1EY4A

Structure of s. nuclease stabilizing mutant s59a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey4A00
4K5WA 5C5MA 2SOBA 1TT2A 4KD4A 2RKSA 4KY5A 4RKBA 4DFAA 1EY0A 1NUCA 1STNA 3SXHA 3MVVA 4EQNA 5IGBA 5KYLA 4NDXA 1SYBA 4KD3A 4LAAA 3NHHA 5IGCA 5IODA 2PQEA 2F0TA 3EJIA 3R3OA 2PZWA 4K8IA 1STGA 3NUCA 1JORA 3MZ5A 5CR3A 3OSOA 1SYDA 2EY5A 3V2TA 4F7XA 1EY8A 3BDLA 2F0KA 4PNYA 2F0DA 5CV6A 5J1ZA 1SYCA 1EY6A 4HMJA 1RKNA 4DF7A 4KJNA 4MIUA 2PW7A 3TP8A 5KYIA 1KDCA 2EYJA 2F0SA 3OMGA 5CV5A 4EVOA 4IZ8A 1STBA 2OEOA 5HGTA 5J39A 2HQEA 2F0NA 2F0EA 1A3TA 4DU9A 4HTHA 1SNOA 3NK9A 3QB3A 2EY1A 1KABA 1SNCA 3MXPA 4PMCA 5HURA 2SNMA 5JAVA 2OF1A 1JOQA 2F3VA 2F0MA 1EY5A 4YIJA 4I65A 5C5LA 3TP6A 2F0PA 5KRUA 3VA5A 1JOOA 2F3WA 5F2DA 3D6CA 2EYOA 3OMCA 3NXWA 5J22A 4ZUJA 1JOKA 2RBMA 4QF4A 5C4HA 2EYFA 2QDBA 5EGTA 2EYHA 4G57A 5E3FA 1SYGA 3SK6A 4KY7A 5EKKA 3HZXA 2RDFA 5KGUA 1SYEA 3D8GA 5DEHA 1EY4A 5I9PA 1KAAA 3EVQA 4N9PA 3T13A 3DHQA 3HEJA 3PMFA 4DGZA 3TP7A 1TQOA 4WRDA 5KEEA 3QOLA 2EY6A 3DMUA 2EYLA 1F2YA 1STHA 3C1EA 4ME5A 1EZ6A 5NUCA 4K5XA 4NP5A 5C4ZA 5ISRA 1ENCA 1SNDA 3BDCA 5EKLA 1SNMA 1EYAA 3D4WA 2EY2A 4R8NA 5DAUA 4IUNA 5CV4A 1A2UA 2LKVA 4PMBA 3T16A 1KDAA 4S3SA 5CGKA 4NMZA 1ENAA 4K14A 2F0QA 5CV7A 5IGEA 4HMIA 2ENBA 3SK5A 2F0UA 4QB4A 4ZQ3A 5C3XA 3LX0A 1EYCA 4J6HA 4B9XA 4K6DA 3ITPA 4IALA 5IIFA 2NUCA 5CC4A 5JOBA 3P1HA 4EQPA 1A3VA 2KQ3A 3D4DA 4H7BA 3S9WA 5IGFA 1A2TA 3SK4A 2F0VA 3U9OA 4J1MA 2F0GA 4KTAA 3NQTA 4EQOA 1EYDA 3C1FA 4KV6A 2WACA 5E1FA 3OWFA 2F0JA 2PZUA 5K5PA 4F8MA 3RUZA 4K5VA 1SNQA 2F0HA 5CV8A 3SK8A 3TP5A 1A3UA 2O4XA 4QMGA 5C3WA 5IOCA 3NP8A 4WORA 4ZUIA 2F0WA 5I6YA 1STAA 2F0OA 1EZ8A 2M00A 4K8JA 4OL7A 2PZTA 5CV9A 3ERQA 5I9OA 1SYFA 1EQVA 1NSNS 2EYPA 1F2ZA 4KY6A 1TR5A 1EY9A 3QOJA 4ID6A 3E5SA 2PW5A 5KIXA 5IGGA 1SNPA 2OXPA 2PYKA 4NKLA 4ODGA 1F2MA 1KDBA 2KHSA 2EYMA 3TMEA 4B9WA 3MHBA 4KJOA 1STYA 4RKLA 4K2LA 4N9TA 4TRDA 1U9RA 2F0LA 3EROA 3SR1A 5C6AA 3SHLA 3H6MA 3MEHA 1EY7A 3P75A 4E6IA 5IGDA 1AEXA 2F0IA 2F0FA 1IHZA 5I6WA 2SNSA 5M9OA 4K2KA 2EXZA 1II3A 4KHVA
chains in the Genus database with same CATH superfamily
2YV5A 1I6HB 1GD7A 1OXXK 1I6VC 4BBRH 4CDCC 1YIJA 3PIOA 5TSSA 2HCIA 2WKDA 3BDLA 3CPFA 1E22A 2JA7H 4BXXH 1EY6A 5L37A 1RKNA 1ILQA 2Z6KC 3MA2B 1B50A 3EQLC 4IZ8A 3KDFB 5J39A 2HQEA 3QWNA 3NBHB 1MJCA 2XSCA 3LWUA 3W2DA 1PH6A 3FVQA 2JE6I 3TP6A 3VR3A 3I4NH 1Q12A 1RTOA 1U0LA 4GS3A 4A93H 3UDXA 3D0FA 2EYFA 5EGTA 4DV6Q 1E24A 1CA5A 4X65L 1SLJA 2E2IH 4APVA 3CCRA 3K7AB 5ELDA 1I4PA 1IBKL 2HDMA 1QZGA 3DMUA 4PQXA 5NUCA 1Y14B 3L0OA 5T1GA 1QVGA 4LF8Q 2BA0A 3WDNA 1KDAA 4DR7L 1KL9A 1SRUA 3A8KE 1I4HA 4CDDC 2HCCA 2FINB 2A6HC 2BH2A 4HJ9A 4X66L 3GTPH 1EU3A 1N36L 4XYOA 5E1FA 3VDYA 1W3SA 2DNCA 2NBFA 1A3UA 4QIWE 4JBJA 1A15A 1TS3A 3CCJA 3RMHA 2M00A 2AUKA 3CKIB 3ERQA 1SMYC 1X3PA 3A56A 4RG1A 2PCFB 2RF4A 4MTNA 1EY9A 1BF4A 1YNJC 4MHEA 3ULPA 5IGGA 1CFMA 4POFA 1GO3E 3CQZH 3ONAB 1XTCD 1IBML 3SR1A 3BS1A 1PVOA 2XRQD 3MC0B 3S1RH 5FKAC 5C0XI 3L2PA 3S17H 2EXZA 1NMGA 1Y1VH 4LFCL 5IGBA 4OGQC 3IKJA 1XWEA 2PQEA 1HH2P 4IUVA 5FLMG 4LF6Q 4XT1B 3D31A 3ULLA 1QVCA 3T1HQ 2Z8LA 4HAEA 5I2YA 1HR0Q 3PIP3 2CWAA 2HQLA 2IL8A 3A5UA 2EPBA 4DR4L 1TU2B 3J7ZC 2FFKB 1TWCB 2B63G 4A3CG 3H3VC 4JI5L 4LF4L 3S2HH 3K7UC 4X64Q 2PNHA 5JEAJ 5JAVA 1TS5A 1JOQA 3M4OH 3NTHA 2KA7A 2QW7A 3K0XA 4A76A 5FLXE 1ZEQX 4O2DA 5EPKA 3BU2A 3NTIA 3D6CA 1R9TH 1PZID 3A5ZB 2VUMH 1I4XA 1B7YB 1OXUA 4QUFA 4GZYC 4L5QA 4DR2Q 2LMCB 4KMUC 1Z9FA 1EY4A 5M5WB 4A3EH 4J15A 1LT3D 4LMQD 2JA9A 1HNZL 3H0GH 1FL0A 3H91A 1UWVA 4YY3L 4DV1L 2XRSD 5C3XA 3GV6A 4CDFC 5IIFA 2A5HA 4KI0A 5DM63 3TZUA 2B2YA 4C3IH 4JG2A 3BZCA 4C1NI 2B8GA 3HOVG 2M9VA 3KOJA 4GKJL 1KLGD 2A1AA 4BS9A 3SVMA 1KLUD 1PH5A 2R93B 2JA6H 1I6HH 3QJYA 1RODA 1KIXA 4CKBA 4X6AH 2E2IB 4OL7A 4X65Q 3F2DA 1EQVA 1X3GA 5FOBB 4Q0FA 4BXXG 1SNPA 2PYKA 2EDGA 2F3IA 4JYAQ 3CP0A 3DWAA 1U5KA 1X55A 5C6AA 2CWPA 1V43A 2FXQA 3OOCA 4HIDA 1GUOA 4KD4A 3EN2A 1IKLA 2LKVA 4KHVA 4K5WA 1U4RA 4KY5A 4DFAA 2X6GA 1X32A 3H0GB 1L0XB 3Q0AA 4XIGS 1E0BA 3JAMi 4HIMA 1EOVA 2WAQG 4F7XA 2HD3A 2N3SA 4RH6A 5C0XG 3BZKA 2CH4W 2D0PA 1TS4A 1FJGQ 4DUYL 1PYBA 4KJNA 4UP9A 1C0AA 1Y8OB 1MIUA 3I2ZA 5M5WH 4A3EB 1HPCA 1QJOA 4OWWB 3QB3A 1JJGA 1F9PA 1Z6HA 3MXPA 1F9RA 1I50B 3WOEA 3X3MA 1WTPA 1PYSB 2VS1A 3CCVA 2K03A 1GUWA 3HOYG 2HUGA 1I3QH 2G9HD 3O13A 1Y1VB 1VQOA 4LFCQ 4O0AA 1T9HA 3D8GA 3A8JE 2QCPX 2GVAA 2VUMG 3HOXG 3S1MB 5LL6X 2NVXH 2KCTA 1VQHA 2NVQH 4B3MQ 5ISRA 4LJZC 3BVMA 2VQEQ 2WKCA 3LNNA 3D3RA 5IP7G 2BA1A 2XWJB 1C48A 1CZGA 3WOFA 3IRBA 3PF4A 3K5OA 2E2JH 5CC4A 4A3BH 1A2TA 3H09A 5M5XB 2F0GA 4A3IH 1TWAH 1EWCA 2JA8G 1KRSA 1LTSD 2PZUA 3C46A 4QL5A 1XNRL 4XDXA 1CKOA 4BY1G 1DOLA 1BCPF 4A3MB 3S2DH 1WJJA 2B2TA 2MGSA 3PO3H 2JA5G 4XQJA 1D7QA 2KECA 2ZTCA 1YNNC 4DV4Q 1JB7A 4KJOA 1RD9D 3GTLB 1WTQA 2EXDA 2PO4A 3EROA 1FR3A 3P20A 3TN2A 2R93G 1AEXA 3TREA 4HN7A 2C5CA 1VQ9A 4MN3A 3Q22A 3L9AX 5LMNW 3HOUB 1G6ZA 1HZAA 2IX3A 4ME3A 2RKSA 2UUCL 4KKTA 2I5LX 4DK1A 3SEBA 1STGA 2OCEA 3DXJC 1AE3A 4J8QA 1I3QB 3MWYW 3OIPA 3G6EA 1HNZQ 3BJUA 1IBMQ 2ES2A 3I8ZA 2VQFQ 1FNWA 2OQKA 4FO2A 4EVOA 2OEOA 1VQJA 4QCLA 3C2PA 1N8RC 4NXML 1KABA 2E2HB 3GTQB 2IW3A 1CK1A 1TY2A 1BDOA 1Q86C 2I5MX 1LT5D 1DYQA 1PTOH 1VQBA 3HKZG 1PH4A 2PMZE 3NXWA 3K8AA 1RL2A 5M3FH 1UE5A 2QDBA 1TWHH 1EOTA 3I4MH 4X3SA 2LXKA 3G7LA 2CFMA 3T13A 2MJ8A 4GOPB 1R4PB 3E3XA 5KEEA 1WD0A 1PH3A 4HCSA 5M3FB 1S5ED 3S2HB 4DR5L 1GUSA 3HOUG 5DNFA 4OX9Q 3KDFA 1EYCA 4J6HA 4YCUA 1SEBD 3R93A 4POGA 3P1HA 4LUVA 4XTCS 1SAPA 4DAYB 4DV4L 2K28A 1OTCA 1VQ7A 1J8IA 4ALPA 2K5QA 3GTJH 1IW7C 4JI1Q 3K58A 3OWFA 3CCMA 5JVG3 4C3JG 1K73C 4DNIA 3KF6B 2TMPA 1SSOA 4N8X1 4LW1A 4MNOA 1AW7A 1K3RA 3PUWA 3E0EA 4K8JA 1DCZA 4JI7Q 1SR3A 5D14A 1QWYA 2K7VA 1E2VA 1JQYD 4AQYQ 1GUNA 4DV7Q 3U58A 2L0CA 4X3KA 3K57A 2K5WA 3TZDA 1GUGA 4JI6Q 3EIVA 1BNZA 1X3EA 2NVYB 3H6MA 1SBBB 4AYBG 2AQ1B 1JCKB 1S5CD 3T1YQ 2FMCA 5C4XB 3NTKA 3S14B 3KUPA 3A7AB 2SOBA 2DY8A 4A3FH 5BN4A 5ELBA 2FJ2A 3A8IE 1LV9A 1PMRA 3GV3A 3EJIA 4JC0A 3R3OA 1JORA 1Y69U 3VR2A 3S1MH 3V2TA 4C3JH 3HG9A 4IUUA 4YHHL 1HNXL 2K52A 2VXWA 2DNEA 3PCOB 1QVFA 2IX1A 4U673 5E7NA 3G6JB 2B3GA 1STBA 4B3TL 2P5ZX 4L6TB 3CCEA 1I4QA 4LF7Q 1K8MA 2RCNA 3A55A 5FLMH 3HOWH 1MKHA 1EY5A 1YBYA 1BKBA 1STEA 3PF5A 3RN2A 2RVLA 2R93H 2K6AA 4QF4A 3KLSA 3U4VA 3SK6A 1IBLL 3HZXA 4ABNA 2PI2E 1GHJA 3KLRA 5LHY1 1TQOA 4YCVA 3FP9A 4WRDA 1PRTB 1SN8A 2EYLA 1IZ6A 1EYAA 1A2UA 1EIHA 1ENAA 5HGQA 4JI7L 1QG7A 3P7JA 4HIOA 3TS2A 3M3YB 1K0RA 5FJ8G 1A8VA 1LTBD 2NYZD 4TKOB 1HA6A 2MUYA 1G2TA 3S24A 4FF3A 3U9OA 1PFBA 3J80L 3NE5B 4DR7Q 2MQHA 4KN4C 4LUOA 4ZKBB 1QZHA 4G7HC 3TDQA 3CD6A 4ZUIA 1E2ZA 2B63H 4A3LH 2F0OA 2K01A 3I72A 1JC7A 1IXRA 4P72A 1Y1WG 4KY6A 2YTVA 2IJ0A 1TR5A 2ALYB 2L5TA 4HEDA 1KD1C 1D1IA 5JEAG 1IBKQ 1BVSA 4NXMQ 4A3MG 3CMAA 3BG3A 4ODGA 1F2MA 4UAIA 3MXNA 4LFAQ 1PA6A 2K5DA 3SHLA 1VQIA 1G91A 3P75A 3R2TA 4E6IA 2F0FA 2JP1A 2SNSA 5GROA 1IL8A 1X6OA 4P74A 1II3A 2LXJA 1S4ZA 2Z4IA 5GADC 1LTAD 2UXCL 2SDFA 4UHVA 3I4NG 1G51A 3FRPB 4B08A 2NN6H 1B3AA 5IGCA 1TWGB 3S1RB 1PFSA 2QKIC 4JI0L 1RTNA 1G8ZD 4EQ5A 1VQGA 2HIVA 2WAQB 4CKEA 1PH7A 1AZQA 5CV5A 5HGTA 1V8QA 3CHBD 1MSGA 4ZK9B 4DK6C 5ELEA 1RJTA 1H9MA 1EYGA 2ASBA 4IUPA 3KYHC 4HSPA 5D3DA 2NZ1D 1V1QA 2JN4A 4CDEC 2RA4A 1HTLD 4A3IB 1AP0A 1CI3M 4JI4Q 1O80A 1JOKA 4A3DB 1M4VA 5C4HA 3D4RA 4R4QA 1CQFA 3QR8A 5LMNQ 2YTXA 4N9PA 3Q24A 1Z47A 1PTOD 1LLRD 2DY7A 4LF6L 1STHA 4I7ZC 3H3VH 2ZXPA 4NP5A 5I2XA 1ENCA 1K9MC 1D2BA 1GUTA 4R8NA 5IOCA 3KJOA 4DXGA 4Y7NB 2HHHQ 3CW2C 3M4QA 2NB0A 2F0QA 2CH4A 4GLAC 5IGEA 3K7AH 3J7YW 4N8FA 2CCZA 3D4DA 3KF8A 2DJGC 2O2LD 4LFAL 4A3FB 4J1MA 1HZ9A 4KKUA 1ZYRC 2EE1A 2ICEC 5FO8B 4K0KL 4JOIC 3VYSA 2XTIA 4BBRG 3I3CA 3JAMc 3PUVA 3UDFA 5IE8A 1KNEA 3F8TA 5EPJA 1IBLQ 3AQQA 3KBGA 2VZAA 1YNJD 1F2ZA 2IHFA 3DEOA 4DV3L 3PIO3 2C9OA 2VY3A 3CXCA 3BZDB 1TWFB 1T5XD 2E2JB 1U4LA 2JA7B 1K83B 1O7LA 2KHSA 2KVMA 5AJ3L 3GTMB 4N9TA 1TKWB 4OEMB 1NE3A 4DR3L 5C0XJ 1PDQA 3RD4A 4DXFA 2JQOA 1LTTD 1GKHA 3HKZB 1NUCA 2Y0SE 2FHTA 5H1SE 2A6EC 5IODA 5CORA 2JA5H 1MBYA 1UNSA 5IP7H 5K36G 1SYDA 4G4KA 1A63A 3HOXB 2FMMA 4A3KG 1OXTA 2WINB 3CAMA 1I4RA 2PPBC 1DOMA 1ICFB 3V96A 1WVLA 2LSSA 1XTDA 3F2UA 1A3TA 1PLFA 3NK9A 2NWGA 2KEDA 2PQAB 2UXBQ 2X69A 5BN3A 2JA7G 4AYBE 4DV5L 2ZTEA 5C0XH 4I65A 4IUTA 1N33Q 2HT1A 1WCMG 3PV0A 4PV1C 3HOWG 1RCVD 2EJFC 3UDGA 5BR8L 2EYOA 4JV5L 2VNUD 4KN7C 2QGQA 1SYGA 4JK1C 1JWUD 3IAYA 5C3EB 1BXTA 3GTPB 5I9PA 1DZ1A 1MI2A 3NBIA 3T53B 4BA2I 2A68C 3C1EA 1TVXA 3I90A 2B2YC 1F77A 1SNMA 3T16A 3QIAA 1YEZA 4H13C 4R4TA 2R7DA 2R92G 4S3SA 2UXDQ 3R2IA 3HKSA 1S72A 2PQAA 4H0LC 2OQ0A 4R4OA 3SK5A 3TRZA 3M4YA 1QOHA 4DUZQ 5JOBA 4C1NK 1CT1D 5C4XG 1KTKA 4A3GG 1WCMB 3OWEB 4AQYL 5CBEE 3RN5A 1DGSA 1WTHA 2WFWA 4RCOA 1K8AC 2B2WA 1AN8A 4IO9A 5C3WA 1VQCA 5IYCH 4A3CH 4OIKA 3GTLH 2EYPA 3U9SA 3M9BA 2O5JC 1HQMC 5GAGC 1BBXC 4FDBA 3HOVB 2Q8TA 2WIIB 4JBKA 4FXGC 4FXDA 1O7IA 5M3MB 1YHQA 2ZJQA 3RR5A 4QGUA 5IGDA 1HA5A 1QE6A 4K2KA 2EIFA 1JJ2A 1BBWA 1ET6A 1E2WA 1STNA 3HOVH 1N34L 1H9SB 2HDLA 4A3JG 2K5NA 3L3OC 3S15H 2BOSA 2EY5A 4JYAL 5EBDA 4LF4Q 3GTQH 1Q8KA 2F0DA 2R92B 2N49A 2HHHL 1XNRQ 4LF5Q 1GVPA 2R3ZA 1D5MC 2UUBL 1DM0B 5GAHC 5EBCA 3HKZE 3TP8A 1WOCA 2I46A 4HR7B 1B70B 1LABA 1DONA 2V1CC 4V0BA 2AWNA 1YITA 1NMFA 3E9IA 1NR4A 2NZHA 2VB2X 3JAML 1Q7YC 3ICEA 4YIJA 1TIID 2F0PA 3SGIA 3GD7A 5J22A 1JWSD 2X6LA 4Q5VA 3L7ZC 3K80C 3OTOL 2I0QA 3U4ZA 4G57A 2A8VA 3BYYB 4L5RC 1X3FA 4G7OC 2F52A 1PTOF 3PMFA 4DGZA 1M8AA 4JI3Q 1IL2A 2OWOA 4ME5A 1HNWQ 2Z6KA 2K5VA 1ML0D 4FP5D 1K83H 2UU9L 1TWHB 1K8OA 3ZJYC 4ZYSA 1RF2D 3AU7A 5E4WC 2NN6G 4JBWA 1XMOQ 3T1HL 4IALA 2Q8RE 5D65A 2UXBL 1KHIA 2B2TC 4C3IB 2BDOA 1N32Q 1WTOA 3E6ZX 2K75A 3RLNA 3ULJA 5A2QL 2JA8H 4OONA 4QMGA 3FEWX 4LF7L 2F0WA 4YWMA 1JMCA 2MHVA 2Y0SB 5I9OA 1YNND 3C3LA 1ET9A 1RDPD 4BBSH 3K5LA 3NELA 2PW5A 4B3SQ 5IYCG 3FKIH 2K05A 4C3IG 3TSSA 1H9JA 1HRJA 4M1UB 3KBXA 1EWIA 4DV5Q 1STYA 3DEPA 3M4OB 1W6JA 1WTXA 2Z4HA 1D1KA 3DM1A 3FKIG 2I5HA 2YU9B 4JI3L 3NWTA 4A3BG 4B3RL 4X62L 2WB1B 1EY0A 4NDXA 1SYBA 4EX5A 2JA5B 4UPAA 5C3EH 1OXSC 2L11A 4DV3Q 1PRTC 4A3GH 2CQAA 3UE0A 3N52A 4JI2Q 3T1YL 3I4MG 4PNYA 5KNCA 1HFGA 1MJEA 1AFPA 4MIUA 4TSSA 2EYJA 3OMGA 1O7ZA 2XNAC 4JCVE 1B3QA 2F0NA 2AMCB 3S15B 1SNOA 5JVH3 3FPUB 4HJAA 2XWBB 1GJXA 3TEHB 1N9WA 2E75C 1D5ZC 4OELB 4DNRB 4GLVB 2AWOA 1TWGH 4ILWA 1JOOA 1Y1VG 2Q8IB 4M8AA 5F2DA 1KC8C 2RDGA 5HY6A 1G2SA 4PG3A 1L2FA 4CJ1B 3UDIA 4XQNA 4KHPQ 4MZ9A 2Q2HA 3QG1A 3K5MA 1SYEA 5DEHA 1KAAA 3GTJB 1CHQD 4DR1L 1L1OB 1F2LA 1PYWD 1Y1WB 4C56C 3QOLA 1F2YA 3J81i 3URYA 3D4WA 4YHHQ 3U50C 3AFPA 4DAYA 4NMZA 2V4DA 3S1QH 5IT9L 3M4PA 1RIPA 4L8JA 3HGBA 4GNXA 1YHBA 2B63B 4NW2A 1SXTA 1YVCA 3FPPA 4P71A 5J3BA 2J4XA 1M1KC 3I91A 1EQRA 3QO2A 1PTOB 1TXYA 3H94A 4X3UA 1SE8A 3TP5A 2NVTH 4IQZA 1E1OA 3WWVA 1W2BA 2KOLA 1STAA 2QEXA 3PO2G 2RSOA 3T56B 2A69C 1HFNA 1LUZA 1HR0W 3W1GA 3PO3B 1UEAB 3I4NB 1Q8IA 3ND8A 1HUNA 3E5SA 3CC2A 3GTKB 3K59A 2OXPA 4NKLA 3E9HA 4KHPL 5JJZA 4B9WA 3MHBA 5M3MH 3HOZH 3MEHA 4P73A 2LY7A 5I6WA 2K14A 5JJKA 4FF2A 4RKBA 1CHPD 3OW2A 4EQNA 4LAAA 4NXNL 2EJMA 4PZ6A 2B2VA 1XNQQ 4GN3B 2LFNA 2UU9Q 2PI2A 2UXCQ 1S5FD 4O1NA 2QA4A 4DF7A 3HOYH 4IFDI 5C44H 4OO1H 3DLLA 1HCZA 1PRTF 2YYZA 1G291 4CHTB 4A3EG 5D3IB 4KHZA 1O7YA 1XMQQ 5JJIA 3I70A 5KNBA 1OO9B 2KHJA 4RWSC 2CW0C 1TWFH 4UP7A 3CCLA 2EJGC 3GTKH 4GKKQ 3BVGA 2ZM6Q 3PQIA 3PO2B 4AH6A 4R4CA 3M7NA 1J5EQ 4ZLTF 3VR6A 5EKKA 2KUMA 3CPWA 2R6GA 4OHJA 1DJRD 1BCPD 2A73B 4DR3Q 2F4IA 4C3HH 1BOSA 2RHQB 4DUZL 2J7ZA 5EQ0A 1U4PA 4JI4L 2JA8B 3HOZG 5EKLA 1L1OA 1EWHA 5DAUA 5CV4A 1TWAB 1TY0A 3OPOA 4K14A 1BQQT 3GTOB 2CKZB 2ENBA 1S5DD 3HS0C 1CUKA 2KJXA 4I7AA 3ITPA 4K6DA 1VQ8A 3FMCA 3S9WA 1YI2A 1VQ5A 4KKSA 1PH1A 3NQTA 4Y7NH 4HSVA 1B9MA 4A3KH 3CC4A 2YU9H 4R8IA 4BBSG 1W6KA 4ZKCB 1UUPA 4JVZA 1H9KA 5EKIA 4OWXB 3RUZA 4K5VA 1WI5A 2NVQB 4IURA 1I50H 2O4XA 1C4QA 3SE0A 1EZ8A 2OT2A 1SYFA 2MP1A 3MXUA 1HTPA 2E74C 2QEJC 3JC66 4A3LG 2AKWB 4ULLA 3GP7A 3DWQA 1CM9A 3CRLC 1NY4A 2JYOA 2B2WC 1ZYRD 4RMFA 5FO7B 4IPCA 2EVBA 2NTSA 1IYJB 1YJNA 3AB9A 4LFBQ 5C5MA 3CQZB 3HFZB 1VCIA 1EFWA 4Y52H 5IYBH 4A3MH 3VA7A 4B3SL 2VUMB 4BY1H 2N55A 2WP8J 1SYCA 1ASZA 2RSNA 1DD2A 1N36Q 5COYA 4RAUC 1EEID 2DGYA 1K28A 1CZWA 1NNXA 2EOTA 3I56A 2EY1A 1S40A 1NTGA 4PMCA 3DUZA 3HOXH 2JA6B 2F0MA 2K1BA 4K0KQ 1IYUA 3NENA 3VA5A 2F3WA 1NBWA 1EFID 3LWEA 1UE1A 4QUCA 2AHOB 4C3JB 4JW0A 1XYIA 2WB1E 3T4AC 2EYHA 4JBMA 3A0JA 3HP3A 3RLOA 2RDFA 5KGUA 3M85A 3J81E 4L5TA 1JWMD 4IUQA 3F2CA 2ZJRA 1EZ6A 1LTID 3PSIA 3I7FA 1S3OA 3OHXC 4WJWA 1PH9A 2B2VC 2L15A 4PZ8A 5CV7A 1HZBA 4DR6L 5C44G 1K8GA 1HNXQ 3OYYA 2XGTA 4DV2L 2DJFC 1A6XA 5LMNL 2B8FA 4DR5Q 3C1FA 3J80E 4DNTB 5GQOA 1XMQL 3A54A 5K5PA 1SNQA 1SE2A 2F0HA 1LYLA 4X64L 4H44C 3VYUA 3NWSA 4BA1I 4A3BB 1PV4A 2QF7A 1KQSA 5K36H 1ILPA 4U68A 2J0TD 3W5OA 4CJ0B 1VF5C 1QUQA 2CQOA 3VYRA 1D5XC 1H9SA 4RKLA 4TRDA 3J81L 4CKCA 3HOYB 1WTVA 1CKNB 4IPDA 2R7ZH 1OXVA 1L1OC 1ASYA 5JEAH 2ZM6L 3RZOH 1HNWL 1B2TA 1Q46A 3T51B 1TT2A 3MVVA 5KYLA 1BCPC 4F87A 4K8IA 1YHAA 3H15A 3MFGA 4V190 4YY3Q 4DN4M 4FVMA 1L0WA 1EY8A 5J1ZA 1Y8PB 4A93G 1BO0A 2Y0SG 1CTMA 4NPSA 3TS0A 1AZPA 1PTOC 4OWTB 1I94Q 1QB5D 5JPNC 4YCWA 1KXLA 1HR0L 5FLXc 1AH9A 2KEEA 2XVSA 1U4MA 2F3VA 4CGYB 1QNKA 2E76C 3RZDB 5KRUA 1ONLA 2MFIA 2UUBQ 1E7ZA 3HRZC 3NBHA 4A3IG 2Z9HA 1FGUA 3E0JA 1H9RA 3LGJA 1VQNA 3ZYYX 4JI5Q 4IFDH 1LTRD 3FHWA 3F2BA 2E2HH 3SDZA 3K81C 4KY7A 4X3TA 5EAYA 3CCSA 2JEAI 3EVQA 2QILA 5IP9H 2F1MA 4JI1L 5A35A 4K6LA 2SEBD 4C3HB 1WTWA 1Q1BA 2RDHA 1A0IA 1B4OA 2L55A 3FDTA 2MO0A 4FF1A 2WAQE 1SJED 4JI8L 1N33L 4DR2L 4HMIA 2Q2TA 5BR8Q 1KAWA 4ZQ3A 1EIYB 2K50A 3LX0A 2LS01 4JI2L 1HQRD 2E5LQ 1CKMA 2KCCA 1JT8A 2K32A 4KTAA 1D8LA 1Z7TA 4KV6A 2WACA 4DUYQ 3B6YA 3J7AF 1S5BD 4C2MH 1SMXA 3JAME 4F8MA 5C4JH 5EPLA 5LL6S 4DV1Q 1KRTA 3GTGH 4A3DH 3SK8A 3RNUA 1GM5A 5C3EG 3ERSX 4QIWB 5CMDA 3OTOQ 3S1NH 1EIFA 2RCFA 3PIPA 5LMUL 1LTLA 3RZDH 1HHVA 3EA6A 1K0SA 4ID6A 5BN5A 2Z1CA 5A2QE 2L12A 2A69D 2R92H 3TMEA 1DOKA 1O78A 3I4MB 2H1EA 1YJWA 1EY7A 1ZXTA 2K33A 3H0GG 3MAQA 3H3VI 3J7AV 4ZCKA 1UEBA 1IW7D 4L5SA 1F9SA 1UAPA 2F0TA 2PZWA 4FXKC 3NUCA 4BY7G 3MZ5A 3DM3A 5CR3A 5DM73 5CV6A 5I4DA 3J81j 4RGNA 2NN6I 2KBNA 2G5DA 1XJVA 2DN8A 2PMZB 2PW7A 2Z0SA 5KYIA 1X3QA 2IY5B 4C2MB 4JI0Q 4IPHA 2KCNA 2YTYA 1Q1EA 2QDLA 4JOIA 4AIMA 1EU4A 4X66Q 4HJ5A 3G4SA 4UP8A 1FJGL 5C5LA 2K4KA 2JK8A 3NPPA 1VQ6A 5IT9c 2N78A 4XYQA 4F88A 2R7ZG 4RGTA 4KLKA 1VQ4A 4RHSA 3DHQA 2NVYH 1YNXA 3GDEA 1GXDC 2BDNA 4BY7B 1PXUA 4A93B 2NTTA 1J6QA 1FD7D 1VQPA 4IUNA 1FNUA 3V05A 1YZ6A 1HXYD 5LMUQ 1LT4D 4Z9CB 3CCUA 5IYBG 2E8GA 2F0UA 3ER0A 5GAEC 1EQQA 1PH2A 4HJ8A 1B8AA 2D9UA 1A3VA 3VR5A 2ZT9C 5IGFA 4BY7H 3F1ZA 1V1PB 5FO9B 4FF4A 4DAVA 1E3PA 3R8BA 3N6RA 3AMUA 1FNVA 3BDOA 1NJIC 1SE4A 3J7A5 4WJ3M 4A3JH 4BY1B 3I4OA 1VMCA 1P8LA 1CSPA 1ICWA 1NSNS 5IYDH 4R4IA 5CBAE 4DR1Q 2MPMA 3K6OA 3J80i 1JR0D 4RFBA 1IYVA 2M2LA 2ICIA 2OTLA 1VQLA 4OIJA 5FJ8H 2A68D 1Y8NB 2JEBI 2GN5A 2ID0A 2EZVA 1IHZA 3RZOB 2R7ZB 3PGZA 1DXMA 4OO1I 1VQAA 3J81c 5M5YB 2UUAQ 1I5FA 1WCMH 2DUDA 3Q8DA 2K5HA 3EFXD 4TQUS 1CSQA 1M90C 4WJ4A 3CRKC 3HOZB 4GKJQ 1V1PA 1PZKD 2Q2UA 4OX9L 4A4IA 3S14H 3KLWA 3S17B 2F0KA 2AQ2B 1LM0A 1XPUA 4HMJA 3NSWA 4UDUC 3PO3G 4RGMA 5FLXL 2D5DA 3MTSA 5AFWA 1KDCA 1WYDA 2ZJPA 1SFOB 1NCVA 1VQKA 4X62Q 4ZAIA 3STBD 4DK3C 3Q23A 1QILA 2N88A 5T1IA 2MO1A 4BWGB 2CW0D 4A3FG 2Z6BA 4XQQA 3KF8B 5IWAL 2D62A 2ZTDA 3OMCA 1PZJD 1MSHA 3W1BA 4ZUJA 2A74C 3MEFA 2RBMA 4JI6L 1WTRA 4O42A 3VR4A 3A74A 3IFTA 1SDFA 2I07B 1BCPB 2TSSA 1I94L 1QNUA 3GTGB 1SNDA 1Q82C 4GNXB 3TBIB 4PMBA 1VQEA 1X54A 4A3KB 3OW7A 4QB4A 1CKNA 1PFNA 3STBC 3K0YA 4B9XA 1V1OA 2KQ3A 4H7BA 3VYTA 4A75A 1LTGD 3W3AA 3IL8A 1EQTA 3CCQA 3S16B 1G6PA 5G3LD 1EYDA 2VB3X 4EQOA 1GHKA 4IFDJ 1PH8A 3EBEA 1NR2A 1JJCB 1VF7A 5IY0A 4IOAA 1Q3LA 3K5NA 1C8CA 4JI8Q 4QJFA 4JPBW 4A3DG 2KHIA 2PZTA 3S16H 5IWAQ 2F03A 2A6HD 5KIXA 3NQIA 1X56A 4B3ML 2EYMA 3NEMA 5M5XH 4IJLA 5IYDG 4LNQA 1FGBD 2VL6A 3HOWB 2BE5C 2B39A 4FNFA 4DKAC 4DV0Q 4H02A 2F0IA 3I55A 1ENFA 2WB1G 5C4XH 4UY8C 1PFMA 1TWCH 2B29A 4HCEA 3BVZA 1JE5A 2L4NA 3SXHA 3GQBA 2JJQA 3AFQA 4A3GB 3ND9A 1X9NA 1J9OA 1D6EC 3CC7A 1T5EA 4GOPA 3D6WA 3OSOA 1Y1WH 2JXMB 2CVRA 1F9QA 1RHPA 4QY7A 5M3FG 4DV6L 1EUJA 4CBVA 4PZ7A 4RHRA 1R4QB 3MXGA 1B44D 1FYCA 4DU9A 3HOUH 1FVIA 4IJHA 4NB3A 1SNCA 4XT3B 1VMPA 4YWKA 2OF1A 1UE7A 1B9NA 1QUQB 2H5XA 5IT9E 2IWHA 1BR9A 3S1QB 1ZKOA 3I4LA 3X3NA 1JE4A 1XNQL 3DWPA 2H4OA 4IPGA 3KLSX 1E1TA 4LFBL 1EL0A 4P75A 2ZXOA 2UUAL 1ESFA 5E3FA 4MTKA 3UE1A 4CJ2C 1BBUA 3HEJA 2C35B 2EY6A 1VQMA 2NVTB 1I4GA 4XXEA 5C4ZA 3BDCA 1NAPA 5DLQE 3I73A 1HUMA 2GVBA 5CGKA 1CQVA 4IN3A 2BCOA 1LT6D 5M3MG 4IFDG 2NUCA 4DV7L 1IKMA 4RGOS 3J80c 1MHWC 2IT1A 2A6ED 2PNRC 5ELOA 3SK4A 3RLFA 3S1NB 2XIWA 2F0VA 4DK0A 2JA6G 3AYHB 1Q90A 3MXNB 2XN9C 4BBRB 2ATWA 4LF9L 4DPGA 4A3JB 4DR6Q 5CV8A 2Q2IA 1P16A 2AQ3B 3MFYA 3PUZA 2VQFL 3CF5A 3NP8A 3PUYA 5I6YA 2UXDL 1EEFD 2GA4B 1A62A 4P2CB 1XPOA 2RQXA 5JPMC 1N34Q 3M3YH 2MNAA 1SE3A 1SFOH 3AEVA 5JJLA 1SROA 2VW9A 1XPRA 2UUCQ 1KDBA 3TQYA 1VS0A 3Q6SA 1L0YB 3GO5A 4LF8L 1C7YA 4GN5A 4K2LA 2IHEA 1U9RA 4DAMA 2R61A 1SMYD 2L9HA 3S2DB 1B1ZA 1PHJA 4YWLA 1YJ9A 2L1BA 2B2UC 2AUJD 4LK1C 5M5YH 1MGSA 5G3LF 1BUVT 4TVAB 4KD3A 3GTMH 3NHHA 4BBSB 1GOZA 4KK7A 1LACA 2BH8A 4RA8A 4C3HG 2O5IC 2G9DA 1Q81C 2F0SA 3BYTB 5C4JB 2KENA 2F0EA 5ELFA 4LF9Q 4JV5Q 4PMWA 4HTHA 1LO5D 1JB3A 5HURA 3G71A 4DV2Q 1J5EL 4QQBX 2SNMA 2NZOA 2RHSB 4DA2A 1HJPA 2D0OA 1WFQA 5FK9C 4L63B 1EIGA 2A19A 3CU7A 3PUXA 2KCMA 1R9TB 4DV0L 1XX8A 3FKIB 1K3BC 1WD1A 4LF5L 4DAPA 3KK7A 2IPKD 2WV6D 3M7GA 5AJ3Q 4OO1G 2OTJA 4RCNA 3CMEA 2F4VL 1N32L 4EGVA 4OXPA 3TP7A 2BE5D 5IP9G 2JSOA 2R7FA 2ZXRA 4K5XA 4LWCA 2EY2A 3KFUA 4R1JA 4GOPC 4LUZA 3GTOH 1VDZA 5EJWA 2N8NA 1VQDA 4GN4B 4NXNQ 4GLXA 5CYUA 1SJHD 4EQPA 3G48A 3PO2H 4IOCA 2VQEL 1QCBD 2K04A 5ELCA 5E4XA 1AE2A 2B2UA 4HJ7A 1V9PA 2F0JA 3KJPA 1KNAA 2HIXA 4AYBB 4B3RQ 3OIQA 4WORA 1C9OA 5CV9A 2E5LL 4DR4Q 4B3TQ 5KNDA 3UI2A 3QOJA 5C44B 1XMOL 1HZCA 2CHBD 1ESRA 2NVXB 4WFN3 2EQSA 1B53A 1PRTD 3KF6A 1CA6A 3IFDA 3A7LA 1XXGA 1JICA 4GKKL 1UE6A 4HIKA 1H95A 1X65A 2E2DC 2D2CC 4GNXC 2F0LA 4G7ZC 2IX0A 4ZRZA 5ELNA 4R9WA 4FYDA 1MD2D 2F4VQ 5M9OA 1TS2A 1VQFA
chains in the Genus database with same CATH topology
1I6HB 1OXXK 1I6VC 5TSSA 2HCIA 2WKDA 3BDLA 1EY6A 1RKNA 1ILQA 3MA2B 1B50A 3EQLC 4IZ8A 5J39A 2HQEA 3QWNA 2XSCA 3LWUA 3W2DA 3FVQA 2JE6I 3TP6A 3VR3A 1Q12A 1RTOA 2EYFA 5EGTA 1CA5A 3K7AB 5ELDA 1I4PA 2HDMA 3DMUA 4PQXA 5NUCA 5T1GA 2BA0A 3WDNA 1KDAA 3A8KE 1I4HA 2HCCA 2FINB 2A6HC 1EU3A 4XYOA 5E1FA 2DNCA 2NBFA 1A3UA 1A15A 1TS3A 3RMHA 2M00A 2AUKA 3CKIB 3A56A 1SMYC 1X3PA 3ERQA 2PCFB 1EY9A 1BF4A 1YNJC 4MHEA 5IGGA 1CFMA 3ONAB 1XTCD 3SR1A 3BS1A 2XRQD 3MC0B 5FKAC 5C0XI 2EXZA 5IGBA 4OGQC 3IKJA 1XWEA 2PQEA 4IUVA 4XT1B 3D31A 2Z8LA 4HAEA 5I2YA 3PIP3 2IL8A 2EPBA 1TU2B 2FFKB 1TWCB 3H3VC 5JEAJ 5JAVA 1TS5A 1JOQA 3NTHA 2KA7A 5FLXE 1ZEQX 5EPKA 3NTIA 3D6CA 1PZID 1I4XA 1OXUA 4QUFA 4GZYC 2LMCB 4KMUC 1EY4A 5M5WB 1LT3D 4LMQD 3H91A 2XRSD 5C3XA 3GV6A 5IIFA 2A5HA 4KI0A 5DM63 3TZUA 2B2YA 4C1NI 2B8GA 2M9VA 1KLGD 4BS9A 3SVMA 1KLUD 2R93B 3QJYA 1RODA 4CKBA 2E2IB 4OL7A 1EQVA 5FOBB 4Q0FA 1SNPA 2PYKA 2EDGA 3DWAA 5C6AA 1V43A 3OOCA 1GUOA 4KD4A 1IKLA 2LKVA 4KHVA 4K5WA 1U4RA 4KY5A 4DFAA 2X6GA 1X32A 3H0GB 1L0XB 3Q0AA 4XIGS 1E0BA 4F7XA 4RH6A 5C0XG 1TS4A 4KJNA 1Y8OB 4A3EB 1HPCA 1QJOA 3QB3A 1F9PA 1Z6HA 3MXPA 1F9RA 1I50B 3WOEA 3X3MA 1WTPA 2K03A 1GUWA 2HUGA 2G9HD 3O13A 1Y1VB 3D8GA 3A8JE 2QCPX 3S1MB 5LL6X 5ISRA 4LJZC 3BVMA 2WKCA 3LNNA 3D3RA 2BA1A 2XWJB 1C48A 1CZGA 3WOFA 3K5OA 5CC4A 1A2TA 3H09A 5M5XB 2F0GA 1EWCA 1LTSD 2PZUA 3C46A 4XDXA 1DOLA 1BCPF 4A3MB 2B2TA 2MGSA 4XQJA 2KECA 1YNNC 4KJOA 3GTLB 1RD9D 1WTQA 2PO4A 3EROA 1FR3A 3P20A 3TN2A 1AEXA 4HN7A 2C5CA 4MN3A 3Q22A 3L9AX 3HOUB 1G6ZA 2IX3A 2RKSA 4KKTA 4DK1A 3SEBA 1STGA 3DXJC 4J8QA 1I3QB 3MWYW 3OIPA 3I8ZA 1FNWA 4FO2A 4EVOA 2OEOA 4QCLA 3C2PA 1KABA 2E2HB 3GTQB 2IW3A 1CK1A 1TY2A 1BDOA 1LT5D 1DYQA 1PTOH 3NXWA 2QDBA 1EOTA 4X3SA 3G7LA 3T13A 2MJ8A 1R4PB 5KEEA 1WD0A 4HCSA 5M3FB 1S5ED 3S2HB 1GUSA 5DNFA 4J6HA 1EYCA 3R93A 1SEBD 3P1HA 4XTCS 1SAPA 2K28A 1J8IA 2K5QA 1IW7C 3K58A 5JVG3 3OWFA 4C3JG 2TMPA 1SSOA 1AW7A 3PUWA 4K8JA 1DCZA 5D14A 1QWYA 2K7VA 1E2VA 1JQYD 1GUNA 2L0CA 4X3KA 3K57A 2K5WA 3TZDA 1GUGA 1BNZA 2NVYB 3H6MA 1SBBB 2AQ1B 1JCKB 1S5CD 2FMCA 5C4XB 3NTKA 3S14B 3KUPA 3A7AB 2SOBA 2DY8A 5BN4A 5ELBA 2FJ2A 3A8IE 1LV9A 1PMRA 3GV3A 3EJIA 3R3OA 1JORA 1Y69U 3VR2A 3V2TA 3HG9A 4IUUA 2VXWA 2DNEA 2IX1A 4U673 3G6JB 1STBA 4L6TB 1I4QA 1K8MA 3A55A 1EY5A 1STEA 2RVLA 2K6AA 4QF4A 3KLSA 3SK6A 3HZXA 4ABNA 1GHJA 3KLRA 5LHY1 1TQOA 4WRDA 1PRTB 2EYLA 1EYAA 1A2UA 1EIHA 1ENAA 3M3YB 1QG7A 3P7JA 1LTBD 2NYZD 4TKOB 1HA6A 2MUYA 1G2TA 4FF3A 3U9OA 1PFBA 3J80L 3NE5B 4KN4C 4ZKBB 4G7HC 3TDQA 4ZUIA 1E2ZA 2F0OA 2K01A 3I72A 1JC7A 4KY6A 2IJ0A 1TR5A 2L5TA 4HEDA 1D1IA 5JEAG 3BG3A 4ODGA 1F2MA 4UAIA 3MXNA 2K5DA 3SHLA 1G91A 3P75A 3R2TA 4E6IA 2F0FA 2JP1A 2SNSA 1IL8A 1II3A 1S4ZA 2Z4IA 1LTAD 2SDFA 3FRPB 4B08A 2NN6H 1B3AA 5IGCA 1TWGB 3S1RB 2QKIC 1RTNA 1G8ZD 2WAQB 4CKEA 1AZQA 5CV5A 5HGTA 1V8QA 3CHBD 1MSGA 4ZK9B 5ELEA 1RJTA 1H9MA 4IUPA 4HSPA 5D3DA 2NZ1D 2RA4A 1HTLD 4A3IB 1AP0A 1CI3M 1O80A 1JOKA 4A3DB 1M4VA 5C4HA 3D4RA 1CQFA 4N9PA 3Q24A 1Z47A 1PTOD 1LLRD 2DY7A 1STHA 4I7ZC 2ZXPA 4NP5A 5I2XA 1ENCA 1D2BA 1GUTA 4R8NA 5IOCA 4DXGA 4Y7NB 2NB0A 2F0QA 5IGEA 3J7YW 3D4DA 3KF8A 2O2LD 4A3FB 4J1MA 4KKUA 1ZYRC 2EE1A 2ICEC 5FO8B 3VYSA 3I3CA 3PUVA 1KNEA 5EPJA 3KBGA 1YNJD 1F2ZA 3DEOA 3PIO3 2C9OA 2E2JB 3BZDB 1TWFB 1T5XD 1U4LA 2JA7B 1K83B 1O7LA 2KHSA 2KVMA 3GTMB 4N9TA 1TKWB 5C0XJ 1PDQA 3RD4A 4DXFA 1LTTD 3HKZB 1NUCA 2FHTA 2A6EC 5IODA 5CORA 1MBYA 1UNSA 5K36G 1SYDA 4G4KA 3HOXB 2FMMA 1OXTA 2WINB 1I4RA 2PPBC 1DOMA 3V96A 1WVLA 3F2UA 1A3TA 1PLFA 3NK9A 2NWGA 2KEDA 2X69A 5BN3A 5C0XH 4I65A 4IUTA 3PV0A 4PV1C 1RCVD 2EJFC 2EYOA 2VNUD 4KN7C 1SYGA 4JK1C 1JWUD 3IAYA 5C3EB 1BXTA 3GTPB 5I9PA 1DZ1A 1MI2A 3NBIA 3T53B 4BA2I 2A68C 3C1EA 1TVXA 3I90A 2B2YC 1F77A 1SNMA 3T16A 3QIAA 4H13C 4S3SA 3R2IA 4H0LC 3SK5A 3M4YA 1QOHA 5JOBA 4C1NK 1CT1D 1KTKA 1WCMB 3OWEB 5CBEE 4RCOA 2B2WA 1AN8A 5C3WA 4OIKA 2EYPA 3U9SA 2O5JC 1HQMC 1BBXC 3HOVB 2Q8TA 2WIIB 4FXGC 4FXDA 5M3MB 5IGDA 1HA5A 1QE6A 4K2KA 1ET6A 1E2WA 1STNA 1H9SB 2HDLA 3L3OC 2BOSA 2EY5A 5EBDA 2R92B 2F0DA 2R3ZA 1D5MC 1DM0B 5EBCA 3TP8A 2I46A 4HR7B 1LABA 1DONA 4V0BA 2AWNA 1NR4A 2VB2X 3JAML 4YIJA 1TIID 2F0PA 3GD7A 5J22A 1JWSD 2X6LA 4Q5VA 3L7ZC 4G57A 3BYYB 4G7OC 1PTOF 3PMFA 4DGZA 1M8AA 4ME5A 1ML0D 4FP5D 1TWHB 1K8OA 4ZYSA 1RF2D 3AU7A 5E4WC 2NN6G 4JBWA 4IALA 2Q8RE 5D65A 2B2TC 4C3IB 2BDOA 1WTOA 3E6ZX 5A2QL 4QMGA 3FEWX 2F0WA 2MHVA 2Y0SB 5I9OA 1YNND 3C3LA 1ET9A 1RDPD 3K5LA 2PW5A 4C3IG 2K05A 3TSSA 1H9JA 1HRJA 4M1UB 3KBXA 1STYA 3DEPA 3M4OB 1WTXA 1W6JA 2Z4HA 1D1KA 3DM1A 2YU9B 3NWTA 2WB1B 1EY0A 4NDXA 1SYBA 2JA5B 1OXSC 2L11A 1PRTC 2CQAA 3N52A 4PNYA 5KNCA 1HFGA 1AFPA 4MIUA 4TSSA 2EYJA 3OMGA 1O7ZA 2XNAC 2F0NA 3S15B 1SNOA 5JVH3 3FPUB 2XWBB 1GJXA 2E75C 1D5ZC 4DNRB 2AWOA 4ILWA 1JOOA 2Q8IB 4M8AA 5F2DA 2RDGA 1G2SA 4CJ1B 4XQNA 3QG1A 3K5MA 1SYEA 5DEHA 1KAAA 3GTJB 1CHQD 1F2LA 1PYWD 1Y1WB 4C56C 3QOLA 1F2YA 3URYA 3D4WA 4DAYA 4NMZA 2V4DA 5IT9L 4L8JA 3HGBA 2B63B 4NW2A 1SXTA 3FPPA 2J4XA 3I91A 3QO2A 1PTOB 3H94A 4X3UA 3TP5A 4IQZA 2KOLA 1STAA 2RSOA 3T56B 2A69C 1HFNA 3PO3B 1UEAB 3I4NB 1Q8IA 3ND8A 1HUNA 3E5SA 3GTKB 3K59A 2OXPA 4NKLA 5JJZA 4B9WA 3MHBA 3MEHA 2LY7A 5I6WA 4FF2A 4RKBA 1CHPD 4EQNA 4LAAA 2EJMA 2B2VA 2LFNA 1S5FD 4O1NA 4DF7A 4IFDI 4OO1H 1HCZA 1PRTF 2YYZA 1G291 4CHTB 5D3IB 4KHZA 1O7YA 3I70A 5KNBA 1OO9B 4RWSC 2CW0C 2EJGC 3BVGA 3PO2B 3M7NA 4ZLTF 3VR6A 5EKKA 2KUMA 2R6GA 4OHJA 1DJRD 1BCPD 2A73B 2F4IA 1BOSA 2J7ZA 5EQ0A 1U4PA 2JA8B 5EKLA 1EWHA 5DAUA 5CV4A 1TWAB 1TY0A 3OPOA 4K14A 1BQQT 3GTOB 2ENBA 1S5DD 3HS0C 2KJXA 4K6DA 3ITPA 3FMCA 3S9WA 4KKSA 3NQTA 4HSVA 1B9MA 4R8IA 1W6KA 4ZKCB 1UUPA 5EKIA 1H9KA 3RUZA 2NVQB 4K5VA 4IURA 2O4XA 1C4QA 3SE0A 1EZ8A 2OT2A 1SYFA 2MP1A 3MXUA 1HTPA 2E74C 2QEJC 4ULLA 3GP7A 3DWQA 1CM9A 3CRLC 2JYOA 2B2WC 1ZYRD 5FO7B 2EVBA 2NTSA 3AB9A 5C5MA 3CQZB 1VCIA 3VA7A 2VUMB 2N55A 2WP8J 1SYCA 2RSNA 1DD2A 5COYA 4RAUC 1EEID 1CZWA 2EOTA 2EY1A 4PMCA 3DUZA 2JA6B 2F0MA 2K1BA 1IYUA 3VA5A 2F3WA 1EFID 3LWEA 4QUCA 4C3JB 1XYIA 3T4AC 2EYHA 3HP3A 2RDFA 5KGUA 3M85A 3J81E 1JWMD 4IUQA 1EZ6A 1LTID 3OHXC 4WJWA 2B2VC 5CV7A 1A6XA 2B8FA 3C1FA 3J80E 4DNTB 3A54A 5K5PA 1SNQA 1SE2A 2F0HA 4H44C 3VYUA 3NWSA 4BA1I 4A3BB 2QF7A 1ILPA 5K36H 4U68A 2J0TD 4CJ0B 1VF5C 3VYRA 1D5XC 1H9SA 4RKLA 4TRDA 3J81L 4CKCA 3HOYB 1WTVA 1OXVA 5JEAH 1B2TA 3T51B 1TT2A 3MVVA 5KYLA 1BCPC 4F87A 4K8IA 3MFGA 4V190 4DN4M 4FVMA 1EY8A 5J1ZA 1Y8PB 1BO0A 1CTMA 1AZPA 1PTOC 1QB5D 5JPNC 2KEEA 2XVSA 1U4MA 2F3VA 4CGYB 1QNKA 2E76C 3RZDB 5KRUA 1ONLA 3HRZC 3NBHA 3E0JA 1H9RA 3ZYYX 4IFDH 1LTRD 3SDZA 4KY7A 4X3TA 2JEAI 3EVQA 2QILA 2F1MA 5A35A 4K6LA 2SEBD 4C3HB 1WTWA 1Q1BA 2RDHA 1B4OA 2L55A 3FDTA 4FF1A 1SJED 4HMIA 4ZQ3A 3LX0A 2LS01 1HQRD 2KCCA 2K32A 4KTAA 1Z7TA 4KV6A 2WACA 3J7AF 1S5BD 3JAME 4F8MA 5EPLA 5LL6S 3SK8A 4QIWB 5CMDA 1HHVA 3EA6A 4ID6A 5BN5A 2Z1CA 5A2QE 2L12A 2A69D 3TMEA 1DOKA 1O78A 3I4MB 2H1EA 1EY7A 1ZXTA 2K33A 3MAQA 3J7AV 1IW7D 1F9SA 1UAPA 2F0TA 2PZWA 4FXKC 3NUCA 3MZ5A 5CR3A 5DM73 5CV6A 5I4DA 4RGNA 2NN6I 2DN8A 2PMZB 2PW7A 5KYIA 1X3QA 4C2MB 2KCNA 1Q1EA 1EU4A 5C5LA 3NPPA 4XYQA 4F88A 4RGTA 4RHSA 3DHQA 1GXDC 2BDNA 4BY7B 1PXUA 4A93B 2NTTA 1FD7D 4IUNA 1FNUA 3V05A 1HXYD 1LT4D 4Z9CB 2F0UA 2D9UA 1A3VA 3VR5A 2ZT9C 5IGFA 1V1PB 5FO9B 4FF4A 4DAVA 3R8BA 3N6RA 3AMUA 1FNVA 3BDOA 1SE4A 4BY1B 1VMCA 1ICWA 1NSNS 5CBAE 2MPMA 3K6OA 1JR0D 4RFBA 1IYVA 2M2LA 2ICIA 4OIJA 2A68D 1Y8NB 2JEBI 2ID0A 2EZVA 1IHZA 3RZOB 2R7ZB 1DXMA 4OO1I 5M5YB 3EFXD 4TQUS 3CRKC 3HOZB 1V1PA 1PZKD 3S17B 2F0KA 2AQ2B 4HMJA 3NSWA 4UDUC 4RGMA 5FLXL 2D5DA 3MTSA 5AFWA 1KDCA 1SFOB 1NCVA 4ZAIA 3Q23A 1QILA 2N88A 5T1IA 4BWGB 2CW0D 4XQQA 2D62A 3OMCA 1PZJD 1MSHA 4ZUJA 2A74C 2RBMA 1WTRA 4O42A 3VR4A 3IFTA 1SDFA 2I07B 1BCPB 2TSSA 1QNUA 3GTGB 1SNDA 3TBIB 4PMBA 4A3KB 3OW7A 4QB4A 1PFNA 3K0YA 4B9XA 1V1OA 2KQ3A 4H7BA 3VYTA 1LTGD 3W3AA 3IL8A 1EQTA 3S16B 5G3LD 1EYDA 2VB3X 4EQOA 1GHKA 4IFDJ 1NR2A 1VF7A 1Q3LA 3K5NA 1C8CA 2PZTA 2F03A 2A6HD 5KIXA 3NQIA 2EYMA 1FGBD 3HOWB 2BE5C 2B39A 4FNFA 2F0IA 1ENFA 1PFMA 4HCEA 3BVZA 2L4NA 3SXHA 3GQBA 4A3GB 3ND9A 1J9OA 1D6EC 1T5EA 3D6WA 3OSOA 2JXMB 2CVRA 1F9QA 1RHPA 4CBVA 4RHRA 1R4QB 3MXGA 1B44D 1FYCA 4DU9A 1SNCA 4XT3B 1VMPA 2OF1A 1B9NA 5IT9E 2IWHA 1BR9A 3S1QB 1ZKOA 3I4LA 3X3NA 1JE4A 3DWPA 2H4OA 3KLSX 1EL0A 2ZXOA 1ESFA 5E3FA 4CJ2C 3HEJA 2EY6A 2NVTB 1I4GA 4XXEA 5C4ZA 3BDCA 1NAPA 3I73A 1HUMA 5CGKA 1CQVA 4IN3A 2BCOA 1LT6D 4IFDG 2NUCA 1IKMA 4RGOS 2IT1A 2PNRC 2A6ED 3S1NB 3SK4A 3RLFA 2XIWA 2F0VA 4DK0A 1Q90A 2XN9C 4BBRB 4A3JB 5CV8A 3MFYA 2AQ3B 3PUZA 3NP8A 3PUYA 5I6YA 1EEFD 2GA4B 4P2CB 2RQXA 5JPMC 1SE3A 1KDBA 3Q6SA 1L0YB 3GO5A 4K2LA 1U9RA 2R61A 1SMYD 2L9HA 3S2DB 1B1ZA 2L1BA 2B2UC 2AUJD 4LK1C 1MGSA 5G3LF 1BUVT 4KD3A 3NHHA 4BBSB 1GOZA 4KK7A 1LACA 4RA8A 4C3HG 2O5IC 2G9DA 2F0SA 3BYTB 5C4JB 2F0EA 5ELFA 4PMWA 4HTHA 1LO5D 1JB3A 5HURA 2SNMA 4DA2A 5FK9C 4L63B 1EIGA 3CU7A 3PUXA 1R9TB 1XX8A 3FKIB 1WD1A 4DAPA 3KK7A 2IPKD 2WV6D 3M7GA 4OO1G 4RCNA 4EGVA 3TP7A 2BE5D 2JSOA 2ZXRA 4K5XA 2EY2A 1VDZA 5EJWA 5CYUA 1SJHD 4EQPA 1QCBD 2K04A 5ELCA 5E4XA 2B2UA 2F0JA 1KNAA 4AYBB 3OIQA 4WORA 5CV9A 5KNDA 3UI2A 3QOJA 5C44B 2CHBD 1ESRA 2NVXB 4WFN3 1B53A 1PRTD 1CA6A 3IFDA 3A7LA 1XXGA 1JICA 2E2DC 2D2CC 2F0LA 4G7ZC 4ZRZA 2IX0A 4R9WA 4FYDA 1MD2D 5M9OA 1TS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5W A;  5C5M A;  2SOB A;  1TT2 A;  4KD4 A;  2RKS A;  4KY5 A;  4RKB A;  4DFA A;  1EY0 A;  1NUC A;  1STN A;  3SXH A;  3MVV A;  4EQN A;  5IGB A;  5KYL A;  4NDX A;  1SYB A;  4KD3 A;  4LAA A;  3NHH A;  5IGC A;  5IOD A;  2PQE A;  2F0T A;  3EJI A;  3R3O A;  2PZW A;  4K8I A;  1STG A;  3NUC A;  1JOR A;  3MZ5 A;  5CR3 A;  3OSO A;  1SYD A;  2EY5 A;  3V2T A;  4F7X A;  1EY8 A;  3BDL A;  2F0K A;  4PNY A;  2F0D A;  5CV6 A;  5J1Z A;  1SYC A;  1EY6 A;  4HMJ A;  1RKN A;  4DF7 A;  4KJN A;  4MIU A;  2PW7 A;  3TP8 A;  5KYI A;  1KDC A;  2EYJ A;  2F0S A;  3OMG A;  5CV5 A;  4EVO A;  4IZ8 A;  1STB A;  2OEO A;  5HGT A;  5J39 A;  2HQE A;  2F0N A;  2F0E A;  1A3T A;  4DU9 A;  4HTH A;  1SNO A;  3NK9 A;  3QB3 A;  2EY1 A;  1KAB A;  1SNC A;  3MXP A;  4PMC A;  5HUR A;  2SNM A;  5JAV A;  2OF1 A;  1JOQ A;  2F3V A;  2F0M A;  1EY5 A;  4YIJ A;  4I65 A;  5C5L A;  3TP6 A;  2F0P A;  5KRU A;  3VA5 A;  1JOO A;  2F3W A;  5F2D A;  3D6C A;  2EYO A;  3OMC A;  3NXW A;  5J22 A;  4ZUJ A;  1JOK A;  2RBM A;  4QF4 A;  5C4H A;  2EYF A;  2QDB A;  5EGT A;  2EYH A;  4G57 A;  5E3F A;  1SYG A;  3SK6 A;  4KY7 A;  5EKK A;  3HZX A;  2RDF A;  5KGU A;  1SYE A;  3D8G A;  5DEH A;  1EY4 A;  5I9P A;  1KAA A;  3EVQ A;  4N9P A;  3T13 A;  3DHQ A;  3HEJ A;  3PMF A;  4DGZ A;  3TP7 A;  1TQO A;  4WRD A;  5KEE A;  3QOL A;  2EY6 A;  3DMU A;  2EYL A;  1F2Y A;  1STH A;  3C1E A;  4ME5 A;  1EZ6 A;  5NUC A;  4K5X A;  4NP5 A;  5C4Z A;  5ISR A;  1ENC A;  1SND A;  3BDC A;  5EKL A;  1SNM A;  1EYA A;  3D4W A;  2EY2 A;  4R8N A;  5DAU A;  4IUN A;  5CV4 A;  1A2U A;  2LKV A;  4PMB A;  3T16 A;  1KDA A;  4S3S A;  5CGK A;  4NMZ A;  1ENA A;  4K14 A;  2F0Q A;  5CV7 A;  5IGE A;  4HMI A;  2ENB A;  3SK5 A;  2F0U A;  4QB4 A;  4ZQ3 A;  5C3X A;  3LX0 A;  1EYC A;  4J6H A;  4B9X A;  4K6D A;  3ITP A;  4IAL A;  5IIF A;  2NUC A;  5CC4 A;  5JOB A;  3P1H A;  4EQP A;  1A3V A;  2KQ3 A;  3D4D A;  4H7B A;  3S9W A;  5IGF A;  1A2T A;  3SK4 A;  2F0V A;  3U9O A;  4J1M A;  2F0G A;  4KTA A;  3NQT A;  4EQO A;  1EYD A;  3C1F A;  4KV6 A;  2WAC A;  5E1F A;  3OWF A;  2F0J A;  2PZU A;  5K5P A;  4F8M A;  3RUZ A;  4K5V A;  1SNQ A;  2F0H A;  5CV8 A;  3SK8 A;  3TP5 A;  1A3U A;  2O4X A;  4QMG A;  5C3W A;  5IOC A;  3NP8 A;  4WOR A;  4ZUI A;  2F0W A;  5I6Y A;  1STA A;  2F0O A;  1EZ8 A;  2M00 A;  4K8J A;  4OL7 A;  2PZT A;  5CV9 A;  3ERQ A;  5I9O A;  1SYF A;  1EQV A;  1NSN S;  2EYP A;  1F2Z A;  4KY6 A;  1TR5 A;  1EY9 A;  3QOJ A;  4ID6 A;  3E5S A;  2PW5 A;  5KIX A;  5IGG A;  1SNP A;  2OXP A;  2PYK A;  4NKL A;  4ODG A;  1F2M A;  1KDB A;  2KHS A;  2EYM A;  3TME A;  4B9W A;  3MHB A;  4KJO A;  1STY A;  4RKL A;  4K2L A;  4N9T A;  4TRD A;  1U9R A;  2F0L A;  3ERO A;  3SR1 A;  5C6A A;  3SHL A;  3H6M A;  3MEH A;  1EY7 A;  3P75 A;  4E6I A;  5IGD A;  1AEX A;  2F0I A;  2F0F A;  1IHZ A;  5I6W A;  2SNS A;  5M9O A;  4K2K A;  2EXZ A;  1II3 A;  4KHV A; 
#chains in the Genus database with same CATH topology
 2YV5 A;  1I6H B;  1GD7 A;  1OXX K;  1I6V C;  4BBR H;  4CDC C;  1YIJ A;  3PIO A;  5TSS A;  2HCI A;  2WKD A;  3BDL A;  3CPF A;  1E22 A;  2JA7 H;  4BXX H;  1EY6 A;  5L37 A;  1RKN A;  1ILQ A;  2Z6K C;  3MA2 B;  1B50 A;  3EQL C;  4IZ8 A;  3KDF B;  5J39 A;  2HQE A;  3QWN A;  3NBH B;  1MJC A;  2XSC A;  3LWU A;  3W2D A;  1PH6 A;  3FVQ A;  2JE6 I;  3TP6 A;  3VR3 A;  3I4N H;  1Q12 A;  1RTO A;  1U0L A;  4GS3 A;  4A93 H;  3UDX A;  3D0F A;  2EYF A;  5EGT A;  4DV6 Q;  1E24 A;  1CA5 A;  4X65 L;  1SLJ A;  2E2I H;  4APV A;  3CCR A;  3K7A B;  5ELD A;  1I4P A;  1IBK L;  2HDM A;  1QZG A;  3DMU A;  4PQX A;  5NUC A;  1Y14 B;  3L0O A;  5T1G A;  1QVG A;  4LF8 Q;  2BA0 A;  3WDN A;  1KDA A;  4DR7 L;  1KL9 A;  1SRU A;  3A8K E;  1I4H A;  4CDD C;  2HCC A;  2FIN B;  2A6H C;  2BH2 A;  4HJ9 A;  4X66 L;  3GTP H;  1EU3 A;  1N36 L;  4XYO A;  5E1F A;  3VDY A;  1W3S A;  2DNC A;  2NBF A;  1A3U A;  4QIW E;  4JBJ A;  1A15 A;  1TS3 A;  3CCJ A;  3RMH A;  2M00 A;  2AUK A;  3CKI B;  3ERQ A;  1SMY C;  1X3P A;  3A56 A;  4RG1 A;  2PCF B;  2RF4 A;  4MTN A;  1EY9 A;  1BF4 A;  1YNJ C;  4MHE A;  3ULP A;  5IGG A;  1CFM A;  4POF A;  1GO3 E;  3CQZ H;  3ONA B;  1XTC D;  1IBM L;  3SR1 A;  3BS1 A;  1PVO A;  2XRQ D;  3MC0 B;  3S1R H;  5FKA C;  5C0X I;  3L2P A;  3S17 H;  2EXZ A;  1NMG A;  1Y1V H;  4LFC L;  5IGB A;  4OGQ C;  3IKJ A;  1XWE A;  2PQE A;  1HH2 P;  4IUV A;  5FLM G;  4LF6 Q;  4XT1 B;  3D31 A;  3ULL A;  1QVC A;  3T1H Q;  2Z8L A;  4HAE A;  5I2Y A;  1HR0 Q;  3PIP 3;  2CWA A;  2HQL A;  2IL8 A;  3A5U A;  2EPB A;  4DR4 L;  1TU2 B;  3J7Z C;  2FFK B;  1TWC B;  2B63 G;  4A3C G;  3H3V C;  4JI5 L;  4LF4 L;  3S2H H;  3K7U C;  4X64 Q;  2PNH A;  5JEA J;  5JAV A;  1TS5 A;  1JOQ A;  3M4O H;  3NTH A;  2KA7 A;  2QW7 A;  3K0X A;  4A76 A;  5FLX E;  1ZEQ X;  4O2D A;  5EPK A;  3BU2 A;  3NTI A;  3D6C A;  1R9T H;  1PZI D;  3A5Z B;  2VUM H;  1I4X A;  1B7Y B;  1OXU A;  4QUF A;  4GZY C;  4L5Q A;  4DR2 Q;  2LMC B;  4KMU C;  1Z9F A;  1EY4 A;  5M5W B;  4A3E H;  4J15 A;  1LT3 D;  4LMQ D;  2JA9 A;  1HNZ L;  3H0G H;  1FL0 A;  3H91 A;  1UWV A;  4YY3 L;  4DV1 L;  2XRS D;  5C3X A;  3GV6 A;  4CDF C;  5IIF A;  2A5H A;  4KI0 A;  5DM6 3;  3TZU A;  2B2Y A;  4C3I H;  4JG2 A;  3BZC A;  4C1N I;  2B8G A;  3HOV G;  2M9V A;  3KOJ A;  4GKJ L;  1KLG D;  2A1A A;  4BS9 A;  3SVM A;  1KLU D;  1PH5 A;  2R93 B;  2JA6 H;  1I6H H;  3QJY A;  1ROD A;  1KIX A;  4CKB A;  4X6A H;  2E2I B;  4OL7 A;  4X65 Q;  3F2D A;  1EQV A;  1X3G A;  5FOB B;  4Q0F A;  4BXX G;  1SNP A;  2PYK A;  2EDG A;  2F3I A;  4JYA Q;  3CP0 A;  3DWA A;  1U5K A;  1X55 A;  5C6A A;  2CWP A;  1V43 A;  2FXQ A;  3OOC A;  4HID A;  1GUO A;  4KD4 A;  3EN2 A;  1IKL A;  2LKV A;  4KHV A;  4K5W A;  1U4R A;  4KY5 A;  4DFA A;  2X6G A;  1X32 A;  3H0G B;  1L0X B;  3Q0A A;  4XIG S;  1E0B A;  3JAM i;  4HIM A;  1EOV A;  2WAQ G;  4F7X A;  2HD3 A;  2N3S A;  4RH6 A;  5C0X G;  3BZK A;  2CH4 W;  2D0P A;  1TS4 A;  1FJG Q;  4DUY L;  1PYB A;  4KJN A;  4UP9 A;  1C0A A;  1Y8O B;  1MIU A;  3I2Z A;  5M5W H;  4A3E B;  1HPC A;  1QJO A;  4OWW B;  3QB3 A;  1JJG A;  1F9P A;  1Z6H A;  3MXP A;  1F9R A;  1I50 B;  3WOE A;  3X3M A;  1WTP A;  1PYS B;  2VS1 A;  3CCV A;  2K03 A;  1GUW A;  3HOY G;  2HUG A;  1I3Q H;  2G9H D;  3O13 A;  1Y1V B;  1VQO A;  4LFC Q;  4O0A A;  1T9H A;  3D8G A;  3A8J E;  2QCP X;  2GVA A;  2VUM G;  3HOX G;  3S1M B;  5LL6 X;  2NVX H;  2KCT A;  1VQH A;  2NVQ H;  4B3M Q;  5ISR A;  4LJZ C;  3BVM A;  2VQE Q;  2WKC A;  3LNN A;  3D3R A;  5IP7 G;  2BA1 A;  2XWJ B;  1C48 A;  1CZG A;  3WOF A;  3IRB A;  3PF4 A;  3K5O A;  2E2J H;  5CC4 A;  4A3B H;  1A2T A;  3H09 A;  5M5X B;  2F0G A;  4A3I H;  1TWA H;  1EWC A;  2JA8 G;  1KRS A;  1LTS D;  2PZU A;  3C46 A;  4QL5 A;  1XNR L;  4XDX A;  1CKO A;  4BY1 G;  1DOL A;  1BCP F;  4A3M B;  3S2D H;  1WJJ A;  2B2T A;  2MGS A;  3PO3 H;  2JA5 G;  4XQJ A;  1D7Q A;  2KEC A;  2ZTC A;  1YNN C;  4DV4 Q;  1JB7 A;  4KJO A;  1RD9 D;  3GTL B;  1WTQ A;  2EXD A;  2PO4 A;  3ERO A;  1FR3 A;  3P20 A;  3TN2 A;  2R93 G;  1AEX A;  3TRE A;  4HN7 A;  2C5C A;  1VQ9 A;  4MN3 A;  3Q22 A;  3L9A X;  5LMN W;  3HOU B;  1G6Z A;  1HZA A;  2IX3 A;  4ME3 A;  2RKS A;  2UUC L;  4KKT A;  2I5L X;  4DK1 A;  3SEB A;  1STG A;  2OCE A;  3DXJ C;  1AE3 A;  4J8Q A;  1I3Q B;  3MWY W;  3OIP A;  3G6E A;  1HNZ Q;  3BJU A;  1IBM Q;  2ES2 A;  3I8Z A;  2VQF Q;  1FNW A;  2OQK A;  4FO2 A;  4EVO A;  2OEO A;  1VQJ A;  4QCL A;  3C2P A;  1N8R C;  4NXM L;  1KAB A;  2E2H B;  3GTQ B;  2IW3 A;  1CK1 A;  1TY2 A;  1BDO A;  1Q86 C;  2I5M X;  1LT5 D;  1DYQ A;  1PTO H;  1VQB A;  3HKZ G;  1PH4 A;  2PMZ E;  3NXW A;  3K8A A;  1RL2 A;  5M3F H;  1UE5 A;  2QDB A;  1TWH H;  1EOT A;  3I4M H;  4X3S A;  2LXK A;  3G7L A;  2CFM A;  3T13 A;  2MJ8 A;  4GOP B;  1R4P B;  3E3X A;  5KEE A;  1WD0 A;  1PH3 A;  4HCS A;  5M3F B;  1S5E D;  3S2H B;  4DR5 L;  1GUS A;  3HOU G;  5DNF A;  4OX9 Q;  3KDF A;  1EYC A;  4J6H A;  4YCU A;  1SEB D;  3R93 A;  4POG A;  3P1H A;  4LUV A;  4XTC S;  1SAP A;  4DAY B;  4DV4 L;  2K28 A;  1OTC A;  1VQ7 A;  1J8I A;  4ALP A;  2K5Q A;  3GTJ H;  1IW7 C;  4JI1 Q;  3K58 A;  3OWF A;  3CCM A;  5JVG 3;  4C3J G;  1K73 C;  4DNI A;  3KF6 B;  2TMP A;  1SSO A;  4N8X 1;  4LW1 A;  4MNO A;  1AW7 A;  1K3R A;  3PUW A;  3E0E A;  4K8J A;  1DCZ A;  4JI7 Q;  1SR3 A;  5D14 A;  1QWY A;  2K7V A;  1E2V A;  1JQY D;  4AQY Q;  1GUN A;  4DV7 Q;  3U58 A;  2L0C A;  4X3K A;  3K57 A;  2K5W A;  3TZD A;  1GUG A;  4JI6 Q;  3EIV A;  1BNZ A;  1X3E A;  2NVY B;  3H6M A;  1SBB B;  4AYB G;  2AQ1 B;  1JCK B;  1S5C D;  3T1Y Q;  2FMC A;  5C4X B;  3NTK A;  3S14 B;  3KUP A;  3A7A B;  2SOB A;  2DY8 A;  4A3F H;  5BN4 A;  5ELB A;  2FJ2 A;  3A8I E;  1LV9 A;  1PMR A;  3GV3 A;  3EJI A;  4JC0 A;  3R3O A;  1JOR A;  1Y69 U;  3VR2 A;  3S1M H;  3V2T A;  4C3J H;  3HG9 A;  4IUU A;  4YHH L;  1HNX L;  2K52 A;  2VXW A;  2DNE A;  3PCO B;  1QVF A;  2IX1 A;  4U67 3;  5E7N A;  3G6J B;  2B3G A;  1STB A;  4B3T L;  2P5Z X;  4L6T B;  3CCE A;  1I4Q A;  4LF7 Q;  1K8M A;  2RCN A;  3A55 A;  5FLM H;  3HOW H;  1MKH A;  1EY5 A;  1YBY A;  1BKB A;  1STE A;  3PF5 A;  3RN2 A;  2RVL A;  2R93 H;  2K6A A;  4QF4 A;  3KLS A;  3U4V A;  3SK6 A;  1IBL L;  3HZX A;  4ABN A;  2PI2 E;  1GHJ A;  3KLR A;  5LHY 1;  1TQO A;  4YCV A;  3FP9 A;  4WRD A;  1PRT B;  1SN8 A;  2EYL A;  1IZ6 A;  1EYA A;  1A2U A;  1EIH A;  1ENA A;  5HGQ A;  4JI7 L;  1QG7 A;  3P7J A;  4HIO A;  3TS2 A;  3M3Y B;  1K0R A;  5FJ8 G;  1A8V A;  1LTB D;  2NYZ D;  4TKO B;  1HA6 A;  2MUY A;  1G2T A;  3S24 A;  4FF3 A;  3U9O A;  1PFB A;  3J80 L;  3NE5 B;  4DR7 Q;  2MQH A;  4KN4 C;  4LUO A;  4ZKB B;  1QZH A;  4G7H C;  3TDQ A;  3CD6 A;  4ZUI A;  1E2Z A;  2B63 H;  4A3L H;  2F0O A;  2K01 A;  3I72 A;  1JC7 A;  1IXR A;  4P72 A;  1Y1W G;  4KY6 A;  2YTV A;  2IJ0 A;  1TR5 A;  2ALY B;  2L5T A;  4HED A;  1KD1 C;  1D1I A;  5JEA G;  1IBK Q;  1BVS A;  4NXM Q;  4A3M G;  3CMA A;  3BG3 A;  4ODG A;  1F2M A;  4UAI A;  3MXN A;  4LFA Q;  1PA6 A;  2K5D A;  3SHL A;  1VQI A;  1G91 A;  3P75 A;  3R2T A;  4E6I A;  2F0F A;  2JP1 A;  2SNS A;  5GRO A;  1IL8 A;  1X6O A;  4P74 A;  1II3 A;  2LXJ A;  1S4Z A;  2Z4I A;  5GAD C;  1LTA D;  2UXC L;  2SDF A;  4UHV A;  3I4N G;  1G51 A;  3FRP B;  4B08 A;  2NN6 H;  1B3A A;  5IGC A;  1TWG B;  3S1R B;  1PFS A;  2QKI C;  4JI0 L;  1RTN A;  1G8Z D;  4EQ5 A;  1VQG A;  2HIV A;  2WAQ B;  4CKE A;  1PH7 A;  1AZQ A;  5CV5 A;  5HGT A;  1V8Q A;  3CHB D;  1MSG A;  4ZK9 B;  4DK6 C;  5ELE A;  1RJT A;  1H9M A;  1EYG A;  2ASB A;  4IUP A;  3KYH C;  4HSP A;  5D3D A;  2NZ1 D;  1V1Q A;  2JN4 A;  4CDE C;  2RA4 A;  1HTL D;  4A3I B;  1AP0 A;  1CI3 M;  4JI4 Q;  1O80 A;  1JOK A;  4A3D B;  1M4V A;  5C4H A;  3D4R A;  4R4Q A;  1CQF A;  3QR8 A;  5LMN Q;  2YTX A;  4N9P A;  3Q24 A;  1Z47 A;  1PTO D;  1LLR D;  2DY7 A;  4LF6 L;  1STH A;  4I7Z C;  3H3V H;  2ZXP A;  4NP5 A;  5I2X A;  1ENC A;  1K9M C;  1D2B A;  1GUT A;  4R8N A;  5IOC A;  3KJO A;  4DXG A;  4Y7N B;  2HHH Q;  3CW2 C;  3M4Q A;  2NB0 A;  2F0Q A;  2CH4 A;  4GLA C;  5IGE A;  3K7A H;  3J7Y W;  4N8F A;  2CCZ A;  3D4D A;  3KF8 A;  2DJG C;  2O2L D;  4LFA L;  4A3F B;  4J1M A;  1HZ9 A;  4KKU A;  1ZYR C;  2EE1 A;  2ICE C;  5FO8 B;  4K0K L;  4JOI C;  3VYS A;  2XTI A;  4BBR G;  3I3C A;  3JAM c;  3PUV A;  3UDF A;  5IE8 A;  1KNE A;  3F8T A;  5EPJ A;  1IBL Q;  3AQQ A;  3KBG A;  2VZA A;  1YNJ D;  1F2Z A;  2IHF A;  3DEO A;  4DV3 L;  3PIO 3;  2C9O A;  2VY3 A;  3CXC A;  3BZD B;  1TWF B;  1T5X D;  2E2J B;  1U4L A;  2JA7 B;  1K83 B;  1O7L A;  2KHS A;  2KVM A;  5AJ3 L;  3GTM B;  4N9T A;  1TKW B;  4OEM B;  1NE3 A;  4DR3 L;  5C0X J;  1PDQ A;  3RD4 A;  4DXF A;  2JQO A;  1LTT D;  1GKH A;  3HKZ B;  1NUC A;  2Y0S E;  2FHT A;  5H1S E;  2A6E C;  5IOD A;  5COR A;  2JA5 H;  1MBY A;  1UNS A;  5IP7 H;  5K36 G;  1SYD A;  4G4K A;  1A63 A;  3HOX B;  2FMM A;  4A3K G;  1OXT A;  2WIN B;  3CAM A;  1I4R A;  2PPB C;  1DOM A;  1ICF B;  3V96 A;  1WVL A;  2LSS A;  1XTD A;  3F2U A;  1A3T A;  1PLF A;  3NK9 A;  2NWG A;  2KED A;  2PQA B;  2UXB Q;  2X69 A;  5BN3 A;  2JA7 G;  4AYB E;  4DV5 L;  2ZTE A;  5C0X H;  4I65 A;  4IUT A;  1N33 Q;  2HT1 A;  1WCM G;  3PV0 A;  4PV1 C;  3HOW G;  1RCV D;  2EJF C;  3UDG A;  5BR8 L;  2EYO A;  4JV5 L;  2VNU D;  4KN7 C;  2QGQ A;  1SYG A;  4JK1 C;  1JWU D;  3IAY A;  5C3E B;  1BXT A;  3GTP B;  5I9P A;  1DZ1 A;  1MI2 A;  3NBI A;  3T53 B;  4BA2 I;  2A68 C;  3C1E A;  1TVX A;  3I90 A;  2B2Y C;  1F77 A;  1SNM A;  3T16 A;  3QIA A;  1YEZ A;  4H13 C;  4R4T A;  2R7D A;  2R92 G;  4S3S A;  2UXD Q;  3R2I A;  3HKS A;  1S72 A;  2PQA A;  4H0L C;  2OQ0 A;  4R4O A;  3SK5 A;  3TRZ A;  3M4Y A;  1QOH A;  4DUZ Q;  5JOB A;  4C1N K;  1CT1 D;  5C4X G;  1KTK A;  4A3G G;  1WCM B;  3OWE B;  4AQY L;  5CBE E;  3RN5 A;  1DGS A;  1WTH A;  2WFW A;  4RCO A;  1K8A C;  2B2W A;  1AN8 A;  4IO9 A;  5C3W A;  1VQC A;  5IYC H;  4A3C H;  4OIK A;  3GTL H;  2EYP A;  3U9S A;  3M9B A;  2O5J C;  1HQM C;  5GAG C;  1BBX C;  4FDB A;  3HOV B;  2Q8T A;  2WII B;  4JBK A;  4FXG C;  4FXD A;  1O7I A;  5M3M B;  1YHQ A;  2ZJQ A;  3RR5 A;  4QGU A;  5IGD A;  1HA5 A;  1QE6 A;  4K2K A;  2EIF A;  1JJ2 A;  1BBW A;  1ET6 A;  1E2W A;  1STN A;  3HOV H;  1N34 L;  1H9S B;  2HDL A;  4A3J G;  2K5N A;  3L3O C;  3S15 H;  2BOS A;  2EY5 A;  4JYA L;  5EBD A;  4LF4 Q;  3GTQ H;  1Q8K A;  2F0D A;  2R92 B;  2N49 A;  2HHH L;  1XNR Q;  4LF5 Q;  1GVP A;  2R3Z A;  1D5M C;  2UUB L;  1DM0 B;  5GAH C;  5EBC A;  3HKZ E;  3TP8 A;  1WOC A;  2I46 A;  4HR7 B;  1B70 B;  1LAB A;  1DON A;  2V1C C;  4V0B A;  2AWN A;  1YIT A;  1NMF A;  3E9I A;  1NR4 A;  2NZH A;  2VB2 X;  3JAM L;  1Q7Y C;  3ICE A;  4YIJ A;  1TII D;  2F0P A;  3SGI A;  3GD7 A;  5J22 A;  1JWS D;  2X6L A;  4Q5V A;  3L7Z C;  3K80 C;  3OTO L;  2I0Q A;  3U4Z A;  4G57 A;  2A8V A;  3BYY B;  4L5R C;  1X3F A;  4G7O C;  2F52 A;  1PTO F;  3PMF A;  4DGZ A;  1M8A A;  4JI3 Q;  1IL2 A;  2OWO A;  4ME5 A;  1HNW Q;  2Z6K A;  2K5V A;  1ML0 D;  4FP5 D;  1K83 H;  2UU9 L;  1TWH B;  1K8O A;  3ZJY C;  4ZYS A;  1RF2 D;  3AU7 A;  5E4W C;  2NN6 G;  4JBW A;  1XMO Q;  3T1H L;  4IAL A;  2Q8R E;  5D65 A;  2UXB L;  1KHI A;  2B2T C;  4C3I B;  2BDO A;  1N32 Q;  1WTO A;  3E6Z X;  2K75 A;  3RLN A;  3ULJ A;  5A2Q L;  2JA8 H;  4OON A;  4QMG A;  3FEW X;  4LF7 L;  2F0W A;  4YWM A;  1JMC A;  2MHV A;  2Y0S B;  5I9O A;  1YNN D;  3C3L A;  1ET9 A;  1RDP D;  4BBS H;  3K5L A;  3NEL A;  2PW5 A;  4B3S Q;  5IYC G;  3FKI H;  2K05 A;  4C3I G;  3TSS A;  1H9J A;  1HRJ A;  4M1U B;  3KBX A;  1EWI A;  4DV5 Q;  1STY A;  3DEP A;  3M4O B;  1W6J A;  1WTX A;  2Z4H A;  1D1K A;  3DM1 A;  3FKI G;  2I5H A;  2YU9 B;  4JI3 L;  3NWT A;  4A3B G;  4B3R L;  4X62 L;  2WB1 B;  1EY0 A;  4NDX A;  1SYB A;  4EX5 A;  2JA5 B;  4UPA A;  5C3E H;  1OXS C;  2L11 A;  4DV3 Q;  1PRT C;  4A3G H;  2CQA A;  3UE0 A;  3N52 A;  4JI2 Q;  3T1Y L;  3I4M G;  4PNY A;  5KNC A;  1HFG A;  1MJE A;  1AFP A;  4MIU A;  4TSS A;  2EYJ A;  3OMG A;  1O7Z A;  2XNA C;  4JCV E;  1B3Q A;  2F0N A;  2AMC B;  3S15 B;  1SNO A;  5JVH 3;  3FPU B;  4HJA A;  2XWB B;  1GJX A;  3TEH B;  1N9W A;  2E75 C;  1D5Z C;  4OEL B;  4DNR B;  4GLV B;  2AWO A;  1TWG H;  4ILW A;  1JOO A;  1Y1V G;  2Q8I B;  4M8A A;  5F2D A;  1KC8 C;  2RDG A;  5HY6 A;  1G2S A;  4PG3 A;  1L2F A;  4CJ1 B;  3UDI A;  4XQN A;  4KHP Q;  4MZ9 A;  2Q2H A;  3QG1 A;  3K5M A;  1SYE A;  5DEH A;  1KAA A;  3GTJ B;  1CHQ D;  4DR1 L;  1L1O B;  1F2L A;  1PYW D;  1Y1W B;  4C56 C;  3QOL A;  1F2Y A;  3J81 i;  3URY A;  3D4W A;  4YHH Q;  3U50 C;  3AFP A;  4DAY A;  4NMZ A;  2V4D A;  3S1Q H;  5IT9 L;  3M4P A;  1RIP A;  4L8J A;  3HGB A;  4GNX A;  1YHB A;  2B63 B;  4NW2 A;  1SXT A;  1YVC A;  3FPP A;  4P71 A;  5J3B A;  2J4X A;  1M1K C;  3I91 A;  1EQR A;  3QO2 A;  1PTO B;  1TXY A;  3H94 A;  4X3U A;  1SE8 A;  3TP5 A;  2NVT H;  4IQZ A;  1E1O A;  3WWV A;  1W2B A;  2KOL A;  1STA A;  2QEX A;  3PO2 G;  2RSO A;  3T56 B;  2A69 C;  1HFN A;  1LUZ A;  1HR0 W;  3W1G A;  3PO3 B;  1UEA B;  3I4N B;  1Q8I A;  3ND8 A;  1HUN A;  3E5S A;  3CC2 A;  3GTK B;  3K59 A;  2OXP A;  4NKL A;  3E9H A;  4KHP L;  5JJZ A;  4B9W A;  3MHB A;  5M3M H;  3HOZ H;  3MEH A;  4P73 A;  2LY7 A;  5I6W A;  2K14 A;  5JJK A;  4FF2 A;  4RKB A;  1CHP D;  3OW2 A;  4EQN A;  4LAA A;  4NXN L;  2EJM A;  4PZ6 A;  2B2V A;  1XNQ Q;  4GN3 B;  2LFN A;  2UU9 Q;  2PI2 A;  2UXC Q;  1S5F D;  4O1N A;  2QA4 A;  4DF7 A;  3HOY H;  4IFD I;  5C44 H;  4OO1 H;  3DLL A;  1HCZ A;  1PRT F;  2YYZ A;  1G29 1;  4CHT B;  4A3E G;  5D3I B;  4KHZ A;  1O7Y A;  1XMQ Q;  5JJI A;  3I70 A;  5KNB A;  1OO9 B;  2KHJ A;  4RWS C;  2CW0 C;  1TWF H;  4UP7 A;  3CCL A;  2EJG C;  3GTK H;  4GKK Q;  3BVG A;  2ZM6 Q;  3PQI A;  3PO2 B;  4AH6 A;  4R4C A;  3M7N A;  1J5E Q;  4ZLT F;  3VR6 A;  5EKK A;  2KUM A;  3CPW A;  2R6G A;  4OHJ A;  1DJR D;  1BCP D;  2A73 B;  4DR3 Q;  2F4I A;  4C3H H;  1BOS A;  2RHQ B;  4DUZ L;  2J7Z A;  5EQ0 A;  1U4P A;  4JI4 L;  2JA8 B;  3HOZ G;  5EKL A;  1L1O A;  1EWH A;  5DAU A;  5CV4 A;  1TWA B;  1TY0 A;  3OPO A;  4K14 A;  1BQQ T;  3GTO B;  2CKZ B;  2ENB A;  1S5D D;  3HS0 C;  1CUK A;  2KJX A;  4I7A A;  3ITP A;  4K6D A;  1VQ8 A;  3FMC A;  3S9W A;  1YI2 A;  1VQ5 A;  4KKS A;  1PH1 A;  3NQT A;  4Y7N H;  4HSV A;  1B9M A;  4A3K H;  3CC4 A;  2YU9 H;  4R8I A;  4BBS G;  1W6K A;  4ZKC B;  1UUP A;  4JVZ A;  1H9K A;  5EKI A;  4OWX B;  3RUZ A;  4K5V A;  1WI5 A;  2NVQ B;  4IUR A;  1I50 H;  2O4X A;  1C4Q A;  3SE0 A;  1EZ8 A;  2OT2 A;  1SYF A;  2MP1 A;  3MXU A;  1HTP A;  2E74 C;  2QEJ C;  3JC6 6;  4A3L G;  2AKW B;  4ULL A;  3GP7 A;  3DWQ A;  1CM9 A;  3CRL C;  1NY4 A;  2JYO A;  2B2W C;  1ZYR D;  4RMF A;  5FO7 B;  4IPC A;  2EVB A;  2NTS A;  1IYJ B;  1YJN A;  3AB9 A;  4LFB Q;  5C5M A;  3CQZ B;  3HFZ B;  1VCI A;  1EFW A;  4Y52 H;  5IYB H;  4A3M H;  3VA7 A;  4B3S L;  2VUM B;  4BY1 H;  2N55 A;  2WP8 J;  1SYC A;  1ASZ A;  2RSN A;  1DD2 A;  1N36 Q;  5COY A;  4RAU C;  1EEI D;  2DGY A;  1K28 A;  1CZW A;  1NNX A;  2EOT A;  3I56 A;  2EY1 A;  1S40 A;  1NTG A;  4PMC A;  3DUZ A;  3HOX H;  2JA6 B;  2F0M A;  2K1B A;  4K0K Q;  1IYU A;  3NEN A;  3VA5 A;  2F3W A;  1NBW A;  1EFI D;  3LWE A;  1UE1 A;  4QUC A;  2AHO B;  4C3J B;  4JW0 A;  1XYI A;  2WB1 E;  3T4A C;  2EYH A;  4JBM A;  3A0J A;  3HP3 A;  3RLO A;  2RDF A;  5KGU A;  3M85 A;  3J81 E;  4L5T A;  1JWM D;  4IUQ A;  3F2C A;  2ZJR A;  1EZ6 A;  1LTI D;  3PSI A;  3I7F A;  1S3O A;  3OHX C;  4WJW A;  1PH9 A;  2B2V C;  2L15 A;  4PZ8 A;  5CV7 A;  1HZB A;  4DR6 L;  5C44 G;  1K8G A;  1HNX Q;  3OYY A;  2XGT A;  4DV2 L;  2DJF C;  1A6X A;  5LMN L;  2B8F A;  4DR5 Q;  3C1F A;  3J80 E;  4DNT B;  5GQO A;  1XMQ L;  3A54 A;  5K5P A;  1SNQ A;  1SE2 A;  2F0H A;  1LYL A;  4X64 L;  4H44 C;  3VYU A;  3NWS A;  4BA1 I;  4A3B B;  1PV4 A;  2QF7 A;  1KQS A;  5K36 H;  1ILP A;  4U68 A;  2J0T D;  3W5O A;  4CJ0 B;  1VF5 C;  1QUQ A;  2CQO A;  3VYR A;  1D5X C;  1H9S A;  4RKL A;  4TRD A;  3J81 L;  4CKC A;  3HOY B;  1WTV A;  1CKN B;  4IPD A;  2R7Z H;  1OXV A;  1L1O C;  1ASY A;  5JEA H;  2ZM6 L;  3RZO H;  1HNW L;  1B2T A;  1Q46 A;  3T51 B;  1TT2 A;  3MVV A;  5KYL A;  1BCP C;  4F87 A;  4K8I A;  1YHA A;  3H15 A;  3MFG A;  4V19 0;  4YY3 Q;  4DN4 M;  4FVM A;  1L0W A;  1EY8 A;  5J1Z A;  1Y8P B;  4A93 G;  1BO0 A;  2Y0S G;  1CTM A;  4NPS A;  3TS0 A;  1AZP A;  1PTO C;  4OWT B;  1I94 Q;  1QB5 D;  5JPN C;  4YCW A;  1KXL A;  1HR0 L;  5FLX c;  1AH9 A;  2KEE A;  2XVS A;  1U4M A;  2F3V A;  4CGY B;  1QNK A;  2E76 C;  3RZD B;  5KRU A;  1ONL A;  2MFI A;  2UUB Q;  1E7Z A;  3HRZ C;  3NBH A;  4A3I G;  2Z9H A;  1FGU A;  3E0J A;  1H9R A;  3LGJ A;  1VQN A;  3ZYY X;  4JI5 Q;  4IFD H;  1LTR D;  3FHW A;  3F2B A;  2E2H H;  3SDZ A;  3K81 C;  4KY7 A;  4X3T A;  5EAY A;  3CCS A;  2JEA I;  3EVQ A;  2QIL A;  5IP9 H;  2F1M A;  4JI1 L;  5A35 A;  4K6L A;  2SEB D;  4C3H B;  1WTW A;  1Q1B A;  2RDH A;  1A0I A;  1B4O A;  2L55 A;  3FDT A;  2MO0 A;  4FF1 A;  2WAQ E;  1SJE D;  4JI8 L;  1N33 L;  4DR2 L;  4HMI A;  2Q2T A;  5BR8 Q;  1KAW A;  4ZQ3 A;  1EIY B;  2K50 A;  3LX0 A;  2LS0 1;  4JI2 L;  1HQR D;  2E5L Q;  1CKM A;  2KCC A;  1JT8 A;  2K32 A;  4KTA A;  1D8L A;  1Z7T A;  4KV6 A;  2WAC A;  4DUY Q;  3B6Y A;  3J7A F;  1S5B D;  4C2M H;  1SMX A;  3JAM E;  4F8M A;  5C4J H;  5EPL A;  5LL6 S;  4DV1 Q;  1KRT A;  3GTG H;  4A3D H;  3SK8 A;  3RNU A;  1GM5 A;  5C3E G;  3ERS X;  4QIW B;  5CMD A;  3OTO Q;  3S1N H;  1EIF A;  2RCF A;  3PIP A;  5LMU L;  1LTL A;  3RZD H;  1HHV A;  3EA6 A;  1K0S A;  4ID6 A;  5BN5 A;  2Z1C A;  5A2Q E;  2L12 A;  2A69 D;  2R92 H;  3TME A;  1DOK A;  1O78 A;  3I4M B;  2H1E A;  1YJW A;  1EY7 A;  1ZXT A;  2K33 A;  3H0G G;  3MAQ A;  3H3V I;  3J7A V;  4ZCK A;  1UEB A;  1IW7 D;  4L5S A;  1F9S A;  1UAP A;  2F0T A;  2PZW A;  4FXK C;  3NUC A;  4BY7 G;  3MZ5 A;  3DM3 A;  5CR3 A;  5DM7 3;  5CV6 A;  5I4D A;  3J81 j;  4RGN A;  2NN6 I;  2KBN A;  2G5D A;  1XJV A;  2DN8 A;  2PMZ B;  2PW7 A;  2Z0S A;  5KYI A;  1X3Q A;  2IY5 B;  4C2M B;  4JI0 Q;  4IPH A;  2KCN A;  2YTY A;  1Q1E A;  2QDL A;  4JOI A;  4AIM A;  1EU4 A;  4X66 Q;  4HJ5 A;  3G4S A;  4UP8 A;  1FJG L;  5C5L A;  2K4K A;  2JK8 A;  3NPP A;  1VQ6 A;  5IT9 c;  2N78 A;  4XYQ A;  4F88 A;  2R7Z G;  4RGT A;  4KLK A;  1VQ4 A;  4RHS A;  3DHQ A;  2NVY H;  1YNX A;  3GDE A;  1GXD C;  2BDN A;  4BY7 B;  1PXU A;  4A93 B;  2NTT A;  1J6Q A;  1FD7 D;  1VQP A;  4IUN A;  1FNU A;  3V05 A;  1YZ6 A;  1HXY D;  5LMU Q;  1LT4 D;  4Z9C B;  3CCU A;  5IYB G;  2E8G A;  2F0U A;  3ER0 A;  5GAE C;  1EQQ A;  1PH2 A;  4HJ8 A;  1B8A A;  2D9U A;  1A3V A;  3VR5 A;  2ZT9 C;  5IGF A;  4BY7 H;  3F1Z A;  1V1P B;  5FO9 B;  4FF4 A;  4DAV A;  1E3P A;  3R8B A;  3N6R A;  3AMU A;  1FNV A;  3BDO A;  1NJI C;  1SE4 A;  3J7A 5;  4WJ3 M;  4A3J H;  4BY1 B;  3I4O A;  1VMC A;  1P8L A;  1CSP A;  1ICW A;  1NSN S;  5IYD H;  4R4I A;  5CBA E;  4DR1 Q;  2MPM A;  3K6O A;  3J80 i;  1JR0 D;  4RFB A;  1IYV A;  2M2L A;  2ICI A;  2OTL A;  1VQL A;  4OIJ A;  5FJ8 H;  2A68 D;  1Y8N B;  2JEB I;  2GN5 A;  2ID0 A;  2EZV A;  1IHZ A;  3RZO B;  2R7Z B;  3PGZ A;  1DXM A;  4OO1 I;  1VQA A;  3J81 c;  5M5Y B;  2UUA Q;  1I5F A;  1WCM H;  2DUD A;  3Q8D A;  2K5H A;  3EFX D;  4TQU S;  1CSQ A;  1M90 C;  4WJ4 A;  3CRK C;  3HOZ B;  4GKJ Q;  1V1P A;  1PZK D;  2Q2U A;  4OX9 L;  4A4I A;  3S14 H;  3KLW A;  3S17 B;  2F0K A;  2AQ2 B;  1LM0 A;  1XPU A;  4HMJ A;  3NSW A;  4UDU C;  3PO3 G;  4RGM A;  5FLX L;  2D5D A;  3MTS A;  5AFW A;  1KDC A;  1WYD A;  2ZJP A;  1SFO B;  1NCV A;  1VQK A;  4X62 Q;  4ZAI A;  3STB D;  4DK3 C;  3Q23 A;  1QIL A;  2N88 A;  5T1I A;  2MO1 A;  4BWG B;  2CW0 D;  4A3F G;  2Z6B A;  4XQQ A;  3KF8 B;  5IWA L;  2D62 A;  2ZTD A;  3OMC A;  1PZJ D;  1MSH A;  3W1B A;  4ZUJ A;  2A74 C;  3MEF A;  2RBM A;  4JI6 L;  1WTR A;  4O42 A;  3VR4 A;  3A74 A;  3IFT A;  1SDF A;  2I07 B;  1BCP B;  2TSS A;  1I94 L;  1QNU A;  3GTG B;  1SND A;  1Q82 C;  4GNX B;  3TBI B;  4PMB A;  1VQE A;  1X54 A;  4A3K B;  3OW7 A;  4QB4 A;  1CKN A;  1PFN A;  3STB C;  3K0Y A;  4B9X A;  1V1O A;  2KQ3 A;  4H7B A;  3VYT A;  4A75 A;  1LTG D;  3W3A A;  3IL8 A;  1EQT A;  3CCQ A;  3S16 B;  1G6P A;  5G3L D;  1EYD A;  2VB3 X;  4EQO A;  1GHK A;  4IFD J;  1PH8 A;  3EBE A;  1NR2 A;  1JJC B;  1VF7 A;  5IY0 A;  4IOA A;  1Q3L A;  3K5N A;  1C8C A;  4JI8 Q;  4QJF A;  4JPB W;  4A3D G;  2KHI A;  2PZT A;  3S16 H;  5IWA Q;  2F03 A;  2A6H D;  5KIX A;  3NQI A;  1X56 A;  4B3M L;  2EYM A;  3NEM A;  5M5X H;  4IJL A;  5IYD G;  4LNQ A;  1FGB D;  2VL6 A;  3HOW B;  2BE5 C;  2B39 A;  4FNF A;  4DKA C;  4DV0 Q;  4H02 A;  2F0I A;  3I55 A;  1ENF A;  2WB1 G;  5C4X H;  4UY8 C;  1PFM A;  1TWC H;  2B29 A;  4HCE A;  3BVZ A;  1JE5 A;  2L4N A;  3SXH A;  3GQB A;  2JJQ A;  3AFQ A;  4A3G B;  3ND9 A;  1X9N A;  1J9O A;  1D6E C;  3CC7 A;  1T5E A;  4GOP A;  3D6W A;  3OSO A;  1Y1W H;  2JXM B;  2CVR A;  1F9Q A;  1RHP A;  4QY7 A;  5M3F G;  4DV6 L;  1EUJ A;  4CBV A;  4PZ7 A;  4RHR A;  1R4Q B;  3MXG A;  1B44 D;  1FYC A;  4DU9 A;  3HOU H;  1FVI A;  4IJH A;  4NB3 A;  1SNC A;  4XT3 B;  1VMP A;  4YWK A;  2OF1 A;  1UE7 A;  1B9N A;  1QUQ B;  2H5X A;  5IT9 E;  2IWH A;  1BR9 A;  3S1Q B;  1ZKO A;  3I4L A;  3X3N A;  1JE4 A;  1XNQ L;  3DWP A;  2H4O A;  4IPG A;  3KLS X;  1E1T A;  4LFB L;  1EL0 A;  4P75 A;  2ZXO A;  2UUA L;  1ESF A;  5E3F A;  4MTK A;  3UE1 A;  4CJ2 C;  1BBU A;  3HEJ A;  2C35 B;  2EY6 A;  1VQM A;  2NVT B;  1I4G A;  4XXE A;  5C4Z A;  3BDC A;  1NAP A;  5DLQ E;  3I73 A;  1HUM A;  2GVB A;  5CGK A;  1CQV A;  4IN3 A;  2BCO A;  1LT6 D;  5M3M G;  4IFD G;  2NUC A;  4DV7 L;  1IKM A;  4RGO S;  3J80 c;  1MHW C;  2IT1 A;  2A6E D;  2PNR C;  5ELO A;  3SK4 A;  3RLF A;  3S1N B;  2XIW A;  2F0V A;  4DK0 A;  2JA6 G;  3AYH B;  1Q90 A;  3MXN B;  2XN9 C;  4BBR B;  2ATW A;  4LF9 L;  4DPG A;  4A3J B;  4DR6 Q;  5CV8 A;  2Q2I A;  1P16 A;  2AQ3 B;  3MFY A;  3PUZ A;  2VQF L;  3CF5 A;  3NP8 A;  3PUY A;  5I6Y A;  2UXD L;  1EEF D;  2GA4 B;  1A62 A;  4P2C B;  1XPO A;  2RQX A;  5JPM C;  1N34 Q;  3M3Y H;  2MNA A;  1SE3 A;  1SFO H;  3AEV A;  5JJL A;  1SRO A;  2VW9 A;  1XPR A;  2UUC Q;  1KDB A;  3TQY A;  1VS0 A;  3Q6S A;  1L0Y B;  3GO5 A;  4LF8 L;  1C7Y A;  4GN5 A;  4K2L A;  2IHE A;  1U9R A;  4DAM A;  2R61 A;  1SMY D;  2L9H A;  3S2D B;  1B1Z A;  1PHJ A;  4YWL A;  1YJ9 A;  2L1B A;  2B2U C;  2AUJ D;  4LK1 C;  5M5Y H;  1MGS A;  5G3L F;  1BUV T;  4TVA B;  4KD3 A;  3GTM H;  3NHH A;  4BBS B;  1GOZ A;  4KK7 A;  1LAC A;  2BH8 A;  4RA8 A;  4C3H G;  2O5I C;  2G9D A;  1Q81 C;  2F0S A;  3BYT B;  5C4J B;  2KEN A;  2F0E A;  5ELF A;  4LF9 Q;  4JV5 Q;  4PMW A;  4HTH A;  1LO5 D;  1JB3 A;  5HUR A;  3G71 A;  4DV2 Q;  1J5E L;  4QQB X;  2SNM A;  2NZO A;  2RHS B;  4DA2 A;  1HJP A;  2D0O A;  1WFQ A;  5FK9 C;  4L63 B;  1EIG A;  2A19 A;  3CU7 A;  3PUX A;  2KCM A;  1R9T B;  4DV0 L;  1XX8 A;  3FKI B;  1K3B C;  1WD1 A;  4LF5 L;  4DAP A;  3KK7 A;  2IPK D;  2WV6 D;  3M7G A;  5AJ3 Q;  4OO1 G;  2OTJ A;  4RCN A;  3CME A;  2F4V L;  1N32 L;  4EGV A;  4OXP A;  3TP7 A;  2BE5 D;  5IP9 G;  2JSO A;  2R7F A;  2ZXR A;  4K5X A;  4LWC A;  2EY2 A;  3KFU A;  4R1J A;  4GOP C;  4LUZ A;  3GTO H;  1VDZ A;  5EJW A;  2N8N A;  1VQD A;  4GN4 B;  4NXN Q;  4GLX A;  5CYU A;  1SJH D;  4EQP A;  3G48 A;  3PO2 H;  4IOC A;  2VQE L;  1QCB D;  2K04 A;  5ELC A;  5E4X A;  1AE2 A;  2B2U A;  4HJ7 A;  1V9P A;  2F0J A;  3KJP A;  1KNA A;  2HIX A;  4AYB B;  4B3R Q;  3OIQ A;  4WOR A;  1C9O A;  5CV9 A;  2E5L L;  4DR4 Q;  4B3T Q;  5KND A;  3UI2 A;  3QOJ A;  5C44 B;  1XMO L;  1HZC A;  2CHB D;  1ESR A;  2NVX B;  4WFN 3;  2EQS A;  1B53 A;  1PRT D;  3KF6 A;  1CA6 A;  3IFD A;  3A7L A;  1XXG A;  1JIC A;  4GKK L;  1UE6 A;  4HIK A;  1H95 A;  1X65 A;  2E2D C;  2D2C C;  4GNX C;  2F0L A;  4G7Z C;  2IX0 A;  4ZRZ A;  5ELN A;  4R9W A;  4FYD A;  1MD2 D;  2F4V Q;  5M9O A;  1TS2 A;  1VQF A; 
#chains in the Genus database with same CATH homology
 1I6H B;  1OXX K;  1I6V C;  5TSS A;  2HCI A;  2WKD A;  3BDL A;  1EY6 A;  1RKN A;  1ILQ A;  3MA2 B;  1B50 A;  3EQL C;  4IZ8 A;  5J39 A;  2HQE A;  3QWN A;  2XSC A;  3LWU A;  3W2D A;  3FVQ A;  2JE6 I;  3TP6 A;  3VR3 A;  1Q12 A;  1RTO A;  2EYF A;  5EGT A;  1CA5 A;  3K7A B;  5ELD A;  1I4P A;  2HDM A;  3DMU A;  4PQX A;  5NUC A;  5T1G A;  2BA0 A;  3WDN A;  1KDA A;  3A8K E;  1I4H A;  2HCC A;  2FIN B;  2A6H C;  1EU3 A;  4XYO A;  5E1F A;  2DNC A;  2NBF A;  1A3U A;  1A15 A;  1TS3 A;  3RMH A;  2M00 A;  2AUK A;  3CKI B;  3A56 A;  1SMY C;  1X3P A;  3ERQ A;  2PCF B;  1EY9 A;  1BF4 A;  1YNJ C;  4MHE A;  5IGG A;  1CFM A;  3ONA B;  1XTC D;  3SR1 A;  3BS1 A;  2XRQ D;  3MC0 B;  5FKA C;  5C0X I;  2EXZ A;  5IGB A;  4OGQ C;  3IKJ A;  1XWE A;  2PQE A;  4IUV A;  4XT1 B;  3D31 A;  2Z8L A;  4HAE A;  5I2Y A;  3PIP 3;  2IL8 A;  2EPB A;  1TU2 B;  2FFK B;  1TWC B;  3H3V C;  5JEA J;  5JAV A;  1TS5 A;  1JOQ A;  3NTH A;  2KA7 A;  5FLX E;  1ZEQ X;  5EPK A;  3NTI A;  3D6C A;  1PZI D;  1I4X A;  1OXU A;  4QUF A;  4GZY C;  2LMC B;  4KMU C;  1EY4 A;  5M5W B;  1LT3 D;  4LMQ D;  3H91 A;  2XRS D;  5C3X A;  3GV6 A;  5IIF A;  2A5H A;  4KI0 A;  5DM6 3;  3TZU A;  2B2Y A;  4C1N I;  2B8G A;  2M9V A;  1KLG D;  4BS9 A;  3SVM A;  1KLU D;  2R93 B;  3QJY A;  1ROD A;  4CKB A;  2E2I B;  4OL7 A;  1EQV A;  5FOB B;  4Q0F A;  1SNP A;  2PYK A;  2EDG A;  3DWA A;  5C6A A;  1V43 A;  3OOC A;  1GUO A;  4KD4 A;  1IKL A;  2LKV A;  4KHV A;  4K5W A;  1U4R A;  4KY5 A;  4DFA A;  2X6G A;  1X32 A;  3H0G B;  1L0X B;  3Q0A A;  4XIG S;  1E0B A;  4F7X A;  4RH6 A;  5C0X G;  1TS4 A;  4KJN A;  1Y8O B;  4A3E B;  1HPC A;  1QJO A;  3QB3 A;  1F9P A;  1Z6H A;  3MXP A;  1F9R A;  1I50 B;  3WOE A;  3X3M A;  1WTP A;  2K03 A;  1GUW A;  2HUG A;  2G9H D;  3O13 A;  1Y1V B;  3D8G A;  3A8J E;  2QCP X;  3S1M B;  5LL6 X;  5ISR A;  4LJZ C;  3BVM A;  2WKC A;  3LNN A;  3D3R A;  2BA1 A;  2XWJ B;  1C48 A;  1CZG A;  3WOF A;  3K5O A;  5CC4 A;  1A2T A;  3H09 A;  5M5X B;  2F0G A;  1EWC A;  1LTS D;  2PZU A;  3C46 A;  4XDX A;  1DOL A;  1BCP F;  4A3M B;  2B2T A;  2MGS A;  4XQJ A;  2KEC A;  1YNN C;  4KJO A;  3GTL B;  1RD9 D;  1WTQ A;  2PO4 A;  3ERO A;  1FR3 A;  3P20 A;  3TN2 A;  1AEX A;  4HN7 A;  2C5C A;  4MN3 A;  3Q22 A;  3L9A X;  3HOU B;  1G6Z A;  2IX3 A;  2RKS A;  4KKT A;  4DK1 A;  3SEB A;  1STG A;  3DXJ C;  4J8Q A;  1I3Q B;  3MWY W;  3OIP A;  3I8Z A;  1FNW A;  4FO2 A;  4EVO A;  2OEO A;  4QCL A;  3C2P A;  1KAB A;  2E2H B;  3GTQ B;  2IW3 A;  1CK1 A;  1TY2 A;  1BDO A;  1LT5 D;  1DYQ A;  1PTO H;  3NXW A;  2QDB A;  1EOT A;  4X3S A;  3G7L A;  3T13 A;  2MJ8 A;  1R4P B;  5KEE A;  1WD0 A;  4HCS A;  5M3F B;  1S5E D;  3S2H B;  1GUS A;  5DNF A;  4J6H A;  1EYC A;  3R93 A;  1SEB D;  3P1H A;  4XTC S;  1SAP A;  2K28 A;  1J8I A;  2K5Q A;  1IW7 C;  3K58 A;  5JVG 3;  3OWF A;  4C3J G;  2TMP A;  1SSO A;  1AW7 A;  3PUW A;  4K8J A;  1DCZ A;  5D14 A;  1QWY A;  2K7V A;  1E2V A;  1JQY D;  1GUN A;  2L0C A;  4X3K A;  3K57 A;  2K5W A;  3TZD A;  1GUG A;  1BNZ A;  2NVY B;  3H6M A;  1SBB B;  2AQ1 B;  1JCK B;  1S5C D;  2FMC A;  5C4X B;  3NTK A;  3S14 B;  3KUP A;  3A7A B;  2SOB A;  2DY8 A;  5BN4 A;  5ELB A;  2FJ2 A;  3A8I E;  1LV9 A;  1PMR A;  3GV3 A;  3EJI A;  3R3O A;  1JOR A;  1Y69 U;  3VR2 A;  3V2T A;  3HG9 A;  4IUU A;  2VXW A;  2DNE A;  2IX1 A;  4U67 3;  3G6J B;  1STB A;  4L6T B;  1I4Q A;  1K8M A;  3A55 A;  1EY5 A;  1STE A;  2RVL A;  2K6A A;  4QF4 A;  3KLS A;  3SK6 A;  3HZX A;  4ABN A;  1GHJ A;  3KLR A;  5LHY 1;  1TQO A;  4WRD A;  1PRT B;  2EYL A;  1EYA A;  1A2U A;  1EIH A;  1ENA A;  3M3Y B;  1QG7 A;  3P7J A;  1LTB D;  2NYZ D;  4TKO B;  1HA6 A;  2MUY A;  1G2T A;  4FF3 A;  3U9O A;  1PFB A;  3J80 L;  3NE5 B;  4KN4 C;  4ZKB B;  4G7H C;  3TDQ A;  4ZUI A;  1E2Z A;  2F0O A;  2K01 A;  3I72 A;  1JC7 A;  4KY6 A;  2IJ0 A;  1TR5 A;  2L5T A;  4HED A;  1D1I A;  5JEA G;  3BG3 A;  4ODG A;  1F2M A;  4UAI A;  3MXN A;  2K5D A;  3SHL A;  1G91 A;  3P75 A;  3R2T A;  4E6I A;  2F0F A;  2JP1 A;  2SNS A;  1IL8 A;  1II3 A;  1S4Z A;  2Z4I A;  1LTA D;  2SDF A;  3FRP B;  4B08 A;  2NN6 H;  1B3A A;  5IGC A;  1TWG B;  3S1R B;  2QKI C;  1RTN A;  1G8Z D;  2WAQ B;  4CKE A;  1AZQ A;  5CV5 A;  5HGT A;  1V8Q A;  3CHB D;  1MSG A;  4ZK9 B;  5ELE A;  1RJT A;  1H9M A;  4IUP A;  4HSP A;  5D3D A;  2NZ1 D;  2RA4 A;  1HTL D;  4A3I B;  1AP0 A;  1CI3 M;  1O80 A;  1JOK A;  4A3D B;  1M4V A;  5C4H A;  3D4R A;  1CQF A;  4N9P A;  3Q24 A;  1Z47 A;  1PTO D;  1LLR D;  2DY7 A;  1STH A;  4I7Z C;  2ZXP A;  4NP5 A;  5I2X A;  1ENC A;  1D2B A;  1GUT A;  4R8N A;  5IOC A;  4DXG A;  4Y7N B;  2NB0 A;  2F0Q A;  5IGE A;  3J7Y W;  3D4D A;  3KF8 A;  2O2L D;  4A3F B;  4J1M A;  4KKU A;  1ZYR C;  2EE1 A;  2ICE C;  5FO8 B;  3VYS A;  3I3C A;  3PUV A;  1KNE A;  5EPJ A;  3KBG A;  1YNJ D;  1F2Z A;  3DEO A;  3PIO 3;  2C9O A;  2E2J B;  3BZD B;  1TWF B;  1T5X D;  1U4L A;  2JA7 B;  1K83 B;  1O7L A;  2KHS A;  2KVM A;  3GTM B;  4N9T A;  1TKW B;  5C0X J;  1PDQ A;  3RD4 A;  4DXF A;  1LTT D;  3HKZ B;  1NUC A;  2FHT A;  2A6E C;  5IOD A;  5COR A;  1MBY A;  1UNS A;  5K36 G;  1SYD A;  4G4K A;  3HOX B;  2FMM A;  1OXT A;  2WIN B;  1I4R A;  2PPB C;  1DOM A;  3V96 A;  1WVL A;  3F2U A;  1A3T A;  1PLF A;  3NK9 A;  2NWG A;  2KED A;  2X69 A;  5BN3 A;  5C0X H;  4I65 A;  4IUT A;  3PV0 A;  4PV1 C;  1RCV D;  2EJF C;  2EYO A;  2VNU D;  4KN7 C;  1SYG A;  4JK1 C;  1JWU D;  3IAY A;  5C3E B;  1BXT A;  3GTP B;  5I9P A;  1DZ1 A;  1MI2 A;  3NBI A;  3T53 B;  4BA2 I;  2A68 C;  3C1E A;  1TVX A;  3I90 A;  2B2Y C;  1F77 A;  1SNM A;  3T16 A;  3QIA A;  4H13 C;  4S3S A;  3R2I A;  4H0L C;  3SK5 A;  3M4Y A;  1QOH A;  5JOB A;  4C1N K;  1CT1 D;  1KTK A;  1WCM B;  3OWE B;  5CBE E;  4RCO A;  2B2W A;  1AN8 A;  5C3W A;  4OIK A;  2EYP A;  3U9S A;  2O5J C;  1HQM C;  1BBX C;  3HOV B;  2Q8T A;  2WII B;  4FXG C;  4FXD A;  5M3M B;  5IGD A;  1HA5 A;  1QE6 A;  4K2K A;  1ET6 A;  1E2W A;  1STN A;  1H9S B;  2HDL A;  3L3O C;  2BOS A;  2EY5 A;  5EBD A;  2R92 B;  2F0D A;  2R3Z A;  1D5M C;  1DM0 B;  5EBC A;  3TP8 A;  2I46 A;  4HR7 B;  1LAB A;  1DON A;  4V0B A;  2AWN A;  1NR4 A;  2VB2 X;  3JAM L;  4YIJ A;  1TII D;  2F0P A;  3GD7 A;  5J22 A;  1JWS D;  2X6L A;  4Q5V A;  3L7Z C;  4G57 A;  3BYY B;  4G7O C;  1PTO F;  3PMF A;  4DGZ A;  1M8A A;  4ME5 A;  1ML0 D;  4FP5 D;  1TWH B;  1K8O A;  4ZYS A;  1RF2 D;  3AU7 A;  5E4W C;  2NN6 G;  4JBW A;  4IAL A;  2Q8R E;  5D65 A;  2B2T C;  4C3I B;  2BDO A;  1WTO A;  3E6Z X;  5A2Q L;  4QMG A;  3FEW X;  2F0W A;  2MHV A;  2Y0S B;  5I9O A;  1YNN D;  3C3L A;  1ET9 A;  1RDP D;  3K5L A;  2PW5 A;  4C3I G;  2K05 A;  3TSS A;  1H9J A;  1HRJ A;  4M1U B;  3KBX A;  1STY A;  3DEP A;  3M4O B;  1WTX A;  1W6J A;  2Z4H A;  1D1K A;  3DM1 A;  2YU9 B;  3NWT A;  2WB1 B;  1EY0 A;  4NDX A;  1SYB A;  2JA5 B;  1OXS C;  2L11 A;  1PRT C;  2CQA A;  3N52 A;  4PNY A;  5KNC A;  1HFG A;  1AFP A;  4MIU A;  4TSS A;  2EYJ A;  3OMG A;  1O7Z A;  2XNA C;  2F0N A;  3S15 B;  1SNO A;  5JVH 3;  3FPU B;  2XWB B;  1GJX A;  2E75 C;  1D5Z C;  4DNR B;  2AWO A;  4ILW A;  1JOO A;  2Q8I B;  4M8A A;  5F2D A;  2RDG A;  1G2S A;  4CJ1 B;  4XQN A;  3QG1 A;  3K5M A;  1SYE A;  5DEH A;  1KAA A;  3GTJ B;  1CHQ D;  1F2L A;  1PYW D;  1Y1W B;  4C56 C;  3QOL A;  1F2Y A;  3URY A;  3D4W A;  4DAY A;  4NMZ A;  2V4D A;  5IT9 L;  4L8J A;  3HGB A;  2B63 B;  4NW2 A;  1SXT A;  3FPP A;  2J4X A;  3I91 A;  3QO2 A;  1PTO B;  3H94 A;  4X3U A;  3TP5 A;  4IQZ A;  2KOL A;  1STA A;  2RSO A;  3T56 B;  2A69 C;  1HFN A;  3PO3 B;  1UEA B;  3I4N B;  1Q8I A;  3ND8 A;  1HUN A;  3E5S A;  3GTK B;  3K59 A;  2OXP A;  4NKL A;  5JJZ A;  4B9W A;  3MHB A;  3MEH A;  2LY7 A;  5I6W A;  4FF2 A;  4RKB A;  1CHP D;  4EQN A;  4LAA A;  2EJM A;  2B2V A;  2LFN A;  1S5F D;  4O1N A;  4DF7 A;  4IFD I;  4OO1 H;  1HCZ A;  1PRT F;  2YYZ A;  1G29 1;  4CHT B;  5D3I B;  4KHZ A;  1O7Y A;  3I70 A;  5KNB A;  1OO9 B;  4RWS C;  2CW0 C;  2EJG C;  3BVG A;  3PO2 B;  3M7N A;  4ZLT F;  3VR6 A;  5EKK A;  2KUM A;  2R6G A;  4OHJ A;  1DJR D;  1BCP D;  2A73 B;  2F4I A;  1BOS A;  2J7Z A;  5EQ0 A;  1U4P A;  2JA8 B;  5EKL A;  1EWH A;  5DAU A;  5CV4 A;  1TWA B;  1TY0 A;  3OPO A;  4K14 A;  1BQQ T;  3GTO B;  2ENB A;  1S5D D;  3HS0 C;  2KJX A;  4K6D A;  3ITP A;  3FMC A;  3S9W A;  4KKS A;  3NQT A;  4HSV A;  1B9M A;  4R8I A;  1W6K A;  4ZKC B;  1UUP A;  5EKI A;  1H9K A;  3RUZ A;  2NVQ B;  4K5V A;  4IUR A;  2O4X A;  1C4Q A;  3SE0 A;  1EZ8 A;  2OT2 A;  1SYF A;  2MP1 A;  3MXU A;  1HTP A;  2E74 C;  2QEJ C;  4ULL A;  3GP7 A;  3DWQ A;  1CM9 A;  3CRL C;  2JYO A;  2B2W C;  1ZYR D;  5FO7 B;  2EVB A;  2NTS A;  3AB9 A;  5C5M A;  3CQZ B;  1VCI A;  3VA7 A;  2VUM B;  2N55 A;  2WP8 J;  1SYC A;  2RSN A;  1DD2 A;  5COY A;  4RAU C;  1EEI D;  1CZW A;  2EOT A;  2EY1 A;  4PMC A;  3DUZ A;  2JA6 B;  2F0M A;  2K1B A;  1IYU A;  3VA5 A;  2F3W A;  1EFI D;  3LWE A;  4QUC A;  4C3J B;  1XYI A;  3T4A C;  2EYH A;  3HP3 A;  2RDF A;  5KGU A;  3M85 A;  3J81 E;  1JWM D;  4IUQ A;  1EZ6 A;  1LTI D;  3OHX C;  4WJW A;  2B2V C;  5CV7 A;  1A6X A;  2B8F A;  3C1F A;  3J80 E;  4DNT B;  3A54 A;  5K5P A;  1SNQ A;  1SE2 A;  2F0H A;  4H44 C;  3VYU A;  3NWS A;  4BA1 I;  4A3B B;  2QF7 A;  1ILP A;  5K36 H;  4U68 A;  2J0T D;  4CJ0 B;  1VF5 C;  3VYR A;  1D5X C;  1H9S A;  4RKL A;  4TRD A;  3J81 L;  4CKC A;  3HOY B;  1WTV A;  1OXV A;  5JEA H;  1B2T A;  3T51 B;  1TT2 A;  3MVV A;  5KYL A;  1BCP C;  4F87 A;  4K8I A;  3MFG A;  4V19 0;  4DN4 M;  4FVM A;  1EY8 A;  5J1Z A;  1Y8P B;  1BO0 A;  1CTM A;  1AZP A;  1PTO C;  1QB5 D;  5JPN C;  2KEE A;  2XVS A;  1U4M A;  2F3V A;  4CGY B;  1QNK A;  2E76 C;  3RZD B;  5KRU A;  1ONL A;  3HRZ C;  3NBH A;  3E0J A;  1H9R A;  3ZYY X;  4IFD H;  1LTR D;  3SDZ A;  4KY7 A;  4X3T A;  2JEA I;  3EVQ A;  2QIL A;  2F1M A;  5A35 A;  4K6L A;  2SEB D;  4C3H B;  1WTW A;  1Q1B A;  2RDH A;  1B4O A;  2L55 A;  3FDT A;  4FF1 A;  1SJE D;  4HMI A;  4ZQ3 A;  3LX0 A;  2LS0 1;  1HQR D;  2KCC A;  2K32 A;  4KTA A;  1Z7T A;  4KV6 A;  2WAC A;  3J7A F;  1S5B D;  3JAM E;  4F8M A;  5EPL A;  5LL6 S;  3SK8 A;  4QIW B;  5CMD A;  1HHV A;  3EA6 A;  4ID6 A;  5BN5 A;  2Z1C A;  5A2Q E;  2L12 A;  2A69 D;  3TME A;  1DOK A;  1O78 A;  3I4M B;  2H1E A;  1EY7 A;  1ZXT A;  2K33 A;  3MAQ A;  3J7A V;  1IW7 D;  1F9S A;  1UAP A;  2F0T A;  2PZW A;  4FXK C;  3NUC A;  3MZ5 A;  5CR3 A;  5DM7 3;  5CV6 A;  5I4D A;  4RGN A;  2NN6 I;  2DN8 A;  2PMZ B;  2PW7 A;  5KYI A;  1X3Q A;  4C2M B;  2KCN A;  1Q1E A;  1EU4 A;  5C5L A;  3NPP A;  4XYQ A;  4F88 A;  4RGT A;  4RHS A;  3DHQ A;  1GXD C;  2BDN A;  4BY7 B;  1PXU A;  4A93 B;  2NTT A;  1FD7 D;  4IUN A;  1FNU A;  3V05 A;  1HXY D;  1LT4 D;  4Z9C B;  2F0U A;  2D9U A;  1A3V A;  3VR5 A;  2ZT9 C;  5IGF A;  1V1P B;  5FO9 B;  4FF4 A;  4DAV A;  3R8B A;  3N6R A;  3AMU A;  1FNV A;  3BDO A;  1SE4 A;  4BY1 B;  1VMC A;  1ICW A;  1NSN S;  5CBA E;  2MPM A;  3K6O A;  1JR0 D;  4RFB A;  1IYV A;  2M2L A;  2ICI A;  4OIJ A;  2A68 D;  1Y8N B;  2JEB I;  2ID0 A;  2EZV A;  1IHZ A;  3RZO B;  2R7Z B;  1DXM A;  4OO1 I;  5M5Y B;  3EFX D;  4TQU S;  3CRK C;  3HOZ B;  1V1P A;  1PZK D;  3S17 B;  2F0K A;  2AQ2 B;  4HMJ A;  3NSW A;  4UDU C;  4RGM A;  5FLX L;  2D5D A;  3MTS A;  5AFW A;  1KDC A;  1SFO B;  1NCV A;  4ZAI A;  3Q23 A;  1QIL A;  2N88 A;  5T1I A;  4BWG B;  2CW0 D;  4XQQ A;  2D62 A;  3OMC A;  1PZJ D;  1MSH A;  4ZUJ A;  2A74 C;  2RBM A;  1WTR A;  4O42 A;  3VR4 A;  3IFT A;  1SDF A;  2I07 B;  1BCP B;  2TSS A;  1QNU A;  3GTG B;  1SND A;  3TBI B;  4PMB A;  4A3K B;  3OW7 A;  4QB4 A;  1PFN A;  3K0Y A;  4B9X A;  1V1O A;  2KQ3 A;  4H7B A;  3VYT A;  1LTG D;  3W3A A;  3IL8 A;  1EQT A;  3S16 B;  5G3L D;  1EYD A;  2VB3 X;  4EQO A;  1GHK A;  4IFD J;  1NR2 A;  1VF7 A;  1Q3L A;  3K5N A;  1C8C A;  2PZT A;  2F03 A;  2A6H D;  5KIX A;  3NQI A;  2EYM A;  1FGB D;  3HOW B;  2BE5 C;  2B39 A;  4FNF A;  2F0I A;  1ENF A;  1PFM A;  4HCE A;  3BVZ A;  2L4N A;  3SXH A;  3GQB A;  4A3G B;  3ND9 A;  1J9O A;  1D6E C;  1T5E A;  3D6W A;  3OSO A;  2JXM B;  2CVR A;  1F9Q A;  1RHP A;  4CBV A;  4RHR A;  1R4Q B;  3MXG A;  1B44 D;  1FYC A;  4DU9 A;  1SNC A;  4XT3 B;  1VMP A;  2OF1 A;  1B9N A;  5IT9 E;  2IWH A;  1BR9 A;  3S1Q B;  1ZKO A;  3I4L A;  3X3N A;  1JE4 A;  3DWP A;  2H4O A;  3KLS X;  1EL0 A;  2ZXO A;  1ESF A;  5E3F A;  4CJ2 C;  3HEJ A;  2EY6 A;  2NVT B;  1I4G A;  4XXE A;  5C4Z A;  3BDC A;  1NAP A;  3I73 A;  1HUM A;  5CGK A;  1CQV A;  4IN3 A;  2BCO A;  1LT6 D;  4IFD G;  2NUC A;  1IKM A;  4RGO S;  2IT1 A;  2PNR C;  2A6E D;  3S1N B;  3SK4 A;  3RLF A;  2XIW A;  2F0V A;  4DK0 A;  1Q90 A;  2XN9 C;  4BBR B;  4A3J B;  5CV8 A;  3MFY A;  2AQ3 B;  3PUZ A;  3NP8 A;  3PUY A;  5I6Y A;  1EEF D;  2GA4 B;  4P2C B;  2RQX A;  5JPM C;  1SE3 A;  1KDB A;  3Q6S A;  1L0Y B;  3GO5 A;  4K2L A;  1U9R A;  2R61 A;  1SMY D;  2L9H A;  3S2D B;  1B1Z A;  2L1B A;  2B2U C;  2AUJ D;  4LK1 C;  1MGS A;  5G3L F;  1BUV T;  4KD3 A;  3NHH A;  4BBS B;  1GOZ A;  4KK7 A;  1LAC A;  4RA8 A;  4C3H G;  2O5I C;  2G9D A;  2F0S A;  3BYT B;  5C4J B;  2F0E A;  5ELF A;  4PMW A;  4HTH A;  1LO5 D;  1JB3 A;  5HUR A;  2SNM A;  4DA2 A;  5FK9 C;  4L63 B;  1EIG A;  3CU7 A;  3PUX A;  1R9T B;  1XX8 A;  3FKI B;  1WD1 A;  4DAP A;  3KK7 A;  2IPK D;  2WV6 D;  3M7G A;  4OO1 G;  4RCN A;  4EGV A;  3TP7 A;  2BE5 D;  2JSO A;  2ZXR A;  4K5X A;  2EY2 A;  1VDZ A;  5EJW A;  5CYU A;  1SJH D;  4EQP A;  1QCB D;  2K04 A;  5ELC A;  5E4X A;  2B2U A;  2F0J A;  1KNA A;  4AYB B;  3OIQ A;  4WOR A;  5CV9 A;  5KND A;  3UI2 A;  3QOJ A;  5C44 B;  2CHB D;  1ESR A;  2NVX B;  4WFN 3;  1B53 A;  1PRT D;  1CA6 A;  3IFD A;  3A7L A;  1XXG A;  1JIC A;  2E2D C;  2D2C C;  2F0L A;  4G7Z C;  4ZRZ A;  2IX0 A;  4R9W A;  4FYD A;  1MD2 D;  5M9O A;  1TS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...