4K5WA

Crystal structure of staphylococcal nuclease variant v23m/l25f/t62f at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
132
Chain Sequence
LHKEPATLIKAIDGDTMKFMYKGQPMTFRLLLVDTPETKHPVEKYGPEASAFFKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 132
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k5wA00
1EYDA 1IHZA 2M00A 5JAVA 3SK6A 2OXPA 5CV4A 4K5XA 3MVVA 4H7BA 4ME5A 5CV7A 4G57A 4K5WA 2PQEA 3EVQA 5EKKA 5CV5A 4YIJA 1ENCA 4EQOA 3D6CA 2EYPA 2EY5A 1EYAA 1SYGA 2EY1A 2F0DA 3D8GA 2EYFA 4KJOA 4ZUIA 5I9PA 1RKNA 1ENAA 1STYA 4HMJA 2SNSA 4NP5A 3NUCA 5KYIA 2F0SA 4KY6A 1AEXA 1EY5A 1KDAA 3RUZA 1TQOA 4MIUA 5J22A 4K8IA 1SYFA 2EY2A 4J6HA 4DFAA 3OMGA 4KV6A 4RKLA 5KEEA 1EY6A 1TT2A 4HTHA 3SK8A 1SNPA 3TP5A 4DU9A 5HGTA 3NXWA 3MZ5A 4PMBA 5C4ZA 4KY7A 1A3TA 2F0TA 1SYDA 4KD4A 4K8JA 3DMUA 5I6WA 3OMCA 2F0FA 4K14A 4R8NA 2F0OA 4K5VA 1STAA 5CC4A 4WORA 5EKLA 5IGBA 5K5PA 3QOJA 2F0JA 3NHHA 3EJIA 1II3A 2F0HA 4NMZA 3TMEA 3TP6A 2PZWA 5IGGA 2ENBA 4EQPA 3LX0A 5CV6A 5IIFA 5J1ZA 4K6DA 2F0GA 5EGTA 3P1HA 1EY7A 1SNOA 3MEHA 4PNYA 4QF4A 5IGCA 2OF1A 2O4XA 1JORA 5F2DA 3BDCA 4RKBA 4QB4A 4EQNA 1JOQA 4KD3A 3SK4A 2F0LA 2F0EA 1F2MA 4KTAA 4ID6A 1KAAA 3NP8A 1SNMA 5IOCA 3C1EA 5KGUA 1NSNS 1A2TA 2LKVA 5NUCA 5ISRA 2F0VA 1EQVA 1SYBA 2WACA 3PMFA 1EY8A 1SNCA 3QOLA 3R3OA 3T16A 4KHVA 3VA5A 5C5LA 4NDXA 5CV9A 1A2UA 4K2LA 2EYOA 3HEJA 4NKLA 3SR1A 5DEHA 4ZQ3A 2RDFA 4WRDA 3S9WA 1EY4A 2EXZA 2RBMA 4N9TA 3V2TA 4KJNA 2F0NA 5I9OA 5KYLA 2F0KA 3QB3A 2NUCA 2F0PA 2OEOA 2PYKA 3DHQA 5C4HA 4E6IA 3TP7A 4LAAA 2EYHA 2QDBA 3SXHA 5I6YA 2HQEA 2F0IA 2F3VA 4QMGA 3E5SA 2KHSA 4PMCA 5DAUA 3OWFA 3T13A 2F0QA 2PZTA 4J1MA 1KDCA 4K2KA 4OL7A 4EVOA 4IALA 1SYEA 2F0UA 3D4DA 5HURA 3P75A 2EY6A 4IUNA 1A3UA 1KDBA 5CGKA 3BDLA 2EYMA 3NK9A 4S3SA 1TR5A 5JOBA 4DGZA 5C3WA 1SNQA 5C6AA 3NQTA 5CV8A 1KABA 1EYCA 1F2ZA 1STBA 4IZ8A 4B9XA 2PW5A 2SOBA 3HZXA 3OSOA 2PZUA 5E3FA 3U9OA 2PW7A 3SK5A 2EYJA 1STGA 4I65A 1U9RA 5C5MA 3H6MA 3SHLA 4TRDA 5IODA 5IGFA 1A3VA 2F0MA 3ERQA 5IGDA 4HMIA 5KIXA 1EY0A 2EYLA 4DF7A 4KY5A 4F8MA 2KQ3A 1EZ6A 5C3XA 1NUCA 1JOOA 2RKSA 3MHBA 4B9WA 5KRUA 5J39A 1EZ8A 5IGEA 1JOKA 2F0WA 5E1FA 2F3WA 5CR3A 4ODGA 5M9OA 3TP8A 1EY9A 2SNMA 3D4WA 3MXPA 1STHA 4N9PA 1STNA 1F2YA 3C1FA 4F7XA 1SYCA 4ZUJA 3ITPA 1SNDA 3EROA
chains in the Genus database with same CATH superfamily
1CSQA 1V8QA 4GZYC 2N55A 5E4WC 5ELCA 3IL8A 3S1RB 3K57A 3MFYA 4FDBA 3I55A 3GDEA 1X56A 4U68A 1RKNA 5IP9G 2LSSA 4BS9A 3HFZB 1O7LA 1HR0W 1SYFA 3GD7A 3QWNA 2WAQB 4RKLA 2B2UC 2UUBQ 4M8AA 1N36Q 1X32A 4JI6L 2QA4A 4QY7A 4B3MQ 2RHSB 1U5KA 2N8NA 2ZT9C 2EOTA 3BVMA 4C3JG 2F0JA 5IGBA 4KKSA 5CORA 4DV6L 4GOPA 5IGGA 5C3EG 4K0KQ 4EGVA 2BOSA 1KHIA 2OF1A 4GN4B 4DA2A 1GD7A 1BUVT 1KC8C 2F0LA 2Z6KA 1JCKB 1E22A 1KAAA 2KUMA 2NVQB 4ZUJA 1A2TA 2WFWA 4DNRB 5NUCA 2WACA 4IJHA 3AFQA 4A3MG 1SROA 2HCCA 4KHVA 3Q6SA 3SDZA 1PTOC 4JK1C 2V1CC 3HOWG 3HOZH 2R92G 1SN8A 2F0KA 1VQKA 4FF2A 1QVFA 4LF6L 3HRZC 1PV4A 1YHAA 4E6IA 2XSCA 4LFCQ 5FLMH 4KK7A 4P74A 2UXBL 1TKWB 5E4XA 3DM3A 5TSSA 2XWJB 3LNNA 1Y8OB 2A68D 3Q8DA 2PZTA 1E7ZA 3T4AC 4EVOA 5FJ8G 4C56C 2O2LD 1ASYA 3T56B 1I50B 2LXJA 5JOBA 5LL6S 4V0BA 1K3RA 4Y7NB 5CV8A 4MZ9A 1KABA 2B2TA 4X65L 4G7HC 5H1SE 3MXGA 3HOYB 4J8QA 2CWAA 5IYCH 5I2XA 2SOBA 1HZBA 3I4MG 4BY1B 3HG9A 4IOAA 1I4HA 4WJ3M 2VQFL 5JJKA 3OOCA 5C4JB 2KQ3A 4GKJL 4IFDJ 1CQFA 4DN4M 4L8JA 1V1PA 3KLRA 2VB3X 2A6HC 2JK8A 4JI3L 4I7AA 3A5ZB 3C1FA 1N8RC 2SNMA 1K83H 1ESFA 1Y1WG 3A56A 1C4QA 3SK6A 5JAVA 2F03A 4G7ZC 1SFOH 3J7A5 3S1NB 5FLXc 2R7FA 1SLJA 3ICEA 4C3IB 3KLSA 3F2CA 4DK3C 4ZCKA 4NXMQ 1FNVA 1NE3A 1D5ZC 2ZTEA 4XQQA 4DV3Q 4LF5Q 4LJZC 1TQOA 2A74C 2ZXOA 2PNRC 2VXWA 1BF4A 2YU9B 4X64Q 1FVIA 1ZYRC 2IL8A 4R4QA 4KKUA 3H0GB 3ULJA 3KOJA 4LFBL 4KD4A 4A3LH 3M9BA 3CCEA 3CCUA 2F0OA 1RCVD 1YJNA 2E2IB 2PQAA 2XRSD 3TP6A 3NHHA 2PZWA 1KLUD 4JI1L 2JA8B 4RGOS 2HIVA 5EKIA 4B3SQ 1OXXK 4PMWA 1BBWA 1LT5D 1L0XB 1LT6D 1LT3D 1JORA 3BDCA 3A8JE 3X3NA 1R9TB 4UAIA 4DR7Q 5EBCA 2K4KA 3D4RA 1QUQB 2Q2UA 1NSNS 1JT8A 1I6HB 5CYUA 1ET6A 3Q24A 3CP0A 4JYAL 1OXVA 3JAMc 3ER0A 1JJ2A 2LXKA 1VS0A 2K5HA 4RHRA 3SR1A 2B2UA 3NQIA 2L4NA 2JA5B 3FVQA 4CDFC 2G5DA 4LAAA 2H4OA 3TZUA 1SJHD 5IP7H 1PH8A 4A3KB 3VYUA 3T13A 1KL9A 4IALA 4BBRB 1H9SA 1GUGA 3K0YA 4AQYL 1HNWQ 3UDIA 4ABNA 2DY7A 3NK9A 3S17B 1TR5A 1VQLA 1CTMA 1YNJC 4G7OC 3TRZA 1N32Q 5T1GA 2DNCA 1LLRD 4CDEC 4LK1C 3WDNA 3HOUB 3J81L 3HKSA 1RDPD 4KY5A 1KIXA 2J7ZA 4FXDA 4DAMA 1IBLL 1SJED 4BY1G 2JA6B 2DNEA 3DEPA 3ITPA 1XPOA 4K5XA 4ME5A 4IFDH 1X54A 1WCMH 4CBVA 5D3IB 3J7ZC 2MUYA 4CDDC 2A5HA 2DGYA 3PGZA 4GKKQ 1X6OA 4P2CB 1TU2B 1B53A 3PF4A 1FJGQ 4XT1B 1B1ZA 3J81i 4DR1L 1I4QA 2Q2HA 1C7YA 4C3IG 4JI4L 4DU9A 4EQ5A 1K9MC 1K0RA 3KYHC 1XMQQ 1K8GA 1HHVA 4A3BG 2NVXH 4LF4L 1E2WA 4NMZA 1YVCA 2B2YA 4WJ4A 1O7YA 3HOZB 1WTPA 5IIFA 1HQMC 1AZPA 5J1ZA 1CUKA 3AU7A 3H0GG 4M1UB 1JMCA 4UDUC 2DJGC 1IW7D 5F2DA 1HFGA 1QNUA 1DZ1A 2K75A 1TY0A 4DAYA 3G7LA 3RLOA 2DJFC 3C1EA 3MTSA 3R3OA 5IP9H 4OO1G 1L1OA 4DR2L 3OTOQ 1QCBD 4PZ8A 1UE5A 3UDXA 3VR2A 1PXUA 3W3AA 4RMFA 3BU2A 3S9WA 3SVMA 4XYOA 2DUDA 4UPAA 4YWLA 1EU3A 1DD2A 2PMZB 4X62L 2F0PA 2Z9HA 4DV0Q 3I2ZA 2EDGA 4GN5A 3G48A 1PFBA 1DOMA 2VL6A 4RCOA 4C3JH 2CKZB 5DAUA 1WTHA 5C3EH 4TQUS 3D4DA 5HURA 1RHPA 3NBHB 4PZ6A 4IOCA 1KDBA 1V9PA 3TN2A 2X69A 4A3KG 4C1NK 4OO1I 4LMQD 1SFOB 2UUAL 1FYCA 4A3MH 3BZCA 2Z4IA 3SHLA 1O80A 5GAHC 3BVGA 1HQRD 2F0MA 4LF5L 2WV6D 4JOIA 3HOWH 4YWKA 1OXUA 3O13A 2ZTCA 3PUWA 2H1EA 5JEAG 5A2QL 1XNQQ 1TY2A 1HZCA 3HOUG 3MXNA 3URYA 4N8FA 3H91A 3UDFA 2Z4HA 4K5WA 2PQEA 3K81C 5FJ8H 3A8IE 1LTGD 1HR0Q 2EYFA 4CKEA 2JA6G 3BZDB 4DV2L 5G3LD 3VR4A 1AE3A 4LUVA 1PH9A 5ELFA 1SBBB 4ZRZA 2MO1A 1VQ5A 4IQZA 1GJXA 3C3LA 4OELB 3E9HA 3I4MH 1Q8IA 1JWUD 1QVGA 1TIID 3SK8A 1Z9FA 2MGSA 1S3OA 2NTSA 1Q8KA 3M4PA 1II3A 1UWVA 2KVMA 3W5OA 3A0JA 3M85A 1YBYA 1WFQA 2ICIA 4LF8Q 4BWGB 1S72A 1KRSA 3RLNA 1VDZA 2MHVA 2NZ1D 4XQNA 1FR3A 1A6XA 1F9SA 1QG7A 4OONA 1HH2P 1Q12A 4JI5L 2UU9Q 1GVPA 1DOKA 4GLVB 2E75C 1PH1A 1SNCA 4JPBW 1CZWA 3VA5A 2MO0A 1PH6A 1BNZA 3STBD 1XTDA 3GTGH 2O5IC 3L2PA 5JJLA 3S1RH 1HCZA 1G8ZD 1EUJA 1MI2A 4DK6C 3I91A 1IKLA 3CRLC 4NXNQ 3U58A 2PMZE 3OYYA 3GO5A 1DJRD 4OXPA 3I72A 1X3EA 3F2BA 1JQYD 2K5DA 3TDQA 2DY8A 3BG3A 1X3QA 4HN7A 5HGQA 4JV5L 2F3VA 3S1MH 3E5SA 1NBWA 4V190 2B63G 3IFDA 2B2WC 4A4IA 5A2QE 3CCQA 3AMUA 1LTID 1LTSD 1C48A 1RTOA 4AIMA 1JWSD 1M1KC 1VQCA 1SRUA 1WTQA 1BR9A 4DR4L 2A6ED 3CKIB 5ELDA 2D5DA 3U9OA 3S1QB 5E7NA 2J0TD 1WCMB 4HR7B 5IGFA 2NN6I 4HMIA 4O42A 5IGDA 1JC7A 1H9MA 1VQNA 3BYTB 2AWNA 1PRTD 1JOOA 2B29A 2NVQH 1D1KA 4JCVE 1W2BA 1AP0A 2LS01 3S2HH 5AJ3Q 3DUZA 1SNDA 2UUCQ 3N52A 4XDXA 2BE5C 3KLWA 1VQFA 3I56A 3CW2C 5KNDA 2NVXB 3EVQA 4MN3A 1DGSA 3NWSA 4KJOA 2EY5A 1UEAB 1KAWA 1JB7A 2MNAA 3I4OA 4X66Q 1IZ6A 1HUMA 3OIPA 2R6GA 3KF8B 4HIOA 3H15A 4DR6L 3DM1A 1WD0A 3PUZA 1QWYA 3A5UA 1IYJB 3DXJC 3MXUA 4AYBB 3JC66 1EFWA 4CKBA 1YHQA 1C0AA 4GNXA 4HTHA 4O2DA 1LTLA 3KDFA 4K8JA 1B9MA 1CI3M 3CCJA 4WJWA 1F2LA 2N88A 3UI2A 2P5ZX 2B8GA 4BY1H 1JWMD 1PFMA 2YYZA 4YCUA 4POGA 2AKWB 4H0LC 4YY3Q 1YEZA 5DNFA 1IBMQ 3OPOA 5FLXE 1WTVA 3W2DA 2QW7A 4ID6A 3A7LA 5C3EB 3WOEA 1WTOA 1SYBA 2JE6I 1S5CD 2A69D 5AFWA 3CCSA 5CV9A 3RLFA 3J81c 2K7VA 1IYVA 1QE6A 2BH2A 3EA6A 4C3IH 2L12A 4Q5VA 3CPFA 3CCRA 4A3BH 4A3MB 2PPBC 2A8VA 1CKMA 5GROA 5LHY1 4YHHL 4KHPQ 3I4NB 2N3SA 1EIHA 4PMCA 2YU9H 4JI8Q 2RSNA 2E8GA 4ME3A 1JE5A 1NMGA 3KK7A 3H0GH 1CKNB 2UXDQ 4DR3L 1I3QB 1BBXC 5KNBA 2Z8LA 3M4YA 5C6AA 1EYCA 3A74A 1HR0L 3OSOA 3EN2A 1EIYB 3JAME 4QIWE 2ES2A 4OO1H 4FYDA 1HNXL 2KA7A 2RSOA 2K5WA 4OX9L 1XTCD 1R9TH 3C2PA 5KIXA 1WTXA 2RDHA 1VQBA 2F4IA 4BY7G 1NUCA 2X6GA 1E1TA 3AQQA 1A62A 1JOKA 2VB2X 2VW9A 1I6HH 1B44D 5CBAE 1STHA 5ELEA 1WCMG 5JPNC 4HSVA 4MTKA 1ENFA 4CJ0B 5CV7A 1J9OA 4CGYB 5EKKA 3A54A 3D6CA 3NSWA 3WWVA 1PH5A 1PH3A 4QUFA 3BZKA 5FK9C 3CC7A 4JC0A 1G291 1A8VA 4A3KH 1VQJA 4K8IA 1Q7YC 3CC2A 2VZAA 3P20A 4LUOA 2IHFA 5COYA 1IKMA 5IWAQ 4MTNA 2Q8IB 3NXWA 2A73B 3VR5A 2F0FA 1WTRA 5CC4A 2EJGC 3GTGB 2ID0A 3EJIA 4ZKCB 4AYBG 1D6EC 1Q1EA 4R4OA 4JBMA 4QJFA 5JEAH 2EJMA 3AB9A 1UE1A 3NTKA 4I7ZC 3HOUH 1EY7A 4PNYA 1ASZA 2RHQB 2OTLA 2F1MA 5LMNW 3VDYA 3LWUA 1M8AA 2D0PA 2F0EA 4DR5L 3S1MB 1T9HA 3KUPA 4LFAQ 1CZGA 4RGNA 2JA6H 2HUGA 1SMYD 1KQSA 4UHVA 1HUNA 1N34Q 2SEBD 1XYIA 1H95A 4IUVA 3K7AH 1ICWA 2F0NA 4XTCS 2TMPA 2QDBA 1IBKL 2HQLA 5BN4A 2KHSA 1VQAA 5IYDG 2D2CC 3A7AB 4A3GB 4RH6A 1TWCH 3UDGA 3T1HL 2QEJC 1PVOA 2ZJRA 3NEMA 1PFSA 3S2HB 1GHJA 3PO3H 2EYMA 1PTOD 2K04A 4DGZA 4IN3A 3I4NG 1V1QA 2VUMG 2F4VQ 2EQSA 1PZJD 2KEEA 4X66L 4I65A 3D31A 1HNZQ 1EOTA 3R93A 2K14A 4NPSA 2G9HD 1E3PA 3F2UA 3TS0A 1K0SA 2AQ1B 4HCEA 2MP1A 4HCSA 4DUZQ 3PUYA 2KCNA 5IT9L 1JJGA 3EROA 2EE1A 2PI2A 1QB5D 1S5ED 2B63H 2XWBB 2CHBD 1LABA 1ILQA 1EEFD 2KBNA 3E0JA 1KD1C 2UXCL 1BKBA 5KYIA 1G91A 4KY6A 5D14A 3R2TA 1XMOQ 3J7AV 2XIWA 1BVSA 1QOHA 2JXMB 2M2LA 1YNXA 1SNPA 2Q8RE 4HAEA 1VQGA 2CWPA 3OMCA 1QNKA 2B3GA 1SSOA 2K32A 3MEFA 2KJXA 2EVBA 1IL8A 1E0BA 4DK0A 2PO4A 1D2BA 1SNOA 3I73A 3VA7A 4A3BB 1I94Q 1NY4A 3PQIA 4EQNA 2I5MX 4H13C 2O5JC 2A19A 2Q8TA 1F2MA 1ZYRD 4LF7Q 4TSSA 1ESRA 1NNXA 2E74C 2UXDL 1F9RA 5JVH3 4OIKA 2HHHL 2NYZD 3HEJA 5GAGC 2YTVA 1A15A 3I8ZA 2FHTA 2YTYA 5A35A 3M4OB 4JI7L 2NUCA 5LMUQ 4B3TQ 1DONA 1A0IA 2E2JH 3IKJA 2BDOA 2HQEA 4WFN3 4JI0Q 4XIGS 4J1MA 1WTWA 1Q82C 3H3VH 2RCNA 4IUNA 3RR5A 5CGKA 3SEBA 2NTTA 2BA1A 3J7YW 2C5CA 1Q1BA 2B8FA 1RTNA 3J80i 3PIOA 4A3GG 1W3SA 4FXGC 4PQXA 2WB1E 4ZYSA 3QG1A 1GUWA 2JQOA 1EIFA 5GAEC 2MFIA 4O0AA 4HSPA 1QVCA 1VQ9A 1BQQT 1EZ6A 2MJ8A 4LUZA 2I0QA 1UE7A 5J39A 4TVAB 2GVBA 4ZLTF 5CR3A 3RMHA 3MXPA 3ND8A 1JB3A 3K58A 1VQ4A 1BDOA 1LTBD 2M00A 5M5XB 1GUOA 1GXDC 4RHSA 4ZUIA 2BH8A 2JEBI 4JBWA 3PIPA 2CH4W 5C0XI 1Y69U 4IPDA 4KLKA 1VQEA 1CHPD 4FO2A 3NUCA 5M3MB 1VQPA 3TQYA 1I4RA 4NW2A 1PRTF 2NBFA 3KF6B 4LFAL 2E2HB 2RQXA 1TWHB 1HTPA 4R4IA 1K3BC 4YCVA 2UUBL 1N36L 3MZ5A 5I6WA 2ZXPA 2KCCA 2B39A 4BY7H 4B3ML 1YJ9A 3KFUA 4C1NI 2IX0A 1Z47A 3S1QH 3CU7A 2OQ0A 3K7AB 4K0KL 4DV5Q 3P1HA 1PRTB 2L55A 3NTIA 4L5SA 3NELA 2F3IA 4IUTA 1I4PA 2HT1A 1TWCB 2F0VA 1SE8A 1IYUA 3QOLA 3NE5B 4ALPA 3PO3B 4PZ7A 1YNNC 2EYOA 4R9WA 4YWMA 5DEHA 1JE4A 1DOLA 4DK1A 4N9TA 1B2TA 3DHQA 1AN8A 3SXHA 2EYHA 4LFCL 4GOPB 2RDGA 4RWSC 1BCPD 4A3CH 4GLAC 4KHZA 1CT1D 4N8X1 2V4DA 5CBEE 3P75A 2FJ2A 4S3SA 2XNAC 4FNFA 3EFXD 4DV1Q 2CCZA 2B63B 1DYQA 2ICEC 1WYDA 1UNSA 4R4TA 4C2MH 4F88A 1SE4A 5FOBB 4MHEA 3J81E 4O1NA 5T1IA 4H02A 1XMOL 1C8CA 2RKSA 4DV4Q 1X3GA 2F3WA 1V1OA 2C9OA 3FMCA 1PH2A 4LNQA 5JPMC 2PNHA 5C0XJ 5CV4A 1DM0B 5IYDH 1F9PA 3H09A 4IJLA 5ISRA 4UP7A 2L11A 5EPKA 1STYA 2GN5A 2KECA 4NXML 5JJZA 2E5LQ 1AE2A 3M7GA 3I4NH 4DV3L 4FF1A 4IURA 1MGSA 2JA9A 2VUMH 2KCTA 2KENA 4CJ2C 4X64L 1GHKA 5KEEA 1EY6A 1EWIA 2L9HA 3G4SA 3HKZB 4KKTA 5IGEA 1I3QH 1BXTA 4IPHA 5M3MG 4DUYQ 4UP9A 1VCIA 1Q81C 4K5VA 2KHIA 1Q46A 3E9IA 3QOJA 1NJIC 1V1PB 5LMNQ 4Z9CB 1SMXA 4HJ9A 5ELNA 1M90C 4B3SL 2NVTB 1S5FD 5EGTA 2Y0SB 2ALYB 3PV0A 2E2JB 1TXYA 1JOQA 2JEAI 4DR7L 1XNRQ 2I5HA 2RF4A 1WD1A 1UE6A 2LKVA 1N33Q 1EQVA 1EY8A 3S16H 4LWCA 4NDXA 4ZQ3A 1X3PA 3K59A 5C4XG 2E2DC 4WRDA 3TS2A 1XPUA 5ELBA 3W1GA 3J7AF 5I4DA 2PYKA 4HIKA 4L6TB 4JI2Q 2PQAB 5IT9c 3PO3G 4LF9Q 1LTTD 2DN8A 3CCMA 3N6RA 3PO2G 3T1YQ 1HFNA 2ZM6Q 2D9UA 1HNWL 5KNCA 2EXDA 3BDLA 1VQ6A 3CCVA 2CW0C 3UE1A 1UUPA 2RA4A 4B9XA 1N32L 3FDTA 2PW5A 3F1ZA 2NN6G 5IY0A 3SK5A 3ULPA 2L0CA 5IE8A 3PIP3 3GTLH 2ZJPA 1MD2D 3ERSX 1EZ8A 3F2DA 3T53B 1STNA 3MFGA 1X65A 1LM0A 4BY7B 2R7ZG 4QGUA 4QQBX 1H9SB 4B08A 3D8GA 1HTLD 2Z6BA 3Q0AA 2AMCB 1EIGA 2PI2E 4QIWB 2FMMA 2RCFA 1GOZA 5EJWA 2XVSA 4GKKL 5CMDA 3RUZA 3A8KE 2WIIB 4A3GH 1H9KA 1FJGL 3KBXA 5M3FG 3CCLA 4KN4C 1XMQL 4DAPA 4JI6Q 3HKZE 5C4ZA 1TS4A 2JJQA 2QF7A 3U4ZA 5LL6X 1STAA 2JP1A 4RFBA 1MJEA 1YJWA 2AQ2B 3IFTA 1OXTA 3PF5A 3HKZG 2Y0SE 4QF4A 2IWHA 1K8AC 1T5XD 3K6OA 1K8OA 3FHWA 1B8AA 1B4OA 2Q2IA 1PRTC 4HIMA 1Y1VB 2R93B 3NP8A 5KGUA 1VQMA 3PUVA 1PH4A 3PMFA 2Y0SG 5C5LA 3PSIA 3VYSA 3OTOL 4RA8A 2LFNA 3GTQB 1KNEA 1CA5A 1OTCA 1HXYD 1AZQA 2Z1CA 3G6EA 1PYWD 4KJNA 1CM9A 4LF6Q 5K36G 3FPPA 4ILWA 4DV0L 4C2MB 3DWPA 1PLFA 3AEVA 3S2DB 1NR4A 2UXBQ 2F0IA 3BJUA 4B3RQ 1SE2A 2FXQA 4BA2I 2F0QA 2R61A 3GV6A 2QDLA 3I3CA 4F87A 1PFNA 1YHBA 1TS3A 1EEID 5IYBG 1RL2A 4DAYB 1S40A 1SNQA 3B6YA 1STBA 1Z6HA 4IZ8A 4X65Q 2PZUA 3RNUA 1L1OB 3E3XA 3VR6A 1H9JA 4TRDA 2VQFQ 1GKHA 3JAMi 1FGUA 5FO8B 4P75A 5M5WB 4GKJQ 5KRUA 2VUMB 5E1FA 3F8TA 2HD3A 1R4PB 3AYHB 1XNQL 4JI3Q 3HOVB 4UP8A 3P7JA 3NPPA 2ZTDA 2OT2A 1LV9A 1EYDA 3SE0A 1IHZA 5BN3A 1KRTA 4H7BA 4A3EG 2OTJA 3M4OH 1PYBA 2EY1A 2F0DA 3L3OC 4IUQA 1QUQA 4DXFA 2SNSA 4ULLA 2IT1A 1R4QB 2HCIA 1EQTA 3CD6A 1JR0D 1T5EA 1WOCA 4KV6A 2K03A 3DWAA 4LFBQ 1Q3LA 1A3TA 3FKIG 1SYDA 3DMUA 3OW7A 4K14A 4R8NA 1G2SA 2IY5B 2FFKB 3CAMA 3S16B 2B2WA 3LWEA 1LTRD 5HY6A 3KJPA 4JI1Q 4LF8L 3TZDA 3MXNB 4K6DA 1RJTA 5C44B 3K80C 1SNMA 2UU9L 2IPKD 1ET9A 4HIDA 4JYAQ 1XJVA 5D65A 3L7ZC 1L0WA 5M5XH 2G9DA 1A2UA 4NKLA 3H3VC 3HS0C 1Y1VG 4A3CG 2R93G 2HDLA 2E76C 4NXNL 4A3DH 2OEOA 1S5BD 3IAYA 5M3MH 1MSGA 3TSSA 4DXGA 3GTLB 4XT3B 2E2HH 1XXGA 1TWHH 3VR3A 2NB0A 1D1IA 2K5QA 2JA7H 2VS1A 5DM73 5DLQE 4IFDI 4AQYQ 1NCVA 2NZOA 1EWHA 4A3IB 3GTKH 3L0OA 1Z7TA 1G6PA 1NAPA 4XXEA 3RZOB 3I70A 3S24A 3H6MA 3BDOA 1BCPF 4F8MA 4A3FH 5C4XH 2EIFA 4DAVA 2HDMA 1FL0A 2VQEQ 1IBLQ 5AJ3L 1EY9A 1SMYC 2QEXA 4A75A 1SYCA 1L2FA 2IJ0A 2NVYB 2UUCL 2HIXA 2OXPA 2CQAA 3PO2H 2EYPA 2K01A 2FINB 1A63A 3ZJYC 3AFPA 4HMJA 5M5YH 5EPLA 1BCPB 1FD7D 3HOVG 2WB1B 3QR8A 4YCWA 1AFPA 1S5DD 1PDQA 4DFAA 2NN6H 4DR1Q 3U9SA 1ONLA 4L63B 2H5XA 1HA6A 4JI4Q 4PMBA 2FMCA 4KY7A 2B2VC 2WKDA 3CPWA 4LF4Q 3TMEA 3K8AA 1VF5C 3KLSX 4X3SA 3LX0A 5CV6A 4IO9A 2F0GA 4YY3L 3NBHA 1I4XA 1HZ9A 1Y14B 1IBML 3GTOB 2GA4B 4B3RL 2R7ZH 1K8MA 3CXCA 2A68C 2AHOB 2SDFA 1G2TA 2CFMA 1BBUA 2A6HD 4A93B 2NZHA 4C3HB 4DR2Q 1YZ6A 1B9NA 5C44G 1FGBD 4GNXB 2EZVA 2RBMA 5M3FH 1TVXA 2K52A 3QB3A 3K5MA 3KDFB 3HOXG 4X62Q 1K73C 1X9NA 1Q86C 1CKOA 3TP7A 5G3LF 4KHPL 1CK1A 2WINB 1LUZA 3K0XA 4IPCA 4EX5A 3OWFA 4JI8L 4K2KA 2B2YC 2XRQD 4GS3A 2AQ3B 1E24A 1YI2A 3J80L 2Q2TA 3NQTA 3I90A 3RD4A 3R8BA 2UUAQ 5E3FA 2NVTH 2EYJA 1STGA 4BXXG 1JICA 2I46A 2TSSA 1C9OA 2JN4A 1L1OC 1EY0A 2EYLA 4DF7A 5C3XA 5FO7B 4ZKBB 4A3IG 1RF2D 2WAQE 3MA2B 4ODGA 5K36H 5IT9E 4JBJA 3GQBA 4A3JB 1B70B 4HJ8A 1HA5A 1V43A 2QCPX 2YTXA 2KHJA 4APVA 5C0XG 3G71A 2WAQG 1W6JA 4GLXA 4OEMB 3ULLA 5I9PA 5IYBH 4DV2Q 2F0SA 3S15B 1EU4A 1F77A 1HZAA 4BBSB 4MIUA 1MKHA 4J6HA 1FNWA 2A1AA 2M9VA 3BYYB 3TP5A 5IWAL 2AUJD 2OWOA 1LTAD 2WB1G 3NWTA 1TWAH 1YNJD 2N78A 3V05A 4X3TA 5K5PA 4JOIC 1YITA 1VQHA 2ENBA 4OGQC 3M7NA 4ZAIA 1K28A 1Y8PB 2F52A 4A3DB 3EBEA 1TS5A 4RKBA 4A3EH 4KD3A 3SK4A 4JI5Q 3UE0A 2K6AA 1SR3A 1KXLA 3J80E 4OHJA 2JA7B 1NMFA 1PHJA 1N34L 3K5OA 2EXZA 1BO0A 3GTKB 1TWFH 3I4LA 2B2VA 4A93G 3FKIH 4IUPA 5L37A 1GUSA 4C3HG 1MSHA 1PMRA 2EPBA 3HP3A 4JV5Q 3HOYG 1XX8A 3X3MA 4Q0FA 2VQEL 4A3FB 5C4XB 1KDCA 1GO3E 5J3BA 1PTOH 4PV1C 3KJOA 1YNND 3A55A 1RODA 3OIQA 3GTJH 5C3WA 3KF8A 4IPGA 4BA1I 4DR4Q 1KTKA 1VQOA 1HRJA 1E2ZA 2J4XA 2F4VL 3K7UC 1LACA 3PO2B 2PW7A 2QILA 1KNAA 1HNZL 5M5YB 1O7ZA 1LO5D 1J8IA 3VYRA 1Y1VH 3ONAB 2R93H 4FF3A 4B9WA 3ND9A 3ZYYX 2CVRA 1ML0D 5M9OA 2AUKA 5DM63 4DUZL 3QO2A 3QJYA 3MC0B 3D6WA 1DCZA 5IODA 2AWOA 1PZID 1I6VC 3CRKC 1J5EQ 3GTQH 5BR8Q 5CV5A 3U4VA 4DKAC 3R2IA 4RGMA 1Q90A 2XN9C 2ZXRA 4PG3A 2K50A 4NP5A 4JBKA 1YIJA 3S2DH 4NB3A 2K1BA 3FRPB 4DR6Q 4A3JG 1AEXA 4RGTA 1BCPC 1IW7C 5J22A 4FF4A 2KEDA 4R4CA 2X6LA 1F9QA 3S14H 2R7ZB 3OMGA 2JA8G 3CF5A 2I5LX 2IHEA 4U673 1NR2A 2BDNA 3DLLA 3BS1A 3IRBA 4OIJA 4BBSG 5EKLA 3RZDH 5EBDA 4HJAA 1U4PA 1VMPA 2R3ZA 1OO9B 1ZEQX 5M3FB 5IGCA 2KCMA 1CKNA 1I94L 3V96A 5M5WH 4UY8C 3QIAA 5IOCA 1B3QA 4LF7L 1D5MC 4Y52H 2JA5G 3HOVH 2WKCA 2I07B 1QZHA 4A3DG 1K83B 4XQJA 4K2LA 1WI5A 5D3DA 1TWGH 2OQKA 1EY4A 4BBRG 1QZGA 3V2TA 1U0LA 4OWXB 3DEOA 4GNXC 2JA7G 1STEA 5LMUL 4B3TL 1EFID 4YHHQ 1IXRA 2XGTA 1VQ7A 3NENA 2R92H 4DNTB 4JI0L 1AH9A 4A76A 5EPJA 1SYEA 2F0UA 1ZKOA 4IUUA 4DR3Q 2K5NA 3GP7A 4L5QA 3GTMH 3OHXC 4L5TA 1VQIA 4A3FG 4QUCA 3PIO3 1HNXQ 4HJ7A 2MPMA 3ERQA 4OX9Q 1W6KA 5C44H 3LGJA 3M3YH 5GADC 3MHBA 1FNUA 5EQ0A 1SEBD 3HOXH 1B3AA 1TS2A 3D4WA 4POFA 1F2YA 4F7XA 2CW0D 4OWTB 3Q23A 4K6LA 3GTPH 1TWAB 3MVVA 1MBYA 2VNUD 5I6YA 4YIJA 1DXMA 1ENCA 1M4VA 4EQOA 3Q22A 1SYGA 1CA6A 1H9RA 1ENAA 1LT4D 1G6ZA 1X55A 4R1JA 1MIUA 2D62A 1Y1WH 4LW1A 4RAUC 4XYQA 2OCEA 4HJ5A 1EY5A 2D0OA 1KDAA 4P72A 4DV7Q 1D7QA 5FKAC 1GUTA 3CQZH 2EY2A 4A3EB 4RCNA 3HOZG 4BXXH 1J6QA 1WJJA 1U4RA 2F0TA 4DNIA 1PTOF 5FLMG 3STBC 4WORA 1RD9D 4A3IH 4KN7C 3TREA 1MJCA 2F0HA 2QKIC 4X3UA 2ZJQA 4EQPA 3RZOH 3NBIA 3RN2A 4DV5L 1EQRA 1TWFB 3MEHA 1PZKD 2Z0SA 3FKIB 2JSOA 3GV3A 3KBGA 4KMUC 4QB4A 5C0XH 1MHWC 4R8IA 3J80c 1CSPA 1U4MA 5FLXL 4AH6A 4DR5Q 5IYCG 1L0YB 2K05A 1PTOB 3W1BA 2ASBA 2NVYH 4P73A 2BE5D 3FP9A 1CFMA 1G51A 3GTJB 2RDFA 4DV6Q 1PYSB 1O78A 2A6EC 5KYLA 1NTGA 4X6AH 5C4HA 2IW3A 2CH4A 3CMAA 1IBKQ 3T1HQ 1VF7A 1P8LA 1UEBA 2EY6A 3T51B 1OXSC 4FVMA 1B50A 5JJIA 1D5XC 2L1BA 1J5EL 2KOLA 5BR8L 4OWWB 1SE3A 4DV1L 1PH7A 2WP8J 4JVZA 4CHTB 3HZXA 3L9AX 3EQLC 1U9RA 3JAML 3GTOH 5FO9B 1D8LA 3D3RA 4JG2A 3OW2A 4A3LG 4FXKC 1VQ8A 2L5TA 1E1OA 4GN3B 2BCOA 3VYTA 4DV4L 5JEAJ 2ATWA 1VQDA 4GOPC 1HJPA 1PA6A 3S14B 3FPUB 4A93H 2IX3A 1I50H 1CQVA 4C3HH 1QJOA 1KLGD 4Y7NH 4L5RC 4TKOB 2GVAA 2K5VA 1SAPA 3E0EA 3HOYH 1ILPA 3E6ZX 4G57A 4FP5D 1EYAA 2Z6KC 1QILA 3RZDB 3MAQA 4CDCC 2VY3A 3RN5A 1Y8NB 2UXCQ 4P71A 1I4GA 2RVLA 5JVG3 5C4JH 2E5LL 1LYLA 3CC4A 2PCFB 5I2YA 1U4LA 1I5FA 4HEDA 4C3JB 1WVLA 4MNOA 2IX1A 3CMEA 3D0FA 3I7FA 5BN5A 1GUNA 2JYOA 1HPCA 1TT2A 5HGTA 4CKCA 4DUYL 1EQQA 1ICFB 2A69C 5GQOA 3S1NH 5IP7G 1O7IA 3G6JB 3DWQA 5LMNL 2K33A 1TWGB 1GM5A 3TEHB 3SGIA 2R7DA 1EL0A 4X3KA 2O4XA 2N49A 3H3VI 2C35B 2CQOA 4KTAA 5EAYA 1XNRL 4QCLA 3HOWB 2B2TC 2R92B 1XWEA 1VMCA 1S4ZA 1N33L 4ZK9B 3T16A 3OWEB 1CHQD 4A3JH 3C46A 2E2IH 4H44C 2L15A 2HHHQ 3H94A 1E2VA 3GTMB 2JA8H 2EJFC 3U50C 4QL5A 1UAPA 3FEWX 5I9OA 2XTIA 3HGBA 2MQHA 4JI7Q 2LY7A 4JI2L 3NTHA 3BVZA 3S15H 1N9WA 4LF9L 4BBSH 3PCOB 1JJCB 4QMGA 2YV5A 1B7YB 1EOVA 4IFDG 4OL7A 3M3YB 4KI0A 3I4MB 3T1YL 1SDFA 4RG1A 1BOSA 4CJ1B 2ZM6L 1A3UA 3HOXB 1P16A 3J81j 2BA0A 2LMCB 4G4KA 3K5LA 1AW7A 3EIVA 1F2ZA 3GTPB 2JA5H 4JW0A 2K28A 1ZXTA 2NWGA 3KF6A 4J15A 1RIPA 3CHBD 5C5MA 1EYGA 3WOFA 1A3VA 1XPRA 3M4QA 4DV7L 3MWYW 1Y1WB 4DPGA 3TBIB 3PUXA 1IL2A 4AYBE 4BBRH 2QGQA 3K5NA 3CQZB 2F0WA 1EWCA 3TP8A 1X3FA 4N9PA 5ELOA 3S17H 1SXTA
chains in the Genus database with same CATH topology
1V8QA 4GZYC 2N55A 5E4WC 5ELCA 3IL8A 3S1RB 3K57A 3MFYA 4U68A 1RKNA 4BS9A 1O7LA 1SYFA 3GD7A 3QWNA 2WAQB 4RKLA 2B2UC 4M8AA 1X32A 2ZT9C 3BVMA 2EOTA 5IGBA 4C3JG 2F0JA 4KKSA 5CORA 5IGGA 4EGVA 2BOSA 2OF1A 4DA2A 1BUVT 2F0LA 1JCKB 1KAAA 2KUMA 2NVQB 1A2TA 4DNRB 5NUCA 2WACA 2HCCA 4KHVA 3Q6SA 3SDZA 1PTOC 4JK1C 2F0KA 4FF2A 3HRZC 4E6IA 2XSCA 4KK7A 1TKWB 5E4XA 5TSSA 2XWJB 3LNNA 1Y8OB 2A68D 2PZTA 3T4AC 4EVOA 4C56C 2O2LD 3T56B 1I50B 5JOBA 5LL6S 4V0BA 4Y7NB 5CV8A 1KABA 2B2TA 4G7HC 3MXGA 3HOYB 4J8QA 5I2XA 2SOBA 4BY1B 3HG9A 1I4HA 3OOCA 5C4JB 2KQ3A 4IFDJ 1CQFA 4DN4M 4L8JA 1V1PA 3KLRA 2VB3X 2A6HC 3C1FA 2SNMA 1ESFA 3A56A 1C4QA 3SK6A 5JAVA 2F03A 4G7ZC 3S1NB 4C3IB 3KLSA 1FNVA 1D5ZC 4XQQA 4LJZC 1TQOA 2A74C 2ZXOA 2PNRC 2VXWA 1BF4A 2YU9B 1ZYRC 2IL8A 4KKUA 3H0GB 4KD4A 2F0OA 1RCVD 2E2IB 2XRSD 3TP6A 3NHHA 2PZWA 1KLUD 2JA8B 4RGOS 5EKIA 1OXXK 4PMWA 1LT5D 1L0XB 1LT6D 1LT3D 1JORA 3BDCA 3A8JE 3X3NA 1R9TB 4UAIA 5EBCA 3D4RA 1NSNS 1I6HB 5CYUA 1ET6A 3Q24A 1OXVA 3SR1A 4RHRA 2B2UA 3NQIA 2L4NA 2JA5B 3FVQA 4LAAA 2H4OA 3TZUA 1SJHD 4A3KB 3VYUA 3T13A 4IALA 4BBRB 1H9SA 1GUGA 3K0YA 4ABNA 2DY7A 3NK9A 3S17B 1TR5A 1CTMA 1YNJC 4G7OC 5T1GA 2DNCA 1LLRD 4LK1C 3WDNA 3HOUB 3J81L 1RDPD 4KY5A 2J7ZA 4FXDA 1SJED 2JA6B 2DNEA 3DEPA 3ITPA 4K5XA 4ME5A 4IFDH 4CBVA 5D3IB 2MUYA 2A5HA 4P2CB 1TU2B 1B53A 4XT1B 1B1ZA 1I4QA 4C3IG 4DU9A 1HHVA 1E2WA 4NMZA 2B2YA 1O7YA 3HOZB 1WTPA 5IIFA 1HQMC 1AZPA 5J1ZA 4M1UB 3AU7A 4UDUC 1IW7D 5F2DA 1HFGA 1QNUA 1DZ1A 1TY0A 4DAYA 3G7LA 3C1EA 3MTSA 3R3OA 4OO1G 1QCBD 3VR2A 1PXUA 3W3AA 3SVMA 3S9WA 4XYOA 1EU3A 1DD2A 2PMZB 2F0PA 2EDGA 1PFBA 1DOMA 4RCOA 5DAUA 4TQUS 3D4DA 5HURA 1RHPA 1KDBA 3TN2A 2X69A 4C1NK 4OO1I 4LMQD 1SFOB 1FYCA 2Z4IA 3SHLA 1O80A 3BVGA 1HQRD 2F0MA 2WV6D 1OXUA 3O13A 3PUWA 2H1EA 5JEAG 5A2QL 1TY2A 3MXNA 3URYA 3H91A 2Z4HA 4K5WA 2PQEA 3A8IE 1LTGD 2EYFA 4CKEA 3BZDB 5G3LD 3VR4A 5ELFA 1SBBB 4ZRZA 4IQZA 1GJXA 3C3LA 1Q8IA 1JWUD 1TIID 3SK8A 2MGSA 2NTSA 1II3A 2KVMA 3M85A 2ICIA 4BWGB 1VDZA 2MHVA 2NZ1D 4XQNA 1FR3A 1A6XA 1F9SA 1QG7A 1Q12A 1DOKA 2E75C 1SNCA 1CZWA 3VA5A 1BNZA 2O5IC 1HCZA 1G8ZD 1MI2A 3I91A 1IKLA 3CRLC 3GO5A 1DJRD 3I72A 1JQYD 2K5DA 3TDQA 2DY8A 3BG3A 1X3QA 4HN7A 2F3VA 3E5SA 4V190 3IFDA 2B2WC 5A2QE 3AMUA 1LTID 1LTSD 1C48A 1RTOA 1JWSD 1WTQA 1BR9A 2A6ED 3CKIB 5ELDA 2D5DA 3U9OA 3S1QB 2J0TD 1WCMB 4HR7B 5IGFA 2NN6I 4HMIA 4O42A 5IGDA 1JC7A 1H9MA 3BYTB 2AWNA 1PRTD 1JOOA 1D1KA 1AP0A 2LS01 3DUZA 1SNDA 3N52A 4XDXA 2BE5C 2NVXB 5KNDA 3EVQA 4MN3A 3NWSA 4KJOA 2EY5A 1UEAB 3OIPA 1HUMA 2R6GA 3DM1A 1WD0A 3PUZA 1QWYA 3DXJC 3MXUA 4AYBB 4CKBA 4HTHA 4K8JA 1B9MA 1CI3M 4WJWA 1F2LA 2N88A 3UI2A 2B8GA 1JWMD 1PFMA 2YYZA 4H0LC 5DNFA 3OPOA 5FLXE 1WTVA 3W2DA 4ID6A 3A7LA 5C3EB 3WOEA 1WTOA 1SYBA 2JE6I 1S5CD 2A69D 5AFWA 5CV9A 3RLFA 2K7VA 1IYVA 1QE6A 3EA6A 2L12A 4Q5VA 4A3MB 2PPBC 5LHY1 3I4NB 1EIHA 4PMCA 2RSNA 3KK7A 1BBXC 1I3QB 5KNBA 2Z8LA 3M4YA 5C6AA 1EYCA 3OSOA 3JAME 4OO1H 4FYDA 2KA7A 2RSOA 2K5WA 1XTCD 3C2PA 5KIXA 1WTXA 2RDHA 2F4IA 1NUCA 2X6GA 1JOKA 2VB2X 1B44D 5CBAE 1STHA 5ELEA 5JPNC 4HSVA 1ENFA 4CJ0B 5CV7A 1J9OA 4CGYB 5EKKA 3A54A 3D6CA 3NSWA 4QUFA 5FK9C 1G291 4K8IA 3P20A 5COYA 1IKMA 2Q8IB 3NXWA 2A73B 3VR5A 2F0FA 1WTRA 5CC4A 2EJGC 3GTGB 2ID0A 3EJIA 4ZKCB 1D6EC 1Q1EA 5JEAH 2EJMA 3AB9A 3NTKA 4I7ZC 1EY7A 4PNYA 2F1MA 3LWUA 1M8AA 2F0EA 3S1MB 3KUPA 1CZGA 4RGNA 2HUGA 1SMYD 1HUNA 2SEBD 1XYIA 4IUVA 1ICWA 2F0NA 4XTCS 2TMPA 2QDBA 5BN4A 2KHSA 2D2CC 3A7AB 4A3GB 4RH6A 2QEJC 3S2HB 1GHJA 2EYMA 1PTOD 2K04A 4DGZA 4IN3A 1PZJD 2KEEA 4I65A 3D31A 1EOTA 3R93A 2G9HD 3F2UA 2AQ1B 4HCEA 2MP1A 4HCSA 3PUYA 2KCNA 5IT9L 3EROA 2EE1A 1QB5D 1S5ED 2XWBB 2CHBD 1LABA 1ILQA 1EEFD 3E0JA 5KYIA 1G91A 4KY6A 5D14A 3R2TA 3J7AV 2XIWA 1QOHA 2JXMB 2M2LA 1SNPA 2Q8RE 4HAEA 3OMCA 1QNKA 1SSOA 2K32A 2KJXA 2EVBA 1IL8A 1E0BA 4DK0A 2PO4A 1D2BA 1SNOA 3I73A 3VA7A 4A3BB 4EQNA 4H13C 2O5JC 2Q8TA 1F2MA 1ZYRD 4TSSA 1ESRA 2E74C 1F9RA 5JVH3 4OIKA 2NYZD 3HEJA 1A15A 3I8ZA 2FHTA 5A35A 3M4OB 2NUCA 1DONA 3IKJA 2BDOA 2HQEA 4WFN3 4XIGS 4J1MA 1WTWA 4IUNA 5CGKA 3SEBA 2NTTA 2BA1A 3J7YW 2C5CA 1Q1BA 2B8FA 1RTNA 4FXGC 4PQXA 4ZYSA 3QG1A 1GUWA 4HSPA 1BQQT 1EZ6A 2MJ8A 5J39A 4ZLTF 5CR3A 3RMHA 3MXPA 3ND8A 1JB3A 3K58A 1BDOA 1LTBD 2M00A 5M5XB 1GUOA 1GXDC 4RHSA 4ZUIA 2JEBI 4JBWA 5C0XI 1Y69U 1CHPD 4FO2A 3NUCA 5M3MB 1I4RA 4NW2A 1PRTF 2NBFA 2E2HB 2RQXA 1TWHB 1HTPA 3MZ5A 5I6WA 2ZXPA 2KCCA 2B39A 4C1NI 2IX0A 1Z47A 3CU7A 3K7AB 3P1HA 1PRTB 2L55A 3NTIA 4IUTA 1I4PA 1SXTA 1TWCB 2F0VA 1IYUA 3QOLA 3NE5B 3PO3B 1YNNC 2EYOA 4R9WA 5DEHA 1JE4A 1DOLA 4DK1A 4N9TA 1B2TA 3DHQA 1AN8A 3SXHA 2EYHA 2RDGA 4RWSC 1BCPD 4KHZA 1CT1D 2V4DA 5CBEE 3P75A 2FJ2A 4S3SA 2XNAC 4FNFA 3EFXD 2B63B 1DYQA 2ICEC 1UNSA 4F88A 1SE4A 5FOBB 4MHEA 3J81E 4O1NA 5T1IA 1C8CA 2RKSA 2F3WA 1V1OA 2C9OA 3FMCA 5JPMC 5C0XJ 5CV4A 1DM0B 1F9PA 3H09A 5ISRA 2L11A 5EPKA 1STYA 2KECA 5JJZA 3M7GA 4FF1A 4IURA 1MGSA 4CJ2C 1GHKA 5KEEA 1EY6A 2L9HA 3HKZB 4KKTA 5IGEA 1BXTA 1VCIA 4K5VA 3QOJA 1V1PB 4Z9CB 2NVTB 1S5FD 5EGTA 2Y0SB 3PV0A 2E2JB 1JOQA 2JEAI 1WD1A 2LKVA 1EQVA 1EY8A 4NDXA 4ZQ3A 1X3PA 3K59A 2E2DC 4WRDA 5ELBA 3J7AF 5I4DA 2PYKA 4L6TB 1LTTD 2DN8A 3N6RA 1HFNA 2D9UA 5KNCA 3BDLA 2CW0C 1UUPA 2RA4A 4B9XA 3FDTA 2PW5A 2NN6G 3SK5A 2L0CA 3PIP3 1MD2D 1EZ8A 3T53B 1STNA 3MFGA 4BY7B 1H9SB 4B08A 3D8GA 1HTLD 3Q0AA 1EIGA 4QIWB 2FMMA 1GOZA 5EJWA 2XVSA 5CMDA 3RUZA 3A8KE 2WIIB 1H9KA 3KBXA 4KN4C 4DAPA 5C4ZA 1TS4A 2QF7A 5LL6X 1STAA 2JP1A 4RFBA 2AQ2B 3IFTA 1OXTA 4QF4A 2IWHA 1T5XD 3K6OA 1K8OA 1B4OA 1PRTC 1Y1VB 2R93B 3NP8A 5KGUA 3PUVA 3PMFA 5C5LA 3VYSA 4RA8A 2LFNA 3GTQB 1KNEA 1CA5A 1HXYD 1AZQA 2Z1CA 1PYWD 4KJNA 1CM9A 5K36G 3FPPA 4ILWA 4C2MB 3DWPA 1PLFA 3S2DB 1NR4A 2F0IA 1SE2A 4BA2I 2F0QA 2R61A 3GV6A 3I3CA 4F87A 1PFNA 1TS3A 1EEID 1SNQA 1STBA 1Z6HA 4IZ8A 2PZUA 3VR6A 1H9JA 4TRDA 5FO8B 5M5WB 5KRUA 2VUMB 5E1FA 1R4PB 3HOVB 3P7JA 3NPPA 2OT2A 1LV9A 1EYDA 3SE0A 1IHZA 5BN3A 4H7BA 2EY1A 2F0DA 3L3OC 4IUQA 4DXFA 2SNSA 4ULLA 2IT1A 1R4QB 2HCIA 1EQTA 1JR0D 1T5EA 4KV6A 2K03A 3DWAA 1Q3LA 1A3TA 1SYDA 3DMUA 3OW7A 4K14A 4R8NA 1G2SA 2FFKB 3S16B 2B2WA 3LWEA 1LTRD 3TZDA 4K6DA 1RJTA 5C44B 1SNMA 2IPKD 1ET9A 5D65A 3L7ZC 2G9DA 1A2UA 4NKLA 3H3VC 3HS0C 2HDLA 2E76C 2OEOA 1S5BD 3IAYA 1MSGA 3TSSA 4DXGA 3GTLB 4XT3B 1XXGA 3VR3A 2NB0A 1D1IA 2K5QA 5DM73 4IFDI 1NCVA 1EWHA 4A3IB 1Z7TA 1NAPA 4XXEA 3RZOB 3I70A 3H6MA 3BDOA 1BCPF 4F8MA 4DAVA 2HDMA 1EY9A 1SMYC 1SYCA 2IJ0A 2NVYB 2OXPA 2CQAA 2EYPA 2K01A 2FINB 4HMJA 5EPLA 1BCPB 1FD7D 2WB1B 1AFPA 1S5DD 1PDQA 4DFAA 2NN6H 3U9SA 1ONLA 4L63B 1HA6A 4PMBA 2FMCA 4KY7A 2B2VC 2WKDA 3TMEA 1VF5C 3KLSX 4X3SA 3LX0A 5CV6A 2F0GA 3NBHA 1I4XA 3GTOB 2GA4B 1K8MA 2A68C 2SDFA 1G2TA 2A6HD 4A93B 4C3HB 1B9NA 1FGBD 2EZVA 2RBMA 1TVXA 3QB3A 3K5MA 3TP7A 5G3LF 1CK1A 2WINB 3OWFA 4K2KA 2B2YC 2XRQD 2AQ3B 3J80L 3NQTA 3I90A 3RD4A 3R8BA 5E3FA 2EYJA 1STGA 1JICA 2I46A 2TSSA 1EY0A 2EYLA 4DF7A 5C3XA 5FO7B 4ZKBB 1RF2D 3MA2B 4ODGA 5K36H 5IT9E 3GQBA 4A3JB 1HA5A 1V43A 2QCPX 5C0XG 1W6JA 5I9PA 2F0SA 3S15B 1EU4A 1F77A 4BBSB 4MIUA 4J6HA 1FNWA 2M9VA 3BYYB 3TP5A 2AUJD 1LTAD 3NWTA 1YNJD 3V05A 4X3TA 5K5PA 2ENBA 4OGQC 3M7NA 4ZAIA 1Y8PB 4A3DB 1TS5A 4RKBA 4KD3A 3SK4A 2K6AA 3J80E 4OHJA 2JA7B 3K5OA 2EXZA 1BO0A 3GTKB 3I4LA 2B2VA 4IUPA 1GUSA 4C3HG 1MSHA 1PMRA 2EPBA 3HP3A 1XX8A 3X3MA 4Q0FA 4A3FB 5C4XB 1KDCA 1PTOH 4PV1C 1YNND 3A55A 1RODA 3OIQA 5C3WA 3KF8A 4BA1I 1KTKA 1HRJA 1E2ZA 2J4XA 1LACA 3PO2B 2PW7A 2QILA 1KNAA 5M5YB 1O7ZA 1LO5D 1J8IA 3VYRA 3ONAB 4FF3A 4B9WA 3ND9A 3ZYYX 2CVRA 1ML0D 5M9OA 2AUKA 5DM63 3QO2A 3QJYA 3MC0B 3D6WA 1DCZA 5IODA 2AWOA 1PZID 1I6VC 3CRKC 5CV5A 3R2IA 4RGMA 1Q90A 2XN9C 2ZXRA 4NP5A 2K1BA 3FRPB 1AEXA 4RGTA 1BCPC 1IW7C 5J22A 4FF4A 2KEDA 2X6LA 1F9QA 2R7ZB 3OMGA 4U673 1NR2A 2BDNA 3BS1A 4OIJA 5EKLA 5EBDA 1U4PA 1VMPA 2R3ZA 1OO9B 1ZEQX 5M3FB 5IGCA 3V96A 3QIAA 5IOCA 1D5MC 2WKCA 2I07B 1K83B 4XQJA 4K2LA 5D3DA 1EY4A 3V2TA 3DEOA 1STEA 1EFID 4DNTB 5EPJA 1SYEA 2F0UA 1ZKOA 4IUUA 3GP7A 3OHXC 4QUCA 3PIO3 2MPMA 3ERQA 1W6KA 3MHBA 1FNUA 5EQ0A 1SEBD 1B3AA 1TS2A 3D4WA 1F2YA 4F7XA 2CW0D 3Q23A 4K6LA 1TWAB 3MVVA 1MBYA 2VNUD 5I6YA 4YIJA 1DXMA 1ENCA 1M4VA 4EQOA 3Q22A 1SYGA 1CA6A 1H9RA 1ENAA 1LT4D 1G6ZA 2D62A 4RAUC 4XYQA 1EY5A 1KDAA 5FKAC 1GUTA 2EY2A 4A3EB 4RCNA 1U4RA 2F0TA 1PTOF 4WORA 1RD9D 4KN7C 2F0HA 2QKIC 4X3UA 4EQPA 3NBIA 1TWFB 3MEHA 1PZKD 3FKIB 2JSOA 3GV3A 3KBGA 4KMUC 4QB4A 5C0XH 4R8IA 5FLXL 1U4MA 1L0YB 2K05A 1PTOB 2BE5D 1CFMA 3GTJB 2RDFA 1O78A 2A6EC 5KYLA 5C4HA 2IW3A 1VF7A 3T51B 2EY6A 1OXSC 4FVMA 1B50A 1D5XC 2L1BA 2KOLA 1SE3A 2WP8J 4CHTB 3HZXA 3L9AX 3EQLC 1U9RA 3JAML 5FO9B 3D3RA 4FXKC 2L5TA 2BCOA 3VYTA 5JEAJ 3S14B 3FPUB 2IX3A 1CQVA 1QJOA 1KLGD 4TKOB 1SAPA 1ILPA 3E6ZX 4G57A 4FP5D 1EYAA 1QILA 3RZDB 3MAQA 1Y8NB 1I4GA 2RVLA 5JVG3 2PCFB 5I2YA 1U4LA 4HEDA 4C3JB 1WVLA 2IX1A 5BN5A 1GUNA 2JYOA 1HPCA 1TT2A 5HGTA 4CKCA 2A69C 3G6JB 3DWQA 2K33A 1TWGB 1EL0A 4X3KA 2O4XA 4KTAA 4QCLA 3HOWB 2B2TC 2R92B 1XWEA 1VMCA 1S4ZA 4ZK9B 3T16A 3OWEB 1CHQD 3C46A 4H44C 3H94A 1E2VA 3GTMB 2EJFC 1UAPA 3FEWX 5I9OA 3HGBA 2LY7A 3NTHA 3BVZA 4QMGA 4IFDG 4OL7A 3M3YB 4KI0A 3I4MB 1SDFA 4CJ1B 1BOSA 1A3UA 3HOXB 2BA0A 2LMCB 4G4KA 3K5LA 1AW7A 1F2ZA 3GTPB 2K28A 1ZXTA 2NWGA 5C5MA 3CHBD 3WOFA 1A3VA 3MWYW 1Y1WB 3TBIB 3PUXA 3K5NA 3CQZB 2F0WA 1EWCA 3TP8A 4N9PA 4ZUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYD A;  1IHZ A;  2M00 A;  5JAV A;  3SK6 A;  2OXP A;  5CV4 A;  4K5X A;  3MVV A;  4H7B A;  4ME5 A;  5CV7 A;  4G57 A;  4K5W A;  2PQE A;  3EVQ A;  5EKK A;  5CV5 A;  4YIJ A;  1ENC A;  4EQO A;  3D6C A;  2EYP A;  2EY5 A;  1EYA A;  1SYG A;  2EY1 A;  2F0D A;  3D8G A;  2EYF A;  4KJO A;  4ZUI A;  5I9P A;  1RKN A;  1ENA A;  1STY A;  4HMJ A;  2SNS A;  4NP5 A;  3NUC A;  5KYI A;  2F0S A;  4KY6 A;  1AEX A;  1EY5 A;  1KDA A;  3RUZ A;  1TQO A;  4MIU A;  5J22 A;  4K8I A;  1SYF A;  2EY2 A;  4J6H A;  4DFA A;  3OMG A;  4KV6 A;  4RKL A;  5KEE A;  1EY6 A;  1TT2 A;  4HTH A;  3SK8 A;  1SNP A;  3TP5 A;  4DU9 A;  5HGT A;  3NXW A;  3MZ5 A;  4PMB A;  5C4Z A;  4KY7 A;  1A3T A;  2F0T A;  1SYD A;  4KD4 A;  4K8J A;  3DMU A;  5I6W A;  3OMC A;  2F0F A;  4K14 A;  4R8N A;  2F0O A;  4K5V A;  1STA A;  5CC4 A;  4WOR A;  5EKL A;  5IGB A;  5K5P A;  3QOJ A;  2F0J A;  3NHH A;  3EJI A;  1II3 A;  2F0H A;  4NMZ A;  3TME A;  3TP6 A;  2PZW A;  5IGG A;  2ENB A;  4EQP A;  3LX0 A;  5CV6 A;  5IIF A;  5J1Z A;  4K6D A;  2F0G A;  5EGT A;  3P1H A;  1EY7 A;  1SNO A;  3MEH A;  4PNY A;  4QF4 A;  5IGC A;  2OF1 A;  2O4X A;  1JOR A;  5F2D A;  3BDC A;  4RKB A;  4QB4 A;  4EQN A;  1JOQ A;  4KD3 A;  3SK4 A;  2F0L A;  2F0E A;  1F2M A;  4KTA A;  4ID6 A;  1KAA A;  3NP8 A;  1SNM A;  5IOC A;  3C1E A;  5KGU A;  1NSN S;  1A2T A;  2LKV A;  5NUC A;  5ISR A;  2F0V A;  1EQV A;  1SYB A;  2WAC A;  3PMF A;  1EY8 A;  1SNC A;  3QOL A;  3R3O A;  3T16 A;  4KHV A;  3VA5 A;  5C5L A;  4NDX A;  5CV9 A;  1A2U A;  4K2L A;  2EYO A;  3HEJ A;  4NKL A;  3SR1 A;  5DEH A;  4ZQ3 A;  2RDF A;  4WRD A;  3S9W A;  1EY4 A;  2EXZ A;  2RBM A;  4N9T A;  3V2T A;  4KJN A;  2F0N A;  5I9O A;  5KYL A;  2F0K A;  3QB3 A;  2NUC A;  2F0P A;  2OEO A;  2PYK A;  3DHQ A;  5C4H A;  4E6I A;  3TP7 A;  4LAA A;  2EYH A;  2QDB A;  3SXH A;  5I6Y A;  2HQE A;  2F0I A;  2F3V A;  4QMG A;  3E5S A;  2KHS A;  4PMC A;  5DAU A;  3OWF A;  3T13 A;  2F0Q A;  2PZT A;  4J1M A;  1KDC A;  4K2K A;  4OL7 A;  4EVO A;  4IAL A;  1SYE A;  2F0U A;  3D4D A;  5HUR A;  3P75 A;  2EY6 A;  4IUN A;  1A3U A;  1KDB A;  5CGK A;  3BDL A;  2EYM A;  3NK9 A;  4S3S A;  1TR5 A;  5JOB A;  4DGZ A;  5C3W A;  1SNQ A;  5C6A A;  3NQT A;  5CV8 A;  1KAB A;  1EYC A;  1F2Z A;  1STB A;  4IZ8 A;  4B9X A;  2PW5 A;  2SOB A;  3HZX A;  3OSO A;  2PZU A;  5E3F A;  3U9O A;  2PW7 A;  3SK5 A;  2EYJ A;  1STG A;  4I65 A;  1U9R A;  5C5M A;  3H6M A;  3SHL A;  4TRD A;  5IOD A;  5IGF A;  1A3V A;  2F0M A;  3ERQ A;  5IGD A;  4HMI A;  5KIX A;  1EY0 A;  2EYL A;  4DF7 A;  4KY5 A;  4F8M A;  2KQ3 A;  1EZ6 A;  5C3X A;  1NUC A;  1JOO A;  2RKS A;  3MHB A;  4B9W A;  5KRU A;  5J39 A;  1EZ8 A;  5IGE A;  1JOK A;  2F0W A;  5E1F A;  2F3W A;  5CR3 A;  4ODG A;  5M9O A;  3TP8 A;  1EY9 A;  2SNM A;  3D4W A;  3MXP A;  1STH A;  4N9P A;  1STN A;  1F2Y A;  3C1F A;  4F7X A;  1SYC A;  4ZUJ A;  3ITP A;  1SND A;  3ERO A; 
#chains in the Genus database with same CATH topology
 1CSQ A;  1V8Q A;  4GZY C;  2N55 A;  5E4W C;  5ELC A;  3IL8 A;  3S1R B;  3K57 A;  3MFY A;  4FDB A;  3I55 A;  3GDE A;  1X56 A;  4U68 A;  1RKN A;  5IP9 G;  2LSS A;  4BS9 A;  3HFZ B;  1O7L A;  1HR0 W;  1SYF A;  3GD7 A;  3QWN A;  2WAQ B;  4RKL A;  2B2U C;  2UUB Q;  4M8A A;  1N36 Q;  1X32 A;  4JI6 L;  2QA4 A;  4QY7 A;  4B3M Q;  2RHS B;  1U5K A;  2N8N A;  2ZT9 C;  2EOT A;  3BVM A;  4C3J G;  2F0J A;  5IGB A;  4KKS A;  5COR A;  4DV6 L;  4GOP A;  5IGG A;  5C3E G;  4K0K Q;  4EGV A;  2BOS A;  1KHI A;  2OF1 A;  4GN4 B;  4DA2 A;  1GD7 A;  1BUV T;  1KC8 C;  2F0L A;  2Z6K A;  1JCK B;  1E22 A;  1KAA A;  2KUM A;  2NVQ B;  4ZUJ A;  1A2T A;  2WFW A;  4DNR B;  5NUC A;  2WAC A;  4IJH A;  3AFQ A;  4A3M G;  1SRO A;  2HCC A;  4KHV A;  3Q6S A;  3SDZ A;  1PTO C;  4JK1 C;  2V1C C;  3HOW G;  3HOZ H;  2R92 G;  1SN8 A;  2F0K A;  1VQK A;  4FF2 A;  1QVF A;  4LF6 L;  3HRZ C;  1PV4 A;  1YHA A;  4E6I A;  2XSC A;  4LFC Q;  5FLM H;  4KK7 A;  4P74 A;  2UXB L;  1TKW B;  5E4X A;  3DM3 A;  5TSS A;  2XWJ B;  3LNN A;  1Y8O B;  2A68 D;  3Q8D A;  2PZT A;  1E7Z A;  3T4A C;  4EVO A;  5FJ8 G;  4C56 C;  2O2L D;  1ASY A;  3T56 B;  1I50 B;  2LXJ A;  5JOB A;  5LL6 S;  4V0B A;  1K3R A;  4Y7N B;  5CV8 A;  4MZ9 A;  1KAB A;  2B2T A;  4X65 L;  4G7H C;  5H1S E;  3MXG A;  3HOY B;  4J8Q A;  2CWA A;  5IYC H;  5I2X A;  2SOB A;  1HZB A;  3I4M G;  4BY1 B;  3HG9 A;  4IOA A;  1I4H A;  4WJ3 M;  2VQF L;  5JJK A;  3OOC A;  5C4J B;  2KQ3 A;  4GKJ L;  4IFD J;  1CQF A;  4DN4 M;  4L8J A;  1V1P A;  3KLR A;  2VB3 X;  2A6H C;  2JK8 A;  4JI3 L;  4I7A A;  3A5Z B;  3C1F A;  1N8R C;  2SNM A;  1K83 H;  1ESF A;  1Y1W G;  3A56 A;  1C4Q A;  3SK6 A;  5JAV A;  2F03 A;  4G7Z C;  1SFO H;  3J7A 5;  3S1N B;  5FLX c;  2R7F A;  1SLJ A;  3ICE A;  4C3I B;  3KLS A;  3F2C A;  4DK3 C;  4ZCK A;  4NXM Q;  1FNV A;  1NE3 A;  1D5Z C;  2ZTE A;  4XQQ A;  4DV3 Q;  4LF5 Q;  4LJZ C;  1TQO A;  2A74 C;  2ZXO A;  2PNR C;  2VXW A;  1BF4 A;  2YU9 B;  4X64 Q;  1FVI A;  1ZYR C;  2IL8 A;  4R4Q A;  4KKU A;  3H0G B;  3ULJ A;  3KOJ A;  4LFB L;  4KD4 A;  4A3L H;  3M9B A;  3CCE A;  3CCU A;  2F0O A;  1RCV D;  1YJN A;  2E2I B;  2PQA A;  2XRS D;  3TP6 A;  3NHH A;  2PZW A;  1KLU D;  4JI1 L;  2JA8 B;  4RGO S;  2HIV A;  5EKI A;  4B3S Q;  1OXX K;  4PMW A;  1BBW A;  1LT5 D;  1L0X B;  1LT6 D;  1LT3 D;  1JOR A;  3BDC A;  3A8J E;  3X3N A;  1R9T B;  4UAI A;  4DR7 Q;  5EBC A;  2K4K A;  3D4R A;  1QUQ B;  2Q2U A;  1NSN S;  1JT8 A;  1I6H B;  5CYU A;  1ET6 A;  3Q24 A;  3CP0 A;  4JYA L;  1OXV A;  3JAM c;  3ER0 A;  1JJ2 A;  2LXK A;  1VS0 A;  2K5H A;  4RHR A;  3SR1 A;  2B2U A;  3NQI A;  2L4N A;  2JA5 B;  3FVQ A;  4CDF C;  2G5D A;  4LAA A;  2H4O A;  3TZU A;  1SJH D;  5IP7 H;  1PH8 A;  4A3K B;  3VYU A;  3T13 A;  1KL9 A;  4IAL A;  4BBR B;  1H9S A;  1GUG A;  3K0Y A;  4AQY L;  1HNW Q;  3UDI A;  4ABN A;  2DY7 A;  3NK9 A;  3S17 B;  1TR5 A;  1VQL A;  1CTM A;  1YNJ C;  4G7O C;  3TRZ A;  1N32 Q;  5T1G A;  2DNC A;  1LLR D;  4CDE C;  4LK1 C;  3WDN A;  3HOU B;  3J81 L;  3HKS A;  1RDP D;  4KY5 A;  1KIX A;  2J7Z A;  4FXD A;  4DAM A;  1IBL L;  1SJE D;  4BY1 G;  2JA6 B;  2DNE A;  3DEP A;  3ITP A;  1XPO A;  4K5X A;  4ME5 A;  4IFD H;  1X54 A;  1WCM H;  4CBV A;  5D3I B;  3J7Z C;  2MUY A;  4CDD C;  2A5H A;  2DGY A;  3PGZ A;  4GKK Q;  1X6O A;  4P2C B;  1TU2 B;  1B53 A;  3PF4 A;  1FJG Q;  4XT1 B;  1B1Z A;  3J81 i;  4DR1 L;  1I4Q A;  2Q2H A;  1C7Y A;  4C3I G;  4JI4 L;  4DU9 A;  4EQ5 A;  1K9M C;  1K0R A;  3KYH C;  1XMQ Q;  1K8G A;  1HHV A;  4A3B G;  2NVX H;  4LF4 L;  1E2W A;  4NMZ A;  1YVC A;  2B2Y A;  4WJ4 A;  1O7Y A;  3HOZ B;  1WTP A;  5IIF A;  1HQM C;  1AZP A;  5J1Z A;  1CUK A;  3AU7 A;  3H0G G;  4M1U B;  1JMC A;  4UDU C;  2DJG C;  1IW7 D;  5F2D A;  1HFG A;  1QNU A;  1DZ1 A;  2K75 A;  1TY0 A;  4DAY A;  3G7L A;  3RLO A;  2DJF C;  3C1E A;  3MTS A;  3R3O A;  5IP9 H;  4OO1 G;  1L1O A;  4DR2 L;  3OTO Q;  1QCB D;  4PZ8 A;  1UE5 A;  3UDX A;  3VR2 A;  1PXU A;  3W3A A;  4RMF A;  3BU2 A;  3S9W A;  3SVM A;  4XYO A;  2DUD A;  4UPA A;  4YWL A;  1EU3 A;  1DD2 A;  2PMZ B;  4X62 L;  2F0P A;  2Z9H A;  4DV0 Q;  3I2Z A;  2EDG A;  4GN5 A;  3G48 A;  1PFB A;  1DOM A;  2VL6 A;  4RCO A;  4C3J H;  2CKZ B;  5DAU A;  1WTH A;  5C3E H;  4TQU S;  3D4D A;  5HUR A;  1RHP A;  3NBH B;  4PZ6 A;  4IOC A;  1KDB A;  1V9P A;  3TN2 A;  2X69 A;  4A3K G;  4C1N K;  4OO1 I;  4LMQ D;  1SFO B;  2UUA L;  1FYC A;  4A3M H;  3BZC A;  2Z4I A;  3SHL A;  1O80 A;  5GAH C;  3BVG A;  1HQR D;  2F0M A;  4LF5 L;  2WV6 D;  4JOI A;  3HOW H;  4YWK A;  1OXU A;  3O13 A;  2ZTC A;  3PUW A;  2H1E A;  5JEA G;  5A2Q L;  1XNQ Q;  1TY2 A;  1HZC A;  3HOU G;  3MXN A;  3URY A;  4N8F A;  3H91 A;  3UDF A;  2Z4H A;  4K5W A;  2PQE A;  3K81 C;  5FJ8 H;  3A8I E;  1LTG D;  1HR0 Q;  2EYF A;  4CKE A;  2JA6 G;  3BZD B;  4DV2 L;  5G3L D;  3VR4 A;  1AE3 A;  4LUV A;  1PH9 A;  5ELF A;  1SBB B;  4ZRZ A;  2MO1 A;  1VQ5 A;  4IQZ A;  1GJX A;  3C3L A;  4OEL B;  3E9H A;  3I4M H;  1Q8I A;  1JWU D;  1QVG A;  1TII D;  3SK8 A;  1Z9F A;  2MGS A;  1S3O A;  2NTS A;  1Q8K A;  3M4P A;  1II3 A;  1UWV A;  2KVM A;  3W5O A;  3A0J A;  3M85 A;  1YBY A;  1WFQ A;  2ICI A;  4LF8 Q;  4BWG B;  1S72 A;  1KRS A;  3RLN A;  1VDZ A;  2MHV A;  2NZ1 D;  4XQN A;  1FR3 A;  1A6X A;  1F9S A;  1QG7 A;  4OON A;  1HH2 P;  1Q12 A;  4JI5 L;  2UU9 Q;  1GVP A;  1DOK A;  4GLV B;  2E75 C;  1PH1 A;  1SNC A;  4JPB W;  1CZW A;  3VA5 A;  2MO0 A;  1PH6 A;  1BNZ A;  3STB D;  1XTD A;  3GTG H;  2O5I C;  3L2P A;  5JJL A;  3S1R H;  1HCZ A;  1G8Z D;  1EUJ A;  1MI2 A;  4DK6 C;  3I91 A;  1IKL A;  3CRL C;  4NXN Q;  3U58 A;  2PMZ E;  3OYY A;  3GO5 A;  1DJR D;  4OXP A;  3I72 A;  1X3E A;  3F2B A;  1JQY D;  2K5D A;  3TDQ A;  2DY8 A;  3BG3 A;  1X3Q A;  4HN7 A;  5HGQ A;  4JV5 L;  2F3V A;  3S1M H;  3E5S A;  1NBW A;  4V19 0;  2B63 G;  3IFD A;  2B2W C;  4A4I A;  5A2Q E;  3CCQ A;  3AMU A;  1LTI D;  1LTS D;  1C48 A;  1RTO A;  4AIM A;  1JWS D;  1M1K C;  1VQC A;  1SRU A;  1WTQ A;  1BR9 A;  4DR4 L;  2A6E D;  3CKI B;  5ELD A;  2D5D A;  3U9O A;  3S1Q B;  5E7N A;  2J0T D;  1WCM B;  4HR7 B;  5IGF A;  2NN6 I;  4HMI A;  4O42 A;  5IGD A;  1JC7 A;  1H9M A;  1VQN A;  3BYT B;  2AWN A;  1PRT D;  1JOO A;  2B29 A;  2NVQ H;  1D1K A;  4JCV E;  1W2B A;  1AP0 A;  2LS0 1;  3S2H H;  5AJ3 Q;  3DUZ A;  1SND A;  2UUC Q;  3N52 A;  4XDX A;  2BE5 C;  3KLW A;  1VQF A;  3I56 A;  3CW2 C;  5KND A;  2NVX B;  3EVQ A;  4MN3 A;  1DGS A;  3NWS A;  4KJO A;  2EY5 A;  1UEA B;  1KAW A;  1JB7 A;  2MNA A;  3I4O A;  4X66 Q;  1IZ6 A;  1HUM A;  3OIP A;  2R6G A;  3KF8 B;  4HIO A;  3H15 A;  4DR6 L;  3DM1 A;  1WD0 A;  3PUZ A;  1QWY A;  3A5U A;  1IYJ B;  3DXJ C;  3MXU A;  4AYB B;  3JC6 6;  1EFW A;  4CKB A;  1YHQ A;  1C0A A;  4GNX A;  4HTH A;  4O2D A;  1LTL A;  3KDF A;  4K8J A;  1B9M A;  1CI3 M;  3CCJ A;  4WJW A;  1F2L A;  2N88 A;  3UI2 A;  2P5Z X;  2B8G A;  4BY1 H;  1JWM D;  1PFM A;  2YYZ A;  4YCU A;  4POG A;  2AKW B;  4H0L C;  4YY3 Q;  1YEZ A;  5DNF A;  1IBM Q;  3OPO A;  5FLX E;  1WTV A;  3W2D A;  2QW7 A;  4ID6 A;  3A7L A;  5C3E B;  3WOE A;  1WTO A;  1SYB A;  2JE6 I;  1S5C D;  2A69 D;  5AFW A;  3CCS A;  5CV9 A;  3RLF A;  3J81 c;  2K7V A;  1IYV A;  1QE6 A;  2BH2 A;  3EA6 A;  4C3I H;  2L12 A;  4Q5V A;  3CPF A;  3CCR A;  4A3B H;  4A3M B;  2PPB C;  2A8V A;  1CKM A;  5GRO A;  5LHY 1;  4YHH L;  4KHP Q;  3I4N B;  2N3S A;  1EIH A;  4PMC A;  2YU9 H;  4JI8 Q;  2RSN A;  2E8G A;  4ME3 A;  1JE5 A;  1NMG A;  3KK7 A;  3H0G H;  1CKN B;  2UXD Q;  4DR3 L;  1I3Q B;  1BBX C;  5KNB A;  2Z8L A;  3M4Y A;  5C6A A;  1EYC A;  3A74 A;  1HR0 L;  3OSO A;  3EN2 A;  1EIY B;  3JAM E;  4QIW E;  2ES2 A;  4OO1 H;  4FYD A;  1HNX L;  2KA7 A;  2RSO A;  2K5W A;  4OX9 L;  1XTC D;  1R9T H;  3C2P A;  5KIX A;  1WTX A;  2RDH A;  1VQB A;  2F4I A;  4BY7 G;  1NUC A;  2X6G A;  1E1T A;  3AQQ A;  1A62 A;  1JOK A;  2VB2 X;  2VW9 A;  1I6H H;  1B44 D;  5CBA E;  1STH A;  5ELE A;  1WCM G;  5JPN C;  4HSV A;  4MTK A;  1ENF A;  4CJ0 B;  5CV7 A;  1J9O A;  4CGY B;  5EKK A;  3A54 A;  3D6C A;  3NSW A;  3WWV A;  1PH5 A;  1PH3 A;  4QUF A;  3BZK A;  5FK9 C;  3CC7 A;  4JC0 A;  1G29 1;  1A8V A;  4A3K H;  1VQJ A;  4K8I A;  1Q7Y C;  3CC2 A;  2VZA A;  3P20 A;  4LUO A;  2IHF A;  5COY A;  1IKM A;  5IWA Q;  4MTN A;  2Q8I B;  3NXW A;  2A73 B;  3VR5 A;  2F0F A;  1WTR A;  5CC4 A;  2EJG C;  3GTG B;  2ID0 A;  3EJI A;  4ZKC B;  4AYB G;  1D6E C;  1Q1E A;  4R4O A;  4JBM A;  4QJF A;  5JEA H;  2EJM A;  3AB9 A;  1UE1 A;  3NTK A;  4I7Z C;  3HOU H;  1EY7 A;  4PNY A;  1ASZ A;  2RHQ B;  2OTL A;  2F1M A;  5LMN W;  3VDY A;  3LWU A;  1M8A A;  2D0P A;  2F0E A;  4DR5 L;  3S1M B;  1T9H A;  3KUP A;  4LFA Q;  1CZG A;  4RGN A;  2JA6 H;  2HUG A;  1SMY D;  1KQS A;  4UHV A;  1HUN A;  1N34 Q;  2SEB D;  1XYI A;  1H95 A;  4IUV A;  3K7A H;  1ICW A;  2F0N A;  4XTC S;  2TMP A;  2QDB A;  1IBK L;  2HQL A;  5BN4 A;  2KHS A;  1VQA A;  5IYD G;  2D2C C;  3A7A B;  4A3G B;  4RH6 A;  1TWC H;  3UDG A;  3T1H L;  2QEJ C;  1PVO A;  2ZJR A;  3NEM A;  1PFS A;  3S2H B;  1GHJ A;  3PO3 H;  2EYM A;  1PTO D;  2K04 A;  4DGZ A;  4IN3 A;  3I4N G;  1V1Q A;  2VUM G;  2F4V Q;  2EQS A;  1PZJ D;  2KEE A;  4X66 L;  4I65 A;  3D31 A;  1HNZ Q;  1EOT A;  3R93 A;  2K14 A;  4NPS A;  2G9H D;  1E3P A;  3F2U A;  3TS0 A;  1K0S A;  2AQ1 B;  4HCE A;  2MP1 A;  4HCS A;  4DUZ Q;  3PUY A;  2KCN A;  5IT9 L;  1JJG A;  3ERO A;  2EE1 A;  2PI2 A;  1QB5 D;  1S5E D;  2B63 H;  2XWB B;  2CHB D;  1LAB A;  1ILQ A;  1EEF D;  2KBN A;  3E0J A;  1KD1 C;  2UXC L;  1BKB A;  5KYI A;  1G91 A;  4KY6 A;  5D14 A;  3R2T A;  1XMO Q;  3J7A V;  2XIW A;  1BVS A;  1QOH A;  2JXM B;  2M2L A;  1YNX A;  1SNP A;  2Q8R E;  4HAE A;  1VQG A;  2CWP A;  3OMC A;  1QNK A;  2B3G A;  1SSO A;  2K32 A;  3MEF A;  2KJX A;  2EVB A;  1IL8 A;  1E0B A;  4DK0 A;  2PO4 A;  1D2B A;  1SNO A;  3I73 A;  3VA7 A;  4A3B B;  1I94 Q;  1NY4 A;  3PQI A;  4EQN A;  2I5M X;  4H13 C;  2O5J C;  2A19 A;  2Q8T A;  1F2M A;  1ZYR D;  4LF7 Q;  4TSS A;  1ESR A;  1NNX A;  2E74 C;  2UXD L;  1F9R A;  5JVH 3;  4OIK A;  2HHH L;  2NYZ D;  3HEJ A;  5GAG C;  2YTV A;  1A15 A;  3I8Z A;  2FHT A;  2YTY A;  5A35 A;  3M4O B;  4JI7 L;  2NUC A;  5LMU Q;  4B3T Q;  1DON A;  1A0I A;  2E2J H;  3IKJ A;  2BDO A;  2HQE A;  4WFN 3;  4JI0 Q;  4XIG S;  4J1M A;  1WTW A;  1Q82 C;  3H3V H;  2RCN A;  4IUN A;  3RR5 A;  5CGK A;  3SEB A;  2NTT A;  2BA1 A;  3J7Y W;  2C5C A;  1Q1B A;  2B8F A;  1RTN A;  3J80 i;  3PIO A;  4A3G G;  1W3S A;  4FXG C;  4PQX A;  2WB1 E;  4ZYS A;  3QG1 A;  1GUW A;  2JQO A;  1EIF A;  5GAE C;  2MFI A;  4O0A A;  4HSP A;  1QVC A;  1VQ9 A;  1BQQ T;  1EZ6 A;  2MJ8 A;  4LUZ A;  2I0Q A;  1UE7 A;  5J39 A;  4TVA B;  2GVB A;  4ZLT F;  5CR3 A;  3RMH A;  3MXP A;  3ND8 A;  1JB3 A;  3K58 A;  1VQ4 A;  1BDO A;  1LTB D;  2M00 A;  5M5X B;  1GUO A;  1GXD C;  4RHS A;  4ZUI A;  2BH8 A;  2JEB I;  4JBW A;  3PIP A;  2CH4 W;  5C0X I;  1Y69 U;  4IPD A;  4KLK A;  1VQE A;  1CHP D;  4FO2 A;  3NUC A;  5M3M B;  1VQP A;  3TQY A;  1I4R A;  4NW2 A;  1PRT F;  2NBF A;  3KF6 B;  4LFA L;  2E2H B;  2RQX A;  1TWH B;  1HTP A;  4R4I A;  1K3B C;  4YCV A;  2UUB L;  1N36 L;  3MZ5 A;  5I6W A;  2ZXP A;  2KCC A;  2B39 A;  4BY7 H;  4B3M L;  1YJ9 A;  3KFU A;  4C1N I;  2IX0 A;  1Z47 A;  3S1Q H;  3CU7 A;  2OQ0 A;  3K7A B;  4K0K L;  4DV5 Q;  3P1H A;  1PRT B;  2L55 A;  3NTI A;  4L5S A;  3NEL A;  2F3I A;  4IUT A;  1I4P A;  2HT1 A;  1TWC B;  2F0V A;  1SE8 A;  1IYU A;  3QOL A;  3NE5 B;  4ALP A;  3PO3 B;  4PZ7 A;  1YNN C;  2EYO A;  4R9W A;  4YWM A;  5DEH A;  1JE4 A;  1DOL A;  4DK1 A;  4N9T A;  1B2T A;  3DHQ A;  1AN8 A;  3SXH A;  2EYH A;  4LFC L;  4GOP B;  2RDG A;  4RWS C;  1BCP D;  4A3C H;  4GLA C;  4KHZ A;  1CT1 D;  4N8X 1;  2V4D A;  5CBE E;  3P75 A;  2FJ2 A;  4S3S A;  2XNA C;  4FNF A;  3EFX D;  4DV1 Q;  2CCZ A;  2B63 B;  1DYQ A;  2ICE C;  1WYD A;  1UNS A;  4R4T A;  4C2M H;  4F88 A;  1SE4 A;  5FOB B;  4MHE A;  3J81 E;  4O1N A;  5T1I A;  4H02 A;  1XMO L;  1C8C A;  2RKS A;  4DV4 Q;  1X3G A;  2F3W A;  1V1O A;  2C9O A;  3FMC A;  1PH2 A;  4LNQ A;  5JPM C;  2PNH A;  5C0X J;  5CV4 A;  1DM0 B;  5IYD H;  1F9P A;  3H09 A;  4IJL A;  5ISR A;  4UP7 A;  2L11 A;  5EPK A;  1STY A;  2GN5 A;  2KEC A;  4NXM L;  5JJZ A;  2E5L Q;  1AE2 A;  3M7G A;  3I4N H;  4DV3 L;  4FF1 A;  4IUR A;  1MGS A;  2JA9 A;  2VUM H;  2KCT A;  2KEN A;  4CJ2 C;  4X64 L;  1GHK A;  5KEE A;  1EY6 A;  1EWI A;  2L9H A;  3G4S A;  3HKZ B;  4KKT A;  5IGE A;  1I3Q H;  1BXT A;  4IPH A;  5M3M G;  4DUY Q;  4UP9 A;  1VCI A;  1Q81 C;  4K5V A;  2KHI A;  1Q46 A;  3E9I A;  3QOJ A;  1NJI C;  1V1P B;  5LMN Q;  4Z9C B;  1SMX A;  4HJ9 A;  5ELN A;  1M90 C;  4B3S L;  2NVT B;  1S5F D;  5EGT A;  2Y0S B;  2ALY B;  3PV0 A;  2E2J B;  1TXY A;  1JOQ A;  2JEA I;  4DR7 L;  1XNR Q;  2I5H A;  2RF4 A;  1WD1 A;  1UE6 A;  2LKV A;  1N33 Q;  1EQV A;  1EY8 A;  3S16 H;  4LWC A;  4NDX A;  4ZQ3 A;  1X3P A;  3K59 A;  5C4X G;  2E2D C;  4WRD A;  3TS2 A;  1XPU A;  5ELB A;  3W1G A;  3J7A F;  5I4D A;  2PYK A;  4HIK A;  4L6T B;  4JI2 Q;  2PQA B;  5IT9 c;  3PO3 G;  4LF9 Q;  1LTT D;  2DN8 A;  3CCM A;  3N6R A;  3PO2 G;  3T1Y Q;  1HFN A;  2ZM6 Q;  2D9U A;  1HNW L;  5KNC A;  2EXD A;  3BDL A;  1VQ6 A;  3CCV A;  2CW0 C;  3UE1 A;  1UUP A;  2RA4 A;  4B9X A;  1N32 L;  3FDT A;  2PW5 A;  3F1Z A;  2NN6 G;  5IY0 A;  3SK5 A;  3ULP A;  2L0C A;  5IE8 A;  3PIP 3;  3GTL H;  2ZJP A;  1MD2 D;  3ERS X;  1EZ8 A;  3F2D A;  3T53 B;  1STN A;  3MFG A;  1X65 A;  1LM0 A;  4BY7 B;  2R7Z G;  4QGU A;  4QQB X;  1H9S B;  4B08 A;  3D8G A;  1HTL D;  2Z6B A;  3Q0A A;  2AMC B;  1EIG A;  2PI2 E;  4QIW B;  2FMM A;  2RCF A;  1GOZ A;  5EJW A;  2XVS A;  4GKK L;  5CMD A;  3RUZ A;  3A8K E;  2WII B;  4A3G H;  1H9K A;  1FJG L;  3KBX A;  5M3F G;  3CCL A;  4KN4 C;  1XMQ L;  4DAP A;  4JI6 Q;  3HKZ E;  5C4Z A;  1TS4 A;  2JJQ A;  2QF7 A;  3U4Z A;  5LL6 X;  1STA A;  2JP1 A;  4RFB A;  1MJE A;  1YJW A;  2AQ2 B;  3IFT A;  1OXT A;  3PF5 A;  3HKZ G;  2Y0S E;  4QF4 A;  2IWH A;  1K8A C;  1T5X D;  3K6O A;  1K8O A;  3FHW A;  1B8A A;  1B4O A;  2Q2I A;  1PRT C;  4HIM A;  1Y1V B;  2R93 B;  3NP8 A;  5KGU A;  1VQM A;  3PUV A;  1PH4 A;  3PMF A;  2Y0S G;  5C5L A;  3PSI A;  3VYS A;  3OTO L;  4RA8 A;  2LFN A;  3GTQ B;  1KNE A;  1CA5 A;  1OTC A;  1HXY D;  1AZQ A;  2Z1C A;  3G6E A;  1PYW D;  4KJN A;  1CM9 A;  4LF6 Q;  5K36 G;  3FPP A;  4ILW A;  4DV0 L;  4C2M B;  3DWP A;  1PLF A;  3AEV A;  3S2D B;  1NR4 A;  2UXB Q;  2F0I A;  3BJU A;  4B3R Q;  1SE2 A;  2FXQ A;  4BA2 I;  2F0Q A;  2R61 A;  3GV6 A;  2QDL A;  3I3C A;  4F87 A;  1PFN A;  1YHB A;  1TS3 A;  1EEI D;  5IYB G;  1RL2 A;  4DAY B;  1S40 A;  1SNQ A;  3B6Y A;  1STB A;  1Z6H A;  4IZ8 A;  4X65 Q;  2PZU A;  3RNU A;  1L1O B;  3E3X A;  3VR6 A;  1H9J A;  4TRD A;  2VQF Q;  1GKH A;  3JAM i;  1FGU A;  5FO8 B;  4P75 A;  5M5W B;  4GKJ Q;  5KRU A;  2VUM B;  5E1F A;  3F8T A;  2HD3 A;  1R4P B;  3AYH B;  1XNQ L;  4JI3 Q;  3HOV B;  4UP8 A;  3P7J A;  3NPP A;  2ZTD A;  2OT2 A;  1LV9 A;  1EYD A;  3SE0 A;  1IHZ A;  5BN3 A;  1KRT A;  4H7B A;  4A3E G;  2OTJ A;  3M4O H;  1PYB A;  2EY1 A;  2F0D A;  3L3O C;  4IUQ A;  1QUQ A;  4DXF A;  2SNS A;  4ULL A;  2IT1 A;  1R4Q B;  2HCI A;  1EQT A;  3CD6 A;  1JR0 D;  1T5E A;  1WOC A;  4KV6 A;  2K03 A;  3DWA A;  4LFB Q;  1Q3L A;  1A3T A;  3FKI G;  1SYD A;  3DMU A;  3OW7 A;  4K14 A;  4R8N A;  1G2S A;  2IY5 B;  2FFK B;  3CAM A;  3S16 B;  2B2W A;  3LWE A;  1LTR D;  5HY6 A;  3KJP A;  4JI1 Q;  4LF8 L;  3TZD A;  3MXN B;  4K6D A;  1RJT A;  5C44 B;  3K80 C;  1SNM A;  2UU9 L;  2IPK D;  1ET9 A;  4HID A;  4JYA Q;  1XJV A;  5D65 A;  3L7Z C;  1L0W A;  5M5X H;  2G9D A;  1A2U A;  4NKL A;  3H3V C;  3HS0 C;  1Y1V G;  4A3C G;  2R93 G;  2HDL A;  2E76 C;  4NXN L;  4A3D H;  2OEO A;  1S5B D;  3IAY A;  5M3M H;  1MSG A;  3TSS A;  4DXG A;  3GTL B;  4XT3 B;  2E2H H;  1XXG A;  1TWH H;  3VR3 A;  2NB0 A;  1D1I A;  2K5Q A;  2JA7 H;  2VS1 A;  5DM7 3;  5DLQ E;  4IFD I;  4AQY Q;  1NCV A;  2NZO A;  1EWH A;  4A3I B;  3GTK H;  3L0O A;  1Z7T A;  1G6P A;  1NAP A;  4XXE A;  3RZO B;  3I70 A;  3S24 A;  3H6M A;  3BDO A;  1BCP F;  4F8M A;  4A3F H;  5C4X H;  2EIF A;  4DAV A;  2HDM A;  1FL0 A;  2VQE Q;  1IBL Q;  5AJ3 L;  1EY9 A;  1SMY C;  2QEX A;  4A75 A;  1SYC A;  1L2F A;  2IJ0 A;  2NVY B;  2UUC L;  2HIX A;  2OXP A;  2CQA A;  3PO2 H;  2EYP A;  2K01 A;  2FIN B;  1A63 A;  3ZJY C;  3AFP A;  4HMJ A;  5M5Y H;  5EPL A;  1BCP B;  1FD7 D;  3HOV G;  2WB1 B;  3QR8 A;  4YCW A;  1AFP A;  1S5D D;  1PDQ A;  4DFA A;  2NN6 H;  4DR1 Q;  3U9S A;  1ONL A;  4L63 B;  2H5X A;  1HA6 A;  4JI4 Q;  4PMB A;  2FMC A;  4KY7 A;  2B2V C;  2WKD A;  3CPW A;  4LF4 Q;  3TME A;  3K8A A;  1VF5 C;  3KLS X;  4X3S A;  3LX0 A;  5CV6 A;  4IO9 A;  2F0G A;  4YY3 L;  3NBH A;  1I4X A;  1HZ9 A;  1Y14 B;  1IBM L;  3GTO B;  2GA4 B;  4B3R L;  2R7Z H;  1K8M A;  3CXC A;  2A68 C;  2AHO B;  2SDF A;  1G2T A;  2CFM A;  1BBU A;  2A6H D;  4A93 B;  2NZH A;  4C3H B;  4DR2 Q;  1YZ6 A;  1B9N A;  5C44 G;  1FGB D;  4GNX B;  2EZV A;  2RBM A;  5M3F H;  1TVX A;  2K52 A;  3QB3 A;  3K5M A;  3KDF B;  3HOX G;  4X62 Q;  1K73 C;  1X9N A;  1Q86 C;  1CKO A;  3TP7 A;  5G3L F;  4KHP L;  1CK1 A;  2WIN B;  1LUZ A;  3K0X A;  4IPC A;  4EX5 A;  3OWF A;  4JI8 L;  4K2K A;  2B2Y C;  2XRQ D;  4GS3 A;  2AQ3 B;  1E24 A;  1YI2 A;  3J80 L;  2Q2T A;  3NQT A;  3I90 A;  3RD4 A;  3R8B A;  2UUA Q;  5E3F A;  2NVT H;  2EYJ A;  1STG A;  4BXX G;  1JIC A;  2I46 A;  2TSS A;  1C9O A;  2JN4 A;  1L1O C;  1EY0 A;  2EYL A;  4DF7 A;  5C3X A;  5FO7 B;  4ZKB B;  4A3I G;  1RF2 D;  2WAQ E;  3MA2 B;  4ODG A;  5K36 H;  5IT9 E;  4JBJ A;  3GQB A;  4A3J B;  1B70 B;  4HJ8 A;  1HA5 A;  1V43 A;  2QCP X;  2YTX A;  2KHJ A;  4APV A;  5C0X G;  3G71 A;  2WAQ G;  1W6J A;  4GLX A;  4OEM B;  3ULL A;  5I9P A;  5IYB H;  4DV2 Q;  2F0S A;  3S15 B;  1EU4 A;  1F77 A;  1HZA A;  4BBS B;  4MIU A;  1MKH A;  4J6H A;  1FNW A;  2A1A A;  2M9V A;  3BYY B;  3TP5 A;  5IWA L;  2AUJ D;  2OWO A;  1LTA D;  2WB1 G;  3NWT A;  1TWA H;  1YNJ D;  2N78 A;  3V05 A;  4X3T A;  5K5P A;  4JOI C;  1YIT A;  1VQH A;  2ENB A;  4OGQ C;  3M7N A;  4ZAI A;  1K28 A;  1Y8P B;  2F52 A;  4A3D B;  3EBE A;  1TS5 A;  4RKB A;  4A3E H;  4KD3 A;  3SK4 A;  4JI5 Q;  3UE0 A;  2K6A A;  1SR3 A;  1KXL A;  3J80 E;  4OHJ A;  2JA7 B;  1NMF A;  1PHJ A;  1N34 L;  3K5O A;  2EXZ A;  1BO0 A;  3GTK B;  1TWF H;  3I4L A;  2B2V A;  4A93 G;  3FKI H;  4IUP A;  5L37 A;  1GUS A;  4C3H G;  1MSH A;  1PMR A;  2EPB A;  3HP3 A;  4JV5 Q;  3HOY G;  1XX8 A;  3X3M A;  4Q0F A;  2VQE L;  4A3F B;  5C4X B;  1KDC A;  1GO3 E;  5J3B A;  1PTO H;  4PV1 C;  3KJO A;  1YNN D;  3A55 A;  1ROD A;  3OIQ A;  3GTJ H;  5C3W A;  3KF8 A;  4IPG A;  4BA1 I;  4DR4 Q;  1KTK A;  1VQO A;  1HRJ A;  1E2Z A;  2J4X A;  2F4V L;  3K7U C;  1LAC A;  3PO2 B;  2PW7 A;  2QIL A;  1KNA A;  1HNZ L;  5M5Y B;  1O7Z A;  1LO5 D;  1J8I A;  3VYR A;  1Y1V H;  3ONA B;  2R93 H;  4FF3 A;  4B9W A;  3ND9 A;  3ZYY X;  2CVR A;  1ML0 D;  5M9O A;  2AUK A;  5DM6 3;  4DUZ L;  3QO2 A;  3QJY A;  3MC0 B;  3D6W A;  1DCZ A;  5IOD A;  2AWO A;  1PZI D;  1I6V C;  3CRK C;  1J5E Q;  3GTQ H;  5BR8 Q;  5CV5 A;  3U4V A;  4DKA C;  3R2I A;  4RGM A;  1Q90 A;  2XN9 C;  2ZXR A;  4PG3 A;  2K50 A;  4NP5 A;  4JBK A;  1YIJ A;  3S2D H;  4NB3 A;  2K1B A;  3FRP B;  4DR6 Q;  4A3J G;  1AEX A;  4RGT A;  1BCP C;  1IW7 C;  5J22 A;  4FF4 A;  2KED A;  4R4C A;  2X6L A;  1F9Q A;  3S14 H;  2R7Z B;  3OMG A;  2JA8 G;  3CF5 A;  2I5L X;  2IHE A;  4U67 3;  1NR2 A;  2BDN A;  3DLL A;  3BS1 A;  3IRB A;  4OIJ A;  4BBS G;  5EKL A;  3RZD H;  5EBD A;  4HJA A;  1U4P A;  1VMP A;  2R3Z A;  1OO9 B;  1ZEQ X;  5M3F B;  5IGC A;  2KCM A;  1CKN A;  1I94 L;  3V96 A;  5M5W H;  4UY8 C;  3QIA A;  5IOC A;  1B3Q A;  4LF7 L;  1D5M C;  4Y52 H;  2JA5 G;  3HOV H;  2WKC A;  2I07 B;  1QZH A;  4A3D G;  1K83 B;  4XQJ A;  4K2L A;  1WI5 A;  5D3D A;  1TWG H;  2OQK A;  1EY4 A;  4BBR G;  1QZG A;  3V2T A;  1U0L A;  4OWX B;  3DEO A;  4GNX C;  2JA7 G;  1STE A;  5LMU L;  4B3T L;  1EFI D;  4YHH Q;  1IXR A;  2XGT A;  1VQ7 A;  3NEN A;  2R92 H;  4DNT B;  4JI0 L;  1AH9 A;  4A76 A;  5EPJ A;  1SYE A;  2F0U A;  1ZKO A;  4IUU A;  4DR3 Q;  2K5N A;  3GP7 A;  4L5Q A;  3GTM H;  3OHX C;  4L5T A;  1VQI A;  4A3F G;  4QUC A;  3PIO 3;  1HNX Q;  4HJ7 A;  2MPM A;  3ERQ A;  4OX9 Q;  1W6K A;  5C44 H;  3LGJ A;  3M3Y H;  5GAD C;  3MHB A;  1FNU A;  5EQ0 A;  1SEB D;  3HOX H;  1B3A A;  1TS2 A;  3D4W A;  4POF A;  1F2Y A;  4F7X A;  2CW0 D;  4OWT B;  3Q23 A;  4K6L A;  3GTP H;  1TWA B;  3MVV A;  1MBY A;  2VNU D;  5I6Y A;  4YIJ A;  1DXM A;  1ENC A;  1M4V A;  4EQO A;  3Q22 A;  1SYG A;  1CA6 A;  1H9R A;  1ENA A;  1LT4 D;  1G6Z A;  1X55 A;  4R1J A;  1MIU A;  2D62 A;  1Y1W H;  4LW1 A;  4RAU C;  4XYQ A;  2OCE A;  4HJ5 A;  1EY5 A;  2D0O A;  1KDA A;  4P72 A;  4DV7 Q;  1D7Q A;  5FKA C;  1GUT A;  3CQZ H;  2EY2 A;  4A3E B;  4RCN A;  3HOZ G;  4BXX H;  1J6Q A;  1WJJ A;  1U4R A;  2F0T A;  4DNI A;  1PTO F;  5FLM G;  3STB C;  4WOR A;  1RD9 D;  4A3I H;  4KN7 C;  3TRE A;  1MJC A;  2F0H A;  2QKI C;  4X3U A;  2ZJQ A;  4EQP A;  3RZO H;  3NBI A;  3RN2 A;  4DV5 L;  1EQR A;  1TWF B;  3MEH A;  1PZK D;  2Z0S A;  3FKI B;  2JSO A;  3GV3 A;  3KBG A;  4KMU C;  4QB4 A;  5C0X H;  1MHW C;  4R8I A;  3J80 c;  1CSP A;  1U4M A;  5FLX L;  4AH6 A;  4DR5 Q;  5IYC G;  1L0Y B;  2K05 A;  1PTO B;  3W1B A;  2ASB A;  2NVY H;  4P73 A;  2BE5 D;  3FP9 A;  1CFM A;  1G51 A;  3GTJ B;  2RDF A;  4DV6 Q;  1PYS B;  1O78 A;  2A6E C;  5KYL A;  1NTG A;  4X6A H;  5C4H A;  2IW3 A;  2CH4 A;  3CMA A;  1IBK Q;  3T1H Q;  1VF7 A;  1P8L A;  1UEB A;  2EY6 A;  3T51 B;  1OXS C;  4FVM A;  1B50 A;  5JJI A;  1D5X C;  2L1B A;  1J5E L;  2KOL A;  5BR8 L;  4OWW B;  1SE3 A;  4DV1 L;  1PH7 A;  2WP8 J;  4JVZ A;  4CHT B;  3HZX A;  3L9A X;  3EQL C;  1U9R A;  3JAM L;  3GTO H;  5FO9 B;  1D8L A;  3D3R A;  4JG2 A;  3OW2 A;  4A3L G;  4FXK C;  1VQ8 A;  2L5T A;  1E1O A;  4GN3 B;  2BCO A;  3VYT A;  4DV4 L;  5JEA J;  2ATW A;  1VQD A;  4GOP C;  1HJP A;  1PA6 A;  3S14 B;  3FPU B;  4A93 H;  2IX3 A;  1I50 H;  1CQV A;  4C3H H;  1QJO A;  1KLG D;  4Y7N H;  4L5R C;  4TKO B;  2GVA A;  2K5V A;  1SAP A;  3E0E A;  3HOY H;  1ILP A;  3E6Z X;  4G57 A;  4FP5 D;  1EYA A;  2Z6K C;  1QIL A;  3RZD B;  3MAQ A;  4CDC C;  2VY3 A;  3RN5 A;  1Y8N B;  2UXC Q;  4P71 A;  1I4G A;  2RVL A;  5JVG 3;  5C4J H;  2E5L L;  1LYL A;  3CC4 A;  2PCF B;  5I2Y A;  1U4L A;  1I5F A;  4HED A;  4C3J B;  1WVL A;  4MNO A;  2IX1 A;  3CME A;  3D0F A;  3I7F A;  5BN5 A;  1GUN A;  2JYO A;  1HPC A;  1TT2 A;  5HGT A;  4CKC A;  4DUY L;  1EQQ A;  1ICF B;  2A69 C;  5GQO A;  3S1N H;  5IP7 G;  1O7I A;  3G6J B;  3DWQ A;  5LMN L;  2K33 A;  1TWG B;  1GM5 A;  3TEH B;  3SGI A;  2R7D A;  1EL0 A;  4X3K A;  2O4X A;  2N49 A;  3H3V I;  2C35 B;  2CQO A;  4KTA A;  5EAY A;  1XNR L;  4QCL A;  3HOW B;  2B2T C;  2R92 B;  1XWE A;  1VMC A;  1S4Z A;  1N33 L;  4ZK9 B;  3T16 A;  3OWE B;  1CHQ D;  4A3J H;  3C46 A;  2E2I H;  4H44 C;  2L15 A;  2HHH Q;  3H94 A;  1E2V A;  3GTM B;  2JA8 H;  2EJF C;  3U50 C;  4QL5 A;  1UAP A;  3FEW X;  5I9O A;  2XTI A;  3HGB A;  2MQH A;  4JI7 Q;  2LY7 A;  4JI2 L;  3NTH A;  3BVZ A;  3S15 H;  1N9W A;  4LF9 L;  4BBS H;  3PCO B;  1JJC B;  4QMG A;  2YV5 A;  1B7Y B;  1EOV A;  4IFD G;  4OL7 A;  3M3Y B;  4KI0 A;  3I4M B;  3T1Y L;  1SDF A;  4RG1 A;  1BOS A;  4CJ1 B;  2ZM6 L;  1A3U A;  3HOX B;  1P16 A;  3J81 j;  2BA0 A;  2LMC B;  4G4K A;  3K5L A;  1AW7 A;  3EIV A;  1F2Z A;  3GTP B;  2JA5 H;  4JW0 A;  2K28 A;  1ZXT A;  2NWG A;  3KF6 A;  4J15 A;  1RIP A;  3CHB D;  5C5M A;  1EYG A;  3WOF A;  1A3V A;  1XPR A;  3M4Q A;  4DV7 L;  3MWY W;  1Y1W B;  4DPG A;  3TBI B;  3PUX A;  1IL2 A;  4AYB E;  4BBR H;  2QGQ A;  3K5N A;  3CQZ B;  2F0W A;  1EWC A;  3TP8 A;  1X3F A;  4N9P A;  5ELO A;  3S17 H;  1SXT A; 
#chains in the Genus database with same CATH homology
 1V8Q A;  4GZY C;  2N55 A;  5E4W C;  5ELC A;  3IL8 A;  3S1R B;  3K57 A;  3MFY A;  4U68 A;  1RKN A;  4BS9 A;  1O7L A;  1SYF A;  3GD7 A;  3QWN A;  2WAQ B;  4RKL A;  2B2U C;  4M8A A;  1X32 A;  2ZT9 C;  3BVM A;  2EOT A;  5IGB A;  4C3J G;  2F0J A;  4KKS A;  5COR A;  5IGG A;  4EGV A;  2BOS A;  2OF1 A;  4DA2 A;  1BUV T;  2F0L A;  1JCK B;  1KAA A;  2KUM A;  2NVQ B;  1A2T A;  4DNR B;  5NUC A;  2WAC A;  2HCC A;  4KHV A;  3Q6S A;  3SDZ A;  1PTO C;  4JK1 C;  2F0K A;  4FF2 A;  3HRZ C;  4E6I A;  2XSC A;  4KK7 A;  1TKW B;  5E4X A;  5TSS A;  2XWJ B;  3LNN A;  1Y8O B;  2A68 D;  2PZT A;  3T4A C;  4EVO A;  4C56 C;  2O2L D;  3T56 B;  1I50 B;  5JOB A;  5LL6 S;  4V0B A;  4Y7N B;  5CV8 A;  1KAB A;  2B2T A;  4G7H C;  3MXG A;  3HOY B;  4J8Q A;  5I2X A;  2SOB A;  4BY1 B;  3HG9 A;  1I4H A;  3OOC A;  5C4J B;  2KQ3 A;  4IFD J;  1CQF A;  4DN4 M;  4L8J A;  1V1P A;  3KLR A;  2VB3 X;  2A6H C;  3C1F A;  2SNM A;  1ESF A;  3A56 A;  1C4Q A;  3SK6 A;  5JAV A;  2F03 A;  4G7Z C;  3S1N B;  4C3I B;  3KLS A;  1FNV A;  1D5Z C;  4XQQ A;  4LJZ C;  1TQO A;  2A74 C;  2ZXO A;  2PNR C;  2VXW A;  1BF4 A;  2YU9 B;  1ZYR C;  2IL8 A;  4KKU A;  3H0G B;  4KD4 A;  2F0O A;  1RCV D;  2E2I B;  2XRS D;  3TP6 A;  3NHH A;  2PZW A;  1KLU D;  2JA8 B;  4RGO S;  5EKI A;  1OXX K;  4PMW A;  1LT5 D;  1L0X B;  1LT6 D;  1LT3 D;  1JOR A;  3BDC A;  3A8J E;  3X3N A;  1R9T B;  4UAI A;  5EBC A;  3D4R A;  1NSN S;  1I6H B;  5CYU A;  1ET6 A;  3Q24 A;  1OXV A;  3SR1 A;  4RHR A;  2B2U A;  3NQI A;  2L4N A;  2JA5 B;  3FVQ A;  4LAA A;  2H4O A;  3TZU A;  1SJH D;  4A3K B;  3VYU A;  3T13 A;  4IAL A;  4BBR B;  1H9S A;  1GUG A;  3K0Y A;  4ABN A;  2DY7 A;  3NK9 A;  3S17 B;  1TR5 A;  1CTM A;  1YNJ C;  4G7O C;  5T1G A;  2DNC A;  1LLR D;  4LK1 C;  3WDN A;  3HOU B;  3J81 L;  1RDP D;  4KY5 A;  2J7Z A;  4FXD A;  1SJE D;  2JA6 B;  2DNE A;  3DEP A;  3ITP A;  4K5X A;  4ME5 A;  4IFD H;  4CBV A;  5D3I B;  2MUY A;  2A5H A;  4P2C B;  1TU2 B;  1B53 A;  4XT1 B;  1B1Z A;  1I4Q A;  4C3I G;  4DU9 A;  1HHV A;  1E2W A;  4NMZ A;  2B2Y A;  1O7Y A;  3HOZ B;  1WTP A;  5IIF A;  1HQM C;  1AZP A;  5J1Z A;  4M1U B;  3AU7 A;  4UDU C;  1IW7 D;  5F2D A;  1HFG A;  1QNU A;  1DZ1 A;  1TY0 A;  4DAY A;  3G7L A;  3C1E A;  3MTS A;  3R3O A;  4OO1 G;  1QCB D;  3VR2 A;  1PXU A;  3W3A A;  3SVM A;  3S9W A;  4XYO A;  1EU3 A;  1DD2 A;  2PMZ B;  2F0P A;  2EDG A;  1PFB A;  1DOM A;  4RCO A;  5DAU A;  4TQU S;  3D4D A;  5HUR A;  1RHP A;  1KDB A;  3TN2 A;  2X69 A;  4C1N K;  4OO1 I;  4LMQ D;  1SFO B;  1FYC A;  2Z4I A;  3SHL A;  1O80 A;  3BVG A;  1HQR D;  2F0M A;  2WV6 D;  1OXU A;  3O13 A;  3PUW A;  2H1E A;  5JEA G;  5A2Q L;  1TY2 A;  3MXN A;  3URY A;  3H91 A;  2Z4H A;  4K5W A;  2PQE A;  3A8I E;  1LTG D;  2EYF A;  4CKE A;  3BZD B;  5G3L D;  3VR4 A;  5ELF A;  1SBB B;  4ZRZ A;  4IQZ A;  1GJX A;  3C3L A;  1Q8I A;  1JWU D;  1TII D;  3SK8 A;  2MGS A;  2NTS A;  1II3 A;  2KVM A;  3M85 A;  2ICI A;  4BWG B;  1VDZ A;  2MHV A;  2NZ1 D;  4XQN A;  1FR3 A;  1A6X A;  1F9S A;  1QG7 A;  1Q12 A;  1DOK A;  2E75 C;  1SNC A;  1CZW A;  3VA5 A;  1BNZ A;  2O5I C;  1HCZ A;  1G8Z D;  1MI2 A;  3I91 A;  1IKL A;  3CRL C;  3GO5 A;  1DJR D;  3I72 A;  1JQY D;  2K5D A;  3TDQ A;  2DY8 A;  3BG3 A;  1X3Q A;  4HN7 A;  2F3V A;  3E5S A;  4V19 0;  3IFD A;  2B2W C;  5A2Q E;  3AMU A;  1LTI D;  1LTS D;  1C48 A;  1RTO A;  1JWS D;  1WTQ A;  1BR9 A;  2A6E D;  3CKI B;  5ELD A;  2D5D A;  3U9O A;  3S1Q B;  2J0T D;  1WCM B;  4HR7 B;  5IGF A;  2NN6 I;  4HMI A;  4O42 A;  5IGD A;  1JC7 A;  1H9M A;  3BYT B;  2AWN A;  1PRT D;  1JOO A;  1D1K A;  1AP0 A;  2LS0 1;  3DUZ A;  1SND A;  3N52 A;  4XDX A;  2BE5 C;  2NVX B;  5KND A;  3EVQ A;  4MN3 A;  3NWS A;  4KJO A;  2EY5 A;  1UEA B;  3OIP A;  1HUM A;  2R6G A;  3DM1 A;  1WD0 A;  3PUZ A;  1QWY A;  3DXJ C;  3MXU A;  4AYB B;  4CKB A;  4HTH A;  4K8J A;  1B9M A;  1CI3 M;  4WJW A;  1F2L A;  2N88 A;  3UI2 A;  2B8G A;  1JWM D;  1PFM A;  2YYZ A;  4H0L C;  5DNF A;  3OPO A;  5FLX E;  1WTV A;  3W2D A;  4ID6 A;  3A7L A;  5C3E B;  3WOE A;  1WTO A;  1SYB A;  2JE6 I;  1S5C D;  2A69 D;  5AFW A;  5CV9 A;  3RLF A;  2K7V A;  1IYV A;  1QE6 A;  3EA6 A;  2L12 A;  4Q5V A;  4A3M B;  2PPB C;  5LHY 1;  3I4N B;  1EIH A;  4PMC A;  2RSN A;  3KK7 A;  1BBX C;  1I3Q B;  5KNB A;  2Z8L A;  3M4Y A;  5C6A A;  1EYC A;  3OSO A;  3JAM E;  4OO1 H;  4FYD A;  2KA7 A;  2RSO A;  2K5W A;  1XTC D;  3C2P A;  5KIX A;  1WTX A;  2RDH A;  2F4I A;  1NUC A;  2X6G A;  1JOK A;  2VB2 X;  1B44 D;  5CBA E;  1STH A;  5ELE A;  5JPN C;  4HSV A;  1ENF A;  4CJ0 B;  5CV7 A;  1J9O A;  4CGY B;  5EKK A;  3A54 A;  3D6C A;  3NSW A;  4QUF A;  5FK9 C;  1G29 1;  4K8I A;  3P20 A;  5COY A;  1IKM A;  2Q8I B;  3NXW A;  2A73 B;  3VR5 A;  2F0F A;  1WTR A;  5CC4 A;  2EJG C;  3GTG B;  2ID0 A;  3EJI A;  4ZKC B;  1D6E C;  1Q1E A;  5JEA H;  2EJM A;  3AB9 A;  3NTK A;  4I7Z C;  1EY7 A;  4PNY A;  2F1M A;  3LWU A;  1M8A A;  2F0E A;  3S1M B;  3KUP A;  1CZG A;  4RGN A;  2HUG A;  1SMY D;  1HUN A;  2SEB D;  1XYI A;  4IUV A;  1ICW A;  2F0N A;  4XTC S;  2TMP A;  2QDB A;  5BN4 A;  2KHS A;  2D2C C;  3A7A B;  4A3G B;  4RH6 A;  2QEJ C;  3S2H B;  1GHJ A;  2EYM A;  1PTO D;  2K04 A;  4DGZ A;  4IN3 A;  1PZJ D;  2KEE A;  4I65 A;  3D31 A;  1EOT A;  3R93 A;  2G9H D;  3F2U A;  2AQ1 B;  4HCE A;  2MP1 A;  4HCS A;  3PUY A;  2KCN A;  5IT9 L;  3ERO A;  2EE1 A;  1QB5 D;  1S5E D;  2XWB B;  2CHB D;  1LAB A;  1ILQ A;  1EEF D;  3E0J A;  5KYI A;  1G91 A;  4KY6 A;  5D14 A;  3R2T A;  3J7A V;  2XIW A;  1QOH A;  2JXM B;  2M2L A;  1SNP A;  2Q8R E;  4HAE A;  3OMC A;  1QNK A;  1SSO A;  2K32 A;  2KJX A;  2EVB A;  1IL8 A;  1E0B A;  4DK0 A;  2PO4 A;  1D2B A;  1SNO A;  3I73 A;  3VA7 A;  4A3B B;  4EQN A;  4H13 C;  2O5J C;  2Q8T A;  1F2M A;  1ZYR D;  4TSS A;  1ESR A;  2E74 C;  1F9R A;  5JVH 3;  4OIK A;  2NYZ D;  3HEJ A;  1A15 A;  3I8Z A;  2FHT A;  5A35 A;  3M4O B;  2NUC A;  1DON A;  3IKJ A;  2BDO A;  2HQE A;  4WFN 3;  4XIG S;  4J1M A;  1WTW A;  4IUN A;  5CGK A;  3SEB A;  2NTT A;  2BA1 A;  3J7Y W;  2C5C A;  1Q1B A;  2B8F A;  1RTN A;  4FXG C;  4PQX A;  4ZYS A;  3QG1 A;  1GUW A;  4HSP A;  1BQQ T;  1EZ6 A;  2MJ8 A;  5J39 A;  4ZLT F;  5CR3 A;  3RMH A;  3MXP A;  3ND8 A;  1JB3 A;  3K58 A;  1BDO A;  1LTB D;  2M00 A;  5M5X B;  1GUO A;  1GXD C;  4RHS A;  4ZUI A;  2JEB I;  4JBW A;  5C0X I;  1Y69 U;  1CHP D;  4FO2 A;  3NUC A;  5M3M B;  1I4R A;  4NW2 A;  1PRT F;  2NBF A;  2E2H B;  2RQX A;  1TWH B;  1HTP A;  3MZ5 A;  5I6W A;  2ZXP A;  2KCC A;  2B39 A;  4C1N I;  2IX0 A;  1Z47 A;  3CU7 A;  3K7A B;  3P1H A;  1PRT B;  2L55 A;  3NTI A;  4IUT A;  1I4P A;  1SXT A;  1TWC B;  2F0V A;  1IYU A;  3QOL A;  3NE5 B;  3PO3 B;  1YNN C;  2EYO A;  4R9W A;  5DEH A;  1JE4 A;  1DOL A;  4DK1 A;  4N9T A;  1B2T A;  3DHQ A;  1AN8 A;  3SXH A;  2EYH A;  2RDG A;  4RWS C;  1BCP D;  4KHZ A;  1CT1 D;  2V4D A;  5CBE E;  3P75 A;  2FJ2 A;  4S3S A;  2XNA C;  4FNF A;  3EFX D;  2B63 B;  1DYQ A;  2ICE C;  1UNS A;  4F88 A;  1SE4 A;  5FOB B;  4MHE A;  3J81 E;  4O1N A;  5T1I A;  1C8C A;  2RKS A;  2F3W A;  1V1O A;  2C9O A;  3FMC A;  5JPM C;  5C0X J;  5CV4 A;  1DM0 B;  1F9P A;  3H09 A;  5ISR A;  2L11 A;  5EPK A;  1STY A;  2KEC A;  5JJZ A;  3M7G A;  4FF1 A;  4IUR A;  1MGS A;  4CJ2 C;  1GHK A;  5KEE A;  1EY6 A;  2L9H A;  3HKZ B;  4KKT A;  5IGE A;  1BXT A;  1VCI A;  4K5V A;  3QOJ A;  1V1P B;  4Z9C B;  2NVT B;  1S5F D;  5EGT A;  2Y0S B;  3PV0 A;  2E2J B;  1JOQ A;  2JEA I;  1WD1 A;  2LKV A;  1EQV A;  1EY8 A;  4NDX A;  4ZQ3 A;  1X3P A;  3K59 A;  2E2D C;  4WRD A;  5ELB A;  3J7A F;  5I4D A;  2PYK A;  4L6T B;  1LTT D;  2DN8 A;  3N6R A;  1HFN A;  2D9U A;  5KNC A;  3BDL A;  2CW0 C;  1UUP A;  2RA4 A;  4B9X A;  3FDT A;  2PW5 A;  2NN6 G;  3SK5 A;  2L0C A;  3PIP 3;  1MD2 D;  1EZ8 A;  3T53 B;  1STN A;  3MFG A;  4BY7 B;  1H9S B;  4B08 A;  3D8G A;  1HTL D;  3Q0A A;  1EIG A;  4QIW B;  2FMM A;  1GOZ A;  5EJW A;  2XVS A;  5CMD A;  3RUZ A;  3A8K E;  2WII B;  1H9K A;  3KBX A;  4KN4 C;  4DAP A;  5C4Z A;  1TS4 A;  2QF7 A;  5LL6 X;  1STA A;  2JP1 A;  4RFB A;  2AQ2 B;  3IFT A;  1OXT A;  4QF4 A;  2IWH A;  1T5X D;  3K6O A;  1K8O A;  1B4O A;  1PRT C;  1Y1V B;  2R93 B;  3NP8 A;  5KGU A;  3PUV A;  3PMF A;  5C5L A;  3VYS A;  4RA8 A;  2LFN A;  3GTQ B;  1KNE A;  1CA5 A;  1HXY D;  1AZQ A;  2Z1C A;  1PYW D;  4KJN A;  1CM9 A;  5K36 G;  3FPP A;  4ILW A;  4C2M B;  3DWP A;  1PLF A;  3S2D B;  1NR4 A;  2F0I A;  1SE2 A;  4BA2 I;  2F0Q A;  2R61 A;  3GV6 A;  3I3C A;  4F87 A;  1PFN A;  1TS3 A;  1EEI D;  1SNQ A;  1STB A;  1Z6H A;  4IZ8 A;  2PZU A;  3VR6 A;  1H9J A;  4TRD A;  5FO8 B;  5M5W B;  5KRU A;  2VUM B;  5E1F A;  1R4P B;  3HOV B;  3P7J A;  3NPP A;  2OT2 A;  1LV9 A;  1EYD A;  3SE0 A;  1IHZ A;  5BN3 A;  4H7B A;  2EY1 A;  2F0D A;  3L3O C;  4IUQ A;  4DXF A;  2SNS A;  4ULL A;  2IT1 A;  1R4Q B;  2HCI A;  1EQT A;  1JR0 D;  1T5E A;  4KV6 A;  2K03 A;  3DWA A;  1Q3L A;  1A3T A;  1SYD A;  3DMU A;  3OW7 A;  4K14 A;  4R8N A;  1G2S A;  2FFK B;  3S16 B;  2B2W A;  3LWE A;  1LTR D;  3TZD A;  4K6D A;  1RJT A;  5C44 B;  1SNM A;  2IPK D;  1ET9 A;  5D65 A;  3L7Z C;  2G9D A;  1A2U A;  4NKL A;  3H3V C;  3HS0 C;  2HDL A;  2E76 C;  2OEO A;  1S5B D;  3IAY A;  1MSG A;  3TSS A;  4DXG A;  3GTL B;  4XT3 B;  1XXG A;  3VR3 A;  2NB0 A;  1D1I A;  2K5Q A;  5DM7 3;  4IFD I;  1NCV A;  1EWH A;  4A3I B;  1Z7T A;  1NAP A;  4XXE A;  3RZO B;  3I70 A;  3H6M A;  3BDO A;  1BCP F;  4F8M A;  4DAV A;  2HDM A;  1EY9 A;  1SMY C;  1SYC A;  2IJ0 A;  2NVY B;  2OXP A;  2CQA A;  2EYP A;  2K01 A;  2FIN B;  4HMJ A;  5EPL A;  1BCP B;  1FD7 D;  2WB1 B;  1AFP A;  1S5D D;  1PDQ A;  4DFA A;  2NN6 H;  3U9S A;  1ONL A;  4L63 B;  1HA6 A;  4PMB A;  2FMC A;  4KY7 A;  2B2V C;  2WKD A;  3TME A;  1VF5 C;  3KLS X;  4X3S A;  3LX0 A;  5CV6 A;  2F0G A;  3NBH A;  1I4X A;  3GTO B;  2GA4 B;  1K8M A;  2A68 C;  2SDF A;  1G2T A;  2A6H D;  4A93 B;  4C3H B;  1B9N A;  1FGB D;  2EZV A;  2RBM A;  1TVX A;  3QB3 A;  3K5M A;  3TP7 A;  5G3L F;  1CK1 A;  2WIN B;  3OWF A;  4K2K A;  2B2Y C;  2XRQ D;  2AQ3 B;  3J80 L;  3NQT A;  3I90 A;  3RD4 A;  3R8B A;  5E3F A;  2EYJ A;  1STG A;  1JIC A;  2I46 A;  2TSS A;  1EY0 A;  2EYL A;  4DF7 A;  5C3X A;  5FO7 B;  4ZKB B;  1RF2 D;  3MA2 B;  4ODG A;  5K36 H;  5IT9 E;  3GQB A;  4A3J B;  1HA5 A;  1V43 A;  2QCP X;  5C0X G;  1W6J A;  5I9P A;  2F0S A;  3S15 B;  1EU4 A;  1F77 A;  4BBS B;  4MIU A;  4J6H A;  1FNW A;  2M9V A;  3BYY B;  3TP5 A;  2AUJ D;  1LTA D;  3NWT A;  1YNJ D;  3V05 A;  4X3T A;  5K5P A;  2ENB A;  4OGQ C;  3M7N A;  4ZAI A;  1Y8P B;  4A3D B;  1TS5 A;  4RKB A;  4KD3 A;  3SK4 A;  2K6A A;  3J80 E;  4OHJ A;  2JA7 B;  3K5O A;  2EXZ A;  1BO0 A;  3GTK B;  3I4L A;  2B2V A;  4IUP A;  1GUS A;  4C3H G;  1MSH A;  1PMR A;  2EPB A;  3HP3 A;  1XX8 A;  3X3M A;  4Q0F A;  4A3F B;  5C4X B;  1KDC A;  1PTO H;  4PV1 C;  1YNN D;  3A55 A;  1ROD A;  3OIQ A;  5C3W A;  3KF8 A;  4BA1 I;  1KTK A;  1HRJ A;  1E2Z A;  2J4X A;  1LAC A;  3PO2 B;  2PW7 A;  2QIL A;  1KNA A;  5M5Y B;  1O7Z A;  1LO5 D;  1J8I A;  3VYR A;  3ONA B;  4FF3 A;  4B9W A;  3ND9 A;  3ZYY X;  2CVR A;  1ML0 D;  5M9O A;  2AUK A;  5DM6 3;  3QO2 A;  3QJY A;  3MC0 B;  3D6W A;  1DCZ A;  5IOD A;  2AWO A;  1PZI D;  1I6V C;  3CRK C;  5CV5 A;  3R2I A;  4RGM A;  1Q90 A;  2XN9 C;  2ZXR A;  4NP5 A;  2K1B A;  3FRP B;  1AEX A;  4RGT A;  1BCP C;  1IW7 C;  5J22 A;  4FF4 A;  2KED A;  2X6L A;  1F9Q A;  2R7Z B;  3OMG A;  4U67 3;  1NR2 A;  2BDN A;  3BS1 A;  4OIJ A;  5EKL A;  5EBD A;  1U4P A;  1VMP A;  2R3Z A;  1OO9 B;  1ZEQ X;  5M3F B;  5IGC A;  3V96 A;  3QIA A;  5IOC A;  1D5M C;  2WKC A;  2I07 B;  1K83 B;  4XQJ A;  4K2L A;  5D3D A;  1EY4 A;  3V2T A;  3DEO A;  1STE A;  1EFI D;  4DNT B;  5EPJ A;  1SYE A;  2F0U A;  1ZKO A;  4IUU A;  3GP7 A;  3OHX C;  4QUC A;  3PIO 3;  2MPM A;  3ERQ A;  1W6K A;  3MHB A;  1FNU A;  5EQ0 A;  1SEB D;  1B3A A;  1TS2 A;  3D4W A;  1F2Y A;  4F7X A;  2CW0 D;  3Q23 A;  4K6L A;  1TWA B;  3MVV A;  1MBY A;  2VNU D;  5I6Y A;  4YIJ A;  1DXM A;  1ENC A;  1M4V A;  4EQO A;  3Q22 A;  1SYG A;  1CA6 A;  1H9R A;  1ENA A;  1LT4 D;  1G6Z A;  2D62 A;  4RAU C;  4XYQ A;  1EY5 A;  1KDA A;  5FKA C;  1GUT A;  2EY2 A;  4A3E B;  4RCN A;  1U4R A;  2F0T A;  1PTO F;  4WOR A;  1RD9 D;  4KN7 C;  2F0H A;  2QKI C;  4X3U A;  4EQP A;  3NBI A;  1TWF B;  3MEH A;  1PZK D;  3FKI B;  2JSO A;  3GV3 A;  3KBG A;  4KMU C;  4QB4 A;  5C0X H;  4R8I A;  5FLX L;  1U4M A;  1L0Y B;  2K05 A;  1PTO B;  2BE5 D;  1CFM A;  3GTJ B;  2RDF A;  1O78 A;  2A6E C;  5KYL A;  5C4H A;  2IW3 A;  1VF7 A;  3T51 B;  2EY6 A;  1OXS C;  4FVM A;  1B50 A;  1D5X C;  2L1B A;  2KOL A;  1SE3 A;  2WP8 J;  4CHT B;  3HZX A;  3L9A X;  3EQL C;  1U9R A;  3JAM L;  5FO9 B;  3D3R A;  4FXK C;  2L5T A;  2BCO A;  3VYT A;  5JEA J;  3S14 B;  3FPU B;  2IX3 A;  1CQV A;  1QJO A;  1KLG D;  4TKO B;  1SAP A;  1ILP A;  3E6Z X;  4G57 A;  4FP5 D;  1EYA A;  1QIL A;  3RZD B;  3MAQ A;  1Y8N B;  1I4G A;  2RVL A;  5JVG 3;  2PCF B;  5I2Y A;  1U4L A;  4HED A;  4C3J B;  1WVL A;  2IX1 A;  5BN5 A;  1GUN A;  2JYO A;  1HPC A;  1TT2 A;  5HGT A;  4CKC A;  2A69 C;  3G6J B;  3DWQ A;  2K33 A;  1TWG B;  1EL0 A;  4X3K A;  2O4X A;  4KTA A;  4QCL A;  3HOW B;  2B2T C;  2R92 B;  1XWE A;  1VMC A;  1S4Z A;  4ZK9 B;  3T16 A;  3OWE B;  1CHQ D;  3C46 A;  4H44 C;  3H94 A;  1E2V A;  3GTM B;  2EJF C;  1UAP A;  3FEW X;  5I9O A;  3HGB A;  2LY7 A;  3NTH A;  3BVZ A;  4QMG A;  4IFD G;  4OL7 A;  3M3Y B;  4KI0 A;  3I4M B;  1SDF A;  4CJ1 B;  1BOS A;  1A3U A;  3HOX B;  2BA0 A;  2LMC B;  4G4K A;  3K5L A;  1AW7 A;  1F2Z A;  3GTP B;  2K28 A;  1ZXT A;  2NWG A;  5C5M A;  3CHB D;  3WOF A;  1A3V A;  3MWY W;  1Y1W B;  3TBI B;  3PUX A;  3K5N A;  3CQZ B;  2F0W A;  1EWC A;  3TP8 A;  4N9P A;  4ZUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...