4K5WA

Crystal structure of staphylococcal nuclease variant v23m/l25f/t62f at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTMKFMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFFKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k5wA00
1EYCA 1STYA 3P75A 1EY6A 1SNOA 2RDFA 3MEHA 2KQ3A 4ME5A 2F0QA 4KJNA 1EZ6A 4K8IA 2PW5A 4H7BA 1NUCA 1TR5A 2F0PA 4IUNA 2F0WA 5EGTA 1NSNS 1TT2A 5IIFA 3T13A 3EJIA 2EYLA 3TMEA 3SK8A 2O4XA 1A2UA 4MIUA 2PZTA 2PZUA 5C6AA 4K5VA 4N9TA 1STAA 4WRDA 1SNMA 2KHSA 2F0FA 3D4WA 5KGUA 5J22A 4K5XA 2PQEA 5I9OA 3TP7A 3PMFA 3SXHA 5E1FA 4E6IA 3LX0A 1A3VA 5KIXA 1SYGA 5EKKA 5CV9A 4QB4A 4EQPA 5C4HA 1SNQA 2F0VA 3SHLA 2WACA 5HURA 5ISRA 3D8GA 4B9WA 2F0JA 1EYAA 1JORA 4KHVA 1SYDA 4HTHA 2EYJA 4K8JA 2F0EA 2PYKA 4K5WA 1ENAA 3ITPA 4YIJA 5C5LA 3SR1A 3NK9A 3T16A 4EQOA 5IGBA 2RKSA 1KABA 3BDLA 5CV5A 2F0LA 2F0OA 3QB3A 3OMCA 4DFAA 4K2KA 5HGTA 2F3VA 1STHA 2LKVA 4HMIA 5C4ZA 3BDCA 4G57A 5EKLA 4DU9A 4K14A 3TP5A 4F7XA 5KYLA 5DAUA 2OXPA 4KD4A 1EY5A 1JOOA 1KDAA 3C1EA 2EY5A 5CR3A 1U9RA 1STNA 2F0KA 1EY8A 5J1ZA 3RUZA 3HEJA 2F0HA 3VA5A 1SYCA 4NDXA 3OWFA 2EYOA 5CGKA 3C1FA 4OL7A 4ID6A 2F0MA 4F8MA 4K2LA 4B9XA 5E3FA 1EZ8A 4PNYA 5I6YA 1SNDA 5K5PA 4ODGA 4ZUIA 4HMJA 5KEEA 3SK4A 1STBA 3MVVA 3NXWA 5CV4A 1EYDA 3NP8A 3QOLA 4KTAA 1KDBA 2M00A 4TRDA 1EY9A 1SYBA 2EY2A 2SNMA 4WORA 4ZQ3A 2OEOA 4KY7A 4RKBA 4DGZA 1EQVA 4RKLA 2SNSA 4DF7A 2EXZA 2F0UA 2EYFA 4EVOA 3MHBA 3OSOA 1F2MA 4I65A 2PW7A 4PMBA 4QMGA 2F0DA 2EY1A 1KDCA 2EYMA 4KV6A 1STGA 4NP5A 5DEHA 4ZUJA 1SYEA 3U9OA 2F0TA 4K6DA 5CV7A 1SNCA 4KY6A 1KAAA 4EQNA 2F0NA 3NUCA 3E5SA 1TQOA 5CV6A 1A3TA 3DMUA 1IHZA 5CC4A 3OMGA 2EYHA 3V2TA 5IGGA 1JOKA 3MXPA 4IZ8A 5IGCA 3NQTA 2F0SA 3D6CA 3TP6A 3D4DA 4QF4A 2F0GA 4LAAA 2NUCA 4NKLA 5C3WA 3H6MA 2F0IA 5KRUA 5J39A 4KY5A 5F2DA 5KYIA 1A2TA 4KJOA 4IALA 2SOBA 2PZWA 5IGFA 5IGDA 1II3A 4J1MA 1EY7A 1F2ZA 3ERQA 1ENCA 3R3OA 5C3XA 5NUCA 3MZ5A 3QOJA 5CV8A 3DHQA 4S3SA 5IOCA 5JOBA 2ENBA 2HQEA 3SK6A 5JAVA 5I9PA 2EYPA 3S9WA 2QDBA 3NHHA 1AEXA 1SYFA 2EY6A 3P1HA 4J6HA 3SK5A 3TP8A 1JOQA 5IGEA 5IODA 5I6WA 2RBMA 4KD3A 1F2YA 3HZXA 1EY4A 4PMCA 4NMZA 1RKNA 5M9OA 3EVQA 3EROA 2OF1A 5C5MA 1SNPA 4N9PA 4R8NA 1EY0A 2F3WA 1A3UA
chains in the Genus database with same CATH superfamily
4A3BH 4ME5A 3ULJA 1PRTF 5BR8L 4BA2I 4ALPA 1E1OA 4B3RL 2CWAA 3QG1A 5EGTA 2QKIC 1KNAA 3CC7A 4MIUA 1A62A 2RCNA 2PZUA 2BDNA 3W2DA 3RN5A 2JXMB 4A3DG 2CFMA 1XPOA 2E5LL 2C9OA 3W5OA 5M5WB 3OTOL 1BCPC 1T5EA 5EKKA 1QWYA 1TS4A 2WACA 4DV3Q 4H02A 4BBRG 2Z4IA 4O0AA 2Q8IB 3BDOA 1RJTA 1N34L 2B29A 4DAPA 3BDLA 1W6JA 2QEXA 2R7ZH 3IKJA 1RHPA 1YNXA 4C1NI 4DU9A 2Q2UA 3BYYB 3HOZB 2QDLA 3RUZA 3LWUA 3NELA 1IZ6A 5C4JB 4BY1G 4Y7NB 3K7AB 3FKIB 2O5IC 4KMUC 4C2MB 4HR7B 3F2UA 2N88A 2SDFA 3EFXD 2AQ1B 3IAYA 4X62Q 1WCMG 1SYBA 2E8GA 3MFGA 4I65A 1X54A 5IYBG 1LT4D 2EY1A 2F0DA 3FHWA 1STEA 1SYEA 3D6WA 3K5MA 1OXVA 1DOLA 4C3JG 2EYHA 1O7ZA 3CPWA 3OIPA 3NQTA 3HOXB 3NBHA 5C3WA 4HN7A 1EEFD 1IBML 2VB2X 3ONAB 2OTLA 1I6HB 4TSSA 4OWWB 1PTOB 3H0GG 3CMEA 4HSPA 3QJYA 2UXCL 2VXWA 3VR5A 1F9SA 2CQOA 2ENBA 4A3DH 1CKNA 2C35B 4J6HA 1SYFA 2F4VQ 2IJ0A 5JJIA 1FJGL 2ALYB 3J81j 3HZXA 4A3KG 4BBRH 4G4KA 3VR3A 4FF3A 5FLXc 4R4QA 4LF5Q 1AZQA 1H9SA 4FYDA 3S24A 1EY0A 3T1YQ 3E3XA 1JQYD 2UUCQ 2EJMA 2AUJD 1HNZL 2GVAA 5IWAQ 2RDHA 1L1OC 3EQLC 1Q90A 3KBXA 3UI2A 3A7AB 3RR5A 1CI3M 4BY1H 2B2TC 1S5FD 2MO1A 3ULLA 4HIDA 2DNCA 1LV9A 2ZTCA 3PMFA 1PRTC 2A5HA 5E1FA 1B2TA 3PIPA 1SYGA 1W3SA 2BOSA 2MJ8A 1WCMH 3CCEA 4NB3A 3VR6A 4RGMA 2WP8J 4IPGA 3AFPA 3K80C 4A3JH 4ULLA 1CFMA 3S16H 1JORA 1WOCA 2K14A 3L2PA 2D0PA 3T16A 4YIJA 3NSWA 5IYBH 2JA9A 3NPPA 1KQSA 5IT9E 2F0LA 1W2BA 1WI5A 3TS0A 4C3JH 3MXNB 3C3LA 3OW2A 1XJVA 5DAUA 4KD4A 3MA2B 4A93G 3Q6SA 2F0HA 1SYCA 1D1IA 2B2WC 1CK1A 4IURA 2ZTEA 4ID6A 5G3LD 5CGKA 3T1HQ 3H0GH 4B9XA 2R92B 4RG1A 1HCZA 4PNYA 1QUQA 2Q8TA 3M7GA 3M3YB 4HSVA 4HJ9A 5C3EG 1JCKB 4G7HC 2JA7B 5FK9C 3QOLA 1QNKA 2M9VA 2B2VC 2OEOA 3AFQA 2SNSA 2JE6I 2XSCA 1F2MA 4FF1A 4DR1Q 2C5CA 3A8KE 3ICEA 2N8NA 4JI5L 1I94Q 2UXDQ 1KAAA 1TQOA 4PQXA 3I70A 3RLFA 3OMGA 2G9HD 4DPGA 3H15A 4HJ8A 1C8CA 3PO3G 2F0SA 1UEAB 1IKLA 3BJUA 4N8FA 2F0IA 3IFTA 3GTKH 4GLXA 3BZCA 4KHPQ 2L12A 1QB5D 2HHHL 5M3FB 4S3SA 1EFID 1PA6A 2HQEA 3OYYA 2R93B 3M9BA 3T53B 1UAPA 4JI1L 3SDZA 3P1HA 1N33Q 4Y52H 3GD7A 1LACA 3K59A 5LHY1 4DV7Q 1X6OA 1AFPA 1SJED 4DNTB 1RIPA 1CZGA 4IUVA 1R4PB 4JI7Q 3BVZA 1XXGA 5ELDA 2ICEC 2VQEQ 1EYCA 1A8VA 5M5XB 2A74C 3JAME 3GV3A 1HNWL 4A93H 1Z7TA 4P72A 3J80L 1GUGA 2K33A 3X3MA 5IIFA 1K8OA 2EYLA 1IBKQ 1EL0A 1XNRL 1RTOA 5CBEE 5C6AA 4QJFA 3S2HH 1EQQA 5C3EH 1VQIA 4Q0FA 1E24A 4E6IA 1V1OA 3FMCA 2RQXA 3Q0AA 3U9SA 1CUKA 4BY7G 1EYAA 4JI4L 4JG2A 1ML0D 1ENAA 3ITPA 1G51A 3M85A 3K0YA 1X9NA 3BS1A 4XXEA 4X64L 1SMYC 5D3DA 2QW7A 5ELNA 3KJPA 3PO3H 4JI8L 1HQRD 1LTGD 2CH4A 1Z47A 1PH9A 4JBJA 2F0MA 1CTMA 1CA6A 2DJGC 1GOZA 4AYBB 2HDMA 2VB3X 2SNMA 4F87A 4GKJQ 2A8VA 1LLRD 4BBSB 5DEHA 2ZXOA 2F0TA 2EJGC 4X3UA 4OX9L 4EQNA 3U58A 4B3TQ 1VCIA 1A3TA 1MSGA 3A5ZB 4IZ8A 1V1PA 3CPFA 4NKLA 2EIFA 3GTJH 3H6MA 5TSSA 3S1RH 1G8ZD 1Q86C 1A2TA 1DJRD 3A8JE 1J5EL 1GO3E 4YY3L 2CWPA 4A4IA 3QOJA 1G2TA 3F2DA 1AW7A 5IOCA 2A6HD 4R9WA 1KC8C 2OQKA 1SLJA 3L3OC 2VW9A 3SK5A 5LMUQ 1IYUA 1Y1VB 5I6WA 2R7FA 4KD3A 1P16A 4BY7H 3NQIA 4JI3Q 3CF5A 4C3IB 4L5SA 5C5MA 4JBMA 3CD6A 1DYQA 3GTMB 1F2LA 1SNOA 1V8QA 4AYBE 1NTGA 1K8AC 4IUNA 3R2IA 3T4AC 3S1NH 1XNQL 1Q12A 4CKCA 2EQSA 5GQOA 3SK8A 1HNXL 4FXKC 3GTPB 1RODA 4K5VA 2EXDA 3CHBD 1JJGA 4LFCL 5CBAE 4XQQA 3KF8A 1KRSA 3VYTA 1JC7A 1GM5A 1RL2A 2ATWA 1VQ7A 4EQPA 5HURA 1A15A 2JEBI 1JE4A 1PH8A 3RD4A 4DV4L 4XYOA 1K3BC 2Z8LA 4JV5Q 3N52A 4FVMA 4RGNA 2YTVA 4KKSA 2BE5C 1YVCA 3RNUA 1VQOA 5BR8Q 4B3RQ 5EJWA 2IWHA 4LWCA 2V4DA 3T56B 3VA7A 3CC4A 2JA5B 1SNDA 3UDIA 1PZID 3KYHC 4DR3L 2E5LQ 1DM0B 2K01A 3OTOQ 1VF5C 1LTTD 2LMCB 1ESFA 1Q3LA 1SEBD 4R8IA 2K5DA 1MSHA 4NP5A 5KNDA 1LTLA 2LXJA 3GP7A 1QILA 5CC4A 3DMUA 1HA5A 2R3ZA 4UAIA 4HEDA 5FOBB 1AE3A 2K5HA 5EBCA 2H5XA 4YCUA 3DWAA 4LAAA 1H95A 4MZ9A 2MQHA 3MC0B 4IALA 3ERQA 1I3QH 3MZ5A 2NVYH 3FP9A 1IL8A 2LXKA 5JAVA 2E2DC 3NHHA 3GTGH 3PF4A 1SE3A 2YV5A 1DGSA 5J3BA 3Q22A 3E9HA 4XIGS 3OHXC 3EVQA 2NWGA 2WB1G 5IYDG 3O13A 2I5MX 4JK1C 2R6GA 1EY6A 1C0AA 4LF7L 2NVTB 4CDDC 3I72A 4H7BA 1NUCA 3BVMA 3HOYG 4JI2L 4ZKCB 1IBMQ 3I55A 1KIXA 3T13A 4HJ5A 2K05A 4IUTA 2UXCQ 1FNUA 1KNEA 1UNSA 1BCPB 2DNEA 5CV9A 2UU9L 1FJGQ 3SHLA 1JWUD 1BBUA 3HFZB 1PH3A 3J80E 3RZDH 5EKIA 4K8JA 3X3NA 1X65A 2PYKA 5L37A 3S1QB 1NE3A 3NK9A 5C44B 4L5QA 1OO9B 4DAYB 1DD2A 2EE1A 2J7ZA 5HGTA 3H91A 5FLXL 3P7JA 4IPHA 2PO4A 2XGTA 3IL8A 1HNZQ 2EY5A 1BO0A 3KBGA 1IW7C 3PIP3 2YYZA 3RMHA 3Q8DA 2RVLA 1SRUA 4RH6A 1PXUA 4X3SA 3HOWB 5I6YA 1TWHB 4ODGA 2R7ZB 1OXXK 1O7IA 4OONA 1J9OA 1S4ZA 1B3AA 4TRDA 3HOVG 1Q46A 4ABNA 4NPSA 2RA4A 1YHAA 2A68D 1SFOH 3PO2G 3OSOA 5IYDH 2GA4B 1UE1A 4LJZC 4BA1I 1WTQA 5JJZA 1S40A 1K0RA 2F52A 4ZRZA 1M4VA 1FGBD 1Y8NB 4X66L 1JWSD 1TWCH 3TN2A 1XPRA 3HOYH 1QOHA 4G7OC 4GN4B 3PV0A 4OXPA 2HQLA 4AIMA 4LFAL 2JA6B 3N6RA 2E2IH 2QDBA 1AEXA 1Q1EA 2NVQH 3KLSA 4NW2A 3BU2A 5JEAG 4DXFA 4GKKL 1K0SA 4L6TB 2OF1A 1HR0Q 1LYLA 3EIVA 1HTLD 2WAQG 1CKMA 1QZGA 5AJ3L 3S1MH 3RN2A 4GOPB 1O7LA 3NE5B 4X3TA 2Z6BA 1JJCB 2DGYA 2ZJPA 2MHVA 1XMQL 1G6PA 4DR6L 2Y0SB 3MFYA 2HHHQ 4A3MG 1E1TA 4JI1Q 1UE6A 1A3VA 2G5DA 5IY0A 1H9KA 4JPBW 1EU3A 2HT1A 1PYBA 3HOVH 1I6VC 3D8GA 4OO1G 3HGBA 4ZKBB 4P75A 5E4WC 5BN4A 4DUZL 1X3FA 1SYDA 1LTBD 2EYJA 4RHSA 4BY1B 2ZM6Q 3PO2H 4QUFA 4IPDA 1EOTA 2F1MA 2VL6A 1C48A 2F3VA 2B63G 5I2YA 1TWGH 5G3LF 3KLSX 5KYLA 3VR2A 2D0OA 2E2JB 1B9NA 5C4XG 1P8LA 4GNXA 3GV6A 5M3MB 5GAHC 4C3JB 4QGUA 1SN8A 1B4OA 3E0EA 4X6AH 2KVMA 4DV2L 4G7ZC 3NTIA 4FXGC 5JEAH 1UE5A 1MD2D 2VZAA 2Y0SE 3MWYW 1BBWA 1SE4A 2PW7A 1WFQA 2K5WA 4RMFA 5CV7A 3GTQH 5EQ0A 4KY6A 1VQPA 2H1EA 1IHZA 3SEBA 1JOKA 2BA0A 2KOLA 4JI8Q 5KRUA 2L55A 4A3KB 1GUSA 1F2ZA 2CW0D 1S72A 1QZHA 5LMNW 3HKZB 4A3MH 2FXQA 4RHRA 2KUMA 1VQMA 1SDFA 1LO5D 3PUZA 2RSOA 4A3JG 2DJFC 2E2HB 3TP8A 1K83B 1GUTA 2K1BA 5KNBA 3D31A 4OO1H 1EY4A 3K0XA 1PZKD 1ZXTA 4XT3B 1NAPA 4R8NA 3DWQA 4R4CA 1STYA 3CCQA 4OX9Q 1VQHA 2RDFA 5LMNL 2KQ3A 4KJNA 1EWCA 2B63H 4RWSC 3I4NB 1B3QA 1NSNS 2Q2TA 1K73C 4LUVA 2IPKD 3EJIA 5C4XH 1EIYB 2E76C 2OCEA 4XTCS 1QVGA 3URYA 2IX0A 2WINB 4YY3Q 3M4OB 3FVQA 3MXNA 1PFBA 2KHSA 3CQZH 1JT8A 4K5XA 3I91A 1MKHA 2ICIA 5D14A 4JYAL 3LX0A 4JI0L 3ULPA 1ZKOA 5ELEA 4A93B 2JP1A 4IUUA 2F0JA 3B6YA 4P71A 1I50B 2PI2A 4HTHA 4APVA 5C5LA 3SR1A 1LUZA 4OELB 4DR2Q 1HTPA 1YJ9A 3HOZG 3HKZE 2D9UA 3OMCA 3P20A 1MJCA 4KLKA 5C3EB 2VQFL 1KHIA 3UE0A 2KCNA 3FKIG 3KK7A 3FPUB 3KUPA 1EY5A 2X69A 3C1EA 2F03A 3CCJA 1XNQQ 4NDXA 4JI6L 1A6XA 2EYOA 2N55A 4CDEC 2RCFA 1HNXQ 2ES2A 4R4TA 5IP9G 5IT9c 2CH4W 4R4OA 1ENFA 5KEEA 4LFCQ 5CV4A 1ET9A 5FLXE 1G2SA 3JC66 1HHVA 3KDFB 3SVMA 1YHBA 4LF9Q 2KHIA 3FRPB 3HOXG 1TY0A 1JB7A 2JA8B 4DR4L 1NMGA 1FD7D 4DV4Q 4QQBX 3U9OA 1R4QB 2Z4HA 1HA6A 4LF8L 2LSSA 1TS3A 3NBHB 4FXDA 1SR3A 3V2TA 1NBWA 1HXYD 2NYZD 3S15H 3HOUB 1PFSA 4QF4A 1E7ZA 4NXNL 1HRJA 3QO2A 1IXRA 1JWMD 4KY5A 4HIMA 5M5WH 1II3A 5C3XA 1Q1BA 1XYIA 2K6AA 5JJKA 4LFBL 2M2LA 4DR3Q 4LF6L 3TREA 4UPAA 4OO1I 2AWOA 3S1RB 2ZT9C 2Q2HA 2KJXA 1EFWA 3GQBA 5EPJA 2HD3A 1TVXA 4DV5L 1ESRA 1X3GA 2LS01 3HOZH 3W1BA 3P75A 3J7AV 4LF4L 5C4JH 4Y7NH 3K7UC 3K7AH 3FKIH 4DUYL 4B3ML 1WTPA 2IY5B 2K75A 4BY7B 2F0WA 1EYGA 1FNVA 1H9JA 2XVSA 1FR3A 3CCMA 1TKWB 2L0CA 4X3KA 4DK3C 5KGUA 1GVPA 3D4WA 5IP9H 2A1AA 4KKTA 2PQAA 4YHHL 1LABA 2B3GA 4C1NK 2NTTA 3NTKA 3WWVA 1YNND 1QCBD 5T1GA 1GUNA 2B39A 3HOXH 4EQOA 3QB3A 4N8X1 1I6HH 4B3SL 4LF7Q 3BDCA 4GNXC 3JAMi 2R92G 3STBD 3KF6B 4J8QA 4UP8A 4DAMA 1D7QA 3ZYYX 3NBIA 2L4NA 1HJPA 5FO8B 3CU7A 1TXYA 4LW1A 1PH7A 4DAVA 2XRSD 2JQOA 1X3EA 1EYDA 3NP8A 1R9TB 1D5ZC 1TWAB 3I73A 3MAQA 2UU9Q 4DF7A 2YTXA 1E2VA 2HIXA 3TRZA 4DV3L 1ZYRC 4O2DA 4K6DA 3VYRA 1GHKA 1WVLA 4FF4A 5M3FG 2VUMB 1PTOD 1AZPA 2AUKA 3BYTB 2B2UA 2R93G 1XX8A 3R93A 1Q82C 1MI2A 1AN8A 4J1MA 1QVFA 3ND8A 3NENA 1K3RA 2K28A 1MBYA 4DV6Q 2K52A 1T5XD 3S9WA 4OEMB 1F9PA 4JC0A 2A6HC 4EQ5A 1S3OA 1RKNA 3PUVA 5JEAJ 1SNPA 3S17B 3I4MB 2NVXB 1PYWD 3KLRA 3F2BA 4IO9A 4AQYL 1UE7A 1XTCD 1ET6A 3I56A 2TMPA 1EZ6A 4X66Q 5M5YB 2R92H 1TR5A 2Z6KA 2O5JC 3M3YH 3C2PA 4MTNA 4FP5D 4L8JA 3TMEA 4KI0A 4A75A 4A3EB 1Y1WG 2BDOA 3LGJA 4IFDG 1VQLA 5C4HA 3CRLC 4C56C 2VNUD 4B9WA 5IE8A 1B1ZA 4I7ZC 4DV1Q 2F4VL 4UP7A 2NZ1D 4QL5A 2B2YA 4K5WA 5EPLA 2YU9B 1DZ1A 5CV5A 4EGVA 1QNUA 4QCLA 4HIOA 4DR5L 1A0IA 3GDEA 2ZJQA 4P74A 1B44D 3T1YL 3PUWA 1YEZA 2CHBD 3LNNA 3TP5A 5M3FH 4IOAA 4FF2A 4RCOA 1JOOA 2I07B 3J81L 1PMRA 2R93H 1XMOQ 1I4PA 3OWFA 1XMQQ 4DR6Q 3S14B 4F8MA 1AH9A 2KEEA 2I5HA 2UUAL 1M90C 3MVVA 4CHTB 4DNRB 1E0BA 4BBSG 1JE5A 2MO0A 4DK1A 4PZ7A 5K36G 1EQRA 5M5XH 3F1ZA 4DUZQ 3MHBA 2BH8A 4PMBA 4U673 4OGQC 5EPKA 4KV6A 2FINB 1FNWA 3WOEA 3LWEA 1TS2A 3D6CA 3RZOB 4DR7L 5GROA 2J0TD 2B8GA 3AQQA 4XYQA 4LMQD 2AQ3B 1LT3D 2EPBA 4C3HB 4YCWA 5JOBA 1VS0A 2I5LX 2JK8A 2MNAA 4A3GB 1OXUA 1Y1WH 1EIHA 4C3IG 1TS5A 3T1HL 1NJIC 4DV2Q 4IFDH 5FLMG 3GTLH 1PFMA 4FDBA 1K28A 4AH6A 1N34Q 1ICWA 5C0XG 2A19A 2N3SA 2IHFA 1RDPD 4PZ8A 1KXLA 2NZOA 3FEWX 1B7YB 1A3UA 3PF5A 1EOVA 1KTKA 1IL2A 3MEHA 1VQ6A 2GN5A 3AYHB 1TWFB 1SXTA 1UWVA 2LFNA 3S2DB 2F0PA 2RF4A 2WIIB 4Z9CB 3U50C 3EN2A 2ZTDA 1V43A 1TT2A 1Y14B 4DAYA 1CQVA 2O4XA 3TSSA 3KF8B 2DN8A 2KHJA 4A3IB 1GXDC 1K8GA 4KHPL 5DM73 1KLUD 1GD7A 2K5VA 5KIXA 2KECA 4BBSH 5I2XA 1G291 3PIO3 3U4ZA 5K36H 3MXUA 1B53A 1CHPD 4RAUC 1C4QA 1VMPA 2B8FA 1EIFA 2QGQA 2FHTA 4HCSA 4OHJA 4RCNA 2KCTA 2ZJRA 3TZUA 1IYJB 4K2KA 1JR0D 4HMIA 4JI7L 2XIWA 5LMNQ 5EKLA 3HOVB 2A6EC 1KDAA 4A3FB 5J1ZA 4A3BB 2RHQB 4BXXG 2XTIA 1F9QA 4ZYSA 1NCVA 1PZJD 3VR4A 2PMZB 5DLQE 3SK4A 1VF7A 2Q2IA 4C3IH 4NXML 4JYAQ 3V96A 4JI0Q 1IBLL 4MHEA 4LUOA 5FLMH 1Y8PB 4JVZA 2EZVA 2G9DA 1Y69U 2AHOB 3GTMH 4RKLA 3J80i 2UXBL 5C0XH 1YNJC 2XWBB 1QVCA 4DK6C 3VDYA 1VMCA 3A56A 2EYMA 4A76A 1M8AA 4QIWB 2A68C 3WDNA 2B2UC 3CXCA 1NY4A 1PYSB 3L0OA 3TBIB 4BS9A 4OWXB 3W3AA 5F2DA 2GVBA 1HZBA 1YJNA 5D3IB 4P2CB 3I4LA 1UEBA 2TSSA 4HJ7A 3CW2C 1VQDA 2MUYA 2R61A 4GOPA 3SK6A 4IFDI 3A0JA 1X55A 5T1IA 3NEMA 4IQZA 3CCSA 2RBMA 4IJHA 4GKJL 4DR4Q 4A3MB 3WOFA 5E4XA 1WTOA 1AE2A 2PMZE 3CRKC 4LF8Q 3NTHA 4YWMA 3I90A 4CBVA 2JA5H 5FO7B 3SGIA 4NXNQ 1VQ9A 5COYA 2D2CC 4BXXH 4QIWE 1SNMA 3AB9A 1HUMA 4LFBQ 2MGSA 1PHJA 3SXHA 1HZAA 1VDZA 1EUJA 5CMDA 4CGYB 5C44G 3OW7A 1B50A 3DXJC 4A3DB 4UDUC 4JI5Q 3UE1A 4KHZA 1OXSC 1VQ4A 2OQ0A 5FO9B 2YTYA 4IN3A 2F3IA 3KFUA 4KK7A 2IX1A 1L1OB 4BBRB 1STHA 2K4KA 3D0FA 2B2VA 5D65A 4V190 3HOWG 4DUYQ 4B3MQ 1CHQD 3UDFA 2F0KA 3TEHB 2FMMA 3KOJA 2K03A 1LTID 3HP3A 4OL7A 4ILWA 1PRTB 4A3CG 3A74A 1VQBA 1S5ED 4L5TA 3PGZA 1C9OA 5EAYA 1PH4A 5C0XI 4DV0L 1KDBA 1PH2A 3BZKA 5DNFA 4ZQ3A 4DGZA 4HJAA 3J81E 1G6ZA 2EYFA 2KENA 2NVTH 5LL6X 1D6EC 4RA8A 4XQJA 1STGA 3A55A 1FYCA 2XN9C 1WCMB 3J81i 4R1JA 4O1NA 1N32L 1HNWQ 3PSIA 3RLNA 4A3JB 3S16B 2IL8A 3G7LA 5IGCA 4B3SQ 3CCLA 2JA6G 1XNRQ 4GS3A 2F0GA 2NUCA 3RLOA 3K58A 1KLGD 1D5XC 1CT1D 1BDOA 4J15A 2ZXRA 2P5ZX 2HCIA 2K7VA 4POGA 2L1BA 2PNRC 1VQ8A 1I4RA 2CW0C 4JI4Q 4CDFC 3S15B 3S1QH 5KNCA 5C44H 3H0GB 1H9RA 4H0LC 3J7YW 3PUXA 2A69D 4X64Q 4HIKA 3U4VA 5JPNC 4N9PA 1SE8A 3HG9A 2F3WA 2Y0SG 2BA1A 2JN4A 1LT6D 2F0QA 3BG3A 4ZLTF 1E2WA 2PW5A 5LL6S 3HOWH 4UY8C 1EQTA 1TWHH 1XTDA 4FO2A 1N8RC 2N49A 4HAEA 1W6KA 5ELCA 2PZTA 1YBYA 1BCPD 3VYSA 1JJ2A 4EX5A 4A3CH 4PV1C 3GTKB 1I5FA 5FJ8G 1ILQA 1V1QA 3FDTA 3M4YA 2IX3A 5H1SE 4YCVA 4ME3A 3A54A 4XDXA 4IFDJ 1D8LA 3PIOA 2QF7A 4M1UB 1PV4A 3DLLA 3TZDA 4DFAA 3KDFA 1HPCA 4AQYQ 1MJEA 4X65L 1J5EQ 4G57A 1Q8IA 5M3MG 4GNXB 2JA6H 2OXPA 1RF2D 1Q7YC 3IFDA 2HIVA 1Y8OB 1G91A 1HZCA 4K2LA 2JJQA 4RGOS 4PZ6A 4XT1B 1SAPA 1OTCA 1MGSA 3F8TA 4K0KL 4KTAA 2M00A 4WORA 3SE0A 3PQIA 1ZEQX 3S2HB 4JBKA 4EVOA 3W1GA 1KDCA 1PTOF 2Q8RE 3GTOH 3NUCA 5CV6A 1Z9FA 3E5SA 4DR5Q 4DN4M 1VQEA 1BF4A 3HKZG 4OIJA 3CAMA 4DNIA 3J7AF 3D4DA 3MXGA 5I4DA 5HGQA 5KYIA 4GOPC 1BUVT 3QR8A 1YIJA 5IGDA 2WFWA 1ENCA 1LTSD 3NWSA 3PO3B 2OWOA 1VQFA 4QY7A 1X32A 2UUAQ 5I9PA 2EYPA 2N78A 2IW3A 1EWIA 2EY6A 5FJ8H 3J7A5 1BR9A 2RSNA 1F2YA 1YZ6A 4NMZA 1E2ZA 5M9OA 2EJFC 1U5KA 2HUGA 5C0XJ 3I4NG 1QG7A 2QCPX 1Q8KA 2E2JH 3OWEB 5DM63 1CKNB 3UDXA 5M3MH 2UUBL 1TY2A 1PFNA 4DR7Q 1O80A 1S5CD 2NBFA 4A3LG 4GN5A 1EIGA 2NN6G 2FJ2A 2J4XA 1PRTD 1HR0W 1SJHD 1CSPA 4XQNA 4WRDA 3E9IA 5J22A 3GTJB 1H9SB 5I9OA 3DWPA 1Q81C 3F2CA 1MIUA 3KF6A 4H13C 1F9RA 2ZXPA 4HCEA 1EEID 4Q5VA 4CDCC 2AWNA 4FNFA 3DM3A 4KHVA 4JOIA 1ONLA 5CYUA 3R2TA 3J7ZC 3M4PA 1XPUA 2K50A 1TU2B 1YNNC 5ELBA 4C2MH 4A3KH 2H4OA 1N36L 1PH1A 1HR0L 2OT2A 1B9MA 3K5NA 5C4ZA 4F7XA 2K5QA 1S5DD 1SMXA 5JVG3 3I2ZA 1BQQT 4POFA 3VA5A 2I46A 2E2HH 3E6ZX 1K83H 3STBC 1O78A 3JAMc 2EOTA 1EU4A 4I7AA 1L2FA 2IHEA 3S1NB 3A8IE 1WTWA 2JA8G 1ICFB 2V1CC 4TKOB 1EY9A 2EY2A 2R7DA 4GN3B 2QA4A 2BCOA 2SEBD 3HKSA 3HOUG 3L9AX 1X3QA 1PTOH 1U4PA 4ZUJA 2FMCA 3I4NH 5JJLA 1AP0A 3I7FA 1J6QA 2F0NA 5IYCG 4JI2Q 2ZM6L 2JA7G 1QUQB 3M4OH 4IUPA 1RD9D 3T51B 2PI2E 5FKAC 2PCFB 1VQJA 3V05A 1L0YB 4A3LH 5A2QL 3CCVA 4KJOA 3OOCA 2SOBA 2PZWA 3IRBA 2NN6H 1YITA 1PTOC 4JBWA 3AU7A 4UHVA 3CC2A 2FFKB 5GADC 5CV8A 4KN4C 3K6OA 4ZCKA 3BZDB 1I50H 3CCUA 4M8AA 1U0LA 1PH6A 4NXMQ 5IGEA 1IBLQ 1HH2P 1WTVA 1NR2A 1CM9A 2UXBQ 2K32A 4WJ4A 5BN3A 1D5MC 4QUCA 1Y1WB 1F77A 4O42A 4R4IA 3GTLB 2L15A 1YHQA 1HQMC 1N9WA 3Q24A 3M7NA 4WJWA 2PQAB 5E7NA 1H9MA 3QIAA 1K9MC 4U68A 2KBNA 2CCZA 2OTJA 2VS1A 2MFIA 1IYVA 3TP7A 2F4IA 4X62L 1UUPA 3M4QA 2JA8H 1DXMA 1I3QB 1SNQA 2NVYB 4ZAIA 3DEOA 1I4GA 4LUZA 1GUOA 3HRZC 1SMYD 1BXTA 2LY7A 3GTGB 2F0EA 1CA5A 3HOUH 1BOSA 5IGBA 1ZYRD 4CKBA 1KABA 3QWNA 5ELOA 2X6LA 2IT1A 1DOKA 5IYCH 2JA7H 2RDGA 2XNAC 4TVAB 4K14A 4V0BA 2HCCA 4IPCA 1U4MA 1X3PA 4LFAQ 3H09A 2WKCA 1T9HA 5K5PA 1KD1C 1STBA 1VQAA 4GKKQ 1JICA 4WJ3M 4KY7A 3G48A 4F88A 2EXZA 1KRTA 2QILA 3OPOA 5AJ3Q 4QMGA 4LF5L 2VUMG 3Q23A 1E22A 1BBXC 2NTSA 2Z9HA 4KN7C 2CQAA 2UUCL 4B08A 5GAEC 3RZDB 4AYBG 5IGGA 1GKHA 4DR2L 3MXPA 5IWAL 2NN6I 3HS0C 5A35A 1SROA 4OWTB 2EVBA 2Z1CA 2JEAI 4L5RC 1FVIA 1D1KA 1EY7A 1VQCA 3R3OA 1WD0A 1MHWC 3DHQA 2KCMA 4PMWA 1ILPA 5CORA 2L5TA 2WV6D 2ID0A 4IOCA 1KAWA 3I4MG 5IODA 4DA2A 2JSOA 4DV0Q 1RTNA 1NR4A 1BKBA 3ER0A 4MNOA 1L0XB 4PMCA 1V1PB 2ASBA 3CP0A 4H44C 1QE6A 4GLAC 4JCVE 3DUZA 3EA6A 4LF9L 1PVOA 3TS2A 2KCCA 1HZ9A 4BWGB 1N32Q 1SFOB 2I0QA 4A3EG 2WB1B 1ASZA 4K8IA 2MPMA 1Y1VG 1U4RA 1CZWA 2D62A 3G4SA 3DEPA 3NWTA 1KL9A 1A2UA 2XWJB 3G6EA 1R9TH 1TWAH 1TWCB 1STAA 2BH2A 3DM1A 2PQEA 1HFGA 3HOYB 1CQFA 2HDLA 4JOIC 3TDQA 2JYOA 4QB4A 1B8AA 2CKZB 5ISRA 1VQGA 1JMCA 4DR1L 5HY6A 2E2IB 2VUMH 2NVQB 1I4QA 2BE5D 2RKSA 1I94L 2UXDL 3R8BA 2F0OA 1A63A 1S5BD 3PUYA 4YWLA 1EY8A 4UP9A 4CKEA 3HEJA 3S1MB 1E3PA 4MTKA 1VQ5A 1VQKA 3E0JA 3D4RA 5E3FA 1GHJA 1NNXA 4ZUIA 1ASYA 3NXWA 3C46A 1N33L 1LM0A 1GJXA 3G6JB 3S17H 3MTSA 4LNQA 1I4XA 2WB1E 4DV7L 1NMFA 1WTHA 5BN5A 2NVXH 3I4MH 1I4HA 1EQVA 2DUDA 2D5DA 2F0UA 1O7YA 5M5YH 1DONA 1V9PA 2E75C 2JA5G 3AEVA 3KLWA 2L9HA 2VQEL 3H3VH 1YI2A 1SBBB 3J80c 2DY7A 2KEDA 3PO2B 2XRQD 4C3HG 4X65Q 4A3EH 4ZK9B 2NB0A 1Y1VH 5J39A 4A3GG 4JW0A 1U4LA 3K5OA 5IGFA 1IBKL 4DXGA 1TWGB 3H3VC 1JB3A 3CKIB 1CKOA 3L7ZC 2NZHA 4K0KQ 3ZJYC 2YU9H 1LTRD 4DKAC 2EDGA 3EBEA 2X6GA 3I3CA 3K8AA 4OIKA 5A2QE 4PG3A 4RFBA 2VQFQ 3GTPH 3BVGA 3VYUA 3K57A 1VQNA 2RHSB 1CSQA 1J8IA 2MP1A 1FGUA 3S14H 4JI6Q 3GO5A 4CJ0B 1BCPF 4A3IG 2A6ED 4GLVB 2KA7A 2WAQB 2AMCB 1OXTA 1RCVD 1Z6HA 3GTQB 4CJ2C 4IJLA 3UDGA 5JPMC 1L1OA 4N9TA 3I4OA 5IT9L 2F0FA 4LK1C 4CJ1B 3K81C 2PNHA 2AQ2B 3AMUA 1TIID 2B2TA 3MEFA 1XWEA 3A5UA 4DV6L 5IP7G 5AFWA 5ELFA 2F0VA 1M1KC 1BNZA 2O2LD 2Z6KC 3A7LA 1YNJD 1L0WA 2L11A 3RZOH 1LTAD 1HFNA 4A3FG 2K04A 2AKWB 4B3TL 4A3BG 1IW7D 3KJOA 2CVRA 2LKVA 5JVH3 4C3HH 2UUBQ 1X56A 5CR3A 4L63B 4A3GH 1U9RA 1STNA 1YJWA 5GAGC 1B70B 1PLFA 1DCZA 3C1FA 1K8MA 4LF6Q 3OIQA 2B63B 4YWKA 2B2YC 1LT5D 4DK0A 1EZ8A 4P73A 1SE2A 4HMJA 2B2WA 5C4XB 5LMUL 4DV5Q 4RKBA 1WYDA 3CQZB 1SSOA 2WAQE 4IUQA 3CCRA 4JI3L 3H94A 4K6LA 1TWFH 3H3VI 4LF4Q 1WTXA 3S2DH 4DV1L 5EBDA 1SNCA 1PDQA 1WD1A 4WFN3 1FL0A 2R7ZG 1N36Q 1JOQA 2DY8A 2WKDA 2Z0SA 1PH5A 3TP6A 4A3IH 4TQUS 1GUWA 3J81c 4MN3A 3ND9A 1BVSA 3G71A 4YHHQ 2PPBC 1IKMA 5NUCA 3GTOB 3FPPA 1XMOL 1EWHA 2K5NA 2E74C 2VY3A 1HUNA 2QEJC 1WTRA 3PCOB 3K5LA 3JAML 4GZYC 5IP7H 2A73B 1C7YA 3I8ZA 1D2BA 3ERSX 1DOMA 3EROA 3TQYA 1WJJA 3CMAA 4RGTA 1QJOA 3D3RA 4KKUA 2A69C 4JV5L 4A3FH
chains in the Genus database with same CATH topology
4ME5A 1PRTF 4BA2I 3QG1A 5EGTA 2QKIC 1KNAA 4MIUA 2PZUA 2BDNA 3W2DA 2JXMB 2C9OA 5M5WB 1BCPC 1T5EA 5EKKA 1QWYA 1TS4A 2WACA 2Z4IA 2Q8IB 3BDOA 1RJTA 4DAPA 3BDLA 1W6JA 3IKJA 1RHPA 4C1NI 4DU9A 3BYYB 3HOZB 3RUZA 3LWUA 5C4JB 4Y7NB 3K7AB 3FKIB 2O5IC 4KMUC 4C2MB 4HR7B 3F2UA 2N88A 2SDFA 3EFXD 2AQ1B 3IAYA 1SYBA 3MFGA 4I65A 1LT4D 2EY1A 2F0DA 1STEA 1SYEA 3D6WA 3K5MA 1OXVA 1DOLA 4C3JG 2EYHA 1O7ZA 3OIPA 3NQTA 3HOXB 3NBHA 5C3WA 4HN7A 1EEFD 2VB2X 3ONAB 1I6HB 4TSSA 1PTOB 4HSPA 3QJYA 2VXWA 3VR5A 1F9SA 2ENBA 4J6HA 1SYFA 2IJ0A 3HZXA 4G4KA 3VR3A 4FF3A 1AZQA 1H9SA 4FYDA 1EY0A 1JQYD 2EJMA 2AUJD 2RDHA 3EQLC 1Q90A 3KBXA 3UI2A 3A7AB 1CI3M 2B2TC 1S5FD 2DNCA 1LV9A 3PMFA 1PRTC 2A5HA 5E1FA 1B2TA 1SYGA 2BOSA 2MJ8A 3VR6A 4RGMA 2WP8J 1JORA 4ULLA 1CFMA 3T16A 4YIJA 3NSWA 3NPPA 5IT9E 2F0LA 3C3LA 5DAUA 4KD4A 3MA2B 3Q6SA 2F0HA 1SYCA 1D1IA 2B2WC 1CK1A 4IURA 4ID6A 5CGKA 5G3LD 4B9XA 2R92B 1HCZA 4PNYA 2Q8TA 3M7GA 3M3YB 4HSVA 1JCKB 4G7HC 2JA7B 5FK9C 3QOLA 1QNKA 2M9VA 2B2VC 2OEOA 2SNSA 2JE6I 2XSCA 1F2MA 4FF1A 2C5CA 3A8KE 1KAAA 1TQOA 4PQXA 3I70A 3RLFA 3OMGA 2G9HD 1C8CA 2F0SA 1UEAB 1IKLA 2F0IA 3IFTA 2L12A 1QB5D 5M3FB 4S3SA 1EFID 2HQEA 2R93B 3T53B 1UAPA 3SDZA 3P1HA 3GD7A 1LACA 3K59A 5LHY1 1AFPA 1SJED 4DNTB 1CZGA 4IUVA 1R4PB 3BVZA 1XXGA 5ELDA 2ICEC 1EYCA 5M5XB 2A74C 3JAME 3GV3A 1Z7TA 3J80L 1GUGA 2K33A 3X3MA 5IIFA 1K8OA 2EYLA 1EL0A 1RTOA 5CBEE 5C6AA 4Q0FA 4E6IA 1V1OA 3FMCA 2RQXA 3Q0AA 3U9SA 1EYAA 1ML0D 1ENAA 3ITPA 3M85A 3K0YA 3BS1A 4XXEA 1SMYC 5D3DA 1HQRD 1LTGD 1Z47A 2F0MA 1CTMA 1CA6A 1GOZA 4AYBB 2HDMA 2VB3X 2SNMA 4F87A 1LLRD 4BBSB 5DEHA 2ZXOA 2F0TA 2EJGC 4X3UA 4EQNA 1VCIA 1A3TA 1MSGA 4IZ8A 1V1PA 4NKLA 3H6MA 5TSSA 1G8ZD 1A2TA 1DJRD 3A8JE 3QOJA 1G2TA 1AW7A 5IOCA 2A6HD 4R9WA 3L3OC 3SK5A 1IYUA 1Y1VB 5I6WA 4KD3A 3NQIA 4C3IB 5C5MA 1DYQA 3GTMB 1F2LA 1SNOA 1V8QA 4IUNA 3R2IA 3T4AC 1Q12A 4CKCA 3GTPB 3SK8A 4FXKC 1RODA 4K5VA 3CHBD 5CBAE 4XQQA 3KF8A 3VYTA 1JC7A 4EQPA 5HURA 1A15A 2JEBI 1JE4A 3RD4A 4XYOA 2Z8LA 3N52A 4FVMA 4RGNA 4KKSA 2BE5C 5EJWA 2IWHA 2V4DA 3T56B 3VA7A 2JA5B 1SNDA 1PZID 1DM0B 2K01A 1VF5C 1LTTD 2LMCB 1ESFA 1Q3LA 1SEBD 4R8IA 2K5DA 1MSHA 4NP5A 5KNDA 3GP7A 1QILA 5CC4A 3DMUA 1HA5A 2R3ZA 4UAIA 4HEDA 5FOBB 5EBCA 3DWAA 4LAAA 3MC0B 4IALA 3ERQA 3MZ5A 1IL8A 5JAVA 2E2DC 3NHHA 1SE3A 3Q22A 4XIGS 3OHXC 3EVQA 2NWGA 3O13A 4JK1C 2R6GA 1EY6A 2NVTB 3I72A 4H7BA 1NUCA 3BVMA 4ZKCB 3T13A 2K05A 4IUTA 1FNUA 1KNEA 1UNSA 1BCPB 2DNEA 5CV9A 3SHLA 1JWUD 3J80E 5EKIA 4K8JA 3X3NA 2PYKA 3S1QB 3NK9A 5C44B 1OO9B 1DD2A 2EE1A 2J7ZA 5HGTA 3H91A 5FLXL 3P7JA 2PO4A 3IL8A 2EY5A 1BO0A 3KBGA 1IW7C 3PIP3 2YYZA 3RMHA 2RVLA 4RH6A 1PXUA 4X3SA 3HOWB 5I6YA 1TWHB 4ODGA 2R7ZB 1OXXK 1J9OA 1S4ZA 1B3AA 4TRDA 4ABNA 2RA4A 2A68D 3OSOA 2GA4B 4LJZC 4BA1I 1WTQA 5JJZA 4ZRZA 1M4VA 1FGBD 1Y8NB 1JWSD 3TN2A 1QOHA 4G7OC 3PV0A 2JA6B 3N6RA 2QDBA 1AEXA 1Q1EA 3KLSA 4NW2A 5JEAG 4DXFA 4L6TB 2OF1A 1HTLD 1O7LA 3NE5B 4X3TA 2MHVA 2Y0SB 3MFYA 1A3VA 1H9KA 1EU3A 1I6VC 3D8GA 4OO1G 3HGBA 4ZKBB 5E4WC 5BN4A 1SYDA 1LTBD 2EYJA 4RHSA 4BY1B 4QUFA 1EOTA 2F1MA 1C48A 2F3VA 5I2YA 5G3LF 5KYLA 3KLSX 3VR2A 2E2JB 1B9NA 3GV6A 5M3MB 4C3JB 1B4OA 2KVMA 4G7ZC 3NTIA 4FXGC 5JEAH 1MD2D 2PW7A 1SE4A 3MWYW 2K5WA 5CV7A 5EQ0A 4KY6A 2H1EA 1IHZA 3SEBA 1JOKA 2BA0A 2KOLA 5KRUA 2L55A 4A3KB 1GUSA 1F2ZA 2CW0D 3HKZB 4RHRA 2KUMA 1SDFA 1LO5D 3PUZA 2RSOA 2E2HB 3TP8A 1K83B 1GUTA 2K1BA 5KNBA 3D31A 4OO1H 1EY4A 1PZKD 1ZXTA 4XT3B 1NAPA 4R8NA 3DWQA 1STYA 2RDFA 2KQ3A 4KJNA 1EWCA 4RWSC 3I4NB 1NSNS 2IPKD 3EJIA 2E76C 4XTCS 3URYA 2IX0A 2WINB 3M4OB 3FVQA 3MXNA 1PFBA 2KHSA 4K5XA 3I91A 2ICIA 5D14A 3LX0A 1ZKOA 5ELEA 4A93B 2JP1A 4IUUA 2F0JA 1I50B 4HTHA 5C5LA 3SR1A 1HTPA 2D9UA 3OMCA 3P20A 5C3EB 2KCNA 3KK7A 3FPUB 3KUPA 1EY5A 2X69A 3C1EA 2F03A 4NDXA 1A6XA 2EYOA 2N55A 1ENFA 5KEEA 5CV4A 1ET9A 5FLXE 1G2SA 1HHVA 3SVMA 3FRPB 1TY0A 2JA8B 1FD7D 3U9OA 1R4QB 2Z4HA 1HA6A 1TS3A 4FXDA 3V2TA 1HXYD 2NYZD 3HOUB 4QF4A 1HRJA 3QO2A 1JWMD 4KY5A 1II3A 5C3XA 1Q1BA 1XYIA 2K6AA 2M2LA 4OO1I 2AWOA 3S1RB 2ZT9C 2KJXA 3GQBA 5EPJA 1TVXA 1ESRA 2LS01 3P75A 3J7AV 1WTPA 4BY7B 2F0WA 1FNVA 1H9JA 2XVSA 1FR3A 1TKWB 2L0CA 4X3KA 5KGUA 3D4WA 4KKTA 1LABA 4C1NK 2NTTA 3NTKA 1YNND 1QCBD 5T1GA 1GUNA 2B39A 4EQOA 3QB3A 3BDCA 4J8QA 3ZYYX 3NBIA 2L4NA 5FO8B 3CU7A 4DAVA 2XRSD 1EYDA 3NP8A 1R9TB 1D5ZC 1TWAB 3I73A 3MAQA 4DF7A 1E2VA 1ZYRC 4K6DA 3VYRA 1GHKA 1WVLA 4FF4A 2VUMB 1PTOD 1AZPA 2AUKA 3BYTB 2B2UA 1XX8A 3R93A 1MI2A 1AN8A 4J1MA 3ND8A 2K28A 1MBYA 1T5XD 3S9WA 1F9PA 2A6HC 1RKNA 3PUVA 5JEAJ 1SNPA 3S17B 3I4MB 2NVXB 1PYWD 3KLRA 1XTCD 1ET6A 2TMPA 1EZ6A 5M5YB 1TR5A 2O5JC 3C2PA 4FP5D 4L8JA 3TMEA 4KI0A 4A3EB 2BDOA 4IFDG 5C4HA 3CRLC 4C56C 2VNUD 4B9WA 1B1ZA 4I7ZC 2NZ1D 2B2YA 4K5WA 5EPLA 2YU9B 1DZ1A 5CV5A 4EGVA 1QNUA 4QCLA 1B44D 3PUWA 3TP5A 2CHBD 3LNNA 4FF2A 4RCOA 1JOOA 2I07B 3J81L 1PMRA 1I4PA 3OWFA 3S14B 4F8MA 2KEEA 3MVVA 4CHTB 4DNRB 1E0BA 4DK1A 5K36G 3MHBA 4PMBA 4U673 4OGQC 5EPKA 4KV6A 2FINB 1FNWA 3WOEA 3LWEA 1TS2A 3D6CA 3RZOB 2J0TD 2B8GA 4XYQA 4LMQD 2AQ3B 1LT3D 2EPBA 4C3HB 5JOBA 4A3GB 1EIHA 1OXUA 4C3IG 1TS5A 4IFDH 1PFMA 1ICWA 5C0XG 1RDPD 3FEWX 1A3UA 1KTKA 3MEHA 1TWFB 1SXTA 2LFNA 3S2DB 2F0PA 2WIIB 4Z9CB 1V43A 1TT2A 4DAYA 1CQVA 2O4XA 3TSSA 2DN8A 4A3IB 1GXDC 5DM73 1KLUD 5KIXA 2KECA 5I2XA 1G291 3PIO3 5K36H 3MXUA 1B53A 1CHPD 4RAUC 1C4QA 1VMPA 2B8FA 2FHTA 4HCSA 4OHJA 4RCNA 3TZUA 4K2KA 1JR0D 4HMIA 2XIWA 5EKLA 3HOVB 2A6EC 1KDAA 4A3FB 5J1ZA 4A3BB 1F9QA 4ZYSA 1NCVA 1PZJD 3VR4A 2PMZB 3SK4A 1VF7A 3V96A 4MHEA 1Y69U 1Y8PB 2EZVA 2G9DA 4RKLA 5C0XH 1YNJC 2XWBB 1VMCA 3A56A 2EYMA 1M8AA 4QIWB 2A68C 3WDNA 2B2UC 3TBIB 4BS9A 3W3AA 5F2DA 5D3IB 4P2CB 3I4LA 2TSSA 2MUYA 2R61A 4IFDI 3SK6A 5T1IA 4IQZA 2RBMA 4A3MB 3WOFA 5E4XA 1WTOA 3CRKC 3NTHA 4CBVA 3I90A 5FO7B 5COYA 2D2CC 1SNMA 3AB9A 1HUMA 2MGSA 3SXHA 1VDZA 5CMDA 4CGYB 3OW7A 1B50A 3DXJC 4A3DB 4UDUC 4KHZA 1OXSC 5FO9B 4IN3A 4KK7A 2IX1A 4BBRB 1STHA 4V190 2B2VA 5D65A 1CHQD 2F0KA 2FMMA 2K03A 1LTID 3HP3A 4OL7A 4ILWA 1PRTB 1S5ED 5C0XI 1KDBA 5DNFA 4ZQ3A 4DGZA 3J81E 1G6ZA 2EYFA 5LL6X 1D6EC 4RA8A 4XQJA 1STGA 3A55A 1FYCA 2XN9C 1WCMB 4O1NA 3S16B 4A3JB 2IL8A 3G7LA 5IGCA 2F0GA 2NUCA 3K58A 1KLGD 1D5XC 1CT1D 1BDOA 2ZXRA 2HCIA 2K7VA 2L1BA 2PNRC 1I4RA 2CW0C 3S15B 5KNCA 3H0GB 1H9RA 4H0LC 3J7YW 3PUXA 2A69D 5JPNC 4N9PA 3HG9A 2F3WA 2BA1A 1LT6D 2F0QA 3BG3A 4ZLTF 1E2WA 2PW5A 5LL6S 1EQTA 4FO2A 4HAEA 1W6KA 5ELCA 2PZTA 1BCPD 3VYSA 4PV1C 3GTKB 1ILQA 3FDTA 3M4YA 2IX3A 3A54A 4XDXA 4IFDJ 2QF7A 4M1UB 3TZDA 4DFAA 1HPCA 4G57A 1Q8IA 2OXPA 1RF2D 3IFDA 1Y8OB 1G91A 4K2LA 4RGOS 4XT1B 1SAPA 1MGSA 4KTAA 2M00A 4WORA 3SE0A 1ZEQX 3S2HB 4EVOA 1KDCA 1PTOF 2Q8RE 3NUCA 5CV6A 3E5SA 4DN4M 1BF4A 4OIJA 3J7AF 3D4DA 3MXGA 5I4DA 5KYIA 1BUVT 5IGDA 1ENCA 1LTSD 3NWSA 3PO3B 1X32A 5I9PA 2EYPA 2IW3A 2EY6A 1BR9A 2RSNA 1F2YA 4NMZA 1E2ZA 5M9OA 2EJFC 2HUGA 5C0XJ 1QG7A 2QCPX 3OWEB 5DM63 1TY2A 1PFNA 1O80A 1S5CD 2NBFA 1EIGA 2NN6G 2FJ2A 2J4XA 1PRTD 1SJHD 4XQNA 4WRDA 5J22A 3GTJB 1H9SB 5I9OA 3DWPA 4H13C 1F9RA 2ZXPA 4HCEA 1EEID 4Q5VA 2AWNA 4FNFA 4KHVA 1ONLA 5CYUA 3R2TA 1TU2B 1YNNC 5ELBA 2H4OA 2OT2A 1B9MA 3K5NA 5C4ZA 4F7XA 2K5QA 1S5DD 5JVG3 1BQQT 3VA5A 2I46A 3E6ZX 1O78A 2EOTA 1EU4A 3S1NB 3A8IE 1WTWA 4TKOB 1EY9A 2EY2A 2BCOA 2SEBD 3L9AX 1X3QA 1PTOH 1U4PA 4ZUJA 2FMCA 1AP0A 2F0NA 4IUPA 1RD9D 3T51B 5FKAC 2PCFB 3V05A 1L0YB 5A2QL 4KJOA 3OOCA 2SOBA 2PZWA 2NN6H 1PTOC 4JBWA 3AU7A 2FFKB 5CV8A 4KN4C 3K6OA 3BZDB 4M8AA 5IGEA 1WTVA 1NR2A 1CM9A 2K32A 5BN3A 1D5MC 4QUCA 1Y1WB 1F77A 4O42A 3GTLB 1HQMC 3Q24A 3M7NA 4WJWA 1H9MA 3QIAA 4U68A 1IYVA 3TP7A 2F4IA 1UUPA 1DXMA 1I3QB 1SNQA 2NVYB 4ZAIA 3DEOA 1I4GA 1GUOA 3HRZC 1SMYD 1BXTA 2LY7A 3GTGB 2F0EA 1CA5A 1BOSA 5IGBA 1ZYRD 4CKBA 1KABA 3QWNA 2X6LA 2IT1A 1DOKA 2RDGA 2XNAC 4K14A 4V0BA 2HCCA 1U4MA 1X3PA 3H09A 2WKCA 5K5PA 1STBA 1JICA 4KY7A 4F88A 2EXZA 2QILA 3OPOA 4QMGA 3Q23A 1BBXC 2NTSA 4KN7C 2CQAA 4B08A 3RZDB 5IGGA 3MXPA 2NN6I 3HS0C 5A35A 2EVBA 2Z1CA 2JEAI 1D1KA 1EY7A 3R3OA 1WD0A 3DHQA 4PMWA 1ILPA 5CORA 2L5TA 2WV6D 2ID0A 5IODA 4DA2A 2JSOA 1RTNA 1NR4A 1L0XB 4PMCA 1V1PB 4H44C 1QE6A 3DUZA 3EA6A 2KCCA 4BWGB 1SFOB 2WB1B 4K8IA 2MPMA 1U4RA 1CZWA 2D62A 3DEPA 3NWTA 2XWJB 1A2UA 1TWCB 1STAA 3DM1A 2PQEA 1HFGA 3HOYB 1CQFA 2HDLA 3TDQA 2JYOA 4QB4A 5ISRA 2E2IB 2NVQB 1I4QA 2BE5D 2RKSA 3R8BA 2F0OA 1S5BD 3PUYA 1EY8A 4CKEA 3HEJA 3S1MB 3E0JA 3D4RA 5E3FA 1GHJA 4ZUIA 3NXWA 3C46A 1GJXA 3G6JB 3MTSA 1I4XA 5BN5A 1I4HA 1EQVA 2D5DA 2F0UA 1O7YA 1DONA 2E75C 2L9HA 1SBBB 2DY7A 2KEDA 3PO2B 2XRQD 4C3HG 4ZK9B 2NB0A 5J39A 1U4LA 3K5OA 5IGFA 4DXGA 1TWGB 3H3VC 1JB3A 3CKIB 3L7ZC 1LTRD 2EDGA 2X6GA 3I3CA 4OIKA 5A2QE 4RFBA 3BVGA 3VYUA 3K57A 1J8IA 2MP1A 3GO5A 4CJ0B 1BCPF 2A6ED 2KA7A 2WAQB 1OXTA 1RCVD 1Z6HA 3GTQB 4CJ2C 5JPMC 4N9TA 5IT9L 2F0FA 4LK1C 4CJ1B 2AQ2B 3AMUA 1TIID 2B2TA 1XWEA 5AFWA 5ELFA 2F0VA 1BNZA 2O2LD 3A7LA 1YNJD 2L11A 1LTAD 1HFNA 2K04A 1IW7D 2CVRA 2LKVA 5JVH3 5CR3A 4L63B 1U9RA 1STNA 1PLFA 1DCZA 3C1FA 1K8MA 3OIQA 2B63B 2B2YC 1LT5D 4DK0A 1EZ8A 1SE2A 4HMJA 2B2WA 5C4XB 4RKBA 4IUQA 3CQZB 1SSOA 3H94A 4K6LA 1WTXA 5EBDA 1SNCA 1PDQA 1WD1A 4WFN3 1JOQA 2DY8A 2WKDA 3TP6A 4TQUS 1GUWA 4MN3A 3ND9A 2PPBC 1IKMA 5NUCA 3GTOB 3FPPA 1EWHA 2E74C 1HUNA 2QEJC 1WTRA 3K5LA 3JAML 4GZYC 2A73B 3I8ZA 1D2BA 1DOMA 3EROA 4RGTA 1QJOA 3D3RA 4KKUA 2A69C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYC A;  1STY A;  3P75 A;  1EY6 A;  1SNO A;  2RDF A;  3MEH A;  2KQ3 A;  4ME5 A;  2F0Q A;  4KJN A;  1EZ6 A;  4K8I A;  2PW5 A;  4H7B A;  1NUC A;  1TR5 A;  2F0P A;  4IUN A;  2F0W A;  5EGT A;  1NSN S;  1TT2 A;  5IIF A;  3T13 A;  3EJI A;  2EYL A;  3TME A;  3SK8 A;  2O4X A;  1A2U A;  4MIU A;  2PZT A;  2PZU A;  5C6A A;  4K5V A;  4N9T A;  1STA A;  4WRD A;  1SNM A;  2KHS A;  2F0F A;  3D4W A;  5KGU A;  5J22 A;  4K5X A;  2PQE A;  5I9O A;  3TP7 A;  3PMF A;  3SXH A;  5E1F A;  4E6I A;  3LX0 A;  1A3V A;  5KIX A;  1SYG A;  5EKK A;  5CV9 A;  4QB4 A;  4EQP A;  5C4H A;  1SNQ A;  2F0V A;  3SHL A;  2WAC A;  5HUR A;  5ISR A;  3D8G A;  4B9W A;  2F0J A;  1EYA A;  1JOR A;  4KHV A;  1SYD A;  4HTH A;  2EYJ A;  4K8J A;  2F0E A;  2PYK A;  4K5W A;  1ENA A;  3ITP A;  4YIJ A;  5C5L A;  3SR1 A;  3NK9 A;  3T16 A;  4EQO A;  5IGB A;  2RKS A;  1KAB A;  3BDL A;  5CV5 A;  2F0L A;  2F0O A;  3QB3 A;  3OMC A;  4DFA A;  4K2K A;  5HGT A;  2F3V A;  1STH A;  2LKV A;  4HMI A;  5C4Z A;  3BDC A;  4G57 A;  5EKL A;  4DU9 A;  4K14 A;  3TP5 A;  4F7X A;  5KYL A;  5DAU A;  2OXP A;  4KD4 A;  1EY5 A;  1JOO A;  1KDA A;  3C1E A;  2EY5 A;  5CR3 A;  1U9R A;  1STN A;  2F0K A;  1EY8 A;  5J1Z A;  3RUZ A;  3HEJ A;  2F0H A;  3VA5 A;  1SYC A;  4NDX A;  3OWF A;  2EYO A;  5CGK A;  3C1F A;  4OL7 A;  4ID6 A;  2F0M A;  4F8M A;  4K2L A;  4B9X A;  5E3F A;  1EZ8 A;  4PNY A;  5I6Y A;  1SND A;  5K5P A;  4ODG A;  4ZUI A;  4HMJ A;  5KEE A;  3SK4 A;  1STB A;  3MVV A;  3NXW A;  5CV4 A;  1EYD A;  3NP8 A;  3QOL A;  4KTA A;  1KDB A;  2M00 A;  4TRD A;  1EY9 A;  1SYB A;  2EY2 A;  2SNM A;  4WOR A;  4ZQ3 A;  2OEO A;  4KY7 A;  4RKB A;  4DGZ A;  1EQV A;  4RKL A;  2SNS A;  4DF7 A;  2EXZ A;  2F0U A;  2EYF A;  4EVO A;  3MHB A;  3OSO A;  1F2M A;  4I65 A;  2PW7 A;  4PMB A;  4QMG A;  2F0D A;  2EY1 A;  1KDC A;  2EYM A;  4KV6 A;  1STG A;  4NP5 A;  5DEH A;  4ZUJ A;  1SYE A;  3U9O A;  2F0T A;  4K6D A;  5CV7 A;  1SNC A;  4KY6 A;  1KAA A;  4EQN A;  2F0N A;  3NUC A;  3E5S A;  1TQO A;  5CV6 A;  1A3T A;  3DMU A;  1IHZ A;  5CC4 A;  3OMG A;  2EYH A;  3V2T A;  5IGG A;  1JOK A;  3MXP A;  4IZ8 A;  5IGC A;  3NQT A;  2F0S A;  3D6C A;  3TP6 A;  3D4D A;  4QF4 A;  2F0G A;  4LAA A;  2NUC A;  4NKL A;  5C3W A;  3H6M A;  2F0I A;  5KRU A;  5J39 A;  4KY5 A;  5F2D A;  5KYI A;  1A2T A;  4KJO A;  4IAL A;  2SOB A;  2PZW A;  5IGF A;  5IGD A;  1II3 A;  4J1M A;  1EY7 A;  1F2Z A;  3ERQ A;  1ENC A;  3R3O A;  5C3X A;  5NUC A;  3MZ5 A;  3QOJ A;  5CV8 A;  3DHQ A;  4S3S A;  5IOC A;  5JOB A;  2ENB A;  2HQE A;  3SK6 A;  5JAV A;  5I9P A;  2EYP A;  3S9W A;  2QDB A;  3NHH A;  1AEX A;  1SYF A;  2EY6 A;  3P1H A;  4J6H A;  3SK5 A;  3TP8 A;  1JOQ A;  5IGE A;  5IOD A;  5I6W A;  2RBM A;  4KD3 A;  1F2Y A;  3HZX A;  1EY4 A;  4PMC A;  4NMZ A;  1RKN A;  5M9O A;  3EVQ A;  3ERO A;  2OF1 A;  5C5M A;  1SNP A;  4N9P A;  4R8N A;  1EY0 A;  2F3W A;  1A3U A; 
#chains in the Genus database with same CATH topology
 4A3B H;  4ME5 A;  3ULJ A;  1PRT F;  5BR8 L;  4BA2 I;  4ALP A;  1E1O A;  4B3R L;  2CWA A;  3QG1 A;  5EGT A;  2QKI C;  1KNA A;  3CC7 A;  4MIU A;  1A62 A;  2RCN A;  2PZU A;  2BDN A;  3W2D A;  3RN5 A;  2JXM B;  4A3D G;  2CFM A;  1XPO A;  2E5L L;  2C9O A;  3W5O A;  5M5W B;  3OTO L;  1BCP C;  1T5E A;  5EKK A;  1QWY A;  1TS4 A;  2WAC A;  4DV3 Q;  4H02 A;  4BBR G;  2Z4I A;  4O0A A;  2Q8I B;  3BDO A;  1RJT A;  1N34 L;  2B29 A;  4DAP A;  3BDL A;  1W6J A;  2QEX A;  2R7Z H;  3IKJ A;  1RHP A;  1YNX A;  4C1N I;  4DU9 A;  2Q2U A;  3BYY B;  3HOZ B;  2QDL A;  3RUZ A;  3LWU A;  3NEL A;  1IZ6 A;  5C4J B;  4BY1 G;  4Y7N B;  3K7A B;  3FKI B;  2O5I C;  4KMU C;  4C2M B;  4HR7 B;  3F2U A;  2N88 A;  2SDF A;  3EFX D;  2AQ1 B;  3IAY A;  4X62 Q;  1WCM G;  1SYB A;  2E8G A;  3MFG A;  4I65 A;  1X54 A;  5IYB G;  1LT4 D;  2EY1 A;  2F0D A;  3FHW A;  1STE A;  1SYE A;  3D6W A;  3K5M A;  1OXV A;  1DOL A;  4C3J G;  2EYH A;  1O7Z A;  3CPW A;  3OIP A;  3NQT A;  3HOX B;  3NBH A;  5C3W A;  4HN7 A;  1EEF D;  1IBM L;  2VB2 X;  3ONA B;  2OTL A;  1I6H B;  4TSS A;  4OWW B;  1PTO B;  3H0G G;  3CME A;  4HSP A;  3QJY A;  2UXC L;  2VXW A;  3VR5 A;  1F9S A;  2CQO A;  2ENB A;  4A3D H;  1CKN A;  2C35 B;  4J6H A;  1SYF A;  2F4V Q;  2IJ0 A;  5JJI A;  1FJG L;  2ALY B;  3J81 j;  3HZX A;  4A3K G;  4BBR H;  4G4K A;  3VR3 A;  4FF3 A;  5FLX c;  4R4Q A;  4LF5 Q;  1AZQ A;  1H9S A;  4FYD A;  3S24 A;  1EY0 A;  3T1Y Q;  3E3X A;  1JQY D;  2UUC Q;  2EJM A;  2AUJ D;  1HNZ L;  2GVA A;  5IWA Q;  2RDH A;  1L1O C;  3EQL C;  1Q90 A;  3KBX A;  3UI2 A;  3A7A B;  3RR5 A;  1CI3 M;  4BY1 H;  2B2T C;  1S5F D;  2MO1 A;  3ULL A;  4HID A;  2DNC A;  1LV9 A;  2ZTC A;  3PMF A;  1PRT C;  2A5H A;  5E1F A;  1B2T A;  3PIP A;  1SYG A;  1W3S A;  2BOS A;  2MJ8 A;  1WCM H;  3CCE A;  4NB3 A;  3VR6 A;  4RGM A;  2WP8 J;  4IPG A;  3AFP A;  3K80 C;  4A3J H;  4ULL A;  1CFM A;  3S16 H;  1JOR A;  1WOC A;  2K14 A;  3L2P A;  2D0P A;  3T16 A;  4YIJ A;  3NSW A;  5IYB H;  2JA9 A;  3NPP A;  1KQS A;  5IT9 E;  2F0L A;  1W2B A;  1WI5 A;  3TS0 A;  4C3J H;  3MXN B;  3C3L A;  3OW2 A;  1XJV A;  5DAU A;  4KD4 A;  3MA2 B;  4A93 G;  3Q6S A;  2F0H A;  1SYC A;  1D1I A;  2B2W C;  1CK1 A;  4IUR A;  2ZTE A;  4ID6 A;  5G3L D;  5CGK A;  3T1H Q;  3H0G H;  4B9X A;  2R92 B;  4RG1 A;  1HCZ A;  4PNY A;  1QUQ A;  2Q8T A;  3M7G A;  3M3Y B;  4HSV A;  4HJ9 A;  5C3E G;  1JCK B;  4G7H C;  2JA7 B;  5FK9 C;  3QOL A;  1QNK A;  2M9V A;  2B2V C;  2OEO A;  3AFQ A;  2SNS A;  2JE6 I;  2XSC A;  1F2M A;  4FF1 A;  4DR1 Q;  2C5C A;  3A8K E;  3ICE A;  2N8N A;  4JI5 L;  1I94 Q;  2UXD Q;  1KAA A;  1TQO A;  4PQX A;  3I70 A;  3RLF A;  3OMG A;  2G9H D;  4DPG A;  3H15 A;  4HJ8 A;  1C8C A;  3PO3 G;  2F0S A;  1UEA B;  1IKL A;  3BJU A;  4N8F A;  2F0I A;  3IFT A;  3GTK H;  4GLX A;  3BZC A;  4KHP Q;  2L12 A;  1QB5 D;  2HHH L;  5M3F B;  4S3S A;  1EFI D;  1PA6 A;  2HQE A;  3OYY A;  2R93 B;  3M9B A;  3T53 B;  1UAP A;  4JI1 L;  3SDZ A;  3P1H A;  1N33 Q;  4Y52 H;  3GD7 A;  1LAC A;  3K59 A;  5LHY 1;  4DV7 Q;  1X6O A;  1AFP A;  1SJE D;  4DNT B;  1RIP A;  1CZG A;  4IUV A;  1R4P B;  4JI7 Q;  3BVZ A;  1XXG A;  5ELD A;  2ICE C;  2VQE Q;  1EYC A;  1A8V A;  5M5X B;  2A74 C;  3JAM E;  3GV3 A;  1HNW L;  4A93 H;  1Z7T A;  4P72 A;  3J80 L;  1GUG A;  2K33 A;  3X3M A;  5IIF A;  1K8O A;  2EYL A;  1IBK Q;  1EL0 A;  1XNR L;  1RTO A;  5CBE E;  5C6A A;  4QJF A;  3S2H H;  1EQQ A;  5C3E H;  1VQI A;  4Q0F A;  1E24 A;  4E6I A;  1V1O A;  3FMC A;  2RQX A;  3Q0A A;  3U9S A;  1CUK A;  4BY7 G;  1EYA A;  4JI4 L;  4JG2 A;  1ML0 D;  1ENA A;  3ITP A;  1G51 A;  3M85 A;  3K0Y A;  1X9N A;  3BS1 A;  4XXE A;  4X64 L;  1SMY C;  5D3D A;  2QW7 A;  5ELN A;  3KJP A;  3PO3 H;  4JI8 L;  1HQR D;  1LTG D;  2CH4 A;  1Z47 A;  1PH9 A;  4JBJ A;  2F0M A;  1CTM A;  1CA6 A;  2DJG C;  1GOZ A;  4AYB B;  2HDM A;  2VB3 X;  2SNM A;  4F87 A;  4GKJ Q;  2A8V A;  1LLR D;  4BBS B;  5DEH A;  2ZXO A;  2F0T A;  2EJG C;  4X3U A;  4OX9 L;  4EQN A;  3U58 A;  4B3T Q;  1VCI A;  1A3T A;  1MSG A;  3A5Z B;  4IZ8 A;  1V1P A;  3CPF A;  4NKL A;  2EIF A;  3GTJ H;  3H6M A;  5TSS A;  3S1R H;  1G8Z D;  1Q86 C;  1A2T A;  1DJR D;  3A8J E;  1J5E L;  1GO3 E;  4YY3 L;  2CWP A;  4A4I A;  3QOJ A;  1G2T A;  3F2D A;  1AW7 A;  5IOC A;  2A6H D;  4R9W A;  1KC8 C;  2OQK A;  1SLJ A;  3L3O C;  2VW9 A;  3SK5 A;  5LMU Q;  1IYU A;  1Y1V B;  5I6W A;  2R7F A;  4KD3 A;  1P16 A;  4BY7 H;  3NQI A;  4JI3 Q;  3CF5 A;  4C3I B;  4L5S A;  5C5M A;  4JBM A;  3CD6 A;  1DYQ A;  3GTM B;  1F2L A;  1SNO A;  1V8Q A;  4AYB E;  1NTG A;  1K8A C;  4IUN A;  3R2I A;  3T4A C;  3S1N H;  1XNQ L;  1Q12 A;  4CKC A;  2EQS A;  5GQO A;  3SK8 A;  1HNX L;  4FXK C;  3GTP B;  1ROD A;  4K5V A;  2EXD A;  3CHB D;  1JJG A;  4LFC L;  5CBA E;  4XQQ A;  3KF8 A;  1KRS A;  3VYT A;  1JC7 A;  1GM5 A;  1RL2 A;  2ATW A;  1VQ7 A;  4EQP A;  5HUR A;  1A15 A;  2JEB I;  1JE4 A;  1PH8 A;  3RD4 A;  4DV4 L;  4XYO A;  1K3B C;  2Z8L A;  4JV5 Q;  3N52 A;  4FVM A;  4RGN A;  2YTV A;  4KKS A;  2BE5 C;  1YVC A;  3RNU A;  1VQO A;  5BR8 Q;  4B3R Q;  5EJW A;  2IWH A;  4LWC A;  2V4D A;  3T56 B;  3VA7 A;  3CC4 A;  2JA5 B;  1SND A;  3UDI A;  1PZI D;  3KYH C;  4DR3 L;  2E5L Q;  1DM0 B;  2K01 A;  3OTO Q;  1VF5 C;  1LTT D;  2LMC B;  1ESF A;  1Q3L A;  1SEB D;  4R8I A;  2K5D A;  1MSH A;  4NP5 A;  5KND A;  1LTL A;  2LXJ A;  3GP7 A;  1QIL A;  5CC4 A;  3DMU A;  1HA5 A;  2R3Z A;  4UAI A;  4HED A;  5FOB B;  1AE3 A;  2K5H A;  5EBC A;  2H5X A;  4YCU A;  3DWA A;  4LAA A;  1H95 A;  4MZ9 A;  2MQH A;  3MC0 B;  4IAL A;  3ERQ A;  1I3Q H;  3MZ5 A;  2NVY H;  3FP9 A;  1IL8 A;  2LXK A;  5JAV A;  2E2D C;  3NHH A;  3GTG H;  3PF4 A;  1SE3 A;  2YV5 A;  1DGS A;  5J3B A;  3Q22 A;  3E9H A;  4XIG S;  3OHX C;  3EVQ A;  2NWG A;  2WB1 G;  5IYD G;  3O13 A;  2I5M X;  4JK1 C;  2R6G A;  1EY6 A;  1C0A A;  4LF7 L;  2NVT B;  4CDD C;  3I72 A;  4H7B A;  1NUC A;  3BVM A;  3HOY G;  4JI2 L;  4ZKC B;  1IBM Q;  3I55 A;  1KIX A;  3T13 A;  4HJ5 A;  2K05 A;  4IUT A;  2UXC Q;  1FNU A;  1KNE A;  1UNS A;  1BCP B;  2DNE A;  5CV9 A;  2UU9 L;  1FJG Q;  3SHL A;  1JWU D;  1BBU A;  3HFZ B;  1PH3 A;  3J80 E;  3RZD H;  5EKI A;  4K8J A;  3X3N A;  1X65 A;  2PYK A;  5L37 A;  3S1Q B;  1NE3 A;  3NK9 A;  5C44 B;  4L5Q A;  1OO9 B;  4DAY B;  1DD2 A;  2EE1 A;  2J7Z A;  5HGT A;  3H91 A;  5FLX L;  3P7J A;  4IPH A;  2PO4 A;  2XGT A;  3IL8 A;  1HNZ Q;  2EY5 A;  1BO0 A;  3KBG A;  1IW7 C;  3PIP 3;  2YYZ A;  3RMH A;  3Q8D A;  2RVL A;  1SRU A;  4RH6 A;  1PXU A;  4X3S A;  3HOW B;  5I6Y A;  1TWH B;  4ODG A;  2R7Z B;  1OXX K;  1O7I A;  4OON A;  1J9O A;  1S4Z A;  1B3A A;  4TRD A;  3HOV G;  1Q46 A;  4ABN A;  4NPS A;  2RA4 A;  1YHA A;  2A68 D;  1SFO H;  3PO2 G;  3OSO A;  5IYD H;  2GA4 B;  1UE1 A;  4LJZ C;  4BA1 I;  1WTQ A;  5JJZ A;  1S40 A;  1K0R A;  2F52 A;  4ZRZ A;  1M4V A;  1FGB D;  1Y8N B;  4X66 L;  1JWS D;  1TWC H;  3TN2 A;  1XPR A;  3HOY H;  1QOH A;  4G7O C;  4GN4 B;  3PV0 A;  4OXP A;  2HQL A;  4AIM A;  4LFA L;  2JA6 B;  3N6R A;  2E2I H;  2QDB A;  1AEX A;  1Q1E A;  2NVQ H;  3KLS A;  4NW2 A;  3BU2 A;  5JEA G;  4DXF A;  4GKK L;  1K0S A;  4L6T B;  2OF1 A;  1HR0 Q;  1LYL A;  3EIV A;  1HTL D;  2WAQ G;  1CKM A;  1QZG A;  5AJ3 L;  3S1M H;  3RN2 A;  4GOP B;  1O7L A;  3NE5 B;  4X3T A;  2Z6B A;  1JJC B;  2DGY A;  2ZJP A;  2MHV A;  1XMQ L;  1G6P A;  4DR6 L;  2Y0S B;  3MFY A;  2HHH Q;  4A3M G;  1E1T A;  4JI1 Q;  1UE6 A;  1A3V A;  2G5D A;  5IY0 A;  1H9K A;  4JPB W;  1EU3 A;  2HT1 A;  1PYB A;  3HOV H;  1I6V C;  3D8G A;  4OO1 G;  3HGB A;  4ZKB B;  4P75 A;  5E4W C;  5BN4 A;  4DUZ L;  1X3F A;  1SYD A;  1LTB D;  2EYJ A;  4RHS A;  4BY1 B;  2ZM6 Q;  3PO2 H;  4QUF A;  4IPD A;  1EOT A;  2F1M A;  2VL6 A;  1C48 A;  2F3V A;  2B63 G;  5I2Y A;  1TWG H;  5G3L F;  3KLS X;  5KYL A;  3VR2 A;  2D0O A;  2E2J B;  1B9N A;  5C4X G;  1P8L A;  4GNX A;  3GV6 A;  5M3M B;  5GAH C;  4C3J B;  4QGU A;  1SN8 A;  1B4O A;  3E0E A;  4X6A H;  2KVM A;  4DV2 L;  4G7Z C;  3NTI A;  4FXG C;  5JEA H;  1UE5 A;  1MD2 D;  2VZA A;  2Y0S E;  3MWY W;  1BBW A;  1SE4 A;  2PW7 A;  1WFQ A;  2K5W A;  4RMF A;  5CV7 A;  3GTQ H;  5EQ0 A;  4KY6 A;  1VQP A;  2H1E A;  1IHZ A;  3SEB A;  1JOK A;  2BA0 A;  2KOL A;  4JI8 Q;  5KRU A;  2L55 A;  4A3K B;  1GUS A;  1F2Z A;  2CW0 D;  1S72 A;  1QZH A;  5LMN W;  3HKZ B;  4A3M H;  2FXQ A;  4RHR A;  2KUM A;  1VQM A;  1SDF A;  1LO5 D;  3PUZ A;  2RSO A;  4A3J G;  2DJF C;  2E2H B;  3TP8 A;  1K83 B;  1GUT A;  2K1B A;  5KNB A;  3D31 A;  4OO1 H;  1EY4 A;  3K0X A;  1PZK D;  1ZXT A;  4XT3 B;  1NAP A;  4R8N A;  3DWQ A;  4R4C A;  1STY A;  3CCQ A;  4OX9 Q;  1VQH A;  2RDF A;  5LMN L;  2KQ3 A;  4KJN A;  1EWC A;  2B63 H;  4RWS C;  3I4N B;  1B3Q A;  1NSN S;  2Q2T A;  1K73 C;  4LUV A;  2IPK D;  3EJI A;  5C4X H;  1EIY B;  2E76 C;  2OCE A;  4XTC S;  1QVG A;  3URY A;  2IX0 A;  2WIN B;  4YY3 Q;  3M4O B;  3FVQ A;  3MXN A;  1PFB A;  2KHS A;  3CQZ H;  1JT8 A;  4K5X A;  3I91 A;  1MKH A;  2ICI A;  5D14 A;  4JYA L;  3LX0 A;  4JI0 L;  3ULP A;  1ZKO A;  5ELE A;  4A93 B;  2JP1 A;  4IUU A;  2F0J A;  3B6Y A;  4P71 A;  1I50 B;  2PI2 A;  4HTH A;  4APV A;  5C5L A;  3SR1 A;  1LUZ A;  4OEL B;  4DR2 Q;  1HTP A;  1YJ9 A;  3HOZ G;  3HKZ E;  2D9U A;  3OMC A;  3P20 A;  1MJC A;  4KLK A;  5C3E B;  2VQF L;  1KHI A;  3UE0 A;  2KCN A;  3FKI G;  3KK7 A;  3FPU B;  3KUP A;  1EY5 A;  2X69 A;  3C1E A;  2F03 A;  3CCJ A;  1XNQ Q;  4NDX A;  4JI6 L;  1A6X A;  2EYO A;  2N55 A;  4CDE C;  2RCF A;  1HNX Q;  2ES2 A;  4R4T A;  5IP9 G;  5IT9 c;  2CH4 W;  4R4O A;  1ENF A;  5KEE A;  4LFC Q;  5CV4 A;  1ET9 A;  5FLX E;  1G2S A;  3JC6 6;  1HHV A;  3KDF B;  3SVM A;  1YHB A;  4LF9 Q;  2KHI A;  3FRP B;  3HOX G;  1TY0 A;  1JB7 A;  2JA8 B;  4DR4 L;  1NMG A;  1FD7 D;  4DV4 Q;  4QQB X;  3U9O A;  1R4Q B;  2Z4H A;  1HA6 A;  4LF8 L;  2LSS A;  1TS3 A;  3NBH B;  4FXD A;  1SR3 A;  3V2T A;  1NBW A;  1HXY D;  2NYZ D;  3S15 H;  3HOU B;  1PFS A;  4QF4 A;  1E7Z A;  4NXN L;  1HRJ A;  3QO2 A;  1IXR A;  1JWM D;  4KY5 A;  4HIM A;  5M5W H;  1II3 A;  5C3X A;  1Q1B A;  1XYI A;  2K6A A;  5JJK A;  4LFB L;  2M2L A;  4DR3 Q;  4LF6 L;  3TRE A;  4UPA A;  4OO1 I;  2AWO A;  3S1R B;  2ZT9 C;  2Q2H A;  2KJX A;  1EFW A;  3GQB A;  5EPJ A;  2HD3 A;  1TVX A;  4DV5 L;  1ESR A;  1X3G A;  2LS0 1;  3HOZ H;  3W1B A;  3P75 A;  3J7A V;  4LF4 L;  5C4J H;  4Y7N H;  3K7U C;  3K7A H;  3FKI H;  4DUY L;  4B3M L;  1WTP A;  2IY5 B;  2K75 A;  4BY7 B;  2F0W A;  1EYG A;  1FNV A;  1H9J A;  2XVS A;  1FR3 A;  3CCM A;  1TKW B;  2L0C A;  4X3K A;  4DK3 C;  5KGU A;  1GVP A;  3D4W A;  5IP9 H;  2A1A A;  4KKT A;  2PQA A;  4YHH L;  1LAB A;  2B3G A;  4C1N K;  2NTT A;  3NTK A;  3WWV A;  1YNN D;  1QCB D;  5T1G A;  1GUN A;  2B39 A;  3HOX H;  4EQO A;  3QB3 A;  4N8X 1;  1I6H H;  4B3S L;  4LF7 Q;  3BDC A;  4GNX C;  3JAM i;  2R92 G;  3STB D;  3KF6 B;  4J8Q A;  4UP8 A;  4DAM A;  1D7Q A;  3ZYY X;  3NBI A;  2L4N A;  1HJP A;  5FO8 B;  3CU7 A;  1TXY A;  4LW1 A;  1PH7 A;  4DAV A;  2XRS D;  2JQO A;  1X3E A;  1EYD A;  3NP8 A;  1R9T B;  1D5Z C;  1TWA B;  3I73 A;  3MAQ A;  2UU9 Q;  4DF7 A;  2YTX A;  1E2V A;  2HIX A;  3TRZ A;  4DV3 L;  1ZYR C;  4O2D A;  4K6D A;  3VYR A;  1GHK A;  1WVL A;  4FF4 A;  5M3F G;  2VUM B;  1PTO D;  1AZP A;  2AUK A;  3BYT B;  2B2U A;  2R93 G;  1XX8 A;  3R93 A;  1Q82 C;  1MI2 A;  1AN8 A;  4J1M A;  1QVF A;  3ND8 A;  3NEN A;  1K3R A;  2K28 A;  1MBY A;  4DV6 Q;  2K52 A;  1T5X D;  3S9W A;  4OEM B;  1F9P A;  4JC0 A;  2A6H C;  4EQ5 A;  1S3O A;  1RKN A;  3PUV A;  5JEA J;  1SNP A;  3S17 B;  3I4M B;  2NVX B;  1PYW D;  3KLR A;  3F2B A;  4IO9 A;  4AQY L;  1UE7 A;  1XTC D;  1ET6 A;  3I56 A;  2TMP A;  1EZ6 A;  4X66 Q;  5M5Y B;  2R92 H;  1TR5 A;  2Z6K A;  2O5J C;  3M3Y H;  3C2P A;  4MTN A;  4FP5 D;  4L8J A;  3TME A;  4KI0 A;  4A75 A;  4A3E B;  1Y1W G;  2BDO A;  3LGJ A;  4IFD G;  1VQL A;  5C4H A;  3CRL C;  4C56 C;  2VNU D;  4B9W A;  5IE8 A;  1B1Z A;  4I7Z C;  4DV1 Q;  2F4V L;  4UP7 A;  2NZ1 D;  4QL5 A;  2B2Y A;  4K5W A;  5EPL A;  2YU9 B;  1DZ1 A;  5CV5 A;  4EGV A;  1QNU A;  4QCL A;  4HIO A;  4DR5 L;  1A0I A;  3GDE A;  2ZJQ A;  4P74 A;  1B44 D;  3T1Y L;  3PUW A;  1YEZ A;  2CHB D;  3LNN A;  3TP5 A;  5M3F H;  4IOA A;  4FF2 A;  4RCO A;  1JOO A;  2I07 B;  3J81 L;  1PMR A;  2R93 H;  1XMO Q;  1I4P A;  3OWF A;  1XMQ Q;  4DR6 Q;  3S14 B;  4F8M A;  1AH9 A;  2KEE A;  2I5H A;  2UUA L;  1M90 C;  3MVV A;  4CHT B;  4DNR B;  1E0B A;  4BBS G;  1JE5 A;  2MO0 A;  4DK1 A;  4PZ7 A;  5K36 G;  1EQR A;  5M5X H;  3F1Z A;  4DUZ Q;  3MHB A;  2BH8 A;  4PMB A;  4U67 3;  4OGQ C;  5EPK A;  4KV6 A;  2FIN B;  1FNW A;  3WOE A;  3LWE A;  1TS2 A;  3D6C A;  3RZO B;  4DR7 L;  5GRO A;  2J0T D;  2B8G A;  3AQQ A;  4XYQ A;  4LMQ D;  2AQ3 B;  1LT3 D;  2EPB A;  4C3H B;  4YCW A;  5JOB A;  1VS0 A;  2I5L X;  2JK8 A;  2MNA A;  4A3G B;  1OXU A;  1Y1W H;  1EIH A;  4C3I G;  1TS5 A;  3T1H L;  1NJI C;  4DV2 Q;  4IFD H;  5FLM G;  3GTL H;  1PFM A;  4FDB A;  1K28 A;  4AH6 A;  1N34 Q;  1ICW A;  5C0X G;  2A19 A;  2N3S A;  2IHF A;  1RDP D;  4PZ8 A;  1KXL A;  2NZO A;  3FEW X;  1B7Y B;  1A3U A;  3PF5 A;  1EOV A;  1KTK A;  1IL2 A;  3MEH A;  1VQ6 A;  2GN5 A;  3AYH B;  1TWF B;  1SXT A;  1UWV A;  2LFN A;  3S2D B;  2F0P A;  2RF4 A;  2WII B;  4Z9C B;  3U50 C;  3EN2 A;  2ZTD A;  1V43 A;  1TT2 A;  1Y14 B;  4DAY A;  1CQV A;  2O4X A;  3TSS A;  3KF8 B;  2DN8 A;  2KHJ A;  4A3I B;  1GXD C;  1K8G A;  4KHP L;  5DM7 3;  1KLU D;  1GD7 A;  2K5V A;  5KIX A;  2KEC A;  4BBS H;  5I2X A;  1G29 1;  3PIO 3;  3U4Z A;  5K36 H;  3MXU A;  1B53 A;  1CHP D;  4RAU C;  1C4Q A;  1VMP A;  2B8F A;  1EIF A;  2QGQ A;  2FHT A;  4HCS A;  4OHJ A;  4RCN A;  2KCT A;  2ZJR A;  3TZU A;  1IYJ B;  4K2K A;  1JR0 D;  4HMI A;  4JI7 L;  2XIW A;  5LMN Q;  5EKL A;  3HOV B;  2A6E C;  1KDA A;  4A3F B;  5J1Z A;  4A3B B;  2RHQ B;  4BXX G;  2XTI A;  1F9Q A;  4ZYS A;  1NCV A;  1PZJ D;  3VR4 A;  2PMZ B;  5DLQ E;  3SK4 A;  1VF7 A;  2Q2I A;  4C3I H;  4NXM L;  4JYA Q;  3V96 A;  4JI0 Q;  1IBL L;  4MHE A;  4LUO A;  5FLM H;  1Y8P B;  4JVZ A;  2EZV A;  2G9D A;  1Y69 U;  2AHO B;  3GTM H;  4RKL A;  3J80 i;  2UXB L;  5C0X H;  1YNJ C;  2XWB B;  1QVC A;  4DK6 C;  3VDY A;  1VMC A;  3A56 A;  2EYM A;  4A76 A;  1M8A A;  4QIW B;  2A68 C;  3WDN A;  2B2U C;  3CXC A;  1NY4 A;  1PYS B;  3L0O A;  3TBI B;  4BS9 A;  4OWX B;  3W3A A;  5F2D A;  2GVB A;  1HZB A;  1YJN A;  5D3I B;  4P2C B;  3I4L A;  1UEB A;  2TSS A;  4HJ7 A;  3CW2 C;  1VQD A;  2MUY A;  2R61 A;  4GOP A;  3SK6 A;  4IFD I;  3A0J A;  1X55 A;  5T1I A;  3NEM A;  4IQZ A;  3CCS A;  2RBM A;  4IJH A;  4GKJ L;  4DR4 Q;  4A3M B;  3WOF A;  5E4X A;  1WTO A;  1AE2 A;  2PMZ E;  3CRK C;  4LF8 Q;  3NTH A;  4YWM A;  3I90 A;  4CBV A;  2JA5 H;  5FO7 B;  3SGI A;  4NXN Q;  1VQ9 A;  5COY A;  2D2C C;  4BXX H;  4QIW E;  1SNM A;  3AB9 A;  1HUM A;  4LFB Q;  2MGS A;  1PHJ A;  3SXH A;  1HZA A;  1VDZ A;  1EUJ A;  5CMD A;  4CGY B;  5C44 G;  3OW7 A;  1B50 A;  3DXJ C;  4A3D B;  4UDU C;  4JI5 Q;  3UE1 A;  4KHZ A;  1OXS C;  1VQ4 A;  2OQ0 A;  5FO9 B;  2YTY A;  4IN3 A;  2F3I A;  3KFU A;  4KK7 A;  2IX1 A;  1L1O B;  4BBR B;  1STH A;  2K4K A;  3D0F A;  2B2V A;  5D65 A;  4V19 0;  3HOW G;  4DUY Q;  4B3M Q;  1CHQ D;  3UDF A;  2F0K A;  3TEH B;  2FMM A;  3KOJ A;  2K03 A;  1LTI D;  3HP3 A;  4OL7 A;  4ILW A;  1PRT B;  4A3C G;  3A74 A;  1VQB A;  1S5E D;  4L5T A;  3PGZ A;  1C9O A;  5EAY A;  1PH4 A;  5C0X I;  4DV0 L;  1KDB A;  1PH2 A;  3BZK A;  5DNF A;  4ZQ3 A;  4DGZ A;  4HJA A;  3J81 E;  1G6Z A;  2EYF A;  2KEN A;  2NVT H;  5LL6 X;  1D6E C;  4RA8 A;  4XQJ A;  1STG A;  3A55 A;  1FYC A;  2XN9 C;  1WCM B;  3J81 i;  4R1J A;  4O1N A;  1N32 L;  1HNW Q;  3PSI A;  3RLN A;  4A3J B;  3S16 B;  2IL8 A;  3G7L A;  5IGC A;  4B3S Q;  3CCL A;  2JA6 G;  1XNR Q;  4GS3 A;  2F0G A;  2NUC A;  3RLO A;  3K58 A;  1KLG D;  1D5X C;  1CT1 D;  1BDO A;  4J15 A;  2ZXR A;  2P5Z X;  2HCI A;  2K7V A;  4POG A;  2L1B A;  2PNR C;  1VQ8 A;  1I4R A;  2CW0 C;  4JI4 Q;  4CDF C;  3S15 B;  3S1Q H;  5KNC A;  5C44 H;  3H0G B;  1H9R A;  4H0L C;  3J7Y W;  3PUX A;  2A69 D;  4X64 Q;  4HIK A;  3U4V A;  5JPN C;  4N9P A;  1SE8 A;  3HG9 A;  2F3W A;  2Y0S G;  2BA1 A;  2JN4 A;  1LT6 D;  2F0Q A;  3BG3 A;  4ZLT F;  1E2W A;  2PW5 A;  5LL6 S;  3HOW H;  4UY8 C;  1EQT A;  1TWH H;  1XTD A;  4FO2 A;  1N8R C;  2N49 A;  4HAE A;  1W6K A;  5ELC A;  2PZT A;  1YBY A;  1BCP D;  3VYS A;  1JJ2 A;  4EX5 A;  4A3C H;  4PV1 C;  3GTK B;  1I5F A;  5FJ8 G;  1ILQ A;  1V1Q A;  3FDT A;  3M4Y A;  2IX3 A;  5H1S E;  4YCV A;  4ME3 A;  3A54 A;  4XDX A;  4IFD J;  1D8L A;  3PIO A;  2QF7 A;  4M1U B;  1PV4 A;  3DLL A;  3TZD A;  4DFA A;  3KDF A;  1HPC A;  4AQY Q;  1MJE A;  4X65 L;  1J5E Q;  4G57 A;  1Q8I A;  5M3M G;  4GNX B;  2JA6 H;  2OXP A;  1RF2 D;  1Q7Y C;  3IFD A;  2HIV A;  1Y8O B;  1G91 A;  1HZC A;  4K2L A;  2JJQ A;  4RGO S;  4PZ6 A;  4XT1 B;  1SAP A;  1OTC A;  1MGS A;  3F8T A;  4K0K L;  4KTA A;  2M00 A;  4WOR A;  3SE0 A;  3PQI A;  1ZEQ X;  3S2H B;  4JBK A;  4EVO A;  3W1G A;  1KDC A;  1PTO F;  2Q8R E;  3GTO H;  3NUC A;  5CV6 A;  1Z9F A;  3E5S A;  4DR5 Q;  4DN4 M;  1VQE A;  1BF4 A;  3HKZ G;  4OIJ A;  3CAM A;  4DNI A;  3J7A F;  3D4D A;  3MXG A;  5I4D A;  5HGQ A;  5KYI A;  4GOP C;  1BUV T;  3QR8 A;  1YIJ A;  5IGD A;  2WFW A;  1ENC A;  1LTS D;  3NWS A;  3PO3 B;  2OWO A;  1VQF A;  4QY7 A;  1X32 A;  2UUA Q;  5I9P A;  2EYP A;  2N78 A;  2IW3 A;  1EWI A;  2EY6 A;  5FJ8 H;  3J7A 5;  1BR9 A;  2RSN A;  1F2Y A;  1YZ6 A;  4NMZ A;  1E2Z A;  5M9O A;  2EJF C;  1U5K A;  2HUG A;  5C0X J;  3I4N G;  1QG7 A;  2QCP X;  1Q8K A;  2E2J H;  3OWE B;  5DM6 3;  1CKN B;  3UDX A;  5M3M H;  2UUB L;  1TY2 A;  1PFN A;  4DR7 Q;  1O80 A;  1S5C D;  2NBF A;  4A3L G;  4GN5 A;  1EIG A;  2NN6 G;  2FJ2 A;  2J4X A;  1PRT D;  1HR0 W;  1SJH D;  1CSP A;  4XQN A;  4WRD A;  3E9I A;  5J22 A;  3GTJ B;  1H9S B;  5I9O A;  3DWP A;  1Q81 C;  3F2C A;  1MIU A;  3KF6 A;  4H13 C;  1F9R A;  2ZXP A;  4HCE A;  1EEI D;  4Q5V A;  4CDC C;  2AWN A;  4FNF A;  3DM3 A;  4KHV A;  4JOI A;  1ONL A;  5CYU A;  3R2T A;  3J7Z C;  3M4P A;  1XPU A;  2K50 A;  1TU2 B;  1YNN C;  5ELB A;  4C2M H;  4A3K H;  2H4O A;  1N36 L;  1PH1 A;  1HR0 L;  2OT2 A;  1B9M A;  3K5N A;  5C4Z A;  4F7X A;  2K5Q A;  1S5D D;  1SMX A;  5JVG 3;  3I2Z A;  1BQQ T;  4POF A;  3VA5 A;  2I46 A;  2E2H H;  3E6Z X;  1K83 H;  3STB C;  1O78 A;  3JAM c;  2EOT A;  1EU4 A;  4I7A A;  1L2F A;  2IHE A;  3S1N B;  3A8I E;  1WTW A;  2JA8 G;  1ICF B;  2V1C C;  4TKO B;  1EY9 A;  2EY2 A;  2R7D A;  4GN3 B;  2QA4 A;  2BCO A;  2SEB D;  3HKS A;  3HOU G;  3L9A X;  1X3Q A;  1PTO H;  1U4P A;  4ZUJ A;  2FMC A;  3I4N H;  5JJL A;  1AP0 A;  3I7F A;  1J6Q A;  2F0N A;  5IYC G;  4JI2 Q;  2ZM6 L;  2JA7 G;  1QUQ B;  3M4O H;  4IUP A;  1RD9 D;  3T51 B;  2PI2 E;  5FKA C;  2PCF B;  1VQJ A;  3V05 A;  1L0Y B;  4A3L H;  5A2Q L;  3CCV A;  4KJO A;  3OOC A;  2SOB A;  2PZW A;  3IRB A;  2NN6 H;  1YIT A;  1PTO C;  4JBW A;  3AU7 A;  4UHV A;  3CC2 A;  2FFK B;  5GAD C;  5CV8 A;  4KN4 C;  3K6O A;  4ZCK A;  3BZD B;  1I50 H;  3CCU A;  4M8A A;  1U0L A;  1PH6 A;  4NXM Q;  5IGE A;  1IBL Q;  1HH2 P;  1WTV A;  1NR2 A;  1CM9 A;  2UXB Q;  2K32 A;  4WJ4 A;  5BN3 A;  1D5M C;  4QUC A;  1Y1W B;  1F77 A;  4O42 A;  4R4I A;  3GTL B;  2L15 A;  1YHQ A;  1HQM C;  1N9W A;  3Q24 A;  3M7N A;  4WJW A;  2PQA B;  5E7N A;  1H9M A;  3QIA A;  1K9M C;  4U68 A;  2KBN A;  2CCZ A;  2OTJ A;  2VS1 A;  2MFI A;  1IYV A;  3TP7 A;  2F4I A;  4X62 L;  1UUP A;  3M4Q A;  2JA8 H;  1DXM A;  1I3Q B;  1SNQ A;  2NVY B;  4ZAI A;  3DEO A;  1I4G A;  4LUZ A;  1GUO A;  3HRZ C;  1SMY D;  1BXT A;  2LY7 A;  3GTG B;  2F0E A;  1CA5 A;  3HOU H;  1BOS A;  5IGB A;  1ZYR D;  4CKB A;  1KAB A;  3QWN A;  5ELO A;  2X6L A;  2IT1 A;  1DOK A;  5IYC H;  2JA7 H;  2RDG A;  2XNA C;  4TVA B;  4K14 A;  4V0B A;  2HCC A;  4IPC A;  1U4M A;  1X3P A;  4LFA Q;  3H09 A;  2WKC A;  1T9H A;  5K5P A;  1KD1 C;  1STB A;  1VQA A;  4GKK Q;  1JIC A;  4WJ3 M;  4KY7 A;  3G48 A;  4F88 A;  2EXZ A;  1KRT A;  2QIL A;  3OPO A;  5AJ3 Q;  4QMG A;  4LF5 L;  2VUM G;  3Q23 A;  1E22 A;  1BBX C;  2NTS A;  2Z9H A;  4KN7 C;  2CQA A;  2UUC L;  4B08 A;  5GAE C;  3RZD B;  4AYB G;  5IGG A;  1GKH A;  4DR2 L;  3MXP A;  5IWA L;  2NN6 I;  3HS0 C;  5A35 A;  1SRO A;  4OWT B;  2EVB A;  2Z1C A;  2JEA I;  4L5R C;  1FVI A;  1D1K A;  1EY7 A;  1VQC A;  3R3O A;  1WD0 A;  1MHW C;  3DHQ A;  2KCM A;  4PMW A;  1ILP A;  5COR A;  2L5T A;  2WV6 D;  2ID0 A;  4IOC A;  1KAW A;  3I4M G;  5IOD A;  4DA2 A;  2JSO A;  4DV0 Q;  1RTN A;  1NR4 A;  1BKB A;  3ER0 A;  4MNO A;  1L0X B;  4PMC A;  1V1P B;  2ASB A;  3CP0 A;  4H44 C;  1QE6 A;  4GLA C;  4JCV E;  3DUZ A;  3EA6 A;  4LF9 L;  1PVO A;  3TS2 A;  2KCC A;  1HZ9 A;  4BWG B;  1N32 Q;  1SFO B;  2I0Q A;  4A3E G;  2WB1 B;  1ASZ A;  4K8I A;  2MPM A;  1Y1V G;  1U4R A;  1CZW A;  2D62 A;  3G4S A;  3DEP A;  3NWT A;  1KL9 A;  1A2U A;  2XWJ B;  3G6E A;  1R9T H;  1TWA H;  1TWC B;  1STA A;  2BH2 A;  3DM1 A;  2PQE A;  1HFG A;  3HOY B;  1CQF A;  2HDL A;  4JOI C;  3TDQ A;  2JYO A;  4QB4 A;  1B8A A;  2CKZ B;  5ISR A;  1VQG A;  1JMC A;  4DR1 L;  5HY6 A;  2E2I B;  2VUM H;  2NVQ B;  1I4Q A;  2BE5 D;  2RKS A;  1I94 L;  2UXD L;  3R8B A;  2F0O A;  1A63 A;  1S5B D;  3PUY A;  4YWL A;  1EY8 A;  4UP9 A;  4CKE A;  3HEJ A;  3S1M B;  1E3P A;  4MTK A;  1VQ5 A;  1VQK A;  3E0J A;  3D4R A;  5E3F A;  1GHJ A;  1NNX A;  4ZUI A;  1ASY A;  3NXW A;  3C46 A;  1N33 L;  1LM0 A;  1GJX A;  3G6J B;  3S17 H;  3MTS A;  4LNQ A;  1I4X A;  2WB1 E;  4DV7 L;  1NMF A;  1WTH A;  5BN5 A;  2NVX H;  3I4M H;  1I4H A;  1EQV A;  2DUD A;  2D5D A;  2F0U A;  1O7Y A;  5M5Y H;  1DON A;  1V9P A;  2E75 C;  2JA5 G;  3AEV A;  3KLW A;  2L9H A;  2VQE L;  3H3V H;  1YI2 A;  1SBB B;  3J80 c;  2DY7 A;  2KED A;  3PO2 B;  2XRQ D;  4C3H G;  4X65 Q;  4A3E H;  4ZK9 B;  2NB0 A;  1Y1V H;  5J39 A;  4A3G G;  4JW0 A;  1U4L A;  3K5O A;  5IGF A;  1IBK L;  4DXG A;  1TWG B;  3H3V C;  1JB3 A;  3CKI B;  1CKO A;  3L7Z C;  2NZH A;  4K0K Q;  3ZJY C;  2YU9 H;  1LTR D;  4DKA C;  2EDG A;  3EBE A;  2X6G A;  3I3C A;  3K8A A;  4OIK A;  5A2Q E;  4PG3 A;  4RFB A;  2VQF Q;  3GTP H;  3BVG A;  3VYU A;  3K57 A;  1VQN A;  2RHS B;  1CSQ A;  1J8I A;  2MP1 A;  1FGU A;  3S14 H;  4JI6 Q;  3GO5 A;  4CJ0 B;  1BCP F;  4A3I G;  2A6E D;  4GLV B;  2KA7 A;  2WAQ B;  2AMC B;  1OXT A;  1RCV D;  1Z6H A;  3GTQ B;  4CJ2 C;  4IJL A;  3UDG A;  5JPM C;  1L1O A;  4N9T A;  3I4O A;  5IT9 L;  2F0F A;  4LK1 C;  4CJ1 B;  3K81 C;  2PNH A;  2AQ2 B;  3AMU A;  1TII D;  2B2T A;  3MEF A;  1XWE A;  3A5U A;  4DV6 L;  5IP7 G;  5AFW A;  5ELF A;  2F0V A;  1M1K C;  1BNZ A;  2O2L D;  2Z6K C;  3A7L A;  1YNJ D;  1L0W A;  2L11 A;  3RZO H;  1LTA D;  1HFN A;  4A3F G;  2K04 A;  2AKW B;  4B3T L;  4A3B G;  1IW7 D;  3KJO A;  2CVR A;  2LKV A;  5JVH 3;  4C3H H;  2UUB Q;  1X56 A;  5CR3 A;  4L63 B;  4A3G H;  1U9R A;  1STN A;  1YJW A;  5GAG C;  1B70 B;  1PLF A;  1DCZ A;  3C1F A;  1K8M A;  4LF6 Q;  3OIQ A;  2B63 B;  4YWK A;  2B2Y C;  1LT5 D;  4DK0 A;  1EZ8 A;  4P73 A;  1SE2 A;  4HMJ A;  2B2W A;  5C4X B;  5LMU L;  4DV5 Q;  4RKB A;  1WYD A;  3CQZ B;  1SSO A;  2WAQ E;  4IUQ A;  3CCR A;  4JI3 L;  3H94 A;  4K6L A;  1TWF H;  3H3V I;  4LF4 Q;  1WTX A;  3S2D H;  4DV1 L;  5EBD A;  1SNC A;  1PDQ A;  1WD1 A;  4WFN 3;  1FL0 A;  2R7Z G;  1N36 Q;  1JOQ A;  2DY8 A;  2WKD A;  2Z0S A;  1PH5 A;  3TP6 A;  4A3I H;  4TQU S;  1GUW A;  3J81 c;  4MN3 A;  3ND9 A;  1BVS A;  3G71 A;  4YHH Q;  2PPB C;  1IKM A;  5NUC A;  3GTO B;  3FPP A;  1XMO L;  1EWH A;  2K5N A;  2E74 C;  2VY3 A;  1HUN A;  2QEJ C;  1WTR A;  3PCO B;  3K5L A;  3JAM L;  4GZY C;  5IP7 H;  2A73 B;  1C7Y A;  3I8Z A;  1D2B A;  3ERS X;  1DOM A;  3ERO A;  3TQY A;  1WJJ A;  3CMA A;  4RGT A;  1QJO A;  3D3R A;  4KKU A;  2A69 C;  4JV5 L;  4A3F H; 
#chains in the Genus database with same CATH homology
 4ME5 A;  1PRT F;  4BA2 I;  3QG1 A;  5EGT A;  2QKI C;  1KNA A;  4MIU A;  2PZU A;  2BDN A;  3W2D A;  2JXM B;  2C9O A;  5M5W B;  1BCP C;  1T5E A;  5EKK A;  1QWY A;  1TS4 A;  2WAC A;  2Z4I A;  2Q8I B;  3BDO A;  1RJT A;  4DAP A;  3BDL A;  1W6J A;  3IKJ A;  1RHP A;  4C1N I;  4DU9 A;  3BYY B;  3HOZ B;  3RUZ A;  3LWU A;  5C4J B;  4Y7N B;  3K7A B;  3FKI B;  2O5I C;  4KMU C;  4C2M B;  4HR7 B;  3F2U A;  2N88 A;  2SDF A;  3EFX D;  2AQ1 B;  3IAY A;  1SYB A;  3MFG A;  4I65 A;  1LT4 D;  2EY1 A;  2F0D A;  1STE A;  1SYE A;  3D6W A;  3K5M A;  1OXV A;  1DOL A;  4C3J G;  2EYH A;  1O7Z A;  3OIP A;  3NQT A;  3HOX B;  3NBH A;  5C3W A;  4HN7 A;  1EEF D;  2VB2 X;  3ONA B;  1I6H B;  4TSS A;  1PTO B;  4HSP A;  3QJY A;  2VXW A;  3VR5 A;  1F9S A;  2ENB A;  4J6H A;  1SYF A;  2IJ0 A;  3HZX A;  4G4K A;  3VR3 A;  4FF3 A;  1AZQ A;  1H9S A;  4FYD A;  1EY0 A;  1JQY D;  2EJM A;  2AUJ D;  2RDH A;  3EQL C;  1Q90 A;  3KBX A;  3UI2 A;  3A7A B;  1CI3 M;  2B2T C;  1S5F D;  2DNC A;  1LV9 A;  3PMF A;  1PRT C;  2A5H A;  5E1F A;  1B2T A;  1SYG A;  2BOS A;  2MJ8 A;  3VR6 A;  4RGM A;  2WP8 J;  1JOR A;  4ULL A;  1CFM A;  3T16 A;  4YIJ A;  3NSW A;  3NPP A;  5IT9 E;  2F0L A;  3C3L A;  5DAU A;  4KD4 A;  3MA2 B;  3Q6S A;  2F0H A;  1SYC A;  1D1I A;  2B2W C;  1CK1 A;  4IUR A;  4ID6 A;  5CGK A;  5G3L D;  4B9X A;  2R92 B;  1HCZ A;  4PNY A;  2Q8T A;  3M7G A;  3M3Y B;  4HSV A;  1JCK B;  4G7H C;  2JA7 B;  5FK9 C;  3QOL A;  1QNK A;  2M9V A;  2B2V C;  2OEO A;  2SNS A;  2JE6 I;  2XSC A;  1F2M A;  4FF1 A;  2C5C A;  3A8K E;  1KAA A;  1TQO A;  4PQX A;  3I70 A;  3RLF A;  3OMG A;  2G9H D;  1C8C A;  2F0S A;  1UEA B;  1IKL A;  2F0I A;  3IFT A;  2L12 A;  1QB5 D;  5M3F B;  4S3S A;  1EFI D;  2HQE A;  2R93 B;  3T53 B;  1UAP A;  3SDZ A;  3P1H A;  3GD7 A;  1LAC A;  3K59 A;  5LHY 1;  1AFP A;  1SJE D;  4DNT B;  1CZG A;  4IUV A;  1R4P B;  3BVZ A;  1XXG A;  5ELD A;  2ICE C;  1EYC A;  5M5X B;  2A74 C;  3JAM E;  3GV3 A;  1Z7T A;  3J80 L;  1GUG A;  2K33 A;  3X3M A;  5IIF A;  1K8O A;  2EYL A;  1EL0 A;  1RTO A;  5CBE E;  5C6A A;  4Q0F A;  4E6I A;  1V1O A;  3FMC A;  2RQX A;  3Q0A A;  3U9S A;  1EYA A;  1ML0 D;  1ENA A;  3ITP A;  3M85 A;  3K0Y A;  3BS1 A;  4XXE A;  1SMY C;  5D3D A;  1HQR D;  1LTG D;  1Z47 A;  2F0M A;  1CTM A;  1CA6 A;  1GOZ A;  4AYB B;  2HDM A;  2VB3 X;  2SNM A;  4F87 A;  1LLR D;  4BBS B;  5DEH A;  2ZXO A;  2F0T A;  2EJG C;  4X3U A;  4EQN A;  1VCI A;  1A3T A;  1MSG A;  4IZ8 A;  1V1P A;  4NKL A;  3H6M A;  5TSS A;  1G8Z D;  1A2T A;  1DJR D;  3A8J E;  3QOJ A;  1G2T A;  1AW7 A;  5IOC A;  2A6H D;  4R9W A;  3L3O C;  3SK5 A;  1IYU A;  1Y1V B;  5I6W A;  4KD3 A;  3NQI A;  4C3I B;  5C5M A;  1DYQ A;  3GTM B;  1F2L A;  1SNO A;  1V8Q A;  4IUN A;  3R2I A;  3T4A C;  1Q12 A;  4CKC A;  3GTP B;  3SK8 A;  4FXK C;  1ROD A;  4K5V A;  3CHB D;  5CBA E;  4XQQ A;  3KF8 A;  3VYT A;  1JC7 A;  4EQP A;  5HUR A;  1A15 A;  2JEB I;  1JE4 A;  3RD4 A;  4XYO A;  2Z8L A;  3N52 A;  4FVM A;  4RGN A;  4KKS A;  2BE5 C;  5EJW A;  2IWH A;  2V4D A;  3T56 B;  3VA7 A;  2JA5 B;  1SND A;  1PZI D;  1DM0 B;  2K01 A;  1VF5 C;  1LTT D;  2LMC B;  1ESF A;  1Q3L A;  1SEB D;  4R8I A;  2K5D A;  1MSH A;  4NP5 A;  5KND A;  3GP7 A;  1QIL A;  5CC4 A;  3DMU A;  1HA5 A;  2R3Z A;  4UAI A;  4HED A;  5FOB B;  5EBC A;  3DWA A;  4LAA A;  3MC0 B;  4IAL A;  3ERQ A;  3MZ5 A;  1IL8 A;  5JAV A;  2E2D C;  3NHH A;  1SE3 A;  3Q22 A;  4XIG S;  3OHX C;  3EVQ A;  2NWG A;  3O13 A;  4JK1 C;  2R6G A;  1EY6 A;  2NVT B;  3I72 A;  4H7B A;  1NUC A;  3BVM A;  4ZKC B;  3T13 A;  2K05 A;  4IUT A;  1FNU A;  1KNE A;  1UNS A;  1BCP B;  2DNE A;  5CV9 A;  3SHL A;  1JWU D;  3J80 E;  5EKI A;  4K8J A;  3X3N A;  2PYK A;  3S1Q B;  3NK9 A;  5C44 B;  1OO9 B;  1DD2 A;  2EE1 A;  2J7Z A;  5HGT A;  3H91 A;  5FLX L;  3P7J A;  2PO4 A;  3IL8 A;  2EY5 A;  1BO0 A;  3KBG A;  1IW7 C;  3PIP 3;  2YYZ A;  3RMH A;  2RVL A;  4RH6 A;  1PXU A;  4X3S A;  3HOW B;  5I6Y A;  1TWH B;  4ODG A;  2R7Z B;  1OXX K;  1J9O A;  1S4Z A;  1B3A A;  4TRD A;  4ABN A;  2RA4 A;  2A68 D;  3OSO A;  2GA4 B;  4LJZ C;  4BA1 I;  1WTQ A;  5JJZ A;  4ZRZ A;  1M4V A;  1FGB D;  1Y8N B;  1JWS D;  3TN2 A;  1QOH A;  4G7O C;  3PV0 A;  2JA6 B;  3N6R A;  2QDB A;  1AEX A;  1Q1E A;  3KLS A;  4NW2 A;  5JEA G;  4DXF A;  4L6T B;  2OF1 A;  1HTL D;  1O7L A;  3NE5 B;  4X3T A;  2MHV A;  2Y0S B;  3MFY A;  1A3V A;  1H9K A;  1EU3 A;  1I6V C;  3D8G A;  4OO1 G;  3HGB A;  4ZKB B;  5E4W C;  5BN4 A;  1SYD A;  1LTB D;  2EYJ A;  4RHS A;  4BY1 B;  4QUF A;  1EOT A;  2F1M A;  1C48 A;  2F3V A;  5I2Y A;  5G3L F;  5KYL A;  3KLS X;  3VR2 A;  2E2J B;  1B9N A;  3GV6 A;  5M3M B;  4C3J B;  1B4O A;  2KVM A;  4G7Z C;  3NTI A;  4FXG C;  5JEA H;  1MD2 D;  2PW7 A;  1SE4 A;  3MWY W;  2K5W A;  5CV7 A;  5EQ0 A;  4KY6 A;  2H1E A;  1IHZ A;  3SEB A;  1JOK A;  2BA0 A;  2KOL A;  5KRU A;  2L55 A;  4A3K B;  1GUS A;  1F2Z A;  2CW0 D;  3HKZ B;  4RHR A;  2KUM A;  1SDF A;  1LO5 D;  3PUZ A;  2RSO A;  2E2H B;  3TP8 A;  1K83 B;  1GUT A;  2K1B A;  5KNB A;  3D31 A;  4OO1 H;  1EY4 A;  1PZK D;  1ZXT A;  4XT3 B;  1NAP A;  4R8N A;  3DWQ A;  1STY A;  2RDF A;  2KQ3 A;  4KJN A;  1EWC A;  4RWS C;  3I4N B;  1NSN S;  2IPK D;  3EJI A;  2E76 C;  4XTC S;  3URY A;  2IX0 A;  2WIN B;  3M4O B;  3FVQ A;  3MXN A;  1PFB A;  2KHS A;  4K5X A;  3I91 A;  2ICI A;  5D14 A;  3LX0 A;  1ZKO A;  5ELE A;  4A93 B;  2JP1 A;  4IUU A;  2F0J A;  1I50 B;  4HTH A;  5C5L A;  3SR1 A;  1HTP A;  2D9U A;  3OMC A;  3P20 A;  5C3E B;  2KCN A;  3KK7 A;  3FPU B;  3KUP A;  1EY5 A;  2X69 A;  3C1E A;  2F03 A;  4NDX A;  1A6X A;  2EYO A;  2N55 A;  1ENF A;  5KEE A;  5CV4 A;  1ET9 A;  5FLX E;  1G2S A;  1HHV A;  3SVM A;  3FRP B;  1TY0 A;  2JA8 B;  1FD7 D;  3U9O A;  1R4Q B;  2Z4H A;  1HA6 A;  1TS3 A;  4FXD A;  3V2T A;  1HXY D;  2NYZ D;  3HOU B;  4QF4 A;  1HRJ A;  3QO2 A;  1JWM D;  4KY5 A;  1II3 A;  5C3X A;  1Q1B A;  1XYI A;  2K6A A;  2M2L A;  4OO1 I;  2AWO A;  3S1R B;  2ZT9 C;  2KJX A;  3GQB A;  5EPJ A;  1TVX A;  1ESR A;  2LS0 1;  3P75 A;  3J7A V;  1WTP A;  4BY7 B;  2F0W A;  1FNV A;  1H9J A;  2XVS A;  1FR3 A;  1TKW B;  2L0C A;  4X3K A;  5KGU A;  3D4W A;  4KKT A;  1LAB A;  4C1N K;  2NTT A;  3NTK A;  1YNN D;  1QCB D;  5T1G A;  1GUN A;  2B39 A;  4EQO A;  3QB3 A;  3BDC A;  4J8Q A;  3ZYY X;  3NBI A;  2L4N A;  5FO8 B;  3CU7 A;  4DAV A;  2XRS D;  1EYD A;  3NP8 A;  1R9T B;  1D5Z C;  1TWA B;  3I73 A;  3MAQ A;  4DF7 A;  1E2V A;  1ZYR C;  4K6D A;  3VYR A;  1GHK A;  1WVL A;  4FF4 A;  2VUM B;  1PTO D;  1AZP A;  2AUK A;  3BYT B;  2B2U A;  1XX8 A;  3R93 A;  1MI2 A;  1AN8 A;  4J1M A;  3ND8 A;  2K28 A;  1MBY A;  1T5X D;  3S9W A;  1F9P A;  2A6H C;  1RKN A;  3PUV A;  5JEA J;  1SNP A;  3S17 B;  3I4M B;  2NVX B;  1PYW D;  3KLR A;  1XTC D;  1ET6 A;  2TMP A;  1EZ6 A;  5M5Y B;  1TR5 A;  2O5J C;  3C2P A;  4FP5 D;  4L8J A;  3TME A;  4KI0 A;  4A3E B;  2BDO A;  4IFD G;  5C4H A;  3CRL C;  4C56 C;  2VNU D;  4B9W A;  1B1Z A;  4I7Z C;  2NZ1 D;  2B2Y A;  4K5W A;  5EPL A;  2YU9 B;  1DZ1 A;  5CV5 A;  4EGV A;  1QNU A;  4QCL A;  1B44 D;  3PUW A;  3TP5 A;  2CHB D;  3LNN A;  4FF2 A;  4RCO A;  1JOO A;  2I07 B;  3J81 L;  1PMR A;  1I4P A;  3OWF A;  3S14 B;  4F8M A;  2KEE A;  3MVV A;  4CHT B;  4DNR B;  1E0B A;  4DK1 A;  5K36 G;  3MHB A;  4PMB A;  4U67 3;  4OGQ C;  5EPK A;  4KV6 A;  2FIN B;  1FNW A;  3WOE A;  3LWE A;  1TS2 A;  3D6C A;  3RZO B;  2J0T D;  2B8G A;  4XYQ A;  4LMQ D;  2AQ3 B;  1LT3 D;  2EPB A;  4C3H B;  5JOB A;  4A3G B;  1EIH A;  1OXU A;  4C3I G;  1TS5 A;  4IFD H;  1PFM A;  1ICW A;  5C0X G;  1RDP D;  3FEW X;  1A3U A;  1KTK A;  3MEH A;  1TWF B;  1SXT A;  2LFN A;  3S2D B;  2F0P A;  2WII B;  4Z9C B;  1V43 A;  1TT2 A;  4DAY A;  1CQV A;  2O4X A;  3TSS A;  2DN8 A;  4A3I B;  1GXD C;  5DM7 3;  1KLU D;  5KIX A;  2KEC A;  5I2X A;  1G29 1;  3PIO 3;  5K36 H;  3MXU A;  1B53 A;  1CHP D;  4RAU C;  1C4Q A;  1VMP A;  2B8F A;  2FHT A;  4HCS A;  4OHJ A;  4RCN A;  3TZU A;  4K2K A;  1JR0 D;  4HMI A;  2XIW A;  5EKL A;  3HOV B;  2A6E C;  1KDA A;  4A3F B;  5J1Z A;  4A3B B;  1F9Q A;  4ZYS A;  1NCV A;  1PZJ D;  3VR4 A;  2PMZ B;  3SK4 A;  1VF7 A;  3V96 A;  4MHE A;  1Y69 U;  1Y8P B;  2EZV A;  2G9D A;  4RKL A;  5C0X H;  1YNJ C;  2XWB B;  1VMC A;  3A56 A;  2EYM A;  1M8A A;  4QIW B;  2A68 C;  3WDN A;  2B2U C;  3TBI B;  4BS9 A;  3W3A A;  5F2D A;  5D3I B;  4P2C B;  3I4L A;  2TSS A;  2MUY A;  2R61 A;  4IFD I;  3SK6 A;  5T1I A;  4IQZ A;  2RBM A;  4A3M B;  3WOF A;  5E4X A;  1WTO A;  3CRK C;  3NTH A;  4CBV A;  3I90 A;  5FO7 B;  5COY A;  2D2C C;  1SNM A;  3AB9 A;  1HUM A;  2MGS A;  3SXH A;  1VDZ A;  5CMD A;  4CGY B;  3OW7 A;  1B50 A;  3DXJ C;  4A3D B;  4UDU C;  4KHZ A;  1OXS C;  5FO9 B;  4IN3 A;  4KK7 A;  2IX1 A;  4BBR B;  1STH A;  4V19 0;  2B2V A;  5D65 A;  1CHQ D;  2F0K A;  2FMM A;  2K03 A;  1LTI D;  3HP3 A;  4OL7 A;  4ILW A;  1PRT B;  1S5E D;  5C0X I;  1KDB A;  5DNF A;  4ZQ3 A;  4DGZ A;  3J81 E;  1G6Z A;  2EYF A;  5LL6 X;  1D6E C;  4RA8 A;  4XQJ A;  1STG A;  3A55 A;  1FYC A;  2XN9 C;  1WCM B;  4O1N A;  3S16 B;  4A3J B;  2IL8 A;  3G7L A;  5IGC A;  2F0G A;  2NUC A;  3K58 A;  1KLG D;  1D5X C;  1CT1 D;  1BDO A;  2ZXR A;  2HCI A;  2K7V A;  2L1B A;  2PNR C;  1I4R A;  2CW0 C;  3S15 B;  5KNC A;  3H0G B;  1H9R A;  4H0L C;  3J7Y W;  3PUX A;  2A69 D;  5JPN C;  4N9P A;  3HG9 A;  2F3W A;  2BA1 A;  1LT6 D;  2F0Q A;  3BG3 A;  4ZLT F;  1E2W A;  2PW5 A;  5LL6 S;  1EQT A;  4FO2 A;  4HAE A;  1W6K A;  5ELC A;  2PZT A;  1BCP D;  3VYS A;  4PV1 C;  3GTK B;  1ILQ A;  3FDT A;  3M4Y A;  2IX3 A;  3A54 A;  4XDX A;  4IFD J;  2QF7 A;  4M1U B;  3TZD A;  4DFA A;  1HPC A;  4G57 A;  1Q8I A;  2OXP A;  1RF2 D;  3IFD A;  1Y8O B;  1G91 A;  4K2L A;  4RGO S;  4XT1 B;  1SAP A;  1MGS A;  4KTA A;  2M00 A;  4WOR A;  3SE0 A;  1ZEQ X;  3S2H B;  4EVO A;  1KDC A;  1PTO F;  2Q8R E;  3NUC A;  5CV6 A;  3E5S A;  4DN4 M;  1BF4 A;  4OIJ A;  3J7A F;  3D4D A;  3MXG A;  5I4D A;  5KYI A;  1BUV T;  5IGD A;  1ENC A;  1LTS D;  3NWS A;  3PO3 B;  1X32 A;  5I9P A;  2EYP A;  2IW3 A;  2EY6 A;  1BR9 A;  2RSN A;  1F2Y A;  4NMZ A;  1E2Z A;  5M9O A;  2EJF C;  2HUG A;  5C0X J;  1QG7 A;  2QCP X;  3OWE B;  5DM6 3;  1TY2 A;  1PFN A;  1O80 A;  1S5C D;  2NBF A;  1EIG A;  2NN6 G;  2FJ2 A;  2J4X A;  1PRT D;  1SJH D;  4XQN A;  4WRD A;  5J22 A;  3GTJ B;  1H9S B;  5I9O A;  3DWP A;  4H13 C;  1F9R A;  2ZXP A;  4HCE A;  1EEI D;  4Q5V A;  2AWN A;  4FNF A;  4KHV A;  1ONL A;  5CYU A;  3R2T A;  1TU2 B;  1YNN C;  5ELB A;  2H4O A;  2OT2 A;  1B9M A;  3K5N A;  5C4Z A;  4F7X A;  2K5Q A;  1S5D D;  5JVG 3;  1BQQ T;  3VA5 A;  2I46 A;  3E6Z X;  1O78 A;  2EOT A;  1EU4 A;  3S1N B;  3A8I E;  1WTW A;  4TKO B;  1EY9 A;  2EY2 A;  2BCO A;  2SEB D;  3L9A X;  1X3Q A;  1PTO H;  1U4P A;  4ZUJ A;  2FMC A;  1AP0 A;  2F0N A;  4IUP A;  1RD9 D;  3T51 B;  5FKA C;  2PCF B;  3V05 A;  1L0Y B;  5A2Q L;  4KJO A;  3OOC A;  2SOB A;  2PZW A;  2NN6 H;  1PTO C;  4JBW A;  3AU7 A;  2FFK B;  5CV8 A;  4KN4 C;  3K6O A;  3BZD B;  4M8A A;  5IGE A;  1WTV A;  1NR2 A;  1CM9 A;  2K32 A;  5BN3 A;  1D5M C;  4QUC A;  1Y1W B;  1F77 A;  4O42 A;  3GTL B;  1HQM C;  3Q24 A;  3M7N A;  4WJW A;  1H9M A;  3QIA A;  4U68 A;  1IYV A;  3TP7 A;  2F4I A;  1UUP A;  1DXM A;  1I3Q B;  1SNQ A;  2NVY B;  4ZAI A;  3DEO A;  1I4G A;  1GUO A;  3HRZ C;  1SMY D;  1BXT A;  2LY7 A;  3GTG B;  2F0E A;  1CA5 A;  1BOS A;  5IGB A;  1ZYR D;  4CKB A;  1KAB A;  3QWN A;  2X6L A;  2IT1 A;  1DOK A;  2RDG A;  2XNA C;  4K14 A;  4V0B A;  2HCC A;  1U4M A;  1X3P A;  3H09 A;  2WKC A;  5K5P A;  1STB A;  1JIC A;  4KY7 A;  4F88 A;  2EXZ A;  2QIL A;  3OPO A;  4QMG A;  3Q23 A;  1BBX C;  2NTS A;  4KN7 C;  2CQA A;  4B08 A;  3RZD B;  5IGG A;  3MXP A;  2NN6 I;  3HS0 C;  5A35 A;  2EVB A;  2Z1C A;  2JEA I;  1D1K A;  1EY7 A;  3R3O A;  1WD0 A;  3DHQ A;  4PMW A;  1ILP A;  5COR A;  2L5T A;  2WV6 D;  2ID0 A;  5IOD A;  4DA2 A;  2JSO A;  1RTN A;  1NR4 A;  1L0X B;  4PMC A;  1V1P B;  4H44 C;  1QE6 A;  3DUZ A;  3EA6 A;  2KCC A;  4BWG B;  1SFO B;  2WB1 B;  4K8I A;  2MPM A;  1U4R A;  1CZW A;  2D62 A;  3DEP A;  3NWT A;  2XWJ B;  1A2U A;  1TWC B;  1STA A;  3DM1 A;  2PQE A;  1HFG A;  3HOY B;  1CQF A;  2HDL A;  3TDQ A;  2JYO A;  4QB4 A;  5ISR A;  2E2I B;  2NVQ B;  1I4Q A;  2BE5 D;  2RKS A;  3R8B A;  2F0O A;  1S5B D;  3PUY A;  1EY8 A;  4CKE A;  3HEJ A;  3S1M B;  3E0J A;  3D4R A;  5E3F A;  1GHJ A;  4ZUI A;  3NXW A;  3C46 A;  1GJX A;  3G6J B;  3MTS A;  1I4X A;  5BN5 A;  1I4H A;  1EQV A;  2D5D A;  2F0U A;  1O7Y A;  1DON A;  2E75 C;  2L9H A;  1SBB B;  2DY7 A;  2KED A;  3PO2 B;  2XRQ D;  4C3H G;  4ZK9 B;  2NB0 A;  5J39 A;  1U4L A;  3K5O A;  5IGF A;  4DXG A;  1TWG B;  3H3V C;  1JB3 A;  3CKI B;  3L7Z C;  1LTR D;  2EDG A;  2X6G A;  3I3C A;  4OIK A;  5A2Q E;  4RFB A;  3BVG A;  3VYU A;  3K57 A;  1J8I A;  2MP1 A;  3GO5 A;  4CJ0 B;  1BCP F;  2A6E D;  2KA7 A;  2WAQ B;  1OXT A;  1RCV D;  1Z6H A;  3GTQ B;  4CJ2 C;  5JPM C;  4N9T A;  5IT9 L;  2F0F A;  4LK1 C;  4CJ1 B;  2AQ2 B;  3AMU A;  1TII D;  2B2T A;  1XWE A;  5AFW A;  5ELF A;  2F0V A;  1BNZ A;  2O2L D;  3A7L A;  1YNJ D;  2L11 A;  1LTA D;  1HFN A;  2K04 A;  1IW7 D;  2CVR A;  2LKV A;  5JVH 3;  5CR3 A;  4L63 B;  1U9R A;  1STN A;  1PLF A;  1DCZ A;  3C1F A;  1K8M A;  3OIQ A;  2B63 B;  2B2Y C;  1LT5 D;  4DK0 A;  1EZ8 A;  1SE2 A;  4HMJ A;  2B2W A;  5C4X B;  4RKB A;  4IUQ A;  3CQZ B;  1SSO A;  3H94 A;  4K6L A;  1WTX A;  5EBD A;  1SNC A;  1PDQ A;  1WD1 A;  4WFN 3;  1JOQ A;  2DY8 A;  2WKD A;  3TP6 A;  4TQU S;  1GUW A;  4MN3 A;  3ND9 A;  2PPB C;  1IKM A;  5NUC A;  3GTO B;  3FPP A;  1EWH A;  2E74 C;  1HUN A;  2QEJ C;  1WTR A;  3K5L A;  3JAM L;  4GZY C;  2A73 B;  3I8Z A;  1D2B A;  1DOM A;  3ERO A;  4RGT A;  1QJO A;  3D3R A;  4KKU A;  2A69 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...