4OIKA

(quasi-)racemic x-ray crystal structure of glycosylated chemokine ser-ccl1.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
73
structure length
73
Chain Sequence
SKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords C-C motif chemokine 1
publication title (Quasi-)Racemic X-ray Structures of Glycosylated and Non-Glycosylated Forms of the Chemokine Ser-CCL1 Prepared by Total Chemical Synthesis.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4oikA00
1CA6A 3Q6SA 1WTPA 3P7JA 2L9HA 5CBEE 1NCVA 4CJ2C 4CJ1B 1HFGA 1BNZA 2RSOA 1LV9A 2K01A 1F9SA 4X3KA 5D65A 1RTOA 1A15A 4MHEA 4U68A 5EPKA 3MWYW 1WTQA 1X32A 1B4OA 1MSHA 2MGSA 2EE1A 2B2VA 4ZAIA 3KUPA 2L1BA 3HP3A 4OIJA 1HUNA 5CMDA 1SDFA 3LWEA 1WTRA 1DOLA 2MJ8A 1BBXC 2MP1A 5EJWA 2DY8A 4XT1B 1ICWA 3FDTA 2Q8RE 1VMPA 4LMQD 1C8CA 1EIGA 2B2WA 1ZXTA 1G91A 2JYOA 3ONAB 4X3UA 1B3AA 1F2LA 1QG7A 4HAEA 4QUCA 2X6LA 2JP1A 5T1GA 2HUGA 1NR4A 4RWSC 2KUMA 4XDXA 1B53A 3SVMA 1GUWA 1HFNA 1B50A 1RTNA 1J8IA 4HSVA 1WD0A 1AZQA 1EOTA 4UAIA 2KVMA 1MGSA 1VMCA 2BDNA 2NYZD 1ML0D 1F9RA 1KNAA 2CVRA 4R8IA 1PLFA 2B2YC 2H1EA 2IL8A 1TVXA 2KEDA 1RJTA 1WD1A 1BF4A 1F9QA 1EL0A 1EIHA 1MI2A 2KEEA 2FHTA 1U4MA 3QO2A 3I3CA 5D14A 3D6WA 3FPUB 1G2TA 4O42A 1O7ZA 4IUTA 2J7ZA 4IUPA 4CJ0B 2K1BA 5E4XA 2NZ1D 2X69A 2X6GA 1U4RA 1NR2A 2B2UC 2XIWA 3F2UA 2MPMA 4IURA 2SDFA 1ILQA 2HCIA 1HRJA 2Q8TA 1IKLA 4NW2A 1CA5A 1SSOA 2L11A 1XYIA 2B2TC 1E0BA 5EPJA 5T1IA 1X3QA 3GV3A 1U4PA 2B2UA 1G6ZA 3TN2A 1F9PA 2N88A 5DNFA 3TZDA 3G7LA 1CM9A 5E4WC 5EPLA 1WTWA 2RSNA 1BO0A 2HCCA 5CORA 1J9OA 3I8ZA 2B2TA 3IL8A 4HCSA 4MN3A 2L12A 2D9UA 2FMMA 3DEOA 1AZPA 2KOLA 3GV6A 1B2TA 1JE4A 1DZ1A 1WTVA 1HHVA 4ZLTF 2K05A 2HDMA 2B2YA 1ILPA 2DY7A 4IUUA 4QUFA 2N55A 3H91A 1WVLA 2FINB 1WTOA 4HEDA 1AP0A 4XT3B 3N52A 1PFBA 4IUQA 3IFDA 2FFKB 1PFMA 5AFWA 5EKIA 4ZK9B 1QE6A 2B2VC 2HDLA 1O80A 1M8AA 2K28A 2RA4A 2KECA 2NWGA 1Q3LA 4RA8A 1EQTA 4X3TA 1SAPA 1X3PA 3I91A 4OIKA 4DN4M 1ESRA 2L4NA 1DOMA 1O7YA 4X3SA 5EQ0A 4RAUC 2B2WC 1QNKA 2R3ZA 5CBAE 1KNEA 3DEPA 4IUVA 1JICA 1WTXA 2FJ2A 1HA6A 3KBXA 1G2SA 2K03A 3I90A 2RVLA 3DM1A 1IKMA 2VXWA 2EPBA 5JJZA 4ZKBB 1IL8A 1HUMA 2K04A 1DONA 1DOKA 1U4LA 3R93A 1S4ZA 1MSGA 3MTSA 4R9WA 2M2LA 2EOTA 4ZKCB 1RHPA 1PFNA 1PDQA 5COYA 3UI2A 1XX8A 1NAPA 1RODA
chains in the Genus database with same CATH superfamily
3SK4A 2NVXH 3D3RA 1MBYA 5CBEE 2CWAA 1BCPB 1F9SA 1A63A 3WWVA 5D65A 4DV5Q 4A93B 5M3FB 1YBYA 4AYBB 3S1MB 3OIQA 1YEZA 5C3EB 1FR3A 1SRUA 2KQ3A 1DJRD 4BWGB 1FJGQ 4JV5Q 4KJOA 1DD2A 4GOPB 4P73A 4DNRB 5M3MB 1HTLD 3K7UC 2PO4A 4OHJA 1B3AA 3EROA 1I50B 3CF5A 1MD2D 3T53B 5IE8A 1PH4A 1I4QA 4R4TA 3KBGA 1Y1VG 4UAIA 1MGSA 1NTGA 3P75A 1D7QA 2SNSA 3H6MA 2KEDA 3NWTA 1VQAA 1NNXA 1F77A 2N49A 1VQGA 2A8VA 4B9XA 1V1QA 1RCVD 1X3GA 1LT4D 2E76C 1G2TA 1O7ZA 3CAMA 2ASBA 1IW7C 1VQIA 5DAUA 2X6GA 5A35A 3OHXC 3J80c 1XTDA 1A8VA 5C4XH 2L11A 4M8AA 1QJOA 5JEAH 4X62L 4R1JA 1X3QA 2IJ0A 2R92G 1PMRA 3V96A 4CKEA 4DKAC 4DV2Q 4DXGA 1HR0Q 5EPLA 4DAMA 1QCBD 2EDGA 5CORA 3N6RA 5HURA 1ZEQX 3DEOA 4IPCA 4WORA 3S15H 4DR3Q 1JE4A 3PF5A 1EWHA 2BCOA 3BJUA 3U9OA 4ZUJA 1Y1WB 4BA1I 2C5CA 4Q5VA 1PFBA 4R4IA 4K5VA 3H94A 3HKZB 2EYFA 4DR6L 4BY7H 2B2VC 4KHPQ 4A3BH 3A5ZB 1R4QB 4JI5Q 1QVFA 1D1KA 1VQDA 4A4IA 1UE1A 1PZKD 2YV5A 4C3HH 4X64L 4RKLA 1R9TH 2UUBQ 3DEPA 4IUVA 1T5EA 5CYUA 1LTSD 4QJFA 1QNUA 2F4IA 3WDNA 3BZKA 2F0TA 2B63G 1IKMA 2K04A 1KC8C 2LSSA 1N32Q 1AFPA 1VQKA 1D6EC 4AH6A 2B39A 2KA7A 1PDQA 1SE2A 4L6TB 5CV4A 1CUKA 4C2MH 3OYYA 3CRLC 1CKMA 1L1OA 2RCNA 5LL6X 3LNNA 3M4PA 2K01A 3JAME 2YU9H 3BS1A 4DGZA 4JI7Q 2EIFA 2JA8H 2F0JA 4AQYQ 1H9SB 2WAQB 3HP3A 4Y7NB 3S1RB 2I5MX 1XNQL 3W1BA 1ASZA 2O4XA 3NSWA 4GNXB 3KOJA 1PZJD 5EGTA 3C1FA 2AWNA 2Y0SB 5DLQE 5FLMH 1ZKOA 2XRSD 1MIUA 1RD9D 2UUAL 5ELCA 4KD3A 3J7AF 2G5DA 4RGNA 1DCZA 2CHBD 3CCSA 2Q2TA 1WD1A 3OMGA 2C9OA 1F2ZA 2Q8IB 1QWYA 1H9RA 4KD4A 3QO2A 3D4DA 3JAML 4IUTA 1A3VA 1SYEA 4DV6Q 4PMBA 2K32A 1SEBD 3EQLC 2Q2HA 5CR3A 2A69C 1A3UA 5KYIA 3F2UA 4HJ7A 4YY3L 1M90C 3GTQB 4DV3L 1QB5D 4B3ML 1KRTA 2N8NA 3I4NH 1JQYD 1KL9A 2F3IA 3PUVA 4BY1G 1KQSA 2VZAA 1SE8A 1LT3D 2HCCA 4UPAA 2ATWA 2PZUA 3IL8A 1TIID 1EYGA 1PRTB 3HRZC 4QUFA 1G6ZA 4NMZA 3DWPA 3S2HH 2ZJRA 1SN8A 3K8AA 4JBMA 1S5ED 3L3OC 2WACA 2LMCB 4DR4Q 4NP5A 4Z9CB 4GN3B 2UXBQ 2PZWA 1V43A 4MTNA 4IALA 1D2BA 1JT8A 1HNWL 4A3BG 4DNIA 4ZKBB 2UXDQ 2VUMB 1T9HA 4TKOB 4PZ7A 2QGQA 2UU9L 3A8IE 1PHJA 5IP7G 1Q12A 1KHIA 2DN8A 2XN9C 3VR5A 1UEBA 2PQAA 3EFXD 2H4OA 1YNXA 3UDXA 4A3JH 2E2JH 2VQFL 1KDBA 3CRKC 1XMQL 3W3AA 1X32A 4IO9A 3S16B 1DYQA 1NMFA 3OPOA 1EOVA 3PO3H 1L1OB 2IW3A 4C3IB 2AHOB 1H9MA 1IYJB 5NUCA 3W1GA 4H13C 1LO5D 1U0LA 1B53A 4N9TA 4JI0L 1HFNA 1UE6A 4LUVA 1WD0A 4OELB 3T1YQ 1SMXA 3CW2C 1F9RA 4WJ4A 3TEHB 2B63B 1I3QH 1EIHA 1VDZA 2H5XA 2DGYA 1JJGA 2KBNA 2OTLA 5ELOA 3GO5A 5J3BA 4KMUC 4DAPA 2JK8A 3E6ZX 3CCRA 2G9DA 5ELNA 3T16A 2KENA 2QILA 1O7LA 2B2TC 4XQQA 3VR4A 3PIPA 3S1QH 3E0JA 1BUVT 3KLSA 2HQEA 3F2DA 5DEHA 1BQQT 2OQ0A 3AB9A 1H9KA 3I8ZA 2K7VA 3PO2H 3FKIB 1HHVA 4K0KL 4L63B 4X66L 1B70B 2B2YA 2K5NA 3VYTA 2F0GA 4G57A 3S17H 3AQQA 4XT3B 1BBUA 1U9RA 2IHFA 4K2KA 1IW7D 2UXCL 1OXSC 4A3KG 3HOXB 4A93H 4RA8A 1Q3LA 2Q2IA 5M3FH 2JXMB 1C0AA 1M1KC 3GDEA 5EKKA 3S1MH 1A3TA 3HFZB 5F2DA 2F0DA 1DXMA 4B08A 1YNJD 2QEJC 5C3EH 2L15A 3K59A 3KFUA 4U673 3ITPA 1Q86C 1FGUA 1PZID 4HIOA 2PI2E 4FDBA 2MHVA 1CZGA 4LNQA 3R93A 1EZ8A 3VYSA 1I50H 1Q90A 4LF8L 2M2LA 1LTBD 3C1EA 1LTID 1RHPA 4F88A 2V4DA 5TSSA 5IT9c 4DUZQ 1CA6A 3S2DH 3BVGA 1LT6D 3RR5A 4CJ1B 1VQ7A 1CT1D 4RMFA 2NVYB 3HOUG 1RTOA 1UUPA 1CI3M 4A3DB 4KN4C 2E5LL 5KIXA 2WB1B 1LTTD 2MGSA 1EY8A 2EE1A 2F0MA 1L0WA 5LL6S 1TWAB 1EY0A 2EJGC 2EXDA 4C3JG 1PTOB 1SYCA 4POFA 1CHQD 2PQAB 1ET6A 1EQVA 3GTJB 4HIDA 2B2WA 1GM5A 1WOCA 3ONAB 4HTHA 2G9HD 2SNMA 2HUGA 3D4RA 3MAQA 2JA6H 3CKIB 5LMUL 3H09A 1RIPA 4J8QA 1EOTA 5I4DA 3UE1A 3PIO3 5FJ8H 4J1MA 4LUOA 1EL0A 2F0HA 1E1TA 1FNUA 1TWFB 1C7YA 2A6ED 3AFPA 1IHZA 4B9WA 4KK7A 1YNNC 1WYDA 2J7ZA 3ND9A 4O0AA 2F0QA 5IWAL 4B3RL 3SK8A 5JJIA 3QOJA 5E4WC 3MXNA 4P71A 1EFID 3J81c 2O5IC 4RG1A 1CTMA 1CKNA 1STGA 3GTLB 5LMNQ 3K5NA 3NUCA 1X3FA 4HMJA 5C0XJ 3LX0A 1B44D 3SGIA 4FP5D 1AP0A 3D8GA 2HIVA 3A74A 4QY7A 1D5ZC 4A3IG 1M8AA 3F8TA 1E1OA 2A69D 2NB0A 1AE2A 3WOEA 1GUTA 4G7OC 2VY3A 3TRZA 1DOMA 3STBC 5FO9B 3RMHA 4N9PA 2EYPA 4KKUA 1AE3A 4OEMB 3I90A 1KLGD 1JR0D 1A62A 2Z0SA 2OEOA 3I7FA 1MSGA 4NPSA 3HEJA 3OW7A 4LWCA 2ZM6L 1NAPA 1RODA 4CBVA 4F87A 3W5OA 4GLVB 4WJWA 1TU2B 5C4JH 3K7AB 2F3VA 5FO7B 5M3MG 3M4YA 4JG2A 1NJIC 4XTCS 1EQQA 1IZ6A 4DR2Q 5LMNW 2F3WA 3HOWB 4GKKL 1MSHA 5M5YH 4IFDG 3GQBA 3M4QA 4BBRH 1BVSA 1B9MA 4BXXG 2IHEA 1SYBA 1XPOA 1ICWA 3CPFA 5GAHC 4DV0L 4ZRZA 4A3KB 2ES2A 4JI4L 2NN6G 3GTQH 2JP1A 3HOZG 3QWNA 1BXTA 1C9OA 1HZCA 4MTKA 3UE0A 2NYZD 1N33Q 1I5FA 4B3TL 4FO2A 2IL8A 2D5DA 1JOQA 1K8OA 5JPNC 4G7ZC 2PCFB 4CJ0B 3CHBD 2K1BA 2CH4W 1VS0A 1X54A 3HOUB 2EYLA 4FF1A 4JI1L 1I94L 1SNCA 1Y1WG 1OTCA 3NQTA 2R7ZG 1CSPA 3UDGA 4A3FB 4LFCQ 3J80E 2EZVA 3HKZG 3NE5B 2OF1A 2NUCA 1LM0A 1TR5A 4FXKC 4HMIA 4HCSA 2B2TA 4CKCA 1HH2P 4NDXA 3A8KE 3GV6A 3T56B 1HTPA 3IKJA 2R93B 3D0FA 1WVLA 4KLKA 1KDAA 2R92H 3RZOB 3BYYB 2O5JC 1TQOA 2WINB 1PFMA 4LJZC 5AFWA 4P74A 1EWIA 2ID0A 2TMPA 2IX1A 1LACA 1TY0A 2E2IB 4GS3A 1I4XA 1CKNB 4DUYQ 1SAPA 4IPHA 3A56A 3C3LA 4DR5L 1IBLL 4DV1L 1L0YB 3ERSX 1VQNA 4CDCC 1Y8OB 2A1AA 3M9BA 3J80L 4R8NA 5BN3A 1Q8KA 3T1HQ 4ME5A 1Q8IA 4MIUA 1OXXK 1A2TA 1SFOB 4UDUC 3GTKB 1CSQA 2WFWA 4OL7A 4QF4A 3ICEA 2Y0SG 1Q81C 1ESFA 2B63H 1EU4A 4FYDA 1JOKA 2UUCL 3PGZA 1QUQB 1B4OA 4JBJA 2L1BA 3K80C 2MP1A 3OTOL 2Z6KA 4QIWB 2KCMA 1VQHA 4LF5Q 1AZQA 3PV0A 2WKDA 2ZTCA 3D31A 2XNAC 2EJFC 3NQIA 1TS4A 4R8IA 1GVPA 1N34Q 3TQYA 3VA5A 3FP9A 1KTKA 1E7ZA 4G7HC 5CGKA 3PUXA 3D6WA 4HJ9A 1CKOA 4HJ5A 4LF7Q 2JA5B 2F4VQ 5ELDA 1FJGL 1BOSA 5IY0A 4JV5L 3Q0AA 4OXPA 4EX5A 2B2UC 2DNEA 4OWXB 2Q8TA 2A68C 5FLXc 2BOSA 3JAMi 2PW7A 2RDGA 4CGYB 4LUZA 1K73C 2RSNA 1BO0A 1Y14B 4YIJA 3RN5A 5FK9C 1JMCA 1VCIA 4JI2Q 2JEAI 3HOZB 4H7BA 4DAYA 2EJMA 1EU3A 3U50C 2DY7A 3I72A 1WTOA 3EA6A 4JBKA 4BY1H 1YNND 4GLAC 2VUMG 2NVYH 3B6YA 1LYLA 1SNMA 4QQBX 1JB3A 3CCEA 2D2CC 3HOVB 1XJVA 2QDLA 1YNJC 2PNRC 3CQZB 1VQ5A 1LT5D 3AMUA 1QNKA 1SNDA 3O13A 1HR0L 2Z1CA 1G2SA 4KHZA 3GTJH 1YIJA 3J7YW 3SK5A 4DR3L 3CMEA 3J7AV 1YVCA 1S4ZA 2BA0A 3G4SA 2GVBA 2R7ZB 4EQ5A 3QJYA 2KHIA 1HJPA 4C3IG 1LUZA 3Q6SA 2RF4A 2WKCA 4X62Q 3OOCA 2JE6I 3CCJA 1EY6A 1Q1EA 2RSOA 5AJ3Q 4JI5L 2NTSA 1TWFH 4HR7B 3NBHB 2CH4A 1VQPA 1WTQA 5IYBG 4RKBA 4DR1Q 2UUBL 2B3GA 5IP7H 1SLJA 1EWCA 4OIJA 3PUWA 3STBD 5CMDA 2HHHL 3LWEA 1L2FA 1BBXC 2DUDA 2ZTEA 3FDTA 4LMQD 4R4QA 3VDYA 1N32L 1TXYA 4YHHQ 2A6HC 1UEAB 2FXQA 4HIKA 2Q2UA 3L2PA 4RWSC 3GTOB 1QVCA 1GUWA 4PMWA 3PQIA 2F0VA 4L5QA 3P20A 2XGTA 4FXDA 2KVMA 2BDNA 2NZHA 2IX3A 4X64Q 2NTTA 3C2PA 1PH5A 3FRPB 2EQSA 1YZ6A 2EYJA 3K5LA 2A6EC 3GTLH 1BKBA 3BU2A 4A3LG 3MFGA 3TS2A 4IUPA 3S14B 3U58A 2QDBA 2NZOA 3FKIG 1SYFA 1YI2A 1IKLA 2EYMA 4DXFA 1G291 1TWCB 2OTJA 3A5UA 1VQOA 3GV3A 4UP7A 3SE0A 1ET9A 1HPCA 3HOXG 3Q24A 2PMZE 4AIMA 1PH7A 4CDDC 2L12A 1EYAA 1XMOL 1JWSD 2K05A 1VQEA 4L5RC 1JJ2A 3LGJA 4DV6L 2AKWB 1Z6HA 4IUUA 3IRBA 4JW0A 3BG3A 2UUAQ 2E2HB 3K7AH 3HOWH 3L7ZC 2PYKA 1PH1A 4DAYB 1WTXA 1KNEA 4L8JA 1JICA 2P5ZX 4RH6A 1OXUA 2JA9A 4ID6A 4A3KH 4C1NK 4A3DG 1STNA 4J15A 1X9NA 1JC7A 2WB1G 4UHVA 1WFQA 4OWTB 2MNAA 5COYA 3UI2A 1CQVA 1GKHA 3MA2B 4OWWB 3DXJC 2VW9A 1V8QA 2JEBI 4CJ2C 5JJLA 4DR4L 4AYBE 3VYRA 3E9HA 5EPKA 2UXBL 1PH8A 1JWMD 1JB7A 1YJWA 5JAVA 5ELFA 3HOYG 2WP8J 5C0XG 4OX9L 2MJ8A 4P2CB 1K8MA 2E74C 2UXDL 4DFAA 3HOUH 5IYCG 1EY4A 2F0NA 4KI0A 4YWMA 1QG7A 3A54A 2F0UA 3SEBA 4ALPA 1STEA 2MFIA 1JE5A 1YJNA 4C3JH 1AH9A 2TSSA 4LF9L 1ML0D 4YCUA 1KNAA 1HQMC 1BF4A 2F0LA 5IGFA 3BDOA 2QCPX 5L37A 1TS2A 3FEWX 3RZOH 1RDPD 2XWBB 3A0JA 2UU9Q 3HG9A 4IOCA 2JJQA 1C48A 4LFAQ 1K0RA 1Z9FA 1HZ9A 4KY5A 1AW7A 4IURA 3BVMA 4UP8A 4A3GB 4CDFC 1SSOA 2CW0D 1XYIA 4ULLA 2Z6BA 1HCZA 2I07B 3T1YL 3JC66 2B2UA 1EEFD 2N88A 3ULLA 4K6DA 3MFYA 4NXNL 1EIYB 1CHPD 4HSPA 3RZDB 1AZPA 1DZ1A 1I6VC 4DA2A 1PYSB 3J81E 4GOPC 1ILPA 1SFOH 3GTKH 3HKZE 1Q1BA 3L9AX 4IUQA 1Q46A 2AQ1B 2ZJPA 3MXGA 2RA4A 2BA1A 3VR6A 1NE3A 4E6IA 4PV1C 4DK6C 1LABA 3IAYA 4A75A 2A68D 4JK1C 1O7YA 5EAYA 1SNOA 1WI5A 4Q0FA 1K83B 4A3IH 1QOHA 2YTVA 4LF6L 1P8LA 3HOWG 5A2QE 3A55A 3H0GG 3MTSA 1XPUA 1Q7YC 3C46A 5CV5A 2IY5B 4TRDA 4JI6L 2LY7A 1TWGB 3QOLA 1I4HA 4DR7L 1GHKA 4DV4L 3P7JA 3J81L 2NVXB 3OMCA 1UE7A 3NWSA 4I7AA 4KN7C 2WAQE 1EFWA 1VQ8A 2AMCB 3MZ5A 1PV4A 1N36Q 2B2VA 4ZQ3A 4APVA 5CC4A 2F0SA 2K52A 4KKSA 1PH9A 4K0KQ 1YITA 4B3SL 2Y0SE 2IPKD 3M7GA 5M3MH 1GD7A 1VMPA 3DUZA 4KTAA 1ZXTA 2Z9HA 4X3UA 2X6LA 4NB3A 1HNZQ 2UXCQ 2R7DA 4XDXA 3SVMA 4DUZL 3MC0B 1LTRD 3GP7A 4IFDH 1MHWC 5A2QL 4BXXH 3RUZA 4BBSG 3KYHC 4C56C 3OSOA 1TVXA 2KEEA 2NN6H 3HOZH 1U4MA 5DM63 4A3FG 1E3PA 2BDOA 4DPGA 4O42A 2MUYA 5JOBA 4TVAB 3X3NA 2XSCA 3CU7A 1S3OA 1DGSA 4I7ZC 2VB3X 1F2YA 4K2LA 5J39A 2R93G 1HRJA 1PVOA 2A6HD 2NVQB 3PUYA 4JCVE 2CKZB 3HOYB 3I2ZA 1PFSA 5C4XB 2E5LQ 3BDLA 2R6GA 3K6OA 2B29A 1PH2A 5JJKA 3TP8A 1YHBA 5FKAC 1VQ4A 4LFBL 1Y1WH 4ABNA 2KOLA 4GNXC 5M5WB 5I9PA 1P16A 1HZBA 2R7ZH 3I73A 1ENFA 2CWPA 4BA2I 4OGQC 3V05A 1VQCA 4JYAQ 2KECA 1S40A 5K36G 2BE5C 4X3SA 1J5EQ 4IJHA 3H3VH 1E22A 4PQXA 3MHBA 2FJ2A 1HA6A 3D4WA 3NTIA 4FXGC 4C3HB 1R9TB 5CV9A 3BVZA 1HNXL 4JOIC 3NELA 4PMCA 1TWHB 2YTXA 2JA7G 2EOTA 5JEAJ 1PFNA 3KJOA 3TP6A 4YWKA 5ELEA 3TDQA 5C6AA 1CK1A 2D0PA 4B3RQ 2LFNA 3TP5A 1V1PA 4DV7Q 4EQNA 5C44G 5BN5A 1SR3A 2DJGC 1EUJA 3J80i 5M5XB 2VQEL 1TS5A 1I4PA 3MWYW 4GKJQ 3S1RH 4Y7NH 3DM3A 2I46A 4UY8C 4ZAIA 4NXML 3E5SA 1EY5A 1EYDA 3S14H 1BCPF 4A3MG 2Q8RE 4IFDI 1RF2D 2EY6A 2CQAA 5J1ZA 4EGVA 1XNRL 1F2LA 2N3SA 4JVZA 5T1GA 1UAPA 2JA5G 3CPWA 1TWCH 2VB2X 1B50A 2IT1A 2NN6I 5D3DA 4LF4L 1VMCA 4C1NI 4IPGA 3NXWA 1EEID 4DR2L 1PLFA 2H1EA 5IGCA 2R61A 5IODA 3I4LA 2OWOA 1TS3A 3NENA 3FPPA 3H0GB 4KHVA 1B7YB 4A3CG 2A19A 4CDEC 1IBMQ 2ZXOA 2J4XA 1PXUA 1UWVA 4XYQA 2ZM6Q 2NZ1D 1IYVA 2X69A 1SJED 4JI3L 3BZDB 3K0YA 3NK9A 1IBKL 3KF6A 1VQMA 2HQLA 1N33L 5FLXE 1VF5C 4GKKQ 1S5DD 4RFBA 4IUNA 3HOVG 2K5HA 4MN3A 1FL0A 5DM73 3UDFA 4EVOA 1IXRA 5JVG3 2LXJA 2MQHA 1ASYA 3H91A 1NSNS 3NTHA 2FFKB 2F0EA 4BBSB 3H3VI 2VS1A 1MJEA 4DK3C 2K5VA 2NWGA 4B3TQ 2GVAA 1TT2A 4LFCL 1C4QA 4FF3A 1Z7TA 1BCPD 4LAAA 2R3ZA 1QILA 1SE3A 4ILWA 4V0BA 1UE5A 3TZUA 1FNVA 3CMAA 1A2UA 2VUMH 3I4OA 3TSSA 2RQXA 2RVLA 3U9SA 4X65Q 3AYHB 3DMUA 5FLXL 2RCFA 5JVH3 2K14A 5BR8Q 3M85A 3TS0A 5BN4A 2OXPA 3CCVA 1JCKB 1H9JA 3MXNB 4HJ8A 2HIXA 1A0IA 1HFGA 4DUYL 3BDCA 2K5DA 3S16H 2WB1E 2E2JB 4MHEA 4A3EG 3NBIA 1SXTA 3TBIB 3QB3A 4P75A 3A7LA 3GTGB 4C3IH 1B1ZA 3KLRA 2DY8A 2F03A 3D6CA 1EIGA 1NMGA 3U4ZA 1S5FD 4HAEA 1X6OA 4A3GH 3UDIA 5IYBH 1NR4A 2MO0A 5I2YA 1QZHA 4N8X1 4O2DA 1D8LA 4DR5Q 4DV1Q 4A76A 2I5HA 1I6HB 3RZDH 4JI8L 2JN4A 1YHAA 4J6HA 2JA7B 4K6LA 3S1NB 3PIOA 3NEMA 4K14A 3X3MA 3AEVA 1JJCB 5CV7A 5C44B 1PYBA 2VNUD 2XIWA 3ERQA 2CW0C 4H02A 4ME3A 4GZYC 1ILQA 4A3LH 1CA5A 1E0BA 4X6AH 1IL2A 2EXZA 4LF5L 1WCMG 2ICEC 1ZYRC 3MXUA 3TN2A 3ULPA 1F9PA 2K4KA 2OT2A 4DV5L 3GTMB 4A3MB 1N34L 3ZJYC 1SBBB 3FKIH 1S5BD 4KY6A 1TKWB 2D9UA 4ZLTF 4LF7L 2LS01 2F4VL 3PO2B 4QL5A 1H9SA 4K5WA 1TWGH 1FYCA 1XWEA 3HOXH 3IFDA 4XQJA 5HGTA 4ZK9B 1KABA 4GNXA 3S17B 1N8RC 1QE6A 2HDLA 2F1MA 2JQOA 3QR8A 1EQTA 3I55A 4OO1G 1PRTF 3M7NA 1L0XB 4RGMA 2PI2A 4L5TA 1NY4A 1SROA 4H0LC 2RDFA 4JPBW 2KHSA 3URYA 3OW2A 2NVTB 4XQNA 4JI2L 1DOKA 1SNQA 4DU9A 5C5MA 2F0KA 3HS0C 3SR1A 2YYZA 1Q82C 3I4MG 1XX8A 4ZYSA 3K0XA 4JOIA 3Q8DA 1NUCA 3S2DB 1H95A 1DM0B 1NCVA 3PMFA 4A3DH 2CCZA 1SYDA 1TWAH 2BE5D 5CV8A 1CZWA 1PTOH 1GHJA 4DV2L 4HIMA 3KUPA 3M4OB 1SDFA 1N9WA 1F2MA 2D0OA 1LTGD 3EVQA 3OWEB 3E3XA 2NVQH 5KNDA 3FMCA 3HOYH 1GXDC 2JA6B 2BH2A 1JWUD 4FNFA 4KHPL 5C0XH 1X56A 2XVSA 5AJ3L 4PNYA 2B2YC 3IFTA 5IYCH 2DJFC 4A3GG 2N78A 4DR1L 3DWQA 5M5WH 3I3CA 1XXGA 4QMGA 3T51B 5KGUA 3KLSX 3HKSA 3NPPA 4IFDJ 2R7FA 2K75A 5IP9H 2KHJA 4YHHL 1PRTD 1U4RA 5GQOA 5HGQA 3PIP3 2ENBA 4DR6Q 2HCIA 4ODGA 4A3EB 3VR3A 2Z4IA 2ZXRA 5JPMC 1STBA 2F0IA 2HHHQ 4JI7L 2C35B 1A6XA 4AQYL 3GD7A 1TWHH 5GAEC 1D5XC 1OXVA 2EY5A 3PUZA 5EBDA 4HEDA 1S72A 3EBEA 5M5XH 1HR0W 1W3SA 3CCUA 1V9PA 2F0OA 3KLWA 1VQ6A 4X3TA 3SK6A 3M3YB 2QW7A 1EIFA 2B2WC 3WOFA 1XNQQ 2E8GA 3I56A 2M9VA 1VQJA 2VXWA 2ZJQA 2NBFA 2RDHA 4DK0A 1D5MC 1WCMB 2LKVA 2QF7A 1HXYD 1M4VA 1WTPA 2MO1A 1ENAA 1BNZA 5C4JB 4R4OA 4NKLA 4K8IA 2AWOA 3HGBA 1Y8NB 3ZYYX 3H0GH 1EY9A 4WFN3 2AUJD 2K5QA 1XMOQ 4LK1C 5M5YB 4QIWE 1BDOA 2LXKA 3TMEA 5GADC 4BBRB 4MNOA 4K8JA 3J81i 1PA6A 1O78A 3KDFA 4I65A 3RLOA 5C0XI 3AU7A 1E2VA 3CCMA 5EKLA 2EY1A 4YY3Q 3VA7A 1PTOF 1QZGA 1T5XD 4DV3Q 3RN2A 4B3MQ 3I70A 1MJCA 3NHHA 3PF4A 4WJ3M 4HSVA 3U4VA 1GUNA 5IT9E 2CVRA 2XTIA 2XWJB 4Y52H 1ONLA 1VQFA 5C4XG 4GN4B 4JC0A 2K50A 5JEAG 3I4MB 3EJIA 1X3EA 1FVIA 5E4XA 5J22A 4F8MA 1Y1VB 4BBSH 1I4RA 4RHRA 1NR2A 3G48A 4ZUIA 2MPMA 2SDFA 3EIVA 4CKBA 2F0WA 2A5HA 4A3FH 1B8AA 5I6YA 5EPJA 5C3WA 2KCCA 5IP9G 2XRQD 1Z47A 1CM9A 1WTWA 3SDZA 4BY7G 4OX9Q 1Y8PB 1KIXA 1J9OA 1HNWQ 2FMMA 2R93H 2JSOA 2KCTA 5IT9L 2GA4B 1YHQA 2HDMA 2CQOA 4C3HG 4XIGS 1SMYC 2FINB 4LFAL 4XYOA 3ND8A 3CC7A 2R92B 5EKIA 2E2IH 2B8GA 4HCEA 3R2TA 4PZ6A 1O80A 2SOBA 4LF9Q 2VQFQ 3DWAA 4HJAA 1XMQQ 1BCPC 4DN4M 1GUOA 3K5MA 3GTGH 3Q22A 2YTYA 1VF7A 1ZYRD 4HN7A 5HY6A 3F2CA 2HD3A 4P72A 5JJZA 4JBWA 1PTOD 5K36H 1LTAD 4WRDA 5ISRA 2JA8G 4ZKCB 3GTPB 4QB4A 1EY7A 3JAMc 4JI0Q 5KRUA 2K5WA 1K3RA 1O7IA 1RKNA 3MVVA 1GJXA 3S24A 1SNPA 2VL6A 1KAWA 2DNCA 4FVMA 3CXCA 1I6HH 5FLMG 2JA7H 1KD1C 4NXNQ 1BR9A 3S1NH 4PZ8A 3W2DA 1STHA 4G4KA 2A74C 3F1ZA 3CCLA 4QCLA 1GO3E 2AQ2B 1R4PB 1VQ9A 4V190 1S5CD 3LWUA 5C44H 2SEBD 1G6PA 1C8CA 3QIAA 2L0CA 3A8JE 4M1UB 2GN5A 3OWFA 1U5KA 5C3XA 1J8IA 3GTMH 5IGBA 4A3MH 1B9NA 4FF4A 3J7ZC 1RJTA 1F9QA 3BYTB 3KDFB 3CCQA 1N36L 3TREA 2QA4A 2JA5H 4MZ9A 1OO9B 5G3LF 3FHWA 3MEHA 4LF6Q 4GN5A 2I0QA 3I4NG 4X66Q 1JORA 2EYOA 4KKTA 3A7AB 4JI6Q 1NBWA 3CC2A 4DR7Q 1HNZL 4DV4Q 1KRSA 2Z4HA 5IOCA 4EQOA 4F7XA 3PCOB 2PZTA 5T1IA 4A3CH 1SJHD 1STYA 5KEEA 1EYCA 2NVTH 5M9OA 3G7LA 3KF8A 3NP8A 4DF7A 3H3VC 3G71A 4B3SQ 1AEXA 4RGTA 3K81C 4IN3A 4IJLA 4OONA 4LF8Q 2RBMA 3T4AC 4CHTB 2N55A 3VYUA 2ZXPA 4KV6A 4BY1B 3PSIA 5I2XA 3HOVH 2K28A 4KJNA 3CQZH 2KJXA 4OIKA 3I91A 1ESRA 2L4NA 2B8FA 3CP0A 2Z6KC 3M4OH 1CQFA 1X55A 4BS9A 2Z8LA 3QG1A 5ELBA 2BH8A 3DLLA 1K3BC 2M00A 2ZTDA 4A3JG 3DM1A 5FOBB 1HUMA 2PW5A 1Y69U 2ZT9C 4TSSA 3RNUA 3S15B 1II3A 1ICFB 2E75C 3ER0A 5LMUQ 1STAA 3PO3G 2L9HA 4JYAL 1LV9A 1G51A 1TY2A 4DK1A 4BY7B 4RCNA 1QVGA 3H15A 5G3LD 1A15A 5IIFA 4A3BB 1J5EL 2ALYB 1GUGA 4LFBQ 5GROA 2PQEA 4IQZA 1DOLA 1E2ZA 1EQRA 1KLUD 5LMNL 1EZ6A 3R8BA 5E3FA 1XPRA 3GTOH 4A3EH 5KNCA 1FNWA 5IWAQ 2KUMA 4S3SA 5IYDH 1MKHA 4C2MB 3DHQA 1RTNA 5EBCA 4DV7L 2EY2A 3MEFA 1RL2A 4GKJL 1K28A 1KDCA 2YU9B 1XTCD 2FHTA 1HNXQ 2EYHA 4UP9A 5D14A 2JA8B 2AQ3B 3FPUB 1D1IA 1GOZA 4YCVA 4GLXA 4YWLA 1PRTC 2A73B 1FGBD 2K33A 2WV6D 5GAGC 3PO2G 2RHQB 4R4CA 4NW2A 1B3QA 5IGGA 3M3YH 2VQEQ 3CD6A 1K8AC 3SHLA 4PG3A 1U4PA 2FMCA 4XXEA 5DNFA 4L5SA 2RKSA 3T13A 1LTLA 4NXMQ 5IGDA 5D3IB 4A93G 5M3FG 1CFMA 3CC4A 1SYGA 4AYBG 1IBML 1QUQA 3ULJA 2E2HH 1XNRQ 1KAAA 1WCMH 5C3EG 2WIIB 3TP7A 4RCOA 3KF8B 3FVQA 1GUSA 3K57A 2I5LX 4K5XA 4LF4Q 1HZAA 5E1FA 4EQPA 1SE4A 1X65A 1V1OA 1LLRD 5KNBA 3F2BA 4RAUC 3I4NB 4LW1A 5CBAE 2L55A 3KBXA 2L5TA 4IPDA 1OXTA 1J6QA 1YJ9A 1IL8A 1L1OC 3RD4A 4DV0Q 1U4LA 4OO1H 3BZCA 1UNSA 4JI4Q 5CV6A 4JI3Q 5FO8B 5C5LA 1SMYD 3S2HB 1IBKQ 1VQLA 4GOPA 4IZ8A 4X3KA 2KCNA 5LHY1 4U68A 2PPBC 2JA6G 4POGA 3I4MH 2HT1A 1HUNA 3V2TA 5C4ZA 1WTRA 5E7NA 5C4HA 5EJWA 1Y1VH 2RHSB 4XT1B 4X65L 3E0EA 3RLNA 5FJ8G 3AFQA 4DNTB 4QGUA 1G91A 2JYOA 1AN8A 2E2DC 2F0PA 4QUCA 4JI1Q 5BR8L 1I94Q 1I4GA 5K5PA 1IYUA 3KK7A 1G8ZD 3EN2A 3KJPA 1KXLA 1HQRD 4C3JB 4H44C 4A3JB 3S9WA 4N8FA 3NTKA 1MI2A 3MXPA 2OCEA 5IYDG 2F52A 1FD7D 2O2LD 2QEXA 1V1PB 4FF2A 5I6WA 3L0OA 3G6EA 3PO3B 3T1HL 5I9OA 2EVBA 4DAVA 4O1NA 1VQBA 4ZCKA 2D62A 4IOAA 1JOOA 3R3OA 5KYLA 1K9MC 1HA5A 1K8GA 1IBLQ 2CFMA 3TZDA 1W6KA 2OQKA 5IGEA 3R2IA 1PH3A 1I3QB 4RHSA 2PMZB 1B2TA 1WTVA 3NBHA 3GTPH 3E9IA 2ICIA 2WAQG 3RLFA 1K0SA 2J0TD 5H1SE 3N52A 3SXHA 3P1HA 2PNHA 3OIPA 2IX0A 2AUKA 3Q23A 1PH6A 4RGOS 1BBWA 1ENCA 1X3PA 1E24A 3J81j 2UUCQ 5EQ0A 3G6JB 4JI8Q 2F0FA 4OO1I 1E2WA 2K6AA 1K83H 3S1QB 1WTHA 2V1CC 4YCWA 2K03A 2IWHA 3J7A5 1PTOC 3OTOQ 1DONA 2EPBA 1WJJA 3K58A 1W6JA 1PYWD 4TQUS 4A3IB 4R9WA 3K5OA 1W2BA 4KY7A 3KF6B 3HZXA 3VR2A 4BBRG 2QKIC
chains in the Genus database with same CATH topology
3SK4A 3D3RA 1MBYA 5CBEE 1BCPB 1F9SA 5D65A 4A93B 5M3FB 4AYBB 3S1MB 3OIQA 5C3EB 1FR3A 2KQ3A 1DJRD 4BWGB 4KJOA 1DD2A 5M3MB 4DNRB 1HTLD 2PO4A 4OHJA 1B3AA 3EROA 1I50B 1MD2D 3T53B 1I4QA 3KBGA 4UAIA 1MGSA 3P75A 2SNSA 3H6MA 2KEDA 3NWTA 1F77A 4B9XA 1RCVD 1LT4D 2E76C 1G2TA 1O7ZA 1IW7C 5DAUA 2X6GA 5A35A 3OHXC 2L11A 4M8AA 1QJOA 5JEAH 1X3QA 2IJ0A 1PMRA 3V96A 4CKEA 4DXGA 5EPLA 1QCBD 2EDGA 5CORA 3N6RA 5HURA 1ZEQX 3DEOA 4WORA 1JE4A 1EWHA 2BCOA 3U9OA 4ZUJA 1Y1WB 4BA1I 2C5CA 4Q5VA 1PFBA 4K5VA 3H94A 3HKZB 2EYFA 2B2VC 1R4QB 1D1KA 1PZKD 4RKLA 3DEPA 4IUVA 1T5EA 5CYUA 1LTSD 1QNUA 2F4IA 3WDNA 2F0TA 1IKMA 2K04A 1AFPA 1D6EC 2B39A 2KA7A 1PDQA 1SE2A 4L6TB 5CV4A 3CRLC 5LL6X 3LNNA 2K01A 3JAME 3BS1A 4DGZA 2F0JA 1H9SB 2WAQB 3HP3A 4Y7NB 3S1RB 2O4XA 3NSWA 1PZJD 5EGTA 3C1FA 2AWNA 2Y0SB 1ZKOA 2XRSD 1RD9D 5ELCA 4KD3A 3J7AF 4RGNA 1DCZA 2CHBD 1WD1A 3OMGA 2C9OA 1F2ZA 2Q8IB 1QWYA 1H9RA 4KD4A 3QO2A 3D4DA 3JAML 4IUTA 1A3VA 1SYEA 4PMBA 2K32A 1SEBD 3EQLC 5CR3A 2A69C 1A3UA 5KYIA 3F2UA 3GTQB 1QB5D 1JQYD 3PUVA 1LT3D 2HCCA 2PZUA 3IL8A 1TIID 1PRTB 3HRZC 4QUFA 1G6ZA 4NMZA 3DWPA 1S5ED 3L3OC 2WACA 2LMCB 4NP5A 4Z9CB 2PZWA 1V43A 4IALA 1D2BA 4ZKBB 2VUMB 4TKOB 3A8IE 1Q12A 2DN8A 2XN9C 3VR5A 3EFXD 2H4OA 1KDBA 3CRKC 3W3AA 1X32A 3S16B 1DYQA 3OPOA 2IW3A 4C3IB 1H9MA 5NUCA 4H13C 1LO5D 1B53A 4N9TA 1HFNA 1WD0A 1F9RA 2B63B 1EIHA 1VDZA 3GO5A 4KMUC 4DAPA 3E6ZX 2G9DA 3T16A 2QILA 1O7LA 2B2TC 4XQQA 3VR4A 3E0JA 1BUVT 3KLSA 2HQEA 5DEHA 1BQQT 3AB9A 1H9KA 3I8ZA 2K7VA 3FKIB 1HHVA 4L63B 2B2YA 3VYTA 2F0GA 4G57A 4XT3B 1U9RA 4K2KA 1IW7D 1OXSC 3HOXB 4RA8A 1Q3LA 2JXMB 5EKKA 1A3TA 5F2DA 2F0DA 1DXMA 4B08A 1YNJD 2QEJC 3K59A 4U673 3ITPA 1PZID 2MHVA 1CZGA 3R93A 1EZ8A 3VYSA 1Q90A 2M2LA 4F88A 1LTBD 3C1EA 1LTID 1RHPA 2V4DA 5TSSA 1CA6A 3BVGA 1LT6D 4CJ1B 1CT1D 2NVYB 1RTOA 1UUPA 1CI3M 4A3DB 4KN4C 5KIXA 2WB1B 1LTTD 2MGSA 1EY8A 2EE1A 2F0MA 5LL6S 1TWAB 1EY0A 2EJGC 4C3JG 1PTOB 1SYCA 1CHQD 1ET6A 1EQVA 3GTJB 2B2WA 3ONAB 4HTHA 2G9HD 2SNMA 2HUGA 3D4RA 3MAQA 3CKIB 3H09A 4J8QA 1EOTA 5I4DA 3PIO3 4J1MA 1EL0A 2F0HA 1FNUA 1TWFB 2A6ED 1IHZA 4B9WA 4KK7A 1YNNC 2J7ZA 3ND9A 2F0QA 3SK8A 3QOJA 5E4WC 3MXNA 2O5IC 1EFID 1CTMA 1STGA 3GTLB 3K5NA 3NUCA 4HMJA 5C0XJ 3LX0A 1B44D 1AP0A 4FP5D 3D8GA 1D5ZC 1M8AA 2A69D 2NB0A 3WOEA 1GUTA 4G7OC 1DOMA 5FO9B 3RMHA 4N9PA 2EYPA 4KKUA 3I90A 1KLGD 1JR0D 2OEOA 1MSGA 3HEJA 3OW7A 1NAPA 4F87A 4CBVA 1RODA 4WJWA 1TU2B 3K7AB 2F3VA 5FO7B 3M4YA 4XTCS 2F3WA 3HOWB 1MSHA 4IFDG 3GQBA 1B9MA 1SYBA 1ICWA 4ZRZA 4A3KB 2NN6G 2JP1A 3QWNA 1BXTA 2NYZD 4FO2A 2IL8A 2D5DA 1JOQA 1K8OA 5JPNC 4G7ZC 2PCFB 4CJ0B 3CHBD 2K1BA 3HOUB 2EYLA 4FF1A 1SNCA 3NQTA 4A3FB 3J80E 2EZVA 3NE5B 2OF1A 2NUCA 1TR5A 4FXKC 4HMIA 4HCSA 2B2TA 4CKCA 4NDXA 3A8KE 3GV6A 3T56B 1HTPA 3IKJA 2R93B 1WVLA 1KDAA 3RZOB 3BYYB 2O5JC 1TQOA 2WINB 1PFMA 4LJZC 5AFWA 2ID0A 2TMPA 2IX1A 1LACA 1TY0A 2E2IB 1I4XA 1SAPA 3A56A 3C3LA 1L0YB 1Y8OB 3J80L 4R8NA 5BN3A 4ME5A 1Q8IA 4MIUA 1OXXK 1A2TA 1SFOB 4UDUC 3GTKB 4OL7A 4QF4A 1ESFA 1EU4A 4FYDA 1JOKA 1B4OA 2L1BA 2MP1A 4QIWB 1AZQA 3PV0A 2WKDA 3D31A 2XNAC 2EJFC 3NQIA 1TS4A 4R8IA 3VA5A 1KTKA 4G7HC 5CGKA 3PUXA 3D6WA 2JA5B 5ELDA 1BOSA 3Q0AA 2B2UC 2DNEA 2Q8TA 2A68C 2BOSA 2PW7A 2RDGA 4CGYB 2RSNA 1BO0A 4YIJA 5FK9C 1VCIA 2JEAI 3HOZB 4H7BA 4DAYA 2EJMA 1EU3A 2DY7A 3I72A 1WTOA 3EA6A 1YNND 1SNMA 1JB3A 2D2CC 3HOVB 1YNJC 2PNRC 3CQZB 1LT5D 3AMUA 1QNKA 1SNDA 3O13A 2Z1CA 1G2SA 4KHZA 3J7YW 3SK5A 3J7AV 1S4ZA 2BA0A 2R7ZB 3QJYA 4C3IG 3Q6SA 2WKCA 3OOCA 2JE6I 1EY6A 1Q1EA 2RSOA 2NTSA 4HR7B 1WTQA 4RKBA 1EWCA 4OIJA 3PUWA 5CMDA 3LWEA 1BBXC 3FDTA 4LMQD 2A6HC 1UEAB 4RWSC 3GTOB 1GUWA 4PMWA 2F0VA 3P20A 4FXDA 2KVMA 2BDNA 2IX3A 3C2PA 2NTTA 3FRPB 2EYJA 3K5LA 2A6EC 3MFGA 4IUPA 3S14B 2QDBA 1SYFA 1IKLA 2EYMA 4DXFA 1G291 1TWCB 3GV3A 3SE0A 1ET9A 1HPCA 3Q24A 2L12A 1EYAA 1JWSD 2K05A 1Z6HA 4IUUA 3BG3A 2E2HB 3L7ZC 2PYKA 1WTXA 1KNEA 4L8JA 1JICA 4RH6A 1OXUA 4ID6A 4C1NK 1STNA 1JC7A 5COYA 3UI2A 1CQVA 3MA2B 3DXJC 1V8QA 2JEBI 4CJ2C 3VYRA 5EPKA 1JWMD 5JAVA 5ELFA 2WP8J 5C0XG 2MJ8A 4P2CB 1K8MA 2E74C 4DFAA 1EY4A 2F0NA 4KI0A 1QG7A 3A54A 2F0UA 3SEBA 1STEA 2TSSA 1ML0D 1KNAA 1HQMC 1BF4A 2F0LA 5IGFA 3BDOA 2QCPX 1TS2A 3FEWX 1RDPD 2XWBB 3HG9A 1C48A 4KY5A 1AW7A 4IURA 3BVMA 4A3GB 1SSOA 2CW0D 1XYIA 4ULLA 1HCZA 2I07B 2B2UA 1EEFD 2N88A 4K6DA 3MFYA 1CHPD 4HSPA 3RZDB 1AZPA 1DZ1A 1I6VC 4DA2A 3J81E 1ILPA 1Q1BA 3L9AX 4IUQA 2AQ1B 3MXGA 2RA4A 2BA1A 3VR6A 4E6IA 4PV1C 1LABA 3IAYA 2A68D 4JK1C 1O7YA 1SNOA 4Q0FA 1K83B 1QOHA 5A2QE 3A55A 3MTSA 3C46A 5CV5A 4TRDA 2LY7A 1TWGB 3QOLA 1I4HA 1GHKA 3P7JA 3J81L 2NVXB 3OMCA 3NWSA 4KN7C 3MZ5A 2B2VA 4ZQ3A 5CC4A 2F0SA 4KKSA 2IPKD 3M7GA 1VMPA 3DUZA 4KTAA 1ZXTA 4X3UA 2X6LA 4XDXA 3SVMA 3MC0B 1LTRD 3GP7A 4IFDH 5A2QL 3RUZA 4C56C 3OSOA 1TVXA 2KEEA 2NN6H 1U4MA 5DM63 2BDOA 4O42A 2MUYA 5JOBA 3X3NA 2XSCA 3CU7A 4I7ZC 2VB3X 1F2YA 4K2LA 5J39A 1HRJA 2A6HD 2NVQB 3PUYA 5C4XB 3HOYB 3BDLA 2R6GA 3K6OA 3TP8A 5FKAC 4ABNA 2KOLA 5M5WB 5I9PA 3I73A 1ENFA 4BA2I 4OGQC 3V05A 2KECA 5K36G 2BE5C 4X3SA 4PQXA 3MHBA 2FJ2A 1HA6A 3D4WA 3NTIA 4FXGC 4C3HB 1R9TB 5CV9A 3BVZA 4PMCA 1TWHB 2EOTA 5JEAJ 1PFNA 3TP6A 5ELEA 3TDQA 5C6AA 1CK1A 2LFNA 3TP5A 1V1PA 4EQNA 5BN5A 5M5XB 1TS5A 1I4PA 3MWYW 2I46A 4ZAIA 3E5SA 1EY5A 1EYDA 1BCPF 2Q8RE 4IFDI 1RF2D 2EY6A 2CQAA 5J1ZA 4EGVA 1F2LA 5T1GA 1UAPA 2VB2X 1B50A 2IT1A 2NN6I 5D3DA 1VMCA 4C1NI 3NXWA 1EEID 1PLFA 2H1EA 5IGCA 2R61A 5IODA 3I4LA 1TS3A 3FPPA 3H0GB 4KHVA 2ZXOA 2J4XA 1PXUA 4XYQA 2NZ1D 1IYVA 2X69A 1SJED 3BZDB 3K0YA 3NK9A 5FLXE 1VF5C 1S5DD 4RFBA 4IUNA 4MN3A 5DM73 4EVOA 5JVG3 3H91A 1NSNS 3NTHA 2FFKB 2F0EA 4BBSB 2NWGA 1TT2A 1C4QA 4FF3A 1Z7TA 1BCPD 4LAAA 2R3ZA 1QILA 1SE3A 4ILWA 4V0BA 3TZUA 1FNVA 1A2UA 3TSSA 2RQXA 2RVLA 3U9SA 3DMUA 5FLXL 5JVH3 3M85A 5BN4A 2OXPA 1JCKB 1H9JA 1HFGA 3BDCA 2K5DA 2E2JB 4MHEA 3NBIA 1SXTA 3TBIB 3QB3A 3GTGB 3A7LA 1B1ZA 3KLRA 2DY8A 2F03A 3D6CA 1EIGA 1S5FD 4HAEA 1NR4A 5I2YA 1I6HB 4J6HA 2JA7B 4K6LA 3S1NB 3X3MA 4K14A 5CV7A 5C44B 2VNUD 2XIWA 3ERQA 2CW0C 4GZYC 1ILQA 1CA5A 1E0BA 2EXZA 2ICEC 1ZYRC 3MXUA 3TN2A 1F9PA 2OT2A 3GTMB 4A3MB 1SBBB 1S5BD 4KY6A 1TKWB 2D9UA 4ZLTF 2LS01 3PO2B 1H9SA 4K5WA 1FYCA 1XWEA 3IFDA 4XQJA 5HGTA 4ZK9B 1KABA 3S17B 1QE6A 2HDLA 2F1MA 1EQTA 4OO1G 1PRTF 3M7NA 1L0XB 4RGMA 4H0LC 2RDFA 2KHSA 3URYA 2NVTB 4XQNA 1DOKA 1SNQA 4DU9A 5C5MA 2F0KA 3HS0C 3SR1A 2YYZA 1XX8A 4ZYSA 1NUCA 3S2DB 1DM0B 1NCVA 3PMFA 1SYDA 2BE5D 5CV8A 1CZWA 1PTOH 1GHJA 3KUPA 3M4OB 1SDFA 1F2MA 1LTGD 3EVQA 3OWEB 5KNDA 3FMCA 1GXDC 2JA6B 1JWUD 4FNFA 5C0XH 2XVSA 4PNYA 2B2YC 3IFTA 3DWQA 3I3CA 1XXGA 4QMGA 3T51B 5KGUA 3KLSX 3NPPA 4IFDJ 1PRTD 1U4RA 3PIP3 2ENBA 2HCIA 4ODGA 4A3EB 3VR3A 2Z4IA 2ZXRA 5JPMC 1STBA 2F0IA 1A6XA 3GD7A 1D5XC 1OXVA 2EY5A 3PUZA 5EBDA 4HEDA 2F0OA 4X3TA 3SK6A 3M3YB 2B2WC 3WOFA 2M9VA 2VXWA 2NBFA 2RDHA 4DK0A 1D5MC 1WCMB 2LKVA 2QF7A 1HXYD 1M4VA 1WTPA 1ENAA 1BNZA 5C4JB 4NKLA 4K8IA 2AWOA 3HGBA 1Y8NB 3ZYYX 1EY9A 4WFN3 2AUJD 2K5QA 4LK1C 5M5YB 1BDOA 3TMEA 4BBRB 4K8JA 1O78A 4I65A 5C0XI 3AU7A 1E2VA 5EKLA 2EY1A 3VA7A 1PTOF 1T5XD 3I70A 3NHHA 4HSVA 1GUNA 5IT9E 2CVRA 2XWJB 1ONLA 5JEAG 3I4MB 3EJIA 5E4XA 5J22A 4F8MA 1Y1VB 1I4RA 4RHRA 1NR2A 4ZUIA 2MPMA 2SDFA 4CKBA 2F0WA 2A5HA 5I6YA 5EPJA 5C3WA 2KCCA 2XRQD 1Z47A 1CM9A 1WTWA 3SDZA 1Y8PB 1J9OA 2FMMA 2JSOA 5IT9L 2GA4B 2HDMA 4C3HG 4XIGS 1SMYC 2FINB 4XYOA 3ND8A 2R92B 5EKIA 2B8GA 4HCEA 3R2TA 1O80A 2SOBA 3DWAA 1BCPC 4DN4M 1GUOA 3K5MA 3Q22A 1VF7A 1ZYRD 4HN7A 5JJZA 4JBWA 1PTOD 5K36H 1LTAD 4WRDA 5ISRA 4ZKCB 3GTPB 4QB4A 1EY7A 5KRUA 2K5WA 1RKNA 3MVVA 1GJXA 1SNPA 2DNCA 4FVMA 1BR9A 3W2DA 1STHA 4G4KA 2A74C 4QCLA 2AQ2B 1R4PB 4V190 1S5CD 3LWUA 2SEBD 1C8CA 3QIAA 2L0CA 3A8JE 4M1UB 3OWFA 5C3XA 1J8IA 5IGBA 1B9NA 4FF4A 1RJTA 1F9QA 3BYTB 1OO9B 5G3LF 3MEHA 1JORA 2EYOA 4KKTA 3A7AB 2Z4HA 5IOCA 4EQOA 4F7XA 2PZTA 5T1IA 1SJHD 1STYA 5KEEA 1EYCA 5M9OA 3G7LA 3KF8A 3NP8A 4DF7A 3H3VC 1AEXA 4RGTA 4IN3A 2RBMA 3T4AC 4CHTB 2N55A 3VYUA 2ZXPA 4KV6A 4BY1B 5I2XA 2K28A 4KJNA 2KJXA 4OIKA 3I91A 1ESRA 2L4NA 2B8FA 1CQFA 4BS9A 2Z8LA 3QG1A 5ELBA 2M00A 3DM1A 5FOBB 1HUMA 2PW5A 1Y69U 2ZT9C 4TSSA 3S15B 1II3A 2E75C 1STAA 2L9HA 1LV9A 1TY2A 4DK1A 4BY7B 4RCNA 5G3LD 1A15A 5IIFA 4A3BB 1GUGA 2PQEA 4IQZA 1DOLA 1E2ZA 1KLUD 1EZ6A 3R8BA 5E3FA 5KNCA 1FNWA 2KUMA 4S3SA 4C2MB 3DHQA 1RTNA 5EBCA 2EY2A 1KDCA 2YU9B 1XTCD 2FHTA 2EYHA 2JA8B 5D14A 2AQ3B 3FPUB 1D1IA 1GOZA 1PRTC 2A73B 1FGBD 2K33A 2WV6D 4NW2A 5IGGA 3SHLA 1U4PA 2FMCA 4XXEA 5DNFA 2RKSA 3T13A 5IGDA 5D3IB 1CFMA 1SYGA 1KAAA 2WIIB 3TP7A 4RCOA 3FVQA 1GUSA 3K57A 4K5XA 4EQPA 5E1FA 1SE4A 1V1OA 1LLRD 5KNBA 4RAUC 3I4NB 5CBAE 2L55A 3KBXA 2L5TA 1OXTA 1IL8A 3RD4A 1U4LA 4OO1H 1UNSA 5CV6A 5FO8B 5C5LA 1SMYD 3S2HB 4IZ8A 4X3KA 2KCNA 5LHY1 4U68A 2PPBC 1HUNA 3V2TA 5C4ZA 1WTRA 5C4HA 5EJWA 4XT1B 4DNTB 1G91A 2JYOA 1AN8A 2E2DC 2F0PA 4QUCA 1I4GA 5K5PA 1IYUA 3KK7A 1G8ZD 1HQRD 4C3JB 4H44C 4A3JB 3S9WA 3NTKA 1MI2A 3MXPA 1FD7D 2O2LD 1V1PB 4FF2A 5I6WA 3PO3B 5I9OA 2EVBA 4DAVA 4O1NA 2D62A 1JOOA 3R3OA 5KYLA 1HA5A 3TZDA 1W6KA 5IGEA 3R2IA 1I3QB 4RHSA 2PMZB 1B2TA 1WTVA 3NBHA 2ICIA 3RLFA 2J0TD 3N52A 3SXHA 3P1HA 3OIPA 2IX0A 2AUKA 3Q23A 4RGOS 1ENCA 1X3PA 5EQ0A 3G6JB 2F0FA 4OO1I 1E2WA 2K6AA 3S1QB 2K03A 2IWHA 1PTOC 1DONA 2EPBA 3K58A 1W6JA 1PYWD 4TQUS 4A3IB 4R9WA 3K5OA 4KY7A 3HZXA 3VR2A 2QKIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CA6 A;  3Q6S A;  1WTP A;  3P7J A;  2L9H A;  5CBE E;  1NCV A;  4CJ2 C;  4CJ1 B;  1HFG A;  1BNZ A;  2RSO A;  1LV9 A;  2K01 A;  1F9S A;  4X3K A;  5D65 A;  1RTO A;  1A15 A;  4MHE A;  4U68 A;  5EPK A;  3MWY W;  1WTQ A;  1X32 A;  1B4O A;  1MSH A;  2MGS A;  2EE1 A;  2B2V A;  4ZAI A;  3KUP A;  2L1B A;  3HP3 A;  4OIJ A;  1HUN A;  5CMD A;  1SDF A;  3LWE A;  1WTR A;  1DOL A;  2MJ8 A;  1BBX C;  2MP1 A;  5EJW A;  2DY8 A;  4XT1 B;  1ICW A;  3FDT A;  2Q8R E;  1VMP A;  4LMQ D;  1C8C A;  1EIG A;  2B2W A;  1ZXT A;  1G91 A;  2JYO A;  3ONA B;  4X3U A;  1B3A A;  1F2L A;  1QG7 A;  4HAE A;  4QUC A;  2X6L A;  2JP1 A;  5T1G A;  2HUG A;  1NR4 A;  4RWS C;  2KUM A;  4XDX A;  1B53 A;  3SVM A;  1GUW A;  1HFN A;  1B50 A;  1RTN A;  1J8I A;  4HSV A;  1WD0 A;  1AZQ A;  1EOT A;  4UAI A;  2KVM A;  1MGS A;  1VMC A;  2BDN A;  2NYZ D;  1ML0 D;  1F9R A;  1KNA A;  2CVR A;  4R8I A;  1PLF A;  2B2Y C;  2H1E A;  2IL8 A;  1TVX A;  2KED A;  1RJT A;  1WD1 A;  1BF4 A;  1F9Q A;  1EL0 A;  1EIH A;  1MI2 A;  2KEE A;  2FHT A;  1U4M A;  3QO2 A;  3I3C A;  5D14 A;  3D6W A;  3FPU B;  1G2T A;  4O42 A;  1O7Z A;  4IUT A;  2J7Z A;  4IUP A;  4CJ0 B;  2K1B A;  5E4X A;  2NZ1 D;  2X69 A;  2X6G A;  1U4R A;  1NR2 A;  2B2U C;  2XIW A;  3F2U A;  2MPM A;  4IUR A;  2SDF A;  1ILQ A;  2HCI A;  1HRJ A;  2Q8T A;  1IKL A;  4NW2 A;  1CA5 A;  1SSO A;  2L11 A;  1XYI A;  2B2T C;  1E0B A;  5EPJ A;  5T1I A;  1X3Q A;  3GV3 A;  1U4P A;  2B2U A;  1G6Z A;  3TN2 A;  1F9P A;  2N88 A;  5DNF A;  3TZD A;  3G7L A;  1CM9 A;  5E4W C;  5EPL A;  1WTW A;  2RSN A;  1BO0 A;  2HCC A;  5COR A;  1J9O A;  3I8Z A;  2B2T A;  3IL8 A;  4HCS A;  4MN3 A;  2L12 A;  2D9U A;  2FMM A;  3DEO A;  1AZP A;  2KOL A;  3GV6 A;  1B2T A;  1JE4 A;  1DZ1 A;  1WTV A;  1HHV A;  4ZLT F;  2K05 A;  2HDM A;  2B2Y A;  1ILP A;  2DY7 A;  4IUU A;  4QUF A;  2N55 A;  3H91 A;  1WVL A;  2FIN B;  1WTO A;  4HED A;  1AP0 A;  4XT3 B;  3N52 A;  1PFB A;  4IUQ A;  3IFD A;  2FFK B;  1PFM A;  5AFW A;  5EKI A;  4ZK9 B;  1QE6 A;  2B2V C;  2HDL A;  1O80 A;  1M8A A;  2K28 A;  2RA4 A;  2KEC A;  2NWG A;  1Q3L A;  4RA8 A;  1EQT A;  4X3T A;  1SAP A;  1X3P A;  3I91 A;  4OIK A;  4DN4 M;  1ESR A;  2L4N A;  1DOM A;  1O7Y A;  4X3S A;  5EQ0 A;  4RAU C;  2B2W C;  1QNK A;  2R3Z A;  5CBA E;  1KNE A;  3DEP A;  4IUV A;  1JIC A;  1WTX A;  2FJ2 A;  1HA6 A;  3KBX A;  1G2S A;  2K03 A;  3I90 A;  2RVL A;  3DM1 A;  1IKM A;  2VXW A;  2EPB A;  5JJZ A;  4ZKB B;  1IL8 A;  1HUM A;  2K04 A;  1DON A;  1DOK A;  1U4L A;  3R93 A;  1S4Z A;  1MSG A;  3MTS A;  4R9W A;  2M2L A;  2EOT A;  4ZKC B;  1RHP A;  1PFN A;  1PDQ A;  5COY A;  3UI2 A;  1XX8 A;  1NAP A;  1ROD A; 
#chains in the Genus database with same CATH topology
 3SK4 A;  2NVX H;  3D3R A;  1MBY A;  5CBE E;  2CWA A;  1BCP B;  1F9S A;  1A63 A;  3WWV A;  5D65 A;  4DV5 Q;  4A93 B;  5M3F B;  1YBY A;  4AYB B;  3S1M B;  3OIQ A;  1YEZ A;  5C3E B;  1FR3 A;  1SRU A;  2KQ3 A;  1DJR D;  4BWG B;  1FJG Q;  4JV5 Q;  4KJO A;  1DD2 A;  4GOP B;  4P73 A;  4DNR B;  5M3M B;  1HTL D;  3K7U C;  2PO4 A;  4OHJ A;  1B3A A;  3ERO A;  1I50 B;  3CF5 A;  1MD2 D;  3T53 B;  5IE8 A;  1PH4 A;  1I4Q A;  4R4T A;  3KBG A;  1Y1V G;  4UAI A;  1MGS A;  1NTG A;  3P75 A;  1D7Q A;  2SNS A;  3H6M A;  2KED A;  3NWT A;  1VQA A;  1NNX A;  1F77 A;  2N49 A;  1VQG A;  2A8V A;  4B9X A;  1V1Q A;  1RCV D;  1X3G A;  1LT4 D;  2E76 C;  1G2T A;  1O7Z A;  3CAM A;  2ASB A;  1IW7 C;  1VQI A;  5DAU A;  2X6G A;  5A35 A;  3OHX C;  3J80 c;  1XTD A;  1A8V A;  5C4X H;  2L11 A;  4M8A A;  1QJO A;  5JEA H;  4X62 L;  4R1J A;  1X3Q A;  2IJ0 A;  2R92 G;  1PMR A;  3V96 A;  4CKE A;  4DKA C;  4DV2 Q;  4DXG A;  1HR0 Q;  5EPL A;  4DAM A;  1QCB D;  2EDG A;  5COR A;  3N6R A;  5HUR A;  1ZEQ X;  3DEO A;  4IPC A;  4WOR A;  3S15 H;  4DR3 Q;  1JE4 A;  3PF5 A;  1EWH A;  2BCO A;  3BJU A;  3U9O A;  4ZUJ A;  1Y1W B;  4BA1 I;  2C5C A;  4Q5V A;  1PFB A;  4R4I A;  4K5V A;  3H94 A;  3HKZ B;  2EYF A;  4DR6 L;  4BY7 H;  2B2V C;  4KHP Q;  4A3B H;  3A5Z B;  1R4Q B;  4JI5 Q;  1QVF A;  1D1K A;  1VQD A;  4A4I A;  1UE1 A;  1PZK D;  2YV5 A;  4C3H H;  4X64 L;  4RKL A;  1R9T H;  2UUB Q;  3DEP A;  4IUV A;  1T5E A;  5CYU A;  1LTS D;  4QJF A;  1QNU A;  2F4I A;  3WDN A;  3BZK A;  2F0T A;  2B63 G;  1IKM A;  2K04 A;  1KC8 C;  2LSS A;  1N32 Q;  1AFP A;  1VQK A;  1D6E C;  4AH6 A;  2B39 A;  2KA7 A;  1PDQ A;  1SE2 A;  4L6T B;  5CV4 A;  1CUK A;  4C2M H;  3OYY A;  3CRL C;  1CKM A;  1L1O A;  2RCN A;  5LL6 X;  3LNN A;  3M4P A;  2K01 A;  3JAM E;  2YU9 H;  3BS1 A;  4DGZ A;  4JI7 Q;  2EIF A;  2JA8 H;  2F0J A;  4AQY Q;  1H9S B;  2WAQ B;  3HP3 A;  4Y7N B;  3S1R B;  2I5M X;  1XNQ L;  3W1B A;  1ASZ A;  2O4X A;  3NSW A;  4GNX B;  3KOJ A;  1PZJ D;  5EGT A;  3C1F A;  2AWN A;  2Y0S B;  5DLQ E;  5FLM H;  1ZKO A;  2XRS D;  1MIU A;  1RD9 D;  2UUA L;  5ELC A;  4KD3 A;  3J7A F;  2G5D A;  4RGN A;  1DCZ A;  2CHB D;  3CCS A;  2Q2T A;  1WD1 A;  3OMG A;  2C9O A;  1F2Z A;  2Q8I B;  1QWY A;  1H9R A;  4KD4 A;  3QO2 A;  3D4D A;  3JAM L;  4IUT A;  1A3V A;  1SYE A;  4DV6 Q;  4PMB A;  2K32 A;  1SEB D;  3EQL C;  2Q2H A;  5CR3 A;  2A69 C;  1A3U A;  5KYI A;  3F2U A;  4HJ7 A;  4YY3 L;  1M90 C;  3GTQ B;  4DV3 L;  1QB5 D;  4B3M L;  1KRT A;  2N8N A;  3I4N H;  1JQY D;  1KL9 A;  2F3I A;  3PUV A;  4BY1 G;  1KQS A;  2VZA A;  1SE8 A;  1LT3 D;  2HCC A;  4UPA A;  2ATW A;  2PZU A;  3IL8 A;  1TII D;  1EYG A;  1PRT B;  3HRZ C;  4QUF A;  1G6Z A;  4NMZ A;  3DWP A;  3S2H H;  2ZJR A;  1SN8 A;  3K8A A;  4JBM A;  1S5E D;  3L3O C;  2WAC A;  2LMC B;  4DR4 Q;  4NP5 A;  4Z9C B;  4GN3 B;  2UXB Q;  2PZW A;  1V43 A;  4MTN A;  4IAL A;  1D2B A;  1JT8 A;  1HNW L;  4A3B G;  4DNI A;  4ZKB B;  2UXD Q;  2VUM B;  1T9H A;  4TKO B;  4PZ7 A;  2QGQ A;  2UU9 L;  3A8I E;  1PHJ A;  5IP7 G;  1Q12 A;  1KHI A;  2DN8 A;  2XN9 C;  3VR5 A;  1UEB A;  2PQA A;  3EFX D;  2H4O A;  1YNX A;  3UDX A;  4A3J H;  2E2J H;  2VQF L;  1KDB A;  3CRK C;  1XMQ L;  3W3A A;  1X32 A;  4IO9 A;  3S16 B;  1DYQ A;  1NMF A;  3OPO A;  1EOV A;  3PO3 H;  1L1O B;  2IW3 A;  4C3I B;  2AHO B;  1H9M A;  1IYJ B;  5NUC A;  3W1G A;  4H13 C;  1LO5 D;  1U0L A;  1B53 A;  4N9T A;  4JI0 L;  1HFN A;  1UE6 A;  4LUV A;  1WD0 A;  4OEL B;  3T1Y Q;  1SMX A;  3CW2 C;  1F9R A;  4WJ4 A;  3TEH B;  2B63 B;  1I3Q H;  1EIH A;  1VDZ A;  2H5X A;  2DGY A;  1JJG A;  2KBN A;  2OTL A;  5ELO A;  3GO5 A;  5J3B A;  4KMU C;  4DAP A;  2JK8 A;  3E6Z X;  3CCR A;  2G9D A;  5ELN A;  3T16 A;  2KEN A;  2QIL A;  1O7L A;  2B2T C;  4XQQ A;  3VR4 A;  3PIP A;  3S1Q H;  3E0J A;  1BUV T;  3KLS A;  2HQE A;  3F2D A;  5DEH A;  1BQQ T;  2OQ0 A;  3AB9 A;  1H9K A;  3I8Z A;  2K7V A;  3PO2 H;  3FKI B;  1HHV A;  4K0K L;  4L63 B;  4X66 L;  1B70 B;  2B2Y A;  2K5N A;  3VYT A;  2F0G A;  4G57 A;  3S17 H;  3AQQ A;  4XT3 B;  1BBU A;  1U9R A;  2IHF A;  4K2K A;  1IW7 D;  2UXC L;  1OXS C;  4A3K G;  3HOX B;  4A93 H;  4RA8 A;  1Q3L A;  2Q2I A;  5M3F H;  2JXM B;  1C0A A;  1M1K C;  3GDE A;  5EKK A;  3S1M H;  1A3T A;  3HFZ B;  5F2D A;  2F0D A;  1DXM A;  4B08 A;  1YNJ D;  2QEJ C;  5C3E H;  2L15 A;  3K59 A;  3KFU A;  4U67 3;  3ITP A;  1Q86 C;  1FGU A;  1PZI D;  4HIO A;  2PI2 E;  4FDB A;  2MHV A;  1CZG A;  4LNQ A;  3R93 A;  1EZ8 A;  3VYS A;  1I50 H;  1Q90 A;  4LF8 L;  2M2L A;  1LTB D;  3C1E A;  1LTI D;  1RHP A;  4F88 A;  2V4D A;  5TSS A;  5IT9 c;  4DUZ Q;  1CA6 A;  3S2D H;  3BVG A;  1LT6 D;  3RR5 A;  4CJ1 B;  1VQ7 A;  1CT1 D;  4RMF A;  2NVY B;  3HOU G;  1RTO A;  1UUP A;  1CI3 M;  4A3D B;  4KN4 C;  2E5L L;  5KIX A;  2WB1 B;  1LTT D;  2MGS A;  1EY8 A;  2EE1 A;  2F0M A;  1L0W A;  5LL6 S;  1TWA B;  1EY0 A;  2EJG C;  2EXD A;  4C3J G;  1PTO B;  1SYC A;  4POF A;  1CHQ D;  2PQA B;  1ET6 A;  1EQV A;  3GTJ B;  4HID A;  2B2W A;  1GM5 A;  1WOC A;  3ONA B;  4HTH A;  2G9H D;  2SNM A;  2HUG A;  3D4R A;  3MAQ A;  2JA6 H;  3CKI B;  5LMU L;  3H09 A;  1RIP A;  4J8Q A;  1EOT A;  5I4D A;  3UE1 A;  3PIO 3;  5FJ8 H;  4J1M A;  4LUO A;  1EL0 A;  2F0H A;  1E1T A;  1FNU A;  1TWF B;  1C7Y A;  2A6E D;  3AFP A;  1IHZ A;  4B9W A;  4KK7 A;  1YNN C;  1WYD A;  2J7Z A;  3ND9 A;  4O0A A;  2F0Q A;  5IWA L;  4B3R L;  3SK8 A;  5JJI A;  3QOJ A;  5E4W C;  3MXN A;  4P71 A;  1EFI D;  3J81 c;  2O5I C;  4RG1 A;  1CTM A;  1CKN A;  1STG A;  3GTL B;  5LMN Q;  3K5N A;  3NUC A;  1X3F A;  4HMJ A;  5C0X J;  3LX0 A;  1B44 D;  3SGI A;  4FP5 D;  1AP0 A;  3D8G A;  2HIV A;  3A74 A;  4QY7 A;  1D5Z C;  4A3I G;  1M8A A;  3F8T A;  1E1O A;  2A69 D;  2NB0 A;  1AE2 A;  3WOE A;  1GUT A;  4G7O C;  2VY3 A;  3TRZ A;  1DOM A;  3STB C;  5FO9 B;  3RMH A;  4N9P A;  2EYP A;  4KKU A;  1AE3 A;  4OEM B;  3I90 A;  1KLG D;  1JR0 D;  1A62 A;  2Z0S A;  2OEO A;  3I7F A;  1MSG A;  4NPS A;  3HEJ A;  3OW7 A;  4LWC A;  2ZM6 L;  1NAP A;  1ROD A;  4CBV A;  4F87 A;  3W5O A;  4GLV B;  4WJW A;  1TU2 B;  5C4J H;  3K7A B;  2F3V A;  5FO7 B;  5M3M G;  3M4Y A;  4JG2 A;  1NJI C;  4XTC S;  1EQQ A;  1IZ6 A;  4DR2 Q;  5LMN W;  2F3W A;  3HOW B;  4GKK L;  1MSH A;  5M5Y H;  4IFD G;  3GQB A;  3M4Q A;  4BBR H;  1BVS A;  1B9M A;  4BXX G;  2IHE A;  1SYB A;  1XPO A;  1ICW A;  3CPF A;  5GAH C;  4DV0 L;  4ZRZ A;  4A3K B;  2ES2 A;  4JI4 L;  2NN6 G;  3GTQ H;  2JP1 A;  3HOZ G;  3QWN A;  1BXT A;  1C9O A;  1HZC A;  4MTK A;  3UE0 A;  2NYZ D;  1N33 Q;  1I5F A;  4B3T L;  4FO2 A;  2IL8 A;  2D5D A;  1JOQ A;  1K8O A;  5JPN C;  4G7Z C;  2PCF B;  4CJ0 B;  3CHB D;  2K1B A;  2CH4 W;  1VS0 A;  1X54 A;  3HOU B;  2EYL A;  4FF1 A;  4JI1 L;  1I94 L;  1SNC A;  1Y1W G;  1OTC A;  3NQT A;  2R7Z G;  1CSP A;  3UDG A;  4A3F B;  4LFC Q;  3J80 E;  2EZV A;  3HKZ G;  3NE5 B;  2OF1 A;  2NUC A;  1LM0 A;  1TR5 A;  4FXK C;  4HMI A;  4HCS A;  2B2T A;  4CKC A;  1HH2 P;  4NDX A;  3A8K E;  3GV6 A;  3T56 B;  1HTP A;  3IKJ A;  2R93 B;  3D0F A;  1WVL A;  4KLK A;  1KDA A;  2R92 H;  3RZO B;  3BYY B;  2O5J C;  1TQO A;  2WIN B;  1PFM A;  4LJZ C;  5AFW A;  4P74 A;  1EWI A;  2ID0 A;  2TMP A;  2IX1 A;  1LAC A;  1TY0 A;  2E2I B;  4GS3 A;  1I4X A;  1CKN B;  4DUY Q;  1SAP A;  4IPH A;  3A56 A;  3C3L A;  4DR5 L;  1IBL L;  4DV1 L;  1L0Y B;  3ERS X;  1VQN A;  4CDC C;  1Y8O B;  2A1A A;  3M9B A;  3J80 L;  4R8N A;  5BN3 A;  1Q8K A;  3T1H Q;  4ME5 A;  1Q8I A;  4MIU A;  1OXX K;  1A2T A;  1SFO B;  4UDU C;  3GTK B;  1CSQ A;  2WFW A;  4OL7 A;  4QF4 A;  3ICE A;  2Y0S G;  1Q81 C;  1ESF A;  2B63 H;  1EU4 A;  4FYD A;  1JOK A;  2UUC L;  3PGZ A;  1QUQ B;  1B4O A;  4JBJ A;  2L1B A;  3K80 C;  2MP1 A;  3OTO L;  2Z6K A;  4QIW B;  2KCM A;  1VQH A;  4LF5 Q;  1AZQ A;  3PV0 A;  2WKD A;  2ZTC A;  3D31 A;  2XNA C;  2EJF C;  3NQI A;  1TS4 A;  4R8I A;  1GVP A;  1N34 Q;  3TQY A;  3VA5 A;  3FP9 A;  1KTK A;  1E7Z A;  4G7H C;  5CGK A;  3PUX A;  3D6W A;  4HJ9 A;  1CKO A;  4HJ5 A;  4LF7 Q;  2JA5 B;  2F4V Q;  5ELD A;  1FJG L;  1BOS A;  5IY0 A;  4JV5 L;  3Q0A A;  4OXP A;  4EX5 A;  2B2U C;  2DNE A;  4OWX B;  2Q8T A;  2A68 C;  5FLX c;  2BOS A;  3JAM i;  2PW7 A;  2RDG A;  4CGY B;  4LUZ A;  1K73 C;  2RSN A;  1BO0 A;  1Y14 B;  4YIJ A;  3RN5 A;  5FK9 C;  1JMC A;  1VCI A;  4JI2 Q;  2JEA I;  3HOZ B;  4H7B A;  4DAY A;  2EJM A;  1EU3 A;  3U50 C;  2DY7 A;  3I72 A;  1WTO A;  3EA6 A;  4JBK A;  4BY1 H;  1YNN D;  4GLA C;  2VUM G;  2NVY H;  3B6Y A;  1LYL A;  1SNM A;  4QQB X;  1JB3 A;  3CCE A;  2D2C C;  3HOV B;  1XJV A;  2QDL A;  1YNJ C;  2PNR C;  3CQZ B;  1VQ5 A;  1LT5 D;  3AMU A;  1QNK A;  1SND A;  3O13 A;  1HR0 L;  2Z1C A;  1G2S A;  4KHZ A;  3GTJ H;  1YIJ A;  3J7Y W;  3SK5 A;  4DR3 L;  3CME A;  3J7A V;  1YVC A;  1S4Z A;  2BA0 A;  3G4S A;  2GVB A;  2R7Z B;  4EQ5 A;  3QJY A;  2KHI A;  1HJP A;  4C3I G;  1LUZ A;  3Q6S A;  2RF4 A;  2WKC A;  4X62 Q;  3OOC A;  2JE6 I;  3CCJ A;  1EY6 A;  1Q1E A;  2RSO A;  5AJ3 Q;  4JI5 L;  2NTS A;  1TWF H;  4HR7 B;  3NBH B;  2CH4 A;  1VQP A;  1WTQ A;  5IYB G;  4RKB A;  4DR1 Q;  2UUB L;  2B3G A;  5IP7 H;  1SLJ A;  1EWC A;  4OIJ A;  3PUW A;  3STB D;  5CMD A;  2HHH L;  3LWE A;  1L2F A;  1BBX C;  2DUD A;  2ZTE A;  3FDT A;  4LMQ D;  4R4Q A;  3VDY A;  1N32 L;  1TXY A;  4YHH Q;  2A6H C;  1UEA B;  2FXQ A;  4HIK A;  2Q2U A;  3L2P A;  4RWS C;  3GTO B;  1QVC A;  1GUW A;  4PMW A;  3PQI A;  2F0V A;  4L5Q A;  3P20 A;  2XGT A;  4FXD A;  2KVM A;  2BDN A;  2NZH A;  2IX3 A;  4X64 Q;  2NTT A;  3C2P A;  1PH5 A;  3FRP B;  2EQS A;  1YZ6 A;  2EYJ A;  3K5L A;  2A6E C;  3GTL H;  1BKB A;  3BU2 A;  4A3L G;  3MFG A;  3TS2 A;  4IUP A;  3S14 B;  3U58 A;  2QDB A;  2NZO A;  3FKI G;  1SYF A;  1YI2 A;  1IKL A;  2EYM A;  4DXF A;  1G29 1;  1TWC B;  2OTJ A;  3A5U A;  1VQO A;  3GV3 A;  4UP7 A;  3SE0 A;  1ET9 A;  1HPC A;  3HOX G;  3Q24 A;  2PMZ E;  4AIM A;  1PH7 A;  4CDD C;  2L12 A;  1EYA A;  1XMO L;  1JWS D;  2K05 A;  1VQE A;  4L5R C;  1JJ2 A;  3LGJ A;  4DV6 L;  2AKW B;  1Z6H A;  4IUU A;  3IRB A;  4JW0 A;  3BG3 A;  2UUA Q;  2E2H B;  3K7A H;  3HOW H;  3L7Z C;  2PYK A;  1PH1 A;  4DAY B;  1WTX A;  1KNE A;  4L8J A;  1JIC A;  2P5Z X;  4RH6 A;  1OXU A;  2JA9 A;  4ID6 A;  4A3K H;  4C1N K;  4A3D G;  1STN A;  4J15 A;  1X9N A;  1JC7 A;  2WB1 G;  4UHV A;  1WFQ A;  4OWT B;  2MNA A;  5COY A;  3UI2 A;  1CQV A;  1GKH A;  3MA2 B;  4OWW B;  3DXJ C;  2VW9 A;  1V8Q A;  2JEB I;  4CJ2 C;  5JJL A;  4DR4 L;  4AYB E;  3VYR A;  3E9H A;  5EPK A;  2UXB L;  1PH8 A;  1JWM D;  1JB7 A;  1YJW A;  5JAV A;  5ELF A;  3HOY G;  2WP8 J;  5C0X G;  4OX9 L;  2MJ8 A;  4P2C B;  1K8M A;  2E74 C;  2UXD L;  4DFA A;  3HOU H;  5IYC G;  1EY4 A;  2F0N A;  4KI0 A;  4YWM A;  1QG7 A;  3A54 A;  2F0U A;  3SEB A;  4ALP A;  1STE A;  2MFI A;  1JE5 A;  1YJN A;  4C3J H;  1AH9 A;  2TSS A;  4LF9 L;  1ML0 D;  4YCU A;  1KNA A;  1HQM C;  1BF4 A;  2F0L A;  5IGF A;  3BDO A;  2QCP X;  5L37 A;  1TS2 A;  3FEW X;  3RZO H;  1RDP D;  2XWB B;  3A0J A;  2UU9 Q;  3HG9 A;  4IOC A;  2JJQ A;  1C48 A;  4LFA Q;  1K0R A;  1Z9F A;  1HZ9 A;  4KY5 A;  1AW7 A;  4IUR A;  3BVM A;  4UP8 A;  4A3G B;  4CDF C;  1SSO A;  2CW0 D;  1XYI A;  4ULL A;  2Z6B A;  1HCZ A;  2I07 B;  3T1Y L;  3JC6 6;  2B2U A;  1EEF D;  2N88 A;  3ULL A;  4K6D A;  3MFY A;  4NXN L;  1EIY B;  1CHP D;  4HSP A;  3RZD B;  1AZP A;  1DZ1 A;  1I6V C;  4DA2 A;  1PYS B;  3J81 E;  4GOP C;  1ILP A;  1SFO H;  3GTK H;  3HKZ E;  1Q1B A;  3L9A X;  4IUQ A;  1Q46 A;  2AQ1 B;  2ZJP A;  3MXG A;  2RA4 A;  2BA1 A;  3VR6 A;  1NE3 A;  4E6I A;  4PV1 C;  4DK6 C;  1LAB A;  3IAY A;  4A75 A;  2A68 D;  4JK1 C;  1O7Y A;  5EAY A;  1SNO A;  1WI5 A;  4Q0F A;  1K83 B;  4A3I H;  1QOH A;  2YTV A;  4LF6 L;  1P8L A;  3HOW G;  5A2Q E;  3A55 A;  3H0G G;  3MTS A;  1XPU A;  1Q7Y C;  3C46 A;  5CV5 A;  2IY5 B;  4TRD A;  4JI6 L;  2LY7 A;  1TWG B;  3QOL A;  1I4H A;  4DR7 L;  1GHK A;  4DV4 L;  3P7J A;  3J81 L;  2NVX B;  3OMC A;  1UE7 A;  3NWS A;  4I7A A;  4KN7 C;  2WAQ E;  1EFW A;  1VQ8 A;  2AMC B;  3MZ5 A;  1PV4 A;  1N36 Q;  2B2V A;  4ZQ3 A;  4APV A;  5CC4 A;  2F0S A;  2K52 A;  4KKS A;  1PH9 A;  4K0K Q;  1YIT A;  4B3S L;  2Y0S E;  2IPK D;  3M7G A;  5M3M H;  1GD7 A;  1VMP A;  3DUZ A;  4KTA A;  1ZXT A;  2Z9H A;  4X3U A;  2X6L A;  4NB3 A;  1HNZ Q;  2UXC Q;  2R7D A;  4XDX A;  3SVM A;  4DUZ L;  3MC0 B;  1LTR D;  3GP7 A;  4IFD H;  1MHW C;  5A2Q L;  4BXX H;  3RUZ A;  4BBS G;  3KYH C;  4C56 C;  3OSO A;  1TVX A;  2KEE A;  2NN6 H;  3HOZ H;  1U4M A;  5DM6 3;  4A3F G;  1E3P A;  2BDO A;  4DPG A;  4O42 A;  2MUY A;  5JOB A;  4TVA B;  3X3N A;  2XSC A;  3CU7 A;  1S3O A;  1DGS A;  4I7Z C;  2VB3 X;  1F2Y A;  4K2L A;  5J39 A;  2R93 G;  1HRJ A;  1PVO A;  2A6H D;  2NVQ B;  3PUY A;  4JCV E;  2CKZ B;  3HOY B;  3I2Z A;  1PFS A;  5C4X B;  2E5L Q;  3BDL A;  2R6G A;  3K6O A;  2B29 A;  1PH2 A;  5JJK A;  3TP8 A;  1YHB A;  5FKA C;  1VQ4 A;  4LFB L;  1Y1W H;  4ABN A;  2KOL A;  4GNX C;  5M5W B;  5I9P A;  1P16 A;  1HZB A;  2R7Z H;  3I73 A;  1ENF A;  2CWP A;  4BA2 I;  4OGQ C;  3V05 A;  1VQC A;  4JYA Q;  2KEC A;  1S40 A;  5K36 G;  2BE5 C;  4X3S A;  1J5E Q;  4IJH A;  3H3V H;  1E22 A;  4PQX A;  3MHB A;  2FJ2 A;  1HA6 A;  3D4W A;  3NTI A;  4FXG C;  4C3H B;  1R9T B;  5CV9 A;  3BVZ A;  1HNX L;  4JOI C;  3NEL A;  4PMC A;  1TWH B;  2YTX A;  2JA7 G;  2EOT A;  5JEA J;  1PFN A;  3KJO A;  3TP6 A;  4YWK A;  5ELE A;  3TDQ A;  5C6A A;  1CK1 A;  2D0P A;  4B3R Q;  2LFN A;  3TP5 A;  1V1P A;  4DV7 Q;  4EQN A;  5C44 G;  5BN5 A;  1SR3 A;  2DJG C;  1EUJ A;  3J80 i;  5M5X B;  2VQE L;  1TS5 A;  1I4P A;  3MWY W;  4GKJ Q;  3S1R H;  4Y7N H;  3DM3 A;  2I46 A;  4UY8 C;  4ZAI A;  4NXM L;  3E5S A;  1EY5 A;  1EYD A;  3S14 H;  1BCP F;  4A3M G;  2Q8R E;  4IFD I;  1RF2 D;  2EY6 A;  2CQA A;  5J1Z A;  4EGV A;  1XNR L;  1F2L A;  2N3S A;  4JVZ A;  5T1G A;  1UAP A;  2JA5 G;  3CPW A;  1TWC H;  2VB2 X;  1B50 A;  2IT1 A;  2NN6 I;  5D3D A;  4LF4 L;  1VMC A;  4C1N I;  4IPG A;  3NXW A;  1EEI D;  4DR2 L;  1PLF A;  2H1E A;  5IGC A;  2R61 A;  5IOD A;  3I4L A;  2OWO A;  1TS3 A;  3NEN A;  3FPP A;  3H0G B;  4KHV A;  1B7Y B;  4A3C G;  2A19 A;  4CDE C;  1IBM Q;  2ZXO A;  2J4X A;  1PXU A;  1UWV A;  4XYQ A;  2ZM6 Q;  2NZ1 D;  1IYV A;  2X69 A;  1SJE D;  4JI3 L;  3BZD B;  3K0Y A;  3NK9 A;  1IBK L;  3KF6 A;  1VQM A;  2HQL A;  1N33 L;  5FLX E;  1VF5 C;  4GKK Q;  1S5D D;  4RFB A;  4IUN A;  3HOV G;  2K5H A;  4MN3 A;  1FL0 A;  5DM7 3;  3UDF A;  4EVO A;  1IXR A;  5JVG 3;  2LXJ A;  2MQH A;  1ASY A;  3H91 A;  1NSN S;  3NTH A;  2FFK B;  2F0E A;  4BBS B;  3H3V I;  2VS1 A;  1MJE A;  4DK3 C;  2K5V A;  2NWG A;  4B3T Q;  2GVA A;  1TT2 A;  4LFC L;  1C4Q A;  4FF3 A;  1Z7T A;  1BCP D;  4LAA A;  2R3Z A;  1QIL A;  1SE3 A;  4ILW A;  4V0B A;  1UE5 A;  3TZU A;  1FNV A;  3CMA A;  1A2U A;  2VUM H;  3I4O A;  3TSS A;  2RQX A;  2RVL A;  3U9S A;  4X65 Q;  3AYH B;  3DMU A;  5FLX L;  2RCF A;  5JVH 3;  2K14 A;  5BR8 Q;  3M85 A;  3TS0 A;  5BN4 A;  2OXP A;  3CCV A;  1JCK B;  1H9J A;  3MXN B;  4HJ8 A;  2HIX A;  1A0I A;  1HFG A;  4DUY L;  3BDC A;  2K5D A;  3S16 H;  2WB1 E;  2E2J B;  4MHE A;  4A3E G;  3NBI A;  1SXT A;  3TBI B;  3QB3 A;  4P75 A;  3A7L A;  3GTG B;  4C3I H;  1B1Z A;  3KLR A;  2DY8 A;  2F03 A;  3D6C A;  1EIG A;  1NMG A;  3U4Z A;  1S5F D;  4HAE A;  1X6O A;  4A3G H;  3UDI A;  5IYB H;  1NR4 A;  2MO0 A;  5I2Y A;  1QZH A;  4N8X 1;  4O2D A;  1D8L A;  4DR5 Q;  4DV1 Q;  4A76 A;  2I5H A;  1I6H B;  3RZD H;  4JI8 L;  2JN4 A;  1YHA A;  4J6H A;  2JA7 B;  4K6L A;  3S1N B;  3PIO A;  3NEM A;  4K14 A;  3X3M A;  3AEV A;  1JJC B;  5CV7 A;  5C44 B;  1PYB A;  2VNU D;  2XIW A;  3ERQ A;  2CW0 C;  4H02 A;  4ME3 A;  4GZY C;  1ILQ A;  4A3L H;  1CA5 A;  1E0B A;  4X6A H;  1IL2 A;  2EXZ A;  4LF5 L;  1WCM G;  2ICE C;  1ZYR C;  3MXU A;  3TN2 A;  3ULP A;  1F9P A;  2K4K A;  2OT2 A;  4DV5 L;  3GTM B;  4A3M B;  1N34 L;  3ZJY C;  1SBB B;  3FKI H;  1S5B D;  4KY6 A;  1TKW B;  2D9U A;  4ZLT F;  4LF7 L;  2LS0 1;  2F4V L;  3PO2 B;  4QL5 A;  1H9S A;  4K5W A;  1TWG H;  1FYC A;  1XWE A;  3HOX H;  3IFD A;  4XQJ A;  5HGT A;  4ZK9 B;  1KAB A;  4GNX A;  3S17 B;  1N8R C;  1QE6 A;  2HDL A;  2F1M A;  2JQO A;  3QR8 A;  1EQT A;  3I55 A;  4OO1 G;  1PRT F;  3M7N A;  1L0X B;  4RGM A;  2PI2 A;  4L5T A;  1NY4 A;  1SRO A;  4H0L C;  2RDF A;  4JPB W;  2KHS A;  3URY A;  3OW2 A;  2NVT B;  4XQN A;  4JI2 L;  1DOK A;  1SNQ A;  4DU9 A;  5C5M A;  2F0K A;  3HS0 C;  3SR1 A;  2YYZ A;  1Q82 C;  3I4M G;  1XX8 A;  4ZYS A;  3K0X A;  4JOI A;  3Q8D A;  1NUC A;  3S2D B;  1H95 A;  1DM0 B;  1NCV A;  3PMF A;  4A3D H;  2CCZ A;  1SYD A;  1TWA H;  2BE5 D;  5CV8 A;  1CZW A;  1PTO H;  1GHJ A;  4DV2 L;  4HIM A;  3KUP A;  3M4O B;  1SDF A;  1N9W A;  1F2M A;  2D0O A;  1LTG D;  3EVQ A;  3OWE B;  3E3X A;  2NVQ H;  5KND A;  3FMC A;  3HOY H;  1GXD C;  2JA6 B;  2BH2 A;  1JWU D;  4FNF A;  4KHP L;  5C0X H;  1X56 A;  2XVS A;  5AJ3 L;  4PNY A;  2B2Y C;  3IFT A;  5IYC H;  2DJF C;  4A3G G;  2N78 A;  4DR1 L;  3DWQ A;  5M5W H;  3I3C A;  1XXG A;  4QMG A;  3T51 B;  5KGU A;  3KLS X;  3HKS A;  3NPP A;  4IFD J;  2R7F A;  2K75 A;  5IP9 H;  2KHJ A;  4YHH L;  1PRT D;  1U4R A;  5GQO A;  5HGQ A;  3PIP 3;  2ENB A;  4DR6 Q;  2HCI A;  4ODG A;  4A3E B;  3VR3 A;  2Z4I A;  2ZXR A;  5JPM C;  1STB A;  2F0I A;  2HHH Q;  4JI7 L;  2C35 B;  1A6X A;  4AQY L;  3GD7 A;  1TWH H;  5GAE C;  1D5X C;  1OXV A;  2EY5 A;  3PUZ A;  5EBD A;  4HED A;  1S72 A;  3EBE A;  5M5X H;  1HR0 W;  1W3S A;  3CCU A;  1V9P A;  2F0O A;  3KLW A;  1VQ6 A;  4X3T A;  3SK6 A;  3M3Y B;  2QW7 A;  1EIF A;  2B2W C;  3WOF A;  1XNQ Q;  2E8G A;  3I56 A;  2M9V A;  1VQJ A;  2VXW A;  2ZJQ A;  2NBF A;  2RDH A;  4DK0 A;  1D5M C;  1WCM B;  2LKV A;  2QF7 A;  1HXY D;  1M4V A;  1WTP A;  2MO1 A;  1ENA A;  1BNZ A;  5C4J B;  4R4O A;  4NKL A;  4K8I A;  2AWO A;  3HGB A;  1Y8N B;  3ZYY X;  3H0G H;  1EY9 A;  4WFN 3;  2AUJ D;  2K5Q A;  1XMO Q;  4LK1 C;  5M5Y B;  4QIW E;  1BDO A;  2LXK A;  3TME A;  5GAD C;  4BBR B;  4MNO A;  4K8J A;  3J81 i;  1PA6 A;  1O78 A;  3KDF A;  4I65 A;  3RLO A;  5C0X I;  3AU7 A;  1E2V A;  3CCM A;  5EKL A;  2EY1 A;  4YY3 Q;  3VA7 A;  1PTO F;  1QZG A;  1T5X D;  4DV3 Q;  3RN2 A;  4B3M Q;  3I70 A;  1MJC A;  3NHH A;  3PF4 A;  4WJ3 M;  4HSV A;  3U4V A;  1GUN A;  5IT9 E;  2CVR A;  2XTI A;  2XWJ B;  4Y52 H;  1ONL A;  1VQF A;  5C4X G;  4GN4 B;  4JC0 A;  2K50 A;  5JEA G;  3I4M B;  3EJI A;  1X3E A;  1FVI A;  5E4X A;  5J22 A;  4F8M A;  1Y1V B;  4BBS H;  1I4R A;  4RHR A;  1NR2 A;  3G48 A;  4ZUI A;  2MPM A;  2SDF A;  3EIV A;  4CKB A;  2F0W A;  2A5H A;  4A3F H;  1B8A A;  5I6Y A;  5EPJ A;  5C3W A;  2KCC A;  5IP9 G;  2XRQ D;  1Z47 A;  1CM9 A;  1WTW A;  3SDZ A;  4BY7 G;  4OX9 Q;  1Y8P B;  1KIX A;  1J9O A;  1HNW Q;  2FMM A;  2R93 H;  2JSO A;  2KCT A;  5IT9 L;  2GA4 B;  1YHQ A;  2HDM A;  2CQO A;  4C3H G;  4XIG S;  1SMY C;  2FIN B;  4LFA L;  4XYO A;  3ND8 A;  3CC7 A;  2R92 B;  5EKI A;  2E2I H;  2B8G A;  4HCE A;  3R2T A;  4PZ6 A;  1O80 A;  2SOB A;  4LF9 Q;  2VQF Q;  3DWA A;  4HJA A;  1XMQ Q;  1BCP C;  4DN4 M;  1GUO A;  3K5M A;  3GTG H;  3Q22 A;  2YTY A;  1VF7 A;  1ZYR D;  4HN7 A;  5HY6 A;  3F2C A;  2HD3 A;  4P72 A;  5JJZ A;  4JBW A;  1PTO D;  5K36 H;  1LTA D;  4WRD A;  5ISR A;  2JA8 G;  4ZKC B;  3GTP B;  4QB4 A;  1EY7 A;  3JAM c;  4JI0 Q;  5KRU A;  2K5W A;  1K3R A;  1O7I A;  1RKN A;  3MVV A;  1GJX A;  3S24 A;  1SNP A;  2VL6 A;  1KAW A;  2DNC A;  4FVM A;  3CXC A;  1I6H H;  5FLM G;  2JA7 H;  1KD1 C;  4NXN Q;  1BR9 A;  3S1N H;  4PZ8 A;  3W2D A;  1STH A;  4G4K A;  2A74 C;  3F1Z A;  3CCL A;  4QCL A;  1GO3 E;  2AQ2 B;  1R4P B;  1VQ9 A;  4V19 0;  1S5C D;  3LWU A;  5C44 H;  2SEB D;  1G6P A;  1C8C A;  3QIA A;  2L0C A;  3A8J E;  4M1U B;  2GN5 A;  3OWF A;  1U5K A;  5C3X A;  1J8I A;  3GTM H;  5IGB A;  4A3M H;  1B9N A;  4FF4 A;  3J7Z C;  1RJT A;  1F9Q A;  3BYT B;  3KDF B;  3CCQ A;  1N36 L;  3TRE A;  2QA4 A;  2JA5 H;  4MZ9 A;  1OO9 B;  5G3L F;  3FHW A;  3MEH A;  4LF6 Q;  4GN5 A;  2I0Q A;  3I4N G;  4X66 Q;  1JOR A;  2EYO A;  4KKT A;  3A7A B;  4JI6 Q;  1NBW A;  3CC2 A;  4DR7 Q;  1HNZ L;  4DV4 Q;  1KRS A;  2Z4H A;  5IOC A;  4EQO A;  4F7X A;  3PCO B;  2PZT A;  5T1I A;  4A3C H;  1SJH D;  1STY A;  5KEE A;  1EYC A;  2NVT H;  5M9O A;  3G7L A;  3KF8 A;  3NP8 A;  4DF7 A;  3H3V C;  3G71 A;  4B3S Q;  1AEX A;  4RGT A;  3K81 C;  4IN3 A;  4IJL A;  4OON A;  4LF8 Q;  2RBM A;  3T4A C;  4CHT B;  2N55 A;  3VYU A;  2ZXP A;  4KV6 A;  4BY1 B;  3PSI A;  5I2X A;  3HOV H;  2K28 A;  4KJN A;  3CQZ H;  2KJX A;  4OIK A;  3I91 A;  1ESR A;  2L4N A;  2B8F A;  3CP0 A;  2Z6K C;  3M4O H;  1CQF A;  1X55 A;  4BS9 A;  2Z8L A;  3QG1 A;  5ELB A;  2BH8 A;  3DLL A;  1K3B C;  2M00 A;  2ZTD A;  4A3J G;  3DM1 A;  5FOB B;  1HUM A;  2PW5 A;  1Y69 U;  2ZT9 C;  4TSS A;  3RNU A;  3S15 B;  1II3 A;  1ICF B;  2E75 C;  3ER0 A;  5LMU Q;  1STA A;  3PO3 G;  2L9H A;  4JYA L;  1LV9 A;  1G51 A;  1TY2 A;  4DK1 A;  4BY7 B;  4RCN A;  1QVG A;  3H15 A;  5G3L D;  1A15 A;  5IIF A;  4A3B B;  1J5E L;  2ALY B;  1GUG A;  4LFB Q;  5GRO A;  2PQE A;  4IQZ A;  1DOL A;  1E2Z A;  1EQR A;  1KLU D;  5LMN L;  1EZ6 A;  3R8B A;  5E3F A;  1XPR A;  3GTO H;  4A3E H;  5KNC A;  1FNW A;  5IWA Q;  2KUM A;  4S3S A;  5IYD H;  1MKH A;  4C2M B;  3DHQ A;  1RTN A;  5EBC A;  4DV7 L;  2EY2 A;  3MEF A;  1RL2 A;  4GKJ L;  1K28 A;  1KDC A;  2YU9 B;  1XTC D;  2FHT A;  1HNX Q;  2EYH A;  4UP9 A;  5D14 A;  2JA8 B;  2AQ3 B;  3FPU B;  1D1I A;  1GOZ A;  4YCV A;  4GLX A;  4YWL A;  1PRT C;  2A73 B;  1FGB D;  2K33 A;  2WV6 D;  5GAG C;  3PO2 G;  2RHQ B;  4R4C A;  4NW2 A;  1B3Q A;  5IGG A;  3M3Y H;  2VQE Q;  3CD6 A;  1K8A C;  3SHL A;  4PG3 A;  1U4P A;  2FMC A;  4XXE A;  5DNF A;  4L5S A;  2RKS A;  3T13 A;  1LTL A;  4NXM Q;  5IGD A;  5D3I B;  4A93 G;  5M3F G;  1CFM A;  3CC4 A;  1SYG A;  4AYB G;  1IBM L;  1QUQ A;  3ULJ A;  2E2H H;  1XNR Q;  1KAA A;  1WCM H;  5C3E G;  2WII B;  3TP7 A;  4RCO A;  3KF8 B;  3FVQ A;  1GUS A;  3K57 A;  2I5L X;  4K5X A;  4LF4 Q;  1HZA A;  5E1F A;  4EQP A;  1SE4 A;  1X65 A;  1V1O A;  1LLR D;  5KNB A;  3F2B A;  4RAU C;  3I4N B;  4LW1 A;  5CBA E;  2L55 A;  3KBX A;  2L5T A;  4IPD A;  1OXT A;  1J6Q A;  1YJ9 A;  1IL8 A;  1L1O C;  3RD4 A;  4DV0 Q;  1U4L A;  4OO1 H;  3BZC A;  1UNS A;  4JI4 Q;  5CV6 A;  4JI3 Q;  5FO8 B;  5C5L A;  1SMY D;  3S2H B;  1IBK Q;  1VQL A;  4GOP A;  4IZ8 A;  4X3K A;  2KCN A;  5LHY 1;  4U68 A;  2PPB C;  2JA6 G;  4POG A;  3I4M H;  2HT1 A;  1HUN A;  3V2T A;  5C4Z A;  1WTR A;  5E7N A;  5C4H A;  5EJW A;  1Y1V H;  2RHS B;  4XT1 B;  4X65 L;  3E0E A;  3RLN A;  5FJ8 G;  3AFQ A;  4DNT B;  4QGU A;  1G91 A;  2JYO A;  1AN8 A;  2E2D C;  2F0P A;  4QUC A;  4JI1 Q;  5BR8 L;  1I94 Q;  1I4G A;  5K5P A;  1IYU A;  3KK7 A;  1G8Z D;  3EN2 A;  3KJP A;  1KXL A;  1HQR D;  4C3J B;  4H44 C;  4A3J B;  3S9W A;  4N8F A;  3NTK A;  1MI2 A;  3MXP A;  2OCE A;  5IYD G;  2F52 A;  1FD7 D;  2O2L D;  2QEX A;  1V1P B;  4FF2 A;  5I6W A;  3L0O A;  3G6E A;  3PO3 B;  3T1H L;  5I9O A;  2EVB A;  4DAV A;  4O1N A;  1VQB A;  4ZCK A;  2D62 A;  4IOA A;  1JOO A;  3R3O A;  5KYL A;  1K9M C;  1HA5 A;  1K8G A;  1IBL Q;  2CFM A;  3TZD A;  1W6K A;  2OQK A;  5IGE A;  3R2I A;  1PH3 A;  1I3Q B;  4RHS A;  2PMZ B;  1B2T A;  1WTV A;  3NBH A;  3GTP H;  3E9I A;  2ICI A;  2WAQ G;  3RLF A;  1K0S A;  2J0T D;  5H1S E;  3N52 A;  3SXH A;  3P1H A;  2PNH A;  3OIP A;  2IX0 A;  2AUK A;  3Q23 A;  1PH6 A;  4RGO S;  1BBW A;  1ENC A;  1X3P A;  1E24 A;  3J81 j;  2UUC Q;  5EQ0 A;  3G6J B;  4JI8 Q;  2F0F A;  4OO1 I;  1E2W A;  2K6A A;  1K83 H;  3S1Q B;  1WTH A;  2V1C C;  4YCW A;  2K03 A;  2IWH A;  3J7A 5;  1PTO C;  3OTO Q;  1DON A;  2EPB A;  1WJJ A;  3K58 A;  1W6J A;  1PYW D;  4TQU S;  4A3I B;  4R9W A;  3K5O A;  1W2B A;  4KY7 A;  3KF6 B;  3HZX A;  3VR2 A;  4BBR G;  2QKI C; 
#chains in the Genus database with same CATH homology
 3SK4 A;  3D3R A;  1MBY A;  5CBE E;  1BCP B;  1F9S A;  5D65 A;  4A93 B;  5M3F B;  4AYB B;  3S1M B;  3OIQ A;  5C3E B;  1FR3 A;  2KQ3 A;  1DJR D;  4BWG B;  4KJO A;  1DD2 A;  5M3M B;  4DNR B;  1HTL D;  2PO4 A;  4OHJ A;  1B3A A;  3ERO A;  1I50 B;  1MD2 D;  3T53 B;  1I4Q A;  3KBG A;  4UAI A;  1MGS A;  3P75 A;  2SNS A;  3H6M A;  2KED A;  3NWT A;  1F77 A;  4B9X A;  1RCV D;  1LT4 D;  2E76 C;  1G2T A;  1O7Z A;  1IW7 C;  5DAU A;  2X6G A;  5A35 A;  3OHX C;  2L11 A;  4M8A A;  1QJO A;  5JEA H;  1X3Q A;  2IJ0 A;  1PMR A;  3V96 A;  4CKE A;  4DXG A;  5EPL A;  1QCB D;  2EDG A;  5COR A;  3N6R A;  5HUR A;  1ZEQ X;  3DEO A;  4WOR A;  1JE4 A;  1EWH A;  2BCO A;  3U9O A;  4ZUJ A;  1Y1W B;  4BA1 I;  2C5C A;  4Q5V A;  1PFB A;  4K5V A;  3H94 A;  3HKZ B;  2EYF A;  2B2V C;  1R4Q B;  1D1K A;  1PZK D;  4RKL A;  3DEP A;  4IUV A;  1T5E A;  5CYU A;  1LTS D;  1QNU A;  2F4I A;  3WDN A;  2F0T A;  1IKM A;  2K04 A;  1AFP A;  1D6E C;  2B39 A;  2KA7 A;  1PDQ A;  1SE2 A;  4L6T B;  5CV4 A;  3CRL C;  5LL6 X;  3LNN A;  2K01 A;  3JAM E;  3BS1 A;  4DGZ A;  2F0J A;  1H9S B;  2WAQ B;  3HP3 A;  4Y7N B;  3S1R B;  2O4X A;  3NSW A;  1PZJ D;  5EGT A;  3C1F A;  2AWN A;  2Y0S B;  1ZKO A;  2XRS D;  1RD9 D;  5ELC A;  4KD3 A;  3J7A F;  4RGN A;  1DCZ A;  2CHB D;  1WD1 A;  3OMG A;  2C9O A;  1F2Z A;  2Q8I B;  1QWY A;  1H9R A;  4KD4 A;  3QO2 A;  3D4D A;  3JAM L;  4IUT A;  1A3V A;  1SYE A;  4PMB A;  2K32 A;  1SEB D;  3EQL C;  5CR3 A;  2A69 C;  1A3U A;  5KYI A;  3F2U A;  3GTQ B;  1QB5 D;  1JQY D;  3PUV A;  1LT3 D;  2HCC A;  2PZU A;  3IL8 A;  1TII D;  1PRT B;  3HRZ C;  4QUF A;  1G6Z A;  4NMZ A;  3DWP A;  1S5E D;  3L3O C;  2WAC A;  2LMC B;  4NP5 A;  4Z9C B;  2PZW A;  1V43 A;  4IAL A;  1D2B A;  4ZKB B;  2VUM B;  4TKO B;  3A8I E;  1Q12 A;  2DN8 A;  2XN9 C;  3VR5 A;  3EFX D;  2H4O A;  1KDB A;  3CRK C;  3W3A A;  1X32 A;  3S16 B;  1DYQ A;  3OPO A;  2IW3 A;  4C3I B;  1H9M A;  5NUC A;  4H13 C;  1LO5 D;  1B53 A;  4N9T A;  1HFN A;  1WD0 A;  1F9R A;  2B63 B;  1EIH A;  1VDZ A;  3GO5 A;  4KMU C;  4DAP A;  3E6Z X;  2G9D A;  3T16 A;  2QIL A;  1O7L A;  2B2T C;  4XQQ A;  3VR4 A;  3E0J A;  1BUV T;  3KLS A;  2HQE A;  5DEH A;  1BQQ T;  3AB9 A;  1H9K A;  3I8Z A;  2K7V A;  3FKI B;  1HHV A;  4L63 B;  2B2Y A;  3VYT A;  2F0G A;  4G57 A;  4XT3 B;  1U9R A;  4K2K A;  1IW7 D;  1OXS C;  3HOX B;  4RA8 A;  1Q3L A;  2JXM B;  5EKK A;  1A3T A;  5F2D A;  2F0D A;  1DXM A;  4B08 A;  1YNJ D;  2QEJ C;  3K59 A;  4U67 3;  3ITP A;  1PZI D;  2MHV A;  1CZG A;  3R93 A;  1EZ8 A;  3VYS A;  1Q90 A;  2M2L A;  4F88 A;  1LTB D;  3C1E A;  1LTI D;  1RHP A;  2V4D A;  5TSS A;  1CA6 A;  3BVG A;  1LT6 D;  4CJ1 B;  1CT1 D;  2NVY B;  1RTO A;  1UUP A;  1CI3 M;  4A3D B;  4KN4 C;  5KIX A;  2WB1 B;  1LTT D;  2MGS A;  1EY8 A;  2EE1 A;  2F0M A;  5LL6 S;  1TWA B;  1EY0 A;  2EJG C;  4C3J G;  1PTO B;  1SYC A;  1CHQ D;  1ET6 A;  1EQV A;  3GTJ B;  2B2W A;  3ONA B;  4HTH A;  2G9H D;  2SNM A;  2HUG A;  3D4R A;  3MAQ A;  3CKI B;  3H09 A;  4J8Q A;  1EOT A;  5I4D A;  3PIO 3;  4J1M A;  1EL0 A;  2F0H A;  1FNU A;  1TWF B;  2A6E D;  1IHZ A;  4B9W A;  4KK7 A;  1YNN C;  2J7Z A;  3ND9 A;  2F0Q A;  3SK8 A;  3QOJ A;  5E4W C;  3MXN A;  2O5I C;  1EFI D;  1CTM A;  1STG A;  3GTL B;  3K5N A;  3NUC A;  4HMJ A;  5C0X J;  3LX0 A;  1B44 D;  1AP0 A;  4FP5 D;  3D8G A;  1D5Z C;  1M8A A;  2A69 D;  2NB0 A;  3WOE A;  1GUT A;  4G7O C;  1DOM A;  5FO9 B;  3RMH A;  4N9P A;  2EYP A;  4KKU A;  3I90 A;  1KLG D;  1JR0 D;  2OEO A;  1MSG A;  3HEJ A;  3OW7 A;  1NAP A;  4F87 A;  4CBV A;  1ROD A;  4WJW A;  1TU2 B;  3K7A B;  2F3V A;  5FO7 B;  3M4Y A;  4XTC S;  2F3W A;  3HOW B;  1MSH A;  4IFD G;  3GQB A;  1B9M A;  1SYB A;  1ICW A;  4ZRZ A;  4A3K B;  2NN6 G;  2JP1 A;  3QWN A;  1BXT A;  2NYZ D;  4FO2 A;  2IL8 A;  2D5D A;  1JOQ A;  1K8O A;  5JPN C;  4G7Z C;  2PCF B;  4CJ0 B;  3CHB D;  2K1B A;  3HOU B;  2EYL A;  4FF1 A;  1SNC A;  3NQT A;  4A3F B;  3J80 E;  2EZV A;  3NE5 B;  2OF1 A;  2NUC A;  1TR5 A;  4FXK C;  4HMI A;  4HCS A;  2B2T A;  4CKC A;  4NDX A;  3A8K E;  3GV6 A;  3T56 B;  1HTP A;  3IKJ A;  2R93 B;  1WVL A;  1KDA A;  3RZO B;  3BYY B;  2O5J C;  1TQO A;  2WIN B;  1PFM A;  4LJZ C;  5AFW A;  2ID0 A;  2TMP A;  2IX1 A;  1LAC A;  1TY0 A;  2E2I B;  1I4X A;  1SAP A;  3A56 A;  3C3L A;  1L0Y B;  1Y8O B;  3J80 L;  4R8N A;  5BN3 A;  4ME5 A;  1Q8I A;  4MIU A;  1OXX K;  1A2T A;  1SFO B;  4UDU C;  3GTK B;  4OL7 A;  4QF4 A;  1ESF A;  1EU4 A;  4FYD A;  1JOK A;  1B4O A;  2L1B A;  2MP1 A;  4QIW B;  1AZQ A;  3PV0 A;  2WKD A;  3D31 A;  2XNA C;  2EJF C;  3NQI A;  1TS4 A;  4R8I A;  3VA5 A;  1KTK A;  4G7H C;  5CGK A;  3PUX A;  3D6W A;  2JA5 B;  5ELD A;  1BOS A;  3Q0A A;  2B2U C;  2DNE A;  2Q8T A;  2A68 C;  2BOS A;  2PW7 A;  2RDG A;  4CGY B;  2RSN A;  1BO0 A;  4YIJ A;  5FK9 C;  1VCI A;  2JEA I;  3HOZ B;  4H7B A;  4DAY A;  2EJM A;  1EU3 A;  2DY7 A;  3I72 A;  1WTO A;  3EA6 A;  1YNN D;  1SNM A;  1JB3 A;  2D2C C;  3HOV B;  1YNJ C;  2PNR C;  3CQZ B;  1LT5 D;  3AMU A;  1QNK A;  1SND A;  3O13 A;  2Z1C A;  1G2S A;  4KHZ A;  3J7Y W;  3SK5 A;  3J7A V;  1S4Z A;  2BA0 A;  2R7Z B;  3QJY A;  4C3I G;  3Q6S A;  2WKC A;  3OOC A;  2JE6 I;  1EY6 A;  1Q1E A;  2RSO A;  2NTS A;  4HR7 B;  1WTQ A;  4RKB A;  1EWC A;  4OIJ A;  3PUW A;  5CMD A;  3LWE A;  1BBX C;  3FDT A;  4LMQ D;  2A6H C;  1UEA B;  4RWS C;  3GTO B;  1GUW A;  4PMW A;  2F0V A;  3P20 A;  4FXD A;  2KVM A;  2BDN A;  2IX3 A;  3C2P A;  2NTT A;  3FRP B;  2EYJ A;  3K5L A;  2A6E C;  3MFG A;  4IUP A;  3S14 B;  2QDB A;  1SYF A;  1IKL A;  2EYM A;  4DXF A;  1G29 1;  1TWC B;  3GV3 A;  3SE0 A;  1ET9 A;  1HPC A;  3Q24 A;  2L12 A;  1EYA A;  1JWS D;  2K05 A;  1Z6H A;  4IUU A;  3BG3 A;  2E2H B;  3L7Z C;  2PYK A;  1WTX A;  1KNE A;  4L8J A;  1JIC A;  4RH6 A;  1OXU A;  4ID6 A;  4C1N K;  1STN A;  1JC7 A;  5COY A;  3UI2 A;  1CQV A;  3MA2 B;  3DXJ C;  1V8Q A;  2JEB I;  4CJ2 C;  3VYR A;  5EPK A;  1JWM D;  5JAV A;  5ELF A;  2WP8 J;  5C0X G;  2MJ8 A;  4P2C B;  1K8M A;  2E74 C;  4DFA A;  1EY4 A;  2F0N A;  4KI0 A;  1QG7 A;  3A54 A;  2F0U A;  3SEB A;  1STE A;  2TSS A;  1ML0 D;  1KNA A;  1HQM C;  1BF4 A;  2F0L A;  5IGF A;  3BDO A;  2QCP X;  1TS2 A;  3FEW X;  1RDP D;  2XWB B;  3HG9 A;  1C48 A;  4KY5 A;  1AW7 A;  4IUR A;  3BVM A;  4A3G B;  1SSO A;  2CW0 D;  1XYI A;  4ULL A;  1HCZ A;  2I07 B;  2B2U A;  1EEF D;  2N88 A;  4K6D A;  3MFY A;  1CHP D;  4HSP A;  3RZD B;  1AZP A;  1DZ1 A;  1I6V C;  4DA2 A;  3J81 E;  1ILP A;  1Q1B A;  3L9A X;  4IUQ A;  2AQ1 B;  3MXG A;  2RA4 A;  2BA1 A;  3VR6 A;  4E6I A;  4PV1 C;  1LAB A;  3IAY A;  2A68 D;  4JK1 C;  1O7Y A;  1SNO A;  4Q0F A;  1K83 B;  1QOH A;  5A2Q E;  3A55 A;  3MTS A;  3C46 A;  5CV5 A;  4TRD A;  2LY7 A;  1TWG B;  3QOL A;  1I4H A;  1GHK A;  3P7J A;  3J81 L;  2NVX B;  3OMC A;  3NWS A;  4KN7 C;  3MZ5 A;  2B2V A;  4ZQ3 A;  5CC4 A;  2F0S A;  4KKS A;  2IPK D;  3M7G A;  1VMP A;  3DUZ A;  4KTA A;  1ZXT A;  4X3U A;  2X6L A;  4XDX A;  3SVM A;  3MC0 B;  1LTR D;  3GP7 A;  4IFD H;  5A2Q L;  3RUZ A;  4C56 C;  3OSO A;  1TVX A;  2KEE A;  2NN6 H;  1U4M A;  5DM6 3;  2BDO A;  4O42 A;  2MUY A;  5JOB A;  3X3N A;  2XSC A;  3CU7 A;  4I7Z C;  2VB3 X;  1F2Y A;  4K2L A;  5J39 A;  1HRJ A;  2A6H D;  2NVQ B;  3PUY A;  5C4X B;  3HOY B;  3BDL A;  2R6G A;  3K6O A;  3TP8 A;  5FKA C;  4ABN A;  2KOL A;  5M5W B;  5I9P A;  3I73 A;  1ENF A;  4BA2 I;  4OGQ C;  3V05 A;  2KEC A;  5K36 G;  2BE5 C;  4X3S A;  4PQX A;  3MHB A;  2FJ2 A;  1HA6 A;  3D4W A;  3NTI A;  4FXG C;  4C3H B;  1R9T B;  5CV9 A;  3BVZ A;  4PMC A;  1TWH B;  2EOT A;  5JEA J;  1PFN A;  3TP6 A;  5ELE A;  3TDQ A;  5C6A A;  1CK1 A;  2LFN A;  3TP5 A;  1V1P A;  4EQN A;  5BN5 A;  5M5X B;  1TS5 A;  1I4P A;  3MWY W;  2I46 A;  4ZAI A;  3E5S A;  1EY5 A;  1EYD A;  1BCP F;  2Q8R E;  4IFD I;  1RF2 D;  2EY6 A;  2CQA A;  5J1Z A;  4EGV A;  1F2L A;  5T1G A;  1UAP A;  2VB2 X;  1B50 A;  2IT1 A;  2NN6 I;  5D3D A;  1VMC A;  4C1N I;  3NXW A;  1EEI D;  1PLF A;  2H1E A;  5IGC A;  2R61 A;  5IOD A;  3I4L A;  1TS3 A;  3FPP A;  3H0G B;  4KHV A;  2ZXO A;  2J4X A;  1PXU A;  4XYQ A;  2NZ1 D;  1IYV A;  2X69 A;  1SJE D;  3BZD B;  3K0Y A;  3NK9 A;  5FLX E;  1VF5 C;  1S5D D;  4RFB A;  4IUN A;  4MN3 A;  5DM7 3;  4EVO A;  5JVG 3;  3H91 A;  1NSN S;  3NTH A;  2FFK B;  2F0E A;  4BBS B;  2NWG A;  1TT2 A;  1C4Q A;  4FF3 A;  1Z7T A;  1BCP D;  4LAA A;  2R3Z A;  1QIL A;  1SE3 A;  4ILW A;  4V0B A;  3TZU A;  1FNV A;  1A2U A;  3TSS A;  2RQX A;  2RVL A;  3U9S A;  3DMU A;  5FLX L;  5JVH 3;  3M85 A;  5BN4 A;  2OXP A;  1JCK B;  1H9J A;  1HFG A;  3BDC A;  2K5D A;  2E2J B;  4MHE A;  3NBI A;  1SXT A;  3TBI B;  3QB3 A;  3GTG B;  3A7L A;  1B1Z A;  3KLR A;  2DY8 A;  2F03 A;  3D6C A;  1EIG A;  1S5F D;  4HAE A;  1NR4 A;  5I2Y A;  1I6H B;  4J6H A;  2JA7 B;  4K6L A;  3S1N B;  3X3M A;  4K14 A;  5CV7 A;  5C44 B;  2VNU D;  2XIW A;  3ERQ A;  2CW0 C;  4GZY C;  1ILQ A;  1CA5 A;  1E0B A;  2EXZ A;  2ICE C;  1ZYR C;  3MXU A;  3TN2 A;  1F9P A;  2OT2 A;  3GTM B;  4A3M B;  1SBB B;  1S5B D;  4KY6 A;  1TKW B;  2D9U A;  4ZLT F;  2LS0 1;  3PO2 B;  1H9S A;  4K5W A;  1FYC A;  1XWE A;  3IFD A;  4XQJ A;  5HGT A;  4ZK9 B;  1KAB A;  3S17 B;  1QE6 A;  2HDL A;  2F1M A;  1EQT A;  4OO1 G;  1PRT F;  3M7N A;  1L0X B;  4RGM A;  4H0L C;  2RDF A;  2KHS A;  3URY A;  2NVT B;  4XQN A;  1DOK A;  1SNQ A;  4DU9 A;  5C5M A;  2F0K A;  3HS0 C;  3SR1 A;  2YYZ A;  1XX8 A;  4ZYS A;  1NUC A;  3S2D B;  1DM0 B;  1NCV A;  3PMF A;  1SYD A;  2BE5 D;  5CV8 A;  1CZW A;  1PTO H;  1GHJ A;  3KUP A;  3M4O B;  1SDF A;  1F2M A;  1LTG D;  3EVQ A;  3OWE B;  5KND A;  3FMC A;  1GXD C;  2JA6 B;  1JWU D;  4FNF A;  5C0X H;  2XVS A;  4PNY A;  2B2Y C;  3IFT A;  3DWQ A;  3I3C A;  1XXG A;  4QMG A;  3T51 B;  5KGU A;  3KLS X;  3NPP A;  4IFD J;  1PRT D;  1U4R A;  3PIP 3;  2ENB A;  2HCI A;  4ODG A;  4A3E B;  3VR3 A;  2Z4I A;  2ZXR A;  5JPM C;  1STB A;  2F0I A;  1A6X A;  3GD7 A;  1D5X C;  1OXV A;  2EY5 A;  3PUZ A;  5EBD A;  4HED A;  2F0O A;  4X3T A;  3SK6 A;  3M3Y B;  2B2W C;  3WOF A;  2M9V A;  2VXW A;  2NBF A;  2RDH A;  4DK0 A;  1D5M C;  1WCM B;  2LKV A;  2QF7 A;  1HXY D;  1M4V A;  1WTP A;  1ENA A;  1BNZ A;  5C4J B;  4NKL A;  4K8I A;  2AWO A;  3HGB A;  1Y8N B;  3ZYY X;  1EY9 A;  4WFN 3;  2AUJ D;  2K5Q A;  4LK1 C;  5M5Y B;  1BDO A;  3TME A;  4BBR B;  4K8J A;  1O78 A;  4I65 A;  5C0X I;  3AU7 A;  1E2V A;  5EKL A;  2EY1 A;  3VA7 A;  1PTO F;  1T5X D;  3I70 A;  3NHH A;  4HSV A;  1GUN A;  5IT9 E;  2CVR A;  2XWJ B;  1ONL A;  5JEA G;  3I4M B;  3EJI A;  5E4X A;  5J22 A;  4F8M A;  1Y1V B;  1I4R A;  4RHR A;  1NR2 A;  4ZUI A;  2MPM A;  2SDF A;  4CKB A;  2F0W A;  2A5H A;  5I6Y A;  5EPJ A;  5C3W A;  2KCC A;  2XRQ D;  1Z47 A;  1CM9 A;  1WTW A;  3SDZ A;  1Y8P B;  1J9O A;  2FMM A;  2JSO A;  5IT9 L;  2GA4 B;  2HDM A;  4C3H G;  4XIG S;  1SMY C;  2FIN B;  4XYO A;  3ND8 A;  2R92 B;  5EKI A;  2B8G A;  4HCE A;  3R2T A;  1O80 A;  2SOB A;  3DWA A;  1BCP C;  4DN4 M;  1GUO A;  3K5M A;  3Q22 A;  1VF7 A;  1ZYR D;  4HN7 A;  5JJZ A;  4JBW A;  1PTO D;  5K36 H;  1LTA D;  4WRD A;  5ISR A;  4ZKC B;  3GTP B;  4QB4 A;  1EY7 A;  5KRU A;  2K5W A;  1RKN A;  3MVV A;  1GJX A;  1SNP A;  2DNC A;  4FVM A;  1BR9 A;  3W2D A;  1STH A;  4G4K A;  2A74 C;  4QCL A;  2AQ2 B;  1R4P B;  4V19 0;  1S5C D;  3LWU A;  2SEB D;  1C8C A;  3QIA A;  2L0C A;  3A8J E;  4M1U B;  3OWF A;  5C3X A;  1J8I A;  5IGB A;  1B9N A;  4FF4 A;  1RJT A;  1F9Q A;  3BYT B;  1OO9 B;  5G3L F;  3MEH A;  1JOR A;  2EYO A;  4KKT A;  3A7A B;  2Z4H A;  5IOC A;  4EQO A;  4F7X A;  2PZT A;  5T1I A;  1SJH D;  1STY A;  5KEE A;  1EYC A;  5M9O A;  3G7L A;  3KF8 A;  3NP8 A;  4DF7 A;  3H3V C;  1AEX A;  4RGT A;  4IN3 A;  2RBM A;  3T4A C;  4CHT B;  2N55 A;  3VYU A;  2ZXP A;  4KV6 A;  4BY1 B;  5I2X A;  2K28 A;  4KJN A;  2KJX A;  4OIK A;  3I91 A;  1ESR A;  2L4N A;  2B8F A;  1CQF A;  4BS9 A;  2Z8L A;  3QG1 A;  5ELB A;  2M00 A;  3DM1 A;  5FOB B;  1HUM A;  2PW5 A;  1Y69 U;  2ZT9 C;  4TSS A;  3S15 B;  1II3 A;  2E75 C;  1STA A;  2L9H A;  1LV9 A;  1TY2 A;  4DK1 A;  4BY7 B;  4RCN A;  5G3L D;  1A15 A;  5IIF A;  4A3B B;  1GUG A;  2PQE A;  4IQZ A;  1DOL A;  1E2Z A;  1KLU D;  1EZ6 A;  3R8B A;  5E3F A;  5KNC A;  1FNW A;  2KUM A;  4S3S A;  4C2M B;  3DHQ A;  1RTN A;  5EBC A;  2EY2 A;  1KDC A;  2YU9 B;  1XTC D;  2FHT A;  2EYH A;  2JA8 B;  5D14 A;  2AQ3 B;  3FPU B;  1D1I A;  1GOZ A;  1PRT C;  2A73 B;  1FGB D;  2K33 A;  2WV6 D;  4NW2 A;  5IGG A;  3SHL A;  1U4P A;  2FMC A;  4XXE A;  5DNF A;  2RKS A;  3T13 A;  5IGD A;  5D3I B;  1CFM A;  1SYG A;  1KAA A;  2WII B;  3TP7 A;  4RCO A;  3FVQ A;  1GUS A;  3K57 A;  4K5X A;  4EQP A;  5E1F A;  1SE4 A;  1V1O A;  1LLR D;  5KNB A;  4RAU C;  3I4N B;  5CBA E;  2L55 A;  3KBX A;  2L5T A;  1OXT A;  1IL8 A;  3RD4 A;  1U4L A;  4OO1 H;  1UNS A;  5CV6 A;  5FO8 B;  5C5L A;  1SMY D;  3S2H B;  4IZ8 A;  4X3K A;  2KCN A;  5LHY 1;  4U68 A;  2PPB C;  1HUN A;  3V2T A;  5C4Z A;  1WTR A;  5C4H A;  5EJW A;  4XT1 B;  4DNT B;  1G91 A;  2JYO A;  1AN8 A;  2E2D C;  2F0P A;  4QUC A;  1I4G A;  5K5P A;  1IYU A;  3KK7 A;  1G8Z D;  1HQR D;  4C3J B;  4H44 C;  4A3J B;  3S9W A;  3NTK A;  1MI2 A;  3MXP A;  1FD7 D;  2O2L D;  1V1P B;  4FF2 A;  5I6W A;  3PO3 B;  5I9O A;  2EVB A;  4DAV A;  4O1N A;  2D62 A;  1JOO A;  3R3O A;  5KYL A;  1HA5 A;  3TZD A;  1W6K A;  5IGE A;  3R2I A;  1I3Q B;  4RHS A;  2PMZ B;  1B2T A;  1WTV A;  3NBH A;  2ICI A;  3RLF A;  2J0T D;  3N52 A;  3SXH A;  3P1H A;  3OIP A;  2IX0 A;  2AUK A;  3Q23 A;  4RGO S;  1ENC A;  1X3P A;  5EQ0 A;  3G6J B;  2F0F A;  4OO1 I;  1E2W A;  2K6A A;  3S1Q B;  2K03 A;  2IWH A;  1PTO C;  1DON A;  2EPB A;  3K58 A;  1W6J A;  1PYW D;  4TQU S;  4A3I B;  4R9W A;  3K5O A;  4KY7 A;  3HZX A;  3VR2 A;  2QKI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...