3SK4A

Crystal structure of staphylococcal nuclease variant delta+phs d21n/v23e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGNTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS D21N/V23E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3sk4A00
2F0SA 3V2TA 5IGEA 1TR5A 5CGKA 2EXZA 5CV8A 3H6MA 4ZUIA 5KEEA 2EYMA 5J22A 3MXPA 4QF4A 5ISRA 2EYPA 4KJOA 4B9WA 5KGUA 1JOQA 4PMCA 5EKKA 1KDAA 3DMUA 2KHSA 1EY8A 4KY5A 1SNMA 2HQEA 3NK9A 3OMCA 3D4DA 4K8IA 5CV9A 3TP6A 5CV7A 5C4HA 3TMEA 1JORA 1ENCA 4HMIA 1EQVA 2F0IA 5F2DA 3RUZA 3R3OA 2F0HA 4H7BA 5C4ZA 3HZXA 2KQ3A 1TQOA 4YIJA 2F0TA 3NQTA 5J1ZA 3SK4A 5CV5A 1SNDA 4F8MA 3SK5A 1EYCA 2SOBA 4ZUJA 1KDCA 1KDBA 1SNCA 5C5LA 3EJIA 5IGFA 1EY5A 3ITPA 4PMBA 1KABA 2F0JA 3SHLA 4HMJA 2F0NA 5NUCA 1A3VA 5C3XA 5EKLA 3E5SA 4ODGA 4HTHA 2F0KA 3NHHA 2PW5A 4K5WA 4EVOA 1A2TA 4WRDA 5CR3A 2F0OA 3OSOA 5DEHA 4KD4A 1IHZA 1KAAA 5E1FA 4E6IA 2RDFA 1EY4A 3QB3A 2RKSA 2F3WA 4NP5A 2PZWA 3D6CA 3DHQA 4NDXA 5CV4A 1STNA 1EZ6A 3OWFA 4QMGA 1U9RA 1JOKA 4R8NA 2O4XA 3VA5A 5IGGA 2SNSA 1A2UA 4J6HA 2ENBA 4PNYA 4WORA 5JAVA 1TT2A 5HURA 4EQNA 3MHBA 2M00A 3T16A 5CV6A 5JOBA 1SYFA 1EZ8A 1STHA 2EYJA 2NUCA 2PQEA 2WACA 5KYIA 4EQPA 2EYHA 1SYEA 3ERQA 5IIFA 2SNMA 4ID6A 1F2YA 1JOOA 2EYOA 2F3VA 2PZTA 4K2KA 2EY1A 3MZ5A 2F0EA 3T13A 3BDLA 3SR1A 4IUNA 5IGBA 5KYLA 1SYGA 4RKBA 3MVVA 5IODA 2F0MA 1SNQA 2F0UA 2F0WA 4KD3A 4F7XA 1II3A 1STGA 2PW7A 4NKLA 4EQOA 4IALA 4KV6A 1EYAA 4G57A 2F0DA 3TP7A 4B9XA 3SK6A 2QDBA 1EY7A 5HGTA 3TP5A 4NMZA 5M9OA 4S3SA 1SYDA 5IGDA 1EY6A 5CC4A 2OXPA 2PZUA 4LAAA 3NXWA 3LX0A 3QOLA 4TRDA 1STAA 3D4WA 2F0PA 5K5PA 2F0VA 5DAUA 4DFAA 4IZ8A 2EY5A 2F0FA 3D8GA 3NP8A 4K5XA 2OEOA 4K2LA 5C6AA 4DGZA 2F0QA 3PMFA 5I9OA 3U9OA 5J39A 3P1HA 4DF7A 3EVQA 4MIUA 4QB4A 1EYDA 1A3TA 5I9PA 4ZQ3A 3EROA 3S9WA 1NSNS 2F0LA 2F0GA 1F2MA 1NUCA 2EYLA 3C1EA 1SYBA 4J1MA 1EY9A 1SNOA 4OL7A 3BDCA 4K5VA 5E3FA 4KY7A 1RKNA 1SNPA 4DU9A 4K6DA 4I65A 4KTAA 1AEXA 4K8JA 2PYKA 4KY6A 3TP8A 5I6YA 5KRUA 2EY2A 5C5MA 4KJNA 5I6WA 5KIXA 5EGTA 3QOJA 3SK8A 1STBA 4N9PA 3NUCA 1STYA 3HEJA 4K14A 5IOCA 4N9TA 1EY0A 2LKVA 3P75A 1ENAA 1F2ZA 2EYFA 3MEHA 3OMGA 4ME5A 3SXHA 3C1FA 1A3UA 2OF1A 4RKLA 4KHVA 1SYCA 2RBMA 5C3WA 5IGCA 2EY6A
chains in the Genus database with same CATH superfamily
2ZT9C 2JA7G 1Q1EA 1E22A 3HOXH 1LACA 1PTOD 1EL0A 2EXZA 4ZUIA 4JOIA 3BYTB 1TS4A 4DV2L 2Z9HA 4IFDH 2DY8A 1KDAA 2ICEC 4GKKQ 4KY5A 3D4DA 2A1AA 4X3UA 3K8AA 3D0FA 4IFDJ 5C3EB 3D4RA 5K36H 3E9IA 2DGYA 1KL9A 4PQXA 4G7ZC 1PLFA 2Z6BA 1QNKA 1UUPA 3ND8A 1KDBA 3SEBA 1OXTA 2NVQH 2A5HA 1Q12A 2Y0SE 2F0NA 3HOXG 3OW2A 3E5SA 1SE4A 2E2HH 2F0KA 1I4XA 4IFDG 2RCFA 4KKTA 3OWEB 1EWCA 3ZJYC 1WD1A 2LMCB 2RKSA 4DV1Q 1U4RA 5G3LD 4CDFC 1LT4D 5CV4A 2B2TC 3I3CA 5K36G 3CPWA 3PUZA 2VZAA 3O13A 1LTLA 2AUJD 3K5LA 1S5FD 3DWQA 3TEHB 1EZ8A 1EIHA 2EYHA 4DK6C 1F2YA 2L9HA 2WB1G 3GTJH 2MHVA 2ZXOA 4JI2Q 2PNHA 4OX9L 1S5DD 4RGTA 3R2TA 2PI2A 1KRTA 2B29A 4KN7C 4DNTB 3T1YQ 3WDNA 5IYCH 1QUQA 1VQAA 4XYOA 1R4PB 5DNFA 3V05A 3FPPA 4A3FB 1IW7C 1CSPA 5J3BA 3HFZB 4C3HH 2DN8A 4XIGS 1L2FA 4MHEA 4TVAB 1GUSA 1PHJA 1EQTA 4LF9Q 1OXVA 2JE6I 1Q1BA 3GTPB 2F52A 3H94A 1HQMC 3RZDH 5JVH3 1X6OA 3E6ZX 3X3NA 4XXEA 3VDYA 1NSNS 3H15A 5IYCG 4X65Q 3S1RH 4GS3A 2LS01 1TWAB 1GOZA 5ELBA 4KY7A 5A2QE 4L5QA 3CMAA 4IJHA 2PYKA 3GTQH 4C3HG 5IY0A 1SE8A 4PG3A 1KLGD 3SDZA 1LV9A 3RMHA 4FO2A 2ZM6Q 3R93A 5C3WA 2ZTDA 4A3BB 1MHWC 3UE0A 2VQFQ 1HNZL 3H6MA 2OCEA 3JC66 1B9MA 3GQBA 2EYPA 4PMCA 2KHSA 1ZYRC 1NCVA 4K8IA 1PH4A 3S1NH 1NJIC 1C7YA 3CXCA 4LK1C 3OHXC 3K58A 5IWAQ 3HKZG 2N88A 2PI2E 3CCQA 1IYUA 4QQBX 1JB3A 1NY4A 3SHLA 1SE3A 1GD7A 1LLRD 2VL6A 1TY0A 1V1PB 2JA5H 1EWIA 2E2IB 4LMQD 2NVYB 1A2TA 5M5XH 3GTGB 4ZCKA 5IYDH 1BCPC 3M4YA 1EEFD 4CKCA 1WOCA 1PH6A 2QEXA 4R9WA 3M9BA 3TQYA 1YJWA 3ULPA 1JC7A 3PQIA 2ALYB 2HQLA 5CYUA 3C46A 2R93B 1SYFA 1BF4A 1B3AA 4DAYB 1HA6A 4RHRA 4CGYB 2JA5G 1SLJA 1XMQQ 5LMNQ 5IYDG 5IODA 1B1ZA 1K8OA 1SNQA 4P75A 1TU2B 5T1IA 2ZJPA 1HRJA 2XN9C 5E4WC 1LABA 1EU3A 3MEFA 2RDHA 2A6HD 2B8FA 1LT3D 1GM5A 4MN3A 4CKBA 1LTID 1PTOF 2RHSB 4GLAC 5BR8L 2EY5A 1M4VA 3I4OA 2OEOA 1K28A 2D9UA 1B7YB 2IL8A 3AFQA 2D62A 1KHIA 4UP7A 2Q8IB 4LFCQ 2QILA 4RA8A 1RIPA 1PA6A 5CBEE 2WP8J 4TKOB 3PCOB 4UY8C 1XX8A 3NELA 2BH2A 1EWHA 3L0OA 3S1QH 1D7QA 4GLVB 3PO2H 4K14A 4U68A 1UNSA 1EY0A 3A56A 3MEHA 3N6RA 5DM73 2O5JC 3KLWA 5G3LF 4DV4L 3G6EA 1ASZA 2HHHQ 1TWGH 1X3GA 4V190 3P20A 2K5WA 2G5DA 2Q2HA 1EIFA 3K0YA 4B3TQ 3TRZA 3RUZA 5C4ZA 1XNQL 4FYDA 5IT9E 3J81j 2F0TA 5J1ZA 3PO2G 1O7YA 1ET6A 1TWHH 4ZUJA 4C2MB 1Y1VB 1K3RA 2RDGA 5IGFA 1CK1A 1Q86C 5JJLA 4HIKA 2L15A 3MTSA 3I56A 2PW5A 1PTOB 2WV6D 5M3MH 4YCWA 1Z7TA 1N34L 4E6IA 4Y7NH 3QB3A 1OXSC 2PZWA 4KI0A 3GTMH 2OQKA 3VR4A 1Q8KA 1B53A 4RFBA 2K5VA 1C9OA 3UI2A 1N36L 2ZTEA 3ERSX 4H44C 1RD9D 2K03A 2EPBA 1HR0W 1JMCA 3K5MA 3TS2A 1V9PA 5E4XA 1EQRA 4JI8Q 3S15H 1L1OC 2L0CA 3KLSA 3KLSX 2JN4A 3T16A 2NUCA 4RAUC 1YHBA 4A3IH 3E0EA 3BJUA 4I7AA 4I7ZC 3JAMc 2EYOA 2PZTA 1HNWL 4QY7A 5M3MG 4NB3A 2UXCQ 3KYHC 1KNAA 4DR3Q 4JV5L 3CCJA 2VY3A 3A7LA 2A19A 1T5XD 5IYBH 4H13C 3G7LA 2HUGA 1CUKA 2XRSD 2XGTA 4H0LC 2F4VQ 1GUTA 5C4JH 2I07B 4YWMA 1QB5D 2OXPA 4KKUA 4TRDA 2N78A 4A3IG 1YHQA 1AE3A 3VYTA 2EJMA 4DR6Q 3S16H 3GV6A 4R1JA 3GTOB 1DD2A 1ZKOA 2FJ2A 2MP1A 1BBXC 4MTNA 4OONA 5IYBG 4R4OA 3I4MH 1SBBB 2B2YC 1KQSA 3EFXD 4JI6L 5I6YA 4FF4A 1AEXA 2JYOA 3L7ZC 2IW3A 1P16A 1WFQA 2I5MX 1TKWB 2XTIA 3P75A 1ENAA 4OHJA 1OO9B 5I2XA 5L37A 4KMUC 4GNXC 2Y0SG 2EY6A 1GUNA 4IUQA 2CW0D 4DR4Q 1HA5A 1N33L 1ML0D 2E76C 2L12A 1F9PA 4KJOA 3I4MG 3CCEA 4IUVA 1PZID 2DJFC 3HOUB 2HQEA 4QIWE 1Y1WB 5H1SE 4A3EG 1XNRL 2BDOA 1PRTC 1HTPA 1S4ZA 2YU9B 3SK5A 4DAYA 4OWWB 2B39A 3S2DB 1N32L 3A8JE 1ZEQX 1Q7YC 1SMXA 3PIP3 3Q6SA 3AQQA 1HZ9A 3I4LA 4GLXA 3CCVA 3UE1A 5IT9c 1SEBD 1U4MA 5CR3A 1SMYC 2F0OA 3OSOA 3EBEA 1KAAA 4IO9A 2OTLA 2F3WA 3D6CA 1WCMB 2QGQA 2WAQG 3F1ZA 1C8CA 1PYSB 3M3YH 1QWYA 2ICIA 1PXUA 1IBLL 3E9HA 3KDFB 2ENBA 1QILA 3QR8A 4CDEC 4B08A 1STHA 2XNAC 3I73A 2ID0A 3A0JA 2K5DA 2Z1CA 1YJ9A 3A7AB 4HCSA 1Q90A 1JJCB 1VQLA 1GXDC 3W1BA 1B70B 3GTLH 1DGSA 2KEDA 4YCUA 4QL5A 1GJXA 3Q24A 5BN3A 3TP7A 1L0XB 1SXTA 1AFPA 2FHTA 1VF5C 4IPHA 3K7AB 3I4NB 5IP7H 5JPMC 2B2VA 1I3QB 4DR2L 3KFUA 3B6YA 1NMFA 1LTRD 3J81E 1JE5A 3QJYA 1EEID 3W1GA 3P1HA 2KCCA 3C2PA 2VUMH 1BQQT 5I9PA 2EIFA 3AB9A 3S9WA 1IL2A 1YNND 2CHBD 1F2MA 1UWVA 1Z9FA 2K28A 4B3SL 1IW7D 4CHTB 3RZOH 1AW7A 2FMMA 2L4NA 4A75A 2H1EA 4DR1L 5EKIA 1VQ7A 5IP7G 3U50C 5EGTA 4PV1C 2XRQD 4GKKL 4O42A 1XPRA 5COYA 4YY3L 2MQHA 1C48A 4UDUC 1T5EA 4ZLTF 2X6GA 3T4AC 4X3SA 1AZQA 2BH8A 1UE5A 2CH4W 2VUMG 2B2UA 5EQ0A 2N8NA 4LF8L 4GOPB 4DXFA 1I94L 2ASBA 5KGUA 3CW2C 5A2QL 5EPLA 2JA6B 3CPFA 1EIYB 2HT1A 2Z0SA 3OOCA 4A3MB 3N52A 1TY2A 3S17B 1SNCA 3HOWB 1UEAB 1KABA 3IKJA 4IFDI 3CAMA 4UPAA 4LFBQ 3CC4A 1S72A 2MUYA 4IURA 4EVOA 1ZYRD 1A6XA 1B3QA 4A3CH 1JCKB 3NTIA 1SFOB 1W6JA 4BBRB 4RCOA 2G9HD 1TVXA 3J80i 4AQYL 1JJ2A 1I5FA 3KF6B 3SGIA 1HNXQ 1NAPA 4XQJA 1XTCD 4DV0Q 3ER0A 1TWCH 1EU4A 3I7FA 3TZDA 2QEJC 1EOVA 4LF9L 1ONLA 3LGJA 4A3CG 3EN2A 1ESRA 4NKLA 5FO7B 4KHPQ 2XVSA 4G57A 4A3KB 4L5SA 3S1MB 1HHVA 3Q0AA 5D14A 5M9OA 4S3SA 1R9TH 3FKIB 4JI7Q 5C44B 2K52A 3J7AF 2AQ2B 1NBWA 3EA6A 4X65L 4LAAA 4BY1B 2DJGC 1HH2P 3D4WA 1X3EA 4HJ8A 5A35A 1Y8PB 3DM1A 1H9KA 2OQ0A 4DGZA 4B3MQ 1PH8A 3CMEA 2KOLA 2F1MA 1A3TA 2ZM6L 3EROA 1EYGA 1CKNB 4DV7L 4J1MA 4LF5Q 1CI3M 3BDCA 2V1CC 4K6DA 1DOKA 3SK8A 4N9PA 4JG2A 4OIKA 1LYLA 2ZXPA 1STEA 4P71A 3ONAB 1YHAA 3UDFA 1BO0A 5J22A 4ULLA 1F9RA 1SR3A 2M2LA 4C3JB 5C0XI 1JORA 3KDFA 2GVAA 3G71A 1K73C 1B2TA 4IPGA 1SNDA 4RG1A 5FO9B 2R7ZB 3DWAA 2E5LL 2JEAI 4A3JB 1EY5A 2VS1A 4YWKA 1K3BC 2A6EC 3HG9A 3IAYA 4HSPA 4KD4A 2A69D 3P7JA 4CBVA 1KD1C 4WJ4A 1S40A 1HCZA 4R4CA 1G51A 1HQRD 2NZ1D 5JJIA 3VYUA 1XMQL 5LMNL 4R8NA 5IT9L 1KAWA 4HJ7A 1YVCA 1J9OA 2QW7A 3I55A 4Z9CB 5CBAE 2NB0A 4LNQA 2K33A 1DCZA 4A3FH 1FNVA 5JEAH 1PH7A 4BS9A 1N8RC 1CQVA 3GTPH 1G6PA 5JEAJ 3BS1A 3A54A 2HDMA 4EQOA 3H3VH 3SK6A 2IT1A 5FOBB 4DR7Q 1KXLA 1SYDA 5GROA 1NNXA 1OXUA 3SE0A 2F0PA 2Q8RE 2F0VA 4QJFA 1ICWA 1XMOL 4A3FG 5JEAG 4GOPA 2QDLA 5J39A 4JI4Q 3EVQA 4MIUA 3K5OA 1JWSD 1YNJC 3M4QA 4GKJL 3C1EA 4B3RL 1EY9A 2HHHL 2K1BA 4DUYQ 4IOCA 1CA5A 2N55A 2K7VA 4X3TA 1IZ6A 3PUWA 1C4QA 5E7NA 3HOXB 3T53B 4DPGA 4ZK9B 4B3TL 1E2WA 1DM0B 3BDOA 4JK1C 1VQMA 2RBMA 3U4VA 1FL0A 4LF4Q 3A5UA 1IYVA 5CV8A 2NTTA 3H3VC 1RF2D 4OIJA 4XTCS 5EKKA 3LNNA 3A55A 1SNMA 1XJVA 1HUNA 4QUCA 1D5ZC 4AH6A 2EOTA 4R8IA 3KF6A 3GTGH 4JYAQ 3TN2A 2WB1B 1QZGA 2E2HB 2WINB 5D3IB 1PDQA 2XIWA 4EQ5A 1CTMA 2CFMA 2D0PA 1IBMQ 2K01A 3NHHA 2R93H 1IBKQ 1LT6D 3OIQA 4DNIA 1RTNA 2PPBC 2A74C 1HXYD 2WKCA 4NP5A 3DM3A 4A3GH 4JI0Q 3M4OH 3HRZC 2YTVA 3FPUB 1HR0Q 1KRSA 2K4KA 2AKWB 4QUFA 4HAEA 3GV3A 2NN6H 1HZCA 2UXDQ 4DV5Q 1BUVT 3HOYH 1CKNA 1B4OA 5I4DA 3K6OA 2R93G 4DV3Q 1NR2A 1PMRA 2JA8H 4M8AA 4A3GG 2VB3X 1S5BD 5HY6A 1OTCA 2C9OA 1A63A 2NN6G 1X65A 4J8QA 1VQGA 4DUZQ 3VR2A 5C6AA 3S1RB 3HOYG 2RVLA 3VR5A 3F2UA 3U4ZA 1I4GA 2K5HA 1TWFB 1CKMA 2JA8G 2EYLA 3CCMA 2J7ZA 4NXNQ 2XWJB 4J15A 3I70A 1VQJA 2ZJQA 1Y8OB 1V1QA 5GAGC 2A68C 2IY5B 2DY7A 5I6WA 3NEMA 4OGQC 2RA4A 5LHY1 4IJLA 3SXHA 4RCNA 3J81L 4ZYSA 1VQNA 1SYCA 3DEOA 2K50A 1GUOA 3PSIA 3S1NB 5EPJA 3HP3A 2VQEQ 4P72A 5KEEA 1QJOA 4C2MH 1Y1VH 1LTAD 1W6KA 4HSVA 1MD2D 5ISRA 4X64L 4DR5Q 3NE5B 3VYRA 3TP6A 3NK9A 1BKBA 1QE6A 4NW2A 1Y69U 2PCFB 4C1NK 3HZXA 2JA5B 1K83B 3JAMi 4L6TB 5LL6S 1JB7A 1FNUA 2NVXB 1JWMD 3ND9A 3HOZH 2B2VC 3D6WA 2UU9L 2A8VA 2IX0A 1Y1VG 1JT8A 3CC7A 4C3IH 1X9NA 1H9RA 1X3QA 1QCBD 2EDGA 4WJ3M 4GZYC 1ZXTA 1EZ6A 4AYBB 3IFTA 4IUTA 1DOLA 1DYQA 4BBSB 2TMPA 1K8MA 1SSOA 2Z6KC 2BE5C 3ZYYX 3RD4A 2I5LX 2RF4A 3HOVB 3S14H 1CM9A 4K2KA 3HOZG 4OEMB 3T51B 2JQOA 2E74C 2E8GA 4HJ5A 3NWTA 4FNFA 4C3IG 1XPUA 1D8LA 5LMUL 2EJGC 4NXMQ 5M5WB 2K5QA 1YEZA 2B2UC 4PZ6A 3GTOH 2F0DA 4G4KA 5ELNA 5HGTA 4ALPA 1EFWA 2R92H 2KHJA 5CC4A 5GAEC 1X3FA 5ELFA 5M3FB 3NXWA 2FINB 1FVIA 1MBYA 1VQIA 2D2CC 4K5XA 4FXKC 1MSHA 2AWNA 1UE1A 5AJ3Q 1JE4A 1BOSA 1TS2A 1NR4A 1L0WA 2EQSA 4HIDA 2D5DA 3J7AV 3S1QB 1OXXK 3PO2B 2L1BA 3M85A 3RLFA 1JICA 1HZBA 2R92G 5KRUA 4K8JA 1L1OB 4ILWA 2NTSA 2BOSA 5FO8B 2JJQA 2IX1A 4L8JA 5IOCA 3AYHB 2FFKB 2UUCQ 2BA0A 1WTRA 2YU9H 2CH4A 2Z8LA 1WVLA 2KBNA 2NVTH 3S2DH 2Q2IA 4A3LH 4UP8A 4QF4A 2JXMB 3H0GH 3MXGA 1JOQA 3F2DA 1FNWA 1B8AA 2A73B 1J6QA 1TWHB 4FF3A 3RN5A 1EFID 3F2BA 3EQLC 4FXDA 4DV6L 1WTQA 4K0KL 2F0IA 1NTGA 3ICEA 2KQ3A 2UUBQ 5BN5A 1WCMH 2B2WC 5M3MB 1X32A 4YHHQ 1YIJA 3GTMB 1B50A 4FP5D 1I6HB 4HTHA 3NBHB 4A3LG 2E2JB 1LM0A 5JVG3 1PYBA 1LO5D 3H0GG 1HNXL 3GTKB 5FKAC 1VQOA 4IN3A 4IUPA 1PH2A 4DV0L 1HFGA 3PUYA 1X56A 2BA1A 4LFAL 4CDCC 4LUVA 3PF4A 4J6HA 4X66Q 1WCMG 1PFSA 2VW9A 3WWVA 4KHPL 2P5ZX 3PUXA 4GNXB 3HKSA 3PUVA 1D1KA 3NSWA 3ERQA 4DK1A 2SNMA 2WB1E 5IIFA 3K7AH 2I0QA 3I4NH 3BDLA 1J5EL 4KHZA 4L5RC 1I3QH 3L3OC 4F87A 1MJEA 4P74A 2UUAL 1STGA 1YITA 5BR8Q 1FD7D 4HEDA 1MJCA 4NMZA 2CKZB 1PFBA 4P2CB 3LX0A 4LF5L 3F2CA 1RODA 2KA7A 3NTHA 4MTKA 3DEPA 1SE2A 3I4MB 3NP8A 4ME3A 1Y8NB 1VQ6A 3I4NG 4WJWA 1WTVA 2D0OA 1QVGA 1EOTA 2K75A 2LFNA 1QZHA 2K14A 4A3EB 4ZQ3A 3MAQA 1HUMA 2F0LA 3DWPA 3KBXA 4LF6Q 1SYBA 1EIGA 1Q82C 4OL7A 4JOIC 2H5XA 1I50B 4MZ9A 3T1HL 5IP9H 3S2HB 2CQOA 4FXGC 4FVMA 5KNBA 4LF7Q 2JA6H 2K5NA 4EX5A 3VA7A 1A8VA 4RKLA 3IL8A 5DM63 4JPBW 2YTXA 4A3MH 2WAQB 5IGEA 3S17H 4G7OC 3K81C 2MO1A 1XNQQ 1U4PA 1YBYA 1VQ8A 4IOAA 5IE8A 3G6JB 3KLRA 2K6AA 1ENCA 1I4QA 1K0SA 2B63H 4H7BA 3QIAA 5IP9G 4FF2A 1WJJA 2J0TD 2N3SA 2HIXA 4F8MA 1YI2A 4XQQA 2UXBQ 1ICFB 2A6HC 4RHSA 1N34Q 4BBRH 4JW0A 5ELEA 4IUUA 4DAMA 1I4HA 4DAVA 4POGA 3URYA 4A3MG 4OO1H 4JBMA 3M3YB 5T1GA 1BDOA 4ODGA 1PH9A 1N36Q 1KIXA 3Q8DA 1FGBD 2RSNA 4JBKA 3J80E 4GOPC 1GHJA 4R4QA 1CKOA 2RSOA 4JC0A 2E75C 1STNA 3VA5A 3OWFA 4KKSA 1UEBA 2CVRA 4XDXA 3CQZH 2B63G 3OIPA 1BBUA 4G7HC 4POFA 4DN4M 1CA6A 4BA1I 4DV1L 1S3OA 4EGVA 4BBRG 1R4QB 4JV5Q 1U5KA 3S1MH 4M1UB 1V43A 3PF5A 4OO1G 4LW1A 3J7ZC 3FKIH 5C44H 4BY1H 1XYIA 2ES2A 2L5TA 5KYLA 3PIO3 1B44D 1SJHD 4A3DH 3MVVA 2F0MA 4KD3A 3MXNB 1II3A 2F4IA 1L1OA 2L11A 5CORA 4JI4L 2PNRC 5HGQA 4JI2L 4O0AA 4O1NA 4BA2I 1Q46A 1UAPA 1Y14B 2AWOA 3T1YL 4ZRZA 4AYBE 1E24A 3FKIG 5C44G 1VF7A 1D5MC 3RZOB 1IL8A 4BY1G 2F0QA 4KK7A 3ULLA 5FLXE 3A8IE 1BCPD 3E0JA 4DF7A 4ZKCB 4JI6Q 4A3DG 3CRLC 1DONA 1I6VC 2N49A 3H3VI 3KOJA 3FEWX 3QG1A 4BY7H 4KTAA 1FJGQ 3CCSA 3QOJA 4F88A 4C3JH 1STYA 1TS5A 3HEJA 5M5YH 1G91A 1N33Q 2JEBI 1E7ZA 2I5HA 3NBHA 1WTPA 4UP9A 3KF8B 3AFPA 1XPOA 3V2TA 3RN2A 1BXTA 1TR5A 4KN4C 4A93B 1XNRQ 1IKMA 2R7ZH 1HJPA 4K6LA 1AP0A 1N32Q 4RH6A 4BY7G 1IBML 5CV7A 1IBKL 3J81c 2VQFL 4JI1Q 4GNXA 4C3JG 1TIID 1EYCA 1E3PA 2ZXRA 2B3GA 4JI0L 1IKLA 4PZ7A 3RNUA 4PMBA 5C3EH 1HR0L 5NUCA 1LTBD 1WD0A 5IWAL 3A8KE 4N8FA 1D6EC 4O2DA 5C4XB 4RGOS 2UXDL 4DV5L 2LSSA 3FDTA 4JI3Q 1PFMA 3K59A 1WTHA 3PGZA 4DV3L 4QMGA 1BNZA 1U9RA 2IHEA 2O4XA 1YZ6A 1TWCB 2EVBA 4WORA 2LY7A 3D31A 1BR9A 1JR0D 5JOBA 2EYJA 4CDDC 5C3EG 1U4LA 3HS0C 1D5XC 5EJWA 1UE6A 4JI5Q 4IUNA 2B8GA 1Z47A 1GUGA 1SYGA 1E1OA 4DUZL 2Z4HA 4GN4B 2X69A 2RCNA 4IALA 4KV6A 2XSCA 2QDBA 2WKDA 3TP5A 3UDXA 2BE5D 3H09A 2NN6I 5GQOA 4DNRB 1VQ4A 1VQCA 1VDZA 5DLQE 1WTXA 2IJ0A 1LT5D 2PZUA 3TDQA 3M7NA 2AMCB 3PO3B 5EPKA 3TZUA 1TS3A 3W2DA 4R4TA 5FK9C 4Q0FA 4DR1Q 5LL6X 3MXUA 2HCCA 1GHKA 4HCEA 1CFMA 2ZTCA 3V96A 4YY3Q 2VQEL 3LWEA 5K5PA 5FLXc 4I65A 4DR5L 4V0BA 2EY2A 5KIXA 1M1KC 1RCVD 3OPOA 3C3LA 1FGUA 2XWBB 4LFCL 3UDGA 2JA7B 1PZKD 1NE3A 1G2SA 3GD7A 1TWAH 4DKAC 4LF8Q 1I94Q 2R7DA 4PMWA 2CCZA 3U9SA 3NTKA 1PYWD 1F9QA 1QOHA 4XQNA 2F0SA 4OELB 4U673 3MXPA 2CQAA 4CJ0B 2QA4A 4KLKA 1H9JA 4A3BH 3K5NA 4ZKBB 1SAPA 5D65A 2JA9A 1EQVA 2AUKA 1M90C 3NQTA 1VQPA 4QCLA 2SOBA 2SEBD 5C5LA 3W5OA 2PO4A 1MGSA 3ITPA 1S5ED 2KUMA 2NZHA 3MXNA 4GN3B 2BCOA 3FVQA 2Q2UA 2MGSA 4AQYQ 4DAPA 2WAQE 4A3BG 3DLLA 1YNNC 5KNDA 5IGGA 4C1NI 1BBWA 1JOKA 2NVYH 4LWCA 4R4IA 2E2IH 3MC0B 2M9VA 2NVQB 1G6ZA 2KHIA 4NXML 1TT2A 1PZJD 2KCMA 1BCPF 1U0LA 2WACA 1F9SA 1D1IA 1MIUA 2F3VA 4QIWB 4JI8L 2J4XA 3MFGA 1SJED 4RKBA 1GUWA 4DXGA 1KNEA 2NWGA 4XYQA 5AJ3L 1PRTD 5FJ8H 5C0XH 2UXCL 1TWFH 4HJAA 5IGDA 3GTJB 4DR3L 4RMFA 3OTOQ 2EE1A 1S5CD 1STAA 3KF8A 1CHPD 5C0XJ 1MI2A 3CP0A 4DV7Q 2F4VL 1IYJB 1SMYD 1A0IA 1JQYD 3DUZA 2HDLA 4C3HB 2UUCL 4DR6L 4X62Q 2OTJA 5FJ8G 3STBC 1SNOA 2KECA 5C0XG 5E3FA 3L9AX 4DU9A 1ILQA 4IQZA 3TP8A 2GA4B 2PMZB 3RZDB 2NYZD 1SRUA 1L0YB 3IFDA 1KTKA 3MA2B 4JVZA 2OF1A 1O7LA 5IGCA 2UUBL 1K83H 1D2BA 1VQDA 1YNXA 1BCPB 3GTQB 2NVXH 4YHHL 2R61A 1VMCA 1EY8A 3HKZB 3JAME 2E5LQ 3TMEA 4DR4L 1Q81C 1J8IA 1CZWA 3KBGA 4MNOA 3NWSA 1EQQA 4L63B 3SK4A 3FMCA 4DV2Q 1DJRD 3NQIA 3X3MA 4HMJA 4BBSH 2V4DA 1A3VA 1HFNA 4X66L 4A3GB 4CJ1B 3M4OB 4WRDA 5DEHA 1IHZA 5ELCA 3U58A 3HOVH 1EY4A 2O2LD 3K7UC 2O5IC 3K80C 4YWLA 1VQ9A 3DHQA 4ZAIA 3AEVA 1K8GA 3TS0A 3HOYB 1PTOH 1A2UA 2R3ZA 2PQAB 5M5WH 1PH3A 5M5XB 3KK7A 4AYBG 3LWUA 4EQPA 1SYEA 2G9DA 5KNCA 2JA8B 4BBSG 3QO2A 3MZ5A 3S24A 3T13A 3J7YW 5M3FH 3ULJA 4JBWA 2DNCA 3J80L 3HOVG 5GAHC 2F0WA 1RHPA 3CCLA 5JJZA 3J7A5 1EYAA 1XMOQ 3IRBA 2CWAA 1JWUD 1G8ZD 2MNAA 2I46A 1EY6A 4LF6L 3VYSA 2HIVA 4OX9Q 3QOLA 4LJZC 3G4SA 1PH1A 5DAUA 4IZ8A 2C35B 2F0FA 2MJ8A 2YTYA 4GKJQ 1GKHA 4K2LA 2EZVA 2JSOA 4B3RQ 1E1TA 5ELDA 5M3FG 3NPPA 3BZDB 3TREA 4LF7L 3VR3A 2B2TA 1CHQD 2F0GA 1NUCA 1PTOC 1F2LA 3EIVA 2A69C 3PV0A 3WOEA 3PIPA 2AQ3B 5JJKA 5FLMH 1I4RA 1M8AA 2DUDA 4UHVA 1H95A 1RKNA 3GO5A 3FHWA 4KJNA 2NBFA 2K32A 2EXDA 3CD6A 2DNEA 3I72A 1VQBA 3OMGA 4ME5A 3I90A 3CC2A 2KCTA 3C1FA 1A3UA 5FLXL 2K04A 1VQ5A 3CCRA 4YCVA 1ENFA 2UXBL 2ATWA 2EYMA 1O78A 1MKHA 3K0XA 4B9WA 3KJOA 3DMUA 5AFWA 4OWXB 2WFWA 3R8BA 3OMCA 5FLMG 1VCIA 1I6HH 2E2JH 1H9MA 2R6GA 2BDNA 2F03A 3BZKA 3HOZB 1AZPA 3GTKH 3SVMA 4HN7A 3MWYW 1TWGB 1HNZQ 2EJFC 1G2TA 4C3IB 3HOUH 2MFIA 4RGMA 1Y1WH 3EJIA 4DK3C 3NBIA 2IPKD 4A76A 1ILPA 4K5WA 1E0BA 1PRTF 1O7IA 4DA2A 3AU7A 1KLUD 5E1FA 2RDFA 4CJ2C 1A15A 3CKIB 2IX3A 4LFBL 1X55A 1PV4A 3S14B 2KEEA 4PNYA 1H9SB 3CRKC 1LTTD 3HOUG 3MHBA 4OO1I 5CV6A 1Y1WG 4RWSC 1VQEA 4NPSA 4Y7NB 1T9HA 3SR1A 2CWPA 2JK8A 3F8TA 1AE2A 5LMNW 4JCVE 2R92B 2F0UA 2GN5A 2K05A 3GDEA 4F7XA 3S15B 4B9XA 4A3IB 1WI5A 4A3EH 4ABNA 1MSGA 4H02A 1V1PA 3QWNA 1I50H 2A6ED 4HR7B 5CMDA 1SDFA 1FJGL 1K8AC 1RJTA 1ASYA 1G291 1YJNA 3S2HH 1WYDA 1XWEA 3PMFA 4JI7L 3U9OA 1BVSA 3OW7A 5BN4A 5C4JB 2MO0A 1EYDA 1AH9A 1VQFA 3H91A 1LTSD 4B3ML 2MPMA 2YV5A 1GO3E 1PRTB 4KY6A 3PIOA 3S16B 2Y0SB 1E2ZA 1STBA 2NVTB 3HGBA 4N9TA 1VQHA 2LKVA 4X64Q 1Z6HA 3H0GB 1DOMA 3AMUA 4JI1L 3G48A 4KHVA 2WIIB 1PFNA 5CGKA 4OXPA 4BXXH 5CV9A 1VS0A 5C4HA 2PQAA 2QKIC 2FMCA 1CSQA 2F0HA 3R3OA 3BVZA 5TSSA 4JI3L 1TQOA 3BVMA 1VQKA 2UU9Q 4DV4Q 5CV5A 2IWHA 5EBDA 1KDCA 4OWTB 2YYZA 1C0AA 4X6AH 2PMZE 1JJGA 3TBIB 1I4PA 1YNJD 2H4OA 2NZOA 3BZCA 3GP7A 1ET9A 4IPDA 1WTWA 1QVFA 4BXXG 3HOWH 2QCPX 4QGUA 4NDXA 2X6LA 4JI5L 1ESFA 4LUOA 5EBCA 3E3XA 2SNSA 4X3KA 1XXGA 1FYCA 3HKZE 3I91A 1QG7A 3WOFA 5JAVA 4GN5A 4EQNA 5HURA 1V1OA 4RGNA 5KYIA 1VMPA 2PQEA 3D3RA 5LMUQ 2JA6G 1SFOH 1DZ1A 1X3PA 1RL2A 2EY1A 3KJPA 5IGBA 3K57A 4HJ9A 3HOWG 2E2DC 2PW7A 2Z6KA 2HD3A 3I8ZA 2F3IA 3CHBD 1HNWQ 1O80A 4L5TA 1TXYA 1GVPA 3NENA 2RQXA 4APVA 5EAYA 3D8GA 5I2YA 2R7FA 4A3KH 3GTLB 4DR7L 5I9OA 4XT3B 5GADC 1RTOA 4QB4A 3UDIA 3J81i 3RLNA 2LXKA 5D3DA 1W3SA 4K5VA 4A93H 3Q23A 4DK0A 1QUQB 3TSSA 5C5MA 1HPCA 1HZAA 3NUCA 1AN8A 4A3KG 2VUMB 1CZGA 1F2ZA 2EYFA 4DUYL 1KC8C 3CU7A 2RHQB 1SROA 4DV6Q 2GVBA 4K0KQ 4A4IA 2B63B 3STBD 1FR3A 2LXJA 2QF7A 4WFN3 4CKEA 4HIMA 1B9NA 4LF4L 4A93G 1XTDA 1F77A 1H9SA 4HMIA 5C4XH 5F2DA 4IPCA 3Q22A 2Q8TA 4YIJA 2VB2X 4UAIA 4JBJA 1RDPD 3BYYB 3I2ZA 5ELOA 3T56B 1QVCA 4P73A 4TQUS 3M4PA 3W3AA 1Q3LA 4JYAL 2F0JA 5C3XA 5EKLA 2L55A 3VR6A 2B2YA 2KCNA 4LFAQ 3CQZB 3RLOA 3M7GA 3JAML 4A3JH 1NMGA 4TSSA 2A68D 4AIMA 4LUZA 2B2WA 2SDFA 1CQFA 3A5ZB 1QNUA 3BU2A 3BVGA 5C4XG 3FP9A 3R2IA 3CCUA 1SN8A 4Q5VA 1J5EQ 2KVMA 2M00A 4A3DB 1WTOA 2Z4IA 2C5CA 2UUAQ 4ID6A 2OT2A 1JOOA 1HTLD 2F0EA 1O7ZA 3OTOL 2VNUD 2TSSA 1K9MC 1E2VA 1LUZA 1P8LA 2R7ZG 2Q2TA 1K0RA 4A3JG 3MFYA 3PO3H 1IBLQ 4C56C 3RR5A 5JPNC 1IXRA 2JP1A 1EY7A 3L2PA 1CT1D 1PH5A 4XT1B 1V8QA 2HCIA 4X62L 1A62A 3DXJC 1UE7A 1DXMA 3OYYA 4DFAA 2VXWA 3J80c 1PVOA 2IHFA 2AQ1B 4N8X1 4Y52H 3CF5A 4BY7B 1LTGD 3BG3A 3FRPB 2JA7H 3A74A 1X54A 3T1HQ 3PO3G 4BWGB 1R9TB 4FDBA 2CW0C 4PZ8A 5M5YB 2OWOA 1W2BA 2ZJRA 3KUPA 4HIOA 4DR2Q 1N9WA 1SNPA 4FF1A 2KENA 4NXNL 2FXQA 2KJXA 1EUJA 1Q8IA 2AHOB 4B3SQ
chains in the Genus database with same CATH topology
2ZT9C 1Q1EA 1LACA 1PTOD 1EL0A 2EXZA 4ZUIA 3BYTB 1TS4A 4IFDH 2DY8A 1KDAA 2ICEC 4KY5A 3D4DA 4X3UA 4IFDJ 5C3EB 3D4RA 5K36H 4G7ZC 4PQXA 1PLFA 1QNKA 1UUPA 3ND8A 1KDBA 3SEBA 1OXTA 2A5HA 1Q12A 2F0NA 3E5SA 1SE4A 2F0KA 1I4XA 4IFDG 4KKTA 3OWEB 1EWCA 1WD1A 2LMCB 2RKSA 1U4RA 5G3LD 1LT4D 5CV4A 2B2TC 3I3CA 5K36G 3PUZA 3O13A 2AUJD 3K5LA 1S5FD 3DWQA 1EZ8A 1EIHA 2EYHA 1F2YA 2L9HA 2MHVA 2ZXOA 1S5DD 4RGTA 3R2TA 4KN7C 4DNTB 3WDNA 4XYOA 1R4PB 5DNFA 3V05A 3FPPA 4A3FB 1IW7C 2DN8A 4XIGS 4MHEA 1GUSA 1EQTA 1OXVA 2JE6I 1Q1BA 3GTPB 3H94A 1HQMC 5JVH3 3E6ZX 3X3NA 4XXEA 1NSNS 2LS01 1TWAB 1GOZA 5ELBA 4KY7A 5A2QE 2PYKA 4C3HG 1KLGD 3SDZA 1LV9A 3RMHA 4FO2A 3R93A 5C3WA 4A3BB 3H6MA 1B9MA 3GQBA 2EYPA 4PMCA 2KHSA 1ZYRC 1NCVA 4K8IA 4LK1C 3OHXC 3K58A 2N88A 1IYUA 1JB3A 3SHLA 1SE3A 1LLRD 1TY0A 1V1PB 2E2IB 4LMQD 2NVYB 1A2TA 3GTGB 1BCPC 3M4YA 1EEFD 4CKCA 4R9WA 1JC7A 5CYUA 3C46A 2R93B 1SYFA 1BF4A 1B3AA 1HA6A 4RHRA 4CGYB 1K8OA 5IODA 1B1ZA 1SNQA 1TU2B 5T1IA 1HRJA 2XN9C 5E4WC 1LABA 1EU3A 2RDHA 2A6HD 2B8FA 1LT3D 4MN3A 4CKBA 1LTID 1PTOF 2EY5A 1M4VA 2OEOA 2D9UA 2IL8A 2D62A 2Q8IB 2QILA 4RA8A 5CBEE 2WP8J 4TKOB 1XX8A 1EWHA 4K14A 4U68A 1UNSA 1EY0A 3A56A 3MEHA 3N6RA 5DM73 2O5JC 5G3LF 4V190 3P20A 2K5WA 3K0YA 3RUZA 5C4ZA 4FYDA 5IT9E 2F0TA 5J1ZA 1O7YA 1ET6A 4ZUJA 4C2MB 1Y1VB 2RDGA 5IGFA 1CK1A 3MTSA 2PW5A 1PTOB 2WV6D 1Z7TA 4E6IA 3QB3A 1OXSC 2PZWA 4KI0A 3VR4A 1B53A 4RFBA 3UI2A 4H44C 1RD9D 2K03A 2EPBA 3K5MA 5E4XA 2L0CA 3KLSA 3KLSX 3T16A 2NUCA 4RAUC 4I7ZC 2EYOA 2PZTA 1KNAA 3A7LA 1T5XD 4H13C 3G7LA 2HUGA 2XRSD 4H0LC 1GUTA 2I07B 1QB5D 2OXPA 4KKUA 4TRDA 3VYTA 2EJMA 3GV6A 3GTOB 1DD2A 1ZKOA 2FJ2A 2MP1A 1BBXC 1SBBB 2B2YC 3EFXD 5I6YA 4FF4A 1AEXA 2JYOA 3L7ZC 2IW3A 1TKWB 3P75A 1ENAA 4OHJA 1OO9B 5I2XA 4KMUC 2EY6A 1GUNA 4IUQA 2CW0D 1HA5A 1ML0D 2E76C 2L12A 1F9PA 4KJOA 4IUVA 1PZID 3HOUB 2HQEA 1Y1WB 2BDOA 1PRTC 1HTPA 1S4ZA 2YU9B 3SK5A 4DAYA 2B39A 3S2DB 3A8JE 1ZEQX 3PIP3 3Q6SA 3I4LA 1SEBD 1U4MA 5CR3A 1SMYC 2F0OA 3OSOA 1KAAA 2F3WA 3D6CA 1WCMB 1C8CA 1QWYA 2ICIA 1PXUA 2ENBA 1QILA 4B08A 1STHA 2XNAC 3I73A 2ID0A 2K5DA 2Z1CA 3A7AB 4HCSA 1Q90A 1GXDC 2KEDA 1GJXA 3Q24A 5BN3A 3TP7A 1L0XB 1SXTA 1AFPA 2FHTA 1VF5C 3K7AB 3I4NB 5JPMC 2B2VA 1I3QB 1LTRD 3J81E 3QJYA 1EEID 3P1HA 2KCCA 3C2PA 1BQQT 5I9PA 3AB9A 3S9WA 1YNND 2CHBD 1F2MA 2K28A 1IW7D 4CHTB 1AW7A 2FMMA 2L4NA 2H1EA 5EKIA 5EGTA 4PV1C 2XRQD 4O42A 5COYA 1C48A 4UDUC 1T5EA 4ZLTF 2X6GA 3T4AC 4X3SA 1AZQA 2B2UA 5EQ0A 4DXFA 5KGUA 5A2QL 5EPLA 2JA6B 3OOCA 4A3MB 3N52A 1TY2A 3S17B 1SNCA 3HOWB 1UEAB 1KABA 3IKJA 4IFDI 2MUYA 4IURA 4EVOA 1ZYRD 1A6XA 1JCKB 3NTIA 1SFOB 1W6JA 4BBRB 4RCOA 2G9HD 1TVXA 1NAPA 4XQJA 1XTCD 3TZDA 1EU4A 2QEJC 1ONLA 1ESRA 4NKLA 5FO7B 2XVSA 4G57A 4A3KB 3S1MB 1HHVA 3Q0AA 5D14A 5M9OA 4S3SA 3FKIB 5C44B 3J7AF 2AQ2B 3EA6A 4BY1B 4LAAA 3D4WA 5A35A 1Y8PB 3DM1A 1H9KA 4DGZA 2KOLA 2F1MA 1A3TA 3EROA 4J1MA 1CI3M 3BDCA 4K6DA 1DOKA 3SK8A 4N9PA 4OIKA 2ZXPA 1STEA 3ONAB 5J22A 1BO0A 4ULLA 1F9RA 2M2LA 4C3JB 5C0XI 1JORA 1B2TA 1SNDA 5FO9B 2R7ZB 3DWAA 2JEAI 4A3JB 1EY5A 2A6EC 3HG9A 3IAYA 4HSPA 4KD4A 2A69D 3P7JA 4CBVA 1HCZA 1HQRD 2NZ1D 3VYUA 4R8NA 5IT9L 1J9OA 4Z9CB 5CBAE 2NB0A 2K33A 1DCZA 1FNVA 5JEAH 4BS9A 1CQVA 5JEAJ 3BS1A 3A54A 2HDMA 4EQOA 3SK6A 2IT1A 5FOBB 1SYDA 1OXUA 3SE0A 2F0PA 2Q8RE 2F0VA 1ICWA 5JEAG 5J39A 3EVQA 4MIUA 3K5OA 1JWSD 1YNJC 3C1EA 1EY9A 2K1BA 1CA5A 2N55A 2K7VA 4X3TA 3PUWA 1C4QA 3HOXB 3T53B 4ZK9B 1E2WA 1DM0B 3BDOA 4JK1C 2RBMA 1IYVA 5CV8A 2NTTA 3H3VC 1RF2D 4OIJA 4XTCS 5EKKA 3LNNA 3A55A 1SNMA 1HUNA 4QUCA 1D5ZC 4R8IA 2EOTA 3TN2A 2WB1B 2E2HB 2WINB 5D3IB 1PDQA 2XIWA 1CTMA 2K01A 3NHHA 1LT6D 3OIQA 1RTNA 2PPBC 2A74C 1HXYD 2WKCA 4NP5A 3HRZC 3FPUB 4QUFA 4HAEA 3GV3A 2NN6H 1BUVT 1B4OA 5I4DA 3K6OA 1NR2A 1PMRA 4M8AA 2VB3X 1S5BD 2C9OA 2NN6G 4J8QA 3VR2A 5C6AA 3S1RB 2RVLA 3VR5A 3F2UA 1I4GA 1TWFB 2EYLA 2J7ZA 2XWJB 3I70A 1Y8OB 2A68C 2DY7A 5I6WA 4OGQC 2RA4A 5LHY1 3SXHA 4RCNA 3J81L 4ZYSA 1SYCA 3DEOA 1GUOA 3S1NB 5EPJA 3HP3A 5KEEA 1QJOA 1LTAD 1W6KA 4HSVA 1MD2D 5ISRA 3NE5B 3VYRA 3TP6A 3NK9A 1QE6A 4NW2A 1Y69U 2PCFB 4C1NK 3HZXA 2JA5B 1K83B 4L6TB 5LL6S 1FNUA 2NVXB 1JWMD 3ND9A 2B2VC 3D6WA 2IX0A 1H9RA 1X3QA 1QCBD 2EDGA 4GZYC 1ZXTA 1EZ6A 4AYBB 3IFTA 4IUTA 1DOLA 1DYQA 4BBSB 2TMPA 1K8MA 1SSOA 2BE5C 3ZYYX 3RD4A 3HOVB 1CM9A 4K2KA 3T51B 2E74C 3NWTA 4FNFA 4C3IG 2EJGC 5M5WB 2K5QA 2B2UC 2F0DA 4G4KA 5HGTA 5CC4A 5ELFA 5M3FB 3NXWA 2FINB 1MBYA 2D2CC 4K5XA 4FXKC 1MSHA 2AWNA 1JE4A 1BOSA 1TS2A 1NR4A 2D5DA 3J7AV 3S1QB 1OXXK 3PO2B 2L1BA 3M85A 3RLFA 1JICA 5KRUA 4K8JA 4ILWA 2NTSA 2BOSA 5FO8B 2IX1A 4L8JA 5IOCA 2FFKB 2BA0A 1WTRA 2Z8LA 1WVLA 4QF4A 2JXMB 3MXGA 1JOQA 1FNWA 2A73B 1TWHB 4FF3A 1EFID 3EQLC 4FXDA 1WTQA 2F0IA 2KQ3A 5BN5A 2B2WC 5M3MB 1X32A 3GTMB 1B50A 4FP5D 1I6HB 4HTHA 2E2JB 5JVG3 1LO5D 3GTKB 5FKAC 4IN3A 4IUPA 1HFGA 3PUYA 2BA1A 4J6HA 3PUXA 3PUVA 1D1KA 3NSWA 3ERQA 4DK1A 2SNMA 5IIFA 3BDLA 4KHZA 3L3OC 4F87A 1STGA 1FD7D 4HEDA 4NMZA 1PFBA 4P2CB 3LX0A 1RODA 2KA7A 3NTHA 3DEPA 1SE2A 3I4MB 3NP8A 1Y8NB 4WJWA 1WTVA 1EOTA 2LFNA 4A3EB 4ZQ3A 3MAQA 1HUMA 2F0LA 3DWPA 3KBXA 1SYBA 1EIGA 4OL7A 1I50B 3S2HB 4FXGC 4FVMA 5KNBA 3VA7A 4RKLA 3IL8A 5DM63 2WAQB 5IGEA 4G7OC 1U4PA 3G6JB 3KLRA 2K6AA 1ENCA 1I4QA 4H7BA 3QIAA 4FF2A 2J0TD 4F8MA 4XQQA 2A6HC 4RHSA 5ELEA 4IUUA 4DAVA 1I4HA 3URYA 4OO1H 3M3YB 5T1GA 1BDOA 4ODGA 1FGBD 2RSNA 3J80E 1GHJA 2RSOA 2E75C 1STNA 3VA5A 3OWFA 4KKSA 2CVRA 4XDXA 3OIPA 4G7HC 4DN4M 1CA6A 4BA1I 4EGVA 1R4QB 4M1UB 1V43A 4OO1G 1XYIA 2L5TA 5KYLA 3PIO3 1B44D 1SJHD 3MVVA 2F0MA 4KD3A 1II3A 2F4IA 2L11A 5CORA 2PNRC 4O1NA 4BA2I 1UAPA 2AWOA 4ZRZA 1VF7A 1D5MC 3RZOB 1IL8A 2F0QA 4KK7A 5FLXE 3A8IE 1BCPD 3E0JA 4DF7A 4ZKCB 1DONA 3CRLC 1I6VC 3FEWX 3QG1A 4KTAA 3QOJA 4F88A 1STYA 1TS5A 3HEJA 1G91A 2JEBI 3NBHA 1WTPA 3V2TA 1BXTA 1TR5A 4KN4C 4A93B 1IKMA 4K6LA 1AP0A 4RH6A 5CV7A 4C3JG 1TIID 1EYCA 2ZXRA 1IKLA 4PMBA 5NUCA 1LTBD 1WD0A 3A8KE 1D6EC 5C4XB 4RGOS 3FDTA 1PFMA 3K59A 4QMGA 1BNZA 1U9RA 2O4XA 1TWCB 2EVBA 4WORA 2LY7A 3D31A 1BR9A 1JR0D 5JOBA 2EYJA 1U4LA 3HS0C 1D5XC 5EJWA 4IUNA 2B8GA 1Z47A 1GUGA 1SYGA 2Z4HA 2X69A 4IALA 4KV6A 2XSCA 2QDBA 2WKDA 3TP5A 2BE5D 3H09A 2NN6I 4DNRB 1VDZA 1WTXA 2IJ0A 1LT5D 2PZUA 3TDQA 3M7NA 3PO3B 5EPKA 3TZUA 1TS3A 3W2DA 5FK9C 4Q0FA 5LL6X 3MXUA 2HCCA 1GHKA 4HCEA 1CFMA 3V96A 3LWEA 5K5PA 4I65A 4V0BA 2EY2A 5KIXA 1RCVD 3OPOA 3C3LA 2XWBB 2JA7B 1PZKD 1G2SA 3GD7A 4PMWA 3U9SA 3NTKA 1PYWD 1F9QA 1QOHA 4XQNA 2F0SA 4U673 3MXPA 2CQAA 4CJ0B 1H9JA 3K5NA 4ZKBB 1SAPA 5D65A 1EQVA 2AUKA 3NQTA 4QCLA 2SOBA 2SEBD 5C5LA 2PO4A 1MGSA 3ITPA 1S5ED 2KUMA 3MXNA 2BCOA 3FVQA 2MGSA 4DAPA 1YNNC 5KNDA 5IGGA 4C1NI 1JOKA 2NVQB 1G6ZA 3MC0B 2M9VA 1TT2A 1PZJD 1BCPF 2WACA 1F9SA 1D1IA 2F3VA 4QIWB 2J4XA 3MFGA 1SJED 4RKBA 1GUWA 4DXGA 1KNEA 2NWGA 4XYQA 1PRTD 5C0XH 5IGDA 3GTJB 2EE1A 1S5CD 1STAA 3KF8A 1CHPD 5C0XJ 1MI2A 1SMYD 1JQYD 3DUZA 2HDLA 4C3HB 1SNOA 2KECA 5C0XG 5E3FA 3L9AX 4DU9A 1ILQA 4IQZA 3TP8A 2GA4B 2PMZB 3RZDB 2NYZD 1L0YB 3IFDA 1KTKA 3MA2B 2OF1A 1O7LA 5IGCA 1D2BA 1BCPB 3GTQB 2R61A 1VMCA 1EY8A 3HKZB 3JAME 3TMEA 1J8IA 1CZWA 3KBGA 3NWSA 4L63B 3SK4A 3FMCA 1DJRD 3NQIA 3X3MA 4HMJA 2V4DA 1A3VA 1HFNA 4A3GB 4CJ1B 3M4OB 4WRDA 5DEHA 1IHZA 5ELCA 1EY4A 2O2LD 2O5IC 3DHQA 4ZAIA 3HOYB 1PTOH 1A2UA 2R3ZA 5M5XB 3KK7A 3LWUA 4EQPA 1SYEA 2G9DA 5KNCA 2JA8B 3QO2A 3MZ5A 3T13A 3J7YW 4JBWA 2DNCA 3J80L 2F0WA 1RHPA 5JJZA 1EYAA 1JWUD 1G8ZD 2I46A 1EY6A 3VYSA 3QOLA 4LJZC 5DAUA 4IZ8A 2MJ8A 2F0FA 4K2LA 2EZVA 2JSOA 5ELDA 3NPPA 3BZDB 3VR3A 2B2TA 1CHQD 2F0GA 1NUCA 1PTOC 1F2LA 2A69C 3PV0A 3WOEA 2AQ3B 1I4RA 1M8AA 1RKNA 3GO5A 4KJNA 2NBFA 2K32A 2DNEA 3I72A 3OMGA 4ME5A 3I90A 3C1FA 1A3UA 5FLXL 2K04A 1ENFA 2EYMA 1O78A 4B9WA 3DMUA 5AFWA 3R8BA 3OMCA 1VCIA 1H9MA 2R6GA 2BDNA 2F03A 3HOZB 1AZPA 3SVMA 4HN7A 3MWYW 1TWGB 2EJFC 1G2TA 4C3IB 4RGMA 3EJIA 3NBIA 2IPKD 1ILPA 4K5WA 1E0BA 1PRTF 4DA2A 3AU7A 1KLUD 5E1FA 2RDFA 4CJ2C 1A15A 3CKIB 2IX3A 3S14B 2KEEA 4PNYA 1H9SB 3CRKC 1LTTD 4OO1I 3MHBA 5CV6A 4RWSC 4Y7NB 3SR1A 2R92B 2F0UA 2K05A 4F7XA 3S15B 4B9XA 4A3IB 4ABNA 1MSGA 1V1PA 3QWNA 4HR7B 2A6ED 5CMDA 1SDFA 1RJTA 1G291 3PMFA 1XWEA 3U9OA 3OW7A 5BN4A 5C4JB 1EYDA 3H91A 1LTSD 2MPMA 1PRTB 4KY6A 3S16B 2Y0SB 1E2ZA 1STBA 2NVTB 3HGBA 4N9TA 2LKVA 1Z6HA 3H0GB 1DOMA 3AMUA 4KHVA 2WIIB 1PFNA 5CGKA 5CV9A 5C4HA 2QKIC 2FMCA 3R3OA 2F0HA 5TSSA 3BVZA 1TQOA 3BVMA 5CV5A 2IWHA 5EBDA 1KDCA 2YYZA 3TBIB 1I4PA 1YNJD 2H4OA 3GP7A 1ET9A 1WTWA 2QCPX 4NDXA 2X6LA 1ESFA 5EBCA 2SNSA 4X3KA 1XXGA 1FYCA 3I91A 1QG7A 3WOFA 5JAVA 5HURA 4EQNA 4RGNA 1V1OA 5KYIA 1VMPA 2PQEA 3D3RA 1DZ1A 1X3PA 2EY1A 5IGBA 3K57A 2E2DC 2PW7A 3I8ZA 3CHBD 1O80A 2RQXA 3D8GA 5I2YA 3GTLB 5I9OA 4XT3B 1RTOA 4QB4A 5D3DA 4K5VA 3Q23A 4DK0A 3TSSA 5C5MA 1HPCA 3NUCA 1AN8A 2VUMB 1CZGA 1F2ZA 2EYFA 3CU7A 2B63B 1FR3A 4WFN3 2QF7A 4CKEA 1B9NA 1F77A 1H9SA 4HMIA 5F2DA 3Q22A 2Q8TA 4YIJA 2VB2X 4UAIA 1RDPD 3BYYB 3T56B 4TQUS 3W3AA 1Q3LA 2F0JA 5C3XA 5EKLA 2L55A 3VR6A 2B2YA 2KCNA 3CQZB 3M7GA 3JAML 4TSSA 2A68D 2B2WA 2SDFA 1CQFA 3BVGA 1QNUA 3R2IA 4Q5VA 2KVMA 2M00A 4A3DB 1WTOA 2Z4IA 2C5CA 4ID6A 2OT2A 1JOOA 1HTLD 2F0EA 1O7ZA 2VNUD 2TSSA 1E2VA 3MFYA 4C56C 5JPNC 2JP1A 1EY7A 1CT1D 4XT1B 1V8QA 2HCIA 3DXJC 1DXMA 4DFAA 2VXWA 2AQ1B 4BY7B 1LTGD 3BG3A 3FRPB 4BWGB 1R9TB 2CW0C 5M5YB 3KUPA 1SNPA 4FF1A 2KJXA 1Q8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0S A;  3V2T A;  5IGE A;  1TR5 A;  5CGK A;  2EXZ A;  5CV8 A;  3H6M A;  4ZUI A;  5KEE A;  2EYM A;  5J22 A;  3MXP A;  4QF4 A;  5ISR A;  2EYP A;  4KJO A;  4B9W A;  5KGU A;  1JOQ A;  4PMC A;  5EKK A;  1KDA A;  3DMU A;  2KHS A;  1EY8 A;  4KY5 A;  1SNM A;  2HQE A;  3NK9 A;  3OMC A;  3D4D A;  4K8I A;  5CV9 A;  3TP6 A;  5CV7 A;  5C4H A;  3TME A;  1JOR A;  1ENC A;  4HMI A;  1EQV A;  2F0I A;  5F2D A;  3RUZ A;  3R3O A;  2F0H A;  4H7B A;  5C4Z A;  3HZX A;  2KQ3 A;  1TQO A;  4YIJ A;  2F0T A;  3NQT A;  5J1Z A;  3SK4 A;  5CV5 A;  1SND A;  4F8M A;  3SK5 A;  1EYC A;  2SOB A;  4ZUJ A;  1KDC A;  1KDB A;  1SNC A;  5C5L A;  3EJI A;  5IGF A;  1EY5 A;  3ITP A;  4PMB A;  1KAB A;  2F0J A;  3SHL A;  4HMJ A;  2F0N A;  5NUC A;  1A3V A;  5C3X A;  5EKL A;  3E5S A;  4ODG A;  4HTH A;  2F0K A;  3NHH A;  2PW5 A;  4K5W A;  4EVO A;  1A2T A;  4WRD A;  5CR3 A;  2F0O A;  3OSO A;  5DEH A;  4KD4 A;  1IHZ A;  1KAA A;  5E1F A;  4E6I A;  2RDF A;  1EY4 A;  3QB3 A;  2RKS A;  2F3W A;  4NP5 A;  2PZW A;  3D6C A;  3DHQ A;  4NDX A;  5CV4 A;  1STN A;  1EZ6 A;  3OWF A;  4QMG A;  1U9R A;  1JOK A;  4R8N A;  2O4X A;  3VA5 A;  5IGG A;  2SNS A;  1A2U A;  4J6H A;  2ENB A;  4PNY A;  4WOR A;  5JAV A;  1TT2 A;  5HUR A;  4EQN A;  3MHB A;  2M00 A;  3T16 A;  5CV6 A;  5JOB A;  1SYF A;  1EZ8 A;  1STH A;  2EYJ A;  2NUC A;  2PQE A;  2WAC A;  5KYI A;  4EQP A;  2EYH A;  1SYE A;  3ERQ A;  5IIF A;  2SNM A;  4ID6 A;  1F2Y A;  1JOO A;  2EYO A;  2F3V A;  2PZT A;  4K2K A;  2EY1 A;  3MZ5 A;  2F0E A;  3T13 A;  3BDL A;  3SR1 A;  4IUN A;  5IGB A;  5KYL A;  1SYG A;  4RKB A;  3MVV A;  5IOD A;  2F0M A;  1SNQ A;  2F0U A;  2F0W A;  4KD3 A;  4F7X A;  1II3 A;  1STG A;  2PW7 A;  4NKL A;  4EQO A;  4IAL A;  4KV6 A;  1EYA A;  4G57 A;  2F0D A;  3TP7 A;  4B9X A;  3SK6 A;  2QDB A;  1EY7 A;  5HGT A;  3TP5 A;  4NMZ A;  5M9O A;  4S3S A;  1SYD A;  5IGD A;  1EY6 A;  5CC4 A;  2OXP A;  2PZU A;  4LAA A;  3NXW A;  3LX0 A;  3QOL A;  4TRD A;  1STA A;  3D4W A;  2F0P A;  5K5P A;  2F0V A;  5DAU A;  4DFA A;  4IZ8 A;  2EY5 A;  2F0F A;  3D8G A;  3NP8 A;  4K5X A;  2OEO A;  4K2L A;  5C6A A;  4DGZ A;  2F0Q A;  3PMF A;  5I9O A;  3U9O A;  5J39 A;  3P1H A;  4DF7 A;  3EVQ A;  4MIU A;  4QB4 A;  1EYD A;  1A3T A;  5I9P A;  4ZQ3 A;  3ERO A;  3S9W A;  1NSN S;  2F0L A;  2F0G A;  1F2M A;  1NUC A;  2EYL A;  3C1E A;  1SYB A;  4J1M A;  1EY9 A;  1SNO A;  4OL7 A;  3BDC A;  4K5V A;  5E3F A;  4KY7 A;  1RKN A;  1SNP A;  4DU9 A;  4K6D A;  4I65 A;  4KTA A;  1AEX A;  4K8J A;  2PYK A;  4KY6 A;  3TP8 A;  5I6Y A;  5KRU A;  2EY2 A;  5C5M A;  4KJN A;  5I6W A;  5KIX A;  5EGT A;  3QOJ A;  3SK8 A;  1STB A;  4N9P A;  3NUC A;  1STY A;  3HEJ A;  4K14 A;  5IOC A;  4N9T A;  1EY0 A;  2LKV A;  3P75 A;  1ENA A;  1F2Z A;  2EYF A;  3MEH A;  3OMG A;  4ME5 A;  3SXH A;  3C1F A;  1A3U A;  2OF1 A;  4RKL A;  4KHV A;  1SYC A;  2RBM A;  5C3W A;  5IGC A;  2EY6 A; 
#chains in the Genus database with same CATH topology
 2ZT9 C;  2JA7 G;  1Q1E A;  1E22 A;  3HOX H;  1LAC A;  1PTO D;  1EL0 A;  2EXZ A;  4ZUI A;  4JOI A;  3BYT B;  1TS4 A;  4DV2 L;  2Z9H A;  4IFD H;  2DY8 A;  1KDA A;  2ICE C;  4GKK Q;  4KY5 A;  3D4D A;  2A1A A;  4X3U A;  3K8A A;  3D0F A;  4IFD J;  5C3E B;  3D4R A;  5K36 H;  3E9I A;  2DGY A;  1KL9 A;  4PQX A;  4G7Z C;  1PLF A;  2Z6B A;  1QNK A;  1UUP A;  3ND8 A;  1KDB A;  3SEB A;  1OXT A;  2NVQ H;  2A5H A;  1Q12 A;  2Y0S E;  2F0N A;  3HOX G;  3OW2 A;  3E5S A;  1SE4 A;  2E2H H;  2F0K A;  1I4X A;  4IFD G;  2RCF A;  4KKT A;  3OWE B;  1EWC A;  3ZJY C;  1WD1 A;  2LMC B;  2RKS A;  4DV1 Q;  1U4R A;  5G3L D;  4CDF C;  1LT4 D;  5CV4 A;  2B2T C;  3I3C A;  5K36 G;  3CPW A;  3PUZ A;  2VZA A;  3O13 A;  1LTL A;  2AUJ D;  3K5L A;  1S5F D;  3DWQ A;  3TEH B;  1EZ8 A;  1EIH A;  2EYH A;  4DK6 C;  1F2Y A;  2L9H A;  2WB1 G;  3GTJ H;  2MHV A;  2ZXO A;  4JI2 Q;  2PNH A;  4OX9 L;  1S5D D;  4RGT A;  3R2T A;  2PI2 A;  1KRT A;  2B29 A;  4KN7 C;  4DNT B;  3T1Y Q;  3WDN A;  5IYC H;  1QUQ A;  1VQA A;  4XYO A;  1R4P B;  5DNF A;  3V05 A;  3FPP A;  4A3F B;  1IW7 C;  1CSP A;  5J3B A;  3HFZ B;  4C3H H;  2DN8 A;  4XIG S;  1L2F A;  4MHE A;  4TVA B;  1GUS A;  1PHJ A;  1EQT A;  4LF9 Q;  1OXV A;  2JE6 I;  1Q1B A;  3GTP B;  2F52 A;  3H94 A;  1HQM C;  3RZD H;  5JVH 3;  1X6O A;  3E6Z X;  3X3N A;  4XXE A;  3VDY A;  1NSN S;  3H15 A;  5IYC G;  4X65 Q;  3S1R H;  4GS3 A;  2LS0 1;  1TWA B;  1GOZ A;  5ELB A;  4KY7 A;  5A2Q E;  4L5Q A;  3CMA A;  4IJH A;  2PYK A;  3GTQ H;  4C3H G;  5IY0 A;  1SE8 A;  4PG3 A;  1KLG D;  3SDZ A;  1LV9 A;  3RMH A;  4FO2 A;  2ZM6 Q;  3R93 A;  5C3W A;  2ZTD A;  4A3B B;  1MHW C;  3UE0 A;  2VQF Q;  1HNZ L;  3H6M A;  2OCE A;  3JC6 6;  1B9M A;  3GQB A;  2EYP A;  4PMC A;  2KHS A;  1ZYR C;  1NCV A;  4K8I A;  1PH4 A;  3S1N H;  1NJI C;  1C7Y A;  3CXC A;  4LK1 C;  3OHX C;  3K58 A;  5IWA Q;  3HKZ G;  2N88 A;  2PI2 E;  3CCQ A;  1IYU A;  4QQB X;  1JB3 A;  1NY4 A;  3SHL A;  1SE3 A;  1GD7 A;  1LLR D;  2VL6 A;  1TY0 A;  1V1P B;  2JA5 H;  1EWI A;  2E2I B;  4LMQ D;  2NVY B;  1A2T A;  5M5X H;  3GTG B;  4ZCK A;  5IYD H;  1BCP C;  3M4Y A;  1EEF D;  4CKC A;  1WOC A;  1PH6 A;  2QEX A;  4R9W A;  3M9B A;  3TQY A;  1YJW A;  3ULP A;  1JC7 A;  3PQI A;  2ALY B;  2HQL A;  5CYU A;  3C46 A;  2R93 B;  1SYF A;  1BF4 A;  1B3A A;  4DAY B;  1HA6 A;  4RHR A;  4CGY B;  2JA5 G;  1SLJ A;  1XMQ Q;  5LMN Q;  5IYD G;  5IOD A;  1B1Z A;  1K8O A;  1SNQ A;  4P75 A;  1TU2 B;  5T1I A;  2ZJP A;  1HRJ A;  2XN9 C;  5E4W C;  1LAB A;  1EU3 A;  3MEF A;  2RDH A;  2A6H D;  2B8F A;  1LT3 D;  1GM5 A;  4MN3 A;  4CKB A;  1LTI D;  1PTO F;  2RHS B;  4GLA C;  5BR8 L;  2EY5 A;  1M4V A;  3I4O A;  2OEO A;  1K28 A;  2D9U A;  1B7Y B;  2IL8 A;  3AFQ A;  2D62 A;  1KHI A;  4UP7 A;  2Q8I B;  4LFC Q;  2QIL A;  4RA8 A;  1RIP A;  1PA6 A;  5CBE E;  2WP8 J;  4TKO B;  3PCO B;  4UY8 C;  1XX8 A;  3NEL A;  2BH2 A;  1EWH A;  3L0O A;  3S1Q H;  1D7Q A;  4GLV B;  3PO2 H;  4K14 A;  4U68 A;  1UNS A;  1EY0 A;  3A56 A;  3MEH A;  3N6R A;  5DM7 3;  2O5J C;  3KLW A;  5G3L F;  4DV4 L;  3G6E A;  1ASZ A;  2HHH Q;  1TWG H;  1X3G A;  4V19 0;  3P20 A;  2K5W A;  2G5D A;  2Q2H A;  1EIF A;  3K0Y A;  4B3T Q;  3TRZ A;  3RUZ A;  5C4Z A;  1XNQ L;  4FYD A;  5IT9 E;  3J81 j;  2F0T A;  5J1Z A;  3PO2 G;  1O7Y A;  1ET6 A;  1TWH H;  4ZUJ A;  4C2M B;  1Y1V B;  1K3R A;  2RDG A;  5IGF A;  1CK1 A;  1Q86 C;  5JJL A;  4HIK A;  2L15 A;  3MTS A;  3I56 A;  2PW5 A;  1PTO B;  2WV6 D;  5M3M H;  4YCW A;  1Z7T A;  1N34 L;  4E6I A;  4Y7N H;  3QB3 A;  1OXS C;  2PZW A;  4KI0 A;  3GTM H;  2OQK A;  3VR4 A;  1Q8K A;  1B53 A;  4RFB A;  2K5V A;  1C9O A;  3UI2 A;  1N36 L;  2ZTE A;  3ERS X;  4H44 C;  1RD9 D;  2K03 A;  2EPB A;  1HR0 W;  1JMC A;  3K5M A;  3TS2 A;  1V9P A;  5E4X A;  1EQR A;  4JI8 Q;  3S15 H;  1L1O C;  2L0C A;  3KLS A;  3KLS X;  2JN4 A;  3T16 A;  2NUC A;  4RAU C;  1YHB A;  4A3I H;  3E0E A;  3BJU A;  4I7A A;  4I7Z C;  3JAM c;  2EYO A;  2PZT A;  1HNW L;  4QY7 A;  5M3M G;  4NB3 A;  2UXC Q;  3KYH C;  1KNA A;  4DR3 Q;  4JV5 L;  3CCJ A;  2VY3 A;  3A7L A;  2A19 A;  1T5X D;  5IYB H;  4H13 C;  3G7L A;  2HUG A;  1CUK A;  2XRS D;  2XGT A;  4H0L C;  2F4V Q;  1GUT A;  5C4J H;  2I07 B;  4YWM A;  1QB5 D;  2OXP A;  4KKU A;  4TRD A;  2N78 A;  4A3I G;  1YHQ A;  1AE3 A;  3VYT A;  2EJM A;  4DR6 Q;  3S16 H;  3GV6 A;  4R1J A;  3GTO B;  1DD2 A;  1ZKO A;  2FJ2 A;  2MP1 A;  1BBX C;  4MTN A;  4OON A;  5IYB G;  4R4O A;  3I4M H;  1SBB B;  2B2Y C;  1KQS A;  3EFX D;  4JI6 L;  5I6Y A;  4FF4 A;  1AEX A;  2JYO A;  3L7Z C;  2IW3 A;  1P16 A;  1WFQ A;  2I5M X;  1TKW B;  2XTI A;  3P75 A;  1ENA A;  4OHJ A;  1OO9 B;  5I2X A;  5L37 A;  4KMU C;  4GNX C;  2Y0S G;  2EY6 A;  1GUN A;  4IUQ A;  2CW0 D;  4DR4 Q;  1HA5 A;  1N33 L;  1ML0 D;  2E76 C;  2L12 A;  1F9P A;  4KJO A;  3I4M G;  3CCE A;  4IUV A;  1PZI D;  2DJF C;  3HOU B;  2HQE A;  4QIW E;  1Y1W B;  5H1S E;  4A3E G;  1XNR L;  2BDO A;  1PRT C;  1HTP A;  1S4Z A;  2YU9 B;  3SK5 A;  4DAY A;  4OWW B;  2B39 A;  3S2D B;  1N32 L;  3A8J E;  1ZEQ X;  1Q7Y C;  1SMX A;  3PIP 3;  3Q6S A;  3AQQ A;  1HZ9 A;  3I4L A;  4GLX A;  3CCV A;  3UE1 A;  5IT9 c;  1SEB D;  1U4M A;  5CR3 A;  1SMY C;  2F0O A;  3OSO A;  3EBE A;  1KAA A;  4IO9 A;  2OTL A;  2F3W A;  3D6C A;  1WCM B;  2QGQ A;  2WAQ G;  3F1Z A;  1C8C A;  1PYS B;  3M3Y H;  1QWY A;  2ICI A;  1PXU A;  1IBL L;  3E9H A;  3KDF B;  2ENB A;  1QIL A;  3QR8 A;  4CDE C;  4B08 A;  1STH A;  2XNA C;  3I73 A;  2ID0 A;  3A0J A;  2K5D A;  2Z1C A;  1YJ9 A;  3A7A B;  4HCS A;  1Q90 A;  1JJC B;  1VQL A;  1GXD C;  3W1B A;  1B70 B;  3GTL H;  1DGS A;  2KED A;  4YCU A;  4QL5 A;  1GJX A;  3Q24 A;  5BN3 A;  3TP7 A;  1L0X B;  1SXT A;  1AFP A;  2FHT A;  1VF5 C;  4IPH A;  3K7A B;  3I4N B;  5IP7 H;  5JPM C;  2B2V A;  1I3Q B;  4DR2 L;  3KFU A;  3B6Y A;  1NMF A;  1LTR D;  3J81 E;  1JE5 A;  3QJY A;  1EEI D;  3W1G A;  3P1H A;  2KCC A;  3C2P A;  2VUM H;  1BQQ T;  5I9P A;  2EIF A;  3AB9 A;  3S9W A;  1IL2 A;  1YNN D;  2CHB D;  1F2M A;  1UWV A;  1Z9F A;  2K28 A;  4B3S L;  1IW7 D;  4CHT B;  3RZO H;  1AW7 A;  2FMM A;  2L4N A;  4A75 A;  2H1E A;  4DR1 L;  5EKI A;  1VQ7 A;  5IP7 G;  3U50 C;  5EGT A;  4PV1 C;  2XRQ D;  4GKK L;  4O42 A;  1XPR A;  5COY A;  4YY3 L;  2MQH A;  1C48 A;  4UDU C;  1T5E A;  4ZLT F;  2X6G A;  3T4A C;  4X3S A;  1AZQ A;  2BH8 A;  1UE5 A;  2CH4 W;  2VUM G;  2B2U A;  5EQ0 A;  2N8N A;  4LF8 L;  4GOP B;  4DXF A;  1I94 L;  2ASB A;  5KGU A;  3CW2 C;  5A2Q L;  5EPL A;  2JA6 B;  3CPF A;  1EIY B;  2HT1 A;  2Z0S A;  3OOC A;  4A3M B;  3N52 A;  1TY2 A;  3S17 B;  1SNC A;  3HOW B;  1UEA B;  1KAB A;  3IKJ A;  4IFD I;  3CAM A;  4UPA A;  4LFB Q;  3CC4 A;  1S72 A;  2MUY A;  4IUR A;  4EVO A;  1ZYR D;  1A6X A;  1B3Q A;  4A3C H;  1JCK B;  3NTI A;  1SFO B;  1W6J A;  4BBR B;  4RCO A;  2G9H D;  1TVX A;  3J80 i;  4AQY L;  1JJ2 A;  1I5F A;  3KF6 B;  3SGI A;  1HNX Q;  1NAP A;  4XQJ A;  1XTC D;  4DV0 Q;  3ER0 A;  1TWC H;  1EU4 A;  3I7F A;  3TZD A;  2QEJ C;  1EOV A;  4LF9 L;  1ONL A;  3LGJ A;  4A3C G;  3EN2 A;  1ESR A;  4NKL A;  5FO7 B;  4KHP Q;  2XVS A;  4G57 A;  4A3K B;  4L5S A;  3S1M B;  1HHV A;  3Q0A A;  5D14 A;  5M9O A;  4S3S A;  1R9T H;  3FKI B;  4JI7 Q;  5C44 B;  2K52 A;  3J7A F;  2AQ2 B;  1NBW A;  3EA6 A;  4X65 L;  4LAA A;  4BY1 B;  2DJG C;  1HH2 P;  3D4W A;  1X3E A;  4HJ8 A;  5A35 A;  1Y8P B;  3DM1 A;  1H9K A;  2OQ0 A;  4DGZ A;  4B3M Q;  1PH8 A;  3CME A;  2KOL A;  2F1M A;  1A3T A;  2ZM6 L;  3ERO A;  1EYG A;  1CKN B;  4DV7 L;  4J1M A;  4LF5 Q;  1CI3 M;  3BDC A;  2V1C C;  4K6D A;  1DOK A;  3SK8 A;  4N9P A;  4JG2 A;  4OIK A;  1LYL A;  2ZXP A;  1STE A;  4P71 A;  3ONA B;  1YHA A;  3UDF A;  1BO0 A;  5J22 A;  4ULL A;  1F9R A;  1SR3 A;  2M2L A;  4C3J B;  5C0X I;  1JOR A;  3KDF A;  2GVA A;  3G71 A;  1K73 C;  1B2T A;  4IPG A;  1SND A;  4RG1 A;  5FO9 B;  2R7Z B;  3DWA A;  2E5L L;  2JEA I;  4A3J B;  1EY5 A;  2VS1 A;  4YWK A;  1K3B C;  2A6E C;  3HG9 A;  3IAY A;  4HSP A;  4KD4 A;  2A69 D;  3P7J A;  4CBV A;  1KD1 C;  4WJ4 A;  1S40 A;  1HCZ A;  4R4C A;  1G51 A;  1HQR D;  2NZ1 D;  5JJI A;  3VYU A;  1XMQ L;  5LMN L;  4R8N A;  5IT9 L;  1KAW A;  4HJ7 A;  1YVC A;  1J9O A;  2QW7 A;  3I55 A;  4Z9C B;  5CBA E;  2NB0 A;  4LNQ A;  2K33 A;  1DCZ A;  4A3F H;  1FNV A;  5JEA H;  1PH7 A;  4BS9 A;  1N8R C;  1CQV A;  3GTP H;  1G6P A;  5JEA J;  3BS1 A;  3A54 A;  2HDM A;  4EQO A;  3H3V H;  3SK6 A;  2IT1 A;  5FOB B;  4DR7 Q;  1KXL A;  1SYD A;  5GRO A;  1NNX A;  1OXU A;  3SE0 A;  2F0P A;  2Q8R E;  2F0V A;  4QJF A;  1ICW A;  1XMO L;  4A3F G;  5JEA G;  4GOP A;  2QDL A;  5J39 A;  4JI4 Q;  3EVQ A;  4MIU A;  3K5O A;  1JWS D;  1YNJ C;  3M4Q A;  4GKJ L;  3C1E A;  4B3R L;  1EY9 A;  2HHH L;  2K1B A;  4DUY Q;  4IOC A;  1CA5 A;  2N55 A;  2K7V A;  4X3T A;  1IZ6 A;  3PUW A;  1C4Q A;  5E7N A;  3HOX B;  3T53 B;  4DPG A;  4ZK9 B;  4B3T L;  1E2W A;  1DM0 B;  3BDO A;  4JK1 C;  1VQM A;  2RBM A;  3U4V A;  1FL0 A;  4LF4 Q;  3A5U A;  1IYV A;  5CV8 A;  2NTT A;  3H3V C;  1RF2 D;  4OIJ A;  4XTC S;  5EKK A;  3LNN A;  3A55 A;  1SNM A;  1XJV A;  1HUN A;  4QUC A;  1D5Z C;  4AH6 A;  2EOT A;  4R8I A;  3KF6 A;  3GTG H;  4JYA Q;  3TN2 A;  2WB1 B;  1QZG A;  2E2H B;  2WIN B;  5D3I B;  1PDQ A;  2XIW A;  4EQ5 A;  1CTM A;  2CFM A;  2D0P A;  1IBM Q;  2K01 A;  3NHH A;  2R93 H;  1IBK Q;  1LT6 D;  3OIQ A;  4DNI A;  1RTN A;  2PPB C;  2A74 C;  1HXY D;  2WKC A;  4NP5 A;  3DM3 A;  4A3G H;  4JI0 Q;  3M4O H;  3HRZ C;  2YTV A;  3FPU B;  1HR0 Q;  1KRS A;  2K4K A;  2AKW B;  4QUF A;  4HAE A;  3GV3 A;  2NN6 H;  1HZC A;  2UXD Q;  4DV5 Q;  1BUV T;  3HOY H;  1CKN A;  1B4O A;  5I4D A;  3K6O A;  2R93 G;  4DV3 Q;  1NR2 A;  1PMR A;  2JA8 H;  4M8A A;  4A3G G;  2VB3 X;  1S5B D;  5HY6 A;  1OTC A;  2C9O A;  1A63 A;  2NN6 G;  1X65 A;  4J8Q A;  1VQG A;  4DUZ Q;  3VR2 A;  5C6A A;  3S1R B;  3HOY G;  2RVL A;  3VR5 A;  3F2U A;  3U4Z A;  1I4G A;  2K5H A;  1TWF B;  1CKM A;  2JA8 G;  2EYL A;  3CCM A;  2J7Z A;  4NXN Q;  2XWJ B;  4J15 A;  3I70 A;  1VQJ A;  2ZJQ A;  1Y8O B;  1V1Q A;  5GAG C;  2A68 C;  2IY5 B;  2DY7 A;  5I6W A;  3NEM A;  4OGQ C;  2RA4 A;  5LHY 1;  4IJL A;  3SXH A;  4RCN A;  3J81 L;  4ZYS A;  1VQN A;  1SYC A;  3DEO A;  2K50 A;  1GUO A;  3PSI A;  3S1N B;  5EPJ A;  3HP3 A;  2VQE Q;  4P72 A;  5KEE A;  1QJO A;  4C2M H;  1Y1V H;  1LTA D;  1W6K A;  4HSV A;  1MD2 D;  5ISR A;  4X64 L;  4DR5 Q;  3NE5 B;  3VYR A;  3TP6 A;  3NK9 A;  1BKB A;  1QE6 A;  4NW2 A;  1Y69 U;  2PCF B;  4C1N K;  3HZX A;  2JA5 B;  1K83 B;  3JAM i;  4L6T B;  5LL6 S;  1JB7 A;  1FNU A;  2NVX B;  1JWM D;  3ND9 A;  3HOZ H;  2B2V C;  3D6W A;  2UU9 L;  2A8V A;  2IX0 A;  1Y1V G;  1JT8 A;  3CC7 A;  4C3I H;  1X9N A;  1H9R A;  1X3Q A;  1QCB D;  2EDG A;  4WJ3 M;  4GZY C;  1ZXT A;  1EZ6 A;  4AYB B;  3IFT A;  4IUT A;  1DOL A;  1DYQ A;  4BBS B;  2TMP A;  1K8M A;  1SSO A;  2Z6K C;  2BE5 C;  3ZYY X;  3RD4 A;  2I5L X;  2RF4 A;  3HOV B;  3S14 H;  1CM9 A;  4K2K A;  3HOZ G;  4OEM B;  3T51 B;  2JQO A;  2E74 C;  2E8G A;  4HJ5 A;  3NWT A;  4FNF A;  4C3I G;  1XPU A;  1D8L A;  5LMU L;  2EJG C;  4NXM Q;  5M5W B;  2K5Q A;  1YEZ A;  2B2U C;  4PZ6 A;  3GTO H;  2F0D A;  4G4K A;  5ELN A;  5HGT A;  4ALP A;  1EFW A;  2R92 H;  2KHJ A;  5CC4 A;  5GAE C;  1X3F A;  5ELF A;  5M3F B;  3NXW A;  2FIN B;  1FVI A;  1MBY A;  1VQI A;  2D2C C;  4K5X A;  4FXK C;  1MSH A;  2AWN A;  1UE1 A;  5AJ3 Q;  1JE4 A;  1BOS A;  1TS2 A;  1NR4 A;  1L0W A;  2EQS A;  4HID A;  2D5D A;  3J7A V;  3S1Q B;  1OXX K;  3PO2 B;  2L1B A;  3M85 A;  3RLF A;  1JIC A;  1HZB A;  2R92 G;  5KRU A;  4K8J A;  1L1O B;  4ILW A;  2NTS A;  2BOS A;  5FO8 B;  2JJQ A;  2IX1 A;  4L8J A;  5IOC A;  3AYH B;  2FFK B;  2UUC Q;  2BA0 A;  1WTR A;  2YU9 H;  2CH4 A;  2Z8L A;  1WVL A;  2KBN A;  2NVT H;  3S2D H;  2Q2I A;  4A3L H;  4UP8 A;  4QF4 A;  2JXM B;  3H0G H;  3MXG A;  1JOQ A;  3F2D A;  1FNW A;  1B8A A;  2A73 B;  1J6Q A;  1TWH B;  4FF3 A;  3RN5 A;  1EFI D;  3F2B A;  3EQL C;  4FXD A;  4DV6 L;  1WTQ A;  4K0K L;  2F0I A;  1NTG A;  3ICE A;  2KQ3 A;  2UUB Q;  5BN5 A;  1WCM H;  2B2W C;  5M3M B;  1X32 A;  4YHH Q;  1YIJ A;  3GTM B;  1B50 A;  4FP5 D;  1I6H B;  4HTH A;  3NBH B;  4A3L G;  2E2J B;  1LM0 A;  5JVG 3;  1PYB A;  1LO5 D;  3H0G G;  1HNX L;  3GTK B;  5FKA C;  1VQO A;  4IN3 A;  4IUP A;  1PH2 A;  4DV0 L;  1HFG A;  3PUY A;  1X56 A;  2BA1 A;  4LFA L;  4CDC C;  4LUV A;  3PF4 A;  4J6H A;  4X66 Q;  1WCM G;  1PFS A;  2VW9 A;  3WWV A;  4KHP L;  2P5Z X;  3PUX A;  4GNX B;  3HKS A;  3PUV A;  1D1K A;  3NSW A;  3ERQ A;  4DK1 A;  2SNM A;  2WB1 E;  5IIF A;  3K7A H;  2I0Q A;  3I4N H;  3BDL A;  1J5E L;  4KHZ A;  4L5R C;  1I3Q H;  3L3O C;  4F87 A;  1MJE A;  4P74 A;  2UUA L;  1STG A;  1YIT A;  5BR8 Q;  1FD7 D;  4HED A;  1MJC A;  4NMZ A;  2CKZ B;  1PFB A;  4P2C B;  3LX0 A;  4LF5 L;  3F2C A;  1ROD A;  2KA7 A;  3NTH A;  4MTK A;  3DEP A;  1SE2 A;  3I4M B;  3NP8 A;  4ME3 A;  1Y8N B;  1VQ6 A;  3I4N G;  4WJW A;  1WTV A;  2D0O A;  1QVG A;  1EOT A;  2K75 A;  2LFN A;  1QZH A;  2K14 A;  4A3E B;  4ZQ3 A;  3MAQ A;  1HUM A;  2F0L A;  3DWP A;  3KBX A;  4LF6 Q;  1SYB A;  1EIG A;  1Q82 C;  4OL7 A;  4JOI C;  2H5X A;  1I50 B;  4MZ9 A;  3T1H L;  5IP9 H;  3S2H B;  2CQO A;  4FXG C;  4FVM A;  5KNB A;  4LF7 Q;  2JA6 H;  2K5N A;  4EX5 A;  3VA7 A;  1A8V A;  4RKL A;  3IL8 A;  5DM6 3;  4JPB W;  2YTX A;  4A3M H;  2WAQ B;  5IGE A;  3S17 H;  4G7O C;  3K81 C;  2MO1 A;  1XNQ Q;  1U4P A;  1YBY A;  1VQ8 A;  4IOA A;  5IE8 A;  3G6J B;  3KLR A;  2K6A A;  1ENC A;  1I4Q A;  1K0S A;  2B63 H;  4H7B A;  3QIA A;  5IP9 G;  4FF2 A;  1WJJ A;  2J0T D;  2N3S A;  2HIX A;  4F8M A;  1YI2 A;  4XQQ A;  2UXB Q;  1ICF B;  2A6H C;  4RHS A;  1N34 Q;  4BBR H;  4JW0 A;  5ELE A;  4IUU A;  4DAM A;  1I4H A;  4DAV A;  4POG A;  3URY A;  4A3M G;  4OO1 H;  4JBM A;  3M3Y B;  5T1G A;  1BDO A;  4ODG A;  1PH9 A;  1N36 Q;  1KIX A;  3Q8D A;  1FGB D;  2RSN A;  4JBK A;  3J80 E;  4GOP C;  1GHJ A;  4R4Q A;  1CKO A;  2RSO A;  4JC0 A;  2E75 C;  1STN A;  3VA5 A;  3OWF A;  4KKS A;  1UEB A;  2CVR A;  4XDX A;  3CQZ H;  2B63 G;  3OIP A;  1BBU A;  4G7H C;  4POF A;  4DN4 M;  1CA6 A;  4BA1 I;  4DV1 L;  1S3O A;  4EGV A;  4BBR G;  1R4Q B;  4JV5 Q;  1U5K A;  3S1M H;  4M1U B;  1V43 A;  3PF5 A;  4OO1 G;  4LW1 A;  3J7Z C;  3FKI H;  5C44 H;  4BY1 H;  1XYI A;  2ES2 A;  2L5T A;  5KYL A;  3PIO 3;  1B44 D;  1SJH D;  4A3D H;  3MVV A;  2F0M A;  4KD3 A;  3MXN B;  1II3 A;  2F4I A;  1L1O A;  2L11 A;  5COR A;  4JI4 L;  2PNR C;  5HGQ A;  4JI2 L;  4O0A A;  4O1N A;  4BA2 I;  1Q46 A;  1UAP A;  1Y14 B;  2AWO A;  3T1Y L;  4ZRZ A;  4AYB E;  1E24 A;  3FKI G;  5C44 G;  1VF7 A;  1D5M C;  3RZO B;  1IL8 A;  4BY1 G;  2F0Q A;  4KK7 A;  3ULL A;  5FLX E;  3A8I E;  1BCP D;  3E0J A;  4DF7 A;  4ZKC B;  4JI6 Q;  4A3D G;  3CRL C;  1DON A;  1I6V C;  2N49 A;  3H3V I;  3KOJ A;  3FEW X;  3QG1 A;  4BY7 H;  4KTA A;  1FJG Q;  3CCS A;  3QOJ A;  4F88 A;  4C3J H;  1STY A;  1TS5 A;  3HEJ A;  5M5Y H;  1G91 A;  1N33 Q;  2JEB I;  1E7Z A;  2I5H A;  3NBH A;  1WTP A;  4UP9 A;  3KF8 B;  3AFP A;  1XPO A;  3V2T A;  3RN2 A;  1BXT A;  1TR5 A;  4KN4 C;  4A93 B;  1XNR Q;  1IKM A;  2R7Z H;  1HJP A;  4K6L A;  1AP0 A;  1N32 Q;  4RH6 A;  4BY7 G;  1IBM L;  5CV7 A;  1IBK L;  3J81 c;  2VQF L;  4JI1 Q;  4GNX A;  4C3J G;  1TII D;  1EYC A;  1E3P A;  2ZXR A;  2B3G A;  4JI0 L;  1IKL A;  4PZ7 A;  3RNU A;  4PMB A;  5C3E H;  1HR0 L;  5NUC A;  1LTB D;  1WD0 A;  5IWA L;  3A8K E;  4N8F A;  1D6E C;  4O2D A;  5C4X B;  4RGO S;  2UXD L;  4DV5 L;  2LSS A;  3FDT A;  4JI3 Q;  1PFM A;  3K59 A;  1WTH A;  3PGZ A;  4DV3 L;  4QMG A;  1BNZ A;  1U9R A;  2IHE A;  2O4X A;  1YZ6 A;  1TWC B;  2EVB A;  4WOR A;  2LY7 A;  3D31 A;  1BR9 A;  1JR0 D;  5JOB A;  2EYJ A;  4CDD C;  5C3E G;  1U4L A;  3HS0 C;  1D5X C;  5EJW A;  1UE6 A;  4JI5 Q;  4IUN A;  2B8G A;  1Z47 A;  1GUG A;  1SYG A;  1E1O A;  4DUZ L;  2Z4H A;  4GN4 B;  2X69 A;  2RCN A;  4IAL A;  4KV6 A;  2XSC A;  2QDB A;  2WKD A;  3TP5 A;  3UDX A;  2BE5 D;  3H09 A;  2NN6 I;  5GQO A;  4DNR B;  1VQ4 A;  1VQC A;  1VDZ A;  5DLQ E;  1WTX A;  2IJ0 A;  1LT5 D;  2PZU A;  3TDQ A;  3M7N A;  2AMC B;  3PO3 B;  5EPK A;  3TZU A;  1TS3 A;  3W2D A;  4R4T A;  5FK9 C;  4Q0F A;  4DR1 Q;  5LL6 X;  3MXU A;  2HCC A;  1GHK A;  4HCE A;  1CFM A;  2ZTC A;  3V96 A;  4YY3 Q;  2VQE L;  3LWE A;  5K5P A;  5FLX c;  4I65 A;  4DR5 L;  4V0B A;  2EY2 A;  5KIX A;  1M1K C;  1RCV D;  3OPO A;  3C3L A;  1FGU A;  2XWB B;  4LFC L;  3UDG A;  2JA7 B;  1PZK D;  1NE3 A;  1G2S A;  3GD7 A;  1TWA H;  4DKA C;  4LF8 Q;  1I94 Q;  2R7D A;  4PMW A;  2CCZ A;  3U9S A;  3NTK A;  1PYW D;  1F9Q A;  1QOH A;  4XQN A;  2F0S A;  4OEL B;  4U67 3;  3MXP A;  2CQA A;  4CJ0 B;  2QA4 A;  4KLK A;  1H9J A;  4A3B H;  3K5N A;  4ZKB B;  1SAP A;  5D65 A;  2JA9 A;  1EQV A;  2AUK A;  1M90 C;  3NQT A;  1VQP A;  4QCL A;  2SOB A;  2SEB D;  5C5L A;  3W5O A;  2PO4 A;  1MGS A;  3ITP A;  1S5E D;  2KUM A;  2NZH A;  3MXN A;  4GN3 B;  2BCO A;  3FVQ A;  2Q2U A;  2MGS A;  4AQY Q;  4DAP A;  2WAQ E;  4A3B G;  3DLL A;  1YNN C;  5KND A;  5IGG A;  4C1N I;  1BBW A;  1JOK A;  2NVY H;  4LWC A;  4R4I A;  2E2I H;  3MC0 B;  2M9V A;  2NVQ B;  1G6Z A;  2KHI A;  4NXM L;  1TT2 A;  1PZJ D;  2KCM A;  1BCP F;  1U0L A;  2WAC A;  1F9S A;  1D1I A;  1MIU A;  2F3V A;  4QIW B;  4JI8 L;  2J4X A;  3MFG A;  1SJE D;  4RKB A;  1GUW A;  4DXG A;  1KNE A;  2NWG A;  4XYQ A;  5AJ3 L;  1PRT D;  5FJ8 H;  5C0X H;  2UXC L;  1TWF H;  4HJA A;  5IGD A;  3GTJ B;  4DR3 L;  4RMF A;  3OTO Q;  2EE1 A;  1S5C D;  1STA A;  3KF8 A;  1CHP D;  5C0X J;  1MI2 A;  3CP0 A;  4DV7 Q;  2F4V L;  1IYJ B;  1SMY D;  1A0I A;  1JQY D;  3DUZ A;  2HDL A;  4C3H B;  2UUC L;  4DR6 L;  4X62 Q;  2OTJ A;  5FJ8 G;  3STB C;  1SNO A;  2KEC A;  5C0X G;  5E3F A;  3L9A X;  4DU9 A;  1ILQ A;  4IQZ A;  3TP8 A;  2GA4 B;  2PMZ B;  3RZD B;  2NYZ D;  1SRU A;  1L0Y B;  3IFD A;  1KTK A;  3MA2 B;  4JVZ A;  2OF1 A;  1O7L A;  5IGC A;  2UUB L;  1K83 H;  1D2B A;  1VQD A;  1YNX A;  1BCP B;  3GTQ B;  2NVX H;  4YHH L;  2R61 A;  1VMC A;  1EY8 A;  3HKZ B;  3JAM E;  2E5L Q;  3TME A;  4DR4 L;  1Q81 C;  1J8I A;  1CZW A;  3KBG A;  4MNO A;  3NWS A;  1EQQ A;  4L63 B;  3SK4 A;  3FMC A;  4DV2 Q;  1DJR D;  3NQI A;  3X3M A;  4HMJ A;  4BBS H;  2V4D A;  1A3V A;  1HFN A;  4X66 L;  4A3G B;  4CJ1 B;  3M4O B;  4WRD A;  5DEH A;  1IHZ A;  5ELC A;  3U58 A;  3HOV H;  1EY4 A;  2O2L D;  3K7U C;  2O5I C;  3K80 C;  4YWL A;  1VQ9 A;  3DHQ A;  4ZAI A;  3AEV A;  1K8G A;  3TS0 A;  3HOY B;  1PTO H;  1A2U A;  2R3Z A;  2PQA B;  5M5W H;  1PH3 A;  5M5X B;  3KK7 A;  4AYB G;  3LWU A;  4EQP A;  1SYE A;  2G9D A;  5KNC A;  2JA8 B;  4BBS G;  3QO2 A;  3MZ5 A;  3S24 A;  3T13 A;  3J7Y W;  5M3F H;  3ULJ A;  4JBW A;  2DNC A;  3J80 L;  3HOV G;  5GAH C;  2F0W A;  1RHP A;  3CCL A;  5JJZ A;  3J7A 5;  1EYA A;  1XMO Q;  3IRB A;  2CWA A;  1JWU D;  1G8Z D;  2MNA A;  2I46 A;  1EY6 A;  4LF6 L;  3VYS A;  2HIV A;  4OX9 Q;  3QOL A;  4LJZ C;  3G4S A;  1PH1 A;  5DAU A;  4IZ8 A;  2C35 B;  2F0F A;  2MJ8 A;  2YTY A;  4GKJ Q;  1GKH A;  4K2L A;  2EZV A;  2JSO A;  4B3R Q;  1E1T A;  5ELD A;  5M3F G;  3NPP A;  3BZD B;  3TRE A;  4LF7 L;  3VR3 A;  2B2T A;  1CHQ D;  2F0G A;  1NUC A;  1PTO C;  1F2L A;  3EIV A;  2A69 C;  3PV0 A;  3WOE A;  3PIP A;  2AQ3 B;  5JJK A;  5FLM H;  1I4R A;  1M8A A;  2DUD A;  4UHV A;  1H95 A;  1RKN A;  3GO5 A;  3FHW A;  4KJN A;  2NBF A;  2K32 A;  2EXD A;  3CD6 A;  2DNE A;  3I72 A;  1VQB A;  3OMG A;  4ME5 A;  3I90 A;  3CC2 A;  2KCT A;  3C1F A;  1A3U A;  5FLX L;  2K04 A;  1VQ5 A;  3CCR A;  4YCV A;  1ENF A;  2UXB L;  2ATW A;  2EYM A;  1O78 A;  1MKH A;  3K0X A;  4B9W A;  3KJO A;  3DMU A;  5AFW A;  4OWX B;  2WFW A;  3R8B A;  3OMC A;  5FLM G;  1VCI A;  1I6H H;  2E2J H;  1H9M A;  2R6G A;  2BDN A;  2F03 A;  3BZK A;  3HOZ B;  1AZP A;  3GTK H;  3SVM A;  4HN7 A;  3MWY W;  1TWG B;  1HNZ Q;  2EJF C;  1G2T A;  4C3I B;  3HOU H;  2MFI A;  4RGM A;  1Y1W H;  3EJI A;  4DK3 C;  3NBI A;  2IPK D;  4A76 A;  1ILP A;  4K5W A;  1E0B A;  1PRT F;  1O7I A;  4DA2 A;  3AU7 A;  1KLU D;  5E1F A;  2RDF A;  4CJ2 C;  1A15 A;  3CKI B;  2IX3 A;  4LFB L;  1X55 A;  1PV4 A;  3S14 B;  2KEE A;  4PNY A;  1H9S B;  3CRK C;  1LTT D;  3HOU G;  3MHB A;  4OO1 I;  5CV6 A;  1Y1W G;  4RWS C;  1VQE A;  4NPS A;  4Y7N B;  1T9H A;  3SR1 A;  2CWP A;  2JK8 A;  3F8T A;  1AE2 A;  5LMN W;  4JCV E;  2R92 B;  2F0U A;  2GN5 A;  2K05 A;  3GDE A;  4F7X A;  3S15 B;  4B9X A;  4A3I B;  1WI5 A;  4A3E H;  4ABN A;  1MSG A;  4H02 A;  1V1P A;  3QWN A;  1I50 H;  2A6E D;  4HR7 B;  5CMD A;  1SDF A;  1FJG L;  1K8A C;  1RJT A;  1ASY A;  1G29 1;  1YJN A;  3S2H H;  1WYD A;  1XWE A;  3PMF A;  4JI7 L;  3U9O A;  1BVS A;  3OW7 A;  5BN4 A;  5C4J B;  2MO0 A;  1EYD A;  1AH9 A;  1VQF A;  3H91 A;  1LTS D;  4B3M L;  2MPM A;  2YV5 A;  1GO3 E;  1PRT B;  4KY6 A;  3PIO A;  3S16 B;  2Y0S B;  1E2Z A;  1STB A;  2NVT B;  3HGB A;  4N9T A;  1VQH A;  2LKV A;  4X64 Q;  1Z6H A;  3H0G B;  1DOM A;  3AMU A;  4JI1 L;  3G48 A;  4KHV A;  2WII B;  1PFN A;  5CGK A;  4OXP A;  4BXX H;  5CV9 A;  1VS0 A;  5C4H A;  2PQA A;  2QKI C;  2FMC A;  1CSQ A;  2F0H A;  3R3O A;  3BVZ A;  5TSS A;  4JI3 L;  1TQO A;  3BVM A;  1VQK A;  2UU9 Q;  4DV4 Q;  5CV5 A;  2IWH A;  5EBD A;  1KDC A;  4OWT B;  2YYZ A;  1C0A A;  4X6A H;  2PMZ E;  1JJG A;  3TBI B;  1I4P A;  1YNJ D;  2H4O A;  2NZO A;  3BZC A;  3GP7 A;  1ET9 A;  4IPD A;  1WTW A;  1QVF A;  4BXX G;  3HOW H;  2QCP X;  4QGU A;  4NDX A;  2X6L A;  4JI5 L;  1ESF A;  4LUO A;  5EBC A;  3E3X A;  2SNS A;  4X3K A;  1XXG A;  1FYC A;  3HKZ E;  3I91 A;  1QG7 A;  3WOF A;  5JAV A;  4GN5 A;  4EQN A;  5HUR A;  1V1O A;  4RGN A;  5KYI A;  1VMP A;  2PQE A;  3D3R A;  5LMU Q;  2JA6 G;  1SFO H;  1DZ1 A;  1X3P A;  1RL2 A;  2EY1 A;  3KJP A;  5IGB A;  3K57 A;  4HJ9 A;  3HOW G;  2E2D C;  2PW7 A;  2Z6K A;  2HD3 A;  3I8Z A;  2F3I A;  3CHB D;  1HNW Q;  1O80 A;  4L5T A;  1TXY A;  1GVP A;  3NEN A;  2RQX A;  4APV A;  5EAY A;  3D8G A;  5I2Y A;  2R7F A;  4A3K H;  3GTL B;  4DR7 L;  5I9O A;  4XT3 B;  5GAD C;  1RTO A;  4QB4 A;  3UDI A;  3J81 i;  3RLN A;  2LXK A;  5D3D A;  1W3S A;  4K5V A;  4A93 H;  3Q23 A;  4DK0 A;  1QUQ B;  3TSS A;  5C5M A;  1HPC A;  1HZA A;  3NUC A;  1AN8 A;  4A3K G;  2VUM B;  1CZG A;  1F2Z A;  2EYF A;  4DUY L;  1KC8 C;  3CU7 A;  2RHQ B;  1SRO A;  4DV6 Q;  2GVB A;  4K0K Q;  4A4I A;  2B63 B;  3STB D;  1FR3 A;  2LXJ A;  2QF7 A;  4WFN 3;  4CKE A;  4HIM A;  1B9N A;  4LF4 L;  4A93 G;  1XTD A;  1F77 A;  1H9S A;  4HMI A;  5C4X H;  5F2D A;  4IPC A;  3Q22 A;  2Q8T A;  4YIJ A;  2VB2 X;  4UAI A;  4JBJ A;  1RDP D;  3BYY B;  3I2Z A;  5ELO A;  3T56 B;  1QVC A;  4P73 A;  4TQU S;  3M4P A;  3W3A A;  1Q3L A;  4JYA L;  2F0J A;  5C3X A;  5EKL A;  2L55 A;  3VR6 A;  2B2Y A;  2KCN A;  4LFA Q;  3CQZ B;  3RLO A;  3M7G A;  3JAM L;  4A3J H;  1NMG A;  4TSS A;  2A68 D;  4AIM A;  4LUZ A;  2B2W A;  2SDF A;  1CQF A;  3A5Z B;  1QNU A;  3BU2 A;  3BVG A;  5C4X G;  3FP9 A;  3R2I A;  3CCU A;  1SN8 A;  4Q5V A;  1J5E Q;  2KVM A;  2M00 A;  4A3D B;  1WTO A;  2Z4I A;  2C5C A;  2UUA Q;  4ID6 A;  2OT2 A;  1JOO A;  1HTL D;  2F0E A;  1O7Z A;  3OTO L;  2VNU D;  2TSS A;  1K9M C;  1E2V A;  1LUZ A;  1P8L A;  2R7Z G;  2Q2T A;  1K0R A;  4A3J G;  3MFY A;  3PO3 H;  1IBL Q;  4C56 C;  3RR5 A;  5JPN C;  1IXR A;  2JP1 A;  1EY7 A;  3L2P A;  1CT1 D;  1PH5 A;  4XT1 B;  1V8Q A;  2HCI A;  4X62 L;  1A62 A;  3DXJ C;  1UE7 A;  1DXM A;  3OYY A;  4DFA A;  2VXW A;  3J80 c;  1PVO A;  2IHF A;  2AQ1 B;  4N8X 1;  4Y52 H;  3CF5 A;  4BY7 B;  1LTG D;  3BG3 A;  3FRP B;  2JA7 H;  3A74 A;  1X54 A;  3T1H Q;  3PO3 G;  4BWG B;  1R9T B;  4FDB A;  2CW0 C;  4PZ8 A;  5M5Y B;  2OWO A;  1W2B A;  2ZJR A;  3KUP A;  4HIO A;  4DR2 Q;  1N9W A;  1SNP A;  4FF1 A;  2KEN A;  4NXN L;  2FXQ A;  2KJX A;  1EUJ A;  1Q8I A;  2AHO B;  4B3S Q; 
#chains in the Genus database with same CATH homology
 2ZT9 C;  1Q1E A;  1LAC A;  1PTO D;  1EL0 A;  2EXZ A;  4ZUI A;  3BYT B;  1TS4 A;  4IFD H;  2DY8 A;  1KDA A;  2ICE C;  4KY5 A;  3D4D A;  4X3U A;  4IFD J;  5C3E B;  3D4R A;  5K36 H;  4G7Z C;  4PQX A;  1PLF A;  1QNK A;  1UUP A;  3ND8 A;  1KDB A;  3SEB A;  1OXT A;  2A5H A;  1Q12 A;  2F0N A;  3E5S A;  1SE4 A;  2F0K A;  1I4X A;  4IFD G;  4KKT A;  3OWE B;  1EWC A;  1WD1 A;  2LMC B;  2RKS A;  1U4R A;  5G3L D;  1LT4 D;  5CV4 A;  2B2T C;  3I3C A;  5K36 G;  3PUZ A;  3O13 A;  2AUJ D;  3K5L A;  1S5F D;  3DWQ A;  1EZ8 A;  1EIH A;  2EYH A;  1F2Y A;  2L9H A;  2MHV A;  2ZXO A;  1S5D D;  4RGT A;  3R2T A;  4KN7 C;  4DNT B;  3WDN A;  4XYO A;  1R4P B;  5DNF A;  3V05 A;  3FPP A;  4A3F B;  1IW7 C;  2DN8 A;  4XIG S;  4MHE A;  1GUS A;  1EQT A;  1OXV A;  2JE6 I;  1Q1B A;  3GTP B;  3H94 A;  1HQM C;  5JVH 3;  3E6Z X;  3X3N A;  4XXE A;  1NSN S;  2LS0 1;  1TWA B;  1GOZ A;  5ELB A;  4KY7 A;  5A2Q E;  2PYK A;  4C3H G;  1KLG D;  3SDZ A;  1LV9 A;  3RMH A;  4FO2 A;  3R93 A;  5C3W A;  4A3B B;  3H6M A;  1B9M A;  3GQB A;  2EYP A;  4PMC A;  2KHS A;  1ZYR C;  1NCV A;  4K8I A;  4LK1 C;  3OHX C;  3K58 A;  2N88 A;  1IYU A;  1JB3 A;  3SHL A;  1SE3 A;  1LLR D;  1TY0 A;  1V1P B;  2E2I B;  4LMQ D;  2NVY B;  1A2T A;  3GTG B;  1BCP C;  3M4Y A;  1EEF D;  4CKC A;  4R9W A;  1JC7 A;  5CYU A;  3C46 A;  2R93 B;  1SYF A;  1BF4 A;  1B3A A;  1HA6 A;  4RHR A;  4CGY B;  1K8O A;  5IOD A;  1B1Z A;  1SNQ A;  1TU2 B;  5T1I A;  1HRJ A;  2XN9 C;  5E4W C;  1LAB A;  1EU3 A;  2RDH A;  2A6H D;  2B8F A;  1LT3 D;  4MN3 A;  4CKB A;  1LTI D;  1PTO F;  2EY5 A;  1M4V A;  2OEO A;  2D9U A;  2IL8 A;  2D62 A;  2Q8I B;  2QIL A;  4RA8 A;  5CBE E;  2WP8 J;  4TKO B;  1XX8 A;  1EWH A;  4K14 A;  4U68 A;  1UNS A;  1EY0 A;  3A56 A;  3MEH A;  3N6R A;  5DM7 3;  2O5J C;  5G3L F;  4V19 0;  3P20 A;  2K5W A;  3K0Y A;  3RUZ A;  5C4Z A;  4FYD A;  5IT9 E;  2F0T A;  5J1Z A;  1O7Y A;  1ET6 A;  4ZUJ A;  4C2M B;  1Y1V B;  2RDG A;  5IGF A;  1CK1 A;  3MTS A;  2PW5 A;  1PTO B;  2WV6 D;  1Z7T A;  4E6I A;  3QB3 A;  1OXS C;  2PZW A;  4KI0 A;  3VR4 A;  1B53 A;  4RFB A;  3UI2 A;  4H44 C;  1RD9 D;  2K03 A;  2EPB A;  3K5M A;  5E4X A;  2L0C A;  3KLS A;  3KLS X;  3T16 A;  2NUC A;  4RAU C;  4I7Z C;  2EYO A;  2PZT A;  1KNA A;  3A7L A;  1T5X D;  4H13 C;  3G7L A;  2HUG A;  2XRS D;  4H0L C;  1GUT A;  2I07 B;  1QB5 D;  2OXP A;  4KKU A;  4TRD A;  3VYT A;  2EJM A;  3GV6 A;  3GTO B;  1DD2 A;  1ZKO A;  2FJ2 A;  2MP1 A;  1BBX C;  1SBB B;  2B2Y C;  3EFX D;  5I6Y A;  4FF4 A;  1AEX A;  2JYO A;  3L7Z C;  2IW3 A;  1TKW B;  3P75 A;  1ENA A;  4OHJ A;  1OO9 B;  5I2X A;  4KMU C;  2EY6 A;  1GUN A;  4IUQ A;  2CW0 D;  1HA5 A;  1ML0 D;  2E76 C;  2L12 A;  1F9P A;  4KJO A;  4IUV A;  1PZI D;  3HOU B;  2HQE A;  1Y1W B;  2BDO A;  1PRT C;  1HTP A;  1S4Z A;  2YU9 B;  3SK5 A;  4DAY A;  2B39 A;  3S2D B;  3A8J E;  1ZEQ X;  3PIP 3;  3Q6S A;  3I4L A;  1SEB D;  1U4M A;  5CR3 A;  1SMY C;  2F0O A;  3OSO A;  1KAA A;  2F3W A;  3D6C A;  1WCM B;  1C8C A;  1QWY A;  2ICI A;  1PXU A;  2ENB A;  1QIL A;  4B08 A;  1STH A;  2XNA C;  3I73 A;  2ID0 A;  2K5D A;  2Z1C A;  3A7A B;  4HCS A;  1Q90 A;  1GXD C;  2KED A;  1GJX A;  3Q24 A;  5BN3 A;  3TP7 A;  1L0X B;  1SXT A;  1AFP A;  2FHT A;  1VF5 C;  3K7A B;  3I4N B;  5JPM C;  2B2V A;  1I3Q B;  1LTR D;  3J81 E;  3QJY A;  1EEI D;  3P1H A;  2KCC A;  3C2P A;  1BQQ T;  5I9P A;  3AB9 A;  3S9W A;  1YNN D;  2CHB D;  1F2M A;  2K28 A;  1IW7 D;  4CHT B;  1AW7 A;  2FMM A;  2L4N A;  2H1E A;  5EKI A;  5EGT A;  4PV1 C;  2XRQ D;  4O42 A;  5COY A;  1C48 A;  4UDU C;  1T5E A;  4ZLT F;  2X6G A;  3T4A C;  4X3S A;  1AZQ A;  2B2U A;  5EQ0 A;  4DXF A;  5KGU A;  5A2Q L;  5EPL A;  2JA6 B;  3OOC A;  4A3M B;  3N52 A;  1TY2 A;  3S17 B;  1SNC A;  3HOW B;  1UEA B;  1KAB A;  3IKJ A;  4IFD I;  2MUY A;  4IUR A;  4EVO A;  1ZYR D;  1A6X A;  1JCK B;  3NTI A;  1SFO B;  1W6J A;  4BBR B;  4RCO A;  2G9H D;  1TVX A;  1NAP A;  4XQJ A;  1XTC D;  3TZD A;  1EU4 A;  2QEJ C;  1ONL A;  1ESR A;  4NKL A;  5FO7 B;  2XVS A;  4G57 A;  4A3K B;  3S1M B;  1HHV A;  3Q0A A;  5D14 A;  5M9O A;  4S3S A;  3FKI B;  5C44 B;  3J7A F;  2AQ2 B;  3EA6 A;  4BY1 B;  4LAA A;  3D4W A;  5A35 A;  1Y8P B;  3DM1 A;  1H9K A;  4DGZ A;  2KOL A;  2F1M A;  1A3T A;  3ERO A;  4J1M A;  1CI3 M;  3BDC A;  4K6D A;  1DOK A;  3SK8 A;  4N9P A;  4OIK A;  2ZXP A;  1STE A;  3ONA B;  5J22 A;  1BO0 A;  4ULL A;  1F9R A;  2M2L A;  4C3J B;  5C0X I;  1JOR A;  1B2T A;  1SND A;  5FO9 B;  2R7Z B;  3DWA A;  2JEA I;  4A3J B;  1EY5 A;  2A6E C;  3HG9 A;  3IAY A;  4HSP A;  4KD4 A;  2A69 D;  3P7J A;  4CBV A;  1HCZ A;  1HQR D;  2NZ1 D;  3VYU A;  4R8N A;  5IT9 L;  1J9O A;  4Z9C B;  5CBA E;  2NB0 A;  2K33 A;  1DCZ A;  1FNV A;  5JEA H;  4BS9 A;  1CQV A;  5JEA J;  3BS1 A;  3A54 A;  2HDM A;  4EQO A;  3SK6 A;  2IT1 A;  5FOB B;  1SYD A;  1OXU A;  3SE0 A;  2F0P A;  2Q8R E;  2F0V A;  1ICW A;  5JEA G;  5J39 A;  3EVQ A;  4MIU A;  3K5O A;  1JWS D;  1YNJ C;  3C1E A;  1EY9 A;  2K1B A;  1CA5 A;  2N55 A;  2K7V A;  4X3T A;  3PUW A;  1C4Q A;  3HOX B;  3T53 B;  4ZK9 B;  1E2W A;  1DM0 B;  3BDO A;  4JK1 C;  2RBM A;  1IYV A;  5CV8 A;  2NTT A;  3H3V C;  1RF2 D;  4OIJ A;  4XTC S;  5EKK A;  3LNN A;  3A55 A;  1SNM A;  1HUN A;  4QUC A;  1D5Z C;  4R8I A;  2EOT A;  3TN2 A;  2WB1 B;  2E2H B;  2WIN B;  5D3I B;  1PDQ A;  2XIW A;  1CTM A;  2K01 A;  3NHH A;  1LT6 D;  3OIQ A;  1RTN A;  2PPB C;  2A74 C;  1HXY D;  2WKC A;  4NP5 A;  3HRZ C;  3FPU B;  4QUF A;  4HAE A;  3GV3 A;  2NN6 H;  1BUV T;  1B4O A;  5I4D A;  3K6O A;  1NR2 A;  1PMR A;  4M8A A;  2VB3 X;  1S5B D;  2C9O A;  2NN6 G;  4J8Q A;  3VR2 A;  5C6A A;  3S1R B;  2RVL A;  3VR5 A;  3F2U A;  1I4G A;  1TWF B;  2EYL A;  2J7Z A;  2XWJ B;  3I70 A;  1Y8O B;  2A68 C;  2DY7 A;  5I6W A;  4OGQ C;  2RA4 A;  5LHY 1;  3SXH A;  4RCN A;  3J81 L;  4ZYS A;  1SYC A;  3DEO A;  1GUO A;  3S1N B;  5EPJ A;  3HP3 A;  5KEE A;  1QJO A;  1LTA D;  1W6K A;  4HSV A;  1MD2 D;  5ISR A;  3NE5 B;  3VYR A;  3TP6 A;  3NK9 A;  1QE6 A;  4NW2 A;  1Y69 U;  2PCF B;  4C1N K;  3HZX A;  2JA5 B;  1K83 B;  4L6T B;  5LL6 S;  1FNU A;  2NVX B;  1JWM D;  3ND9 A;  2B2V C;  3D6W A;  2IX0 A;  1H9R A;  1X3Q A;  1QCB D;  2EDG A;  4GZY C;  1ZXT A;  1EZ6 A;  4AYB B;  3IFT A;  4IUT A;  1DOL A;  1DYQ A;  4BBS B;  2TMP A;  1K8M A;  1SSO A;  2BE5 C;  3ZYY X;  3RD4 A;  3HOV B;  1CM9 A;  4K2K A;  3T51 B;  2E74 C;  3NWT A;  4FNF A;  4C3I G;  2EJG C;  5M5W B;  2K5Q A;  2B2U C;  2F0D A;  4G4K A;  5HGT A;  5CC4 A;  5ELF A;  5M3F B;  3NXW A;  2FIN B;  1MBY A;  2D2C C;  4K5X A;  4FXK C;  1MSH A;  2AWN A;  1JE4 A;  1BOS A;  1TS2 A;  1NR4 A;  2D5D A;  3J7A V;  3S1Q B;  1OXX K;  3PO2 B;  2L1B A;  3M85 A;  3RLF A;  1JIC A;  5KRU A;  4K8J A;  4ILW A;  2NTS A;  2BOS A;  5FO8 B;  2IX1 A;  4L8J A;  5IOC A;  2FFK B;  2BA0 A;  1WTR A;  2Z8L A;  1WVL A;  4QF4 A;  2JXM B;  3MXG A;  1JOQ A;  1FNW A;  2A73 B;  1TWH B;  4FF3 A;  1EFI D;  3EQL C;  4FXD A;  1WTQ A;  2F0I A;  2KQ3 A;  5BN5 A;  2B2W C;  5M3M B;  1X32 A;  3GTM B;  1B50 A;  4FP5 D;  1I6H B;  4HTH A;  2E2J B;  5JVG 3;  1LO5 D;  3GTK B;  5FKA C;  4IN3 A;  4IUP A;  1HFG A;  3PUY A;  2BA1 A;  4J6H A;  3PUX A;  3PUV A;  1D1K A;  3NSW A;  3ERQ A;  4DK1 A;  2SNM A;  5IIF A;  3BDL A;  4KHZ A;  3L3O C;  4F87 A;  1STG A;  1FD7 D;  4HED A;  4NMZ A;  1PFB A;  4P2C B;  3LX0 A;  1ROD A;  2KA7 A;  3NTH A;  3DEP A;  1SE2 A;  3I4M B;  3NP8 A;  1Y8N B;  4WJW A;  1WTV A;  1EOT A;  2LFN A;  4A3E B;  4ZQ3 A;  3MAQ A;  1HUM A;  2F0L A;  3DWP A;  3KBX A;  1SYB A;  1EIG A;  4OL7 A;  1I50 B;  3S2H B;  4FXG C;  4FVM A;  5KNB A;  3VA7 A;  4RKL A;  3IL8 A;  5DM6 3;  2WAQ B;  5IGE A;  4G7O C;  1U4P A;  3G6J B;  3KLR A;  2K6A A;  1ENC A;  1I4Q A;  4H7B A;  3QIA A;  4FF2 A;  2J0T D;  4F8M A;  4XQQ A;  2A6H C;  4RHS A;  5ELE A;  4IUU A;  4DAV A;  1I4H A;  3URY A;  4OO1 H;  3M3Y B;  5T1G A;  1BDO A;  4ODG A;  1FGB D;  2RSN A;  3J80 E;  1GHJ A;  2RSO A;  2E75 C;  1STN A;  3VA5 A;  3OWF A;  4KKS A;  2CVR A;  4XDX A;  3OIP A;  4G7H C;  4DN4 M;  1CA6 A;  4BA1 I;  4EGV A;  1R4Q B;  4M1U B;  1V43 A;  4OO1 G;  1XYI A;  2L5T A;  5KYL A;  3PIO 3;  1B44 D;  1SJH D;  3MVV A;  2F0M A;  4KD3 A;  1II3 A;  2F4I A;  2L11 A;  5COR A;  2PNR C;  4O1N A;  4BA2 I;  1UAP A;  2AWO A;  4ZRZ A;  1VF7 A;  1D5M C;  3RZO B;  1IL8 A;  2F0Q A;  4KK7 A;  5FLX E;  3A8I E;  1BCP D;  3E0J A;  4DF7 A;  4ZKC B;  1DON A;  3CRL C;  1I6V C;  3FEW X;  3QG1 A;  4KTA A;  3QOJ A;  4F88 A;  1STY A;  1TS5 A;  3HEJ A;  1G91 A;  2JEB I;  3NBH A;  1WTP A;  3V2T A;  1BXT A;  1TR5 A;  4KN4 C;  4A93 B;  1IKM A;  4K6L A;  1AP0 A;  4RH6 A;  5CV7 A;  4C3J G;  1TII D;  1EYC A;  2ZXR A;  1IKL A;  4PMB A;  5NUC A;  1LTB D;  1WD0 A;  3A8K E;  1D6E C;  5C4X B;  4RGO S;  3FDT A;  1PFM A;  3K59 A;  4QMG A;  1BNZ A;  1U9R A;  2O4X A;  1TWC B;  2EVB A;  4WOR A;  2LY7 A;  3D31 A;  1BR9 A;  1JR0 D;  5JOB A;  2EYJ A;  1U4L A;  3HS0 C;  1D5X C;  5EJW A;  4IUN A;  2B8G A;  1Z47 A;  1GUG A;  1SYG A;  2Z4H A;  2X69 A;  4IAL A;  4KV6 A;  2XSC A;  2QDB A;  2WKD A;  3TP5 A;  2BE5 D;  3H09 A;  2NN6 I;  4DNR B;  1VDZ A;  1WTX A;  2IJ0 A;  1LT5 D;  2PZU A;  3TDQ A;  3M7N A;  3PO3 B;  5EPK A;  3TZU A;  1TS3 A;  3W2D A;  5FK9 C;  4Q0F A;  5LL6 X;  3MXU A;  2HCC A;  1GHK A;  4HCE A;  1CFM A;  3V96 A;  3LWE A;  5K5P A;  4I65 A;  4V0B A;  2EY2 A;  5KIX A;  1RCV D;  3OPO A;  3C3L A;  2XWB B;  2JA7 B;  1PZK D;  1G2S A;  3GD7 A;  4PMW A;  3U9S A;  3NTK A;  1PYW D;  1F9Q A;  1QOH A;  4XQN A;  2F0S A;  4U67 3;  3MXP A;  2CQA A;  4CJ0 B;  1H9J A;  3K5N A;  4ZKB B;  1SAP A;  5D65 A;  1EQV A;  2AUK A;  3NQT A;  4QCL A;  2SOB A;  2SEB D;  5C5L A;  2PO4 A;  1MGS A;  3ITP A;  1S5E D;  2KUM A;  3MXN A;  2BCO A;  3FVQ A;  2MGS A;  4DAP A;  1YNN C;  5KND A;  5IGG A;  4C1N I;  1JOK A;  2NVQ B;  1G6Z A;  3MC0 B;  2M9V A;  1TT2 A;  1PZJ D;  1BCP F;  2WAC A;  1F9S A;  1D1I A;  2F3V A;  4QIW B;  2J4X A;  3MFG A;  1SJE D;  4RKB A;  1GUW A;  4DXG A;  1KNE A;  2NWG A;  4XYQ A;  1PRT D;  5C0X H;  5IGD A;  3GTJ B;  2EE1 A;  1S5C D;  1STA A;  3KF8 A;  1CHP D;  5C0X J;  1MI2 A;  1SMY D;  1JQY D;  3DUZ A;  2HDL A;  4C3H B;  1SNO A;  2KEC A;  5C0X G;  5E3F A;  3L9A X;  4DU9 A;  1ILQ A;  4IQZ A;  3TP8 A;  2GA4 B;  2PMZ B;  3RZD B;  2NYZ D;  1L0Y B;  3IFD A;  1KTK A;  3MA2 B;  2OF1 A;  1O7L A;  5IGC A;  1D2B A;  1BCP B;  3GTQ B;  2R61 A;  1VMC A;  1EY8 A;  3HKZ B;  3JAM E;  3TME A;  1J8I A;  1CZW A;  3KBG A;  3NWS A;  4L63 B;  3SK4 A;  3FMC A;  1DJR D;  3NQI A;  3X3M A;  4HMJ A;  2V4D A;  1A3V A;  1HFN A;  4A3G B;  4CJ1 B;  3M4O B;  4WRD A;  5DEH A;  1IHZ A;  5ELC A;  1EY4 A;  2O2L D;  2O5I C;  3DHQ A;  4ZAI A;  3HOY B;  1PTO H;  1A2U A;  2R3Z A;  5M5X B;  3KK7 A;  3LWU A;  4EQP A;  1SYE A;  2G9D A;  5KNC A;  2JA8 B;  3QO2 A;  3MZ5 A;  3T13 A;  3J7Y W;  4JBW A;  2DNC A;  3J80 L;  2F0W A;  1RHP A;  5JJZ A;  1EYA A;  1JWU D;  1G8Z D;  2I46 A;  1EY6 A;  3VYS A;  3QOL A;  4LJZ C;  5DAU A;  4IZ8 A;  2MJ8 A;  2F0F A;  4K2L A;  2EZV A;  2JSO A;  5ELD A;  3NPP A;  3BZD B;  3VR3 A;  2B2T A;  1CHQ D;  2F0G A;  1NUC A;  1PTO C;  1F2L A;  2A69 C;  3PV0 A;  3WOE A;  2AQ3 B;  1I4R A;  1M8A A;  1RKN A;  3GO5 A;  4KJN A;  2NBF A;  2K32 A;  2DNE A;  3I72 A;  3OMG A;  4ME5 A;  3I90 A;  3C1F A;  1A3U A;  5FLX L;  2K04 A;  1ENF A;  2EYM A;  1O78 A;  4B9W A;  3DMU A;  5AFW A;  3R8B A;  3OMC A;  1VCI A;  1H9M A;  2R6G A;  2BDN A;  2F03 A;  3HOZ B;  1AZP A;  3SVM A;  4HN7 A;  3MWY W;  1TWG B;  2EJF C;  1G2T A;  4C3I B;  4RGM A;  3EJI A;  3NBI A;  2IPK D;  1ILP A;  4K5W A;  1E0B A;  1PRT F;  4DA2 A;  3AU7 A;  1KLU D;  5E1F A;  2RDF A;  4CJ2 C;  1A15 A;  3CKI B;  2IX3 A;  3S14 B;  2KEE A;  4PNY A;  1H9S B;  3CRK C;  1LTT D;  4OO1 I;  3MHB A;  5CV6 A;  4RWS C;  4Y7N B;  3SR1 A;  2R92 B;  2F0U A;  2K05 A;  4F7X A;  3S15 B;  4B9X A;  4A3I B;  4ABN A;  1MSG A;  1V1P A;  3QWN A;  4HR7 B;  2A6E D;  5CMD A;  1SDF A;  1RJT A;  1G29 1;  3PMF A;  1XWE A;  3U9O A;  3OW7 A;  5BN4 A;  5C4J B;  1EYD A;  3H91 A;  1LTS D;  2MPM A;  1PRT B;  4KY6 A;  3S16 B;  2Y0S B;  1E2Z A;  1STB A;  2NVT B;  3HGB A;  4N9T A;  2LKV A;  1Z6H A;  3H0G B;  1DOM A;  3AMU A;  4KHV A;  2WII B;  1PFN A;  5CGK A;  5CV9 A;  5C4H A;  2QKI C;  2FMC A;  3R3O A;  2F0H A;  5TSS A;  3BVZ A;  1TQO A;  3BVM A;  5CV5 A;  2IWH A;  5EBD A;  1KDC A;  2YYZ A;  3TBI B;  1I4P A;  1YNJ D;  2H4O A;  3GP7 A;  1ET9 A;  1WTW A;  2QCP X;  4NDX A;  2X6L A;  1ESF A;  5EBC A;  2SNS A;  4X3K A;  1XXG A;  1FYC A;  3I91 A;  1QG7 A;  3WOF A;  5JAV A;  5HUR A;  4EQN A;  4RGN A;  1V1O A;  5KYI A;  1VMP A;  2PQE A;  3D3R A;  1DZ1 A;  1X3P A;  2EY1 A;  5IGB A;  3K57 A;  2E2D C;  2PW7 A;  3I8Z A;  3CHB D;  1O80 A;  2RQX A;  3D8G A;  5I2Y A;  3GTL B;  5I9O A;  4XT3 B;  1RTO A;  4QB4 A;  5D3D A;  4K5V A;  3Q23 A;  4DK0 A;  3TSS A;  5C5M A;  1HPC A;  3NUC A;  1AN8 A;  2VUM B;  1CZG A;  1F2Z A;  2EYF A;  3CU7 A;  2B63 B;  1FR3 A;  4WFN 3;  2QF7 A;  4CKE A;  1B9N A;  1F77 A;  1H9S A;  4HMI A;  5F2D A;  3Q22 A;  2Q8T A;  4YIJ A;  2VB2 X;  4UAI A;  1RDP D;  3BYY B;  3T56 B;  4TQU S;  3W3A A;  1Q3L A;  2F0J A;  5C3X A;  5EKL A;  2L55 A;  3VR6 A;  2B2Y A;  2KCN A;  3CQZ B;  3M7G A;  3JAM L;  4TSS A;  2A68 D;  2B2W A;  2SDF A;  1CQF A;  3BVG A;  1QNU A;  3R2I A;  4Q5V A;  2KVM A;  2M00 A;  4A3D B;  1WTO A;  2Z4I A;  2C5C A;  4ID6 A;  2OT2 A;  1JOO A;  1HTL D;  2F0E A;  1O7Z A;  2VNU D;  2TSS A;  1E2V A;  3MFY A;  4C56 C;  5JPN C;  2JP1 A;  1EY7 A;  1CT1 D;  4XT1 B;  1V8Q A;  2HCI A;  3DXJ C;  1DXM A;  4DFA A;  2VXW A;  2AQ1 B;  4BY7 B;  1LTG D;  3BG3 A;  3FRP B;  4BWG B;  1R9T B;  2CW0 C;  5M5Y B;  3KUP A;  1SNP A;  4FF1 A;  2KJX A;  1Q8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...