3SK4A

Crystal structure of staphylococcal nuclease variant delta+phs d21n/v23e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS D21N/V23E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk4A00
3OMCA 3SHLA 2PW7A 4K5XA 2EY2A 1U9RA 3QOLA 1EY4A 5CR3A 1STBA 4EQPA 5IGFA 1AEXA 3H6MA 2EYFA 1STGA 1JOQA 3OSOA 2SOBA 3SR1A 2EY6A 3NP8A 4J6HA 5E1FA 4OL7A 2OF1A 3BDCA 2EYOA 5IIFA 3TMEA 1NUCA 2F0NA 3NXWA 4K14A 3DMUA 4K2LA 4ID6A 4KJNA 4MIUA 5C3WA 5IGDA 2EYPA 3HEJA 5DAUA 3MEHA 1EYDA 1F2YA 3ITPA 2RBMA 3SK5A 3U9OA 5I9PA 2NUCA 3BDLA 4QB4A 3PMFA 3P75A 2EXZA 5DEHA 3T16A 2F0UA 2M00A 3S9WA 1NSNS 3MHBA 2EYLA 1EY6A 4KTAA 5EKKA 3TP6A 3VA5A 5I9OA 5IOCA 1A3TA 5JAVA 5IGGA 3R3OA 2F0WA 4J1MA 2F0LA 3D4DA 4I65A 3SK6A 2RKSA 3TP5A 3EVQA 4F8MA 4KY7A 4HMJA 5C4HA 5I6YA 4NDXA 1EQVA 5CV6A 1STAA 3D4WA 4G57A 5CV9A 4K2KA 2EYMA 4KHVA 4EQNA 4EVOA 5CGKA 5J39A 1JOOA 3D6CA 3V2TA 3T13A 2F0FA 4LAAA 5I6WA 1IHZA 1SYGA 5C6AA 4R8NA 3MVVA 4QF4A 5CV5A 1SNCA 3MXPA 4K6DA 1SNMA 2EY1A 4B9WA 3OWFA 4PNYA 2F0TA 3OMGA 5ISRA 3NK9A 5NUCA 1SYEA 4HMIA 3C1EA 4PMCA 1JOKA 1EYAA 4HTHA 4E6IA 2KHSA 3NQTA 4QMGA 1F2ZA 3NHHA 1KDBA 3DHQA 1EZ8A 2F0QA 3D8GA 5CC4A 2PZWA 4KD3A 1EZ6A 2EYJA 5IODA 5KYIA 2WACA 4H7BA 5EKLA 3QOJA 5CV4A 5IGCA 5C5LA 4NP5A 4N9TA 2PZTA 1A3UA 4K5WA 3HZXA 4KY5A 5KYLA 1SNDA 4DU9A 1EY8A 3MZ5A 2F0DA 1SNOA 3EJIA 2F3VA 3NUCA 4S3SA 2SNSA 4NMZA 5J1ZA 5KRUA 4DF7A 1KDAA 1STHA 3C1FA 5K5PA 2F3WA 4ZQ3A 5C5MA 1EY9A 4F7XA 5C3XA 4ZUIA 3SXHA 3TP7A 1TT2A 1II3A 2OXPA 3RUZA 1JORA 1A2TA 3ERQA 5KIXA 3SK4A 1SYDA 1EY7A 2PQEA 2PYKA 4DGZA 1EY0A 2F0EA 4K8IA 4K8JA 4TRDA 1SYCA 2PZUA 4ODGA 5CV7A 2F0PA 5M9OA 2F0HA 4WORA 2F0GA 2F0SA 5C4ZA 1F2MA 5E3FA 5KGUA 3SK8A 2F0VA 2ENBA 2F0OA 4NKLA 3E5SA 4EQOA 4KV6A 2F0JA 4IALA 5F2DA 4PMBA 5J22A 2EYHA 2F0KA 1ENCA 3QB3A 2LKVA 1TR5A 5KEEA 1A2UA 2EY5A 1RKNA 2KQ3A 2OEOA 4IZ8A 1SYFA 2SNMA 2QDBA 4KY6A 4DFAA 4YIJA 4KJOA 4N9PA 4ZUJA 1KABA 2F0IA 2PW5A 1SNQA 3LX0A 5IGEA 1A3VA 4KD4A 5HGTA 3TP8A 1EYCA 1EY5A 2RDFA 4K5VA 4RKBA 5IGBA 1STYA 5JOBA 1SNPA 2O4XA 1ENAA 5EGTA 3P1HA 1KAAA 1TQOA 1STNA 4RKLA 1KDCA 4IUNA 4ME5A 4WRDA 2HQEA 4B9XA 2F0MA 5CV8A 1SYBA 5HURA 3EROA
chains in the Genus database with same CATH superfamily
3VR5A 1U9RA 3D3RA 3QOLA 1EY4A 1T5XD 1YHBA 2UUBL 1EIHA 1KXLA 1STBA 3T1HQ 2QGQA 4C3IG 1V43A 3HGBA 2RCNA 2GVAA 1E3PA 5IIFA 1ILPA 1L1OA 3ITPA 2VZAA 1OXSC 4JPBW 5CBEE 3J7A5 4ME3A 4HJ9A 1EWHA 1WJJA 4A3LG 1FGUA 1NSNS 3FMCA 3Q24A 4A3DB 2GVBA 1A3TA 2Q8TA 1Z6HA 1S5CD 1Z7TA 4JI4Q 1TS4A 4A3IH 2HQLA 1SR3A 3J80c 2CFMA 2O5IC 1XNQL 1SROA 3R2IA 3S1NH 3KF8B 1HZBA 4CKBA 1SE2A 3JAML 3W1GA 4AQYQ 1A15A 3GTJH 3OTOQ 4QIWE 3ULJA 2F0TA 2K75A 4IN3A 3CC4A 4LF7Q 1BCPD 5C0XG 2I5LX 1BNZA 1I50H 2BE5C 2K5NA 4KLKA 4WJWA 4R4OA 4LF8Q 4P73A 3K8AA 1YNNC 3FDTA 1TS3A 3RR5A 3PO3B 2JK8A 1HNXL 5JVG3 4POFA 1QG7A 5ELEA 2PZTA 1Z9FA 2R7ZG 4L8JA 1SJHD 5KYLA 3K7AH 1Q86C 4R4QA 1EY8A 3NENA 3CCMA 3S1MB 3DM3A 2EZVA 2A8VA 3K5MA 3HOZB 1LV9A 2FXQA 3JAME 1GUTA 1BVSA 2B2UC 2ZXPA 1PH1A 1EY9A 1ZYRC 1O78A 4LF5L 4K0KQ 1JORA 1JJCB 2PQEA 4KKUA 1M1KC 3VYRA 1B7YB 1B3AA 4JI5L 3I70A 2M2LA 5E3FA 5JEAG 1PH2A 5F2DA 2AWNA 4JI6L 4QY7A 4V190 1TWHH 4Y52H 1OXTA 4IUVA 3D31A 4NKLA 1V1QA 1Q1EA 1RKNA 2KQ3A 1K8OA 2SNMA 2R93G 2C9OA 4C3JB 5CMDA 3LWUA 1SNQA 1Q12A 1MJCA 2RSNA 4X62Q 3I4NB 2OTLA 3M3YH 2G9DA 1ENFA 2FMMA 1TQOA 3H91A 2UUAQ 2JA9A 1G291 2KENA 1LTLA 5HURA 1PH9A 1CA6A 2EY2A 1VQAA 1JB3A 1YBYA 3S14B 4A75A 2L0CA 3MFGA 5GROA 1D1IA 1VQMA 1LACA 4DNTB 2IX0A 4HIOA 1GHKA 1ICWA 2WIIB 3NE5B 4J6HA 2DGYA 1CKMA 4A3MH 2Z8LA 4K2LA 2E2HB 4CHTB 2OQKA 2ID0A 4LF6Q 4L5SA 4IFDI 2JA8H 4UPAA 5ELDA 2HUGA 4DR1L 1BUVT 2F03A 3GTGH 3V05A 1PTOB 5LMNL 2CWAA 4J1MA 3J7YW 4ZK9B 2KVMA 4HMJA 2IHFA 3KLSX 5CV6A 5EKLA 1STAA 4ULLA 4IURA 4C56C 4BBRB 5CGKA 3NWSA 1RF2D 3HKZE 4JI2L 3Q22A 1X3GA 1KTKA 1D1KA 4BA2I 2ZJRA 2JA7B 3OWFA 4CJ0B 1CQFA 2B2WA 3CCJA 2Z6BA 2UU9Q 3CCLA 1C0AA 1EWCA 4B08A 3ZYYX 3L0OA 2PZWA 2UXCL 1CKNA 3K80C 4APVA 3W1BA 5IODA 1HR0L 5EPJA 2MJ8A 2JXMB 4FP5D 4WJ4A 3KLSA 1U4PA 1VDZA 4DU9A 2KHIA 5C3EH 2ZM6L 2F3WA 3GTMB 3TP7A 1II3A 3CCUA 3CCVA 1NR4A 3VR4A 5KIXA 1HH2P 5T1GA 3HKZG 1VQHA 4K8JA 3T53B 2A74C 4X3UA 2UXBL 3S17H 3HP3A 4GN3B 1V1PB 1KRTA 5M5YH 3A56A 2B3GA 4XQNA 3T1YL 2JA5G 5C0XJ 1X54A 2QDBA 4N9PA 3A5UA 2JQOA 4C3HH 3G6JB 1B4OA 1X3QA 1U4LA 1I4HA 3GTPH 1SFOB 4ME5A 1ESFA 4RG1A 3PUVA 3G6EA 2PW7A 4OO1G 1ASYA 3BS1A 4BY7G 4EQPA 3H6MA 2EYFA 4NXMQ 2Q2HA 4RCOA 1Q8IA 2EYOA 4X3SA 5IT9c 1LTGD 2AKWB 4IUPA 2HIXA 1F2YA 4A3JH 2NZ1D 1D2BA 4C2MB 4DR7L 2M00A 4KHPQ 4PZ8A 3CCSA 5C44G 3PO3H 4JI6Q 1T9HA 2BCOA 3K0YA 3L2PA 3GO5A 3H0GH 4PZ7A 3SK6A 1RTOA 3S1MH 3TS2A 1G91A 1KLUD 3HOZH 1V8QA 4A93H 4A3DG 4DV4L 2VXWA 1OTCA 5BN5A 3T13A 4M8AA 3P20A 4RGTA 4YCUA 2KOLA 3MVVA 1A62A 2NVQH 1GD7A 4B9WA 4A3EH 3S1QB 3FKIG 2IWHA 2XTIA 2VL6A 3ULLA 3A0JA 1F2ZA 2N88A 4XQQA 3OPOA 1G8ZD 1SXTA 4KD3A 4B3SQ 4MN3A 5DM73 2JEBI 5CV4A 1RHPA 2JA6G 3TS0A 2NBFA 4Y7NB 4HIDA 4A3FB 4L5RC 2EQSA 1NY4A 3A8IE 4XQJA 2RHQB 1X9NA 4BXXH 4DR1Q 1B50A 3E0EA 1IBKQ 1HQRD 1U0LA 2ZXOA 3BYYB 4OWXB 1LM0A 4HIMA 4DUYQ 2R7DA 2RDGA 1Y8PB 2XWBB 2F0EA 1VQCA 4K8IA 3S14H 2IJ0A 1SYCA 3D0FA 1YZ6A 2WINB 3E6ZX 5FJ8G 4YWKA 4X3TA 4GN5A 2F0HA 2N78A 5I2YA 1NMGA 1HHVA 3RZDH 4EQOA 5GAHC 2EYHA 2F0KA 2VB2X 4K6LA 1TWAH 1LTAD 1GM5A 1VMPA 3VR6A 2GA4B 2B8FA 3H15A 2B2TC 2D62A 2PO4A 3CMAA 4JBJA 1GXDC 3FRPB 5M3FB 5KNDA 1K28A 2D9UA 3AYHB 3FP9A 3S24A 4AH6A 1HR0Q 5IGBA 1X56A 5EJWA 5IWAL 3KF6B 4B9XA 3RN2A 1LTSD 4FXKC 4XT3B 3BZKA 3OIPA 4C3JG 5IP9H 1B44D 1G51A 2L12A 1PH5A 3CU7A 3I4NG 2KEEA 2BOSA 4JV5L 1KRSA 3KFUA 2YV5A 5BN4A 1OXUA 1XPOA 2A69C 4YHHL 2UXBQ 1B70B 2WFWA 4Q0FA 4DUZL 1XPRA 2G5DA 5FLXL 1FR3A 5IOCA 1VQLA 3GTKB 3I8ZA 3T1YQ 1X3EA 2Z0SA 4IQZA 2XGTA 1KQSA 2HHHQ 4V0BA 1M90C 3MAQA 2Z1CA 3A55A 2F0FA 1QVGA 2K33A 4GKJL 1GUGA 3M4PA 1TXYA 2MNAA 1P16A 1SNMA 2K52A 1EU4A 3OMGA 4A3CG 4BBRG 3R93A 3V96A 2KHSA 3T51B 3NQTA 1VS0A 5C4XB 1EZ8A 2JA7G 1QILA 4QUCA 5FLXE 1FJGL 1HRJA 2E75C 2HDLA 2RA4A 1BBXC 1TY2A 1KNEA 3WOFA 5BN3A 4DR3L 2R92B 4LJZC 3K57A 4JI3Q 1GVPA 3D4RA 2KCMA 1STHA 3L7ZC 4X66L 2EOTA 1SFOH 2BA0A 2QF7A 1L1OB 4GOPA 1SYDA 1UE6A 2PYKA 1CZWA 2DY8A 3DXJC 2QCPX 4DA2A 4DR5Q 2UXDL 2XWJB 1SE4A 4DV4Q 1H95A 4WORA 4XIGS 2F0VA 2ENBA 4HSVA 2AUKA 1RODA 2MO0A 2NZHA 4J15A 3FHWA 4KV6A 4PMBA 4HAEA 2ZTEA 1ASZA 1EL0A 4HR7B 5E7NA 1ENCA 4HJAA 3NPPA 2OEOA 3R2TA 3FPPA 4KY6A 4A3IB 2E5LQ 4DV1Q 3S1NB 1E7ZA 4IJLA 3X3MA 1PTOC 1MKHA 1CK1A 1ENAA 3PUZA 4IUNA 5HY6A 1W6JA 2CCZA 1C48A 5IP7G 3A54A 1B3QA 1I50B 4QJFA 1BBUA 1KNAA 3NP8A 4BY1B 3E9IA 4JI4L 3KUPA 4HCSA 4XXEA 4MTNA 4BBSH 2RBMA 2G9HD 3MXUA 5FLMH 3JC66 3PIP3 3GTLH 1JR0D 4RAUC 1IKLA 3TZUA 3PUXA 1S5BD 4A3FH 2MFIA 3OTOL 5BR8Q 4EGVA 4LF7L 2BA1A 5FOBB 3GTOH 3UDGA 4CDEC 1XNRQ 5A35A 3MWYW 4LF8L 1VQOA 1IHZA 5LL6X 5IWAQ 2ICEC 1Y69U 1E24A 1E2WA 3UDFA 1IZ6A 2X6LA 2FHTA 2L55A 2K5DA 1LTRD 4JV5Q 2X6GA 2Q2IA 2EYJA 2HT1A 4H7BA 2Z4IA 1BR9A 3M3YB 1E22A 1JCKB 2B2YA 2KEDA 1WFQA 2XIWA 2DNCA 2C5CA 4NP5A 4YHHQ 4JOIA 4C1NI 5M3FH 2ICIA 3NTIA 3KK7A 5IYDH 1VMCA 5M3MH 2AHOB 2VUMH 1H9SA 1KL9A 2YTYA 1MSGA 5C3XA 1QUQA 1IW7C 2K01A 2PI2E 4A3MB 2BE5D 1U5KA 2OCEA 1UUPA 3LGJA 2L11A 4GLAC 2JA8B 4JG2A 5C4ZA 3BJUA 2L5TA 4GKJQ 1IBMQ 4IOAA 4A3BH 1WCMB 5COYA 3HOXG 2QA4A 4DKAC 3QB3A 2V4DA 3BVMA 3KLRA 1LO5D 3PSIA 1Q90A 1EIGA 3JAMc 2BH2A 3W3AA 3M85A 4IO9A 2JSOA 3CC7A 1W2BA 3GTKH 3QG1A 4CKCA 2RDFA 5EGTA 1PVOA 4IPGA 1KDCA 5AJ3L 1QB5D 2F0MA 4DR3Q 5CV8A 4LF6L 2AQ3B 4KKTA 2D0OA 1CKNB 4KHZA 4X66Q 4DAPA 1A6XA 3K81C 3WWVA 1LUZA 2YTXA 2OQ0A 4ID6A 2UXDQ 1OXXK 1LTBD 3HEJA 1RIPA 4MZ9A 5C4XH 3G71A 2QDLA 1BDOA 5I9PA 3UE1A 4OGQC 4P71A 4B3TQ 1CFMA 1F9PA 1NMFA 4C1NK 2ES2A 4LFBL 5I9OA 4R4IA 4KMUC 4RHSA 4A3LH 5CYUA 2F0WA 5K36G 2RHSB 3F2DA 4LUVA 2UU9L 4JI1Q 4DK6C 1HPCA 3S17B 4B3MQ 3D6WA 1IL8A 1GUWA 5ELCA 3K5NA 5M5YB 2A6HC 1UNSA 4RGNA 2LMCB 3TQYA 3FEWX 4HMIA 3C1EA 1JOKA 4IFDH 3PV0A 1PFMA 4BWGB 4TKOB 1X3PA 3L3OC 4C3HB 5IYBG 3L9AX 4JI0L 4ABNA 1O7IA 5CORA 3I73A 1HXYD 3GTPB 1DCZA 1SMYD 2ZTDA 3R8BA 4O1NA 4JYAQ 4R4TA 3PO2H 4DK3C 1AP0A 2UUCQ 5A2QL 1WTWA 5FO9B 2R92G 1WVLA 4A3GG 1QNUA 2AQ1B 3KJOA 2Y0SB 1YHAA 2B39A 1XTCD 4A3JB 4BY1H 1A63A 2JJQA 3PF5A 5L37A 2NN6H 1SE3A 1BF4A 2QILA 4GKKL 1QNKA 3H0GB 3I4MH 2AQ2B 4DK0A 1EEFD 2PW5A 4A93B 4NXML 5IGEA 5HGTA 1N33L 3TP8A 1U4RA 4OELB 3SVMA 5A2QE 3LWEA 2NVQB 4RWSC 4A3EB 2B2VC 3MXGA 4JBKA 4DR6Q 3MA2B 4DV3Q 3H09A 5T1IA 4KHPL 2K5WA 2KA7A 2YU9H 3O13A 4MTKA 1PH3A 1WTVA 3TSSA 4K14A 1GJXA 2F52A 3K7UC 4FF4A 1STEA 3HKSA 1O80A 1YI2A 3J81j 4LF9Q 2NUCA 3BDLA 1CSQA 1MGSA 4JI8L 3M7GA 5I2XA 1HTLD 3U58A 1O7YA 1HNWL 1FYCA 3NELA 1K83H 2EYMA 5EPLA 2B63H 1RJTA 2YTVA 5I6WA 1SYGA 1J9OA 2H4OA 4B3SL 1JE5A 1UEBA 3T56B 1L1OC 3RZDB 4QF4A 5EBCA 4ZYSA 5AJ3Q 4H02A 1TWAB 5NUCA 2FMCA 1HTPA 3F8TA 4E6IA 4QMGA 1DXMA 3DHQA 1IBKL 1WCMH 3D8GA 2R61A 2Q2TA 4AIMA 1W6KA 4LK1C 3F2CA 4DR4Q 4DUYL 1B2TA 1KIXA 2F4VQ 2ALYB 4K5WA 5FO8B 2ZTCA 3F2BA 3NEMA 4RMFA 2KCNA 3MZ5A 4S3SA 4EQ5A 3EA6A 2NVXH 1Y1VH 4LFBQ 2DN8A 3CCQA 3SXHA 3RUZA 2CVRA 4FYDA 3ERQA 1EY7A 4FO2A 3DEOA 1N32L 1B8AA 4FXGC 4QCLA 1LT5D 3W2DA 5M9OA 1YNJD 1B9NA 2NN6I 1CTMA 1XPUA 2F0SA 3HG9A 3SK8A 2F0OA 4OXPA 1GUOA 3B6YA 1FL0A 1LYLA 1PRTB 3CHBD 4A3MG 2I07B 2HCCA 4OHJA 1PTOF 5LMUL 1MI2A 4FF3A 2JA8G 1A2UA 1AH9A 1BOSA 4LUOA 4DFAA 1L0YB 4ZUJA 1I4RA 4KKSA 1EQTA 1ZXTA 5IYCH 1I5FA 1PXUA 4JI0Q 4LF4L 1SNPA 2EXDA 2IPKD 3PF4A 1LTTD 1DONA 1PYSB 5D14A 5CR3A 2VS1A 1E1TA 5IGFA 3F1ZA 4ILWA 5EPKA 3ICEA 1PH8A 1DYQA 2HHHL 4DV5Q 4FF2A 1GOZA 3EN2A 1Q82C 4JC0A 3OWEB 1KLGD 1X3FA 5DEHA 4IUQA 3S9WA 4GOPB 2L15A 4A4IA 1QVCA 1I94Q 1Y1WB 2SEBD 4GKKQ 2VY3A 5C44H 2K5QA 2NWGA 2V1CC 4IFDJ 4L5QA 5C3EG 2L1BA 1JOOA 1N33Q 3AMUA 4ZRZA 2HIVA 1GUSA 3HOYB 2K32A 1NE3A 1PHJA 2NTTA 5CV5A 3MXPA 4LW1A 2VB3X 2ATWA 2A69D 3A7LA 4NB3A 4DV0L 1JE4A 1EEID 4JI3L 2PPBC 3I3CA 1SE8A 2EJMA 5JVH3 2Y0SE 1N36L 3A74A 1WTXA 3GTQH 3MEFA 2LXJA 5D3DA 1J5EQ 5C5LA 1H9RA 1UE1A 3STBD 4DR5L 4RA8A 2ZXRA 1VQ8A 4JI8Q 5KRUA 1C7YA 1YVCA 1HUNA 4C3HG 1HFGA 2MPMA 5K5PA 5C5MA 1CT1D 1SDFA 2B2WC 1JT8A 1RTNA 1HNWQ 2WAQB 3DLLA 1F77A 1EQQA 2E5LL 4DV1L 4BBSB 2F0GA 5FLXc 3GTLB 3CW2C 2FFKB 2BDOA 2L4NA 1IYJB 1TU2B 2Y0SG 1K3BC 3QR8A 1TR5A 4JVZA 4A3JG 4IZ8A 3GTOB 4UAIA 1QE6A 3CRLC 3PO3G 1B53A 1TVXA 3OHXC 1TWGH 5JPMC 1EYGA 3H0GG 3MXNA 2N3SA 4DV6L 3TDQA 3GD7A 1UEAB 3HOZG 3I4OA 1I4QA 1F2LA 4YCVA 1VQ5A 3C3LA 1YEZA 3A5ZB 2LY7A 5LHY1 3VA7A 1QZHA 1D5ZC 1WTQA 2SOBA 4PG3A 3HOWB 2X69A 1N32Q 3NXWA 4MIUA 1JWSD 3UDXA 5BR8L 2OT2A 4FNFA 1H9SB 2NVYH 1XNRL 2Q8IB 1VQFA 1QUQB 5M3MB 2VUMB 1O7LA 4HJ7A 4NPSA 3QJYA 1PTOD 2R3ZA 1NNXA 3TP6A 1N34L 1PA6A 3T4AC 1FD7D 1L0XB 4DN4M 5LMUQ 4MHEA 4F87A 4I65A 3EVQA 1EQVA 5FO7B 4BXXG 4RFBA 4PZ6A 3D6CA 1C9OA 1PYWD 4LAAA 4KN7C 4LF4Q 3M9BA 4R8NA 4A3BB 4DV2Q 1S5FD 1JJ2A 4GN4B 2XRSD 2WB1B 1KDBA 3PGZA 3KBGA 5GAGC 1BO0A 2HDMA 4PQXA 2BDNA 1K0RA 3K59A 2CH4A 4ZQ3A 1IBML 1JB7A 3CMEA 1A2TA 3TRZA 3PUWA 5IP9G 5JJZA 3X3NA 2XRQD 1VQ7A 1FVIA 1UWVA 2PZUA 3IFTA 2N49A 1LTID 4ZCKA 3G7LA 1KHIA 2ZJQA 5J3BA 2LXKA 1HJPA 4TSSA 1K9MC 4DV0Q 2EY5A 1ONLA 1SYFA 3AB9A 4YWLA 3VYTA 3ER0A 3M4YA 1N36Q 2EVBA 4NXNQ 5DM63 1Z47A 3SGIA 2K03A 1A3VA 4KD4A 1Y1WH 3HS0C 1WD0A 1IW7D 1CHPD 1AE2A 4XYQA 3H94A 2CW0C 2XN9C 4XYOA 3G4SA 3RN5A 1CSPA 4DAYA 2A19A 4B3TL 3HOYH 2Z6KA 1AEXA 4LFAQ 3MC0B 2RQXA 1JOQA 2CKZB 2PMZB 3M4OH 1NJIC 1PDQA 3OSOA 1DM0B 2EY6A 4GNXA 1I3QH 3HOUH 2OF1A 3BDCA 2NZOA 1ZKOA 5C3WA 1PFNA 4OX9Q 4JI1L 2CHBD 4B3ML 2RVLA 3T16A 2XVSA 3U4VA 2R7ZB 3PO2B 3MHBA 2DUDA 4KTAA 3S2DB 3R3OA 4A76A 4KY7A 3J7AV 5CV9A 2I0QA 3D4WA 1D7QA 4EVOA 4FXDA 5EKIA 4DNRB 3V2TA 2Q2UA 1XMQQ 4HJ5A 3K0XA 3GP7A 4L6TB 4DV6Q 1SNCA 1B1ZA 1TWCH 4QIWB 2EPBA 2K1BA 2TMPA 4JI7L 5ISRA 2WAQE 1JJGA 1EOVA 2JE6I 2MQHA 3I4MB 1GHJA 1BCPB 1KC8C 4JYAL 1XMOL 2EIFA 3J81i 2F0QA 3BYTB 2UUCL 1PRTC 3C2PA 2WACA 2A6EC 1ESRA 1S40A 3OIQA 5D65A 3GV3A 3HOVH 3NUCA 2F0DA 1EWIA 4NMZA 4N8FA 2K14A 1N34Q 5M5XH 4POGA 4EX5A 2YU9B 5M5WB 4X65L 4FVMA 1BBWA 4JCVE 1JQYD 4TRDA 4ODGA 1I6VC 2F0PA 4IUUA 1Y14B 5CV7A 4OONA 4OWTB 5LMNW 4WJ3M 1IBLQ 4LUZA 1GUNA 3HOWH 3A7AB 1KD1C 2WAQG 1LLRD 2F0JA 4IALA 1EIFA 1XYIA 1HCZA 4BBSG 4DR6L 1IKMA 1XTDA 5FLMG 4A3KH 1K83B 4KJOA 4DV3L 5JJLA 1KABA 3VYSA 1CKOA 4GOPC 1VQJA 2B63B 1PFBA 1EY5A 4A3FG 3IRBA 4IPCA 3E0JA 4OIKA 1HUMA 1STNA 2MGSA 1SYBA 3SHLA 4LF9L 1YNND 5IY0A 1HZCA 3CRKC 3AFPA 3SR1A 1K73C 4GZYC 4OL7A 4ALPA 5D3IB 3DMUA 4UY8C 3AQQA 3PUYA 4RGOS 5TSSA 4L5TA 3KDFA 3TN2A 5E4XA 2WV6D 4P75A 1ZYRD 1CM9A 4DAMA 3I72A 2F4IA 1YJWA 2NVXB 4HIKA 2F0UA 2WB1E 1Y1VB 1SJED 3RZOH 5IGGA 3CCRA 2VQFQ 5M3FG 4F8MA 5IYDG 1PZKD 2O5JC 5M3MG 2VUMG 3NWTA 2RCFA 1TWFH 3BG3A 3U4ZA 3HKZB 2MUYA 3F2UA 2XNAC 4RCNA 3J81L 1WOCA 4C3IH 2IX3A 1SEBD 2PNRC 4DR4L 2A73B 2QW7A 2VW9A 2F4VL 2B2UA 1G6ZA 4PNYA 3OYYA 1SYEA 2M9VA 2E2DC 1EYAA 1RCVD 4UDUC 4OIJA 2JA5B 3OW7A 4DNIA 2B29A 1PYBA 1VCIA 1EZ6A 3KYHC 1C8CA 2WKDA 3E3XA 3RLFA 3S16B 2WB1G 3Q6SA 4OWWB 2I5MX 2TSSA 4CGYB 4H44C 3GV6A 3S15H 3J81E 4PV1C 4R9WA 1DJRD 3SK4A 1MSHA 5H1SE 1E1OA 3CXCA 1H9KA 4QL5A 2JYOA 5AFWA 4DR2L 2E8GA 4A3GH 2A68C 5C0XH 1PH7A 2NVTH 5KGUA 1BXTA 2B2YC 3VR2A 3QO2A 4PMWA 4CJ2C 4JOIC 1HZAA 2PMZE 4JI7Q 2KECA 3BVZA 5C44B 1FGBD 5KEEA 5C4XG 4XDXA 4X3KA 3J80i 2R7ZH 3CKIB 1XMOQ 2QKIC 1E2VA 1T5EA 1RDPD 3CD6A 3S2DH 1ML0D 2O4XA 1AN8A 3ULPA 3Q8DA 2R7FA 4WRDA 1ICFB 4DV5L 4UP8A 2WP8J 2O2LD 5ELFA 1QOHA 3FKIB 3I7FA 4DXGA 4B3RL 5C4JH 2F1MA 2EDGA 3HFZB 2BH8A 4X65Q 1I94L 5JEAH 3GTQB 4F88A 3HRZC 5EBDA 5IGDA 4KJNA 1MD2D 1NCVA 2GN5A 2QEJC 5LL6S 4IFDG 3NBHA 3CPWA 2J4XA 4LFCQ 2JA6B 2R93H 3MTSA 3LNNA 1D8LA 3DWPA 3PMFA 5EKKA 4UP7A 2K5HA 3ND9A 3K6OA 4A3IG 3FVQA 4NW2A 1K8MA 4YY3Q 3I4LA 3TP5A 2K5VA 3U50C 4HSPA 4K2KA 3PO2G 3M7NA 1HQMC 1QJOA 2E76C 1N8RC 5M5WH 3ND8A 1ET6A 5GAEC 2CH4W 3PIOA 1J5EL 2EY1A 1EIYB 2EE1A 3C46A 3NK9A 1XXGA 1NTGA 4PMCA 2NB0A 3N52A 1O7ZA 1HZ9A 4WFN3 1V1OA 1D5MC 1CA5A 4BY1G 4RHRA 2NN6G 3G48A 4R4CA 1G2SA 3MXNB 1K3RA 2HD3A 1KAWA 5KYIA 3QIAA 1TWGB 2AUJD 4GS3A 4KN4C 3PIO3 2L9HA 3BZDB 4CDCC 1VQEA 5JJKA 1TS5A 3I4MG 4N9TA 2KCCA 2RDHA 4KY5A 4QQBX 2Q8RE 1SNOA 3EJIA 4DV7L 3URYA 2DJFC 2IL8A 4KI0A 5C0XI 1L2FA 4X64L 2NVYB 3J80L 3PCOB 3I91A 2E2JH 3EQLC 4Q5VA 1H9MA 4I7ZC 1PFSA 1I4XA 1MBYA 2F3IA 2LKVA 3UDIA 4DXFA 4HN7A 3IFDA 4YCWA 4CKEA 1P8LA 3KLWA 3FPUB 4P74A 1LABA 2K50A 3OW2A 2I46A 2F0IA 2D2CC 2KUMA 1EYCA 1JICA 2KCTA 4IPDA 4QGUA 2HQEA 2RSOA 4G4KA 2J7ZA 3SDZA 1H9JA 2VQEQ 5GADC 3DM1A 4CJ1B 2B63G 1SMYC 3J80E 2IX1A 4P2CB 1EFWA 2K7VA 1PH4A 3CF5A 1OO9B 2LSSA 1WTHA 3AFQA 1IXRA 2H1EA 5E1FA 1R9TH 3TMEA 1WD1A 2K04A 4DR2Q 2EYPA 2JA5H 4BA1I 4ZKCB 1EYDA 1BCPC 2UUBQ 1YITA 1EUJA 3S2HB 3SK5A 1WCMG 2CQOA 2EJFC 1RD9D 3P75A 4KK7A 5ELOA 1VQKA 1BQQT 1QCBD 1XJVA 4JBMA 1X32A 4IOCA 3S16H 4IUTA 4DV2L 1MJEA 1S4ZA 4U673 4GLXA 3CC2A 3VR3A 1YHQA 4MNOA 1D6EC 4IPHA 5J39A 4KHVA 1Y1VG 4OO1H 4BY7H 1PMRA 3DWAA 4HJ8A 1ZEQX 2Z4HA 1DOLA 1PRTF 4LWCA 2RF4A 1U4MA 1Y8OB 3BVGA 3P7JA 1XNQQ 2PQAA 4B3RQ 2YYZA 5CC4A 1XWEA 4FDBA 1PZJD 3QOJA 2KBNA 1CI3M 4DAYB 2N55A 4O0AA 1JMCA 1ET9A 5J1ZA 3TZDA 5IYCG 4FF1A 4BS9A 4GNXB 1PH6A 1I6HB 1S3OA 2B2TA 4A3DH 1D5XC 3M4OB 1I3QB 3HOUB 1UAPA 5I4DA 4DGZA 1HNXQ 5CBAE 3FKIH 1BKBA 4OEMB 1SRUA 5FK9C 1PZID 1F9SA 4NXNL 1SSOA 2E2IB 3PQIA 3RLOA 3KF8A 4LF5Q 4G7HC 5ELBA 1I4GA 2JA6H 3H3VH 4IJHA 4UP9A 3E9HA 4TVAB 3DWQA 4JI5Q 4LFAL 4AYBB 1JWMD 5JEAJ 1SMXA 1EOTA 4ZAIA 4G7ZC 1JWUD 1KAAA 1SBBB 2MO1A 3NBIA 5KNBA 3BDOA 1FNWA 1AE3A 1TWCB 4OX9L 1DD2A 4DV7Q 4X6AH 1J6QA 5FJ8H 2SDFA 1R4PB 1NAPA 1STGA 1MHWC 3ZJYC 1EFID 4LNQA 4X64Q 1SAPA 5GQOA 1WTRA 3HOVB 3OOCA 2KJXA 1SLJA 1XMQL 1WYDA 1YNJC 2EYLA 2IHEA 5M5XB 2HCIA 3SEBA 3DEPA 2AMCB 2CW0D 3IKJA 1YJNA 2XSCA 1J8IA 4OO1I 4A93G 2K4KA 3K58A 5I6YA 4NDXA 2CWPA 4C3JH 4CDDC 3Q0AA 1F9RA 4HCEA 2D5DA 3I4NH 4A3EG 3TEHB 4Z9CB 1A0IA 4K6DA 5G3LF 5LMNQ 1CUKA 2OTJA 3MFYA 1QZGA 5E4WC 1EQRA 2K28A 3HOXB 2JP1A 4A3KB 1S5DD 4JBWA 1VQ4A 4JI2Q 1LT4D 2AWOA 4TQUS 2E2HH 2DJGC 2WKCA 1DOMA 3I56A 5KNCA 5IT9L 2EJGC 2E74C 1IBLL 2IT1A 1K8AC 3K5LA 2UXCQ 1PTOH 3CQZB 3A8KE 4R8IA 3EBEA 3KDFB 1EU3A 1EY0A 1DOKA 2P5ZX 1UE5A 3I90A 4L63B 1S5ED 4A3CH 4BBRH 1PRTD 1VF7A 2ZM6Q 2A6ED 1HNZL 3RMHA 2JA7H 3CCEA 3H3VI 3RZOB 5J22A 3WDNA 1E2ZA 3S2HH 1B9MA 3ONAB 5IT9E 3H3VC 2I5HA 2VNUD 1LT3D 1AZPA 1TWFB 3J7ZC 1NR2A 2ASBA 3KBXA 4RKBA 4CBVA 1STYA 2C35B 3GDEA 4C3IB 2K6AA 2N8NA 3P1HA 4RKLA 2IY5B 1TY0A 1VQPA 3RD4A 1V9PA 3STBC 1PLFA 3DUZA 3S1RB 1QVFA 3GTMH 1CZGA 3EIVA 4QUFA 2MHVA 2VQFL 1NUCA 2F0NA 1C4QA 3IAYA 2Z9HA 4H13C 5DAUA 1I4PA 1IYUA 1CQVA 3TREA 3U9OA 4JK1C 5JJIA 1A8VA 2J0TD 4XT1B 3VA5A 3S15B 1V1PA 1HFNA 3SE0A 3VDYA 2LS01 2RKSA 3UI2A 3I55A 5C4HA 1I6HH 1AW7A 2R6GA 3W5OA 1K0SA 5IP7H 4A3GB 1YJ9A 4XTCS 2NVTB 4DR7Q 3U9SA 4O42A 4H0LC 2A5HA 5FKAC 3J7AF 2JN4A 2E2IH 1HA6A 2PCFB 5IE8A 1G6PA 3GQBA 1VF5C 1VQ9A 2A1AA 5IGCA 1F9QA 1LT6D 1HA5A 3HZXA 2F3VA 4I7AA 2SNSA 4C2MH 1Y1WG 1KDAA 3C1FA 1R4QB 3T1HL 1Q46A 1RL2A 4F7XA 3CAMA 3NTHA 4ZUIA 2OXPA 4AYBE 5C4JB 4YWMA 4ZKBB 4O2DA 4M1UB 3NBHB 3GTJB 2ZT9C 2KHJA 2CQAA 1X55A 3HOYG 2D0PA 2DY7A 3PIPA 2R93B 5G3LD 2FJ2A 1AZQA 4DAVA 3HOUG 1TIID 1WTPA 2PNHA 3S1QH 5ELNA 4DK1A 3TBIB 5HGQA 4N8X1 1TKWB 4YIJA 1CHQD 3J81c 2B8GA 2A6HD 3K7AB 3LX0A 1Q7YC 2QEXA 4AQYL 1PV4A 3ERSX 4Y7NH 4JW0A 1Y8NB 3UE0A 1VQGA 3CPFA 3OMCA 2A68D 1Q1BA 4K5XA 4AYBG 4LFCL 2H5XA 3WOEA 1MIUA 3A8JE 1BCPF 3BU2A 1L0WA 1WI5A 4YY3L 1N9WA 3HOXH 1X6OA 3EFXD 1TWHB 4P72A 1S72A 1FNVA 4G7OC 3MEHA 4CDFC 1WTOA 4QB4A 2EXZA 1IL2A 1OXVA 1HNZQ 4UHVA 1EY6A 2K05A 5DNFA 1W3SA 3NQIA 1JC7A 4DPGA 5JAVA 1QWYA 5EAYA 1Q81C 4K0KL 1G2TA 3IL8A 2F0LA 2Z6KC 3D4DA 4RGMA 3HOVG 1HR0W 1GO3E 1VQNA 2FINB 1Q8KA 4G57A 4EQNA 4GNXC 1AFPA 4DUZQ 2MP1A 1XX8A 3CQZH 3VYUA 5C6AA 4RH6A 3RLNA 1YIJA 1K8GA 2E2JB 1Q3LA 2PI2A 4R1JA 5EQ0A 3KF6A 4HTHA 1VQDA 3HOWG 1TS2A 3NHHA 3JAMi 1DGSA 4X62L 2NYZD 3Q23A 3KOJA 3GTGB 2UUAL 4A3KG 1A3UA 5K36H 1SNDA 3KJPA 1ILQA 1NBWA 2ZJPA 1M8AA 1YNXA 3AU7A 4DF7A 2LFNA 1VQ6A 2DNEA 1IYVA 1TT2A 2IW3A 1FJGQ 1X65A 1R9TB 3NTKA 3K5OA 3AEVA 2NTSA 3NSWA 3RNUA 2JEAI 1DZ1A 1M4VA 3S1RH 1GKHA 2B2VA 4A3BG 1F2MA 5JPNC 3I2ZA 1FNUA 1E0BA 3E5SA 5DLQE 4HEDA 5IYBH 2VQEL 4U68A 1SN8A 4ZLTF 4GLVB 1VQBA 1VQIA 3QWNA 4BY7B 4K5VA 5JOBA 5C3EB 2OWOA 4J8QA 1UE7A 4LMQD 3CP0A 2R92H 3M4QA 3N6RA 3BZCA 2PQAB 3EROA
chains in the Genus database with same CATH topology
3VR5A 1U9RA 3D3RA 3QOLA 1EY4A 1T5XD 1EIHA 1STBA 4C3IG 1V43A 3HGBA 5IIFA 1ILPA 3ITPA 1OXSC 5CBEE 1EWHA 1NSNS 3FMCA 3Q24A 4A3DB 1A3TA 2Q8TA 1Z6HA 1S5CD 1Z7TA 1TS4A 2O5IC 3R2IA 3JAML 4CKBA 1SE2A 1A15A 2F0TA 4IN3A 1BCPD 5C0XG 1BNZA 2BE5C 4WJWA 1YNNC 3FDTA 1TS3A 3PO3B 5JVG3 1QG7A 5ELEA 2PZTA 4L8JA 1SJHD 5KYLA 1EY8A 3S1MB 2EZVA 3K5MA 3HOZB 1LV9A 3JAME 1GUTA 2B2UC 2ZXPA 1EY9A 1ZYRC 1O78A 1JORA 2PQEA 4KKUA 3VYRA 1B3AA 3I70A 2M2LA 5E3FA 5JEAG 5F2DA 2AWNA 4V190 1OXTA 4IUVA 3D31A 4NKLA 1Q1EA 1RKNA 2KQ3A 1K8OA 2SNMA 2C9OA 4C3JB 5CMDA 3LWUA 1SNQA 1Q12A 2RSNA 3I4NB 2G9DA 1ENFA 2FMMA 1TQOA 3H91A 1G291 1CA6A 5HURA 2EY2A 1JB3A 3S14B 2L0CA 3MFGA 1D1IA 1LACA 4DNTB 2IX0A 1GHKA 1ICWA 2WIIB 3NE5B 4J6HA 2Z8LA 4K2LA 2E2HB 4CHTB 2ID0A 4IFDI 5ELDA 2HUGA 1BUVT 2F03A 3V05A 1PTOB 4J1MA 3J7YW 4ZK9B 2KVMA 4HMJA 3KLSX 5CV6A 5EKLA 1STAA 4ULLA 4IURA 4C56C 4BBRB 5CGKA 3NWSA 1RF2D 3Q22A 1KTKA 1D1KA 4BA2I 2JA7B 3OWFA 4CJ0B 1CQFA 2B2WA 1EWCA 4B08A 3ZYYX 2PZWA 5IODA 5EPJA 2MJ8A 2JXMB 4FP5D 3KLSA 1U4PA 1VDZA 4DU9A 2F3WA 3GTMB 3TP7A 1II3A 1NR4A 3VR4A 5KIXA 5T1GA 4K8JA 3T53B 2A74C 4X3UA 3HP3A 1V1PB 3A56A 4XQNA 5C0XJ 2QDBA 4N9PA 3G6JB 1B4OA 1X3QA 1U4LA 1I4HA 1SFOB 4ME5A 1ESFA 3PUVA 2PW7A 4OO1G 3BS1A 4EQPA 3H6MA 2EYFA 4RCOA 1Q8IA 2EYOA 4X3SA 1LTGD 4IUPA 1F2YA 2NZ1D 1D2BA 4C2MB 2M00A 2BCOA 3K0YA 3GO5A 3SK6A 1RTOA 1G91A 1KLUD 1V8QA 2VXWA 5BN5A 3T13A 4M8AA 3P20A 4RGTA 2KOLA 3MVVA 4B9WA 3S1QB 2IWHA 1F2ZA 2N88A 4XQQA 3OPOA 1G8ZD 1SXTA 4KD3A 4MN3A 5DM73 2JEBI 5CV4A 1RHPA 2NBFA 4Y7NB 4A3FB 3A8IE 4XQJA 1B50A 1HQRD 2ZXOA 3BYYB 2RDGA 1Y8PB 2XWBB 2F0EA 4K8IA 2IJ0A 1SYCA 2WINB 3E6ZX 4X3TA 2F0HA 5I2YA 1HHVA 4EQOA 2EYHA 2F0KA 2VB2X 4K6LA 1LTAD 1VMPA 3VR6A 2GA4B 2B8FA 2B2TC 2D62A 2PO4A 1GXDC 3FRPB 5M3FB 5KNDA 2D9UA 5IGBA 5EJWA 4B9XA 1LTSD 4FXKC 4XT3B 3OIPA 4C3JG 1B44D 2L12A 3CU7A 2KEEA 2BOSA 5BN4A 1OXUA 2A69C 4Q0FA 5FLXL 1FR3A 5IOCA 3GTKB 3I8ZA 4IQZA 4V0BA 3MAQA 2Z1CA 3A55A 2F0FA 2K33A 1GUGA 1SNMA 1EU4A 3OMGA 3R93A 3V96A 2KHSA 3T51B 3NQTA 5C4XB 1EZ8A 1QILA 4QUCA 5FLXE 1HRJA 2E75C 2HDLA 2RA4A 1BBXC 1TY2A 1KNEA 3WOFA 5BN3A 2R92B 4LJZC 3K57A 3D4RA 3L7ZC 1STHA 2EOTA 2BA0A 2QF7A 1SYDA 2PYKA 1CZWA 2DY8A 3DXJC 2QCPX 4DA2A 2XWJB 1SE4A 4WORA 4XIGS 2F0VA 2ENBA 4HSVA 2AUKA 1RODA 4KV6A 4PMBA 4HAEA 1EL0A 4HR7B 1ENCA 3NPPA 2OEOA 3R2TA 3FPPA 4KY6A 4A3IB 3S1NB 3X3MA 1PTOC 1CK1A 1ENAA 3PUZA 4IUNA 1W6JA 1C48A 3A54A 1I50B 1KNAA 3NP8A 4BY1B 3KUPA 4HCSA 4XXEA 2RBMA 2G9HD 3MXUA 3PIP3 4RAUC 1JR0D 1IKLA 3TZUA 3PUXA 1S5BD 4EGVA 2BA1A 5FOBB 5A35A 3MWYW 1IHZA 5LL6X 2ICEC 1Y69U 1E2WA 2X6LA 2FHTA 2L55A 2K5DA 1LTRD 2X6GA 2EYJA 4H7BA 2Z4IA 1BR9A 3M3YB 2KEDA 1JCKB 2B2YA 2XIWA 2DNCA 2C5CA 4NP5A 4C1NI 2ICIA 3NTIA 3KK7A 1VMCA 1H9SA 1MSGA 5C3XA 1IW7C 2K01A 4A3MB 2BE5D 1UUPA 2L11A 2JA8B 5C4ZA 2L5TA 1WCMB 5COYA 3QB3A 2V4DA 3BVMA 3KLRA 1LO5D 1Q90A 1EIGA 3W3AA 3M85A 2JSOA 3QG1A 4CKCA 2RDFA 5EGTA 1KDCA 1QB5D 2F0MA 5CV8A 2AQ3B 4KKTA 4KHZA 4DAPA 1A6XA 4ID6A 1OXXK 1LTBD 3HEJA 1BDOA 5I9PA 4OGQC 1CFMA 1F9PA 4C1NK 5I9OA 4KMUC 4RHSA 5CYUA 2F0WA 5K36G 1HPCA 3S17B 3D6WA 1IL8A 1GUWA 5ELCA 3K5NA 5M5YB 2A6HC 1UNSA 4RGNA 2LMCB 3FEWX 4HMIA 3C1EA 1JOKA 4IFDH 3PV0A 1PFMA 4BWGB 4TKOB 1X3PA 3L3OC 4C3HB 3L9AX 4ABNA 5CORA 3I73A 1HXYD 3GTPB 1DCZA 1SMYD 3R8BA 4O1NA 1AP0A 5A2QL 1WTWA 5FO9B 1WVLA 1QNUA 2AQ1B 2Y0SB 2B39A 1XTCD 4A3JB 2NN6H 1SE3A 1BF4A 2QILA 1QNKA 3H0GB 2AQ2B 4DK0A 1EEFD 2PW5A 4A93B 5IGEA 5HGTA 3TP8A 1U4RA 3SVMA 5A2QE 3LWEA 2NVQB 4RWSC 4A3EB 2B2VC 3MXGA 3MA2B 3H09A 5T1IA 2K5WA 2KA7A 3O13A 1WTVA 3TSSA 4K14A 1GJXA 4FF4A 1STEA 1O80A 2NUCA 3BDLA 1MGSA 3M7GA 5I2XA 1HTLD 1O7YA 1FYCA 2EYMA 5EPLA 1RJTA 5I6WA 1SYGA 1J9OA 2H4OA 3T56B 3RZDB 4QF4A 5EBCA 4ZYSA 1TWAB 5NUCA 2FMCA 1HTPA 4E6IA 4QMGA 1DXMA 3DHQA 3D8GA 2R61A 1W6KA 4LK1C 1B2TA 4K5WA 5FO8B 2KCNA 3MZ5A 4S3SA 3EA6A 2DN8A 3SXHA 3RUZA 2CVRA 4FYDA 3ERQA 1EY7A 4FO2A 3DEOA 4FXGC 4QCLA 1LT5D 3W2DA 5M9OA 1YNJD 1B9NA 2NN6I 1CTMA 2F0SA 3HG9A 3SK8A 2F0OA 1GUOA 1PRTB 3CHBD 2I07B 2HCCA 4OHJA 1PTOF 1MI2A 4FF3A 1A2UA 1BOSA 4DFAA 1L0YB 4ZUJA 1I4RA 4KKSA 1EQTA 1ZXTA 1PXUA 1SNPA 2IPKD 1LTTD 1DONA 5D14A 5CR3A 5IGFA 4ILWA 5EPKA 1DYQA 4FF2A 1GOZA 3OWEB 1KLGD 5DEHA 4IUQA 3S9WA 1Y1WB 2SEBD 2K5QA 2NWGA 4IFDJ 2L1BA 1JOOA 3AMUA 4ZRZA 1GUSA 3HOYB 2K32A 2NTTA 5CV5A 3MXPA 2VB3X 2A69D 3A7LA 1JE4A 1EEID 2PPBC 3I3CA 2EJMA 5JVH3 1WTXA 5D3DA 5C5LA 1H9RA 4RA8A 2ZXRA 5KRUA 1HUNA 4C3HG 1HFGA 2MPMA 5K5PA 5C5MA 1CT1D 1SDFA 2B2WC 1RTNA 2WAQB 1F77A 4BBSB 2F0GA 3GTLB 2FFKB 2BDOA 2L4NA 1TU2B 1TR5A 4IZ8A 3GTOB 4UAIA 1QE6A 3CRLC 1B53A 1TVXA 3OHXC 5JPMC 3MXNA 3TDQA 3GD7A 1UEAB 1I4QA 1F2LA 3C3LA 2LY7A 5LHY1 3VA7A 1D5ZC 1WTQA 2SOBA 3HOWB 2X69A 3NXWA 4MIUA 1JWSD 2OT2A 4FNFA 1H9SB 2Q8IB 5M3MB 2VUMB 1O7LA 3QJYA 1PTOD 2R3ZA 3TP6A 3T4AC 1FD7D 1L0XB 4DN4M 4MHEA 4F87A 4I65A 3EVQA 1EQVA 5FO7B 4RFBA 3D6CA 1PYWD 4LAAA 4KN7C 4R8NA 4A3BB 1S5FD 2XRSD 2WB1B 1KDBA 3KBGA 1BO0A 2HDMA 4PQXA 2BDNA 3K59A 4ZQ3A 1A2TA 3PUWA 5JJZA 3X3NA 2XRQD 2PZUA 3IFTA 1LTID 3G7LA 4TSSA 2EY5A 1ONLA 1SYFA 3AB9A 3VYTA 3M4YA 2EVBA 5DM63 1Z47A 2K03A 1A3VA 4KD4A 3HS0C 1WD0A 1IW7D 1CHPD 4XYQA 3H94A 2CW0C 2XN9C 4XYOA 4DAYA 1AEXA 2RQXA 3MC0B 1JOQA 2PMZB 1PDQA 3OSOA 1DM0B 2EY6A 2OF1A 3BDCA 1ZKOA 5C3WA 1PFNA 2CHBD 2RVLA 3T16A 2XVSA 2R7ZB 3PO2B 3MHBA 4KTAA 3S2DB 3R3OA 4KY7A 3J7AV 5CV9A 3D4WA 4EVOA 4FXDA 5EKIA 4DNRB 3V2TA 3GP7A 4L6TB 1SNCA 1B1ZA 4QIWB 2EPBA 2K1BA 2TMPA 5ISRA 2JE6I 3I4MB 1GHJA 1BCPB 2F0QA 3BYTB 1PRTC 3C2PA 2WACA 2A6EC 1ESRA 3OIQA 5D65A 3GV3A 3NUCA 2F0DA 4NMZA 2YU9B 5M5WB 4FVMA 1JQYD 4TRDA 4ODGA 1I6VC 2F0PA 4IUUA 5CV7A 1GUNA 3A7AB 1LLRD 2F0JA 4IALA 1XYIA 1HCZA 1IKMA 1K83B 4KJOA 1KABA 3VYSA 2B63B 1PFBA 1EY5A 3E0JA 4OIKA 1HUMA 1STNA 2MGSA 1SYBA 3SHLA 1YNND 3CRKC 3SR1A 4GZYC 4OL7A 5D3IB 3DMUA 3PUYA 4RGOS 5TSSA 3TN2A 5E4XA 2WV6D 1ZYRD 1CM9A 3I72A 2F4IA 2NVXB 2F0UA 1Y1VB 1SJED 5IGGA 4F8MA 1PZKD 2O5JC 3NWTA 3BG3A 3HKZB 2MUYA 3F2UA 2XNAC 4RCNA 3J81L 2IX3A 1SEBD 2PNRC 2A73B 2B2UA 1G6ZA 4PNYA 1SYEA 2M9VA 2E2DC 1EYAA 1RCVD 4UDUC 4OIJA 2JA5B 3OW7A 1VCIA 1EZ6A 1C8CA 2WKDA 3RLFA 3S16B 3Q6SA 2TSSA 4CGYB 4H44C 3GV6A 3J81E 4PV1C 4R9WA 1DJRD 3SK4A 1MSHA 1H9KA 2JYOA 5AFWA 2A68C 5C0XH 5KGUA 1BXTA 2B2YC 3VR2A 3QO2A 4PMWA 4CJ2C 2KECA 3BVZA 5C44B 1FGBD 5KEEA 4XDXA 4X3KA 3CKIB 2QKIC 1E2VA 1T5EA 1RDPD 1ML0D 2O4XA 1AN8A 4WRDA 2WP8J 2O2LD 5ELFA 1QOHA 3FKIB 4DXGA 2F1MA 2EDGA 5JEAH 3GTQB 4F88A 3HRZC 5EBDA 5IGDA 4KJNA 1MD2D 1NCVA 5LL6S 2QEJC 4IFDG 3NBHA 2J4XA 2JA6B 3MTSA 3LNNA 3DWPA 3PMFA 5EKKA 3ND9A 3K6OA 3FVQA 4NW2A 1K8MA 3I4LA 3TP5A 4HSPA 4K2KA 3M7NA 1HQMC 1QJOA 2E76C 3ND8A 1ET6A 2EY1A 2EE1A 3C46A 3NK9A 1XXGA 4PMCA 2NB0A 3N52A 1O7ZA 4WFN3 1V1OA 1D5MC 1CA5A 4RHRA 2NN6G 1G2SA 5KYIA 3QIAA 1TWGB 2AUJD 4KN4C 3PIO3 2L9HA 3BZDB 1TS5A 4N9TA 2KCCA 2RDHA 4KY5A 2Q8RE 1SNOA 3EJIA 3URYA 2IL8A 4KI0A 5C0XI 2NVYB 3J80L 3I91A 3EQLC 4Q5VA 1H9MA 4I7ZC 1I4XA 1MBYA 2LKVA 4DXFA 4HN7A 3IFDA 4CKEA 3FPUB 1LABA 2I46A 2F0IA 2D2CC 2KUMA 1EYCA 1JICA 2HQEA 2RSOA 4G4KA 3SDZA 2J7ZA 1H9JA 3DM1A 4CJ1B 1SMYC 3J80E 2IX1A 4P2CB 2K7VA 1OO9B 2H1EA 5E1FA 3TMEA 1WD1A 2K04A 2EYPA 4BA1I 4ZKCB 1EYDA 1BCPC 3S2HB 3SK5A 2EJFC 1RD9D 3P75A 4KK7A 1BQQT 1QCBD 1X32A 4IUTA 1S4ZA 4U673 3VR3A 1D6EC 5J39A 4KHVA 4OO1H 1PMRA 3DWAA 1ZEQX 2Z4HA 1DOLA 1PRTF 1U4MA 1Y8OB 3BVGA 3P7JA 2YYZA 5CC4A 1XWEA 1PZJD 3QOJA 1CI3M 2N55A 1ET9A 5J1ZA 3TZDA 4FF1A 4BS9A 1I6HB 2B2TA 1D5XC 3M4OB 1I3QB 3HOUB 1UAPA 5I4DA 4DGZA 5CBAE 5FK9C 1PZID 1F9SA 1SSOA 2E2IB 3KF8A 4G7HC 5ELBA 1I4GA 3DWQA 4AYBB 1JWMD 5JEAJ 4G7ZC 1EOTA 4ZAIA 1JWUD 1KAAA 1SBBB 3NBIA 5KNBA 3BDOA 1FNWA 1TWCB 1DD2A 2SDFA 1R4PB 1NAPA 1STGA 1EFID 1SAPA 1WTRA 3HOVB 3OOCA 2KJXA 1YNJC 2EYLA 5M5XB 2HCIA 3SEBA 3DEPA 2CW0D 3IKJA 2XSCA 1J8IA 4OO1I 3K58A 5I6YA 4NDXA 3Q0AA 1F9RA 4HCEA 2D5DA 4Z9CB 4K6DA 5G3LF 3MFYA 5E4WC 3HOXB 2K28A 2JP1A 4A3KB 1S5DD 4JBWA 1LT4D 2AWOA 4TQUS 2WKCA 1DOMA 5KNCA 5IT9L 2EJGC 2E74C 2IT1A 3K5LA 1PTOH 3CQZB 3A8KE 4R8IA 1EU3A 1EY0A 1DOKA 3I90A 4L63B 1S5ED 1PRTD 1VF7A 2A6ED 3RMHA 3RZOB 5J22A 3WDNA 1E2ZA 1B9MA 3ONAB 5IT9E 3H3VC 2VNUD 1LT3D 1AZPA 1TWFB 1NR2A 3KBXA 4RKBA 4CBVA 1STYA 4C3IB 2K6AA 3P1HA 4RKLA 1TY0A 3RD4A 1PLFA 3DUZA 3S1RB 1CZGA 4QUFA 2MHVA 1NUCA 2F0NA 1C4QA 3IAYA 4H13C 5DAUA 1I4PA 1IYUA 1CQVA 3U9OA 4JK1C 2J0TD 3VA5A 4XT1B 3S15B 1V1PA 1HFNA 3SE0A 2LS01 2RKSA 3UI2A 5C4HA 1AW7A 2R6GA 4A3GB 4XTCS 2NVTB 3U9SA 4O42A 4H0LC 2A5HA 5FKAC 3J7AF 1HA6A 2PCFB 3GQBA 1VF5C 5IGCA 1F9QA 1LT6D 1HA5A 3HZXA 2F3VA 2SNSA 1KDAA 3C1FA 1R4QB 4F7XA 4ZUIA 3NTHA 5C4JB 2OXPA 4ZKBB 4M1UB 3GTJB 2ZT9C 2CQAA 2DY7A 2R93B 5G3LD 2FJ2A 1AZQA 4DAVA 1TIID 1WTPA 4DK1A 3TBIB 1TKWB 4YIJA 1CHQD 2B8GA 2A6HD 3K7AB 3LX0A 1Y8NB 3OMCA 2A68D 1Q1BA 4K5XA 3WOEA 3A8JE 1BCPF 3EFXD 1TWHB 1FNVA 4G7OC 3MEHA 1WTOA 4QB4A 2EXZA 1OXVA 1EY6A 2K05A 5DNFA 3NQIA 1JC7A 5JAVA 1QWYA 1G2TA 3IL8A 2F0LA 3D4DA 4RGMA 2FINB 4G57A 4EQNA 1AFPA 2MP1A 1XX8A 3VYUA 5C6AA 4RH6A 2E2JB 1Q3LA 5EQ0A 4HTHA 1TS2A 3NHHA 2NYZD 3Q23A 3GTGB 1A3UA 5K36H 1SNDA 1ILQA 1M8AA 3AU7A 4DF7A 2LFNA 2DNEA 1IYVA 1TT2A 2IW3A 1R9TB 3NTKA 3K5OA 2NTSA 3NSWA 2JEAI 1DZ1A 1M4VA 2B2VA 1F2MA 5JPNC 1FNUA 1E0BA 3E5SA 4HEDA 4U68A 4ZLTF 3QWNA 4BY7B 4K5VA 5JOBA 5C3EB 4J8QA 4LMQD 3N6RA 3EROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMC A;  3SHL A;  2PW7 A;  4K5X A;  2EY2 A;  1U9R A;  3QOL A;  1EY4 A;  5CR3 A;  1STB A;  4EQP A;  5IGF A;  1AEX A;  3H6M A;  2EYF A;  1STG A;  1JOQ A;  3OSO A;  2SOB A;  3SR1 A;  2EY6 A;  3NP8 A;  4J6H A;  5E1F A;  4OL7 A;  2OF1 A;  3BDC A;  2EYO A;  5IIF A;  3TME A;  1NUC A;  2F0N A;  3NXW A;  4K14 A;  3DMU A;  4K2L A;  4ID6 A;  4KJN A;  4MIU A;  5C3W A;  5IGD A;  2EYP A;  3HEJ A;  5DAU A;  3MEH A;  1EYD A;  1F2Y A;  3ITP A;  2RBM A;  3SK5 A;  3U9O A;  5I9P A;  2NUC A;  3BDL A;  4QB4 A;  3PMF A;  3P75 A;  2EXZ A;  5DEH A;  3T16 A;  2F0U A;  2M00 A;  3S9W A;  1NSN S;  3MHB A;  2EYL A;  1EY6 A;  4KTA A;  5EKK A;  3TP6 A;  3VA5 A;  5I9O A;  5IOC A;  1A3T A;  5JAV A;  5IGG A;  3R3O A;  2F0W A;  4J1M A;  2F0L A;  3D4D A;  4I65 A;  3SK6 A;  2RKS A;  3TP5 A;  3EVQ A;  4F8M A;  4KY7 A;  4HMJ A;  5C4H A;  5I6Y A;  4NDX A;  1EQV A;  5CV6 A;  1STA A;  3D4W A;  4G57 A;  5CV9 A;  4K2K A;  2EYM A;  4KHV A;  4EQN A;  4EVO A;  5CGK A;  5J39 A;  1JOO A;  3D6C A;  3V2T A;  3T13 A;  2F0F A;  4LAA A;  5I6W A;  1IHZ A;  1SYG A;  5C6A A;  4R8N A;  3MVV A;  4QF4 A;  5CV5 A;  1SNC A;  3MXP A;  4K6D A;  1SNM A;  2EY1 A;  4B9W A;  3OWF A;  4PNY A;  2F0T A;  3OMG A;  5ISR A;  3NK9 A;  5NUC A;  1SYE A;  4HMI A;  3C1E A;  4PMC A;  1JOK A;  1EYA A;  4HTH A;  4E6I A;  2KHS A;  3NQT A;  4QMG A;  1F2Z A;  3NHH A;  1KDB A;  3DHQ A;  1EZ8 A;  2F0Q A;  3D8G A;  5CC4 A;  2PZW A;  4KD3 A;  1EZ6 A;  2EYJ A;  5IOD A;  5KYI A;  2WAC A;  4H7B A;  5EKL A;  3QOJ A;  5CV4 A;  5IGC A;  5C5L A;  4NP5 A;  4N9T A;  2PZT A;  1A3U A;  4K5W A;  3HZX A;  4KY5 A;  5KYL A;  1SND A;  4DU9 A;  1EY8 A;  3MZ5 A;  2F0D A;  1SNO A;  3EJI A;  2F3V A;  3NUC A;  4S3S A;  2SNS A;  4NMZ A;  5J1Z A;  5KRU A;  4DF7 A;  1KDA A;  1STH A;  3C1F A;  5K5P A;  2F3W A;  4ZQ3 A;  5C5M A;  1EY9 A;  4F7X A;  5C3X A;  4ZUI A;  3SXH A;  3TP7 A;  1TT2 A;  1II3 A;  2OXP A;  3RUZ A;  1JOR A;  1A2T A;  3ERQ A;  5KIX A;  3SK4 A;  1SYD A;  1EY7 A;  2PQE A;  2PYK A;  4DGZ A;  1EY0 A;  2F0E A;  4K8I A;  4K8J A;  4TRD A;  1SYC A;  2PZU A;  4ODG A;  5CV7 A;  2F0P A;  5M9O A;  2F0H A;  4WOR A;  2F0G A;  2F0S A;  5C4Z A;  1F2M A;  5E3F A;  5KGU A;  3SK8 A;  2F0V A;  2ENB A;  2F0O A;  4NKL A;  3E5S A;  4EQO A;  4KV6 A;  2F0J A;  4IAL A;  5F2D A;  4PMB A;  5J22 A;  2EYH A;  2F0K A;  1ENC A;  3QB3 A;  2LKV A;  1TR5 A;  5KEE A;  1A2U A;  2EY5 A;  1RKN A;  2KQ3 A;  2OEO A;  4IZ8 A;  1SYF A;  2SNM A;  2QDB A;  4KY6 A;  4DFA A;  4YIJ A;  4KJO A;  4N9P A;  4ZUJ A;  1KAB A;  2F0I A;  2PW5 A;  1SNQ A;  3LX0 A;  5IGE A;  1A3V A;  4KD4 A;  5HGT A;  3TP8 A;  1EYC A;  1EY5 A;  2RDF A;  4K5V A;  4RKB A;  5IGB A;  1STY A;  5JOB A;  1SNP A;  2O4X A;  1ENA A;  5EGT A;  3P1H A;  1KAA A;  1TQO A;  1STN A;  4RKL A;  1KDC A;  4IUN A;  4ME5 A;  4WRD A;  2HQE A;  4B9X A;  2F0M A;  5CV8 A;  1SYB A;  5HUR A;  3ERO A; 
#chains in the Genus database with same CATH topology
 3VR5 A;  1U9R A;  3D3R A;  3QOL A;  1EY4 A;  1T5X D;  1YHB A;  2UUB L;  1EIH A;  1KXL A;  1STB A;  3T1H Q;  2QGQ A;  4C3I G;  1V43 A;  3HGB A;  2RCN A;  2GVA A;  1E3P A;  5IIF A;  1ILP A;  1L1O A;  3ITP A;  2VZA A;  1OXS C;  4JPB W;  5CBE E;  3J7A 5;  4ME3 A;  4HJ9 A;  1EWH A;  1WJJ A;  4A3L G;  1FGU A;  1NSN S;  3FMC A;  3Q24 A;  4A3D B;  2GVB A;  1A3T A;  2Q8T A;  1Z6H A;  1S5C D;  1Z7T A;  4JI4 Q;  1TS4 A;  4A3I H;  2HQL A;  1SR3 A;  3J80 c;  2CFM A;  2O5I C;  1XNQ L;  1SRO A;  3R2I A;  3S1N H;  3KF8 B;  1HZB A;  4CKB A;  1SE2 A;  3JAM L;  3W1G A;  4AQY Q;  1A15 A;  3GTJ H;  3OTO Q;  4QIW E;  3ULJ A;  2F0T A;  2K75 A;  4IN3 A;  3CC4 A;  4LF7 Q;  1BCP D;  5C0X G;  2I5L X;  1BNZ A;  1I50 H;  2BE5 C;  2K5N A;  4KLK A;  4WJW A;  4R4O A;  4LF8 Q;  4P73 A;  3K8A A;  1YNN C;  3FDT A;  1TS3 A;  3RR5 A;  3PO3 B;  2JK8 A;  1HNX L;  5JVG 3;  4POF A;  1QG7 A;  5ELE A;  2PZT A;  1Z9F A;  2R7Z G;  4L8J A;  1SJH D;  5KYL A;  3K7A H;  1Q86 C;  4R4Q A;  1EY8 A;  3NEN A;  3CCM A;  3S1M B;  3DM3 A;  2EZV A;  2A8V A;  3K5M A;  3HOZ B;  1LV9 A;  2FXQ A;  3JAM E;  1GUT A;  1BVS A;  2B2U C;  2ZXP A;  1PH1 A;  1EY9 A;  1ZYR C;  1O78 A;  4LF5 L;  4K0K Q;  1JOR A;  1JJC B;  2PQE A;  4KKU A;  1M1K C;  3VYR A;  1B7Y B;  1B3A A;  4JI5 L;  3I70 A;  2M2L A;  5E3F A;  5JEA G;  1PH2 A;  5F2D A;  2AWN A;  4JI6 L;  4QY7 A;  4V19 0;  1TWH H;  4Y52 H;  1OXT A;  4IUV A;  3D31 A;  4NKL A;  1V1Q A;  1Q1E A;  1RKN A;  2KQ3 A;  1K8O A;  2SNM A;  2R93 G;  2C9O A;  4C3J B;  5CMD A;  3LWU A;  1SNQ A;  1Q12 A;  1MJC A;  2RSN A;  4X62 Q;  3I4N B;  2OTL A;  3M3Y H;  2G9D A;  1ENF A;  2FMM A;  1TQO A;  3H91 A;  2UUA Q;  2JA9 A;  1G29 1;  2KEN A;  1LTL A;  5HUR A;  1PH9 A;  1CA6 A;  2EY2 A;  1VQA A;  1JB3 A;  1YBY A;  3S14 B;  4A75 A;  2L0C A;  3MFG A;  5GRO A;  1D1I A;  1VQM A;  1LAC A;  4DNT B;  2IX0 A;  4HIO A;  1GHK A;  1ICW A;  2WII B;  3NE5 B;  4J6H A;  2DGY A;  1CKM A;  4A3M H;  2Z8L A;  4K2L A;  2E2H B;  4CHT B;  2OQK A;  2ID0 A;  4LF6 Q;  4L5S A;  4IFD I;  2JA8 H;  4UPA A;  5ELD A;  2HUG A;  4DR1 L;  1BUV T;  2F03 A;  3GTG H;  3V05 A;  1PTO B;  5LMN L;  2CWA A;  4J1M A;  3J7Y W;  4ZK9 B;  2KVM A;  4HMJ A;  2IHF A;  3KLS X;  5CV6 A;  5EKL A;  1STA A;  4ULL A;  4IUR A;  4C56 C;  4BBR B;  5CGK A;  3NWS A;  1RF2 D;  3HKZ E;  4JI2 L;  3Q22 A;  1X3G A;  1KTK A;  1D1K A;  4BA2 I;  2ZJR A;  2JA7 B;  3OWF A;  4CJ0 B;  1CQF A;  2B2W A;  3CCJ A;  2Z6B A;  2UU9 Q;  3CCL A;  1C0A A;  1EWC A;  4B08 A;  3ZYY X;  3L0O A;  2PZW A;  2UXC L;  1CKN A;  3K80 C;  4APV A;  3W1B A;  5IOD A;  1HR0 L;  5EPJ A;  2MJ8 A;  2JXM B;  4FP5 D;  4WJ4 A;  3KLS A;  1U4P A;  1VDZ A;  4DU9 A;  2KHI A;  5C3E H;  2ZM6 L;  2F3W A;  3GTM B;  3TP7 A;  1II3 A;  3CCU A;  3CCV A;  1NR4 A;  3VR4 A;  5KIX A;  1HH2 P;  5T1G A;  3HKZ G;  1VQH A;  4K8J A;  3T53 B;  2A74 C;  4X3U A;  2UXB L;  3S17 H;  3HP3 A;  4GN3 B;  1V1P B;  1KRT A;  5M5Y H;  3A56 A;  2B3G A;  4XQN A;  3T1Y L;  2JA5 G;  5C0X J;  1X54 A;  2QDB A;  4N9P A;  3A5U A;  2JQO A;  4C3H H;  3G6J B;  1B4O A;  1X3Q A;  1U4L A;  1I4H A;  3GTP H;  1SFO B;  4ME5 A;  1ESF A;  4RG1 A;  3PUV A;  3G6E A;  2PW7 A;  4OO1 G;  1ASY A;  3BS1 A;  4BY7 G;  4EQP A;  3H6M A;  2EYF A;  4NXM Q;  2Q2H A;  4RCO A;  1Q8I A;  2EYO A;  4X3S A;  5IT9 c;  1LTG D;  2AKW B;  4IUP A;  2HIX A;  1F2Y A;  4A3J H;  2NZ1 D;  1D2B A;  4C2M B;  4DR7 L;  2M00 A;  4KHP Q;  4PZ8 A;  3CCS A;  5C44 G;  3PO3 H;  4JI6 Q;  1T9H A;  2BCO A;  3K0Y A;  3L2P A;  3GO5 A;  3H0G H;  4PZ7 A;  3SK6 A;  1RTO A;  3S1M H;  3TS2 A;  1G91 A;  1KLU D;  3HOZ H;  1V8Q A;  4A93 H;  4A3D G;  4DV4 L;  2VXW A;  1OTC A;  5BN5 A;  3T13 A;  4M8A A;  3P20 A;  4RGT A;  4YCU A;  2KOL A;  3MVV A;  1A62 A;  2NVQ H;  1GD7 A;  4B9W A;  4A3E H;  3S1Q B;  3FKI G;  2IWH A;  2XTI A;  2VL6 A;  3ULL A;  3A0J A;  1F2Z A;  2N88 A;  4XQQ A;  3OPO A;  1G8Z D;  1SXT A;  4KD3 A;  4B3S Q;  4MN3 A;  5DM7 3;  2JEB I;  5CV4 A;  1RHP A;  2JA6 G;  3TS0 A;  2NBF A;  4Y7N B;  4HID A;  4A3F B;  4L5R C;  2EQS A;  1NY4 A;  3A8I E;  4XQJ A;  2RHQ B;  1X9N A;  4BXX H;  4DR1 Q;  1B50 A;  3E0E A;  1IBK Q;  1HQR D;  1U0L A;  2ZXO A;  3BYY B;  4OWX B;  1LM0 A;  4HIM A;  4DUY Q;  2R7D A;  2RDG A;  1Y8P B;  2XWB B;  2F0E A;  1VQC A;  4K8I A;  3S14 H;  2IJ0 A;  1SYC A;  3D0F A;  1YZ6 A;  2WIN B;  3E6Z X;  5FJ8 G;  4YWK A;  4X3T A;  4GN5 A;  2F0H A;  2N78 A;  5I2Y A;  1NMG A;  1HHV A;  3RZD H;  4EQO A;  5GAH C;  2EYH A;  2F0K A;  2VB2 X;  4K6L A;  1TWA H;  1LTA D;  1GM5 A;  1VMP A;  3VR6 A;  2GA4 B;  2B8F A;  3H15 A;  2B2T C;  2D62 A;  2PO4 A;  3CMA A;  4JBJ A;  1GXD C;  3FRP B;  5M3F B;  5KND A;  1K28 A;  2D9U A;  3AYH B;  3FP9 A;  3S24 A;  4AH6 A;  1HR0 Q;  5IGB A;  1X56 A;  5EJW A;  5IWA L;  3KF6 B;  4B9X A;  3RN2 A;  1LTS D;  4FXK C;  4XT3 B;  3BZK A;  3OIP A;  4C3J G;  5IP9 H;  1B44 D;  1G51 A;  2L12 A;  1PH5 A;  3CU7 A;  3I4N G;  2KEE A;  2BOS A;  4JV5 L;  1KRS A;  3KFU A;  2YV5 A;  5BN4 A;  1OXU A;  1XPO A;  2A69 C;  4YHH L;  2UXB Q;  1B70 B;  2WFW A;  4Q0F A;  4DUZ L;  1XPR A;  2G5D A;  5FLX L;  1FR3 A;  5IOC A;  1VQL A;  3GTK B;  3I8Z A;  3T1Y Q;  1X3E A;  2Z0S A;  4IQZ A;  2XGT A;  1KQS A;  2HHH Q;  4V0B A;  1M90 C;  3MAQ A;  2Z1C A;  3A55 A;  2F0F A;  1QVG A;  2K33 A;  4GKJ L;  1GUG A;  3M4P A;  1TXY A;  2MNA A;  1P16 A;  1SNM A;  2K52 A;  1EU4 A;  3OMG A;  4A3C G;  4BBR G;  3R93 A;  3V96 A;  2KHS A;  3T51 B;  3NQT A;  1VS0 A;  5C4X B;  1EZ8 A;  2JA7 G;  1QIL A;  4QUC A;  5FLX E;  1FJG L;  1HRJ A;  2E75 C;  2HDL A;  2RA4 A;  1BBX C;  1TY2 A;  1KNE A;  3WOF A;  5BN3 A;  4DR3 L;  2R92 B;  4LJZ C;  3K57 A;  4JI3 Q;  1GVP A;  3D4R A;  2KCM A;  1STH A;  3L7Z C;  4X66 L;  2EOT A;  1SFO H;  2BA0 A;  2QF7 A;  1L1O B;  4GOP A;  1SYD A;  1UE6 A;  2PYK A;  1CZW A;  2DY8 A;  3DXJ C;  2QCP X;  4DA2 A;  4DR5 Q;  2UXD L;  2XWJ B;  1SE4 A;  4DV4 Q;  1H95 A;  4WOR A;  4XIG S;  2F0V A;  2ENB A;  4HSV A;  2AUK A;  1ROD A;  2MO0 A;  2NZH A;  4J15 A;  3FHW A;  4KV6 A;  4PMB A;  4HAE A;  2ZTE A;  1ASZ A;  1EL0 A;  4HR7 B;  5E7N A;  1ENC A;  4HJA A;  3NPP A;  2OEO A;  3R2T A;  3FPP A;  4KY6 A;  4A3I B;  2E5L Q;  4DV1 Q;  3S1N B;  1E7Z A;  4IJL A;  3X3M A;  1PTO C;  1MKH A;  1CK1 A;  1ENA A;  3PUZ A;  4IUN A;  5HY6 A;  1W6J A;  2CCZ A;  1C48 A;  5IP7 G;  3A54 A;  1B3Q A;  1I50 B;  4QJF A;  1BBU A;  1KNA A;  3NP8 A;  4BY1 B;  3E9I A;  4JI4 L;  3KUP A;  4HCS A;  4XXE A;  4MTN A;  4BBS H;  2RBM A;  2G9H D;  3MXU A;  5FLM H;  3JC6 6;  3PIP 3;  3GTL H;  1JR0 D;  4RAU C;  1IKL A;  3TZU A;  3PUX A;  1S5B D;  4A3F H;  2MFI A;  3OTO L;  5BR8 Q;  4EGV A;  4LF7 L;  2BA1 A;  5FOB B;  3GTO H;  3UDG A;  4CDE C;  1XNR Q;  5A35 A;  3MWY W;  4LF8 L;  1VQO A;  1IHZ A;  5LL6 X;  5IWA Q;  2ICE C;  1Y69 U;  1E24 A;  1E2W A;  3UDF A;  1IZ6 A;  2X6L A;  2FHT A;  2L55 A;  2K5D A;  1LTR D;  4JV5 Q;  2X6G A;  2Q2I A;  2EYJ A;  2HT1 A;  4H7B A;  2Z4I A;  1BR9 A;  3M3Y B;  1E22 A;  1JCK B;  2B2Y A;  2KED A;  1WFQ A;  2XIW A;  2DNC A;  2C5C A;  4NP5 A;  4YHH Q;  4JOI A;  4C1N I;  5M3F H;  2ICI A;  3NTI A;  3KK7 A;  5IYD H;  1VMC A;  5M3M H;  2AHO B;  2VUM H;  1H9S A;  1KL9 A;  2YTY A;  1MSG A;  5C3X A;  1QUQ A;  1IW7 C;  2K01 A;  2PI2 E;  4A3M B;  2BE5 D;  1U5K A;  2OCE A;  1UUP A;  3LGJ A;  2L11 A;  4GLA C;  2JA8 B;  4JG2 A;  5C4Z A;  3BJU A;  2L5T A;  4GKJ Q;  1IBM Q;  4IOA A;  4A3B H;  1WCM B;  5COY A;  3HOX G;  2QA4 A;  4DKA C;  3QB3 A;  2V4D A;  3BVM A;  3KLR A;  1LO5 D;  3PSI A;  1Q90 A;  1EIG A;  3JAM c;  2BH2 A;  3W3A A;  3M85 A;  4IO9 A;  2JSO A;  3CC7 A;  1W2B A;  3GTK H;  3QG1 A;  4CKC A;  2RDF A;  5EGT A;  1PVO A;  4IPG A;  1KDC A;  5AJ3 L;  1QB5 D;  2F0M A;  4DR3 Q;  5CV8 A;  4LF6 L;  2AQ3 B;  4KKT A;  2D0O A;  1CKN B;  4KHZ A;  4X66 Q;  4DAP A;  1A6X A;  3K81 C;  3WWV A;  1LUZ A;  2YTX A;  2OQ0 A;  4ID6 A;  2UXD Q;  1OXX K;  1LTB D;  3HEJ A;  1RIP A;  4MZ9 A;  5C4X H;  3G71 A;  2QDL A;  1BDO A;  5I9P A;  3UE1 A;  4OGQ C;  4P71 A;  4B3T Q;  1CFM A;  1F9P A;  1NMF A;  4C1N K;  2ES2 A;  4LFB L;  5I9O A;  4R4I A;  4KMU C;  4RHS A;  4A3L H;  5CYU A;  2F0W A;  5K36 G;  2RHS B;  3F2D A;  4LUV A;  2UU9 L;  4JI1 Q;  4DK6 C;  1HPC A;  3S17 B;  4B3M Q;  3D6W A;  1IL8 A;  1GUW A;  5ELC A;  3K5N A;  5M5Y B;  2A6H C;  1UNS A;  4RGN A;  2LMC B;  3TQY A;  3FEW X;  4HMI A;  3C1E A;  1JOK A;  4IFD H;  3PV0 A;  1PFM A;  4BWG B;  4TKO B;  1X3P A;  3L3O C;  4C3H B;  5IYB G;  3L9A X;  4JI0 L;  4ABN A;  1O7I A;  5COR A;  3I73 A;  1HXY D;  3GTP B;  1DCZ A;  1SMY D;  2ZTD A;  3R8B A;  4O1N A;  4JYA Q;  4R4T A;  3PO2 H;  4DK3 C;  1AP0 A;  2UUC Q;  5A2Q L;  1WTW A;  5FO9 B;  2R92 G;  1WVL A;  4A3G G;  1QNU A;  2AQ1 B;  3KJO A;  2Y0S B;  1YHA A;  2B39 A;  1XTC D;  4A3J B;  4BY1 H;  1A63 A;  2JJQ A;  3PF5 A;  5L37 A;  2NN6 H;  1SE3 A;  1BF4 A;  2QIL A;  4GKK L;  1QNK A;  3H0G B;  3I4M H;  2AQ2 B;  4DK0 A;  1EEF D;  2PW5 A;  4A93 B;  4NXM L;  5IGE A;  5HGT A;  1N33 L;  3TP8 A;  1U4R A;  4OEL B;  3SVM A;  5A2Q E;  3LWE A;  2NVQ B;  4RWS C;  4A3E B;  2B2V C;  3MXG A;  4JBK A;  4DR6 Q;  3MA2 B;  4DV3 Q;  3H09 A;  5T1I A;  4KHP L;  2K5W A;  2KA7 A;  2YU9 H;  3O13 A;  4MTK A;  1PH3 A;  1WTV A;  3TSS A;  4K14 A;  1GJX A;  2F52 A;  3K7U C;  4FF4 A;  1STE A;  3HKS A;  1O80 A;  1YI2 A;  3J81 j;  4LF9 Q;  2NUC A;  3BDL A;  1CSQ A;  1MGS A;  4JI8 L;  3M7G A;  5I2X A;  1HTL D;  3U58 A;  1O7Y A;  1HNW L;  1FYC A;  3NEL A;  1K83 H;  2EYM A;  5EPL A;  2B63 H;  1RJT A;  2YTV A;  5I6W A;  1SYG A;  1J9O A;  2H4O A;  4B3S L;  1JE5 A;  1UEB A;  3T56 B;  1L1O C;  3RZD B;  4QF4 A;  5EBC A;  4ZYS A;  5AJ3 Q;  4H02 A;  1TWA B;  5NUC A;  2FMC A;  1HTP A;  3F8T A;  4E6I A;  4QMG A;  1DXM A;  3DHQ A;  1IBK L;  1WCM H;  3D8G A;  2R61 A;  2Q2T A;  4AIM A;  1W6K A;  4LK1 C;  3F2C A;  4DR4 Q;  4DUY L;  1B2T A;  1KIX A;  2F4V Q;  2ALY B;  4K5W A;  5FO8 B;  2ZTC A;  3F2B A;  3NEM A;  4RMF A;  2KCN A;  3MZ5 A;  4S3S A;  4EQ5 A;  3EA6 A;  2NVX H;  1Y1V H;  4LFB Q;  2DN8 A;  3CCQ A;  3SXH A;  3RUZ A;  2CVR A;  4FYD A;  3ERQ A;  1EY7 A;  4FO2 A;  3DEO A;  1N32 L;  1B8A A;  4FXG C;  4QCL A;  1LT5 D;  3W2D A;  5M9O A;  1YNJ D;  1B9N A;  2NN6 I;  1CTM A;  1XPU A;  2F0S A;  3HG9 A;  3SK8 A;  2F0O A;  4OXP A;  1GUO A;  3B6Y A;  1FL0 A;  1LYL A;  1PRT B;  3CHB D;  4A3M G;  2I07 B;  2HCC A;  4OHJ A;  1PTO F;  5LMU L;  1MI2 A;  4FF3 A;  2JA8 G;  1A2U A;  1AH9 A;  1BOS A;  4LUO A;  4DFA A;  1L0Y B;  4ZUJ A;  1I4R A;  4KKS A;  1EQT A;  1ZXT A;  5IYC H;  1I5F A;  1PXU A;  4JI0 Q;  4LF4 L;  1SNP A;  2EXD A;  2IPK D;  3PF4 A;  1LTT D;  1DON A;  1PYS B;  5D14 A;  5CR3 A;  2VS1 A;  1E1T A;  5IGF A;  3F1Z A;  4ILW A;  5EPK A;  3ICE A;  1PH8 A;  1DYQ A;  2HHH L;  4DV5 Q;  4FF2 A;  1GOZ A;  3EN2 A;  1Q82 C;  4JC0 A;  3OWE B;  1KLG D;  1X3F A;  5DEH A;  4IUQ A;  3S9W A;  4GOP B;  2L15 A;  4A4I A;  1QVC A;  1I94 Q;  1Y1W B;  2SEB D;  4GKK Q;  2VY3 A;  5C44 H;  2K5Q A;  2NWG A;  2V1C C;  4IFD J;  4L5Q A;  5C3E G;  2L1B A;  1JOO A;  1N33 Q;  3AMU A;  4ZRZ A;  2HIV A;  1GUS A;  3HOY B;  2K32 A;  1NE3 A;  1PHJ A;  2NTT A;  5CV5 A;  3MXP A;  4LW1 A;  2VB3 X;  2ATW A;  2A69 D;  3A7L A;  4NB3 A;  4DV0 L;  1JE4 A;  1EEI D;  4JI3 L;  2PPB C;  3I3C A;  1SE8 A;  2EJM A;  5JVH 3;  2Y0S E;  1N36 L;  3A74 A;  1WTX A;  3GTQ H;  3MEF A;  2LXJ A;  5D3D A;  1J5E Q;  5C5L A;  1H9R A;  1UE1 A;  3STB D;  4DR5 L;  4RA8 A;  2ZXR A;  1VQ8 A;  4JI8 Q;  5KRU A;  1C7Y A;  1YVC A;  1HUN A;  4C3H G;  1HFG A;  2MPM A;  5K5P A;  5C5M A;  1CT1 D;  1SDF A;  2B2W C;  1JT8 A;  1RTN A;  1HNW Q;  2WAQ B;  3DLL A;  1F77 A;  1EQQ A;  2E5L L;  4DV1 L;  4BBS B;  2F0G A;  5FLX c;  3GTL B;  3CW2 C;  2FFK B;  2BDO A;  2L4N A;  1IYJ B;  1TU2 B;  2Y0S G;  1K3B C;  3QR8 A;  1TR5 A;  4JVZ A;  4A3J G;  4IZ8 A;  3GTO B;  4UAI A;  1QE6 A;  3CRL C;  3PO3 G;  1B53 A;  1TVX A;  3OHX C;  1TWG H;  5JPM C;  1EYG A;  3H0G G;  3MXN A;  2N3S A;  4DV6 L;  3TDQ A;  3GD7 A;  1UEA B;  3HOZ G;  3I4O A;  1I4Q A;  1F2L A;  4YCV A;  1VQ5 A;  3C3L A;  1YEZ A;  3A5Z B;  2LY7 A;  5LHY 1;  3VA7 A;  1QZH A;  1D5Z C;  1WTQ A;  2SOB A;  4PG3 A;  3HOW B;  2X69 A;  1N32 Q;  3NXW A;  4MIU A;  1JWS D;  3UDX A;  5BR8 L;  2OT2 A;  4FNF A;  1H9S B;  2NVY H;  1XNR L;  2Q8I B;  1VQF A;  1QUQ B;  5M3M B;  2VUM B;  1O7L A;  4HJ7 A;  4NPS A;  3QJY A;  1PTO D;  2R3Z A;  1NNX A;  3TP6 A;  1N34 L;  1PA6 A;  3T4A C;  1FD7 D;  1L0X B;  4DN4 M;  5LMU Q;  4MHE A;  4F87 A;  4I65 A;  3EVQ A;  1EQV A;  5FO7 B;  4BXX G;  4RFB A;  4PZ6 A;  3D6C A;  1C9O A;  1PYW D;  4LAA A;  4KN7 C;  4LF4 Q;  3M9B A;  4R8N A;  4A3B B;  4DV2 Q;  1S5F D;  1JJ2 A;  4GN4 B;  2XRS D;  2WB1 B;  1KDB A;  3PGZ A;  3KBG A;  5GAG C;  1BO0 A;  2HDM A;  4PQX A;  2BDN A;  1K0R A;  3K59 A;  2CH4 A;  4ZQ3 A;  1IBM L;  1JB7 A;  3CME A;  1A2T A;  3TRZ A;  3PUW A;  5IP9 G;  5JJZ A;  3X3N A;  2XRQ D;  1VQ7 A;  1FVI A;  1UWV A;  2PZU A;  3IFT A;  2N49 A;  1LTI D;  4ZCK A;  3G7L A;  1KHI A;  2ZJQ A;  5J3B A;  2LXK A;  1HJP A;  4TSS A;  1K9M C;  4DV0 Q;  2EY5 A;  1ONL A;  1SYF A;  3AB9 A;  4YWL A;  3VYT A;  3ER0 A;  3M4Y A;  1N36 Q;  2EVB A;  4NXN Q;  5DM6 3;  1Z47 A;  3SGI A;  2K03 A;  1A3V A;  4KD4 A;  1Y1W H;  3HS0 C;  1WD0 A;  1IW7 D;  1CHP D;  1AE2 A;  4XYQ A;  3H94 A;  2CW0 C;  2XN9 C;  4XYO A;  3G4S A;  3RN5 A;  1CSP A;  4DAY A;  2A19 A;  4B3T L;  3HOY H;  2Z6K A;  1AEX A;  4LFA Q;  3MC0 B;  2RQX A;  1JOQ A;  2CKZ B;  2PMZ B;  3M4O H;  1NJI C;  1PDQ A;  3OSO A;  1DM0 B;  2EY6 A;  4GNX A;  1I3Q H;  3HOU H;  2OF1 A;  3BDC A;  2NZO A;  1ZKO A;  5C3W A;  1PFN A;  4OX9 Q;  4JI1 L;  2CHB D;  4B3M L;  2RVL A;  3T16 A;  2XVS A;  3U4V A;  2R7Z B;  3PO2 B;  3MHB A;  2DUD A;  4KTA A;  3S2D B;  3R3O A;  4A76 A;  4KY7 A;  3J7A V;  5CV9 A;  2I0Q A;  3D4W A;  1D7Q A;  4EVO A;  4FXD A;  5EKI A;  4DNR B;  3V2T A;  2Q2U A;  1XMQ Q;  4HJ5 A;  3K0X A;  3GP7 A;  4L6T B;  4DV6 Q;  1SNC A;  1B1Z A;  1TWC H;  4QIW B;  2EPB A;  2K1B A;  2TMP A;  4JI7 L;  5ISR A;  2WAQ E;  1JJG A;  1EOV A;  2JE6 I;  2MQH A;  3I4M B;  1GHJ A;  1BCP B;  1KC8 C;  4JYA L;  1XMO L;  2EIF A;  3J81 i;  2F0Q A;  3BYT B;  2UUC L;  1PRT C;  3C2P A;  2WAC A;  2A6E C;  1ESR A;  1S40 A;  3OIQ A;  5D65 A;  3GV3 A;  3HOV H;  3NUC A;  2F0D A;  1EWI A;  4NMZ A;  4N8F A;  2K14 A;  1N34 Q;  5M5X H;  4POG A;  4EX5 A;  2YU9 B;  5M5W B;  4X65 L;  4FVM A;  1BBW A;  4JCV E;  1JQY D;  4TRD A;  4ODG A;  1I6V C;  2F0P A;  4IUU A;  1Y14 B;  5CV7 A;  4OON A;  4OWT B;  5LMN W;  4WJ3 M;  1IBL Q;  4LUZ A;  1GUN A;  3HOW H;  3A7A B;  1KD1 C;  2WAQ G;  1LLR D;  2F0J A;  4IAL A;  1EIF A;  1XYI A;  1HCZ A;  4BBS G;  4DR6 L;  1IKM A;  1XTD A;  5FLM G;  4A3K H;  1K83 B;  4KJO A;  4DV3 L;  5JJL A;  1KAB A;  3VYS A;  1CKO A;  4GOP C;  1VQJ A;  2B63 B;  1PFB A;  1EY5 A;  4A3F G;  3IRB A;  4IPC A;  3E0J A;  4OIK A;  1HUM A;  1STN A;  2MGS A;  1SYB A;  3SHL A;  4LF9 L;  1YNN D;  5IY0 A;  1HZC A;  3CRK C;  3AFP A;  3SR1 A;  1K73 C;  4GZY C;  4OL7 A;  4ALP A;  5D3I B;  3DMU A;  4UY8 C;  3AQQ A;  3PUY A;  4RGO S;  5TSS A;  4L5T A;  3KDF A;  3TN2 A;  5E4X A;  2WV6 D;  4P75 A;  1ZYR D;  1CM9 A;  4DAM A;  3I72 A;  2F4I A;  1YJW A;  2NVX B;  4HIK A;  2F0U A;  2WB1 E;  1Y1V B;  1SJE D;  3RZO H;  5IGG A;  3CCR A;  2VQF Q;  5M3F G;  4F8M A;  5IYD G;  1PZK D;  2O5J C;  5M3M G;  2VUM G;  3NWT A;  2RCF A;  1TWF H;  3BG3 A;  3U4Z A;  3HKZ B;  2MUY A;  3F2U A;  2XNA C;  4RCN A;  3J81 L;  1WOC A;  4C3I H;  2IX3 A;  1SEB D;  2PNR C;  4DR4 L;  2A73 B;  2QW7 A;  2VW9 A;  2F4V L;  2B2U A;  1G6Z A;  4PNY A;  3OYY A;  1SYE A;  2M9V A;  2E2D C;  1EYA A;  1RCV D;  4UDU C;  4OIJ A;  2JA5 B;  3OW7 A;  4DNI A;  2B29 A;  1PYB A;  1VCI A;  1EZ6 A;  3KYH C;  1C8C A;  2WKD A;  3E3X A;  3RLF A;  3S16 B;  2WB1 G;  3Q6S A;  4OWW B;  2I5M X;  2TSS A;  4CGY B;  4H44 C;  3GV6 A;  3S15 H;  3J81 E;  4PV1 C;  4R9W A;  1DJR D;  3SK4 A;  1MSH A;  5H1S E;  1E1O A;  3CXC A;  1H9K A;  4QL5 A;  2JYO A;  5AFW A;  4DR2 L;  2E8G A;  4A3G H;  2A68 C;  5C0X H;  1PH7 A;  2NVT H;  5KGU A;  1BXT A;  2B2Y C;  3VR2 A;  3QO2 A;  4PMW A;  4CJ2 C;  4JOI C;  1HZA A;  2PMZ E;  4JI7 Q;  2KEC A;  3BVZ A;  5C44 B;  1FGB D;  5KEE A;  5C4X G;  4XDX A;  4X3K A;  3J80 i;  2R7Z H;  3CKI B;  1XMO Q;  2QKI C;  1E2V A;  1T5E A;  1RDP D;  3CD6 A;  3S2D H;  1ML0 D;  2O4X A;  1AN8 A;  3ULP A;  3Q8D A;  2R7F A;  4WRD A;  1ICF B;  4DV5 L;  4UP8 A;  2WP8 J;  2O2L D;  5ELF A;  1QOH A;  3FKI B;  3I7F A;  4DXG A;  4B3R L;  5C4J H;  2F1M A;  2EDG A;  3HFZ B;  2BH8 A;  4X65 Q;  1I94 L;  5JEA H;  3GTQ B;  4F88 A;  3HRZ C;  5EBD A;  5IGD A;  4KJN A;  1MD2 D;  1NCV A;  2GN5 A;  2QEJ C;  5LL6 S;  4IFD G;  3NBH A;  3CPW A;  2J4X A;  4LFC Q;  2JA6 B;  2R93 H;  3MTS A;  3LNN A;  1D8L A;  3DWP A;  3PMF A;  5EKK A;  4UP7 A;  2K5H A;  3ND9 A;  3K6O A;  4A3I G;  3FVQ A;  4NW2 A;  1K8M A;  4YY3 Q;  3I4L A;  3TP5 A;  2K5V A;  3U50 C;  4HSP A;  4K2K A;  3PO2 G;  3M7N A;  1HQM C;  1QJO A;  2E76 C;  1N8R C;  5M5W H;  3ND8 A;  1ET6 A;  5GAE C;  2CH4 W;  3PIO A;  1J5E L;  2EY1 A;  1EIY B;  2EE1 A;  3C46 A;  3NK9 A;  1XXG A;  1NTG A;  4PMC A;  2NB0 A;  3N52 A;  1O7Z A;  1HZ9 A;  4WFN 3;  1V1O A;  1D5M C;  1CA5 A;  4BY1 G;  4RHR A;  2NN6 G;  3G48 A;  4R4C A;  1G2S A;  3MXN B;  1K3R A;  2HD3 A;  1KAW A;  5KYI A;  3QIA A;  1TWG B;  2AUJ D;  4GS3 A;  4KN4 C;  3PIO 3;  2L9H A;  3BZD B;  4CDC C;  1VQE A;  5JJK A;  1TS5 A;  3I4M G;  4N9T A;  2KCC A;  2RDH A;  4KY5 A;  4QQB X;  2Q8R E;  1SNO A;  3EJI A;  4DV7 L;  3URY A;  2DJF C;  2IL8 A;  4KI0 A;  5C0X I;  1L2F A;  4X64 L;  2NVY B;  3J80 L;  3PCO B;  3I91 A;  2E2J H;  3EQL C;  4Q5V A;  1H9M A;  4I7Z C;  1PFS A;  1I4X A;  1MBY A;  2F3I A;  2LKV A;  3UDI A;  4DXF A;  4HN7 A;  3IFD A;  4YCW A;  4CKE A;  1P8L A;  3KLW A;  3FPU B;  4P74 A;  1LAB A;  2K50 A;  3OW2 A;  2I46 A;  2F0I A;  2D2C C;  2KUM A;  1EYC A;  1JIC A;  2KCT A;  4IPD A;  4QGU A;  2HQE A;  2RSO A;  4G4K A;  2J7Z A;  3SDZ A;  1H9J A;  2VQE Q;  5GAD C;  3DM1 A;  4CJ1 B;  2B63 G;  1SMY C;  3J80 E;  2IX1 A;  4P2C B;  1EFW A;  2K7V A;  1PH4 A;  3CF5 A;  1OO9 B;  2LSS A;  1WTH A;  3AFQ A;  1IXR A;  2H1E A;  5E1F A;  1R9T H;  3TME A;  1WD1 A;  2K04 A;  4DR2 Q;  2EYP A;  2JA5 H;  4BA1 I;  4ZKC B;  1EYD A;  1BCP C;  2UUB Q;  1YIT A;  1EUJ A;  3S2H B;  3SK5 A;  1WCM G;  2CQO A;  2EJF C;  1RD9 D;  3P75 A;  4KK7 A;  5ELO A;  1VQK A;  1BQQ T;  1QCB D;  1XJV A;  4JBM A;  1X32 A;  4IOC A;  3S16 H;  4IUT A;  4DV2 L;  1MJE A;  1S4Z A;  4U67 3;  4GLX A;  3CC2 A;  3VR3 A;  1YHQ A;  4MNO A;  1D6E C;  4IPH A;  5J39 A;  4KHV A;  1Y1V G;  4OO1 H;  4BY7 H;  1PMR A;  3DWA A;  4HJ8 A;  1ZEQ X;  2Z4H A;  1DOL A;  1PRT F;  4LWC A;  2RF4 A;  1U4M A;  1Y8O B;  3BVG A;  3P7J A;  1XNQ Q;  2PQA A;  4B3R Q;  2YYZ A;  5CC4 A;  1XWE A;  4FDB A;  1PZJ D;  3QOJ A;  2KBN A;  1CI3 M;  4DAY B;  2N55 A;  4O0A A;  1JMC A;  1ET9 A;  5J1Z A;  3TZD A;  5IYC G;  4FF1 A;  4BS9 A;  4GNX B;  1PH6 A;  1I6H B;  1S3O A;  2B2T A;  4A3D H;  1D5X C;  3M4O B;  1I3Q B;  3HOU B;  1UAP A;  5I4D A;  4DGZ A;  1HNX Q;  5CBA E;  3FKI H;  1BKB A;  4OEM B;  1SRU A;  5FK9 C;  1PZI D;  1F9S A;  4NXN L;  1SSO A;  2E2I B;  3PQI A;  3RLO A;  3KF8 A;  4LF5 Q;  4G7H C;  5ELB A;  1I4G A;  2JA6 H;  3H3V H;  4IJH A;  4UP9 A;  3E9H A;  4TVA B;  3DWQ A;  4JI5 Q;  4LFA L;  4AYB B;  1JWM D;  5JEA J;  1SMX A;  1EOT A;  4ZAI A;  4G7Z C;  1JWU D;  1KAA A;  1SBB B;  2MO1 A;  3NBI A;  5KNB A;  3BDO A;  1FNW A;  1AE3 A;  1TWC B;  4OX9 L;  1DD2 A;  4DV7 Q;  4X6A H;  1J6Q A;  5FJ8 H;  2SDF A;  1R4P B;  1NAP A;  1STG A;  1MHW C;  3ZJY C;  1EFI D;  4LNQ A;  4X64 Q;  1SAP A;  5GQO A;  1WTR A;  3HOV B;  3OOC A;  2KJX A;  1SLJ A;  1XMQ L;  1WYD A;  1YNJ C;  2EYL A;  2IHE A;  5M5X B;  2HCI A;  3SEB A;  3DEP A;  2AMC B;  2CW0 D;  3IKJ A;  1YJN A;  2XSC A;  1J8I A;  4OO1 I;  4A93 G;  2K4K A;  3K58 A;  5I6Y A;  4NDX A;  2CWP A;  4C3J H;  4CDD C;  3Q0A A;  1F9R A;  4HCE A;  2D5D A;  3I4N H;  4A3E G;  3TEH B;  4Z9C B;  1A0I A;  4K6D A;  5G3L F;  5LMN Q;  1CUK A;  2OTJ A;  3MFY A;  1QZG A;  5E4W C;  1EQR A;  2K28 A;  3HOX B;  2JP1 A;  4A3K B;  1S5D D;  4JBW A;  1VQ4 A;  4JI2 Q;  1LT4 D;  2AWO A;  4TQU S;  2E2H H;  2DJG C;  2WKC A;  1DOM A;  3I56 A;  5KNC A;  5IT9 L;  2EJG C;  2E74 C;  1IBL L;  2IT1 A;  1K8A C;  3K5L A;  2UXC Q;  1PTO H;  3CQZ B;  3A8K E;  4R8I A;  3EBE A;  3KDF B;  1EU3 A;  1EY0 A;  1DOK A;  2P5Z X;  1UE5 A;  3I90 A;  4L63 B;  1S5E D;  4A3C H;  4BBR H;  1PRT D;  1VF7 A;  2ZM6 Q;  2A6E D;  1HNZ L;  3RMH A;  2JA7 H;  3CCE A;  3H3V I;  3RZO B;  5J22 A;  3WDN A;  1E2Z A;  3S2H H;  1B9M A;  3ONA B;  5IT9 E;  3H3V C;  2I5H A;  2VNU D;  1LT3 D;  1AZP A;  1TWF B;  3J7Z C;  1NR2 A;  2ASB A;  3KBX A;  4RKB A;  4CBV A;  1STY A;  2C35 B;  3GDE A;  4C3I B;  2K6A A;  2N8N A;  3P1H A;  4RKL A;  2IY5 B;  1TY0 A;  1VQP A;  3RD4 A;  1V9P A;  3STB C;  1PLF A;  3DUZ A;  3S1R B;  1QVF A;  3GTM H;  1CZG A;  3EIV A;  4QUF A;  2MHV A;  2VQF L;  1NUC A;  2F0N A;  1C4Q A;  3IAY A;  2Z9H A;  4H13 C;  5DAU A;  1I4P A;  1IYU A;  1CQV A;  3TRE A;  3U9O A;  4JK1 C;  5JJI A;  1A8V A;  2J0T D;  4XT1 B;  3VA5 A;  3S15 B;  1V1P A;  1HFN A;  3SE0 A;  3VDY A;  2LS0 1;  2RKS A;  3UI2 A;  3I55 A;  5C4H A;  1I6H H;  1AW7 A;  2R6G A;  3W5O A;  1K0S A;  5IP7 H;  4A3G B;  1YJ9 A;  4XTC S;  2NVT B;  4DR7 Q;  3U9S A;  4O42 A;  4H0L C;  2A5H A;  5FKA C;  3J7A F;  2JN4 A;  2E2I H;  1HA6 A;  2PCF B;  5IE8 A;  1G6P A;  3GQB A;  1VF5 C;  1VQ9 A;  2A1A A;  5IGC A;  1F9Q A;  1LT6 D;  1HA5 A;  3HZX A;  2F3V A;  4I7A A;  2SNS A;  4C2M H;  1Y1W G;  1KDA A;  3C1F A;  1R4Q B;  3T1H L;  1Q46 A;  1RL2 A;  4F7X A;  3CAM A;  3NTH A;  4ZUI A;  2OXP A;  4AYB E;  5C4J B;  4YWM A;  4ZKB B;  4O2D A;  4M1U B;  3NBH B;  3GTJ B;  2ZT9 C;  2KHJ A;  2CQA A;  1X55 A;  3HOY G;  2D0P A;  2DY7 A;  3PIP A;  2R93 B;  5G3L D;  2FJ2 A;  1AZQ A;  4DAV A;  3HOU G;  1TII D;  1WTP A;  2PNH A;  3S1Q H;  5ELN A;  4DK1 A;  3TBI B;  5HGQ A;  4N8X 1;  1TKW B;  4YIJ A;  1CHQ D;  3J81 c;  2B8G A;  2A6H D;  3K7A B;  3LX0 A;  1Q7Y C;  2QEX A;  4AQY L;  1PV4 A;  3ERS X;  4Y7N H;  4JW0 A;  1Y8N B;  3UE0 A;  1VQG A;  3CPF A;  3OMC A;  2A68 D;  1Q1B A;  4K5X A;  4AYB G;  4LFC L;  2H5X A;  3WOE A;  1MIU A;  3A8J E;  1BCP F;  3BU2 A;  1L0W A;  1WI5 A;  4YY3 L;  1N9W A;  3HOX H;  1X6O A;  3EFX D;  1TWH B;  4P72 A;  1S72 A;  1FNV A;  4G7O C;  3MEH A;  4CDF C;  1WTO A;  4QB4 A;  2EXZ A;  1IL2 A;  1OXV A;  1HNZ Q;  4UHV A;  1EY6 A;  2K05 A;  5DNF A;  1W3S A;  3NQI A;  1JC7 A;  4DPG A;  5JAV A;  1QWY A;  5EAY A;  1Q81 C;  4K0K L;  1G2T A;  3IL8 A;  2F0L A;  2Z6K C;  3D4D A;  4RGM A;  3HOV G;  1HR0 W;  1GO3 E;  1VQN A;  2FIN B;  1Q8K A;  4G57 A;  4EQN A;  4GNX C;  1AFP A;  4DUZ Q;  2MP1 A;  1XX8 A;  3CQZ H;  3VYU A;  5C6A A;  4RH6 A;  3RLN A;  1YIJ A;  1K8G A;  2E2J B;  1Q3L A;  2PI2 A;  4R1J A;  5EQ0 A;  3KF6 A;  4HTH A;  1VQD A;  3HOW G;  1TS2 A;  3NHH A;  3JAM i;  1DGS A;  4X62 L;  2NYZ D;  3Q23 A;  3KOJ A;  3GTG B;  2UUA L;  4A3K G;  1A3U A;  5K36 H;  1SND A;  3KJP A;  1ILQ A;  1NBW A;  2ZJP A;  1M8A A;  1YNX A;  3AU7 A;  4DF7 A;  2LFN A;  1VQ6 A;  2DNE A;  1IYV A;  1TT2 A;  2IW3 A;  1FJG Q;  1X65 A;  1R9T B;  3NTK A;  3K5O A;  3AEV A;  2NTS A;  3NSW A;  3RNU A;  2JEA I;  1DZ1 A;  1M4V A;  3S1R H;  1GKH A;  2B2V A;  4A3B G;  1F2M A;  5JPN C;  3I2Z A;  1FNU A;  1E0B A;  3E5S A;  5DLQ E;  4HED A;  5IYB H;  2VQE L;  4U68 A;  1SN8 A;  4ZLT F;  4GLV B;  1VQB A;  1VQI A;  3QWN A;  4BY7 B;  4K5V A;  5JOB A;  5C3E B;  2OWO A;  4J8Q A;  1UE7 A;  4LMQ D;  3CP0 A;  2R92 H;  3M4Q A;  3N6R A;  3BZC A;  2PQA B;  3ERO A; 
#chains in the Genus database with same CATH homology
 3VR5 A;  1U9R A;  3D3R A;  3QOL A;  1EY4 A;  1T5X D;  1EIH A;  1STB A;  4C3I G;  1V43 A;  3HGB A;  5IIF A;  1ILP A;  3ITP A;  1OXS C;  5CBE E;  1EWH A;  1NSN S;  3FMC A;  3Q24 A;  4A3D B;  1A3T A;  2Q8T A;  1Z6H A;  1S5C D;  1Z7T A;  1TS4 A;  2O5I C;  3R2I A;  3JAM L;  4CKB A;  1SE2 A;  1A15 A;  2F0T A;  4IN3 A;  1BCP D;  5C0X G;  1BNZ A;  2BE5 C;  4WJW A;  1YNN C;  3FDT A;  1TS3 A;  3PO3 B;  5JVG 3;  1QG7 A;  5ELE A;  2PZT A;  4L8J A;  1SJH D;  5KYL A;  1EY8 A;  3S1M B;  2EZV A;  3K5M A;  3HOZ B;  1LV9 A;  3JAM E;  1GUT A;  2B2U C;  2ZXP A;  1EY9 A;  1ZYR C;  1O78 A;  1JOR A;  2PQE A;  4KKU A;  3VYR A;  1B3A A;  3I70 A;  2M2L A;  5E3F A;  5JEA G;  5F2D A;  2AWN A;  4V19 0;  1OXT A;  4IUV A;  3D31 A;  4NKL A;  1Q1E A;  1RKN A;  2KQ3 A;  1K8O A;  2SNM A;  2C9O A;  4C3J B;  5CMD A;  3LWU A;  1SNQ A;  1Q12 A;  2RSN A;  3I4N B;  2G9D A;  1ENF A;  2FMM A;  1TQO A;  3H91 A;  1G29 1;  1CA6 A;  5HUR A;  2EY2 A;  1JB3 A;  3S14 B;  2L0C A;  3MFG A;  1D1I A;  1LAC A;  4DNT B;  2IX0 A;  1GHK A;  1ICW A;  2WII B;  3NE5 B;  4J6H A;  2Z8L A;  4K2L A;  2E2H B;  4CHT B;  2ID0 A;  4IFD I;  5ELD A;  2HUG A;  1BUV T;  2F03 A;  3V05 A;  1PTO B;  4J1M A;  3J7Y W;  4ZK9 B;  2KVM A;  4HMJ A;  3KLS X;  5CV6 A;  5EKL A;  1STA A;  4ULL A;  4IUR A;  4C56 C;  4BBR B;  5CGK A;  3NWS A;  1RF2 D;  3Q22 A;  1KTK A;  1D1K A;  4BA2 I;  2JA7 B;  3OWF A;  4CJ0 B;  1CQF A;  2B2W A;  1EWC A;  4B08 A;  3ZYY X;  2PZW A;  5IOD A;  5EPJ A;  2MJ8 A;  2JXM B;  4FP5 D;  3KLS A;  1U4P A;  1VDZ A;  4DU9 A;  2F3W A;  3GTM B;  3TP7 A;  1II3 A;  1NR4 A;  3VR4 A;  5KIX A;  5T1G A;  4K8J A;  3T53 B;  2A74 C;  4X3U A;  3HP3 A;  1V1P B;  3A56 A;  4XQN A;  5C0X J;  2QDB A;  4N9P A;  3G6J B;  1B4O A;  1X3Q A;  1U4L A;  1I4H A;  1SFO B;  4ME5 A;  1ESF A;  3PUV A;  2PW7 A;  4OO1 G;  3BS1 A;  4EQP A;  3H6M A;  2EYF A;  4RCO A;  1Q8I A;  2EYO A;  4X3S A;  1LTG D;  4IUP A;  1F2Y A;  2NZ1 D;  1D2B A;  4C2M B;  2M00 A;  2BCO A;  3K0Y A;  3GO5 A;  3SK6 A;  1RTO A;  1G91 A;  1KLU D;  1V8Q A;  2VXW A;  5BN5 A;  3T13 A;  4M8A A;  3P20 A;  4RGT A;  2KOL A;  3MVV A;  4B9W A;  3S1Q B;  2IWH A;  1F2Z A;  2N88 A;  4XQQ A;  3OPO A;  1G8Z D;  1SXT A;  4KD3 A;  4MN3 A;  5DM7 3;  2JEB I;  5CV4 A;  1RHP A;  2NBF A;  4Y7N B;  4A3F B;  3A8I E;  4XQJ A;  1B50 A;  1HQR D;  2ZXO A;  3BYY B;  2RDG A;  1Y8P B;  2XWB B;  2F0E A;  4K8I A;  2IJ0 A;  1SYC A;  2WIN B;  3E6Z X;  4X3T A;  2F0H A;  5I2Y A;  1HHV A;  4EQO A;  2EYH A;  2F0K A;  2VB2 X;  4K6L A;  1LTA D;  1VMP A;  3VR6 A;  2GA4 B;  2B8F A;  2B2T C;  2D62 A;  2PO4 A;  1GXD C;  3FRP B;  5M3F B;  5KND A;  2D9U A;  5IGB A;  5EJW A;  4B9X A;  1LTS D;  4FXK C;  4XT3 B;  3OIP A;  4C3J G;  1B44 D;  2L12 A;  3CU7 A;  2KEE A;  2BOS A;  5BN4 A;  1OXU A;  2A69 C;  4Q0F A;  5FLX L;  1FR3 A;  5IOC A;  3GTK B;  3I8Z A;  4IQZ A;  4V0B A;  3MAQ A;  2Z1C A;  3A55 A;  2F0F A;  2K33 A;  1GUG A;  1SNM A;  1EU4 A;  3OMG A;  3R93 A;  3V96 A;  2KHS A;  3T51 B;  3NQT A;  5C4X B;  1EZ8 A;  1QIL A;  4QUC A;  5FLX E;  1HRJ A;  2E75 C;  2HDL A;  2RA4 A;  1BBX C;  1TY2 A;  1KNE A;  3WOF A;  5BN3 A;  2R92 B;  4LJZ C;  3K57 A;  3D4R A;  3L7Z C;  1STH A;  2EOT A;  2BA0 A;  2QF7 A;  1SYD A;  2PYK A;  1CZW A;  2DY8 A;  3DXJ C;  2QCP X;  4DA2 A;  2XWJ B;  1SE4 A;  4WOR A;  4XIG S;  2F0V A;  2ENB A;  4HSV A;  2AUK A;  1ROD A;  4KV6 A;  4PMB A;  4HAE A;  1EL0 A;  4HR7 B;  1ENC A;  3NPP A;  2OEO A;  3R2T A;  3FPP A;  4KY6 A;  4A3I B;  3S1N B;  3X3M A;  1PTO C;  1CK1 A;  1ENA A;  3PUZ A;  4IUN A;  1W6J A;  1C48 A;  3A54 A;  1I50 B;  1KNA A;  3NP8 A;  4BY1 B;  3KUP A;  4HCS A;  4XXE A;  2RBM A;  2G9H D;  3MXU A;  3PIP 3;  4RAU C;  1JR0 D;  1IKL A;  3TZU A;  3PUX A;  1S5B D;  4EGV A;  2BA1 A;  5FOB B;  5A35 A;  3MWY W;  1IHZ A;  5LL6 X;  2ICE C;  1Y69 U;  1E2W A;  2X6L A;  2FHT A;  2L55 A;  2K5D A;  1LTR D;  2X6G A;  2EYJ A;  4H7B A;  2Z4I A;  1BR9 A;  3M3Y B;  2KED A;  1JCK B;  2B2Y A;  2XIW A;  2DNC A;  2C5C A;  4NP5 A;  4C1N I;  2ICI A;  3NTI A;  3KK7 A;  1VMC A;  1H9S A;  1MSG A;  5C3X A;  1IW7 C;  2K01 A;  4A3M B;  2BE5 D;  1UUP A;  2L11 A;  2JA8 B;  5C4Z A;  2L5T A;  1WCM B;  5COY A;  3QB3 A;  2V4D A;  3BVM A;  3KLR A;  1LO5 D;  1Q90 A;  1EIG A;  3W3A A;  3M85 A;  2JSO A;  3QG1 A;  4CKC A;  2RDF A;  5EGT A;  1KDC A;  1QB5 D;  2F0M A;  5CV8 A;  2AQ3 B;  4KKT A;  4KHZ A;  4DAP A;  1A6X A;  4ID6 A;  1OXX K;  1LTB D;  3HEJ A;  1BDO A;  5I9P A;  4OGQ C;  1CFM A;  1F9P A;  4C1N K;  5I9O A;  4KMU C;  4RHS A;  5CYU A;  2F0W A;  5K36 G;  1HPC A;  3S17 B;  3D6W A;  1IL8 A;  1GUW A;  5ELC A;  3K5N A;  5M5Y B;  2A6H C;  1UNS A;  4RGN A;  2LMC B;  3FEW X;  4HMI A;  3C1E A;  1JOK A;  4IFD H;  3PV0 A;  1PFM A;  4BWG B;  4TKO B;  1X3P A;  3L3O C;  4C3H B;  3L9A X;  4ABN A;  5COR A;  3I73 A;  1HXY D;  3GTP B;  1DCZ A;  1SMY D;  3R8B A;  4O1N A;  1AP0 A;  5A2Q L;  1WTW A;  5FO9 B;  1WVL A;  1QNU A;  2AQ1 B;  2Y0S B;  2B39 A;  1XTC D;  4A3J B;  2NN6 H;  1SE3 A;  1BF4 A;  2QIL A;  1QNK A;  3H0G B;  2AQ2 B;  4DK0 A;  1EEF D;  2PW5 A;  4A93 B;  5IGE A;  5HGT A;  3TP8 A;  1U4R A;  3SVM A;  5A2Q E;  3LWE A;  2NVQ B;  4RWS C;  4A3E B;  2B2V C;  3MXG A;  3MA2 B;  3H09 A;  5T1I A;  2K5W A;  2KA7 A;  3O13 A;  1WTV A;  3TSS A;  4K14 A;  1GJX A;  4FF4 A;  1STE A;  1O80 A;  2NUC A;  3BDL A;  1MGS A;  3M7G A;  5I2X A;  1HTL D;  1O7Y A;  1FYC A;  2EYM A;  5EPL A;  1RJT A;  5I6W A;  1SYG A;  1J9O A;  2H4O A;  3T56 B;  3RZD B;  4QF4 A;  5EBC A;  4ZYS A;  1TWA B;  5NUC A;  2FMC A;  1HTP A;  4E6I A;  4QMG A;  1DXM A;  3DHQ A;  3D8G A;  2R61 A;  1W6K A;  4LK1 C;  1B2T A;  4K5W A;  5FO8 B;  2KCN A;  3MZ5 A;  4S3S A;  3EA6 A;  2DN8 A;  3SXH A;  3RUZ A;  2CVR A;  4FYD A;  3ERQ A;  1EY7 A;  4FO2 A;  3DEO A;  4FXG C;  4QCL A;  1LT5 D;  3W2D A;  5M9O A;  1YNJ D;  1B9N A;  2NN6 I;  1CTM A;  2F0S A;  3HG9 A;  3SK8 A;  2F0O A;  1GUO A;  1PRT B;  3CHB D;  2I07 B;  2HCC A;  4OHJ A;  1PTO F;  1MI2 A;  4FF3 A;  1A2U A;  1BOS A;  4DFA A;  1L0Y B;  4ZUJ A;  1I4R A;  4KKS A;  1EQT A;  1ZXT A;  1PXU A;  1SNP A;  2IPK D;  1LTT D;  1DON A;  5D14 A;  5CR3 A;  5IGF A;  4ILW A;  5EPK A;  1DYQ A;  4FF2 A;  1GOZ A;  3OWE B;  1KLG D;  5DEH A;  4IUQ A;  3S9W A;  1Y1W B;  2SEB D;  2K5Q A;  2NWG A;  4IFD J;  2L1B A;  1JOO A;  3AMU A;  4ZRZ A;  1GUS A;  3HOY B;  2K32 A;  2NTT A;  5CV5 A;  3MXP A;  2VB3 X;  2A69 D;  3A7L A;  1JE4 A;  1EEI D;  2PPB C;  3I3C A;  2EJM A;  5JVH 3;  1WTX A;  5D3D A;  5C5L A;  1H9R A;  4RA8 A;  2ZXR A;  5KRU A;  1HUN A;  4C3H G;  1HFG A;  2MPM A;  5K5P A;  5C5M A;  1CT1 D;  1SDF A;  2B2W C;  1RTN A;  2WAQ B;  1F77 A;  4BBS B;  2F0G A;  3GTL B;  2FFK B;  2BDO A;  2L4N A;  1TU2 B;  1TR5 A;  4IZ8 A;  3GTO B;  4UAI A;  1QE6 A;  3CRL C;  1B53 A;  1TVX A;  3OHX C;  5JPM C;  3MXN A;  3TDQ A;  3GD7 A;  1UEA B;  1I4Q A;  1F2L A;  3C3L A;  2LY7 A;  5LHY 1;  3VA7 A;  1D5Z C;  1WTQ A;  2SOB A;  3HOW B;  2X69 A;  3NXW A;  4MIU A;  1JWS D;  2OT2 A;  4FNF A;  1H9S B;  2Q8I B;  5M3M B;  2VUM B;  1O7L A;  3QJY A;  1PTO D;  2R3Z A;  3TP6 A;  3T4A C;  1FD7 D;  1L0X B;  4DN4 M;  4MHE A;  4F87 A;  4I65 A;  3EVQ A;  1EQV A;  5FO7 B;  4RFB A;  3D6C A;  1PYW D;  4LAA A;  4KN7 C;  4R8N A;  4A3B B;  1S5F D;  2XRS D;  2WB1 B;  1KDB A;  3KBG A;  1BO0 A;  2HDM A;  4PQX A;  2BDN A;  3K59 A;  4ZQ3 A;  1A2T A;  3PUW A;  5JJZ A;  3X3N A;  2XRQ D;  2PZU A;  3IFT A;  1LTI D;  3G7L A;  4TSS A;  2EY5 A;  1ONL A;  1SYF A;  3AB9 A;  3VYT A;  3M4Y A;  2EVB A;  5DM6 3;  1Z47 A;  2K03 A;  1A3V A;  4KD4 A;  3HS0 C;  1WD0 A;  1IW7 D;  1CHP D;  4XYQ A;  3H94 A;  2CW0 C;  2XN9 C;  4XYO A;  4DAY A;  1AEX A;  2RQX A;  3MC0 B;  1JOQ A;  2PMZ B;  1PDQ A;  3OSO A;  1DM0 B;  2EY6 A;  2OF1 A;  3BDC A;  1ZKO A;  5C3W A;  1PFN A;  2CHB D;  2RVL A;  3T16 A;  2XVS A;  2R7Z B;  3PO2 B;  3MHB A;  4KTA A;  3S2D B;  3R3O A;  4KY7 A;  3J7A V;  5CV9 A;  3D4W A;  4EVO A;  4FXD A;  5EKI A;  4DNR B;  3V2T A;  3GP7 A;  4L6T B;  1SNC A;  1B1Z A;  4QIW B;  2EPB A;  2K1B A;  2TMP A;  5ISR A;  2JE6 I;  3I4M B;  1GHJ A;  1BCP B;  2F0Q A;  3BYT B;  1PRT C;  3C2P A;  2WAC A;  2A6E C;  1ESR A;  3OIQ A;  5D65 A;  3GV3 A;  3NUC A;  2F0D A;  4NMZ A;  2YU9 B;  5M5W B;  4FVM A;  1JQY D;  4TRD A;  4ODG A;  1I6V C;  2F0P A;  4IUU A;  5CV7 A;  1GUN A;  3A7A B;  1LLR D;  2F0J A;  4IAL A;  1XYI A;  1HCZ A;  1IKM A;  1K83 B;  4KJO A;  1KAB A;  3VYS A;  2B63 B;  1PFB A;  1EY5 A;  3E0J A;  4OIK A;  1HUM A;  1STN A;  2MGS A;  1SYB A;  3SHL A;  1YNN D;  3CRK C;  3SR1 A;  4GZY C;  4OL7 A;  5D3I B;  3DMU A;  3PUY A;  4RGO S;  5TSS A;  3TN2 A;  5E4X A;  2WV6 D;  1ZYR D;  1CM9 A;  3I72 A;  2F4I A;  2NVX B;  2F0U A;  1Y1V B;  1SJE D;  5IGG A;  4F8M A;  1PZK D;  2O5J C;  3NWT A;  3BG3 A;  3HKZ B;  2MUY A;  3F2U A;  2XNA C;  4RCN A;  3J81 L;  2IX3 A;  1SEB D;  2PNR C;  2A73 B;  2B2U A;  1G6Z A;  4PNY A;  1SYE A;  2M9V A;  2E2D C;  1EYA A;  1RCV D;  4UDU C;  4OIJ A;  2JA5 B;  3OW7 A;  1VCI A;  1EZ6 A;  1C8C A;  2WKD A;  3RLF A;  3S16 B;  3Q6S A;  2TSS A;  4CGY B;  4H44 C;  3GV6 A;  3J81 E;  4PV1 C;  4R9W A;  1DJR D;  3SK4 A;  1MSH A;  1H9K A;  2JYO A;  5AFW A;  2A68 C;  5C0X H;  5KGU A;  1BXT A;  2B2Y C;  3VR2 A;  3QO2 A;  4PMW A;  4CJ2 C;  2KEC A;  3BVZ A;  5C44 B;  1FGB D;  5KEE A;  4XDX A;  4X3K A;  3CKI B;  2QKI C;  1E2V A;  1T5E A;  1RDP D;  1ML0 D;  2O4X A;  1AN8 A;  4WRD A;  2WP8 J;  2O2L D;  5ELF A;  1QOH A;  3FKI B;  4DXG A;  2F1M A;  2EDG A;  5JEA H;  3GTQ B;  4F88 A;  3HRZ C;  5EBD A;  5IGD A;  4KJN A;  1MD2 D;  1NCV A;  5LL6 S;  2QEJ C;  4IFD G;  3NBH A;  2J4X A;  2JA6 B;  3MTS A;  3LNN A;  3DWP A;  3PMF A;  5EKK A;  3ND9 A;  3K6O A;  3FVQ A;  4NW2 A;  1K8M A;  3I4L A;  3TP5 A;  4HSP A;  4K2K A;  3M7N A;  1HQM C;  1QJO A;  2E76 C;  3ND8 A;  1ET6 A;  2EY1 A;  2EE1 A;  3C46 A;  3NK9 A;  1XXG A;  4PMC A;  2NB0 A;  3N52 A;  1O7Z A;  4WFN 3;  1V1O A;  1D5M C;  1CA5 A;  4RHR A;  2NN6 G;  1G2S A;  5KYI A;  3QIA A;  1TWG B;  2AUJ D;  4KN4 C;  3PIO 3;  2L9H A;  3BZD B;  1TS5 A;  4N9T A;  2KCC A;  2RDH A;  4KY5 A;  2Q8R E;  1SNO A;  3EJI A;  3URY A;  2IL8 A;  4KI0 A;  5C0X I;  2NVY B;  3J80 L;  3I91 A;  3EQL C;  4Q5V A;  1H9M A;  4I7Z C;  1I4X A;  1MBY A;  2LKV A;  4DXF A;  4HN7 A;  3IFD A;  4CKE A;  3FPU B;  1LAB A;  2I46 A;  2F0I A;  2D2C C;  2KUM A;  1EYC A;  1JIC A;  2HQE A;  2RSO A;  4G4K A;  3SDZ A;  2J7Z A;  1H9J A;  3DM1 A;  4CJ1 B;  1SMY C;  3J80 E;  2IX1 A;  4P2C B;  2K7V A;  1OO9 B;  2H1E A;  5E1F A;  3TME A;  1WD1 A;  2K04 A;  2EYP A;  4BA1 I;  4ZKC B;  1EYD A;  1BCP C;  3S2H B;  3SK5 A;  2EJF C;  1RD9 D;  3P75 A;  4KK7 A;  1BQQ T;  1QCB D;  1X32 A;  4IUT A;  1S4Z A;  4U67 3;  3VR3 A;  1D6E C;  5J39 A;  4KHV A;  4OO1 H;  1PMR A;  3DWA A;  1ZEQ X;  2Z4H A;  1DOL A;  1PRT F;  1U4M A;  1Y8O B;  3BVG A;  3P7J A;  2YYZ A;  5CC4 A;  1XWE A;  1PZJ D;  3QOJ A;  1CI3 M;  2N55 A;  1ET9 A;  5J1Z A;  3TZD A;  4FF1 A;  4BS9 A;  1I6H B;  2B2T A;  1D5X C;  3M4O B;  1I3Q B;  3HOU B;  1UAP A;  5I4D A;  4DGZ A;  5CBA E;  5FK9 C;  1PZI D;  1F9S A;  1SSO A;  2E2I B;  3KF8 A;  4G7H C;  5ELB A;  1I4G A;  3DWQ A;  4AYB B;  1JWM D;  5JEA J;  4G7Z C;  1EOT A;  4ZAI A;  1JWU D;  1KAA A;  1SBB B;  3NBI A;  5KNB A;  3BDO A;  1FNW A;  1TWC B;  1DD2 A;  2SDF A;  1R4P B;  1NAP A;  1STG A;  1EFI D;  1SAP A;  1WTR A;  3HOV B;  3OOC A;  2KJX A;  1YNJ C;  2EYL A;  5M5X B;  2HCI A;  3SEB A;  3DEP A;  2CW0 D;  3IKJ A;  2XSC A;  1J8I A;  4OO1 I;  3K58 A;  5I6Y A;  4NDX A;  3Q0A A;  1F9R A;  4HCE A;  2D5D A;  4Z9C B;  4K6D A;  5G3L F;  3MFY A;  5E4W C;  3HOX B;  2K28 A;  2JP1 A;  4A3K B;  1S5D D;  4JBW A;  1LT4 D;  2AWO A;  4TQU S;  2WKC A;  1DOM A;  5KNC A;  5IT9 L;  2EJG C;  2E74 C;  2IT1 A;  3K5L A;  1PTO H;  3CQZ B;  3A8K E;  4R8I A;  1EU3 A;  1EY0 A;  1DOK A;  3I90 A;  4L63 B;  1S5E D;  1PRT D;  1VF7 A;  2A6E D;  3RMH A;  3RZO B;  5J22 A;  3WDN A;  1E2Z A;  1B9M A;  3ONA B;  5IT9 E;  3H3V C;  2VNU D;  1LT3 D;  1AZP A;  1TWF B;  1NR2 A;  3KBX A;  4RKB A;  4CBV A;  1STY A;  4C3I B;  2K6A A;  3P1H A;  4RKL A;  1TY0 A;  3RD4 A;  1PLF A;  3DUZ A;  3S1R B;  1CZG A;  4QUF A;  2MHV A;  1NUC A;  2F0N A;  1C4Q A;  3IAY A;  4H13 C;  5DAU A;  1I4P A;  1IYU A;  1CQV A;  3U9O A;  4JK1 C;  2J0T D;  3VA5 A;  4XT1 B;  3S15 B;  1V1P A;  1HFN A;  3SE0 A;  2LS0 1;  2RKS A;  3UI2 A;  5C4H A;  1AW7 A;  2R6G A;  4A3G B;  4XTC S;  2NVT B;  3U9S A;  4O42 A;  4H0L C;  2A5H A;  5FKA C;  3J7A F;  1HA6 A;  2PCF B;  3GQB A;  1VF5 C;  5IGC A;  1F9Q A;  1LT6 D;  1HA5 A;  3HZX A;  2F3V A;  2SNS A;  1KDA A;  3C1F A;  1R4Q B;  4F7X A;  4ZUI A;  3NTH A;  5C4J B;  2OXP A;  4ZKB B;  4M1U B;  3GTJ B;  2ZT9 C;  2CQA A;  2DY7 A;  2R93 B;  5G3L D;  2FJ2 A;  1AZQ A;  4DAV A;  1TII D;  1WTP A;  4DK1 A;  3TBI B;  1TKW B;  4YIJ A;  1CHQ D;  2B8G A;  2A6H D;  3K7A B;  3LX0 A;  1Y8N B;  3OMC A;  2A68 D;  1Q1B A;  4K5X A;  3WOE A;  3A8J E;  1BCP F;  3EFX D;  1TWH B;  1FNV A;  4G7O C;  3MEH A;  1WTO A;  4QB4 A;  2EXZ A;  1OXV A;  1EY6 A;  2K05 A;  5DNF A;  3NQI A;  1JC7 A;  5JAV A;  1QWY A;  1G2T A;  3IL8 A;  2F0L A;  3D4D A;  4RGM A;  2FIN B;  4G57 A;  4EQN A;  1AFP A;  2MP1 A;  1XX8 A;  3VYU A;  5C6A A;  4RH6 A;  2E2J B;  1Q3L A;  5EQ0 A;  4HTH A;  1TS2 A;  3NHH A;  2NYZ D;  3Q23 A;  3GTG B;  1A3U A;  5K36 H;  1SND A;  1ILQ A;  1M8A A;  3AU7 A;  4DF7 A;  2LFN A;  2DNE A;  1IYV A;  1TT2 A;  2IW3 A;  1R9T B;  3NTK A;  3K5O A;  2NTS A;  3NSW A;  2JEA I;  1DZ1 A;  1M4V A;  2B2V A;  1F2M A;  5JPN C;  1FNU A;  1E0B A;  3E5S A;  4HED A;  4U68 A;  4ZLT F;  3QWN A;  4BY7 B;  4K5V A;  5JOB A;  5C3E B;  4J8Q A;  4LMQ D;  3N6R A;  3ERO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...