2F0FA

Crystal structure of staphylococcal nuclease mutant l25i
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0fA00
4K2KA 3DMUA 4DFAA 4EQOA 1EYCA 1EQVA 1EYDA 1KDCA 3OMCA 2SOBA 4K6DA 4N9PA 5CV5A 4PNYA 1U9RA 1EYAA 5J39A 3MXPA 5EKLA 2PZUA 1KDBA 2EYJA 1II3A 4RKBA 2EY1A 2F0HA 2QDBA 4MIUA 2OF1A 2EYMA 2RBMA 3QOJA 2KQ3A 4KJNA 3OMGA 4KJOA 1TQOA 2F0GA 3DHQA 1EY6A 4K5VA 4K8JA 2OEOA 3NHHA 4YIJA 2EYHA 3RUZA 4LAAA 5C6AA 5IIFA 5C5LA 2LKVA 3P1HA 3V2TA 2EY5A 1STBA 4IZ8A 1A2TA 2F0OA 1NUCA 2F0UA 2EXZA 3NK9A 1EY9A 5DAUA 2F0FA 1A2UA 1SNQA 3TMEA 1IHZA 4G57A 3BDLA 4K8IA 5IGFA 1TT2A 3QB3A 3D4DA 5CV4A 4I65A 3VA5A 2EYPA 4IALA 2SNSA 3HEJA 5CR3A 2OXPA 4ID6A 1A3UA 3T13A 3E5SA 3SR1A 1ENCA 5HURA 3SXHA 2F0IA 2EY6A 1JORA 4HMJA 4ODGA 1ENAA 5IGBA 5KYIA 5KYLA 1A3TA 5IOCA 1EZ8A 1STHA 2F0QA 5HGTA 1JOOA 3OWFA 5IGEA 2F3WA 2SNMA 5IODA 5KEEA 1EY0A 5KGUA 1SNDA 1A3VA 1STAA 3C1FA 3NP8A 4J6HA 4ZQ3A 5ISRA 4K5WA 2F0PA 2F3VA 4R8NA 3TP8A 5NUCA 2RDFA 4S3SA 2M00A 2PZWA 4DU9A 5JAVA 4HTHA 2F0MA 3D6CA 3MZ5A 4QF4A 4QB4A 4KTAA 2KHSA 1EZ6A 5J1ZA 1SNMA 3U9OA 3T16A 3NXWA 2EYOA 5CV6A 2F0NA 4OL7A 5CV9A 3SK4A 4B9WA 1EY8A 2F0JA 4WRDA 2F0LA 3SK6A 5CV7A 1SYGA 4KHVA 5C4HA 3OSOA 4K14A 3HZXA 3SK5A 5C3WA 3MVVA 5I9OA 5CV8A 1SYFA 2F0TA 4N9TA 5KIXA 1SYCA 4KY7A 1KABA 4ZUJA 3EVQA 4J1MA 5C4ZA 3EROA 3MEHA 4NMZA 5IGDA 2O4XA 4E6IA 2PQEA 5C3XA 2F0WA 1STGA 4ME5A 2PYKA 3ITPA 1TR5A 1NSNS 5E1FA 5I6WA 4F7XA 2EYLA 2F0DA 1STNA 2PW7A 1KDAA 1STYA 1SNOA 2F0SA 1JOKA 4ZUIA 1EY5A 2EY2A 3D4WA 3NUCA 5EKKA 1SNPA 4RKLA 5I6YA 5IGCA 1EY7A 1SNCA 2HQEA 4TRDA 2F0EA 1F2MA 5KRUA 3EJIA 3QOLA 4K5XA 3C1EA 3LX0A 4PMBA 2EYFA 5EGTA 3NQTA 3SK8A 3SHLA 2WACA 1AEXA 3P75A 1EY4A 3ERQA 3TP7A 3H6MA 2F0VA 5DEHA 1SYDA 2PZTA 4EQNA 3MHBA 4B9XA 5CGKA 1SYBA 3BDCA 4KY6A 5I9PA 2F0KA 4HMIA 4IUNA 2RKSA 5C5MA 5IGGA 5J22A 2NUCA 1SYEA 3S9WA 3R3OA 5K5PA 3TP6A 4DGZA 4QMGA 4KD4A 4KY5A 4WORA 4NDXA 4NKLA 5F2DA 4EQPA 4H7BA 4F8MA 3TP5A 5CC4A 1KAAA 2ENBA 4PMCA 4EVOA 4DF7A 1F2YA 3PMFA 5E3FA 1JOQA 5JOBA 1F2ZA 2PW5A 4K2LA 5M9OA 4KV6A 3D8GA 1RKNA 4KD3A 4NP5A
chains in the Genus database with same CATH superfamily
4HR7B 1NMGA 2E74C 2F3IA 3ULJA 4DV0Q 5J39A 3VR2A 4MIUA 1HZAA 3QOJA 4EQ5A 2JA5H 2N8NA 1L1OA 4HIMA 4B08A 1H9MA 3IL8A 4NPSA 4KHZA 1AE2A 2UUBL 3GTJH 5IIFA 1MSGA 2K04A 5K36G 1HRJA 3NWTA 1F77A 1RF2D 1PRTF 2JP1A 3WOEA 3HOWH 2JA5B 3P7JA 4DR6Q 3GTJB 2B2UC 4YY3L 1S3OA 1HNWQ 1B4OA 2CW0D 3SXHA 3NTIA 1Q12A 3HOWB 1WCMG 5IOCA 4X62Q 4DN4M 2I5HA 1JOOA 3T4AC 2RCNA 1SMYC 1SNDA 5I2XA 4DA2A 1DONA 2A8VA 1BBUA 2ZJRA 4GN5A 2PZWA 1JC7A 1LTGD 4GN3B 4LF5L 2ATWA 1IYVA 1IKMA 4HJ9A 1EWHA 2V4DA 4B9WA 2BDOA 2F4IA 3MXGA 5M3FH 4LUOA 3D4RA 4YY3Q 4DUYL 4A3BH 4GOPC 1SYFA 2UU9Q 1EU4A 1R9TH 3EROA 3CPWA 1WTQA 1YITA 3GTOH 4C3IH 2AUJD 3EBEA 4A3BB 1WTVA 2AKWB 2VB2X 5IP7H 1GOZA 5ELFA 3DEOA 1SEBD 1Y1WH 1QNKA 3KLRA 1R9TB 1HNZQ 2MFIA 3CC2A 2PPBC 3R93A 3BVMA 2D0OA 3J80c 2RVLA 3K0XA 4DR3L 1W3SA 1EOTA 2CCZA 2UUAL 3GTOB 4O2DA 2K5HA 1HUNA 1D1KA 3GTGH 1ZKOA 3ONAB 1DCZA 5JJKA 1Y1WB 1SBBB 1HR0W 4IJHA 4OGQC 4DGZA 1JB7A 4B3TQ 1IL2A 1X3EA 5JVH3 1SMXA 3S1QB 3GTGB 2WB1G 1PZID 4X64Q 3NWSA 4JI8L 4DR1Q 2PCFB 1IZ6A 5CV5A 3OYYA 5ELBA 3GV3A 4LF7Q 4C56C 4YHHQ 3GDEA 3MXNA 2SEBD 3VYTA 1CM9A 3CCSA 2B2YA 3RLOA 3I70A 3T56B 4F88A 4DR4Q 3Q8DA 2PO4A 2CWPA 4LF9Q 1VQDA 1JCKB 2DY8A 4H13C 4A3EH 3D4DA 4XT3B 3A7LA 3MXUA 2JN4A 3CKIB 1SE8A 1SROA 2BDNA 1V9PA 5IWAQ 3H0GH 1JORA 1K8GA 4L6TB 4A3EB 2WP8J 1PH5A 5GQOA 2MHVA 2SNMA 1HFNA 1W6KA 5KGUA 2MQHA 2A69D 1LO5D 2F0PA 3GO5A 4DU9A 2N78A 2M00A 4A3DH 1BNZA 3H0GB 1YVCA 4IPCA 4KK7A 1EL0A 2BE5C 2NTSA 3WWVA 2EYOA 1J6QA 1C48A 1B3QA 2QA4A 4V0BA 3D31A 5A35A 2L12A 3IAYA 3HOXH 2H5XA 1V43A 1K3RA 2B2VC 5C3WA 2K6AA 4QQBX 1TWAH 3CQZH 2Q8IB 1S40A 3CCQA 1HCZA 1ASZA 1GJXA 5C3XA 1TS2A 4Z9CB 5EAYA 1N33Q 3ITPA 1VQEA 2KCTA 2Z6BA 3PV0A 4ZLTF 5I6WA 1QVGA 2PW7A 3HOXB 3JC66 1BBXC 1ZEQX 1I4HA 2EY2A 3D4WA 4DV2Q 4RKLA 1SNCA 3ERSX 1PZJD 4X3TA 5KRUA 4JI4L 4JI6Q 1U4RA 3S24A 2L4NA 4IUVA 2WACA 2Z6KC 2E5LL 5DEHA 1SYDA 1HQMC 4DV1L 2ZM6Q 3MHBA 5CGKA 1JWMD 2MO0A 4A93H 4KY6A 3A74A 2A5HA 4HMIA 2K01A 4KKTA 3V05A 4NW2A 3TP6A 1C7YA 5CC4A 4HJAA 1PFNA 2PI2E 5IP9H 1WTRA 2E2DC 2Z8LA 3S16H 4A93B 4Y7NH 2PW5A 1OXSC 1IBLL 1WFQA 3PQIA 2MGSA 2IPKD 4EQOA 1KDCA 1H9RA 1O7YA 5BR8L 4UPAA 4DPGA 4DR7L 5CYUA 2N88A 3S16B 1CK1A 2EY1A 4Y7NB 3H91A 4L5TA 2LY7A 5I2YA 2FFKB 2QEJC 2JA7H 4EX5A 1U4LA 2F0GA 5D65A 5DLQE 4AQYQ 3I91A 1M1KC 4LNQA 1VQBA 1MIUA 1XTDA 1QUQA 2R92G 4LWCA 1PXUA 4IUTA 3TRZA 1PDQA 1WI5A 2KOLA 1PTOD 1A2TA 2QW7A 2EXZA 3QG1A 5DAUA 1DOLA 3I8ZA 2NVQH 4LFCL 2JA7B 1IBLQ 4GLAC 4GOPB 1KLUD 3BDOA 4LUZA 1WTPA 3N52A 4JBMA 4OO1I 2L55A 3VYUA 4DNRB 2AUKA 1H95A 5EBDA 4OO1H 2NVQB 5IGBA 3NEMA 4RHSA 3M7NA 5FLMH 4H0LC 3GTQH 4JOIC 3NP8A 4FP5D 3J81i 4DV3Q 3I4NH 1XXGA 1W6JA 2XVSA 4HTHA 1MKHA 3BG3A 1L0WA 4JI2Q 1D5XC 5BN5A 5C0XI 5M5WH 4DAVA 4C3HH 2YTXA 1BUVT 1PMRA 1SYGA 4KKUA 4MN3A 3I4NB 5C0XH 2KEDA 3DXJC 3AYHB 1DGSA 3HRZC 3VYSA 2D5DA 3CRLC 4B3SL 2F0TA 4KY7A 4UAIA 2EJGC 3OHXC 4H44C 5M5WB 4C3HB 1STGA 2EYLA 2FMCA 5EPJA 1BQQT 1DYQA 3PO3G 3I4LA 1FNWA 1PRTD 4X65L 4KI0A 2RDGA 3X3MA 1WD1A 1OXUA 4AYBG 4L63B 1GHKA 2O5JC 4HSPA 3NQTA 3VR3A 2UXDQ 1JQYD 1KNEA 3H3VC 1HR0Q 1IYUA 3CD6A 4O0AA 5J22A 1EEID 4B3SQ 1SYEA 3H94A 3ND9A 3NTKA 4QL5A 3W2DA 4H7BA 3NBHB 3TP5A 4OXPA 2K32A 1Q1BA 4JVZA 1IBKQ 3EIVA 2VUMG 3TZDA 2YU9B 2CH4A 4KV6A 2JA6H 4HCEA 4Y52H 2GA4B 4LF6Q 1IW7D 3T1HL 3GP7A 1EYDA 3BVZA 1FYCA 1CHPD 1KC8C 1RCVD 2JA6B 1AP0A 4A4IA 1VQPA 2XRSD 2Z4HA 1NBWA 3PF4A 4N8FA 2ICEC 3CRKC 2OWOA 4UP8A 5C4XH 4XDXA 2PMZB 3G6JB 4BY7H 3PCOB 1U4MA 2F0FA 1XMOQ 2KENA 5DNFA 4JI5L 2XGTA 2EYPA 3HEJA 4OWWB 4BY7B 1MHWC 1PTOH 2CKZB 4LW1A 4BWGB 3TQYA 1A3TA 1PA6A 4A3LH 2B2UA 2Z4IA 3D0FA 3KLSX 1ZXTA 2KJXA 4CKCA 3QR8A 4JI7L 3SGIA 4A3MG 4M1UB 1F9SA 4QF4A 3U50C 4UP9A 5J1ZA 1Y8PB 1XNQL 3J7AV 1X6OA 4LF8Q 1IL8A 4AH6A 3I55A 3KDFA 1CSQA 1X54A 5KIXA 4OIJA 4DUZL 1P16A 1AN8A 1V1PB 1Q90A 3BS1A 4JV5L 1PZKD 2B2WC 2NZ1D 5JEAH 4L5RC 2HQEA 1AW7A 2F0EA 2QCPX 2TSSA 2VW9A 3R2IA 2JA5G 2FINB 5EGTA 1XNQQ 1FNUA 4IN3A 1R4QB 3H6MA 1JJGA 2JA8H 5I9PA 2IJ0A 1I4PA 1PH1A 1N36L 1C4QA 1CZWA 4GN4B 1KLGD 1MBYA 4DNTB 4F8MA 4BBSB 4RGNA 3CW2C 1OXTA 3JAML 2JA8B 1VQFA 5M3MH 2K52A 2IL8A 1PH8A 4POGA 4QIWE 3MFYA 1TWGH 1G6ZA 1EYCA 1O7LA 4NXML 1GKHA 2WV6D 2E2IH 1FJGQ 4KN4C 4CGYB 1CKNB 1Q1EA 3TREA 3RNUA 3HKSA 3C3LA 4IFDI 2F0HA 1A6XA 2B63B 3S1NH 4IFDH 4LF4Q 1TWGB 1I3QH 3NQIA 1VQNA 2E2IB 1B70B 1BCPB 1NR2A 1RJTA 5C5LA 2KCCA 3M7GA 1JWSD 4ZK9B 3S1NB 4A3BG 1VQ6A 4L5SA 1ICFB 2DGYA 3I4MH 1MJEA 1QILA 2QF7A 4IALA 1ONLA 4ID6A 3SDZA 5IYCH 3SR1A 4PZ7A 1XNRQ 1VQLA 3A0JA 1HPCA 4BXXG 3I4MB 1Y1WG 1UUPA 1PYWD 2Q8RE 3OWFA 1TIID 1VQKA 3ZYYX 3H15A 1EY0A 2A6EC 2RDHA 1STAA 3FKIH 2LSSA 3E9IA 1EIGA 1MI2A 4IUPA 1EZ6A 2CFMA 3AB9A 5EQ0A 2F0NA 3VDYA 1YNNC 3FKIB 4G7ZC 3OSOA 5CMDA 3PO2H 4HIOA 1D8LA 4B3RL 1GD7A 3K7UC 5E7NA 2ZJPA 2WKDA 3KJOA 1F9QA 3M85A 3GV6A 5GROA 5E1FA 1TR5A 4GKJQ 2B2VA 2L5TA 3S2DH 1WTHA 4RH6A 3PUYA 1K73C 5GAHC 2ZTDA 1HNXQ 3R2TA 5I6YA 4ULLA 2R3ZA 4QUCA 3K6OA 4GNXB 2MPMA 3S2DB 2B8FA 1CA6A 2MUYA 2NN6H 4HJ7A 1TY0A 1CTMA 3A5UA 4JYAQ 4G7OC 4X3KA 2E76C 4Q0FA 1FVIA 2XN9C 2VQEQ 4JCVE 5C3EH 3G6EA 2NUCA 1BXTA 3R3OA 1C9OA 3HOYH 2Z6KA 5F2DA 1E2ZA 4MHEA 4A3EG 2AQ2B 2JXMB 1NY4A 4P73A 3AFQA 2UUCL 2HIVA 1YJ9A 1E2WA 2ZT9C 4A3KH 4FXDA 5A2QL 1VQIA 3HOYB 2J7ZA 3ULPA 3HOUH 1U9RA 2D9UA 3K58A 1XPRA 3A8IE 5EPKA 1T9HA 3TDQA 4CDDC 4KJOA 1GVPA 1G6PA 5LL6S 4JK1C 1CUKA 2CW0C 3HOUB 3U58A 4A3IH 4R4QA 5ELDA 2NVTH 3P1HA 3V2TA 3HOXG 3FDTA 2K28A 3K8AA 1CFMA 5IT9c 3A55A 1KD1C 1N32Q 4KLKA 2UXCQ 3VR5A 2K5DA 1G8ZD 5AFWA 2HDLA 2NVTB 2IX3A 1VQJA 2PQAA 4IUUA 3GTKH 1OXXK 5IYBH 3A56A 1ENCA 4LFBQ 2EY6A 3NBIA 3KK7A 3K57A 4NXNQ 4B3MQ 2JQOA 3PIPA 1Q46A 4HJ8A 1G2SA 3GTKB 2F3VA 5NUCA 1HQRD 1K0RA 1BO0A 1S4ZA 1Q82C 1LTSD 3CC4A 1LT3D 2N55A 1UAPA 4TQUS 2Y0SE 4K14A 1XYIA 3IFDA 2NTTA 1N8RC 1NAPA 1O7IA 1X65A 2PI2A 1TS4A 2NVYH 4LJZC 1YI2A 1HA5A 4G7HC 2CQOA 2I07B 3TSSA 1SR3A 2UUBQ 3BVGA 2GVAA 4DR2L 2ES2A 1YNJD 1IYJB 4A3JH 3TZUA 3UDIA 3HKZE 2JA7G 4JI1L 2KHIA 4DAYB 1HTPA 4TSSA 1S72A 1H9SA 2M9VA 3K59A 1DJRD 2I5MX 1RD9D 2UXBL 3OPOA 4QMGA 1SRUA 1CQFA 5I4DA 5M3FB 5IYDG 1ILQA 3PGZA 4K2LA 1YJNA 4KD3A 4ME3A 4K2KA 3S14H 4HN7A 1AZQA 4LF5Q 4I7ZC 4AIMA 3LNNA 3URYA 4C3IB 1MGSA 1II3A 3I4NG 3GQBA 5IE8A 4DUYQ 1JMCA 3S14B 2L1BA 3I7FA 2KHJA 5J3BA 3OMGA 1Y1VG 2OQ0A 3W1GA 2PMZE 4CJ0B 2XIWA 1JT8A 5JJLA 3S15H 1PV4A 4BY1H 3PIP3 1LTTD 3NTHA 4ZYSA 4IO9A 2DNEA 1PHJA 2Q2UA 3J7AF 4K8IA 3CCJA 5C0XJ 4QIWB 4I65A 1ASYA 1V8QA 2EDGA 4R9WA 1EFWA 4ILWA 1SN8A 4DR3Q 2F03A 1A3UA 1SJHD 2AHOB 2UUAQ 1SMYD 3HOVH 2YTYA 2YTVA 4BY1B 5FLXL 2FJ2A 3L3OC 1DM0B 1XTCD 1JR0D 1STHA 2J4XA 1B50A 5LMUL 1I6VC 4FF3A 3NXWA 2G9HD 4JI8Q 4CKBA 2RSNA 1AZPA 1HH2P 3MTSA 3FRPB 1TU2B 1S5BD 1QZHA 2X6GA 3HZXA 5AJ3L 2F52A 1I4QA 4L8JA 1IBML 1IKLA 3TS2A 4J1MA 3NENA 1EYGA 2JA6G 1G291 3E6ZX 2K1BA 5LMNL 3UI2A 3W3AA 1B9NA 3CXCA 1E1OA 4C1NI 1BDOA 4DR5L 1DZ1A 2EYFA 4JC0A 3SHLA 3RD4A 4JBKA 4QJFA 3TP7A 2B2WA 4KKSA 1PYBA 4A3CG 1KRSA 5LL6X 4A3DB 3RMHA 4H02A 2HCIA 2F0KA 4BY7G 3UDGA 1LTBD 1VQHA 2YV5A 2TMPA 2ENBA 2WINB 3ULLA 1JOQA 1QB5D 1SJED 3BZCA 1XPOA 1TWAB 2RHSB 3CQZB 5FKAC 4A3LG 3J81j 4F87A 1UEBA 3MXPA 2PZUA 2EYJA 1TXYA 2ICIA 1SSOA 1J5EL 2AQ1B 1MJCA 2AMCB 3J81L 3OTOL 5C6AA 2OEOA 4YIJA 2K75A 2Z0SA 2CH4W 1STBA 2F0OA 1RIPA 1A15A 3DWQA 4YWLA 4G57A 4JI4Q 3GTMH 3HOZG 1KNAA 4OEMB 2Z1CA 3PIOA 2HHHL 5K36H 3T53B 3Q23A 3JAMc 1PYSB 2E5LQ 4DV1Q 2RQXA 2NYZD 5JEAG 1J5EQ 3KF6B 3IFTA 2NB0A 2BE5D 2OTLA 3C1FA 1FGUA 5JEAJ 1CA5A 4BBSG 1JB3A 3K5OA 2BCOA 1O80A 3R8BA 1WCMH 1U5KA 4KTAA 3J7YW 2JA8G 1I94L 1EY8A 3JAMi 4BA1I 1S5FD 1ESFA 4CJ1B 2C35B 4FDBA 2K14A 5BR8Q 4DR7Q 1WCMB 1NE3A 3VYRA 4V190 1XPUA 5LHY1 2B63G 3K5NA 2CVRA 1J8IA 2PQEA 5JVG3 2F0WA 3QJYA 3S2HH 1KDAA 1JOKA 1QNUA 1STEA 2IX0A 2A68C 1SNPA 1VQ4A 1GUNA 1BCPC 2B8GA 3SEBA 2N49A 3C1EA 4LFCQ 3GTQB 3S2HB 3GTLH 2PZTA 2EQSA 1IW7C 1FD7D 4IFDJ 2G9DA 2Y0SB 3I72A 4X3UA 3I4MG 2BA1A 2VQFL 1GUOA 2ASBA 3GTLB 4DF7A 2R7DA 3F8TA 4X3SA 3QWNA 5KNDA 1EQTA 2OCEA 3UDFA 1VF7A 1LYLA 3HKZB 1M8AA 2QDBA 3FKIG 1W2BA 3L9AX 3EA6A 1BKBA 4JBJA 3PIO3 4A3FG 2FXQA 2N3SA 2DNCA 3J80L 4G4KA 4RCNA 3W1BA 2WB1B 2BH2A 4IOAA 2VQFQ 3KLWA 4PQXA 1U4PA 4MNOA 1JWUD 3HGBA 1NUCA 1EY9A 4DNIA 1SNQA 1ESRA 4X65Q 5IT9E 3TMEA 2EJMA 1DD2A 4FF1A 2H1EA 5CV4A 1QZGA 2KEEA 4DK3C 1K8MA 5ELEA 2SNSA 1ENFA 3E5SA 3DM3A 4GNXC 4R4TA 4HMJA 1A62A 2JSOA 1K9MC 1T5XD 3CPFA 1A8VA 1VQCA 3DWPA 5T1IA 2KCMA 2F3WA 3RLFA 1VMCA 2RDFA 2NN6G 4XQJA 3OIQA 1K28A 1FNVA 1HZ9A 1M4VA 3IKJA 3T16A 4OWXB 2E2JH 3MFGA 3RN2A 1Q8IA 3T1HQ 1YHAA 2D62A 1D7QA 5C4XB 4DV6L 3TEHB 5CV8A 4PMWA 4P74A 5FO9B 5TSSA 4DV5L 1LTID 2PNHA 2E2JB 5EKIA 1Q81C 1JE4A 2QGQA 1NSNS 1HZCA 4ZUIA 4BBRG 4JI3L 2Q2HA 1QVFA 4UHVA 1PTOB 2KECA 1F2MA 4GLXA 1B1ZA 1ZYRC 4O1NA 1WVLA 3I90A 4PZ6A 4JI5Q 1FL0A 4GKKL 1WJJA 1XMQL 1G51A 1EU3A 2L0CA 4DV4L 3L0OA 3W5OA 4YCVA 3S9WA 3CMEA 5K5PA 4RG1A 1A0IA 3VA7A 3Q22A 4KY5A 1EWCA 4IOCA 2IW3A 3FPPA 4FYDA 1KL9A 1QVCA 4IQZA 4DV7L 1KXLA 1CSPA 4GOPA 1UWVA 1F2YA 3BYYB 4DXGA 4JI7Q 3BZDB 1LUZA 1VQAA 3X3NA 1BBWA 1HTLD 1RODA 4ABNA 3L7ZC 3KF8B 1NNXA 4R8IA 2RBMA 1XMQQ 5JPMC 2K5NA 1C0AA 1I4RA 1EY6A 4DUZQ 3HOWG 2JK8A 2LFNA 5EBCA 1E24A 4CHTB 4JV5Q 4HJ5A 1PRTB 4KHPL 1O78A 2NZOA 4LUVA 3EQLC 4GZYC 4WJWA 1TT2A 5IGFA 4LFAL 1VCIA 1WYDA 2RHQB 3ND8A 2OXPA 2WAQE 4GLVB 4Q5VA 5M3MB 1HJPA 1X3PA 1ENAA 4FXGC 2KCNA 3MC0B 4DAMA 1BVSA 1N36Q 2F0QA 1HHVA 2K03A 3A5ZB 1Z6HA 1D1IA 2B3GA 1A3VA 5CBAE 1EIFA 4UY8C 2ZJQA 5M3FG 2A6HC 1L1OB 2ZXRA 2K4KA 2B29A 3SK4A 3STBC 2F0JA 2JYOA 1I3QB 2OT2A 4LFAQ 4P75A 1SFOH 2XRQD 4C1NK 4NXMQ 3I2ZA 3NBHA 4C3IG 3F1ZA 5IP7G 3EVQA 4JI0L 1X9NA 1CHQD 1SFOB 2F0DA 1STNA 3I4OA 4EGVA 3PF5A 2LXJA 1VF5C 4RGOS 2DJGC 3KUPA 1EY7A 2H4OA 1VQMA 1K0SA 3IRBA 2GVBA 3PO3H 1AEXA 3NPPA 2F0VA 3L2PA 5GAGC 3H3VI 4XT1B 4ZRZA 1E7ZA 1EQQA 3H3VH 4DK1A 3F2CA 1QJOA 2CHBD 3K80C 3C2PA 4BY1G 3PO3B 1TS3A 5D3IB 3UE1A 1RTNA 4X6AH 3AQQA 3PO2B 5JOBA 4CDCC 1VQ8A 3DMUA 3MEFA 1S5ED 3F2UA 4LK1C 4K6DA 4YWKA 4JG2A 4I7AA 3K7AH 3OIPA 5EKLA 1G2TA 2DN8A 2O2LD 2Z9HA 4HSVA 3CU7A 4WFN3 4B3RQ 4LMQD 4DK0A 1F2LA 3U4VA 2ALYB 3K7AB 1YBYA 3NHHA 4MTNA 4LAAA 5E4XA 2EY5A 3A8KE 5LMNW 4L5QA 2F0UA 4C2MH 3KBGA 2O5IC 4FVMA 5C3EB 3AU7A 3H0GG 1CI3M 2HIXA 3CCUA 1L0XB 1SXTA 1E22A 1FR3A 5CR3A 4R4CA 1V1PA 1X56A 1YHBA 5GADC 3JAME 2A6ED 4C2MB 1AE3A 4ODGA 2AQ3B 1O7ZA 4ZKBB 4A3DG 1ET6A 2RCFA 4A3KB 2K5VA 4K0KL 2VXWA 2KUMA 2B2TC 3BU2A 3CP0A 3MXNB 3DUZA 1OTCA 4IURA 1KRTA 3MAQA 4IUQA 1P8LA 5HGQA 2JE6I 2F1MA 5JAVA 1D2BA 2F0MA 4XIGS 1PTOF 2UUCQ 1GUSA 2B39A 1LABA 2M2LA 4DV0L 2F4VL 3GD7A 1Q7YC 4A3MH 4JW0A 4A3IB 2XSCA 1K83H 3B6YA 3FVQA 4DK6C 1TY2A 3Q24A 3UE0A 5I9OA 2IX1A 1SYCA 1KABA 1HUMA 1X3GA 2K5QA 2O4XA 1UE7A 3ICEA 1XX8A 4ME5A 5C44H 1K83B 4DAPA 2IWHA 3NUCA 4WJ4A 2VS1A 1N34L 1CKNA 1QE6A 3KLSA 3QOLA 4A93G 4DR6L 5C44B 2R6GA 4JOIA 2F4VQ 1EFID 1EY4A 1HNWL 3N6RA 1NMFA 3E0EA 5IP9G 3HG9A 3BDCA 3BJUA 3M4QA 3HFZB 1UE5A 4X62L 5CORA 2RKSA 5C5MA 3P20A 5IY0A 3CHBD 1PH3A 4WORA 1ET9A 4NKLA 3EFXD 4EVOA 3CMAA 4P71A 3WOFA 3KBXA 1YZ6A 5L37A 2ZXOA 1TWHH 1U0LA 2EXDA 1N34Q 2NVYB 4C3JH 4FF2A 3FEWX 1H9KA 3A8JE 4FO2A 1EYAA 4OIKA 1NJIC 2OTJA 4BS9A 2UU9L 1BOSA 2K05A 2EYMA 1TWHB 1PFSA 4A3JB 1Q3LA 4C3JB 3SVMA 2WB1E 4UP7A 3OW7A 4K5VA 1KQSA 3M9BA 3Q6SA 4CBVA 1K8AC 3RUZA 2LKVA 1BCPF 3UDXA 3I3CA 3U4ZA 1ILPA 1HNZL 4PZ8A 3CCLA 1TWCH 4DR2Q 2FHTA 3RN5A 4OO1G 3BDLA 5FO8B 2EE1A 3VA5A 1MSHA 4JI1Q 5FLMG 2VB3X 5HURA 1Y69U 1Q86C 1DOMA 1TWCB 3NE5B 4B3TL 5A2QE 3M4OH 1WOCA 2Y0SG 5KYLA 2MO1A 2IHEA 2UXBQ 2VY3A 5HGTA 3K5LA 5IGEA 4GNXA 1D5ZC 1NR4A 4K5WA 4C3HG 5JJZA 1LTLA 1EOVA 4X64L 1LACA 1LT5D 2QDLA 4BXXH 3MZ5A 5C0XG 1WTOA 4DR1L 3M4OB 1C8CA 1QUQB 4K6LA 4X66L 2ZXPA 5CV9A 3AMUA 2A69C 4CJ2C 2IHFA 4LF7L 1GM5A 3S1QH 1S5DD 5BN3A 4YHHL 3PUZA 1IXRA 3HKZG 3PUXA 1SE2A 2WAQB 4N9TA 4DR4L 3S15B 3MEHA 4APVA 1KTKA 1LT4D 3SE0A 1UEAB 5M5XH 1R4PB 2JEBI 3G4SA 1STYA 1MD2D 4LF9L 3HOVB 2I46A 3AFPA 3F2BA 2R7ZH 3J80i 5IGCA 4RGTA 4CKEA 2E75C 3EJIA 3D6WA 4X66Q 5M5XB 5EJWA 3SK8A 2NVXH 3BZKA 2CWAA 5IWAL 4B9XA 2R7ZB 1QG7A 3CCRA 2K5WA 5IGGA 3M4YA 2C5CA 3E0JA 2HCCA 3RZOH 1AFPA 2NVXB 2CQAA 1EIYB 3T1YL 4IJLA 3OWEB 2IT1A 2KBNA 5E3FA 5FJ8H 5H1SE 5M9OA 5LMUQ 1UE6A 1EWIA 2EPBA 4TKOB 3RZOB 4R1JA 1VMPA 2KVMA 1KDBA 5JPNC 2R7FA 4POFA 5AJ3Q 2Q2IA 2XWBB 5C4XG 1XWEA 4KJNA 1N33L 1B9MA 3DHQA 1IBMQ 2R93H 1I5FA 4XYOA 4DV2L 5LMNQ 3T51B 3T1YQ 4NB3A 3EN2A 4JI6L 4MTKA 2X6LA 3NK9A 3K5MA 4HCSA 1EQRA 1A2UA 4OX9L 3S1RH 3OW2A 4A3GH 1IHZA 1K8OA 3QB3A 2R93B 3VR4A 4DR5Q 1BR9A 2ZM6L 1PTOC 1H9JA 5C4JH 1UNSA 4O42A 1B7YB 1K3BC 1PFBA 3J7ZC 2VNUD 3S1RB 4A3GB 4CDEC 1EZ8A 2QILA 1V1QA 5ISRA 5C4JB 4J6HA 4XTCS 3S17H 3I73A 4DAYA 1EIHA 2R61A 2EOTA 2JJQA 4OX9Q 1AH9A 1LLRD 2VZAA 3SK6A 5CV7A 3FP9A 5C4HA 1JE5A 2DY7A 2NZHA 3S17B 4ZKCB 3SK5A 1S5CD 3MVVA 2WIIB 1VQOA 1A63A 2V1CC 3FHWA 4HIKA 5IT9L 1PH4A 4AQYL 5IGDA 3KFUA 1SDFA 2NWGA 2XWJB 2ZTCA 2OQKA 3GTMB 1LM0A 3OTOQ 1CKOA 2RF4A 1EY5A 4GS3A 2QEXA 4FF4A 1OO9B 1TVXA 4A75A 5EKKA 5FLXE 1Y8NB 1PRTC 3P75A 3ERQA 4RHRA 2HHHQ 3J7A5 3KYHC 2MJ8A 4OHJA 5BN4A 5M3MG 5CBEE 2I0QA 5ELOA 3E3XA 2RA4A 3KDFB 1L0YB 4EQPA 4DV3L 1PH6A 4HIDA 3LGJA 4AYBE 1RL2A 4PMCA 5HY6A 4JI2L 2EZVA 3OOCA 1JJCB 1RKNA 4DFAA 5G3LF 4KN7C 4RCOA 5IYDH 3OMCA 4IFDG 1L1OC 1I94Q 4IPDA 3K0YA 3ER0A 1VQ9A 3HS0C 1LV9A 4ZCKA 4RKBA 3HP3A 1XJVA 4CDFC 2KQ3A 2HD3A 5KNCA 1B3AA 5KNBA 4K8JA 1SAPA 1D6EC 5EPLA 1YJWA 1Y1VH 5IYCG 4XQNA 2UXDL 4RFBA 1HR0L 1GHJA 3CCMA 4OWTB 3T13A 3G71A 2F0IA 1Y1VB 2QKIC 1PH7A 1Q8KA 2EVBA 2ID0A 5FK9C 2DUDA 4TVAB 3KJPA 3M4PA 1IBKL 4N8X1 4RA8A 4YCUA 3PUWA 4S3SA 2WKCA 3O13A 1SE3A 4LF6L 3D6CA 1SLJA 1WTXA 1BF4A 1DOKA 3PO2G 1SNMA 3RLNA 3U9OA 3U9SA 1G91A 5CV6A 4OL7A 2B2TA 3J81E 3CCEA 4WRDA 1PH9A 1DXMA 1EEFD 1TKWB 1ICWA 2DJFC 4KHVA 2YU9H 2KA7A 1I4XA 4RGMA 2MP1A 2A68D 5C4ZA 1CKMA 1GUGA 4E6IA 2PYKA 1BCPD 2LS01 1WD0A 2L9HA 2A19A 4RWSC 2EJFC 2F0SA 2LXKA 3A7AB 4XQQA 4IPGA 2PNRC 1PVOA 2D2CC 1XMOL 1Y8OB 3AEVA 1HZBA 3LX0A 2A1AA 2K33A 5C3EG 2HDMA 1I50H 1X55A 2L11A 2ZTEA 4J8QA 3HOYG 1B53A 1VQ5A 1OXVA 3S1MH 5E4WC 1HFGA 2G5DA 4IUNA 3G7LA 4J15A 4A3CH 4A3KG 4NDXA 1I50B 1B44D 1GXDC 1I4GA 4R4OA 4OELB 3PMFA 3S1MB 3HOUG 3FPUB 1PH2A 1X32A 4P2CB 2K7VA 4LF8L 2LMCB 2B2YC 4HEDA 2BOSA 2Q8TA 3KF6A 1YEZA 2BH8A 4PNYA 4KMUC 2GN5A 2JA9A 4A3IG 2JEAI 2C9OA 1E2VA 4UDUC 4DV6Q 1CZGA 3K81C 1TQOA 2X69A 4DV5Q 1JICA 3DWAA 3LWEA 1F9RA 1YIJA 5ELNA 4HAEA 1Z9FA 1LTRD 3MA2B 4JI3Q 3CF5A 5IYBG 5FOBB 3C46A 4RAUC 5C44G 2XTIA 3GTPH 3E9HA 4BA2I 3HOZH 1Z47A 4GKKQ 2P5ZX 1PFMA 1VQGA 2WFWA 4DV4Q 4QCLA 4U68A 1KIXA 3ZJYC 4R4IA 3GTPB 3TP8A 4JPBW 4RMFA 1KAWA 4DV7Q 1QWYA 3HOZB 3FMCA 4QB4A 2KHSA 3PUVA 4MZ9A 2HQLA 5T1GA 3TS0A 3J80E 1FJGL 3NELA 4FNFA 2R92H 2F0LA 2D0PA 3MWYW 4BBSH 4YCWA 4FXKC 4LF4L 1NTGA 4ZUJA 1T5EA 4NMZA 2PQAB 5ELCA 2R92B 4A3JG 4C3JG 5D14A 1ZYRD 4F7XA 3H09A 3TBIB 1SNOA 2MNAA 4QGUA 2B63H 2L15A 2BA0A 4KHPQ 2A73B 3DEPA 2HUGA 1X3QA 1XNRL 4EQNA 3TN2A 1Y14B 2YYZA 4KD4A 1KAAA 2Q2TA 1JJ2A 3WDNA 4U673 1EUJA 1V1OA 1F2ZA 1GUTA 2XNAC 2K50A 4NP5A 1PLFA 5FLXc 1KHIA 5DM63 1EQVA 1FGBD 2SOBA 4N9PA 4YWMA 1CQVA 1X3FA 5M5YH 2OF1A 1Z7TA 5D3DA 3M3YH 3Q0AA 2FMMA 3NSWA 4GKJL 2WAQG 3QIAA 4QUFA 1H9SB 3KOJA 4JI0Q 2EYHA 4JBWA 1HNXL 5M5YB 4IZ8A 4AYBB 4A3FH 1RDPD 3M3YB 3HOVG 4PG3A 3DLLA 1QCBD 1YNXA 1F9PA 4DXFA 3BYTB 1E0BA 1UE1A 1D5MC 4XYQA 3LWUA 4JYAL 2VUMH 4A3FB 3CC7A 2EIFA 2VQEL 1QOHA 2R7ZG 5DM73 2A6HD 3CAMA 1RHPA 4IPHA 5KYIA 5KEEA 3G48A 1YHQA 3RR5A 4ZQ3A 5GAEC 2VUMB 3QO2A 3STBD 4R8NA 1VQ7A 1B8AA 1CT1D 4DKAC 5G3LD 3I56A 1HXYD 3F2DA 2NN6I 1VS0A 1LTAD 5JJIA 1ML0D 1N9WA 2HT1A 2SDFA 1TWFH 4M8AA 3CCVA 2AWOA 1WTWA 1I6HH 2E8GA 1LT6D 5FJ8G 2IY5B 1HA6A 2E2HH 4PV1C 3V96A 1J9OA 5IODA 1E3PA 1B2TA 1GO3E 1L2FA 1YNND 1TWFB 3PSIA 2NBFA 5COYA 5FO7B 2AWNA 1I6HB 2VL6A 4TRDA 3VR6A 3KF8A 2A74C 1N32L 1SE4A 2UXCL 3DM1A 4K5XA 2E2HB 4P72A 3RZDH 4PMBA 1TS5A 4BBRH 3J81c 3A54A 4ALPA 4LFBL 2R93G 1YNJC 1SYBA 2J0TD 3D3RA 4OONA 4NXNL 1E1TA 3RZDB 4B3ML 4BBRB 1VDZA 4XXEA 2RSOA 1M90C 4A3GG 4K0KQ 1GUWA 1NCVA 4A76A 4A3MB 4ZAIA 4WJ3M 1RTOA 2I5LX 3D8GA 4QY7A
chains in the Genus database with same CATH topology
4HR7B 2E74C 5J39A 3VR2A 4MIUA 3QOJA 4B08A 1H9MA 3IL8A 4KHZA 5IIFA 1MSGA 2K04A 5K36G 1HRJA 3NWTA 1F77A 1RF2D 1PRTF 2JP1A 3WOEA 2JA5B 3P7JA 3GTJB 2B2UC 1B4OA 2CW0D 3SXHA 3NTIA 1Q12A 3HOWB 5IOCA 4DN4M 1JOOA 3T4AC 1SMYC 1SNDA 5I2XA 4DA2A 1DONA 2PZWA 1JC7A 1LTGD 1IYVA 1IKMA 1EWHA 2V4DA 4B9WA 2BDOA 2F4IA 3MXGA 3D4RA 1SYFA 1EU4A 3EROA 1WTQA 2AUJD 4A3BB 1WTVA 2VB2X 1GOZA 5ELFA 3DEOA 1SEBD 1QNKA 3KLRA 1R9TB 2PPBC 3R93A 3BVMA 2RVLA 1EOTA 3GTOB 1HUNA 1D1KA 1ZKOA 3ONAB 1DCZA 1Y1WB 1SBBB 4OGQC 4DGZA 5JVH3 3S1QB 3GTGB 1PZID 3NWSA 2PCFB 5CV5A 5ELBA 3GV3A 4C56C 3VYTA 3MXNA 2SEBD 1CM9A 2B2YA 4F88A 3I70A 3T56B 2PO4A 1JCKB 2DY8A 4H13C 3D4DA 4XT3B 3A7LA 3MXUA 3CKIB 2BDNA 1JORA 4L6TB 4A3EB 2WP8J 2MHVA 2SNMA 1HFNA 1W6KA 5KGUA 2A69D 1LO5D 2F0PA 3GO5A 4DU9A 2M00A 1BNZA 3H0GB 4KK7A 1EL0A 2BE5C 2NTSA 2EYOA 1C48A 4V0BA 3D31A 5A35A 2L12A 3IAYA 1V43A 2B2VC 5C3WA 2K6AA 2Q8IB 1HCZA 1GJXA 5C3XA 1TS2A 4Z9CB 3ITPA 4ZLTF 3PV0A 5I6WA 3HOXB 2PW7A 1BBXC 1ZEQX 1I4HA 2EY2A 3D4WA 4RKLA 1SNCA 1PZJD 4X3TA 5KRUA 1U4RA 2L4NA 4IUVA 2WACA 5DEHA 1SYDA 1HQMC 3MHBA 5CGKA 1JWMD 4KY6A 2A5HA 4HMIA 2K01A 4KKTA 3V05A 4NW2A 3TP6A 5CC4A 1PFNA 1WTRA 2E2DC 2Z8LA 4A93B 2PW5A 1OXSC 2MGSA 2IPKD 4EQOA 1KDCA 1H9RA 1O7YA 5CYUA 2N88A 3S16B 1CK1A 2EY1A 4Y7NB 3H91A 2LY7A 5I2YA 2FFKB 2QEJC 1U4LA 2F0GA 5D65A 3I91A 1PXUA 4IUTA 1PDQA 2KOLA 1PTOD 1A2TA 2EXZA 3QG1A 5DAUA 1DOLA 3I8ZA 2JA7B 1KLUD 3BDOA 1WTPA 3N52A 4OO1I 2L55A 3VYUA 4DNRB 2AUKA 5EBDA 4OO1H 2NVQB 5IGBA 4RHSA 3M7NA 4H0LC 3NP8A 4FP5D 1XXGA 1W6JA 2XVSA 4HTHA 3BG3A 1D5XC 5BN5A 5C0XI 4DAVA 1BUVT 1PMRA 1SYGA 4KKUA 4MN3A 3I4NB 5C0XH 2KEDA 3DXJC 3HRZC 3VYSA 2D5DA 3CRLC 2F0TA 4KY7A 4UAIA 2EJGC 3OHXC 4H44C 5M5WB 4C3HB 1STGA 2EYLA 2FMCA 5EPJA 1BQQT 1DYQA 3I4LA 1FNWA 1PRTD 4KI0A 2RDGA 3X3MA 1WD1A 1OXUA 4L63B 1GHKA 2O5JC 4HSPA 3NQTA 3VR3A 1JQYD 1KNEA 3H3VC 1IYUA 5J22A 1EEID 1SYEA 3H94A 3ND9A 3NTKA 3W2DA 4H7BA 3TP5A 2K32A 1Q1BA 3TZDA 2YU9B 4KV6A 4HCEA 2GA4B 1IW7D 3GP7A 1EYDA 3BVZA 1FYCA 1CHPD 1RCVD 2JA6B 1AP0A 2XRSD 2Z4HA 2ICEC 3CRKC 4XDXA 2PMZB 3G6JB 1U4MA 2F0FA 5DNFA 2EYPA 3HEJA 4BY7B 1PTOH 4BWGB 1A3TA 2B2UA 2Z4IA 3KLSX 1ZXTA 2KJXA 4CKCA 4M1UB 1F9SA 4QF4A 5J1ZA 1Y8PB 3J7AV 1IL8A 5KIXA 4OIJA 1AN8A 1V1PB 1Q90A 3BS1A 1PZKD 2B2WC 2NZ1D 5JEAH 2HQEA 1AW7A 2F0EA 2QCPX 2TSSA 3R2IA 2FINB 5EGTA 1FNUA 4IN3A 1R4QB 3H6MA 5I9PA 2IJ0A 1I4PA 1C4QA 1CZWA 1KLGD 1MBYA 4DNTB 4F8MA 4BBSB 4RGNA 1OXTA 3JAML 2JA8B 2IL8A 3MFYA 1G6ZA 1EYCA 1O7LA 2WV6D 4KN4C 4CGYB 1Q1EA 3C3LA 4IFDI 2F0HA 1A6XA 2B63B 4IFDH 1TWGB 3NQIA 2E2IB 1BCPB 1NR2A 1RJTA 5C5LA 2KCCA 3M7GA 1JWSD 4ZK9B 3S1NB 1QILA 2QF7A 4IALA 1ONLA 4ID6A 3SDZA 3SR1A 1HPCA 3I4MB 1UUPA 1PYWD 2Q8RE 3OWFA 1TIID 3ZYYX 1EY0A 2A6EC 2RDHA 1STAA 1EIGA 1MI2A 4IUPA 1EZ6A 3AB9A 5EQ0A 2F0NA 1YNNC 3FKIB 4G7ZC 3OSOA 5CMDA 2WKDA 1F9QA 3M85A 3GV6A 5E1FA 1TR5A 2B2VA 2L5TA 4RH6A 3PUYA 5I6YA 3R2TA 4ULLA 2R3ZA 4QUCA 3K6OA 2MPMA 3S2DB 2B8FA 1CA6A 2MUYA 2NN6H 1TY0A 1CTMA 4G7OC 4X3KA 2E76C 4Q0FA 2XN9C 2NUCA 1BXTA 3R3OA 5F2DA 1E2ZA 4MHEA 2AQ2B 2JXMB 1E2WA 2ZT9C 4FXDA 5A2QL 3HOYB 2J7ZA 1U9RA 2D9UA 3K58A 3A8IE 5EPKA 3TDQA 4KJOA 5LL6S 4JK1C 2CW0C 3HOUB 5ELDA 3P1HA 3V2TA 3FDTA 2K28A 1CFMA 3A55A 3VR5A 2K5DA 1G8ZD 5AFWA 2HDLA 2NVTB 2IX3A 4IUUA 1OXXK 3A56A 1ENCA 2EY6A 3NBIA 3KK7A 3K57A 1G2SA 3GTKB 2F3VA 5NUCA 1HQRD 1BO0A 1S4ZA 1LTSD 1LT3D 2N55A 1UAPA 4TQUS 4K14A 1XYIA 3IFDA 2NTTA 1NAPA 1TS4A 4LJZC 1HA5A 4G7HC 2I07B 3TSSA 3BVGA 1YNJD 3TZUA 1HTPA 4TSSA 1H9SA 2M9VA 3K59A 1DJRD 1RD9D 3OPOA 4QMGA 1CQFA 5I4DA 5M3FB 1ILQA 4K2LA 4KD3A 4K2KA 4HN7A 1AZQA 4I7ZC 3LNNA 3URYA 4C3IB 1MGSA 1II3A 3GQBA 3S14B 2L1BA 3OMGA 4CJ0B 2XIWA 3J7AF 3PIP3 1LTTD 3NTHA 4ZYSA 2DNEA 4K8IA 5C0XJ 4QIWB 4I65A 1V8QA 2EDGA 4R9WA 2F03A 4ILWA 1A3UA 1SJHD 1SMYD 4BY1B 5FLXL 2FJ2A 3L3OC 1DM0B 1XTCD 1JR0D 1STHA 2J4XA 1B50A 1I6VC 4FF3A 3NXWA 2G9HD 4CKBA 2RSNA 1AZPA 3MTSA 3FRPB 1TU2B 1S5BD 2X6GA 3HZXA 1I4QA 4L8JA 1IKLA 4J1MA 1G291 3E6ZX 2K1BA 3UI2A 3W3AA 1B9NA 4C1NI 1BDOA 1DZ1A 2EYFA 3SHLA 3RD4A 3TP7A 2B2WA 4KKSA 5LL6X 4A3DB 3RMHA 2HCIA 2F0KA 1LTBD 2TMPA 2ENBA 2WINB 1JOQA 1QB5D 1SJED 1TWAB 3CQZB 5FKAC 4F87A 3MXPA 2PZUA 2EYJA 2ICIA 1SSOA 2AQ1B 3J81L 5C6AA 2OEOA 4YIJA 1STBA 2F0OA 1A15A 3DWQA 4G57A 1KNAA 5K36H 2Z1CA 3T53B 3Q23A 2RQXA 2NYZD 5JEAG 3IFTA 2NB0A 2BE5D 3C1FA 5JEAJ 1CA5A 1JB3A 2BCOA 3R8BA 1O80A 3K5OA 4KTAA 3J7YW 1EY8A 4BA1I 1S5FD 1ESFA 4CJ1B 1WCMB 3VYRA 4V190 5LHY1 3K5NA 2CVRA 1J8IA 2PQEA 5JVG3 2F0WA 3QJYA 1KDAA 1JOKA 1QNUA 1STEA 2IX0A 2A68C 1SNPA 1GUNA 1BCPC 2B8GA 3SEBA 3C1EA 3GTQB 3S2HB 2PZTA 1IW7C 1FD7D 4IFDJ 2G9DA 2Y0SB 3I72A 4X3UA 2BA1A 1GUOA 3GTLB 4DF7A 4X3SA 3QWNA 5KNDA 1EQTA 1VF7A 3HKZB 1M8AA 2QDBA 3L9AX 3EA6A 3PIO3 2DNCA 3J80L 4G4KA 4RCNA 2WB1B 4PQXA 1U4PA 1JWUD 3HGBA 1NUCA 1EY9A 1SNQA 1ESRA 5IT9E 3TMEA 2EJMA 1DD2A 4FF1A 2H1EA 5CV4A 2KEEA 1K8MA 5ELEA 2SNSA 1ENFA 3E5SA 4HMJA 2JSOA 1T5XD 3DWPA 5T1IA 2F3WA 3RLFA 1VMCA 2RDFA 2NN6G 4XQJA 3OIQA 1FNVA 1M4VA 3IKJA 3T16A 3MFGA 1Q8IA 2D62A 5C4XB 5CV8A 4PMWA 5FO9B 5TSSA 1LTID 2E2JB 5EKIA 1JE4A 1NSNS 4ZUIA 1PTOB 2KECA 1F2MA 1B1ZA 1ZYRC 4O1NA 1WVLA 3I90A 1EU3A 2L0CA 3S9WA 5K5PA 3Q22A 3VA7A 4KY5A 1EWCA 2IW3A 3FPPA 4FYDA 4IQZA 1F2YA 3BYYB 4DXGA 3BZDB 3X3NA 1HTLD 1RODA 4ABNA 3L7ZC 4R8IA 2RBMA 5JPMC 1I4RA 1EY6A 2LFNA 5EBCA 4CHTB 1PRTB 1O78A 3EQLC 4GZYC 4WJWA 1TT2A 5IGFA 1VCIA 3ND8A 2OXPA 4Q5VA 5M3MB 1X3PA 1ENAA 4FXGC 2KCNA 3MC0B 2F0QA 1HHVA 2K03A 1Z6HA 1D1IA 1A3VA 5CBAE 2A6HC 2ZXRA 3SK4A 2F0JA 2JYOA 1I3QB 2OT2A 2XRQD 4C1NK 3NBHA 4C3IG 3EVQA 1CHQD 1SFOB 2F0DA 1STNA 4EGVA 1VF5C 4RGOS 3KUPA 1EY7A 2H4OA 1AEXA 3NPPA 2F0VA 4XT1B 4ZRZA 4DK1A 1QJOA 2CHBD 3C2PA 3PO3B 1TS3A 5D3IB 1RTNA 3PO2B 5JOBA 3DMUA 1S5ED 3F2UA 4LK1C 4K6DA 3OIPA 5EKLA 1G2TA 2DN8A 2O2LD 4HSVA 3CU7A 4WFN3 4LMQD 4DK0A 1F2LA 3K7AB 3NHHA 4LAAA 5E4XA 2EY5A 3A8KE 2F0UA 3KBGA 2O5IC 4FVMA 5C3EB 3AU7A 1CI3M 1L0XB 1SXTA 1FR3A 5CR3A 1V1PA 3JAME 2A6ED 4C2MB 4ODGA 2AQ3B 1O7ZA 4ZKBB 1ET6A 4A3KB 2VXWA 2KUMA 2B2TC 3DUZA 4IURA 3MAQA 4IUQA 5JAVA 2JE6I 2F1MA 1D2BA 2F0MA 4XIGS 1PTOF 1GUSA 2B39A 1LABA 2M2LA 3GD7A 4A3IB 2XSCA 3FVQA 1TY2A 3Q24A 5I9OA 2IX1A 1SYCA 1KABA 1HUMA 2K5QA 2O4XA 1XX8A 4ME5A 1K83B 4DAPA 2IWHA 3NUCA 1QE6A 3KLSA 3QOLA 5C44B 2R6GA 1EFID 1EY4A 3N6RA 3HG9A 3BDCA 5CORA 2RKSA 5C5MA 3P20A 3CHBD 4WORA 1ET9A 4NKLA 3EFXD 4EVOA 3WOFA 3KBXA 2ZXOA 2NVYB 4FF2A 3FEWX 1H9KA 3A8JE 4FO2A 1EYAA 4OIKA 4BS9A 1BOSA 2K05A 2EYMA 1TWHB 4A3JB 1Q3LA 4C3JB 3SVMA 3OW7A 4K5VA 4CBVA 3Q6SA 3RUZA 2LKVA 1BCPF 3I3CA 1ILPA 2FHTA 4OO1G 3BDLA 5FO8B 2EE1A 3VA5A 1MSHA 2VB3X 5HURA 1Y69U 1DOMA 1TWCB 3NE5B 5A2QE 5KYLA 5HGTA 3K5LA 5IGEA 1D5ZC 1NR4A 4K5WA 4C3HG 5JJZA 1LACA 1LT5D 3MZ5A 5C0XG 1WTOA 3M4OB 1C8CA 4K6LA 3AMUA 2ZXPA 5CV9A 2A69C 4CJ2C 1S5DD 5BN3A 3PUZA 3PUXA 1SE2A 2WAQB 4N9TA 3S15B 3MEHA 1KTKA 1LT4D 3SE0A 1UEAB 1R4PB 2JEBI 1STYA 1MD2D 3HOVB 2I46A 5IGCA 4RGTA 4CKEA 2E75C 3EJIA 3D6WA 5M5XB 5EJWA 3SK8A 4B9XA 2R7ZB 1QG7A 2K5WA 5IGGA 3M4YA 2C5CA 3E0JA 2HCCA 1AFPA 2NVXB 2CQAA 3OWEB 2IT1A 5E3FA 5M9OA 2EPBA 4TKOB 3RZOB 1VMPA 2KVMA 1KDBA 5JPNC 2XWBB 1XWEA 4KJNA 1B9MA 3DHQA 4XYOA 3T51B 2X6LA 3NK9A 3K5MA 4HCSA 1A2UA 1IHZA 1K8OA 3QB3A 2R93B 3VR4A 1BR9A 1PTOC 1H9JA 1UNSA 4O42A 1PFBA 2VNUD 3S1RB 4A3GB 1EZ8A 2QILA 5ISRA 5C4JB 4J6HA 4XTCS 3I73A 4DAYA 1EIHA 2R61A 2EOTA 1LLRD 3SK6A 5CV7A 5C4HA 2DY7A 3S17B 4ZKCB 3SK5A 1S5CD 3MVVA 2WIIB 5IT9L 5IGDA 1SDFA 2NWGA 2XWJB 3GTMB 1EY5A 4FF4A 1OO9B 1TVXA 5EKKA 5FLXE 1Y8NB 1PRTC 3P75A 3ERQA 4RHRA 2MJ8A 4OHJA 5BN4A 5CBEE 2RA4A 1L0YB 4EQPA 4PMCA 2EZVA 3OOCA 1RKNA 4DFAA 5G3LF 4KN7C 4RCOA 3OMCA 4IFDG 3K0YA 3HS0C 1LV9A 4RKBA 3HP3A 2KQ3A 5KNCA 1B3AA 5KNBA 4K8JA 1SAPA 1D6EC 5EPLA 4XQNA 4RFBA 1GHJA 3T13A 2F0IA 1Y1VB 2QKIC 2EVBA 5FK9C 2ID0A 4RA8A 3PUWA 4S3SA 2WKCA 3O13A 1SE3A 3D6CA 1WTXA 1BF4A 1DOKA 1SNMA 3U9OA 3U9SA 1G91A 5CV6A 4OL7A 2B2TA 3J81E 4WRDA 1DXMA 1EEFD 1TKWB 1ICWA 4KHVA 2KA7A 1I4XA 4RGMA 2MP1A 2A68D 5C4ZA 1GUGA 4E6IA 2PYKA 1BCPD 2LS01 1WD0A 2L9HA 4RWSC 2EJFC 2F0SA 3A7AB 4XQQA 2PNRC 2D2CC 1Y8OB 3LX0A 2K33A 2HDMA 2L11A 4J8QA 1B53A 1OXVA 5E4WC 1HFGA 4IUNA 3G7LA 4NDXA 1I50B 1B44D 1GXDC 1I4GA 3PMFA 3S1MB 3FPUB 1X32A 4P2CB 2K7VA 2LMCB 2B2YC 4HEDA 2BOSA 2Q8TA 4PNYA 4KMUC 2JEAI 2C9OA 1E2VA 4UDUC 1CZGA 1TQOA 2X69A 1JICA 3DWAA 3LWEA 1F9RA 4HAEA 1LTRD 3MA2B 5FOBB 3C46A 4RAUC 4BA2I 1Z47A 1PFMA 4QCLA 4U68A 3GTPB 3TP8A 1QWYA 3HOZB 3FMCA 4QB4A 2KHSA 3PUVA 5T1GA 3J80E 4FNFA 2F0LA 3MWYW 4FXKC 4ZUJA 1T5EA 4NMZA 5ELCA 2R92B 4C3JG 5D14A 1ZYRD 4F7XA 3H09A 3TBIB 1SNOA 2BA0A 2A73B 3DEPA 2HUGA 1X3QA 4EQNA 3TN2A 2YYZA 4KD4A 1KAAA 3WDNA 4U673 1V1OA 1F2ZA 1GUTA 2XNAC 4NP5A 1PLFA 5DM63 1EQVA 1FGBD 2SOBA 4N9PA 1CQVA 2OF1A 1Z7TA 5D3DA 3Q0AA 2FMMA 3NSWA 3QIAA 4QUFA 1H9SB 2EYHA 4JBWA 5M5YB 4IZ8A 4AYBB 1RDPD 3M3YB 1QCBD 1F9PA 4DXFA 3BYTB 1E0BA 1D5MC 4XYQA 3LWUA 4A3FB 1QOHA 5DM73 2A6HD 5KYIA 1RHPA 5KEEA 4ZQ3A 2VUMB 3QO2A 4R8NA 1CT1D 5G3LD 1HXYD 2NN6I 1LTAD 1ML0D 2SDFA 4M8AA 2AWOA 1WTWA 1LT6D 1HA6A 4PV1C 3V96A 1J9OA 5IODA 1B2TA 1YNND 1TWFB 5COYA 2NBFA 5FO7B 2AWNA 1I6HB 4TRDA 3VR6A 3KF8A 2A74C 1SE4A 3DM1A 4K5XA 2E2HB 4PMBA 1TS5A 3A54A 1YNJC 1SYBA 2J0TD 3D3RA 3RZDB 4BBRB 1VDZA 4XXEA 2RSOA 1GUWA 1NCVA 4A3MB 4ZAIA 1RTOA 3D8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2K A;  3DMU A;  4DFA A;  4EQO A;  1EYC A;  1EQV A;  1EYD A;  1KDC A;  3OMC A;  2SOB A;  4K6D A;  4N9P A;  5CV5 A;  4PNY A;  1U9R A;  1EYA A;  5J39 A;  3MXP A;  5EKL A;  2PZU A;  1KDB A;  2EYJ A;  1II3 A;  4RKB A;  2EY1 A;  2F0H A;  2QDB A;  4MIU A;  2OF1 A;  2EYM A;  2RBM A;  3QOJ A;  2KQ3 A;  4KJN A;  3OMG A;  4KJO A;  1TQO A;  2F0G A;  3DHQ A;  1EY6 A;  4K5V A;  4K8J A;  2OEO A;  3NHH A;  4YIJ A;  2EYH A;  3RUZ A;  4LAA A;  5C6A A;  5IIF A;  5C5L A;  2LKV A;  3P1H A;  3V2T A;  2EY5 A;  1STB A;  4IZ8 A;  1A2T A;  2F0O A;  1NUC A;  2F0U A;  2EXZ A;  3NK9 A;  1EY9 A;  5DAU A;  2F0F A;  1A2U A;  1SNQ A;  3TME A;  1IHZ A;  4G57 A;  3BDL A;  4K8I A;  5IGF A;  1TT2 A;  3QB3 A;  3D4D A;  5CV4 A;  4I65 A;  3VA5 A;  2EYP A;  4IAL A;  2SNS A;  3HEJ A;  5CR3 A;  2OXP A;  4ID6 A;  1A3U A;  3T13 A;  3E5S A;  3SR1 A;  1ENC A;  5HUR A;  3SXH A;  2F0I A;  2EY6 A;  1JOR A;  4HMJ A;  4ODG A;  1ENA A;  5IGB A;  5KYI A;  5KYL A;  1A3T A;  5IOC A;  1EZ8 A;  1STH A;  2F0Q A;  5HGT A;  1JOO A;  3OWF A;  5IGE A;  2F3W A;  2SNM A;  5IOD A;  5KEE A;  1EY0 A;  5KGU A;  1SND A;  1A3V A;  1STA A;  3C1F A;  3NP8 A;  4J6H A;  4ZQ3 A;  5ISR A;  4K5W A;  2F0P A;  2F3V A;  4R8N A;  3TP8 A;  5NUC A;  2RDF A;  4S3S A;  2M00 A;  2PZW A;  4DU9 A;  5JAV A;  4HTH A;  2F0M A;  3D6C A;  3MZ5 A;  4QF4 A;  4QB4 A;  4KTA A;  2KHS A;  1EZ6 A;  5J1Z A;  1SNM A;  3U9O A;  3T16 A;  3NXW A;  2EYO A;  5CV6 A;  2F0N A;  4OL7 A;  5CV9 A;  3SK4 A;  4B9W A;  1EY8 A;  2F0J A;  4WRD A;  2F0L A;  3SK6 A;  5CV7 A;  1SYG A;  4KHV A;  5C4H A;  3OSO A;  4K14 A;  3HZX A;  3SK5 A;  5C3W A;  3MVV A;  5I9O A;  5CV8 A;  1SYF A;  2F0T A;  4N9T A;  5KIX A;  1SYC A;  4KY7 A;  1KAB A;  4ZUJ A;  3EVQ A;  4J1M A;  5C4Z A;  3ERO A;  3MEH A;  4NMZ A;  5IGD A;  2O4X A;  4E6I A;  2PQE A;  5C3X A;  2F0W A;  1STG A;  4ME5 A;  2PYK A;  3ITP A;  1TR5 A;  1NSN S;  5E1F A;  5I6W A;  4F7X A;  2EYL A;  2F0D A;  1STN A;  2PW7 A;  1KDA A;  1STY A;  1SNO A;  2F0S A;  1JOK A;  4ZUI A;  1EY5 A;  2EY2 A;  3D4W A;  3NUC A;  5EKK A;  1SNP A;  4RKL A;  5I6Y A;  5IGC A;  1EY7 A;  1SNC A;  2HQE A;  4TRD A;  2F0E A;  1F2M A;  5KRU A;  3EJI A;  3QOL A;  4K5X A;  3C1E A;  3LX0 A;  4PMB A;  2EYF A;  5EGT A;  3NQT A;  3SK8 A;  3SHL A;  2WAC A;  1AEX A;  3P75 A;  1EY4 A;  3ERQ A;  3TP7 A;  3H6M A;  2F0V A;  5DEH A;  1SYD A;  2PZT A;  4EQN A;  3MHB A;  4B9X A;  5CGK A;  1SYB A;  3BDC A;  4KY6 A;  5I9P A;  2F0K A;  4HMI A;  4IUN A;  2RKS A;  5C5M A;  5IGG A;  5J22 A;  2NUC A;  1SYE A;  3S9W A;  3R3O A;  5K5P A;  3TP6 A;  4DGZ A;  4QMG A;  4KD4 A;  4KY5 A;  4WOR A;  4NDX A;  4NKL A;  5F2D A;  4EQP A;  4H7B A;  4F8M A;  3TP5 A;  5CC4 A;  1KAA A;  2ENB A;  4PMC A;  4EVO A;  4DF7 A;  1F2Y A;  3PMF A;  5E3F A;  1JOQ A;  5JOB A;  1F2Z A;  2PW5 A;  4K2L A;  5M9O A;  4KV6 A;  3D8G A;  1RKN A;  4KD3 A;  4NP5 A; 
#chains in the Genus database with same CATH topology
 4HR7 B;  1NMG A;  2E74 C;  2F3I A;  3ULJ A;  4DV0 Q;  5J39 A;  3VR2 A;  4MIU A;  1HZA A;  3QOJ A;  4EQ5 A;  2JA5 H;  2N8N A;  1L1O A;  4HIM A;  4B08 A;  1H9M A;  3IL8 A;  4NPS A;  4KHZ A;  1AE2 A;  2UUB L;  3GTJ H;  5IIF A;  1MSG A;  2K04 A;  5K36 G;  1HRJ A;  3NWT A;  1F77 A;  1RF2 D;  1PRT F;  2JP1 A;  3WOE A;  3HOW H;  2JA5 B;  3P7J A;  4DR6 Q;  3GTJ B;  2B2U C;  4YY3 L;  1S3O A;  1HNW Q;  1B4O A;  2CW0 D;  3SXH A;  3NTI A;  1Q12 A;  3HOW B;  1WCM G;  5IOC A;  4X62 Q;  4DN4 M;  2I5H A;  1JOO A;  3T4A C;  2RCN A;  1SMY C;  1SND A;  5I2X A;  4DA2 A;  1DON A;  2A8V A;  1BBU A;  2ZJR A;  4GN5 A;  2PZW A;  1JC7 A;  1LTG D;  4GN3 B;  4LF5 L;  2ATW A;  1IYV A;  1IKM A;  4HJ9 A;  1EWH A;  2V4D A;  4B9W A;  2BDO A;  2F4I A;  3MXG A;  5M3F H;  4LUO A;  3D4R A;  4YY3 Q;  4DUY L;  4A3B H;  4GOP C;  1SYF A;  2UU9 Q;  1EU4 A;  1R9T H;  3ERO A;  3CPW A;  1WTQ A;  1YIT A;  3GTO H;  4C3I H;  2AUJ D;  3EBE A;  4A3B B;  1WTV A;  2AKW B;  2VB2 X;  5IP7 H;  1GOZ A;  5ELF A;  3DEO A;  1SEB D;  1Y1W H;  1QNK A;  3KLR A;  1R9T B;  1HNZ Q;  2MFI A;  3CC2 A;  2PPB C;  3R93 A;  3BVM A;  2D0O A;  3J80 c;  2RVL A;  3K0X A;  4DR3 L;  1W3S A;  1EOT A;  2CCZ A;  2UUA L;  3GTO B;  4O2D A;  2K5H A;  1HUN A;  1D1K A;  3GTG H;  1ZKO A;  3ONA B;  1DCZ A;  5JJK A;  1Y1W B;  1SBB B;  1HR0 W;  4IJH A;  4OGQ C;  4DGZ A;  1JB7 A;  4B3T Q;  1IL2 A;  1X3E A;  5JVH 3;  1SMX A;  3S1Q B;  3GTG B;  2WB1 G;  1PZI D;  4X64 Q;  3NWS A;  4JI8 L;  4DR1 Q;  2PCF B;  1IZ6 A;  5CV5 A;  3OYY A;  5ELB A;  3GV3 A;  4LF7 Q;  4C56 C;  4YHH Q;  3GDE A;  3MXN A;  2SEB D;  3VYT A;  1CM9 A;  3CCS A;  2B2Y A;  3RLO A;  3I70 A;  3T56 B;  4F88 A;  4DR4 Q;  3Q8D A;  2PO4 A;  2CWP A;  4LF9 Q;  1VQD A;  1JCK B;  2DY8 A;  4H13 C;  4A3E H;  3D4D A;  4XT3 B;  3A7L A;  3MXU A;  2JN4 A;  3CKI B;  1SE8 A;  1SRO A;  2BDN A;  1V9P A;  5IWA Q;  3H0G H;  1JOR A;  1K8G A;  4L6T B;  4A3E B;  2WP8 J;  1PH5 A;  5GQO A;  2MHV A;  2SNM A;  1HFN A;  1W6K A;  5KGU A;  2MQH A;  2A69 D;  1LO5 D;  2F0P A;  3GO5 A;  4DU9 A;  2N78 A;  2M00 A;  4A3D H;  1BNZ A;  3H0G B;  1YVC A;  4IPC A;  4KK7 A;  1EL0 A;  2BE5 C;  2NTS A;  3WWV A;  2EYO A;  1J6Q A;  1C48 A;  1B3Q A;  2QA4 A;  4V0B A;  3D31 A;  5A35 A;  2L12 A;  3IAY A;  3HOX H;  2H5X A;  1V43 A;  1K3R A;  2B2V C;  5C3W A;  2K6A A;  4QQB X;  1TWA H;  3CQZ H;  2Q8I B;  1S40 A;  3CCQ A;  1HCZ A;  1ASZ A;  1GJX A;  5C3X A;  1TS2 A;  4Z9C B;  5EAY A;  1N33 Q;  3ITP A;  1VQE A;  2KCT A;  2Z6B A;  3PV0 A;  4ZLT F;  5I6W A;  1QVG A;  2PW7 A;  3HOX B;  3JC6 6;  1BBX C;  1ZEQ X;  1I4H A;  2EY2 A;  3D4W A;  4DV2 Q;  4RKL A;  1SNC A;  3ERS X;  1PZJ D;  4X3T A;  5KRU A;  4JI4 L;  4JI6 Q;  1U4R A;  3S24 A;  2L4N A;  4IUV A;  2WAC A;  2Z6K C;  2E5L L;  5DEH A;  1SYD A;  1HQM C;  4DV1 L;  2ZM6 Q;  3MHB A;  5CGK A;  1JWM D;  2MO0 A;  4A93 H;  4KY6 A;  3A74 A;  2A5H A;  4HMI A;  2K01 A;  4KKT A;  3V05 A;  4NW2 A;  3TP6 A;  1C7Y A;  5CC4 A;  4HJA A;  1PFN A;  2PI2 E;  5IP9 H;  1WTR A;  2E2D C;  2Z8L A;  3S16 H;  4A93 B;  4Y7N H;  2PW5 A;  1OXS C;  1IBL L;  1WFQ A;  3PQI A;  2MGS A;  2IPK D;  4EQO A;  1KDC A;  1H9R A;  1O7Y A;  5BR8 L;  4UPA A;  4DPG A;  4DR7 L;  5CYU A;  2N88 A;  3S16 B;  1CK1 A;  2EY1 A;  4Y7N B;  3H91 A;  4L5T A;  2LY7 A;  5I2Y A;  2FFK B;  2QEJ C;  2JA7 H;  4EX5 A;  1U4L A;  2F0G A;  5D65 A;  5DLQ E;  4AQY Q;  3I91 A;  1M1K C;  4LNQ A;  1VQB A;  1MIU A;  1XTD A;  1QUQ A;  2R92 G;  4LWC A;  1PXU A;  4IUT A;  3TRZ A;  1PDQ A;  1WI5 A;  2KOL A;  1PTO D;  1A2T A;  2QW7 A;  2EXZ A;  3QG1 A;  5DAU A;  1DOL A;  3I8Z A;  2NVQ H;  4LFC L;  2JA7 B;  1IBL Q;  4GLA C;  4GOP B;  1KLU D;  3BDO A;  4LUZ A;  1WTP A;  3N52 A;  4JBM A;  4OO1 I;  2L55 A;  3VYU A;  4DNR B;  2AUK A;  1H95 A;  5EBD A;  4OO1 H;  2NVQ B;  5IGB A;  3NEM A;  4RHS A;  3M7N A;  5FLM H;  4H0L C;  3GTQ H;  4JOI C;  3NP8 A;  4FP5 D;  3J81 i;  4DV3 Q;  3I4N H;  1XXG A;  1W6J A;  2XVS A;  4HTH A;  1MKH A;  3BG3 A;  1L0W A;  4JI2 Q;  1D5X C;  5BN5 A;  5C0X I;  5M5W H;  4DAV A;  4C3H H;  2YTX A;  1BUV T;  1PMR A;  1SYG A;  4KKU A;  4MN3 A;  3I4N B;  5C0X H;  2KED A;  3DXJ C;  3AYH B;  1DGS A;  3HRZ C;  3VYS A;  2D5D A;  3CRL C;  4B3S L;  2F0T A;  4KY7 A;  4UAI A;  2EJG C;  3OHX C;  4H44 C;  5M5W B;  4C3H B;  1STG A;  2EYL A;  2FMC A;  5EPJ A;  1BQQ T;  1DYQ A;  3PO3 G;  3I4L A;  1FNW A;  1PRT D;  4X65 L;  4KI0 A;  2RDG A;  3X3M A;  1WD1 A;  1OXU A;  4AYB G;  4L63 B;  1GHK A;  2O5J C;  4HSP A;  3NQT A;  3VR3 A;  2UXD Q;  1JQY D;  1KNE A;  3H3V C;  1HR0 Q;  1IYU A;  3CD6 A;  4O0A A;  5J22 A;  1EEI D;  4B3S Q;  1SYE A;  3H94 A;  3ND9 A;  3NTK A;  4QL5 A;  3W2D A;  4H7B A;  3NBH B;  3TP5 A;  4OXP A;  2K32 A;  1Q1B A;  4JVZ A;  1IBK Q;  3EIV A;  2VUM G;  3TZD A;  2YU9 B;  2CH4 A;  4KV6 A;  2JA6 H;  4HCE A;  4Y52 H;  2GA4 B;  4LF6 Q;  1IW7 D;  3T1H L;  3GP7 A;  1EYD A;  3BVZ A;  1FYC A;  1CHP D;  1KC8 C;  1RCV D;  2JA6 B;  1AP0 A;  4A4I A;  1VQP A;  2XRS D;  2Z4H A;  1NBW A;  3PF4 A;  4N8F A;  2ICE C;  3CRK C;  2OWO A;  4UP8 A;  5C4X H;  4XDX A;  2PMZ B;  3G6J B;  4BY7 H;  3PCO B;  1U4M A;  2F0F A;  1XMO Q;  2KEN A;  5DNF A;  4JI5 L;  2XGT A;  2EYP A;  3HEJ A;  4OWW B;  4BY7 B;  1MHW C;  1PTO H;  2CKZ B;  4LW1 A;  4BWG B;  3TQY A;  1A3T A;  1PA6 A;  4A3L H;  2B2U A;  2Z4I A;  3D0F A;  3KLS X;  1ZXT A;  2KJX A;  4CKC A;  3QR8 A;  4JI7 L;  3SGI A;  4A3M G;  4M1U B;  1F9S A;  4QF4 A;  3U50 C;  4UP9 A;  5J1Z A;  1Y8P B;  1XNQ L;  3J7A V;  1X6O A;  4LF8 Q;  1IL8 A;  4AH6 A;  3I55 A;  3KDF A;  1CSQ A;  1X54 A;  5KIX A;  4OIJ A;  4DUZ L;  1P16 A;  1AN8 A;  1V1P B;  1Q90 A;  3BS1 A;  4JV5 L;  1PZK D;  2B2W C;  2NZ1 D;  5JEA H;  4L5R C;  2HQE A;  1AW7 A;  2F0E A;  2QCP X;  2TSS A;  2VW9 A;  3R2I A;  2JA5 G;  2FIN B;  5EGT A;  1XNQ Q;  1FNU A;  4IN3 A;  1R4Q B;  3H6M A;  1JJG A;  2JA8 H;  5I9P A;  2IJ0 A;  1I4P A;  1PH1 A;  1N36 L;  1C4Q A;  1CZW A;  4GN4 B;  1KLG D;  1MBY A;  4DNT B;  4F8M A;  4BBS B;  4RGN A;  3CW2 C;  1OXT A;  3JAM L;  2JA8 B;  1VQF A;  5M3M H;  2K52 A;  2IL8 A;  1PH8 A;  4POG A;  4QIW E;  3MFY A;  1TWG H;  1G6Z A;  1EYC A;  1O7L A;  4NXM L;  1GKH A;  2WV6 D;  2E2I H;  1FJG Q;  4KN4 C;  4CGY B;  1CKN B;  1Q1E A;  3TRE A;  3RNU A;  3HKS A;  3C3L A;  4IFD I;  2F0H A;  1A6X A;  2B63 B;  3S1N H;  4IFD H;  4LF4 Q;  1TWG B;  1I3Q H;  3NQI A;  1VQN A;  2E2I B;  1B70 B;  1BCP B;  1NR2 A;  1RJT A;  5C5L A;  2KCC A;  3M7G A;  1JWS D;  4ZK9 B;  3S1N B;  4A3B G;  1VQ6 A;  4L5S A;  1ICF B;  2DGY A;  3I4M H;  1MJE A;  1QIL A;  2QF7 A;  4IAL A;  1ONL A;  4ID6 A;  3SDZ A;  5IYC H;  3SR1 A;  4PZ7 A;  1XNR Q;  1VQL A;  3A0J A;  1HPC A;  4BXX G;  3I4M B;  1Y1W G;  1UUP A;  1PYW D;  2Q8R E;  3OWF A;  1TII D;  1VQK A;  3ZYY X;  3H15 A;  1EY0 A;  2A6E C;  2RDH A;  1STA A;  3FKI H;  2LSS A;  3E9I A;  1EIG A;  1MI2 A;  4IUP A;  1EZ6 A;  2CFM A;  3AB9 A;  5EQ0 A;  2F0N A;  3VDY A;  1YNN C;  3FKI B;  4G7Z C;  3OSO A;  5CMD A;  3PO2 H;  4HIO A;  1D8L A;  4B3R L;  1GD7 A;  3K7U C;  5E7N A;  2ZJP A;  2WKD A;  3KJO A;  1F9Q A;  3M85 A;  3GV6 A;  5GRO A;  5E1F A;  1TR5 A;  4GKJ Q;  2B2V A;  2L5T A;  3S2D H;  1WTH A;  4RH6 A;  3PUY A;  1K73 C;  5GAH C;  2ZTD A;  1HNX Q;  3R2T A;  5I6Y A;  4ULL A;  2R3Z A;  4QUC A;  3K6O A;  4GNX B;  2MPM A;  3S2D B;  2B8F A;  1CA6 A;  2MUY A;  2NN6 H;  4HJ7 A;  1TY0 A;  1CTM A;  3A5U A;  4JYA Q;  4G7O C;  4X3K A;  2E76 C;  4Q0F A;  1FVI A;  2XN9 C;  2VQE Q;  4JCV E;  5C3E H;  3G6E A;  2NUC A;  1BXT A;  3R3O A;  1C9O A;  3HOY H;  2Z6K A;  5F2D A;  1E2Z A;  4MHE A;  4A3E G;  2AQ2 B;  2JXM B;  1NY4 A;  4P73 A;  3AFQ A;  2UUC L;  2HIV A;  1YJ9 A;  1E2W A;  2ZT9 C;  4A3K H;  4FXD A;  5A2Q L;  1VQI A;  3HOY B;  2J7Z A;  3ULP A;  3HOU H;  1U9R A;  2D9U A;  3K58 A;  1XPR A;  3A8I E;  5EPK A;  1T9H A;  3TDQ A;  4CDD C;  4KJO A;  1GVP A;  1G6P A;  5LL6 S;  4JK1 C;  1CUK A;  2CW0 C;  3HOU B;  3U58 A;  4A3I H;  4R4Q A;  5ELD A;  2NVT H;  3P1H A;  3V2T A;  3HOX G;  3FDT A;  2K28 A;  3K8A A;  1CFM A;  5IT9 c;  3A55 A;  1KD1 C;  1N32 Q;  4KLK A;  2UXC Q;  3VR5 A;  2K5D A;  1G8Z D;  5AFW A;  2HDL A;  2NVT B;  2IX3 A;  1VQJ A;  2PQA A;  4IUU A;  3GTK H;  1OXX K;  5IYB H;  3A56 A;  1ENC A;  4LFB Q;  2EY6 A;  3NBI A;  3KK7 A;  3K57 A;  4NXN Q;  4B3M Q;  2JQO A;  3PIP A;  1Q46 A;  4HJ8 A;  1G2S A;  3GTK B;  2F3V A;  5NUC A;  1HQR D;  1K0R A;  1BO0 A;  1S4Z A;  1Q82 C;  1LTS D;  3CC4 A;  1LT3 D;  2N55 A;  1UAP A;  4TQU S;  2Y0S E;  4K14 A;  1XYI A;  3IFD A;  2NTT A;  1N8R C;  1NAP A;  1O7I A;  1X65 A;  2PI2 A;  1TS4 A;  2NVY H;  4LJZ C;  1YI2 A;  1HA5 A;  4G7H C;  2CQO A;  2I07 B;  3TSS A;  1SR3 A;  2UUB Q;  3BVG A;  2GVA A;  4DR2 L;  2ES2 A;  1YNJ D;  1IYJ B;  4A3J H;  3TZU A;  3UDI A;  3HKZ E;  2JA7 G;  4JI1 L;  2KHI A;  4DAY B;  1HTP A;  4TSS A;  1S72 A;  1H9S A;  2M9V A;  3K59 A;  1DJR D;  2I5M X;  1RD9 D;  2UXB L;  3OPO A;  4QMG A;  1SRU A;  1CQF A;  5I4D A;  5M3F B;  5IYD G;  1ILQ A;  3PGZ A;  4K2L A;  1YJN A;  4KD3 A;  4ME3 A;  4K2K A;  3S14 H;  4HN7 A;  1AZQ A;  4LF5 Q;  4I7Z C;  4AIM A;  3LNN A;  3URY A;  4C3I B;  1MGS A;  1II3 A;  3I4N G;  3GQB A;  5IE8 A;  4DUY Q;  1JMC A;  3S14 B;  2L1B A;  3I7F A;  2KHJ A;  5J3B A;  3OMG A;  1Y1V G;  2OQ0 A;  3W1G A;  2PMZ E;  4CJ0 B;  2XIW A;  1JT8 A;  5JJL A;  3S15 H;  1PV4 A;  4BY1 H;  3PIP 3;  1LTT D;  3NTH A;  4ZYS A;  4IO9 A;  2DNE A;  1PHJ A;  2Q2U A;  3J7A F;  4K8I A;  3CCJ A;  5C0X J;  4QIW B;  4I65 A;  1ASY A;  1V8Q A;  2EDG A;  4R9W A;  1EFW A;  4ILW A;  1SN8 A;  4DR3 Q;  2F03 A;  1A3U A;  1SJH D;  2AHO B;  2UUA Q;  1SMY D;  3HOV H;  2YTY A;  2YTV A;  4BY1 B;  5FLX L;  2FJ2 A;  3L3O C;  1DM0 B;  1XTC D;  1JR0 D;  1STH A;  2J4X A;  1B50 A;  5LMU L;  1I6V C;  4FF3 A;  3NXW A;  2G9H D;  4JI8 Q;  4CKB A;  2RSN A;  1AZP A;  1HH2 P;  3MTS A;  3FRP B;  1TU2 B;  1S5B D;  1QZH A;  2X6G A;  3HZX A;  5AJ3 L;  2F52 A;  1I4Q A;  4L8J A;  1IBM L;  1IKL A;  3TS2 A;  4J1M A;  3NEN A;  1EYG A;  2JA6 G;  1G29 1;  3E6Z X;  2K1B A;  5LMN L;  3UI2 A;  3W3A A;  1B9N A;  3CXC A;  1E1O A;  4C1N I;  1BDO A;  4DR5 L;  1DZ1 A;  2EYF A;  4JC0 A;  3SHL A;  3RD4 A;  4JBK A;  4QJF A;  3TP7 A;  2B2W A;  4KKS A;  1PYB A;  4A3C G;  1KRS A;  5LL6 X;  4A3D B;  3RMH A;  4H02 A;  2HCI A;  2F0K A;  4BY7 G;  3UDG A;  1LTB D;  1VQH A;  2YV5 A;  2TMP A;  2ENB A;  2WIN B;  3ULL A;  1JOQ A;  1QB5 D;  1SJE D;  3BZC A;  1XPO A;  1TWA B;  2RHS B;  3CQZ B;  5FKA C;  4A3L G;  3J81 j;  4F87 A;  1UEB A;  3MXP A;  2PZU A;  2EYJ A;  1TXY A;  2ICI A;  1SSO A;  1J5E L;  2AQ1 B;  1MJC A;  2AMC B;  3J81 L;  3OTO L;  5C6A A;  2OEO A;  4YIJ A;  2K75 A;  2Z0S A;  2CH4 W;  1STB A;  2F0O A;  1RIP A;  1A15 A;  3DWQ A;  4YWL A;  4G57 A;  4JI4 Q;  3GTM H;  3HOZ G;  1KNA A;  4OEM B;  2Z1C A;  3PIO A;  2HHH L;  5K36 H;  3T53 B;  3Q23 A;  3JAM c;  1PYS B;  2E5L Q;  4DV1 Q;  2RQX A;  2NYZ D;  5JEA G;  1J5E Q;  3KF6 B;  3IFT A;  2NB0 A;  2BE5 D;  2OTL A;  3C1F A;  1FGU A;  5JEA J;  1CA5 A;  4BBS G;  1JB3 A;  3K5O A;  2BCO A;  1O80 A;  3R8B A;  1WCM H;  1U5K A;  4KTA A;  3J7Y W;  2JA8 G;  1I94 L;  1EY8 A;  3JAM i;  4BA1 I;  1S5F D;  1ESF A;  4CJ1 B;  2C35 B;  4FDB A;  2K14 A;  5BR8 Q;  4DR7 Q;  1WCM B;  1NE3 A;  3VYR A;  4V19 0;  1XPU A;  5LHY 1;  2B63 G;  3K5N A;  2CVR A;  1J8I A;  2PQE A;  5JVG 3;  2F0W A;  3QJY A;  3S2H H;  1KDA A;  1JOK A;  1QNU A;  1STE A;  2IX0 A;  2A68 C;  1SNP A;  1VQ4 A;  1GUN A;  1BCP C;  2B8G A;  3SEB A;  2N49 A;  3C1E A;  4LFC Q;  3GTQ B;  3S2H B;  3GTL H;  2PZT A;  2EQS A;  1IW7 C;  1FD7 D;  4IFD J;  2G9D A;  2Y0S B;  3I72 A;  4X3U A;  3I4M G;  2BA1 A;  2VQF L;  1GUO A;  2ASB A;  3GTL B;  4DF7 A;  2R7D A;  3F8T A;  4X3S A;  3QWN A;  5KND A;  1EQT A;  2OCE A;  3UDF A;  1VF7 A;  1LYL A;  3HKZ B;  1M8A A;  2QDB A;  3FKI G;  1W2B A;  3L9A X;  3EA6 A;  1BKB A;  4JBJ A;  3PIO 3;  4A3F G;  2FXQ A;  2N3S A;  2DNC A;  3J80 L;  4G4K A;  4RCN A;  3W1B A;  2WB1 B;  2BH2 A;  4IOA A;  2VQF Q;  3KLW A;  4PQX A;  1U4P A;  4MNO A;  1JWU D;  3HGB A;  1NUC A;  1EY9 A;  4DNI A;  1SNQ A;  1ESR A;  4X65 Q;  5IT9 E;  3TME A;  2EJM A;  1DD2 A;  4FF1 A;  2H1E A;  5CV4 A;  1QZG A;  2KEE A;  4DK3 C;  1K8M A;  5ELE A;  2SNS A;  1ENF A;  3E5S A;  3DM3 A;  4GNX C;  4R4T A;  4HMJ A;  1A62 A;  2JSO A;  1K9M C;  1T5X D;  3CPF A;  1A8V A;  1VQC A;  3DWP A;  5T1I A;  2KCM A;  2F3W A;  3RLF A;  1VMC A;  2RDF A;  2NN6 G;  4XQJ A;  3OIQ A;  1K28 A;  1FNV A;  1HZ9 A;  1M4V A;  3IKJ A;  3T16 A;  4OWX B;  2E2J H;  3MFG A;  3RN2 A;  1Q8I A;  3T1H Q;  1YHA A;  2D62 A;  1D7Q A;  5C4X B;  4DV6 L;  3TEH B;  5CV8 A;  4PMW A;  4P74 A;  5FO9 B;  5TSS A;  4DV5 L;  1LTI D;  2PNH A;  2E2J B;  5EKI A;  1Q81 C;  1JE4 A;  2QGQ A;  1NSN S;  1HZC A;  4ZUI A;  4BBR G;  4JI3 L;  2Q2H A;  1QVF A;  4UHV A;  1PTO B;  2KEC A;  1F2M A;  4GLX A;  1B1Z A;  1ZYR C;  4O1N A;  1WVL A;  3I90 A;  4PZ6 A;  4JI5 Q;  1FL0 A;  4GKK L;  1WJJ A;  1XMQ L;  1G51 A;  1EU3 A;  2L0C A;  4DV4 L;  3L0O A;  3W5O A;  4YCV A;  3S9W A;  3CME A;  5K5P A;  4RG1 A;  1A0I A;  3VA7 A;  3Q22 A;  4KY5 A;  1EWC A;  4IOC A;  2IW3 A;  3FPP A;  4FYD A;  1KL9 A;  1QVC A;  4IQZ A;  4DV7 L;  1KXL A;  1CSP A;  4GOP A;  1UWV A;  1F2Y A;  3BYY B;  4DXG A;  4JI7 Q;  3BZD B;  1LUZ A;  1VQA A;  3X3N A;  1BBW A;  1HTL D;  1ROD A;  4ABN A;  3L7Z C;  3KF8 B;  1NNX A;  4R8I A;  2RBM A;  1XMQ Q;  5JPM C;  2K5N A;  1C0A A;  1I4R A;  1EY6 A;  4DUZ Q;  3HOW G;  2JK8 A;  2LFN A;  5EBC A;  1E24 A;  4CHT B;  4JV5 Q;  4HJ5 A;  1PRT B;  4KHP L;  1O78 A;  2NZO A;  4LUV A;  3EQL C;  4GZY C;  4WJW A;  1TT2 A;  5IGF A;  4LFA L;  1VCI A;  1WYD A;  2RHQ B;  3ND8 A;  2OXP A;  2WAQ E;  4GLV B;  4Q5V A;  5M3M B;  1HJP A;  1X3P A;  1ENA A;  4FXG C;  2KCN A;  3MC0 B;  4DAM A;  1BVS A;  1N36 Q;  2F0Q A;  1HHV A;  2K03 A;  3A5Z B;  1Z6H A;  1D1I A;  2B3G A;  1A3V A;  5CBA E;  1EIF A;  4UY8 C;  2ZJQ A;  5M3F G;  2A6H C;  1L1O B;  2ZXR A;  2K4K A;  2B29 A;  3SK4 A;  3STB C;  2F0J A;  2JYO A;  1I3Q B;  2OT2 A;  4LFA Q;  4P75 A;  1SFO H;  2XRQ D;  4C1N K;  4NXM Q;  3I2Z A;  3NBH A;  4C3I G;  3F1Z A;  5IP7 G;  3EVQ A;  4JI0 L;  1X9N A;  1CHQ D;  1SFO B;  2F0D A;  1STN A;  3I4O A;  4EGV A;  3PF5 A;  2LXJ A;  1VF5 C;  4RGO S;  2DJG C;  3KUP A;  1EY7 A;  2H4O A;  1VQM A;  1K0S A;  3IRB A;  2GVB A;  3PO3 H;  1AEX A;  3NPP A;  2F0V A;  3L2P A;  5GAG C;  3H3V I;  4XT1 B;  4ZRZ A;  1E7Z A;  1EQQ A;  3H3V H;  4DK1 A;  3F2C A;  1QJO A;  2CHB D;  3K80 C;  3C2P A;  4BY1 G;  3PO3 B;  1TS3 A;  5D3I B;  3UE1 A;  1RTN A;  4X6A H;  3AQQ A;  3PO2 B;  5JOB A;  4CDC C;  1VQ8 A;  3DMU A;  3MEF A;  1S5E D;  3F2U A;  4LK1 C;  4K6D A;  4YWK A;  4JG2 A;  4I7A A;  3K7A H;  3OIP A;  5EKL A;  1G2T A;  2DN8 A;  2O2L D;  2Z9H A;  4HSV A;  3CU7 A;  4WFN 3;  4B3R Q;  4LMQ D;  4DK0 A;  1F2L A;  3U4V A;  2ALY B;  3K7A B;  1YBY A;  3NHH A;  4MTN A;  4LAA A;  5E4X A;  2EY5 A;  3A8K E;  5LMN W;  4L5Q A;  2F0U A;  4C2M H;  3KBG A;  2O5I C;  4FVM A;  5C3E B;  3AU7 A;  3H0G G;  1CI3 M;  2HIX A;  3CCU A;  1L0X B;  1SXT A;  1E22 A;  1FR3 A;  5CR3 A;  4R4C A;  1V1P A;  1X56 A;  1YHB A;  5GAD C;  3JAM E;  2A6E D;  4C2M B;  1AE3 A;  4ODG A;  2AQ3 B;  1O7Z A;  4ZKB B;  4A3D G;  1ET6 A;  2RCF A;  4A3K B;  2K5V A;  4K0K L;  2VXW A;  2KUM A;  2B2T C;  3BU2 A;  3CP0 A;  3MXN B;  3DUZ A;  1OTC A;  4IUR A;  1KRT A;  3MAQ A;  4IUQ A;  1P8L A;  5HGQ A;  2JE6 I;  2F1M A;  5JAV A;  1D2B A;  2F0M A;  4XIG S;  1PTO F;  2UUC Q;  1GUS A;  2B39 A;  1LAB A;  2M2L A;  4DV0 L;  2F4V L;  3GD7 A;  1Q7Y C;  4A3M H;  4JW0 A;  4A3I B;  2XSC A;  1K83 H;  3B6Y A;  3FVQ A;  4DK6 C;  1TY2 A;  3Q24 A;  3UE0 A;  5I9O A;  2IX1 A;  1SYC A;  1KAB A;  1HUM A;  1X3G A;  2K5Q A;  2O4X A;  1UE7 A;  3ICE A;  1XX8 A;  4ME5 A;  5C44 H;  1K83 B;  4DAP A;  2IWH A;  3NUC A;  4WJ4 A;  2VS1 A;  1N34 L;  1CKN A;  1QE6 A;  3KLS A;  3QOL A;  4A93 G;  4DR6 L;  5C44 B;  2R6G A;  4JOI A;  2F4V Q;  1EFI D;  1EY4 A;  1HNW L;  3N6R A;  1NMF A;  3E0E A;  5IP9 G;  3HG9 A;  3BDC A;  3BJU A;  3M4Q A;  3HFZ B;  1UE5 A;  4X62 L;  5COR A;  2RKS A;  5C5M A;  3P20 A;  5IY0 A;  3CHB D;  1PH3 A;  4WOR A;  1ET9 A;  4NKL A;  3EFX D;  4EVO A;  3CMA A;  4P71 A;  3WOF A;  3KBX A;  1YZ6 A;  5L37 A;  2ZXO A;  1TWH H;  1U0L A;  2EXD A;  1N34 Q;  2NVY B;  4C3J H;  4FF2 A;  3FEW X;  1H9K A;  3A8J E;  4FO2 A;  1EYA A;  4OIK A;  1NJI C;  2OTJ A;  4BS9 A;  2UU9 L;  1BOS A;  2K05 A;  2EYM A;  1TWH B;  1PFS A;  4A3J B;  1Q3L A;  4C3J B;  3SVM A;  2WB1 E;  4UP7 A;  3OW7 A;  4K5V A;  1KQS A;  3M9B A;  3Q6S A;  4CBV A;  1K8A C;  3RUZ A;  2LKV A;  1BCP F;  3UDX A;  3I3C A;  3U4Z A;  1ILP A;  1HNZ L;  4PZ8 A;  3CCL A;  1TWC H;  4DR2 Q;  2FHT A;  3RN5 A;  4OO1 G;  3BDL A;  5FO8 B;  2EE1 A;  3VA5 A;  1MSH A;  4JI1 Q;  5FLM G;  2VB3 X;  5HUR A;  1Y69 U;  1Q86 C;  1DOM A;  1TWC B;  3NE5 B;  4B3T L;  5A2Q E;  3M4O H;  1WOC A;  2Y0S G;  5KYL A;  2MO1 A;  2IHE A;  2UXB Q;  2VY3 A;  5HGT A;  3K5L A;  5IGE A;  4GNX A;  1D5Z C;  1NR4 A;  4K5W A;  4C3H G;  5JJZ A;  1LTL A;  1EOV A;  4X64 L;  1LAC A;  1LT5 D;  2QDL A;  4BXX H;  3MZ5 A;  5C0X G;  1WTO A;  4DR1 L;  3M4O B;  1C8C A;  1QUQ B;  4K6L A;  4X66 L;  2ZXP A;  5CV9 A;  3AMU A;  2A69 C;  4CJ2 C;  2IHF A;  4LF7 L;  1GM5 A;  3S1Q H;  1S5D D;  5BN3 A;  4YHH L;  3PUZ A;  1IXR A;  3HKZ G;  3PUX A;  1SE2 A;  2WAQ B;  4N9T A;  4DR4 L;  3S15 B;  3MEH A;  4APV A;  1KTK A;  1LT4 D;  3SE0 A;  1UEA B;  5M5X H;  1R4P B;  2JEB I;  3G4S A;  1STY A;  1MD2 D;  4LF9 L;  3HOV B;  2I46 A;  3AFP A;  3F2B A;  2R7Z H;  3J80 i;  5IGC A;  4RGT A;  4CKE A;  2E75 C;  3EJI A;  3D6W A;  4X66 Q;  5M5X B;  5EJW A;  3SK8 A;  2NVX H;  3BZK A;  2CWA A;  5IWA L;  4B9X A;  2R7Z B;  1QG7 A;  3CCR A;  2K5W A;  5IGG A;  3M4Y A;  2C5C A;  3E0J A;  2HCC A;  3RZO H;  1AFP A;  2NVX B;  2CQA A;  1EIY B;  3T1Y L;  4IJL A;  3OWE B;  2IT1 A;  2KBN A;  5E3F A;  5FJ8 H;  5H1S E;  5M9O A;  5LMU Q;  1UE6 A;  1EWI A;  2EPB A;  4TKO B;  3RZO B;  4R1J A;  1VMP A;  2KVM A;  1KDB A;  5JPN C;  2R7F A;  4POF A;  5AJ3 Q;  2Q2I A;  2XWB B;  5C4X G;  1XWE A;  4KJN A;  1N33 L;  1B9M A;  3DHQ A;  1IBM Q;  2R93 H;  1I5F A;  4XYO A;  4DV2 L;  5LMN Q;  3T51 B;  3T1Y Q;  4NB3 A;  3EN2 A;  4JI6 L;  4MTK A;  2X6L A;  3NK9 A;  3K5M A;  4HCS A;  1EQR A;  1A2U A;  4OX9 L;  3S1R H;  3OW2 A;  4A3G H;  1IHZ A;  1K8O A;  3QB3 A;  2R93 B;  3VR4 A;  4DR5 Q;  1BR9 A;  2ZM6 L;  1PTO C;  1H9J A;  5C4J H;  1UNS A;  4O42 A;  1B7Y B;  1K3B C;  1PFB A;  3J7Z C;  2VNU D;  3S1R B;  4A3G B;  4CDE C;  1EZ8 A;  2QIL A;  1V1Q A;  5ISR A;  5C4J B;  4J6H A;  4XTC S;  3S17 H;  3I73 A;  4DAY A;  1EIH A;  2R61 A;  2EOT A;  2JJQ A;  4OX9 Q;  1AH9 A;  1LLR D;  2VZA A;  3SK6 A;  5CV7 A;  3FP9 A;  5C4H A;  1JE5 A;  2DY7 A;  2NZH A;  3S17 B;  4ZKC B;  3SK5 A;  1S5C D;  3MVV A;  2WII B;  1VQO A;  1A63 A;  2V1C C;  3FHW A;  4HIK A;  5IT9 L;  1PH4 A;  4AQY L;  5IGD A;  3KFU A;  1SDF A;  2NWG A;  2XWJ B;  2ZTC A;  2OQK A;  3GTM B;  1LM0 A;  3OTO Q;  1CKO A;  2RF4 A;  1EY5 A;  4GS3 A;  2QEX A;  4FF4 A;  1OO9 B;  1TVX A;  4A75 A;  5EKK A;  5FLX E;  1Y8N B;  1PRT C;  3P75 A;  3ERQ A;  4RHR A;  2HHH Q;  3J7A 5;  3KYH C;  2MJ8 A;  4OHJ A;  5BN4 A;  5M3M G;  5CBE E;  2I0Q A;  5ELO A;  3E3X A;  2RA4 A;  3KDF B;  1L0Y B;  4EQP A;  4DV3 L;  1PH6 A;  4HID A;  3LGJ A;  4AYB E;  1RL2 A;  4PMC A;  5HY6 A;  4JI2 L;  2EZV A;  3OOC A;  1JJC B;  1RKN A;  4DFA A;  5G3L F;  4KN7 C;  4RCO A;  5IYD H;  3OMC A;  4IFD G;  1L1O C;  1I94 Q;  4IPD A;  3K0Y A;  3ER0 A;  1VQ9 A;  3HS0 C;  1LV9 A;  4ZCK A;  4RKB A;  3HP3 A;  1XJV A;  4CDF C;  2KQ3 A;  2HD3 A;  5KNC A;  1B3A A;  5KNB A;  4K8J A;  1SAP A;  1D6E C;  5EPL A;  1YJW A;  1Y1V H;  5IYC G;  4XQN A;  2UXD L;  4RFB A;  1HR0 L;  1GHJ A;  3CCM A;  4OWT B;  3T13 A;  3G71 A;  2F0I A;  1Y1V B;  2QKI C;  1PH7 A;  1Q8K A;  2EVB A;  2ID0 A;  5FK9 C;  2DUD A;  4TVA B;  3KJP A;  3M4P A;  1IBK L;  4N8X 1;  4RA8 A;  4YCU A;  3PUW A;  4S3S A;  2WKC A;  3O13 A;  1SE3 A;  4LF6 L;  3D6C A;  1SLJ A;  1WTX A;  1BF4 A;  1DOK A;  3PO2 G;  1SNM A;  3RLN A;  3U9O A;  3U9S A;  1G91 A;  5CV6 A;  4OL7 A;  2B2T A;  3J81 E;  3CCE A;  4WRD A;  1PH9 A;  1DXM A;  1EEF D;  1TKW B;  1ICW A;  2DJF C;  4KHV A;  2YU9 H;  2KA7 A;  1I4X A;  4RGM A;  2MP1 A;  2A68 D;  5C4Z A;  1CKM A;  1GUG A;  4E6I A;  2PYK A;  1BCP D;  2LS0 1;  1WD0 A;  2L9H A;  2A19 A;  4RWS C;  2EJF C;  2F0S A;  2LXK A;  3A7A B;  4XQQ A;  4IPG A;  2PNR C;  1PVO A;  2D2C C;  1XMO L;  1Y8O B;  3AEV A;  1HZB A;  3LX0 A;  2A1A A;  2K33 A;  5C3E G;  2HDM A;  1I50 H;  1X55 A;  2L11 A;  2ZTE A;  4J8Q A;  3HOY G;  1B53 A;  1VQ5 A;  1OXV A;  3S1M H;  5E4W C;  1HFG A;  2G5D A;  4IUN A;  3G7L A;  4J15 A;  4A3C H;  4A3K G;  4NDX A;  1I50 B;  1B44 D;  1GXD C;  1I4G A;  4R4O A;  4OEL B;  3PMF A;  3S1M B;  3HOU G;  3FPU B;  1PH2 A;  1X32 A;  4P2C B;  2K7V A;  4LF8 L;  2LMC B;  2B2Y C;  4HED A;  2BOS A;  2Q8T A;  3KF6 A;  1YEZ A;  2BH8 A;  4PNY A;  4KMU C;  2GN5 A;  2JA9 A;  4A3I G;  2JEA I;  2C9O A;  1E2V A;  4UDU C;  4DV6 Q;  1CZG A;  3K81 C;  1TQO A;  2X69 A;  4DV5 Q;  1JIC A;  3DWA A;  3LWE A;  1F9R A;  1YIJ A;  5ELN A;  4HAE A;  1Z9F A;  1LTR D;  3MA2 B;  4JI3 Q;  3CF5 A;  5IYB G;  5FOB B;  3C46 A;  4RAU C;  5C44 G;  2XTI A;  3GTP H;  3E9H A;  4BA2 I;  3HOZ H;  1Z47 A;  4GKK Q;  2P5Z X;  1PFM A;  1VQG A;  2WFW A;  4DV4 Q;  4QCL A;  4U68 A;  1KIX A;  3ZJY C;  4R4I A;  3GTP B;  3TP8 A;  4JPB W;  4RMF A;  1KAW A;  4DV7 Q;  1QWY A;  3HOZ B;  3FMC A;  4QB4 A;  2KHS A;  3PUV A;  4MZ9 A;  2HQL A;  5T1G A;  3TS0 A;  3J80 E;  1FJG L;  3NEL A;  4FNF A;  2R92 H;  2F0L A;  2D0P A;  3MWY W;  4BBS H;  4YCW A;  4FXK C;  4LF4 L;  1NTG A;  4ZUJ A;  1T5E A;  4NMZ A;  2PQA B;  5ELC A;  2R92 B;  4A3J G;  4C3J G;  5D14 A;  1ZYR D;  4F7X A;  3H09 A;  3TBI B;  1SNO A;  2MNA A;  4QGU A;  2B63 H;  2L15 A;  2BA0 A;  4KHP Q;  2A73 B;  3DEP A;  2HUG A;  1X3Q A;  1XNR L;  4EQN A;  3TN2 A;  1Y14 B;  2YYZ A;  4KD4 A;  1KAA A;  2Q2T A;  1JJ2 A;  3WDN A;  4U67 3;  1EUJ A;  1V1O A;  1F2Z A;  1GUT A;  2XNA C;  2K50 A;  4NP5 A;  1PLF A;  5FLX c;  1KHI A;  5DM6 3;  1EQV A;  1FGB D;  2SOB A;  4N9P A;  4YWM A;  1CQV A;  1X3F A;  5M5Y H;  2OF1 A;  1Z7T A;  5D3D A;  3M3Y H;  3Q0A A;  2FMM A;  3NSW A;  4GKJ L;  2WAQ G;  3QIA A;  4QUF A;  1H9S B;  3KOJ A;  4JI0 Q;  2EYH A;  4JBW A;  1HNX L;  5M5Y B;  4IZ8 A;  4AYB B;  4A3F H;  1RDP D;  3M3Y B;  3HOV G;  4PG3 A;  3DLL A;  1QCB D;  1YNX A;  1F9P A;  4DXF A;  3BYT B;  1E0B A;  1UE1 A;  1D5M C;  4XYQ A;  3LWU A;  4JYA L;  2VUM H;  4A3F B;  3CC7 A;  2EIF A;  2VQE L;  1QOH A;  2R7Z G;  5DM7 3;  2A6H D;  3CAM A;  1RHP A;  4IPH A;  5KYI A;  5KEE A;  3G48 A;  1YHQ A;  3RR5 A;  4ZQ3 A;  5GAE C;  2VUM B;  3QO2 A;  3STB D;  4R8N A;  1VQ7 A;  1B8A A;  1CT1 D;  4DKA C;  5G3L D;  3I56 A;  1HXY D;  3F2D A;  2NN6 I;  1VS0 A;  1LTA D;  5JJI A;  1ML0 D;  1N9W A;  2HT1 A;  2SDF A;  1TWF H;  4M8A A;  3CCV A;  2AWO A;  1WTW A;  1I6H H;  2E8G A;  1LT6 D;  5FJ8 G;  2IY5 B;  1HA6 A;  2E2H H;  4PV1 C;  3V96 A;  1J9O A;  5IOD A;  1E3P A;  1B2T A;  1GO3 E;  1L2F A;  1YNN D;  1TWF B;  3PSI A;  2NBF A;  5COY A;  5FO7 B;  2AWN A;  1I6H B;  2VL6 A;  4TRD A;  3VR6 A;  3KF8 A;  2A74 C;  1N32 L;  1SE4 A;  2UXC L;  3DM1 A;  4K5X A;  2E2H B;  4P72 A;  3RZD H;  4PMB A;  1TS5 A;  4BBR H;  3J81 c;  3A54 A;  4ALP A;  4LFB L;  2R93 G;  1YNJ C;  1SYB A;  2J0T D;  3D3R A;  4OON A;  4NXN L;  1E1T A;  3RZD B;  4B3M L;  4BBR B;  1VDZ A;  4XXE A;  2RSO A;  1M90 C;  4A3G G;  4K0K Q;  1GUW A;  1NCV A;  4A76 A;  4A3M B;  4ZAI A;  4WJ3 M;  1RTO A;  2I5L X;  3D8G A;  4QY7 A; 
#chains in the Genus database with same CATH homology
 4HR7 B;  2E74 C;  5J39 A;  3VR2 A;  4MIU A;  3QOJ A;  4B08 A;  1H9M A;  3IL8 A;  4KHZ A;  5IIF A;  1MSG A;  2K04 A;  5K36 G;  1HRJ A;  3NWT A;  1F77 A;  1RF2 D;  1PRT F;  2JP1 A;  3WOE A;  2JA5 B;  3P7J A;  3GTJ B;  2B2U C;  1B4O A;  2CW0 D;  3SXH A;  3NTI A;  1Q12 A;  3HOW B;  5IOC A;  4DN4 M;  1JOO A;  3T4A C;  1SMY C;  1SND A;  5I2X A;  4DA2 A;  1DON A;  2PZW A;  1JC7 A;  1LTG D;  1IYV A;  1IKM A;  1EWH A;  2V4D A;  4B9W A;  2BDO A;  2F4I A;  3MXG A;  3D4R A;  1SYF A;  1EU4 A;  3ERO A;  1WTQ A;  2AUJ D;  4A3B B;  1WTV A;  2VB2 X;  1GOZ A;  5ELF A;  3DEO A;  1SEB D;  1QNK A;  3KLR A;  1R9T B;  2PPB C;  3R93 A;  3BVM A;  2RVL A;  1EOT A;  3GTO B;  1HUN A;  1D1K A;  1ZKO A;  3ONA B;  1DCZ A;  1Y1W B;  1SBB B;  4OGQ C;  4DGZ A;  5JVH 3;  3S1Q B;  3GTG B;  1PZI D;  3NWS A;  2PCF B;  5CV5 A;  5ELB A;  3GV3 A;  4C56 C;  3VYT A;  3MXN A;  2SEB D;  1CM9 A;  2B2Y A;  4F88 A;  3I70 A;  3T56 B;  2PO4 A;  1JCK B;  2DY8 A;  4H13 C;  3D4D A;  4XT3 B;  3A7L A;  3MXU A;  3CKI B;  2BDN A;  1JOR A;  4L6T B;  4A3E B;  2WP8 J;  2MHV A;  2SNM A;  1HFN A;  1W6K A;  5KGU A;  2A69 D;  1LO5 D;  2F0P A;  3GO5 A;  4DU9 A;  2M00 A;  1BNZ A;  3H0G B;  4KK7 A;  1EL0 A;  2BE5 C;  2NTS A;  2EYO A;  1C48 A;  4V0B A;  3D31 A;  5A35 A;  2L12 A;  3IAY A;  1V43 A;  2B2V C;  5C3W A;  2K6A A;  2Q8I B;  1HCZ A;  1GJX A;  5C3X A;  1TS2 A;  4Z9C B;  3ITP A;  4ZLT F;  3PV0 A;  5I6W A;  3HOX B;  2PW7 A;  1BBX C;  1ZEQ X;  1I4H A;  2EY2 A;  3D4W A;  4RKL A;  1SNC A;  1PZJ D;  4X3T A;  5KRU A;  1U4R A;  2L4N A;  4IUV A;  2WAC A;  5DEH A;  1SYD A;  1HQM C;  3MHB A;  5CGK A;  1JWM D;  4KY6 A;  2A5H A;  4HMI A;  2K01 A;  4KKT A;  3V05 A;  4NW2 A;  3TP6 A;  5CC4 A;  1PFN A;  1WTR A;  2E2D C;  2Z8L A;  4A93 B;  2PW5 A;  1OXS C;  2MGS A;  2IPK D;  4EQO A;  1KDC A;  1H9R A;  1O7Y A;  5CYU A;  2N88 A;  3S16 B;  1CK1 A;  2EY1 A;  4Y7N B;  3H91 A;  2LY7 A;  5I2Y A;  2FFK B;  2QEJ C;  1U4L A;  2F0G A;  5D65 A;  3I91 A;  1PXU A;  4IUT A;  1PDQ A;  2KOL A;  1PTO D;  1A2T A;  2EXZ A;  3QG1 A;  5DAU A;  1DOL A;  3I8Z A;  2JA7 B;  1KLU D;  3BDO A;  1WTP A;  3N52 A;  4OO1 I;  2L55 A;  3VYU A;  4DNR B;  2AUK A;  5EBD A;  4OO1 H;  2NVQ B;  5IGB A;  4RHS A;  3M7N A;  4H0L C;  3NP8 A;  4FP5 D;  1XXG A;  1W6J A;  2XVS A;  4HTH A;  3BG3 A;  1D5X C;  5BN5 A;  5C0X I;  4DAV A;  1BUV T;  1PMR A;  1SYG A;  4KKU A;  4MN3 A;  3I4N B;  5C0X H;  2KED A;  3DXJ C;  3HRZ C;  3VYS A;  2D5D A;  3CRL C;  2F0T A;  4KY7 A;  4UAI A;  2EJG C;  3OHX C;  4H44 C;  5M5W B;  4C3H B;  1STG A;  2EYL A;  2FMC A;  5EPJ A;  1BQQ T;  1DYQ A;  3I4L A;  1FNW A;  1PRT D;  4KI0 A;  2RDG A;  3X3M A;  1WD1 A;  1OXU A;  4L63 B;  1GHK A;  2O5J C;  4HSP A;  3NQT A;  3VR3 A;  1JQY D;  1KNE A;  3H3V C;  1IYU A;  5J22 A;  1EEI D;  1SYE A;  3H94 A;  3ND9 A;  3NTK A;  3W2D A;  4H7B A;  3TP5 A;  2K32 A;  1Q1B A;  3TZD A;  2YU9 B;  4KV6 A;  4HCE A;  2GA4 B;  1IW7 D;  3GP7 A;  1EYD A;  3BVZ A;  1FYC A;  1CHP D;  1RCV D;  2JA6 B;  1AP0 A;  2XRS D;  2Z4H A;  2ICE C;  3CRK C;  4XDX A;  2PMZ B;  3G6J B;  1U4M A;  2F0F A;  5DNF A;  2EYP A;  3HEJ A;  4BY7 B;  1PTO H;  4BWG B;  1A3T A;  2B2U A;  2Z4I A;  3KLS X;  1ZXT A;  2KJX A;  4CKC A;  4M1U B;  1F9S A;  4QF4 A;  5J1Z A;  1Y8P B;  3J7A V;  1IL8 A;  5KIX A;  4OIJ A;  1AN8 A;  1V1P B;  1Q90 A;  3BS1 A;  1PZK D;  2B2W C;  2NZ1 D;  5JEA H;  2HQE A;  1AW7 A;  2F0E A;  2QCP X;  2TSS A;  3R2I A;  2FIN B;  5EGT A;  1FNU A;  4IN3 A;  1R4Q B;  3H6M A;  5I9P A;  2IJ0 A;  1I4P A;  1C4Q A;  1CZW A;  1KLG D;  1MBY A;  4DNT B;  4F8M A;  4BBS B;  4RGN A;  1OXT A;  3JAM L;  2JA8 B;  2IL8 A;  3MFY A;  1G6Z A;  1EYC A;  1O7L A;  2WV6 D;  4KN4 C;  4CGY B;  1Q1E A;  3C3L A;  4IFD I;  2F0H A;  1A6X A;  2B63 B;  4IFD H;  1TWG B;  3NQI A;  2E2I B;  1BCP B;  1NR2 A;  1RJT A;  5C5L A;  2KCC A;  3M7G A;  1JWS D;  4ZK9 B;  3S1N B;  1QIL A;  2QF7 A;  4IAL A;  1ONL A;  4ID6 A;  3SDZ A;  3SR1 A;  1HPC A;  3I4M B;  1UUP A;  1PYW D;  2Q8R E;  3OWF A;  1TII D;  3ZYY X;  1EY0 A;  2A6E C;  2RDH A;  1STA A;  1EIG A;  1MI2 A;  4IUP A;  1EZ6 A;  3AB9 A;  5EQ0 A;  2F0N A;  1YNN C;  3FKI B;  4G7Z C;  3OSO A;  5CMD A;  2WKD A;  1F9Q A;  3M85 A;  3GV6 A;  5E1F A;  1TR5 A;  2B2V A;  2L5T A;  4RH6 A;  3PUY A;  5I6Y A;  3R2T A;  4ULL A;  2R3Z A;  4QUC A;  3K6O A;  2MPM A;  3S2D B;  2B8F A;  1CA6 A;  2MUY A;  2NN6 H;  1TY0 A;  1CTM A;  4G7O C;  4X3K A;  2E76 C;  4Q0F A;  2XN9 C;  2NUC A;  1BXT A;  3R3O A;  5F2D A;  1E2Z A;  4MHE A;  2AQ2 B;  2JXM B;  1E2W A;  2ZT9 C;  4FXD A;  5A2Q L;  3HOY B;  2J7Z A;  1U9R A;  2D9U A;  3K58 A;  3A8I E;  5EPK A;  3TDQ A;  4KJO A;  5LL6 S;  4JK1 C;  2CW0 C;  3HOU B;  5ELD A;  3P1H A;  3V2T A;  3FDT A;  2K28 A;  1CFM A;  3A55 A;  3VR5 A;  2K5D A;  1G8Z D;  5AFW A;  2HDL A;  2NVT B;  2IX3 A;  4IUU A;  1OXX K;  3A56 A;  1ENC A;  2EY6 A;  3NBI A;  3KK7 A;  3K57 A;  1G2S A;  3GTK B;  2F3V A;  5NUC A;  1HQR D;  1BO0 A;  1S4Z A;  1LTS D;  1LT3 D;  2N55 A;  1UAP A;  4TQU S;  4K14 A;  1XYI A;  3IFD A;  2NTT A;  1NAP A;  1TS4 A;  4LJZ C;  1HA5 A;  4G7H C;  2I07 B;  3TSS A;  3BVG A;  1YNJ D;  3TZU A;  1HTP A;  4TSS A;  1H9S A;  2M9V A;  3K59 A;  1DJR D;  1RD9 D;  3OPO A;  4QMG A;  1CQF A;  5I4D A;  5M3F B;  1ILQ A;  4K2L A;  4KD3 A;  4K2K A;  4HN7 A;  1AZQ A;  4I7Z C;  3LNN A;  3URY A;  4C3I B;  1MGS A;  1II3 A;  3GQB A;  3S14 B;  2L1B A;  3OMG A;  4CJ0 B;  2XIW A;  3J7A F;  3PIP 3;  1LTT D;  3NTH A;  4ZYS A;  2DNE A;  4K8I A;  5C0X J;  4QIW B;  4I65 A;  1V8Q A;  2EDG A;  4R9W A;  2F03 A;  4ILW A;  1A3U A;  1SJH D;  1SMY D;  4BY1 B;  5FLX L;  2FJ2 A;  3L3O C;  1DM0 B;  1XTC D;  1JR0 D;  1STH A;  2J4X A;  1B50 A;  1I6V C;  4FF3 A;  3NXW A;  2G9H D;  4CKB A;  2RSN A;  1AZP A;  3MTS A;  3FRP B;  1TU2 B;  1S5B D;  2X6G A;  3HZX A;  1I4Q A;  4L8J A;  1IKL A;  4J1M A;  1G29 1;  3E6Z X;  2K1B A;  3UI2 A;  3W3A A;  1B9N A;  4C1N I;  1BDO A;  1DZ1 A;  2EYF A;  3SHL A;  3RD4 A;  3TP7 A;  2B2W A;  4KKS A;  5LL6 X;  4A3D B;  3RMH A;  2HCI A;  2F0K A;  1LTB D;  2TMP A;  2ENB A;  2WIN B;  1JOQ A;  1QB5 D;  1SJE D;  1TWA B;  3CQZ B;  5FKA C;  4F87 A;  3MXP A;  2PZU A;  2EYJ A;  2ICI A;  1SSO A;  2AQ1 B;  3J81 L;  5C6A A;  2OEO A;  4YIJ A;  1STB A;  2F0O A;  1A15 A;  3DWQ A;  4G57 A;  1KNA A;  5K36 H;  2Z1C A;  3T53 B;  3Q23 A;  2RQX A;  2NYZ D;  5JEA G;  3IFT A;  2NB0 A;  2BE5 D;  3C1F A;  5JEA J;  1CA5 A;  1JB3 A;  2BCO A;  3R8B A;  1O80 A;  3K5O A;  4KTA A;  3J7Y W;  1EY8 A;  4BA1 I;  1S5F D;  1ESF A;  4CJ1 B;  1WCM B;  3VYR A;  4V19 0;  5LHY 1;  3K5N A;  2CVR A;  1J8I A;  2PQE A;  5JVG 3;  2F0W A;  3QJY A;  1KDA A;  1JOK A;  1QNU A;  1STE A;  2IX0 A;  2A68 C;  1SNP A;  1GUN A;  1BCP C;  2B8G A;  3SEB A;  3C1E A;  3GTQ B;  3S2H B;  2PZT A;  1IW7 C;  1FD7 D;  4IFD J;  2G9D A;  2Y0S B;  3I72 A;  4X3U A;  2BA1 A;  1GUO A;  3GTL B;  4DF7 A;  4X3S A;  3QWN A;  5KND A;  1EQT A;  1VF7 A;  3HKZ B;  1M8A A;  2QDB A;  3L9A X;  3EA6 A;  3PIO 3;  2DNC A;  3J80 L;  4G4K A;  4RCN A;  2WB1 B;  4PQX A;  1U4P A;  1JWU D;  3HGB A;  1NUC A;  1EY9 A;  1SNQ A;  1ESR A;  5IT9 E;  3TME A;  2EJM A;  1DD2 A;  4FF1 A;  2H1E A;  5CV4 A;  2KEE A;  1K8M A;  5ELE A;  2SNS A;  1ENF A;  3E5S A;  4HMJ A;  2JSO A;  1T5X D;  3DWP A;  5T1I A;  2F3W A;  3RLF A;  1VMC A;  2RDF A;  2NN6 G;  4XQJ A;  3OIQ A;  1FNV A;  1M4V A;  3IKJ A;  3T16 A;  3MFG A;  1Q8I A;  2D62 A;  5C4X B;  5CV8 A;  4PMW A;  5FO9 B;  5TSS A;  1LTI D;  2E2J B;  5EKI A;  1JE4 A;  1NSN S;  4ZUI A;  1PTO B;  2KEC A;  1F2M A;  1B1Z A;  1ZYR C;  4O1N A;  1WVL A;  3I90 A;  1EU3 A;  2L0C A;  3S9W A;  5K5P A;  3Q22 A;  3VA7 A;  4KY5 A;  1EWC A;  2IW3 A;  3FPP A;  4FYD A;  4IQZ A;  1F2Y A;  3BYY B;  4DXG A;  3BZD B;  3X3N A;  1HTL D;  1ROD A;  4ABN A;  3L7Z C;  4R8I A;  2RBM A;  5JPM C;  1I4R A;  1EY6 A;  2LFN A;  5EBC A;  4CHT B;  1PRT B;  1O78 A;  3EQL C;  4GZY C;  4WJW A;  1TT2 A;  5IGF A;  1VCI A;  3ND8 A;  2OXP A;  4Q5V A;  5M3M B;  1X3P A;  1ENA A;  4FXG C;  2KCN A;  3MC0 B;  2F0Q A;  1HHV A;  2K03 A;  1Z6H A;  1D1I A;  1A3V A;  5CBA E;  2A6H C;  2ZXR A;  3SK4 A;  2F0J A;  2JYO A;  1I3Q B;  2OT2 A;  2XRQ D;  4C1N K;  3NBH A;  4C3I G;  3EVQ A;  1CHQ D;  1SFO B;  2F0D A;  1STN A;  4EGV A;  1VF5 C;  4RGO S;  3KUP A;  1EY7 A;  2H4O A;  1AEX A;  3NPP A;  2F0V A;  4XT1 B;  4ZRZ A;  4DK1 A;  1QJO A;  2CHB D;  3C2P A;  3PO3 B;  1TS3 A;  5D3I B;  1RTN A;  3PO2 B;  5JOB A;  3DMU A;  1S5E D;  3F2U A;  4LK1 C;  4K6D A;  3OIP A;  5EKL A;  1G2T A;  2DN8 A;  2O2L D;  4HSV A;  3CU7 A;  4WFN 3;  4LMQ D;  4DK0 A;  1F2L A;  3K7A B;  3NHH A;  4LAA A;  5E4X A;  2EY5 A;  3A8K E;  2F0U A;  3KBG A;  2O5I C;  4FVM A;  5C3E B;  3AU7 A;  1CI3 M;  1L0X B;  1SXT A;  1FR3 A;  5CR3 A;  1V1P A;  3JAM E;  2A6E D;  4C2M B;  4ODG A;  2AQ3 B;  1O7Z A;  4ZKB B;  1ET6 A;  4A3K B;  2VXW A;  2KUM A;  2B2T C;  3DUZ A;  4IUR A;  3MAQ A;  4IUQ A;  5JAV A;  2JE6 I;  2F1M A;  1D2B A;  2F0M A;  4XIG S;  1PTO F;  1GUS A;  2B39 A;  1LAB A;  2M2L A;  3GD7 A;  4A3I B;  2XSC A;  3FVQ A;  1TY2 A;  3Q24 A;  5I9O A;  2IX1 A;  1SYC A;  1KAB A;  1HUM A;  2K5Q A;  2O4X A;  1XX8 A;  4ME5 A;  1K83 B;  4DAP A;  2IWH A;  3NUC A;  1QE6 A;  3KLS A;  3QOL A;  5C44 B;  2R6G A;  1EFI D;  1EY4 A;  3N6R A;  3HG9 A;  3BDC A;  5COR A;  2RKS A;  5C5M A;  3P20 A;  3CHB D;  4WOR A;  1ET9 A;  4NKL A;  3EFX D;  4EVO A;  3WOF A;  3KBX A;  2ZXO A;  2NVY B;  4FF2 A;  3FEW X;  1H9K A;  3A8J E;  4FO2 A;  1EYA A;  4OIK A;  4BS9 A;  1BOS A;  2K05 A;  2EYM A;  1TWH B;  4A3J B;  1Q3L A;  4C3J B;  3SVM A;  3OW7 A;  4K5V A;  4CBV A;  3Q6S A;  3RUZ A;  2LKV A;  1BCP F;  3I3C A;  1ILP A;  2FHT A;  4OO1 G;  3BDL A;  5FO8 B;  2EE1 A;  3VA5 A;  1MSH A;  2VB3 X;  5HUR A;  1Y69 U;  1DOM A;  1TWC B;  3NE5 B;  5A2Q E;  5KYL A;  5HGT A;  3K5L A;  5IGE A;  1D5Z C;  1NR4 A;  4K5W A;  4C3H G;  5JJZ A;  1LAC A;  1LT5 D;  3MZ5 A;  5C0X G;  1WTO A;  3M4O B;  1C8C A;  4K6L A;  3AMU A;  2ZXP A;  5CV9 A;  2A69 C;  4CJ2 C;  1S5D D;  5BN3 A;  3PUZ A;  3PUX A;  1SE2 A;  2WAQ B;  4N9T A;  3S15 B;  3MEH A;  1KTK A;  1LT4 D;  3SE0 A;  1UEA B;  1R4P B;  2JEB I;  1STY A;  1MD2 D;  3HOV B;  2I46 A;  5IGC A;  4RGT A;  4CKE A;  2E75 C;  3EJI A;  3D6W A;  5M5X B;  5EJW A;  3SK8 A;  4B9X A;  2R7Z B;  1QG7 A;  2K5W A;  5IGG A;  3M4Y A;  2C5C A;  3E0J A;  2HCC A;  1AFP A;  2NVX B;  2CQA A;  3OWE B;  2IT1 A;  5E3F A;  5M9O A;  2EPB A;  4TKO B;  3RZO B;  1VMP A;  2KVM A;  1KDB A;  5JPN C;  2XWB B;  1XWE A;  4KJN A;  1B9M A;  3DHQ A;  4XYO A;  3T51 B;  2X6L A;  3NK9 A;  3K5M A;  4HCS A;  1A2U A;  1IHZ A;  1K8O A;  3QB3 A;  2R93 B;  3VR4 A;  1BR9 A;  1PTO C;  1H9J A;  1UNS A;  4O42 A;  1PFB A;  2VNU D;  3S1R B;  4A3G B;  1EZ8 A;  2QIL A;  5ISR A;  5C4J B;  4J6H A;  4XTC S;  3I73 A;  4DAY A;  1EIH A;  2R61 A;  2EOT A;  1LLR D;  3SK6 A;  5CV7 A;  5C4H A;  2DY7 A;  3S17 B;  4ZKC B;  3SK5 A;  1S5C D;  3MVV A;  2WII B;  5IT9 L;  5IGD A;  1SDF A;  2NWG A;  2XWJ B;  3GTM B;  1EY5 A;  4FF4 A;  1OO9 B;  1TVX A;  5EKK A;  5FLX E;  1Y8N B;  1PRT C;  3P75 A;  3ERQ A;  4RHR A;  2MJ8 A;  4OHJ A;  5BN4 A;  5CBE E;  2RA4 A;  1L0Y B;  4EQP A;  4PMC A;  2EZV A;  3OOC A;  1RKN A;  4DFA A;  5G3L F;  4KN7 C;  4RCO A;  3OMC A;  4IFD G;  3K0Y A;  3HS0 C;  1LV9 A;  4RKB A;  3HP3 A;  2KQ3 A;  5KNC A;  1B3A A;  5KNB A;  4K8J A;  1SAP A;  1D6E C;  5EPL A;  4XQN A;  4RFB A;  1GHJ A;  3T13 A;  2F0I A;  1Y1V B;  2QKI C;  2EVB A;  5FK9 C;  2ID0 A;  4RA8 A;  3PUW A;  4S3S A;  2WKC A;  3O13 A;  1SE3 A;  3D6C A;  1WTX A;  1BF4 A;  1DOK A;  1SNM A;  3U9O A;  3U9S A;  1G91 A;  5CV6 A;  4OL7 A;  2B2T A;  3J81 E;  4WRD A;  1DXM A;  1EEF D;  1TKW B;  1ICW A;  4KHV A;  2KA7 A;  1I4X A;  4RGM A;  2MP1 A;  2A68 D;  5C4Z A;  1GUG A;  4E6I A;  2PYK A;  1BCP D;  2LS0 1;  1WD0 A;  2L9H A;  4RWS C;  2EJF C;  2F0S A;  3A7A B;  4XQQ A;  2PNR C;  2D2C C;  1Y8O B;  3LX0 A;  2K33 A;  2HDM A;  2L11 A;  4J8Q A;  1B53 A;  1OXV A;  5E4W C;  1HFG A;  4IUN A;  3G7L A;  4NDX A;  1I50 B;  1B44 D;  1GXD C;  1I4G A;  3PMF A;  3S1M B;  3FPU B;  1X32 A;  4P2C B;  2K7V A;  2LMC B;  2B2Y C;  4HED A;  2BOS A;  2Q8T A;  4PNY A;  4KMU C;  2JEA I;  2C9O A;  1E2V A;  4UDU C;  1CZG A;  1TQO A;  2X69 A;  1JIC A;  3DWA A;  3LWE A;  1F9R A;  4HAE A;  1LTR D;  3MA2 B;  5FOB B;  3C46 A;  4RAU C;  4BA2 I;  1Z47 A;  1PFM A;  4QCL A;  4U68 A;  3GTP B;  3TP8 A;  1QWY A;  3HOZ B;  3FMC A;  4QB4 A;  2KHS A;  3PUV A;  5T1G A;  3J80 E;  4FNF A;  2F0L A;  3MWY W;  4FXK C;  4ZUJ A;  1T5E A;  4NMZ A;  5ELC A;  2R92 B;  4C3J G;  5D14 A;  1ZYR D;  4F7X A;  3H09 A;  3TBI B;  1SNO A;  2BA0 A;  2A73 B;  3DEP A;  2HUG A;  1X3Q A;  4EQN A;  3TN2 A;  2YYZ A;  4KD4 A;  1KAA A;  3WDN A;  4U67 3;  1V1O A;  1F2Z A;  1GUT A;  2XNA C;  4NP5 A;  1PLF A;  5DM6 3;  1EQV A;  1FGB D;  2SOB A;  4N9P A;  1CQV A;  2OF1 A;  1Z7T A;  5D3D A;  3Q0A A;  2FMM A;  3NSW A;  3QIA A;  4QUF A;  1H9S B;  2EYH A;  4JBW A;  5M5Y B;  4IZ8 A;  4AYB B;  1RDP D;  3M3Y B;  1QCB D;  1F9P A;  4DXF A;  3BYT B;  1E0B A;  1D5M C;  4XYQ A;  3LWU A;  4A3F B;  1QOH A;  5DM7 3;  2A6H D;  5KYI A;  1RHP A;  5KEE A;  4ZQ3 A;  2VUM B;  3QO2 A;  4R8N A;  1CT1 D;  5G3L D;  1HXY D;  2NN6 I;  1LTA D;  1ML0 D;  2SDF A;  4M8A A;  2AWO A;  1WTW A;  1LT6 D;  1HA6 A;  4PV1 C;  3V96 A;  1J9O A;  5IOD A;  1B2T A;  1YNN D;  1TWF B;  5COY A;  2NBF A;  5FO7 B;  2AWN A;  1I6H B;  4TRD A;  3VR6 A;  3KF8 A;  2A74 C;  1SE4 A;  3DM1 A;  4K5X A;  2E2H B;  4PMB A;  1TS5 A;  3A54 A;  1YNJ C;  1SYB A;  2J0T D;  3D3R A;  3RZD B;  4BBR B;  1VDZ A;  4XXE A;  2RSO A;  1GUW A;  1NCV A;  4A3M B;  4ZAI A;  1RTO A;  3D8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...