3SK4A

Crystal structure of staphylococcal nuclease variant delta+phs d21n/v23e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS D21N/V23E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk4A00
2HQEA 2M00A 1NUCA 4QB4A 2F0HA 2RBMA 1TQOA 4KV6A 3TP7A 3D4WA 4DGZA 4EQPA 3SK6A 5CC4A 4RKBA 4WORA 3MEHA 4K8JA 4N9PA 2PZWA 4K5WA 2EYHA 3QB3A 2EYFA 2F0GA 3RUZA 4EVOA 3EROA 4NMZA 3D4DA 3MZ5A 4DF7A 1EY8A 3NQTA 3OSOA 3SXHA 4IZ8A 2EY2A 3OWFA 3MVVA 1EY7A 2PW7A 2F0MA 1A3UA 4HMJA 2F0VA 4NP5A 4ZQ3A 5C4HA 4IALA 5KYIA 3V2TA 3LX0A 4KHVA 2EYOA 3H6MA 2QDBA 3E5SA 5EKKA 4J6HA 3EVQA 4K6DA 5IGFA 5K5PA 4NKLA 5C4ZA 4R8NA 2F3WA 4KY5A 5CV5A 1JOOA 5J39A 2O4XA 1SYGA 3U9OA 1SNDA 2EYJA 3NUCA 3QOLA 4KY7A 1ENCA 4S3SA 3SK8A 5C3WA 2WACA 1SYCA 3EJIA 1SYDA 4QF4A 5J22A 1STBA 4EQNA 2F0LA 1KABA 2LKVA 1EY5A 3P75A 2PZUA 3R3OA 4QMGA 3SK5A 5EGTA 1SYBA 4MIUA 5DEHA 5CGKA 5IOCA 1KDBA 1TR5A 5CV8A 2F0EA 1IHZA 4J1MA 5JAVA 5I6WA 1EZ6A 2PW5A 3QOJA 1EYCA 1TT2A 5IGDA 3OMGA 4KD4A 5C3XA 4EQOA 2PZTA 5IIFA 2F0DA 1EYAA 1EY6A 1EQVA 1JOKA 2RDFA 2SNMA 4K2KA 4TRDA 4WRDA 5HGTA 2RKSA 3P1HA 1SNCA 2PYKA 5KGUA 4F8MA 2F0PA 5IODA 1EY4A 3NK9A 3NHHA 1KDCA 4YIJA 4H7BA 5I9PA 1JORA 3S9WA 5CV4A 1U9RA 3DHQA 2F0FA 1JOQA 2EYPA 4B9WA 3NP8A 3DMUA 1II3A 4KJNA 2F0IA 4I65A 5CV6A 3BDCA 5KEEA 3SK4A 2EY5A 4DU9A 1SNMA 4HMIA 1F2YA 4KY6A 3TP8A 1EYDA 4KJOA 1SNPA 5KIXA 3D6CA 5F2DA 1RKNA 1STAA 1NSNS 2OXPA 4ZUIA 3D8GA 5IGBA 2EYMA 1SYFA 4ME5A 4PMBA 5J1ZA 1STNA 5C6AA 1SNQA 2OEOA 1EZ8A 4PNYA 2EY1A 1AEXA 5CR3A 4K2LA 2EXZA 1A2UA 4G57A 3MHBA 2F0OA 4ID6A 2F0UA 5KYLA 1A2TA 5E1FA 5IGEA 5C5MA 3SHLA 5HURA 3TP6A 1SNOA 5JOBA 4ZUJA 5CV9A 3VA5A 1STGA 3PMFA 2F3VA 1ENAA 2OF1A 3SR1A 2F0WA 3MXPA 5I9OA 4HTHA 5KRUA 3T13A 4N9TA 3TMEA 3HZXA 2F0SA 5C5LA 5IGCA 1STHA 3T16A 1SYEA 1A3VA 4ODGA 5NUCA 1EY9A 4KTAA 1F2ZA 4LAAA 2KQ3A 3BDLA 5E3FA 3C1FA 4K14A 1EY0A 1A3TA 1STYA 4K8IA 4B9XA 4RKLA 3TP5A 4E6IA 2KHSA 2ENBA 3HEJA 2F0QA 2SOBA 2SNSA 5ISRA 5CV7A 2EY6A 4PMCA 2PQEA 4F7XA 3NXWA 4OL7A 2NUCA 1F2MA 1KDAA 3ERQA 2EYLA 4IUNA 4KD3A 5DAUA 5EKLA 5M9OA 3C1EA 4K5VA 5IGGA 1KAAA 2F0TA 3ITPA 3OMCA 2F0KA 4DFAA 4NDXA 5I6YA 2F0NA 4K5XA 2F0JA
chains in the Genus database with same CATH superfamily
1IXRA 3I70A 1QUQA 2B3GA 1Y1VH 1K0SA 1X55A 3OPOA 5CC4A 1IL2A 3BVGA 2PZWA 3OHXC 1PFSA 4JCVE 3D4DA 2X6LA 3M4OH 5KYIA 2E5LL 1K9MC 1U0LA 4P72A 3SVMA 4A75A 3J80E 3I4LA 4J6HA 3EVQA 1E24A 1Y8PB 1Z47A 4ILWA 3KF8A 4A3KH 4L5SA 4IQZA 4ZAIA 3SK8A 5C3WA 3DLLA 4XTCS 3NQIA 2JA6B 2ZTCA 1PTOH 1GHKA 4ZKBB 4QMGA 3K5NA 5JJIA 1VQAA 2F4IA 1UNSA 4HR7B 5IP9H 4UP8A 2DN8A 1N34Q 4O2DA 2OCEA 4LUVA 1SR3A 1E2WA 2A8VA 3I8ZA 2JA5B 3PUXA 2PZTA 4LF4L 1O7LA 3DEOA 5HGTA 3S1RB 4JYAQ 2UUCL 3A74A 3DM1A 3KDFB 3HOUB 3NHHA 3Q24A 2MO1A 2N49A 3DHQA 2DY8A 2KENA 3NP8A 1YHBA 3D0FA 1MSHA 2LFNA 4L6TB 1KIXA 5FJ8G 2PNRC 1SNMA 2JEAI 1S5CD 2ZT9C 2ZTDA 4JI5L 1WI5A 4HIKA 1U4RA 3AU7A 1YHQA 2JQOA 2JA7H 1WYDA 5CR3A 2YYZA 2WKDA 2YV5A 5KYLA 2NZHA 5C3EG 2IHEA 5EJWA 3HOZB 4C3JH 1R9TB 5JOBA 3CU7A 5GAHC 2BE5D 1VQMA 4B3SQ 5CV9A 2B39A 1XTCD 2OF1A 1ENAA 3SR1A 2L1BA 4JBMA 4A3MH 3K80C 3J80L 4IUTA 3A55A 1T5XD 4A93H 3S1NH 1TWAB 2GVBA 3WOEA 3STBD 1B9MA 2SOBA 1ESRA 3T56B 1STEA 4JI6Q 3D31A 3J81c 1K73C 1DZ1A 2BE5C 2QDLA 4MTKA 3FPUB 4Y7NH 3F2DA 4FF2A 1YI2A 3AFPA 1DD2A 2UUBL 4CKEA 4DNIA 4A3LH 4DGZA 2FINB 4AYBE 4DNRB 3STBC 4YCUA 4FO2A 3HRZC 1I4PA 3CQZH 1D8LA 1YBYA 3M4PA 1I94L 1PTOD 3SXHA 2EQSA 2K5HA 1FGUA 2TSSA 1XX8A 1O7YA 1SSOA 5K5PA 5C44B 4NKLA 3I91A 3RR5A 4DV5Q 3AYHB 1GJXA 2O4XA 2XRSD 3K5OA 1JCKB 2PI2E 4DR1Q 1EIHA 2M2LA 1LTAD 1PTOC 3NBHA 4KHPQ 1V1PB 4A3EG 5DEHA 5CV8A 2IPKD 5JJZA 4WJ3M 5M5WB 3L0OA 1VF5C 5DM73 5IIFA 2CQAA 4LF5Q 1VQOA 3KF6B 4DR5L 3CF5A 2K6AA 4BXXH 2KHJA 2F0FA 2QEJC 1II3A 1MGSA 1MIUA 2E2DC 3E6ZX 3Q0AA 4KN4C 3OW7A 2KEDA 2MUYA 4OIKA 1F2YA 2SDFA 4XT1B 3I73A 1B70B 5LMNW 1HZAA 2EYMA 1VQIA 1V1PA 4PNYA 4G57A 3U50C 4B3MQ 4B3SL 3S14B 1G8ZD 2CKZB 1PA6A 2WAQB 2HD3A 2I5MX 1DXMA 1P16A 5KRUA 4CJ2C 2CVRA 4HAEA 4JV5Q 1B44D 4CDCC 1M4VA 1FNUA 1HZ9A 2VW9A 1EQRA 3M7NA 4JI6L 3M7GA 1HPCA 1PXUA 1NMFA 4OL7A 1R4QB 5M5XB 1LT6D 4BY1B 2R93G 4OWTB 1C48A 4R4TA 1YITA 3S15B 4DFAA 5IYDG 3S1QH 4NDXA 4Y52H 4UP7A 1T5EA 1XNQQ 1PH4A 4JI4L 3PIP3 4NW2A 2ZM6L 3DWAA 4DA2A 1PFNA 1PH3A 1XPUA 4U673 1ZYRD 1D6EC 5BN4A 3RZDH 2JSOA 3IAYA 1LACA 2A5HA 4NMZA 1IBMQ 5IGFA 1TWCH 3EIVA 1E2VA 4R4IA 2EYOA 5GQOA 3O13A 1V8QA 4RA8A 1W6KA 1XMQQ 1X6OA 2JA9A 2K5QA 3HOVB 1ZYRC 1H9MA 2LS01 1HJPA 1LLRD 4QF4A 2N3SA 1I3QB 1HQMC 1LV9A 3K59A 2R7DA 1I6VC 4IUPA 2G9DA 3EN2A 1HR0Q 3J7YW 3VYUA 4IJLA 4NB3A 4LF5L 3FP9A 3PO2G 3GTJB 1G51A 4EQOA 2YU9B 1QE6A 3UDIA 1WTHA 3S16H 1CQFA 3H3VH 3KLWA 5JPMC 4DXGA 3A0JA 1EOTA 3GTLH 2KUMA 4H7BA 2QGQA 1F9PA 4JI8L 1JOQA 3BS1A 2UUAQ 3PF4A 4IURA 1BCPD 3RZOH 3RN2A 4DV4Q 5GROA 5FJ8H 4HMIA 4KY6A 2WINB 1Q46A 4KJOA 1EYGA 3GTQB 3OTOL 2PQAA 4C1NK 4B3ML 5M3FG 3JAMc 1AEXA 1DCZA 1Q8KA 5LMUQ 3VR3A 4XYQA 1OXUA 1BO0A 1YJWA 3UE1A 2A69D 1BCPC 1GHJA 3MXPA 1RF2D 1VQPA 4K6LA 1PLFA 1WD1A 1PRTF 1TWHB 1SYEA 2YTVA 4WJWA 1KLGD 5FLXc 1UE1A 1G291 4U68A 1YJ9A 2B8FA 2EVBA 2NWGA 4TQUS 3TP5A 3T1HQ 3FKIB 4LFAQ 1UAPA 4L5TA 4QGUA 1PDQA 2ZXOA 1K8AC 3GO5A 4BY7B 2A69C 3URYA 2F0TA 2RVLA 2VL6A 3ITPA 3OMCA 1CA5A 2Z9HA 2R7ZB 3HOYG 4Z9CB 2AWOA 4JBJA 1IBLL 1VMPA 1JT8A 2KCMA 4EQPA 1ZXTA 1LTRD 2MPMA 1YEZA 5I4DA 4BBSB 5C0XJ 1L1OB 3CRLC 3RD4A 5FO7B 1SN8A 1C0AA 4C3IB 4IZ8A 2JXMB 4NP5A 1PRTB 2R7FA 1XMQL 4KHVA 3H6MA 2UU9Q 3E5SA 5EKKA 2B2TC 2L12A 1RJTA 2VXWA 2F3WA 3AEVA 1OTCA 1IBKQ 1ENFA 4AQYL 5IE8A 3I4NG 3GTKB 4L5QA 1HZBA 4EQNA 1X56A 3R3OA 3OIQA 1HR0L 4RHRA 3OWEB 3QO2A 1SYBA 4L8JA 1TS4A 4A3EH 2XTIA 4C56C 3A7LA 5CMDA 1K0RA 3CCQA 2VQFQ 2F03A 4A3FG 3BJUA 1XWEA 5E4WC 1S5ED 1CK1A 1CTMA 1VF7A 2XVSA 2HT1A 2EPBA 3CCVA 4IFDH 2P5ZX 4DV4L 1QOHA 2F0IA 3M9BA 2B2WA 2NVYB 1I50B 1JWMD 5GADC 1U4PA 3ULJA 2R6GA 1Q12A 3D8GA 1X32A 1D1IA 3R2IA 1SNQA 4ZYSA 1KD1C 1RCVD 4BBRB 5CYUA 1DYQA 2B29A 4X3SA 5HURA 4JI7Q 4XDXA 5EPJA 3RNUA 5CBAE 4DR7L 4GNXA 2JA6G 1B8AA 4FYDA 2B2VA 1KTKA 5E3FA 5M9OA 5LL6S 2IT1A 4RKLA 3GTOH 1A0IA 1U5KA 2N78A 4UHVA 4IFDJ 4YCWA 1NE3A 2NUCA 1W3SA 3PO3B 2E2IH 2L15A 2L4NA 2OQKA 2JA5G 4JPBW 4RG1A 3FHWA 2R93H 5I6YA 4FF3A 3K58A 4F88A 2FFKB 4MTNA 5IYDH 4A3JG 2RBMA 3TP7A 4X64L 3K5LA 3HOUG 4NPSA 2QILA 4RKBA 1NJIC 4JI2Q 1GOZA 1IKMA 4EVOA 1Y14B 2E74C 1G91A 2B8GA 2A74C 1K8GA 1EY8A 4K0KL 1LTLA 2NVXB 3MWYW 5DLQE 4JW0A 1ESFA 1QNKA 2H4OA 1W2BA 1DOKA 4DR3L 4JI0Q 2DNCA 5ELNA 4K6DA 4X65Q 1TS3A 4P71A 3RLNA 3TSSA 3HOZG 2EYJA 3NUCA 2KEEA 1PH5A 4DV2L 3SEBA 1SYDA 2N8NA 2XN9C 2EJFC 3S2HB 3IFTA 2EIFA 1KHIA 3BZCA 4ALPA 1RDPD 3VR2A 3K81C 4KI0A 2B2WC 4MIUA 3FPPA 1E7ZA 2VQFL 3QOJA 3ZYYX 4GOPB 4RCOA 2HIVA 3LGJA 3J81L 3H0GH 1CSPA 3N52A 1XYIA 2F0PA 1WTQA 2L5TA 3GTGB 3I4MB 3S9WA 5M5YH 4A3BG 1E1OA 4NXMQ 3GTMH 2XSCA 1WTWA 4FDBA 3HKZB 2YTXA 2BDNA 2EOTA 1SNPA 4AH6A 3C2PA 2F52A 1Y1WH 4ME5A 1WCMB 2NZOA 4R4CA 2K03A 1A2UA 2EJMA 1FGBD 4JI7L 2X6GA 5IGEA 2I5HA 2K01A 1CZWA 5JVH3 2MQHA 4P75A 4LF4Q 2PPBC 5C44G 4F87A 2JEBI 1STGA 2FJ2A 2F0WA 4KKTA 4N9TA 5AJ3L 1Y8NB 3L9AX 5ELBA 2M9VA 2G5DA 2QKIC 4DN4M 4DV7Q 2E2HB 3S1MH 3I72A 4B9XA 4QIWE 4DAPA 2SNSA 1LT3D 5ISRA 4DK1A 2A6EC 4JI5Q 2L55A 5C4XH 1U4LA 1NNXA 1PH8A 1PH9A 1QUQB 2F0KA 1B1ZA 2B2YA 2KHIA 4A76A 3HOYH 3FRPB 4OGQC 1XJVA 1K83H 4GN5A 1PYBA 1YIJA 3P7JA 4Q0FA 5M3MB 5KNBA 3TRZA 2F0GA 1NTGA 5DNFA 2LXKA 3OSOA 2E2JH 2VY3A 2L9HA 1PTOF 3FMCA 4B3TL 3KF8B 4JI0L 5L37A 2FMCA 1J9OA 2AQ2B 1L0XB 3PUVA 3GP7A 1Y1VB 5IWAQ 3P20A 3ND8A 1JB3A 1N8RC 1VQEA 2WAQG 4KMUC 3I4NH 1AH9A 5A2QL 3G7LA 2UUBQ 1QVFA 1VDZA 4DNTB 4A3IG 5JEAG 2VUMB 2OTLA 1I5FA 3KLSA 4G7HC 1PH7A 1CKOA 1NR2A 4DR2L 4A3KB 5IT9c 1I94Q 4DAVA 1Q3LA 3D3RA 2RSNA 3CPFA 1L0YB 2GA4B 1JOKA 4WRDA 3U9SA 1EWHA 1PTOB 4CKBA 2PMZE 3P1HA 2PYKA 1YNND 1KLUD 2KJXA 4ZK9B 2JP1A 4NXML 5CV4A 4IN3A 1V1QA 4DK6C 4I65A 1KAWA 2ICEC 3PCOB 3JAME 3T1YL 3S24A 1QZGA 5F2DA 1QWYA 1EEID 3MTSA 1GM5A 2K14A 1YNNC 3A5ZB 1C8CA 2NVQH 1GUTA 4V190 5E1FA 3I4OA 3HOXG 4LW1A 1TWFB 1NBWA 3UDXA 2D62A 2B2YC 5FLXE 5EPKA 5FO8B 3BVZA 3BDOA 2NBFA 3T53B 3HOVG 2VNUD 4DR5Q 4DV7L 2IJ0A 2JA6H 3VDYA 2JA7B 1GUNA 4G7ZC 3C1FA 4DAYA 2K5DA 1HUNA 1YZ6A 2OQ0A 1WVLA 3E0EA 3W5OA 3GTPB 5EKIA 4C3JB 4F7XA 5EKLA 2JA5H 2H1EA 2DJFC 3EROA 2F0JA 3S1RH 3NTIA 4A93B 3BYTB 4A3JH 3NENA 1Y8OB 3NSWA 3QB3A 4L63B 4LNQA 1BNZA 3PUWA 1XTDA 1LTGD 4Y7NB 4A3GH 3PUZA 2O2LD 1NCVA 3J80i 5IWAL 2QDBA 4A3DG 4OHJA 2UXBQ 3JAML 2PI2A 4Q5VA 4R8NA 3S17H 2WB1B 3LWUA 4LUOA 1GUSA 1SYGA 3CRKC 3NBHB 4I7ZC 5COYA 5EPLA 3W3AA 3PF5A 3CQZB 1R9TH 3HP3A 3BG3A 3A8KE 5C4JB 2VZAA 1WTOA 4JI4Q 1EY5A 4HJ7A 1FJGL 3CCJA 2V4DA 2ZM6Q 3VR5A 3ONAB 3I2ZA 3A7AB 4OELB 4C3HG 4PG3A 1KDBA 5FLXL 3PIO3 4BA1I 1N33L 3ULLA 1TY2A 2Z8LA 1YVCA 4KKSA 1S40A 2IL8A 2J4XA 3L3OC 1EY4A 4RGNA 3J81j 2R7ZG 1A8VA 1A15A 3G6JB 4H13C 3PSIA 4A3BH 5K36H 3HOWG 1MI2A 1TWGH 4BBSG 2IY5B 1H9SA 3CHBD 1E3PA 5E7NA 1IZ6A 1HQRD 4C3IG 2B63H 2Z6BA 2OEOA 1YNJD 3MHBA 1SBBB 1A2TA 4LJZC 4CHTB 1EUJA 1XXGA 3TP6A 3W2DA 1XMOQ 1V1OA 1JORA 5C44H 1WTRA 1I4RA 5CBEE 1STHA 1JWSD 1A3VA 3K6OA 1HA5A 1E0BA 4JI8Q 1TS2A 5TSSA 5D3DA 1YNJC 1CKNA 2KHSA 5HGQA 1HR0W 3IFDA 2EY6A 1BUVT 2RDGA 2K04A 1K3BC 1BCPB 2BOSA 2NTTA 4YWLA 1JJ2A 3OTOQ 2CWPA 3K57A 1AZPA 5IGGA 5M5WH 2K5NA 2OT2A 4IUVA 2UXDQ 2Z4IA 4JI3Q 1XNRQ 2CFMA 1NUCA 2QEXA 4KV6A 3TS0A 2JK8A 1BXTA 3SK6A 4K8JA 4FXDA 2XWJB 2AUKA 2PW7A 1MJCA 2UXBL 3S1QB 1VQCA 3A8JE 4UP9A 3X3NA 1TKWB 1WFQA 2WACA 1I4XA 4YWKA 3SK5A 1MD2D 3LNNA 1IBLQ 3E0JA 2K32A 3SGIA 3CC7A 5JJKA 1H9KA 1TR5A 2Y0SB 1WTVA 2PW5A 4A3IH 5JEAH 3HFZB 1TT2A 1PFBA 4TRDA 5C3XA 2HUGA 4CDDC 3PO3G 1I4QA 2F1MA 1EWCA 3TQYA 4JVZA 1JE5A 1AN8A 5ELFA 1Q86C 2HCIA 1VQJA 1B3AA 1FR3A 2XGTA 4AQYQ 2AUJD 2KCTA 2PQAB 3UE0A 1LTBD 5BN5A 3S2DH 5KIXA 3D6CA 1VQ5A 1C4QA 1RKNA 1PYWD 4OEMB 4LWCA 1STNA 3R2TA 5BN3A 2PO4A 4FNFA 3GTLB 4QUCA 2B2TA 1ASZA 4KLKA 1VQNA 4X3TA 1XMOL 2K50A 2K5VA 3SHLA 1SNOA 3HOXH 1NMGA 1RD9D 1TXYA 5JJLA 2YTYA 3RZOB 3H09A 2QCPX 1T9HA 2WP8J 2BCOA 1ASYA 2JJQA 3SDZA 5D14A 1CUKA 1IKLA 3KUPA 2WAQE 3K0XA 1CFMA 1ZEQX 2KQ3A 4X66L 3VR4A 1VQKA 2DGYA 3VYTA 4X62L 1S72A 3W1GA 1VQDA 4DV3Q 3C46A 2NTSA 2R92B 5J3BA 2C9OA 1Z7TA 3PUYA 2K33A 3BVMA 4KD3A 5EQ0A 4J8QA 2A6HD 4XIGS 4JI3L 3MXUA 1XNRL 4R4OA 2UXDL 5C3EH 2Z4HA 4RGTA 3CCUA 2L0CA 4ABNA 3EFXD 2BH2A 1K8MA 3D4WA 4A4IA 1A63A 1A62A 3BZDB 5DM63 3Q23A 4ZRZA 4DR7Q 1D5XC 2EYHA 4K5WA 3VR6A 1SDFA 3A5UA 1EWIA 1O7IA 1KNEA 2VB2X 4DR4Q 3MZ5A 3HKZG 4R4QA 4KHZA 4G4KA 2JA8G 5CV7A 2LMCB 2A6HC 1L2FA 1D5ZC 1CKMA 1WCMG 2KBNA 4A3DH 1Z9FA 3QOLA 4LF9L 4AIMA 4GS3A 2FXQA 3KJPA 2Q2TA 3IL8A 1HZCA 4TKOB 4PZ8A 4YY3L 1QZHA 4X64Q 5IT9E 1UE6A 2XRQD 4C3HH 5JAVA 3DM3A 3IRBA 5I2YA 4K0KQ 4KN7C 1JB7A 4QCLA 3KJOA 2RDHA 4OX9Q 2NN6G 4UY8C 1SNCA 4EX5A 1JR0D 1Q1EA 4DR3Q 4CJ0B 1J8IA 3JC66 4GKJL 1WTXA 3ICEA 2FHTA 4KJNA 4DK3C 3BDCA 1PH6A 4GN4B 4DV2Q 3CKIB 3BZKA 3HOWH 5M3MG 1EYDA 4CDEC 1B2TA 2OTJA 3OOCA 1B9NA 1BKBA 3DEPA 2EXZA 4JOIC 2Z1CA 5I2XA 2JYOA 4GNXB 3QWNA 3AQQA 4CDFC 5LMNL 5IY0A 1EOVA 4I7AA 5C0XI 4ODGA 1HNXL 5IP7G 4ZKCB 4DR6Q 3CMEA 4DV3L 1HFGA 1ZKOA 2KOLA 3ER0A 4XT3B 2JE6I 4RHSA 2XIWA 1SE8A 4PMCA 2MGSA 2VUMG 3NXWA 1JWUD 1VQGA 2X69A 3F2BA 1QG7A 5IT9L 1EFWA 4MZ9A 2UXCL 1KC8C 5ELCA 2FMMA 1FL0A 1X54A 2DNEA 3GTOB 2A68D 4RWSC 4DR4L 4WJ4A 2NB0A 5AJ3Q 1LYLA 3RLOA 1MJEA 2QF7A 3J81E 2NVTH 4HMJA 4RFBA 1OXXK 4DAMA 3U58A 2R93B 1MHWC 1AFPA 4HN7A 3A56A 2HIXA 2NZ1D 2WV6D 3I56A 2Q2IA 4C1NI 2A68C 1ENCA 1YNXA 1STBA 4ULLA 1Q81C 2PZUA 4TVAB 2Q2HA 1I6HH 4N8FA 5CGKA 3CCLA 4IPDA 2JA7G 1PYSB 4J1MA 2HQLA 3OIPA 3K7AH 4HSVA 4OX9L 1E1TA 3Q6SA 1X9NA 3M4QA 4PMWA 4B3TQ 1LO5D 4RH6A 3AMUA 4F8MA 3HG9A 5EBDA 4LMQD 1IW7D 4KKUA 4ZCKA 4B08A 3PQIA 2MFIA 2E8GA 5CORA 1SFOH 2RQXA 4NXNL 2ZJPA 3CC2A 4QUFA 4H0LC 1B3QA 1L1OC 5J1ZA 5KNDA 2VS1A 1PZKD 1VQ9A 3H0GB 4J15A 4K2LA 4ID6A 2K1BA 3PO2H 1QCBD 5M5YB 4DR2Q 1IW7C 4DUYQ 3M85A 1PZID 3GTMB 1SRUA 3G4SA 4HIMA 2WB1G 2CW0D 1SROA 3HKSA 3HZXA 4DR6L 1Y1WB 4C2MH 1F2LA 1BVSA 3J81i 3BDLA 1J6QA 1PV4A 2KVMA 4HJ9A 3T1YQ 2PQEA 5G3LD 1JJGA 5M3FH 2E75C 5A2QE 2CW0C 1WD0A 4UDUC 1LTSD 2Q8RE 2RHSB 2A6ED 3QIAA 3DWQA 4IOAA 2HCCA 2HQEA 2M00A 5JPNC 3DWPA 2AMCB 1OO9B 1CHPD 1X3QA 3M3YH 1HNWL 4IUQA 1PVOA 2MHVA 3NWSA 4EQ5A 4HJ5A 2ID0A 5BR8L 4ZLTF 1U4MA 5C4XB 1IYUA 1EY7A 1MBYA 1A3UA 2Z6KA 4ZQ3A 2JA8H 5C4HA 4DPGA 1E2ZA 3V2TA 5FO9B 1WCMH 1HNZL 5IYBG 1EQTA 4BXXG 1SE2A 4IO9A 1SAPA 1SNDA 2HHHQ 2IWHA 2CQOA 2E2JB 2F0LA 1FD7D 1AW7A 4X3KA 1UEAB 1JJCB 3GD7A 3CW2C 4HIDA 1K28A 2BA1A 3A54A 1KXLA 2Q8IB 1EZ6A 2E2HH 2ZJQA 4P74A 1PH2A 1J5EQ 4KD4A 1EYAA 1EY6A 2RDFA 3I4NB 1LUZA 4XQQA 2VB3X 2ALYB 1LT5D 1FNWA 1GO3E 2EYPA 3GDEA 1OXTA 2D5DA 1EIYB 3M4OB 3I3CA 1SXTA 4HIOA 4LF8L 3R93A 2C35B 1FJGQ 4MN3A 4OONA 1SYFA 4EGVA 1S5BD 1IYVA 1HRJA 2IW3A 4DUYL 3HKZE 5ELOA 2ICIA 1N33Q 4IJHA 4XQNA 1LABA 1VS0A 2A1AA 1GUWA 4BY1G 4A3FH 1HFNA 1QJOA 2HDMA 4PQXA 4IPCA 3R8BA 4DAYB 5C5LA 5IGCA 2IHFA 1RTOA 4LAAA 1ILPA 1FVIA 5IP7H 2I46A 1B4OA 2JN4A 4E6IA 3CXCA 1SJHD 2ZJRA 2NVQB 4LFBQ 2Z6KC 2Y0SG 2EZVA 3MXNB 2EJGC 4HCEA 1VQ8A 2EYLA 4GLXA 2VUMH 4OO1I 4AYBB 3C1EA 4K5VA 3TN2A 1VQ7A 2F0NA 3NEMA 4POGA 4JC0A 1CSQA 3DUZA 4GOPC 1VQBA 3W1BA 1X3PA 2K52A 1HA6A 2ZXRA 3OWFA 2EY2A 3BU2A 2NN6I 4LUZA 2KCCA 2CHBD 2O5JC 5EBCA 4CBVA 1O80A 4A3JB 4A3MB 2HHHL 4OXPA 4IPHA 4OIJA 4FVMA 3MXNA 3KK7A 4S3SA 1F77A 3S1NB 1TWFH 1H95A 2BA0A 1X3FA 2O5IC 3HOUH 2CH4W 4A3GB 4JK1C 2J0TD 4YWMA 1SJED 1BF4A 5IOCA 2ES2A 1J5EL 4LFCQ 5LL6X 1IHZA 2QA4A 1G6PA 1L0WA 3S17B 5C0XG 3K5MA 3VA7A 3TDQA 3PGZA 1IYJB 2R92G 1EQVA 4K2KA 4RGMA 1PHJA 3GTPH 1BBWA 2ATWA 5KGUA 2R3ZA 1AE2A 2LSSA 4YIJA 3TBIB 4ME3A 3HOZH 1NAPA 1H9SB 3OW2A 3KDFA 4HJ8A 2EY5A 4PZ7A 2L11A 3JAMi 4ZUIA 1Z6HA 1DM0B 2MJ8A 4DKAC 4YCVA 1TVXA 3TEHB 3J7ZC 1OXSC 1TWAH 1HUMA 1CA6A 3KOJA 4MNOA 1GKHA 4WFN3 3PIOA 1ILQA 3FKIG 2F0OA 4HEDA 3E9IA 4A3BB 4BY7G 4DUZQ 1DOLA 1VQHA 3TZDA 5D3IB 1TWGB 3UDGA 1CQVA 3T13A 2F0SA 1CKNB 1G2TA 2RA4A 1G6ZA 1EY9A 1UWVA 2B63B 5C4JH 1G2SA 4LFBL 1BCPF 1STYA 2LY7A 3A8IE 1JMCA 1D5MC 1SEBD 1VCIA 5DAUA 2ZXPA 3LWEA 1AE3A 4G7OC 1ICFB 1M8AA 1LTID 4K5XA 1UE7A 4QJFA 4CGYB 1ET6A 3AFQA 4YHHQ 3FVQA 1N34L 1KRSA 1QNUA 1D1KA 3MEFA 4O0AA 3RUZA 4GLVB 1UUPA 2CH4A 2KA7A 4JG2A 3NWTA 3MVVA 5FLMG 4JYAL 3AB9A 4X66Q 4X62Q 1D2BA 3WWVA 2AQ1B 1LT4D 5C4ZA 5IYBH 3QR8A 3H15A 3KLSX 5J39A 4B3RQ 5H1SE 1LM0A 4IFDG 4KY7A 1Y69U 1EEFD 2IX3A 4GKKQ 2TMPA 3F2UA 3H94A 1VQ4A 5ELEA 2WB1E 4UPAA 4LFCL 2ASBA 2I07B 3MFGA 3F1ZA 3GQBA 3WDNA 2F0EA 4JI1Q 4H44C 5I6WA 1CHQD 4GLAC 1CT1D 3QJYA 2NYZD 3NK9A 4BBRG 3RZDB 2WIIB 4DXFA 4HCSA 3DXJC 1U9RA 4OWXB 2GN5A 3MC0B 2F4VQ 3KF6A 3ZJYC 3S14H 4B9WA 1IL8A 5KEEA 4LF9Q 1RL2A 3K7UC 1FNVA 1K8OA 5AFWA 3SK4A 4DU9A 3PIPA 4A3IB 1TWCB 1EIFA 2HDLA 3I90A 3UDFA 3F8TA 4YY3Q 5FOBB 4PMBA 1HHVA 2A19A 2CWAA 1VMCA 2EY1A 3G6EA 2F0UA 4UAIA 4DUZL 4IOCA 3CCMA 4DK0A 5M5XH 4HSPA 3VA5A 4N8X1 4BY1H 1GVPA 4HTHA 1ML0D 3S15H 3S2DB 1SE4A 4QQBX 5IYCG 2KCNA 4GKJQ 4GN3B 3UI2A 1CI3M 3E9HA 2J7ZA 4LF6Q 1RTNA 1A3TA 5GAGC 1YJNA 1N9WA 1Q82C 3ND9A 1Q8IA 3S16B 3HOXB 4DV5L 1KDAA 3CMAA 1N36Q 4DR1L 1S5DD 2Q2UA 4BS9A 3G71A 2D2CC 1QVGA 4KHPL 2DJGC 1TQOA 4YHHL 1UE5A 5JEAJ 4RMFA 3HOVH 3NELA 4WORA 1R4PB 3MEHA 1YHAA 5LMNQ 2MNAA 4DF7A 1I3QH 3NQTA 1VQFA 3U4VA 1HNXQ 2A73B 2F0VA 3CCRA 1KQSA 2SEBD 3MFYA 4IALA 4POFA 4FF4A 5C3EB 3N6RA 1X3GA 4JOIA 3L2PA 3H0GG 5HY6A 1KNAA 1TY0A 3GV3A 4B3RL 3KBGA 4FF1A 3QG1A 5JVG3 3GTJH 5ELDA 4GKKL 2YU9H 3J80c 3NTKA 1SYCA 4BA2I 2RCFA 5FK9C 2UXCQ 3BYYB 5T1GA 3I4MG 1KABA 2LKVA 3CD6A 3KFUA 3PV0A 1DGSA 4JI1L 4H02A 1Y1WG 2G9HD 4DV0Q 3FDTA 1HTPA 3K8AA 2K5WA 1WJJA 3X3MA 5KNCA 4A3DB 1NR4A 4TSSA 1EYCA 1JQYD 1BQQT 4RCNA 5C0XH 1F9QA 4XYOA 1MKHA 2E76C 3U4ZA 3GTQH 1QVCA 3IKJA 3T4AC 1Q90A 1X3EA 2R92H 2RKSA 1SLJA 2Y0SE 5A35A 5IODA 2F4VL 1ET9A 4JV5L 4O1NA 4FXKC 3OYYA 4O42A 3RN5A 1AZQA 3V05A 4OO1G 1OXVA 3J7AF 2MO0A 4C3HB 4R9WA 1KL9A 3VYSA 3TS2A 1WOCA 1EU4A 1P8LA 1STAA 1TWHH 1EQQA 5IGBA 2VQEQ 2V1CC 3VYRA 2MP1A 3L7ZC 5C6AA 5C4XG 2KECA 4KK7A 2OWOA 1XNQL 3J7A5 3FKIH 4A3CG 1BR9A 4ZUJA 1EIGA 2I0QA 4BY7H 5I9OA 2DUDA 3HOWB 4LF6L 4M1UB 2R7ZH 3Q22A 2Q8TA 4A3EB 1IBML 2K4KA 3WOFA 1F2ZA 3H3VI 1JC7A 1QILA 4JBKA 4BBSH 2ENBA 3HEJA 2F0QA 3Q8DA 1N36L 4APVA 4NXNQ 2AWNA 3EBEA 4C3IH 3ERQA 5G3LF 1BBUA 2I5LX 3H91A 4XXEA 1KAAA 1H9RA 1RHPA 1Y1VG 1BDOA 2F0HA 4QB4A 3SE0A 3F2CA 1DJRD 5D65A 1V9PA 3GTKH 1GXDC 1H9JA 3TREA 1L1OA 5EAYA 2N88A 4JBWA 5FLMH 3HGBA 1E22A 1QB5D 3C3LA 2R61A 3J7AV 2PNHA 4A3KG 3I7FA 2C5CA 2N55A 4DV1Q 2ZTEA 3H3VC 3CCEA 5CV5A 1JOOA 2UUAL 3V96A 1SMYD 2QW7A 4P73A 2AHOB 2AKWB 3FEWX 4BWGB 1JE4A 3P75A 4DV0L 2NVTB 2Z0SA 4FXGC 4RGOS 5IP9G 1D7QA 5EGTA 4CKCA 2XWBB 3NPPA 1HNWQ 2E2IB 2NVYH 5IGDA 1I50H 5BR8Q 5FKAC 5GAEC 5LMUL 2SNMA 1B50A 1SMYC 2WKCA 2RF4A 5T1IA 4AYBG 1PFMA 1HNZQ 5I9PA 2K75A 1I6HB 4BBRH 3B6YA 4V0BA 3DMUA 2DY7A 1TIID 3K7AB 3T1HL 2F3IA 2BH8A 2VQEL 4LFAL 4OWWB 1XPOA 1NSNS 2OXPA 1DOMA 1EFID 1SMXA 2WFWA 1CZGA 1GUOA 1X65A 1PH1A 1RODA 4C3JG 4DV6Q 3HS0C 2K28A 3NBIA 5E4XA 3PO3H 1SFOB 4A3MG 3PMFA 2F3VA 4QIWB 3NE5B 3TMEA 1PRTD 1AP0A 1VQLA 3T16A 2BDOA 4A93G 2XNAC 5IYCH 4KTAA 2EE1A 1S4ZA 2PCFB 4QL5A 4A3GG 1HH2P 1EY0A 4MHEA 1B53A 2UU9L 2RHQB 3PO2B 2AQ3B 1JICA 4LF8Q 4IFDI 2B2UA 1O7ZA 1IBKL 2EDGA 1VQ6A 3RMHA 1MSGA 3ERSX 1N32Q 1FYCA 2RSOA 3CCSA 2NVXH 2K05A 2D0OA 1PMRA 3ULPA 3KYHC 1PRTC 2CCZA 4LF7Q 4A3LG 4C2MB 1BOSA 4X3UA 4M8AA 3MXGA 4N9PA 4L5RC 1EU3A 1TU2B 2EYFA 1B7YB 1I4HA 3S2HH 4GZYC 5M3FB 2IX0A 2F0MA 1HTLD 1K3RA 3LX0A 1W6JA 3KBXA 4DV1L 1M1KC 2E5LQ 3CPWA 3RLFA 3TZUA 5LHY1 4KY5A 1PZJD 1Q1BA 4P2CB 3M3YB 3K0YA 3U9OA 1I4GA 4X6AH 1S3OA 3CP0A 3EJIA 4R8IA 3I55A 5K36G 5J22A 4IPGA 3EA6A 4GNXC 3S1MB 1LTTD 3T51B 1NY4A 3GTGH 3I4MH 2JA8B 2B2VC 3GV6A 2D0PA 1XPRA 2RCNA 1Q7YC 2B63G 3EQLC 4PV1C 2PMZB 1S5FD 3KLRA 2LXJA 3OMGA 4QY7A 1HXYD 1UEBA 2F0DA 1GUGA 3CC4A 2K7VA 3HOYB 1K83B 2GVAA 1F9SA 2UUCQ 3G48A 1KDCA 1F9RA 4GOPA 1EL0A 4FP5D 1C7YA 1GD7A 1HCZA 4LK1C 5CV6A 4OO1H 1BBXC 3TP8A 3MAQA 3E3XA 1SE3A 1RIPA 4RAUC 1ICWA 1KRTA 3D6WA 1EZ8A 4DV6L 4IUUA 2B2UC 1CM9A 4HJAA 5C5MA 4A3CH 3D4RA 2EXDA 4PZ6A 2IX1A 2NN6H 4JI2L 1V43A 4CJ1B 5NUCA 1C9OA 1TS5A 1M90C 2D9UA 4K14A 3CAMA 1A6XA 4K8IA 2H5XA 5M3MH 4XQJA 4X65L 1N32L 1ONLA 1F2MA 1O78A 4IUNA 4A3FB 4LF7L 1WTPA 4R1JA 3NTHA 3M4YA 3MA2B 1DONA
chains in the Genus database with same CATH topology
3I70A 3OPOA 5CC4A 3BVGA 2PZWA 3OHXC 3D4DA 2X6LA 5KYIA 3SVMA 3J80E 3I4LA 4J6HA 3EVQA 1Y8PB 1Z47A 4ILWA 3KF8A 4IQZA 4ZAIA 3SK8A 5C3WA 4XTCS 3NQIA 2JA6B 1PTOH 1GHKA 4ZKBB 4QMGA 3K5NA 2F4IA 1UNSA 4HR7B 2DN8A 1E2WA 3I8ZA 2JA5B 3PUXA 2PZTA 1O7LA 3DEOA 5HGTA 3S1RB 3DM1A 3HOUB 3NHHA 3Q24A 3DHQA 2DY8A 3NP8A 1MSHA 2LFNA 4L6TB 2PNRC 1SNMA 2JEAI 1S5CD 2ZT9C 1U4RA 3AU7A 5CR3A 2YYZA 2WKDA 5KYLA 5EJWA 3HOZB 1R9TB 5JOBA 3CU7A 2BE5D 5CV9A 2B39A 1XTCD 2OF1A 1ENAA 3SR1A 2L1BA 3J80L 4IUTA 3A55A 1T5XD 1TWAB 3WOEA 1B9MA 2SOBA 1ESRA 3T56B 1STEA 3D31A 1DZ1A 2BE5C 3FPUB 4FF2A 1DD2A 4CKEA 4DGZA 2FINB 4DNRB 4FO2A 3HRZC 1I4PA 1PTOD 3SXHA 2TSSA 1XX8A 1O7YA 1SSOA 5K5PA 5C44B 4NKLA 3I91A 1GJXA 2O4XA 2XRSD 3K5OA 1JCKB 1EIHA 2M2LA 1LTAD 1PTOC 3NBHA 1V1PB 5DEHA 5CV8A 2IPKD 5JJZA 5M5WB 1VF5C 5DM73 5IIFA 2CQAA 2K6AA 2F0FA 2QEJC 1II3A 1MGSA 2E2DC 3E6ZX 3Q0AA 4KN4C 3OW7A 2KEDA 2MUYA 4OIKA 1F2YA 2SDFA 4XT1B 3I73A 2EYMA 1V1PA 4PNYA 4G57A 3S14B 1G8ZD 2WAQB 1DXMA 5KRUA 4CJ2C 2CVRA 4HAEA 1B44D 1M4VA 1FNUA 3M7NA 3M7GA 1HPCA 1PXUA 4OL7A 1R4QB 5M5XB 1LT6D 4BY1B 1C48A 3S15B 4DFAA 4NDXA 1T5EA 3PIP3 4NW2A 3DWAA 4DA2A 1PFNA 4U673 1ZYRD 1D6EC 5BN4A 2JSOA 3IAYA 1LACA 2A5HA 4NMZA 5IGFA 1E2VA 2EYOA 3O13A 1V8QA 4RA8A 1W6KA 2K5QA 3HOVB 1ZYRC 1H9MA 2LS01 1LLRD 4QF4A 1I3QB 1HQMC 1LV9A 3K59A 1I6VC 4IUPA 2G9DA 3J7YW 3VYUA 3GTJB 4EQOA 2YU9B 1QE6A 1CQFA 5JPMC 4DXGA 1EOTA 2KUMA 4H7BA 1F9PA 1JOQA 3BS1A 4IURA 1BCPD 4HMIA 4KY6A 2WINB 4KJOA 3GTQB 4C1NK 1AEXA 1DCZA 3VR3A 4XYQA 1OXUA 1BO0A 2A69D 1BCPC 1GHJA 3MXPA 1RF2D 4K6LA 1PLFA 1WD1A 1PRTF 1TWHB 1SYEA 4WJWA 1KLGD 1G291 4U68A 2B8FA 2EVBA 2NWGA 4TQUS 3TP5A 3FKIB 1UAPA 1PDQA 2ZXOA 3GO5A 4BY7B 2A69C 3URYA 2F0TA 2RVLA 3ITPA 3OMCA 1CA5A 2R7ZB 4Z9CB 2AWOA 1VMPA 4EQPA 1ZXTA 1LTRD 2MPMA 5I4DA 4BBSB 5C0XJ 3CRLC 3RD4A 5FO7B 4C3IB 4IZ8A 2JXMB 4NP5A 1PRTB 4KHVA 3H6MA 3E5SA 5EKKA 2B2TC 2L12A 1RJTA 2VXWA 2F3WA 1ENFA 3GTKB 4EQNA 3R3OA 3OIQA 4RHRA 3OWEB 3QO2A 1SYBA 4L8JA 1TS4A 4C56C 3A7LA 5CMDA 2F03A 1XWEA 5E4WC 1S5ED 1CK1A 1CTMA 1VF7A 2XVSA 2EPBA 4IFDH 1QOHA 2F0IA 2B2WA 2NVYB 1I50B 1JWMD 1U4PA 2R6GA 1Q12A 3D8GA 1X32A 1D1IA 3R2IA 1SNQA 4ZYSA 1RCVD 4BBRB 5CYUA 1DYQA 4X3SA 5HURA 4XDXA 5EPJA 5CBAE 4FYDA 2B2VA 1KTKA 5E3FA 5M9OA 5LL6S 2IT1A 4RKLA 4IFDJ 2NUCA 3PO3B 2L4NA 5I6YA 4FF3A 3K58A 4F88A 2FFKB 2RBMA 3TP7A 3K5LA 2QILA 4RKBA 1GOZA 1IKMA 4EVOA 2E74C 1G91A 2B8GA 2A74C 1EY8A 2NVXB 3MWYW 1ESFA 1QNKA 2H4OA 1DOKA 2DNCA 4K6DA 1TS3A 3TSSA 2EYJA 3NUCA 2KEEA 3SEBA 1SYDA 2XN9C 2EJFC 3S2HB 3IFTA 1RDPD 3VR2A 4KI0A 2B2WC 4MIUA 3FPPA 3QOJA 3ZYYX 4RCOA 3J81L 3N52A 1XYIA 2F0PA 1WTQA 2L5TA 3GTGB 3I4MB 3S9WA 2XSCA 1WTWA 3HKZB 2BDNA 2EOTA 1SNPA 3C2PA 4ME5A 1WCMB 2K03A 1A2UA 2EJMA 1FGBD 2X6GA 5IGEA 2K01A 1CZWA 5JVH3 2PPBC 4F87A 2JEBI 1STGA 2FJ2A 2F0WA 4KKTA 4N9TA 1Y8NB 3L9AX 5ELBA 2M9VA 2QKIC 4DN4M 2E2HB 3I72A 4B9XA 4DAPA 2SNSA 1LT3D 5ISRA 4DK1A 2A6EC 2L55A 1U4LA 2F0KA 1B1ZA 2B2YA 3FRPB 4OGQC 3P7JA 4Q0FA 5M3MB 5KNBA 2F0GA 5DNFA 3OSOA 2L9HA 1PTOF 3FMCA 2FMCA 1J9OA 2AQ2B 1L0XB 3PUVA 3GP7A 1Y1VB 3P20A 3ND8A 1JB3A 4KMUC 5A2QL 3G7LA 1VDZA 4DNTB 5JEAG 2VUMB 3KLSA 4G7HC 1NR2A 4A3KB 4DAVA 1Q3LA 3D3RA 2RSNA 1L0YB 2GA4B 1JOKA 4WRDA 3U9SA 1EWHA 1PTOB 4CKBA 3P1HA 2PYKA 4ZK9B 1YNND 1KLUD 2KJXA 2JP1A 5CV4A 4IN3A 4I65A 2ICEC 3JAME 5F2DA 1QWYA 1EEID 3MTSA 1YNNC 1C8CA 1GUTA 4V190 5E1FA 1TWFB 2D62A 2B2YC 5FLXE 5EPKA 5FO8B 3BVZA 3BDOA 2NBFA 3T53B 2VNUD 2IJ0A 2JA7B 1GUNA 4G7ZC 3C1FA 4DAYA 2K5DA 1HUNA 1WVLA 3GTPB 5EKIA 4C3JB 4F7XA 5EKLA 2H1EA 3EROA 2F0JA 3NTIA 4A93B 3BYTB 1Y8OB 3NSWA 3QB3A 4L63B 1BNZA 3PUWA 1LTGD 4Y7NB 3PUZA 2O2LD 1NCVA 2QDBA 4OHJA 3JAML 4Q5VA 4R8NA 2WB1B 3LWUA 1GUSA 1SYGA 3CRKC 4I7ZC 5COYA 5EPLA 3W3AA 3CQZB 3BG3A 3A8KE 3HP3A 5C4JB 1WTOA 1EY5A 2V4DA 3VR5A 3ONAB 3A7AB 4C3HG 3PIO3 1KDBA 5FLXL 4BA1I 1TY2A 2Z8LA 4KKSA 2IL8A 2J4XA 3L3OC 1EY4A 4RGNA 1A15A 3G6JB 4H13C 5K36H 1MI2A 1H9SA 3CHBD 1HQRD 4C3IG 2OEOA 1YNJD 3MHBA 1SBBB 1A2TA 4LJZC 4CHTB 1XXGA 3TP6A 3W2DA 1V1OA 1JORA 1WTRA 1I4RA 5CBEE 1STHA 1JWSD 1A3VA 3K6OA 1HA5A 1E0BA 1TS2A 5TSSA 5D3DA 1YNJC 2KHSA 3IFDA 2EY6A 1BUVT 2RDGA 2K04A 1BCPB 2BOSA 2NTTA 3K57A 1AZPA 5IGGA 2OT2A 4IUVA 2Z4IA 1NUCA 4KV6A 1BXTA 3SK6A 4K8JA 4FXDA 2XWJB 2AUKA 2PW7A 3S1QB 3A8JE 3X3NA 1TKWB 2WACA 1I4XA 3SK5A 1MD2D 3LNNA 3E0JA 2K32A 1H9KA 1TR5A 2Y0SB 1WTVA 2PW5A 5JEAH 1TT2A 1PFBA 4TRDA 5C3XA 2HUGA 1I4QA 2F1MA 1EWCA 1AN8A 5ELFA 2HCIA 1B3AA 1FR3A 2AUJD 1LTBD 5BN5A 5KIXA 3D6CA 1C4QA 1RKNA 1PYWD 1STNA 3R2TA 5BN3A 2PO4A 4FNFA 3GTLB 4QUCA 2B2TA 4X3TA 3SHLA 1SNOA 1RD9D 3RZOB 3H09A 2QCPX 2WP8J 2BCOA 3SDZA 5D14A 1IKLA 3KUPA 1CFMA 1ZEQX 2KQ3A 3VR4A 3VYTA 3C46A 2NTSA 2R92B 2C9OA 1Z7TA 4KD3A 5EQ0A 2K33A 3BVMA 3PUYA 4J8QA 2A6HD 4XIGS 3MXUA 2Z4HA 4RGTA 2L0CA 4ABNA 3EFXD 1K8MA 3D4WA 3BZDB 5DM63 3Q23A 4ZRZA 1D5XC 2EYHA 4K5WA 3VR6A 1SDFA 2VB2X 1KNEA 3MZ5A 4KHZA 4G4KA 5CV7A 2LMCB 2A6HC 1D5ZC 3QOLA 3IL8A 4TKOB 5IT9E 2XRQD 5JAVA 5I2YA 4KN7C 4QCLA 2RDHA 2NN6G 1SNCA 1JR0D 1Q1EA 4CJ0B 1J8IA 1WTXA 2FHTA 4KJNA 3BDCA 3CKIB 1EYDA 1B2TA 3OOCA 1B9NA 3DEPA 2EXZA 2Z1CA 5I2XA 2JYOA 3QWNA 5C0XI 4ODGA 4ZKCB 1HFGA 1ZKOA 2KOLA 4XT3B 2JE6I 4RHSA 2XIWA 4PMCA 2MGSA 3NXWA 1JWUD 2X69A 1QG7A 5IT9L 5ELCA 2FMMA 2DNEA 3GTOB 2A68D 4RWSC 2NB0A 2QF7A 3J81E 4HMJA 4RFBA 1OXXK 2R93B 1AFPA 4HN7A 3A56A 2NZ1D 2WV6D 4C1NI 2A68C 1ENCA 1STBA 4ULLA 2PZUA 5CGKA 4J1MA 3OIPA 4HSVA 3Q6SA 4PMWA 1LO5D 4RH6A 3AMUA 4F8MA 3HG9A 5EBDA 4LMQD 1IW7D 4KKUA 4B08A 5CORA 2RQXA 4QUFA 4H0LC 5J1ZA 5KNDA 1PZKD 3H0GB 4K2LA 4ID6A 2K1BA 1QCBD 5M5YB 1IW7C 3M85A 1PZID 3GTMB 2CW0D 3HZXA 1Y1WB 1F2LA 3BDLA 2KVMA 2PQEA 5G3LD 2E75C 5A2QE 2CW0C 1WD0A 4UDUC 1LTSD 2Q8RE 2A6ED 3QIAA 3DWQA 2HCCA 2HQEA 2M00A 5JPNC 3DWPA 1OO9B 1CHPD 1X3QA 4IUQA 2MHVA 3NWSA 2ID0A 4ZLTF 1U4MA 5C4XB 1IYUA 1EY7A 1MBYA 1A3UA 4ZQ3A 5C4HA 1E2ZA 3V2TA 5FO9B 1EQTA 1SE2A 1SAPA 1SNDA 2IWHA 2E2JB 2F0LA 1FD7D 1AW7A 4X3KA 1UEAB 3GD7A 2BA1A 3A54A 2Q8IB 1EZ6A 4KD4A 1EYAA 1EY6A 2RDFA 3I4NB 4XQQA 2VB3X 1LT5D 1FNWA 2EYPA 1OXTA 2D5DA 3M4OB 3I3CA 1SXTA 3R93A 4MN3A 1SYFA 4EGVA 1S5BD 1IYVA 1HRJA 2IW3A 2ICIA 4XQNA 1LABA 1GUWA 1HFNA 1QJOA 2HDMA 4PQXA 3R8BA 5C5LA 5IGCA 1RTOA 4LAAA 1ILPA 2I46A 1B4OA 4E6IA 2NVQB 1SJHD 2EZVA 2EJGC 4HCEA 2EYLA 4OO1I 4AYBB 3C1EA 4K5VA 3TN2A 2F0NA 3DUZA 1X3PA 1HA6A 2ZXRA 2EY2A 3OWFA 2NN6I 2KCCA 2CHBD 2O5JC 5EBCA 4CBVA 1O80A 4A3JB 4A3MB 4OIJA 4FVMA 3MXNA 3KK7A 4S3SA 1F77A 3S1NB 2BA0A 2O5IC 4A3GB 4JK1C 2J0TD 1SJED 1BF4A 5IOCA 5LL6X 1IHZA 3S17B 5C0XG 3K5MA 3VA7A 3TDQA 1EQVA 4K2KA 4RGMA 5KGUA 2R3ZA 4YIJA 3TBIB 1NAPA 1H9SB 2EY5A 2L11A 4ZUIA 1Z6HA 1DM0B 2MJ8A 1TVXA 1OXSC 1HUMA 1CA6A 4WFN3 1ILQA 4HEDA 2F0OA 4A3BB 1DOLA 3TZDA 5D3IB 1TWGB 1CQVA 3T13A 2F0SA 1G2TA 2RA4A 1G6ZA 1EY9A 2B63B 1G2SA 1BCPF 1STYA 2LY7A 3A8IE 1D5MC 5DAUA 1SEBD 1VCIA 2ZXPA 3LWEA 4G7OC 1M8AA 4K5XA 1LTID 4CGYB 1ET6A 3FVQA 1QNUA 1D1KA 3RUZA 1UUPA 2KA7A 3NWTA 3MVVA 3AB9A 1D2BA 2AQ1B 1LT4D 5C4ZA 3KLSX 5J39A 4IFDG 4KY7A 1Y69U 1EEFD 2IX3A 2TMPA 3F2UA 3H94A 5ELEA 2I07B 3MFGA 3WDNA 3GQBA 2F0EA 4H44C 5I6WA 1CHQD 1CT1D 3QJYA 2NYZD 3NK9A 3RZDB 2WIIB 4DXFA 4HCSA 3DXJC 1U9RA 3MC0B 4B9WA 1IL8A 5KEEA 1K8OA 1FNVA 5AFWA 3SK4A 4DU9A 4A3IB 1TWCB 2HDLA 3I90A 5FOBB 4PMBA 1HHVA 1VMCA 2EY1A 2F0UA 4UAIA 4DK0A 4HSPA 3VA5A 4HTHA 1ML0D 3S2DB 1SE4A 2KCNA 3UI2A 1CI3M 2J7ZA 1RTNA 1A3TA 3ND9A 1Q8IA 3S16B 3HOXB 1KDAA 1S5DD 4BS9A 2D2CC 1TQOA 5JEAJ 4WORA 1R4PB 3MEHA 4DF7A 3NQTA 2A73B 2F0VA 2SEBD 3MFYA 4IALA 4FF4A 5C3EB 3N6RA 1KNAA 1TY0A 3GV3A 3KBGA 4FF1A 3QG1A 5JVG3 5ELDA 3NTKA 1SYCA 4BA2I 5FK9C 3BYYB 5T1GA 1KABA 2LKVA 3PV0A 2G9HD 3FDTA 1HTPA 2K5WA 3X3MA 5KNCA 4A3DB 1NR4A 4TSSA 1EYCA 1JQYD 1BQQT 4RCNA 5C0XH 1F9QA 4XYOA 2E76C 3IKJA 3T4AC 1Q90A 2RKSA 5A35A 5IODA 1ET9A 4O1NA 4FXKC 4O42A 1AZQA 3V05A 4OO1G 1OXVA 3J7AF 4C3HB 4R9WA 3VYSA 1EU4A 1STAA 5IGBA 3VYRA 2MP1A 3L7ZC 5C6AA 2KECA 4KK7A 1BR9A 4ZUJA 1EIGA 5I9OA 3HOWB 4M1UB 3Q22A 2Q8TA 4A3EB 3WOFA 1F2ZA 1JC7A 1QILA 2ENBA 3HEJA 2F0QA 2AWNA 3ERQA 5G3LF 3H91A 4XXEA 1KAAA 1H9RA 3SE0A 1RHPA 1BDOA 2F0HA 4QB4A 1DJRD 5D65A 1GXDC 1H9JA 2N88A 4JBWA 3HGBA 1QB5D 3C3LA 2R61A 3J7AV 2C5CA 2N55A 3H3VC 5CV5A 1JOOA 3V96A 1SMYD 3FEWX 4BWGB 1JE4A 3P75A 2NVTB 4FXGC 4RGOS 5EGTA 4CKCA 2XWBB 3NPPA 2E2IB 5IGDA 5FKAC 2SNMA 1B50A 1SMYC 2WKCA 5T1IA 1PFMA 5I9PA 1I6HB 4V0BA 3DMUA 2DY7A 1TIID 3K7AB 1NSNS 2OXPA 1DOMA 1EFID 1CZGA 1GUOA 1RODA 4C3JG 3HS0C 2K28A 3NBIA 5E4XA 1SFOB 3PMFA 2F3VA 4QIWB 3NE5B 3TMEA 1PRTD 1AP0A 3T16A 2BDOA 2XNAC 4KTAA 2EE1A 1S4ZA 2PCFB 4MHEA 1EY0A 1B53A 3PO2B 2AQ3B 1JICA 4IFDI 2B2UA 1O7ZA 2EDGA 3RMHA 1MSGA 1FYCA 2RSOA 2K05A 1PMRA 1PRTC 4C2MB 1BOSA 4X3UA 4M8AA 3MXGA 4N9PA 1EU3A 1TU2B 2EYFA 1I4HA 4GZYC 5M3FB 2IX0A 2F0MA 1HTLD 3LX0A 1W6JA 3KBXA 3RLFA 3TZUA 5LHY1 4KY5A 1PZJD 1Q1BA 4P2CB 3M3YB 3K0YA 3U9OA 1I4GA 3EJIA 4R8IA 5K36G 5J22A 3EA6A 3S1MB 1LTTD 3T51B 2JA8B 2B2VC 3GV6A 3EQLC 4PV1C 2PMZB 1S5FD 3KLRA 3OMGA 1HXYD 2F0DA 1GUGA 2K7VA 3HOYB 1K83B 1F9SA 1KDCA 1F9RA 1EL0A 4FP5D 1HCZA 4LK1C 5CV6A 4OO1H 1BBXC 3TP8A 3MAQA 1SE3A 4RAUC 1ICWA 3D6WA 1EZ8A 4IUUA 2B2UC 1CM9A 5C5MA 3D4RA 2IX1A 2NN6H 1V43A 4CJ1B 5NUCA 1TS5A 2D9UA 4K14A 1A6XA 4K8IA 4XQJA 1ONLA 4IUNA 1F2MA 1O78A 4A3FB 1WTPA 3NTHA 3M4YA 3MA2B 1DONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HQE A;  2M00 A;  1NUC A;  4QB4 A;  2F0H A;  2RBM A;  1TQO A;  4KV6 A;  3TP7 A;  3D4W A;  4DGZ A;  4EQP A;  3SK6 A;  5CC4 A;  4RKB A;  4WOR A;  3MEH A;  4K8J A;  4N9P A;  2PZW A;  4K5W A;  2EYH A;  3QB3 A;  2EYF A;  2F0G A;  3RUZ A;  4EVO A;  3ERO A;  4NMZ A;  3D4D A;  3MZ5 A;  4DF7 A;  1EY8 A;  3NQT A;  3OSO A;  3SXH A;  4IZ8 A;  2EY2 A;  3OWF A;  3MVV A;  1EY7 A;  2PW7 A;  2F0M A;  1A3U A;  4HMJ A;  2F0V A;  4NP5 A;  4ZQ3 A;  5C4H A;  4IAL A;  5KYI A;  3V2T A;  3LX0 A;  4KHV A;  2EYO A;  3H6M A;  2QDB A;  3E5S A;  5EKK A;  4J6H A;  3EVQ A;  4K6D A;  5IGF A;  5K5P A;  4NKL A;  5C4Z A;  4R8N A;  2F3W A;  4KY5 A;  5CV5 A;  1JOO A;  5J39 A;  2O4X A;  1SYG A;  3U9O A;  1SND A;  2EYJ A;  3NUC A;  3QOL A;  4KY7 A;  1ENC A;  4S3S A;  3SK8 A;  5C3W A;  2WAC A;  1SYC A;  3EJI A;  1SYD A;  4QF4 A;  5J22 A;  1STB A;  4EQN A;  2F0L A;  1KAB A;  2LKV A;  1EY5 A;  3P75 A;  2PZU A;  3R3O A;  4QMG A;  3SK5 A;  5EGT A;  1SYB A;  4MIU A;  5DEH A;  5CGK A;  5IOC A;  1KDB A;  1TR5 A;  5CV8 A;  2F0E A;  1IHZ A;  4J1M A;  5JAV A;  5I6W A;  1EZ6 A;  2PW5 A;  3QOJ A;  1EYC A;  1TT2 A;  5IGD A;  3OMG A;  4KD4 A;  5C3X A;  4EQO A;  2PZT A;  5IIF A;  2F0D A;  1EYA A;  1EY6 A;  1EQV A;  1JOK A;  2RDF A;  2SNM A;  4K2K A;  4TRD A;  4WRD A;  5HGT A;  2RKS A;  3P1H A;  1SNC A;  2PYK A;  5KGU A;  4F8M A;  2F0P A;  5IOD A;  1EY4 A;  3NK9 A;  3NHH A;  1KDC A;  4YIJ A;  4H7B A;  5I9P A;  1JOR A;  3S9W A;  5CV4 A;  1U9R A;  3DHQ A;  2F0F A;  1JOQ A;  2EYP A;  4B9W A;  3NP8 A;  3DMU A;  1II3 A;  4KJN A;  2F0I A;  4I65 A;  5CV6 A;  3BDC A;  5KEE A;  3SK4 A;  2EY5 A;  4DU9 A;  1SNM A;  4HMI A;  1F2Y A;  4KY6 A;  3TP8 A;  1EYD A;  4KJO A;  1SNP A;  5KIX A;  3D6C A;  5F2D A;  1RKN A;  1STA A;  1NSN S;  2OXP A;  4ZUI A;  3D8G A;  5IGB A;  2EYM A;  1SYF A;  4ME5 A;  4PMB A;  5J1Z A;  1STN A;  5C6A A;  1SNQ A;  2OEO A;  1EZ8 A;  4PNY A;  2EY1 A;  1AEX A;  5CR3 A;  4K2L A;  2EXZ A;  1A2U A;  4G57 A;  3MHB A;  2F0O A;  4ID6 A;  2F0U A;  5KYL A;  1A2T A;  5E1F A;  5IGE A;  5C5M A;  3SHL A;  5HUR A;  3TP6 A;  1SNO A;  5JOB A;  4ZUJ A;  5CV9 A;  3VA5 A;  1STG A;  3PMF A;  2F3V A;  1ENA A;  2OF1 A;  3SR1 A;  2F0W A;  3MXP A;  5I9O A;  4HTH A;  5KRU A;  3T13 A;  4N9T A;  3TME A;  3HZX A;  2F0S A;  5C5L A;  5IGC A;  1STH A;  3T16 A;  1SYE A;  1A3V A;  4ODG A;  5NUC A;  1EY9 A;  4KTA A;  1F2Z A;  4LAA A;  2KQ3 A;  3BDL A;  5E3F A;  3C1F A;  4K14 A;  1EY0 A;  1A3T A;  1STY A;  4K8I A;  4B9X A;  4RKL A;  3TP5 A;  4E6I A;  2KHS A;  2ENB A;  3HEJ A;  2F0Q A;  2SOB A;  2SNS A;  5ISR A;  5CV7 A;  2EY6 A;  4PMC A;  2PQE A;  4F7X A;  3NXW A;  4OL7 A;  2NUC A;  1F2M A;  1KDA A;  3ERQ A;  2EYL A;  4IUN A;  4KD3 A;  5DAU A;  5EKL A;  5M9O A;  3C1E A;  4K5V A;  5IGG A;  1KAA A;  2F0T A;  3ITP A;  3OMC A;  2F0K A;  4DFA A;  4NDX A;  5I6Y A;  2F0N A;  4K5X A;  2F0J A; 
#chains in the Genus database with same CATH topology
 1IXR A;  3I70 A;  1QUQ A;  2B3G A;  1Y1V H;  1K0S A;  1X55 A;  3OPO A;  5CC4 A;  1IL2 A;  3BVG A;  2PZW A;  3OHX C;  1PFS A;  4JCV E;  3D4D A;  2X6L A;  3M4O H;  5KYI A;  2E5L L;  1K9M C;  1U0L A;  4P72 A;  3SVM A;  4A75 A;  3J80 E;  3I4L A;  4J6H A;  3EVQ A;  1E24 A;  1Y8P B;  1Z47 A;  4ILW A;  3KF8 A;  4A3K H;  4L5S A;  4IQZ A;  4ZAI A;  3SK8 A;  5C3W A;  3DLL A;  4XTC S;  3NQI A;  2JA6 B;  2ZTC A;  1PTO H;  1GHK A;  4ZKB B;  4QMG A;  3K5N A;  5JJI A;  1VQA A;  2F4I A;  1UNS A;  4HR7 B;  5IP9 H;  4UP8 A;  2DN8 A;  1N34 Q;  4O2D A;  2OCE A;  4LUV A;  1SR3 A;  1E2W A;  2A8V A;  3I8Z A;  2JA5 B;  3PUX A;  2PZT A;  4LF4 L;  1O7L A;  3DEO A;  5HGT A;  3S1R B;  4JYA Q;  2UUC L;  3A74 A;  3DM1 A;  3KDF B;  3HOU B;  3NHH A;  3Q24 A;  2MO1 A;  2N49 A;  3DHQ A;  2DY8 A;  2KEN A;  3NP8 A;  1YHB A;  3D0F A;  1MSH A;  2LFN A;  4L6T B;  1KIX A;  5FJ8 G;  2PNR C;  1SNM A;  2JEA I;  1S5C D;  2ZT9 C;  2ZTD A;  4JI5 L;  1WI5 A;  4HIK A;  1U4R A;  3AU7 A;  1YHQ A;  2JQO A;  2JA7 H;  1WYD A;  5CR3 A;  2YYZ A;  2WKD A;  2YV5 A;  5KYL A;  2NZH A;  5C3E G;  2IHE A;  5EJW A;  3HOZ B;  4C3J H;  1R9T B;  5JOB A;  3CU7 A;  5GAH C;  2BE5 D;  1VQM A;  4B3S Q;  5CV9 A;  2B39 A;  1XTC D;  2OF1 A;  1ENA A;  3SR1 A;  2L1B A;  4JBM A;  4A3M H;  3K80 C;  3J80 L;  4IUT A;  3A55 A;  1T5X D;  4A93 H;  3S1N H;  1TWA B;  2GVB A;  3WOE A;  3STB D;  1B9M A;  2SOB A;  1ESR A;  3T56 B;  1STE A;  4JI6 Q;  3D31 A;  3J81 c;  1K73 C;  1DZ1 A;  2BE5 C;  2QDL A;  4MTK A;  3FPU B;  4Y7N H;  3F2D A;  4FF2 A;  1YI2 A;  3AFP A;  1DD2 A;  2UUB L;  4CKE A;  4DNI A;  4A3L H;  4DGZ A;  2FIN B;  4AYB E;  4DNR B;  3STB C;  4YCU A;  4FO2 A;  3HRZ C;  1I4P A;  3CQZ H;  1D8L A;  1YBY A;  3M4P A;  1I94 L;  1PTO D;  3SXH A;  2EQS A;  2K5H A;  1FGU A;  2TSS A;  1XX8 A;  1O7Y A;  1SSO A;  5K5P A;  5C44 B;  4NKL A;  3I91 A;  3RR5 A;  4DV5 Q;  3AYH B;  1GJX A;  2O4X A;  2XRS D;  3K5O A;  1JCK B;  2PI2 E;  4DR1 Q;  1EIH A;  2M2L A;  1LTA D;  1PTO C;  3NBH A;  4KHP Q;  1V1P B;  4A3E G;  5DEH A;  5CV8 A;  2IPK D;  5JJZ A;  4WJ3 M;  5M5W B;  3L0O A;  1VF5 C;  5DM7 3;  5IIF A;  2CQA A;  4LF5 Q;  1VQO A;  3KF6 B;  4DR5 L;  3CF5 A;  2K6A A;  4BXX H;  2KHJ A;  2F0F A;  2QEJ C;  1II3 A;  1MGS A;  1MIU A;  2E2D C;  3E6Z X;  3Q0A A;  4KN4 C;  3OW7 A;  2KED A;  2MUY A;  4OIK A;  1F2Y A;  2SDF A;  4XT1 B;  3I73 A;  1B70 B;  5LMN W;  1HZA A;  2EYM A;  1VQI A;  1V1P A;  4PNY A;  4G57 A;  3U50 C;  4B3M Q;  4B3S L;  3S14 B;  1G8Z D;  2CKZ B;  1PA6 A;  2WAQ B;  2HD3 A;  2I5M X;  1DXM A;  1P16 A;  5KRU A;  4CJ2 C;  2CVR A;  4HAE A;  4JV5 Q;  1B44 D;  4CDC C;  1M4V A;  1FNU A;  1HZ9 A;  2VW9 A;  1EQR A;  3M7N A;  4JI6 L;  3M7G A;  1HPC A;  1PXU A;  1NMF A;  4OL7 A;  1R4Q B;  5M5X B;  1LT6 D;  4BY1 B;  2R93 G;  4OWT B;  1C48 A;  4R4T A;  1YIT A;  3S15 B;  4DFA A;  5IYD G;  3S1Q H;  4NDX A;  4Y52 H;  4UP7 A;  1T5E A;  1XNQ Q;  1PH4 A;  4JI4 L;  3PIP 3;  4NW2 A;  2ZM6 L;  3DWA A;  4DA2 A;  1PFN A;  1PH3 A;  1XPU A;  4U67 3;  1ZYR D;  1D6E C;  5BN4 A;  3RZD H;  2JSO A;  3IAY A;  1LAC A;  2A5H A;  4NMZ A;  1IBM Q;  5IGF A;  1TWC H;  3EIV A;  1E2V A;  4R4I A;  2EYO A;  5GQO A;  3O13 A;  1V8Q A;  4RA8 A;  1W6K A;  1XMQ Q;  1X6O A;  2JA9 A;  2K5Q A;  3HOV B;  1ZYR C;  1H9M A;  2LS0 1;  1HJP A;  1LLR D;  4QF4 A;  2N3S A;  1I3Q B;  1HQM C;  1LV9 A;  3K59 A;  2R7D A;  1I6V C;  4IUP A;  2G9D A;  3EN2 A;  1HR0 Q;  3J7Y W;  3VYU A;  4IJL A;  4NB3 A;  4LF5 L;  3FP9 A;  3PO2 G;  3GTJ B;  1G51 A;  4EQO A;  2YU9 B;  1QE6 A;  3UDI A;  1WTH A;  3S16 H;  1CQF A;  3H3V H;  3KLW A;  5JPM C;  4DXG A;  3A0J A;  1EOT A;  3GTL H;  2KUM A;  4H7B A;  2QGQ A;  1F9P A;  4JI8 L;  1JOQ A;  3BS1 A;  2UUA Q;  3PF4 A;  4IUR A;  1BCP D;  3RZO H;  3RN2 A;  4DV4 Q;  5GRO A;  5FJ8 H;  4HMI A;  4KY6 A;  2WIN B;  1Q46 A;  4KJO A;  1EYG A;  3GTQ B;  3OTO L;  2PQA A;  4C1N K;  4B3M L;  5M3F G;  3JAM c;  1AEX A;  1DCZ A;  1Q8K A;  5LMU Q;  3VR3 A;  4XYQ A;  1OXU A;  1BO0 A;  1YJW A;  3UE1 A;  2A69 D;  1BCP C;  1GHJ A;  3MXP A;  1RF2 D;  1VQP A;  4K6L A;  1PLF A;  1WD1 A;  1PRT F;  1TWH B;  1SYE A;  2YTV A;  4WJW A;  1KLG D;  5FLX c;  1UE1 A;  1G29 1;  4U68 A;  1YJ9 A;  2B8F A;  2EVB A;  2NWG A;  4TQU S;  3TP5 A;  3T1H Q;  3FKI B;  4LFA Q;  1UAP A;  4L5T A;  4QGU A;  1PDQ A;  2ZXO A;  1K8A C;  3GO5 A;  4BY7 B;  2A69 C;  3URY A;  2F0T A;  2RVL A;  2VL6 A;  3ITP A;  3OMC A;  1CA5 A;  2Z9H A;  2R7Z B;  3HOY G;  4Z9C B;  2AWO A;  4JBJ A;  1IBL L;  1VMP A;  1JT8 A;  2KCM A;  4EQP A;  1ZXT A;  1LTR D;  2MPM A;  1YEZ A;  5I4D A;  4BBS B;  5C0X J;  1L1O B;  3CRL C;  3RD4 A;  5FO7 B;  1SN8 A;  1C0A A;  4C3I B;  4IZ8 A;  2JXM B;  4NP5 A;  1PRT B;  2R7F A;  1XMQ L;  4KHV A;  3H6M A;  2UU9 Q;  3E5S A;  5EKK A;  2B2T C;  2L12 A;  1RJT A;  2VXW A;  2F3W A;  3AEV A;  1OTC A;  1IBK Q;  1ENF A;  4AQY L;  5IE8 A;  3I4N G;  3GTK B;  4L5Q A;  1HZB A;  4EQN A;  1X56 A;  3R3O A;  3OIQ A;  1HR0 L;  4RHR A;  3OWE B;  3QO2 A;  1SYB A;  4L8J A;  1TS4 A;  4A3E H;  2XTI A;  4C56 C;  3A7L A;  5CMD A;  1K0R A;  3CCQ A;  2VQF Q;  2F03 A;  4A3F G;  3BJU A;  1XWE A;  5E4W C;  1S5E D;  1CK1 A;  1CTM A;  1VF7 A;  2XVS A;  2HT1 A;  2EPB A;  3CCV A;  4IFD H;  2P5Z X;  4DV4 L;  1QOH A;  2F0I A;  3M9B A;  2B2W A;  2NVY B;  1I50 B;  1JWM D;  5GAD C;  1U4P A;  3ULJ A;  2R6G A;  1Q12 A;  3D8G A;  1X32 A;  1D1I A;  3R2I A;  1SNQ A;  4ZYS A;  1KD1 C;  1RCV D;  4BBR B;  5CYU A;  1DYQ A;  2B29 A;  4X3S A;  5HUR A;  4JI7 Q;  4XDX A;  5EPJ A;  3RNU A;  5CBA E;  4DR7 L;  4GNX A;  2JA6 G;  1B8A A;  4FYD A;  2B2V A;  1KTK A;  5E3F A;  5M9O A;  5LL6 S;  2IT1 A;  4RKL A;  3GTO H;  1A0I A;  1U5K A;  2N78 A;  4UHV A;  4IFD J;  4YCW A;  1NE3 A;  2NUC A;  1W3S A;  3PO3 B;  2E2I H;  2L15 A;  2L4N A;  2OQK A;  2JA5 G;  4JPB W;  4RG1 A;  3FHW A;  2R93 H;  5I6Y A;  4FF3 A;  3K58 A;  4F88 A;  2FFK B;  4MTN A;  5IYD H;  4A3J G;  2RBM A;  3TP7 A;  4X64 L;  3K5L A;  3HOU G;  4NPS A;  2QIL A;  4RKB A;  1NJI C;  4JI2 Q;  1GOZ A;  1IKM A;  4EVO A;  1Y14 B;  2E74 C;  1G91 A;  2B8G A;  2A74 C;  1K8G A;  1EY8 A;  4K0K L;  1LTL A;  2NVX B;  3MWY W;  5DLQ E;  4JW0 A;  1ESF A;  1QNK A;  2H4O A;  1W2B A;  1DOK A;  4DR3 L;  4JI0 Q;  2DNC A;  5ELN A;  4K6D A;  4X65 Q;  1TS3 A;  4P71 A;  3RLN A;  3TSS A;  3HOZ G;  2EYJ A;  3NUC A;  2KEE A;  1PH5 A;  4DV2 L;  3SEB A;  1SYD A;  2N8N A;  2XN9 C;  2EJF C;  3S2H B;  3IFT A;  2EIF A;  1KHI A;  3BZC A;  4ALP A;  1RDP D;  3VR2 A;  3K81 C;  4KI0 A;  2B2W C;  4MIU A;  3FPP A;  1E7Z A;  2VQF L;  3QOJ A;  3ZYY X;  4GOP B;  4RCO A;  2HIV A;  3LGJ A;  3J81 L;  3H0G H;  1CSP A;  3N52 A;  1XYI A;  2F0P A;  1WTQ A;  2L5T A;  3GTG B;  3I4M B;  3S9W A;  5M5Y H;  4A3B G;  1E1O A;  4NXM Q;  3GTM H;  2XSC A;  1WTW A;  4FDB A;  3HKZ B;  2YTX A;  2BDN A;  2EOT A;  1SNP A;  4AH6 A;  3C2P A;  2F52 A;  1Y1W H;  4ME5 A;  1WCM B;  2NZO A;  4R4C A;  2K03 A;  1A2U A;  2EJM A;  1FGB D;  4JI7 L;  2X6G A;  5IGE A;  2I5H A;  2K01 A;  1CZW A;  5JVH 3;  2MQH A;  4P75 A;  4LF4 Q;  2PPB C;  5C44 G;  4F87 A;  2JEB I;  1STG A;  2FJ2 A;  2F0W A;  4KKT A;  4N9T A;  5AJ3 L;  1Y8N B;  3L9A X;  5ELB A;  2M9V A;  2G5D A;  2QKI C;  4DN4 M;  4DV7 Q;  2E2H B;  3S1M H;  3I72 A;  4B9X A;  4QIW E;  4DAP A;  2SNS A;  1LT3 D;  5ISR A;  4DK1 A;  2A6E C;  4JI5 Q;  2L55 A;  5C4X H;  1U4L A;  1NNX A;  1PH8 A;  1PH9 A;  1QUQ B;  2F0K A;  1B1Z A;  2B2Y A;  2KHI A;  4A76 A;  3HOY H;  3FRP B;  4OGQ C;  1XJV A;  1K83 H;  4GN5 A;  1PYB A;  1YIJ A;  3P7J A;  4Q0F A;  5M3M B;  5KNB A;  3TRZ A;  2F0G A;  1NTG A;  5DNF A;  2LXK A;  3OSO A;  2E2J H;  2VY3 A;  2L9H A;  1PTO F;  3FMC A;  4B3T L;  3KF8 B;  4JI0 L;  5L37 A;  2FMC A;  1J9O A;  2AQ2 B;  1L0X B;  3PUV A;  3GP7 A;  1Y1V B;  5IWA Q;  3P20 A;  3ND8 A;  1JB3 A;  1N8R C;  1VQE A;  2WAQ G;  4KMU C;  3I4N H;  1AH9 A;  5A2Q L;  3G7L A;  2UUB Q;  1QVF A;  1VDZ A;  4DNT B;  4A3I G;  5JEA G;  2VUM B;  2OTL A;  1I5F A;  3KLS A;  4G7H C;  1PH7 A;  1CKO A;  1NR2 A;  4DR2 L;  4A3K B;  5IT9 c;  1I94 Q;  4DAV A;  1Q3L A;  3D3R A;  2RSN A;  3CPF A;  1L0Y B;  2GA4 B;  1JOK A;  4WRD A;  3U9S A;  1EWH A;  1PTO B;  4CKB A;  2PMZ E;  3P1H A;  2PYK A;  1YNN D;  1KLU D;  2KJX A;  4ZK9 B;  2JP1 A;  4NXM L;  5CV4 A;  4IN3 A;  1V1Q A;  4DK6 C;  4I65 A;  1KAW A;  2ICE C;  3PCO B;  3JAM E;  3T1Y L;  3S24 A;  1QZG A;  5F2D A;  1QWY A;  1EEI D;  3MTS A;  1GM5 A;  2K14 A;  1YNN C;  3A5Z B;  1C8C A;  2NVQ H;  1GUT A;  4V19 0;  5E1F A;  3I4O A;  3HOX G;  4LW1 A;  1TWF B;  1NBW A;  3UDX A;  2D62 A;  2B2Y C;  5FLX E;  5EPK A;  5FO8 B;  3BVZ A;  3BDO A;  2NBF A;  3T53 B;  3HOV G;  2VNU D;  4DR5 Q;  4DV7 L;  2IJ0 A;  2JA6 H;  3VDY A;  2JA7 B;  1GUN A;  4G7Z C;  3C1F A;  4DAY A;  2K5D A;  1HUN A;  1YZ6 A;  2OQ0 A;  1WVL A;  3E0E A;  3W5O A;  3GTP B;  5EKI A;  4C3J B;  4F7X A;  5EKL A;  2JA5 H;  2H1E A;  2DJF C;  3ERO A;  2F0J A;  3S1R H;  3NTI A;  4A93 B;  3BYT B;  4A3J H;  3NEN A;  1Y8O B;  3NSW A;  3QB3 A;  4L63 B;  4LNQ A;  1BNZ A;  3PUW A;  1XTD A;  1LTG D;  4Y7N B;  4A3G H;  3PUZ A;  2O2L D;  1NCV A;  3J80 i;  5IWA L;  2QDB A;  4A3D G;  4OHJ A;  2UXB Q;  3JAM L;  2PI2 A;  4Q5V A;  4R8N A;  3S17 H;  2WB1 B;  3LWU A;  4LUO A;  1GUS A;  1SYG A;  3CRK C;  3NBH B;  4I7Z C;  5COY A;  5EPL A;  3W3A A;  3PF5 A;  3CQZ B;  1R9T H;  3HP3 A;  3BG3 A;  3A8K E;  5C4J B;  2VZA A;  1WTO A;  4JI4 Q;  1EY5 A;  4HJ7 A;  1FJG L;  3CCJ A;  2V4D A;  2ZM6 Q;  3VR5 A;  3ONA B;  3I2Z A;  3A7A B;  4OEL B;  4C3H G;  4PG3 A;  1KDB A;  5FLX L;  3PIO 3;  4BA1 I;  1N33 L;  3ULL A;  1TY2 A;  2Z8L A;  1YVC A;  4KKS A;  1S40 A;  2IL8 A;  2J4X A;  3L3O C;  1EY4 A;  4RGN A;  3J81 j;  2R7Z G;  1A8V A;  1A15 A;  3G6J B;  4H13 C;  3PSI A;  4A3B H;  5K36 H;  3HOW G;  1MI2 A;  1TWG H;  4BBS G;  2IY5 B;  1H9S A;  3CHB D;  1E3P A;  5E7N A;  1IZ6 A;  1HQR D;  4C3I G;  2B63 H;  2Z6B A;  2OEO A;  1YNJ D;  3MHB A;  1SBB B;  1A2T A;  4LJZ C;  4CHT B;  1EUJ A;  1XXG A;  3TP6 A;  3W2D A;  1XMO Q;  1V1O A;  1JOR A;  5C44 H;  1WTR A;  1I4R A;  5CBE E;  1STH A;  1JWS D;  1A3V A;  3K6O A;  1HA5 A;  1E0B A;  4JI8 Q;  1TS2 A;  5TSS A;  5D3D A;  1YNJ C;  1CKN A;  2KHS A;  5HGQ A;  1HR0 W;  3IFD A;  2EY6 A;  1BUV T;  2RDG A;  2K04 A;  1K3B C;  1BCP B;  2BOS A;  2NTT A;  4YWL A;  1JJ2 A;  3OTO Q;  2CWP A;  3K57 A;  1AZP A;  5IGG A;  5M5W H;  2K5N A;  2OT2 A;  4IUV A;  2UXD Q;  2Z4I A;  4JI3 Q;  1XNR Q;  2CFM A;  1NUC A;  2QEX A;  4KV6 A;  3TS0 A;  2JK8 A;  1BXT A;  3SK6 A;  4K8J A;  4FXD A;  2XWJ B;  2AUK A;  2PW7 A;  1MJC A;  2UXB L;  3S1Q B;  1VQC A;  3A8J E;  4UP9 A;  3X3N A;  1TKW B;  1WFQ A;  2WAC A;  1I4X A;  4YWK A;  3SK5 A;  1MD2 D;  3LNN A;  1IBL Q;  3E0J A;  2K32 A;  3SGI A;  3CC7 A;  5JJK A;  1H9K A;  1TR5 A;  2Y0S B;  1WTV A;  2PW5 A;  4A3I H;  5JEA H;  3HFZ B;  1TT2 A;  1PFB A;  4TRD A;  5C3X A;  2HUG A;  4CDD C;  3PO3 G;  1I4Q A;  2F1M A;  1EWC A;  3TQY A;  4JVZ A;  1JE5 A;  1AN8 A;  5ELF A;  1Q86 C;  2HCI A;  1VQJ A;  1B3A A;  1FR3 A;  2XGT A;  4AQY Q;  2AUJ D;  2KCT A;  2PQA B;  3UE0 A;  1LTB D;  5BN5 A;  3S2D H;  5KIX A;  3D6C A;  1VQ5 A;  1C4Q A;  1RKN A;  1PYW D;  4OEM B;  4LWC A;  1STN A;  3R2T A;  5BN3 A;  2PO4 A;  4FNF A;  3GTL B;  4QUC A;  2B2T A;  1ASZ A;  4KLK A;  1VQN A;  4X3T A;  1XMO L;  2K50 A;  2K5V A;  3SHL A;  1SNO A;  3HOX H;  1NMG A;  1RD9 D;  1TXY A;  5JJL A;  2YTY A;  3RZO B;  3H09 A;  2QCP X;  1T9H A;  2WP8 J;  2BCO A;  1ASY A;  2JJQ A;  3SDZ A;  5D14 A;  1CUK A;  1IKL A;  3KUP A;  2WAQ E;  3K0X A;  1CFM A;  1ZEQ X;  2KQ3 A;  4X66 L;  3VR4 A;  1VQK A;  2DGY A;  3VYT A;  4X62 L;  1S72 A;  3W1G A;  1VQD A;  4DV3 Q;  3C46 A;  2NTS A;  2R92 B;  5J3B A;  2C9O A;  1Z7T A;  3PUY A;  2K33 A;  3BVM A;  4KD3 A;  5EQ0 A;  4J8Q A;  2A6H D;  4XIG S;  4JI3 L;  3MXU A;  1XNR L;  4R4O A;  2UXD L;  5C3E H;  2Z4H A;  4RGT A;  3CCU A;  2L0C A;  4ABN A;  3EFX D;  2BH2 A;  1K8M A;  3D4W A;  4A4I A;  1A63 A;  1A62 A;  3BZD B;  5DM6 3;  3Q23 A;  4ZRZ A;  4DR7 Q;  1D5X C;  2EYH A;  4K5W A;  3VR6 A;  1SDF A;  3A5U A;  1EWI A;  1O7I A;  1KNE A;  2VB2 X;  4DR4 Q;  3MZ5 A;  3HKZ G;  4R4Q A;  4KHZ A;  4G4K A;  2JA8 G;  5CV7 A;  2LMC B;  2A6H C;  1L2F A;  1D5Z C;  1CKM A;  1WCM G;  2KBN A;  4A3D H;  1Z9F A;  3QOL A;  4LF9 L;  4AIM A;  4GS3 A;  2FXQ A;  3KJP A;  2Q2T A;  3IL8 A;  1HZC A;  4TKO B;  4PZ8 A;  4YY3 L;  1QZH A;  4X64 Q;  5IT9 E;  1UE6 A;  2XRQ D;  4C3H H;  5JAV A;  3DM3 A;  3IRB A;  5I2Y A;  4K0K Q;  4KN7 C;  1JB7 A;  4QCL A;  3KJO A;  2RDH A;  4OX9 Q;  2NN6 G;  4UY8 C;  1SNC A;  4EX5 A;  1JR0 D;  1Q1E A;  4DR3 Q;  4CJ0 B;  1J8I A;  3JC6 6;  4GKJ L;  1WTX A;  3ICE A;  2FHT A;  4KJN A;  4DK3 C;  3BDC A;  1PH6 A;  4GN4 B;  4DV2 Q;  3CKI B;  3BZK A;  3HOW H;  5M3M G;  1EYD A;  4CDE C;  1B2T A;  2OTJ A;  3OOC A;  1B9N A;  1BKB A;  3DEP A;  2EXZ A;  4JOI C;  2Z1C A;  5I2X A;  2JYO A;  4GNX B;  3QWN A;  3AQQ A;  4CDF C;  5LMN L;  5IY0 A;  1EOV A;  4I7A A;  5C0X I;  4ODG A;  1HNX L;  5IP7 G;  4ZKC B;  4DR6 Q;  3CME A;  4DV3 L;  1HFG A;  1ZKO A;  2KOL A;  3ER0 A;  4XT3 B;  2JE6 I;  4RHS A;  2XIW A;  1SE8 A;  4PMC A;  2MGS A;  2VUM G;  3NXW A;  1JWU D;  1VQG A;  2X69 A;  3F2B A;  1QG7 A;  5IT9 L;  1EFW A;  4MZ9 A;  2UXC L;  1KC8 C;  5ELC A;  2FMM A;  1FL0 A;  1X54 A;  2DNE A;  3GTO B;  2A68 D;  4RWS C;  4DR4 L;  4WJ4 A;  2NB0 A;  5AJ3 Q;  1LYL A;  3RLO A;  1MJE A;  2QF7 A;  3J81 E;  2NVT H;  4HMJ A;  4RFB A;  1OXX K;  4DAM A;  3U58 A;  2R93 B;  1MHW C;  1AFP A;  4HN7 A;  3A56 A;  2HIX A;  2NZ1 D;  2WV6 D;  3I56 A;  2Q2I A;  4C1N I;  2A68 C;  1ENC A;  1YNX A;  1STB A;  4ULL A;  1Q81 C;  2PZU A;  4TVA B;  2Q2H A;  1I6H H;  4N8F A;  5CGK A;  3CCL A;  4IPD A;  2JA7 G;  1PYS B;  4J1M A;  2HQL A;  3OIP A;  3K7A H;  4HSV A;  4OX9 L;  1E1T A;  3Q6S A;  1X9N A;  3M4Q A;  4PMW A;  4B3T Q;  1LO5 D;  4RH6 A;  3AMU A;  4F8M A;  3HG9 A;  5EBD A;  4LMQ D;  1IW7 D;  4KKU A;  4ZCK A;  4B08 A;  3PQI A;  2MFI A;  2E8G A;  5COR A;  1SFO H;  2RQX A;  4NXN L;  2ZJP A;  3CC2 A;  4QUF A;  4H0L C;  1B3Q A;  1L1O C;  5J1Z A;  5KND A;  2VS1 A;  1PZK D;  1VQ9 A;  3H0G B;  4J15 A;  4K2L A;  4ID6 A;  2K1B A;  3PO2 H;  1QCB D;  5M5Y B;  4DR2 Q;  1IW7 C;  4DUY Q;  3M85 A;  1PZI D;  3GTM B;  1SRU A;  3G4S A;  4HIM A;  2WB1 G;  2CW0 D;  1SRO A;  3HKS A;  3HZX A;  4DR6 L;  1Y1W B;  4C2M H;  1F2L A;  1BVS A;  3J81 i;  3BDL A;  1J6Q A;  1PV4 A;  2KVM A;  4HJ9 A;  3T1Y Q;  2PQE A;  5G3L D;  1JJG A;  5M3F H;  2E75 C;  5A2Q E;  2CW0 C;  1WD0 A;  4UDU C;  1LTS D;  2Q8R E;  2RHS B;  2A6E D;  3QIA A;  3DWQ A;  4IOA A;  2HCC A;  2HQE A;  2M00 A;  5JPN C;  3DWP A;  2AMC B;  1OO9 B;  1CHP D;  1X3Q A;  3M3Y H;  1HNW L;  4IUQ A;  1PVO A;  2MHV A;  3NWS A;  4EQ5 A;  4HJ5 A;  2ID0 A;  5BR8 L;  4ZLT F;  1U4M A;  5C4X B;  1IYU A;  1EY7 A;  1MBY A;  1A3U A;  2Z6K A;  4ZQ3 A;  2JA8 H;  5C4H A;  4DPG A;  1E2Z A;  3V2T A;  5FO9 B;  1WCM H;  1HNZ L;  5IYB G;  1EQT A;  4BXX G;  1SE2 A;  4IO9 A;  1SAP A;  1SND A;  2HHH Q;  2IWH A;  2CQO A;  2E2J B;  2F0L A;  1FD7 D;  1AW7 A;  4X3K A;  1UEA B;  1JJC B;  3GD7 A;  3CW2 C;  4HID A;  1K28 A;  2BA1 A;  3A54 A;  1KXL A;  2Q8I B;  1EZ6 A;  2E2H H;  2ZJQ A;  4P74 A;  1PH2 A;  1J5E Q;  4KD4 A;  1EYA A;  1EY6 A;  2RDF A;  3I4N B;  1LUZ A;  4XQQ A;  2VB3 X;  2ALY B;  1LT5 D;  1FNW A;  1GO3 E;  2EYP A;  3GDE A;  1OXT A;  2D5D A;  1EIY B;  3M4O B;  3I3C A;  1SXT A;  4HIO A;  4LF8 L;  3R93 A;  2C35 B;  1FJG Q;  4MN3 A;  4OON A;  1SYF A;  4EGV A;  1S5B D;  1IYV A;  1HRJ A;  2IW3 A;  4DUY L;  3HKZ E;  5ELO A;  2ICI A;  1N33 Q;  4IJH A;  4XQN A;  1LAB A;  1VS0 A;  2A1A A;  1GUW A;  4BY1 G;  4A3F H;  1HFN A;  1QJO A;  2HDM A;  4PQX A;  4IPC A;  3R8B A;  4DAY B;  5C5L A;  5IGC A;  2IHF A;  1RTO A;  4LAA A;  1ILP A;  1FVI A;  5IP7 H;  2I46 A;  1B4O A;  2JN4 A;  4E6I A;  3CXC A;  1SJH D;  2ZJR A;  2NVQ B;  4LFB Q;  2Z6K C;  2Y0S G;  2EZV A;  3MXN B;  2EJG C;  4HCE A;  1VQ8 A;  2EYL A;  4GLX A;  2VUM H;  4OO1 I;  4AYB B;  3C1E A;  4K5V A;  3TN2 A;  1VQ7 A;  2F0N A;  3NEM A;  4POG A;  4JC0 A;  1CSQ A;  3DUZ A;  4GOP C;  1VQB A;  3W1B A;  1X3P A;  2K52 A;  1HA6 A;  2ZXR A;  3OWF A;  2EY2 A;  3BU2 A;  2NN6 I;  4LUZ A;  2KCC A;  2CHB D;  2O5J C;  5EBC A;  4CBV A;  1O80 A;  4A3J B;  4A3M B;  2HHH L;  4OXP A;  4IPH A;  4OIJ A;  4FVM A;  3MXN A;  3KK7 A;  4S3S A;  1F77 A;  3S1N B;  1TWF H;  1H95 A;  2BA0 A;  1X3F A;  2O5I C;  3HOU H;  2CH4 W;  4A3G B;  4JK1 C;  2J0T D;  4YWM A;  1SJE D;  1BF4 A;  5IOC A;  2ES2 A;  1J5E L;  4LFC Q;  5LL6 X;  1IHZ A;  2QA4 A;  1G6P A;  1L0W A;  3S17 B;  5C0X G;  3K5M A;  3VA7 A;  3TDQ A;  3PGZ A;  1IYJ B;  2R92 G;  1EQV A;  4K2K A;  4RGM A;  1PHJ A;  3GTP H;  1BBW A;  2ATW A;  5KGU A;  2R3Z A;  1AE2 A;  2LSS A;  4YIJ A;  3TBI B;  4ME3 A;  3HOZ H;  1NAP A;  1H9S B;  3OW2 A;  3KDF A;  4HJ8 A;  2EY5 A;  4PZ7 A;  2L11 A;  3JAM i;  4ZUI A;  1Z6H A;  1DM0 B;  2MJ8 A;  4DKA C;  4YCV A;  1TVX A;  3TEH B;  3J7Z C;  1OXS C;  1TWA H;  1HUM A;  1CA6 A;  3KOJ A;  4MNO A;  1GKH A;  4WFN 3;  3PIO A;  1ILQ A;  3FKI G;  2F0O A;  4HED A;  3E9I A;  4A3B B;  4BY7 G;  4DUZ Q;  1DOL A;  1VQH A;  3TZD A;  5D3I B;  1TWG B;  3UDG A;  1CQV A;  3T13 A;  2F0S A;  1CKN B;  1G2T A;  2RA4 A;  1G6Z A;  1EY9 A;  1UWV A;  2B63 B;  5C4J H;  1G2S A;  4LFB L;  1BCP F;  1STY A;  2LY7 A;  3A8I E;  1JMC A;  1D5M C;  1SEB D;  1VCI A;  5DAU A;  2ZXP A;  3LWE A;  1AE3 A;  4G7O C;  1ICF B;  1M8A A;  1LTI D;  4K5X A;  1UE7 A;  4QJF A;  4CGY B;  1ET6 A;  3AFQ A;  4YHH Q;  3FVQ A;  1N34 L;  1KRS A;  1QNU A;  1D1K A;  3MEF A;  4O0A A;  3RUZ A;  4GLV B;  1UUP A;  2CH4 A;  2KA7 A;  4JG2 A;  3NWT A;  3MVV A;  5FLM G;  4JYA L;  3AB9 A;  4X66 Q;  4X62 Q;  1D2B A;  3WWV A;  2AQ1 B;  1LT4 D;  5C4Z A;  5IYB H;  3QR8 A;  3H15 A;  3KLS X;  5J39 A;  4B3R Q;  5H1S E;  1LM0 A;  4IFD G;  4KY7 A;  1Y69 U;  1EEF D;  2IX3 A;  4GKK Q;  2TMP A;  3F2U A;  3H94 A;  1VQ4 A;  5ELE A;  2WB1 E;  4UPA A;  4LFC L;  2ASB A;  2I07 B;  3MFG A;  3F1Z A;  3GQB A;  3WDN A;  2F0E A;  4JI1 Q;  4H44 C;  5I6W A;  1CHQ D;  4GLA C;  1CT1 D;  3QJY A;  2NYZ D;  3NK9 A;  4BBR G;  3RZD B;  2WII B;  4DXF A;  4HCS A;  3DXJ C;  1U9R A;  4OWX B;  2GN5 A;  3MC0 B;  2F4V Q;  3KF6 A;  3ZJY C;  3S14 H;  4B9W A;  1IL8 A;  5KEE A;  4LF9 Q;  1RL2 A;  3K7U C;  1FNV A;  1K8O A;  5AFW A;  3SK4 A;  4DU9 A;  3PIP A;  4A3I B;  1TWC B;  1EIF A;  2HDL A;  3I90 A;  3UDF A;  3F8T A;  4YY3 Q;  5FOB B;  4PMB A;  1HHV A;  2A19 A;  2CWA A;  1VMC A;  2EY1 A;  3G6E A;  2F0U A;  4UAI A;  4DUZ L;  4IOC A;  3CCM A;  4DK0 A;  5M5X H;  4HSP A;  3VA5 A;  4N8X 1;  4BY1 H;  1GVP A;  4HTH A;  1ML0 D;  3S15 H;  3S2D B;  1SE4 A;  4QQB X;  5IYC G;  2KCN A;  4GKJ Q;  4GN3 B;  3UI2 A;  1CI3 M;  3E9H A;  2J7Z A;  4LF6 Q;  1RTN A;  1A3T A;  5GAG C;  1YJN A;  1N9W A;  1Q82 C;  3ND9 A;  1Q8I A;  3S16 B;  3HOX B;  4DV5 L;  1KDA A;  3CMA A;  1N36 Q;  4DR1 L;  1S5D D;  2Q2U A;  4BS9 A;  3G71 A;  2D2C C;  1QVG A;  4KHP L;  2DJG C;  1TQO A;  4YHH L;  1UE5 A;  5JEA J;  4RMF A;  3HOV H;  3NEL A;  4WOR A;  1R4P B;  3MEH A;  1YHA A;  5LMN Q;  2MNA A;  4DF7 A;  1I3Q H;  3NQT A;  1VQF A;  3U4V A;  1HNX Q;  2A73 B;  2F0V A;  3CCR A;  1KQS A;  2SEB D;  3MFY A;  4IAL A;  4POF A;  4FF4 A;  5C3E B;  3N6R A;  1X3G A;  4JOI A;  3L2P A;  3H0G G;  5HY6 A;  1KNA A;  1TY0 A;  3GV3 A;  4B3R L;  3KBG A;  4FF1 A;  3QG1 A;  5JVG 3;  3GTJ H;  5ELD A;  4GKK L;  2YU9 H;  3J80 c;  3NTK A;  1SYC A;  4BA2 I;  2RCF A;  5FK9 C;  2UXC Q;  3BYY B;  5T1G A;  3I4M G;  1KAB A;  2LKV A;  3CD6 A;  3KFU A;  3PV0 A;  1DGS A;  4JI1 L;  4H02 A;  1Y1W G;  2G9H D;  4DV0 Q;  3FDT A;  1HTP A;  3K8A A;  2K5W A;  1WJJ A;  3X3M A;  5KNC A;  4A3D B;  1NR4 A;  4TSS A;  1EYC A;  1JQY D;  1BQQ T;  4RCN A;  5C0X H;  1F9Q A;  4XYO A;  1MKH A;  2E76 C;  3U4Z A;  3GTQ H;  1QVC A;  3IKJ A;  3T4A C;  1Q90 A;  1X3E A;  2R92 H;  2RKS A;  1SLJ A;  2Y0S E;  5A35 A;  5IOD A;  2F4V L;  1ET9 A;  4JV5 L;  4O1N A;  4FXK C;  3OYY A;  4O42 A;  3RN5 A;  1AZQ A;  3V05 A;  4OO1 G;  1OXV A;  3J7A F;  2MO0 A;  4C3H B;  4R9W A;  1KL9 A;  3VYS A;  3TS2 A;  1WOC A;  1EU4 A;  1P8L A;  1STA A;  1TWH H;  1EQQ A;  5IGB A;  2VQE Q;  2V1C C;  3VYR A;  2MP1 A;  3L7Z C;  5C6A A;  5C4X G;  2KEC A;  4KK7 A;  2OWO A;  1XNQ L;  3J7A 5;  3FKI H;  4A3C G;  1BR9 A;  4ZUJ A;  1EIG A;  2I0Q A;  4BY7 H;  5I9O A;  2DUD A;  3HOW B;  4LF6 L;  4M1U B;  2R7Z H;  3Q22 A;  2Q8T A;  4A3E B;  1IBM L;  2K4K A;  3WOF A;  1F2Z A;  3H3V I;  1JC7 A;  1QIL A;  4JBK A;  4BBS H;  2ENB A;  3HEJ A;  2F0Q A;  3Q8D A;  1N36 L;  4APV A;  4NXN Q;  2AWN A;  3EBE A;  4C3I H;  3ERQ A;  5G3L F;  1BBU A;  2I5L X;  3H91 A;  4XXE A;  1KAA A;  1H9R A;  1RHP A;  1Y1V G;  1BDO A;  2F0H A;  4QB4 A;  3SE0 A;  3F2C A;  1DJR D;  5D65 A;  1V9P A;  3GTK H;  1GXD C;  1H9J A;  3TRE A;  1L1O A;  5EAY A;  2N88 A;  4JBW A;  5FLM H;  3HGB A;  1E22 A;  1QB5 D;  3C3L A;  2R61 A;  3J7A V;  2PNH A;  4A3K G;  3I7F A;  2C5C A;  2N55 A;  4DV1 Q;  2ZTE A;  3H3V C;  3CCE A;  5CV5 A;  1JOO A;  2UUA L;  3V96 A;  1SMY D;  2QW7 A;  4P73 A;  2AHO B;  2AKW B;  3FEW X;  4BWG B;  1JE4 A;  3P75 A;  4DV0 L;  2NVT B;  2Z0S A;  4FXG C;  4RGO S;  5IP9 G;  1D7Q A;  5EGT A;  4CKC A;  2XWB B;  3NPP A;  1HNW Q;  2E2I B;  2NVY H;  5IGD A;  1I50 H;  5BR8 Q;  5FKA C;  5GAE C;  5LMU L;  2SNM A;  1B50 A;  1SMY C;  2WKC A;  2RF4 A;  5T1I A;  4AYB G;  1PFM A;  1HNZ Q;  5I9P A;  2K75 A;  1I6H B;  4BBR H;  3B6Y A;  4V0B A;  3DMU A;  2DY7 A;  1TII D;  3K7A B;  3T1H L;  2F3I A;  2BH8 A;  2VQE L;  4LFA L;  4OWW B;  1XPO A;  1NSN S;  2OXP A;  1DOM A;  1EFI D;  1SMX A;  2WFW A;  1CZG A;  1GUO A;  1X65 A;  1PH1 A;  1ROD A;  4C3J G;  4DV6 Q;  3HS0 C;  2K28 A;  3NBI A;  5E4X A;  3PO3 H;  1SFO B;  4A3M G;  3PMF A;  2F3V A;  4QIW B;  3NE5 B;  3TME A;  1PRT D;  1AP0 A;  1VQL A;  3T16 A;  2BDO A;  4A93 G;  2XNA C;  5IYC H;  4KTA A;  2EE1 A;  1S4Z A;  2PCF B;  4QL5 A;  4A3G G;  1HH2 P;  1EY0 A;  4MHE A;  1B53 A;  2UU9 L;  2RHQ B;  3PO2 B;  2AQ3 B;  1JIC A;  4LF8 Q;  4IFD I;  2B2U A;  1O7Z A;  1IBK L;  2EDG A;  1VQ6 A;  3RMH A;  1MSG A;  3ERS X;  1N32 Q;  1FYC A;  2RSO A;  3CCS A;  2NVX H;  2K05 A;  2D0O A;  1PMR A;  3ULP A;  3KYH C;  1PRT C;  2CCZ A;  4LF7 Q;  4A3L G;  4C2M B;  1BOS A;  4X3U A;  4M8A A;  3MXG A;  4N9P A;  4L5R C;  1EU3 A;  1TU2 B;  2EYF A;  1B7Y B;  1I4H A;  3S2H H;  4GZY C;  5M3F B;  2IX0 A;  2F0M A;  1HTL D;  1K3R A;  3LX0 A;  1W6J A;  3KBX A;  4DV1 L;  1M1K C;  2E5L Q;  3CPW A;  3RLF A;  3TZU A;  5LHY 1;  4KY5 A;  1PZJ D;  1Q1B A;  4P2C B;  3M3Y B;  3K0Y A;  3U9O A;  1I4G A;  4X6A H;  1S3O A;  3CP0 A;  3EJI A;  4R8I A;  3I55 A;  5K36 G;  5J22 A;  4IPG A;  3EA6 A;  4GNX C;  3S1M B;  1LTT D;  3T51 B;  1NY4 A;  3GTG H;  3I4M H;  2JA8 B;  2B2V C;  3GV6 A;  2D0P A;  1XPR A;  2RCN A;  1Q7Y C;  2B63 G;  3EQL C;  4PV1 C;  2PMZ B;  1S5F D;  3KLR A;  2LXJ A;  3OMG A;  4QY7 A;  1HXY D;  1UEB A;  2F0D A;  1GUG A;  3CC4 A;  2K7V A;  3HOY B;  1K83 B;  2GVA A;  1F9S A;  2UUC Q;  3G48 A;  1KDC A;  1F9R A;  4GOP A;  1EL0 A;  4FP5 D;  1C7Y A;  1GD7 A;  1HCZ A;  4LK1 C;  5CV6 A;  4OO1 H;  1BBX C;  3TP8 A;  3MAQ A;  3E3X A;  1SE3 A;  1RIP A;  4RAU C;  1ICW A;  1KRT A;  3D6W A;  1EZ8 A;  4DV6 L;  4IUU A;  2B2U C;  1CM9 A;  4HJA A;  5C5M A;  4A3C H;  3D4R A;  2EXD A;  4PZ6 A;  2IX1 A;  2NN6 H;  4JI2 L;  1V43 A;  4CJ1 B;  5NUC A;  1C9O A;  1TS5 A;  1M90 C;  2D9U A;  4K14 A;  3CAM A;  1A6X A;  4K8I A;  2H5X A;  5M3M H;  4XQJ A;  4X65 L;  1N32 L;  1ONL A;  1F2M A;  1O78 A;  4IUN A;  4A3F B;  4LF7 L;  1WTP A;  4R1J A;  3NTH A;  3M4Y A;  3MA2 B;  1DON A; 
#chains in the Genus database with same CATH homology
 3I70 A;  3OPO A;  5CC4 A;  3BVG A;  2PZW A;  3OHX C;  3D4D A;  2X6L A;  5KYI A;  3SVM A;  3J80 E;  3I4L A;  4J6H A;  3EVQ A;  1Y8P B;  1Z47 A;  4ILW A;  3KF8 A;  4IQZ A;  4ZAI A;  3SK8 A;  5C3W A;  4XTC S;  3NQI A;  2JA6 B;  1PTO H;  1GHK A;  4ZKB B;  4QMG A;  3K5N A;  2F4I A;  1UNS A;  4HR7 B;  2DN8 A;  1E2W A;  3I8Z A;  2JA5 B;  3PUX A;  2PZT A;  1O7L A;  3DEO A;  5HGT A;  3S1R B;  3DM1 A;  3HOU B;  3NHH A;  3Q24 A;  3DHQ A;  2DY8 A;  3NP8 A;  1MSH A;  2LFN A;  4L6T B;  2PNR C;  1SNM A;  2JEA I;  1S5C D;  2ZT9 C;  1U4R A;  3AU7 A;  5CR3 A;  2YYZ A;  2WKD A;  5KYL A;  5EJW A;  3HOZ B;  1R9T B;  5JOB A;  3CU7 A;  2BE5 D;  5CV9 A;  2B39 A;  1XTC D;  2OF1 A;  1ENA A;  3SR1 A;  2L1B A;  3J80 L;  4IUT A;  3A55 A;  1T5X D;  1TWA B;  3WOE A;  1B9M A;  2SOB A;  1ESR A;  3T56 B;  1STE A;  3D31 A;  1DZ1 A;  2BE5 C;  3FPU B;  4FF2 A;  1DD2 A;  4CKE A;  4DGZ A;  2FIN B;  4DNR B;  4FO2 A;  3HRZ C;  1I4P A;  1PTO D;  3SXH A;  2TSS A;  1XX8 A;  1O7Y A;  1SSO A;  5K5P A;  5C44 B;  4NKL A;  3I91 A;  1GJX A;  2O4X A;  2XRS D;  3K5O A;  1JCK B;  1EIH A;  2M2L A;  1LTA D;  1PTO C;  3NBH A;  1V1P B;  5DEH A;  5CV8 A;  2IPK D;  5JJZ A;  5M5W B;  1VF5 C;  5DM7 3;  5IIF A;  2CQA A;  2K6A A;  2F0F A;  2QEJ C;  1II3 A;  1MGS A;  2E2D C;  3E6Z X;  3Q0A A;  4KN4 C;  3OW7 A;  2KED A;  2MUY A;  4OIK A;  1F2Y A;  2SDF A;  4XT1 B;  3I73 A;  2EYM A;  1V1P A;  4PNY A;  4G57 A;  3S14 B;  1G8Z D;  2WAQ B;  1DXM A;  5KRU A;  4CJ2 C;  2CVR A;  4HAE A;  1B44 D;  1M4V A;  1FNU A;  3M7N A;  3M7G A;  1HPC A;  1PXU A;  4OL7 A;  1R4Q B;  5M5X B;  1LT6 D;  4BY1 B;  1C48 A;  3S15 B;  4DFA A;  4NDX A;  1T5E A;  3PIP 3;  4NW2 A;  3DWA A;  4DA2 A;  1PFN A;  4U67 3;  1ZYR D;  1D6E C;  5BN4 A;  2JSO A;  3IAY A;  1LAC A;  2A5H A;  4NMZ A;  5IGF A;  1E2V A;  2EYO A;  3O13 A;  1V8Q A;  4RA8 A;  1W6K A;  2K5Q A;  3HOV B;  1ZYR C;  1H9M A;  2LS0 1;  1LLR D;  4QF4 A;  1I3Q B;  1HQM C;  1LV9 A;  3K59 A;  1I6V C;  4IUP A;  2G9D A;  3J7Y W;  3VYU A;  3GTJ B;  4EQO A;  2YU9 B;  1QE6 A;  1CQF A;  5JPM C;  4DXG A;  1EOT A;  2KUM A;  4H7B A;  1F9P A;  1JOQ A;  3BS1 A;  4IUR A;  1BCP D;  4HMI A;  4KY6 A;  2WIN B;  4KJO A;  3GTQ B;  4C1N K;  1AEX A;  1DCZ A;  3VR3 A;  4XYQ A;  1OXU A;  1BO0 A;  2A69 D;  1BCP C;  1GHJ A;  3MXP A;  1RF2 D;  4K6L A;  1PLF A;  1WD1 A;  1PRT F;  1TWH B;  1SYE A;  4WJW A;  1KLG D;  1G29 1;  4U68 A;  2B8F A;  2EVB A;  2NWG A;  4TQU S;  3TP5 A;  3FKI B;  1UAP A;  1PDQ A;  2ZXO A;  3GO5 A;  4BY7 B;  2A69 C;  3URY A;  2F0T A;  2RVL A;  3ITP A;  3OMC A;  1CA5 A;  2R7Z B;  4Z9C B;  2AWO A;  1VMP A;  4EQP A;  1ZXT A;  1LTR D;  2MPM A;  5I4D A;  4BBS B;  5C0X J;  3CRL C;  3RD4 A;  5FO7 B;  4C3I B;  4IZ8 A;  2JXM B;  4NP5 A;  1PRT B;  4KHV A;  3H6M A;  3E5S A;  5EKK A;  2B2T C;  2L12 A;  1RJT A;  2VXW A;  2F3W A;  1ENF A;  3GTK B;  4EQN A;  3R3O A;  3OIQ A;  4RHR A;  3OWE B;  3QO2 A;  1SYB A;  4L8J A;  1TS4 A;  4C56 C;  3A7L A;  5CMD A;  2F03 A;  1XWE A;  5E4W C;  1S5E D;  1CK1 A;  1CTM A;  1VF7 A;  2XVS A;  2EPB A;  4IFD H;  1QOH A;  2F0I A;  2B2W A;  2NVY B;  1I50 B;  1JWM D;  1U4P A;  2R6G A;  1Q12 A;  3D8G A;  1X32 A;  1D1I A;  3R2I A;  1SNQ A;  4ZYS A;  1RCV D;  4BBR B;  5CYU A;  1DYQ A;  4X3S A;  5HUR A;  4XDX A;  5EPJ A;  5CBA E;  4FYD A;  2B2V A;  1KTK A;  5E3F A;  5M9O A;  5LL6 S;  2IT1 A;  4RKL A;  4IFD J;  2NUC A;  3PO3 B;  2L4N A;  5I6Y A;  4FF3 A;  3K58 A;  4F88 A;  2FFK B;  2RBM A;  3TP7 A;  3K5L A;  2QIL A;  4RKB A;  1GOZ A;  1IKM A;  4EVO A;  2E74 C;  1G91 A;  2B8G A;  2A74 C;  1EY8 A;  2NVX B;  3MWY W;  1ESF A;  1QNK A;  2H4O A;  1DOK A;  2DNC A;  4K6D A;  1TS3 A;  3TSS A;  2EYJ A;  3NUC A;  2KEE A;  3SEB A;  1SYD A;  2XN9 C;  2EJF C;  3S2H B;  3IFT A;  1RDP D;  3VR2 A;  4KI0 A;  2B2W C;  4MIU A;  3FPP A;  3QOJ A;  3ZYY X;  4RCO A;  3J81 L;  3N52 A;  1XYI A;  2F0P A;  1WTQ A;  2L5T A;  3GTG B;  3I4M B;  3S9W A;  2XSC A;  1WTW A;  3HKZ B;  2BDN A;  2EOT A;  1SNP A;  3C2P A;  4ME5 A;  1WCM B;  2K03 A;  1A2U A;  2EJM A;  1FGB D;  2X6G A;  5IGE A;  2K01 A;  1CZW A;  5JVH 3;  2PPB C;  4F87 A;  2JEB I;  1STG A;  2FJ2 A;  2F0W A;  4KKT A;  4N9T A;  1Y8N B;  3L9A X;  5ELB A;  2M9V A;  2QKI C;  4DN4 M;  2E2H B;  3I72 A;  4B9X A;  4DAP A;  2SNS A;  1LT3 D;  5ISR A;  4DK1 A;  2A6E C;  2L55 A;  1U4L A;  2F0K A;  1B1Z A;  2B2Y A;  3FRP B;  4OGQ C;  3P7J A;  4Q0F A;  5M3M B;  5KNB A;  2F0G A;  5DNF A;  3OSO A;  2L9H A;  1PTO F;  3FMC A;  2FMC A;  1J9O A;  2AQ2 B;  1L0X B;  3PUV A;  3GP7 A;  1Y1V B;  3P20 A;  3ND8 A;  1JB3 A;  4KMU C;  5A2Q L;  3G7L A;  1VDZ A;  4DNT B;  5JEA G;  2VUM B;  3KLS A;  4G7H C;  1NR2 A;  4A3K B;  4DAV A;  1Q3L A;  3D3R A;  2RSN A;  1L0Y B;  2GA4 B;  1JOK A;  4WRD A;  3U9S A;  1EWH A;  1PTO B;  4CKB A;  3P1H A;  2PYK A;  4ZK9 B;  1YNN D;  1KLU D;  2KJX A;  2JP1 A;  5CV4 A;  4IN3 A;  4I65 A;  2ICE C;  3JAM E;  5F2D A;  1QWY A;  1EEI D;  3MTS A;  1YNN C;  1C8C A;  1GUT A;  4V19 0;  5E1F A;  1TWF B;  2D62 A;  2B2Y C;  5FLX E;  5EPK A;  5FO8 B;  3BVZ A;  3BDO A;  2NBF A;  3T53 B;  2VNU D;  2IJ0 A;  2JA7 B;  1GUN A;  4G7Z C;  3C1F A;  4DAY A;  2K5D A;  1HUN A;  1WVL A;  3GTP B;  5EKI A;  4C3J B;  4F7X A;  5EKL A;  2H1E A;  3ERO A;  2F0J A;  3NTI A;  4A93 B;  3BYT B;  1Y8O B;  3NSW A;  3QB3 A;  4L63 B;  1BNZ A;  3PUW A;  1LTG D;  4Y7N B;  3PUZ A;  2O2L D;  1NCV A;  2QDB A;  4OHJ A;  3JAM L;  4Q5V A;  4R8N A;  2WB1 B;  3LWU A;  1GUS A;  1SYG A;  3CRK C;  4I7Z C;  5COY A;  5EPL A;  3W3A A;  3CQZ B;  3BG3 A;  3A8K E;  3HP3 A;  5C4J B;  1WTO A;  1EY5 A;  2V4D A;  3VR5 A;  3ONA B;  3A7A B;  4C3H G;  3PIO 3;  1KDB A;  5FLX L;  4BA1 I;  1TY2 A;  2Z8L A;  4KKS A;  2IL8 A;  2J4X A;  3L3O C;  1EY4 A;  4RGN A;  1A15 A;  3G6J B;  4H13 C;  5K36 H;  1MI2 A;  1H9S A;  3CHB D;  1HQR D;  4C3I G;  2OEO A;  1YNJ D;  3MHB A;  1SBB B;  1A2T A;  4LJZ C;  4CHT B;  1XXG A;  3TP6 A;  3W2D A;  1V1O A;  1JOR A;  1WTR A;  1I4R A;  5CBE E;  1STH A;  1JWS D;  1A3V A;  3K6O A;  1HA5 A;  1E0B A;  1TS2 A;  5TSS A;  5D3D A;  1YNJ C;  2KHS A;  3IFD A;  2EY6 A;  1BUV T;  2RDG A;  2K04 A;  1BCP B;  2BOS A;  2NTT A;  3K57 A;  1AZP A;  5IGG A;  2OT2 A;  4IUV A;  2Z4I A;  1NUC A;  4KV6 A;  1BXT A;  3SK6 A;  4K8J A;  4FXD A;  2XWJ B;  2AUK A;  2PW7 A;  3S1Q B;  3A8J E;  3X3N A;  1TKW B;  2WAC A;  1I4X A;  3SK5 A;  1MD2 D;  3LNN A;  3E0J A;  2K32 A;  1H9K A;  1TR5 A;  2Y0S B;  1WTV A;  2PW5 A;  5JEA H;  1TT2 A;  1PFB A;  4TRD A;  5C3X A;  2HUG A;  1I4Q A;  2F1M A;  1EWC A;  1AN8 A;  5ELF A;  2HCI A;  1B3A A;  1FR3 A;  2AUJ D;  1LTB D;  5BN5 A;  5KIX A;  3D6C A;  1C4Q A;  1RKN A;  1PYW D;  1STN A;  3R2T A;  5BN3 A;  2PO4 A;  4FNF A;  3GTL B;  4QUC A;  2B2T A;  4X3T A;  3SHL A;  1SNO A;  1RD9 D;  3RZO B;  3H09 A;  2QCP X;  2WP8 J;  2BCO A;  3SDZ A;  5D14 A;  1IKL A;  3KUP A;  1CFM A;  1ZEQ X;  2KQ3 A;  3VR4 A;  3VYT A;  3C46 A;  2NTS A;  2R92 B;  2C9O A;  1Z7T A;  4KD3 A;  5EQ0 A;  2K33 A;  3BVM A;  3PUY A;  4J8Q A;  2A6H D;  4XIG S;  3MXU A;  2Z4H A;  4RGT A;  2L0C A;  4ABN A;  3EFX D;  1K8M A;  3D4W A;  3BZD B;  5DM6 3;  3Q23 A;  4ZRZ A;  1D5X C;  2EYH A;  4K5W A;  3VR6 A;  1SDF A;  2VB2 X;  1KNE A;  3MZ5 A;  4KHZ A;  4G4K A;  5CV7 A;  2LMC B;  2A6H C;  1D5Z C;  3QOL A;  3IL8 A;  4TKO B;  5IT9 E;  2XRQ D;  5JAV A;  5I2Y A;  4KN7 C;  4QCL A;  2RDH A;  2NN6 G;  1SNC A;  1JR0 D;  1Q1E A;  4CJ0 B;  1J8I A;  1WTX A;  2FHT A;  4KJN A;  3BDC A;  3CKI B;  1EYD A;  1B2T A;  3OOC A;  1B9N A;  3DEP A;  2EXZ A;  2Z1C A;  5I2X A;  2JYO A;  3QWN A;  5C0X I;  4ODG A;  4ZKC B;  1HFG A;  1ZKO A;  2KOL A;  4XT3 B;  2JE6 I;  4RHS A;  2XIW A;  4PMC A;  2MGS A;  3NXW A;  1JWU D;  2X69 A;  1QG7 A;  5IT9 L;  5ELC A;  2FMM A;  2DNE A;  3GTO B;  2A68 D;  4RWS C;  2NB0 A;  2QF7 A;  3J81 E;  4HMJ A;  4RFB A;  1OXX K;  2R93 B;  1AFP A;  4HN7 A;  3A56 A;  2NZ1 D;  2WV6 D;  4C1N I;  2A68 C;  1ENC A;  1STB A;  4ULL A;  2PZU A;  5CGK A;  4J1M A;  3OIP A;  4HSV A;  3Q6S A;  4PMW A;  1LO5 D;  4RH6 A;  3AMU A;  4F8M A;  3HG9 A;  5EBD A;  4LMQ D;  1IW7 D;  4KKU A;  4B08 A;  5COR A;  2RQX A;  4QUF A;  4H0L C;  5J1Z A;  5KND A;  1PZK D;  3H0G B;  4K2L A;  4ID6 A;  2K1B A;  1QCB D;  5M5Y B;  1IW7 C;  3M85 A;  1PZI D;  3GTM B;  2CW0 D;  3HZX A;  1Y1W B;  1F2L A;  3BDL A;  2KVM A;  2PQE A;  5G3L D;  2E75 C;  5A2Q E;  2CW0 C;  1WD0 A;  4UDU C;  1LTS D;  2Q8R E;  2A6E D;  3QIA A;  3DWQ A;  2HCC A;  2HQE A;  2M00 A;  5JPN C;  3DWP A;  1OO9 B;  1CHP D;  1X3Q A;  4IUQ A;  2MHV A;  3NWS A;  2ID0 A;  4ZLT F;  1U4M A;  5C4X B;  1IYU A;  1EY7 A;  1MBY A;  1A3U A;  4ZQ3 A;  5C4H A;  1E2Z A;  3V2T A;  5FO9 B;  1EQT A;  1SE2 A;  1SAP A;  1SND A;  2IWH A;  2E2J B;  2F0L A;  1FD7 D;  1AW7 A;  4X3K A;  1UEA B;  3GD7 A;  2BA1 A;  3A54 A;  2Q8I B;  1EZ6 A;  4KD4 A;  1EYA A;  1EY6 A;  2RDF A;  3I4N B;  4XQQ A;  2VB3 X;  1LT5 D;  1FNW A;  2EYP A;  1OXT A;  2D5D A;  3M4O B;  3I3C A;  1SXT A;  3R93 A;  4MN3 A;  1SYF A;  4EGV A;  1S5B D;  1IYV A;  1HRJ A;  2IW3 A;  2ICI A;  4XQN A;  1LAB A;  1GUW A;  1HFN A;  1QJO A;  2HDM A;  4PQX A;  3R8B A;  5C5L A;  5IGC A;  1RTO A;  4LAA A;  1ILP A;  2I46 A;  1B4O A;  4E6I A;  2NVQ B;  1SJH D;  2EZV A;  2EJG C;  4HCE A;  2EYL A;  4OO1 I;  4AYB B;  3C1E A;  4K5V A;  3TN2 A;  2F0N A;  3DUZ A;  1X3P A;  1HA6 A;  2ZXR A;  2EY2 A;  3OWF A;  2NN6 I;  2KCC A;  2CHB D;  2O5J C;  5EBC A;  4CBV A;  1O80 A;  4A3J B;  4A3M B;  4OIJ A;  4FVM A;  3MXN A;  3KK7 A;  4S3S A;  1F77 A;  3S1N B;  2BA0 A;  2O5I C;  4A3G B;  4JK1 C;  2J0T D;  1SJE D;  1BF4 A;  5IOC A;  5LL6 X;  1IHZ A;  3S17 B;  5C0X G;  3K5M A;  3VA7 A;  3TDQ A;  1EQV A;  4K2K A;  4RGM A;  5KGU A;  2R3Z A;  4YIJ A;  3TBI B;  1NAP A;  1H9S B;  2EY5 A;  2L11 A;  4ZUI A;  1Z6H A;  1DM0 B;  2MJ8 A;  1TVX A;  1OXS C;  1HUM A;  1CA6 A;  4WFN 3;  1ILQ A;  4HED A;  2F0O A;  4A3B B;  1DOL A;  3TZD A;  5D3I B;  1TWG B;  1CQV A;  3T13 A;  2F0S A;  1G2T A;  2RA4 A;  1G6Z A;  1EY9 A;  2B63 B;  1G2S A;  1BCP F;  1STY A;  2LY7 A;  3A8I E;  1D5M C;  5DAU A;  1SEB D;  1VCI A;  2ZXP A;  3LWE A;  4G7O C;  1M8A A;  4K5X A;  1LTI D;  4CGY B;  1ET6 A;  3FVQ A;  1QNU A;  1D1K A;  3RUZ A;  1UUP A;  2KA7 A;  3NWT A;  3MVV A;  3AB9 A;  1D2B A;  2AQ1 B;  1LT4 D;  5C4Z A;  3KLS X;  5J39 A;  4IFD G;  4KY7 A;  1Y69 U;  1EEF D;  2IX3 A;  2TMP A;  3F2U A;  3H94 A;  5ELE A;  2I07 B;  3MFG A;  3WDN A;  3GQB A;  2F0E A;  4H44 C;  5I6W A;  1CHQ D;  1CT1 D;  3QJY A;  2NYZ D;  3NK9 A;  3RZD B;  2WII B;  4DXF A;  4HCS A;  3DXJ C;  1U9R A;  3MC0 B;  4B9W A;  1IL8 A;  5KEE A;  1K8O A;  1FNV A;  5AFW A;  3SK4 A;  4DU9 A;  4A3I B;  1TWC B;  2HDL A;  3I90 A;  5FOB B;  4PMB A;  1HHV A;  1VMC A;  2EY1 A;  2F0U A;  4UAI A;  4DK0 A;  4HSP A;  3VA5 A;  4HTH A;  1ML0 D;  3S2D B;  1SE4 A;  2KCN A;  3UI2 A;  1CI3 M;  2J7Z A;  1RTN A;  1A3T A;  3ND9 A;  1Q8I A;  3S16 B;  3HOX B;  1KDA A;  1S5D D;  4BS9 A;  2D2C C;  1TQO A;  5JEA J;  4WOR A;  1R4P B;  3MEH A;  4DF7 A;  3NQT A;  2A73 B;  2F0V A;  2SEB D;  3MFY A;  4IAL A;  4FF4 A;  5C3E B;  3N6R A;  1KNA A;  1TY0 A;  3GV3 A;  3KBG A;  4FF1 A;  3QG1 A;  5JVG 3;  5ELD A;  3NTK A;  1SYC A;  4BA2 I;  5FK9 C;  3BYY B;  5T1G A;  1KAB A;  2LKV A;  3PV0 A;  2G9H D;  3FDT A;  1HTP A;  2K5W A;  3X3M A;  5KNC A;  4A3D B;  1NR4 A;  4TSS A;  1EYC A;  1JQY D;  1BQQ T;  4RCN A;  5C0X H;  1F9Q A;  4XYO A;  2E76 C;  3IKJ A;  3T4A C;  1Q90 A;  2RKS A;  5A35 A;  5IOD A;  1ET9 A;  4O1N A;  4FXK C;  4O42 A;  1AZQ A;  3V05 A;  4OO1 G;  1OXV A;  3J7A F;  4C3H B;  4R9W A;  3VYS A;  1EU4 A;  1STA A;  5IGB A;  3VYR A;  2MP1 A;  3L7Z C;  5C6A A;  2KEC A;  4KK7 A;  1BR9 A;  4ZUJ A;  1EIG A;  5I9O A;  3HOW B;  4M1U B;  3Q22 A;  2Q8T A;  4A3E B;  3WOF A;  1F2Z A;  1JC7 A;  1QIL A;  2ENB A;  3HEJ A;  2F0Q A;  2AWN A;  3ERQ A;  5G3L F;  3H91 A;  4XXE A;  1KAA A;  1H9R A;  3SE0 A;  1RHP A;  1BDO A;  2F0H A;  4QB4 A;  1DJR D;  5D65 A;  1GXD C;  1H9J A;  2N88 A;  4JBW A;  3HGB A;  1QB5 D;  3C3L A;  2R61 A;  3J7A V;  2C5C A;  2N55 A;  3H3V C;  5CV5 A;  1JOO A;  3V96 A;  1SMY D;  3FEW X;  4BWG B;  1JE4 A;  3P75 A;  2NVT B;  4FXG C;  4RGO S;  5EGT A;  4CKC A;  2XWB B;  3NPP A;  2E2I B;  5IGD A;  5FKA C;  2SNM A;  1B50 A;  1SMY C;  2WKC A;  5T1I A;  1PFM A;  5I9P A;  1I6H B;  4V0B A;  3DMU A;  2DY7 A;  1TII D;  3K7A B;  1NSN S;  2OXP A;  1DOM A;  1EFI D;  1CZG A;  1GUO A;  1ROD A;  4C3J G;  3HS0 C;  2K28 A;  3NBI A;  5E4X A;  1SFO B;  3PMF A;  2F3V A;  4QIW B;  3NE5 B;  3TME A;  1PRT D;  1AP0 A;  3T16 A;  2BDO A;  2XNA C;  4KTA A;  2EE1 A;  1S4Z A;  2PCF B;  4MHE A;  1EY0 A;  1B53 A;  3PO2 B;  2AQ3 B;  1JIC A;  4IFD I;  2B2U A;  1O7Z A;  2EDG A;  3RMH A;  1MSG A;  1FYC A;  2RSO A;  2K05 A;  1PMR A;  1PRT C;  4C2M B;  1BOS A;  4X3U A;  4M8A A;  3MXG A;  4N9P A;  1EU3 A;  1TU2 B;  2EYF A;  1I4H A;  4GZY C;  5M3F B;  2IX0 A;  2F0M A;  1HTL D;  3LX0 A;  1W6J A;  3KBX A;  3RLF A;  3TZU A;  5LHY 1;  4KY5 A;  1PZJ D;  1Q1B A;  4P2C B;  3M3Y B;  3K0Y A;  3U9O A;  1I4G A;  3EJI A;  4R8I A;  5K36 G;  5J22 A;  3EA6 A;  3S1M B;  1LTT D;  3T51 B;  2JA8 B;  2B2V C;  3GV6 A;  3EQL C;  4PV1 C;  2PMZ B;  1S5F D;  3KLR A;  3OMG A;  1HXY D;  2F0D A;  1GUG A;  2K7V A;  3HOY B;  1K83 B;  1F9S A;  1KDC A;  1F9R A;  1EL0 A;  4FP5 D;  1HCZ A;  4LK1 C;  5CV6 A;  4OO1 H;  1BBX C;  3TP8 A;  3MAQ A;  1SE3 A;  4RAU C;  1ICW A;  3D6W A;  1EZ8 A;  4IUU A;  2B2U C;  1CM9 A;  5C5M A;  3D4R A;  2IX1 A;  2NN6 H;  1V43 A;  4CJ1 B;  5NUC A;  1TS5 A;  2D9U A;  4K14 A;  1A6X A;  4K8I A;  4XQJ A;  1ONL A;  4IUN A;  1F2M A;  1O78 A;  4A3F B;  1WTP A;  3NTH A;  3M4Y A;  3MA2 B;  1DON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...