3SK4A

Crystal structure of staphylococcal nuclease variant delta+phs d21n/v23e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS D21N/V23E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk4A00
1SNOA 2SNMA 4B9XA 1EY5A 1SYBA 2HQEA 2PZUA 4N9TA 2EYJA 2EYPA 2PW7A 3D4WA 2QDBA 1EZ8A 3EVQA 5CV7A 1KDBA 3R3OA 4K2LA 5J22A 4NMZA 2EY2A 5CV8A 3NUCA 1JORA 1EY9A 4RKBA 3MHBA 3TP5A 2F0FA 4KD3A 2F0JA 1NSNS 4IALA 1IHZA 3DMUA 4K6DA 4QB4A 2EY6A 3V2TA 5C6AA 5C5LA 1SNMA 1JOQA 4H7BA 3SHLA 2EYHA 3VA5A 5IIFA 2PYKA 3OMCA 4K5WA 5EKKA 5IOCA 3QOJA 4NDXA 5KGUA 1F2ZA 5IODA 1STGA 1NUCA 3NHHA 5E1FA 2RKSA 4KHVA 2F0QA 2M00A 4KY7A 1EY7A 4MIUA 4J1MA 4ZUIA 5CC4A 1EQVA 5J39A 5C4ZA 2O4XA 1A3TA 2PQEA 3BDCA 4K14A 2KQ3A 4PMBA 3TP8A 5HGTA 2F0DA 4HMJA 5ISRA 5EGTA 4KY6A 1KABA 2EXZA 4KJNA 3SK8A 4HTHA 1SYCA 2F3WA 4K2KA 3SXHA 4DU9A 5KYIA 1EY8A 1STAA 3HEJA 3T16A 2EYLA 4EVOA 1EYDA 3H6MA 2F0VA 5IGFA 4F7XA 1STBA 4QF4A 3RUZA 3MZ5A 5HURA 3OMGA 4TRDA 1F2YA 4KTAA 2RBMA 5CV6A 5M9OA 2NUCA 4K8IA 4IUNA 4DGZA 2WACA 2F3VA 2F0IA 5F2DA 2LKVA 3MXPA 4K8JA 2EYFA 5CV9A 1TQOA 3HZXA 1II3A 4K5XA 2F0LA 2EY5A 2F0KA 3T13A 5C4HA 3NP8A 4G57A 5K5PA 4EQNA 5KIXA 3NK9A 2PZWA 3BDLA 1A3VA 3EJIA 1TR5A 3P1HA 3TP6A 1A2UA 1A3UA 1SNDA 1SNPA 5NUCA 2F0OA 5CV5A 3U9OA 1KDCA 5C3XA 4NKLA 3SK6A 5CV4A 1SYFA 5EKLA 3SK4A 2F0HA 4PNYA 2SOBA 5KRUA 4K5VA 4EQPA 3NQTA 4ODGA 5IGBA 4NP5A 4EQOA 2F0WA 1SNCA 4E6IA 5I6YA 2F0PA 2OXPA 2F0GA 3OSOA 5C3WA 2OEOA 3DHQA 3TMEA 5IGGA 3NXWA 2RDFA 2ENBA 2F0TA 4ID6A 4QMGA 5IGDA 1RKNA 2F0SA 4WORA 4ZQ3A 5KEEA 4KV6A 1EYCA 5DAUA 2PZTA 3SK5A 2EYMA 1KAAA 2F0EA 4KY5A 1ENCA 2F0NA 2F0MA 5JOBA 5IGCA 2KHSA 1EY4A 5KYLA 1STNA 3D6CA 3ERQA 4PMCA 1A2TA 5C5MA 4B9WA 3S9WA 4OL7A 1EYAA 4KJOA 5I6WA 3SR1A 5E3FA 5J1ZA 1F2MA 1SYDA 2SNSA 4J6HA 4WRDA 2OF1A 3MEHA 5IGEA 1STHA 2F0UA 1ENAA 1SYEA 2EY1A 4KD4A 5JAVA 1SYGA 3QOLA 1TT2A 3ITPA 1JOKA 4LAAA 3P75A 4ME5A 3TP7A 5I9OA 3D4DA 1U9RA 3QB3A 1AEXA 3C1EA 3C1FA 1JOOA 4N9PA 2EYOA 5I9PA 3D8GA 4DFAA 5CGKA 4R8NA 4I65A 3PMFA 3LX0A 1EZ6A 3E5SA 4S3SA 4ZUJA 5DEHA 4RKLA 1EY6A 4F8MA 3OWFA 1EY0A 1KDAA 4DF7A 4IZ8A 3EROA 5CR3A 3MVVA 1STYA 1SNQA 2PW5A 4HMIA 4YIJA
chains in the Genus database with same CATH superfamily
3SE0A 3E0EA 1VQOA 2HQEA 4L5SA 4KLKA 3MXNA 3D4WA 2BA1A 3UDFA 3J81j 3OTOL 4GZYC 3CXCA 4HJ5A 2E2JB 1ASYA 3FKIH 1KIXA 4WJWA 4KD3A 1WOCA 2F0JA 1XMQQ 2JYOA 3HS0C 3FP9A 1WTVA 2IHEA 3KDFA 3NTKA 5IIFA 3U50C 3FRPB 1HR0Q 4LUOA 5IOCA 3G4SA 1F2ZA 1JWUD 3LNNA 4KY7A 4Y7NH 1PH5A 4R8IA 5IYCH 4DR3Q 1B4OA 1GUGA 3M85A 3EA6A 1L1OC 2KHIA 3OOCA 1NE3A 3FEWX 4DV1Q 2R7ZH 3K81C 4JC0A 2ALYB 2ZXRA 1HUMA 2NVXH 1I5FA 3J80i 2LXJA 1EFWA 2UUAQ 3S17H 3GTPB 1F2YA 1VQMA 3HKZG 1C9OA 5M9OA 4K8IA 2EXDA 3H09A 4L5RC 2B63G 4OX9L 1Q1BA 1I6VC 4KI0A 1B53A 4C3HB 4O1NA 4BA1I 1IW7C 3PIO3 3ULPA 1QILA 2PCFB 1BVSA 1BUVT 3NP8A 2MO0A 4IPHA 1OXTA 4BBSG 4XQQA 4MTNA 2UUBL 3BDLA 3KF6A 3GTQH 2CWPA 1TS2A 2F0OA 4ULLA 3JAML 1DZ1A 4B3SL 3EIVA 1XMQL 5CV4A 3SK4A 4DAMA 4K5VA 1HZCA 4X65Q 3GTOH 3VYRA 3OPOA 4HJ9A 1WD1A 5IYDG 4DV0Q 3TMEA 2P5ZX 3QO2A 4A3JH 3FDTA 2YTYA 1RKNA 1PH3A 5BN4A 1Y14B 3LGJA 1STEA 1I4PA 4CKCA 1LTID 1E1TA 1YNJD 2WAQB 3Q23A 4CDCC 1QZHA 3CW2C 3ND9A 1K28A 1MD2D 3I4MH 1DGSA 5IP9G 1KQSA 5KNCA 5A2QE 2I07B 4DKAC 4ZLTF 3C1FA 4C2MH 5I9PA 4HCSA 4CKEA 5C44G 2GVBA 4JCVE 1CA5A 2KCMA 3HOYB 4F8MA 1KDAA 4KMUC 1K73C 3H0GH 1UNSA 1XMOQ 5ELCA 5FJ8G 2F03A 4A93H 2PZUA 1SXTA 2YU9H 1XTDA 1UWVA 2A6EC 3A54A 1XPUA 3KLWA 2CQOA 1VQ6A 4BBSB 1JJ2A 1DYQA 4A75A 1WTRA 2K03A 2L1BA 4KHPQ 4JBMA 1TWHH 4PZ6A 2G9HD 1NSNS 1CKNA 4IO9A 5FJ8H 4K5WA 3CMEA 1VQ7A 2AMCB 2R7FA 3H0GB 2J7ZA 2K6AA 3VYTA 1PYBA 1HNWQ 2K01A 2K32A 5I4DA 1EY7A 4R9WA 5J39A 3D6WA 3BDCA 4A93B 1SMYC 4NXML 1SRUA 4KJNA 4KKTA 3JAME 3UE0A 2B8FA 2WKDA 4DU9A 5KYIA 3KDFB 2F52A 2MGSA 1VQ4A 4RMFA 3VYSA 2F0VA 3CD6A 1UE7A 4GS3A 1X3QA 3K57A 2A19A 2Z0SA 1HXYD 1FNVA 2JA8G 5JPNC 1SE8A 5C0XH 4K6LA 2EY5A 1GHKA 2B2VC 5K5PA 2MQHA 4QUFA 3AMUA 4DK0A 1PH2A 1T9HA 4KN7C 4EQOA 2A68D 3CKIB 2NWGA 1S5BD 2OEOA 4GNXC 1VQBA 2RQXA 1PHJA 4IFDH 4ZKCB 3KBXA 1K0SA 1TWGB 1Q86C 3S2DB 1LT6D 1SLJA 2A6HC 1VQCA 2F4VL 5LL6S 4LF4L 2EE1A 2JA5H 1X3EA 1UUPA 1VMPA 4UY8C 1DCZA 1RJTA 3QOLA 1D2BA 1JOKA 2KOLA 4AQYQ 4OEMB 3DM3A 4DFAA 4DR5L 2UXCQ 1HNZQ 1FGBD 2DY7A 1VQ9A 1ZKOA 1DJRD 1CHQD 3TEHB 5LMNQ 4DV7Q 1SNOA 4JI2Q 5E7NA 2UU9L 1HNXL 3I55A 2EYJA 4FF4A 3A7LA 3ND8A 1JWSD 2EY2A 2KA7A 3A8IE 4YWMA 3DUZA 2F0FA 1B1ZA 3PV0A 3E0JA 4RG1A 4LFCQ 2BOSA 1VQDA 1IHZA 2H4OA 4GN3B 1AZQA 5LHY1 2PYKA 1AE3A 3KF8A 4LFCL 2ZJQA 2A68C 3F2BA 1E1OA 3A55A 4X3TA 5E4XA 1HH2P 4A3FG 1CTMA 1EIHA 2M2LA 1Q12A 2E2DC 2B2WC 1CZGA 1SYCA 4IUPA 2JA8B 4JI2L 3HEJA 2BDNA 1IBKL 2I46A 1TS4A 1JB3A 4JVZA 1PFNA 4FF2A 4P75A 2J0TD 3ONAB 3S14H 4XTCS 2K5VA 2EYFA 1LTTD 3T13A 1PRTB 4XQNA 3K58A 1XPRA 2AHOB 1XNQQ 1A3UA 1SNPA 3RLFA 3A5ZB 3IL8A 3AB9A 2UXBL 1I94L 2R92G 4HR7B 1M90C 3TS2A 1G6PA 1XWEA 2Z8LA 5KRUA 3PF5A 3K7AB 3I4NG 3D31A 2C35B 2LY7A 2RCNA 3DHQA 4HIOA 1Q7YC 1PFBA 4KV6A 2B63H 4YCUA 4YWKA 1N32L 2K28A 4KKUA 1WCMG 1VS0A 5KYLA 5C5MA 4JI6L 3GTQB 4BY7B 4IQZA 4JBKA 1L0WA 2KCCA 2A8VA 1S40A 4HJAA 1LACA 1VQFA 1TT2A 3KF8B 4A3MB 5T1IA 1NJIC 1TWFH 5IT9L 2K33A 3QB3A 3PIP3 1N32Q 5EKIA 1ML0D 1CKMA 1PLFA 2K4KA 3PMFA 3KBGA 1F9RA 2B2UC 2N55A 3K6OA 1RODA 1LLRD 3GTGB 4A3GB 1UEAB 1I4RA 5LMUL 1EIYB 2D0OA 5GQOA 3MXUA 1V8QA 2K75A 5IYCG 4ZAIA 3C3LA 4JK1C 2XNAC 4IUVA 4IPCA 5COYA 3NTIA 3D4RA 5BN5A 1YHAA 1SEBD 5FLXc 4X64Q 2VZAA 4H7BA 1AN8A 3JC66 1SE2A 1STGA 2M9VA 4QCLA 1SJED 3M3YH 3MFYA 4LFBL 2NB0A 1RL2A 4DV4Q 4R4OA 2JE6I 5C4XB 4YCWA 4F7XA 3STBD 3CCLA 2IHFA 1PZKD 2NUCA 2LS01 2WACA 3HG9A 2OTLA 3C2PA 4FXDA 2F0LA 5IWAQ 3E9HA 3OYYA 2K5NA 4KHPL 1PTOB 1QG7A 3NTHA 3H3VH 1R4PB 3CCJA 3EBEA 3PO2H 4LF7Q 3X3MA 1TS5A 2F0WA 5JEAG 3CCRA 4DV7L 5I6YA 4QMGA 1KRSA 4JI1L 2B2YC 1A6XA 2E2JH 1K8AC 3RZDH 1SAPA 1ZXTA 4DV5Q 2HT1A 2EJFC 2HIVA 5C4JH 3GTMB 3GD7A 1KLGD 3SEBA 2L12A 4FF3A 4V190 3GTKB 1CKOA 4L5QA 1XNRL 3PSIA 4KJOA 1Y8NB 1J9OA 1LYLA 3D0FA 3CCQA 5JJLA 1S72A 3MEHA 3M4YA 2F4VQ 1SYEA 1PRTD 2RA4A 3H3VI 1BBUA 3P75A 4DNTB 4N9PA 4DR7Q 2NVYB 1ET9A 5CMDA 4LF6L 2UUAL 1X56A 3HOWB 2G9DA 1DOLA 1NY4A 1BQQT 2NN6H 4C3JB 1YI2A 1JE5A 3HOVH 1EZ8A 2FHTA 3A8JE 3HFZB 4DR3L 5M5XH 2JA5G 3E3XA 1CSPA 3Q8DA 4RKBA 5EPKA 3IFTA 2UUBQ 1GJXA 4LW1A 1QNKA 4KHZA 2NZHA 1HUNA 4C3IB 2NVTB 4ZCKA 4NDXA 2JA7G 4RWSC 1NUCA 1V1OA 2HUGA 4J1MA 3S17B 5FO8B 5CORA 1A3TA 2VUMH 4HIMA 2WFWA 3VDYA 4X6AH 2EXZA 4QUCA 2I0QA 3T16A 1QVCA 1NAPA 1YNND 1VQ8A 3GTLB 1QJOA 2VXWA 4FO2A 2K7VA 4Y7NB 5KNDA 1H9MA 1OXXK 2DJGC 3FHWA 3ER0A 2CQAA 1IL8A 2F0IA 4DV3L 3BU2A 3GTJB 5G3LD 5C4HA 2HIXA 3M3YB 2BE5C 4P71A 2PMZB 3TN2A 5KIXA 1K3BC 1D6EC 3TP6A 1A3VA 1HTPA 1VQNA 2I5HA 1GUTA 5DM73 3K5MA 1MI2A 3CCVA 4A3GG 4IURA 1SR3A 3CP0A 4HAEA 5IE8A 3GTLH 4NP5A 1LTLA 3VYUA 3WOFA 3MWYW 2VW9A 1IKMA 4X66L 1EQQA 1Y1WB 3HOYG 5IGGA 3I91A 4OIKA 1B3AA 2K5HA 3UI2A 3VR3A 4ZQ3A 1KLUD 4OO1I 5DAUA 4DNIA 1V1QA 4A3MG 2YV5A 1S4ZA 1VQGA 3M4QA 3HRZC 1I50H 4PMCA 3DEOA 1U0LA 2Q2TA 3BS1A 3HOYH 1G51A 3BVGA 1C8CA 2R92H 1WCMB 2EVBA 4DAVA 2GN5A 1ZEQX 2F4IA 4L63B 3TP7A 3I4NH 3D4DA 4CDEC 3DXJC 4A3KH 4RH6A 4CGYB 2Q8IB 2FJ2A 1BBWA 4A3BH 4OONA 3EROA 1X55A 4JG2A 4QIWB 1LTGD 1T5EA 2JP1A 3I90A 3TRZA 4B9XA 1GUSA 2B2UA 2EYPA 4CKBA 5JEAJ 1G8ZD 2QDBA 1B3QA 2H1EA 4LF8L 3HKZE 3CCSA 3F1ZA 1S5CD 1JQYD 3JAMc 4RGNA 1PYSB 4POGA 3DMUA 2WV6D 1IZ6A 2EYHA 3KUPA 1J6QA 3T56B 3I72A 4MN3A 4EGVA 2WB1B 1VQEA 1BF4A 2VNUD 3M4OB 2TSSA 4QQBX 1WFQA 2AQ1B 5FLMH 1PV4A 2XWBB 2RCFA 2WB1G 1Q8KA 3SK8A 5AFWA 5IYBH 4K2KA 3DM1A 1STAA 4CJ0B 3K0YA 2L0CA 4JI8Q 2K52A 1FNWA 3T1HL 3F8TA 3I56A 1FYCA 4G4KA 3CPWA 4DK3C 2QF7A 4IUNA 1XX8A 1STYA 4B3RL 1SE3A 1Z6HA 3ZYYX 1VMCA 1VQKA 4IN3A 1L0YB 4UAIA 2O2LD 2YTVA 4JI0L 1YNJC 4K0KQ 3P7JA 3NE5B 1UE1A 1HQMC 1JJCB 1R9TB 3V96A 2B2TC 1LTBD 3U4ZA 2EQSA 4POFA 2R3ZA 2QEXA 1Q8IA 4BBRH 2VQFQ 3S15B 1FR3A 3S1QB 3WDNA 1SE4A 5C4XH 1PFSA 1Y1VH 1U4RA 1HZAA 2ZTCA 2Q2IA 3CMAA 4UDUC 1B70B 5I6WA 1RTNA 1FD7D 1XXGA 1BO0A 5M3MG 1YNXA 4KD4A 4BBRG 4C1NI 3IRBA 3BG3A 1OXUA 3EFXD 1H9SB 4PQXA 1Q1EA 3UDXA 1VQIA 4BY1G 4Q5VA 1SSOA 2L9HA 3PO2B 4DV4L 3FKIB 4DF7A 1EY0A 5BR8L 4LFBQ 2XIWA 1QVFA 1AP0A 3WOEA 3PQIA 4DK1A 3M4PA 4CBVA 1ILPA 1EY5A 3HOZB 2XTIA 4JV5L 3UDGA 3S14B 2MUYA 4MTKA 3S1MH 4X64L 2ZTEA 2AUKA 3GTMH 2AQ3B 2ZT9C 1JB7A 1M4VA 1PXUA 4AIMA 2R7ZG 4R1JA 5ELFA 1GUNA 2NN6I 4RCNA 4A3EH 1MJEA 5D3DA 1SNMA 2OQKA 1Y8OB 3SHLA 2GVAA 4MNOA 5C3EB 5K36H 3PO3G 2B3GA 3M7GA 4JI7Q 1Y69U 2RKSA 2N49A 2O4XA 3TP8A 2QILA 4TKOB 2A5HA 4HMJA 5HGQA 1C7YA 4DUYQ 4DR2Q 3J7YW 3J7AV 4OO1H 4UP9A 3L7ZC 4BS9A 3SXHA 2R7DA 1W6JA 3QIAA 5GADC 3O13A 1TY2A 2PQAA 1X65A 3MTSA 5G3LF 3OW2A 2I5MX 3CF5A 3EQLC 4K8JA 1NTGA 4HIKA 5KNBA 2D9UA 1TWCB 4EQNA 1UE6A 1B50A 2VQEL 3F2CA 3KLSA 2VUMB 4P74A 3V05A 2B63B 2F0HA 2R61A 2OCEA 1FJGL 3PGZA 4AYBE 1PVOA 1B44D 1UE5A 5M3FB 3FVQA 4X3UA 3H94A 2ENBA 1CZWA 4KKSA 3J81L 4XYQA 2UXBQ 1PZID 2JA8H 3RNUA 1QUQB 1KAAA 1WTPA 1Q46A 4ME3A 2G5DA 5EAYA 2F0NA 1IKLA 3KYHC 3K0XA 2WAQE 2H5XA 1HRJA 3TS0A 5E3FA 1GUWA 2AUJD 3J80c 1HZ9A 4BA2I 3OW7A 1OXVA 1EWHA 1ICWA 4RHSA 2MHVA 5C44B 2RHSB 4HSPA 4X62L 1Y1WH 4U68A 4TVAB 3H91A 2AQ2B 2D2CC 2WIIB 1RD9D 4AYBB 5CGKA 4FF1A 3LX0A 1EZ6A 4O0AA 4S3SA 3KLSX 1O80A 2VL6A 4A3MH 1JCKB 2SNMA 1GO3E 1PRTF 3HOWG 2VB2X 2CH4A 2PW7A 4RGOS 3T4AC 2BH8A 4A3IH 2AWOA 1EY9A 3L0OA 4IJHA 1N36L 2E2IH 4A3BB 3ICEA 3GTPH 4HSVA 2JA9A 2R6GA 4BY7H 1JOQA 5C5LA 1RDPD 3U9SA 4YHHL 1X9NA 4OWTB 3NSWA 3AQQA 1EQTA 1HNXQ 4GKJQ 1JJGA 2E5LQ 2PQAB 4DPGA 2IW3A 5HGTA 5C0XJ 4DUZQ 1WTQA 2OTJA 5JJIA 1AFPA 4DR5Q 5JJZA 3BJUA 3W5OA 4AQYL 4CJ1B 1D1KA 3RLOA 4B3TQ 2F1MA 5CBEE 4KTAA 3A5UA 2K5QA 1KXLA 4EQ5A 1SJHD 1WYDA 4LF4Q 4QIWE 1BCPF 4DXGA 4X66Q 5CBAE 4RHRA 4JI3Q 4IFDG 3STBC 4ALPA 5IT9c 3GV6A 4L5TA 3I8ZA 5NUCA 1LABA 1KDCA 1P16A 2BE5D 4XDXA 4XYOA 5LMNW 1SDFA 1OO9B 3CRKC 1YJNA 1LV9A 2GA4B 1Y8PB 1N34Q 2OXPA 3MC0B 1E24A 1D1IA 4ILWA 2ZXOA 4IPGA 4JOIA 2JA5B 4RAUC 1R9TH 3SK5A 5M5XB 4LJZC 1H9RA 2B2YA 2ES2A 3ERQA 1XYIA 4L6TB 3F2DA 5EQ0A 1YHBA 3W3AA 3FKIG 4LUZA 4C3IH 4B3MQ 2KVMA 3RZDB 5IGEA 2QA4A 5DM63 3BVMA 1D5ZC 3GTOB 2IL8A 4LF9Q 1CKNB 3CPFA 2E75C 3BZCA 4DV6L 3D8GA 2PMZE 3RZOH 2ZXPA 1G6ZA 5M3MB 2JEBI 1JWMD 1MSGA 2CHBD 2N8NA 2FFKB 1SNQA 1ONLA 1I4XA 4Q0FA 1CHPD 1GHJA 1CSQA 4PZ7A 4M8AA 1E22A 2NZ1D 2RHQB 3URYA 1WTHA 1N8RC 3HGBA 4G7OC 1O7ZA 4C2MB 5C6AA 4OGQC 4H13C 3VA5A 4XIGS 2A6ED 3I73A 4UPAA 3K80C 3CQZH 4I7AA 1EOVA 4OWWB 5E1FA 4ZUIA 2F0QA 2I5LX 2D5DA 1IL2A 1MIUA 2Q2HA 2F0DA 3S24A 1N33Q 2F3WA 3NPPA 3MXGA 3HOUB 4QF4A 3RUZA 3MZ5A 2EZVA 4DAPA 1JMCA 3P20A 2C5CA 2B8GA 3G71A 1O7IA 5F2DA 1MBYA 1QCBD 3HOXB 4NW2A 2BH2A 5A35A 2XN9C 3T1YL 4XT1B 4DR1Q 4P73A 3C46A 2XWJB 2PZWA 4LF7L 1K83H 3AU7A 3TDQA 1SNDA 3FPUB 3HOXG 2O5JC 2OT2A 2CH4W 2WB1E 2KHJA 2CVRA 3NQTA 4JPBW 5IP9H 2NVXB 1E2WA 5C0XG 3OSOA 1TWFB 4JI5Q 2YYZA 3J80E 1H9JA 4WORA 4GN4B 4QY7A 1LM0A 4B3SQ 1N33L 1EYCA 3HOXH 4XQJA 1NR2A 1Q82C 3CC4A 5IP7G 2Q2UA 2E74C 1K83B 2QGQA 4UHVA 4OL7A 2MFIA 2YU9B 1L1OB 4RA8A 3I4OA 3NQIA 1BOSA 4JOIC 1PH9A 4LFAQ 3BZKA 4EX5A 4YY3L 1DONA 1KTKA 5CYUA 3CCEA 3PIOA 2RF4A 3VR2A 5IYDH 4ZYSA 2HDMA 1VQHA 4DV1L 4ZUJA 1Q90A 4HN7A 4RKLA 3U58A 3OWFA 1IBLL 2IWHA 5A2QL 3MVVA 2UXDL 4MIUA 1S5ED 3S1NB 4N9TA 1F9QA 2Z4HA 2A73B 1HR0L 1QE6A 1PRTC 1SMXA 2EDGA 3Q0AA 3TP5A 4CDDC 3QJYA 1B7YB 2L11A 5M3FG 4N8X1 1AH9A 1ENFA 1U4PA 3ERSX 4B3ML 5EKKA 1CUKA 3PUWA 3RN2A 5AJ3L 1PZJD 4KHVA 4LF5L 1MHWC 2IT1A 4PV1C 1TU2B 4DR4L 2IX3A 2KQ3A 2L5TA 4KY6A 4JBWA 4OHJA 4RGMA 1BCPB 3GQBA 2IJ0A 3K7AH 2NVQB 5D65A 4H02A 4HJ7A 3HP3A 1BNZA 1M1KC 1LUZA 2ZJPA 4DUYL 4DR2L 2NZOA 4APVA 4CHTB 4DUZL 1L1OA 2ICEC 2L15A 2K1BA 4IFDI 5I2XA 2F3IA 2K05A 4C3JG 1IXRA 3ULJA 5C3XA 5C3EG 2K04A 4NKLA 1EOTA 3S1QH 4IJLA 1SYFA 5EKLA 1A15A 1YVCA 3MEFA 1KNEA 1TXYA 4R4QA 1SNCA 1DM0B 2F0PA 1L2FA 4XT3B 4GKKQ 3QG1A 3NENA 2NVYH 1BXTA 2F0SA 4IUTA 2J4XA 1B2TA 3RR5A 2A1AA 1WTXA 3J81c 1EY4A 4P2CB 3H0GG 1V1PA 5FO7B 4A3DG 1VQLA 2UUCQ 1SYDA 4YHHQ 2KCTA 4WRDA 2OF1A 1H9KA 3KJPA 3HOWH 5JAVA 3T53B 1TWHB 2KEDA 1HQRD 3AFPA 4N8FA 5FLXL 3C1EA 1X6OA 1JOOA 5ELOA 1RTOA 2EOTA 1PH4A 1YZ6A 4JI4Q 1MGSA 1I3QH 4NPSA 4A3DH 4LNQA 4HMIA 2MP1A 1X3PA 1HR0W 2JEAI 1HZBA 1TWAH 1KDBA 5J22A 2VQFL 2WAQG 4NMZA 2NVTH 2QCPX 5CV8A 1B9NA 3A74A 5LMNL 2VB3X 1C0AA 4JW0A 1S5FD 4H44C 1F9SA 1U4MA 4K6DA 1J5EQ 4RFBA 3V2TA 5M5YB 1MSHA 3A7AB 1H95A 4JI0Q 3QOJA 1PTOC 2M00A 1K9MC 1JORA 2EJGC 3CRLC 2PQEA 4C1NK 1S3OA 1SN8A 1U5KA 1S5DD 3I2ZA 2ZM6Q 2SDFA 2RDHA 2Q8TA 1Q81C 3IAYA 4XXEA 4JI4L 3HKSA 1QOHA 2LSSA 2BCOA 2DGYA 2RBMA 4GOPA 2XRQD 2E8GA 4BXXH 1HFNA 3W1BA 4TQUS 4FXGC 4J15A 1G2SA 1DOKA 1WCMH 2F0KA 1J5EL 3HOUH 3UDIA 3TZDA 2CKZB 4IUUA 1WTWA 2XSCA 4M1UB 3TQYA 5FLMG 1A2UA 1SFOB 3NWSA 5LL6X 4IOCA 2RSNA 1D8LA 4GNXB 2K5DA 2XVSA 2DY8A 4TSSA 1GVPA 3N6RA 2Z6KC 1F2LA 4E6IA 4C3IG 2CW0C 4RCOA 5IGDA 3U4VA 4LF8Q 1LTSD 3KLRA 2R7ZB 4O42A 1JT8A 5KEEA 3KK7A 4JV5Q 1XPOA 2EYMA 2Z1CA 5ELNA 1I3QB 4A3DB 1VDZA 1CM9A 4A3CG 1EWIA 3R8BA 3GO5A 1RHPA 3PUZA 4UP8A 3RD4A 1JC7A 1K8MA 3PUVA 3HOVB 1NNXA 4QL5A 1F2MA 1GM5A 1Z47A 1ENAA 1O7YA 4F88A 1X54A 1HNWL 2RDGA 1W6KA 5EJWA 1X3FA 3NBIA 4PZ8A 1U9RA 2QKIC 2LXKA 1VCIA 3S1RB 2JJQA 3E5SA 3PF4A 5C4XG 2PW5A 4YIJA 5FKAC 5IP7H 4OXPA 2DNEA 2K5WA 4H0LC 1IYVA 1R4QB 4GLAC 2B2WA 1BCPD 3EVQA 5T1GA 4JYAQ 1D5XC 2L4NA 1XTCD 1A8VA 3FPPA 4ZRZA 2NBFA 4BY1B 5AJ3Q 2TMPA 4HCEA 1XMOL 2A6HD 5EPLA 1I6HB 3S1NH 4QB4A 1PFMA 1UEBA 3MA2B 2FINB 2Y0SG 4DN4M 1CK1A 1G291 1DXMA 1X3GA 2DNCA 1PH6A 1VQ5A 4BBSH 1TIID 2KENA 3NHHA 1AZPA 3QWNA 2FMCA 3KJOA 1VQAA 1KABA 3I3CA 2EYLA 2UXDQ 5IGFA 1LT5D 3DWQA 4DR4Q 1I6HH 2ATWA 2BDOA 4TRDA 3W2DA 3AFQA 1NMFA 2X6LA 3N52A 4DR6L 4A3IB 1N9WA 4ZK9B 1VF5C 2B29A 2L55A 4DV0L 4K0KL 1HJPA 2ZJRA 4LFAL 3G48A 4G57A 1T5XD 4X65L 2N78A 3EJIA 4IPDA 3GTKH 4OWXB 4J8QA 1A63A 4IUQA 1HTLD 3DLLA 3CU7A 3J81E 4B3RQ 4PNYA 2SOBA 4EQPA 1IW7D 4ODGA 5DNFA 4IOAA 1BBXC 1O78A 3G6JB 1HPCA 5M5WH 3BDOA 4RGTA 4JI8L 3QR8A 2C9OA 1PMRA 3S1MB 2PI2E 4B08A 5JOBA 3TREA 1FVIA 1B9MA 2NN6G 3GTGH 4A3GH 4YY3Q 2NTTA 4PG3A 3SVMA 1DD2A 3MXNB 1EFID 4C3JH 1SFOH 3SR1A 2DUDA 2XGTA 5J1ZA 1G2TA 2MNAA 2PI2A 5C3EH 3J7AF 3PO2G 2EY1A 1PDQA 4GNXA 1OXSC 5JEAH 4V0BA 3KFUA 2KCNA 2N88A 1ASZA 4NB3A 4UP7A 1E2ZA 1E2VA 3A56A 5CR3A 4JI5L 2D0PA 3VR6A 5JVG3 1RCVD 1GKHA 4CJ2C 2B2VA 4K2LA 3MAQA 1PTOD 1ESFA 3FMCA 4C3HH 3H15A 4FYDA 3MHBA 4BWGB 3S2DH 3S16H 1QZGA 3G7LA 5D3IB 2PPBC 3I70A 3T1YQ 4JBJA 4KK7A 3S1RH 1EU3A 1YIJA 5C0XI 3PIPA 3DWPA 1TWCH 5CC4A 4DV2L 1FNUA 1P8LA 3RMHA 5BN3A 5GAGC 3ULLA 5EGTA 4A93G 1EU4A 1A62A 4HTHA 2X69A 4A3IG 2MPMA 5FLXE 3E9IA 3Q24A 3H6MA 3S16B 4LF5Q 3DEPA 5M5YH 4GN5A 2HCIA 3OHXC 4AH6A 1YBYA 4A3FH 3LWUA 3HZXA 1TQOA 1II3A 1UAPA 1PH1A 2ICIA 2ID0A 2PNHA 4GLVB 1WVLA 1EWCA 3RLNA 1VQJA 4YCVA 5CV5A 1KRTA 2HHHQ 3G6EA 3J7A5 3L3OC 1WJJA 1ZYRD 1QWYA 1FL0A 5IGBA 5HY6A 1Q3LA 1SMYD 4MHEA 1V9PA 2IX1A 2OWOA 2F0GA 4A3KG 4ZKBB 1IBLQ 4OELB 5JVH3 2RDFA 2F0TA 2KJXA 2WP8J 3F2UA 1ZYRC 2JA6G 2HHHL 1YEZA 3T51B 4C56C 4KN4C 4DA2A 1V43A 1MKHA 2Z6KA 4MZ9A 4DV6Q 1KNAA 5IGCA 3WWVA 2KHSA 4WFN3 3HOZH 4LF6Q 2Z6BA 3OIPA 2LFNA 1OTCA 4DR7L 1I4GA 1LO5D 5DLQE 1BKBA 3SDZA 3SGIA 2R93B 4HEDA 4F87A 4LAAA 2JA6H 2VS1A 4ME5A 5EPJA 1PH7A 2R93G 4LWCA 1YITA 4R8NA 2JN4A 4JI6Q 4ABNA 4BY7G 2QDLA 2NVQH 1Y1VB 2PO4A 1N34L 3K5NA 4DV5L 2RVLA 1SYBA 1JE4A 3GDEA 2JSOA 3I7FA 2Q8RE 2JXMB 1EIGA 3CHBD 1KD1C 2B39A 2HDLA 1V1PB 2AKWB 2R93H 3NUCA 3BYTB 1K0RA 1ET6A 2E5LL 1CQVA 1ICFB 4DR1L 1ESRA 3I4NB 3KOJA 4IALA 1M8AA 1CFMA 1IYJB 1YNNC 1I94Q 5GROA 4Y52H 1H9SA 5J3BA 4X3SA 3Q22A 1BDOA 1XNRQ 1CT1D 1N36Q 3MFGA 4A3BG 1AW7A 4PMWA 4K14A 1G91A 3BYYB 1SROA 4A3LH 2NYZD 1EYGA 1KC8C 5H1SE 1EY8A 4JI1Q 4EVOA 1HA6A 3OIQA 1HCZA 4YWLA 2JA7B 3HKZB 5IY0A 1J8IA 3S15H 2CCZA 2DJFC 2K14A 3MXPA 5CV9A 3GP7A 4X62Q 4A3LG 1QVGA 3PUXA 5ELDA 5ELEA 3CC7A 3M4OH 4OO1G 2Z4IA 3NK9A 4A4IA 1CI3M 3R2TA 3AEVA 1CQFA 1LTAD 5IWAL 1TS3A 1VF7A 5M3MH 2KEEA 3J80L 1EQRA 1PYWD 1JICA 2HQLA 4O2DA 5IYBG 1QUQA 3A8KE 3J7ZC 1MJCA 3NBHB 2E76C 5EBCA 2DN8A 4QGUA 1PTOH 4ID6A 4DXFA 3RZOB 1GD7A 2IPKD 5L37A 5LMUQ 4GLXA 1D5MC 2Y0SE 2MJ8A 2PZTA 3CC2A 2JQOA 3GTJH 2F0MA 4LF9L 4FXKC 3H3VC 3S2HB 4NXNQ 2RSOA 2SEBD 1HNZL 1EYAA 1QB5D 4WJ3M 4LUVA 4DR6Q 3TSSA 2IX0A 4DAYB 1STHA 2E2IB 1TWGH 3CQZB 3ZJYC 1GUOA 3K7UC 4A3EG 2Z9HA 3OWEB 1Z9FA 4AYBG 4A3EB 2K50A 2EYOA 1LTRD 4BBRB 1A0IA 5K36G 2KUMA 5DEHA 1EY6A 3TBIB 3PUYA 1YJWA 3E6ZX 3I4MG 4HJ8A 1Y1VG 1E0BA 1FJGQ 4GOPB 1C4QA 1IYUA 1GOZA 5CV7A 3R3OA 5GAEC 1KL9A 4JI7L 5C44H 2ASBA 4FVMA 3VR5A 2VQEQ 1XJVA 1I4QA 2B2TA 4JI3L 3VA7A 2JA6B 1QNUA 3M9BA 4A3KB 1XNQL 5TSSA 3OMCA 4JYAL 4GOPC 5IODA 2WKCA 1BCPC 4LMQD 4B3TL 4LK1C 1EQVA 2D62A 2CFMA 2E2HB 3B6YA 4FDBA 4U673 1NCVA 4NXNL 3KF6B 4C3HG 4A3JG 2N3SA 5M3FH 3DWAA 4GKJL 4IFDJ 2XRSD 1PTOF 1TWAB 5ELBA 2CWAA 2F3VA 3D3RA 1LT3D 1NMGA 4DK6C 1VQPA 3CAMA 3K59A 4K5XA 1C48A 2VUMG 1F77A 1DOMA 1W3SA 3S2HH 2FXQA 1TR5A 4FNFA 2LMCB 4R4IA 4A3FB 3SK6A 2QW7A 1F9PA 1L0XB 1NR4A 2ZTDA 4G7ZC 1D7QA 3L9AX 3BZDB 5FOBB 2KBNA 3K5OA 1E3PA 1EEID 1KAWA 1IBKQ 2BA0A 4R4TA 3NELA 2UU9Q 4QJFA 1PA6A 4KY5A 1E7ZA 1ENCA 4BY1H 1CA6A 3UE1A 3D6CA 1RIPA 3HOVG 1U4LA 3PO3B 2KECA 4FP5D 5I2YA 2SNSA 2WINB 2F0UA 5GAHC 2X6GA 3ITPA 2HD3A 3AYHB 1Z7TA 4Z9CB 1I4HA 5I9OA 1KHIA 1O7LA 2PNRC 4OIJA 5EBDA 2ZM6L 1X32A 4I7ZC 1TKWB 3T1HQ 4IZ8A 1I50B 3R2IA 2JK8A 3K5LA 2E2HH 3LWEA 3EN2A 1WTOA 4L8JA 3PO3H 3GV3A 2EPBA 4DAYA 1JR0D 2UXCL 2O5IC 1HFGA 3PCOB 1TY0A 3TZUA 4BXXG 1EIFA 1TVXA 2EY6A 3K8AA 2VY3A 4DNRB 2A69C 3HOUG 2A74C 5KGUA 2R92B 3Q6SA 3VR4A 1HA5A 2CW0D 5C4ZA 3J81i 2V1CC 5ISRA 4PMBA 1W2BA 1BR9A 4OX9Q 1WD0A 1SBBB 2A69D 5JJKA 1B8AA 1YJ9A 4X3KA 1EYDA 3BVZA 1AE2A 1EUJA 3M7NA 5IT9E 5HURA 1STBA 2OQ0A 2IY5B 3OMGA 5D14A 4A3JB 5CV6A 4HIDA 4WJ4A 3CCUA 4DGZA 2HCCA 1YHQA 2UUCL 4NXMQ 3NBHA 2LKVA 4A3CH 5JPMC 2JA7H 1HHVA 1K8GA 1NBWA 3R93A 4CDFC 3P1HA 1EEFD 2NTSA 2EJMA 3U9OA 3W1GA 3I4MB 3X3NA 5FO9B 2FMMA 3HOZG 4GKKL 2MO1A 2EIFA 3JAMi 2AWNA 1LT4D 4A76A 3NWTA 5C3WA 1EL0A 5BR8Q 3NXWA 3OTOQ 1WI5A 1Y1WG 1K3RA 4P72A 2F0EA 1PH8A 3CCMA 1RF2D 1STNA 5FK9C 3NEMA 5M5WB 1A2TA 4B9WA 3S9WA 3RN5A 1IBML 4J6HA 2Y0SB 2YTXA 3L2PA 4R4CA 1K8OA 5C4JB 4DV2Q 1SYGA 3I4LA 1FGUA 4DV3Q 1AEXA 3IKJA 1ILQA 5E4WC 4G7HC 1IBMQ 4I65A 3A0JA 2V4DA 1GXDC 3IFDA 2QEJC
chains in the Genus database with same CATH topology
3SE0A 2HQEA 3MXNA 3D4WA 2BA1A 4GZYC 2E2JB 4WJWA 4KD3A 2F0JA 2JYOA 3HS0C 1WTVA 3NTKA 5IIFA 3FRPB 5IOCA 1F2ZA 1JWUD 3LNNA 4KY7A 4R8IA 1B4OA 1GUGA 3M85A 3EA6A 3OOCA 3FEWX 2ZXRA 1HUMA 3GTPB 1F2YA 5M9OA 4K8IA 3H09A 1Q1BA 1I6VC 4KI0A 1B53A 4C3HB 4O1NA 4BA1I 1IW7C 3PIO3 1QILA 2PCFB 1BUVT 3NP8A 1OXTA 4XQQA 3BDLA 1TS2A 2F0OA 4ULLA 3JAML 1DZ1A 5CV4A 3SK4A 4K5VA 3VYRA 3OPOA 1WD1A 3TMEA 3QO2A 3FDTA 1RKNA 5BN4A 1STEA 1I4PA 4CKCA 1LTID 1YNJD 2WAQB 3Q23A 3ND9A 1MD2D 5KNCA 5A2QE 2I07B 4ZLTF 3C1FA 5I9PA 4HCSA 4CKEA 1CA5A 3HOYB 4F8MA 1KDAA 4KMUC 1UNSA 5ELCA 2F03A 2PZUA 1SXTA 2A6EC 3A54A 4BBSB 1DYQA 1WTRA 2K03A 2L1BA 2G9HD 1NSNS 4K5WA 3H0GB 2J7ZA 2K6AA 3VYTA 2K01A 2K32A 5I4DA 1EY7A 4R9WA 5J39A 3D6WA 3BDCA 4A93B 1SMYC 4KJNA 4KKTA 3JAME 2B8FA 2WKDA 4DU9A 5KYIA 2MGSA 3VYSA 2F0VA 1X3QA 3K57A 1HXYD 1FNVA 5JPNC 5C0XH 4K6LA 2EY5A 1GHKA 2B2VC 5K5PA 4QUFA 3AMUA 4DK0A 4KN7C 4EQOA 2A68D 3CKIB 2NWGA 1S5BD 2OEOA 2RQXA 4IFDH 4ZKCB 3KBXA 1TWGB 3S2DB 1LT6D 2A6HC 5LL6S 2EE1A 1UUPA 1VMPA 1DCZA 1RJTA 3QOLA 1D2BA 1JOKA 2KOLA 4DFAA 1FGBD 2DY7A 1ZKOA 1DJRD 1CHQD 1SNOA 2EYJA 4FF4A 3A7LA 3ND8A 1JWSD 2EY2A 2KA7A 3A8IE 3DUZA 2F0FA 1B1ZA 3PV0A 3E0JA 2BOSA 1IHZA 2H4OA 1AZQA 5LHY1 2PYKA 3KF8A 2A68C 3A55A 4X3TA 5E4XA 1CTMA 1EIHA 2M2LA 1Q12A 2E2DC 2B2WC 1CZGA 1SYCA 4IUPA 2JA8B 3HEJA 2BDNA 2I46A 1TS4A 1JB3A 1PFNA 4FF2A 2J0TD 3ONAB 4XTCS 2EYFA 1LTTD 3T13A 1PRTB 4XQNA 3K58A 1A3UA 1SNPA 3RLFA 3IL8A 3AB9A 4HR7B 1XWEA 2Z8LA 5KRUA 3K7AB 3D31A 2LY7A 3DHQA 1PFBA 4KV6A 2K28A 4KKUA 5KYLA 5C5MA 3GTQB 4BY7B 4IQZA 2KCCA 1LACA 1TT2A 4A3MB 5T1IA 5IT9L 3PIP3 2K33A 3QB3A 5EKIA 1ML0D 1PLFA 3PMFA 3KBGA 1F9RA 2B2UC 2N55A 3K6OA 1RODA 1LLRD 3GTGB 4A3GB 1UEAB 1I4RA 3MXUA 1V8QA 3C3LA 4ZAIA 4JK1C 2XNAC 4IUVA 5COYA 3NTIA 3D4RA 5BN5A 1SEBD 4H7BA 1AN8A 1SE2A 1STGA 2M9VA 4QCLA 1SJED 3MFYA 2NB0A 2JE6I 5C4XB 4F7XA 1PZKD 2NUCA 2LS01 2WACA 3HG9A 3C2PA 4FXDA 2F0LA 1PTOB 1QG7A 3NTHA 1R4PB 3X3MA 1TS5A 2F0WA 5JEAG 5I6YA 4QMGA 2B2YC 1A6XA 1SAPA 1ZXTA 2EJFC 3GTMB 3GD7A 1KLGD 3SEBA 2L12A 4FF3A 4V190 3GTKB 4KJOA 1Y8NB 1J9OA 3MEHA 3M4YA 1SYEA 1PRTD 2RA4A 3P75A 4DNTB 4N9PA 2NVYB 1ET9A 5CMDA 3HOWB 2G9DA 1DOLA 1BQQT 2NN6H 4C3JB 1EZ8A 2FHTA 3A8JE 5EPKA 4RKBA 3IFTA 1GJXA 1QNKA 4KHZA 1HUNA 4C3IB 2NVTB 4NDXA 4RWSC 1NUCA 1V1OA 2HUGA 4J1MA 3S17B 5FO8B 5CORA 1A3TA 2EXZA 4QUCA 3T16A 1NAPA 1YNND 3GTLB 1QJOA 2VXWA 4FO2A 2K7VA 4Y7NB 5KNDA 1H9MA 1OXXK 2CQAA 1IL8A 2F0IA 3GTJB 5G3LD 5C4HA 3M3YB 2BE5C 3TN2A 2PMZB 5KIXA 1D6EC 3TP6A 1A3VA 1HTPA 1GUTA 5DM73 3K5MA 1MI2A 4IURA 4HAEA 4NP5A 3VYUA 3WOFA 3MWYW 1IKMA 1Y1WB 5IGGA 3I91A 4OIKA 1B3AA 3UI2A 3VR3A 4ZQ3A 1KLUD 4OO1I 5DAUA 1S4ZA 3HRZC 4PMCA 3DEOA 3BS1A 3BVGA 1C8CA 1WCMB 2EVBA 4DAVA 1ZEQX 2F4IA 4L63B 3TP7A 3D4DA 3DXJC 4RH6A 4CGYB 2Q8IB 2FJ2A 3EROA 4QIWB 1LTGD 1T5EA 2JP1A 3I90A 4B9XA 1GUSA 2B2UA 2EYPA 4CKBA 5JEAJ 1G8ZD 2QDBA 2H1EA 1S5CD 1JQYD 4RGNA 3DMUA 2WV6D 2EYHA 3KUPA 3T56B 3I72A 4MN3A 4EGVA 2WB1B 1BF4A 2VNUD 3M4OB 2TSSA 2AQ1B 2XWBB 3SK8A 5AFWA 4K2KA 3DM1A 1STAA 4CJ0B 3K0YA 2L0CA 1FNWA 1FYCA 4G4KA 2QF7A 4IUNA 1XX8A 1STYA 1SE3A 1Z6HA 3ZYYX 1VMCA 4IN3A 1L0YB 4UAIA 2O2LD 1YNJC 3P7JA 3NE5B 1HQMC 1R9TB 3V96A 2B2TC 1LTBD 2R3ZA 1Q8IA 3S15B 1FR3A 3S1QB 3WDNA 1SE4A 1U4RA 4UDUC 5I6WA 1RTNA 1FD7D 1XXGA 1BO0A 4KD4A 4C1NI 3BG3A 1OXUA 3EFXD 1H9SB 4PQXA 1Q1EA 4Q5VA 1SSOA 2L9HA 3PO2B 3FKIB 4DF7A 1EY0A 2XIWA 1AP0A 3WOEA 4DK1A 4CBVA 1ILPA 1EY5A 3HOZB 3S14B 2MUYA 2AUKA 2AQ3B 2ZT9C 1M4VA 1PXUA 5ELFA 1GUNA 2NN6I 4RCNA 5D3DA 1SNMA 1Y8OB 3SHLA 5C3EB 5K36H 3M7GA 1Y69U 2RKSA 2O4XA 3TP8A 2QILA 4TKOB 2A5HA 4HMJA 3J7AV 3J7YW 4OO1H 3L7ZC 4BS9A 3SXHA 1W6JA 3QIAA 3O13A 1TY2A 3MTSA 5G3LF 3EQLC 4K8JA 5KNBA 2D9UA 1TWCB 4EQNA 1B50A 3KLSA 2VUMB 3V05A 2B63B 2F0HA 2R61A 1B44D 5M3FB 3FVQA 4X3UA 3H94A 2ENBA 1CZWA 4KKSA 3J81L 4XYQA 1PZID 1KAAA 1WTPA 2F0NA 1IKLA 1HRJA 5E3FA 1GUWA 2AUJD 4BA2I 3OW7A 1OXVA 1EWHA 1ICWA 4RHSA 2MHVA 5C44B 4HSPA 4U68A 3H91A 2AQ2B 2D2CC 2WIIB 1RD9D 4AYBB 5CGKA 4FF1A 3LX0A 1EZ6A 4S3SA 3KLSX 1O80A 1JCKB 2SNMA 1PRTF 2VB2X 2PW7A 4RGOS 3T4AC 2AWOA 1EY9A 4A3BB 4HSVA 2R6GA 1JOQA 5C5LA 1RDPD 3U9SA 3NSWA 1EQTA 2IW3A 5HGTA 5C0XJ 1WTQA 1AFPA 5JJZA 4CJ1B 1D1KA 2F1MA 5CBEE 4KTAA 2K5QA 1SJHD 1BCPF 4DXGA 5CBAE 4RHRA 4IFDG 3GV6A 3I8ZA 5NUCA 1LABA 1KDCA 2BE5D 4XDXA 4XYOA 1SDFA 1OO9B 3CRKC 1LV9A 2GA4B 1Y8PB 2OXPA 3MC0B 1D1IA 4ILWA 2ZXOA 2JA5B 4RAUC 3SK5A 5M5XB 4LJZC 1H9RA 2B2YA 3ERQA 1XYIA 4L6TB 5EQ0A 3W3AA 2KVMA 3RZDB 5IGEA 5DM63 3BVMA 1D5ZC 3GTOB 2IL8A 2E75C 3D8GA 2ZXPA 1G6ZA 5M3MB 2JEBI 1JWMD 1MSGA 2CHBD 2FFKB 1SNQA 4Q0FA 1ONLA 1I4XA 1CHPD 1GHJA 4M8AA 2NZ1D 3URYA 3HGBA 4G7OC 1O7ZA 4C2MB 5C6AA 4OGQC 4H13C 3VA5A 4XIGS 2A6ED 3I73A 5E1FA 4ZUIA 2F0QA 2D5DA 2F0DA 2F3WA 3NPPA 3MXGA 3HOUB 4QF4A 3RUZA 3MZ5A 2EZVA 4DAPA 3P20A 2C5CA 2B8GA 5F2DA 1MBYA 1QCBD 3HOXB 4NW2A 5A35A 2XN9C 4XT1B 3C46A 2XWJB 2PZWA 3AU7A 3TDQA 1SNDA 3FPUB 2O5JC 2OT2A 2CVRA 3NQTA 2NVXB 1E2WA 5C0XG 3OSOA 1TWFB 2YYZA 3J80E 1H9JA 4WORA 1EYCA 4XQJA 1NR2A 2E74C 1K83B 4OL7A 2YU9B 4RA8A 3NQIA 1BOSA 1DONA 1KTKA 5CYUA 3VR2A 4ZYSA 2HDMA 4ZUJA 1Q90A 4HN7A 4RKLA 3OWFA 2IWHA 5A2QL 3MVVA 4MIUA 1S5ED 3S1NB 4N9TA 1F9QA 2Z4HA 2A73B 1QE6A 1PRTC 2EDGA 3Q0AA 3TP5A 3QJYA 2L11A 1ENFA 1U4PA 5EKKA 3PUWA 1PZJD 4KHVA 2IT1A 4PV1C 1TU2B 2IX3A 2KQ3A 2L5TA 4KY6A 4JBWA 4OHJA 4RGMA 1BCPB 3GQBA 2IJ0A 2NVQB 5D65A 3HP3A 1BNZA 4CHTB 2ICEC 2K1BA 4IFDI 5I2XA 2K05A 4C3JG 5C3XA 2K04A 4NKLA 1EOTA 1SYFA 5EKLA 1A15A 1KNEA 1SNCA 1DM0B 2F0PA 4XT3B 3QG1A 1BXTA 2F0SA 4IUTA 2J4XA 1B2TA 1WTXA 1EY4A 4P2CB 1V1PA 5FO7B 1SYDA 4WRDA 2OF1A 1H9KA 5JAVA 3T53B 1TWHB 2KEDA 1HQRD 5FLXL 3C1EA 1JOOA 1RTOA 2EOTA 1MGSA 4HMIA 2MP1A 1X3PA 2JEAI 1KDBA 5J22A 4NMZA 2QCPX 5CV8A 1B9NA 2VB3X 1S5FD 4H44C 1F9SA 1U4MA 4K6DA 4RFBA 3V2TA 5M5YB 1MSHA 3A7AB 3QOJA 1PTOC 2M00A 1JORA 2EJGC 3CRLC 2PQEA 4C1NK 1S5DD 2SDFA 2RDHA 2Q8TA 3IAYA 4XXEA 1QOHA 2BCOA 2RBMA 2XRQD 1HFNA 4TQUS 4FXGC 1G2SA 1DOKA 2F0KA 3TZDA 4IUUA 1WTWA 2XSCA 4M1UB 1A2UA 1SFOB 3NWSA 5LL6X 2RSNA 2K5DA 2XVSA 2DY8A 4TSSA 3N6RA 4E6IA 1F2LA 4C3IG 2CW0C 4RCOA 5IGDA 1LTSD 3KLRA 2R7ZB 4O42A 5KEEA 3KK7A 2EYMA 2Z1CA 1I3QB 4A3DB 1VDZA 1CM9A 3R8BA 3GO5A 1RHPA 3PUZA 3RD4A 1JC7A 1K8MA 3PUVA 3HOVB 1F2MA 1Z47A 1ENAA 1O7YA 4F88A 2RDGA 1W6KA 5EJWA 3NBIA 1U9RA 2QKIC 1VCIA 3S1RB 3E5SA 2PW5A 4YIJA 5FKAC 2DNEA 2K5WA 4H0LC 1IYVA 1R4QB 2B2WA 1BCPD 3EVQA 5T1GA 1D5XC 2L4NA 1XTCD 3FPPA 4ZRZA 2NBFA 4BY1B 2TMPA 4HCEA 2A6HD 5EPLA 1I6HB 4QB4A 1PFMA 3MA2B 2FINB 4DN4M 1CK1A 1G291 1DXMA 2DNCA 1TIID 3NHHA 1AZPA 3QWNA 2FMCA 1KABA 3I3CA 2EYLA 5IGFA 1LT5D 3DWQA 2BDOA 4TRDA 3W2DA 2X6LA 3N52A 4A3IB 4ZK9B 1VF5C 2L55A 4G57A 1T5XD 3EJIA 4J8QA 4IUQA 1HTLD 3CU7A 3J81E 4PNYA 2SOBA 4EQPA 1IW7D 4ODGA 5DNFA 1BBXC 1O78A 3G6JB 1HPCA 3BDOA 4RGTA 2C9OA 1PMRA 3S1MB 4B08A 5JOBA 1B9MA 2NN6G 2NTTA 3SVMA 1DD2A 1EFID 3SR1A 5J1ZA 1G2TA 3J7AF 2EY1A 1PDQA 1OXSC 5JEAH 4V0BA 2KCNA 2N88A 1E2ZA 1E2VA 5CR3A 3A56A 3VR6A 5JVG3 1RCVD 4CJ2C 2B2VA 4K2LA 3MAQA 1PTOD 1ESFA 3FMCA 4FYDA 3MHBA 4BWGB 3G7LA 5D3IB 2PPBC 3I70A 4KK7A 1EU3A 5C0XI 3DWPA 5CC4A 1FNUA 3RMHA 5BN3A 5EGTA 1EU4A 4HTHA 2X69A 2MPMA 5FLXE 3Q24A 3H6MA 3S16B 3DEPA 2HCIA 3OHXC 3LWUA 1TQOA 3HZXA 1II3A 1UAPA 2ICIA 2ID0A 1WVLA 1EWCA 5CV5A 3L3OC 1ZYRD 1QWYA 5IGBA 1Q3LA 1SMYD 4MHEA 2IX1A 2F0GA 4ZKBB 5JVH3 2RDFA 2F0TA 2KJXA 2WP8J 3F2UA 1ZYRC 3T51B 4C56C 4KN4C 4DA2A 1V43A 1KNAA 5IGCA 2KHSA 4WFN3 3OIPA 2LFNA 1I4GA 1LO5D 3SDZA 2R93B 4HEDA 4F87A 4LAAA 4ME5A 5EPJA 4R8NA 4ABNA 1Y1VB 2PO4A 3K5NA 2RVLA 1SYBA 1JE4A 2JSOA 2Q8RE 2JXMB 1EIGA 3CHBD 2B39A 2HDLA 1V1PB 3NUCA 3BYTB 1ET6A 1CQVA 1ESRA 3I4NB 4IALA 1M8AA 1CFMA 1YNNC 1H9SA 4X3SA 3Q22A 1BDOA 1CT1D 3MFGA 1AW7A 4PMWA 4K14A 1G91A 3BYYB 2NYZD 1EY8A 4EVOA 1HA6A 3OIQA 1HCZA 2JA7B 3HKZB 1J8IA 3MXPA 5CV9A 3GP7A 3PUXA 5ELDA 5ELEA 4OO1G 2Z4IA 3NK9A 1CI3M 3R2TA 1CQFA 1LTAD 1TS3A 1VF7A 2KEEA 3J80L 1PYWD 1JICA 3A8KE 2E76C 5EBCA 2DN8A 1PTOH 4ID6A 4DXFA 3RZOB 2IPKD 1D5MC 2MJ8A 2PZTA 2F0MA 4FXKC 3H3VC 3S2HB 2RSOA 2SEBD 1EYAA 1QB5D 3TSSA 2IX0A 1STHA 2E2IB 3CQZB 1GUOA 3OWEB 4A3EB 4BBRB 2EYOA 1LTRD 5K36G 2KUMA 5DEHA 1EY6A 3TBIB 3PUYA 3E6ZX 1E0BA 1C4QA 1IYUA 1GOZA 5CV7A 3R3OA 4FVMA 2JA6B 3VR5A 1I4QA 2B2TA 3VA7A 1QNUA 4A3KB 5TSSA 3OMCA 5IODA 2WKCA 1BCPC 4LMQD 4LK1C 1EQVA 2D62A 2E2HB 4U673 1NCVA 4C3HG 3DWAA 4IFDJ 2XRSD 1PTOF 1TWAB 5ELBA 2F3VA 3D3RA 1LT3D 3K59A 4K5XA 1C48A 1F77A 1DOMA 1TR5A 4FNFA 2LMCB 4A3FB 3SK6A 1F9PA 1L0XB 1NR4A 4G7ZC 3L9AX 3BZDB 5FOBB 3K5OA 1EEID 2BA0A 4KY5A 1ENCA 1CA6A 3D6CA 1U4LA 3PO3B 2KECA 4FP5D 5I2YA 2SNSA 2WINB 2F0UA 2X6GA 3ITPA 1Z7TA 4Z9CB 1I4HA 5I9OA 1O7LA 2PNRC 4OIJA 5EBDA 1X32A 4I7ZC 1TKWB 4IZ8A 1I50B 3R2IA 3K5LA 3LWEA 1WTOA 4L8JA 3GV3A 2EPBA 4DAYA 1JR0D 2O5IC 1HFGA 1TY0A 3TZUA 1TVXA 2EY6A 4DNRB 2A69C 2R92B 2A74C 5KGUA 3Q6SA 3VR4A 1HA5A 2CW0D 5C4ZA 5ISRA 4PMBA 1BR9A 1WD0A 1SBBB 2A69D 4X3KA 1EYDA 3BVZA 3M7NA 5IT9E 5HURA 1STBA 3OMGA 5D14A 4A3JB 5CV6A 4DGZA 2HCCA 3NBHA 2LKVA 5JPMC 1HHVA 3R93A 3P1HA 1EEFD 2NTSA 2EJMA 3U9OA 3I4MB 5FO9B 3X3NA 2FMMA 2AWNA 1LT4D 3NWTA 5C3WA 1EL0A 3NXWA 2F0EA 1RF2D 1STNA 5FK9C 5M5WB 1A2TA 4B9WA 3S9WA 4J6HA 2Y0SB 1K8OA 5C4JB 1SYGA 3I4LA 1AEXA 3IKJA 1ILQA 5E4WC 4G7HC 4I65A 2V4DA 1GXDC 3IFDA 2QEJC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNO A;  2SNM A;  4B9X A;  1EY5 A;  1SYB A;  2HQE A;  2PZU A;  4N9T A;  2EYJ A;  2EYP A;  2PW7 A;  3D4W A;  2QDB A;  1EZ8 A;  3EVQ A;  5CV7 A;  1KDB A;  3R3O A;  4K2L A;  5J22 A;  4NMZ A;  2EY2 A;  5CV8 A;  3NUC A;  1JOR A;  1EY9 A;  4RKB A;  3MHB A;  3TP5 A;  2F0F A;  4KD3 A;  2F0J A;  1NSN S;  4IAL A;  1IHZ A;  3DMU A;  4K6D A;  4QB4 A;  2EY6 A;  3V2T A;  5C6A A;  5C5L A;  1SNM A;  1JOQ A;  4H7B A;  3SHL A;  2EYH A;  3VA5 A;  5IIF A;  2PYK A;  3OMC A;  4K5W A;  5EKK A;  5IOC A;  3QOJ A;  4NDX A;  5KGU A;  1F2Z A;  5IOD A;  1STG A;  1NUC A;  3NHH A;  5E1F A;  2RKS A;  4KHV A;  2F0Q A;  2M00 A;  4KY7 A;  1EY7 A;  4MIU A;  4J1M A;  4ZUI A;  5CC4 A;  1EQV A;  5J39 A;  5C4Z A;  2O4X A;  1A3T A;  2PQE A;  3BDC A;  4K14 A;  2KQ3 A;  4PMB A;  3TP8 A;  5HGT A;  2F0D A;  4HMJ A;  5ISR A;  5EGT A;  4KY6 A;  1KAB A;  2EXZ A;  4KJN A;  3SK8 A;  4HTH A;  1SYC A;  2F3W A;  4K2K A;  3SXH A;  4DU9 A;  5KYI A;  1EY8 A;  1STA A;  3HEJ A;  3T16 A;  2EYL A;  4EVO A;  1EYD A;  3H6M A;  2F0V A;  5IGF A;  4F7X A;  1STB A;  4QF4 A;  3RUZ A;  3MZ5 A;  5HUR A;  3OMG A;  4TRD A;  1F2Y A;  4KTA A;  2RBM A;  5CV6 A;  5M9O A;  2NUC A;  4K8I A;  4IUN A;  4DGZ A;  2WAC A;  2F3V A;  2F0I A;  5F2D A;  2LKV A;  3MXP A;  4K8J A;  2EYF A;  5CV9 A;  1TQO A;  3HZX A;  1II3 A;  4K5X A;  2F0L A;  2EY5 A;  2F0K A;  3T13 A;  5C4H A;  3NP8 A;  4G57 A;  5K5P A;  4EQN A;  5KIX A;  3NK9 A;  2PZW A;  3BDL A;  1A3V A;  3EJI A;  1TR5 A;  3P1H A;  3TP6 A;  1A2U A;  1A3U A;  1SND A;  1SNP A;  5NUC A;  2F0O A;  5CV5 A;  3U9O A;  1KDC A;  5C3X A;  4NKL A;  3SK6 A;  5CV4 A;  1SYF A;  5EKL A;  3SK4 A;  2F0H A;  4PNY A;  2SOB A;  5KRU A;  4K5V A;  4EQP A;  3NQT A;  4ODG A;  5IGB A;  4NP5 A;  4EQO A;  2F0W A;  1SNC A;  4E6I A;  5I6Y A;  2F0P A;  2OXP A;  2F0G A;  3OSO A;  5C3W A;  2OEO A;  3DHQ A;  3TME A;  5IGG A;  3NXW A;  2RDF A;  2ENB A;  2F0T A;  4ID6 A;  4QMG A;  5IGD A;  1RKN A;  2F0S A;  4WOR A;  4ZQ3 A;  5KEE A;  4KV6 A;  1EYC A;  5DAU A;  2PZT A;  3SK5 A;  2EYM A;  1KAA A;  2F0E A;  4KY5 A;  1ENC A;  2F0N A;  2F0M A;  5JOB A;  5IGC A;  2KHS A;  1EY4 A;  5KYL A;  1STN A;  3D6C A;  3ERQ A;  4PMC A;  1A2T A;  5C5M A;  4B9W A;  3S9W A;  4OL7 A;  1EYA A;  4KJO A;  5I6W A;  3SR1 A;  5E3F A;  5J1Z A;  1F2M A;  1SYD A;  2SNS A;  4J6H A;  4WRD A;  2OF1 A;  3MEH A;  5IGE A;  1STH A;  2F0U A;  1ENA A;  1SYE A;  2EY1 A;  4KD4 A;  5JAV A;  1SYG A;  3QOL A;  1TT2 A;  3ITP A;  1JOK A;  4LAA A;  3P75 A;  4ME5 A;  3TP7 A;  5I9O A;  3D4D A;  1U9R A;  3QB3 A;  1AEX A;  3C1E A;  3C1F A;  1JOO A;  4N9P A;  2EYO A;  5I9P A;  3D8G A;  4DFA A;  5CGK A;  4R8N A;  4I65 A;  3PMF A;  3LX0 A;  1EZ6 A;  3E5S A;  4S3S A;  4ZUJ A;  5DEH A;  4RKL A;  1EY6 A;  4F8M A;  3OWF A;  1EY0 A;  1KDA A;  4DF7 A;  4IZ8 A;  3ERO A;  5CR3 A;  3MVV A;  1STY A;  1SNQ A;  2PW5 A;  4HMI A;  4YIJ A; 
#chains in the Genus database with same CATH topology
 3SE0 A;  3E0E A;  1VQO A;  2HQE A;  4L5S A;  4KLK A;  3MXN A;  3D4W A;  2BA1 A;  3UDF A;  3J81 j;  3OTO L;  4GZY C;  3CXC A;  4HJ5 A;  2E2J B;  1ASY A;  3FKI H;  1KIX A;  4WJW A;  4KD3 A;  1WOC A;  2F0J A;  1XMQ Q;  2JYO A;  3HS0 C;  3FP9 A;  1WTV A;  2IHE A;  3KDF A;  3NTK A;  5IIF A;  3U50 C;  3FRP B;  1HR0 Q;  4LUO A;  5IOC A;  3G4S A;  1F2Z A;  1JWU D;  3LNN A;  4KY7 A;  4Y7N H;  1PH5 A;  4R8I A;  5IYC H;  4DR3 Q;  1B4O A;  1GUG A;  3M85 A;  3EA6 A;  1L1O C;  2KHI A;  3OOC A;  1NE3 A;  3FEW X;  4DV1 Q;  2R7Z H;  3K81 C;  4JC0 A;  2ALY B;  2ZXR A;  1HUM A;  2NVX H;  1I5F A;  3J80 i;  2LXJ A;  1EFW A;  2UUA Q;  3S17 H;  3GTP B;  1F2Y A;  1VQM A;  3HKZ G;  1C9O A;  5M9O A;  4K8I A;  2EXD A;  3H09 A;  4L5R C;  2B63 G;  4OX9 L;  1Q1B A;  1I6V C;  4KI0 A;  1B53 A;  4C3H B;  4O1N A;  4BA1 I;  1IW7 C;  3PIO 3;  3ULP A;  1QIL A;  2PCF B;  1BVS A;  1BUV T;  3NP8 A;  2MO0 A;  4IPH A;  1OXT A;  4BBS G;  4XQQ A;  4MTN A;  2UUB L;  3BDL A;  3KF6 A;  3GTQ H;  2CWP A;  1TS2 A;  2F0O A;  4ULL A;  3JAM L;  1DZ1 A;  4B3S L;  3EIV A;  1XMQ L;  5CV4 A;  3SK4 A;  4DAM A;  4K5V A;  1HZC A;  4X65 Q;  3GTO H;  3VYR A;  3OPO A;  4HJ9 A;  1WD1 A;  5IYD G;  4DV0 Q;  3TME A;  2P5Z X;  3QO2 A;  4A3J H;  3FDT A;  2YTY A;  1RKN A;  1PH3 A;  5BN4 A;  1Y14 B;  3LGJ A;  1STE A;  1I4P A;  4CKC A;  1LTI D;  1E1T A;  1YNJ D;  2WAQ B;  3Q23 A;  4CDC C;  1QZH A;  3CW2 C;  3ND9 A;  1K28 A;  1MD2 D;  3I4M H;  1DGS A;  5IP9 G;  1KQS A;  5KNC A;  5A2Q E;  2I07 B;  4DKA C;  4ZLT F;  3C1F A;  4C2M H;  5I9P A;  4HCS A;  4CKE A;  5C44 G;  2GVB A;  4JCV E;  1CA5 A;  2KCM A;  3HOY B;  4F8M A;  1KDA A;  4KMU C;  1K73 C;  3H0G H;  1UNS A;  1XMO Q;  5ELC A;  5FJ8 G;  2F03 A;  4A93 H;  2PZU A;  1SXT A;  2YU9 H;  1XTD A;  1UWV A;  2A6E C;  3A54 A;  1XPU A;  3KLW A;  2CQO A;  1VQ6 A;  4BBS B;  1JJ2 A;  1DYQ A;  4A75 A;  1WTR A;  2K03 A;  2L1B A;  4KHP Q;  4JBM A;  1TWH H;  4PZ6 A;  2G9H D;  1NSN S;  1CKN A;  4IO9 A;  5FJ8 H;  4K5W A;  3CME A;  1VQ7 A;  2AMC B;  2R7F A;  3H0G B;  2J7Z A;  2K6A A;  3VYT A;  1PYB A;  1HNW Q;  2K01 A;  2K32 A;  5I4D A;  1EY7 A;  4R9W A;  5J39 A;  3D6W A;  3BDC A;  4A93 B;  1SMY C;  4NXM L;  1SRU A;  4KJN A;  4KKT A;  3JAM E;  3UE0 A;  2B8F A;  2WKD A;  4DU9 A;  5KYI A;  3KDF B;  2F52 A;  2MGS A;  1VQ4 A;  4RMF A;  3VYS A;  2F0V A;  3CD6 A;  1UE7 A;  4GS3 A;  1X3Q A;  3K57 A;  2A19 A;  2Z0S A;  1HXY D;  1FNV A;  2JA8 G;  5JPN C;  1SE8 A;  5C0X H;  4K6L A;  2EY5 A;  1GHK A;  2B2V C;  5K5P A;  2MQH A;  4QUF A;  3AMU A;  4DK0 A;  1PH2 A;  1T9H A;  4KN7 C;  4EQO A;  2A68 D;  3CKI B;  2NWG A;  1S5B D;  2OEO A;  4GNX C;  1VQB A;  2RQX A;  1PHJ A;  4IFD H;  4ZKC B;  3KBX A;  1K0S A;  1TWG B;  1Q86 C;  3S2D B;  1LT6 D;  1SLJ A;  2A6H C;  1VQC A;  2F4V L;  5LL6 S;  4LF4 L;  2EE1 A;  2JA5 H;  1X3E A;  1UUP A;  1VMP A;  4UY8 C;  1DCZ A;  1RJT A;  3QOL A;  1D2B A;  1JOK A;  2KOL A;  4AQY Q;  4OEM B;  3DM3 A;  4DFA A;  4DR5 L;  2UXC Q;  1HNZ Q;  1FGB D;  2DY7 A;  1VQ9 A;  1ZKO A;  1DJR D;  1CHQ D;  3TEH B;  5LMN Q;  4DV7 Q;  1SNO A;  4JI2 Q;  5E7N A;  2UU9 L;  1HNX L;  3I55 A;  2EYJ A;  4FF4 A;  3A7L A;  3ND8 A;  1JWS D;  2EY2 A;  2KA7 A;  3A8I E;  4YWM A;  3DUZ A;  2F0F A;  1B1Z A;  3PV0 A;  3E0J A;  4RG1 A;  4LFC Q;  2BOS A;  1VQD A;  1IHZ A;  2H4O A;  4GN3 B;  1AZQ A;  5LHY 1;  2PYK A;  1AE3 A;  3KF8 A;  4LFC L;  2ZJQ A;  2A68 C;  3F2B A;  1E1O A;  3A55 A;  4X3T A;  5E4X A;  1HH2 P;  4A3F G;  1CTM A;  1EIH A;  2M2L A;  1Q12 A;  2E2D C;  2B2W C;  1CZG A;  1SYC A;  4IUP A;  2JA8 B;  4JI2 L;  3HEJ A;  2BDN A;  1IBK L;  2I46 A;  1TS4 A;  1JB3 A;  4JVZ A;  1PFN A;  4FF2 A;  4P75 A;  2J0T D;  3ONA B;  3S14 H;  4XTC S;  2K5V A;  2EYF A;  1LTT D;  3T13 A;  1PRT B;  4XQN A;  3K58 A;  1XPR A;  2AHO B;  1XNQ Q;  1A3U A;  1SNP A;  3RLF A;  3A5Z B;  3IL8 A;  3AB9 A;  2UXB L;  1I94 L;  2R92 G;  4HR7 B;  1M90 C;  3TS2 A;  1G6P A;  1XWE A;  2Z8L A;  5KRU A;  3PF5 A;  3K7A B;  3I4N G;  3D31 A;  2C35 B;  2LY7 A;  2RCN A;  3DHQ A;  4HIO A;  1Q7Y C;  1PFB A;  4KV6 A;  2B63 H;  4YCU A;  4YWK A;  1N32 L;  2K28 A;  4KKU A;  1WCM G;  1VS0 A;  5KYL A;  5C5M A;  4JI6 L;  3GTQ B;  4BY7 B;  4IQZ A;  4JBK A;  1L0W A;  2KCC A;  2A8V A;  1S40 A;  4HJA A;  1LAC A;  1VQF A;  1TT2 A;  3KF8 B;  4A3M B;  5T1I A;  1NJI C;  1TWF H;  5IT9 L;  2K33 A;  3QB3 A;  3PIP 3;  1N32 Q;  5EKI A;  1ML0 D;  1CKM A;  1PLF A;  2K4K A;  3PMF A;  3KBG A;  1F9R A;  2B2U C;  2N55 A;  3K6O A;  1ROD A;  1LLR D;  3GTG B;  4A3G B;  1UEA B;  1I4R A;  5LMU L;  1EIY B;  2D0O A;  5GQO A;  3MXU A;  1V8Q A;  2K75 A;  5IYC G;  4ZAI A;  3C3L A;  4JK1 C;  2XNA C;  4IUV A;  4IPC A;  5COY A;  3NTI A;  3D4R A;  5BN5 A;  1YHA A;  1SEB D;  5FLX c;  4X64 Q;  2VZA A;  4H7B A;  1AN8 A;  3JC6 6;  1SE2 A;  1STG A;  2M9V A;  4QCL A;  1SJE D;  3M3Y H;  3MFY A;  4LFB L;  2NB0 A;  1RL2 A;  4DV4 Q;  4R4O A;  2JE6 I;  5C4X B;  4YCW A;  4F7X A;  3STB D;  3CCL A;  2IHF A;  1PZK D;  2NUC A;  2LS0 1;  2WAC A;  3HG9 A;  2OTL A;  3C2P A;  4FXD A;  2F0L A;  5IWA Q;  3E9H A;  3OYY A;  2K5N A;  4KHP L;  1PTO B;  1QG7 A;  3NTH A;  3H3V H;  1R4P B;  3CCJ A;  3EBE A;  3PO2 H;  4LF7 Q;  3X3M A;  1TS5 A;  2F0W A;  5JEA G;  3CCR A;  4DV7 L;  5I6Y A;  4QMG A;  1KRS A;  4JI1 L;  2B2Y C;  1A6X A;  2E2J H;  1K8A C;  3RZD H;  1SAP A;  1ZXT A;  4DV5 Q;  2HT1 A;  2EJF C;  2HIV A;  5C4J H;  3GTM B;  3GD7 A;  1KLG D;  3SEB A;  2L12 A;  4FF3 A;  4V19 0;  3GTK B;  1CKO A;  4L5Q A;  1XNR L;  3PSI A;  4KJO A;  1Y8N B;  1J9O A;  1LYL A;  3D0F A;  3CCQ A;  5JJL A;  1S72 A;  3MEH A;  3M4Y A;  2F4V Q;  1SYE A;  1PRT D;  2RA4 A;  3H3V I;  1BBU A;  3P75 A;  4DNT B;  4N9P A;  4DR7 Q;  2NVY B;  1ET9 A;  5CMD A;  4LF6 L;  2UUA L;  1X56 A;  3HOW B;  2G9D A;  1DOL A;  1NY4 A;  1BQQ T;  2NN6 H;  4C3J B;  1YI2 A;  1JE5 A;  3HOV H;  1EZ8 A;  2FHT A;  3A8J E;  3HFZ B;  4DR3 L;  5M5X H;  2JA5 G;  3E3X A;  1CSP A;  3Q8D A;  4RKB A;  5EPK A;  3IFT A;  2UUB Q;  1GJX A;  4LW1 A;  1QNK A;  4KHZ A;  2NZH A;  1HUN A;  4C3I B;  2NVT B;  4ZCK A;  4NDX A;  2JA7 G;  4RWS C;  1NUC A;  1V1O A;  2HUG A;  4J1M A;  3S17 B;  5FO8 B;  5COR A;  1A3T A;  2VUM H;  4HIM A;  2WFW A;  3VDY A;  4X6A H;  2EXZ A;  4QUC A;  2I0Q A;  3T16 A;  1QVC A;  1NAP A;  1YNN D;  1VQ8 A;  3GTL B;  1QJO A;  2VXW A;  4FO2 A;  2K7V A;  4Y7N B;  5KND A;  1H9M A;  1OXX K;  2DJG C;  3FHW A;  3ER0 A;  2CQA A;  1IL8 A;  2F0I A;  4DV3 L;  3BU2 A;  3GTJ B;  5G3L D;  5C4H A;  2HIX A;  3M3Y B;  2BE5 C;  4P71 A;  2PMZ B;  3TN2 A;  5KIX A;  1K3B C;  1D6E C;  3TP6 A;  1A3V A;  1HTP A;  1VQN A;  2I5H A;  1GUT A;  5DM7 3;  3K5M A;  1MI2 A;  3CCV A;  4A3G G;  4IUR A;  1SR3 A;  3CP0 A;  4HAE A;  5IE8 A;  3GTL H;  4NP5 A;  1LTL A;  3VYU A;  3WOF A;  3MWY W;  2VW9 A;  1IKM A;  4X66 L;  1EQQ A;  1Y1W B;  3HOY G;  5IGG A;  3I91 A;  4OIK A;  1B3A A;  2K5H A;  3UI2 A;  3VR3 A;  4ZQ3 A;  1KLU D;  4OO1 I;  5DAU A;  4DNI A;  1V1Q A;  4A3M G;  2YV5 A;  1S4Z A;  1VQG A;  3M4Q A;  3HRZ C;  1I50 H;  4PMC A;  3DEO A;  1U0L A;  2Q2T A;  3BS1 A;  3HOY H;  1G51 A;  3BVG A;  1C8C A;  2R92 H;  1WCM B;  2EVB A;  4DAV A;  2GN5 A;  1ZEQ X;  2F4I A;  4L63 B;  3TP7 A;  3I4N H;  3D4D A;  4CDE C;  3DXJ C;  4A3K H;  4RH6 A;  4CGY B;  2Q8I B;  2FJ2 A;  1BBW A;  4A3B H;  4OON A;  3ERO A;  1X55 A;  4JG2 A;  4QIW B;  1LTG D;  1T5E A;  2JP1 A;  3I90 A;  3TRZ A;  4B9X A;  1GUS A;  2B2U A;  2EYP A;  4CKB A;  5JEA J;  1G8Z D;  2QDB A;  1B3Q A;  2H1E A;  4LF8 L;  3HKZ E;  3CCS A;  3F1Z A;  1S5C D;  1JQY D;  3JAM c;  4RGN A;  1PYS B;  4POG A;  3DMU A;  2WV6 D;  1IZ6 A;  2EYH A;  3KUP A;  1J6Q A;  3T56 B;  3I72 A;  4MN3 A;  4EGV A;  2WB1 B;  1VQE A;  1BF4 A;  2VNU D;  3M4O B;  2TSS A;  4QQB X;  1WFQ A;  2AQ1 B;  5FLM H;  1PV4 A;  2XWB B;  2RCF A;  2WB1 G;  1Q8K A;  3SK8 A;  5AFW A;  5IYB H;  4K2K A;  3DM1 A;  1STA A;  4CJ0 B;  3K0Y A;  2L0C A;  4JI8 Q;  2K52 A;  1FNW A;  3T1H L;  3F8T A;  3I56 A;  1FYC A;  4G4K A;  3CPW A;  4DK3 C;  2QF7 A;  4IUN A;  1XX8 A;  1STY A;  4B3R L;  1SE3 A;  1Z6H A;  3ZYY X;  1VMC A;  1VQK A;  4IN3 A;  1L0Y B;  4UAI A;  2O2L D;  2YTV A;  4JI0 L;  1YNJ C;  4K0K Q;  3P7J A;  3NE5 B;  1UE1 A;  1HQM C;  1JJC B;  1R9T B;  3V96 A;  2B2T C;  1LTB D;  3U4Z A;  2EQS A;  4POF A;  2R3Z A;  2QEX A;  1Q8I A;  4BBR H;  2VQF Q;  3S15 B;  1FR3 A;  3S1Q B;  3WDN A;  1SE4 A;  5C4X H;  1PFS A;  1Y1V H;  1U4R A;  1HZA A;  2ZTC A;  2Q2I A;  3CMA A;  4UDU C;  1B70 B;  5I6W A;  1RTN A;  1FD7 D;  1XXG A;  1BO0 A;  5M3M G;  1YNX A;  4KD4 A;  4BBR G;  4C1N I;  3IRB A;  3BG3 A;  1OXU A;  3EFX D;  1H9S B;  4PQX A;  1Q1E A;  3UDX A;  1VQI A;  4BY1 G;  4Q5V A;  1SSO A;  2L9H A;  3PO2 B;  4DV4 L;  3FKI B;  4DF7 A;  1EY0 A;  5BR8 L;  4LFB Q;  2XIW A;  1QVF A;  1AP0 A;  3WOE A;  3PQI A;  4DK1 A;  3M4P A;  4CBV A;  1ILP A;  1EY5 A;  3HOZ B;  2XTI A;  4JV5 L;  3UDG A;  3S14 B;  2MUY A;  4MTK A;  3S1M H;  4X64 L;  2ZTE A;  2AUK A;  3GTM H;  2AQ3 B;  2ZT9 C;  1JB7 A;  1M4V A;  1PXU A;  4AIM A;  2R7Z G;  4R1J A;  5ELF A;  1GUN A;  2NN6 I;  4RCN A;  4A3E H;  1MJE A;  5D3D A;  1SNM A;  2OQK A;  1Y8O B;  3SHL A;  2GVA A;  4MNO A;  5C3E B;  5K36 H;  3PO3 G;  2B3G A;  3M7G A;  4JI7 Q;  1Y69 U;  2RKS A;  2N49 A;  2O4X A;  3TP8 A;  2QIL A;  4TKO B;  2A5H A;  4HMJ A;  5HGQ A;  1C7Y A;  4DUY Q;  4DR2 Q;  3J7Y W;  3J7A V;  4OO1 H;  4UP9 A;  3L7Z C;  4BS9 A;  3SXH A;  2R7D A;  1W6J A;  3QIA A;  5GAD C;  3O13 A;  1TY2 A;  2PQA A;  1X65 A;  3MTS A;  5G3L F;  3OW2 A;  2I5M X;  3CF5 A;  3EQL C;  4K8J A;  1NTG A;  4HIK A;  5KNB A;  2D9U A;  1TWC B;  4EQN A;  1UE6 A;  1B50 A;  2VQE L;  3F2C A;  3KLS A;  2VUM B;  4P74 A;  3V05 A;  2B63 B;  2F0H A;  2R61 A;  2OCE A;  1FJG L;  3PGZ A;  4AYB E;  1PVO A;  1B44 D;  1UE5 A;  5M3F B;  3FVQ A;  4X3U A;  3H94 A;  2ENB A;  1CZW A;  4KKS A;  3J81 L;  4XYQ A;  2UXB Q;  1PZI D;  2JA8 H;  3RNU A;  1QUQ B;  1KAA A;  1WTP A;  1Q46 A;  4ME3 A;  2G5D A;  5EAY A;  2F0N A;  1IKL A;  3KYH C;  3K0X A;  2WAQ E;  2H5X A;  1HRJ A;  3TS0 A;  5E3F A;  1GUW A;  2AUJ D;  3J80 c;  1HZ9 A;  4BA2 I;  3OW7 A;  1OXV A;  1EWH A;  1ICW A;  4RHS A;  2MHV A;  5C44 B;  2RHS B;  4HSP A;  4X62 L;  1Y1W H;  4U68 A;  4TVA B;  3H91 A;  2AQ2 B;  2D2C C;  2WII B;  1RD9 D;  4AYB B;  5CGK A;  4FF1 A;  3LX0 A;  1EZ6 A;  4O0A A;  4S3S A;  3KLS X;  1O80 A;  2VL6 A;  4A3M H;  1JCK B;  2SNM A;  1GO3 E;  1PRT F;  3HOW G;  2VB2 X;  2CH4 A;  2PW7 A;  4RGO S;  3T4A C;  2BH8 A;  4A3I H;  2AWO A;  1EY9 A;  3L0O A;  4IJH A;  1N36 L;  2E2I H;  4A3B B;  3ICE A;  3GTP H;  4HSV A;  2JA9 A;  2R6G A;  4BY7 H;  1JOQ A;  5C5L A;  1RDP D;  3U9S A;  4YHH L;  1X9N A;  4OWT B;  3NSW A;  3AQQ A;  1EQT A;  1HNX Q;  4GKJ Q;  1JJG A;  2E5L Q;  2PQA B;  4DPG A;  2IW3 A;  5HGT A;  5C0X J;  4DUZ Q;  1WTQ A;  2OTJ A;  5JJI A;  1AFP A;  4DR5 Q;  5JJZ A;  3BJU A;  3W5O A;  4AQY L;  4CJ1 B;  1D1K A;  3RLO A;  4B3T Q;  2F1M A;  5CBE E;  4KTA A;  3A5U A;  2K5Q A;  1KXL A;  4EQ5 A;  1SJH D;  1WYD A;  4LF4 Q;  4QIW E;  1BCP F;  4DXG A;  4X66 Q;  5CBA E;  4RHR A;  4JI3 Q;  4IFD G;  3STB C;  4ALP A;  5IT9 c;  3GV6 A;  4L5T A;  3I8Z A;  5NUC A;  1LAB A;  1KDC A;  1P16 A;  2BE5 D;  4XDX A;  4XYO A;  5LMN W;  1SDF A;  1OO9 B;  3CRK C;  1YJN A;  1LV9 A;  2GA4 B;  1Y8P B;  1N34 Q;  2OXP A;  3MC0 B;  1E24 A;  1D1I A;  4ILW A;  2ZXO A;  4IPG A;  4JOI A;  2JA5 B;  4RAU C;  1R9T H;  3SK5 A;  5M5X B;  4LJZ C;  1H9R A;  2B2Y A;  2ES2 A;  3ERQ A;  1XYI A;  4L6T B;  3F2D A;  5EQ0 A;  1YHB A;  3W3A A;  3FKI G;  4LUZ A;  4C3I H;  4B3M Q;  2KVM A;  3RZD B;  5IGE A;  2QA4 A;  5DM6 3;  3BVM A;  1D5Z C;  3GTO B;  2IL8 A;  4LF9 Q;  1CKN B;  3CPF A;  2E75 C;  3BZC A;  4DV6 L;  3D8G A;  2PMZ E;  3RZO H;  2ZXP A;  1G6Z A;  5M3M B;  2JEB I;  1JWM D;  1MSG A;  2CHB D;  2N8N A;  2FFK B;  1SNQ A;  1ONL A;  1I4X A;  4Q0F A;  1CHP D;  1GHJ A;  1CSQ A;  4PZ7 A;  4M8A A;  1E22 A;  2NZ1 D;  2RHQ B;  3URY A;  1WTH A;  1N8R C;  3HGB A;  4G7O C;  1O7Z A;  4C2M B;  5C6A A;  4OGQ C;  4H13 C;  3VA5 A;  4XIG S;  2A6E D;  3I73 A;  4UPA A;  3K80 C;  3CQZ H;  4I7A A;  1EOV A;  4OWW B;  5E1F A;  4ZUI A;  2F0Q A;  2I5L X;  2D5D A;  1IL2 A;  1MIU A;  2Q2H A;  2F0D A;  3S24 A;  1N33 Q;  2F3W A;  3NPP A;  3MXG A;  3HOU B;  4QF4 A;  3RUZ A;  3MZ5 A;  2EZV A;  4DAP A;  1JMC A;  3P20 A;  2C5C A;  2B8G A;  3G71 A;  1O7I A;  5F2D A;  1MBY A;  1QCB D;  3HOX B;  4NW2 A;  2BH2 A;  5A35 A;  2XN9 C;  3T1Y L;  4XT1 B;  4DR1 Q;  4P73 A;  3C46 A;  2XWJ B;  2PZW A;  4LF7 L;  1K83 H;  3AU7 A;  3TDQ A;  1SND A;  3FPU B;  3HOX G;  2O5J C;  2OT2 A;  2CH4 W;  2WB1 E;  2KHJ A;  2CVR A;  3NQT A;  4JPB W;  5IP9 H;  2NVX B;  1E2W A;  5C0X G;  3OSO A;  1TWF B;  4JI5 Q;  2YYZ A;  3J80 E;  1H9J A;  4WOR A;  4GN4 B;  4QY7 A;  1LM0 A;  4B3S Q;  1N33 L;  1EYC A;  3HOX H;  4XQJ A;  1NR2 A;  1Q82 C;  3CC4 A;  5IP7 G;  2Q2U A;  2E74 C;  1K83 B;  2QGQ A;  4UHV A;  4OL7 A;  2MFI A;  2YU9 B;  1L1O B;  4RA8 A;  3I4O A;  3NQI A;  1BOS A;  4JOI C;  1PH9 A;  4LFA Q;  3BZK A;  4EX5 A;  4YY3 L;  1DON A;  1KTK A;  5CYU A;  3CCE A;  3PIO A;  2RF4 A;  3VR2 A;  5IYD H;  4ZYS A;  2HDM A;  1VQH A;  4DV1 L;  4ZUJ A;  1Q90 A;  4HN7 A;  4RKL A;  3U58 A;  3OWF A;  1IBL L;  2IWH A;  5A2Q L;  3MVV A;  2UXD L;  4MIU A;  1S5E D;  3S1N B;  4N9T A;  1F9Q A;  2Z4H A;  2A73 B;  1HR0 L;  1QE6 A;  1PRT C;  1SMX A;  2EDG A;  3Q0A A;  3TP5 A;  4CDD C;  3QJY A;  1B7Y B;  2L11 A;  5M3F G;  4N8X 1;  1AH9 A;  1ENF A;  1U4P A;  3ERS X;  4B3M L;  5EKK A;  1CUK A;  3PUW A;  3RN2 A;  5AJ3 L;  1PZJ D;  4KHV A;  4LF5 L;  1MHW C;  2IT1 A;  4PV1 C;  1TU2 B;  4DR4 L;  2IX3 A;  2KQ3 A;  2L5T A;  4KY6 A;  4JBW A;  4OHJ A;  4RGM A;  1BCP B;  3GQB A;  2IJ0 A;  3K7A H;  2NVQ B;  5D65 A;  4H02 A;  4HJ7 A;  3HP3 A;  1BNZ A;  1M1K C;  1LUZ A;  2ZJP A;  4DUY L;  4DR2 L;  2NZO A;  4APV A;  4CHT B;  4DUZ L;  1L1O A;  2ICE C;  2L15 A;  2K1B A;  4IFD I;  5I2X A;  2F3I A;  2K05 A;  4C3J G;  1IXR A;  3ULJ A;  5C3X A;  5C3E G;  2K04 A;  4NKL A;  1EOT A;  3S1Q H;  4IJL A;  1SYF A;  5EKL A;  1A15 A;  1YVC A;  3MEF A;  1KNE A;  1TXY A;  4R4Q A;  1SNC A;  1DM0 B;  2F0P A;  1L2F A;  4XT3 B;  4GKK Q;  3QG1 A;  3NEN A;  2NVY H;  1BXT A;  2F0S A;  4IUT A;  2J4X A;  1B2T A;  3RR5 A;  2A1A A;  1WTX A;  3J81 c;  1EY4 A;  4P2C B;  3H0G G;  1V1P A;  5FO7 B;  4A3D G;  1VQL A;  2UUC Q;  1SYD A;  4YHH Q;  2KCT A;  4WRD A;  2OF1 A;  1H9K A;  3KJP A;  3HOW H;  5JAV A;  3T53 B;  1TWH B;  2KED A;  1HQR D;  3AFP A;  4N8F A;  5FLX L;  3C1E A;  1X6O A;  1JOO A;  5ELO A;  1RTO A;  2EOT A;  1PH4 A;  1YZ6 A;  4JI4 Q;  1MGS A;  1I3Q H;  4NPS A;  4A3D H;  4LNQ A;  4HMI A;  2MP1 A;  1X3P A;  1HR0 W;  2JEA I;  1HZB A;  1TWA H;  1KDB A;  5J22 A;  2VQF L;  2WAQ G;  4NMZ A;  2NVT H;  2QCP X;  5CV8 A;  1B9N A;  3A74 A;  5LMN L;  2VB3 X;  1C0A A;  4JW0 A;  1S5F D;  4H44 C;  1F9S A;  1U4M A;  4K6D A;  1J5E Q;  4RFB A;  3V2T A;  5M5Y B;  1MSH A;  3A7A B;  1H95 A;  4JI0 Q;  3QOJ A;  1PTO C;  2M00 A;  1K9M C;  1JOR A;  2EJG C;  3CRL C;  2PQE A;  4C1N K;  1S3O A;  1SN8 A;  1U5K A;  1S5D D;  3I2Z A;  2ZM6 Q;  2SDF A;  2RDH A;  2Q8T A;  1Q81 C;  3IAY A;  4XXE A;  4JI4 L;  3HKS A;  1QOH A;  2LSS A;  2BCO A;  2DGY A;  2RBM A;  4GOP A;  2XRQ D;  2E8G A;  4BXX H;  1HFN A;  3W1B A;  4TQU S;  4FXG C;  4J15 A;  1G2S A;  1DOK A;  1WCM H;  2F0K A;  1J5E L;  3HOU H;  3UDI A;  3TZD A;  2CKZ B;  4IUU A;  1WTW A;  2XSC A;  4M1U B;  3TQY A;  5FLM G;  1A2U A;  1SFO B;  3NWS A;  5LL6 X;  4IOC A;  2RSN A;  1D8L A;  4GNX B;  2K5D A;  2XVS A;  2DY8 A;  4TSS A;  1GVP A;  3N6R A;  2Z6K C;  1F2L A;  4E6I A;  4C3I G;  2CW0 C;  4RCO A;  5IGD A;  3U4V A;  4LF8 Q;  1LTS D;  3KLR A;  2R7Z B;  4O42 A;  1JT8 A;  5KEE A;  3KK7 A;  4JV5 Q;  1XPO A;  2EYM A;  2Z1C A;  5ELN A;  1I3Q B;  4A3D B;  1VDZ A;  1CM9 A;  4A3C G;  1EWI A;  3R8B A;  3GO5 A;  1RHP A;  3PUZ A;  4UP8 A;  3RD4 A;  1JC7 A;  1K8M A;  3PUV A;  3HOV B;  1NNX A;  4QL5 A;  1F2M A;  1GM5 A;  1Z47 A;  1ENA A;  1O7Y A;  4F88 A;  1X54 A;  1HNW L;  2RDG A;  1W6K A;  5EJW A;  1X3F A;  3NBI A;  4PZ8 A;  1U9R A;  2QKI C;  2LXK A;  1VCI A;  3S1R B;  2JJQ A;  3E5S A;  3PF4 A;  5C4X G;  2PW5 A;  4YIJ A;  5FKA C;  5IP7 H;  4OXP A;  2DNE A;  2K5W A;  4H0L C;  1IYV A;  1R4Q B;  4GLA C;  2B2W A;  1BCP D;  3EVQ A;  5T1G A;  4JYA Q;  1D5X C;  2L4N A;  1XTC D;  1A8V A;  3FPP A;  4ZRZ A;  2NBF A;  4BY1 B;  5AJ3 Q;  2TMP A;  4HCE A;  1XMO L;  2A6H D;  5EPL A;  1I6H B;  3S1N H;  4QB4 A;  1PFM A;  1UEB A;  3MA2 B;  2FIN B;  2Y0S G;  4DN4 M;  1CK1 A;  1G29 1;  1DXM A;  1X3G A;  2DNC A;  1PH6 A;  1VQ5 A;  4BBS H;  1TII D;  2KEN A;  3NHH A;  1AZP A;  3QWN A;  2FMC A;  3KJO A;  1VQA A;  1KAB A;  3I3C A;  2EYL A;  2UXD Q;  5IGF A;  1LT5 D;  3DWQ A;  4DR4 Q;  1I6H H;  2ATW A;  2BDO A;  4TRD A;  3W2D A;  3AFQ A;  1NMF A;  2X6L A;  3N52 A;  4DR6 L;  4A3I B;  1N9W A;  4ZK9 B;  1VF5 C;  2B29 A;  2L55 A;  4DV0 L;  4K0K L;  1HJP A;  2ZJR A;  4LFA L;  3G48 A;  4G57 A;  1T5X D;  4X65 L;  2N78 A;  3EJI A;  4IPD A;  3GTK H;  4OWX B;  4J8Q A;  1A63 A;  4IUQ A;  1HTL D;  3DLL A;  3CU7 A;  3J81 E;  4B3R Q;  4PNY A;  2SOB A;  4EQP A;  1IW7 D;  4ODG A;  5DNF A;  4IOA A;  1BBX C;  1O78 A;  3G6J B;  1HPC A;  5M5W H;  3BDO A;  4RGT A;  4JI8 L;  3QR8 A;  2C9O A;  1PMR A;  3S1M B;  2PI2 E;  4B08 A;  5JOB A;  3TRE A;  1FVI A;  1B9M A;  2NN6 G;  3GTG H;  4A3G H;  4YY3 Q;  2NTT A;  4PG3 A;  3SVM A;  1DD2 A;  3MXN B;  1EFI D;  4C3J H;  1SFO H;  3SR1 A;  2DUD A;  2XGT A;  5J1Z A;  1G2T A;  2MNA A;  2PI2 A;  5C3E H;  3J7A F;  3PO2 G;  2EY1 A;  1PDQ A;  4GNX A;  1OXS C;  5JEA H;  4V0B A;  3KFU A;  2KCN A;  2N88 A;  1ASZ A;  4NB3 A;  4UP7 A;  1E2Z A;  1E2V A;  3A56 A;  5CR3 A;  4JI5 L;  2D0P A;  3VR6 A;  5JVG 3;  1RCV D;  1GKH A;  4CJ2 C;  2B2V A;  4K2L A;  3MAQ A;  1PTO D;  1ESF A;  3FMC A;  4C3H H;  3H15 A;  4FYD A;  3MHB A;  4BWG B;  3S2D H;  3S16 H;  1QZG A;  3G7L A;  5D3I B;  2PPB C;  3I70 A;  3T1Y Q;  4JBJ A;  4KK7 A;  3S1R H;  1EU3 A;  1YIJ A;  5C0X I;  3PIP A;  3DWP A;  1TWC H;  5CC4 A;  4DV2 L;  1FNU A;  1P8L A;  3RMH A;  5BN3 A;  5GAG C;  3ULL A;  5EGT A;  4A93 G;  1EU4 A;  1A62 A;  4HTH A;  2X69 A;  4A3I G;  2MPM A;  5FLX E;  3E9I A;  3Q24 A;  3H6M A;  3S16 B;  4LF5 Q;  3DEP A;  5M5Y H;  4GN5 A;  2HCI A;  3OHX C;  4AH6 A;  1YBY A;  4A3F H;  3LWU A;  3HZX A;  1TQO A;  1II3 A;  1UAP A;  1PH1 A;  2ICI A;  2ID0 A;  2PNH A;  4GLV B;  1WVL A;  1EWC A;  3RLN A;  1VQJ A;  4YCV A;  5CV5 A;  1KRT A;  2HHH Q;  3G6E A;  3J7A 5;  3L3O C;  1WJJ A;  1ZYR D;  1QWY A;  1FL0 A;  5IGB A;  5HY6 A;  1Q3L A;  1SMY D;  4MHE A;  1V9P A;  2IX1 A;  2OWO A;  2F0G A;  4A3K G;  4ZKB B;  1IBL Q;  4OEL B;  5JVH 3;  2RDF A;  2F0T A;  2KJX A;  2WP8 J;  3F2U A;  1ZYR C;  2JA6 G;  2HHH L;  1YEZ A;  3T51 B;  4C56 C;  4KN4 C;  4DA2 A;  1V43 A;  1MKH A;  2Z6K A;  4MZ9 A;  4DV6 Q;  1KNA A;  5IGC A;  3WWV A;  2KHS A;  4WFN 3;  3HOZ H;  4LF6 Q;  2Z6B A;  3OIP A;  2LFN A;  1OTC A;  4DR7 L;  1I4G A;  1LO5 D;  5DLQ E;  1BKB A;  3SDZ A;  3SGI A;  2R93 B;  4HED A;  4F87 A;  4LAA A;  2JA6 H;  2VS1 A;  4ME5 A;  5EPJ A;  1PH7 A;  2R93 G;  4LWC A;  1YIT A;  4R8N A;  2JN4 A;  4JI6 Q;  4ABN A;  4BY7 G;  2QDL A;  2NVQ H;  1Y1V B;  2PO4 A;  1N34 L;  3K5N A;  4DV5 L;  2RVL A;  1SYB A;  1JE4 A;  3GDE A;  2JSO A;  3I7F A;  2Q8R E;  2JXM B;  1EIG A;  3CHB D;  1KD1 C;  2B39 A;  2HDL A;  1V1P B;  2AKW B;  2R93 H;  3NUC A;  3BYT B;  1K0R A;  1ET6 A;  2E5L L;  1CQV A;  1ICF B;  4DR1 L;  1ESR A;  3I4N B;  3KOJ A;  4IAL A;  1M8A A;  1CFM A;  1IYJ B;  1YNN C;  1I94 Q;  5GRO A;  4Y52 H;  1H9S A;  5J3B A;  4X3S A;  3Q22 A;  1BDO A;  1XNR Q;  1CT1 D;  1N36 Q;  3MFG A;  4A3B G;  1AW7 A;  4PMW A;  4K14 A;  1G91 A;  3BYY B;  1SRO A;  4A3L H;  2NYZ D;  1EYG A;  1KC8 C;  5H1S E;  1EY8 A;  4JI1 Q;  4EVO A;  1HA6 A;  3OIQ A;  1HCZ A;  4YWL A;  2JA7 B;  3HKZ B;  5IY0 A;  1J8I A;  3S15 H;  2CCZ A;  2DJF C;  2K14 A;  3MXP A;  5CV9 A;  3GP7 A;  4X62 Q;  4A3L G;  1QVG A;  3PUX A;  5ELD A;  5ELE A;  3CC7 A;  3M4O H;  4OO1 G;  2Z4I A;  3NK9 A;  4A4I A;  1CI3 M;  3R2T A;  3AEV A;  1CQF A;  1LTA D;  5IWA L;  1TS3 A;  1VF7 A;  5M3M H;  2KEE A;  3J80 L;  1EQR A;  1PYW D;  1JIC A;  2HQL A;  4O2D A;  5IYB G;  1QUQ A;  3A8K E;  3J7Z C;  1MJC A;  3NBH B;  2E76 C;  5EBC A;  2DN8 A;  4QGU A;  1PTO H;  4ID6 A;  4DXF A;  3RZO B;  1GD7 A;  2IPK D;  5L37 A;  5LMU Q;  4GLX A;  1D5M C;  2Y0S E;  2MJ8 A;  2PZT A;  3CC2 A;  2JQO A;  3GTJ H;  2F0M A;  4LF9 L;  4FXK C;  3H3V C;  3S2H B;  4NXN Q;  2RSO A;  2SEB D;  1HNZ L;  1EYA A;  1QB5 D;  4WJ3 M;  4LUV A;  4DR6 Q;  3TSS A;  2IX0 A;  4DAY B;  1STH A;  2E2I B;  1TWG H;  3CQZ B;  3ZJY C;  1GUO A;  3K7U C;  4A3E G;  2Z9H A;  3OWE B;  1Z9F A;  4AYB G;  4A3E B;  2K50 A;  2EYO A;  1LTR D;  4BBR B;  1A0I A;  5K36 G;  2KUM A;  5DEH A;  1EY6 A;  3TBI B;  3PUY A;  1YJW A;  3E6Z X;  3I4M G;  4HJ8 A;  1Y1V G;  1E0B A;  1FJG Q;  4GOP B;  1C4Q A;  1IYU A;  1GOZ A;  5CV7 A;  3R3O A;  5GAE C;  1KL9 A;  4JI7 L;  5C44 H;  2ASB A;  4FVM A;  3VR5 A;  2VQE Q;  1XJV A;  1I4Q A;  2B2T A;  4JI3 L;  3VA7 A;  2JA6 B;  1QNU A;  3M9B A;  4A3K B;  1XNQ L;  5TSS A;  3OMC A;  4JYA L;  4GOP C;  5IOD A;  2WKC A;  1BCP C;  4LMQ D;  4B3T L;  4LK1 C;  1EQV A;  2D62 A;  2CFM A;  2E2H B;  3B6Y A;  4FDB A;  4U67 3;  1NCV A;  4NXN L;  3KF6 B;  4C3H G;  4A3J G;  2N3S A;  5M3F H;  3DWA A;  4GKJ L;  4IFD J;  2XRS D;  1PTO F;  1TWA B;  5ELB A;  2CWA A;  2F3V A;  3D3R A;  1LT3 D;  1NMG A;  4DK6 C;  1VQP A;  3CAM A;  3K59 A;  4K5X A;  1C48 A;  2VUM G;  1F77 A;  1DOM A;  1W3S A;  3S2H H;  2FXQ A;  1TR5 A;  4FNF A;  2LMC B;  4R4I A;  4A3F B;  3SK6 A;  2QW7 A;  1F9P A;  1L0X B;  1NR4 A;  2ZTD A;  4G7Z C;  1D7Q A;  3L9A X;  3BZD B;  5FOB B;  2KBN A;  3K5O A;  1E3P A;  1EEI D;  1KAW A;  1IBK Q;  2BA0 A;  4R4T A;  3NEL A;  2UU9 Q;  4QJF A;  1PA6 A;  4KY5 A;  1E7Z A;  1ENC A;  4BY1 H;  1CA6 A;  3UE1 A;  3D6C A;  1RIP A;  3HOV G;  1U4L A;  3PO3 B;  2KEC A;  4FP5 D;  5I2Y A;  2SNS A;  2WIN B;  2F0U A;  5GAH C;  2X6G A;  3ITP A;  2HD3 A;  3AYH B;  1Z7T A;  4Z9C B;  1I4H A;  5I9O A;  1KHI A;  1O7L A;  2PNR C;  4OIJ A;  5EBD A;  2ZM6 L;  1X32 A;  4I7Z C;  1TKW B;  3T1H Q;  4IZ8 A;  1I50 B;  3R2I A;  2JK8 A;  3K5L A;  2E2H H;  3LWE A;  3EN2 A;  1WTO A;  4L8J A;  3PO3 H;  3GV3 A;  2EPB A;  4DAY A;  1JR0 D;  2UXC L;  2O5I C;  1HFG A;  3PCO B;  1TY0 A;  3TZU A;  4BXX G;  1EIF A;  1TVX A;  2EY6 A;  3K8A A;  2VY3 A;  4DNR B;  2A69 C;  3HOU G;  2A74 C;  5KGU A;  2R92 B;  3Q6S A;  3VR4 A;  1HA5 A;  2CW0 D;  5C4Z A;  3J81 i;  2V1C C;  5ISR A;  4PMB A;  1W2B A;  1BR9 A;  4OX9 Q;  1WD0 A;  1SBB B;  2A69 D;  5JJK A;  1B8A A;  1YJ9 A;  4X3K A;  1EYD A;  3BVZ A;  1AE2 A;  1EUJ A;  3M7N A;  5IT9 E;  5HUR A;  1STB A;  2OQ0 A;  2IY5 B;  3OMG A;  5D14 A;  4A3J B;  5CV6 A;  4HID A;  4WJ4 A;  3CCU A;  4DGZ A;  2HCC A;  1YHQ A;  2UUC L;  4NXM Q;  3NBH A;  2LKV A;  4A3C H;  5JPM C;  2JA7 H;  1HHV A;  1K8G A;  1NBW A;  3R93 A;  4CDF C;  3P1H A;  1EEF D;  2NTS A;  2EJM A;  3U9O A;  3W1G A;  3I4M B;  3X3N A;  5FO9 B;  2FMM A;  3HOZ G;  4GKK L;  2MO1 A;  2EIF A;  3JAM i;  2AWN A;  1LT4 D;  4A76 A;  3NWT A;  5C3W A;  1EL0 A;  5BR8 Q;  3NXW A;  3OTO Q;  1WI5 A;  1Y1W G;  1K3R A;  4P72 A;  2F0E A;  1PH8 A;  3CCM A;  1RF2 D;  1STN A;  5FK9 C;  3NEM A;  5M5W B;  1A2T A;  4B9W A;  3S9W A;  3RN5 A;  1IBM L;  4J6H A;  2Y0S B;  2YTX A;  3L2P A;  4R4C A;  1K8O A;  5C4J B;  4DV2 Q;  1SYG A;  3I4L A;  1FGU A;  4DV3 Q;  1AEX A;  3IKJ A;  1ILQ A;  5E4W C;  4G7H C;  1IBM Q;  4I65 A;  3A0J A;  2V4D A;  1GXD C;  3IFD A;  2QEJ C; 
#chains in the Genus database with same CATH homology
 3SE0 A;  2HQE A;  3MXN A;  3D4W A;  2BA1 A;  4GZY C;  2E2J B;  4WJW A;  4KD3 A;  2F0J A;  2JYO A;  3HS0 C;  1WTV A;  3NTK A;  5IIF A;  3FRP B;  5IOC A;  1F2Z A;  1JWU D;  3LNN A;  4KY7 A;  4R8I A;  1B4O A;  1GUG A;  3M85 A;  3EA6 A;  3OOC A;  3FEW X;  2ZXR A;  1HUM A;  3GTP B;  1F2Y A;  5M9O A;  4K8I A;  3H09 A;  1Q1B A;  1I6V C;  4KI0 A;  1B53 A;  4C3H B;  4O1N A;  4BA1 I;  1IW7 C;  3PIO 3;  1QIL A;  2PCF B;  1BUV T;  3NP8 A;  1OXT A;  4XQQ A;  3BDL A;  1TS2 A;  2F0O A;  4ULL A;  3JAM L;  1DZ1 A;  5CV4 A;  3SK4 A;  4K5V A;  3VYR A;  3OPO A;  1WD1 A;  3TME A;  3QO2 A;  3FDT A;  1RKN A;  5BN4 A;  1STE A;  1I4P A;  4CKC A;  1LTI D;  1YNJ D;  2WAQ B;  3Q23 A;  3ND9 A;  1MD2 D;  5KNC A;  5A2Q E;  2I07 B;  4ZLT F;  3C1F A;  5I9P A;  4HCS A;  4CKE A;  1CA5 A;  3HOY B;  4F8M A;  1KDA A;  4KMU C;  1UNS A;  5ELC A;  2F03 A;  2PZU A;  1SXT A;  2A6E C;  3A54 A;  4BBS B;  1DYQ A;  1WTR A;  2K03 A;  2L1B A;  2G9H D;  1NSN S;  4K5W A;  3H0G B;  2J7Z A;  2K6A A;  3VYT A;  2K01 A;  2K32 A;  5I4D A;  1EY7 A;  4R9W A;  5J39 A;  3D6W A;  3BDC A;  4A93 B;  1SMY C;  4KJN A;  4KKT A;  3JAM E;  2B8F A;  2WKD A;  4DU9 A;  5KYI A;  2MGS A;  3VYS A;  2F0V A;  1X3Q A;  3K57 A;  1HXY D;  1FNV A;  5JPN C;  5C0X H;  4K6L A;  2EY5 A;  1GHK A;  2B2V C;  5K5P A;  4QUF A;  3AMU A;  4DK0 A;  4KN7 C;  4EQO A;  2A68 D;  3CKI B;  2NWG A;  1S5B D;  2OEO A;  2RQX A;  4IFD H;  4ZKC B;  3KBX A;  1TWG B;  3S2D B;  1LT6 D;  2A6H C;  5LL6 S;  2EE1 A;  1UUP A;  1VMP A;  1DCZ A;  1RJT A;  3QOL A;  1D2B A;  1JOK A;  2KOL A;  4DFA A;  1FGB D;  2DY7 A;  1ZKO A;  1DJR D;  1CHQ D;  1SNO A;  2EYJ A;  4FF4 A;  3A7L A;  3ND8 A;  1JWS D;  2EY2 A;  2KA7 A;  3A8I E;  3DUZ A;  2F0F A;  1B1Z A;  3PV0 A;  3E0J A;  2BOS A;  1IHZ A;  2H4O A;  1AZQ A;  5LHY 1;  2PYK A;  3KF8 A;  2A68 C;  3A55 A;  4X3T A;  5E4X A;  1CTM A;  1EIH A;  2M2L A;  1Q12 A;  2E2D C;  2B2W C;  1CZG A;  1SYC A;  4IUP A;  2JA8 B;  3HEJ A;  2BDN A;  2I46 A;  1TS4 A;  1JB3 A;  1PFN A;  4FF2 A;  2J0T D;  3ONA B;  4XTC S;  2EYF A;  1LTT D;  3T13 A;  1PRT B;  4XQN A;  3K58 A;  1A3U A;  1SNP A;  3RLF A;  3IL8 A;  3AB9 A;  4HR7 B;  1XWE A;  2Z8L A;  5KRU A;  3K7A B;  3D31 A;  2LY7 A;  3DHQ A;  1PFB A;  4KV6 A;  2K28 A;  4KKU A;  5KYL A;  5C5M A;  3GTQ B;  4BY7 B;  4IQZ A;  2KCC A;  1LAC A;  1TT2 A;  4A3M B;  5T1I A;  5IT9 L;  3PIP 3;  2K33 A;  3QB3 A;  5EKI A;  1ML0 D;  1PLF A;  3PMF A;  3KBG A;  1F9R A;  2B2U C;  2N55 A;  3K6O A;  1ROD A;  1LLR D;  3GTG B;  4A3G B;  1UEA B;  1I4R A;  3MXU A;  1V8Q A;  3C3L A;  4ZAI A;  4JK1 C;  2XNA C;  4IUV A;  5COY A;  3NTI A;  3D4R A;  5BN5 A;  1SEB D;  4H7B A;  1AN8 A;  1SE2 A;  1STG A;  2M9V A;  4QCL A;  1SJE D;  3MFY A;  2NB0 A;  2JE6 I;  5C4X B;  4F7X A;  1PZK D;  2NUC A;  2LS0 1;  2WAC A;  3HG9 A;  3C2P A;  4FXD A;  2F0L A;  1PTO B;  1QG7 A;  3NTH A;  1R4P B;  3X3M A;  1TS5 A;  2F0W A;  5JEA G;  5I6Y A;  4QMG A;  2B2Y C;  1A6X A;  1SAP A;  1ZXT A;  2EJF C;  3GTM B;  3GD7 A;  1KLG D;  3SEB A;  2L12 A;  4FF3 A;  4V19 0;  3GTK B;  4KJO A;  1Y8N B;  1J9O A;  3MEH A;  3M4Y A;  1SYE A;  1PRT D;  2RA4 A;  3P75 A;  4DNT B;  4N9P A;  2NVY B;  1ET9 A;  5CMD A;  3HOW B;  2G9D A;  1DOL A;  1BQQ T;  2NN6 H;  4C3J B;  1EZ8 A;  2FHT A;  3A8J E;  5EPK A;  4RKB A;  3IFT A;  1GJX A;  1QNK A;  4KHZ A;  1HUN A;  4C3I B;  2NVT B;  4NDX A;  4RWS C;  1NUC A;  1V1O A;  2HUG A;  4J1M A;  3S17 B;  5FO8 B;  5COR A;  1A3T A;  2EXZ A;  4QUC A;  3T16 A;  1NAP A;  1YNN D;  3GTL B;  1QJO A;  2VXW A;  4FO2 A;  2K7V A;  4Y7N B;  5KND A;  1H9M A;  1OXX K;  2CQA A;  1IL8 A;  2F0I A;  3GTJ B;  5G3L D;  5C4H A;  3M3Y B;  2BE5 C;  3TN2 A;  2PMZ B;  5KIX A;  1D6E C;  3TP6 A;  1A3V A;  1HTP A;  1GUT A;  5DM7 3;  3K5M A;  1MI2 A;  4IUR A;  4HAE A;  4NP5 A;  3VYU A;  3WOF A;  3MWY W;  1IKM A;  1Y1W B;  5IGG A;  3I91 A;  4OIK A;  1B3A A;  3UI2 A;  3VR3 A;  4ZQ3 A;  1KLU D;  4OO1 I;  5DAU A;  1S4Z A;  3HRZ C;  4PMC A;  3DEO A;  3BS1 A;  3BVG A;  1C8C A;  1WCM B;  2EVB A;  4DAV A;  1ZEQ X;  2F4I A;  4L63 B;  3TP7 A;  3D4D A;  3DXJ C;  4RH6 A;  4CGY B;  2Q8I B;  2FJ2 A;  3ERO A;  4QIW B;  1LTG D;  1T5E A;  2JP1 A;  3I90 A;  4B9X A;  1GUS A;  2B2U A;  2EYP A;  4CKB A;  5JEA J;  1G8Z D;  2QDB A;  2H1E A;  1S5C D;  1JQY D;  4RGN A;  3DMU A;  2WV6 D;  2EYH A;  3KUP A;  3T56 B;  3I72 A;  4MN3 A;  4EGV A;  2WB1 B;  1BF4 A;  2VNU D;  3M4O B;  2TSS A;  2AQ1 B;  2XWB B;  3SK8 A;  5AFW A;  4K2K A;  3DM1 A;  1STA A;  4CJ0 B;  3K0Y A;  2L0C A;  1FNW A;  1FYC A;  4G4K A;  2QF7 A;  4IUN A;  1XX8 A;  1STY A;  1SE3 A;  1Z6H A;  3ZYY X;  1VMC A;  4IN3 A;  1L0Y B;  4UAI A;  2O2L D;  1YNJ C;  3P7J A;  3NE5 B;  1HQM C;  1R9T B;  3V96 A;  2B2T C;  1LTB D;  2R3Z A;  1Q8I A;  3S15 B;  1FR3 A;  3S1Q B;  3WDN A;  1SE4 A;  1U4R A;  4UDU C;  5I6W A;  1RTN A;  1FD7 D;  1XXG A;  1BO0 A;  4KD4 A;  4C1N I;  3BG3 A;  1OXU A;  3EFX D;  1H9S B;  4PQX A;  1Q1E A;  4Q5V A;  1SSO A;  2L9H A;  3PO2 B;  3FKI B;  4DF7 A;  1EY0 A;  2XIW A;  1AP0 A;  3WOE A;  4DK1 A;  4CBV A;  1ILP A;  1EY5 A;  3HOZ B;  3S14 B;  2MUY A;  2AUK A;  2AQ3 B;  2ZT9 C;  1M4V A;  1PXU A;  5ELF A;  1GUN A;  2NN6 I;  4RCN A;  5D3D A;  1SNM A;  1Y8O B;  3SHL A;  5C3E B;  5K36 H;  3M7G A;  1Y69 U;  2RKS A;  2O4X A;  3TP8 A;  2QIL A;  4TKO B;  2A5H A;  4HMJ A;  3J7A V;  3J7Y W;  4OO1 H;  3L7Z C;  4BS9 A;  3SXH A;  1W6J A;  3QIA A;  3O13 A;  1TY2 A;  3MTS A;  5G3L F;  3EQL C;  4K8J A;  5KNB A;  2D9U A;  1TWC B;  4EQN A;  1B50 A;  3KLS A;  2VUM B;  3V05 A;  2B63 B;  2F0H A;  2R61 A;  1B44 D;  5M3F B;  3FVQ A;  4X3U A;  3H94 A;  2ENB A;  1CZW A;  4KKS A;  3J81 L;  4XYQ A;  1PZI D;  1KAA A;  1WTP A;  2F0N A;  1IKL A;  1HRJ A;  5E3F A;  1GUW A;  2AUJ D;  4BA2 I;  3OW7 A;  1OXV A;  1EWH A;  1ICW A;  4RHS A;  2MHV A;  5C44 B;  4HSP A;  4U68 A;  3H91 A;  2AQ2 B;  2D2C C;  2WII B;  1RD9 D;  4AYB B;  5CGK A;  4FF1 A;  3LX0 A;  1EZ6 A;  4S3S A;  3KLS X;  1O80 A;  1JCK B;  2SNM A;  1PRT F;  2VB2 X;  2PW7 A;  4RGO S;  3T4A C;  2AWO A;  1EY9 A;  4A3B B;  4HSV A;  2R6G A;  1JOQ A;  5C5L A;  1RDP D;  3U9S A;  3NSW A;  1EQT A;  2IW3 A;  5HGT A;  5C0X J;  1WTQ A;  1AFP A;  5JJZ A;  4CJ1 B;  1D1K A;  2F1M A;  5CBE E;  4KTA A;  2K5Q A;  1SJH D;  1BCP F;  4DXG A;  5CBA E;  4RHR A;  4IFD G;  3GV6 A;  3I8Z A;  5NUC A;  1LAB A;  1KDC A;  2BE5 D;  4XDX A;  4XYO A;  1SDF A;  1OO9 B;  3CRK C;  1LV9 A;  2GA4 B;  1Y8P B;  2OXP A;  3MC0 B;  1D1I A;  4ILW A;  2ZXO A;  2JA5 B;  4RAU C;  3SK5 A;  5M5X B;  4LJZ C;  1H9R A;  2B2Y A;  3ERQ A;  1XYI A;  4L6T B;  5EQ0 A;  3W3A A;  2KVM A;  3RZD B;  5IGE A;  5DM6 3;  3BVM A;  1D5Z C;  3GTO B;  2IL8 A;  2E75 C;  3D8G A;  2ZXP A;  1G6Z A;  5M3M B;  2JEB I;  1JWM D;  1MSG A;  2CHB D;  2FFK B;  1SNQ A;  4Q0F A;  1ONL A;  1I4X A;  1CHP D;  1GHJ A;  4M8A A;  2NZ1 D;  3URY A;  3HGB A;  4G7O C;  1O7Z A;  4C2M B;  5C6A A;  4OGQ C;  4H13 C;  3VA5 A;  4XIG S;  2A6E D;  3I73 A;  5E1F A;  4ZUI A;  2F0Q A;  2D5D A;  2F0D A;  2F3W A;  3NPP A;  3MXG A;  3HOU B;  4QF4 A;  3RUZ A;  3MZ5 A;  2EZV A;  4DAP A;  3P20 A;  2C5C A;  2B8G A;  5F2D A;  1MBY A;  1QCB D;  3HOX B;  4NW2 A;  5A35 A;  2XN9 C;  4XT1 B;  3C46 A;  2XWJ B;  2PZW A;  3AU7 A;  3TDQ A;  1SND A;  3FPU B;  2O5J C;  2OT2 A;  2CVR A;  3NQT A;  2NVX B;  1E2W A;  5C0X G;  3OSO A;  1TWF B;  2YYZ A;  3J80 E;  1H9J A;  4WOR A;  1EYC A;  4XQJ A;  1NR2 A;  2E74 C;  1K83 B;  4OL7 A;  2YU9 B;  4RA8 A;  3NQI A;  1BOS A;  1DON A;  1KTK A;  5CYU A;  3VR2 A;  4ZYS A;  2HDM A;  4ZUJ A;  1Q90 A;  4HN7 A;  4RKL A;  3OWF A;  2IWH A;  5A2Q L;  3MVV A;  4MIU A;  1S5E D;  3S1N B;  4N9T A;  1F9Q A;  2Z4H A;  2A73 B;  1QE6 A;  1PRT C;  2EDG A;  3Q0A A;  3TP5 A;  3QJY A;  2L11 A;  1ENF A;  1U4P A;  5EKK A;  3PUW A;  1PZJ D;  4KHV A;  2IT1 A;  4PV1 C;  1TU2 B;  2IX3 A;  2KQ3 A;  2L5T A;  4KY6 A;  4JBW A;  4OHJ A;  4RGM A;  1BCP B;  3GQB A;  2IJ0 A;  2NVQ B;  5D65 A;  3HP3 A;  1BNZ A;  4CHT B;  2ICE C;  2K1B A;  4IFD I;  5I2X A;  2K05 A;  4C3J G;  5C3X A;  2K04 A;  4NKL A;  1EOT A;  1SYF A;  5EKL A;  1A15 A;  1KNE A;  1SNC A;  1DM0 B;  2F0P A;  4XT3 B;  3QG1 A;  1BXT A;  2F0S A;  4IUT A;  2J4X A;  1B2T A;  1WTX A;  1EY4 A;  4P2C B;  1V1P A;  5FO7 B;  1SYD A;  4WRD A;  2OF1 A;  1H9K A;  5JAV A;  3T53 B;  1TWH B;  2KED A;  1HQR D;  5FLX L;  3C1E A;  1JOO A;  1RTO A;  2EOT A;  1MGS A;  4HMI A;  2MP1 A;  1X3P A;  2JEA I;  1KDB A;  5J22 A;  4NMZ A;  2QCP X;  5CV8 A;  1B9N A;  2VB3 X;  1S5F D;  4H44 C;  1F9S A;  1U4M A;  4K6D A;  4RFB A;  3V2T A;  5M5Y B;  1MSH A;  3A7A B;  3QOJ A;  1PTO C;  2M00 A;  1JOR A;  2EJG C;  3CRL C;  2PQE A;  4C1N K;  1S5D D;  2SDF A;  2RDH A;  2Q8T A;  3IAY A;  4XXE A;  1QOH A;  2BCO A;  2RBM A;  2XRQ D;  1HFN A;  4TQU S;  4FXG C;  1G2S A;  1DOK A;  2F0K A;  3TZD A;  4IUU A;  1WTW A;  2XSC A;  4M1U B;  1A2U A;  1SFO B;  3NWS A;  5LL6 X;  2RSN A;  2K5D A;  2XVS A;  2DY8 A;  4TSS A;  3N6R A;  4E6I A;  1F2L A;  4C3I G;  2CW0 C;  4RCO A;  5IGD A;  1LTS D;  3KLR A;  2R7Z B;  4O42 A;  5KEE A;  3KK7 A;  2EYM A;  2Z1C A;  1I3Q B;  4A3D B;  1VDZ A;  1CM9 A;  3R8B A;  3GO5 A;  1RHP A;  3PUZ A;  3RD4 A;  1JC7 A;  1K8M A;  3PUV A;  3HOV B;  1F2M A;  1Z47 A;  1ENA A;  1O7Y A;  4F88 A;  2RDG A;  1W6K A;  5EJW A;  3NBI A;  1U9R A;  2QKI C;  1VCI A;  3S1R B;  3E5S A;  2PW5 A;  4YIJ A;  5FKA C;  2DNE A;  2K5W A;  4H0L C;  1IYV A;  1R4Q B;  2B2W A;  1BCP D;  3EVQ A;  5T1G A;  1D5X C;  2L4N A;  1XTC D;  3FPP A;  4ZRZ A;  2NBF A;  4BY1 B;  2TMP A;  4HCE A;  2A6H D;  5EPL A;  1I6H B;  4QB4 A;  1PFM A;  3MA2 B;  2FIN B;  4DN4 M;  1CK1 A;  1G29 1;  1DXM A;  2DNC A;  1TII D;  3NHH A;  1AZP A;  3QWN A;  2FMC A;  1KAB A;  3I3C A;  2EYL A;  5IGF A;  1LT5 D;  3DWQ A;  2BDO A;  4TRD A;  3W2D A;  2X6L A;  3N52 A;  4A3I B;  4ZK9 B;  1VF5 C;  2L55 A;  4G57 A;  1T5X D;  3EJI A;  4J8Q A;  4IUQ A;  1HTL D;  3CU7 A;  3J81 E;  4PNY A;  2SOB A;  4EQP A;  1IW7 D;  4ODG A;  5DNF A;  1BBX C;  1O78 A;  3G6J B;  1HPC A;  3BDO A;  4RGT A;  2C9O A;  1PMR A;  3S1M B;  4B08 A;  5JOB A;  1B9M A;  2NN6 G;  2NTT A;  3SVM A;  1DD2 A;  1EFI D;  3SR1 A;  5J1Z A;  1G2T A;  3J7A F;  2EY1 A;  1PDQ A;  1OXS C;  5JEA H;  4V0B A;  2KCN A;  2N88 A;  1E2Z A;  1E2V A;  5CR3 A;  3A56 A;  3VR6 A;  5JVG 3;  1RCV D;  4CJ2 C;  2B2V A;  4K2L A;  3MAQ A;  1PTO D;  1ESF A;  3FMC A;  4FYD A;  3MHB A;  4BWG B;  3G7L A;  5D3I B;  2PPB C;  3I70 A;  4KK7 A;  1EU3 A;  5C0X I;  3DWP A;  5CC4 A;  1FNU A;  3RMH A;  5BN3 A;  5EGT A;  1EU4 A;  4HTH A;  2X69 A;  2MPM A;  5FLX E;  3Q24 A;  3H6M A;  3S16 B;  3DEP A;  2HCI A;  3OHX C;  3LWU A;  1TQO A;  3HZX A;  1II3 A;  1UAP A;  2ICI A;  2ID0 A;  1WVL A;  1EWC A;  5CV5 A;  3L3O C;  1ZYR D;  1QWY A;  5IGB A;  1Q3L A;  1SMY D;  4MHE A;  2IX1 A;  2F0G A;  4ZKB B;  5JVH 3;  2RDF A;  2F0T A;  2KJX A;  2WP8 J;  3F2U A;  1ZYR C;  3T51 B;  4C56 C;  4KN4 C;  4DA2 A;  1V43 A;  1KNA A;  5IGC A;  2KHS A;  4WFN 3;  3OIP A;  2LFN A;  1I4G A;  1LO5 D;  3SDZ A;  2R93 B;  4HED A;  4F87 A;  4LAA A;  4ME5 A;  5EPJ A;  4R8N A;  4ABN A;  1Y1V B;  2PO4 A;  3K5N A;  2RVL A;  1SYB A;  1JE4 A;  2JSO A;  2Q8R E;  2JXM B;  1EIG A;  3CHB D;  2B39 A;  2HDL A;  1V1P B;  3NUC A;  3BYT B;  1ET6 A;  1CQV A;  1ESR A;  3I4N B;  4IAL A;  1M8A A;  1CFM A;  1YNN C;  1H9S A;  4X3S A;  3Q22 A;  1BDO A;  1CT1 D;  3MFG A;  1AW7 A;  4PMW A;  4K14 A;  1G91 A;  3BYY B;  2NYZ D;  1EY8 A;  4EVO A;  1HA6 A;  3OIQ A;  1HCZ A;  2JA7 B;  3HKZ B;  1J8I A;  3MXP A;  5CV9 A;  3GP7 A;  3PUX A;  5ELD A;  5ELE A;  4OO1 G;  2Z4I A;  3NK9 A;  1CI3 M;  3R2T A;  1CQF A;  1LTA D;  1TS3 A;  1VF7 A;  2KEE A;  3J80 L;  1PYW D;  1JIC A;  3A8K E;  2E76 C;  5EBC A;  2DN8 A;  1PTO H;  4ID6 A;  4DXF A;  3RZO B;  2IPK D;  1D5M C;  2MJ8 A;  2PZT A;  2F0M A;  4FXK C;  3H3V C;  3S2H B;  2RSO A;  2SEB D;  1EYA A;  1QB5 D;  3TSS A;  2IX0 A;  1STH A;  2E2I B;  3CQZ B;  1GUO A;  3OWE B;  4A3E B;  4BBR B;  2EYO A;  1LTR D;  5K36 G;  2KUM A;  5DEH A;  1EY6 A;  3TBI B;  3PUY A;  3E6Z X;  1E0B A;  1C4Q A;  1IYU A;  1GOZ A;  5CV7 A;  3R3O A;  4FVM A;  2JA6 B;  3VR5 A;  1I4Q A;  2B2T A;  3VA7 A;  1QNU A;  4A3K B;  5TSS A;  3OMC A;  5IOD A;  2WKC A;  1BCP C;  4LMQ D;  4LK1 C;  1EQV A;  2D62 A;  2E2H B;  4U67 3;  1NCV A;  4C3H G;  3DWA A;  4IFD J;  2XRS D;  1PTO F;  1TWA B;  5ELB A;  2F3V A;  3D3R A;  1LT3 D;  3K59 A;  4K5X A;  1C48 A;  1F77 A;  1DOM A;  1TR5 A;  4FNF A;  2LMC B;  4A3F B;  3SK6 A;  1F9P A;  1L0X B;  1NR4 A;  4G7Z C;  3L9A X;  3BZD B;  5FOB B;  3K5O A;  1EEI D;  2BA0 A;  4KY5 A;  1ENC A;  1CA6 A;  3D6C A;  1U4L A;  3PO3 B;  2KEC A;  4FP5 D;  5I2Y A;  2SNS A;  2WIN B;  2F0U A;  2X6G A;  3ITP A;  1Z7T A;  4Z9C B;  1I4H A;  5I9O A;  1O7L A;  2PNR C;  4OIJ A;  5EBD A;  1X32 A;  4I7Z C;  1TKW B;  4IZ8 A;  1I50 B;  3R2I A;  3K5L A;  3LWE A;  1WTO A;  4L8J A;  3GV3 A;  2EPB A;  4DAY A;  1JR0 D;  2O5I C;  1HFG A;  1TY0 A;  3TZU A;  1TVX A;  2EY6 A;  4DNR B;  2A69 C;  2R92 B;  2A74 C;  5KGU A;  3Q6S A;  3VR4 A;  1HA5 A;  2CW0 D;  5C4Z A;  5ISR A;  4PMB A;  1BR9 A;  1WD0 A;  1SBB B;  2A69 D;  4X3K A;  1EYD A;  3BVZ A;  3M7N A;  5IT9 E;  5HUR A;  1STB A;  3OMG A;  5D14 A;  4A3J B;  5CV6 A;  4DGZ A;  2HCC A;  3NBH A;  2LKV A;  5JPM C;  1HHV A;  3R93 A;  3P1H A;  1EEF D;  2NTS A;  2EJM A;  3U9O A;  3I4M B;  5FO9 B;  3X3N A;  2FMM A;  2AWN A;  1LT4 D;  3NWT A;  5C3W A;  1EL0 A;  3NXW A;  2F0E A;  1RF2 D;  1STN A;  5FK9 C;  5M5W B;  1A2T A;  4B9W A;  3S9W A;  4J6H A;  2Y0S B;  1K8O A;  5C4J B;  1SYG A;  3I4L A;  1AEX A;  3IKJ A;  1ILQ A;  5E4W C;  4G7H C;  4I65 A;  2V4D A;  1GXD C;  3IFD A;  2QEJ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...