4OIKA

(quasi-)racemic x-ray crystal structure of glycosylated chemokine ser-ccl1.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
b'SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 1
publication title (Quasi-)Racemic X-ray Structures of Glycosylated and Non-Glycosylated Forms of the Chemokine Ser-CCL1 Prepared by Total Chemical Synthesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oikA00
1B4OA 2KEDA 4HEDA 4X3UA 3TZDA 1HFGA 3TN2A 3FDTA 1WTOA 2N88A 2Q8RE 1C8CA 1U4PA 5EPKA 2JP1A 1CM9A 3GV3A 3UI2A 2MGSA 1A15A 1PFMA 3DM1A 4HCSA 1EQTA 1RTNA 1F9QA 1KNEA 2B2TA 3GV6A 3MTSA 3ONAB 3SVMA 1BBXC 4DN4M 1QG7A 5D65A 2B2YA 1IKLA 1TVXA 2B2VA 4IUUA 1U4RA 1B3AA 4ZK9B 1PDQA 1O7ZA 4ZAIA 5EQ0A 1XYIA 3I91A 1G2SA 2BDNA 5JJZA 1E0BA 2B2TC 1B50A 3D6WA 4CJ0B 2L4NA 4RAUC 2L9HA 3I3CA 1AZQA 1NCVA 1MSGA 2B2WC 1SSOA 2HDMA 2HDLA 5EJWA 4ZKBB 3IFDA 3QO2A 1WTXA 1G91A 1LV9A 2L1BA 4NW2A 2EOTA 1O7YA 1PLFA 4HAEA 5D14A 4QUCA 1PFNA 2SDFA 1ML0D 1WTRA 4HSVA 2NZ1D 3LWEA 4CJ2C 1WTVA 1Q3LA 2B2UA 2FHTA 1DOLA 2K03A 1F9SA 1RHPA 1DZ1A 3KUPA 1ZXTA 2FMMA 2KEEA 2NYZD 1B53A 2KOLA 2MPMA 1NAPA 2NWGA 1HUMA 2H1EA 1EIGA 1RJTA 2K04A 4OIJA 1WD0A 1GUWA 1JE4A 4XT3B 1B2TA 2MJ8A 1WTQA 2DY8A 3H91A 1J8IA 2D9UA 2KUMA 4ZLTF 1XX8A 5COYA 1WVLA 1MI2A 5E4XA 1ILPA 2RA4A 5DNFA 1QE6A 2FFKB 2X69A 1KNAA 2B2YC 2B2VC 2X6LA 1MGSA 4IUQA 1O80A 1ICWA 4XT1B 3R93A 4LMQD 1BNZA 4RWSC 1EIHA 3FPUB 4ZKCB 2R3ZA 2DY7A 2HCCA 1NR4A 1RODA 3DEPA 4U68A 5E4WC 2N55A 2EE1A 1HRJA 4OIKA 2KECA 5T1IA 1U4MA 4X3KA 4MN3A 4R8IA 1QNKA 2XIWA 1X3QA 1WD1A 1HA6A 2FJ2A 1SAPA 2K1BA 2X6GA 1IL8A 1F9PA 4XDXA 1CA5A 1J9OA 4IUVA 1HUNA 5CBEE 1G2TA 2Q8TA 2B2UC 1F9RA 1PFBA 1S4ZA 5T1GA 4O42A 4QUFA 3I8ZA 3MWYW 3IL8A 2MP1A 5CORA 1DOKA 2KVMA 1EL0A 1VMPA 1BO0A 3N52A 4UAIA 2HCIA 5EKIA 1VMCA 1JICA 1X3PA 4IUPA 5CMDA 1X32A 1WTWA 1NR2A 2RSNA 1HFNA 3KBXA 2B2WA 4IURA 2L11A 1SDFA 1U4LA 2EPBA 4X3TA 1BF4A 1G6ZA 4IUTA 5CBAE 1ILQA 1DOMA 1AP0A 1RTOA 2JYOA 1AZPA 1DONA 3P7JA 1F2LA 2IL8A 2J7ZA 4RA8A 5EPJA 5EPLA 1WTPA 1HHVA 2K01A 3F2UA 3G7LA 2K05A 2RVLA 3Q6SA 5AFWA 1CA6A 1IKMA 3DEOA 2VXWA 4X3SA 1EOTA 4MHEA 3HP3A 2M2LA 2CVRA 1MSHA 2L12A 2RSOA 2FINB 3I90A 4CJ1B 2K28A 1ESRA 1M8AA 2HUGA 4R9WA
chains in the Genus database with same CATH superfamily
2V1CC 1FJGQ 4HEDA 1I50H 4IZ8A 2VY3A 3TP5A 1HNXQ 1EYGA 4L8JA 1KL9A 2KHIA 1X3GA 1NNXA 3AQQA 3HOZG 2D62A 1QWYA 5KRUA 3CC7A 2VQEQ 1L1OB 3I4NB 4DV7L 5C4XH 4DAYA 4ZK9B 3JAME 4ZAIA 1O7ZA 2Z1CA 4B3TQ 3TP6A 1JORA 5I2XA 4A3JG 3UDFA 1VQNA 5E3FA 3T56B 1CZWA 3AYHB 2K5NA 3HOYB 1KRSA 3PUXA 5IYCH 5C44H 1YI2A 2F4VL 2DGYA 2L1BA 2R93B 1TS3A 1O7YA 2F3IA 4L6TB 3D4DA 3SEBA 3LWEA 5FO9B 5IT9c 1DOLA 2JN4A 2I5LX 3JC66 1ZXTA 1SFOH 4DR2Q 5EGTA 1PRTB 4CDCC 1EYCA 4OX9L 4BBSH 1S3OA 2B39A 5CYUA 1KQSA 3HOUH 5FOBB 4JVZA 4XT1B 3KLWA 4CDEC 5BN4A 1EIHA 3A7AB 4IUNA 4RHRA 1GVPA 2EE1A 1D2BA 2VUMH 1XNRL 2X6GA 4Y52H 1VQ6A 1JE5A 2PMZE 2RHSB 3RN2A 3BZKA 4LNQA 2HD3A 1HNWQ 1GM5A 1DYQA 2F0KA 3WOEA 2VZAA 1OO9B 1F9RA 2MO0A 2PW5A 1X3FA 4BY7G 1O78A 1VQEA 3X3NA 1B44D 4CBVA 5KIXA 5JJLA 4JV5L 3KDFA 1VQHA 2EJGC 1CTMA 2A68C 2N8NA 1EY8A 4J6HA 1ET6A 2RSNA 4JC0A 1UEAB 4QB4A 2L11A 2SOBA 5IP9G 4BY1G 2XNAC 3VR2A 1AZPA 4KLKA 5AFWA 3DEOA 1VQIA 4GKKQ 1EY6A 1SNPA 2Q2IA 1VQ4A 2CCZA 1HA5A 2AWOA 3L0OA 5JEAJ 1U9RA 4H02A 1EIYB 3AMUA 3K57A 3H15A 2KHJA 1U4PA 3M4YA 5GAHC 4QIWB 1A15A 3O13A 1FYCA 4JI3Q 3HEJA 1BBXC 1WCMH 3DUZA 1JC7A 4X65Q 2JA7G 5E1FA 3FKIB 3A8KE 1ICFB 4KY5A 2JEBI 4EQOA 2R7DA 2MFIA 1XYIA 4YHHL 5JJZA 1EFID 1GD7A 4L5QA 2K4KA 3ULPA 2K5DA 2PO4A 3QJYA 2OWOA 3MXNB 3CCSA 3Q0AA 3IFDA 1WTXA 4A3KG 3V05A 2J0TD 1PFNA 4HR7B 4N8FA 1Q3LA 5ELBA 5M9OA 2JA9A 4DV4L 3CCQA 2OQKA 1RD9D 3S1RB 4QMGA 4LW1A 1A2UA 4WORA 4O1NA 4XT3B 5IGCA 1H9SA 4JI0L 1GOZA 2EJMA 5C5LA 3OIPA 1ZKOA 5CGKA 4PZ7A 2CWPA 2X69A 1HTLD 2X6LA 4NB3A 3JAMc 1XMOQ 2R7ZB 3J81j 3P20A 2F0SA 2E2JB 4DK3C 3ICEA 3RR5A 4JPBW 1JR0D 3Q22A 1EZ6A 2E75C 3IAYA 5T1IA 2ICIA 3HOXH 4K0KL 1G291 4X64L 1J9OA 5A35A 4A3DG 1G2TA 4LFBQ 4WRDA 4OO1H 1HQRD 2UUBL 1EYDA 2GN5A 2KENA 4E6IA 1X6OA 3D4RA 3U50C 1STHA 4MNOA 1HJPA 1LACA 1Z6HA 3IL8A 1KC8C 1VQ5A 2WKDA 3RNUA 1D7QA 2IW3A 2VNUD 3PO3G 2BDOA 1TQOA 4P72A 3KBXA 5LMUL 1TWCH 1SNCA 3BVMA 1G8ZD 4NPSA 1ILQA 1TWFB 2I07B 5J3BA 1VF7A 3EJIA 4HJ9A 1XMQQ 2NVTB 4N9TA 1NBWA 3S15B 1O7LA 1E2ZA 2WB1G 1K8MA 1VF5C 4LAAA 2GVBA 1B4OA 5C5MA 2ALYB 5IY0A 4K2KA 2G9DA 3FDTA 1SNMA 2WIIB 4C3IG 4LF4L 1T9HA 1EFWA 5IGEA 4DUYQ 3CPWA 3KOJA 3ONAB 1IYVA 2Q2TA 2PI2A 4AIMA 4A3LG 3SXHA 3GTMH 5C3EH 1ENFA 1TS2A 4C3HG 5KGUA 2WV6D 3C2PA 3EVQA 1AZQA 3G48A 1PH2A 2R92H 1YJNA 5EJWA 3DLLA 3QO2A 4JI2Q 1Y8OB 4TKOB 1R4PB 1G51A 3TS0A 3EBEA 5A2QL 3HOZH 4FNFA 3S24A 3CRKC 4DUZL 4QY7A 3GTGH 1CHPD 3OMCA 2MJ8A 2F3WA 3NELA 4QCLA 2D9UA 5COYA 3H09A 1MI2A 1PZJD 4J1MA 2Q8IB 2RA4A 4DR3Q 4IOCA 2B2YC 2ZTDA 4I7ZC 2IHFA 4ME3A 4P75A 2QDLA 4ZYSA 1SYEA 1AW7A 3BYTB 2F0TA 1STAA 3CCLA 4DAMA 2DJGC 2G5DA 1FVIA 3PUWA 5HGQA 1SYCA 4DAVA 3ERQA 2K1BA 1YHAA 3CCVA 2E2HB 2F0NA 2AWNA 4DR1Q 1EEID 1Q8IA 1I94Q 3GO5A 4M8AA 3J7YW 1UUPA 4ILWA 3TP7A 3ZJYC 2D0PA 1E7ZA 2OXPA 3OMGA 4JBWA 3KJOA 5J1ZA 2NN6G 2Z6KA 2HHHL 3DMUA 1PTOD 3KK7A 2F0EA 1JWMD 3PUZA 4LUOA 3TMEA 3BDLA 1PTOF 2UUCL 3PMFA 1D1KA 1XPRA 4BBRG 1ZEQX 4N9PA 2WAQB 4KKSA 4RA8A 4OO1I 4Q5VA 1NUCA 2QW7A 4MHEA 4DR6L 1JJGA 2DN8A 1SYDA 3A56A 2PPBC 3S2DB 5KNDA 2Q8RE 2A68D 2JP1A 1MBYA 3S17B 2B3GA 1F9QA 3MTSA 1KDBA 3CMAA 2F0OA 1S5DD 1SE4A 1BBWA 1IKLA 1E1OA 2B2YA 5IP9H 4C1NK 4BY1H 3J7ZC 1HNZL 3IFTA 1I4GA 3HGBA 3I91A 1DJRD 1B50A 4YWMA 4JI7Q 1EYAA 3CU7A 3NK9A 4ZKBB 4DV1Q 5KYLA 3HKSA 2ENBA 3K81C 1BR9A 1FR3A 3NQIA 1KHIA 3QOJA 4DXGA 2A6EC 4LFCQ 5BR8L 3S1NH 3VR5A 4BWGB 1PH3A 4MTKA 4U673 2BCOA 1NAPA 2NZOA 4LUZA 2JA7H 1X55A 2VW9A 1I5FA 2ZJPA 4X6AH 4OGQC 4QGUA 1SJED 2MNAA 2ICEC 2WACA 4AQYQ 3L3OC 2ZXRA 3CQZH 3CPFA 2CKZB 1SROA 4A3KH 5CV7A 1BDOA 1OXSC 2E76C 3H3VC 5GADC 1ZYRD 2N55A 4DR7L 4A93B 3OPOA 4B3RQ 2D2CC 2VUMG 1Q1BA 3NP8A 5CV5A 3Q24A 5DM73 1R9TH 3S2HH 1PTOH 1HUNA 1TWHH 3R8BA 2IY5B 3CXCA 3VA7A 2ZTCA 1AN8A 2F0MA 4PZ8A 1MD2D 2Q2HA 1VMPA 1PH1A 2ATWA 2DNCA 1AE2A 2TSSA 4KD4A 3SK8A 3GTPH 1NR2A 1IYJB 3AFQA 3WWVA 1IBKQ 4X3TA 3CC2A 1WOCA 2RDFA 3GD7A 3PSIA 1F2LA 1N36Q 3OYYA 3Q6SA 4A3DH 2LSSA 3W2DA 4DKAC 2UXDQ 1A3VA 2F1MA 4CGYB 2L12A 4C3JG 1SYFA 2FINB 4B3MQ 1HRJA 2HUGA 1FNWA 5I4DA 4X3UA 4ALPA 4KN7C 1Q81C 1B8AA 4JI1Q 3I55A 2KJXA 3DM1A 2OCEA 3PO3H 4GKJL 5JPMC 3SVMA 1IYUA 2IX3A 2EXDA 1GO3E 2QDBA 2KA7A 3LGJA 3KF8A 1HPCA 3KLSX 5M5YH 5EQ0A 5IGDA 2Z0SA 4RG1A 3MAQA 2UUAL 3A5ZB 3QB3A 4HSPA 3CMEA 1YNNC 3D6WA 4OWTB 4DR4Q 3GTQB 3M7NA 2ZT9C 2B2WC 5LL6X 4LF9Q 4POGA 1CI3M 4KJOA 2EYMA 4HAEA 1OXVA 1ENAA 3OTOQ 1D5MC 1RF2D 4C3IH 3AEVA 2NVQB 2GA4B 4F8MA 4H0LC 3HZXA 3DM3A 4A3LH 4LWCA 1KDCA 3QOLA 1WCMB 1K73C 1JB3A 1B2TA 4C3HH 3K5LA 2C5CA 1L1OC 2DNEA 4A3EG 1D6EC 4DV5Q 1U0LA 1LT4D 3M85A 1M90C 2B29A 1Y8PB 1LTID 3T1YL 1CFMA 3OOCA 4U68A 1JQYD 1LTSD 2L55A 4DK1A 1E1TA 4OHJA 3J81i 1A8VA 2VB3X 3H0GG 3MXPA 4GLXA 1IBLQ 4B08A 1CSQA 2PQAB 1C7YA 5CV6A 4EQPA 1PRTC 1C4QA 3NBIA 3M3YH 4QL5A 3MWYW 1STNA 1DOKA 1QJOA 4IOAA 4A3BG 3RZOH 1JWUD 1KAAA 2B63B 4DV3L 2UU9Q 1GHJA 1TU2B 1RDPD 2B2WA 4P74A 3I4MG 1KD1C 3W3AA 2F0PA 5KEEA 4B9XA 2HT1A 3F2UA 3F1ZA 1EY0A 1TKWB 3KBGA 3M4OB 1IBMQ 2ZXPA 3P75A 3HP3A 1EWHA 3NBHA 3NEMA 2BH2A 2HIXA 4R9WA 4JCVE 5DLQE 2SNMA 2NN6H 2L0CA 1VQLA 5FK9C 2N88A 2LFNA 1Z7TA 1N33L 3PO2G 5AJ3L 3OSOA 1HR0Q 2A69C 1YIJA 3SK6A 4CKCA 1EU3A 5M5XH 3PV0A 1PYSB 1FJGL 2QF7A 1TVXA 1I3QH 4I7AA 4BBRH 1HNXL 4UP9A 2K75A 3DWAA 1Q7YC 2IWHA 3SDZA 2VQEL 2B2TC 3DXJC 4GOPB 1TWGB 1OXTA 1TT2A 3KYHC 2R92G 2HDMA 2HDLA 2SEBD 5BN5A 1K0SA 2JA8B 4O2DA 1JB7A 3HOWG 5M3FB 3I4NG 4FYDA 4AYBG 3NTIA 4HSVA 4YY3L 4OWWB 1CQFA 1QVCA 4RCOA 4XQNA 3A8IE 3HKZG 4KV6A 5HURA 4KHVA 1OXUA 3HOYG 1WD0A 1RJTA 4ZQ3A 5FLMG 1P16A 1FGUA 2F0QA 2R93G 2F03A 4RGNA 5IE8A 5ELDA 2JQOA 1UE7A 3TQYA 3RZDH 4AYBE 4F87A 2NTSA 3RD4A 2A6ED 1IL2A 4RWSC 3FPUB 3D8GA 4ZKCB 4R8NA 1B9NA 1DCZA 3HKZE 1X54A 1E2WA 3A74A 3L9AX 1SMYD 5IYBG 1JCKB 3F2DA 4FF1A 2MUYA 5IT9L 1FL0A 1I4XA 3TREA 3GTGB 1NJIC 5FO8B 4F7XA 2EXZA 2JA5G 4A3JB 1HZAA 2KVMA 3A0JA 1JICA 4IUPA 3GTLB 1Y1WG 1PTOC 4QF4A 2Z4IA 5IODA 2XTIA 1PV4A 3LNNA 2BOSA 3S16H 3V96A 5ISRA 4L5TA 3P7JA 4ABNA 1HHVA 4GN5A 3U4ZA 4DAYB 3CCJA 1JOKA 1M4VA 2EYOA 3J80E 4LF7Q 5JAVA 2ZTEA 2F4IA 3PF5A 1LO5D 2PMZB 1NMGA 4DR5Q 4B3SL 5M5WB 4FF4A 1K83H 4IPGA 4IPDA 2UXBL 2RBMA 4GKKL 5C4JB 1YBYA 2MGSA 1SE2A 3AU7A 3K7AB 1BCPB 3U9OA 1U4RA 1Q86C 1K3BC 2A6HC 2YTVA 4JI3L 1L0YB 1XPOA 3PQIA 3NQTA 4UDUC 4JI0Q 4CJ0B 4X65L 3U9SA 1VQOA 4C3JH 1TS5A 4NW2A 1H9KA 4IJLA 5EBDA 4LUVA 2NZ1D 4CJ2C 1XNQQ 4BY7B 3HG9A 3FKIG 1RHPA 4RGOS 2EY2A 1HZ9A 2NVXH 3S14H 2OF1A 5FKAC 5FLXE 5J39A 1YNND 3BVGA 1PZID 2OTLA 4QIWE 5IP7G 3T51B 1STEA 1I6HB 4IUQA 3SK5A 1X65A 2PW7A 1HZCA 4K8IA 1QNUA 4NXNQ 5EBCA 3GQBA 1TS4A 2HCCA 4HJ5A 4JI8Q 3KDFB 4ZUJA 1XMOL 1ZYRC 2O2LD 2RCNA 3H3VH 4JK1C 1PYWD 4XDXA 2K5HA 4IUVA 3E9HA 2NVYH 1U5KA 2R7ZG 2AHOB 5C0XG 1VQ9A 4A3EH 1SXTA 1SYGA 2FMCA 2I5MX 2K14A 4RFBA 1YJWA 2E74C 1YHQA 5CORA 4LFBL 1PH5A 5H1SE 4UAIA 2E2IB 1VMCA 3QIAA 5IGBA 3NWSA 2JSOA 4YHHQ 1EUJA 2XWJB 2EVBA 3JAML 4ZCKA 3H0GH 3STBC 1JOQA 3RLOA 2YU9H 2K05A 1PRTD 4A4IA 1B70B 4YCUA 1PRTF 4FF2A 3CCRA 1TWHB 3LWUA 1RCVD 4KTAA 2I46A 2P5ZX 4DF7A 4R4OA 4A3BH 3NUCA 1EWIA 4V190 2F0GA 3I4MH 5IIFA 2L15A 1GUTA 3E5SA 4DUYL 2HIVA 2ZM6Q 2K52A 2QEJC 2QCPX 4K14A 5HGTA 5KYIA 4PZ6A 3RLFA 1H9SB 3EQLC 2V4DA 5FO7B 1VQMA 2BA1A 3SGIA 1EY4A 2A69D 2EYJA 2KCNA 1FGBD 3PO2H 4LFAQ 3NWTA 3J80c 1SEBD 4JI2L 2VQFL 4YWLA 1VQCA 4C1NI 3PO3B 4UP7A 2H1EA 4JI4Q 3NTKA 3BDOA 3ER0A 3C46A 4RKLA 2EIFA 4K5WA 2WB1E 3URYA 4G7ZC 4KMUC 1QOHA 5M5YB 4ZLTF 3JAMi 5FJ8G 1WJJA 4O0AA 5DNFA 4HJ8A 1VQJA 3GTJH 4GNXC 1S5ED 1SBBB 2RCFA 3HOWH 3I4NH 4IQZA 2HQEA 4JI5Q 3BVZA 4DR3L 4X3KA 2K5WA 4C3IB 1H9RA 2XIWA 3H94A 1AFPA 1L0WA 1QILA 1VQAA 3FVQA 1K9MC 1D5XC 3KF6A 5JJKA 3HOYH 2Q2UA 2F0FA 1F77A 5FLMH 2F52A 4HIKA 5C3XA 5D3IB 2K5QA 3M9BA 2R93H 2Q8TA 3VYUA 2AUJD 3F2CA 4L5SA 1D5ZC 4DR1L 1I94L 1EL0A 1K8GA 3MFGA 1RIPA 1BO0A 3N52A 1W2BA 5CV4A 4DXFA 5FLXc 2O4XA 1NTGA 3Q8DA 3ND9A 1EWCA 3QR8A 4OONA 1R4QB 4IURA 3K80C 1K3RA 1U4LA 5I6YA 5IYBH 2NTTA 2JYOA 1UEBA 1Y1VB 4C56C 1CA6A 1VDZA 3S9WA 3CC4A 4X3SA 2H5XA 1N32Q 2JA5H 1CZGA 1FNVA 5M3MB 2K28A 2Z9HA 4KHPQ 4S3SA 4WJ4A 2EJFC 3CRLC 3M3YB 3J81E 1C8CA 4X62L 2E5LQ 2ASBA 1Y1WH 2WAQG 3BZDB 1X9NA 4IFDG 2CQOA 1N34L 1VQ8A 1V8QA 1C0AA 4GNXA 3GTOB 1IZ6A 4NXMQ 3GTKB 2K33A 4A3GB 3HOVB 4RAUC 3I3CA 1NCVA 1SSOA 2A5HA 1NY4A 2A73B 2RF4A 2YTYA 3BDCA 4F88A 1RKNA 2WAQE 3S1QB 4NP5A 3I70A 2ES2A 4JI7L 2K03A 2ID0A 2F0JA 1VCIA 5ELEA 1BQQT 3MEFA 2A6HD 2A1AA 3X3MA 1IHZA 4LFCL 5IOCA 1EIGA 2K04A 2HHHQ 1AH9A 4BBRB 1CQVA 2B8FA 2CH4W 3I7FA 1YJ9A 4ID6A 1JMCA 4A3MG 2JA6G 2F3VA 4CDDC 1MJEA 1PVOA 4RGMA 2AMCB 3DEPA 1UWVA 3FKIH 1I50B 5JEAG 4MN3A 1UAPA 5ELFA 1WD1A 2FJ2A 4BXXG 1CKOA 3T53B 1SYBA 1F9PA 1SMYC 1V1PA 4B3RL 1TY2A 5C4XB 3C1FA 4UY8C 2RQXA 1KIXA 2C9OA 4YIJA 5IP7H 1V43A 1Q82C 2F0UA 1ASYA 1A2TA 4A93G 4HN7A 2IHEA 5C44B 4XQJA 1NSNS 1HFNA 1LYLA 4KHZA 4FO2A 4Y7NH 1G6ZA 4DV0Q 1PH9A 1VQDA 1STBA 1VQFA 1SFOB 3E9IA 2RVLA 2K6AA 1MJCA 1LM0A 2C35B 2Y0SB 3FMCA 2R7ZH 4KN4C 5C0XH 4BBSB 3I72A 3PCOB 3FRPB 1N36L 1Q46A 1S5CD 3HOUB 1Y8NB 2F0LA 1PYBA 1Z9FA 3R2TA 2PYKA 1QCBD 5I9PA 4B3ML 1BOSA 4G4KA 2A74C 4IPCA 2D0OA 2QEXA 4DN4M 1SNOA 1NMFA 2EQSA 3STBD 4JOIC 4JI1L 4IUUA 4P2CB 1T5XD 3J7AV 1Q90A 2VUMB 4LF8L 4HIDA 3E0JA 3VYRA 3A7LA 3FHWA 4X66Q 3E6ZX 2ZXOA 4GN4B 3SHLA 4DGZA 1KABA 2GVAA 1UE6A 2AQ2B 4CKEA 2WINB 4DR4L 1STGA 3ND8A 5DEHA 3K58A 4I65A 1TWFH 2AQ1B 4LF9L 1CKNA 3OTOL 5F2DA 3S15H 3PIP3 4K5XA 3VYTA 2EZVA 1CK1A 3J81c 4PMCA 3AFPA 1IW7C 1Q8KA 1QUQA 4LF6Q 1EOVA 4EQNA 2XVSA 1SMXA 2HQLA 1S5FD 3F8TA 3WOFA 3VR6A 5LMNL 1LTGD 4ME5A 3KLSA 5GAGC 2WP8J 4EQ5A 4DV6Q 5IYDG 4R8IA 4K5VA 1CUKA 4A3IG 3MFYA 1M1KC 2NVXB 3U58A 4DV2Q 4PMWA 1B1ZA 3P1HA 5FJ8H 4IO9A 2M9VA 4JOIA 3UE1A 4JI6Q 1IBLL 4QUFA 2WFWA 5IWAL 1J5EQ 3CW2C 2I5HA 3J7AF 3TBIB 1BBUA 4A3FG 1PFSA 4CDFC 5JJIA 5CMDA 1JOOA 4WJ3M 1J6QA 5EKLA 3LX0A 3TZUA 2EPBA 1H9MA 5LMNW 2PCFB 3DWQA 2O5IC 3K7UC 5EPLA 2UU9L 1TWAH 2AUKA 3KF8B 1EOTA 3EROA 5CR3A 2M2LA 2CVRA 1MSHA 4JYAQ 3NPPA 2B63G 1B3QA 5JVH3 1SE3A 3PIO3 1PH8A 4GLAC 1IBML 2UXCQ 2K7VA 3BU2A 5EPKA 4LF5Q 4QJFA 2G9HD 3BG3A 3GV6A 2OTJA 2NBFA 3I4LA 1HR0L 5DM63 2B8GA 4NKLA 4KKUA 3HOXB 5J22A 2IT1A 4CKBA 2YU9B 2MO1A 1MSGA 1BNZA 3IRBA 3HRZC 2EOTA 3UE0A 5D14A 1W3SA 2SDFA 1P8LA 1VQ7A 1PZKD 3MHBA 2BE5C 1L1OA 1DZ1A 2BH8A 4IN3A 3K5OA 3KUPA 4IFDH 1QB5D 1C9OA 2EYFA 4IPHA 1F2ZA 3PUYA 2K5VA 1TWCB 5I9OA 1AE3A 1F2MA 1BCPC 5C6AA 1J8IA 3NXWA 2JA8G 1XX8A 1WVLA 5M3FG 4DV3Q 1NE3A 3S17H 1ONLA 4B3TL 1H95A 2F0DA 2L5TA 1YNJD 1LTTD 4K6DA 1SE8A 1JWSD 2KECA 4RGTA 1SNDA 1A3TA 3PO2B 4IJHA 3T1HQ 4K6LA 1TY0A 1VQBA 1ET9A 2NZHA 1BUVT 3E0EA 2PQEA 5CBEE 2EDGA 1SNQA 1YEZA 3ULLA 3TS2A 1TXYA 3I56A 4DR2L 5K36G 3GTMB 5C3EB 3I8ZA 1LTBD 3NBHB 4DPGA 3D6CA 4A3MH 2JA6H 5BN3A 2R92B 2KCTA 3T13A 3GTJB 1FNUA 5JEAH 3HOWB 1K0RA 4AYBB 3DWPA 1XXGA 3VR4A 3PUVA 4BXXH 1RTOA 2JXMB 1DONA 1I4PA 4P71A 1KLGD 3HKZB 2OT2A 4KY7A 3HOZB 2VXWA 1GUGA 4YY3Q 4KK7A 1SR3A 1KTKA 4CJ1B 1I6VC 4UHVA 1HNWL 4A93H 3NHHA 2H4OA 4DV7Q 3GV3A 1YITA 4LF7L 3PF4A 4DA2A 1RTNA 4L5RC 4BA1I 2B2TA 2LXKA 3W1GA 4DR5L 3QWNA 5HY6A 1LT6D 4FXDA 1Q12A 2R6GA 3TEHB 1E2VA 3MVVA 5JVG3 4HMIA 1SRUA 1X3EA 4IALA 2F4VQ 3KJPA 4GS3A 3BJUA 2O5JC 4A3CG 2L4NA 1X56A 2QA4A 1LABA 5C4ZA 3KFUA 4IFDJ 3GDEA 2EY5A 2OEOA 2JA5B 1VQGA 1DXMA 4HIMA 4OX9Q 4AH6A 3N6RA 2KEEA 4DAPA 2RHQB 4C2MH 1Y1WB 3A8JE 3OIQA 1XNQL 3MXNA 4DU9A 1JT8A 1Y14B 3ULJA 4HCEA 4JBKA 2VS1A 1CT1D 2NN6I 3IKJA 4FF3A 2B2VC 3HFZB 1O80A 3FP9A 1K8OA 1XNRQ 4TRDA 1NR4A 1RODA 4KY6A 4IFDI 4P73A 5A2QE 1QNKA 4NXNL 2QILA 4JI8L 4PV1C 4RMFA 4EGVA 1IW7D 3ERSX 4QQBX 4TVAB 4B3SQ 3GTQH 1QZGA 4UP8A 2EYHA 1JJCB 2CH4A 2UXBQ 4BY1B 2BA0A 4JV5Q 4OEMB 1S4ZA 3S1MH 1TIID 1PXUA 4BA2I 2N49A 4XYOA 2NVQH 1Q1EA 3K0XA 4HJ7A 2FXQA 2A8VA 4DK0A 5EKIA 1GXDC 2PZUA 1L2FA 2JE6I 3SE0A 4R4QA 3RUZA 5IYDH 4XTCS 4A3IH 1DOMA 2CW0D 1AP0A 4DK6C 3S1NB 5IGGA 3A54A 1FD7D 5JOBA 2K50A 4R4TA 5E7NA 2JA7B 2KHSA 4XYQA 2Z6BA 1CHQD 4PMBA 2KEDA 5C3WA 4R1JA 2E2DC 1WTOA 3CCMA 4A3FH 3UI2A 3CQZB 4LK1C 4HCSA 1EQTA 4DNRB 4A3KB 2XWBB 3EA6A 3R2IA 4K8JA 3TSSA 1LTRD 2B2VA 1S72A 4R4IA 3FEWX 1YZ6A 1EIFA 4Y7NB 1VQPA 1XJVA 1HH2P 2LY7A 3Q23A 4G7HC 2CWAA 1R9TB 3S2HB 1PTOB 3I4OA 1GHKA 2ZM6L 1G91A 1HXYD 2B63H 1XMQL 4PG3A 4DV4Q 3D3RA 2XRQD 1GUOA 1DGSA 4ODGA 5JPNC 1WTVA 3EIVA 4YWKA 2NYZD 1H9JA 3BYYB 2MPMA 2YV5A 4JG2A 4FDBA 4KD3A 4OWXB 2LXJA 1PH6A 3M4OH 2XSCA 4LFAL 3GTPB 3PGZA 1HQMC 1GJXA 2ZJRA 3CKIB 4BS9A 3M4QA 1V9PA 5D3DA 4A76A 4JI4L 2AQ3B 3UDIA 4A3DB 2KBNA 1EY7A 4LMQD 4K0KQ 2DY7A 2BE5D 1EY9A 4LJZC 4X64Q 1U4MA 2VB2X 2UUBQ 2EY6A 1HA6A 2JK8A 4JI5L 1TWGH 1BCPD 3MZ5A 3J80L 3MC0B 4FP5D 1XTDA 1BCPF 2JA8H 1A62A 5M3FH 3A5UA 4NMZA 2E8GA 2PNHA 4O42A 3F2BA 5LMUQ 2WB1B 2NUCA 3G71A 3BS1A 1EQVA 1WTWA 1SN8A 4N8X1 2PZTA 4POFA 5GQOA 4K2LA 5G3LD 1TR5A 1W6KA 2Z6KC 3CHBD 2MQHA 2LS01 2J7ZA 2JJQA 5G3LF 3CP0A 2K01A 3CCEA 2MHVA 4XIGS 4MZ9A 4LF4Q 3G6JB 5K36H 2WKCA 3D0FA 2VQFQ 3UDXA 4C3HB 3TN2A 1N32L 5CV8A 3FPPA 1Y1VG 1PA6A 4KHPL 5EAYA 1PHJA 1PH7A 1QG7A 1ASZA 3K5MA 1E3PA 1RL2A 5NUCA 3OW2A 1F2YA 3H3VI 5DAUA 5FLXL 2E5LL 5M3MG 4OL7A 4A3JH 2BDNA 3D4WA 4HTHA 1E22A 5LL6S 4TSSA 2F0VA 1TWAB 2OQ0A 1EU4A 2YYZA 5EKKA 3VDYA 3GTLH 1LV9A 5ELOA 4NXML 3J80i 4DFAA 4GZYC 1ML0D 4DUZQ 2PI2E 1WTRA 2FHTA 3OWEB 3G4SA 1T5EA 2FMMA 3NE5B 1AEXA 4WJWA 1B53A 2VL6A 2XGTA 2KOLA 2J4XA 4RH6A 3RZOB 4DNTB 1XPUA 4A3GG 3HOVG 2JEAI 1GUWA 3KF6B 5CV9A 1LT3D 1WTQA 2DY8A 1BKBA 5M5WH 4A3CH 2Z8LA 2NB0A 1ILPA 3MA2B 5C4JH 1QE6A 4B9WA 3UDGA 3MXGA 3OWFA 3K7AH 3CD6A 2R3ZA 4H7BA 1YNJC 4OIKA 4DV1L 3RMHA 2RDHA 5M5XB 4HIOA 2KQ3A 4H44C 1A3UA 3EFXD 4NDXA 1I3QB 1LLRD 1PMRA 1MHWC 3DHQA 4X62Q 2B2UC 1D8LA 1WI5A 1O7IA 4BY7H 1N34Q 2UUCQ 4OXPA 5L37A 4AQYL 2N78A 3T16A 1Y69U 2D5DA 3M7GA 4EX5A 3K5NA 2CQAA 2LKVA 4ULLA 3PIPA 4DR6Q 5C4XG 1WTPA 1HZBA 2N3SA 1I6HH 3H6MA 4J8QA 2CHBD 4GNXB 2EYPA 1VS0A 1A6XA 4DV0L 2M00A 4PQXA 1GUSA 5C44G 5IYCG 2IX1A 2NWGA 1M8AA 1CSPA 1QVFA 3CF5A 1BVSA 4CHTB 1CM9A 1HNZQ 3RZDB 1PFMA 2PNRC 4A3MB 2JA6B 3S1RH 4RCNA 5D65A 2Y0SG 1XWEA 3K59A 1B3AA 1UE1A 4BBSG 5C4HA 2F0IA 1DD2A 2I0QA 1G2SA 2IJ0A 2K32A 3HOUG 1UE5A 1E0BA 4M1UB 1IBKL 3M4PA 4TQUS 4JBMA 2L9HA 5BR8Q 2E2IH 1II3A 2E2JH 1LUZA 2KCMA 2SNSA 3D31A 4QUCA 5I6WA 2EYLA 2UXDL 4X66L 1S5BD 2B2UA 1KDAA 2R61A 2Y0SE 4APVA 1E24A 4FXKC 2CFMA 5KNCA 3RLNA 1WYDA 4XXEA 1KAWA 3K6OA 1LT5D 3A55A 1SJHD 3NSWA 1JE4A 4MTNA 3MXUA 1G6PA 3S16B 1V1PB 2KUMA 5E4XA 4DR7Q 2FFKB 3HS0C 3PIOA 1KNAA 1GKHA 4DNIA 3G6EA 1XTCD 2XN9C 3R93A 1QZHA 1EQRA 1BXTA 4LF6L 1OXXK 2RDGA 5ELCA 2QGQA 4HJAA 4ZRZA 1K83B 5LHY1 5K5PA 1SLJA 1CKMA 2NVTH 1SAPA 1PH4A 4GN3B 1QVGA 5GROA 4C2MB 4DV6L 3NENA 3C1EA 2DJFC 4RHSA 1EZ8A 4ZUIA 5T1GA 3J7A5 2TMPA 3J81L 3WDNA 1GUNA 4DV2L 1EEFD 1B9MA 3SR1A 4C3JB 1MKHA 4JI6L 4DV5L 4GOPC 4LF8Q 4YCVA 5TSSA 3VR3A 1STYA 1IXRA 1J5EL 2QKIC 1SDFA 1LTAD 1HCZA 1WCMG 3W5OA 1BF4A 5CBAE 3CCUA 3GP7A 2PQAA 4JW0A 2F0WA 2CW0C 3S14B 2IPKD 5IT9E 2R7FA 1VQKA 1K28A 1YNXA 2RSOA 1S40A 4FVMA 1ESRA 1C48A 4GKJQ 3R3OA 3TZDA 1HFGA 1HTPA 3SK4A 3S1MB 1V1OA 2EY1A 4L63B 4JYAL 3K8AA 3B6YA 1KNEA 1YHBA 2UXCL 1L0XB 4J15A 2UUAQ 4KJNA 3W1BA 3U4VA 4LF5L 1CKNB 2LMCB 5C0XJ 1PDQA 4HMJA 1OTCA 5LMNQ 4A3IB 3TP8A 1EY5A 2AKWB 2F0HA 3L2PA 5IGFA 1D1IA 1QUQB 2NVYB 1WFQA 3TRZA 4UPAA 5ELNA 1PLFA 4A3EB 4G57A 1KLUD 2Z4HA 4R4CA 5GAEC 4OELB 2ZJQA 4Q0FA 3ITPA 3VA5A 1F9SA 5CC4A 1Y1VH 2A19A 4A3FB 2E2HH 3OW7A 3L7ZC 3HOXG 4FXGC 1I4RA 1UNSA 1HUMA 4OIJA 5IWAQ 5M3MH 1W6JA 4EVOA 4GOPA 1DM0B 1I4HA 4PNYA 5C0XI 3H91A 4OO1G 3H0GB 3T1YQ 2DUDA 1Z47A 1K8AC 3OHXC 1V1QA 1MGSA 1MIUA 1ICWA 3TDQA 3I73A 3T4AC 5E4WC 3RN5A 3GTOH 4XQQA 1JJ2A 3GTKH 4Z9CB 1A0IA 1X3QA 4A3BB 1KXLA 4KKTA 1IL8A 5KNBA 4A3GH 3E3XA 1WTHA 3HOVH 4G7OC 3MEHA 3C3LA 1B7YB 1CA5A 4RKBA 1ENCA 3I4MB 3I2ZA 3T1HL 3ZYYX 3S2DH 1LTLA 1YVCA 4GLVB 1PFBA 4YCWA 3VYSA 1A63A 3S1QH 1KRTA 2IX0A 3NTHA 2MP1A 1HR0W 2PZWA 3AB9A 2HCIA 4KI0A 1ESFA 1X3PA 1X32A 3QG1A 5I2YA 3K0YA 2KCCA 1N9WA 2YTXA 2XRSD 1N8RC 4IUTA 4A75A 3EN2A 2IL8A 5EPJA 4V0BA 1IKMA 3G7LA 5C3EG 4WFN3 3BZCA 3V2TA 3KLRA 4JBJA 4H13C 1I4QA 1EQQA 1N33Q 3CAMA 5AJ3Q 4MIUA 2RKSA 3I90A
chains in the Genus database with same CATH topology
4HEDA 4IZ8A 3TP5A 4L8JA 2D62A 1QWYA 5KRUA 3I4NB 4DAYA 4ZK9B 3JAME 4ZAIA 1O7ZA 2Z1CA 3TP6A 1JORA 5I2XA 5E3FA 3T56B 1CZWA 3HOYB 3PUXA 2L1BA 2R93B 1TS3A 1O7YA 4L6TB 3D4DA 3SEBA 3LWEA 5FO9B 1DOLA 1ZXTA 5EGTA 1PRTB 1EYCA 2B39A 5CYUA 5FOBB 4XT1B 5BN4A 1EIHA 3A7AB 4IUNA 4RHRA 2EE1A 1D2BA 2X6GA 1DYQA 2F0KA 3WOEA 1OO9B 1F9RA 2PW5A 1O78A 3X3NA 4CBVA 1B44D 5KIXA 2EJGC 1CTMA 2A68C 1EY8A 4J6HA 1ET6A 2RSNA 1UEAB 4QB4A 2L11A 2SOBA 2XNAC 3VR2A 1AZPA 5AFWA 3DEOA 1EY6A 1SNPA 1HA5A 2AWOA 5JEAJ 1U9RA 3AMUA 3K57A 1U4PA 3M4YA 4QIWB 1A15A 3O13A 1FYCA 3HEJA 1BBXC 3DUZA 1JC7A 5E1FA 3FKIB 3A8KE 4KY5A 2JEBI 4EQOA 1XYIA 5JJZA 1EFID 2K5DA 2PO4A 3QJYA 3Q0AA 3IFDA 1WTXA 3V05A 2J0TD 1PFNA 4HR7B 1Q3LA 5ELBA 5M9OA 1RD9D 3S1RB 4QMGA 1A2UA 4WORA 4O1NA 4XT3B 5IGCA 1H9SA 1GOZA 2EJMA 5C5LA 3OIPA 1ZKOA 5CGKA 2X69A 1HTLD 2X6LA 2R7ZB 3P20A 2F0SA 2E2JB 1JR0D 3Q22A 1EZ6A 2E75C 3IAYA 5T1IA 2ICIA 1G291 1J9OA 5A35A 1G2TA 4WRDA 4OO1H 1HQRD 1EYDA 4E6IA 3D4RA 1STHA 1LACA 1Z6HA 3IL8A 2WKDA 2IW3A 2VNUD 2BDOA 1TQOA 3KBXA 3BVMA 1SNCA 1G8ZD 1ILQA 1TWFB 2I07B 1VF7A 3EJIA 2NVTB 4N9TA 3S15B 1E2ZA 1O7LA 1K8MA 1VF5C 4LAAA 1B4OA 5C5MA 4K2KA 2G9DA 3FDTA 1SNMA 2WIIB 4C3IG 5IGEA 3ONAB 1IYVA 3SXHA 1ENFA 1TS2A 4C3HG 5KGUA 2WV6D 3C2PA 3EVQA 1AZQA 5EJWA 3QO2A 1Y8OB 4TKOB 1R4PB 5A2QL 4FNFA 3CRKC 1CHPD 3OMCA 2MJ8A 2F3WA 4QCLA 2D9UA 5COYA 3H09A 1MI2A 1PZJD 4J1MA 2Q8IB 2RA4A 2B2YC 4I7ZC 4ZYSA 1SYEA 1AW7A 3BYTB 2F0TA 1STAA 3PUWA 1SYCA 4DAVA 3ERQA 2K1BA 2E2HB 2F0NA 2AWNA 1EEID 1Q8IA 3GO5A 4M8AA 3J7YW 1UUPA 4ILWA 3TP7A 2OXPA 4JBWA 3OMGA 5J1ZA 2NN6G 3DMUA 1PTOD 3KK7A 2F0EA 1JWMD 3PUZA 3TMEA 3BDLA 1PTOF 3PMFA 1D1KA 1ZEQX 4N9PA 2WAQB 4KKSA 4RA8A 4OO1I 4Q5VA 1NUCA 4MHEA 2DN8A 1SYDA 3A56A 2PPBC 3S2DB 5KNDA 2Q8RE 2A68D 2JP1A 1MBYA 3S17B 1F9QA 3MTSA 1KDBA 2F0OA 1S5DD 1SE4A 2B2YA 1IKLA 4C1NK 3IFTA 1I4GA 3HGBA 3I91A 1DJRD 1B50A 1EYAA 3CU7A 3NK9A 4ZKBB 5KYLA 2ENBA 1BR9A 1FR3A 3NQIA 3QOJA 4DXGA 2A6EC 3VR5A 4BWGB 4U673 2BCOA 1NAPA 4OGQC 1SJED 2ICEC 2WACA 3L3OC 2ZXRA 5CV7A 1BDOA 1OXSC 2E76C 3H3VC 1ZYRD 2N55A 4A93B 3OPOA 2D2CC 1Q1BA 3NP8A 5CV5A 3Q24A 5DM73 1PTOH 1HUNA 3R8BA 3VA7A 1AN8A 2F0MA 1MD2D 1VMPA 2DNCA 2TSSA 4KD4A 3SK8A 1NR2A 4X3TA 2RDFA 3GD7A 1F2LA 3Q6SA 3W2DA 1A3VA 2F1MA 4CGYB 2L12A 4C3JG 1SYFA 2FINB 1HRJA 2HUGA 1FNWA 5I4DA 4X3UA 4KN7C 2KJXA 3DM1A 5JPMC 3SVMA 1IYUA 2IX3A 2QDBA 2KA7A 3KF8A 1HPCA 3KLSX 5EQ0A 5IGDA 3MAQA 3QB3A 4HSPA 1YNNC 3D6WA 3GTQB 3M7NA 2ZT9C 2B2WC 5LL6X 1CI3M 4KJOA 2EYMA 4HAEA 1OXVA 1ENAA 1D5MC 1RF2D 2NVQB 2GA4B 4F8MA 4H0LC 3HZXA 1KDCA 3QOLA 1WCMB 1B2TA 1JB3A 3K5LA 2C5CA 2DNEA 1D6EC 1LT4D 3M85A 1Y8PB 1LTID 1CFMA 3OOCA 4U68A 1JQYD 1LTSD 2L55A 4DK1A 4OHJA 2VB3X 3MXPA 4B08A 5CV6A 4EQPA 1PRTC 1C4QA 3NBIA 3MWYW 1STNA 1DOKA 1QJOA 1JWUD 1KAAA 2B63B 1GHJA 1TU2B 1RDPD 2B2WA 3W3AA 2F0PA 5KEEA 4B9XA 3F2UA 1EY0A 1TKWB 3KBGA 3M4OB 2ZXPA 3P75A 3HP3A 1EWHA 3NBHA 4R9WA 2SNMA 2NN6H 2L0CA 5FK9C 2N88A 2LFNA 1Z7TA 3OSOA 2A69C 3SK6A 4CKCA 1EU3A 3PV0A 2QF7A 1TVXA 3DWAA 2IWHA 3SDZA 2B2TC 3DXJC 1TWGB 1OXTA 1TT2A 2HDMA 2HDLA 2SEBD 5BN5A 2JA8B 5M3FB 4FYDA 3NTIA 4HSVA 1CQFA 4RCOA 4XQNA 3A8IE 4KV6A 5HURA 4KHVA 1OXUA 1WD0A 1RJTA 4ZQ3A 2F0QA 2F03A 4RGNA 5ELDA 4F87A 2NTSA 3RD4A 2A6ED 4RWSC 3FPUB 3D8GA 4ZKCB 4R8NA 1B9NA 1DCZA 1E2WA 3L9AX 1SMYD 1JCKB 4FF1A 2MUYA 5IT9L 1I4XA 3GTGB 5FO8B 4F7XA 2EXZA 4A3JB 2KVMA 1JICA 4IUPA 3GTLB 1PTOC 4QF4A 2Z4IA 5IODA 3LNNA 2BOSA 3V96A 5ISRA 3P7JA 4ABNA 1HHVA 1JOKA 1M4VA 2EYOA 3J80E 5JAVA 2F4IA 1LO5D 2PMZB 5M5WB 4FF4A 2RBMA 5C4JB 2MGSA 1SE2A 3AU7A 3K7AB 1BCPB 3U9OA 1U4RA 2A6HC 1L0YB 3NQTA 4UDUC 4CJ0B 3U9SA 1TS5A 4NW2A 1H9KA 5EBDA 4CJ2C 2NZ1D 4BY7B 3HG9A 1RHPA 4RGOS 2EY2A 2OF1A 5FKAC 5FLXE 5J39A 1YNND 3BVGA 1PZID 3T51B 1STEA 1I6HB 4IUQA 3SK5A 2PW7A 4K8IA 1QNUA 5EBCA 3GQBA 1TS4A 2HCCA 4ZUJA 1ZYRC 2O2LD 4JK1C 1PYWD 4XDXA 4IUVA 5C0XG 1SXTA 1SYGA 2FMCA 4RFBA 2E74C 5CORA 4UAIA 2E2IB 1VMCA 3QIAA 5IGBA 3NWSA 2JSOA 2XWJB 2EVBA 3JAML 1JOQA 2K05A 1PRTD 1PRTF 4FF2A 1TWHB 3LWUA 1RCVD 4KTAA 2I46A 4DF7A 3NUCA 4V190 2F0GA 5IIFA 3E5SA 1GUTA 2QEJC 2QCPX 4K14A 5HGTA 5KYIA 3RLFA 1H9SB 3EQLC 2V4DA 5FO7B 2BA1A 1EY4A 2A69D 2EYJA 2KCNA 1FGBD 3NWTA 1SEBD 4C1NI 3PO3B 2H1EA 3NTKA 3BDOA 3C46A 4RKLA 4K5WA 3URYA 4G7ZC 4KMUC 1QOHA 5M5YB 4ZLTF 5DNFA 1S5ED 1SBBB 4IQZA 2HQEA 3BVZA 4X3KA 2K5WA 4C3IB 1H9RA 2XIWA 3H94A 1AFPA 1QILA 3FVQA 1D5XC 2F0FA 1F77A 5C3XA 5D3IB 2K5QA 2Q8TA 3VYUA 2AUJD 1D5ZC 1EL0A 3MFGA 1BO0A 3N52A 5CV4A 4DXFA 2O4XA 3ND9A 1EWCA 1R4QB 4IURA 1U4LA 5I6YA 2NTTA 2JYOA 1Y1VB 4C56C 1CA6A 1VDZA 3S9WA 4X3SA 1CZGA 1FNVA 5M3MB 2K28A 4S3SA 2EJFC 3CRLC 3M3YB 3J81E 1C8CA 3BZDB 4IFDG 1V8QA 3GTOB 3GTKB 2K33A 4A3GB 3HOVB 4RAUC 3I3CA 1NCVA 1SSOA 2A5HA 2A73B 3BDCA 4F88A 1RKNA 3S1QB 4NP5A 3I70A 2K03A 2ID0A 2F0JA 1VCIA 5ELEA 1BQQT 2A6HD 3X3MA 1IHZA 5IOCA 1EIGA 2K04A 4BBRB 1CQVA 2B8FA 4ID6A 2F3VA 4RGMA 3DEPA 1I50B 5JEAG 4MN3A 1UAPA 5ELFA 1WD1A 2FJ2A 3T53B 1SYBA 1F9PA 1SMYC 1V1PA 1TY2A 5C4XB 3C1FA 2RQXA 2C9OA 4YIJA 1V43A 2F0UA 1A2TA 4HN7A 5C44B 4XQJA 1NSNS 1HFNA 4KHZA 4FO2A 1G6ZA 1STBA 1SFOB 2RVLA 2K6AA 3FMCA 2Y0SB 4KN4C 5C0XH 4BBSB 3I72A 3FRPB 1S5CD 3HOUB 1Y8NB 2F0LA 3R2TA 2PYKA 1QCBD 5I9PA 1BOSA 4G4KA 2A74C 4DN4M 1SNOA 4IUUA 4P2CB 1T5XD 3J7AV 1Q90A 2VUMB 3E0JA 3VYRA 3A7LA 3E6ZX 2ZXOA 3SHLA 4DGZA 1KABA 2AQ2B 4CKEA 2WINB 1STGA 3ND8A 5DEHA 3K58A 4I65A 2AQ1B 5F2DA 3PIP3 4K5XA 3VYTA 2EZVA 1CK1A 4PMCA 1IW7C 4EQNA 2XVSA 3WOFA 1S5FD 3VR6A 1LTGD 4ME5A 3KLSA 2WP8J 4R8IA 4K5VA 3MFYA 2NVXB 4PMWA 1B1ZA 3P1HA 2M9VA 4QUFA 3J7AF 3TBIB 5CMDA 1JOOA 5EKLA 3LX0A 3TZUA 2EPBA 1H9MA 2PCFB 3DWQA 2O5IC 5EPLA 2AUKA 1EOTA 3EROA 5CR3A 2M2LA 2CVRA 1MSHA 3NPPA 5JVH3 1SE3A 3PIO3 2K7VA 5EPKA 2G9HD 3BG3A 3GV6A 2NBFA 3I4LA 5DM63 2B8GA 4NKLA 4KKUA 3HOXB 5J22A 2IT1A 4CKBA 2YU9B 1MSGA 1BNZA 3HRZC 2EOTA 5D14A 2SDFA 1PZKD 3MHBA 2BE5C 1DZ1A 4IN3A 3K5OA 3KUPA 4IFDH 1QB5D 2EYFA 1F2ZA 3PUYA 1TWCB 5I9OA 1F2MA 1BCPC 5C6AA 1J8IA 3NXWA 1XX8A 1WVLA 1ONLA 2F0DA 2L5TA 1YNJD 1LTTD 4K6DA 1JWSD 2KECA 4RGTA 1SNDA 1A3TA 3PO2B 4K6LA 1TY0A 1ET9A 1BUVT 2PQEA 5CBEE 2EDGA 1SNQA 5K36G 3GTMB 5C3EB 3I8ZA 1LTBD 3D6CA 5BN3A 2R92B 3T13A 3GTJB 1FNUA 5JEAH 3HOWB 4AYBB 3DWPA 1XXGA 3VR4A 3PUVA 1RTOA 2JXMB 1DONA 1I4PA 1KLGD 3HKZB 2OT2A 4KY7A 3HOZB 2VXWA 1GUGA 4KK7A 1KTKA 4CJ1B 1I6VC 3NHHA 2H4OA 3GV3A 4DA2A 1RTNA 4BA1I 2B2TA 3QWNA 1LT6D 4FXDA 1Q12A 2R6GA 1E2VA 3MVVA 5JVG3 4HMIA 4IALA 2O5JC 2L4NA 1LABA 5C4ZA 4IFDJ 2EY5A 2OEOA 2JA5B 1DXMA 3N6RA 2KEEA 4DAPA 1Y1WB 3A8JE 3OIQA 3MXNA 4DU9A 4HCEA 1CT1D 2NN6I 3IKJA 4FF3A 2B2VC 1O80A 1K8OA 4TRDA 1NR4A 1RODA 4KY6A 4IFDI 5A2QE 1QNKA 2QILA 4PV1C 4EGVA 1IW7D 2EYHA 4BY1B 2BA0A 1S4ZA 1TIID 1PXUA 4BA2I 4XYOA 1Q1EA 4DK0A 5EKIA 1GXDC 2PZUA 2JE6I 3SE0A 3RUZA 4XTCS 1DOMA 2CW0D 1AP0A 3S1NB 5IGGA 3A54A 1FD7D 5JOBA 2JA7B 2KHSA 4XYQA 1CHQD 4PMBA 2KEDA 5C3WA 2E2DC 1WTOA 3UI2A 3CQZB 4LK1C 4HCSA 1EQTA 4DNRB 4A3KB 2XWBB 3EA6A 3R2IA 4K8JA 3TSSA 1LTRD 2B2VA 3FEWX 4Y7NB 2LY7A 3Q23A 4G7HC 1R9TB 3S2HB 1PTOB 1GHKA 1G91A 1HXYD 3D3RA 2XRQD 1GUOA 4ODGA 5JPNC 1WTVA 2NYZD 1H9JA 3BYYB 2MPMA 4KD3A 2XSCA 3GTPB 1HQMC 1GJXA 3CKIB 4BS9A 5D3DA 2AQ3B 4A3DB 1EY7A 4LMQD 2DY7A 2BE5D 1EY9A 4LJZC 1U4MA 2VB2X 2EY6A 1HA6A 1BCPD 3MZ5A 3J80L 3MC0B 4FP5D 1BCPF 4NMZA 4O42A 2WB1B 2NUCA 3BS1A 1EQVA 1WTWA 2PZTA 4K2LA 5G3LD 1TR5A 1W6KA 3CHBD 2LS01 2J7ZA 5G3LF 2K01A 2MHVA 4XIGS 3G6JB 5K36H 2WKCA 4C3HB 3TN2A 5CV8A 3FPPA 1QG7A 3K5MA 5NUCA 1F2YA 5DAUA 5FLXL 4OL7A 2BDNA 3D4WA 4HTHA 5LL6S 4TSSA 2F0VA 1TWAB 2YYZA 1EU4A 5EKKA 1LV9A 4DFAA 4GZYC 1ML0D 1WTRA 2FHTA 3OWEB 1T5EA 2FMMA 3NE5B 1AEXA 4WJWA 1B53A 2KOLA 2J4XA 4RH6A 3RZOB 4DNTB 2JEAI 1GUWA 5CV9A 1LT3D 1WTQA 2DY8A 2Z8LA 2NB0A 1ILPA 3MA2B 1QE6A 4B9WA 3MXGA 3OWFA 2R3ZA 4H7BA 1YNJC 4OIKA 3RMHA 2RDHA 5M5XB 2KQ3A 4H44C 1A3UA 3EFXD 4NDXA 1I3QB 1LLRD 1PMRA 3DHQA 2B2UC 3T16A 1Y69U 2D5DA 3M7GA 3K5NA 2CQAA 2LKVA 4ULLA 1WTPA 3H6MA 4J8QA 2CHBD 2EYPA 1A6XA 2M00A 4PQXA 1GUSA 2IX1A 2NWGA 1M8AA 4CHTB 1CM9A 3RZDB 1PFMA 2PNRC 4A3MB 2JA6B 4RCNA 5D65A 1XWEA 3K59A 1B3AA 5C4HA 2F0IA 1DD2A 1G2SA 2IJ0A 2K32A 1E0BA 4M1UB 4TQUS 2L9HA 1II3A 2SNSA 3D31A 4QUCA 5I6WA 2EYLA 1S5BD 2B2UA 1KDAA 2R61A 4FXKC 5KNCA 4XXEA 3K6OA 1LT5D 3A55A 1SJHD 3NSWA 1JE4A 3MXUA 3S16B 1V1PB 2KUMA 5E4XA 2FFKB 3HS0C 1KNAA 1XTCD 2XN9C 3R93A 1BXTA 1OXXK 2RDGA 5ELCA 4ZRZA 1K83B 5LHY1 5K5PA 1SAPA 4C2MB 3C1EA 4RHSA 1EZ8A 4ZUIA 5T1GA 2TMPA 3J81L 3WDNA 1GUNA 1EEFD 1B9MA 3SR1A 4C3JB 5TSSA 3VR3A 1STYA 2QKIC 1SDFA 1LTAD 1HCZA 1BF4A 5CBAE 3GP7A 2F0WA 2CW0C 3S14B 2IPKD 5IT9E 2RSOA 4FVMA 1ESRA 1C48A 3R3OA 3TZDA 1HFGA 1HTPA 3SK4A 3S1MB 1V1OA 2EY1A 4L63B 1KNEA 1L0XB 4KJNA 2LMCB 5C0XJ 1PDQA 4HMJA 4A3IB 3TP8A 1EY5A 2F0HA 5IGFA 1D1IA 2NVYB 1PLFA 4A3EB 4G57A 1KLUD 2Z4HA 4Q0FA 3ITPA 3VA5A 1F9SA 5CC4A 4A3FB 3OW7A 3L7ZC 4FXGC 1I4RA 1UNSA 1HUMA 4OIJA 1W6JA 4EVOA 1DM0B 1I4HA 4PNYA 5C0XI 3H91A 4OO1G 3H0GB 1Z47A 3OHXC 1MGSA 1ICWA 3TDQA 3I73A 3T4AC 5E4WC 4XQQA 4Z9CB 4A3BB 1X3QA 4KKTA 1IL8A 5KNBA 4G7OC 3MEHA 3C3LA 1CA5A 4RKBA 1ENCA 3I4MB 3ZYYX 3VYSA 1PFBA 2IX0A 3NTHA 2MP1A 2PZWA 3AB9A 2HCIA 4KI0A 1ESFA 1X3PA 1X32A 3QG1A 5I2YA 3K0YA 2KCCA 2XRSD 4IUTA 2IL8A 5EPJA 4V0BA 1IKMA 3G7LA 4WFN3 3V2TA 3KLRA 4H13C 1I4QA 4MIUA 2RKSA 3I90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4O A;  2KED A;  4HED A;  4X3U A;  3TZD A;  1HFG A;  3TN2 A;  3FDT A;  1WTO A;  2N88 A;  2Q8R E;  1C8C A;  1U4P A;  5EPK A;  2JP1 A;  1CM9 A;  3GV3 A;  3UI2 A;  2MGS A;  1A15 A;  1PFM A;  3DM1 A;  4HCS A;  1EQT A;  1RTN A;  1F9Q A;  1KNE A;  2B2T A;  3GV6 A;  3MTS A;  3ONA B;  3SVM A;  1BBX C;  4DN4 M;  1QG7 A;  5D65 A;  2B2Y A;  1IKL A;  1TVX A;  2B2V A;  4IUU A;  1U4R A;  1B3A A;  4ZK9 B;  1PDQ A;  1O7Z A;  4ZAI A;  5EQ0 A;  1XYI A;  3I91 A;  1G2S A;  2BDN A;  5JJZ A;  1E0B A;  2B2T C;  1B50 A;  3D6W A;  4CJ0 B;  2L4N A;  4RAU C;  2L9H A;  3I3C A;  1AZQ A;  1NCV A;  1MSG A;  2B2W C;  1SSO A;  2HDM A;  2HDL A;  5EJW A;  4ZKB B;  3IFD A;  3QO2 A;  1WTX A;  1G91 A;  1LV9 A;  2L1B A;  4NW2 A;  2EOT A;  1O7Y A;  1PLF A;  4HAE A;  5D14 A;  4QUC A;  1PFN A;  2SDF A;  1ML0 D;  1WTR A;  4HSV A;  2NZ1 D;  3LWE A;  4CJ2 C;  1WTV A;  1Q3L A;  2B2U A;  2FHT A;  1DOL A;  2K03 A;  1F9S A;  1RHP A;  1DZ1 A;  3KUP A;  1ZXT A;  2FMM A;  2KEE A;  2NYZ D;  1B53 A;  2KOL A;  2MPM A;  1NAP A;  2NWG A;  1HUM A;  2H1E A;  1EIG A;  1RJT A;  2K04 A;  4OIJ A;  1WD0 A;  1GUW A;  1JE4 A;  4XT3 B;  1B2T A;  2MJ8 A;  1WTQ A;  2DY8 A;  3H91 A;  1J8I A;  2D9U A;  2KUM A;  4ZLT F;  1XX8 A;  5COY A;  1WVL A;  1MI2 A;  5E4X A;  1ILP A;  2RA4 A;  5DNF A;  1QE6 A;  2FFK B;  2X69 A;  1KNA A;  2B2Y C;  2B2V C;  2X6L A;  1MGS A;  4IUQ A;  1O80 A;  1ICW A;  4XT1 B;  3R93 A;  4LMQ D;  1BNZ A;  4RWS C;  1EIH A;  3FPU B;  4ZKC B;  2R3Z A;  2DY7 A;  2HCC A;  1NR4 A;  1ROD A;  3DEP A;  4U68 A;  5E4W C;  2N55 A;  2EE1 A;  1HRJ A;  4OIK A;  2KEC A;  5T1I A;  1U4M A;  4X3K A;  4MN3 A;  4R8I A;  1QNK A;  2XIW A;  1X3Q A;  1WD1 A;  1HA6 A;  2FJ2 A;  1SAP A;  2K1B A;  2X6G A;  1IL8 A;  1F9P A;  4XDX A;  1CA5 A;  1J9O A;  4IUV A;  1HUN A;  5CBE E;  1G2T A;  2Q8T A;  2B2U C;  1F9R A;  1PFB A;  1S4Z A;  5T1G A;  4O42 A;  4QUF A;  3I8Z A;  3MWY W;  3IL8 A;  2MP1 A;  5COR A;  1DOK A;  2KVM A;  1EL0 A;  1VMP A;  1BO0 A;  3N52 A;  4UAI A;  2HCI A;  5EKI A;  1VMC A;  1JIC A;  1X3P A;  4IUP A;  5CMD A;  1X32 A;  1WTW A;  1NR2 A;  2RSN A;  1HFN A;  3KBX A;  2B2W A;  4IUR A;  2L11 A;  1SDF A;  1U4L A;  2EPB A;  4X3T A;  1BF4 A;  1G6Z A;  4IUT A;  5CBA E;  1ILQ A;  1DOM A;  1AP0 A;  1RTO A;  2JYO A;  1AZP A;  1DON A;  3P7J A;  1F2L A;  2IL8 A;  2J7Z A;  4RA8 A;  5EPJ A;  5EPL A;  1WTP A;  1HHV A;  2K01 A;  3F2U A;  3G7L A;  2K05 A;  2RVL A;  3Q6S A;  5AFW A;  1CA6 A;  1IKM A;  3DEO A;  2VXW A;  4X3S A;  1EOT A;  4MHE A;  3HP3 A;  2M2L A;  2CVR A;  1MSH A;  2L12 A;  2RSO A;  2FIN B;  3I90 A;  4CJ1 B;  2K28 A;  1ESR A;  1M8A A;  2HUG A;  4R9W A; 
#chains in the Genus database with same CATH topology
 2V1C C;  1FJG Q;  4HED A;  1I50 H;  4IZ8 A;  2VY3 A;  3TP5 A;  1HNX Q;  1EYG A;  4L8J A;  1KL9 A;  2KHI A;  1X3G A;  1NNX A;  3AQQ A;  3HOZ G;  2D62 A;  1QWY A;  5KRU A;  3CC7 A;  2VQE Q;  1L1O B;  3I4N B;  4DV7 L;  5C4X H;  4DAY A;  4ZK9 B;  3JAM E;  4ZAI A;  1O7Z A;  2Z1C A;  4B3T Q;  3TP6 A;  1JOR A;  5I2X A;  4A3J G;  3UDF A;  1VQN A;  5E3F A;  3T56 B;  1CZW A;  3AYH B;  2K5N A;  3HOY B;  1KRS A;  3PUX A;  5IYC H;  5C44 H;  1YI2 A;  2F4V L;  2DGY A;  2L1B A;  2R93 B;  1TS3 A;  1O7Y A;  2F3I A;  4L6T B;  3D4D A;  3SEB A;  3LWE A;  5FO9 B;  5IT9 c;  1DOL A;  2JN4 A;  2I5L X;  3JC6 6;  1ZXT A;  1SFO H;  4DR2 Q;  5EGT A;  1PRT B;  4CDC C;  1EYC A;  4OX9 L;  4BBS H;  1S3O A;  2B39 A;  5CYU A;  1KQS A;  3HOU H;  5FOB B;  4JVZ A;  4XT1 B;  3KLW A;  4CDE C;  5BN4 A;  1EIH A;  3A7A B;  4IUN A;  4RHR A;  1GVP A;  2EE1 A;  1D2B A;  2VUM H;  1XNR L;  2X6G A;  4Y52 H;  1VQ6 A;  1JE5 A;  2PMZ E;  2RHS B;  3RN2 A;  3BZK A;  4LNQ A;  2HD3 A;  1HNW Q;  1GM5 A;  1DYQ A;  2F0K A;  3WOE A;  2VZA A;  1OO9 B;  1F9R A;  2MO0 A;  2PW5 A;  1X3F A;  4BY7 G;  1O78 A;  1VQE A;  3X3N A;  1B44 D;  4CBV A;  5KIX A;  5JJL A;  4JV5 L;  3KDF A;  1VQH A;  2EJG C;  1CTM A;  2A68 C;  2N8N A;  1EY8 A;  4J6H A;  1ET6 A;  2RSN A;  4JC0 A;  1UEA B;  4QB4 A;  2L11 A;  2SOB A;  5IP9 G;  4BY1 G;  2XNA C;  3VR2 A;  1AZP A;  4KLK A;  5AFW A;  3DEO A;  1VQI A;  4GKK Q;  1EY6 A;  1SNP A;  2Q2I A;  1VQ4 A;  2CCZ A;  1HA5 A;  2AWO A;  3L0O A;  5JEA J;  1U9R A;  4H02 A;  1EIY B;  3AMU A;  3K57 A;  3H15 A;  2KHJ A;  1U4P A;  3M4Y A;  5GAH C;  4QIW B;  1A15 A;  3O13 A;  1FYC A;  4JI3 Q;  3HEJ A;  1BBX C;  1WCM H;  3DUZ A;  1JC7 A;  4X65 Q;  2JA7 G;  5E1F A;  3FKI B;  3A8K E;  1ICF B;  4KY5 A;  2JEB I;  4EQO A;  2R7D A;  2MFI A;  1XYI A;  4YHH L;  5JJZ A;  1EFI D;  1GD7 A;  4L5Q A;  2K4K A;  3ULP A;  2K5D A;  2PO4 A;  3QJY A;  2OWO A;  3MXN B;  3CCS A;  3Q0A A;  3IFD A;  1WTX A;  4A3K G;  3V05 A;  2J0T D;  1PFN A;  4HR7 B;  4N8F A;  1Q3L A;  5ELB A;  5M9O A;  2JA9 A;  4DV4 L;  3CCQ A;  2OQK A;  1RD9 D;  3S1R B;  4QMG A;  4LW1 A;  1A2U A;  4WOR A;  4O1N A;  4XT3 B;  5IGC A;  1H9S A;  4JI0 L;  1GOZ A;  2EJM A;  5C5L A;  3OIP A;  1ZKO A;  5CGK A;  4PZ7 A;  2CWP A;  2X69 A;  1HTL D;  2X6L A;  4NB3 A;  3JAM c;  1XMO Q;  2R7Z B;  3J81 j;  3P20 A;  2F0S A;  2E2J B;  4DK3 C;  3ICE A;  3RR5 A;  4JPB W;  1JR0 D;  3Q22 A;  1EZ6 A;  2E75 C;  3IAY A;  5T1I A;  2ICI A;  3HOX H;  4K0K L;  1G29 1;  4X64 L;  1J9O A;  5A35 A;  4A3D G;  1G2T A;  4LFB Q;  4WRD A;  4OO1 H;  1HQR D;  2UUB L;  1EYD A;  2GN5 A;  2KEN A;  4E6I A;  1X6O A;  3D4R A;  3U50 C;  1STH A;  4MNO A;  1HJP A;  1LAC A;  1Z6H A;  3IL8 A;  1KC8 C;  1VQ5 A;  2WKD A;  3RNU A;  1D7Q A;  2IW3 A;  2VNU D;  3PO3 G;  2BDO A;  1TQO A;  4P72 A;  3KBX A;  5LMU L;  1TWC H;  1SNC A;  3BVM A;  1G8Z D;  4NPS A;  1ILQ A;  1TWF B;  2I07 B;  5J3B A;  1VF7 A;  3EJI A;  4HJ9 A;  1XMQ Q;  2NVT B;  4N9T A;  1NBW A;  3S15 B;  1O7L A;  1E2Z A;  2WB1 G;  1K8M A;  1VF5 C;  4LAA A;  2GVB A;  1B4O A;  5C5M A;  2ALY B;  5IY0 A;  4K2K A;  2G9D A;  3FDT A;  1SNM A;  2WII B;  4C3I G;  4LF4 L;  1T9H A;  1EFW A;  5IGE A;  4DUY Q;  3CPW A;  3KOJ A;  3ONA B;  1IYV A;  2Q2T A;  2PI2 A;  4AIM A;  4A3L G;  3SXH A;  3GTM H;  5C3E H;  1ENF A;  1TS2 A;  4C3H G;  5KGU A;  2WV6 D;  3C2P A;  3EVQ A;  1AZQ A;  3G48 A;  1PH2 A;  2R92 H;  1YJN A;  5EJW A;  3DLL A;  3QO2 A;  4JI2 Q;  1Y8O B;  4TKO B;  1R4P B;  1G51 A;  3TS0 A;  3EBE A;  5A2Q L;  3HOZ H;  4FNF A;  3S24 A;  3CRK C;  4DUZ L;  4QY7 A;  3GTG H;  1CHP D;  3OMC A;  2MJ8 A;  2F3W A;  3NEL A;  4QCL A;  2D9U A;  5COY A;  3H09 A;  1MI2 A;  1PZJ D;  4J1M A;  2Q8I B;  2RA4 A;  4DR3 Q;  4IOC A;  2B2Y C;  2ZTD A;  4I7Z C;  2IHF A;  4ME3 A;  4P75 A;  2QDL A;  4ZYS A;  1SYE A;  1AW7 A;  3BYT B;  2F0T A;  1STA A;  3CCL A;  4DAM A;  2DJG C;  2G5D A;  1FVI A;  3PUW A;  5HGQ A;  1SYC A;  4DAV A;  3ERQ A;  2K1B A;  1YHA A;  3CCV A;  2E2H B;  2F0N A;  2AWN A;  4DR1 Q;  1EEI D;  1Q8I A;  1I94 Q;  3GO5 A;  4M8A A;  3J7Y W;  1UUP A;  4ILW A;  3TP7 A;  3ZJY C;  2D0P A;  1E7Z A;  2OXP A;  3OMG A;  4JBW A;  3KJO A;  5J1Z A;  2NN6 G;  2Z6K A;  2HHH L;  3DMU A;  1PTO D;  3KK7 A;  2F0E A;  1JWM D;  3PUZ A;  4LUO A;  3TME A;  3BDL A;  1PTO F;  2UUC L;  3PMF A;  1D1K A;  1XPR A;  4BBR G;  1ZEQ X;  4N9P A;  2WAQ B;  4KKS A;  4RA8 A;  4OO1 I;  4Q5V A;  1NUC A;  2QW7 A;  4MHE A;  4DR6 L;  1JJG A;  2DN8 A;  1SYD A;  3A56 A;  2PPB C;  3S2D B;  5KND A;  2Q8R E;  2A68 D;  2JP1 A;  1MBY A;  3S17 B;  2B3G A;  1F9Q A;  3MTS A;  1KDB A;  3CMA A;  2F0O A;  1S5D D;  1SE4 A;  1BBW A;  1IKL A;  1E1O A;  2B2Y A;  5IP9 H;  4C1N K;  4BY1 H;  3J7Z C;  1HNZ L;  3IFT A;  1I4G A;  3HGB A;  3I91 A;  1DJR D;  1B50 A;  4YWM A;  4JI7 Q;  1EYA A;  3CU7 A;  3NK9 A;  4ZKB B;  4DV1 Q;  5KYL A;  3HKS A;  2ENB A;  3K81 C;  1BR9 A;  1FR3 A;  3NQI A;  1KHI A;  3QOJ A;  4DXG A;  2A6E C;  4LFC Q;  5BR8 L;  3S1N H;  3VR5 A;  4BWG B;  1PH3 A;  4MTK A;  4U67 3;  2BCO A;  1NAP A;  2NZO A;  4LUZ A;  2JA7 H;  1X55 A;  2VW9 A;  1I5F A;  2ZJP A;  4X6A H;  4OGQ C;  4QGU A;  1SJE D;  2MNA A;  2ICE C;  2WAC A;  4AQY Q;  3L3O C;  2ZXR A;  3CQZ H;  3CPF A;  2CKZ B;  1SRO A;  4A3K H;  5CV7 A;  1BDO A;  1OXS C;  2E76 C;  3H3V C;  5GAD C;  1ZYR D;  2N55 A;  4DR7 L;  4A93 B;  3OPO A;  4B3R Q;  2D2C C;  2VUM G;  1Q1B A;  3NP8 A;  5CV5 A;  3Q24 A;  5DM7 3;  1R9T H;  3S2H H;  1PTO H;  1HUN A;  1TWH H;  3R8B A;  2IY5 B;  3CXC A;  3VA7 A;  2ZTC A;  1AN8 A;  2F0M A;  4PZ8 A;  1MD2 D;  2Q2H A;  1VMP A;  1PH1 A;  2ATW A;  2DNC A;  1AE2 A;  2TSS A;  4KD4 A;  3SK8 A;  3GTP H;  1NR2 A;  1IYJ B;  3AFQ A;  3WWV A;  1IBK Q;  4X3T A;  3CC2 A;  1WOC A;  2RDF A;  3GD7 A;  3PSI A;  1F2L A;  1N36 Q;  3OYY A;  3Q6S A;  4A3D H;  2LSS A;  3W2D A;  4DKA C;  2UXD Q;  1A3V A;  2F1M A;  4CGY B;  2L12 A;  4C3J G;  1SYF A;  2FIN B;  4B3M Q;  1HRJ A;  2HUG A;  1FNW A;  5I4D A;  4X3U A;  4ALP A;  4KN7 C;  1Q81 C;  1B8A A;  4JI1 Q;  3I55 A;  2KJX A;  3DM1 A;  2OCE A;  3PO3 H;  4GKJ L;  5JPM C;  3SVM A;  1IYU A;  2IX3 A;  2EXD A;  1GO3 E;  2QDB A;  2KA7 A;  3LGJ A;  3KF8 A;  1HPC A;  3KLS X;  5M5Y H;  5EQ0 A;  5IGD A;  2Z0S A;  4RG1 A;  3MAQ A;  2UUA L;  3A5Z B;  3QB3 A;  4HSP A;  3CME A;  1YNN C;  3D6W A;  4OWT B;  4DR4 Q;  3GTQ B;  3M7N A;  2ZT9 C;  2B2W C;  5LL6 X;  4LF9 Q;  4POG A;  1CI3 M;  4KJO A;  2EYM A;  4HAE A;  1OXV A;  1ENA A;  3OTO Q;  1D5M C;  1RF2 D;  4C3I H;  3AEV A;  2NVQ B;  2GA4 B;  4F8M A;  4H0L C;  3HZX A;  3DM3 A;  4A3L H;  4LWC A;  1KDC A;  3QOL A;  1WCM B;  1K73 C;  1JB3 A;  1B2T A;  4C3H H;  3K5L A;  2C5C A;  1L1O C;  2DNE A;  4A3E G;  1D6E C;  4DV5 Q;  1U0L A;  1LT4 D;  3M85 A;  1M90 C;  2B29 A;  1Y8P B;  1LTI D;  3T1Y L;  1CFM A;  3OOC A;  4U68 A;  1JQY D;  1LTS D;  2L55 A;  4DK1 A;  1E1T A;  4OHJ A;  3J81 i;  1A8V A;  2VB3 X;  3H0G G;  3MXP A;  4GLX A;  1IBL Q;  4B08 A;  1CSQ A;  2PQA B;  1C7Y A;  5CV6 A;  4EQP A;  1PRT C;  1C4Q A;  3NBI A;  3M3Y H;  4QL5 A;  3MWY W;  1STN A;  1DOK A;  1QJO A;  4IOA A;  4A3B G;  3RZO H;  1JWU D;  1KAA A;  2B63 B;  4DV3 L;  2UU9 Q;  1GHJ A;  1TU2 B;  1RDP D;  2B2W A;  4P74 A;  3I4M G;  1KD1 C;  3W3A A;  2F0P A;  5KEE A;  4B9X A;  2HT1 A;  3F2U A;  3F1Z A;  1EY0 A;  1TKW B;  3KBG A;  3M4O B;  1IBM Q;  2ZXP A;  3P75 A;  3HP3 A;  1EWH A;  3NBH A;  3NEM A;  2BH2 A;  2HIX A;  4R9W A;  4JCV E;  5DLQ E;  2SNM A;  2NN6 H;  2L0C A;  1VQL A;  5FK9 C;  2N88 A;  2LFN A;  1Z7T A;  1N33 L;  3PO2 G;  5AJ3 L;  3OSO A;  1HR0 Q;  2A69 C;  1YIJ A;  3SK6 A;  4CKC A;  1EU3 A;  5M5X H;  3PV0 A;  1PYS B;  1FJG L;  2QF7 A;  1TVX A;  1I3Q H;  4I7A A;  4BBR H;  1HNX L;  4UP9 A;  2K75 A;  3DWA A;  1Q7Y C;  2IWH A;  3SDZ A;  2VQE L;  2B2T C;  3DXJ C;  4GOP B;  1TWG B;  1OXT A;  1TT2 A;  3KYH C;  2R92 G;  2HDM A;  2HDL A;  2SEB D;  5BN5 A;  1K0S A;  2JA8 B;  4O2D A;  1JB7 A;  3HOW G;  5M3F B;  3I4N G;  4FYD A;  4AYB G;  3NTI A;  4HSV A;  4YY3 L;  4OWW B;  1CQF A;  1QVC A;  4RCO A;  4XQN A;  3A8I E;  3HKZ G;  4KV6 A;  5HUR A;  4KHV A;  1OXU A;  3HOY G;  1WD0 A;  1RJT A;  4ZQ3 A;  5FLM G;  1P16 A;  1FGU A;  2F0Q A;  2R93 G;  2F03 A;  4RGN A;  5IE8 A;  5ELD A;  2JQO A;  1UE7 A;  3TQY A;  3RZD H;  4AYB E;  4F87 A;  2NTS A;  3RD4 A;  2A6E D;  1IL2 A;  4RWS C;  3FPU B;  3D8G A;  4ZKC B;  4R8N A;  1B9N A;  1DCZ A;  3HKZ E;  1X54 A;  1E2W A;  3A74 A;  3L9A X;  1SMY D;  5IYB G;  1JCK B;  3F2D A;  4FF1 A;  2MUY A;  5IT9 L;  1FL0 A;  1I4X A;  3TRE A;  3GTG B;  1NJI C;  5FO8 B;  4F7X A;  2EXZ A;  2JA5 G;  4A3J B;  1HZA A;  2KVM A;  3A0J A;  1JIC A;  4IUP A;  3GTL B;  1Y1W G;  1PTO C;  4QF4 A;  2Z4I A;  5IOD A;  2XTI A;  1PV4 A;  3LNN A;  2BOS A;  3S16 H;  3V96 A;  5ISR A;  4L5T A;  3P7J A;  4ABN A;  1HHV A;  4GN5 A;  3U4Z A;  4DAY B;  3CCJ A;  1JOK A;  1M4V A;  2EYO A;  3J80 E;  4LF7 Q;  5JAV A;  2ZTE A;  2F4I A;  3PF5 A;  1LO5 D;  2PMZ B;  1NMG A;  4DR5 Q;  4B3S L;  5M5W B;  4FF4 A;  1K83 H;  4IPG A;  4IPD A;  2UXB L;  2RBM A;  4GKK L;  5C4J B;  1YBY A;  2MGS A;  1SE2 A;  3AU7 A;  3K7A B;  1BCP B;  3U9O A;  1U4R A;  1Q86 C;  1K3B C;  2A6H C;  2YTV A;  4JI3 L;  1L0Y B;  1XPO A;  3PQI A;  3NQT A;  4UDU C;  4JI0 Q;  4CJ0 B;  4X65 L;  3U9S A;  1VQO A;  4C3J H;  1TS5 A;  4NW2 A;  1H9K A;  4IJL A;  5EBD A;  4LUV A;  2NZ1 D;  4CJ2 C;  1XNQ Q;  4BY7 B;  3HG9 A;  3FKI G;  1RHP A;  4RGO S;  2EY2 A;  1HZ9 A;  2NVX H;  3S14 H;  2OF1 A;  5FKA C;  5FLX E;  5J39 A;  1YNN D;  3BVG A;  1PZI D;  2OTL A;  4QIW E;  5IP7 G;  3T51 B;  1STE A;  1I6H B;  4IUQ A;  3SK5 A;  1X65 A;  2PW7 A;  1HZC A;  4K8I A;  1QNU A;  4NXN Q;  5EBC A;  3GQB A;  1TS4 A;  2HCC A;  4HJ5 A;  4JI8 Q;  3KDF B;  4ZUJ A;  1XMO L;  1ZYR C;  2O2L D;  2RCN A;  3H3V H;  4JK1 C;  1PYW D;  4XDX A;  2K5H A;  4IUV A;  3E9H A;  2NVY H;  1U5K A;  2R7Z G;  2AHO B;  5C0X G;  1VQ9 A;  4A3E H;  1SXT A;  1SYG A;  2FMC A;  2I5M X;  2K14 A;  4RFB A;  1YJW A;  2E74 C;  1YHQ A;  5COR A;  4LFB L;  1PH5 A;  5H1S E;  4UAI A;  2E2I B;  1VMC A;  3QIA A;  5IGB A;  3NWS A;  2JSO A;  4YHH Q;  1EUJ A;  2XWJ B;  2EVB A;  3JAM L;  4ZCK A;  3H0G H;  3STB C;  1JOQ A;  3RLO A;  2YU9 H;  2K05 A;  1PRT D;  4A4I A;  1B70 B;  4YCU A;  1PRT F;  4FF2 A;  3CCR A;  1TWH B;  3LWU A;  1RCV D;  4KTA A;  2I46 A;  2P5Z X;  4DF7 A;  4R4O A;  4A3B H;  3NUC A;  1EWI A;  4V19 0;  2F0G A;  3I4M H;  5IIF A;  2L15 A;  1GUT A;  3E5S A;  4DUY L;  2HIV A;  2ZM6 Q;  2K52 A;  2QEJ C;  2QCP X;  4K14 A;  5HGT A;  5KYI A;  4PZ6 A;  3RLF A;  1H9S B;  3EQL C;  2V4D A;  5FO7 B;  1VQM A;  2BA1 A;  3SGI A;  1EY4 A;  2A69 D;  2EYJ A;  2KCN A;  1FGB D;  3PO2 H;  4LFA Q;  3NWT A;  3J80 c;  1SEB D;  4JI2 L;  2VQF L;  4YWL A;  1VQC A;  4C1N I;  3PO3 B;  4UP7 A;  2H1E A;  4JI4 Q;  3NTK A;  3BDO A;  3ER0 A;  3C46 A;  4RKL A;  2EIF A;  4K5W A;  2WB1 E;  3URY A;  4G7Z C;  4KMU C;  1QOH A;  5M5Y B;  4ZLT F;  3JAM i;  5FJ8 G;  1WJJ A;  4O0A A;  5DNF A;  4HJ8 A;  1VQJ A;  3GTJ H;  4GNX C;  1S5E D;  1SBB B;  2RCF A;  3HOW H;  3I4N H;  4IQZ A;  2HQE A;  4JI5 Q;  3BVZ A;  4DR3 L;  4X3K A;  2K5W A;  4C3I B;  1H9R A;  2XIW A;  3H94 A;  1AFP A;  1L0W A;  1QIL A;  1VQA A;  3FVQ A;  1K9M C;  1D5X C;  3KF6 A;  5JJK A;  3HOY H;  2Q2U A;  2F0F A;  1F77 A;  5FLM H;  2F52 A;  4HIK A;  5C3X A;  5D3I B;  2K5Q A;  3M9B A;  2R93 H;  2Q8T A;  3VYU A;  2AUJ D;  3F2C A;  4L5S A;  1D5Z C;  4DR1 L;  1I94 L;  1EL0 A;  1K8G A;  3MFG A;  1RIP A;  1BO0 A;  3N52 A;  1W2B A;  5CV4 A;  4DXF A;  5FLX c;  2O4X A;  1NTG A;  3Q8D A;  3ND9 A;  1EWC A;  3QR8 A;  4OON A;  1R4Q B;  4IUR A;  3K80 C;  1K3R A;  1U4L A;  5I6Y A;  5IYB H;  2NTT A;  2JYO A;  1UEB A;  1Y1V B;  4C56 C;  1CA6 A;  1VDZ A;  3S9W A;  3CC4 A;  4X3S A;  2H5X A;  1N32 Q;  2JA5 H;  1CZG A;  1FNV A;  5M3M B;  2K28 A;  2Z9H A;  4KHP Q;  4S3S A;  4WJ4 A;  2EJF C;  3CRL C;  3M3Y B;  3J81 E;  1C8C A;  4X62 L;  2E5L Q;  2ASB A;  1Y1W H;  2WAQ G;  3BZD B;  1X9N A;  4IFD G;  2CQO A;  1N34 L;  1VQ8 A;  1V8Q A;  1C0A A;  4GNX A;  3GTO B;  1IZ6 A;  4NXM Q;  3GTK B;  2K33 A;  4A3G B;  3HOV B;  4RAU C;  3I3C A;  1NCV A;  1SSO A;  2A5H A;  1NY4 A;  2A73 B;  2RF4 A;  2YTY A;  3BDC A;  4F88 A;  1RKN A;  2WAQ E;  3S1Q B;  4NP5 A;  3I70 A;  2ES2 A;  4JI7 L;  2K03 A;  2ID0 A;  2F0J A;  1VCI A;  5ELE A;  1BQQ T;  3MEF A;  2A6H D;  2A1A A;  3X3M A;  1IHZ A;  4LFC L;  5IOC A;  1EIG A;  2K04 A;  2HHH Q;  1AH9 A;  4BBR B;  1CQV A;  2B8F A;  2CH4 W;  3I7F A;  1YJ9 A;  4ID6 A;  1JMC A;  4A3M G;  2JA6 G;  2F3V A;  4CDD C;  1MJE A;  1PVO A;  4RGM A;  2AMC B;  3DEP A;  1UWV A;  3FKI H;  1I50 B;  5JEA G;  4MN3 A;  1UAP A;  5ELF A;  1WD1 A;  2FJ2 A;  4BXX G;  1CKO A;  3T53 B;  1SYB A;  1F9P A;  1SMY C;  1V1P A;  4B3R L;  1TY2 A;  5C4X B;  3C1F A;  4UY8 C;  2RQX A;  1KIX A;  2C9O A;  4YIJ A;  5IP7 H;  1V43 A;  1Q82 C;  2F0U A;  1ASY A;  1A2T A;  4A93 G;  4HN7 A;  2IHE A;  5C44 B;  4XQJ A;  1NSN S;  1HFN A;  1LYL A;  4KHZ A;  4FO2 A;  4Y7N H;  1G6Z A;  4DV0 Q;  1PH9 A;  1VQD A;  1STB A;  1VQF A;  1SFO B;  3E9I A;  2RVL A;  2K6A A;  1MJC A;  1LM0 A;  2C35 B;  2Y0S B;  3FMC A;  2R7Z H;  4KN4 C;  5C0X H;  4BBS B;  3I72 A;  3PCO B;  3FRP B;  1N36 L;  1Q46 A;  1S5C D;  3HOU B;  1Y8N B;  2F0L A;  1PYB A;  1Z9F A;  3R2T A;  2PYK A;  1QCB D;  5I9P A;  4B3M L;  1BOS A;  4G4K A;  2A74 C;  4IPC A;  2D0O A;  2QEX A;  4DN4 M;  1SNO A;  1NMF A;  2EQS A;  3STB D;  4JOI C;  4JI1 L;  4IUU A;  4P2C B;  1T5X D;  3J7A V;  1Q90 A;  2VUM B;  4LF8 L;  4HID A;  3E0J A;  3VYR A;  3A7L A;  3FHW A;  4X66 Q;  3E6Z X;  2ZXO A;  4GN4 B;  3SHL A;  4DGZ A;  1KAB A;  2GVA A;  1UE6 A;  2AQ2 B;  4CKE A;  2WIN B;  4DR4 L;  1STG A;  3ND8 A;  5DEH A;  3K58 A;  4I65 A;  1TWF H;  2AQ1 B;  4LF9 L;  1CKN A;  3OTO L;  5F2D A;  3S15 H;  3PIP 3;  4K5X A;  3VYT A;  2EZV A;  1CK1 A;  3J81 c;  4PMC A;  3AFP A;  1IW7 C;  1Q8K A;  1QUQ A;  4LF6 Q;  1EOV A;  4EQN A;  2XVS A;  1SMX A;  2HQL A;  1S5F D;  3F8T A;  3WOF A;  3VR6 A;  5LMN L;  1LTG D;  4ME5 A;  3KLS A;  5GAG C;  2WP8 J;  4EQ5 A;  4DV6 Q;  5IYD G;  4R8I A;  4K5V A;  1CUK A;  4A3I G;  3MFY A;  1M1K C;  2NVX B;  3U58 A;  4DV2 Q;  4PMW A;  1B1Z A;  3P1H A;  5FJ8 H;  4IO9 A;  2M9V A;  4JOI A;  3UE1 A;  4JI6 Q;  1IBL L;  4QUF A;  2WFW A;  5IWA L;  1J5E Q;  3CW2 C;  2I5H A;  3J7A F;  3TBI B;  1BBU A;  4A3F G;  1PFS A;  4CDF C;  5JJI A;  5CMD A;  1JOO A;  4WJ3 M;  1J6Q A;  5EKL A;  3LX0 A;  3TZU A;  2EPB A;  1H9M A;  5LMN W;  2PCF B;  3DWQ A;  2O5I C;  3K7U C;  5EPL A;  2UU9 L;  1TWA H;  2AUK A;  3KF8 B;  1EOT A;  3ERO A;  5CR3 A;  2M2L A;  2CVR A;  1MSH A;  4JYA Q;  3NPP A;  2B63 G;  1B3Q A;  5JVH 3;  1SE3 A;  3PIO 3;  1PH8 A;  4GLA C;  1IBM L;  2UXC Q;  2K7V A;  3BU2 A;  5EPK A;  4LF5 Q;  4QJF A;  2G9H D;  3BG3 A;  3GV6 A;  2OTJ A;  2NBF A;  3I4L A;  1HR0 L;  5DM6 3;  2B8G A;  4NKL A;  4KKU A;  3HOX B;  5J22 A;  2IT1 A;  4CKB A;  2YU9 B;  2MO1 A;  1MSG A;  1BNZ A;  3IRB A;  3HRZ C;  2EOT A;  3UE0 A;  5D14 A;  1W3S A;  2SDF A;  1P8L A;  1VQ7 A;  1PZK D;  3MHB A;  2BE5 C;  1L1O A;  1DZ1 A;  2BH8 A;  4IN3 A;  3K5O A;  3KUP A;  4IFD H;  1QB5 D;  1C9O A;  2EYF A;  4IPH A;  1F2Z A;  3PUY A;  2K5V A;  1TWC B;  5I9O A;  1AE3 A;  1F2M A;  1BCP C;  5C6A A;  1J8I A;  3NXW A;  2JA8 G;  1XX8 A;  1WVL A;  5M3F G;  4DV3 Q;  1NE3 A;  3S17 H;  1ONL A;  4B3T L;  1H95 A;  2F0D A;  2L5T A;  1YNJ D;  1LTT D;  4K6D A;  1SE8 A;  1JWS D;  2KEC A;  4RGT A;  1SND A;  1A3T A;  3PO2 B;  4IJH A;  3T1H Q;  4K6L A;  1TY0 A;  1VQB A;  1ET9 A;  2NZH A;  1BUV T;  3E0E A;  2PQE A;  5CBE E;  2EDG A;  1SNQ A;  1YEZ A;  3ULL A;  3TS2 A;  1TXY A;  3I56 A;  4DR2 L;  5K36 G;  3GTM B;  5C3E B;  3I8Z A;  1LTB D;  3NBH B;  4DPG A;  3D6C A;  4A3M H;  2JA6 H;  5BN3 A;  2R92 B;  2KCT A;  3T13 A;  3GTJ B;  1FNU A;  5JEA H;  3HOW B;  1K0R A;  4AYB B;  3DWP A;  1XXG A;  3VR4 A;  3PUV A;  4BXX H;  1RTO A;  2JXM B;  1DON A;  1I4P A;  4P71 A;  1KLG D;  3HKZ B;  2OT2 A;  4KY7 A;  3HOZ B;  2VXW A;  1GUG A;  4YY3 Q;  4KK7 A;  1SR3 A;  1KTK A;  4CJ1 B;  1I6V C;  4UHV A;  1HNW L;  4A93 H;  3NHH A;  2H4O A;  4DV7 Q;  3GV3 A;  1YIT A;  4LF7 L;  3PF4 A;  4DA2 A;  1RTN A;  4L5R C;  4BA1 I;  2B2T A;  2LXK A;  3W1G A;  4DR5 L;  3QWN A;  5HY6 A;  1LT6 D;  4FXD A;  1Q12 A;  2R6G A;  3TEH B;  1E2V A;  3MVV A;  5JVG 3;  4HMI A;  1SRU A;  1X3E A;  4IAL A;  2F4V Q;  3KJP A;  4GS3 A;  3BJU A;  2O5J C;  4A3C G;  2L4N A;  1X56 A;  2QA4 A;  1LAB A;  5C4Z A;  3KFU A;  4IFD J;  3GDE A;  2EY5 A;  2OEO A;  2JA5 B;  1VQG A;  1DXM A;  4HIM A;  4OX9 Q;  4AH6 A;  3N6R A;  2KEE A;  4DAP A;  2RHQ B;  4C2M H;  1Y1W B;  3A8J E;  3OIQ A;  1XNQ L;  3MXN A;  4DU9 A;  1JT8 A;  1Y14 B;  3ULJ A;  4HCE A;  4JBK A;  2VS1 A;  1CT1 D;  2NN6 I;  3IKJ A;  4FF3 A;  2B2V C;  3HFZ B;  1O80 A;  3FP9 A;  1K8O A;  1XNR Q;  4TRD A;  1NR4 A;  1ROD A;  4KY6 A;  4IFD I;  4P73 A;  5A2Q E;  1QNK A;  4NXN L;  2QIL A;  4JI8 L;  4PV1 C;  4RMF A;  4EGV A;  1IW7 D;  3ERS X;  4QQB X;  4TVA B;  4B3S Q;  3GTQ H;  1QZG A;  4UP8 A;  2EYH A;  1JJC B;  2CH4 A;  2UXB Q;  4BY1 B;  2BA0 A;  4JV5 Q;  4OEM B;  1S4Z A;  3S1M H;  1TII D;  1PXU A;  4BA2 I;  2N49 A;  4XYO A;  2NVQ H;  1Q1E A;  3K0X A;  4HJ7 A;  2FXQ A;  2A8V A;  4DK0 A;  5EKI A;  1GXD C;  2PZU A;  1L2F A;  2JE6 I;  3SE0 A;  4R4Q A;  3RUZ A;  5IYD H;  4XTC S;  4A3I H;  1DOM A;  2CW0 D;  1AP0 A;  4DK6 C;  3S1N B;  5IGG A;  3A54 A;  1FD7 D;  5JOB A;  2K50 A;  4R4T A;  5E7N A;  2JA7 B;  2KHS A;  4XYQ A;  2Z6B A;  1CHQ D;  4PMB A;  2KED A;  5C3W A;  4R1J A;  2E2D C;  1WTO A;  3CCM A;  4A3F H;  3UI2 A;  3CQZ B;  4LK1 C;  4HCS A;  1EQT A;  4DNR B;  4A3K B;  2XWB B;  3EA6 A;  3R2I A;  4K8J A;  3TSS A;  1LTR D;  2B2V A;  1S72 A;  4R4I A;  3FEW X;  1YZ6 A;  1EIF A;  4Y7N B;  1VQP A;  1XJV A;  1HH2 P;  2LY7 A;  3Q23 A;  4G7H C;  2CWA A;  1R9T B;  3S2H B;  1PTO B;  3I4O A;  1GHK A;  2ZM6 L;  1G91 A;  1HXY D;  2B63 H;  1XMQ L;  4PG3 A;  4DV4 Q;  3D3R A;  2XRQ D;  1GUO A;  1DGS A;  4ODG A;  5JPN C;  1WTV A;  3EIV A;  4YWK A;  2NYZ D;  1H9J A;  3BYY B;  2MPM A;  2YV5 A;  4JG2 A;  4FDB A;  4KD3 A;  4OWX B;  2LXJ A;  1PH6 A;  3M4O H;  2XSC A;  4LFA L;  3GTP B;  3PGZ A;  1HQM C;  1GJX A;  2ZJR A;  3CKI B;  4BS9 A;  3M4Q A;  1V9P A;  5D3D A;  4A76 A;  4JI4 L;  2AQ3 B;  3UDI A;  4A3D B;  2KBN A;  1EY7 A;  4LMQ D;  4K0K Q;  2DY7 A;  2BE5 D;  1EY9 A;  4LJZ C;  4X64 Q;  1U4M A;  2VB2 X;  2UUB Q;  2EY6 A;  1HA6 A;  2JK8 A;  4JI5 L;  1TWG H;  1BCP D;  3MZ5 A;  3J80 L;  3MC0 B;  4FP5 D;  1XTD A;  1BCP F;  2JA8 H;  1A62 A;  5M3F H;  3A5U A;  4NMZ A;  2E8G A;  2PNH A;  4O42 A;  3F2B A;  5LMU Q;  2WB1 B;  2NUC A;  3G71 A;  3BS1 A;  1EQV A;  1WTW A;  1SN8 A;  4N8X 1;  2PZT A;  4POF A;  5GQO A;  4K2L A;  5G3L D;  1TR5 A;  1W6K A;  2Z6K C;  3CHB D;  2MQH A;  2LS0 1;  2J7Z A;  2JJQ A;  5G3L F;  3CP0 A;  2K01 A;  3CCE A;  2MHV A;  4XIG S;  4MZ9 A;  4LF4 Q;  3G6J B;  5K36 H;  2WKC A;  3D0F A;  2VQF Q;  3UDX A;  4C3H B;  3TN2 A;  1N32 L;  5CV8 A;  3FPP A;  1Y1V G;  1PA6 A;  4KHP L;  5EAY A;  1PHJ A;  1PH7 A;  1QG7 A;  1ASZ A;  3K5M A;  1E3P A;  1RL2 A;  5NUC A;  3OW2 A;  1F2Y A;  3H3V I;  5DAU A;  5FLX L;  2E5L L;  5M3M G;  4OL7 A;  4A3J H;  2BDN A;  3D4W A;  4HTH A;  1E22 A;  5LL6 S;  4TSS A;  2F0V A;  1TWA B;  2OQ0 A;  1EU4 A;  2YYZ A;  5EKK A;  3VDY A;  3GTL H;  1LV9 A;  5ELO A;  4NXM L;  3J80 i;  4DFA A;  4GZY C;  1ML0 D;  4DUZ Q;  2PI2 E;  1WTR A;  2FHT A;  3OWE B;  3G4S A;  1T5E A;  2FMM A;  3NE5 B;  1AEX A;  4WJW A;  1B53 A;  2VL6 A;  2XGT A;  2KOL A;  2J4X A;  4RH6 A;  3RZO B;  4DNT B;  1XPU A;  4A3G G;  3HOV G;  2JEA I;  1GUW A;  3KF6 B;  5CV9 A;  1LT3 D;  1WTQ A;  2DY8 A;  1BKB A;  5M5W H;  4A3C H;  2Z8L A;  2NB0 A;  1ILP A;  3MA2 B;  5C4J H;  1QE6 A;  4B9W A;  3UDG A;  3MXG A;  3OWF A;  3K7A H;  3CD6 A;  2R3Z A;  4H7B A;  1YNJ C;  4OIK A;  4DV1 L;  3RMH A;  2RDH A;  5M5X B;  4HIO A;  2KQ3 A;  4H44 C;  1A3U A;  3EFX D;  4NDX A;  1I3Q B;  1LLR D;  1PMR A;  1MHW C;  3DHQ A;  4X62 Q;  2B2U C;  1D8L A;  1WI5 A;  1O7I A;  4BY7 H;  1N34 Q;  2UUC Q;  4OXP A;  5L37 A;  4AQY L;  2N78 A;  3T16 A;  1Y69 U;  2D5D A;  3M7G A;  4EX5 A;  3K5N A;  2CQA A;  2LKV A;  4ULL A;  3PIP A;  4DR6 Q;  5C4X G;  1WTP A;  1HZB A;  2N3S A;  1I6H H;  3H6M A;  4J8Q A;  2CHB D;  4GNX B;  2EYP A;  1VS0 A;  1A6X A;  4DV0 L;  2M00 A;  4PQX A;  1GUS A;  5C44 G;  5IYC G;  2IX1 A;  2NWG A;  1M8A A;  1CSP A;  1QVF A;  3CF5 A;  1BVS A;  4CHT B;  1CM9 A;  1HNZ Q;  3RZD B;  1PFM A;  2PNR C;  4A3M B;  2JA6 B;  3S1R H;  4RCN A;  5D65 A;  2Y0S G;  1XWE A;  3K59 A;  1B3A A;  1UE1 A;  4BBS G;  5C4H A;  2F0I A;  1DD2 A;  2I0Q A;  1G2S A;  2IJ0 A;  2K32 A;  3HOU G;  1UE5 A;  1E0B A;  4M1U B;  1IBK L;  3M4P A;  4TQU S;  4JBM A;  2L9H A;  5BR8 Q;  2E2I H;  1II3 A;  2E2J H;  1LUZ A;  2KCM A;  2SNS A;  3D31 A;  4QUC A;  5I6W A;  2EYL A;  2UXD L;  4X66 L;  1S5B D;  2B2U A;  1KDA A;  2R61 A;  2Y0S E;  4APV A;  1E24 A;  4FXK C;  2CFM A;  5KNC A;  3RLN A;  1WYD A;  4XXE A;  1KAW A;  3K6O A;  1LT5 D;  3A55 A;  1SJH D;  3NSW A;  1JE4 A;  4MTN A;  3MXU A;  1G6P A;  3S16 B;  1V1P B;  2KUM A;  5E4X A;  4DR7 Q;  2FFK B;  3HS0 C;  3PIO A;  1KNA A;  1GKH A;  4DNI A;  3G6E A;  1XTC D;  2XN9 C;  3R93 A;  1QZH A;  1EQR A;  1BXT A;  4LF6 L;  1OXX K;  2RDG A;  5ELC A;  2QGQ A;  4HJA A;  4ZRZ A;  1K83 B;  5LHY 1;  5K5P A;  1SLJ A;  1CKM A;  2NVT H;  1SAP A;  1PH4 A;  4GN3 B;  1QVG A;  5GRO A;  4C2M B;  4DV6 L;  3NEN A;  3C1E A;  2DJF C;  4RHS A;  1EZ8 A;  4ZUI A;  5T1G A;  3J7A 5;  2TMP A;  3J81 L;  3WDN A;  1GUN A;  4DV2 L;  1EEF D;  1B9M A;  3SR1 A;  4C3J B;  1MKH A;  4JI6 L;  4DV5 L;  4GOP C;  4LF8 Q;  4YCV A;  5TSS A;  3VR3 A;  1STY A;  1IXR A;  1J5E L;  2QKI C;  1SDF A;  1LTA D;  1HCZ A;  1WCM G;  3W5O A;  1BF4 A;  5CBA E;  3CCU A;  3GP7 A;  2PQA A;  4JW0 A;  2F0W A;  2CW0 C;  3S14 B;  2IPK D;  5IT9 E;  2R7F A;  1VQK A;  1K28 A;  1YNX A;  2RSO A;  1S40 A;  4FVM A;  1ESR A;  1C48 A;  4GKJ Q;  3R3O A;  3TZD A;  1HFG A;  1HTP A;  3SK4 A;  3S1M B;  1V1O A;  2EY1 A;  4L63 B;  4JYA L;  3K8A A;  3B6Y A;  1KNE A;  1YHB A;  2UXC L;  1L0X B;  4J15 A;  2UUA Q;  4KJN A;  3W1B A;  3U4V A;  4LF5 L;  1CKN B;  2LMC B;  5C0X J;  1PDQ A;  4HMJ A;  1OTC A;  5LMN Q;  4A3I B;  3TP8 A;  1EY5 A;  2AKW B;  2F0H A;  3L2P A;  5IGF A;  1D1I A;  1QUQ B;  2NVY B;  1WFQ A;  3TRZ A;  4UPA A;  5ELN A;  1PLF A;  4A3E B;  4G57 A;  1KLU D;  2Z4H A;  4R4C A;  5GAE C;  4OEL B;  2ZJQ A;  4Q0F A;  3ITP A;  3VA5 A;  1F9S A;  5CC4 A;  1Y1V H;  2A19 A;  4A3F B;  2E2H H;  3OW7 A;  3L7Z C;  3HOX G;  4FXG C;  1I4R A;  1UNS A;  1HUM A;  4OIJ A;  5IWA Q;  5M3M H;  1W6J A;  4EVO A;  4GOP A;  1DM0 B;  1I4H A;  4PNY A;  5C0X I;  3H91 A;  4OO1 G;  3H0G B;  3T1Y Q;  2DUD A;  1Z47 A;  1K8A C;  3OHX C;  1V1Q A;  1MGS A;  1MIU A;  1ICW A;  3TDQ A;  3I73 A;  3T4A C;  5E4W C;  3RN5 A;  3GTO H;  4XQQ A;  1JJ2 A;  3GTK H;  4Z9C B;  1A0I A;  1X3Q A;  4A3B B;  1KXL A;  4KKT A;  1IL8 A;  5KNB A;  4A3G H;  3E3X A;  1WTH A;  3HOV H;  4G7O C;  3MEH A;  3C3L A;  1B7Y B;  1CA5 A;  4RKB A;  1ENC A;  3I4M B;  3I2Z A;  3T1H L;  3ZYY X;  3S2D H;  1LTL A;  1YVC A;  4GLV B;  1PFB A;  4YCW A;  3VYS A;  1A63 A;  3S1Q H;  1KRT A;  2IX0 A;  3NTH A;  2MP1 A;  1HR0 W;  2PZW A;  3AB9 A;  2HCI A;  4KI0 A;  1ESF A;  1X3P A;  1X32 A;  3QG1 A;  5I2Y A;  3K0Y A;  2KCC A;  1N9W A;  2YTX A;  2XRS D;  1N8R C;  4IUT A;  4A75 A;  3EN2 A;  2IL8 A;  5EPJ A;  4V0B A;  1IKM A;  3G7L A;  5C3E G;  4WFN 3;  3BZC A;  3V2T A;  3KLR A;  4JBJ A;  4H13 C;  1I4Q A;  1EQQ A;  1N33 Q;  3CAM A;  5AJ3 Q;  4MIU A;  2RKS A;  3I90 A; 
#chains in the Genus database with same CATH homology
 4HED A;  4IZ8 A;  3TP5 A;  4L8J A;  2D62 A;  1QWY A;  5KRU A;  3I4N B;  4DAY A;  4ZK9 B;  3JAM E;  4ZAI A;  1O7Z A;  2Z1C A;  3TP6 A;  1JOR A;  5I2X A;  5E3F A;  3T56 B;  1CZW A;  3HOY B;  3PUX A;  2L1B A;  2R93 B;  1TS3 A;  1O7Y A;  4L6T B;  3D4D A;  3SEB A;  3LWE A;  5FO9 B;  1DOL A;  1ZXT A;  5EGT A;  1PRT B;  1EYC A;  2B39 A;  5CYU A;  5FOB B;  4XT1 B;  5BN4 A;  1EIH A;  3A7A B;  4IUN A;  4RHR A;  2EE1 A;  1D2B A;  2X6G A;  1DYQ A;  2F0K A;  3WOE A;  1OO9 B;  1F9R A;  2PW5 A;  1O78 A;  3X3N A;  4CBV A;  1B44 D;  5KIX A;  2EJG C;  1CTM A;  2A68 C;  1EY8 A;  4J6H A;  1ET6 A;  2RSN A;  1UEA B;  4QB4 A;  2L11 A;  2SOB A;  2XNA C;  3VR2 A;  1AZP A;  5AFW A;  3DEO A;  1EY6 A;  1SNP A;  1HA5 A;  2AWO A;  5JEA J;  1U9R A;  3AMU A;  3K57 A;  1U4P A;  3M4Y A;  4QIW B;  1A15 A;  3O13 A;  1FYC A;  3HEJ A;  1BBX C;  3DUZ A;  1JC7 A;  5E1F A;  3FKI B;  3A8K E;  4KY5 A;  2JEB I;  4EQO A;  1XYI A;  5JJZ A;  1EFI D;  2K5D A;  2PO4 A;  3QJY A;  3Q0A A;  3IFD A;  1WTX A;  3V05 A;  2J0T D;  1PFN A;  4HR7 B;  1Q3L A;  5ELB A;  5M9O A;  1RD9 D;  3S1R B;  4QMG A;  1A2U A;  4WOR A;  4O1N A;  4XT3 B;  5IGC A;  1H9S A;  1GOZ A;  2EJM A;  5C5L A;  3OIP A;  1ZKO A;  5CGK A;  2X69 A;  1HTL D;  2X6L A;  2R7Z B;  3P20 A;  2F0S A;  2E2J B;  1JR0 D;  3Q22 A;  1EZ6 A;  2E75 C;  3IAY A;  5T1I A;  2ICI A;  1G29 1;  1J9O A;  5A35 A;  1G2T A;  4WRD A;  4OO1 H;  1HQR D;  1EYD A;  4E6I A;  3D4R A;  1STH A;  1LAC A;  1Z6H A;  3IL8 A;  2WKD A;  2IW3 A;  2VNU D;  2BDO A;  1TQO A;  3KBX A;  3BVM A;  1SNC A;  1G8Z D;  1ILQ A;  1TWF B;  2I07 B;  1VF7 A;  3EJI A;  2NVT B;  4N9T A;  3S15 B;  1E2Z A;  1O7L A;  1K8M A;  1VF5 C;  4LAA A;  1B4O A;  5C5M A;  4K2K A;  2G9D A;  3FDT A;  1SNM A;  2WII B;  4C3I G;  5IGE A;  3ONA B;  1IYV A;  3SXH A;  1ENF A;  1TS2 A;  4C3H G;  5KGU A;  2WV6 D;  3C2P A;  3EVQ A;  1AZQ A;  5EJW A;  3QO2 A;  1Y8O B;  4TKO B;  1R4P B;  5A2Q L;  4FNF A;  3CRK C;  1CHP D;  3OMC A;  2MJ8 A;  2F3W A;  4QCL A;  2D9U A;  5COY A;  3H09 A;  1MI2 A;  1PZJ D;  4J1M A;  2Q8I B;  2RA4 A;  2B2Y C;  4I7Z C;  4ZYS A;  1SYE A;  1AW7 A;  3BYT B;  2F0T A;  1STA A;  3PUW A;  1SYC A;  4DAV A;  3ERQ A;  2K1B A;  2E2H B;  2F0N A;  2AWN A;  1EEI D;  1Q8I A;  3GO5 A;  4M8A A;  3J7Y W;  1UUP A;  4ILW A;  3TP7 A;  2OXP A;  4JBW A;  3OMG A;  5J1Z A;  2NN6 G;  3DMU A;  1PTO D;  3KK7 A;  2F0E A;  1JWM D;  3PUZ A;  3TME A;  3BDL A;  1PTO F;  3PMF A;  1D1K A;  1ZEQ X;  4N9P A;  2WAQ B;  4KKS A;  4RA8 A;  4OO1 I;  4Q5V A;  1NUC A;  4MHE A;  2DN8 A;  1SYD A;  3A56 A;  2PPB C;  3S2D B;  5KND A;  2Q8R E;  2A68 D;  2JP1 A;  1MBY A;  3S17 B;  1F9Q A;  3MTS A;  1KDB A;  2F0O A;  1S5D D;  1SE4 A;  2B2Y A;  1IKL A;  4C1N K;  3IFT A;  1I4G A;  3HGB A;  3I91 A;  1DJR D;  1B50 A;  1EYA A;  3CU7 A;  3NK9 A;  4ZKB B;  5KYL A;  2ENB A;  1BR9 A;  1FR3 A;  3NQI A;  3QOJ A;  4DXG A;  2A6E C;  3VR5 A;  4BWG B;  4U67 3;  2BCO A;  1NAP A;  4OGQ C;  1SJE D;  2ICE C;  2WAC A;  3L3O C;  2ZXR A;  5CV7 A;  1BDO A;  1OXS C;  2E76 C;  3H3V C;  1ZYR D;  2N55 A;  4A93 B;  3OPO A;  2D2C C;  1Q1B A;  3NP8 A;  5CV5 A;  3Q24 A;  5DM7 3;  1PTO H;  1HUN A;  3R8B A;  3VA7 A;  1AN8 A;  2F0M A;  1MD2 D;  1VMP A;  2DNC A;  2TSS A;  4KD4 A;  3SK8 A;  1NR2 A;  4X3T A;  2RDF A;  3GD7 A;  1F2L A;  3Q6S A;  3W2D A;  1A3V A;  2F1M A;  4CGY B;  2L12 A;  4C3J G;  1SYF A;  2FIN B;  1HRJ A;  2HUG A;  1FNW A;  5I4D A;  4X3U A;  4KN7 C;  2KJX A;  3DM1 A;  5JPM C;  3SVM A;  1IYU A;  2IX3 A;  2QDB A;  2KA7 A;  3KF8 A;  1HPC A;  3KLS X;  5EQ0 A;  5IGD A;  3MAQ A;  3QB3 A;  4HSP A;  1YNN C;  3D6W A;  3GTQ B;  3M7N A;  2ZT9 C;  2B2W C;  5LL6 X;  1CI3 M;  4KJO A;  2EYM A;  4HAE A;  1OXV A;  1ENA A;  1D5M C;  1RF2 D;  2NVQ B;  2GA4 B;  4F8M A;  4H0L C;  3HZX A;  1KDC A;  3QOL A;  1WCM B;  1B2T A;  1JB3 A;  3K5L A;  2C5C A;  2DNE A;  1D6E C;  1LT4 D;  3M85 A;  1Y8P B;  1LTI D;  1CFM A;  3OOC A;  4U68 A;  1JQY D;  1LTS D;  2L55 A;  4DK1 A;  4OHJ A;  2VB3 X;  3MXP A;  4B08 A;  5CV6 A;  4EQP A;  1PRT C;  1C4Q A;  3NBI A;  3MWY W;  1STN A;  1DOK A;  1QJO A;  1JWU D;  1KAA A;  2B63 B;  1GHJ A;  1TU2 B;  1RDP D;  2B2W A;  3W3A A;  2F0P A;  5KEE A;  4B9X A;  3F2U A;  1EY0 A;  1TKW B;  3KBG A;  3M4O B;  2ZXP A;  3P75 A;  3HP3 A;  1EWH A;  3NBH A;  4R9W A;  2SNM A;  2NN6 H;  2L0C A;  5FK9 C;  2N88 A;  2LFN A;  1Z7T A;  3OSO A;  2A69 C;  3SK6 A;  4CKC A;  1EU3 A;  3PV0 A;  2QF7 A;  1TVX A;  3DWA A;  2IWH A;  3SDZ A;  2B2T C;  3DXJ C;  1TWG B;  1OXT A;  1TT2 A;  2HDM A;  2HDL A;  2SEB D;  5BN5 A;  2JA8 B;  5M3F B;  4FYD A;  3NTI A;  4HSV A;  1CQF A;  4RCO A;  4XQN A;  3A8I E;  4KV6 A;  5HUR A;  4KHV A;  1OXU A;  1WD0 A;  1RJT A;  4ZQ3 A;  2F0Q A;  2F03 A;  4RGN A;  5ELD A;  4F87 A;  2NTS A;  3RD4 A;  2A6E D;  4RWS C;  3FPU B;  3D8G A;  4ZKC B;  4R8N A;  1B9N A;  1DCZ A;  1E2W A;  3L9A X;  1SMY D;  1JCK B;  4FF1 A;  2MUY A;  5IT9 L;  1I4X A;  3GTG B;  5FO8 B;  4F7X A;  2EXZ A;  4A3J B;  2KVM A;  1JIC A;  4IUP A;  3GTL B;  1PTO C;  4QF4 A;  2Z4I A;  5IOD A;  3LNN A;  2BOS A;  3V96 A;  5ISR A;  3P7J A;  4ABN A;  1HHV A;  1JOK A;  1M4V A;  2EYO A;  3J80 E;  5JAV A;  2F4I A;  1LO5 D;  2PMZ B;  5M5W B;  4FF4 A;  2RBM A;  5C4J B;  2MGS A;  1SE2 A;  3AU7 A;  3K7A B;  1BCP B;  3U9O A;  1U4R A;  2A6H C;  1L0Y B;  3NQT A;  4UDU C;  4CJ0 B;  3U9S A;  1TS5 A;  4NW2 A;  1H9K A;  5EBD A;  4CJ2 C;  2NZ1 D;  4BY7 B;  3HG9 A;  1RHP A;  4RGO S;  2EY2 A;  2OF1 A;  5FKA C;  5FLX E;  5J39 A;  1YNN D;  3BVG A;  1PZI D;  3T51 B;  1STE A;  1I6H B;  4IUQ A;  3SK5 A;  2PW7 A;  4K8I A;  1QNU A;  5EBC A;  3GQB A;  1TS4 A;  2HCC A;  4ZUJ A;  1ZYR C;  2O2L D;  4JK1 C;  1PYW D;  4XDX A;  4IUV A;  5C0X G;  1SXT A;  1SYG A;  2FMC A;  4RFB A;  2E74 C;  5COR A;  4UAI A;  2E2I B;  1VMC A;  3QIA A;  5IGB A;  3NWS A;  2JSO A;  2XWJ B;  2EVB A;  3JAM L;  1JOQ A;  2K05 A;  1PRT D;  1PRT F;  4FF2 A;  1TWH B;  3LWU A;  1RCV D;  4KTA A;  2I46 A;  4DF7 A;  3NUC A;  4V19 0;  2F0G A;  5IIF A;  3E5S A;  1GUT A;  2QEJ C;  2QCP X;  4K14 A;  5HGT A;  5KYI A;  3RLF A;  1H9S B;  3EQL C;  2V4D A;  5FO7 B;  2BA1 A;  1EY4 A;  2A69 D;  2EYJ A;  2KCN A;  1FGB D;  3NWT A;  1SEB D;  4C1N I;  3PO3 B;  2H1E A;  3NTK A;  3BDO A;  3C46 A;  4RKL A;  4K5W A;  3URY A;  4G7Z C;  4KMU C;  1QOH A;  5M5Y B;  4ZLT F;  5DNF A;  1S5E D;  1SBB B;  4IQZ A;  2HQE A;  3BVZ A;  4X3K A;  2K5W A;  4C3I B;  1H9R A;  2XIW A;  3H94 A;  1AFP A;  1QIL A;  3FVQ A;  1D5X C;  2F0F A;  1F77 A;  5C3X A;  5D3I B;  2K5Q A;  2Q8T A;  3VYU A;  2AUJ D;  1D5Z C;  1EL0 A;  3MFG A;  1BO0 A;  3N52 A;  5CV4 A;  4DXF A;  2O4X A;  3ND9 A;  1EWC A;  1R4Q B;  4IUR A;  1U4L A;  5I6Y A;  2NTT A;  2JYO A;  1Y1V B;  4C56 C;  1CA6 A;  1VDZ A;  3S9W A;  4X3S A;  1CZG A;  1FNV A;  5M3M B;  2K28 A;  4S3S A;  2EJF C;  3CRL C;  3M3Y B;  3J81 E;  1C8C A;  3BZD B;  4IFD G;  1V8Q A;  3GTO B;  3GTK B;  2K33 A;  4A3G B;  3HOV B;  4RAU C;  3I3C A;  1NCV A;  1SSO A;  2A5H A;  2A73 B;  3BDC A;  4F88 A;  1RKN A;  3S1Q B;  4NP5 A;  3I70 A;  2K03 A;  2ID0 A;  2F0J A;  1VCI A;  5ELE A;  1BQQ T;  2A6H D;  3X3M A;  1IHZ A;  5IOC A;  1EIG A;  2K04 A;  4BBR B;  1CQV A;  2B8F A;  4ID6 A;  2F3V A;  4RGM A;  3DEP A;  1I50 B;  5JEA G;  4MN3 A;  1UAP A;  5ELF A;  1WD1 A;  2FJ2 A;  3T53 B;  1SYB A;  1F9P A;  1SMY C;  1V1P A;  1TY2 A;  5C4X B;  3C1F A;  2RQX A;  2C9O A;  4YIJ A;  1V43 A;  2F0U A;  1A2T A;  4HN7 A;  5C44 B;  4XQJ A;  1NSN S;  1HFN A;  4KHZ A;  4FO2 A;  1G6Z A;  1STB A;  1SFO B;  2RVL A;  2K6A A;  3FMC A;  2Y0S B;  4KN4 C;  5C0X H;  4BBS B;  3I72 A;  3FRP B;  1S5C D;  3HOU B;  1Y8N B;  2F0L A;  3R2T A;  2PYK A;  1QCB D;  5I9P A;  1BOS A;  4G4K A;  2A74 C;  4DN4 M;  1SNO A;  4IUU A;  4P2C B;  1T5X D;  3J7A V;  1Q90 A;  2VUM B;  3E0J A;  3VYR A;  3A7L A;  3E6Z X;  2ZXO A;  3SHL A;  4DGZ A;  1KAB A;  2AQ2 B;  4CKE A;  2WIN B;  1STG A;  3ND8 A;  5DEH A;  3K58 A;  4I65 A;  2AQ1 B;  5F2D A;  3PIP 3;  4K5X A;  3VYT A;  2EZV A;  1CK1 A;  4PMC A;  1IW7 C;  4EQN A;  2XVS A;  3WOF A;  1S5F D;  3VR6 A;  1LTG D;  4ME5 A;  3KLS A;  2WP8 J;  4R8I A;  4K5V A;  3MFY A;  2NVX B;  4PMW A;  1B1Z A;  3P1H A;  2M9V A;  4QUF A;  3J7A F;  3TBI B;  5CMD A;  1JOO A;  5EKL A;  3LX0 A;  3TZU A;  2EPB A;  1H9M A;  2PCF B;  3DWQ A;  2O5I C;  5EPL A;  2AUK A;  1EOT A;  3ERO A;  5CR3 A;  2M2L A;  2CVR A;  1MSH A;  3NPP A;  5JVH 3;  1SE3 A;  3PIO 3;  2K7V A;  5EPK A;  2G9H D;  3BG3 A;  3GV6 A;  2NBF A;  3I4L A;  5DM6 3;  2B8G A;  4NKL A;  4KKU A;  3HOX B;  5J22 A;  2IT1 A;  4CKB A;  2YU9 B;  1MSG A;  1BNZ A;  3HRZ C;  2EOT A;  5D14 A;  2SDF A;  1PZK D;  3MHB A;  2BE5 C;  1DZ1 A;  4IN3 A;  3K5O A;  3KUP A;  4IFD H;  1QB5 D;  2EYF A;  1F2Z A;  3PUY A;  1TWC B;  5I9O A;  1F2M A;  1BCP C;  5C6A A;  1J8I A;  3NXW A;  1XX8 A;  1WVL A;  1ONL A;  2F0D A;  2L5T A;  1YNJ D;  1LTT D;  4K6D A;  1JWS D;  2KEC A;  4RGT A;  1SND A;  1A3T A;  3PO2 B;  4K6L A;  1TY0 A;  1ET9 A;  1BUV T;  2PQE A;  5CBE E;  2EDG A;  1SNQ A;  5K36 G;  3GTM B;  5C3E B;  3I8Z A;  1LTB D;  3D6C A;  5BN3 A;  2R92 B;  3T13 A;  3GTJ B;  1FNU A;  5JEA H;  3HOW B;  4AYB B;  3DWP A;  1XXG A;  3VR4 A;  3PUV A;  1RTO A;  2JXM B;  1DON A;  1I4P A;  1KLG D;  3HKZ B;  2OT2 A;  4KY7 A;  3HOZ B;  2VXW A;  1GUG A;  4KK7 A;  1KTK A;  4CJ1 B;  1I6V C;  3NHH A;  2H4O A;  3GV3 A;  4DA2 A;  1RTN A;  4BA1 I;  2B2T A;  3QWN A;  1LT6 D;  4FXD A;  1Q12 A;  2R6G A;  1E2V A;  3MVV A;  5JVG 3;  4HMI A;  4IAL A;  2O5J C;  2L4N A;  1LAB A;  5C4Z A;  4IFD J;  2EY5 A;  2OEO A;  2JA5 B;  1DXM A;  3N6R A;  2KEE A;  4DAP A;  1Y1W B;  3A8J E;  3OIQ A;  3MXN A;  4DU9 A;  4HCE A;  1CT1 D;  2NN6 I;  3IKJ A;  4FF3 A;  2B2V C;  1O80 A;  1K8O A;  4TRD A;  1NR4 A;  1ROD A;  4KY6 A;  4IFD I;  5A2Q E;  1QNK A;  2QIL A;  4PV1 C;  4EGV A;  1IW7 D;  2EYH A;  4BY1 B;  2BA0 A;  1S4Z A;  1TII D;  1PXU A;  4BA2 I;  4XYO A;  1Q1E A;  4DK0 A;  5EKI A;  1GXD C;  2PZU A;  2JE6 I;  3SE0 A;  3RUZ A;  4XTC S;  1DOM A;  2CW0 D;  1AP0 A;  3S1N B;  5IGG A;  3A54 A;  1FD7 D;  5JOB A;  2JA7 B;  2KHS A;  4XYQ A;  1CHQ D;  4PMB A;  2KED A;  5C3W A;  2E2D C;  1WTO A;  3UI2 A;  3CQZ B;  4LK1 C;  4HCS A;  1EQT A;  4DNR B;  4A3K B;  2XWB B;  3EA6 A;  3R2I A;  4K8J A;  3TSS A;  1LTR D;  2B2V A;  3FEW X;  4Y7N B;  2LY7 A;  3Q23 A;  4G7H C;  1R9T B;  3S2H B;  1PTO B;  1GHK A;  1G91 A;  1HXY D;  3D3R A;  2XRQ D;  1GUO A;  4ODG A;  5JPN C;  1WTV A;  2NYZ D;  1H9J A;  3BYY B;  2MPM A;  4KD3 A;  2XSC A;  3GTP B;  1HQM C;  1GJX A;  3CKI B;  4BS9 A;  5D3D A;  2AQ3 B;  4A3D B;  1EY7 A;  4LMQ D;  2DY7 A;  2BE5 D;  1EY9 A;  4LJZ C;  1U4M A;  2VB2 X;  2EY6 A;  1HA6 A;  1BCP D;  3MZ5 A;  3J80 L;  3MC0 B;  4FP5 D;  1BCP F;  4NMZ A;  4O42 A;  2WB1 B;  2NUC A;  3BS1 A;  1EQV A;  1WTW A;  2PZT A;  4K2L A;  5G3L D;  1TR5 A;  1W6K A;  3CHB D;  2LS0 1;  2J7Z A;  5G3L F;  2K01 A;  2MHV A;  4XIG S;  3G6J B;  5K36 H;  2WKC A;  4C3H B;  3TN2 A;  5CV8 A;  3FPP A;  1QG7 A;  3K5M A;  5NUC A;  1F2Y A;  5DAU A;  5FLX L;  4OL7 A;  2BDN A;  3D4W A;  4HTH A;  5LL6 S;  4TSS A;  2F0V A;  1TWA B;  2YYZ A;  1EU4 A;  5EKK A;  1LV9 A;  4DFA A;  4GZY C;  1ML0 D;  1WTR A;  2FHT A;  3OWE B;  1T5E A;  2FMM A;  3NE5 B;  1AEX A;  4WJW A;  1B53 A;  2KOL A;  2J4X A;  4RH6 A;  3RZO B;  4DNT B;  2JEA I;  1GUW A;  5CV9 A;  1LT3 D;  1WTQ A;  2DY8 A;  2Z8L A;  2NB0 A;  1ILP A;  3MA2 B;  1QE6 A;  4B9W A;  3MXG A;  3OWF A;  2R3Z A;  4H7B A;  1YNJ C;  4OIK A;  3RMH A;  2RDH A;  5M5X B;  2KQ3 A;  4H44 C;  1A3U A;  3EFX D;  4NDX A;  1I3Q B;  1LLR D;  1PMR A;  3DHQ A;  2B2U C;  3T16 A;  1Y69 U;  2D5D A;  3M7G A;  3K5N A;  2CQA A;  2LKV A;  4ULL A;  1WTP A;  3H6M A;  4J8Q A;  2CHB D;  2EYP A;  1A6X A;  2M00 A;  4PQX A;  1GUS A;  2IX1 A;  2NWG A;  1M8A A;  4CHT B;  1CM9 A;  3RZD B;  1PFM A;  2PNR C;  4A3M B;  2JA6 B;  4RCN A;  5D65 A;  1XWE A;  3K59 A;  1B3A A;  5C4H A;  2F0I A;  1DD2 A;  1G2S A;  2IJ0 A;  2K32 A;  1E0B A;  4M1U B;  4TQU S;  2L9H A;  1II3 A;  2SNS A;  3D31 A;  4QUC A;  5I6W A;  2EYL A;  1S5B D;  2B2U A;  1KDA A;  2R61 A;  4FXK C;  5KNC A;  4XXE A;  3K6O A;  1LT5 D;  3A55 A;  1SJH D;  3NSW A;  1JE4 A;  3MXU A;  3S16 B;  1V1P B;  2KUM A;  5E4X A;  2FFK B;  3HS0 C;  1KNA A;  1XTC D;  2XN9 C;  3R93 A;  1BXT A;  1OXX K;  2RDG A;  5ELC A;  4ZRZ A;  1K83 B;  5LHY 1;  5K5P A;  1SAP A;  4C2M B;  3C1E A;  4RHS A;  1EZ8 A;  4ZUI A;  5T1G A;  2TMP A;  3J81 L;  3WDN A;  1GUN A;  1EEF D;  1B9M A;  3SR1 A;  4C3J B;  5TSS A;  3VR3 A;  1STY A;  2QKI C;  1SDF A;  1LTA D;  1HCZ A;  1BF4 A;  5CBA E;  3GP7 A;  2F0W A;  2CW0 C;  3S14 B;  2IPK D;  5IT9 E;  2RSO A;  4FVM A;  1ESR A;  1C48 A;  3R3O A;  3TZD A;  1HFG A;  1HTP A;  3SK4 A;  3S1M B;  1V1O A;  2EY1 A;  4L63 B;  1KNE A;  1L0X B;  4KJN A;  2LMC B;  5C0X J;  1PDQ A;  4HMJ A;  4A3I B;  3TP8 A;  1EY5 A;  2F0H A;  5IGF A;  1D1I A;  2NVY B;  1PLF A;  4A3E B;  4G57 A;  1KLU D;  2Z4H A;  4Q0F A;  3ITP A;  3VA5 A;  1F9S A;  5CC4 A;  4A3F B;  3OW7 A;  3L7Z C;  4FXG C;  1I4R A;  1UNS A;  1HUM A;  4OIJ A;  1W6J A;  4EVO A;  1DM0 B;  1I4H A;  4PNY A;  5C0X I;  3H91 A;  4OO1 G;  3H0G B;  1Z47 A;  3OHX C;  1MGS A;  1ICW A;  3TDQ A;  3I73 A;  3T4A C;  5E4W C;  4XQQ A;  4Z9C B;  4A3B B;  1X3Q A;  4KKT A;  1IL8 A;  5KNB A;  4G7O C;  3MEH A;  3C3L A;  1CA5 A;  4RKB A;  1ENC A;  3I4M B;  3ZYY X;  3VYS A;  1PFB A;  2IX0 A;  3NTH A;  2MP1 A;  2PZW A;  3AB9 A;  2HCI A;  4KI0 A;  1ESF A;  1X3P A;  1X32 A;  3QG1 A;  5I2Y A;  3K0Y A;  2KCC A;  2XRS D;  4IUT A;  2IL8 A;  5EPJ A;  4V0B A;  1IKM A;  3G7L A;  4WFN 3;  3V2T A;  3KLR A;  4H13 C;  1I4Q A;  4MIU A;  2RKS A;  3I90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...