2F0FA

Crystal structure of staphylococcal nuclease mutant l25i
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0fA00
1TT2A 2PYKA 2EY6A 3OSOA 2O4XA 2F0GA 1IHZA 2LKVA 5EKKA 4QF4A 5IGBA 2F0EA 3DMUA 3SHLA 2F0SA 4KJNA 1ENCA 4NKLA 5CV9A 5F2DA 2F3WA 3D4DA 4IUNA 4K5VA 3SK8A 3R3OA 1NUCA 1ENAA 4ZUIA 5JAVA 1KAAA 4RKLA 3P1HA 2EYHA 3SXHA 1SYBA 5CC4A 3NHHA 2F0MA 4IALA 4NDXA 5CGKA 1EY4A 2F0IA 4K5WA 4QMGA 3LX0A 3PMFA 1SNOA 4WORA 5IGEA 2F0JA 2EYPA 1A3VA 2EYMA 5IGFA 3C1EA 4NMZA 2F0OA 2OF1A 2F0LA 5IIFA 3BDCA 4E6IA 5K5PA 2F0NA 1JOKA 3SK4A 2F0FA 1EZ6A 2EYOA 2RBMA 1SNDA 4KY7A 1STBA 3U9OA 3E5SA 4EVOA 5IGGA 2EXZA 4F8MA 2EY5A 1EY5A 3BDLA 3NQTA 4N9PA 4K8JA 5I6YA 1F2YA 1SNQA 5JOBA 3TP8A 5IOCA 5HURA 2PZWA 4HTHA 4J6HA 1EY6A 5IODA 2F0TA 4J1MA 5C3WA 4ID6A 3OMGA 1EZ8A 3MXPA 5KYLA 4TRDA 4DF7A 5C6AA 5M9OA 4K2KA 5CV4A 5ISRA 3D4WA 4NP5A 3T13A 3MHBA 2EY2A 2F0WA 1STYA 1A2UA 4PMCA 5C4HA 1SYGA 1A2TA 2RKSA 1U9RA 4K5XA 5CR3A 4KHVA 5KEEA 4ODGA 1SNPA 3D6CA 5CV8A 3S9WA 3C1FA 2PW7A 2EYLA 5CV7A 4EQNA 3MZ5A 4K8IA 2EYFA 4HMIA 5I9PA 4QB4A 3H6MA 3D8GA 3SK5A 1TR5A 4S3SA 1EYCA 1SYDA 5KGUA 4N9TA 1KDAA 3NXWA 4DGZA 2PW5A 1EYDA 1EY8A 1JOQA 2F0VA 3ITPA 4B9XA 2OEOA 1STHA 2PQEA 2QDBA 4K6DA 5E1FA 2KQ3A 1SYCA 3EROA 5DEHA 5IGDA 5IGCA 2F0PA 2PZUA 4YIJA 5DAUA 4EQPA 4F7XA 2F0QA 3ERQA 1A3UA 2EY1A 2M00A 3OMCA 4H7BA 3OWFA 4KY6A 4PMBA 3HEJA 1KDBA 3TMEA 5C4ZA 5C5LA 5I9OA 1EY9A 3MEHA 4PNYA 4EQOA 5E3FA 4KD4A 1SYEA 1STGA 4KD3A 3QB3A 4KY5A 3P75A 4ME5A 4MIUA 2NUCA 3QOJA 2KHSA 5NUCA 5CV5A 2F0KA 1KABA 3HZXA 3DHQA 3TP6A 4K2LA 2F0UA 5CV6A 5J22A 4B9WA 5J1ZA 4OL7A 3NUCA 1EQVA 5EGTA 5C5MA 4ZQ3A 1EY7A 1F2ZA 4DFAA 5I6WA 4IZ8A 2HQEA 2OXPA 3NP8A 1F2MA 4G57A 4LAAA 4KV6A 4RKBA 1SNCA 1SNMA 2EYJA 2F0DA 3NK9A 3RUZA 3SR1A 2SOBA 3TP7A 5KYIA 1JORA 5HGTA 3EJIA 3V2TA 5J39A 1EYAA 4DU9A 2SNMA 4KJOA 1A3TA 1STAA 1AEXA 4KTAA 2SNSA 2RDFA 5KRUA 4WRDA 1RKNA 1EY0A 2ENBA 3EVQA 3QOLA 5EKLA 3TP5A 5KIXA 4K14A 4R8NA 4I65A 2F3VA 5C3XA 4HMJA 2PZTA 3MVVA 1NSNS 1KDCA 1STNA 1JOOA 4ZUJA 3SK6A 3T16A 1SYFA 3VA5A 2WACA 1TQOA 2F0HA 1II3A
chains in the Genus database with same CATH superfamily
1TT2A 3H3VH 2PYKA 4IUUA 1WJJA 3GTLB 1VQKA 1KRSA 1AH9A 4DAYB 1PHJA 1XTCD 2FMMA 1W3SA 4A3IH 5KNDA 5JAVA 1KAAA 1BDOA 1BCPF 5CC4A 3GDEA 2DY7A 4P73A 3AMUA 2R92B 1A15A 3F8TA 2NZHA 3R93A 2QKIC 1JT8A 3S1MB 3BDCA 4LF8Q 1NCVA 4GKKQ 1K0SA 5CMDA 4WJ4A 1AE3A 1RJTA 1U5KA 1EIHA 4L5TA 1EQQA 3PUVA 1MIUA 3TP8A 1A63A 4HTHA 1VQ9A 5AJ3Q 1K83B 4LF8L 5M3MG 3V05A 4Y52H 1OXXK 3PF5A 4GKKL 2CW0D 3A74A 5C0XI 2X69A 4JBJA 4O2DA 1QJOA 4CJ1B 2V1CC 1E1OA 3HOZH 1PFBA 1LTGD 3QO2A 4FF1A 1EWCA 2F03A 5AJ3L 1S5CD 2R3ZA 3PUZA 4EQNA 1SEBD 1YEZA 3H6MA 3HG9A 4L8JA 5FLXE 4LW1A 1KQSA 1SYCA 3HOYH 1TWFB 2FHTA 1I6VC 1MKHA 2AWOA 4LF5Q 3HEJA 3K7AH 4OELB 3I70A 4DA2A 3MWYW 3NSWA 3RNUA 2KHSA 4XQNA 2BH2A 2HDMA 4DNTB 1EOTA 5EQ0A 2EPBA 4IOAA 4GOPA 4BY7H 3J7AV 4CBVA 3KDFA 4LF5L 1GUGA 5M5WB 3U9SA 1DOKA 4IN3A 3HOUH 1ZXTA 3GO5A 3TP7A 4A3JB 1DXMA 5COYA 4DU9A 1AN8A 1PYWD 2A6EC 1ET6A 1VQ6A 2BCOA 2A69D 4IOCA 1KNEA 4B3RQ 2WACA 4DV6L 4S3SA 3TS2A 2AKWB 2D62A 3DMUA 1X65A 2F0SA 1BXTA 1UEAB 4IUTA 3CRLC 4JV5L 1A8VA 1HTPA 1S5BD 1T9HA 3P1HA 5GROA 5JVG3 2JA7H 4NDXA 3S2DH 3D31A 5M3MB 3GTQH 1S40A 4B3RL 5JJKA 1QUQB 3HOVG 1I4QA 1M8AA 2B63G 3UDXA 2VS1A 3CCQA 1GXDC 1DYQA 3JAMi 1WTVA 1SNDA 1BQQT 3KLSA 4LWCA 4F8MA 2YTXA 4A76A 1GKHA 4P75A 3CCMA 1SFOB 2ES2A 2KEEA 1ONLA 3E9HA 3F1ZA 4H02A 3AFQA 1Q90A 2E2DC 2RA4A 3A55A 4A93H 5C4XB 3EIVA 1YITA 5EKIA 1P8LA 2B8FA 4A3FG 2BE5D 4TKOB 2NVYB 2B2WA 4LF9Q 2KVMA 3DLLA 2K7VA 1Y1WH 2AUJD 3DUZA 1A2TA 4YHHQ 3S9WA 4QY7A 1D1KA 4L5QA 1FL0A 1E22A 4LF9L 2PQEA 2F0PA 5DAUA 4PG3A 3RZOB 2F0QA 1H9SA 2RDGA 3QJYA 4HAEA 3ERSX 4EQOA 4HIMA 2WV6D 4HR7B 3U4VA 5T1GA 1TS3A 3MXNA 1SDFA 1LTBD 1KXLA 1L1OB 3DHQA 1VQBA 3AQQA 4LF6Q 4HIDA 4KKSA 4KN7C 4G57A 3S14H 3SR1A 5CBEE 1PMRA 1Q12A 3K5LA 1B50A 1A3TA 1CQFA 2EJMA 4DUZQ 1GUTA 4HJ7A 1V8QA 1HNWL 4R8NA 4F88A 4HMJA 5M3FB 1MSGA 5C4JH 3CHBD 1VQ4A 3KF8A 3J81c 4DUZL 1EFWA 1O78A 4LJZC 5HGQA 2DJFC 1SYBA 3NHHA 5LL6X 3J80i 2F0IA 4K5WA 4X66Q 1TY0A 1YHAA 2F0JA 4RCOA 3PO2B 4A3FB 1V1QA 2UXDQ 2NN6G 2N8NA 1E3PA 5IYDH 3A5UA 4ZYSA 3DWAA 2BA0A 4A3GG 2WINB 3IFDA 5IY0A 5JEAG 4DK1A 3K7UC 2KOLA 4X66L 1K8OA 2K5NA 4IQZA 1BNZA 2UXDL 2MO0A 4LF7Q 1XPOA 5LMUQ 2I0QA 2JA8B 2P5ZX 3GTKH 3CPWA 3TZDA 3RN5A 3ND8A 3UDIA 4BBSH 1TS4A 1AE2A 5C0XH 2E8GA 1RDPD 3G7LA 3I4MG 3EA6A 4JI5Q 4LF7L 5LMUL 1KIXA 4WJ3M 1CKMA 4X64Q 1LT6D 4A3IG 3I55A 2BH8A 1TWHH 2JEAI 3F2UA 2JA5H 3IKJA 5E1FA 3TDQA 5FLXL 2VUMG 3D6WA 1S72A 4CJ2C 2LY7A 3ERQA 1Q1EA 1HNZQ 1KDBA 3M9BA 3K0XA 4JI5L 1EY9A 4KD4A 1C4QA 4X64L 1RODA 4FYDA 2R7ZH 1NNXA 1TY2A 2HT1A 5EBDA 3J7ZC 2NZ1D 2Z8LA 4HCSA 2JA6B 5CV6A 3UE0A 4GN5A 1HNZL 3M3YB 4O0AA 4DK3C 1HRJA 4A3EG 2CHBD 4A3MB 1A62A 5CORA 1LT5D 4XQJA 3I4NH 1EIGA 3K58A 2L15A 3NTHA 4IFDJ 2JYOA 4M1UB 3TP5A 2XSCA 1SE4A 3ND9A 4MN3A 2GVAA 2LMCB 3NBHA 1JMCA 4ZUJA 2Q8IB 1C0AA 1V43A 4RCNA 1XNRQ 1EOVA 1EWHA 1WD1A 4A3GB 1F9QA 1N36Q 4QUCA 3ER0A 2Y0SG 3HKZB 1FNVA 4IUNA 1N8RC 2ID0A 1IBLQ 4RKLA 4DV3Q 3QG1A 3SXHA 3M4OB 3KLRA 3LX0A 3PMFA 1SNOA 5IYCG 4NXMQ 4C2MB 4C3HB 2EYPA 4DUYL 1XNRL 5DM63 1HQMC 1PZID 2OF1A 2F0LA 2PMZB 1N36L 1E0BA 1LACA 2LS01 2O5IC 2PQAB 2NVTB 1IBLL 4DV3L 1SNQA 4A3DB 4A3LH 1F9RA 3TSSA 4NXML 3HOUG 2B8GA 1NR2A 2B39A 5KYLA 4A3IB 2KJXA 3I73A 3E9IA 5CV4A 2AHOB 1G91A 1BR9A 3T13A 2ZJQA 2VUMB 1VQ7A 4ZKCB 1ESFA 1SJED 3FDTA 4CHTB 2ZM6Q 4ZCKA 1A6XA 4QIWE 2AUKA 2EYLA 3HKSA 4FF3A 3STBC 1RTOA 4X6AH 3S1NH 2Q2HA 2XWBB 3FRPB 2KEDA 1PZKD 3A7LA 3CCVA 1T5EA 3I4OA 2EDGA 3BYYB 5HY6A 4NB3A 2ZM6L 4BXXH 4CKBA 2RSNA 1HFGA 1A3UA 1QNKA 2N88A 2L9HA 5C4ZA 4EQ5A 1V1PB 5E4XA 2FJ2A 3HOZB 2E2HH 1IYVA 3PO3H 3DWPA 3A8KE 3FPUB 2EJGC 3OW2A 4IUVA 1EL0A 4C3IG 4M8AA 4A3CH 1XPRA 1QILA 1SE8A 5KNBA 2Y0SB 2F0DA 1V9PA 1VQLA 1YNND 4PZ6A 3F2DA 1IW7C 3HOYB 1B9NA 1NR4A 1WFQA 1BOSA 1GOZA 4FNFA 3K7AB 1M90C 3S1QH 2WB1G 3FMCA 4X3UA 3AB9A 2Z6KC 2RCNA 2K05A 4C1NK 3Q24A 2LKVA 2QW7A 4BY7B 1TKWB 2ZTCA 2JP1A 4XDXA 4ME3A 3HOUB 4MTNA 4NW2A 1VQIA 3H3VC 2N3SA 1H9JA 3K0YA 1JWSD 4HJ5A 2AQ2B 4X65Q 4BY1H 1JOKA 2NB0A 2N49A 2K75A 5I6YA 3T53B 5IT9E 1GUSA 5M5XH 3VYSA 2MJ8A 3I91A 1IBMQ 3HKZE 3H15A 2PNRC 1YJNA 1K8MA 4C3JH 2AQ1B 2Z9HA 3H09A 3MTSA 1WVLA 1STEA 1JB7A 3CXCA 4X65L 2PCFB 1LTLA 3S2DB 1Q8IA 2JA7B 4ILWA 1KHIA 3GTQB 1SE3A 4BA2I 1X3EA 1IBML 4K5XA 3B6YA 4QCLA 4JBWA 3CC7A 3U4ZA 2Z1CA 1EU4A 1EQRA 4U68A 5ELFA 5I9PA 3HGBA 5DLQE 1XXGA 3SK5A 5FO9B 3QWNA 1FYCA 3KDFB 2OEOA 3R8BA 1STHA 4G7HC 4MTKA 4JI3Q 5DEHA 2Q2TA 2R92G 4A93B 1G2SA 1F2LA 1YBYA 1RIPA 3A56A 1PTOC 2JK8A 5BR8Q 2QEXA 2I5LX 4PNYA 2K50A 3LNNA 4KD3A 4A3BH 4R4CA 1NBWA 3DM1A 1E1TA 3F2BA 3G4SA 4JI3L 1IXRA 3RLOA 4R4IA 3W5OA 5J22A 4B9WA 2NVXH 5ELNA 4RHRA 3A54A 5BR8L 1H95A 3JAML 1CA5A 2N55A 1EYAA 4DV5Q 1U4RA 4FXDA 2E2IB 2NTSA 4DR2Q 3SGIA 1MHWC 1VQGA 2ENBA 4XIGS 4BBSG 3KF6A 3KBXA 3AYHB 2KUMA 1PH6A 4TSSA 3MVVA 3SK6A 1JOOA 1I4XA 3C46A 4UHVA 1J9OA 2QDLA 2F0GA 4DV5L 3KJPA 2VQEQ 4KN4C 4FP5D 2MHVA 4DR2L 2XIWA 2Y0SE 3R3OA 3J81i 3FHWA 3S14B 2XRQD 1ASYA 1UWVA 4IALA 3H0GH 2JEBI 3MFYA 4FF4A 3GTMH 3I2ZA 1A3VA 2OCEA 3FPPA 2VQEL 4JI0Q 1TWCH 1RCVD 4JI4Q 2A6ED 2HIXA 3P20A 1DM0B 1I4PA 5C4JB 4HEDA 3PIP3 3OW7A 1NE3A 3NTIA 4ZK9B 1WTRA 5H1SE 5K36H 4B3ML 5C3WA 3I4NG 4A3JG 1MI2A 4JI0L 3KBGA 1MSHA 3K8AA 3K6OA 4JI4L 1PFSA 2UUAQ 1W2BA 4GOPC 1I4HA 4GLAC 1CT1D 4EX5A 4BS9A 1K8AC 1U9RA 2PPBC 1BKBA 1MBYA 1VQJA 4JBKA 3CC4A 1AZQA 3PUWA 5GAEC 1G2TA 2CWAA 1ZEQX 2N78A 1E2ZA 3A5ZB 2UUAL 2PW5A 4DR7Q 2F0VA 1F9PA 2NVQB 2PI2E 4HSPA 4N8X1 4RHSA 2IJ0A 4AYBB 4G4KA 4EQPA 2H1EA 3TQYA 1AW7A 1X3PA 1EYGA 3TRZA 5C5LA 2M2LA 3GTKB 4POFA 2KHJA 3VYRA 2C35B 3A8JE 4DR7L 2B2YA 4BBSB 3BU2A 2EJFC 4DR1Q 2K33A 1LLRD 1HFNA 1PTOH 4OIKA 1EY7A 3KF8B 1F2MA 5C4XG 2PO4A 2WP8J 3U50C 1KC8C 1TWHB 2CWPA 5IP7H 4DR6Q 2JA5B 2XVSA 4DR1L 2KCCA 1ESRA 2EE1A 2DY8A 4A3KH 1RKNA 1F77A 3VR6A 3K80C 1PV4A 1NSNS 3TN2A 1I3QH 2WB1E 1SAPA 3CMAA 2ZXOA 2R7ZB 4F87A 2AQ3B 3J7YW 1EU3A 1K28A 2DNEA 4OGQC 2B2WC 4DR6L 1LTRD 2E74C 5FJ8H 5IGBA 2VXWA 1CSPA 4LF4Q 4O1NA 4TQUS 4AQYQ 1E2WA 3PIPA 4I7AA 2B2TA 2A73B 3I4NB 2FINB 4GNXA 1SJHD 1SLJA 1GUWA 3FVQA 4UP8A 2F0NA 5M5YH 4LF4L 1EZ6A 4EVOA 1KLUD 2JQOA 4AQYL 1FR3A 5JOBA 1PRTB 1J5EQ 3NPPA 4DV2Q 1RF2D 2R7DA 5IT9L 3CCRA 5T1IA 5FLMG 3TBIB 1SR3A 1I6HH 2EVBA 3GQBA 3VR5A 1L0YB 2H5XA 4IFDH 1R9TH 4YWMA 1IL2A 4R4OA 3CCJA 1FD7D 1C7YA 2F4VQ 2F0WA 1UE5A 5E7NA 1HXYD 1J5EL 2RKSA 4DV2L 2E5LQ 3ULJA 5M3FG 4Y7NB 5CYUA 1LT3D 2QF7A 3TREA 3D8GA 1Y1VH 2C9OA 3NENA 1EY8A 2F4VL 2HCCA 1L0WA 4JI2Q 1HCZA 2OTLA 2E5LL 2E75C 2J0TD 2PZUA 5JVH3 3CW2C 1D5MC 3W3AA 1UE1A 5FKAC 3PO2G 1Z9FA 1D7QA 3I4LA 3J7A5 1CHPD 1CKNB 3HS0C 1SMYC 1FNUA 3PF4A 1EQTA 1SYEA 2Z4IA 5FLXc 1FJGQ 4Q5VA 1XPUA 3BZDB 3NBHB 4JI2L 4LUOA 3VYUA 2ICIA 4KKUA 5J1ZA 1PYSB 3NUCA 3TEHB 3VYTA 1Q86C 2OQKA 2IY5B 3S1NB 4I7ZC 4KV6A 5EPKA 2RHSB 3N52A 4AYBE 1FJGL 1KAWA 1RL2A 2JA8G 1UAPA 2VB3X 4YHHL 1CA6A 1X54A 1ICFB 4A75A 3AEVA 3T51B 1O7IA 3GTGH 1WCMH 1X55A 1PXUA 1Q7YC 2F3VA 2KHIA 2MUYA 1ET9A 2E2HB 1SYFA 4XT3B 3BYTB 1I94Q 1MJCA 2DNCA 3SE0A 2O4XA 4ULLA 3SHLA 2D0PA 2V4DA 2J7ZA 5JEAJ 1Y69U 2OQ0A 4GN3B 4YWLA 1ENAA 2M9VA 3GTJH 2K5HA 3Q8DA 2DJGC 1PRTC 1I94L 4JG2A 2MP1A 5BN5A 3ICEA 2A5HA 4OONA 4XXEA 2ZJPA 4A3BG 1PH8A 1SSOA 4DV0Q 4OO1H 2E2JH 4LF6L 2IL8A 2JA6G 2EY5A 3GD7A 2LFNA 4KLKA 2ZXPA 4J6HA 4A3MG 1JJ2A 2F3IA 1CZGA 1Z6HA 2RF4A 2L11A 4HN7A 1VQMA 4FF2A 4C1NI 4K0KQ 1LM0A 4DV0L 3D4WA 2EY2A 3WOEA 1BBWA 4P2CB 3CQZH 1STYA 4RGOS 4PMCA 5IP9H 2UXBQ 3PIO3 1VF7A 1O80A 1T5XD 4ODGA 1SNPA 4BY1B 3BVZA 3W1GA 1UNSA 3K5OA 4ALPA 4K0KL 3J7AF 2A74C 5M5XB 3FKIH 3HKZG 3UE1A 2MFIA 2B2VA 4DR4Q 2UXBL 2HQLA 1WOCA 4C3JB 5L37A 4KI0A 4R1JA 2UXCQ 3K5NA 5GAHC 3M7GA 4C3HG 1WYDA 3S1RH 3HOWH 2RSOA 5E3FA 1VQHA 4GLXA 1QE6A 4RG1A 3P75A 3L0OA 5EPJA 3QOJA 1AFPA 4YWKA 1SMXA 4DR4L 2CCZA 3BVMA 3NWSA 1CZWA 4A3DG 4J8QA 2UXCL 1L0XB 5D3IB 3GTPH 3KOJA 4JVZA 5C5MA 5TSSA 1WTPA 3STBD 2EOTA 3A0JA 3NP8A 2GA4B 3RD4A 1I4GA 1LTTD 5AFWA 5I2XA 1S5ED 1O7YA 2Z6BA 4BBRH 1EEFD 4H44C 1XWEA 3R2TA 2D0OA 5KRUA 4L63B 4RMFA 3ZJYC 3KK7A 4JCVE 2FFKB 3PSIA 3G6JB 2Z4HA 4Z9CB 3S24A 4A3BB 3Q23A 2RHQB 3CD6A 5IYBH 1XMOQ 3I56A 4PZ8A 3JAME 1JQYD 2F4IA 1ENCA 5CV9A 2NVXB 3CCEA 1LUZA 1NUCA 2R7FA 3MXGA 1XMQQ 1IKLA 4CKCA 3W1BA 1QUQA 2R93H 1XMOL 2B3GA 5G3LD 1IW7D 3WDNA 2F0OA 3HOZG 4KHPQ 4QL5A 1CUKA 3UDGA 3D0FA 1E24A 2RBMA 3O13A 1QG7A 3ULPA 1XMQL 3PIOA 4UDUC 4IJLA 3NEMA 3I8ZA 2F0TA 4J1MA 3OOCA 3MXPA 4KHPL 1XNQQ 3MAQA 2NN6I 3HOYG 4BWGB 1DCZA 4OEMB 1RHPA 3OHXC 4A3KG 3NE5B 1D5XC 3H0GB 1HNXQ 1ML0D 2AWNA 3VR4A 3GTMB 3A7AB 1W6KA 4R4QA 2YU9H 1HZBA 1S5DD 1N34Q 2XTIA 3D6CA 1TWCB 4DPGA 3CPFA 1XNQL 2EYFA 1BVSA 1NJIC 4QB4A 1WTHA 1G8ZD 3M4QA 4BY7G 1PVOA 2VY3A 2MQHA 5D65A 1HNXL 2CH4A 1Q82C 4B9XA 4IPGA 1CFMA 3A8IE 1VQFA 4PQXA 1G6PA 4H7BA 1HJPA 1BBUA 2A8VA 1X3QA 1B2TA 2CKZB 1YHBA 1TVXA 3KF6B 1JWUD 1R4QB 3J81j 3CU7A 3M4YA 4L5SA 1EUJA 1L1OA 1K9MC 2KBNA 1ZKOA 2XRSD 2F0UA 4DV7Q 4OL7A 2TSSA 1KD1C 1MGSA 1EIFA 2HHHQ 1JORA 2NVYH 2JA7G 2L12A 1M1KC 3I72A 2SNMA 3K5MA 3T1HQ 4KTAA 1IYUA 3JC66 3JAMc 3QOLA 5EPLA 4DV7L 2L1BA 1CSQA 1PTOD 4LMQD 3J80E 4I65A 5C3XA 3VA5A 2MPMA 3BG3A 4CKEA 2HHHL 5I2YA 3PGZA 1IHZA 4YCVA 2I5HA 4ZAIA 1DOMA 1S3OA 2G9HD 1PTOB 4EGVA 1J6QA 4A93G 3CKIB 2C5CA 3SVMA 4WFN3 4JW0A 4A3KB 1Y1WG 1GVPA 5IIFA 5DNFA 4E6IA 1BCPB 3SK4A 4KY7A 2ZTDA 1I3QB 2RQXA 3IFTA 4K8JA 4CDFC 2K4KA 4CDCC 1YIJA 2DUDA 4DNIA 2FXQA 5C6AA 5ISRA 3F2CA 2HCIA 4NP5A 4L6TB 4OX9Q 2O5JC 2NBFA 3HOVH 3DXJC 2B63H 4CJ0B 1JWMD 3L9AX 2KENA 3C1FA 4JPBW 1NY4A 3M4PA 3NELA 4OX9L 1ICWA 4DV4Q 1YJ9A 1EFID 3L3OC 3I7FA 4K6DA 1GO3E 4B08A 1I6HB 3U58A 3OMCA 1QVCA 3RN2A 1R9TB 4K6LA 1OO9B 1PH1A 4A4IA 1VQCA 2PMZE 3QB3A 4FVMA 4KY5A 1VQDA 5EBCA 4DV4L 1KLGD 4HJ8A 3S17H 2CQOA 3DWQA 2IHFA 2ZTEA 1N9WA 2JN4A 2K5QA 4IPDA 3IAYA 2IWHA 1XYIA 4IUQA 4QJFA 1A0IA 1Y1VB 4GOPB 3WWVA 2EYJA 4HIOA 1GHKA 3E3XA 5J39A 1Y14B 1D1IA 1VDZA 1B7YB 1STAA 1SXTA 5G3LF 3EVQA 1PH5A 4XT1B 2K52A 4XYQA 1Y1WB 4RAUC 5IYDG 4RGTA 4HJAA 5JPMC 1YNXA 4L5RC 4QGUA 1DGSA 3BDOA 4RH6A 1HH2P 1BUVT 1YZ6A 2F0EA 1YNJC 1M4VA 2K04A 1BCPC 5F2DA 1JE4A 2K28A 4AYBG 2EYHA 2AMCB 4WORA 2F1MA 3HOWG 1K0RA 3P7JA 3PV0A 1B1ZA 2K5DA 3BJUA 5K5PA 2PQAA 3AU7A 2A68C 5C0XG 3GTGB 1WCMB 1VQNA 1TWAH 1O7LA 5IGGA 4N9PA 5IOCA 1TIID 2DN8A 2WFWA 4LUVA 5ELBA 4DAMA 2K14A 4UAIA 2B2YC 1CQVA 3GV6A 1HZCA 3MEFA 3S2HH 3Q6SA 1EZ8A 2JA5G 4PZ7A 1B8AA 1XX8A 4JK1C 4X62Q 3GTJB 2Q8TA 4B3SQ 1X3FA 2A6HC 5IT9c 3I3CA 3HRZC 1A2UA 4JI8Q 1SBBB 2NN6H 1SYGA 3FEWX 1GHJA 4KHVA 2R7ZG 2R61A 2E2JB 4A3GH 1L2FA 4HMIA 1B9MA 3MXUA 5JEAH 1N32Q 4X62L 4LK1C 3NXWA 4DGZA 5D14A 4B3SL 3GV3A 4JI8L 3C3LA 2QDBA 1HHVA 2VB2X 1GUNA 1NAPA 4F7XA 1VCIA 2RDHA 2EY1A 4FXGC 1V1PA 1FNWA 1FGUA 1H9SB 1JB3A 4UP9A 3CQZB 2K01A 4DKAC 1H9KA 4UY8C 2NVTH 1PTOF 3E0EA 4ME5A 2TMPA 4TVAB 2NWGA 3I4MH 2B2TC 4V190 1JE5A 4UPAA 1S4ZA 3MXNB 4GNXC 1TWGH 4CDEC 4DNRB 1RTNA 1R4PB 3FKIB 1YI2A 1SNCA 3LGJA 3RUZA 2J4XA 2SOBA 2VUMH 4ABNA 1TS5A 1TU2B 2LXJA 4JI6Q 3BVGA 1PH7A 1LYLA 3G71A 4HCEA 1JR0D 1Z7TA 4WRDA 3S1RB 3HOWB 3LWEA 4DK6C 3PUYA 3CC2A 1VQPA 1SMYD 4IPHA 4JI7Q 3J80L 2F0HA 4DV1Q 1ZYRC 1OXSC 2VZAA 3PUXA 4FO2A 2B2UA 4A3LG 2KECA 4JI6L 5EKKA 2K5VA 1CM9A 4KJNA 3GTPB 2Q2IA 1FGBD 3D4DA 4A3EH 2WKDA 4GS3A 2L55A 1EWIA 5FOBB 3VA7A 3GP7A 2JSOA 4JI7L 4BBRB 4DV1L 5IGFA 1Q81C 4X3SA 2A1AA 3IRBA 3CRKC 2F0FA 2KCTA 2EQSA 2EXZA 3QR8A 3NQTA 2EIFA 1NMFA 2R6GA 2X6GA 3K81C 3FP9A 2EZVA 4ZKBB 1K8GA 1VQAA 2PI2A 5EAYA 2WAQB 3KYHC 4JOIA 4XQQA 2X6LA 1MJEA 1WTWA 4K2KA 4BXXG 5IYCH 3DEOA 5JPNC 4ZRZA 1HR0W 5C44H 2R93B 4CDDC 2RCFA 5A35A 1IZ6A 1C8CA 1YHQA 1PRTD 5C4HA 5CR3A 2PW7A 3PO3G 1B4OA 1Q1BA 1BBXC 1SYDA 2Z0SA 4A3CG 1IL8A 1DOLA 1D2BA 4DV6Q 4OXPA 2A19A 3EROA 5IGDA 1HR0Q 5LHY1 4KMUC 1SE2A 1YVCA 3GTOH 1JJCB 1LV9A 5BN4A 4JV5Q 1GJXA 2OWOA 5IE8A 3N6RA 2IT1A 2YU9B 5CBAE 2K32A 5C3EH 4C56C 2I07B 2D2CC 4K2LA 4GZYC 1ENFA 2ASBA 1HR0L 3S16H 1AZPA 1QVFA 4AH6A 1TXYA 2O2LD 5HGTA 1U0LA 1ILQA 3J81E 3EQLC 1B3AA 2SNSA 2RDFA 1D5ZC 1PLFA 5KIXA 1LT4D 4BY1G 3X3MA 4DAVA 1XTDA 1GD7A 3E0JA 1II3A 5DM73 3OSOA 4C3IH 1K3RA 2H4OA 1LTSD 3SK8A 3OIPA 4K5VA 2CW0C 4C3JG 3EN2A 4KK7A 4ZUIA 3KLSX 4N8FA 2OTJA 4O42A 3TZUA 4QMGA 2EYMA 2B2VC 2YTVA 1J8IA 1DZ1A 2F52A 2EYOA 4YY3Q 1STBA 3BDLA 1F2YA 3PO3B 2VQFQ 4DAYA 2PZWA 1EY6A 1QWYA 1WTXA 2NYZD 1WTQA 5JJLA 2E2IH 1X3GA 1MD2D 4YY3L 3NBIA 3SDZA 3CMEA 1PZJD 4RA8A 1Z47A 2K5WA 3MHBA 1OXTA 3IL8A 3KUPA 2QGQA 3MA2B 1O7ZA 5BN3A 2VQFL 4LNQA 2KCNA 1BF4A 2UUCQ 5FO7B 2JXMB 4X3TA 3S1QB 3MZ5A 4QUFA 1Q3LA 1VQ8A 2BA1A 1PH3A 1VQEA 1TR5A 3RZDH 4R9WA 1V1OA 1EYDA 1I50H 2WAQE 3VDYA 1NTGA 2E76C 1SROA 1DD2A 1K73C 3URYA 4P74A 2UUCL 5JJZA 3S15H 4KY6A 3OWFA 3TMEA 3K57A 3UDFA 3HOXH 1EEID 5EJWA 2A69C 3E6ZX 3HOVB 4MNOA 2B63B 1GUOA 2HUGA 2ATWA 4X3KA 1D6EC 4G7OC 2YTYA 4J15A 4NXNQ 3GTLH 1C9OA 1KL9A 1F2ZA 1VMPA 1GM5A 3VR3A 4IZ8A 2QCPX 4LAAA 1K3BC 1SNMA 4RGMA 3V96A 4DR5Q 1B44D 5ELEA 2R92H 1Q46A 4UP7A 1VMCA 3H0GG 5GADC 4KJOA 2L0CA 5ELDA 4NXNL 3S1MH 1G51A 2QA4A 2HIVA 3M85A 4DXGA 2BDNA 4PMWA 4QIWB 2G5DA 2WKCA 3CCUA 2CVRA 4GKJQ 1TQOA 1I5FA 4DR5L 3H91A 3S17B 1QZHA 4DN4M 2WIIB 2EY6A 2OT2A 4DXFA 2NZOA 4QF4A 2NVQH 1DJRD 1X32A 2IW3A 1K83H 4IPCA 5K36G 2JJQA 3EFXD 1CK1A 2BE5C 1ILPA 4R4TA 3VR2A 4HIKA 4BA1I 1G6ZA 1C48A 5ELCA 5IWAQ 2YYZA 4GKJL 3NWTA 3C2PA 3K59A 2KCMA 2G9DA 3C1EA 1PRTF 1KNAA 3UI2A 1UE6A 3BZCA 3X3NA 3U9OA 3E5SA 4IURA 1CKOA 1VS0A 5LL6S 2GN5A 1X56A 1IBKQ 4GLVB 5IWAL 4NPSA 5IODA 3Q0AA 4G7ZC 1CHQD 2VNUD 1U4LA 1TWFH 2CQAA 1L1OC 1UE7A 4OIJA 3QIAA 5GQOA 3T56B 2MNAA 1IBKL 3ZYYX 2ICEC 1UEBA 2ZXRA 3G6EA 2MGSA 5KEEA 3AFPA 1HTLD 5CV8A 3CCSA 2YV5A 1QCBD 3WOFA 1TWAB 3BZKA 4HSVA 2D9UA 4B3TQ 4H0LC 2NTTA 1EYCA 5M5WH 2LXKA 4N9TA 5D3DA 3L2PA 1YJWA 1B3QA 1SN8A 4P72A 4A3JH 1OXVA 3T4AC 4GN4B 3S2HB 1JICA 1S5FD 5IP7G 3PCOB 5IGCA 1W6JA 2M00A 1CKNA 4PMBA 3G48A 1FVIA 2BOSA 3MEHA 4JI1Q 3W2DA 2JE6I 4B3TL 1STGA 1Q8KA 3I90A 5FK9C 2K03A 4DUYQ 5CV5A 3HZXA 3TP6A 2HDLA 2K6AA 2VW9A 5FJ8G 1PYBA 3OPOA 4FXKC 2QEJC 2OXPA 4RKBA 1U4MA 3OWEB 4JI1L 5KYIA 1D8LA 1X6OA 3NK9A 3V2TA 5M3MH 1QB5D 5JJIA 1VF5C 1N34L 3RMHA 1JC7A 1VQOA 5A2QE 2FMCA 5C44G 1H9RA 3D4RA 4Y7NH 3H3VI 3M7NA 4K14A 3J81L 3CCLA 1HA6A 5ELOA 3MC0B 3I4MB 2UU9Q 4MZ9A 1SFOH 1B70B 2LSSA 1TWGB 1BO0A 2HD3A 5C4XH 3ULLA 3RR5A 3OTOQ 2KA7A 5KGUA 1EY4A 1HQRD 5IGEA 4IFDG 3MFGA 3D3RA 1JCKB 2UU9L 4NMZA 1HA5A 1XJVA 1RD9D 2IX1A 4RWSC 5C3EG 4YCWA 1I4RA 3NQIA 1EY5A 1OXUA 3OTOL 2DGYA 2D5DA 5HURA 1LTAD 1Y1VG 2L4NA 1LABA 3TS0A 1TS2A 3CF5A 4DR3Q 1QZGA 1PH2A 1IKMA 3T1HL 4ID6A 3OMGA 4A3EB 1YNJD 4TRDA 3RZOH 1DONA 1BCPD 4DF7A 4JYAQ 2BDOA 2XNAC 5GAGC 3R2IA 1HUMA 1PA6A 4OWWB 1OTCA 1B53A 4DR3L 3DM3A 5CV7A 1NMGA 1WI5A 2Q8RE 2A68D 1SRUA 4MHEA 4JYAL 1PH4A 4LFBQ 1ASZA 2ZJRA 1KDAA 4IUPA 5J3BA 1G291 4R8IA 1JOQA 1HZ9A 1Y8OB 4U673 5FLMH 2SEBD 2KQ3A 1AP0A 2I5MX 3NTKA 3OIQA 4WJWA 1X9NA 1QNUA 1U4PA 3LWUA 5C44B 1F9SA 4LFBL 1EIYB 1WCMG 2A6HD 5M3FH 1QVGA 4QQBX 4P71A 5NUCA 5M5YB 1PH9A 4KHZA 1KABA 4LUZA 1HUNA 3DEPA 5EGTA 1IYJB 4OWXB 3EBEA 3RLNA 2HQEA 2VL6A 3OYYA 2GVBA 1KTKA 2I46A 5FO8B 3ONAB 1CI3M 3Q22A 3PO2H 4A3FH 1H9MA 2K1BA 1EY0A 5EKLA 3GTOB 2QILA 4OO1G 1Y8PB 1KDCA 4DK0A 5C0XJ 5C3EB 4APVA 4JBMA 4IFDI 2XWJB 4NKLA 1E2VA 2F3WA 3S16B 4RGNA 2ZT9C 2IPKD 5E4WC 3J80c 4PV1C 2JA8H 3KLWA 2F0MA 3PQIA 5CGKA 1WD0A 3HOXG 1Y8NB 1LTID 2UUBQ 4GNXB 5IP9G 4LFAQ 1E7ZA 4AIMA 2PNHA 2JA9A 4XTCS 4YCUA 4IO9A 1P16A 1CTMA 2CH4W 1KRTA 4CGYB 4H13C 1PDQA 1JJGA 3FKIG 1ZYRD 3HP3A 4C3IB 2UUBL 1PFNA 4LFAL 5M9OA 2SDFA 4POGA 3HFZB 2Z6KA 3SEBA 2IX0A 1LO5D 2ALYB 4KKTA 5LMNW 4DAPA 2EXDA 2WB1B 4LFCQ 2JA6H 4K8IA 2IX3A 2MO1A 2RVLA 4XYOA 3M3YH 4OWTB 5I4DA 4FDBA 4A3MH 1YNNC 2IHEA 3ITPA 4RFBA 1HZAA 4Q0FA 1QOHA 5KNCA 3CP0A 1VQ5A 2XGTA 4YIJA 4BBRG 2L5TA 2B2UC 3KFUA 4LFCL 1HPCA 5I9OA 3T1YQ 1WTOA 5LMNQ 3CAMA 3H94A 1N33Q 4V0BA 4MIUA 2NUCA 3BS1A 2F0KA 5IYBG 1EQVA 4ZQ3A 2WAQG 4DFAA 4ZLTF 3RZDB 3T1YL 5LMNL 2B29A 3L7ZC 1I50B 1HNWQ 1N33L 3M4OH 3EJIA 4OO1I 4C2MH 4C3HH 2R93G 4OHJA 2CFMA 1PFMA 3KJOA 3S15B 1UUPA 1AEXA 4B3MQ 4IJHA 3RLFA 3HOXB 4JC0A 1N32L 5A2QL 4JOIC 4HJ9A 5I6WA 2PZTA 1STNA 3T16A 2XN9C 4A3DH 2Q2UA
chains in the Genus database with same CATH topology
1TT2A 2PYKA 4IUUA 3GTLB 1XTCD 2FMMA 5KNDA 5JAVA 1KAAA 1BDOA 1BCPF 5CC4A 2DY7A 3AMUA 2R92B 1A15A 3R93A 2QKIC 3S1MB 3BDCA 1NCVA 5CMDA 1RJTA 1EIHA 3PUVA 3TP8A 4HTHA 1K83B 3V05A 1OXXK 2CW0D 5C0XI 2X69A 1QJOA 4CJ1B 1PFBA 1LTGD 3QO2A 4FF1A 1EWCA 2F03A 1S5CD 2R3ZA 3PUZA 4EQNA 1SEBD 3H6MA 3HG9A 4L8JA 5FLXE 1SYCA 1TWFB 2FHTA 1I6VC 2AWOA 3HEJA 3I70A 4DA2A 3MWYW 3NSWA 2KHSA 4XQNA 2HDMA 4DNTB 1EOTA 5EQ0A 2EPBA 3J7AV 4CBVA 1GUGA 5M5WB 3U9SA 1DOKA 4IN3A 1ZXTA 3GO5A 3TP7A 4A3JB 1DXMA 5COYA 4DU9A 1AN8A 1PYWD 2A6EC 1ET6A 2BCOA 2A69D 1KNEA 2WACA 4S3SA 2D62A 3DMUA 2F0SA 1BXTA 1UEAB 4IUTA 3CRLC 1S5BD 1HTPA 3P1HA 5JVG3 4NDXA 3D31A 5M3MB 1I4QA 1M8AA 1GXDC 1DYQA 1WTVA 1SNDA 1BQQT 3KLSA 4F8MA 1SFOB 2KEEA 1ONLA 1Q90A 2E2DC 2RA4A 3A55A 5C4XB 5EKIA 2B8FA 2BE5D 4TKOB 2NVYB 2B2WA 2KVMA 2K7VA 2AUJD 3DUZA 1A2TA 3S9WA 1D1KA 2PQEA 2F0PA 5DAUA 3RZOB 2F0QA 1H9SA 2RDGA 3QJYA 4HAEA 4EQOA 2WV6D 4HR7B 5T1GA 1TS3A 3MXNA 1SDFA 1LTBD 3DHQA 4KKSA 4KN7C 4G57A 3SR1A 5CBEE 1PMRA 1Q12A 3K5LA 1B50A 1A3TA 1CQFA 2EJMA 1GUTA 1V8QA 4R8NA 4F88A 4HMJA 5M3FB 1MSGA 3CHBD 3KF8A 1O78A 4LJZC 1SYBA 3NHHA 5LL6X 2F0IA 4K5WA 1TY0A 2F0JA 4RCOA 3PO2B 4A3FB 2NN6G 4ZYSA 3DWAA 2BA0A 2WINB 3IFDA 5JEAG 4DK1A 2KOLA 1K8OA 4IQZA 1BNZA 2JA8B 3TZDA 3ND8A 1TS4A 5C0XH 1RDPD 3G7LA 3EA6A 1LT6D 2JEAI 3F2UA 3IKJA 3TDQA 5E1FA 5FLXL 3D6WA 4CJ2C 2LY7A 3ERQA 1Q1EA 1KDBA 1EY9A 4KD4A 1C4QA 1RODA 4FYDA 1TY2A 5EBDA 2NZ1D 2Z8LA 4HCSA 2JA6B 5CV6A 3M3YB 1HRJA 2CHBD 4A3MB 5CORA 1LT5D 4XQJA 1EIGA 3K58A 3NTHA 4IFDJ 2JYOA 4M1UB 3TP5A 2XSCA 1SE4A 3ND9A 4MN3A 2LMCB 3NBHA 4ZUJA 2Q8IB 1V43A 4RCNA 1EWHA 1WD1A 4A3GB 1F9QA 4QUCA 3HKZB 1FNVA 4IUNA 2ID0A 4RKLA 3QG1A 3SXHA 3M4OB 3KLRA 3LX0A 3PMFA 1SNOA 4C2MB 4C3HB 2EYPA 5DM63 1HQMC 1PZID 2OF1A 2F0LA 2PMZB 1E0BA 1LACA 2LS01 2O5IC 2NVTB 1SNQA 4A3DB 1F9RA 3TSSA 2B8GA 1NR2A 2B39A 5KYLA 4A3IB 2KJXA 3I73A 5CV4A 1G91A 1BR9A 3T13A 2VUMB 4ZKCB 1ESFA 1SJED 3FDTA 4CHTB 1A6XA 2AUKA 2EYLA 4FF3A 1RTOA 2XWBB 3FRPB 2KEDA 1PZKD 3A7LA 1T5EA 2EDGA 3BYYB 4CKBA 2RSNA 1HFGA 1A3UA 1QNKA 2N88A 2L9HA 5C4ZA 1V1PB 5E4XA 2FJ2A 3HOZB 1IYVA 3DWPA 3A8KE 3FPUB 2EJGC 4IUVA 1EL0A 4C3IG 4M8AA 1QILA 5KNBA 2Y0SB 2F0DA 1YNND 1IW7C 3HOYB 1B9NA 1NR4A 1BOSA 1GOZA 4FNFA 3K7AB 3FMCA 4X3UA 3AB9A 2K05A 4C1NK 3Q24A 2LKVA 4BY7B 1TKWB 2JP1A 4XDXA 3HOUB 4NW2A 3H3VC 1H9JA 3K0YA 1JWSD 2AQ2B 1JOKA 2NB0A 5I6YA 5IT9E 3T53B 1GUSA 3VYSA 2MJ8A 3I91A 2PNRC 1K8MA 2AQ1B 3H09A 3MTSA 1WVLA 1STEA 2PCFB 3S2DB 1Q8IA 2JA7B 4ILWA 3GTQB 1SE3A 4BA2I 4K5XA 4QCLA 4JBWA 2Z1CA 1EU4A 4U68A 5ELFA 5I9PA 3HGBA 1XXGA 3SK5A 5FO9B 3QWNA 1FYCA 2OEOA 3R8BA 1STHA 4G7HC 5DEHA 4A93B 1G2SA 1F2LA 3A56A 1PTOC 4PNYA 3LNNA 4KD3A 3DM1A 5J22A 4B9WA 4RHRA 3A54A 3JAML 1CA5A 2N55A 1EYAA 1U4RA 4FXDA 2E2IB 2NTSA 2ENBA 4XIGS 3KBXA 2KUMA 4TSSA 3SK6A 3MVVA 1JOOA 1I4XA 3C46A 1J9OA 2F0GA 4KN4C 4FP5D 2MHVA 2XIWA 3R3OA 3S14B 2XRQD 4IALA 2JEBI 3MFYA 4FF4A 1A3VA 3FPPA 1RCVD 2A6ED 3P20A 1DM0B 1I4PA 5C4JB 4HEDA 3PIP3 3OW7A 3NTIA 4ZK9B 1WTRA 5K36H 5C3WA 1MI2A 3KBGA 1MSHA 3K6OA 1I4HA 1CT1D 4BS9A 1U9RA 2PPBC 1MBYA 1AZQA 3PUWA 1G2TA 1ZEQX 1E2ZA 2PW5A 2F0VA 1F9PA 2NVQB 4HSPA 4RHSA 2IJ0A 4AYBB 4G4KA 4EQPA 2H1EA 1AW7A 1X3PA 5C5LA 2M2LA 3GTKB 3VYRA 3A8JE 4BBSB 2B2YA 2EJFC 2K33A 1LLRD 1HFNA 1PTOH 4OIKA 1EY7A 1F2MA 2PO4A 2WP8J 1TWHB 2JA5B 2XVSA 2KCCA 1ESRA 2EE1A 2DY8A 1RKNA 1F77A 3VR6A 1NSNS 3TN2A 1SAPA 2ZXOA 2R7ZB 4F87A 2AQ3B 3J7YW 1EU3A 2DNEA 4OGQC 2B2WC 1LTRD 2E74C 5IGBA 2VXWA 4O1NA 4TQUS 1E2WA 2B2TA 2A73B 3I4NB 2FINB 1SJHD 1GUWA 3FVQA 2F0NA 1EZ6A 4EVOA 1KLUD 1FR3A 5JOBA 1PRTB 3NPPA 1RF2D 5IT9L 5T1IA 3TBIB 2EVBA 3GQBA 3VR5A 1L0YB 4IFDH 1FD7D 2F0WA 1HXYD 2RKSA 4Y7NB 5CYUA 1LT3D 2QF7A 3D8GA 2C9OA 1EY8A 2HCCA 1HCZA 2E75C 2J0TD 2PZUA 5JVH3 1D5MC 3W3AA 5FKAC 3I4LA 1CHPD 3HS0C 1SMYC 1FNUA 1EQTA 1SYEA 2Z4IA 4Q5VA 3BZDB 3VYUA 2ICIA 4KKUA 5J1ZA 3NUCA 3VYTA 3S1NB 4I7ZC 4KV6A 5EPKA 3N52A 1UAPA 2VB3X 1CA6A 3T51B 1PXUA 2F3VA 2MUYA 1ET9A 2E2HB 1SYFA 4XT3B 3BYTB 2DNCA 3SE0A 2O4XA 4ULLA 3SHLA 2V4DA 2J7ZA 5JEAJ 1Y69U 1ENAA 2M9VA 1PRTC 2MP1A 5BN5A 2A5HA 4XXEA 1SSOA 4OO1H 2IL8A 2EY5A 3GD7A 2LFNA 2ZXPA 4J6HA 1CZGA 1Z6HA 4HN7A 2L11A 4FF2A 4C1NI 3D4WA 2EY2A 3WOEA 4P2CB 1STYA 4RGOS 4PMCA 3PIO3 1VF7A 1O80A 1T5XD 4ODGA 1SNPA 4BY1B 3BVZA 1UNSA 3K5OA 3J7AF 2A74C 5M5XB 2B2VA 4C3JB 4KI0A 3K5NA 3M7GA 4C3HG 2RSOA 5E3FA 1QE6A 3P75A 5EPJA 3QOJA 1AFPA 3BVMA 3NWSA 1CZWA 4J8QA 1L0XB 5D3IB 5C5MA 5TSSA 1WTPA 2EOTA 3NP8A 2GA4B 3RD4A 1I4GA 1LTTD 5AFWA 5I2XA 1S5ED 1O7YA 1EEFD 4H44C 1XWEA 3R2TA 5KRUA 4L63B 3KK7A 2FFKB 3G6JB 2Z4HA 4Z9CB 4A3BB 3Q23A 3JAME 1JQYD 2F4IA 1ENCA 5CV9A 2NVXB 1NUCA 3MXGA 1IKLA 4CKCA 5G3LD 1IW7D 3WDNA 2F0OA 2RBMA 3O13A 1QG7A 4UDUC 3I8ZA 2F0TA 4J1MA 3OOCA 3MXPA 3MAQA 2NN6I 4BWGB 1DCZA 1RHPA 3OHXC 3NE5B 1D5XC 3H0GB 1ML0D 2AWNA 3VR4A 3GTMB 3A7AB 1W6KA 1S5DD 3D6CA 1TWCB 2EYFA 4QB4A 1G8ZD 5D65A 4B9XA 1CFMA 3A8IE 4PQXA 4H7BA 1X3QA 1B2TA 1TVXA 1JWUD 1R4QB 3CU7A 3M4YA 2XRSD 1ZKOA 2F0UA 4OL7A 2TSSA 1MGSA 1JORA 2L12A 3I72A 2SNMA 3K5MA 4KTAA 1IYUA 3QOLA 5EPLA 2L1BA 1PTOD 3J80E 4LMQD 4I65A 5C3XA 3VA5A 2MPMA 3BG3A 4CKEA 5I2YA 1IHZA 4ZAIA 1DOMA 2G9HD 1PTOB 4EGVA 3CKIB 2C5CA 3SVMA 4WFN3 4A3KB 5IIFA 5DNFA 4E6IA 1BCPB 3SK4A 4KY7A 1I3QB 2RQXA 3IFTA 4K8JA 5C6AA 5ISRA 2HCIA 4NP5A 4L6TB 2O5JC 2NBFA 3DXJC 4CJ0B 1JWMD 3L9AX 3C1FA 1ICWA 1EFID 3L3OC 4K6DA 4B08A 1I6HB 3OMCA 1R9TB 4K6LA 1OO9B 3QB3A 4FVMA 4KY5A 5EBCA 1KLGD 3DWQA 2K5QA 3IAYA 2IWHA 1XYIA 4IUQA 1Y1VB 2EYJA 1GHKA 5J39A 1D1IA 1VDZA 1STAA 1SXTA 5G3LF 3EVQA 4XT1B 4XYQA 1Y1WB 4RAUC 4RGTA 5JPMC 3BDOA 4RH6A 1BUVT 2F0EA 1YNJC 1M4VA 2K04A 1BCPC 5F2DA 1JE4A 2K28A 2EYHA 4WORA 2F1MA 3P7JA 3PV0A 1B1ZA 2K5DA 5K5PA 3AU7A 2A68C 5C0XG 3GTGB 1WCMB 1O7LA 5IGGA 4N9PA 5IOCA 1TIID 2DN8A 5ELBA 4UAIA 2B2YC 1CQVA 3GV6A 3Q6SA 1EZ8A 1XX8A 4JK1C 3GTJB 2Q8TA 2A6HC 3I3CA 3HRZC 1A2UA 1SBBB 2NN6H 1SYGA 3FEWX 1GHJA 4KHVA 2R61A 2E2JB 4HMIA 1B9MA 3MXUA 5JEAH 4LK1C 3NXWA 4DGZA 5D14A 3GV3A 3C3LA 2QDBA 1HHVA 2VB2X 1GUNA 1NAPA 4F7XA 1VCIA 2RDHA 2EY1A 4FXGC 1V1PA 1FNWA 1H9SB 1JB3A 3CQZB 2K01A 1H9KA 1PTOF 4ME5A 2TMPA 2NWGA 2B2TC 4V190 1S4ZA 4DNRB 1RTNA 1R4PB 3FKIB 1SNCA 3RUZA 2J4XA 2SOBA 4ABNA 1TS5A 1TU2B 3BVGA 4HCEA 1JR0D 1Z7TA 4WRDA 3S1RB 3HOWB 3LWEA 3PUYA 1SMYD 3J80L 2F0HA 1ZYRC 1OXSC 3PUXA 4FO2A 2B2UA 2KECA 5EKKA 1CM9A 4KJNA 3GTPB 1FGBD 3D4DA 2WKDA 2L55A 5FOBB 3VA7A 3GP7A 2JSOA 4BBRB 5IGFA 4X3SA 3CRKC 2F0FA 2EXZA 3NQTA 2R6GA 2X6GA 2EZVA 4ZKBB 2WAQB 4XQQA 2X6LA 1WTWA 4K2KA 3DEOA 5JPNC 4ZRZA 2R93B 5A35A 1C8CA 1PRTD 5C4HA 5CR3A 2PW7A 1B4OA 1Q1BA 1BBXC 1SYDA 1IL8A 1DOLA 1D2BA 3EROA 5IGDA 5LHY1 4KMUC 1SE2A 1LV9A 5BN4A 1GJXA 3N6RA 2IT1A 2YU9B 5CBAE 2K32A 4C56C 2I07B 2D2CC 4K2LA 4GZYC 1ENFA 1AZPA 2O2LD 5HGTA 1ILQA 3J81E 3EQLC 1B3AA 2SNSA 2RDFA 1D5ZC 1PLFA 5KIXA 1LT4D 3X3MA 4DAVA 3E0JA 1II3A 5DM73 3OSOA 2H4OA 1LTSD 3SK8A 3OIPA 4K5VA 2CW0C 4C3JG 4KK7A 4ZUIA 3KLSX 4O42A 3TZUA 4QMGA 2EYMA 2B2VC 1J8IA 1DZ1A 2EYOA 1STBA 3BDLA 1F2YA 3PO3B 4DAYA 2PZWA 1EY6A 1QWYA 1WTXA 2NYZD 1WTQA 1MD2D 3NBIA 3SDZA 1PZJD 4RA8A 1Z47A 2K5WA 3MHBA 1OXTA 3IL8A 3KUPA 3MA2B 1O7ZA 5BN3A 2KCNA 1BF4A 5FO7B 2JXMB 4X3TA 3S1QB 3MZ5A 4QUFA 1Q3LA 2BA1A 1TR5A 4R9WA 1V1OA 1EYDA 2E76C 1DD2A 3URYA 5JJZA 4KY6A 3OWFA 3TMEA 3K57A 1EEID 5EJWA 2A69C 3E6ZX 3HOVB 2B63B 1GUOA 2HUGA 4X3KA 1D6EC 4G7OC 1F2ZA 1VMPA 3VR3A 4IZ8A 2QCPX 4LAAA 1SNMA 4RGMA 3V96A 1B44D 5ELEA 1VMCA 4KJOA 2L0CA 5ELDA 3M85A 4DXGA 2BDNA 4PMWA 4QIWB 2WKCA 2CVRA 1TQOA 3S17B 3H91A 4DN4M 2WIIB 2EY6A 2OT2A 4DXFA 4QF4A 1DJRD 1X32A 2IW3A 5K36G 3EFXD 1CK1A 2BE5C 1ILPA 3VR2A 1G6ZA 4BA1I 1C48A 5ELCA 2YYZA 3NWTA 3C2PA 3K59A 2G9DA 3C1EA 1PRTF 1KNAA 3UI2A 3X3NA 3U9OA 3E5SA 4IURA 5LL6S 5IODA 3Q0AA 4G7ZC 1CHQD 2VNUD 1U4LA 2CQAA 4OIJA 3QIAA 3T56B 3ZYYX 2ICEC 2ZXRA 2MGSA 5KEEA 1HTLD 5CV8A 1QCBD 3WOFA 1TWAB 4HSVA 2D9UA 4H0LC 2NTTA 1EYCA 4N9TA 5D3DA 1OXVA 3T4AC 3S2HB 1JICA 1S5FD 5IGCA 1W6JA 2M00A 4PMBA 2BOSA 3MEHA 3W2DA 2JE6I 1STGA 3I90A 5FK9C 2K03A 5CV5A 3HZXA 3TP6A 2HDLA 2K6AA 3OPOA 4FXKC 2QEJC 2OXPA 4RKBA 1U4MA 3OWEB 5KYIA 3NK9A 3V2TA 1QB5D 1VF5C 3RMHA 1JC7A 5A2QE 2FMCA 1H9RA 3D4RA 3M7NA 4K14A 3J81L 1HA6A 3MC0B 3I4MB 1TWGB 1BO0A 2KA7A 5KGUA 1EY4A 1HQRD 5IGEA 4IFDG 3MFGA 3D3RA 1JCKB 4NMZA 1HA5A 1RD9D 2IX1A 4RWSC 1I4RA 3NQIA 1EY5A 1OXUA 2D5DA 5HURA 1LTAD 2L4NA 1LABA 1TS2A 1IKMA 4ID6A 3OMGA 4A3EB 1YNJD 4TRDA 1DONA 1BCPD 4DF7A 2BDOA 2XNAC 3R2IA 1HUMA 1B53A 5CV7A 2Q8RE 2A68D 4MHEA 1KDAA 4IUPA 1G291 4R8IA 1JOQA 1Y8OB 4U673 2SEBD 2KQ3A 1AP0A 3NTKA 3OIQA 4WJWA 1QNUA 1U4PA 3LWUA 5C44B 1F9SA 2A6HD 5NUCA 5M5YB 4KHZA 1KABA 1HUNA 3DEPA 5EGTA 2HQEA 1KTKA 2I46A 5FO8B 3ONAB 1CI3M 3Q22A 1H9MA 2K1BA 1EY0A 5EKLA 3GTOB 2QILA 4OO1G 1Y8PB 1KDCA 4DK0A 5C0XJ 5C3EB 4IFDI 2XWJB 4NKLA 1E2VA 2F3WA 3S16B 4RGNA 2ZT9C 2IPKD 5E4WC 4PV1C 2F0MA 5CGKA 1WD0A 1Y8NB 1LTID 4XTCS 1CTMA 4CGYB 4H13C 1PDQA 1ZYRD 3HP3A 4C3IB 1PFNA 5M9OA 2SDFA 3SEBA 2IX0A 1LO5D 4KKTA 4DAPA 2WB1B 4K8IA 2IX3A 2RVLA 4XYOA 5I4DA 1YNNC 3ITPA 4RFBA 4Q0FA 1QOHA 5KNCA 4YIJA 2L5TA 2B2UC 1HPCA 5I9OA 1WTOA 3H94A 4V0BA 4MIUA 2NUCA 3BS1A 2F0KA 1EQVA 4ZQ3A 4DFAA 4ZLTF 3RZDB 3L7ZC 1I50B 3EJIA 4OO1I 4OHJA 1PFMA 3S15B 1UUPA 1AEXA 3RLFA 3HOXB 5A2QL 5I6WA 2PZTA 1STNA 3T16A 2XN9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TT2 A;  2PYK A;  2EY6 A;  3OSO A;  2O4X A;  2F0G A;  1IHZ A;  2LKV A;  5EKK A;  4QF4 A;  5IGB A;  2F0E A;  3DMU A;  3SHL A;  2F0S A;  4KJN A;  1ENC A;  4NKL A;  5CV9 A;  5F2D A;  2F3W A;  3D4D A;  4IUN A;  4K5V A;  3SK8 A;  3R3O A;  1NUC A;  1ENA A;  4ZUI A;  5JAV A;  1KAA A;  4RKL A;  3P1H A;  2EYH A;  3SXH A;  1SYB A;  5CC4 A;  3NHH A;  2F0M A;  4IAL A;  4NDX A;  5CGK A;  1EY4 A;  2F0I A;  4K5W A;  4QMG A;  3LX0 A;  3PMF A;  1SNO A;  4WOR A;  5IGE A;  2F0J A;  2EYP A;  1A3V A;  2EYM A;  5IGF A;  3C1E A;  4NMZ A;  2F0O A;  2OF1 A;  2F0L A;  5IIF A;  3BDC A;  4E6I A;  5K5P A;  2F0N A;  1JOK A;  3SK4 A;  2F0F A;  1EZ6 A;  2EYO A;  2RBM A;  1SND A;  4KY7 A;  1STB A;  3U9O A;  3E5S A;  4EVO A;  5IGG A;  2EXZ A;  4F8M A;  2EY5 A;  1EY5 A;  3BDL A;  3NQT A;  4N9P A;  4K8J A;  5I6Y A;  1F2Y A;  1SNQ A;  5JOB A;  3TP8 A;  5IOC A;  5HUR A;  2PZW A;  4HTH A;  4J6H A;  1EY6 A;  5IOD A;  2F0T A;  4J1M A;  5C3W A;  4ID6 A;  3OMG A;  1EZ8 A;  3MXP A;  5KYL A;  4TRD A;  4DF7 A;  5C6A A;  5M9O A;  4K2K A;  5CV4 A;  5ISR A;  3D4W A;  4NP5 A;  3T13 A;  3MHB A;  2EY2 A;  2F0W A;  1STY A;  1A2U A;  4PMC A;  5C4H A;  1SYG A;  1A2T A;  2RKS A;  1U9R A;  4K5X A;  5CR3 A;  4KHV A;  5KEE A;  4ODG A;  1SNP A;  3D6C A;  5CV8 A;  3S9W A;  3C1F A;  2PW7 A;  2EYL A;  5CV7 A;  4EQN A;  3MZ5 A;  4K8I A;  2EYF A;  4HMI A;  5I9P A;  4QB4 A;  3H6M A;  3D8G A;  3SK5 A;  1TR5 A;  4S3S A;  1EYC A;  1SYD A;  5KGU A;  4N9T A;  1KDA A;  3NXW A;  4DGZ A;  2PW5 A;  1EYD A;  1EY8 A;  1JOQ A;  2F0V A;  3ITP A;  4B9X A;  2OEO A;  1STH A;  2PQE A;  2QDB A;  4K6D A;  5E1F A;  2KQ3 A;  1SYC A;  3ERO A;  5DEH A;  5IGD A;  5IGC A;  2F0P A;  2PZU A;  4YIJ A;  5DAU A;  4EQP A;  4F7X A;  2F0Q A;  3ERQ A;  1A3U A;  2EY1 A;  2M00 A;  3OMC A;  4H7B A;  3OWF A;  4KY6 A;  4PMB A;  3HEJ A;  1KDB A;  3TME A;  5C4Z A;  5C5L A;  5I9O A;  1EY9 A;  3MEH A;  4PNY A;  4EQO A;  5E3F A;  4KD4 A;  1SYE A;  1STG A;  4KD3 A;  3QB3 A;  4KY5 A;  3P75 A;  4ME5 A;  4MIU A;  2NUC A;  3QOJ A;  2KHS A;  5NUC A;  5CV5 A;  2F0K A;  1KAB A;  3HZX A;  3DHQ A;  3TP6 A;  4K2L A;  2F0U A;  5CV6 A;  5J22 A;  4B9W A;  5J1Z A;  4OL7 A;  3NUC A;  1EQV A;  5EGT A;  5C5M A;  4ZQ3 A;  1EY7 A;  1F2Z A;  4DFA A;  5I6W A;  4IZ8 A;  2HQE A;  2OXP A;  3NP8 A;  1F2M A;  4G57 A;  4LAA A;  4KV6 A;  4RKB A;  1SNC A;  1SNM A;  2EYJ A;  2F0D A;  3NK9 A;  3RUZ A;  3SR1 A;  2SOB A;  3TP7 A;  5KYI A;  1JOR A;  5HGT A;  3EJI A;  3V2T A;  5J39 A;  1EYA A;  4DU9 A;  2SNM A;  4KJO A;  1A3T A;  1STA A;  1AEX A;  4KTA A;  2SNS A;  2RDF A;  5KRU A;  4WRD A;  1RKN A;  1EY0 A;  2ENB A;  3EVQ A;  3QOL A;  5EKL A;  3TP5 A;  5KIX A;  4K14 A;  4R8N A;  4I65 A;  2F3V A;  5C3X A;  4HMJ A;  2PZT A;  3MVV A;  1NSN S;  1KDC A;  1STN A;  1JOO A;  4ZUJ A;  3SK6 A;  3T16 A;  1SYF A;  3VA5 A;  2WAC A;  1TQO A;  2F0H A;  1II3 A; 
#chains in the Genus database with same CATH topology
 1TT2 A;  3H3V H;  2PYK A;  4IUU A;  1WJJ A;  3GTL B;  1VQK A;  1KRS A;  1AH9 A;  4DAY B;  1PHJ A;  1XTC D;  2FMM A;  1W3S A;  4A3I H;  5KND A;  5JAV A;  1KAA A;  1BDO A;  1BCP F;  5CC4 A;  3GDE A;  2DY7 A;  4P73 A;  3AMU A;  2R92 B;  1A15 A;  3F8T A;  2NZH A;  3R93 A;  2QKI C;  1JT8 A;  3S1M B;  3BDC A;  4LF8 Q;  1NCV A;  4GKK Q;  1K0S A;  5CMD A;  4WJ4 A;  1AE3 A;  1RJT A;  1U5K A;  1EIH A;  4L5T A;  1EQQ A;  3PUV A;  1MIU A;  3TP8 A;  1A63 A;  4HTH A;  1VQ9 A;  5AJ3 Q;  1K83 B;  4LF8 L;  5M3M G;  3V05 A;  4Y52 H;  1OXX K;  3PF5 A;  4GKK L;  2CW0 D;  3A74 A;  5C0X I;  2X69 A;  4JBJ A;  4O2D A;  1QJO A;  4CJ1 B;  2V1C C;  1E1O A;  3HOZ H;  1PFB A;  1LTG D;  3QO2 A;  4FF1 A;  1EWC A;  2F03 A;  5AJ3 L;  1S5C D;  2R3Z A;  3PUZ A;  4EQN A;  1SEB D;  1YEZ A;  3H6M A;  3HG9 A;  4L8J A;  5FLX E;  4LW1 A;  1KQS A;  1SYC A;  3HOY H;  1TWF B;  2FHT A;  1I6V C;  1MKH A;  2AWO A;  4LF5 Q;  3HEJ A;  3K7A H;  4OEL B;  3I70 A;  4DA2 A;  3MWY W;  3NSW A;  3RNU A;  2KHS A;  4XQN A;  2BH2 A;  2HDM A;  4DNT B;  1EOT A;  5EQ0 A;  2EPB A;  4IOA A;  4GOP A;  4BY7 H;  3J7A V;  4CBV A;  3KDF A;  4LF5 L;  1GUG A;  5M5W B;  3U9S A;  1DOK A;  4IN3 A;  3HOU H;  1ZXT A;  3GO5 A;  3TP7 A;  4A3J B;  1DXM A;  5COY A;  4DU9 A;  1AN8 A;  1PYW D;  2A6E C;  1ET6 A;  1VQ6 A;  2BCO A;  2A69 D;  4IOC A;  1KNE A;  4B3R Q;  2WAC A;  4DV6 L;  4S3S A;  3TS2 A;  2AKW B;  2D62 A;  3DMU A;  1X65 A;  2F0S A;  1BXT A;  1UEA B;  4IUT A;  3CRL C;  4JV5 L;  1A8V A;  1HTP A;  1S5B D;  1T9H A;  3P1H A;  5GRO A;  5JVG 3;  2JA7 H;  4NDX A;  3S2D H;  3D31 A;  5M3M B;  3GTQ H;  1S40 A;  4B3R L;  5JJK A;  1QUQ B;  3HOV G;  1I4Q A;  1M8A A;  2B63 G;  3UDX A;  2VS1 A;  3CCQ A;  1GXD C;  1DYQ A;  3JAM i;  1WTV A;  1SND A;  1BQQ T;  3KLS A;  4LWC A;  4F8M A;  2YTX A;  4A76 A;  1GKH A;  4P75 A;  3CCM A;  1SFO B;  2ES2 A;  2KEE A;  1ONL A;  3E9H A;  3F1Z A;  4H02 A;  3AFQ A;  1Q90 A;  2E2D C;  2RA4 A;  3A55 A;  4A93 H;  5C4X B;  3EIV A;  1YIT A;  5EKI A;  1P8L A;  2B8F A;  4A3F G;  2BE5 D;  4TKO B;  2NVY B;  2B2W A;  4LF9 Q;  2KVM A;  3DLL A;  2K7V A;  1Y1W H;  2AUJ D;  3DUZ A;  1A2T A;  4YHH Q;  3S9W A;  4QY7 A;  1D1K A;  4L5Q A;  1FL0 A;  1E22 A;  4LF9 L;  2PQE A;  2F0P A;  5DAU A;  4PG3 A;  3RZO B;  2F0Q A;  1H9S A;  2RDG A;  3QJY A;  4HAE A;  3ERS X;  4EQO A;  4HIM A;  2WV6 D;  4HR7 B;  3U4V A;  5T1G A;  1TS3 A;  3MXN A;  1SDF A;  1LTB D;  1KXL A;  1L1O B;  3DHQ A;  1VQB A;  3AQQ A;  4LF6 Q;  4HID A;  4KKS A;  4KN7 C;  4G57 A;  3S14 H;  3SR1 A;  5CBE E;  1PMR A;  1Q12 A;  3K5L A;  1B50 A;  1A3T A;  1CQF A;  2EJM A;  4DUZ Q;  1GUT A;  4HJ7 A;  1V8Q A;  1HNW L;  4R8N A;  4F88 A;  4HMJ A;  5M3F B;  1MSG A;  5C4J H;  3CHB D;  1VQ4 A;  3KF8 A;  3J81 c;  4DUZ L;  1EFW A;  1O78 A;  4LJZ C;  5HGQ A;  2DJF C;  1SYB A;  3NHH A;  5LL6 X;  3J80 i;  2F0I A;  4K5W A;  4X66 Q;  1TY0 A;  1YHA A;  2F0J A;  4RCO A;  3PO2 B;  4A3F B;  1V1Q A;  2UXD Q;  2NN6 G;  2N8N A;  1E3P A;  5IYD H;  3A5U A;  4ZYS A;  3DWA A;  2BA0 A;  4A3G G;  2WIN B;  3IFD A;  5IY0 A;  5JEA G;  4DK1 A;  3K7U C;  2KOL A;  4X66 L;  1K8O A;  2K5N A;  4IQZ A;  1BNZ A;  2UXD L;  2MO0 A;  4LF7 Q;  1XPO A;  5LMU Q;  2I0Q A;  2JA8 B;  2P5Z X;  3GTK H;  3CPW A;  3TZD A;  3RN5 A;  3ND8 A;  3UDI A;  4BBS H;  1TS4 A;  1AE2 A;  5C0X H;  2E8G A;  1RDP D;  3G7L A;  3I4M G;  3EA6 A;  4JI5 Q;  4LF7 L;  5LMU L;  1KIX A;  4WJ3 M;  1CKM A;  4X64 Q;  1LT6 D;  4A3I G;  3I55 A;  2BH8 A;  1TWH H;  2JEA I;  3F2U A;  2JA5 H;  3IKJ A;  5E1F A;  3TDQ A;  5FLX L;  2VUM G;  3D6W A;  1S72 A;  4CJ2 C;  2LY7 A;  3ERQ A;  1Q1E A;  1HNZ Q;  1KDB A;  3M9B A;  3K0X A;  4JI5 L;  1EY9 A;  4KD4 A;  1C4Q A;  4X64 L;  1ROD A;  4FYD A;  2R7Z H;  1NNX A;  1TY2 A;  2HT1 A;  5EBD A;  3J7Z C;  2NZ1 D;  2Z8L A;  4HCS A;  2JA6 B;  5CV6 A;  3UE0 A;  4GN5 A;  1HNZ L;  3M3Y B;  4O0A A;  4DK3 C;  1HRJ A;  4A3E G;  2CHB D;  4A3M B;  1A62 A;  5COR A;  1LT5 D;  4XQJ A;  3I4N H;  1EIG A;  3K58 A;  2L15 A;  3NTH A;  4IFD J;  2JYO A;  4M1U B;  3TP5 A;  2XSC A;  1SE4 A;  3ND9 A;  4MN3 A;  2GVA A;  2LMC B;  3NBH A;  1JMC A;  4ZUJ A;  2Q8I B;  1C0A A;  1V43 A;  4RCN A;  1XNR Q;  1EOV A;  1EWH A;  1WD1 A;  4A3G B;  1F9Q A;  1N36 Q;  4QUC A;  3ER0 A;  2Y0S G;  3HKZ B;  1FNV A;  4IUN A;  1N8R C;  2ID0 A;  1IBL Q;  4RKL A;  4DV3 Q;  3QG1 A;  3SXH A;  3M4O B;  3KLR A;  3LX0 A;  3PMF A;  1SNO A;  5IYC G;  4NXM Q;  4C2M B;  4C3H B;  2EYP A;  4DUY L;  1XNR L;  5DM6 3;  1HQM C;  1PZI D;  2OF1 A;  2F0L A;  2PMZ B;  1N36 L;  1E0B A;  1LAC A;  2LS0 1;  2O5I C;  2PQA B;  2NVT B;  1IBL L;  4DV3 L;  1SNQ A;  4A3D B;  4A3L H;  1F9R A;  3TSS A;  4NXM L;  3HOU G;  2B8G A;  1NR2 A;  2B39 A;  5KYL A;  4A3I B;  2KJX A;  3I73 A;  3E9I A;  5CV4 A;  2AHO B;  1G91 A;  1BR9 A;  3T13 A;  2ZJQ A;  2VUM B;  1VQ7 A;  4ZKC B;  1ESF A;  1SJE D;  3FDT A;  4CHT B;  2ZM6 Q;  4ZCK A;  1A6X A;  4QIW E;  2AUK A;  2EYL A;  3HKS A;  4FF3 A;  3STB C;  1RTO A;  4X6A H;  3S1N H;  2Q2H A;  2XWB B;  3FRP B;  2KED A;  1PZK D;  3A7L A;  3CCV A;  1T5E A;  3I4O A;  2EDG A;  3BYY B;  5HY6 A;  4NB3 A;  2ZM6 L;  4BXX H;  4CKB A;  2RSN A;  1HFG A;  1A3U A;  1QNK A;  2N88 A;  2L9H A;  5C4Z A;  4EQ5 A;  1V1P B;  5E4X A;  2FJ2 A;  3HOZ B;  2E2H H;  1IYV A;  3PO3 H;  3DWP A;  3A8K E;  3FPU B;  2EJG C;  3OW2 A;  4IUV A;  1EL0 A;  4C3I G;  4M8A A;  4A3C H;  1XPR A;  1QIL A;  1SE8 A;  5KNB A;  2Y0S B;  2F0D A;  1V9P A;  1VQL A;  1YNN D;  4PZ6 A;  3F2D A;  1IW7 C;  3HOY B;  1B9N A;  1NR4 A;  1WFQ A;  1BOS A;  1GOZ A;  4FNF A;  3K7A B;  1M90 C;  3S1Q H;  2WB1 G;  3FMC A;  4X3U A;  3AB9 A;  2Z6K C;  2RCN A;  2K05 A;  4C1N K;  3Q24 A;  2LKV A;  2QW7 A;  4BY7 B;  1TKW B;  2ZTC A;  2JP1 A;  4XDX A;  4ME3 A;  3HOU B;  4MTN A;  4NW2 A;  1VQI A;  3H3V C;  2N3S A;  1H9J A;  3K0Y A;  1JWS D;  4HJ5 A;  2AQ2 B;  4X65 Q;  4BY1 H;  1JOK A;  2NB0 A;  2N49 A;  2K75 A;  5I6Y A;  3T53 B;  5IT9 E;  1GUS A;  5M5X H;  3VYS A;  2MJ8 A;  3I91 A;  1IBM Q;  3HKZ E;  3H15 A;  2PNR C;  1YJN A;  1K8M A;  4C3J H;  2AQ1 B;  2Z9H A;  3H09 A;  3MTS A;  1WVL A;  1STE A;  1JB7 A;  3CXC A;  4X65 L;  2PCF B;  1LTL A;  3S2D B;  1Q8I A;  2JA7 B;  4ILW A;  1KHI A;  3GTQ B;  1SE3 A;  4BA2 I;  1X3E A;  1IBM L;  4K5X A;  3B6Y A;  4QCL A;  4JBW A;  3CC7 A;  3U4Z A;  2Z1C A;  1EU4 A;  1EQR A;  4U68 A;  5ELF A;  5I9P A;  3HGB A;  5DLQ E;  1XXG A;  3SK5 A;  5FO9 B;  3QWN A;  1FYC A;  3KDF B;  2OEO A;  3R8B A;  1STH A;  4G7H C;  4MTK A;  4JI3 Q;  5DEH A;  2Q2T A;  2R92 G;  4A93 B;  1G2S A;  1F2L A;  1YBY A;  1RIP A;  3A56 A;  1PTO C;  2JK8 A;  5BR8 Q;  2QEX A;  2I5L X;  4PNY A;  2K50 A;  3LNN A;  4KD3 A;  4A3B H;  4R4C A;  1NBW A;  3DM1 A;  1E1T A;  3F2B A;  3G4S A;  4JI3 L;  1IXR A;  3RLO A;  4R4I A;  3W5O A;  5J22 A;  4B9W A;  2NVX H;  5ELN A;  4RHR A;  3A54 A;  5BR8 L;  1H95 A;  3JAM L;  1CA5 A;  2N55 A;  1EYA A;  4DV5 Q;  1U4R A;  4FXD A;  2E2I B;  2NTS A;  4DR2 Q;  3SGI A;  1MHW C;  1VQG A;  2ENB A;  4XIG S;  4BBS G;  3KF6 A;  3KBX A;  3AYH B;  2KUM A;  1PH6 A;  4TSS A;  3MVV A;  3SK6 A;  1JOO A;  1I4X A;  3C46 A;  4UHV A;  1J9O A;  2QDL A;  2F0G A;  4DV5 L;  3KJP A;  2VQE Q;  4KN4 C;  4FP5 D;  2MHV A;  4DR2 L;  2XIW A;  2Y0S E;  3R3O A;  3J81 i;  3FHW A;  3S14 B;  2XRQ D;  1ASY A;  1UWV A;  4IAL A;  3H0G H;  2JEB I;  3MFY A;  4FF4 A;  3GTM H;  3I2Z A;  1A3V A;  2OCE A;  3FPP A;  2VQE L;  4JI0 Q;  1TWC H;  1RCV D;  4JI4 Q;  2A6E D;  2HIX A;  3P20 A;  1DM0 B;  1I4P A;  5C4J B;  4HED A;  3PIP 3;  3OW7 A;  1NE3 A;  3NTI A;  4ZK9 B;  1WTR A;  5H1S E;  5K36 H;  4B3M L;  5C3W A;  3I4N G;  4A3J G;  1MI2 A;  4JI0 L;  3KBG A;  1MSH A;  3K8A A;  3K6O A;  4JI4 L;  1PFS A;  2UUA Q;  1W2B A;  4GOP C;  1I4H A;  4GLA C;  1CT1 D;  4EX5 A;  4BS9 A;  1K8A C;  1U9R A;  2PPB C;  1BKB A;  1MBY A;  1VQJ A;  4JBK A;  3CC4 A;  1AZQ A;  3PUW A;  5GAE C;  1G2T A;  2CWA A;  1ZEQ X;  2N78 A;  1E2Z A;  3A5Z B;  2UUA L;  2PW5 A;  4DR7 Q;  2F0V A;  1F9P A;  2NVQ B;  2PI2 E;  4HSP A;  4N8X 1;  4RHS A;  2IJ0 A;  4AYB B;  4G4K A;  4EQP A;  2H1E A;  3TQY A;  1AW7 A;  1X3P A;  1EYG A;  3TRZ A;  5C5L A;  2M2L A;  3GTK B;  4POF A;  2KHJ A;  3VYR A;  2C35 B;  3A8J E;  4DR7 L;  2B2Y A;  4BBS B;  3BU2 A;  2EJF C;  4DR1 Q;  2K33 A;  1LLR D;  1HFN A;  1PTO H;  4OIK A;  1EY7 A;  3KF8 B;  1F2M A;  5C4X G;  2PO4 A;  2WP8 J;  3U50 C;  1KC8 C;  1TWH B;  2CWP A;  5IP7 H;  4DR6 Q;  2JA5 B;  2XVS A;  4DR1 L;  2KCC A;  1ESR A;  2EE1 A;  2DY8 A;  4A3K H;  1RKN A;  1F77 A;  3VR6 A;  3K80 C;  1PV4 A;  1NSN S;  3TN2 A;  1I3Q H;  2WB1 E;  1SAP A;  3CMA A;  2ZXO A;  2R7Z B;  4F87 A;  2AQ3 B;  3J7Y W;  1EU3 A;  1K28 A;  2DNE A;  4OGQ C;  2B2W C;  4DR6 L;  1LTR D;  2E74 C;  5FJ8 H;  5IGB A;  2VXW A;  1CSP A;  4LF4 Q;  4O1N A;  4TQU S;  4AQY Q;  1E2W A;  3PIP A;  4I7A A;  2B2T A;  2A73 B;  3I4N B;  2FIN B;  4GNX A;  1SJH D;  1SLJ A;  1GUW A;  3FVQ A;  4UP8 A;  2F0N A;  5M5Y H;  4LF4 L;  1EZ6 A;  4EVO A;  1KLU D;  2JQO A;  4AQY L;  1FR3 A;  5JOB A;  1PRT B;  1J5E Q;  3NPP A;  4DV2 Q;  1RF2 D;  2R7D A;  5IT9 L;  3CCR A;  5T1I A;  5FLM G;  3TBI B;  1SR3 A;  1I6H H;  2EVB A;  3GQB A;  3VR5 A;  1L0Y B;  2H5X A;  4IFD H;  1R9T H;  4YWM A;  1IL2 A;  4R4O A;  3CCJ A;  1FD7 D;  1C7Y A;  2F4V Q;  2F0W A;  1UE5 A;  5E7N A;  1HXY D;  1J5E L;  2RKS A;  4DV2 L;  2E5L Q;  3ULJ A;  5M3F G;  4Y7N B;  5CYU A;  1LT3 D;  2QF7 A;  3TRE A;  3D8G A;  1Y1V H;  2C9O A;  3NEN A;  1EY8 A;  2F4V L;  2HCC A;  1L0W A;  4JI2 Q;  1HCZ A;  2OTL A;  2E5L L;  2E75 C;  2J0T D;  2PZU A;  5JVH 3;  3CW2 C;  1D5M C;  3W3A A;  1UE1 A;  5FKA C;  3PO2 G;  1Z9F A;  1D7Q A;  3I4L A;  3J7A 5;  1CHP D;  1CKN B;  3HS0 C;  1SMY C;  1FNU A;  3PF4 A;  1EQT A;  1SYE A;  2Z4I A;  5FLX c;  1FJG Q;  4Q5V A;  1XPU A;  3BZD B;  3NBH B;  4JI2 L;  4LUO A;  3VYU A;  2ICI A;  4KKU A;  5J1Z A;  1PYS B;  3NUC A;  3TEH B;  3VYT A;  1Q86 C;  2OQK A;  2IY5 B;  3S1N B;  4I7Z C;  4KV6 A;  5EPK A;  2RHS B;  3N52 A;  4AYB E;  1FJG L;  1KAW A;  1RL2 A;  2JA8 G;  1UAP A;  2VB3 X;  4YHH L;  1CA6 A;  1X54 A;  1ICF B;  4A75 A;  3AEV A;  3T51 B;  1O7I A;  3GTG H;  1WCM H;  1X55 A;  1PXU A;  1Q7Y C;  2F3V A;  2KHI A;  2MUY A;  1ET9 A;  2E2H B;  1SYF A;  4XT3 B;  3BYT B;  1I94 Q;  1MJC A;  2DNC A;  3SE0 A;  2O4X A;  4ULL A;  3SHL A;  2D0P A;  2V4D A;  2J7Z A;  5JEA J;  1Y69 U;  2OQ0 A;  4GN3 B;  4YWL A;  1ENA A;  2M9V A;  3GTJ H;  2K5H A;  3Q8D A;  2DJG C;  1PRT C;  1I94 L;  4JG2 A;  2MP1 A;  5BN5 A;  3ICE A;  2A5H A;  4OON A;  4XXE A;  2ZJP A;  4A3B G;  1PH8 A;  1SSO A;  4DV0 Q;  4OO1 H;  2E2J H;  4LF6 L;  2IL8 A;  2JA6 G;  2EY5 A;  3GD7 A;  2LFN A;  4KLK A;  2ZXP A;  4J6H A;  4A3M G;  1JJ2 A;  2F3I A;  1CZG A;  1Z6H A;  2RF4 A;  2L11 A;  4HN7 A;  1VQM A;  4FF2 A;  4C1N I;  4K0K Q;  1LM0 A;  4DV0 L;  3D4W A;  2EY2 A;  3WOE A;  1BBW A;  4P2C B;  3CQZ H;  1STY A;  4RGO S;  4PMC A;  5IP9 H;  2UXB Q;  3PIO 3;  1VF7 A;  1O80 A;  1T5X D;  4ODG A;  1SNP A;  4BY1 B;  3BVZ A;  3W1G A;  1UNS A;  3K5O A;  4ALP A;  4K0K L;  3J7A F;  2A74 C;  5M5X B;  3FKI H;  3HKZ G;  3UE1 A;  2MFI A;  2B2V A;  4DR4 Q;  2UXB L;  2HQL A;  1WOC A;  4C3J B;  5L37 A;  4KI0 A;  4R1J A;  2UXC Q;  3K5N A;  5GAH C;  3M7G A;  4C3H G;  1WYD A;  3S1R H;  3HOW H;  2RSO A;  5E3F A;  1VQH A;  4GLX A;  1QE6 A;  4RG1 A;  3P75 A;  3L0O A;  5EPJ A;  3QOJ A;  1AFP A;  4YWK A;  1SMX A;  4DR4 L;  2CCZ A;  3BVM A;  3NWS A;  1CZW A;  4A3D G;  4J8Q A;  2UXC L;  1L0X B;  5D3I B;  3GTP H;  3KOJ A;  4JVZ A;  5C5M A;  5TSS A;  1WTP A;  3STB D;  2EOT A;  3A0J A;  3NP8 A;  2GA4 B;  3RD4 A;  1I4G A;  1LTT D;  5AFW A;  5I2X A;  1S5E D;  1O7Y A;  2Z6B A;  4BBR H;  1EEF D;  4H44 C;  1XWE A;  3R2T A;  2D0O A;  5KRU A;  4L63 B;  4RMF A;  3ZJY C;  3KK7 A;  4JCV E;  2FFK B;  3PSI A;  3G6J B;  2Z4H A;  4Z9C B;  3S24 A;  4A3B B;  3Q23 A;  2RHQ B;  3CD6 A;  5IYB H;  1XMO Q;  3I56 A;  4PZ8 A;  3JAM E;  1JQY D;  2F4I A;  1ENC A;  5CV9 A;  2NVX B;  3CCE A;  1LUZ A;  1NUC A;  2R7F A;  3MXG A;  1XMQ Q;  1IKL A;  4CKC A;  3W1B A;  1QUQ A;  2R93 H;  1XMO L;  2B3G A;  5G3L D;  1IW7 D;  3WDN A;  2F0O A;  3HOZ G;  4KHP Q;  4QL5 A;  1CUK A;  3UDG A;  3D0F A;  1E24 A;  2RBM A;  3O13 A;  1QG7 A;  3ULP A;  1XMQ L;  3PIO A;  4UDU C;  4IJL A;  3NEM A;  3I8Z A;  2F0T A;  4J1M A;  3OOC A;  3MXP A;  4KHP L;  1XNQ Q;  3MAQ A;  2NN6 I;  3HOY G;  4BWG B;  1DCZ A;  4OEM B;  1RHP A;  3OHX C;  4A3K G;  3NE5 B;  1D5X C;  3H0G B;  1HNX Q;  1ML0 D;  2AWN A;  3VR4 A;  3GTM B;  3A7A B;  1W6K A;  4R4Q A;  2YU9 H;  1HZB A;  1S5D D;  1N34 Q;  2XTI A;  3D6C A;  1TWC B;  4DPG A;  3CPF A;  1XNQ L;  2EYF A;  1BVS A;  1NJI C;  4QB4 A;  1WTH A;  1G8Z D;  3M4Q A;  4BY7 G;  1PVO A;  2VY3 A;  2MQH A;  5D65 A;  1HNX L;  2CH4 A;  1Q82 C;  4B9X A;  4IPG A;  1CFM A;  3A8I E;  1VQF A;  4PQX A;  1G6P A;  4H7B A;  1HJP A;  1BBU A;  2A8V A;  1X3Q A;  1B2T A;  2CKZ B;  1YHB A;  1TVX A;  3KF6 B;  1JWU D;  1R4Q B;  3J81 j;  3CU7 A;  3M4Y A;  4L5S A;  1EUJ A;  1L1O A;  1K9M C;  2KBN A;  1ZKO A;  2XRS D;  2F0U A;  4DV7 Q;  4OL7 A;  2TSS A;  1KD1 C;  1MGS A;  1EIF A;  2HHH Q;  1JOR A;  2NVY H;  2JA7 G;  2L12 A;  1M1K C;  3I72 A;  2SNM A;  3K5M A;  3T1H Q;  4KTA A;  1IYU A;  3JC6 6;  3JAM c;  3QOL A;  5EPL A;  4DV7 L;  2L1B A;  1CSQ A;  1PTO D;  4LMQ D;  3J80 E;  4I65 A;  5C3X A;  3VA5 A;  2MPM A;  3BG3 A;  4CKE A;  2HHH L;  5I2Y A;  3PGZ A;  1IHZ A;  4YCV A;  2I5H A;  4ZAI A;  1DOM A;  1S3O A;  2G9H D;  1PTO B;  4EGV A;  1J6Q A;  4A93 G;  3CKI B;  2C5C A;  3SVM A;  4WFN 3;  4JW0 A;  4A3K B;  1Y1W G;  1GVP A;  5IIF A;  5DNF A;  4E6I A;  1BCP B;  3SK4 A;  4KY7 A;  2ZTD A;  1I3Q B;  2RQX A;  3IFT A;  4K8J A;  4CDF C;  2K4K A;  4CDC C;  1YIJ A;  2DUD A;  4DNI A;  2FXQ A;  5C6A A;  5ISR A;  3F2C A;  2HCI A;  4NP5 A;  4L6T B;  4OX9 Q;  2O5J C;  2NBF A;  3HOV H;  3DXJ C;  2B63 H;  4CJ0 B;  1JWM D;  3L9A X;  2KEN A;  3C1F A;  4JPB W;  1NY4 A;  3M4P A;  3NEL A;  4OX9 L;  1ICW A;  4DV4 Q;  1YJ9 A;  1EFI D;  3L3O C;  3I7F A;  4K6D A;  1GO3 E;  4B08 A;  1I6H B;  3U58 A;  3OMC A;  1QVC A;  3RN2 A;  1R9T B;  4K6L A;  1OO9 B;  1PH1 A;  4A4I A;  1VQC A;  2PMZ E;  3QB3 A;  4FVM A;  4KY5 A;  1VQD A;  5EBC A;  4DV4 L;  1KLG D;  4HJ8 A;  3S17 H;  2CQO A;  3DWQ A;  2IHF A;  2ZTE A;  1N9W A;  2JN4 A;  2K5Q A;  4IPD A;  3IAY A;  2IWH A;  1XYI A;  4IUQ A;  4QJF A;  1A0I A;  1Y1V B;  4GOP B;  3WWV A;  2EYJ A;  4HIO A;  1GHK A;  3E3X A;  5J39 A;  1Y14 B;  1D1I A;  1VDZ A;  1B7Y B;  1STA A;  1SXT A;  5G3L F;  3EVQ A;  1PH5 A;  4XT1 B;  2K52 A;  4XYQ A;  1Y1W B;  4RAU C;  5IYD G;  4RGT A;  4HJA A;  5JPM C;  1YNX A;  4L5R C;  4QGU A;  1DGS A;  3BDO A;  4RH6 A;  1HH2 P;  1BUV T;  1YZ6 A;  2F0E A;  1YNJ C;  1M4V A;  2K04 A;  1BCP C;  5F2D A;  1JE4 A;  2K28 A;  4AYB G;  2EYH A;  2AMC B;  4WOR A;  2F1M A;  3HOW G;  1K0R A;  3P7J A;  3PV0 A;  1B1Z A;  2K5D A;  3BJU A;  5K5P A;  2PQA A;  3AU7 A;  2A68 C;  5C0X G;  3GTG B;  1WCM B;  1VQN A;  1TWA H;  1O7L A;  5IGG A;  4N9P A;  5IOC A;  1TII D;  2DN8 A;  2WFW A;  4LUV A;  5ELB A;  4DAM A;  2K14 A;  4UAI A;  2B2Y C;  1CQV A;  3GV6 A;  1HZC A;  3MEF A;  3S2H H;  3Q6S A;  1EZ8 A;  2JA5 G;  4PZ7 A;  1B8A A;  1XX8 A;  4JK1 C;  4X62 Q;  3GTJ B;  2Q8T A;  4B3S Q;  1X3F A;  2A6H C;  5IT9 c;  3I3C A;  3HRZ C;  1A2U A;  4JI8 Q;  1SBB B;  2NN6 H;  1SYG A;  3FEW X;  1GHJ A;  4KHV A;  2R7Z G;  2R61 A;  2E2J B;  4A3G H;  1L2F A;  4HMI A;  1B9M A;  3MXU A;  5JEA H;  1N32 Q;  4X62 L;  4LK1 C;  3NXW A;  4DGZ A;  5D14 A;  4B3S L;  3GV3 A;  4JI8 L;  3C3L A;  2QDB A;  1HHV A;  2VB2 X;  1GUN A;  1NAP A;  4F7X A;  1VCI A;  2RDH A;  2EY1 A;  4FXG C;  1V1P A;  1FNW A;  1FGU A;  1H9S B;  1JB3 A;  4UP9 A;  3CQZ B;  2K01 A;  4DKA C;  1H9K A;  4UY8 C;  2NVT H;  1PTO F;  3E0E A;  4ME5 A;  2TMP A;  4TVA B;  2NWG A;  3I4M H;  2B2T C;  4V19 0;  1JE5 A;  4UPA A;  1S4Z A;  3MXN B;  4GNX C;  1TWG H;  4CDE C;  4DNR B;  1RTN A;  1R4P B;  3FKI B;  1YI2 A;  1SNC A;  3LGJ A;  3RUZ A;  2J4X A;  2SOB A;  2VUM H;  4ABN A;  1TS5 A;  1TU2 B;  2LXJ A;  4JI6 Q;  3BVG A;  1PH7 A;  1LYL A;  3G71 A;  4HCE A;  1JR0 D;  1Z7T A;  4WRD A;  3S1R B;  3HOW B;  3LWE A;  4DK6 C;  3PUY A;  3CC2 A;  1VQP A;  1SMY D;  4IPH A;  4JI7 Q;  3J80 L;  2F0H A;  4DV1 Q;  1ZYR C;  1OXS C;  2VZA A;  3PUX A;  4FO2 A;  2B2U A;  4A3L G;  2KEC A;  4JI6 L;  5EKK A;  2K5V A;  1CM9 A;  4KJN A;  3GTP B;  2Q2I A;  1FGB D;  3D4D A;  4A3E H;  2WKD A;  4GS3 A;  2L55 A;  1EWI A;  5FOB B;  3VA7 A;  3GP7 A;  2JSO A;  4JI7 L;  4BBR B;  4DV1 L;  5IGF A;  1Q81 C;  4X3S A;  2A1A A;  3IRB A;  3CRK C;  2F0F A;  2KCT A;  2EQS A;  2EXZ A;  3QR8 A;  3NQT A;  2EIF A;  1NMF A;  2R6G A;  2X6G A;  3K81 C;  3FP9 A;  2EZV A;  4ZKB B;  1K8G A;  1VQA A;  2PI2 A;  5EAY A;  2WAQ B;  3KYH C;  4JOI A;  4XQQ A;  2X6L A;  1MJE A;  1WTW A;  4K2K A;  4BXX G;  5IYC H;  3DEO A;  5JPN C;  4ZRZ A;  1HR0 W;  5C44 H;  2R93 B;  4CDD C;  2RCF A;  5A35 A;  1IZ6 A;  1C8C A;  1YHQ A;  1PRT D;  5C4H A;  5CR3 A;  2PW7 A;  3PO3 G;  1B4O A;  1Q1B A;  1BBX C;  1SYD A;  2Z0S A;  4A3C G;  1IL8 A;  1DOL A;  1D2B A;  4DV6 Q;  4OXP A;  2A19 A;  3ERO A;  5IGD A;  1HR0 Q;  5LHY 1;  4KMU C;  1SE2 A;  1YVC A;  3GTO H;  1JJC B;  1LV9 A;  5BN4 A;  4JV5 Q;  1GJX A;  2OWO A;  5IE8 A;  3N6R A;  2IT1 A;  2YU9 B;  5CBA E;  2K32 A;  5C3E H;  4C56 C;  2I07 B;  2D2C C;  4K2L A;  4GZY C;  1ENF A;  2ASB A;  1HR0 L;  3S16 H;  1AZP A;  1QVF A;  4AH6 A;  1TXY A;  2O2L D;  5HGT A;  1U0L A;  1ILQ A;  3J81 E;  3EQL C;  1B3A A;  2SNS A;  2RDF A;  1D5Z C;  1PLF A;  5KIX A;  1LT4 D;  4BY1 G;  3X3M A;  4DAV A;  1XTD A;  1GD7 A;  3E0J A;  1II3 A;  5DM7 3;  3OSO A;  4C3I H;  1K3R A;  2H4O A;  1LTS D;  3SK8 A;  3OIP A;  4K5V A;  2CW0 C;  4C3J G;  3EN2 A;  4KK7 A;  4ZUI A;  3KLS X;  4N8F A;  2OTJ A;  4O42 A;  3TZU A;  4QMG A;  2EYM A;  2B2V C;  2YTV A;  1J8I A;  1DZ1 A;  2F52 A;  2EYO A;  4YY3 Q;  1STB A;  3BDL A;  1F2Y A;  3PO3 B;  2VQF Q;  4DAY A;  2PZW A;  1EY6 A;  1QWY A;  1WTX A;  2NYZ D;  1WTQ A;  5JJL A;  2E2I H;  1X3G A;  1MD2 D;  4YY3 L;  3NBI A;  3SDZ A;  3CME A;  1PZJ D;  4RA8 A;  1Z47 A;  2K5W A;  3MHB A;  1OXT A;  3IL8 A;  3KUP A;  2QGQ A;  3MA2 B;  1O7Z A;  5BN3 A;  2VQF L;  4LNQ A;  2KCN A;  1BF4 A;  2UUC Q;  5FO7 B;  2JXM B;  4X3T A;  3S1Q B;  3MZ5 A;  4QUF A;  1Q3L A;  1VQ8 A;  2BA1 A;  1PH3 A;  1VQE A;  1TR5 A;  3RZD H;  4R9W A;  1V1O A;  1EYD A;  1I50 H;  2WAQ E;  3VDY A;  1NTG A;  2E76 C;  1SRO A;  1DD2 A;  1K73 C;  3URY A;  4P74 A;  2UUC L;  5JJZ A;  3S15 H;  4KY6 A;  3OWF A;  3TME A;  3K57 A;  3UDF A;  3HOX H;  1EEI D;  5EJW A;  2A69 C;  3E6Z X;  3HOV B;  4MNO A;  2B63 B;  1GUO A;  2HUG A;  2ATW A;  4X3K A;  1D6E C;  4G7O C;  2YTY A;  4J15 A;  4NXN Q;  3GTL H;  1C9O A;  1KL9 A;  1F2Z A;  1VMP A;  1GM5 A;  3VR3 A;  4IZ8 A;  2QCP X;  4LAA A;  1K3B C;  1SNM A;  4RGM A;  3V96 A;  4DR5 Q;  1B44 D;  5ELE A;  2R92 H;  1Q46 A;  4UP7 A;  1VMC A;  3H0G G;  5GAD C;  4KJO A;  2L0C A;  5ELD A;  4NXN L;  3S1M H;  1G51 A;  2QA4 A;  2HIV A;  3M85 A;  4DXG A;  2BDN A;  4PMW A;  4QIW B;  2G5D A;  2WKC A;  3CCU A;  2CVR A;  4GKJ Q;  1TQO A;  1I5F A;  4DR5 L;  3H91 A;  3S17 B;  1QZH A;  4DN4 M;  2WII B;  2EY6 A;  2OT2 A;  4DXF A;  2NZO A;  4QF4 A;  2NVQ H;  1DJR D;  1X32 A;  2IW3 A;  1K83 H;  4IPC A;  5K36 G;  2JJQ A;  3EFX D;  1CK1 A;  2BE5 C;  1ILP A;  4R4T A;  3VR2 A;  4HIK A;  4BA1 I;  1G6Z A;  1C48 A;  5ELC A;  5IWA Q;  2YYZ A;  4GKJ L;  3NWT A;  3C2P A;  3K59 A;  2KCM A;  2G9D A;  3C1E A;  1PRT F;  1KNA A;  3UI2 A;  1UE6 A;  3BZC A;  3X3N A;  3U9O A;  3E5S A;  4IUR A;  1CKO A;  1VS0 A;  5LL6 S;  2GN5 A;  1X56 A;  1IBK Q;  4GLV B;  5IWA L;  4NPS A;  5IOD A;  3Q0A A;  4G7Z C;  1CHQ D;  2VNU D;  1U4L A;  1TWF H;  2CQA A;  1L1O C;  1UE7 A;  4OIJ A;  3QIA A;  5GQO A;  3T56 B;  2MNA A;  1IBK L;  3ZYY X;  2ICE C;  1UEB A;  2ZXR A;  3G6E A;  2MGS A;  5KEE A;  3AFP A;  1HTL D;  5CV8 A;  3CCS A;  2YV5 A;  1QCB D;  3WOF A;  1TWA B;  3BZK A;  4HSV A;  2D9U A;  4B3T Q;  4H0L C;  2NTT A;  1EYC A;  5M5W H;  2LXK A;  4N9T A;  5D3D A;  3L2P A;  1YJW A;  1B3Q A;  1SN8 A;  4P72 A;  4A3J H;  1OXV A;  3T4A C;  4GN4 B;  3S2H B;  1JIC A;  1S5F D;  5IP7 G;  3PCO B;  5IGC A;  1W6J A;  2M00 A;  1CKN A;  4PMB A;  3G48 A;  1FVI A;  2BOS A;  3MEH A;  4JI1 Q;  3W2D A;  2JE6 I;  4B3T L;  1STG A;  1Q8K A;  3I90 A;  5FK9 C;  2K03 A;  4DUY Q;  5CV5 A;  3HZX A;  3TP6 A;  2HDL A;  2K6A A;  2VW9 A;  5FJ8 G;  1PYB A;  3OPO A;  4FXK C;  2QEJ C;  2OXP A;  4RKB A;  1U4M A;  3OWE B;  4JI1 L;  5KYI A;  1D8L A;  1X6O A;  3NK9 A;  3V2T A;  5M3M H;  1QB5 D;  5JJI A;  1VF5 C;  1N34 L;  3RMH A;  1JC7 A;  1VQO A;  5A2Q E;  2FMC A;  5C44 G;  1H9R A;  3D4R A;  4Y7N H;  3H3V I;  3M7N A;  4K14 A;  3J81 L;  3CCL A;  1HA6 A;  5ELO A;  3MC0 B;  3I4M B;  2UU9 Q;  4MZ9 A;  1SFO H;  1B70 B;  2LSS A;  1TWG B;  1BO0 A;  2HD3 A;  5C4X H;  3ULL A;  3RR5 A;  3OTO Q;  2KA7 A;  5KGU A;  1EY4 A;  1HQR D;  5IGE A;  4IFD G;  3MFG A;  3D3R A;  1JCK B;  2UU9 L;  4NMZ A;  1HA5 A;  1XJV A;  1RD9 D;  2IX1 A;  4RWS C;  5C3E G;  4YCW A;  1I4R A;  3NQI A;  1EY5 A;  1OXU A;  3OTO L;  2DGY A;  2D5D A;  5HUR A;  1LTA D;  1Y1V G;  2L4N A;  1LAB A;  3TS0 A;  1TS2 A;  3CF5 A;  4DR3 Q;  1QZG A;  1PH2 A;  1IKM A;  3T1H L;  4ID6 A;  3OMG A;  4A3E B;  1YNJ D;  4TRD A;  3RZO H;  1DON A;  1BCP D;  4DF7 A;  4JYA Q;  2BDO A;  2XNA C;  5GAG C;  3R2I A;  1HUM A;  1PA6 A;  4OWW B;  1OTC A;  1B53 A;  4DR3 L;  3DM3 A;  5CV7 A;  1NMG A;  1WI5 A;  2Q8R E;  2A68 D;  1SRU A;  4MHE A;  4JYA L;  1PH4 A;  4LFB Q;  1ASZ A;  2ZJR A;  1KDA A;  4IUP A;  5J3B A;  1G29 1;  4R8I A;  1JOQ A;  1HZ9 A;  1Y8O B;  4U67 3;  5FLM H;  2SEB D;  2KQ3 A;  1AP0 A;  2I5M X;  3NTK A;  3OIQ A;  4WJW A;  1X9N A;  1QNU A;  1U4P A;  3LWU A;  5C44 B;  1F9S A;  4LFB L;  1EIY B;  1WCM G;  2A6H D;  5M3F H;  1QVG A;  4QQB X;  4P71 A;  5NUC A;  5M5Y B;  1PH9 A;  4KHZ A;  1KAB A;  4LUZ A;  1HUN A;  3DEP A;  5EGT A;  1IYJ B;  4OWX B;  3EBE A;  3RLN A;  2HQE A;  2VL6 A;  3OYY A;  2GVB A;  1KTK A;  2I46 A;  5FO8 B;  3ONA B;  1CI3 M;  3Q22 A;  3PO2 H;  4A3F H;  1H9M A;  2K1B A;  1EY0 A;  5EKL A;  3GTO B;  2QIL A;  4OO1 G;  1Y8P B;  1KDC A;  4DK0 A;  5C0X J;  5C3E B;  4APV A;  4JBM A;  4IFD I;  2XWJ B;  4NKL A;  1E2V A;  2F3W A;  3S16 B;  4RGN A;  2ZT9 C;  2IPK D;  5E4W C;  3J80 c;  4PV1 C;  2JA8 H;  3KLW A;  2F0M A;  3PQI A;  5CGK A;  1WD0 A;  3HOX G;  1Y8N B;  1LTI D;  2UUB Q;  4GNX B;  5IP9 G;  4LFA Q;  1E7Z A;  4AIM A;  2PNH A;  2JA9 A;  4XTC S;  4YCU A;  4IO9 A;  1P16 A;  1CTM A;  2CH4 W;  1KRT A;  4CGY B;  4H13 C;  1PDQ A;  1JJG A;  3FKI G;  1ZYR D;  3HP3 A;  4C3I B;  2UUB L;  1PFN A;  4LFA L;  5M9O A;  2SDF A;  4POG A;  3HFZ B;  2Z6K A;  3SEB A;  2IX0 A;  1LO5 D;  2ALY B;  4KKT A;  5LMN W;  4DAP A;  2EXD A;  2WB1 B;  4LFC Q;  2JA6 H;  4K8I A;  2IX3 A;  2MO1 A;  2RVL A;  4XYO A;  3M3Y H;  4OWT B;  5I4D A;  4FDB A;  4A3M H;  1YNN C;  2IHE A;  3ITP A;  4RFB A;  1HZA A;  4Q0F A;  1QOH A;  5KNC A;  3CP0 A;  1VQ5 A;  2XGT A;  4YIJ A;  4BBR G;  2L5T A;  2B2U C;  3KFU A;  4LFC L;  1HPC A;  5I9O A;  3T1Y Q;  1WTO A;  5LMN Q;  3CAM A;  3H94 A;  1N33 Q;  4V0B A;  4MIU A;  2NUC A;  3BS1 A;  2F0K A;  5IYB G;  1EQV A;  4ZQ3 A;  2WAQ G;  4DFA A;  4ZLT F;  3RZD B;  3T1Y L;  5LMN L;  2B29 A;  3L7Z C;  1I50 B;  1HNW Q;  1N33 L;  3M4O H;  3EJI A;  4OO1 I;  4C2M H;  4C3H H;  2R93 G;  4OHJ A;  2CFM A;  1PFM A;  3KJO A;  3S15 B;  1UUP A;  1AEX A;  4B3M Q;  4IJH A;  3RLF A;  3HOX B;  4JC0 A;  1N32 L;  5A2Q L;  4JOI C;  4HJ9 A;  5I6W A;  2PZT A;  1STN A;  3T16 A;  2XN9 C;  4A3D H;  2Q2U A; 
#chains in the Genus database with same CATH homology
 1TT2 A;  2PYK A;  4IUU A;  3GTL B;  1XTC D;  2FMM A;  5KND A;  5JAV A;  1KAA A;  1BDO A;  1BCP F;  5CC4 A;  2DY7 A;  3AMU A;  2R92 B;  1A15 A;  3R93 A;  2QKI C;  3S1M B;  3BDC A;  1NCV A;  5CMD A;  1RJT A;  1EIH A;  3PUV A;  3TP8 A;  4HTH A;  1K83 B;  3V05 A;  1OXX K;  2CW0 D;  5C0X I;  2X69 A;  1QJO A;  4CJ1 B;  1PFB A;  1LTG D;  3QO2 A;  4FF1 A;  1EWC A;  2F03 A;  1S5C D;  2R3Z A;  3PUZ A;  4EQN A;  1SEB D;  3H6M A;  3HG9 A;  4L8J A;  5FLX E;  1SYC A;  1TWF B;  2FHT A;  1I6V C;  2AWO A;  3HEJ A;  3I70 A;  4DA2 A;  3MWY W;  3NSW A;  2KHS A;  4XQN A;  2HDM A;  4DNT B;  1EOT A;  5EQ0 A;  2EPB A;  3J7A V;  4CBV A;  1GUG A;  5M5W B;  3U9S A;  1DOK A;  4IN3 A;  1ZXT A;  3GO5 A;  3TP7 A;  4A3J B;  1DXM A;  5COY A;  4DU9 A;  1AN8 A;  1PYW D;  2A6E C;  1ET6 A;  2BCO A;  2A69 D;  1KNE A;  2WAC A;  4S3S A;  2D62 A;  3DMU A;  2F0S A;  1BXT A;  1UEA B;  4IUT A;  3CRL C;  1S5B D;  1HTP A;  3P1H A;  5JVG 3;  4NDX A;  3D31 A;  5M3M B;  1I4Q A;  1M8A A;  1GXD C;  1DYQ A;  1WTV A;  1SND A;  1BQQ T;  3KLS A;  4F8M A;  1SFO B;  2KEE A;  1ONL A;  1Q90 A;  2E2D C;  2RA4 A;  3A55 A;  5C4X B;  5EKI A;  2B8F A;  2BE5 D;  4TKO B;  2NVY B;  2B2W A;  2KVM A;  2K7V A;  2AUJ D;  3DUZ A;  1A2T A;  3S9W A;  1D1K A;  2PQE A;  2F0P A;  5DAU A;  3RZO B;  2F0Q A;  1H9S A;  2RDG A;  3QJY A;  4HAE A;  4EQO A;  2WV6 D;  4HR7 B;  5T1G A;  1TS3 A;  3MXN A;  1SDF A;  1LTB D;  3DHQ A;  4KKS A;  4KN7 C;  4G57 A;  3SR1 A;  5CBE E;  1PMR A;  1Q12 A;  3K5L A;  1B50 A;  1A3T A;  1CQF A;  2EJM A;  1GUT A;  1V8Q A;  4R8N A;  4F88 A;  4HMJ A;  5M3F B;  1MSG A;  3CHB D;  3KF8 A;  1O78 A;  4LJZ C;  1SYB A;  3NHH A;  5LL6 X;  2F0I A;  4K5W A;  1TY0 A;  2F0J A;  4RCO A;  3PO2 B;  4A3F B;  2NN6 G;  4ZYS A;  3DWA A;  2BA0 A;  2WIN B;  3IFD A;  5JEA G;  4DK1 A;  2KOL A;  1K8O A;  4IQZ A;  1BNZ A;  2JA8 B;  3TZD A;  3ND8 A;  1TS4 A;  5C0X H;  1RDP D;  3G7L A;  3EA6 A;  1LT6 D;  2JEA I;  3F2U A;  3IKJ A;  3TDQ A;  5E1F A;  5FLX L;  3D6W A;  4CJ2 C;  2LY7 A;  3ERQ A;  1Q1E A;  1KDB A;  1EY9 A;  4KD4 A;  1C4Q A;  1ROD A;  4FYD A;  1TY2 A;  5EBD A;  2NZ1 D;  2Z8L A;  4HCS A;  2JA6 B;  5CV6 A;  3M3Y B;  1HRJ A;  2CHB D;  4A3M B;  5COR A;  1LT5 D;  4XQJ A;  1EIG A;  3K58 A;  3NTH A;  4IFD J;  2JYO A;  4M1U B;  3TP5 A;  2XSC A;  1SE4 A;  3ND9 A;  4MN3 A;  2LMC B;  3NBH A;  4ZUJ A;  2Q8I B;  1V43 A;  4RCN A;  1EWH A;  1WD1 A;  4A3G B;  1F9Q A;  4QUC A;  3HKZ B;  1FNV A;  4IUN A;  2ID0 A;  4RKL A;  3QG1 A;  3SXH A;  3M4O B;  3KLR A;  3LX0 A;  3PMF A;  1SNO A;  4C2M B;  4C3H B;  2EYP A;  5DM6 3;  1HQM C;  1PZI D;  2OF1 A;  2F0L A;  2PMZ B;  1E0B A;  1LAC A;  2LS0 1;  2O5I C;  2NVT B;  1SNQ A;  4A3D B;  1F9R A;  3TSS A;  2B8G A;  1NR2 A;  2B39 A;  5KYL A;  4A3I B;  2KJX A;  3I73 A;  5CV4 A;  1G91 A;  1BR9 A;  3T13 A;  2VUM B;  4ZKC B;  1ESF A;  1SJE D;  3FDT A;  4CHT B;  1A6X A;  2AUK A;  2EYL A;  4FF3 A;  1RTO A;  2XWB B;  3FRP B;  2KED A;  1PZK D;  3A7L A;  1T5E A;  2EDG A;  3BYY B;  4CKB A;  2RSN A;  1HFG A;  1A3U A;  1QNK A;  2N88 A;  2L9H A;  5C4Z A;  1V1P B;  5E4X A;  2FJ2 A;  3HOZ B;  1IYV A;  3DWP A;  3A8K E;  3FPU B;  2EJG C;  4IUV A;  1EL0 A;  4C3I G;  4M8A A;  1QIL A;  5KNB A;  2Y0S B;  2F0D A;  1YNN D;  1IW7 C;  3HOY B;  1B9N A;  1NR4 A;  1BOS A;  1GOZ A;  4FNF A;  3K7A B;  3FMC A;  4X3U A;  3AB9 A;  2K05 A;  4C1N K;  3Q24 A;  2LKV A;  4BY7 B;  1TKW B;  2JP1 A;  4XDX A;  3HOU B;  4NW2 A;  3H3V C;  1H9J A;  3K0Y A;  1JWS D;  2AQ2 B;  1JOK A;  2NB0 A;  5I6Y A;  5IT9 E;  3T53 B;  1GUS A;  3VYS A;  2MJ8 A;  3I91 A;  2PNR C;  1K8M A;  2AQ1 B;  3H09 A;  3MTS A;  1WVL A;  1STE A;  2PCF B;  3S2D B;  1Q8I A;  2JA7 B;  4ILW A;  3GTQ B;  1SE3 A;  4BA2 I;  4K5X A;  4QCL A;  4JBW A;  2Z1C A;  1EU4 A;  4U68 A;  5ELF A;  5I9P A;  3HGB A;  1XXG A;  3SK5 A;  5FO9 B;  3QWN A;  1FYC A;  2OEO A;  3R8B A;  1STH A;  4G7H C;  5DEH A;  4A93 B;  1G2S A;  1F2L A;  3A56 A;  1PTO C;  4PNY A;  3LNN A;  4KD3 A;  3DM1 A;  5J22 A;  4B9W A;  4RHR A;  3A54 A;  3JAM L;  1CA5 A;  2N55 A;  1EYA A;  1U4R A;  4FXD A;  2E2I B;  2NTS A;  2ENB A;  4XIG S;  3KBX A;  2KUM A;  4TSS A;  3SK6 A;  3MVV A;  1JOO A;  1I4X A;  3C46 A;  1J9O A;  2F0G A;  4KN4 C;  4FP5 D;  2MHV A;  2XIW A;  3R3O A;  3S14 B;  2XRQ D;  4IAL A;  2JEB I;  3MFY A;  4FF4 A;  1A3V A;  3FPP A;  1RCV D;  2A6E D;  3P20 A;  1DM0 B;  1I4P A;  5C4J B;  4HED A;  3PIP 3;  3OW7 A;  3NTI A;  4ZK9 B;  1WTR A;  5K36 H;  5C3W A;  1MI2 A;  3KBG A;  1MSH A;  3K6O A;  1I4H A;  1CT1 D;  4BS9 A;  1U9R A;  2PPB C;  1MBY A;  1AZQ A;  3PUW A;  1G2T A;  1ZEQ X;  1E2Z A;  2PW5 A;  2F0V A;  1F9P A;  2NVQ B;  4HSP A;  4RHS A;  2IJ0 A;  4AYB B;  4G4K A;  4EQP A;  2H1E A;  1AW7 A;  1X3P A;  5C5L A;  2M2L A;  3GTK B;  3VYR A;  3A8J E;  4BBS B;  2B2Y A;  2EJF C;  2K33 A;  1LLR D;  1HFN A;  1PTO H;  4OIK A;  1EY7 A;  1F2M A;  2PO4 A;  2WP8 J;  1TWH B;  2JA5 B;  2XVS A;  2KCC A;  1ESR A;  2EE1 A;  2DY8 A;  1RKN A;  1F77 A;  3VR6 A;  1NSN S;  3TN2 A;  1SAP A;  2ZXO A;  2R7Z B;  4F87 A;  2AQ3 B;  3J7Y W;  1EU3 A;  2DNE A;  4OGQ C;  2B2W C;  1LTR D;  2E74 C;  5IGB A;  2VXW A;  4O1N A;  4TQU S;  1E2W A;  2B2T A;  2A73 B;  3I4N B;  2FIN B;  1SJH D;  1GUW A;  3FVQ A;  2F0N A;  1EZ6 A;  4EVO A;  1KLU D;  1FR3 A;  5JOB A;  1PRT B;  3NPP A;  1RF2 D;  5IT9 L;  5T1I A;  3TBI B;  2EVB A;  3GQB A;  3VR5 A;  1L0Y B;  4IFD H;  1FD7 D;  2F0W A;  1HXY D;  2RKS A;  4Y7N B;  5CYU A;  1LT3 D;  2QF7 A;  3D8G A;  2C9O A;  1EY8 A;  2HCC A;  1HCZ A;  2E75 C;  2J0T D;  2PZU A;  5JVH 3;  1D5M C;  3W3A A;  5FKA C;  3I4L A;  1CHP D;  3HS0 C;  1SMY C;  1FNU A;  1EQT A;  1SYE A;  2Z4I A;  4Q5V A;  3BZD B;  3VYU A;  2ICI A;  4KKU A;  5J1Z A;  3NUC A;  3VYT A;  3S1N B;  4I7Z C;  4KV6 A;  5EPK A;  3N52 A;  1UAP A;  2VB3 X;  1CA6 A;  3T51 B;  1PXU A;  2F3V A;  2MUY A;  1ET9 A;  2E2H B;  1SYF A;  4XT3 B;  3BYT B;  2DNC A;  3SE0 A;  2O4X A;  4ULL A;  3SHL A;  2V4D A;  2J7Z A;  5JEA J;  1Y69 U;  1ENA A;  2M9V A;  1PRT C;  2MP1 A;  5BN5 A;  2A5H A;  4XXE A;  1SSO A;  4OO1 H;  2IL8 A;  2EY5 A;  3GD7 A;  2LFN A;  2ZXP A;  4J6H A;  1CZG A;  1Z6H A;  4HN7 A;  2L11 A;  4FF2 A;  4C1N I;  3D4W A;  2EY2 A;  3WOE A;  4P2C B;  1STY A;  4RGO S;  4PMC A;  3PIO 3;  1VF7 A;  1O80 A;  1T5X D;  4ODG A;  1SNP A;  4BY1 B;  3BVZ A;  1UNS A;  3K5O A;  3J7A F;  2A74 C;  5M5X B;  2B2V A;  4C3J B;  4KI0 A;  3K5N A;  3M7G A;  4C3H G;  2RSO A;  5E3F A;  1QE6 A;  3P75 A;  5EPJ A;  3QOJ A;  1AFP A;  3BVM A;  3NWS A;  1CZW A;  4J8Q A;  1L0X B;  5D3I B;  5C5M A;  5TSS A;  1WTP A;  2EOT A;  3NP8 A;  2GA4 B;  3RD4 A;  1I4G A;  1LTT D;  5AFW A;  5I2X A;  1S5E D;  1O7Y A;  1EEF D;  4H44 C;  1XWE A;  3R2T A;  5KRU A;  4L63 B;  3KK7 A;  2FFK B;  3G6J B;  2Z4H A;  4Z9C B;  4A3B B;  3Q23 A;  3JAM E;  1JQY D;  2F4I A;  1ENC A;  5CV9 A;  2NVX B;  1NUC A;  3MXG A;  1IKL A;  4CKC A;  5G3L D;  1IW7 D;  3WDN A;  2F0O A;  2RBM A;  3O13 A;  1QG7 A;  4UDU C;  3I8Z A;  2F0T A;  4J1M A;  3OOC A;  3MXP A;  3MAQ A;  2NN6 I;  4BWG B;  1DCZ A;  1RHP A;  3OHX C;  3NE5 B;  1D5X C;  3H0G B;  1ML0 D;  2AWN A;  3VR4 A;  3GTM B;  3A7A B;  1W6K A;  1S5D D;  3D6C A;  1TWC B;  2EYF A;  4QB4 A;  1G8Z D;  5D65 A;  4B9X A;  1CFM A;  3A8I E;  4PQX A;  4H7B A;  1X3Q A;  1B2T A;  1TVX A;  1JWU D;  1R4Q B;  3CU7 A;  3M4Y A;  2XRS D;  1ZKO A;  2F0U A;  4OL7 A;  2TSS A;  1MGS A;  1JOR A;  2L12 A;  3I72 A;  2SNM A;  3K5M A;  4KTA A;  1IYU A;  3QOL A;  5EPL A;  2L1B A;  1PTO D;  3J80 E;  4LMQ D;  4I65 A;  5C3X A;  3VA5 A;  2MPM A;  3BG3 A;  4CKE A;  5I2Y A;  1IHZ A;  4ZAI A;  1DOM A;  2G9H D;  1PTO B;  4EGV A;  3CKI B;  2C5C A;  3SVM A;  4WFN 3;  4A3K B;  5IIF A;  5DNF A;  4E6I A;  1BCP B;  3SK4 A;  4KY7 A;  1I3Q B;  2RQX A;  3IFT A;  4K8J A;  5C6A A;  5ISR A;  2HCI A;  4NP5 A;  4L6T B;  2O5J C;  2NBF A;  3DXJ C;  4CJ0 B;  1JWM D;  3L9A X;  3C1F A;  1ICW A;  1EFI D;  3L3O C;  4K6D A;  4B08 A;  1I6H B;  3OMC A;  1R9T B;  4K6L A;  1OO9 B;  3QB3 A;  4FVM A;  4KY5 A;  5EBC A;  1KLG D;  3DWQ A;  2K5Q A;  3IAY A;  2IWH A;  1XYI A;  4IUQ A;  1Y1V B;  2EYJ A;  1GHK A;  5J39 A;  1D1I A;  1VDZ A;  1STA A;  1SXT A;  5G3L F;  3EVQ A;  4XT1 B;  4XYQ A;  1Y1W B;  4RAU C;  4RGT A;  5JPM C;  3BDO A;  4RH6 A;  1BUV T;  2F0E A;  1YNJ C;  1M4V A;  2K04 A;  1BCP C;  5F2D A;  1JE4 A;  2K28 A;  2EYH A;  4WOR A;  2F1M A;  3P7J A;  3PV0 A;  1B1Z A;  2K5D A;  5K5P A;  3AU7 A;  2A68 C;  5C0X G;  3GTG B;  1WCM B;  1O7L A;  5IGG A;  4N9P A;  5IOC A;  1TII D;  2DN8 A;  5ELB A;  4UAI A;  2B2Y C;  1CQV A;  3GV6 A;  3Q6S A;  1EZ8 A;  1XX8 A;  4JK1 C;  3GTJ B;  2Q8T A;  2A6H C;  3I3C A;  3HRZ C;  1A2U A;  1SBB B;  2NN6 H;  1SYG A;  3FEW X;  1GHJ A;  4KHV A;  2R61 A;  2E2J B;  4HMI A;  1B9M A;  3MXU A;  5JEA H;  4LK1 C;  3NXW A;  4DGZ A;  5D14 A;  3GV3 A;  3C3L A;  2QDB A;  1HHV A;  2VB2 X;  1GUN A;  1NAP A;  4F7X A;  1VCI A;  2RDH A;  2EY1 A;  4FXG C;  1V1P A;  1FNW A;  1H9S B;  1JB3 A;  3CQZ B;  2K01 A;  1H9K A;  1PTO F;  4ME5 A;  2TMP A;  2NWG A;  2B2T C;  4V19 0;  1S4Z A;  4DNR B;  1RTN A;  1R4P B;  3FKI B;  1SNC A;  3RUZ A;  2J4X A;  2SOB A;  4ABN A;  1TS5 A;  1TU2 B;  3BVG A;  4HCE A;  1JR0 D;  1Z7T A;  4WRD A;  3S1R B;  3HOW B;  3LWE A;  3PUY A;  1SMY D;  3J80 L;  2F0H A;  1ZYR C;  1OXS C;  3PUX A;  4FO2 A;  2B2U A;  2KEC A;  5EKK A;  1CM9 A;  4KJN A;  3GTP B;  1FGB D;  3D4D A;  2WKD A;  2L55 A;  5FOB B;  3VA7 A;  3GP7 A;  2JSO A;  4BBR B;  5IGF A;  4X3S A;  3CRK C;  2F0F A;  2EXZ A;  3NQT A;  2R6G A;  2X6G A;  2EZV A;  4ZKB B;  2WAQ B;  4XQQ A;  2X6L A;  1WTW A;  4K2K A;  3DEO A;  5JPN C;  4ZRZ A;  2R93 B;  5A35 A;  1C8C A;  1PRT D;  5C4H A;  5CR3 A;  2PW7 A;  1B4O A;  1Q1B A;  1BBX C;  1SYD A;  1IL8 A;  1DOL A;  1D2B A;  3ERO A;  5IGD A;  5LHY 1;  4KMU C;  1SE2 A;  1LV9 A;  5BN4 A;  1GJX A;  3N6R A;  2IT1 A;  2YU9 B;  5CBA E;  2K32 A;  4C56 C;  2I07 B;  2D2C C;  4K2L A;  4GZY C;  1ENF A;  1AZP A;  2O2L D;  5HGT A;  1ILQ A;  3J81 E;  3EQL C;  1B3A A;  2SNS A;  2RDF A;  1D5Z C;  1PLF A;  5KIX A;  1LT4 D;  3X3M A;  4DAV A;  3E0J A;  1II3 A;  5DM7 3;  3OSO A;  2H4O A;  1LTS D;  3SK8 A;  3OIP A;  4K5V A;  2CW0 C;  4C3J G;  4KK7 A;  4ZUI A;  3KLS X;  4O42 A;  3TZU A;  4QMG A;  2EYM A;  2B2V C;  1J8I A;  1DZ1 A;  2EYO A;  1STB A;  3BDL A;  1F2Y A;  3PO3 B;  4DAY A;  2PZW A;  1EY6 A;  1QWY A;  1WTX A;  2NYZ D;  1WTQ A;  1MD2 D;  3NBI A;  3SDZ A;  1PZJ D;  4RA8 A;  1Z47 A;  2K5W A;  3MHB A;  1OXT A;  3IL8 A;  3KUP A;  3MA2 B;  1O7Z A;  5BN3 A;  2KCN A;  1BF4 A;  5FO7 B;  2JXM B;  4X3T A;  3S1Q B;  3MZ5 A;  4QUF A;  1Q3L A;  2BA1 A;  1TR5 A;  4R9W A;  1V1O A;  1EYD A;  2E76 C;  1DD2 A;  3URY A;  5JJZ A;  4KY6 A;  3OWF A;  3TME A;  3K57 A;  1EEI D;  5EJW A;  2A69 C;  3E6Z X;  3HOV B;  2B63 B;  1GUO A;  2HUG A;  4X3K A;  1D6E C;  4G7O C;  1F2Z A;  1VMP A;  3VR3 A;  4IZ8 A;  2QCP X;  4LAA A;  1SNM A;  4RGM A;  3V96 A;  1B44 D;  5ELE A;  1VMC A;  4KJO A;  2L0C A;  5ELD A;  3M85 A;  4DXG A;  2BDN A;  4PMW A;  4QIW B;  2WKC A;  2CVR A;  1TQO A;  3S17 B;  3H91 A;  4DN4 M;  2WII B;  2EY6 A;  2OT2 A;  4DXF A;  4QF4 A;  1DJR D;  1X32 A;  2IW3 A;  5K36 G;  3EFX D;  1CK1 A;  2BE5 C;  1ILP A;  3VR2 A;  1G6Z A;  4BA1 I;  1C48 A;  5ELC A;  2YYZ A;  3NWT A;  3C2P A;  3K59 A;  2G9D A;  3C1E A;  1PRT F;  1KNA A;  3UI2 A;  3X3N A;  3U9O A;  3E5S A;  4IUR A;  5LL6 S;  5IOD A;  3Q0A A;  4G7Z C;  1CHQ D;  2VNU D;  1U4L A;  2CQA A;  4OIJ A;  3QIA A;  3T56 B;  3ZYY X;  2ICE C;  2ZXR A;  2MGS A;  5KEE A;  1HTL D;  5CV8 A;  1QCB D;  3WOF A;  1TWA B;  4HSV A;  2D9U A;  4H0L C;  2NTT A;  1EYC A;  4N9T A;  5D3D A;  1OXV A;  3T4A C;  3S2H B;  1JIC A;  1S5F D;  5IGC A;  1W6J A;  2M00 A;  4PMB A;  2BOS A;  3MEH A;  3W2D A;  2JE6 I;  1STG A;  3I90 A;  5FK9 C;  2K03 A;  5CV5 A;  3HZX A;  3TP6 A;  2HDL A;  2K6A A;  3OPO A;  4FXK C;  2QEJ C;  2OXP A;  4RKB A;  1U4M A;  3OWE B;  5KYI A;  3NK9 A;  3V2T A;  1QB5 D;  1VF5 C;  3RMH A;  1JC7 A;  5A2Q E;  2FMC A;  1H9R A;  3D4R A;  3M7N A;  4K14 A;  3J81 L;  1HA6 A;  3MC0 B;  3I4M B;  1TWG B;  1BO0 A;  2KA7 A;  5KGU A;  1EY4 A;  1HQR D;  5IGE A;  4IFD G;  3MFG A;  3D3R A;  1JCK B;  4NMZ A;  1HA5 A;  1RD9 D;  2IX1 A;  4RWS C;  1I4R A;  3NQI A;  1EY5 A;  1OXU A;  2D5D A;  5HUR A;  1LTA D;  2L4N A;  1LAB A;  1TS2 A;  1IKM A;  4ID6 A;  3OMG A;  4A3E B;  1YNJ D;  4TRD A;  1DON A;  1BCP D;  4DF7 A;  2BDO A;  2XNA C;  3R2I A;  1HUM A;  1B53 A;  5CV7 A;  2Q8R E;  2A68 D;  4MHE A;  1KDA A;  4IUP A;  1G29 1;  4R8I A;  1JOQ A;  1Y8O B;  4U67 3;  2SEB D;  2KQ3 A;  1AP0 A;  3NTK A;  3OIQ A;  4WJW A;  1QNU A;  1U4P A;  3LWU A;  5C44 B;  1F9S A;  2A6H D;  5NUC A;  5M5Y B;  4KHZ A;  1KAB A;  1HUN A;  3DEP A;  5EGT A;  2HQE A;  1KTK A;  2I46 A;  5FO8 B;  3ONA B;  1CI3 M;  3Q22 A;  1H9M A;  2K1B A;  1EY0 A;  5EKL A;  3GTO B;  2QIL A;  4OO1 G;  1Y8P B;  1KDC A;  4DK0 A;  5C0X J;  5C3E B;  4IFD I;  2XWJ B;  4NKL A;  1E2V A;  2F3W A;  3S16 B;  4RGN A;  2ZT9 C;  2IPK D;  5E4W C;  4PV1 C;  2F0M A;  5CGK A;  1WD0 A;  1Y8N B;  1LTI D;  4XTC S;  1CTM A;  4CGY B;  4H13 C;  1PDQ A;  1ZYR D;  3HP3 A;  4C3I B;  1PFN A;  5M9O A;  2SDF A;  3SEB A;  2IX0 A;  1LO5 D;  4KKT A;  4DAP A;  2WB1 B;  4K8I A;  2IX3 A;  2RVL A;  4XYO A;  5I4D A;  1YNN C;  3ITP A;  4RFB A;  4Q0F A;  1QOH A;  5KNC A;  4YIJ A;  2L5T A;  2B2U C;  1HPC A;  5I9O A;  1WTO A;  3H94 A;  4V0B A;  4MIU A;  2NUC A;  3BS1 A;  2F0K A;  1EQV A;  4ZQ3 A;  4DFA A;  4ZLT F;  3RZD B;  3L7Z C;  1I50 B;  3EJI A;  4OO1 I;  4OHJ A;  1PFM A;  3S15 B;  1UUP A;  1AEX A;  3RLF A;  3HOX B;  5A2Q L;  5I6W A;  2PZT A;  1STN A;  3T16 A;  2XN9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...