3SK4A

Crystal structure of staphylococcal nuclease variant delta+phs d21n/v23e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGNTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS D21N/V23E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk4A00
4KJOA 3LX0A 1A2UA 3TP7A 3T13A 5ISRA 2KQ3A 5IODA 3NK9A 1A3VA 4K8IA 5CR3A 4B9XA 2F0KA 1EY4A 4PMCA 5J22A 4K6DA 2PW5A 5JOBA 3SHLA 4K5VA 2F0TA 1SNCA 1NUCA 5CV9A 2EY6A 2F0FA 4R8NA 5I9PA 4F8MA 1TT2A 3OSOA 3OMGA 4HMIA 5J1ZA 5NUCA 1SYGA 2KHSA 2PZUA 4K5XA 1F2ZA 4ZUIA 3OMCA 5CV5A 4IALA 4KD3A 2F0NA 4ODGA 4PNYA 3TP8A 1EZ6A 3SXHA 1TR5A 2F0LA 5DAUA 1EZ8A 3MEHA 2F0WA 1IHZA 2EYOA 2F0MA 3BDLA 3R3OA 4K14A 3ERQA 3SK8A 3VA5A 1KDCA 4YIJA 3D6CA 1KDBA 4J1MA 3QOLA 2RDFA 4N9PA 2F0QA 1EQVA 4NDXA 4HTHA 5DEHA 2F0VA 1EYAA 1EY0A 2F0UA 3BDCA 4QF4A 5JAVA 3QB3A 3V2TA 4E6IA 5IIFA 5IGFA 1SNDA 5C3WA 2LKVA 1JOQA 4KY5A 4KJNA 4QB4A 2F0JA 2F3VA 2QDBA 4WRDA 3SK6A 3TP6A 5KYIA 5J39A 2F0IA 3QOJA 2SOBA 5EKKA 2PZTA 4EVOA 5KRUA 4N9TA 5C4ZA 3SK5A 1JORA 5I9OA 5KGUA 1SNPA 2HQEA 1ENAA 4K2KA 1A3UA 1EY5A 4KTAA 4LAAA 5CGKA 1SNQA 2EY1A 3RUZA 4NKLA 3HEJA 4KV6A 4OL7A 3T16A 1EYCA 3MZ5A 2F3WA 1SNOA 1STNA 3P1HA 2NUCA 4KY7A 5IGGA 4KHVA 5C6AA 2PZWA 4WORA 3TMEA 2F0EA 4B9WA 5IGDA 3MHBA 3MXPA 2F0OA 2EY5A 3E5SA 5KYLA 2F0SA 2EXZA 4ID6A 1KDAA 1F2MA 4RKLA 5F2DA 1RKNA 5EKLA 3NXWA 2ENBA 5C5LA 2OXPA 5HGTA 1STBA 2RKSA 3P75A 1STAA 4EQNA 4NMZA 4S3SA 1AEXA 5E3FA 1A3TA 2EYLA 1STHA 4DGZA 1STYA 4ZQ3A 5HURA 5I6YA 3DMUA 4K8JA 2EYJA 3C1FA 3NHHA 4G57A 4KD4A 1SYEA 2PW7A 4PMBA 5E1FA 1ENCA 5IGBA 2WACA 4H7BA 4DU9A 2PQEA 3EROA 1SYDA 2PYKA 2EY2A 1A2TA 3HZXA 1NSNS 1SYFA 2EYFA 3ITPA 3OWFA 3D8GA 1EYDA 2F0GA 5I6WA 2F0HA 1SNMA 3MVVA 4K2LA 4MIUA 4EQOA 3S9WA 4NP5A 2M00A 1SYCA 4IZ8A 3PMFA 4ME5A 1JOKA 3TP5A 5IGCA 1TQOA 2F0DA 2OF1A 4I65A 1KABA 4KY6A 1STGA 1U9RA 1EY9A 2SNSA 1II3A 3NQTA 4TRDA 3H6MA 3SK4A 3EVQA 5CV8A 5KIXA 5IOCA 1JOOA 3D4DA 4DFAA 4RKBA 5C3XA 1EY7A 4HMJA 1EY8A 2OEOA 5CC4A 2SNMA 3C1EA 4QMGA 5IGEA 4IUNA 5KEEA 4J6HA 1KAAA 3EJIA 2EYMA 1SYBA 4EQPA 2O4XA 5K5PA 3U9OA 5M9OA 1EY6A 5CV7A 3D4WA 3DHQA 2RBMA 2EYHA 4K5WA 4ZUJA 4DF7A 3SR1A 4F7XA 5EGTA 5C4HA 5CV6A 2EYPA 3NUCA 5C5MA 5CV4A 2F0PA 1F2YA 3NP8A
chains in the Genus database with same CATH superfamily
3SEBA 2ICIA 4R4TA 4N8X1 1IBLQ 2K03A 3T53B 2TMPA 4DXGA 3IFDA 1O7ZA 2N49A 2PNRC 3QJYA 3S24A 3Q22A 3LWEA 1YJ9A 4LFCL 2N78A 3PCOB 4ZRZA 2CKZB 1O7IA 2WB1B 1Z47A 2ZJQA 1S5DD 4JI3L 3FRPB 3R3OA 3G71A 3PIPA 1CI3M 1KDCA 4YIJA 3TZDA 2WKDA 2GA4B 4N9PA 3KLSA 4C2MH 1UE5A 3K5MA 3H91A 2AWNA 4MTKA 1VQOA 3J80L 3K7UC 2E75C 1IKMA 5GAEC 2R61A 4UAIA 5EKKA 3HOVH 1N8RC 2NN6G 5KGUA 4DR4Q 1ENAA 3I3CA 4HSPA 4LW1A 1V9PA 4LAAA 3KBGA 3HRZC 1KQSA 5CYUA 1TWHB 3BG3A 2UU9L 3D6WA 4ILWA 2NZ1D 3P1HA 4LF9L 2JA6G 1U4LA 3NBIA 4GS3A 5ELCA 4FF2A 3TMEA 2A74C 2F0OA 2I07B 1D1KA 3A54A 3J81c 2XVSA 3CQZB 2AWOA 4DV0L 1SE8A 4X3SA 2RA4A 4AH6A 1TWGH 5E3FA 3UDFA 4LF7Q 4H44C 4IOAA 2E76C 4I7ZC 1SJED 2GVAA 4UPAA 5I6YA 1HZ9A 5C44B 4G57A 4XYQA 1VQ5A 1SE2A 2OT2A 1UNSA 3C3LA 3PO2B 4RG1A 2PQEA 1I4PA 2QGQA 3EFXD 4LMQD 2F4VQ 1SFOB 1HZAA 1BQQT 5K36G 2B39A 2F0HA 3E0EA 4M1UB 1PMRA 4J8QA 2XTIA 2G5DA 2JA8H 1IL8A 1WTOA 1GD7A 3EN2A 1Y1WG 1EQRA 4LF8L 5HY6A 1QVFA 5EPJA 1LTAD 3C1EA 1XWEA 3CRLC 5HGQA 4A3KG 2SDFA 1HXYD 2B2VC 2YTYA 3MXNB 4F7XA 1HQMC 3RZDH 2NN6I 2MQHA 5EGTA 2EZVA 2RVLA 4XQJA 3VR5A 4X64Q 1E1OA 4DR1Q 2UXBL 5IYCH 2KVMA 3A8JE 2VUMH 2AUKA 2B2UC 3OMGA 5NUCA 2KHSA 3ZJYC 1EWHA 3CCRA 2XRQD 4C1NK 3S1QH 4WFN3 1LT3D 1ZEQX 1BXTA 2K05A 3Q8DA 1HUMA 1NCVA 3K6OA 1KDBA 1XNQQ 5IYBH 3PUWA 2DJFC 2ZJRA 2F0VA 2JJQA 4NPSA 5IIFA 1SNDA 2IW3A 4QGUA 2E5LL 4QB4A 1EL0A 2QCPX 1YNNC 4KHPL 4JI6Q 2CFMA 4HCEA 3QG1A 2N55A 1RTNA 2B2YA 5JVH3 3OIPA 2A6HD 2K01A 2LY7A 4BBRG 5IP7H 1EFWA 1ASYA 4HSVA 2WAQG 3URYA 1YJWA 4OX9L 1VQKA 1Z7TA 1Q1EA 2TSSA 1VQBA 2KCMA 2MPMA 2KECA 2PI2A 2ZTEA 5F2DA 1KNEA 4NB3A 2YTVA 2ENBA 3NXWA 2BA1A 3WDNA 2OXPA 4DR6Q 1STBA 4B3TQ 2R93G 4EQNA 4LWCA 5ELEA 1S5ED 3WOEA 3GTQB 3A7LA 1KLGD 3RR5A 1J5EL 3C1FA 1XMQL 3HOWG 3IFTA 4JW0A 1R4PB 2JSOA 1BBUA 3VR4A 3CC4A 2CHBD 4GKKL 2FXQA 3M7GA 3MVVA 2KHJA 4JVZA 2MNAA 3NBHA 4NP5A 4FNFA 4HIDA 1HA6A 4ME5A 2ZM6Q 4RGNA 1BVSA 2CVRA 4OWWB 3GTPB 2K1BA 1JQYD 4DV2L 2WKCA 4RKBA 4MNOA 1EY8A 4QJFA 1KAAA 5M9OA 2UXDQ 1E2VA 1J9OA 4DF7A 1SROA 3SR1A 2NYZD 1WVLA 3A55A 3Q24A 2EYPA 3NUCA 3MTSA 1Y1VG 1F2YA 3BZKA 3NP8A 1UUPA 4YHHL 5C4XB 5C3EG 2R7ZG 3HOXH 2BE5C 1PTOH 4R8NA 2CWAA 2CW0C 1SYGA 2KHIA 4FF4A 1NAPA 4PNYA 3VYSA 1VMPA 2HDMA 1R4QB 2AHOB 1KLUD 1UE7A 1TWFB 1ML0D 3ERQA 1TWAH 4LF4Q 4XTCS 3G4SA 1GJXA 5T1GA 4E6IA 4R4CA 4A3BB 3GTJB 4CKBA 4KJNA 2QDBA 2F3VA 2VQFL 3K59A 3STBD 4X3TA 4CJ2C 3H0GB 1PLFA 3T1HL 5GAGC 4A3DB 1SNPA 3PIOA 3PO2G 1XTCD 4LUZA 1K83B 2IHFA 4IURA 5JEAJ 4A3GH 1Q7YC 2NVQB 4CJ1B 2JEBI 1DOLA 3ULLA 4A3MG 3GTKH 4H02A 3BS1A 4X66Q 4X3KA 1T5XD 4IFDG 3DUZA 2K14A 5E7NA 5C6AA 1HRJA 2PZWA 4Q0FA 4WORA 3VYTA 1IKLA 4A3LH 4ZKCB 4C3JB 3FHWA 2QEJC 3TDQA 1EQQA 1FNVA 4PZ7A 1BOSA 3DWAA 4X3UA 5LMUL 1Y69U 1TU2B 2E2HH 2B8GA 1VQNA 4S3SA 5FLMG 5T1IA 5M5YB 1Y14B 1FJGQ 1HNZL 2NVXB 5FO8B 5GROA 1I4GA 2KCCA 3NENA 3ICEA 4GN3B 4A3IH 4MHEA 2OTJA 4DU9A 3CP0A 1SYFA 3OWFA 3PSIA 4V190 1QOHA 2F0GA 1MBYA 3ULPA 3S9WA 4LNQA 1UEBA 3KLWA 4IZ8A 3PO3H 2FMCA 4A3FB 5G3LF 3I72A 1MHWC 1HNWL 4BY1B 1U0LA 1EQTA 1GO3E 4RGTA 2OEOA 4UP9A 1JMCA 1BUVT 3NSWA 1RHPA 1X55A 2B3GA 3I4MG 3KF6A 1VQ4A 3S14H 1YI2A 4B3SQ 1YNJC 2BH2A 3PIP3 5IODA 2IX1A 3MAQA 2B63H 2F0TA 3SGIA 3JAMc 3KYHC 4IFDI 4IJHA 1PH5A 1NY4A 4MN3A 1XNRQ 2MO0A 4YWKA 1YZ6A 2IT1A 2F0WA 1NE3A 3RZOB 1YHBA 1UE1A 4DR7L 2Z4IA 2JXMB 3Q23A 1AZQA 2K32A 4DKAC 4HIOA 3HKZE 3UE1A 5M3MB 5C0XI 2K75A 5KYIA 2UXBQ 3BZDB 3M3YH 4DR4L 2N3SA 3TQYA 1G6PA 3M4PA 5FLXE 2NZOA 1G2TA 5JEAH 1WJJA 5EBCA 4WJWA 5FJ8H 5IYDH 2LSSA 2A6EC 2A69C 1BBXC 3JC66 2F52A 2RSNA 1FL0A 1QILA 2JA5B 2RQXA 2NBFA 2EY5A 1VQLA 1F2LA 3DWPA 2EIFA 5EKLA 1S3OA 4LF7L 1NJIC 2DNEA 2KEEA 3OWEB 2JA7H 3E6ZX 3CXCA 2F4VL 1SMYD 4KD4A 1QZGA 3VA7A 1QUQB 4LFAL 2OQKA 4DV5Q 1V8QA 2KEDA 3Q0AA 3RNUA 3GTGH 3OPOA 5EJWA 4C3IB 3HG9A 4XT1B 3PMFA 1CQFA 4DR5Q 5E4WC 1RDPD 1G6ZA 4H13C 1E22A 3HOZG 1U4RA 4TRDA 2B29A 3PGZA 3EVQA 5JJZA 2M9VA 2HD3A 3TBIB 1ESRA 2VB3X 4P73A 1EU4A 4DK1A 1AZPA 2EVBA 4J6HA 1EIFA 1JT8A 2PMZE 1SAPA 3D4WA 2O5IC 3GTMB 4C56C 2HIVA 5M3FG 4APVA 3GTOB 4X64L 2K5NA 5EPKA 3W1GA 2D62A 3PF5A 4DR1L 1TWHH 1Q8IA 4OWTB 4NW2A 4CJ0B 3K5LA 4GKKQ 1MGSA 1X3PA 1GXDC 2JA6B 3OMCA 3R93A 1SEBD 1U5KA 1YJNA 1G8ZD 3R2IA 4R1JA 5DAUA 3SK8A 5LL6X 2F0MA 2EYOA 1XNQL 4DAMA 1VQFA 3CPWA 1WTRA 3M4OB 2E2JH 3T1YQ 1EY0A 2JP1A 5C44H 3E9HA 1Q81C 5JAVA 1J6QA 4QL5A 1VQMA 2LKVA 2KBNA 4JI6L 4YCVA 3SK6A 1E7ZA 3LNNA 4XIGS 3EBEA 2D9UA 3SK5A 1PH7A 1WTQA 5J3BA 1ILQA 5GADC 5IT9E 3A0JA 1OTCA 5CGKA 3K81C 3OW7A 1NR4A 4FDBA 4NKLA 4OL7A 2Q2TA 4A3FG 1STNA 4EX5A 1Y1WB 2G9DA 3J80i 3IRBA 4PG3A 4A3KB 3VR3A 2JK8A 4DV6Q 2P5ZX 1KDAA 4DR6L 4B3TL 2E74C 1I6HB 1E24A 2MP1A 3CMEA 1GKHA 3UDIA 4MTNA 4DGZA 4ZQ3A 2R92H 3Q6SA 3DMUA 3CKIB 2O2LD 3M7NA 3CCLA 3HZXA 2EYFA 3FKIB 4CHTB 4Y7NH 3D8GA 1LYLA 4ZK9B 3S2HB 1YIJA 1JJGA 1PFNA 5M5XB 4QIWE 1VF5C 4I65A 1P16A 1IYJB 5FLXL 3H6MA 4IJLA 4JBJA 4TVAB 3BVMA 1M1KC 5IGEA 4OO1G 2UXDL 4IUQA 1HH2P 2EYMA 1VQEA 3U9OA 4A4IA 3DHQA 5M3MG 3S1MB 1HNZQ 1V1PA 1CKOA 3NE5B 1CA5A 3LX0A 1H9KA 2EPBA 1ZXTA 4PMCA 4CKEA 1KXLA 1EWIA 2PQAB 2B2WA 2RSOA 2WAQB 4IPCA 1L0WA 5CV9A 4J15A 4BXXG 5J1ZA 2PQAA 1C48A 1Q1BA 3TRZA 1H95A 1N36L 5IP9H 2JA5G 3PIO3 1D6EC 5M5WB 2F0LA 4LF4L 4L5RC 2IJ0A 4HJ7A 1JJ2A 4XQNA 1SN8A 3KJOA 3EIVA 1DM0B 1OXUA 1I4XA 2A6HC 3IAYA 2BDOA 2A1AA 4POGA 1JOQA 4DA2A 3TZUA 3TP6A 4A93B 3HOWB 3PF4A 5A35A 4JI7Q 1D7QA 3S17H 4K6LA 1B7YB 3GTPH 1D5MC 4RHRA 3GV6A 1Q82C 3NEMA 3DM1A 1KIXA 1PTOD 2K4KA 4C3IG 2Q2IA 1EYCA 1EFID 4X66L 1MI2A 4HJAA 3PV0A 4IPHA 5JPNC 3NPPA 4OO1I 4DR7Q 4LF6Q 4JI1Q 1W6JA 3UI2A 4HJ5A 4QUFA 3FVQA 4IUVA 1B2TA 1OXXK 4B08A 2E2IH 3V96A 1Y1VB 3BYTB 1Q12A 1FJGL 4RFBA 5C3EB 1LT6D 2R7ZB 5D65A 1STYA 4JI5Q 4GLXA 2Z4HA 1SMXA 1TIID 1LTTD 2ATWA 5KNCA 2Z0SA 1C9OA 1FR3A 2EY2A 2PYKA 1HA5A 1PV4A 1PDQA 2Z6BA 5FK9C 5COYA 1TWFH 1YVCA 3AQQA 4MIUA 4EQOA 4R4QA 2L5TA 3TP5A 1JOKA 3WOFA 2JN4A 2F0DA 3OIQA 4A3BH 4ZLTF 3GTJH 2LMCB 1YHQA 4DFAA 5CC4A 4LUVA 2SNMA 4ZCKA 1HNXQ 1OO9B 3QO2A 2MO1A 4P2CB 2RHQB 1FVIA 4X6AH 3CW2C 1HR0Q 1K83H 2J4XA 1G291 4B3SL 5A2QE 1U4PA 4KN7C 4ZUIA 4IALA 3RLFA 2NVQH 4LFAQ 2PNHA 1B3AA 4DN4M 2KQ3A 2A5HA 5TSSA 3NK9A 3VDYA 2XWJB 3GV3A 3J81E 5J22A 1CKMA 2EJMA 1NUCA 4A3JB 4A3MB 3S1NB 2V4DA 4DAPA 1XNRL 4C3JH 3OSOA 5C4JB 1QB5D 2QKIC 2VQEQ 3HOYB 1IBKL 1N34Q 1LTLA 1X9NA 2ES2A 5I2XA 1S5FD 4XDXA 2MUYA 3STBC 5L37A 2B2TA 2WINB 3D6CA 2B2TC 3R2TA 2H4OA 1VQ6A 3J81i 1Z9FA 4LF5L 2VXWA 1B70B 2E8GA 4OHJA 2IWHA 4EVOA 3W1BA 4YWLA 5I9OA 3I55A 4O2DA 3FKIG 4BY1H 3I4NH 3J7ZC 1W2BA 1ZYRD 3HEJA 3VR2A 4GOPA 1R9TB 1AE3A 3J7YW 1DXMA 1MJEA 5GQOA 4B9WA 1EU3A 5IGDA 3FP9A 3E5SA 1XPOA 3I4MB 4KKUA 3TS0A 3BZCA 5JJIA 3QR8A 2NVYB 2RCNA 2OCEA 2EDGA 1I4HA 4DR3L 1AFPA 2B2YC 2BOSA 1DGSA 3CCMA 4BY7B 4JOIA 4DV5L 1HFNA 1BCPB 3RLOA 1A6XA 1HZCA 2EQSA 2XWBB 4KKTA 2IY5B 5EKIA 2NB0A 1BCPC 5EBDA 1SNMA 3RZOH 2E2DC 4JBWA 2M00A 2EJFC 4DR5L 1F9PA 1CK1A 2K5QA 4BBSG 4U673 1JB7A 2RDHA 2R7DA 4POFA 1GUTA 4ALPA 2RF4A 1BR9A 3I4LA 1WTXA 2YYZA 4A93G 3H3VH 3MXGA 4DAYB 3HOUH 3NBHB 3J7AV 1H9JA 1PH8A 3F2BA 2QILA 3BU2A 4DAYA 1GVPA 2PW5A 4L63B 1WD1A 1PHJA 1JB3A 1WCMG 3CAMA 1PA6A 3U50C 2L55A 2Y0SE 2CQOA 4CBVA 2YU9B 3T1YL 1B44D 1C4QA 1MIUA 4KHZA 4BA1I 1IXRA 3CU7A 2MFIA 4HTHA 2Q8IB 1FD7D 3HKZG 4YCUA 1DOMA 3S2DH 3G7LA 4FF3A 4C3HH 1LTGD 4ULLA 5J39A 4R9WA 2F0IA 5KRUA 4GN5A 1X3FA 2AMCB 2WFWA 4N9TA 2X6LA 1FYCA 2GN5A 1S5BD 4O42A 1IYVA 3V05A 1BF4A 1WOCA 4CGYB 4C2MB 3KOJA 3RUZA 1N36Q 3T51B 3HOZB 2L4NA 3U4VA 1A62A 4KY7A 1LTSD 3DWQA 4DK0A 3HOVB 4DV6L 1LACA 2NN6H 3KK7A 1PRTB 2N8NA 1RKNA 5M3FB 1SMYC 3TREA 1PRTC 3FDTA 3GP7A 1AEXA 4OWXB 5IY0A 2EYLA 3FEWX 1STHA 4OXPA 4DV3Q 1HJPA 2I5MX 2JA9A 2YTXA 1SBBB 3NHHA 2FFKB 2L11A 5EPLA 4CDCC 2NZHA 3F1ZA 4TKOB 4A3JG 1K28A 5JPMC 3AB9A 4QUCA 2R7FA 4K2LA 2L1BA 1TWGB 3HOYG 4JI0L 5DNFA 1QG7A 1X3GA 2H5XA 2Q2UA 3M85A 3D4DA 5CBEE 4IUTA 2Q8RE 4QMGA 2VB2X 4R4IA 1SSOA 5K36H 1S4ZA 1G91A 4IO9A 4AQYQ 1E1TA 2BH8A 1A15A 5C0XG 4G7OC 1IBMQ 2AQ3B 3D4RA 5CV4A 2CQAA 3M9BA 2WIIB 3GQBA 1A2UA 2DJGC 3KLRA 5DLQE 1Y1WH 2K52A 1KHIA 3W2DA 4K8IA 4B9XA 4JYAQ 1CT1D 4DV7L 4K6DA 2YV5A 3GD7A 4JI2Q 4A3KH 2EY6A 4A75A 2B8FA 4RAUC 4M8AA 1L2FA 5JJKA 4PV1C 2K5HA 3RZDB 4DK6C 3PUYA 5IWAL 1B50A 1YNND 2UUCQ 1WTWA 4O1NA 1VS0A 1EZ8A 1RTOA 3KF6B 1O80A 2J0TD 4OELB 4J1MA 1LM0A 3QOLA 2RDFA 2R92G 2L12A 1SE4A 2CH4A 2DN8A 4DV1Q 3L0OA 1TVXA 4JI7L 4BY7G 1G2SA 2Q8TA 3S1QB 1GUGA 3LGJA 2AUJD 5ELDA 5D14A 1O7LA 2LS01 4KTAA 2NVTB 3E9IA 2OTLA 1JE4A 4IUPA 3T16A 1XX8A 4A3EG 1IBKQ 2K5VA 3K5NA 3G6JB 4CDEC 4ZKBB 4LF6L 4JI1L 4RA8A 3S1MH 5FO9B 3JAME 3CD6A 4ID6A 4RKLA 2WB1E 4LF5Q 4BBRH 5HGTA 3S1RB 3AEVA 4DPGA 1QWYA 5FLXc 4JI5L 1QVGA 3G48A 4DUZL 3K5OA 1IW7D 2QF7A 4FF1A 2EYJA 3S15H 5IP9G 4JV5Q 1K8AC 1ENCA 5C3XA 1SYDA 5M5WH 1EYDA 2UUBL 3JAMi 5H1SE 2R93H 1HHVA 1OXSC 3U9SA 1TQOA 1FGBD 1A8VA 1U9RA 1IZ6A 1I94Q 2L15A 4V0BA 2IX3A 1E2ZA 1X3EA 4ABNA 1HNXL 3HOWH 3DXJC 2D0PA 1KD1C 1DJRD 1TS2A 2BE5D 4ZYSA 1HR0L 1ONLA 4DR3Q 2O4XA 2DGYA 4IPDA 1I3QB 1K8MA 4KMUC 2QEXA 2CW0D 5C4HA 1RF2D 2FJ2A 4DR2Q 4A3CH 1M8AA 1LTRD 4CDFC 4DAVA 3W5OA 1M90C 2F0KA 5ELBA 1JWMD 5JOBA 1NNXA 3OTOQ 1WTHA 3K7AB 2C9OA 5I9PA 4F8MA 2VQEL 4ZAIA 1LUZA 1N34L 3E3XA 1B9NA 3HOVG 1Y1VH 2A68D 3SXHA 2HCIA 1MJCA 5C3EH 2A8VA 2R7ZH 3MA2B 2L0CA 1PTOB 5IGFA 1ASZA 1CKNB 5BR8Q 1PTOC 2SOBA 2JQOA 2WV6D 3A8KE 1CKNA 2KENA 3KDFA 4G7ZC 3I7FA 2HQLA 3EA6A 1C7YA 1EY5A 2R6GA 3CQZH 4G4KA 1X3QA 3CPFA 1B9MA 2Y0SB 2X6GA 2KCTA 1HR0W 1PXUA 3MZ5A 3ZYYX 4BS9A 1PZID 4NXMQ 2K50A 3VR6A 5FOBB 1WI5A 3MXUA 4Y52H 2F0EA 1OXTA 3N6RA 3J80E 1V43A 2D5DA 3PO2H 5KYLA 1E2WA 1SFOH 5JVG3 4ME3A 2CWPA 1HPCA 4FXKC 4A3MH 3S1NH 2JA8G 1ESFA 5IT9c 1X65A 5ELNA 5LMNQ 4IFDH 3K8AA 1EYGA 1Q86C 5ELFA 3G6EA 1PH6A 1MD2D 1JR0D 1XPRA 3O13A 1CZGA 2ZT9C 2K04A 2HT1A 2VS1A 2E2HB 2PO4A 5FLMH 4HEDA 5IGCA 2K28A 2VZAA 4KY6A 1KABA 4Q5VA 5CV8A 3KFUA 1BCPF 1K9MC 5IYCG 3H15A 1XMOQ 2VUMG 2NWGA 1G51A 1TS5A 1CUKA 1T5EA 1H9SA 4UP7A 4RGMA 1L0YB 1F9SA 2Z6KA 2XN9C 2Z6KC 1XPUA 1NMGA 3OYYA 4GLAC 1BKBA 1BO0A 2DNCA 1R9TH 1EIYB 5ISRA 1JC7A 1TXYA 1EEFD 4GN4B 3RD4A 5IYBG 1FGUA 1GUNA 4UY8C 4JI0Q 1GUOA 3D31A 2ICEC 4P71A 2I46A 1TS4A 4C1NI 4K5XA 4OIKA 3I4MH 1RIPA 1CZWA 5CV5A 1GHKA 1UE6A 2KOLA 2NVYH 3HGBA 1TR5A 1V1PB 1S72A 3GTLB 1CA6A 4K14A 4XXEA 2IX0A 4NXNQ 1N33Q 1YHAA 2F0QA 4NDXA 3P7JA 5IP7G 1ZKOA 1B53A 2BDNA 3HKSA 1RD9D 1K3RA 3D3RA 1N32Q 4KY5A 3S16B 5KNBA 2B2WC 2IPKD 4HJ8A 4DV7Q 1SDFA 1ET9A 2K5DA 1AN8A 4HN7A 3PUVA 1I4RA 1HUNA 2EY1A 1VQAA 3ERSX 3K0YA 5IWAQ 4BBSB 2F03A 4R4OA 1L1OB 4L5SA 5FO7B 3GTQH 2UXCQ 3M3YB 1DD2A 1D2BA 1L1OA 1L1OC 4L6TB 3HOUG 1Y8PB 1QVCA 1TWCB 1YEZA 3P75A 1STAA 2R3ZA 4DV3L 1D5ZC 1Q90A 3BVZA 2XGTA 2RCFA 1XJVA 3W3AA 2MJ8A 1WCMB 1X32A 1C0AA 1KL9A 1PRTF 4X65Q 3WWVA 3ULJA 1K8OA 1CSQA 3P20A 3ITPA 1HZBA 1RJTA 2HHHQ 2YU9H 1W6KA 2JE6I 1S5CD 3A56A 4OGQC 3I8ZA 1ICFB 2JA7B 1II3A 3NQTA 2N88A 4C3HG 5C4XH 1A63A 2F4IA 5BN5A 3HOXG 3HKZB 1VCIA 3K80C 1SXTA 3M4YA 1F9QA 3OOCA 4AQYL 4EQPA 5K5PA 1IBML 3GTGB 4DUZQ 3I56A 4K5WA 1V1QA 3PUZA 3MFYA 1SRUA 3HP3A 3KUPA 5C5MA 1A0IA 2Z9HA 3T13A 4JYAL 1GUWA 3HOZH 1FNUA 4UP8A 1A3VA 1P8LA 4RGOS 4JI2L 5CR3A 5BN3A 2DUDA 4IN3A 2UUBQ 4K5VA 2Y0SG 1OXVA 2Z8LA 4DK3C 4QCLA 3ER0A 4XYOA 1PYBA 3R8BA 5IT9L 2UUCL 5M3FH 2AQ2B 3H3VI 3MWYW 1PH3A 3CHBD 2H1EA 3H0GH 2UUAQ 3MEHA 4A3DH 3VA5A 3MC0B 2JEAI 4AYBE 4DV1L 3NWSA 4A3GG 4RWSC 3V2TA 3DEPA 1VDZA 1V1OA 3ND9A 5KNDA 2F0JA 3KBXA 2K5WA 2PZTA 4CDDC 1JICA 3L7ZC 4A3LG 1HTPA 2GVBA 4K2KA 4P75A 2E2JB 1T9HA 4TSSA 3B6YA 3DLLA 3X3NA 1MKHA 1E0BA 3CCEA 2IL8A 3NTIA 5M5YH 1VQGA 1LTID 4DV4Q 4IPGA 2NVXH 3M4QA 2L9HA 2PMZB 3RMHA 4A3IG 2ZJPA 3MXPA 1MSGA 4R8IA 1F2MA 3SDZA 5C5LA 1CSPA 1PFBA 1U4MA 1MSHA 4GKJL 1YBYA 3PO3G 4A3FH 4RH6A 3L9AX 4GOPB 2B2VA 1GM5A 4JV5L 2V1CC 1LLRD 4JG2A 5IGBA 2QDLA 4TQUS 1PZJD 4GOPC 3EROA 3MXNA 1QNKA 1VQIA 4RMFA 1QE6A 4KLKA 5JJLA 3UDXA 1D1IA 2EE1A 1I94L 2B2UA 5G3LD 1LT5D 2WP8J 4N8FA 2R92B 5KIXA 4KI0A 5FKAC 2MHVA 4HMJA 2RHSB 2B63G 4DNTB 4Y7NB 4RCOA 4DR2L 4U68A 3K0XA 4JOIC 3I73A 3ND8A 5CV6A 3TSSA 2NVTH 1LO5D 3MFGA 3A8IE 2F0PA 1XYIA 4BA2I 2XSCA 3FPUB 3OTOL 3TS2A 1EY4A 4A3EB 3RLNA 3TEHB 4OO1H 4JK1C 3T56B 5M3MH 1F2ZA 1I4QA 1PH1A 4FVMA 1DOKA 2F0NA 4FP5D 3S1RH 2PCFB 1EZ6A 1I50B 1AE2A 5JEAG 4LFBQ 1EQVA 3J7A5 5DEHA 3BDCA 5IYDG 5FJ8G 4Z9CB 2VL6A 4OEMB 1KRSA 5BR8L 4BXXH 5C3WA 3J7AF 3AFPA 5AJ3L 2JA5H 4GZYC 1EIHA 3CRKC 2I5LX 4HIKA 3CC7A 4QIWB 3UE0A 1IL2A 1SLJA 4WJ4A 1PTOF 4HJ9A 4NXML 1KC8C 1SNOA 2I5HA 1QZHA 3F2CA 2JA7G 1I3QH 3FMCA 1K0RA 4UDUC 4EGVA 5ELOA 3S17B 2WB1G 4CKCA 4JI8Q 1IW7C 4A3CG 3U4ZA 2F0SA 3NELA 2F3IA 2D0OA 3SVMA 2BA0A 4NMZA 4C3IH 1A3TA 5LMNL 2LFNA 3K7AH 2LXKA 1DONA 1D5XC 1RL2A 4KK7A 4PMBA 5A2QL 4H7BA 1HQRD 1NSNS 1B1ZA 1QJOA 3GTMH 4BWGB 2E2IB 4XT3B 2G9HD 4GLVB 3J81L 3K57A 3CCSA 4JI4Q 4FXGC 3GTOH 1NMFA 3DM3A 4K0KQ 1STGA 4IOCA 4PQXA 1WTPA 4KN4C 1JE5A 1XMOL 3I70A 2CCZA 3BJUA 1EY7A 2ID0A 4IUNA 3C46A 5DM63 2JA6H 1EY6A 5CV7A 5E4XA 4FYDA 1H9MA 4WJ3M 1WTVA 1Z6HA 1SE3A 1RCVD 1VQCA 2M2LA 4X62Q 4DUYQ 4B3RQ 3SE0A 2DY8A 1TY0A 3M4OH 1VQJA 1B8AA 2A68C 4L8JA 4PZ6A 3SHLA 3BYYB 4YWMA 5C44G 1GOZA 4LJZC 3NTHA 2FMMA 4I7AA 1PH9A 4B3ML 4LFCQ 1EWCA 4GNXB 3AYHB 2AQ1B 2CH4W 2X69A 3TP8A 5LMNW 2I0QA 1AH9A 2O5JC 4NXNL 4GNXA 1N33L 4GNXC 1I6VC 1NBWA 4JI3Q 1VQHA 1QCBD 1XXGA 1EYAA 5CMDA 1B3QA 2JA8B 1N32L 4LUOA 1PFSA 5IE8A 2IHEA 4JBMA 5C4ZA 2D2CC 1RODA 2AKWB 1UEAB 3TN2A 2K6AA 3I2ZA 3H09A 1PVOA 1I6HH 2XNAC 4KV6A 5CBAE 2F3WA 2UXCL 2RDGA 1CM9A 1E3PA 1C8CA 2UU9Q 2NUCA 4QQBX 2WAQE 3A7AB 1LTBD 2VUMB 4LF9Q 1Y8OB 4AYBB 4YY3L 1I5FA 2EXZA 3FKIH 3I4NB 4DNRB 4DV0Q 4G7HC 2ZXOA 1EUJA 3S2HH 1BCPD 5EAYA 2HDLA 2QW7A 5AFWA 5M5XH 3K58A 2NTTA 3CCUA 4LK1C 1Y8NB 1AW7A 1PZKD 2OQ0A 4X65L 1HFGA 1K0SA 1JWUD 4XQQA 2HHHL 1LABA 1ET6A 1IBLL 3DEOA 4O0AA 3GTLH 2DY7A 1NR2A 1FNWA 1EIGA 1K3BC 1GHJA 1O7YA 3EQLC 2Q2HA 3GDEA 1CFMA 2SNSA 2A19A 3A5ZB 3S16H 5IOCA 1BDOA 1JOOA 1UAPA 4LF8Q 1XTDA 4GKJQ 1KTKA 4ZUJA 1VQPA 2EYHA 4UHVA 1VQ8A 4IFDJ 4P72A 1CTMA 1ICWA 1PH4A 4BBSH 5I2YA 1UWVA 4IQZA 1HTLD 2XIWA 3CCQA 1ILPA 2XRSD 3UDGA 3IKJA 1F77A 2F0FA 3J81j 4L5QA 1DCZA 3N52A 1TT2A 3OW2A 3KF8B 1WD0A 1VMCA 2PZUA 1STEA 2ZXPA 2UUAL 4IUUA 4A93H 1KRTA 3CMAA 4ODGA 2KCNA 3KF8A 1TWCH 3HOUB 5C0XJ 1JCKB 3BDLA 1IHZA 4PZ8A 3H3VC 1LV9A 2QA4A 3VYRA 2F0UA 3CCVA 4JC0A 1WCMH 2ZXRA 4EQ5A 1TY2A 2K33A 3BVGA 2ZTDA 1DYQA 3QOJA 2E5LQ 1JORA 3VYUA 1X6OA 3NQIA 4KHPQ 2HQEA 1A3UA 2EOTA 2KJXA 5C4XG 1VQ7A 4HCSA 3H94A 4A76A 1ENFA 1J8IA 1H9RA 1TKWB 4DV4L 3S2DB 3AU7A 1PRTD 4DXFA 4C3HB 2J7ZA 3HOXB 5IGGA 1QUQA 1WFQA 4JPBW 2PPBC 4OX9Q 4YCWA 3RN2A 3MHBA 3CCJA 1EOTA 3KDFB 2NTSA 1EOVA 3L3OC 5AJ3Q 2ASBA 1AP0A 2VW9A 4HIMA 2JYOA 5D3IB 5EQ0A 1TWAB 3RN5A 3A74A 3F2DA 4A3BG 1NTGA 4K8JA 4FO2A 1LT4D 1KNAA 1J5EQ 1SYEA 2PW7A 5E1FA 2LXJA 3AFQA 2WACA 2SEBD 3H0GG 1A2TA 1XMQQ 4A3DG 4HR7B 1SYCA 3J80c 4FXDA 1Q3LA 2KUMA 2ZTCA 2OF1A 1Q8KA 1N9WA 3QWNA 2ALYB 2FINB 4A3GB 2EJGC 1YITA 1F9RA 4F88A 3OHXC 4DV2Q 4A3JH 3GTKB 5KEEA 3QIAA 4RCNA 1EEID 4C3JG 5C4JH 3KLSX 1X54A 2RBMA 2C5CA 2EXDA 3HOYH 1KAWA 3I91A 1BNZA 5CORA 1VQ9A 4KJOA 3TP7A 1JWSD 2HUGA 3PUXA 2VNUD 4YHHQ 3HFZB 1VQDA 3PQIA 2OWOA 1SNCA 1TS3A 4HMIA 1YNJD 3KJPA 1H9SB 2MGSA 4JCVE 5C0XH 4KD3A 4A3IB 2Z1CA 2C35B 3E0JA 4LFBL 3A5UA 1IYUA 4AYBG 4DNIA 3F2UA 2PI2E 4BY1G 3I4NG 3GO5A 4OONA 1QNUA 3PO3B 2VY3A 1S40A 4QF4A 3QB3A 3BDOA 1K8GA 3JAML 1DZ1A 4WRDA 2FHTA 5BN4A 4F87A 1WYDA 4L5TA 1PYSB 2K7VA 1GUSA 2VQFQ 2HCCA 3C2PA 3T1HQ 4OIJA 3ONAB 3I4OA 1SNQA 3S14B 4B3MQ 1JJCB 2HIXA 3D0FA 3NTKA 4P74A 4KHVA 4BY7H 1CHPD 1B4OA 4JI8L 2B63B 2ZM6L 1L0XB 2A6ED 2A69D 3X3MA 1ZYRC 1HCZA 1PH2A 2RKSA 5LMUQ 4A3EH 1BBWA 3L2PA 1D8LA 5DM73 5HURA 4MZ9A 1CHQD 3AMUA 5D3DA 3CF5A 1CQVA 3T4AC 2A73B 1K73C 3CC2A 4PMWA 3IL8A 4HAEA 5I6WA 1I50H 4JI4L 3I90A 4BBRB 1Q46A 1SJHD 1PFMA 4K0KL 3NWTA 3U58A 4RHSA 1VF7A 2F1MA 4JBKA 4KKSA 1EY9A 3LWUA 4YY3Q 4H0LC 5I4DA 3SK4A 1W3SA 1HNWQ 3S15B 3FPPA 1X56A 1PYWD 1SR3A 5LHY1 3HS0C 2BCOA 1O78A 1M4VA 3F8TA 3EJIA 1SYBA 2KA7A 3MEFA 5LL6S 2R93B 4AIMA 4X62L 4DUYL 4B3RL 1YNXA 4QY7A 5GAHC
chains in the Genus database with same CATH topology
3SEBA 2ICIA 2K03A 3T53B 2TMPA 4DXGA 3IFDA 1O7ZA 2PNRC 3QJYA 3Q22A 3LWEA 4ZRZA 2WB1B 1Z47A 1S5DD 3FRPB 3R3OA 1CI3M 1KDCA 4YIJA 3TZDA 2WKDA 2GA4B 4N9PA 3KLSA 3K5MA 3H91A 2AWNA 3J80L 2E75C 1IKMA 2R61A 4UAIA 5EKKA 2NN6G 5KGUA 1ENAA 3I3CA 4HSPA 4LAAA 3KBGA 3HRZC 5CYUA 1TWHB 3BG3A 3D6WA 4ILWA 2NZ1D 3P1HA 1U4LA 3NBIA 5ELCA 4FF2A 3TMEA 2A74C 2F0OA 2I07B 1D1KA 3A54A 2XVSA 3CQZB 2AWOA 4X3SA 2RA4A 5E3FA 4H44C 2E76C 4I7ZC 1SJED 5I6YA 5C44B 4G57A 4XYQA 3C3LA 1SE2A 2OT2A 1UNSA 3PO2B 2PQEA 1I4PA 3EFXD 4LMQD 1SFOB 1BQQT 5K36G 2B39A 2F0HA 4M1UB 1PMRA 4J8QA 1IL8A 1WTOA 5EPJA 1LTAD 3C1EA 1XWEA 3CRLC 2SDFA 1HXYD 2B2VC 4F7XA 1HQMC 2NN6I 5EGTA 2EZVA 2RVLA 4XQJA 3VR5A 2KVMA 3A8JE 2AUKA 2B2UC 3OMGA 5NUCA 2KHSA 1EWHA 2XRQD 4C1NK 4WFN3 1LT3D 1ZEQX 1BXTA 2K05A 1HUMA 1NCVA 3K6OA 1KDBA 3PUWA 2F0VA 5IIFA 1SNDA 2IW3A 4QB4A 1EL0A 2QCPX 1YNNC 4HCEA 3QG1A 2N55A 1RTNA 2B2YA 5JVH3 3OIPA 2A6HD 2K01A 2LY7A 4HSVA 3URYA 1Z7TA 1Q1EA 2TSSA 2MPMA 2KECA 5F2DA 1KNEA 3NXWA 2ENBA 2BA1A 3WDNA 2OXPA 1STBA 4EQNA 5ELEA 1S5ED 3WOEA 3GTQB 3A7LA 1KLGD 3C1FA 3IFTA 1R4PB 2JSOA 3VR4A 2CHBD 3M7GA 3MVVA 3NBHA 4NP5A 4FNFA 1HA6A 4ME5A 4RGNA 2CVRA 3GTPB 2K1BA 1JQYD 2WKCA 4RKBA 1EY8A 1KAAA 5M9OA 1E2VA 1J9OA 4DF7A 3SR1A 2NYZD 1WVLA 3A55A 3Q24A 2EYPA 3NUCA 3MTSA 1F2YA 3NP8A 1UUPA 5C4XB 2BE5C 1PTOH 4R8NA 2CW0C 1SYGA 4FF4A 1NAPA 4PNYA 3VYSA 1VMPA 2HDMA 1R4QB 1KLUD 1TWFB 1ML0D 3ERQA 4XTCS 1GJXA 5T1GA 4E6IA 4A3BB 3GTJB 4CKBA 4KJNA 2QDBA 2F3VA 3K59A 4X3TA 4CJ2C 3H0GB 1PLFA 4A3DB 1SNPA 1XTCD 1K83B 4IURA 5JEAJ 2NVQB 4CJ1B 2JEBI 1DOLA 3BS1A 4X3KA 1T5XD 4IFDG 3DUZA 5C6AA 1HRJA 2PZWA 4Q0FA 4WORA 3VYTA 1IKLA 4ZKCB 4C3JB 2QEJC 3TDQA 1FNVA 1BOSA 3DWAA 4X3UA 1Y69U 1TU2B 2B8GA 4S3SA 5T1IA 5M5YB 2NVXB 5FO8B 1I4GA 2KCCA 4MHEA 4DU9A 1SYFA 3OWFA 4V190 1QOHA 2F0GA 1MBYA 3S9WA 4IZ8A 2FMCA 4A3FB 5G3LF 3I72A 4BY1B 1EQTA 4RGTA 2OEOA 1BUVT 3NSWA 1RHPA 1YNJC 3PIP3 5IODA 2IX1A 3MAQA 2F0TA 4IFDI 4MN3A 2IT1A 2F0WA 3RZOB 2Z4IA 2JXMB 3Q23A 1AZQA 2K32A 5M3MB 5C0XI 5KYIA 3BZDB 5FLXE 1G2TA 5JEAH 5EBCA 4WJWA 2A6EC 2A69C 1BBXC 2RSNA 1QILA 2JA5B 2RQXA 2NBFA 2EY5A 1F2LA 3DWPA 5EKLA 2DNEA 2KEEA 3OWEB 3E6ZX 1SMYD 4KD4A 3VA7A 1V8QA 2KEDA 3Q0AA 3OPOA 5EJWA 4C3IB 3HG9A 4XT1B 3PMFA 1CQFA 5E4WC 1RDPD 1G6ZA 4H13C 1U4RA 4TRDA 3EVQA 5JJZA 2M9VA 3TBIB 1ESRA 2VB3X 1EU4A 4DK1A 1AZPA 2EVBA 4J6HA 3D4WA 1SAPA 3GTMB 2O5IC 4C56C 3GTOB 5EPKA 2D62A 1Q8IA 4NW2A 4CJ0B 3K5LA 1MGSA 1X3PA 1GXDC 2JA6B 3OMCA 3R93A 1SEBD 1G8ZD 3R2IA 5DAUA 3SK8A 5LL6X 2F0MA 2EYOA 1WTRA 3M4OB 1EY0A 2JP1A 5JAVA 2LKVA 3SK6A 3LNNA 4XIGS 2D9UA 3SK5A 1WTQA 1ILQA 5IT9E 5CGKA 3OW7A 1NR4A 4NKLA 4OL7A 1STNA 1Y1WB 2G9DA 4A3KB 3VR3A 1KDAA 2E74C 1I6HB 2MP1A 4DGZA 4ZQ3A 3Q6SA 3DMUA 3CKIB 2O2LD 3M7NA 3HZXA 2EYFA 3FKIB 4CHTB 3D8GA 4ZK9B 3S2HB 1PFNA 5M5XB 1VF5C 4I65A 5FLXL 3H6MA 3BVMA 5IGEA 4OO1G 4IUQA 2EYMA 3U9OA 3DHQA 3S1MB 1V1PA 3NE5B 1CA5A 3LX0A 1H9KA 2EPBA 1ZXTA 4PMCA 4CKEA 2B2WA 2RSOA 2WAQB 5CV9A 5J1ZA 1C48A 1Q1BA 3PIO3 1D6EC 5M5WB 2F0LA 2IJ0A 4XQNA 1DM0B 1OXUA 1I4XA 2A6HC 3IAYA 2BDOA 1JOQA 4DA2A 3TZUA 3TP6A 4A93B 3HOWB 5A35A 4K6LA 1D5MC 4RHRA 3GV6A 3DM1A 1PTOD 4C3IG 1EYCA 1EFID 1MI2A 3PV0A 5JPNC 3NPPA 4OO1I 1W6JA 3UI2A 4QUFA 3FVQA 4IUVA 1B2TA 1OXXK 4B08A 3V96A 1Y1VB 3BYTB 1Q12A 4RFBA 5C3EB 1LT6D 2R7ZB 5D65A 1STYA 2Z4HA 1TIID 1LTTD 5KNCA 1FR3A 2EY2A 2PYKA 1HA5A 1PDQA 5FK9C 5COYA 4MIUA 4EQOA 2L5TA 3TP5A 1JOKA 3WOFA 2F0DA 3OIQA 4ZLTF 2LMCB 4DFAA 5CC4A 2SNMA 1OO9B 3QO2A 4P2CB 2J4XA 1G291 5A2QE 1U4PA 4KN7C 4ZUIA 4IALA 3RLFA 1B3AA 4DN4M 2KQ3A 2A5HA 5TSSA 3NK9A 2XWJB 3GV3A 3J81E 5J22A 2EJMA 1NUCA 4A3JB 4A3MB 3S1NB 2V4DA 4DAPA 3OSOA 5C4JB 1QB5D 2QKIC 3HOYB 5I2XA 1S5FD 4XDXA 2MUYA 2B2TA 2WINB 3D6CA 2B2TC 3R2TA 2H4OA 2VXWA 4OHJA 2IWHA 4EVOA 5I9OA 1ZYRD 3HEJA 3VR2A 1R9TB 3J7YW 1DXMA 4B9WA 1EU3A 5IGDA 3E5SA 3I4MB 4KKUA 2NVYB 2EDGA 1I4HA 1AFPA 2B2YC 2BOSA 4BY7B 1HFNA 1BCPB 1A6XA 2XWBB 4KKTA 5EKIA 2NB0A 1BCPC 5EBDA 1SNMA 2E2DC 4JBWA 2M00A 2EJFC 1F9PA 1CK1A 2K5QA 4U673 2RDHA 1GUTA 1BR9A 3I4LA 1WTXA 2YYZA 3MXGA 3J7AV 1H9JA 2QILA 4DAYA 2PW5A 4L63B 1WD1A 1JB3A 2L55A 4CBVA 2YU9B 1B44D 1C4QA 4KHZA 4BA1I 3CU7A 4HTHA 2Q8IB 1FD7D 1DOMA 3G7LA 4FF3A 1LTGD 4ULLA 5J39A 4R9WA 2F0IA 5KRUA 4N9TA 2X6LA 1FYCA 1S5BD 4O42A 1IYVA 3V05A 1BF4A 4CGYB 4C2MB 3RUZA 3T51B 3HOZB 2L4NA 4KY7A 1LTSD 3DWQA 4DK0A 3HOVB 1LACA 2NN6H 3KK7A 1PRTB 1RKNA 5M3FB 1SMYC 1PRTC 3FDTA 3GP7A 1AEXA 2EYLA 3FEWX 1STHA 1SBBB 3NHHA 2FFKB 2L11A 5EPLA 4TKOB 5JPMC 3AB9A 4QUCA 4K2LA 2L1BA 1TWGB 5DNFA 1QG7A 3M85A 3D4DA 5CBEE 4IUTA 2Q8RE 4QMGA 2VB2X 1SSOA 5K36H 1S4ZA 1G91A 5C0XG 1A15A 4G7OC 2AQ3B 3D4RA 5CV4A 2CQAA 2WIIB 3GQBA 1A2UA 3KLRA 3W2DA 4K8IA 4B9XA 1CT1D 4K6DA 3GD7A 2EY6A 2B8FA 4RAUC 4M8AA 4PV1C 3RZDB 3PUYA 1B50A 1YNND 1WTWA 4O1NA 1EZ8A 1RTOA 1O80A 2J0TD 4J1MA 3QOLA 2RDFA 2L12A 1SE4A 2DN8A 1TVXA 1G2SA 2Q8TA 3S1QB 1GUGA 2AUJD 5ELDA 5D14A 1O7LA 2LS01 4KTAA 2NVTB 1JE4A 4IUPA 3T16A 1XX8A 3K5NA 3G6JB 4ZKBB 4RA8A 5FO9B 3JAME 4ID6A 4RKLA 5HGTA 3S1RB 1QWYA 3K5OA 1IW7D 2QF7A 4FF1A 2EYJA 1ENCA 5C3XA 1SYDA 1EYDA 1HHVA 1OXSC 3U9SA 1TQOA 1FGBD 1U9RA 4V0BA 2IX3A 1E2ZA 4ABNA 3DXJC 1DJRD 1TS2A 2BE5D 4ZYSA 1ONLA 2O4XA 1I3QB 1K8MA 4KMUC 2CW0D 5C4HA 1RF2D 2FJ2A 1M8AA 1LTRD 4DAVA 2F0KA 5ELBA 1JWMD 5JOBA 3K7AB 2C9OA 5I9PA 4F8MA 4ZAIA 1B9NA 2A68D 3SXHA 2HCIA 3MA2B 2L0CA 1PTOB 5IGFA 1PTOC 2SOBA 2WV6D 3A8KE 4G7ZC 3EA6A 1EY5A 2R6GA 4G4KA 1X3QA 1B9MA 2Y0SB 2X6GA 1PXUA 3MZ5A 3ZYYX 4BS9A 1PZID 3VR6A 5FOBB 3MXUA 2F0EA 1OXTA 3N6RA 3J80E 1V43A 2D5DA 5KYLA 1E2WA 5JVG3 1HPCA 4FXKC 1ESFA 4IFDH 5ELFA 1MD2D 1JR0D 3O13A 1CZGA 2ZT9C 2K04A 2E2HB 2PO4A 4HEDA 5IGCA 2K28A 4KY6A 1KABA 4Q5VA 5CV8A 1BCPF 2NWGA 1TS5A 1T5EA 1H9SA 4RGMA 1L0YB 1F9SA 2XN9C 2DNCA 1BO0A 5ISRA 1JC7A 1EEFD 3RD4A 1GUNA 1GUOA 3D31A 2ICEC 2I46A 1TS4A 4C1NI 4K5XA 4OIKA 1CZWA 5CV5A 1GHKA 2KOLA 3HGBA 1TR5A 1V1PB 3GTLB 1CA6A 4K14A 4XXEA 2IX0A 2F0QA 4NDXA 3P7JA 1ZKOA 1B53A 2BDNA 1RD9D 3D3RA 4KY5A 3S16B 5KNBA 2B2WC 2IPKD 1SDFA 1ET9A 2K5DA 1AN8A 4HN7A 3PUVA 1I4RA 1HUNA 2EY1A 3K0YA 4BBSB 2F03A 5FO7B 3M3YB 1DD2A 1D2BA 4L6TB 1Y8PB 1TWCB 3P75A 1STAA 2R3ZA 1D5ZC 1Q90A 3BVZA 2MJ8A 3W3AA 1WCMB 1X32A 1PRTF 1K8OA 3P20A 3ITPA 1RJTA 1W6KA 2JE6I 1S5CD 3A56A 4OGQC 3I8ZA 2JA7B 1II3A 3NQTA 2N88A 4C3HG 2F4IA 5BN5A 3HKZB 1VCIA 1SXTA 3M4YA 1F9QA 3OOCA 4EQPA 5K5PA 3GTGB 4K5WA 3PUZA 3MFYA 3HP3A 3KUPA 5C5MA 3T13A 1GUWA 1FNUA 1A3VA 4RGOS 5CR3A 5BN3A 4IN3A 4K5VA 1OXVA 2Z8LA 4QCLA 4XYOA 3R8BA 5IT9L 2AQ2B 3MWYW 3CHBD 2H1EA 3MEHA 3VA5A 3MC0B 2JEAI 3NWSA 4RWSC 3V2TA 3DEPA 1VDZA 1V1OA 3ND9A 5KNDA 2F0JA 3KBXA 2K5WA 2PZTA 1JICA 3L7ZC 1HTPA 4K2KA 2E2JB 4TSSA 3X3NA 1E0BA 2IL8A 3NTIA 1LTID 2L9HA 2PMZB 3RMHA 3MXPA 1MSGA 4R8IA 1F2MA 3SDZA 5C5LA 1PFBA 1U4MA 1MSHA 4RH6A 3L9AX 2B2VA 1LLRD 5IGBA 4TQUS 1PZJD 3EROA 3MXNA 1QNKA 1QE6A 1D1IA 2EE1A 2B2UA 5G3LD 1LT5D 2WP8J 2R92B 5KIXA 4KI0A 5FKAC 2MHVA 4HMJA 4DNTB 4Y7NB 4RCOA 4U68A 3I73A 3ND8A 5CV6A 3TSSA 1LO5D 3MFGA 3A8IE 2F0PA 1XYIA 4BA2I 2XSCA 3FPUB 1EY4A 4A3EB 4OO1H 4JK1C 3T56B 1F2ZA 1I4QA 4FVMA 1DOKA 2F0NA 4FP5D 2PCFB 1EZ6A 1I50B 5JEAG 1EQVA 5DEHA 3BDCA 4Z9CB 5C3WA 3J7AF 4GZYC 1EIHA 3CRKC 4QIWB 1PTOF 1SNOA 3FMCA 4UDUC 4EGVA 3S17B 4CKCA 1IW7C 2F0SA 3SVMA 2BA0A 4NMZA 1A3TA 2LFNA 1DONA 1D5XC 4KK7A 4PMBA 5A2QL 4H7BA 1HQRD 1NSNS 1B1ZA 1QJOA 4BWGB 2E2IB 4XT3B 2G9HD 3J81L 3K57A 4FXGC 1STGA 4PQXA 1WTPA 4KN4C 3I70A 1EY7A 2ID0A 4IUNA 3C46A 5DM63 1EY6A 5CV7A 5E4XA 4FYDA 1H9MA 1WTVA 1Z6HA 1SE3A 1RCVD 2M2LA 3SE0A 2DY8A 1TY0A 2A68C 4L8JA 3SHLA 3BYYB 1GOZA 4LJZC 3NTHA 2FMMA 1EWCA 2AQ1B 2X69A 3TP8A 2O5JC 1I6VC 1QCBD 1XXGA 1EYAA 5CMDA 2JA8B 5C4ZA 2D2CC 1RODA 1UEAB 3TN2A 2K6AA 3H09A 2XNAC 4KV6A 5CBAE 2F3WA 2RDGA 1CM9A 1C8CA 2NUCA 3A7AB 1LTBD 2VUMB 1Y8OB 4AYBB 2EXZA 3I4NB 4DNRB 4G7HC 2ZXOA 1BCPD 2HDLA 5AFWA 3K58A 2NTTA 4LK1C 1Y8NB 1AW7A 1PZKD 1HFGA 1JWUD 4XQQA 1ET6A 1LABA 3DEOA 2DY7A 1NR2A 1FNWA 1EIGA 1GHJA 1O7YA 3EQLC 1CFMA 2SNSA 5IOCA 1BDOA 1JOOA 1UAPA 1KTKA 4ZUJA 2EYHA 4IFDJ 1CTMA 1ICWA 5I2YA 4IQZA 1HTLD 2XIWA 1ILPA 2XRSD 3IKJA 1F77A 2F0FA 1DCZA 3N52A 1TT2A 1WD0A 1VMCA 2PZUA 1STEA 2ZXPA 4IUUA 4ODGA 2KCNA 3KF8A 3HOUB 5C0XJ 1JCKB 3BDLA 1IHZA 3H3VC 1LV9A 3VYRA 2F0UA 2ZXRA 1TY2A 2K33A 3BVGA 1DYQA 3QOJA 1JORA 3VYUA 3NQIA 2HQEA 1A3UA 2EOTA 2KJXA 4HCSA 3H94A 1ENFA 1J8IA 1H9RA 1TKWB 3S2DB 3AU7A 1PRTD 4DXFA 4C3HB 2J7ZA 3HOXB 5IGGA 2PPBC 3MHBA 1EOTA 2NTSA 3L3OC 1AP0A 2JYOA 5D3IB 5EQ0A 1TWAB 4K8JA 4FO2A 1LT4D 1KNAA 1SYEA 2PW7A 5E1FA 2WACA 2SEBD 1A2TA 4HR7B 1SYCA 4FXDA 1Q3LA 2KUMA 2OF1A 3QWNA 2FINB 4A3GB 2EJGC 1F9RA 4F88A 3OHXC 3GTKB 5KEEA 3QIAA 4RCNA 1EEID 4C3JG 3KLSX 2RBMA 2C5CA 3I91A 1BNZA 5CORA 4KJOA 3TP7A 1JWSD 2HUGA 3PUXA 2VNUD 1SNCA 1TS3A 4HMIA 1YNJD 1H9SB 2MGSA 5C0XH 4KD3A 4A3IB 2Z1CA 3E0JA 1IYUA 3F2UA 3GO5A 1QNUA 3PO3B 4QF4A 3QB3A 3BDOA 3JAML 1DZ1A 4WRDA 2FHTA 5BN4A 4F87A 2K7VA 1GUSA 2HCCA 3C2PA 4OIJA 3ONAB 1SNQA 3S14B 3NTKA 4KHVA 1CHPD 1B4OA 2B63B 1L0XB 2A6ED 2A69D 3X3MA 1ZYRC 1HCZA 2RKSA 5DM73 5HURA 1CHQD 3AMUA 5D3DA 1CQVA 3T4AC 2A73B 4PMWA 5I6WA 3IL8A 4HAEA 3I90A 4BBRB 1SJHD 1PFMA 3NWTA 4RHSA 1VF7A 2F1MA 4KKSA 1EY9A 3LWUA 4H0LC 5I4DA 3SK4A 3S15B 3FPPA 1PYWD 5LHY1 3HS0C 2BCOA 1O78A 1M4VA 3EJIA 1SYBA 2KA7A 5LL6S 2R93B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJO A;  3LX0 A;  1A2U A;  3TP7 A;  3T13 A;  5ISR A;  2KQ3 A;  5IOD A;  3NK9 A;  1A3V A;  4K8I A;  5CR3 A;  4B9X A;  2F0K A;  1EY4 A;  4PMC A;  5J22 A;  4K6D A;  2PW5 A;  5JOB A;  3SHL A;  4K5V A;  2F0T A;  1SNC A;  1NUC A;  5CV9 A;  2EY6 A;  2F0F A;  4R8N A;  5I9P A;  4F8M A;  1TT2 A;  3OSO A;  3OMG A;  4HMI A;  5J1Z A;  5NUC A;  1SYG A;  2KHS A;  2PZU A;  4K5X A;  1F2Z A;  4ZUI A;  3OMC A;  5CV5 A;  4IAL A;  4KD3 A;  2F0N A;  4ODG A;  4PNY A;  3TP8 A;  1EZ6 A;  3SXH A;  1TR5 A;  2F0L A;  5DAU A;  1EZ8 A;  3MEH A;  2F0W A;  1IHZ A;  2EYO A;  2F0M A;  3BDL A;  3R3O A;  4K14 A;  3ERQ A;  3SK8 A;  3VA5 A;  1KDC A;  4YIJ A;  3D6C A;  1KDB A;  4J1M A;  3QOL A;  2RDF A;  4N9P A;  2F0Q A;  1EQV A;  4NDX A;  4HTH A;  5DEH A;  2F0V A;  1EYA A;  1EY0 A;  2F0U A;  3BDC A;  4QF4 A;  5JAV A;  3QB3 A;  3V2T A;  4E6I A;  5IIF A;  5IGF A;  1SND A;  5C3W A;  2LKV A;  1JOQ A;  4KY5 A;  4KJN A;  4QB4 A;  2F0J A;  2F3V A;  2QDB A;  4WRD A;  3SK6 A;  3TP6 A;  5KYI A;  5J39 A;  2F0I A;  3QOJ A;  2SOB A;  5EKK A;  2PZT A;  4EVO A;  5KRU A;  4N9T A;  5C4Z A;  3SK5 A;  1JOR A;  5I9O A;  5KGU A;  1SNP A;  2HQE A;  1ENA A;  4K2K A;  1A3U A;  1EY5 A;  4KTA A;  4LAA A;  5CGK A;  1SNQ A;  2EY1 A;  3RUZ A;  4NKL A;  3HEJ A;  4KV6 A;  4OL7 A;  3T16 A;  1EYC A;  3MZ5 A;  2F3W A;  1SNO A;  1STN A;  3P1H A;  2NUC A;  4KY7 A;  5IGG A;  4KHV A;  5C6A A;  2PZW A;  4WOR A;  3TME A;  2F0E A;  4B9W A;  5IGD A;  3MHB A;  3MXP A;  2F0O A;  2EY5 A;  3E5S A;  5KYL A;  2F0S A;  2EXZ A;  4ID6 A;  1KDA A;  1F2M A;  4RKL A;  5F2D A;  1RKN A;  5EKL A;  3NXW A;  2ENB A;  5C5L A;  2OXP A;  5HGT A;  1STB A;  2RKS A;  3P75 A;  1STA A;  4EQN A;  4NMZ A;  4S3S A;  1AEX A;  5E3F A;  1A3T A;  2EYL A;  1STH A;  4DGZ A;  1STY A;  4ZQ3 A;  5HUR A;  5I6Y A;  3DMU A;  4K8J A;  2EYJ A;  3C1F A;  3NHH A;  4G57 A;  4KD4 A;  1SYE A;  2PW7 A;  4PMB A;  5E1F A;  1ENC A;  5IGB A;  2WAC A;  4H7B A;  4DU9 A;  2PQE A;  3ERO A;  1SYD A;  2PYK A;  2EY2 A;  1A2T A;  3HZX A;  1NSN S;  1SYF A;  2EYF A;  3ITP A;  3OWF A;  3D8G A;  1EYD A;  2F0G A;  5I6W A;  2F0H A;  1SNM A;  3MVV A;  4K2L A;  4MIU A;  4EQO A;  3S9W A;  4NP5 A;  2M00 A;  1SYC A;  4IZ8 A;  3PMF A;  4ME5 A;  1JOK A;  3TP5 A;  5IGC A;  1TQO A;  2F0D A;  2OF1 A;  4I65 A;  1KAB A;  4KY6 A;  1STG A;  1U9R A;  1EY9 A;  2SNS A;  1II3 A;  3NQT A;  4TRD A;  3H6M A;  3SK4 A;  3EVQ A;  5CV8 A;  5KIX A;  5IOC A;  1JOO A;  3D4D A;  4DFA A;  4RKB A;  5C3X A;  1EY7 A;  4HMJ A;  1EY8 A;  2OEO A;  5CC4 A;  2SNM A;  3C1E A;  4QMG A;  5IGE A;  4IUN A;  5KEE A;  4J6H A;  1KAA A;  3EJI A;  2EYM A;  1SYB A;  4EQP A;  2O4X A;  5K5P A;  3U9O A;  5M9O A;  1EY6 A;  5CV7 A;  3D4W A;  3DHQ A;  2RBM A;  2EYH A;  4K5W A;  4ZUJ A;  4DF7 A;  3SR1 A;  4F7X A;  5EGT A;  5C4H A;  5CV6 A;  2EYP A;  3NUC A;  5C5M A;  5CV4 A;  2F0P A;  1F2Y A;  3NP8 A; 
#chains in the Genus database with same CATH topology
 3SEB A;  2ICI A;  4R4T A;  4N8X 1;  1IBL Q;  2K03 A;  3T53 B;  2TMP A;  4DXG A;  3IFD A;  1O7Z A;  2N49 A;  2PNR C;  3QJY A;  3S24 A;  3Q22 A;  3LWE A;  1YJ9 A;  4LFC L;  2N78 A;  3PCO B;  4ZRZ A;  2CKZ B;  1O7I A;  2WB1 B;  1Z47 A;  2ZJQ A;  1S5D D;  4JI3 L;  3FRP B;  3R3O A;  3G71 A;  3PIP A;  1CI3 M;  1KDC A;  4YIJ A;  3TZD A;  2WKD A;  2GA4 B;  4N9P A;  3KLS A;  4C2M H;  1UE5 A;  3K5M A;  3H91 A;  2AWN A;  4MTK A;  1VQO A;  3J80 L;  3K7U C;  2E75 C;  1IKM A;  5GAE C;  2R61 A;  4UAI A;  5EKK A;  3HOV H;  1N8R C;  2NN6 G;  5KGU A;  4DR4 Q;  1ENA A;  3I3C A;  4HSP A;  4LW1 A;  1V9P A;  4LAA A;  3KBG A;  3HRZ C;  1KQS A;  5CYU A;  1TWH B;  3BG3 A;  2UU9 L;  3D6W A;  4ILW A;  2NZ1 D;  3P1H A;  4LF9 L;  2JA6 G;  1U4L A;  3NBI A;  4GS3 A;  5ELC A;  4FF2 A;  3TME A;  2A74 C;  2F0O A;  2I07 B;  1D1K A;  3A54 A;  3J81 c;  2XVS A;  3CQZ B;  2AWO A;  4DV0 L;  1SE8 A;  4X3S A;  2RA4 A;  4AH6 A;  1TWG H;  5E3F A;  3UDF A;  4LF7 Q;  4H44 C;  4IOA A;  2E76 C;  4I7Z C;  1SJE D;  2GVA A;  4UPA A;  5I6Y A;  1HZ9 A;  5C44 B;  4G57 A;  4XYQ A;  1VQ5 A;  1SE2 A;  2OT2 A;  1UNS A;  3C3L A;  3PO2 B;  4RG1 A;  2PQE A;  1I4P A;  2QGQ A;  3EFX D;  4LMQ D;  2F4V Q;  1SFO B;  1HZA A;  1BQQ T;  5K36 G;  2B39 A;  2F0H A;  3E0E A;  4M1U B;  1PMR A;  4J8Q A;  2XTI A;  2G5D A;  2JA8 H;  1IL8 A;  1WTO A;  1GD7 A;  3EN2 A;  1Y1W G;  1EQR A;  4LF8 L;  5HY6 A;  1QVF A;  5EPJ A;  1LTA D;  3C1E A;  1XWE A;  3CRL C;  5HGQ A;  4A3K G;  2SDF A;  1HXY D;  2B2V C;  2YTY A;  3MXN B;  4F7X A;  1HQM C;  3RZD H;  2NN6 I;  2MQH A;  5EGT A;  2EZV A;  2RVL A;  4XQJ A;  3VR5 A;  4X64 Q;  1E1O A;  4DR1 Q;  2UXB L;  5IYC H;  2KVM A;  3A8J E;  2VUM H;  2AUK A;  2B2U C;  3OMG A;  5NUC A;  2KHS A;  3ZJY C;  1EWH A;  3CCR A;  2XRQ D;  4C1N K;  3S1Q H;  4WFN 3;  1LT3 D;  1ZEQ X;  1BXT A;  2K05 A;  3Q8D A;  1HUM A;  1NCV A;  3K6O A;  1KDB A;  1XNQ Q;  5IYB H;  3PUW A;  2DJF C;  2ZJR A;  2F0V A;  2JJQ A;  4NPS A;  5IIF A;  1SND A;  2IW3 A;  4QGU A;  2E5L L;  4QB4 A;  1EL0 A;  2QCP X;  1YNN C;  4KHP L;  4JI6 Q;  2CFM A;  4HCE A;  3QG1 A;  2N55 A;  1RTN A;  2B2Y A;  5JVH 3;  3OIP A;  2A6H D;  2K01 A;  2LY7 A;  4BBR G;  5IP7 H;  1EFW A;  1ASY A;  4HSV A;  2WAQ G;  3URY A;  1YJW A;  4OX9 L;  1VQK A;  1Z7T A;  1Q1E A;  2TSS A;  1VQB A;  2KCM A;  2MPM A;  2KEC A;  2PI2 A;  2ZTE A;  5F2D A;  1KNE A;  4NB3 A;  2YTV A;  2ENB A;  3NXW A;  2BA1 A;  3WDN A;  2OXP A;  4DR6 Q;  1STB A;  4B3T Q;  2R93 G;  4EQN A;  4LWC A;  5ELE A;  1S5E D;  3WOE A;  3GTQ B;  3A7L A;  1KLG D;  3RR5 A;  1J5E L;  3C1F A;  1XMQ L;  3HOW G;  3IFT A;  4JW0 A;  1R4P B;  2JSO A;  1BBU A;  3VR4 A;  3CC4 A;  2CHB D;  4GKK L;  2FXQ A;  3M7G A;  3MVV A;  2KHJ A;  4JVZ A;  2MNA A;  3NBH A;  4NP5 A;  4FNF A;  4HID A;  1HA6 A;  4ME5 A;  2ZM6 Q;  4RGN A;  1BVS A;  2CVR A;  4OWW B;  3GTP B;  2K1B A;  1JQY D;  4DV2 L;  2WKC A;  4RKB A;  4MNO A;  1EY8 A;  4QJF A;  1KAA A;  5M9O A;  2UXD Q;  1E2V A;  1J9O A;  4DF7 A;  1SRO A;  3SR1 A;  2NYZ D;  1WVL A;  3A55 A;  3Q24 A;  2EYP A;  3NUC A;  3MTS A;  1Y1V G;  1F2Y A;  3BZK A;  3NP8 A;  1UUP A;  4YHH L;  5C4X B;  5C3E G;  2R7Z G;  3HOX H;  2BE5 C;  1PTO H;  4R8N A;  2CWA A;  2CW0 C;  1SYG A;  2KHI A;  4FF4 A;  1NAP A;  4PNY A;  3VYS A;  1VMP A;  2HDM A;  1R4Q B;  2AHO B;  1KLU D;  1UE7 A;  1TWF B;  1ML0 D;  3ERQ A;  1TWA H;  4LF4 Q;  4XTC S;  3G4S A;  1GJX A;  5T1G A;  4E6I A;  4R4C A;  4A3B B;  3GTJ B;  4CKB A;  4KJN A;  2QDB A;  2F3V A;  2VQF L;  3K59 A;  3STB D;  4X3T A;  4CJ2 C;  3H0G B;  1PLF A;  3T1H L;  5GAG C;  4A3D B;  1SNP A;  3PIO A;  3PO2 G;  1XTC D;  4LUZ A;  1K83 B;  2IHF A;  4IUR A;  5JEA J;  4A3G H;  1Q7Y C;  2NVQ B;  4CJ1 B;  2JEB I;  1DOL A;  3ULL A;  4A3M G;  3GTK H;  4H02 A;  3BS1 A;  4X66 Q;  4X3K A;  1T5X D;  4IFD G;  3DUZ A;  2K14 A;  5E7N A;  5C6A A;  1HRJ A;  2PZW A;  4Q0F A;  4WOR A;  3VYT A;  1IKL A;  4A3L H;  4ZKC B;  4C3J B;  3FHW A;  2QEJ C;  3TDQ A;  1EQQ A;  1FNV A;  4PZ7 A;  1BOS A;  3DWA A;  4X3U A;  5LMU L;  1Y69 U;  1TU2 B;  2E2H H;  2B8G A;  1VQN A;  4S3S A;  5FLM G;  5T1I A;  5M5Y B;  1Y14 B;  1FJG Q;  1HNZ L;  2NVX B;  5FO8 B;  5GRO A;  1I4G A;  2KCC A;  3NEN A;  3ICE A;  4GN3 B;  4A3I H;  4MHE A;  2OTJ A;  4DU9 A;  3CP0 A;  1SYF A;  3OWF A;  3PSI A;  4V19 0;  1QOH A;  2F0G A;  1MBY A;  3ULP A;  3S9W A;  4LNQ A;  1UEB A;  3KLW A;  4IZ8 A;  3PO3 H;  2FMC A;  4A3F B;  5G3L F;  3I72 A;  1MHW C;  1HNW L;  4BY1 B;  1U0L A;  1EQT A;  1GO3 E;  4RGT A;  2OEO A;  4UP9 A;  1JMC A;  1BUV T;  3NSW A;  1RHP A;  1X55 A;  2B3G A;  3I4M G;  3KF6 A;  1VQ4 A;  3S14 H;  1YI2 A;  4B3S Q;  1YNJ C;  2BH2 A;  3PIP 3;  5IOD A;  2IX1 A;  3MAQ A;  2B63 H;  2F0T A;  3SGI A;  3JAM c;  3KYH C;  4IFD I;  4IJH A;  1PH5 A;  1NY4 A;  4MN3 A;  1XNR Q;  2MO0 A;  4YWK A;  1YZ6 A;  2IT1 A;  2F0W A;  1NE3 A;  3RZO B;  1YHB A;  1UE1 A;  4DR7 L;  2Z4I A;  2JXM B;  3Q23 A;  1AZQ A;  2K32 A;  4DKA C;  4HIO A;  3HKZ E;  3UE1 A;  5M3M B;  5C0X I;  2K75 A;  5KYI A;  2UXB Q;  3BZD B;  3M3Y H;  4DR4 L;  2N3S A;  3TQY A;  1G6P A;  3M4P A;  5FLX E;  2NZO A;  1G2T A;  5JEA H;  1WJJ A;  5EBC A;  4WJW A;  5FJ8 H;  5IYD H;  2LSS A;  2A6E C;  2A69 C;  1BBX C;  3JC6 6;  2F52 A;  2RSN A;  1FL0 A;  1QIL A;  2JA5 B;  2RQX A;  2NBF A;  2EY5 A;  1VQL A;  1F2L A;  3DWP A;  2EIF A;  5EKL A;  1S3O A;  4LF7 L;  1NJI C;  2DNE A;  2KEE A;  3OWE B;  2JA7 H;  3E6Z X;  3CXC A;  2F4V L;  1SMY D;  4KD4 A;  1QZG A;  3VA7 A;  1QUQ B;  4LFA L;  2OQK A;  4DV5 Q;  1V8Q A;  2KED A;  3Q0A A;  3RNU A;  3GTG H;  3OPO A;  5EJW A;  4C3I B;  3HG9 A;  4XT1 B;  3PMF A;  1CQF A;  4DR5 Q;  5E4W C;  1RDP D;  1G6Z A;  4H13 C;  1E22 A;  3HOZ G;  1U4R A;  4TRD A;  2B29 A;  3PGZ A;  3EVQ A;  5JJZ A;  2M9V A;  2HD3 A;  3TBI B;  1ESR A;  2VB3 X;  4P73 A;  1EU4 A;  4DK1 A;  1AZP A;  2EVB A;  4J6H A;  1EIF A;  1JT8 A;  2PMZ E;  1SAP A;  3D4W A;  2O5I C;  3GTM B;  4C56 C;  2HIV A;  5M3F G;  4APV A;  3GTO B;  4X64 L;  2K5N A;  5EPK A;  3W1G A;  2D62 A;  3PF5 A;  4DR1 L;  1TWH H;  1Q8I A;  4OWT B;  4NW2 A;  4CJ0 B;  3K5L A;  4GKK Q;  1MGS A;  1X3P A;  1GXD C;  2JA6 B;  3OMC A;  3R93 A;  1SEB D;  1U5K A;  1YJN A;  1G8Z D;  3R2I A;  4R1J A;  5DAU A;  3SK8 A;  5LL6 X;  2F0M A;  2EYO A;  1XNQ L;  4DAM A;  1VQF A;  3CPW A;  1WTR A;  3M4O B;  2E2J H;  3T1Y Q;  1EY0 A;  2JP1 A;  5C44 H;  3E9H A;  1Q81 C;  5JAV A;  1J6Q A;  4QL5 A;  1VQM A;  2LKV A;  2KBN A;  4JI6 L;  4YCV A;  3SK6 A;  1E7Z A;  3LNN A;  4XIG S;  3EBE A;  2D9U A;  3SK5 A;  1PH7 A;  1WTQ A;  5J3B A;  1ILQ A;  5GAD C;  5IT9 E;  3A0J A;  1OTC A;  5CGK A;  3K81 C;  3OW7 A;  1NR4 A;  4FDB A;  4NKL A;  4OL7 A;  2Q2T A;  4A3F G;  1STN A;  4EX5 A;  1Y1W B;  2G9D A;  3J80 i;  3IRB A;  4PG3 A;  4A3K B;  3VR3 A;  2JK8 A;  4DV6 Q;  2P5Z X;  1KDA A;  4DR6 L;  4B3T L;  2E74 C;  1I6H B;  1E24 A;  2MP1 A;  3CME A;  1GKH A;  3UDI A;  4MTN A;  4DGZ A;  4ZQ3 A;  2R92 H;  3Q6S A;  3DMU A;  3CKI B;  2O2L D;  3M7N A;  3CCL A;  3HZX A;  2EYF A;  3FKI B;  4CHT B;  4Y7N H;  3D8G A;  1LYL A;  4ZK9 B;  3S2H B;  1YIJ A;  1JJG A;  1PFN A;  5M5X B;  4QIW E;  1VF5 C;  4I65 A;  1P16 A;  1IYJ B;  5FLX L;  3H6M A;  4IJL A;  4JBJ A;  4TVA B;  3BVM A;  1M1K C;  5IGE A;  4OO1 G;  2UXD L;  4IUQ A;  1HH2 P;  2EYM A;  1VQE A;  3U9O A;  4A4I A;  3DHQ A;  5M3M G;  3S1M B;  1HNZ Q;  1V1P A;  1CKO A;  3NE5 B;  1CA5 A;  3LX0 A;  1H9K A;  2EPB A;  1ZXT A;  4PMC A;  4CKE A;  1KXL A;  1EWI A;  2PQA B;  2B2W A;  2RSO A;  2WAQ B;  4IPC A;  1L0W A;  5CV9 A;  4J15 A;  4BXX G;  5J1Z A;  2PQA A;  1C48 A;  1Q1B A;  3TRZ A;  1H95 A;  1N36 L;  5IP9 H;  2JA5 G;  3PIO 3;  1D6E C;  5M5W B;  2F0L A;  4LF4 L;  4L5R C;  2IJ0 A;  4HJ7 A;  1JJ2 A;  4XQN A;  1SN8 A;  3KJO A;  3EIV A;  1DM0 B;  1OXU A;  1I4X A;  2A6H C;  3IAY A;  2BDO A;  2A1A A;  4POG A;  1JOQ A;  4DA2 A;  3TZU A;  3TP6 A;  4A93 B;  3HOW B;  3PF4 A;  5A35 A;  4JI7 Q;  1D7Q A;  3S17 H;  4K6L A;  1B7Y B;  3GTP H;  1D5M C;  4RHR A;  3GV6 A;  1Q82 C;  3NEM A;  3DM1 A;  1KIX A;  1PTO D;  2K4K A;  4C3I G;  2Q2I A;  1EYC A;  1EFI D;  4X66 L;  1MI2 A;  4HJA A;  3PV0 A;  4IPH A;  5JPN C;  3NPP A;  4OO1 I;  4DR7 Q;  4LF6 Q;  4JI1 Q;  1W6J A;  3UI2 A;  4HJ5 A;  4QUF A;  3FVQ A;  4IUV A;  1B2T A;  1OXX K;  4B08 A;  2E2I H;  3V96 A;  1Y1V B;  3BYT B;  1Q12 A;  1FJG L;  4RFB A;  5C3E B;  1LT6 D;  2R7Z B;  5D65 A;  1STY A;  4JI5 Q;  4GLX A;  2Z4H A;  1SMX A;  1TII D;  1LTT D;  2ATW A;  5KNC A;  2Z0S A;  1C9O A;  1FR3 A;  2EY2 A;  2PYK A;  1HA5 A;  1PV4 A;  1PDQ A;  2Z6B A;  5FK9 C;  5COY A;  1TWF H;  1YVC A;  3AQQ A;  4MIU A;  4EQO A;  4R4Q A;  2L5T A;  3TP5 A;  1JOK A;  3WOF A;  2JN4 A;  2F0D A;  3OIQ A;  4A3B H;  4ZLT F;  3GTJ H;  2LMC B;  1YHQ A;  4DFA A;  5CC4 A;  4LUV A;  2SNM A;  4ZCK A;  1HNX Q;  1OO9 B;  3QO2 A;  2MO1 A;  4P2C B;  2RHQ B;  1FVI A;  4X6A H;  3CW2 C;  1HR0 Q;  1K83 H;  2J4X A;  1G29 1;  4B3S L;  5A2Q E;  1U4P A;  4KN7 C;  4ZUI A;  4IAL A;  3RLF A;  2NVQ H;  4LFA Q;  2PNH A;  1B3A A;  4DN4 M;  2KQ3 A;  2A5H A;  5TSS A;  3NK9 A;  3VDY A;  2XWJ B;  3GV3 A;  3J81 E;  5J22 A;  1CKM A;  2EJM A;  1NUC A;  4A3J B;  4A3M B;  3S1N B;  2V4D A;  4DAP A;  1XNR L;  4C3J H;  3OSO A;  5C4J B;  1QB5 D;  2QKI C;  2VQE Q;  3HOY B;  1IBK L;  1N34 Q;  1LTL A;  1X9N A;  2ES2 A;  5I2X A;  1S5F D;  4XDX A;  2MUY A;  3STB C;  5L37 A;  2B2T A;  2WIN B;  3D6C A;  2B2T C;  3R2T A;  2H4O A;  1VQ6 A;  3J81 i;  1Z9F A;  4LF5 L;  2VXW A;  1B70 B;  2E8G A;  4OHJ A;  2IWH A;  4EVO A;  3W1B A;  4YWL A;  5I9O A;  3I55 A;  4O2D A;  3FKI G;  4BY1 H;  3I4N H;  3J7Z C;  1W2B A;  1ZYR D;  3HEJ A;  3VR2 A;  4GOP A;  1R9T B;  1AE3 A;  3J7Y W;  1DXM A;  1MJE A;  5GQO A;  4B9W A;  1EU3 A;  5IGD A;  3FP9 A;  3E5S A;  1XPO A;  3I4M B;  4KKU A;  3TS0 A;  3BZC A;  5JJI A;  3QR8 A;  2NVY B;  2RCN A;  2OCE A;  2EDG A;  1I4H A;  4DR3 L;  1AFP A;  2B2Y C;  2BOS A;  1DGS A;  3CCM A;  4BY7 B;  4JOI A;  4DV5 L;  1HFN A;  1BCP B;  3RLO A;  1A6X A;  1HZC A;  2EQS A;  2XWB B;  4KKT A;  2IY5 B;  5EKI A;  2NB0 A;  1BCP C;  5EBD A;  1SNM A;  3RZO H;  2E2D C;  4JBW A;  2M00 A;  2EJF C;  4DR5 L;  1F9P A;  1CK1 A;  2K5Q A;  4BBS G;  4U67 3;  1JB7 A;  2RDH A;  2R7D A;  4POF A;  1GUT A;  4ALP A;  2RF4 A;  1BR9 A;  3I4L A;  1WTX A;  2YYZ A;  4A93 G;  3H3V H;  3MXG A;  4DAY B;  3HOU H;  3NBH B;  3J7A V;  1H9J A;  1PH8 A;  3F2B A;  2QIL A;  3BU2 A;  4DAY A;  1GVP A;  2PW5 A;  4L63 B;  1WD1 A;  1PHJ A;  1JB3 A;  1WCM G;  3CAM A;  1PA6 A;  3U50 C;  2L55 A;  2Y0S E;  2CQO A;  4CBV A;  2YU9 B;  3T1Y L;  1B44 D;  1C4Q A;  1MIU A;  4KHZ A;  4BA1 I;  1IXR A;  3CU7 A;  2MFI A;  4HTH A;  2Q8I B;  1FD7 D;  3HKZ G;  4YCU A;  1DOM A;  3S2D H;  3G7L A;  4FF3 A;  4C3H H;  1LTG D;  4ULL A;  5J39 A;  4R9W A;  2F0I A;  5KRU A;  4GN5 A;  1X3F A;  2AMC B;  2WFW A;  4N9T A;  2X6L A;  1FYC A;  2GN5 A;  1S5B D;  4O42 A;  1IYV A;  3V05 A;  1BF4 A;  1WOC A;  4CGY B;  4C2M B;  3KOJ A;  3RUZ A;  1N36 Q;  3T51 B;  3HOZ B;  2L4N A;  3U4V A;  1A62 A;  4KY7 A;  1LTS D;  3DWQ A;  4DK0 A;  3HOV B;  4DV6 L;  1LAC A;  2NN6 H;  3KK7 A;  1PRT B;  2N8N A;  1RKN A;  5M3F B;  1SMY C;  3TRE A;  1PRT C;  3FDT A;  3GP7 A;  1AEX A;  4OWX B;  5IY0 A;  2EYL A;  3FEW X;  1STH A;  4OXP A;  4DV3 Q;  1HJP A;  2I5M X;  2JA9 A;  2YTX A;  1SBB B;  3NHH A;  2FFK B;  2L11 A;  5EPL A;  4CDC C;  2NZH A;  3F1Z A;  4TKO B;  4A3J G;  1K28 A;  5JPM C;  3AB9 A;  4QUC A;  2R7F A;  4K2L A;  2L1B A;  1TWG B;  3HOY G;  4JI0 L;  5DNF A;  1QG7 A;  1X3G A;  2H5X A;  2Q2U A;  3M85 A;  3D4D A;  5CBE E;  4IUT A;  2Q8R E;  4QMG A;  2VB2 X;  4R4I A;  1SSO A;  5K36 H;  1S4Z A;  1G91 A;  4IO9 A;  4AQY Q;  1E1T A;  2BH8 A;  1A15 A;  5C0X G;  4G7O C;  1IBM Q;  2AQ3 B;  3D4R A;  5CV4 A;  2CQA A;  3M9B A;  2WII B;  3GQB A;  1A2U A;  2DJG C;  3KLR A;  5DLQ E;  1Y1W H;  2K52 A;  1KHI A;  3W2D A;  4K8I A;  4B9X A;  4JYA Q;  1CT1 D;  4DV7 L;  4K6D A;  2YV5 A;  3GD7 A;  4JI2 Q;  4A3K H;  2EY6 A;  4A75 A;  2B8F A;  4RAU C;  4M8A A;  1L2F A;  5JJK A;  4PV1 C;  2K5H A;  3RZD B;  4DK6 C;  3PUY A;  5IWA L;  1B50 A;  1YNN D;  2UUC Q;  1WTW A;  4O1N A;  1VS0 A;  1EZ8 A;  1RTO A;  3KF6 B;  1O80 A;  2J0T D;  4OEL B;  4J1M A;  1LM0 A;  3QOL A;  2RDF A;  2R92 G;  2L12 A;  1SE4 A;  2CH4 A;  2DN8 A;  4DV1 Q;  3L0O A;  1TVX A;  4JI7 L;  4BY7 G;  1G2S A;  2Q8T A;  3S1Q B;  1GUG A;  3LGJ A;  2AUJ D;  5ELD A;  5D14 A;  1O7L A;  2LS0 1;  4KTA A;  2NVT B;  3E9I A;  2OTL A;  1JE4 A;  4IUP A;  3T16 A;  1XX8 A;  4A3E G;  1IBK Q;  2K5V A;  3K5N A;  3G6J B;  4CDE C;  4ZKB B;  4LF6 L;  4JI1 L;  4RA8 A;  3S1M H;  5FO9 B;  3JAM E;  3CD6 A;  4ID6 A;  4RKL A;  2WB1 E;  4LF5 Q;  4BBR H;  5HGT A;  3S1R B;  3AEV A;  4DPG A;  1QWY A;  5FLX c;  4JI5 L;  1QVG A;  3G48 A;  4DUZ L;  3K5O A;  1IW7 D;  2QF7 A;  4FF1 A;  2EYJ A;  3S15 H;  5IP9 G;  4JV5 Q;  1K8A C;  1ENC A;  5C3X A;  1SYD A;  5M5W H;  1EYD A;  2UUB L;  3JAM i;  5H1S E;  2R93 H;  1HHV A;  1OXS C;  3U9S A;  1TQO A;  1FGB D;  1A8V A;  1U9R A;  1IZ6 A;  1I94 Q;  2L15 A;  4V0B A;  2IX3 A;  1E2Z A;  1X3E A;  4ABN A;  1HNX L;  3HOW H;  3DXJ C;  2D0P A;  1KD1 C;  1DJR D;  1TS2 A;  2BE5 D;  4ZYS A;  1HR0 L;  1ONL A;  4DR3 Q;  2O4X A;  2DGY A;  4IPD A;  1I3Q B;  1K8M A;  4KMU C;  2QEX A;  2CW0 D;  5C4H A;  1RF2 D;  2FJ2 A;  4DR2 Q;  4A3C H;  1M8A A;  1LTR D;  4CDF C;  4DAV A;  3W5O A;  1M90 C;  2F0K A;  5ELB A;  1JWM D;  5JOB A;  1NNX A;  3OTO Q;  1WTH A;  3K7A B;  2C9O A;  5I9P A;  4F8M A;  2VQE L;  4ZAI A;  1LUZ A;  1N34 L;  3E3X A;  1B9N A;  3HOV G;  1Y1V H;  2A68 D;  3SXH A;  2HCI A;  1MJC A;  5C3E H;  2A8V A;  2R7Z H;  3MA2 B;  2L0C A;  1PTO B;  5IGF A;  1ASZ A;  1CKN B;  5BR8 Q;  1PTO C;  2SOB A;  2JQO A;  2WV6 D;  3A8K E;  1CKN A;  2KEN A;  3KDF A;  4G7Z C;  3I7F A;  2HQL A;  3EA6 A;  1C7Y A;  1EY5 A;  2R6G A;  3CQZ H;  4G4K A;  1X3Q A;  3CPF A;  1B9M A;  2Y0S B;  2X6G A;  2KCT A;  1HR0 W;  1PXU A;  3MZ5 A;  3ZYY X;  4BS9 A;  1PZI D;  4NXM Q;  2K50 A;  3VR6 A;  5FOB B;  1WI5 A;  3MXU A;  4Y52 H;  2F0E A;  1OXT A;  3N6R A;  3J80 E;  1V43 A;  2D5D A;  3PO2 H;  5KYL A;  1E2W A;  1SFO H;  5JVG 3;  4ME3 A;  2CWP A;  1HPC A;  4FXK C;  4A3M H;  3S1N H;  2JA8 G;  1ESF A;  5IT9 c;  1X65 A;  5ELN A;  5LMN Q;  4IFD H;  3K8A A;  1EYG A;  1Q86 C;  5ELF A;  3G6E A;  1PH6 A;  1MD2 D;  1JR0 D;  1XPR A;  3O13 A;  1CZG A;  2ZT9 C;  2K04 A;  2HT1 A;  2VS1 A;  2E2H B;  2PO4 A;  5FLM H;  4HED A;  5IGC A;  2K28 A;  2VZA A;  4KY6 A;  1KAB A;  4Q5V A;  5CV8 A;  3KFU A;  1BCP F;  1K9M C;  5IYC G;  3H15 A;  1XMO Q;  2VUM G;  2NWG A;  1G51 A;  1TS5 A;  1CUK A;  1T5E A;  1H9S A;  4UP7 A;  4RGM A;  1L0Y B;  1F9S A;  2Z6K A;  2XN9 C;  2Z6K C;  1XPU A;  1NMG A;  3OYY A;  4GLA C;  1BKB A;  1BO0 A;  2DNC A;  1R9T H;  1EIY B;  5ISR A;  1JC7 A;  1TXY A;  1EEF D;  4GN4 B;  3RD4 A;  5IYB G;  1FGU A;  1GUN A;  4UY8 C;  4JI0 Q;  1GUO A;  3D31 A;  2ICE C;  4P71 A;  2I46 A;  1TS4 A;  4C1N I;  4K5X A;  4OIK A;  3I4M H;  1RIP A;  1CZW A;  5CV5 A;  1GHK A;  1UE6 A;  2KOL A;  2NVY H;  3HGB A;  1TR5 A;  1V1P B;  1S72 A;  3GTL B;  1CA6 A;  4K14 A;  4XXE A;  2IX0 A;  4NXN Q;  1N33 Q;  1YHA A;  2F0Q A;  4NDX A;  3P7J A;  5IP7 G;  1ZKO A;  1B53 A;  2BDN A;  3HKS A;  1RD9 D;  1K3R A;  3D3R A;  1N32 Q;  4KY5 A;  3S16 B;  5KNB A;  2B2W C;  2IPK D;  4HJ8 A;  4DV7 Q;  1SDF A;  1ET9 A;  2K5D A;  1AN8 A;  4HN7 A;  3PUV A;  1I4R A;  1HUN A;  2EY1 A;  1VQA A;  3ERS X;  3K0Y A;  5IWA Q;  4BBS B;  2F03 A;  4R4O A;  1L1O B;  4L5S A;  5FO7 B;  3GTQ H;  2UXC Q;  3M3Y B;  1DD2 A;  1D2B A;  1L1O A;  1L1O C;  4L6T B;  3HOU G;  1Y8P B;  1QVC A;  1TWC B;  1YEZ A;  3P75 A;  1STA A;  2R3Z A;  4DV3 L;  1D5Z C;  1Q90 A;  3BVZ A;  2XGT A;  2RCF A;  1XJV A;  3W3A A;  2MJ8 A;  1WCM B;  1X32 A;  1C0A A;  1KL9 A;  1PRT F;  4X65 Q;  3WWV A;  3ULJ A;  1K8O A;  1CSQ A;  3P20 A;  3ITP A;  1HZB A;  1RJT A;  2HHH Q;  2YU9 H;  1W6K A;  2JE6 I;  1S5C D;  3A56 A;  4OGQ C;  3I8Z A;  1ICF B;  2JA7 B;  1II3 A;  3NQT A;  2N88 A;  4C3H G;  5C4X H;  1A63 A;  2F4I A;  5BN5 A;  3HOX G;  3HKZ B;  1VCI A;  3K80 C;  1SXT A;  3M4Y A;  1F9Q A;  3OOC A;  4AQY L;  4EQP A;  5K5P A;  1IBM L;  3GTG B;  4DUZ Q;  3I56 A;  4K5W A;  1V1Q A;  3PUZ A;  3MFY A;  1SRU A;  3HP3 A;  3KUP A;  5C5M A;  1A0I A;  2Z9H A;  3T13 A;  4JYA L;  1GUW A;  3HOZ H;  1FNU A;  4UP8 A;  1A3V A;  1P8L A;  4RGO S;  4JI2 L;  5CR3 A;  5BN3 A;  2DUD A;  4IN3 A;  2UUB Q;  4K5V A;  2Y0S G;  1OXV A;  2Z8L A;  4DK3 C;  4QCL A;  3ER0 A;  4XYO A;  1PYB A;  3R8B A;  5IT9 L;  2UUC L;  5M3F H;  2AQ2 B;  3H3V I;  3MWY W;  1PH3 A;  3CHB D;  2H1E A;  3H0G H;  2UUA Q;  3MEH A;  4A3D H;  3VA5 A;  3MC0 B;  2JEA I;  4AYB E;  4DV1 L;  3NWS A;  4A3G G;  4RWS C;  3V2T A;  3DEP A;  1VDZ A;  1V1O A;  3ND9 A;  5KND A;  2F0J A;  3KBX A;  2K5W A;  2PZT A;  4CDD C;  1JIC A;  3L7Z C;  4A3L G;  1HTP A;  2GVB A;  4K2K A;  4P75 A;  2E2J B;  1T9H A;  4TSS A;  3B6Y A;  3DLL A;  3X3N A;  1MKH A;  1E0B A;  3CCE A;  2IL8 A;  3NTI A;  5M5Y H;  1VQG A;  1LTI D;  4DV4 Q;  4IPG A;  2NVX H;  3M4Q A;  2L9H A;  2PMZ B;  3RMH A;  4A3I G;  2ZJP A;  3MXP A;  1MSG A;  4R8I A;  1F2M A;  3SDZ A;  5C5L A;  1CSP A;  1PFB A;  1U4M A;  1MSH A;  4GKJ L;  1YBY A;  3PO3 G;  4A3F H;  4RH6 A;  3L9A X;  4GOP B;  2B2V A;  1GM5 A;  4JV5 L;  2V1C C;  1LLR D;  4JG2 A;  5IGB A;  2QDL A;  4TQU S;  1PZJ D;  4GOP C;  3ERO A;  3MXN A;  1QNK A;  1VQI A;  4RMF A;  1QE6 A;  4KLK A;  5JJL A;  3UDX A;  1D1I A;  2EE1 A;  1I94 L;  2B2U A;  5G3L D;  1LT5 D;  2WP8 J;  4N8F A;  2R92 B;  5KIX A;  4KI0 A;  5FKA C;  2MHV A;  4HMJ A;  2RHS B;  2B63 G;  4DNT B;  4Y7N B;  4RCO A;  4DR2 L;  4U68 A;  3K0X A;  4JOI C;  3I73 A;  3ND8 A;  5CV6 A;  3TSS A;  2NVT H;  1LO5 D;  3MFG A;  3A8I E;  2F0P A;  1XYI A;  4BA2 I;  2XSC A;  3FPU B;  3OTO L;  3TS2 A;  1EY4 A;  4A3E B;  3RLN A;  3TEH B;  4OO1 H;  4JK1 C;  3T56 B;  5M3M H;  1F2Z A;  1I4Q A;  1PH1 A;  4FVM A;  1DOK A;  2F0N A;  4FP5 D;  3S1R H;  2PCF B;  1EZ6 A;  1I50 B;  1AE2 A;  5JEA G;  4LFB Q;  1EQV A;  3J7A 5;  5DEH A;  3BDC A;  5IYD G;  5FJ8 G;  4Z9C B;  2VL6 A;  4OEM B;  1KRS A;  5BR8 L;  4BXX H;  5C3W A;  3J7A F;  3AFP A;  5AJ3 L;  2JA5 H;  4GZY C;  1EIH A;  3CRK C;  2I5L X;  4HIK A;  3CC7 A;  4QIW B;  3UE0 A;  1IL2 A;  1SLJ A;  4WJ4 A;  1PTO F;  4HJ9 A;  4NXM L;  1KC8 C;  1SNO A;  2I5H A;  1QZH A;  3F2C A;  2JA7 G;  1I3Q H;  3FMC A;  1K0R A;  4UDU C;  4EGV A;  5ELO A;  3S17 B;  2WB1 G;  4CKC A;  4JI8 Q;  1IW7 C;  4A3C G;  3U4Z A;  2F0S A;  3NEL A;  2F3I A;  2D0O A;  3SVM A;  2BA0 A;  4NMZ A;  4C3I H;  1A3T A;  5LMN L;  2LFN A;  3K7A H;  2LXK A;  1DON A;  1D5X C;  1RL2 A;  4KK7 A;  4PMB A;  5A2Q L;  4H7B A;  1HQR D;  1NSN S;  1B1Z A;  1QJO A;  3GTM H;  4BWG B;  2E2I B;  4XT3 B;  2G9H D;  4GLV B;  3J81 L;  3K57 A;  3CCS A;  4JI4 Q;  4FXG C;  3GTO H;  1NMF A;  3DM3 A;  4K0K Q;  1STG A;  4IOC A;  4PQX A;  1WTP A;  4KN4 C;  1JE5 A;  1XMO L;  3I70 A;  2CCZ A;  3BJU A;  1EY7 A;  2ID0 A;  4IUN A;  3C46 A;  5DM6 3;  2JA6 H;  1EY6 A;  5CV7 A;  5E4X A;  4FYD A;  1H9M A;  4WJ3 M;  1WTV A;  1Z6H A;  1SE3 A;  1RCV D;  1VQC A;  2M2L A;  4X62 Q;  4DUY Q;  4B3R Q;  3SE0 A;  2DY8 A;  1TY0 A;  3M4O H;  1VQJ A;  1B8A A;  2A68 C;  4L8J A;  4PZ6 A;  3SHL A;  3BYY B;  4YWM A;  5C44 G;  1GOZ A;  4LJZ C;  3NTH A;  2FMM A;  4I7A A;  1PH9 A;  4B3M L;  4LFC Q;  1EWC A;  4GNX B;  3AYH B;  2AQ1 B;  2CH4 W;  2X69 A;  3TP8 A;  5LMN W;  2I0Q A;  1AH9 A;  2O5J C;  4NXN L;  4GNX A;  1N33 L;  4GNX C;  1I6V C;  1NBW A;  4JI3 Q;  1VQH A;  1QCB D;  1XXG A;  1EYA A;  5CMD A;  1B3Q A;  2JA8 B;  1N32 L;  4LUO A;  1PFS A;  5IE8 A;  2IHE A;  4JBM A;  5C4Z A;  2D2C C;  1ROD A;  2AKW B;  1UEA B;  3TN2 A;  2K6A A;  3I2Z A;  3H09 A;  1PVO A;  1I6H H;  2XNA C;  4KV6 A;  5CBA E;  2F3W A;  2UXC L;  2RDG A;  1CM9 A;  1E3P A;  1C8C A;  2UU9 Q;  2NUC A;  4QQB X;  2WAQ E;  3A7A B;  1LTB D;  2VUM B;  4LF9 Q;  1Y8O B;  4AYB B;  4YY3 L;  1I5F A;  2EXZ A;  3FKI H;  3I4N B;  4DNR B;  4DV0 Q;  4G7H C;  2ZXO A;  1EUJ A;  3S2H H;  1BCP D;  5EAY A;  2HDL A;  2QW7 A;  5AFW A;  5M5X H;  3K58 A;  2NTT A;  3CCU A;  4LK1 C;  1Y8N B;  1AW7 A;  1PZK D;  2OQ0 A;  4X65 L;  1HFG A;  1K0S A;  1JWU D;  4XQQ A;  2HHH L;  1LAB A;  1ET6 A;  1IBL L;  3DEO A;  4O0A A;  3GTL H;  2DY7 A;  1NR2 A;  1FNW A;  1EIG A;  1K3B C;  1GHJ A;  1O7Y A;  3EQL C;  2Q2H A;  3GDE A;  1CFM A;  2SNS A;  2A19 A;  3A5Z B;  3S16 H;  5IOC A;  1BDO A;  1JOO A;  1UAP A;  4LF8 Q;  1XTD A;  4GKJ Q;  1KTK A;  4ZUJ A;  1VQP A;  2EYH A;  4UHV A;  1VQ8 A;  4IFD J;  4P72 A;  1CTM A;  1ICW A;  1PH4 A;  4BBS H;  5I2Y A;  1UWV A;  4IQZ A;  1HTL D;  2XIW A;  3CCQ A;  1ILP A;  2XRS D;  3UDG A;  3IKJ A;  1F77 A;  2F0F A;  3J81 j;  4L5Q A;  1DCZ A;  3N52 A;  1TT2 A;  3OW2 A;  3KF8 B;  1WD0 A;  1VMC A;  2PZU A;  1STE A;  2ZXP A;  2UUA L;  4IUU A;  4A93 H;  1KRT A;  3CMA A;  4ODG A;  2KCN A;  3KF8 A;  1TWC H;  3HOU B;  5C0X J;  1JCK B;  3BDL A;  1IHZ A;  4PZ8 A;  3H3V C;  1LV9 A;  2QA4 A;  3VYR A;  2F0U A;  3CCV A;  4JC0 A;  1WCM H;  2ZXR A;  4EQ5 A;  1TY2 A;  2K33 A;  3BVG A;  2ZTD A;  1DYQ A;  3QOJ A;  2E5L Q;  1JOR A;  3VYU A;  1X6O A;  3NQI A;  4KHP Q;  2HQE A;  1A3U A;  2EOT A;  2KJX A;  5C4X G;  1VQ7 A;  4HCS A;  3H94 A;  4A76 A;  1ENF A;  1J8I A;  1H9R A;  1TKW B;  4DV4 L;  3S2D B;  3AU7 A;  1PRT D;  4DXF A;  4C3H B;  2J7Z A;  3HOX B;  5IGG A;  1QUQ A;  1WFQ A;  4JPB W;  2PPB C;  4OX9 Q;  4YCW A;  3RN2 A;  3MHB A;  3CCJ A;  1EOT A;  3KDF B;  2NTS A;  1EOV A;  3L3O C;  5AJ3 Q;  2ASB A;  1AP0 A;  2VW9 A;  4HIM A;  2JYO A;  5D3I B;  5EQ0 A;  1TWA B;  3RN5 A;  3A74 A;  3F2D A;  4A3B G;  1NTG A;  4K8J A;  4FO2 A;  1LT4 D;  1KNA A;  1J5E Q;  1SYE A;  2PW7 A;  5E1F A;  2LXJ A;  3AFQ A;  2WAC A;  2SEB D;  3H0G G;  1A2T A;  1XMQ Q;  4A3D G;  4HR7 B;  1SYC A;  3J80 c;  4FXD A;  1Q3L A;  2KUM A;  2ZTC A;  2OF1 A;  1Q8K A;  1N9W A;  3QWN A;  2ALY B;  2FIN B;  4A3G B;  2EJG C;  1YIT A;  1F9R A;  4F88 A;  3OHX C;  4DV2 Q;  4A3J H;  3GTK B;  5KEE A;  3QIA A;  4RCN A;  1EEI D;  4C3J G;  5C4J H;  3KLS X;  1X54 A;  2RBM A;  2C5C A;  2EXD A;  3HOY H;  1KAW A;  3I91 A;  1BNZ A;  5COR A;  1VQ9 A;  4KJO A;  3TP7 A;  1JWS D;  2HUG A;  3PUX A;  2VNU D;  4YHH Q;  3HFZ B;  1VQD A;  3PQI A;  2OWO A;  1SNC A;  1TS3 A;  4HMI A;  1YNJ D;  3KJP A;  1H9S B;  2MGS A;  4JCV E;  5C0X H;  4KD3 A;  4A3I B;  2Z1C A;  2C35 B;  3E0J A;  4LFB L;  3A5U A;  1IYU A;  4AYB G;  4DNI A;  3F2U A;  2PI2 E;  4BY1 G;  3I4N G;  3GO5 A;  4OON A;  1QNU A;  3PO3 B;  2VY3 A;  1S40 A;  4QF4 A;  3QB3 A;  3BDO A;  1K8G A;  3JAM L;  1DZ1 A;  4WRD A;  2FHT A;  5BN4 A;  4F87 A;  1WYD A;  4L5T A;  1PYS B;  2K7V A;  1GUS A;  2VQF Q;  2HCC A;  3C2P A;  3T1H Q;  4OIJ A;  3ONA B;  3I4O A;  1SNQ A;  3S14 B;  4B3M Q;  1JJC B;  2HIX A;  3D0F A;  3NTK A;  4P74 A;  4KHV A;  4BY7 H;  1CHP D;  1B4O A;  4JI8 L;  2B63 B;  2ZM6 L;  1L0X B;  2A6E D;  2A69 D;  3X3M A;  1ZYR C;  1HCZ A;  1PH2 A;  2RKS A;  5LMU Q;  4A3E H;  1BBW A;  3L2P A;  1D8L A;  5DM7 3;  5HUR A;  4MZ9 A;  1CHQ D;  3AMU A;  5D3D A;  3CF5 A;  1CQV A;  3T4A C;  2A73 B;  1K73 C;  3CC2 A;  4PMW A;  3IL8 A;  4HAE A;  5I6W A;  1I50 H;  4JI4 L;  3I90 A;  4BBR B;  1Q46 A;  1SJH D;  1PFM A;  4K0K L;  3NWT A;  3U58 A;  4RHS A;  1VF7 A;  2F1M A;  4JBK A;  4KKS A;  1EY9 A;  3LWU A;  4YY3 Q;  4H0L C;  5I4D A;  3SK4 A;  1W3S A;  1HNW Q;  3S15 B;  3FPP A;  1X56 A;  1PYW D;  1SR3 A;  5LHY 1;  3HS0 C;  2BCO A;  1O78 A;  1M4V A;  3F8T A;  3EJI A;  1SYB A;  2KA7 A;  3MEF A;  5LL6 S;  2R93 B;  4AIM A;  4X62 L;  4DUY L;  4B3R L;  1YNX A;  4QY7 A;  5GAH C; 
#chains in the Genus database with same CATH homology
 3SEB A;  2ICI A;  2K03 A;  3T53 B;  2TMP A;  4DXG A;  3IFD A;  1O7Z A;  2PNR C;  3QJY A;  3Q22 A;  3LWE A;  4ZRZ A;  2WB1 B;  1Z47 A;  1S5D D;  3FRP B;  3R3O A;  1CI3 M;  1KDC A;  4YIJ A;  3TZD A;  2WKD A;  2GA4 B;  4N9P A;  3KLS A;  3K5M A;  3H91 A;  2AWN A;  3J80 L;  2E75 C;  1IKM A;  2R61 A;  4UAI A;  5EKK A;  2NN6 G;  5KGU A;  1ENA A;  3I3C A;  4HSP A;  4LAA A;  3KBG A;  3HRZ C;  5CYU A;  1TWH B;  3BG3 A;  3D6W A;  4ILW A;  2NZ1 D;  3P1H A;  1U4L A;  3NBI A;  5ELC A;  4FF2 A;  3TME A;  2A74 C;  2F0O A;  2I07 B;  1D1K A;  3A54 A;  2XVS A;  3CQZ B;  2AWO A;  4X3S A;  2RA4 A;  5E3F A;  4H44 C;  2E76 C;  4I7Z C;  1SJE D;  5I6Y A;  5C44 B;  4G57 A;  4XYQ A;  3C3L A;  1SE2 A;  2OT2 A;  1UNS A;  3PO2 B;  2PQE A;  1I4P A;  3EFX D;  4LMQ D;  1SFO B;  1BQQ T;  5K36 G;  2B39 A;  2F0H A;  4M1U B;  1PMR A;  4J8Q A;  1IL8 A;  1WTO A;  5EPJ A;  1LTA D;  3C1E A;  1XWE A;  3CRL C;  2SDF A;  1HXY D;  2B2V C;  4F7X A;  1HQM C;  2NN6 I;  5EGT A;  2EZV A;  2RVL A;  4XQJ A;  3VR5 A;  2KVM A;  3A8J E;  2AUK A;  2B2U C;  3OMG A;  5NUC A;  2KHS A;  1EWH A;  2XRQ D;  4C1N K;  4WFN 3;  1LT3 D;  1ZEQ X;  1BXT A;  2K05 A;  1HUM A;  1NCV A;  3K6O A;  1KDB A;  3PUW A;  2F0V A;  5IIF A;  1SND A;  2IW3 A;  4QB4 A;  1EL0 A;  2QCP X;  1YNN C;  4HCE A;  3QG1 A;  2N55 A;  1RTN A;  2B2Y A;  5JVH 3;  3OIP A;  2A6H D;  2K01 A;  2LY7 A;  4HSV A;  3URY A;  1Z7T A;  1Q1E A;  2TSS A;  2MPM A;  2KEC A;  5F2D A;  1KNE A;  3NXW A;  2ENB A;  2BA1 A;  3WDN A;  2OXP A;  1STB A;  4EQN A;  5ELE A;  1S5E D;  3WOE A;  3GTQ B;  3A7L A;  1KLG D;  3C1F A;  3IFT A;  1R4P B;  2JSO A;  3VR4 A;  2CHB D;  3M7G A;  3MVV A;  3NBH A;  4NP5 A;  4FNF A;  1HA6 A;  4ME5 A;  4RGN A;  2CVR A;  3GTP B;  2K1B A;  1JQY D;  2WKC A;  4RKB A;  1EY8 A;  1KAA A;  5M9O A;  1E2V A;  1J9O A;  4DF7 A;  3SR1 A;  2NYZ D;  1WVL A;  3A55 A;  3Q24 A;  2EYP A;  3NUC A;  3MTS A;  1F2Y A;  3NP8 A;  1UUP A;  5C4X B;  2BE5 C;  1PTO H;  4R8N A;  2CW0 C;  1SYG A;  4FF4 A;  1NAP A;  4PNY A;  3VYS A;  1VMP A;  2HDM A;  1R4Q B;  1KLU D;  1TWF B;  1ML0 D;  3ERQ A;  4XTC S;  1GJX A;  5T1G A;  4E6I A;  4A3B B;  3GTJ B;  4CKB A;  4KJN A;  2QDB A;  2F3V A;  3K59 A;  4X3T A;  4CJ2 C;  3H0G B;  1PLF A;  4A3D B;  1SNP A;  1XTC D;  1K83 B;  4IUR A;  5JEA J;  2NVQ B;  4CJ1 B;  2JEB I;  1DOL A;  3BS1 A;  4X3K A;  1T5X D;  4IFD G;  3DUZ A;  5C6A A;  1HRJ A;  2PZW A;  4Q0F A;  4WOR A;  3VYT A;  1IKL A;  4ZKC B;  4C3J B;  2QEJ C;  3TDQ A;  1FNV A;  1BOS A;  3DWA A;  4X3U A;  1Y69 U;  1TU2 B;  2B8G A;  4S3S A;  5T1I A;  5M5Y B;  2NVX B;  5FO8 B;  1I4G A;  2KCC A;  4MHE A;  4DU9 A;  1SYF A;  3OWF A;  4V19 0;  1QOH A;  2F0G A;  1MBY A;  3S9W A;  4IZ8 A;  2FMC A;  4A3F B;  5G3L F;  3I72 A;  4BY1 B;  1EQT A;  4RGT A;  2OEO A;  1BUV T;  3NSW A;  1RHP A;  1YNJ C;  3PIP 3;  5IOD A;  2IX1 A;  3MAQ A;  2F0T A;  4IFD I;  4MN3 A;  2IT1 A;  2F0W A;  3RZO B;  2Z4I A;  2JXM B;  3Q23 A;  1AZQ A;  2K32 A;  5M3M B;  5C0X I;  5KYI A;  3BZD B;  5FLX E;  1G2T A;  5JEA H;  5EBC A;  4WJW A;  2A6E C;  2A69 C;  1BBX C;  2RSN A;  1QIL A;  2JA5 B;  2RQX A;  2NBF A;  2EY5 A;  1F2L A;  3DWP A;  5EKL A;  2DNE A;  2KEE A;  3OWE B;  3E6Z X;  1SMY D;  4KD4 A;  3VA7 A;  1V8Q A;  2KED A;  3Q0A A;  3OPO A;  5EJW A;  4C3I B;  3HG9 A;  4XT1 B;  3PMF A;  1CQF A;  5E4W C;  1RDP D;  1G6Z A;  4H13 C;  1U4R A;  4TRD A;  3EVQ A;  5JJZ A;  2M9V A;  3TBI B;  1ESR A;  2VB3 X;  1EU4 A;  4DK1 A;  1AZP A;  2EVB A;  4J6H A;  3D4W A;  1SAP A;  3GTM B;  2O5I C;  4C56 C;  3GTO B;  5EPK A;  2D62 A;  1Q8I A;  4NW2 A;  4CJ0 B;  3K5L A;  1MGS A;  1X3P A;  1GXD C;  2JA6 B;  3OMC A;  3R93 A;  1SEB D;  1G8Z D;  3R2I A;  5DAU A;  3SK8 A;  5LL6 X;  2F0M A;  2EYO A;  1WTR A;  3M4O B;  1EY0 A;  2JP1 A;  5JAV A;  2LKV A;  3SK6 A;  3LNN A;  4XIG S;  2D9U A;  3SK5 A;  1WTQ A;  1ILQ A;  5IT9 E;  5CGK A;  3OW7 A;  1NR4 A;  4NKL A;  4OL7 A;  1STN A;  1Y1W B;  2G9D A;  4A3K B;  3VR3 A;  1KDA A;  2E74 C;  1I6H B;  2MP1 A;  4DGZ A;  4ZQ3 A;  3Q6S A;  3DMU A;  3CKI B;  2O2L D;  3M7N A;  3HZX A;  2EYF A;  3FKI B;  4CHT B;  3D8G A;  4ZK9 B;  3S2H B;  1PFN A;  5M5X B;  1VF5 C;  4I65 A;  5FLX L;  3H6M A;  3BVM A;  5IGE A;  4OO1 G;  4IUQ A;  2EYM A;  3U9O A;  3DHQ A;  3S1M B;  1V1P A;  3NE5 B;  1CA5 A;  3LX0 A;  1H9K A;  2EPB A;  1ZXT A;  4PMC A;  4CKE A;  2B2W A;  2RSO A;  2WAQ B;  5CV9 A;  5J1Z A;  1C48 A;  1Q1B A;  3PIO 3;  1D6E C;  5M5W B;  2F0L A;  2IJ0 A;  4XQN A;  1DM0 B;  1OXU A;  1I4X A;  2A6H C;  3IAY A;  2BDO A;  1JOQ A;  4DA2 A;  3TZU A;  3TP6 A;  4A93 B;  3HOW B;  5A35 A;  4K6L A;  1D5M C;  4RHR A;  3GV6 A;  3DM1 A;  1PTO D;  4C3I G;  1EYC A;  1EFI D;  1MI2 A;  3PV0 A;  5JPN C;  3NPP A;  4OO1 I;  1W6J A;  3UI2 A;  4QUF A;  3FVQ A;  4IUV A;  1B2T A;  1OXX K;  4B08 A;  3V96 A;  1Y1V B;  3BYT B;  1Q12 A;  4RFB A;  5C3E B;  1LT6 D;  2R7Z B;  5D65 A;  1STY A;  2Z4H A;  1TII D;  1LTT D;  5KNC A;  1FR3 A;  2EY2 A;  2PYK A;  1HA5 A;  1PDQ A;  5FK9 C;  5COY A;  4MIU A;  4EQO A;  2L5T A;  3TP5 A;  1JOK A;  3WOF A;  2F0D A;  3OIQ A;  4ZLT F;  2LMC B;  4DFA A;  5CC4 A;  2SNM A;  1OO9 B;  3QO2 A;  4P2C B;  2J4X A;  1G29 1;  5A2Q E;  1U4P A;  4KN7 C;  4ZUI A;  4IAL A;  3RLF A;  1B3A A;  4DN4 M;  2KQ3 A;  2A5H A;  5TSS A;  3NK9 A;  2XWJ B;  3GV3 A;  3J81 E;  5J22 A;  2EJM A;  1NUC A;  4A3J B;  4A3M B;  3S1N B;  2V4D A;  4DAP A;  3OSO A;  5C4J B;  1QB5 D;  2QKI C;  3HOY B;  5I2X A;  1S5F D;  4XDX A;  2MUY A;  2B2T A;  2WIN B;  3D6C A;  2B2T C;  3R2T A;  2H4O A;  2VXW A;  4OHJ A;  2IWH A;  4EVO A;  5I9O A;  1ZYR D;  3HEJ A;  3VR2 A;  1R9T B;  3J7Y W;  1DXM A;  4B9W A;  1EU3 A;  5IGD A;  3E5S A;  3I4M B;  4KKU A;  2NVY B;  2EDG A;  1I4H A;  1AFP A;  2B2Y C;  2BOS A;  4BY7 B;  1HFN A;  1BCP B;  1A6X A;  2XWB B;  4KKT A;  5EKI A;  2NB0 A;  1BCP C;  5EBD A;  1SNM A;  2E2D C;  4JBW A;  2M00 A;  2EJF C;  1F9P A;  1CK1 A;  2K5Q A;  4U67 3;  2RDH A;  1GUT A;  1BR9 A;  3I4L A;  1WTX A;  2YYZ A;  3MXG A;  3J7A V;  1H9J A;  2QIL A;  4DAY A;  2PW5 A;  4L63 B;  1WD1 A;  1JB3 A;  2L55 A;  4CBV A;  2YU9 B;  1B44 D;  1C4Q A;  4KHZ A;  4BA1 I;  3CU7 A;  4HTH A;  2Q8I B;  1FD7 D;  1DOM A;  3G7L A;  4FF3 A;  1LTG D;  4ULL A;  5J39 A;  4R9W A;  2F0I A;  5KRU A;  4N9T A;  2X6L A;  1FYC A;  1S5B D;  4O42 A;  1IYV A;  3V05 A;  1BF4 A;  4CGY B;  4C2M B;  3RUZ A;  3T51 B;  3HOZ B;  2L4N A;  4KY7 A;  1LTS D;  3DWQ A;  4DK0 A;  3HOV B;  1LAC A;  2NN6 H;  3KK7 A;  1PRT B;  1RKN A;  5M3F B;  1SMY C;  1PRT C;  3FDT A;  3GP7 A;  1AEX A;  2EYL A;  3FEW X;  1STH A;  1SBB B;  3NHH A;  2FFK B;  2L11 A;  5EPL A;  4TKO B;  5JPM C;  3AB9 A;  4QUC A;  4K2L A;  2L1B A;  1TWG B;  5DNF A;  1QG7 A;  3M85 A;  3D4D A;  5CBE E;  4IUT A;  2Q8R E;  4QMG A;  2VB2 X;  1SSO A;  5K36 H;  1S4Z A;  1G91 A;  5C0X G;  1A15 A;  4G7O C;  2AQ3 B;  3D4R A;  5CV4 A;  2CQA A;  2WII B;  3GQB A;  1A2U A;  3KLR A;  3W2D A;  4K8I A;  4B9X A;  1CT1 D;  4K6D A;  3GD7 A;  2EY6 A;  2B8F A;  4RAU C;  4M8A A;  4PV1 C;  3RZD B;  3PUY A;  1B50 A;  1YNN D;  1WTW A;  4O1N A;  1EZ8 A;  1RTO A;  1O80 A;  2J0T D;  4J1M A;  3QOL A;  2RDF A;  2L12 A;  1SE4 A;  2DN8 A;  1TVX A;  1G2S A;  2Q8T A;  3S1Q B;  1GUG A;  2AUJ D;  5ELD A;  5D14 A;  1O7L A;  2LS0 1;  4KTA A;  2NVT B;  1JE4 A;  4IUP A;  3T16 A;  1XX8 A;  3K5N A;  3G6J B;  4ZKB B;  4RA8 A;  5FO9 B;  3JAM E;  4ID6 A;  4RKL A;  5HGT A;  3S1R B;  1QWY A;  3K5O A;  1IW7 D;  2QF7 A;  4FF1 A;  2EYJ A;  1ENC A;  5C3X A;  1SYD A;  1EYD A;  1HHV A;  1OXS C;  3U9S A;  1TQO A;  1FGB D;  1U9R A;  4V0B A;  2IX3 A;  1E2Z A;  4ABN A;  3DXJ C;  1DJR D;  1TS2 A;  2BE5 D;  4ZYS A;  1ONL A;  2O4X A;  1I3Q B;  1K8M A;  4KMU C;  2CW0 D;  5C4H A;  1RF2 D;  2FJ2 A;  1M8A A;  1LTR D;  4DAV A;  2F0K A;  5ELB A;  1JWM D;  5JOB A;  3K7A B;  2C9O A;  5I9P A;  4F8M A;  4ZAI A;  1B9N A;  2A68 D;  3SXH A;  2HCI A;  3MA2 B;  2L0C A;  1PTO B;  5IGF A;  1PTO C;  2SOB A;  2WV6 D;  3A8K E;  4G7Z C;  3EA6 A;  1EY5 A;  2R6G A;  4G4K A;  1X3Q A;  1B9M A;  2Y0S B;  2X6G A;  1PXU A;  3MZ5 A;  3ZYY X;  4BS9 A;  1PZI D;  3VR6 A;  5FOB B;  3MXU A;  2F0E A;  1OXT A;  3N6R A;  3J80 E;  1V43 A;  2D5D A;  5KYL A;  1E2W A;  5JVG 3;  1HPC A;  4FXK C;  1ESF A;  4IFD H;  5ELF A;  1MD2 D;  1JR0 D;  3O13 A;  1CZG A;  2ZT9 C;  2K04 A;  2E2H B;  2PO4 A;  4HED A;  5IGC A;  2K28 A;  4KY6 A;  1KAB A;  4Q5V A;  5CV8 A;  1BCP F;  2NWG A;  1TS5 A;  1T5E A;  1H9S A;  4RGM A;  1L0Y B;  1F9S A;  2XN9 C;  2DNC A;  1BO0 A;  5ISR A;  1JC7 A;  1EEF D;  3RD4 A;  1GUN A;  1GUO A;  3D31 A;  2ICE C;  2I46 A;  1TS4 A;  4C1N I;  4K5X A;  4OIK A;  1CZW A;  5CV5 A;  1GHK A;  2KOL A;  3HGB A;  1TR5 A;  1V1P B;  3GTL B;  1CA6 A;  4K14 A;  4XXE A;  2IX0 A;  2F0Q A;  4NDX A;  3P7J A;  1ZKO A;  1B53 A;  2BDN A;  1RD9 D;  3D3R A;  4KY5 A;  3S16 B;  5KNB A;  2B2W C;  2IPK D;  1SDF A;  1ET9 A;  2K5D A;  1AN8 A;  4HN7 A;  3PUV A;  1I4R A;  1HUN A;  2EY1 A;  3K0Y A;  4BBS B;  2F03 A;  5FO7 B;  3M3Y B;  1DD2 A;  1D2B A;  4L6T B;  1Y8P B;  1TWC B;  3P75 A;  1STA A;  2R3Z A;  1D5Z C;  1Q90 A;  3BVZ A;  2MJ8 A;  3W3A A;  1WCM B;  1X32 A;  1PRT F;  1K8O A;  3P20 A;  3ITP A;  1RJT A;  1W6K A;  2JE6 I;  1S5C D;  3A56 A;  4OGQ C;  3I8Z A;  2JA7 B;  1II3 A;  3NQT A;  2N88 A;  4C3H G;  2F4I A;  5BN5 A;  3HKZ B;  1VCI A;  1SXT A;  3M4Y A;  1F9Q A;  3OOC A;  4EQP A;  5K5P A;  3GTG B;  4K5W A;  3PUZ A;  3MFY A;  3HP3 A;  3KUP A;  5C5M A;  3T13 A;  1GUW A;  1FNU A;  1A3V A;  4RGO S;  5CR3 A;  5BN3 A;  4IN3 A;  4K5V A;  1OXV A;  2Z8L A;  4QCL A;  4XYO A;  3R8B A;  5IT9 L;  2AQ2 B;  3MWY W;  3CHB D;  2H1E A;  3MEH A;  3VA5 A;  3MC0 B;  2JEA I;  3NWS A;  4RWS C;  3V2T A;  3DEP A;  1VDZ A;  1V1O A;  3ND9 A;  5KND A;  2F0J A;  3KBX A;  2K5W A;  2PZT A;  1JIC A;  3L7Z C;  1HTP A;  4K2K A;  2E2J B;  4TSS A;  3X3N A;  1E0B A;  2IL8 A;  3NTI A;  1LTI D;  2L9H A;  2PMZ B;  3RMH A;  3MXP A;  1MSG A;  4R8I A;  1F2M A;  3SDZ A;  5C5L A;  1PFB A;  1U4M A;  1MSH A;  4RH6 A;  3L9A X;  2B2V A;  1LLR D;  5IGB A;  4TQU S;  1PZJ D;  3ERO A;  3MXN A;  1QNK A;  1QE6 A;  1D1I A;  2EE1 A;  2B2U A;  5G3L D;  1LT5 D;  2WP8 J;  2R92 B;  5KIX A;  4KI0 A;  5FKA C;  2MHV A;  4HMJ A;  4DNT B;  4Y7N B;  4RCO A;  4U68 A;  3I73 A;  3ND8 A;  5CV6 A;  3TSS A;  1LO5 D;  3MFG A;  3A8I E;  2F0P A;  1XYI A;  4BA2 I;  2XSC A;  3FPU B;  1EY4 A;  4A3E B;  4OO1 H;  4JK1 C;  3T56 B;  1F2Z A;  1I4Q A;  4FVM A;  1DOK A;  2F0N A;  4FP5 D;  2PCF B;  1EZ6 A;  1I50 B;  5JEA G;  1EQV A;  5DEH A;  3BDC A;  4Z9C B;  5C3W A;  3J7A F;  4GZY C;  1EIH A;  3CRK C;  4QIW B;  1PTO F;  1SNO A;  3FMC A;  4UDU C;  4EGV A;  3S17 B;  4CKC A;  1IW7 C;  2F0S A;  3SVM A;  2BA0 A;  4NMZ A;  1A3T A;  2LFN A;  1DON A;  1D5X C;  4KK7 A;  4PMB A;  5A2Q L;  4H7B A;  1HQR D;  1NSN S;  1B1Z A;  1QJO A;  4BWG B;  2E2I B;  4XT3 B;  2G9H D;  3J81 L;  3K57 A;  4FXG C;  1STG A;  4PQX A;  1WTP A;  4KN4 C;  3I70 A;  1EY7 A;  2ID0 A;  4IUN A;  3C46 A;  5DM6 3;  1EY6 A;  5CV7 A;  5E4X A;  4FYD A;  1H9M A;  1WTV A;  1Z6H A;  1SE3 A;  1RCV D;  2M2L A;  3SE0 A;  2DY8 A;  1TY0 A;  2A68 C;  4L8J A;  3SHL A;  3BYY B;  1GOZ A;  4LJZ C;  3NTH A;  2FMM A;  1EWC A;  2AQ1 B;  2X69 A;  3TP8 A;  2O5J C;  1I6V C;  1QCB D;  1XXG A;  1EYA A;  5CMD A;  2JA8 B;  5C4Z A;  2D2C C;  1ROD A;  1UEA B;  3TN2 A;  2K6A A;  3H09 A;  2XNA C;  4KV6 A;  5CBA E;  2F3W A;  2RDG A;  1CM9 A;  1C8C A;  2NUC A;  3A7A B;  1LTB D;  2VUM B;  1Y8O B;  4AYB B;  2EXZ A;  3I4N B;  4DNR B;  4G7H C;  2ZXO A;  1BCP D;  2HDL A;  5AFW A;  3K58 A;  2NTT A;  4LK1 C;  1Y8N B;  1AW7 A;  1PZK D;  1HFG A;  1JWU D;  4XQQ A;  1ET6 A;  1LAB A;  3DEO A;  2DY7 A;  1NR2 A;  1FNW A;  1EIG A;  1GHJ A;  1O7Y A;  3EQL C;  1CFM A;  2SNS A;  5IOC A;  1BDO A;  1JOO A;  1UAP A;  1KTK A;  4ZUJ A;  2EYH A;  4IFD J;  1CTM A;  1ICW A;  5I2Y A;  4IQZ A;  1HTL D;  2XIW A;  1ILP A;  2XRS D;  3IKJ A;  1F77 A;  2F0F A;  1DCZ A;  3N52 A;  1TT2 A;  1WD0 A;  1VMC A;  2PZU A;  1STE A;  2ZXP A;  4IUU A;  4ODG A;  2KCN A;  3KF8 A;  3HOU B;  5C0X J;  1JCK B;  3BDL A;  1IHZ A;  3H3V C;  1LV9 A;  3VYR A;  2F0U A;  2ZXR A;  1TY2 A;  2K33 A;  3BVG A;  1DYQ A;  3QOJ A;  1JOR A;  3VYU A;  3NQI A;  2HQE A;  1A3U A;  2EOT A;  2KJX A;  4HCS A;  3H94 A;  1ENF A;  1J8I A;  1H9R A;  1TKW B;  3S2D B;  3AU7 A;  1PRT D;  4DXF A;  4C3H B;  2J7Z A;  3HOX B;  5IGG A;  2PPB C;  3MHB A;  1EOT A;  2NTS A;  3L3O C;  1AP0 A;  2JYO A;  5D3I B;  5EQ0 A;  1TWA B;  4K8J A;  4FO2 A;  1LT4 D;  1KNA A;  1SYE A;  2PW7 A;  5E1F A;  2WAC A;  2SEB D;  1A2T A;  4HR7 B;  1SYC A;  4FXD A;  1Q3L A;  2KUM A;  2OF1 A;  3QWN A;  2FIN B;  4A3G B;  2EJG C;  1F9R A;  4F88 A;  3OHX C;  3GTK B;  5KEE A;  3QIA A;  4RCN A;  1EEI D;  4C3J G;  3KLS X;  2RBM A;  2C5C A;  3I91 A;  1BNZ A;  5COR A;  4KJO A;  3TP7 A;  1JWS D;  2HUG A;  3PUX A;  2VNU D;  1SNC A;  1TS3 A;  4HMI A;  1YNJ D;  1H9S B;  2MGS A;  5C0X H;  4KD3 A;  4A3I B;  2Z1C A;  3E0J A;  1IYU A;  3F2U A;  3GO5 A;  1QNU A;  3PO3 B;  4QF4 A;  3QB3 A;  3BDO A;  3JAM L;  1DZ1 A;  4WRD A;  2FHT A;  5BN4 A;  4F87 A;  2K7V A;  1GUS A;  2HCC A;  3C2P A;  4OIJ A;  3ONA B;  1SNQ A;  3S14 B;  3NTK A;  4KHV A;  1CHP D;  1B4O A;  2B63 B;  1L0X B;  2A6E D;  2A69 D;  3X3M A;  1ZYR C;  1HCZ A;  2RKS A;  5DM7 3;  5HUR A;  1CHQ D;  3AMU A;  5D3D A;  1CQV A;  3T4A C;  2A73 B;  4PMW A;  5I6W A;  3IL8 A;  4HAE A;  3I90 A;  4BBR B;  1SJH D;  1PFM A;  3NWT A;  4RHS A;  1VF7 A;  2F1M A;  4KKS A;  1EY9 A;  3LWU A;  4H0L C;  5I4D A;  3SK4 A;  3S15 B;  3FPP A;  1PYW D;  5LHY 1;  3HS0 C;  2BCO A;  1O78 A;  1M4V A;  3EJI A;  1SYB A;  2KA7 A;  5LL6 S;  2R93 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...