4OIKA

(quasi-)racemic x-ray crystal structure of glycosylated chemokine ser-ccl1.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 1
publication title (Quasi-)Racemic X-ray Structures of Glycosylated and Non-Glycosylated Forms of the Chemokine Ser-CCL1 Prepared by Total Chemical Synthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oikA00
1M8AA 1O7YA 2HDMA 1WVLA 1RTNA 2K01A 1B4OA 2L9HA 2L12A 3I91A 5CORA 1CM9A 2EPBA 3D6WA 2N55A 1EQTA 1G2TA 3H91A 4IUUA 1DZ1A 2KOLA 2B2WA 1DOLA 1F9SA 5CMDA 4IUQA 4CJ2C 4R8IA 1S4ZA 5EPLA 1RJTA 1WD1A 4U68A 1QG7A 1AP0A 4ZAIA 1EOTA 2JP1A 5EPKA 4XDXA 1JICA 3KBXA 2HUGA 1U4LA 2K05A 4MHEA 4R9WA 4ZK9B 1ML0D 2B2VA 5CBEE 1ILPA 2Q8RE 4QUCA 2NYZD 4HEDA 1SDFA 4IUVA 4UAIA 5E4WC 5T1GA 4NW2A 2D9UA 2B2YA 4IUTA 3FDTA 2XIWA 1PFMA 3DEOA 3HP3A 1DOKA 4ZKCB 2EOTA 2DY7A 1U4MA 1HUNA 2L11A 5D65A 4ZKBB 3SVMA 3TN2A 1RODA 1U4RA 3MWYW 4ZLTF 1BF4A 2K03A 5EKIA 1RTOA 4CJ0B 1CA5A 5T1IA 1F2LA 1G6ZA 2DY8A 4LMQD 4XT3B 2B2UC 1MSHA 3N52A 2MP1A 1GUWA 1U4PA 2HCCA 2L4NA 1JE4A 1KNAA 1SSOA 2J7ZA 2RA4A 2K1BA 2K04A 4OIKA 1AZQA 2NZ1D 4RWSC 4CJ1B 1WD0A 1NCVA 2B2TC 2EE1A 1RHPA 1VMPA 1WTQA 5AFWA 3QO2A 1NR2A 1XX8A 1B50A 1EIHA 2KEDA 1TVXA 2B2WC 2L1BA 2HDLA 1CA6A 1EL0A 2KECA 2M2LA 1ZXTA 1A15A 2FFKB 1WTRA 5CBAE 5EPJA 1DOMA 4DN4M 1J9OA 1E0BA 1Q3LA 3ONAB 1MI2A 4HCSA 1WTWA 2B2VC 2H1EA 1C8CA 2JYOA 1NAPA 2FHTA 2CVRA 1SAPA 2BDNA 2FJ2A 1VMCA 2FINB 2SDFA 2MPMA 2N88A 2R3ZA 2X69A 2VXWA 1PFNA 3GV3A 3P7JA 1QNKA 4X3KA 1J8IA 3MTSA 4RAUC 5EQ0A 1ICWA 1WTXA 1G91A 4QUFA 2RVLA 1G2SA 2RSNA 1PLFA 3R93A 4XT1B 1IL8A 1KNEA 1PFBA 1X3PA 1X3QA 1LV9A 2X6LA 3F2UA 2Q8TA 1QE6A 2MGSA 3KUPA 5JJZA 3IL8A 4RA8A 1ILQA 4IUPA 3I3CA 1IKLA 3I8ZA 2KEEA 4X3TA 5D14A 2NWGA 1B3AA 3TZDA 1BNZA 1B53A 1PDQA 1HRJA 1F9QA 1HFNA 3I90A 3FPUB 2B2TA 1X32A 5COYA 1DONA 5EJWA 1HHVA 4X3UA 1BBXC 2K28A 1AZPA 1F9PA 1WTPA 3GV6A 3Q6SA 1BO0A 4O42A 4OIJA 1MSGA 1ESRA 4X3SA 1HFGA 1O7ZA 1MGSA 3DM1A 1HUMA 4IURA 3G7LA 1WTVA 1IKMA 2B2YC 4HSVA 2KVMA 4MN3A 1WTOA 1O80A 4HAEA 1EIGA 5E4XA 1B2TA 2KUMA 2X6GA 1XYIA 3UI2A 1NR4A 2IL8A 2RSOA 1F9RA 2FMMA 2B2UA 3IFDA 3LWEA 1HA6A 3DEPA 5DNFA 2HCIA 2MJ8A
chains in the Genus database with same CATH superfamily
2F52A 1B4OA 5NUCA 5JPNC 4X64L 1A6XA 1OO9B 1SNQA 4DK3C 1ZEQX 1G2TA 4JI5L 3OMCA 4EQ5A 4BXXG 1LTID 3KLSX 4XXEA 2IX1A 5EPLA 1RJTA 1QG7A 3VR6A 1IYJB 1EY7A 4XDXA 1EUJA 2YU9H 2F1MA 2RHSB 5M3FG 2UU9L 1SMYD 1F2YA 2NZHA 1VQMA 4UHVA 1L0XB 3VYSA 3F1ZA 2L55A 2L0CA 3D8GA 2WB1G 1UE7A 1N34Q 1N33L 3ER0A 2D0PA 2B29A 1AH9A 4HSPA 4IQZA 1EZ6A 1M90C 4DV5L 5JJKA 4RGNA 2F0JA 3OWEB 2B63H 4A3MB 1TWGB 1MJCA 1L1OC 1NMFA 5JOBA 1EU3A 2EYFA 4GKJQ 4LFBL 1QUQA 5C4HA 2EE1A 1VF7A 1ESFA 3KDFA 3HOWG 3U9SA 2ZXRA 4GLVB 3OOCA 2D2CC 3FP9A 5CBAE 5EPJA 1K0SA 5IWAL 2F4VQ 1JE5A 4PNYA 2AHOB 3EFXD 3M4OB 4RG1A 3PIO3 1Q82C 2R7ZH 1EZ8A 4DFAA 1ICWA 2ENBA 1G51A 4L63B 5C0XH 1PLFA 2PZUA 2E2HB 1S5DD 3AFPA 1ZYRD 1IKLA 2OXPA 3M4YA 1IBLQ 3VR2A 4PZ7A 2DN8A 1EYGA 3PO2G 2QKIC 1KRTA 4HIKA 2ZXOA 1GKHA 2K28A 2E2DC 3Q6SA 5D3DA 4R1JA 3CW2C 3S1QB 2IW3A 2RBMA 1MGSA 4DPGA 1QUQB 4HR7B 2AUJD 1WTOA 2L15A 1HNXQ 1MBYA 2UXDQ 3VR4A 2ID0A 1OXUA 3V05A 4WJ3M 3WDNA 1GO3E 1O7YA 2EYLA 4LF5Q 3I70A 2PI2E 1A2TA 3I91A 1YEZA 1KQSA 2E75C 4RKBA 1FNUA 4A3BB 2Z6KC 4LFAL 1C9OA 2VUMH 4GKKL 3TZUA 5IGCA 1PH2A 4I65A 3DLLA 2JP1A 4KY6A 3FPPA 1Z7TA 3HOVB 2B2VA 1HTLD 5KIXA 1PYWD 4R4IA 5DM73 2O5JC 1TWHH 5E4WC 1PZKD 1RCVD 4JI4L 4UY8C 3T13A 2KHJA 3G48A 1T5XD 4RKLA 1SR3A 4A3EG 1BF4A 1Z6HA 4GOPC 4A3KG 4K2LA 3KLSA 1Q86C 3L2PA 2Q8IB 4M1UB 2AMCB 1QZHA 4IFDJ 2NVXB 3FEWX 2Z4HA 2L4NA 2Z9HA 3CMAA 4A93G 4A3IH 1AZQA 2K5HA 4JBKA 5IGGA 1EIHA 2OF1A 1HR0L 3BZCA 1IL2A 2VQFQ 1CZWA 4CGYB 1HNWL 1CTMA 1I6HB 4DN4M 1E0BA 1Q3LA 1Q8KA 1MI2A 1PH8A 3R2IA 4ULLA 1SAPA 3HKSA 1VMCA 3J81i 3M9BA 4RGMA 3GTMB 5HURA 2QEJC 4QUFA 3GQBA 1TQOA 2PNHA 3G4SA 2D62A 5C3EG 1AE3A 2LXJA 5EAYA 3RNUA 1PDQA 1Q90A 3CPWA 1HFNA 3FPUB 5A35A 4X65L 1PTOB 5L37A 4K0KL 1JR0D 1TKWB 3VR5A 4DV0L 1TWFB 4DR3Q 2F0TA 4HIOA 1SNDA 2SNSA 3Q24A 3AEVA 2EY5A 3PIOA 4GLXA 1TY0A 5C4JB 1EIGA 4YCUA 2K5VA 5EKLA 4BY1B 4DV3L 1LTAD 5AJ3Q 2LFNA 1I6VC 1YNJD 2OEOA 1QVFA 5FOBB 2N3SA 2NUCA 1IBKQ 5KNDA 3L3OC 5I9PA 1VQCA 2RCNA 1WD1A 3RD4A 4YCVA 3HOXG 2CH4W 1G8ZD 1VS0A 2G9DA 4OGQC 3DXJC 2NYZD 3HKZB 1JOOA 1I5FA 4Z9CB 4DV1L 3KOJA 1YHBA 4B3SL 1JQYD 5TSSA 3WOEA 3FDTA 4HCEA 2JQOA 4RH6A 4RCNA 1ICFB 1U4MA 2EXDA 1VQ9A 1H95A 3H3VC 4NDXA 5BR8L 3O13A 1TT2A 3J81E 1SNPA 4DR5Q 4MZ9A 3ULJA 2JE6I 2SOBA 2XWJB 1UE5A 2UU9Q 4K6LA 4BBRH 4AYBG 2JA8G 1WD0A 5C44H 5LMUL 3RZDH 1PH7A 4A3JB 3S1RH 1N33Q 3MZ5A 5M5YB 3OYYA 3F2CA 3MXNB 3ONAB 4OWXB 2IT1A 2JYOA 1C4QA 3OIQA 2PW5A 2ZXPA 3BDCA 1EWHA 3AU7A 4NPSA 1D5XC 1LTLA 2F0LA 2RQXA 5M3FH 4LFBQ 1X3PA 3KUPA 5JJZA 4P2CB 3FRPB 5D14A 4N9TA 1LABA 2KHIA 3GP7A 1HRJA 3GTOB 1JJCB 2K5NA 4MTKA 3T1YL 4GN3B 3H15A 4KD3A 5IWAQ 4DV2L 2K4KA 2PI2A 2Q2UA 4QL5A 1PXUA 4V0BA 3B6YA 2F0GA 5ELFA 5G3LD 4LFCQ 1RL2A 4C3IB 1CI3M 4HTHA 3H0GH 1RF2D 2A6EC 4OEMB 1GUSA 2PYKA 4MN3A 1STGA 4GS3A 1UEAB 4KY5A 4FF2A 2HIXA 3TS0A 2F0FA 3G6JB 3S2DH 2MFIA 2HDMA 1IBML 1MJEA 1PRTD 3SEBA 3AFQA 4YY3L 4CJ2C 1EY5A 1S4ZA 3DHQA 3FVQA 4EGVA 2QGQA 3A8JE 4MHEA 2YTVA 5E1FA 4FYDA 4RMFA 1IYVA 2Q2HA 4P71A 3PO3G 2EYHA 1O7LA 1BCPF 3SR1A 3SE0A 4LFAQ 5KNBA 1SN8A 4ZKBB 1EY0A 4JBMA 1VQLA 3CF5A 2Z6BA 5IGDA 3E5SA 4A3BG 1KDBA 5C0XI 3S1MB 1S5BD 2J4XA 4XQNA 5DAUA 1I4QA 4DNRB 3A0JA 5FJ8H 2EXZA 3NP8A 3J80L 1HTPA 1K83B 3CMEA 2B2TC 5F2DA 5FO7B 1VMPA 4JI4Q 5EBDA 1PHJA 1PYSB 4C2MH 4DV6Q 5IYDH 1A0IA 1K0RA 3I4NG 1TWCH 2JA7B 2WIIB 2JA5G 4XQQA 4HN7A 2XNAC 5CR3A 4X3KA 2WAQE 2EVBA 2LXKA 1LTSD 3MTSA 1I3QH 3S16H 5M9OA 1WTXA 1Y1VG 3I56A 4CDCC 5EBCA 4EQPA 2Q8TA 4IJHA 3STBC 2HQLA 3X3MA 3IL8A 4DAYA 3NBIA 2UUCL 1SYDA 4BBSH 1HR0Q 3A5ZB 1B53A 4C3HG 3N6RA 1KAAA 2GVAA 4POFA 1TS3A 1DONA 2ICIA 3W3AA 4O0AA 2VNUD 4A3EH 1AZPA 3U4VA 3K5NA 1ENAA 2F0VA 4KTAA 4A3KH 3H3VI 1HFGA 1SE2A 3TP6A 1S5CD 3JAMi 4K14A 1EY8A 5GQOA 1STBA 1I4RA 4HSVA 2EDGA 4A93H 2V4DA 2QILA 2TSSA 5I6WA 2CFMA 1GUOA 3S17B 4O2DA 1DXMA 3DWAA 5JVG3 4LF5L 4A3DH 4F88A 3PIP3 4JI2L 4X65Q 1JOQA 2N55A 3IRBA 4K0KQ 5CYUA 2I5MX 4ZRZA 4NMZA 4DV0Q 2VQEL 4HJ8A 2UXCQ 1ZKOA 3J7ZC 2EQSA 5G3LF 1A8VA 4HMIA 4A3CG 1BXTA 4POGA 3H94A 3K6OA 3OW2A 4B3RL 2R92H 4ILWA 3KF6A 3RZOH 4IALA 5C3EH 4JPBW 2B2YA 3J81c 1CHQD 3J7AF 1PFMA 1PRTF 2AWOA 2F3WA 4JG2A 4KKSA 5ELBA 4B08A 5IE8A 4A3FH 1GXDC 5CV7A 4S3SA 4ZQ3A 3K5MA 2PZTA 2LSSA 2NB0A 4DK0A 1CA5A 3PSIA 4FXGC 5T1IA 1FGBD 1D1IA 1E22A 1OTCA 1Q1EA 4OELB 2BDOA 2RA4A 1E7ZA 2K1BA 1NMGA 1BBUA 4DV1Q 2NZ1D 5JEAH 4RGTA 4B3SQ 3C1EA 2I5HA 4DR4L 3JAML 4LUVA 3M3YH 1Q8IA 1HZBA 4ODGA 4OWWB 1XTDA 1DOMA 2ZTCA 5FLXE 1KD1C 5BR8Q 3I4OA 2JN4A 3GTJH 2OQ0A 1ASYA 2MO0A 3HOZB 1IW7C 3BZKA 2FINB 1XNRQ 3JAME 1JC7A 4QQBX 3HOXH 1VCIA 5M5XB 3KF6B 1HXYD 1PFBA 1NSNS 4J1MA 4F8MA 2VW9A 1D5ZC 2KCNA 1L1OA 5LMUQ 1CKMA 3PUVA 3GTPH 1EYDA 1GOZA 2K75A 3CCLA 4MIUA 4DAPA 1Y1WB 3RN2A 1YI2A 3DUZA 2XWBB 4MTNA 1X55A 4G7ZC 3UDIA 1SFOH 4LF8L 5C4XB 1WTPA 1Y14B 3AB9A 4LUZA 1HZCA 1SXTA 4DR3L 1GM5A 3TMEA 2F0PA 1EYCA 2PMZB 1BOSA 1RD9D 1E2WA 2AUKA 1RDPD 1VQKA 2JA8H 2R7DA 2LS01 3R2TA 1GUTA 4HJ9A 1HR0W 2MJ8A 1LYLA 4JBWA 3W1GA 1TY2A 1HH2P 3NWSA 5JAVA 3I73A 2O2LD 5BN4A 3T1YQ 5IYBG 1VQOA 5FLMG 1A3VA 3GTKB 1LTBD 1FL0A 4JI8Q 3S2HB 3QIAA 4GNXB 3SGIA 3E6ZX 1EY4A 3K7UC 1ASZA 3PF5A 1EU4A 1YBYA 3K0YA 2DJFC 1L2FA 4C3IG 1CQFA 3EBEA 1YZ6A 2YV5A 1D7QA 1ET6A 1IBMQ 3HP3A 2K5QA 3A8KE 2EOTA 3J7A5 1PRTB 3C3LA 1TXYA 3QWNA 1KDCA 3EN2A 3PIPA 1DGSA 4H02A 4YY3Q 1R9TB 2A73B 3GO5A 1G6ZA 1X65A 2MQHA 2Z6KA 1SYBA 1XJVA 4WJWA 2Z1CA 2NN6H 3HOUB 1SRUA 1WCMH 1A3UA 4DR5L 4CKEA 2BE5D 2HQEA 1W3SA 1VQFA 3E0EA 4A3LH 3CQZH 5C5LA 2DNCA 2UUBL 2L1BA 1LUZA 1UNSA 5K36G 1A15A 2EYJA 3OIPA 2R93G 4C56C 1KLGD 3PUYA 4HCSA 2QEXA 2YYZA 1LTRD 2CVRA 2RCFA 2K33A 2DUDA 5HGTA 1H9KA 4JVZA 1K9MC 3I4LA 2Y0SE 4GOPA 4QB4A 3CRKC 3D6CA 4XT1B 2O4XA 3F2UA 1KXLA 2D0OA 1MHWC 3PO3H 2KEEA 2FXQA 4YWKA 1YVCA 4L5TA 3I90A 5JJIA 1KLUD 4X3UA 5J1ZA 3E0JA 4OIJA 4NXNL 4B3MQ 5IYCG 3F2DA 3SK5A 3H6MA 2JA7G 1GJXA 4QIWE 2CH4A 4LFCL 4JCVE 3CP0A 1F9RA 2NTTA 3LWEA 4P74A 4BY7G 2UUCQ 1Q12A 5CV9A 3BVMA 4UPAA 1SYEA 1V1OA 2C9OA 3QR8A 4H7BA 1CM9A 1FVIA 3A7AB 3D31A 3CXCA 2RHQB 2YU9B 1DZ1A 2KOLA 2K52A 1DYQA 3I4NH 2OTJA 4IUQA 2WACA 3HOYH 2JA5H 2B8GA 3DWPA 3MAQA 3LNNA 2JEAI 1EY9A 4A3GG 4R9WA 5ELEA 5IOCA 1Y1VH 4KHZA 3OW7A 4PV1C 1DM0B 1J6QA 2F0KA 4UP9A 3KDFB 4NW2A 4DGZA 5M3MB 1U5KA 1X3EA 3DEOA 4YCWA 3STBD 4JI2Q 1SYGA 4C3HH 2B63B 3OWFA 4C3JG 4IOCA 2BCOA 4QCLA 4ZLTF 4YWLA 3OTOL 2VQEQ 1JB7A 4DR1L 2QDBA 3DM3A 1IHZA 4XT3B 1CKOA 2WB1E 4DAMA 1CSPA 4B3RQ 1PZJD 4C1NI 2RF4A 5FLXc 2QW7A 3UDFA 3H3VH 1M4VA 1D6EC 4KJNA 2A6HC 4K6DA 3MXPA 4CDFC 3JAMc 3RLNA 3FKIH 1ZXTA 2FFKB 5CV6A 4P72A 2R7ZB 4DV6L 5J3BA 1I94Q 1AN8A 3PCOB 4JC0A 5C3XA 1NAPA 1ENFA 5ELOA 1FR3A 3BG3A 1U0LA 5BN3A 3CCJA 1LT5D 5D3IB 4DK1A 2ASBA 4C1NK 1LV9A 4DR4Q 3DMUA 2IX0A 3T56B 2ES2A 3K57A 2KCCA 1B3AA 3I55A 2XRQD 1VQGA 1X32A 3NBHA 2VB2X 1VQPA 3ZYYX 3KJPA 1SEBD 1MSGA 2FMCA 3TP5A 3I4MH 2C5CA 4DR6L 3MC0B 1S72A 2F0SA 4OWTB 2RKSA 3D4DA 1NR4A 4H44C 2VUMB 1XNQL 4IPGA 4JI7L 3T16A 1FGUA 3M4PA 2EY2A 1NJIC 4LF8Q 2XTIA 2I07B 2D5DA 1Y1WG 4XYOA 5CMDA 4WORA 2CW0D 2F0NA 1EEID 2UXCL 5C4XG 1MKHA 1TWHB 1E3PA 1EQQA 1IW7D 2ZJRA 3EVQA 4HMJA 4I7AA 2BH8A 1WJJA 1CUKA 2P5ZX 3BYTB 3BZDB 4QUCA 3UE0A 4OHJA 4K5WA 5C0XJ 4LF7Q 3M4QA 2KCMA 3CC4A 2HD3A 2XIWA 4ZCKA 1BCPD 5JJLA 2NVTH 4L5QA 3WOFA 4ABNA 4JYAQ 1SBBB 5M5WH 4G4KA 1U4RA 3MWYW 2I5LX 4J8QA 2A74C 3S14H 2UXBL 5I2XA 2DNEA 4A3IB 2JA6G 4AH6A 2DY8A 2PZWA 2N78A 5IGEA 3CAMA 1MSHA 1SLJA 1MIUA 2E76C 1GUWA 1Y69U 2KCTA 3EIVA 1QILA 2K04A 3RMHA 5H1SE 3KLWA 1NNXA 2E5LQ 4CJ1B 1NTGA 3P75A 2A69D 4R8NA 1XX8A 2F4IA 4WFN3 1MD2D 2F0EA 3W2DA 1DJRD 3SXHA 3OMGA 4BWGB 2B2VC 2ZT9C 4DU9A 3A5UA 3HS0C 3NSWA 3TBIB 1PH5A 2SDFA 2NVYH 4IN3A 2XN9C 1XNRL 4IJLA 4RAUC 4FVMA 2KHSA 3GTQH 4JOIC 1IL8A 1KNEA 1SJED 3E3XA 2VS1A 4IO9A 1QE6A 2UUBQ 4KMUC 1PTOC 3Q0AA 1V1QA 2V1CC 1VQNA 1SMXA 2UUAQ 3QOJA 4X62Q 2B2TA 4RFBA 4DAVA 4O1NA 1HHVA 4K5VA 5K5PA 4LF4L 4BXXH 4L5RC 2BA1A 2NVQH 1G6PA 3AQQA 4DV7Q 5IP7G 4A3MG 3HEJA 1B2TA 1XYIA 1PA6A 3TS2A 2Y0SB 2B2UA 1E1TA 3P1HA 1KDAA 2F03A 2WFWA 3PF4A 5K36H 2EYPA 3NELA 1HQRD 1PH3A 2NN6I 3VR3A 4QJFA 4U673 1H9SA 1P8LA 2R93H 2A19A 4NXNQ 1VQHA 3J80i 1HPCA 3EQLC 3U58A 1YNNC 5C4ZA 4JI8L 4E6IA 5IGFA 2Q2IA 2E2JH 1LACA 4UAIA 5T1GA 2AQ2B 4B9XA 3HOWH 1DOKA 3T51B 2DY7A 2RDHA 1GUNA 3G6EA 4ME3A 1N36Q 3LGJA 4KKTA 4DKAC 4IFDG 1Z47A 4KI0A 1RTOA 1SYCA 2CHBD 2Z8LA 4BBRB 4Q5VA 2PQAA 1TS4A 5C44B 3RZDB 1SSOA 3R8BA 1K8AC 1EWCA 2A8VA 3S1RB 1SYFA 1PH4A 2XRSD 1PV4A 1PH9A 2K6AA 1A62A 2CQAA 1E24A 4BY7H 2K50A 1BR9A 2AKWB 5M3MG 5LL6S 3ULLA 3PO2H 3OTOQ 4AYBE 5LHY1 1JT8A 4DR1Q 5M3FB 1J8IA 2LKVA 3CRLC 4OX9Q 1HJPA 4ID6A 4YHHQ 5CGKA 2EYOA 2RVLA 3S1NH 4A3GH 2F0WA 2E74C 3R93A 1F77A 1PYBA 4H13C 2X6LA 3HOVG 4OO1G 2CQOA 4RA8A 4X3TA 1B3QA 1BNZA 3DWQA 3TZDA 4G7HC 1F9QA 1AFPA 2KBNA 3ND8A 4C3JH 3ERQA 1V8QA 2MHVA 3H0GB 3J80E 2IHFA 4DNTB 4Y7NH 2ZJPA 2R7ZG 1FJGL 1PZID 4B3ML 2HT1A 1O7ZA 4H0LC 2YTXA 3S2DB 1ZYRC 3FMCA 4JBJA 3NHHA 3UI2A 3PGZA 2RSOA 1A3TA 4UP7A 1I4PA 1TWAH 1Y8NB 1Y8OB 2EPBA 2A6HD 3D4WA 4F87A 2CCZA 1NY4A 2PCFB 4HJAA 2BOSA 2B2WA 1F9SA 5CV8A 1VF5C 3TREA 3PQIA 1YJWA 3GTGB 1SROA 3MEHA 5I2YA 4LAAA 4DR6Q 1U4LA 2E2IH 1M1KC 2KJXA 4GN5A 2VB3X 1IXRA 1SDFA 5I6YA 4DNIA 1XNQQ 1ET9A 1STNA 4JI7Q 1VQDA 1B7YB 4L8JA 4UDUC 2WINB 2IWHA 1UE6A 1I50H 1HUNA 2F0OA 1VQEA 3CCMA 5LMNL 2A68C 4PZ6A 1T9HA 2K7VA 3RLFA 1F2LA 3TP7A 1XMQL 2HCCA 3IKJA 2J7ZA 2G9HD 4B9WA 4KV6A 1Q46A 2ZM6L 4C2MB 4DAYB 4JI0L 1TWCB 2KECA 4DR7Q 1BCPB 4BY1G 5A2QL 3U50C 1QVGA 2OTLA 2Z0SA 2EJFC 4CDEC 1I3QB 3I7FA 4LF9L 3S16B 3S15H 1B9MA 2UXBQ 4G7OC 3U4ZA 1I94L 5FKAC 5IIFA 2EZVA 2VXWA 1QB5D 1QNKA 2VL6A 4L5SA 4K5XA 3J81j 1G91A 1Q1BA 2LY7A 4BBSB 3BVZA 3IAYA 3C2PA 3D3RA 4TQUS 2MUYA 3K81C 1N32Q 4A3EB 2F0DA 2L5TA 4WJ4A 3W5OA 2NWGA 4N8FA 3T1HQ 3HKZG 4J15A 4JV5L 1X3GA 3NUCA 4A3KB 2EJMA 1X56A 4PG3A 1VQBA 1BBXC 3VA7A 5IP9G 1N9WA 5CV4A 4R4OA 4A93B 3KK7A 1EEFD 3GDEA 3GTLH 1B8AA 5C6AA 1VQ8A 2JA6H 4PMCA 4TSSA 4HAEA 4A3DB 2KUMA 1HA6A 1L0WA 5ISRA 3QJYA 2Z4IA 2B3GA 2RDFA 4QF4A 4IUNA 3KF8A 1WVLA 1YHAA 2IY5B 5KYIA 3QOLA 2XGTA 1PFSA 2DJGC 4NB3A 3K7AH 4A3JG 3CCSA 2JXMB 4LF4Q 4R8IA 3Q8DA 2R92B 3RZOB 1X3FA 2GVBA 5C3EB 1ML0D 4DR2Q 3UDXA 3A8IE 1YNJC 4A3FB 4IPHA 4KJOA 4LF7L 4ZKCB 1PTOD 3ITPA 2K5DA 5LL6X 3CCEA 4JYAL 3TDQA 4JI3Q 4R4CA 2EYMA 2WKCA 4EQNA 1WFQA 2EIFA 1U4PA 2PNRC 4OXPA 1HNZL 4R4QA 3M3YB 1CSQA 1EFID 5IP7H 2SNMA 3AYHB 1TWGH 4A3MH 1L1OB 2E5LL 5EKKA 2DGYA 2YTYA 3KF8B 1B50A 1EL0A 3GTJB 2F0QA 3M7GA 4CKBA 3PUXA 4LUOA 1N8RC 1K73C 5CV5A 3HOXB 2H1EA 4XIGS 2JK8A 2MPMA 3P7JA 2A5HA 3BVGA 3VDYA 3GTPB 4BBRG 1X3QA 3I72A 3M4OH 2F0UA 5C44G 1SE4A 1I4HA 3J80c 2MGSA 2A6ED 4G57A 2G5DA 5DLQE 4AQYQ 3V96A 1SFOB 4OL7A 2E2HH 1JWMD 2EY1A 4IPDA 2UUAL 3MA2B 2GN5A 1KL9A 4X62L 1CFMA 4LF6L 5GAHC 3NTKA 4IFDH 1K3BC 3A54A 2CWAA 4AYBB 2JA8B 2PQEA 4NP5A 1WTVA 1E1OA 2GA4B 2KVMA 3HG9A 2X6GA 3HGBA 4DV7L 3G71A 3S1QH 3K5LA 3ERSX 3IFDA 1XPUA 2FMMA 3SK8A 4B3TQ 5JEAJ 1QVCA 4CBVA 2K01A 2L12A 5M3MH 4KD4A 3CC7A 1EWIA 4GNXC 3C1FA 1FJGQ 1JJGA 2JEBI 3ZJYC 4A3BH 3H0GG 4JI6Q 2K05A 4K8IA 1FNVA 4LW1A 2WAQB 4IUVA 1KHIA 4L6TB 1PRTC 3HOVH 1FD7D 1XXGA 5I4DA 1CZGA 3E9IA 4OO1H 3UDGA 4LK1C 1G291 1WCMB 1YHQA 1VQIA 1N36L 2KENA 2WKDA 2K5WA 3KFUA 5IY0A 1GD7A 4YWMA 4GOPB 3CQZB 1QWYA 1TIID 3NXWA 1CQVA 3BS1A 3MXUA 4OIKA 1RHPA 3ULPA 1YJ9A 2NVXH 1TS2A 4CDDC 5GAEC 3MXGA 1CA6A 3VYUA 1BDOA 1O78A 2M00A 1PTOF 1LLRD 1J9OA 5LMNQ 2VY3A 1Q7YC 1I6HH 1XMQQ 2R3ZA 2X69A 1LO5D 2BH2A 4KHPL 1L0YB 2OCEA 5FJ8G 3PO3B 4OX9L 1UEBA 1WYDA 4YHHL 4XQJA 2ZM6Q 2ICEC 1UUPA 5E3FA 3GTMH 2PO4A 4GN4B 3TSSA 1HZ9A 3BDOA 4JI0Q 1UWVA 3FHWA 3OSOA 5IYDG 3I2ZA 1STEA 4MNOA 4PZ8A 4PQXA 2SEBD 4LF9Q 3CPFA 3D0FA 3RN5A 4QY7A 3HZXA 1RIPA 2C35B 1VQ4A 1VQ5A 2A68D 4BA1I 3SK4A 1PTOH 3DM1A 3CD6A 4IURA 1XTCD 1IKMA 2H5XA 2QF7A 3A7LA 4A3CH 2RDGA 1TWFH 1JJ2A 1GHJA 4BBSG 2NTSA 5KRUA 2IHEA 4JOIA 1SE8A 1T5EA 1I4XA 1RTNA 3I4NB 4JV5Q 5C4JH 4X66L 3NEMA 4FF1A 3HOYB 2JA5B 3D6WA 4BY1H 2AQ1B 4IUUA 1AEXA 1DOLA 1S5ED 5ELNA 1VQJA 1Y1VB 2AWNA 4FXDA 1PH6A 1TR5A 2JSOA 2WP8J 3CHBD 3HOZG 1ILPA 2LMCB 2F0MA 3A55A 4HEDA 4C3HB 2B8FA 3URYA 2D9UA 3IFTA 4A3DG 3HRZC 3MFGA 1JWUD 1CHPD 1SNCA 4FXKC 2XSCA 4HIDA 4ZUIA 3SK6A 3NENA 1H9MA 4DXFA 2HHHL 2K03A 3D4RA 3Q22A 1XMOL 5IP9H 1AE2A 1CT1D 4LWCA 3N52A 3NTIA 4FP5D 3SHLA 3CKIB 2R92G 1JE4A 1KNAA 2KQ3A 3FKIB 1CKNA 4RWSC 2PW7A 1YNXA 3CCQA 1LT6D 4A76A 3QO2A 1NR2A 2KEDA 1TVXA 4DUYL 1SNOA 2J0TD 4A3FG 5E7NA 1EIFA 3NBHB 1WTRA 1IYUA 4DR7L 4DXGA 2QDLA 1LT4D 4YIJA 1C8CA 1W2BA 4HIMA 4F7XA 4A3JH 1IZ6A 2FJ2A 1U9RA 2XVSA 4KN7C 1HZAA 3GV3A 3KYHC 5M5YH 1PFNA 4FDBA 1OXSC 2OQKA 1HNZQ 5JEAG 4RGOS 3QB3A 4TVAB 1X9NA 3EJIA 4KY7A 1CK1A 1FNWA 1VQAA 4LNQA 1FYCA 5EGTA 1R4QB 4NKLA 1N32L 3T1HL 4JI1L 2JA9A 5LMNW 4IOAA 1ONLA 1GHKA 3I4MB 1XWEA 4ME5A 1F2ZA 1I4GA 2MNAA 3NE5B 3RR5A 1DCZA 3MXNA 5IYBH 3ICEA 4NXMQ 4O42A 5FLMH 3GTOH 1B1ZA 3S24A 1S5FD 2VZAA 5FO8B 5KEEA 2WV6D 3G7LA 1CKNB 4BS9A 3HOUG 3J81L 2IL8A 2ALYB 4C3IH 1B44D 2HCIA 1M8AA 2IX3A 1A63A 4X64Q 2IJ0A 4DUZL 3TRZA 1E2VA 1C7YA 4JI5Q 1O7IA 2HIVA 1KRSA 3H91A 4LF6Q 4U68A 1W6KA 5KNCA 4IPCA 3R3OA 5EPKA 2TMPA 1NUCA 3PUZA 3EROA 1TS5A 1BBWA 1EYAA 4LJZC 4P73A 4DR2L 5GAGC 2NVTB 4M8AA 5M5WB 2EJGC 3S14B 3J7AV 1KABA 1K28A 4ZYSA 5D65A 4DV5Q 3BU2A 1SJHD 5EKIA 1X6OA 2PMZE 4JI3L 3KLRA 4JK1C 3S9WA 4LMQD 4FNFA 3MHBA 4DF7A 2MP1A 1SNMA 3S1MH 4QIWB 2F3VA 3VYTA 4HJ5A 1NCVA 4WRDA 1UAPA 4Q0FA 1WOCA 5AFWA 4GLAC 3CCRA 3SDZA 2WAQG 3UE1A 4IFDI 4K8JA 1K83H 1KTKA 2H4OA 1C48A 2NVYB 5GADC 1NBWA 3V2TA 2IPKD 1J5EL 1D2BA 1WTWA 5CC4A 1VDZA 1X54A 4JW0A 3GTQB 2NN6G 2R61A 2BDNA 1WCMG 5C3WA 4DV4L 2N88A 4KK7A 5IYCH 4Y52H 1LM0A 2BE5C 1S40A 1SMYC 4KKUA 2JA7H 1G2SA 3MFYA 4A3LG 3TQYA 4A4IA 1HQMC 1HCZA 3C46A 3KBGA 4AQYL 4FF3A 3F8TA 1B70B 5COYA 3K80C 1KIXA 1H9SB 2NVQB 1BUVT 5ELDA 4QMGA 2B63G 4P75A 4X3SA 1D5MC 3OPOA 2N8NA 3LX0A 3K59A 5FK9C 4KHPQ 1QOHA 1WI5A 4OO1I 3GTGH 5BN5A 3K5OA 5DEHA 4CKCA 5IT9L 2WB1B 2E8GA 3DEPA 2R93B 4DA2A 4B3TL 2MO1A 5KGUA 2PPBC 5CORA 1STHA 3M85A 1N34L 1HA5A 1EOVA 3S17H 4GKKQ 1EQTA 3TEHB 3MEFA 4K2KA 4TRDA 5IT9E 2E2JB 2BA0A 1H9RA 1V1PA 2PQAB 1AP0A 1BQQT 1EOTA 3RLOA 1JICA 1GUGA 2I0QA 3L0OA 2HUGA 1KC8C 4J6HA 5C0XG 4UP8A 3RUZA 5IGBA 1YJNA 4JI6L 2Q8RE 3L7ZC 2M9VA 3HOWB 4GKJL 3T4AC 4QGUA 5IODA 4IUTA 4EQOA 1QCBD 3E9HA 4X66Q 1UE1A 2OWOA 4AIMA 3NQTA 4ALPA 2R6GA 1II3A 3TN2A 3AMUA 1RODA 3T53B 3HOYG 4CJ0B 1LTTD 1JCKB 3H09A 2F4VL 1PMRA 3PMFA 2B2UC 1K8MA 5HGQA 4KHVA 4BY7B 1Q81C 3PUWA 4EVOA 1EFWA 1B9NA 3W1BA 3PO2B 1D1KA 1H9JA 5ELCA 1HNWQ 1IBLL 1YITA 4DK6C 5FO9B 1EIYB 3OHXC 2QCPX 2VUMG 1JWSD 2K32A 2HHHQ 1V1PB 1OXVA 4RCOA 4A3GB 1XMOQ 2ZJQA 3S1NB 4X6AH 2FHTA 2NBFA 3K0XA 1W6JA 3TP8A 3KJOA 3MVVA 5JPMC 3HOZH 2Q2TA 1HNXL 3JC66 1KAWA 1LTGD 3QG1A 2UXDL 4C3JB 2AQ3B 4DUYQ 3I8ZA 3FKIG 5M5XH 4HJ7A 4Y7NB 4PMWA 3CU7A 4EX5A 1EY6A 1K8GA 3A56A 4ZUJA 4GZYC 1AW7A 1F9PA 3GV6A 1BO0A 3HFZB 1Y1WH 2ZTEA 2A1AA 4FF4A 2ATWA 1HUMA 2JJQA 2NZOA 1K8OA 2CWPA 5C4XH 1NE3A 1S3OA 3U9OA 1TWAB 1R4PB 5A2QE 4A3IG 1EQRA 1V43A 4DV3Q 4BA2I 4OONA 2I46A 4V190 2F3IA 1VQ6A 4R4TA 3WWVA 5I9OA 3A74A 1QZGA 2L9HA 3GD7A 4JI1Q 5JVH3 3EA6A 2OT2A 3ND9A 1XPOA 1JB3A 3J7YW 2E2IB 4XTCS 3PV0A 1PH1A 1BKBA 1ENCA 3NK9A 3I4MG 4N8X1 1YIJA 4ZAIA 3L9AX 1V9PA 3KBXA 4ZK9B 3GTKH 5FLXL 5CBEE 4KLKA 1I50B 3S2HH 1OXTA 2F0IA 5J39A 3M7NA 5J22A 1JOKA 2K14A 2O5IC 4DUZQ 3X3NA 2VQFL 2CW0C 2L11A 3CCVA 1C0AA 3SVMA 1D8LA 3K8AA 1XPRA 1RKNA 2EY6A 2ZTDA 5KYLA 4N9PA 3F2BA 1LT3D 3VA5A 4GNXA 1R9TH 1QNUA 1STYA 3NWTA 2R7FA 3HOUH 4TKOB 1QJOA 1BCPC 2CKZB 4APVA 1Z9FA 1WTQA 1K3RA 3NPPA 2B2WC 3S15B 1E2ZA 2F0HA 2HDLA 2B39A 2M2LA 1SE3A 2Y0SG 4PMBA 3CC2A 3BYYB 1WTHA 1Y8PB 3P20A 3NQIA 3LWUA 4RHRA 1JORA 5DM63 1A2UA 4IZ8A 5C5MA 5EQ0A 2A69C 5GROA 4XYQA 3CCUA 2RSNA 2N49A 3BJUA 4CHTB 1P16A 1VQ7A 1GVPA 1ILQA 4IUPA 3I3CA 5AJ3L 4FO2A 1EQVA 1BVSA 1DD2A 5EJWA 3GTLB 5HY6A 1PVOA 1IBKL 2JA6B 1J5EQ 4DV2Q 3BDLA 2KA7A 1STAA 3NTHA 4RHSA 4NXML 1ESRA 4DV4Q 4A75A 3K58A 1OXXK 3HKZE 1JMCA 4KN4C 1TU2B 1F2MA 2B2YC 1YNND 1O80A 5E4XA 3VYRA 3Q23A 5IT9c 2QA4A 3K7AB 5DNFA 4I7ZC
chains in the Genus database with same CATH topology
1B4OA 5NUCA 5JPNC 1A6XA 1OO9B 1SNQA 1ZEQX 1G2TA 3OMCA 1LTID 3KLSX 4XXEA 2IX1A 5EPLA 1RJTA 1QG7A 3VR6A 1EY7A 4XDXA 2F1MA 1SMYD 1F2YA 1L0XB 3VYSA 2L55A 2L0CA 3D8GA 4HSPA 4IQZA 1EZ6A 4RGNA 2F0JA 3OWEB 4A3MB 1TWGB 5JOBA 1EU3A 2EYFA 5C4HA 2EE1A 1VF7A 1ESFA 3U9SA 2ZXRA 3OOCA 2D2CC 5CBAE 5EPJA 4PNYA 3EFXD 3M4OB 3PIO3 1EZ8A 4DFAA 1ICWA 2ENBA 4L63B 5C0XH 1PLFA 2PZUA 2E2HB 1S5DD 1ZYRD 1IKLA 2OXPA 3M4YA 3VR2A 2DN8A 2QKIC 2ZXOA 2K28A 2E2DC 3Q6SA 5D3DA 3S1QB 2IW3A 2RBMA 1MGSA 4HR7B 2AUJD 1WTOA 1MBYA 3VR4A 2ID0A 1OXUA 3V05A 3WDNA 1O7YA 2EYLA 3I70A 1A2TA 3I91A 2E75C 4RKBA 1FNUA 4A3BB 3TZUA 5IGCA 4I65A 2JP1A 4KY6A 3FPPA 1Z7TA 3HOVB 2B2VA 1HTLD 5KIXA 1PYWD 5DM73 2O5JC 5E4WC 1PZKD 1RCVD 3T13A 1T5XD 4RKLA 1BF4A 1Z6HA 4K2LA 3KLSA 2Q8IB 4M1UB 4IFDJ 2NVXB 3FEWX 2Z4HA 2L4NA 1AZQA 5IGGA 1EIHA 2OF1A 1CZWA 4CGYB 1CTMA 1I6HB 4DN4M 1E0BA 1Q3LA 1MI2A 3R2IA 4ULLA 1SAPA 1VMCA 4RGMA 3GTMB 5HURA 2QEJC 4QUFA 3GQBA 1TQOA 2D62A 1PDQA 1Q90A 1HFNA 3FPUB 5A35A 1PTOB 1JR0D 1TKWB 3VR5A 1TWFB 2F0TA 1SNDA 2SNSA 3Q24A 2EY5A 1TY0A 5C4JB 1EIGA 5EKLA 4BY1B 1LTAD 2LFNA 1I6VC 1YNJD 2OEOA 5FOBB 2NUCA 5KNDA 3L3OC 5I9PA 1WD1A 3RD4A 1G8ZD 2G9DA 4OGQC 3DXJC 2NYZD 3HKZB 1JOOA 4Z9CB 1JQYD 5TSSA 3WOEA 3FDTA 4HCEA 4RH6A 4RCNA 1U4MA 3H3VC 4NDXA 3O13A 1TT2A 3J81E 1SNPA 2JE6I 2SOBA 2XWJB 4K6LA 1WD0A 4A3JB 3MZ5A 5M5YB 3ONAB 2IT1A 2JYOA 1C4QA 3OIQA 2PW5A 2ZXPA 3BDCA 1EWHA 3AU7A 1D5XC 2F0LA 2RQXA 1X3PA 3KUPA 5JJZA 4P2CB 3FRPB 5D14A 4N9TA 1LABA 3GP7A 1HRJA 3GTOB 4KD3A 1PXUA 4V0BA 2F0GA 5ELFA 5G3LD 4C3IB 1CI3M 4HTHA 1RF2D 2A6EC 1GUSA 2PYKA 4MN3A 1STGA 1UEAB 4KY5A 4FF2A 2F0FA 3G6JB 2HDMA 1PRTD 3SEBA 4CJ2C 1EY5A 1S4ZA 3DHQA 3FVQA 4EGVA 3A8JE 4MHEA 5E1FA 4FYDA 1IYVA 2EYHA 1O7LA 1BCPF 3SR1A 3SE0A 5KNBA 4ZKBB 1EY0A 5IGDA 3E5SA 1KDBA 5C0XI 3S1MB 1S5BD 2J4XA 4XQNA 5DAUA 1I4QA 4DNRB 2EXZA 3NP8A 3J80L 1HTPA 1K83B 2B2TC 5F2DA 5FO7B 1VMPA 5EBDA 2JA7B 2WIIB 4XQQA 4HN7A 2XNAC 5CR3A 4X3KA 2EVBA 1LTSD 3MTSA 5M9OA 1WTXA 5EBCA 4EQPA 2Q8TA 3X3MA 3IL8A 4DAYA 3NBIA 1SYDA 1B53A 4C3HG 3N6RA 1KAAA 1TS3A 1DONA 2ICIA 3W3AA 2VNUD 1AZPA 3K5NA 1ENAA 2F0VA 4KTAA 1HFGA 1SE2A 3TP6A 1S5CD 4K14A 1EY8A 1STBA 1I4RA 4HSVA 2EDGA 2V4DA 2QILA 2TSSA 5I6WA 3S17B 1GUOA 1DXMA 3DWAA 5JVG3 4F88A 3PIP3 1JOQA 2N55A 5CYUA 4ZRZA 4NMZA 1ZKOA 5G3LF 4HMIA 1BXTA 3H94A 3K6OA 4ILWA 4IALA 2B2YA 1CHQD 3J7AF 1PFMA 1PRTF 2AWOA 2F3WA 4KKSA 4B08A 5ELBA 1GXDC 5CV7A 4S3SA 4ZQ3A 3K5MA 2PZTA 2NB0A 4DK0A 1CA5A 4FXGC 5T1IA 1FGBD 1D1IA 1Q1EA 2BDOA 2RA4A 2K1BA 2NZ1D 5JEAH 4RGTA 3C1EA 3JAML 1Q8IA 4ODGA 1DOMA 5FLXE 3HOZB 1IW7C 2FINB 3JAME 1JC7A 1VCIA 5M5XB 1HXYD 1PFBA 1NSNS 4J1MA 4F8MA 1D5ZC 2KCNA 3PUVA 1EYDA 1GOZA 4MIUA 4DAPA 1Y1WB 3DUZA 2XWBB 4G7ZC 5C4XB 1WTPA 3AB9A 1SXTA 3TMEA 2F0PA 1EYCA 2PMZB 1BOSA 1RD9D 1E2WA 2AUKA 1RDPD 2LS01 3R2TA 1GUTA 2MJ8A 4JBWA 1TY2A 3NWSA 5JAVA 3I73A 2O2LD 5BN4A 1A3VA 3GTKB 1LTBD 3S2HB 3QIAA 3E6ZX 1EY4A 1EU4A 3K0YA 4C3IG 1CQFA 1ET6A 3HP3A 2K5QA 3A8KE 2EOTA 1PRTB 3C3LA 3QWNA 1KDCA 1R9TB 2A73B 3GO5A 1G6ZA 3HOUB 1SYBA 4WJWA 2Z1CA 2NN6H 1A3UA 4CKEA 2BE5D 2HQEA 5C5LA 2DNCA 2L1BA 1UNSA 5K36G 1A15A 2EYJA 3OIPA 4C56C 1KLGD 3PUYA 4HCSA 2YYZA 1LTRD 2CVRA 2K33A 5HGTA 1H9KA 3I4LA 4QB4A 3CRKC 3D6CA 4XT1B 2O4XA 3F2UA 2KEEA 3I90A 1KLUD 4X3UA 5J1ZA 3E0JA 4OIJA 3SK5A 3H6MA 1GJXA 1F9RA 2NTTA 3LWEA 1Q12A 5CV9A 3BVMA 1SYEA 1V1OA 2C9OA 4H7BA 1CM9A 3A7AB 3D31A 2YU9B 1DZ1A 2KOLA 1DYQA 4IUQA 2WACA 2B8GA 3DWPA 3MAQA 3LNNA 2JEAI 1EY9A 4R9WA 5ELEA 5IOCA 4KHZA 3OW7A 4PV1C 1DM0B 2F0KA 4DGZA 4NW2A 5M3MB 3DEOA 1SYGA 2B63B 3OWFA 4C3JG 2BCOA 4QCLA 4ZLTF 2QDBA 1IHZA 4XT3B 1PZJD 4C1NI 1M4VA 1D6EC 4KJNA 2A6HC 4K6DA 3MXPA 1ZXTA 2FFKB 5CV6A 2R7ZB 1AN8A 5C3XA 1NAPA 1ENFA 1FR3A 3BG3A 5BN3A 1LT5D 5D3IB 4DK1A 4C1NK 1LV9A 3DMUA 2IX0A 3T56B 3K57A 2KCCA 1B3AA 2XRQD 1X32A 3NBHA 2VB2X 3ZYYX 1SEBD 1MSGA 2FMCA 3TP5A 2C5CA 3MC0B 2F0SA 2RKSA 3D4DA 1NR4A 4H44C 2VUMB 3T16A 2EY2A 2I07B 2D5DA 4XYOA 5CMDA 4WORA 2CW0D 2F0NA 1EEID 1TWHB 1IW7D 3EVQA 4HMJA 3BZDB 3BYTB 4QUCA 4OHJA 4K5WA 5C0XJ 2XIWA 1BCPD 3WOFA 4ABNA 1SBBB 4G4KA 1U4RA 3MWYW 4J8QA 2A74C 5I2XA 2DNEA 4A3IB 5IGEA 2DY8A 2PZWA 1MSHA 2E76C 1GUWA 1Y69U 1QILA 2K04A 3RMHA 4CJ1B 3P75A 2A69D 4R8NA 1XX8A 2F4IA 4WFN3 1MD2D 2F0EA 3W2DA 1DJRD 3SXHA 3OMGA 4BWGB 2B2VC 2ZT9C 4DU9A 3HS0C 3NSWA 3TBIB 2SDFA 4IN3A 2XN9C 4RAUC 4FVMA 2KHSA 1IL8A 1KNEA 1SJED 1QE6A 4KMUC 1PTOC 3Q0AA 3QOJA 2B2TA 4RFBA 4DAVA 4O1NA 1HHVA 4K5VA 5K5PA 2BA1A 3HEJA 1B2TA 1XYIA 2Y0SB 2B2UA 3P1HA 1KDAA 2F03A 5K36H 2EYPA 1HQRD 2NN6I 3VR3A 4U673 1H9SA 1HPCA 3EQLC 1YNNC 5C4ZA 4E6IA 5IGFA 1LACA 4UAIA 5T1GA 2AQ2B 4B9XA 1DOKA 3T51B 2DY7A 2RDHA 1GUNA 4KKTA 4IFDG 1Z47A 4KI0A 1RTOA 1SYCA 2CHBD 2Z8LA 4BBRB 4Q5VA 1TS4A 5C44B 3RZDB 1SSOA 3R8BA 1EWCA 3S1RB 1SYFA 2XRSD 2K6AA 2CQAA 1BR9A 5LL6S 5LHY1 5M3FB 1J8IA 2LKVA 3CRLC 4ID6A 5CGKA 2EYOA 2RVLA 2F0WA 2E74C 3R93A 1F77A 4H13C 2X6LA 4OO1G 4RA8A 4X3TA 1BNZA 3DWQA 3TZDA 4G7HC 1F9QA 1AFPA 3ND8A 3ERQA 1V8QA 2MHVA 3H0GB 3J80E 4DNTB 1PZID 1O7ZA 4H0LC 3S2DB 1ZYRC 3FMCA 3NHHA 3UI2A 2RSOA 1A3TA 1I4PA 1Y8NB 1Y8OB 2EPBA 2A6HD 3D4WA 4F87A 2PCFB 2BOSA 2B2WA 1F9SA 5CV8A 1VF5C 3GTGB 3MEHA 5I2YA 4LAAA 1U4LA 2KJXA 2VB3X 1SDFA 5I6YA 1ET9A 1STNA 4L8JA 4UDUC 2WINB 2IWHA 1HUNA 2F0OA 2A68C 2K7VA 3RLFA 1F2LA 3TP7A 2HCCA 3IKJA 2J7ZA 2G9HD 4B9WA 4KV6A 4C2MB 1TWCB 2KECA 1BCPB 5A2QL 2EJFC 1I3QB 3S16B 4G7OC 1B9MA 5FKAC 5IIFA 2EZVA 2VXWA 1QB5D 1QNKA 4K5XA 1G91A 1Q1BA 2LY7A 4BBSB 3BVZA 3IAYA 3C2PA 3D3RA 4TQUS 2MUYA 4A3EB 2F0DA 2L5TA 2NWGA 3NUCA 4A3KB 2EJMA 1BBXC 3VA7A 5CV4A 4A93B 3KK7A 1EEFD 5C6AA 4PMCA 4TSSA 4HAEA 4A3DB 2KUMA 1HA6A 5ISRA 3QJYA 2Z4IA 4QF4A 2RDFA 4IUNA 3KF8A 1WVLA 5KYIA 3QOLA 2JXMB 4R8IA 2R92B 3RZOB 5C3EB 1ML0D 3A8IE 1YNJC 4A3FB 4KJOA 4ZKCB 1PTOD 3ITPA 2K5DA 5LL6X 3TDQA 2EYMA 2WKCA 4EQNA 1U4PA 2PNRC 3M3YB 1EFID 2SNMA 5EKKA 1B50A 1EL0A 3GTJB 2F0QA 3M7GA 4CKBA 3PUXA 5CV5A 3HOXB 2H1EA 4XIGS 2MPMA 3P7JA 2A5HA 3BVGA 3GTPB 1X3QA 3I72A 2F0UA 1SE4A 1I4HA 2MGSA 2A6ED 4G57A 3V96A 1SFOB 4OL7A 1JWMD 2EY1A 3MA2B 1CFMA 3NTKA 4IFDH 3A54A 4AYBB 2JA8B 2PQEA 4NP5A 1WTVA 2GA4B 2KVMA 3HG9A 2X6GA 3HGBA 3K5LA 3IFDA 2FMMA 3SK8A 5JEAJ 4CBVA 2K01A 2L12A 4KD4A 3C1FA 2JEBI 2K05A 4K8IA 1FNVA 2WAQB 4IUVA 4L6TB 1PRTC 1FD7D 1XXGA 5I4DA 1CZGA 4OO1H 4LK1C 1G291 1WCMB 2WKDA 2K5WA 3CQZB 1QWYA 1TIID 3NXWA 1CQVA 3BS1A 3MXUA 4OIKA 1RHPA 1TS2A 3MXGA 1CA6A 3VYUA 1BDOA 1O78A 2M00A 1PTOF 1LLRD 1J9OA 2R3ZA 2X69A 1LO5D 1L0YB 3PO3B 4XQJA 2ICEC 1UUPA 5E3FA 2PO4A 3TSSA 3BDOA 3OSOA 1STEA 4PQXA 2SEBD 3HZXA 2A68D 4BA1I 3SK4A 1PTOH 3DM1A 4IURA 1XTCD 1IKMA 2QF7A 3A7LA 2RDGA 1GHJA 2NTSA 5KRUA 1T5EA 1I4XA 1RTNA 3I4NB 4FF1A 3HOYB 2JA5B 3D6WA 2AQ1B 4IUUA 1AEXA 1DOLA 1S5ED 1Y1VB 2AWNA 4FXDA 1TR5A 2JSOA 2WP8J 3CHBD 1ILPA 2LMCB 2F0MA 3A55A 4HEDA 4C3HB 2B8FA 3URYA 2D9UA 3IFTA 3HRZC 3MFGA 1JWUD 1CHPD 1SNCA 4FXKC 2XSCA 4ZUIA 3SK6A 4DXFA 1H9MA 2K03A 3D4RA 3Q22A 1CT1D 3N52A 3NTIA 4FP5D 3SHLA 3CKIB 1JE4A 1KNAA 2KQ3A 3FKIB 4RWSC 2PW7A 1LT6D 3QO2A 1NR2A 2KEDA 1TVXA 1SNOA 2J0TD 1WTRA 1IYUA 4DXGA 1LT4D 4YIJA 1C8CA 4F7XA 2FJ2A 1U9RA 2XVSA 4KN7C 3GV3A 1PFNA 1OXSC 5JEAG 4RGOS 3QB3A 3EJIA 4KY7A 1CK1A 1FNWA 1FYCA 5EGTA 1R4QB 4NKLA 1GHKA 1ONLA 3I4MB 1XWEA 4ME5A 1F2ZA 1I4GA 3NE5B 1DCZA 3MXNA 4O42A 1B1ZA 1S5FD 5FO8B 5KEEA 2WV6D 3G7LA 4BS9A 3J81L 2IL8A 1B44D 2HCIA 1M8AA 2IX3A 2IJ0A 1E2VA 3H91A 4U68A 1W6KA 5KNCA 5EPKA 3R3OA 2TMPA 1NUCA 3PUZA 3EROA 1TS5A 1EYAA 4LJZC 2NVTB 4M8AA 5M5WB 2EJGC 3S14B 3J7AV 1KABA 4ZYSA 5D65A 1SJHD 5EKIA 3KLRA 4JK1C 3S9WA 4LMQD 4FNFA 3MHBA 4DF7A 2MP1A 1SNMA 4QIWB 2F3VA 3VYTA 1NCVA 4WRDA 1UAPA 4Q0FA 5AFWA 3SDZA 4IFDI 4K8JA 1KTKA 2H4OA 1C48A 2NVYB 3V2TA 2IPKD 1D2BA 1WTWA 5CC4A 1VDZA 3GTQB 2NN6G 2R61A 2BDNA 5C3WA 2N88A 4KK7A 2BE5C 1SMYC 4KKUA 1G2SA 3MFYA 1HQMC 1HCZA 3C46A 3KBGA 4FF3A 5COYA 1H9SB 2NVQB 1BUVT 5ELDA 4QMGA 4X3SA 1D5MC 3OPOA 3LX0A 3K59A 5FK9C 1QOHA 4OO1I 5BN5A 3K5OA 5DEHA 4CKCA 5IT9L 2WB1B 3DEPA 2R93B 4DA2A 2PPBC 5KGUA 5CORA 1STHA 3M85A 1HA5A 1EQTA 4K2KA 4TRDA 5IT9E 2E2JB 2BA0A 1H9RA 1V1PA 1AP0A 1BQQT 1EOTA 1JICA 1GUGA 2HUGA 4J6HA 5C0XG 3RUZA 5IGBA 2Q8RE 3L7ZC 2M9VA 3HOWB 3T4AC 5IODA 4IUTA 4EQOA 1QCBD 3NQTA 2R6GA 1II3A 3TN2A 3AMUA 1RODA 3T53B 4CJ0B 1LTTD 1JCKB 3H09A 1PMRA 3PMFA 2B2UC 1K8MA 4KHVA 4BY7B 3PUWA 4EVOA 1B9NA 3PO2B 1D1KA 1H9JA 5ELCA 5FO9B 3OHXC 2QCPX 1JWSD 2K32A 1V1PB 1OXVA 4RCOA 4A3GB 3S1NB 2FHTA 2NBFA 1W6JA 3TP8A 3MVVA 5JPMC 3QG1A 1LTGD 4C3JB 2AQ3B 3I8ZA 4Y7NB 4PMWA 3CU7A 1EY6A 3A56A 4ZUJA 4GZYC 1AW7A 1F9PA 3GV6A 1BO0A 4FF4A 1HUMA 1K8OA 3U9OA 1TWAB 1R4PB 5A2QE 1V43A 4BA2I 2I46A 4V190 5I9OA 2L9HA 3GD7A 5JVH3 3EA6A 2OT2A 3ND9A 1JB3A 3J7YW 2E2IB 4XTCS 3PV0A 1ENCA 3NK9A 4ZAIA 3L9AX 3KBXA 4ZK9B 5FLXL 5CBEE 1I50B 1OXTA 2F0IA 5J39A 3M7NA 5J22A 1JOKA 2O5IC 3X3NA 2CW0C 2L11A 3SVMA 1RKNA 2EY6A 5KYLA 4N9PA 1LT3D 3VA5A 1QNUA 1STYA 3NWTA 4TKOB 1QJOA 1BCPC 1WTQA 3NPPA 2B2WC 3S15B 1E2ZA 2F0HA 2HDLA 2B39A 2M2LA 1SE3A 4PMBA 3BYYB 1Y8PB 3P20A 3NQIA 3LWUA 4RHRA 1JORA 5DM63 1A2UA 4IZ8A 5C5MA 5EQ0A 2A69C 4XYQA 2RSNA 4CHTB 1ILQA 4IUPA 3I3CA 4FO2A 1EQVA 1DD2A 5EJWA 3GTLB 2JA6B 3BDLA 2KA7A 1STAA 3NTHA 4RHSA 1ESRA 3K58A 1OXXK 4KN4C 1TU2B 1F2MA 2B2YC 1YNND 1O80A 5E4XA 3VYRA 3Q23A 3K7AB 5DNFA 4I7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8A A;  1O7Y A;  2HDM A;  1WVL A;  1RTN A;  2K01 A;  1B4O A;  2L9H A;  2L12 A;  3I91 A;  5COR A;  1CM9 A;  2EPB A;  3D6W A;  2N55 A;  1EQT A;  1G2T A;  3H91 A;  4IUU A;  1DZ1 A;  2KOL A;  2B2W A;  1DOL A;  1F9S A;  5CMD A;  4IUQ A;  4CJ2 C;  4R8I A;  1S4Z A;  5EPL A;  1RJT A;  1WD1 A;  4U68 A;  1QG7 A;  1AP0 A;  4ZAI A;  1EOT A;  2JP1 A;  5EPK A;  4XDX A;  1JIC A;  3KBX A;  2HUG A;  1U4L A;  2K05 A;  4MHE A;  4R9W A;  4ZK9 B;  1ML0 D;  2B2V A;  5CBE E;  1ILP A;  2Q8R E;  4QUC A;  2NYZ D;  4HED A;  1SDF A;  4IUV A;  4UAI A;  5E4W C;  5T1G A;  4NW2 A;  2D9U A;  2B2Y A;  4IUT A;  3FDT A;  2XIW A;  1PFM A;  3DEO A;  3HP3 A;  1DOK A;  4ZKC B;  2EOT A;  2DY7 A;  1U4M A;  1HUN A;  2L11 A;  5D65 A;  4ZKB B;  3SVM A;  3TN2 A;  1ROD A;  1U4R A;  3MWY W;  4ZLT F;  1BF4 A;  2K03 A;  5EKI A;  1RTO A;  4CJ0 B;  1CA5 A;  5T1I A;  1F2L A;  1G6Z A;  2DY8 A;  4LMQ D;  4XT3 B;  2B2U C;  1MSH A;  3N52 A;  2MP1 A;  1GUW A;  1U4P A;  2HCC A;  2L4N A;  1JE4 A;  1KNA A;  1SSO A;  2J7Z A;  2RA4 A;  2K1B A;  2K04 A;  4OIK A;  1AZQ A;  2NZ1 D;  4RWS C;  4CJ1 B;  1WD0 A;  1NCV A;  2B2T C;  2EE1 A;  1RHP A;  1VMP A;  1WTQ A;  5AFW A;  3QO2 A;  1NR2 A;  1XX8 A;  1B50 A;  1EIH A;  2KED A;  1TVX A;  2B2W C;  2L1B A;  2HDL A;  1CA6 A;  1EL0 A;  2KEC A;  2M2L A;  1ZXT A;  1A15 A;  2FFK B;  1WTR A;  5CBA E;  5EPJ A;  1DOM A;  4DN4 M;  1J9O A;  1E0B A;  1Q3L A;  3ONA B;  1MI2 A;  4HCS A;  1WTW A;  2B2V C;  2H1E A;  1C8C A;  2JYO A;  1NAP A;  2FHT A;  2CVR A;  1SAP A;  2BDN A;  2FJ2 A;  1VMC A;  2FIN B;  2SDF A;  2MPM A;  2N88 A;  2R3Z A;  2X69 A;  2VXW A;  1PFN A;  3GV3 A;  3P7J A;  1QNK A;  4X3K A;  1J8I A;  3MTS A;  4RAU C;  5EQ0 A;  1ICW A;  1WTX A;  1G91 A;  4QUF A;  2RVL A;  1G2S A;  2RSN A;  1PLF A;  3R93 A;  4XT1 B;  1IL8 A;  1KNE A;  1PFB A;  1X3P A;  1X3Q A;  1LV9 A;  2X6L A;  3F2U A;  2Q8T A;  1QE6 A;  2MGS A;  3KUP A;  5JJZ A;  3IL8 A;  4RA8 A;  1ILQ A;  4IUP A;  3I3C A;  1IKL A;  3I8Z A;  2KEE A;  4X3T A;  5D14 A;  2NWG A;  1B3A A;  3TZD A;  1BNZ A;  1B53 A;  1PDQ A;  1HRJ A;  1F9Q A;  1HFN A;  3I90 A;  3FPU B;  2B2T A;  1X32 A;  5COY A;  1DON A;  5EJW A;  1HHV A;  4X3U A;  1BBX C;  2K28 A;  1AZP A;  1F9P A;  1WTP A;  3GV6 A;  3Q6S A;  1BO0 A;  4O42 A;  4OIJ A;  1MSG A;  1ESR A;  4X3S A;  1HFG A;  1O7Z A;  1MGS A;  3DM1 A;  1HUM A;  4IUR A;  3G7L A;  1WTV A;  1IKM A;  2B2Y C;  4HSV A;  2KVM A;  4MN3 A;  1WTO A;  1O80 A;  4HAE A;  1EIG A;  5E4X A;  1B2T A;  2KUM A;  2X6G A;  1XYI A;  3UI2 A;  1NR4 A;  2IL8 A;  2RSO A;  1F9R A;  2FMM A;  2B2U A;  3IFD A;  3LWE A;  1HA6 A;  3DEP A;  5DNF A;  2HCI A;  2MJ8 A; 
#chains in the Genus database with same CATH topology
 2F52 A;  1B4O A;  5NUC A;  5JPN C;  4X64 L;  1A6X A;  1OO9 B;  1SNQ A;  4DK3 C;  1ZEQ X;  1G2T A;  4JI5 L;  3OMC A;  4EQ5 A;  4BXX G;  1LTI D;  3KLS X;  4XXE A;  2IX1 A;  5EPL A;  1RJT A;  1QG7 A;  3VR6 A;  1IYJ B;  1EY7 A;  4XDX A;  1EUJ A;  2YU9 H;  2F1M A;  2RHS B;  5M3F G;  2UU9 L;  1SMY D;  1F2Y A;  2NZH A;  1VQM A;  4UHV A;  1L0X B;  3VYS A;  3F1Z A;  2L55 A;  2L0C A;  3D8G A;  2WB1 G;  1UE7 A;  1N34 Q;  1N33 L;  3ER0 A;  2D0P A;  2B29 A;  1AH9 A;  4HSP A;  4IQZ A;  1EZ6 A;  1M90 C;  4DV5 L;  5JJK A;  4RGN A;  2F0J A;  3OWE B;  2B63 H;  4A3M B;  1TWG B;  1MJC A;  1L1O C;  1NMF A;  5JOB A;  1EU3 A;  2EYF A;  4GKJ Q;  4LFB L;  1QUQ A;  5C4H A;  2EE1 A;  1VF7 A;  1ESF A;  3KDF A;  3HOW G;  3U9S A;  2ZXR A;  4GLV B;  3OOC A;  2D2C C;  3FP9 A;  5CBA E;  5EPJ A;  1K0S A;  5IWA L;  2F4V Q;  1JE5 A;  4PNY A;  2AHO B;  3EFX D;  3M4O B;  4RG1 A;  3PIO 3;  1Q82 C;  2R7Z H;  1EZ8 A;  4DFA A;  1ICW A;  2ENB A;  1G51 A;  4L63 B;  5C0X H;  1PLF A;  2PZU A;  2E2H B;  1S5D D;  3AFP A;  1ZYR D;  1IKL A;  2OXP A;  3M4Y A;  1IBL Q;  3VR2 A;  4PZ7 A;  2DN8 A;  1EYG A;  3PO2 G;  2QKI C;  1KRT A;  4HIK A;  2ZXO A;  1GKH A;  2K28 A;  2E2D C;  3Q6S A;  5D3D A;  4R1J A;  3CW2 C;  3S1Q B;  2IW3 A;  2RBM A;  1MGS A;  4DPG A;  1QUQ B;  4HR7 B;  2AUJ D;  1WTO A;  2L15 A;  1HNX Q;  1MBY A;  2UXD Q;  3VR4 A;  2ID0 A;  1OXU A;  3V05 A;  4WJ3 M;  3WDN A;  1GO3 E;  1O7Y A;  2EYL A;  4LF5 Q;  3I70 A;  2PI2 E;  1A2T A;  3I91 A;  1YEZ A;  1KQS A;  2E75 C;  4RKB A;  1FNU A;  4A3B B;  2Z6K C;  4LFA L;  1C9O A;  2VUM H;  4GKK L;  3TZU A;  5IGC A;  1PH2 A;  4I65 A;  3DLL A;  2JP1 A;  4KY6 A;  3FPP A;  1Z7T A;  3HOV B;  2B2V A;  1HTL D;  5KIX A;  1PYW D;  4R4I A;  5DM7 3;  2O5J C;  1TWH H;  5E4W C;  1PZK D;  1RCV D;  4JI4 L;  4UY8 C;  3T13 A;  2KHJ A;  3G48 A;  1T5X D;  4RKL A;  1SR3 A;  4A3E G;  1BF4 A;  1Z6H A;  4GOP C;  4A3K G;  4K2L A;  3KLS A;  1Q86 C;  3L2P A;  2Q8I B;  4M1U B;  2AMC B;  1QZH A;  4IFD J;  2NVX B;  3FEW X;  2Z4H A;  2L4N A;  2Z9H A;  3CMA A;  4A93 G;  4A3I H;  1AZQ A;  2K5H A;  4JBK A;  5IGG A;  1EIH A;  2OF1 A;  1HR0 L;  3BZC A;  1IL2 A;  2VQF Q;  1CZW A;  4CGY B;  1HNW L;  1CTM A;  1I6H B;  4DN4 M;  1E0B A;  1Q3L A;  1Q8K A;  1MI2 A;  1PH8 A;  3R2I A;  4ULL A;  1SAP A;  3HKS A;  1VMC A;  3J81 i;  3M9B A;  4RGM A;  3GTM B;  5HUR A;  2QEJ C;  4QUF A;  3GQB A;  1TQO A;  2PNH A;  3G4S A;  2D62 A;  5C3E G;  1AE3 A;  2LXJ A;  5EAY A;  3RNU A;  1PDQ A;  1Q90 A;  3CPW A;  1HFN A;  3FPU B;  5A35 A;  4X65 L;  1PTO B;  5L37 A;  4K0K L;  1JR0 D;  1TKW B;  3VR5 A;  4DV0 L;  1TWF B;  4DR3 Q;  2F0T A;  4HIO A;  1SND A;  2SNS A;  3Q24 A;  3AEV A;  2EY5 A;  3PIO A;  4GLX A;  1TY0 A;  5C4J B;  1EIG A;  4YCU A;  2K5V A;  5EKL A;  4BY1 B;  4DV3 L;  1LTA D;  5AJ3 Q;  2LFN A;  1I6V C;  1YNJ D;  2OEO A;  1QVF A;  5FOB B;  2N3S A;  2NUC A;  1IBK Q;  5KND A;  3L3O C;  5I9P A;  1VQC A;  2RCN A;  1WD1 A;  3RD4 A;  4YCV A;  3HOX G;  2CH4 W;  1G8Z D;  1VS0 A;  2G9D A;  4OGQ C;  3DXJ C;  2NYZ D;  3HKZ B;  1JOO A;  1I5F A;  4Z9C B;  4DV1 L;  3KOJ A;  1YHB A;  4B3S L;  1JQY D;  5TSS A;  3WOE A;  3FDT A;  4HCE A;  2JQO A;  4RH6 A;  4RCN A;  1ICF B;  1U4M A;  2EXD A;  1VQ9 A;  1H95 A;  3H3V C;  4NDX A;  5BR8 L;  3O13 A;  1TT2 A;  3J81 E;  1SNP A;  4DR5 Q;  4MZ9 A;  3ULJ A;  2JE6 I;  2SOB A;  2XWJ B;  1UE5 A;  2UU9 Q;  4K6L A;  4BBR H;  4AYB G;  2JA8 G;  1WD0 A;  5C44 H;  5LMU L;  3RZD H;  1PH7 A;  4A3J B;  3S1R H;  1N33 Q;  3MZ5 A;  5M5Y B;  3OYY A;  3F2C A;  3MXN B;  3ONA B;  4OWX B;  2IT1 A;  2JYO A;  1C4Q A;  3OIQ A;  2PW5 A;  2ZXP A;  3BDC A;  1EWH A;  3AU7 A;  4NPS A;  1D5X C;  1LTL A;  2F0L A;  2RQX A;  5M3F H;  4LFB Q;  1X3P A;  3KUP A;  5JJZ A;  4P2C B;  3FRP B;  5D14 A;  4N9T A;  1LAB A;  2KHI A;  3GP7 A;  1HRJ A;  3GTO B;  1JJC B;  2K5N A;  4MTK A;  3T1Y L;  4GN3 B;  3H15 A;  4KD3 A;  5IWA Q;  4DV2 L;  2K4K A;  2PI2 A;  2Q2U A;  4QL5 A;  1PXU A;  4V0B A;  3B6Y A;  2F0G A;  5ELF A;  5G3L D;  4LFC Q;  1RL2 A;  4C3I B;  1CI3 M;  4HTH A;  3H0G H;  1RF2 D;  2A6E C;  4OEM B;  1GUS A;  2PYK A;  4MN3 A;  1STG A;  4GS3 A;  1UEA B;  4KY5 A;  4FF2 A;  2HIX A;  3TS0 A;  2F0F A;  3G6J B;  3S2D H;  2MFI A;  2HDM A;  1IBM L;  1MJE A;  1PRT D;  3SEB A;  3AFQ A;  4YY3 L;  4CJ2 C;  1EY5 A;  1S4Z A;  3DHQ A;  3FVQ A;  4EGV A;  2QGQ A;  3A8J E;  4MHE A;  2YTV A;  5E1F A;  4FYD A;  4RMF A;  1IYV A;  2Q2H A;  4P71 A;  3PO3 G;  2EYH A;  1O7L A;  1BCP F;  3SR1 A;  3SE0 A;  4LFA Q;  5KNB A;  1SN8 A;  4ZKB B;  1EY0 A;  4JBM A;  1VQL A;  3CF5 A;  2Z6B A;  5IGD A;  3E5S A;  4A3B G;  1KDB A;  5C0X I;  3S1M B;  1S5B D;  2J4X A;  4XQN A;  5DAU A;  1I4Q A;  4DNR B;  3A0J A;  5FJ8 H;  2EXZ A;  3NP8 A;  3J80 L;  1HTP A;  1K83 B;  3CME A;  2B2T C;  5F2D A;  5FO7 B;  1VMP A;  4JI4 Q;  5EBD A;  1PHJ A;  1PYS B;  4C2M H;  4DV6 Q;  5IYD H;  1A0I A;  1K0R A;  3I4N G;  1TWC H;  2JA7 B;  2WII B;  2JA5 G;  4XQQ A;  4HN7 A;  2XNA C;  5CR3 A;  4X3K A;  2WAQ E;  2EVB A;  2LXK A;  1LTS D;  3MTS A;  1I3Q H;  3S16 H;  5M9O A;  1WTX A;  1Y1V G;  3I56 A;  4CDC C;  5EBC A;  4EQP A;  2Q8T A;  4IJH A;  3STB C;  2HQL A;  3X3M A;  3IL8 A;  4DAY A;  3NBI A;  2UUC L;  1SYD A;  4BBS H;  1HR0 Q;  3A5Z B;  1B53 A;  4C3H G;  3N6R A;  1KAA A;  2GVA A;  4POF A;  1TS3 A;  1DON A;  2ICI A;  3W3A A;  4O0A A;  2VNU D;  4A3E H;  1AZP A;  3U4V A;  3K5N A;  1ENA A;  2F0V A;  4KTA A;  4A3K H;  3H3V I;  1HFG A;  1SE2 A;  3TP6 A;  1S5C D;  3JAM i;  4K14 A;  1EY8 A;  5GQO A;  1STB A;  1I4R A;  4HSV A;  2EDG A;  4A93 H;  2V4D A;  2QIL A;  2TSS A;  5I6W A;  2CFM A;  1GUO A;  3S17 B;  4O2D A;  1DXM A;  3DWA A;  5JVG 3;  4LF5 L;  4A3D H;  4F88 A;  3PIP 3;  4JI2 L;  4X65 Q;  1JOQ A;  2N55 A;  3IRB A;  4K0K Q;  5CYU A;  2I5M X;  4ZRZ A;  4NMZ A;  4DV0 Q;  2VQE L;  4HJ8 A;  2UXC Q;  1ZKO A;  3J7Z C;  2EQS A;  5G3L F;  1A8V A;  4HMI A;  4A3C G;  1BXT A;  4POG A;  3H94 A;  3K6O A;  3OW2 A;  4B3R L;  2R92 H;  4ILW A;  3KF6 A;  3RZO H;  4IAL A;  5C3E H;  4JPB W;  2B2Y A;  3J81 c;  1CHQ D;  3J7A F;  1PFM A;  1PRT F;  2AWO A;  2F3W A;  4JG2 A;  4KKS A;  5ELB A;  4B08 A;  5IE8 A;  4A3F H;  1GXD C;  5CV7 A;  4S3S A;  4ZQ3 A;  3K5M A;  2PZT A;  2LSS A;  2NB0 A;  4DK0 A;  1CA5 A;  3PSI A;  4FXG C;  5T1I A;  1FGB D;  1D1I A;  1E22 A;  1OTC A;  1Q1E A;  4OEL B;  2BDO A;  2RA4 A;  1E7Z A;  2K1B A;  1NMG A;  1BBU A;  4DV1 Q;  2NZ1 D;  5JEA H;  4RGT A;  4B3S Q;  3C1E A;  2I5H A;  4DR4 L;  3JAM L;  4LUV A;  3M3Y H;  1Q8I A;  1HZB A;  4ODG A;  4OWW B;  1XTD A;  1DOM A;  2ZTC A;  5FLX E;  1KD1 C;  5BR8 Q;  3I4O A;  2JN4 A;  3GTJ H;  2OQ0 A;  1ASY A;  2MO0 A;  3HOZ B;  1IW7 C;  3BZK A;  2FIN B;  1XNR Q;  3JAM E;  1JC7 A;  4QQB X;  3HOX H;  1VCI A;  5M5X B;  3KF6 B;  1HXY D;  1PFB A;  1NSN S;  4J1M A;  4F8M A;  2VW9 A;  1D5Z C;  2KCN A;  1L1O A;  5LMU Q;  1CKM A;  3PUV A;  3GTP H;  1EYD A;  1GOZ A;  2K75 A;  3CCL A;  4MIU A;  4DAP A;  1Y1W B;  3RN2 A;  1YI2 A;  3DUZ A;  2XWB B;  4MTN A;  1X55 A;  4G7Z C;  3UDI A;  1SFO H;  4LF8 L;  5C4X B;  1WTP A;  1Y14 B;  3AB9 A;  4LUZ A;  1HZC A;  1SXT A;  4DR3 L;  1GM5 A;  3TME A;  2F0P A;  1EYC A;  2PMZ B;  1BOS A;  1RD9 D;  1E2W A;  2AUK A;  1RDP D;  1VQK A;  2JA8 H;  2R7D A;  2LS0 1;  3R2T A;  1GUT A;  4HJ9 A;  1HR0 W;  2MJ8 A;  1LYL A;  4JBW A;  3W1G A;  1TY2 A;  1HH2 P;  3NWS A;  5JAV A;  3I73 A;  2O2L D;  5BN4 A;  3T1Y Q;  5IYB G;  1VQO A;  5FLM G;  1A3V A;  3GTK B;  1LTB D;  1FL0 A;  4JI8 Q;  3S2H B;  3QIA A;  4GNX B;  3SGI A;  3E6Z X;  1EY4 A;  3K7U C;  1ASZ A;  3PF5 A;  1EU4 A;  1YBY A;  3K0Y A;  2DJF C;  1L2F A;  4C3I G;  1CQF A;  3EBE A;  1YZ6 A;  2YV5 A;  1D7Q A;  1ET6 A;  1IBM Q;  3HP3 A;  2K5Q A;  3A8K E;  2EOT A;  3J7A 5;  1PRT B;  3C3L A;  1TXY A;  3QWN A;  1KDC A;  3EN2 A;  3PIP A;  1DGS A;  4H02 A;  4YY3 Q;  1R9T B;  2A73 B;  3GO5 A;  1G6Z A;  1X65 A;  2MQH A;  2Z6K A;  1SYB A;  1XJV A;  4WJW A;  2Z1C A;  2NN6 H;  3HOU B;  1SRU A;  1WCM H;  1A3U A;  4DR5 L;  4CKE A;  2BE5 D;  2HQE A;  1W3S A;  1VQF A;  3E0E A;  4A3L H;  3CQZ H;  5C5L A;  2DNC A;  2UUB L;  2L1B A;  1LUZ A;  1UNS A;  5K36 G;  1A15 A;  2EYJ A;  3OIP A;  2R93 G;  4C56 C;  1KLG D;  3PUY A;  4HCS A;  2QEX A;  2YYZ A;  1LTR D;  2CVR A;  2RCF A;  2K33 A;  2DUD A;  5HGT A;  1H9K A;  4JVZ A;  1K9M C;  3I4L A;  2Y0S E;  4GOP A;  4QB4 A;  3CRK C;  3D6C A;  4XT1 B;  2O4X A;  3F2U A;  1KXL A;  2D0O A;  1MHW C;  3PO3 H;  2KEE A;  2FXQ A;  4YWK A;  1YVC A;  4L5T A;  3I90 A;  5JJI A;  1KLU D;  4X3U A;  5J1Z A;  3E0J A;  4OIJ A;  4NXN L;  4B3M Q;  5IYC G;  3F2D A;  3SK5 A;  3H6M A;  2JA7 G;  1GJX A;  4QIW E;  2CH4 A;  4LFC L;  4JCV E;  3CP0 A;  1F9R A;  2NTT A;  3LWE A;  4P74 A;  4BY7 G;  2UUC Q;  1Q12 A;  5CV9 A;  3BVM A;  4UPA A;  1SYE A;  1V1O A;  2C9O A;  3QR8 A;  4H7B A;  1CM9 A;  1FVI A;  3A7A B;  3D31 A;  3CXC A;  2RHQ B;  2YU9 B;  1DZ1 A;  2KOL A;  2K52 A;  1DYQ A;  3I4N H;  2OTJ A;  4IUQ A;  2WAC A;  3HOY H;  2JA5 H;  2B8G A;  3DWP A;  3MAQ A;  3LNN A;  2JEA I;  1EY9 A;  4A3G G;  4R9W A;  5ELE A;  5IOC A;  1Y1V H;  4KHZ A;  3OW7 A;  4PV1 C;  1DM0 B;  1J6Q A;  2F0K A;  4UP9 A;  3KDF B;  4NW2 A;  4DGZ A;  5M3M B;  1U5K A;  1X3E A;  3DEO A;  4YCW A;  3STB D;  4JI2 Q;  1SYG A;  4C3H H;  2B63 B;  3OWF A;  4C3J G;  4IOC A;  2BCO A;  4QCL A;  4ZLT F;  4YWL A;  3OTO L;  2VQE Q;  1JB7 A;  4DR1 L;  2QDB A;  3DM3 A;  1IHZ A;  4XT3 B;  1CKO A;  2WB1 E;  4DAM A;  1CSP A;  4B3R Q;  1PZJ D;  4C1N I;  2RF4 A;  5FLX c;  2QW7 A;  3UDF A;  3H3V H;  1M4V A;  1D6E C;  4KJN A;  2A6H C;  4K6D A;  3MXP A;  4CDF C;  3JAM c;  3RLN A;  3FKI H;  1ZXT A;  2FFK B;  5CV6 A;  4P72 A;  2R7Z B;  4DV6 L;  5J3B A;  1I94 Q;  1AN8 A;  3PCO B;  4JC0 A;  5C3X A;  1NAP A;  1ENF A;  5ELO A;  1FR3 A;  3BG3 A;  1U0L A;  5BN3 A;  3CCJ A;  1LT5 D;  5D3I B;  4DK1 A;  2ASB A;  4C1N K;  1LV9 A;  4DR4 Q;  3DMU A;  2IX0 A;  3T56 B;  2ES2 A;  3K57 A;  2KCC A;  1B3A A;  3I55 A;  2XRQ D;  1VQG A;  1X32 A;  3NBH A;  2VB2 X;  1VQP A;  3ZYY X;  3KJP A;  1SEB D;  1MSG A;  2FMC A;  3TP5 A;  3I4M H;  2C5C A;  4DR6 L;  3MC0 B;  1S72 A;  2F0S A;  4OWT B;  2RKS A;  3D4D A;  1NR4 A;  4H44 C;  2VUM B;  1XNQ L;  4IPG A;  4JI7 L;  3T16 A;  1FGU A;  3M4P A;  2EY2 A;  1NJI C;  4LF8 Q;  2XTI A;  2I07 B;  2D5D A;  1Y1W G;  4XYO A;  5CMD A;  4WOR A;  2CW0 D;  2F0N A;  1EEI D;  2UXC L;  5C4X G;  1MKH A;  1TWH B;  1E3P A;  1EQQ A;  1IW7 D;  2ZJR A;  3EVQ A;  4HMJ A;  4I7A A;  2BH8 A;  1WJJ A;  1CUK A;  2P5Z X;  3BYT B;  3BZD B;  4QUC A;  3UE0 A;  4OHJ A;  4K5W A;  5C0X J;  4LF7 Q;  3M4Q A;  2KCM A;  3CC4 A;  2HD3 A;  2XIW A;  4ZCK A;  1BCP D;  5JJL A;  2NVT H;  4L5Q A;  3WOF A;  4ABN A;  4JYA Q;  1SBB B;  5M5W H;  4G4K A;  1U4R A;  3MWY W;  2I5L X;  4J8Q A;  2A74 C;  3S14 H;  2UXB L;  5I2X A;  2DNE A;  4A3I B;  2JA6 G;  4AH6 A;  2DY8 A;  2PZW A;  2N78 A;  5IGE A;  3CAM A;  1MSH A;  1SLJ A;  1MIU A;  2E76 C;  1GUW A;  1Y69 U;  2KCT A;  3EIV A;  1QIL A;  2K04 A;  3RMH A;  5H1S E;  3KLW A;  1NNX A;  2E5L Q;  4CJ1 B;  1NTG A;  3P75 A;  2A69 D;  4R8N A;  1XX8 A;  2F4I A;  4WFN 3;  1MD2 D;  2F0E A;  3W2D A;  1DJR D;  3SXH A;  3OMG A;  4BWG B;  2B2V C;  2ZT9 C;  4DU9 A;  3A5U A;  3HS0 C;  3NSW A;  3TBI B;  1PH5 A;  2SDF A;  2NVY H;  4IN3 A;  2XN9 C;  1XNR L;  4IJL A;  4RAU C;  4FVM A;  2KHS A;  3GTQ H;  4JOI C;  1IL8 A;  1KNE A;  1SJE D;  3E3X A;  2VS1 A;  4IO9 A;  1QE6 A;  2UUB Q;  4KMU C;  1PTO C;  3Q0A A;  1V1Q A;  2V1C C;  1VQN A;  1SMX A;  2UUA Q;  3QOJ A;  4X62 Q;  2B2T A;  4RFB A;  4DAV A;  4O1N A;  1HHV A;  4K5V A;  5K5P A;  4LF4 L;  4BXX H;  4L5R C;  2BA1 A;  2NVQ H;  1G6P A;  3AQQ A;  4DV7 Q;  5IP7 G;  4A3M G;  3HEJ A;  1B2T A;  1XYI A;  1PA6 A;  3TS2 A;  2Y0S B;  2B2U A;  1E1T A;  3P1H A;  1KDA A;  2F03 A;  2WFW A;  3PF4 A;  5K36 H;  2EYP A;  3NEL A;  1HQR D;  1PH3 A;  2NN6 I;  3VR3 A;  4QJF A;  4U67 3;  1H9S A;  1P8L A;  2R93 H;  2A19 A;  4NXN Q;  1VQH A;  3J80 i;  1HPC A;  3EQL C;  3U58 A;  1YNN C;  5C4Z A;  4JI8 L;  4E6I A;  5IGF A;  2Q2I A;  2E2J H;  1LAC A;  4UAI A;  5T1G A;  2AQ2 B;  4B9X A;  3HOW H;  1DOK A;  3T51 B;  2DY7 A;  2RDH A;  1GUN A;  3G6E A;  4ME3 A;  1N36 Q;  3LGJ A;  4KKT A;  4DKA C;  4IFD G;  1Z47 A;  4KI0 A;  1RTO A;  1SYC A;  2CHB D;  2Z8L A;  4BBR B;  4Q5V A;  2PQA A;  1TS4 A;  5C44 B;  3RZD B;  1SSO A;  3R8B A;  1K8A C;  1EWC A;  2A8V A;  3S1R B;  1SYF A;  1PH4 A;  2XRS D;  1PV4 A;  1PH9 A;  2K6A A;  1A62 A;  2CQA A;  1E24 A;  4BY7 H;  2K50 A;  1BR9 A;  2AKW B;  5M3M G;  5LL6 S;  3ULL A;  3PO2 H;  3OTO Q;  4AYB E;  5LHY 1;  1JT8 A;  4DR1 Q;  5M3F B;  1J8I A;  2LKV A;  3CRL C;  4OX9 Q;  1HJP A;  4ID6 A;  4YHH Q;  5CGK A;  2EYO A;  2RVL A;  3S1N H;  4A3G H;  2F0W A;  2E74 C;  3R93 A;  1F77 A;  1PYB A;  4H13 C;  2X6L A;  3HOV G;  4OO1 G;  2CQO A;  4RA8 A;  4X3T A;  1B3Q A;  1BNZ A;  3DWQ A;  3TZD A;  4G7H C;  1F9Q A;  1AFP A;  2KBN A;  3ND8 A;  4C3J H;  3ERQ A;  1V8Q A;  2MHV A;  3H0G B;  3J80 E;  2IHF A;  4DNT B;  4Y7N H;  2ZJP A;  2R7Z G;  1FJG L;  1PZI D;  4B3M L;  2HT1 A;  1O7Z A;  4H0L C;  2YTX A;  3S2D B;  1ZYR C;  3FMC A;  4JBJ A;  3NHH A;  3UI2 A;  3PGZ A;  2RSO A;  1A3T A;  4UP7 A;  1I4P A;  1TWA H;  1Y8N B;  1Y8O B;  2EPB A;  2A6H D;  3D4W A;  4F87 A;  2CCZ A;  1NY4 A;  2PCF B;  4HJA A;  2BOS A;  2B2W A;  1F9S A;  5CV8 A;  1VF5 C;  3TRE A;  3PQI A;  1YJW A;  3GTG B;  1SRO A;  3MEH A;  5I2Y A;  4LAA A;  4DR6 Q;  1U4L A;  2E2I H;  1M1K C;  2KJX A;  4GN5 A;  2VB3 X;  1IXR A;  1SDF A;  5I6Y A;  4DNI A;  1XNQ Q;  1ET9 A;  1STN A;  4JI7 Q;  1VQD A;  1B7Y B;  4L8J A;  4UDU C;  2WIN B;  2IWH A;  1UE6 A;  1I50 H;  1HUN A;  2F0O A;  1VQE A;  3CCM A;  5LMN L;  2A68 C;  4PZ6 A;  1T9H A;  2K7V A;  3RLF A;  1F2L A;  3TP7 A;  1XMQ L;  2HCC A;  3IKJ A;  2J7Z A;  2G9H D;  4B9W A;  4KV6 A;  1Q46 A;  2ZM6 L;  4C2M B;  4DAY B;  4JI0 L;  1TWC B;  2KEC A;  4DR7 Q;  1BCP B;  4BY1 G;  5A2Q L;  3U50 C;  1QVG A;  2OTL A;  2Z0S A;  2EJF C;  4CDE C;  1I3Q B;  3I7F A;  4LF9 L;  3S16 B;  3S15 H;  1B9M A;  2UXB Q;  4G7O C;  3U4Z A;  1I94 L;  5FKA C;  5IIF A;  2EZV A;  2VXW A;  1QB5 D;  1QNK A;  2VL6 A;  4L5S A;  4K5X A;  3J81 j;  1G91 A;  1Q1B A;  2LY7 A;  4BBS B;  3BVZ A;  3IAY A;  3C2P A;  3D3R A;  4TQU S;  2MUY A;  3K81 C;  1N32 Q;  4A3E B;  2F0D A;  2L5T A;  4WJ4 A;  3W5O A;  2NWG A;  4N8F A;  3T1H Q;  3HKZ G;  4J15 A;  4JV5 L;  1X3G A;  3NUC A;  4A3K B;  2EJM A;  1X56 A;  4PG3 A;  1VQB A;  1BBX C;  3VA7 A;  5IP9 G;  1N9W A;  5CV4 A;  4R4O A;  4A93 B;  3KK7 A;  1EEF D;  3GDE A;  3GTL H;  1B8A A;  5C6A A;  1VQ8 A;  2JA6 H;  4PMC A;  4TSS A;  4HAE A;  4A3D B;  2KUM A;  1HA6 A;  1L0W A;  5ISR A;  3QJY A;  2Z4I A;  2B3G A;  2RDF A;  4QF4 A;  4IUN A;  3KF8 A;  1WVL A;  1YHA A;  2IY5 B;  5KYI A;  3QOL A;  2XGT A;  1PFS A;  2DJG C;  4NB3 A;  3K7A H;  4A3J G;  3CCS A;  2JXM B;  4LF4 Q;  4R8I A;  3Q8D A;  2R92 B;  3RZO B;  1X3F A;  2GVB A;  5C3E B;  1ML0 D;  4DR2 Q;  3UDX A;  3A8I E;  1YNJ C;  4A3F B;  4IPH A;  4KJO A;  4LF7 L;  4ZKC B;  1PTO D;  3ITP A;  2K5D A;  5LL6 X;  3CCE A;  4JYA L;  3TDQ A;  4JI3 Q;  4R4C A;  2EYM A;  2WKC A;  4EQN A;  1WFQ A;  2EIF A;  1U4P A;  2PNR C;  4OXP A;  1HNZ L;  4R4Q A;  3M3Y B;  1CSQ A;  1EFI D;  5IP7 H;  2SNM A;  3AYH B;  1TWG H;  4A3M H;  1L1O B;  2E5L L;  5EKK A;  2DGY A;  2YTY A;  3KF8 B;  1B50 A;  1EL0 A;  3GTJ B;  2F0Q A;  3M7G A;  4CKB A;  3PUX A;  4LUO A;  1N8R C;  1K73 C;  5CV5 A;  3HOX B;  2H1E A;  4XIG S;  2JK8 A;  2MPM A;  3P7J A;  2A5H A;  3BVG A;  3VDY A;  3GTP B;  4BBR G;  1X3Q A;  3I72 A;  3M4O H;  2F0U A;  5C44 G;  1SE4 A;  1I4H A;  3J80 c;  2MGS A;  2A6E D;  4G57 A;  2G5D A;  5DLQ E;  4AQY Q;  3V96 A;  1SFO B;  4OL7 A;  2E2H H;  1JWM D;  2EY1 A;  4IPD A;  2UUA L;  3MA2 B;  2GN5 A;  1KL9 A;  4X62 L;  1CFM A;  4LF6 L;  5GAH C;  3NTK A;  4IFD H;  1K3B C;  3A54 A;  2CWA A;  4AYB B;  2JA8 B;  2PQE A;  4NP5 A;  1WTV A;  1E1O A;  2GA4 B;  2KVM A;  3HG9 A;  2X6G A;  3HGB A;  4DV7 L;  3G71 A;  3S1Q H;  3K5L A;  3ERS X;  3IFD A;  1XPU A;  2FMM A;  3SK8 A;  4B3T Q;  5JEA J;  1QVC A;  4CBV A;  2K01 A;  2L12 A;  5M3M H;  4KD4 A;  3CC7 A;  1EWI A;  4GNX C;  3C1F A;  1FJG Q;  1JJG A;  2JEB I;  3ZJY C;  4A3B H;  3H0G G;  4JI6 Q;  2K05 A;  4K8I A;  1FNV A;  4LW1 A;  2WAQ B;  4IUV A;  1KHI A;  4L6T B;  1PRT C;  3HOV H;  1FD7 D;  1XXG A;  5I4D A;  1CZG A;  3E9I A;  4OO1 H;  3UDG A;  4LK1 C;  1G29 1;  1WCM B;  1YHQ A;  1VQI A;  1N36 L;  2KEN A;  2WKD A;  2K5W A;  3KFU A;  5IY0 A;  1GD7 A;  4YWM A;  4GOP B;  3CQZ B;  1QWY A;  1TII D;  3NXW A;  1CQV A;  3BS1 A;  3MXU A;  4OIK A;  1RHP A;  3ULP A;  1YJ9 A;  2NVX H;  1TS2 A;  4CDD C;  5GAE C;  3MXG A;  1CA6 A;  3VYU A;  1BDO A;  1O78 A;  2M00 A;  1PTO F;  1LLR D;  1J9O A;  5LMN Q;  2VY3 A;  1Q7Y C;  1I6H H;  1XMQ Q;  2R3Z A;  2X69 A;  1LO5 D;  2BH2 A;  4KHP L;  1L0Y B;  2OCE A;  5FJ8 G;  3PO3 B;  4OX9 L;  1UEB A;  1WYD A;  4YHH L;  4XQJ A;  2ZM6 Q;  2ICE C;  1UUP A;  5E3F A;  3GTM H;  2PO4 A;  4GN4 B;  3TSS A;  1HZ9 A;  3BDO A;  4JI0 Q;  1UWV A;  3FHW A;  3OSO A;  5IYD G;  3I2Z A;  1STE A;  4MNO A;  4PZ8 A;  4PQX A;  2SEB D;  4LF9 Q;  3CPF A;  3D0F A;  3RN5 A;  4QY7 A;  3HZX A;  1RIP A;  2C35 B;  1VQ4 A;  1VQ5 A;  2A68 D;  4BA1 I;  3SK4 A;  1PTO H;  3DM1 A;  3CD6 A;  4IUR A;  1XTC D;  1IKM A;  2H5X A;  2QF7 A;  3A7L A;  4A3C H;  2RDG A;  1TWF H;  1JJ2 A;  1GHJ A;  4BBS G;  2NTS A;  5KRU A;  2IHE A;  4JOI A;  1SE8 A;  1T5E A;  1I4X A;  1RTN A;  3I4N B;  4JV5 Q;  5C4J H;  4X66 L;  3NEM A;  4FF1 A;  3HOY B;  2JA5 B;  3D6W A;  4BY1 H;  2AQ1 B;  4IUU A;  1AEX A;  1DOL A;  1S5E D;  5ELN A;  1VQJ A;  1Y1V B;  2AWN A;  4FXD A;  1PH6 A;  1TR5 A;  2JSO A;  2WP8 J;  3CHB D;  3HOZ G;  1ILP A;  2LMC B;  2F0M A;  3A55 A;  4HED A;  4C3H B;  2B8F A;  3URY A;  2D9U A;  3IFT A;  4A3D G;  3HRZ C;  3MFG A;  1JWU D;  1CHP D;  1SNC A;  4FXK C;  2XSC A;  4HID A;  4ZUI A;  3SK6 A;  3NEN A;  1H9M A;  4DXF A;  2HHH L;  2K03 A;  3D4R A;  3Q22 A;  1XMO L;  5IP9 H;  1AE2 A;  1CT1 D;  4LWC A;  3N52 A;  3NTI A;  4FP5 D;  3SHL A;  3CKI B;  2R92 G;  1JE4 A;  1KNA A;  2KQ3 A;  3FKI B;  1CKN A;  4RWS C;  2PW7 A;  1YNX A;  3CCQ A;  1LT6 D;  4A76 A;  3QO2 A;  1NR2 A;  2KED A;  1TVX A;  4DUY L;  1SNO A;  2J0T D;  4A3F G;  5E7N A;  1EIF A;  3NBH B;  1WTR A;  1IYU A;  4DR7 L;  4DXG A;  2QDL A;  1LT4 D;  4YIJ A;  1C8C A;  1W2B A;  4HIM A;  4F7X A;  4A3J H;  1IZ6 A;  2FJ2 A;  1U9R A;  2XVS A;  4KN7 C;  1HZA A;  3GV3 A;  3KYH C;  5M5Y H;  1PFN A;  4FDB A;  1OXS C;  2OQK A;  1HNZ Q;  5JEA G;  4RGO S;  3QB3 A;  4TVA B;  1X9N A;  3EJI A;  4KY7 A;  1CK1 A;  1FNW A;  1VQA A;  4LNQ A;  1FYC A;  5EGT A;  1R4Q B;  4NKL A;  1N32 L;  3T1H L;  4JI1 L;  2JA9 A;  5LMN W;  4IOA A;  1ONL A;  1GHK A;  3I4M B;  1XWE A;  4ME5 A;  1F2Z A;  1I4G A;  2MNA A;  3NE5 B;  3RR5 A;  1DCZ A;  3MXN A;  5IYB H;  3ICE A;  4NXM Q;  4O42 A;  5FLM H;  3GTO H;  1B1Z A;  3S24 A;  1S5F D;  2VZA A;  5FO8 B;  5KEE A;  2WV6 D;  3G7L A;  1CKN B;  4BS9 A;  3HOU G;  3J81 L;  2IL8 A;  2ALY B;  4C3I H;  1B44 D;  2HCI A;  1M8A A;  2IX3 A;  1A63 A;  4X64 Q;  2IJ0 A;  4DUZ L;  3TRZ A;  1E2V A;  1C7Y A;  4JI5 Q;  1O7I A;  2HIV A;  1KRS A;  3H91 A;  4LF6 Q;  4U68 A;  1W6K A;  5KNC A;  4IPC A;  3R3O A;  5EPK A;  2TMP A;  1NUC A;  3PUZ A;  3ERO A;  1TS5 A;  1BBW A;  1EYA A;  4LJZ C;  4P73 A;  4DR2 L;  5GAG C;  2NVT B;  4M8A A;  5M5W B;  2EJG C;  3S14 B;  3J7A V;  1KAB A;  1K28 A;  4ZYS A;  5D65 A;  4DV5 Q;  3BU2 A;  1SJH D;  5EKI A;  1X6O A;  2PMZ E;  4JI3 L;  3KLR A;  4JK1 C;  3S9W A;  4LMQ D;  4FNF A;  3MHB A;  4DF7 A;  2MP1 A;  1SNM A;  3S1M H;  4QIW B;  2F3V A;  3VYT A;  4HJ5 A;  1NCV A;  4WRD A;  1UAP A;  4Q0F A;  1WOC A;  5AFW A;  4GLA C;  3CCR A;  3SDZ A;  2WAQ G;  3UE1 A;  4IFD I;  4K8J A;  1K83 H;  1KTK A;  2H4O A;  1C48 A;  2NVY B;  5GAD C;  1NBW A;  3V2T A;  2IPK D;  1J5E L;  1D2B A;  1WTW A;  5CC4 A;  1VDZ A;  1X54 A;  4JW0 A;  3GTQ B;  2NN6 G;  2R61 A;  2BDN A;  1WCM G;  5C3W A;  4DV4 L;  2N88 A;  4KK7 A;  5IYC H;  4Y52 H;  1LM0 A;  2BE5 C;  1S40 A;  1SMY C;  4KKU A;  2JA7 H;  1G2S A;  3MFY A;  4A3L G;  3TQY A;  4A4I A;  1HQM C;  1HCZ A;  3C46 A;  3KBG A;  4AQY L;  4FF3 A;  3F8T A;  1B70 B;  5COY A;  3K80 C;  1KIX A;  1H9S B;  2NVQ B;  1BUV T;  5ELD A;  4QMG A;  2B63 G;  4P75 A;  4X3S A;  1D5M C;  3OPO A;  2N8N A;  3LX0 A;  3K59 A;  5FK9 C;  4KHP Q;  1QOH A;  1WI5 A;  4OO1 I;  3GTG H;  5BN5 A;  3K5O A;  5DEH A;  4CKC A;  5IT9 L;  2WB1 B;  2E8G A;  3DEP A;  2R93 B;  4DA2 A;  4B3T L;  2MO1 A;  5KGU A;  2PPB C;  5COR A;  1STH A;  3M85 A;  1N34 L;  1HA5 A;  1EOV A;  3S17 H;  4GKK Q;  1EQT A;  3TEH B;  3MEF A;  4K2K A;  4TRD A;  5IT9 E;  2E2J B;  2BA0 A;  1H9R A;  1V1P A;  2PQA B;  1AP0 A;  1BQQ T;  1EOT A;  3RLO A;  1JIC A;  1GUG A;  2I0Q A;  3L0O A;  2HUG A;  1KC8 C;  4J6H A;  5C0X G;  4UP8 A;  3RUZ A;  5IGB A;  1YJN A;  4JI6 L;  2Q8R E;  3L7Z C;  2M9V A;  3HOW B;  4GKJ L;  3T4A C;  4QGU A;  5IOD A;  4IUT A;  4EQO A;  1QCB D;  3E9H A;  4X66 Q;  1UE1 A;  2OWO A;  4AIM A;  3NQT A;  4ALP A;  2R6G A;  1II3 A;  3TN2 A;  3AMU A;  1ROD A;  3T53 B;  3HOY G;  4CJ0 B;  1LTT D;  1JCK B;  3H09 A;  2F4V L;  1PMR A;  3PMF A;  2B2U C;  1K8M A;  5HGQ A;  4KHV A;  4BY7 B;  1Q81 C;  3PUW A;  4EVO A;  1EFW A;  1B9N A;  3W1B A;  3PO2 B;  1D1K A;  1H9J A;  5ELC A;  1HNW Q;  1IBL L;  1YIT A;  4DK6 C;  5FO9 B;  1EIY B;  3OHX C;  2QCP X;  2VUM G;  1JWS D;  2K32 A;  2HHH Q;  1V1P B;  1OXV A;  4RCO A;  4A3G B;  1XMO Q;  2ZJQ A;  3S1N B;  4X6A H;  2FHT A;  2NBF A;  3K0X A;  1W6J A;  3TP8 A;  3KJO A;  3MVV A;  5JPM C;  3HOZ H;  2Q2T A;  1HNX L;  3JC6 6;  1KAW A;  1LTG D;  3QG1 A;  2UXD L;  4C3J B;  2AQ3 B;  4DUY Q;  3I8Z A;  3FKI G;  5M5X H;  4HJ7 A;  4Y7N B;  4PMW A;  3CU7 A;  4EX5 A;  1EY6 A;  1K8G A;  3A56 A;  4ZUJ A;  4GZY C;  1AW7 A;  1F9P A;  3GV6 A;  1BO0 A;  3HFZ B;  1Y1W H;  2ZTE A;  2A1A A;  4FF4 A;  2ATW A;  1HUM A;  2JJQ A;  2NZO A;  1K8O A;  2CWP A;  5C4X H;  1NE3 A;  1S3O A;  3U9O A;  1TWA B;  1R4P B;  5A2Q E;  4A3I G;  1EQR A;  1V43 A;  4DV3 Q;  4BA2 I;  4OON A;  2I46 A;  4V19 0;  2F3I A;  1VQ6 A;  4R4T A;  3WWV A;  5I9O A;  3A74 A;  1QZG A;  2L9H A;  3GD7 A;  4JI1 Q;  5JVH 3;  3EA6 A;  2OT2 A;  3ND9 A;  1XPO A;  1JB3 A;  3J7Y W;  2E2I B;  4XTC S;  3PV0 A;  1PH1 A;  1BKB A;  1ENC A;  3NK9 A;  3I4M G;  4N8X 1;  1YIJ A;  4ZAI A;  3L9A X;  1V9P A;  3KBX A;  4ZK9 B;  3GTK H;  5FLX L;  5CBE E;  4KLK A;  1I50 B;  3S2H H;  1OXT A;  2F0I A;  5J39 A;  3M7N A;  5J22 A;  1JOK A;  2K14 A;  2O5I C;  4DUZ Q;  3X3N A;  2VQF L;  2CW0 C;  2L11 A;  3CCV A;  1C0A A;  3SVM A;  1D8L A;  3K8A A;  1XPR A;  1RKN A;  2EY6 A;  2ZTD A;  5KYL A;  4N9P A;  3F2B A;  1LT3 D;  3VA5 A;  4GNX A;  1R9T H;  1QNU A;  1STY A;  3NWT A;  2R7F A;  3HOU H;  4TKO B;  1QJO A;  1BCP C;  2CKZ B;  4APV A;  1Z9F A;  1WTQ A;  1K3R A;  3NPP A;  2B2W C;  3S15 B;  1E2Z A;  2F0H A;  2HDL A;  2B39 A;  2M2L A;  1SE3 A;  2Y0S G;  4PMB A;  3CC2 A;  3BYY B;  1WTH A;  1Y8P B;  3P20 A;  3NQI A;  3LWU A;  4RHR A;  1JOR A;  5DM6 3;  1A2U A;  4IZ8 A;  5C5M A;  5EQ0 A;  2A69 C;  5GRO A;  4XYQ A;  3CCU A;  2RSN A;  2N49 A;  3BJU A;  4CHT B;  1P16 A;  1VQ7 A;  1GVP A;  1ILQ A;  4IUP A;  3I3C A;  5AJ3 L;  4FO2 A;  1EQV A;  1BVS A;  1DD2 A;  5EJW A;  3GTL B;  5HY6 A;  1PVO A;  1IBK L;  2JA6 B;  1J5E Q;  4DV2 Q;  3BDL A;  2KA7 A;  1STA A;  3NTH A;  4RHS A;  4NXM L;  1ESR A;  4DV4 Q;  4A75 A;  3K58 A;  1OXX K;  3HKZ E;  1JMC A;  4KN4 C;  1TU2 B;  1F2M A;  2B2Y C;  1YNN D;  1O80 A;  5E4X A;  3VYR A;  3Q23 A;  5IT9 c;  2QA4 A;  3K7A B;  5DNF A;  4I7Z C; 
#chains in the Genus database with same CATH homology
 1B4O A;  5NUC A;  5JPN C;  1A6X A;  1OO9 B;  1SNQ A;  1ZEQ X;  1G2T A;  3OMC A;  1LTI D;  3KLS X;  4XXE A;  2IX1 A;  5EPL A;  1RJT A;  1QG7 A;  3VR6 A;  1EY7 A;  4XDX A;  2F1M A;  1SMY D;  1F2Y A;  1L0X B;  3VYS A;  2L55 A;  2L0C A;  3D8G A;  4HSP A;  4IQZ A;  1EZ6 A;  4RGN A;  2F0J A;  3OWE B;  4A3M B;  1TWG B;  5JOB A;  1EU3 A;  2EYF A;  5C4H A;  2EE1 A;  1VF7 A;  1ESF A;  3U9S A;  2ZXR A;  3OOC A;  2D2C C;  5CBA E;  5EPJ A;  4PNY A;  3EFX D;  3M4O B;  3PIO 3;  1EZ8 A;  4DFA A;  1ICW A;  2ENB A;  4L63 B;  5C0X H;  1PLF A;  2PZU A;  2E2H B;  1S5D D;  1ZYR D;  1IKL A;  2OXP A;  3M4Y A;  3VR2 A;  2DN8 A;  2QKI C;  2ZXO A;  2K28 A;  2E2D C;  3Q6S A;  5D3D A;  3S1Q B;  2IW3 A;  2RBM A;  1MGS A;  4HR7 B;  2AUJ D;  1WTO A;  1MBY A;  3VR4 A;  2ID0 A;  1OXU A;  3V05 A;  3WDN A;  1O7Y A;  2EYL A;  3I70 A;  1A2T A;  3I91 A;  2E75 C;  4RKB A;  1FNU A;  4A3B B;  3TZU A;  5IGC A;  4I65 A;  2JP1 A;  4KY6 A;  3FPP A;  1Z7T A;  3HOV B;  2B2V A;  1HTL D;  5KIX A;  1PYW D;  5DM7 3;  2O5J C;  5E4W C;  1PZK D;  1RCV D;  3T13 A;  1T5X D;  4RKL A;  1BF4 A;  1Z6H A;  4K2L A;  3KLS A;  2Q8I B;  4M1U B;  4IFD J;  2NVX B;  3FEW X;  2Z4H A;  2L4N A;  1AZQ A;  5IGG A;  1EIH A;  2OF1 A;  1CZW A;  4CGY B;  1CTM A;  1I6H B;  4DN4 M;  1E0B A;  1Q3L A;  1MI2 A;  3R2I A;  4ULL A;  1SAP A;  1VMC A;  4RGM A;  3GTM B;  5HUR A;  2QEJ C;  4QUF A;  3GQB A;  1TQO A;  2D62 A;  1PDQ A;  1Q90 A;  1HFN A;  3FPU B;  5A35 A;  1PTO B;  1JR0 D;  1TKW B;  3VR5 A;  1TWF B;  2F0T A;  1SND A;  2SNS A;  3Q24 A;  2EY5 A;  1TY0 A;  5C4J B;  1EIG A;  5EKL A;  4BY1 B;  1LTA D;  2LFN A;  1I6V C;  1YNJ D;  2OEO A;  5FOB B;  2NUC A;  5KND A;  3L3O C;  5I9P A;  1WD1 A;  3RD4 A;  1G8Z D;  2G9D A;  4OGQ C;  3DXJ C;  2NYZ D;  3HKZ B;  1JOO A;  4Z9C B;  1JQY D;  5TSS A;  3WOE A;  3FDT A;  4HCE A;  4RH6 A;  4RCN A;  1U4M A;  3H3V C;  4NDX A;  3O13 A;  1TT2 A;  3J81 E;  1SNP A;  2JE6 I;  2SOB A;  2XWJ B;  4K6L A;  1WD0 A;  4A3J B;  3MZ5 A;  5M5Y B;  3ONA B;  2IT1 A;  2JYO A;  1C4Q A;  3OIQ A;  2PW5 A;  2ZXP A;  3BDC A;  1EWH A;  3AU7 A;  1D5X C;  2F0L A;  2RQX A;  1X3P A;  3KUP A;  5JJZ A;  4P2C B;  3FRP B;  5D14 A;  4N9T A;  1LAB A;  3GP7 A;  1HRJ A;  3GTO B;  4KD3 A;  1PXU A;  4V0B A;  2F0G A;  5ELF A;  5G3L D;  4C3I B;  1CI3 M;  4HTH A;  1RF2 D;  2A6E C;  1GUS A;  2PYK A;  4MN3 A;  1STG A;  1UEA B;  4KY5 A;  4FF2 A;  2F0F A;  3G6J B;  2HDM A;  1PRT D;  3SEB A;  4CJ2 C;  1EY5 A;  1S4Z A;  3DHQ A;  3FVQ A;  4EGV A;  3A8J E;  4MHE A;  5E1F A;  4FYD A;  1IYV A;  2EYH A;  1O7L A;  1BCP F;  3SR1 A;  3SE0 A;  5KNB A;  4ZKB B;  1EY0 A;  5IGD A;  3E5S A;  1KDB A;  5C0X I;  3S1M B;  1S5B D;  2J4X A;  4XQN A;  5DAU A;  1I4Q A;  4DNR B;  2EXZ A;  3NP8 A;  3J80 L;  1HTP A;  1K83 B;  2B2T C;  5F2D A;  5FO7 B;  1VMP A;  5EBD A;  2JA7 B;  2WII B;  4XQQ A;  4HN7 A;  2XNA C;  5CR3 A;  4X3K A;  2EVB A;  1LTS D;  3MTS A;  5M9O A;  1WTX A;  5EBC A;  4EQP A;  2Q8T A;  3X3M A;  3IL8 A;  4DAY A;  3NBI A;  1SYD A;  1B53 A;  4C3H G;  3N6R A;  1KAA A;  1TS3 A;  1DON A;  2ICI A;  3W3A A;  2VNU D;  1AZP A;  3K5N A;  1ENA A;  2F0V A;  4KTA A;  1HFG A;  1SE2 A;  3TP6 A;  1S5C D;  4K14 A;  1EY8 A;  1STB A;  1I4R A;  4HSV A;  2EDG A;  2V4D A;  2QIL A;  2TSS A;  5I6W A;  3S17 B;  1GUO A;  1DXM A;  3DWA A;  5JVG 3;  4F88 A;  3PIP 3;  1JOQ A;  2N55 A;  5CYU A;  4ZRZ A;  4NMZ A;  1ZKO A;  5G3L F;  4HMI A;  1BXT A;  3H94 A;  3K6O A;  4ILW A;  4IAL A;  2B2Y A;  1CHQ D;  3J7A F;  1PFM A;  1PRT F;  2AWO A;  2F3W A;  4KKS A;  4B08 A;  5ELB A;  1GXD C;  5CV7 A;  4S3S A;  4ZQ3 A;  3K5M A;  2PZT A;  2NB0 A;  4DK0 A;  1CA5 A;  4FXG C;  5T1I A;  1FGB D;  1D1I A;  1Q1E A;  2BDO A;  2RA4 A;  2K1B A;  2NZ1 D;  5JEA H;  4RGT A;  3C1E A;  3JAM L;  1Q8I A;  4ODG A;  1DOM A;  5FLX E;  3HOZ B;  1IW7 C;  2FIN B;  3JAM E;  1JC7 A;  1VCI A;  5M5X B;  1HXY D;  1PFB A;  1NSN S;  4J1M A;  4F8M A;  1D5Z C;  2KCN A;  3PUV A;  1EYD A;  1GOZ A;  4MIU A;  4DAP A;  1Y1W B;  3DUZ A;  2XWB B;  4G7Z C;  5C4X B;  1WTP A;  3AB9 A;  1SXT A;  3TME A;  2F0P A;  1EYC A;  2PMZ B;  1BOS A;  1RD9 D;  1E2W A;  2AUK A;  1RDP D;  2LS0 1;  3R2T A;  1GUT A;  2MJ8 A;  4JBW A;  1TY2 A;  3NWS A;  5JAV A;  3I73 A;  2O2L D;  5BN4 A;  1A3V A;  3GTK B;  1LTB D;  3S2H B;  3QIA A;  3E6Z X;  1EY4 A;  1EU4 A;  3K0Y A;  4C3I G;  1CQF A;  1ET6 A;  3HP3 A;  2K5Q A;  3A8K E;  2EOT A;  1PRT B;  3C3L A;  3QWN A;  1KDC A;  1R9T B;  2A73 B;  3GO5 A;  1G6Z A;  3HOU B;  1SYB A;  4WJW A;  2Z1C A;  2NN6 H;  1A3U A;  4CKE A;  2BE5 D;  2HQE A;  5C5L A;  2DNC A;  2L1B A;  1UNS A;  5K36 G;  1A15 A;  2EYJ A;  3OIP A;  4C56 C;  1KLG D;  3PUY A;  4HCS A;  2YYZ A;  1LTR D;  2CVR A;  2K33 A;  5HGT A;  1H9K A;  3I4L A;  4QB4 A;  3CRK C;  3D6C A;  4XT1 B;  2O4X A;  3F2U A;  2KEE A;  3I90 A;  1KLU D;  4X3U A;  5J1Z A;  3E0J A;  4OIJ A;  3SK5 A;  3H6M A;  1GJX A;  1F9R A;  2NTT A;  3LWE A;  1Q12 A;  5CV9 A;  3BVM A;  1SYE A;  1V1O A;  2C9O A;  4H7B A;  1CM9 A;  3A7A B;  3D31 A;  2YU9 B;  1DZ1 A;  2KOL A;  1DYQ A;  4IUQ A;  2WAC A;  2B8G A;  3DWP A;  3MAQ A;  3LNN A;  2JEA I;  1EY9 A;  4R9W A;  5ELE A;  5IOC A;  4KHZ A;  3OW7 A;  4PV1 C;  1DM0 B;  2F0K A;  4DGZ A;  4NW2 A;  5M3M B;  3DEO A;  1SYG A;  2B63 B;  3OWF A;  4C3J G;  2BCO A;  4QCL A;  4ZLT F;  2QDB A;  1IHZ A;  4XT3 B;  1PZJ D;  4C1N I;  1M4V A;  1D6E C;  4KJN A;  2A6H C;  4K6D A;  3MXP A;  1ZXT A;  2FFK B;  5CV6 A;  2R7Z B;  1AN8 A;  5C3X A;  1NAP A;  1ENF A;  1FR3 A;  3BG3 A;  5BN3 A;  1LT5 D;  5D3I B;  4DK1 A;  4C1N K;  1LV9 A;  3DMU A;  2IX0 A;  3T56 B;  3K57 A;  2KCC A;  1B3A A;  2XRQ D;  1X32 A;  3NBH A;  2VB2 X;  3ZYY X;  1SEB D;  1MSG A;  2FMC A;  3TP5 A;  2C5C A;  3MC0 B;  2F0S A;  2RKS A;  3D4D A;  1NR4 A;  4H44 C;  2VUM B;  3T16 A;  2EY2 A;  2I07 B;  2D5D A;  4XYO A;  5CMD A;  4WOR A;  2CW0 D;  2F0N A;  1EEI D;  1TWH B;  1IW7 D;  3EVQ A;  4HMJ A;  3BZD B;  3BYT B;  4QUC A;  4OHJ A;  4K5W A;  5C0X J;  2XIW A;  1BCP D;  3WOF A;  4ABN A;  1SBB B;  4G4K A;  1U4R A;  3MWY W;  4J8Q A;  2A74 C;  5I2X A;  2DNE A;  4A3I B;  5IGE A;  2DY8 A;  2PZW A;  1MSH A;  2E76 C;  1GUW A;  1Y69 U;  1QIL A;  2K04 A;  3RMH A;  4CJ1 B;  3P75 A;  2A69 D;  4R8N A;  1XX8 A;  2F4I A;  4WFN 3;  1MD2 D;  2F0E A;  3W2D A;  1DJR D;  3SXH A;  3OMG A;  4BWG B;  2B2V C;  2ZT9 C;  4DU9 A;  3HS0 C;  3NSW A;  3TBI B;  2SDF A;  4IN3 A;  2XN9 C;  4RAU C;  4FVM A;  2KHS A;  1IL8 A;  1KNE A;  1SJE D;  1QE6 A;  4KMU C;  1PTO C;  3Q0A A;  3QOJ A;  2B2T A;  4RFB A;  4DAV A;  4O1N A;  1HHV A;  4K5V A;  5K5P A;  2BA1 A;  3HEJ A;  1B2T A;  1XYI A;  2Y0S B;  2B2U A;  3P1H A;  1KDA A;  2F03 A;  5K36 H;  2EYP A;  1HQR D;  2NN6 I;  3VR3 A;  4U67 3;  1H9S A;  1HPC A;  3EQL C;  1YNN C;  5C4Z A;  4E6I A;  5IGF A;  1LAC A;  4UAI A;  5T1G A;  2AQ2 B;  4B9X A;  1DOK A;  3T51 B;  2DY7 A;  2RDH A;  1GUN A;  4KKT A;  4IFD G;  1Z47 A;  4KI0 A;  1RTO A;  1SYC A;  2CHB D;  2Z8L A;  4BBR B;  4Q5V A;  1TS4 A;  5C44 B;  3RZD B;  1SSO A;  3R8B A;  1EWC A;  3S1R B;  1SYF A;  2XRS D;  2K6A A;  2CQA A;  1BR9 A;  5LL6 S;  5LHY 1;  5M3F B;  1J8I A;  2LKV A;  3CRL C;  4ID6 A;  5CGK A;  2EYO A;  2RVL A;  2F0W A;  2E74 C;  3R93 A;  1F77 A;  4H13 C;  2X6L A;  4OO1 G;  4RA8 A;  4X3T A;  1BNZ A;  3DWQ A;  3TZD A;  4G7H C;  1F9Q A;  1AFP A;  3ND8 A;  3ERQ A;  1V8Q A;  2MHV A;  3H0G B;  3J80 E;  4DNT B;  1PZI D;  1O7Z A;  4H0L C;  3S2D B;  1ZYR C;  3FMC A;  3NHH A;  3UI2 A;  2RSO A;  1A3T A;  1I4P A;  1Y8N B;  1Y8O B;  2EPB A;  2A6H D;  3D4W A;  4F87 A;  2PCF B;  2BOS A;  2B2W A;  1F9S A;  5CV8 A;  1VF5 C;  3GTG B;  3MEH A;  5I2Y A;  4LAA A;  1U4L A;  2KJX A;  2VB3 X;  1SDF A;  5I6Y A;  1ET9 A;  1STN A;  4L8J A;  4UDU C;  2WIN B;  2IWH A;  1HUN A;  2F0O A;  2A68 C;  2K7V A;  3RLF A;  1F2L A;  3TP7 A;  2HCC A;  3IKJ A;  2J7Z A;  2G9H D;  4B9W A;  4KV6 A;  4C2M B;  1TWC B;  2KEC A;  1BCP B;  5A2Q L;  2EJF C;  1I3Q B;  3S16 B;  4G7O C;  1B9M A;  5FKA C;  5IIF A;  2EZV A;  2VXW A;  1QB5 D;  1QNK A;  4K5X A;  1G91 A;  1Q1B A;  2LY7 A;  4BBS B;  3BVZ A;  3IAY A;  3C2P A;  3D3R A;  4TQU S;  2MUY A;  4A3E B;  2F0D A;  2L5T A;  2NWG A;  3NUC A;  4A3K B;  2EJM A;  1BBX C;  3VA7 A;  5CV4 A;  4A93 B;  3KK7 A;  1EEF D;  5C6A A;  4PMC A;  4TSS A;  4HAE A;  4A3D B;  2KUM A;  1HA6 A;  5ISR A;  3QJY A;  2Z4I A;  4QF4 A;  2RDF A;  4IUN A;  3KF8 A;  1WVL A;  5KYI A;  3QOL A;  2JXM B;  4R8I A;  2R92 B;  3RZO B;  5C3E B;  1ML0 D;  3A8I E;  1YNJ C;  4A3F B;  4KJO A;  4ZKC B;  1PTO D;  3ITP A;  2K5D A;  5LL6 X;  3TDQ A;  2EYM A;  2WKC A;  4EQN A;  1U4P A;  2PNR C;  3M3Y B;  1EFI D;  2SNM A;  5EKK A;  1B50 A;  1EL0 A;  3GTJ B;  2F0Q A;  3M7G A;  4CKB A;  3PUX A;  5CV5 A;  3HOX B;  2H1E A;  4XIG S;  2MPM A;  3P7J A;  2A5H A;  3BVG A;  3GTP B;  1X3Q A;  3I72 A;  2F0U A;  1SE4 A;  1I4H A;  2MGS A;  2A6E D;  4G57 A;  3V96 A;  1SFO B;  4OL7 A;  1JWM D;  2EY1 A;  3MA2 B;  1CFM A;  3NTK A;  4IFD H;  3A54 A;  4AYB B;  2JA8 B;  2PQE A;  4NP5 A;  1WTV A;  2GA4 B;  2KVM A;  3HG9 A;  2X6G A;  3HGB A;  3K5L A;  3IFD A;  2FMM A;  3SK8 A;  5JEA J;  4CBV A;  2K01 A;  2L12 A;  4KD4 A;  3C1F A;  2JEB I;  2K05 A;  4K8I A;  1FNV A;  2WAQ B;  4IUV A;  4L6T B;  1PRT C;  1FD7 D;  1XXG A;  5I4D A;  1CZG A;  4OO1 H;  4LK1 C;  1G29 1;  1WCM B;  2WKD A;  2K5W A;  3CQZ B;  1QWY A;  1TII D;  3NXW A;  1CQV A;  3BS1 A;  3MXU A;  4OIK A;  1RHP A;  1TS2 A;  3MXG A;  1CA6 A;  3VYU A;  1BDO A;  1O78 A;  2M00 A;  1PTO F;  1LLR D;  1J9O A;  2R3Z A;  2X69 A;  1LO5 D;  1L0Y B;  3PO3 B;  4XQJ A;  2ICE C;  1UUP A;  5E3F A;  2PO4 A;  3TSS A;  3BDO A;  3OSO A;  1STE A;  4PQX A;  2SEB D;  3HZX A;  2A68 D;  4BA1 I;  3SK4 A;  1PTO H;  3DM1 A;  4IUR A;  1XTC D;  1IKM A;  2QF7 A;  3A7L A;  2RDG A;  1GHJ A;  2NTS A;  5KRU A;  1T5E A;  1I4X A;  1RTN A;  3I4N B;  4FF1 A;  3HOY B;  2JA5 B;  3D6W A;  2AQ1 B;  4IUU A;  1AEX A;  1DOL A;  1S5E D;  1Y1V B;  2AWN A;  4FXD A;  1TR5 A;  2JSO A;  2WP8 J;  3CHB D;  1ILP A;  2LMC B;  2F0M A;  3A55 A;  4HED A;  4C3H B;  2B8F A;  3URY A;  2D9U A;  3IFT A;  3HRZ C;  3MFG A;  1JWU D;  1CHP D;  1SNC A;  4FXK C;  2XSC A;  4ZUI A;  3SK6 A;  4DXF A;  1H9M A;  2K03 A;  3D4R A;  3Q22 A;  1CT1 D;  3N52 A;  3NTI A;  4FP5 D;  3SHL A;  3CKI B;  1JE4 A;  1KNA A;  2KQ3 A;  3FKI B;  4RWS C;  2PW7 A;  1LT6 D;  3QO2 A;  1NR2 A;  2KED A;  1TVX A;  1SNO A;  2J0T D;  1WTR A;  1IYU A;  4DXG A;  1LT4 D;  4YIJ A;  1C8C A;  4F7X A;  2FJ2 A;  1U9R A;  2XVS A;  4KN7 C;  3GV3 A;  1PFN A;  1OXS C;  5JEA G;  4RGO S;  3QB3 A;  3EJI A;  4KY7 A;  1CK1 A;  1FNW A;  1FYC A;  5EGT A;  1R4Q B;  4NKL A;  1GHK A;  1ONL A;  3I4M B;  1XWE A;  4ME5 A;  1F2Z A;  1I4G A;  3NE5 B;  1DCZ A;  3MXN A;  4O42 A;  1B1Z A;  1S5F D;  5FO8 B;  5KEE A;  2WV6 D;  3G7L A;  4BS9 A;  3J81 L;  2IL8 A;  1B44 D;  2HCI A;  1M8A A;  2IX3 A;  2IJ0 A;  1E2V A;  3H91 A;  4U68 A;  1W6K A;  5KNC A;  5EPK A;  3R3O A;  2TMP A;  1NUC A;  3PUZ A;  3ERO A;  1TS5 A;  1EYA A;  4LJZ C;  2NVT B;  4M8A A;  5M5W B;  2EJG C;  3S14 B;  3J7A V;  1KAB A;  4ZYS A;  5D65 A;  1SJH D;  5EKI A;  3KLR A;  4JK1 C;  3S9W A;  4LMQ D;  4FNF A;  3MHB A;  4DF7 A;  2MP1 A;  1SNM A;  4QIW B;  2F3V A;  3VYT A;  1NCV A;  4WRD A;  1UAP A;  4Q0F A;  5AFW A;  3SDZ A;  4IFD I;  4K8J A;  1KTK A;  2H4O A;  1C48 A;  2NVY B;  3V2T A;  2IPK D;  1D2B A;  1WTW A;  5CC4 A;  1VDZ A;  3GTQ B;  2NN6 G;  2R61 A;  2BDN A;  5C3W A;  2N88 A;  4KK7 A;  2BE5 C;  1SMY C;  4KKU A;  1G2S A;  3MFY A;  1HQM C;  1HCZ A;  3C46 A;  3KBG A;  4FF3 A;  5COY A;  1H9S B;  2NVQ B;  1BUV T;  5ELD A;  4QMG A;  4X3S A;  1D5M C;  3OPO A;  3LX0 A;  3K59 A;  5FK9 C;  1QOH A;  4OO1 I;  5BN5 A;  3K5O A;  5DEH A;  4CKC A;  5IT9 L;  2WB1 B;  3DEP A;  2R93 B;  4DA2 A;  2PPB C;  5KGU A;  5COR A;  1STH A;  3M85 A;  1HA5 A;  1EQT A;  4K2K A;  4TRD A;  5IT9 E;  2E2J B;  2BA0 A;  1H9R A;  1V1P A;  1AP0 A;  1BQQ T;  1EOT A;  1JIC A;  1GUG A;  2HUG A;  4J6H A;  5C0X G;  3RUZ A;  5IGB A;  2Q8R E;  3L7Z C;  2M9V A;  3HOW B;  3T4A C;  5IOD A;  4IUT A;  4EQO A;  1QCB D;  3NQT A;  2R6G A;  1II3 A;  3TN2 A;  3AMU A;  1ROD A;  3T53 B;  4CJ0 B;  1LTT D;  1JCK B;  3H09 A;  1PMR A;  3PMF A;  2B2U C;  1K8M A;  4KHV A;  4BY7 B;  3PUW A;  4EVO A;  1B9N A;  3PO2 B;  1D1K A;  1H9J A;  5ELC A;  5FO9 B;  3OHX C;  2QCP X;  1JWS D;  2K32 A;  1V1P B;  1OXV A;  4RCO A;  4A3G B;  3S1N B;  2FHT A;  2NBF A;  1W6J A;  3TP8 A;  3MVV A;  5JPM C;  3QG1 A;  1LTG D;  4C3J B;  2AQ3 B;  3I8Z A;  4Y7N B;  4PMW A;  3CU7 A;  1EY6 A;  3A56 A;  4ZUJ A;  4GZY C;  1AW7 A;  1F9P A;  3GV6 A;  1BO0 A;  4FF4 A;  1HUM A;  1K8O A;  3U9O A;  1TWA B;  1R4P B;  5A2Q E;  1V43 A;  4BA2 I;  2I46 A;  4V19 0;  5I9O A;  2L9H A;  3GD7 A;  5JVH 3;  3EA6 A;  2OT2 A;  3ND9 A;  1JB3 A;  3J7Y W;  2E2I B;  4XTC S;  3PV0 A;  1ENC A;  3NK9 A;  4ZAI A;  3L9A X;  3KBX A;  4ZK9 B;  5FLX L;  5CBE E;  1I50 B;  1OXT A;  2F0I A;  5J39 A;  3M7N A;  5J22 A;  1JOK A;  2O5I C;  3X3N A;  2CW0 C;  2L11 A;  3SVM A;  1RKN A;  2EY6 A;  5KYL A;  4N9P A;  1LT3 D;  3VA5 A;  1QNU A;  1STY A;  3NWT A;  4TKO B;  1QJO A;  1BCP C;  1WTQ A;  3NPP A;  2B2W C;  3S15 B;  1E2Z A;  2F0H A;  2HDL A;  2B39 A;  2M2L A;  1SE3 A;  4PMB A;  3BYY B;  1Y8P B;  3P20 A;  3NQI A;  3LWU A;  4RHR A;  1JOR A;  5DM6 3;  1A2U A;  4IZ8 A;  5C5M A;  5EQ0 A;  2A69 C;  4XYQ A;  2RSN A;  4CHT B;  1ILQ A;  4IUP A;  3I3C A;  4FO2 A;  1EQV A;  1DD2 A;  5EJW A;  3GTL B;  2JA6 B;  3BDL A;  2KA7 A;  1STA A;  3NTH A;  4RHS A;  1ESR A;  3K58 A;  1OXX K;  4KN4 C;  1TU2 B;  1F2M A;  2B2Y C;  1YNN D;  1O80 A;  5E4X A;  3VYR A;  3Q23 A;  3K7A B;  5DNF A;  4I7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...