4JOIC

Crystal structure of the human telomeric stn1-ten1 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
MLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords CST complex subunit STN1
total genus 28
structure length 118
sequence length 118
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15490 Ten1_2 Telomere-capping, CST complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4joiC00
3STBD 4LNQA 2VQFL 4GN5A 4A3KH 4QL5A 1WYDA 2Q2TA 1E3PA 1QUQB 1N33L 4JOIA 2HIXA 4IPCA 2MO0A 2UXBQ 3BZCA 2UU9Q 4X65Q 1VQ9A 3BU2A 3HKZG 4Y52H 2R93H 1JE5A 4Y7NH 1A0IA 2JA6H 2AHOB 2K5VA 2OTLA 3F2CA 1W3SA 4HJ7A 2WP8J 2N3SA 3WWVA 3CMEA 1YITA 2R92G 2ZTDA 3H15A 5IYDH 4LF8L 5IP7H 3HOVG 4A3IH 4C2MH 4LFCQ 3HOWH 2JA7H 4A3KG 5M5WH 5ELNA 1WCMG 1XMQQ 2F4VL 1BKBA 4DR2L 4X64Q 2AKWB 5J3BA 1Z47A 4GNXB 4YWMA 4DR6L 4LF7L 3T1YQ 2QEXA 4R4QA 1SN8A 4RMFA 5C3EG 2Q2HA 4L5SA 1QVCA 3F8TA 3ULLA 3CCSA 4OX9Q 2PMZE 1VQKA 1O7IA 1X6OA 3HOVH 4O2DA 3RLOA 4HJ9A 3KOJA 4DV6L 1FGUA 4QJFA 5GAGC 3RLNA 4HJAA 1PA6A 5K36G 4GLVB 3E0EA 4DV3Q 3PUWA 5C0XJ 5IE8A 2VQEL 1PHJA 1G6PA 2E2IH 5IT9c 1K0RA 4B3MQ 2K4KA 2VY3A 4QGUA 4AQYL 3S16H 1SLJA 4IFDJ 3S24A 1TXYA 3A0JA 4R4IA 5GAEC 4A3LH 5JJKA 4LF9Q 1GKHA 4APVA 2H5XA 2D0PA 4UP8A 1KL9A 3OTOL 2VL6A 4B3SQ 2YTVA 3HOXG 2E5LL 2JQOA 1EUJA 1KD1C 2D0OA 3G48A 4YHHL 4FDBA 4JYAL 1JT8A 3CP0A 4LF8Q 2WFWA 4LW1A 1IBLL 4IFDI 2CCZA 1OXSC 3K7UC 4GN3B 4EX5A 1PH5A 4DV0Q 4KI0A 5E7NA 3TQYA 3CC4A 1YEZA 4JI5Q 4YCWA 4JI2Q 1A8VA 1XPUA 1WFQA 2JA8G 1VQ6A 1XNQQ 4JG2A 2OCEA 1LYLA 4JC0A 1LTLA 4IJLA 4P73A 1T9HA 1X56A 1J5EL 2JEAI 1K9MC 2UXDQ 2FXQA 3J80c 2ZM6L 1CUKA 3J7A5 1XTDA 4BBSH 3JAMi 4B3TL 4LUZA 1YJNA 4A3DG 5LMUQ 4A3CH 5IWAL 1NE3A 1VQOA 3S2HH 4KHPL 1XNRQ 4TVAB 3D0FA 3HKSA 3I7FA 2A8VA 2NVXH 4JV5Q 4JBWA 4B3RL 1BVSA 5C44G 4GLXA 3MXNB 1YBYA 4OONA 3UDGA 1C9OA 5BR8L 1R9TH 3UDIA 4JOIC 1KAWA 2F52A 2VQFQ 2BH8A 2I0QA 1XMOL 3GDEA 3PUYA 4DV5Q 1UE7A 1VCIA 1Y1VH 2K75A 4DNIA 3VDYA 4UP9A 1HZBA 4A76A 1K3RA 2PI2E 3J80i 3ULPA 2UXCL 3PSIA 1KIXA 2YU9H 5EAYA 4JI4L 4DAYB 1GVPA 3U4VA 2QA4A 3GTGH 3Q8DA 4LUOA 5ELOA 2YTXA 3RZOH 1I6HH 2NN6G 2R7FA 4DR3L 2JK8A 2LSSA 4LFCL 4JBMA 4A3FG 1CKMA 4A3EG 4NXML 5JEAJ 1SR3A 2AWOA 2WB1E 1Y1WH 4A3CG 2WAQG 2OQ0A 5GQOA 5FLMH 1YVCA 4C3JH 1J6QA 3HOUG 1VQIA 3CMAA 1NJIC 1K8GA 3OW2A 3GD7A 1EIFA 3I4NG 4GKJQ 1PH2A 5C44H 1U5KA 3J7ZC 3JC66 4YCUA 4DV4L 1PH4A 2VNUD 3A74A 1PH9A 3GTMH 5IYBG 4AIMA 3FHWA 1VQMA 3W5OA 4LUVA 1VQ4A 3CC7A 3J81j 3M7NA 4A3JG 1SE8A 1BBUA 4DV7Q 1PH6A 1IYJB 3IRBA 2MO1A 3M4QA 3M85A 2JA6G 3CCEA 5M3MG 3CCLA 1Y1WG 2PNHA 3ZJYC 1IL2A 4DR4Q 4WJ3M 4JI6L 4AYBE 1HNXL 2V1CC 2UU9L 3UDXA 2KENA 3GTJH 1MKHA 4HJ5A 2JJQA 2F4VQ 1N32Q 2HQLA 2ASBA 2VUMG 1AE3A 2BH2A 3TRZA 3GO5A 3KJOA 4A3IG 1OTCA 1UEBA 2JE6I 3FP9A 2KHJA 1N36Q 3PCOB 2DUDA 1FL0A 4EQ5A 3CCUA 1L1OA 1WJJA 1M90C 4IOAA 4JYAQ 1KXLA 1WCMH 1QZHA 2E2HH 1A63A 4A3JH 4OXPA 4UP7A 3CPFA 3KF6A 1KRSA 1NTGA 1HZ9A 4DR3Q 1K8AC 1N34Q 4BY1H 4DK3C 2K5HA 2KHIA 3KYHC 2L15A 1E24A 2B63H 1K73C 4A93G 1WOCA 2OTJA 2DGYA 4MZ9A 5LMNQ 4UY8C 2WAQE 4DK6C 2UUCQ 4L5TA 4LFAL 1SRUA 5FLMG 1YJWA 1ASYA 2IX0A 2MFIA 5M3FG 1A62A 3I4MH 2IT1A 4GNXA 1XPOA 4JI0Q 4BBSG 3DLLA 2IHFA 1EQRA 1HJPA 4JI3L 3F2DA 4P74A 5C0XG 2K5NA 3TEHB 1GD7A 2ZJRA 4NXNQ 2PQAA 3AFPA 1W2BA 1PH3A 1HNZQ 1LUZA 3J81c 2JA8H 1X3GA 3W1GA 4PG3A 4IPDA 3PUXA 2A19A 4AQYQ 1TWGH 1VQFA 2YYZA 4DV5L 3EIVA 3NENA 5JJLA 3PF4A 3PO2H 2N49A 4LF4Q 3KF8B 4BBRG 2WB1G 1E22A 4K0KL 4JI8Q 4OWTB 5GAHC 1EOVA 2K14A 1MJEA 1HR0L 1SMXA 4DV1Q 1B7YB 2CWPA 1N34L 2BA0A 1EFWA 3FKIH 3K80C 1FJGQ 1YNXA 3I56A 2E8GA 3J81i 3I55A 4HIOA 3CCMA 4B3RQ 4MTNA 4A3FH 4DR5Q 4DR1Q 1Y1VG 2C35B 4GOPC 1U0LA 1MIUA 2VQEQ 5LMNL 4LF7Q 1G51A 4LWCA 4O0AA 3PO3H 1YZ6A 4OO1G 1IXRA 4ME3A 3G4SA 4JBJA 3S1RH 1GM5A 4PZ6A 4JI7L 2HT1A 2KBNA 1E7ZA 3TS2A 5IP9H 4TQUS 4B3SL 2OWOA 4JI3Q 3A5UA 3S1NH 1OXVA 3M4PA 2D62A 3BZKA 4IJHA 4YCVA 4YWLA 5JEAG 2ZJQA 3KLWA 5BR8Q 4A3DH 4C3HH 5HY6A 1VQPA 4HIDA 1N8RC 1IBKQ 1HNXQ 1KHIA 4P75A 1VS0A 3HOUH 1AE2A 4R4CA 3ULJA 1Q8KA 4A3MG 5IP7G 1I3QH 1HH2P 1JMCA 4DUZQ 4DAMA 4C3IH 2EIFA 4GS3A 1P16A 2R6GA 4JCVE 4HJ8A 1N9WA 2CWAA 1BBWA 1QVFA 4BXXG 1OXXK 1V9PA 2ALYB 4YY3Q 5IYCG 2Z0SA 1HZAA 3CCVA 4HIKA 3KDFA 4A3GG 2RHQB 1YJ9A 2K52A 2HHHQ 1V1QA 2JA9A 1VQ7A 1YHAA 4DV6Q 4LF5Q 1QUQA 4LFBL 3PIOA 4DR1L 1I5FA 1HNWL 2E2JH 1TWCH 4XTCS 1Q1BA 4R4OA 3UDFA 4GLAC 3L2PA 1N33Q 4A3BG 2PQAB 1L0WA 3HOXH 1PH7A 4GKKL 5LMUL 1JJ2A 1Q81C 2IY5B 3M3YH 1XNRL 3OTOQ 3HOYH 4NPSA 1C0AA 1CSPA 1IBMQ 4QQBX 4YHHQ 2XTIA 2VW9A 2MQHA 3K0XA 4POGA 2ATWA 1TWFH 4HIMA 4X65L 1IBKL 3PIPA 2B29A 3G6EA 2A1AA 4JI5L 4JI1L 4DR2Q 4GNXC 1S72A 1PVOA 4BY1G 2YTYA 2UXCQ 4IO9A 1OXUA 2VZAA 1NMFA 2I5MX 3AQQA 4A75A 3PF5A 4LF6L 4K0KQ 3I4MG 3T1HQ 1V43A 3K8AA 4GOPB 1IBLQ 1Q86C 3PUZA 3I2ZA 5IYDG 5FLXc 4BY7H 2NVTH 1Z9FA 3JAMc 2Y0SG 1JJCB 3U50C 1XNQL 3E9HA 4DV3L 3K7AH 2JA7G 3HOWG 4X66Q 3NELA 1J5EQ 2UXDL 2HIVA 2UUCL 2GVBA 4GKJL 4DUYL 2GVAA 3ER0A 2CQOA 4RG1A 2RCNA 3S1MH 2PI2A 3CXCA 1SFOH 1Q82C 2GN5A 1CKOA 1M1KC 3BJUA 3D31A 1YI2A 2E5LQ 3KFUA 2QGQA 5IYBH 3CCRA 4A3EH 1PV4A 1N36L 2R7ZH 2CKZB 1TWHH 1MJCA 4OO1I 2KCTA 3H0GH 2Q2IA 2OQKA 4DV1L 2ZJPA 1CKNA 3I4OA 4QY7A 5M3MH 4NXMQ 1P8LA 3TREA 3H3VH 4LF4L 5C3EH 1EIYB 2YV5A 1GO3E 3HFZB 4A3LG 5HGQA 4PMWA 1H95A 4GOPA 1I50H 4OWWB 4B3TQ 1TWAH 3DM3A 1E1TA 1LM0A 3PGZA 5FJ8H 1RL2A 2IHEA 3PUVA 4PZ7A 3KF6B 3K81C 4DV7L 1UE1A 3RZDH 1B8AA 4MNOA 3CC2A 2R93G 3RNUA 3T1YL 2JA5G 4J15A 4POFA 4P72A 1HNZL 2VUMH 3MEFA 3HKZE 1XMOQ 5IP9G 4B3ML 3OYYA 3EN2A 1XPRA 3E9IA 4DV2Q 3CD6A 1CKNB 1PH1A 4OWXB 4A3BH 4JI0L 1VQHA 4DR7Q 1FVIA 1VQDA 3PO3G 4JI4Q 3A5ZB 4XIGS 3EBEA 5GROA 1D8LA 5DLQE 2UUBQ 3CAMA 1JJGA 1X54A 3L7ZC 2JEBI 2CFMA 1Y14B 4PZ8A 3GTPH 3H3VI 1VQ5A 3AFQA 3S17H 3SGIA 4DV0L 2KCMA 2UUAL 2NVYH 3STBC 4JI1Q 3W1BA 4IOCA 4DKAC 1EYGA 4LF5L 4A4IA 5M5XH 5C4JH 1SROA 3GTKH 4DUZL 4DR6Q 4X62L 5M3FH 4A3GH 1VQGA 2N8NA 3PO2G 4YY3L 2AMCB 5C4XH 1UWVA 4L5RC 3HOYG 1VQAA 2ES2A 5IWAQ 4JI7Q 3I4NH 1L2FA 3CCQA 3RN5A 1FJGL 1XMQL 4BY7G 4ALPA 2NVQH 3GTLH 5M5YH 1UE5A 1HZCA 2IX1A 4IPGA 4NXNL 1PH8A 4DR4L 4JBKA 4LFAQ 2UXBL 2I5HA 4JI6Q 2BA1A 4IPHA 4DV4Q 1DGSA 1VQJA 4GKKQ 4BA1I 3CCJA 1VQEA 1NBWA 1NY4A 3PV0A 3CF5A 4LF9L 1KC8C 3NEMA 1Q1EA 1X65A 1YHQA 2NZOA 4IFDG 4QIWE 5AJ3Q 3G71A 1C7YA 2UUBL 3S1QH 4AYBG 1VQLA 1CSQA 2N78A 3F1ZA 3GTOH 1PYSB 3LGJA 4GN4B 1VQCA 2LXJA 2EQSA 4X64L 3U4ZA 2MNAA 2ZTEA 4H02A 3ICEA 2Y0SE 2Z6KA 4DR5L 1XJVA 1I94L 1RIPA 2ZTCA 3S15H 5C4XG 4JI8L 4X62Q 4A3MH 2ID0A 3FKIG 4R1JA 3KJPA 5LMNW 3L0OA 1YIJA 4LF6Q 1KRTA 3F2BA 4DPGA 1HR0Q 4OX9L 1NMGA 3GTQH 3KDFB 3RR5A 3NBHB 5C0XI 2Q2UA 2AWNA 1HR0W 2Z6KC 4JI2L 3S2DH 1QVGA 5JJIA 1IZ6A 5GADC 1ASZA 1L1OC 4X66L 1WI5A 1Q46A 1Q7YC 1JB7A 1VQNA 1HNWQ 2RF4A 4L5QA 4DUYQ 2R7DA 3CQZH 1VQ8A 3AEVA 2R7ZG 3S14H 2JA5H 1X9NA 4DV2L 1N32L 1G291 2RHSB 5IYCH 1D7QA 4BXXH 3H0GG 1VQBA 4KHZA 2F3IA 1X3EA 5FJ8G 3M4OH 3HOZH 4R4TA 1IBML 5AJ3L 3M9BA 3UE0A 4A93H 2I5LX 1X3FA 5IY0A 1KQSA 2B63G 1QZGA 4BBRH 4KLKA 4AH6A 1UE6A 2NZHA 3CW2C 1PYBA 1S3OA 2R92H 1YHBA 1X55A 3B6YA 3AYHB 2HHHL 1EWIA 4NB3A 2UUAQ 4X6AH 1E1OA 2B3GA 1B70B 2K50A 1EQQA 4LFBQ 1Q12A 1I94Q 3RN2A 4WJ4A 1AH9A 1PFSA 4BA2I 2EXDA 4UPAA 5H1SE 2ZM6Q 4YWKA 3T1HL 3CPWA 1L1OB 1K83H 2VS1A 1S40A 3HOZG 3ERSX 3RLFA 3TS0A 3UE1A 4KHPQ 1OXTA 2LXKA 4P71A 4DR7L 4JV5L 2XGTA 3U58A 2NN6I
chains in the Genus database with same CATH superfamily
1YNJD 4KN7C 1E3PA 3HOWB 3G6JB 2MO0A 3J7AV 1VQ9A 3HKZG 2EY5A 1YNNC 2EYFA 2L5TA 2R93H 1R4PB 1IW7D 5IODA 3WWVA 5CYUA 1YITA 3CKIB 1PRTC 2KJXA 5EKKA 2EVBA 3NSWA 3P7JA 3HOWH 1GOZA 4R8NA 4A3KG 4FXGC 1B44D 3GTKB 3S9WA 4X64Q 4RGOS 1Z7TA 2BCOA 1STAA 2QW7A 4YWMA 4DR6L 3A54A 2KQ3A 1BUVT 3VR2A 3TSSA 4EQPA 5DNFA 2OXPA 4RMFA 1CQFA 3CCSA 3RLOA 1K8OA 4CHTB 1C8CA 1DD2A 2Z1CA 3E0EA 1IL8A 5C0XJ 3VA7A 2VQEL 1BDOA 3I73A 4JPBW 1K0RA 1SLJA 3GP7A 5FOBB 2AUJD 1F2ZA 3OTOL 3P75A 2L9HA 3G48A 4YHHL 4KY6A 4A3KB 1JT8A 3CP0A 1SYDA 4CGYB 1IBLL 3S17B 4IFDI 4GN3B 4EX5A 2OT2A 5E7NA 3TQYA 3TP7A 3A8IE 2JA8G 2QF7A 1A3VA 1LTLA 4P73A 1R9TB 2JEAI 2NTSA 1CUKA 4B3TL 2JSOA 3HEJA 2F0PA 5IWAL 1VQOA 3RD4A 1XNRQ 1DJRD 4TVAB 3D0FA 3HKSA 3I7FA 3PO2B 2NVXH 4DNRB 3SXHA 1BVSA 3QR8A 4GLXA 1YBYA 1T5XD 2K03A 3R8BA 1C9OA 1XXGA 1R9TH 3UDIA 1KAWA 2EPBA 3PUYA 3Q0AA 1WD1A 2O2LD 3A56A 4A76A 2UXCL 1KIXA 2YU9H 2VB3X 4KN4C 5FO7B 2QA4A 2SDFA 5ELOA 3RZOH 2Z6BA 1II3A 1CKMA 4KD4A 1NSNS 4NXML 5JEAJ 1RD9D 4CBVA 2EY2A 2EZVA 1HUNA 5FLMH 3I90A 5A2QL 1GJXA 3GD7A 1DZ1A 2VNUD 4DV4L 5C4XB 3GTMH 5IYBG 1VQMA 4IALA 4LUVA 4OIKA 1BBUA 5EKIA 1IYJB 2JA6G 1DXMA 1ET9A 1SDFA 3ZJYC 1Y1WG 2F0GA 4AYBE 2UU9L 3UDXA 1VDZA 2KENA 1SAPA 4HJ5A 2JJQA 1G2SA 1E0BA 2BH2A 3TRZA 3GO5A 3KJOA 4A3IG 3OIQA 1UEBA 2KHJA 4KMUC 2DUDA 3CCUA 1L1OA 1KXLA 2X6GA 4UP7A 1KRSA 1SFOB 2K5HA 5D3DA 5TSSA 2B63H 2F3WA 4HTHA 1SJHD 4YIJA 3P1HA 1EY9A 4L5TA 1JICA 1H9RA 2RA4A 4BBSB 4LJZC 2NBFA 2IT1A 4IUQA 4U673 4BBSG 1HJPA 2A5HA 4JI3L 4P74A 2HCIA 4IZ8A 1HXYD 1NUCA 1M4VA 3AFPA 1AN8A 3J81c 1UNSA 4PG3A 3JAME 4AQYQ 2YYZA 4K6LA 3NENA 3TP8A 3T56B 5G3LD 2N49A 2X6LA 4K0KL 3J7YW 5FLXL 2MP1A 4A3MB 4BBRB 1HR0L 2A68D 2BA0A 3FKIH 3IKJA 2N88A 1TT2A 3J81i 3I55A 4L8JA 2D9UA 1TU2B 1Y1VG 5BN4A 1G51A 4LWCA 1U4LA 1K0SA 1K83B 1LTRD 3S1RH 4PZ6A 4JI7L 2KBNA 5IP9H 2PYKA 3M4PA 2B8FA 1QNUA 3KLWA 4CJ2C 4C1NI 2IJ0A 1VQPA 3VYUA 4HIDA 1ESRA 3SE0A 1IBKQ 1KHIA 3H94A 1AFPA 4R4CA 3ULJA 1Q8KA 2DY7A 4DAMA 2WINB 2EIFA 1QB5D 3HGBA 4C3IH 1P16A 3T16A 4HJ8A 2CWAA 1SXTA 2E2HB 1OXXK 3CCVA 5JEAH 1Y1VB 4A3GG 1YHAA 3L9AX 1QUQA 3S2DB 1CTMA 4C3IB 1I5FA 4RGNA 4FF4A 1N33Q 4GLAC 1SJED 3L2PA 2PQAB 3KBGA 1JJ2A 1Q81C 1Q3LA 3QJYA 1L0YB 2ICIA 2PQEA 2NZ1D 2ZXRA 2XTIA 2VW9A 2MQHA 3FRPB 4POGA 4F8MA 1TWGB 2F0HA 4DF7A 1IBKL 3MWYW 2B29A 3PIPA 3NTIA 1S72A 1PVOA 4BY1G 1OXUA 3OHXC 3PF5A 1KLUD 5IGCA 3CQZB 1IBLQ 1Q86C 5FLXc 3K5MA 3DHQA 3MVVA 2JYOA 4A3EB 1E2VA 1TS3A 5E1FA 4DUYL 2GVAA 3ER0A 3KF8A 2BDNA 3CXCA 1D5MC 3X3NA 2GN5A 1BO0A 5JJZA 1N36L 4A3EH 4I65A 1MJCA 3D3RA 2OQKA 2Q8IB 5FO9B 2RKSA 3H3VC 4NXMQ 1P8LA 3TREA 1H9SA 3VYSA 2LY7A 2FHTA 2Z8LA 2VUMB 2LFNA 2RVLA 1I50H 4G7OC 3AMUA 2XRSD 3S2HB 4PZ7A 3VYTA 4G7ZC 4DV7L 3RZDH 4C3JB 3CC2A 1DYQA 3RNUA 1EZ6A 3MTSA 1LTGD 4DK1A 5I6WA 2JA5G 2PZWA 4POFA 2VUMH 1XMOQ 1RODA 5IP9G 4ZUJA 4S3SA 4Z9CB 4DV2Q 2TMPA 3CD6A 4LMQD 4OWXB 4JI0L 1FVIA 2SNSA 2K32A 4XIGS 2UUBQ 1D5ZC 1JJGA 5I9OA 2EYOA 1BQQT 1LV9A 3AFQA 3S17H 3SGIA 4ME5A 2KCMA 5M9OA 4IOCA 3W1BA 2K28A 1EYGA 4A4IA 5M5XH 1SROA 1STHA 3RMHA 1AP0A 3CRLC 3Q6SA 1MSHA 3C1EA 5M3FH 3LWEA 4X3KA 1STEA 4YY3L 4L5RC 2ES2A 1TR5A 2LS01 5DM73 3RN5A 1JWSD 2X69A 2NVXB 1EFID 4RAUC 5FK9C 3WDNA 3BZDB 1TS5A 3SR1A 1PH8A 4DR4L 2UXBL 4IUNA 2BA1A 4IPHA 4DV4Q 1DGSA 4JI6Q 5EJWA 4XXEA 4OGQC 4IUUA 3F2UA 1HQRD 5CV8A 4IURA 2ENBA 2F0UA 3MEHA 3MHBA 3PIO3 3G71A 1KDAA 3S1QH 1SMYC 1PYSB 4GN4B 4O42A 1VQCA 3LX0A 1PRTB 2EQSA 2IX3A 2Z4HA 4X64L 2ZTEA 1RCVD 5KGUA 1JOQA 1JE4A 5LMNW 2DJFC 1SYFA 4K8JA 1KRTA 1BCPB 1WTWA 1HR0W 2XNAC 2LMCB 3TZUA 1IZ6A 5GADC 4X66L 3OOCA 4L5QA 5IOCA 4N9PA 4DXGA 2PW7A 5IT9L 4DV2L 5CORA 5IYCH 3R2TA 3MZ5A 1Y8PB 1XYIA 4BXXH 1JB3A 4I7ZC 4AYBB 3HOZH 4NMZA 1SNQA 4Q5VA 4OEMB 5EBDA 1BBXC 2KCNA 1UE6A 1PYBA 4CDEC 1EY6A 2UUAQ 2B63B 4X6AH 4NKLA 2CW0D 2B3GA 1TY0A 2RSNA 5JAVA 1EQQA 3HOZB 1AH9A 2EXDA 4G4KA 1ML0D 1ET6A 4PMBA 3T1HL 3CPWA 3GTJB 3TS0A 3RLFA 3UI2A 4KHPQ 3V2TA 3E3XA 1O80A 5EPKA 3ZYYX 2K1BA 4LNQA 3HKZB 4A3KH 1PMRA 1WYDA 2K33A 1LABA 4TKOB 2Q2TA 1N33L 2HIXA 4IPCA 2UXBQ 3BZCA 1PTOD 4X65Q 3BU2A 2VXWA 4HSPA 1A0IA 1F2YA 2AHOB 2K5VA 2OTLA 2EYMA 3QB3A 1MBYA 2N3SA 2K6AA 2CW0C 2L1BA 3HZXA 2ZT9C 5ELNA 1BKBA 4GNXB 3BVZA 4LF7L 2EJGC 5C5MA 2L0CA 1FNWA 2QEXA 4R4QA 5J22A 1R4QB 3R93A 3F8TA 3ULLA 1SYEA 2HCCA 1VQKA 2KCCA 2JN4A 3KOJA 2GA4B 4QJFA 4DV3Q 1G6PA 2E2IH 5IT9c 3QIAA 2K5DA 2K4KA 4QGUA 4AQYL 3S16H 3HG9A 4FXDA 2WB1B 5GAEC 4X3UA 4LF9Q 5KYLA 2D0PA 1KL9A 3U9OA 2E5LL 3GQBA 1B1ZA 4JYAL 2D0OA 3OMCA 3BDLA 3S1QB 3O13A 2WFWA 4LW1A 1B50A 3S14B 4WFN3 3DEOA 4DV0Q 5ELBA 1F2MA 1UEAB 1A8VA 3NWTA 1XPUA 1VQ6A 1U4MA 2OCEA 1NCVA 4IJLA 2UXDQ 1O7LA 1X56A 1K9MC 2F0LA 3J80c 3J7A5 4B9WA 4LUZA 4X3SA 5I2YA 5LMUQ 4J8QA 1AZQA 4KHPL 2A8VA 3DWPA 4JBWA 4B3RL 5C44G 3NWSA 3UDGA 3MXNB 2F52A 1EU3A 2DY8A 2L55A 2EE1A 4DV5Q 1VCIA 3U9SA 2JP1A 3VDYA 1GUOA 1HZBA 1KABA 5EAYA 3U4VA 1BXTA 2YTXA 2NN6G 1QE6A 3KLSX 1IKMA 4DR3L 2JK8A 5F2DA 4A3FG 1SMYD 1SR3A 2WB1E 3H91A 5GQOA 1B4OA 3CMAA 3OW2A 3I4NG 1EIFA 1HUMA 5C44H 1U5KA 1PH4A 1PZJD 4OELB 1Y69U 3KLSA 4QMGA 3NP8A 5T1IA 1VQ4A 4M1UB 4A3JG 1SE8A 4DV7Q 4OHJA 3M4QA 2A6EC 3BYYB 5DEHA 3M85A 3CCEA 3K5NA 3CCLA 4DR4Q 2EYJA 2PNHA 4A3JB 3C3LA 4JI6L 2O5IC 2A73B 1KLGD 2XIWA 2HQLA 1AE3A 1W6KA 1OTCA 2JE6I 3PCOB 1FL0A 1WJJA 1M90C 4JYAQ 4A3JH 4OXPA 3GV6A 3KF6A 4DR3Q 1K73C 4NP5A 2OTJA 3TN2A 1JOOA 3RZDB 1QWYA 1SE3A 3BDCA 4DK6C 2PZUA 3V05A 1YJWA 4ZQ3A 2J4XA 3N52A 1K8MA 2B2WC 5C3EB 4BS9A 2XWJB 4LAAA 5C0XG 1GD7A 4B08A 1EOTA 1F9QA 4NXNQ 1W2BA 1HNZQ 1DOKA 1LUZA 3W1GA 2FFKB 4IPDA 1JWMD 4DV5L 3VR3A 5K5PA 3PF4A 1HFGA 4LF4Q 4BBRG 1E22A 1LTID 1I4PA 3D8GA 1MJEA 2B2YA 1SMXA 2CWPA 1TVXA 3K80C 5I9PA 2F0FA 1A15A 1LTBD 1PFBA 4JW0A 3S1NB 5EPJA 1V1OA 1EQTA 4MTNA 3EQLC 1STGA 2C35B 2VQEQ 1U4PA 5G3LF 3DXJC 4O0AA 3GTGB 2F0TA 2F0OA 2KEDA 4JBJA 5CC4A 1GM5A 1RJTA 2HT1A 4N8FA 2ZXPA 5ELDA 3A5UA 4JI3Q 3S1NH 3BZKA 3EA6A 4IJHA 3T4AC 4ZLTF 5JEAG 2TSSA 4A3DH 2QEJC 1RTOA 4FVMA 3K6OA 3J80L 4P75A 1CK1A 3M4YA 5FLXE 5IP7G 1HH2P 1G8ZD 1B3AA 4JCVE 2PO4A 1QVFA 3K0YA 4A3GB 5KEEA 1V9PA 4YY3Q 1FYCA 1HFNA 2Z0SA 1FNUA 4XQNA 1D1IA 2A6ED 2I07B 2F0VA 2K52A 1VQ7A 4LF5Q 1SSOA 2N55A 1HNWL 2E2JH 1Q1BA 2MHVA 4GKKL 4A3BG 1PLFA 5ELFA 5K36H 4KV6A 1CA6A 1JOKA 3LNNA 5IGEA 1H9KA 3HOYH 2B2UC 3FEWX 1C0AA 3K0XA 4O1NA 2IWHA 1LTSD 1LT6D 4EQOA 2ATWA 4X65L 1E2ZA 3G6EA 1Y8NB 3IFTA 1RHPA 3ND9A 2B2TC 2UXCQ 1EY5A 4JK1C 1W6JA 2VZAA 1NMFA 1I4HA 4LF6L 3EROA 3I4MG 4GOPB 5IYDG 4XQQA 1SNMA 4FP5D 1Z9FA 3JAMc 1YNJC 2Y0SG 4KTAA 3HOWG 3U50C 2JA7G 3K7AH 1EU4A 3C46A 2UUCL 2GVBA 4GKJL 1CFMA 2CQOA 2RCNA 5C3XA 3Q22A 3S1MH 1Z6HA 1SFOH 2XVSA 1JCKB 2I46A 1M1KC 1YI2A 5IT9E 4IQZA 2QGQA 3CCRA 1QILA 2CKZB 2H4OA 2KCTA 2Q2IA 2Q8RE 2ZJPA 1CKNA 3D4WA 1D6EC 5M3MH 5C4ZA 4R9WA 1HA5A 1K28A 1XX8A 1EIYB 3HFZB 4PMWA 3Q23A 1B53A 4OWWB 1VF5C 4RCOA 1TWAH 2SEBD 1RL2A 2MJ8A 2IHEA 4KD3A 4QB4A 1QG7A 5C6AA 3KF6B 1SYGA 4HEDA 2QCPX 3K81C 2QDBA 4MNOA 1KAAA 3I8ZA 4A93B 3I4LA 4P72A 3MEFA 3EN2A 3S16B 2JA5B 1T5EA 4ZKCB 2QKIC 1CKNB 1NAPA 1HQMC 4DR7Q 1VQDA 5EQ0A 4N8X1 3T53B 3DUZA 1FD7D 5GROA 5DLQE 3CAMA 3BVGA 5E3FA 2JEBI 1H9JA 4RA8A 3OSOA 2B39A 2UUAL 2NVYH 3STBC 4IUTA 2CHBD 4DUZL 4DR6Q 2PZTA 4A3GH 2AMCB 5C4XH 3HOYG 1VQAA 5IWAQ 4JI7Q 2NN6H 1FJGL 5J39A 3IFDA 2NVQH 2B2UA 2IX1A 4IPGA 4NXNL 3TDQA 3OPOA 3GTOB 5KYIA 4BA1I 3E5SA 3K58A 1VQEA 1NY4A 4KKUA 1Q1EA 4CKEA 1NR2A 5AJ3Q 3VR4A 2B2TA 2BDOA 2CH4W 1C7YA 2UUBL 3GTOH 4FF3A 2MNAA 1EIHA 5EGTA 3S15H 1RIPA 1YIJA 1UUPA 3FKIG 4R1JA 3F2BA 4ZAIA 1HR0Q 3WOEA 2H1EA 5ELCA 4JI2L 1QVGA 1OO9B 1L1OC 1ONLA 1VQNA 1Q46A 2RF4A 1VQ8A 3CQZH 4CJ0B 2R7ZG 1F9SA 2QDLA 5KIXA 5CV5A 1X9NA 3NQTA 1N32L 1G291 1D7QA 1L0XB 4KHZA 3R2IA 5DM63 5J1ZA 5M5YB 1IBML 5AJ3L 3NUCA 3M9BA 1O78A 1X3FA 1KQSA 4JVZA 4TRDA 4U68A 5I4DA 4BBRH 2B63G 1F9PA 1SYBA 3AB9A 1PDQA 1IYUA 3NTHA 4NB3A 2IPKD 2AUKA 1E1OA 3DM1A 3HS0C 1LTTD 2DJGC 1SEBD 5M3FB 4UPAA 1KNAA 5H1SE 2ZM6Q 3MFYA 1TWAB 4DGZA 1L1OB 1K83H 2VS1A 3HOZG 5CV9A 3UE1A 3S1RB 1OXTA 1NNXA 4PMCA 1F77A 1MHWC 1G2TA 4GN5A 2KOLA 1QUQB 3T51B 2UU9Q 3I70A 4Y52H 3E6ZX 1JE5A 2JA6H 2B2VA 4HJ7A 2FMMA 3K5OA 5A35A 4EQNA 2ZTDA 3H15A 5IYDH 2K5WA 3W2DA 4LF8L 5IP7H 1WCMB 2EDGA 2JA7H 3SVMA 1XMQQ 2EJMA 2B2VC 3QOJA 2F4VL 1HRJA 5J3BA 1Z47A 4DAPA 1B9NA 1SNPA 4K2KA 2JA8B 3LWUA 1SN8A 5C3EG 1BF4A 4J6HA 1X6OA 4O2DA 4ZUIA 2NVQB 4DV6L 1FGUA 1PA6A 3RLNA 2F3VA 5K36G 2L4NA 4WRDA 3H09A 3PUWA 5IE8A 1HPCA 3TP6A 3D6CA 4B3MQ 3QO2A 4R4IA 3A0JA 1H9SB 5CGKA 3HOXG 4H0LC 4NDXA 2EY1A 4KI0A 4JI5Q 1YEZA 4YCWA 1BOSA 4A3FB 1J5EL 1JORA 2KEEA 4C56C 2ZM6L 1RF2D 4CKBA 3KUPA 1YJNA 4A3DG 5M5WB 1ZKOA 3D6WA 3HOYB 1Q90A 1CQVA 1S5FD 1TIID 2KHSA 4OONA 4DFAA 3K57A 2SOBA 2VQFQ 1XMOL 3GDEA 4KY5A 1UE7A 3E0JA 4UP9A 2PI2E 3SDZA 1VMPA 3VA5A 2BE5D 3PSIA 4DAYB 2A69C 2KA7A 3VYRA 4LUOA 3FVQA 4HMJA 2R7FA 4JBMA 4A3EG 4C3IG 4HN7A 5KNBA 4HCSA 2OQ0A 4C3JH 1PYWD 2ICEC 4HCEA 1VQIA 1NJIC 1K8GA 1SBBB 3JC66 4YCUA 3OMGA 3A74A 4DAVA 1IYVA 5CBAE 4AIMA 1CT1D 3I4NB 3K59A 4KY7A 4IN3A 3CC7A 3M7NA 5CR3A 2F0EA 1PH6A 3DEPA 3IRBA 5C4HA 5M3MG 1HNXL 5C0XH 3GTJH 1MKHA 4RH6A 5M3MB 1JQYD 2F0QA 3FDTA 2VUMG 3FP9A 3C1FA 4EQ5A 1ENFA 1LO5D 1FNVA 4IOAA 1WCMH 2WKCA 1QZHA 1WTXA 3CPFA 1NTGA 4DK0A 5D3IB 4C3JG 1N34Q 4BY1H 1MSGA 4DK3C 2KHIA 4DNTB 5A2QE 2L15A 1E24A 3I91A 4A93G 2DGYA 2CVRA 2LKVA 5LMNQ 3C2PA 2Z9HA 2UUCQ 3G7LA 4LFAL 1SRUA 2B2YC 1ZYRD 5FLMG 5L37A 3I4MH 1XPOA 1BCPC 1WVLA 1EQRA 5IGFA 1ENAA 3F2DA 5FKAC 2B2WA 2K5NA 3TEHB 2FJ2A 2ZJRA 3KBXA 4ID6A 1DOLA 1X3GA 1LT3D 4J1MA 1PXUA 3PUXA 3MXGA 1VQFA 3EIVA 1C4QA 3PO2H 3NQIA 3KF8B 2L12A 1YNND 3IL8A 2WB1G 4JI8Q 2F0KA 5GAHC 1EOVA 4K5XA 4DV1Q 1B7YB 3DWQA 4UHVA 5BN3A 1N34L 1EFWA 1YNXA 1EWHA 1ZYRC 4CDFC 2EJFC 4P2CB 4A3FH 1KTKA 4DR1Q 1ILQA 4ULLA 3KK7A 4GOPC 4LF7Q 3A8JE 1STYA 3PO3H 1YZ6A 4OO1G 3ERQA 1IXRA 2QILA 3GTPB 4ME3A 1X32A 5LL6S 3TS2A 4ZK9B 1E7ZA 2DN8A 5JOBA 4A3BB 4G7HC 5COYA 4R8IA 4YCVA 2ZJQA 1J9OA 4YWLA 5BR8Q 2EY6A 1PTOC 2PW5A 2F0IA 1HNXQ 3GTMB 1VS0A 3URYA 1AE2A 5ISRA 5IGDA 4A3MG 3GTLB 3PIP3 1GUSA 2K05A 4DUZQ 1G91A 1ESFA 3S15B 4PNYA 1D2BA 2B8GA 1N9WA 1BBWA 1NR4A 2ALYB 4HSVA 1D1KA 1HZAA 2IW3A 4HIKA 3KDFA 2HHHQ 4F87A 2JA9A 1O7YA 4DV6Q 4F7XA 4IFDH 2MGSA 4XTCS 4BWGB 1PH7A 1TWFB 1MD2D 4MHEA 4DXFA 3M3YH 2F1MA 1XNRL 2E2DC 3HRZC 4NPSA 2A74C 1I4RA 2NUCA 4FF1A 1J8IA 1EWCA 1TWFH 2L11A 1SE4A 1JWUD 2A1AA 4JI5L 4DR2Q 1GUGA 2NWGA 2K5QA 2YTYA 5JPMC 3AQQA 2I5MX 1WTRA 1V43A 2A69D 1Q8IA 4BY7H 2V4DA 2O5JC 1CI3M 2NTTA 1RKNA 1FGBD 2R7ZB 1PFNA 4X66Q 1QJOA 2UXDL 4N9TA 1A2TA 1PTOH 2PI2A 2NVYB 2F03A 3CRKC 2A68C 1CKOA 2M00A 3D31A 5IYBH 1PV4A 2C5CA 2R7ZH 4OO1I 3H0GH 4KJOA 1IKLA 4HR7B 5KNDA 3I72A 5AFWA 1ICFB 1CA5A 2XRQD 1EY0A 5C3EH 3VR6A 2YU9B 2RSOA 4A3LG 5HGQA 1H95A 3RZOB 1DM0B 4GOPA 4B3TQ 2EYPA 3PGZA 2R93B 3J81L 4KK7A 4MTKA 3I3CA 2R93G 3T1YL 4J15A 1HNZL 3HKZE 1SNDA 3OYYA 1HA6A 1XPRA 5D65A 2PNRC 4XT1B 2NVTB 1PH1A 4Y7NB 3A7LA 4A3BH 1VQHA 3BDOA 5IGBA 3PO3G 3Q24A 4E6IA 4JI4Q 1Y8OB 2RCFA 3EBEA 4DU9A 5EBCA 1LACA 1AZPA 2CFMA 1Y14B 4OL7A 5EKLA 2RQXA 4RGTA 4PV1C 4LF5L 1B2TA 1H9MA 3TP5A 1CZGA 1TS4A 1VQGA 2N8NA 3PO2G 3X3MA 1UWVA 4EGVA 4KKTA 4ZRZA 1L2FA 1XWEA 2HD3A 1F9RA 4ALPA 1GUWA 5M5YH 1HZCA 3MXPA 4XT3B 4DAYA 4JBKA 4LFAQ 2I5HA 1BCPD 3PV0A 4LF9L 3CU7A 1KC8C 1BR9A 3NEMA 1WTOA 1CHPD 1X65A 4IFDG 4KKSA 1STNA 1EYDA 2O4XA 2PCFB 1A6XA 2P5ZX 1S4ZA 1KNEA 3QG1A 5ELEA 2IL8A 3HOUB 2LXJA 1I3QB 3ICEA 2Z6KA 2NB0A 4DR5L 4CJ1B 1XJVA 2ZTCA 4XQJA 2ID0A 1HTPA 1EYCA 4A3MH 3L0OA 4V0BA 4BY7B 4OX9L 1PFMA 3GTQH 3KDFB 3NBHB 4K6DA 2Q2UA 5JJIA 2Z6KC 2K04A 4K5VA 1ILPA 4XYQA 2HDLA 1Q7YC 3WOFA 1HNWQ 5C5LA 1I50B 4DUYQ 3AEVA 3S14H 2JA7B 2WIIB 2JA5H 1AW7A 2C9OA 1S5DD 3MFGA 4ABNA 3RUZA 4QUFA 1VQBA 1C48A 2F3IA 3M4OH 1GXDC 3H0GB 2NZHA 3MC0B 1S3OA 2R92H 1YHBA 3MA2B 4DA2A 4MIUA 3B6YA 3S1MB 2HHHL 1B70B 2K50A 3VR5A 3RN2A 3M4OB 3N6RA 1CM9A 1JR0D 1TS2A 1GUNA 1V1PB 4YWKA 3ERSX 2BE5C 4KHVA 3ND8A 2HQEA 4OIJA 4P71A 1WTPA 2F0SA 3I4MB 4DR7L 3NPPA 2A6HC 2WV6D 3STBD 1S5ED 2VQFL 4QL5A 1I6VC 3KLRA 2RDHA 4JOIA 1BCPF 4C2MB 5KNCA 5BN5A 4Y7NH 3BG3A 3F2CA 1W3SA 2G9DA 2WP8J 2XWBB 3CMEA 2R92G 2SNMA 3D4DA 1QNKA 3SK8A 4L6TB 3HOVG 4A3IH 4C2MH 4LFCQ 3ITPA 5NUCA 4RGMA 5D14A 5M5WH 2OEOA 1MGSA 1WCMG 4DR2L 4RKLA 2AKWB 1ICWA 2FINB 2JXMB 3OWEB 2XN9C 4NW2A 3BYTB 5CV6A 1V8QA 3T1YQ 4UAIA 3DWAA 3TMEA 2Q2HA 4L5SA 1QVCA 4OX9Q 2PMZE 1O7IA 3HOVH 3SK6A 1EY7A 4HJ9A 3BVMA 5GAGC 4HJAA 3K5LA 1PZID 4GLVB 1SYCA 1TY2A 1ZXTA 4ZYSA 1PHJA 1EL0A 2VY3A 4IFDJ 3SHLA 3S24A 1TXYA 1HCZA 4A3LH 5JJKA 1GKHA 4APVA 2H5XA 4UP8A 5FO8B 4QUCA 2VL6A 4B3SQ 1G6ZA 2YTVA 3J81E 2JQOA 3QOLA 1EUJA 1HTLD 1KD1C 4FDBA 1QCBD 4LF8Q 1U9RA 1A2UA 4X3TA 1EYAA 2CCZA 1OXSC 3FMCA 3K7UC 1RTNA 1PH5A 3CC4A 4JI2Q 1WFQA 1XNQQ 5HURA 4JG2A 4JC0A 1EEFD 1LYLA 1T9HA 2FXQA 1XTDA 1KDCA 4RWSC 3JAMi 4BBSH 4A3CH 3GTQB 1NE3A 1JC7A 3S2HH 3QWNA 4JV5Q 2EXZA 5BR8L 1I6HB 4JOIC 2I0QA 4C3HB 2BH8A 1MI2A 2OF1A 2RBMA 3W3AA 2K7VA 4BY1B 1Y1VH 2K75A 4DNIA 2JA6B 1B9MA 3TZDA 2K01A 1K3RA 3J80i 3ULPA 4JI4L 1GVPA 3GTGH 3Q8DA 4K2LA 1I6HH 2EYHA 2LSSA 4LFCL 1XTCD 4XDXA 3NTKA 2AWOA 1Y1WH 4A3CG 2WAQG 4RHRA 1YVCA 4OO1H 1J6QA 3HOUG 4WJWA 4A3DB 5T1GA 2HDMA 1GHKA 1IW7C 4GKJQ 1SE2A 2WAQB 1PH2A 3J7ZC 1PH9A 2XSCA 3DMUA 3BS1A 3FHWA 1LTAD 4B9XA 3W5OA 3J81j 1Y1WB 2MO1A 1IL2A 4WJ3M 1I4QA 2DNEA 2V1CC 1PZKD 2F4VQ 1N32Q 2ASBA 2RDFA 3NHHA 2BOSA 3SEBA 5JPNC 2J0TD 3T13A 1N36Q 1A63A 2E2HH 4A3IB 4K14A 1K8AC 1HZ9A 3OIPA 3KYHC 2Q8TA 1WOCA 4MZ9A 2KVMA 2VB2X 3L3OC 4UY8C 2WAQE 1EIGA 4CDCC 1ASYA 3H6MA 2IX0A 2MFIA 4K5WA 5M3FG 1A62A 1A3TA 3J7AF 4GNXA 4JI0Q 3DLLA 2IHFA 4HMIA 1A3UA 5CMDA 3HP3A 5JVH3 4WORA 1TWHB 2PQAA 1PH3A 2JA8H 2R61A 2A19A 1TWGH 3CHBD 5JJLA 4G57A 3R3OA 1M8AA 2D2CC 3EVQA 4CDDC 3V96A 3K7AB 4OWTB 1LLRD 3A8KE 1PRTD 2K14A 2KUMA 3ONAB 4FNFA 1FJGQ 3I56A 2E8GA 4B3RQ 4HIOA 3CCMA 4DR5Q 3D4RA 1U0LA 1MIUA 5LMNL 4C1NK 1EQVA 1DONA 3A55A 4FO2A 3G4SA 3FPUB 1EEID 4TQUS 1SNOA 2OWOA 3P20A 4B3SL 2F0DA 1OXVA 2MUYA 2D62A 2FMCA 4C3HH 1X3QA 3GV3A 5C44B 5HY6A 1N8RC 1VF7A 4DN4M 1BNZA 3HOUH 2M2LA 1I4GA 5CV4A 1VMCA 1I3QH 1JMCA 1ENCA 4GS3A 2R6GA 1TWCB 4BXXG 5IYCG 3HOXB 1TKWB 2RHQB 1YJ9A 2F0NA 1DCZA 1DOMA 1V1QA 4RCNA 4RHSA 3NBHA 4LFBL 3PIOA 2EYLA 4DR1L 2WKDA 1TWCH 4R4OA 3UDFA 5E4WC 2RDGA 3NE5B 1L0WA 3HOXH 2EOTA 1O7ZA 5I2XA 2DNCA 5LMUL 5DAUA 2IY5B 2F0WA 3OTOQ 2AQ2B 1CSPA 1IBMQ 4QQBX 4YHHQ 2E2IB 4TSSA 3J80E 5I6YA 1KDBA 1WTQA 4HIMA 1WTVA 2J7ZA 2F0JA 1WTHA 4C3HG 1EY4A 4JI1L 1ZEQX 4GNXC 2WACA 4IO9A 5CBEE 4K0KQ 4A75A 3T1HQ 3K8AA 2E74C 3I2ZA 2Y0SB 3PUZA 2CH4A 2NVTH 4HAEA 1F2LA 1JJCB 1XNQL 3E9HA 3PQIA 4DV3L 1IHZA 1RDPD 3NELA 1J5EQ 1S5CD 2HIVA 2G5DA 4RG1A 5IGGA 4QIWB 4ILWA 3MAQA 1Q82C 2PMZB 2E5LQ 3BJUA 3KFUA 1TWHH 1HHVA 5EPLA 4DV1L 1EY8A 3I4OA 4QY7A 3H3VH 4KJNA 4LF4L 4QF4A 2YV5A 1GO3E 4GZYC 4ODGA 3AU7A 3DM3A 1E1TA 1GUTA 1LM0A 5FJ8H 2AQ1B 3PUVA 1GHJA 5KRUA 1UE1A 3EJIA 1FR3A 1B8AA 2M9VA 3FPPA 4B3ML 3E9IA 1I4XA 5C4JB 2E76C 2KECA 3A5ZB 1D8LA 2E2JB 3PO3B 1X54A 3L7ZC 4ZCKA 4PZ8A 2PPBC 4FF2A 3GTPH 2F0MA 1VQ5A 3H3VI 5LL6X 4DV0L 1UAPA 4IUPA 4UDUC 3IAYA 4JI1Q 3GTKH 4DKAC 1EZ8A 1TQOA 5C4JH 3NK9A 4Q0FA 4X62L 4FYDA 4H44C 4H7BA 4LK1C 3I4NH 3FKIB 3CCQA 1XMQL 2F4IA 2Z4IA 5HGTA 1U4RA 4BY7G 1AEXA 2E75C 3GTLH 1CZWA 1UE5A 4RKBA 4IUVA 1B3QA 1V1PA 4MN3A 1VQJA 4GKKQ 2G9HD 3CCJA 1NBWA 3CF5A 4FXKC 3SK4A 1YHQA 1D5XC 2NZOA 1CHQD 1K3BC 4QIWE 3M7GA 5JVG3 3NBIA 1S5BD 3MXNA 5IIFA 4AYBG 1WD0A 1CSQA 2N78A 3F1ZA 1VQLA 3LGJA 1LT4D 3OW7A 5LHY1 3M3YB 4XYOA 3U4ZA 4H02A 4PQXA 2Y0SE 5C4XG 1I94L 5E4XA 3EFXD 4JI8L 4I7AA 4X62Q 3KJPA 4LF6Q 5CV7A 4DPGA 4L63B 3SK5A 1NMGA 3RR5A 4M8AA 5C0XI 4V190 2AWNA 1E2WA 2D5DA 1X3PA 5M5XB 3S2DH 5C3WA 1ASZA 1WI5A 1JB7A 3OWFA 2R7DA 3MXUA 2A6HD 2R3ZA 3JAML 3TBIB 1PRTF 3A7AB 2RHSB 4ZKBB 3H0GG 1X3EA 5FJ8G 4R4TA 2MPMA 3UE0A 4A93H 2I5LX 5IY0A 1QZGA 4KLKA 1QOHA 4K8IA 4AH6A 2NYZD 3CW2C 1PTOB 1SNCA 4CKCA 1X55A 2AQ3B 3AYHB 1EWIA 3HOVB 2R92B 2CQAA 4RFBA 4LFBQ 1Q12A 1I94Q 2ZXOA 4WJ4A 1LT5D 1PFSA 4BA2I 4EVOA 2HUGA 1PTOF 1S40A 4H13C 2LXKA 4JV5L 2XGTA 3U58A 1STBA 4F88A 4QCLA 3PMFA 3NXWA 2NN6I
chains in the Genus database with same CATH topology
3STBD 4LNQA 2VQFL 4GN5A 4A3KH 4QL5A 1WYDA 2Q2TA 1E3PA 1QUQB 1N33L 4JOIA 2HIXA 4IPCA 2MO0A 2UXBQ 3BZCA 2UU9Q 4X65Q 1VQ9A 3BU2A 3HKZG 4Y52H 2R93H 1JE5A 4Y7NH 1A0IA 2JA6H 2AHOB 2K5VA 2OTLA 3F2CA 1W3SA 4HJ7A 2WP8J 2N3SA 3WWVA 3CMEA 1YITA 2R92G 2ZTDA 3H15A 5IYDH 4LF8L 5IP7H 3HOVG 4A3IH 4C2MH 4LFCQ 3HOWH 2JA7H 4A3KG 5M5WH 5ELNA 1WCMG 1XMQQ 2F4VL 1BKBA 4DR2L 4X64Q 2AKWB 5J3BA 1Z47A 4GNXB 4YWMA 4DR6L 4LF7L 3T1YQ 2QEXA 4R4QA 1SN8A 4RMFA 5C3EG 2Q2HA 4L5SA 1QVCA 3F8TA 3ULLA 3CCSA 4OX9Q 2PMZE 1VQKA 1O7IA 1X6OA 3HOVH 4O2DA 3RLOA 4HJ9A 3KOJA 4DV6L 1FGUA 4QJFA 5GAGC 3RLNA 4HJAA 1PA6A 5K36G 4GLVB 3E0EA 4DV3Q 3PUWA 5C0XJ 5IE8A 2VQEL 1PHJA 1G6PA 2E2IH 5IT9c 1K0RA 4B3MQ 2K4KA 2VY3A 4QGUA 4AQYL 3S16H 1SLJA 4IFDJ 3S24A 1TXYA 3A0JA 4R4IA 5GAEC 4A3LH 5JJKA 4LF9Q 1GKHA 4APVA 2H5XA 2D0PA 4UP8A 1KL9A 3OTOL 2VL6A 4B3SQ 2YTVA 3HOXG 2E5LL 2JQOA 1EUJA 1KD1C 2D0OA 3G48A 4YHHL 4FDBA 4JYAL 1JT8A 3CP0A 4LF8Q 2WFWA 4LW1A 1IBLL 4IFDI 2CCZA 1OXSC 3K7UC 4GN3B 4EX5A 1PH5A 4DV0Q 4KI0A 5E7NA 3TQYA 3CC4A 1YEZA 4JI5Q 4YCWA 4JI2Q 1A8VA 1XPUA 1WFQA 2JA8G 1VQ6A 1XNQQ 4JG2A 2OCEA 1LYLA 4JC0A 1LTLA 4IJLA 4P73A 1T9HA 1X56A 1J5EL 2JEAI 1K9MC 2UXDQ 2FXQA 3J80c 2ZM6L 1CUKA 3J7A5 1XTDA 4BBSH 3JAMi 4B3TL 4LUZA 1YJNA 4A3DG 5LMUQ 4A3CH 5IWAL 1NE3A 1VQOA 3S2HH 4KHPL 1XNRQ 4TVAB 3D0FA 3HKSA 3I7FA 2A8VA 2NVXH 4JV5Q 4JBWA 4B3RL 1BVSA 5C44G 4GLXA 3MXNB 1YBYA 4OONA 3UDGA 1C9OA 5BR8L 1R9TH 3UDIA 4JOIC 1KAWA 2F52A 2VQFQ 2BH8A 2I0QA 1XMOL 3GDEA 3PUYA 4DV5Q 1UE7A 1VCIA 1Y1VH 2K75A 4DNIA 3VDYA 4UP9A 1HZBA 4A76A 1K3RA 2PI2E 3J80i 3ULPA 2UXCL 3PSIA 1KIXA 2YU9H 5EAYA 4JI4L 4DAYB 1GVPA 3U4VA 2QA4A 3GTGH 3Q8DA 4LUOA 5ELOA 2YTXA 3RZOH 1I6HH 2NN6G 2R7FA 4DR3L 2JK8A 2LSSA 4LFCL 4JBMA 4A3FG 1CKMA 4A3EG 4NXML 5JEAJ 1SR3A 2AWOA 2WB1E 1Y1WH 4A3CG 2WAQG 2OQ0A 5GQOA 5FLMH 1YVCA 4C3JH 1J6QA 3HOUG 1VQIA 3CMAA 1NJIC 1K8GA 3OW2A 3GD7A 1EIFA 3I4NG 4GKJQ 1PH2A 5C44H 1U5KA 3J7ZC 3JC66 4YCUA 4DV4L 1PH4A 2VNUD 3A74A 1PH9A 3GTMH 5IYBG 4AIMA 3FHWA 1VQMA 3W5OA 4LUVA 1VQ4A 3CC7A 3J81j 3M7NA 4A3JG 1SE8A 1BBUA 4DV7Q 1PH6A 1IYJB 3IRBA 2MO1A 3M4QA 3M85A 2JA6G 3CCEA 5M3MG 3CCLA 1Y1WG 2PNHA 3ZJYC 1IL2A 4DR4Q 4WJ3M 4JI6L 4AYBE 1HNXL 2V1CC 2UU9L 3UDXA 2KENA 3GTJH 1MKHA 4HJ5A 2JJQA 2F4VQ 1N32Q 2HQLA 2ASBA 2VUMG 1AE3A 2BH2A 3TRZA 3GO5A 3KJOA 4A3IG 1OTCA 1UEBA 2JE6I 3FP9A 2KHJA 1N36Q 3PCOB 2DUDA 1FL0A 4EQ5A 3CCUA 1L1OA 1WJJA 1M90C 4IOAA 4JYAQ 1KXLA 1WCMH 1QZHA 2E2HH 1A63A 4A3JH 4OXPA 4UP7A 3CPFA 3KF6A 1KRSA 1NTGA 1HZ9A 4DR3Q 1K8AC 1N34Q 4BY1H 4DK3C 2K5HA 2KHIA 3KYHC 2L15A 1E24A 2B63H 1K73C 4A93G 1WOCA 2OTJA 2DGYA 4MZ9A 5LMNQ 4UY8C 2WAQE 4DK6C 2UUCQ 4L5TA 4LFAL 1SRUA 5FLMG 1YJWA 1ASYA 2IX0A 2MFIA 5M3FG 1A62A 3I4MH 2IT1A 4GNXA 1XPOA 4JI0Q 4BBSG 3DLLA 2IHFA 1EQRA 1HJPA 4JI3L 3F2DA 4P74A 5C0XG 2K5NA 3TEHB 1GD7A 2ZJRA 4NXNQ 2PQAA 3AFPA 1W2BA 1PH3A 1HNZQ 1LUZA 3J81c 2JA8H 1X3GA 3W1GA 4PG3A 4IPDA 3PUXA 2A19A 4AQYQ 1TWGH 1VQFA 2YYZA 4DV5L 3EIVA 3NENA 5JJLA 3PF4A 3PO2H 2N49A 4LF4Q 3KF8B 4BBRG 2WB1G 1E22A 4K0KL 4JI8Q 4OWTB 5GAHC 1EOVA 2K14A 1MJEA 1HR0L 1SMXA 4DV1Q 1B7YB 2CWPA 1N34L 2BA0A 1EFWA 3FKIH 3K80C 1FJGQ 1YNXA 3I56A 2E8GA 3J81i 3I55A 4HIOA 3CCMA 4B3RQ 4MTNA 4A3FH 4DR5Q 4DR1Q 1Y1VG 2C35B 4GOPC 1U0LA 1MIUA 2VQEQ 5LMNL 4LF7Q 1G51A 4LWCA 4O0AA 3PO3H 1YZ6A 4OO1G 1IXRA 4ME3A 3G4SA 4JBJA 3S1RH 1GM5A 4PZ6A 4JI7L 2HT1A 2KBNA 1E7ZA 3TS2A 5IP9H 4TQUS 4B3SL 2OWOA 4JI3Q 3A5UA 3S1NH 1OXVA 3M4PA 2D62A 3BZKA 4IJHA 4YCVA 4YWLA 5JEAG 2ZJQA 3KLWA 5BR8Q 4A3DH 4C3HH 5HY6A 1VQPA 4HIDA 1N8RC 1IBKQ 1HNXQ 1KHIA 4P75A 1VS0A 3HOUH 1AE2A 4R4CA 3ULJA 1Q8KA 4A3MG 5IP7G 1I3QH 1HH2P 1JMCA 4DUZQ 4DAMA 4C3IH 2EIFA 4GS3A 1P16A 2R6GA 4JCVE 4HJ8A 1N9WA 2CWAA 1BBWA 1QVFA 4BXXG 1OXXK 1V9PA 2ALYB 4YY3Q 5IYCG 2Z0SA 1HZAA 3CCVA 4HIKA 3KDFA 4A3GG 2RHQB 1YJ9A 2K52A 2HHHQ 1V1QA 2JA9A 1VQ7A 1YHAA 4DV6Q 4LF5Q 1QUQA 4LFBL 3PIOA 4DR1L 1I5FA 1HNWL 2E2JH 1TWCH 4XTCS 1Q1BA 4R4OA 3UDFA 4GLAC 3L2PA 1N33Q 4A3BG 2PQAB 1L0WA 3HOXH 1PH7A 4GKKL 5LMUL 1JJ2A 1Q81C 2IY5B 3M3YH 1XNRL 3OTOQ 3HOYH 4NPSA 1C0AA 1CSPA 1IBMQ 4QQBX 4YHHQ 2XTIA 2VW9A 2MQHA 3K0XA 4POGA 2ATWA 1TWFH 4HIMA 4X65L 1IBKL 3PIPA 2B29A 3G6EA 2A1AA 4JI5L 4JI1L 4DR2Q 4GNXC 1S72A 1PVOA 4BY1G 2YTYA 2UXCQ 4IO9A 1OXUA 2VZAA 1NMFA 2I5MX 3AQQA 4A75A 3PF5A 4LF6L 4K0KQ 3I4MG 3T1HQ 1V43A 3K8AA 4GOPB 1IBLQ 1Q86C 3PUZA 3I2ZA 5IYDG 5FLXc 4BY7H 2NVTH 1Z9FA 3JAMc 2Y0SG 1JJCB 3U50C 1XNQL 3E9HA 4DV3L 3K7AH 2JA7G 3HOWG 4X66Q 3NELA 1J5EQ 2UXDL 2HIVA 2UUCL 2GVBA 4GKJL 4DUYL 2GVAA 3ER0A 2CQOA 4RG1A 2RCNA 3S1MH 2PI2A 3CXCA 1SFOH 1Q82C 2GN5A 1CKOA 1M1KC 3BJUA 3D31A 1YI2A 2E5LQ 3KFUA 2QGQA 5IYBH 3CCRA 4A3EH 1PV4A 1N36L 2R7ZH 2CKZB 1TWHH 1MJCA 4OO1I 2KCTA 3H0GH 2Q2IA 2OQKA 4DV1L 2ZJPA 1CKNA 3I4OA 4QY7A 5M3MH 4NXMQ 1P8LA 3TREA 3H3VH 4LF4L 5C3EH 1EIYB 2YV5A 1GO3E 3HFZB 4A3LG 5HGQA 4PMWA 1H95A 4GOPA 1I50H 4OWWB 4B3TQ 1TWAH 3DM3A 1E1TA 1LM0A 3PGZA 5FJ8H 1RL2A 2IHEA 3PUVA 4PZ7A 3KF6B 3K81C 4DV7L 1UE1A 3RZDH 1B8AA 4MNOA 3CC2A 2R93G 3RNUA 3T1YL 2JA5G 4J15A 4POFA 4P72A 1HNZL 2VUMH 3MEFA 3HKZE 1XMOQ 5IP9G 4B3ML 3OYYA 3EN2A 1XPRA 3E9IA 4DV2Q 3CD6A 1CKNB 1PH1A 4OWXB 4A3BH 4JI0L 1VQHA 4DR7Q 1FVIA 1VQDA 3PO3G 4JI4Q 3A5ZB 4XIGS 3EBEA 5GROA 1D8LA 5DLQE 2UUBQ 3CAMA 1JJGA 1X54A 3L7ZC 2JEBI 2CFMA 1Y14B 4PZ8A 3GTPH 3H3VI 1VQ5A 3AFQA 3S17H 3SGIA 4DV0L 2KCMA 2UUAL 2NVYH 3STBC 4JI1Q 3W1BA 4IOCA 4DKAC 1EYGA 4LF5L 4A4IA 5M5XH 5C4JH 1SROA 3GTKH 4DUZL 4DR6Q 4X62L 5M3FH 4A3GH 1VQGA 2N8NA 3PO2G 4YY3L 2AMCB 5C4XH 1UWVA 4L5RC 3HOYG 1VQAA 2ES2A 5IWAQ 4JI7Q 3I4NH 1L2FA 3CCQA 3RN5A 1FJGL 1XMQL 4BY7G 4ALPA 2NVQH 3GTLH 5M5YH 1UE5A 1HZCA 2IX1A 4IPGA 4NXNL 1PH8A 4DR4L 4JBKA 4LFAQ 2UXBL 2I5HA 4JI6Q 2BA1A 4IPHA 4DV4Q 1DGSA 1VQJA 4GKKQ 4BA1I 3CCJA 1VQEA 1NBWA 1NY4A 3PV0A 3CF5A 4LF9L 1KC8C 3NEMA 1Q1EA 1X65A 1YHQA 2NZOA 4IFDG 4QIWE 5AJ3Q 3G71A 1C7YA 2UUBL 3S1QH 4AYBG 1VQLA 1CSQA 2N78A 3F1ZA 3GTOH 1PYSB 3LGJA 4GN4B 1VQCA 2LXJA 2EQSA 4X64L 3U4ZA 2MNAA 2ZTEA 4H02A 3ICEA 2Y0SE 2Z6KA 4DR5L 1XJVA 1I94L 1RIPA 2ZTCA 3S15H 5C4XG 4JI8L 4X62Q 4A3MH 2ID0A 3FKIG 4R1JA 3KJPA 5LMNW 3L0OA 1YIJA 4LF6Q 1KRTA 3F2BA 4DPGA 1HR0Q 4OX9L 1NMGA 3GTQH 3KDFB 3RR5A 3NBHB 5C0XI 2Q2UA 2AWNA 1HR0W 2Z6KC 4JI2L 3S2DH 1QVGA 5JJIA 1IZ6A 5GADC 1ASZA 1L1OC 4X66L 1WI5A 1Q46A 1Q7YC 1JB7A 1VQNA 1HNWQ 2RF4A 4L5QA 4DUYQ 2R7DA 3CQZH 1VQ8A 3AEVA 2R7ZG 3S14H 2JA5H 1X9NA 4DV2L 1N32L 1G291 2RHSB 5IYCH 1D7QA 4BXXH 3H0GG 1VQBA 4KHZA 2F3IA 1X3EA 5FJ8G 3M4OH 3HOZH 4R4TA 1IBML 5AJ3L 3M9BA 3UE0A 4A93H 2I5LX 1X3FA 5IY0A 1KQSA 2B63G 1QZGA 4BBRH 4KLKA 4AH6A 1UE6A 2NZHA 3CW2C 1PYBA 1S3OA 2R92H 1YHBA 1X55A 3B6YA 3AYHB 2HHHL 1EWIA 4NB3A 2UUAQ 4X6AH 1E1OA 2B3GA 1B70B 2K50A 1EQQA 4LFBQ 1Q12A 1I94Q 3RN2A 4WJ4A 1AH9A 1PFSA 4BA2I 2EXDA 4UPAA 5H1SE 2ZM6Q 4YWKA 3T1HL 3CPWA 1L1OB 1K83H 2VS1A 1S40A 3HOZG 3ERSX 3RLFA 3TS0A 3UE1A 4KHPQ 1OXTA 2LXKA 4P71A 4DR7L 4JV5L 2XGTA 3U58A 2NN6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STB D;  4LNQ A;  2VQF L;  4GN5 A;  4A3K H;  4QL5 A;  1WYD A;  2Q2T A;  1E3P A;  1QUQ B;  1N33 L;  4JOI A;  2HIX A;  4IPC A;  2MO0 A;  2UXB Q;  3BZC A;  2UU9 Q;  4X65 Q;  1VQ9 A;  3BU2 A;  3HKZ G;  4Y52 H;  2R93 H;  1JE5 A;  4Y7N H;  1A0I A;  2JA6 H;  2AHO B;  2K5V A;  2OTL A;  3F2C A;  1W3S A;  4HJ7 A;  2WP8 J;  2N3S A;  3WWV A;  3CME A;  1YIT A;  2R92 G;  2ZTD A;  3H15 A;  5IYD H;  4LF8 L;  5IP7 H;  3HOV G;  4A3I H;  4C2M H;  4LFC Q;  3HOW H;  2JA7 H;  4A3K G;  5M5W H;  5ELN A;  1WCM G;  1XMQ Q;  2F4V L;  1BKB A;  4DR2 L;  4X64 Q;  2AKW B;  5J3B A;  1Z47 A;  4GNX B;  4YWM A;  4DR6 L;  4LF7 L;  3T1Y Q;  2QEX A;  4R4Q A;  1SN8 A;  4RMF A;  5C3E G;  2Q2H A;  4L5S A;  1QVC A;  3F8T A;  3ULL A;  3CCS A;  4OX9 Q;  2PMZ E;  1VQK A;  1O7I A;  1X6O A;  3HOV H;  4O2D A;  3RLO A;  4HJ9 A;  3KOJ A;  4DV6 L;  1FGU A;  4QJF A;  5GAG C;  3RLN A;  4HJA A;  1PA6 A;  5K36 G;  4GLV B;  3E0E A;  4DV3 Q;  3PUW A;  5C0X J;  5IE8 A;  2VQE L;  1PHJ A;  1G6P A;  2E2I H;  5IT9 c;  1K0R A;  4B3M Q;  2K4K A;  2VY3 A;  4QGU A;  4AQY L;  3S16 H;  1SLJ A;  4IFD J;  3S24 A;  1TXY A;  3A0J A;  4R4I A;  5GAE C;  4A3L H;  5JJK A;  4LF9 Q;  1GKH A;  4APV A;  2H5X A;  2D0P A;  4UP8 A;  1KL9 A;  3OTO L;  2VL6 A;  4B3S Q;  2YTV A;  3HOX G;  2E5L L;  2JQO A;  1EUJ A;  1KD1 C;  2D0O A;  3G48 A;  4YHH L;  4FDB A;  4JYA L;  1JT8 A;  3CP0 A;  4LF8 Q;  2WFW A;  4LW1 A;  1IBL L;  4IFD I;  2CCZ A;  1OXS C;  3K7U C;  4GN3 B;  4EX5 A;  1PH5 A;  4DV0 Q;  4KI0 A;  5E7N A;  3TQY A;  3CC4 A;  1YEZ A;  4JI5 Q;  4YCW A;  4JI2 Q;  1A8V A;  1XPU A;  1WFQ A;  2JA8 G;  1VQ6 A;  1XNQ Q;  4JG2 A;  2OCE A;  1LYL A;  4JC0 A;  1LTL A;  4IJL A;  4P73 A;  1T9H A;  1X56 A;  1J5E L;  2JEA I;  1K9M C;  2UXD Q;  2FXQ A;  3J80 c;  2ZM6 L;  1CUK A;  3J7A 5;  1XTD A;  4BBS H;  3JAM i;  4B3T L;  4LUZ A;  1YJN A;  4A3D G;  5LMU Q;  4A3C H;  5IWA L;  1NE3 A;  1VQO A;  3S2H H;  4KHP L;  1XNR Q;  4TVA B;  3D0F A;  3HKS A;  3I7F A;  2A8V A;  2NVX H;  4JV5 Q;  4JBW A;  4B3R L;  1BVS A;  5C44 G;  4GLX A;  3MXN B;  1YBY A;  4OON A;  3UDG A;  1C9O A;  5BR8 L;  1R9T H;  3UDI A;  4JOI C;  1KAW A;  2F52 A;  2VQF Q;  2BH8 A;  2I0Q A;  1XMO L;  3GDE A;  3PUY A;  4DV5 Q;  1UE7 A;  1VCI A;  1Y1V H;  2K75 A;  4DNI A;  3VDY A;  4UP9 A;  1HZB A;  4A76 A;  1K3R A;  2PI2 E;  3J80 i;  3ULP A;  2UXC L;  3PSI A;  1KIX A;  2YU9 H;  5EAY A;  4JI4 L;  4DAY B;  1GVP A;  3U4V A;  2QA4 A;  3GTG H;  3Q8D A;  4LUO A;  5ELO A;  2YTX A;  3RZO H;  1I6H H;  2NN6 G;  2R7F A;  4DR3 L;  2JK8 A;  2LSS A;  4LFC L;  4JBM A;  4A3F G;  1CKM A;  4A3E G;  4NXM L;  5JEA J;  1SR3 A;  2AWO A;  2WB1 E;  1Y1W H;  4A3C G;  2WAQ G;  2OQ0 A;  5GQO A;  5FLM H;  1YVC A;  4C3J H;  1J6Q A;  3HOU G;  1VQI A;  3CMA A;  1NJI C;  1K8G A;  3OW2 A;  3GD7 A;  1EIF A;  3I4N G;  4GKJ Q;  1PH2 A;  5C44 H;  1U5K A;  3J7Z C;  3JC6 6;  4YCU A;  4DV4 L;  1PH4 A;  2VNU D;  3A74 A;  1PH9 A;  3GTM H;  5IYB G;  4AIM A;  3FHW A;  1VQM A;  3W5O A;  4LUV A;  1VQ4 A;  3CC7 A;  3J81 j;  3M7N A;  4A3J G;  1SE8 A;  1BBU A;  4DV7 Q;  1PH6 A;  1IYJ B;  3IRB A;  2MO1 A;  3M4Q A;  3M85 A;  2JA6 G;  3CCE A;  5M3M G;  3CCL A;  1Y1W G;  2PNH A;  3ZJY C;  1IL2 A;  4DR4 Q;  4WJ3 M;  4JI6 L;  4AYB E;  1HNX L;  2V1C C;  2UU9 L;  3UDX A;  2KEN A;  3GTJ H;  1MKH A;  4HJ5 A;  2JJQ A;  2F4V Q;  1N32 Q;  2HQL A;  2ASB A;  2VUM G;  1AE3 A;  2BH2 A;  3TRZ A;  3GO5 A;  3KJO A;  4A3I G;  1OTC A;  1UEB A;  2JE6 I;  3FP9 A;  2KHJ A;  1N36 Q;  3PCO B;  2DUD A;  1FL0 A;  4EQ5 A;  3CCU A;  1L1O A;  1WJJ A;  1M90 C;  4IOA A;  4JYA Q;  1KXL A;  1WCM H;  1QZH A;  2E2H H;  1A63 A;  4A3J H;  4OXP A;  4UP7 A;  3CPF A;  3KF6 A;  1KRS A;  1NTG A;  1HZ9 A;  4DR3 Q;  1K8A C;  1N34 Q;  4BY1 H;  4DK3 C;  2K5H A;  2KHI A;  3KYH C;  2L15 A;  1E24 A;  2B63 H;  1K73 C;  4A93 G;  1WOC A;  2OTJ A;  2DGY A;  4MZ9 A;  5LMN Q;  4UY8 C;  2WAQ E;  4DK6 C;  2UUC Q;  4L5T A;  4LFA L;  1SRU A;  5FLM G;  1YJW A;  1ASY A;  2IX0 A;  2MFI A;  5M3F G;  1A62 A;  3I4M H;  2IT1 A;  4GNX A;  1XPO A;  4JI0 Q;  4BBS G;  3DLL A;  2IHF A;  1EQR A;  1HJP A;  4JI3 L;  3F2D A;  4P74 A;  5C0X G;  2K5N A;  3TEH B;  1GD7 A;  2ZJR A;  4NXN Q;  2PQA A;  3AFP A;  1W2B A;  1PH3 A;  1HNZ Q;  1LUZ A;  3J81 c;  2JA8 H;  1X3G A;  3W1G A;  4PG3 A;  4IPD A;  3PUX A;  2A19 A;  4AQY Q;  1TWG H;  1VQF A;  2YYZ A;  4DV5 L;  3EIV A;  3NEN A;  5JJL A;  3PF4 A;  3PO2 H;  2N49 A;  4LF4 Q;  3KF8 B;  4BBR G;  2WB1 G;  1E22 A;  4K0K L;  4JI8 Q;  4OWT B;  5GAH C;  1EOV A;  2K14 A;  1MJE A;  1HR0 L;  1SMX A;  4DV1 Q;  1B7Y B;  2CWP A;  1N34 L;  2BA0 A;  1EFW A;  3FKI H;  3K80 C;  1FJG Q;  1YNX A;  3I56 A;  2E8G A;  3J81 i;  3I55 A;  4HIO A;  3CCM A;  4B3R Q;  4MTN A;  4A3F H;  4DR5 Q;  4DR1 Q;  1Y1V G;  2C35 B;  4GOP C;  1U0L A;  1MIU A;  2VQE Q;  5LMN L;  4LF7 Q;  1G51 A;  4LWC A;  4O0A A;  3PO3 H;  1YZ6 A;  4OO1 G;  1IXR A;  4ME3 A;  3G4S A;  4JBJ A;  3S1R H;  1GM5 A;  4PZ6 A;  4JI7 L;  2HT1 A;  2KBN A;  1E7Z A;  3TS2 A;  5IP9 H;  4TQU S;  4B3S L;  2OWO A;  4JI3 Q;  3A5U A;  3S1N H;  1OXV A;  3M4P A;  2D62 A;  3BZK A;  4IJH A;  4YCV A;  4YWL A;  5JEA G;  2ZJQ A;  3KLW A;  5BR8 Q;  4A3D H;  4C3H H;  5HY6 A;  1VQP A;  4HID A;  1N8R C;  1IBK Q;  1HNX Q;  1KHI A;  4P75 A;  1VS0 A;  3HOU H;  1AE2 A;  4R4C A;  3ULJ A;  1Q8K A;  4A3M G;  5IP7 G;  1I3Q H;  1HH2 P;  1JMC A;  4DUZ Q;  4DAM A;  4C3I H;  2EIF A;  4GS3 A;  1P16 A;  2R6G A;  4JCV E;  4HJ8 A;  1N9W A;  2CWA A;  1BBW A;  1QVF A;  4BXX G;  1OXX K;  1V9P A;  2ALY B;  4YY3 Q;  5IYC G;  2Z0S A;  1HZA A;  3CCV A;  4HIK A;  3KDF A;  4A3G G;  2RHQ B;  1YJ9 A;  2K52 A;  2HHH Q;  1V1Q A;  2JA9 A;  1VQ7 A;  1YHA A;  4DV6 Q;  4LF5 Q;  1QUQ A;  4LFB L;  3PIO A;  4DR1 L;  1I5F A;  1HNW L;  2E2J H;  1TWC H;  4XTC S;  1Q1B A;  4R4O A;  3UDF A;  4GLA C;  3L2P A;  1N33 Q;  4A3B G;  2PQA B;  1L0W A;  3HOX H;  1PH7 A;  4GKK L;  5LMU L;  1JJ2 A;  1Q81 C;  2IY5 B;  3M3Y H;  1XNR L;  3OTO Q;  3HOY H;  4NPS A;  1C0A A;  1CSP A;  1IBM Q;  4QQB X;  4YHH Q;  2XTI A;  2VW9 A;  2MQH A;  3K0X A;  4POG A;  2ATW A;  1TWF H;  4HIM A;  4X65 L;  1IBK L;  3PIP A;  2B29 A;  3G6E A;  2A1A A;  4JI5 L;  4JI1 L;  4DR2 Q;  4GNX C;  1S72 A;  1PVO A;  4BY1 G;  2YTY A;  2UXC Q;  4IO9 A;  1OXU A;  2VZA A;  1NMF A;  2I5M X;  3AQQ A;  4A75 A;  3PF5 A;  4LF6 L;  4K0K Q;  3I4M G;  3T1H Q;  1V43 A;  3K8A A;  4GOP B;  1IBL Q;  1Q86 C;  3PUZ A;  3I2Z A;  5IYD G;  5FLX c;  4BY7 H;  2NVT H;  1Z9F A;  3JAM c;  2Y0S G;  1JJC B;  3U50 C;  1XNQ L;  3E9H A;  4DV3 L;  3K7A H;  2JA7 G;  3HOW G;  4X66 Q;  3NEL A;  1J5E Q;  2UXD L;  2HIV A;  2UUC L;  2GVB A;  4GKJ L;  4DUY L;  2GVA A;  3ER0 A;  2CQO A;  4RG1 A;  2RCN A;  3S1M H;  2PI2 A;  3CXC A;  1SFO H;  1Q82 C;  2GN5 A;  1CKO A;  1M1K C;  3BJU A;  3D31 A;  1YI2 A;  2E5L Q;  3KFU A;  2QGQ A;  5IYB H;  3CCR A;  4A3E H;  1PV4 A;  1N36 L;  2R7Z H;  2CKZ B;  1TWH H;  1MJC A;  4OO1 I;  2KCT A;  3H0G H;  2Q2I A;  2OQK A;  4DV1 L;  2ZJP A;  1CKN A;  3I4O A;  4QY7 A;  5M3M H;  4NXM Q;  1P8L A;  3TRE A;  3H3V H;  4LF4 L;  5C3E H;  1EIY B;  2YV5 A;  1GO3 E;  3HFZ B;  4A3L G;  5HGQ A;  4PMW A;  1H95 A;  4GOP A;  1I50 H;  4OWW B;  4B3T Q;  1TWA H;  3DM3 A;  1E1T A;  1LM0 A;  3PGZ A;  5FJ8 H;  1RL2 A;  2IHE A;  3PUV A;  4PZ7 A;  3KF6 B;  3K81 C;  4DV7 L;  1UE1 A;  3RZD H;  1B8A A;  4MNO A;  3CC2 A;  2R93 G;  3RNU A;  3T1Y L;  2JA5 G;  4J15 A;  4POF A;  4P72 A;  1HNZ L;  2VUM H;  3MEF A;  3HKZ E;  1XMO Q;  5IP9 G;  4B3M L;  3OYY A;  3EN2 A;  1XPR A;  3E9I A;  4DV2 Q;  3CD6 A;  1CKN B;  1PH1 A;  4OWX B;  4A3B H;  4JI0 L;  1VQH A;  4DR7 Q;  1FVI A;  1VQD A;  3PO3 G;  4JI4 Q;  3A5Z B;  4XIG S;  3EBE A;  5GRO A;  1D8L A;  5DLQ E;  2UUB Q;  3CAM A;  1JJG A;  1X54 A;  3L7Z C;  2JEB I;  2CFM A;  1Y14 B;  4PZ8 A;  3GTP H;  3H3V I;  1VQ5 A;  3AFQ A;  3S17 H;  3SGI A;  4DV0 L;  2KCM A;  2UUA L;  2NVY H;  3STB C;  4JI1 Q;  3W1B A;  4IOC A;  4DKA C;  1EYG A;  4LF5 L;  4A4I A;  5M5X H;  5C4J H;  1SRO A;  3GTK H;  4DUZ L;  4DR6 Q;  4X62 L;  5M3F H;  4A3G H;  1VQG A;  2N8N A;  3PO2 G;  4YY3 L;  2AMC B;  5C4X H;  1UWV A;  4L5R C;  3HOY G;  1VQA A;  2ES2 A;  5IWA Q;  4JI7 Q;  3I4N H;  1L2F A;  3CCQ A;  3RN5 A;  1FJG L;  1XMQ L;  4BY7 G;  4ALP A;  2NVQ H;  3GTL H;  5M5Y H;  1UE5 A;  1HZC A;  2IX1 A;  4IPG A;  4NXN L;  1PH8 A;  4DR4 L;  4JBK A;  4LFA Q;  2UXB L;  2I5H A;  4JI6 Q;  2BA1 A;  4IPH A;  4DV4 Q;  1DGS A;  1VQJ A;  4GKK Q;  4BA1 I;  3CCJ A;  1VQE A;  1NBW A;  1NY4 A;  3PV0 A;  3CF5 A;  4LF9 L;  1KC8 C;  3NEM A;  1Q1E A;  1X65 A;  1YHQ A;  2NZO A;  4IFD G;  4QIW E;  5AJ3 Q;  3G71 A;  1C7Y A;  2UUB L;  3S1Q H;  4AYB G;  1VQL A;  1CSQ A;  2N78 A;  3F1Z A;  3GTO H;  1PYS B;  3LGJ A;  4GN4 B;  1VQC A;  2LXJ A;  2EQS A;  4X64 L;  3U4Z A;  2MNA A;  2ZTE A;  4H02 A;  3ICE A;  2Y0S E;  2Z6K A;  4DR5 L;  1XJV A;  1I94 L;  1RIP A;  2ZTC A;  3S15 H;  5C4X G;  4JI8 L;  4X62 Q;  4A3M H;  2ID0 A;  3FKI G;  4R1J A;  3KJP A;  5LMN W;  3L0O A;  1YIJ A;  4LF6 Q;  1KRT A;  3F2B A;  4DPG A;  1HR0 Q;  4OX9 L;  1NMG A;  3GTQ H;  3KDF B;  3RR5 A;  3NBH B;  5C0X I;  2Q2U A;  2AWN A;  1HR0 W;  2Z6K C;  4JI2 L;  3S2D H;  1QVG A;  5JJI A;  1IZ6 A;  5GAD C;  1ASZ A;  1L1O C;  4X66 L;  1WI5 A;  1Q46 A;  1Q7Y C;  1JB7 A;  1VQN A;  1HNW Q;  2RF4 A;  4L5Q A;  4DUY Q;  2R7D A;  3CQZ H;  1VQ8 A;  3AEV A;  2R7Z G;  3S14 H;  2JA5 H;  1X9N A;  4DV2 L;  1N32 L;  1G29 1;  2RHS B;  5IYC H;  1D7Q A;  4BXX H;  3H0G G;  1VQB A;  4KHZ A;  2F3I A;  1X3E A;  5FJ8 G;  3M4O H;  3HOZ H;  4R4T A;  1IBM L;  5AJ3 L;  3M9B A;  3UE0 A;  4A93 H;  2I5L X;  1X3F A;  5IY0 A;  1KQS A;  2B63 G;  1QZG A;  4BBR H;  4KLK A;  4AH6 A;  1UE6 A;  2NZH A;  3CW2 C;  1PYB A;  1S3O A;  2R92 H;  1YHB A;  1X55 A;  3B6Y A;  3AYH B;  2HHH L;  1EWI A;  4NB3 A;  2UUA Q;  4X6A H;  1E1O A;  2B3G A;  1B70 B;  2K50 A;  1EQQ A;  4LFB Q;  1Q12 A;  1I94 Q;  3RN2 A;  4WJ4 A;  1AH9 A;  1PFS A;  4BA2 I;  2EXD A;  4UPA A;  5H1S E;  2ZM6 Q;  4YWK A;  3T1H L;  3CPW A;  1L1O B;  1K83 H;  2VS1 A;  1S40 A;  3HOZ G;  3ERS X;  3RLF A;  3TS0 A;  3UE1 A;  4KHP Q;  1OXT A;  2LXK A;  4P71 A;  4DR7 L;  4JV5 L;  2XGT A;  3U58 A;  2NN6 I; 
#chains in the Genus database with same CATH topology
 1YNJ D;  4KN7 C;  1E3P A;  3HOW B;  3G6J B;  2MO0 A;  3J7A V;  1VQ9 A;  3HKZ G;  2EY5 A;  1YNN C;  2EYF A;  2L5T A;  2R93 H;  1R4P B;  1IW7 D;  5IOD A;  3WWV A;  5CYU A;  1YIT A;  3CKI B;  1PRT C;  2KJX A;  5EKK A;  2EVB A;  3NSW A;  3P7J A;  3HOW H;  1GOZ A;  4R8N A;  4A3K G;  4FXG C;  1B44 D;  3GTK B;  3S9W A;  4X64 Q;  4RGO S;  1Z7T A;  2BCO A;  1STA A;  2QW7 A;  4YWM A;  4DR6 L;  3A54 A;  2KQ3 A;  1BUV T;  3VR2 A;  3TSS A;  4EQP A;  5DNF A;  2OXP A;  4RMF A;  1CQF A;  3CCS A;  3RLO A;  1K8O A;  4CHT B;  1C8C A;  1DD2 A;  2Z1C A;  3E0E A;  1IL8 A;  5C0X J;  3VA7 A;  2VQE L;  1BDO A;  3I73 A;  4JPB W;  1K0R A;  1SLJ A;  3GP7 A;  5FOB B;  2AUJ D;  1F2Z A;  3OTO L;  3P75 A;  2L9H A;  3G48 A;  4YHH L;  4KY6 A;  4A3K B;  1JT8 A;  3CP0 A;  1SYD A;  4CGY B;  1IBL L;  3S17 B;  4IFD I;  4GN3 B;  4EX5 A;  2OT2 A;  5E7N A;  3TQY A;  3TP7 A;  3A8I E;  2JA8 G;  2QF7 A;  1A3V A;  1LTL A;  4P73 A;  1R9T B;  2JEA I;  2NTS A;  1CUK A;  4B3T L;  2JSO A;  3HEJ A;  2F0P A;  5IWA L;  1VQO A;  3RD4 A;  1XNR Q;  1DJR D;  4TVA B;  3D0F A;  3HKS A;  3I7F A;  3PO2 B;  2NVX H;  4DNR B;  3SXH A;  1BVS A;  3QR8 A;  4GLX A;  1YBY A;  1T5X D;  2K03 A;  3R8B A;  1C9O A;  1XXG A;  1R9T H;  3UDI A;  1KAW A;  2EPB A;  3PUY A;  3Q0A A;  1WD1 A;  2O2L D;  3A56 A;  4A76 A;  2UXC L;  1KIX A;  2YU9 H;  2VB3 X;  4KN4 C;  5FO7 B;  2QA4 A;  2SDF A;  5ELO A;  3RZO H;  2Z6B A;  1II3 A;  1CKM A;  4KD4 A;  1NSN S;  4NXM L;  5JEA J;  1RD9 D;  4CBV A;  2EY2 A;  2EZV A;  1HUN A;  5FLM H;  3I90 A;  5A2Q L;  1GJX A;  3GD7 A;  1DZ1 A;  2VNU D;  4DV4 L;  5C4X B;  3GTM H;  5IYB G;  1VQM A;  4IAL A;  4LUV A;  4OIK A;  1BBU A;  5EKI A;  1IYJ B;  2JA6 G;  1DXM A;  1ET9 A;  1SDF A;  3ZJY C;  1Y1W G;  2F0G A;  4AYB E;  2UU9 L;  3UDX A;  1VDZ A;  2KEN A;  1SAP A;  4HJ5 A;  2JJQ A;  1G2S A;  1E0B A;  2BH2 A;  3TRZ A;  3GO5 A;  3KJO A;  4A3I G;  3OIQ A;  1UEB A;  2KHJ A;  4KMU C;  2DUD A;  3CCU A;  1L1O A;  1KXL A;  2X6G A;  4UP7 A;  1KRS A;  1SFO B;  2K5H A;  5D3D A;  5TSS A;  2B63 H;  2F3W A;  4HTH A;  1SJH D;  4YIJ A;  3P1H A;  1EY9 A;  4L5T A;  1JIC A;  1H9R A;  2RA4 A;  4BBS B;  4LJZ C;  2NBF A;  2IT1 A;  4IUQ A;  4U67 3;  4BBS G;  1HJP A;  2A5H A;  4JI3 L;  4P74 A;  2HCI A;  4IZ8 A;  1HXY D;  1NUC A;  1M4V A;  3AFP A;  1AN8 A;  3J81 c;  1UNS A;  4PG3 A;  3JAM E;  4AQY Q;  2YYZ A;  4K6L A;  3NEN A;  3TP8 A;  3T56 B;  5G3L D;  2N49 A;  2X6L A;  4K0K L;  3J7Y W;  5FLX L;  2MP1 A;  4A3M B;  4BBR B;  1HR0 L;  2A68 D;  2BA0 A;  3FKI H;  3IKJ A;  2N88 A;  1TT2 A;  3J81 i;  3I55 A;  4L8J A;  2D9U A;  1TU2 B;  1Y1V G;  5BN4 A;  1G51 A;  4LWC A;  1U4L A;  1K0S A;  1K83 B;  1LTR D;  3S1R H;  4PZ6 A;  4JI7 L;  2KBN A;  5IP9 H;  2PYK A;  3M4P A;  2B8F A;  1QNU A;  3KLW A;  4CJ2 C;  4C1N I;  2IJ0 A;  1VQP A;  3VYU A;  4HID A;  1ESR A;  3SE0 A;  1IBK Q;  1KHI A;  3H94 A;  1AFP A;  4R4C A;  3ULJ A;  1Q8K A;  2DY7 A;  4DAM A;  2WIN B;  2EIF A;  1QB5 D;  3HGB A;  4C3I H;  1P16 A;  3T16 A;  4HJ8 A;  2CWA A;  1SXT A;  2E2H B;  1OXX K;  3CCV A;  5JEA H;  1Y1V B;  4A3G G;  1YHA A;  3L9A X;  1QUQ A;  3S2D B;  1CTM A;  4C3I B;  1I5F A;  4RGN A;  4FF4 A;  1N33 Q;  4GLA C;  1SJE D;  3L2P A;  2PQA B;  3KBG A;  1JJ2 A;  1Q81 C;  1Q3L A;  3QJY A;  1L0Y B;  2ICI A;  2PQE A;  2NZ1 D;  2ZXR A;  2XTI A;  2VW9 A;  2MQH A;  3FRP B;  4POG A;  4F8M A;  1TWG B;  2F0H A;  4DF7 A;  1IBK L;  3MWY W;  2B29 A;  3PIP A;  3NTI A;  1S72 A;  1PVO A;  4BY1 G;  1OXU A;  3OHX C;  3PF5 A;  1KLU D;  5IGC A;  3CQZ B;  1IBL Q;  1Q86 C;  5FLX c;  3K5M A;  3DHQ A;  3MVV A;  2JYO A;  4A3E B;  1E2V A;  1TS3 A;  5E1F A;  4DUY L;  2GVA A;  3ER0 A;  3KF8 A;  2BDN A;  3CXC A;  1D5M C;  3X3N A;  2GN5 A;  1BO0 A;  5JJZ A;  1N36 L;  4A3E H;  4I65 A;  1MJC A;  3D3R A;  2OQK A;  2Q8I B;  5FO9 B;  2RKS A;  3H3V C;  4NXM Q;  1P8L A;  3TRE A;  1H9S A;  3VYS A;  2LY7 A;  2FHT A;  2Z8L A;  2VUM B;  2LFN A;  2RVL A;  1I50 H;  4G7O C;  3AMU A;  2XRS D;  3S2H B;  4PZ7 A;  3VYT A;  4G7Z C;  4DV7 L;  3RZD H;  4C3J B;  3CC2 A;  1DYQ A;  3RNU A;  1EZ6 A;  3MTS A;  1LTG D;  4DK1 A;  5I6W A;  2JA5 G;  2PZW A;  4POF A;  2VUM H;  1XMO Q;  1ROD A;  5IP9 G;  4ZUJ A;  4S3S A;  4Z9C B;  4DV2 Q;  2TMP A;  3CD6 A;  4LMQ D;  4OWX B;  4JI0 L;  1FVI A;  2SNS A;  2K32 A;  4XIG S;  2UUB Q;  1D5Z C;  1JJG A;  5I9O A;  2EYO A;  1BQQ T;  1LV9 A;  3AFQ A;  3S17 H;  3SGI A;  4ME5 A;  2KCM A;  5M9O A;  4IOC A;  3W1B A;  2K28 A;  1EYG A;  4A4I A;  5M5X H;  1SRO A;  1STH A;  3RMH A;  1AP0 A;  3CRL C;  3Q6S A;  1MSH A;  3C1E A;  5M3F H;  3LWE A;  4X3K A;  1STE A;  4YY3 L;  4L5R C;  2ES2 A;  1TR5 A;  2LS0 1;  5DM7 3;  3RN5 A;  1JWS D;  2X69 A;  2NVX B;  1EFI D;  4RAU C;  5FK9 C;  3WDN A;  3BZD B;  1TS5 A;  3SR1 A;  1PH8 A;  4DR4 L;  2UXB L;  4IUN A;  2BA1 A;  4IPH A;  4DV4 Q;  1DGS A;  4JI6 Q;  5EJW A;  4XXE A;  4OGQ C;  4IUU A;  3F2U A;  1HQR D;  5CV8 A;  4IUR A;  2ENB A;  2F0U A;  3MEH A;  3MHB A;  3PIO 3;  3G71 A;  1KDA A;  3S1Q H;  1SMY C;  1PYS B;  4GN4 B;  4O42 A;  1VQC A;  3LX0 A;  1PRT B;  2EQS A;  2IX3 A;  2Z4H A;  4X64 L;  2ZTE A;  1RCV D;  5KGU A;  1JOQ A;  1JE4 A;  5LMN W;  2DJF C;  1SYF A;  4K8J A;  1KRT A;  1BCP B;  1WTW A;  1HR0 W;  2XNA C;  2LMC B;  3TZU A;  1IZ6 A;  5GAD C;  4X66 L;  3OOC A;  4L5Q A;  5IOC A;  4N9P A;  4DXG A;  2PW7 A;  5IT9 L;  4DV2 L;  5COR A;  5IYC H;  3R2T A;  3MZ5 A;  1Y8P B;  1XYI A;  4BXX H;  1JB3 A;  4I7Z C;  4AYB B;  3HOZ H;  4NMZ A;  1SNQ A;  4Q5V A;  4OEM B;  5EBD A;  1BBX C;  2KCN A;  1UE6 A;  1PYB A;  4CDE C;  1EY6 A;  2UUA Q;  2B63 B;  4X6A H;  4NKL A;  2CW0 D;  2B3G A;  1TY0 A;  2RSN A;  5JAV A;  1EQQ A;  3HOZ B;  1AH9 A;  2EXD A;  4G4K A;  1ML0 D;  1ET6 A;  4PMB A;  3T1H L;  3CPW A;  3GTJ B;  3TS0 A;  3RLF A;  3UI2 A;  4KHP Q;  3V2T A;  3E3X A;  1O80 A;  5EPK A;  3ZYY X;  2K1B A;  4LNQ A;  3HKZ B;  4A3K H;  1PMR A;  1WYD A;  2K33 A;  1LAB A;  4TKO B;  2Q2T A;  1N33 L;  2HIX A;  4IPC A;  2UXB Q;  3BZC A;  1PTO D;  4X65 Q;  3BU2 A;  2VXW A;  4HSP A;  1A0I A;  1F2Y A;  2AHO B;  2K5V A;  2OTL A;  2EYM A;  3QB3 A;  1MBY A;  2N3S A;  2K6A A;  2CW0 C;  2L1B A;  3HZX A;  2ZT9 C;  5ELN A;  1BKB A;  4GNX B;  3BVZ A;  4LF7 L;  2EJG C;  5C5M A;  2L0C A;  1FNW A;  2QEX A;  4R4Q A;  5J22 A;  1R4Q B;  3R93 A;  3F8T A;  3ULL A;  1SYE A;  2HCC A;  1VQK A;  2KCC A;  2JN4 A;  3KOJ A;  2GA4 B;  4QJF A;  4DV3 Q;  1G6P A;  2E2I H;  5IT9 c;  3QIA A;  2K5D A;  2K4K A;  4QGU A;  4AQY L;  3S16 H;  3HG9 A;  4FXD A;  2WB1 B;  5GAE C;  4X3U A;  4LF9 Q;  5KYL A;  2D0P A;  1KL9 A;  3U9O A;  2E5L L;  3GQB A;  1B1Z A;  4JYA L;  2D0O A;  3OMC A;  3BDL A;  3S1Q B;  3O13 A;  2WFW A;  4LW1 A;  1B50 A;  3S14 B;  4WFN 3;  3DEO A;  4DV0 Q;  5ELB A;  1F2M A;  1UEA B;  1A8V A;  3NWT A;  1XPU A;  1VQ6 A;  1U4M A;  2OCE A;  1NCV A;  4IJL A;  2UXD Q;  1O7L A;  1X56 A;  1K9M C;  2F0L A;  3J80 c;  3J7A 5;  4B9W A;  4LUZ A;  4X3S A;  5I2Y A;  5LMU Q;  4J8Q A;  1AZQ A;  4KHP L;  2A8V A;  3DWP A;  4JBW A;  4B3R L;  5C44 G;  3NWS A;  3UDG A;  3MXN B;  2F52 A;  1EU3 A;  2DY8 A;  2L55 A;  2EE1 A;  4DV5 Q;  1VCI A;  3U9S A;  2JP1 A;  3VDY A;  1GUO A;  1HZB A;  1KAB A;  5EAY A;  3U4V A;  1BXT A;  2YTX A;  2NN6 G;  1QE6 A;  3KLS X;  1IKM A;  4DR3 L;  2JK8 A;  5F2D A;  4A3F G;  1SMY D;  1SR3 A;  2WB1 E;  3H91 A;  5GQO A;  1B4O A;  3CMA A;  3OW2 A;  3I4N G;  1EIF A;  1HUM A;  5C44 H;  1U5K A;  1PH4 A;  1PZJ D;  4OEL B;  1Y69 U;  3KLS A;  4QMG A;  3NP8 A;  5T1I A;  1VQ4 A;  4M1U B;  4A3J G;  1SE8 A;  4DV7 Q;  4OHJ A;  3M4Q A;  2A6E C;  3BYY B;  5DEH A;  3M85 A;  3CCE A;  3K5N A;  3CCL A;  4DR4 Q;  2EYJ A;  2PNH A;  4A3J B;  3C3L A;  4JI6 L;  2O5I C;  2A73 B;  1KLG D;  2XIW A;  2HQL A;  1AE3 A;  1W6K A;  1OTC A;  2JE6 I;  3PCO B;  1FL0 A;  1WJJ A;  1M90 C;  4JYA Q;  4A3J H;  4OXP A;  3GV6 A;  3KF6 A;  4DR3 Q;  1K73 C;  4NP5 A;  2OTJ A;  3TN2 A;  1JOO A;  3RZD B;  1QWY A;  1SE3 A;  3BDC A;  4DK6 C;  2PZU A;  3V05 A;  1YJW A;  4ZQ3 A;  2J4X A;  3N52 A;  1K8M A;  2B2W C;  5C3E B;  4BS9 A;  2XWJ B;  4LAA A;  5C0X G;  1GD7 A;  4B08 A;  1EOT A;  1F9Q A;  4NXN Q;  1W2B A;  1HNZ Q;  1DOK A;  1LUZ A;  3W1G A;  2FFK B;  4IPD A;  1JWM D;  4DV5 L;  3VR3 A;  5K5P A;  3PF4 A;  1HFG A;  4LF4 Q;  4BBR G;  1E22 A;  1LTI D;  1I4P A;  3D8G A;  1MJE A;  2B2Y A;  1SMX A;  2CWP A;  1TVX A;  3K80 C;  5I9P A;  2F0F A;  1A15 A;  1LTB D;  1PFB A;  4JW0 A;  3S1N B;  5EPJ A;  1V1O A;  1EQT A;  4MTN A;  3EQL C;  1STG A;  2C35 B;  2VQE Q;  1U4P A;  5G3L F;  3DXJ C;  4O0A A;  3GTG B;  2F0T A;  2F0O A;  2KED A;  4JBJ A;  5CC4 A;  1GM5 A;  1RJT A;  2HT1 A;  4N8F A;  2ZXP A;  5ELD A;  3A5U A;  4JI3 Q;  3S1N H;  3BZK A;  3EA6 A;  4IJH A;  3T4A C;  4ZLT F;  5JEA G;  2TSS A;  4A3D H;  2QEJ C;  1RTO A;  4FVM A;  3K6O A;  3J80 L;  4P75 A;  1CK1 A;  3M4Y A;  5FLX E;  5IP7 G;  1HH2 P;  1G8Z D;  1B3A A;  4JCV E;  2PO4 A;  1QVF A;  3K0Y A;  4A3G B;  5KEE A;  1V9P A;  4YY3 Q;  1FYC A;  1HFN A;  2Z0S A;  1FNU A;  4XQN A;  1D1I A;  2A6E D;  2I07 B;  2F0V A;  2K52 A;  1VQ7 A;  4LF5 Q;  1SSO A;  2N55 A;  1HNW L;  2E2J H;  1Q1B A;  2MHV A;  4GKK L;  4A3B G;  1PLF A;  5ELF A;  5K36 H;  4KV6 A;  1CA6 A;  1JOK A;  3LNN A;  5IGE A;  1H9K A;  3HOY H;  2B2U C;  3FEW X;  1C0A A;  3K0X A;  4O1N A;  2IWH A;  1LTS D;  1LT6 D;  4EQO A;  2ATW A;  4X65 L;  1E2Z A;  3G6E A;  1Y8N B;  3IFT A;  1RHP A;  3ND9 A;  2B2T C;  2UXC Q;  1EY5 A;  4JK1 C;  1W6J A;  2VZA A;  1NMF A;  1I4H A;  4LF6 L;  3ERO A;  3I4M G;  4GOP B;  5IYD G;  4XQQ A;  1SNM A;  4FP5 D;  1Z9F A;  3JAM c;  1YNJ C;  2Y0S G;  4KTA A;  3HOW G;  3U50 C;  2JA7 G;  3K7A H;  1EU4 A;  3C46 A;  2UUC L;  2GVB A;  4GKJ L;  1CFM A;  2CQO A;  2RCN A;  5C3X A;  3Q22 A;  3S1M H;  1Z6H A;  1SFO H;  2XVS A;  1JCK B;  2I46 A;  1M1K C;  1YI2 A;  5IT9 E;  4IQZ A;  2QGQ A;  3CCR A;  1QIL A;  2CKZ B;  2H4O A;  2KCT A;  2Q2I A;  2Q8R E;  2ZJP A;  1CKN A;  3D4W A;  1D6E C;  5M3M H;  5C4Z A;  4R9W A;  1HA5 A;  1K28 A;  1XX8 A;  1EIY B;  3HFZ B;  4PMW A;  3Q23 A;  1B53 A;  4OWW B;  1VF5 C;  4RCO A;  1TWA H;  2SEB D;  1RL2 A;  2MJ8 A;  2IHE A;  4KD3 A;  4QB4 A;  1QG7 A;  5C6A A;  3KF6 B;  1SYG A;  4HED A;  2QCP X;  3K81 C;  2QDB A;  4MNO A;  1KAA A;  3I8Z A;  4A93 B;  3I4L A;  4P72 A;  3MEF A;  3EN2 A;  3S16 B;  2JA5 B;  1T5E A;  4ZKC B;  2QKI C;  1CKN B;  1NAP A;  1HQM C;  4DR7 Q;  1VQD A;  5EQ0 A;  4N8X 1;  3T53 B;  3DUZ A;  1FD7 D;  5GRO A;  5DLQ E;  3CAM A;  3BVG A;  5E3F A;  2JEB I;  1H9J A;  4RA8 A;  3OSO A;  2B39 A;  2UUA L;  2NVY H;  3STB C;  4IUT A;  2CHB D;  4DUZ L;  4DR6 Q;  2PZT A;  4A3G H;  2AMC B;  5C4X H;  3HOY G;  1VQA A;  5IWA Q;  4JI7 Q;  2NN6 H;  1FJG L;  5J39 A;  3IFD A;  2NVQ H;  2B2U A;  2IX1 A;  4IPG A;  4NXN L;  3TDQ A;  3OPO A;  3GTO B;  5KYI A;  4BA1 I;  3E5S A;  3K58 A;  1VQE A;  1NY4 A;  4KKU A;  1Q1E A;  4CKE A;  1NR2 A;  5AJ3 Q;  3VR4 A;  2B2T A;  2BDO A;  2CH4 W;  1C7Y A;  2UUB L;  3GTO H;  4FF3 A;  2MNA A;  1EIH A;  5EGT A;  3S15 H;  1RIP A;  1YIJ A;  1UUP A;  3FKI G;  4R1J A;  3F2B A;  4ZAI A;  1HR0 Q;  3WOE A;  2H1E A;  5ELC A;  4JI2 L;  1QVG A;  1OO9 B;  1L1O C;  1ONL A;  1VQN A;  1Q46 A;  2RF4 A;  1VQ8 A;  3CQZ H;  4CJ0 B;  2R7Z G;  1F9S A;  2QDL A;  5KIX A;  5CV5 A;  1X9N A;  3NQT A;  1N32 L;  1G29 1;  1D7Q A;  1L0X B;  4KHZ A;  3R2I A;  5DM6 3;  5J1Z A;  5M5Y B;  1IBM L;  5AJ3 L;  3NUC A;  3M9B A;  1O78 A;  1X3F A;  1KQS A;  4JVZ A;  4TRD A;  4U68 A;  5I4D A;  4BBR H;  2B63 G;  1F9P A;  1SYB A;  3AB9 A;  1PDQ A;  1IYU A;  3NTH A;  4NB3 A;  2IPK D;  2AUK A;  1E1O A;  3DM1 A;  3HS0 C;  1LTT D;  2DJG C;  1SEB D;  5M3F B;  4UPA A;  1KNA A;  5H1S E;  2ZM6 Q;  3MFY A;  1TWA B;  4DGZ A;  1L1O B;  1K83 H;  2VS1 A;  3HOZ G;  5CV9 A;  3UE1 A;  3S1R B;  1OXT A;  1NNX A;  4PMC A;  1F77 A;  1MHW C;  1G2T A;  4GN5 A;  2KOL A;  1QUQ B;  3T51 B;  2UU9 Q;  3I70 A;  4Y52 H;  3E6Z X;  1JE5 A;  2JA6 H;  2B2V A;  4HJ7 A;  2FMM A;  3K5O A;  5A35 A;  4EQN A;  2ZTD A;  3H15 A;  5IYD H;  2K5W A;  3W2D A;  4LF8 L;  5IP7 H;  1WCM B;  2EDG A;  2JA7 H;  3SVM A;  1XMQ Q;  2EJM A;  2B2V C;  3QOJ A;  2F4V L;  1HRJ A;  5J3B A;  1Z47 A;  4DAP A;  1B9N A;  1SNP A;  4K2K A;  2JA8 B;  3LWU A;  1SN8 A;  5C3E G;  1BF4 A;  4J6H A;  1X6O A;  4O2D A;  4ZUI A;  2NVQ B;  4DV6 L;  1FGU A;  1PA6 A;  3RLN A;  2F3V A;  5K36 G;  2L4N A;  4WRD A;  3H09 A;  3PUW A;  5IE8 A;  1HPC A;  3TP6 A;  3D6C A;  4B3M Q;  3QO2 A;  4R4I A;  3A0J A;  1H9S B;  5CGK A;  3HOX G;  4H0L C;  4NDX A;  2EY1 A;  4KI0 A;  4JI5 Q;  1YEZ A;  4YCW A;  1BOS A;  4A3F B;  1J5E L;  1JOR A;  2KEE A;  4C56 C;  2ZM6 L;  1RF2 D;  4CKB A;  3KUP A;  1YJN A;  4A3D G;  5M5W B;  1ZKO A;  3D6W A;  3HOY B;  1Q90 A;  1CQV A;  1S5F D;  1TII D;  2KHS A;  4OON A;  4DFA A;  3K57 A;  2SOB A;  2VQF Q;  1XMO L;  3GDE A;  4KY5 A;  1UE7 A;  3E0J A;  4UP9 A;  2PI2 E;  3SDZ A;  1VMP A;  3VA5 A;  2BE5 D;  3PSI A;  4DAY B;  2A69 C;  2KA7 A;  3VYR A;  4LUO A;  3FVQ A;  4HMJ A;  2R7F A;  4JBM A;  4A3E G;  4C3I G;  4HN7 A;  5KNB A;  4HCS A;  2OQ0 A;  4C3J H;  1PYW D;  2ICE C;  4HCE A;  1VQI A;  1NJI C;  1K8G A;  1SBB B;  3JC6 6;  4YCU A;  3OMG A;  3A74 A;  4DAV A;  1IYV A;  5CBA E;  4AIM A;  1CT1 D;  3I4N B;  3K59 A;  4KY7 A;  4IN3 A;  3CC7 A;  3M7N A;  5CR3 A;  2F0E A;  1PH6 A;  3DEP A;  3IRB A;  5C4H A;  5M3M G;  1HNX L;  5C0X H;  3GTJ H;  1MKH A;  4RH6 A;  5M3M B;  1JQY D;  2F0Q A;  3FDT A;  2VUM G;  3FP9 A;  3C1F A;  4EQ5 A;  1ENF A;  1LO5 D;  1FNV A;  4IOA A;  1WCM H;  2WKC A;  1QZH A;  1WTX A;  3CPF A;  1NTG A;  4DK0 A;  5D3I B;  4C3J G;  1N34 Q;  4BY1 H;  1MSG A;  4DK3 C;  2KHI A;  4DNT B;  5A2Q E;  2L15 A;  1E24 A;  3I91 A;  4A93 G;  2DGY A;  2CVR A;  2LKV A;  5LMN Q;  3C2P A;  2Z9H A;  2UUC Q;  3G7L A;  4LFA L;  1SRU A;  2B2Y C;  1ZYR D;  5FLM G;  5L37 A;  3I4M H;  1XPO A;  1BCP C;  1WVL A;  1EQR A;  5IGF A;  1ENA A;  3F2D A;  5FKA C;  2B2W A;  2K5N A;  3TEH B;  2FJ2 A;  2ZJR A;  3KBX A;  4ID6 A;  1DOL A;  1X3G A;  1LT3 D;  4J1M A;  1PXU A;  3PUX A;  3MXG A;  1VQF A;  3EIV A;  1C4Q A;  3PO2 H;  3NQI A;  3KF8 B;  2L12 A;  1YNN D;  3IL8 A;  2WB1 G;  4JI8 Q;  2F0K A;  5GAH C;  1EOV A;  4K5X A;  4DV1 Q;  1B7Y B;  3DWQ A;  4UHV A;  5BN3 A;  1N34 L;  1EFW A;  1YNX A;  1EWH A;  1ZYR C;  4CDF C;  2EJF C;  4P2C B;  4A3F H;  1KTK A;  4DR1 Q;  1ILQ A;  4ULL A;  3KK7 A;  4GOP C;  4LF7 Q;  3A8J E;  1STY A;  3PO3 H;  1YZ6 A;  4OO1 G;  3ERQ A;  1IXR A;  2QIL A;  3GTP B;  4ME3 A;  1X32 A;  5LL6 S;  3TS2 A;  4ZK9 B;  1E7Z A;  2DN8 A;  5JOB A;  4A3B B;  4G7H C;  5COY A;  4R8I A;  4YCV A;  2ZJQ A;  1J9O A;  4YWL A;  5BR8 Q;  2EY6 A;  1PTO C;  2PW5 A;  2F0I A;  1HNX Q;  3GTM B;  1VS0 A;  3URY A;  1AE2 A;  5ISR A;  5IGD A;  4A3M G;  3GTL B;  3PIP 3;  1GUS A;  2K05 A;  4DUZ Q;  1G91 A;  1ESF A;  3S15 B;  4PNY A;  1D2B A;  2B8G A;  1N9W A;  1BBW A;  1NR4 A;  2ALY B;  4HSV A;  1D1K A;  1HZA A;  2IW3 A;  4HIK A;  3KDF A;  2HHH Q;  4F87 A;  2JA9 A;  1O7Y A;  4DV6 Q;  4F7X A;  4IFD H;  2MGS A;  4XTC S;  4BWG B;  1PH7 A;  1TWF B;  1MD2 D;  4MHE A;  4DXF A;  3M3Y H;  2F1M A;  1XNR L;  2E2D C;  3HRZ C;  4NPS A;  2A74 C;  1I4R A;  2NUC A;  4FF1 A;  1J8I A;  1EWC A;  1TWF H;  2L11 A;  1SE4 A;  1JWU D;  2A1A A;  4JI5 L;  4DR2 Q;  1GUG A;  2NWG A;  2K5Q A;  2YTY A;  5JPM C;  3AQQ A;  2I5M X;  1WTR A;  1V43 A;  2A69 D;  1Q8I A;  4BY7 H;  2V4D A;  2O5J C;  1CI3 M;  2NTT A;  1RKN A;  1FGB D;  2R7Z B;  1PFN A;  4X66 Q;  1QJO A;  2UXD L;  4N9T A;  1A2T A;  1PTO H;  2PI2 A;  2NVY B;  2F03 A;  3CRK C;  2A68 C;  1CKO A;  2M00 A;  3D31 A;  5IYB H;  1PV4 A;  2C5C A;  2R7Z H;  4OO1 I;  3H0G H;  4KJO A;  1IKL A;  4HR7 B;  5KND A;  3I72 A;  5AFW A;  1ICF B;  1CA5 A;  2XRQ D;  1EY0 A;  5C3E H;  3VR6 A;  2YU9 B;  2RSO A;  4A3L G;  5HGQ A;  1H95 A;  3RZO B;  1DM0 B;  4GOP A;  4B3T Q;  2EYP A;  3PGZ A;  2R93 B;  3J81 L;  4KK7 A;  4MTK A;  3I3C A;  2R93 G;  3T1Y L;  4J15 A;  1HNZ L;  3HKZ E;  1SND A;  3OYY A;  1HA6 A;  1XPR A;  5D65 A;  2PNR C;  4XT1 B;  2NVT B;  1PH1 A;  4Y7N B;  3A7L A;  4A3B H;  1VQH A;  3BDO A;  5IGB A;  3PO3 G;  3Q24 A;  4E6I A;  4JI4 Q;  1Y8O B;  2RCF A;  3EBE A;  4DU9 A;  5EBC A;  1LAC A;  1AZP A;  2CFM A;  1Y14 B;  4OL7 A;  5EKL A;  2RQX A;  4RGT A;  4PV1 C;  4LF5 L;  1B2T A;  1H9M A;  3TP5 A;  1CZG A;  1TS4 A;  1VQG A;  2N8N A;  3PO2 G;  3X3M A;  1UWV A;  4EGV A;  4KKT A;  4ZRZ A;  1L2F A;  1XWE A;  2HD3 A;  1F9R A;  4ALP A;  1GUW A;  5M5Y H;  1HZC A;  3MXP A;  4XT3 B;  4DAY A;  4JBK A;  4LFA Q;  2I5H A;  1BCP D;  3PV0 A;  4LF9 L;  3CU7 A;  1KC8 C;  1BR9 A;  3NEM A;  1WTO A;  1CHP D;  1X65 A;  4IFD G;  4KKS A;  1STN A;  1EYD A;  2O4X A;  2PCF B;  1A6X A;  2P5Z X;  1S4Z A;  1KNE A;  3QG1 A;  5ELE A;  2IL8 A;  3HOU B;  2LXJ A;  1I3Q B;  3ICE A;  2Z6K A;  2NB0 A;  4DR5 L;  4CJ1 B;  1XJV A;  2ZTC A;  4XQJ A;  2ID0 A;  1HTP A;  1EYC A;  4A3M H;  3L0O A;  4V0B A;  4BY7 B;  4OX9 L;  1PFM A;  3GTQ H;  3KDF B;  3NBH B;  4K6D A;  2Q2U A;  5JJI A;  2Z6K C;  2K04 A;  4K5V A;  1ILP A;  4XYQ A;  2HDL A;  1Q7Y C;  3WOF A;  1HNW Q;  5C5L A;  1I50 B;  4DUY Q;  3AEV A;  3S14 H;  2JA7 B;  2WII B;  2JA5 H;  1AW7 A;  2C9O A;  1S5D D;  3MFG A;  4ABN A;  3RUZ A;  4QUF A;  1VQB A;  1C48 A;  2F3I A;  3M4O H;  1GXD C;  3H0G B;  2NZH A;  3MC0 B;  1S3O A;  2R92 H;  1YHB A;  3MA2 B;  4DA2 A;  4MIU A;  3B6Y A;  3S1M B;  2HHH L;  1B70 B;  2K50 A;  3VR5 A;  3RN2 A;  3M4O B;  3N6R A;  1CM9 A;  1JR0 D;  1TS2 A;  1GUN A;  1V1P B;  4YWK A;  3ERS X;  2BE5 C;  4KHV A;  3ND8 A;  2HQE A;  4OIJ A;  4P71 A;  1WTP A;  2F0S A;  3I4M B;  4DR7 L;  3NPP A;  2A6H C;  2WV6 D;  3STB D;  1S5E D;  2VQF L;  4QL5 A;  1I6V C;  3KLR A;  2RDH A;  4JOI A;  1BCP F;  4C2M B;  5KNC A;  5BN5 A;  4Y7N H;  3BG3 A;  3F2C A;  1W3S A;  2G9D A;  2WP8 J;  2XWB B;  3CME A;  2R92 G;  2SNM A;  3D4D A;  1QNK A;  3SK8 A;  4L6T B;  3HOV G;  4A3I H;  4C2M H;  4LFC Q;  3ITP A;  5NUC A;  4RGM A;  5D14 A;  5M5W H;  2OEO A;  1MGS A;  1WCM G;  4DR2 L;  4RKL A;  2AKW B;  1ICW A;  2FIN B;  2JXM B;  3OWE B;  2XN9 C;  4NW2 A;  3BYT B;  5CV6 A;  1V8Q A;  3T1Y Q;  4UAI A;  3DWA A;  3TME A;  2Q2H A;  4L5S A;  1QVC A;  4OX9 Q;  2PMZ E;  1O7I A;  3HOV H;  3SK6 A;  1EY7 A;  4HJ9 A;  3BVM A;  5GAG C;  4HJA A;  3K5L A;  1PZI D;  4GLV B;  1SYC A;  1TY2 A;  1ZXT A;  4ZYS A;  1PHJ A;  1EL0 A;  2VY3 A;  4IFD J;  3SHL A;  3S24 A;  1TXY A;  1HCZ A;  4A3L H;  5JJK A;  1GKH A;  4APV A;  2H5X A;  4UP8 A;  5FO8 B;  4QUC A;  2VL6 A;  4B3S Q;  1G6Z A;  2YTV A;  3J81 E;  2JQO A;  3QOL A;  1EUJ A;  1HTL D;  1KD1 C;  4FDB A;  1QCB D;  4LF8 Q;  1U9R A;  1A2U A;  4X3T A;  1EYA A;  2CCZ A;  1OXS C;  3FMC A;  3K7U C;  1RTN A;  1PH5 A;  3CC4 A;  4JI2 Q;  1WFQ A;  1XNQ Q;  5HUR A;  4JG2 A;  4JC0 A;  1EEF D;  1LYL A;  1T9H A;  2FXQ A;  1XTD A;  1KDC A;  4RWS C;  3JAM i;  4BBS H;  4A3C H;  3GTQ B;  1NE3 A;  1JC7 A;  3S2H H;  3QWN A;  4JV5 Q;  2EXZ A;  5BR8 L;  1I6H B;  4JOI C;  2I0Q A;  4C3H B;  2BH8 A;  1MI2 A;  2OF1 A;  2RBM A;  3W3A A;  2K7V A;  4BY1 B;  1Y1V H;  2K75 A;  4DNI A;  2JA6 B;  1B9M A;  3TZD A;  2K01 A;  1K3R A;  3J80 i;  3ULP A;  4JI4 L;  1GVP A;  3GTG H;  3Q8D A;  4K2L A;  1I6H H;  2EYH A;  2LSS A;  4LFC L;  1XTC D;  4XDX A;  3NTK A;  2AWO A;  1Y1W H;  4A3C G;  2WAQ G;  4RHR A;  1YVC A;  4OO1 H;  1J6Q A;  3HOU G;  4WJW A;  4A3D B;  5T1G A;  2HDM A;  1GHK A;  1IW7 C;  4GKJ Q;  1SE2 A;  2WAQ B;  1PH2 A;  3J7Z C;  1PH9 A;  2XSC A;  3DMU A;  3BS1 A;  3FHW A;  1LTA D;  4B9X A;  3W5O A;  3J81 j;  1Y1W B;  2MO1 A;  1IL2 A;  4WJ3 M;  1I4Q A;  2DNE A;  2V1C C;  1PZK D;  2F4V Q;  1N32 Q;  2ASB A;  2RDF A;  3NHH A;  2BOS A;  3SEB A;  5JPN C;  2J0T D;  3T13 A;  1N36 Q;  1A63 A;  2E2H H;  4A3I B;  4K14 A;  1K8A C;  1HZ9 A;  3OIP A;  3KYH C;  2Q8T A;  1WOC A;  4MZ9 A;  2KVM A;  2VB2 X;  3L3O C;  4UY8 C;  2WAQ E;  1EIG A;  4CDC C;  1ASY A;  3H6M A;  2IX0 A;  2MFI A;  4K5W A;  5M3F G;  1A62 A;  1A3T A;  3J7A F;  4GNX A;  4JI0 Q;  3DLL A;  2IHF A;  4HMI A;  1A3U A;  5CMD A;  3HP3 A;  5JVH 3;  4WOR A;  1TWH B;  2PQA A;  1PH3 A;  2JA8 H;  2R61 A;  2A19 A;  1TWG H;  3CHB D;  5JJL A;  4G57 A;  3R3O A;  1M8A A;  2D2C C;  3EVQ A;  4CDD C;  3V96 A;  3K7A B;  4OWT B;  1LLR D;  3A8K E;  1PRT D;  2K14 A;  2KUM A;  3ONA B;  4FNF A;  1FJG Q;  3I56 A;  2E8G A;  4B3R Q;  4HIO A;  3CCM A;  4DR5 Q;  3D4R A;  1U0L A;  1MIU A;  5LMN L;  4C1N K;  1EQV A;  1DON A;  3A55 A;  4FO2 A;  3G4S A;  3FPU B;  1EEI D;  4TQU S;  1SNO A;  2OWO A;  3P20 A;  4B3S L;  2F0D A;  1OXV A;  2MUY A;  2D62 A;  2FMC A;  4C3H H;  1X3Q A;  3GV3 A;  5C44 B;  5HY6 A;  1N8R C;  1VF7 A;  4DN4 M;  1BNZ A;  3HOU H;  2M2L A;  1I4G A;  5CV4 A;  1VMC A;  1I3Q H;  1JMC A;  1ENC A;  4GS3 A;  2R6G A;  1TWC B;  4BXX G;  5IYC G;  3HOX B;  1TKW B;  2RHQ B;  1YJ9 A;  2F0N A;  1DCZ A;  1DOM A;  1V1Q A;  4RCN A;  4RHS A;  3NBH A;  4LFB L;  3PIO A;  2EYL A;  4DR1 L;  2WKD A;  1TWC H;  4R4O A;  3UDF A;  5E4W C;  2RDG A;  3NE5 B;  1L0W A;  3HOX H;  2EOT A;  1O7Z A;  5I2X A;  2DNC A;  5LMU L;  5DAU A;  2IY5 B;  2F0W A;  3OTO Q;  2AQ2 B;  1CSP A;  1IBM Q;  4QQB X;  4YHH Q;  2E2I B;  4TSS A;  3J80 E;  5I6Y A;  1KDB A;  1WTQ A;  4HIM A;  1WTV A;  2J7Z A;  2F0J A;  1WTH A;  4C3H G;  1EY4 A;  4JI1 L;  1ZEQ X;  4GNX C;  2WAC A;  4IO9 A;  5CBE E;  4K0K Q;  4A75 A;  3T1H Q;  3K8A A;  2E74 C;  3I2Z A;  2Y0S B;  3PUZ A;  2CH4 A;  2NVT H;  4HAE A;  1F2L A;  1JJC B;  1XNQ L;  3E9H A;  3PQI A;  4DV3 L;  1IHZ A;  1RDP D;  3NEL A;  1J5E Q;  1S5C D;  2HIV A;  2G5D A;  4RG1 A;  5IGG A;  4QIW B;  4ILW A;  3MAQ A;  1Q82 C;  2PMZ B;  2E5L Q;  3BJU A;  3KFU A;  1TWH H;  1HHV A;  5EPL A;  4DV1 L;  1EY8 A;  3I4O A;  4QY7 A;  3H3V H;  4KJN A;  4LF4 L;  4QF4 A;  2YV5 A;  1GO3 E;  4GZY C;  4ODG A;  3AU7 A;  3DM3 A;  1E1T A;  1GUT A;  1LM0 A;  5FJ8 H;  2AQ1 B;  3PUV A;  1GHJ A;  5KRU A;  1UE1 A;  3EJI A;  1FR3 A;  1B8A A;  2M9V A;  3FPP A;  4B3M L;  3E9I A;  1I4X A;  5C4J B;  2E76 C;  2KEC A;  3A5Z B;  1D8L A;  2E2J B;  3PO3 B;  1X54 A;  3L7Z C;  4ZCK A;  4PZ8 A;  2PPB C;  4FF2 A;  3GTP H;  2F0M A;  1VQ5 A;  3H3V I;  5LL6 X;  4DV0 L;  1UAP A;  4IUP A;  4UDU C;  3IAY A;  4JI1 Q;  3GTK H;  4DKA C;  1EZ8 A;  1TQO A;  5C4J H;  3NK9 A;  4Q0F A;  4X62 L;  4FYD A;  4H44 C;  4H7B A;  4LK1 C;  3I4N H;  3FKI B;  3CCQ A;  1XMQ L;  2F4I A;  2Z4I A;  5HGT A;  1U4R A;  4BY7 G;  1AEX A;  2E75 C;  3GTL H;  1CZW A;  1UE5 A;  4RKB A;  4IUV A;  1B3Q A;  1V1P A;  4MN3 A;  1VQJ A;  4GKK Q;  2G9H D;  3CCJ A;  1NBW A;  3CF5 A;  4FXK C;  3SK4 A;  1YHQ A;  1D5X C;  2NZO A;  1CHQ D;  1K3B C;  4QIW E;  3M7G A;  5JVG 3;  3NBI A;  1S5B D;  3MXN A;  5IIF A;  4AYB G;  1WD0 A;  1CSQ A;  2N78 A;  3F1Z A;  1VQL A;  3LGJ A;  1LT4 D;  3OW7 A;  5LHY 1;  3M3Y B;  4XYO A;  3U4Z A;  4H02 A;  4PQX A;  2Y0S E;  5C4X G;  1I94 L;  5E4X A;  3EFX D;  4JI8 L;  4I7A A;  4X62 Q;  3KJP A;  4LF6 Q;  5CV7 A;  4DPG A;  4L63 B;  3SK5 A;  1NMG A;  3RR5 A;  4M8A A;  5C0X I;  4V19 0;  2AWN A;  1E2W A;  2D5D A;  1X3P A;  5M5X B;  3S2D H;  5C3W A;  1ASZ A;  1WI5 A;  1JB7 A;  3OWF A;  2R7D A;  3MXU A;  2A6H D;  2R3Z A;  3JAM L;  3TBI B;  1PRT F;  3A7A B;  2RHS B;  4ZKB B;  3H0G G;  1X3E A;  5FJ8 G;  4R4T A;  2MPM A;  3UE0 A;  4A93 H;  2I5L X;  5IY0 A;  1QZG A;  4KLK A;  1QOH A;  4K8I A;  4AH6 A;  2NYZ D;  3CW2 C;  1PTO B;  1SNC A;  4CKC A;  1X55 A;  2AQ3 B;  3AYH B;  1EWI A;  3HOV B;  2R92 B;  2CQA A;  4RFB A;  4LFB Q;  1Q12 A;  1I94 Q;  2ZXO A;  4WJ4 A;  1LT5 D;  1PFS A;  4BA2 I;  4EVO A;  2HUG A;  1PTO F;  1S40 A;  4H13 C;  2LXK A;  4JV5 L;  2XGT A;  3U58 A;  1STB A;  4F88 A;  4QCL A;  3PMF A;  3NXW A;  2NN6 I; 
#chains in the Genus database with same CATH homology
 3STB D;  4LNQ A;  2VQF L;  4GN5 A;  4A3K H;  4QL5 A;  1WYD A;  2Q2T A;  1E3P A;  1QUQ B;  1N33 L;  4JOI A;  2HIX A;  4IPC A;  2MO0 A;  2UXB Q;  3BZC A;  2UU9 Q;  4X65 Q;  1VQ9 A;  3BU2 A;  3HKZ G;  4Y52 H;  2R93 H;  1JE5 A;  4Y7N H;  1A0I A;  2JA6 H;  2AHO B;  2K5V A;  2OTL A;  3F2C A;  1W3S A;  4HJ7 A;  2WP8 J;  2N3S A;  3WWV A;  3CME A;  1YIT A;  2R92 G;  2ZTD A;  3H15 A;  5IYD H;  4LF8 L;  5IP7 H;  3HOV G;  4A3I H;  4C2M H;  4LFC Q;  3HOW H;  2JA7 H;  4A3K G;  5M5W H;  5ELN A;  1WCM G;  1XMQ Q;  2F4V L;  1BKB A;  4DR2 L;  4X64 Q;  2AKW B;  5J3B A;  1Z47 A;  4GNX B;  4YWM A;  4DR6 L;  4LF7 L;  3T1Y Q;  2QEX A;  4R4Q A;  1SN8 A;  4RMF A;  5C3E G;  2Q2H A;  4L5S A;  1QVC A;  3F8T A;  3ULL A;  3CCS A;  4OX9 Q;  2PMZ E;  1VQK A;  1O7I A;  1X6O A;  3HOV H;  4O2D A;  3RLO A;  4HJ9 A;  3KOJ A;  4DV6 L;  1FGU A;  4QJF A;  5GAG C;  3RLN A;  4HJA A;  1PA6 A;  5K36 G;  4GLV B;  3E0E A;  4DV3 Q;  3PUW A;  5C0X J;  5IE8 A;  2VQE L;  1PHJ A;  1G6P A;  2E2I H;  5IT9 c;  1K0R A;  4B3M Q;  2K4K A;  2VY3 A;  4QGU A;  4AQY L;  3S16 H;  1SLJ A;  4IFD J;  3S24 A;  1TXY A;  3A0J A;  4R4I A;  5GAE C;  4A3L H;  5JJK A;  4LF9 Q;  1GKH A;  4APV A;  2H5X A;  2D0P A;  4UP8 A;  1KL9 A;  3OTO L;  2VL6 A;  4B3S Q;  2YTV A;  3HOX G;  2E5L L;  2JQO A;  1EUJ A;  1KD1 C;  2D0O A;  3G48 A;  4YHH L;  4FDB A;  4JYA L;  1JT8 A;  3CP0 A;  4LF8 Q;  2WFW A;  4LW1 A;  1IBL L;  4IFD I;  2CCZ A;  1OXS C;  3K7U C;  4GN3 B;  4EX5 A;  1PH5 A;  4DV0 Q;  4KI0 A;  5E7N A;  3TQY A;  3CC4 A;  1YEZ A;  4JI5 Q;  4YCW A;  4JI2 Q;  1A8V A;  1XPU A;  1WFQ A;  2JA8 G;  1VQ6 A;  1XNQ Q;  4JG2 A;  2OCE A;  1LYL A;  4JC0 A;  1LTL A;  4IJL A;  4P73 A;  1T9H A;  1X56 A;  1J5E L;  2JEA I;  1K9M C;  2UXD Q;  2FXQ A;  3J80 c;  2ZM6 L;  1CUK A;  3J7A 5;  1XTD A;  4BBS H;  3JAM i;  4B3T L;  4LUZ A;  1YJN A;  4A3D G;  5LMU Q;  4A3C H;  5IWA L;  1NE3 A;  1VQO A;  3S2H H;  4KHP L;  1XNR Q;  4TVA B;  3D0F A;  3HKS A;  3I7F A;  2A8V A;  2NVX H;  4JV5 Q;  4JBW A;  4B3R L;  1BVS A;  5C44 G;  4GLX A;  3MXN B;  1YBY A;  4OON A;  3UDG A;  1C9O A;  5BR8 L;  1R9T H;  3UDI A;  4JOI C;  1KAW A;  2F52 A;  2VQF Q;  2BH8 A;  2I0Q A;  1XMO L;  3GDE A;  3PUY A;  4DV5 Q;  1UE7 A;  1VCI A;  1Y1V H;  2K75 A;  4DNI A;  3VDY A;  4UP9 A;  1HZB A;  4A76 A;  1K3R A;  2PI2 E;  3J80 i;  3ULP A;  2UXC L;  3PSI A;  1KIX A;  2YU9 H;  5EAY A;  4JI4 L;  4DAY B;  1GVP A;  3U4V A;  2QA4 A;  3GTG H;  3Q8D A;  4LUO A;  5ELO A;  2YTX A;  3RZO H;  1I6H H;  2NN6 G;  2R7F A;  4DR3 L;  2JK8 A;  2LSS A;  4LFC L;  4JBM A;  4A3F G;  1CKM A;  4A3E G;  4NXM L;  5JEA J;  1SR3 A;  2AWO A;  2WB1 E;  1Y1W H;  4A3C G;  2WAQ G;  2OQ0 A;  5GQO A;  5FLM H;  1YVC A;  4C3J H;  1J6Q A;  3HOU G;  1VQI A;  3CMA A;  1NJI C;  1K8G A;  3OW2 A;  3GD7 A;  1EIF A;  3I4N G;  4GKJ Q;  1PH2 A;  5C44 H;  1U5K A;  3J7Z C;  3JC6 6;  4YCU A;  4DV4 L;  1PH4 A;  2VNU D;  3A74 A;  1PH9 A;  3GTM H;  5IYB G;  4AIM A;  3FHW A;  1VQM A;  3W5O A;  4LUV A;  1VQ4 A;  3CC7 A;  3J81 j;  3M7N A;  4A3J G;  1SE8 A;  1BBU A;  4DV7 Q;  1PH6 A;  1IYJ B;  3IRB A;  2MO1 A;  3M4Q A;  3M85 A;  2JA6 G;  3CCE A;  5M3M G;  3CCL A;  1Y1W G;  2PNH A;  3ZJY C;  1IL2 A;  4DR4 Q;  4WJ3 M;  4JI6 L;  4AYB E;  1HNX L;  2V1C C;  2UU9 L;  3UDX A;  2KEN A;  3GTJ H;  1MKH A;  4HJ5 A;  2JJQ A;  2F4V Q;  1N32 Q;  2HQL A;  2ASB A;  2VUM G;  1AE3 A;  2BH2 A;  3TRZ A;  3GO5 A;  3KJO A;  4A3I G;  1OTC A;  1UEB A;  2JE6 I;  3FP9 A;  2KHJ A;  1N36 Q;  3PCO B;  2DUD A;  1FL0 A;  4EQ5 A;  3CCU A;  1L1O A;  1WJJ A;  1M90 C;  4IOA A;  4JYA Q;  1KXL A;  1WCM H;  1QZH A;  2E2H H;  1A63 A;  4A3J H;  4OXP A;  4UP7 A;  3CPF A;  3KF6 A;  1KRS A;  1NTG A;  1HZ9 A;  4DR3 Q;  1K8A C;  1N34 Q;  4BY1 H;  4DK3 C;  2K5H A;  2KHI A;  3KYH C;  2L15 A;  1E24 A;  2B63 H;  1K73 C;  4A93 G;  1WOC A;  2OTJ A;  2DGY A;  4MZ9 A;  5LMN Q;  4UY8 C;  2WAQ E;  4DK6 C;  2UUC Q;  4L5T A;  4LFA L;  1SRU A;  5FLM G;  1YJW A;  1ASY A;  2IX0 A;  2MFI A;  5M3F G;  1A62 A;  3I4M H;  2IT1 A;  4GNX A;  1XPO A;  4JI0 Q;  4BBS G;  3DLL A;  2IHF A;  1EQR A;  1HJP A;  4JI3 L;  3F2D A;  4P74 A;  5C0X G;  2K5N A;  3TEH B;  1GD7 A;  2ZJR A;  4NXN Q;  2PQA A;  3AFP A;  1W2B A;  1PH3 A;  1HNZ Q;  1LUZ A;  3J81 c;  2JA8 H;  1X3G A;  3W1G A;  4PG3 A;  4IPD A;  3PUX A;  2A19 A;  4AQY Q;  1TWG H;  1VQF A;  2YYZ A;  4DV5 L;  3EIV A;  3NEN A;  5JJL A;  3PF4 A;  3PO2 H;  2N49 A;  4LF4 Q;  3KF8 B;  4BBR G;  2WB1 G;  1E22 A;  4K0K L;  4JI8 Q;  4OWT B;  5GAH C;  1EOV A;  2K14 A;  1MJE A;  1HR0 L;  1SMX A;  4DV1 Q;  1B7Y B;  2CWP A;  1N34 L;  2BA0 A;  1EFW A;  3FKI H;  3K80 C;  1FJG Q;  1YNX A;  3I56 A;  2E8G A;  3J81 i;  3I55 A;  4HIO A;  3CCM A;  4B3R Q;  4MTN A;  4A3F H;  4DR5 Q;  4DR1 Q;  1Y1V G;  2C35 B;  4GOP C;  1U0L A;  1MIU A;  2VQE Q;  5LMN L;  4LF7 Q;  1G51 A;  4LWC A;  4O0A A;  3PO3 H;  1YZ6 A;  4OO1 G;  1IXR A;  4ME3 A;  3G4S A;  4JBJ A;  3S1R H;  1GM5 A;  4PZ6 A;  4JI7 L;  2HT1 A;  2KBN A;  1E7Z A;  3TS2 A;  5IP9 H;  4TQU S;  4B3S L;  2OWO A;  4JI3 Q;  3A5U A;  3S1N H;  1OXV A;  3M4P A;  2D62 A;  3BZK A;  4IJH A;  4YCV A;  4YWL A;  5JEA G;  2ZJQ A;  3KLW A;  5BR8 Q;  4A3D H;  4C3H H;  5HY6 A;  1VQP A;  4HID A;  1N8R C;  1IBK Q;  1HNX Q;  1KHI A;  4P75 A;  1VS0 A;  3HOU H;  1AE2 A;  4R4C A;  3ULJ A;  1Q8K A;  4A3M G;  5IP7 G;  1I3Q H;  1HH2 P;  1JMC A;  4DUZ Q;  4DAM A;  4C3I H;  2EIF A;  4GS3 A;  1P16 A;  2R6G A;  4JCV E;  4HJ8 A;  1N9W A;  2CWA A;  1BBW A;  1QVF A;  4BXX G;  1OXX K;  1V9P A;  2ALY B;  4YY3 Q;  5IYC G;  2Z0S A;  1HZA A;  3CCV A;  4HIK A;  3KDF A;  4A3G G;  2RHQ B;  1YJ9 A;  2K52 A;  2HHH Q;  1V1Q A;  2JA9 A;  1VQ7 A;  1YHA A;  4DV6 Q;  4LF5 Q;  1QUQ A;  4LFB L;  3PIO A;  4DR1 L;  1I5F A;  1HNW L;  2E2J H;  1TWC H;  4XTC S;  1Q1B A;  4R4O A;  3UDF A;  4GLA C;  3L2P A;  1N33 Q;  4A3B G;  2PQA B;  1L0W A;  3HOX H;  1PH7 A;  4GKK L;  5LMU L;  1JJ2 A;  1Q81 C;  2IY5 B;  3M3Y H;  1XNR L;  3OTO Q;  3HOY H;  4NPS A;  1C0A A;  1CSP A;  1IBM Q;  4QQB X;  4YHH Q;  2XTI A;  2VW9 A;  2MQH A;  3K0X A;  4POG A;  2ATW A;  1TWF H;  4HIM A;  4X65 L;  1IBK L;  3PIP A;  2B29 A;  3G6E A;  2A1A A;  4JI5 L;  4JI1 L;  4DR2 Q;  4GNX C;  1S72 A;  1PVO A;  4BY1 G;  2YTY A;  2UXC Q;  4IO9 A;  1OXU A;  2VZA A;  1NMF A;  2I5M X;  3AQQ A;  4A75 A;  3PF5 A;  4LF6 L;  4K0K Q;  3I4M G;  3T1H Q;  1V43 A;  3K8A A;  4GOP B;  1IBL Q;  1Q86 C;  3PUZ A;  3I2Z A;  5IYD G;  5FLX c;  4BY7 H;  2NVT H;  1Z9F A;  3JAM c;  2Y0S G;  1JJC B;  3U50 C;  1XNQ L;  3E9H A;  4DV3 L;  3K7A H;  2JA7 G;  3HOW G;  4X66 Q;  3NEL A;  1J5E Q;  2UXD L;  2HIV A;  2UUC L;  2GVB A;  4GKJ L;  4DUY L;  2GVA A;  3ER0 A;  2CQO A;  4RG1 A;  2RCN A;  3S1M H;  2PI2 A;  3CXC A;  1SFO H;  1Q82 C;  2GN5 A;  1CKO A;  1M1K C;  3BJU A;  3D31 A;  1YI2 A;  2E5L Q;  3KFU A;  2QGQ A;  5IYB H;  3CCR A;  4A3E H;  1PV4 A;  1N36 L;  2R7Z H;  2CKZ B;  1TWH H;  1MJC A;  4OO1 I;  2KCT A;  3H0G H;  2Q2I A;  2OQK A;  4DV1 L;  2ZJP A;  1CKN A;  3I4O A;  4QY7 A;  5M3M H;  4NXM Q;  1P8L A;  3TRE A;  3H3V H;  4LF4 L;  5C3E H;  1EIY B;  2YV5 A;  1GO3 E;  3HFZ B;  4A3L G;  5HGQ A;  4PMW A;  1H95 A;  4GOP A;  1I50 H;  4OWW B;  4B3T Q;  1TWA H;  3DM3 A;  1E1T A;  1LM0 A;  3PGZ A;  5FJ8 H;  1RL2 A;  2IHE A;  3PUV A;  4PZ7 A;  3KF6 B;  3K81 C;  4DV7 L;  1UE1 A;  3RZD H;  1B8A A;  4MNO A;  3CC2 A;  2R93 G;  3RNU A;  3T1Y L;  2JA5 G;  4J15 A;  4POF A;  4P72 A;  1HNZ L;  2VUM H;  3MEF A;  3HKZ E;  1XMO Q;  5IP9 G;  4B3M L;  3OYY A;  3EN2 A;  1XPR A;  3E9I A;  4DV2 Q;  3CD6 A;  1CKN B;  1PH1 A;  4OWX B;  4A3B H;  4JI0 L;  1VQH A;  4DR7 Q;  1FVI A;  1VQD A;  3PO3 G;  4JI4 Q;  3A5Z B;  4XIG S;  3EBE A;  5GRO A;  1D8L A;  5DLQ E;  2UUB Q;  3CAM A;  1JJG A;  1X54 A;  3L7Z C;  2JEB I;  2CFM A;  1Y14 B;  4PZ8 A;  3GTP H;  3H3V I;  1VQ5 A;  3AFQ A;  3S17 H;  3SGI A;  4DV0 L;  2KCM A;  2UUA L;  2NVY H;  3STB C;  4JI1 Q;  3W1B A;  4IOC A;  4DKA C;  1EYG A;  4LF5 L;  4A4I A;  5M5X H;  5C4J H;  1SRO A;  3GTK H;  4DUZ L;  4DR6 Q;  4X62 L;  5M3F H;  4A3G H;  1VQG A;  2N8N A;  3PO2 G;  4YY3 L;  2AMC B;  5C4X H;  1UWV A;  4L5R C;  3HOY G;  1VQA A;  2ES2 A;  5IWA Q;  4JI7 Q;  3I4N H;  1L2F A;  3CCQ A;  3RN5 A;  1FJG L;  1XMQ L;  4BY7 G;  4ALP A;  2NVQ H;  3GTL H;  5M5Y H;  1UE5 A;  1HZC A;  2IX1 A;  4IPG A;  4NXN L;  1PH8 A;  4DR4 L;  4JBK A;  4LFA Q;  2UXB L;  2I5H A;  4JI6 Q;  2BA1 A;  4IPH A;  4DV4 Q;  1DGS A;  1VQJ A;  4GKK Q;  4BA1 I;  3CCJ A;  1VQE A;  1NBW A;  1NY4 A;  3PV0 A;  3CF5 A;  4LF9 L;  1KC8 C;  3NEM A;  1Q1E A;  1X65 A;  1YHQ A;  2NZO A;  4IFD G;  4QIW E;  5AJ3 Q;  3G71 A;  1C7Y A;  2UUB L;  3S1Q H;  4AYB G;  1VQL A;  1CSQ A;  2N78 A;  3F1Z A;  3GTO H;  1PYS B;  3LGJ A;  4GN4 B;  1VQC A;  2LXJ A;  2EQS A;  4X64 L;  3U4Z A;  2MNA A;  2ZTE A;  4H02 A;  3ICE A;  2Y0S E;  2Z6K A;  4DR5 L;  1XJV A;  1I94 L;  1RIP A;  2ZTC A;  3S15 H;  5C4X G;  4JI8 L;  4X62 Q;  4A3M H;  2ID0 A;  3FKI G;  4R1J A;  3KJP A;  5LMN W;  3L0O A;  1YIJ A;  4LF6 Q;  1KRT A;  3F2B A;  4DPG A;  1HR0 Q;  4OX9 L;  1NMG A;  3GTQ H;  3KDF B;  3RR5 A;  3NBH B;  5C0X I;  2Q2U A;  2AWN A;  1HR0 W;  2Z6K C;  4JI2 L;  3S2D H;  1QVG A;  5JJI A;  1IZ6 A;  5GAD C;  1ASZ A;  1L1O C;  4X66 L;  1WI5 A;  1Q46 A;  1Q7Y C;  1JB7 A;  1VQN A;  1HNW Q;  2RF4 A;  4L5Q A;  4DUY Q;  2R7D A;  3CQZ H;  1VQ8 A;  3AEV A;  2R7Z G;  3S14 H;  2JA5 H;  1X9N A;  4DV2 L;  1N32 L;  1G29 1;  2RHS B;  5IYC H;  1D7Q A;  4BXX H;  3H0G G;  1VQB A;  4KHZ A;  2F3I A;  1X3E A;  5FJ8 G;  3M4O H;  3HOZ H;  4R4T A;  1IBM L;  5AJ3 L;  3M9B A;  3UE0 A;  4A93 H;  2I5L X;  1X3F A;  5IY0 A;  1KQS A;  2B63 G;  1QZG A;  4BBR H;  4KLK A;  4AH6 A;  1UE6 A;  2NZH A;  3CW2 C;  1PYB A;  1S3O A;  2R92 H;  1YHB A;  1X55 A;  3B6Y A;  3AYH B;  2HHH L;  1EWI A;  4NB3 A;  2UUA Q;  4X6A H;  1E1O A;  2B3G A;  1B70 B;  2K50 A;  1EQQ A;  4LFB Q;  1Q12 A;  1I94 Q;  3RN2 A;  4WJ4 A;  1AH9 A;  1PFS A;  4BA2 I;  2EXD A;  4UPA A;  5H1S E;  2ZM6 Q;  4YWK A;  3T1H L;  3CPW A;  1L1O B;  1K83 H;  2VS1 A;  1S40 A;  3HOZ G;  3ERS X;  3RLF A;  3TS0 A;  3UE1 A;  4KHP Q;  1OXT A;  2LXK A;  4P71 A;  4DR7 L;  4JV5 L;  2XGT A;  3U58 A;  2NN6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...