3J7YW

Structure of the large ribosomal subunit from human mitochondria
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
107
Chain Sequence
LGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1030 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j7yW00
4V190 3J7YW
chains in the Genus database with same CATH superfamily
1GUTA 4IUPA 2Q8IB 4DAYA 4HSPA 1AEXA 1MBYA 1P8LA 1NBWA 1WJJA 3ONAB 4M1UB 5DAUA 3PO2G 2PO4A 2NVQB 4OWTB 4EGVA 2LFNA 1X3PA 3NTIA 3HOUH 3BVMA 3L7ZC 5IP9G 1TWAB 3TZDA 4A3FH 3FVQA 4U673 1FJGQ 3Q0AA 3JAMc 4LW1A 2EDGA 3C2PA 2NVXB 4P73A 1SNDA 1FGUA 5DEHA 2XWJB 2WIIB 2HDLA 2CKZB 4MN3A 2CQOA 4K6DA 2OF1A 1L2FA 1WVLA 3GTMB 4TKOB 1PYWD 2KHIA 3NTHA 5J22A 2Q2UA 2VW9A 1N32Q 4LF7Q 1VQCA 1CTMA 1V8QA 2EE1A 4X62Q 3H6MA 2KCNA 1VF7A 2F1MA 1UUPA 3U58A 4A3DG 1B1ZA 5CBEE 4DFAA 1IYVA 2XSCA 1LTGD 1STEA 1WCMG 1S5ED 2BDOA 5I6YA 4MHEA 2XWBB 3QWNA 1Q8KA 3K8AA 4A3MG 1FNVA 3VR2A 2Q2TA 4OONA 3KDFA 4A93H 4RGTA 3PIOA 5C0XI 4ZAIA 1LM0A 1SN8A 3ZYYX 2K33A 5GROA 2X6GA 2LKVA 1X9NA 3HOVH 1UNSA 1SXTA 1MJCA 2F0DA 3TBIB 1U4RA 2CHBD 2B3GA 2RDHA 1B4OA 2JEBI 3EFXD 1I94L 3D4WA 3I55A 5D3DA 1SDFA 1Y1VH 1CZGA 4QIWE 4PZ8A 1C8CA 2RHQB 1U4LA 1YNND 3VYRA 1K3BC 2KENA 4QJFA 1V1PB 3UDXA 3Q24A 5FKAC 5I9PA 1TY0A 2VL6A 2JA6B 1FGBD 4UP8A 3GTQB 5GAEC 1ET6A 1S3OA 4X3UA 3D4RA 2K75A 2PQAA 2PMZB 1PTOD 4IPHA 4WORA 4OXPA 5IP9H 1LTLA 1F9SA 3I4MG 3KFUA 3GO5A 4DV7Q 3M7NA 5IGCA 5KIXA 3S16H 1STNA 1WTXA 2HT1A 1NUCA 1EU4A 4XXEA 3K5MA 4U68A 2K32A 4DF7A 4LFAL 3S2DB 1E0BA 2PZTA 3SK4A 5F2DA 4NXMQ 1HCZA 1A3UA 3J81c 3HG9A 4XQNA 4WRDA 1HTLD 4IZ8A 1ENCA 1YJWA 3QIAA 3VDYA 3NPPA 3UDIA 3NENA 4XYOA 4DR7L 2PI2A 4LJZC 4X3SA 3N6RA 3C46A 3MZ5A 1Q3LA 1FVIA 4A3DH 1D5ZC 1E2ZA 2L4NA 3CPWA 1CK1A 1I6VC 4Q5VA 2K5QA 1WCMH 3RUZA 4XIGS 2R93H 1RDPD 3O13A 1LUZA 3I91A 4A3KG 2KECA 3MA2B 4C56C 1JORA 4A3MH 4KY5A 3PO3G 1JT8A 2DY7A 1G51A 2ZTDA 4EVOA 1I6HH 1PHJA 4GN5A 1IBMQ 4HIOA 2CQAA 3RZDH 3GTKH 2VQEL 2FMMA 2ZTCA 3CD6A 3ULPA 4EQ5A 2PNRC 4DV4L 4O1NA 4BA1I 5IT9E 1FR3A 1VMPA 1XTDA 1D8LA 2SOBA 2B39A 4F88A 4YWMA 1IKMA 4C3JH 5FLMG 2F0EA 2NVYH 3CCEA 2MGSA 2QILA 4JI7Q 2R7ZG 2NVTB 1QNKA 3NBHB 4OO1G 1I4RA 3RLFA 4LMQD 2LMCB 1TY2A 3AMUA 4WFN3 4F7XA 5C6AA 5FLXL 1BOSA 1KRSA 2YTVA 4P74A 2M00A 2YTXA 1G8ZD 4BBRG 4APVA 1D1IA 1WI5A 1B70B 4AQYL 3J80i 4RH6A 1YEZA 3T16A 1EOTA 1EQVA 2G9HD 5TSSA 4XQQA 3RZOB 1VQDA 2D5DA 2EZVA 2E2HB 4PMBA 4A76A 4DN4M 1M90C 1LT3D 3LWEA 1HJPA 1IKLA 1XPUA 1R4QB 4GS3A 4DK0A 1PH4A 4JG2A 4L5QA 1SJHD 1KNEA 3I4MH 3QR8A 1K9MC 3T1HQ 5DM63 1LTID 3GV6A 2KCTA 5KRUA 3NWTA 2AUKA 1LTSD 4A3CG 2JYOA 3K59A 4KN7C 4R9WA 1EY9A 4ALPA 4QMGA 1YJNA 1K0RA 4P2CB 2A6ED 1CKNB 1B7YB 4KHPQ 2RSNA 2EJFC 1HA6A 1A2UA 2LXJA 1JJ2A 2KOLA 4JBMA 1EY4A 2Z4HA 1A15A 3NHHA 4JV5L 2K5DA 1PFSA 2UU9L 4A3KH 3CU7A 4RCOA 1CHPD 5M5YH 5M3FH 5A2QE 3L9AX 2QA4A 1EYGA 3H3VI 1PZID 2J0TD 3KLSA 4P72A 3PO3H 4YY3L 3E0EA 1FNUA 1QE6A 4X3KA 4L5SA 2EJMA 3HOUB 5EPJA 1W2BA 1DYQA 3E5SA 1F2ZA 4O0AA 1OTCA 3NQIA 3MXGA 2P5ZX 4JI6L 1HFGA 1V1PA 1GUSA 1LYLA 4LFBQ 5M5XH 1PH6A 4IJLA 2ZJRA 3AB9A 1OXTA 4V190 1RTNA 3K5LA 5EQ0A 3I3CA 1VMCA 1F2LA 1K83H 3GP7A 1VQ4A 4HIDA 4JI2L 1NR4A 4PZ7A 4E6IA 2JA8B 2PZUA 1M4VA 1E2VA 3KF6B 4PZ6A 4TSSA 3H0GG 2K5VA 1G2SA 2NN6I 2YV5A 4KV6A 2VQFL 1QVFA 1E1OA 1NTGA 3TP5A 5C4XG 2AWNA 1T9HA 1TWAH 2FHTA 4GN4B 1N33Q 3PIO3 5D14A 3BYTB 3CKIB 4GKJL 3L3OC 4A93B 1IL8A 1O80A 1TXYA 2JQOA 3K6OA 2L55A 1CT1D 3H94A 5CV5A 1BVSA 2KHSA 5LMNL 4A3GG 1B2TA 4LF6L 3RN5A 2BH8A 1B8AA 1BXTA 2B2YC 3HOVB 1VQFA 4IUVA 5J1ZA 4DNIA 5IGBA 4KKUA 5JOBA 2EIFA 4QF4A 1HNWL 1EIFA 1PFNA 2E74C 2RCFA 2I46A 3EIVA 2BE5C 5C0XG 4A3CH 5K36G 1PRTF 5EKLA 3T13A 2JN4A 2K05A 4BY1H 4POGA 3M3YH 1J8IA 5EBDA 3W3AA 1YIJA 1N36L 1WTWA 4FXDA 1DOLA 4J15A 3D6CA 1A2TA 4X66Q 4JPBW 4X65L 1S72A 3QO2A 4GLVB 4JI5L 3J80c 2B2YA 3L0OA 2EOTA 3PO2B 4F87A 4JOIC 2KQ3A 4BBSG 2Z6BA 2Q8TA 2WAQB 1L0XB 2RCNA 1YHAA 3S2HB 4JI4Q 1SYFA 2H5XA 3I70A 3I4NG 2E75C 4QIWB 3DM3A 2NBFA 3BZCA 2ID0A 1NCVA 1U5KA 3OSOA 4JI0L 3W5OA 3D0FA 1SSOA 5CR3A 5JJKA 4HTHA 1BCPD 5LL6X 3J7AF 1CHQD 4GKKL 4KN4C 2B63G 1A63A 3TN2A 1X3FA 2JA6H 3HRZC 5GAGC 2K14A 3GTQH 2MJ8A 4LF9L 4A3DB 3DLLA 2Q2IA 2AKWB 5C4XH 1WCMB 4JOIA 4AH6A 1XNQQ 3PGZA 4I7AA 4UP9A 2SNSA 1PFBA 2KVMA 4FO2A 3TZUA 2KJXA 3L2PA 1ML0D 4A3MB 5FO7B 1CKNA 5KGUA 3MC0B 1I6HB 3X3NA 3RZDB 3GTKB 1EIHA 1JR0D 4HSVA 5IWAQ 1RF2D 2VNUD 2PW7A 2L15A 2C5CA 5M9OA 3NK9A 2V4DA 2E5LL 1HNZQ 1VQ5A 4OWWB 4ZQ3A 1SYGA 3HOZG 1EYCA 1Q12A 1RKNA 5C3WA 4IPCA 1MKHA 2FINB 4DUYL 4V0BA 3QB3A 1TS4A 5KNDA 4L5RC 5K36H 3PUXA 4A3BG 5KNCA 3OTOL 4DV5Q 1CM9A 1PH8A 4UAIA 1R9TH 4LF8Q 3KYHC 4NDXA 2F0UA 1ONLA 4JI8Q 4XYQA 4CJ2C 3CCLA 1SBBB 5FOBB 4ODGA 2Z8LA 4CBVA 3EA6A 2HCCA 1O7LA 3KF6A 2MHVA 4DR4Q 4C1NI 1HZ9A 2MO0A 1HTPA 5JJIA 1A0IA 4HJ5A 3CW2C 5ELDA 1Z6HA 1LACA 4NXNQ 5C5MA 3WOFA 4I7ZC 1SNQA 1CUKA 3S14H 1X54A 4DR5L 4B3RQ 4PMWA 1JB3A 3I4MB 1KDBA 5LMUQ 1HNXL 2DJFC 1VQIA 3I4NH 1XNRQ 2R3ZA 3CRKC 2F0NA 3ULJA 2Z6KC 4DR1L 2MQHA 2PQAB 2VZAA 4FVMA 4M8AA 3STBD 1HFNA 2OTLA 3RZOH 5JVH3 4CKCA 4HIMA 1XMOL 1EYDA 5AJ3L 1WTQA 2XGTA 1N34L 2EY1A 3HOWG 5ELFA 1D7QA 1VQEA 5EJWA 5LHY1 4A3KB 4K0KQ 5M5YB 5M3FB 2OCEA 1RCVD 3A56A 5IGFA 1PLFA 2YYZA 3U50C 3PO3B 3J81i 4NW2A 2Q2HA 3E6ZX 4LUVA 1S5DD 1SEBD 4X64Q 1XXGA 2EXDA 2QDBA 3CCRA 5LMNW 2ZTEA 1F9PA 1SROA 1LTAD 2RF4A 5M5XB 1EEFD 4HCSA 1EWIA 3HOZH 4PG3A 4YCVA 3IFDA 1GUOA 2EY2A 2XN9C 1K83B 1PRTB 1SRUA 1HZAA 2QCPX 2DNCA 5EKIA 2HIXA 2PCFB 2RSOA 3K7UC 2R7ZB 3OMGA 1R4PB 1FJGL 4DR2Q 4MNOA 2NTTA 1HR0L 1GUGA 3DUZA 1JE5A 2N88A 2N49A 3DMUA 3OMCA 5FLXE 1EFID 2A69C 2R7DA 3Q6SA 3LX0A 1EL0A 1MHWC 2CH4W 4ABNA 2Y0SG 3G6JB 5E3FA 4BBRB 4DR6Q 4ZUJA 3CCQA 3BYYB 2K28A 1STAA 1WD1A 4KKTA 1RL2A 4LF7L 1MJEA 1PYBA 4X62L 4X6AH 2JE6I 1K0SA 2MFIA 4FXGC 4MTNA 1UE6A 1YHBA 2ICEC 2UUCQ 2AWOA 3A74A 3P1HA 4RHSA 4DA2A 3U4ZA 5IOCA 2NN6G 1HPCA 1TS3A 1K8GA 1W6JA 2DY8A 5JJLA 1PH7A 2JA8H 1NJIC 5IP7G 1MGSA 2K5HA 4I65A 2AHOB 5C4JH 4HR7B 2PQEA 4G57A 2K6AA 3M85A 3MXNB 1K8OA 1O7YA 4DAPA 4MTKA 1WTHA 4DV1Q 2BH2A 1Q1BA 1SMYC 4BY1B 2DUDA 3M3YB 4KK7A 5C4HA 2K04A 1AE3A 2B2TC 3F2DA 1U4MA 5IIFA 3RNUA 2DGYA 3TSSA 3J81j 5CORA 3HOWH 3SE0A 3UI2A 2OQKA 2UXBQ 4DV0Q 1Y8OB 2R7FA 1H9RA 1KAAA 3TP6A 3SVMA 5ISRA 2XVSA 3HOYG 1VQ6A 2ENBA 3CRLC 1K8AC 2Y0SE 1UE5A 3PUVA 4JVZA 3D3RA 4K5WA 1PH3A 1HUNA 1TS2A 3MXUA 3Q23A 2G5DA 5G3LF 2CWPA 2EYJA 1J5EQ 1CSPA 1S5CD 2WFWA 2B2TA 1SYEA 2VUMG 4H44C 3PSIA 1PH9A 5J3BA 4DV7L 4OL7A 4CKEA 1Q81C 2F03A 1DZ1A 4TVAB 1PV4A 3SK8A 2HHHQ 3OW2A 2KA7A 2VS1A 2JA5G 3EROA 3H0GB 3PO2H 4PQXA 3W2DA 5C4XB 4NXML 2D0OA 2GN5A 3GDEA 2K03A 1DM0B 3S2HH 4XTCS 1GKHA 3K5NA 2PW5A 3E3XA 4R8NA 4DV2Q 1VQ7A 3CQZH 1EZ8A 4ZK9B 1PRTC 1I5FA 4KY6A 4A3LG 3NEMA 4HEDA 4LF4Q 1MIUA 3MEFA 3R3OA 4HN7A 1LTTD 2R92G 3WOEA 2NN6H 1KNAA 1T5XD 4DV3L 1TR5A 3URYA 2EYHA 3W1BA 1Y1WG 1VQHA 5IP7H 3GTGH 2EQSA 1K28A 1EWCA 2MNAA 3I7FA 1E2WA 2F0OA 3I90A 2KCCA 2IHFA 3PIPA 1D1KA 3CC4A 2AUJD 2EYLA 2UUAQ 2F4VQ 3FKIG 5KYLA 1X3GA 3NTKA 1R9TB 3JAML 4JI7L 3NP8A 3MFYA 4DK1A 4IPGA 1WD0A 3EJIA 2RVLA 2ZXOA 1SYCA 5E4WC 1IBKL 5GADC 3RLNA 4NP5A 2PNHA 2LSSA 4KLKA 1HUMA 3T53B 2VB2X 1B3QA 2GVBA 3KLSX 1HHVA 1KLGD 4IALA 2K01A 5GQOA 3T1YQ 1NMGA 3I72A 4DR7Q 1O7ZA 4BBSB 3NWSA 3HOYH 2I07B 4K8JA 3S14B 3A8KE 5CV8A 1TWCB 3HEJA 2F52A 3R93A 5LL6S 3U4VA 1BKBA 1I4GA 3F2UA 4PNYA 4C3HG 2K7VA 5HURA 1EWHA 3TDQA 3I4NB 5CMDA 2ZXRA 3JC66 1IW7C 3FP9A 1IBLQ 4JI3Q 2A6HC 1S40A 1BBUA 1TS5A 4DV6Q 1I4XA 1OXUA 5M3MG 3E9HA 1OXXK 1QNUA 5C3EG 3EBEA 3NBIA 1VQ8A 1MI2A 2VUMH 1QVCA 2B63B 2EVBA 4LK1C 1HR0W 2D0PA 1CA5A 3T1HL 5IYDG 5CC4A 3H09A 3TS0A 3FDTA 3Q8DA 4ID6A 5CV9A 2MPMA 1JQYD 3MXNA 1XPRA 2F0PA 3CAMA 4CDCC 1QVGA 1E7ZA 3RN2A 1ZEQX 2A74C 1A62A 4N9TA 1GVPA 2ZXPA 3PF5A 4KHPL 1VCIA 4IUUA 2HUGA 2A68C 3K0YA 3CCMA 3CCUA 1UEBA 5IT9c 4LFCQ 4N8FA 1SYBA 1ZKOA 1UAPA 2IX1A 3TMEA 1VS0A 2OT2A 3EN2A 4ZRZA 2HD3A 4HJ7A 2I0QA 2M9VA 5IYCG 1LLRD 3HOZB 1BF4A 1Y1WH 3M4QA 3H91A 4DR3Q 1E24A 4HJ9A 2F0SA 4RMFA 4C3IG 1IYJB 1YNXA 4LFBL 2I5MX 1EIGA 1F2MA 1LTRD 1OXVA 5I4DA 4A3BB 1Q8IA 3FKIH 3E0JA 2WB1G 1HXYD 2NB0A 2L5TA 2WINB 4H0LC 4Y52H 3R2TA 1B53A 4RKBA 2EYMA 4DU9A 1Q7YC 3A7AB 3KJOA 1GXDC 4YHHQ 1X56A 3VYUA 4IN3A 3G48A 5FLMH 1NNXA 1HH2P 1GO3E 2L9HA 4Z9CB 1N33L 3J7ZC 2BCOA 2R7ZH 4OO1H 4Y7NB 1AZQA 1KDAA 3HKSA 1PA6A 4DNTB 3MWYW 1YNJC 5C4JB 1ESFA 1PH1A 3PUZA 3VR6A 1GM5A 2ZJQA 2NZHA 1UE1A 1SE8A 2LXKA 1GJXA 4BBRH 1OXSC 1YZ6A 2PZWA 4NMZA 4RAUC 5C3EH 5JEAG 4A75A 4OEMB 5E7NA 4GLAC 3UE1A 3B6YA 3RR5A 4BY7G 4YIJA 3FPUB 3G7LA 1MSGA 3HOWB 1D5MC 2RHSB 4JW0A 4QUFA 1U4PA 1LT6D 1E1TA 4OGQC 4NKLA 3J80E 2X6LA 3K57A 2K4KA 4UDUC 4JI2Q 1Q86C 2UUBQ 4K2KA 4JI1Q 3H15A 3AFPA 1KC8C 2UXCQ 2XRQD 3PQIA 5M5WH 3FHWA 3I4LA 4AYBG 3I8ZA 2JP1A 1STYA 3DXJC 1EQQA 1PRTD 2CW0C 2WB1E 4RCNA 1LT4D 3S1NH 1ZYRC 4DNRB 2A19A 4F8MA 1KABA 5JVG3 4P75A 5HY6A 4FDBA 4X66L 2K5NA 1PTOB 1LT5D 2KEDA 5I2YA 5I2XA 4WJ3M 3IAYA 3W1GA 5IYCH 3K5OA 2M2LA 2A1AA 4OIJA 4GKJQ 2B8GA 4B3MQ 3FPPA 2K5WA 1MSHA 3S1RH 4JI4L 1E22A 3KUPA 3GTOH 4IPDA 1TQOA 5C3XA 2AMCB 3OYYA 1F9RA 5CV6A 2EYOA 3M7GA 1JWMD 1HZBA 3I73A 5DNFA 1DOMA 3TP7A 2F0IA 5C0XJ 1EY8A 2Y0SB 3D6WA 4IURA 1YJ9A 2WKCA 1HNWQ 1YI2A 3G4SA 1QJOA 2B29A 2GA4B 1FD7D 1H9SB 3DWQA 4XQJA 3CQZB 4G4KA 3LGJA 1I4HA 4K14A 3LNNA 3S24A 1J6QA 5BR8Q 3UE0A 2F0HA 3FRPB 4YCUA 2IL8A 4X3TA 1JJGA 1XNQL 3CF5A 2RBMA 4JYAQ 1BBWA 3OOCA 2D9UA 2J7ZA 4OWXB 5FJ8G 3H0GH 3GTGB 2B8FA 2KCMA 5IWAL 3GTPH 4AYBE 1VQMA 2A6HD 5HGQA 2IWHA 1Y69U 2XRSD 1HNZL 3D4DA 3U9OA 1ILPA 1GHJA 3A8IE 4KJNA 1S5BD 3IL8A 1GHKA 3R8BA 1HRJA 1CSQA 1FYCA 1PH2A 1JOOA 1QUQB 4B3SQ 2BA1A 1NY4A 2FMCA 3S9WA 1L0WA 5KYIA 1AW7A 1EFWA 4A3GH 1XMQQ 2E8GA 1S5FD 1Z47A 5JPMC 2LY7A 2V1CC 4DV5L 4CHTB 1OO9B 4LF8L 1Z7TA 4GZYC 1TWFB 2ZT9C 4LWCA 3HOYB 2ZM6Q 4QY7A 4JI8L 4LF9Q 4A3EG 1AN8A 3CPFA 5C0XH 3C1FA 5EPLA 4DR4L 1VQPA 1SMXA 1SJED 3P75A 4NXNL 1YNNC 4QUCA 2I5LX 3RMHA 2N78A 3M4YA 5CBAE 2F0VA 4A3JG 4B3RL 1KIXA 1JOQA 4RFBA 5CGKA 3TREA 2VUMB 5LMUL 3F2CA 4GLXA 1XNRL 1SNOA 1F2YA 2JA5B 2BDNA 1X55A 4BBSH 2F0GA 2NUCA 5EAYA 1PTOC 1PZKD 3HOUG 2JK8A 1WTPA 1TWCH 4A3FG 3KLWA 4QB4A 2OXPA 3BDLA 4S3SA 4QL5A 1I4QA 3IFTA 3I2ZA 2AQ1B 2N3SA 3H3VC 1VQGA 4HIKA 3T56B 4DUZQ 4FF2A 2X69A 2RDGA 1CQFA 2WKDA 4YWLA 1SE4A 3PF4A 4K0KL 2R92B 4IFDI 3OWEB 3A5UA 4OX9Q 4RA8A 4G7HC 2B63H 2NYZD 4ZKCB 1SNCA 3IRBA 3NELA 5IE8A 3J7AV 2A73B 3OWFA 2VB3X 1JOKA 5JAVA 1Y1WB 1SNPA 4N8X1 5FJ8H 3Q22A 3OHXC 4X64L 3N52A 4PMCA 1KD1C 5ELNA 4J8QA 4WJ4A 2B2VC 3J80L 1VQ9A 3MHBA 4PV1C 1H9MA 2IPKD 2RKSA 3T51B 1EY6A 3PV0A 2SEBD 4MIUA 3ICEA 1EUJA 2EY6A 3FKIB 3P20A 3JAME 3GTJB 4LF5Q 5JPNC 3UDGA 3NE5B 3KBXA 5EBCA 1QZGA 1DOKA 3A0JA 4CJ0B 4DR2L 3DM1A 2Z4IA 3AQQA 4DAMA 1WTVA 1QG7A 2IJ0A 3ND8A 3HOVG 4R1JA 1PVOA 2RQXA 1NSNS 1XJVA 4Q0FA 2XTIA 3GD7A 4K2LA 2RDFA 3S15H 1HA5A 1N34Q 4ZKBB 1VQKA 2B2VA 1H9SA 4CDFC 4O42A 2BE5D 1XPOA 5IGGA 4B3TQ 4C3HB 1C0AA 4A3BH 1H9KA 3BZKA 1Y1VG 2KHJA 2J4XA 1CI3M 2Z1CA 5NUCA 3KJPA 5M3MB 4A3JH 4K5VA 5C3EB 3SEBA 1N32L 1RODA 2UXDQ 1PYSB 1BO0A 1C4QA 5EPKA 2G9DA 4FP5D 3F2BA 3KLRA 1SE2A 3VYSA 1TVXA 1BNZA 4A3IG 2HQEA 1W3SA 2WAQG 1II3A 4FYDA 3IKJA 1HQRD 4JK1C 4Y7NH 3CP0A 4WJWA 5BN4A 3KOJA 4DV1L 2L0CA 1MD2D 5M5WB 1HR0Q 1O7IA 1X65A 1QUQA 2NZ1D 1UE7A 1TWHH 1IL2A 4HJ8A 3S1NB 1M8AA 3KK7A 2Z0SA 4QGUA 3NSWA 1QB5D 1YVCA 2UXBL 4DV0L 2A6EC 3DHQA 3M4PA 3VR4A 2E76C 4ILWA 1G6PA 4LUOA 2KUMA 3S1RB 1F9QA 4C3IB 2R93G 1BCPB 1QWYA 3GTOB 5FLXc 3GQBA 5IYBG 1YITA 2JA9A 1WTOA 3GV3A 2HCIA 1J5EL 1IZ6A 1NE3A 2QGQA 2CH4A 1EOVA 2TSSA 2WB1B 3FEWX 4KJOA 2YU9H 1KXLA 2PPBC 3K81C 1JMCA 2R6GA 4H7BA 3WWVA 5G3LD 2AQ2B 1PTOH 2HDMA 4GNXB 4UP7A 3QG1A 3CMEA 3PUWA 2HHHL 1CKOA 3J81E 1M1KC 4C3JG 1A3TA 3AYHB 1ENAA 2D62A 2OWOA 5FO8B 3H3VH 1G2TA 3CCSA 2WAQE 4N9PA 4DV2L 1C48A 3QOJA 2TMPA 3TQYA 3S17H 4P71A 1WOCA 2F3VA 5D3IB 3GTPB 2H1EA 2ICIA 4LF4L 4DAVA 1Y8PB 3BS1A 4IUNA 1I94Q 2BOSA 2IT1A 4KKSA 3HOXG 1STHA 1EY5A 1L1OB 2KEEA 3BJUA 4R8IA 1JICA 4RKLA 1IHZA 4BY7B 2IX0A 1DGSA 3KF8B 2E2IH 4A3GB 4LAAA 4ULLA 4A3IH 4HAEA 3ND9A 5C4ZA 2UUAL 2F4VL 1PTOF 1SLJA 3MVVA 1IBML 1JCKB 1KTKA 3F1ZA 4AYBB 2K50A 1PZJD 1AP0A 3HS0C 5I6WA 1N9WA 3HKZG 2E2DC 1X3EA 1JJCB 1Z9FA 4ME3A 2QKIC 1T5EA 1A8VA 1TU2B 4UPAA 5CV4A 5KEEA 1D2BA 1Q82C 2EYPA 3T1YL 5EKKA 5K5PA 4KTAA 3AEVA 4FNFA 5DM73 3DEPA 4LFAQ 3TS2A 1X3QA 1TWGH 3K7AB 3SXHA 5IYBH 5M3FG 2ES2A 4DV3Q 3SHLA 3RD4A 2HIVA 4JI3L 1IBLL 1TWFH 2C35B 1H9JA 4QCLA 4DV6L 3OPOA 2FXQA 3SK5A 3DWAA 5CYUA 3QOLA 2YTYA 2QEJC 1KDCA 4KD4A 4IO9A 2JA7G 4OELB 2E2JB 1EY7A 1UEAB 4BXXG 4H13C 2A5HA 5ELCA 1BCPC 4LUZA 1ET9A 3DEOA 3C3LA 5C44G 2VQEQ 4R4TA 4O2DA 4DV4Q 4R4QA 1V9PA 1Y14B 1IBKQ 3S1MH 1K3RA 4CDDC 3M4OH 3A8JE 2JJQA 5A35A 1K73C 1PDQA 2JA5H 4AIMA 3K0XA 4GOPB 1VQOA 4LFCL 2A69D 1SR3A 2I5HA 3VYTA 5JJZA 4NPSA 3PUYA 1KLUD 4GNXC 3ULLA 2C9OA 1NR2A 3HKZE 3SR1A 4CDEC 4JBKA 3CC7A 3HGBA 5ELBA 5IY0A 3SGIA 5FO9B 2MUYA 3HOXH 3CCJA 4XT1B 3V2TA 3BVGA 4IFDG 2BA0A 1KL9A 1RTOA 5T1IA 4A3LH 4DR3L 3VA7A 3BVZA 3PMFA 3FMCA 1W6KA 2R92H 1I50H 4EX5A 3M9BA 1O78A 2F0WA 2EPBA 4AQYQ 4YWKA 4FF1A 3F8TA 1A3VA 1UWVA 3BZDB 3ERQA 2F3IA 2PI2E 1SFOH 1NAPA 2EXZA 3S1QH 1I4PA 5ELEA 3S15B 3P7JA 3HFZB 2K1BA 5DLQE 4A3EB 3CC2A 2O2LD 4TRDA 3SK6A 1L1OC 4FXKC 4GNXA 4IFDJ 4YHHL 4XT3B 3BG3A 4BY1G 1SMYD 2FFKB 2F0MA 2D2CC 4RGMA 4HMIA 3GTJH 2GVAA 1JWSD 5T1GA 4A3JB 3NQTA 2F0KA 4R4IA 1PXUA 4JBWA 4QQBX 1ESRA 1BQQT 1A6XA 1DCZA 1LABA 3J81L 4C2MH 3AFQA 1I3QH 2MO1A 3V05A 2SNMA 1LO5D 4KHVA 2WV6D 1Y8NB 5L37A 3G6EA 1EIYB 4DXFA 1JC7A 4RGOS 3PCOB 4DK3C 3GTLH 4A3FB 1PMRA 4JV5Q 2O5JC 2UU9Q 4BS9A 1KQSA 4C3HH 1SE3A 1L1OA 1JE4A 1HQMC 2JA7H 1D6EC 4BXXH 1TWHB 3MTSA 4YY3Q 1G291 4RGNA 3KF8A 4A4IA 5M3MH 4DPGA 2UUBL 5C44H 4JI6Q 2CFMA 4JI1L 3STBC 1EYAA 1E3PA 3A54A 3MEHA 2UXCL 5EGTA 4RG1A 3CXCA 5ELOA 2JA6G 5IYDH 4L8JA 4IOCA 2F0LA 3K58A 2IHEA 4OIKA 1CFMA 2FJ2A 4DGZA 2NVQH 1XX8A 1P16A 5J39A 2CVRA 3C1EA 1U0LA 4GN3B 4CJ1B 3T4AC 2K52A 2DJGC 3ERSX 1RD9D 1WFQA 3X3MA 1N8RC 2MP1A 5COYA 1JB7A 4UHVA 2F4IA 3NXWA 2NVXH 4IFDH 4B3ML 1VQJA 2YU9B 3QJYA 2VQFQ 2EJGC 2QF7A 4IUTA 5JEAJ 1QOHA 3GTMH 3ITPA 5I9OA 3J7YW 1XWEA 3DWPA 2QW7A 2ALYB 1G6ZA 4GOPC 3V96A 1STGA 1XTCD 3LWUA 1PFMA 2EY5A 1TT2A 1ILQA 4KHZA 2WACA 4C3IH 2HQLA 5LMNQ 2QDLA 4LF6Q 3J7A5 4ME5A 1VQNA 4FF4A 1RIPA 3S17B 3BU2A 2EYFA 1B50A 3CHBD 2NWGA 5FK9C 5BR8L 4EQPA 1Y1VB 3OW7A 1CA6A 2B2WC 2L1BA 4RHRA 1DJRD 2CCZA 4C1NK 4JYAL 3SDZA 1V1QA 5IT9L 3NBHA 2SDFA 4K5XA 4JC0A 1JWUD 1EQRA 2NZOA 5HGTA 1B44D 1Q90A 4GOPA 4B08A 2IY5B 1YBYA 2E2IB 3G71A 4A3IB 1B9NA 1N36Q 2ASBA 3R2IA 4KD3A 1FL0A 2L11A 2PMZE 4DAYB 1TIID 5C5LA 1DD2A 4JBJA 2IW3A 1VQLA 5E1FA 1SAPA 2KBNA 4X65Q 3S16B 3PIP3 1VQBA 3VA5A 1EZ6A 4K6LA 3NUCA 2CWAA 4JI5Q 1EY0A 3MXPA 1AE2A 4B3SL 2OEOA 1IW7D 1KHIA 4DKAC 1BUVT 1X6OA 1ASZA 3WDNA 3A55A 4DK6C 1XMQL 2B2WA 1AFPA 4EQOA 4JCVE 4DXGA 1BCPF 3D31A 5JEAH 4B9WA 1V43A 3OIPA 1ENFA 2H4OA 2VXWA 4BY7H 1K8MA 3A5ZB 2ZM6L 1KRTA 4KI0A 1KAWA 1NMFA 2B2UC 2NTSA 4JI0Q 4TQUS 1ICWA 4FF3A 5BN3A 2ATWA 3JAMi 2R93B 4XDXA 1STBA 2Q8RE 1GUNA 4GKKQ 1TWGB 1CQVA 1FNWA 4J1MA 1Q46A 1GD7A 3EVQA 2OQ0A 4IJHA 2R61A 3TEHB 2A68D 3OIQA 4B9XA 1AH9A 3BDOA 1X32A 3S2DH 3KBGA 3E9IA 1B3AA 1HZCA 1C9OA 2IX3A 3K80C 1VDZA 5GAHC 1G91A 4POFA 1ICFB 1XYIA 1RJTA 4KY7A 4C3JB 3KDFB 2NVYB 3ER0A 1DXMA 3RLOA 2JEAI 4CGYB 2JXMB 2VY3A 4IQZA 4BWGB 1SNMA 2B2UA 2QEXA 1QCBD 1WYDA 3K7AH 4ZYSA 5E4XA 5A2QL 2E5LQ 3AU7A 1LTBD 4EQNA 3S1MB 3UDFA 4KMUC 3M4OB 1AZPA 2Z9HA 1LV9A 4NB3A 4OO1I 4DUZL 1SYDA 2WP8J 4R4OA 4OX9L 3ZJYC 4DUYQ 1IYUA 2DN8A 4MZ9A 4ZCKA 2O5IC 1VQAA 1J9OA 3MFGA 4OHJA 1IXRA 2F0JA 4HJAA 2N8NA 3HOXB 1C7YA 2E2JH 4IOAA 2F0QA 1H95A 2DNEA 3OTOQ 5H1SE 5IODA 1EQTA 3HZXA 1GOZA 3VR3A 2F0FA 5IGDA 1I50B 2NVTH 5KNBA 4LNQA 1QILA 2JA8G 4K8IA 4HCEA 5CV7A 3TRZA 2L12A 2PYKA 4L6TB 2OTJA 1SFOB 1D5XC 5BN5A 1YNJD 3I56A 1YHQA 1QZHA 4LF5L 3TP8A 3S1QB 2A8VA 3HKZB 2RA4A 1TKWB 4DR5Q 1BR9A 1L0YB 2ZJPA 1BBXC 5IGEA 4G7OC 4IUQA 4A93G 1EEID 1CZWA 1HNXQ 4ZUIA 1VF5C 3BDCA 3VR5A 4L5TA 1BDOA 1U9RA 3I4OA 4R4CA 4CKBA 3MAQA 2E2HH 4UY8C 4DR1Q 1GUWA 4G7ZC 3EQLC 4B3TL 2F0TA 1DONA 2XNAC 4C2MB 1B9MA 5D65A 1I3QB 2JSOA 1ASYA 3CMAA 1WTRA 2N55A 1XMOQ 4DR6L 2F3WA 1CKMA 3GTLB 5AJ3Q 2CW0D 4A3EH 2O4XA 1ZYRD 1F77A 2Z6KA 3U9SA 2UXDL 2XIWA 1PH5A 3D8GA 3HP3A 1Q1EA 2JA7B 2UUCL 4RWSC 4YCWA 4BA2I 2AQ3B 1V1OA 3A7LA 1S4ZA 2LS01 1EU3A 1ZXTA 4J6HA 3CCVA 4H02A 4ZLTF 4L63B 4HMJA 1RHPA 5AFWA 5C44B
chains in the Genus database with same CATH topology
1GUTA 4IUPA 2Q8IB 4DAYA 4HSPA 1AEXA 1MBYA 3ONAB 4M1UB 5DAUA 2PO4A 2NVQB 4EGVA 2LFNA 1X3PA 3NTIA 3BVMA 3L7ZC 1TWAB 3TZDA 3FVQA 4U673 3Q0AA 2EDGA 3C2PA 2NVXB 1SNDA 5DEHA 2XWJB 2WIIB 2HDLA 4MN3A 4K6DA 3GTMB 2OF1A 1WVLA 4TKOB 1PYWD 3NTHA 5J22A 1CTMA 1V8QA 2EE1A 2KCNA 3H6MA 1VF7A 2F1MA 1UUPA 1B1ZA 5CBEE 4DFAA 1IYVA 2XSCA 1LTGD 1STEA 1S5ED 2BDOA 5I6YA 4MHEA 2XWBB 3QWNA 1FNVA 3VR2A 4RGTA 5C0XI 4ZAIA 3ZYYX 2K33A 2X6GA 2LKVA 1UNSA 1SXTA 2F0DA 3TBIB 1U4RA 2CHBD 2RDHA 1B4OA 2JEBI 3EFXD 3D4WA 5D3DA 1SDFA 1CZGA 1C8CA 1U4LA 1YNND 3VYRA 1V1PB 3Q24A 5FKAC 5I9PA 1TY0A 2JA6B 1FGBD 3GTQB 1ET6A 4X3UA 3D4RA 2PMZB 1PTOD 4WORA 1F9SA 3GO5A 3M7NA 5KIXA 5IGCA 1STNA 1WTXA 1NUCA 1EU4A 4XXEA 3K5MA 4U68A 2K32A 4DF7A 3S2DB 1E0BA 3SK4A 2PZTA 5F2DA 1HCZA 1A3UA 3HG9A 4XQNA 4WRDA 1HTLD 4IZ8A 1ENCA 3QIAA 3NPPA 4XYOA 4LJZC 4X3SA 3N6RA 3C46A 3MZ5A 1Q3LA 1D5ZC 1E2ZA 2L4NA 1CK1A 1I6VC 4Q5VA 2K5QA 3RUZA 4XIGS 1RDPD 3O13A 3I91A 2KECA 3MA2B 4C56C 1JORA 4KY5A 2DY7A 4EVOA 2CQAA 2FMMA 2PNRC 4O1NA 4BA1I 5IT9E 1FR3A 1VMPA 2SOBA 2B39A 4F88A 1IKMA 2F0EA 2MGSA 2QILA 2NVTB 1QNKA 4OO1G 1I4RA 3RLFA 4LMQD 2LMCB 1TY2A 4WFN3 4F7XA 5C6AA 5FLXL 1BOSA 2M00A 1G8ZD 1D1IA 4RH6A 3T16A 1EOTA 1EQVA 2G9HD 5TSSA 4XQQA 3RZOB 2D5DA 2EZVA 2E2HB 4PMBA 4DN4M 1LT3D 3LWEA 1IKLA 1R4QB 4DK0A 1SJHD 1KNEA 5DM63 1LTID 3GV6A 5KRUA 3NWTA 2AUKA 1LTSD 2JYOA 3K59A 4KN7C 4R9WA 1EY9A 4QMGA 4P2CB 2A6ED 2RSNA 2EJFC 1HA6A 1A2UA 2KOLA 1EY4A 2Z4HA 1A15A 3NHHA 2K5DA 3CU7A 4RCOA 1CHPD 5A2QE 3L9AX 1PZID 2J0TD 3KLSA 1FNUA 1QE6A 4X3KA 2EJMA 3HOUB 5EPJA 1DYQA 3E5SA 1F2ZA 3NQIA 3MXGA 1HFGA 1V1PA 1GUSA 3AB9A 1OXTA 4V190 1RTNA 3K5LA 5EQ0A 3I3CA 1VMCA 1F2LA 3GP7A 1NR4A 4E6IA 2JA8B 2PZUA 1M4VA 1E2VA 4TSSA 2NN6I 1G2SA 4KV6A 3TP5A 2AWNA 2FHTA 3PIO3 5D14A 3BYTB 3CKIB 3L3OC 4A93B 1IL8A 1O80A 3K6OA 2L55A 1CT1D 3H94A 5CV5A 2KHSA 1B2TA 1BXTA 2B2YC 3HOVB 4IUVA 5J1ZA 5IGBA 4KKUA 5JOBA 4QF4A 1PFNA 2E74C 2I46A 2BE5C 5C0XG 5K36G 1PRTF 5EKLA 3T13A 2K05A 1J8IA 5EBDA 3W3AA 1WTWA 4FXDA 1DOLA 3D6CA 1A2TA 3QO2A 2B2YA 2EOTA 3PO2B 4F87A 2KQ3A 2Q8TA 2WAQB 1L0XB 3S2HB 1SYFA 3I70A 2E75C 4QIWB 2NBFA 2ID0A 1NCVA 3OSOA 1SSOA 5CR3A 4HTHA 1BCPD 5LL6X 3J7AF 1CHQD 4KN4C 3TN2A 3HRZC 2MJ8A 4A3DB 1WCMB 2SNSA 1PFBA 2KVMA 4FO2A 3TZUA 2KJXA 4A3MB 1ML0D 5FO7B 5KGUA 3MC0B 1I6HB 3X3NA 3RZDB 3GTKB 1EIHA 1JR0D 4HSVA 1RF2D 2VNUD 2PW7A 2C5CA 5M9OA 3NK9A 2V4DA 4ZQ3A 1SYGA 1EYCA 1Q12A 1RKNA 5C3WA 2FINB 4V0BA 3QB3A 1TS4A 5KNDA 5K36H 3PUXA 5KNCA 1CM9A 4UAIA 4NDXA 2F0UA 1ONLA 4XYQA 4CJ2C 1SBBB 5FOBB 4ODGA 2Z8LA 4CBVA 3EA6A 2HCCA 1O7LA 2MHVA 4C1NI 1HTPA 5ELDA 1Z6HA 1LACA 5C5MA 3WOFA 4I7ZC 1SNQA 4PMWA 1JB3A 3I4MB 1KDBA 2R3ZA 3CRKC 2F0NA 4FVMA 4M8AA 1HFNA 5JVH3 4CKCA 1EYDA 1WTQA 2EY1A 5ELFA 5EJWA 5LHY1 4A3KB 5M5YB 5M3FB 1RCVD 3A56A 5IGFA 1PLFA 2YYZA 3PO3B 4NW2A 3E6ZX 1S5DD 1SEBD 1XXGA 2QDBA 1F9PA 5M5XB 1LTAD 1EEFD 4HCSA 3IFDA 1GUOA 2EY2A 2XN9C 1K83B 1PRTB 2QCPX 2DNCA 5EKIA 2PCFB 2RSOA 2R7ZB 3OMGA 1R4PB 2NTTA 1GUGA 3DUZA 2N88A 3DMUA 3OMCA 5FLXE 1EFID 2A69C 3Q6SA 3LX0A 1EL0A 4ABNA 3G6JB 4BBRB 5E3FA 4ZUJA 3BYYB 2K28A 1STAA 1WD1A 4KKTA 2JE6I 4FXGC 2ICEC 2AWOA 4DA2A 3P1HA 4RHSA 5IOCA 2NN6G 1HPCA 1TS3A 1W6JA 2DY8A 1MGSA 4I65A 4HR7B 2PQEA 4G57A 2K6AA 3M85A 1K8OA 1O7YA 4DAPA 1Q1BA 1SMYC 4BY1B 3M3YB 4KK7A 5C4HA 2K04A 2B2TC 1U4MA 5IIFA 3TSSA 5CORA 3SE0A 3UI2A 1Y8OB 1H9RA 1KAAA 3TP6A 3SVMA 5ISRA 2XVSA 2ENBA 3CRLC 3PUVA 3D3RA 4K5WA 1HUNA 1TS2A 3MXUA 3Q23A 5G3LF 2EYJA 1S5CD 2B2TA 1SYEA 4H44C 4OL7A 4CKEA 1DZ1A 2F03A 3SK8A 2KA7A 3EROA 3H0GB 4PQXA 3W2DA 5C4XB 2K03A 1DM0B 4XTCS 3K5NA 2PW5A 4R8NA 1EZ8A 4ZK9B 1PRTC 4KY6A 4HEDA 3R3OA 4HN7A 1LTTD 3WOEA 2NN6H 1KNAA 1T5XD 1TR5A 3URYA 2EYHA 1EWCA 1E2WA 2F0OA 3I90A 2KCCA 1D1KA 2AUJD 2EYLA 5KYLA 3NTKA 1R9TB 3JAML 3NP8A 3MFYA 4DK1A 1WD0A 3EJIA 2RVLA 2ZXOA 1SYCA 5E4WC 4NP5A 1HUMA 3T53B 2VB2X 3KLSX 1HHVA 1KLGD 4IALA 2K01A 3I72A 1O7ZA 4BBSB 3NWSA 2I07B 4K8JA 3S14B 3A8KE 5CV8A 1TWCB 3HEJA 3R93A 5LL6S 1I4GA 3F2UA 4PNYA 4C3HG 2K7VA 5HURA 1EWHA 3TDQA 3I4NB 5CMDA 2ZXRA 1IW7C 2A6HC 1TS5A 1I4XA 1OXUA 1OXXK 1QNUA 3NBIA 1MI2A 2B63B 2EVBA 4LK1C 1CA5A 5CC4A 3H09A 3FDTA 4ID6A 5CV9A 2MPMA 1JQYD 3MXNA 2F0PA 1ZEQX 2A74C 4N9TA 2ZXPA 1VCIA 4IUUA 2HUGA 2A68C 3K0YA 1SYBA 1ZKOA 1UAPA 2IX1A 3TMEA 2OT2A 4ZRZA 2M9VA 1LLRD 3HOZB 1BF4A 3H91A 2F0SA 4C3IG 1EIGA 1F2MA 1LTRD 1OXVA 5I4DA 4A3BB 1Q8IA 3E0JA 1HXYD 2NB0A 2L5TA 2WINB 4H0LC 3R2TA 1B53A 4RKBA 2EYMA 4DU9A 3A7AB 1GXDC 3VYUA 4IN3A 2L9HA 4Z9CB 2BCOA 4OO1H 4Y7NB 1AZQA 1KDAA 4DNTB 3MWYW 1YNJC 5C4JB 1ESFA 3PUZA 3VR6A 1GJXA 1OXSC 2PZWA 4NMZA 4RAUC 5JEAG 4YIJA 3FPUB 3G7LA 1MSGA 3HOWB 1D5MC 4QUFA 1U4PA 1LT6D 4OGQC 4NKLA 3J80E 2X6LA 3K57A 4UDUC 3AMUA 4K2KA 2XRQD 3I4LA 3I8ZA 2JP1A 1STYA 3DXJC 1PRTD 2CW0C 4RCNA 1LT4D 1ZYRC 4DNRB 4F8MA 1KABA 5JVG3 1PTOB 1LT5D 2KEDA 5I2YA 5I2XA 3IAYA 3K5OA 2M2LA 4OIJA 2B8GA 3FPPA 2K5WA 1MSHA 3KUPA 1TQOA 5C3XA 1F9RA 5CV6A 2EYOA 3M7GA 1JWMD 3I73A 5DNFA 1DOMA 3TP7A 2F0IA 5C0XJ 1EY8A 2Y0SB 3D6WA 4IURA 2WKCA 1QJOA 2GA4B 1FD7D 1H9SB 3DWQA 4XQJA 3CQZB 4G4KA 1I4HA 4K14A 3LNNA 2F0HA 3FRPB 2IL8A 4X3TA 2RBMA 3OOCA 2D9UA 2J7ZA 3GTGB 2B8FA 2A6HD 2IWHA 1Y69U 2XRSD 3D4DA 3U9OA 1ILPA 4KJNA 1GHJA 3A8IE 1S5BD 3IL8A 1GHKA 3R8BA 1HRJA 1FYCA 1JOOA 2BA1A 2FMCA 3S9WA 5KYIA 1AW7A 1S5FD 1Z47A 5JPMC 2LY7A 4CHTB 1OO9B 1Z7TA 4GZYC 1TWFB 2ZT9C 3HOYB 1AN8A 5C0XH 3C1FA 5EPLA 1SJED 3P75A 1YNNC 4QUCA 3RMHA 3M4YA 5CBAE 2F0VA 1JOQA 4RFBA 5CGKA 2VUMB 1SNOA 1F2YA 2JA5B 2BDNA 2F0GA 2NUCA 1PTOC 1PZKD 1WTPA 4QB4A 2OXPA 3BDLA 4S3SA 1I4QA 3IFTA 2AQ1B 3H3VC 3T56B 4FF2A 2X69A 2RDGA 1CQFA 2WKDA 1SE4A 2R92B 4IFDI 3OWEB 4RA8A 4G7HC 2NYZD 4ZKCB 1SNCA 3J7AV 2A73B 3OWFA 2VB3X 1JOKA 5JAVA 1Y1WB 1SNPA 3Q22A 3OHXC 3N52A 4PMCA 4J8QA 2B2VC 3J80L 3MHBA 4PV1C 1H9MA 2IPKD 2RKSA 3T51B 1EY6A 3PV0A 2SEBD 4MIUA 2EY6A 3FKIB 3P20A 3JAME 3GTJB 5JPNC 3NE5B 3KBXA 5EBCA 1DOKA 4CJ0B 3DM1A 2Z4IA 1WTVA 1QG7A 2IJ0A 3ND8A 2RQXA 1NSNS 4Q0FA 3GD7A 4K2LA 2RDFA 1HA5A 4ZKBB 2B2VA 1H9SA 4O42A 2BE5D 5IGGA 4C3HB 1H9KA 2J4XA 1CI3M 2Z1CA 5NUCA 5M3MB 4K5VA 5C3EB 3SEBA 1RODA 1BO0A 1C4QA 5EPKA 2G9DA 4FP5D 3KLRA 1SE2A 3VYSA 1TVXA 1BNZA 2HQEA 1II3A 4FYDA 3IKJA 1HQRD 4JK1C 4WJWA 5BN4A 2L0CA 1MD2D 5M5WB 2NZ1D 3S1NB 1M8AA 3KK7A 3NSWA 1QB5D 2A6EC 3DHQA 3VR4A 2E76C 4ILWA 2KUMA 3S1RB 1F9QA 4C3IB 1BCPB 1QWYA 3GTOB 3GQBA 1WTOA 3GV3A 2HCIA 2TSSA 2WB1B 3FEWX 4KJOA 2PPBC 2R6GA 4H7BA 5G3LD 2AQ2B 1PTOH 2HDMA 3QG1A 3PUWA 3J81E 4C3JG 1A3TA 1ENAA 2D62A 5FO8B 1G2TA 4N9PA 1C48A 3QOJA 2TMPA 2F3VA 5D3IB 3GTPB 2H1EA 2ICIA 4DAVA 1Y8PB 3BS1A 4IUNA 2BOSA 2IT1A 4KKSA 1STHA 1EY5A 2KEEA 4R8IA 1JICA 4RKLA 1IHZA 4BY7B 2IX0A 4A3GB 4LAAA 4ULLA 4HAEA 3ND9A 5C4ZA 1PTOF 3MVVA 1JCKB 1KTKA 4AYBB 1PZJD 1AP0A 3HS0C 5I6WA 2E2DC 2QKIC 1T5EA 1TU2B 5CV4A 5KEEA 1D2BA 2EYPA 5EKKA 5K5PA 4KTAA 4FNFA 5DM73 3DEPA 1X3QA 3K7AB 3SXHA 3SHLA 3RD4A 4QCLA 1H9JA 3OPOA 3SK5A 3DWAA 5CYUA 3QOLA 2QEJC 1KDCA 4KD4A 2E2JB 1EY7A 1UEAB 4H13C 2A5HA 5ELCA 1BCPC 1ET9A 3DEOA 3C3LA 3A8JE 5A35A 1PDQA 2A69D 3VYTA 5JJZA 3PUYA 1KLUD 2C9OA 1NR2A 3SR1A 3HGBA 5ELBA 5FO9B 2MUYA 4XT1B 3V2TA 3BVGA 4IFDG 2BA0A 1RTOA 5T1IA 3VA7A 3BVZA 3PMFA 3FMCA 1W6KA 1O78A 2F0WA 2EPBA 4FF1A 1A3VA 3BZDB 3ERQA 1NAPA 2EXZA 1I4PA 5ELEA 3S15B 3P7JA 2K1BA 4A3EB 2O2LD 4TRDA 3SK6A 4FXKC 4IFDJ 4XT3B 3BG3A 1SMYD 2FFKB 2F0MA 2D2CC 4RGMA 4HMIA 1JWSD 5T1GA 4A3JB 3NQTA 2F0KA 1PXUA 4JBWA 1ESRA 1BQQT 1A6XA 1DCZA 1LABA 3J81L 3V05A 2SNMA 1LO5D 4KHVA 2WV6D 1Y8NB 4DXFA 1JC7A 4RGOS 4A3FB 1PMRA 2O5JC 4BS9A 1SE3A 1JE4A 1HQMC 1D6EC 1TWHB 3MTSA 1G291 4RGNA 3KF8A 1EYAA 3A54A 3MEHA 5EGTA 4L8JA 2F0LA 3K58A 4OIKA 1CFMA 2FJ2A 4DGZA 1XX8A 5J39A 2CVRA 3C1EA 4CJ1B 3T4AC 1RD9D 3X3MA 2MP1A 5COYA 2F4IA 3NXWA 4IFDH 2YU9B 3QJYA 2EJGC 2QF7A 4IUTA 5JEAJ 1QOHA 3ITPA 5I9OA 3J7YW 1XWEA 3DWPA 1G6ZA 3V96A 1STGA 1XTCD 3LWUA 1PFMA 2EY5A 1TT2A 1ILQA 4KHZA 2WACA 4ME5A 4FF4A 3S17B 1B50A 2EYFA 3CHBD 2NWGA 5FK9C 4EQPA 1Y1VB 3OW7A 1CA6A 2B2WC 2L1BA 4RHRA 1DJRD 4C1NK 3SDZA 5IT9L 3NBHA 2SDFA 4K5XA 1JWUD 5HGTA 1B44D 1Q90A 4B08A 2E2IB 4A3IB 1B9NA 3R2IA 4KD3A 2L11A 1DD2A 1TIID 5C5LA 2IW3A 5E1FA 1SAPA 3S16B 3PIP3 3VA5A 1EZ6A 4K6LA 3NUCA 1EY0A 3MXPA 2OEOA 1IW7D 1BUVT 3WDNA 3A55A 2B2WA 1AFPA 4EQOA 4DXGA 1BCPF 3D31A 5JEAH 4B9WA 1V43A 3OIPA 1ENFA 2H4OA 2VXWA 1K8MA 4KI0A 2B2UC 2NTSA 4TQUS 1ICWA 4FF3A 5BN3A 2R93B 4XDXA 1STBA 2Q8RE 1GUNA 1TWGB 1CQVA 1FNWA 4J1MA 3EVQA 2R61A 2A68D 3OIQA 4B9XA 3BDOA 1X32A 3KBGA 1B3AA 2IX3A 1VDZA 1G91A 1XYIA 1RJTA 4KY7A 4C3JB 2NVYB 1DXMA 2JEAI 4CGYB 2JXMB 4IQZA 4BWGB 1SNMA 2B2UA 1QCBD 4ZYSA 5E4XA 5A2QL 3AU7A 1LTBD 4EQNA 3S1MB 4KMUC 3M4OB 1AZPA 1LV9A 4OO1I 1SYDA 2WP8J 1IYUA 2DN8A 2O5IC 1J9OA 3MFGA 4OHJA 2F0JA 3HOXB 2F0QA 2DNEA 5IODA 1EQTA 3HZXA 1GOZA 3VR3A 2F0FA 5IGDA 1I50B 5KNBA 1QILA 4K8IA 4HCEA 5CV7A 2L12A 2PYKA 4L6TB 1SFOB 1D5XC 5BN5A 1YNJD 3S1QB 3TP8A 3HKZB 2RA4A 1TKWB 1BR9A 1L0YB 1BBXC 5IGEA 4G7OC 4IUQA 1EEID 1CZWA 4ZUIA 1VF5C 3BDCA 3VR5A 1BDOA 1U9RA 4CKBA 3MAQA 1GUWA 4G7ZC 3EQLC 2F0TA 1DONA 2XNAC 4C2MB 1B9MA 5D65A 1I3QB 2JSOA 1WTRA 2N55A 2F3WA 3GTLB 2CW0D 2O4XA 1ZYRD 1F77A 3U9SA 2XIWA 3D8GA 3HP3A 1Q1EA 2JA7B 4RWSC 4BA2I 2AQ3B 1V1OA 3A7LA 1S4ZA 2LS01 1EU3A 1ZXTA 4J6HA 4ZLTF 4L63B 4HMJA 1RHPA 5AFWA 5C44B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 0;  3J7Y W; 
#chains in the Genus database with same CATH topology
 1GUT A;  4IUP A;  2Q8I B;  4DAY A;  4HSP A;  1AEX A;  1MBY A;  1P8L A;  1NBW A;  1WJJ A;  3ONA B;  4M1U B;  5DAU A;  3PO2 G;  2PO4 A;  2NVQ B;  4OWT B;  4EGV A;  2LFN A;  1X3P A;  3NTI A;  3HOU H;  3BVM A;  3L7Z C;  5IP9 G;  1TWA B;  3TZD A;  4A3F H;  3FVQ A;  4U67 3;  1FJG Q;  3Q0A A;  3JAM c;  4LW1 A;  2EDG A;  3C2P A;  2NVX B;  4P73 A;  1SND A;  1FGU A;  5DEH A;  2XWJ B;  2WII B;  2HDL A;  2CKZ B;  4MN3 A;  2CQO A;  4K6D A;  2OF1 A;  1L2F A;  1WVL A;  3GTM B;  4TKO B;  1PYW D;  2KHI A;  3NTH A;  5J22 A;  2Q2U A;  2VW9 A;  1N32 Q;  4LF7 Q;  1VQC A;  1CTM A;  1V8Q A;  2EE1 A;  4X62 Q;  3H6M A;  2KCN A;  1VF7 A;  2F1M A;  1UUP A;  3U58 A;  4A3D G;  1B1Z A;  5CBE E;  4DFA A;  1IYV A;  2XSC A;  1LTG D;  1STE A;  1WCM G;  1S5E D;  2BDO A;  5I6Y A;  4MHE A;  2XWB B;  3QWN A;  1Q8K A;  3K8A A;  4A3M G;  1FNV A;  3VR2 A;  2Q2T A;  4OON A;  3KDF A;  4A93 H;  4RGT A;  3PIO A;  5C0X I;  4ZAI A;  1LM0 A;  1SN8 A;  3ZYY X;  2K33 A;  5GRO A;  2X6G A;  2LKV A;  1X9N A;  3HOV H;  1UNS A;  1SXT A;  1MJC A;  2F0D A;  3TBI B;  1U4R A;  2CHB D;  2B3G A;  2RDH A;  1B4O A;  2JEB I;  3EFX D;  1I94 L;  3D4W A;  3I55 A;  5D3D A;  1SDF A;  1Y1V H;  1CZG A;  4QIW E;  4PZ8 A;  1C8C A;  2RHQ B;  1U4L A;  1YNN D;  3VYR A;  1K3B C;  2KEN A;  4QJF A;  1V1P B;  3UDX A;  3Q24 A;  5FKA C;  5I9P A;  1TY0 A;  2VL6 A;  2JA6 B;  1FGB D;  4UP8 A;  3GTQ B;  5GAE C;  1ET6 A;  1S3O A;  4X3U A;  3D4R A;  2K75 A;  2PQA A;  2PMZ B;  1PTO D;  4IPH A;  4WOR A;  4OXP A;  5IP9 H;  1LTL A;  1F9S A;  3I4M G;  3KFU A;  3GO5 A;  4DV7 Q;  3M7N A;  5IGC A;  5KIX A;  3S16 H;  1STN A;  1WTX A;  2HT1 A;  1NUC A;  1EU4 A;  4XXE A;  3K5M A;  4U68 A;  2K32 A;  4DF7 A;  4LFA L;  3S2D B;  1E0B A;  2PZT A;  3SK4 A;  5F2D A;  4NXM Q;  1HCZ A;  1A3U A;  3J81 c;  3HG9 A;  4XQN A;  4WRD A;  1HTL D;  4IZ8 A;  1ENC A;  1YJW A;  3QIA A;  3VDY A;  3NPP A;  3UDI A;  3NEN A;  4XYO A;  4DR7 L;  2PI2 A;  4LJZ C;  4X3S A;  3N6R A;  3C46 A;  3MZ5 A;  1Q3L A;  1FVI A;  4A3D H;  1D5Z C;  1E2Z A;  2L4N A;  3CPW A;  1CK1 A;  1I6V C;  4Q5V A;  2K5Q A;  1WCM H;  3RUZ A;  4XIG S;  2R93 H;  1RDP D;  3O13 A;  1LUZ A;  3I91 A;  4A3K G;  2KEC A;  3MA2 B;  4C56 C;  1JOR A;  4A3M H;  4KY5 A;  3PO3 G;  1JT8 A;  2DY7 A;  1G51 A;  2ZTD A;  4EVO A;  1I6H H;  1PHJ A;  4GN5 A;  1IBM Q;  4HIO A;  2CQA A;  3RZD H;  3GTK H;  2VQE L;  2FMM A;  2ZTC A;  3CD6 A;  3ULP A;  4EQ5 A;  2PNR C;  4DV4 L;  4O1N A;  4BA1 I;  5IT9 E;  1FR3 A;  1VMP A;  1XTD A;  1D8L A;  2SOB A;  2B39 A;  4F88 A;  4YWM A;  1IKM A;  4C3J H;  5FLM G;  2F0E A;  2NVY H;  3CCE A;  2MGS A;  2QIL A;  4JI7 Q;  2R7Z G;  2NVT B;  1QNK A;  3NBH B;  4OO1 G;  1I4R A;  3RLF A;  4LMQ D;  2LMC B;  1TY2 A;  3AMU A;  4WFN 3;  4F7X A;  5C6A A;  5FLX L;  1BOS A;  1KRS A;  2YTV A;  4P74 A;  2M00 A;  2YTX A;  1G8Z D;  4BBR G;  4APV A;  1D1I A;  1WI5 A;  1B70 B;  4AQY L;  3J80 i;  4RH6 A;  1YEZ A;  3T16 A;  1EOT A;  1EQV A;  2G9H D;  5TSS A;  4XQQ A;  3RZO B;  1VQD A;  2D5D A;  2EZV A;  2E2H B;  4PMB A;  4A76 A;  4DN4 M;  1M90 C;  1LT3 D;  3LWE A;  1HJP A;  1IKL A;  1XPU A;  1R4Q B;  4GS3 A;  4DK0 A;  1PH4 A;  4JG2 A;  4L5Q A;  1SJH D;  1KNE A;  3I4M H;  3QR8 A;  1K9M C;  3T1H Q;  5DM6 3;  1LTI D;  3GV6 A;  2KCT A;  5KRU A;  3NWT A;  2AUK A;  1LTS D;  4A3C G;  2JYO A;  3K59 A;  4KN7 C;  4R9W A;  1EY9 A;  4ALP A;  4QMG A;  1YJN A;  1K0R A;  4P2C B;  2A6E D;  1CKN B;  1B7Y B;  4KHP Q;  2RSN A;  2EJF C;  1HA6 A;  1A2U A;  2LXJ A;  1JJ2 A;  2KOL A;  4JBM A;  1EY4 A;  2Z4H A;  1A15 A;  3NHH A;  4JV5 L;  2K5D A;  1PFS A;  2UU9 L;  4A3K H;  3CU7 A;  4RCO A;  1CHP D;  5M5Y H;  5M3F H;  5A2Q E;  3L9A X;  2QA4 A;  1EYG A;  3H3V I;  1PZI D;  2J0T D;  3KLS A;  4P72 A;  3PO3 H;  4YY3 L;  3E0E A;  1FNU A;  1QE6 A;  4X3K A;  4L5S A;  2EJM A;  3HOU B;  5EPJ A;  1W2B A;  1DYQ A;  3E5S A;  1F2Z A;  4O0A A;  1OTC A;  3NQI A;  3MXG A;  2P5Z X;  4JI6 L;  1HFG A;  1V1P A;  1GUS A;  1LYL A;  4LFB Q;  5M5X H;  1PH6 A;  4IJL A;  2ZJR A;  3AB9 A;  1OXT A;  4V19 0;  1RTN A;  3K5L A;  5EQ0 A;  3I3C A;  1VMC A;  1F2L A;  1K83 H;  3GP7 A;  1VQ4 A;  4HID A;  4JI2 L;  1NR4 A;  4PZ7 A;  4E6I A;  2JA8 B;  2PZU A;  1M4V A;  1E2V A;  3KF6 B;  4PZ6 A;  4TSS A;  3H0G G;  2K5V A;  1G2S A;  2NN6 I;  2YV5 A;  4KV6 A;  2VQF L;  1QVF A;  1E1O A;  1NTG A;  3TP5 A;  5C4X G;  2AWN A;  1T9H A;  1TWA H;  2FHT A;  4GN4 B;  1N33 Q;  3PIO 3;  5D14 A;  3BYT B;  3CKI B;  4GKJ L;  3L3O C;  4A93 B;  1IL8 A;  1O80 A;  1TXY A;  2JQO A;  3K6O A;  2L55 A;  1CT1 D;  3H94 A;  5CV5 A;  1BVS A;  2KHS A;  5LMN L;  4A3G G;  1B2T A;  4LF6 L;  3RN5 A;  2BH8 A;  1B8A A;  1BXT A;  2B2Y C;  3HOV B;  1VQF A;  4IUV A;  5J1Z A;  4DNI A;  5IGB A;  4KKU A;  5JOB A;  2EIF A;  4QF4 A;  1HNW L;  1EIF A;  1PFN A;  2E74 C;  2RCF A;  2I46 A;  3EIV A;  2BE5 C;  5C0X G;  4A3C H;  5K36 G;  1PRT F;  5EKL A;  3T13 A;  2JN4 A;  2K05 A;  4BY1 H;  4POG A;  3M3Y H;  1J8I A;  5EBD A;  3W3A A;  1YIJ A;  1N36 L;  1WTW A;  4FXD A;  1DOL A;  4J15 A;  3D6C A;  1A2T A;  4X66 Q;  4JPB W;  4X65 L;  1S72 A;  3QO2 A;  4GLV B;  4JI5 L;  3J80 c;  2B2Y A;  3L0O A;  2EOT A;  3PO2 B;  4F87 A;  4JOI C;  2KQ3 A;  4BBS G;  2Z6B A;  2Q8T A;  2WAQ B;  1L0X B;  2RCN A;  1YHA A;  3S2H B;  4JI4 Q;  1SYF A;  2H5X A;  3I70 A;  3I4N G;  2E75 C;  4QIW B;  3DM3 A;  2NBF A;  3BZC A;  2ID0 A;  1NCV A;  1U5K A;  3OSO A;  4JI0 L;  3W5O A;  3D0F A;  1SSO A;  5CR3 A;  5JJK A;  4HTH A;  1BCP D;  5LL6 X;  3J7A F;  1CHQ D;  4GKK L;  4KN4 C;  2B63 G;  1A63 A;  3TN2 A;  1X3F A;  2JA6 H;  3HRZ C;  5GAG C;  2K14 A;  3GTQ H;  2MJ8 A;  4LF9 L;  4A3D B;  3DLL A;  2Q2I A;  2AKW B;  5C4X H;  1WCM B;  4JOI A;  4AH6 A;  1XNQ Q;  3PGZ A;  4I7A A;  4UP9 A;  2SNS A;  1PFB A;  2KVM A;  4FO2 A;  3TZU A;  2KJX A;  3L2P A;  1ML0 D;  4A3M B;  5FO7 B;  1CKN A;  5KGU A;  3MC0 B;  1I6H B;  3X3N A;  3RZD B;  3GTK B;  1EIH A;  1JR0 D;  4HSV A;  5IWA Q;  1RF2 D;  2VNU D;  2PW7 A;  2L15 A;  2C5C A;  5M9O A;  3NK9 A;  2V4D A;  2E5L L;  1HNZ Q;  1VQ5 A;  4OWW B;  4ZQ3 A;  1SYG A;  3HOZ G;  1EYC A;  1Q12 A;  1RKN A;  5C3W A;  4IPC A;  1MKH A;  2FIN B;  4DUY L;  4V0B A;  3QB3 A;  1TS4 A;  5KND A;  4L5R C;  5K36 H;  3PUX A;  4A3B G;  5KNC A;  3OTO L;  4DV5 Q;  1CM9 A;  1PH8 A;  4UAI A;  1R9T H;  4LF8 Q;  3KYH C;  4NDX A;  2F0U A;  1ONL A;  4JI8 Q;  4XYQ A;  4CJ2 C;  3CCL A;  1SBB B;  5FOB B;  4ODG A;  2Z8L A;  4CBV A;  3EA6 A;  2HCC A;  1O7L A;  3KF6 A;  2MHV A;  4DR4 Q;  4C1N I;  1HZ9 A;  2MO0 A;  1HTP A;  5JJI A;  1A0I A;  4HJ5 A;  3CW2 C;  5ELD A;  1Z6H A;  1LAC A;  4NXN Q;  5C5M A;  3WOF A;  4I7Z C;  1SNQ A;  1CUK A;  3S14 H;  1X54 A;  4DR5 L;  4B3R Q;  4PMW A;  1JB3 A;  3I4M B;  1KDB A;  5LMU Q;  1HNX L;  2DJF C;  1VQI A;  3I4N H;  1XNR Q;  2R3Z A;  3CRK C;  2F0N A;  3ULJ A;  2Z6K C;  4DR1 L;  2MQH A;  2PQA B;  2VZA A;  4FVM A;  4M8A A;  3STB D;  1HFN A;  2OTL A;  3RZO H;  5JVH 3;  4CKC A;  4HIM A;  1XMO L;  1EYD A;  5AJ3 L;  1WTQ A;  2XGT A;  1N34 L;  2EY1 A;  3HOW G;  5ELF A;  1D7Q A;  1VQE A;  5EJW A;  5LHY 1;  4A3K B;  4K0K Q;  5M5Y B;  5M3F B;  2OCE A;  1RCV D;  3A56 A;  5IGF A;  1PLF A;  2YYZ A;  3U50 C;  3PO3 B;  3J81 i;  4NW2 A;  2Q2H A;  3E6Z X;  4LUV A;  1S5D D;  1SEB D;  4X64 Q;  1XXG A;  2EXD A;  2QDB A;  3CCR A;  5LMN W;  2ZTE A;  1F9P A;  1SRO A;  1LTA D;  2RF4 A;  5M5X B;  1EEF D;  4HCS A;  1EWI A;  3HOZ H;  4PG3 A;  4YCV A;  3IFD A;  1GUO A;  2EY2 A;  2XN9 C;  1K83 B;  1PRT B;  1SRU A;  1HZA A;  2QCP X;  2DNC A;  5EKI A;  2HIX A;  2PCF B;  2RSO A;  3K7U C;  2R7Z B;  3OMG A;  1R4P B;  1FJG L;  4DR2 Q;  4MNO A;  2NTT A;  1HR0 L;  1GUG A;  3DUZ A;  1JE5 A;  2N88 A;  2N49 A;  3DMU A;  3OMC A;  5FLX E;  1EFI D;  2A69 C;  2R7D A;  3Q6S A;  3LX0 A;  1EL0 A;  1MHW C;  2CH4 W;  4ABN A;  2Y0S G;  3G6J B;  5E3F A;  4BBR B;  4DR6 Q;  4ZUJ A;  3CCQ A;  3BYY B;  2K28 A;  1STA A;  1WD1 A;  4KKT A;  1RL2 A;  4LF7 L;  1MJE A;  1PYB A;  4X62 L;  4X6A H;  2JE6 I;  1K0S A;  2MFI A;  4FXG C;  4MTN A;  1UE6 A;  1YHB A;  2ICE C;  2UUC Q;  2AWO A;  3A74 A;  3P1H A;  4RHS A;  4DA2 A;  3U4Z A;  5IOC A;  2NN6 G;  1HPC A;  1TS3 A;  1K8G A;  1W6J A;  2DY8 A;  5JJL A;  1PH7 A;  2JA8 H;  1NJI C;  5IP7 G;  1MGS A;  2K5H A;  4I65 A;  2AHO B;  5C4J H;  4HR7 B;  2PQE A;  4G57 A;  2K6A A;  3M85 A;  3MXN B;  1K8O A;  1O7Y A;  4DAP A;  4MTK A;  1WTH A;  4DV1 Q;  2BH2 A;  1Q1B A;  1SMY C;  4BY1 B;  2DUD A;  3M3Y B;  4KK7 A;  5C4H A;  2K04 A;  1AE3 A;  2B2T C;  3F2D A;  1U4M A;  5IIF A;  3RNU A;  2DGY A;  3TSS A;  3J81 j;  5COR A;  3HOW H;  3SE0 A;  3UI2 A;  2OQK A;  2UXB Q;  4DV0 Q;  1Y8O B;  2R7F A;  1H9R A;  1KAA A;  3TP6 A;  3SVM A;  5ISR A;  2XVS A;  3HOY G;  1VQ6 A;  2ENB A;  3CRL C;  1K8A C;  2Y0S E;  1UE5 A;  3PUV A;  4JVZ A;  3D3R A;  4K5W A;  1PH3 A;  1HUN A;  1TS2 A;  3MXU A;  3Q23 A;  2G5D A;  5G3L F;  2CWP A;  2EYJ A;  1J5E Q;  1CSP A;  1S5C D;  2WFW A;  2B2T A;  1SYE A;  2VUM G;  4H44 C;  3PSI A;  1PH9 A;  5J3B A;  4DV7 L;  4OL7 A;  4CKE A;  1Q81 C;  2F03 A;  1DZ1 A;  4TVA B;  1PV4 A;  3SK8 A;  2HHH Q;  3OW2 A;  2KA7 A;  2VS1 A;  2JA5 G;  3ERO A;  3H0G B;  3PO2 H;  4PQX A;  3W2D A;  5C4X B;  4NXM L;  2D0O A;  2GN5 A;  3GDE A;  2K03 A;  1DM0 B;  3S2H H;  4XTC S;  1GKH A;  3K5N A;  2PW5 A;  3E3X A;  4R8N A;  4DV2 Q;  1VQ7 A;  3CQZ H;  1EZ8 A;  4ZK9 B;  1PRT C;  1I5F A;  4KY6 A;  4A3L G;  3NEM A;  4HED A;  4LF4 Q;  1MIU A;  3MEF A;  3R3O A;  4HN7 A;  1LTT D;  2R92 G;  3WOE A;  2NN6 H;  1KNA A;  1T5X D;  4DV3 L;  1TR5 A;  3URY A;  2EYH A;  3W1B A;  1Y1W G;  1VQH A;  5IP7 H;  3GTG H;  2EQS A;  1K28 A;  1EWC A;  2MNA A;  3I7F A;  1E2W A;  2F0O A;  3I90 A;  2KCC A;  2IHF A;  3PIP A;  1D1K A;  3CC4 A;  2AUJ D;  2EYL A;  2UUA Q;  2F4V Q;  3FKI G;  5KYL A;  1X3G A;  3NTK A;  1R9T B;  3JAM L;  4JI7 L;  3NP8 A;  3MFY A;  4DK1 A;  4IPG A;  1WD0 A;  3EJI A;  2RVL A;  2ZXO A;  1SYC A;  5E4W C;  1IBK L;  5GAD C;  3RLN A;  4NP5 A;  2PNH A;  2LSS A;  4KLK A;  1HUM A;  3T53 B;  2VB2 X;  1B3Q A;  2GVB A;  3KLS X;  1HHV A;  1KLG D;  4IAL A;  2K01 A;  5GQO A;  3T1Y Q;  1NMG A;  3I72 A;  4DR7 Q;  1O7Z A;  4BBS B;  3NWS A;  3HOY H;  2I07 B;  4K8J A;  3S14 B;  3A8K E;  5CV8 A;  1TWC B;  3HEJ A;  2F52 A;  3R93 A;  5LL6 S;  3U4V A;  1BKB A;  1I4G A;  3F2U A;  4PNY A;  4C3H G;  2K7V A;  5HUR A;  1EWH A;  3TDQ A;  3I4N B;  5CMD A;  2ZXR A;  3JC6 6;  1IW7 C;  3FP9 A;  1IBL Q;  4JI3 Q;  2A6H C;  1S40 A;  1BBU A;  1TS5 A;  4DV6 Q;  1I4X A;  1OXU A;  5M3M G;  3E9H A;  1OXX K;  1QNU A;  5C3E G;  3EBE A;  3NBI A;  1VQ8 A;  1MI2 A;  2VUM H;  1QVC A;  2B63 B;  2EVB A;  4LK1 C;  1HR0 W;  2D0P A;  1CA5 A;  3T1H L;  5IYD G;  5CC4 A;  3H09 A;  3TS0 A;  3FDT A;  3Q8D A;  4ID6 A;  5CV9 A;  2MPM A;  1JQY D;  3MXN A;  1XPR A;  2F0P A;  3CAM A;  4CDC C;  1QVG A;  1E7Z A;  3RN2 A;  1ZEQ X;  2A74 C;  1A62 A;  4N9T A;  1GVP A;  2ZXP A;  3PF5 A;  4KHP L;  1VCI A;  4IUU A;  2HUG A;  2A68 C;  3K0Y A;  3CCM A;  3CCU A;  1UEB A;  5IT9 c;  4LFC Q;  4N8F A;  1SYB A;  1ZKO A;  1UAP A;  2IX1 A;  3TME A;  1VS0 A;  2OT2 A;  3EN2 A;  4ZRZ A;  2HD3 A;  4HJ7 A;  2I0Q A;  2M9V A;  5IYC G;  1LLR D;  3HOZ B;  1BF4 A;  1Y1W H;  3M4Q A;  3H91 A;  4DR3 Q;  1E24 A;  4HJ9 A;  2F0S A;  4RMF A;  4C3I G;  1IYJ B;  1YNX A;  4LFB L;  2I5M X;  1EIG A;  1F2M A;  1LTR D;  1OXV A;  5I4D A;  4A3B B;  1Q8I A;  3FKI H;  3E0J A;  2WB1 G;  1HXY D;  2NB0 A;  2L5T A;  2WIN B;  4H0L C;  4Y52 H;  3R2T A;  1B53 A;  4RKB A;  2EYM A;  4DU9 A;  1Q7Y C;  3A7A B;  3KJO A;  1GXD C;  4YHH Q;  1X56 A;  3VYU A;  4IN3 A;  3G48 A;  5FLM H;  1NNX A;  1HH2 P;  1GO3 E;  2L9H A;  4Z9C B;  1N33 L;  3J7Z C;  2BCO A;  2R7Z H;  4OO1 H;  4Y7N B;  1AZQ A;  1KDA A;  3HKS A;  1PA6 A;  4DNT B;  3MWY W;  1YNJ C;  5C4J B;  1ESF A;  1PH1 A;  3PUZ A;  3VR6 A;  1GM5 A;  2ZJQ A;  2NZH A;  1UE1 A;  1SE8 A;  2LXK A;  1GJX A;  4BBR H;  1OXS C;  1YZ6 A;  2PZW A;  4NMZ A;  4RAU C;  5C3E H;  5JEA G;  4A75 A;  4OEM B;  5E7N A;  4GLA C;  3UE1 A;  3B6Y A;  3RR5 A;  4BY7 G;  4YIJ A;  3FPU B;  3G7L A;  1MSG A;  3HOW B;  1D5M C;  2RHS B;  4JW0 A;  4QUF A;  1U4P A;  1LT6 D;  1E1T A;  4OGQ C;  4NKL A;  3J80 E;  2X6L A;  3K57 A;  2K4K A;  4UDU C;  4JI2 Q;  1Q86 C;  2UUB Q;  4K2K A;  4JI1 Q;  3H15 A;  3AFP A;  1KC8 C;  2UXC Q;  2XRQ D;  3PQI A;  5M5W H;  3FHW A;  3I4L A;  4AYB G;  3I8Z A;  2JP1 A;  1STY A;  3DXJ C;  1EQQ A;  1PRT D;  2CW0 C;  2WB1 E;  4RCN A;  1LT4 D;  3S1N H;  1ZYR C;  4DNR B;  2A19 A;  4F8M A;  1KAB A;  5JVG 3;  4P75 A;  5HY6 A;  4FDB A;  4X66 L;  2K5N A;  1PTO B;  1LT5 D;  2KED A;  5I2Y A;  5I2X A;  4WJ3 M;  3IAY A;  3W1G A;  5IYC H;  3K5O A;  2M2L A;  2A1A A;  4OIJ A;  4GKJ Q;  2B8G A;  4B3M Q;  3FPP A;  2K5W A;  1MSH A;  3S1R H;  4JI4 L;  1E22 A;  3KUP A;  3GTO H;  4IPD A;  1TQO A;  5C3X A;  2AMC B;  3OYY A;  1F9R A;  5CV6 A;  2EYO A;  3M7G A;  1JWM D;  1HZB A;  3I73 A;  5DNF A;  1DOM A;  3TP7 A;  2F0I A;  5C0X J;  1EY8 A;  2Y0S B;  3D6W A;  4IUR A;  1YJ9 A;  2WKC A;  1HNW Q;  1YI2 A;  3G4S A;  1QJO A;  2B29 A;  2GA4 B;  1FD7 D;  1H9S B;  3DWQ A;  4XQJ A;  3CQZ B;  4G4K A;  3LGJ A;  1I4H A;  4K14 A;  3LNN A;  3S24 A;  1J6Q A;  5BR8 Q;  3UE0 A;  2F0H A;  3FRP B;  4YCU A;  2IL8 A;  4X3T A;  1JJG A;  1XNQ L;  3CF5 A;  2RBM A;  4JYA Q;  1BBW A;  3OOC A;  2D9U A;  2J7Z A;  4OWX B;  5FJ8 G;  3H0G H;  3GTG B;  2B8F A;  2KCM A;  5IWA L;  3GTP H;  4AYB E;  1VQM A;  2A6H D;  5HGQ A;  2IWH A;  1Y69 U;  2XRS D;  1HNZ L;  3D4D A;  3U9O A;  1ILP A;  1GHJ A;  3A8I E;  4KJN A;  1S5B D;  3IL8 A;  1GHK A;  3R8B A;  1HRJ A;  1CSQ A;  1FYC A;  1PH2 A;  1JOO A;  1QUQ B;  4B3S Q;  2BA1 A;  1NY4 A;  2FMC A;  3S9W A;  1L0W A;  5KYI A;  1AW7 A;  1EFW A;  4A3G H;  1XMQ Q;  2E8G A;  1S5F D;  1Z47 A;  5JPM C;  2LY7 A;  2V1C C;  4DV5 L;  4CHT B;  1OO9 B;  4LF8 L;  1Z7T A;  4GZY C;  1TWF B;  2ZT9 C;  4LWC A;  3HOY B;  2ZM6 Q;  4QY7 A;  4JI8 L;  4LF9 Q;  4A3E G;  1AN8 A;  3CPF A;  5C0X H;  3C1F A;  5EPL A;  4DR4 L;  1VQP A;  1SMX A;  1SJE D;  3P75 A;  4NXN L;  1YNN C;  4QUC A;  2I5L X;  3RMH A;  2N78 A;  3M4Y A;  5CBA E;  2F0V A;  4A3J G;  4B3R L;  1KIX A;  1JOQ A;  4RFB A;  5CGK A;  3TRE A;  2VUM B;  5LMU L;  3F2C A;  4GLX A;  1XNR L;  1SNO A;  1F2Y A;  2JA5 B;  2BDN A;  1X55 A;  4BBS H;  2F0G A;  2NUC A;  5EAY A;  1PTO C;  1PZK D;  3HOU G;  2JK8 A;  1WTP A;  1TWC H;  4A3F G;  3KLW A;  4QB4 A;  2OXP A;  3BDL A;  4S3S A;  4QL5 A;  1I4Q A;  3IFT A;  3I2Z A;  2AQ1 B;  2N3S A;  3H3V C;  1VQG A;  4HIK A;  3T56 B;  4DUZ Q;  4FF2 A;  2X69 A;  2RDG A;  1CQF A;  2WKD A;  4YWL A;  1SE4 A;  3PF4 A;  4K0K L;  2R92 B;  4IFD I;  3OWE B;  3A5U A;  4OX9 Q;  4RA8 A;  4G7H C;  2B63 H;  2NYZ D;  4ZKC B;  1SNC A;  3IRB A;  3NEL A;  5IE8 A;  3J7A V;  2A73 B;  3OWF A;  2VB3 X;  1JOK A;  5JAV A;  1Y1W B;  1SNP A;  4N8X 1;  5FJ8 H;  3Q22 A;  3OHX C;  4X64 L;  3N52 A;  4PMC A;  1KD1 C;  5ELN A;  4J8Q A;  4WJ4 A;  2B2V C;  3J80 L;  1VQ9 A;  3MHB A;  4PV1 C;  1H9M A;  2IPK D;  2RKS A;  3T51 B;  1EY6 A;  3PV0 A;  2SEB D;  4MIU A;  3ICE A;  1EUJ A;  2EY6 A;  3FKI B;  3P20 A;  3JAM E;  3GTJ B;  4LF5 Q;  5JPN C;  3UDG A;  3NE5 B;  3KBX A;  5EBC A;  1QZG A;  1DOK A;  3A0J A;  4CJ0 B;  4DR2 L;  3DM1 A;  2Z4I A;  3AQQ A;  4DAM A;  1WTV A;  1QG7 A;  2IJ0 A;  3ND8 A;  3HOV G;  4R1J A;  1PVO A;  2RQX A;  1NSN S;  1XJV A;  4Q0F A;  2XTI A;  3GD7 A;  4K2L A;  2RDF A;  3S15 H;  1HA5 A;  1N34 Q;  4ZKB B;  1VQK A;  2B2V A;  1H9S A;  4CDF C;  4O42 A;  2BE5 D;  1XPO A;  5IGG A;  4B3T Q;  4C3H B;  1C0A A;  4A3B H;  1H9K A;  3BZK A;  1Y1V G;  2KHJ A;  2J4X A;  1CI3 M;  2Z1C A;  5NUC A;  3KJP A;  5M3M B;  4A3J H;  4K5V A;  5C3E B;  3SEB A;  1N32 L;  1ROD A;  2UXD Q;  1PYS B;  1BO0 A;  1C4Q A;  5EPK A;  2G9D A;  4FP5 D;  3F2B A;  3KLR A;  1SE2 A;  3VYS A;  1TVX A;  1BNZ A;  4A3I G;  2HQE A;  1W3S A;  2WAQ G;  1II3 A;  4FYD A;  3IKJ A;  1HQR D;  4JK1 C;  4Y7N H;  3CP0 A;  4WJW A;  5BN4 A;  3KOJ A;  4DV1 L;  2L0C A;  1MD2 D;  5M5W B;  1HR0 Q;  1O7I A;  1X65 A;  1QUQ A;  2NZ1 D;  1UE7 A;  1TWH H;  1IL2 A;  4HJ8 A;  3S1N B;  1M8A A;  3KK7 A;  2Z0S A;  4QGU A;  3NSW A;  1QB5 D;  1YVC A;  2UXB L;  4DV0 L;  2A6E C;  3DHQ A;  3M4P A;  3VR4 A;  2E76 C;  4ILW A;  1G6P A;  4LUO A;  2KUM A;  3S1R B;  1F9Q A;  4C3I B;  2R93 G;  1BCP B;  1QWY A;  3GTO B;  5FLX c;  3GQB A;  5IYB G;  1YIT A;  2JA9 A;  1WTO A;  3GV3 A;  2HCI A;  1J5E L;  1IZ6 A;  1NE3 A;  2QGQ A;  2CH4 A;  1EOV A;  2TSS A;  2WB1 B;  3FEW X;  4KJO A;  2YU9 H;  1KXL A;  2PPB C;  3K81 C;  1JMC A;  2R6G A;  4H7B A;  3WWV A;  5G3L D;  2AQ2 B;  1PTO H;  2HDM A;  4GNX B;  4UP7 A;  3QG1 A;  3CME A;  3PUW A;  2HHH L;  1CKO A;  3J81 E;  1M1K C;  4C3J G;  1A3T A;  3AYH B;  1ENA A;  2D62 A;  2OWO A;  5FO8 B;  3H3V H;  1G2T A;  3CCS A;  2WAQ E;  4N9P A;  4DV2 L;  1C48 A;  3QOJ A;  2TMP A;  3TQY A;  3S17 H;  4P71 A;  1WOC A;  2F3V A;  5D3I B;  3GTP B;  2H1E A;  2ICI A;  4LF4 L;  4DAV A;  1Y8P B;  3BS1 A;  4IUN A;  1I94 Q;  2BOS A;  2IT1 A;  4KKS A;  3HOX G;  1STH A;  1EY5 A;  1L1O B;  2KEE A;  3BJU A;  4R8I A;  1JIC A;  4RKL A;  1IHZ A;  4BY7 B;  2IX0 A;  1DGS A;  3KF8 B;  2E2I H;  4A3G B;  4LAA A;  4ULL A;  4A3I H;  4HAE A;  3ND9 A;  5C4Z A;  2UUA L;  2F4V L;  1PTO F;  1SLJ A;  3MVV A;  1IBM L;  1JCK B;  1KTK A;  3F1Z A;  4AYB B;  2K50 A;  1PZJ D;  1AP0 A;  3HS0 C;  5I6W A;  1N9W A;  3HKZ G;  2E2D C;  1X3E A;  1JJC B;  1Z9F A;  4ME3 A;  2QKI C;  1T5E A;  1A8V A;  1TU2 B;  4UPA A;  5CV4 A;  5KEE A;  1D2B A;  1Q82 C;  2EYP A;  3T1Y L;  5EKK A;  5K5P A;  4KTA A;  3AEV A;  4FNF A;  5DM7 3;  3DEP A;  4LFA Q;  3TS2 A;  1X3Q A;  1TWG H;  3K7A B;  3SXH A;  5IYB H;  5M3F G;  2ES2 A;  4DV3 Q;  3SHL A;  3RD4 A;  2HIV A;  4JI3 L;  1IBL L;  1TWF H;  2C35 B;  1H9J A;  4QCL A;  4DV6 L;  3OPO A;  2FXQ A;  3SK5 A;  3DWA A;  5CYU A;  3QOL A;  2YTY A;  2QEJ C;  1KDC A;  4KD4 A;  4IO9 A;  2JA7 G;  4OEL B;  2E2J B;  1EY7 A;  1UEA B;  4BXX G;  4H13 C;  2A5H A;  5ELC A;  1BCP C;  4LUZ A;  1ET9 A;  3DEO A;  3C3L A;  5C44 G;  2VQE Q;  4R4T A;  4O2D A;  4DV4 Q;  4R4Q A;  1V9P A;  1Y14 B;  1IBK Q;  3S1M H;  1K3R A;  4CDD C;  3M4O H;  3A8J E;  2JJQ A;  5A35 A;  1K73 C;  1PDQ A;  2JA5 H;  4AIM A;  3K0X A;  4GOP B;  1VQO A;  4LFC L;  2A69 D;  1SR3 A;  2I5H A;  3VYT A;  5JJZ A;  4NPS A;  3PUY A;  1KLU D;  4GNX C;  3ULL A;  2C9O A;  1NR2 A;  3HKZ E;  3SR1 A;  4CDE C;  4JBK A;  3CC7 A;  3HGB A;  5ELB A;  5IY0 A;  3SGI A;  5FO9 B;  2MUY A;  3HOX H;  3CCJ A;  4XT1 B;  3V2T A;  3BVG A;  4IFD G;  2BA0 A;  1KL9 A;  1RTO A;  5T1I A;  4A3L H;  4DR3 L;  3VA7 A;  3BVZ A;  3PMF A;  3FMC A;  1W6K A;  2R92 H;  1I50 H;  4EX5 A;  3M9B A;  1O78 A;  2F0W A;  2EPB A;  4AQY Q;  4YWK A;  4FF1 A;  3F8T A;  1A3V A;  1UWV A;  3BZD B;  3ERQ A;  2F3I A;  2PI2 E;  1SFO H;  1NAP A;  2EXZ A;  3S1Q H;  1I4P A;  5ELE A;  3S15 B;  3P7J A;  3HFZ B;  2K1B A;  5DLQ E;  4A3E B;  3CC2 A;  2O2L D;  4TRD A;  3SK6 A;  1L1O C;  4FXK C;  4GNX A;  4IFD J;  4YHH L;  4XT3 B;  3BG3 A;  4BY1 G;  1SMY D;  2FFK B;  2F0M A;  2D2C C;  4RGM A;  4HMI A;  3GTJ H;  2GVA A;  1JWS D;  5T1G A;  4A3J B;  3NQT A;  2F0K A;  4R4I A;  1PXU A;  4JBW A;  4QQB X;  1ESR A;  1BQQ T;  1A6X A;  1DCZ A;  1LAB A;  3J81 L;  4C2M H;  3AFQ A;  1I3Q H;  2MO1 A;  3V05 A;  2SNM A;  1LO5 D;  4KHV A;  2WV6 D;  1Y8N B;  5L37 A;  3G6E A;  1EIY B;  4DXF A;  1JC7 A;  4RGO S;  3PCO B;  4DK3 C;  3GTL H;  4A3F B;  1PMR A;  4JV5 Q;  2O5J C;  2UU9 Q;  4BS9 A;  1KQS A;  4C3H H;  1SE3 A;  1L1O A;  1JE4 A;  1HQM C;  2JA7 H;  1D6E C;  4BXX H;  1TWH B;  3MTS A;  4YY3 Q;  1G29 1;  4RGN A;  3KF8 A;  4A4I A;  5M3M H;  4DPG A;  2UUB L;  5C44 H;  4JI6 Q;  2CFM A;  4JI1 L;  3STB C;  1EYA A;  1E3P A;  3A54 A;  3MEH A;  2UXC L;  5EGT A;  4RG1 A;  3CXC A;  5ELO A;  2JA6 G;  5IYD H;  4L8J A;  4IOC A;  2F0L A;  3K58 A;  2IHE A;  4OIK A;  1CFM A;  2FJ2 A;  4DGZ A;  2NVQ H;  1XX8 A;  1P16 A;  5J39 A;  2CVR A;  3C1E A;  1U0L A;  4GN3 B;  4CJ1 B;  3T4A C;  2K52 A;  2DJG C;  3ERS X;  1RD9 D;  1WFQ A;  3X3M A;  1N8R C;  2MP1 A;  5COY A;  1JB7 A;  4UHV A;  2F4I A;  3NXW A;  2NVX H;  4IFD H;  4B3M L;  1VQJ A;  2YU9 B;  3QJY A;  2VQF Q;  2EJG C;  2QF7 A;  4IUT A;  5JEA J;  1QOH A;  3GTM H;  3ITP A;  5I9O A;  3J7Y W;  1XWE A;  3DWP A;  2QW7 A;  2ALY B;  1G6Z A;  4GOP C;  3V96 A;  1STG A;  1XTC D;  3LWU A;  1PFM A;  2EY5 A;  1TT2 A;  1ILQ A;  4KHZ A;  2WAC A;  4C3I H;  2HQL A;  5LMN Q;  2QDL A;  4LF6 Q;  3J7A 5;  4ME5 A;  1VQN A;  4FF4 A;  1RIP A;  3S17 B;  3BU2 A;  2EYF A;  1B50 A;  3CHB D;  2NWG A;  5FK9 C;  5BR8 L;  4EQP A;  1Y1V B;  3OW7 A;  1CA6 A;  2B2W C;  2L1B A;  4RHR A;  1DJR D;  2CCZ A;  4C1N K;  4JYA L;  3SDZ A;  1V1Q A;  5IT9 L;  3NBH A;  2SDF A;  4K5X A;  4JC0 A;  1JWU D;  1EQR A;  2NZO A;  5HGT A;  1B44 D;  1Q90 A;  4GOP A;  4B08 A;  2IY5 B;  1YBY A;  2E2I B;  3G71 A;  4A3I B;  1B9N A;  1N36 Q;  2ASB A;  3R2I A;  4KD3 A;  1FL0 A;  2L11 A;  2PMZ E;  4DAY B;  1TII D;  5C5L A;  1DD2 A;  4JBJ A;  2IW3 A;  1VQL A;  5E1F A;  1SAP A;  2KBN A;  4X65 Q;  3S16 B;  3PIP 3;  1VQB A;  3VA5 A;  1EZ6 A;  4K6L A;  3NUC A;  2CWA A;  4JI5 Q;  1EY0 A;  3MXP A;  1AE2 A;  4B3S L;  2OEO A;  1IW7 D;  1KHI A;  4DKA C;  1BUV T;  1X6O A;  1ASZ A;  3WDN A;  3A55 A;  4DK6 C;  1XMQ L;  2B2W A;  1AFP A;  4EQO A;  4JCV E;  4DXG A;  1BCP F;  3D31 A;  5JEA H;  4B9W A;  1V43 A;  3OIP A;  1ENF A;  2H4O A;  2VXW A;  4BY7 H;  1K8M A;  3A5Z B;  2ZM6 L;  1KRT A;  4KI0 A;  1KAW A;  1NMF A;  2B2U C;  2NTS A;  4JI0 Q;  4TQU S;  1ICW A;  4FF3 A;  5BN3 A;  2ATW A;  3JAM i;  2R93 B;  4XDX A;  1STB A;  2Q8R E;  1GUN A;  4GKK Q;  1TWG B;  1CQV A;  1FNW A;  4J1M A;  1Q46 A;  1GD7 A;  3EVQ A;  2OQ0 A;  4IJH A;  2R61 A;  3TEH B;  2A68 D;  3OIQ A;  4B9X A;  1AH9 A;  3BDO A;  1X32 A;  3S2D H;  3KBG A;  3E9I A;  1B3A A;  1HZC A;  1C9O A;  2IX3 A;  3K80 C;  1VDZ A;  5GAH C;  1G91 A;  4POF A;  1ICF B;  1XYI A;  1RJT A;  4KY7 A;  4C3J B;  3KDF B;  2NVY B;  3ER0 A;  1DXM A;  3RLO A;  2JEA I;  4CGY B;  2JXM B;  2VY3 A;  4IQZ A;  4BWG B;  1SNM A;  2B2U A;  2QEX A;  1QCB D;  1WYD A;  3K7A H;  4ZYS A;  5E4X A;  5A2Q L;  2E5L Q;  3AU7 A;  1LTB D;  4EQN A;  3S1M B;  3UDF A;  4KMU C;  3M4O B;  1AZP A;  2Z9H A;  1LV9 A;  4NB3 A;  4OO1 I;  4DUZ L;  1SYD A;  2WP8 J;  4R4O A;  4OX9 L;  3ZJY C;  4DUY Q;  1IYU A;  2DN8 A;  4MZ9 A;  4ZCK A;  2O5I C;  1VQA A;  1J9O A;  3MFG A;  4OHJ A;  1IXR A;  2F0J A;  4HJA A;  2N8N A;  3HOX B;  1C7Y A;  2E2J H;  4IOA A;  2F0Q A;  1H95 A;  2DNE A;  3OTO Q;  5H1S E;  5IOD A;  1EQT A;  3HZX A;  1GOZ A;  3VR3 A;  2F0F A;  5IGD A;  1I50 B;  2NVT H;  5KNB A;  4LNQ A;  1QIL A;  2JA8 G;  4K8I A;  4HCE A;  5CV7 A;  3TRZ A;  2L12 A;  2PYK A;  4L6T B;  2OTJ A;  1SFO B;  1D5X C;  5BN5 A;  1YNJ D;  3I56 A;  1YHQ A;  1QZH A;  4LF5 L;  3TP8 A;  3S1Q B;  2A8V A;  3HKZ B;  2RA4 A;  1TKW B;  4DR5 Q;  1BR9 A;  1L0Y B;  2ZJP A;  1BBX C;  5IGE A;  4G7O C;  4IUQ A;  4A93 G;  1EEI D;  1CZW A;  1HNX Q;  4ZUI A;  1VF5 C;  3BDC A;  3VR5 A;  4L5T A;  1BDO A;  1U9R A;  3I4O A;  4R4C A;  4CKB A;  3MAQ A;  2E2H H;  4UY8 C;  4DR1 Q;  1GUW A;  4G7Z C;  3EQL C;  4B3T L;  2F0T A;  1DON A;  2XNA C;  4C2M B;  1B9M A;  5D65 A;  1I3Q B;  2JSO A;  1ASY A;  3CMA A;  1WTR A;  2N55 A;  1XMO Q;  4DR6 L;  2F3W A;  1CKM A;  3GTL B;  5AJ3 Q;  2CW0 D;  4A3E H;  2O4X A;  1ZYR D;  1F77 A;  2Z6K A;  3U9S A;  2UXD L;  2XIW A;  1PH5 A;  3D8G A;  3HP3 A;  1Q1E A;  2JA7 B;  2UUC L;  4RWS C;  4YCW A;  4BA2 I;  2AQ3 B;  1V1O A;  3A7L A;  1S4Z A;  2LS0 1;  1EU3 A;  1ZXT A;  4J6H A;  3CCV A;  4H02 A;  4ZLT F;  4L63 B;  4HMJ A;  1RHP A;  5AFW A;  5C44 B; 
#chains in the Genus database with same CATH homology
 1GUT A;  4IUP A;  2Q8I B;  4DAY A;  4HSP A;  1AEX A;  1MBY A;  3ONA B;  4M1U B;  5DAU A;  2PO4 A;  2NVQ B;  4EGV A;  2LFN A;  1X3P A;  3NTI A;  3BVM A;  3L7Z C;  1TWA B;  3TZD A;  3FVQ A;  4U67 3;  3Q0A A;  2EDG A;  3C2P A;  2NVX B;  1SND A;  5DEH A;  2XWJ B;  2WII B;  2HDL A;  4MN3 A;  4K6D A;  3GTM B;  2OF1 A;  1WVL A;  4TKO B;  1PYW D;  3NTH A;  5J22 A;  1CTM A;  1V8Q A;  2EE1 A;  2KCN A;  3H6M A;  1VF7 A;  2F1M A;  1UUP A;  1B1Z A;  5CBE E;  4DFA A;  1IYV A;  2XSC A;  1LTG D;  1STE A;  1S5E D;  2BDO A;  5I6Y A;  4MHE A;  2XWB B;  3QWN A;  1FNV A;  3VR2 A;  4RGT A;  5C0X I;  4ZAI A;  3ZYY X;  2K33 A;  2X6G A;  2LKV A;  1UNS A;  1SXT A;  2F0D A;  3TBI B;  1U4R A;  2CHB D;  2RDH A;  1B4O A;  2JEB I;  3EFX D;  3D4W A;  5D3D A;  1SDF A;  1CZG A;  1C8C A;  1U4L A;  1YNN D;  3VYR A;  1V1P B;  3Q24 A;  5FKA C;  5I9P A;  1TY0 A;  2JA6 B;  1FGB D;  3GTQ B;  1ET6 A;  4X3U A;  3D4R A;  2PMZ B;  1PTO D;  4WOR A;  1F9S A;  3GO5 A;  3M7N A;  5KIX A;  5IGC A;  1STN A;  1WTX A;  1NUC A;  1EU4 A;  4XXE A;  3K5M A;  4U68 A;  2K32 A;  4DF7 A;  3S2D B;  1E0B A;  3SK4 A;  2PZT A;  5F2D A;  1HCZ A;  1A3U A;  3HG9 A;  4XQN A;  4WRD A;  1HTL D;  4IZ8 A;  1ENC A;  3QIA A;  3NPP A;  4XYO A;  4LJZ C;  4X3S A;  3N6R A;  3C46 A;  3MZ5 A;  1Q3L A;  1D5Z C;  1E2Z A;  2L4N A;  1CK1 A;  1I6V C;  4Q5V A;  2K5Q A;  3RUZ A;  4XIG S;  1RDP D;  3O13 A;  3I91 A;  2KEC A;  3MA2 B;  4C56 C;  1JOR A;  4KY5 A;  2DY7 A;  4EVO A;  2CQA A;  2FMM A;  2PNR C;  4O1N A;  4BA1 I;  5IT9 E;  1FR3 A;  1VMP A;  2SOB A;  2B39 A;  4F88 A;  1IKM A;  2F0E A;  2MGS A;  2QIL A;  2NVT B;  1QNK A;  4OO1 G;  1I4R A;  3RLF A;  4LMQ D;  2LMC B;  1TY2 A;  4WFN 3;  4F7X A;  5C6A A;  5FLX L;  1BOS A;  2M00 A;  1G8Z D;  1D1I A;  4RH6 A;  3T16 A;  1EOT A;  1EQV A;  2G9H D;  5TSS A;  4XQQ A;  3RZO B;  2D5D A;  2EZV A;  2E2H B;  4PMB A;  4DN4 M;  1LT3 D;  3LWE A;  1IKL A;  1R4Q B;  4DK0 A;  1SJH D;  1KNE A;  5DM6 3;  1LTI D;  3GV6 A;  5KRU A;  3NWT A;  2AUK A;  1LTS D;  2JYO A;  3K59 A;  4KN7 C;  4R9W A;  1EY9 A;  4QMG A;  4P2C B;  2A6E D;  2RSN A;  2EJF C;  1HA6 A;  1A2U A;  2KOL A;  1EY4 A;  2Z4H A;  1A15 A;  3NHH A;  2K5D A;  3CU7 A;  4RCO A;  1CHP D;  5A2Q E;  3L9A X;  1PZI D;  2J0T D;  3KLS A;  1FNU A;  1QE6 A;  4X3K A;  2EJM A;  3HOU B;  5EPJ A;  1DYQ A;  3E5S A;  1F2Z A;  3NQI A;  3MXG A;  1HFG A;  1V1P A;  1GUS A;  3AB9 A;  1OXT A;  4V19 0;  1RTN A;  3K5L A;  5EQ0 A;  3I3C A;  1VMC A;  1F2L A;  3GP7 A;  1NR4 A;  4E6I A;  2JA8 B;  2PZU A;  1M4V A;  1E2V A;  4TSS A;  2NN6 I;  1G2S A;  4KV6 A;  3TP5 A;  2AWN A;  2FHT A;  3PIO 3;  5D14 A;  3BYT B;  3CKI B;  3L3O C;  4A93 B;  1IL8 A;  1O80 A;  3K6O A;  2L55 A;  1CT1 D;  3H94 A;  5CV5 A;  2KHS A;  1B2T A;  1BXT A;  2B2Y C;  3HOV B;  4IUV A;  5J1Z A;  5IGB A;  4KKU A;  5JOB A;  4QF4 A;  1PFN A;  2E74 C;  2I46 A;  2BE5 C;  5C0X G;  5K36 G;  1PRT F;  5EKL A;  3T13 A;  2K05 A;  1J8I A;  5EBD A;  3W3A A;  1WTW A;  4FXD A;  1DOL A;  3D6C A;  1A2T A;  3QO2 A;  2B2Y A;  2EOT A;  3PO2 B;  4F87 A;  2KQ3 A;  2Q8T A;  2WAQ B;  1L0X B;  3S2H B;  1SYF A;  3I70 A;  2E75 C;  4QIW B;  2NBF A;  2ID0 A;  1NCV A;  3OSO A;  1SSO A;  5CR3 A;  4HTH A;  1BCP D;  5LL6 X;  3J7A F;  1CHQ D;  4KN4 C;  3TN2 A;  3HRZ C;  2MJ8 A;  4A3D B;  1WCM B;  2SNS A;  1PFB A;  2KVM A;  4FO2 A;  3TZU A;  2KJX A;  4A3M B;  1ML0 D;  5FO7 B;  5KGU A;  3MC0 B;  1I6H B;  3X3N A;  3RZD B;  3GTK B;  1EIH A;  1JR0 D;  4HSV A;  1RF2 D;  2VNU D;  2PW7 A;  2C5C A;  5M9O A;  3NK9 A;  2V4D A;  4ZQ3 A;  1SYG A;  1EYC A;  1Q12 A;  1RKN A;  5C3W A;  2FIN B;  4V0B A;  3QB3 A;  1TS4 A;  5KND A;  5K36 H;  3PUX A;  5KNC A;  1CM9 A;  4UAI A;  4NDX A;  2F0U A;  1ONL A;  4XYQ A;  4CJ2 C;  1SBB B;  5FOB B;  4ODG A;  2Z8L A;  4CBV A;  3EA6 A;  2HCC A;  1O7L A;  2MHV A;  4C1N I;  1HTP A;  5ELD A;  1Z6H A;  1LAC A;  5C5M A;  3WOF A;  4I7Z C;  1SNQ A;  4PMW A;  1JB3 A;  3I4M B;  1KDB A;  2R3Z A;  3CRK C;  2F0N A;  4FVM A;  4M8A A;  1HFN A;  5JVH 3;  4CKC A;  1EYD A;  1WTQ A;  2EY1 A;  5ELF A;  5EJW A;  5LHY 1;  4A3K B;  5M5Y B;  5M3F B;  1RCV D;  3A56 A;  5IGF A;  1PLF A;  2YYZ A;  3PO3 B;  4NW2 A;  3E6Z X;  1S5D D;  1SEB D;  1XXG A;  2QDB A;  1F9P A;  5M5X B;  1LTA D;  1EEF D;  4HCS A;  3IFD A;  1GUO A;  2EY2 A;  2XN9 C;  1K83 B;  1PRT B;  2QCP X;  2DNC A;  5EKI A;  2PCF B;  2RSO A;  2R7Z B;  3OMG A;  1R4P B;  2NTT A;  1GUG A;  3DUZ A;  2N88 A;  3DMU A;  3OMC A;  5FLX E;  1EFI D;  2A69 C;  3Q6S A;  3LX0 A;  1EL0 A;  4ABN A;  3G6J B;  4BBR B;  5E3F A;  4ZUJ A;  3BYY B;  2K28 A;  1STA A;  1WD1 A;  4KKT A;  2JE6 I;  4FXG C;  2ICE C;  2AWO A;  4DA2 A;  3P1H A;  4RHS A;  5IOC A;  2NN6 G;  1HPC A;  1TS3 A;  1W6J A;  2DY8 A;  1MGS A;  4I65 A;  4HR7 B;  2PQE A;  4G57 A;  2K6A A;  3M85 A;  1K8O A;  1O7Y A;  4DAP A;  1Q1B A;  1SMY C;  4BY1 B;  3M3Y B;  4KK7 A;  5C4H A;  2K04 A;  2B2T C;  1U4M A;  5IIF A;  3TSS A;  5COR A;  3SE0 A;  3UI2 A;  1Y8O B;  1H9R A;  1KAA A;  3TP6 A;  3SVM A;  5ISR A;  2XVS A;  2ENB A;  3CRL C;  3PUV A;  3D3R A;  4K5W A;  1HUN A;  1TS2 A;  3MXU A;  3Q23 A;  5G3L F;  2EYJ A;  1S5C D;  2B2T A;  1SYE A;  4H44 C;  4OL7 A;  4CKE A;  1DZ1 A;  2F03 A;  3SK8 A;  2KA7 A;  3ERO A;  3H0G B;  4PQX A;  3W2D A;  5C4X B;  2K03 A;  1DM0 B;  4XTC S;  3K5N A;  2PW5 A;  4R8N A;  1EZ8 A;  4ZK9 B;  1PRT C;  4KY6 A;  4HED A;  3R3O A;  4HN7 A;  1LTT D;  3WOE A;  2NN6 H;  1KNA A;  1T5X D;  1TR5 A;  3URY A;  2EYH A;  1EWC A;  1E2W A;  2F0O A;  3I90 A;  2KCC A;  1D1K A;  2AUJ D;  2EYL A;  5KYL A;  3NTK A;  1R9T B;  3JAM L;  3NP8 A;  3MFY A;  4DK1 A;  1WD0 A;  3EJI A;  2RVL A;  2ZXO A;  1SYC A;  5E4W C;  4NP5 A;  1HUM A;  3T53 B;  2VB2 X;  3KLS X;  1HHV A;  1KLG D;  4IAL A;  2K01 A;  3I72 A;  1O7Z A;  4BBS B;  3NWS A;  2I07 B;  4K8J A;  3S14 B;  3A8K E;  5CV8 A;  1TWC B;  3HEJ A;  3R93 A;  5LL6 S;  1I4G A;  3F2U A;  4PNY A;  4C3H G;  2K7V A;  5HUR A;  1EWH A;  3TDQ A;  3I4N B;  5CMD A;  2ZXR A;  1IW7 C;  2A6H C;  1TS5 A;  1I4X A;  1OXU A;  1OXX K;  1QNU A;  3NBI A;  1MI2 A;  2B63 B;  2EVB A;  4LK1 C;  1CA5 A;  5CC4 A;  3H09 A;  3FDT A;  4ID6 A;  5CV9 A;  2MPM A;  1JQY D;  3MXN A;  2F0P A;  1ZEQ X;  2A74 C;  4N9T A;  2ZXP A;  1VCI A;  4IUU A;  2HUG A;  2A68 C;  3K0Y A;  1SYB A;  1ZKO A;  1UAP A;  2IX1 A;  3TME A;  2OT2 A;  4ZRZ A;  2M9V A;  1LLR D;  3HOZ B;  1BF4 A;  3H91 A;  2F0S A;  4C3I G;  1EIG A;  1F2M A;  1LTR D;  1OXV A;  5I4D A;  4A3B B;  1Q8I A;  3E0J A;  1HXY D;  2NB0 A;  2L5T A;  2WIN B;  4H0L C;  3R2T A;  1B53 A;  4RKB A;  2EYM A;  4DU9 A;  3A7A B;  1GXD C;  3VYU A;  4IN3 A;  2L9H A;  4Z9C B;  2BCO A;  4OO1 H;  4Y7N B;  1AZQ A;  1KDA A;  4DNT B;  3MWY W;  1YNJ C;  5C4J B;  1ESF A;  3PUZ A;  3VR6 A;  1GJX A;  1OXS C;  2PZW A;  4NMZ A;  4RAU C;  5JEA G;  4YIJ A;  3FPU B;  3G7L A;  1MSG A;  3HOW B;  1D5M C;  4QUF A;  1U4P A;  1LT6 D;  4OGQ C;  4NKL A;  3J80 E;  2X6L A;  3K57 A;  4UDU C;  3AMU A;  4K2K A;  2XRQ D;  3I4L A;  3I8Z A;  2JP1 A;  1STY A;  3DXJ C;  1PRT D;  2CW0 C;  4RCN A;  1LT4 D;  1ZYR C;  4DNR B;  4F8M A;  1KAB A;  5JVG 3;  1PTO B;  1LT5 D;  2KED A;  5I2Y A;  5I2X A;  3IAY A;  3K5O A;  2M2L A;  4OIJ A;  2B8G A;  3FPP A;  2K5W A;  1MSH A;  3KUP A;  1TQO A;  5C3X A;  1F9R A;  5CV6 A;  2EYO A;  3M7G A;  1JWM D;  3I73 A;  5DNF A;  1DOM A;  3TP7 A;  2F0I A;  5C0X J;  1EY8 A;  2Y0S B;  3D6W A;  4IUR A;  2WKC A;  1QJO A;  2GA4 B;  1FD7 D;  1H9S B;  3DWQ A;  4XQJ A;  3CQZ B;  4G4K A;  1I4H A;  4K14 A;  3LNN A;  2F0H A;  3FRP B;  2IL8 A;  4X3T A;  2RBM A;  3OOC A;  2D9U A;  2J7Z A;  3GTG B;  2B8F A;  2A6H D;  2IWH A;  1Y69 U;  2XRS D;  3D4D A;  3U9O A;  1ILP A;  4KJN A;  1GHJ A;  3A8I E;  1S5B D;  3IL8 A;  1GHK A;  3R8B A;  1HRJ A;  1FYC A;  1JOO A;  2BA1 A;  2FMC A;  3S9W A;  5KYI A;  1AW7 A;  1S5F D;  1Z47 A;  5JPM C;  2LY7 A;  4CHT B;  1OO9 B;  1Z7T A;  4GZY C;  1TWF B;  2ZT9 C;  3HOY B;  1AN8 A;  5C0X H;  3C1F A;  5EPL A;  1SJE D;  3P75 A;  1YNN C;  4QUC A;  3RMH A;  3M4Y A;  5CBA E;  2F0V A;  1JOQ A;  4RFB A;  5CGK A;  2VUM B;  1SNO A;  1F2Y A;  2JA5 B;  2BDN A;  2F0G A;  2NUC A;  1PTO C;  1PZK D;  1WTP A;  4QB4 A;  2OXP A;  3BDL A;  4S3S A;  1I4Q A;  3IFT A;  2AQ1 B;  3H3V C;  3T56 B;  4FF2 A;  2X69 A;  2RDG A;  1CQF A;  2WKD A;  1SE4 A;  2R92 B;  4IFD I;  3OWE B;  4RA8 A;  4G7H C;  2NYZ D;  4ZKC B;  1SNC A;  3J7A V;  2A73 B;  3OWF A;  2VB3 X;  1JOK A;  5JAV A;  1Y1W B;  1SNP A;  3Q22 A;  3OHX C;  3N52 A;  4PMC A;  4J8Q A;  2B2V C;  3J80 L;  3MHB A;  4PV1 C;  1H9M A;  2IPK D;  2RKS A;  3T51 B;  1EY6 A;  3PV0 A;  2SEB D;  4MIU A;  2EY6 A;  3FKI B;  3P20 A;  3JAM E;  3GTJ B;  5JPN C;  3NE5 B;  3KBX A;  5EBC A;  1DOK A;  4CJ0 B;  3DM1 A;  2Z4I A;  1WTV A;  1QG7 A;  2IJ0 A;  3ND8 A;  2RQX A;  1NSN S;  4Q0F A;  3GD7 A;  4K2L A;  2RDF A;  1HA5 A;  4ZKB B;  2B2V A;  1H9S A;  4O42 A;  2BE5 D;  5IGG A;  4C3H B;  1H9K A;  2J4X A;  1CI3 M;  2Z1C A;  5NUC A;  5M3M B;  4K5V A;  5C3E B;  3SEB A;  1ROD A;  1BO0 A;  1C4Q A;  5EPK A;  2G9D A;  4FP5 D;  3KLR A;  1SE2 A;  3VYS A;  1TVX A;  1BNZ A;  2HQE A;  1II3 A;  4FYD A;  3IKJ A;  1HQR D;  4JK1 C;  4WJW A;  5BN4 A;  2L0C A;  1MD2 D;  5M5W B;  2NZ1 D;  3S1N B;  1M8A A;  3KK7 A;  3NSW A;  1QB5 D;  2A6E C;  3DHQ A;  3VR4 A;  2E76 C;  4ILW A;  2KUM A;  3S1R B;  1F9Q A;  4C3I B;  1BCP B;  1QWY A;  3GTO B;  3GQB A;  1WTO A;  3GV3 A;  2HCI A;  2TSS A;  2WB1 B;  3FEW X;  4KJO A;  2PPB C;  2R6G A;  4H7B A;  5G3L D;  2AQ2 B;  1PTO H;  2HDM A;  3QG1 A;  3PUW A;  3J81 E;  4C3J G;  1A3T A;  1ENA A;  2D62 A;  5FO8 B;  1G2T A;  4N9P A;  1C48 A;  3QOJ A;  2TMP A;  2F3V A;  5D3I B;  3GTP B;  2H1E A;  2ICI A;  4DAV A;  1Y8P B;  3BS1 A;  4IUN A;  2BOS A;  2IT1 A;  4KKS A;  1STH A;  1EY5 A;  2KEE A;  4R8I A;  1JIC A;  4RKL A;  1IHZ A;  4BY7 B;  2IX0 A;  4A3G B;  4LAA A;  4ULL A;  4HAE A;  3ND9 A;  5C4Z A;  1PTO F;  3MVV A;  1JCK B;  1KTK A;  4AYB B;  1PZJ D;  1AP0 A;  3HS0 C;  5I6W A;  2E2D C;  2QKI C;  1T5E A;  1TU2 B;  5CV4 A;  5KEE A;  1D2B A;  2EYP A;  5EKK A;  5K5P A;  4KTA A;  4FNF A;  5DM7 3;  3DEP A;  1X3Q A;  3K7A B;  3SXH A;  3SHL A;  3RD4 A;  4QCL A;  1H9J A;  3OPO A;  3SK5 A;  3DWA A;  5CYU A;  3QOL A;  2QEJ C;  1KDC A;  4KD4 A;  2E2J B;  1EY7 A;  1UEA B;  4H13 C;  2A5H A;  5ELC A;  1BCP C;  1ET9 A;  3DEO A;  3C3L A;  3A8J E;  5A35 A;  1PDQ A;  2A69 D;  3VYT A;  5JJZ A;  3PUY A;  1KLU D;  2C9O A;  1NR2 A;  3SR1 A;  3HGB A;  5ELB A;  5FO9 B;  2MUY A;  4XT1 B;  3V2T A;  3BVG A;  4IFD G;  2BA0 A;  1RTO A;  5T1I A;  3VA7 A;  3BVZ A;  3PMF A;  3FMC A;  1W6K A;  1O78 A;  2F0W A;  2EPB A;  4FF1 A;  1A3V A;  3BZD B;  3ERQ A;  1NAP A;  2EXZ A;  1I4P A;  5ELE A;  3S15 B;  3P7J A;  2K1B A;  4A3E B;  2O2L D;  4TRD A;  3SK6 A;  4FXK C;  4IFD J;  4XT3 B;  3BG3 A;  1SMY D;  2FFK B;  2F0M A;  2D2C C;  4RGM A;  4HMI A;  1JWS D;  5T1G A;  4A3J B;  3NQT A;  2F0K A;  1PXU A;  4JBW A;  1ESR A;  1BQQ T;  1A6X A;  1DCZ A;  1LAB A;  3J81 L;  3V05 A;  2SNM A;  1LO5 D;  4KHV A;  2WV6 D;  1Y8N B;  4DXF A;  1JC7 A;  4RGO S;  4A3F B;  1PMR A;  2O5J C;  4BS9 A;  1SE3 A;  1JE4 A;  1HQM C;  1D6E C;  1TWH B;  3MTS A;  1G29 1;  4RGN A;  3KF8 A;  1EYA A;  3A54 A;  3MEH A;  5EGT A;  4L8J A;  2F0L A;  3K58 A;  4OIK A;  1CFM A;  2FJ2 A;  4DGZ A;  1XX8 A;  5J39 A;  2CVR A;  3C1E A;  4CJ1 B;  3T4A C;  1RD9 D;  3X3M A;  2MP1 A;  5COY A;  2F4I A;  3NXW A;  4IFD H;  2YU9 B;  3QJY A;  2EJG C;  2QF7 A;  4IUT A;  5JEA J;  1QOH A;  3ITP A;  5I9O A;  3J7Y W;  1XWE A;  3DWP A;  1G6Z A;  3V96 A;  1STG A;  1XTC D;  3LWU A;  1PFM A;  2EY5 A;  1TT2 A;  1ILQ A;  4KHZ A;  2WAC A;  4ME5 A;  4FF4 A;  3S17 B;  1B50 A;  2EYF A;  3CHB D;  2NWG A;  5FK9 C;  4EQP A;  1Y1V B;  3OW7 A;  1CA6 A;  2B2W C;  2L1B A;  4RHR A;  1DJR D;  4C1N K;  3SDZ A;  5IT9 L;  3NBH A;  2SDF A;  4K5X A;  1JWU D;  5HGT A;  1B44 D;  1Q90 A;  4B08 A;  2E2I B;  4A3I B;  1B9N A;  3R2I A;  4KD3 A;  2L11 A;  1DD2 A;  1TII D;  5C5L A;  2IW3 A;  5E1F A;  1SAP A;  3S16 B;  3PIP 3;  3VA5 A;  1EZ6 A;  4K6L A;  3NUC A;  1EY0 A;  3MXP A;  2OEO A;  1IW7 D;  1BUV T;  3WDN A;  3A55 A;  2B2W A;  1AFP A;  4EQO A;  4DXG A;  1BCP F;  3D31 A;  5JEA H;  4B9W A;  1V43 A;  3OIP A;  1ENF A;  2H4O A;  2VXW A;  1K8M A;  4KI0 A;  2B2U C;  2NTS A;  4TQU S;  1ICW A;  4FF3 A;  5BN3 A;  2R93 B;  4XDX A;  1STB A;  2Q8R E;  1GUN A;  1TWG B;  1CQV A;  1FNW A;  4J1M A;  3EVQ A;  2R61 A;  2A68 D;  3OIQ A;  4B9X A;  3BDO A;  1X32 A;  3KBG A;  1B3A A;  2IX3 A;  1VDZ A;  1G91 A;  1XYI A;  1RJT A;  4KY7 A;  4C3J B;  2NVY B;  1DXM A;  2JEA I;  4CGY B;  2JXM B;  4IQZ A;  4BWG B;  1SNM A;  2B2U A;  1QCB D;  4ZYS A;  5E4X A;  5A2Q L;  3AU7 A;  1LTB D;  4EQN A;  3S1M B;  4KMU C;  3M4O B;  1AZP A;  1LV9 A;  4OO1 I;  1SYD A;  2WP8 J;  1IYU A;  2DN8 A;  2O5I C;  1J9O A;  3MFG A;  4OHJ A;  2F0J A;  3HOX B;  2F0Q A;  2DNE A;  5IOD A;  1EQT A;  3HZX A;  1GOZ A;  3VR3 A;  2F0F A;  5IGD A;  1I50 B;  5KNB A;  1QIL A;  4K8I A;  4HCE A;  5CV7 A;  2L12 A;  2PYK A;  4L6T B;  1SFO B;  1D5X C;  5BN5 A;  1YNJ D;  3S1Q B;  3TP8 A;  3HKZ B;  2RA4 A;  1TKW B;  1BR9 A;  1L0Y B;  1BBX C;  5IGE A;  4G7O C;  4IUQ A;  1EEI D;  1CZW A;  4ZUI A;  1VF5 C;  3BDC A;  3VR5 A;  1BDO A;  1U9R A;  4CKB A;  3MAQ A;  1GUW A;  4G7Z C;  3EQL C;  2F0T A;  1DON A;  2XNA C;  4C2M B;  1B9M A;  5D65 A;  1I3Q B;  2JSO A;  1WTR A;  2N55 A;  2F3W A;  3GTL B;  2CW0 D;  2O4X A;  1ZYR D;  1F77 A;  3U9S A;  2XIW A;  3D8G A;  3HP3 A;  1Q1E A;  2JA7 B;  4RWS C;  4BA2 I;  2AQ3 B;  1V1O A;  3A7L A;  1S4Z A;  2LS0 1;  1EU3 A;  1ZXT A;  4J6H A;  4ZLT F;  4L63 B;  4HMJ A;  1RHP A;  5AFW A;  5C44 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...