4JOIC

Crystal structure of the human telomeric stn1-ten1 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
MLPKPGTYYLPWEVSAGQVPDGSTLRTFGRLCLYDMIQSRVTLMAQHGSDQHQVLVCTKLVEPFHAQVGSLYIVLGELQHQQDRGSVVKARVLTCVEGMNLPLLEQAIREQRLYKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords CST complex subunit STN1
publication title Structure of the human telomeric stn1-ten1 capping complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 118
sequence length 118
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF15490 Ten1_2 Telomere-capping, CST complex subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4joiC00
3PGZA 1SROA 4QIWE 3HOVH 4IFDJ 1AE3A 3T1HQ 1FL0A 1YHBA 1L0WA 4JC0A 2XGTA 5FLMH 2JA7G 3DLLA 2K50A 1N32L 3UDGA 4A3GH 2R7ZG 3M9BA 4BY7G 3S24A 4X62L 4P74A 2HHHL 1YIJA 4YCUA 5E7NA 1N32Q 4ALPA 2F3IA 1SLJA 2GVBA 4X66L 1E1TA 1Q46A 2EXDA 4X62Q 1EQRA 1N34Q 2HHHQ 1X54A 4MTNA 4DV7L 1HNZL 4DR1L 1RIPA 2YTXA 4AIMA 4DAYB 4Y52H 1EFWA 3KOJA 2UXDQ 1KXLA 4YCVA 1IBLQ 1TWHH 4AYBE 4DV7Q 5IYCG 1LM0A 2H5XA 1HNZQ 3FHWA 4UP8A 4DUYL 4LUZA 5M3MH 2ID0A 3KDFA 4JI5Q 4DR3Q 5IYDG 5HGQA 4HIMA 4A3EG 1TXYA 2F4VL 3IRBA 1JJGA 2UU9L 4BBSG 3F1ZA 3RN2A 2Y0SG 2ALYB 4QL5A 3J80c 4PMWA 3T1YQ 3I4MH 4X6AH 2MO1A 3A74A 2KENA 4GLVB 4LFCL 3I7FA 4JOIA 4A75A 3KF6B 4A3KH 3JC66 2UU9Q 3ZJYC 2F4VQ 3GTGH 2DUDA 1T9HA 3GD7A 4LF6L 1C0AA 2JK8A 2ZM6L 3CPWA 4C3IH 2JJQA 4A3LG 3AYHB 5ELNA 4HIKA 4LF6Q 1X3EA 1Q7YC 4P75A 3CCEA 2ASBA 3GTQH 1E7ZA 4JBMA 3G4SA 3HKZE 2N49A 2JEBI 1YJ9A 5JJIA 2K5NA 2KHIA 1PYSB 1KQSA 1K8GA 2R92H 2LXJA 4NPSA 5JJKA 1X65A 1HZCA 5IYBG 4LF4Q 1KRSA 1VQCA 1OXXK 4IO9A 4DR2L 3PO3G 3L2PA 2IT1A 1Q81C 1MIUA 3CC2A 1XPUA 4BXXH 4L5SA 1CKMA 2KCMA 3A5UA 4GNXB 3FKIG 4KHPQ 5FLXc 5C4JH 1YEZA 3JAMc 2UUBL 1HR0W 4DV0Q 2AKWB 1EIFA 1X55A 4JI3Q 2FXQA 3GTLH 2AHOB 5JJLA 3TREA 3K8AA 5J3BA 4GN3B 5IE8A 1XNRL 4LUVA 1YVCA 3RZOH 1N8RC 3GTJH 2VY3A 1VQLA 2B29A 3HOXH 1RL2A 1KRTA 3H3VH 2AWOA 1OTCA 4KHZA 1LYLA 3HKSA 1PH8A 4DV1L 4JI8Q 3VDYA 2A19A 1FVIA 3CCSA 1B70B 4JI0Q 2BA1A 1VQ4A 3CCLA 4IJLA 3J7A5 2K5HA 2ES2A 1W2BA 5AJ3L 3OW2A 3GTMH 1QVCA 4UY8C 2I0QA 1Z9FA 4IOCA 1K0RA 1VQGA 2IX0A 5AJ3Q 2RHQB 1VQFA 4HIDA 2JA6H 1UE5A 1L1OC 4B3SQ 3HOZH 4A4IA 1VQ5A 5M3FH 2VUMH 1I94Q 1HZAA 4JI2L 3KF8B 4YY3Q 4A93G 2N78A 1VQBA 2V1CC 2YU9H 2ATWA 2CWPA 2PI2E 4MNOA 4NXNL 4C2MH 1Y1VH 2JA5G 2Q2UA 4GLAC 1I50H 1PH9A 4A3IG 2JA9A 4BBRH 5C0XG 4GN5A 1Q8KA 1FGUA 1JE5A 3PUZA 1YITA 4AYBG 1PH3A 2VQFL 2D0PA 1XMOQ 1XNQL 4A3BH 1R9TH 1FJGQ 4GKJL 3PCOB 1YZ6A 1B8AA 2E2IH 2KBNA 4A3JH 2RF4A 1VQAA 4OXPA 4AQYL 2I5LX 4X64Q 4DV3Q 5C0XI 4A3MG 2IY5B 4BY1G 4DKAC 2Q2HA 3PIOA 4DUZQ 3CAMA 4AQYQ 2MNAA 1WOCA 1S40A 4BA2I 3J80i 3TRZA 5C4XG 1CKOA 2BH2A 3T1HL 2CQOA 4GOPA 1BKBA 2EIFA 2R93H 3W5OA 3NEMA 2VQEQ 5LMNQ 3CW2C 1SFOH 1YNXA 3ULPA 4QQBX 2YV5A 2EQSA 1GM5A 2XTIA 4JI4L 4JCVE 5M5XH 3CCMA 4DR5L 1IBKL 3I4OA 3HKZG 5C0XJ 1Y1WH 2PI2A 3I55A 5LMUQ 3CCVA 1PHJA 4L5TA 1TWCH 4JI4Q 4DR5Q 1IBKQ 2B63H 2NVTH 1N34L 1OXVA 5GAHC 4R4OA 3HOYG 4FDBA 3HOVG 4R4IA 3PUVA 3GTKH 2UXDL 3E0EA 3M4QA 1IBLL 5FJ8H 3U4ZA 1CKNA 1AH9A 5FLMG 5ELOA 2JE6I 2WB1E 2WFWA 4APVA 4A3GG 4HIOA 4R4TA 2OQ0A 4A3CH 3MEFA 3S1RH 1V1QA 1I5FA 4JI5L 3JAMi 4DR3L 3KJOA 1TWFH 1JMCA 1GO3E 1PH2A 1NJIC 5GROA 3U4VA 3T1YL 1K8AC 3EBEA 4DR7Q 4LNQA 3CF5A 3PF5A 4L5RC 1HNWQ 1P16A 1N33Q 4XIGS 4YCWA 1HZBA 3HOYH 2VNUD 4DV5L 1L2FA 4LF7Q 3K7UC 3ULJA 2ZJRA 1N36L 5IP9H 1WCMH 1X56A 2CWAA 1VQ7A 2KCTA 5M3MG 4DV5Q 4WJ4A 1IZ6A 1E24A 3Q8DA 1N36Q 3F2DA 2ZJPA 4XTCS 3GO5A 5C44H 3CCRA 1YHQA 4B3ML 4WJ3M 3UDFA 1O7IA 2NN6G 3E9HA 4YWKA 5C3EH 1XMQQ 2YTVA 4B3MQ 3I4MG 4R4QA 2E2HH 1WJJA 4A3KG 2NVXH 4LF5Q 4LF4L 4HJ9A 2PNHA 1VS0A 4QGUA 4JI7L 3PIPA 1M1KC 4IPGA 3UE0A 5IWAQ 1Q82C 1X9NA 2NN6I 3CC4A 4JI7Q 4YWLA 2ZTCA 3E9IA 3TS0A 4KHPL 2K14A 4O0AA 4A3DH 3STBC 1BBWA 3KF6A 1YI2A 2D0OA 4O2DA 3F2BA 3TEHB 4DV0L 3H15A 4JI3L 4UP7A 4HJ8A 4UPAA 2IX1A 1L1OB 1QVGA 1QUQB 2R92G 3S15H 1VQPA 5IT9c 1EQQA 1NMGA 2PMZE 1PYBA 4JOIC 1MJEA 4QJFA 3U58A 2HQLA 4OWWB 2DGYA 4POGA 1A0IA 2K52A 3BZKA 4OONA 3BZCA 4JBWA 1BBUA 2VS1A 3NELA 3PUWA 5GAEC 1GD7A 1IBML 2HIVA 3GDEA 2NVYH 4LW1A 3UDIA 4BXXG 1E22A 4KI0A 1MKHA 2OTLA 4JI8L 2C35B 1B7YB 2IHEA 4YHHL 1IBMQ 4JI0L 4JI6L 2VZAA 1VCIA 3PF4A 1VQ8A 1NTGA 3RNUA 1SE8A 4IOAA 4YHHQ 4JI6Q 5IP7H 2NVQH 1TWGH 4LFBQ 3CMAA 4GNXA 3S1MH 1TWAH 4TVAB 3G6EA 3H0GH 1PH5A 2B3GA 4LF8Q 5H1SE 3HOXG 4DV4Q 1HJPA 3CCQA 1MJCA 4B3SL 3M85A 1Z47A 1OXTA 4DR6Q 4LUOA 2HIXA 2UUAL 4A3FH 1I94L 1HZ9A 4DNIA 1PH4A 3F8TA 3M4PA 4YY3L 3J81c 2YYZA 2UUAQ 3HOUH 3S16H 1V9PA 1IXRA 5M5WH 1YJNA 1PV4A 3U50C 5BR8Q 3H3VI 3EN2A 1G6PA 3OTOL 4DK6C 1V43A 1PFSA 3KYHC 4PZ7A 4DV6Q 1VQOA 4GN4B 3OTOQ 2JA6G 3HOZG 2OTJA 1VQJA 1XMOL 2PQAA 4QY7A 1NE3A 5M3FG 4TQUS 4B3RQ 2JA8H 2VUMG 2WB1G 4EX5A 1FJGL 2QGQA 1I3QH 3OYYA 4LFAQ 4X65L 3G71A 1EWIA 4X64L 4DV3L 3I4NH 2UXBQ 1Q12A 1Y1VG 4DUZL 5M5YH 1D8LA 1KHIA 1DGSA 4X65Q 1LTLA 2A1AA 4PZ6A 4HJ7A 4ME3A 4BBRG 3M7NA 2R7FA 4K0KQ 1Q1EA 4DAMA 3A5ZB 4R1JA 3KLWA 1CSPA 4P71A 2AMCB 3S1QH 2YTYA 1X3GA 2Z0SA 1J6QA 2I5HA 4JG2A 2VQEL 4AH6A 5LMNL 1K73C 3HOWH 3ICEA 4A3BG 5EAYA 4HJAA 4A3JG 4B3TL 1ASYA 5LMUL 4NB3A 1KD1C 4B3TQ 4KLKA 2L15A 2I5MX 2RCNA 2ZTEA 1PH7A 3ULLA 4GLXA 1ASZA 3GTPH 2K5VA 2K4KA 1K9MC 1BVSA 4DPGA 1KIXA 5GAGC 2R93G 2RHSB 2JA7H 1EOVA 3PSIA 1J5EL 1VQNA 3CCUA 4DV2Q 1VQKA 1NY4A 1Y1WG 2R7ZH 3B6YA 3L0OA 2Q2IA 3K81C 3MXNB 1EYGA 1CUKA 5IY0A 1J5EQ 2ZJQA 4BY7H 4BA1I 3ERSX 2B63G 4LWCA 1NBWA 3K80C 2UUCL 1VQMA 2WP8J 3CD6A 4DR7L 3KDFB 3AFQA 4GOPC 2UUCQ 1HNWL 5FJ8G 4H02A 1GVPA 2ZTDA 1N33L 1KAWA 2K75A 4LF7L 4OO1G 5IYCH 2R6GA 4A3CG 1HR0L 1JT8A 1XPRA 3M3YH 1A8VA 3RZDH 2OQKA 3CCJA 3UE1A 3HFZB 3CQZH 2WAQE 4X66Q 1XMQL 1HR0Q 1IL2A 3S2HH 5IYDH 4A3EH 1OXSC 3ER0A 2D62A 1PA6A 4BBSH 4OO1I 3S14H 4IPCA 4LF5L 2Z6KA 4MZ9A 1S3OA 4DR1Q 3AFPA 1UE1A 4LF9L 2UXCL 3NBHB 4IJHA 5LMNW 1C7YA 2CKZB 3GTOH 3PUXA 5IP9G 1WCMG 5IWAL 4LF9Q 2UXCQ 4DUYQ 4A3LH 1PH1A 5JEAG 1QZHA 2N3SA 3RLNA 2GN5A 5C44G 3S17H 1XJVA 1VQ9A 1OXUA 1UEBA 5C3EG 3J81i 3RLOA 4JBKA 4POFA 2IHFA 2MFIA 4IPHA 1X6OA 3PO2H 1EIYB 4GKKL 4L5QA 4LFCQ 1JJ2A 5IYBH 3STBD 3KJPA 3PO3H 2ZM6Q 4GKKQ 1XPOA 1U5KA 2GVAA 4C3HH 3M4OH 1HH2P 1G51A 4A3DG 4A76A 2AWNA 3FKIH 3PV0A 5GQOA 4PG3A 1EUJA 3PO2G 3AQQA 1UE7A 1AE2A 2Z6KC 3J7ZC 1Q86C 1M90C 2VW9A 4LFBL 2NZHA 4HJ5A 1JB7A 1NMFA 3EIVA 4RMFA 4P72A 4YWMA 1VQEA 5JEAJ 4NXML 5GADC 1LUZA 4DR2Q 4JV5L 4LF8L 1SMXA 3RR5A 4DV4L 3SGIA 4UP9A 5K36G 4R4CA 3I56A 3D31A 4NXMQ 1P8LA 1L1OA 5DLQE 1QUQA 4DR6L 1I6HH 4JV5Q 1GKHA 3RLFA 3TQYA 1A63A 2UUBQ 4OX9L 3CPFA 3CP0A 1D7QA 2BA0A 2E8GA 1N9WA 1VQDA 4JI1L 2CFMA 5IP7G 5BR8L 5HY6A 2E5LL 1E3PA 2Y0SE 4OX9Q 1XNRQ 3AEVA 3NENA 3I2ZA 1SRUA 1VQIA 1QVFA 4JI1Q 4JYAL 3H0GG 1YJWA 4DV6L 2E5LQ 4P73A 2A8VA 3PUYA 2LXKA 3L7ZC 4JYAQ 1G291 3CC7A 4A3FG 1CSQA 1S72A 2PQAB 1KL9A 1YBYA 4DV1Q 2LSSA 2N8NA 4LFAL 3K7AH 2MO0A 2KHJA 3HOUG 4A93H 2BH8A 2QA4A 4J15A 2JQOA 1Y14B 3KFUA 2UXBL 1VQHA 3J81j 1WFQA 2CCZA 4GNXC 2JA5H 4EQ5A 2VL6A 1HNXL 4PZ8A 4GS3A 3CMEA 4RG1A 4A3IH 4K0KL 1JJCB 1WI5A 3A0JA 3TS2A 4B3RL 1YHAA 2QEXA 1HNXQ 2JA8G 2OCEA 3UDXA 1SN8A 1KC8C 2Q2TA 1IYJB 4C3JH 1K83H 1C9OA 3BJUA 4JI2Q 1UWVA 4IFDG 4GOPB 2F52A 1E1OA 2OWOA 3I4NG 4OWXB 2WAQG 4A3MH 1QZGA 4NXNQ 4Y7NH 3G48A 3WWVA 3BU2A 1Q1BA 4BY1H 1K3RA 3DM3A 4JBJA 3W1BA 1PH6A 1XTDA 1VQ6A 5C4XH 2MQHA 2VQFQ 3K0XA 1X3FA 1U0LA 4IPDA 1XNQQ 4DK3C 2JEAI 3HOWG 4IFDI 2R7DA 1A62A 4GKJQ 4DV2L 3LGJA 3F2CA 1PVOA 3CXCA 1H95A 1UE6A 2E2JH 3S2DH 4DR4L 3W1GA 1CKNB 3S1NH 1WYDA 1SR3A 3D0FA 3RN5A 4DR4Q 2HT1A 3FP9A 4OWTB 1W3SA 2NZOA
chains in the Genus database with same CATH superfamily
5KNBA 3HOVH 1S5BD 4QB4A 1AE3A 3R2IA 1FL0A 4C1NI 3BYTB 3SK5A 4JC0A 1SYEA 1PTOF 1N32L 2Z6BA 1LTTD 1OO9B 4BY7G 3C1FA 3M9BA 4X62L 3HOXB 1PFBA 1SLJA 1SMYD 1EQRA 3E5SA 4MTNA 1I4PA 1HXYD 1HNZL 2YTXA 5CV8A 4AIMA 1K3BC 2HQEA 4AYBE 5DM73 5IYCG 1B3QA 4DK0A 5CGKA 5LL6S 4XYOA 1EY4A 4LUZA 5M3MH 3HOZB 4DR3Q 3MFYA 5IYDG 3DEPA 3S16B 5M5WB 3RN2A 1KXLA 4X6AH 2MO1A 3FEWX 4LFCL 1O7ZA 3GP7A 1FNVA 4H44C 4JOIA 3K57A 4A75A 2F4VQ 2ZT9C 3GTGH 2FMMA 2IPKD 1T9HA 2MGSA 2ZM6L 4BBRB 3AYHB 3N6RA 3NWTA 2AQ3B 4A3BB 3NBHA 2KHIA 3NUCA 1KQSA 1K8GA 1EU4A 5JJKA 3NTIA 1VQCA 4V0BA 1Q81C 1F77A 4BXXH 2GA4B 5EKLA 5LHY1 4UAIA 3A5UA 3FKIG 4CJ2C 2UUBL 2R93B 1HQMC 2F0GA 1SYGA 3TZUA 4G7ZC 1EIFA 1ZXTA 3TP8A 4KY7A 2AHOB 5M5XB 3K8AA 4HSPA 5IE8A 2XNAC 3RZOH 5I9OA 3VYUA 3ERQA 2VY3A 4OIKA 1TWCB 3W2DA 1VQLA 1ICFB 1X3PA 5C4HA 3H3VH 5I2XA 1OTCA 1XTCD 1JWUD 1G8ZD 4J8QA 1JC7A 1PH8A 4DV1L 2RDGA 3CCSA 3R3OA 3ND9A 3CCLA 2B2WC 3NHHA 3J81L 4H0LC 5C4ZA 1TWFB 3VR3A 1K0RA 4IOCA 2IX0A 4M1UB 1VQFA 1L0YB 2K5WA 1DJRD 3CKIB 5M3FH 2VUMH 3VR2A 2F3VA 4R8NA 1TVXA 1VQBA 2X6GA 2C9OA 4NXNL 1PFMA 1F9PA 1STEA 5KNDA 3D3RA 3LWUA 4GN5A 1Q8KA 5EPLA 2D0PA 1I4HA 1AW7A 2NVXB 4KV6A 4IN3A 1EY9A 3PCOB 1YZ6A 2KBNA 1F2MA 4A3JH 4AQYL 1SSOA 4NW2A 4DKAC 1QB5D 4A3DB 5C5LA 3J80i 4RHRA 5D3DA 3OHXC 5CC4A 2BH2A 3S15B 2CQOA 4GOPA 4RGMA 2F0IA 3W5OA 3NEMA 5LMNQ 3CW2C 3ULPA 2EQSA 1E2VA 1GM5A 1PTOH 3CCMA 3HKZG 5C0XJ 3I55A 2NVYB 1S5DD 3DWAA 4L5TA 4DR5Q 1IBKQ 1OXVA 4R4OA 1ESFA 3P1HA 3OMCA 5CYUA 2VXWA 4L8JA 3E0EA 2PO4A 5FLMG 1PZKD 5ELOA 3D4DA 4OELB 4RA8A 4R4TA 4RFBA 4ZQ3A 2A6EC 2FHTA 5EPKA 4A3FB 1HUMA 1JMCA 3N52A 5KYIA 2SEBD 3CRKC 3NBIA 5GROA 3U4VA 2DJFC 3EBEA 5C3WA 3CF5A 4L5RC 1P16A 1KTKA 1HZBA 4Q0FA 3TBIB 1L2FA 3NQIA 3ULJA 4I7AA 2CWAA 4DV5Q 5JEAH 3CCRA 5C44H 3GO5A 1YHQA 4LAAA 2JA8B 1O7IA 4RGOS 5C3EH 5T1IA 4R4QA 3CHBD 4A3KG 4ZKBB 4HSVA 4LF5Q 4B9WA 3I4NB 2WAQB 3QWNA 5CV6A 1M1KC 1F9RA 3UE0A 4PQXA 3TS0A 3T56B 3KF6A 2D0OA 4O2DA 4IUTA 3GV3A 4UP7A 3I91A 1A3VA 3VR5A 2R92G 1QUQB 1SNQA 1IW7C 2PMZE 5EKIA 1STYA 1JOKA 4XXEA 2L12A 1A0IA 2K52A 4Z9CB 4HTHA 3BZCA 1BBUA 5GAEC 1IBML 3GDEA 1RJTA 4O1NA 4JI8L 2JXMB 4YHHL 4JI6L 2VZAA 1VCIA 4IOAA 2R7ZB 1PDQA 1QCBD 3CMAA 1WVLA 4TVAB 1B3AA 2PZUA 3H0GH 2F0MA 1PH5A 2WKDA 3HOXG 4RH6A 2RQXA 1PYWD 4FO2A 2UUAL 1U9RA 1I94L 5CR3A 1PH4A 3F8TA 1VDZA 4YY3L 3J81c 3HOUH 1NAPA 3K59A 3Q24A 1IXRA 2FFKB 5BR8Q 3LWEA 3MVVA 2WACA 3H3VI 4DK6C 4B08A 3OPOA 4DV6Q 4A3EB 3HOZG 1XMOL 2F0EA 2Y0SB 4QY7A 2QGQA 1I3QH 2AQ2B 1R4PB 4X65L 3G71A 4X64L 1SEBD 3KLRA 4DUZL 1KHIA 2A1AA 1EOTA 1MBYA 2M00A 4BBRG 2R7FA 4K0KQ 2MJ8A 2B8GA 4A3BG 2YTYA 3D4RA 4WRDA 1FNWA 1QG7A 2E74C 4HJAA 4CJ1B 4C3HB 4FF4A 3LX0A 4CHTB 1KD1C 2L0CA 1LABA 1W6JA 2K5VA 4LMQD 1K9MC 5JVG3 2K5DA 4K2LA 2R93G 3PSIA 1VQNA 1EY6A 1VQKA 3K81C 3DM1A 3MXNB 5ISRA 1UUPA 2E2DC 3ERSX 4LWCA 1MSGA 2UUCL 1VQMA 3SR1A 4DA2A 3WOEA 1GVPA 2ZTDA 1DONA 1KAWA 4R8IA 4LF7L 4OO1G 1SMYC 5FK9C 3MEHA 1HR0L 2CVRA 1XPRA 1CT1D 4KY5A 3RZDH 3HFZB 3CQZH 1XX8A 2L11A 1IL2A 4C1NK 2NYZD 3TDQA 4IPCA 2KJXA 3MHBA 2SNMA 4LF9L 5CV9A 1NCVA 3I3CA 2CKZB 3PUXA 5J39A 5IGBA 2UXCQ 3UI2A 3T4AC 5M3FB 3MZ5A 1JICA 2PNRC 1JWSD 1UEBA 4FXKC 4JBKA 5FO8B 3PO2H 4LFCQ 4A3MB 3KJPA 4G57A 3PO3H 2ZM6Q 2OF1A 1LACA 3M4OH 1EZ8A 3SK6A 3MC0B 4QMGA 4A3DG 4PG3A 3I73A 4G7HC 4QUFA 2VW9A 3JAML 4LFBL 1CHPD 2E2JB 2NZHA 3BVZA 1VQEA 1F2LA 4LF8L 3RR5A 4DV4L 3I56A 2RBMA 2XWJB 3D31A 2OEOA 4JV5Q 1QWYA 5I9PA 1B50A 1DOMA 2D2CC 1ET9A 3TQYA 1PTOB 4CDDC 2UUBQ 1TIID 4LJZC 2E8GA 1N9WA 1VQDA 4A3GB 1I6VC 5IP7G 2E5LL 1E3PA 2F0OA 4OX9Q 4DAPA 3NENA 3I2ZA 3BDLA 4JYAL 4CJ0B 2A8VA 1H9SA 4A3FG 1CSQA 1ML0D 4DV1Q 1TWHB 4KKUA 4RCOA 2N8NA 3K7AH 4A93H 4J15A 2JQOA 5IOCA 2B2VA 3J81j 1SYFA 4GNXC 2V4DA 5EPJA 3CMEA 1ZYRD 4N9PA 5C0XH 3A0JA 3TSSA 3TS2A 1HNXQ 3NSWA 1EQTA 2JA8G 3I4MB 1PLFA 2ZXRA 1SN8A 1KAAA 4C3JH 3BJUA 4C3IB 3I4NG 1STNA 2WAQG 4NXNQ 3HRZC 3GTQB 5G3LF 3J7AV 4JBJA 1PH6A 1I4GA 1XTDA 5C4XH 3E6ZX 1Z6HA 1VF7A 4IPDA 3VYRA 1E0BA 3R93A 3L3OC 4XQQA 1IYVA 2A5HA 3PIO3 1I4XA 1CKNB 4PMCA 4DR4Q 1O80A 1W3SA 1JOOA 3HOYH 1SROA 3BDCA 3MWYW 3AMUA 4FXGC 5KRUA 2XGTA 3DLLA 2K50A 2BE5C 3GTJB 3JAME 2R7ZG 4RAUC 5D3IB 1XXGA 2SOBA 1YIJA 2XRQD 5E7NA 5KIXA 1WTOA 4ALPA 2F3IA 1E1TA 1Q46A 2EXDA 2HHHQ 4N9TA 1X54A 1Y8NB 1HTLD 5AFWA 2NWGA 1TY2A 3KOJA 4DV7Q 3GTMB 1KNEA 1LM0A 1LT6D 2H5XA 4RKBA 4DUYL 1IYUA 2EY5A 2JA6B 2ID0A 2RVLA 1PZID 3A54A 4F87A 4A3EG 1TXYA 1JJGA 3IRBA 4RWSC 2NN6H 2UU9L 1QNUA 3MAQA 2Y0SG 2ALYB 3A74A 2KENA 3H94A 5DM63 2F03A 2DUDA 4ZK9B 3CPWA 1I50B 2K01A 1JCKB 2JJQA 3G7LA 4A3LG 4LF6Q 1X3EA 1Q7YC 4P75A 2ASBA 1E7ZA 4OGQC 3HKZE 3I72A 5KYLA 1R9TB 2JEBI 2PW5A 2KQ3A 5JJIA 2JSOA 1FR3A 3C2PA 2E2IB 3FPUB 5IYBG 4IO9A 1CA5A 5CMDA 4C3HG 2XVSA 4J1MA 2O5IC 4GNXB 3OMGA 2EY1A 3L9AX 3JAMc 3ZYYX 4IUPA 1X55A 3GTLH 3GQBA 5JJLA 5J3BA 4GN3B 1XNRL 5EBCA 1YVCA 4IALA 2NVTB 2FJ2A 3VR6A 3BVGA 1LYLA 1V1OA 2WINB 4JI8Q 2EPBA 3VDYA 2BA1A 1VQ4A 1TKWB 5BN3A 4IUQA 4TKOB 3S1RB 2IJ0A 2ES2A 1HA6A 3E0JA 1EWHA 1QVCA 1FGBD 3EQLC 5AJ3Q 2H4OA 1L1OC 3T13A 4A4IA 4OEMB 1I94Q 1SYBA 1HZAA 5ELDA 3KF8B 2F4IA 4YY3Q 2N78A 4DFAA 2YU9H 3RZDB 2F0TA 1NR4A 2PI2E 1PTOD 1Y1VH 5FO9B 4GLAC 1SDFA 1PH9A 1YITA 3PUZA 1JE5A 4EGVA 2K28A 4CBVA 1XMOQ 3EFXD 4CDCC 4PNYA 3Q6SA 2G9HD 1VQAA 4X64Q 4A3MG 5C0XI 4F8MA 3C3LA 2AQ1B 4DUZQ 4KTAA 1WOCA 1S40A 3PO2B 3OSOA 2VB3X 1CKOA 3T1HL 5I6YA 1BKBA 2EIFA 2EZVA 1SFOH 1YNXA 2YV5A 3FMCA 2XTIA 4JI4L 1GXDC 3I4OA 1Y1WH 1D2BA 2F1MA 3CCVA 1PHJA 1WTRA 2B63H 1N34L 5DNFA 3SK4A 4OHJA 1O78A 3PUVA 1TS4A 3GTKH 2NVQB 3I4LA 3M4QA 1TWGB 1IBLL 1EIGA 2LY7A 3BVMA 4EQPA 1TWAB 4A3GG 4HIOA 2OQ0A 1DOLA 3HS0C 4EQNA 2E76C 1NR2A 1VMPA 2IX3A 1I5FA 3KJOA 1GO3E 1HFGA 1K8AC 1LO5D 4LNQA 4FNFA 2VNUD 5TSSA 4LF7Q 3K7UC 2ZJRA 1N36L 5IP9H 1WCMH 1X56A 1VQ7A 2KCTA 1IZ6A 3NP8A 1XYIA 2ZJPA 3IKJA 4WJ3M 3K7AB 3E9HA 4B3MQ 4ABNA 3I4MG 2RCFA 2E2HH 4HMJA 4LF4L 1SYDA 1C4QA 2QW7A 4QGUA 3PIPA 4C3IG 2QCPX 1JOQA 1K8MA 2NN6I 1X9NA 3CC4A 4JI7Q 1GUWA 3E9IA 2K14A 3S1QB 1BBWA 4K5WA 2RA4A 3IFDA 4HJ8A 4ME5A 1L1OB 4KN4C 1EQQA 1NMGA 4JOIC 1JORA 4QJFA 3U58A 2HQLA 4DK1A 4POGA 1GD7A 4X3TA 3UDIA 1E22A 2C35B 2JA7B 1KLUD 1VQ8A 3RNUA 4LFBQ 2NUCA 3S1MH 3G6EA 1ENCA 4LF8Q 4NMZA 4DV4Q 1C48A 1HJPA 2QILA 1D6EC 3U9SA 4BWGB 1HZ9A 4DNIA 1HTPA 1PZJD 3NQTA 2YYZA 1PV4A 1EY5A 3M3YB 1HA5A 3OTOL 1G6ZA 1RHPA 4PZ7A 3S2HB 4GN4B 2JA6G 2OTJA 1VQJA 4BBSB 2PQAA 3S14B 1PRTD 2R3ZA 4EX5A 1FJGL 3OYYA 1ZYRC 1SNPA 2A69D 3GTOB 4DV3L 4QUCA 5M5YH 2OXPA 3QO2A 4HJ7A 1Q1EA 4DAMA 1UNSA 4P71A 2AMCB 4JG2A 3HOWH 1K73C 1AFPA 1Z7TA 5EAYA 4B3TL 1NSNS 1CI3M 1ASYA 2KA7A 2RCNA 2O2LD 1PH7A 4GLXA 1TS2A 3GTPH 2K4KA 1BVSA 1PRTF 4DPGA 1KIXA 1J9OA 2NB0A 1J5EL 4UDUC 1NY4A 3Q0AA 5HURA 1I4QA 4BY7H 2Q2IA 1CUKA 1I6HB 4G4KA 1TR5A 2CH4A 2VB2X 4XQJA 3K80C 2WP8J 1GUTA 1CZGA 5M9OA 4GOPC 3H91A 5FJ8G 5IYCH 2R6GA 4QIWB 3D6WA 4A3CG 1VF5C 4FF1A 1WD0A 2Z9HA 2OQKA 5I2YA 2WAQE 5IYDH 3J81E 4DAYA 2LS01 4MZ9A 5L37A 3NBHB 3J80L 5FO7B 2JA5B 4P2CB 4N8X1 5KEEA 4K5VA 4DUYQ 4KMUC 4A3IB 2NBFA 4K8IA 2GN5A 3S17H 1XJVA 1RTOA 3RLOA 1KLGD 4KD3A 1MHWC 2MFIA 1Y1VB 4YIJA 3H3VC 2QKIC 4BY1B 1A15A 4GKKQ 1H9RA 1U5KA 1HH2P 1G51A 3A8KE 2AWNA 3FKIH 4XT3B 5GQOA 3PO2G 3AQQA 4HN7A 1UE7A 1AE2A 3J7ZC 5FLXL 4HEDA 2K32A 1M90C 2EJFC 3CRLC 4ZLTF 4HJ5A 5E1FA 3S2DB 1NMFA 2D9UA 3EIVA 4LK1C 3S1NB 1SMXA 3SGIA 4UP9A 5K36G 4R4CA 2KOLA 4NXMQ 4DR6L 3HOVB 1IKMA 5DEHA 3SEBA 1A63A 3S9WA 1RKNA 2G9DA 2EYLA 2BA0A 2H1EA 4JI1L 2WV6D 4RGNA 5C6AA 2WKCA 3W3AA 1JB3A 1STHA 2Y0SE 1RCVD 1XNRQ 1QVFA 3AEVA 1DD2A 1YJWA 4P73A 3SDZA 2F3WA 5ELCA 4K6LA 2PCFB 1QJOA 1G291 3CC7A 1SNMA 2PQAB 1YBYA 2LSSA 1ILPA 1IHZA 2KHJA 2ZXPA 3A55A 3A8JE 2UXBL 1Y14B 1DZ1A 3FPPA 1VQHA 5M3MB 4EQ5A 4PZ8A 4GS3A 1VMCA 4KKSA 1JJCB 5DAUA 1YHAA 1PTOC 3UDXA 5NUCA 3GTGB 2PZWA 1K83H 4IFDG 4GOPB 2F52A 1GOZA 1QZGA 1HQRD 4Y7NH 3WWVA 3BU2A 1Y69U 5F2DA 3SXHA 3KK7A 3K0XA 1X3FA 3I90A 2A73B 1EY8A 2R7DA 1LV9A 4DV2L 1YNJD 5BN5A 3D6CA 3MXPA 1D1KA 2HT1A 1HUNA 1MSHA 2NZOA 3PGZA 2F0FA 1LT4D 3T1HQ 2JA7G 5FLMH 3RZOB 3DMUA 5CV4A 3UDGA 1D1IA 1SJED 4P74A 4YCUA 1N32Q 2GVBA 4X66L 4X62Q 2KHSA 2PYKA 1N34Q 3M7GA 1ENAA 4O42A 5CBAE 3NXWA 4H7BA 1RIPA 4WJWA 4DAYB 4FVMA 1EFWA 3VYSA 1IBLQ 5EJWA 1RTNA 1HNZQ 3FHWA 3DXJC 4UP8A 3FRPB 1EWCA 3KDFA 1LTID 4UHVA 1H9MA 2VUMB 2WB1B 4HIMA 2F4VL 1F2ZA 4BBSG 3F1ZA 5J1ZA 3J80c 3I8ZA 2L1BA 2PW7A 4GLVB 4A3KH 3HZXA 3KF6B 3JC66 3ZJYC 3GD7A 2DN8A 2ICEC 4H13C 2DY7A 3CCEA 2N49A 2L4NA 1YJ9A 2K5NA 2QF7A 1PYSB 3RMHA 2R92H 2LXJA 4A3JB 2EJGC 2F0WA 1HZCA 1GUGA 1STBA 4LF4Q 1OXXK 5IT9L 2IT1A 1MIUA 1G2TA 2B2YA 4CDEC 5FLXc 5C4JH 1YEZA 1AEXA 1CTMA 1JQYD 1HR0W 1S5ED 3TP7A 4X3KA 2M2LA 2JP1A 3V2TA 3TREA 1WTVA 1SNDA 5ELEA 3GTPB 1EY0A 4XYQA 3HOXH 1RL2A 5G3LD 2AWOA 4KHZA 1SXTA 4MN3A 3HKSA 3WDNA 4ZRZA 4HR7B 5CV5A 3QG1A 2A19A 1FVIA 1B70B 5C5MA 3J7A5 1FD7D 3TMEA 1W2BA 1B9NA 1LTBD 1Z9FA 4MHEA 1VQGA 4RCNA 4OL7A 3HOZH 1UE5A 3DHQA 2DJGC 2K33A 2LMCB 1VQ5A 2RSOA 2B2TA 2KCNA 2QDLA 1R4QB 1X32A 2Q8TA 2CWPA 3O13A 4C2MH 5JAVA 1PRTC 1NUCA 2JA5G 2Q8IB 5C44B 1DM0B 4A3IG 2JA9A 4BBRH 2F0SA 5C3EB 1PH3A 2A69C 2VQFL 1XNQL 4A3BH 5FOBB 1FJGQ 3J7AF 4GKJL 1UEAB 1ICWA 1W6KA 4OXPA 2EE1A 4DV3Q 1PMRA 2B2VC 4BY1G 2LFNA 4FF2A 1SE3A 4AQYQ 1GHKA 2FINB 3G6JB 1BNZA 2R93H 1BCPD 1SE2A 4QQBX 1CZWA 3A8IE 2QDBA 5IODA 4JCVE 5M5XH 4DR5L 5E4XA 1IBKL 4MTKA 2PI2A 4ZAIA 5D65A 1TWCH 5IT9E 1SE4A 2R61A 3QOLA 4FDBA 1V1PA 2F0LA 3HOVG 2IW3A 4DNTB 2UXDL 1LTGD 3U4ZA 1AH9A 2JE6I 4OO1H 3FDTA 2WFWA 4APVA 3H0GB 2TSSA 3MEFA 2Z1CA 1V1QA 4JI5L 1TWFH 4X3UA 1NJIC 1PXUA 1QOHA 3T1YL 3HOUB 1YNND 3C46A 1WTQA 1BCPF 4XIGS 4DV5L 4R9WA 4FYDA 3SVMA 4G7OC 1E2ZA 5M3MG 2F0HA 2N88A 1E24A 5A35A 3F2DA 2EYMA 1I3QB 3UDFA 1F9QA 1A2UA 4YWKA 2X69A 3DWPA 2NVXH 1WJJA 4HCSA 4HJ9A 1VS0A 4DNRB 3QIAA 5LL6X 2C5CA 2BCOA 4IPGA 4TSSA 1Q82C 3OOCA 2ZTCA 4KHPL 4A3DH 1YI2A 4DV0L 3TEHB 4JI3L 2Z4HA 2IX1A 3S15H 1QVGA 1VQPA 5IT9c 1PYBA 3MTSA 2QEJC 4EQOA 1Y8PB 3BZKA 1HCZA 2RSNA 4I65A 1CM9A 3NELA 1U4MA 2HIVA 4BXXG 2NVYH 4LW1A 1B4OA 1PRTB 1A3TA 2HCIA 4KI0A 5IGFA 1STGA 2IHEA 1IBMQ 4JI0L 2B2UA 3T53B 2P5ZX 1H9SB 1NTGA 1SE8A 3VA5A 4YHHQ 4JI6Q 5IP7H 1EL0A 1U4RA 2EY6A 1EIHA 2B3GA 3CCQA 1H9KA 4B3SL 1V8QA 3M85A 4DR6Q 2EJMA 2HIXA 4A3FH 1ZEQX 1M4VA 2KEEA 1FYCA 3HP3A 4ULLA 2UUAQ 1V9PA 1G6PA 5CV7A 1JWMD 1RODA 3U50C 1V43A 1GJXA 3CQZB 3KYHC 1VQOA 2PPBC 1NE3A 3KUPA 5M3FG 2IL8A 2JA8H 2VUMG 2WB1G 3MFGA 2IWHA 2SNSA 1WTPA 1EWIA 4KK7A 1BF4A 3I4NH 2UXBQ 3I70A 1D8LA 4X65Q 1DGSA 1LTLA 3M7NA 4ME3A 2JN4A 3A5ZB 4R1JA 1IKLA 2Z0SA 1J6QA 2VQEL 3OWEB 3ICEA 4U68A 4AH6A 1C8CA 3PO3B 4A3JG 1BXTA 1WTWA 2K7VA 3M4OB 5JPMC 3EJIA 5LMUL 3BG3A 4NB3A 5IGGA 4OIJA 4FF3A 1G91A 3P75A 2R92B 1ASZA 3WOFA 1YNJC 4KY6A 1CA6A 1V1PB 5GAGC 4WFN3 3CCUA 4DV2Q 2A68D 2CW0D 1LTAD 3B6YA 3L0OA 1BDOA 2R7ZH 5IY0A 4BA1I 4IUNA 2PQEA 5E3FA 1NBWA 3CD6A 4DR7L 3FVQA 1HNWL 2MPMA 5K5PA 2UUCQ 1N33L 2K75A 4DN4M 5COYA 3ONAB 1PFNA 1U4PA 1EZ6A 3UE1A 1S5CD 4X66Q 2F0QA 1XMQL 1HR0Q 4A3EH 1OXSC 3ER0A 1PA6A 1SNOA 4OO1I 4A93B 2Z6KA 1S3OA 1UE1A 2UXCL 4IJHA 4CGYB 2EVBA 3AU7A 5IWAL 4LF9Q 5IGEA 4A3LH 1ENFA 1PH1A 5JEAG 1QZHA 2N3SA 3X3MA 1STAA 4AYBB 5C44G 1D5ZC 1OXUA 5C3EG 3J81i 4C3JB 3D8GA 4C2MB 4IPHA 1HRJA 1EIYB 1KABA 1NNXA 3BDOA 3STBD 5IYBH 3TP6A 5ELFA 4C3HH 1B9MA 1B1ZA 1Q90A 5C4XB 3NTKA 2F0PA 1EUJA 4KJNA 1CFMA 2Z6KC 1Q86C 2B2WA 1JB7A 2DNCA 4RMFA 4ID6A 4YWMA 5GADC 4JV5L 2EOTA 3HOYB 1QUQA 3RLFA 3AB9A 5EGTA 4CKEA 4OX9L 1ZKOA 1D7QA 1RD9D 5ELBA 3K0YA 5HY6A 4HCEA 2JYOA 1ET6A 4L63B 4K14A 1VQIA 3H0GG 2E5LQ 1IL8A 1SBBB 3PUYA 1MGSA 4FP5D 3L7ZC 4JYAQ 3NE5B 5D14A 3VR4A 3V05A 2KVMA 1GHJA 4LFAL 3MXGA 3HOUG 2BH8A 3URYA 2EYHA 1EY7A 3KFUA 1WFQA 2CCZA 1A6XA 5BN4A 1TT2A 2VL6A 1HNXL 4RGTA 1TS3A 4RG1A 5IGCA 4B3RL 5JOBA 3TZDA 1KC8C 2Q2TA 1IYJB 5FKAC 1E2WA 1C9OA 2MUYA 1UWVA 2F0VA 1E1OA 2SDFA 4A3MH 4IUVA 3G48A 1CQVA 3BS1A 3IAYA 1Q1BA 3RUZA 3CU7A 3W1BA 1VQ6A 1TU2B 2VQFQ 1XNQQ 1U0LA 3KLSA 1A62A 2BOSA 2BDOA 4GKJQ 1PVOA 3LGJA 1HHVA 1H95A 2EDGA 1UE6A 2E2JH 2HCCA 4DR4L 1WYDA 1SR3A 2E75C 1BCPC 1BO0A 3FP9A 4OWTB 2Z8LA 5IGDA 2M9VA 3GTLB 4QIWE 4IFDJ 3SK8A 1BR9A 1YHBA 1L0WA 3U9OA 5EQ0A 4A3GH 2J7ZA 3S24A 2F0KA 2HHHL 2BE5D 1XWEA 4BS9A 1EEID 2L9HA 4DV7L 4DR1L 4Y52H 2ENBA 3MXNA 2UXDQ 4YCVA 1TWHH 2KUMA 2WIIB 1ILQA 4DF7A 2Z4IA 4JPBW 5KNCA 5KGUA 3DUZA 2NTTA 4RHSA 1YNNC 2EYJA 1H9JA 4KJOA 3T51B 4JI5Q 2XIWA 5HGQA 2Q8RE 1U4LA 2HDMA 5I4DA 1LT3D 4QL5A 1JE4A 4PMWA 1SNCA 4XDXA 4F88A 3SE0A 3T1YQ 2YU9B 3I4MH 3I7FA 2UU9Q 2EY2A 4F7XA 4LF6L 2EYFA 2RDHA 4TRDA 1C0AA 2JK8A 1HFNA 5T1GA 4C3IH 3K5LA 5ELNA 4HIKA 1KNAA 3GTQH 4JBMA 3G4SA 4IQZA 3Q22A 2ZXOA 4NPSA 2EXZA 3PIP3 1X65A 1KRSA 4KD4A 3PO3G 4DR2L 1D5MC 3L2PA 1K0SA 3CC2A 1XPUA 1B53A 4L5SA 1CKMA 1FNUA 2KCMA 2I07B 1AZPA 4KHPQ 2RDFA 2K05A 4DV0Q 1SFOB 2AKWB 4S3SA 4JI3Q 2FXQA 4KKTA 1Y1WB 1F2YA 3HG9A 4LUVA 3H09A 1N8RC 3GTJH 1BQQT 2B63B 2B29A 1T5XD 4PMBA 1KRTA 2X6LA 2PMZB 4ODGA 3GTKB 4JI0Q 2KECA 4IJLA 2CH4W 2K5HA 5AJ3L 3OW2A 3GTMH 3IFTA 4XQNA 4UY8C 2I0QA 4HIDA 2RHQB 2G5DA 2JA6H 4NP5A 4B3SQ 1BCPB 5EBDA 1D5XC 2D5DA 2O4XA 4JI2L 4A93G 2V1CC 2ATWA 1WCMB 4MNOA 3QB3A 2Q2UA 1I50H 2K04A 2XN9C 4DXGA 3K6OA 3J80E 5C0XG 1FGUA 2A6HD 4J6HA 2F0UA 3VYTA 4AYBG 1A2TA 2E2HB 1CK1A 1R9TH 3QR8A 4C3JG 5I6WA 1B8AA 1BUVT 4DU9A 2E2IH 3OWFA 2RF4A 1SYCA 2LKVA 2I5LX 2IY5B 3PIOA 2Q2HA 1MI2A 3CAMA 1II3A 1I4RA 1Q3LA 1KDAA 4DGZA 2MNAA 3TRZA 4K8JA 4BA2I 5C4XG 4X3SA 1WTXA 2FMCA 2F0NA 2HD3A 2VQEQ 1QE6A 4ZUJA 3PQIA 2MHVA 1TY0A 5CORA 5FLXE 3R8BA 5LMUQ 5A2QL 5HGTA 2CQAA 4JI4Q 2NVTH 2O5JC 5GAHC 3HOYG 4KHVA 2A68C 4V190 1KDBA 2CW0C 4R4IA 2AUKA 2TMPA 5FJ8H 1CKNA 3S1MB 4EVOA 2WB1E 1G2SA 4A3CH 3S1RH 3IL8A 3C1EA 1DXMA 4K6DA 1K28A 2CHBD 3JAMi 5EKKA 4DR3L 1PH2A 4DR7Q 2HDLA 1HNWQ 3PF5A 2F0DA 1N33Q 4YCWA 1EYAA 1A3UA 2XWBB 4WJ4A 3Q8DA 3HEJA 1N36Q 4B3ML 4XTCS 1WD1A 1XMQQ 2NN6G 1SAPA 1O7YA 2YTVA 1L0XB 3X3NA 1GUSA 2PNHA 1CQFA 4JI7L 2N55A 5M5YB 3EA6A 3LNNA 4GZYC 1HPCA 5IWAQ 4YWLA 4PV1C 2EYPA 4IZ8A 4O0AA 3STBC 4N8FA 3K58A 3F2BA 3HOWB 3H15A 4UPAA 2K03A 3KBXA 2K6AA 1MJEA 4OWWB 3K5MA 1X3QA 2DGYA 4OONA 3A7AB 4IUUA 4JBWA 4K5XA 2VS1A 3PUWA 4XT1B 5K36H 1MKHA 4IURA 2OTLA 1B7YB 4E6IA 3PF4A 3Q23A 2K1BA 3KLSX 2NVQH 4BY7B 1TWGH 4JW0A 1AP0A 4GNXA 1TWAH 3MA2B 1GUNA 2EYOA 4ZYSA 5H1SE 1MJCA 5JJZA 1Z47A 1OXTA 5A2QE 2B2YC 4LUOA 3EROA 1RF2D 3QJYA 3M4PA 3NPPA 5JVH3 3S16H 1CHQD 3NTHA 5M5WH 1YJNA 1F9SA 3EN2A 3MXUA 1PFSA 3J7YW 3ITPA 3OTOQ 3E3XA 1QILA 4TQUS 4RKLA 4LFAQ 4I7ZC 4IFDH 4FXDA 1QNKA 1Q12A 1Y1VG 3ND8A 2AUJD 3K5OA 4PZ6A 3S17B 1EEFD 5IIFA 1TS5A 4B9XA 3KF8A 4B3RQ 3KLWA 1CSPA 3S1QH 3VA7A 1X3GA 5LMNL 5J22A 2I5HA 3GV6A 4DAVA 2B2TC 2XRSD 2XSCA 3T16A 4B3TQ 3DEOA 2L15A 4KLKA 2I5MX 4DXFA 3FKIB 2ZTEA 3ULLA 2MP1A 1TQOA 3P20A 1RDPD 4U673 4NDXA 4K2KA 1B2TA 2RHSB 4ILWA 3R2TA 2JA7H 1EOVA 3QOJA 1Y1WG 2NTSA 3K5NA 1EYGA 1J5EQ 1EYCA 2ZJQA 1B44D 5E4WC 2B63G 1SJHD 3KDFB 4MIUA 3AFQA 2A6ED 4H02A 3SHLA 4Q5VA 1AZQA 5C3XA 4KN7C 1M8AA 1JT8A 2NZ1D 3M3YH 1A8VA 3CCJA 2B8FA 3V96A 3S2HH 1Q8IA 2D62A 1GUOA 4BBSH 3S14H 4LF5L 1KDCA 3P7JA 4DR1Q 2J4XA 3AFPA 5LMNW 1ESRA 4L6TB 1C7YA 2DY8A 2DNEA 5CBEE 1EYDA 1WCMG 5IP9G 3GTOH 1JR0D 1MD2D 1J8IA 3RLNA 1ONLA 1VQ9A 2F0JA 2I46A 4POFA 1K83B 1LLRD 2IHFA 2RKSA 1X6OA 4GKKL 4L5QA 1JJ2A 4Y7NB 3D4WA 3A56A 1XPOA 2GVAA 2A74C 4HMIA 1IW7D 4A76A 3PV0A 3A7LA 1T5EA 3EVQA 3RD4A 1BBXC 3OW7A 3HKZB 4CDFC 4P72A 5JEAJ 4NXML 1LUZA 4DR2Q 1DYQA 3F2UA 1LTRD 1P8LA 1L1OA 5DLQE 1I6HH 2L55A 1S4ZA 1LT5D 3OIPA 1BOSA 1GKHA 4WORA 3PMFA 1WTHA 3CPFA 3CP0A 3BZDB 2CFMA 1DCZA 4M8AA 4NKLA 5BR8L 1AN8A 4JK1C 1UAPA 3TN2A 1SRUA 4JI1Q 4DV6L 5JPNC 1EFID 1Y8OB 2ICIA 2L5TA 2LXKA 4CKCA 4ZKCB 2PZTA 2HUGA 1S72A 1KL9A 2B2UC 2MO0A 4QF4A 3TP5A 2QA4A 4C56C 2KCCA 2JA5H 1LTSD 1EU3A 4A3IH 4K0KL 1WI5A 3HGBA 2QEXA 3KBGA 2OCEA 3OIQA 4A3KB 1EQVA 3DWQA 2KEDA 4HAEA 4JI2Q 4ZUIA 4JVZA 1S5FD 3NK9A 2A6HC 2OWOA 4QCLA 4OWXB 4BY1H 4CKBA 3BYYB 3H6MA 1K3RA 3DM3A 2MQHA 1O7LA 2BDNA 4IFDI 3HOWG 4DK3C 2JEAI 3NWSA 2K5QA 4ZCKA 3F2CA 3CXCA 3S2DH 2OT2A 3M4YA 3W1GA 3S1NH 2B39A 3D0FA 3RN5A 1DOKA 5C4JB 2J0TD 1K8OA
chains in the Genus database with same CATH topology
3PGZA 1SROA 4QIWE 3HOVH 4IFDJ 1AE3A 3T1HQ 1FL0A 1YHBA 1L0WA 4JC0A 2XGTA 5FLMH 2JA7G 3DLLA 2K50A 1N32L 3UDGA 4A3GH 2R7ZG 3M9BA 4BY7G 3S24A 4X62L 4P74A 2HHHL 1YIJA 4YCUA 5E7NA 1N32Q 4ALPA 2F3IA 1SLJA 2GVBA 4X66L 1E1TA 1Q46A 2EXDA 4X62Q 1EQRA 1N34Q 2HHHQ 1X54A 4MTNA 4DV7L 1HNZL 4DR1L 1RIPA 2YTXA 4AIMA 4DAYB 4Y52H 1EFWA 3KOJA 2UXDQ 1KXLA 4YCVA 1IBLQ 1TWHH 4AYBE 4DV7Q 5IYCG 1LM0A 2H5XA 1HNZQ 3FHWA 4UP8A 4DUYL 4LUZA 5M3MH 2ID0A 3KDFA 4JI5Q 4DR3Q 5IYDG 5HGQA 4HIMA 4A3EG 1TXYA 2F4VL 3IRBA 1JJGA 2UU9L 4BBSG 3F1ZA 3RN2A 2Y0SG 2ALYB 4QL5A 3J80c 4PMWA 3T1YQ 3I4MH 4X6AH 2MO1A 3A74A 2KENA 4GLVB 4LFCL 3I7FA 4JOIA 4A75A 3KF6B 4A3KH 3JC66 2UU9Q 3ZJYC 2F4VQ 3GTGH 2DUDA 1T9HA 3GD7A 4LF6L 1C0AA 2JK8A 2ZM6L 3CPWA 4C3IH 2JJQA 4A3LG 3AYHB 5ELNA 4HIKA 4LF6Q 1X3EA 1Q7YC 4P75A 3CCEA 2ASBA 3GTQH 1E7ZA 4JBMA 3G4SA 3HKZE 2N49A 2JEBI 1YJ9A 5JJIA 2K5NA 2KHIA 1PYSB 1KQSA 1K8GA 2R92H 2LXJA 4NPSA 5JJKA 1X65A 1HZCA 5IYBG 4LF4Q 1KRSA 1VQCA 1OXXK 4IO9A 4DR2L 3PO3G 3L2PA 2IT1A 1Q81C 1MIUA 3CC2A 1XPUA 4BXXH 4L5SA 1CKMA 2KCMA 3A5UA 4GNXB 3FKIG 4KHPQ 5FLXc 5C4JH 1YEZA 3JAMc 2UUBL 1HR0W 4DV0Q 2AKWB 1EIFA 1X55A 4JI3Q 2FXQA 3GTLH 2AHOB 5JJLA 3TREA 3K8AA 5J3BA 4GN3B 5IE8A 1XNRL 4LUVA 1YVCA 3RZOH 1N8RC 3GTJH 2VY3A 1VQLA 2B29A 3HOXH 1RL2A 1KRTA 3H3VH 2AWOA 1OTCA 4KHZA 1LYLA 3HKSA 1PH8A 4DV1L 4JI8Q 3VDYA 2A19A 1FVIA 3CCSA 1B70B 4JI0Q 2BA1A 1VQ4A 3CCLA 4IJLA 3J7A5 2K5HA 2ES2A 1W2BA 5AJ3L 3OW2A 3GTMH 1QVCA 4UY8C 2I0QA 1Z9FA 4IOCA 1K0RA 1VQGA 2IX0A 5AJ3Q 2RHQB 1VQFA 4HIDA 2JA6H 1UE5A 1L1OC 4B3SQ 3HOZH 4A4IA 1VQ5A 5M3FH 2VUMH 1I94Q 1HZAA 4JI2L 3KF8B 4YY3Q 4A93G 2N78A 1VQBA 2V1CC 2YU9H 2ATWA 2CWPA 2PI2E 4MNOA 4NXNL 4C2MH 1Y1VH 2JA5G 2Q2UA 4GLAC 1I50H 1PH9A 4A3IG 2JA9A 4BBRH 5C0XG 4GN5A 1Q8KA 1FGUA 1JE5A 3PUZA 1YITA 4AYBG 1PH3A 2VQFL 2D0PA 1XMOQ 1XNQL 4A3BH 1R9TH 1FJGQ 4GKJL 3PCOB 1YZ6A 1B8AA 2E2IH 2KBNA 4A3JH 2RF4A 1VQAA 4OXPA 4AQYL 2I5LX 4X64Q 4DV3Q 5C0XI 4A3MG 2IY5B 4BY1G 4DKAC 2Q2HA 3PIOA 4DUZQ 3CAMA 4AQYQ 2MNAA 1WOCA 1S40A 4BA2I 3J80i 3TRZA 5C4XG 1CKOA 2BH2A 3T1HL 2CQOA 4GOPA 1BKBA 2EIFA 2R93H 3W5OA 3NEMA 2VQEQ 5LMNQ 3CW2C 1SFOH 1YNXA 3ULPA 4QQBX 2YV5A 2EQSA 1GM5A 2XTIA 4JI4L 4JCVE 5M5XH 3CCMA 4DR5L 1IBKL 3I4OA 3HKZG 5C0XJ 1Y1WH 2PI2A 3I55A 5LMUQ 3CCVA 1PHJA 4L5TA 1TWCH 4JI4Q 4DR5Q 1IBKQ 2B63H 2NVTH 1N34L 1OXVA 5GAHC 4R4OA 3HOYG 4FDBA 3HOVG 4R4IA 3PUVA 3GTKH 2UXDL 3E0EA 3M4QA 1IBLL 5FJ8H 3U4ZA 1CKNA 1AH9A 5FLMG 5ELOA 2JE6I 2WB1E 2WFWA 4APVA 4A3GG 4HIOA 4R4TA 2OQ0A 4A3CH 3MEFA 3S1RH 1V1QA 1I5FA 4JI5L 3JAMi 4DR3L 3KJOA 1TWFH 1JMCA 1GO3E 1PH2A 1NJIC 5GROA 3U4VA 3T1YL 1K8AC 3EBEA 4DR7Q 4LNQA 3CF5A 3PF5A 4L5RC 1HNWQ 1P16A 1N33Q 4XIGS 4YCWA 1HZBA 3HOYH 2VNUD 4DV5L 1L2FA 4LF7Q 3K7UC 3ULJA 2ZJRA 1N36L 5IP9H 1WCMH 1X56A 2CWAA 1VQ7A 2KCTA 5M3MG 4DV5Q 4WJ4A 1IZ6A 1E24A 3Q8DA 1N36Q 3F2DA 2ZJPA 4XTCS 3GO5A 5C44H 3CCRA 1YHQA 4B3ML 4WJ3M 3UDFA 1O7IA 2NN6G 3E9HA 4YWKA 5C3EH 1XMQQ 2YTVA 4B3MQ 3I4MG 4R4QA 2E2HH 1WJJA 4A3KG 2NVXH 4LF5Q 4LF4L 4HJ9A 2PNHA 1VS0A 4QGUA 4JI7L 3PIPA 1M1KC 4IPGA 3UE0A 5IWAQ 1Q82C 1X9NA 2NN6I 3CC4A 4JI7Q 4YWLA 2ZTCA 3E9IA 3TS0A 4KHPL 2K14A 4O0AA 4A3DH 3STBC 1BBWA 3KF6A 1YI2A 2D0OA 4O2DA 3F2BA 3TEHB 4DV0L 3H15A 4JI3L 4UP7A 4HJ8A 4UPAA 2IX1A 1L1OB 1QVGA 1QUQB 2R92G 3S15H 1VQPA 5IT9c 1EQQA 1NMGA 2PMZE 1PYBA 4JOIC 1MJEA 4QJFA 3U58A 2HQLA 4OWWB 2DGYA 4POGA 1A0IA 2K52A 3BZKA 4OONA 3BZCA 4JBWA 1BBUA 2VS1A 3NELA 3PUWA 5GAEC 1GD7A 1IBML 2HIVA 3GDEA 2NVYH 4LW1A 3UDIA 4BXXG 1E22A 4KI0A 1MKHA 2OTLA 4JI8L 2C35B 1B7YB 2IHEA 4YHHL 1IBMQ 4JI0L 4JI6L 2VZAA 1VCIA 3PF4A 1VQ8A 1NTGA 3RNUA 1SE8A 4IOAA 4YHHQ 4JI6Q 5IP7H 2NVQH 1TWGH 4LFBQ 3CMAA 4GNXA 3S1MH 1TWAH 4TVAB 3G6EA 3H0GH 1PH5A 2B3GA 4LF8Q 5H1SE 3HOXG 4DV4Q 1HJPA 3CCQA 1MJCA 4B3SL 3M85A 1Z47A 1OXTA 4DR6Q 4LUOA 2HIXA 2UUAL 4A3FH 1I94L 1HZ9A 4DNIA 1PH4A 3F8TA 3M4PA 4YY3L 3J81c 2YYZA 2UUAQ 3HOUH 3S16H 1V9PA 1IXRA 5M5WH 1YJNA 1PV4A 3U50C 5BR8Q 3H3VI 3EN2A 1G6PA 3OTOL 4DK6C 1V43A 1PFSA 3KYHC 4PZ7A 4DV6Q 1VQOA 4GN4B 3OTOQ 2JA6G 3HOZG 2OTJA 1VQJA 1XMOL 2PQAA 4QY7A 1NE3A 5M3FG 4TQUS 4B3RQ 2JA8H 2VUMG 2WB1G 4EX5A 1FJGL 2QGQA 1I3QH 3OYYA 4LFAQ 4X65L 3G71A 1EWIA 4X64L 4DV3L 3I4NH 2UXBQ 1Q12A 1Y1VG 4DUZL 5M5YH 1D8LA 1KHIA 1DGSA 4X65Q 1LTLA 2A1AA 4PZ6A 4HJ7A 4ME3A 4BBRG 3M7NA 2R7FA 4K0KQ 1Q1EA 4DAMA 3A5ZB 4R1JA 3KLWA 1CSPA 4P71A 2AMCB 3S1QH 2YTYA 1X3GA 2Z0SA 1J6QA 2I5HA 4JG2A 2VQEL 4AH6A 5LMNL 1K73C 3HOWH 3ICEA 4A3BG 5EAYA 4HJAA 4A3JG 4B3TL 1ASYA 5LMUL 4NB3A 1KD1C 4B3TQ 4KLKA 2L15A 2I5MX 2RCNA 2ZTEA 1PH7A 3ULLA 4GLXA 1ASZA 3GTPH 2K5VA 2K4KA 1K9MC 1BVSA 4DPGA 1KIXA 5GAGC 2R93G 2RHSB 2JA7H 1EOVA 3PSIA 1J5EL 1VQNA 3CCUA 4DV2Q 1VQKA 1NY4A 1Y1WG 2R7ZH 3B6YA 3L0OA 2Q2IA 3K81C 3MXNB 1EYGA 1CUKA 5IY0A 1J5EQ 2ZJQA 4BY7H 4BA1I 3ERSX 2B63G 4LWCA 1NBWA 3K80C 2UUCL 1VQMA 2WP8J 3CD6A 4DR7L 3KDFB 3AFQA 4GOPC 2UUCQ 1HNWL 5FJ8G 4H02A 1GVPA 2ZTDA 1N33L 1KAWA 2K75A 4LF7L 4OO1G 5IYCH 2R6GA 4A3CG 1HR0L 1JT8A 1XPRA 3M3YH 1A8VA 3RZDH 2OQKA 3CCJA 3UE1A 3HFZB 3CQZH 2WAQE 4X66Q 1XMQL 1HR0Q 1IL2A 3S2HH 5IYDH 4A3EH 1OXSC 3ER0A 2D62A 1PA6A 4BBSH 4OO1I 3S14H 4IPCA 4LF5L 2Z6KA 4MZ9A 1S3OA 4DR1Q 3AFPA 1UE1A 4LF9L 2UXCL 3NBHB 4IJHA 5LMNW 1C7YA 2CKZB 3GTOH 3PUXA 5IP9G 1WCMG 5IWAL 4LF9Q 2UXCQ 4DUYQ 4A3LH 1PH1A 5JEAG 1QZHA 2N3SA 3RLNA 2GN5A 5C44G 3S17H 1XJVA 1VQ9A 1OXUA 1UEBA 5C3EG 3J81i 3RLOA 4JBKA 4POFA 2IHFA 2MFIA 4IPHA 1X6OA 3PO2H 1EIYB 4GKKL 4L5QA 4LFCQ 1JJ2A 5IYBH 3STBD 3KJPA 3PO3H 2ZM6Q 4GKKQ 1XPOA 1U5KA 2GVAA 4C3HH 3M4OH 1HH2P 1G51A 4A3DG 4A76A 2AWNA 3FKIH 3PV0A 5GQOA 4PG3A 1EUJA 3PO2G 3AQQA 1UE7A 1AE2A 2Z6KC 3J7ZC 1Q86C 1M90C 2VW9A 4LFBL 2NZHA 4HJ5A 1JB7A 1NMFA 3EIVA 4RMFA 4P72A 4YWMA 1VQEA 5JEAJ 4NXML 5GADC 1LUZA 4DR2Q 4JV5L 4LF8L 1SMXA 3RR5A 4DV4L 3SGIA 4UP9A 5K36G 4R4CA 3I56A 3D31A 4NXMQ 1P8LA 1L1OA 5DLQE 1QUQA 4DR6L 1I6HH 4JV5Q 1GKHA 3RLFA 3TQYA 1A63A 2UUBQ 4OX9L 3CPFA 3CP0A 1D7QA 2BA0A 2E8GA 1N9WA 1VQDA 4JI1L 2CFMA 5IP7G 5BR8L 5HY6A 2E5LL 1E3PA 2Y0SE 4OX9Q 1XNRQ 3AEVA 3NENA 3I2ZA 1SRUA 1VQIA 1QVFA 4JI1Q 4JYAL 3H0GG 1YJWA 4DV6L 2E5LQ 4P73A 2A8VA 3PUYA 2LXKA 3L7ZC 4JYAQ 1G291 3CC7A 4A3FG 1CSQA 1S72A 2PQAB 1KL9A 1YBYA 4DV1Q 2LSSA 2N8NA 4LFAL 3K7AH 2MO0A 2KHJA 3HOUG 4A93H 2BH8A 2QA4A 4J15A 2JQOA 1Y14B 3KFUA 2UXBL 1VQHA 3J81j 1WFQA 2CCZA 4GNXC 2JA5H 4EQ5A 2VL6A 1HNXL 4PZ8A 4GS3A 3CMEA 4RG1A 4A3IH 4K0KL 1JJCB 1WI5A 3A0JA 3TS2A 4B3RL 1YHAA 2QEXA 1HNXQ 2JA8G 2OCEA 3UDXA 1SN8A 1KC8C 2Q2TA 1IYJB 4C3JH 1K83H 1C9OA 3BJUA 4JI2Q 1UWVA 4IFDG 4GOPB 2F52A 1E1OA 2OWOA 3I4NG 4OWXB 2WAQG 4A3MH 1QZGA 4NXNQ 4Y7NH 3G48A 3WWVA 3BU2A 1Q1BA 4BY1H 1K3RA 3DM3A 4JBJA 3W1BA 1PH6A 1XTDA 1VQ6A 5C4XH 2MQHA 2VQFQ 3K0XA 1X3FA 1U0LA 4IPDA 1XNQQ 4DK3C 2JEAI 3HOWG 4IFDI 2R7DA 1A62A 4GKJQ 4DV2L 3LGJA 3F2CA 1PVOA 3CXCA 1H95A 1UE6A 2E2JH 3S2DH 4DR4L 3W1GA 1CKNB 3S1NH 1WYDA 1SR3A 3D0FA 3RN5A 4DR4Q 2HT1A 3FP9A 4OWTB 1W3SA 2NZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGZ A;  1SRO A;  4QIW E;  3HOV H;  4IFD J;  1AE3 A;  3T1H Q;  1FL0 A;  1YHB A;  1L0W A;  4JC0 A;  2XGT A;  5FLM H;  2JA7 G;  3DLL A;  2K50 A;  1N32 L;  3UDG A;  4A3G H;  2R7Z G;  3M9B A;  4BY7 G;  3S24 A;  4X62 L;  4P74 A;  2HHH L;  1YIJ A;  4YCU A;  5E7N A;  1N32 Q;  4ALP A;  2F3I A;  1SLJ A;  2GVB A;  4X66 L;  1E1T A;  1Q46 A;  2EXD A;  4X62 Q;  1EQR A;  1N34 Q;  2HHH Q;  1X54 A;  4MTN A;  4DV7 L;  1HNZ L;  4DR1 L;  1RIP A;  2YTX A;  4AIM A;  4DAY B;  4Y52 H;  1EFW A;  3KOJ A;  2UXD Q;  1KXL A;  4YCV A;  1IBL Q;  1TWH H;  4AYB E;  4DV7 Q;  5IYC G;  1LM0 A;  2H5X A;  1HNZ Q;  3FHW A;  4UP8 A;  4DUY L;  4LUZ A;  5M3M H;  2ID0 A;  3KDF A;  4JI5 Q;  4DR3 Q;  5IYD G;  5HGQ A;  4HIM A;  4A3E G;  1TXY A;  2F4V L;  3IRB A;  1JJG A;  2UU9 L;  4BBS G;  3F1Z A;  3RN2 A;  2Y0S G;  2ALY B;  4QL5 A;  3J80 c;  4PMW A;  3T1Y Q;  3I4M H;  4X6A H;  2MO1 A;  3A74 A;  2KEN A;  4GLV B;  4LFC L;  3I7F A;  4JOI A;  4A75 A;  3KF6 B;  4A3K H;  3JC6 6;  2UU9 Q;  3ZJY C;  2F4V Q;  3GTG H;  2DUD A;  1T9H A;  3GD7 A;  4LF6 L;  1C0A A;  2JK8 A;  2ZM6 L;  3CPW A;  4C3I H;  2JJQ A;  4A3L G;  3AYH B;  5ELN A;  4HIK A;  4LF6 Q;  1X3E A;  1Q7Y C;  4P75 A;  3CCE A;  2ASB A;  3GTQ H;  1E7Z A;  4JBM A;  3G4S A;  3HKZ E;  2N49 A;  2JEB I;  1YJ9 A;  5JJI A;  2K5N A;  2KHI A;  1PYS B;  1KQS A;  1K8G A;  2R92 H;  2LXJ A;  4NPS A;  5JJK A;  1X65 A;  1HZC A;  5IYB G;  4LF4 Q;  1KRS A;  1VQC A;  1OXX K;  4IO9 A;  4DR2 L;  3PO3 G;  3L2P A;  2IT1 A;  1Q81 C;  1MIU A;  3CC2 A;  1XPU A;  4BXX H;  4L5S A;  1CKM A;  2KCM A;  3A5U A;  4GNX B;  3FKI G;  4KHP Q;  5FLX c;  5C4J H;  1YEZ A;  3JAM c;  2UUB L;  1HR0 W;  4DV0 Q;  2AKW B;  1EIF A;  1X55 A;  4JI3 Q;  2FXQ A;  3GTL H;  2AHO B;  5JJL A;  3TRE A;  3K8A A;  5J3B A;  4GN3 B;  5IE8 A;  1XNR L;  4LUV A;  1YVC A;  3RZO H;  1N8R C;  3GTJ H;  2VY3 A;  1VQL A;  2B29 A;  3HOX H;  1RL2 A;  1KRT A;  3H3V H;  2AWO A;  1OTC A;  4KHZ A;  1LYL A;  3HKS A;  1PH8 A;  4DV1 L;  4JI8 Q;  3VDY A;  2A19 A;  1FVI A;  3CCS A;  1B70 B;  4JI0 Q;  2BA1 A;  1VQ4 A;  3CCL A;  4IJL A;  3J7A 5;  2K5H A;  2ES2 A;  1W2B A;  5AJ3 L;  3OW2 A;  3GTM H;  1QVC A;  4UY8 C;  2I0Q A;  1Z9F A;  4IOC A;  1K0R A;  1VQG A;  2IX0 A;  5AJ3 Q;  2RHQ B;  1VQF A;  4HID A;  2JA6 H;  1UE5 A;  1L1O C;  4B3S Q;  3HOZ H;  4A4I A;  1VQ5 A;  5M3F H;  2VUM H;  1I94 Q;  1HZA A;  4JI2 L;  3KF8 B;  4YY3 Q;  4A93 G;  2N78 A;  1VQB A;  2V1C C;  2YU9 H;  2ATW A;  2CWP A;  2PI2 E;  4MNO A;  4NXN L;  4C2M H;  1Y1V H;  2JA5 G;  2Q2U A;  4GLA C;  1I50 H;  1PH9 A;  4A3I G;  2JA9 A;  4BBR H;  5C0X G;  4GN5 A;  1Q8K A;  1FGU A;  1JE5 A;  3PUZ A;  1YIT A;  4AYB G;  1PH3 A;  2VQF L;  2D0P A;  1XMO Q;  1XNQ L;  4A3B H;  1R9T H;  1FJG Q;  4GKJ L;  3PCO B;  1YZ6 A;  1B8A A;  2E2I H;  2KBN A;  4A3J H;  2RF4 A;  1VQA A;  4OXP A;  4AQY L;  2I5L X;  4X64 Q;  4DV3 Q;  5C0X I;  4A3M G;  2IY5 B;  4BY1 G;  4DKA C;  2Q2H A;  3PIO A;  4DUZ Q;  3CAM A;  4AQY Q;  2MNA A;  1WOC A;  1S40 A;  4BA2 I;  3J80 i;  3TRZ A;  5C4X G;  1CKO A;  2BH2 A;  3T1H L;  2CQO A;  4GOP A;  1BKB A;  2EIF A;  2R93 H;  3W5O A;  3NEM A;  2VQE Q;  5LMN Q;  3CW2 C;  1SFO H;  1YNX A;  3ULP A;  4QQB X;  2YV5 A;  2EQS A;  1GM5 A;  2XTI A;  4JI4 L;  4JCV E;  5M5X H;  3CCM A;  4DR5 L;  1IBK L;  3I4O A;  3HKZ G;  5C0X J;  1Y1W H;  2PI2 A;  3I55 A;  5LMU Q;  3CCV A;  1PHJ A;  4L5T A;  1TWC H;  4JI4 Q;  4DR5 Q;  1IBK Q;  2B63 H;  2NVT H;  1N34 L;  1OXV A;  5GAH C;  4R4O A;  3HOY G;  4FDB A;  3HOV G;  4R4I A;  3PUV A;  3GTK H;  2UXD L;  3E0E A;  3M4Q A;  1IBL L;  5FJ8 H;  3U4Z A;  1CKN A;  1AH9 A;  5FLM G;  5ELO A;  2JE6 I;  2WB1 E;  2WFW A;  4APV A;  4A3G G;  4HIO A;  4R4T A;  2OQ0 A;  4A3C H;  3MEF A;  3S1R H;  1V1Q A;  1I5F A;  4JI5 L;  3JAM i;  4DR3 L;  3KJO A;  1TWF H;  1JMC A;  1GO3 E;  1PH2 A;  1NJI C;  5GRO A;  3U4V A;  3T1Y L;  1K8A C;  3EBE A;  4DR7 Q;  4LNQ A;  3CF5 A;  3PF5 A;  4L5R C;  1HNW Q;  1P16 A;  1N33 Q;  4XIG S;  4YCW A;  1HZB A;  3HOY H;  2VNU D;  4DV5 L;  1L2F A;  4LF7 Q;  3K7U C;  3ULJ A;  2ZJR A;  1N36 L;  5IP9 H;  1WCM H;  1X56 A;  2CWA A;  1VQ7 A;  2KCT A;  5M3M G;  4DV5 Q;  4WJ4 A;  1IZ6 A;  1E24 A;  3Q8D A;  1N36 Q;  3F2D A;  2ZJP A;  4XTC S;  3GO5 A;  5C44 H;  3CCR A;  1YHQ A;  4B3M L;  4WJ3 M;  3UDF A;  1O7I A;  2NN6 G;  3E9H A;  4YWK A;  5C3E H;  1XMQ Q;  2YTV A;  4B3M Q;  3I4M G;  4R4Q A;  2E2H H;  1WJJ A;  4A3K G;  2NVX H;  4LF5 Q;  4LF4 L;  4HJ9 A;  2PNH A;  1VS0 A;  4QGU A;  4JI7 L;  3PIP A;  1M1K C;  4IPG A;  3UE0 A;  5IWA Q;  1Q82 C;  1X9N A;  2NN6 I;  3CC4 A;  4JI7 Q;  4YWL A;  2ZTC A;  3E9I A;  3TS0 A;  4KHP L;  2K14 A;  4O0A A;  4A3D H;  3STB C;  1BBW A;  3KF6 A;  1YI2 A;  2D0O A;  4O2D A;  3F2B A;  3TEH B;  4DV0 L;  3H15 A;  4JI3 L;  4UP7 A;  4HJ8 A;  4UPA A;  2IX1 A;  1L1O B;  1QVG A;  1QUQ B;  2R92 G;  3S15 H;  1VQP A;  5IT9 c;  1EQQ A;  1NMG A;  2PMZ E;  1PYB A;  4JOI C;  1MJE A;  4QJF A;  3U58 A;  2HQL A;  4OWW B;  2DGY A;  4POG A;  1A0I A;  2K52 A;  3BZK A;  4OON A;  3BZC A;  4JBW A;  1BBU A;  2VS1 A;  3NEL A;  3PUW A;  5GAE C;  1GD7 A;  1IBM L;  2HIV A;  3GDE A;  2NVY H;  4LW1 A;  3UDI A;  4BXX G;  1E22 A;  4KI0 A;  1MKH A;  2OTL A;  4JI8 L;  2C35 B;  1B7Y B;  2IHE A;  4YHH L;  1IBM Q;  4JI0 L;  4JI6 L;  2VZA A;  1VCI A;  3PF4 A;  1VQ8 A;  1NTG A;  3RNU A;  1SE8 A;  4IOA A;  4YHH Q;  4JI6 Q;  5IP7 H;  2NVQ H;  1TWG H;  4LFB Q;  3CMA A;  4GNX A;  3S1M H;  1TWA H;  4TVA B;  3G6E A;  3H0G H;  1PH5 A;  2B3G A;  4LF8 Q;  5H1S E;  3HOX G;  4DV4 Q;  1HJP A;  3CCQ A;  1MJC A;  4B3S L;  3M85 A;  1Z47 A;  1OXT A;  4DR6 Q;  4LUO A;  2HIX A;  2UUA L;  4A3F H;  1I94 L;  1HZ9 A;  4DNI A;  1PH4 A;  3F8T A;  3M4P A;  4YY3 L;  3J81 c;  2YYZ A;  2UUA Q;  3HOU H;  3S16 H;  1V9P A;  1IXR A;  5M5W H;  1YJN A;  1PV4 A;  3U50 C;  5BR8 Q;  3H3V I;  3EN2 A;  1G6P A;  3OTO L;  4DK6 C;  1V43 A;  1PFS A;  3KYH C;  4PZ7 A;  4DV6 Q;  1VQO A;  4GN4 B;  3OTO Q;  2JA6 G;  3HOZ G;  2OTJ A;  1VQJ A;  1XMO L;  2PQA A;  4QY7 A;  1NE3 A;  5M3F G;  4TQU S;  4B3R Q;  2JA8 H;  2VUM G;  2WB1 G;  4EX5 A;  1FJG L;  2QGQ A;  1I3Q H;  3OYY A;  4LFA Q;  4X65 L;  3G71 A;  1EWI A;  4X64 L;  4DV3 L;  3I4N H;  2UXB Q;  1Q12 A;  1Y1V G;  4DUZ L;  5M5Y H;  1D8L A;  1KHI A;  1DGS A;  4X65 Q;  1LTL A;  2A1A A;  4PZ6 A;  4HJ7 A;  4ME3 A;  4BBR G;  3M7N A;  2R7F A;  4K0K Q;  1Q1E A;  4DAM A;  3A5Z B;  4R1J A;  3KLW A;  1CSP A;  4P71 A;  2AMC B;  3S1Q H;  2YTY A;  1X3G A;  2Z0S A;  1J6Q A;  2I5H A;  4JG2 A;  2VQE L;  4AH6 A;  5LMN L;  1K73 C;  3HOW H;  3ICE A;  4A3B G;  5EAY A;  4HJA A;  4A3J G;  4B3T L;  1ASY A;  5LMU L;  4NB3 A;  1KD1 C;  4B3T Q;  4KLK A;  2L15 A;  2I5M X;  2RCN A;  2ZTE A;  1PH7 A;  3ULL A;  4GLX A;  1ASZ A;  3GTP H;  2K5V A;  2K4K A;  1K9M C;  1BVS A;  4DPG A;  1KIX A;  5GAG C;  2R93 G;  2RHS B;  2JA7 H;  1EOV A;  3PSI A;  1J5E L;  1VQN A;  3CCU A;  4DV2 Q;  1VQK A;  1NY4 A;  1Y1W G;  2R7Z H;  3B6Y A;  3L0O A;  2Q2I A;  3K81 C;  3MXN B;  1EYG A;  1CUK A;  5IY0 A;  1J5E Q;  2ZJQ A;  4BY7 H;  4BA1 I;  3ERS X;  2B63 G;  4LWC A;  1NBW A;  3K80 C;  2UUC L;  1VQM A;  2WP8 J;  3CD6 A;  4DR7 L;  3KDF B;  3AFQ A;  4GOP C;  2UUC Q;  1HNW L;  5FJ8 G;  4H02 A;  1GVP A;  2ZTD A;  1N33 L;  1KAW A;  2K75 A;  4LF7 L;  4OO1 G;  5IYC H;  2R6G A;  4A3C G;  1HR0 L;  1JT8 A;  1XPR A;  3M3Y H;  1A8V A;  3RZD H;  2OQK A;  3CCJ A;  3UE1 A;  3HFZ B;  3CQZ H;  2WAQ E;  4X66 Q;  1XMQ L;  1HR0 Q;  1IL2 A;  3S2H H;  5IYD H;  4A3E H;  1OXS C;  3ER0 A;  2D62 A;  1PA6 A;  4BBS H;  4OO1 I;  3S14 H;  4IPC A;  4LF5 L;  2Z6K A;  4MZ9 A;  1S3O A;  4DR1 Q;  3AFP A;  1UE1 A;  4LF9 L;  2UXC L;  3NBH B;  4IJH A;  5LMN W;  1C7Y A;  2CKZ B;  3GTO H;  3PUX A;  5IP9 G;  1WCM G;  5IWA L;  4LF9 Q;  2UXC Q;  4DUY Q;  4A3L H;  1PH1 A;  5JEA G;  1QZH A;  2N3S A;  3RLN A;  2GN5 A;  5C44 G;  3S17 H;  1XJV A;  1VQ9 A;  1OXU A;  1UEB A;  5C3E G;  3J81 i;  3RLO A;  4JBK A;  4POF A;  2IHF A;  2MFI A;  4IPH A;  1X6O A;  3PO2 H;  1EIY B;  4GKK L;  4L5Q A;  4LFC Q;  1JJ2 A;  5IYB H;  3STB D;  3KJP A;  3PO3 H;  2ZM6 Q;  4GKK Q;  1XPO A;  1U5K A;  2GVA A;  4C3H H;  3M4O H;  1HH2 P;  1G51 A;  4A3D G;  4A76 A;  2AWN A;  3FKI H;  3PV0 A;  5GQO A;  4PG3 A;  1EUJ A;  3PO2 G;  3AQQ A;  1UE7 A;  1AE2 A;  2Z6K C;  3J7Z C;  1Q86 C;  1M90 C;  2VW9 A;  4LFB L;  2NZH A;  4HJ5 A;  1JB7 A;  1NMF A;  3EIV A;  4RMF A;  4P72 A;  4YWM A;  1VQE A;  5JEA J;  4NXM L;  5GAD C;  1LUZ A;  4DR2 Q;  4JV5 L;  4LF8 L;  1SMX A;  3RR5 A;  4DV4 L;  3SGI A;  4UP9 A;  5K36 G;  4R4C A;  3I56 A;  3D31 A;  4NXM Q;  1P8L A;  1L1O A;  5DLQ E;  1QUQ A;  4DR6 L;  1I6H H;  4JV5 Q;  1GKH A;  3RLF A;  3TQY A;  1A63 A;  2UUB Q;  4OX9 L;  3CPF A;  3CP0 A;  1D7Q A;  2BA0 A;  2E8G A;  1N9W A;  1VQD A;  4JI1 L;  2CFM A;  5IP7 G;  5BR8 L;  5HY6 A;  2E5L L;  1E3P A;  2Y0S E;  4OX9 Q;  1XNR Q;  3AEV A;  3NEN A;  3I2Z A;  1SRU A;  1VQI A;  1QVF A;  4JI1 Q;  4JYA L;  3H0G G;  1YJW A;  4DV6 L;  2E5L Q;  4P73 A;  2A8V A;  3PUY A;  2LXK A;  3L7Z C;  4JYA Q;  1G29 1;  3CC7 A;  4A3F G;  1CSQ A;  1S72 A;  2PQA B;  1KL9 A;  1YBY A;  4DV1 Q;  2LSS A;  2N8N A;  4LFA L;  3K7A H;  2MO0 A;  2KHJ A;  3HOU G;  4A93 H;  2BH8 A;  2QA4 A;  4J15 A;  2JQO A;  1Y14 B;  3KFU A;  2UXB L;  1VQH A;  3J81 j;  1WFQ A;  2CCZ A;  4GNX C;  2JA5 H;  4EQ5 A;  2VL6 A;  1HNX L;  4PZ8 A;  4GS3 A;  3CME A;  4RG1 A;  4A3I H;  4K0K L;  1JJC B;  1WI5 A;  3A0J A;  3TS2 A;  4B3R L;  1YHA A;  2QEX A;  1HNX Q;  2JA8 G;  2OCE A;  3UDX A;  1SN8 A;  1KC8 C;  2Q2T A;  1IYJ B;  4C3J H;  1K83 H;  1C9O A;  3BJU A;  4JI2 Q;  1UWV A;  4IFD G;  4GOP B;  2F52 A;  1E1O A;  2OWO A;  3I4N G;  4OWX B;  2WAQ G;  4A3M H;  1QZG A;  4NXN Q;  4Y7N H;  3G48 A;  3WWV A;  3BU2 A;  1Q1B A;  4BY1 H;  1K3R A;  3DM3 A;  4JBJ A;  3W1B A;  1PH6 A;  1XTD A;  1VQ6 A;  5C4X H;  2MQH A;  2VQF Q;  3K0X A;  1X3F A;  1U0L A;  4IPD A;  1XNQ Q;  4DK3 C;  2JEA I;  3HOW G;  4IFD I;  2R7D A;  1A62 A;  4GKJ Q;  4DV2 L;  3LGJ A;  3F2C A;  1PVO A;  3CXC A;  1H95 A;  1UE6 A;  2E2J H;  3S2D H;  4DR4 L;  3W1G A;  1CKN B;  3S1N H;  1WYD A;  1SR3 A;  3D0F A;  3RN5 A;  4DR4 Q;  2HT1 A;  3FP9 A;  4OWT B;  1W3S A;  2NZO A; 
#chains in the Genus database with same CATH topology
 5KNB A;  3HOV H;  1S5B D;  4QB4 A;  1AE3 A;  3R2I A;  1FL0 A;  4C1N I;  3BYT B;  3SK5 A;  4JC0 A;  1SYE A;  1PTO F;  1N32 L;  2Z6B A;  1LTT D;  1OO9 B;  4BY7 G;  3C1F A;  3M9B A;  4X62 L;  3HOX B;  1PFB A;  1SLJ A;  1SMY D;  1EQR A;  3E5S A;  4MTN A;  1I4P A;  1HXY D;  1HNZ L;  2YTX A;  5CV8 A;  4AIM A;  1K3B C;  2HQE A;  4AYB E;  5DM7 3;  5IYC G;  1B3Q A;  4DK0 A;  5CGK A;  5LL6 S;  4XYO A;  1EY4 A;  4LUZ A;  5M3M H;  3HOZ B;  4DR3 Q;  3MFY A;  5IYD G;  3DEP A;  3S16 B;  5M5W B;  3RN2 A;  1KXL A;  4X6A H;  2MO1 A;  3FEW X;  4LFC L;  1O7Z A;  3GP7 A;  1FNV A;  4H44 C;  4JOI A;  3K57 A;  4A75 A;  2F4V Q;  2ZT9 C;  3GTG H;  2FMM A;  2IPK D;  1T9H A;  2MGS A;  2ZM6 L;  4BBR B;  3AYH B;  3N6R A;  3NWT A;  2AQ3 B;  4A3B B;  3NBH A;  2KHI A;  3NUC A;  1KQS A;  1K8G A;  1EU4 A;  5JJK A;  3NTI A;  1VQC A;  4V0B A;  1Q81 C;  1F77 A;  4BXX H;  2GA4 B;  5EKL A;  5LHY 1;  4UAI A;  3A5U A;  3FKI G;  4CJ2 C;  2UUB L;  2R93 B;  1HQM C;  2F0G A;  1SYG A;  3TZU A;  4G7Z C;  1EIF A;  1ZXT A;  3TP8 A;  4KY7 A;  2AHO B;  5M5X B;  3K8A A;  4HSP A;  5IE8 A;  2XNA C;  3RZO H;  5I9O A;  3VYU A;  3ERQ A;  2VY3 A;  4OIK A;  1TWC B;  3W2D A;  1VQL A;  1ICF B;  1X3P A;  5C4H A;  3H3V H;  5I2X A;  1OTC A;  1XTC D;  1JWU D;  1G8Z D;  4J8Q A;  1JC7 A;  1PH8 A;  4DV1 L;  2RDG A;  3CCS A;  3R3O A;  3ND9 A;  3CCL A;  2B2W C;  3NHH A;  3J81 L;  4H0L C;  5C4Z A;  1TWF B;  3VR3 A;  1K0R A;  4IOC A;  2IX0 A;  4M1U B;  1VQF A;  1L0Y B;  2K5W A;  1DJR D;  3CKI B;  5M3F H;  2VUM H;  3VR2 A;  2F3V A;  4R8N A;  1TVX A;  1VQB A;  2X6G A;  2C9O A;  4NXN L;  1PFM A;  1F9P A;  1STE A;  5KND A;  3D3R A;  3LWU A;  4GN5 A;  1Q8K A;  5EPL A;  2D0P A;  1I4H A;  1AW7 A;  2NVX B;  4KV6 A;  4IN3 A;  1EY9 A;  3PCO B;  1YZ6 A;  2KBN A;  1F2M A;  4A3J H;  4AQY L;  1SSO A;  4NW2 A;  4DKA C;  1QB5 D;  4A3D B;  5C5L A;  3J80 i;  4RHR A;  5D3D A;  3OHX C;  5CC4 A;  2BH2 A;  3S15 B;  2CQO A;  4GOP A;  4RGM A;  2F0I A;  3W5O A;  3NEM A;  5LMN Q;  3CW2 C;  3ULP A;  2EQS A;  1E2V A;  1GM5 A;  1PTO H;  3CCM A;  3HKZ G;  5C0X J;  3I55 A;  2NVY B;  1S5D D;  3DWA A;  4L5T A;  4DR5 Q;  1IBK Q;  1OXV A;  4R4O A;  1ESF A;  3P1H A;  3OMC A;  5CYU A;  2VXW A;  4L8J A;  3E0E A;  2PO4 A;  5FLM G;  1PZK D;  5ELO A;  3D4D A;  4OEL B;  4RA8 A;  4R4T A;  4RFB A;  4ZQ3 A;  2A6E C;  2FHT A;  5EPK A;  4A3F B;  1HUM A;  1JMC A;  3N52 A;  5KYI A;  2SEB D;  3CRK C;  3NBI A;  5GRO A;  3U4V A;  2DJF C;  3EBE A;  5C3W A;  3CF5 A;  4L5R C;  1P16 A;  1KTK A;  1HZB A;  4Q0F A;  3TBI B;  1L2F A;  3NQI A;  3ULJ A;  4I7A A;  2CWA A;  4DV5 Q;  5JEA H;  3CCR A;  5C44 H;  3GO5 A;  1YHQ A;  4LAA A;  2JA8 B;  1O7I A;  4RGO S;  5C3E H;  5T1I A;  4R4Q A;  3CHB D;  4A3K G;  4ZKB B;  4HSV A;  4LF5 Q;  4B9W A;  3I4N B;  2WAQ B;  3QWN A;  5CV6 A;  1M1K C;  1F9R A;  3UE0 A;  4PQX A;  3TS0 A;  3T56 B;  3KF6 A;  2D0O A;  4O2D A;  4IUT A;  3GV3 A;  4UP7 A;  3I91 A;  1A3V A;  3VR5 A;  2R92 G;  1QUQ B;  1SNQ A;  1IW7 C;  2PMZ E;  5EKI A;  1STY A;  1JOK A;  4XXE A;  2L12 A;  1A0I A;  2K52 A;  4Z9C B;  4HTH A;  3BZC A;  1BBU A;  5GAE C;  1IBM L;  3GDE A;  1RJT A;  4O1N A;  4JI8 L;  2JXM B;  4YHH L;  4JI6 L;  2VZA A;  1VCI A;  4IOA A;  2R7Z B;  1PDQ A;  1QCB D;  3CMA A;  1WVL A;  4TVA B;  1B3A A;  2PZU A;  3H0G H;  2F0M A;  1PH5 A;  2WKD A;  3HOX G;  4RH6 A;  2RQX A;  1PYW D;  4FO2 A;  2UUA L;  1U9R A;  1I94 L;  5CR3 A;  1PH4 A;  3F8T A;  1VDZ A;  4YY3 L;  3J81 c;  3HOU H;  1NAP A;  3K59 A;  3Q24 A;  1IXR A;  2FFK B;  5BR8 Q;  3LWE A;  3MVV A;  2WAC A;  3H3V I;  4DK6 C;  4B08 A;  3OPO A;  4DV6 Q;  4A3E B;  3HOZ G;  1XMO L;  2F0E A;  2Y0S B;  4QY7 A;  2QGQ A;  1I3Q H;  2AQ2 B;  1R4P B;  4X65 L;  3G71 A;  4X64 L;  1SEB D;  3KLR A;  4DUZ L;  1KHI A;  2A1A A;  1EOT A;  1MBY A;  2M00 A;  4BBR G;  2R7F A;  4K0K Q;  2MJ8 A;  2B8G A;  4A3B G;  2YTY A;  3D4R A;  4WRD A;  1FNW A;  1QG7 A;  2E74 C;  4HJA A;  4CJ1 B;  4C3H B;  4FF4 A;  3LX0 A;  4CHT B;  1KD1 C;  2L0C A;  1LAB A;  1W6J A;  2K5V A;  4LMQ D;  1K9M C;  5JVG 3;  2K5D A;  4K2L A;  2R93 G;  3PSI A;  1VQN A;  1EY6 A;  1VQK A;  3K81 C;  3DM1 A;  3MXN B;  5ISR A;  1UUP A;  2E2D C;  3ERS X;  4LWC A;  1MSG A;  2UUC L;  1VQM A;  3SR1 A;  4DA2 A;  3WOE A;  1GVP A;  2ZTD A;  1DON A;  1KAW A;  4R8I A;  4LF7 L;  4OO1 G;  1SMY C;  5FK9 C;  3MEH A;  1HR0 L;  2CVR A;  1XPR A;  1CT1 D;  4KY5 A;  3RZD H;  3HFZ B;  3CQZ H;  1XX8 A;  2L11 A;  1IL2 A;  4C1N K;  2NYZ D;  3TDQ A;  4IPC A;  2KJX A;  3MHB A;  2SNM A;  4LF9 L;  5CV9 A;  1NCV A;  3I3C A;  2CKZ B;  3PUX A;  5J39 A;  5IGB A;  2UXC Q;  3UI2 A;  3T4A C;  5M3F B;  3MZ5 A;  1JIC A;  2PNR C;  1JWS D;  1UEB A;  4FXK C;  4JBK A;  5FO8 B;  3PO2 H;  4LFC Q;  4A3M B;  3KJP A;  4G57 A;  3PO3 H;  2ZM6 Q;  2OF1 A;  1LAC A;  3M4O H;  1EZ8 A;  3SK6 A;  3MC0 B;  4QMG A;  4A3D G;  4PG3 A;  3I73 A;  4G7H C;  4QUF A;  2VW9 A;  3JAM L;  4LFB L;  1CHP D;  2E2J B;  2NZH A;  3BVZ A;  1VQE A;  1F2L A;  4LF8 L;  3RR5 A;  4DV4 L;  3I56 A;  2RBM A;  2XWJ B;  3D31 A;  2OEO A;  4JV5 Q;  1QWY A;  5I9P A;  1B50 A;  1DOM A;  2D2C C;  1ET9 A;  3TQY A;  1PTO B;  4CDD C;  2UUB Q;  1TII D;  4LJZ C;  2E8G A;  1N9W A;  1VQD A;  4A3G B;  1I6V C;  5IP7 G;  2E5L L;  1E3P A;  2F0O A;  4OX9 Q;  4DAP A;  3NEN A;  3I2Z A;  3BDL A;  4JYA L;  4CJ0 B;  2A8V A;  1H9S A;  4A3F G;  1CSQ A;  1ML0 D;  4DV1 Q;  1TWH B;  4KKU A;  4RCO A;  2N8N A;  3K7A H;  4A93 H;  4J15 A;  2JQO A;  5IOC A;  2B2V A;  3J81 j;  1SYF A;  4GNX C;  2V4D A;  5EPJ A;  3CME A;  1ZYR D;  4N9P A;  5C0X H;  3A0J A;  3TSS A;  3TS2 A;  1HNX Q;  3NSW A;  1EQT A;  2JA8 G;  3I4M B;  1PLF A;  2ZXR A;  1SN8 A;  1KAA A;  4C3J H;  3BJU A;  4C3I B;  3I4N G;  1STN A;  2WAQ G;  4NXN Q;  3HRZ C;  3GTQ B;  5G3L F;  3J7A V;  4JBJ A;  1PH6 A;  1I4G A;  1XTD A;  5C4X H;  3E6Z X;  1Z6H A;  1VF7 A;  4IPD A;  3VYR A;  1E0B A;  3R93 A;  3L3O C;  4XQQ A;  1IYV A;  2A5H A;  3PIO 3;  1I4X A;  1CKN B;  4PMC A;  4DR4 Q;  1O80 A;  1W3S A;  1JOO A;  3HOY H;  1SRO A;  3BDC A;  3MWY W;  3AMU A;  4FXG C;  5KRU A;  2XGT A;  3DLL A;  2K50 A;  2BE5 C;  3GTJ B;  3JAM E;  2R7Z G;  4RAU C;  5D3I B;  1XXG A;  2SOB A;  1YIJ A;  2XRQ D;  5E7N A;  5KIX A;  1WTO A;  4ALP A;  2F3I A;  1E1T A;  1Q46 A;  2EXD A;  2HHH Q;  4N9T A;  1X54 A;  1Y8N B;  1HTL D;  5AFW A;  2NWG A;  1TY2 A;  3KOJ A;  4DV7 Q;  3GTM B;  1KNE A;  1LM0 A;  1LT6 D;  2H5X A;  4RKB A;  4DUY L;  1IYU A;  2EY5 A;  2JA6 B;  2ID0 A;  2RVL A;  1PZI D;  3A54 A;  4F87 A;  4A3E G;  1TXY A;  1JJG A;  3IRB A;  4RWS C;  2NN6 H;  2UU9 L;  1QNU A;  3MAQ A;  2Y0S G;  2ALY B;  3A74 A;  2KEN A;  3H94 A;  5DM6 3;  2F03 A;  2DUD A;  4ZK9 B;  3CPW A;  1I50 B;  2K01 A;  1JCK B;  2JJQ A;  3G7L A;  4A3L G;  4LF6 Q;  1X3E A;  1Q7Y C;  4P75 A;  2ASB A;  1E7Z A;  4OGQ C;  3HKZ E;  3I72 A;  5KYL A;  1R9T B;  2JEB I;  2PW5 A;  2KQ3 A;  5JJI A;  2JSO A;  1FR3 A;  3C2P A;  2E2I B;  3FPU B;  5IYB G;  4IO9 A;  1CA5 A;  5CMD A;  4C3H G;  2XVS A;  4J1M A;  2O5I C;  4GNX B;  3OMG A;  2EY1 A;  3L9A X;  3JAM c;  3ZYY X;  4IUP A;  1X55 A;  3GTL H;  3GQB A;  5JJL A;  5J3B A;  4GN3 B;  1XNR L;  5EBC A;  1YVC A;  4IAL A;  2NVT B;  2FJ2 A;  3VR6 A;  3BVG A;  1LYL A;  1V1O A;  2WIN B;  4JI8 Q;  2EPB A;  3VDY A;  2BA1 A;  1VQ4 A;  1TKW B;  5BN3 A;  4IUQ A;  4TKO B;  3S1R B;  2IJ0 A;  2ES2 A;  1HA6 A;  3E0J A;  1EWH A;  1QVC A;  1FGB D;  3EQL C;  5AJ3 Q;  2H4O A;  1L1O C;  3T13 A;  4A4I A;  4OEM B;  1I94 Q;  1SYB A;  1HZA A;  5ELD A;  3KF8 B;  2F4I A;  4YY3 Q;  2N78 A;  4DFA A;  2YU9 H;  3RZD B;  2F0T A;  1NR4 A;  2PI2 E;  1PTO D;  1Y1V H;  5FO9 B;  4GLA C;  1SDF A;  1PH9 A;  1YIT A;  3PUZ A;  1JE5 A;  4EGV A;  2K28 A;  4CBV A;  1XMO Q;  3EFX D;  4CDC C;  4PNY A;  3Q6S A;  2G9H D;  1VQA A;  4X64 Q;  4A3M G;  5C0X I;  4F8M A;  3C3L A;  2AQ1 B;  4DUZ Q;  4KTA A;  1WOC A;  1S40 A;  3PO2 B;  3OSO A;  2VB3 X;  1CKO A;  3T1H L;  5I6Y A;  1BKB A;  2EIF A;  2EZV A;  1SFO H;  1YNX A;  2YV5 A;  3FMC A;  2XTI A;  4JI4 L;  1GXD C;  3I4O A;  1Y1W H;  1D2B A;  2F1M A;  3CCV A;  1PHJ A;  1WTR A;  2B63 H;  1N34 L;  5DNF A;  3SK4 A;  4OHJ A;  1O78 A;  3PUV A;  1TS4 A;  3GTK H;  2NVQ B;  3I4L A;  3M4Q A;  1TWG B;  1IBL L;  1EIG A;  2LY7 A;  3BVM A;  4EQP A;  1TWA B;  4A3G G;  4HIO A;  2OQ0 A;  1DOL A;  3HS0 C;  4EQN A;  2E76 C;  1NR2 A;  1VMP A;  2IX3 A;  1I5F A;  3KJO A;  1GO3 E;  1HFG A;  1K8A C;  1LO5 D;  4LNQ A;  4FNF A;  2VNU D;  5TSS A;  4LF7 Q;  3K7U C;  2ZJR A;  1N36 L;  5IP9 H;  1WCM H;  1X56 A;  1VQ7 A;  2KCT A;  1IZ6 A;  3NP8 A;  1XYI A;  2ZJP A;  3IKJ A;  4WJ3 M;  3K7A B;  3E9H A;  4B3M Q;  4ABN A;  3I4M G;  2RCF A;  2E2H H;  4HMJ A;  4LF4 L;  1SYD A;  1C4Q A;  2QW7 A;  4QGU A;  3PIP A;  4C3I G;  2QCP X;  1JOQ A;  1K8M A;  2NN6 I;  1X9N A;  3CC4 A;  4JI7 Q;  1GUW A;  3E9I A;  2K14 A;  3S1Q B;  1BBW A;  4K5W A;  2RA4 A;  3IFD A;  4HJ8 A;  4ME5 A;  1L1O B;  4KN4 C;  1EQQ A;  1NMG A;  4JOI C;  1JOR A;  4QJF A;  3U58 A;  2HQL A;  4DK1 A;  4POG A;  1GD7 A;  4X3T A;  3UDI A;  1E22 A;  2C35 B;  2JA7 B;  1KLU D;  1VQ8 A;  3RNU A;  4LFB Q;  2NUC A;  3S1M H;  3G6E A;  1ENC A;  4LF8 Q;  4NMZ A;  4DV4 Q;  1C48 A;  1HJP A;  2QIL A;  1D6E C;  3U9S A;  4BWG B;  1HZ9 A;  4DNI A;  1HTP A;  1PZJ D;  3NQT A;  2YYZ A;  1PV4 A;  1EY5 A;  3M3Y B;  1HA5 A;  3OTO L;  1G6Z A;  1RHP A;  4PZ7 A;  3S2H B;  4GN4 B;  2JA6 G;  2OTJ A;  1VQJ A;  4BBS B;  2PQA A;  3S14 B;  1PRT D;  2R3Z A;  4EX5 A;  1FJG L;  3OYY A;  1ZYR C;  1SNP A;  2A69 D;  3GTO B;  4DV3 L;  4QUC A;  5M5Y H;  2OXP A;  3QO2 A;  4HJ7 A;  1Q1E A;  4DAM A;  1UNS A;  4P71 A;  2AMC B;  4JG2 A;  3HOW H;  1K73 C;  1AFP A;  1Z7T A;  5EAY A;  4B3T L;  1NSN S;  1CI3 M;  1ASY A;  2KA7 A;  2RCN A;  2O2L D;  1PH7 A;  4GLX A;  1TS2 A;  3GTP H;  2K4K A;  1BVS A;  1PRT F;  4DPG A;  1KIX A;  1J9O A;  2NB0 A;  1J5E L;  4UDU C;  1NY4 A;  3Q0A A;  5HUR A;  1I4Q A;  4BY7 H;  2Q2I A;  1CUK A;  1I6H B;  4G4K A;  1TR5 A;  2CH4 A;  2VB2 X;  4XQJ A;  3K80 C;  2WP8 J;  1GUT A;  1CZG A;  5M9O A;  4GOP C;  3H91 A;  5FJ8 G;  5IYC H;  2R6G A;  4QIW B;  3D6W A;  4A3C G;  1VF5 C;  4FF1 A;  1WD0 A;  2Z9H A;  2OQK A;  5I2Y A;  2WAQ E;  5IYD H;  3J81 E;  4DAY A;  2LS0 1;  4MZ9 A;  5L37 A;  3NBH B;  3J80 L;  5FO7 B;  2JA5 B;  4P2C B;  4N8X 1;  5KEE A;  4K5V A;  4DUY Q;  4KMU C;  4A3I B;  2NBF A;  4K8I A;  2GN5 A;  3S17 H;  1XJV A;  1RTO A;  3RLO A;  1KLG D;  4KD3 A;  1MHW C;  2MFI A;  1Y1V B;  4YIJ A;  3H3V C;  2QKI C;  4BY1 B;  1A15 A;  4GKK Q;  1H9R A;  1U5K A;  1HH2 P;  1G51 A;  3A8K E;  2AWN A;  3FKI H;  4XT3 B;  5GQO A;  3PO2 G;  3AQQ A;  4HN7 A;  1UE7 A;  1AE2 A;  3J7Z C;  5FLX L;  4HED A;  2K32 A;  1M90 C;  2EJF C;  3CRL C;  4ZLT F;  4HJ5 A;  5E1F A;  3S2D B;  1NMF A;  2D9U A;  3EIV A;  4LK1 C;  3S1N B;  1SMX A;  3SGI A;  4UP9 A;  5K36 G;  4R4C A;  2KOL A;  4NXM Q;  4DR6 L;  3HOV B;  1IKM A;  5DEH A;  3SEB A;  1A63 A;  3S9W A;  1RKN A;  2G9D A;  2EYL A;  2BA0 A;  2H1E A;  4JI1 L;  2WV6 D;  4RGN A;  5C6A A;  2WKC A;  3W3A A;  1JB3 A;  1STH A;  2Y0S E;  1RCV D;  1XNR Q;  1QVF A;  3AEV A;  1DD2 A;  1YJW A;  4P73 A;  3SDZ A;  2F3W A;  5ELC A;  4K6L A;  2PCF B;  1QJO A;  1G29 1;  3CC7 A;  1SNM A;  2PQA B;  1YBY A;  2LSS A;  1ILP A;  1IHZ A;  2KHJ A;  2ZXP A;  3A55 A;  3A8J E;  2UXB L;  1Y14 B;  1DZ1 A;  3FPP A;  1VQH A;  5M3M B;  4EQ5 A;  4PZ8 A;  4GS3 A;  1VMC A;  4KKS A;  1JJC B;  5DAU A;  1YHA A;  1PTO C;  3UDX A;  5NUC A;  3GTG B;  2PZW A;  1K83 H;  4IFD G;  4GOP B;  2F52 A;  1GOZ A;  1QZG A;  1HQR D;  4Y7N H;  3WWV A;  3BU2 A;  1Y69 U;  5F2D A;  3SXH A;  3KK7 A;  3K0X A;  1X3F A;  3I90 A;  2A73 B;  1EY8 A;  2R7D A;  1LV9 A;  4DV2 L;  1YNJ D;  5BN5 A;  3D6C A;  3MXP A;  1D1K A;  2HT1 A;  1HUN A;  1MSH A;  2NZO A;  3PGZ A;  2F0F A;  1LT4 D;  3T1H Q;  2JA7 G;  5FLM H;  3RZO B;  3DMU A;  5CV4 A;  3UDG A;  1D1I A;  1SJE D;  4P74 A;  4YCU A;  1N32 Q;  2GVB A;  4X66 L;  4X62 Q;  2KHS A;  2PYK A;  1N34 Q;  3M7G A;  1ENA A;  4O42 A;  5CBA E;  3NXW A;  4H7B A;  1RIP A;  4WJW A;  4DAY B;  4FVM A;  1EFW A;  3VYS A;  1IBL Q;  5EJW A;  1RTN A;  1HNZ Q;  3FHW A;  3DXJ C;  4UP8 A;  3FRP B;  1EWC A;  3KDF A;  1LTI D;  4UHV A;  1H9M A;  2VUM B;  2WB1 B;  4HIM A;  2F4V L;  1F2Z A;  4BBS G;  3F1Z A;  5J1Z A;  3J80 c;  3I8Z A;  2L1B A;  2PW7 A;  4GLV B;  4A3K H;  3HZX A;  3KF6 B;  3JC6 6;  3ZJY C;  3GD7 A;  2DN8 A;  2ICE C;  4H13 C;  2DY7 A;  3CCE A;  2N49 A;  2L4N A;  1YJ9 A;  2K5N A;  2QF7 A;  1PYS B;  3RMH A;  2R92 H;  2LXJ A;  4A3J B;  2EJG C;  2F0W A;  1HZC A;  1GUG A;  1STB A;  4LF4 Q;  1OXX K;  5IT9 L;  2IT1 A;  1MIU A;  1G2T A;  2B2Y A;  4CDE C;  5FLX c;  5C4J H;  1YEZ A;  1AEX A;  1CTM A;  1JQY D;  1HR0 W;  1S5E D;  3TP7 A;  4X3K A;  2M2L A;  2JP1 A;  3V2T A;  3TRE A;  1WTV A;  1SND A;  5ELE A;  3GTP B;  1EY0 A;  4XYQ A;  3HOX H;  1RL2 A;  5G3L D;  2AWO A;  4KHZ A;  1SXT A;  4MN3 A;  3HKS A;  3WDN A;  4ZRZ A;  4HR7 B;  5CV5 A;  3QG1 A;  2A19 A;  1FVI A;  1B70 B;  5C5M A;  3J7A 5;  1FD7 D;  3TME A;  1W2B A;  1B9N A;  1LTB D;  1Z9F A;  4MHE A;  1VQG A;  4RCN A;  4OL7 A;  3HOZ H;  1UE5 A;  3DHQ A;  2DJG C;  2K33 A;  2LMC B;  1VQ5 A;  2RSO A;  2B2T A;  2KCN A;  2QDL A;  1R4Q B;  1X32 A;  2Q8T A;  2CWP A;  3O13 A;  4C2M H;  5JAV A;  1PRT C;  1NUC A;  2JA5 G;  2Q8I B;  5C44 B;  1DM0 B;  4A3I G;  2JA9 A;  4BBR H;  2F0S A;  5C3E B;  1PH3 A;  2A69 C;  2VQF L;  1XNQ L;  4A3B H;  5FOB B;  1FJG Q;  3J7A F;  4GKJ L;  1UEA B;  1ICW A;  1W6K A;  4OXP A;  2EE1 A;  4DV3 Q;  1PMR A;  2B2V C;  4BY1 G;  2LFN A;  4FF2 A;  1SE3 A;  4AQY Q;  1GHK A;  2FIN B;  3G6J B;  1BNZ A;  2R93 H;  1BCP D;  1SE2 A;  4QQB X;  1CZW A;  3A8I E;  2QDB A;  5IOD A;  4JCV E;  5M5X H;  4DR5 L;  5E4X A;  1IBK L;  4MTK A;  2PI2 A;  4ZAI A;  5D65 A;  1TWC H;  5IT9 E;  1SE4 A;  2R61 A;  3QOL A;  4FDB A;  1V1P A;  2F0L A;  3HOV G;  2IW3 A;  4DNT B;  2UXD L;  1LTG D;  3U4Z A;  1AH9 A;  2JE6 I;  4OO1 H;  3FDT A;  2WFW A;  4APV A;  3H0G B;  2TSS A;  3MEF A;  2Z1C A;  1V1Q A;  4JI5 L;  1TWF H;  4X3U A;  1NJI C;  1PXU A;  1QOH A;  3T1Y L;  3HOU B;  1YNN D;  3C46 A;  1WTQ A;  1BCP F;  4XIG S;  4DV5 L;  4R9W A;  4FYD A;  3SVM A;  4G7O C;  1E2Z A;  5M3M G;  2F0H A;  2N88 A;  1E24 A;  5A35 A;  3F2D A;  2EYM A;  1I3Q B;  3UDF A;  1F9Q A;  1A2U A;  4YWK A;  2X69 A;  3DWP A;  2NVX H;  1WJJ A;  4HCS A;  4HJ9 A;  1VS0 A;  4DNR B;  3QIA A;  5LL6 X;  2C5C A;  2BCO A;  4IPG A;  4TSS A;  1Q82 C;  3OOC A;  2ZTC A;  4KHP L;  4A3D H;  1YI2 A;  4DV0 L;  3TEH B;  4JI3 L;  2Z4H A;  2IX1 A;  3S15 H;  1QVG A;  1VQP A;  5IT9 c;  1PYB A;  3MTS A;  2QEJ C;  4EQO A;  1Y8P B;  3BZK A;  1HCZ A;  2RSN A;  4I65 A;  1CM9 A;  3NEL A;  1U4M A;  2HIV A;  4BXX G;  2NVY H;  4LW1 A;  1B4O A;  1PRT B;  1A3T A;  2HCI A;  4KI0 A;  5IGF A;  1STG A;  2IHE A;  1IBM Q;  4JI0 L;  2B2U A;  3T53 B;  2P5Z X;  1H9S B;  1NTG A;  1SE8 A;  3VA5 A;  4YHH Q;  4JI6 Q;  5IP7 H;  1EL0 A;  1U4R A;  2EY6 A;  1EIH A;  2B3G A;  3CCQ A;  1H9K A;  4B3S L;  1V8Q A;  3M85 A;  4DR6 Q;  2EJM A;  2HIX A;  4A3F H;  1ZEQ X;  1M4V A;  2KEE A;  1FYC A;  3HP3 A;  4ULL A;  2UUA Q;  1V9P A;  1G6P A;  5CV7 A;  1JWM D;  1ROD A;  3U50 C;  1V43 A;  1GJX A;  3CQZ B;  3KYH C;  1VQO A;  2PPB C;  1NE3 A;  3KUP A;  5M3F G;  2IL8 A;  2JA8 H;  2VUM G;  2WB1 G;  3MFG A;  2IWH A;  2SNS A;  1WTP A;  1EWI A;  4KK7 A;  1BF4 A;  3I4N H;  2UXB Q;  3I70 A;  1D8L A;  4X65 Q;  1DGS A;  1LTL A;  3M7N A;  4ME3 A;  2JN4 A;  3A5Z B;  4R1J A;  1IKL A;  2Z0S A;  1J6Q A;  2VQE L;  3OWE B;  3ICE A;  4U68 A;  4AH6 A;  1C8C A;  3PO3 B;  4A3J G;  1BXT A;  1WTW A;  2K7V A;  3M4O B;  5JPM C;  3EJI A;  5LMU L;  3BG3 A;  4NB3 A;  5IGG A;  4OIJ A;  4FF3 A;  1G91 A;  3P75 A;  2R92 B;  1ASZ A;  3WOF A;  1YNJ C;  4KY6 A;  1CA6 A;  1V1P B;  5GAG C;  4WFN 3;  3CCU A;  4DV2 Q;  2A68 D;  2CW0 D;  1LTA D;  3B6Y A;  3L0O A;  1BDO A;  2R7Z H;  5IY0 A;  4BA1 I;  4IUN A;  2PQE A;  5E3F A;  1NBW A;  3CD6 A;  4DR7 L;  3FVQ A;  1HNW L;  2MPM A;  5K5P A;  2UUC Q;  1N33 L;  2K75 A;  4DN4 M;  5COY A;  3ONA B;  1PFN A;  1U4P A;  1EZ6 A;  3UE1 A;  1S5C D;  4X66 Q;  2F0Q A;  1XMQ L;  1HR0 Q;  4A3E H;  1OXS C;  3ER0 A;  1PA6 A;  1SNO A;  4OO1 I;  4A93 B;  2Z6K A;  1S3O A;  1UE1 A;  2UXC L;  4IJH A;  4CGY B;  2EVB A;  3AU7 A;  5IWA L;  4LF9 Q;  5IGE A;  4A3L H;  1ENF A;  1PH1 A;  5JEA G;  1QZH A;  2N3S A;  3X3M A;  1STA A;  4AYB B;  5C44 G;  1D5Z C;  1OXU A;  5C3E G;  3J81 i;  4C3J B;  3D8G A;  4C2M B;  4IPH A;  1HRJ A;  1EIY B;  1KAB A;  1NNX A;  3BDO A;  3STB D;  5IYB H;  3TP6 A;  5ELF A;  4C3H H;  1B9M A;  1B1Z A;  1Q90 A;  5C4X B;  3NTK A;  2F0P A;  1EUJ A;  4KJN A;  1CFM A;  2Z6K C;  1Q86 C;  2B2W A;  1JB7 A;  2DNC A;  4RMF A;  4ID6 A;  4YWM A;  5GAD C;  4JV5 L;  2EOT A;  3HOY B;  1QUQ A;  3RLF A;  3AB9 A;  5EGT A;  4CKE A;  4OX9 L;  1ZKO A;  1D7Q A;  1RD9 D;  5ELB A;  3K0Y A;  5HY6 A;  4HCE A;  2JYO A;  1ET6 A;  4L63 B;  4K14 A;  1VQI A;  3H0G G;  2E5L Q;  1IL8 A;  1SBB B;  3PUY A;  1MGS A;  4FP5 D;  3L7Z C;  4JYA Q;  3NE5 B;  5D14 A;  3VR4 A;  3V05 A;  2KVM A;  1GHJ A;  4LFA L;  3MXG A;  3HOU G;  2BH8 A;  3URY A;  2EYH A;  1EY7 A;  3KFU A;  1WFQ A;  2CCZ A;  1A6X A;  5BN4 A;  1TT2 A;  2VL6 A;  1HNX L;  4RGT A;  1TS3 A;  4RG1 A;  5IGC A;  4B3R L;  5JOB A;  3TZD A;  1KC8 C;  2Q2T A;  1IYJ B;  5FKA C;  1E2W A;  1C9O A;  2MUY A;  1UWV A;  2F0V A;  1E1O A;  2SDF A;  4A3M H;  4IUV A;  3G48 A;  1CQV A;  3BS1 A;  3IAY A;  1Q1B A;  3RUZ A;  3CU7 A;  3W1B A;  1VQ6 A;  1TU2 B;  2VQF Q;  1XNQ Q;  1U0L A;  3KLS A;  1A62 A;  2BOS A;  2BDO A;  4GKJ Q;  1PVO A;  3LGJ A;  1HHV A;  1H95 A;  2EDG A;  1UE6 A;  2E2J H;  2HCC A;  4DR4 L;  1WYD A;  1SR3 A;  2E75 C;  1BCP C;  1BO0 A;  3FP9 A;  4OWT B;  2Z8L A;  5IGD A;  2M9V A;  3GTL B;  4QIW E;  4IFD J;  3SK8 A;  1BR9 A;  1YHB A;  1L0W A;  3U9O A;  5EQ0 A;  4A3G H;  2J7Z A;  3S24 A;  2F0K A;  2HHH L;  2BE5 D;  1XWE A;  4BS9 A;  1EEI D;  2L9H A;  4DV7 L;  4DR1 L;  4Y52 H;  2ENB A;  3MXN A;  2UXD Q;  4YCV A;  1TWH H;  2KUM A;  2WII B;  1ILQ A;  4DF7 A;  2Z4I A;  4JPB W;  5KNC A;  5KGU A;  3DUZ A;  2NTT A;  4RHS A;  1YNN C;  2EYJ A;  1H9J A;  4KJO A;  3T51 B;  4JI5 Q;  2XIW A;  5HGQ A;  2Q8R E;  1U4L A;  2HDM A;  5I4D A;  1LT3 D;  4QL5 A;  1JE4 A;  4PMW A;  1SNC A;  4XDX A;  4F88 A;  3SE0 A;  3T1Y Q;  2YU9 B;  3I4M H;  3I7F A;  2UU9 Q;  2EY2 A;  4F7X A;  4LF6 L;  2EYF A;  2RDH A;  4TRD A;  1C0A A;  2JK8 A;  1HFN A;  5T1G A;  4C3I H;  3K5L A;  5ELN A;  4HIK A;  1KNA A;  3GTQ H;  4JBM A;  3G4S A;  4IQZ A;  3Q22 A;  2ZXO A;  4NPS A;  2EXZ A;  3PIP 3;  1X65 A;  1KRS A;  4KD4 A;  3PO3 G;  4DR2 L;  1D5M C;  3L2P A;  1K0S A;  3CC2 A;  1XPU A;  1B53 A;  4L5S A;  1CKM A;  1FNU A;  2KCM A;  2I07 B;  1AZP A;  4KHP Q;  2RDF A;  2K05 A;  4DV0 Q;  1SFO B;  2AKW B;  4S3S A;  4JI3 Q;  2FXQ A;  4KKT A;  1Y1W B;  1F2Y A;  3HG9 A;  4LUV A;  3H09 A;  1N8R C;  3GTJ H;  1BQQ T;  2B63 B;  2B29 A;  1T5X D;  4PMB A;  1KRT A;  2X6L A;  2PMZ B;  4ODG A;  3GTK B;  4JI0 Q;  2KEC A;  4IJL A;  2CH4 W;  2K5H A;  5AJ3 L;  3OW2 A;  3GTM H;  3IFT A;  4XQN A;  4UY8 C;  2I0Q A;  4HID A;  2RHQ B;  2G5D A;  2JA6 H;  4NP5 A;  4B3S Q;  1BCP B;  5EBD A;  1D5X C;  2D5D A;  2O4X A;  4JI2 L;  4A93 G;  2V1C C;  2ATW A;  1WCM B;  4MNO A;  3QB3 A;  2Q2U A;  1I50 H;  2K04 A;  2XN9 C;  4DXG A;  3K6O A;  3J80 E;  5C0X G;  1FGU A;  2A6H D;  4J6H A;  2F0U A;  3VYT A;  4AYB G;  1A2T A;  2E2H B;  1CK1 A;  1R9T H;  3QR8 A;  4C3J G;  5I6W A;  1B8A A;  1BUV T;  4DU9 A;  2E2I H;  3OWF A;  2RF4 A;  1SYC A;  2LKV A;  2I5L X;  2IY5 B;  3PIO A;  2Q2H A;  1MI2 A;  3CAM A;  1II3 A;  1I4R A;  1Q3L A;  1KDA A;  4DGZ A;  2MNA A;  3TRZ A;  4K8J A;  4BA2 I;  5C4X G;  4X3S A;  1WTX A;  2FMC A;  2F0N A;  2HD3 A;  2VQE Q;  1QE6 A;  4ZUJ A;  3PQI A;  2MHV A;  1TY0 A;  5COR A;  5FLX E;  3R8B A;  5LMU Q;  5A2Q L;  5HGT A;  2CQA A;  4JI4 Q;  2NVT H;  2O5J C;  5GAH C;  3HOY G;  4KHV A;  2A68 C;  4V19 0;  1KDB A;  2CW0 C;  4R4I A;  2AUK A;  2TMP A;  5FJ8 H;  1CKN A;  3S1M B;  4EVO A;  2WB1 E;  1G2S A;  4A3C H;  3S1R H;  3IL8 A;  3C1E A;  1DXM A;  4K6D A;  1K28 A;  2CHB D;  3JAM i;  5EKK A;  4DR3 L;  1PH2 A;  4DR7 Q;  2HDL A;  1HNW Q;  3PF5 A;  2F0D A;  1N33 Q;  4YCW A;  1EYA A;  1A3U A;  2XWB B;  4WJ4 A;  3Q8D A;  3HEJ A;  1N36 Q;  4B3M L;  4XTC S;  1WD1 A;  1XMQ Q;  2NN6 G;  1SAP A;  1O7Y A;  2YTV A;  1L0X B;  3X3N A;  1GUS A;  2PNH A;  1CQF A;  4JI7 L;  2N55 A;  5M5Y B;  3EA6 A;  3LNN A;  4GZY C;  1HPC A;  5IWA Q;  4YWL A;  4PV1 C;  2EYP A;  4IZ8 A;  4O0A A;  3STB C;  4N8F A;  3K58 A;  3F2B A;  3HOW B;  3H15 A;  4UPA A;  2K03 A;  3KBX A;  2K6A A;  1MJE A;  4OWW B;  3K5M A;  1X3Q A;  2DGY A;  4OON A;  3A7A B;  4IUU A;  4JBW A;  4K5X A;  2VS1 A;  3PUW A;  4XT1 B;  5K36 H;  1MKH A;  4IUR A;  2OTL A;  1B7Y B;  4E6I A;  3PF4 A;  3Q23 A;  2K1B A;  3KLS X;  2NVQ H;  4BY7 B;  1TWG H;  4JW0 A;  1AP0 A;  4GNX A;  1TWA H;  3MA2 B;  1GUN A;  2EYO A;  4ZYS A;  5H1S E;  1MJC A;  5JJZ A;  1Z47 A;  1OXT A;  5A2Q E;  2B2Y C;  4LUO A;  3ERO A;  1RF2 D;  3QJY A;  3M4P A;  3NPP A;  5JVH 3;  3S16 H;  1CHQ D;  3NTH A;  5M5W H;  1YJN A;  1F9S A;  3EN2 A;  3MXU A;  1PFS A;  3J7Y W;  3ITP A;  3OTO Q;  3E3X A;  1QIL A;  4TQU S;  4RKL A;  4LFA Q;  4I7Z C;  4IFD H;  4FXD A;  1QNK A;  1Q12 A;  1Y1V G;  3ND8 A;  2AUJ D;  3K5O A;  4PZ6 A;  3S17 B;  1EEF D;  5IIF A;  1TS5 A;  4B9X A;  3KF8 A;  4B3R Q;  3KLW A;  1CSP A;  3S1Q H;  3VA7 A;  1X3G A;  5LMN L;  5J22 A;  2I5H A;  3GV6 A;  4DAV A;  2B2T C;  2XRS D;  2XSC A;  3T16 A;  4B3T Q;  3DEO A;  2L15 A;  4KLK A;  2I5M X;  4DXF A;  3FKI B;  2ZTE A;  3ULL A;  2MP1 A;  1TQO A;  3P20 A;  1RDP D;  4U67 3;  4NDX A;  4K2K A;  1B2T A;  2RHS B;  4ILW A;  3R2T A;  2JA7 H;  1EOV A;  3QOJ A;  1Y1W G;  2NTS A;  3K5N A;  1EYG A;  1J5E Q;  1EYC A;  2ZJQ A;  1B44 D;  5E4W C;  2B63 G;  1SJH D;  3KDF B;  4MIU A;  3AFQ A;  2A6E D;  4H02 A;  3SHL A;  4Q5V A;  1AZQ A;  5C3X A;  4KN7 C;  1M8A A;  1JT8 A;  2NZ1 D;  3M3Y H;  1A8V A;  3CCJ A;  2B8F A;  3V96 A;  3S2H H;  1Q8I A;  2D62 A;  1GUO A;  4BBS H;  3S14 H;  4LF5 L;  1KDC A;  3P7J A;  4DR1 Q;  2J4X A;  3AFP A;  5LMN W;  1ESR A;  4L6T B;  1C7Y A;  2DY8 A;  2DNE A;  5CBE E;  1EYD A;  1WCM G;  5IP9 G;  3GTO H;  1JR0 D;  1MD2 D;  1J8I A;  3RLN A;  1ONL A;  1VQ9 A;  2F0J A;  2I46 A;  4POF A;  1K83 B;  1LLR D;  2IHF A;  2RKS A;  1X6O A;  4GKK L;  4L5Q A;  1JJ2 A;  4Y7N B;  3D4W A;  3A56 A;  1XPO A;  2GVA A;  2A74 C;  4HMI A;  1IW7 D;  4A76 A;  3PV0 A;  3A7L A;  1T5E A;  3EVQ A;  3RD4 A;  1BBX C;  3OW7 A;  3HKZ B;  4CDF C;  4P72 A;  5JEA J;  4NXM L;  1LUZ A;  4DR2 Q;  1DYQ A;  3F2U A;  1LTR D;  1P8L A;  1L1O A;  5DLQ E;  1I6H H;  2L55 A;  1S4Z A;  1LT5 D;  3OIP A;  1BOS A;  1GKH A;  4WOR A;  3PMF A;  1WTH A;  3CPF A;  3CP0 A;  3BZD B;  2CFM A;  1DCZ A;  4M8A A;  4NKL A;  5BR8 L;  1AN8 A;  4JK1 C;  1UAP A;  3TN2 A;  1SRU A;  4JI1 Q;  4DV6 L;  5JPN C;  1EFI D;  1Y8O B;  2ICI A;  2L5T A;  2LXK A;  4CKC A;  4ZKC B;  2PZT A;  2HUG A;  1S72 A;  1KL9 A;  2B2U C;  2MO0 A;  4QF4 A;  3TP5 A;  2QA4 A;  4C56 C;  2KCC A;  2JA5 H;  1LTS D;  1EU3 A;  4A3I H;  4K0K L;  1WI5 A;  3HGB A;  2QEX A;  3KBG A;  2OCE A;  3OIQ A;  4A3K B;  1EQV A;  3DWQ A;  2KED A;  4HAE A;  4JI2 Q;  4ZUI A;  4JVZ A;  1S5F D;  3NK9 A;  2A6H C;  2OWO A;  4QCL A;  4OWX B;  4BY1 H;  4CKB A;  3BYY B;  3H6M A;  1K3R A;  3DM3 A;  2MQH A;  1O7L A;  2BDN A;  4IFD I;  3HOW G;  4DK3 C;  2JEA I;  3NWS A;  2K5Q A;  4ZCK A;  3F2C A;  3CXC A;  3S2D H;  2OT2 A;  3M4Y A;  3W1G A;  3S1N H;  2B39 A;  3D0F A;  3RN5 A;  1DOK A;  5C4J B;  2J0T D;  1K8O A; 
#chains in the Genus database with same CATH homology
 3PGZ A;  1SRO A;  4QIW E;  3HOV H;  4IFD J;  1AE3 A;  3T1H Q;  1FL0 A;  1YHB A;  1L0W A;  4JC0 A;  2XGT A;  5FLM H;  2JA7 G;  3DLL A;  2K50 A;  1N32 L;  3UDG A;  4A3G H;  2R7Z G;  3M9B A;  4BY7 G;  3S24 A;  4X62 L;  4P74 A;  2HHH L;  1YIJ A;  4YCU A;  5E7N A;  1N32 Q;  4ALP A;  2F3I A;  1SLJ A;  2GVB A;  4X66 L;  1E1T A;  1Q46 A;  2EXD A;  4X62 Q;  1EQR A;  1N34 Q;  2HHH Q;  1X54 A;  4MTN A;  4DV7 L;  1HNZ L;  4DR1 L;  1RIP A;  2YTX A;  4AIM A;  4DAY B;  4Y52 H;  1EFW A;  3KOJ A;  2UXD Q;  1KXL A;  4YCV A;  1IBL Q;  1TWH H;  4AYB E;  4DV7 Q;  5IYC G;  1LM0 A;  2H5X A;  1HNZ Q;  3FHW A;  4UP8 A;  4DUY L;  4LUZ A;  5M3M H;  2ID0 A;  3KDF A;  4JI5 Q;  4DR3 Q;  5IYD G;  5HGQ A;  4HIM A;  4A3E G;  1TXY A;  2F4V L;  3IRB A;  1JJG A;  2UU9 L;  4BBS G;  3F1Z A;  3RN2 A;  2Y0S G;  2ALY B;  4QL5 A;  3J80 c;  4PMW A;  3T1Y Q;  3I4M H;  4X6A H;  2MO1 A;  3A74 A;  2KEN A;  4GLV B;  4LFC L;  3I7F A;  4JOI A;  4A75 A;  3KF6 B;  4A3K H;  3JC6 6;  2UU9 Q;  3ZJY C;  2F4V Q;  3GTG H;  2DUD A;  1T9H A;  3GD7 A;  4LF6 L;  1C0A A;  2JK8 A;  2ZM6 L;  3CPW A;  4C3I H;  2JJQ A;  4A3L G;  3AYH B;  5ELN A;  4HIK A;  4LF6 Q;  1X3E A;  1Q7Y C;  4P75 A;  3CCE A;  2ASB A;  3GTQ H;  1E7Z A;  4JBM A;  3G4S A;  3HKZ E;  2N49 A;  2JEB I;  1YJ9 A;  5JJI A;  2K5N A;  2KHI A;  1PYS B;  1KQS A;  1K8G A;  2R92 H;  2LXJ A;  4NPS A;  5JJK A;  1X65 A;  1HZC A;  5IYB G;  4LF4 Q;  1KRS A;  1VQC A;  1OXX K;  4IO9 A;  4DR2 L;  3PO3 G;  3L2P A;  2IT1 A;  1Q81 C;  1MIU A;  3CC2 A;  1XPU A;  4BXX H;  4L5S A;  1CKM A;  2KCM A;  3A5U A;  4GNX B;  3FKI G;  4KHP Q;  5FLX c;  5C4J H;  1YEZ A;  3JAM c;  2UUB L;  1HR0 W;  4DV0 Q;  2AKW B;  1EIF A;  1X55 A;  4JI3 Q;  2FXQ A;  3GTL H;  2AHO B;  5JJL A;  3TRE A;  3K8A A;  5J3B A;  4GN3 B;  5IE8 A;  1XNR L;  4LUV A;  1YVC A;  3RZO H;  1N8R C;  3GTJ H;  2VY3 A;  1VQL A;  2B29 A;  3HOX H;  1RL2 A;  1KRT A;  3H3V H;  2AWO A;  1OTC A;  4KHZ A;  1LYL A;  3HKS A;  1PH8 A;  4DV1 L;  4JI8 Q;  3VDY A;  2A19 A;  1FVI A;  3CCS A;  1B70 B;  4JI0 Q;  2BA1 A;  1VQ4 A;  3CCL A;  4IJL A;  3J7A 5;  2K5H A;  2ES2 A;  1W2B A;  5AJ3 L;  3OW2 A;  3GTM H;  1QVC A;  4UY8 C;  2I0Q A;  1Z9F A;  4IOC A;  1K0R A;  1VQG A;  2IX0 A;  5AJ3 Q;  2RHQ B;  1VQF A;  4HID A;  2JA6 H;  1UE5 A;  1L1O C;  4B3S Q;  3HOZ H;  4A4I A;  1VQ5 A;  5M3F H;  2VUM H;  1I94 Q;  1HZA A;  4JI2 L;  3KF8 B;  4YY3 Q;  4A93 G;  2N78 A;  1VQB A;  2V1C C;  2YU9 H;  2ATW A;  2CWP A;  2PI2 E;  4MNO A;  4NXN L;  4C2M H;  1Y1V H;  2JA5 G;  2Q2U A;  4GLA C;  1I50 H;  1PH9 A;  4A3I G;  2JA9 A;  4BBR H;  5C0X G;  4GN5 A;  1Q8K A;  1FGU A;  1JE5 A;  3PUZ A;  1YIT A;  4AYB G;  1PH3 A;  2VQF L;  2D0P A;  1XMO Q;  1XNQ L;  4A3B H;  1R9T H;  1FJG Q;  4GKJ L;  3PCO B;  1YZ6 A;  1B8A A;  2E2I H;  2KBN A;  4A3J H;  2RF4 A;  1VQA A;  4OXP A;  4AQY L;  2I5L X;  4X64 Q;  4DV3 Q;  5C0X I;  4A3M G;  2IY5 B;  4BY1 G;  4DKA C;  2Q2H A;  3PIO A;  4DUZ Q;  3CAM A;  4AQY Q;  2MNA A;  1WOC A;  1S40 A;  4BA2 I;  3J80 i;  3TRZ A;  5C4X G;  1CKO A;  2BH2 A;  3T1H L;  2CQO A;  4GOP A;  1BKB A;  2EIF A;  2R93 H;  3W5O A;  3NEM A;  2VQE Q;  5LMN Q;  3CW2 C;  1SFO H;  1YNX A;  3ULP A;  4QQB X;  2YV5 A;  2EQS A;  1GM5 A;  2XTI A;  4JI4 L;  4JCV E;  5M5X H;  3CCM A;  4DR5 L;  1IBK L;  3I4O A;  3HKZ G;  5C0X J;  1Y1W H;  2PI2 A;  3I55 A;  5LMU Q;  3CCV A;  1PHJ A;  4L5T A;  1TWC H;  4JI4 Q;  4DR5 Q;  1IBK Q;  2B63 H;  2NVT H;  1N34 L;  1OXV A;  5GAH C;  4R4O A;  3HOY G;  4FDB A;  3HOV G;  4R4I A;  3PUV A;  3GTK H;  2UXD L;  3E0E A;  3M4Q A;  1IBL L;  5FJ8 H;  3U4Z A;  1CKN A;  1AH9 A;  5FLM G;  5ELO A;  2JE6 I;  2WB1 E;  2WFW A;  4APV A;  4A3G G;  4HIO A;  4R4T A;  2OQ0 A;  4A3C H;  3MEF A;  3S1R H;  1V1Q A;  1I5F A;  4JI5 L;  3JAM i;  4DR3 L;  3KJO A;  1TWF H;  1JMC A;  1GO3 E;  1PH2 A;  1NJI C;  5GRO A;  3U4V A;  3T1Y L;  1K8A C;  3EBE A;  4DR7 Q;  4LNQ A;  3CF5 A;  3PF5 A;  4L5R C;  1HNW Q;  1P16 A;  1N33 Q;  4XIG S;  4YCW A;  1HZB A;  3HOY H;  2VNU D;  4DV5 L;  1L2F A;  4LF7 Q;  3K7U C;  3ULJ A;  2ZJR A;  1N36 L;  5IP9 H;  1WCM H;  1X56 A;  2CWA A;  1VQ7 A;  2KCT A;  5M3M G;  4DV5 Q;  4WJ4 A;  1IZ6 A;  1E24 A;  3Q8D A;  1N36 Q;  3F2D A;  2ZJP A;  4XTC S;  3GO5 A;  5C44 H;  3CCR A;  1YHQ A;  4B3M L;  4WJ3 M;  3UDF A;  1O7I A;  2NN6 G;  3E9H A;  4YWK A;  5C3E H;  1XMQ Q;  2YTV A;  4B3M Q;  3I4M G;  4R4Q A;  2E2H H;  1WJJ A;  4A3K G;  2NVX H;  4LF5 Q;  4LF4 L;  4HJ9 A;  2PNH A;  1VS0 A;  4QGU A;  4JI7 L;  3PIP A;  1M1K C;  4IPG A;  3UE0 A;  5IWA Q;  1Q82 C;  1X9N A;  2NN6 I;  3CC4 A;  4JI7 Q;  4YWL A;  2ZTC A;  3E9I A;  3TS0 A;  4KHP L;  2K14 A;  4O0A A;  4A3D H;  3STB C;  1BBW A;  3KF6 A;  1YI2 A;  2D0O A;  4O2D A;  3F2B A;  3TEH B;  4DV0 L;  3H15 A;  4JI3 L;  4UP7 A;  4HJ8 A;  4UPA A;  2IX1 A;  1L1O B;  1QVG A;  1QUQ B;  2R92 G;  3S15 H;  1VQP A;  5IT9 c;  1EQQ A;  1NMG A;  2PMZ E;  1PYB A;  4JOI C;  1MJE A;  4QJF A;  3U58 A;  2HQL A;  4OWW B;  2DGY A;  4POG A;  1A0I A;  2K52 A;  3BZK A;  4OON A;  3BZC A;  4JBW A;  1BBU A;  2VS1 A;  3NEL A;  3PUW A;  5GAE C;  1GD7 A;  1IBM L;  2HIV A;  3GDE A;  2NVY H;  4LW1 A;  3UDI A;  4BXX G;  1E22 A;  4KI0 A;  1MKH A;  2OTL A;  4JI8 L;  2C35 B;  1B7Y B;  2IHE A;  4YHH L;  1IBM Q;  4JI0 L;  4JI6 L;  2VZA A;  1VCI A;  3PF4 A;  1VQ8 A;  1NTG A;  3RNU A;  1SE8 A;  4IOA A;  4YHH Q;  4JI6 Q;  5IP7 H;  2NVQ H;  1TWG H;  4LFB Q;  3CMA A;  4GNX A;  3S1M H;  1TWA H;  4TVA B;  3G6E A;  3H0G H;  1PH5 A;  2B3G A;  4LF8 Q;  5H1S E;  3HOX G;  4DV4 Q;  1HJP A;  3CCQ A;  1MJC A;  4B3S L;  3M85 A;  1Z47 A;  1OXT A;  4DR6 Q;  4LUO A;  2HIX A;  2UUA L;  4A3F H;  1I94 L;  1HZ9 A;  4DNI A;  1PH4 A;  3F8T A;  3M4P A;  4YY3 L;  3J81 c;  2YYZ A;  2UUA Q;  3HOU H;  3S16 H;  1V9P A;  1IXR A;  5M5W H;  1YJN A;  1PV4 A;  3U50 C;  5BR8 Q;  3H3V I;  3EN2 A;  1G6P A;  3OTO L;  4DK6 C;  1V43 A;  1PFS A;  3KYH C;  4PZ7 A;  4DV6 Q;  1VQO A;  4GN4 B;  3OTO Q;  2JA6 G;  3HOZ G;  2OTJ A;  1VQJ A;  1XMO L;  2PQA A;  4QY7 A;  1NE3 A;  5M3F G;  4TQU S;  4B3R Q;  2JA8 H;  2VUM G;  2WB1 G;  4EX5 A;  1FJG L;  2QGQ A;  1I3Q H;  3OYY A;  4LFA Q;  4X65 L;  3G71 A;  1EWI A;  4X64 L;  4DV3 L;  3I4N H;  2UXB Q;  1Q12 A;  1Y1V G;  4DUZ L;  5M5Y H;  1D8L A;  1KHI A;  1DGS A;  4X65 Q;  1LTL A;  2A1A A;  4PZ6 A;  4HJ7 A;  4ME3 A;  4BBR G;  3M7N A;  2R7F A;  4K0K Q;  1Q1E A;  4DAM A;  3A5Z B;  4R1J A;  3KLW A;  1CSP A;  4P71 A;  2AMC B;  3S1Q H;  2YTY A;  1X3G A;  2Z0S A;  1J6Q A;  2I5H A;  4JG2 A;  2VQE L;  4AH6 A;  5LMN L;  1K73 C;  3HOW H;  3ICE A;  4A3B G;  5EAY A;  4HJA A;  4A3J G;  4B3T L;  1ASY A;  5LMU L;  4NB3 A;  1KD1 C;  4B3T Q;  4KLK A;  2L15 A;  2I5M X;  2RCN A;  2ZTE A;  1PH7 A;  3ULL A;  4GLX A;  1ASZ A;  3GTP H;  2K5V A;  2K4K A;  1K9M C;  1BVS A;  4DPG A;  1KIX A;  5GAG C;  2R93 G;  2RHS B;  2JA7 H;  1EOV A;  3PSI A;  1J5E L;  1VQN A;  3CCU A;  4DV2 Q;  1VQK A;  1NY4 A;  1Y1W G;  2R7Z H;  3B6Y A;  3L0O A;  2Q2I A;  3K81 C;  3MXN B;  1EYG A;  1CUK A;  5IY0 A;  1J5E Q;  2ZJQ A;  4BY7 H;  4BA1 I;  3ERS X;  2B63 G;  4LWC A;  1NBW A;  3K80 C;  2UUC L;  1VQM A;  2WP8 J;  3CD6 A;  4DR7 L;  3KDF B;  3AFQ A;  4GOP C;  2UUC Q;  1HNW L;  5FJ8 G;  4H02 A;  1GVP A;  2ZTD A;  1N33 L;  1KAW A;  2K75 A;  4LF7 L;  4OO1 G;  5IYC H;  2R6G A;  4A3C G;  1HR0 L;  1JT8 A;  1XPR A;  3M3Y H;  1A8V A;  3RZD H;  2OQK A;  3CCJ A;  3UE1 A;  3HFZ B;  3CQZ H;  2WAQ E;  4X66 Q;  1XMQ L;  1HR0 Q;  1IL2 A;  3S2H H;  5IYD H;  4A3E H;  1OXS C;  3ER0 A;  2D62 A;  1PA6 A;  4BBS H;  4OO1 I;  3S14 H;  4IPC A;  4LF5 L;  2Z6K A;  4MZ9 A;  1S3O A;  4DR1 Q;  3AFP A;  1UE1 A;  4LF9 L;  2UXC L;  3NBH B;  4IJH A;  5LMN W;  1C7Y A;  2CKZ B;  3GTO H;  3PUX A;  5IP9 G;  1WCM G;  5IWA L;  4LF9 Q;  2UXC Q;  4DUY Q;  4A3L H;  1PH1 A;  5JEA G;  1QZH A;  2N3S A;  3RLN A;  2GN5 A;  5C44 G;  3S17 H;  1XJV A;  1VQ9 A;  1OXU A;  1UEB A;  5C3E G;  3J81 i;  3RLO A;  4JBK A;  4POF A;  2IHF A;  2MFI A;  4IPH A;  1X6O A;  3PO2 H;  1EIY B;  4GKK L;  4L5Q A;  4LFC Q;  1JJ2 A;  5IYB H;  3STB D;  3KJP A;  3PO3 H;  2ZM6 Q;  4GKK Q;  1XPO A;  1U5K A;  2GVA A;  4C3H H;  3M4O H;  1HH2 P;  1G51 A;  4A3D G;  4A76 A;  2AWN A;  3FKI H;  3PV0 A;  5GQO A;  4PG3 A;  1EUJ A;  3PO2 G;  3AQQ A;  1UE7 A;  1AE2 A;  2Z6K C;  3J7Z C;  1Q86 C;  1M90 C;  2VW9 A;  4LFB L;  2NZH A;  4HJ5 A;  1JB7 A;  1NMF A;  3EIV A;  4RMF A;  4P72 A;  4YWM A;  1VQE A;  5JEA J;  4NXM L;  5GAD C;  1LUZ A;  4DR2 Q;  4JV5 L;  4LF8 L;  1SMX A;  3RR5 A;  4DV4 L;  3SGI A;  4UP9 A;  5K36 G;  4R4C A;  3I56 A;  3D31 A;  4NXM Q;  1P8L A;  1L1O A;  5DLQ E;  1QUQ A;  4DR6 L;  1I6H H;  4JV5 Q;  1GKH A;  3RLF A;  3TQY A;  1A63 A;  2UUB Q;  4OX9 L;  3CPF A;  3CP0 A;  1D7Q A;  2BA0 A;  2E8G A;  1N9W A;  1VQD A;  4JI1 L;  2CFM A;  5IP7 G;  5BR8 L;  5HY6 A;  2E5L L;  1E3P A;  2Y0S E;  4OX9 Q;  1XNR Q;  3AEV A;  3NEN A;  3I2Z A;  1SRU A;  1VQI A;  1QVF A;  4JI1 Q;  4JYA L;  3H0G G;  1YJW A;  4DV6 L;  2E5L Q;  4P73 A;  2A8V A;  3PUY A;  2LXK A;  3L7Z C;  4JYA Q;  1G29 1;  3CC7 A;  4A3F G;  1CSQ A;  1S72 A;  2PQA B;  1KL9 A;  1YBY A;  4DV1 Q;  2LSS A;  2N8N A;  4LFA L;  3K7A H;  2MO0 A;  2KHJ A;  3HOU G;  4A93 H;  2BH8 A;  2QA4 A;  4J15 A;  2JQO A;  1Y14 B;  3KFU A;  2UXB L;  1VQH A;  3J81 j;  1WFQ A;  2CCZ A;  4GNX C;  2JA5 H;  4EQ5 A;  2VL6 A;  1HNX L;  4PZ8 A;  4GS3 A;  3CME A;  4RG1 A;  4A3I H;  4K0K L;  1JJC B;  1WI5 A;  3A0J A;  3TS2 A;  4B3R L;  1YHA A;  2QEX A;  1HNX Q;  2JA8 G;  2OCE A;  3UDX A;  1SN8 A;  1KC8 C;  2Q2T A;  1IYJ B;  4C3J H;  1K83 H;  1C9O A;  3BJU A;  4JI2 Q;  1UWV A;  4IFD G;  4GOP B;  2F52 A;  1E1O A;  2OWO A;  3I4N G;  4OWX B;  2WAQ G;  4A3M H;  1QZG A;  4NXN Q;  4Y7N H;  3G48 A;  3WWV A;  3BU2 A;  1Q1B A;  4BY1 H;  1K3R A;  3DM3 A;  4JBJ A;  3W1B A;  1PH6 A;  1XTD A;  1VQ6 A;  5C4X H;  2MQH A;  2VQF Q;  3K0X A;  1X3F A;  1U0L A;  4IPD A;  1XNQ Q;  4DK3 C;  2JEA I;  3HOW G;  4IFD I;  2R7D A;  1A62 A;  4GKJ Q;  4DV2 L;  3LGJ A;  3F2C A;  1PVO A;  3CXC A;  1H95 A;  1UE6 A;  2E2J H;  3S2D H;  4DR4 L;  3W1G A;  1CKN B;  3S1N H;  1WYD A;  1SR3 A;  3D0F A;  3RN5 A;  4DR4 Q;  2HT1 A;  3FP9 A;  4OWT B;  1W3S A;  2NZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...