4JOIC

Crystal structure of the human telomeric stn1-ten1 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
MLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CST complex subunit STN1
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 28
structure length 118
sequence length 118
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15490 Ten1_2 Telomere-capping, CST complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4joiC00
4BY7H 2PI2A 2RHQB 1XTDA 2PMZE 1D7QA 1TWGH 1FL0A 1W3SA 4L5QA 5JJIA 4GNXB 3PIOA 3S1NH 1C7YA 2B3GA 4RMFA 1IZ6A 2PQAA 1SRUA 4HJ5A 3A5ZB 2UXBQ 1Q82C 1CUKA 2UXDQ 4A3BH 1Q81C 4A3DG 1QVCA 3I55A 4JI0Q 4P74A 3K81C 3PUZA 4IJHA 2AWOA 4AQYL 1B70B 4LFCL 3S17H 2N78A 1K9MC 2A19A 2RCNA 2YV5A 3HOWH 4OO1I 1EUJA 4DV4Q 1G6PA 2HQLA 3B6YA 5FLMH 1B8AA 2VUMH 2NN6I 1FJGQ 4OWXB 2LXJA 3HOXG 3UE1A 4ALPA 1PH1A 2MO0A 1N36Q 3KDFB 2OQKA 4APVA 4GNXA 1J6QA 3NELA 3U50C 1KRSA 2A8VA 3NEMA 1KRTA 1YHBA 1I50H 3I4MH 1YHQA 1A62A 2YTXA 4GLVB 3K0XA 1X9NA 3CAMA 1YEZA 3LGJA 3RLNA 4DUYL 4L5SA 1KHIA 3AQQA 4JI1L 2IX0A 4YY3L 1IBKL 4A4IA 4DK6C 3ICEA 4JBWA 5LMNQ 4UY8C 4X65Q 4R4CA 5IYCG 4OO1G 2ZTDA 4B3SQ 5C44H 1H95A 1KAWA 1Z9FA 3I4OA 1V1QA 3CCJA 1NJIC 4GKKL 3G4SA 4JI4L 2NVTH 3IRBA 4OWWB 2NN6G 4YWKA 3BJUA 5GROA 5AJ3Q 1Y14B 2I5LX 3PCOB 3W5OA 1SMXA 5IYBH 2VQFL 4DUZQ 2BH2A 4X64L 1YIJA 5IY0A 4YCUA 1BBWA 4DK3C 3I56A 1KQSA 4LF9Q 1LYLA 1U0LA 1MJCA 1VQIA 2LSSA 4O2DA 4LUVA 1N33L 3CD6A 2VS1A 4GOPB 1NY4A 1Q8KA 1M1KC 2UUCL 2OQ0A 1L1OB 3CC2A 1GD7A 1XNQL 3AEVA 2MQHA 3CQZH 3AYHB 1YHAA 3K8AA 4L5TA 1SR3A 4DKAC 2A1AA 3PF5A 4NXML 2Y0SG 3HOYH 1QUQB 3I4NG 1PH5A 2B63H 2VL6A 2CCZA 1HNZL 4JI8Q 1PYSB 1Q46A 3STBD 1JJ2A 1VQNA 5C3EH 4LF7Q 4IPGA 1VS0A 3E0EA 2ZM6L 3CCUA 2NVXH 4DR3L 1EWIA 2E5LQ 4DV5L 2UUBQ 2UXCQ 4PMWA 5E7NA 1CSPA 4LUOA 3CP0A 4GN3B 1X55A 1JB7A 2AHOB 2IX1A 3CCLA 3GTQH 3KF6B 4R4IA 4B3TQ 1G51A 5C0XI 4A3IG 1UWVA 3NENA 1X3GA 2MO1A 4GLXA 5HGQA 4LF5Q 4YWLA 4B3RQ 4A3FH 2JA7H 2ES2A 2NVQH 1VQAA 4DV6Q 1P8LA 2UUAL 3BZKA 1IBLQ 4JBKA 4BXXG 4LF4L 2R7FA 3BU2A 4QJFA 2AWNA 4A93G 4X66L 4DAYB 3HOZH 1K83H 2YU9H 2VNUD 4OONA 5IP7H 1HH2P 1EQQA 2NVYH 4JI7Q 3JC66 3PO2G 2JA6H 5GADC 1LTLA 4BA2I 4A3LG 5IE8A 1U5KA 3S24A 5M3MG 1Q7YC 3KF6A 3HKSA 4YCVA 5C0XG 4RG1A 2GN5A 4LF8Q 2UXBL 2ZTEA 2HIVA 2UXDL 1T9HA 3U4VA 1EIFA 5M5YH 4JI5Q 1HZCA 1PFSA 4OWTB 4JI0L 4AYBE 2E2IH 2D0OA 1HNXQ 4IFDI 4GKJL 3HKZE 2K5VA 4A3CG 1UE1A 3CCQA 3S2HH 3EN2A 1X56A 2HIXA 3G6EA 4DV4L 5C4XG 1XNRQ 2ALYB 2KCMA 1GM5A 2ID0A 1KIXA 5GAGC 1FJGL 3M4QA 1XMQQ 4IPCA 2IHFA 1O7IA 4LUZA 4KI0A 4P72A 1N36L 4KHZA 2XTIA 4JI6L 1PVOA 2D0PA 2R7DA 3PUWA 3PO3H 2CQOA 2JJQA 3S15H 3GTLH 3GTJH 2K5NA 1HR0Q 4JI2Q 4DR1Q 1PA6A 3OTOQ 2VY3A 2JA9A 4A3GG 3J81j 4AIMA 4DV0Q 1IXRA 4R1JA 4OX9Q 3DM3A 4IFDG 3KLWA 3AFQA 5FJ8H 4X65L 1YZ6A 4DV3Q 4BBRG 5M3FH 1Y1WH 4B3SL 1IL2A 2N8NA 1E3PA 2R6GA 1NTGA 1SLJA 1SE8A 4LW1A 1K8GA 3A74A 5K36G 1YJWA 2JA5H 2R93H 4A3JH 4LF4Q 2KHJA 3UDFA 2JA8H 4JOIC 1OXVA 4POFA 3CC7A 4GN5A 1TXYA 3PIPA 1Z47A 4DUZL 2BH8A 1XPUA 4IO9A 3PF4A 2RHSB 3L0OA 4UP8A 1YBYA 4UPAA 4DV7Q 3RZOH 4LF9L 1CKOA 3T1HQ 2CWAA 2WB1E 4JI3Q 3M7NA 3CW2C 4X62Q 1EQRA 3CCRA 5BR8Q 4LWCA 5EAYA 3HOVG 4LNQA 1S40A 2OTLA 2QA4A 3J80i 5IYDG 4PG3A 4BBSG 2F4VQ 4JI8L 2E8GA 5GAEC 3S16H 3RZDH 1VQ9A 1LM0A 2OCEA 1UEBA 4LF7L 2F3IA 5IP9H 2VW9A 2R92G 4A3MH 3BZCA 4JG2A 2BA0A 3K7UC 4IJLA 2UUBL 4DR6Q 2K4KA 2JE6I 4A3EG 4WJ4A 2L15A 3TQYA 1CKNB 4DR5Q 2Q2IA 4IPDA 3UE0A 2YTYA 3KDFA 1Q1EA 4A3KG 1UE5A 2Y0SE 2JEBI 4TVAB 4DAMA 4DR2Q 1SFOH 3G71A 1OXXK 4EX5A 4LF5L 1MJEA 5DLQE 2KCTA 5H1SE 1K8AC 1VQJA 3CXCA 2FXQA 2VQEQ 4JC0A 4DR7Q 2ZJQA 3GTOH 4DV6L 3L7ZC 4P73A 5GQOA 3I2ZA 3TEHB 5IWAL 4GLAC 2H5XA 3F2BA 1NE3A 3A5UA 4LF6Q 4IFDJ 4HIKA 2IT1A 3PSIA 1OTCA 1TWFH 3WWVA 4JI7L 4LFCQ 4DV2Q 4A76A 3S1MH 1CKNA 4KLKA 3H3VH 4LFBQ 4LF8L 4QIWE 4KHPQ 3HOUH 5LMUQ 4JI5L 3HOZG 1GVPA 1HNXL 4GOPA 1VQKA 1XJVA 1NBWA 2YTVA 1WFQA 1L1OA 1E1OA 1WOCA 2QGQA 3FKIG 5IYCH 3F2DA 1XNRL 3A0JA 1N32Q 3KOJA 1Y1VG 4HJAA 1KC8C 1QUQA 1VQOA 1IBMQ 1RL2A 3MXNB 1EYGA 3GTPH 1LUZA 2I0QA 4TQUS 2CKZB 1VQMA 1IBKQ 4L5RC 4Y52H 2DGYA 3STBC 1YITA 2WFWA 3G48A 3I7FA 1HZBA 1MIUA 3OYYA 3J81i 1Q86C 4DR4Q 1HR0L 4R4OA 4C3HH 4DR1L 1V9PA 2K14A 1VQHA 3OTOL 1XPOA 3ZJYC 1L2FA 3OW2A 4IPHA 3M9BA 3RLOA 1HJPA 4GKKQ 4JV5Q 4WJ3M 1UE6A 4MNOA 1GO3E 1OXUA 4K0KQ 4OX9L 1Q1BA 2KHIA 2MNAA 1YVCA 1KXLA 1CKMA 2K5HA 4R4QA 3I4NH 1X54A 1AH9A 4YHHQ 4BY7G 1VQ5A 2R7ZG 5M5WH 4DPGA 2K52A 4JOIA 2I5MX 1VQ7A 3PUXA 1XNQQ 4HJ8A 3T1YQ 1QVGA 2JEAI 3M3YH 1WCMH 3ULJA 1MKHA 1VQCA 5FLXc 1C9OA 5IT9c 2HHHQ 4NB3A 4DV7L 4A3BG 1VQDA 2Z6KC 3M4OH 1E1TA 4JI3L 3PGZA 2R93G 4A3IH 2OWOA 4X62L 3S1QH 3J7A5 4XIGS 1GKHA 5BR8L 4GS3A 3HOWG 1QVFA 1HNWQ 4DNIA 4JBMA 3PV0A 3J81c 3PUYA 1X3EA 3GD7A 5FLMG 1PH8A 2F4VL 4XTCS 2VUMG 1JJCB 3RNUA 3TS0A 1VQBA 4J15A 5GAHC 2UU9Q 3W1BA 1YNXA 2PQAB 4MTNA 1RIPA 3HFZB 1PH4A 2HT1A 4BXXH 5JEAG 5LMNL 4A93H 3I4MG 1WJJA 4DV1Q 1JMCA 4DR6L 3PO2H 4A3LH 1KL9A 3FHWA 3UDXA 4DR5L 4LFAQ 1PH2A 4X6AH 5HY6A 2QEXA 5AJ3L 1TWAH 4JBJA 2I5HA 1ASYA 4HIMA 2UUAQ 4B3MQ 1XMOQ 4DR2L 5IP9G 4GN4B 4A3MG 1TWCH 1PV4A 4X66Q 5C44G 1BKBA 3NBHB 3U58A 4A3CH 2VQEL 4HIDA 3H3VI 3S14H 4DR7L 5C4XH 1SROA 3H0GH 2WAQG 5ELNA 2GVAA 1JJGA 2KBNA 3CC4A 2AMCB 3UDIA 5IYBG 3K80C 5LMNW 4LF6L 5C0XJ 4JYAQ 4C3IH 4OXPA 3ULPA 2CWPA 3E9IA 1VQ8A 3EIVA 4DV2L 4GKJQ 2E2HH 4BY1H 3KFUA 3KF8B 4NXNQ 4LFBL 1OXSC 1S3OA 1XPRA 1FVIA 3F1ZA 2BA1A 3JAMi 2E5LL 1SN8A 3HOYG 4KHPL 2UXCL 4A3GH 3D0FA 1N34Q 1FGUA 2N49A 5LMUL 2B63G 1DGSA 4JI6Q 1A63A 4FDBA 1BBUA 5C3EG 4B3TL 1WYDA 2V1CC 1VCIA 1J5EQ 2VZAA 4B3RL 1I94Q 1AE2A 1IYJB 4YWMA 4BBRH 3CF5A 1VQLA 1N32L 1I94L 1Q12A 3GTGH 4A3DH 1VQ6A 4BA1I 1P16A 1IBML 3HOUG 1M90C 2YYZA 1X3FA 3FP9A 1X6OA 5M5XH 1D8LA 2GVBA 2WB1G 1IBLL 4DR4L 1E7ZA 3TRZA 1S72A 3F8TA 4NPSA 5JEAJ 2Q2HA 3HOXH 2N3SA 3ULLA 4QY7A 4EQ5A 3ERSX 2K75A 4R4TA 2XGTA 4C2MH 4JV5L 3J80c 3TREA 4AQYQ 4A3FG 2JA7G 2Q2TA 2CFMA 5C4JH 3M85A 2C35B 4AH6A 3CPWA 2ASBA 4K0KL 3CCSA 1N8RC 3HOVH 2EXDA 2Q2UA 1NMGA 4BBSH 5IYDH 2WP8J 3MEFA 3CMAA 1PH3A 3JAMc 4YHHL 3KJPA 4IOAA 2OTJA 3S2DH 4P71A 1N9WA 2PNHA 5IP7G 2R92H 4GNXC 2JA6G 3T1YL 1VQEA 1HZ9A 3F2CA 4A3EH 1A8VA 2Z6KA 2HHHL 1JE5A 3CCVA 4DUYQ 2ZTCA 1XMQL 1I6HH 3W1GA 4JI1Q 2F52A 4YY3Q 4A3KH 1ASZA 3H15A 2LXKA 1B7YB 1PHJA 1EIYB 4MZ9A 1JT8A 4JI2L 3J7ZC 2E2JH 1WCMG 1VQFA 2IHEA 1HNWL 3CCEA 2IY5B 1A0IA 3UDGA 2NZHA 4QQBX 1V43A 4JI4Q 5ELOA 1K3RA 1C0AA 4JCVE 3CMEA 1VQGA 2ZJRA 1R9TH 4QL5A 1UE7A 4DV0L 2UU9L 3D31A 3CPFA 3M4PA 2R7ZH 3PO3G 2VQFQ 4X64Q 1BVSA 2ZJPA 4Y7NH 1PYBA 2MFIA 4C3JH 4DV1L 4DV3L 1EFWA 4UP7A 1K73C 2ATWA 1PH9A 3S1RH 1N33Q 3GO5A 4ME3A 4IOCA 1QZHA 3CCMA 4LFAL 1WI5A 2UUCQ 1EOVA 2Z0SA 3E9HA 4PZ6A 4B3ML 3TS2A 4PZ8A 1XMOL 1OXTA 3RN5A 5IWAQ 2EQSA 2NZOA 1I5FA 4HJ9A 4NXMQ 1HZAA 5FJ8G 2RF4A 1HR0W 5M3FG 1HNZQ 1Y1WG 3T1HL 5JJLA 3ER0A 1YI2A 2JA5G 1I3QH 2DUDA 4A3JG 3VDYA 1X65A 1L0WA 3FKIH 3AFPA 3GTKH 2ZM6Q 1TWHH 2JA8G 1E24A 1E22A 1AE3A 3DLLA 4DR3Q 1VQPA 1YJ9A 4HIOA 3SGIA 4DV5Q 1QZGA 1Y1VH 4POGA 2AKWB 4JYAL 4PZ7A 4A75A 3Q8DA 1PH7A 3GTMH 2PI2E 4HJ7A 5JJKA 3PUVA 1VQ4A 2K50A 4NXNL 4GOPC 1PH6A 4O0AA 1L1OC 3H0GG 3EBEA 3U4ZA 1W2BA 3RLFA 2KENA 1KD1C 2JQOA 1N34L 4P75A 4QGUA 3KJOA 1YJNA 2D62A 5J3BA 1K0RA 4YCWA 2WAQE 5M3MH 4H02A 1G291 2EIFA 2B29A 3RR5A 4AYBG 3RN2A 1J5EL 4UP9A 3KYHC 3GDEA 1CSQA 4BY1G 3K7AH 3HKZG 1NMFA 3L2PA 2JK8A
chains in the Genus database with same CATH superfamily
4BY7H 2KHSA 2WKCA 1K0SA 1D7QA 1FL0A 4L5QA 3NTKA 1TWFB 1NSNS 5C3EB 1IZ6A 4OEMB 2PQAA 3LWUA 4HJ5A 1Q82C 4A3DG 1QVCA 4JI0Q 2PO4A 2MUYA 4AQYL 2HDMA 1V1PB 2F0VA 4RH6A 1EUJA 3K58A 3OMGA 1G6PA 5FLMH 3BG3A 4RGTA 4UDUC 2Z4HA 4APVA 1EEFD 3U50C 1KRSA 4A3FB 3I4MH 4IZ8A 1YHQA 4IUTA 3A8KE 4C3HB 3RLNA 4L5SA 2EY5A 1KHIA 1IBKL 4YY3L 4A4IA 4UY8C 2G5DA 4X65Q 4K8IA 4R4CA 1EY4A 1KAWA 2Y0SB 4DNTB 4HMJA 4OWWB 5A2QL 4YWKA 5E3FA 2I5LX 3PCOB 1SDFA 2X6LA 4X64L 3M3YB 1W6JA 4YCUA 4OELB 4DK3C 4LF9Q 4O2DA 2LSSA 3Q22A 1N33L 3CD6A 1PFBA 1M1KC 2XWBB 3MXGA 3CC2A 1GD7A 2MQHA 3CQZH 4L5TA 4A3IB 3K8AA 3S1QB 2Y0SG 2K33A 3MXUA 1PH5A 2B63H 3SK5A 2VL6A 1NAPA 1HNZL 4JI8Q 1B3QA 1JC7A 2CW0C 1DM0B 4IPGA 1VS0A 4DR3L 1GOZA 2UUBQ 4J6HA 4PMWA 5I2XA 4FNFA 2F0QA 3CCLA 3BYYB 4A3IG 3NENA 1X3GA 2OT2A 4GLXA 3EJIA 5HGQA 3IAYA 3R8BA 1B2TA 5KNBA 2NVQH 4G7OC 2UUAL 4G57A 3TP7A 4RFBA 4LF4L 4BXXG 2A74C 3NWSA 3KLSA 4A93G 4FXDA 1EYAA 1K83H 2VNUD 4X3UA 2A6HC 1HH2P 4YIJA 3K59A 3HKSA 5EBDA 2HIVA 1A3VA 4JI0L 4AYBE 2L0CA 1UE1A 1X56A 2HIXA 3BS1A 2O5JC 4IPCA 1PDQA 2NZ1D 1HFNA 1WTRA 3S15H 4KN7C 2LY7A 1HR0Q 4J1MA 5CC4A 2NBFA 4AIMA 4H0LC 5CV4A 4X65L 1YZ6A 4DV3Q 4BBRG 3MAQA 2N8NA 2B39A 1NTGA 1SLJA 5K36G 3EA6A 4A3JH 3UDFA 3DUZA 1S5DD 4GN5A 5CBAE 1W6KA 4IO9A 1XPUA 4K6LA 4MTKA 3H91A 4LF9L 1OO9B 3M7NA 1EQRA 4A3KB 1S40A 5C3XA 2OTLA 2QA4A 3J80i 2RSNA 4JI8L 2E2JB 2E8GA 3V05A 3S16H 1VQ9A 1SMYD 2OCEA 1UEBA 2K01A 5IP9H 4A3MH 3BZCA 3K7UC 2UUBL 3KK7A 4Q0FA 4C3JB 2L15A 5I4DA 1BR9A 1I4RA 3KDFA 4KY6A 4A3KG 4DAMA 2E76C 4DR2Q 4CDFC 4CJ1B 4IUVA 2KQ3A 1K8AC 2FXQA 1EFID 5E1FA 2ZJQA 2F0UA 5GQOA 5LL6X 3I2ZA 5IWAL 4GLAC 2H5XA 3MFGA 3A5UA 3F2BA 4HIKA 2IT1A 2VB3X 1OTCA 3H6MA 1TWFH 3NPPA 3NTHA 2MP1A 3H3VH 4LFBQ 4MN3A 2A68C 3HOZG 2NTTA 1KLGD 1STAA 4GOPA 1VQKA 3SVMA 4GZYC 2YTVA 1L1OA 5M3MB 2QGQA 3QB3A 3TSSA 3OMCA 4HJAA 1KC8C 1VQOA 3GTPH 1EYGA 3TP5A 3T4AC 4Y52H 1AP0A 2DGYA 3GQBA 1Q86C 3I7FA 1MIUA 4EQNA 1HR0L 1LT3D 2RKSA 3HP3A 4C3HH 2K14A 1VQHA 1XPOA 2QDBA 1HJPA 4K2LA 2QCPX 4MNOA 1OXUA 5DAUA 1Q1BA 2K5HA 4R4QA 3HOWB 4M8AA 2G9HD 3BDCA 5M5WH 4A3GB 4DPGA 4JOIA 2CQAA 1J9OA 3M3YH 1QVGA 3T1YQ 2JEAI 1BQQT 2PZWA 2B8FA 3PIP3 1VQDA 1UAPA 2EE1A 2Z6KC 3C1EA 5E4WC 4CKEA 4DAYA 1HPCA 5CV7A 4A3IH 2VB2X 5FOBB 3S1QH 4XIGS 1D1KA 3HOWG 1QVFA 4ZUIA 4JBMA 2F0NA 1X3EA 4KKTA 1ET6A 3RNUA 1AW7A 3T13A 1BNZA 2CH4W 2UU9Q 3W1BA 1YNXA 4MTNA 1PH4A 4BXXH 5KNCA 5LMNL 1EWCA 4A93H 2WAQB 1F2ZA 3OPOA 1AFPA 2XIWA 3I90A 3OWFA 2B2UA 4KV6A 1ASYA 2I5HA 4B3MQ 1C8CA 4DR2L 4GN4B 3TBIB 4X66Q 1XXGA 2H4OA 1CQFA 1KABA 5I2YA 3QR8A 3NBHB 4HIDA 2BCOA 3L3OC 2WAQG 1JJGA 2AMCB 1Q90A 1TR5A 4IALA 3E9IA 1VQ8A 5D3DA 1JOKA 4GKJQ 4LFBL 1OXSC 1FVIA 1GXDC 2BA1A 1S5CD 2E5LL 5EPKA 1SEBD 1FGUA 2EY2A 3JAME 4JI6Q 3A55A 3D6CA 3NBHA 1PTOD 1WYDA 4B3TL 4C56C 2OXPA 1J5EQ 1I94Q 4BBRH 3CF5A 1G2SA 3SDZA 2PW7A 2YU9B 3FP9A 1MSGA 3LNNA 2WB1G 3Q24A 2JA6B 1E7ZA 1S72A 4NPSA 4ID6A 2K75A 2E2DC 3NP8A 1Y1VB 3TDQA 4ZK9B 3DWQA 5C4JH 1F2MA 2ASBA 5D3IB 1N8RC 2EXDA 4KY7A 3MEFA 4XT3B 3S2HB 2EYPA 1WD0A 2OTJA 4P71A 2PNHA 2EYOA 2JA6G 3T1YL 4F8MA 1HZ9A 2SNMA 4FF2A 3F2CA 2MGSA 4FXGC 1SJED 4DUYQ 4JI1Q 1ASZA 4A3KH 2F0KA 1JICA 2LXKA 1PHJA 1EIYB 1DOKA 4MZ9A 1JT8A 4JI2L 3J7ZC 2E2JH 2IHEA 1L0YB 2IY5B 1LT4D 5ELOA 1Y1WB 4B08A 2ZJRA 4DV0L 2UU9L 3CPFA 2JA8B 1EFWA 1PYBA 2MFIA 4C3JH 2DNCA 4C1NK 1FR3A 3GO5A 3DMUA 3HRZC 3AU7A 3CHBD 2Z0SA 3D4RA 3E9HA 4B3ML 3RN5A 1I5FA 4NXMQ 3RD4A 3KUPA 3NBIA 5FJ8G 1HR0W 5M3FG 1Y1WG 2C5CA 3T1HL 1YI2A 2F0HA 4G7ZC 3RZDB 3AFPA 5JPMC 2JA8G 1E24A 3P7JA 4AYBB 3DHQA 4PZ7A 1B4OA 4ZKBB 3GTMH 1EQTA 1LTBD 2PI2E 4JPBW 3FDTA 3PUVA 2K50A 5G3LD 4GOPC 1PH6A 4PV1C 1L1OC 1PRTD 1KD1C 1ICFB 4C3IG 5J22A 2D62A 3MC0B 5M3MH 2EIFA 4AYBG 1J5EL 3CW2C 1I94L 1LTGD 3GTOB 4V0BA 2PMZE 1TWGH 1SYCA 4LJZC 5JJIA 1I4XA 3PIOA 2A6EC 2B3GA 3TZUA 1RDPD 3M7GA 2XN9C 4EQPA 3A5ZB 2UXBQ 5EKIA 3SR1A 1T5XD 2KEDA 2Z4IA 4DXFA 1DYQA 4P74A 3PUZA 4IJHA 1SYBA 3F2UA 1I4GA 3HOUB 4LFCL 4L8JA 4QF4A 1H9SA 2RCNA 2YV5A 4LMQD 4ZLTF 3HOWH 2JXMB 1LABA 1F9QA 1FJGQ 1TS4A 2LXJA 1PH1A 2MO0A 1EY8A 2KCNA 3HG9A 1PZJD 3MVVA 3NELA 2D2CC 4G4KA 3T51B 4IUNA 1JWSD 3CAMA 3QOJA 4DUYL 2EVBA 4JI1L 2IX0A 1PLFA 3FMCA 4DK6C 2J0TD 4DF7A 3ICEA 3KF8A 3I4OA 4H13C 1V1QA 4GKKL 1B9NA 1XX8A 1DJRD 3G4SA 1SNCA 2LS01 2R61A 1GJXA 2B2UC 1K8OA 1WTVA 1KDBA 4JK1C 1WCMB 1BCPC 1KQSA 2Q8IB 1LYLA 1VQIA 4LUVA 1NY4A 1Q8KA 1ONLA 3M4OB 5FLXL 3SEBA 3M4YA 1SNQA 1GUSA 1YHAA 1ZKOA 5IT9L 3A7AB 3VR6A 4NXML 3I4NG 1QUQB 4MHEA 4QUCA 5KNDA 1Q46A 2ICEC 1EU3A 5A2QE 1EWIA 3H09A 2QF7A 2UXCQ 1SAPA 5FKAC 3P1HA 1VF5C 1CSPA 2IX1A 1TT2A 4GN3B 1JB7A 1TS3A 4R4IA 3PO2B 1X32A 2B2VA 1CA5A 1TWAB 2MO1A 4HSPA 3ND9A 5JOBA 4LF5Q 2NYZD 1Y69U 3E5SA 4DN4M 3BVGA 3BZKA 4JBKA 3S14B 1EY9A 2AWNA 3J81E 2YU9H 1O7LA 2TMPA 3PO2G 4A3LG 2JA6H 5GADC 1YNJD 4PNYA 4RA8A 1VMPA 1Q7YC 4RG1A 3FPPA 5IGEA 4LF8Q 2UXBL 4NDXA 3U4VA 1EIFA 4FP5D 4JI5Q 1HZCA 1PFSA 1IW7D 2D0OA 1HNXQ 2F0DA 4IFDI 3HKZE 4A3CG 4CKCA 3CCQA 3S2HH 2JSOA 3EN2A 3G6EA 2EDGA 2KJXA 1XNRQ 2ALYB 2K5WA 2KCMA 3N6RA 1Y8PB 2ID0A 4XYOA 1FJGL 1UNSA 1XMQQ 5ELBA 4E6IA 1GUGA 3GTGB 4KI0A 1FNVA 4A3DB 2XTIA 4DK1A 2JJQA 1PTOB 2F3WA 1QWYA 2K5NA 5I6YA 3KLRA 4N8X1 4PMCA 2JA9A 3C46A 4IUPA 4R1JA 4IFDG 5FJ8H 3R2TA 2HCIA 1RTOA 5COYA 5M3FH 1Y1WH 1IL2A 3EROA 1GUOA 1WTQA 4NKLA 3I3CA 4LF4Q 3PQIA 2KHJA 5FO7B 2JA8H 4QMGA 3VYTA 1OXVA 1S4ZA 1X3PA 4POFA 3PIPA 1SNOA 4X3KA 1CI3M 2ZXOA 3DWPA 2RHSB 1YBYA 1EIHA 4HR7B 4UPAA 1LTRD 5IGGA 1CKOA 3K6OA 4A3EB 2WB1E 3GTPB 4X62Q 1EWHA 5BR8Q 3I8ZA 4LWCA 5EAYA 1ILQA 5IYDG 4BBSG 1EU4A 4QCLA 3QO2A 1G8ZD 1S5BD 3RZDH 4K5XA 3CRLC 1KAAA 5ELCA 2F3IA 3MA2B 1SYGA 4DGZA 1R9TB 1V1PA 1EY7A 3DWAA 1Z6HA 1FNUA 4A3EG 3TQYA 3UE0A 2YTYA 1SXTA 1CFMA 2I07B 2XRQD 1JWMD 2K03A 4TVAB 5M5WB 1NR4A 1IKMA 2EJMA 3EFXD 5DM73 4Q5VA 4EX5A 3G71A 1T5EA 2KECA 4LF5L 5DLQE 5H1SE 1VQJA 4JC0A 4DR7Q 3GTOH 4P73A 3BDOA 3GTKB 3E6ZX 1NE3A 4LF6Q 1CHPD 2FHTA 1V8QA 1O80A 2F03A 2Q8TA 4OIKA 1JCKB 3J81L 4LF8L 4KTAA 3ITPA 4QIWE 1IYVA 3HOUH 4A93B 3BDLA 4JI5L 2D9UA 1VDZA 1HNXL 1IKLA 3Q6SA 1WFQA 1N32Q 1XNRL 1PRTB 2PQEA 3A0JA 2FMMA 3MXNB 4KHVA 1QCBD 1LUZA 2I0QA 4CBVA 2CKZB 2L12A 3MZ5A 4L5RC 3STBC 1YITA 2NUCA 4FXKC 4R8IA 1DOMA 4K5VA 4DR4Q 3S1NB 5JAVA 5DM63 4R4OA 1V9PA 2BE5D 1L2FA 3M9BA 1CT1D 1A15A 2QW7A 1YNNC 3FPUB 1SJHD 3S17B 1F9PA 3I4NH 3PIO3 4FO2A 5ISRA 2A69C 1HA6A 2VUMB 1D6EC 1PYWD 2OF1A 1XNQQ 1WCMH 3ULJA 1RHPA 4OIJA 1I50B 1C9OA 5EKLA 4BBRB 2HHHQ 4NB3A 1PXUA 4CJ2C 3M4OH 1LTSD 5KYLA 2R93G 4X62L 2EYMA 4RWSC 5BR8L 2L1BA 4GS3A 3W2DA 4B9XA 5JJZA 1JOOA 2EPBA 1XTCD 3J81c 3NQIA 3GD7A 2VUMG 3TS0A 2B2YA 2EZVA 2HT1A 3HFZB 4KY5A 5JEAG 2F0MA 5C4JB 1G2TA 2F3VA 1JMCA 2TSSA 1H9KA 4PQXA 3PO2H 1GUNA 4LK1C 4A3LH 1KL9A 3UDXA 1KTKA 5HY6A 2QEXA 1TWAH 2L11A 4HIMA 5EKKA 2E75C 1PV4A 3W3AA 4JW0A 1M8AA 2B2WC 4QB4A 3HOYB 5IIFA 4KJOA 2WIIB 3U58A 1D5MC 4IQZA 2LFNA 4A3CH 3S14H 4DR7L 3K5LA 1SROA 5ELNA 5IYBG 4DFAA 4U673 4LF6L 1Y8OB 5C0XJ 4JYAQ 4OXPA 2CWPA 2AQ3B 3I4LA 3GV3A 3GTQB 3NK9A 4FVMA 3TP8A 1XPRA 5KGUA 3JAMi 3U9OA 1SN8A 3HOYG 4CKBA 3D0FA 1N34Q 3GP7A 4K14A 2EOTA 5ELEA 4IFDH 2JA7B 1HFGA 1VCIA 1E2VA 2IX3A 4RHSA 1AE2A 1N32L 1FD7D 3GTGH 4A3DH 1A2TA 1ICWA 1PTOH 3FRPB 3P20A 3HOZB 2XWJB 1STHA 1RKNA 3IKJA 1X6OA 1D8LA 5M5XH 1LV9A 1SBBB 4DR4L 1AZPA 1AZQA 2Q2HA 1AEXA 2N3SA 2F0GA 2HUGA 2XGTA 2CW0D 3TREA 2JA7G 5M5YB 2C35B 3CCSA 1ZYRC 3GTMB 2E2IB 5I9PA 4M1UB 1PZKD 4BBSH 5IYDH 1EY6A 3KJPA 2EY6A 3EVQA 5NUCA 1KLUD 5IGFA 1TKWB 3PO3B 3GTLB 3GTJB 1HQMC 4A3EH 1HUNA 1A8VA 3H3VC 2HHHL 1JE5A 3CCVA 1MD2D 3W1GA 1TWGB 1STGA 3H15A 5CR3A 2A6HD 1VQFA 1PZID 1A0IA 2F1MA 3UDGA 4QQBX 1V43A 2EY1A 4JI4Q 3D6WA 3J7AF 4JCVE 3LX0A 2EYJA 1R9TH 3D31A 4HCEA 2JA5B 3VYUA 3M4PA 3PO3G 2O4XA 2VQFQ 1BVSA 4DV3L 4ZYSA 4UP7A 1SSOA 3H94A 3CCMA 3RZOB 2UUCQ 3Q0AA 1HZAA 4F7XA 4L6TB 4MIUA 1RF2D 4ZAIA 2JA5G 3GTKH 1X65A 3A7LA 4S3SA 1YJ9A 3DLLA 2LMCB 1HUMA 3DM1A 4POGA 1HRJA 4JYAL 2IL8A 2RVLA 5F2DA 5CBEE 1HQRD 4UAIA 1VQ4A 1NUCA 1CTMA 4EGVA 3H0GG 3EBEA 3U4ZA 2JQOA 1N34L 1BO0A 5J3BA 1K0RA 3R2IA 4H02A 2G9DA 2K28A 2AUJD 1JOQA 3RR5A 3CRKC 3TMEA 4UP9A 3KYHC 2M00A 1CSQA 4BY1G 3HKZG 5BN4A 1KDAA 1LTID 2ZXRA 1XTDA 1QG7A 4GNXB 2K6AA 3S1NH 1C7YA 4RMFA 2H1EA 1SRUA 3KBGA 3S1MB 1CUKA 2UXDQ 4N9TA 2D5DA 1Q81C 3I55A 2E74C 3K81C 3S17H 2N78A 3K0YA 2A19A 1Q3LA 4FF4A 4OO1I 4IN3A 4DV4Q 2L5TA 2WB1B 3VR3A 1B8AA 2VUMH 2NN6I 3HOXG 3UE1A 2PW5A 1N36Q 5EGTA 4GNXA 1J6QA 1SNPA 5JEAH 2PYKA 3NEMA 1KRTA 1YHBA 1I50H 1CQVA 4RGMA 1A62A 2DJGC 2YTXA 5K36H 3K0XA 1X9NA 1YEZA 4N9PA 1IYUA 1K3BC 1Q8IA 4JBWA 3VA5A 5IYCG 4OO1G 2KEEA 4B9WA 3CCJA 3QJYA 1NJIC 4JI4L 3IRBA 2NN6G 1SYDA 1RJTA 5AJ3Q 3CU7A 2BH2A 3W5OA 5IYBH 2VQFL 2F0WA 4DUZQ 2A68D 2BDOA 1PRTF 5T1IA 5IY0A 3I56A 1BBWA 2RSOA 5LHY1 1U0LA 2WV6D 3K5NA 3C3LA 2VS1A 2DJFC 2UUCL 1I4HA 1STYA 3AEVA 5CV8A 3NE5B 3PF5A 2R7ZG 4DKAC 3HOYH 2A1AA 4P2CB 3O13A 2CCZA 1G91A 3N52A 1JJ2A 1VQNA 4QIWB 1K8MA 3TZDA 4LF7Q 3NQTA 3E0EA 4K5WA 3FEWX 4G7HC 1TQOA 1DCZA 1JR0D 2JYOA 5E7NA 1JORA 5M3FB 1Z7TA 1X55A 3GTQH 3KF6B 1G51A 4ZCKA 5C0XI 1CK1A 5FLXE 2WACA 4YWLA 4CDEC 3J7YW 1MGSA 4KKSA 5IT9E 2JA7H 2ES2A 1SE4A 4I7AA 2X6GA 1NCVA 4XQQA 1IBLQ 2RCFA 3BVZA 2R7FA 5IGDA 4QJFA 4X66L 1FYCA 3HOZH 4OONA 1GHKA 2K05A 4F87A 2AQ2B 4JI7Q 4C3IB 1LTLA 1U5KA 3S24A 3TN2A 3KF6A 1WVLA 5C0XG 2GN5A 2ZXPA 2UXDL 5M5YH 2DN8A 4OWTB 4DNRB 2E2IH 3OIQA 4GKJL 4WJWA 1MSHA 1X3QA 3QOLA 3I73A 4DV4L 1GM5A 1PMRA 1EYDA 4C1NI 5GAGC 3M4QA 2IHFA 1O7IA 4LUZA 4JI6L 1N36L 3R93A 4CDDC 2D0PA 2R7DA 3PUWA 4IURA 3PO3H 4HN7A 2J4XA 3GTLH 3GTJH 5CV5A 1H9RA 1WTWA 4DR1Q 1C48A 5C6AA 3HZXA 3J81j 5KYIA 1IXRA 5DEHA 3DM3A 1CZWA 3KLWA 3AFQA 1QJOA 3FVQA 2HQEA 3HOVB 3J80L 4LW1A 1K8GA 5EQ0A 1YJWA 2JA5H 1GUWA 3A54A 4JOIC 3S2DB 2F0IA 1Z47A 4DUZL 2BH8A 3PF4A 4UP8A 3L0OA 5TSSA 4K2KA 3RZOH 3U9SA 4WRDA 3X3NA 2CWAA 4JI3Q 1BOSA 3QWNA 3CCRA 4RGNA 3HOVG 1F9SA 1WTXA 1O7YA 3HS0C 4PG3A 2A5HA 4LF7L 1A3UA 4FF3A 5CV9A 2VW9A 1DOLA 1HTPA 2BA0A 2DY8A 4IJLA 5D65A 3HEJA 4DR6Q 3I4NB 3A8JE 3I70A 2JE6I 4Y7NB 4WJ4A 1CKNB 4DR5Q 1LT5D 4IPDA 3S1RB 2JEBI 1TS5A 1F2YA 4DXGA 2CVRA 4H7BA 3T53B 3MFYA 2VQEQ 2R3ZA 3L7ZC 2XRSD 3FKIB 1TWHB 2F0LA 4FF1A 3SXHA 3WWVA 4JI7L 4DV2Q 3S9WA 3S1MH 1CKNA 4KLKA 2KUMA 1D5ZC 4KHPQ 1I4QA 4OGQC 1XYIA 1LO5D 2F0EA 1XJVA 4UHVA 1NBWA 3FKIG 1R4QB 2MJ8A 1E1OA 1WOCA 5IYCH 3SHLA 1QE6A 5IGCA 2Z9HA 1QUQA 4HSVA 4ZRZA 3VA7A 1IBKQ 3A8IE 3WDNA 1HZBA 4DR1L 1ENAA 2F4IA 4IPHA 3RLOA 3OW2A 2ENBA 3VR4A 3Q23A 3PMFA 4DU9A 1UE6A 1GO3E 3MHBA 4K0KQ 2MNAA 2KHIA 4K6DA 2O5IC 4YHHQ 2EXZA 1U4MA 2K52A 1VQ7A 2JP1A 1WTPA 1MKHA 4JVZA 5FLXc 2DNEA 2NTSA 5IT9c 4A3BG 1B53A 1DD2A 5A35A 2QKIC 3DXJC 1E1TA 4JI3L 2OWOA 3J7A5 5LL6S 1TIID 1D2BA 4KD3A 5M5XB 3PV0A 5IODA 2A6ED 4XTCS 5C44B 1VQBA 5GAHC 2PQAB 1RIPA 1WJJA 4IUUA 4DR6L 4TRDA 4BBSB 4RKBA 4LFAQ 4DR5L 1LACA 4JBJA 2UUAQ 1XMOQ 5IP9G 4A3MG 1TWCH 4RCNA 5C44G 2VQEL 5CORA 3H3VI 4LAAA 2KBNA 5JVH3 3UDIA 1V1OA 5AFWA 2K7VA 2NVXB 1E2ZA 4C3IH 3BYTB 3EIVA 4DV2L 4KN4C 1I4PA 1S3OA 1HA5A 1ZEQX 4ILWA 4CDCC 4KHPL 1HXYD 2UXCL 1G6ZA 2SEBD 1DZ1A 1DGSA 1MI2A 1ML0D 1B50A 1BBUA 5C3EG 2VZAA 3WOEA 1TU2B 1IYJB 1BCPD 3I72A 3D4DA 1Q12A 1B9MA 3OWEB 5KIXA 1VQ6A 4BA1I 1AN8A 1P16A 1M90C 5IOCA 5ELDA 2AQ1B 3OHXC 1SMYC 2NVYB 4U68A 1LT6D 5FO8B 1IHZA 2MHVA 3ULLA 1CA6A 3ERSX 4C2MH 5M9OA 3OW7A 2V4DA 4A3FG 2Q2TA 3M85A 4K0KL 3HOVH 1NMGA 1XWEA 1E0BA 2WP8J 3CMAA 3DEOA 4C3HG 4YHHL 3LWEA 3KBXA 5CV6A 3S2DH 5IP7G 3IL8A 4HAEA 2XNAC 5JPNC 4XQJA 1VQEA 5J1ZA 1BF4A 1HTLD 2PCFB 3A56A 4XYQA 2Z6KA 1MHWC 1XMQL 2ZTCA 2HCCA 2B2TA 3BVMA 3NTIA 3SK6A 4O1NA 1TY0A 3TP6A 3CCEA 2NZHA 1K3RA 4KKUA 1QNUA 3CMEA 1C0AA 1VQGA 4QL5A 4XDXA 2R93B 2ZJPA 4Y7NH 2ATWA 2XSCA 1PH9A 3S1RH 4IUQA 4ME3A 3MXNA 4IOCA 1QZHA 4LFAL 4PZ6A 4PZ8A 1XMOL 1O7ZA 1OXTA 5IWAQ 2EQSA 4HJ9A 2ICIA 1JQYD 2RF4A 3V2TA 4OHJA 1SNDA 1GHJA 3ER0A 1Y8NB 4R8NA 3FKIH 2ZM6Q 1TWHH 4L63B 1VQPA 4HCSA 4HIOA 4DV5Q 2EJFC 1QZGA 2K5DA 2OEOA 2WKDA 1VMCA 2B2VC 3RLFA 1SFOB 4ME5A 3KJOA 1MBYA 1D5XC 1G291 2PMZB 2B29A 2O2LD 3K5MA 2PPBC 3GDEA 3SGIA 2PNRC 2GA4B 3L2PA 2J7ZA 2PI2A 3K57A 2RHQB 5C4HA 1W3SA 2KA7A 2BOSA 3E3XA 2K04A 1O78A 3VR2A 2N55A 5K5PA 1BUVT 3V96A 4HMIA 4A3BH 1JWUD 3MWYW 2ZT9C 2AWOA 1B70B 5C5LA 1K9MC 1KDCA 1EQVA 1EEID 2M2LA 2HDLA 2HQLA 3B6YA 5KEEA 4DAPA 4OWXB 2NB0A 4ALPA 3KDFB 2OQKA 2RDFA 2A8VA 2F0JA 4XQNA 1E2WA 3SE0A 3C1FA 2IPKD 4GLVB 4ODGA 3LGJA 3KLSX 2IJ0A 3AQQA 1BDOA 4OL7A 1H9JA 2BDNA 2M9VA 1ET9A 5LMNQ 3T16A 2IWHA 3R3OA 2ZTDA 4B3SQ 5C44H 4V190 1H95A 1Z9FA 1I6VC 2NVTH 3BJUA 5GROA 1EY0A 1Y14B 1S5ED 1SMXA 1PTOC 2WINB 1YIJA 2RDHA 5BN5A 1MJCA 1UEAB 1J8IA 2PZTA 4GOPB 5CMDA 2OQ0A 1L1OB 1XNQL 1TS2A 3AYHB 2X69A 1SR3A 2IW3A 4C3JG 1PYSB 1DXMA 3STBD 5C3EH 1JE4A 1FGBD 2SOBA 3WOFA 2ZM6L 2NVXH 3CCUA 1EL0A 4N8FA 2E5LQ 1M4VA 4DV5L 5T1GA 1U4LA 1YNND 4LUOA 3CP0A 2AHOB 4B3TQ 1UWVA 1BBXC 4BWGB 1B44D 2A69D 1HHVA 2SNSA 4A3FH 4NW2A 1SE2A 1VQAA 3BZDB 2QEJC 4DV6Q 3OIPA 1P8LA 1PTOF 4ULLA 3BU2A 5C4XB 3H0GB 3CKIB 4DAYB 2JN4A 5IP7H 1EQQA 2NVYH 3JC66 4BA2I 2EYFA 5IE8A 3X3MA 5M3MG 4CGYB 4PMBA 4YCVA 2P5ZX 4BY1B 2E2HB 2ZTEA 3HKZB 1T9HA 2L9HA 2K5VA 5C4XG 3QIAA 5CYUA 1KIXA 1D1IA 4RGOS 1DONA 4P72A 4KHZA 2LKVA 3SK8A 4ZKCB 1PVOA 2CQOA 2B2TC 1ENFA 4I65A 1RD9D 1ESFA 4JI2Q 5HGTA 1BCPB 3OTOQ 5EBCA 1PA6A 2VY3A 5J39A 4A3GG 4K8JA 3HOXB 1NNXA 4DV0Q 4OX9Q 2Z1CA 3L9AX 1C4QA 4B3SL 1E3PA 2R6GA 1PRTC 1SE8A 3A74A 2R93H 1WTHA 4Z9CB 1II3A 1A2UA 3CC7A 1TY2A 1TXYA 2Z8LA 2R92B 3EQLC 1WTOA 1QILA 2FMCA 4DV7Q 4XT1B 3HGBA 1LLRD 3T1HQ 2CH4A 3D3RA 2F0TA 3D8GA 1SYEA 1I6HB 4LNQA 2F4VQ 1CZGA 5GAEC 1LM0A 3J80E 1B1ZA 2B2YC 2R92G 1SYFA 2K32A 4JG2A 1QB5D 2R7ZB 2K4KA 5KRUA 1RTNA 5IGBA 1ZYRD 2Q2IA 4TKOB 1Q1EA 1UE5A 2Y0SE 1SFOH 1ESRA 1U4PA 5G3LF 1OXXK 1MJEA 2QDLA 1WD1A 2KCTA 3NSWA 1K28A 3NUCA 3CXCA 4DV6L 1I3QB 1ILPA 3TEHB 1A6XA 4IFDJ 1KNAA 3PSIA 2QILA 2A73B 3T56B 5JVG3 1TVXA 4LFCQ 1EYCA 4A76A 2PZUA 5E4XA 1EZ8A 5LMUQ 3NHHA 3UI2A 1GVPA 4X3SA 3SK4A 4B3RQ 3URYA 3F2DA 1U4RA 1LTAD 2B8GA 1B3AA 3KOJA 1Y1VG 3K7AB 3AB9A 1TWCB 1IBMQ 1RL2A 4BY7B 4QUFA 4TQUS 1VQMA 1PFNA 4WORA 2WFWA 3G48A 3OYYA 1BXTA 1ENCA 3J81i 3G7LA 3OTOL 2N88A 3ZJYC 2C9OA 4GKKQ 4WJ3M 4JV5Q 4FYDA 4F88A 5BN3A 4XXEA 4OX9L 1KXLA 1YVCA 3QG1A 1CKMA 1X54A 1AH9A 2L55A 1R4PB 1STNA 1VQ5A 4BY7G 4NP5A 1KNEA 1H9MA 2I5MX 3PUXA 5C5MA 1S5FD 1STBA 4HJ8A 2KVMA 1VQCA 2KOLA 3RUZA 3I4MB 4KJNA 1F77A 4DV7L 2EJGC 4RCOA 1EOTA 5FO9B 3PGZA 5EPJA 2I46A 1L0XB 5ELFA 1GKHA 4HEDA 1YNJC 3GV6A 3MEHA 4DNIA 1HNWQ 3I91A 2EYHA 3PUYA 5FLMG 2F4VL 1PH8A 1JJCB 2HD3A 1HCZA 3DEPA 4J15A 4C2MB 1IW7C 1QNKA 3I4MG 4DV1Q 3RMHA 4HTHA 5EJWA 3OOCA 3FHWA 4O42A 1PH2A 3IFTA 1H9SB 4X6AH 5D14A 5AJ3L 4DA2A 3JAML 1VF7A 4J8QA 2Q8RE 3CQZB 3NXWA 1BKBA 2B63B 2FJ2A 5C4XH 3ONAB 3E0JA 3H0GH 1STEA 2GVAA 3CC4A 2K1BA 4DK0A 3K80C 5LMNW 3C2PA 4RKLA 3ULPA 3VYSA 3D4WA 2E2HH 4BY1H 3KFUA 3KF8B 4NXNQ 1SNMA 4I7ZC 3F1ZA 4NMZA 5DNFA 4KMUC 5L37A 3ZYYX 5C3WA 4A3GH 4R9WA 2N49A 1EIGA 2RDGA 3VR5A 5HURA 5LMUL 2B63G 2RA4A 1A63A 2MPMA 4FDBA 2V1CC 2NVQB 1RCVD 4B3RL 2F0OA 4YWMA 4ZUJA 1VQLA 2F0SA 2Z6BA 2EYLA 1IBML 3HOUG 2L4NA 2RBMA 1K83B 2YYZA 1X3FA 2GVBA 4KK7A 1IBLL 5I9OA 2VXWA 2AUKA 1CM9A 3TRZA 2KCCA 3F8TA 5JEAJ 3HOXH 4EQ5A 4QY7A 4R4TA 4JV5L 3J80c 4EVOA 4AQYQ 1UUPA 1QOHA 2CFMA 3CPWA 1LTTD 4AH6A 4ABNA 2Q2UA 5EPLA 5CGKA 1PH3A 3JAMc 4IOAA 5I6WA 1N9WA 4H44C 2R92H 1RODA 4GNXC 4DAVA 4OO1H 1SE3A 2FFKB 3S15B 3K5OA 2NN6H 1I6HH 3P75A 4BS9A 1A3TA 2F52A 4YY3Q 2XVSA 2CHBD 1B7YB 4RHRA 3OSOA 1WCMG 4KD4A 1HNWL 1JB3A 2RQXA 4X3TA 4A3BB 4CHTB 1PFMA 1UE7A 1F2LA 2F0PA 4A3JB 2F0FA 2R7ZH 4X64Q 3AMUA 4DV1L 1NR2A 1K73C 1EZ6A 1CHQD 1N33Q 1WI5A 1ZXTA 3IFDA 1EOVA 4WFN3 3TS2A 4CJ0B 2NZOA 1FNWA 1U9RA 3J7AV 3MTSA 2B2WA 1BCPF 1HNZQ 2DY7A 5JJLA 2BE5C 3NWTA 3G6JB 1GUTA 1I3QH 2DUDA 2K5QA 3VDYA 1L0WA 4A3JG 3MXPA 3S16B 4EQOA 1E22A 1AE3A 4DR3Q 4TSSA 1Y1VH 4A3MB 2AKWB 4A75A 3ND8A 3Q8DA 1PH7A 1EY5A 2SDFA 1IL8A 4HJ7A 2NVTB 5JJKA 4NXNL 4O0AA 2FINB 3ERQA 1W2BA 4ZQ3A 2NWGA 4P75A 4QGUA 1YJNA 3VYRA 4YCWA 1F9RA 2WAQE 4RAUC 5FK9C 5C0XH 3RN2A 5C4ZA 2KENA 3K7AH 1NMFA 2JK8A
chains in the Genus database with same CATH topology
4BY7H 2PI2A 2RHQB 1XTDA 2PMZE 1D7QA 1TWGH 1FL0A 1W3SA 4L5QA 5JJIA 4GNXB 3PIOA 3S1NH 1C7YA 2B3GA 4RMFA 1IZ6A 2PQAA 1SRUA 4HJ5A 3A5ZB 2UXBQ 1Q82C 1CUKA 2UXDQ 4A3BH 1Q81C 4A3DG 1QVCA 3I55A 4JI0Q 4P74A 3K81C 3PUZA 4IJHA 2AWOA 4AQYL 1B70B 4LFCL 3S17H 2N78A 1K9MC 2A19A 2RCNA 2YV5A 3HOWH 4OO1I 1EUJA 4DV4Q 1G6PA 2HQLA 3B6YA 5FLMH 1B8AA 2VUMH 2NN6I 1FJGQ 4OWXB 2LXJA 3HOXG 3UE1A 4ALPA 1PH1A 2MO0A 1N36Q 3KDFB 2OQKA 4APVA 4GNXA 1J6QA 3NELA 3U50C 1KRSA 2A8VA 3NEMA 1KRTA 1YHBA 1I50H 3I4MH 1YHQA 1A62A 2YTXA 4GLVB 3K0XA 1X9NA 3CAMA 1YEZA 3LGJA 3RLNA 4DUYL 4L5SA 1KHIA 3AQQA 4JI1L 2IX0A 4YY3L 1IBKL 4A4IA 4DK6C 3ICEA 4JBWA 5LMNQ 4UY8C 4X65Q 4R4CA 5IYCG 4OO1G 2ZTDA 4B3SQ 5C44H 1H95A 1KAWA 1Z9FA 3I4OA 1V1QA 3CCJA 1NJIC 4GKKL 3G4SA 4JI4L 2NVTH 3IRBA 4OWWB 2NN6G 4YWKA 3BJUA 5GROA 5AJ3Q 1Y14B 2I5LX 3PCOB 3W5OA 1SMXA 5IYBH 2VQFL 4DUZQ 2BH2A 4X64L 1YIJA 5IY0A 4YCUA 1BBWA 4DK3C 3I56A 1KQSA 4LF9Q 1LYLA 1U0LA 1MJCA 1VQIA 2LSSA 4O2DA 4LUVA 1N33L 3CD6A 2VS1A 4GOPB 1NY4A 1Q8KA 1M1KC 2UUCL 2OQ0A 1L1OB 3CC2A 1GD7A 1XNQL 3AEVA 2MQHA 3CQZH 3AYHB 1YHAA 3K8AA 4L5TA 1SR3A 4DKAC 2A1AA 3PF5A 4NXML 2Y0SG 3HOYH 1QUQB 3I4NG 1PH5A 2B63H 2VL6A 2CCZA 1HNZL 4JI8Q 1PYSB 1Q46A 3STBD 1JJ2A 1VQNA 5C3EH 4LF7Q 4IPGA 1VS0A 3E0EA 2ZM6L 3CCUA 2NVXH 4DR3L 1EWIA 2E5LQ 4DV5L 2UUBQ 2UXCQ 4PMWA 5E7NA 1CSPA 4LUOA 3CP0A 4GN3B 1X55A 1JB7A 2AHOB 2IX1A 3CCLA 3GTQH 3KF6B 4R4IA 4B3TQ 1G51A 5C0XI 4A3IG 1UWVA 3NENA 1X3GA 2MO1A 4GLXA 5HGQA 4LF5Q 4YWLA 4B3RQ 4A3FH 2JA7H 2ES2A 2NVQH 1VQAA 4DV6Q 1P8LA 2UUAL 3BZKA 1IBLQ 4JBKA 4BXXG 4LF4L 2R7FA 3BU2A 4QJFA 2AWNA 4A93G 4X66L 4DAYB 3HOZH 1K83H 2YU9H 2VNUD 4OONA 5IP7H 1HH2P 1EQQA 2NVYH 4JI7Q 3JC66 3PO2G 2JA6H 5GADC 1LTLA 4BA2I 4A3LG 5IE8A 1U5KA 3S24A 5M3MG 1Q7YC 3KF6A 3HKSA 4YCVA 5C0XG 4RG1A 2GN5A 4LF8Q 2UXBL 2ZTEA 2HIVA 2UXDL 1T9HA 3U4VA 1EIFA 5M5YH 4JI5Q 1HZCA 1PFSA 4OWTB 4JI0L 4AYBE 2E2IH 2D0OA 1HNXQ 4IFDI 4GKJL 3HKZE 2K5VA 4A3CG 1UE1A 3CCQA 3S2HH 3EN2A 1X56A 2HIXA 3G6EA 4DV4L 5C4XG 1XNRQ 2ALYB 2KCMA 1GM5A 2ID0A 1KIXA 5GAGC 1FJGL 3M4QA 1XMQQ 4IPCA 2IHFA 1O7IA 4LUZA 4KI0A 4P72A 1N36L 4KHZA 2XTIA 4JI6L 1PVOA 2D0PA 2R7DA 3PUWA 3PO3H 2CQOA 2JJQA 3S15H 3GTLH 3GTJH 2K5NA 1HR0Q 4JI2Q 4DR1Q 1PA6A 3OTOQ 2VY3A 2JA9A 4A3GG 3J81j 4AIMA 4DV0Q 1IXRA 4R1JA 4OX9Q 3DM3A 4IFDG 3KLWA 3AFQA 5FJ8H 4X65L 1YZ6A 4DV3Q 4BBRG 5M3FH 1Y1WH 4B3SL 1IL2A 2N8NA 1E3PA 2R6GA 1NTGA 1SLJA 1SE8A 4LW1A 1K8GA 3A74A 5K36G 1YJWA 2JA5H 2R93H 4A3JH 4LF4Q 2KHJA 3UDFA 2JA8H 4JOIC 1OXVA 4POFA 3CC7A 4GN5A 1TXYA 3PIPA 1Z47A 4DUZL 2BH8A 1XPUA 4IO9A 3PF4A 2RHSB 3L0OA 4UP8A 1YBYA 4UPAA 4DV7Q 3RZOH 4LF9L 1CKOA 3T1HQ 2CWAA 2WB1E 4JI3Q 3M7NA 3CW2C 4X62Q 1EQRA 3CCRA 5BR8Q 4LWCA 5EAYA 3HOVG 4LNQA 1S40A 2OTLA 2QA4A 3J80i 5IYDG 4PG3A 4BBSG 2F4VQ 4JI8L 2E8GA 5GAEC 3S16H 3RZDH 1VQ9A 1LM0A 2OCEA 1UEBA 4LF7L 2F3IA 5IP9H 2VW9A 2R92G 4A3MH 3BZCA 4JG2A 2BA0A 3K7UC 4IJLA 2UUBL 4DR6Q 2K4KA 2JE6I 4A3EG 4WJ4A 2L15A 3TQYA 1CKNB 4DR5Q 2Q2IA 4IPDA 3UE0A 2YTYA 3KDFA 1Q1EA 4A3KG 1UE5A 2Y0SE 2JEBI 4TVAB 4DAMA 4DR2Q 1SFOH 3G71A 1OXXK 4EX5A 4LF5L 1MJEA 5DLQE 2KCTA 5H1SE 1K8AC 1VQJA 3CXCA 2FXQA 2VQEQ 4JC0A 4DR7Q 2ZJQA 3GTOH 4DV6L 3L7ZC 4P73A 5GQOA 3I2ZA 3TEHB 5IWAL 4GLAC 2H5XA 3F2BA 1NE3A 3A5UA 4LF6Q 4IFDJ 4HIKA 2IT1A 3PSIA 1OTCA 1TWFH 3WWVA 4JI7L 4LFCQ 4DV2Q 4A76A 3S1MH 1CKNA 4KLKA 3H3VH 4LFBQ 4LF8L 4QIWE 4KHPQ 3HOUH 5LMUQ 4JI5L 3HOZG 1GVPA 1HNXL 4GOPA 1VQKA 1XJVA 1NBWA 2YTVA 1WFQA 1L1OA 1E1OA 1WOCA 2QGQA 3FKIG 5IYCH 3F2DA 1XNRL 3A0JA 1N32Q 3KOJA 1Y1VG 4HJAA 1KC8C 1QUQA 1VQOA 1IBMQ 1RL2A 3MXNB 1EYGA 3GTPH 1LUZA 2I0QA 4TQUS 2CKZB 1VQMA 1IBKQ 4L5RC 4Y52H 2DGYA 3STBC 1YITA 2WFWA 3G48A 3I7FA 1HZBA 1MIUA 3OYYA 3J81i 1Q86C 4DR4Q 1HR0L 4R4OA 4C3HH 4DR1L 1V9PA 2K14A 1VQHA 3OTOL 1XPOA 3ZJYC 1L2FA 3OW2A 4IPHA 3M9BA 3RLOA 1HJPA 4GKKQ 4JV5Q 4WJ3M 1UE6A 4MNOA 1GO3E 1OXUA 4K0KQ 4OX9L 1Q1BA 2KHIA 2MNAA 1YVCA 1KXLA 1CKMA 2K5HA 4R4QA 3I4NH 1X54A 1AH9A 4YHHQ 4BY7G 1VQ5A 2R7ZG 5M5WH 4DPGA 2K52A 4JOIA 2I5MX 1VQ7A 3PUXA 1XNQQ 4HJ8A 3T1YQ 1QVGA 2JEAI 3M3YH 1WCMH 3ULJA 1MKHA 1VQCA 5FLXc 1C9OA 5IT9c 2HHHQ 4NB3A 4DV7L 4A3BG 1VQDA 2Z6KC 3M4OH 1E1TA 4JI3L 3PGZA 2R93G 4A3IH 2OWOA 4X62L 3S1QH 3J7A5 4XIGS 1GKHA 5BR8L 4GS3A 3HOWG 1QVFA 1HNWQ 4DNIA 4JBMA 3PV0A 3J81c 3PUYA 1X3EA 3GD7A 5FLMG 1PH8A 2F4VL 4XTCS 2VUMG 1JJCB 3RNUA 3TS0A 1VQBA 4J15A 5GAHC 2UU9Q 3W1BA 1YNXA 2PQAB 4MTNA 1RIPA 3HFZB 1PH4A 2HT1A 4BXXH 5JEAG 5LMNL 4A93H 3I4MG 1WJJA 4DV1Q 1JMCA 4DR6L 3PO2H 4A3LH 1KL9A 3FHWA 3UDXA 4DR5L 4LFAQ 1PH2A 4X6AH 5HY6A 2QEXA 5AJ3L 1TWAH 4JBJA 2I5HA 1ASYA 4HIMA 2UUAQ 4B3MQ 1XMOQ 4DR2L 5IP9G 4GN4B 4A3MG 1TWCH 1PV4A 4X66Q 5C44G 1BKBA 3NBHB 3U58A 4A3CH 2VQEL 4HIDA 3H3VI 3S14H 4DR7L 5C4XH 1SROA 3H0GH 2WAQG 5ELNA 2GVAA 1JJGA 2KBNA 3CC4A 2AMCB 3UDIA 5IYBG 3K80C 5LMNW 4LF6L 5C0XJ 4JYAQ 4C3IH 4OXPA 3ULPA 2CWPA 3E9IA 1VQ8A 3EIVA 4DV2L 4GKJQ 2E2HH 4BY1H 3KFUA 3KF8B 4NXNQ 4LFBL 1OXSC 1S3OA 1XPRA 1FVIA 3F1ZA 2BA1A 3JAMi 2E5LL 1SN8A 3HOYG 4KHPL 2UXCL 4A3GH 3D0FA 1N34Q 1FGUA 2N49A 5LMUL 2B63G 1DGSA 4JI6Q 1A63A 4FDBA 1BBUA 5C3EG 4B3TL 1WYDA 2V1CC 1VCIA 1J5EQ 2VZAA 4B3RL 1I94Q 1AE2A 1IYJB 4YWMA 4BBRH 3CF5A 1VQLA 1N32L 1I94L 1Q12A 3GTGH 4A3DH 1VQ6A 4BA1I 1P16A 1IBML 3HOUG 1M90C 2YYZA 1X3FA 3FP9A 1X6OA 5M5XH 1D8LA 2GVBA 2WB1G 1IBLL 4DR4L 1E7ZA 3TRZA 1S72A 3F8TA 4NPSA 5JEAJ 2Q2HA 3HOXH 2N3SA 3ULLA 4QY7A 4EQ5A 3ERSX 2K75A 4R4TA 2XGTA 4C2MH 4JV5L 3J80c 3TREA 4AQYQ 4A3FG 2JA7G 2Q2TA 2CFMA 5C4JH 3M85A 2C35B 4AH6A 3CPWA 2ASBA 4K0KL 3CCSA 1N8RC 3HOVH 2EXDA 2Q2UA 1NMGA 4BBSH 5IYDH 2WP8J 3MEFA 3CMAA 1PH3A 3JAMc 4YHHL 3KJPA 4IOAA 2OTJA 3S2DH 4P71A 1N9WA 2PNHA 5IP7G 2R92H 4GNXC 2JA6G 3T1YL 1VQEA 1HZ9A 3F2CA 4A3EH 1A8VA 2Z6KA 2HHHL 1JE5A 3CCVA 4DUYQ 2ZTCA 1XMQL 1I6HH 3W1GA 4JI1Q 2F52A 4YY3Q 4A3KH 1ASZA 3H15A 2LXKA 1B7YB 1PHJA 1EIYB 4MZ9A 1JT8A 4JI2L 3J7ZC 2E2JH 1WCMG 1VQFA 2IHEA 1HNWL 3CCEA 2IY5B 1A0IA 3UDGA 2NZHA 4QQBX 1V43A 4JI4Q 5ELOA 1K3RA 1C0AA 4JCVE 3CMEA 1VQGA 2ZJRA 1R9TH 4QL5A 1UE7A 4DV0L 2UU9L 3D31A 3CPFA 3M4PA 2R7ZH 3PO3G 2VQFQ 4X64Q 1BVSA 2ZJPA 4Y7NH 1PYBA 2MFIA 4C3JH 4DV1L 4DV3L 1EFWA 4UP7A 1K73C 2ATWA 1PH9A 3S1RH 1N33Q 3GO5A 4ME3A 4IOCA 1QZHA 3CCMA 4LFAL 1WI5A 2UUCQ 1EOVA 2Z0SA 3E9HA 4PZ6A 4B3ML 3TS2A 4PZ8A 1XMOL 1OXTA 3RN5A 5IWAQ 2EQSA 2NZOA 1I5FA 4HJ9A 4NXMQ 1HZAA 5FJ8G 2RF4A 1HR0W 5M3FG 1HNZQ 1Y1WG 3T1HL 5JJLA 3ER0A 1YI2A 2JA5G 1I3QH 2DUDA 4A3JG 3VDYA 1X65A 1L0WA 3FKIH 3AFPA 3GTKH 2ZM6Q 1TWHH 2JA8G 1E24A 1E22A 1AE3A 3DLLA 4DR3Q 1VQPA 1YJ9A 4HIOA 3SGIA 4DV5Q 1QZGA 1Y1VH 4POGA 2AKWB 4JYAL 4PZ7A 4A75A 3Q8DA 1PH7A 3GTMH 2PI2E 4HJ7A 5JJKA 3PUVA 1VQ4A 2K50A 4NXNL 4GOPC 1PH6A 4O0AA 1L1OC 3H0GG 3EBEA 3U4ZA 1W2BA 3RLFA 2KENA 1KD1C 2JQOA 1N34L 4P75A 4QGUA 3KJOA 1YJNA 2D62A 5J3BA 1K0RA 4YCWA 2WAQE 5M3MH 4H02A 1G291 2EIFA 2B29A 3RR5A 4AYBG 3RN2A 1J5EL 4UP9A 3KYHC 3GDEA 1CSQA 4BY1G 3K7AH 3HKZG 1NMFA 3L2PA 2JK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 H;  2PI2 A;  2RHQ B;  1XTD A;  2PMZ E;  1D7Q A;  1TWG H;  1FL0 A;  1W3S A;  4L5Q A;  5JJI A;  4GNX B;  3PIO A;  3S1N H;  1C7Y A;  2B3G A;  4RMF A;  1IZ6 A;  2PQA A;  1SRU A;  4HJ5 A;  3A5Z B;  2UXB Q;  1Q82 C;  1CUK A;  2UXD Q;  4A3B H;  1Q81 C;  4A3D G;  1QVC A;  3I55 A;  4JI0 Q;  4P74 A;  3K81 C;  3PUZ A;  4IJH A;  2AWO A;  4AQY L;  1B70 B;  4LFC L;  3S17 H;  2N78 A;  1K9M C;  2A19 A;  2RCN A;  2YV5 A;  3HOW H;  4OO1 I;  1EUJ A;  4DV4 Q;  1G6P A;  2HQL A;  3B6Y A;  5FLM H;  1B8A A;  2VUM H;  2NN6 I;  1FJG Q;  4OWX B;  2LXJ A;  3HOX G;  3UE1 A;  4ALP A;  1PH1 A;  2MO0 A;  1N36 Q;  3KDF B;  2OQK A;  4APV A;  4GNX A;  1J6Q A;  3NEL A;  3U50 C;  1KRS A;  2A8V A;  3NEM A;  1KRT A;  1YHB A;  1I50 H;  3I4M H;  1YHQ A;  1A62 A;  2YTX A;  4GLV B;  3K0X A;  1X9N A;  3CAM A;  1YEZ A;  3LGJ A;  3RLN A;  4DUY L;  4L5S A;  1KHI A;  3AQQ A;  4JI1 L;  2IX0 A;  4YY3 L;  1IBK L;  4A4I A;  4DK6 C;  3ICE A;  4JBW A;  5LMN Q;  4UY8 C;  4X65 Q;  4R4C A;  5IYC G;  4OO1 G;  2ZTD A;  4B3S Q;  5C44 H;  1H95 A;  1KAW A;  1Z9F A;  3I4O A;  1V1Q A;  3CCJ A;  1NJI C;  4GKK L;  3G4S A;  4JI4 L;  2NVT H;  3IRB A;  4OWW B;  2NN6 G;  4YWK A;  3BJU A;  5GRO A;  5AJ3 Q;  1Y14 B;  2I5L X;  3PCO B;  3W5O A;  1SMX A;  5IYB H;  2VQF L;  4DUZ Q;  2BH2 A;  4X64 L;  1YIJ A;  5IY0 A;  4YCU A;  1BBW A;  4DK3 C;  3I56 A;  1KQS A;  4LF9 Q;  1LYL A;  1U0L A;  1MJC A;  1VQI A;  2LSS A;  4O2D A;  4LUV A;  1N33 L;  3CD6 A;  2VS1 A;  4GOP B;  1NY4 A;  1Q8K A;  1M1K C;  2UUC L;  2OQ0 A;  1L1O B;  3CC2 A;  1GD7 A;  1XNQ L;  3AEV A;  2MQH A;  3CQZ H;  3AYH B;  1YHA A;  3K8A A;  4L5T A;  1SR3 A;  4DKA C;  2A1A A;  3PF5 A;  4NXM L;  2Y0S G;  3HOY H;  1QUQ B;  3I4N G;  1PH5 A;  2B63 H;  2VL6 A;  2CCZ A;  1HNZ L;  4JI8 Q;  1PYS B;  1Q46 A;  3STB D;  1JJ2 A;  1VQN A;  5C3E H;  4LF7 Q;  4IPG A;  1VS0 A;  3E0E A;  2ZM6 L;  3CCU A;  2NVX H;  4DR3 L;  1EWI A;  2E5L Q;  4DV5 L;  2UUB Q;  2UXC Q;  4PMW A;  5E7N A;  1CSP A;  4LUO A;  3CP0 A;  4GN3 B;  1X55 A;  1JB7 A;  2AHO B;  2IX1 A;  3CCL A;  3GTQ H;  3KF6 B;  4R4I A;  4B3T Q;  1G51 A;  5C0X I;  4A3I G;  1UWV A;  3NEN A;  1X3G A;  2MO1 A;  4GLX A;  5HGQ A;  4LF5 Q;  4YWL A;  4B3R Q;  4A3F H;  2JA7 H;  2ES2 A;  2NVQ H;  1VQA A;  4DV6 Q;  1P8L A;  2UUA L;  3BZK A;  1IBL Q;  4JBK A;  4BXX G;  4LF4 L;  2R7F A;  3BU2 A;  4QJF A;  2AWN A;  4A93 G;  4X66 L;  4DAY B;  3HOZ H;  1K83 H;  2YU9 H;  2VNU D;  4OON A;  5IP7 H;  1HH2 P;  1EQQ A;  2NVY H;  4JI7 Q;  3JC6 6;  3PO2 G;  2JA6 H;  5GAD C;  1LTL A;  4BA2 I;  4A3L G;  5IE8 A;  1U5K A;  3S24 A;  5M3M G;  1Q7Y C;  3KF6 A;  3HKS A;  4YCV A;  5C0X G;  4RG1 A;  2GN5 A;  4LF8 Q;  2UXB L;  2ZTE A;  2HIV A;  2UXD L;  1T9H A;  3U4V A;  1EIF A;  5M5Y H;  4JI5 Q;  1HZC A;  1PFS A;  4OWT B;  4JI0 L;  4AYB E;  2E2I H;  2D0O A;  1HNX Q;  4IFD I;  4GKJ L;  3HKZ E;  2K5V A;  4A3C G;  1UE1 A;  3CCQ A;  3S2H H;  3EN2 A;  1X56 A;  2HIX A;  3G6E A;  4DV4 L;  5C4X G;  1XNR Q;  2ALY B;  2KCM A;  1GM5 A;  2ID0 A;  1KIX A;  5GAG C;  1FJG L;  3M4Q A;  1XMQ Q;  4IPC A;  2IHF A;  1O7I A;  4LUZ A;  4KI0 A;  4P72 A;  1N36 L;  4KHZ A;  2XTI A;  4JI6 L;  1PVO A;  2D0P A;  2R7D A;  3PUW A;  3PO3 H;  2CQO A;  2JJQ A;  3S15 H;  3GTL H;  3GTJ H;  2K5N A;  1HR0 Q;  4JI2 Q;  4DR1 Q;  1PA6 A;  3OTO Q;  2VY3 A;  2JA9 A;  4A3G G;  3J81 j;  4AIM A;  4DV0 Q;  1IXR A;  4R1J A;  4OX9 Q;  3DM3 A;  4IFD G;  3KLW A;  3AFQ A;  5FJ8 H;  4X65 L;  1YZ6 A;  4DV3 Q;  4BBR G;  5M3F H;  1Y1W H;  4B3S L;  1IL2 A;  2N8N A;  1E3P A;  2R6G A;  1NTG A;  1SLJ A;  1SE8 A;  4LW1 A;  1K8G A;  3A74 A;  5K36 G;  1YJW A;  2JA5 H;  2R93 H;  4A3J H;  4LF4 Q;  2KHJ A;  3UDF A;  2JA8 H;  4JOI C;  1OXV A;  4POF A;  3CC7 A;  4GN5 A;  1TXY A;  3PIP A;  1Z47 A;  4DUZ L;  2BH8 A;  1XPU A;  4IO9 A;  3PF4 A;  2RHS B;  3L0O A;  4UP8 A;  1YBY A;  4UPA A;  4DV7 Q;  3RZO H;  4LF9 L;  1CKO A;  3T1H Q;  2CWA A;  2WB1 E;  4JI3 Q;  3M7N A;  3CW2 C;  4X62 Q;  1EQR A;  3CCR A;  5BR8 Q;  4LWC A;  5EAY A;  3HOV G;  4LNQ A;  1S40 A;  2OTL A;  2QA4 A;  3J80 i;  5IYD G;  4PG3 A;  4BBS G;  2F4V Q;  4JI8 L;  2E8G A;  5GAE C;  3S16 H;  3RZD H;  1VQ9 A;  1LM0 A;  2OCE A;  1UEB A;  4LF7 L;  2F3I A;  5IP9 H;  2VW9 A;  2R92 G;  4A3M H;  3BZC A;  4JG2 A;  2BA0 A;  3K7U C;  4IJL A;  2UUB L;  4DR6 Q;  2K4K A;  2JE6 I;  4A3E G;  4WJ4 A;  2L15 A;  3TQY A;  1CKN B;  4DR5 Q;  2Q2I A;  4IPD A;  3UE0 A;  2YTY A;  3KDF A;  1Q1E A;  4A3K G;  1UE5 A;  2Y0S E;  2JEB I;  4TVA B;  4DAM A;  4DR2 Q;  1SFO H;  3G71 A;  1OXX K;  4EX5 A;  4LF5 L;  1MJE A;  5DLQ E;  2KCT A;  5H1S E;  1K8A C;  1VQJ A;  3CXC A;  2FXQ A;  2VQE Q;  4JC0 A;  4DR7 Q;  2ZJQ A;  3GTO H;  4DV6 L;  3L7Z C;  4P73 A;  5GQO A;  3I2Z A;  3TEH B;  5IWA L;  4GLA C;  2H5X A;  3F2B A;  1NE3 A;  3A5U A;  4LF6 Q;  4IFD J;  4HIK A;  2IT1 A;  3PSI A;  1OTC A;  1TWF H;  3WWV A;  4JI7 L;  4LFC Q;  4DV2 Q;  4A76 A;  3S1M H;  1CKN A;  4KLK A;  3H3V H;  4LFB Q;  4LF8 L;  4QIW E;  4KHP Q;  3HOU H;  5LMU Q;  4JI5 L;  3HOZ G;  1GVP A;  1HNX L;  4GOP A;  1VQK A;  1XJV A;  1NBW A;  2YTV A;  1WFQ A;  1L1O A;  1E1O A;  1WOC A;  2QGQ A;  3FKI G;  5IYC H;  3F2D A;  1XNR L;  3A0J A;  1N32 Q;  3KOJ A;  1Y1V G;  4HJA A;  1KC8 C;  1QUQ A;  1VQO A;  1IBM Q;  1RL2 A;  3MXN B;  1EYG A;  3GTP H;  1LUZ A;  2I0Q A;  4TQU S;  2CKZ B;  1VQM A;  1IBK Q;  4L5R C;  4Y52 H;  2DGY A;  3STB C;  1YIT A;  2WFW A;  3G48 A;  3I7F A;  1HZB A;  1MIU A;  3OYY A;  3J81 i;  1Q86 C;  4DR4 Q;  1HR0 L;  4R4O A;  4C3H H;  4DR1 L;  1V9P A;  2K14 A;  1VQH A;  3OTO L;  1XPO A;  3ZJY C;  1L2F A;  3OW2 A;  4IPH A;  3M9B A;  3RLO A;  1HJP A;  4GKK Q;  4JV5 Q;  4WJ3 M;  1UE6 A;  4MNO A;  1GO3 E;  1OXU A;  4K0K Q;  4OX9 L;  1Q1B A;  2KHI A;  2MNA A;  1YVC A;  1KXL A;  1CKM A;  2K5H A;  4R4Q A;  3I4N H;  1X54 A;  1AH9 A;  4YHH Q;  4BY7 G;  1VQ5 A;  2R7Z G;  5M5W H;  4DPG A;  2K52 A;  4JOI A;  2I5M X;  1VQ7 A;  3PUX A;  1XNQ Q;  4HJ8 A;  3T1Y Q;  1QVG A;  2JEA I;  3M3Y H;  1WCM H;  3ULJ A;  1MKH A;  1VQC A;  5FLX c;  1C9O A;  5IT9 c;  2HHH Q;  4NB3 A;  4DV7 L;  4A3B G;  1VQD A;  2Z6K C;  3M4O H;  1E1T A;  4JI3 L;  3PGZ A;  2R93 G;  4A3I H;  2OWO A;  4X62 L;  3S1Q H;  3J7A 5;  4XIG S;  1GKH A;  5BR8 L;  4GS3 A;  3HOW G;  1QVF A;  1HNW Q;  4DNI A;  4JBM A;  3PV0 A;  3J81 c;  3PUY A;  1X3E A;  3GD7 A;  5FLM G;  1PH8 A;  2F4V L;  4XTC S;  2VUM G;  1JJC B;  3RNU A;  3TS0 A;  1VQB A;  4J15 A;  5GAH C;  2UU9 Q;  3W1B A;  1YNX A;  2PQA B;  4MTN A;  1RIP A;  3HFZ B;  1PH4 A;  2HT1 A;  4BXX H;  5JEA G;  5LMN L;  4A93 H;  3I4M G;  1WJJ A;  4DV1 Q;  1JMC A;  4DR6 L;  3PO2 H;  4A3L H;  1KL9 A;  3FHW A;  3UDX A;  4DR5 L;  4LFA Q;  1PH2 A;  4X6A H;  5HY6 A;  2QEX A;  5AJ3 L;  1TWA H;  4JBJ A;  2I5H A;  1ASY A;  4HIM A;  2UUA Q;  4B3M Q;  1XMO Q;  4DR2 L;  5IP9 G;  4GN4 B;  4A3M G;  1TWC H;  1PV4 A;  4X66 Q;  5C44 G;  1BKB A;  3NBH B;  3U58 A;  4A3C H;  2VQE L;  4HID A;  3H3V I;  3S14 H;  4DR7 L;  5C4X H;  1SRO A;  3H0G H;  2WAQ G;  5ELN A;  2GVA A;  1JJG A;  2KBN A;  3CC4 A;  2AMC B;  3UDI A;  5IYB G;  3K80 C;  5LMN W;  4LF6 L;  5C0X J;  4JYA Q;  4C3I H;  4OXP A;  3ULP A;  2CWP A;  3E9I A;  1VQ8 A;  3EIV A;  4DV2 L;  4GKJ Q;  2E2H H;  4BY1 H;  3KFU A;  3KF8 B;  4NXN Q;  4LFB L;  1OXS C;  1S3O A;  1XPR A;  1FVI A;  3F1Z A;  2BA1 A;  3JAM i;  2E5L L;  1SN8 A;  3HOY G;  4KHP L;  2UXC L;  4A3G H;  3D0F A;  1N34 Q;  1FGU A;  2N49 A;  5LMU L;  2B63 G;  1DGS A;  4JI6 Q;  1A63 A;  4FDB A;  1BBU A;  5C3E G;  4B3T L;  1WYD A;  2V1C C;  1VCI A;  1J5E Q;  2VZA A;  4B3R L;  1I94 Q;  1AE2 A;  1IYJ B;  4YWM A;  4BBR H;  3CF5 A;  1VQL A;  1N32 L;  1I94 L;  1Q12 A;  3GTG H;  4A3D H;  1VQ6 A;  4BA1 I;  1P16 A;  1IBM L;  3HOU G;  1M90 C;  2YYZ A;  1X3F A;  3FP9 A;  1X6O A;  5M5X H;  1D8L A;  2GVB A;  2WB1 G;  1IBL L;  4DR4 L;  1E7Z A;  3TRZ A;  1S72 A;  3F8T A;  4NPS A;  5JEA J;  2Q2H A;  3HOX H;  2N3S A;  3ULL A;  4QY7 A;  4EQ5 A;  3ERS X;  2K75 A;  4R4T A;  2XGT A;  4C2M H;  4JV5 L;  3J80 c;  3TRE A;  4AQY Q;  4A3F G;  2JA7 G;  2Q2T A;  2CFM A;  5C4J H;  3M85 A;  2C35 B;  4AH6 A;  3CPW A;  2ASB A;  4K0K L;  3CCS A;  1N8R C;  3HOV H;  2EXD A;  2Q2U A;  1NMG A;  4BBS H;  5IYD H;  2WP8 J;  3MEF A;  3CMA A;  1PH3 A;  3JAM c;  4YHH L;  3KJP A;  4IOA A;  2OTJ A;  3S2D H;  4P71 A;  1N9W A;  2PNH A;  5IP7 G;  2R92 H;  4GNX C;  2JA6 G;  3T1Y L;  1VQE A;  1HZ9 A;  3F2C A;  4A3E H;  1A8V A;  2Z6K A;  2HHH L;  1JE5 A;  3CCV A;  4DUY Q;  2ZTC A;  1XMQ L;  1I6H H;  3W1G A;  4JI1 Q;  2F52 A;  4YY3 Q;  4A3K H;  1ASZ A;  3H15 A;  2LXK A;  1B7Y B;  1PHJ A;  1EIY B;  4MZ9 A;  1JT8 A;  4JI2 L;  3J7Z C;  2E2J H;  1WCM G;  1VQF A;  2IHE A;  1HNW L;  3CCE A;  2IY5 B;  1A0I A;  3UDG A;  2NZH A;  4QQB X;  1V43 A;  4JI4 Q;  5ELO A;  1K3R A;  1C0A A;  4JCV E;  3CME A;  1VQG A;  2ZJR A;  1R9T H;  4QL5 A;  1UE7 A;  4DV0 L;  2UU9 L;  3D31 A;  3CPF A;  3M4P A;  2R7Z H;  3PO3 G;  2VQF Q;  4X64 Q;  1BVS A;  2ZJP A;  4Y7N H;  1PYB A;  2MFI A;  4C3J H;  4DV1 L;  4DV3 L;  1EFW A;  4UP7 A;  1K73 C;  2ATW A;  1PH9 A;  3S1R H;  1N33 Q;  3GO5 A;  4ME3 A;  4IOC A;  1QZH A;  3CCM A;  4LFA L;  1WI5 A;  2UUC Q;  1EOV A;  2Z0S A;  3E9H A;  4PZ6 A;  4B3M L;  3TS2 A;  4PZ8 A;  1XMO L;  1OXT A;  3RN5 A;  5IWA Q;  2EQS A;  2NZO A;  1I5F A;  4HJ9 A;  4NXM Q;  1HZA A;  5FJ8 G;  2RF4 A;  1HR0 W;  5M3F G;  1HNZ Q;  1Y1W G;  3T1H L;  5JJL A;  3ER0 A;  1YI2 A;  2JA5 G;  1I3Q H;  2DUD A;  4A3J G;  3VDY A;  1X65 A;  1L0W A;  3FKI H;  3AFP A;  3GTK H;  2ZM6 Q;  1TWH H;  2JA8 G;  1E24 A;  1E22 A;  1AE3 A;  3DLL A;  4DR3 Q;  1VQP A;  1YJ9 A;  4HIO A;  3SGI A;  4DV5 Q;  1QZG A;  1Y1V H;  4POG A;  2AKW B;  4JYA L;  4PZ7 A;  4A75 A;  3Q8D A;  1PH7 A;  3GTM H;  2PI2 E;  4HJ7 A;  5JJK A;  3PUV A;  1VQ4 A;  2K50 A;  4NXN L;  4GOP C;  1PH6 A;  4O0A A;  1L1O C;  3H0G G;  3EBE A;  3U4Z A;  1W2B A;  3RLF A;  2KEN A;  1KD1 C;  2JQO A;  1N34 L;  4P75 A;  4QGU A;  3KJO A;  1YJN A;  2D62 A;  5J3B A;  1K0R A;  4YCW A;  2WAQ E;  5M3M H;  4H02 A;  1G29 1;  2EIF A;  2B29 A;  3RR5 A;  4AYB G;  3RN2 A;  1J5E L;  4UP9 A;  3KYH C;  3GDE A;  1CSQ A;  4BY1 G;  3K7A H;  3HKZ G;  1NMF A;  3L2P A;  2JK8 A; 
#chains in the Genus database with same CATH topology
 4BY7 H;  2KHS A;  2WKC A;  1K0S A;  1D7Q A;  1FL0 A;  4L5Q A;  3NTK A;  1TWF B;  1NSN S;  5C3E B;  1IZ6 A;  4OEM B;  2PQA A;  3LWU A;  4HJ5 A;  1Q82 C;  4A3D G;  1QVC A;  4JI0 Q;  2PO4 A;  2MUY A;  4AQY L;  2HDM A;  1V1P B;  2F0V A;  4RH6 A;  1EUJ A;  3K58 A;  3OMG A;  1G6P A;  5FLM H;  3BG3 A;  4RGT A;  4UDU C;  2Z4H A;  4APV A;  1EEF D;  3U50 C;  1KRS A;  4A3F B;  3I4M H;  4IZ8 A;  1YHQ A;  4IUT A;  3A8K E;  4C3H B;  3RLN A;  4L5S A;  2EY5 A;  1KHI A;  1IBK L;  4YY3 L;  4A4I A;  4UY8 C;  2G5D A;  4X65 Q;  4K8I A;  4R4C A;  1EY4 A;  1KAW A;  2Y0S B;  4DNT B;  4HMJ A;  4OWW B;  5A2Q L;  4YWK A;  5E3F A;  2I5L X;  3PCO B;  1SDF A;  2X6L A;  4X64 L;  3M3Y B;  1W6J A;  4YCU A;  4OEL B;  4DK3 C;  4LF9 Q;  4O2D A;  2LSS A;  3Q22 A;  1N33 L;  3CD6 A;  1PFB A;  1M1K C;  2XWB B;  3MXG A;  3CC2 A;  1GD7 A;  2MQH A;  3CQZ H;  4L5T A;  4A3I B;  3K8A A;  3S1Q B;  2Y0S G;  2K33 A;  3MXU A;  1PH5 A;  2B63 H;  3SK5 A;  2VL6 A;  1NAP A;  1HNZ L;  4JI8 Q;  1B3Q A;  1JC7 A;  2CW0 C;  1DM0 B;  4IPG A;  1VS0 A;  4DR3 L;  1GOZ A;  2UUB Q;  4J6H A;  4PMW A;  5I2X A;  4FNF A;  2F0Q A;  3CCL A;  3BYY B;  4A3I G;  3NEN A;  1X3G A;  2OT2 A;  4GLX A;  3EJI A;  5HGQ A;  3IAY A;  3R8B A;  1B2T A;  5KNB A;  2NVQ H;  4G7O C;  2UUA L;  4G57 A;  3TP7 A;  4RFB A;  4LF4 L;  4BXX G;  2A74 C;  3NWS A;  3KLS A;  4A93 G;  4FXD A;  1EYA A;  1K83 H;  2VNU D;  4X3U A;  2A6H C;  1HH2 P;  4YIJ A;  3K59 A;  3HKS A;  5EBD A;  2HIV A;  1A3V A;  4JI0 L;  4AYB E;  2L0C A;  1UE1 A;  1X56 A;  2HIX A;  3BS1 A;  2O5J C;  4IPC A;  1PDQ A;  2NZ1 D;  1HFN A;  1WTR A;  3S15 H;  4KN7 C;  2LY7 A;  1HR0 Q;  4J1M A;  5CC4 A;  2NBF A;  4AIM A;  4H0L C;  5CV4 A;  4X65 L;  1YZ6 A;  4DV3 Q;  4BBR G;  3MAQ A;  2N8N A;  2B39 A;  1NTG A;  1SLJ A;  5K36 G;  3EA6 A;  4A3J H;  3UDF A;  3DUZ A;  1S5D D;  4GN5 A;  5CBA E;  1W6K A;  4IO9 A;  1XPU A;  4K6L A;  4MTK A;  3H91 A;  4LF9 L;  1OO9 B;  3M7N A;  1EQR A;  4A3K B;  1S40 A;  5C3X A;  2OTL A;  2QA4 A;  3J80 i;  2RSN A;  4JI8 L;  2E2J B;  2E8G A;  3V05 A;  3S16 H;  1VQ9 A;  1SMY D;  2OCE A;  1UEB A;  2K01 A;  5IP9 H;  4A3M H;  3BZC A;  3K7U C;  2UUB L;  3KK7 A;  4Q0F A;  4C3J B;  2L15 A;  5I4D A;  1BR9 A;  1I4R A;  3KDF A;  4KY6 A;  4A3K G;  4DAM A;  2E76 C;  4DR2 Q;  4CDF C;  4CJ1 B;  4IUV A;  2KQ3 A;  1K8A C;  2FXQ A;  1EFI D;  5E1F A;  2ZJQ A;  2F0U A;  5GQO A;  5LL6 X;  3I2Z A;  5IWA L;  4GLA C;  2H5X A;  3MFG A;  3A5U A;  3F2B A;  4HIK A;  2IT1 A;  2VB3 X;  1OTC A;  3H6M A;  1TWF H;  3NPP A;  3NTH A;  2MP1 A;  3H3V H;  4LFB Q;  4MN3 A;  2A68 C;  3HOZ G;  2NTT A;  1KLG D;  1STA A;  4GOP A;  1VQK A;  3SVM A;  4GZY C;  2YTV A;  1L1O A;  5M3M B;  2QGQ A;  3QB3 A;  3TSS A;  3OMC A;  4HJA A;  1KC8 C;  1VQO A;  3GTP H;  1EYG A;  3TP5 A;  3T4A C;  4Y52 H;  1AP0 A;  2DGY A;  3GQB A;  1Q86 C;  3I7F A;  1MIU A;  4EQN A;  1HR0 L;  1LT3 D;  2RKS A;  3HP3 A;  4C3H H;  2K14 A;  1VQH A;  1XPO A;  2QDB A;  1HJP A;  4K2L A;  2QCP X;  4MNO A;  1OXU A;  5DAU A;  1Q1B A;  2K5H A;  4R4Q A;  3HOW B;  4M8A A;  2G9H D;  3BDC A;  5M5W H;  4A3G B;  4DPG A;  4JOI A;  2CQA A;  1J9O A;  3M3Y H;  1QVG A;  3T1Y Q;  2JEA I;  1BQQ T;  2PZW A;  2B8F A;  3PIP 3;  1VQD A;  1UAP A;  2EE1 A;  2Z6K C;  3C1E A;  5E4W C;  4CKE A;  4DAY A;  1HPC A;  5CV7 A;  4A3I H;  2VB2 X;  5FOB B;  3S1Q H;  4XIG S;  1D1K A;  3HOW G;  1QVF A;  4ZUI A;  4JBM A;  2F0N A;  1X3E A;  4KKT A;  1ET6 A;  3RNU A;  1AW7 A;  3T13 A;  1BNZ A;  2CH4 W;  2UU9 Q;  3W1B A;  1YNX A;  4MTN A;  1PH4 A;  4BXX H;  5KNC A;  5LMN L;  1EWC A;  4A93 H;  2WAQ B;  1F2Z A;  3OPO A;  1AFP A;  2XIW A;  3I90 A;  3OWF A;  2B2U A;  4KV6 A;  1ASY A;  2I5H A;  4B3M Q;  1C8C A;  4DR2 L;  4GN4 B;  3TBI B;  4X66 Q;  1XXG A;  2H4O A;  1CQF A;  1KAB A;  5I2Y A;  3QR8 A;  3NBH B;  4HID A;  2BCO A;  3L3O C;  2WAQ G;  1JJG A;  2AMC B;  1Q90 A;  1TR5 A;  4IAL A;  3E9I A;  1VQ8 A;  5D3D A;  1JOK A;  4GKJ Q;  4LFB L;  1OXS C;  1FVI A;  1GXD C;  2BA1 A;  1S5C D;  2E5L L;  5EPK A;  1SEB D;  1FGU A;  2EY2 A;  3JAM E;  4JI6 Q;  3A55 A;  3D6C A;  3NBH A;  1PTO D;  1WYD A;  4B3T L;  4C56 C;  2OXP A;  1J5E Q;  1I94 Q;  4BBR H;  3CF5 A;  1G2S A;  3SDZ A;  2PW7 A;  2YU9 B;  3FP9 A;  1MSG A;  3LNN A;  2WB1 G;  3Q24 A;  2JA6 B;  1E7Z A;  1S72 A;  4NPS A;  4ID6 A;  2K75 A;  2E2D C;  3NP8 A;  1Y1V B;  3TDQ A;  4ZK9 B;  3DWQ A;  5C4J H;  1F2M A;  2ASB A;  5D3I B;  1N8R C;  2EXD A;  4KY7 A;  3MEF A;  4XT3 B;  3S2H B;  2EYP A;  1WD0 A;  2OTJ A;  4P71 A;  2PNH A;  2EYO A;  2JA6 G;  3T1Y L;  4F8M A;  1HZ9 A;  2SNM A;  4FF2 A;  3F2C A;  2MGS A;  4FXG C;  1SJE D;  4DUY Q;  4JI1 Q;  1ASZ A;  4A3K H;  2F0K A;  1JIC A;  2LXK A;  1PHJ A;  1EIY B;  1DOK A;  4MZ9 A;  1JT8 A;  4JI2 L;  3J7Z C;  2E2J H;  2IHE A;  1L0Y B;  2IY5 B;  1LT4 D;  5ELO A;  1Y1W B;  4B08 A;  2ZJR A;  4DV0 L;  2UU9 L;  3CPF A;  2JA8 B;  1EFW A;  1PYB A;  2MFI A;  4C3J H;  2DNC A;  4C1N K;  1FR3 A;  3GO5 A;  3DMU A;  3HRZ C;  3AU7 A;  3CHB D;  2Z0S A;  3D4R A;  3E9H A;  4B3M L;  3RN5 A;  1I5F A;  4NXM Q;  3RD4 A;  3KUP A;  3NBI A;  5FJ8 G;  1HR0 W;  5M3F G;  1Y1W G;  2C5C A;  3T1H L;  1YI2 A;  2F0H A;  4G7Z C;  3RZD B;  3AFP A;  5JPM C;  2JA8 G;  1E24 A;  3P7J A;  4AYB B;  3DHQ A;  4PZ7 A;  1B4O A;  4ZKB B;  3GTM H;  1EQT A;  1LTB D;  2PI2 E;  4JPB W;  3FDT A;  3PUV A;  2K50 A;  5G3L D;  4GOP C;  1PH6 A;  4PV1 C;  1L1O C;  1PRT D;  1KD1 C;  1ICF B;  4C3I G;  5J22 A;  2D62 A;  3MC0 B;  5M3M H;  2EIF A;  4AYB G;  1J5E L;  3CW2 C;  1I94 L;  1LTG D;  3GTO B;  4V0B A;  2PMZ E;  1TWG H;  1SYC A;  4LJZ C;  5JJI A;  1I4X A;  3PIO A;  2A6E C;  2B3G A;  3TZU A;  1RDP D;  3M7G A;  2XN9 C;  4EQP A;  3A5Z B;  2UXB Q;  5EKI A;  3SR1 A;  1T5X D;  2KED A;  2Z4I A;  4DXF A;  1DYQ A;  4P74 A;  3PUZ A;  4IJH A;  1SYB A;  3F2U A;  1I4G A;  3HOU B;  4LFC L;  4L8J A;  4QF4 A;  1H9S A;  2RCN A;  2YV5 A;  4LMQ D;  4ZLT F;  3HOW H;  2JXM B;  1LAB A;  1F9Q A;  1FJG Q;  1TS4 A;  2LXJ A;  1PH1 A;  2MO0 A;  1EY8 A;  2KCN A;  3HG9 A;  1PZJ D;  3MVV A;  3NEL A;  2D2C C;  4G4K A;  3T51 B;  4IUN A;  1JWS D;  3CAM A;  3QOJ A;  4DUY L;  2EVB A;  4JI1 L;  2IX0 A;  1PLF A;  3FMC A;  4DK6 C;  2J0T D;  4DF7 A;  3ICE A;  3KF8 A;  3I4O A;  4H13 C;  1V1Q A;  4GKK L;  1B9N A;  1XX8 A;  1DJR D;  3G4S A;  1SNC A;  2LS0 1;  2R61 A;  1GJX A;  2B2U C;  1K8O A;  1WTV A;  1KDB A;  4JK1 C;  1WCM B;  1BCP C;  1KQS A;  2Q8I B;  1LYL A;  1VQI A;  4LUV A;  1NY4 A;  1Q8K A;  1ONL A;  3M4O B;  5FLX L;  3SEB A;  3M4Y A;  1SNQ A;  1GUS A;  1YHA A;  1ZKO A;  5IT9 L;  3A7A B;  3VR6 A;  4NXM L;  3I4N G;  1QUQ B;  4MHE A;  4QUC A;  5KND A;  1Q46 A;  2ICE C;  1EU3 A;  5A2Q E;  1EWI A;  3H09 A;  2QF7 A;  2UXC Q;  1SAP A;  5FKA C;  3P1H A;  1VF5 C;  1CSP A;  2IX1 A;  1TT2 A;  4GN3 B;  1JB7 A;  1TS3 A;  4R4I A;  3PO2 B;  1X32 A;  2B2V A;  1CA5 A;  1TWA B;  2MO1 A;  4HSP A;  3ND9 A;  5JOB A;  4LF5 Q;  2NYZ D;  1Y69 U;  3E5S A;  4DN4 M;  3BVG A;  3BZK A;  4JBK A;  3S14 B;  1EY9 A;  2AWN A;  3J81 E;  2YU9 H;  1O7L A;  2TMP A;  3PO2 G;  4A3L G;  2JA6 H;  5GAD C;  1YNJ D;  4PNY A;  4RA8 A;  1VMP A;  1Q7Y C;  4RG1 A;  3FPP A;  5IGE A;  4LF8 Q;  2UXB L;  4NDX A;  3U4V A;  1EIF A;  4FP5 D;  4JI5 Q;  1HZC A;  1PFS A;  1IW7 D;  2D0O A;  1HNX Q;  2F0D A;  4IFD I;  3HKZ E;  4A3C G;  4CKC A;  3CCQ A;  3S2H H;  2JSO A;  3EN2 A;  3G6E A;  2EDG A;  2KJX A;  1XNR Q;  2ALY B;  2K5W A;  2KCM A;  3N6R A;  1Y8P B;  2ID0 A;  4XYO A;  1FJG L;  1UNS A;  1XMQ Q;  5ELB A;  4E6I A;  1GUG A;  3GTG B;  4KI0 A;  1FNV A;  4A3D B;  2XTI A;  4DK1 A;  2JJQ A;  1PTO B;  2F3W A;  1QWY A;  2K5N A;  5I6Y A;  3KLR A;  4N8X 1;  4PMC A;  2JA9 A;  3C46 A;  4IUP A;  4R1J A;  4IFD G;  5FJ8 H;  3R2T A;  2HCI A;  1RTO A;  5COY A;  5M3F H;  1Y1W H;  1IL2 A;  3ERO A;  1GUO A;  1WTQ A;  4NKL A;  3I3C A;  4LF4 Q;  3PQI A;  2KHJ A;  5FO7 B;  2JA8 H;  4QMG A;  3VYT A;  1OXV A;  1S4Z A;  1X3P A;  4POF A;  3PIP A;  1SNO A;  4X3K A;  1CI3 M;  2ZXO A;  3DWP A;  2RHS B;  1YBY A;  1EIH A;  4HR7 B;  4UPA A;  1LTR D;  5IGG A;  1CKO A;  3K6O A;  4A3E B;  2WB1 E;  3GTP B;  4X62 Q;  1EWH A;  5BR8 Q;  3I8Z A;  4LWC A;  5EAY A;  1ILQ A;  5IYD G;  4BBS G;  1EU4 A;  4QCL A;  3QO2 A;  1G8Z D;  1S5B D;  3RZD H;  4K5X A;  3CRL C;  1KAA A;  5ELC A;  2F3I A;  3MA2 B;  1SYG A;  4DGZ A;  1R9T B;  1V1P A;  1EY7 A;  3DWA A;  1Z6H A;  1FNU A;  4A3E G;  3TQY A;  3UE0 A;  2YTY A;  1SXT A;  1CFM A;  2I07 B;  2XRQ D;  1JWM D;  2K03 A;  4TVA B;  5M5W B;  1NR4 A;  1IKM A;  2EJM A;  3EFX D;  5DM7 3;  4Q5V A;  4EX5 A;  3G71 A;  1T5E A;  2KEC A;  4LF5 L;  5DLQ E;  5H1S E;  1VQJ A;  4JC0 A;  4DR7 Q;  3GTO H;  4P73 A;  3BDO A;  3GTK B;  3E6Z X;  1NE3 A;  4LF6 Q;  1CHP D;  2FHT A;  1V8Q A;  1O80 A;  2F03 A;  2Q8T A;  4OIK A;  1JCK B;  3J81 L;  4LF8 L;  4KTA A;  3ITP A;  4QIW E;  1IYV A;  3HOU H;  4A93 B;  3BDL A;  4JI5 L;  2D9U A;  1VDZ A;  1HNX L;  1IKL A;  3Q6S A;  1WFQ A;  1N32 Q;  1XNR L;  1PRT B;  2PQE A;  3A0J A;  2FMM A;  3MXN B;  4KHV A;  1QCB D;  1LUZ A;  2I0Q A;  4CBV A;  2CKZ B;  2L12 A;  3MZ5 A;  4L5R C;  3STB C;  1YIT A;  2NUC A;  4FXK C;  4R8I A;  1DOM A;  4K5V A;  4DR4 Q;  3S1N B;  5JAV A;  5DM6 3;  4R4O A;  1V9P A;  2BE5 D;  1L2F A;  3M9B A;  1CT1 D;  1A15 A;  2QW7 A;  1YNN C;  3FPU B;  1SJH D;  3S17 B;  1F9P A;  3I4N H;  3PIO 3;  4FO2 A;  5ISR A;  2A69 C;  1HA6 A;  2VUM B;  1D6E C;  1PYW D;  2OF1 A;  1XNQ Q;  1WCM H;  3ULJ A;  1RHP A;  4OIJ A;  1I50 B;  1C9O A;  5EKL A;  4BBR B;  2HHH Q;  4NB3 A;  1PXU A;  4CJ2 C;  3M4O H;  1LTS D;  5KYL A;  2R93 G;  4X62 L;  2EYM A;  4RWS C;  5BR8 L;  2L1B A;  4GS3 A;  3W2D A;  4B9X A;  5JJZ A;  1JOO A;  2EPB A;  1XTC D;  3J81 c;  3NQI A;  3GD7 A;  2VUM G;  3TS0 A;  2B2Y A;  2EZV A;  2HT1 A;  3HFZ B;  4KY5 A;  5JEA G;  2F0M A;  5C4J B;  1G2T A;  2F3V A;  1JMC A;  2TSS A;  1H9K A;  4PQX A;  3PO2 H;  1GUN A;  4LK1 C;  4A3L H;  1KL9 A;  3UDX A;  1KTK A;  5HY6 A;  2QEX A;  1TWA H;  2L11 A;  4HIM A;  5EKK A;  2E75 C;  1PV4 A;  3W3A A;  4JW0 A;  1M8A A;  2B2W C;  4QB4 A;  3HOY B;  5IIF A;  4KJO A;  2WII B;  3U58 A;  1D5M C;  4IQZ A;  2LFN A;  4A3C H;  3S14 H;  4DR7 L;  3K5L A;  1SRO A;  5ELN A;  5IYB G;  4DFA A;  4U67 3;  4LF6 L;  1Y8O B;  5C0X J;  4JYA Q;  4OXP A;  2CWP A;  2AQ3 B;  3I4L A;  3GV3 A;  3GTQ B;  3NK9 A;  4FVM A;  3TP8 A;  1XPR A;  5KGU A;  3JAM i;  3U9O A;  1SN8 A;  3HOY G;  4CKB A;  3D0F A;  1N34 Q;  3GP7 A;  4K14 A;  2EOT A;  5ELE A;  4IFD H;  2JA7 B;  1HFG A;  1VCI A;  1E2V A;  2IX3 A;  4RHS A;  1AE2 A;  1N32 L;  1FD7 D;  3GTG H;  4A3D H;  1A2T A;  1ICW A;  1PTO H;  3FRP B;  3P20 A;  3HOZ B;  2XWJ B;  1STH A;  1RKN A;  3IKJ A;  1X6O A;  1D8L A;  5M5X H;  1LV9 A;  1SBB B;  4DR4 L;  1AZP A;  1AZQ A;  2Q2H A;  1AEX A;  2N3S A;  2F0G A;  2HUG A;  2XGT A;  2CW0 D;  3TRE A;  2JA7 G;  5M5Y B;  2C35 B;  3CCS A;  1ZYR C;  3GTM B;  2E2I B;  5I9P A;  4M1U B;  1PZK D;  4BBS H;  5IYD H;  1EY6 A;  3KJP A;  2EY6 A;  3EVQ A;  5NUC A;  1KLU D;  5IGF A;  1TKW B;  3PO3 B;  3GTL B;  3GTJ B;  1HQM C;  4A3E H;  1HUN A;  1A8V A;  3H3V C;  2HHH L;  1JE5 A;  3CCV A;  1MD2 D;  3W1G A;  1TWG B;  1STG A;  3H15 A;  5CR3 A;  2A6H D;  1VQF A;  1PZI D;  1A0I A;  2F1M A;  3UDG A;  4QQB X;  1V43 A;  2EY1 A;  4JI4 Q;  3D6W A;  3J7A F;  4JCV E;  3LX0 A;  2EYJ A;  1R9T H;  3D31 A;  4HCE A;  2JA5 B;  3VYU A;  3M4P A;  3PO3 G;  2O4X A;  2VQF Q;  1BVS A;  4DV3 L;  4ZYS A;  4UP7 A;  1SSO A;  3H94 A;  3CCM A;  3RZO B;  2UUC Q;  3Q0A A;  1HZA A;  4F7X A;  4L6T B;  4MIU A;  1RF2 D;  4ZAI A;  2JA5 G;  3GTK H;  1X65 A;  3A7L A;  4S3S A;  1YJ9 A;  3DLL A;  2LMC B;  1HUM A;  3DM1 A;  4POG A;  1HRJ A;  4JYA L;  2IL8 A;  2RVL A;  5F2D A;  5CBE E;  1HQR D;  4UAI A;  1VQ4 A;  1NUC A;  1CTM A;  4EGV A;  3H0G G;  3EBE A;  3U4Z A;  2JQO A;  1N34 L;  1BO0 A;  5J3B A;  1K0R A;  3R2I A;  4H02 A;  2G9D A;  2K28 A;  2AUJ D;  1JOQ A;  3RR5 A;  3CRK C;  3TME A;  4UP9 A;  3KYH C;  2M00 A;  1CSQ A;  4BY1 G;  3HKZ G;  5BN4 A;  1KDA A;  1LTI D;  2ZXR A;  1XTD A;  1QG7 A;  4GNX B;  2K6A A;  3S1N H;  1C7Y A;  4RMF A;  2H1E A;  1SRU A;  3KBG A;  3S1M B;  1CUK A;  2UXD Q;  4N9T A;  2D5D A;  1Q81 C;  3I55 A;  2E74 C;  3K81 C;  3S17 H;  2N78 A;  3K0Y A;  2A19 A;  1Q3L A;  4FF4 A;  4OO1 I;  4IN3 A;  4DV4 Q;  2L5T A;  2WB1 B;  3VR3 A;  1B8A A;  2VUM H;  2NN6 I;  3HOX G;  3UE1 A;  2PW5 A;  1N36 Q;  5EGT A;  4GNX A;  1J6Q A;  1SNP A;  5JEA H;  2PYK A;  3NEM A;  1KRT A;  1YHB A;  1I50 H;  1CQV A;  4RGM A;  1A62 A;  2DJG C;  2YTX A;  5K36 H;  3K0X A;  1X9N A;  1YEZ A;  4N9P A;  1IYU A;  1K3B C;  1Q8I A;  4JBW A;  3VA5 A;  5IYC G;  4OO1 G;  2KEE A;  4B9W A;  3CCJ A;  3QJY A;  1NJI C;  4JI4 L;  3IRB A;  2NN6 G;  1SYD A;  1RJT A;  5AJ3 Q;  3CU7 A;  2BH2 A;  3W5O A;  5IYB H;  2VQF L;  2F0W A;  4DUZ Q;  2A68 D;  2BDO A;  1PRT F;  5T1I A;  5IY0 A;  3I56 A;  1BBW A;  2RSO A;  5LHY 1;  1U0L A;  2WV6 D;  3K5N A;  3C3L A;  2VS1 A;  2DJF C;  2UUC L;  1I4H A;  1STY A;  3AEV A;  5CV8 A;  3NE5 B;  3PF5 A;  2R7Z G;  4DKA C;  3HOY H;  2A1A A;  4P2C B;  3O13 A;  2CCZ A;  1G91 A;  3N52 A;  1JJ2 A;  1VQN A;  4QIW B;  1K8M A;  3TZD A;  4LF7 Q;  3NQT A;  3E0E A;  4K5W A;  3FEW X;  4G7H C;  1TQO A;  1DCZ A;  1JR0 D;  2JYO A;  5E7N A;  1JOR A;  5M3F B;  1Z7T A;  1X55 A;  3GTQ H;  3KF6 B;  1G51 A;  4ZCK A;  5C0X I;  1CK1 A;  5FLX E;  2WAC A;  4YWL A;  4CDE C;  3J7Y W;  1MGS A;  4KKS A;  5IT9 E;  2JA7 H;  2ES2 A;  1SE4 A;  4I7A A;  2X6G A;  1NCV A;  4XQQ A;  1IBL Q;  2RCF A;  3BVZ A;  2R7F A;  5IGD A;  4QJF A;  4X66 L;  1FYC A;  3HOZ H;  4OON A;  1GHK A;  2K05 A;  4F87 A;  2AQ2 B;  4JI7 Q;  4C3I B;  1LTL A;  1U5K A;  3S24 A;  3TN2 A;  3KF6 A;  1WVL A;  5C0X G;  2GN5 A;  2ZXP A;  2UXD L;  5M5Y H;  2DN8 A;  4OWT B;  4DNR B;  2E2I H;  3OIQ A;  4GKJ L;  4WJW A;  1MSH A;  1X3Q A;  3QOL A;  3I73 A;  4DV4 L;  1GM5 A;  1PMR A;  1EYD A;  4C1N I;  5GAG C;  3M4Q A;  2IHF A;  1O7I A;  4LUZ A;  4JI6 L;  1N36 L;  3R93 A;  4CDD C;  2D0P A;  2R7D A;  3PUW A;  4IUR A;  3PO3 H;  4HN7 A;  2J4X A;  3GTL H;  3GTJ H;  5CV5 A;  1H9R A;  1WTW A;  4DR1 Q;  1C48 A;  5C6A A;  3HZX A;  3J81 j;  5KYI A;  1IXR A;  5DEH A;  3DM3 A;  1CZW A;  3KLW A;  3AFQ A;  1QJO A;  3FVQ A;  2HQE A;  3HOV B;  3J80 L;  4LW1 A;  1K8G A;  5EQ0 A;  1YJW A;  2JA5 H;  1GUW A;  3A54 A;  4JOI C;  3S2D B;  2F0I A;  1Z47 A;  4DUZ L;  2BH8 A;  3PF4 A;  4UP8 A;  3L0O A;  5TSS A;  4K2K A;  3RZO H;  3U9S A;  4WRD A;  3X3N A;  2CWA A;  4JI3 Q;  1BOS A;  3QWN A;  3CCR A;  4RGN A;  3HOV G;  1F9S A;  1WTX A;  1O7Y A;  3HS0 C;  4PG3 A;  2A5H A;  4LF7 L;  1A3U A;  4FF3 A;  5CV9 A;  2VW9 A;  1DOL A;  1HTP A;  2BA0 A;  2DY8 A;  4IJL A;  5D65 A;  3HEJ A;  4DR6 Q;  3I4N B;  3A8J E;  3I70 A;  2JE6 I;  4Y7N B;  4WJ4 A;  1CKN B;  4DR5 Q;  1LT5 D;  4IPD A;  3S1R B;  2JEB I;  1TS5 A;  1F2Y A;  4DXG A;  2CVR A;  4H7B A;  3T53 B;  3MFY A;  2VQE Q;  2R3Z A;  3L7Z C;  2XRS D;  3FKI B;  1TWH B;  2F0L A;  4FF1 A;  3SXH A;  3WWV A;  4JI7 L;  4DV2 Q;  3S9W A;  3S1M H;  1CKN A;  4KLK A;  2KUM A;  1D5Z C;  4KHP Q;  1I4Q A;  4OGQ C;  1XYI A;  1LO5 D;  2F0E A;  1XJV A;  4UHV A;  1NBW A;  3FKI G;  1R4Q B;  2MJ8 A;  1E1O A;  1WOC A;  5IYC H;  3SHL A;  1QE6 A;  5IGC A;  2Z9H A;  1QUQ A;  4HSV A;  4ZRZ A;  3VA7 A;  1IBK Q;  3A8I E;  3WDN A;  1HZB A;  4DR1 L;  1ENA A;  2F4I A;  4IPH A;  3RLO A;  3OW2 A;  2ENB A;  3VR4 A;  3Q23 A;  3PMF A;  4DU9 A;  1UE6 A;  1GO3 E;  3MHB A;  4K0K Q;  2MNA A;  2KHI A;  4K6D A;  2O5I C;  4YHH Q;  2EXZ A;  1U4M A;  2K52 A;  1VQ7 A;  2JP1 A;  1WTP A;  1MKH A;  4JVZ A;  5FLX c;  2DNE A;  2NTS A;  5IT9 c;  4A3B G;  1B53 A;  1DD2 A;  5A35 A;  2QKI C;  3DXJ C;  1E1T A;  4JI3 L;  2OWO A;  3J7A 5;  5LL6 S;  1TII D;  1D2B A;  4KD3 A;  5M5X B;  3PV0 A;  5IOD A;  2A6E D;  4XTC S;  5C44 B;  1VQB A;  5GAH C;  2PQA B;  1RIP A;  1WJJ A;  4IUU A;  4DR6 L;  4TRD A;  4BBS B;  4RKB A;  4LFA Q;  4DR5 L;  1LAC A;  4JBJ A;  2UUA Q;  1XMO Q;  5IP9 G;  4A3M G;  1TWC H;  4RCN A;  5C44 G;  2VQE L;  5COR A;  3H3V I;  4LAA A;  2KBN A;  5JVH 3;  3UDI A;  1V1O A;  5AFW A;  2K7V A;  2NVX B;  1E2Z A;  4C3I H;  3BYT B;  3EIV A;  4DV2 L;  4KN4 C;  1I4P A;  1S3O A;  1HA5 A;  1ZEQ X;  4ILW A;  4CDC C;  4KHP L;  1HXY D;  2UXC L;  1G6Z A;  2SEB D;  1DZ1 A;  1DGS A;  1MI2 A;  1ML0 D;  1B50 A;  1BBU A;  5C3E G;  2VZA A;  3WOE A;  1TU2 B;  1IYJ B;  1BCP D;  3I72 A;  3D4D A;  1Q12 A;  1B9M A;  3OWE B;  5KIX A;  1VQ6 A;  4BA1 I;  1AN8 A;  1P16 A;  1M90 C;  5IOC A;  5ELD A;  2AQ1 B;  3OHX C;  1SMY C;  2NVY B;  4U68 A;  1LT6 D;  5FO8 B;  1IHZ A;  2MHV A;  3ULL A;  1CA6 A;  3ERS X;  4C2M H;  5M9O A;  3OW7 A;  2V4D A;  4A3F G;  2Q2T A;  3M85 A;  4K0K L;  3HOV H;  1NMG A;  1XWE A;  1E0B A;  2WP8 J;  3CMA A;  3DEO A;  4C3H G;  4YHH L;  3LWE A;  3KBX A;  5CV6 A;  3S2D H;  5IP7 G;  3IL8 A;  4HAE A;  2XNA C;  5JPN C;  4XQJ A;  1VQE A;  5J1Z A;  1BF4 A;  1HTL D;  2PCF B;  3A56 A;  4XYQ A;  2Z6K A;  1MHW C;  1XMQ L;  2ZTC A;  2HCC A;  2B2T A;  3BVM A;  3NTI A;  3SK6 A;  4O1N A;  1TY0 A;  3TP6 A;  3CCE A;  2NZH A;  1K3R A;  4KKU A;  1QNU A;  3CME A;  1C0A A;  1VQG A;  4QL5 A;  4XDX A;  2R93 B;  2ZJP A;  4Y7N H;  2ATW A;  2XSC A;  1PH9 A;  3S1R H;  4IUQ A;  4ME3 A;  3MXN A;  4IOC A;  1QZH A;  4LFA L;  4PZ6 A;  4PZ8 A;  1XMO L;  1O7Z A;  1OXT A;  5IWA Q;  2EQS A;  4HJ9 A;  2ICI A;  1JQY D;  2RF4 A;  3V2T A;  4OHJ A;  1SND A;  1GHJ A;  3ER0 A;  1Y8N B;  4R8N A;  3FKI H;  2ZM6 Q;  1TWH H;  4L63 B;  1VQP A;  4HCS A;  4HIO A;  4DV5 Q;  2EJF C;  1QZG A;  2K5D A;  2OEO A;  2WKD A;  1VMC A;  2B2V C;  3RLF A;  1SFO B;  4ME5 A;  3KJO A;  1MBY A;  1D5X C;  1G29 1;  2PMZ B;  2B29 A;  2O2L D;  3K5M A;  2PPB C;  3GDE A;  3SGI A;  2PNR C;  2GA4 B;  3L2P A;  2J7Z A;  2PI2 A;  3K57 A;  2RHQ B;  5C4H A;  1W3S A;  2KA7 A;  2BOS A;  3E3X A;  2K04 A;  1O78 A;  3VR2 A;  2N55 A;  5K5P A;  1BUV T;  3V96 A;  4HMI A;  4A3B H;  1JWU D;  3MWY W;  2ZT9 C;  2AWO A;  1B70 B;  5C5L A;  1K9M C;  1KDC A;  1EQV A;  1EEI D;  2M2L A;  2HDL A;  2HQL A;  3B6Y A;  5KEE A;  4DAP A;  4OWX B;  2NB0 A;  4ALP A;  3KDF B;  2OQK A;  2RDF A;  2A8V A;  2F0J A;  4XQN A;  1E2W A;  3SE0 A;  3C1F A;  2IPK D;  4GLV B;  4ODG A;  3LGJ A;  3KLS X;  2IJ0 A;  3AQQ A;  1BDO A;  4OL7 A;  1H9J A;  2BDN A;  2M9V A;  1ET9 A;  5LMN Q;  3T16 A;  2IWH A;  3R3O A;  2ZTD A;  4B3S Q;  5C44 H;  4V19 0;  1H95 A;  1Z9F A;  1I6V C;  2NVT H;  3BJU A;  5GRO A;  1EY0 A;  1Y14 B;  1S5E D;  1SMX A;  1PTO C;  2WIN B;  1YIJ A;  2RDH A;  5BN5 A;  1MJC A;  1UEA B;  1J8I A;  2PZT A;  4GOP B;  5CMD A;  2OQ0 A;  1L1O B;  1XNQ L;  1TS2 A;  3AYH B;  2X69 A;  1SR3 A;  2IW3 A;  4C3J G;  1PYS B;  1DXM A;  3STB D;  5C3E H;  1JE4 A;  1FGB D;  2SOB A;  3WOF A;  2ZM6 L;  2NVX H;  3CCU A;  1EL0 A;  4N8F A;  2E5L Q;  1M4V A;  4DV5 L;  5T1G A;  1U4L A;  1YNN D;  4LUO A;  3CP0 A;  2AHO B;  4B3T Q;  1UWV A;  1BBX C;  4BWG B;  1B44 D;  2A69 D;  1HHV A;  2SNS A;  4A3F H;  4NW2 A;  1SE2 A;  1VQA A;  3BZD B;  2QEJ C;  4DV6 Q;  3OIP A;  1P8L A;  1PTO F;  4ULL A;  3BU2 A;  5C4X B;  3H0G B;  3CKI B;  4DAY B;  2JN4 A;  5IP7 H;  1EQQ A;  2NVY H;  3JC6 6;  4BA2 I;  2EYF A;  5IE8 A;  3X3M A;  5M3M G;  4CGY B;  4PMB A;  4YCV A;  2P5Z X;  4BY1 B;  2E2H B;  2ZTE A;  3HKZ B;  1T9H A;  2L9H A;  2K5V A;  5C4X G;  3QIA A;  5CYU A;  1KIX A;  1D1I A;  4RGO S;  1DON A;  4P72 A;  4KHZ A;  2LKV A;  3SK8 A;  4ZKC B;  1PVO A;  2CQO A;  2B2T C;  1ENF A;  4I65 A;  1RD9 D;  1ESF A;  4JI2 Q;  5HGT A;  1BCP B;  3OTO Q;  5EBC A;  1PA6 A;  2VY3 A;  5J39 A;  4A3G G;  4K8J A;  3HOX B;  1NNX A;  4DV0 Q;  4OX9 Q;  2Z1C A;  3L9A X;  1C4Q A;  4B3S L;  1E3P A;  2R6G A;  1PRT C;  1SE8 A;  3A74 A;  2R93 H;  1WTH A;  4Z9C B;  1II3 A;  1A2U A;  3CC7 A;  1TY2 A;  1TXY A;  2Z8L A;  2R92 B;  3EQL C;  1WTO A;  1QIL A;  2FMC A;  4DV7 Q;  4XT1 B;  3HGB A;  1LLR D;  3T1H Q;  2CH4 A;  3D3R A;  2F0T A;  3D8G A;  1SYE A;  1I6H B;  4LNQ A;  2F4V Q;  1CZG A;  5GAE C;  1LM0 A;  3J80 E;  1B1Z A;  2B2Y C;  2R92 G;  1SYF A;  2K32 A;  4JG2 A;  1QB5 D;  2R7Z B;  2K4K A;  5KRU A;  1RTN A;  5IGB A;  1ZYR D;  2Q2I A;  4TKO B;  1Q1E A;  1UE5 A;  2Y0S E;  1SFO H;  1ESR A;  1U4P A;  5G3L F;  1OXX K;  1MJE A;  2QDL A;  1WD1 A;  2KCT A;  3NSW A;  1K28 A;  3NUC A;  3CXC A;  4DV6 L;  1I3Q B;  1ILP A;  3TEH B;  1A6X A;  4IFD J;  1KNA A;  3PSI A;  2QIL A;  2A73 B;  3T56 B;  5JVG 3;  1TVX A;  4LFC Q;  1EYC A;  4A76 A;  2PZU A;  5E4X A;  1EZ8 A;  5LMU Q;  3NHH A;  3UI2 A;  1GVP A;  4X3S A;  3SK4 A;  4B3R Q;  3URY A;  3F2D A;  1U4R A;  1LTA D;  2B8G A;  1B3A A;  3KOJ A;  1Y1V G;  3K7A B;  3AB9 A;  1TWC B;  1IBM Q;  1RL2 A;  4BY7 B;  4QUF A;  4TQU S;  1VQM A;  1PFN A;  4WOR A;  2WFW A;  3G48 A;  3OYY A;  1BXT A;  1ENC A;  3J81 i;  3G7L A;  3OTO L;  2N88 A;  3ZJY C;  2C9O A;  4GKK Q;  4WJ3 M;  4JV5 Q;  4FYD A;  4F88 A;  5BN3 A;  4XXE A;  4OX9 L;  1KXL A;  1YVC A;  3QG1 A;  1CKM A;  1X54 A;  1AH9 A;  2L55 A;  1R4P B;  1STN A;  1VQ5 A;  4BY7 G;  4NP5 A;  1KNE A;  1H9M A;  2I5M X;  3PUX A;  5C5M A;  1S5F D;  1STB A;  4HJ8 A;  2KVM A;  1VQC A;  2KOL A;  3RUZ A;  3I4M B;  4KJN A;  1F77 A;  4DV7 L;  2EJG C;  4RCO A;  1EOT A;  5FO9 B;  3PGZ A;  5EPJ A;  2I46 A;  1L0X B;  5ELF A;  1GKH A;  4HED A;  1YNJ C;  3GV6 A;  3MEH A;  4DNI A;  1HNW Q;  3I91 A;  2EYH A;  3PUY A;  5FLM G;  2F4V L;  1PH8 A;  1JJC B;  2HD3 A;  1HCZ A;  3DEP A;  4J15 A;  4C2M B;  1IW7 C;  1QNK A;  3I4M G;  4DV1 Q;  3RMH A;  4HTH A;  5EJW A;  3OOC A;  3FHW A;  4O42 A;  1PH2 A;  3IFT A;  1H9S B;  4X6A H;  5D14 A;  5AJ3 L;  4DA2 A;  3JAM L;  1VF7 A;  4J8Q A;  2Q8R E;  3CQZ B;  3NXW A;  1BKB A;  2B63 B;  2FJ2 A;  5C4X H;  3ONA B;  3E0J A;  3H0G H;  1STE A;  2GVA A;  3CC4 A;  2K1B A;  4DK0 A;  3K80 C;  5LMN W;  3C2P A;  4RKL A;  3ULP A;  3VYS A;  3D4W A;  2E2H H;  4BY1 H;  3KFU A;  3KF8 B;  4NXN Q;  1SNM A;  4I7Z C;  3F1Z A;  4NMZ A;  5DNF A;  4KMU C;  5L37 A;  3ZYY X;  5C3W A;  4A3G H;  4R9W A;  2N49 A;  1EIG A;  2RDG A;  3VR5 A;  5HUR A;  5LMU L;  2B63 G;  2RA4 A;  1A63 A;  2MPM A;  4FDB A;  2V1C C;  2NVQ B;  1RCV D;  4B3R L;  2F0O A;  4YWM A;  4ZUJ A;  1VQL A;  2F0S A;  2Z6B A;  2EYL A;  1IBM L;  3HOU G;  2L4N A;  2RBM A;  1K83 B;  2YYZ A;  1X3F A;  2GVB A;  4KK7 A;  1IBL L;  5I9O A;  2VXW A;  2AUK A;  1CM9 A;  3TRZ A;  2KCC A;  3F8T A;  5JEA J;  3HOX H;  4EQ5 A;  4QY7 A;  4R4T A;  4JV5 L;  3J80 c;  4EVO A;  4AQY Q;  1UUP A;  1QOH A;  2CFM A;  3CPW A;  1LTT D;  4AH6 A;  4ABN A;  2Q2U A;  5EPL A;  5CGK A;  1PH3 A;  3JAM c;  4IOA A;  5I6W A;  1N9W A;  4H44 C;  2R92 H;  1ROD A;  4GNX C;  4DAV A;  4OO1 H;  1SE3 A;  2FFK B;  3S15 B;  3K5O A;  2NN6 H;  1I6H H;  3P75 A;  4BS9 A;  1A3T A;  2F52 A;  4YY3 Q;  2XVS A;  2CHB D;  1B7Y B;  4RHR A;  3OSO A;  1WCM G;  4KD4 A;  1HNW L;  1JB3 A;  2RQX A;  4X3T A;  4A3B B;  4CHT B;  1PFM A;  1UE7 A;  1F2L A;  2F0P A;  4A3J B;  2F0F A;  2R7Z H;  4X64 Q;  3AMU A;  4DV1 L;  1NR2 A;  1K73 C;  1EZ6 A;  1CHQ D;  1N33 Q;  1WI5 A;  1ZXT A;  3IFD A;  1EOV A;  4WFN 3;  3TS2 A;  4CJ0 B;  2NZO A;  1FNW A;  1U9R A;  3J7A V;  3MTS A;  2B2W A;  1BCP F;  1HNZ Q;  2DY7 A;  5JJL A;  2BE5 C;  3NWT A;  3G6J B;  1GUT A;  1I3Q H;  2DUD A;  2K5Q A;  3VDY A;  1L0W A;  4A3J G;  3MXP A;  3S16 B;  4EQO A;  1E22 A;  1AE3 A;  4DR3 Q;  4TSS A;  1Y1V H;  4A3M B;  2AKW B;  4A75 A;  3ND8 A;  3Q8D A;  1PH7 A;  1EY5 A;  2SDF A;  1IL8 A;  4HJ7 A;  2NVT B;  5JJK A;  4NXN L;  4O0A A;  2FIN B;  3ERQ A;  1W2B A;  4ZQ3 A;  2NWG A;  4P75 A;  4QGU A;  1YJN A;  3VYR A;  4YCW A;  1F9R A;  2WAQ E;  4RAU C;  5FK9 C;  5C0X H;  3RN2 A;  5C4Z A;  2KEN A;  3K7A H;  1NMF A;  2JK8 A; 
#chains in the Genus database with same CATH homology
 4BY7 H;  2PI2 A;  2RHQ B;  1XTD A;  2PMZ E;  1D7Q A;  1TWG H;  1FL0 A;  1W3S A;  4L5Q A;  5JJI A;  4GNX B;  3PIO A;  3S1N H;  1C7Y A;  2B3G A;  4RMF A;  1IZ6 A;  2PQA A;  1SRU A;  4HJ5 A;  3A5Z B;  2UXB Q;  1Q82 C;  1CUK A;  2UXD Q;  4A3B H;  1Q81 C;  4A3D G;  1QVC A;  3I55 A;  4JI0 Q;  4P74 A;  3K81 C;  3PUZ A;  4IJH A;  2AWO A;  4AQY L;  1B70 B;  4LFC L;  3S17 H;  2N78 A;  1K9M C;  2A19 A;  2RCN A;  2YV5 A;  3HOW H;  4OO1 I;  1EUJ A;  4DV4 Q;  1G6P A;  2HQL A;  3B6Y A;  5FLM H;  1B8A A;  2VUM H;  2NN6 I;  1FJG Q;  4OWX B;  2LXJ A;  3HOX G;  3UE1 A;  4ALP A;  1PH1 A;  2MO0 A;  1N36 Q;  3KDF B;  2OQK A;  4APV A;  4GNX A;  1J6Q A;  3NEL A;  3U50 C;  1KRS A;  2A8V A;  3NEM A;  1KRT A;  1YHB A;  1I50 H;  3I4M H;  1YHQ A;  1A62 A;  2YTX A;  4GLV B;  3K0X A;  1X9N A;  3CAM A;  1YEZ A;  3LGJ A;  3RLN A;  4DUY L;  4L5S A;  1KHI A;  3AQQ A;  4JI1 L;  2IX0 A;  4YY3 L;  1IBK L;  4A4I A;  4DK6 C;  3ICE A;  4JBW A;  5LMN Q;  4UY8 C;  4X65 Q;  4R4C A;  5IYC G;  4OO1 G;  2ZTD A;  4B3S Q;  5C44 H;  1H95 A;  1KAW A;  1Z9F A;  3I4O A;  1V1Q A;  3CCJ A;  1NJI C;  4GKK L;  3G4S A;  4JI4 L;  2NVT H;  3IRB A;  4OWW B;  2NN6 G;  4YWK A;  3BJU A;  5GRO A;  5AJ3 Q;  1Y14 B;  2I5L X;  3PCO B;  3W5O A;  1SMX A;  5IYB H;  2VQF L;  4DUZ Q;  2BH2 A;  4X64 L;  1YIJ A;  5IY0 A;  4YCU A;  1BBW A;  4DK3 C;  3I56 A;  1KQS A;  4LF9 Q;  1LYL A;  1U0L A;  1MJC A;  1VQI A;  2LSS A;  4O2D A;  4LUV A;  1N33 L;  3CD6 A;  2VS1 A;  4GOP B;  1NY4 A;  1Q8K A;  1M1K C;  2UUC L;  2OQ0 A;  1L1O B;  3CC2 A;  1GD7 A;  1XNQ L;  3AEV A;  2MQH A;  3CQZ H;  3AYH B;  1YHA A;  3K8A A;  4L5T A;  1SR3 A;  4DKA C;  2A1A A;  3PF5 A;  4NXM L;  2Y0S G;  3HOY H;  1QUQ B;  3I4N G;  1PH5 A;  2B63 H;  2VL6 A;  2CCZ A;  1HNZ L;  4JI8 Q;  1PYS B;  1Q46 A;  3STB D;  1JJ2 A;  1VQN A;  5C3E H;  4LF7 Q;  4IPG A;  1VS0 A;  3E0E A;  2ZM6 L;  3CCU A;  2NVX H;  4DR3 L;  1EWI A;  2E5L Q;  4DV5 L;  2UUB Q;  2UXC Q;  4PMW A;  5E7N A;  1CSP A;  4LUO A;  3CP0 A;  4GN3 B;  1X55 A;  1JB7 A;  2AHO B;  2IX1 A;  3CCL A;  3GTQ H;  3KF6 B;  4R4I A;  4B3T Q;  1G51 A;  5C0X I;  4A3I G;  1UWV A;  3NEN A;  1X3G A;  2MO1 A;  4GLX A;  5HGQ A;  4LF5 Q;  4YWL A;  4B3R Q;  4A3F H;  2JA7 H;  2ES2 A;  2NVQ H;  1VQA A;  4DV6 Q;  1P8L A;  2UUA L;  3BZK A;  1IBL Q;  4JBK A;  4BXX G;  4LF4 L;  2R7F A;  3BU2 A;  4QJF A;  2AWN A;  4A93 G;  4X66 L;  4DAY B;  3HOZ H;  1K83 H;  2YU9 H;  2VNU D;  4OON A;  5IP7 H;  1HH2 P;  1EQQ A;  2NVY H;  4JI7 Q;  3JC6 6;  3PO2 G;  2JA6 H;  5GAD C;  1LTL A;  4BA2 I;  4A3L G;  5IE8 A;  1U5K A;  3S24 A;  5M3M G;  1Q7Y C;  3KF6 A;  3HKS A;  4YCV A;  5C0X G;  4RG1 A;  2GN5 A;  4LF8 Q;  2UXB L;  2ZTE A;  2HIV A;  2UXD L;  1T9H A;  3U4V A;  1EIF A;  5M5Y H;  4JI5 Q;  1HZC A;  1PFS A;  4OWT B;  4JI0 L;  4AYB E;  2E2I H;  2D0O A;  1HNX Q;  4IFD I;  4GKJ L;  3HKZ E;  2K5V A;  4A3C G;  1UE1 A;  3CCQ A;  3S2H H;  3EN2 A;  1X56 A;  2HIX A;  3G6E A;  4DV4 L;  5C4X G;  1XNR Q;  2ALY B;  2KCM A;  1GM5 A;  2ID0 A;  1KIX A;  5GAG C;  1FJG L;  3M4Q A;  1XMQ Q;  4IPC A;  2IHF A;  1O7I A;  4LUZ A;  4KI0 A;  4P72 A;  1N36 L;  4KHZ A;  2XTI A;  4JI6 L;  1PVO A;  2D0P A;  2R7D A;  3PUW A;  3PO3 H;  2CQO A;  2JJQ A;  3S15 H;  3GTL H;  3GTJ H;  2K5N A;  1HR0 Q;  4JI2 Q;  4DR1 Q;  1PA6 A;  3OTO Q;  2VY3 A;  2JA9 A;  4A3G G;  3J81 j;  4AIM A;  4DV0 Q;  1IXR A;  4R1J A;  4OX9 Q;  3DM3 A;  4IFD G;  3KLW A;  3AFQ A;  5FJ8 H;  4X65 L;  1YZ6 A;  4DV3 Q;  4BBR G;  5M3F H;  1Y1W H;  4B3S L;  1IL2 A;  2N8N A;  1E3P A;  2R6G A;  1NTG A;  1SLJ A;  1SE8 A;  4LW1 A;  1K8G A;  3A74 A;  5K36 G;  1YJW A;  2JA5 H;  2R93 H;  4A3J H;  4LF4 Q;  2KHJ A;  3UDF A;  2JA8 H;  4JOI C;  1OXV A;  4POF A;  3CC7 A;  4GN5 A;  1TXY A;  3PIP A;  1Z47 A;  4DUZ L;  2BH8 A;  1XPU A;  4IO9 A;  3PF4 A;  2RHS B;  3L0O A;  4UP8 A;  1YBY A;  4UPA A;  4DV7 Q;  3RZO H;  4LF9 L;  1CKO A;  3T1H Q;  2CWA A;  2WB1 E;  4JI3 Q;  3M7N A;  3CW2 C;  4X62 Q;  1EQR A;  3CCR A;  5BR8 Q;  4LWC A;  5EAY A;  3HOV G;  4LNQ A;  1S40 A;  2OTL A;  2QA4 A;  3J80 i;  5IYD G;  4PG3 A;  4BBS G;  2F4V Q;  4JI8 L;  2E8G A;  5GAE C;  3S16 H;  3RZD H;  1VQ9 A;  1LM0 A;  2OCE A;  1UEB A;  4LF7 L;  2F3I A;  5IP9 H;  2VW9 A;  2R92 G;  4A3M H;  3BZC A;  4JG2 A;  2BA0 A;  3K7U C;  4IJL A;  2UUB L;  4DR6 Q;  2K4K A;  2JE6 I;  4A3E G;  4WJ4 A;  2L15 A;  3TQY A;  1CKN B;  4DR5 Q;  2Q2I A;  4IPD A;  3UE0 A;  2YTY A;  3KDF A;  1Q1E A;  4A3K G;  1UE5 A;  2Y0S E;  2JEB I;  4TVA B;  4DAM A;  4DR2 Q;  1SFO H;  3G71 A;  1OXX K;  4EX5 A;  4LF5 L;  1MJE A;  5DLQ E;  2KCT A;  5H1S E;  1K8A C;  1VQJ A;  3CXC A;  2FXQ A;  2VQE Q;  4JC0 A;  4DR7 Q;  2ZJQ A;  3GTO H;  4DV6 L;  3L7Z C;  4P73 A;  5GQO A;  3I2Z A;  3TEH B;  5IWA L;  4GLA C;  2H5X A;  3F2B A;  1NE3 A;  3A5U A;  4LF6 Q;  4IFD J;  4HIK A;  2IT1 A;  3PSI A;  1OTC A;  1TWF H;  3WWV A;  4JI7 L;  4LFC Q;  4DV2 Q;  4A76 A;  3S1M H;  1CKN A;  4KLK A;  3H3V H;  4LFB Q;  4LF8 L;  4QIW E;  4KHP Q;  3HOU H;  5LMU Q;  4JI5 L;  3HOZ G;  1GVP A;  1HNX L;  4GOP A;  1VQK A;  1XJV A;  1NBW A;  2YTV A;  1WFQ A;  1L1O A;  1E1O A;  1WOC A;  2QGQ A;  3FKI G;  5IYC H;  3F2D A;  1XNR L;  3A0J A;  1N32 Q;  3KOJ A;  1Y1V G;  4HJA A;  1KC8 C;  1QUQ A;  1VQO A;  1IBM Q;  1RL2 A;  3MXN B;  1EYG A;  3GTP H;  1LUZ A;  2I0Q A;  4TQU S;  2CKZ B;  1VQM A;  1IBK Q;  4L5R C;  4Y52 H;  2DGY A;  3STB C;  1YIT A;  2WFW A;  3G48 A;  3I7F A;  1HZB A;  1MIU A;  3OYY A;  3J81 i;  1Q86 C;  4DR4 Q;  1HR0 L;  4R4O A;  4C3H H;  4DR1 L;  1V9P A;  2K14 A;  1VQH A;  3OTO L;  1XPO A;  3ZJY C;  1L2F A;  3OW2 A;  4IPH A;  3M9B A;  3RLO A;  1HJP A;  4GKK Q;  4JV5 Q;  4WJ3 M;  1UE6 A;  4MNO A;  1GO3 E;  1OXU A;  4K0K Q;  4OX9 L;  1Q1B A;  2KHI A;  2MNA A;  1YVC A;  1KXL A;  1CKM A;  2K5H A;  4R4Q A;  3I4N H;  1X54 A;  1AH9 A;  4YHH Q;  4BY7 G;  1VQ5 A;  2R7Z G;  5M5W H;  4DPG A;  2K52 A;  4JOI A;  2I5M X;  1VQ7 A;  3PUX A;  1XNQ Q;  4HJ8 A;  3T1Y Q;  1QVG A;  2JEA I;  3M3Y H;  1WCM H;  3ULJ A;  1MKH A;  1VQC A;  5FLX c;  1C9O A;  5IT9 c;  2HHH Q;  4NB3 A;  4DV7 L;  4A3B G;  1VQD A;  2Z6K C;  3M4O H;  1E1T A;  4JI3 L;  3PGZ A;  2R93 G;  4A3I H;  2OWO A;  4X62 L;  3S1Q H;  3J7A 5;  4XIG S;  1GKH A;  5BR8 L;  4GS3 A;  3HOW G;  1QVF A;  1HNW Q;  4DNI A;  4JBM A;  3PV0 A;  3J81 c;  3PUY A;  1X3E A;  3GD7 A;  5FLM G;  1PH8 A;  2F4V L;  4XTC S;  2VUM G;  1JJC B;  3RNU A;  3TS0 A;  1VQB A;  4J15 A;  5GAH C;  2UU9 Q;  3W1B A;  1YNX A;  2PQA B;  4MTN A;  1RIP A;  3HFZ B;  1PH4 A;  2HT1 A;  4BXX H;  5JEA G;  5LMN L;  4A93 H;  3I4M G;  1WJJ A;  4DV1 Q;  1JMC A;  4DR6 L;  3PO2 H;  4A3L H;  1KL9 A;  3FHW A;  3UDX A;  4DR5 L;  4LFA Q;  1PH2 A;  4X6A H;  5HY6 A;  2QEX A;  5AJ3 L;  1TWA H;  4JBJ A;  2I5H A;  1ASY A;  4HIM A;  2UUA Q;  4B3M Q;  1XMO Q;  4DR2 L;  5IP9 G;  4GN4 B;  4A3M G;  1TWC H;  1PV4 A;  4X66 Q;  5C44 G;  1BKB A;  3NBH B;  3U58 A;  4A3C H;  2VQE L;  4HID A;  3H3V I;  3S14 H;  4DR7 L;  5C4X H;  1SRO A;  3H0G H;  2WAQ G;  5ELN A;  2GVA A;  1JJG A;  2KBN A;  3CC4 A;  2AMC B;  3UDI A;  5IYB G;  3K80 C;  5LMN W;  4LF6 L;  5C0X J;  4JYA Q;  4C3I H;  4OXP A;  3ULP A;  2CWP A;  3E9I A;  1VQ8 A;  3EIV A;  4DV2 L;  4GKJ Q;  2E2H H;  4BY1 H;  3KFU A;  3KF8 B;  4NXN Q;  4LFB L;  1OXS C;  1S3O A;  1XPR A;  1FVI A;  3F1Z A;  2BA1 A;  3JAM i;  2E5L L;  1SN8 A;  3HOY G;  4KHP L;  2UXC L;  4A3G H;  3D0F A;  1N34 Q;  1FGU A;  2N49 A;  5LMU L;  2B63 G;  1DGS A;  4JI6 Q;  1A63 A;  4FDB A;  1BBU A;  5C3E G;  4B3T L;  1WYD A;  2V1C C;  1VCI A;  1J5E Q;  2VZA A;  4B3R L;  1I94 Q;  1AE2 A;  1IYJ B;  4YWM A;  4BBR H;  3CF5 A;  1VQL A;  1N32 L;  1I94 L;  1Q12 A;  3GTG H;  4A3D H;  1VQ6 A;  4BA1 I;  1P16 A;  1IBM L;  3HOU G;  1M90 C;  2YYZ A;  1X3F A;  3FP9 A;  1X6O A;  5M5X H;  1D8L A;  2GVB A;  2WB1 G;  1IBL L;  4DR4 L;  1E7Z A;  3TRZ A;  1S72 A;  3F8T A;  4NPS A;  5JEA J;  2Q2H A;  3HOX H;  2N3S A;  3ULL A;  4QY7 A;  4EQ5 A;  3ERS X;  2K75 A;  4R4T A;  2XGT A;  4C2M H;  4JV5 L;  3J80 c;  3TRE A;  4AQY Q;  4A3F G;  2JA7 G;  2Q2T A;  2CFM A;  5C4J H;  3M85 A;  2C35 B;  4AH6 A;  3CPW A;  2ASB A;  4K0K L;  3CCS A;  1N8R C;  3HOV H;  2EXD A;  2Q2U A;  1NMG A;  4BBS H;  5IYD H;  2WP8 J;  3MEF A;  3CMA A;  1PH3 A;  3JAM c;  4YHH L;  3KJP A;  4IOA A;  2OTJ A;  3S2D H;  4P71 A;  1N9W A;  2PNH A;  5IP7 G;  2R92 H;  4GNX C;  2JA6 G;  3T1Y L;  1VQE A;  1HZ9 A;  3F2C A;  4A3E H;  1A8V A;  2Z6K A;  2HHH L;  1JE5 A;  3CCV A;  4DUY Q;  2ZTC A;  1XMQ L;  1I6H H;  3W1G A;  4JI1 Q;  2F52 A;  4YY3 Q;  4A3K H;  1ASZ A;  3H15 A;  2LXK A;  1B7Y B;  1PHJ A;  1EIY B;  4MZ9 A;  1JT8 A;  4JI2 L;  3J7Z C;  2E2J H;  1WCM G;  1VQF A;  2IHE A;  1HNW L;  3CCE A;  2IY5 B;  1A0I A;  3UDG A;  2NZH A;  4QQB X;  1V43 A;  4JI4 Q;  5ELO A;  1K3R A;  1C0A A;  4JCV E;  3CME A;  1VQG A;  2ZJR A;  1R9T H;  4QL5 A;  1UE7 A;  4DV0 L;  2UU9 L;  3D31 A;  3CPF A;  3M4P A;  2R7Z H;  3PO3 G;  2VQF Q;  4X64 Q;  1BVS A;  2ZJP A;  4Y7N H;  1PYB A;  2MFI A;  4C3J H;  4DV1 L;  4DV3 L;  1EFW A;  4UP7 A;  1K73 C;  2ATW A;  1PH9 A;  3S1R H;  1N33 Q;  3GO5 A;  4ME3 A;  4IOC A;  1QZH A;  3CCM A;  4LFA L;  1WI5 A;  2UUC Q;  1EOV A;  2Z0S A;  3E9H A;  4PZ6 A;  4B3M L;  3TS2 A;  4PZ8 A;  1XMO L;  1OXT A;  3RN5 A;  5IWA Q;  2EQS A;  2NZO A;  1I5F A;  4HJ9 A;  4NXM Q;  1HZA A;  5FJ8 G;  2RF4 A;  1HR0 W;  5M3F G;  1HNZ Q;  1Y1W G;  3T1H L;  5JJL A;  3ER0 A;  1YI2 A;  2JA5 G;  1I3Q H;  2DUD A;  4A3J G;  3VDY A;  1X65 A;  1L0W A;  3FKI H;  3AFP A;  3GTK H;  2ZM6 Q;  1TWH H;  2JA8 G;  1E24 A;  1E22 A;  1AE3 A;  3DLL A;  4DR3 Q;  1VQP A;  1YJ9 A;  4HIO A;  3SGI A;  4DV5 Q;  1QZG A;  1Y1V H;  4POG A;  2AKW B;  4JYA L;  4PZ7 A;  4A75 A;  3Q8D A;  1PH7 A;  3GTM H;  2PI2 E;  4HJ7 A;  5JJK A;  3PUV A;  1VQ4 A;  2K50 A;  4NXN L;  4GOP C;  1PH6 A;  4O0A A;  1L1O C;  3H0G G;  3EBE A;  3U4Z A;  1W2B A;  3RLF A;  2KEN A;  1KD1 C;  2JQO A;  1N34 L;  4P75 A;  4QGU A;  3KJO A;  1YJN A;  2D62 A;  5J3B A;  1K0R A;  4YCW A;  2WAQ E;  5M3M H;  4H02 A;  1G29 1;  2EIF A;  2B29 A;  3RR5 A;  4AYB G;  3RN2 A;  1J5E L;  4UP9 A;  3KYH C;  3GDE A;  1CSQ A;  4BY1 G;  3K7A H;  3HKZ G;  1NMF A;  3L2P A;  2JK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...