4JOIC

Crystal structure of the human telomeric stn1-ten1 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
MLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CST complex subunit STN1
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 28
structure length 118
sequence length 118
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15490 Ten1_2 Telomere-capping, CST complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4joiC00
2Q2HA 1B7YB 4A3IG 4JI8L 3UDXA 1K9MC 4LF4L 3K81C 4R4OA 3M4PA 1QVGA 3VDYA 3B6YA 1AE2A 2Q2UA 4LF7L 1K0RA 1UE6A 4GS3A 4QY7A 1CKNA 4HIMA 1XNQQ 2ZJPA 4BA2I 1CUKA 2OQ0A 3CCRA 5IYBH 4DV0L 2VY3A 3G71A 1PH8A 1KIXA 3GTKH 4BXXG 3TREA 3HKZE 1OXTA 4JBJA 3OTOL 1X56A 4DR2L 1PFSA 2GVBA 3FHWA 5IY0A 4A3KH 4IPGA 2KCTA 4P72A 3UDIA 4JI7L 2JA6G 3M3YH 2D0OA 2FXQA 3PGZA 3K80C 4NB3A 1HZAA 4B3RQ 1MKHA 4R4TA 1HNXQ 2NN6G 4PZ6A 1VQDA 2JQOA 4PZ7A 4YHHQ 3KJOA 1S72A 4LF8L 4LF9L 2ZTCA 4YWMA 2ATWA 1YI2A 2VQEQ 2ASBA 1U5KA 4DR1Q 4JI3Q 4DV7L 1KQSA 3KJPA 1QVCA 3PSIA 4X66L 1IBLQ 3G6EA 4OX9L 3L0OA 2XGTA 2E5LQ 2UXDL 4L5SA 4DV6Q 1VQMA 4X64Q 1IBMQ 4A76A 1CKNB 1SRUA 3UDGA 2YU9H 4JI6L 3M4QA 4DV3Q 1WJJA 1IZ6A 1Q81C 2UUAL 1IBKQ 2YTVA 2V1CC 2LSSA 3F2DA 4B3SQ 2HHHL 1YJ9A 1N9WA 3CCSA 1KAWA 3CD6A 1N36Q 3HOVG 2B29A 1WCMG 1HNWL 1CKOA 4JBKA 5H1SE 3AFQA 1KRTA 4DK3C 4X65Q 3CCLA 4DUYQ 4R4QA 3JAMc 1X3GA 2CWPA 1XMOQ 1K83H 2MO1A 2MFIA 4DR4Q 1YBYA 3A74A 4ME3A 4KHPL 4X6AH 3W1BA 3HKZG 2DUDA 2N3SA 3FP9A 3TQYA 3ERSX 4DR3L 3S1MH 4A3MH 2VQFQ 3HOUG 4YCUA 2I5MX 5JEAG 4LFAL 4IPHA 1B8AA 4A3DH 5IT9c 1Y1VH 2DGYA 3KF6A 4IJLA 4B3TL 4FDBA 1PH4A 3E9HA 1RIPA 3CF5A 3F8TA 3BZKA 5LMNW 2UXBQ 1NTGA 2WAQG 2KBNA 5IE8A 5AJ3L 4MNOA 1GO3E 4EQ5A 1VS0A 4IJHA 4A3FG 2R93G 5C44H 5M3MH 3IRBA 3RNUA 2I5HA 4JI4Q 1CKMA 1VQ7A 5C4XH 3W5OA 4A3LH 2IX1A 5K36G 2Y0SG 3RLFA 2MO0A 5C3EG 3GTMH 3HOWG 3FKIG 5J3BA 1E3PA 3L7ZC 2VNUD 4DV1Q 3J7A5 3BU2A 2UUCQ 2VUMH 4IO9A 3GDEA 1XNRQ 2HIXA 2ZJRA 1N33Q 1SN8A 2CWAA 3AQQA 5IWAL 4AQYQ 4JI2L 1I94Q 5IYDG 5LMUL 3G48A 3S16H 4DV2Q 4RG1A 1PH5A 3KYHC 4QJFA 1I5FA 1D8LA 2AWNA 2IT1A 3NENA 1OTCA 2UUBQ 2UXCL 4GLVB 2UU9Q 4DKAC 1HR0W 1UEBA 1Q1BA 3RN2A 4OO1I 4NPSA 1O7IA 3KDFA 1HR0Q 5IYCH 1LYLA 2JJQA 3T1HQ 1AH9A 3CPFA 1C0AA 2MQHA 3GTLH 4JYAL 2ES2A 4HJ5A 2F3IA 1X65A 4HJ8A 1LM0A 2R7ZH 3GTGH 2CFMA 3M7NA 4IFDG 1B70B 4LWCA 5FLMH 1EYGA 4DUZL 2E2JH 3KFUA 1Y1WH 1A0IA 2OQKA 2VL6A 4L5QA 4X62L 4A3KG 2YV5A 5M5WH 3I56A 1HZBA 4LF5Q 1IL2A 2BA1A 4DR7L 4JV5L 3EBEA 1PYBA 3A0JA 4XIGS 3S24A 2VS1A 3T1YQ 3BZCA 3EN2A 2B63H 1KRSA 5IP9H 1QZHA 4C3JH 3NBHB 3UDFA 3CCMA 3HKSA 1VQPA 1X3FA 3TRZA 4BBSH 3JC66 4JI0L 4JI1L 3CW2C 3RZOH 1EIFA 1VQ9A 4DR5Q 1XMQL 1JMCA 5C0XI 2K50A 1XPRA 3J81j 5HY6A 2ALYB 3PF4A 1S3OA 3S1NH 2JE6I 2R92H 3STBC 3RN5A 4LFBL 2H5XA 2VZAA 1HNZQ 1VQLA 2Q2IA 1PH7A 3AEVA 4DNIA 1TWCH 4GOPA 1OXSC 2I0QA 4K0KL 1WI5A 2LXKA 3J80i 1VQ5A 1E24A 1LUZA 1VQHA 2PI2E 1X55A 4GN4B 4YCVA 3AYHB 2WB1G 3H0GH 1XNQL 3PO2H 1WOCA 3U4ZA 4JBMA 4A3EH 3CC7A 4LFCQ 1OXUA 4KI0A 1HJPA 1GKHA 1L1OA 4P73A 3PV0A 4APVA 1RL2A 1VQOA 4LW1A 3PO3H 2JA5H 4PZ8A 4A3JH 1QVFA 4A3MG 1QUQA 1HZ9A 1NMFA 3OYYA 1N34Q 4J15A 4A3DG 4BY7H 2NZOA 4DV5Q 2JEAI 3F2BA 1P16A 1JE5A 2JA7H 1PVOA 4LF8Q 4B3RL 1HNXL 4YHHL 1VQ4A 4JI5Q 3U58A 3U50C 4NXMQ 4K0KQ 5C44G 5M3MG 2VQEL 1VQIA 1YVCA 2MNAA 4DR1L 1JB7A 4JI3L 4OWWB 5C4XG 1IBLL 4Y52H 1VQJA 1J5EL 1J6QA 1Z47A 3BJUA 4IPDA 4GOPB 2ZM6Q 1N32L 1U0LA 3K7AH 2AWOA 3RR5A 4X64L 2ZJQA 4L5TA 4JI6Q 1EOVA 2NVYH 1G51A 1UE7A 2R6GA 3PUVA 3CCJA 1H95A 3KF8B 1VQFA 2VUMG 4DV3L 1PV4A 1BVSA 1LTLA 4A3IH 2ID0A 2D62A 3J80c 3CC4A 1FJGL 1IBKL 1OXXK 2HHHQ 4GLAC 4GOPC 4B3SL 1BBUA 1L2FA 4P71A 1EFWA 3E0EA 2CQOA 1GM5A 2Z6KA 1QUQB 4BBRH 4DK6C 1N36L 3TS0A 3D0FA 4A3CH 3TS2A 4DV4Q 4H02A 1TWFH 4O0AA 4UPAA 1L1OC 1P8LA 5GAHC 3CCUA 4X65L 4KHPQ 2E2HH 4C2MH 4DUYL 1XMOL 5IYCG 2N78A 5E7NA 1TXYA 4LF6Q 4B3MQ 1XPUA 3HOXG 1YJWA 4NXNQ 1TWGH 4LFAQ 2K5NA 2E8GA 1SMXA 2IY5B 2PQAA 4R1JA 1KD1C 2RCNA 1NE3A 4UP8A 2RF4A 3I4MG 4Y7NH 4UY8C 5FLMG 4QQBX 1E1OA 1Y1WG 5BR8Q 5AJ3Q 2OWOA 2XTIA 3DM3A 4JBWA 3D31A 2UXBL 1G6PA 3CCVA 2KENA 2B3GA 4BY1G 5IP7H 5C4JH 3F1ZA 5C0XJ 5LMNL 1Y14B 1SFOH 3K7UC 1TWAH 2K75A 3E9IA 5GQOA 2YTYA 3ICEA 4HJ9A 2B63G 3ZJYC 4IOCA 1MIUA 5IP9G 1NY4A 1Q82C 2JEBI 3UE1A 2R7DA 1X3EA 4YY3Q 3RLOA 1VQBA 3G4SA 2K4KA 4DV1L 2QGQA 2LXJA 4BBSG 1K8AC 1PH6A 1A63A 2UUCL 3KF6B 1EIYB 1SE8A 2NZHA 1XNRL 1CSPA 1N33L 1FGUA 1UWVA 4UP9A 1Q86C 3STBD 3W1GA 1IYJB 1PH2A 2Z6KC 3GTJH 3MEFA 2ZTEA 3H15A 5GAEC 1BBWA 2R92G 2PQAB 3PUYA 1DGSA 5IYBG 2JA8H 1OXVA 1SROA 3LGJA 1X6OA 3I4NH 3PUXA 4AIMA 4AYBE 4C3IH 2ZTDA 4AH6A 2EIFA 3AFPA 4OO1G 1HR0L 4GKJQ 3PO2G 1EWIA 3T1HL 4JCVE 4JYAQ 2IHEA 4A3EG 2N8NA 2WP8J 4EX5A 3PO3G 2F52A 1Z9FA 3GTQH 2CKZB 2JA5G 1UE5A 2WFWA 4A3JG 2HQLA 2IX0A 1EQQA 2F4VQ 4GKKQ 2A19A 2BA0A 4OONA 1XTDA 2EXDA 2JA9A 3MXNB 2HIVA 3CMAA 2IHFA 4DR6L 2JA7G 1VQ6A 1JT8A 1PYSB 4HJAA 4QIWE 3KDFB 1YZ6A 3T1YL 3NELA 3FKIH 3PF5A 2Z0SA 4A4IA 4A93H 2D0PA 1W2BA 4JI8Q 3CQZH 1BKBA 4A75A 4LF4Q 4JOIA 1PHJA 5JJLA 4LUVA 1Q7YC 5M5YH 2A1AA 1R9TH 3EIVA 4LNQA 3S17H 4LF7Q 2RHSB 3S1RH 4KLKA 1V9PA 4R4CA 1HH2P 1YHAA 2N49A 3CAMA 5M3FH 3J7ZC 3S2DH 1EQRA 3PIPA 2KCMA 1NMGA 4DV0Q 5DLQE 5JEAJ 1CSQA 3F2CA 5FJ8H 1ASZA 3K8AA 2NVQH 3M85A 1TWHH 1HNZL 1ASYA 3I7FA 3OTOQ 4DR2Q 3HOYH 4AYBG 4BBRG 1VQAA 4JI7Q 1M90C 3GTPH 4A3CG 2NN6I 1YNXA 3PIOA 1V1QA 1PH9A 1E7ZA 1EUJA 1Y1VG 3U4VA 3HFZB 4LFCL 2I5LX 4BA1I 4LF9Q 4POGA 1Q46A 3GTOH 4NXNL 3ULLA 4WJ3M 1E1TA 1SR3A 3S15H 4PMWA 5ELNA 3J81i 3JAMi 3ULPA 5GAGC 2YYZA 4A3BH 1IXRA 1I3QH 4P75A 4DV7Q 4A3GH 1SLJA 4X66Q 1N34L 4QGUA 4OX9Q 5ELOA 4DAYB 4DV5L 2UXDQ 1AE3A 4HIOA 4A3LG 4TQUS 2YTXA 1KC8C 2E5LL 2WAQE 4DV6L 3GD7A 3K0XA 4JI5L 3CCQA 1IBML 5M5XH 2BH2A 3DLLA 2JK8A 4GLXA 4POFA 4NXML 3A5UA 4JC0A 1G291 1UE1A 5IP7G 4GNXA 2UUAQ 3KOJA 4JOIC 1XPOA 1KL9A 1J5EQ 1X9NA 2OTJA 1L1OB 4MTNA 4IPCA 1WYDA 2Y0SE 3WWVA 1PH3A 1A62A 2PMZE 1N32Q 2QA4A 2ZM6L 4ALPA 4YWKA 2GVAA 3I2ZA 4GN5A 1GVPA 1HNWQ 4O2DA 4DPGA 1K73C 1VQEA 4GN3B 1FJGQ 3S2HH 3H3VI 1NJIC 1Q12A 5JJIA 1VQKA 4IFDJ 2PNHA 4OWTB 3RLNA 4DR4L 4BXXH 3NEMA 1VQCA 4DR3Q 2KHJA 2NVTH 3CP0A 1I50H 1D7QA 4OXPA 2VQFL 2JA6H 2JA8G 1FVIA 3S14H 2R7ZG 4B3TQ 4DV4L 3I4NG 3J81c 2R7FA 4HIKA 2E2IH 4OWXB 1V43A 1X54A 1YITA 2VW9A 5C0XG 3PCOB 3PUWA 4LF6L 4GNXB 4B3ML 1Q1EA 4WJ4A 1I6HH 2RHQB 5HGQA 4JI4L 3HOZH 2KHIA 4JG2A 2QEXA 3S1QH 1VQ8A 5JJKA 1K3RA 5BR8L 4TVAB 3SGIA 4GNXC 2K5HA 2OTLA 5LMNQ 1MJEA 3L2PA 3GO5A 3CXCA 1M1KC 1T9HA 4XTCS 4R4IA 2L15A 1YEZA 4JI2Q 2PI2A 3ER0A 4QL5A 5IWAQ 5LMUQ 5GROA 1C7YA 4C3HH 3OW2A 4PG3A 4YWLA 4AQYL 4RMFA 1I94L 1NBWA 1Q8KA 4A93G 5GADC 4DV2L 3HOVH 1QZGA 1K8GA 4LUOA 4YY3L 1VQNA 1WCMH 2AKWB 3Q8DA 2UXCQ 1KXLA 1FL0A 3CPWA 2UUBL 1YHQA 2UU9L 2Q2TA 1JJCB 3M9BA 4IOAA 3CC2A 5EAYA 3RZDH 1PA6A 3H3VH 3CCEA 1KHIA 3H0GG 2K52A 5M3FG 4HJ7A 1JJ2A 4IFDI 4DAMA 3PUZA 1VCIA 3HOUH 2C35B 1PH1A 5FJ8G 3CMEA 1GD7A 4DUZQ 1N8RC 3HOYG 4P74A 2NVXH 2K14A 4X62Q 1L0WA 2WB1E 4YCWA 4HIDA 4MZ9A 2A8VA 3HOXH 4DR7Q 2CCZA 5FLXc 1YJNA 3I4OA 4LUZA 4L5RC 4A3FH 4LF5L 4KHZA 4BY7G 4JV5Q 4GKJL 2R93H 3TEHB 3I55A 2GN5A 1VQGA 1MJCA 3I4MH 1S40A 2AHOB 1W3SA 1YHBA 3M4OH 2OCEA 5C3EH 1HZCA 2EQSA 3HOWH 2AMCB 4A3BG 3KLWA 4GKKL 2K5VA 1YIJA 2F4VL 4A3GG 4DR6Q 4JI0Q 4JI1Q 4BY1H 1JJGA 1E22A 3A5ZB 1XJVA 2HT1A 1XMQQ 1A8VA 4UP7A 3ULJA 4DR5L 5IYDH 2BH8A 3HOZG 3UE0A 1C9OA 1WFQA 4LFBQ
chains in the Genus database with same CATH superfamily
1SBBB 1UUPA 2QEJC 4R4OA 3CRKC 3M4PA 3VDYA 3MFGA 1AE2A 1K0RA 4QY7A 1RKNA 1CKNA 1EY0A 1L0XB 2B2UC 3TDQA 4HIMA 5KYLA 3MAQA 2D5DA 4DV0L 2VY3A 4IFDH 3NWSA 1C8CA 4BBSB 5FLXE 3OTOL 1PFSA 5CV5A 2KCTA 4JI7L 3X3NA 2FHTA 3K80C 4NB3A 1MKHA 5FLXL 1VQDA 2JQOA 3KJOA 2ZTCA 4YWMA 5ELDA 4DR1Q 2TMPA 1QVCA 3FEWX 3EJIA 3PO2B 4TKOB 4DV6Q 1IBMQ 4A76A 1PTOD 2RCFA 5EGTA 2JP1A 2JA5B 2VB3X 4NDXA 4A3JB 1IBKQ 4B3SQ 1H9RA 1H9MA 2KEEA 4BY7B 1YJ9A 3V2TA 1HXYD 1STYA 2JA7B 1N36Q 3HOVG 4V0BA 4XDXA 2B29A 2RBMA 1WTOA 4FF3A 5HURA 4JBKA 1KRTA 1LTRD 1ONLA 1K83H 3SXHA 4ME3A 3DWPA 2N3SA 2A6ED 3EFXD 1TQOA 4YCUA 2I5MX 1UEAB 4LFAL 4A3DH 2F0KA 2NVYB 3KF6A 1PZJD 4IJLA 4B3TL 5L37A 1RIPA 3CF5A 2F0OA 5LMNW 1VS0A 3FPPA 2I5HA 1PTOC 4JI4Q 4BBRB 5C4XH 2F03A 4A3LH 2EJFC 3URYA 1TWFB 3HOWG 5C4HA 2E2HB 3ITPA 5I4DA 2VUMH 2PPBC 3GDEA 2B2WC 2HIXA 4KK7A 1L0YB 1SN8A 1Z6HA 4AQYQ 1I94Q 5IYDG 5LMUL 4Y7NB 3S16H 1PH5A 1LT4D 4HEDA 1OTCA 4QIWB 2DY7A 3DHQA 4GLVB 2UUBQ 2A6EC 4RGOS 3T4AC 1Q1BA 4BWGB 3KDFA 2EYPA 1SFOB 1U4MA 1TWAB 1HR0Q 1LYLA 1AH9A 3GTLH 4JYAL 4HJ5A 2F3IA 3GTGH 1FNUA 1LM0A 1ET9A 1B70B 1SEBD 3A8IE 2E2JH 4DUZL 2WIIB 2VL6A 4X62L 4HR7B 5DEHA 2YV5A 5IODA 4DR7L 4ZKCB 4RGNA 1PYBA 3A0JA 1GJXA 2E76C 1BOSA 2VS1A 2AQ1B 1PRTC 2JA8B 2EY2A 1HQRD 5IP9H 3NBHB 1ENAA 3I4NB 5CBEE 3JC66 1O80A 5I9OA 3VA5A 1B44D 1VQ9A 1XMQL 1JMCA 4J8QA 5DM73 1SSOA 1CHQD 2G9DA 1S3OA 4LFBL 2WAQB 4LAAA 1DONA 2CW0D 1VDZA 1TWCH 2I0QA 2F1MA 4FF1A 4ZKBB 2PI2E 4YCVA 1VQHA 1IHZA 3AYHB 1XNQL 3U4ZA 2EJGC 2KJXA 3FKIB 4LFCQ 1LTGD 3KLSA 4KI0A 4A93B 1PTOF 1L1OA 2MHVA 4Z9CB 4PZ8A 4A3MG 1KTKA 1HZ9A 5I2XA 1N34Q 4HMJA 4HSVA 4JK1C 4LF8Q 4B3RL 1Y69U 1VMCA 3HGBA 1BCPB 3U58A 1TWHB 5NUCA 3IFDA 4K0KQ 1JQYD 2MNAA 3UI2A 4H13C 2QKIC 1HA5A 1VQJA 1B3QA 1RHPA 3BJUA 5DAUA 4L5TA 4GZYC 1PTOH 1G51A 3PUVA 5C6AA 4G4KA 1O78A 1PV4A 1BVSA 1LTLA 2ID0A 3A7AB 2HHHQ 2FFKB 4GOPC 4A3GB 1BBUA 1L2FA 4P71A 2HDLA 5FO9B 1EWCA 2PNRC 4NMZA 3TS2A 2D2CC 4DV4Q 4UPAA 5GAHC 1HFNA 1F2MA 3WOEA 1XMOL 1PRTF 4CDEC 2N78A 4B3MQ 3HOXG 3G6JB 2XVSA 1TWGH 2PQAA 2K03A 2RCNA 1QOHA 4DGZA 4UP8A 2RF4A 3DM3A 1CZWA 4JBWA 3D31A 5ELCA 2AUJD 2B3GA 3F1ZA 4LK1C 3K7UC 2WB1B 5GQOA 2YTYA 4CDFC 4HJ9A 2K1BA 4IUUA 1NY4A 3UE1A 1H9SA 2WKDA 1G91A 3EVQA 1GUWA 4BBSG 4J1MA 1A3TA 3KF6B 5CR3A 2UUCL 5C3WA 1SE8A 2NZHA 3R93A 1XNRL 1N33L 1I6HB 3W1GA 4DU9A 2Z6KC 3NBIA 3OMGA 2F0EA 2CH4A 1DGSA 1TKWB 5IYBG 1OXVA 3BDLA 3PUXA 4DF7A 3C3LA 1EY6A 1ENCA 3I4LA 1WTXA 2C9OA 3PO2G 1IW7D 2N8NA 2WP8J 1Z9FA 3GTQH 2JA5G 1UE5A 4A3JG 3I8ZA 5BN5A 4IUPA 3MXNB 1SAPA 2HIVA 2JA7G 2FMMA 2QW7A 1VQ6A 1JT8A 3HOUB 5LHY1 3KDFB 2RSOA 3OIPA 3PF5A 1STHA 3CQZH 4YIJA 2L9HA 5M5YH 2A1AA 4RFBA 2KQ3A 2MPMA 4A3FB 1M4VA 3EROA 2KOLA 3NTHA 1HH2P 3SR1A 1YHAA 1JOOA 3CAMA 2AUKA 3J7ZC 2Y0SB 5C3EB 5DLQE 1CSQA 2Z9HA 1STEA 1HNZL 1BDOA 1ASYA 1IW7C 4BY1B 4OHJA 4BBRG 1VQAA 5KRUA 1Q90A 4IZ8A 1QNUA 2F0MA 3TBIB 3PIOA 1PH9A 4IUNA 1MSHA 3U4VA 1DZ1A 3I3CA 4DK0A 5I9PA 2I5LX 2CH4W 3NPPA 4POGA 4NXNL 4PMWA 3J81i 3JAMi 5JVG3 2YYZA 3RMHA 1I3QH 4P75A 4QGUA 4ULLA 1AE3A 2E5LL 1SE3A 3K0XA 2JK8A 4NXML 5FKAC 4POFA 3SVMA 5IP7G 2UUAQ 1B2TA 5C0XH 2B2YC 1J5EQ 5EKKA 1L1OB 4MTNA 4IPCA 1WYDA 2L11A 1N32Q 5G3LD 4DNTB 2ZM6L 1CHPD 2NUCA 4GN5A 1I4RA 3D6WA 1LTSD 1AEXA 2RVLA 1NJIC 5JJIA 2PNHA 4HSPA 5I6YA 1ML0D 4K5VA 4DR3Q 4KJNA 2Q8TA 1TS2A 1D7QA 2JA8G 3S14H 2I07B 2YU9B 1QILA 4EVOA 2PZTA 1SYDA 3I4NG 3J81c 1PZID 2E2IH 4OWXB 1W6JA 2Z6BA 2HCIA 4LF6L 4B9WA 4WJ4A 1J9OA 3CHBD 3QIAA 3X3MA 4CJ2C 4X3SA 1C4QA 2KHIA 4JG2A 3S1QH 3P75A 4GNXC 4CDCC 1BF4A 2A5HA 3GO5A 3NHHA 1T9HA 3S1MB 2PO4A 3C1FA 2DY8A 2VXWA 5GROA 1EIHA 4C3HH 1CZGA 1Y1VB 2P5ZX 1NBWA 4A93G 2O5IC 4DV2L 5E4WC 1D1IA 2F0FA 3Q8DA 4FF4A 1JJCB 4M1UB 2HCCA 2R3ZA 2K52A 5T1GA 3TP5A 4DAMA 1VF5C 3GTMB 1PH1A 5JEAH 1PXUA 2RQXA 1GXDC 1QJOA 1I6VC 4R8IA 1A2TA 1ILQA 4YCWA 3HOXH 2CCZA 5FLXc 4LF5L 4JV5Q 4GKJL 2R93H 3I55A 1LTAD 2KEDA 4N9TA 1MJCA 1S40A 3BDCA 2X69A 3M4OH 3NXWA 2EQSA 3KLWA 2K5VA 2F4VL 4A3GG 4JI0Q 4JI1Q 3A5ZB 5J1ZA 2HT1A 1DCZA 3MHBA 4KMUC 4XYQA 1STGA 1ZKOA 3IFTA 4KD4A 4HTHA 2R7ZB 3V96A 1CTMA 3BS1A 4G57A 4A3IG 4O1NA 3UDXA 1K9MC 4LF4L 1FGBD 1QVGA 3B6YA 1ZEQX 4X3TA 1B9MA 2EY6A 4N8X1 1TU2B 4DXFA 2B63B 5IYBH 3G71A 1PH8A 1KIXA 1VF7A 3HKZE 1OXTA 5IGBA 4DR2L 1WTRA 4A3KH 4DAPA 2EE1A 2D0OA 3PGZA 5G3LF 4XQNA 4B9XA 3S1NB 1HNXQ 4PZ6A 4YHHQ 2SEBD 2R92B 1LT6D 1ESRA 4CKEA 4JI3Q 4DV7L 1IBLQ 3PSIA 3HRZC 4X66L 1WTQA 3L0OA 3H0GB 2XGTA 4X64Q 4A3EB 1SNPA 3SDZA 1JWSD 5CV6A 4JI6L 4S3SA 4M8AA 4DV3Q 2YTVA 3F2DA 4NKLA 1TVXA 3CCSA 1KAWA 3C1EA 2HDMA 5D65A 4G7OC 2BDNA 4FXGC 3AFQA 4X65Q 4DR4Q 4KHPL 4RGMA 4C3IG 5T1IA 4X6AH 3FVQA 4ZAIA 3ERSX 2VQFQ 3HOUG 3K7AB 5IT9c 3TP6A 1SNQA 4FDBA 2UXBQ 1NAPA 4A3FG 5C44H 5M3MH 1RJTA 3RNUA 1CKMA 1HCZA 3W5OA 3C46A 5K36G 2Y0SG 5C3EG 5EKLA 5J3BA 1E3PA 4WJWA 1VMPA 4IO9A 2Z1CA 3J7YW 4RKLA 4JI2L 2HQEA 2N88A 2OXPA 1ENFA 2NWGA 3NBHA 1I5FA 2AWNA 2IT1A 3J81E 5D14A 3JAME 2UXCL 2UU9Q 4HAEA 1SYEA 1UEBA 5JAVA 3RN2A 1EQTA 5KYIA 5IYCH 3JAML 3T1HQ 3CPFA 1QCBD 5CYUA 4G7ZC 3M7NA 2CFMA 1FNVA 1EIGA 5FLMH 1EYGA 1Y1WH 4UDUC 2F0VA 1RD9D 5M5WH 1IL2A 2BA1A 2H4OA 3GTJB 1EL0A 3SK6A 3S24A 1EQVA 3T1YQ 3BZCA 3DWQA 2NYZD 2JXMB 4C3JH 1MGSA 4ZK9B 1VQPA 4X3UA 1X3FA 4NW2A 4FF2A 3TRZA 3CW2C 3RZOH 1EIFA 1QB5D 1TY2A 1WD0A 2K50A 5I2YA 1E0BA 5C5LA 1I4PA 1M8AA 5HY6A 1V1OA 1TY0A 3STBC 2H5XA 4V190 3AEVA 3K58A 1STNA 1ZYRD 1VQ5A 4GN4B 1LUZA 2CHBD 3CC7A 1F77A 1GUGA 1OXUA 3A55A 4P73A 4BS9A 1VQOA 3PO3H 4LW1A 4H44C 3ZYYX 3S17B 2EOTA 4J15A 4RCOA 4DV5Q 3BYTB 5KGUA 1P16A 3S2DB 5EBDA 2NVQB 4JI5Q 1JWMD 1DOLA 4FXDA 1BNZA 1D1KA 4C56C 1YVCA 1EZ8A 4DR1L 4CJ0B 4OWWB 1F9QA 2F0JA 2KA7A 5KEEA 4IPDA 1U0LA 2K5QA 2R6GA 1H95A 1UE7A 2IL8A 3H91A 3GTOB 1ZYRC 3Q23A 3S15B 4PNYA 4A3IH 3CC4A 1X3PA 1IBKL 3OSOA 2ZXRA 4GLAC 1KDAA 1SE2A 1EFWA 4B3SL 3QJYA 3I91A 1STBA 1EU3A 2KCNA 1QUQB 1HFGA 4DK6C 1N36L 3D0FA 4A3CH 3FPUB 4IUVA 4O0AA 1L1OC 3D4WA 3KLRA 3MZ5A 1CM9A 4C2MH 1TXYA 1YJWA 4LFAQ 2K5NA 3KK7A 2IY5B 4R1JA 1NE3A 2ENBA 5ELBA 1KLGD 1E1OA 4PV1C 4DNRB 5TSSA 3S2HB 5BR8Q 4J6HA 2OWOA 2XTIA 5CV4A 3CCVA 4EGVA 1PRTD 2KENA 5C4JH 3TP7A 3T16A 2PW7A 2JA6B 2B63G 2K7VA 1B3AA 3ZJYC 1AFPA 1MIUA 2JEBI 2F0QA 2R7DA 3G4SA 4KKSA 1I4GA 2LXJA 3MXNA 4IURA 1PH6A 2X6GA 2F0TA 4UP9A 1Q86C 3OW7A 2K5DA 3H15A 5IT9E 5GAEC 2R92G 2K04A 4K6LA 1HUMA 4L63B 1G8ZD 3H6MA 5IT9L 4AYBE 4C3IH 4AH6A 2EIFA 2LFNA 4OO1G 1HR0L 2B2UA 4RHSA 4JYAQ 4JCVE 1ICFB 2IHEA 1KDCA 2ICIA 4A3EG 4EX5A 4EQOA 3BVMA 3OWFA 4QB4A 1WCMB 2CKZB 3T51B 3TZUA 2HQLA 4I7AA 1EQQA 4GKKQ 1G2SA 3HKZB 4CBVA 1PYSB 2F0PA 3NELA 1Q8IA 2Z0SA 4A4IA 1EY5A 2D0PA 1W2BA 4MN3A 4JI8Q 1BKBA 3QOLA 4A75A 4JW0A 1PHJA 2XSCA 1NCVA 1R9TH 1HUNA 3EIVA 2X6LA 3LX0A 3LNNA 4LF7Q 1GUNA 3S1RH 1V9PA 3I4MB 4R4CA 4MHEA 2N49A 3SK8A 5M3FH 3OOCA 3BDOA 1NMGA 4TRDA 2RSNA 5JOBA 1ASZA 5FJ8H 3K8AA 4PQXA 1V8QA 3CU7A 4EQNA 3HOYH 2M00A 3GTPH 1RCVD 3E5SA 1S5ED 3BYYB 4LFCL 4LF9Q 4BA1I 4WJ3M 2L55A 1GHJA 1E1TA 5HGTA 2B2VA 4A3BH 1SLJA 1N34L 4OX9Q 2A74C 3P7JA 4DAYB 2UXDQ 1LT5D 5COYA 2Q8RE 3BZDB 1KC8C 4LJZC 3C2PA 3CCQA 5M5XH 3HOZH 4K0KL 4JC0A 1G291 1UE1A 3DEOA 1EWHA 2PMZE 5ELFA 4K6DA 4ALPA 1JCKB 1EY7A 1HNWQ 1VQEA 2WACA 4GN3B 3GQBA 4IFDJ 3PMFA 4OWTB 2F0NA 1VQCA 3GV6A 2KHJA 2NVTH 1I50H 1LLRD 2MUYA 4OXPA 1FVIA 2M2LA 4DV4L 1EYAA 3VA7A 2BDOA 3NTIA 4HIKA 4LMQD 3R2IA 1V43A 1X54A 2VW9A 2B39A 3PUWA 4B3ML 5IIFA 2EYLA 4KY5A 2PYKA 4Q0FA 3KUPA 5KNBA 1E2WA 1V1PA 1G2TA 1CK1A 4X3KA 2TSSA 3NTKA 1WTHA 1K83B 1MJEA 3CXCA 1M1KC 2B8FA 4XTCS 4JVZA 2PI2A 3ER0A 5IWAQ 2XRQD 4A3DB 4IN3A 4G7HC 1LTTD 4PG3A 2AQ3B 1WTWA 3HOVH 1CQFA 1VQNA 2SDFA 2AKWB 1KXLA 1U4RA 2Z4IA 1YHQA 4CHTB 3M9BA 4DA2A 1BQQT 2DNEA 3RZDH 1PA6A 5C4XB 3CCEA 4F88A 3P1HA 1VCIA 2EPBA 3E0JA 3CMEA 1GD7A 4RCNA 1B1ZA 3I90A 2VUMB 4P74A 3Q6SA 2NVXH 4HIDA 2A6HC 2A8VA 1O7YA 4BY7G 4LUZA 4L5RC 3S16B 3TEHB 3OPOA 4PMCA 3K57A 3DXJC 1E2ZA 2AHOB 4CKCA 1EFID 2K05A 3SK4A 2OCEA 1HZCA 2J7ZA 3CRLC 3K5MA 3HOWH 2H1EA 2DJGC 4ILWA 3N6RA 1XJVA 3G7LA 3GTLB 1GOZA 4DR5L 3GTGB 5IYDH 1AP0A 2E2JB 3UE0A 1C9OA 1B7YB 1F9SA 3K81C 2K28A 2Q2UA 1UE6A 4GS3A 4TSSA 2ZJPA 5BN4A 1CUKA 3R8BA 3H94A 2OQ0A 2B2TA 3CCRA 2NZ1D 3GTKH 4BXXG 3TREA 2NTTA 4JBJA 2GVBA 3FHWA 5IY0A 1MD2D 3M3YH 3UDIA 2JA6G 2FXQA 1FD7D 1B53A 1HZAA 1SNMA 4NXNQ 2NN6G 1S72A 2EYHA 4PZ7A 3VYUA 1B50A 2AQ2B 1RTOA 4ME5A 2VQEQ 1TWCB 2ASBA 3FMCA 3KJPA 1Y8OB 2E5LQ 4MIUA 4L5SA 1VQMA 2K32A 1SRUA 1F2ZA 2ZXPA 3MEHA 3K6OA 1IZ6A 1Q81C 2UUAL 2SOBA 3I70A 2V1CC 2LSSA 4CDDC 1N9WA 1CFMA 3CD6A 1KABA 1GUTA 1WCMG 5FO7B 5IGDA 4DK3C 4N8FA 4DUYQ 3JAMc 2CWPA 2IWHA 3A74A 1A3UA 3W1BA 3HKZG 2DUDA 3V05A 3TQYA 4DR3L 4A3MH 5IGEA 1PTOB 1NR4A 1PH4A 1ILPA 4RKBA 3F8TA 4ZCKA 3BZKA 2WAQG 5E3FA 2KBNA 5CV9A 5IE8A 5AJ3L 2FJ2A 4MNOA 4ZUIA 4AYBB 1TS3A 4ZLTF 3VYTA 2IX1A 3RLFA 2MO0A 3FKIG 1NNXA 3L7ZC 2VNUD 4DV1Q 3BU2A 1II3A 1R4PB 1TWGB 2ZJRA 4Q5VA 1SYFA 3G48A 2J0TD 3IKJA 4DV2Q 4RG1A 3KYHC 2EY1A 2GA4B 1IKLA 4DKAC 4OO1I 1V1PB 4NPSA 2EXZA 1Z7TA 1XX8A 3NSWA 1C0AA 2MQHA 5KNDA 3OWEB 3K5OA 4IOAA 2IX3A 1AZPA 4K8JA 4IFDG 5FK9C 3KBXA 1PRTB 2MJ8A 2XIWA 1D6EC 2MGSA 2VB2X 3KFUA 1NR2A 2OQKA 4L5QA 4LF5Q 1HZBA 1B9NA 4JV5L 3EBEA 3TMEA 4XIGS 4RHRA 3MXGA 3A8JE 4O42A 3N52A 1SE4A 3D4RA 1QZHA 2F0WA 3CCMA 3R3OA 4RA8A 4BBSH 4JI0L 4JI1L 2OT2A 4RAUC 3NUCA 5C0XI 1S5FD 3J81j 2IPKD 2RDFA 2LS01 4F87A 3PF4A 3GTQB 1LTBD 1A15A 1BCPD 3SEBA 2Q2IA 1PH7A 1VQLA 1B4OA 1WI5A 1MHWC 1X55A 2BOSA 2WB1G 2A69D 3PO2H 1WOCA 4JBMA 2RDGA 2PMZB 3QWNA 1AZQA 4EQPA 1HJPA 1GKHA 4APVA 1RL2A 3CQZB 2HUGA 2JA5H 5LL6X 4A3JH 5M5YB 1QVFA 1C48A 1QUQA 1NMFA 1F2LA 3OYYA 4A3DG 4BY7H 4QMGA 5EJWA 3F2BA 3HS0C 2JA7H 1JE5A 3VR2A 1BO0A 1HNXL 2A68C 4YHHL 5EPJA 1VQ4A 1CI3M 3U50C 5JVH3 3L3OC 1JB7A 4JI3L 5C4XG 1IBLL 4Y52H 1J6QA 1Z47A 4GOPB 1JORA 3NWTA 1BCPC 1E2VA 2ZJQA 4X64L 4JI6Q 2NVYH 3GV3A 4L6TB 3KF8B 1VQFA 2VUMG 4DV3L 1U4LA 3LWEA 1FJGL 1PMRA 5D3IB 1OXXK 1I3QB 2A69C 2F0IA 3D6CA 3PQIA 1SNOA 4CKBA 1GM5A 1T5EA 1ICWA 4BBRH 4HCSA 4H02A 1TWFH 3CCUA 1P8LA 4KHPQ 4X65L 2E2HH 4R9WA 5E7NA 2KCCA 1XPUA 2NB0A 5LL6S 2E8GA 1SMXA 1KD1C 3OHXC 4Y7NH 5E1FA 2F0DA 2O4XA 1DJRD 2HD3A 4KJOA 2UXBL 2NTSA 1EYDA 3QO2A 4BY1G 4JPBW 5IP7H 5LMNL 1UNSA 5C0XJ 1Y14B 1SFOH 2O5JC 1TWAH 2K75A 3ICEA 3J7AF 3S14B 4IOCA 5IP9G 1Q82C 4KN4C 5EBCA 1X3EA 4YY3Q 3RLOA 4FNFA 2E2IB 1D2BA 1EEFD 4DN4M 1A63A 4C1NK 1FGUA 1UWVA 3J80L 3STBD 1IYJB 1PH2A 2O2LD 3MEFA 2ZTEA 3HEJA 1HHVA 1BBWA 3HZXA 3S1QB 4ODGA 3PUYA 1MI2A 2JA8H 3KBGA 1SROA 1TT2A 3I4NH 3MTSA 4KN7C 2ZTDA 3AFPA 2K5WA 3T1HL 4C3HB 2F52A 3VR4A 1BCPF 5ELEA 1TR5A 4P2CB 2A19A 2BA0A 4OONA 2EXDA 2JA9A 3I73A 4NP5A 3CMAA 4R8NA 4DR6L 4HJAA 1D5MC 3T1YL 1WD1A 3FKIH 1K8OA 2WV6D 4A93H 3QOJA 2F3VA 1BUVT 4KKUA 1BR9A 4JOIA 3KLSX 5JJLA 4LUVA 4DAYA 1Q7YC 3HOXB 2R93B 2RHSB 2CQAA 1K0SA 1CA6A 4F7XA 3M4OB 5JPMC 4ZRZA 3L9AX 4DV0Q 4KY6A 5JEAJ 1MSGA 3M85A 1TWHH 3OTOQ 5K5PA 4AYBG 4JI7Q 2NN6I 3W2DA 3WOFA 1Y1VG 4FO2A 1EUJA 5DM63 3DEPA 3HFZB 3ULLA 4FYDA 4ZUJA 3EA6A 1SYGA 1IXRA 1S5BD 4A3GH 3E6ZX 2F3WA 4DV5L 3NP8A 4TQUS 1F9PA 3BVZA 4DV6L 1YNND 4JI5L 1IBML 3FRPB 3D3RA 5CORA 2BH2A 3A5UA 1H9JA 1XPOA 1KL9A 5DNFA 4A3KB 3WWVA 2Y0SE 1PH3A 1A62A 2QA4A 3K5LA 4K2KA 3I2ZA 1TS5A 4KHVA 3H3VI 1Q12A 2E74C 1VQKA 2SNSA 1K8MA 2XWBB 2KHSA 3R2TA 3SK5A 2R7ZG 4B3TQ 3TP8A 2DJFC 2Q8IB 2R7FA 3NE5B 3NQIA 5C5MA 3VR3A 5ISRA 2B2VC 1YITA 4OL7A 3PCOB 4GNXB 1PZKD 1I6HH 1YNNC 3K5NA 4JI4L 2R61A 4K2LA 2QEXA 4RH6A 1VQ8A 5JJKA 1K3RA 5BR8L 1GUOA 4TVAB 1EU4A 2E2DC 2ZXOA 2OTLA 4XT1B 3AB9A 4XT3B 2L15A 2PZUA 5LMUQ 1C7YA 4FVMA 3I72A 2K6AA 1HTPA 4RMFA 4AQYL 1TS4A 1I94L 4XQQA 2F0HA 1SDFA 2UUBL 5C44B 5M3MB 1LT3D 3CC2A 1HTLD 2ICEC 3E3XA 2N55A 2PQEA 3H0GG 4IFDI 4H7BA 3BVGA 3PUZA 3HOUH 3P20A 3A56A 4DUZQ 1N8RC 2K14A 4X62Q 3PIP3 3ND9A 4MZ9A 5EKIA 4DR7Q 1YJNA 3Q22A 3I4OA 4A3FH 4KHZA 4I65A 2NBFA 1VQGA 2XNAC 3MC0B 5K36H 5C3EH 2WKCA 4DK1A 1YIJA 4GKKL 5CC4A 1JJGA 4BY1H 3EQLC 1SJED 1I4QA 1XMQQ 1A8VA 1KNAA 2K01A 1XWEA 4KKTA 3ULJA 2F4IA 1ET6A 3T13A 3AMUA 2BH8A 3NK9A 5C0XG 1Y1WB 4LFBQ 2Q2HA 1T5XD 4JI8L 5M5WB 1X32A 1KLUD 4LF7L 3MVVA 2L12A 1Q3LA 1XNQQ 4BA2I 1AN8A 4FP5D 2FMCA 1PFBA 3GP7A 3A54A 4C3JB 2XRSD 3M4YA 3QG1A 4QF4A 1PYWD 3RZOB 1LO5D 1X56A 2WINB 3TZDA 4IPGA 4KV6A 4P72A 2B8GA 3OMCA 4B3RQ 4R4TA 4LF9L 3A7LA 4LF8L 2ATWA 4QUFA 1YI2A 1CA5A 4K5WA 1U5KA 3HG9A 1KQSA 2ZT9C 4OX9L 2JN4A 3G6EA 2Z8LA 2UXDL 3DWAA 1QWYA 4XYOA 2LMCB 1TIID 1CKNB 2K33A 3UDGA 2YU9H 1IYUA 1AW7A 3M4QA 3PO3B 1WJJA 1QG7A 1EY4A 2B2WA 2HHHL 1K28A 4C3HG 2Z4HA 2CW0C 2FINB 1HNWL 2B2TC 1CKOA 5H1SE 3CCLA 4R4QA 1X3GA 1XMOQ 2MO1A 2MFIA 1YBYA 3FP9A 3S1MH 4RWSC 2OF1A 5JEAG 1EOTA 3DM1A 4IPHA 1B8AA 2CVRA 3U9SA 1Y1VH 2DGYA 2A6HD 3E9HA 1BBXC 4A3IB 1NTGA 1GO3E 4EQ5A 4IJHA 3SE0A 2R93G 1OO9B 5CV7A 3IRBA 2L0CA 1VQ7A 5EPKA 1SNCA 5BN3A 4L8JA 4ZQ3A 1JC7A 2F0GA 2MP1A 5FOBB 5M9OA 3GTMH 4XQJA 3Q24A 1RODA 3J7A5 4C2MB 2UUCQ 3Q0AA 1XNRQ 1N33Q 2CWAA 1EEID 4F8MA 3AQQA 5IWAL 2A73B 1YNJD 1RTNA 4FXKC 2BE5D 4HCEA 4U68A 4C1NI 4QJFA 2QDBA 1KAAA 1D8LA 3NENA 1QE6A 1HR0W 5C4JB 5EQ0A 1O7IA 2JJQA 4DXGA 1HQMC 4N9PA 2ES2A 4HJ8A 1X65A 4WORA 2R7ZH 4ID6A 1DYQA 4LWCA 1W6KA 3VR5A 4B08A 1A0IA 3MA2B 2SNMA 3MXPA 4A3KG 1CQVA 3I56A 1QNKA 1PDQA 3QB3A 1IYVA 1S4ZA 1ESFA 1CT1D 3EN2A 3ERQA 1HPCA 5J22A 2B63H 5A2QE 1KRSA 1PFMA 1SJHD 2KUMA 3UDFA 3HKSA 4C3IB 4ZYSA 5I6WA 1YNJC 5IGFA 2BE5C 5A2QL 4DR5Q 1XPRA 1D5XC 5CV8A 2PCFB 2ALYB 3S1NH 2JE6I 1XXGA 2RDHA 2R92H 3RN5A 1EYCA 2VZAA 1HNZQ 4DNIA 4QCLA 4GOPA 1OXSC 2LXKA 3J80i 1E24A 1GHKA 1HA6A 3H0GH 4OO1H 1PLFA 3KF8A 4IUQA 5AFWA 3WDNA 1SMYD 4A3EH 2EYOA 2DNCA 3PV0A 5D3DA 1R9TB 1K3BC 1LTID 3S1RB 2EZVA 2NZOA 3VYSA 2JEAI 3J7AV 1JOKA 5CMDA 5M3FB 1PVOA 1FYCA 4NXMQ 1PFNA 2F0LA 5C44G 5M3MG 2VQEL 1VQIA 2EYMA 3HOYB 4UHVA 1F9RA 1KNEA 2EVBA 1RF2D 4RGTA 5IOCA 3D4DA 1J5EL 3GTPB 3TN2A 2ZM6Q 1N32L 2DN8A 1XTCD 2AWOA 3K7AH 3RR5A 3RUZA 3VYRA 1WTVA 1EOVA 2I46A 3CCJA 4U673 5CGKA 1NUCA 2D62A 3J80c 4A3BB 2IJ0A 4HMIA 3E0EA 2CQOA 1SMYC 5KIXA 2M9VA 1IL8A 2Z6KA 3ND8A 2LY7A 3TS0A 2JYOA 1LACA 5M5XB 1S5CD 3HOZB 4DUYL 5IYCG 1F2YA 2PZWA 4LF6Q 3MWYW 3D8GA 1G6ZA 1NSNS 3I4MG 1EZ6A 4UY8C 5FLMG 4QQBX 2L5TA 1Y1WG 3M7GA 5AJ3Q 1G6PA 3DMUA 2NVTB 1I50B 1O7LA 3E9IA 4XXEA 3QR8A 1FNWA 4C3JG 1WVLA 3IL8A 3O13A 1SYBA 1VQBA 2K4KA 4DV1L 2QGQA 5IGGA 1K8AC 3U9OA 1EIYB 1D5ZC 1CSPA 4K5XA 3GTJH 2L4NA 3AU7A 3F2UA 2BCOA 2PQAB 3FDTA 5CBAE 1UAPA 3LGJA 1X6OA 4AIMA 1DXMA 2G5DA 3W3AA 4OIJA 3H09A 2OEOA 2EYFA 2EJMA 2D9UA 4GKJQ 1EWIA 5IGCA 3HOVB 3PO3G 1R4QB 2WFWA 1H9SB 2L1BA 1A6XA 1O7ZA 2IX0A 2F4VQ 1XTDA 2A68D 3RZDB 2IHFA 5J39A 1LV9A 4QIWE 1YZ6A 2EY5A 4UAIA 3LWUA 2IW3A 2J4XA 4WFN3 1SXTA 2NVXB 4LF4Q 3H3VC 2B2YA 1FR3A 3SHLA 4LNQA 3S17H 1HRJA 3HP3A 4KLKA 1ZXTA 2F0UA 4IALA 2E75C 1EQRA 5KNCA 3PIPA 2KCMA 3HOWB 2NVQH 3S2DH 3F2CA 4H0LC 2F0SA 3I7FA 4DR2Q 4OEMB 1MBYA 1M90C 4ABNA 4A3CG 1YNXA 1V1QA 2PW5A 3IAYA 1E7ZA 3A8KE 2XWJB 3T53B 1Q46A 3GTOH 3RD4A 1SR3A 3S15H 5ELNA 5C3XA 3ULPA 1GUSA 5GAGC 1SYCA 4DV7Q 1JWUD 4X66Q 5ELOA 3NQTA 4HIOA 4A3LG 2YTXA 2WAQE 1IKMA 3GD7A 1EY8A 1A3VA 1STAA 3GTKB 3DLLA 4GLXA 1KDBA 4GNXA 3CKIB 3KOJA 4JOIC 1WTPA 5FO8B 2QCPX 2OTJA 1X9NA 3M3YB 1I4HA 2QDLA 1BXTA 1H9KA 4YWKA 2GVAA 4KY7A 4WRDA 1EY9A 1GVPA 4O2DA 4DPGA 1K73C 1FJGQ 3S2HH 3K59A 5JJZA 3RLNA 4DR4L 4PMBA 4BXXH 1J8IA 3NEMA 3VR6A 1Y8PB 2JSOA 3CP0A 5A35A 4KD3A 2VQFL 2JA6H 4I7ZC 2RKSA 1RDPD 2NN6H 3MFYA 1U9RA 2G9HD 1U4PA 4IUTA 1Q1EA 1S5DD 4QUCA 2RHQB 4DFAA 5HGQA 1DD2A 4OELB 4E6IA 2XN9C 1X3QA 3TSSA 3SGIA 2K5HA 3J80E 5LMNQ 3L2PA 3S9WA 2KECA 4R4IA 4A3MB 1YEZA 4JI2Q 4QL5A 4K8IA 3K0YA 3OW2A 4YWLA 3ONAB 4CGYB 1Q8KA 5GADC 1Y8NB 1QZGA 1K8GA 4LUOA 4YY3L 1WCMH 2UXCQ 5EPLA 1FL0A 3CPWA 1A2UA 1DOMA 1JE4A 4OIKA 2Q2TA 2UU9L 5F2DA 4IQZA 5C4ZA 2V4DA 2EYJA 5EAYA 3H3VH 1KHIA 1JR0D 5M3FG 4HJ7A 4K14A 3T56B 1JJ2A 2C35B 2LKVA 5FJ8G 1LABA 1I4XA 3HOYG 4HN7A 4OGQC 1L0WA 1DOKA 2WB1E 2KVMA 3J81L 1JICA 3OIQA 2QILA 1DM0B 1JB3A 1SNDA 2GN5A 2QF7A 3I4MH 5E4XA 1XYIA 1W3SA 1YHBA 2RA4A 4CJ1B 3PIO3 2AMCB 3BG3A 4A3BG 4DR6Q 3MXUA 1E22A 4DAVA 4KTAA 2C5CA 5JPNC 1JOQA 4MTKA 4UP7A 2EDGA 3DUZA 3HOZG 1WFQA
chains in the Genus database with same CATH topology
2Q2HA 1B7YB 4A3IG 4JI8L 3UDXA 1K9MC 4LF4L 3K81C 4R4OA 3M4PA 1QVGA 3VDYA 3B6YA 1AE2A 2Q2UA 4LF7L 1K0RA 1UE6A 4GS3A 4QY7A 1CKNA 4HIMA 1XNQQ 2ZJPA 4BA2I 1CUKA 2OQ0A 3CCRA 5IYBH 4DV0L 2VY3A 3G71A 1PH8A 1KIXA 3GTKH 4BXXG 3TREA 3HKZE 1OXTA 4JBJA 3OTOL 1X56A 4DR2L 1PFSA 2GVBA 3FHWA 5IY0A 4A3KH 4IPGA 2KCTA 4P72A 3UDIA 4JI7L 2JA6G 3M3YH 2D0OA 2FXQA 3PGZA 3K80C 4NB3A 1HZAA 4B3RQ 1MKHA 4R4TA 1HNXQ 2NN6G 4PZ6A 1VQDA 2JQOA 4PZ7A 4YHHQ 3KJOA 1S72A 4LF8L 4LF9L 2ZTCA 4YWMA 2ATWA 1YI2A 2VQEQ 2ASBA 1U5KA 4DR1Q 4JI3Q 4DV7L 1KQSA 3KJPA 1QVCA 3PSIA 4X66L 1IBLQ 3G6EA 4OX9L 3L0OA 2XGTA 2E5LQ 2UXDL 4L5SA 4DV6Q 1VQMA 4X64Q 1IBMQ 4A76A 1CKNB 1SRUA 3UDGA 2YU9H 4JI6L 3M4QA 4DV3Q 1WJJA 1IZ6A 1Q81C 2UUAL 1IBKQ 2YTVA 2V1CC 2LSSA 3F2DA 4B3SQ 2HHHL 1YJ9A 1N9WA 3CCSA 1KAWA 3CD6A 1N36Q 3HOVG 2B29A 1WCMG 1HNWL 1CKOA 4JBKA 5H1SE 3AFQA 1KRTA 4DK3C 4X65Q 3CCLA 4DUYQ 4R4QA 3JAMc 1X3GA 2CWPA 1XMOQ 1K83H 2MO1A 2MFIA 4DR4Q 1YBYA 3A74A 4ME3A 4KHPL 4X6AH 3W1BA 3HKZG 2DUDA 2N3SA 3FP9A 3TQYA 3ERSX 4DR3L 3S1MH 4A3MH 2VQFQ 3HOUG 4YCUA 2I5MX 5JEAG 4LFAL 4IPHA 1B8AA 4A3DH 5IT9c 1Y1VH 2DGYA 3KF6A 4IJLA 4B3TL 4FDBA 1PH4A 3E9HA 1RIPA 3CF5A 3F8TA 3BZKA 5LMNW 2UXBQ 1NTGA 2WAQG 2KBNA 5IE8A 5AJ3L 4MNOA 1GO3E 4EQ5A 1VS0A 4IJHA 4A3FG 2R93G 5C44H 5M3MH 3IRBA 3RNUA 2I5HA 4JI4Q 1CKMA 1VQ7A 5C4XH 3W5OA 4A3LH 2IX1A 5K36G 2Y0SG 3RLFA 2MO0A 5C3EG 3GTMH 3HOWG 3FKIG 5J3BA 1E3PA 3L7ZC 2VNUD 4DV1Q 3J7A5 3BU2A 2UUCQ 2VUMH 4IO9A 3GDEA 1XNRQ 2HIXA 2ZJRA 1N33Q 1SN8A 2CWAA 3AQQA 5IWAL 4AQYQ 4JI2L 1I94Q 5IYDG 5LMUL 3G48A 3S16H 4DV2Q 4RG1A 1PH5A 3KYHC 4QJFA 1I5FA 1D8LA 2AWNA 2IT1A 3NENA 1OTCA 2UUBQ 2UXCL 4GLVB 2UU9Q 4DKAC 1HR0W 1UEBA 1Q1BA 3RN2A 4OO1I 4NPSA 1O7IA 3KDFA 1HR0Q 5IYCH 1LYLA 2JJQA 3T1HQ 1AH9A 3CPFA 1C0AA 2MQHA 3GTLH 4JYAL 2ES2A 4HJ5A 2F3IA 1X65A 4HJ8A 1LM0A 2R7ZH 3GTGH 2CFMA 3M7NA 4IFDG 1B70B 4LWCA 5FLMH 1EYGA 4DUZL 2E2JH 3KFUA 1Y1WH 1A0IA 2OQKA 2VL6A 4L5QA 4X62L 4A3KG 2YV5A 5M5WH 3I56A 1HZBA 4LF5Q 1IL2A 2BA1A 4DR7L 4JV5L 3EBEA 1PYBA 3A0JA 4XIGS 3S24A 2VS1A 3T1YQ 3BZCA 3EN2A 2B63H 1KRSA 5IP9H 1QZHA 4C3JH 3NBHB 3UDFA 3CCMA 3HKSA 1VQPA 1X3FA 3TRZA 4BBSH 3JC66 4JI0L 4JI1L 3CW2C 3RZOH 1EIFA 1VQ9A 4DR5Q 1XMQL 1JMCA 5C0XI 2K50A 1XPRA 3J81j 5HY6A 2ALYB 3PF4A 1S3OA 3S1NH 2JE6I 2R92H 3STBC 3RN5A 4LFBL 2H5XA 2VZAA 1HNZQ 1VQLA 2Q2IA 1PH7A 3AEVA 4DNIA 1TWCH 4GOPA 1OXSC 2I0QA 4K0KL 1WI5A 2LXKA 3J80i 1VQ5A 1E24A 1LUZA 1VQHA 2PI2E 1X55A 4GN4B 4YCVA 3AYHB 2WB1G 3H0GH 1XNQL 3PO2H 1WOCA 3U4ZA 4JBMA 4A3EH 3CC7A 4LFCQ 1OXUA 4KI0A 1HJPA 1GKHA 1L1OA 4P73A 3PV0A 4APVA 1RL2A 1VQOA 4LW1A 3PO3H 2JA5H 4PZ8A 4A3JH 1QVFA 4A3MG 1QUQA 1HZ9A 1NMFA 3OYYA 1N34Q 4J15A 4A3DG 4BY7H 2NZOA 4DV5Q 2JEAI 3F2BA 1P16A 1JE5A 2JA7H 1PVOA 4LF8Q 4B3RL 1HNXL 4YHHL 1VQ4A 4JI5Q 3U58A 3U50C 4NXMQ 4K0KQ 5C44G 5M3MG 2VQEL 1VQIA 1YVCA 2MNAA 4DR1L 1JB7A 4JI3L 4OWWB 5C4XG 1IBLL 4Y52H 1VQJA 1J5EL 1J6QA 1Z47A 3BJUA 4IPDA 4GOPB 2ZM6Q 1N32L 1U0LA 3K7AH 2AWOA 3RR5A 4X64L 2ZJQA 4L5TA 4JI6Q 1EOVA 2NVYH 1G51A 1UE7A 2R6GA 3PUVA 3CCJA 1H95A 3KF8B 1VQFA 2VUMG 4DV3L 1PV4A 1BVSA 1LTLA 4A3IH 2ID0A 2D62A 3J80c 3CC4A 1FJGL 1IBKL 1OXXK 2HHHQ 4GLAC 4GOPC 4B3SL 1BBUA 1L2FA 4P71A 1EFWA 3E0EA 2CQOA 1GM5A 2Z6KA 1QUQB 4BBRH 4DK6C 1N36L 3TS0A 3D0FA 4A3CH 3TS2A 4DV4Q 4H02A 1TWFH 4O0AA 4UPAA 1L1OC 1P8LA 5GAHC 3CCUA 4X65L 4KHPQ 2E2HH 4C2MH 4DUYL 1XMOL 5IYCG 2N78A 5E7NA 1TXYA 4LF6Q 4B3MQ 1XPUA 3HOXG 1YJWA 4NXNQ 1TWGH 4LFAQ 2K5NA 2E8GA 1SMXA 2IY5B 2PQAA 4R1JA 1KD1C 2RCNA 1NE3A 4UP8A 2RF4A 3I4MG 4Y7NH 4UY8C 5FLMG 4QQBX 1E1OA 1Y1WG 5BR8Q 5AJ3Q 2OWOA 2XTIA 3DM3A 4JBWA 3D31A 2UXBL 1G6PA 3CCVA 2KENA 2B3GA 4BY1G 5IP7H 5C4JH 3F1ZA 5C0XJ 5LMNL 1Y14B 1SFOH 3K7UC 1TWAH 2K75A 3E9IA 5GQOA 2YTYA 3ICEA 4HJ9A 2B63G 3ZJYC 4IOCA 1MIUA 5IP9G 1NY4A 1Q82C 2JEBI 3UE1A 2R7DA 1X3EA 4YY3Q 3RLOA 1VQBA 3G4SA 2K4KA 4DV1L 2QGQA 2LXJA 4BBSG 1K8AC 1PH6A 1A63A 2UUCL 3KF6B 1EIYB 1SE8A 2NZHA 1XNRL 1CSPA 1N33L 1FGUA 1UWVA 4UP9A 1Q86C 3STBD 3W1GA 1IYJB 1PH2A 2Z6KC 3GTJH 3MEFA 2ZTEA 3H15A 5GAEC 1BBWA 2R92G 2PQAB 3PUYA 1DGSA 5IYBG 2JA8H 1OXVA 1SROA 3LGJA 1X6OA 3I4NH 3PUXA 4AIMA 4AYBE 4C3IH 2ZTDA 4AH6A 2EIFA 3AFPA 4OO1G 1HR0L 4GKJQ 3PO2G 1EWIA 3T1HL 4JCVE 4JYAQ 2IHEA 4A3EG 2N8NA 2WP8J 4EX5A 3PO3G 2F52A 1Z9FA 3GTQH 2CKZB 2JA5G 1UE5A 2WFWA 4A3JG 2HQLA 2IX0A 1EQQA 2F4VQ 4GKKQ 2A19A 2BA0A 4OONA 1XTDA 2EXDA 2JA9A 3MXNB 2HIVA 3CMAA 2IHFA 4DR6L 2JA7G 1VQ6A 1JT8A 1PYSB 4HJAA 4QIWE 3KDFB 1YZ6A 3T1YL 3NELA 3FKIH 3PF5A 2Z0SA 4A4IA 4A93H 2D0PA 1W2BA 4JI8Q 3CQZH 1BKBA 4A75A 4LF4Q 4JOIA 1PHJA 5JJLA 4LUVA 1Q7YC 5M5YH 2A1AA 1R9TH 3EIVA 4LNQA 3S17H 4LF7Q 2RHSB 3S1RH 4KLKA 1V9PA 4R4CA 1HH2P 1YHAA 2N49A 3CAMA 5M3FH 3J7ZC 3S2DH 1EQRA 3PIPA 2KCMA 1NMGA 4DV0Q 5DLQE 5JEAJ 1CSQA 3F2CA 5FJ8H 1ASZA 3K8AA 2NVQH 3M85A 1TWHH 1HNZL 1ASYA 3I7FA 3OTOQ 4DR2Q 3HOYH 4AYBG 4BBRG 1VQAA 4JI7Q 1M90C 3GTPH 4A3CG 2NN6I 1YNXA 3PIOA 1V1QA 1PH9A 1E7ZA 1EUJA 1Y1VG 3U4VA 3HFZB 4LFCL 2I5LX 4BA1I 4LF9Q 4POGA 1Q46A 3GTOH 4NXNL 3ULLA 4WJ3M 1E1TA 1SR3A 3S15H 4PMWA 5ELNA 3J81i 3JAMi 3ULPA 5GAGC 2YYZA 4A3BH 1IXRA 1I3QH 4P75A 4DV7Q 4A3GH 1SLJA 4X66Q 1N34L 4QGUA 4OX9Q 5ELOA 4DAYB 4DV5L 2UXDQ 1AE3A 4HIOA 4A3LG 4TQUS 2YTXA 1KC8C 2E5LL 2WAQE 4DV6L 3GD7A 3K0XA 4JI5L 3CCQA 1IBML 5M5XH 2BH2A 3DLLA 2JK8A 4GLXA 4POFA 4NXML 3A5UA 4JC0A 1G291 1UE1A 5IP7G 4GNXA 2UUAQ 3KOJA 4JOIC 1XPOA 1KL9A 1J5EQ 1X9NA 2OTJA 1L1OB 4MTNA 4IPCA 1WYDA 2Y0SE 3WWVA 1PH3A 1A62A 2PMZE 1N32Q 2QA4A 2ZM6L 4ALPA 4YWKA 2GVAA 3I2ZA 4GN5A 1GVPA 1HNWQ 4O2DA 4DPGA 1K73C 1VQEA 4GN3B 1FJGQ 3S2HH 3H3VI 1NJIC 1Q12A 5JJIA 1VQKA 4IFDJ 2PNHA 4OWTB 3RLNA 4DR4L 4BXXH 3NEMA 1VQCA 4DR3Q 2KHJA 2NVTH 3CP0A 1I50H 1D7QA 4OXPA 2VQFL 2JA6H 2JA8G 1FVIA 3S14H 2R7ZG 4B3TQ 4DV4L 3I4NG 3J81c 2R7FA 4HIKA 2E2IH 4OWXB 1V43A 1X54A 1YITA 2VW9A 5C0XG 3PCOB 3PUWA 4LF6L 4GNXB 4B3ML 1Q1EA 4WJ4A 1I6HH 2RHQB 5HGQA 4JI4L 3HOZH 2KHIA 4JG2A 2QEXA 3S1QH 1VQ8A 5JJKA 1K3RA 5BR8L 4TVAB 3SGIA 4GNXC 2K5HA 2OTLA 5LMNQ 1MJEA 3L2PA 3GO5A 3CXCA 1M1KC 1T9HA 4XTCS 4R4IA 2L15A 1YEZA 4JI2Q 2PI2A 3ER0A 4QL5A 5IWAQ 5LMUQ 5GROA 1C7YA 4C3HH 3OW2A 4PG3A 4YWLA 4AQYL 4RMFA 1I94L 1NBWA 1Q8KA 4A93G 5GADC 4DV2L 3HOVH 1QZGA 1K8GA 4LUOA 4YY3L 1VQNA 1WCMH 2AKWB 3Q8DA 2UXCQ 1KXLA 1FL0A 3CPWA 2UUBL 1YHQA 2UU9L 2Q2TA 1JJCB 3M9BA 4IOAA 3CC2A 5EAYA 3RZDH 1PA6A 3H3VH 3CCEA 1KHIA 3H0GG 2K52A 5M3FG 4HJ7A 1JJ2A 4IFDI 4DAMA 3PUZA 1VCIA 3HOUH 2C35B 1PH1A 5FJ8G 3CMEA 1GD7A 4DUZQ 1N8RC 3HOYG 4P74A 2NVXH 2K14A 4X62Q 1L0WA 2WB1E 4YCWA 4HIDA 4MZ9A 2A8VA 3HOXH 4DR7Q 2CCZA 5FLXc 1YJNA 3I4OA 4LUZA 4L5RC 4A3FH 4LF5L 4KHZA 4BY7G 4JV5Q 4GKJL 2R93H 3TEHB 3I55A 2GN5A 1VQGA 1MJCA 3I4MH 1S40A 2AHOB 1W3SA 1YHBA 3M4OH 2OCEA 5C3EH 1HZCA 2EQSA 3HOWH 2AMCB 4A3BG 3KLWA 4GKKL 2K5VA 1YIJA 2F4VL 4A3GG 4DR6Q 4JI0Q 4JI1Q 4BY1H 1JJGA 1E22A 3A5ZB 1XJVA 2HT1A 1XMQQ 1A8VA 4UP7A 3ULJA 4DR5L 5IYDH 2BH8A 3HOZG 3UE0A 1C9OA 1WFQA 4LFBQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2H A;  1B7Y B;  4A3I G;  4JI8 L;  3UDX A;  1K9M C;  4LF4 L;  3K81 C;  4R4O A;  3M4P A;  1QVG A;  3VDY A;  3B6Y A;  1AE2 A;  2Q2U A;  4LF7 L;  1K0R A;  1UE6 A;  4GS3 A;  4QY7 A;  1CKN A;  4HIM A;  1XNQ Q;  2ZJP A;  4BA2 I;  1CUK A;  2OQ0 A;  3CCR A;  5IYB H;  4DV0 L;  2VY3 A;  3G71 A;  1PH8 A;  1KIX A;  3GTK H;  4BXX G;  3TRE A;  3HKZ E;  1OXT A;  4JBJ A;  3OTO L;  1X56 A;  4DR2 L;  1PFS A;  2GVB A;  3FHW A;  5IY0 A;  4A3K H;  4IPG A;  2KCT A;  4P72 A;  3UDI A;  4JI7 L;  2JA6 G;  3M3Y H;  2D0O A;  2FXQ A;  3PGZ A;  3K80 C;  4NB3 A;  1HZA A;  4B3R Q;  1MKH A;  4R4T A;  1HNX Q;  2NN6 G;  4PZ6 A;  1VQD A;  2JQO A;  4PZ7 A;  4YHH Q;  3KJO A;  1S72 A;  4LF8 L;  4LF9 L;  2ZTC A;  4YWM A;  2ATW A;  1YI2 A;  2VQE Q;  2ASB A;  1U5K A;  4DR1 Q;  4JI3 Q;  4DV7 L;  1KQS A;  3KJP A;  1QVC A;  3PSI A;  4X66 L;  1IBL Q;  3G6E A;  4OX9 L;  3L0O A;  2XGT A;  2E5L Q;  2UXD L;  4L5S A;  4DV6 Q;  1VQM A;  4X64 Q;  1IBM Q;  4A76 A;  1CKN B;  1SRU A;  3UDG A;  2YU9 H;  4JI6 L;  3M4Q A;  4DV3 Q;  1WJJ A;  1IZ6 A;  1Q81 C;  2UUA L;  1IBK Q;  2YTV A;  2V1C C;  2LSS A;  3F2D A;  4B3S Q;  2HHH L;  1YJ9 A;  1N9W A;  3CCS A;  1KAW A;  3CD6 A;  1N36 Q;  3HOV G;  2B29 A;  1WCM G;  1HNW L;  1CKO A;  4JBK A;  5H1S E;  3AFQ A;  1KRT A;  4DK3 C;  4X65 Q;  3CCL A;  4DUY Q;  4R4Q A;  3JAM c;  1X3G A;  2CWP A;  1XMO Q;  1K83 H;  2MO1 A;  2MFI A;  4DR4 Q;  1YBY A;  3A74 A;  4ME3 A;  4KHP L;  4X6A H;  3W1B A;  3HKZ G;  2DUD A;  2N3S A;  3FP9 A;  3TQY A;  3ERS X;  4DR3 L;  3S1M H;  4A3M H;  2VQF Q;  3HOU G;  4YCU A;  2I5M X;  5JEA G;  4LFA L;  4IPH A;  1B8A A;  4A3D H;  5IT9 c;  1Y1V H;  2DGY A;  3KF6 A;  4IJL A;  4B3T L;  4FDB A;  1PH4 A;  3E9H A;  1RIP A;  3CF5 A;  3F8T A;  3BZK A;  5LMN W;  2UXB Q;  1NTG A;  2WAQ G;  2KBN A;  5IE8 A;  5AJ3 L;  4MNO A;  1GO3 E;  4EQ5 A;  1VS0 A;  4IJH A;  4A3F G;  2R93 G;  5C44 H;  5M3M H;  3IRB A;  3RNU A;  2I5H A;  4JI4 Q;  1CKM A;  1VQ7 A;  5C4X H;  3W5O A;  4A3L H;  2IX1 A;  5K36 G;  2Y0S G;  3RLF A;  2MO0 A;  5C3E G;  3GTM H;  3HOW G;  3FKI G;  5J3B A;  1E3P A;  3L7Z C;  2VNU D;  4DV1 Q;  3J7A 5;  3BU2 A;  2UUC Q;  2VUM H;  4IO9 A;  3GDE A;  1XNR Q;  2HIX A;  2ZJR A;  1N33 Q;  1SN8 A;  2CWA A;  3AQQ A;  5IWA L;  4AQY Q;  4JI2 L;  1I94 Q;  5IYD G;  5LMU L;  3G48 A;  3S16 H;  4DV2 Q;  4RG1 A;  1PH5 A;  3KYH C;  4QJF A;  1I5F A;  1D8L A;  2AWN A;  2IT1 A;  3NEN A;  1OTC A;  2UUB Q;  2UXC L;  4GLV B;  2UU9 Q;  4DKA C;  1HR0 W;  1UEB A;  1Q1B A;  3RN2 A;  4OO1 I;  4NPS A;  1O7I A;  3KDF A;  1HR0 Q;  5IYC H;  1LYL A;  2JJQ A;  3T1H Q;  1AH9 A;  3CPF A;  1C0A A;  2MQH A;  3GTL H;  4JYA L;  2ES2 A;  4HJ5 A;  2F3I A;  1X65 A;  4HJ8 A;  1LM0 A;  2R7Z H;  3GTG H;  2CFM A;  3M7N A;  4IFD G;  1B70 B;  4LWC A;  5FLM H;  1EYG A;  4DUZ L;  2E2J H;  3KFU A;  1Y1W H;  1A0I A;  2OQK A;  2VL6 A;  4L5Q A;  4X62 L;  4A3K G;  2YV5 A;  5M5W H;  3I56 A;  1HZB A;  4LF5 Q;  1IL2 A;  2BA1 A;  4DR7 L;  4JV5 L;  3EBE A;  1PYB A;  3A0J A;  4XIG S;  3S24 A;  2VS1 A;  3T1Y Q;  3BZC A;  3EN2 A;  2B63 H;  1KRS A;  5IP9 H;  1QZH A;  4C3J H;  3NBH B;  3UDF A;  3CCM A;  3HKS A;  1VQP A;  1X3F A;  3TRZ A;  4BBS H;  3JC6 6;  4JI0 L;  4JI1 L;  3CW2 C;  3RZO H;  1EIF A;  1VQ9 A;  4DR5 Q;  1XMQ L;  1JMC A;  5C0X I;  2K50 A;  1XPR A;  3J81 j;  5HY6 A;  2ALY B;  3PF4 A;  1S3O A;  3S1N H;  2JE6 I;  2R92 H;  3STB C;  3RN5 A;  4LFB L;  2H5X A;  2VZA A;  1HNZ Q;  1VQL A;  2Q2I A;  1PH7 A;  3AEV A;  4DNI A;  1TWC H;  4GOP A;  1OXS C;  2I0Q A;  4K0K L;  1WI5 A;  2LXK A;  3J80 i;  1VQ5 A;  1E24 A;  1LUZ A;  1VQH A;  2PI2 E;  1X55 A;  4GN4 B;  4YCV A;  3AYH B;  2WB1 G;  3H0G H;  1XNQ L;  3PO2 H;  1WOC A;  3U4Z A;  4JBM A;  4A3E H;  3CC7 A;  4LFC Q;  1OXU A;  4KI0 A;  1HJP A;  1GKH A;  1L1O A;  4P73 A;  3PV0 A;  4APV A;  1RL2 A;  1VQO A;  4LW1 A;  3PO3 H;  2JA5 H;  4PZ8 A;  4A3J H;  1QVF A;  4A3M G;  1QUQ A;  1HZ9 A;  1NMF A;  3OYY A;  1N34 Q;  4J15 A;  4A3D G;  4BY7 H;  2NZO A;  4DV5 Q;  2JEA I;  3F2B A;  1P16 A;  1JE5 A;  2JA7 H;  1PVO A;  4LF8 Q;  4B3R L;  1HNX L;  4YHH L;  1VQ4 A;  4JI5 Q;  3U58 A;  3U50 C;  4NXM Q;  4K0K Q;  5C44 G;  5M3M G;  2VQE L;  1VQI A;  1YVC A;  2MNA A;  4DR1 L;  1JB7 A;  4JI3 L;  4OWW B;  5C4X G;  1IBL L;  4Y52 H;  1VQJ A;  1J5E L;  1J6Q A;  1Z47 A;  3BJU A;  4IPD A;  4GOP B;  2ZM6 Q;  1N32 L;  1U0L A;  3K7A H;  2AWO A;  3RR5 A;  4X64 L;  2ZJQ A;  4L5T A;  4JI6 Q;  1EOV A;  2NVY H;  1G51 A;  1UE7 A;  2R6G A;  3PUV A;  3CCJ A;  1H95 A;  3KF8 B;  1VQF A;  2VUM G;  4DV3 L;  1PV4 A;  1BVS A;  1LTL A;  4A3I H;  2ID0 A;  2D62 A;  3J80 c;  3CC4 A;  1FJG L;  1IBK L;  1OXX K;  2HHH Q;  4GLA C;  4GOP C;  4B3S L;  1BBU A;  1L2F A;  4P71 A;  1EFW A;  3E0E A;  2CQO A;  1GM5 A;  2Z6K A;  1QUQ B;  4BBR H;  4DK6 C;  1N36 L;  3TS0 A;  3D0F A;  4A3C H;  3TS2 A;  4DV4 Q;  4H02 A;  1TWF H;  4O0A A;  4UPA A;  1L1O C;  1P8L A;  5GAH C;  3CCU A;  4X65 L;  4KHP Q;  2E2H H;  4C2M H;  4DUY L;  1XMO L;  5IYC G;  2N78 A;  5E7N A;  1TXY A;  4LF6 Q;  4B3M Q;  1XPU A;  3HOX G;  1YJW A;  4NXN Q;  1TWG H;  4LFA Q;  2K5N A;  2E8G A;  1SMX A;  2IY5 B;  2PQA A;  4R1J A;  1KD1 C;  2RCN A;  1NE3 A;  4UP8 A;  2RF4 A;  3I4M G;  4Y7N H;  4UY8 C;  5FLM G;  4QQB X;  1E1O A;  1Y1W G;  5BR8 Q;  5AJ3 Q;  2OWO A;  2XTI A;  3DM3 A;  4JBW A;  3D31 A;  2UXB L;  1G6P A;  3CCV A;  2KEN A;  2B3G A;  4BY1 G;  5IP7 H;  5C4J H;  3F1Z A;  5C0X J;  5LMN L;  1Y14 B;  1SFO H;  3K7U C;  1TWA H;  2K75 A;  3E9I A;  5GQO A;  2YTY A;  3ICE A;  4HJ9 A;  2B63 G;  3ZJY C;  4IOC A;  1MIU A;  5IP9 G;  1NY4 A;  1Q82 C;  2JEB I;  3UE1 A;  2R7D A;  1X3E A;  4YY3 Q;  3RLO A;  1VQB A;  3G4S A;  2K4K A;  4DV1 L;  2QGQ A;  2LXJ A;  4BBS G;  1K8A C;  1PH6 A;  1A63 A;  2UUC L;  3KF6 B;  1EIY B;  1SE8 A;  2NZH A;  1XNR L;  1CSP A;  1N33 L;  1FGU A;  1UWV A;  4UP9 A;  1Q86 C;  3STB D;  3W1G A;  1IYJ B;  1PH2 A;  2Z6K C;  3GTJ H;  3MEF A;  2ZTE A;  3H15 A;  5GAE C;  1BBW A;  2R92 G;  2PQA B;  3PUY A;  1DGS A;  5IYB G;  2JA8 H;  1OXV A;  1SRO A;  3LGJ A;  1X6O A;  3I4N H;  3PUX A;  4AIM A;  4AYB E;  4C3I H;  2ZTD A;  4AH6 A;  2EIF A;  3AFP A;  4OO1 G;  1HR0 L;  4GKJ Q;  3PO2 G;  1EWI A;  3T1H L;  4JCV E;  4JYA Q;  2IHE A;  4A3E G;  2N8N A;  2WP8 J;  4EX5 A;  3PO3 G;  2F52 A;  1Z9F A;  3GTQ H;  2CKZ B;  2JA5 G;  1UE5 A;  2WFW A;  4A3J G;  2HQL A;  2IX0 A;  1EQQ A;  2F4V Q;  4GKK Q;  2A19 A;  2BA0 A;  4OON A;  1XTD A;  2EXD A;  2JA9 A;  3MXN B;  2HIV A;  3CMA A;  2IHF A;  4DR6 L;  2JA7 G;  1VQ6 A;  1JT8 A;  1PYS B;  4HJA A;  4QIW E;  3KDF B;  1YZ6 A;  3T1Y L;  3NEL A;  3FKI H;  3PF5 A;  2Z0S A;  4A4I A;  4A93 H;  2D0P A;  1W2B A;  4JI8 Q;  3CQZ H;  1BKB A;  4A75 A;  4LF4 Q;  4JOI A;  1PHJ A;  5JJL A;  4LUV A;  1Q7Y C;  5M5Y H;  2A1A A;  1R9T H;  3EIV A;  4LNQ A;  3S17 H;  4LF7 Q;  2RHS B;  3S1R H;  4KLK A;  1V9P A;  4R4C A;  1HH2 P;  1YHA A;  2N49 A;  3CAM A;  5M3F H;  3J7Z C;  3S2D H;  1EQR A;  3PIP A;  2KCM A;  1NMG A;  4DV0 Q;  5DLQ E;  5JEA J;  1CSQ A;  3F2C A;  5FJ8 H;  1ASZ A;  3K8A A;  2NVQ H;  3M85 A;  1TWH H;  1HNZ L;  1ASY A;  3I7F A;  3OTO Q;  4DR2 Q;  3HOY H;  4AYB G;  4BBR G;  1VQA A;  4JI7 Q;  1M90 C;  3GTP H;  4A3C G;  2NN6 I;  1YNX A;  3PIO A;  1V1Q A;  1PH9 A;  1E7Z A;  1EUJ A;  1Y1V G;  3U4V A;  3HFZ B;  4LFC L;  2I5L X;  4BA1 I;  4LF9 Q;  4POG A;  1Q46 A;  3GTO H;  4NXN L;  3ULL A;  4WJ3 M;  1E1T A;  1SR3 A;  3S15 H;  4PMW A;  5ELN A;  3J81 i;  3JAM i;  3ULP A;  5GAG C;  2YYZ A;  4A3B H;  1IXR A;  1I3Q H;  4P75 A;  4DV7 Q;  4A3G H;  1SLJ A;  4X66 Q;  1N34 L;  4QGU A;  4OX9 Q;  5ELO A;  4DAY B;  4DV5 L;  2UXD Q;  1AE3 A;  4HIO A;  4A3L G;  4TQU S;  2YTX A;  1KC8 C;  2E5L L;  2WAQ E;  4DV6 L;  3GD7 A;  3K0X A;  4JI5 L;  3CCQ A;  1IBM L;  5M5X H;  2BH2 A;  3DLL A;  2JK8 A;  4GLX A;  4POF A;  4NXM L;  3A5U A;  4JC0 A;  1G29 1;  1UE1 A;  5IP7 G;  4GNX A;  2UUA Q;  3KOJ A;  4JOI C;  1XPO A;  1KL9 A;  1J5E Q;  1X9N A;  2OTJ A;  1L1O B;  4MTN A;  4IPC A;  1WYD A;  2Y0S E;  3WWV A;  1PH3 A;  1A62 A;  2PMZ E;  1N32 Q;  2QA4 A;  2ZM6 L;  4ALP A;  4YWK A;  2GVA A;  3I2Z A;  4GN5 A;  1GVP A;  1HNW Q;  4O2D A;  4DPG A;  1K73 C;  1VQE A;  4GN3 B;  1FJG Q;  3S2H H;  3H3V I;  1NJI C;  1Q12 A;  5JJI A;  1VQK A;  4IFD J;  2PNH A;  4OWT B;  3RLN A;  4DR4 L;  4BXX H;  3NEM A;  1VQC A;  4DR3 Q;  2KHJ A;  2NVT H;  3CP0 A;  1I50 H;  1D7Q A;  4OXP A;  2VQF L;  2JA6 H;  2JA8 G;  1FVI A;  3S14 H;  2R7Z G;  4B3T Q;  4DV4 L;  3I4N G;  3J81 c;  2R7F A;  4HIK A;  2E2I H;  4OWX B;  1V43 A;  1X54 A;  1YIT A;  2VW9 A;  5C0X G;  3PCO B;  3PUW A;  4LF6 L;  4GNX B;  4B3M L;  1Q1E A;  4WJ4 A;  1I6H H;  2RHQ B;  5HGQ A;  4JI4 L;  3HOZ H;  2KHI A;  4JG2 A;  2QEX A;  3S1Q H;  1VQ8 A;  5JJK A;  1K3R A;  5BR8 L;  4TVA B;  3SGI A;  4GNX C;  2K5H A;  2OTL A;  5LMN Q;  1MJE A;  3L2P A;  3GO5 A;  3CXC A;  1M1K C;  1T9H A;  4XTC S;  4R4I A;  2L15 A;  1YEZ A;  4JI2 Q;  2PI2 A;  3ER0 A;  4QL5 A;  5IWA Q;  5LMU Q;  5GRO A;  1C7Y A;  4C3H H;  3OW2 A;  4PG3 A;  4YWL A;  4AQY L;  4RMF A;  1I94 L;  1NBW A;  1Q8K A;  4A93 G;  5GAD C;  4DV2 L;  3HOV H;  1QZG A;  1K8G A;  4LUO A;  4YY3 L;  1VQN A;  1WCM H;  2AKW B;  3Q8D A;  2UXC Q;  1KXL A;  1FL0 A;  3CPW A;  2UUB L;  1YHQ A;  2UU9 L;  2Q2T A;  1JJC B;  3M9B A;  4IOA A;  3CC2 A;  5EAY A;  3RZD H;  1PA6 A;  3H3V H;  3CCE A;  1KHI A;  3H0G G;  2K52 A;  5M3F G;  4HJ7 A;  1JJ2 A;  4IFD I;  4DAM A;  3PUZ A;  1VCI A;  3HOU H;  2C35 B;  1PH1 A;  5FJ8 G;  3CME A;  1GD7 A;  4DUZ Q;  1N8R C;  3HOY G;  4P74 A;  2NVX H;  2K14 A;  4X62 Q;  1L0W A;  2WB1 E;  4YCW A;  4HID A;  4MZ9 A;  2A8V A;  3HOX H;  4DR7 Q;  2CCZ A;  5FLX c;  1YJN A;  3I4O A;  4LUZ A;  4L5R C;  4A3F H;  4LF5 L;  4KHZ A;  4BY7 G;  4JV5 Q;  4GKJ L;  2R93 H;  3TEH B;  3I55 A;  2GN5 A;  1VQG A;  1MJC A;  3I4M H;  1S40 A;  2AHO B;  1W3S A;  1YHB A;  3M4O H;  2OCE A;  5C3E H;  1HZC A;  2EQS A;  3HOW H;  2AMC B;  4A3B G;  3KLW A;  4GKK L;  2K5V A;  1YIJ A;  2F4V L;  4A3G G;  4DR6 Q;  4JI0 Q;  4JI1 Q;  4BY1 H;  1JJG A;  1E22 A;  3A5Z B;  1XJV A;  2HT1 A;  1XMQ Q;  1A8V A;  4UP7 A;  3ULJ A;  4DR5 L;  5IYD H;  2BH8 A;  3HOZ G;  3UE0 A;  1C9O A;  1WFQ A;  4LFB Q; 
#chains in the Genus database with same CATH topology
 1SBB B;  1UUP A;  2QEJ C;  4R4O A;  3CRK C;  3M4P A;  3VDY A;  3MFG A;  1AE2 A;  1K0R A;  4QY7 A;  1RKN A;  1CKN A;  1EY0 A;  1L0X B;  2B2U C;  3TDQ A;  4HIM A;  5KYL A;  3MAQ A;  2D5D A;  4DV0 L;  2VY3 A;  4IFD H;  3NWS A;  1C8C A;  4BBS B;  5FLX E;  3OTO L;  1PFS A;  5CV5 A;  2KCT A;  4JI7 L;  3X3N A;  2FHT A;  3K80 C;  4NB3 A;  1MKH A;  5FLX L;  1VQD A;  2JQO A;  3KJO A;  2ZTC A;  4YWM A;  5ELD A;  4DR1 Q;  2TMP A;  1QVC A;  3FEW X;  3EJI A;  3PO2 B;  4TKO B;  4DV6 Q;  1IBM Q;  4A76 A;  1PTO D;  2RCF A;  5EGT A;  2JP1 A;  2JA5 B;  2VB3 X;  4NDX A;  4A3J B;  1IBK Q;  4B3S Q;  1H9R A;  1H9M A;  2KEE A;  4BY7 B;  1YJ9 A;  3V2T A;  1HXY D;  1STY A;  2JA7 B;  1N36 Q;  3HOV G;  4V0B A;  4XDX A;  2B29 A;  2RBM A;  1WTO A;  4FF3 A;  5HUR A;  4JBK A;  1KRT A;  1LTR D;  1ONL A;  1K83 H;  3SXH A;  4ME3 A;  3DWP A;  2N3S A;  2A6E D;  3EFX D;  1TQO A;  4YCU A;  2I5M X;  1UEA B;  4LFA L;  4A3D H;  2F0K A;  2NVY B;  3KF6 A;  1PZJ D;  4IJL A;  4B3T L;  5L37 A;  1RIP A;  3CF5 A;  2F0O A;  5LMN W;  1VS0 A;  3FPP A;  2I5H A;  1PTO C;  4JI4 Q;  4BBR B;  5C4X H;  2F03 A;  4A3L H;  2EJF C;  3URY A;  1TWF B;  3HOW G;  5C4H A;  2E2H B;  3ITP A;  5I4D A;  2VUM H;  2PPB C;  3GDE A;  2B2W C;  2HIX A;  4KK7 A;  1L0Y B;  1SN8 A;  1Z6H A;  4AQY Q;  1I94 Q;  5IYD G;  5LMU L;  4Y7N B;  3S16 H;  1PH5 A;  1LT4 D;  4HED A;  1OTC A;  4QIW B;  2DY7 A;  3DHQ A;  4GLV B;  2UUB Q;  2A6E C;  4RGO S;  3T4A C;  1Q1B A;  4BWG B;  3KDF A;  2EYP A;  1SFO B;  1U4M A;  1TWA B;  1HR0 Q;  1LYL A;  1AH9 A;  3GTL H;  4JYA L;  4HJ5 A;  2F3I A;  3GTG H;  1FNU A;  1LM0 A;  1ET9 A;  1B70 B;  1SEB D;  3A8I E;  2E2J H;  4DUZ L;  2WII B;  2VL6 A;  4X62 L;  4HR7 B;  5DEH A;  2YV5 A;  5IOD A;  4DR7 L;  4ZKC B;  4RGN A;  1PYB A;  3A0J A;  1GJX A;  2E76 C;  1BOS A;  2VS1 A;  2AQ1 B;  1PRT C;  2JA8 B;  2EY2 A;  1HQR D;  5IP9 H;  3NBH B;  1ENA A;  3I4N B;  5CBE E;  3JC6 6;  1O80 A;  5I9O A;  3VA5 A;  1B44 D;  1VQ9 A;  1XMQ L;  1JMC A;  4J8Q A;  5DM7 3;  1SSO A;  1CHQ D;  2G9D A;  1S3O A;  4LFB L;  2WAQ B;  4LAA A;  1DON A;  2CW0 D;  1VDZ A;  1TWC H;  2I0Q A;  2F1M A;  4FF1 A;  4ZKB B;  2PI2 E;  4YCV A;  1VQH A;  1IHZ A;  3AYH B;  1XNQ L;  3U4Z A;  2EJG C;  2KJX A;  3FKI B;  4LFC Q;  1LTG D;  3KLS A;  4KI0 A;  4A93 B;  1PTO F;  1L1O A;  2MHV A;  4Z9C B;  4PZ8 A;  4A3M G;  1KTK A;  1HZ9 A;  5I2X A;  1N34 Q;  4HMJ A;  4HSV A;  4JK1 C;  4LF8 Q;  4B3R L;  1Y69 U;  1VMC A;  3HGB A;  1BCP B;  3U58 A;  1TWH B;  5NUC A;  3IFD A;  4K0K Q;  1JQY D;  2MNA A;  3UI2 A;  4H13 C;  2QKI C;  1HA5 A;  1VQJ A;  1B3Q A;  1RHP A;  3BJU A;  5DAU A;  4L5T A;  4GZY C;  1PTO H;  1G51 A;  3PUV A;  5C6A A;  4G4K A;  1O78 A;  1PV4 A;  1BVS A;  1LTL A;  2ID0 A;  3A7A B;  2HHH Q;  2FFK B;  4GOP C;  4A3G B;  1BBU A;  1L2F A;  4P71 A;  2HDL A;  5FO9 B;  1EWC A;  2PNR C;  4NMZ A;  3TS2 A;  2D2C C;  4DV4 Q;  4UPA A;  5GAH C;  1HFN A;  1F2M A;  3WOE A;  1XMO L;  1PRT F;  4CDE C;  2N78 A;  4B3M Q;  3HOX G;  3G6J B;  2XVS A;  1TWG H;  2PQA A;  2K03 A;  2RCN A;  1QOH A;  4DGZ A;  4UP8 A;  2RF4 A;  3DM3 A;  1CZW A;  4JBW A;  3D31 A;  5ELC A;  2AUJ D;  2B3G A;  3F1Z A;  4LK1 C;  3K7U C;  2WB1 B;  5GQO A;  2YTY A;  4CDF C;  4HJ9 A;  2K1B A;  4IUU A;  1NY4 A;  3UE1 A;  1H9S A;  2WKD A;  1G91 A;  3EVQ A;  1GUW A;  4BBS G;  4J1M A;  1A3T A;  3KF6 B;  5CR3 A;  2UUC L;  5C3W A;  1SE8 A;  2NZH A;  3R93 A;  1XNR L;  1N33 L;  1I6H B;  3W1G A;  4DU9 A;  2Z6K C;  3NBI A;  3OMG A;  2F0E A;  2CH4 A;  1DGS A;  1TKW B;  5IYB G;  1OXV A;  3BDL A;  3PUX A;  4DF7 A;  3C3L A;  1EY6 A;  1ENC A;  3I4L A;  1WTX A;  2C9O A;  3PO2 G;  1IW7 D;  2N8N A;  2WP8 J;  1Z9F A;  3GTQ H;  2JA5 G;  1UE5 A;  4A3J G;  3I8Z A;  5BN5 A;  4IUP A;  3MXN B;  1SAP A;  2HIV A;  2JA7 G;  2FMM A;  2QW7 A;  1VQ6 A;  1JT8 A;  3HOU B;  5LHY 1;  3KDF B;  2RSO A;  3OIP A;  3PF5 A;  1STH A;  3CQZ H;  4YIJ A;  2L9H A;  5M5Y H;  2A1A A;  4RFB A;  2KQ3 A;  2MPM A;  4A3F B;  1M4V A;  3ERO A;  2KOL A;  3NTH A;  1HH2 P;  3SR1 A;  1YHA A;  1JOO A;  3CAM A;  2AUK A;  3J7Z C;  2Y0S B;  5C3E B;  5DLQ E;  1CSQ A;  2Z9H A;  1STE A;  1HNZ L;  1BDO A;  1ASY A;  1IW7 C;  4BY1 B;  4OHJ A;  4BBR G;  1VQA A;  5KRU A;  1Q90 A;  4IZ8 A;  1QNU A;  2F0M A;  3TBI B;  3PIO A;  1PH9 A;  4IUN A;  1MSH A;  3U4V A;  1DZ1 A;  3I3C A;  4DK0 A;  5I9P A;  2I5L X;  2CH4 W;  3NPP A;  4POG A;  4NXN L;  4PMW A;  3J81 i;  3JAM i;  5JVG 3;  2YYZ A;  3RMH A;  1I3Q H;  4P75 A;  4QGU A;  4ULL A;  1AE3 A;  2E5L L;  1SE3 A;  3K0X A;  2JK8 A;  4NXM L;  5FKA C;  4POF A;  3SVM A;  5IP7 G;  2UUA Q;  1B2T A;  5C0X H;  2B2Y C;  1J5E Q;  5EKK A;  1L1O B;  4MTN A;  4IPC A;  1WYD A;  2L11 A;  1N32 Q;  5G3L D;  4DNT B;  2ZM6 L;  1CHP D;  2NUC A;  4GN5 A;  1I4R A;  3D6W A;  1LTS D;  1AEX A;  2RVL A;  1NJI C;  5JJI A;  2PNH A;  4HSP A;  5I6Y A;  1ML0 D;  4K5V A;  4DR3 Q;  4KJN A;  2Q8T A;  1TS2 A;  1D7Q A;  2JA8 G;  3S14 H;  2I07 B;  2YU9 B;  1QIL A;  4EVO A;  2PZT A;  1SYD A;  3I4N G;  3J81 c;  1PZI D;  2E2I H;  4OWX B;  1W6J A;  2Z6B A;  2HCI A;  4LF6 L;  4B9W A;  4WJ4 A;  1J9O A;  3CHB D;  3QIA A;  3X3M A;  4CJ2 C;  4X3S A;  1C4Q A;  2KHI A;  4JG2 A;  3S1Q H;  3P75 A;  4GNX C;  4CDC C;  1BF4 A;  2A5H A;  3GO5 A;  3NHH A;  1T9H A;  3S1M B;  2PO4 A;  3C1F A;  2DY8 A;  2VXW A;  5GRO A;  1EIH A;  4C3H H;  1CZG A;  1Y1V B;  2P5Z X;  1NBW A;  4A93 G;  2O5I C;  4DV2 L;  5E4W C;  1D1I A;  2F0F A;  3Q8D A;  4FF4 A;  1JJC B;  4M1U B;  2HCC A;  2R3Z A;  2K52 A;  5T1G A;  3TP5 A;  4DAM A;  1VF5 C;  3GTM B;  1PH1 A;  5JEA H;  1PXU A;  2RQX A;  1GXD C;  1QJO A;  1I6V C;  4R8I A;  1A2T A;  1ILQ A;  4YCW A;  3HOX H;  2CCZ A;  5FLX c;  4LF5 L;  4JV5 Q;  4GKJ L;  2R93 H;  3I55 A;  1LTA D;  2KED A;  4N9T A;  1MJC A;  1S40 A;  3BDC A;  2X69 A;  3M4O H;  3NXW A;  2EQS A;  3KLW A;  2K5V A;  2F4V L;  4A3G G;  4JI0 Q;  4JI1 Q;  3A5Z B;  5J1Z A;  2HT1 A;  1DCZ A;  3MHB A;  4KMU C;  4XYQ A;  1STG A;  1ZKO A;  3IFT A;  4KD4 A;  4HTH A;  2R7Z B;  3V96 A;  1CTM A;  3BS1 A;  4G57 A;  4A3I G;  4O1N A;  3UDX A;  1K9M C;  4LF4 L;  1FGB D;  1QVG A;  3B6Y A;  1ZEQ X;  4X3T A;  1B9M A;  2EY6 A;  4N8X 1;  1TU2 B;  4DXF A;  2B63 B;  5IYB H;  3G71 A;  1PH8 A;  1KIX A;  1VF7 A;  3HKZ E;  1OXT A;  5IGB A;  4DR2 L;  1WTR A;  4A3K H;  4DAP A;  2EE1 A;  2D0O A;  3PGZ A;  5G3L F;  4XQN A;  4B9X A;  3S1N B;  1HNX Q;  4PZ6 A;  4YHH Q;  2SEB D;  2R92 B;  1LT6 D;  1ESR A;  4CKE A;  4JI3 Q;  4DV7 L;  1IBL Q;  3PSI A;  3HRZ C;  4X66 L;  1WTQ A;  3L0O A;  3H0G B;  2XGT A;  4X64 Q;  4A3E B;  1SNP A;  3SDZ A;  1JWS D;  5CV6 A;  4JI6 L;  4S3S A;  4M8A A;  4DV3 Q;  2YTV A;  3F2D A;  4NKL A;  1TVX A;  3CCS A;  1KAW A;  3C1E A;  2HDM A;  5D65 A;  4G7O C;  2BDN A;  4FXG C;  3AFQ A;  4X65 Q;  4DR4 Q;  4KHP L;  4RGM A;  4C3I G;  5T1I A;  4X6A H;  3FVQ A;  4ZAI A;  3ERS X;  2VQF Q;  3HOU G;  3K7A B;  5IT9 c;  3TP6 A;  1SNQ A;  4FDB A;  2UXB Q;  1NAP A;  4A3F G;  5C44 H;  5M3M H;  1RJT A;  3RNU A;  1CKM A;  1HCZ A;  3W5O A;  3C46 A;  5K36 G;  2Y0S G;  5C3E G;  5EKL A;  5J3B A;  1E3P A;  4WJW A;  1VMP A;  4IO9 A;  2Z1C A;  3J7Y W;  4RKL A;  4JI2 L;  2HQE A;  2N88 A;  2OXP A;  1ENF A;  2NWG A;  3NBH A;  1I5F A;  2AWN A;  2IT1 A;  3J81 E;  5D14 A;  3JAM E;  2UXC L;  2UU9 Q;  4HAE A;  1SYE A;  1UEB A;  5JAV A;  3RN2 A;  1EQT A;  5KYI A;  5IYC H;  3JAM L;  3T1H Q;  3CPF A;  1QCB D;  5CYU A;  4G7Z C;  3M7N A;  2CFM A;  1FNV A;  1EIG A;  5FLM H;  1EYG A;  1Y1W H;  4UDU C;  2F0V A;  1RD9 D;  5M5W H;  1IL2 A;  2BA1 A;  2H4O A;  3GTJ B;  1EL0 A;  3SK6 A;  3S24 A;  1EQV A;  3T1Y Q;  3BZC A;  3DWQ A;  2NYZ D;  2JXM B;  4C3J H;  1MGS A;  4ZK9 B;  1VQP A;  4X3U A;  1X3F A;  4NW2 A;  4FF2 A;  3TRZ A;  3CW2 C;  3RZO H;  1EIF A;  1QB5 D;  1TY2 A;  1WD0 A;  2K50 A;  5I2Y A;  1E0B A;  5C5L A;  1I4P A;  1M8A A;  5HY6 A;  1V1O A;  1TY0 A;  3STB C;  2H5X A;  4V19 0;  3AEV A;  3K58 A;  1STN A;  1ZYR D;  1VQ5 A;  4GN4 B;  1LUZ A;  2CHB D;  3CC7 A;  1F77 A;  1GUG A;  1OXU A;  3A55 A;  4P73 A;  4BS9 A;  1VQO A;  3PO3 H;  4LW1 A;  4H44 C;  3ZYY X;  3S17 B;  2EOT A;  4J15 A;  4RCO A;  4DV5 Q;  3BYT B;  5KGU A;  1P16 A;  3S2D B;  5EBD A;  2NVQ B;  4JI5 Q;  1JWM D;  1DOL A;  4FXD A;  1BNZ A;  1D1K A;  4C56 C;  1YVC A;  1EZ8 A;  4DR1 L;  4CJ0 B;  4OWW B;  1F9Q A;  2F0J A;  2KA7 A;  5KEE A;  4IPD A;  1U0L A;  2K5Q A;  2R6G A;  1H95 A;  1UE7 A;  2IL8 A;  3H91 A;  3GTO B;  1ZYR C;  3Q23 A;  3S15 B;  4PNY A;  4A3I H;  3CC4 A;  1X3P A;  1IBK L;  3OSO A;  2ZXR A;  4GLA C;  1KDA A;  1SE2 A;  1EFW A;  4B3S L;  3QJY A;  3I91 A;  1STB A;  1EU3 A;  2KCN A;  1QUQ B;  1HFG A;  4DK6 C;  1N36 L;  3D0F A;  4A3C H;  3FPU B;  4IUV A;  4O0A A;  1L1O C;  3D4W A;  3KLR A;  3MZ5 A;  1CM9 A;  4C2M H;  1TXY A;  1YJW A;  4LFA Q;  2K5N A;  3KK7 A;  2IY5 B;  4R1J A;  1NE3 A;  2ENB A;  5ELB A;  1KLG D;  1E1O A;  4PV1 C;  4DNR B;  5TSS A;  3S2H B;  5BR8 Q;  4J6H A;  2OWO A;  2XTI A;  5CV4 A;  3CCV A;  4EGV A;  1PRT D;  2KEN A;  5C4J H;  3TP7 A;  3T16 A;  2PW7 A;  2JA6 B;  2B63 G;  2K7V A;  1B3A A;  3ZJY C;  1AFP A;  1MIU A;  2JEB I;  2F0Q A;  2R7D A;  3G4S A;  4KKS A;  1I4G A;  2LXJ A;  3MXN A;  4IUR A;  1PH6 A;  2X6G A;  2F0T A;  4UP9 A;  1Q86 C;  3OW7 A;  2K5D A;  3H15 A;  5IT9 E;  5GAE C;  2R92 G;  2K04 A;  4K6L A;  1HUM A;  4L63 B;  1G8Z D;  3H6M A;  5IT9 L;  4AYB E;  4C3I H;  4AH6 A;  2EIF A;  2LFN A;  4OO1 G;  1HR0 L;  2B2U A;  4RHS A;  4JYA Q;  4JCV E;  1ICF B;  2IHE A;  1KDC A;  2ICI A;  4A3E G;  4EX5 A;  4EQO A;  3BVM A;  3OWF A;  4QB4 A;  1WCM B;  2CKZ B;  3T51 B;  3TZU A;  2HQL A;  4I7A A;  1EQQ A;  4GKK Q;  1G2S A;  3HKZ B;  4CBV A;  1PYS B;  2F0P A;  3NEL A;  1Q8I A;  2Z0S A;  4A4I A;  1EY5 A;  2D0P A;  1W2B A;  4MN3 A;  4JI8 Q;  1BKB A;  3QOL A;  4A75 A;  4JW0 A;  1PHJ A;  2XSC A;  1NCV A;  1R9T H;  1HUN A;  3EIV A;  2X6L A;  3LX0 A;  3LNN A;  4LF7 Q;  1GUN A;  3S1R H;  1V9P A;  3I4M B;  4R4C A;  4MHE A;  2N49 A;  3SK8 A;  5M3F H;  3OOC A;  3BDO A;  1NMG A;  4TRD A;  2RSN A;  5JOB A;  1ASZ A;  5FJ8 H;  3K8A A;  4PQX A;  1V8Q A;  3CU7 A;  4EQN A;  3HOY H;  2M00 A;  3GTP H;  1RCV D;  3E5S A;  1S5E D;  3BYY B;  4LFC L;  4LF9 Q;  4BA1 I;  4WJ3 M;  2L55 A;  1GHJ A;  1E1T A;  5HGT A;  2B2V A;  4A3B H;  1SLJ A;  1N34 L;  4OX9 Q;  2A74 C;  3P7J A;  4DAY B;  2UXD Q;  1LT5 D;  5COY A;  2Q8R E;  3BZD B;  1KC8 C;  4LJZ C;  3C2P A;  3CCQ A;  5M5X H;  3HOZ H;  4K0K L;  4JC0 A;  1G29 1;  1UE1 A;  3DEO A;  1EWH A;  2PMZ E;  5ELF A;  4K6D A;  4ALP A;  1JCK B;  1EY7 A;  1HNW Q;  1VQE A;  2WAC A;  4GN3 B;  3GQB A;  4IFD J;  3PMF A;  4OWT B;  2F0N A;  1VQC A;  3GV6 A;  2KHJ A;  2NVT H;  1I50 H;  1LLR D;  2MUY A;  4OXP A;  1FVI A;  2M2L A;  4DV4 L;  1EYA A;  3VA7 A;  2BDO A;  3NTI A;  4HIK A;  4LMQ D;  3R2I A;  1V43 A;  1X54 A;  2VW9 A;  2B39 A;  3PUW A;  4B3M L;  5IIF A;  2EYL A;  4KY5 A;  2PYK A;  4Q0F A;  3KUP A;  5KNB A;  1E2W A;  1V1P A;  1G2T A;  1CK1 A;  4X3K A;  2TSS A;  3NTK A;  1WTH A;  1K83 B;  1MJE A;  3CXC A;  1M1K C;  2B8F A;  4XTC S;  4JVZ A;  2PI2 A;  3ER0 A;  5IWA Q;  2XRQ D;  4A3D B;  4IN3 A;  4G7H C;  1LTT D;  4PG3 A;  2AQ3 B;  1WTW A;  3HOV H;  1CQF A;  1VQN A;  2SDF A;  2AKW B;  1KXL A;  1U4R A;  2Z4I A;  1YHQ A;  4CHT B;  3M9B A;  4DA2 A;  1BQQ T;  2DNE A;  3RZD H;  1PA6 A;  5C4X B;  3CCE A;  4F88 A;  3P1H A;  1VCI A;  2EPB A;  3E0J A;  3CME A;  1GD7 A;  4RCN A;  1B1Z A;  3I90 A;  2VUM B;  4P74 A;  3Q6S A;  2NVX H;  4HID A;  2A6H C;  2A8V A;  1O7Y A;  4BY7 G;  4LUZ A;  4L5R C;  3S16 B;  3TEH B;  3OPO A;  4PMC A;  3K57 A;  3DXJ C;  1E2Z A;  2AHO B;  4CKC A;  1EFI D;  2K05 A;  3SK4 A;  2OCE A;  1HZC A;  2J7Z A;  3CRL C;  3K5M A;  3HOW H;  2H1E A;  2DJG C;  4ILW A;  3N6R A;  1XJV A;  3G7L A;  3GTL B;  1GOZ A;  4DR5 L;  3GTG B;  5IYD H;  1AP0 A;  2E2J B;  3UE0 A;  1C9O A;  1B7Y B;  1F9S A;  3K81 C;  2K28 A;  2Q2U A;  1UE6 A;  4GS3 A;  4TSS A;  2ZJP A;  5BN4 A;  1CUK A;  3R8B A;  3H94 A;  2OQ0 A;  2B2T A;  3CCR A;  2NZ1 D;  3GTK H;  4BXX G;  3TRE A;  2NTT A;  4JBJ A;  2GVB A;  3FHW A;  5IY0 A;  1MD2 D;  3M3Y H;  3UDI A;  2JA6 G;  2FXQ A;  1FD7 D;  1B53 A;  1HZA A;  1SNM A;  4NXN Q;  2NN6 G;  1S72 A;  2EYH A;  4PZ7 A;  3VYU A;  1B50 A;  2AQ2 B;  1RTO A;  4ME5 A;  2VQE Q;  1TWC B;  2ASB A;  3FMC A;  3KJP A;  1Y8O B;  2E5L Q;  4MIU A;  4L5S A;  1VQM A;  2K32 A;  1SRU A;  1F2Z A;  2ZXP A;  3MEH A;  3K6O A;  1IZ6 A;  1Q81 C;  2UUA L;  2SOB A;  3I70 A;  2V1C C;  2LSS A;  4CDD C;  1N9W A;  1CFM A;  3CD6 A;  1KAB A;  1GUT A;  1WCM G;  5FO7 B;  5IGD A;  4DK3 C;  4N8F A;  4DUY Q;  3JAM c;  2CWP A;  2IWH A;  3A74 A;  1A3U A;  3W1B A;  3HKZ G;  2DUD A;  3V05 A;  3TQY A;  4DR3 L;  4A3M H;  5IGE A;  1PTO B;  1NR4 A;  1PH4 A;  1ILP A;  4RKB A;  3F8T A;  4ZCK A;  3BZK A;  2WAQ G;  5E3F A;  2KBN A;  5CV9 A;  5IE8 A;  5AJ3 L;  2FJ2 A;  4MNO A;  4ZUI A;  4AYB B;  1TS3 A;  4ZLT F;  3VYT A;  2IX1 A;  3RLF A;  2MO0 A;  3FKI G;  1NNX A;  3L7Z C;  2VNU D;  4DV1 Q;  3BU2 A;  1II3 A;  1R4P B;  1TWG B;  2ZJR A;  4Q5V A;  1SYF A;  3G48 A;  2J0T D;  3IKJ A;  4DV2 Q;  4RG1 A;  3KYH C;  2EY1 A;  2GA4 B;  1IKL A;  4DKA C;  4OO1 I;  1V1P B;  4NPS A;  2EXZ A;  1Z7T A;  1XX8 A;  3NSW A;  1C0A A;  2MQH A;  5KND A;  3OWE B;  3K5O A;  4IOA A;  2IX3 A;  1AZP A;  4K8J A;  4IFD G;  5FK9 C;  3KBX A;  1PRT B;  2MJ8 A;  2XIW A;  1D6E C;  2MGS A;  2VB2 X;  3KFU A;  1NR2 A;  2OQK A;  4L5Q A;  4LF5 Q;  1HZB A;  1B9N A;  4JV5 L;  3EBE A;  3TME A;  4XIG S;  4RHR A;  3MXG A;  3A8J E;  4O42 A;  3N52 A;  1SE4 A;  3D4R A;  1QZH A;  2F0W A;  3CCM A;  3R3O A;  4RA8 A;  4BBS H;  4JI0 L;  4JI1 L;  2OT2 A;  4RAU C;  3NUC A;  5C0X I;  1S5F D;  3J81 j;  2IPK D;  2RDF A;  2LS0 1;  4F87 A;  3PF4 A;  3GTQ B;  1LTB D;  1A15 A;  1BCP D;  3SEB A;  2Q2I A;  1PH7 A;  1VQL A;  1B4O A;  1WI5 A;  1MHW C;  1X55 A;  2BOS A;  2WB1 G;  2A69 D;  3PO2 H;  1WOC A;  4JBM A;  2RDG A;  2PMZ B;  3QWN A;  1AZQ A;  4EQP A;  1HJP A;  1GKH A;  4APV A;  1RL2 A;  3CQZ B;  2HUG A;  2JA5 H;  5LL6 X;  4A3J H;  5M5Y B;  1QVF A;  1C48 A;  1QUQ A;  1NMF A;  1F2L A;  3OYY A;  4A3D G;  4BY7 H;  4QMG A;  5EJW A;  3F2B A;  3HS0 C;  2JA7 H;  1JE5 A;  3VR2 A;  1BO0 A;  1HNX L;  2A68 C;  4YHH L;  5EPJ A;  1VQ4 A;  1CI3 M;  3U50 C;  5JVH 3;  3L3O C;  1JB7 A;  4JI3 L;  5C4X G;  1IBL L;  4Y52 H;  1J6Q A;  1Z47 A;  4GOP B;  1JOR A;  3NWT A;  1BCP C;  1E2V A;  2ZJQ A;  4X64 L;  4JI6 Q;  2NVY H;  3GV3 A;  4L6T B;  3KF8 B;  1VQF A;  2VUM G;  4DV3 L;  1U4L A;  3LWE A;  1FJG L;  1PMR A;  5D3I B;  1OXX K;  1I3Q B;  2A69 C;  2F0I A;  3D6C A;  3PQI A;  1SNO A;  4CKB A;  1GM5 A;  1T5E A;  1ICW A;  4BBR H;  4HCS A;  4H02 A;  1TWF H;  3CCU A;  1P8L A;  4KHP Q;  4X65 L;  2E2H H;  4R9W A;  5E7N A;  2KCC A;  1XPU A;  2NB0 A;  5LL6 S;  2E8G A;  1SMX A;  1KD1 C;  3OHX C;  4Y7N H;  5E1F A;  2F0D A;  2O4X A;  1DJR D;  2HD3 A;  4KJO A;  2UXB L;  2NTS A;  1EYD A;  3QO2 A;  4BY1 G;  4JPB W;  5IP7 H;  5LMN L;  1UNS A;  5C0X J;  1Y14 B;  1SFO H;  2O5J C;  1TWA H;  2K75 A;  3ICE A;  3J7A F;  3S14 B;  4IOC A;  5IP9 G;  1Q82 C;  4KN4 C;  5EBC A;  1X3E A;  4YY3 Q;  3RLO A;  4FNF A;  2E2I B;  1D2B A;  1EEF D;  4DN4 M;  1A63 A;  4C1N K;  1FGU A;  1UWV A;  3J80 L;  3STB D;  1IYJ B;  1PH2 A;  2O2L D;  3MEF A;  2ZTE A;  3HEJ A;  1HHV A;  1BBW A;  3HZX A;  3S1Q B;  4ODG A;  3PUY A;  1MI2 A;  2JA8 H;  3KBG A;  1SRO A;  1TT2 A;  3I4N H;  3MTS A;  4KN7 C;  2ZTD A;  3AFP A;  2K5W A;  3T1H L;  4C3H B;  2F52 A;  3VR4 A;  1BCP F;  5ELE A;  1TR5 A;  4P2C B;  2A19 A;  2BA0 A;  4OON A;  2EXD A;  2JA9 A;  3I73 A;  4NP5 A;  3CMA A;  4R8N A;  4DR6 L;  4HJA A;  1D5M C;  3T1Y L;  1WD1 A;  3FKI H;  1K8O A;  2WV6 D;  4A93 H;  3QOJ A;  2F3V A;  1BUV T;  4KKU A;  1BR9 A;  4JOI A;  3KLS X;  5JJL A;  4LUV A;  4DAY A;  1Q7Y C;  3HOX B;  2R93 B;  2RHS B;  2CQA A;  1K0S A;  1CA6 A;  4F7X A;  3M4O B;  5JPM C;  4ZRZ A;  3L9A X;  4DV0 Q;  4KY6 A;  5JEA J;  1MSG A;  3M85 A;  1TWH H;  3OTO Q;  5K5P A;  4AYB G;  4JI7 Q;  2NN6 I;  3W2D A;  3WOF A;  1Y1V G;  4FO2 A;  1EUJ A;  5DM6 3;  3DEP A;  3HFZ B;  3ULL A;  4FYD A;  4ZUJ A;  3EA6 A;  1SYG A;  1IXR A;  1S5B D;  4A3G H;  3E6Z X;  2F3W A;  4DV5 L;  3NP8 A;  4TQU S;  1F9P A;  3BVZ A;  4DV6 L;  1YNN D;  4JI5 L;  1IBM L;  3FRP B;  3D3R A;  5COR A;  2BH2 A;  3A5U A;  1H9J A;  1XPO A;  1KL9 A;  5DNF A;  4A3K B;  3WWV A;  2Y0S E;  1PH3 A;  1A62 A;  2QA4 A;  3K5L A;  4K2K A;  3I2Z A;  1TS5 A;  4KHV A;  3H3V I;  1Q12 A;  2E74 C;  1VQK A;  2SNS A;  1K8M A;  2XWB B;  2KHS A;  3R2T A;  3SK5 A;  2R7Z G;  4B3T Q;  3TP8 A;  2DJF C;  2Q8I B;  2R7F A;  3NE5 B;  3NQI A;  5C5M A;  3VR3 A;  5ISR A;  2B2V C;  1YIT A;  4OL7 A;  3PCO B;  4GNX B;  1PZK D;  1I6H H;  1YNN C;  3K5N A;  4JI4 L;  2R61 A;  4K2L A;  2QEX A;  4RH6 A;  1VQ8 A;  5JJK A;  1K3R A;  5BR8 L;  1GUO A;  4TVA B;  1EU4 A;  2E2D C;  2ZXO A;  2OTL A;  4XT1 B;  3AB9 A;  4XT3 B;  2L15 A;  2PZU A;  5LMU Q;  1C7Y A;  4FVM A;  3I72 A;  2K6A A;  1HTP A;  4RMF A;  4AQY L;  1TS4 A;  1I94 L;  4XQQ A;  2F0H A;  1SDF A;  2UUB L;  5C44 B;  5M3M B;  1LT3 D;  3CC2 A;  1HTL D;  2ICE C;  3E3X A;  2N55 A;  2PQE A;  3H0G G;  4IFD I;  4H7B A;  3BVG A;  3PUZ A;  3HOU H;  3P20 A;  3A56 A;  4DUZ Q;  1N8R C;  2K14 A;  4X62 Q;  3PIP 3;  3ND9 A;  4MZ9 A;  5EKI A;  4DR7 Q;  1YJN A;  3Q22 A;  3I4O A;  4A3F H;  4KHZ A;  4I65 A;  2NBF A;  1VQG A;  2XNA C;  3MC0 B;  5K36 H;  5C3E H;  2WKC A;  4DK1 A;  1YIJ A;  4GKK L;  5CC4 A;  1JJG A;  4BY1 H;  3EQL C;  1SJE D;  1I4Q A;  1XMQ Q;  1A8V A;  1KNA A;  2K01 A;  1XWE A;  4KKT A;  3ULJ A;  2F4I A;  1ET6 A;  3T13 A;  3AMU A;  2BH8 A;  3NK9 A;  5C0X G;  1Y1W B;  4LFB Q;  2Q2H A;  1T5X D;  4JI8 L;  5M5W B;  1X32 A;  1KLU D;  4LF7 L;  3MVV A;  2L12 A;  1Q3L A;  1XNQ Q;  4BA2 I;  1AN8 A;  4FP5 D;  2FMC A;  1PFB A;  3GP7 A;  3A54 A;  4C3J B;  2XRS D;  3M4Y A;  3QG1 A;  4QF4 A;  1PYW D;  3RZO B;  1LO5 D;  1X56 A;  2WIN B;  3TZD A;  4IPG A;  4KV6 A;  4P72 A;  2B8G A;  3OMC A;  4B3R Q;  4R4T A;  4LF9 L;  3A7L A;  4LF8 L;  2ATW A;  4QUF A;  1YI2 A;  1CA5 A;  4K5W A;  1U5K A;  3HG9 A;  1KQS A;  2ZT9 C;  4OX9 L;  2JN4 A;  3G6E A;  2Z8L A;  2UXD L;  3DWA A;  1QWY A;  4XYO A;  2LMC B;  1TII D;  1CKN B;  2K33 A;  3UDG A;  2YU9 H;  1IYU A;  1AW7 A;  3M4Q A;  3PO3 B;  1WJJ A;  1QG7 A;  1EY4 A;  2B2W A;  2HHH L;  1K28 A;  4C3H G;  2Z4H A;  2CW0 C;  2FIN B;  1HNW L;  2B2T C;  1CKO A;  5H1S E;  3CCL A;  4R4Q A;  1X3G A;  1XMO Q;  2MO1 A;  2MFI A;  1YBY A;  3FP9 A;  3S1M H;  4RWS C;  2OF1 A;  5JEA G;  1EOT A;  3DM1 A;  4IPH A;  1B8A A;  2CVR A;  3U9S A;  1Y1V H;  2DGY A;  2A6H D;  3E9H A;  1BBX C;  4A3I B;  1NTG A;  1GO3 E;  4EQ5 A;  4IJH A;  3SE0 A;  2R93 G;  1OO9 B;  5CV7 A;  3IRB A;  2L0C A;  1VQ7 A;  5EPK A;  1SNC A;  5BN3 A;  4L8J A;  4ZQ3 A;  1JC7 A;  2F0G A;  2MP1 A;  5FOB B;  5M9O A;  3GTM H;  4XQJ A;  3Q24 A;  1ROD A;  3J7A 5;  4C2M B;  2UUC Q;  3Q0A A;  1XNR Q;  1N33 Q;  2CWA A;  1EEI D;  4F8M A;  3AQQ A;  5IWA L;  2A73 B;  1YNJ D;  1RTN A;  4FXK C;  2BE5 D;  4HCE A;  4U68 A;  4C1N I;  4QJF A;  2QDB A;  1KAA A;  1D8L A;  3NEN A;  1QE6 A;  1HR0 W;  5C4J B;  5EQ0 A;  1O7I A;  2JJQ A;  4DXG A;  1HQM C;  4N9P A;  2ES2 A;  4HJ8 A;  1X65 A;  4WOR A;  2R7Z H;  4ID6 A;  1DYQ A;  4LWC A;  1W6K A;  3VR5 A;  4B08 A;  1A0I A;  3MA2 B;  2SNM A;  3MXP A;  4A3K G;  1CQV A;  3I56 A;  1QNK A;  1PDQ A;  3QB3 A;  1IYV A;  1S4Z A;  1ESF A;  1CT1 D;  3EN2 A;  3ERQ A;  1HPC A;  5J22 A;  2B63 H;  5A2Q E;  1KRS A;  1PFM A;  1SJH D;  2KUM A;  3UDF A;  3HKS A;  4C3I B;  4ZYS A;  5I6W A;  1YNJ C;  5IGF A;  2BE5 C;  5A2Q L;  4DR5 Q;  1XPR A;  1D5X C;  5CV8 A;  2PCF B;  2ALY B;  3S1N H;  2JE6 I;  1XXG A;  2RDH A;  2R92 H;  3RN5 A;  1EYC A;  2VZA A;  1HNZ Q;  4DNI A;  4QCL A;  4GOP A;  1OXS C;  2LXK A;  3J80 i;  1E24 A;  1GHK A;  1HA6 A;  3H0G H;  4OO1 H;  1PLF A;  3KF8 A;  4IUQ A;  5AFW A;  3WDN A;  1SMY D;  4A3E H;  2EYO A;  2DNC A;  3PV0 A;  5D3D A;  1R9T B;  1K3B C;  1LTI D;  3S1R B;  2EZV A;  2NZO A;  3VYS A;  2JEA I;  3J7A V;  1JOK A;  5CMD A;  5M3F B;  1PVO A;  1FYC A;  4NXM Q;  1PFN A;  2F0L A;  5C44 G;  5M3M G;  2VQE L;  1VQI A;  2EYM A;  3HOY B;  4UHV A;  1F9R A;  1KNE A;  2EVB A;  1RF2 D;  4RGT A;  5IOC A;  3D4D A;  1J5E L;  3GTP B;  3TN2 A;  2ZM6 Q;  1N32 L;  2DN8 A;  1XTC D;  2AWO A;  3K7A H;  3RR5 A;  3RUZ A;  3VYR A;  1WTV A;  1EOV A;  2I46 A;  3CCJ A;  4U67 3;  5CGK A;  1NUC A;  2D62 A;  3J80 c;  4A3B B;  2IJ0 A;  4HMI A;  3E0E A;  2CQO A;  1SMY C;  5KIX A;  2M9V A;  1IL8 A;  2Z6K A;  3ND8 A;  2LY7 A;  3TS0 A;  2JYO A;  1LAC A;  5M5X B;  1S5C D;  3HOZ B;  4DUY L;  5IYC G;  1F2Y A;  2PZW A;  4LF6 Q;  3MWY W;  3D8G A;  1G6Z A;  1NSN S;  3I4M G;  1EZ6 A;  4UY8 C;  5FLM G;  4QQB X;  2L5T A;  1Y1W G;  3M7G A;  5AJ3 Q;  1G6P A;  3DMU A;  2NVT B;  1I50 B;  1O7L A;  3E9I A;  4XXE A;  3QR8 A;  1FNW A;  4C3J G;  1WVL A;  3IL8 A;  3O13 A;  1SYB A;  1VQB A;  2K4K A;  4DV1 L;  2QGQ A;  5IGG A;  1K8A C;  3U9O A;  1EIY B;  1D5Z C;  1CSP A;  4K5X A;  3GTJ H;  2L4N A;  3AU7 A;  3F2U A;  2BCO A;  2PQA B;  3FDT A;  5CBA E;  1UAP A;  3LGJ A;  1X6O A;  4AIM A;  1DXM A;  2G5D A;  3W3A A;  4OIJ A;  3H09 A;  2OEO A;  2EYF A;  2EJM A;  2D9U A;  4GKJ Q;  1EWI A;  5IGC A;  3HOV B;  3PO3 G;  1R4Q B;  2WFW A;  1H9S B;  2L1B A;  1A6X A;  1O7Z A;  2IX0 A;  2F4V Q;  1XTD A;  2A68 D;  3RZD B;  2IHF A;  5J39 A;  1LV9 A;  4QIW E;  1YZ6 A;  2EY5 A;  4UAI A;  3LWU A;  2IW3 A;  2J4X A;  4WFN 3;  1SXT A;  2NVX B;  4LF4 Q;  3H3V C;  2B2Y A;  1FR3 A;  3SHL A;  4LNQ A;  3S17 H;  1HRJ A;  3HP3 A;  4KLK A;  1ZXT A;  2F0U A;  4IAL A;  2E75 C;  1EQR A;  5KNC A;  3PIP A;  2KCM A;  3HOW B;  2NVQ H;  3S2D H;  3F2C A;  4H0L C;  2F0S A;  3I7F A;  4DR2 Q;  4OEM B;  1MBY A;  1M90 C;  4ABN A;  4A3C G;  1YNX A;  1V1Q A;  2PW5 A;  3IAY A;  1E7Z A;  3A8K E;  2XWJ B;  3T53 B;  1Q46 A;  3GTO H;  3RD4 A;  1SR3 A;  3S15 H;  5ELN A;  5C3X A;  3ULP A;  1GUS A;  5GAG C;  1SYC A;  4DV7 Q;  1JWU D;  4X66 Q;  5ELO A;  3NQT A;  4HIO A;  4A3L G;  2YTX A;  2WAQ E;  1IKM A;  3GD7 A;  1EY8 A;  1A3V A;  1STA A;  3GTK B;  3DLL A;  4GLX A;  1KDB A;  4GNX A;  3CKI B;  3KOJ A;  4JOI C;  1WTP A;  5FO8 B;  2QCP X;  2OTJ A;  1X9N A;  3M3Y B;  1I4H A;  2QDL A;  1BXT A;  1H9K A;  4YWK A;  2GVA A;  4KY7 A;  4WRD A;  1EY9 A;  1GVP A;  4O2D A;  4DPG A;  1K73 C;  1FJG Q;  3S2H H;  3K59 A;  5JJZ A;  3RLN A;  4DR4 L;  4PMB A;  4BXX H;  1J8I A;  3NEM A;  3VR6 A;  1Y8P B;  2JSO A;  3CP0 A;  5A35 A;  4KD3 A;  2VQF L;  2JA6 H;  4I7Z C;  2RKS A;  1RDP D;  2NN6 H;  3MFY A;  1U9R A;  2G9H D;  1U4P A;  4IUT A;  1Q1E A;  1S5D D;  4QUC A;  2RHQ B;  4DFA A;  5HGQ A;  1DD2 A;  4OEL B;  4E6I A;  2XN9 C;  1X3Q A;  3TSS A;  3SGI A;  2K5H A;  3J80 E;  5LMN Q;  3L2P A;  3S9W A;  2KEC A;  4R4I A;  4A3M B;  1YEZ A;  4JI2 Q;  4QL5 A;  4K8I A;  3K0Y A;  3OW2 A;  4YWL A;  3ONA B;  4CGY B;  1Q8K A;  5GAD C;  1Y8N B;  1QZG A;  1K8G A;  4LUO A;  4YY3 L;  1WCM H;  2UXC Q;  5EPL A;  1FL0 A;  3CPW A;  1A2U A;  1DOM A;  1JE4 A;  4OIK A;  2Q2T A;  2UU9 L;  5F2D A;  4IQZ A;  5C4Z A;  2V4D A;  2EYJ A;  5EAY A;  3H3V H;  1KHI A;  1JR0 D;  5M3F G;  4HJ7 A;  4K14 A;  3T56 B;  1JJ2 A;  2C35 B;  2LKV A;  5FJ8 G;  1LAB A;  1I4X A;  3HOY G;  4HN7 A;  4OGQ C;  1L0W A;  1DOK A;  2WB1 E;  2KVM A;  3J81 L;  1JIC A;  3OIQ A;  2QIL A;  1DM0 B;  1JB3 A;  1SND A;  2GN5 A;  2QF7 A;  3I4M H;  5E4X A;  1XYI A;  1W3S A;  1YHB A;  2RA4 A;  4CJ1 B;  3PIO 3;  2AMC B;  3BG3 A;  4A3B G;  4DR6 Q;  3MXU A;  1E22 A;  4DAV A;  4KTA A;  2C5C A;  5JPN C;  1JOQ A;  4MTK A;  4UP7 A;  2EDG A;  3DUZ A;  3HOZ G;  1WFQ A; 
#chains in the Genus database with same CATH homology
 2Q2H A;  1B7Y B;  4A3I G;  4JI8 L;  3UDX A;  1K9M C;  4LF4 L;  3K81 C;  4R4O A;  3M4P A;  1QVG A;  3VDY A;  3B6Y A;  1AE2 A;  2Q2U A;  4LF7 L;  1K0R A;  1UE6 A;  4GS3 A;  4QY7 A;  1CKN A;  4HIM A;  1XNQ Q;  2ZJP A;  4BA2 I;  1CUK A;  2OQ0 A;  3CCR A;  5IYB H;  4DV0 L;  2VY3 A;  3G71 A;  1PH8 A;  1KIX A;  3GTK H;  4BXX G;  3TRE A;  3HKZ E;  1OXT A;  4JBJ A;  3OTO L;  1X56 A;  4DR2 L;  1PFS A;  2GVB A;  3FHW A;  5IY0 A;  4A3K H;  4IPG A;  2KCT A;  4P72 A;  3UDI A;  4JI7 L;  2JA6 G;  3M3Y H;  2D0O A;  2FXQ A;  3PGZ A;  3K80 C;  4NB3 A;  1HZA A;  4B3R Q;  1MKH A;  4R4T A;  1HNX Q;  2NN6 G;  4PZ6 A;  1VQD A;  2JQO A;  4PZ7 A;  4YHH Q;  3KJO A;  1S72 A;  4LF8 L;  4LF9 L;  2ZTC A;  4YWM A;  2ATW A;  1YI2 A;  2VQE Q;  2ASB A;  1U5K A;  4DR1 Q;  4JI3 Q;  4DV7 L;  1KQS A;  3KJP A;  1QVC A;  3PSI A;  4X66 L;  1IBL Q;  3G6E A;  4OX9 L;  3L0O A;  2XGT A;  2E5L Q;  2UXD L;  4L5S A;  4DV6 Q;  1VQM A;  4X64 Q;  1IBM Q;  4A76 A;  1CKN B;  1SRU A;  3UDG A;  2YU9 H;  4JI6 L;  3M4Q A;  4DV3 Q;  1WJJ A;  1IZ6 A;  1Q81 C;  2UUA L;  1IBK Q;  2YTV A;  2V1C C;  2LSS A;  3F2D A;  4B3S Q;  2HHH L;  1YJ9 A;  1N9W A;  3CCS A;  1KAW A;  3CD6 A;  1N36 Q;  3HOV G;  2B29 A;  1WCM G;  1HNW L;  1CKO A;  4JBK A;  5H1S E;  3AFQ A;  1KRT A;  4DK3 C;  4X65 Q;  3CCL A;  4DUY Q;  4R4Q A;  3JAM c;  1X3G A;  2CWP A;  1XMO Q;  1K83 H;  2MO1 A;  2MFI A;  4DR4 Q;  1YBY A;  3A74 A;  4ME3 A;  4KHP L;  4X6A H;  3W1B A;  3HKZ G;  2DUD A;  2N3S A;  3FP9 A;  3TQY A;  3ERS X;  4DR3 L;  3S1M H;  4A3M H;  2VQF Q;  3HOU G;  4YCU A;  2I5M X;  5JEA G;  4LFA L;  4IPH A;  1B8A A;  4A3D H;  5IT9 c;  1Y1V H;  2DGY A;  3KF6 A;  4IJL A;  4B3T L;  4FDB A;  1PH4 A;  3E9H A;  1RIP A;  3CF5 A;  3F8T A;  3BZK A;  5LMN W;  2UXB Q;  1NTG A;  2WAQ G;  2KBN A;  5IE8 A;  5AJ3 L;  4MNO A;  1GO3 E;  4EQ5 A;  1VS0 A;  4IJH A;  4A3F G;  2R93 G;  5C44 H;  5M3M H;  3IRB A;  3RNU A;  2I5H A;  4JI4 Q;  1CKM A;  1VQ7 A;  5C4X H;  3W5O A;  4A3L H;  2IX1 A;  5K36 G;  2Y0S G;  3RLF A;  2MO0 A;  5C3E G;  3GTM H;  3HOW G;  3FKI G;  5J3B A;  1E3P A;  3L7Z C;  2VNU D;  4DV1 Q;  3J7A 5;  3BU2 A;  2UUC Q;  2VUM H;  4IO9 A;  3GDE A;  1XNR Q;  2HIX A;  2ZJR A;  1N33 Q;  1SN8 A;  2CWA A;  3AQQ A;  5IWA L;  4AQY Q;  4JI2 L;  1I94 Q;  5IYD G;  5LMU L;  3G48 A;  3S16 H;  4DV2 Q;  4RG1 A;  1PH5 A;  3KYH C;  4QJF A;  1I5F A;  1D8L A;  2AWN A;  2IT1 A;  3NEN A;  1OTC A;  2UUB Q;  2UXC L;  4GLV B;  2UU9 Q;  4DKA C;  1HR0 W;  1UEB A;  1Q1B A;  3RN2 A;  4OO1 I;  4NPS A;  1O7I A;  3KDF A;  1HR0 Q;  5IYC H;  1LYL A;  2JJQ A;  3T1H Q;  1AH9 A;  3CPF A;  1C0A A;  2MQH A;  3GTL H;  4JYA L;  2ES2 A;  4HJ5 A;  2F3I A;  1X65 A;  4HJ8 A;  1LM0 A;  2R7Z H;  3GTG H;  2CFM A;  3M7N A;  4IFD G;  1B70 B;  4LWC A;  5FLM H;  1EYG A;  4DUZ L;  2E2J H;  3KFU A;  1Y1W H;  1A0I A;  2OQK A;  2VL6 A;  4L5Q A;  4X62 L;  4A3K G;  2YV5 A;  5M5W H;  3I56 A;  1HZB A;  4LF5 Q;  1IL2 A;  2BA1 A;  4DR7 L;  4JV5 L;  3EBE A;  1PYB A;  3A0J A;  4XIG S;  3S24 A;  2VS1 A;  3T1Y Q;  3BZC A;  3EN2 A;  2B63 H;  1KRS A;  5IP9 H;  1QZH A;  4C3J H;  3NBH B;  3UDF A;  3CCM A;  3HKS A;  1VQP A;  1X3F A;  3TRZ A;  4BBS H;  3JC6 6;  4JI0 L;  4JI1 L;  3CW2 C;  3RZO H;  1EIF A;  1VQ9 A;  4DR5 Q;  1XMQ L;  1JMC A;  5C0X I;  2K50 A;  1XPR A;  3J81 j;  5HY6 A;  2ALY B;  3PF4 A;  1S3O A;  3S1N H;  2JE6 I;  2R92 H;  3STB C;  3RN5 A;  4LFB L;  2H5X A;  2VZA A;  1HNZ Q;  1VQL A;  2Q2I A;  1PH7 A;  3AEV A;  4DNI A;  1TWC H;  4GOP A;  1OXS C;  2I0Q A;  4K0K L;  1WI5 A;  2LXK A;  3J80 i;  1VQ5 A;  1E24 A;  1LUZ A;  1VQH A;  2PI2 E;  1X55 A;  4GN4 B;  4YCV A;  3AYH B;  2WB1 G;  3H0G H;  1XNQ L;  3PO2 H;  1WOC A;  3U4Z A;  4JBM A;  4A3E H;  3CC7 A;  4LFC Q;  1OXU A;  4KI0 A;  1HJP A;  1GKH A;  1L1O A;  4P73 A;  3PV0 A;  4APV A;  1RL2 A;  1VQO A;  4LW1 A;  3PO3 H;  2JA5 H;  4PZ8 A;  4A3J H;  1QVF A;  4A3M G;  1QUQ A;  1HZ9 A;  1NMF A;  3OYY A;  1N34 Q;  4J15 A;  4A3D G;  4BY7 H;  2NZO A;  4DV5 Q;  2JEA I;  3F2B A;  1P16 A;  1JE5 A;  2JA7 H;  1PVO A;  4LF8 Q;  4B3R L;  1HNX L;  4YHH L;  1VQ4 A;  4JI5 Q;  3U58 A;  3U50 C;  4NXM Q;  4K0K Q;  5C44 G;  5M3M G;  2VQE L;  1VQI A;  1YVC A;  2MNA A;  4DR1 L;  1JB7 A;  4JI3 L;  4OWW B;  5C4X G;  1IBL L;  4Y52 H;  1VQJ A;  1J5E L;  1J6Q A;  1Z47 A;  3BJU A;  4IPD A;  4GOP B;  2ZM6 Q;  1N32 L;  1U0L A;  3K7A H;  2AWO A;  3RR5 A;  4X64 L;  2ZJQ A;  4L5T A;  4JI6 Q;  1EOV A;  2NVY H;  1G51 A;  1UE7 A;  2R6G A;  3PUV A;  3CCJ A;  1H95 A;  3KF8 B;  1VQF A;  2VUM G;  4DV3 L;  1PV4 A;  1BVS A;  1LTL A;  4A3I H;  2ID0 A;  2D62 A;  3J80 c;  3CC4 A;  1FJG L;  1IBK L;  1OXX K;  2HHH Q;  4GLA C;  4GOP C;  4B3S L;  1BBU A;  1L2F A;  4P71 A;  1EFW A;  3E0E A;  2CQO A;  1GM5 A;  2Z6K A;  1QUQ B;  4BBR H;  4DK6 C;  1N36 L;  3TS0 A;  3D0F A;  4A3C H;  3TS2 A;  4DV4 Q;  4H02 A;  1TWF H;  4O0A A;  4UPA A;  1L1O C;  1P8L A;  5GAH C;  3CCU A;  4X65 L;  4KHP Q;  2E2H H;  4C2M H;  4DUY L;  1XMO L;  5IYC G;  2N78 A;  5E7N A;  1TXY A;  4LF6 Q;  4B3M Q;  1XPU A;  3HOX G;  1YJW A;  4NXN Q;  1TWG H;  4LFA Q;  2K5N A;  2E8G A;  1SMX A;  2IY5 B;  2PQA A;  4R1J A;  1KD1 C;  2RCN A;  1NE3 A;  4UP8 A;  2RF4 A;  3I4M G;  4Y7N H;  4UY8 C;  5FLM G;  4QQB X;  1E1O A;  1Y1W G;  5BR8 Q;  5AJ3 Q;  2OWO A;  2XTI A;  3DM3 A;  4JBW A;  3D31 A;  2UXB L;  1G6P A;  3CCV A;  2KEN A;  2B3G A;  4BY1 G;  5IP7 H;  5C4J H;  3F1Z A;  5C0X J;  5LMN L;  1Y14 B;  1SFO H;  3K7U C;  1TWA H;  2K75 A;  3E9I A;  5GQO A;  2YTY A;  3ICE A;  4HJ9 A;  2B63 G;  3ZJY C;  4IOC A;  1MIU A;  5IP9 G;  1NY4 A;  1Q82 C;  2JEB I;  3UE1 A;  2R7D A;  1X3E A;  4YY3 Q;  3RLO A;  1VQB A;  3G4S A;  2K4K A;  4DV1 L;  2QGQ A;  2LXJ A;  4BBS G;  1K8A C;  1PH6 A;  1A63 A;  2UUC L;  3KF6 B;  1EIY B;  1SE8 A;  2NZH A;  1XNR L;  1CSP A;  1N33 L;  1FGU A;  1UWV A;  4UP9 A;  1Q86 C;  3STB D;  3W1G A;  1IYJ B;  1PH2 A;  2Z6K C;  3GTJ H;  3MEF A;  2ZTE A;  3H15 A;  5GAE C;  1BBW A;  2R92 G;  2PQA B;  3PUY A;  1DGS A;  5IYB G;  2JA8 H;  1OXV A;  1SRO A;  3LGJ A;  1X6O A;  3I4N H;  3PUX A;  4AIM A;  4AYB E;  4C3I H;  2ZTD A;  4AH6 A;  2EIF A;  3AFP A;  4OO1 G;  1HR0 L;  4GKJ Q;  3PO2 G;  1EWI A;  3T1H L;  4JCV E;  4JYA Q;  2IHE A;  4A3E G;  2N8N A;  2WP8 J;  4EX5 A;  3PO3 G;  2F52 A;  1Z9F A;  3GTQ H;  2CKZ B;  2JA5 G;  1UE5 A;  2WFW A;  4A3J G;  2HQL A;  2IX0 A;  1EQQ A;  2F4V Q;  4GKK Q;  2A19 A;  2BA0 A;  4OON A;  1XTD A;  2EXD A;  2JA9 A;  3MXN B;  2HIV A;  3CMA A;  2IHF A;  4DR6 L;  2JA7 G;  1VQ6 A;  1JT8 A;  1PYS B;  4HJA A;  4QIW E;  3KDF B;  1YZ6 A;  3T1Y L;  3NEL A;  3FKI H;  3PF5 A;  2Z0S A;  4A4I A;  4A93 H;  2D0P A;  1W2B A;  4JI8 Q;  3CQZ H;  1BKB A;  4A75 A;  4LF4 Q;  4JOI A;  1PHJ A;  5JJL A;  4LUV A;  1Q7Y C;  5M5Y H;  2A1A A;  1R9T H;  3EIV A;  4LNQ A;  3S17 H;  4LF7 Q;  2RHS B;  3S1R H;  4KLK A;  1V9P A;  4R4C A;  1HH2 P;  1YHA A;  2N49 A;  3CAM A;  5M3F H;  3J7Z C;  3S2D H;  1EQR A;  3PIP A;  2KCM A;  1NMG A;  4DV0 Q;  5DLQ E;  5JEA J;  1CSQ A;  3F2C A;  5FJ8 H;  1ASZ A;  3K8A A;  2NVQ H;  3M85 A;  1TWH H;  1HNZ L;  1ASY A;  3I7F A;  3OTO Q;  4DR2 Q;  3HOY H;  4AYB G;  4BBR G;  1VQA A;  4JI7 Q;  1M90 C;  3GTP H;  4A3C G;  2NN6 I;  1YNX A;  3PIO A;  1V1Q A;  1PH9 A;  1E7Z A;  1EUJ A;  1Y1V G;  3U4V A;  3HFZ B;  4LFC L;  2I5L X;  4BA1 I;  4LF9 Q;  4POG A;  1Q46 A;  3GTO H;  4NXN L;  3ULL A;  4WJ3 M;  1E1T A;  1SR3 A;  3S15 H;  4PMW A;  5ELN A;  3J81 i;  3JAM i;  3ULP A;  5GAG C;  2YYZ A;  4A3B H;  1IXR A;  1I3Q H;  4P75 A;  4DV7 Q;  4A3G H;  1SLJ A;  4X66 Q;  1N34 L;  4QGU A;  4OX9 Q;  5ELO A;  4DAY B;  4DV5 L;  2UXD Q;  1AE3 A;  4HIO A;  4A3L G;  4TQU S;  2YTX A;  1KC8 C;  2E5L L;  2WAQ E;  4DV6 L;  3GD7 A;  3K0X A;  4JI5 L;  3CCQ A;  1IBM L;  5M5X H;  2BH2 A;  3DLL A;  2JK8 A;  4GLX A;  4POF A;  4NXM L;  3A5U A;  4JC0 A;  1G29 1;  1UE1 A;  5IP7 G;  4GNX A;  2UUA Q;  3KOJ A;  4JOI C;  1XPO A;  1KL9 A;  1J5E Q;  1X9N A;  2OTJ A;  1L1O B;  4MTN A;  4IPC A;  1WYD A;  2Y0S E;  3WWV A;  1PH3 A;  1A62 A;  2PMZ E;  1N32 Q;  2QA4 A;  2ZM6 L;  4ALP A;  4YWK A;  2GVA A;  3I2Z A;  4GN5 A;  1GVP A;  1HNW Q;  4O2D A;  4DPG A;  1K73 C;  1VQE A;  4GN3 B;  1FJG Q;  3S2H H;  3H3V I;  1NJI C;  1Q12 A;  5JJI A;  1VQK A;  4IFD J;  2PNH A;  4OWT B;  3RLN A;  4DR4 L;  4BXX H;  3NEM A;  1VQC A;  4DR3 Q;  2KHJ A;  2NVT H;  3CP0 A;  1I50 H;  1D7Q A;  4OXP A;  2VQF L;  2JA6 H;  2JA8 G;  1FVI A;  3S14 H;  2R7Z G;  4B3T Q;  4DV4 L;  3I4N G;  3J81 c;  2R7F A;  4HIK A;  2E2I H;  4OWX B;  1V43 A;  1X54 A;  1YIT A;  2VW9 A;  5C0X G;  3PCO B;  3PUW A;  4LF6 L;  4GNX B;  4B3M L;  1Q1E A;  4WJ4 A;  1I6H H;  2RHQ B;  5HGQ A;  4JI4 L;  3HOZ H;  2KHI A;  4JG2 A;  2QEX A;  3S1Q H;  1VQ8 A;  5JJK A;  1K3R A;  5BR8 L;  4TVA B;  3SGI A;  4GNX C;  2K5H A;  2OTL A;  5LMN Q;  1MJE A;  3L2P A;  3GO5 A;  3CXC A;  1M1K C;  1T9H A;  4XTC S;  4R4I A;  2L15 A;  1YEZ A;  4JI2 Q;  2PI2 A;  3ER0 A;  4QL5 A;  5IWA Q;  5LMU Q;  5GRO A;  1C7Y A;  4C3H H;  3OW2 A;  4PG3 A;  4YWL A;  4AQY L;  4RMF A;  1I94 L;  1NBW A;  1Q8K A;  4A93 G;  5GAD C;  4DV2 L;  3HOV H;  1QZG A;  1K8G A;  4LUO A;  4YY3 L;  1VQN A;  1WCM H;  2AKW B;  3Q8D A;  2UXC Q;  1KXL A;  1FL0 A;  3CPW A;  2UUB L;  1YHQ A;  2UU9 L;  2Q2T A;  1JJC B;  3M9B A;  4IOA A;  3CC2 A;  5EAY A;  3RZD H;  1PA6 A;  3H3V H;  3CCE A;  1KHI A;  3H0G G;  2K52 A;  5M3F G;  4HJ7 A;  1JJ2 A;  4IFD I;  4DAM A;  3PUZ A;  1VCI A;  3HOU H;  2C35 B;  1PH1 A;  5FJ8 G;  3CME A;  1GD7 A;  4DUZ Q;  1N8R C;  3HOY G;  4P74 A;  2NVX H;  2K14 A;  4X62 Q;  1L0W A;  2WB1 E;  4YCW A;  4HID A;  4MZ9 A;  2A8V A;  3HOX H;  4DR7 Q;  2CCZ A;  5FLX c;  1YJN A;  3I4O A;  4LUZ A;  4L5R C;  4A3F H;  4LF5 L;  4KHZ A;  4BY7 G;  4JV5 Q;  4GKJ L;  2R93 H;  3TEH B;  3I55 A;  2GN5 A;  1VQG A;  1MJC A;  3I4M H;  1S40 A;  2AHO B;  1W3S A;  1YHB A;  3M4O H;  2OCE A;  5C3E H;  1HZC A;  2EQS A;  3HOW H;  2AMC B;  4A3B G;  3KLW A;  4GKK L;  2K5V A;  1YIJ A;  2F4V L;  4A3G G;  4DR6 Q;  4JI0 Q;  4JI1 Q;  4BY1 H;  1JJG A;  1E22 A;  3A5Z B;  1XJV A;  2HT1 A;  1XMQ Q;  1A8V A;  4UP7 A;  3ULJ A;  4DR5 L;  5IYD H;  2BH8 A;  3HOZ G;  3UE0 A;  1C9O A;  1WFQ A;  4LFB Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...