3J7YW

Structure of the large ribosomal subunit from human mitochondria
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
107
structure length
107
Chain Sequence
LGGKSSGRRQGIKKMEGHYVHAGNIIATQRHFRWHPGAHVGVGKNKCLYALEEGIVRYTKEVYVPHPRNTEAVDLITRLPKGAVLYKTFVHVVPAKPEGTFKLVAML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
total genus 18
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01016 Ribosomal_L27 Ribosomal L27 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1030 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3j7yW00
4V190 3J7YW
chains in the Genus database with same CATH superfamily
2FINB 4X64L 5C4JB 5M3MG 4X65Q 3CCLA 4IJLA 2MGSA 2VUMH 3J7YW 4FF3A 2E2IB 4DFAA 1W6JA 2Z6BA 2EYJA 4RGMA 5J3BA 4A3LH 2MO0A 3HOZB 2OT2A 2N3SA 1QVCA 1GHKA 1EFWA 3HP3A 2E2JH 2QCPX 2G9DA 2NZHA 4DK3C 1VQGA 2GN5A 3K6OA 4BY7H 4K2KA 3I70A 1G2SA 1FNUA 1PVOA 2K33A 1I6HH 2UUBQ 2MO1A 2NVYB 1UE5A 2NN6H 4PZ7A 3ERQA 4N9PA 5CGKA 1IKLA 3D6CA 3K59A 4HIMA 4LF7L 5JJKA 3PF5A 3M3YB 5IYBG 1IL8A 4DV2L 3VA7A 3R8BA 2HHHL 3KFUA 4PQXA 1PZID 1V9PA 1ZXTA 1DONA 3JAMi 1Q1BA 2QF7A 3HOXG 2KVMA 4OO1I 3MFGA 4C3IB 2IX1A 1SLJA 2EYHA 2Z4HA 3K80C 3R93A 3NBHB 5I6WA 2D0PA 1AFPA 5IT9E 1QB5D 3K8AA 4O1NA 4IUTA 2IY5B 4IURA 2L11A 4NW2A 1D5ZC 1QOHA 4KK7A 5IGCA 4L63B 5KIXA 1AZQA 3K5MA 3HGBA 4IOCA 1IL2A 1JE4A 5CV6A 5IYCH 1UAPA 3E5SA 4OWTB 5IGEA 1RD9D 1SNMA 3J80c 2B8GA 1U5KA 5M5WB 3BDCA 1K0SA 4IPGA 4DK0A 3J81i 2H4OA 4ME3A 3K0XA 1UEBA 3CC4A 4A93G 2EYPA 1EQVA 2CCZA 3M4YA 1N33L 1SNCA 3W2DA 1CI3M 4C1NI 4LAAA 4CKEA 3DWPA 1EU4A 4KKSA 5FLXE 2D2CC 3RNUA 2A6EC 1CSPA 2FXQA 2HD3A 2WP8J 3TP8A 5DM73 2D9UA 3W1BA 1WCMG 2HDMA 2VZAA 1PH7A 2EE1A 3FEWX 3VA5A 1CK1A 4A3BB 3U9OA 5C44H 2BE5C 2RF4A 1X3FA 1B70B 3TSSA 1EUJA 4MNOA 3S15H 3OHXC 4C3JG 2KHJA 2ZTCA 3ERSX 1WTQA 4DAYA 3GV6A 2IHFA 1EOVA 1EU3A 5E4XA 1P8LA 4JI3Q 3S14H 1JORA 3PUVA 3I4NH 2TMPA 1XNRL 2VB2X 2WAQB 4EQNA 3M85A 1XNQL 1MI2A 3I4OA 1MKHA 4PMBA 4P2CB 1ENAA 4BA1I 4DGZA 4NP5A 2JXMB 3CRKC 4DF7A 4LUVA 1ASZA 4U673 4B3TL 2QW7A 2XRQD 1DGSA 1HA5A 1K28A 2MFIA 1OXVA 4DV4Q 2KUMA 1JOQA 2UXCL 1YJWA 4DR1Q 1LO5D 4H0LC 2WB1B 1SN8A 2N49A 3D4WA 1EIYB 1JJGA 1CKNA 2I5MX 1Q7YC 1H9SB 2F0LA 3ICEA 2CQAA 2V4DA 3NEMA 4J1MA 4A3KG 2NYZD 1WI5A 1Y1WB 4XT3B 2CFMA 1NCVA 4IPCA 3GTQH 1LTID 1C4QA 1KTKA 2RKSA 2ZJPA 2JJQA 1B8AA 4NXNL 1PFNA 1O80A 2QEXA 3N6RA 3L2PA 3BYTB 1E1OA 1X3EA 4BY1B 1G8ZD 4B9XA 2EYOA 1STHA 2GA4B 1HNXQ 2UUCQ 4Y7NH 1K8GA 1Q8KA 1TS5A 3OIQA 2K5HA 4C3HG 3S2DB 2K4KA 4ZCKA 5C4JH 4A3GB 2K5NA 1PZJD 3GTMB 5L37A 2E2IH 1U9RA 1PH2A 1D8LA 2SNSA 1EFID 3HOZH 2A6HC 2DY8A 1CFMA 4RFBA 4MHEA 4LF4L 4PNYA 3M9BA 1KL9A 3H3VI 4QIWE 1N36Q 1CHPD 1FGUA 2R7DA 2RSOA 4LFAQ 4LF6L 5IP9H 1SYFA 3NENA 2PQAA 4XT1B 3T1HQ 1O7ZA 2ATWA 1LTRD 3MTSA 4F87A 1A2TA 3M3YH 3O13A 3ZJYC 1GOZA 2EVBA 1L1OB 2K32A 3U9SA 3S1MB 1GKHA 1A8VA 3J80E 4NKLA 1PV4A 3V2TA 2CKZB 1VS0A 3C2PA 4RMFA 4DR6L 3RZDB 4Q0FA 4C3IH 3QR8A 1EY8A 3CQZB 3FPPA 4DR2Q 4RCOA 3ULLA 5LHY1 2B2TA 4DXGA 3JAMc 1RTNA 3GTJB 3PCOB 4ZRZA 2F52A 3H6MA 1LTGD 3VR3A 4F88A 2K5VA 1LTTD 1V1QA 1F2MA 2ZTEA 2L9HA 2F0SA 4LK1C 2UXBL 2UUAQ 2L4NA 2AHOB 1Y1VH 3J81j 4DV1Q 1JWMD 1EQTA 2Q8RE 3PSIA 3IRBA 4HIKA 3NE5B 3EFXD 3J81L 1IHZA 1EL0A 5LMNQ 4KKTA 4ME5A 2R6GA 1AW7A 4DR4Q 5M5WH 5IWAL 2A6ED 4WJ3M 5C4ZA 2J7ZA 4KTAA 1STGA 3BVZA 3ND9A 4H44C 5IODA 1WTXA 1SXTA 1WOCA 1YHQA 2AUKA 3HOUG 2IX0A 4OX9Q 1TIID 4IO9A 5DM63 2BE5D 4ODGA 1TT2A 3KF8B 5CC4A 4A3DG 4C56C 2EQSA 4HSPA 3V05A 1FNWA 3PO2G 3U50C 1HZ9A 3RLFA 3HOYG 1GHJA 1HTPA 3CCQA 2B2YA 2AWNA 2JA5G 1E22A 2Y0SB 2F0FA 3MXUA 3CCEA 1IW7C 1X6OA 2Y0SE 4A3BH 2F1MA 4HAEA 5JJLA 2AKWB 2R93B 3M4QA 3LGJA 1AE3A 1FD7D 1NR4A 3BZKA 2PQEA 3ZYYX 2IWHA 3OOCA 1E3PA 3UDFA 1XPOA 3M7NA 1AH9A 1HFGA 2K5QA 5EKLA 3DM3A 1X9NA 5CBEE 1YNJC 2XWBB 1DYQA 3FRPB 5A2QL 5JJZA 2E5LL 4IUPA 4AYBG 4KLKA 3EROA 4DR5Q 1K8AC 2YYZA 3CCSA 3KBGA 2E2DC 1SRUA 2PNRC 5IGFA 4LFBQ 2FHTA 1HXYD 1ZYRC 4OIJA 4UP9A 2M00A 3HOWB 1IBKL 3FDTA 1PTOB 4JYAL 4OL7A 1GO3E 2N88A 1G291 1VQNA 3TZUA 3K57A 1SYCA 1GUOA 4NPSA 5M3MB 2JSOA 4V190 1LLRD 1IBMQ 1ET6A 3TBIB 5C3WA 1T5XD 1EY9A 1Y1WH 2PW5A 1VDZA 3OMCA 3S1RB 1XTDA 1X55A 4CJ0B 3NP8A 3TS0A 1FJGL 1QUQB 4GKJL 2K6AA 4BBRG 1KAWA 1Z47A 1EQQA 5I4DA 1S5FD 4IUVA 1TWAB 2A6HD 4LF7Q 1EY7A 1VQDA 4MIUA 4BY1H 2UXDL 4GNXB 4DV2Q 3WDNA 2HHHQ 3S16B 3HKSA 1RDPD 1JB3A 2L55A 4WORA 2NB0A 1TR5A 3S2DH 1KRTA 4A3GH 1SYDA 4P73A 3TP6A 2Z6KC 1W2BA 4LUZA 3GTMH 1EEID 2Q2HA 1GUNA 4DA2A 4OEMB 4GS3A 1TWGB 3HOXB 2EZVA 2OQ0A 3A74A 1U4PA 5HGQA 3FMCA 4RKBA 2LXKA 3I56A 1BCPC 4QL5A 2F0QA 3BG3A 1SE2A 3BVGA 4P72A 2O4XA 3BVMA 1JT8A 1XPUA 3QG1A 2EXZA 4ZAIA 4IOAA 1E0BA 3GTGB 2Q2UA 1SNPA 4GN5A 2IJ0A 3TZDA 2PI2A 1ONLA 4A75A 2N8NA 3S1MH 1UWVA 5AJ3Q 3TN2A 2GVBA 4JBMA 3RLNA 1JE5A 4PMCA 2ZM6Q 1R4QB 4ILWA 1D1KA 3RZDH 5M3FG 4X3SA 2JQOA 5KYIA 2DNEA 1Q86C 3CQZH 4ZUIA 1GD7A 3MEHA 5T1IA 3GTJH 1CA6A 4BXXG 4A93B 2FFKB 3QJYA 1TS4A 5ELDA 4IFDG 2AQ1B 4ZK9B 3VR2A 1G91A 1N9WA 1ICFB 5EGTA 1CKOA 1LM0A 4KHZA 5FLMG 4DV5L 1TY2A 5EBDA 1SYEA 4K6LA 3A54A 1WCMB 3J7AV 4LWCA 2JYOA 4K0KL 3BJUA 1OXXK 2BCOA 5EPLA 3F1ZA 3EJIA 4JI7L 2B63B 4KHPL 1LTSD 1TY0A 2ES2A 5IYDG 1YI2A 4C3JB 5M5YB 1BO0A 3GP7A 1B7YB 3W5OA 1WTRA 1NJIC 4G4KA 1STYA 4LUOA 3FKIG 4ZKCB 4RCNA 5FLXL 4A3EG 1Y8OB 2CHBD 1TWFB 2R61A 3FVQA 3QOLA 4TRDA 1SROA 5KNBA 5E1FA 2J4XA 2EYFA 4B3TQ 1BDOA 2SNMA 3KDFA 3BYYB 2L12A 4EQ5A 4B3RQ 5LMUQ 2RQXA 2UXCQ 2F4VL 1CT1D 2JA7G 3L3OC 1XXGA 4HJ5A 5T1GA 5FJ8H 1BKBA 2JK8A 3NPPA 2MHVA 2R93H 1K73C 2WV6D 2G9HD 1X56A 2QEJC 4K2LA 5C4XB 5J39A 5IY0A 2CVRA 2A5HA 4DV0Q 1ZYRD 4XDXA 5JOBA 3H0GG 1LT4D 3S24A 1RF2D 4FVMA 1CM9A 1N32L 4A3KB 3RN5A 2ENBA 2UU9L 2HQLA 1LABA 3KK7A 1PH6A 2KHIA 4LF9Q 5E3FA 1WD0A 2LFNA 2PPBC 5K36G 1YZ6A 1IYJB 1DCZA 3QIAA 4EVOA 4A3CG 2JA6G 1CKNB 3MXGA 3HOWH 3KF6A 3M4PA 1PTOH 3H15A 4AIMA 3HOVG 2DUDA 4JI6Q 2ZTDA 4RAUC 4JI4Q 1EYGA 1KNEA 1PYSB 1B44D 2B29A 4ULLA 4RHSA 4HJ8A 4IN3A 4XXEA 2B2YC 5M3MH 3I8ZA 1KAAA 4QMGA 1F2YA 1F9QA 2EYLA 5DNFA 4LF4Q 3CRLC 2VUMG 1KC8C 2A68C 4BWGB 4QGUA 3S1RH 5EAYA 2BA0A 1QCBD 4F8MA 3NQTA 3U4VA 3EIVA 1TWAH 4KY5A 2E2HB 5EPKA 5HY6A 1NNXA 3S16H 4F7XA 5ISRA 5JPNC 1O78A 2KQ3A 3CCUA 4JI1L 3PUYA 1EZ6A 2YTYA 2XWJB 2F0WA 4WJ4A 4DAVA 1FNVA 1TWGH 3HOXH 1DOKA 4DR3L 3MFYA 3OTOL 1D5XC 2PQAB 1RIPA 1YJNA 1H95A 4R1JA 2B2WA 2PZTA 2C5CA 3MEFA 2QDLA 1PFMA 2G5DA 1HQMC 1Q1EA 2EJGC 4DK1A 1E2ZA 3T1YL 4POGA 1A63A 2RCNA 4JI5Q 3X3NA 5CV9A 2NZOA 3GTGH 5I6YA 2B2UC 1EWCA 1C9OA 1UEAB 1V1PB 1OXTA 5EKIA 1I4XA 1R9TB 1PLFA 3L9AX 1QJOA 3UDXA 4ZKBB 5IYCG 1HZBA 4IFDJ 2EOTA 3UDGA 3D8GA 3I4MG 4B3SL 2DY7A 2D5DA 3ONAB 3I2ZA 1SR3A 4RGOS 1A3TA 3CD6A 3HOUB 4PV1C 3OSOA 4OHJA 2R92G 1GM5A 3D4RA 4A93H 1F2ZA 5DAUA 2KCMA 4A3DB 3CC2A 4DR7Q 2KCTA 1HZAA 3E9IA 3TEHB 1PRTD 1WD1A 1AZPA 1WCMH 2PZWA 3IL8A 5GROA 1VQJA 5DEHA 4WFN3 4M1UB 5C6AA 3MXPA 2NWGA 3VYUA 1ICWA 2B63H 2IW3A 1HUMA 4H7BA 4IJHA 3VDYA 1XMOL 4C3JH 4JG2A 5M5YH 4JI2L 3KYHC 4GOPA 4ZQ3A 2JP1A 3QB3A 2F0UA 2E5LQ 1EY0A 1D1IA 1KIXA 5C4HA 4R8NA 1F9RA 1NTGA 2WAQE 1TWFH 2Z6KA 2A8VA 1YNNC 1QNUA 1CHQD 1HH2P 1SMYD 3EQLC 4AYBB 2I0QA 4IFDI 2F0IA 1E24A 1YEZA 2VXWA 3VYRA 3CC7A 1XJVA 2XVSA 4X6AH 1RL2A 3NTKA 1VQOA 3E6ZX 4N8X1 3SR1A 4GN3B 4R4IA 1A62A 4CGYB 4DV6L 3G7LA 4HN7A 1JICA 2HIVA 3J7A5 1IKMA 4X62L 4NB3A 4LJZC 4QJFA 3ITPA 2QA4A 1ENFA 2WB1E 4GZYC 5J22A 1AE2A 5C4XH 1S5ED 4XYOA 2M9VA 5ELBA 2WKCA 1LT6D 2HCCA 4FXKC 4RGNA 5I9PA 1NAPA 4EX5A 2JEBI 4A3KH 4DUZL 1WTOA 1RODA 1FJGQ 1VQ6A 3NXWA 4P75A 2F03A 2WINB 1SE3A 2NBFA 4NXML 3SK8A 4RHRA 4BBRB 1X3GA 2EDGA 3G4SA 2A68D 4O2DA 3K58A 3SEBA 2DGYA 4POFA 2VQEQ 3L7ZC 1PRTF 5G3LD 4DNIA 5GAGC 4YY3L 1LTLA 1EQRA 2CW0C 1A3VA 2OXPA 1MHWC 4X66L 5BR8L 1FGBD 3HKZB 3FPUB 1PDQA 1JJCB 3H94A 3HKZE 5FKAC 1BNZA 1B50A 3QWNA 5E4WC 2IL8A 3AEVA 1NE3A 5EPJA 4DV3Q 3DM1A 3LNNA 5FO7B 3K81C 3URYA 1I94Q 1Q81C 5C3EB 1PXUA 2F3WA 4A3IB 3U4ZA 4X65L 1IZ6A 1J6QA 2NVYH 1S3OA 1K9MC 3Q0AA 1LACA 2K01A 2NZ1D 4DUYQ 1GUWA 1RTOA 4HJ7A 2E2HH 4KD4A 2VY3A 2K75A 1I50B 1GXDC 4NMZA 1QE6A 5CMDA 5IP9G 1PH4A 4LF8Q 1EEFD 4HEDA 1CUKA 4LF5L 2JEAI 1EOTA 4DXFA 4O42A 3EN2A 1M90C 3NBHA 3TMEA 1S5CD 2XRSD 1TU2B 3TQYA 2UUBL 3AFQA 3DHQA 3OWFA 1LV9A 2HIXA 4U68A 3P20A 1HCZA 4A3MB 2PO4A 1TS2A 5M3FB 1A6XA 1HQRD 5ELOA 3UE1A 2KHSA 2A69C 1GUGA 2OQKA 3PIPA 1SYBA 1IBLL 1KLGD 1BF4A 1NBWA 3PQIA 4QB4A 3NHHA 3KBXA 5KNCA 1F9SA 4R4QA 4X3TA 3F2UA 2K05A 1O7YA 2C35B 4UAIA 4CBVA 4L5TA 2ASBA 4K0KQ 1STAA 1R9TH 3MHBA 2NTTA 1BVSA 1Y1VG 4KHPQ 4IQZA 3Q8DA 4GKKQ 2RDHA 4K8JA 5KGUA 1C7YA 3S9WA 2AMCB 4B9WA 3PUXA 4QY7A 1HR0W 4GNXC 3MZ5A 4FNFA 1EYDA 3P1HA 3J81c 4JBWA 2XSCA 3HOUH 4OWXB 5G3LF 5IP7G 4HR7B 1CSQA 2KCCA 2IHEA 2O5JC 1ET9A 3SVMA 3G48A 4CDEC 2VQFL 4A3FB 4A3DH 2PW7A 3E3XA 2ICEC 3K7AB 2I07B 2E75C 4IUUA 1MD2D 3GQBA 4FDBA 1D7QA 1PH3A 4DPGA 3WOEA 1UE1A 1J9OA 1YNND 5JEAH 3A7LA 3NWSA 3GD7A 3BDOA 1AP0A 1YBYA 2B2WC 2WKDA 1K0RA 5EKKA 3IAYA 2RCFA 2JA7B 4AQYL 4A76A 4JBJA 3QO2A 4JI8Q 3FHWA 5JPMC 5EJWA 4A3JG 3RR5A 1UUPA 2F0DA 2KJXA 2BDOA 4DV7Q 1EIFA 4XTCS 2MPMA 3T4AC 3X3MA 3H0GB 3KDFB 4OGQC 2CWAA 1PH5A 3STBC 2R7ZG 1KQSA 1GJXA 4K5VA 4YIJA 1HNZQ 4FF1A 3T51B 1TVXA 2O2LD 4MTKA 5IOCA 3ULJA 4X64Q 1H9SA 1Q8IA 2DJFC 3MXNA 1MJCA 2F0JA 2EXDA 3WOFA 1J5EL 2IPKD 1XX8A 3PO3G 4OO1H 3S1QB 2B2UA 4OWWB 1EY6A 1JOOA 2B3GA 2N78A 4DV4L 1LT5D 4N9TA 5FOBB 1L0XB 4DR1L 2VNUD 1VMPA 1KDCA 3GTOB 3NUCA 1HTLD 1Y14B 2CW0D 3SK5A 1EZ8A 1EWHA 1Y1WG 4JC0A 1SFOB 2OWOA 1CQFA 4BBRH 3MAQA 3DLLA 4GOPC 3A8JE 4PMWA 2E8GA 2OTLA 3BZDB 5JAVA 2PYKA 4JI1Q 1G6ZA 1MGSA 3I91A 4IUNA 1HFNA 4RWSC 4I7ZC 1FYCA 3A0JA 4HMJA 4J15A 3ULPA 1SEBD 5IGDA 1F2LA 1STBA 1K8OA 4A3GG 1U4MA 4KHVA 4JOIC 4YCWA 2OEOA 1HNXL 4UP8A 3JAME 1VQEA 2EPBA 3K7UC 4QUFA 3BS1A 1QILA 1H9KA 5C3EH 4CKBA 4A3IH 4YCUA 1X32A 1SE4A 2GVAA 1MJEA 1KDBA 1WTPA 1L1OA 3WWVA 3KLRA 4K14A 3K5NA 3B6YA 4XQQA 1I50H 2YV5A 2A69D 3TP7A 2F0KA 1S5BD 3S1NB 1RCVD 1N36L 4YWMA 1G6PA 2I5HA 4LFAL 3GTPB 3J80i 1HHVA 1PH1A 4OIKA 5IT9L 4DKAC 3HS0C 1JCKB 4CDDC 1VQBA 1N33Q 1JWSD 1VQIA 3I4MB 3A7AB 4A3MH 5DLQE 1HRJA 5M3FH 1DXMA 3GO5A 2EY5A 1GUTA 3J81E 3FP9A 5C3XA 2Q2TA 2EYMA 1N34L 1VCIA 5M5XB 3TREA 1YJ9A 1STNA 2R92B 1LTBD 4WJWA 4IFDH 1J8IA 3BZCA 2EJMA 5IT9c 3PV0A 1PH8A 3SDZA 5I2XA 2VL6A 4DR2L 1VQAA 2OTJA 3DEPA 4XYQA 4QCLA 3VYTA 3RUZA 1CZWA 1CKMA 4HSVA 3K0YA 5KYLA 1XTCD 1IW7D 1XMOQ 2F0MA 4JI2Q 3KF8A 4YWLA 4G57A 3CP0A 2KBNA 1XNRQ 2UUAL 1W6KA 3E9HA 1MSGA 2I5LX 3Q23A 2PNHA 4CDCC 3Q24A 5IYDH 2B8FA 1T5EA 4HCSA 1XNQQ 1OXUA 1UE7A 4CHTB 2VW9A 2A19A 1YHBA 2M2LA 3S15B 2Z8LA 1ILPA 3UE0A 4A3FH 1JOKA 4Y52H 1YNXA 1JMCA 1YNJD 3K7AH 3OMGA 4TSSA 4DAYB 1AEXA 2HQEA 4K6DA 5ELFA 3OPOA 4JW0A 2K50A 3SE0A 2NVTB 3STBD 5FLXc 4QF4A 1D2BA 4R4TA 4N8FA 1Q3LA 3PIOA 3A5ZB 2LXJA 2Y0SG 1VMCA 1JJ2A 2JA7H 3AFPA 2YTVA 4GN4B 5EBCA 3EA6A 3CF5A 4OONA 1BUVT 3CXCA 1VQPA 4K8IA 3EBEA 5FJ8G 4YWKA 3UDIA 3T56B 4FXGC 4DUZQ 4K5WA 1WTVA 3H0GH 4G7OC 4KN7C 5C0XG 1BCPB 3H3VH 1HR0L 1Z9FA 1X3PA 4B3ML 5FO8B 4KV6A 4NXNQ 1WJJA 1EIGA 1YITA 3CPWA 2NVQB 3I90A 1VF5C 4NXMQ 4TKOB 5LL6S 5JVG3 3G71A 3NWTA 4UDUC 5GAHC 4JK1C 1WTWA 2D0OA 2DNCA 3VYSA 1IYUA 2QGQA 4DR5L 2LMCB 3M7GA 4C3HB 2JA8G 1NMGA 1QVFA 4BBSG 3S1QH 1SAPA 1QVGA 4LFBL 1L0YB 1LTAD 4QUCA 1Y69U 1BBXC 4LF6Q 3AQQA 3GTOH 4A3LG 3F2DA 3I3CA 1CZGA 2RDGA 4HCEA 4GNXA 1HUNA 3ER0A 5GADC 1VQCA 1SFOH 1SJHD 4RKLA 1BCPD 4BY7G 3DWQA 2K04A 4AH6A 1IBML 1SJED 3A56A 3OYYA 4KI0A 1BBUA 4LF5Q 2XIWA 3SK4A 3K5LA 4JI0L 4FYDA 3KUPA 3W3AA 2NN6G 3VR4A 1SSOA 3T13A 5IYBH 2L5TA 4DR6Q 2B2VA 4L5SA 4JCVE 1EWIA 1A0IA 3A55A 2NUCA 3CCMA 3NSWA 4HIDA 1QZHA 2HUGA 3VR6A 2A1AA 2RSNA 4ZUJA 1VQLA 4KD3A 1W3SA 4TQUS 3D4DA 1Q90A 3IKJA 4I7AA 3U58A 1SNQA 3S2HB 3RLOA 2PMZB 3SK6A 2WIIB 2HCIA 1PRTB 5D3DA 3I73A 1LUZA 2PMZE 3M4OB 1RKNA 2TSSA 1IBLQ 2UXBQ 1V8QA 3DEOA 4YHHL 2VB3X 1Z7TA 2WFWA 4RA8A 1ZEQX 3NK9A 4L8JA 2BA1A 1HZCA 3IFTA 3J80L 4L5QA 2XNAC 4GLXA 2F0OA 5IWAQ 3L0OA 1UNSA 1NY4A 1SMXA 4PZ8A 1FR3A 1TKWB 3S1NH 1PMRA 2KENA 1I3QB 5IE8A 3GTPH 4K5XA 2HT1A 3JC66 3KLSX 2BDNA 3N52A 2KCNA 3RD4A 1Y1VB 3G6EA 1DOMA 5JVH3 1G51A 1KHIA 1OTCA 3I4MH 1EY4A 3D31A 3HEJA 4PZ6A 4JBKA 3S17B 2EY2A 2VQFQ 2CQOA 4DN4M 1NSNS 5M5XH 5AJ3L 2ICIA 2YTXA 4DNTB 1VQKA 3PO2B 2R92H 1WFQA 2ZM6L 4UP7A 1EY5A 1SNOA 3P75A 3HOYB 3OWEB 1VF7A 2LY7A 4Q5VA 1BR9A 1XMQL 2JA5B 1KD1C 2F0PA 1QNKA 1QWYA 3Q6SA 3PIP3 2RVLA 1JQYD 1ILQA 1N8RC 1EYAA 1CQVA 4C1NK 3CCJA 2ZXRA 4AQYQ 1U4RA 1JR0D 1S4ZA 1BCPF 2F0GA 1QG7A 5IIFA 2F3VA 4R4OA 5C44G 3DXJC 3BDLA 5CYUA 5ELCA 5D65A 1L1OC 2QKIC 3DWAA 4WRDA 4A3JB 2B63G 1E2WA 1XPRA 1X65A 2VS1A 2JA9A 3I4NG 3GTKB 4AYBE 2R3ZA 2PCFB 4IALA 2R7ZB 3Q22A 4JOIA 4R8IA 4JV5L 1IBKQ 4JYAQ 3SXHA 2BH8A 2NVTH 3J7ZC 1NR2A 3I4LA 3V96A 1TQOA 2K28A 2C9OA 1HNWL 4TVAB 1J5EQ 1FVIA 3E0EA 1RJTA 5C0XJ 4APVA 2A74C 1DOLA 3NTIA 1K3RA 3TS2A 4HIOA 3TDQA 2MP1A 4DK6C 4IPHA 2IX3A 1BBWA 3PO3B 4B3RL 5LMUL 4NDXA 1SYGA 1QZGA 2OF1A 4PG3A 1B53A 5C4XG 3J7AF 4GKJQ 1YIJA 5KEEA 4UPAA 1F9PA 2NVQH 5HGTA 1PA6A 2SOBA 3MXNB 4ID6A 2UXDQ 1B9NA 4DV0L 2X6GA 2IT1A 4LFCL 3KLSA 4IZ8A 1I4QA 2EY1A 3CKIB 4EGVA 1HA6A 3CAMA 1PH9A 3RZOB 5KRUA 3R2IA 3PUZA 2EY6A 3MC0B 2K7VA 2Q8TA 3K5OA 4C3HH 4LF9L 5E7NA 4KMUC 1ENCA 1FL0A 1B4OA 2ALYB 3C3LA 1IXRA 1I5FA 2DN8A 4RG1A 3GTLB 2RHSB 1H9RA 3D0FA 3E0JA 4CKCA 1MBYA 2MQHA 1LT3D 4JI6L 1PYBA 3A8IE 4JI4L 5C0XI 3NTHA 3HOZG 5GQOA 2CWPA 4OXPA 1OXSC 4R4CA 4L6TB 5IGGA 3RN2A 4UY8C 4CJ1B 1A3UA 1A15A 1S72A 1WYDA 4JPBW 4HMIA 4QIWB 1Q12A 3H3VC 2K52A 5LMNW 4KY7A 5D14A 1MIUA 1I4HA 4G7ZC 2V1CC 1K83B 1WTHA 1PTOC 3JAML 5F2DA 3S2HH 1XWEA 1N34Q 2NTSA 4H02A 2F0TA 3M4OH 4C3IG 4GLAC 1V1OA 4J8QA 1NMFA 3PUWA 4FO2A 4HJ9A 4DV5Q 1LYLA 2PI2E 1V1PA 1SNDA 4MTNA 2ZXPA 2AQ2B 2HDLA 3NELA 4FF2A 5A35A 2YU9B 4MN3A 5H1SE 3D3RA 1TWHB 4JI7Q 1I6VC 5C5LA 3KJPA 2BH2A 2N55A 4A4IA 1I3QH 3I7FA 1A2UA 2NN6I 1IYVA 1DD2A 4L5RC 5CV4A 1DM0B 4DAPA 1I4RA 5ELNA 4DAMA 4JI5L 5JJIA 1U0LA 2X6LA 3KLWA 1ESRA 2XTIA 3AMUA 3S17H 2B39A 3FKIB 1KRSA 5IP7H 1X54A 4A3EB 5CORA 3PO2H 1VQ4A 2B2VC 5CV8A 1O7IA 5KNDA 3LX0A 5CV5A 3HOYH 3SHLA 3R2TA 4FP5D 4P71A 3CMAA 2F4VQ 4EQPA 4EQOA 1R4PB 1E7ZA 2JA5H 1TWCB 5K5PA 3NBIA 1BQQT 4R9WA 1VQ9A 2ZT9C 4IPDA 2SEBD 3H91A 1ZKOA 3DMUA 2J0TD 2Q2IA 1VQMA 4O0AA 2RA4A 2A73B 1GUSA 4J6HA 4C2MB 3C1FA 4A3BG 3GV3A 1B2TA 4DR7L 1S5DD 2MJ8A 1C48A 4S3SA 4BA2I 5ELEA 5JEAG 3LWEA 1N32Q 1STEA 2UU9Q 4A3JH 4RH6A 2LS01 1HR0Q 3HRZC 4B3MQ 2EJFC 5BN4A 2WACA 3C1EA 4LW1A 5GAEC 3F2BA 3GTKH 2E74C 4JI3L 2WAQG 2Z4IA 3CCVA 2K03A 2R7ZH 4P74A 3KOJA 2I46A 1VQ8A 1I4PA 1HPCA 1YVCA 2Q8IB 5TSSA 2JA6B 3OIPA 2NVXB 5EQ0A 2JE6I 1I4GA 4ZYSA 3PF4A 2F4IA 1KNAA 3AB9A 3HOVB 3CU7A 4BS9A 2F0EA 2FMMA 3W1GA 4FXDA 1GVPA 2FJ2A 2WB1G 4JVZA 4KY6A 1PYWD 3PIO3 2JA8B 3PO3H 2MUYA 4BBSB 3HZXA 2KEDA 5J1ZA 2VUMB 1PHJA 3KF6B 4OO1G 1KLUD 4LNQA 4HJAA 5IGBA 5I9OA 2KECA 2BOSA 2QDBA 2F0HA 2ZJRA 3RMHA 1F77A 3A8KE 3F2CA 2E2JB 2LSSA 1Y8NB 4JI0Q 3QOJA 2JN4A 2P5ZX 3A5UA 4LMQD 4BY7B 1VQ5A 3MWYW 4CJ2C 3BU2A 3CMEA 1I6HB 1TXYA 3I72A 3RZOH 1JC7A 3PMFA 4IUQA 4BY1G 1KXLA 4E6IA 2ZXOA 4DU9A 4DR3Q 3TP5A 3OTOQ 2KOLA 1B9MA 1UE6A 1B3QA 2X69A 3GTLH 1B1ZA 2KEEA 4H13C 3PGZA 2UUCL 1CA5A 3MVVA 1E1TA 4YHHQ 4DNRB 2AWOA 2XN9C 3CW2C 5FK9C 3T1YQ 3HKZG 2VQEL 1Y8PB 1PTOD 3UI2A 1H9MA 3R3OA 2OCEA 3OW7A 1BOSA 2Z1CA 5COYA 2K5DA 1JWUD 2EIFA 3TRZA 1D5MC 5C3EG 2K1BA 5I2YA 4A3IG 2ID0A 3T53B 1SE8A 4OELB 2F3IA 4DV3L 1I94L 1Q46A 5BN3A 4B3SQ 1P16A 3OW2A 1K83H 2FMCA 4MZ9A 1YHAA 2L0CA 4DUYL 4HTHA 3T1HL 1CTMA 1TS3A 3EVQA 1L0WA 2F0NA 1E2VA 3P7JA 1PFBA 1K8MA 1T9HA 1V43A 1X3QA 3KJOA 4KKUA 4LF8L 5BN5A 3H09A 3IFDA 1KDAA 2H5XA 1BXTA 4BXXH 1SDFA 4XQNA 1XYIA 1C8CA 4A3MG 3AU7A 4X3UA 1XMQQ 2CH4W 3CCRA 5NUCA 2L1BA 5FO9B 1Q82C 2YU9H 5FLMH 2DJGC 1TWHH 5CV7A 3CPFA 3T16A 3DUZA 4UHVA 1B3AA 2RDFA 1O7LA 4DV1L 4FF4A 2RBMA 2ZJQA 5C44B 4G7HC 5CBAE 5LMNL 4QQBX 4XQJA 1EYCA 1HJPA 4KJNA 5D3IB 4DR4L 2PZUA 3HG9A 3AYHB 2Z9HA 3FKIH 1DZ1A 2K5WA 1G2TA 2L15A 4KN4C 5LL6X 4A3EH 2XGTA 5C5MA 4GKKL 4B08A 1NUCA 3S14B 1L2FA 3I4NB 4DV6Q 4OX9L 4JV5Q 1DJRD 4ALPA 2E76C 1TWCH 4RGTA 4X62Q 1PRTC 3CHBD 3C46A 4Z9CB 4M8AA 5A2QE 4A3FG 5JEAJ 3HFZB 4GOPB 1S40A 2CH4A 3VR5A 1HNWQ 1PTOF 4KJOA 2D62A 4I65A 3ND8A 2SDFA 3G6JB 4C2MH 1VQFA 1K3BC 1H9JA 3LWUA 1M1KC 2R93G 4XIGS 5AFWA 1AN8A 5M9OA 1PFSA 1SBBB 2RHQB 3MA2B 2B2TC 1D6EC 2R7FA 4YCVA 1ML0D 4GLVB 1EIHA 1M8AA 4V0BA 3F8TA 2H1EA 1C0AA 1SMYC 5CR3A 1ASYA 4ABNA 5C0XH 4JI8L 2MNAA 4LFCQ 5K36H 1MSHA 1RHPA 1KABA 1PZKD 4DV7L 2QILA 2JA6H 4A3CH 3GDEA 5HURA 1ESFA 2NVXH 3SGIA 3GTQB 2AUJD 4YY3Q 2AQ3B 1WVLA 3D6WA 1VQHA 4ZLTF 3HOVH 2LKVA 1OO9B 4X66Q 5BR8Q 1II3A 1JB7A 2K14A 3NQIA 3HOWG 2KA7A 4X3KA 1Z6HA 1VQ7A 2O5IC 1HNZL 1M4VA 3I55A 4CDFC 1QUQA 1U4LA 2JA8H 4Y7NB 2F0VA 4BBSH 2Z0SA
chains in the Genus database with same CATH topology
2FINB 5C4JB 2MGSA 3J7YW 4FF3A 2E2IB 4DFAA 1W6JA 2EYJA 4RGMA 3HOZB 2OT2A 1GHKA 3HP3A 2QCPX 2G9DA 3K6OA 4K2KA 3I70A 1G2SA 1FNUA 2K33A 2NVYB 2NN6H 3ERQA 4N9PA 5CGKA 1IKLA 3D6CA 3K59A 3M3YB 1IL8A 3VA7A 3R8BA 4PQXA 1PZID 1ZXTA 1DONA 1Q1BA 2QF7A 2KVMA 4OO1I 3MFGA 4C3IB 2IX1A 2EYHA 2Z4HA 3R93A 5I6WA 1AFPA 5IT9E 1QB5D 4O1NA 4IUTA 4IURA 2L11A 4NW2A 1D5ZC 1QOHA 4KK7A 5IGCA 4L63B 5KIXA 1AZQA 3K5MA 3HGBA 1JE4A 5CV6A 1UAPA 3E5SA 5IGEA 1RD9D 1SNMA 2B8GA 5M5WB 3BDCA 4DK0A 2H4OA 2EYPA 1EQVA 3M4YA 1SNCA 3W2DA 1CI3M 4C1NI 4LAAA 4CKEA 3DWPA 1EU4A 4KKSA 5FLXE 2D2CC 2A6EC 2WP8J 3TP8A 5DM73 2D9UA 2HDMA 2EE1A 3FEWX 3VA5A 1CK1A 4A3BB 3U9OA 2BE5C 3TSSA 3OHXC 4C3JG 1WTQA 4DAYA 3GV6A 5E4XA 1EU3A 1JORA 3PUVA 2TMPA 2VB2X 2WAQB 4EQNA 3M85A 1MI2A 4PMBA 4P2CB 1ENAA 4BA1I 4DGZA 4NP5A 2JXMB 3CRKC 4DF7A 4U673 2XRQD 1HA5A 1OXVA 2KUMA 1JOQA 1LO5D 4H0LC 2WB1B 3D4WA 1H9SB 2F0LA 2CQAA 2V4DA 4J1MA 2NYZD 1Y1WB 4XT3B 1NCVA 1LTID 1C4QA 1KTKA 2RKSA 1PFNA 1O80A 3N6RA 3BYTB 4BY1B 1G8ZD 4B9XA 2EYOA 1STHA 2GA4B 4C3HG 1TS5A 3OIQA 3S2DB 4A3GB 1PZJD 3GTMB 1U9RA 2SNSA 1EFID 2A6HC 2DY8A 1CFMA 4RFBA 4MHEA 4PNYA 1CHPD 2RSOA 1SYFA 4XT1B 1O7ZA 1LTRD 3MTSA 4F87A 1A2TA 3O13A 1GOZA 2EVBA 2K32A 3U9SA 3S1MB 3J80E 4NKLA 3V2TA 3C2PA 3RZDB 4Q0FA 1EY8A 3CQZB 3FPPA 4RCOA 5LHY1 2B2TA 4DXGA 1RTNA 3GTJB 4ZRZA 3H6MA 1LTGD 3VR3A 4F88A 1LTTD 1F2MA 2L9HA 2F0SA 4LK1C 2L4NA 1JWMD 1EQTA 2Q8RE 3NE5B 3EFXD 3J81L 1IHZA 1EL0A 4KKTA 4ME5A 2R6GA 1AW7A 2A6ED 5C4ZA 2J7ZA 4KTAA 1STGA 3BVZA 3ND9A 4H44C 5IODA 1WTXA 1SXTA 2AUKA 2IX0A 1TIID 5DM63 2BE5D 4ODGA 1TT2A 5CC4A 4C56C 4HSPA 3V05A 1FNWA 3RLFA 1GHJA 1HTPA 2B2YA 2AWNA 2Y0SB 2F0FA 3MXUA 1IW7C 2F1MA 4HAEA 2R93B 1FD7D 1NR4A 2PQEA 3ZYYX 2IWHA 3OOCA 3M7NA 1HFGA 2K5QA 5EKLA 5CBEE 1YNJC 2XWBB 1DYQA 3FRPB 5A2QL 5JJZA 4IUPA 3EROA 2YYZA 3KBGA 2E2DC 2PNRC 5IGFA 2FHTA 1HXYD 1ZYRC 4OIJA 2M00A 3HOWB 3FDTA 1PTOB 4OL7A 2N88A 1G291 3TZUA 3K57A 1SYCA 1GUOA 5M3MB 2JSOA 4V190 1LLRD 1ET6A 3TBIB 5C3WA 1T5XD 1EY9A 2PW5A 1VDZA 3OMCA 3S1RB 4CJ0B 3NP8A 2K6AA 1Z47A 5I4DA 4IUVA 1S5FD 1TWAB 2A6HD 1EY7A 4MIUA 3WDNA 3S16B 1RDPD 1JB3A 2L55A 4WORA 2NB0A 1TR5A 1SYDA 3TP6A 1EEID 1GUNA 4DA2A 1TWGB 3HOXB 2EZVA 1U4PA 3FMCA 4RKBA 1BCPC 2F0QA 3BG3A 1SE2A 3BVGA 2O4XA 3BVMA 3QG1A 2EXZA 4ZAIA 1E0BA 3GTGB 1SNPA 2IJ0A 3TZDA 1ONLA 3TN2A 4PMCA 1R4QB 4ILWA 1D1KA 4X3SA 5KYIA 2DNEA 4ZUIA 5T1IA 3MEHA 1CA6A 4A93B 2FFKB 3QJYA 1TS4A 5ELDA 4IFDG 2AQ1B 4ZK9B 3VR2A 1G91A 5EGTA 4KHZA 1TY2A 5EBDA 1SYEA 4K6LA 3A54A 1WCMB 3J7AV 2JYOA 1OXXK 2BCOA 5EPLA 3EJIA 2B63B 1LTSD 1TY0A 4C3JB 5M5YB 1BO0A 3GP7A 1WTRA 4G4KA 1STYA 4ZKCB 4RCNA 5FLXL 1Y8OB 2CHBD 1TWFB 2R61A 3FVQA 3QOLA 4TRDA 5KNBA 5E1FA 2J4XA 2EYFA 1BDOA 2SNMA 3BYYB 2L12A 2RQXA 1CT1D 3L3OC 1XXGA 5T1GA 3NPPA 2MHVA 2WV6D 2G9HD 2QEJC 4K2LA 5C4XB 5J39A 2CVRA 2A5HA 1ZYRD 4XDXA 5JOBA 1LT4D 1RF2D 4FVMA 1CM9A 4A3KB 2ENBA 1LABA 3KK7A 5E3FA 1WD0A 2LFNA 2PPBC 5K36G 1DCZA 3QIAA 4EVOA 3MXGA 1PTOH 4RAUC 1KNEA 1B44D 4ULLA 4RHSA 4IN3A 4XXEA 2B2YC 3I8ZA 1KAAA 4QMGA 1F2YA 1F9QA 2EYLA 5DNFA 3CRLC 2A68C 4BWGB 2BA0A 1QCBD 4F8MA 3NQTA 4KY5A 2E2HB 5EPKA 4F7XA 5ISRA 5JPNC 1O78A 2KQ3A 3PUYA 1EZ6A 2XWJB 2F0WA 4DAVA 1FNVA 1DOKA 3MFYA 1D5XC 2B2WA 2PZTA 2C5CA 1PFMA 1HQMC 1Q1EA 2EJGC 4DK1A 1E2ZA 3X3NA 5CV9A 5I6YA 2B2UC 1EWCA 1UEAB 1V1PB 1OXTA 5EKIA 1I4XA 1R9TB 1PLFA 3L9AX 1QJOA 4ZKBB 4IFDJ 2EOTA 3D8GA 2DY7A 2D5DA 3ONAB 4RGOS 1A3TA 3HOUB 4PV1C 3OSOA 4OHJA 3D4RA 1F2ZA 5DAUA 4A3DB 1PRTD 1WD1A 1AZPA 2PZWA 3IL8A 5DEHA 4WFN3 4M1UB 5C6AA 3MXPA 2NWGA 3VYUA 1ICWA 2IW3A 1HUMA 4H7BA 4ZQ3A 2JP1A 3QB3A 2F0UA 1EY0A 1D1IA 5C4HA 4R8NA 1F9RA 1YNNC 1QNUA 1CHQD 1SMYD 3EQLC 4AYBB 4IFDI 2F0IA 3VYRA 2VXWA 2XVSA 3NTKA 3E6ZX 3SR1A 4CGYB 3G7LA 4HN7A 1JICA 1IKMA 4LJZC 3ITPA 1ENFA 4GZYC 5J22A 1S5ED 4XYOA 2M9VA 5ELBA 2WKCA 1LT6D 2HCCA 4FXKC 4RGNA 5I9PA 1NAPA 2JEBI 1WTOA 1RODA 3NXWA 2F03A 2WINB 1SE3A 2NBFA 3SK8A 4BBRB 4RHRA 2EDGA 2A68D 3K58A 3SEBA 3L7ZC 1PRTF 5G3LD 2CW0C 1A3VA 2OXPA 1FGBD 3HKZB 3FPUB 1PDQA 3H94A 5FKAC 1BNZA 1B50A 3QWNA 5E4WC 2IL8A 5EPJA 3DM1A 3LNNA 5FO7B 3URYA 5C3EB 1PXUA 2F3WA 4A3IB 3Q0AA 1LACA 2K01A 2NZ1D 1GUWA 1RTOA 4KD4A 1I50B 1GXDC 4NMZA 1QE6A 5CMDA 1EEFD 4HEDA 2JEAI 1EOTA 4DXFA 4O42A 3TMEA 3NBHA 1S5CD 2XRSD 1TU2B 3DHQA 3OWFA 1LV9A 4U68A 3P20A 1HCZA 4A3MB 2PO4A 1TS2A 5M3FB 1A6XA 1HQRD 2KHSA 2A69C 1GUGA 1SYBA 1KLGD 1BF4A 4QB4A 3NHHA 3KBXA 5KNCA 1F9SA 4X3TA 3F2UA 2K05A 1O7YA 4UAIA 4CBVA 1STAA 3MHBA 2NTTA 4IQZA 2RDHA 4K8JA 5KGUA 3S9WA 4B9WA 3PUXA 3MZ5A 4FNFA 1EYDA 3P1HA 4JBWA 2XSCA 5G3LF 4HR7B 2KCCA 2O5JC 1ET9A 3SVMA 4A3FB 2PW7A 2ICEC 3K7AB 2I07B 2E75C 4IUUA 1MD2D 3GQBA 3WOEA 1J9OA 1YNND 5JEAH 3A7LA 3NWSA 3GD7A 3BDOA 1AP0A 2B2WC 2WKDA 5EKKA 3IAYA 2JA7B 3QO2A 5JPMC 5EJWA 1UUPA 2F0DA 2KJXA 2BDOA 4XTCS 2MPMA 3T4AC 3X3MA 3H0GB 4OGQC 1GJXA 4K5VA 4YIJA 4FF1A 3T51B 1TVXA 2O2LD 5IOCA 1H9SA 1Q8IA 3MXNA 2F0JA 3WOFA 2IPKD 1XX8A 4OO1H 3S1QB 2B2UA 1EY6A 1JOOA 1LT5D 4N9TA 5FOBB 1L0XB 2VNUD 1VMPA 1KDCA 3GTOB 3NUCA 1HTLD 2CW0D 3SK5A 1EZ8A 1EWHA 1SFOB 1CQFA 3MAQA 3A8JE 4PMWA 3BZDB 5JAVA 2PYKA 1G6ZA 1MGSA 3I91A 4IUNA 1HFNA 4RWSC 4I7ZC 1FYCA 4HMJA 1SEBD 5IGDA 1F2LA 1STBA 1K8OA 1U4MA 4KHVA 2OEOA 3JAME 2EPBA 4QUFA 3BS1A 1QILA 1H9KA 4CKBA 1X32A 1SE4A 1KDBA 1WTPA 3KLRA 4K14A 3K5NA 4XQQA 2A69D 3TP7A 2F0KA 1S5BD 3S1NB 1RCVD 3GTPB 1HHVA 4OIKA 5IT9L 3HS0C 1JCKB 1JWSD 3I4MB 3A7AB 1HRJA 1DXMA 3GO5A 2EY5A 1GUTA 3J81E 5C3XA 2EYMA 1VCIA 5M5XB 1STNA 2R92B 1LTBD 4WJWA 4IFDH 1J8IA 2EJMA 3PV0A 3SDZA 5I2XA 3DEPA 4XYQA 4QCLA 3VYTA 3RUZA 1CZWA 4HSVA 3K0YA 5KYLA 1XTCD 1IW7D 2F0MA 3KF8A 4G57A 1W6KA 1MSGA 3Q23A 3Q24A 2B8FA 1T5EA 4HCSA 1OXUA 4CHTB 2M2LA 3S15B 2Z8LA 1ILPA 1JOKA 1YNJD 3OMGA 4TSSA 1AEXA 2HQEA 4K6DA 5ELFA 3OPOA 3SE0A 2NVTB 4QF4A 1D2BA 1Q3LA 1VMCA 5EBCA 3EA6A 1BUVT 4K8IA 3T56B 4FXGC 4K5WA 1WTVA 4G7OC 4KN7C 5C0XG 1BCPB 1X3PA 5FO8B 4KV6A 1EIGA 2NVQB 3I90A 1VF5C 4TKOB 5LL6S 5JVG3 3NWTA 4UDUC 1WTWA 4JK1C 2DNCA 3VYSA 1IYUA 2LMCB 3M7GA 4C3HB 1SAPA 1L0YB 1LTAD 4QUCA 1Y69U 1BBXC 3I3CA 1CZGA 2RDGA 4HCEA 1HUNA 1SJHD 4RKLA 1BCPD 3DWQA 2K04A 1SJED 3A56A 4KI0A 2XIWA 3SK4A 3K5LA 4FYDA 3KUPA 3W3AA 2NN6G 3VR4A 1SSOA 3T13A 2L5TA 2B2VA 3A55A 2NUCA 3NSWA 2HUGA 3VR6A 2RSNA 4ZUJA 4KD3A 4TQUS 3D4DA 1Q90A 3IKJA 3S2HB 1SNQA 2PMZB 3SK6A 2WIIB 2HCIA 1PRTB 5D3DA 3I73A 3M4OB 1RKNA 2TSSA 1V8QA 3DEOA 2VB3X 1Z7TA 4RA8A 1ZEQX 3NK9A 4L8JA 2BA1A 3IFTA 3J80L 2XNAC 2F0OA 1UNSA 1FR3A 1TKWB 1PMRA 1I3QB 4K5XA 3KLSX 2BDNA 3N52A 2KCNA 3RD4A 1Y1VB 1DOMA 5JVH3 1EY4A 3D31A 3HEJA 3S17B 2EY2A 4DN4M 1NSNS 2ICIA 4DNTB 3PO2B 1EY5A 1SNOA 3P75A 3HOYB 3OWEB 1VF7A 2LY7A 4Q5VA 1BR9A 2JA5B 2F0PA 1QNKA 1QWYA 3Q6SA 3PIP3 2RVLA 1JQYD 1ILQA 1EYAA 1CQVA 4C1NK 2ZXRA 1U4RA 1JR0D 1S4ZA 1BCPF 2F0GA 1QG7A 5IIFA 2F3VA 3DXJC 3BDLA 5CYUA 5ELCA 5D65A 2QKIC 3DWAA 4WRDA 4A3JB 1E2WA 3GTKB 2R3ZA 2PCFB 4IALA 2R7ZB 3Q22A 4R8IA 3SXHA 1NR2A 3I4LA 3V96A 1TQOA 2K28A 2C9OA 1RJTA 5C0XJ 2A74C 1DOLA 3NTIA 3TDQA 2MP1A 2IX3A 3PO3B 4NDXA 1SYGA 2OF1A 1B53A 3J7AF 5KEEA 1F9PA 5HGTA 2SOBA 4ID6A 1B9NA 2X6GA 2IT1A 3KLSA 4IZ8A 1I4QA 2EY1A 3CKIB 4EGVA 1HA6A 3RZOB 5KRUA 3R2IA 3PUZA 2EY6A 3MC0B 2K7VA 2Q8TA 3K5OA 4KMUC 1ENCA 1B4OA 3C3LA 3GTLB 2DN8A 1H9RA 3E0JA 4CKCA 1MBYA 1LT3D 3A8IE 5C0XI 3NTHA 1OXSC 4L6TB 5IGGA 4CJ1B 1A3UA 1A15A 4HMIA 4QIWB 1Q12A 3H3VC 4KY7A 5D14A 1I4HA 4G7ZC 1K83B 1PTOC 3JAML 5F2DA 1XWEA 2NTSA 2F0TA 4C3IG 4J8QA 1V1OA 3PUWA 4FO2A 1V1PA 1SNDA 2ZXPA 2AQ2B 2HDLA 4FF2A 5A35A 2YU9B 4MN3A 3D3RA 1TWHB 1I6VC 5C5LA 2N55A 1IYVA 1A2UA 2NN6I 1DD2A 5CV4A 1DM0B 4DAPA 1I4RA 2X6LA 1ESRA 3AMUA 2B39A 3FKIB 4A3EB 5CORA 2B2VC 5CV8A 5KNDA 3LX0A 5CV5A 3SHLA 3R2TA 4FP5D 4EQPA 4EQOA 1R4PB 1TWCB 5K5PA 3NBIA 1BQQT 4R9WA 2ZT9C 2SEBD 3H91A 1ZKOA 3DMUA 2J0TD 2RA4A 2A73B 1GUSA 4J6HA 4C2MB 3C1FA 1B2TA 3GV3A 1S5DD 2MJ8A 1C48A 4S3SA 4BA2I 5ELEA 5JEAG 3LWEA 1STEA 4RH6A 2LS01 3HRZC 2EJFC 5BN4A 2WACA 3C1EA 2E74C 2Z4IA 2K03A 2I46A 1I4PA 1HPCA 2Q8IB 5TSSA 2JA6B 3OIPA 2NVXB 5EQ0A 2JE6I 1I4GA 4ZYSA 2F4IA 1KNAA 3AB9A 3HOVB 3CU7A 4BS9A 2F0EA 2FMMA 4FXDA 2FJ2A 4KY6A 1PYWD 3PIO3 2JA8B 2MUYA 4BBSB 3HZXA 2KEDA 5J1ZA 2VUMB 4OO1G 1KLUD 5IGBA 5I9OA 2KECA 2BOSA 2QDBA 2F0HA 3RMHA 1F77A 3A8KE 2E2JB 1Y8NB 3QOJA 4LMQD 4BY7B 3MWYW 4CJ2C 1I6HB 3I72A 1JC7A 3PMFA 4IUQA 4E6IA 2ZXOA 4DU9A 3TP5A 2KOLA 1B9MA 2X69A 1B1ZA 2KEEA 4H13C 1CA5A 3MVVA 4DNRB 2AWOA 2XN9C 5FK9C 1Y8PB 1PTOD 3UI2A 1H9MA 3R3OA 3OW7A 1BOSA 2Z1CA 5COYA 2K5DA 1JWUD 1D5MC 2K1BA 5I2YA 2ID0A 3T53B 5BN3A 2FMCA 2L0CA 4HTHA 1CTMA 1TS3A 3EVQA 2F0NA 1E2VA 3P7JA 1PFBA 1K8MA 1V43A 1X3QA 4KKUA 5BN5A 3H09A 3IFDA 1KDAA 1BXTA 1SDFA 4XQNA 1XYIA 1C8CA 3AU7A 4X3UA 5NUCA 2L1BA 5FO9B 5CV7A 3T16A 3DUZA 1B3AA 2RDFA 1O7LA 4FF4A 2RBMA 5C44B 4G7HC 5CBAE 4XQJA 1EYCA 4KJNA 5D3IB 2PZUA 3HG9A 1G2TA 1DZ1A 2K5WA 4KN4C 5LL6X 5C5MA 4B08A 1NUCA 3S14B 3I4NB 1DJRD 2E76C 4RGTA 3C46A 1PRTC 3CHBD 4Z9CB 4M8AA 5A2QE 5JEAJ 3VR5A 1PTOF 4KJOA 2D62A 4I65A 3ND8A 2SDFA 3G6JB 3LWUA 1H9JA 4XIGS 5AFWA 1AN8A 5M9OA 1SBBB 3MA2B 2B2TC 1D6EC 1ML0D 1EIHA 1M8AA 4V0BA 2H1EA 1SMYC 5CR3A 4ABNA 5C0XH 5K36H 1MSHA 1RHPA 1KABA 1PZKD 2QILA 5HURA 1ESFA 3GTQB 2AUJD 2AQ3B 1WVLA 3D6WA 4ZLTF 2LKVA 1OO9B 1II3A 3NQIA 2KA7A 4X3KA 1Z6HA 2O5IC 1M4VA 1U4LA 4Y7NB 2F0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V19 0;  3J7Y W; 
#chains in the Genus database with same CATH topology
 2FIN B;  4X64 L;  5C4J B;  5M3M G;  4X65 Q;  3CCL A;  4IJL A;  2MGS A;  2VUM H;  3J7Y W;  4FF3 A;  2E2I B;  4DFA A;  1W6J A;  2Z6B A;  2EYJ A;  4RGM A;  5J3B A;  4A3L H;  2MO0 A;  3HOZ B;  2OT2 A;  2N3S A;  1QVC A;  1GHK A;  1EFW A;  3HP3 A;  2E2J H;  2QCP X;  2G9D A;  2NZH A;  4DK3 C;  1VQG A;  2GN5 A;  3K6O A;  4BY7 H;  4K2K A;  3I70 A;  1G2S A;  1FNU A;  1PVO A;  2K33 A;  1I6H H;  2UUB Q;  2MO1 A;  2NVY B;  1UE5 A;  2NN6 H;  4PZ7 A;  3ERQ A;  4N9P A;  5CGK A;  1IKL A;  3D6C A;  3K59 A;  4HIM A;  4LF7 L;  5JJK A;  3PF5 A;  3M3Y B;  5IYB G;  1IL8 A;  4DV2 L;  3VA7 A;  3R8B A;  2HHH L;  3KFU A;  4PQX A;  1PZI D;  1V9P A;  1ZXT A;  1DON A;  3JAM i;  1Q1B A;  2QF7 A;  3HOX G;  2KVM A;  4OO1 I;  3MFG A;  4C3I B;  2IX1 A;  1SLJ A;  2EYH A;  2Z4H A;  3K80 C;  3R93 A;  3NBH B;  5I6W A;  2D0P A;  1AFP A;  5IT9 E;  1QB5 D;  3K8A A;  4O1N A;  4IUT A;  2IY5 B;  4IUR A;  2L11 A;  4NW2 A;  1D5Z C;  1QOH A;  4KK7 A;  5IGC A;  4L63 B;  5KIX A;  1AZQ A;  3K5M A;  3HGB A;  4IOC A;  1IL2 A;  1JE4 A;  5CV6 A;  5IYC H;  1UAP A;  3E5S A;  4OWT B;  5IGE A;  1RD9 D;  1SNM A;  3J80 c;  2B8G A;  1U5K A;  5M5W B;  3BDC A;  1K0S A;  4IPG A;  4DK0 A;  3J81 i;  2H4O A;  4ME3 A;  3K0X A;  1UEB A;  3CC4 A;  4A93 G;  2EYP A;  1EQV A;  2CCZ A;  3M4Y A;  1N33 L;  1SNC A;  3W2D A;  1CI3 M;  4C1N I;  4LAA A;  4CKE A;  3DWP A;  1EU4 A;  4KKS A;  5FLX E;  2D2C C;  3RNU A;  2A6E C;  1CSP A;  2FXQ A;  2HD3 A;  2WP8 J;  3TP8 A;  5DM7 3;  2D9U A;  3W1B A;  1WCM G;  2HDM A;  2VZA A;  1PH7 A;  2EE1 A;  3FEW X;  3VA5 A;  1CK1 A;  4A3B B;  3U9O A;  5C44 H;  2BE5 C;  2RF4 A;  1X3F A;  1B70 B;  3TSS A;  1EUJ A;  4MNO A;  3S15 H;  3OHX C;  4C3J G;  2KHJ A;  2ZTC A;  3ERS X;  1WTQ A;  4DAY A;  3GV6 A;  2IHF A;  1EOV A;  1EU3 A;  5E4X A;  1P8L A;  4JI3 Q;  3S14 H;  1JOR A;  3PUV A;  3I4N H;  2TMP A;  1XNR L;  2VB2 X;  2WAQ B;  4EQN A;  3M85 A;  1XNQ L;  1MI2 A;  3I4O A;  1MKH A;  4PMB A;  4P2C B;  1ENA A;  4BA1 I;  4DGZ A;  4NP5 A;  2JXM B;  3CRK C;  4DF7 A;  4LUV A;  1ASZ A;  4U67 3;  4B3T L;  2QW7 A;  2XRQ D;  1DGS A;  1HA5 A;  1K28 A;  2MFI A;  1OXV A;  4DV4 Q;  2KUM A;  1JOQ A;  2UXC L;  1YJW A;  4DR1 Q;  1LO5 D;  4H0L C;  2WB1 B;  1SN8 A;  2N49 A;  3D4W A;  1EIY B;  1JJG A;  1CKN A;  2I5M X;  1Q7Y C;  1H9S B;  2F0L A;  3ICE A;  2CQA A;  2V4D A;  3NEM A;  4J1M A;  4A3K G;  2NYZ D;  1WI5 A;  1Y1W B;  4XT3 B;  2CFM A;  1NCV A;  4IPC A;  3GTQ H;  1LTI D;  1C4Q A;  1KTK A;  2RKS A;  2ZJP A;  2JJQ A;  1B8A A;  4NXN L;  1PFN A;  1O80 A;  2QEX A;  3N6R A;  3L2P A;  3BYT B;  1E1O A;  1X3E A;  4BY1 B;  1G8Z D;  4B9X A;  2EYO A;  1STH A;  2GA4 B;  1HNX Q;  2UUC Q;  4Y7N H;  1K8G A;  1Q8K A;  1TS5 A;  3OIQ A;  2K5H A;  4C3H G;  3S2D B;  2K4K A;  4ZCK A;  5C4J H;  4A3G B;  2K5N A;  1PZJ D;  3GTM B;  5L37 A;  2E2I H;  1U9R A;  1PH2 A;  1D8L A;  2SNS A;  1EFI D;  3HOZ H;  2A6H C;  2DY8 A;  1CFM A;  4RFB A;  4MHE A;  4LF4 L;  4PNY A;  3M9B A;  1KL9 A;  3H3V I;  4QIW E;  1N36 Q;  1CHP D;  1FGU A;  2R7D A;  2RSO A;  4LFA Q;  4LF6 L;  5IP9 H;  1SYF A;  3NEN A;  2PQA A;  4XT1 B;  3T1H Q;  1O7Z A;  2ATW A;  1LTR D;  3MTS A;  4F87 A;  1A2T A;  3M3Y H;  3O13 A;  3ZJY C;  1GOZ A;  2EVB A;  1L1O B;  2K32 A;  3U9S A;  3S1M B;  1GKH A;  1A8V A;  3J80 E;  4NKL A;  1PV4 A;  3V2T A;  2CKZ B;  1VS0 A;  3C2P A;  4RMF A;  4DR6 L;  3RZD B;  4Q0F A;  4C3I H;  3QR8 A;  1EY8 A;  3CQZ B;  3FPP A;  4DR2 Q;  4RCO A;  3ULL A;  5LHY 1;  2B2T A;  4DXG A;  3JAM c;  1RTN A;  3GTJ B;  3PCO B;  4ZRZ A;  2F52 A;  3H6M A;  1LTG D;  3VR3 A;  4F88 A;  2K5V A;  1LTT D;  1V1Q A;  1F2M A;  2ZTE A;  2L9H A;  2F0S A;  4LK1 C;  2UXB L;  2UUA Q;  2L4N A;  2AHO B;  1Y1V H;  3J81 j;  4DV1 Q;  1JWM D;  1EQT A;  2Q8R E;  3PSI A;  3IRB A;  4HIK A;  3NE5 B;  3EFX D;  3J81 L;  1IHZ A;  1EL0 A;  5LMN Q;  4KKT A;  4ME5 A;  2R6G A;  1AW7 A;  4DR4 Q;  5M5W H;  5IWA L;  2A6E D;  4WJ3 M;  5C4Z A;  2J7Z A;  4KTA A;  1STG A;  3BVZ A;  3ND9 A;  4H44 C;  5IOD A;  1WTX A;  1SXT A;  1WOC A;  1YHQ A;  2AUK A;  3HOU G;  2IX0 A;  4OX9 Q;  1TII D;  4IO9 A;  5DM6 3;  2BE5 D;  4ODG A;  1TT2 A;  3KF8 B;  5CC4 A;  4A3D G;  4C56 C;  2EQS A;  4HSP A;  3V05 A;  1FNW A;  3PO2 G;  3U50 C;  1HZ9 A;  3RLF A;  3HOY G;  1GHJ A;  1HTP A;  3CCQ A;  2B2Y A;  2AWN A;  2JA5 G;  1E22 A;  2Y0S B;  2F0F A;  3MXU A;  3CCE A;  1IW7 C;  1X6O A;  2Y0S E;  4A3B H;  2F1M A;  4HAE A;  5JJL A;  2AKW B;  2R93 B;  3M4Q A;  3LGJ A;  1AE3 A;  1FD7 D;  1NR4 A;  3BZK A;  2PQE A;  3ZYY X;  2IWH A;  3OOC A;  1E3P A;  3UDF A;  1XPO A;  3M7N A;  1AH9 A;  1HFG A;  2K5Q A;  5EKL A;  3DM3 A;  1X9N A;  5CBE E;  1YNJ C;  2XWB B;  1DYQ A;  3FRP B;  5A2Q L;  5JJZ A;  2E5L L;  4IUP A;  4AYB G;  4KLK A;  3ERO A;  4DR5 Q;  1K8A C;  2YYZ A;  3CCS A;  3KBG A;  2E2D C;  1SRU A;  2PNR C;  5IGF A;  4LFB Q;  2FHT A;  1HXY D;  1ZYR C;  4OIJ A;  4UP9 A;  2M00 A;  3HOW B;  1IBK L;  3FDT A;  1PTO B;  4JYA L;  4OL7 A;  1GO3 E;  2N88 A;  1G29 1;  1VQN A;  3TZU A;  3K57 A;  1SYC A;  1GUO A;  4NPS A;  5M3M B;  2JSO A;  4V19 0;  1LLR D;  1IBM Q;  1ET6 A;  3TBI B;  5C3W A;  1T5X D;  1EY9 A;  1Y1W H;  2PW5 A;  1VDZ A;  3OMC A;  3S1R B;  1XTD A;  1X55 A;  4CJ0 B;  3NP8 A;  3TS0 A;  1FJG L;  1QUQ B;  4GKJ L;  2K6A A;  4BBR G;  1KAW A;  1Z47 A;  1EQQ A;  5I4D A;  1S5F D;  4IUV A;  1TWA B;  2A6H D;  4LF7 Q;  1EY7 A;  1VQD A;  4MIU A;  4BY1 H;  2UXD L;  4GNX B;  4DV2 Q;  3WDN A;  2HHH Q;  3S16 B;  3HKS A;  1RDP D;  1JB3 A;  2L55 A;  4WOR A;  2NB0 A;  1TR5 A;  3S2D H;  1KRT A;  4A3G H;  1SYD A;  4P73 A;  3TP6 A;  2Z6K C;  1W2B A;  4LUZ A;  3GTM H;  1EEI D;  2Q2H A;  1GUN A;  4DA2 A;  4OEM B;  4GS3 A;  1TWG B;  3HOX B;  2EZV A;  2OQ0 A;  3A74 A;  1U4P A;  5HGQ A;  3FMC A;  4RKB A;  2LXK A;  3I56 A;  1BCP C;  4QL5 A;  2F0Q A;  3BG3 A;  1SE2 A;  3BVG A;  4P72 A;  2O4X A;  3BVM A;  1JT8 A;  1XPU A;  3QG1 A;  2EXZ A;  4ZAI A;  4IOA A;  1E0B A;  3GTG B;  2Q2U A;  1SNP A;  4GN5 A;  2IJ0 A;  3TZD A;  2PI2 A;  1ONL A;  4A75 A;  2N8N A;  3S1M H;  1UWV A;  5AJ3 Q;  3TN2 A;  2GVB A;  4JBM A;  3RLN A;  1JE5 A;  4PMC A;  2ZM6 Q;  1R4Q B;  4ILW A;  1D1K A;  3RZD H;  5M3F G;  4X3S A;  2JQO A;  5KYI A;  2DNE A;  1Q86 C;  3CQZ H;  4ZUI A;  1GD7 A;  3MEH A;  5T1I A;  3GTJ H;  1CA6 A;  4BXX G;  4A93 B;  2FFK B;  3QJY A;  1TS4 A;  5ELD A;  4IFD G;  2AQ1 B;  4ZK9 B;  3VR2 A;  1G91 A;  1N9W A;  1ICF B;  5EGT A;  1CKO A;  1LM0 A;  4KHZ A;  5FLM G;  4DV5 L;  1TY2 A;  5EBD A;  1SYE A;  4K6L A;  3A54 A;  1WCM B;  3J7A V;  4LWC A;  2JYO A;  4K0K L;  3BJU A;  1OXX K;  2BCO A;  5EPL A;  3F1Z A;  3EJI A;  4JI7 L;  2B63 B;  4KHP L;  1LTS D;  1TY0 A;  2ES2 A;  5IYD G;  1YI2 A;  4C3J B;  5M5Y B;  1BO0 A;  3GP7 A;  1B7Y B;  3W5O A;  1WTR A;  1NJI C;  4G4K A;  1STY A;  4LUO A;  3FKI G;  4ZKC B;  4RCN A;  5FLX L;  4A3E G;  1Y8O B;  2CHB D;  1TWF B;  2R61 A;  3FVQ A;  3QOL A;  4TRD A;  1SRO A;  5KNB A;  5E1F A;  2J4X A;  2EYF A;  4B3T Q;  1BDO A;  2SNM A;  3KDF A;  3BYY B;  2L12 A;  4EQ5 A;  4B3R Q;  5LMU Q;  2RQX A;  2UXC Q;  2F4V L;  1CT1 D;  2JA7 G;  3L3O C;  1XXG A;  4HJ5 A;  5T1G A;  5FJ8 H;  1BKB A;  2JK8 A;  3NPP A;  2MHV A;  2R93 H;  1K73 C;  2WV6 D;  2G9H D;  1X56 A;  2QEJ C;  4K2L A;  5C4X B;  5J39 A;  5IY0 A;  2CVR A;  2A5H A;  4DV0 Q;  1ZYR D;  4XDX A;  5JOB A;  3H0G G;  1LT4 D;  3S24 A;  1RF2 D;  4FVM A;  1CM9 A;  1N32 L;  4A3K B;  3RN5 A;  2ENB A;  2UU9 L;  2HQL A;  1LAB A;  3KK7 A;  1PH6 A;  2KHI A;  4LF9 Q;  5E3F A;  1WD0 A;  2LFN A;  2PPB C;  5K36 G;  1YZ6 A;  1IYJ B;  1DCZ A;  3QIA A;  4EVO A;  4A3C G;  2JA6 G;  1CKN B;  3MXG A;  3HOW H;  3KF6 A;  3M4P A;  1PTO H;  3H15 A;  4AIM A;  3HOV G;  2DUD A;  4JI6 Q;  2ZTD A;  4RAU C;  4JI4 Q;  1EYG A;  1KNE A;  1PYS B;  1B44 D;  2B29 A;  4ULL A;  4RHS A;  4HJ8 A;  4IN3 A;  4XXE A;  2B2Y C;  5M3M H;  3I8Z A;  1KAA A;  4QMG A;  1F2Y A;  1F9Q A;  2EYL A;  5DNF A;  4LF4 Q;  3CRL C;  2VUM G;  1KC8 C;  2A68 C;  4BWG B;  4QGU A;  3S1R H;  5EAY A;  2BA0 A;  1QCB D;  4F8M A;  3NQT A;  3U4V A;  3EIV A;  1TWA H;  4KY5 A;  2E2H B;  5EPK A;  5HY6 A;  1NNX A;  3S16 H;  4F7X A;  5ISR A;  5JPN C;  1O78 A;  2KQ3 A;  3CCU A;  4JI1 L;  3PUY A;  1EZ6 A;  2YTY A;  2XWJ B;  2F0W A;  4WJ4 A;  4DAV A;  1FNV A;  1TWG H;  3HOX H;  1DOK A;  4DR3 L;  3MFY A;  3OTO L;  1D5X C;  2PQA B;  1RIP A;  1YJN A;  1H95 A;  4R1J A;  2B2W A;  2PZT A;  2C5C A;  3MEF A;  2QDL A;  1PFM A;  2G5D A;  1HQM C;  1Q1E A;  2EJG C;  4DK1 A;  1E2Z A;  3T1Y L;  4POG A;  1A63 A;  2RCN A;  4JI5 Q;  3X3N A;  5CV9 A;  2NZO A;  3GTG H;  5I6Y A;  2B2U C;  1EWC A;  1C9O A;  1UEA B;  1V1P B;  1OXT A;  5EKI A;  1I4X A;  1R9T B;  1PLF A;  3L9A X;  1QJO A;  3UDX A;  4ZKB B;  5IYC G;  1HZB A;  4IFD J;  2EOT A;  3UDG A;  3D8G A;  3I4M G;  4B3S L;  2DY7 A;  2D5D A;  3ONA B;  3I2Z A;  1SR3 A;  4RGO S;  1A3T A;  3CD6 A;  3HOU B;  4PV1 C;  3OSO A;  4OHJ A;  2R92 G;  1GM5 A;  3D4R A;  4A93 H;  1F2Z A;  5DAU A;  2KCM A;  4A3D B;  3CC2 A;  4DR7 Q;  2KCT A;  1HZA A;  3E9I A;  3TEH B;  1PRT D;  1WD1 A;  1AZP A;  1WCM H;  2PZW A;  3IL8 A;  5GRO A;  1VQJ A;  5DEH A;  4WFN 3;  4M1U B;  5C6A A;  3MXP A;  2NWG A;  3VYU A;  1ICW A;  2B63 H;  2IW3 A;  1HUM A;  4H7B A;  4IJH A;  3VDY A;  1XMO L;  4C3J H;  4JG2 A;  5M5Y H;  4JI2 L;  3KYH C;  4GOP A;  4ZQ3 A;  2JP1 A;  3QB3 A;  2F0U A;  2E5L Q;  1EY0 A;  1D1I A;  1KIX A;  5C4H A;  4R8N A;  1F9R A;  1NTG A;  2WAQ E;  1TWF H;  2Z6K A;  2A8V A;  1YNN C;  1QNU A;  1CHQ D;  1HH2 P;  1SMY D;  3EQL C;  4AYB B;  2I0Q A;  4IFD I;  2F0I A;  1E24 A;  1YEZ A;  2VXW A;  3VYR A;  3CC7 A;  1XJV A;  2XVS A;  4X6A H;  1RL2 A;  3NTK A;  1VQO A;  3E6Z X;  4N8X 1;  3SR1 A;  4GN3 B;  4R4I A;  1A62 A;  4CGY B;  4DV6 L;  3G7L A;  4HN7 A;  1JIC A;  2HIV A;  3J7A 5;  1IKM A;  4X62 L;  4NB3 A;  4LJZ C;  4QJF A;  3ITP A;  2QA4 A;  1ENF A;  2WB1 E;  4GZY C;  5J22 A;  1AE2 A;  5C4X H;  1S5E D;  4XYO A;  2M9V A;  5ELB A;  2WKC A;  1LT6 D;  2HCC A;  4FXK C;  4RGN A;  5I9P A;  1NAP A;  4EX5 A;  2JEB I;  4A3K H;  4DUZ L;  1WTO A;  1ROD A;  1FJG Q;  1VQ6 A;  3NXW A;  4P75 A;  2F03 A;  2WIN B;  1SE3 A;  2NBF A;  4NXM L;  3SK8 A;  4RHR A;  4BBR B;  1X3G A;  2EDG A;  3G4S A;  2A68 D;  4O2D A;  3K58 A;  3SEB A;  2DGY A;  4POF A;  2VQE Q;  3L7Z C;  1PRT F;  5G3L D;  4DNI A;  5GAG C;  4YY3 L;  1LTL A;  1EQR A;  2CW0 C;  1A3V A;  2OXP A;  1MHW C;  4X66 L;  5BR8 L;  1FGB D;  3HKZ B;  3FPU B;  1PDQ A;  1JJC B;  3H94 A;  3HKZ E;  5FKA C;  1BNZ A;  1B50 A;  3QWN A;  5E4W C;  2IL8 A;  3AEV A;  1NE3 A;  5EPJ A;  4DV3 Q;  3DM1 A;  3LNN A;  5FO7 B;  3K81 C;  3URY A;  1I94 Q;  1Q81 C;  5C3E B;  1PXU A;  2F3W A;  4A3I B;  3U4Z A;  4X65 L;  1IZ6 A;  1J6Q A;  2NVY H;  1S3O A;  1K9M C;  3Q0A A;  1LAC A;  2K01 A;  2NZ1 D;  4DUY Q;  1GUW A;  1RTO A;  4HJ7 A;  2E2H H;  4KD4 A;  2VY3 A;  2K75 A;  1I50 B;  1GXD C;  4NMZ A;  1QE6 A;  5CMD A;  5IP9 G;  1PH4 A;  4LF8 Q;  1EEF D;  4HED A;  1CUK A;  4LF5 L;  2JEA I;  1EOT A;  4DXF A;  4O42 A;  3EN2 A;  1M90 C;  3NBH A;  3TME A;  1S5C D;  2XRS D;  1TU2 B;  3TQY A;  2UUB L;  3AFQ A;  3DHQ A;  3OWF A;  1LV9 A;  2HIX A;  4U68 A;  3P20 A;  1HCZ A;  4A3M B;  2PO4 A;  1TS2 A;  5M3F B;  1A6X A;  1HQR D;  5ELO A;  3UE1 A;  2KHS A;  2A69 C;  1GUG A;  2OQK A;  3PIP A;  1SYB A;  1IBL L;  1KLG D;  1BF4 A;  1NBW A;  3PQI A;  4QB4 A;  3NHH A;  3KBX A;  5KNC A;  1F9S A;  4R4Q A;  4X3T A;  3F2U A;  2K05 A;  1O7Y A;  2C35 B;  4UAI A;  4CBV A;  4L5T A;  2ASB A;  4K0K Q;  1STA A;  1R9T H;  3MHB A;  2NTT A;  1BVS A;  1Y1V G;  4KHP Q;  4IQZ A;  3Q8D A;  4GKK Q;  2RDH A;  4K8J A;  5KGU A;  1C7Y A;  3S9W A;  2AMC B;  4B9W A;  3PUX A;  4QY7 A;  1HR0 W;  4GNX C;  3MZ5 A;  4FNF A;  1EYD A;  3P1H A;  3J81 c;  4JBW A;  2XSC A;  3HOU H;  4OWX B;  5G3L F;  5IP7 G;  4HR7 B;  1CSQ A;  2KCC A;  2IHE A;  2O5J C;  1ET9 A;  3SVM A;  3G48 A;  4CDE C;  2VQF L;  4A3F B;  4A3D H;  2PW7 A;  3E3X A;  2ICE C;  3K7A B;  2I07 B;  2E75 C;  4IUU A;  1MD2 D;  3GQB A;  4FDB A;  1D7Q A;  1PH3 A;  4DPG A;  3WOE A;  1UE1 A;  1J9O A;  1YNN D;  5JEA H;  3A7L A;  3NWS A;  3GD7 A;  3BDO A;  1AP0 A;  1YBY A;  2B2W C;  2WKD A;  1K0R A;  5EKK A;  3IAY A;  2RCF A;  2JA7 B;  4AQY L;  4A76 A;  4JBJ A;  3QO2 A;  4JI8 Q;  3FHW A;  5JPM C;  5EJW A;  4A3J G;  3RR5 A;  1UUP A;  2F0D A;  2KJX A;  2BDO A;  4DV7 Q;  1EIF A;  4XTC S;  2MPM A;  3T4A C;  3X3M A;  3H0G B;  3KDF B;  4OGQ C;  2CWA A;  1PH5 A;  3STB C;  2R7Z G;  1KQS A;  1GJX A;  4K5V A;  4YIJ A;  1HNZ Q;  4FF1 A;  3T51 B;  1TVX A;  2O2L D;  4MTK A;  5IOC A;  3ULJ A;  4X64 Q;  1H9S A;  1Q8I A;  2DJF C;  3MXN A;  1MJC A;  2F0J A;  2EXD A;  3WOF A;  1J5E L;  2IPK D;  1XX8 A;  3PO3 G;  4OO1 H;  3S1Q B;  2B2U A;  4OWW B;  1EY6 A;  1JOO A;  2B3G A;  2N78 A;  4DV4 L;  1LT5 D;  4N9T A;  5FOB B;  1L0X B;  4DR1 L;  2VNU D;  1VMP A;  1KDC A;  3GTO B;  3NUC A;  1HTL D;  1Y14 B;  2CW0 D;  3SK5 A;  1EZ8 A;  1EWH A;  1Y1W G;  4JC0 A;  1SFO B;  2OWO A;  1CQF A;  4BBR H;  3MAQ A;  3DLL A;  4GOP C;  3A8J E;  4PMW A;  2E8G A;  2OTL A;  3BZD B;  5JAV A;  2PYK A;  4JI1 Q;  1G6Z A;  1MGS A;  3I91 A;  4IUN A;  1HFN A;  4RWS C;  4I7Z C;  1FYC A;  3A0J A;  4HMJ A;  4J15 A;  3ULP A;  1SEB D;  5IGD A;  1F2L A;  1STB A;  1K8O A;  4A3G G;  1U4M A;  4KHV A;  4JOI C;  4YCW A;  2OEO A;  1HNX L;  4UP8 A;  3JAM E;  1VQE A;  2EPB A;  3K7U C;  4QUF A;  3BS1 A;  1QIL A;  1H9K A;  5C3E H;  4CKB A;  4A3I H;  4YCU A;  1X32 A;  1SE4 A;  2GVA A;  1MJE A;  1KDB A;  1WTP A;  1L1O A;  3WWV A;  3KLR A;  4K14 A;  3K5N A;  3B6Y A;  4XQQ A;  1I50 H;  2YV5 A;  2A69 D;  3TP7 A;  2F0K A;  1S5B D;  3S1N B;  1RCV D;  1N36 L;  4YWM A;  1G6P A;  2I5H A;  4LFA L;  3GTP B;  3J80 i;  1HHV A;  1PH1 A;  4OIK A;  5IT9 L;  4DKA C;  3HS0 C;  1JCK B;  4CDD C;  1VQB A;  1N33 Q;  1JWS D;  1VQI A;  3I4M B;  3A7A B;  4A3M H;  5DLQ E;  1HRJ A;  5M3F H;  1DXM A;  3GO5 A;  2EY5 A;  1GUT A;  3J81 E;  3FP9 A;  5C3X A;  2Q2T A;  2EYM A;  1N34 L;  1VCI A;  5M5X B;  3TRE A;  1YJ9 A;  1STN A;  2R92 B;  1LTB D;  4WJW A;  4IFD H;  1J8I A;  3BZC A;  2EJM A;  5IT9 c;  3PV0 A;  1PH8 A;  3SDZ A;  5I2X A;  2VL6 A;  4DR2 L;  1VQA A;  2OTJ A;  3DEP A;  4XYQ A;  4QCL A;  3VYT A;  3RUZ A;  1CZW A;  1CKM A;  4HSV A;  3K0Y A;  5KYL A;  1XTC D;  1IW7 D;  1XMO Q;  2F0M A;  4JI2 Q;  3KF8 A;  4YWL A;  4G57 A;  3CP0 A;  2KBN A;  1XNR Q;  2UUA L;  1W6K A;  3E9H A;  1MSG A;  2I5L X;  3Q23 A;  2PNH A;  4CDC C;  3Q24 A;  5IYD H;  2B8F A;  1T5E A;  4HCS A;  1XNQ Q;  1OXU A;  1UE7 A;  4CHT B;  2VW9 A;  2A19 A;  1YHB A;  2M2L A;  3S15 B;  2Z8L A;  1ILP A;  3UE0 A;  4A3F H;  1JOK A;  4Y52 H;  1YNX A;  1JMC A;  1YNJ D;  3K7A H;  3OMG A;  4TSS A;  4DAY B;  1AEX A;  2HQE A;  4K6D A;  5ELF A;  3OPO A;  4JW0 A;  2K50 A;  3SE0 A;  2NVT B;  3STB D;  5FLX c;  4QF4 A;  1D2B A;  4R4T A;  4N8F A;  1Q3L A;  3PIO A;  3A5Z B;  2LXJ A;  2Y0S G;  1VMC A;  1JJ2 A;  2JA7 H;  3AFP A;  2YTV A;  4GN4 B;  5EBC A;  3EA6 A;  3CF5 A;  4OON A;  1BUV T;  3CXC A;  1VQP A;  4K8I A;  3EBE A;  5FJ8 G;  4YWK A;  3UDI A;  3T56 B;  4FXG C;  4DUZ Q;  4K5W A;  1WTV A;  3H0G H;  4G7O C;  4KN7 C;  5C0X G;  1BCP B;  3H3V H;  1HR0 L;  1Z9F A;  1X3P A;  4B3M L;  5FO8 B;  4KV6 A;  4NXN Q;  1WJJ A;  1EIG A;  1YIT A;  3CPW A;  2NVQ B;  3I90 A;  1VF5 C;  4NXM Q;  4TKO B;  5LL6 S;  5JVG 3;  3G71 A;  3NWT A;  4UDU C;  5GAH C;  4JK1 C;  1WTW A;  2D0O A;  2DNC A;  3VYS A;  1IYU A;  2QGQ A;  4DR5 L;  2LMC B;  3M7G A;  4C3H B;  2JA8 G;  1NMG A;  1QVF A;  4BBS G;  3S1Q H;  1SAP A;  1QVG A;  4LFB L;  1L0Y B;  1LTA D;  4QUC A;  1Y69 U;  1BBX C;  4LF6 Q;  3AQQ A;  3GTO H;  4A3L G;  3F2D A;  3I3C A;  1CZG A;  2RDG A;  4HCE A;  4GNX A;  1HUN A;  3ER0 A;  5GAD C;  1VQC A;  1SFO H;  1SJH D;  4RKL A;  1BCP D;  4BY7 G;  3DWQ A;  2K04 A;  4AH6 A;  1IBM L;  1SJE D;  3A56 A;  3OYY A;  4KI0 A;  1BBU A;  4LF5 Q;  2XIW A;  3SK4 A;  3K5L A;  4JI0 L;  4FYD A;  3KUP A;  3W3A A;  2NN6 G;  3VR4 A;  1SSO A;  3T13 A;  5IYB H;  2L5T A;  4DR6 Q;  2B2V A;  4L5S A;  4JCV E;  1EWI A;  1A0I A;  3A55 A;  2NUC A;  3CCM A;  3NSW A;  4HID A;  1QZH A;  2HUG A;  3VR6 A;  2A1A A;  2RSN A;  4ZUJ A;  1VQL A;  4KD3 A;  1W3S A;  4TQU S;  3D4D A;  1Q90 A;  3IKJ A;  4I7A A;  3U58 A;  1SNQ A;  3S2H B;  3RLO A;  2PMZ B;  3SK6 A;  2WII B;  2HCI A;  1PRT B;  5D3D A;  3I73 A;  1LUZ A;  2PMZ E;  3M4O B;  1RKN A;  2TSS A;  1IBL Q;  2UXB Q;  1V8Q A;  3DEO A;  4YHH L;  2VB3 X;  1Z7T A;  2WFW A;  4RA8 A;  1ZEQ X;  3NK9 A;  4L8J A;  2BA1 A;  1HZC A;  3IFT A;  3J80 L;  4L5Q A;  2XNA C;  4GLX A;  2F0O A;  5IWA Q;  3L0O A;  1UNS A;  1NY4 A;  1SMX A;  4PZ8 A;  1FR3 A;  1TKW B;  3S1N H;  1PMR A;  2KEN A;  1I3Q B;  5IE8 A;  3GTP H;  4K5X A;  2HT1 A;  3JC6 6;  3KLS X;  2BDN A;  3N52 A;  2KCN A;  3RD4 A;  1Y1V B;  3G6E A;  1DOM A;  5JVH 3;  1G51 A;  1KHI A;  1OTC A;  3I4M H;  1EY4 A;  3D31 A;  3HEJ A;  4PZ6 A;  4JBK A;  3S17 B;  2EY2 A;  2VQF Q;  2CQO A;  4DN4 M;  1NSN S;  5M5X H;  5AJ3 L;  2ICI A;  2YTX A;  4DNT B;  1VQK A;  3PO2 B;  2R92 H;  1WFQ A;  2ZM6 L;  4UP7 A;  1EY5 A;  1SNO A;  3P75 A;  3HOY B;  3OWE B;  1VF7 A;  2LY7 A;  4Q5V A;  1BR9 A;  1XMQ L;  2JA5 B;  1KD1 C;  2F0P A;  1QNK A;  1QWY A;  3Q6S A;  3PIP 3;  2RVL A;  1JQY D;  1ILQ A;  1N8R C;  1EYA A;  1CQV A;  4C1N K;  3CCJ A;  2ZXR A;  4AQY Q;  1U4R A;  1JR0 D;  1S4Z A;  1BCP F;  2F0G A;  1QG7 A;  5IIF A;  2F3V A;  4R4O A;  5C44 G;  3DXJ C;  3BDL A;  5CYU A;  5ELC A;  5D65 A;  1L1O C;  2QKI C;  3DWA A;  4WRD A;  4A3J B;  2B63 G;  1E2W A;  1XPR A;  1X65 A;  2VS1 A;  2JA9 A;  3I4N G;  3GTK B;  4AYB E;  2R3Z A;  2PCF B;  4IAL A;  2R7Z B;  3Q22 A;  4JOI A;  4R8I A;  4JV5 L;  1IBK Q;  4JYA Q;  3SXH A;  2BH8 A;  2NVT H;  3J7Z C;  1NR2 A;  3I4L A;  3V96 A;  1TQO A;  2K28 A;  2C9O A;  1HNW L;  4TVA B;  1J5E Q;  1FVI A;  3E0E A;  1RJT A;  5C0X J;  4APV A;  2A74 C;  1DOL A;  3NTI A;  1K3R A;  3TS2 A;  4HIO A;  3TDQ A;  2MP1 A;  4DK6 C;  4IPH A;  2IX3 A;  1BBW A;  3PO3 B;  4B3R L;  5LMU L;  4NDX A;  1SYG A;  1QZG A;  2OF1 A;  4PG3 A;  1B53 A;  5C4X G;  3J7A F;  4GKJ Q;  1YIJ A;  5KEE A;  4UPA A;  1F9P A;  2NVQ H;  5HGT A;  1PA6 A;  2SOB A;  3MXN B;  4ID6 A;  2UXD Q;  1B9N A;  4DV0 L;  2X6G A;  2IT1 A;  4LFC L;  3KLS A;  4IZ8 A;  1I4Q A;  2EY1 A;  3CKI B;  4EGV A;  1HA6 A;  3CAM A;  1PH9 A;  3RZO B;  5KRU A;  3R2I A;  3PUZ A;  2EY6 A;  3MC0 B;  2K7V A;  2Q8T A;  3K5O A;  4C3H H;  4LF9 L;  5E7N A;  4KMU C;  1ENC A;  1FL0 A;  1B4O A;  2ALY B;  3C3L A;  1IXR A;  1I5F A;  2DN8 A;  4RG1 A;  3GTL B;  2RHS B;  1H9R A;  3D0F A;  3E0J A;  4CKC A;  1MBY A;  2MQH A;  1LT3 D;  4JI6 L;  1PYB A;  3A8I E;  4JI4 L;  5C0X I;  3NTH A;  3HOZ G;  5GQO A;  2CWP A;  4OXP A;  1OXS C;  4R4C A;  4L6T B;  5IGG A;  3RN2 A;  4UY8 C;  4CJ1 B;  1A3U A;  1A15 A;  1S72 A;  1WYD A;  4JPB W;  4HMI A;  4QIW B;  1Q12 A;  3H3V C;  2K52 A;  5LMN W;  4KY7 A;  5D14 A;  1MIU A;  1I4H A;  4G7Z C;  2V1C C;  1K83 B;  1WTH A;  1PTO C;  3JAM L;  5F2D A;  3S2H H;  1XWE A;  1N34 Q;  2NTS A;  4H02 A;  2F0T A;  3M4O H;  4C3I G;  4GLA C;  1V1O A;  4J8Q A;  1NMF A;  3PUW A;  4FO2 A;  4HJ9 A;  4DV5 Q;  1LYL A;  2PI2 E;  1V1P A;  1SND A;  4MTN A;  2ZXP A;  2AQ2 B;  2HDL A;  3NEL A;  4FF2 A;  5A35 A;  2YU9 B;  4MN3 A;  5H1S E;  3D3R A;  1TWH B;  4JI7 Q;  1I6V C;  5C5L A;  3KJP A;  2BH2 A;  2N55 A;  4A4I A;  1I3Q H;  3I7F A;  1A2U A;  2NN6 I;  1IYV A;  1DD2 A;  4L5R C;  5CV4 A;  1DM0 B;  4DAP A;  1I4R A;  5ELN A;  4DAM A;  4JI5 L;  5JJI A;  1U0L A;  2X6L A;  3KLW A;  1ESR A;  2XTI A;  3AMU A;  3S17 H;  2B39 A;  3FKI B;  1KRS A;  5IP7 H;  1X54 A;  4A3E B;  5COR A;  3PO2 H;  1VQ4 A;  2B2V C;  5CV8 A;  1O7I A;  5KND A;  3LX0 A;  5CV5 A;  3HOY H;  3SHL A;  3R2T A;  4FP5 D;  4P71 A;  3CMA A;  2F4V Q;  4EQP A;  4EQO A;  1R4P B;  1E7Z A;  2JA5 H;  1TWC B;  5K5P A;  3NBI A;  1BQQ T;  4R9W A;  1VQ9 A;  2ZT9 C;  4IPD A;  2SEB D;  3H91 A;  1ZKO A;  3DMU A;  2J0T D;  2Q2I A;  1VQM A;  4O0A A;  2RA4 A;  2A73 B;  1GUS A;  4J6H A;  4C2M B;  3C1F A;  4A3B G;  3GV3 A;  1B2T A;  4DR7 L;  1S5D D;  2MJ8 A;  1C48 A;  4S3S A;  4BA2 I;  5ELE A;  5JEA G;  3LWE A;  1N32 Q;  1STE A;  2UU9 Q;  4A3J H;  4RH6 A;  2LS0 1;  1HR0 Q;  3HRZ C;  4B3M Q;  2EJF C;  5BN4 A;  2WAC A;  3C1E A;  4LW1 A;  5GAE C;  3F2B A;  3GTK H;  2E74 C;  4JI3 L;  2WAQ G;  2Z4I A;  3CCV A;  2K03 A;  2R7Z H;  4P74 A;  3KOJ A;  2I46 A;  1VQ8 A;  1I4P A;  1HPC A;  1YVC A;  2Q8I B;  5TSS A;  2JA6 B;  3OIP A;  2NVX B;  5EQ0 A;  2JE6 I;  1I4G A;  4ZYS A;  3PF4 A;  2F4I A;  1KNA A;  3AB9 A;  3HOV B;  3CU7 A;  4BS9 A;  2F0E A;  2FMM A;  3W1G A;  4FXD A;  1GVP A;  2FJ2 A;  2WB1 G;  4JVZ A;  4KY6 A;  1PYW D;  3PIO 3;  2JA8 B;  3PO3 H;  2MUY A;  4BBS B;  3HZX A;  2KED A;  5J1Z A;  2VUM B;  1PHJ A;  3KF6 B;  4OO1 G;  1KLU D;  4LNQ A;  4HJA A;  5IGB A;  5I9O A;  2KEC A;  2BOS A;  2QDB A;  2F0H A;  2ZJR A;  3RMH A;  1F77 A;  3A8K E;  3F2C A;  2E2J B;  2LSS A;  1Y8N B;  4JI0 Q;  3QOJ A;  2JN4 A;  2P5Z X;  3A5U A;  4LMQ D;  4BY7 B;  1VQ5 A;  3MWY W;  4CJ2 C;  3BU2 A;  3CME A;  1I6H B;  1TXY A;  3I72 A;  3RZO H;  1JC7 A;  3PMF A;  4IUQ A;  4BY1 G;  1KXL A;  4E6I A;  2ZXO A;  4DU9 A;  4DR3 Q;  3TP5 A;  3OTO Q;  2KOL A;  1B9M A;  1UE6 A;  1B3Q A;  2X69 A;  3GTL H;  1B1Z A;  2KEE A;  4H13 C;  3PGZ A;  2UUC L;  1CA5 A;  3MVV A;  1E1T A;  4YHH Q;  4DNR B;  2AWO A;  2XN9 C;  3CW2 C;  5FK9 C;  3T1Y Q;  3HKZ G;  2VQE L;  1Y8P B;  1PTO D;  3UI2 A;  1H9M A;  3R3O A;  2OCE A;  3OW7 A;  1BOS A;  2Z1C A;  5COY A;  2K5D A;  1JWU D;  2EIF A;  3TRZ A;  1D5M C;  5C3E G;  2K1B A;  5I2Y A;  4A3I G;  2ID0 A;  3T53 B;  1SE8 A;  4OEL B;  2F3I A;  4DV3 L;  1I94 L;  1Q46 A;  5BN3 A;  4B3S Q;  1P16 A;  3OW2 A;  1K83 H;  2FMC A;  4MZ9 A;  1YHA A;  2L0C A;  4DUY L;  4HTH A;  3T1H L;  1CTM A;  1TS3 A;  3EVQ A;  1L0W A;  2F0N A;  1E2V A;  3P7J A;  1PFB A;  1K8M A;  1T9H A;  1V43 A;  1X3Q A;  3KJO A;  4KKU A;  4LF8 L;  5BN5 A;  3H09 A;  3IFD A;  1KDA A;  2H5X A;  1BXT A;  4BXX H;  1SDF A;  4XQN A;  1XYI A;  1C8C A;  4A3M G;  3AU7 A;  4X3U A;  1XMQ Q;  2CH4 W;  3CCR A;  5NUC A;  2L1B A;  5FO9 B;  1Q82 C;  2YU9 H;  5FLM H;  2DJG C;  1TWH H;  5CV7 A;  3CPF A;  3T16 A;  3DUZ A;  4UHV A;  1B3A A;  2RDF A;  1O7L A;  4DV1 L;  4FF4 A;  2RBM A;  2ZJQ A;  5C44 B;  4G7H C;  5CBA E;  5LMN L;  4QQB X;  4XQJ A;  1EYC A;  1HJP A;  4KJN A;  5D3I B;  4DR4 L;  2PZU A;  3HG9 A;  3AYH B;  2Z9H A;  3FKI H;  1DZ1 A;  2K5W A;  1G2T A;  2L15 A;  4KN4 C;  5LL6 X;  4A3E H;  2XGT A;  5C5M A;  4GKK L;  4B08 A;  1NUC A;  3S14 B;  1L2F A;  3I4N B;  4DV6 Q;  4OX9 L;  4JV5 Q;  1DJR D;  4ALP A;  2E76 C;  1TWC H;  4RGT A;  4X62 Q;  1PRT C;  3CHB D;  3C46 A;  4Z9C B;  4M8A A;  5A2Q E;  4A3F G;  5JEA J;  3HFZ B;  4GOP B;  1S40 A;  2CH4 A;  3VR5 A;  1HNW Q;  1PTO F;  4KJO A;  2D62 A;  4I65 A;  3ND8 A;  2SDF A;  3G6J B;  4C2M H;  1VQF A;  1K3B C;  1H9J A;  3LWU A;  1M1K C;  2R93 G;  4XIG S;  5AFW A;  1AN8 A;  5M9O A;  1PFS A;  1SBB B;  2RHQ B;  3MA2 B;  2B2T C;  1D6E C;  2R7F A;  4YCV A;  1ML0 D;  4GLV B;  1EIH A;  1M8A A;  4V0B A;  3F8T A;  2H1E A;  1C0A A;  1SMY C;  5CR3 A;  1ASY A;  4ABN A;  5C0X H;  4JI8 L;  2MNA A;  4LFC Q;  5K36 H;  1MSH A;  1RHP A;  1KAB A;  1PZK D;  4DV7 L;  2QIL A;  2JA6 H;  4A3C H;  3GDE A;  5HUR A;  1ESF A;  2NVX H;  3SGI A;  3GTQ B;  2AUJ D;  4YY3 Q;  2AQ3 B;  1WVL A;  3D6W A;  1VQH A;  4ZLT F;  3HOV H;  2LKV A;  1OO9 B;  4X66 Q;  5BR8 Q;  1II3 A;  1JB7 A;  2K14 A;  3NQI A;  3HOW G;  2KA7 A;  4X3K A;  1Z6H A;  1VQ7 A;  2O5I C;  1HNZ L;  1M4V A;  3I55 A;  4CDF C;  1QUQ A;  1U4L A;  2JA8 H;  4Y7N B;  2F0V A;  4BBS H;  2Z0S A; 
#chains in the Genus database with same CATH homology
 2FIN B;  5C4J B;  2MGS A;  3J7Y W;  4FF3 A;  2E2I B;  4DFA A;  1W6J A;  2EYJ A;  4RGM A;  3HOZ B;  2OT2 A;  1GHK A;  3HP3 A;  2QCP X;  2G9D A;  3K6O A;  4K2K A;  3I70 A;  1G2S A;  1FNU A;  2K33 A;  2NVY B;  2NN6 H;  3ERQ A;  4N9P A;  5CGK A;  1IKL A;  3D6C A;  3K59 A;  3M3Y B;  1IL8 A;  3VA7 A;  3R8B A;  4PQX A;  1PZI D;  1ZXT A;  1DON A;  1Q1B A;  2QF7 A;  2KVM A;  4OO1 I;  3MFG A;  4C3I B;  2IX1 A;  2EYH A;  2Z4H A;  3R93 A;  5I6W A;  1AFP A;  5IT9 E;  1QB5 D;  4O1N A;  4IUT A;  4IUR A;  2L11 A;  4NW2 A;  1D5Z C;  1QOH A;  4KK7 A;  5IGC A;  4L63 B;  5KIX A;  1AZQ A;  3K5M A;  3HGB A;  1JE4 A;  5CV6 A;  1UAP A;  3E5S A;  5IGE A;  1RD9 D;  1SNM A;  2B8G A;  5M5W B;  3BDC A;  4DK0 A;  2H4O A;  2EYP A;  1EQV A;  3M4Y A;  1SNC A;  3W2D A;  1CI3 M;  4C1N I;  4LAA A;  4CKE A;  3DWP A;  1EU4 A;  4KKS A;  5FLX E;  2D2C C;  2A6E C;  2WP8 J;  3TP8 A;  5DM7 3;  2D9U A;  2HDM A;  2EE1 A;  3FEW X;  3VA5 A;  1CK1 A;  4A3B B;  3U9O A;  2BE5 C;  3TSS A;  3OHX C;  4C3J G;  1WTQ A;  4DAY A;  3GV6 A;  5E4X A;  1EU3 A;  1JOR A;  3PUV A;  2TMP A;  2VB2 X;  2WAQ B;  4EQN A;  3M85 A;  1MI2 A;  4PMB A;  4P2C B;  1ENA A;  4BA1 I;  4DGZ A;  4NP5 A;  2JXM B;  3CRK C;  4DF7 A;  4U67 3;  2XRQ D;  1HA5 A;  1OXV A;  2KUM A;  1JOQ A;  1LO5 D;  4H0L C;  2WB1 B;  3D4W A;  1H9S B;  2F0L A;  2CQA A;  2V4D A;  4J1M A;  2NYZ D;  1Y1W B;  4XT3 B;  1NCV A;  1LTI D;  1C4Q A;  1KTK A;  2RKS A;  1PFN A;  1O80 A;  3N6R A;  3BYT B;  4BY1 B;  1G8Z D;  4B9X A;  2EYO A;  1STH A;  2GA4 B;  4C3H G;  1TS5 A;  3OIQ A;  3S2D B;  4A3G B;  1PZJ D;  3GTM B;  1U9R A;  2SNS A;  1EFI D;  2A6H C;  2DY8 A;  1CFM A;  4RFB A;  4MHE A;  4PNY A;  1CHP D;  2RSO A;  1SYF A;  4XT1 B;  1O7Z A;  1LTR D;  3MTS A;  4F87 A;  1A2T A;  3O13 A;  1GOZ A;  2EVB A;  2K32 A;  3U9S A;  3S1M B;  3J80 E;  4NKL A;  3V2T A;  3C2P A;  3RZD B;  4Q0F A;  1EY8 A;  3CQZ B;  3FPP A;  4RCO A;  5LHY 1;  2B2T A;  4DXG A;  1RTN A;  3GTJ B;  4ZRZ A;  3H6M A;  1LTG D;  3VR3 A;  4F88 A;  1LTT D;  1F2M A;  2L9H A;  2F0S A;  4LK1 C;  2L4N A;  1JWM D;  1EQT A;  2Q8R E;  3NE5 B;  3EFX D;  3J81 L;  1IHZ A;  1EL0 A;  4KKT A;  4ME5 A;  2R6G A;  1AW7 A;  2A6E D;  5C4Z A;  2J7Z A;  4KTA A;  1STG A;  3BVZ A;  3ND9 A;  4H44 C;  5IOD A;  1WTX A;  1SXT A;  2AUK A;  2IX0 A;  1TII D;  5DM6 3;  2BE5 D;  4ODG A;  1TT2 A;  5CC4 A;  4C56 C;  4HSP A;  3V05 A;  1FNW A;  3RLF A;  1GHJ A;  1HTP A;  2B2Y A;  2AWN A;  2Y0S B;  2F0F A;  3MXU A;  1IW7 C;  2F1M A;  4HAE A;  2R93 B;  1FD7 D;  1NR4 A;  2PQE A;  3ZYY X;  2IWH A;  3OOC A;  3M7N A;  1HFG A;  2K5Q A;  5EKL A;  5CBE E;  1YNJ C;  2XWB B;  1DYQ A;  3FRP B;  5A2Q L;  5JJZ A;  4IUP A;  3ERO A;  2YYZ A;  3KBG A;  2E2D C;  2PNR C;  5IGF A;  2FHT A;  1HXY D;  1ZYR C;  4OIJ A;  2M00 A;  3HOW B;  3FDT A;  1PTO B;  4OL7 A;  2N88 A;  1G29 1;  3TZU A;  3K57 A;  1SYC A;  1GUO A;  5M3M B;  2JSO A;  4V19 0;  1LLR D;  1ET6 A;  3TBI B;  5C3W A;  1T5X D;  1EY9 A;  2PW5 A;  1VDZ A;  3OMC A;  3S1R B;  4CJ0 B;  3NP8 A;  2K6A A;  1Z47 A;  5I4D A;  4IUV A;  1S5F D;  1TWA B;  2A6H D;  1EY7 A;  4MIU A;  3WDN A;  3S16 B;  1RDP D;  1JB3 A;  2L55 A;  4WOR A;  2NB0 A;  1TR5 A;  1SYD A;  3TP6 A;  1EEI D;  1GUN A;  4DA2 A;  1TWG B;  3HOX B;  2EZV A;  1U4P A;  3FMC A;  4RKB A;  1BCP C;  2F0Q A;  3BG3 A;  1SE2 A;  3BVG A;  2O4X A;  3BVM A;  3QG1 A;  2EXZ A;  4ZAI A;  1E0B A;  3GTG B;  1SNP A;  2IJ0 A;  3TZD A;  1ONL A;  3TN2 A;  4PMC A;  1R4Q B;  4ILW A;  1D1K A;  4X3S A;  5KYI A;  2DNE A;  4ZUI A;  5T1I A;  3MEH A;  1CA6 A;  4A93 B;  2FFK B;  3QJY A;  1TS4 A;  5ELD A;  4IFD G;  2AQ1 B;  4ZK9 B;  3VR2 A;  1G91 A;  5EGT A;  4KHZ A;  1TY2 A;  5EBD A;  1SYE A;  4K6L A;  3A54 A;  1WCM B;  3J7A V;  2JYO A;  1OXX K;  2BCO A;  5EPL A;  3EJI A;  2B63 B;  1LTS D;  1TY0 A;  4C3J B;  5M5Y B;  1BO0 A;  3GP7 A;  1WTR A;  4G4K A;  1STY A;  4ZKC B;  4RCN A;  5FLX L;  1Y8O B;  2CHB D;  1TWF B;  2R61 A;  3FVQ A;  3QOL A;  4TRD A;  5KNB A;  5E1F A;  2J4X A;  2EYF A;  1BDO A;  2SNM A;  3BYY B;  2L12 A;  2RQX A;  1CT1 D;  3L3O C;  1XXG A;  5T1G A;  3NPP A;  2MHV A;  2WV6 D;  2G9H D;  2QEJ C;  4K2L A;  5C4X B;  5J39 A;  2CVR A;  2A5H A;  1ZYR D;  4XDX A;  5JOB A;  1LT4 D;  1RF2 D;  4FVM A;  1CM9 A;  4A3K B;  2ENB A;  1LAB A;  3KK7 A;  5E3F A;  1WD0 A;  2LFN A;  2PPB C;  5K36 G;  1DCZ A;  3QIA A;  4EVO A;  3MXG A;  1PTO H;  4RAU C;  1KNE A;  1B44 D;  4ULL A;  4RHS A;  4IN3 A;  4XXE A;  2B2Y C;  3I8Z A;  1KAA A;  4QMG A;  1F2Y A;  1F9Q A;  2EYL A;  5DNF A;  3CRL C;  2A68 C;  4BWG B;  2BA0 A;  1QCB D;  4F8M A;  3NQT A;  4KY5 A;  2E2H B;  5EPK A;  4F7X A;  5ISR A;  5JPN C;  1O78 A;  2KQ3 A;  3PUY A;  1EZ6 A;  2XWJ B;  2F0W A;  4DAV A;  1FNV A;  1DOK A;  3MFY A;  1D5X C;  2B2W A;  2PZT A;  2C5C A;  1PFM A;  1HQM C;  1Q1E A;  2EJG C;  4DK1 A;  1E2Z A;  3X3N A;  5CV9 A;  5I6Y A;  2B2U C;  1EWC A;  1UEA B;  1V1P B;  1OXT A;  5EKI A;  1I4X A;  1R9T B;  1PLF A;  3L9A X;  1QJO A;  4ZKB B;  4IFD J;  2EOT A;  3D8G A;  2DY7 A;  2D5D A;  3ONA B;  4RGO S;  1A3T A;  3HOU B;  4PV1 C;  3OSO A;  4OHJ A;  3D4R A;  1F2Z A;  5DAU A;  4A3D B;  1PRT D;  1WD1 A;  1AZP A;  2PZW A;  3IL8 A;  5DEH A;  4WFN 3;  4M1U B;  5C6A A;  3MXP A;  2NWG A;  3VYU A;  1ICW A;  2IW3 A;  1HUM A;  4H7B A;  4ZQ3 A;  2JP1 A;  3QB3 A;  2F0U A;  1EY0 A;  1D1I A;  5C4H A;  4R8N A;  1F9R A;  1YNN C;  1QNU A;  1CHQ D;  1SMY D;  3EQL C;  4AYB B;  4IFD I;  2F0I A;  3VYR A;  2VXW A;  2XVS A;  3NTK A;  3E6Z X;  3SR1 A;  4CGY B;  3G7L A;  4HN7 A;  1JIC A;  1IKM A;  4LJZ C;  3ITP A;  1ENF A;  4GZY C;  5J22 A;  1S5E D;  4XYO A;  2M9V A;  5ELB A;  2WKC A;  1LT6 D;  2HCC A;  4FXK C;  4RGN A;  5I9P A;  1NAP A;  2JEB I;  1WTO A;  1ROD A;  3NXW A;  2F03 A;  2WIN B;  1SE3 A;  2NBF A;  3SK8 A;  4BBR B;  4RHR A;  2EDG A;  2A68 D;  3K58 A;  3SEB A;  3L7Z C;  1PRT F;  5G3L D;  2CW0 C;  1A3V A;  2OXP A;  1FGB D;  3HKZ B;  3FPU B;  1PDQ A;  3H94 A;  5FKA C;  1BNZ A;  1B50 A;  3QWN A;  5E4W C;  2IL8 A;  5EPJ A;  3DM1 A;  3LNN A;  5FO7 B;  3URY A;  5C3E B;  1PXU A;  2F3W A;  4A3I B;  3Q0A A;  1LAC A;  2K01 A;  2NZ1 D;  1GUW A;  1RTO A;  4KD4 A;  1I50 B;  1GXD C;  4NMZ A;  1QE6 A;  5CMD A;  1EEF D;  4HED A;  2JEA I;  1EOT A;  4DXF A;  4O42 A;  3TME A;  3NBH A;  1S5C D;  2XRS D;  1TU2 B;  3DHQ A;  3OWF A;  1LV9 A;  4U68 A;  3P20 A;  1HCZ A;  4A3M B;  2PO4 A;  1TS2 A;  5M3F B;  1A6X A;  1HQR D;  2KHS A;  2A69 C;  1GUG A;  1SYB A;  1KLG D;  1BF4 A;  4QB4 A;  3NHH A;  3KBX A;  5KNC A;  1F9S A;  4X3T A;  3F2U A;  2K05 A;  1O7Y A;  4UAI A;  4CBV A;  1STA A;  3MHB A;  2NTT A;  4IQZ A;  2RDH A;  4K8J A;  5KGU A;  3S9W A;  4B9W A;  3PUX A;  3MZ5 A;  4FNF A;  1EYD A;  3P1H A;  4JBW A;  2XSC A;  5G3L F;  4HR7 B;  2KCC A;  2O5J C;  1ET9 A;  3SVM A;  4A3F B;  2PW7 A;  2ICE C;  3K7A B;  2I07 B;  2E75 C;  4IUU A;  1MD2 D;  3GQB A;  3WOE A;  1J9O A;  1YNN D;  5JEA H;  3A7L A;  3NWS A;  3GD7 A;  3BDO A;  1AP0 A;  2B2W C;  2WKD A;  5EKK A;  3IAY A;  2JA7 B;  3QO2 A;  5JPM C;  5EJW A;  1UUP A;  2F0D A;  2KJX A;  2BDO A;  4XTC S;  2MPM A;  3T4A C;  3X3M A;  3H0G B;  4OGQ C;  1GJX A;  4K5V A;  4YIJ A;  4FF1 A;  3T51 B;  1TVX A;  2O2L D;  5IOC A;  1H9S A;  1Q8I A;  3MXN A;  2F0J A;  3WOF A;  2IPK D;  1XX8 A;  4OO1 H;  3S1Q B;  2B2U A;  1EY6 A;  1JOO A;  1LT5 D;  4N9T A;  5FOB B;  1L0X B;  2VNU D;  1VMP A;  1KDC A;  3GTO B;  3NUC A;  1HTL D;  2CW0 D;  3SK5 A;  1EZ8 A;  1EWH A;  1SFO B;  1CQF A;  3MAQ A;  3A8J E;  4PMW A;  3BZD B;  5JAV A;  2PYK A;  1G6Z A;  1MGS A;  3I91 A;  4IUN A;  1HFN A;  4RWS C;  4I7Z C;  1FYC A;  4HMJ A;  1SEB D;  5IGD A;  1F2L A;  1STB A;  1K8O A;  1U4M A;  4KHV A;  2OEO A;  3JAM E;  2EPB A;  4QUF A;  3BS1 A;  1QIL A;  1H9K A;  4CKB A;  1X32 A;  1SE4 A;  1KDB A;  1WTP A;  3KLR A;  4K14 A;  3K5N A;  4XQQ A;  2A69 D;  3TP7 A;  2F0K A;  1S5B D;  3S1N B;  1RCV D;  3GTP B;  1HHV A;  4OIK A;  5IT9 L;  3HS0 C;  1JCK B;  1JWS D;  3I4M B;  3A7A B;  1HRJ A;  1DXM A;  3GO5 A;  2EY5 A;  1GUT A;  3J81 E;  5C3X A;  2EYM A;  1VCI A;  5M5X B;  1STN A;  2R92 B;  1LTB D;  4WJW A;  4IFD H;  1J8I A;  2EJM A;  3PV0 A;  3SDZ A;  5I2X A;  3DEP A;  4XYQ A;  4QCL A;  3VYT A;  3RUZ A;  1CZW A;  4HSV A;  3K0Y A;  5KYL A;  1XTC D;  1IW7 D;  2F0M A;  3KF8 A;  4G57 A;  1W6K A;  1MSG A;  3Q23 A;  3Q24 A;  2B8F A;  1T5E A;  4HCS A;  1OXU A;  4CHT B;  2M2L A;  3S15 B;  2Z8L A;  1ILP A;  1JOK A;  1YNJ D;  3OMG A;  4TSS A;  1AEX A;  2HQE A;  4K6D A;  5ELF A;  3OPO A;  3SE0 A;  2NVT B;  4QF4 A;  1D2B A;  1Q3L A;  1VMC A;  5EBC A;  3EA6 A;  1BUV T;  4K8I A;  3T56 B;  4FXG C;  4K5W A;  1WTV A;  4G7O C;  4KN7 C;  5C0X G;  1BCP B;  1X3P A;  5FO8 B;  4KV6 A;  1EIG A;  2NVQ B;  3I90 A;  1VF5 C;  4TKO B;  5LL6 S;  5JVG 3;  3NWT A;  4UDU C;  1WTW A;  4JK1 C;  2DNC A;  3VYS A;  1IYU A;  2LMC B;  3M7G A;  4C3H B;  1SAP A;  1L0Y B;  1LTA D;  4QUC A;  1Y69 U;  1BBX C;  3I3C A;  1CZG A;  2RDG A;  4HCE A;  1HUN A;  1SJH D;  4RKL A;  1BCP D;  3DWQ A;  2K04 A;  1SJE D;  3A56 A;  4KI0 A;  2XIW A;  3SK4 A;  3K5L A;  4FYD A;  3KUP A;  3W3A A;  2NN6 G;  3VR4 A;  1SSO A;  3T13 A;  2L5T A;  2B2V A;  3A55 A;  2NUC A;  3NSW A;  2HUG A;  3VR6 A;  2RSN A;  4ZUJ A;  4KD3 A;  4TQU S;  3D4D A;  1Q90 A;  3IKJ A;  3S2H B;  1SNQ A;  2PMZ B;  3SK6 A;  2WII B;  2HCI A;  1PRT B;  5D3D A;  3I73 A;  3M4O B;  1RKN A;  2TSS A;  1V8Q A;  3DEO A;  2VB3 X;  1Z7T A;  4RA8 A;  1ZEQ X;  3NK9 A;  4L8J A;  2BA1 A;  3IFT A;  3J80 L;  2XNA C;  2F0O A;  1UNS A;  1FR3 A;  1TKW B;  1PMR A;  1I3Q B;  4K5X A;  3KLS X;  2BDN A;  3N52 A;  2KCN A;  3RD4 A;  1Y1V B;  1DOM A;  5JVH 3;  1EY4 A;  3D31 A;  3HEJ A;  3S17 B;  2EY2 A;  4DN4 M;  1NSN S;  2ICI A;  4DNT B;  3PO2 B;  1EY5 A;  1SNO A;  3P75 A;  3HOY B;  3OWE B;  1VF7 A;  2LY7 A;  4Q5V A;  1BR9 A;  2JA5 B;  2F0P A;  1QNK A;  1QWY A;  3Q6S A;  3PIP 3;  2RVL A;  1JQY D;  1ILQ A;  1EYA A;  1CQV A;  4C1N K;  2ZXR A;  1U4R A;  1JR0 D;  1S4Z A;  1BCP F;  2F0G A;  1QG7 A;  5IIF A;  2F3V A;  3DXJ C;  3BDL A;  5CYU A;  5ELC A;  5D65 A;  2QKI C;  3DWA A;  4WRD A;  4A3J B;  1E2W A;  3GTK B;  2R3Z A;  2PCF B;  4IAL A;  2R7Z B;  3Q22 A;  4R8I A;  3SXH A;  1NR2 A;  3I4L A;  3V96 A;  1TQO A;  2K28 A;  2C9O A;  1RJT A;  5C0X J;  2A74 C;  1DOL A;  3NTI A;  3TDQ A;  2MP1 A;  2IX3 A;  3PO3 B;  4NDX A;  1SYG A;  2OF1 A;  1B53 A;  3J7A F;  5KEE A;  1F9P A;  5HGT A;  2SOB A;  4ID6 A;  1B9N A;  2X6G A;  2IT1 A;  3KLS A;  4IZ8 A;  1I4Q A;  2EY1 A;  3CKI B;  4EGV A;  1HA6 A;  3RZO B;  5KRU A;  3R2I A;  3PUZ A;  2EY6 A;  3MC0 B;  2K7V A;  2Q8T A;  3K5O A;  4KMU C;  1ENC A;  1B4O A;  3C3L A;  3GTL B;  2DN8 A;  1H9R A;  3E0J A;  4CKC A;  1MBY A;  1LT3 D;  3A8I E;  5C0X I;  3NTH A;  1OXS C;  4L6T B;  5IGG A;  4CJ1 B;  1A3U A;  1A15 A;  4HMI A;  4QIW B;  1Q12 A;  3H3V C;  4KY7 A;  5D14 A;  1I4H A;  4G7Z C;  1K83 B;  1PTO C;  3JAM L;  5F2D A;  1XWE A;  2NTS A;  2F0T A;  4C3I G;  4J8Q A;  1V1O A;  3PUW A;  4FO2 A;  1V1P A;  1SND A;  2ZXP A;  2AQ2 B;  2HDL A;  4FF2 A;  5A35 A;  2YU9 B;  4MN3 A;  3D3R A;  1TWH B;  1I6V C;  5C5L A;  2N55 A;  1IYV A;  1A2U A;  2NN6 I;  1DD2 A;  5CV4 A;  1DM0 B;  4DAP A;  1I4R A;  2X6L A;  1ESR A;  3AMU A;  2B39 A;  3FKI B;  4A3E B;  5COR A;  2B2V C;  5CV8 A;  5KND A;  3LX0 A;  5CV5 A;  3SHL A;  3R2T A;  4FP5 D;  4EQP A;  4EQO A;  1R4P B;  1TWC B;  5K5P A;  3NBI A;  1BQQ T;  4R9W A;  2ZT9 C;  2SEB D;  3H91 A;  1ZKO A;  3DMU A;  2J0T D;  2RA4 A;  2A73 B;  1GUS A;  4J6H A;  4C2M B;  3C1F A;  1B2T A;  3GV3 A;  1S5D D;  2MJ8 A;  1C48 A;  4S3S A;  4BA2 I;  5ELE A;  5JEA G;  3LWE A;  1STE A;  4RH6 A;  2LS0 1;  3HRZ C;  2EJF C;  5BN4 A;  2WAC A;  3C1E A;  2E74 C;  2Z4I A;  2K03 A;  2I46 A;  1I4P A;  1HPC A;  2Q8I B;  5TSS A;  2JA6 B;  3OIP A;  2NVX B;  5EQ0 A;  2JE6 I;  1I4G A;  4ZYS A;  2F4I A;  1KNA A;  3AB9 A;  3HOV B;  3CU7 A;  4BS9 A;  2F0E A;  2FMM A;  4FXD A;  2FJ2 A;  4KY6 A;  1PYW D;  3PIO 3;  2JA8 B;  2MUY A;  4BBS B;  3HZX A;  2KED A;  5J1Z A;  2VUM B;  4OO1 G;  1KLU D;  5IGB A;  5I9O A;  2KEC A;  2BOS A;  2QDB A;  2F0H A;  3RMH A;  1F77 A;  3A8K E;  2E2J B;  1Y8N B;  3QOJ A;  4LMQ D;  4BY7 B;  3MWY W;  4CJ2 C;  1I6H B;  3I72 A;  1JC7 A;  3PMF A;  4IUQ A;  4E6I A;  2ZXO A;  4DU9 A;  3TP5 A;  2KOL A;  1B9M A;  2X69 A;  1B1Z A;  2KEE A;  4H13 C;  1CA5 A;  3MVV A;  4DNR B;  2AWO A;  2XN9 C;  5FK9 C;  1Y8P B;  1PTO D;  3UI2 A;  1H9M A;  3R3O A;  3OW7 A;  1BOS A;  2Z1C A;  5COY A;  2K5D A;  1JWU D;  1D5M C;  2K1B A;  5I2Y A;  2ID0 A;  3T53 B;  5BN3 A;  2FMC A;  2L0C A;  4HTH A;  1CTM A;  1TS3 A;  3EVQ A;  2F0N A;  1E2V A;  3P7J A;  1PFB A;  1K8M A;  1V43 A;  1X3Q A;  4KKU A;  5BN5 A;  3H09 A;  3IFD A;  1KDA A;  1BXT A;  1SDF A;  4XQN A;  1XYI A;  1C8C A;  3AU7 A;  4X3U A;  5NUC A;  2L1B A;  5FO9 B;  5CV7 A;  3T16 A;  3DUZ A;  1B3A A;  2RDF A;  1O7L A;  4FF4 A;  2RBM A;  5C44 B;  4G7H C;  5CBA E;  4XQJ A;  1EYC A;  4KJN A;  5D3I B;  2PZU A;  3HG9 A;  1G2T A;  1DZ1 A;  2K5W A;  4KN4 C;  5LL6 X;  5C5M A;  4B08 A;  1NUC A;  3S14 B;  3I4N B;  1DJR D;  2E76 C;  4RGT A;  3C46 A;  1PRT C;  3CHB D;  4Z9C B;  4M8A A;  5A2Q E;  5JEA J;  3VR5 A;  1PTO F;  4KJO A;  2D62 A;  4I65 A;  3ND8 A;  2SDF A;  3G6J B;  3LWU A;  1H9J A;  4XIG S;  5AFW A;  1AN8 A;  5M9O A;  1SBB B;  3MA2 B;  2B2T C;  1D6E C;  1ML0 D;  1EIH A;  1M8A A;  4V0B A;  2H1E A;  1SMY C;  5CR3 A;  4ABN A;  5C0X H;  5K36 H;  1MSH A;  1RHP A;  1KAB A;  1PZK D;  2QIL A;  5HUR A;  1ESF A;  3GTQ B;  2AUJ D;  2AQ3 B;  1WVL A;  3D6W A;  4ZLT F;  2LKV A;  1OO9 B;  1II3 A;  3NQI A;  2KA7 A;  4X3K A;  1Z6H A;  2O5I C;  1M4V A;  1U4L A;  4Y7N B;  2F0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...