3J7YW

Structure of the large ribosomal subunit from human mitochondria
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
107
Chain Sequence
LGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1030 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j7yW00
4V190 3J7YW
chains in the Genus database with same CATH superfamily
5JJLA 2R92H 4LF9L 5ELNA 3SK5A 1I4QA 2AHOB 1A62A 4B3SL 5D3IB 1N32L 5COYA 1DOLA 3F2BA 2I5MX 3PCOB 2A6HC 3NP8A 3NSWA 3W3AA 1OXTA 2R6GA 1STNA 3GTOB 3NXWA 4AIMA 3OHXC 5EBDA 4DK1A 4K2KA 5BN3A 4DV3Q 3OIPA 1W6JA 1FJGQ 3RZDH 3I3CA 2GVAA 1IBLQ 1JMCA 2Y0SE 3BZCA 2K32A 3JAML 3SGIA 2VQFQ 2TSSA 2K03A 1HA6A 2C9OA 1HQMC 5ELCA 1C7YA 4JV5L 2R93H 2SNSA 3MXNA 5I9PA 5FLMG 1ZKOA 1H9SA 3DM1A 2C5CA 3GDEA 4P74A 2CH4W 5IY0A 4LF4Q 4HMIA 1EL0A 5AJ3Q 2NN6G 3GTLB 1E7ZA 1F9QA 2NVQH 4M1UB 1RCVD 2I5LX 1EU4A 4AYBG 1S5BD 4HJ7A 1STGA 3T13A 2R7DA 3D6CA 1A6XA 4HR7B 5E4WC 2UU9L 4AQYQ 4A3GB 4Z9CB 5JJZA 4Y7NH 1JB3A 4KY7A 1HPCA 2Z6KA 3HKZB 4RA8A 4GNXB 2O5IC 1B3AA 1H9MA 4C3IH 5FLXE 4A3JH 4K6DA 4LMQD 2OF1A 1AZQA 2N55A 4A3DG 1X3FA 1V8QA 5M5YB 2F4VQ 4IOAA 5M9OA 3HOUG 2RBMA 4R4QA 2G5DA 4IALA 1GD7A 1RTNA 1QVFA 5M3MH 2A8VA 1I4PA 3F2UA 2LXJA 1SMXA 2NZHA 2EJFC 1OO9B 3J7ZC 1U5KA 1F2LA 1WTRA 1HR0L 3IKJA 5M3FH 2KHSA 3TZUA 1KC8C 2VB2X 4FF4A 3T51B 3G6EA 1EU3A 2SEBD 2EXDA 1ESFA 1TWCH 3NK9A 3EVQA 4NW2A 4EQOA 3CCEA 4YIJA 3NWSA 3S1QB 4A93G 4C3JH 4DUYQ 3T53B 5BN4A 3MZ5A 1YHQA 4JI0Q 4R8NA 2R7ZG 3KF8A 5JEAG 4NDXA 3I4MB 1VQGA 1SFOH 4WORA 2F03A 1M4VA 2IHEA 2OXPA 2F0KA 1U0LA 4CDCC 2MFIA 5IGGA 3J81L 5EAYA 5FOBB 4J8QA 1AN8A 4UHVA 3I55A 2EYMA 2PMZB 4M8AA 1A2UA 3VYRA 3WOFA 4A3IB 2A5HA 2B63B 1A3TA 3K5MA 3CRLC 2BDOA 2RA4A 5CMDA 3A7AB 1UEBA 1SDFA 4ZLTF 2QDBA 1LT6D 1W6KA 3CCMA 5CV7A 1WOCA 3RLOA 3SEBA 2L5TA 3D0FA 1XPRA 2K5VA 5JEAJ 1P16A 2KECA 5JVG3 2NUCA 1I3QB 4JBWA 4KKTA 1SYDA 1VMPA 1JQYD 3PO3B 3Q24A 2K5DA 2WFWA 2RQXA 3R93A 3OYYA 4DV5Q 1XX8A 1J8IA 3A8JE 3GTJB 4G7ZC 4QY7A 3MFYA 4HTHA 4IPDA 1PH5A 4DAYB 3UDXA 2N49A 3K5NA 1RD9D 1HZCA 4FDBA 1QE6A 4XQJA 1HNWL 2KQ3A 1ET9A 4HJ8A 1HR0W 2ZM6Q 4DV3L 4L5SA 4A76A 1K8AC 1FJGL 1IBLL 4GOPA 1KAWA 3U9OA 3EQLC 4EQNA 2CWAA 3UE0A 4DA2A 2VQFL 3HOXG 3CMAA 3K0XA 2VB3X 4B3RL 3R2TA 4RHSA 1WTXA 4IPCA 1F2MA 1DOKA 2HIXA 5AJ3L 5HY6A 1RF2D 3HOYG 1GUSA 2B2WA 1PRTF 2YYZA 1R9TH 3UDGA 2X6LA 3SXHA 1GKHA 2UXDQ 1Y8OB 2QDLA 1I4RA 4CGYB 3F1ZA 3D4WA 5C6AA 5C4XG 1ENFA 4DK6C 5HGTA 5KEEA 4AQYL 3T16A 1WTVA 4RKLA 2F0HA 1HQRD 3I7FA 2ZJPA 2L11A 2R61A 3JAMi 3Q8DA 1YI2A 2JEAI 3J80L 2K50A 3L0OA 4HEDA 1X55A 4KN4C 1S5ED 3C3LA 4R9WA 1UE5A 4A3MB 4AYBE 4CDFC 4JK1C 1I50H 2F0EA 3AQQA 2JYOA 5NUCA 1B44D 2F4VL 1K8MA 2ICEC 2VY3A 2ZTCA 2RKSA 2L1BA 4LUVA 3VYSA 1J9OA 5FJ8H 1EY6A 4DR2L 4IUTA 1HNXQ 1R4QB 1D5ZC 1PRTB 2PI2E 1TWGB 1SE3A 1EY9A 5LHY1 1A15A 3U58A 2IL8A 1DGSA 2VS1A 4DUYL 2Y0SB 5KYLA 4BY1G 4JI0L 1Z47A 3K5OA 4R4OA 1FR3A 5F2DA 4O1NA 5GAHC 2IWHA 2A69D 2AQ1B 2FFKB 5J39A 2ASBA 3J81j 1WI5A 5ELBA 2B2VC 5EPJA 2RVLA 3ND9A 4C1NI 2HHHQ 2E2IB 1ENCA 5K5PA 2K7VA 3VA5A 3CRKC 5CV8A 4ME5A 1B9NA 4TVAB 5C0XJ 5C3EB 4A3EG 1STYA 1Z6HA 4QF4A 4QL5A 3CU7A 1JJ2A 4HIDA 4YY3Q 1K8GA 1Y8PB 4C56C 2K14A 4FXDA 1TS3A 2A6ED 2V4DA 3CD6A 3M4QA 4X65Q 3VYTA 3NPPA 3MWYW 3TP6A 1IYJB 3J81i 1D1KA 4BBSG 5T1IA 4A3FG 1LO5D 4E6IA 4DV5L 2NN6H 1S72A 4LUOA 2R92G 3MXGA 4KLKA 2EY1A 1CSPA 4X64Q 3CAMA 4ZQ3A 4IUPA 5ELOA 1IBMQ 4N9PA 3VR4A 1W2BA 4IUQA 3QOLA 3HOWB 1FVIA 2H1EA 1EIYB 1PDQA 5AFWA 1ENAA 2ZM6L 3MAQA 3GTQH 1HH2P 2HDMA 1LV9A 4DGZA 3Q23A 1EQTA 4F8MA 1V9PA 5JPMC 4A3DH 1RTOA 3CW2C 1LT3D 1RHPA 2O4XA 1QUQB 2JQOA 4GNXA 3KBGA 5EGTA 5LL6X 2R93G 2Z9HA 1QNUA 3K81C 2LSSA 4JOIC 1EY8A 1RJTA 3E9HA 4DV0Q 1EQQA 2VW9A 1UNSA 2VXWA 1XNQQ 1H9RA 3NTIA 3NQIA 3M7NA 3P7JA 1VCIA 3K58A 2PYKA 3M9BA 4H44C 2I46A 2CKZB 1Y1VB 2UXDL 4DR6Q 1PLFA 5C44B 3N6RA 1WTQA 4A3KH 2LMCB 1GXDC 2CFMA 1STBA 2B2YA 3CC7A 1RKNA 3BDCA 1NMGA 3PIPA 2CW0D 4J6HA 5C0XI 3I4NH 4C3IG 4A3JG 4LF6Q 4BS9A 4UY8C 1E1TA 1EEFD 2OCEA 4RGNA 3KUPA 1EYAA 4JI1Q 2ZXRA 1SRUA 4CDDC 1J6QA 2ZTEA 5JJKA 4IOCA 5M3MG 4NXNQ 4JI3Q 3VR3A 2KCTA 2AMCB 2MUYA 1D2BA 1HNXL 1ASZA 1PH7A 1VQFA 5M3FG 3OTOQ 2E2JB 4L63B 3QR8A 3GTMB 4A3BB 1I6HB 2L0CA 5GQOA 1BCPC 3J80i 5CGKA 4RHRA 2QW7A 2RDGA 1EY4A 4C3JG 2AQ3B 5IOCA 2E74C 1EWIA 1CQVA 2RSOA 2UUBQ 5I6YA 1EYCA 3K59A 2X6GA 1OXUA 3KLSA 2IY5B 2BDNA 5JJIA 4LK1C 4IFDI 1HXYD 1B3QA 3GP7A 3S17B 3ICEA 1JC7A 2PNHA 2AKWB 2HHHL 1PZID 4GKJQ 1Q3LA 4KV6A 1FNUA 2B8GA 3KLWA 4ID6A 1QB5D 1S5FD 3LGJA 3A55A 4H0LC 4DNTB 4DAYA 2NVYH 1SE8A 4XQQA 1EYDA 1LTID 4YY3L 3KDFA 4BWGB 1SNDA 3IAYA 3S1NB 5IGEA 4R8IA 1OXSC 3HOVH 4XQNA 1KABA 2JEBI 1S4ZA 4DR7Q 3HOXH 4X65L 4AYBB 1TWHB 3HRZC 4C3HH 3J7AV 3S1MB 1VQNA 1C0AA 4CKEA 2BOSA 1DM0B 3JAMc 2Q2TA 2UXCQ 2EDGA 3HOYH 3CQZB 5CYUA 4X64L 2BE5C 3I90A 3VR6A 2ALYB 1SR3A 4NPSA 1IBML 2K5HA 1ZEQX 2V1CC 3K8AA 3F2DA 3I91A 4DN4M 1K3BC 4FXGC 1B70B 1L0XB 4QMGA 4C2MB 1HZ9A 1Q86C 4NKLA 4IPGA 4MZ9A 3HOUB 5D3DA 4XT3B 1AH9A 4L6TB 3TN2A 1TR5A 2G9HD 2I07B 2EIFA 3A8IE 1YIJA 5EBCA 2SOBA 2JE6I 3ITPA 4YCVA 5E4XA 3TREA 3S14B 3V2TA 1NUCA 4FXKC 4HCSA 2L9HA 1BVSA 1PH4A 1IZ6A 2J7ZA 3WWVA 1XNQL 3FP9A 5IGDA 2R7ZB 1PFMA 4IQZA 5C0XH 1MHWC 1O7IA 2YV5A 3BYYB 2UUAQ 4IUVA 4DR6L 1N33Q 4OXPA 2IW3A 3FKIH 3IFDA 3CPWA 2DGYA 1TWFH 4JCVE 4HJ9A 3AU7A 1F2YA 1SYGA 4P71A 3T1HQ 4AH6A 1YJWA 4ME3A 1P8LA 5JPNC 4LF6L 1CKOA 2DNEA 3VR5A 3OPOA 1I94Q 1EIGA 4KK7A 4RFBA 1Q81C 3S2DH 4JI1L 3S2HB 3NEMA 4RGMA 1TU2B 1CTMA 1YEZA 4A3EH 3J81c 1L0WA 4RCNA 2KHIA 3H3VH 4NXNL 4JI3L 4JPBW 4HIOA 4DR1Q 2B2UA 2CCZA 1GO3E 3OTOL 4JVZA 3S15H 4PMCA 2K33A 3H0GG 2SNMA 5DAUA 2WB1B 3PUVA 4ILWA 3MTSA 4ZCKA 1LTBD 2N78A 3ERQA 1M90C 1KDBA 1FD7D 3SDZA 4FO2A 1FNWA 4BBSH 2UUBL 1SJED 2ZTDA 3A74A 1AE2A 3PQIA 2NB0A 1JOKA 2K5QA 1QNKA 1JOQA 1VQCA 2AWNA 2C35B 1HUMA 4XXEA 2Z4IA 1MSHA 2CHBD 1V1QA 2F0QA 4V0BA 2JA5B 4PZ7A 5JVH3 5C5LA 5LMNQ 1PTOC 3T56B 1Q90A 5E7NA 4GKJL 1CA6A 3U50C 1LM0A 1TIID 2JA8H 1HFNA 2H4OA 2Z4HA 3D31A 1WYDA 1YHAA 3JAME 3TP5A 1A0IA 3U9SA 2WV6D 1GOZA 1UWVA 1B53A 1A3VA 2QGQA 1Y14B 1JE5A 4X3SA 2EQSA 4KHVA 2KCMA 2OQKA 1HA5A 3PO3H 1PFBA 1VQEA 3HOZH 4DR7L 4EQ5A 2PCFB 2E8GA 2F0VA 2JA6H 1RDPD 1LTLA 3TP8A 3AB9A 1RIPA 1V1PA 5C4XB 1SYEA 2PQAA 2UXCL 2RDHA 1V1OA 3M4OH 4O2DA 5KNDA 2NBFA 2MQHA 1IYUA 4KHZA 3B6YA 4OWTB 5IODA 3DM3A 4B08A 1WVLA 1D7QA 1TWAB 4LF7Q 4UP9A 1WCMH 2B2TA 2FINB 2VL6A 5LMUQ 1YNNC 1BO0A 2LKVA 2F0IA 3A56A 5CBEE 2XNAC 4QUCA 1QG7A 1L1OA 1KTKA 3J80c 2F0MA 3RNUA 1C48A 1S3OA 3PO2H 2MNAA 1CKMA 1CZGA 1PTOB 1E24A 1AFPA 3AMUA 3ERSX 5KRUA 3K7AH 1EWCA 1O78A 4RGOS 1G2TA 5C4ZA 2HCCA 4MHEA 2XN9C 3TMEA 4G7OC 3TDQA 4O0AA 1AE3A 3UDIA 3PGZA 1VQKA 1N33L 4YWLA 4A3KG 1VDZA 4OONA 3RN2A 1PH1A 2MO0A 3J81E 1NY4A 4JG2A 2D62A 3T1HL 1GJXA 1BNZA 3BVGA 1NE3A 3I4NG 4ZK9B 2LFNA 4OIKA 4L5QA 1SAPA 2QA4A 1TY2A 1XYIA 2DN8A 4LAAA 4DFAA 1I94L 4RGTA 2E75C 1O7LA 1NNXA 2A74C 1DCZA 3JC66 2A68D 5D14A 2NVXB 1VF7A 5CV4A 3KJPA 3EBEA 1G51A 1SXTA 3T4AC 1TWGH 1TY0A 4HJAA 4LW1A 1CI3M 2XTIA 4IPHA 5I9OA 4DR1L 4DR4Q 4N8FA 1E2WA 4BBRH 4A3FB 1C8CA 2F0NA 3N52A 2R92B 5CORA 3K0YA 3BZKA 1CK1A 5EPLA 1PH9A 1K0RA 1BF4A 4DV7Q 4KTAA 1JICA 4FP5D 1SNQA 1LTSD 2OEOA 2DY7A 4UP8A 3KBXA 4H02A 1U4LA 1F9RA 4GN3B 2A6HD 3CCRA 5LMNL 2PW7A 1PA6A 4IJHA 3RZDB 4CJ2C 1LT5D 5JAVA 3WOEA 4DKAC 3BJUA 5EJWA 4R4TA 3E3XA 3C46A 2KCCA 1VMCA 3GTPB 2R93B 1BOSA 4KD4A 4OGQC 3CXCA 4F88A 1WD0A 2EPBA 3A5UA 3BVMA 2IX0A 5IP7G 1CKNA 2NVQB 3LX0A 3HOVG 2O2LD 2E2HB 1XMOQ 2F0WA 1T5EA 4C3HG 2RDFA 1CUKA 5GROA 1U4PA 1B9MA 4Q5VA 4LF4L 4TRDA 1Q82C 2EXZA 3PIO3 3L3OC 4JI2Q 4Y7NB 3DEOA 4DNRB 1QZHA 1A2TA 1HZAA 1UE1A 2F0PA 4XDXA 3J80E 4RCOA 4C3IB 2ZT9C 3MVVA 1E1OA 4A3JB 5IYDH 1JWMD 4I65A 3S24A 3GTGH 3H91A 3P20A 4DXGA 1G6PA 2XWBB 4LF7L 4XTCS 3EN2A 2IJ0A 3EIVA 4CBVA 2ATWA 1EIFA 1LABA 4FNFA 4DF7A 5LMUL 4MTNA 3OOCA 2JA7B 5M3MB 1F2ZA 4WJ4A 1EIHA 2KHJA 3RLNA 2XWJB 3TP7A 5M5WH 1VQOA 1YVCA 4XT1B 4IUUA 2EOTA 2VUMH 4X3UA 2JA9A 1JOOA 1HTLD 1I4XA 1TWCB 4ZUIA 1EY0A 1KDAA 2CW0C 4PG3A 3LWUA 4C3JB 4ZYSA 4X66Q 2DNCA 2Q8IB 1GUOA 3SR1A 3KF6A 3H0GH 1PXUA 5LMNW 5C0XG 1SFOB 2P5ZX 1TQOA 3DWAA 4A3GG 4KHPQ 3PUYA 2ICIA 4HCEA 3M3YH 5KGUA 1UUPA 3HKZG 4PMWA 5IP9H 3AFPA 2YTVA 2F0LA 4X3TA 4DR3Q 1KXLA 3FKIG 4IO9A 1IW7C 2M9VA 2NYZD 2F3IA 4LFCQ 1Y1WB 1ZYRC 2RSNA 2YU9H 1KNEA 1TT2A 1YJNA 3MXPA 1XJVA 1PH6A 1X6OA 4Y52H 5EPKA 1SE2A 1PH3A 1GVPA 2Q2HA 2FMCA 4GN4B 1ILQA 1F9SA 1HCZA 3IL8A 2XGTA 3TEHB 4KY6A 1YNJC 4K8JA 4JBMA 3D3RA 3LWEA 2H5XA 1X9NA 4ZAIA 4S3SA 3EJIA 3K80C 4DR4L 3MEHA 3A8KE 2I5HA 5BR8Q 4CDEC 4O42A 4IFDG 3CCJA 1PYBA 5L37A 2D5DA 5IYCG 4BY7H 1T9HA 5FO9B 1QJOA 3TS2A 4DV7L 2EJMA 1WTOA 2IPKD 3F2CA 4DV6Q 3S17H 3CCQA 3GTKH 2Z6KC 4WRDA 4GZYC 4A3LH 1NAPA 4OWWB 3E0JA 5IIFA 5K36G 3PF5A 2B63G 1BBXC 2K5NA 1WD1A 3P75A 2GN5A 4X3KA 2JA8G 5HGQA 1X32A 1MBYA 4IFDJ 1U4RA 3RR5A 2ZJQA 2M00A 2CQAA 3D8GA 3TQYA 1PRTD 1EQRA 3V96A 4DV2Q 1TWHH 1BBUA 1SMYD 3PO3G 2K28A 3X3MA 3HOZG 1XMOL 4K0KQ 1R9TB 1JORA 1CHPD 1K83H 4OWXB 2JA6G 3DWQA 3G6JB 4KJNA 4LFAQ 4U68A 3UI2A 2IT1A 3RUZA 1LTGD 3S1RB 1VQ5A 4C1NK 4J1MA 1WTPA 3MXNB 1B7YB 1H9SB 3HFZB 4JI2L 1IKLA 4IUNA 4FVMA 2K5WA 2F3WA 1KIXA 3A7LA 1DD2A 1BKBA 5GAEC 2K1BA 1VQMA 4DV1Q 1GHJA 1I50B 1UEAB 1O7YA 1VQAA 1WCMG 1CA5A 2LS01 4K2LA 1RODA 1B50A 3MEFA 1KD1C 4GLXA 4DNIA 3M85A 4P72A 1ESRA 2BCOA 4JI5Q 3MXUA 3BDOA 1XMQQ 4QQBX 4I7ZC 1EOVA 3PO2G 1LTRD 4X66L 1J5EQ 2DUDA 1W3SA 2X69A 4OEMB 2DJGC 2FMMA 1VQ4A 3CCSA 2M2LA 4F87A 4NMZA 4OIJA 4DR3L 4PQXA 3RLFA 3CCVA 4PZ6A 1STAA 4L5TA 3CF5A 2EY5A 1VQIA 4LFCL 4JW0A 3C1FA 4A3MG 2NZOA 3KLSX 1L0YB 5J22A 4A3CH 3ULJA 5FK9C 2RCNA 3S2HH 3KF8B 5EKKA 4ODGA 4FF2A 4XIGS 1SN8A 1M1KC 4DU9A 1SNPA 3GD7A 5DEHA 4POGA 1BCPF 4GOPC 2BH8A 1K3RA 1D5MC 2AWOA 2FHTA 3HKZE 1SROA 5T1GA 3OMCA 1I4HA 2RF4A 3OIQA 1MKHA 4KD3A 1H95A 1HNZQ 1E22A 3HZXA 1EWHA 1FYCA 1PYWD 1QZGA 2KVMA 4BBRG 1F9PA 2MP1A 5IP7H 1U9RA 2B2WC 4L5RC 1S5DD 5BR8L 4IN3A 1AP0A 3BS1A 2KJXA 2CH4A 5G3LF 3O13A 4MIUA 2Q2UA 2F52A 4IURA 2L4NA 2F0JA 3FDTA 4UPAA 2PZWA 3X3NA 1Q46A 4DV6L 2EYOA 3FMCA 1I4GA 3CC2A 1Z7TA 1EUJA 3GTQB 3CKIB 2K01A 2JJQA 1Q12A 3GTOH 5C5MA 5H1SE 1F77A 1BCPB 5EKIA 4A3DB 2XIWA 5EQ0A 2EYPA 2D0OA 2YTXA 2PZUA 3VYUA 1Y69U 2A73B 4Q0FA 5IE8A 3QJYA 1I6VC 3VDYA 5CR3A 2VNUD 4EGVA 3DMUA 4DV2L 3KFUA 1CQFA 1GM5A 4K0KL 3SHLA 1MJCA 1OTCA 3GTLH 4GOPB 3KYHC 5M5XB 1IBKQ 4LFAL 4DV0L 1BR9A 2IX1A 4A93B 2Z6BA 4K8IA 3PUZA 4A75A 1JR0D 3HOWG 4A3GH 1TWAH 1GUTA 4NB3A 2F0GA 3I4NB 1HFGA 3W1BA 1L2FA 5IYDG 1E3PA 3K5LA 1XXGA 5ISRA 2CQOA 2KUMA 4POFA 4NXMQ 3GO5A 4LUZA 4JI6Q 1VQ6A 5M5YH 5FLXc 2HT1A 2XRSD 1FL0A 4FYDA 4KY5A 2KENA 4OL7A 3RD4A 3EROA 1XMQL 4B3TQ 2B29A 1CSQA 1HUNA 1PHJA 1MD2D 3SE0A 2VUMG 3ULPA 1UE6A 1ICFB 3HG9A 4XYQA 1OXXK 2OTJA 1EQVA 2KEEA 1XWEA 2GA4B 3I56A 1J5EL 4IZ8A 2BA1A 4IJLA 1R4PB 3S1QH 2DJFC 2EY6A 2F0DA 4OHJA 5ELFA 4IFDH 1K0SA 5C4JB 3NBHB 1ZXTA 5IYCH 3I4MH 2A68C 3K6OA 5IP9G 1GUNA 2WAQG 1KDCA 3BVZA 2HUGA 4MNOA 3K7UC 5IT9L 5JOBA 2HQEA 4DUZQ 3FHWA 4N9TA 3AFQA 2BA0A 3FVQA 2ZJRA 4A3IH 4B3MQ 2JXMB 1S5CD 4WFN3 3F8TA 5K36H 2B63H 3SK8A 1MGSA 4UDUC 5DM63 1FGUA 1G2SA 3I73A 4DAPA 3Q6SA 5G3LD 4CJ1B 1N36Q 3OW2A 3ND8A 4QJFA 1PV4A 4GNXC 4HN7A 2D2CC 2MJ8A 3NE5B 4LF8Q 3HOXB 1HNZL 4BA1I 5A2QL 4ZRZA 1NJIC 2VQEQ 4C3HB 3I2ZA 3KJOA 2UUCQ 1IYVA 1I3QH 4DAVA 4OX9Q 3RZOB 4DK3C 4DPGA 4QCLA 1Q7YC 3HOYB 2B3GA 4PMBA 2QILA 4BY7G 1SYCA 3U4ZA 1PTOF 3PIOA 1HNWQ 3GTJH 3CP0A 1VQDA 3ER0A 2NTSA 1D8LA 1VQBA 3CCLA 2B2YC 1DYQA 1VQLA 2B2VA 2B39A 4NP5A 3IFTA 3CMEA 4PNYA 4A3LG 3H3VC 1Z9FA 2HDLA 1QUQA 2BE5D 2K04A 2K75A 4G7HC 2E2DC 3T1YQ 1HJPA 1IXRA 2J0TD 2MHVA 4OO1I 1G91A 3STBD 2NVTB 1DOMA 1SNCA 2HCIA 3R8BA 3GTPH 2K4KA 3L2PA 5I2XA 4B3RQ 2QKIC 1G291 1M8AA 3EFXD 3G7LA 5IGBA 1SNOA 2E2HH 3PSIA 4A4IA 1E2VA 4JI7Q 4LJZC 3TBIB 4HSPA 2HD3A 1SE4A 2J4XA 1UE7A 3TZDA 1DXMA 1KHIA 2EYHA 1EOTA 1WJJA 1BUVT 1QVGA 1IBKL 1X65A 2PNRC 4GKKQ 3DUZA 2EY2A 2RCFA 3FKIB 4BY1B 1PYSB 1HZBA 3HEJA 4FF3A 1GUGA 1TWFB 2KEDA 3CHBD 2ZXPA 3URYA 2IX3A 1VQPA 5A35A 2UUAL 3S16B 4KMUC 3C2PA 5FLXL 3E5SA 3GQBA 5E3FA 4MTKA 1N8RC 4NXML 2JSOA 2JA7H 3S2DB 5ELEA 4DR2Q 4A3MH 4HIKA 1OXVA 4JI6L 1XPUA 4A3EB 5IYBH 2ZXOA 1VQ7A 1N34Q 1JB7A 1G6ZA 5J3BA 2F0OA 2WP8J 4B3TL 3S15B 4JOIA 4MN3A 2EYLA 4OELB 3ZYYX 2OT2A 1JT8A 4DR5Q 3H94A 1TS4A 2A69C 3DHQA 4CJ0B 3TRZA 3MC0B 4BBSB 2AUJD 4PV1C 4CHTB 2Z8LA 1Y1WH 1A3UA 2HQLA 3NTHA 3VA7A 2BH2A 3PUXA 1IL8A 2L55A 5HURA 1CHQD 1EY7A 4DUZL 4A3CG 2JA8B 1XNRQ 3PMFA 2E2IH 4B3ML 2NTTA 3HGBA 1BDOA 2A6EC 4BA2I 2L12A 4YWKA 5C3EH 1S40A 4RG1A 2EVBA 1I5FA 1SYBA 3BDLA 1PTOD 2N8NA 2RHQB 4WJ3M 3ZJYC 3OMGA 4KI0A 2WAQE 1N36L 1BQQT 4QIWE 3K57A 3FPUB 1KQSA 5EKLA 4LF8L 3HOZB 1TS5A 1ET6A 1LT4D 2WB1G 4YCUA 4L8JA 3ULLA 1O80A 3D4DA 2VQEL 2JA6B 2PI2A 2UUCL 4OX9L 4BXXG 3QG1A 4WJWA 3M4YA 5ELDA 2KBNA 4K6LA 2K52A 1RL2A 2EZVA 3M4OB 3KDFB 1KNAA 3CPFA 4OO1H 3GV3A 2NN6I 2FJ2A 4H7BA 1HRJA 1PRTC 3M4PA 3S9WA 2JA5G 4LNQA 1QOHA 1QCBD 2ID0A 1WCMB 5TSSA 4APVA 3HOWH 1SMYC 3A5ZB 2QEXA 2B8FA 3I72A 4HIMA 3KOJA 3T1YL 4R1JA 4JI8Q 1TVXA 3G48A 4UP7A 4EVOA 3BU2A 3CC4A 2LXKA 2CWPA 4CKBA 3KK7A 3P1HA 4GLAC 3VR2A 4YWMA 5IGCA 2EYJA 5I2YA 3PO2B 3DLLA 1BXTA 4F7XA 4ALPA 2QEJC 1YNND 3K7AB 1X3QA 2B2UC 4JI7L 3MFGA 2WKCA 3R2IA 2G9DA 4JBJA 1PVOA 5M3FB 3S1RH 3OW7A 3I70A 4JYAQ 1AEXA 4EQPA 1X54A 3HKSA 4K14A 4GKKL 4ZKCB 5C4HA 1MIUA 1Y1VH 5C44H 4P2CB 3W5OA 4HSVA 4TQUS 1X56A 1B2TA 2EE1A 4HJ5A 4DV4Q 1XTCD 2PZTA 2JP1A 1DONA 1PFSA 1T5XD 1K9MC 1HTPA 2D9UA 2KCNA 1STEA 3M7GA 1NR4A 4DK0A 3V05A 1SBBB 3PUWA 3MHBA 3U4VA 1PFNA 3NBHA 5CV6A 1Q8KA 4DXFA 1EEID 2HIVA 5FO7B 1N34L 1FNVA 1Q8IA 2PQEA 4K5WA 4TKOB 3RN5A 2A1AA 3NWTA 1WTWA 5KIXA 3D4RA 4BBRB 4LFBQ 4HAEA 2DY8A 4RKBA 2E2JH 1PZJD 1LYLA 1EZ6A 4DR5L 4GLVB 3GTMH 4A3BH 1I6HH 5IGFA 1Q1BA 4LF5Q 2PO4A 5C3WA 2NZ1D 4PZ8A 3W2DA 3NELA 2WIIB 5GADC 1CM9A 2KOLA 2XRQD 3I4MG 3BYTB 3RMHA 3L9AX 3DEPA 1YHBA 1IHZA 3NTKA 1SYFA 5DNFA 3BG3A 4ABNA 5E1FA 4KKSA 3BZDB 1VQ9A 1E2ZA 3IRBA 2B2TC 5KYIA 2PPBC 1XNRL 1O7ZA 4A3IG 4H13C 1VQJA 1KLGD 3FPPA 2E5LQ 3ONAB 1ILPA 4JBKA 2EYFA 2R3ZA 1L1OC 5DLQE 5FLMH 4ULLA 1VF5C 3S1NH 1LUZA 1CT1D 4JI4Q 2OWOA 1KRSA 3OWFA 5IWAQ 2AQ2B 4QB4A 1MI2A 4RMFA 3NUCA 2FXQA 5LL6S 2EJGC 3S1MH 1K73C 1YNXA 3I8ZA 1K28A 4JC0A 3WDNA 4U673 3I4OA 3Q0AA 3CQZH 2XVSA 1LTAD 1G8ZD 4LWCA 4RH6A 1JE4A 2F4IA 3FEWX 1TKWB 2K05A 3GTGB 2WB1E 2N3SA 1V1PB 2NWGA 2PQAB 4QUFA 4C2MH 5BN5A 4JI8L 3HOUH 5CC4A 1FGBD 5M5WB 1LLRD 3QOJA 4I7AA 2CVRA 2Q2IA 3G71A 1PH2A 3QIAA 1PH8A 2VUMB 1SNMA 1B1ZA 3S14H 1QVCA 4UAIA 1PMRA 1C9OA 4EX5A 1NMFA 5M5XH 4V190 2UXBQ 1VQ8A 4RWSC 4A93H 3E9IA 4JYAL 3H0GB 1B8AA 3E6ZX 1ASYA 1B4OA 1SLJA 2R7ZH 1L1OB 3TS0A 5JEAH 3M3YB 2JK8A 1VQHA 2MPMA 2WAQB 4HMJA 3AEVA 1CFMA 1ONLA 4QIWB 1STHA 2WINB 2GVBA 1JWSD 1CZWA 1UAPA 4DV4L 3G4SA 4KHPL 1EFID 1EFWA 1X3PA 2YU9B 1A8VA 3DWPA 2D0PA 1EYGA 1GHKA 1TS2A 3A0JA 2JA7G 2KA7A 1IW7D 1D6EC 1X3GA 3NHHA 1JJGA 2MGSA 1ZYRD 1BBWA 5KNBA 4X62Q 5IYBG 1WTHA 3SVMA 1DZ1A 4KKUA 1H9KA 5IT9c 1EY5A 4YHHQ 2XSCA 3H09A 2QF7A 4LFBL 1D5XC 3H3VI 1II3A 2WACA 3SK6A 2LY7A 3E0EA 3UE1A 2Z0SA 4R4CA 2F0SA 3OWEB 2YTYA 4BY7B 4P75A 3QB3A 1YNJD 5C4JH 4LF9Q 3H6MA 1XTDA 4LF5L 4G57A 4B3SQ 2E76C 1N32Q 4BXXH 2Y0SG 4K5XA 1MSGA 3GTKB 2Q8TA 1Y1WG 3HP3A 2N88A 4ZKBB 2SDFA 3TSSA 2AUKA 3HS0C 1IL2A 2QCPX 1AZPA 3J7A5 2JA5H 4J15A 5FKAC 1EZ8A 4ZUJA 3R3OA 5KNCA 1NSNS 2ES2A 2F0FA 3A54A 5C3EG 2E5LL 4B9WA 2OQ0A 4JV5Q 1E0BA 1NTGA 1A63A 5GAGC 3AYHB 4GS3A 3RZOH 4TSSA 4XYOA 4JI4L 1K83B 5IWAL 1GUWA 4GN5A 1AW7A 2PMZE 1KRTA 3STBC 2MO1A 3NBIA 1XPOA 1SSOA 5C4XH 1MJEA 3I4LA 1H9JA 4OO1G 2UU9Q 3SK4A 3NQTA 2ENBA 1CKNB 1SJHD 4N8X1 3NENA 3J7AF 4X6AH 5FO8B 3CCUA 1IKMA 2IHFA 5C3XA 4A3KB 1HHVA 1QILA 1ICWA 3GV6A 3J7YW 1YITA 2F3VA 2WKDA 2O5JC 3PV0A 5D65A 2NVTH 1X3EA 3L7ZC 1JJCB 1ML0D 1NCVA 5DM73 1LTTD 3KLRA 2K6AA 3D6WA 3QO2A 1WFQA 4DV1L 2JN4A 4R4IA 5CV5A 1YZ6A 1HR0Q 1JWUD 5CV9A 3H15A 1YJ9A 1Q1EA 1NBWA 1V43A 1PTOH 1PZKD 4JI5L 1KL9A 1VS0A 2PW5A 2UXBL 2RHSB 5J1ZA 2Q8RE 4DAMA 1YBYA 2R7FA 2F0UA 4RAUC 4BY1H 1D1IA 1NR2A 2F1MA 1N9WA 2TMPA 5I4DA 1TXYA 4YCWA 1Y1VG 4KJOA 3W1GA 5C44G 3S16H 1DJRD 3LNNA 1QWYA 3PIP3 3FRPB 4G4KA 5IT9E 1KLUD 3PF4A 5I6WA 1BCPD 3QWNA 3KF6B 5CBAE 1C4QA 2L15A 3UDFA 1SEBD 1U4MA 5FJ8G 3C1EA 2OTLA 3EA6A 4B9XA 4X62L 2NVXH 1JCKB 4FF1A 3OSOA 4KN7C 1K8OA 3Q22A 4YHHL 4K5VA 1KAAA 2NVYB 4QGUA 5A2QE 3DXJC 2I0QA 1LACA 2A19A 4P73A 4CKCA 3MA2B 2VZAA 2Z1CA 1Y8NB 3HOVB 4A3FH 2F0TA 4A3BG
chains in the Genus database with same CATH topology
3SK5A 1I4QA 5D3IB 5COYA 1DOLA 2A6HC 3NP8A 3NSWA 3W3AA 1OXTA 2R6GA 1STNA 3GTOB 3NXWA 3OHXC 5EBDA 4DK1A 4K2KA 5BN3A 3OIPA 1W6JA 3I3CA 3JAML 2K32A 2TSSA 2K03A 1HA6A 2C9OA 1HQMC 5ELCA 2SNSA 3MXNA 5I9PA 1ZKOA 1H9SA 3DM1A 2C5CA 4HMIA 1EL0A 2NN6G 3GTLB 1F9QA 4M1UB 1RCVD 1EU4A 1S5BD 1STGA 3T13A 3D6CA 1A6XA 4HR7B 5E4WC 4A3GB 4Z9CB 5JJZA 1JB3A 4KY7A 1HPCA 3HKZB 4RA8A 2O5IC 1B3AA 1H9MA 5FLXE 4K6DA 4LMQD 2OF1A 1AZQA 2N55A 1V8QA 5M5YB 5M9OA 2RBMA 4IALA 1RTNA 1I4PA 3F2UA 2EJFC 1OO9B 1F2LA 1WTRA 3IKJA 2KHSA 3TZUA 2VB2X 4FF4A 3T51B 1EU3A 2SEBD 1ESFA 3NK9A 4EQOA 3EVQA 4NW2A 4YIJA 3NWSA 3S1QB 3T53B 5BN4A 3MZ5A 4R8NA 3KF8A 5JEAG 4NDXA 3I4MB 4WORA 2F03A 1M4VA 2OXPA 2F0KA 5IGGA 3J81L 5FOBB 4J8QA 1AN8A 2EYMA 2PMZB 4M8AA 1A2UA 3VYRA 3WOFA 4A3IB 2A5HA 2B63B 1A3TA 3K5MA 3CRLC 2BDOA 2RA4A 5CMDA 3A7AB 1SDFA 4ZLTF 2QDBA 1LT6D 1W6KA 5CV7A 3SEBA 2L5TA 5JEAJ 5JVG3 2KECA 2NUCA 1I3QB 4JBWA 4KKTA 1SYDA 1VMPA 1JQYD 3PO3B 3Q24A 2K5DA 2RQXA 3R93A 1XX8A 1J8IA 3A8JE 3GTJB 4G7ZC 3MFYA 4HTHA 3K5NA 1RD9D 1QE6A 4XQJA 2KQ3A 1ET9A 3U9OA 3EQLC 4EQNA 4DA2A 2VB3X 3R2TA 4RHSA 1WTXA 1F2MA 1DOKA 1RF2D 1GUSA 2B2WA 1PRTF 2YYZA 2X6LA 3SXHA 1Y8OB 1I4RA 4CGYB 3D4WA 5C6AA 1ENFA 5HGTA 5KEEA 3T16A 1WTVA 4RKLA 2F0HA 1HQRD 2L11A 2R61A 2JEAI 3J80L 4HEDA 4KN4C 1S5ED 3C3LA 4R9WA 4A3MB 4JK1C 2F0EA 2JYOA 5NUCA 1B44D 1K8MA 2ICEC 2RKSA 2L1BA 3VYSA 1J9OA 1EY6A 4IUTA 1R4QB 1D5ZC 1PRTB 1TWGB 1SE3A 1EY9A 5LHY1 1A15A 2IL8A 2Y0SB 5KYLA 1Z47A 3K5OA 1FR3A 5F2DA 4O1NA 2IWHA 2A69D 2AQ1B 2FFKB 5J39A 5EPJA 5ELBA 2B2VC 2RVLA 3ND9A 4C1NI 2E2IB 1ENCA 5K5PA 2K7VA 3VA5A 3CRKC 5CV8A 4ME5A 1B9NA 5C0XJ 5C3EB 1STYA 1Z6HA 4QF4A 3CU7A 1Y8PB 4C56C 4FXDA 1TS3A 2A6ED 2V4DA 3VYTA 3NPPA 3MWYW 3TP6A 1D1KA 5T1IA 1LO5D 4E6IA 2NN6H 3MXGA 2EY1A 4ZQ3A 4IUPA 4N9PA 3VR4A 4IUQA 3QOLA 3HOWB 2H1EA 1PDQA 5AFWA 1ENAA 3MAQA 2HDMA 1LV9A 4DGZA 3Q23A 1EQTA 4F8MA 5JPMC 1RTOA 1LT3D 1RHPA 2O4XA 3KBGA 5EGTA 5LL6X 1QNUA 1EY8A 1RJTA 1UNSA 2VXWA 1H9RA 3NQIA 3NTIA 3M7NA 3P7JA 1VCIA 3K58A 2PYKA 4H44C 2I46A 1Y1VB 1PLFA 5C44B 3N6RA 1WTQA 2LMCB 1GXDC 1STBA 2B2YA 1RKNA 3BDCA 2CW0D 4J6HA 5C0XI 4C3IG 4BS9A 1EEFD 4RGNA 3KUPA 1EYAA 2ZXRA 3VR3A 2MUYA 1D2BA 2E2JB 4L63B 4A3BB 3GTMB 1I6HB 2L0CA 1BCPC 5CGKA 4RHRA 2RDGA 1EY4A 4C3JG 2AQ3B 5IOCA 2E74C 1CQVA 2RSOA 5I6YA 1EYCA 3K59A 2X6GA 1OXUA 3KLSA 2BDNA 4LK1C 4IFDI 1HXYD 3GP7A 3S17B 1JC7A 1PZID 4KV6A 1Q3LA 1FNUA 2B8GA 4ID6A 1QB5D 1S5FD 4H0LC 3A55A 4DNTB 4DAYA 4XQQA 1EYDA 1LTID 4BWGB 3S1NB 1SNDA 3IAYA 5IGEA 4R8IA 1OXSC 4XQNA 1KABA 2JEBI 1S4ZA 4AYBB 1TWHB 3HRZC 3J7AV 3S1MB 4CKEA 2BOSA 1DM0B 2EDGA 3CQZB 5CYUA 2BE5C 3I90A 3VR6A 1ZEQX 3I91A 4DN4M 4FXGC 4C2MB 1L0XB 4QMGA 4NKLA 3HOUB 5D3DA 4XT3B 4L6TB 3TN2A 1TR5A 2G9HD 2I07B 3A8IE 5EBCA 2SOBA 2JE6I 3ITPA 5E4XA 3S14B 3V2TA 1NUCA 4FXKC 4HCSA 2L9HA 2J7ZA 5IGDA 2R7ZB 1PFMA 4IQZA 5C0XH 3BYYB 4IUVA 2IW3A 3IFDA 3AU7A 1F2YA 1SYGA 5JPNC 2DNEA 3VR5A 3OPOA 1EIGA 4KK7A 4RFBA 3S2HB 4RGMA 1TU2B 1CTMA 4RCNA 2B2UA 4PMCA 2K33A 2SNMA 5DAUA 2WB1B 3PUVA 4ILWA 3MTSA 1LTBD 3ERQA 1KDBA 1FD7D 3SDZA 4FO2A 1FNWA 1SJED 2NB0A 1JOKA 2K5QA 1QNKA 1JOQA 2AWNA 1HUMA 4XXEA 2Z4IA 1MSHA 2CHBD 2F0QA 4V0BA 2JA5B 5JVH3 5C5LA 1PTOC 3T56B 1Q90A 1CA6A 1TIID 1HFNA 2H4OA 2Z4HA 3D31A 3JAME 3TP5A 3U9SA 2WV6D 1GOZA 1B53A 1A3VA 4X3SA 4KHVA 1HA5A 1PFBA 2PCFB 2F0VA 1RDPD 3TP8A 3AB9A 1V1PA 5C4XB 1SYEA 2RDHA 1V1OA 5KNDA 2NBFA 1IYUA 4KHZA 5IODA 4B08A 1WVLA 1TWAB 2B2TA 2FINB 1YNNC 1BO0A 2LKVA 2F0IA 3A56A 5CBEE 2XNAC 4QUCA 1QG7A 1KTKA 2F0MA 1C48A 1CZGA 1PTOB 1AFPA 3AMUA 5KRUA 1EWCA 1O78A 4RGOS 1G2TA 5C4ZA 2HCCA 4MHEA 2XN9C 3TMEA 4G7OC 3TDQA 1VDZA 3J81E 2D62A 1GJXA 1BNZA 3BVGA 4ZK9B 2LFNA 4OIKA 1SAPA 1TY2A 1XYIA 2DN8A 4LAAA 4DFAA 4RGTA 2E75C 1O7LA 2A74C 5D14A 1DCZA 2A68D 2NVXB 1VF7A 5CV4A 1SXTA 3T4AC 1TY0A 1CI3M 5I9OA 1E2WA 4A3FB 1C8CA 2F0NA 3N52A 2R92B 5CORA 3K0YA 1CK1A 5EPLA 1BF4A 4KTAA 1JICA 4FP5D 1SNQA 1LTSD 2OEOA 2DY7A 3KBXA 1U4LA 1F9RA 2A6HD 2PW7A 3RZDB 4CJ2C 1LT5D 5JAVA 3WOEA 5EJWA 3C46A 2KCCA 1VMCA 3GTPB 2R93B 1BOSA 4KD4A 4OGQC 4F88A 1WD0A 2EPBA 3BVMA 2IX0A 2NVQB 3LX0A 2O2LD 2E2HB 2F0WA 1T5EA 4C3HG 2RDFA 1U4PA 1B9MA 4Q5VA 4TRDA 2EXZA 3PIO3 3L3OC 4Y7NB 3DEOA 4DNRB 1A2TA 2F0PA 4XDXA 3J80E 4RCOA 4C3IB 2ZT9C 3MVVA 4A3JB 1JWMD 4I65A 3H91A 4DXGA 3P20A 2XWBB 4XTCS 2IJ0A 4CBVA 4DF7A 1LABA 4FNFA 3OOCA 2JA7B 5M3MB 1F2ZA 1EIHA 2XWJB 3TP7A 4XT1B 4IUUA 2EOTA 4X3UA 1JOOA 1HTLD 1I4XA 1TWCB 4ZUIA 1EY0A 1KDAA 2CW0C 3LWUA 4C3JB 4ZYSA 2DNCA 2Q8IB 1GUOA 3SR1A 1PXUA 5C0XG 1SFOB 1TQOA 3DWAA 3PUYA 2ICIA 4HCEA 5KGUA 1UUPA 4PMWA 4X3TA 2F0LA 1IW7C 2M9VA 2NYZD 1Y1WB 1ZYRC 2RSNA 1KNEA 1TT2A 3MXPA 5EPKA 1SE2A 2FMCA 1ILQA 1F9SA 1HCZA 3IL8A 4KY6A 1YNJC 4K8JA 3D3RA 3LWEA 4ZAIA 4S3SA 3EJIA 3MEHA 3A8KE 4O42A 4IFDG 2D5DA 5FO9B 1QJOA 2EJMA 1WTOA 2IPKD 4GZYC 4WRDA 1NAPA 3E0JA 5IIFA 5K36G 1BBXC 1WD1A 3P75A 4X3KA 1X32A 1MBYA 4IFDJ 1U4RA 2M00A 2CQAA 3D8GA 1PRTD 3V96A 1SMYD 2K28A 3X3MA 1JORA 1R9TB 1CHPD 3DWQA 3G6JB 4KJNA 4U68A 3UI2A 2IT1A 3RUZA 1LTGD 3S1RB 4C1NK 4J1MA 1WTPA 1H9SB 1IKLA 4IUNA 4FVMA 2K5WA 2F3WA 3A7LA 1DD2A 2K1BA 1GHJA 1I50B 1UEAB 1O7YA 1CA5A 2LS01 4K2LA 1RODA 1B50A 3M85A 1ESRA 2BCOA 3MXUA 3BDOA 4I7ZC 1LTRD 2X69A 2FMMA 2M2LA 4F87A 4NMZA 4OIJA 4PQXA 3RLFA 1STAA 2EY5A 3C1FA 3KLSX 1L0YB 5J22A 5FK9C 5EKKA 4ODGA 4FF2A 4XIGS 4DU9A 1SNPA 3GD7A 5DEHA 1BCPF 1D5MC 2AWOA 2FHTA 5T1GA 3OMCA 1I4HA 3OIQA 4KD3A 3HZXA 1EWHA 1FYCA 1PYWD 2KVMA 1F9PA 2MP1A 1U9RA 2B2WC 1AP0A 1S5DD 4IN3A 3BS1A 2KJXA 5G3LF 3O13A 4MIUA 4IURA 2L4NA 2F0JA 3FDTA 2PZWA 3X3NA 2EYOA 3FMCA 1I4GA 1Z7TA 3GTQB 3CKIB 2K01A 1Q12A 5C5MA 1F77A 1BCPB 5EKIA 4A3DB 2XIWA 5EQ0A 2EYPA 2PZUA 3VYUA 1Y69U 2A73B 4Q0FA 3QJYA 1I6VC 2VNUD 5CR3A 4EGVA 3DMUA 1CQFA 3SHLA 5M5XB 1BR9A 2IX1A 4A93B 4K8IA 3PUZA 1JR0D 1GUTA 2F0GA 3I4NB 1HFGA 3K5LA 1XXGA 5ISRA 2KUMA 3GO5A 2XRSD 4FYDA 4KY5A 4OL7A 3RD4A 3EROA 1HUNA 1MD2D 3SE0A 3HG9A 4XYQA 1OXXK 1EQVA 2KEEA 1XWEA 2GA4B 4IZ8A 2BA1A 1R4PB 2EY6A 5ELFA 2F0DA 4OHJA 4IFDH 5C4JB 1ZXTA 2A68C 3K6OA 1GUNA 1KDCA 3BVZA 2HUGA 5IT9L 5JOBA 2HQEA 4N9TA 2BA0A 3FVQA 2JXMB 1S5CD 4WFN3 5K36H 3SK8A 1MGSA 4UDUC 5DM63 3I73A 1G2SA 4DAPA 3Q6SA 5G3LD 4CJ1B 3ND8A 4HN7A 2D2CC 2MJ8A 3NE5B 3HOXB 4BA1I 5A2QL 4ZRZA 4C3HB 1IYVA 4DAVA 3RZOB 4QCLA 3HOYB 4PMBA 2QILA 1SYCA 1PTOF 2NTSA 2B2YC 1DYQA 2B2VA 2B39A 4NP5A 3IFTA 4PNYA 3H3VC 2HDLA 2BE5D 2K04A 4G7HC 2E2DC 2J0TD 4OO1I 2MHVA 1G91A 2NVTB 1DOMA 1SNCA 2HCIA 3R8BA 5I2XA 2QKIC 1G291 1M8AA 3EFXD 3G7LA 5IGBA 1SNOA 1E2VA 4LJZC 3TBIB 4HSPA 2J4XA 1SE4A 3TZDA 1DXMA 2EYHA 1EOTA 1BUVT 2PNRC 3DUZA 2EY2A 3FKIB 4BY1B 3HEJA 4FF3A 1GUGA 1TWFB 2KEDA 3CHBD 2ZXPA 3URYA 2IX3A 5A35A 3S16B 4KMUC 3C2PA 5FLXL 3E5SA 3GQBA 5E3FA 2JSOA 3S2DB 5ELEA 1OXVA 4A3EB 2ZXOA 1G6ZA 2F0OA 2WP8J 3S15B 4MN3A 2EYLA 3ZYYX 2OT2A 3H94A 1TS4A 2A69C 3DHQA 4CJ0B 3MC0B 4BBSB 2AUJD 4PV1C 4CHTB 2Z8LA 1A3UA 3NTHA 3VA7A 3PUXA 1IL8A 2L55A 5HURA 1CHQD 1EY7A 2JA8B 3PMFA 2NTTA 3HGBA 1BDOA 2A6EC 4BA2I 2L12A 2EVBA 1SYBA 3BDLA 1PTOD 3OMGA 4KI0A 1BQQT 3K57A 3FPUB 5EKLA 3HOZB 1TS5A 1ET6A 1LT4D 4L8JA 1O80A 3D4DA 2JA6B 3QG1A 4WJWA 3M4YA 5ELDA 4K6LA 2EZVA 3M4OB 1KNAA 4OO1H 3GV3A 2NN6I 2FJ2A 4H7BA 1HRJA 1PRTC 3S9WA 1QOHA 1QCBD 2ID0A 1WCMB 5TSSA 1SMYC 2B8FA 3I72A 1TVXA 4EVOA 4CKBA 3KK7A 3P1HA 3VR2A 5IGCA 2EYJA 5I2YA 3PO2B 1BXTA 4F7XA 2QEJC 1YNND 3K7AB 1X3QA 2B2UC 3MFGA 2WKCA 3R2IA 2G9DA 5M3FB 3OW7A 3I70A 1AEXA 4EQPA 4K14A 4ZKCB 5C4HA 4P2CB 4HSVA 4TQUS 1B2TA 2EE1A 1XTCD 2PZTA 2JP1A 1DONA 1T5XD 1HTPA 2D9UA 2KCNA 1STEA 3M7GA 1NR4A 4DK0A 3V05A 1SBBB 3PUWA 3MHBA 1PFNA 3NBHA 5CV6A 4DXFA 1EEID 5FO7B 1FNVA 1Q8IA 2PQEA 4K5WA 4TKOB 3NWTA 1WTWA 5KIXA 3D4RA 4BBRB 4HAEA 2DY8A 4RKBA 1PZJD 1EZ6A 5IGFA 1Q1BA 2PO4A 5C3WA 2NZ1D 3W2DA 2WIIB 1CM9A 2KOLA 2XRQD 3BYTB 3RMHA 3L9AX 3DEPA 1IHZA 3NTKA 1SYFA 5DNFA 3BG3A 4ABNA 5E1FA 4KKSA 3BZDB 1E2ZA 2B2TC 5KYIA 2PPBC 1O7ZA 4H13C 1KLGD 3FPPA 3ONAB 1ILPA 2EYFA 2R3ZA 4ULLA 1VF5C 1CT1D 3OWFA 2AQ2B 4QB4A 1MI2A 3NUCA 5LL6S 2EJGC 3I8ZA 3WDNA 4U673 3Q0AA 2XVSA 1LTAD 1G8ZD 4RH6A 1JE4A 2F4IA 3FEWX 1TKWB 2K05A 3GTGB 1V1PB 2NWGA 4QUFA 5BN5A 5CC4A 1FGBD 5M5WB 1LLRD 3QOJA 2CVRA 2VUMB 3QIAA 1SNMA 1B1ZA 4UAIA 1PMRA 4V190 4RWSC 3H0GB 3E6ZX 1B4OA 5JEAH 3M3YB 2MPMA 2WAQB 4HMJA 1CFMA 1ONLA 4QIWB 1STHA 2WINB 1JWSD 1CZWA 1UAPA 1EFID 1X3PA 2YU9B 3DWPA 1GHKA 1TS2A 2KA7A 1IW7D 1D6EC 3NHHA 2MGSA 1ZYRD 5KNBA 3SVMA 1DZ1A 4KKUA 1H9KA 1EY5A 2XSCA 3H09A 2QF7A 1D5XC 1II3A 2WACA 3SK6A 2LY7A 2F0SA 3OWEB 4BY7B 3QB3A 1YNJD 3H6MA 4G57A 2E76C 4K5XA 1MSGA 3GTKB 2Q8TA 3HP3A 2N88A 4ZKBB 2SDFA 3TSSA 2AUKA 3HS0C 2QCPX 1AZPA 5FKAC 1EZ8A 4ZUJA 3R3OA 5KNCA 1NSNS 2F0FA 3A54A 4B9WA 1E0BA 4TSSA 4XYOA 1K83B 1GUWA 1AW7A 3NBIA 1SSOA 3I4LA 1H9JA 4OO1G 3SK4A 3NQTA 2ENBA 1SJHD 3J7AF 5FO8B 1IKMA 5C3XA 4A3KB 1HHVA 1QILA 1ICWA 3GV6A 3J7YW 2F3VA 2WKDA 2O5JC 3PV0A 5D65A 3L7ZC 1ML0D 1NCVA 5DM73 1LTTD 3KLRA 2K6AA 3D6WA 3QO2A 5CV5A 1JWUD 5CV9A 1Q1EA 1V43A 1PTOH 1PZKD 2PW5A 5J1ZA 2Q8RE 2F0UA 4RAUC 1D1IA 1NR2A 2F1MA 2TMPA 5I4DA 4KJOA 1DJRD 3LNNA 1QWYA 3PIP3 3FRPB 4G4KA 5IT9E 1KLUD 5I6WA 1BCPD 3QWNA 5CBAE 1C4QA 1SEBD 1U4MA 3C1EA 3EA6A 4B9XA 1JCKB 4FF1A 3OSOA 4KN7C 1K8OA 3Q22A 4K5VA 1KAAA 2NVYB 5A2QE 3DXJC 1LACA 4CKCA 3MA2B 2Z1CA 1Y8NB 3HOVB 2F0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 0;  3J7Y W; 
#chains in the Genus database with same CATH topology
 5JJL A;  2R92 H;  4LF9 L;  5ELN A;  3SK5 A;  1I4Q A;  2AHO B;  1A62 A;  4B3S L;  5D3I B;  1N32 L;  5COY A;  1DOL A;  3F2B A;  2I5M X;  3PCO B;  2A6H C;  3NP8 A;  3NSW A;  3W3A A;  1OXT A;  2R6G A;  1STN A;  3GTO B;  3NXW A;  4AIM A;  3OHX C;  5EBD A;  4DK1 A;  4K2K A;  5BN3 A;  4DV3 Q;  3OIP A;  1W6J A;  1FJG Q;  3RZD H;  3I3C A;  2GVA A;  1IBL Q;  1JMC A;  2Y0S E;  3BZC A;  2K32 A;  3JAM L;  3SGI A;  2VQF Q;  2TSS A;  2K03 A;  1HA6 A;  2C9O A;  1HQM C;  5ELC A;  1C7Y A;  4JV5 L;  2R93 H;  2SNS A;  3MXN A;  5I9P A;  5FLM G;  1ZKO A;  1H9S A;  3DM1 A;  2C5C A;  3GDE A;  4P74 A;  2CH4 W;  5IY0 A;  4LF4 Q;  4HMI A;  1EL0 A;  5AJ3 Q;  2NN6 G;  3GTL B;  1E7Z A;  1F9Q A;  2NVQ H;  4M1U B;  1RCV D;  2I5L X;  1EU4 A;  4AYB G;  1S5B D;  4HJ7 A;  1STG A;  3T13 A;  2R7D A;  3D6C A;  1A6X A;  4HR7 B;  5E4W C;  2UU9 L;  4AQY Q;  4A3G B;  4Z9C B;  5JJZ A;  4Y7N H;  1JB3 A;  4KY7 A;  1HPC A;  2Z6K A;  3HKZ B;  4RA8 A;  4GNX B;  2O5I C;  1B3A A;  1H9M A;  4C3I H;  5FLX E;  4A3J H;  4K6D A;  4LMQ D;  2OF1 A;  1AZQ A;  2N55 A;  4A3D G;  1X3F A;  1V8Q A;  5M5Y B;  2F4V Q;  4IOA A;  5M9O A;  3HOU G;  2RBM A;  4R4Q A;  2G5D A;  4IAL A;  1GD7 A;  1RTN A;  1QVF A;  5M3M H;  2A8V A;  1I4P A;  3F2U A;  2LXJ A;  1SMX A;  2NZH A;  2EJF C;  1OO9 B;  3J7Z C;  1U5K A;  1F2L A;  1WTR A;  1HR0 L;  3IKJ A;  5M3F H;  2KHS A;  3TZU A;  1KC8 C;  2VB2 X;  4FF4 A;  3T51 B;  3G6E A;  1EU3 A;  2SEB D;  2EXD A;  1ESF A;  1TWC H;  3NK9 A;  3EVQ A;  4NW2 A;  4EQO A;  3CCE A;  4YIJ A;  3NWS A;  3S1Q B;  4A93 G;  4C3J H;  4DUY Q;  3T53 B;  5BN4 A;  3MZ5 A;  1YHQ A;  4JI0 Q;  4R8N A;  2R7Z G;  3KF8 A;  5JEA G;  4NDX A;  3I4M B;  1VQG A;  1SFO H;  4WOR A;  2F03 A;  1M4V A;  2IHE A;  2OXP A;  2F0K A;  1U0L A;  4CDC C;  2MFI A;  5IGG A;  3J81 L;  5EAY A;  5FOB B;  4J8Q A;  1AN8 A;  4UHV A;  3I55 A;  2EYM A;  2PMZ B;  4M8A A;  1A2U A;  3VYR A;  3WOF A;  4A3I B;  2A5H A;  2B63 B;  1A3T A;  3K5M A;  3CRL C;  2BDO A;  2RA4 A;  5CMD A;  3A7A B;  1UEB A;  1SDF A;  4ZLT F;  2QDB A;  1LT6 D;  1W6K A;  3CCM A;  5CV7 A;  1WOC A;  3RLO A;  3SEB A;  2L5T A;  3D0F A;  1XPR A;  2K5V A;  5JEA J;  1P16 A;  2KEC A;  5JVG 3;  2NUC A;  1I3Q B;  4JBW A;  4KKT A;  1SYD A;  1VMP A;  1JQY D;  3PO3 B;  3Q24 A;  2K5D A;  2WFW A;  2RQX A;  3R93 A;  3OYY A;  4DV5 Q;  1XX8 A;  1J8I A;  3A8J E;  3GTJ B;  4G7Z C;  4QY7 A;  3MFY A;  4HTH A;  4IPD A;  1PH5 A;  4DAY B;  3UDX A;  2N49 A;  3K5N A;  1RD9 D;  1HZC A;  4FDB A;  1QE6 A;  4XQJ A;  1HNW L;  2KQ3 A;  1ET9 A;  4HJ8 A;  1HR0 W;  2ZM6 Q;  4DV3 L;  4L5S A;  4A76 A;  1K8A C;  1FJG L;  1IBL L;  4GOP A;  1KAW A;  3U9O A;  3EQL C;  4EQN A;  2CWA A;  3UE0 A;  4DA2 A;  2VQF L;  3HOX G;  3CMA A;  3K0X A;  2VB3 X;  4B3R L;  3R2T A;  4RHS A;  1WTX A;  4IPC A;  1F2M A;  1DOK A;  2HIX A;  5AJ3 L;  5HY6 A;  1RF2 D;  3HOY G;  1GUS A;  2B2W A;  1PRT F;  2YYZ A;  1R9T H;  3UDG A;  2X6L A;  3SXH A;  1GKH A;  2UXD Q;  1Y8O B;  2QDL A;  1I4R A;  4CGY B;  3F1Z A;  3D4W A;  5C6A A;  5C4X G;  1ENF A;  4DK6 C;  5HGT A;  5KEE A;  4AQY L;  3T16 A;  1WTV A;  4RKL A;  2F0H A;  1HQR D;  3I7F A;  2ZJP A;  2L11 A;  2R61 A;  3JAM i;  3Q8D A;  1YI2 A;  2JEA I;  3J80 L;  2K50 A;  3L0O A;  4HED A;  1X55 A;  4KN4 C;  1S5E D;  3C3L A;  4R9W A;  1UE5 A;  4A3M B;  4AYB E;  4CDF C;  4JK1 C;  1I50 H;  2F0E A;  3AQQ A;  2JYO A;  5NUC A;  1B44 D;  2F4V L;  1K8M A;  2ICE C;  2VY3 A;  2ZTC A;  2RKS A;  2L1B A;  4LUV A;  3VYS A;  1J9O A;  5FJ8 H;  1EY6 A;  4DR2 L;  4IUT A;  1HNX Q;  1R4Q B;  1D5Z C;  1PRT B;  2PI2 E;  1TWG B;  1SE3 A;  1EY9 A;  5LHY 1;  1A15 A;  3U58 A;  2IL8 A;  1DGS A;  2VS1 A;  4DUY L;  2Y0S B;  5KYL A;  4BY1 G;  4JI0 L;  1Z47 A;  3K5O A;  4R4O A;  1FR3 A;  5F2D A;  4O1N A;  5GAH C;  2IWH A;  2A69 D;  2AQ1 B;  2FFK B;  5J39 A;  2ASB A;  3J81 j;  1WI5 A;  5ELB A;  2B2V C;  5EPJ A;  2RVL A;  3ND9 A;  4C1N I;  2HHH Q;  2E2I B;  1ENC A;  5K5P A;  2K7V A;  3VA5 A;  3CRK C;  5CV8 A;  4ME5 A;  1B9N A;  4TVA B;  5C0X J;  5C3E B;  4A3E G;  1STY A;  1Z6H A;  4QF4 A;  4QL5 A;  3CU7 A;  1JJ2 A;  4HID A;  4YY3 Q;  1K8G A;  1Y8P B;  4C56 C;  2K14 A;  4FXD A;  1TS3 A;  2A6E D;  2V4D A;  3CD6 A;  3M4Q A;  4X65 Q;  3VYT A;  3NPP A;  3MWY W;  3TP6 A;  1IYJ B;  3J81 i;  1D1K A;  4BBS G;  5T1I A;  4A3F G;  1LO5 D;  4E6I A;  4DV5 L;  2NN6 H;  1S72 A;  4LUO A;  2R92 G;  3MXG A;  4KLK A;  2EY1 A;  1CSP A;  4X64 Q;  3CAM A;  4ZQ3 A;  4IUP A;  5ELO A;  1IBM Q;  4N9P A;  3VR4 A;  1W2B A;  4IUQ A;  3QOL A;  3HOW B;  1FVI A;  2H1E A;  1EIY B;  1PDQ A;  5AFW A;  1ENA A;  2ZM6 L;  3MAQ A;  3GTQ H;  1HH2 P;  2HDM A;  1LV9 A;  4DGZ A;  3Q23 A;  1EQT A;  4F8M A;  1V9P A;  5JPM C;  4A3D H;  1RTO A;  3CW2 C;  1LT3 D;  1RHP A;  2O4X A;  1QUQ B;  2JQO A;  4GNX A;  3KBG A;  5EGT A;  5LL6 X;  2R93 G;  2Z9H A;  1QNU A;  3K81 C;  2LSS A;  4JOI C;  1EY8 A;  1RJT A;  3E9H A;  4DV0 Q;  1EQQ A;  2VW9 A;  1UNS A;  2VXW A;  1XNQ Q;  1H9R A;  3NTI A;  3NQI A;  3M7N A;  3P7J A;  1VCI A;  3K58 A;  2PYK A;  3M9B A;  4H44 C;  2I46 A;  2CKZ B;  1Y1V B;  2UXD L;  4DR6 Q;  1PLF A;  5C44 B;  3N6R A;  1WTQ A;  4A3K H;  2LMC B;  1GXD C;  2CFM A;  1STB A;  2B2Y A;  3CC7 A;  1RKN A;  3BDC A;  1NMG A;  3PIP A;  2CW0 D;  4J6H A;  5C0X I;  3I4N H;  4C3I G;  4A3J G;  4LF6 Q;  4BS9 A;  4UY8 C;  1E1T A;  1EEF D;  2OCE A;  4RGN A;  3KUP A;  1EYA A;  4JI1 Q;  2ZXR A;  1SRU A;  4CDD C;  1J6Q A;  2ZTE A;  5JJK A;  4IOC A;  5M3M G;  4NXN Q;  4JI3 Q;  3VR3 A;  2KCT A;  2AMC B;  2MUY A;  1D2B A;  1HNX L;  1ASZ A;  1PH7 A;  1VQF A;  5M3F G;  3OTO Q;  2E2J B;  4L63 B;  3QR8 A;  3GTM B;  4A3B B;  1I6H B;  2L0C A;  5GQO A;  1BCP C;  3J80 i;  5CGK A;  4RHR A;  2QW7 A;  2RDG A;  1EY4 A;  4C3J G;  2AQ3 B;  5IOC A;  2E74 C;  1EWI A;  1CQV A;  2RSO A;  2UUB Q;  5I6Y A;  1EYC A;  3K59 A;  2X6G A;  1OXU A;  3KLS A;  2IY5 B;  2BDN A;  5JJI A;  4LK1 C;  4IFD I;  1HXY D;  1B3Q A;  3GP7 A;  3S17 B;  3ICE A;  1JC7 A;  2PNH A;  2AKW B;  2HHH L;  1PZI D;  4GKJ Q;  1Q3L A;  4KV6 A;  1FNU A;  2B8G A;  3KLW A;  4ID6 A;  1QB5 D;  1S5F D;  3LGJ A;  3A55 A;  4H0L C;  4DNT B;  4DAY A;  2NVY H;  1SE8 A;  4XQQ A;  1EYD A;  1LTI D;  4YY3 L;  3KDF A;  4BWG B;  1SND A;  3IAY A;  3S1N B;  5IGE A;  4R8I A;  1OXS C;  3HOV H;  4XQN A;  1KAB A;  2JEB I;  1S4Z A;  4DR7 Q;  3HOX H;  4X65 L;  4AYB B;  1TWH B;  3HRZ C;  4C3H H;  3J7A V;  3S1M B;  1VQN A;  1C0A A;  4CKE A;  2BOS A;  1DM0 B;  3JAM c;  2Q2T A;  2UXC Q;  2EDG A;  3HOY H;  3CQZ B;  5CYU A;  4X64 L;  2BE5 C;  3I90 A;  3VR6 A;  2ALY B;  1SR3 A;  4NPS A;  1IBM L;  2K5H A;  1ZEQ X;  2V1C C;  3K8A A;  3F2D A;  3I91 A;  4DN4 M;  1K3B C;  4FXG C;  1B70 B;  1L0X B;  4QMG A;  4C2M B;  1HZ9 A;  1Q86 C;  4NKL A;  4IPG A;  4MZ9 A;  3HOU B;  5D3D A;  4XT3 B;  1AH9 A;  4L6T B;  3TN2 A;  1TR5 A;  2G9H D;  2I07 B;  2EIF A;  3A8I E;  1YIJ A;  5EBC A;  2SOB A;  2JE6 I;  3ITP A;  4YCV A;  5E4X A;  3TRE A;  3S14 B;  3V2T A;  1NUC A;  4FXK C;  4HCS A;  2L9H A;  1BVS A;  1PH4 A;  1IZ6 A;  2J7Z A;  3WWV A;  1XNQ L;  3FP9 A;  5IGD A;  2R7Z B;  1PFM A;  4IQZ A;  5C0X H;  1MHW C;  1O7I A;  2YV5 A;  3BYY B;  2UUA Q;  4IUV A;  4DR6 L;  1N33 Q;  4OXP A;  2IW3 A;  3FKI H;  3IFD A;  3CPW A;  2DGY A;  1TWF H;  4JCV E;  4HJ9 A;  3AU7 A;  1F2Y A;  1SYG A;  4P71 A;  3T1H Q;  4AH6 A;  1YJW A;  4ME3 A;  1P8L A;  5JPN C;  4LF6 L;  1CKO A;  2DNE A;  3VR5 A;  3OPO A;  1I94 Q;  1EIG A;  4KK7 A;  4RFB A;  1Q81 C;  3S2D H;  4JI1 L;  3S2H B;  3NEM A;  4RGM A;  1TU2 B;  1CTM A;  1YEZ A;  4A3E H;  3J81 c;  1L0W A;  4RCN A;  2KHI A;  3H3V H;  4NXN L;  4JI3 L;  4JPB W;  4HIO A;  4DR1 Q;  2B2U A;  2CCZ A;  1GO3 E;  3OTO L;  4JVZ A;  3S15 H;  4PMC A;  2K33 A;  3H0G G;  2SNM A;  5DAU A;  2WB1 B;  3PUV A;  4ILW A;  3MTS A;  4ZCK A;  1LTB D;  2N78 A;  3ERQ A;  1M90 C;  1KDB A;  1FD7 D;  3SDZ A;  4FO2 A;  1FNW A;  4BBS H;  2UUB L;  1SJE D;  2ZTD A;  3A74 A;  1AE2 A;  3PQI A;  2NB0 A;  1JOK A;  2K5Q A;  1QNK A;  1JOQ A;  1VQC A;  2AWN A;  2C35 B;  1HUM A;  4XXE A;  2Z4I A;  1MSH A;  2CHB D;  1V1Q A;  2F0Q A;  4V0B A;  2JA5 B;  4PZ7 A;  5JVH 3;  5C5L A;  5LMN Q;  1PTO C;  3T56 B;  1Q90 A;  5E7N A;  4GKJ L;  1CA6 A;  3U50 C;  1LM0 A;  1TII D;  2JA8 H;  1HFN A;  2H4O A;  2Z4H A;  3D31 A;  1WYD A;  1YHA A;  3JAM E;  3TP5 A;  1A0I A;  3U9S A;  2WV6 D;  1GOZ A;  1UWV A;  1B53 A;  1A3V A;  2QGQ A;  1Y14 B;  1JE5 A;  4X3S A;  2EQS A;  4KHV A;  2KCM A;  2OQK A;  1HA5 A;  3PO3 H;  1PFB A;  1VQE A;  3HOZ H;  4DR7 L;  4EQ5 A;  2PCF B;  2E8G A;  2F0V A;  2JA6 H;  1RDP D;  1LTL A;  3TP8 A;  3AB9 A;  1RIP A;  1V1P A;  5C4X B;  1SYE A;  2PQA A;  2UXC L;  2RDH A;  1V1O A;  3M4O H;  4O2D A;  5KND A;  2NBF A;  2MQH A;  1IYU A;  4KHZ A;  3B6Y A;  4OWT B;  5IOD A;  3DM3 A;  4B08 A;  1WVL A;  1D7Q A;  1TWA B;  4LF7 Q;  4UP9 A;  1WCM H;  2B2T A;  2FIN B;  2VL6 A;  5LMU Q;  1YNN C;  1BO0 A;  2LKV A;  2F0I A;  3A56 A;  5CBE E;  2XNA C;  4QUC A;  1QG7 A;  1L1O A;  1KTK A;  3J80 c;  2F0M A;  3RNU A;  1C48 A;  1S3O A;  3PO2 H;  2MNA A;  1CKM A;  1CZG A;  1PTO B;  1E24 A;  1AFP A;  3AMU A;  3ERS X;  5KRU A;  3K7A H;  1EWC A;  1O78 A;  4RGO S;  1G2T A;  5C4Z A;  2HCC A;  4MHE A;  2XN9 C;  3TME A;  4G7O C;  3TDQ A;  4O0A A;  1AE3 A;  3UDI A;  3PGZ A;  1VQK A;  1N33 L;  4YWL A;  4A3K G;  1VDZ A;  4OON A;  3RN2 A;  1PH1 A;  2MO0 A;  3J81 E;  1NY4 A;  4JG2 A;  2D62 A;  3T1H L;  1GJX A;  1BNZ A;  3BVG A;  1NE3 A;  3I4N G;  4ZK9 B;  2LFN A;  4OIK A;  4L5Q A;  1SAP A;  2QA4 A;  1TY2 A;  1XYI A;  2DN8 A;  4LAA A;  4DFA A;  1I94 L;  4RGT A;  2E75 C;  1O7L A;  1NNX A;  2A74 C;  1DCZ A;  3JC6 6;  2A68 D;  5D14 A;  2NVX B;  1VF7 A;  5CV4 A;  3KJP A;  3EBE A;  1G51 A;  1SXT A;  3T4A C;  1TWG H;  1TY0 A;  4HJA A;  4LW1 A;  1CI3 M;  2XTI A;  4IPH A;  5I9O A;  4DR1 L;  4DR4 Q;  4N8F A;  1E2W A;  4BBR H;  4A3F B;  1C8C A;  2F0N A;  3N52 A;  2R92 B;  5COR A;  3K0Y A;  3BZK A;  1CK1 A;  5EPL A;  1PH9 A;  1K0R A;  1BF4 A;  4DV7 Q;  4KTA A;  1JIC A;  4FP5 D;  1SNQ A;  1LTS D;  2OEO A;  2DY7 A;  4UP8 A;  3KBX A;  4H02 A;  1U4L A;  1F9R A;  4GN3 B;  2A6H D;  3CCR A;  5LMN L;  2PW7 A;  1PA6 A;  4IJH A;  3RZD B;  4CJ2 C;  1LT5 D;  5JAV A;  3WOE A;  4DKA C;  3BJU A;  5EJW A;  4R4T A;  3E3X A;  3C46 A;  2KCC A;  1VMC A;  3GTP B;  2R93 B;  1BOS A;  4KD4 A;  4OGQ C;  3CXC A;  4F88 A;  1WD0 A;  2EPB A;  3A5U A;  3BVM A;  2IX0 A;  5IP7 G;  1CKN A;  2NVQ B;  3LX0 A;  3HOV G;  2O2L D;  2E2H B;  1XMO Q;  2F0W A;  1T5E A;  4C3H G;  2RDF A;  1CUK A;  5GRO A;  1U4P A;  1B9M A;  4Q5V A;  4LF4 L;  4TRD A;  1Q82 C;  2EXZ A;  3PIO 3;  3L3O C;  4JI2 Q;  4Y7N B;  3DEO A;  4DNR B;  1QZH A;  1A2T A;  1HZA A;  1UE1 A;  2F0P A;  4XDX A;  3J80 E;  4RCO A;  4C3I B;  2ZT9 C;  3MVV A;  1E1O A;  4A3J B;  5IYD H;  1JWM D;  4I65 A;  3S24 A;  3GTG H;  3H91 A;  3P20 A;  4DXG A;  1G6P A;  2XWB B;  4LF7 L;  4XTC S;  3EN2 A;  2IJ0 A;  3EIV A;  4CBV A;  2ATW A;  1EIF A;  1LAB A;  4FNF A;  4DF7 A;  5LMU L;  4MTN A;  3OOC A;  2JA7 B;  5M3M B;  1F2Z A;  4WJ4 A;  1EIH A;  2KHJ A;  3RLN A;  2XWJ B;  3TP7 A;  5M5W H;  1VQO A;  1YVC A;  4XT1 B;  4IUU A;  2EOT A;  2VUM H;  4X3U A;  2JA9 A;  1JOO A;  1HTL D;  1I4X A;  1TWC B;  4ZUI A;  1EY0 A;  1KDA A;  2CW0 C;  4PG3 A;  3LWU A;  4C3J B;  4ZYS A;  4X66 Q;  2DNC A;  2Q8I B;  1GUO A;  3SR1 A;  3KF6 A;  3H0G H;  1PXU A;  5LMN W;  5C0X G;  1SFO B;  2P5Z X;  1TQO A;  3DWA A;  4A3G G;  4KHP Q;  3PUY A;  2ICI A;  4HCE A;  3M3Y H;  5KGU A;  1UUP A;  3HKZ G;  4PMW A;  5IP9 H;  3AFP A;  2YTV A;  2F0L A;  4X3T A;  4DR3 Q;  1KXL A;  3FKI G;  4IO9 A;  1IW7 C;  2M9V A;  2NYZ D;  2F3I A;  4LFC Q;  1Y1W B;  1ZYR C;  2RSN A;  2YU9 H;  1KNE A;  1TT2 A;  1YJN A;  3MXP A;  1XJV A;  1PH6 A;  1X6O A;  4Y52 H;  5EPK A;  1SE2 A;  1PH3 A;  1GVP A;  2Q2H A;  2FMC A;  4GN4 B;  1ILQ A;  1F9S A;  1HCZ A;  3IL8 A;  2XGT A;  3TEH B;  4KY6 A;  1YNJ C;  4K8J A;  4JBM A;  3D3R A;  3LWE A;  2H5X A;  1X9N A;  4ZAI A;  4S3S A;  3EJI A;  3K80 C;  4DR4 L;  3MEH A;  3A8K E;  2I5H A;  5BR8 Q;  4CDE C;  4O42 A;  4IFD G;  3CCJ A;  1PYB A;  5L37 A;  2D5D A;  5IYC G;  4BY7 H;  1T9H A;  5FO9 B;  1QJO A;  3TS2 A;  4DV7 L;  2EJM A;  1WTO A;  2IPK D;  3F2C A;  4DV6 Q;  3S17 H;  3CCQ A;  3GTK H;  2Z6K C;  4WRD A;  4GZY C;  4A3L H;  1NAP A;  4OWW B;  3E0J A;  5IIF A;  5K36 G;  3PF5 A;  2B63 G;  1BBX C;  2K5N A;  1WD1 A;  3P75 A;  2GN5 A;  4X3K A;  2JA8 G;  5HGQ A;  1X32 A;  1MBY A;  4IFD J;  1U4R A;  3RR5 A;  2ZJQ A;  2M00 A;  2CQA A;  3D8G A;  3TQY A;  1PRT D;  1EQR A;  3V96 A;  4DV2 Q;  1TWH H;  1BBU A;  1SMY D;  3PO3 G;  2K28 A;  3X3M A;  3HOZ G;  1XMO L;  4K0K Q;  1R9T B;  1JOR A;  1CHP D;  1K83 H;  4OWX B;  2JA6 G;  3DWQ A;  3G6J B;  4KJN A;  4LFA Q;  4U68 A;  3UI2 A;  2IT1 A;  3RUZ A;  1LTG D;  3S1R B;  1VQ5 A;  4C1N K;  4J1M A;  1WTP A;  3MXN B;  1B7Y B;  1H9S B;  3HFZ B;  4JI2 L;  1IKL A;  4IUN A;  4FVM A;  2K5W A;  2F3W A;  1KIX A;  3A7L A;  1DD2 A;  1BKB A;  5GAE C;  2K1B A;  1VQM A;  4DV1 Q;  1GHJ A;  1I50 B;  1UEA B;  1O7Y A;  1VQA A;  1WCM G;  1CA5 A;  2LS0 1;  4K2L A;  1ROD A;  1B50 A;  3MEF A;  1KD1 C;  4GLX A;  4DNI A;  3M85 A;  4P72 A;  1ESR A;  2BCO A;  4JI5 Q;  3MXU A;  3BDO A;  1XMQ Q;  4QQB X;  4I7Z C;  1EOV A;  3PO2 G;  1LTR D;  4X66 L;  1J5E Q;  2DUD A;  1W3S A;  2X69 A;  4OEM B;  2DJG C;  2FMM A;  1VQ4 A;  3CCS A;  2M2L A;  4F87 A;  4NMZ A;  4OIJ A;  4DR3 L;  4PQX A;  3RLF A;  3CCV A;  4PZ6 A;  1STA A;  4L5T A;  3CF5 A;  2EY5 A;  1VQI A;  4LFC L;  4JW0 A;  3C1F A;  4A3M G;  2NZO A;  3KLS X;  1L0Y B;  5J22 A;  4A3C H;  3ULJ A;  5FK9 C;  2RCN A;  3S2H H;  3KF8 B;  5EKK A;  4ODG A;  4FF2 A;  4XIG S;  1SN8 A;  1M1K C;  4DU9 A;  1SNP A;  3GD7 A;  5DEH A;  4POG A;  1BCP F;  4GOP C;  2BH8 A;  1K3R A;  1D5M C;  2AWO A;  2FHT A;  3HKZ E;  1SRO A;  5T1G A;  3OMC A;  1I4H A;  2RF4 A;  3OIQ A;  1MKH A;  4KD3 A;  1H95 A;  1HNZ Q;  1E22 A;  3HZX A;  1EWH A;  1FYC A;  1PYW D;  1QZG A;  2KVM A;  4BBR G;  1F9P A;  2MP1 A;  5IP7 H;  1U9R A;  2B2W C;  4L5R C;  1S5D D;  5BR8 L;  4IN3 A;  1AP0 A;  3BS1 A;  2KJX A;  2CH4 A;  5G3L F;  3O13 A;  4MIU A;  2Q2U A;  2F52 A;  4IUR A;  2L4N A;  2F0J A;  3FDT A;  4UPA A;  2PZW A;  3X3N A;  1Q46 A;  4DV6 L;  2EYO A;  3FMC A;  1I4G A;  3CC2 A;  1Z7T A;  1EUJ A;  3GTQ B;  3CKI B;  2K01 A;  2JJQ A;  1Q12 A;  3GTO H;  5C5M A;  5H1S E;  1F77 A;  1BCP B;  5EKI A;  4A3D B;  2XIW A;  5EQ0 A;  2EYP A;  2D0O A;  2YTX A;  2PZU A;  3VYU A;  1Y69 U;  2A73 B;  4Q0F A;  5IE8 A;  3QJY A;  1I6V C;  3VDY A;  5CR3 A;  2VNU D;  4EGV A;  3DMU A;  4DV2 L;  3KFU A;  1CQF A;  1GM5 A;  4K0K L;  3SHL A;  1MJC A;  1OTC A;  3GTL H;  4GOP B;  3KYH C;  5M5X B;  1IBK Q;  4LFA L;  4DV0 L;  1BR9 A;  2IX1 A;  4A93 B;  2Z6B A;  4K8I A;  3PUZ A;  4A75 A;  1JR0 D;  3HOW G;  4A3G H;  1TWA H;  1GUT A;  4NB3 A;  2F0G A;  3I4N B;  1HFG A;  3W1B A;  1L2F A;  5IYD G;  1E3P A;  3K5L A;  1XXG A;  5ISR A;  2CQO A;  2KUM A;  4POF A;  4NXM Q;  3GO5 A;  4LUZ A;  4JI6 Q;  1VQ6 A;  5M5Y H;  5FLX c;  2HT1 A;  2XRS D;  1FL0 A;  4FYD A;  4KY5 A;  2KEN A;  4OL7 A;  3RD4 A;  3ERO A;  1XMQ L;  4B3T Q;  2B29 A;  1CSQ A;  1HUN A;  1PHJ A;  1MD2 D;  3SE0 A;  2VUM G;  3ULP A;  1UE6 A;  1ICF B;  3HG9 A;  4XYQ A;  1OXX K;  2OTJ A;  1EQV A;  2KEE A;  1XWE A;  2GA4 B;  3I56 A;  1J5E L;  4IZ8 A;  2BA1 A;  4IJL A;  1R4P B;  3S1Q H;  2DJF C;  2EY6 A;  2F0D A;  4OHJ A;  5ELF A;  4IFD H;  1K0S A;  5C4J B;  3NBH B;  1ZXT A;  5IYC H;  3I4M H;  2A68 C;  3K6O A;  5IP9 G;  1GUN A;  2WAQ G;  1KDC A;  3BVZ A;  2HUG A;  4MNO A;  3K7U C;  5IT9 L;  5JOB A;  2HQE A;  4DUZ Q;  3FHW A;  4N9T A;  3AFQ A;  2BA0 A;  3FVQ A;  2ZJR A;  4A3I H;  4B3M Q;  2JXM B;  1S5C D;  4WFN 3;  3F8T A;  5K36 H;  2B63 H;  3SK8 A;  1MGS A;  4UDU C;  5DM6 3;  1FGU A;  1G2S A;  3I73 A;  4DAP A;  3Q6S A;  5G3L D;  4CJ1 B;  1N36 Q;  3OW2 A;  3ND8 A;  4QJF A;  1PV4 A;  4GNX C;  4HN7 A;  2D2C C;  2MJ8 A;  3NE5 B;  4LF8 Q;  3HOX B;  1HNZ L;  4BA1 I;  5A2Q L;  4ZRZ A;  1NJI C;  2VQE Q;  4C3H B;  3I2Z A;  3KJO A;  2UUC Q;  1IYV A;  1I3Q H;  4DAV A;  4OX9 Q;  3RZO B;  4DK3 C;  4DPG A;  4QCL A;  1Q7Y C;  3HOY B;  2B3G A;  4PMB A;  2QIL A;  4BY7 G;  1SYC A;  3U4Z A;  1PTO F;  3PIO A;  1HNW Q;  3GTJ H;  3CP0 A;  1VQD A;  3ER0 A;  2NTS A;  1D8L A;  1VQB A;  3CCL A;  2B2Y C;  1DYQ A;  1VQL A;  2B2V A;  2B39 A;  4NP5 A;  3IFT A;  3CME A;  4PNY A;  4A3L G;  3H3V C;  1Z9F A;  2HDL A;  1QUQ A;  2BE5 D;  2K04 A;  2K75 A;  4G7H C;  2E2D C;  3T1Y Q;  1HJP A;  1IXR A;  2J0T D;  2MHV A;  4OO1 I;  1G91 A;  3STB D;  2NVT B;  1DOM A;  1SNC A;  2HCI A;  3R8B A;  3GTP H;  2K4K A;  3L2P A;  5I2X A;  4B3R Q;  2QKI C;  1G29 1;  1M8A A;  3EFX D;  3G7L A;  5IGB A;  1SNO A;  2E2H H;  3PSI A;  4A4I A;  1E2V A;  4JI7 Q;  4LJZ C;  3TBI B;  4HSP A;  2HD3 A;  1SE4 A;  2J4X A;  1UE7 A;  3TZD A;  1DXM A;  1KHI A;  2EYH A;  1EOT A;  1WJJ A;  1BUV T;  1QVG A;  1IBK L;  1X65 A;  2PNR C;  4GKK Q;  3DUZ A;  2EY2 A;  2RCF A;  3FKI B;  4BY1 B;  1PYS B;  1HZB A;  3HEJ A;  4FF3 A;  1GUG A;  1TWF B;  2KED A;  3CHB D;  2ZXP A;  3URY A;  2IX3 A;  1VQP A;  5A35 A;  2UUA L;  3S16 B;  4KMU C;  3C2P A;  5FLX L;  3E5S A;  3GQB A;  5E3F A;  4MTK A;  1N8R C;  4NXM L;  2JSO A;  2JA7 H;  3S2D B;  5ELE A;  4DR2 Q;  4A3M H;  4HIK A;  1OXV A;  4JI6 L;  1XPU A;  4A3E B;  5IYB H;  2ZXO A;  1VQ7 A;  1N34 Q;  1JB7 A;  1G6Z A;  5J3B A;  2F0O A;  2WP8 J;  4B3T L;  3S15 B;  4JOI A;  4MN3 A;  2EYL A;  4OEL B;  3ZYY X;  2OT2 A;  1JT8 A;  4DR5 Q;  3H94 A;  1TS4 A;  2A69 C;  3DHQ A;  4CJ0 B;  3TRZ A;  3MC0 B;  4BBS B;  2AUJ D;  4PV1 C;  4CHT B;  2Z8L A;  1Y1W H;  1A3U A;  2HQL A;  3NTH A;  3VA7 A;  2BH2 A;  3PUX A;  1IL8 A;  2L55 A;  5HUR A;  1CHQ D;  1EY7 A;  4DUZ L;  4A3C G;  2JA8 B;  1XNR Q;  3PMF A;  2E2I H;  4B3M L;  2NTT A;  3HGB A;  1BDO A;  2A6E C;  4BA2 I;  2L12 A;  4YWK A;  5C3E H;  1S40 A;  4RG1 A;  2EVB A;  1I5F A;  1SYB A;  3BDL A;  1PTO D;  2N8N A;  2RHQ B;  4WJ3 M;  3ZJY C;  3OMG A;  4KI0 A;  2WAQ E;  1N36 L;  1BQQ T;  4QIW E;  3K57 A;  3FPU B;  1KQS A;  5EKL A;  4LF8 L;  3HOZ B;  1TS5 A;  1ET6 A;  1LT4 D;  2WB1 G;  4YCU A;  4L8J A;  3ULL A;  1O80 A;  3D4D A;  2VQE L;  2JA6 B;  2PI2 A;  2UUC L;  4OX9 L;  4BXX G;  3QG1 A;  4WJW A;  3M4Y A;  5ELD A;  2KBN A;  4K6L A;  2K52 A;  1RL2 A;  2EZV A;  3M4O B;  3KDF B;  1KNA A;  3CPF A;  4OO1 H;  3GV3 A;  2NN6 I;  2FJ2 A;  4H7B A;  1HRJ A;  1PRT C;  3M4P A;  3S9W A;  2JA5 G;  4LNQ A;  1QOH A;  1QCB D;  2ID0 A;  1WCM B;  5TSS A;  4APV A;  3HOW H;  1SMY C;  3A5Z B;  2QEX A;  2B8F A;  3I72 A;  4HIM A;  3KOJ A;  3T1Y L;  4R1J A;  4JI8 Q;  1TVX A;  3G48 A;  4UP7 A;  4EVO A;  3BU2 A;  3CC4 A;  2LXK A;  2CWP A;  4CKB A;  3KK7 A;  3P1H A;  4GLA C;  3VR2 A;  4YWM A;  5IGC A;  2EYJ A;  5I2Y A;  3PO2 B;  3DLL A;  1BXT A;  4F7X A;  4ALP A;  2QEJ C;  1YNN D;  3K7A B;  1X3Q A;  2B2U C;  4JI7 L;  3MFG A;  2WKC A;  3R2I A;  2G9D A;  4JBJ A;  1PVO A;  5M3F B;  3S1R H;  3OW7 A;  3I70 A;  4JYA Q;  1AEX A;  4EQP A;  1X54 A;  3HKS A;  4K14 A;  4GKK L;  4ZKC B;  5C4H A;  1MIU A;  1Y1V H;  5C44 H;  4P2C B;  3W5O A;  4HSV A;  4TQU S;  1X56 A;  1B2T A;  2EE1 A;  4HJ5 A;  4DV4 Q;  1XTC D;  2PZT A;  2JP1 A;  1DON A;  1PFS A;  1T5X D;  1K9M C;  1HTP A;  2D9U A;  2KCN A;  1STE A;  3M7G A;  1NR4 A;  4DK0 A;  3V05 A;  1SBB B;  3PUW A;  3MHB A;  3U4V A;  1PFN A;  3NBH A;  5CV6 A;  1Q8K A;  4DXF A;  1EEI D;  2HIV A;  5FO7 B;  1N34 L;  1FNV A;  1Q8I A;  2PQE A;  4K5W A;  4TKO B;  3RN5 A;  2A1A A;  3NWT A;  1WTW A;  5KIX A;  3D4R A;  4BBR B;  4LFB Q;  4HAE A;  2DY8 A;  4RKB A;  2E2J H;  1PZJ D;  1LYL A;  1EZ6 A;  4DR5 L;  4GLV B;  3GTM H;  4A3B H;  1I6H H;  5IGF A;  1Q1B A;  4LF5 Q;  2PO4 A;  5C3W A;  2NZ1 D;  4PZ8 A;  3W2D A;  3NEL A;  2WII B;  5GAD C;  1CM9 A;  2KOL A;  2XRQ D;  3I4M G;  3BYT B;  3RMH A;  3L9A X;  3DEP A;  1YHB A;  1IHZ A;  3NTK A;  1SYF A;  5DNF A;  3BG3 A;  4ABN A;  5E1F A;  4KKS A;  3BZD B;  1VQ9 A;  1E2Z A;  3IRB A;  2B2T C;  5KYI A;  2PPB C;  1XNR L;  1O7Z A;  4A3I G;  4H13 C;  1VQJ A;  1KLG D;  3FPP A;  2E5L Q;  3ONA B;  1ILP A;  4JBK A;  2EYF A;  2R3Z A;  1L1O C;  5DLQ E;  5FLM H;  4ULL A;  1VF5 C;  3S1N H;  1LUZ A;  1CT1 D;  4JI4 Q;  2OWO A;  1KRS A;  3OWF A;  5IWA Q;  2AQ2 B;  4QB4 A;  1MI2 A;  4RMF A;  3NUC A;  2FXQ A;  5LL6 S;  2EJG C;  3S1M H;  1K73 C;  1YNX A;  3I8Z A;  1K28 A;  4JC0 A;  3WDN A;  4U67 3;  3I4O A;  3Q0A A;  3CQZ H;  2XVS A;  1LTA D;  1G8Z D;  4LWC A;  4RH6 A;  1JE4 A;  2F4I A;  3FEW X;  1TKW B;  2K05 A;  3GTG B;  2WB1 E;  2N3S A;  1V1P B;  2NWG A;  2PQA B;  4QUF A;  4C2M H;  5BN5 A;  4JI8 L;  3HOU H;  5CC4 A;  1FGB D;  5M5W B;  1LLR D;  3QOJ A;  4I7A A;  2CVR A;  2Q2I A;  3G71 A;  1PH2 A;  3QIA A;  1PH8 A;  2VUM B;  1SNM A;  1B1Z A;  3S14 H;  1QVC A;  4UAI A;  1PMR A;  1C9O A;  4EX5 A;  1NMF A;  5M5X H;  4V19 0;  2UXB Q;  1VQ8 A;  4RWS C;  4A93 H;  3E9I A;  4JYA L;  3H0G B;  1B8A A;  3E6Z X;  1ASY A;  1B4O A;  1SLJ A;  2R7Z H;  1L1O B;  3TS0 A;  5JEA H;  3M3Y B;  2JK8 A;  1VQH A;  2MPM A;  2WAQ B;  4HMJ A;  3AEV A;  1CFM A;  1ONL A;  4QIW B;  1STH A;  2WIN B;  2GVB A;  1JWS D;  1CZW A;  1UAP A;  4DV4 L;  3G4S A;  4KHP L;  1EFI D;  1EFW A;  1X3P A;  2YU9 B;  1A8V A;  3DWP A;  2D0P A;  1EYG A;  1GHK A;  1TS2 A;  3A0J A;  2JA7 G;  2KA7 A;  1IW7 D;  1D6E C;  1X3G A;  3NHH A;  1JJG A;  2MGS A;  1ZYR D;  1BBW A;  5KNB A;  4X62 Q;  5IYB G;  1WTH A;  3SVM A;  1DZ1 A;  4KKU A;  1H9K A;  5IT9 c;  1EY5 A;  4YHH Q;  2XSC A;  3H09 A;  2QF7 A;  4LFB L;  1D5X C;  3H3V I;  1II3 A;  2WAC A;  3SK6 A;  2LY7 A;  3E0E A;  3UE1 A;  2Z0S A;  4R4C A;  2F0S A;  3OWE B;  2YTY A;  4BY7 B;  4P75 A;  3QB3 A;  1YNJ D;  5C4J H;  4LF9 Q;  3H6M A;  1XTD A;  4LF5 L;  4G57 A;  4B3S Q;  2E76 C;  1N32 Q;  4BXX H;  2Y0S G;  4K5X A;  1MSG A;  3GTK B;  2Q8T A;  1Y1W G;  3HP3 A;  2N88 A;  4ZKB B;  2SDF A;  3TSS A;  2AUK A;  3HS0 C;  1IL2 A;  2QCP X;  1AZP A;  3J7A 5;  2JA5 H;  4J15 A;  5FKA C;  1EZ8 A;  4ZUJ A;  3R3O A;  5KNC A;  1NSN S;  2ES2 A;  2F0F A;  3A54 A;  5C3E G;  2E5L L;  4B9W A;  2OQ0 A;  4JV5 Q;  1E0B A;  1NTG A;  1A63 A;  5GAG C;  3AYH B;  4GS3 A;  3RZO H;  4TSS A;  4XYO A;  4JI4 L;  1K83 B;  5IWA L;  1GUW A;  4GN5 A;  1AW7 A;  2PMZ E;  1KRT A;  3STB C;  2MO1 A;  3NBI A;  1XPO A;  1SSO A;  5C4X H;  1MJE A;  3I4L A;  1H9J A;  4OO1 G;  2UU9 Q;  3SK4 A;  3NQT A;  2ENB A;  1CKN B;  1SJH D;  4N8X 1;  3NEN A;  3J7A F;  4X6A H;  5FO8 B;  3CCU A;  1IKM A;  2IHF A;  5C3X A;  4A3K B;  1HHV A;  1QIL A;  1ICW A;  3GV6 A;  3J7Y W;  1YIT A;  2F3V A;  2WKD A;  2O5J C;  3PV0 A;  5D65 A;  2NVT H;  1X3E A;  3L7Z C;  1JJC B;  1ML0 D;  1NCV A;  5DM7 3;  1LTT D;  3KLR A;  2K6A A;  3D6W A;  3QO2 A;  1WFQ A;  4DV1 L;  2JN4 A;  4R4I A;  5CV5 A;  1YZ6 A;  1HR0 Q;  1JWU D;  5CV9 A;  3H15 A;  1YJ9 A;  1Q1E A;  1NBW A;  1V43 A;  1PTO H;  1PZK D;  4JI5 L;  1KL9 A;  1VS0 A;  2PW5 A;  2UXB L;  2RHS B;  5J1Z A;  2Q8R E;  4DAM A;  1YBY A;  2R7F A;  2F0U A;  4RAU C;  4BY1 H;  1D1I A;  1NR2 A;  2F1M A;  1N9W A;  2TMP A;  5I4D A;  1TXY A;  4YCW A;  1Y1V G;  4KJO A;  3W1G A;  5C44 G;  3S16 H;  1DJR D;  3LNN A;  1QWY A;  3PIP 3;  3FRP B;  4G4K A;  5IT9 E;  1KLU D;  3PF4 A;  5I6W A;  1BCP D;  3QWN A;  3KF6 B;  5CBA E;  1C4Q A;  2L15 A;  3UDF A;  1SEB D;  1U4M A;  5FJ8 G;  3C1E A;  2OTL A;  3EA6 A;  4B9X A;  4X62 L;  2NVX H;  1JCK B;  4FF1 A;  3OSO A;  4KN7 C;  1K8O A;  3Q22 A;  4YHH L;  4K5V A;  1KAA A;  2NVY B;  4QGU A;  5A2Q E;  3DXJ C;  2I0Q A;  1LAC A;  2A19 A;  4P73 A;  4CKC A;  3MA2 B;  2VZA A;  2Z1C A;  1Y8N B;  3HOV B;  4A3F H;  2F0T A;  4A3B G; 
#chains in the Genus database with same CATH homology
 3SK5 A;  1I4Q A;  5D3I B;  5COY A;  1DOL A;  2A6H C;  3NP8 A;  3NSW A;  3W3A A;  1OXT A;  2R6G A;  1STN A;  3GTO B;  3NXW A;  3OHX C;  5EBD A;  4DK1 A;  4K2K A;  5BN3 A;  3OIP A;  1W6J A;  3I3C A;  3JAM L;  2K32 A;  2TSS A;  2K03 A;  1HA6 A;  2C9O A;  1HQM C;  5ELC A;  2SNS A;  3MXN A;  5I9P A;  1ZKO A;  1H9S A;  3DM1 A;  2C5C A;  4HMI A;  1EL0 A;  2NN6 G;  3GTL B;  1F9Q A;  4M1U B;  1RCV D;  1EU4 A;  1S5B D;  1STG A;  3T13 A;  3D6C A;  1A6X A;  4HR7 B;  5E4W C;  4A3G B;  4Z9C B;  5JJZ A;  1JB3 A;  4KY7 A;  1HPC A;  3HKZ B;  4RA8 A;  2O5I C;  1B3A A;  1H9M A;  5FLX E;  4K6D A;  4LMQ D;  2OF1 A;  1AZQ A;  2N55 A;  1V8Q A;  5M5Y B;  5M9O A;  2RBM A;  4IAL A;  1RTN A;  1I4P A;  3F2U A;  2EJF C;  1OO9 B;  1F2L A;  1WTR A;  3IKJ A;  2KHS A;  3TZU A;  2VB2 X;  4FF4 A;  3T51 B;  1EU3 A;  2SEB D;  1ESF A;  3NK9 A;  4EQO A;  3EVQ A;  4NW2 A;  4YIJ A;  3NWS A;  3S1Q B;  3T53 B;  5BN4 A;  3MZ5 A;  4R8N A;  3KF8 A;  5JEA G;  4NDX A;  3I4M B;  4WOR A;  2F03 A;  1M4V A;  2OXP A;  2F0K A;  5IGG A;  3J81 L;  5FOB B;  4J8Q A;  1AN8 A;  2EYM A;  2PMZ B;  4M8A A;  1A2U A;  3VYR A;  3WOF A;  4A3I B;  2A5H A;  2B63 B;  1A3T A;  3K5M A;  3CRL C;  2BDO A;  2RA4 A;  5CMD A;  3A7A B;  1SDF A;  4ZLT F;  2QDB A;  1LT6 D;  1W6K A;  5CV7 A;  3SEB A;  2L5T A;  5JEA J;  5JVG 3;  2KEC A;  2NUC A;  1I3Q B;  4JBW A;  4KKT A;  1SYD A;  1VMP A;  1JQY D;  3PO3 B;  3Q24 A;  2K5D A;  2RQX A;  3R93 A;  1XX8 A;  1J8I A;  3A8J E;  3GTJ B;  4G7Z C;  3MFY A;  4HTH A;  3K5N A;  1RD9 D;  1QE6 A;  4XQJ A;  2KQ3 A;  1ET9 A;  3U9O A;  3EQL C;  4EQN A;  4DA2 A;  2VB3 X;  3R2T A;  4RHS A;  1WTX A;  1F2M A;  1DOK A;  1RF2 D;  1GUS A;  2B2W A;  1PRT F;  2YYZ A;  2X6L A;  3SXH A;  1Y8O B;  1I4R A;  4CGY B;  3D4W A;  5C6A A;  1ENF A;  5HGT A;  5KEE A;  3T16 A;  1WTV A;  4RKL A;  2F0H A;  1HQR D;  2L11 A;  2R61 A;  2JEA I;  3J80 L;  4HED A;  4KN4 C;  1S5E D;  3C3L A;  4R9W A;  4A3M B;  4JK1 C;  2F0E A;  2JYO A;  5NUC A;  1B44 D;  1K8M A;  2ICE C;  2RKS A;  2L1B A;  3VYS A;  1J9O A;  1EY6 A;  4IUT A;  1R4Q B;  1D5Z C;  1PRT B;  1TWG B;  1SE3 A;  1EY9 A;  5LHY 1;  1A15 A;  2IL8 A;  2Y0S B;  5KYL A;  1Z47 A;  3K5O A;  1FR3 A;  5F2D A;  4O1N A;  2IWH A;  2A69 D;  2AQ1 B;  2FFK B;  5J39 A;  5EPJ A;  5ELB A;  2B2V C;  2RVL A;  3ND9 A;  4C1N I;  2E2I B;  1ENC A;  5K5P A;  2K7V A;  3VA5 A;  3CRK C;  5CV8 A;  4ME5 A;  1B9N A;  5C0X J;  5C3E B;  1STY A;  1Z6H A;  4QF4 A;  3CU7 A;  1Y8P B;  4C56 C;  4FXD A;  1TS3 A;  2A6E D;  2V4D A;  3VYT A;  3NPP A;  3MWY W;  3TP6 A;  1D1K A;  5T1I A;  1LO5 D;  4E6I A;  2NN6 H;  3MXG A;  2EY1 A;  4ZQ3 A;  4IUP A;  4N9P A;  3VR4 A;  4IUQ A;  3QOL A;  3HOW B;  2H1E A;  1PDQ A;  5AFW A;  1ENA A;  3MAQ A;  2HDM A;  1LV9 A;  4DGZ A;  3Q23 A;  1EQT A;  4F8M A;  5JPM C;  1RTO A;  1LT3 D;  1RHP A;  2O4X A;  3KBG A;  5EGT A;  5LL6 X;  1QNU A;  1EY8 A;  1RJT A;  1UNS A;  2VXW A;  1H9R A;  3NQI A;  3NTI A;  3M7N A;  3P7J A;  1VCI A;  3K58 A;  2PYK A;  4H44 C;  2I46 A;  1Y1V B;  1PLF A;  5C44 B;  3N6R A;  1WTQ A;  2LMC B;  1GXD C;  1STB A;  2B2Y A;  1RKN A;  3BDC A;  2CW0 D;  4J6H A;  5C0X I;  4C3I G;  4BS9 A;  1EEF D;  4RGN A;  3KUP A;  1EYA A;  2ZXR A;  3VR3 A;  2MUY A;  1D2B A;  2E2J B;  4L63 B;  4A3B B;  3GTM B;  1I6H B;  2L0C A;  1BCP C;  5CGK A;  4RHR A;  2RDG A;  1EY4 A;  4C3J G;  2AQ3 B;  5IOC A;  2E74 C;  1CQV A;  2RSO A;  5I6Y A;  1EYC A;  3K59 A;  2X6G A;  1OXU A;  3KLS A;  2BDN A;  4LK1 C;  4IFD I;  1HXY D;  3GP7 A;  3S17 B;  1JC7 A;  1PZI D;  4KV6 A;  1Q3L A;  1FNU A;  2B8G A;  4ID6 A;  1QB5 D;  1S5F D;  4H0L C;  3A55 A;  4DNT B;  4DAY A;  4XQQ A;  1EYD A;  1LTI D;  4BWG B;  3S1N B;  1SND A;  3IAY A;  5IGE A;  4R8I A;  1OXS C;  4XQN A;  1KAB A;  2JEB I;  1S4Z A;  4AYB B;  1TWH B;  3HRZ C;  3J7A V;  3S1M B;  4CKE A;  2BOS A;  1DM0 B;  2EDG A;  3CQZ B;  5CYU A;  2BE5 C;  3I90 A;  3VR6 A;  1ZEQ X;  3I91 A;  4DN4 M;  4FXG C;  4C2M B;  1L0X B;  4QMG A;  4NKL A;  3HOU B;  5D3D A;  4XT3 B;  4L6T B;  3TN2 A;  1TR5 A;  2G9H D;  2I07 B;  3A8I E;  5EBC A;  2SOB A;  2JE6 I;  3ITP A;  5E4X A;  3S14 B;  3V2T A;  1NUC A;  4FXK C;  4HCS A;  2L9H A;  2J7Z A;  5IGD A;  2R7Z B;  1PFM A;  4IQZ A;  5C0X H;  3BYY B;  4IUV A;  2IW3 A;  3IFD A;  3AU7 A;  1F2Y A;  1SYG A;  5JPN C;  2DNE A;  3VR5 A;  3OPO A;  1EIG A;  4KK7 A;  4RFB A;  3S2H B;  4RGM A;  1TU2 B;  1CTM A;  4RCN A;  2B2U A;  4PMC A;  2K33 A;  2SNM A;  5DAU A;  2WB1 B;  3PUV A;  4ILW A;  3MTS A;  1LTB D;  3ERQ A;  1KDB A;  1FD7 D;  3SDZ A;  4FO2 A;  1FNW A;  1SJE D;  2NB0 A;  1JOK A;  2K5Q A;  1QNK A;  1JOQ A;  2AWN A;  1HUM A;  4XXE A;  2Z4I A;  1MSH A;  2CHB D;  2F0Q A;  4V0B A;  2JA5 B;  5JVH 3;  5C5L A;  1PTO C;  3T56 B;  1Q90 A;  1CA6 A;  1TII D;  1HFN A;  2H4O A;  2Z4H A;  3D31 A;  3JAM E;  3TP5 A;  3U9S A;  2WV6 D;  1GOZ A;  1B53 A;  1A3V A;  4X3S A;  4KHV A;  1HA5 A;  1PFB A;  2PCF B;  2F0V A;  1RDP D;  3TP8 A;  3AB9 A;  1V1P A;  5C4X B;  1SYE A;  2RDH A;  1V1O A;  5KND A;  2NBF A;  1IYU A;  4KHZ A;  5IOD A;  4B08 A;  1WVL A;  1TWA B;  2B2T A;  2FIN B;  1YNN C;  1BO0 A;  2LKV A;  2F0I A;  3A56 A;  5CBE E;  2XNA C;  4QUC A;  1QG7 A;  1KTK A;  2F0M A;  1C48 A;  1CZG A;  1PTO B;  1AFP A;  3AMU A;  5KRU A;  1EWC A;  1O78 A;  4RGO S;  1G2T A;  5C4Z A;  2HCC A;  4MHE A;  2XN9 C;  3TME A;  4G7O C;  3TDQ A;  1VDZ A;  3J81 E;  2D62 A;  1GJX A;  1BNZ A;  3BVG A;  4ZK9 B;  2LFN A;  4OIK A;  1SAP A;  1TY2 A;  1XYI A;  2DN8 A;  4LAA A;  4DFA A;  4RGT A;  2E75 C;  1O7L A;  2A74 C;  5D14 A;  1DCZ A;  2A68 D;  2NVX B;  1VF7 A;  5CV4 A;  1SXT A;  3T4A C;  1TY0 A;  1CI3 M;  5I9O A;  1E2W A;  4A3F B;  1C8C A;  2F0N A;  3N52 A;  2R92 B;  5COR A;  3K0Y A;  1CK1 A;  5EPL A;  1BF4 A;  4KTA A;  1JIC A;  4FP5 D;  1SNQ A;  1LTS D;  2OEO A;  2DY7 A;  3KBX A;  1U4L A;  1F9R A;  2A6H D;  2PW7 A;  3RZD B;  4CJ2 C;  1LT5 D;  5JAV A;  3WOE A;  5EJW A;  3C46 A;  2KCC A;  1VMC A;  3GTP B;  2R93 B;  1BOS A;  4KD4 A;  4OGQ C;  4F88 A;  1WD0 A;  2EPB A;  3BVM A;  2IX0 A;  2NVQ B;  3LX0 A;  2O2L D;  2E2H B;  2F0W A;  1T5E A;  4C3H G;  2RDF A;  1U4P A;  1B9M A;  4Q5V A;  4TRD A;  2EXZ A;  3PIO 3;  3L3O C;  4Y7N B;  3DEO A;  4DNR B;  1A2T A;  2F0P A;  4XDX A;  3J80 E;  4RCO A;  4C3I B;  2ZT9 C;  3MVV A;  4A3J B;  1JWM D;  4I65 A;  3H91 A;  4DXG A;  3P20 A;  2XWB B;  4XTC S;  2IJ0 A;  4CBV A;  4DF7 A;  1LAB A;  4FNF A;  3OOC A;  2JA7 B;  5M3M B;  1F2Z A;  1EIH A;  2XWJ B;  3TP7 A;  4XT1 B;  4IUU A;  2EOT A;  4X3U A;  1JOO A;  1HTL D;  1I4X A;  1TWC B;  4ZUI A;  1EY0 A;  1KDA A;  2CW0 C;  3LWU A;  4C3J B;  4ZYS A;  2DNC A;  2Q8I B;  1GUO A;  3SR1 A;  1PXU A;  5C0X G;  1SFO B;  1TQO A;  3DWA A;  3PUY A;  2ICI A;  4HCE A;  5KGU A;  1UUP A;  4PMW A;  4X3T A;  2F0L A;  1IW7 C;  2M9V A;  2NYZ D;  1Y1W B;  1ZYR C;  2RSN A;  1KNE A;  1TT2 A;  3MXP A;  5EPK A;  1SE2 A;  2FMC A;  1ILQ A;  1F9S A;  1HCZ A;  3IL8 A;  4KY6 A;  1YNJ C;  4K8J A;  3D3R A;  3LWE A;  4ZAI A;  4S3S A;  3EJI A;  3MEH A;  3A8K E;  4O42 A;  4IFD G;  2D5D A;  5FO9 B;  1QJO A;  2EJM A;  1WTO A;  2IPK D;  4GZY C;  4WRD A;  1NAP A;  3E0J A;  5IIF A;  5K36 G;  1BBX C;  1WD1 A;  3P75 A;  4X3K A;  1X32 A;  1MBY A;  4IFD J;  1U4R A;  2M00 A;  2CQA A;  3D8G A;  1PRT D;  3V96 A;  1SMY D;  2K28 A;  3X3M A;  1JOR A;  1R9T B;  1CHP D;  3DWQ A;  3G6J B;  4KJN A;  4U68 A;  3UI2 A;  2IT1 A;  3RUZ A;  1LTG D;  3S1R B;  4C1N K;  4J1M A;  1WTP A;  1H9S B;  1IKL A;  4IUN A;  4FVM A;  2K5W A;  2F3W A;  3A7L A;  1DD2 A;  2K1B A;  1GHJ A;  1I50 B;  1UEA B;  1O7Y A;  1CA5 A;  2LS0 1;  4K2L A;  1ROD A;  1B50 A;  3M85 A;  1ESR A;  2BCO A;  3MXU A;  3BDO A;  4I7Z C;  1LTR D;  2X69 A;  2FMM A;  2M2L A;  4F87 A;  4NMZ A;  4OIJ A;  4PQX A;  3RLF A;  1STA A;  2EY5 A;  3C1F A;  3KLS X;  1L0Y B;  5J22 A;  5FK9 C;  5EKK A;  4ODG A;  4FF2 A;  4XIG S;  4DU9 A;  1SNP A;  3GD7 A;  5DEH A;  1BCP F;  1D5M C;  2AWO A;  2FHT A;  5T1G A;  3OMC A;  1I4H A;  3OIQ A;  4KD3 A;  3HZX A;  1EWH A;  1FYC A;  1PYW D;  2KVM A;  1F9P A;  2MP1 A;  1U9R A;  2B2W C;  1AP0 A;  1S5D D;  4IN3 A;  3BS1 A;  2KJX A;  5G3L F;  3O13 A;  4MIU A;  4IUR A;  2L4N A;  2F0J A;  3FDT A;  2PZW A;  3X3N A;  2EYO A;  3FMC A;  1I4G A;  1Z7T A;  3GTQ B;  3CKI B;  2K01 A;  1Q12 A;  5C5M A;  1F77 A;  1BCP B;  5EKI A;  4A3D B;  2XIW A;  5EQ0 A;  2EYP A;  2PZU A;  3VYU A;  1Y69 U;  2A73 B;  4Q0F A;  3QJY A;  1I6V C;  2VNU D;  5CR3 A;  4EGV A;  3DMU A;  1CQF A;  3SHL A;  5M5X B;  1BR9 A;  2IX1 A;  4A93 B;  4K8I A;  3PUZ A;  1JR0 D;  1GUT A;  2F0G A;  3I4N B;  1HFG A;  3K5L A;  1XXG A;  5ISR A;  2KUM A;  3GO5 A;  2XRS D;  4FYD A;  4KY5 A;  4OL7 A;  3RD4 A;  3ERO A;  1HUN A;  1MD2 D;  3SE0 A;  3HG9 A;  4XYQ A;  1OXX K;  1EQV A;  2KEE A;  1XWE A;  2GA4 B;  4IZ8 A;  2BA1 A;  1R4P B;  2EY6 A;  5ELF A;  2F0D A;  4OHJ A;  4IFD H;  5C4J B;  1ZXT A;  2A68 C;  3K6O A;  1GUN A;  1KDC A;  3BVZ A;  2HUG A;  5IT9 L;  5JOB A;  2HQE A;  4N9T A;  2BA0 A;  3FVQ A;  2JXM B;  1S5C D;  4WFN 3;  5K36 H;  3SK8 A;  1MGS A;  4UDU C;  5DM6 3;  3I73 A;  1G2S A;  4DAP A;  3Q6S A;  5G3L D;  4CJ1 B;  3ND8 A;  4HN7 A;  2D2C C;  2MJ8 A;  3NE5 B;  3HOX B;  4BA1 I;  5A2Q L;  4ZRZ A;  4C3H B;  1IYV A;  4DAV A;  3RZO B;  4QCL A;  3HOY B;  4PMB A;  2QIL A;  1SYC A;  1PTO F;  2NTS A;  2B2Y C;  1DYQ A;  2B2V A;  2B39 A;  4NP5 A;  3IFT A;  4PNY A;  3H3V C;  2HDL A;  2BE5 D;  2K04 A;  4G7H C;  2E2D C;  2J0T D;  4OO1 I;  2MHV A;  1G91 A;  2NVT B;  1DOM A;  1SNC A;  2HCI A;  3R8B A;  5I2X A;  2QKI C;  1G29 1;  1M8A A;  3EFX D;  3G7L A;  5IGB A;  1SNO A;  1E2V A;  4LJZ C;  3TBI B;  4HSP A;  2J4X A;  1SE4 A;  3TZD A;  1DXM A;  2EYH A;  1EOT A;  1BUV T;  2PNR C;  3DUZ A;  2EY2 A;  3FKI B;  4BY1 B;  3HEJ A;  4FF3 A;  1GUG A;  1TWF B;  2KED A;  3CHB D;  2ZXP A;  3URY A;  2IX3 A;  5A35 A;  3S16 B;  4KMU C;  3C2P A;  5FLX L;  3E5S A;  3GQB A;  5E3F A;  2JSO A;  3S2D B;  5ELE A;  1OXV A;  4A3E B;  2ZXO A;  1G6Z A;  2F0O A;  2WP8 J;  3S15 B;  4MN3 A;  2EYL A;  3ZYY X;  2OT2 A;  3H94 A;  1TS4 A;  2A69 C;  3DHQ A;  4CJ0 B;  3MC0 B;  4BBS B;  2AUJ D;  4PV1 C;  4CHT B;  2Z8L A;  1A3U A;  3NTH A;  3VA7 A;  3PUX A;  1IL8 A;  2L55 A;  5HUR A;  1CHQ D;  1EY7 A;  2JA8 B;  3PMF A;  2NTT A;  3HGB A;  1BDO A;  2A6E C;  4BA2 I;  2L12 A;  2EVB A;  1SYB A;  3BDL A;  1PTO D;  3OMG A;  4KI0 A;  1BQQ T;  3K57 A;  3FPU B;  5EKL A;  3HOZ B;  1TS5 A;  1ET6 A;  1LT4 D;  4L8J A;  1O80 A;  3D4D A;  2JA6 B;  3QG1 A;  4WJW A;  3M4Y A;  5ELD A;  4K6L A;  2EZV A;  3M4O B;  1KNA A;  4OO1 H;  3GV3 A;  2NN6 I;  2FJ2 A;  4H7B A;  1HRJ A;  1PRT C;  3S9W A;  1QOH A;  1QCB D;  2ID0 A;  1WCM B;  5TSS A;  1SMY C;  2B8F A;  3I72 A;  1TVX A;  4EVO A;  4CKB A;  3KK7 A;  3P1H A;  3VR2 A;  5IGC A;  2EYJ A;  5I2Y A;  3PO2 B;  1BXT A;  4F7X A;  2QEJ C;  1YNN D;  3K7A B;  1X3Q A;  2B2U C;  3MFG A;  2WKC A;  3R2I A;  2G9D A;  5M3F B;  3OW7 A;  3I70 A;  1AEX A;  4EQP A;  4K14 A;  4ZKC B;  5C4H A;  4P2C B;  4HSV A;  4TQU S;  1B2T A;  2EE1 A;  1XTC D;  2PZT A;  2JP1 A;  1DON A;  1T5X D;  1HTP A;  2D9U A;  2KCN A;  1STE A;  3M7G A;  1NR4 A;  4DK0 A;  3V05 A;  1SBB B;  3PUW A;  3MHB A;  1PFN A;  3NBH A;  5CV6 A;  4DXF A;  1EEI D;  5FO7 B;  1FNV A;  1Q8I A;  2PQE A;  4K5W A;  4TKO B;  3NWT A;  1WTW A;  5KIX A;  3D4R A;  4BBR B;  4HAE A;  2DY8 A;  4RKB A;  1PZJ D;  1EZ6 A;  5IGF A;  1Q1B A;  2PO4 A;  5C3W A;  2NZ1 D;  3W2D A;  2WII B;  1CM9 A;  2KOL A;  2XRQ D;  3BYT B;  3RMH A;  3L9A X;  3DEP A;  1IHZ A;  3NTK A;  1SYF A;  5DNF A;  3BG3 A;  4ABN A;  5E1F A;  4KKS A;  3BZD B;  1E2Z A;  2B2T C;  5KYI A;  2PPB C;  1O7Z A;  4H13 C;  1KLG D;  3FPP A;  3ONA B;  1ILP A;  2EYF A;  2R3Z A;  4ULL A;  1VF5 C;  1CT1 D;  3OWF A;  2AQ2 B;  4QB4 A;  1MI2 A;  3NUC A;  5LL6 S;  2EJG C;  3I8Z A;  3WDN A;  4U67 3;  3Q0A A;  2XVS A;  1LTA D;  1G8Z D;  4RH6 A;  1JE4 A;  2F4I A;  3FEW X;  1TKW B;  2K05 A;  3GTG B;  1V1P B;  2NWG A;  4QUF A;  5BN5 A;  5CC4 A;  1FGB D;  5M5W B;  1LLR D;  3QOJ A;  2CVR A;  2VUM B;  3QIA A;  1SNM A;  1B1Z A;  4UAI A;  1PMR A;  4V19 0;  4RWS C;  3H0G B;  3E6Z X;  1B4O A;  5JEA H;  3M3Y B;  2MPM A;  2WAQ B;  4HMJ A;  1CFM A;  1ONL A;  4QIW B;  1STH A;  2WIN B;  1JWS D;  1CZW A;  1UAP A;  1EFI D;  1X3P A;  2YU9 B;  3DWP A;  1GHK A;  1TS2 A;  2KA7 A;  1IW7 D;  1D6E C;  3NHH A;  2MGS A;  1ZYR D;  5KNB A;  3SVM A;  1DZ1 A;  4KKU A;  1H9K A;  1EY5 A;  2XSC A;  3H09 A;  2QF7 A;  1D5X C;  1II3 A;  2WAC A;  3SK6 A;  2LY7 A;  2F0S A;  3OWE B;  4BY7 B;  3QB3 A;  1YNJ D;  3H6M A;  4G57 A;  2E76 C;  4K5X A;  1MSG A;  3GTK B;  2Q8T A;  3HP3 A;  2N88 A;  4ZKB B;  2SDF A;  3TSS A;  2AUK A;  3HS0 C;  2QCP X;  1AZP A;  5FKA C;  1EZ8 A;  4ZUJ A;  3R3O A;  5KNC A;  1NSN S;  2F0F A;  3A54 A;  4B9W A;  1E0B A;  4TSS A;  4XYO A;  1K83 B;  1GUW A;  1AW7 A;  3NBI A;  1SSO A;  3I4L A;  1H9J A;  4OO1 G;  3SK4 A;  3NQT A;  2ENB A;  1SJH D;  3J7A F;  5FO8 B;  1IKM A;  5C3X A;  4A3K B;  1HHV A;  1QIL A;  1ICW A;  3GV6 A;  3J7Y W;  2F3V A;  2WKD A;  2O5J C;  3PV0 A;  5D65 A;  3L7Z C;  1ML0 D;  1NCV A;  5DM7 3;  1LTT D;  3KLR A;  2K6A A;  3D6W A;  3QO2 A;  5CV5 A;  1JWU D;  5CV9 A;  1Q1E A;  1V43 A;  1PTO H;  1PZK D;  2PW5 A;  5J1Z A;  2Q8R E;  2F0U A;  4RAU C;  1D1I A;  1NR2 A;  2F1M A;  2TMP A;  5I4D A;  4KJO A;  1DJR D;  3LNN A;  1QWY A;  3PIP 3;  3FRP B;  4G4K A;  5IT9 E;  1KLU D;  5I6W A;  1BCP D;  3QWN A;  5CBA E;  1C4Q A;  1SEB D;  1U4M A;  3C1E A;  3EA6 A;  4B9X A;  1JCK B;  4FF1 A;  3OSO A;  4KN7 C;  1K8O A;  3Q22 A;  4K5V A;  1KAA A;  2NVY B;  5A2Q E;  3DXJ C;  1LAC A;  4CKC A;  3MA2 B;  2Z1C A;  1Y8N B;  3HOV B;  2F0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...