OHJA 2RDHA 5LL6S 4C3IB 3K7UC 1WI5A 1PH1A 2HIVA 1YNNC 3S2HB 4CKCA 1XMOQ 3JAMi 4DV3L 5IWAQ 2AUJD 4H44C 1V43A 1EQTA 2XGTA 3BZDB 2K50A 1LACA 2A8VA 3PF5A 3U58A 4DK6C 2EY2A 1SJED 3PUYA 3VR4A 3H3VI 3WWVA 3OMCA 1EY5A 2RSNA 1F2MA 2QEJC 4DU9A 1U9RA 1KQSA 2TMPA 3E9IA 5JOBA 5C0XH 3HKZB 1WCMG 5M3FG 1EOVA 4OONA 4GNXA 4AYBB 2R7DA 4A93G 5EGTA 5DM73 4GNXB 3AU7A 4UY8C 1KXLA 1NJIC 2JJQA 3KJOA 5I9PA 3SEBA 4A3JG 1LTRD 3S1NH 4DNRB 2IX1A 2H1EA 1PFMA 1PV4A 2O4XA 1VMPA 1RTOA 2DY8A 5FJ8H 2E2IB 3UE0A 4OIJA 3T4AC 3D4WA 1SMXA 1I4PA 2JA5G 4CJ0B 1AE3A 2VS1A 3A54A 3S2DB 5JJIA 5IYCH 2ZJQA 3HOWB 1Y1WG 2OQKA 1HFGA 1TVXA 4LF5L 5HGTA 2UUBL 2MPMA 1N8RC 1W6JA 5EQ0A 2F0TA 4FF1A 4FXGC 1KC8C 2UUAQ 4LF4L 2EYJA 4R4QA 2Z6KC 2K01A 5LMUQ 3OW2A 2SNMA 4MHEA 2DGYA 2A6ED 3TSSA 4KY7A 1O78A 3NQIA 1PTOC 3D4DA 3K81C 4MZ9A 1Q8KA 3VR2A 1JWMD 4BBRG 1RCVD 1GOZA 1HUMA 3OOCA 2Y0SG 5BR8Q 3S1QH 3D0FA 3TP7A 2UU9L 4OIKA 3CC2A 3UDIA 4CJ2C 2E5LL 3HOZB 2Q2HA 4YHHL 1TWAH 1STEA 2XRQD 1BCPB 2ASBA 4WJ4A 3NBIA 2VY3A 3LWEA 4DV5Q 3Q24A 2L12A 3EIVA 4JI8Q 1VQFA 3E9HA 1A15A 1A3VA 1BUVT 2JP1A 2HIXA 5C0XI 3I73A 3JC66 3U9SA 1GUTA 1K8OA 5COYA 1EIYB 4KHZA 2DNCA 1IXRA 5DEHA 1RL2A 3HZXA 1IW7C 1HHVA 1RKNA 1UUPA 1VF7A 3BDCA 2LKVA 3VR3A 1JMCA 5M3MG 1RTNA 3BYYB 4YCWA 4B3RQ 2AQ1B 1BBWA 2CWPA 4NXNQ 3M7NA 4KTAA 4DK3C 1B44D 3GTJH 4U68A 1PVOA 4IQZA 1EIFA 1FGUA 4DV2Q 1HNZQ 2BOSA 4LF9L 3NEMA 2X69A 2KCNA 3BU2A 5G3LD 1BO0A 3UDGA 3OWEB 4RMFA 3KF6A 1RD9D 5KRUA 2VQEQ 1K83H 3G48A 2UXDL 4JI2Q 3KF6B 4C2MH 3JAMc 3OYYA 1PFBA 5ELCA 1JICA 3CQZH 3I55A 5JJKA 1MI2A 3G6JB 1JOQA 4K14A 5E7NA 3D3RA 5EAYA 3CKIB 4R4OA 1BCPD 3I7FA 3A74A 2MJ8A 3CU7A 1KAWA 2NZ1D 3W5OA 1FJGL 2KA7A 2ZM6Q 3F8TA 4XT1B 3RLNA 4HJ7A 3S1RH 2KEEA 4YIJA 1MBYA 3VDYA 1VQOA 3M4OB 3M3YH 2UXBQ 3KLWA 3BZKA 3TMEA 2F0MA 3OW7A 1N33Q 1ENAA 3DWPA 2IL8A 1WYDA 2FINB 2B2YC 4G4KA 1LT3D 1X9NA 3I90A 3NPPA 2ES2A 3FDTA 3TBIB 4DN4M 3A8IE 3R8BA 1EU3A 2NN6I 2CHBD 3P7JA 1VQ6A 1M1KC 4DR3Q 3J7ZC 5C3XA 2RBMA 4NXMQ 2E8GA 1LLRD 2WKCA 3KYHC 1SYGA 1E24A 4GLXA 1MSHA 1X55A 4UPAA 3CD6A 2XWBB 3ERSX 4MTNA 3F2BA 1XMQL 2JA7G 1BQQT 1PH2A 4DAYA 3NENA 4V0BA 1DM0B 1HTLD 4ZAIA 3I4OA 5IYBG 1NUCA 1F2ZA 3NE5B 3J80c 1AW7A 3UE1A 1ILQA 2EXZA 4YCUA 1PTOF 2L5TA 3BDLA 3H15A 2ZXRA 5EPJA 2A1AA 2N49A 4H0LC 1WVLA 2F1MA 1Y8NB 1Y8OB 4HAEA 5AJ3Q 1CKNA 1H95A 2C5CA 5FOBB 1HH2P 5IYCG 1LT4D 1VQKA 1CKNB 2F0GA 4IURA 1U4PA 3E0JA 4X66Q 1LTTD 5D3DA 4HJ8A 4KKSA 1YIJA 3GO5A 4JV5Q 4RWSC 4X3UA 4KHPQ 3EJIA 2L0CA 3J81j 2A6HD 1HR0W 2G5DA 1QILA 1HPCA 3EBEA 2BE5D 2JE6I 1WOCA 2IHFA 3WOFA 3A8KE 1WTQA 3K7AH 1K28A 4B3MQ 3TZUA 2B2VA 1XNRQ 4DV1L 3OIQA 2NYZD 5HY6A 3PIOA 5IYDG 4TKOB 4DUZQ 1EYCA 2E74C 2G9DA 2R93B 2EYFA 2F52A 5FLMG 1CT1D 4N9PA 4RKBA 4XQQA 2AQ3B 1X3EA 2E2HH 2N3SA 3K0YA 3A55A 4A3FH 3PSIA 4JI0L 1VQEA 3PMFA 5JPMC 2R92G 2Q8TA 1QOHA 2K6AA 4PV1C 4FYDA 1S3OA 4GKJL 3PIO3 2HDMA 2K7VA 1CKMA 3HOYH 5E1FA 4LJZC 3I4MH 4A3DH 4MN3A 2K32A 1YNJD 4XTCS 3SHLA 1SYCA 3I70A 1ZYRD 1GVPA 4DV3Q 4C3JH 1GKHA 3VA5A 4KMUC 1U4RA 3ITPA 2K03A 4DXGA 1B8AA 3SDZA 5HURA 1B7YB 3HOVG 3M3YB 1FL0A 2KOLA 1FR3A 1B2TA 2F0JA 2B2TA 1D7QA 5GAGC 2O5IC 1X54A 3IRBA 1HTPA 2A74C 4OWWB 2PMZE 3S15B 5C44G 2JA6B 1YI2A 1O7YA 1WJJA 2I5LX 3KUPA 4DPGA 3VYSA 2UXCQ 2NVXH 3IFDA 4JI5L 1YBYA 3JAML 3HOXH 1TWFH 3I4LA 1F77A 2CVRA 1I50H 5G3LF 3MZ5A 4KLKA 3HKSA 1SNDA 2WAQG 4XQJA 3AYHB 4GOPC 2N88A 2E2JH 1LYLA 3PO3H 2EQSA 1J5EQ 1H9KA 1Y1VH 2VUMB 1Z9FA 1FGBD 4JI4L 4DKAC 3BJUA 4ZUJA 2NZHA 1IBML 4IJHA 3PUVA 1HA6A 3PIP3 1I4XA 3ZJYC 1ASYA 1PZID 1SNPA 3EA6A 4OO1I 2DJGC 1NMGA 2A68C 2V4DA 2QDLA 4DR4L 1G91A 2OCEA 3L9AX 4K2KA 2RQXA 3DM1A 5H1SE 3NXWA 3DHQA 2YV5A 5FK9C 4LF5Q 2UUBQ 4N8FA 2ZTCA 3A7AB 3CCUA 4LF4Q 4LF7L 1ML0D 4C3IH 2NB0A 3IL8A 2K33A 5ISRA 2RKSA 4DR1L 3FHWA 4RCOA 5CORA 2LFNA 3TQYA 4BXXH 5IY0A 3GTMB 4DK1A 3CXCA 1H9MA 1GHKA 3GTPB 1E3PA 3QG1A 4DV0Q 3KF8A 4DV7L 4FO2A 2LY7A 4RGMA 3KF8B 1A3TA 2HDLA 2NVTB 1ASZA 4UHVA 4A3IG 2UU9Q 2F3IA 1II3A 2K5DA 3WOEA 1QZHA 1NR4A 2E5LQ 1X65A 4YHHQ 3RNUA 4P73A 2X6GA 3KOJA 5DAUA 3KLSX 3MFYA 1KDCA 2Y0SE 4ME5A 4LFCL 2VW9A 3J80L 5IIFA 4EQPA 1N34Q 2YTXA 2B2UA 2PPBC 4X6AH 1SAPA 5IGFA 1KD1C 3PO2B 1NNXA 1KL9A 4BA2I 3STBC 1YVCA 1Q12A 2B29A 2PCFB 1CHPD 4GKKQ 1LT6D 1CI3M 2F3VA 2OEOA 3P75A 1E2WA 2K5HA 1T5XD 4ZKCB 1E1TA 3I4NB 1PH9A 2JSOA 3RZOB 2RCNA 3S2DH 2R7FA 1UE7A 4LF9Q 4K5WA 3EROA 3HOYB 3K59A 4TSSA 2F03A 3GV3A 5IODA 3AB9A 2KHSA 1PH4A 4LFAQ 2CW0C 3H3VH 4KY6A 2HCIA 4G7ZC 1HQMC 4JCVE 3G4SA 3CPFA 5LHY1 2VXWA 4A3EG 4JG2A 5JJZA 2JXMB 4B3TQ 2IX3A 3PUWA 2K5NA 2ALYB 4P2CB 2N8NA 1PRTD 1S40A 4OGQC 3K57A 3J80E 4A3FG 3TS0A 2Q8IB 2ZT9C 1FJGQ 5KNCA 2RDGA 5KNBA 1X3QA 2EYOA 3MVVA 4LFBQ 1EZ6A 2BH8A 1KRSA 5M5XH 3HOZH 4GN4B 4ZYSA 4HJAA 2EZVA 4NDXA 4A3DG 4U673 4R9WA 4L5QA 1X56A 2WINB 1TWFB 2HQEA 3HFZB 1BNZA 3MTSA 1DZ1A 5CV9A 2QA4A 4H02A 4AQYL 4LF8Q 5AFWA 3TN2A 2R7ZG 4A3CH 4GN5A 4C1NK 3RD4A 1Y1VB 2Z6KA 4KN7C 2HUGA 5IGCA 1MD2D 1XTCD 3NUCA 1WTPA 1KNAA 1QVCA 3J7AV 5KEEA 2ZJPA 4FF4A 4QMGA 4K8JA 3BS1A 1STAA 3PUZA 4JI7L 2WB1B 3NQTA 3VR6A 5IGDA 4ZLTF 1I94L 1QZGA 3NP8A 1K3BC 3Q0AA 2NUCA 5CGKA 1XMQQ 1QUQA 4UP9A 4BBSB 5BN5A 4OEMB 4EQ5A 1OXXK 2MO0A 1O7ZA 3OMGA 5DM63 2C9OA 1NE3A 1IYJB 3DUZA 4X65L 1J8IA 1HJPA 1LT5D 1UNSA 1SYEA 4QY7A 3PO3G 4PG3A 3LWUA 2L55A 4IPGA 2CCZA 2FMMA 5IP9G 3OSOA 4IOAA 4PMWA 1DGSA 1TU2B 3PV0A 1X32A 4Q5VA 1VDZA 5C0XJ 1EIHA 2D0OA 1PYBA 3F2CA 1EYDA 1X6OA 3M4OH 4A3JB 1X3GA 2VZAA 4ME3A 1YHBA 2F0QA 2CFMA 1XPOA 3UI2A 4G7OC 1ICFB 2YU9B 2XVSA 4C3IG 1S5FD 4QF4A 4K0KL 2F0HA 3BDOA 1F2YA 4OX9L 2MGSA 1UEAB 4POFA 1AZQA 4BY7H 4JI3Q 2BA0A 3CP0A 5GAHC 1VQ9A 5CR3A 2B8GA 3MXUA 5FLXL 1M90C 4DV1Q 3TREA 2Z4HA 4QJFA 1P16A 1SNCA 1Q82C 3SK4A 2AHOB 3LGJA 5F2DA 1SROA 2JYOA 3K6OA 1WTRA 3AMUA 3HKZG 1STYA 3R93A 2NBFA 3QB3A 4J6HA 4PMBA 4LWCA 1I5FA 4IZ8A 1Q1BA 4X3TA 3C3LA 4JI0Q 2L1BA 1E2VA 3VYRA 4AYBG 1HR0L 3NWSA 2EYHA 4GKJQ 1VMCA 1IBLQ 3PCOB 3HOUG 1PH5A 4BY1H 3J80i 1ET6A 1EZ8A 3I56A 4KD3A 3W1BA 4X64Q 4XT3B 1B3QA 1IYUA 2RDFA 1KAAA 2B63G 3K8AA 1U5KA 3ULPA 1MGSA 4M8AA 3KJPA 1Q8IA 1X3FA 2EDGA 1CM9A 3T56B 3D4RA 2SDFA 5M5XB 1NCVA 1GD7A 5ELNA 3HOWG 3J81L 1RJTA 2Q2TA 2NN6H 5FLXE 1TY2A 3G71A 2A69D 1SN8A 5EJWA 4XQNA 2K14A 4JI6Q 1XPUA 1GUGA 1Y69U 1NR2A 4JI5Q 1VQAA 4QIWE 2YYZA 2GVAA 1A3UA 1JOKA 1SJHD 1B9MA 2R3ZA 1A2UA 2WKDA 1AEXA 3E3XA 2IHEA 4JI4Q 2HT1A 1A8VA 1L1OC 1LM0A 4O0AA 4RAUC 4DGZA 2WAQE 3S1MH 1IBMQ 3TRZA 2R93H 3A8JE 5C4XG 4R4IA 2XNAC 3E6ZX 4PNYA 3HOZG 3M4QA 2L15A 2SEBD 3FEWX 4GN3B 1HNWL 4BWGB 4DR4Q 1EQQA 3KK7A 1PRTF 2DUDA 3RLOA 3MXGA 1A0IA 2A6EC 2YTYA 2D5DA 3A5UA 2VB3X 5C3EG 1MSGA 1V1PB 4XDXA 5IT9L 4N8X1 1D5MC 3HRZC 4LF7Q 3RMHA 2WP8J 4R4TA 3J81E 1UE6A 2F0KA 3H0GB 4A75A 3M4PA 1N32Q 4DR1Q 4ABNA 2MQHA 1CA5A 3T13A 4J8QA 3MHBA 3RUZA 3V2TA 1C8CA 2HQLA 3M7GA 2GA4B 4HTHA 1HZBA 3GTLB 1SNMA 4A3KB 5IGBA 1QNKA 2CH4A 4QL5A 1HNXL 1EQRA 1PH7A 3T1YL 3D8GA 2RHQB 2Q8RE 5DLQE 1SNOA 3LX0A 1U4MA 5CV5A 5ELOA 3S15H 1SDFA 2X6LA 4LFCQ 1Z47A 2JA6H 5ELBA 1W6KA 4BY7B 4OWTB 2F4VQ 4CDEC 2LSSA 2JN4A 1EY7A 1V1QA 1JJGA 2H5XA 1FNWA 1K9MC 2NWGA 2EE1A 1HXYD 5EKKA 4BA1I 2F0LA 4I65A 1JC7A 5C0XG 4A3BH 2VUMH 4C3HH 5IT9E 4LNQA 1JJCB 2BCOA 1EY6A 1GHJA 2E75C 1HZCA 2Z6BA 1NSNS 5C5MA 1I4HA 5HGQA 4JK1C 2CWAA 4KHVA 3NBHA 3RZDH 1IYVA 1D5ZC 4BY1B 4IPCA 3HEJA 3H94A 2KCCA 3NBHB 1Q86C 5K36H 5BN3A 2YTVA 5E4WC 3S17H 3P1HA 1GUWA 1AFPA 5FJ8G 1V8QA 1E0BA 4IUTA 3EQLC 3IKJA 2RSOA 4RHSA 1DJRD 4QUFA 3T16A 4IFDH 4F88A 1J9OA 2BDOA 3GTMH 2KEDA 4HMIA 4HR7B 3GTPH 4B3SL 1GUOA 5JVH3 1C9OA 1WTVA 1HA5A 1RIPA 4IUVA 1U0LA 4GOPB 1LV9A 3I8ZA 4X3SA 2NVTH 5J39A 5IWAL 4LF6L 5KIXA 3Q8DA 2AWOA 2FMCA 4HIOA 3OHXC 1CFMA 1RF2D 2EOTA 1SXTA 5K5PA 3TZDA 1WD0A 3QO2A 4K5VA 2HHHL 2EYMA 1GM5A 1SR3A 4Y7NB 3T1HL 1SE2A 1B4OA 2IT1A 4Y52H 2I07B 4AQYQ 5KYLA 2F0WA 3S14H 4IUPA 3PO2H 4OO1H 1CKOA 2IPKD 2K28A 3K5NA 3MXNA 3NTIA 4FNFA 3S1MB 1YZ6A 4K6LA 1M4VA 2G9HD 3MXNB 3HG9A 1WFQA 1KLGD 1Q3LA 2KVMA 1LTLA 4IALA 4JI7Q 3MA2B 1A62A 3I4NH 1I94Q 1TXYA 3RZOH 3FKIH 3J81i 1Q90A 4A3MH 1EYGA 1E7ZA 2P5ZX 3V05A 3AFPA 3SK8A 4DR6L 4JYAL 1HUNA 4XYQA 3CCQA 1QG7A 2Z0SA 3I3CA 2QGQA 1QJOA 4HIMA 4IOCA 4XIGS 1Y8PB 3M85A 4EQNA 1O7LA 1VQHA 1Q81C 4A3GB 1CHQD 3SXHA 1WTWA 1SMYD 2KENA 3SGIA 4OXPA 2ATWA 2R93G 3DM3A 1VS0A 2RA4A 1XPRA 4QUCA 1S5ED 2A6HC 4PZ6A 5C44B 4TVAB 1YJNA 3EN2A 1RODA 2IY5B 2A68D 2BE5C 2D2CC 2FFKB 1G8ZD 4IFDI 1TY0A 2Q2UA 3DLLA 1I4QA 1EFWA 2JA8B 2EXDA 4NPSA 2WB1E 3CCSA 4DXFA 1SNQA 2LXJA 1GXDC 3RN5A 4RA8A 4RHRA 4KK7A 3PIPA 1H9RA 3DXJC 4GLVB 4NMZA 2F0SA 1CZGA 4K0KQ 4OX9Q 3M9BA 1C7YA 2XN9C 2B2WC 2KECA 1N9WA 1T5EA 2EY1A 1NAPA 4F87A 3CMEA 1H9JA 1EY9A 3BVMA 2MP1A 4JPBW 1GO3E 3G6EA 4A3BB 4C3HB 2C35B 3TS2A 3U4VA 4FP5D 1ET9A 3GV6A 3RN2A 3BYTB 2MUYA 4IUQA 4TQUS 5IP7H 3R2IA 2QILA 1VQLA 2NVQB 2EY6A 1KHIA 2EPBA 1YNJC 2PQEA 4I7AA 5I2XA 1W2BA 1PTOH 1BCPF 4NB3A 3W1GA 1HR0Q 2PO4A 3RZDB 1ZYRC 5JPNC 1EWCA 4DAMA 1I4GA 3K5MA 3HKZE 1VQIA 3QOLA 1VQ5A 3S17B 1B3AA 4NXNL 4BBSH 2F0NA 3K5LA 2L9HA 1BXTA 3T53B 4AYBE 1CZWA 1SLJA 3I91A 2HD3A 5ELEA 1DCZA 1IZ6A 2K5VA 4IO9A 2OTJA 1VQPA 3E5SA 3STBD 4A3IB 4L8JA 2ZJRA 1HFNA 3NTKA 2WFWA 3A5ZB 5FLXc 1LO5D 2UUCL 1NMFA 1ICWA 1VQDA 5ELFA 1WCMH 4DK0A 3H91A 2Z8LA 4HSVA 1TS3A 4JI2L 4IN3A 3CCJA 2I0QA 1JQYD 4A93H 2B2VC 3C1FA 4OELB 2RVLA 1TWCB 1JWSD 3L3OC 5J1ZA 3GTGH 3ONAB 3KBGA 1CSQA 4A3JH 1CA6A 1IBKL 5KNDA 4G57A 2CW0D 4RG1A 1ZEQX 5ELDA 1SYBA 5D3IB 3EFXD 4DAPA 1T9HA 2I5MX 2YU9H 1OTCA 5LMNW 5IE8A 4ALPA 3S14B 1PH8A 3BVGA 1N33L 1L2FA 2JA5H 1PZKD 1D6EC 2FHTA 1JB3A 3WDNA 2MFIA 4H7BA 5JJLA 4DV6L 1QE6A 3CPWA 1PHJA 5A35A 1P8LA 4CKEA 1K0SA 1SBBB 1KTKA 3FKIB 4YWLA 1G2TA 1J6QA 3J81c 2Q2IA 1B9NA 4A3MB 4DR3L 1HNWQ 4A3EB 1YHAA 2RHSB 4LMQD 4NXML 1SYDA 2ZXPA 1ESRA 4GS3A 1I6VC 2B2TC 3F2UA 4K5XA 2UXDQ 1F2LA 3UDFA 3C2PA 3CRLC 3PO2G 4FDBA 4JBJA 4BBRH 1TWGB 4DF7A 1YITA 1XYIA 4DR5L 3CCLA 1B70B 2I46A 1XNQL 3NSWA 2E2DC 3I4NG 3MXPA 3GTQH 1WTHA 3NHHA 3GDEA 1HNXQ 3T1YQ 1DOKA 1N36L 3SK6A 3X3NA 3HOYG 2R7ZB 3F2DA 3I4MG 2NTTA 3PF4A 4HJ9A 1D1IA 1EFID 1AH9A 3GD7A 1KABA 1VQCA 3M4YA 3OTOL 1D1KA 5DNFA 1YNND 5IT9c 2D9UA 4J1MA 4C3JG 4ZK9B 4JI1L 1TWHH 2BDNA 1FYCA 1S5DD 5C3WA 1ZXTA 1CQFA 2CQAA 3VYUA 4L63B 1SFOB 2F0DA 3HS0C 1WTOA 1OXUA 2K1BA 2K4KA 5T1GA 2EYPA 4DUYL 3Q6SA 1IL8A 4HJ5A 4HIKA 2Z4IA 1R9TH 4EVOA 5CV7A 3CC4A 1LTGD 1PTOB 1MJEA 2R6GA 3SR1A 4B3ML 3NK9A 1VQ8A 1XNRL 1KDBA 1K8MA 4O2DA 2JEAI 3PGZA 1VQJA 2ICEC 4RFBA 4DUZL 1KRTA 3MWYW 3HOXG 1ENCA 4NP5A 1K0RA 2AWNA 2NVYB 1IHZA 2EVBA 2WACA 3NWTA 1PRTC 3FRPB 4HN7A 5KGUA 4NW2A 4OL7A 5EBCA 2PMZB 3ND9A 1GUSA 2LXKA 4ILWA 4CJ1B 1D2BA 1EWIA 2XSCA 1Y1VG 4K2LA 5GQOA 1STGA 4K8IA 1E22A 3H0GH 4OWXB 2CQOA 1WCMB 5M3FB 2B2UC 1KLUD 3CC7A 3ERQA 5IP7G 2HCCA 5D14A 1XWEA 4A93B 2DN8A 3O13A 4R8NA 4AIMA 2WB1G 2IW3A 3KBXA 2H4OA 2V1CC 3GTLH 1VQNA 2JQOA 2D62A 3GTGB 3D6CA 3ER0A 4LUOA 4A3KH 1PFNA 2QEXA 1L1OA 1LTID 3CCEA 4WRDA 2VQFL 2PNRC 4LF6Q 1L1OB 4BBSG 2JA9A 4J15A 2B39A 5C4ZA 4G7HC 1PMRA 4X62L 4IPDA 1D5XC 2F0PA 1XJVA 1Q46A 2PQAA 1HRJA 3NELA 4EGVA 2HHHQ 2OF1A 4R1JA 2JA5B 2PQAB 2R61A 4BXXG 1JCKB 1MIUA 3T1HQ 4DNTB 1I3QB 4LUZA 2L11A 1PTOD 1GJXA 1Y1WB 2OWOA 2M2LA 1JJ2A 3RLFA 4XXEA 4NKLA 5E3FA 3GQBA 2JA7H 3AQQA 2UXCL 3ULJA 4R8IA 3GTKB 4GZYC 3SVMA 3KFUA 4CGYB 2GN5A 3QWNA 3C46A 1ONLA 3V96A 4L5TA 3L0OA 5IYBH 3HOUB 1PYWD 1V1OA 2OXPA 2WV6D 1NY4A 3DEOA 4ZQ3A 4L6TB 2QDBA 1J5EL 4UP8A 1K73C 5J3BA 2B63B 5CMDA 4E6IA 3W3AA 1ILPA 1JB7A 4DR6Q 1EOTA 2B2YA 2EYLA 4CBVA 4ULLA 2A19A 5I9OA 4BBRB 4JYAQ 5JAVA 2Y0SB 4WFN3 1OXTA 1IW7D 1AN8A 1B1ZA 3PQIA 4DR7L 4DNIA 4FF2A 1O80A 2Z9HA 4ODGA 3GTQB 2F3WA 1I6HH 4JBWA 4HEDA 2EJMA 1EY8A 4JOIC 4TRDA 3S16B 2D0PA 1VQBA 4DR2L 5JEAJ 5EBDA 1ESFA 1SE8A 1AE2A 5JEAH 2ICIA 2SOBA 3DWAA 1SEBD 2J7ZA 3TP5A 1HZAA 4IUNA 4JC0A 4DV0L 1HQRD 5M3MB 1QCBD 3S24A 3R2TA 5IGEA 5IYDH 2AQ2B 2K04A 1TWHB 4LW1A 1MKHA 1BR9A 2QW7A 1BVSA 4Y7NH 5FLMH 5C4XB 3R3OA 3W2DA 3FPPA 4KKUA 5I6WA 1JT8A 1WTXA 1Z7TA 1E2ZA 3D6WA 2R92H 1N34L 1R9TB 1BOSA 2B8FA 5C3EB 3CRKC 2CH4W 3GTOB 3FVQA 4ZRZA 4KKTA 3OWFA 3KLRA 3PUXA 1G6PA 1A63A 4MIUA 1A6XA 1K8AC 1F9QA 1AP0A 3AFQA 2F0EA 1V1PA 3TP8A 5GADC 4GKKL 3B6YA 4RKLA 1VF5C 4KJNA 3A7LA 2F0FA 1QVFA 4WJ3M 4A3CG 1TKWB 5CV4A 4O42A 3ND8A 4KY5A 4DV4L 2MNAA 4GNXC 4HCEA 3BVZA 3D31A 4CDDC 1VQ7A 3HOVH 2Z1CA 4YWMA 4RCNA 2XRSD 4YCVA 4UAIA 4YY3L 4A3GH 1CSPA 3A0JA 2A69C 1S4ZA 3MEFA 2UUCQ 1K3RA 3X3MA 4LFAL 4V190 4DV7Q 4B08A 5M5WH 1EIGA 2F4IA 4QGUA 2ID0A 5C44H 4CDCC 3FPUB 1STBA 1YJWA 4B3TL 2LMCB 2PI2A 2JA8H 2O2LD 4X3KA 3HP3A 1YNXA 3BG3A 3I72A 1IBKQ 2GVBA 2SNSA 3DWQA 2O5JC 1E1OA 3MFGA 4LFBL 4PQXA 1MJCA 3H0GG 4KD4A 3H3VC 4CKBA 1VCIA 2VB2X 2JA7B 2RF4A 5BN4A 1WD1A 3EVQA 4WORA 1XX8A 1JR0D 1G2SA 1PZJD 5M5YH 4A3KG 4M1UB 5CBAE 1DYQA 1G291 5M9OA 3S1NB 3OIPA
chains in the Genus database with same CATH topology
5EPLA 1TS4A 4ZUIA 1LABA 1FD7D 1QB5D 2BA1A 1CK1A 5C5LA 1BCPC 4B9WA 5CYUA 2VNUD 1STHA 1S5BD 3Q23A 2EY5A 2E76C 4IFDJ 4QB4A 1DOMA 2L4NA 3H6MA 5J22A 4F8MA 2B2WA 1PDQA 1I6HB 2PZTA 2F0UA 3IAYA 1DONA 1EYAA 5CC4A 1ENFA 4FF3A 2DNEA 2WIIB 2TSSA 5EPKA 2KUMA 2KQ3A 1OXVA 2EJFC 4B9XA 4FXKC 1L0YB 1EY4A 3S1QB 4RGNA 4O1NA 5TSSA 2PZUA 2A73B 1TWAB 2AUKA 5EKIA 5FKAC 3DEPA 2R92B 3QIAA 1SSOA 5LL6X 4DAVA 1HCZA 1EQVA 1TR5A 5JEAG 2NN6G 1SE4A 1TS5A 1XXGA 4KV6A 4S3SA 2QF7A 1G6ZA 1JORA 1Z6HA 2QCPX 3GTJB 2F0VA 3T51B 2ZXOA 2M00A 3HOVB 4Z9CB 1F9RA 2EJGC 1OXSC 4K6DA 2QKIC 1R4PB 1IKMA 5A2QL 4QIWB 5M5WB 1K83B 2JEBI 4C2MB 4WJWA 4BS9A 3URYA 3CQZB 5KYIA 2PZWA 2IX0A 2F0OA 1CTMA 2WAQB 4UDUC 3S1RB 1QWYA 5C6AA 5CV8A 1B50A 3SK5A 1F9SA 2LS01 3A56A 1EWHA 1S5CD 3KLSA 1DD2A 4DA2A 1EEFD 2PW5A 2PW7A 5M5YB 1EEID 2XWJB 2K05A 4XYOA 2NTSA 2M9VA 1BF4A 5FO8B 3L7ZC 2ENBA 1DOLA 1KDAA 4EQOA 1ZKOA 1L0XB 3MEHA 5C4HA 5A2QE 4ID6A 5IGGA 1SMYC 3K58A 1QNUA 5I2YA 1RDPD 5T1IA 4ZKBB 2FJ2A 2OT2A 3U9OA 3VR5A 1FNUA 1OO9B 5CV6A 1EL0A 2PYKA 1RHPA 3TDQA 2KJXA 3K5OA 4C3HG 1LTSD 3MC0B 4F7XA 1TT2A 2IWHA 3G7LA 3P20A 1BBXC 1C4QA 5I6YA 3S9WA 1JE4A 1LTBD 4RGTA 1STNA 4KJOA 4N9TA 3ZYYX 1DXMA 1EU4A 5K36G 5EKLA 1EY0A 5CBEE 2IJ0A 3VYTA 3JAME 4IFDG 1Q1EA 4KI0A 3J7AF 2A5HA 2N55A 4C1NI 2XIWA 3Q22A 1PRTB 5FO9B 3TP6A 3SE0A 4LAAA 3C1EA 4QCLA 5FO7B 1A2TA 3GP7A 1I4RA 4IUUA 3HGBA 3QJYA 3K7AB 3J7YW 3OPOA 1KNEA 1U4LA 1IKLA 1UAPA 1B53A 1H9SA 4FXDA 1C48A 1H9SB 2MHVA 2E2HB 4DFAA 4A3FB 1JOOA 4OO1G 1SYFA 1AZPA 3N6RA 4FVMA 1SE3A 2J0TD 2J4XA 1GUNA 3I4MB 4HSPA 4A3DB 1BDOA 3FMCA 1TIID 4RGOS 3CHBD 1JWUD 2F0IA 5JVG3 1M8AA 4I7ZC 2K5WA 4C3JB 1F9PA 5E4XA 4C56C 4HCSA 4CHTB 4KN4C 4LK1C 4Q0FA 5IOCA 5I4DA 2K5QA 2NVXB 1X3PA 3LNNA 3MAQA 3HOXB 1PLFA 1I50B 3N52A 1LTAD 2E2JB 3PO3B 4RH6A 3VA7A 4HMJA 5C4JB 2DY7A 1TS2A 1CQVA 1PXUA 3NTHA 1R4QB 4H13C 3QOJA 5D65A 5NUCA 3IFTA 3H09A 4PMCA 1FNVA 3DMUA 1TQOA 4OHJA 2RDHA 5LL6S 4C3IB 1YNNC 3S2HB 4CKCA 2AUJD 4H44C 1V43A 1EQTA 3BZDB 1LACA 2EY2A 1SJED 3PUYA 3VR4A 3OMCA 1EY5A 2RSNA 1F2MA 2QEJC 4DU9A 1U9RA 2TMPA 5JOBA 5C0XH 3HKZB 4AYBB 5EGTA 5DM73 3AU7A 5I9PA 3SEBA 1LTRD 4DNRB 2IX1A 2H1EA 1PFMA 2O4XA 1VMPA 1RTOA 2DY8A 2E2IB 4OIJA 3T4AC 3D4WA 1I4PA 4CJ0B 3A54A 3S2DB 3HOWB 1HFGA 1TVXA 5HGTA 2MPMA 1W6JA 5EQ0A 2F0TA 4FF1A 4FXGC 2EYJA 2K01A 2SNMA 4MHEA 2A6ED 3TSSA 4KY7A 1O78A 3NQIA 1PTOC 3D4DA 3VR2A 1JWMD 1RCVD 1GOZA 1HUMA 3OOCA 3TP7A 4OIKA 4CJ2C 3HOZB 2XRQD 1STEA 1BCPB 3NBIA 3LWEA 3Q24A 2L12A 1A15A 1A3VA 1BUVT 2JP1A 5C0XI 3I73A 3U9SA 1GUTA 1K8OA 5COYA 4KHZA 2DNCA 5DEHA 3HZXA 1IW7C 1HHVA 1RKNA 1UUPA 1VF7A 3BDCA 2LKVA 3VR3A 1RTNA 3BYYB 2AQ1B 3M7NA 4KTAA 1B44D 4U68A 4IQZA 2BOSA 2X69A 2KCNA 5G3LD 1BO0A 3OWEB 1RD9D 5KRUA 5ELCA 1PFBA 1JICA 1MI2A 3G6JB 1JOQA 4K14A 3D3RA 3CKIB 1BCPD 2MJ8A 3CU7A 2NZ1D 2KA7A 4XT1B 2KEEA 4YIJA 1MBYA 3M4OB 3TMEA 2F0MA 3OW7A 1ENAA 3DWPA 2IL8A 2FINB 2B2YC 4G4KA 1LT3D 3I90A 3NPPA 3FDTA 3TBIB 4DN4M 3A8IE 3R8BA 1EU3A 2NN6I 2CHBD 3P7JA 5C3XA 2RBMA 1LLRD 2WKCA 1SYGA 1MSHA 2XWBB 1BQQT 4DAYA 4V0BA 1DM0B 1HTLD 4ZAIA 1NUCA 1F2ZA 3NE5B 1AW7A 1ILQA 2EXZA 1PTOF 2L5TA 3BDLA 2ZXRA 5EPJA 4H0LC 1WVLA 2F1MA 1Y8NB 1Y8OB 4HAEA 2C5CA 5FOBB 1LT4D 2F0GA 4IURA 1U4PA 3E0JA 1LTTD 5D3DA 4KKSA 3GO5A 4RWSC 4X3UA 3EJIA 2L0CA 2A6HD 1QILA 1HPCA 2BE5D 2JE6I 3WOFA 3A8KE 1WTQA 3TZUA 2B2VA 3OIQA 2NYZD 4TKOB 1EYCA 2E74C 2G9DA 2R93B 2EYFA 1CT1D 4N9PA 4RKBA 4XQQA 2AQ3B 3K0YA 3A55A 3PMFA 5JPMC 2Q8TA 1QOHA 2K6AA 4PV1C 4FYDA 3PIO3 2HDMA 2K7VA 5E1FA 4LJZC 4MN3A 2K32A 1YNJD 4XTCS 3SHLA 1SYCA 3I70A 1ZYRD 3VA5A 4KMUC 1U4RA 3ITPA 2K03A 4DXGA 3SDZA 5HURA 3M3YB 2KOLA 1FR3A 1B2TA 2F0JA 2B2TA 2O5IC 1HTPA 2A74C 3S15B 2JA6B 1O7YA 3KUPA 3VYSA 3IFDA 3JAML 3I4LA 1F77A 2CVRA 5G3LF 3MZ5A 1SNDA 4XQJA 2N88A 1H9KA 2VUMB 1FGBD 4ZUJA 3PUVA 1HA6A 3PIP3 1I4XA 1PZID 1SNPA 3EA6A 4OO1I 2A68C 2V4DA 1G91A 3L9AX 4K2KA 2RQXA 3DM1A 3NXWA 3DHQA 5FK9C 3A7AB 1ML0D 2NB0A 3IL8A 2K33A 5ISRA 2RKSA 4RCOA 5CORA 2LFNA 3GTMB 4DK1A 1H9MA 1GHKA 3GTPB 3QG1A 3KF8A 4FO2A 2LY7A 4RGMA 1A3TA 2HDLA 2NVTB 1II3A 2K5DA 3WOEA 1NR4A 2X6GA 5DAUA 3KLSX 3MFYA 1KDCA 4ME5A 3J80L 5IIFA 4EQPA 2B2UA 2PPBC 1SAPA 5IGFA 3PO2B 4BA2I 1Q12A 2PCFB 1CHPD 1LT6D 1CI3M 2F3VA 2OEOA 3P75A 1E2WA 1T5XD 4ZKCB 3I4NB 2JSOA 3RZOB 4K5WA 3EROA 3HOYB 3K59A 4TSSA 2F03A 3GV3A 5IODA 3AB9A 2KHSA 2CW0C 4KY6A 2HCIA 4G7ZC 1HQMC 5LHY1 2VXWA 5JJZA 2JXMB 2IX3A 3PUWA 4P2CB 1PRTD 4OGQC 3K57A 3J80E 2Q8IB 2ZT9C 5KNCA 2RDGA 5KNBA 1X3QA 2EYOA 3MVVA 1EZ6A 4ZYSA 2EZVA 4NDXA 4U673 4R9WA 2WINB 1TWFB 2HQEA 1BNZA 1DZ1A 3MTSA 5CV9A 5AFWA 3TN2A 4C1NK 3RD4A 1Y1VB 4KN7C 2HUGA 5IGCA 1MD2D 1XTCD 3NUCA 1WTPA 1KNAA 3J7AV 5KEEA 4FF4A 4QMGA 4K8JA 3BS1A 1STAA 3PUZA 2WB1B 3NQTA 3VR6A 5IGDA 4ZLTF 3NP8A 3Q0AA 2NUCA 5CGKA 4BBSB 5BN5A 1OXXK 1O7ZA 3OMGA 5DM63 2C9OA 3DUZA 1J8IA 1LT5D 1UNSA 1SYEA 3LWUA 2L55A 2FMMA 3OSOA 4PMWA 1TU2B 3PV0A 1X32A 4Q5VA 1VDZA 5C0XJ 1EIHA 1EYDA 4A3JB 2F0QA 3UI2A 4G7OC 2YU9B 2XVSA 4C3IG 1S5FD 4QF4A 2F0HA 3BDOA 1F2YA 2MGSA 1UEAB 1AZQA 2BA0A 5CR3A 2B8GA 3MXUA 5FLXL 2Z4HA 1SNCA 3SK4A 5F2DA 2JYOA 3K6OA 1WTRA 3AMUA 1STYA 3R93A 2NBFA 3QB3A 4J6HA 4PMBA 3C3LA 4IZ8A 1Q1BA 4X3TA 2L1BA 1E2VA 3VYRA 3NWSA 2EYHA 1VMCA 1ET6A 1EZ8A 4KD3A 4XT3B 2RDFA 1IYUA 1KAAA 1MGSA 4M8AA 1Q8IA 2EDGA 1CM9A 3T56B 3D4RA 2SDFA 5M5XB 1NCVA 3J81L 1RJTA 2NN6H 5FLXE 1TY2A 2A69D 5EJWA 4XQNA 1GUGA 1Y69U 1NR2A 2YYZA 1A3UA 1JOKA 1SJHD 1B9MA 2R3ZA 1A2UA 2WKDA 1AEXA 4RAUC 4DGZA 3A8JE 2XNAC 3E6ZX 4PNYA 2SEBD 3FEWX 4BWGB 3KK7A 1PRTF 3MXGA 2A6EC 2D5DA 2VB3X 1MSGA 1V1PB 4XDXA 5IT9L 1D5MC 3HRZC 3RMHA 2WP8J 3J81E 2F0KA 3H0GB 4ABNA 1CA5A 3T13A 4J8QA 3MHBA 3RUZA 3V2TA 1C8CA 3M7GA 2GA4B 4HTHA 3GTLB 1SNMA 4A3KB 5IGBA 1QNKA 3D8GA 2Q8RE 1SNOA 3LX0A 1U4MA 5CV5A 1SDFA 2X6LA 1Z47A 5ELBA 1W6KA 4BY7B 1EY7A 1FNWA 2NWGA 2EE1A 1HXYD 5EKKA 4BA1I 2F0LA 4I65A 1JC7A 5C0XG 5IT9E 2BCOA 1EY6A 1GHJA 2E75C 1NSNS 5C5MA 1I4HA 4JK1C 4KHVA 3NBHA 1IYVA 1D5ZC 4BY1B 3HEJA 3H94A 2KCCA 5K36H 5BN3A 5E4WC 3P1HA 1GUWA 1AFPA 1V8QA 1E0BA 4IUTA 3EQLC 3IKJA 2RSOA 4RHSA 1DJRD 4QUFA 3T16A 4IFDH 4F88A 1J9OA 2BDOA 2KEDA 4HMIA 4HR7B 1GUOA 5JVH3 1WTVA 1HA5A 4IUVA 1LV9A 3I8ZA 4X3SA 5J39A 5KIXA 2AWOA 2FMCA 3OHXC 1CFMA 1RF2D 2EOTA 1SXTA 5K5PA 3TZDA 1WD0A 3QO2A 4K5VA 2EYMA 4Y7NB 1SE2A 1B4OA 2IT1A 2I07B 5KYLA 2F0WA 4IUPA 4OO1H 2IPKD 2K28A 3K5NA 3MXNA 3NTIA 4FNFA 3S1MB 4K6LA 1M4VA 2G9HD 3HG9A 1KLGD 1Q3LA 2KVMA 4IALA 3MA2B 1Q90A 3V05A 3SK8A 1HUNA 4XYQA 1QG7A 3I3CA 1QJOA 4XIGS 1Y8PB 3M85A 4EQNA 1O7LA 4A3GB 1CHQD 3SXHA 1WTWA 1SMYD 2RA4A 4QUCA 1S5ED 2A6HC 5C44B 1RODA 2A68D 2BE5C 2D2CC 2FFKB 1G8ZD 4IFDI 1TY0A 1I4QA 2JA8B 4DXFA 1SNQA 1GXDC 4RA8A 4RHRA 4KK7A 1H9RA 3DXJC 4NMZA 2F0SA 1CZGA 2XN9C 2B2WC 2KECA 1T5EA 2EY1A 1NAPA 4F87A 1H9JA 1EY9A 3BVMA 2MP1A 4A3BB 4C3HB 4FP5D 1ET9A 3GV6A 3BYTB 2MUYA 4IUQA 4TQUS 3R2IA 2QILA 2NVQB 2EY6A 2EPBA 1YNJC 2PQEA 5I2XA 1PTOH 1BCPF 2PO4A 3RZDB 1ZYRC 5JPNC 1EWCA 1I4GA 3K5MA 3QOLA 3S17B 1B3AA 2F0NA 3K5LA 2L9HA 1BXTA 3T53B 1CZWA 3I91A 5ELEA 1DCZA 3E5SA 4A3IB 4L8JA 1HFNA 3NTKA 1LO5D 1ICWA 5ELFA 4DK0A 3H91A 2Z8LA 4HSVA 1TS3A 4IN3A 1JQYD 2B2VC 3C1FA 2RVLA 1TWCB 1JWSD 3L3OC 5J1ZA 3ONAB 3KBGA 1CA6A 5KNDA 4G57A 2CW0D 1ZEQX 5ELDA 1SYBA 5D3IB 3EFXD 4DAPA 3S14B 3BVGA 1PZKD 1D6EC 2FHTA 1JB3A 3WDNA 4H7BA 1QE6A 5A35A 4CKEA 1SBBB 1KTKA 3FKIB 1G2TA 1B9NA 4A3MB 4A3EB 4LMQD 1SYDA 2ZXPA 1ESRA 1I6VC 2B2TC 3F2UA 4K5XA 1F2LA 3C2PA 3CRLC 1TWGB 4DF7A 1XYIA 2I46A 3NSWA 2E2DC 3MXPA 3NHHA 1DOKA 3SK6A 3X3NA 2R7ZB 2NTTA 1D1IA 1EFID 3GD7A 1KABA 3M4YA 1D1KA 5DNFA 1YNND 2D9UA 4J1MA 4C3JG 4ZK9B 2BDNA 1FYCA 1S5DD 5C3WA 1ZXTA 1CQFA 2CQAA 3VYUA 4L63B 1SFOB 2F0DA 3HS0C 1WTOA 1OXUA 2K1BA 5T1GA 2EYPA 3Q6SA 1IL8A 2Z4IA 4EVOA 5CV7A 1LTGD 1PTOB 2R6GA 3SR1A 3NK9A 1KDBA 1K8MA 2JEAI 2ICEC 4RFBA 3MWYW 1ENCA 4NP5A 2AWNA 2NVYB 1IHZA 2EVBA 2WACA 3NWTA 1PRTC 3FRPB 4HN7A 5KGUA 4NW2A 4OL7A 5EBCA 2PMZB 3ND9A 1GUSA 4ILWA 4CJ1B 1D2BA 2XSCA 4K2LA 1STGA 4K8IA 1WCMB 5M3FB 2B2UC 1KLUD 3ERQA 2HCCA 5D14A 1XWEA 4A93B 2DN8A 3O13A 4R8NA 3KBXA 2IW3A 2H4OA 2D62A 3GTGB 3D6CA 1PFNA 1LTID 4WRDA 2PNRC 5C4ZA 2B39A 4G7HC 1PMRA 1D5XC 2F0PA 1HRJA 4EGVA 2OF1A 2JA5B 2R61A 1JCKB 4DNTB 1I3QB 2L11A 1PTOD 1GJXA 1Y1WB 2M2LA 3RLFA 4XXEA 4NKLA 5E3FA 3GQBA 4R8IA 3GTKB 4GZYC 3SVMA 4CGYB 3QWNA 3C46A 1ONLA 3V96A 3HOUB 1PYWD 1V1OA 2OXPA 2WV6D 3DEOA 4ZQ3A 4L6TB 2QDBA 2B63B 5CMDA 4E6IA 3W3AA 1ILPA 1EOTA 2B2YA 2EYLA 4CBVA 4ULLA 5I9OA 4BBRB 5JAVA 2Y0SB 4WFN3 1IW7D 1OXTA 1AN8A 1B1ZA 4FF2A 1O80A 4ODGA 3GTQB 2F3WA 4JBWA 4HEDA 2EJMA 1EY8A 4TRDA 3S16B 5JEAJ 5EBDA 1ESFA 5JEAH 2ICIA 2SOBA 3DWAA 1SEBD 3TP5A 2J7ZA 4IUNA 1HQRD 5M3MB 1QCBD 3R2TA 5IGEA 2AQ2B 2K04A 1TWHB 1BR9A 5C4XB 3R3OA 3W2DA 3FPPA 4KKUA 5I6WA 1WTXA 1Z7TA 1E2ZA 3D6WA 1R9TB 1BOSA 2B8FA 5C3EB 3CRKC 3GTOB 3FVQA 4ZRZA 4KKTA 3OWFA 3KLRA 3PUXA 1A6XA 4MIUA 1F9QA 1AP0A 2F0EA 1V1PA 3TP8A 4RKLA 1VF5C 4KJNA 3A7LA 2F0FA 1TKWB 5CV4A 4O42A 3ND8A 4KY5A 4HCEA 3BVZA 3D31A 2Z1CA 4RCNA 2XRSD 4UAIA 2A69C 1S4ZA 3X3MA 4V190 4B08A 1EIGA 2F4IA 2ID0A 3FPUB 1STBA 2LMCB 2O2LD 4X3KA 3HP3A 3BG3A 3I72A 2SNSA 3DWQA 2O5JC 3MFGA 4PQXA 4KD4A 3H3VC 4CKBA 1VCIA 2VB2X 2JA7B 5BN4A 1WD1A 3EVQA 4WORA 1XX8A 1JR0D 1G2SA 1PZJD 4M1UB 5CBAE 1DYQA 1G291 5M9OA 3S1NB 3OIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNY A;  4K2L A;  4QF4 A;  3T16 A;  5EKL A;  1EY0 A;  1STG A;  4K8I A;  2F0H A;  4NMZ A;  4ZUI A;  4K2K A;  1F2Y A;  2F0S A;  5IGE A;  3NXW A;  3DHQ A;  3ERQ A;  4HMI A;  4YIJ A;  5HGT A;  2EYO A;  3MVV A;  4R8N A;  1SYD A;  2EY1 A;  5CR3 A;  1EZ6 A;  4HMJ A;  3R3O A;  5C5L A;  2F0T A;  5I6W A;  3D6C A;  2F0M A;  1EY9 A;  1EYC A;  3TME A;  2PZW A;  5KYI A;  1ENA A;  2EYJ A;  5J39 A;  3TP6 A;  4K5X A;  4WRD A;  4B9W A;  5KIX A;  4LAA A;  2EYF A;  3C1E A;  5ISR A;  1SNC A;  4N9P A;  4NDX A;  2RKS A;  2SNM A;  2F0O A;  1A2T A;  3QOJ A;  4RKB A;  3SK4 A;  1STH A;  2F0K A;  5F2D A;  5C4Z A;  2EY5 A;  5K5P A;  4KY7 A;  4QB4 A;  1STY A;  2F0P A;  3H6M A;  4PMB A;  3QB3 A;  4J6H A;  5NUC A;  2EY6 A;  3MHB A;  3PMF A;  3D4D A;  2EYM A;  2HQE A;  4IZ8 A;  4K5V A;  5CV8 A;  3RUZ A;  2PQE A;  3V2T A;  5CV9 A;  4F8M A;  3OWF A;  3SK5 A;  4PMC A;  2OF1 A;  4HTH A;  1SNM A;  3TP7 A;  4MIU A;  2PZT A;  2EYH A;  2F0U A;  3MXP A;  1A3T A;  3DMU A;  1EYA A;  5IGB A;  2F0E A;  5CC4 A;  1TQO A;  3TP8 A;  5KYL A;  3QOL A;  2F0W A;  5E1F A;  5IGC A;  1II3 A;  4RKL A;  5C3X A;  2RBM A;  4KJN A;  3NHH A;  3NUC A;  2F0N A;  3D8G A;  2F0F A;  3SHL A;  1SYG A;  1SYC A;  2PW5 A;  2KQ3 A;  2PW7 A;  5DAU A;  4NKL A;  4DFA A;  1KDC A;  1SNO A;  5E3F A;  4ME5 A;  5CV4 A;  1EZ8 A;  3SK6 A;  4B9X A;  5KEE A;  4QMG A;  3LX0 A;  4K8J A;  1JOO A;  1EY4 A;  5CV5 A;  1SYF A;  3E5S A;  1STA A;  4KD3 A;  1A3V A;  4KY5 A;  3NQT A;  5IIF A;  2RDF A;  4EQP A;  1KAA A;  3VA5 A;  5IGD A;  2ENB A;  4IAL A;  2EY2 A;  1KAB A;  3ITP A;  1KDA A;  3NP8 A;  2OXP A;  4EQO A;  5HUR A;  2NUC A;  3OMC A;  5CGK A;  1EY5 A;  2PZU A;  1F2M A;  3MEH A;  4J1M A;  4ZQ3 A;  4DU9 A;  5IGF A;  1U9R A;  5C4H A;  5DEH A;  2QDB A;  1NUC A;  1F2Z A;  1EY7 A;  3HZX A;  4ID6 A;  1RKN A;  5JOB A;  3BDC A;  3SK8 A;  2F0J A;  2LKV A;  3C1F A;  4E6I A;  5IGG A;  5C3W A;  3T13 A;  2F0I A;  2EXZ A;  2F0D A;  3OMG A;  1STB A;  2EYL A;  5J1Z A;  2F3V A;  2OEO A;  3BDL A;  3P75 A;  5EKK A;  4KTA A;  3U9O A;  5I9O A;  2F0L A;  4I65 A;  5JAV A;  1SYE A;  4EQN A;  2EYP A;  5EGT A;  5CV6 A;  1TR5 A;  1EQV A;  4G57 A;  4DF7 A;  1EY6 A;  2PYK A;  3SXH A;  5I9P A;  4EVO A;  1SYB A;  5CV7 A;  2SNS A;  3OSO A;  3SR1 A;  3NK9 A;  4ODG A;  1NSN S;  5C5M A;  4F7X A;  1KDB A;  1TT2 A;  4K5W A;  3ERO A;  2O4X A;  2F3W A;  1A3U A;  1JOK A;  3MZ5 A;  2F0G A;  4KD4 A;  5IOD A;  1SND A;  4KHV A;  2KHS A;  4TRD A;  1EY8 A;  5I6Y A;  5KRU A;  1ENC A;  4KV6 A;  4NP5 A;  1EYD A;  4S3S A;  3HEJ A;  1IHZ A;  4KY6 A;  3S9W A;  2WAC A;  1JOR A;  5J22 A;  1A2U A;  2F0V A;  5IOC A;  5KGU A;  2F0Q A;  4ZUJ A;  1AEX A;  5C6A A;  3D4W A;  1STN A;  3EJI A;  2SOB A;  3EVQ A;  2M00 A;  3P1H A;  4H7B A;  4OL7 A;  4WOR A;  1JOQ A;  4KJO A;  4N9T A;  4DGZ A;  1SNQ A;  4K14 A;  3TP5 A;  4K6D A;  5M9O A;  1SNP A;  4IUN A; 
#chains in the Genus database with same CATH topology
 4DV6 Q;  4L5R C;  5EPL A;  1TS4 A;  4ZUI A;  4LF8 L;  1LAB A;  1FD7 D;  1QB5 D;  2BA1 A;  2NVQ H;  2ZTE A;  1CK1 A;  1K8G A;  5C5L A;  4R4C A;  5LMN L;  1BCP C;  4BY7 G;  4B9W A;  5CYU A;  4P75 A;  4A3L H;  2VNU D;  3U4Z A;  1STH A;  3ICE A;  1S5B D;  3Q23 A;  2EY5 A;  2E76 C;  4IFD J;  1CUK A;  3K0X A;  4QB4 A;  1DOM A;  2L4N A;  3H6M A;  5J22 A;  4A3I H;  4F8M A;  4DR5 Q;  2B2W A;  1PDQ A;  1I6H B;  4POG A;  2CKZ B;  1XNQ Q;  2PZT A;  4DAY B;  4GOP A;  2F0U A;  3IAY A;  1D8L A;  1EYA A;  1DON A;  5CC4 A;  2ZTD A;  1ENF A;  4FF3 A;  2DNE A;  2WII B;  2TSS A;  1XMO L;  5EPK A;  4CDF C;  2KUM A;  2KQ3 A;  3UDX A;  1OXV A;  2EJF C;  4B9X A;  4FXK C;  2MO1 A;  1L0Y B;  1N36 Q;  1EY4 A;  1TWC H;  1YHQ A;  4BY1 G;  3S1Q B;  4RGN A;  4O1N A;  3OTO Q;  5TSS A;  2PZU A;  4APV A;  2A73 B;  1TWA B;  2AUK A;  5EKI A;  2XTI A;  4JI1 Q;  4L5S A;  3TEH B;  5FKA C;  4JBM A;  3DEP A;  3AEV A;  2R92 B;  2FXQ A;  3QIA A;  1VQM A;  1SSO A;  5LL6 X;  4DAV A;  1HCZ A;  1EQV A;  1TR5 A;  4DUY Q;  5JEA G;  2NN6 G;  4JI3 L;  4JBK A;  1SE4 A;  4JVZ A;  1TS5 A;  2N78 A;  1XXG A;  4UP7 A;  4A3E H;  2K52 A;  4KV6 A;  4S3S A;  2QF7 A;  1G6Z A;  1UE5 A;  1JOR A;  1Z6H A;  2QCP X;  3GTJ B;  2F0V A;  4IJL A;  3T51 B;  1C0A A;  2ZXO A;  2M00 A;  4ZCK A;  3HOV B;  4Z9C B;  3CF5 A;  1F9R A;  2EJG C;  1OXS C;  5GAE C;  4K6D A;  3J7A 5;  4X65 Q;  2QKI C;  1MHW C;  1R4P B;  1IKM A;  5A2Q L;  5L37 A;  1TWG H;  2AMC B;  3F1Z A;  4QIW B;  1IBL L;  5M5W B;  1K83 B;  1PYS B;  2JEB I;  4C2M B;  4WJW A;  4BS9 A;  3URY A;  2UUA L;  2KCM A;  3CQZ B;  5KYI A;  5LMU L;  2PZW A;  2IX0 A;  2AKW B;  4X64 L;  2F0O A;  2VQF Q;  1CTM A;  2WAQ B;  2R7Z H;  3K80 C;  4UDU C;  3S1R B;  4X62 Q;  1QWY A;  5C6A A;  5CV8 A;  1B50 A;  2NZO A;  2JK8 A;  5BR8 L;  3SK5 A;  1F9S A;  2LS0 1;  3A56 A;  1EWH A;  1S5C D;  3KLS A;  1DD2 A;  4A3G G;  4LUV A;  4DA2 A;  1EEF D;  4DV5 L;  2K75 A;  2KHI A;  1YJ9 A;  4P71 A;  2PW5 A;  2PW7 A;  5M5Y B;  4JI8 L;  1EEI D;  2XWJ B;  4JI6 L;  1SFO H;  2K05 A;  4XYO A;  1V9P A;  2NTS A;  2M9V A;  1BF4 A;  4AH6 A;  5FO8 B;  3CCM A;  1FVI A;  3L7Z C;  2ENB A;  1DOL A;  1KDA A;  2JA8 G;  4EQO A;  1ZKO A;  4EX5 A;  1UEB A;  1PH6 A;  1L0X B;  3MEH A;  4HID A;  5C4H A;  5A2Q E;  1Q7Y C;  2JA6 G;  4ID6 A;  5IGG A;  1SMY C;  4B3R L;  3K58 A;  1QNU A;  5I2Y A;  1RDP D;  5T1I A;  5C4J H;  4ZKB B;  2FJ2 A;  2OT2 A;  5IP9 H;  3U9O A;  4P72 A;  2NVY H;  3VR5 A;  1FNU A;  1OO9 B;  4DV2 L;  4A4I A;  5CV6 A;  1HNZ L;  1EL0 A;  2PYK A;  1RHP A;  3TDQ A;  1IL2 A;  2KJX A;  3RR5 A;  4A3B G;  2VUM G;  3K5O A;  4C3H G;  1LTS D;  4DR7 Q;  3MC0 B;  4F7X A;  1TT2 A;  3BZC A;  4PZ8 A;  2IWH A;  1VQG A;  2KBN A;  5M3F H;  3G7L A;  3P20 A;  2VQE L;  1BBX C;  1C4Q A;  5I6Y A;  1Y14 B;  3S9W A;  1JE4 A;  1HZ9 A;  3FP9 A;  4DR2 Q;  1LTB D;  4RGT A;  1N32 L;  1STN A;  3S2H H;  1LUZ A;  4KJO A;  4P74 A;  4N9T A;  2KCT A;  3ZYY X;  1DXM A;  1EU4 A;  5K36 G;  5EKL A;  1EY0 A;  4A3L G;  2ZM6 L;  1NTG A;  5CBE E;  2IJ0 A;  3VYT A;  1KIX A;  3I2Z A;  3JAM E;  4IFD G;  2UXB L;  1Q1E A;  4KI0 A;  3J7A F;  3U50 C;  2A5H A;  2N55 A;  4C1N I;  2XIW A;  1I3Q H;  3Q22 A;  4MTK A;  1PRT B;  5FO9 B;  3CMA A;  3TP6 A;  3SE0 A;  4LAA A;  3C1E A;  4QCL A;  5FO7 B;  1Y1W H;  1A2T A;  2DJF C;  3GP7 A;  3E0E A;  1BBU A;  1I4R A;  4IUU A;  3HGB A;  3QJY A;  2F4V L;  3GTK H;  3K7A B;  3J7Y W;  3HOU H;  3OPO A;  1KNE A;  1UWV A;  2I5H A;  1U4L A;  1IKL A;  1UAP A;  1B53 A;  1H9S A;  4FXD A;  1C48 A;  2B3G A;  1JE5 A;  1XTD A;  1PH3 A;  2E2I H;  1H9S B;  2MHV A;  2B63 H;  2E2H B;  4DFA A;  4PZ7 A;  4A3F B;  4YWK A;  1JOO A;  4OO1 G;  1SYF A;  3ULL A;  1S72 A;  1AZP A;  4DV4 Q;  1G51 A;  1PFS A;  3N6R A;  4FVM A;  1SE3 A;  3HOW H;  2J0T D;  2J4X A;  4YY3 Q;  1BKB A;  1GUN A;  3I4M B;  4HSP A;  4A3D B;  1BDO A;  1QVG A;  3FKI G;  3FMC A;  1TII D;  4RGO S;  3CHB D;  1JWU D;  2F0I A;  3L2P A;  5JVG 3;  3KDF A;  1M8A A;  3CAM A;  4I7Z C;  1L0W A;  4A3M G;  3S16 H;  2K5W A;  4C3J B;  3KDF B;  2KHJ A;  1F9P A;  5E4X A;  5AJ3 L;  4C56 C;  4HCS A;  5GRO A;  1W3S A;  4CHT B;  5M3M H;  4QQB X;  4KN4 C;  4LK1 C;  4X66 L;  4A76 A;  2RCF A;  1O7I A;  2BH2 A;  3CCV A;  4JV5 L;  4KHP L;  4Q0F A;  5C4X H;  2EIF A;  2PNH A;  5I4D A;  5IOC A;  2K5Q A;  2OTL A;  2NVX B;  1X3P A;  3LNN A;  3MAQ A;  3HOX B;  1PLF A;  3CW2 C;  2VL6 A;  1I50 B;  4MNO A;  3N52 A;  5C3E H;  1LTA D;  3GTO H;  4JOI A;  2E2J B;  1YEZ A;  3PO3 B;  4RH6 A;  1SRU A;  3VA7 A;  4HMJ A;  3QR8 A;  5C4J B;  2DY7 A;  3CCR A;  1TS2 A;  1CQV A;  1PXU A;  3NTH A;  1R4Q B;  2OQ0 A;  5LMN Q;  4H13 C;  3QOJ A;  1UE1 A;  1NBW A;  2PI2 E;  1PA6 A;  5D65 A;  1VQ4 A;  5NUC A;  3IFT A;  3H09 A;  1EUJ A;  4JW0 A;  4PMC A;  4IPH A;  1FNV A;  4GLA C;  3DMU A;  1QUQ B;  1TQO A;  4B3S Q;  4OHJ A;  2RDH A;  5LL6 S;  4C3I B;  3K7U C;  1WI5 A;  1PH1 A;  2HIV A;  1YNN C;  3S2H B;  4CKC A;  1XMO Q;  3JAM i;  4DV3 L;  5IWA Q;  2AUJ D;  4H44 C;  1V43 A;  1EQT A;  2XGT A;  3BZD B;  2K50 A;  1LAC A;  2A8V A;  3PF5 A;  3U58 A;  4DK6 C;  2EY2 A;  1SJE D;  3PUY A;  3VR4 A;  3H3V I;  3WWV A;  3OMC A;  1EY5 A;  2RSN A;  1F2M A;  2QEJ C;  4DU9 A;  1U9R A;  1KQS A;  2TMP A;  3E9I A;  5JOB A;  5C0X H;  3HKZ B;  1WCM G;  5M3F G;  1EOV A;  4OON A;  4GNX A;  4AYB B;  2R7D A;  4A93 G;  5EGT A;  5DM7 3;  4GNX B;  3AU7 A;  4UY8 C;  1KXL A;  1NJI C;  2JJQ A;  3KJO A;  5I9P A;  3SEB A;  4A3J G;  1LTR D;  3S1N H;  4DNR B;  2IX1 A;  2H1E A;  1PFM A;  1PV4 A;  2O4X A;  1VMP A;  1RTO A;  2DY8 A;  5FJ8 H;  2E2I B;  3UE0 A;  4OIJ A;  3T4A C;  3D4W A;  1SMX A;  1I4P A;  2JA5 G;  4CJ0 B;  1AE3 A;  2VS1 A;  3A54 A;  3S2D B;  5JJI A;  5IYC H;  2ZJQ A;  3HOW B;  1Y1W G;  2OQK A;  1HFG A;  1TVX A;  4LF5 L;  5HGT A;  2UUB L;  2MPM A;  1N8R C;  1W6J A;  5EQ0 A;  2F0T A;  4FF1 A;  4FXG C;  1KC8 C;  2UUA Q;  4LF4 L;  2EYJ A;  4R4Q A;  2Z6K C;  2K01 A;  5LMU Q;  3OW2 A;  2SNM A;  4MHE A;  2DGY A;  2A6E D;  3TSS A;  4KY7 A;  1O78 A;  3NQI A;  1PTO C;  3D4D A;  3K81 C;  4MZ9 A;  1Q8K A;  3VR2 A;  1JWM D;  4BBR G;  1RCV D;  1GOZ A;  1HUM A;  3OOC A;  2Y0S G;  5BR8 Q;  3S1Q H;  3D0F A;  3TP7 A;  2UU9 L;  4OIK A;  3CC2 A;  3UDI A;  4CJ2 C;  2E5L L;  3HOZ B;  2Q2H A;  4YHH L;  1TWA H;  1STE A;  2XRQ D;  1BCP B;  2ASB A;  4WJ4 A;  3NBI A;  2VY3 A;  3LWE A;  4DV5 Q;  3Q24 A;  2L12 A;  3EIV A;  4JI8 Q;  1VQF A;  3E9H A;  1A15 A;  1A3V A;  1BUV T;  2JP1 A;  2HIX A;  5C0X I;  3I73 A;  3JC6 6;  3U9S A;  1GUT A;  1K8O A;  5COY A;  1EIY B;  4KHZ A;  2DNC A;  1IXR A;  5DEH A;  1RL2 A;  3HZX A;  1IW7 C;  1HHV A;  1RKN A;  1UUP A;  1VF7 A;  3BDC A;  2LKV A;  3VR3 A;  1JMC A;  5M3M G;  1RTN A;  3BYY B;  4YCW A;  4B3R Q;  2AQ1 B;  1BBW A;  2CWP A;  4NXN Q;  3M7N A;  4KTA A;  4DK3 C;  1B44 D;  3GTJ H;  4U68 A;  1PVO A;  4IQZ A;  1EIF A;  1FGU A;  4DV2 Q;  1HNZ Q;  2BOS A;  4LF9 L;  3NEM A;  2X69 A;  2KCN A;  3BU2 A;  5G3L D;  1BO0 A;  3UDG A;  3OWE B;  4RMF A;  3KF6 A;  1RD9 D;  5KRU A;  2VQE Q;  1K83 H;  3G48 A;  2UXD L;  4JI2 Q;  3KF6 B;  4C2M H;  3JAM c;  3OYY A;  1PFB A;  5ELC A;  1JIC A;  3CQZ H;  3I55 A;  5JJK A;  1MI2 A;  3G6J B;  1JOQ A;  4K14 A;  5E7N A;  3D3R A;  5EAY A;  3CKI B;  4R4O A;  1BCP D;  3I7F A;  3A74 A;  2MJ8 A;  3CU7 A;  1KAW A;  2NZ1 D;  3W5O A;  1FJG L;  2KA7 A;  2ZM6 Q;  3F8T A;  4XT1 B;  3RLN A;  4HJ7 A;  3S1R H;  2KEE A;  4YIJ A;  1MBY A;  3VDY A;  1VQO A;  3M4O B;  3M3Y H;  2UXB Q;  3KLW A;  3BZK A;  3TME A;  2F0M A;  3OW7 A;  1N33 Q;  1ENA A;  3DWP A;  2IL8 A;  1WYD A;  2FIN B;  2B2Y C;  4G4K A;  1LT3 D;  1X9N A;  3I90 A;  3NPP A;  2ES2 A;  3FDT A;  3TBI B;  4DN4 M;  3A8I E;  3R8B A;  1EU3 A;  2NN6 I;  2CHB D;  3P7J A;  1VQ6 A;  1M1K C;  4DR3 Q;  3J7Z C;  5C3X A;  2RBM A;  4NXM Q;  2E8G A;  1LLR D;  2WKC A;  3KYH C;  1SYG A;  1E24 A;  4GLX A;  1MSH A;  1X55 A;  4UPA A;  3CD6 A;  2XWB B;  3ERS X;  4MTN A;  3F2B A;  1XMQ L;  2JA7 G;  1BQQ T;  1PH2 A;  4DAY A;  3NEN A;  4V0B A;  1DM0 B;  1HTL D;  4ZAI A;  3I4O A;  5IYB G;  1NUC A;  1F2Z A;  3NE5 B;  3J80 c;  1AW7 A;  3UE1 A;  1ILQ A;  2EXZ A;  4YCU A;  1PTO F;  2L5T A;  3BDL A;  3H15 A;  2ZXR A;  5EPJ A;  2A1A A;  2N49 A;  4H0L C;  1WVL A;  2F1M A;  1Y8N B;  1Y8O B;  4HAE A;  5AJ3 Q;  1CKN A;  1H95 A;  2C5C A;  5FOB B;  1HH2 P;  5IYC G;  1LT4 D;  1VQK A;  1CKN B;  2F0G A;  4IUR A;  1U4P A;  3E0J A;  4X66 Q;  1LTT D;  5D3D A;  4HJ8 A;  4KKS A;  1YIJ A;  3GO5 A;  4JV5 Q;  4RWS C;  4X3U A;  4KHP Q;  3EJI A;  2L0C A;  3J81 j;  2A6H D;  1HR0 W;  2G5D A;  1QIL A;  1HPC A;  3EBE A;  2BE5 D;  2JE6 I;  1WOC A;  2IHF A;  3WOF A;  3A8K E;  1WTQ A;  3K7A H;  1K28 A;  4B3M Q;  3TZU A;  2B2V A;  1XNR Q;  4DV1 L;  3OIQ A;  2NYZ D;  5HY6 A;  3PIO A;  5IYD G;  4TKO B;  4DUZ Q;  1EYC A;  2E74 C;  2G9D A;  2R93 B;  2EYF A;  2F52 A;  5FLM G;  1CT1 D;  4N9P A;  4RKB A;  4XQQ A;  2AQ3 B;  1X3E A;  2E2H H;  2N3S A;  3K0Y A;  3A55 A;  4A3F H;  3PSI A;  4JI0 L;  1VQE A;  3PMF A;  5JPM C;  2R92 G;  2Q8T A;  1QOH A;  2K6A A;  4PV1 C;  4FYD A;  1S3O A;  4GKJ L;  3PIO 3;  2HDM A;  2K7V A;  1CKM A;  3HOY H;  5E1F A;  4LJZ C;  3I4M H;  4A3D H;  4MN3 A;  2K32 A;  1YNJ D;  4XTC S;  3SHL A;  1SYC A;  3I70 A;  1ZYR D;  1GVP A;  4DV3 Q;  4C3J H;  1GKH A;  3VA5 A;  4KMU C;  1U4R A;  3ITP A;  2K03 A;  4DXG A;  1B8A A;  3SDZ A;  5HUR A;  1B7Y B;  3HOV G;  3M3Y B;  1FL0 A;  2KOL A;  1FR3 A;  1B2T A;  2F0J A;  2B2T A;  1D7Q A;  5GAG C;  2O5I C;  1X54 A;  3IRB A;  1HTP A;  2A74 C;  4OWW B;  2PMZ E;  3S15 B;  5C44 G;  2JA6 B;  1YI2 A;  1O7Y A;  1WJJ A;  2I5L X;  3KUP A;  4DPG A;  3VYS A;  2UXC Q;  2NVX H;  3IFD A;  4JI5 L;  1YBY A;  3JAM L;  3HOX H;  1TWF H;  3I4L A;  1F77 A;  2CVR A;  1I50 H;  5G3L F;  3MZ5 A;  4KLK A;  3HKS A;  1SND A;  2WAQ G;  4XQJ A;  3AYH B;  4GOP C;  2N88 A;  2E2J H;  1LYL A;  3PO3 H;  2EQS A;  1J5E Q;  1H9K A;  1Y1V H;  2VUM B;  1Z9F A;  1FGB D;  4JI4 L;  4DKA C;  3BJU A;  4ZUJ A;  2NZH A;  1IBM L;  4IJH A;  3PUV A;  1HA6 A;  3PIP 3;  1I4X A;  3ZJY C;  1ASY A;  1PZI D;  1SNP A;  3EA6 A;  4OO1 I;  2DJG C;  1NMG A;  2A68 C;  2V4D A;  2QDL A;  4DR4 L;  1G91 A;  2OCE A;  3L9A X;  4K2K A;  2RQX A;  3DM1 A;  5H1S E;  3NXW A;  3DHQ A;  2YV5 A;  5FK9 C;  4LF5 Q;  2UUB Q;  4N8F A;  2ZTC A;  3A7A B;  3CCU A;  4LF4 Q;  4LF7 L;  1ML0 D;  4C3I H;  2NB0 A;  3IL8 A;  2K33 A;  5ISR A;  2RKS A;  4DR1 L;  3FHW A;  4RCO A;  5COR A;  2LFN A;  3TQY A;  4BXX H;  5IY0 A;  3GTM B;  4DK1 A;  3CXC A;  1H9M A;  1GHK A;  3GTP B;  1E3P A;  3QG1 A;  4DV0 Q;  3KF8 A;  4DV7 L;  4FO2 A;  2LY7 A;  4RGM A;  3KF8 B;  1A3T A;  2HDL A;  2NVT B;  1ASZ A;  4UHV A;  4A3I G;  2UU9 Q;  2F3I A;  1II3 A;  2K5D A;  3WOE A;  1QZH A;  1NR4 A;  2E5L Q;  1X65 A;  4YHH Q;  3RNU A;  4P73 A;  2X6G A;  3KOJ A;  5DAU A;  3KLS X;  3MFY A;  1KDC A;  2Y0S E;  4ME5 A;  4LFC L;  2VW9 A;  3J80 L;  5IIF A;  4EQP A;  1N34 Q;  2YTX A;  2B2U A;  2PPB C;  4X6A H;  1SAP A;  5IGF A;  1KD1 C;  3PO2 B;  1NNX A;  1KL9 A;  4BA2 I;  3STB C;  1YVC A;  1Q12 A;  2B29 A;  2PCF B;  1CHP D;  4GKK Q;  1LT6 D;  1CI3 M;  2F3V A;  2OEO A;  3P75 A;  1E2W A;  2K5H A;  1T5X D;  4ZKC B;  1E1T A;  3I4N B;  1PH9 A;  2JSO A;  3RZO B;  2RCN A;  3S2D H;  2R7F A;  1UE7 A;  4LF9 Q;  4K5W A;  3ERO A;  3HOY B;  3K59 A;  4TSS A;  2F03 A;  3GV3 A;  5IOD A;  3AB9 A;  2KHS A;  1PH4 A;  4LFA Q;  2CW0 C;  3H3V H;  4KY6 A;  2HCI A;  4G7Z C;  1HQM C;  4JCV E;  3G4S A;  3CPF A;  5LHY 1;  2VXW A;  4A3E G;  4JG2 A;  5JJZ A;  2JXM B;  4B3T Q;  2IX3 A;  3PUW A;  2K5N A;  2ALY B;  4P2C B;  2N8N A;  1PRT D;  1S40 A;  4OGQ C;  3K57 A;  3J80 E;  4A3F G;  3TS0 A;  2Q8I B;  2ZT9 C;  1FJG Q;  5KNC A;  2RDG A;  5KNB A;  1X3Q A;  2EYO A;  3MVV A;  4LFB Q;  1EZ6 A;  2BH8 A;  1KRS A;  5M5X H;  3HOZ H;  4GN4 B;  4ZYS A;  4HJA A;  2EZV A;  4NDX A;  4A3D G;  4U67 3;  4R9W A;  4L5Q A;  1X56 A;  2WIN B;  1TWF B;  2HQE A;  3HFZ B;  1BNZ A;  3MTS A;  1DZ1 A;  5CV9 A;  2QA4 A;  4H02 A;  4AQY L;  4LF8 Q;  5AFW A;  3TN2 A;  2R7Z G;  4A3C H;  4GN5 A;  4C1N K;  3RD4 A;  1Y1V B;  2Z6K A;  4KN7 C;  2HUG A;  5IGC A;  1MD2 D;  1XTC D;  3NUC A;  1WTP A;  1KNA A;  1QVC A;  3J7A V;  5KEE A;  2ZJP A;  4FF4 A;  4QMG A;  4K8J A;  3BS1 A;  1STA A;  3PUZ A;  4JI7 L;  2WB1 B;  3NQT A;  3VR6 A;  5IGD A;  4ZLT F;  1I94 L;  1QZG A;  3NP8 A;  1K3B C;  3Q0A A;  2NUC A;  5CGK A;  1XMQ Q;  1QUQ A;  4UP9 A;  4BBS B;  5BN5 A;  4OEM B;  4EQ5 A;  1OXX K;  2MO0 A;  1O7Z A;  3OMG A;  5DM6 3;  2C9O A;  1NE3 A;  1IYJ B;  3DUZ A;  4X65 L;  1J8I A;  1HJP A;  1LT5 D;  1UNS A;  1SYE A;  4QY7 A;  3PO3 G;  4PG3 A;  3LWU A;  2L55 A;  4IPG A;  2CCZ A;  2FMM A;  5IP9 G;  3OSO A;  4IOA A;  4PMW A;  1DGS A;  1TU2 B;  3PV0 A;  1X32 A;  4Q5V A;  1VDZ A;  5C0X J;  1EIH A;  2D0O A;  1PYB A;  3F2C A;  1EYD A;  1X6O A;  3M4O H;  4A3J B;  1X3G A;  2VZA A;  4ME3 A;  1YHB A;  2F0Q A;  2CFM A;  1XPO A;  3UI2 A;  4G7O C;  1ICF B;  2YU9 B;  2XVS A;  4C3I G;  1S5F D;  4QF4 A;  4K0K L;  2F0H A;  3BDO A;  1F2Y A;  4OX9 L;  2MGS A;  1UEA B;  4POF A;  1AZQ A;  4BY7 H;  4JI3 Q;  2BA0 A;  3CP0 A;  5GAH C;  1VQ9 A;  5CR3 A;  2B8G A;  3MXU A;  5FLX L;  1M90 C;  4DV1 Q;  3TRE A;  2Z4H A;  4QJF A;  1P16 A;  1SNC A;  1Q82 C;  3SK4 A;  2AHO B;  3LGJ A;  5F2D A;  1SRO A;  2JYO A;  3K6O A;  1WTR A;  3AMU A;  3HKZ G;  1STY A;  3R93 A;  2NBF A;  3QB3 A;  4J6H A;  4PMB A;  4LWC A;  1I5F A;  4IZ8 A;  1Q1B A;  4X3T A;  3C3L A;  4JI0 Q;  2L1B A;  1E2V A;  3VYR A;  4AYB G;  1HR0 L;  3NWS A;  2EYH A;  4GKJ Q;  1VMC A;  1IBL Q;  3PCO B;  3HOU G;  1PH5 A;  4BY1 H;  3J80 i;  1ET6 A;  1EZ8 A;  3I56 A;  4KD3 A;  3W1B A;  4X64 Q;  4XT3 B;  1B3Q A;  1IYU A;  2RDF A;  1KAA A;  2B63 G;  3K8A A;  1U5K A;  3ULP A;  1MGS A;  4M8A A;  3KJP A;  1Q8I A;  1X3F A;  2EDG A;  1CM9 A;  3T56 B;  3D4R A;  2SDF A;  5M5X B;  1NCV A;  1GD7 A;  5ELN A;  3HOW G;  3J81 L;  1RJT A;  2Q2T A;  2NN6 H;  5FLX E;  1TY2 A;  3G71 A;  2A69 D;  1SN8 A;  5EJW A;  4XQN A;  2K14 A;  4JI6 Q;  1XPU A;  1GUG A;  1Y69 U;  1NR2 A;  4JI5 Q;  1VQA A;  4QIW E;  2YYZ A;  2GVA A;  1A3U A;  1JOK A;  1SJH D;  1B9M A;  2R3Z A;  1A2U A;  2WKD A;  1AEX A;  3E3X A;  2IHE A;  4JI4 Q;  2HT1 A;  1A8V A;  1L1O C;  1LM0 A;  4O0A A;  4RAU C;  4DGZ A;  2WAQ E;  3S1M H;  1IBM Q;  3TRZ A;  2R93 H;  3A8J E;  5C4X G;  4R4I A;  2XNA C;  3E6Z X;  4PNY A;  3HOZ G;  3M4Q A;  2L15 A;  2SEB D;  3FEW X;  4GN3 B;  1HNW L;  4BWG B;  4DR4 Q;  1EQQ A;  3KK7 A;  1PRT F;  2DUD A;  3RLO A;  3MXG A;  1A0I A;  2A6E C;  2YTY A;  2D5D A;  3A5U A;  2VB3 X;  5C3E G;  1MSG A;  1V1P B;  4XDX A;  5IT9 L;  4N8X 1;  1D5M C;  3HRZ C;  4LF7 Q;  3RMH A;  2WP8 J;  4R4T A;  3J81 E;  1UE6 A;  2F0K A;  3H0G B;  4A75 A;  3M4P A;  1N32 Q;  4DR1 Q;  4ABN A;  2MQH A;  1CA5 A;  3T13 A;  4J8Q A;  3MHB A;  3RUZ A;  3V2T A;  1C8C A;  2HQL A;  3M7G A;  2GA4 B;  4HTH A;  1HZB A;  3GTL B;  1SNM A;  4A3K B;  5IGB A;  1QNK A;  2CH4 A;  4QL5 A;  1HNX L;  1EQR A;  1PH7 A;  3T1Y L;  3D8G A;  2RHQ B;  2Q8R E;  5DLQ E;  1SNO A;  3LX0 A;  1U4M A;  5CV5 A;  5ELO A;  3S15 H;  1SDF A;  2X6L A;  4LFC Q;  1Z47 A;  2JA6 H;  5ELB A;  1W6K A;  4BY7 B;  4OWT B;  2F4V Q;  4CDE C;  2LSS A;  2JN4 A;  1EY7 A;  1V1Q A;  1JJG A;  2H5X A;  1FNW A;  1K9M C;  2NWG A;  2EE1 A;  1HXY D;  5EKK A;  4BA1 I;  2F0L A;  4I65 A;  1JC7 A;  5C0X G;  4A3B H;  2VUM H;  4C3H H;  5IT9 E;  4LNQ A;  1JJC B;  2BCO A;  1EY6 A;  1GHJ A;  2E75 C;  1HZC A;  2Z6B A;  1NSN S;  5C5M A;  1I4H A;  5HGQ A;  4JK1 C;  2CWA A;  4KHV A;  3NBH A;  3RZD H;  1IYV A;  1D5Z C;  4BY1 B;  4IPC A;  3HEJ A;  3H94 A;  2KCC A;  3NBH B;  1Q86 C;  5K36 H;  5BN3 A;  2YTV A;  5E4W C;  3S17 H;  3P1H A;  1GUW A;  1AFP A;  5FJ8 G;  1V8Q A;  1E0B A;  4IUT A;  3EQL C;  3IKJ A;  2RSO A;  4RHS A;  1DJR D;  4QUF A;  3T16 A;  4IFD H;  4F88 A;  1J9O A;  2BDO A;  3GTM H;  2KED A;  4HMI A;  4HR7 B;  3GTP H;  4B3S L;  1GUO A;  5JVH 3;  1C9O A;  1WTV A;  1HA5 A;  1RIP A;  4IUV A;  1U0L A;  4GOP B;  1LV9 A;  3I8Z A;  4X3S A;  2NVT H;  5J39 A;  5IWA L;  4LF6 L;  5KIX A;  3Q8D A;  2AWO A;  2FMC A;  4HIO A;  3OHX C;  1CFM A;  1RF2 D;  2EOT A;  1SXT A;  5K5P A;  3TZD A;  1WD0 A;  3QO2 A;  4K5V A;  2HHH L;  2EYM A;  1GM5 A;  1SR3 A;  4Y7N B;  3T1H L;  1SE2 A;  1B4O A;  2IT1 A;  4Y52 H;  2I07 B;  4AQY Q;  5KYL A;  2F0W A;  3S14 H;  4IUP A;  3PO2 H;  4OO1 H;  1CKO A;  2IPK D;  2K28 A;  3K5N A;  3MXN A;  3NTI A;  4FNF A;  3S1M B;  1YZ6 A;  4K6L A;  1M4V A;  2G9H D;  3MXN B;  3HG9 A;  1WFQ A;  1KLG D;  1Q3L A;  2KVM A;  1LTL A;  4IAL A;  4JI7 Q;  3MA2 B;  1A62 A;  3I4N H;  1I94 Q;  1TXY A;  3RZO H;  3FKI H;  3J81 i;  1Q90 A;  4A3M H;  1EYG A;  1E7Z A;  2P5Z X;  3V05 A;  3AFP A;  3SK8 A;  4DR6 L;  4JYA L;  1HUN A;  4XYQ A;  3CCQ A;  1QG7 A;  2Z0S A;  3I3C A;  2QGQ A;  1QJO A;  4HIM A;  4IOC A;  4XIG S;  1Y8P B;  3M85 A;  4EQN A;  1O7L A;  1VQH A;  1Q81 C;  4A3G B;  1CHQ D;  3SXH A;  1WTW A;  1SMY D;  2KEN A;  3SGI A;  4OXP A;  2ATW A;  2R93 G;  3DM3 A;  1VS0 A;  2RA4 A;  1XPR A;  4QUC A;  1S5E D;  2A6H C;  4PZ6 A;  5C44 B;  4TVA B;  1YJN A;  3EN2 A;  1ROD A;  2IY5 B;  2A68 D;  2BE5 C;  2D2C C;  2FFK B;  1G8Z D;  4IFD I;  1TY0 A;  2Q2U A;  3DLL A;  1I4Q A;  1EFW A;  2JA8 B;  2EXD A;  4NPS A;  2WB1 E;  3CCS A;  4DXF A;  1SNQ A;  2LXJ A;  1GXD C;  3RN5 A;  4RA8 A;  4RHR A;  4KK7 A;  3PIP A;  1H9R A;  3DXJ C;  4GLV B;  4NMZ A;  2F0S A;  1CZG A;  4K0K Q;  4OX9 Q;  3M9B A;  1C7Y A;  2XN9 C;  2B2W C;  2KEC A;  1N9W A;  1T5E A;  2EY1 A;  1NAP A;  4F87 A;  3CME A;  1H9J A;  1EY9 A;  3BVM A;  2MP1 A;  4JPB W;  1GO3 E;  3G6E A;  4A3B B;  4C3H B;  2C35 B;  3TS2 A;  3U4V A;  4FP5 D;  1ET9 A;  3GV6 A;  3RN2 A;  3BYT B;  2MUY A;  4IUQ A;  4TQU S;  5IP7 H;  3R2I A;  2QIL A;  1VQL A;  2NVQ B;  2EY6 A;  1KHI A;  2EPB A;  1YNJ C;  2PQE A;  4I7A A;  5I2X A;  1W2B A;  1PTO H;  1BCP F;  4NB3 A;  3W1G A;  1HR0 Q;  2PO4 A;  3RZD B;  1ZYR C;  5JPN C;  1EWC A;  4DAM A;  1I4G A;  3K5M A;  3HKZ E;  1VQI A;  3QOL A;  1VQ5 A;  3S17 B;  1B3A A;  4NXN L;  4BBS H;  2F0N A;  3K5L A;  2L9H A;  1BXT A;  3T53 B;  4AYB E;  1CZW A;  1SLJ A;  3I91 A;  2HD3 A;  5ELE A;  1DCZ A;  1IZ6 A;  2K5V A;  4IO9 A;  2OTJ A;  1VQP A;  3E5S A;  3STB D;  4A3I B;  4L8J A;  2ZJR A;  1HFN A;  3NTK A;  2WFW A;  3A5Z B;  5FLX c;  1LO5 D;  2UUC L;  1NMF A;  1ICW A;  1VQD A;  5ELF A;  1WCM H;  4DK0 A;  3H91 A;  2Z8L A;  4HSV A;  1TS3 A;  4JI2 L;  4IN3 A;  3CCJ A;  2I0Q A;  1JQY D;  4A93 H;  2B2V C;  3C1F A;  4OEL B;  2RVL A;  1TWC B;  1JWS D;  3L3O C;  5J1Z A;  3GTG H;  3ONA B;  3KBG A;  1CSQ A;  4A3J H;  1CA6 A;  1IBK L;  5KND A;  4G57 A;  2CW0 D;  4RG1 A;  1ZEQ X;  5ELD A;  1SYB A;  5D3I B;  3EFX D;  4DAP A;  1T9H A;  2I5M X;  2YU9 H;  1OTC A;  5LMN W;  5IE8 A;  4ALP A;  3S14 B;  1PH8 A;  3BVG A;  1N33 L;  1L2F A;  2JA5 H;  1PZK D;  1D6E C;  2FHT A;  1JB3 A;  3WDN A;  2MFI A;  4H7B A;  5JJL A;  4DV6 L;  1QE6 A;  3CPW A;  1PHJ A;  5A35 A;  1P8L A;  4CKE A;  1K0S A;  1SBB B;  1KTK A;  3FKI B;  4YWL A;  1G2T A;  1J6Q A;  3J81 c;  2Q2I A;  1B9N A;  4A3M B;  4DR3 L;  1HNW Q;  4A3E B;  1YHA A;  2RHS B;  4LMQ D;  4NXM L;  1SYD A;  2ZXP A;  1ESR A;  4GS3 A;  1I6V C;  2B2T C;  3F2U A;  4K5X A;  2UXD Q;  1F2L A;  3UDF A;  3C2P A;  3CRL C;  3PO2 G;  4FDB A;  4JBJ A;  4BBR H;  1TWG B;  4DF7 A;  1YIT A;  1XYI A;  4DR5 L;  3CCL A;  1B70 B;  2I46 A;  1XNQ L;  3NSW A;  2E2D C;  3I4N G;  3MXP A;  3GTQ H;  1WTH A;  3NHH A;  3GDE A;  1HNX Q;  3T1Y Q;  1DOK A;  1N36 L;  3SK6 A;  3X3N A;  3HOY G;  2R7Z B;  3F2D A;  3I4M G;  2NTT A;  3PF4 A;  4HJ9 A;  1D1I A;  1EFI D;  1AH9 A;  3GD7 A;  1KAB A;  1VQC A;  3M4Y A;  3OTO L;  1D1K A;  5DNF A;  1YNN D;  5IT9 c;  2D9U A;  4J1M A;  4C3J G;  4ZK9 B;  4JI1 L;  1TWH H;  2BDN A;  1FYC A;  1S5D D;  5C3W A;  1ZXT A;  1CQF A;  2CQA A;  3VYU A;  4L63 B;  1SFO B;  2F0D A;  3HS0 C;  1WTO A;  1OXU A;  2K1B A;  2K4K A;  5T1G A;  2EYP A;  4DUY L;  3Q6S A;  1IL8 A;  4HJ5 A;  4HIK A;  2Z4I A;  1R9T H;  4EVO A;  5CV7 A;  3CC4 A;  1LTG D;  1PTO B;  1MJE A;  2R6G A;  3SR1 A;  4B3M L;  3NK9 A;  1VQ8 A;  1XNR L;  1KDB A;  1K8M A;  4O2D A;  2JEA I;  3PGZ A;  1VQJ A;  2ICE C;  4RFB A;  4DUZ L;  1KRT A;  3MWY W;  3HOX G;  1ENC A;  4NP5 A;  1K0R A;  2AWN A;  2NVY B;  1IHZ A;  2EVB A;  2WAC A;  3NWT A;  1PRT C;  3FRP B;  4HN7 A;  5KGU A;  4NW2 A;  4OL7 A;  5EBC A;  2PMZ B;  3ND9 A;  1GUS A;  2LXK A;  4ILW A;  4CJ1 B;  1D2B A;  1EWI A;  2XSC A;  1Y1V G;  4K2L A;  5GQO A;  1STG A;  4K8I A;  1E22 A;  3H0G H;  4OWX B;  2CQO A;  1WCM B;  5M3F B;  2B2U C;  1KLU D;  3CC7 A;  3ERQ A;  5IP7 G;  2HCC A;  5D14 A;  1XWE A;  4A93 B;  2DN8 A;  3O13 A;  4R8N A;  4AIM A;  2WB1 G;  2IW3 A;  3KBX A;  2H4O A;  2V1C C;  3GTL H;  1VQN A;  2JQO A;  2D62 A;  3GTG B;  3D6C A;  3ER0 A;  4LUO A;  4A3K H;  1PFN A;  2QEX A;  1L1O A;  1LTI D;  3CCE A;  4WRD A;  2VQF L;  2PNR C;  4LF6 Q;  1L1O B;  4BBS G;  2JA9 A;  4J15 A;  2B39 A;  5C4Z A;  4G7H C;  1PMR A;  4X62 L;  4IPD A;  1D5X C;  2F0P A;  1XJV A;  1Q46 A;  2PQA A;  1HRJ A;  3NEL A;  4EGV A;  2HHH Q;  2OF1 A;  4R1J A;  2JA5 B;  2PQA B;  2R61 A;  4BXX G;  1JCK B;  1MIU A;  3T1H Q;  4DNT B;  1I3Q B;  4LUZ A;  2L11 A;  1PTO D;  1GJX A;  1Y1W B;  2OWO A;  2M2L A;  1JJ2 A;  3RLF A;  4XXE A;  4NKL A;  5E3F A;  3GQB A;  2JA7 H;  3AQQ A;  2UXC L;  3ULJ A;  4R8I A;  3GTK B;  4GZY C;  3SVM A;  3KFU A;  4CGY B;  2GN5 A;  3QWN A;  3C46 A;  1ONL A;  3V96 A;  4L5T A;  3L0O A;  5IYB H;  3HOU B;  1PYW D;  1V1O A;  2OXP A;  2WV6 D;  1NY4 A;  3DEO A;  4ZQ3 A;  4L6T B;  2QDB A;  1J5E L;  4UP8 A;  1K73 C;  5J3B A;  2B63 B;  5CMD A;  4E6I A;  3W3A A;  1ILP A;  1JB7 A;  4DR6 Q;  1EOT A;  2B2Y A;  2EYL A;  4CBV A;  4ULL A;  2A19 A;  5I9O A;  4BBR B;  4JYA Q;  5JAV A;  2Y0S B;  4WFN 3;  1OXT A;  1IW7 D;  1AN8 A;  1B1Z A;  3PQI A;  4DR7 L;  4DNI A;  4FF2 A;  1O80 A;  2Z9H A;  4ODG A;  3GTQ B;  2F3W A;  1I6H H;  4JBW A;  4HED A;  2EJM A;  1EY8 A;  4JOI C;  4TRD A;  3S16 B;  2D0P A;  1VQB A;  4DR2 L;  5JEA J;  5EBD A;  1ESF A;  1SE8 A;  1AE2 A;  5JEA H;  2ICI A;  2SOB A;  3DWA A;  1SEB D;  2J7Z A;  3TP5 A;  1HZA A;  4IUN A;  4JC0 A;  4DV0 L;  1HQR D;  5M3M B;  1QCB D;  3S24 A;  3R2T A;  5IGE A;  5IYD H;  2AQ2 B;  2K04 A;  1TWH B;  4LW1 A;  1MKH A;  1BR9 A;  2QW7 A;  1BVS A;  4Y7N H;  5FLM H;  5C4X B;  3R3O A;  3W2D A;  3FPP A;  4KKU A;  5I6W A;  1JT8 A;  1WTX A;  1Z7T A;  1E2Z A;  3D6W A;  2R92 H;  1N34 L;  1R9T B;  1BOS A;  2B8F A;  5C3E B;  3CRK C;  2CH4 W;  3GTO B;  3FVQ A;  4ZRZ A;  4KKT A;  3OWF A;  3KLR A;  3PUX A;  1G6P A;  1A63 A;  4MIU A;  1A6X A;  1K8A C;  1F9Q A;  1AP0 A;  3AFQ A;  2F0E A;  1V1P A;  3TP8 A;  5GAD C;  4GKK L;  3B6Y A;  4RKL A;  1VF5 C;  4KJN A;  3A7L A;  2F0F A;  1QVF A;  4WJ3 M;  4A3C G;  1TKW B;  5CV4 A;  4O42 A;  3ND8 A;  4KY5 A;  4DV4 L;  2MNA A;  4GNX C;  4HCE A;  3BVZ A;  3D31 A;  4CDD C;  1VQ7 A;  3HOV H;  2Z1C A;  4YWM A;  4RCN A;  2XRS D;  4YCV A;  4UAI A;  4YY3 L;  4A3G H;  1CSP A;  3A0J A;  2A69 C;  1S4Z A;  3MEF A;  2UUC Q;  1K3R A;  3X3M A;  4LFA L;  4V19 0;  4DV7 Q;  4B08 A;  5M5W H;  1EIG A;  2F4I A;  4QGU A;  2ID0 A;  5C44 H;  4CDC C;  3FPU B;  1STB A;  1YJW A;  4B3T L;  2LMC B;  2PI2 A;  2JA8 H;  2O2L D;  4X3K A;  3HP3 A;  1YNX A;  3BG3 A;  3I72 A;  1IBK Q;  2GVB A;  2SNS A;  3DWQ A;  2O5J C;  1E1O A;  3MFG A;  4LFB L;  4PQX A;  1MJC A;  3H0G G;  4KD4 A;  3H3V C;  4CKB A;  1VCI A;  2VB2 X;  2JA7 B;  2RF4 A;  5BN4 A;  1WD1 A;  3EVQ A;  4WOR A;  1XX8 A;  1JR0 D;  1G2S A;  1PZJ D;  5M5Y H;  4A3K G;  4M1U B;  5CBA E;  1DYQ A;  1G29 1;  5M9O A;  3S1N B;  3OIP A; 
#chains in the Genus database with same CATH homology
 5EPL A;  1TS4 A;  4ZUI A;  1LAB A;  1FD7 D;  1QB5 D;  2BA1 A;  1CK1 A;  5C5L A;  1BCP C;  4B9W A;  5CYU A;  2VNU D;  1STH A;  1S5B D;  3Q23 A;  2EY5 A;  2E76 C;  4IFD J;  4QB4 A;  1DOM A;  2L4N A;  3H6M A;  5J22 A;  4F8M A;  2B2W A;  1PDQ A;  1I6H B;  2PZT A;  2F0U A;  3IAY A;  1DON A;  1EYA A;  5CC4 A;  1ENF A;  4FF3 A;  2DNE A;  2WII B;  2TSS A;  5EPK A;  2KUM A;  2KQ3 A;  1OXV A;  2EJF C;  4B9X A;  4FXK C;  1L0Y B;  1EY4 A;  3S1Q B;  4RGN A;  4O1N A;  5TSS A;  2PZU A;  2A73 B;  1TWA B;  2AUK A;  5EKI A;  5FKA C;  3DEP A;  2R92 B;  3QIA A;  1SSO A;  5LL6 X;  4DAV A;  1HCZ A;  1EQV A;  1TR5 A;  5JEA G;  2NN6 G;  1SE4 A;  1TS5 A;  1XXG A;  4KV6 A;  4S3S A;  2QF7 A;  1G6Z A;  1JOR A;  1Z6H A;  2QCP X;  3GTJ B;  2F0V A;  3T51 B;  2ZXO A;  2M00 A;  3HOV B;  4Z9C B;  1F9R A;  2EJG C;  1OXS C;  4K6D A;  2QKI C;  1R4P B;  1IKM A;  5A2Q L;  4QIW B;  5M5W B;  1K83 B;  2JEB I;  4C2M B;  4WJW A;  4BS9 A;  3URY A;  3CQZ B;  5KYI A;  2PZW A;  2IX0 A;  2F0O A;  1CTM A;  2WAQ B;  4UDU C;  3S1R B;  1QWY A;  5C6A A;  5CV8 A;  1B50 A;  3SK5 A;  1F9S A;  2LS0 1;  3A56 A;  1EWH A;  1S5C D;  3KLS A;  1DD2 A;  4DA2 A;  1EEF D;  2PW5 A;  2PW7 A;  5M5Y B;  1EEI D;  2XWJ B;  2K05 A;  4XYO A;  2NTS A;  2M9V A;  1BF4 A;  5FO8 B;  3L7Z C;  2ENB A;  1DOL A;  1KDA A;  4EQO A;  1ZKO A;  1L0X B;  3MEH A;  5C4H A;  5A2Q E;  4ID6 A;  5IGG A;  1SMY C;  3K58 A;  1QNU A;  5I2Y A;  1RDP D;  5T1I A;  4ZKB B;  2FJ2 A;  2OT2 A;  3U9O A;  3VR5 A;  1FNU A;  1OO9 B;  5CV6 A;  1EL0 A;  2PYK A;  1RHP A;  3TDQ A;  2KJX A;  3K5O A;  4C3H G;  1LTS D;  3MC0 B;  4F7X A;  1TT2 A;  2IWH A;  3G7L A;  3P20 A;  1BBX C;  1C4Q A;  5I6Y A;  3S9W A;  1JE4 A;  1LTB D;  4RGT A;  1STN A;  4KJO A;  4N9T A;  3ZYY X;  1DXM A;  1EU4 A;  5K36 G;  5EKL A;  1EY0 A;  5CBE E;  2IJ0 A;  3VYT A;  3JAM E;  4IFD G;  1Q1E A;  4KI0 A;  3J7A F;  2A5H A;  2N55 A;  4C1N I;  2XIW A;  3Q22 A;  1PRT B;  5FO9 B;  3TP6 A;  3SE0 A;  4LAA A;  3C1E A;  4QCL A;  5FO7 B;  1A2T A;  3GP7 A;  1I4R A;  4IUU A;  3HGB A;  3QJY A;  3K7A B;  3J7Y W;  3OPO A;  1KNE A;  1U4L A;  1IKL A;  1UAP A;  1B53 A;  1H9S A;  4FXD A;  1C48 A;  1H9S B;  2MHV A;  2E2H B;  4DFA A;  4A3F B;  1JOO A;  4OO1 G;  1SYF A;  1AZP A;  3N6R A;  4FVM A;  1SE3 A;  2J0T D;  2J4X A;  1GUN A;  3I4M B;  4HSP A;  4A3D B;  1BDO A;  3FMC A;  1TII D;  4RGO S;  3CHB D;  1JWU D;  2F0I A;  5JVG 3;  1M8A A;  4I7Z C;  2K5W A;  4C3J B;  1F9P A;  5E4X A;  4C56 C;  4HCS A;  4CHT B;  4KN4 C;  4LK1 C;  4Q0F A;  5IOC A;  5I4D A;  2K5Q A;  2NVX B;  1X3P A;  3LNN A;  3MAQ A;  3HOX B;  1PLF A;  1I50 B;  3N52 A;  1LTA D;  2E2J B;  3PO3 B;  4RH6 A;  3VA7 A;  4HMJ A;  5C4J B;  2DY7 A;  1TS2 A;  1CQV A;  1PXU A;  3NTH A;  1R4Q B;  4H13 C;  3QOJ A;  5D65 A;  5NUC A;  3IFT A;  3H09 A;  4PMC A;  1FNV A;  3DMU A;  1TQO A;  4OHJ A;  2RDH A;  5LL6 S;  4C3I B;  1YNN C;  3S2H B;  4CKC A;  2AUJ D;  4H44 C;  1V43 A;  1EQT A;  3BZD B;  1LAC A;  2EY2 A;  1SJE D;  3PUY A;  3VR4 A;  3OMC A;  1EY5 A;  2RSN A;  1F2M A;  2QEJ C;  4DU9 A;  1U9R A;  2TMP A;  5JOB A;  5C0X H;  3HKZ B;  4AYB B;  5EGT A;  5DM7 3;  3AU7 A;  5I9P A;  3SEB A;  1LTR D;  4DNR B;  2IX1 A;  2H1E A;  1PFM A;  2O4X A;  1VMP A;  1RTO A;  2DY8 A;  2E2I B;  4OIJ A;  3T4A C;  3D4W A;  1I4P A;  4CJ0 B;  3A54 A;  3S2D B;  3HOW B;  1HFG A;  1TVX A;  5HGT A;  2MPM A;  1W6J A;  5EQ0 A;  2F0T A;  4FF1 A;  4FXG C;  2EYJ A;  2K01 A;  2SNM A;  4MHE A;  2A6E D;  3TSS A;  4KY7 A;  1O78 A;  3NQI A;  1PTO C;  3D4D A;  3VR2 A;  1JWM D;  1RCV D;  1GOZ A;  1HUM A;  3OOC A;  3TP7 A;  4OIK A;  4CJ2 C;  3HOZ B;  2XRQ D;  1STE A;  1BCP B;  3NBI A;  3LWE A;  3Q24 A;  2L12 A;  1A15 A;  1A3V A;  1BUV T;  2JP1 A;  5C0X I;  3I73 A;  3U9S A;  1GUT A;  1K8O A;  5COY A;  4KHZ A;  2DNC A;  5DEH A;  3HZX A;  1IW7 C;  1HHV A;  1RKN A;  1UUP A;  1VF7 A;  3BDC A;  2LKV A;  3VR3 A;  1RTN A;  3BYY B;  2AQ1 B;  3M7N A;  4KTA A;  1B44 D;  4U68 A;  4IQZ A;  2BOS A;  2X69 A;  2KCN A;  5G3L D;  1BO0 A;  3OWE B;  1RD9 D;  5KRU A;  5ELC A;  1PFB A;  1JIC A;  1MI2 A;  3G6J B;  1JOQ A;  4K14 A;  3D3R A;  3CKI B;  1BCP D;  2MJ8 A;  3CU7 A;  2NZ1 D;  2KA7 A;  4XT1 B;  2KEE A;  4YIJ A;  1MBY A;  3M4O B;  3TME A;  2F0M A;  3OW7 A;  1ENA A;  3DWP A;  2IL8 A;  2FIN B;  2B2Y C;  4G4K A;  1LT3 D;  3I90 A;  3NPP A;  3FDT A;  3TBI B;  4DN4 M;  3A8I E;  3R8B A;  1EU3 A;  2NN6 I;  2CHB D;  3P7J A;  5C3X A;  2RBM A;  1LLR D;  2WKC A;  1SYG A;  1MSH A;  2XWB B;  1BQQ T;  4DAY A;  4V0B A;  1DM0 B;  1HTL D;  4ZAI A;  1NUC A;  1F2Z A;  3NE5 B;  1AW7 A;  1ILQ A;  2EXZ A;  1PTO F;  2L5T A;  3BDL A;  2ZXR A;  5EPJ A;  4H0L C;  1WVL A;  2F1M A;  1Y8N B;  1Y8O B;  4HAE A;  2C5C A;  5FOB B;  1LT4 D;  2F0G A;  4IUR A;  1U4P A;  3E0J A;  1LTT D;  5D3D A;  4KKS A;  3GO5 A;  4RWS C;  4X3U A;  3EJI A;  2L0C A;  2A6H D;  1QIL A;  1HPC A;  2BE5 D;  2JE6 I;  3WOF A;  3A8K E;  1WTQ A;  3TZU A;  2B2V A;  3OIQ A;  2NYZ D;  4TKO B;  1EYC A;  2E74 C;  2G9D A;  2R93 B;  2EYF A;  1CT1 D;  4N9P A;  4RKB A;  4XQQ A;  2AQ3 B;  3K0Y A;  3A55 A;  3PMF A;  5JPM C;  2Q8T A;  1QOH A;  2K6A A;  4PV1 C;  4FYD A;  3PIO 3;  2HDM A;  2K7V A;  5E1F A;  4LJZ C;  4MN3 A;  2K32 A;  1YNJ D;  4XTC S;  3SHL A;  1SYC A;  3I70 A;  1ZYR D;  3VA5 A;  4KMU C;  1U4R A;  3ITP A;  2K03 A;  4DXG A;  3SDZ A;  5HUR A;  3M3Y B;  2KOL A;  1FR3 A;  1B2T A;  2F0J A;  2B2T A;  2O5I C;  1HTP A;  2A74 C;  3S15 B;  2JA6 B;  1O7Y A;  3KUP A;  3VYS A;  3IFD A;  3JAM L;  3I4L A;  1F77 A;  2CVR A;  5G3L F;  3MZ5 A;  1SND A;  4XQJ A;  2N88 A;  1H9K A;  2VUM B;  1FGB D;  4ZUJ A;  3PUV A;  1HA6 A;  3PIP 3;  1I4X A;  1PZI D;  1SNP A;  3EA6 A;  4OO1 I;  2A68 C;  2V4D A;  1G91 A;  3L9A X;  4K2K A;  2RQX A;  3DM1 A;  3NXW A;  3DHQ A;  5FK9 C;  3A7A B;  1ML0 D;  2NB0 A;  3IL8 A;  2K33 A;  5ISR A;  2RKS A;  4RCO A;  5COR A;  2LFN A;  3GTM B;  4DK1 A;  1H9M A;  1GHK A;  3GTP B;  3QG1 A;  3KF8 A;  4FO2 A;  2LY7 A;  4RGM A;  1A3T A;  2HDL A;  2NVT B;  1II3 A;  2K5D A;  3WOE A;  1NR4 A;  2X6G A;  5DAU A;  3KLS X;  3MFY A;  1KDC A;  4ME5 A;  3J80 L;  5IIF A;  4EQP A;  2B2U A;  2PPB C;  1SAP A;  5IGF A;  3PO2 B;  4BA2 I;  1Q12 A;  2PCF B;  1CHP D;  1LT6 D;  1CI3 M;  2F3V A;  2OEO A;  3P75 A;  1E2W A;  1T5X D;  4ZKC B;  3I4N B;  2JSO A;  3RZO B;  4K5W A;  3ERO A;  3HOY B;  3K59 A;  4TSS A;  2F03 A;  3GV3 A;  5IOD A;  3AB9 A;  2KHS A;  2CW0 C;  4KY6 A;  2HCI A;  4G7Z C;  1HQM C;  5LHY 1;  2VXW A;  5JJZ A;  2JXM B;  2IX3 A;  3PUW A;  4P2C B;  1PRT D;  4OGQ C;  3K57 A;  3J80 E;  2Q8I B;  2ZT9 C;  5KNC A;  2RDG A;  5KNB A;  1X3Q A;  2EYO A;  3MVV A;  1EZ6 A;  4ZYS A;  2EZV A;  4NDX A;  4U67 3;  4R9W A;  2WIN B;  1TWF B;  2HQE A;  1BNZ A;  1DZ1 A;  3MTS A;  5CV9 A;  5AFW A;  3TN2 A;  4C1N K;  3RD4 A;  1Y1V B;  4KN7 C;  2HUG A;  5IGC A;  1MD2 D;  1XTC D;  3NUC A;  1WTP A;  1KNA A;  3J7A V;  5KEE A;  4FF4 A;  4QMG A;  4K8J A;  3BS1 A;  1STA A;  3PUZ A;  2WB1 B;  3NQT A;  3VR6 A;  5IGD A;  4ZLT F;  3NP8 A;  3Q0A A;  2NUC A;  5CGK A;  4BBS B;  5BN5 A;  1OXX K;  1O7Z A;  3OMG A;  5DM6 3;  2C9O A;  3DUZ A;  1J8I A;  1LT5 D;  1UNS A;  1SYE A;  3LWU A;  2L55 A;  2FMM A;  3OSO A;  4PMW A;  1TU2 B;  3PV0 A;  1X32 A;  4Q5V A;  1VDZ A;  5C0X J;  1EIH A;  1EYD A;  4A3J B;  2F0Q A;  3UI2 A;  4G7O C;  2YU9 B;  2XVS A;  4C3I G;  1S5F D;  4QF4 A;  2F0H A;  3BDO A;  1F2Y A;  2MGS A;  1UEA B;  1AZQ A;  2BA0 A;  5CR3 A;  2B8G A;  3MXU A;  5FLX L;  2Z4H A;  1SNC A;  3SK4 A;  5F2D A;  2JYO A;  3K6O A;  1WTR A;  3AMU A;  1STY A;  3R93 A;  2NBF A;  3QB3 A;  4J6H A;  4PMB A;  3C3L A;  4IZ8 A;  1Q1B A;  4X3T A;  2L1B A;  1E2V A;  3VYR A;  3NWS A;  2EYH A;  1VMC A;  1ET6 A;  1EZ8 A;  4KD3 A;  4XT3 B;  2RDF A;  1IYU A;  1KAA A;  1MGS A;  4M8A A;  1Q8I A;  2EDG A;  1CM9 A;  3T56 B;  3D4R A;  2SDF A;  5M5X B;  1NCV A;  3J81 L;  1RJT A;  2NN6 H;  5FLX E;  1TY2 A;  2A69 D;  5EJW A;  4XQN A;  1GUG A;  1Y69 U;  1NR2 A;  2YYZ A;  1A3U A;  1JOK A;  1SJH D;  1B9M A;  2R3Z A;  1A2U A;  2WKD A;  1AEX A;  4RAU C;  4DGZ A;  3A8J E;  2XNA C;  3E6Z X;  4PNY A;  2SEB D;  3FEW X;  4BWG B;  3KK7 A;  1PRT F;  3MXG A;  2A6E C;  2D5D A;  2VB3 X;  1MSG A;  1V1P B;  4XDX A;  5IT9 L;  1D5M C;  3HRZ C;  3RMH A;  2WP8 J;  3J81 E;  2F0K A;  3H0G B;  4ABN A;  1CA5 A;  3T13 A;  4J8Q A;  3MHB A;  3RUZ A;  3V2T A;  1C8C A;  3M7G A;  2GA4 B;  4HTH A;  3GTL B;  1SNM A;  4A3K B;  5IGB A;  1QNK A;  3D8G A;  2Q8R E;  1SNO A;  3LX0 A;  1U4M A;  5CV5 A;  1SDF A;  2X6L A;  1Z47 A;  5ELB A;  1W6K A;  4BY7 B;  1EY7 A;  1FNW A;  2NWG A;  2EE1 A;  1HXY D;  5EKK A;  4BA1 I;  2F0L A;  4I65 A;  1JC7 A;  5C0X G;  5IT9 E;  2BCO A;  1EY6 A;  1GHJ A;  2E75 C;  1NSN S;  5C5M A;  1I4H A;  4JK1 C;  4KHV A;  3NBH A;  1IYV A;  1D5Z C;  4BY1 B;  3HEJ A;  3H94 A;  2KCC A;  5K36 H;  5BN3 A;  5E4W C;  3P1H A;  1GUW A;  1AFP A;  1V8Q A;  1E0B A;  4IUT A;  3EQL C;  3IKJ A;  2RSO A;  4RHS A;  1DJR D;  4QUF A;  3T16 A;  4IFD H;  4F88 A;  1J9O A;  2BDO A;  2KED A;  4HMI A;  4HR7 B;  1GUO A;  5JVH 3;  1WTV A;  1HA5 A;  4IUV A;  1LV9 A;  3I8Z A;  4X3S A;  5J39 A;  5KIX A;  2AWO A;  2FMC A;  3OHX C;  1CFM A;  1RF2 D;  2EOT A;  1SXT A;  5K5P A;  3TZD A;  1WD0 A;  3QO2 A;  4K5V A;  2EYM A;  4Y7N B;  1SE2 A;  1B4O A;  2IT1 A;  2I07 B;  5KYL A;  2F0W A;  4IUP A;  4OO1 H;  2IPK D;  2K28 A;  3K5N A;  3MXN A;  3NTI A;  4FNF A;  3S1M B;  4K6L A;  1M4V A;  2G9H D;  3HG9 A;  1KLG D;  1Q3L A;  2KVM A;  4IAL A;  3MA2 B;  1Q90 A;  3V05 A;  3SK8 A;  1HUN A;  4XYQ A;  1QG7 A;  3I3C A;  1QJO A;  4XIG S;  1Y8P B;  3M85 A;  4EQN A;  1O7L A;  4A3G B;  1CHQ D;  3SXH A;  1WTW A;  1SMY D;  2RA4 A;  4QUC A;  1S5E D;  2A6H C;  5C44 B;  1ROD A;  2A68 D;  2BE5 C;  2D2C C;  2FFK B;  1G8Z D;  4IFD I;  1TY0 A;  1I4Q A;  2JA8 B;  4DXF A;  1SNQ A;  1GXD C;  4RA8 A;  4RHR A;  4KK7 A;  1H9R A;  3DXJ C;  4NMZ A;  2F0S A;  1CZG A;  2XN9 C;  2B2W C;  2KEC A;  1T5E A;  2EY1 A;  1NAP A;  4F87 A;  1H9J A;  1EY9 A;  3BVM A;  2MP1 A;  4A3B B;  4C3H B;  4FP5 D;  1ET9 A;  3GV6 A;  3BYT B;  2MUY A;  4IUQ A;  4TQU S;  3R2I A;  2QIL A;  2NVQ B;  2EY6 A;  2EPB A;  1YNJ C;  2PQE A;  5I2X A;  1PTO H;  1BCP F;  2PO4 A;  3RZD B;  1ZYR C;  5JPN C;  1EWC A;  1I4G A;  3K5M A;  3QOL A;  3S17 B;  1B3A A;  2F0N A;  3K5L A;  2L9H A;  1BXT A;  3T53 B;  1CZW A;  3I91 A;  5ELE A;  1DCZ A;  3E5S A;  4A3I B;  4L8J A;  1HFN A;  3NTK A;  1LO5 D;  1ICW A;  5ELF A;  4DK0 A;  3H91 A;  2Z8L A;  4HSV A;  1TS3 A;  4IN3 A;  1JQY D;  2B2V C;  3C1F A;  2RVL A;  1TWC B;  1JWS D;  3L3O C;  5J1Z A;  3ONA B;  3KBG A;  1CA6 A;  5KND A;  4G57 A;  2CW0 D;  1ZEQ X;  5ELD A;  1SYB A;  5D3I B;  3EFX D;  4DAP A;  3S14 B;  3BVG A;  1PZK D;  1D6E C;  2FHT A;  1JB3 A;  3WDN A;  4H7B A;  1QE6 A;  5A35 A;  4CKE A;  1SBB B;  1KTK A;  3FKI B;  1G2T A;  1B9N A;  4A3M B;  4A3E B;  4LMQ D;  1SYD A;  2ZXP A;  1ESR A;  1I6V C;  2B2T C;  3F2U A;  4K5X A;  1F2L A;  3C2P A;  3CRL C;  1TWG B;  4DF7 A;  1XYI A;  2I46 A;  3NSW A;  2E2D C;  3MXP A;  3NHH A;  1DOK A;  3SK6 A;  3X3N A;  2R7Z B;  2NTT A;  1D1I A;  1EFI D;  3GD7 A;  1KAB A;  3M4Y A;  1D1K A;  5DNF A;  1YNN D;  2D9U A;  4J1M A;  4C3J G;  4ZK9 B;  2BDN A;  1FYC A;  1S5D D;  5C3W A;  1ZXT A;  1CQF A;  2CQA A;  3VYU A;  4L63 B;  1SFO B;  2F0D A;  3HS0 C;  1WTO A;  1OXU A;  2K1B A;  5T1G A;  2EYP A;  3Q6S A;  1IL8 A;  2Z4I A;  4EVO A;  5CV7 A;  1LTG D;  1PTO B;  2R6G A;  3SR1 A;  3NK9 A;  1KDB A;  1K8M A;  2JEA I;  2ICE C;  4RFB A;  3MWY W;  1ENC A;  4NP5 A;  2AWN A;  2NVY B;  1IHZ A;  2EVB A;  2WAC A;  3NWT A;  1PRT C;  3FRP B;  4HN7 A;  5KGU A;  4NW2 A;  4OL7 A;  5EBC A;  2PMZ B;  3ND9 A;  1GUS A;  4ILW A;  4CJ1 B;  1D2B A;  2XSC A;  4K2L A;  1STG A;  4K8I A;  1WCM B;  5M3F B;  2B2U C;  1KLU D;  3ERQ A;  2HCC A;  5D14 A;  1XWE A;  4A93 B;  2DN8 A;  3O13 A;  4R8N A;  3KBX A;  2IW3 A;  2H4O A;  2D62 A;  3GTG B;  3D6C A;  1PFN A;  1LTI D;  4WRD A;  2PNR C;  5C4Z A;  2B39 A;  4G7H C;  1PMR A;  1D5X C;  2F0P A;  1HRJ A;  4EGV A;  2OF1 A;  2JA5 B;  2R61 A;  1JCK B;  4DNT B;  1I3Q B;  2L11 A;  1PTO D;  1GJX A;  1Y1W B;  2M2L A;  3RLF A;  4XXE A;  4NKL A;  5E3F A;  3GQB A;  4R8I A;  3GTK B;  4GZY C;  3SVM A;  4CGY B;  3QWN A;  3C46 A;  1ONL A;  3V96 A;  3HOU B;  1PYW D;  1V1O A;  2OXP A;  2WV6 D;  3DEO A;  4ZQ3 A;  4L6T B;  2QDB A;  2B63 B;  5CMD A;  4E6I A;  3W3A A;  1ILP A;  1EOT A;  2B2Y A;  2EYL A;  4CBV A;  4ULL A;  5I9O A;  4BBR B;  5JAV A;  2Y0S B;  4WFN 3;  1IW7 D;  1OXT A;  1AN8 A;  1B1Z A;  4FF2 A;  1O80 A;  4ODG A;  3GTQ B;  2F3W A;  4JBW A;  4HED A;  2EJM A;  1EY8 A;  4TRD A;  3S16 B;  5JEA J;  5EBD A;  1ESF A;  5JEA H;  2ICI A;  2SOB A;  3DWA A;  1SEB D;  3TP5 A;  2J7Z A;  4IUN A;  1HQR D;  5M3M B;  1QCB D;  3R2T A;  5IGE A;  2AQ2 B;  2K04 A;  1TWH B;  1BR9 A;  5C4X B;  3R3O A;  3W2D A;  3FPP A;  4KKU A;  5I6W A;  1WTX A;  1Z7T A;  1E2Z A;  3D6W A;  1R9T B;  1BOS A;  2B8F A;  5C3E B;  3CRK C;  3GTO B;  3FVQ A;  4ZRZ A;  4KKT A;  3OWF A;  3KLR A;  3PUX A;  1A6X A;  4MIU A;  1F9Q A;  1AP0 A;  2F0E A;  1V1P A;  3TP8 A;  4RKL A;  1VF5 C;  4KJN A;  3A7L A;  2F0F A;  1TKW B;  5CV4 A;  4O42 A;  3ND8 A;  4KY5 A;  4HCE A;  3BVZ A;  3D31 A;  2Z1C A;  4RCN A;  2XRS D;  4UAI A;  2A69 C;  1S4Z A;  3X3M A;  4V19 0;  4B08 A;  1EIG A;  2F4I A;  2ID0 A;  3FPU B;  1STB A;  2LMC B;  2O2L D;  4X3K A;  3HP3 A;  3BG3 A;  3I72 A;  2SNS A;  3DWQ A;  2O5J C;  3MFG A;  4PQX A;  4KD4 A;  3H3V C;  4CKB A;  1VCI A;  2VB2 X;  2JA7 B;  5BN4 A;  1WD1 A;  3EVQ A;  4WOR A;  1XX8 A;  1JR0 D;  1G2S A;  1PZJ D;  4M1U B;  5CBA E;  1DYQ A;  1G29 1;  5M9O A;  3S1N B;  3OIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...