1EY4A

Structure of s. nuclease stabilizing mutant s59a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey4A00
4K6DA 4YIJA 4NP5A 1EY6A 4I65A 5EGTA 2KQ3A 4KJNA 3TMEA 4PMBA 2F0QA 2SOBA 4ID6A 5E3FA 3SK6A 5E1FA 3D4WA 3MXPA 1JOOA 4LAAA 2OXPA 1NSNS 4EQNA 3SR1A 1ENAA 3E5SA 2EY2A 3SHLA 1KABA 2PQEA 5C6AA 5KRUA 1JOQA 3EVQA 4KY6A 2EYJA 2OEOA 1ENCA 3ERQA 4MIUA 2LKVA 1F2MA 2SNMA 3MZ5A 4HMJA 4K8IA 5CV6A 3TP7A 5HURA 5IGEA 3SK4A 5K5PA 1JORA 3NK9A 5DEHA 2PW5A 1JOKA 2PZTA 4B9XA 4DF7A 1SYDA 4QMGA 5J22A 5DAUA 4ZQ3A 1STBA 4PMCA 3OWFA 2F0UA 2F3VA 4NKLA 2F0KA 2EYMA 2EY6A 2RBMA 4J1MA 5IGBA 3NUCA 4IUNA 3OSOA 1EY4A 5CR3A 4EQOA 5JAVA 1F2ZA 4F7XA 5IIFA 4EVOA 5KYIA 3QB3A 1EY5A 1STAA 2EYOA 4HMIA 5C4HA 1A3VA 1II3A 5IOCA 1AEXA 5J39A 2WACA 1SNPA 1SNMA 1TQOA 3R3OA 4K2LA 1KDCA 5CGKA 4WRDA 1EYAA 5I6YA 2F0DA 5C3WA 5IGGA 2F0VA 1STYA 2EY1A 4DFAA 5C4ZA 2F0OA 4ZUJA 4KJOA 3ITPA 2ENBA 2F0TA 2PZUA 3D6CA 5KYLA 4IZ8A 1SNQA 4G57A 2RDFA 2HQEA 3EROA 4RKBA 5C5MA 3DMUA 5I9PA 4KD3A 2F0PA 2M00A 2PYKA 1KDAA 1A2TA 5M9OA 3S9WA 2F0JA 3VA5A 2F0GA 1IHZA 3D4DA 5EKKA 5J1ZA 2F0WA 3NQTA 5CV8A 3NHHA 4IALA 5I9OA 3C1FA 5EKLA 3MVVA 5F2DA 3U9OA 4H7BA 1STNA 1EY7A 4R8NA 3P1HA 1EYDA 4EQPA 4ODGA 1KDBA 5I6WA 5IGCA 5C3XA 5IODA 2F3WA 5NUCA 3D8GA 5C5LA 3RUZA 4K5XA 1SNCA 1NUCA 1A3UA 2F0SA 4QF4A 4WORA 4N9TA 3SXHA 2OF1A 2SNSA 3T13A 1EY0A 2F0MA 3QOJA 5ISRA 1TR5A 1F2YA 3NXWA 3TP5A 4QB4A 1A3TA 3H6MA 2PZWA 3TP8A 5IGDA 2EYLA 3QOLA 4E6IA 1EZ6A 5IGFA 2EXZA 4N9PA 3BDLA 4B9WA 3P75A 3SK8A 2EYFA 4F8MA 5HGTA 2F0NA 2F0HA 4K5VA 3T16A 4KHVA 2F0IA 3HZXA 3SK5A 4DU9A 2F0FA 4KY5A 3PMFA 1KAAA 3EJIA 3BDCA 4S3SA 1EZ8A 2F0LA 3OMGA 2NUCA 5KIXA 1EY8A 2RKSA 2QDBA 1SNOA 1SYFA 2KHSA 3DHQA 4OL7A 1SYCA 5CC4A 3HEJA 1EQVA 1STHA 3MHBA 5CV7A 4ZUIA 1SNDA 1SYGA 4HTHA 4PNYA 4TRDA 3V2TA 1TT2A 2EYHA 2O4XA 1EYCA 4KV6A 4ME5A 1U9RA 1RKNA 3LX0A 4NMZA 4K2KA 2PW7A 3OMCA 2EY5A 4DGZA 4KY7A 5KGUA 4KD4A 4J6HA 4K5WA 4NDXA 1STGA 3C1EA 4K8JA 3NP8A 1EY9A 2EYPA 4K14A 2F0EA 5CV5A 3MEHA 5CV9A 5JOBA 5KEEA 3TP6A 4RKLA 1A2UA 1SYBA 5CV4A 4KTAA 1SYEA
chains in the Genus database with same CATH superfamily
1PYWD 4I65A 4YHHL 3BVZA 3MXGA 1PH8A 1VQNA 4NPSA 2KEEA 3F2BA 3S17B 4CKCA 2WAQG 2B2VA 2Q2IA 4FF4A 1F9PA 4IURA 2NB0A 2PPBC 2K7VA 4DXFA 2JXMB 1YNXA 5A2QL 5IWAL 4C56C 1PA6A 2B3GA 3S1QB 3J7AV 2F3VA 4HSVA 3C3LA 1XTCD 4IUTA 2RBMA 4IUNA 1YJWA 2Z4IA 1CSQA 1NNXA 4GS3A 2FINB 2K4KA 1EU3A 4JYAQ 5K36H 1EYAA 4B3SL 2MO0A 5C4ZA 3U58A 1HXYD 2B2UA 3CRKC 3GD7A 4DAYA 4IZ8A 2LFNA 4FXGC 4RKBA 2K5DA 4KD3A 2F0PA 4NXNQ 3NTIA 3K7AB 1BO0A 3OWEB 2NWGA 4JV5Q 2EPBA 1Q86C 4DUZQ 4LFCL 1D8LA 4J8QA 3P7JA 4N8FA 1KAWA 3U9OA 4DV6L 1E1OA 1K3BC 1Y1WG 4DK1A 2NVYH 2AUKA 3GQBA 5IE8A 4RH6A 4QUCA 2WAQE 1CQFA 1WCMB 1WD0A 1KD1C 1VQ8A 1RD9D 1G51A 2SNSA 2K5QA 1OTCA 2OT2A 3GTKH 1HZCA 3FPPA 1XJVA 4LF8L 2YU9B 1MHWC 1X3GA 3SK8A 2EE1A 1N32Q 4FP5D 4DU9A 1J5EL 3A56A 2F0FA 4HSPA 3EN2A 2ID0A 3CPWA 2IHEA 1S72A 3TRZA 5FJ8G 2NUCA 1F9QA 4LUVA 4A3IH 2NVQH 1I6HH 3G7LA 4YHHQ 3K0XA 3VYRA 1HNWL 2PQAA 3PUYA 1LV9A 1MGSA 1XTDA 2QGQA 1EYCA 5M3MH 2JQOA 5FK9C 4KKUA 3GTJH 1A6XA 1PTOF 4JC0A 4KY7A 2B2YC 4K8JA 5GAEC 5GADC 3DM1A 5IWAQ 5KEEA 5BN4A 2N78A 3EBEA 3WOEA 4C3HB 2AKWB 5C3EG 2KCTA 2GVBA 5E1FA 3JAME 3D4WA 4ZK9B 4QGUA 3E5SA 2EY2A 4OWXB 3EVQA 3KK7A 3K59A 1SJED 1M8AA 4FNFA 4A3BB 4HR7B 5IGEA 1G2SA 4B3TL 4DV0L 4H13C 1X9NA 2AQ1B 4DF7A 4F87A 3HOWB 1GHJA 1GO3E 2K32A 4LFCQ 3HKZG 4XQNA 4K0KL 2D0PA 1AZPA 4YCWA 2B2TC 4DV6Q 4EQOA 4ALPA 3PO3B 1WTVA 1EY5A 3TSSA 3A74A 1STAA 4B3RL 4JI2L 1TWCH 1EU4A 5IY0A 2RSNA 4A3MB 4X3KA 2RA4A 1VQJA 1A62A 4K2LA 4A3EB 1S40A 1I4GA 4OO1G 4CJ1B 1O7LA 4A3LG 5C5MA 1JMCA 3GTPB 3STBC 4LF8Q 3T53B 1C48A 3VA5A 1JC7A 1MI2A 1VDZA 3K81C 3I91A 1J5EQ 1L1OA 1O7ZA 1Y1VG 2GN5A 2RVLA 5CBEE 3PIO3 5FLMG 3H0GB 1X56A 3H09A 5C3XA 3KYHC 1HNWQ 2X6LA 2K5VA 3CCEA 1BOSA 2K04A 2ZTDA 4FVMA 4JI3L 1I3QH 5BN3A 3M3YH 1GHKA 2EXZA 1I50H 4ABNA 3MEFA 4P75A 3GTOH 3BU2A 3E3XA 1O80A 3HZXA 3PMFA 4BA2I 2ZJQA 1G6PA 3NWSA 4HCEA 1NR2A 1ML0D 3PIPA 3A54A 4HTHA 2O4XA 4A93H 1RKNA 1IL8A 4JI1L 1K8MA 1GOZA 2EY5A 1JQYD 4IN3A 2FXQA 4HN7A 1SE8A 2I07B 3MTSA 1K8GA 2VS1A 4DV0Q 1LTTD 2LY7A 1IW7C 1PZJD 4LW1A 1STEA 2EDGA 1SYBA 4DV1Q 4K0KQ 2L55A 2F52A 4BXXH 3BZDB 2JA8G 1IL2A 3HOZG 3CKIB 4DV7L 4JI2Q 4B3RQ 3I90A 1B1ZA 1N36Q 1SSOA 5IYDG 3MAQA 4JOIC 3GTQH 2PQEA 2E74C 1RCVD 1HZ9A 3ERQA 2PI2A 4C3IB 1QVCA 4HAEA 4UPAA 2J0TD 2JA7B 3I8ZA 1N9WA 4PMCA 3SDZA 4ZYSA 2ZJRA 1Y8OB 1HCZA 1PH2A 1HFNA 3KLSA 1UEAB 2N55A 1NTGA 4A3KH 1FGUA 2DJGC 2C5CA 1II3A 1S4ZA 1HR0W 4XTCS 4DUYL 4X3SA 4RFBA 3ITPA 4JI8Q 3NBHA 1KRTA 3HOYG 4IFDJ 3R2TA 2IWHA 2M00A 3S1NH 2F0GA 5C0XJ 3CC4A 3HOXG 4OHJA 2CCZA 1JWMD 2R93B 3I4MH 4IALA 1Y8PB 4CBVA 4DNIA 1Q8IA 1C7YA 3HOVG 4BBRH 1KDBA 4DPGA 5IGCA 1LTAD 4GN5A 2L15A 3PUXA 1A8VA 4QF4A 4DNRB 2XIWA 3JAML 1WTOA 2J4XA 4Z9CB 4OWTB 2F0MA 4JI1Q 2IX3A 1TR5A 3KDFB 3W1GA 3AEVA 5IGDA 3H6MA 3UI2A 4ULLA 2BDOA 4DR4L 1CKMA 3O13A 1O78A 4CGYB 2Z6KA 2F0IA 4YCVA 5DLQE 2UU9L 4ZCKA 2AQ3B 4LK1C 1FL0A 1OXSC 1VF5C 4PQXA 5ELBA 2F4VQ 1GM5A 4XYOA 4DV7Q 1R9TH 1HRJA 1D6EC 3GDEA 4BWGB 2PW7A 3HOUH 1ILPA 3D3RA 1H9SA 4G4KA 4BY1G 3QIAA 3D0FA 2AQ2B 3OIPA 1QJOA 4UDUC 4IPCA 3S14B 5D65A 2XWBB 4YCUA 1CT1D 1LYLA 2NZ1D 3GTLH 4AYBG 2YTXA 1F9SA 1V1PA 2CH4A 4ZLTF 5LMNW 1TWGH 2QEJC 2Z9HA 4OIJA 3GO5A 3KDFA 4L8JA 3K8AA 2XNAC 3SK4A 4OXPA 4B9XA 1JOKA 2EIFA 3I4NG 5LL6X 2F0UA 1PHJA 2EYMA 1KLUD 4PZ7A 5IGBA 1WOCA 5CR3A 4IQZA 2BH8A 4IFDG 2WB1G 3W2DA 4Y7NH 2EYOA 1VMCA 2XRSD 1LT4D 2FHTA 5LL6S 4JI5L 4O2DA 5IT9c 1YJNA 1AE3A 1EFID 1X6OA 4WRDA 2MP1A 2A68D 5IGGA 4DV2L 1VQBA 1YVCA 2WAQB 4GKJL 2R7DA 2Q8TA 2N8NA 4CDDC 2RDFA 3EROA 2OTJA 2ALYB 5I9PA 4DR4Q 3M4OH 1QG7A 2NN6I 1L0XB 3NHHA 4PMWA 1JWUD 4BA1I 1Q12A 2HQLA 2UU9Q 4B08A 4HJ8A 1HTLD 2D62A 4LUZA 2IY5B 2B2UC 1EYDA 1JWSD 2Y0SG 4A3CH 4AYBE 2KJXA 1TWFB 3UDGA 1VQLA 3R2IA 4X66L 4DAMA 1VQKA 1KNAA 1X32A 4A3GH 2QF7A 1BCPB 4B9WA 3WDNA 5JJZA 4Q5VA 1E7ZA 3CMEA 1VQCA 4K5VA 3K5MA 4QUFA 3EJIA 2VUMG 1ICWA 1EIGA 1FD7D 2WB1E 1JCKB 3EA6A 4MN3A 4GLXA 1B53A 1Y1WB 2Q2TA 1MSGA 3U9SA 1Y69U 4NMZA 4DK3C 2K03A 4A3DG 4R9WA 1JJCB 5ELDA 2X6GA 1PYBA 1W6KA 2JA6H 2AUJD 4B3MQ 4YWMA 1DM0B 1SRUA 3S17H 1E22A 1A2UA 4XDXA 3SHLA 4QY7A 4XT1B 1C9OA 2Y0SE 1HZBA 2AHOB 4JI5Q 4JI6L 2H1EA 4FF2A 5KRUA 2UXDQ 5C6AA 1KABA 4DV2Q 1IW7D 2UUCL 2E76C 4RCNA 2OEOA 4GKJQ 3ULPA 1A0IA 2KUMA 1E24A 3M4QA 3DM3A 3T56B 5C0XI 4IOAA 1U4PA 1HUNA 2D2CC 1X54A 1NY4A 1ENFA 4YWLA 2R6GA 3HFZB 5IYCH 1BDOA 3OSOA 2K5NA 3CF5A 4KI0A 3QB3A 1RDPD 4BS9A 4G7HC 2E2HB 4IJLA 2QEXA 5CGKA 3R3OA 4A3IG 1KDCA 4X66Q 5C3EB 2QA4A 3Q24A 3J80i 1TS2A 4DN4M 3J81E 4LF9L 1L0WA 5EKIA 1A2TA 2F0JA 2QW7A 1ASZA 2KENA 4R8IA 1PZID 1WCMH 1IKMA 3MXNA 3RZOB 2ZTEA 5I9OA 4F88A 4BY7H 2NN6H 4LUOA 4EQPA 1JB3A 1FYCA 1LM0A 2YU9H 1BF4A 4LF4Q 3TBIB 2FMCA 3CP0A 2IPKD 1K83B 4JW0A 3KUPA 3K7UC 1L1OC 3CD6A 2PZWA 5EQ0A 4FYDA 4FDBA 3E9IA 1Z7TA 3P20A 1C4QA 1M4VA 3VR2A 1KL9A 1Q3LA 5IYBH 1KC8C 1EEID 3CRLC 3FRPB 3M85A 1IBKL 4P73A 2UXCL 1N34L 4JI6Q 1SJHD 1JE4A 1ICFB 1S3OA 3K5OA 4FF1A 3MWYW 4XT3B 4K2KA 1PTOC 2UUCQ 1F2LA 1J9OA 4KD4A 4RCOA 4ZKCB 3T1YL 4C3HH 2N3SA 3KLWA 4OWWB 2K75A 3TP6A 4NB3A 1SE4A 1Y8NB 2Z6BA 4HJ5A 2VQEL 3IFTA 1CZGA 2ZXPA 4CDEC 4A3BH 1QZGA 4LAAA 2BE5C 5LMUQ 3IFDA 3HOWH 4KY6A 1VQHA 3S2HB 4A3JH 1KRSA 3MZ5A 4LF9Q 4LF5L 3PO3H 4K6LA 3F2CA 2BA0A 2K50A 3PIOA 4QMGA 1JT8A 3N6RA 1HUMA 4A3MH 3I3CA 1QOHA 1B44D 2JK8A 3FKIH 5C0XH 4J1MA 3A0JA 2NBFA 1TWHB 3RR5A 4DXGA 1XMQL 2R92G 2E2JB 3CQZB 3CC7A 3UDIA 3U4ZA 2MGSA 3GTPH 2JA8B 3HOZB 1AEXA 4DK6C 3CPFA 1K28A 3SEBA 3GV3A 1D1IA 4RHRA 4G57A 2B63G 4A93G 1EOVA 2FJ2A 1CM9A 3H0GH 3LGJA 1O7IA 1XNRL 3FHWA 1VQEA 5EKLA 3MVVA 3ND9A 1NJIC 1IBKQ 1E1TA 4WJ4A 1BXTA 4A3FH 4DA2A 3PSIA 4UP8A 1B3QA 2UXCQ 2DGYA 2PO4A 3CXCA 1N34Q 3S24A 3S1MB 1NUCA 2OTLA 3NBIA 1CK1A 2A5HA 2CHBD 4C2MH 4GN4B 1GUSA 4JI4L 3PGZA 3J7ZC 1E0BA 3CC2A 1YNNC 2NTSA 4LFAL 5IGFA 3T1YQ 5C4JB 2E2IB 4R4OA 2R3ZA 4MTKA 3HOYB 2LXKA 1S5BD 2KHJA 4YWKA 1UE5A 1SFOB 3HOXB 1BBXC 5IP9H 3L2PA 5AFWA 1GKHA 1X55A 3QO2A 4P2CB 1R4QB 2VQEQ 1GD7A 1YI2A 2J7ZA 3HOVB 1LTSD 2Z4HA 1K0SA 4HJ9A 3DWAA 1ESRA 4ME5A 3T51B 5FLXL 1HR0L 2Z6KC 3RZDB 3M4PA 5FO9B 1CA5A 1MJEA 2VB2X 1PH5A 4K5WA 4PZ8A 1PV4A 2MFIA 2JA5H 2RHSB 4C3JH 2IX0A 4LF5Q 3J7AF 3ER0A 1GUNA 2EYPA 2OQ0A 2KCCA 3SR1A 3EFXD 3AFQA 4NP5A 4L5QA 2KOLA 1XMQQ 3I4MG 4HJ7A 2IW3A 2SOBA 5E3FA 2DN8A 3JAMi 3EIVA 4JBKA 2EJGC 4JG2A 3VR5A 4JCVE 4EQNA 1FJGL 1N33L 4L5TA 2BDNA 4OEMB 3CCMA 1QUQB 3TZDA 4LMQD 4R4QA 4H02A 3LWEA 3X3MA 2SNMA 4CDCC 5DEHA 5C44G 1LUZA 3J80L 1TIID 4IJHA 2A69D 1XNRQ 5M3FG 1LTID 2JE6I 3LWUA 1D5ZC 4BY1B 2LMCB 1MIUA 1V1QA 1PH1A 1QNKA 2K52A 4HMIA 4QJFA 3ND8A 1VQ9A 4GNXC 2HCCA 3W5OA 5ELNA 2F0VA 4PV1C 1PH3A 2A6HD 2IX1A 3J7A5 4AYBB 4B3SQ 3AU7A 4JI4Q 5LHY1 3CCLA 2XRQD 4O1NA 1VQGA 4LFAQ 1H9KA 2VL6A 1D5MC 1S5DD 4ZRZA 3S9WA 1KXLA 1WFQA 4P71A 3NQTA 4ME3A 2R61A 5C4XG 5EBDA 3QWNA 4LF6L 1LT6D 3I4NB 4AIMA 4R8NA 4JBJA 1LTBD 3H94A 4KHPL 1SXTA 2WB1B 1A3UA 5JPMC 1RTOA 3DWPA 1YITA 4H44C 1HR0Q 3GTGH 3OPOA 1BQQT 5LMNL 4FO2A 5M5WB 1EIFA 1PTOB 1SMYD 2V1CC 5J3BA 2KVMA 1D7QA 3ZYYX 4S3SA 3S2DB 1DCZA 1U4RA 1SYCA 1MBYA 2GVAA 5IT9E 1HNZL 2WIIB 2Y0SB 1FJGQ 1N33Q 5FO7B 3M7NA 2X69A 1L0YB 2EZVA 4RAUC 2A6EC 3ICEA 3S14H 1EY9A 3Q22A 2F0EA 1U4MA 2A1AA 2RDGA 5CV4A 2RCNA 3NQIA 1LO5D 1PTOD 1JR0D 1XXGA 2VUMB 3SK6A 3D4RA 1PZKD 3OTOL 5JJKA 1HPCA 1ENAA 2VNUD 3FP9A 4G7ZC 4A3CG 3PF4A 4GOPC 1FNUA 5DNFA 4XQQA 1H95A 4MIUA 4C1NK 1DOLA 2I46A 3N52A 4A3DB 4B3TQ 2PZTA 3E6ZX 1STBA 4A76A 1LT5D 2WKDA 4NKLA 1GJXA 2BE5D 4LF6Q 3CCVA 3I7FA 2K28A 5JEAJ 1HFGA 4KHPQ 2WP8J 5I6YA 3H3VI 1STYA 1EEFD 1SMXA 5H1SE 2I5HA 4DNTB 3M9BA 1MKHA 3LNNA 5LMNQ 3NE5B 2B8GA 3BYTB 3FDTA 5EKKA 1YBYA 1TWFH 4OONA 4UHVA 3C1FA 1K9MC 1E2WA 1STNA 1HNXL 3B6YA 3JC66 3P1HA 1AE2A 4ODGA 2MO1A 1VQOA 5IODA 3D8GA 1HNZQ 1CI3M 3GTMB 1M1KC 4DR7L 1U4LA 3KF6B 3T13A 4IOCA 4A3IB 2DY8A 1V43A 2NVQB 2VXWA 4JI3Q 1I6HB 1GUOA 3E9HA 1A3TA 5JPNC 2KA7A 1JB7A 4CDFC 1RF2D 2JYOA 1ILQA 3KJOA 2TMPA 1U0LA 4NXML 1HJPA 1BR9A 3FPUB 3PO2G 1C8CA 3M7GA 1EY8A 1WJJA 1A15A 1KIXA 1ZKOA 4XIGS 5IYCG 5EPJA 1SYGA 2QKIC 1I94L 3NWTA 3OTOQ 4CKBA 1CKNB 1U9RA 1MJCA 3AQQA 2PNRC 5EBCA 5KGUA 3Q6SA 3OHXC 1Q8KA 2ICIA 5FJ8H 4K14A 2OWOA 1VMPA 3MEHA 4BBSG 1HZAA 2A8VA 1DYQA 4V0BA 2MHVA 4YIJA 1VQ7A 1KHIA 4X65L 1EOTA 4KJNA 2RF4A 4KN7C 1W6JA 4ID6A 4BY7G 1WTRA 1NE3A 1FNVA 4GKKL 1RL2A 4CKEA 2HHHL 1ENCA 1TWCB 2WFWA 1DOKA 5JEAG 3RLNA 2LKVA 2NVTH 5HURA 4JI7L 1B4OA 5COYA 5J22A 1HTPA 4M1UB 2XTIA 5IP7H 2E2HH 2E8GA 2F1MA 2EY6A 2WKCA 5IYBG 3KLRA 1HNXQ 2R7ZG 3JAMc 2HUGA 5C4HA 4IO9A 1TQOA 1TVXA 3CCQA 3R8BA 4DR7Q 1WVLA 3M4YA 2F0OA 2AMCB 4DUYQ 3AMUA 2I5LX 5I2YA 2WV6D 3HRZC 1Z6HA 3E0JA 3H3VH 1KDAA 1CA6A 4LF7L 1IBLL 3D4DA 1QZHA 4OGQC 2ZT9C 1I3QB 4NXMQ 1OO9B 5F2DA 1B70B 1SROA 2B2VC 3R93A 1K83H 2EXDA 1CHPD 2KCMA 1TKWB 3L0OA 3KFUA 2R92B 1PRTC 4A3LH 1Z47A 1WTWA 3BZCA 1WTPA 4RMFA 2NTTA 3OIQA 1U5KA 3NXWA 5HGQA 1Y1VH 2B39A 4N9PA 5CYUA 2B63B 4A93B 5M5YB 4F8MA 5HGTA 2F0NA 1CZWA 3CAMA 1OXVA 2CW0C 3L3OC 4TSSA 2B29A 1EWHA 4HIKA 4IPDA 2L0CA 2QDBA 3DHQA 3FKIG 2BOSA 1AH9A 1QVGA 4IPGA 1BKBA 2NZHA 2CQOA 3PIP3 2Q2UA 3STBD 3D6WA 3S1RB 4GKKQ 2F03A 4KK7A 2HHHQ 4FXKC 3VA7A 3I56A 5DM73 2IJ0A 4GOPB 1RTNA 2ZM6L 1V1OA 2MQHA 3UDFA 3PV0A 2B2WA 4RKLA 4TQUS 4FXDA 1BNZA 1YZ6A 1VF7A 4RGOS 1X3PA 1YHBA 1ESFA 4JVZA 3S2HH 4AH6A 4CHTB 1CUKA 2Q2HA 1N8RC 2A6ED 4Q0FA 4A3FG 1BBWA 1VQ6A 1DONA 4GLVB 2JJQA 1GUGA 1JOQA 3CCRA 2L12A 1WD1A 5K36G 3J7YW 3ERSX 5CBAE 5ELCA 1TWHH 2NVXB 2E2JH 3KLSX 2PW5A 4DV5L 4LF7Q 1GXDC 1IBLQ 2JA8H 4DV3L 3HOZH 1OXUA 4I7ZC 2M2LA 1EY4A 3AB9A 1B8AA 5IYDH 4EVOA 2Z0SA 3I4MB 3K6OA 1EUJA 2LS01 4QCLA 1LT3D 2N49A 3S1QH 5A2QE 4QL5A 3J81i 1FR3A 4IFDI 1SNQA 1B7YB 3CHBD 2YTYA 4X62L 4A4IA 4HIDA 2KCNA 2ZXRA 2K01A 1ONLA 5ELEA 3S15B 1SLJA 2F0WA 2M9VA 3S1MH 5CORA 2JA5G 1DXMA 4C3JG 5C44B 4DR1L 3A7AB 5A35A 1X3QA 4X6AH 1G2TA 4LNQA 5M3FB 2I0QA 4R4IA 3G4SA 1HH2P 3F1ZA 4X3UA 2PI2E 5C4JH 3K7AH 1D5XC 4ILWA 3HOYH 1NBWA 2OF1A 3TREA 1VCIA 2IL8A 2NYZD 3HOXH 1SFOH 4PG3A 1QWYA 1XWEA 1CTMA 1R9TB 4CJ0B 1IKLA 5M3MG 3WOFA 5JJLA 1SE2A 4JOIA 3NPPA 2ZM6Q 4WJ3M 1J6QA 3T16A 2YV5A 1QVFA 5M5XB 5C4XB 3RZDH 1PVOA 2K5HA 2N88A 2BH2A 2AWOA 3MHBA 1QNUA 4JK1C 2SDFA 1XNQL 1G6ZA 2R7FA 1PRTF 2G9DA 1IYUA 3URYA 4IUUA 1AN8A 1HQMC 4RHSA 3BS1A 3PQIA 2NZOA 4DV5Q 3V96A 5JOBA 2P5ZX 4DV3Q 2DNEA 3SVMA 3AFPA 1PFSA 4EQ5A 1K3RA 1QCBD 3ONAB 2MUYA 2XN9C 1BBUA 2RSOA 4U68A 3UE1A 1TS5A 2ES2A 5TSSA 1S5ED 4PZ6A 2EYJA 4BY1H 1B2TA 3A8IE 3J81j 4HMJA 3G48A 4X62Q 3K80C 5K5PA 3NK9A 1XX8A 2PNHA 3NENA 3K5LA 2XGTA 1KTKA 2G9HD 1SEBD 1CQVA 1YHQA 3M4OB 1RIPA 3ULJA 3QR8A 5J39A 2UUBL 3X3NA 5ELOA 3VYUA 1G8ZD 3TS0A 1PRTB 3I4NH 1HQRD 1K8OA 2PYKA 1K0RA 2QCPX 3CCJA 3Q0AA 2AWNA 4IFDH 2ZTCA 4TVAB 4A3EH 2EVBA 1PH7A 3FVQA 1PYSB 1XNQQ 1B3AA 1SNCA 3SGIA 3MXUA 5M5WH 1EL0A 4DAYB 3NTHA 3TP5A 2H5XA 1IZ6A 4HIMA 1DZ1A 2B8FA 3S2DH 1J8IA 3F2DA 3G71A 1I4XA 1KQSA 1UNSA 1PRTD 4FF3A 1Q7YC 2JA6B 5KIXA 1UAPA 4MNOA 1B9NA 3HEJA 1STHA 2HDMA 4BXXG 4DR6L 2Q8RE 3VYTA 3LX0A 4O42A 1O7YA 4OX9L 4QQBX 2CW0D 1TXYA 3TEHB 4DR3L 2VUMH 5D3DA 3NP8A 2JEBI 3H91A 4U673 2GA4B 1PH9A 1FVIA 2L4NA 3IRBA 4KTAA 1S5CD 1SYEA 4HEDA 1L2FA 5EGTA 1YNJC 5BR8L 3RD4A 4DV4L 3PO2B 2PQAB 3HKSA 1OXTA 3G6EA 1PXUA 4A3DH 5L37A 2UUBQ 2OXPA 2BCOA 4A3KG 2JA9A 4R4TA 3K5NA 2FFKB 1G291 2G5DA 1NCVA 3Q8DA 1S5FD 1TWAB 5E4XA 4P72A 1JORA 2EOTA 1QILA 2YYZA 3J81L 1M90C 1BUVT 4BBSB 3DEPA 3NUCA 5FKAC 4IUVA 1F2ZA 5IIFA 1E2VA 4RGNA 4YY3L 1T5XD 2XWJB 1VS0A 2RCFA 2CWAA 1NMGA 3QJYA 4C3IH 4BBRG 4BY7B 2F0DA 4DFAA 3HS0C 2JA7H 3HP3A 1HA5A 2SEBD 1ZYRC 1PLFA 2K5WA 2LXJA 1AFPA 3PUZA 4MTNA 1IHZA 1E2ZA 5J1ZA 3IKJA 5CV8A 1VQFA 3GTMH 1W2BA 1QE6A 4DR5L 1EY7A 3RLOA 3HG9A 2JP1A 5FLXc 4KHZA 2F3WA 5C5LA 1B50A 2R7ZB 2A19A 2F0SA 4DR6Q 1IYJB 1I5FA 2D9UA 3GV6A 3RN5A 3I70A 4OX9Q 1F2YA 5HY6A 2R93H 4XXEA 3J81c 3PUVA 2EYLA 1JICA 4L5RC 3DWQA 4DR3Q 4HJAA 3PCOB 3P75A 3HOUG 1KLGD 2L5TA 1L1OB 1CKOA 2F0HA 1XPUA 1EWIA 3S16B 1LLRD 3KF8B 1KAAA 2EQSA 5IP7G 1R4PB 2VZAA 4QIWE 2KHSA 5D14A 4OL7A 5BR8Q 4DV4Q 3PUWA 4ZUIA 5CC4A 1V8QA 5CV7A 3MFGA 3W3AA 5I2XA 4KV6A 1T9HA 1AW7A 3OW7A 3BVMA 2PCFB 3J80c 3OMCA 5AJ3L 1QUQA 5KNCA 1TS4A 4NDXA 3VR4A 4R4CA 2A68C 1EWCA 2UXBL 1P16A 5CV5A 4DV1L 4RGTA 4A3JB 1VQAA 2IHFA 2KQ3A 1SAPA 1AZQA 1SE3A 4PMBA 4YY3Q 1N36L 1I4HA 3FKIB 4X3TA 5EJWA 1K8AC 3SE0A 2A74C 2CQAA 4JI0L 1LTLA 3NSWA 2XVSA 2B2WC 2HDLA 1DJRD 3BYYB 5GAHC 4KLKA 2RHQB 3K58A 3T1HL 2F0KA 3KF8A 3WWVA 5JAVA 4DR5Q 3BJUA 1D2BA 1A3VA 1Q82C 4UP9A 1SNMA 5CMDA 2XSCA 2EY1A 3ZJYC 4JI8L 4NW2A 4XYQA 3U50C 4A3FB 4L63B 2HQEA 1EIYB 5M9OA 1V9PA 3HKZE 2O5JC 3NEMA 1EYGA 2R92H 4C2MB 4A3GG 2CFMA 1I6VC 5I6WA 4DK0A 1RHPA 3I2ZA 4GN3B 4WORA 4RG1A 2B63H 2PMZE 5M5YH 1MSHA 4N9TA 1BCPC 3NBHB 2HCIA 1PFBA 5ELFA 2NVYB 4LFBL 5AJ3Q 1PH6A 2JEAI 3QOLA 1EZ6A 3BDLA 3L7ZC 3UE0A 1UE1A 3EQLC 2EYFA 2IT1A 2UXBQ 2VW9A 3SK5A 2ZJPA 1F77A 2JA6G 3GTKB 3BDCA 4RWSC 3S1RH 3IAYA 2HIVA 2JA5B 4C3JB 1Y14B 2F4VL 4OO1I 1GVPA 1SYFA 1XMOL 1SNDA 3V2TA 1UUPA 2EYHA 4WFN3 2UUAL 1VQPA 3Q23A 4JI0Q 2E5LL 2K33A 1NR4A 1E3PA 3K0YA 1UE7A 1GUWA 5M3MB 3GTJB 3DXJC 3T1HQ 1Y1WH 4K6DA 1B9MA 1EY6A 3FEWX 2QDLA 3TMEA 2F0QA 2FMMA 3V05A 4A75A 2NVXH 1YNND 2Z1CA 1I4PA 5JVG3 4Y52H 1ZXTA 1NSNS 2K05A 1X3EA 4TKOB 1ET9A 3TS2A 1UE6A 3A8JE 1F2MA 4K8IA 1H9SB 3BDOA 1YNJD 2BA1A 3KBXA 3FMCA 4ZQ3A 3KJPA 4OELB 3VR6A 4DKAC 1I4RA 5KYIA 4KN4C 1WCMG 1RODA 2DJFC 2LSSA 4GZYC 5IOCA 1V1PB 2WACA 4L6TB 4HIOA 5EPKA 2NN6G 3S15H 1VQMA 1ET6A 3F8TA 4LJZC 4ZUJA 1RJTA 4KJOA 5C44H 3RN2A 2ENBA 4R1JA 2PZUA 2CVRA 1GUTA 3KF6A 4J15A 4LFBQ 5G3LF 4GNXB 3DMUA 5GROA 5M3FH 3H3VC 3CCUA 3GP7A 3GTGB 2JSOA 5KNDA 1IBML 5JVH3 4H7BA 5C3EH 4MHEA 2O2LD 2RDHA 1ZYRD 4AQYL 1XMOQ 2L1BA 1Q90A 2VQFL 3I72A 3SXHA 2UUAQ 1CKNA 4IPHA 2E5LQ 1PFMA 5IT9L 3RZOH 4QB4A 5M5XH 3NELA 1A63A 5C4XH 4UP7A 4E6IA 1YJ9A 3A7LA 1AP0A 1PMRA 3DUZA 2OCEA 4UAIA 3I4OA 3U4VA 1JE5A 1EZ8A 4C3HG 2MJ8A 3M3YB 4H0LC 2B2YA 2RKSA 5T1IA 5T1GA 1I50B 1X3FA 5EPLA 3L9AX 1ASYA 2CH4W 2K1BA 2C9OA 3GTOB 1TT2A 2WINB 1DD2A 3D31A 4OO1H 2DUDA 1I94Q 4A3BG 1BCPF 4XQJA 1MD2D 5FO8B 3MFYA 4DGZA 1HHVA 4B3ML 3HOWG 2Z8LA 4P74A 4GNXA 2MNAA 4RGMA 4JPBW 3OW2A 4G7OC 3OYYA 4POFA 4L5SA 4A3JG 3I4LA 1CSPA 5FLMH 3DLLA 1EIHA 3PO3G 3K57A 2KEDA 5BN5A 1WI5A 2L11A 4A3MG 1CHQD 4X65Q 4A3EG 3TQYA 1D1KA 5C0XG 1ZEQX 3MXPA 2UXDL 3I55A 1H9RA 2ATWA 2B2TA 3BZKA 5D3IB 3F2UA 1SR3A 3TZUA 1VQDA 3TP7A 4JI7Q 4O0AA 2F3IA 2K14A 3GTQB 5DAUA 2KBNA 1X65A 1WTQA 3OWFA 1NMFA 4JBMA 2O5IC 1C0AA 3H0GG 1IBMQ 2H4OA 4IUQA 1XYIA 4DAVA 5G3LD 4V190 4POGA 4AQYQ 3A5UA 3OOCA 1Q81C 1SNPA 4N8X1 1EQRA 4C1NI 2D5DA 2VQFQ 5C3WA 2HD3A 2TSSA 2F0TA 3D6CA 4A3KB 3NTKA 1LABA 3PF5A 1IXRA 4I7AA 4X64L 3HGBA 5EAYA 1Q1EA 3CQZH 2L9HA 3AYHB 1TY2A 4M8AA 3C2PA 4IUPA 2HT1A 3S1NB 4APVA 3CW2C 4LF4L 1Q1BA 5IP9G 1SN8A 5NUCA 3RUZA 4QIWB 4K5XA 1I4QA 2E2DC 3MC0B 3W1BA 3QOJA 3KOJA 4BBRB 1Z9FA 2F4IA 1F9RA 2JN4A 1DOMA 2ZXOA 5FOBB 1PDQA 1LTGD 2QILA 1VQ4A 3MXNB 4GOPA 2DNCA 1HA6A 3H15A 3A8KE 4ZKBB 2F0LA 1BCPD 3OMGA 4RA8A 2KECA 1SDFA 1XPRA 2A69C 3MA2B 1EQVA 3G6JB 4PNYA 4MZ9A 2ICEC 1T5EA 2E2IH 1QB5D 1XPOA 4DAPA 4C3IG 1LTRD 2EJMA 1K73C 4J6HA 1W3SA 2JA7G 3UDXA 1STGA 3C1EA 5E4WC 4DR2L 1H9MA 2A6HC 2VY3A 3PO2H 4LWCA 3KBGA 5CV9A 4HCSA 1WTXA 3HOVH 3HOUB 4GLAC 1TY0A 2K6AA 2NVTB 4WJWA 1EQQA 2Q8IB 1TWAH 2VB3X 5DM63 5FLXE 3A55A 1KNEA 3BVGA 3TDQA 5LMUL 1EQTA 1JOOA 3TN2A 3E0EA 2MPMA 2D0OA 3T4AC 1PH4A 4BBSH 5CV6A 3GTLB 3C46A 3ULLA 1YHAA 2R93G 4X64Q 2HIXA 1SYDA 2EJFC 1TWGB 4KMUC 3HKZB 2V4DA 5E7NA 4F7XA 1CFMA 2ASBA 3QG1A 1SMYC 1YIJA 1NAPA 3IL8A 4KKSA 1TU2B 5JEAH 1SBBB 3DEOA 1FGBD 1WYDA 3J80E 5KNBA 5KYLA 4Y7NB 1EFWA 2PMZB 4EGVA 1H9JA 1Q46A 1DGSA 3RMHA 3RLFA 1YEZA 2A73B 4ZAIA 1LACA 2R7ZH 2RQXA 4OIKA 4DR1Q 3A5ZB 1Y1VB 1VQ5A 1UEBA 3VDYA 1IYVA 3RNUA 3CCSA 4JYAL 4JBWA 1UWVA 5GAGC 4UY8C 1VQIA 4KKTA 1EY0A 1TS3A 5ISRA 3S16H 3I73A 3TP8A 4NXNL 5GQOA 3CMAA 2KHIA 2OQKA 5JJIA 4DR2Q 4JV5L 4DUZL 3CU7A 4KHVA 1P8LA 4KY5A 1G91A 4A3GB 1SNOA 2E75C 2CKZB 1JJGA 3VR3A 2C35B 4TRDA 1FNWA 1PFNA 1PTOH 2DY7A 5I4DA 2I5MX 1BVSA 1OXXK 3VYSA 1WTHA 2CWPA 4CJ2C 1JJ2A 1N32L 4EX5A 2YTVA 3BG3A
chains in the Genus database with same CATH topology
1PYWD 4I65A 3BVZA 3MXGA 2KEEA 3S17B 4CKCA 2B2VA 4FF4A 1F9PA 4IURA 2NB0A 2PPBC 2K7VA 4DXFA 2JXMB 5A2QL 4C56C 3S1QB 3J7AV 2F3VA 4HSVA 3C3LA 1XTCD 4IUTA 2RBMA 4IUNA 2Z4IA 2FINB 1EU3A 5K36H 1EYAA 5C4ZA 1HXYD 2B2UA 3CRKC 3GD7A 4DAYA 4IZ8A 2LFNA 4FXGC 4RKBA 2K5DA 4KD3A 2F0PA 3NTIA 3K7AB 1BO0A 3OWEB 2NWGA 2EPBA 4J8QA 3P7JA 3U9OA 4DK1A 2AUKA 3GQBA 4RH6A 4QUCA 1CQFA 1WCMB 1WD0A 1RD9D 2SNSA 2K5QA 2OT2A 3FPPA 2YU9B 3SK8A 2EE1A 4FP5D 4DU9A 3A56A 2F0FA 4HSPA 2ID0A 2NUCA 1F9QA 3G7LA 3VYRA 3PUYA 1LV9A 1MGSA 1EYCA 5FK9C 4KKUA 1A6XA 1PTOF 4KY7A 2B2YC 4K8JA 3DM1A 5KEEA 5BN4A 3WOEA 4C3HB 5E1FA 3JAME 3D4WA 4ZK9B 3E5SA 2EY2A 3EVQA 3KK7A 3K59A 1SJED 1M8AA 4FNFA 4A3BB 4HR7B 5IGEA 1G2SA 4H13C 4F87A 2AQ1B 4DF7A 3HOWB 1GHJA 2K32A 4XQNA 1AZPA 2B2TC 4EQOA 3PO3B 1WTVA 1EY5A 3TSSA 1STAA 1EU4A 2RSNA 4A3MB 4X3KA 2RA4A 4K2LA 4A3EB 1I4GA 4OO1G 4CJ1B 1O7LA 5C5MA 3GTPB 3T53B 1C48A 3VA5A 1JC7A 1MI2A 1VDZA 3I91A 1O7ZA 2RVLA 5CBEE 3PIO3 3H0GB 3H09A 5C3XA 2X6LA 1BOSA 2K04A 4FVMA 5BN3A 1GHKA 2EXZA 4ABNA 1O80A 3HZXA 3PMFA 4BA2I 3NWSA 4HCEA 1NR2A 1ML0D 3A54A 4HTHA 2O4XA 1RKNA 1IL8A 1K8MA 1GOZA 2EY5A 1JQYD 4IN3A 4HN7A 2I07B 3MTSA 1LTTD 2LY7A 1IW7C 1PZJD 1STEA 2EDGA 1SYBA 2L55A 3BZDB 3CKIB 3I90A 1B1ZA 1SSOA 3MAQA 2PQEA 2E74C 1RCVD 3ERQA 4C3IB 4HAEA 2J0TD 2JA7B 3I8ZA 4PMCA 3SDZA 4ZYSA 1Y8OB 1HCZA 1HFNA 3KLSA 1UEAB 2N55A 2C5CA 1II3A 1S4ZA 4XTCS 4X3SA 4RFBA 3ITPA 3NBHA 4IFDJ 3R2TA 2IWHA 2M00A 2F0GA 5C0XJ 4OHJA 1JWMD 2R93B 4IALA 1Y8PB 4CBVA 1Q8IA 1KDBA 5IGCA 1LTAD 3PUXA 4QF4A 4DNRB 2XIWA 3JAML 1WTOA 2J4XA 4Z9CB 2F0MA 2IX3A 1TR5A 5IGDA 3H6MA 3UI2A 4ULLA 2BDOA 3O13A 1O78A 4CGYB 2F0IA 2AQ3B 4LK1C 1OXSC 1VF5C 4PQXA 5ELBA 4XYOA 1HRJA 1D6EC 4BWGB 2PW7A 1ILPA 3D3RA 1H9SA 4G4KA 3QIAA 2AQ2B 3OIPA 1QJOA 4UDUC 3S14B 5D65A 2XWBB 1CT1D 2NZ1D 1F9SA 1V1PA 4ZLTF 2QEJC 4OIJA 3GO5A 4L8JA 2XNAC 3SK4A 4B9XA 1JOKA 5LL6X 2F0UA 2EYMA 1KLUD 5IGBA 5CR3A 4IQZA 4IFDG 3W2DA 2EYOA 1VMCA 2XRSD 1LT4D 2FHTA 5LL6S 1EFID 5IGGA 4WRDA 2MP1A 2A68D 2WAQB 2Q8TA 2RDFA 3EROA 5I9PA 1QG7A 2NN6I 1L0XB 3NHHA 4PMWA 1JWUD 4BA1I 1Q12A 4B08A 1HTLD 2D62A 2B2UC 1EYDA 1JWSD 2KJXA 1TWFB 3R2IA 1KNAA 1X32A 2QF7A 1BCPB 4B9WA 3WDNA 5JJZA 4Q5VA 4K5VA 3K5MA 4QUFA 3EJIA 1ICWA 1EIGA 1FD7D 1JCKB 3EA6A 4MN3A 1B53A 1Y1WB 1MSGA 3U9SA 1Y69U 4NMZA 2K03A 4R9WA 5ELDA 2X6GA 1W6KA 2AUJD 1DM0B 1A2UA 4XDXA 3SHLA 4XT1B 2H1EA 4FF2A 5KRUA 5C6AA 1KABA 1IW7D 2E76C 4RCNA 2OEOA 2KUMA 5C0XI 3T56B 1U4PA 1HUNA 2D2CC 1ENFA 2R6GA 1BDOA 3OSOA 4KI0A 3QB3A 1RDPD 4BS9A 4G7HC 2E2HB 5CGKA 3R3OA 1KDCA 5C3EB 3Q24A 1TS2A 4DN4M 3J81E 5EKIA 1A2TA 2F0JA 4R8IA 1PZID 1IKMA 3MXNA 3RZOB 5I9OA 4F88A 2NN6H 4EQPA 1JB3A 1FYCA 1BF4A 3TBIB 2FMCA 2IPKD 1K83B 3KUPA 2PZWA 5EQ0A 4FYDA 3P20A 1Z7TA 1C4QA 1M4VA 3VR2A 1Q3LA 1EEID 3CRLC 3FRPB 3M85A 1SJHD 1JE4A 3K5OA 4FF1A 3MWYW 4XT3B 4K2KA 1PTOC 1F2LA 1J9OA 4KD4A 4RCOA 4ZKCB 3TP6A 1SE4A 1Y8NB 3IFTA 1CZGA 2ZXPA 4LAAA 2BE5C 3IFDA 4KY6A 3S2HB 3MZ5A 4K6LA 2BA0A 4QMGA 3N6RA 1HUMA 3I3CA 1QOHA 1B44D 5C0XH 4J1MA 2NBFA 1TWHB 4DXGA 2E2JB 3CQZB 2MGSA 2JA8B 3HOZB 1AEXA 3SEBA 3GV3A 1D1IA 4RHRA 4G57A 2FJ2A 1CM9A 5EKLA 3MVVA 3ND9A 1BXTA 4DA2A 2PO4A 3S1MB 1NUCA 3NBIA 1CK1A 2A5HA 2CHBD 1GUSA 1E0BA 1YNNC 2NTSA 5IGFA 5C4JB 2E2IB 2R3ZA 3HOYB 1S5BD 1SFOB 3HOXB 1BBXC 5AFWA 3QO2A 4P2CB 1R4QB 2J7ZA 3HOVB 1LTSD 2Z4HA 3DWAA 1ESRA 4ME5A 3T51B 5FLXL 3RZDB 1CA5A 5FO9B 2VB2X 4K5WA 2IX0A 3J7AF 1GUNA 2EYPA 2KCCA 3SR1A 3EFXD 4NP5A 2KOLA 2IW3A 2SOBA 5E3FA 2DN8A 2EJGC 3VR5A 4EQNA 2BDNA 3TZDA 4LMQD 3LWEA 3X3MA 2SNMA 5DEHA 3J80L 1TIID 2A69D 1LTID 2JE6I 3LWUA 1D5ZC 4BY1B 2LMCB 1QNKA 4HMIA 3ND8A 2HCCA 2F0VA 4PV1C 2IX1A 2A6HD 4AYBB 3AU7A 5LHY1 2XRQD 4O1NA 1H9KA 1D5MC 1S5DD 4ZRZA 3S9WA 3NQTA 2R61A 5EBDA 3QWNA 1LT6D 3I4NB 4R8NA 1LTBD 3H94A 1SXTA 2WB1B 1A3UA 5JPMC 1RTOA 3DWPA 4H44C 3OPOA 1BQQT 4FO2A 5M5WB 1PTOB 1SMYD 2KVMA 3ZYYX 4S3SA 3S2DB 1DCZA 1U4RA 1SYCA 1MBYA 5IT9E 2WIIB 2Y0SB 5FO7B 3M7NA 2X69A 1L0YB 2EZVA 4RAUC 2A6EC 1EY9A 3Q22A 2F0EA 1U4MA 2RDGA 5CV4A 3NQIA 1LO5D 1PTOD 1JR0D 1XXGA 2VUMB 3SK6A 3D4RA 1PZKD 1HPCA 1ENAA 2VNUD 4G7ZC 1FNUA 5DNFA 4XQQA 4MIUA 4C1NK 1DOLA 2I46A 3N52A 4A3DB 2PZTA 3E6ZX 1STBA 1LT5D 2WKDA 4NKLA 1GJXA 2BE5D 2K28A 5JEAJ 1HFGA 2WP8J 5I6YA 1STYA 1EEFD 4DNTB 3LNNA 3NE5B 2B8GA 3BYTB 3FDTA 5EKKA 3C1FA 1E2WA 1STNA 3P1HA 4ODGA 5IODA 3D8GA 1CI3M 3GTMB 1U4LA 3T13A 4A3IB 2DY8A 1V43A 2NVQB 2VXWA 1I6HB 1GUOA 1A3TA 5JPNC 2KA7A 1RF2D 2JYOA 1ILQA 2TMPA 1BR9A 3FPUB 1C8CA 3M7GA 1EY8A 1A15A 1ZKOA 4XIGS 5EPJA 1SYGA 2QKIC 3NWTA 4CKBA 1U9RA 2PNRC 5EBCA 5KGUA 3Q6SA 3OHXC 2ICIA 4K14A 1VMPA 3MEHA 1DYQA 4V0BA 2MHVA 4YIJA 1EOTA 4KJNA 4KN7C 1W6JA 4ID6A 1WTRA 1FNVA 4CKEA 1ENCA 1TWCB 5JEAG 1DOKA 2LKVA 5HURA 1B4OA 5COYA 5J22A 1HTPA 4M1UB 2F1MA 2EY6A 2WKCA 3KLRA 2HUGA 5C4HA 1TQOA 1TVXA 3R8BA 1WVLA 3M4YA 2F0OA 3AMUA 5I2YA 2WV6D 3HRZC 1Z6HA 3E0JA 1KDAA 1CA6A 3D4DA 4OGQC 2ZT9C 1I3QB 1OO9B 5F2DA 2B2VC 3R93A 1CHPD 1TKWB 2R92B 1PRTC 1Z47A 1WTWA 1WTPA 2NTTA 3OIQA 3NXWA 2B39A 4N9PA 5CYUA 2B63B 4A93B 5M5YB 4F8MA 5HGTA 2F0NA 1CZWA 1OXVA 2CW0C 3L3OC 4TSSA 1EWHA 2L0CA 2QDBA 3DHQA 2BOSA 3PIP3 3D6WA 3S1RB 2F03A 4KK7A 4FXKC 3VA7A 5DM73 2IJ0A 1RTNA 1V1OA 3PV0A 2B2WA 4RKLA 4TQUS 4FXDA 1BNZA 1VF7A 4RGOS 1X3PA 1ESFA 4CHTB 2A6ED 4Q0FA 1DONA 1GUGA 1JOQA 2L12A 1WD1A 5K36G 3J7YW 5CBAE 5ELCA 2NVXB 3KLSX 2PW5A 1GXDC 1OXUA 4I7ZC 2M2LA 1EY4A 3AB9A 4EVOA 3I4MB 3K6OA 4QCLA 2LS01 1LT3D 5A2QE 1FR3A 4IFDI 1SNQA 3CHBD 2KCNA 2ZXRA 2K01A 1ONLA 5ELEA 3S15B 2F0WA 2M9VA 5CORA 1DXMA 4C3JG 5C44B 3A7AB 5A35A 1X3QA 1G2TA 5M3FB 4X3UA 1D5XC 4ILWA 2OF1A 1VCIA 2IL8A 2NYZD 1QWYA 1XWEA 1CTMA 1R9TB 4CJ0B 1IKLA 3WOFA 1SE2A 3NPPA 3T16A 5M5XB 5C4XB 2N88A 2AWOA 3MHBA 1QNUA 4JK1C 2SDFA 1G6ZA 1PRTF 2G9DA 1IYUA 3URYA 4IUUA 1AN8A 1HQMC 4RHSA 3BS1A 3V96A 5JOBA 2DNEA 3SVMA 1QCBD 3ONAB 2MUYA 2XN9C 2RSOA 4U68A 1TS5A 5TSSA 1S5ED 2EYJA 1B2TA 3A8IE 4HMJA 5K5PA 3NK9A 1XX8A 3K5LA 1KTKA 2G9HD 1SEBD 1CQVA 3M4OB 5J39A 3X3NA 3VYUA 1G8ZD 1PRTB 1HQRD 1K8OA 2PYKA 2QCPX 3Q0AA 2AWNA 4IFDH 2EVBA 3FVQA 1B3AA 1SNCA 3MXUA 1EL0A 3NTHA 3TP5A 1DZ1A 2B8FA 1J8IA 1I4XA 1UNSA 1PRTD 4FF3A 2JA6B 5KIXA 1UAPA 1B9NA 3HEJA 1STHA 2HDMA 2Q8RE 3VYTA 3LX0A 4O42A 1O7YA 2CW0D 5D3DA 3NP8A 2JEBI 3H91A 4U673 2GA4B 2L4NA 4KTAA 1S5CD 1SYEA 4HEDA 5EGTA 1YNJC 3RD4A 3PO2B 1OXTA 1PXUA 2OXPA 2BCOA 3K5NA 2FFKB 1G291 1NCVA 1S5FD 1TWAB 5E4XA 1JORA 2EOTA 1QILA 2YYZA 3J81L 1BUVT 4BBSB 3DEPA 3NUCA 5FKAC 4IUVA 1F2ZA 5IIFA 1E2VA 4RGNA 1T5XD 2XWJB 3QJYA 4BY7B 2F0DA 4DFAA 3HS0C 3HP3A 1HA5A 2SEBD 1ZYRC 1PLFA 2K5WA 1AFPA 3PUZA 1IHZA 1E2ZA 5J1ZA 3IKJA 5CV8A 1QE6A 1EY7A 3HG9A 2JP1A 4KHZA 2F3WA 5C5LA 1B50A 2R7ZB 2F0SA 2D9UA 3GV6A 3I70A 1F2YA 4XXEA 3PUVA 2EYLA 1JICA 3DWQA 3P75A 1KLGD 2L5TA 2F0HA 3S16B 1LLRD 1KAAA 1R4PB 2KHSA 5D14A 4OL7A 3PUWA 4ZUIA 5CC4A 1V8QA 5CV7A 3MFGA 3W3AA 5I2XA 4KV6A 3OW7A 1AW7A 3BVMA 2PCFB 3OMCA 5KNCA 1TS4A 4NDXA 3VR4A 2A68C 1EWCA 5CV5A 4RGTA 4A3JB 2KQ3A 1SAPA 1AZQA 1SE3A 4PMBA 1I4HA 3FKIB 4X3TA 5EJWA 3SE0A 2A74C 2CQAA 3NSWA 2XVSA 2B2WC 2HDLA 1DJRD 3BYYB 3K58A 2F0KA 3KF8A 5JAVA 1D2BA 1A3VA 1SNMA 5CMDA 2XSCA 2EY1A 4NW2A 4XYQA 4A3FB 4L63B 2HQEA 5M9OA 2O5JC 4C2MB 1I6VC 5I6WA 4DK0A 1RHPA 4WORA 1MSHA 4N9TA 1BCPC 2HCIA 1PFBA 5ELFA 2NVYB 2JEAI 3QOLA 1EZ6A 3BDLA 3L7ZC 3EQLC 2EYFA 2IT1A 3SK5A 1F77A 3GTKB 3BDCA 4RWSC 3IAYA 2JA5B 4C3JB 4OO1I 1SYFA 1SNDA 3V2TA 1UUPA 2EYHA 4WFN3 3Q23A 2K33A 1NR4A 3K0YA 1GUWA 5M3MB 3GTJB 3DXJC 4K6DA 1B9MA 1EY6A 3FEWX 3TMEA 2F0QA 2FMMA 3V05A 1YNND 2Z1CA 1I4PA 5JVG3 1ZXTA 1NSNS 2K05A 4TKOB 1ET9A 3A8JE 1F2MA 4K8IA 1H9SB 3BDOA 1YNJD 2BA1A 3KBXA 3FMCA 4ZQ3A 3VR6A 1I4RA 5KYIA 4KN4C 1RODA 4GZYC 5IOCA 1V1PB 2WACA 4L6TB 5EPKA 2NN6G 1ET6A 4LJZC 4ZUJA 1RJTA 4KJOA 2ENBA 2PZUA 2CVRA 1GUTA 5G3LF 3DMUA 3H3VC 3GP7A 3GTGB 2JSOA 5KNDA 5JVH3 4H7BA 4MHEA 2O2LD 2RDHA 1ZYRD 2L1BA 1Q90A 3I72A 3SXHA 1PFMA 5IT9L 4QB4A 4E6IA 3A7LA 1AP0A 1PMRA 3DUZA 4UAIA 4C3HG 1EZ8A 2MJ8A 3M3YB 4H0LC 2B2YA 2RKSA 5T1IA 5T1GA 1I50B 5EPLA 3L9AX 2K1BA 2C9OA 3GTOB 1TT2A 2WINB 1DD2A 3D31A 4OO1H 1BCPF 4XQJA 1MD2D 5FO8B 3MFYA 4DGZA 1HHVA 2Z8LA 4RGMA 4G7OC 3I4LA 1EIHA 3K57A 2KEDA 5BN5A 2L11A 1CHQD 1D1KA 5C0XG 1ZEQX 3MXPA 1H9RA 2B2TA 5D3IB 3F2UA 3TZUA 3TP7A 3GTQB 5DAUA 1WTQA 3OWFA 2O5IC 2H4OA 4IUQA 1XYIA 4DAVA 5G3LD 4V190 3OOCA 1SNPA 4C1NI 2D5DA 5C3WA 2TSSA 2F0TA 3D6CA 4A3KB 3NTKA 1LABA 3HGBA 1Q1EA 2L9HA 4M8AA 1TY2A 3C2PA 4IUPA 3S1NB 1Q1BA 5NUCA 3RUZA 4QIWB 4K5XA 1I4QA 2E2DC 3MC0B 3QOJA 4BBRB 2F4IA 1F9RA 5FOBB 1DOMA 2ZXOA 1PDQA 1LTGD 2QILA 2DNCA 1HA6A 3A8KE 4ZKBB 2F0LA 1BCPD 3OMGA 4RA8A 2KECA 1SDFA 2A69C 3MA2B 1EQVA 3G6JB 4PNYA 2ICEC 1T5EA 1QB5D 4DAPA 4C3IG 1LTRD 2EJMA 4J6HA 1STGA 3C1EA 5E4WC 1H9MA 2A6HC 3KBGA 5CV9A 4HCSA 1WTXA 3HOUB 1TY0A 2K6AA 2NVTB 4WJWA 2Q8IB 2VB3X 5DM63 5FLXE 3A55A 1KNEA 3BVGA 3TDQA 1EQTA 1JOOA 3TN2A 2MPMA 3T4AC 5CV6A 3GTLB 3C46A 1SYDA 2EJFC 1TWGB 4KMUC 3HKZB 2V4DA 4F7XA 1CFMA 3QG1A 1SMYC 1NAPA 3IL8A 4KKSA 1TU2B 5JEAH 1SBBB 3DEOA 1FGBD 3J80E 5KNBA 5KYLA 4Y7NB 2PMZB 4EGVA 1H9JA 3RMHA 3RLFA 2A73B 4ZAIA 1LACA 2RQXA 4OIKA 1Y1VB 1IYVA 4JBWA 4KKTA 1EY0A 1TS3A 5ISRA 3I73A 3TP8A 3CU7A 4KHVA 4KY5A 1G91A 4A3GB 1SNOA 2E75C 3VR3A 4TRDA 1FNWA 1PFNA 1PTOH 2DY7A 5I4DA 1OXXK 3VYSA 4CJ2C 3BG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K6D A;  4YIJ A;  4NP5 A;  1EY6 A;  4I65 A;  5EGT A;  2KQ3 A;  4KJN A;  3TME A;  4PMB A;  2F0Q A;  2SOB A;  4ID6 A;  5E3F A;  3SK6 A;  5E1F A;  3D4W A;  3MXP A;  1JOO A;  4LAA A;  2OXP A;  1NSN S;  4EQN A;  3SR1 A;  1ENA A;  3E5S A;  2EY2 A;  3SHL A;  1KAB A;  2PQE A;  5C6A A;  5KRU A;  1JOQ A;  3EVQ A;  4KY6 A;  2EYJ A;  2OEO A;  1ENC A;  3ERQ A;  4MIU A;  2LKV A;  1F2M A;  2SNM A;  3MZ5 A;  4HMJ A;  4K8I A;  5CV6 A;  3TP7 A;  5HUR A;  5IGE A;  3SK4 A;  5K5P A;  1JOR A;  3NK9 A;  5DEH A;  2PW5 A;  1JOK A;  2PZT A;  4B9X A;  4DF7 A;  1SYD A;  4QMG A;  5J22 A;  5DAU A;  4ZQ3 A;  1STB A;  4PMC A;  3OWF A;  2F0U A;  2F3V A;  4NKL A;  2F0K A;  2EYM A;  2EY6 A;  2RBM A;  4J1M A;  5IGB A;  3NUC A;  4IUN A;  3OSO A;  1EY4 A;  5CR3 A;  4EQO A;  5JAV A;  1F2Z A;  4F7X A;  5IIF A;  4EVO A;  5KYI A;  3QB3 A;  1EY5 A;  1STA A;  2EYO A;  4HMI A;  5C4H A;  1A3V A;  1II3 A;  5IOC A;  1AEX A;  5J39 A;  2WAC A;  1SNP A;  1SNM A;  1TQO A;  3R3O A;  4K2L A;  1KDC A;  5CGK A;  4WRD A;  1EYA A;  5I6Y A;  2F0D A;  5C3W A;  5IGG A;  2F0V A;  1STY A;  2EY1 A;  4DFA A;  5C4Z A;  2F0O A;  4ZUJ A;  4KJO A;  3ITP A;  2ENB A;  2F0T A;  2PZU A;  3D6C A;  5KYL A;  4IZ8 A;  1SNQ A;  4G57 A;  2RDF A;  2HQE A;  3ERO A;  4RKB A;  5C5M A;  3DMU A;  5I9P A;  4KD3 A;  2F0P A;  2M00 A;  2PYK A;  1KDA A;  1A2T A;  5M9O A;  3S9W A;  2F0J A;  3VA5 A;  2F0G A;  1IHZ A;  3D4D A;  5EKK A;  5J1Z A;  2F0W A;  3NQT A;  5CV8 A;  3NHH A;  4IAL A;  5I9O A;  3C1F A;  5EKL A;  3MVV A;  5F2D A;  3U9O A;  4H7B A;  1STN A;  1EY7 A;  4R8N A;  3P1H A;  1EYD A;  4EQP A;  4ODG A;  1KDB A;  5I6W A;  5IGC A;  5C3X A;  5IOD A;  2F3W A;  5NUC A;  3D8G A;  5C5L A;  3RUZ A;  4K5X A;  1SNC A;  1NUC A;  1A3U A;  2F0S A;  4QF4 A;  4WOR A;  4N9T A;  3SXH A;  2OF1 A;  2SNS A;  3T13 A;  1EY0 A;  2F0M A;  3QOJ A;  5ISR A;  1TR5 A;  1F2Y A;  3NXW A;  3TP5 A;  4QB4 A;  1A3T A;  3H6M A;  2PZW A;  3TP8 A;  5IGD A;  2EYL A;  3QOL A;  4E6I A;  1EZ6 A;  5IGF A;  2EXZ A;  4N9P A;  3BDL A;  4B9W A;  3P75 A;  3SK8 A;  2EYF A;  4F8M A;  5HGT A;  2F0N A;  2F0H A;  4K5V A;  3T16 A;  4KHV A;  2F0I A;  3HZX A;  3SK5 A;  4DU9 A;  2F0F A;  4KY5 A;  3PMF A;  1KAA A;  3EJI A;  3BDC A;  4S3S A;  1EZ8 A;  2F0L A;  3OMG A;  2NUC A;  5KIX A;  1EY8 A;  2RKS A;  2QDB A;  1SNO A;  1SYF A;  2KHS A;  3DHQ A;  4OL7 A;  1SYC A;  5CC4 A;  3HEJ A;  1EQV A;  1STH A;  3MHB A;  5CV7 A;  4ZUI A;  1SND A;  1SYG A;  4HTH A;  4PNY A;  4TRD A;  3V2T A;  1TT2 A;  2EYH A;  2O4X A;  1EYC A;  4KV6 A;  4ME5 A;  1U9R A;  1RKN A;  3LX0 A;  4NMZ A;  4K2K A;  2PW7 A;  3OMC A;  2EY5 A;  4DGZ A;  4KY7 A;  5KGU A;  4KD4 A;  4J6H A;  4K5W A;  4NDX A;  1STG A;  3C1E A;  4K8J A;  3NP8 A;  1EY9 A;  2EYP A;  4K14 A;  2F0E A;  5CV5 A;  3MEH A;  5CV9 A;  5JOB A;  5KEE A;  3TP6 A;  4RKL A;  1A2U A;  1SYB A;  5CV4 A;  4KTA A;  1SYE A; 
#chains in the Genus database with same CATH topology
 1PYW D;  4I65 A;  4YHH L;  3BVZ A;  3MXG A;  1PH8 A;  1VQN A;  4NPS A;  2KEE A;  3F2B A;  3S17 B;  4CKC A;  2WAQ G;  2B2V A;  2Q2I A;  4FF4 A;  1F9P A;  4IUR A;  2NB0 A;  2PPB C;  2K7V A;  4DXF A;  2JXM B;  1YNX A;  5A2Q L;  5IWA L;  4C56 C;  1PA6 A;  2B3G A;  3S1Q B;  3J7A V;  2F3V A;  4HSV A;  3C3L A;  1XTC D;  4IUT A;  2RBM A;  4IUN A;  1YJW A;  2Z4I A;  1CSQ A;  1NNX A;  4GS3 A;  2FIN B;  2K4K A;  1EU3 A;  4JYA Q;  5K36 H;  1EYA A;  4B3S L;  2MO0 A;  5C4Z A;  3U58 A;  1HXY D;  2B2U A;  3CRK C;  3GD7 A;  4DAY A;  4IZ8 A;  2LFN A;  4FXG C;  4RKB A;  2K5D A;  4KD3 A;  2F0P A;  4NXN Q;  3NTI A;  3K7A B;  1BO0 A;  3OWE B;  2NWG A;  4JV5 Q;  2EPB A;  1Q86 C;  4DUZ Q;  4LFC L;  1D8L A;  4J8Q A;  3P7J A;  4N8F A;  1KAW A;  3U9O A;  4DV6 L;  1E1O A;  1K3B C;  1Y1W G;  4DK1 A;  2NVY H;  2AUK A;  3GQB A;  5IE8 A;  4RH6 A;  4QUC A;  2WAQ E;  1CQF A;  1WCM B;  1WD0 A;  1KD1 C;  1VQ8 A;  1RD9 D;  1G51 A;  2SNS A;  2K5Q A;  1OTC A;  2OT2 A;  3GTK H;  1HZC A;  3FPP A;  1XJV A;  4LF8 L;  2YU9 B;  1MHW C;  1X3G A;  3SK8 A;  2EE1 A;  1N32 Q;  4FP5 D;  4DU9 A;  1J5E L;  3A56 A;  2F0F A;  4HSP A;  3EN2 A;  2ID0 A;  3CPW A;  2IHE A;  1S72 A;  3TRZ A;  5FJ8 G;  2NUC A;  1F9Q A;  4LUV A;  4A3I H;  2NVQ H;  1I6H H;  3G7L A;  4YHH Q;  3K0X A;  3VYR A;  1HNW L;  2PQA A;  3PUY A;  1LV9 A;  1MGS A;  1XTD A;  2QGQ A;  1EYC A;  5M3M H;  2JQO A;  5FK9 C;  4KKU A;  3GTJ H;  1A6X A;  1PTO F;  4JC0 A;  4KY7 A;  2B2Y C;  4K8J A;  5GAE C;  5GAD C;  3DM1 A;  5IWA Q;  5KEE A;  5BN4 A;  2N78 A;  3EBE A;  3WOE A;  4C3H B;  2AKW B;  5C3E G;  2KCT A;  2GVB A;  5E1F A;  3JAM E;  3D4W A;  4ZK9 B;  4QGU A;  3E5S A;  2EY2 A;  4OWX B;  3EVQ A;  3KK7 A;  3K59 A;  1SJE D;  1M8A A;  4FNF A;  4A3B B;  4HR7 B;  5IGE A;  1G2S A;  4B3T L;  4DV0 L;  4H13 C;  1X9N A;  2AQ1 B;  4DF7 A;  4F87 A;  3HOW B;  1GHJ A;  1GO3 E;  2K32 A;  4LFC Q;  3HKZ G;  4XQN A;  4K0K L;  2D0P A;  1AZP A;  4YCW A;  2B2T C;  4DV6 Q;  4EQO A;  4ALP A;  3PO3 B;  1WTV A;  1EY5 A;  3TSS A;  3A74 A;  1STA A;  4B3R L;  4JI2 L;  1TWC H;  1EU4 A;  5IY0 A;  2RSN A;  4A3M B;  4X3K A;  2RA4 A;  1VQJ A;  1A62 A;  4K2L A;  4A3E B;  1S40 A;  1I4G A;  4OO1 G;  4CJ1 B;  1O7L A;  4A3L G;  5C5M A;  1JMC A;  3GTP B;  3STB C;  4LF8 Q;  3T53 B;  1C48 A;  3VA5 A;  1JC7 A;  1MI2 A;  1VDZ A;  3K81 C;  3I91 A;  1J5E Q;  1L1O A;  1O7Z A;  1Y1V G;  2GN5 A;  2RVL A;  5CBE E;  3PIO 3;  5FLM G;  3H0G B;  1X56 A;  3H09 A;  5C3X A;  3KYH C;  1HNW Q;  2X6L A;  2K5V A;  3CCE A;  1BOS A;  2K04 A;  2ZTD A;  4FVM A;  4JI3 L;  1I3Q H;  5BN3 A;  3M3Y H;  1GHK A;  2EXZ A;  1I50 H;  4ABN A;  3MEF A;  4P75 A;  3GTO H;  3BU2 A;  3E3X A;  1O80 A;  3HZX A;  3PMF A;  4BA2 I;  2ZJQ A;  1G6P A;  3NWS A;  4HCE A;  1NR2 A;  1ML0 D;  3PIP A;  3A54 A;  4HTH A;  2O4X A;  4A93 H;  1RKN A;  1IL8 A;  4JI1 L;  1K8M A;  1GOZ A;  2EY5 A;  1JQY D;  4IN3 A;  2FXQ A;  4HN7 A;  1SE8 A;  2I07 B;  3MTS A;  1K8G A;  2VS1 A;  4DV0 Q;  1LTT D;  2LY7 A;  1IW7 C;  1PZJ D;  4LW1 A;  1STE A;  2EDG A;  1SYB A;  4DV1 Q;  4K0K Q;  2L55 A;  2F52 A;  4BXX H;  3BZD B;  2JA8 G;  1IL2 A;  3HOZ G;  3CKI B;  4DV7 L;  4JI2 Q;  4B3R Q;  3I90 A;  1B1Z A;  1N36 Q;  1SSO A;  5IYD G;  3MAQ A;  4JOI C;  3GTQ H;  2PQE A;  2E74 C;  1RCV D;  1HZ9 A;  3ERQ A;  2PI2 A;  4C3I B;  1QVC A;  4HAE A;  4UPA A;  2J0T D;  2JA7 B;  3I8Z A;  1N9W A;  4PMC A;  3SDZ A;  4ZYS A;  2ZJR A;  1Y8O B;  1HCZ A;  1PH2 A;  1HFN A;  3KLS A;  1UEA B;  2N55 A;  1NTG A;  4A3K H;  1FGU A;  2DJG C;  2C5C A;  1II3 A;  1S4Z A;  1HR0 W;  4XTC S;  4DUY L;  4X3S A;  4RFB A;  3ITP A;  4JI8 Q;  3NBH A;  1KRT A;  3HOY G;  4IFD J;  3R2T A;  2IWH A;  2M00 A;  3S1N H;  2F0G A;  5C0X J;  3CC4 A;  3HOX G;  4OHJ A;  2CCZ A;  1JWM D;  2R93 B;  3I4M H;  4IAL A;  1Y8P B;  4CBV A;  4DNI A;  1Q8I A;  1C7Y A;  3HOV G;  4BBR H;  1KDB A;  4DPG A;  5IGC A;  1LTA D;  4GN5 A;  2L15 A;  3PUX A;  1A8V A;  4QF4 A;  4DNR B;  2XIW A;  3JAM L;  1WTO A;  2J4X A;  4Z9C B;  4OWT B;  2F0M A;  4JI1 Q;  2IX3 A;  1TR5 A;  3KDF B;  3W1G A;  3AEV A;  5IGD A;  3H6M A;  3UI2 A;  4ULL A;  2BDO A;  4DR4 L;  1CKM A;  3O13 A;  1O78 A;  4CGY B;  2Z6K A;  2F0I A;  4YCV A;  5DLQ E;  2UU9 L;  4ZCK A;  2AQ3 B;  4LK1 C;  1FL0 A;  1OXS C;  1VF5 C;  4PQX A;  5ELB A;  2F4V Q;  1GM5 A;  4XYO A;  4DV7 Q;  1R9T H;  1HRJ A;  1D6E C;  3GDE A;  4BWG B;  2PW7 A;  3HOU H;  1ILP A;  3D3R A;  1H9S A;  4G4K A;  4BY1 G;  3QIA A;  3D0F A;  2AQ2 B;  3OIP A;  1QJO A;  4UDU C;  4IPC A;  3S14 B;  5D65 A;  2XWB B;  4YCU A;  1CT1 D;  1LYL A;  2NZ1 D;  3GTL H;  4AYB G;  2YTX A;  1F9S A;  1V1P A;  2CH4 A;  4ZLT F;  5LMN W;  1TWG H;  2QEJ C;  2Z9H A;  4OIJ A;  3GO5 A;  3KDF A;  4L8J A;  3K8A A;  2XNA C;  3SK4 A;  4OXP A;  4B9X A;  1JOK A;  2EIF A;  3I4N G;  5LL6 X;  2F0U A;  1PHJ A;  2EYM A;  1KLU D;  4PZ7 A;  5IGB A;  1WOC A;  5CR3 A;  4IQZ A;  2BH8 A;  4IFD G;  2WB1 G;  3W2D A;  4Y7N H;  2EYO A;  1VMC A;  2XRS D;  1LT4 D;  2FHT A;  5LL6 S;  4JI5 L;  4O2D A;  5IT9 c;  1YJN A;  1AE3 A;  1EFI D;  1X6O A;  4WRD A;  2MP1 A;  2A68 D;  5IGG A;  4DV2 L;  1VQB A;  1YVC A;  2WAQ B;  4GKJ L;  2R7D A;  2Q8T A;  2N8N A;  4CDD C;  2RDF A;  3ERO A;  2OTJ A;  2ALY B;  5I9P A;  4DR4 Q;  3M4O H;  1QG7 A;  2NN6 I;  1L0X B;  3NHH A;  4PMW A;  1JWU D;  4BA1 I;  1Q12 A;  2HQL A;  2UU9 Q;  4B08 A;  4HJ8 A;  1HTL D;  2D62 A;  4LUZ A;  2IY5 B;  2B2U C;  1EYD A;  1JWS D;  2Y0S G;  4A3C H;  4AYB E;  2KJX A;  1TWF B;  3UDG A;  1VQL A;  3R2I A;  4X66 L;  4DAM A;  1VQK A;  1KNA A;  1X32 A;  4A3G H;  2QF7 A;  1BCP B;  4B9W A;  3WDN A;  5JJZ A;  4Q5V A;  1E7Z A;  3CME A;  1VQC A;  4K5V A;  3K5M A;  4QUF A;  3EJI A;  2VUM G;  1ICW A;  1EIG A;  1FD7 D;  2WB1 E;  1JCK B;  3EA6 A;  4MN3 A;  4GLX A;  1B53 A;  1Y1W B;  2Q2T A;  1MSG A;  3U9S A;  1Y69 U;  4NMZ A;  4DK3 C;  2K03 A;  4A3D G;  4R9W A;  1JJC B;  5ELD A;  2X6G A;  1PYB A;  1W6K A;  2JA6 H;  2AUJ D;  4B3M Q;  4YWM A;  1DM0 B;  1SRU A;  3S17 H;  1E22 A;  1A2U A;  4XDX A;  3SHL A;  4QY7 A;  4XT1 B;  1C9O A;  2Y0S E;  1HZB A;  2AHO B;  4JI5 Q;  4JI6 L;  2H1E A;  4FF2 A;  5KRU A;  2UXD Q;  5C6A A;  1KAB A;  4DV2 Q;  1IW7 D;  2UUC L;  2E76 C;  4RCN A;  2OEO A;  4GKJ Q;  3ULP A;  1A0I A;  2KUM A;  1E24 A;  3M4Q A;  3DM3 A;  3T56 B;  5C0X I;  4IOA A;  1U4P A;  1HUN A;  2D2C C;  1X54 A;  1NY4 A;  1ENF A;  4YWL A;  2R6G A;  3HFZ B;  5IYC H;  1BDO A;  3OSO A;  2K5N A;  3CF5 A;  4KI0 A;  3QB3 A;  1RDP D;  4BS9 A;  4G7H C;  2E2H B;  4IJL A;  2QEX A;  5CGK A;  3R3O A;  4A3I G;  1KDC A;  4X66 Q;  5C3E B;  2QA4 A;  3Q24 A;  3J80 i;  1TS2 A;  4DN4 M;  3J81 E;  4LF9 L;  1L0W A;  5EKI A;  1A2T A;  2F0J A;  2QW7 A;  1ASZ A;  2KEN A;  4R8I A;  1PZI D;  1WCM H;  1IKM A;  3MXN A;  3RZO B;  2ZTE A;  5I9O A;  4F88 A;  4BY7 H;  2NN6 H;  4LUO A;  4EQP A;  1JB3 A;  1FYC A;  1LM0 A;  2YU9 H;  1BF4 A;  4LF4 Q;  3TBI B;  2FMC A;  3CP0 A;  2IPK D;  1K83 B;  4JW0 A;  3KUP A;  3K7U C;  1L1O C;  3CD6 A;  2PZW A;  5EQ0 A;  4FYD A;  4FDB A;  3E9I A;  1Z7T A;  3P20 A;  1C4Q A;  1M4V A;  3VR2 A;  1KL9 A;  1Q3L A;  5IYB H;  1KC8 C;  1EEI D;  3CRL C;  3FRP B;  3M85 A;  1IBK L;  4P73 A;  2UXC L;  1N34 L;  4JI6 Q;  1SJH D;  1JE4 A;  1ICF B;  1S3O A;  3K5O A;  4FF1 A;  3MWY W;  4XT3 B;  4K2K A;  1PTO C;  2UUC Q;  1F2L A;  1J9O A;  4KD4 A;  4RCO A;  4ZKC B;  3T1Y L;  4C3H H;  2N3S A;  3KLW A;  4OWW B;  2K75 A;  3TP6 A;  4NB3 A;  1SE4 A;  1Y8N B;  2Z6B A;  4HJ5 A;  2VQE L;  3IFT A;  1CZG A;  2ZXP A;  4CDE C;  4A3B H;  1QZG A;  4LAA A;  2BE5 C;  5LMU Q;  3IFD A;  3HOW H;  4KY6 A;  1VQH A;  3S2H B;  4A3J H;  1KRS A;  3MZ5 A;  4LF9 Q;  4LF5 L;  3PO3 H;  4K6L A;  3F2C A;  2BA0 A;  2K50 A;  3PIO A;  4QMG A;  1JT8 A;  3N6R A;  1HUM A;  4A3M H;  3I3C A;  1QOH A;  1B44 D;  2JK8 A;  3FKI H;  5C0X H;  4J1M A;  3A0J A;  2NBF A;  1TWH B;  3RR5 A;  4DXG A;  1XMQ L;  2R92 G;  2E2J B;  3CQZ B;  3CC7 A;  3UDI A;  3U4Z A;  2MGS A;  3GTP H;  2JA8 B;  3HOZ B;  1AEX A;  4DK6 C;  3CPF A;  1K28 A;  3SEB A;  3GV3 A;  1D1I A;  4RHR A;  4G57 A;  2B63 G;  4A93 G;  1EOV A;  2FJ2 A;  1CM9 A;  3H0G H;  3LGJ A;  1O7I A;  1XNR L;  3FHW A;  1VQE A;  5EKL A;  3MVV A;  3ND9 A;  1NJI C;  1IBK Q;  1E1T A;  4WJ4 A;  1BXT A;  4A3F H;  4DA2 A;  3PSI A;  4UP8 A;  1B3Q A;  2UXC Q;  2DGY A;  2PO4 A;  3CXC A;  1N34 Q;  3S24 A;  3S1M B;  1NUC A;  2OTL A;  3NBI A;  1CK1 A;  2A5H A;  2CHB D;  4C2M H;  4GN4 B;  1GUS A;  4JI4 L;  3PGZ A;  3J7Z C;  1E0B A;  3CC2 A;  1YNN C;  2NTS A;  4LFA L;  5IGF A;  3T1Y Q;  5C4J B;  2E2I B;  4R4O A;  2R3Z A;  4MTK A;  3HOY B;  2LXK A;  1S5B D;  2KHJ A;  4YWK A;  1UE5 A;  1SFO B;  3HOX B;  1BBX C;  5IP9 H;  3L2P A;  5AFW A;  1GKH A;  1X55 A;  3QO2 A;  4P2C B;  1R4Q B;  2VQE Q;  1GD7 A;  1YI2 A;  2J7Z A;  3HOV B;  1LTS D;  2Z4H A;  1K0S A;  4HJ9 A;  3DWA A;  1ESR A;  4ME5 A;  3T51 B;  5FLX L;  1HR0 L;  2Z6K C;  3RZD B;  3M4P A;  5FO9 B;  1CA5 A;  1MJE A;  2VB2 X;  1PH5 A;  4K5W A;  4PZ8 A;  1PV4 A;  2MFI A;  2JA5 H;  2RHS B;  4C3J H;  2IX0 A;  4LF5 Q;  3J7A F;  3ER0 A;  1GUN A;  2EYP A;  2OQ0 A;  2KCC A;  3SR1 A;  3EFX D;  3AFQ A;  4NP5 A;  4L5Q A;  2KOL A;  1XMQ Q;  3I4M G;  4HJ7 A;  2IW3 A;  2SOB A;  5E3F A;  2DN8 A;  3JAM i;  3EIV A;  4JBK A;  2EJG C;  4JG2 A;  3VR5 A;  4JCV E;  4EQN A;  1FJG L;  1N33 L;  4L5T A;  2BDN A;  4OEM B;  3CCM A;  1QUQ B;  3TZD A;  4LMQ D;  4R4Q A;  4H02 A;  3LWE A;  3X3M A;  2SNM A;  4CDC C;  5DEH A;  5C44 G;  1LUZ A;  3J80 L;  1TII D;  4IJH A;  2A69 D;  1XNR Q;  5M3F G;  1LTI D;  2JE6 I;  3LWU A;  1D5Z C;  4BY1 B;  2LMC B;  1MIU A;  1V1Q A;  1PH1 A;  1QNK A;  2K52 A;  4HMI A;  4QJF A;  3ND8 A;  1VQ9 A;  4GNX C;  2HCC A;  3W5O A;  5ELN A;  2F0V A;  4PV1 C;  1PH3 A;  2A6H D;  2IX1 A;  3J7A 5;  4AYB B;  4B3S Q;  3AU7 A;  4JI4 Q;  5LHY 1;  3CCL A;  2XRQ D;  4O1N A;  1VQG A;  4LFA Q;  1H9K A;  2VL6 A;  1D5M C;  1S5D D;  4ZRZ A;  3S9W A;  1KXL A;  1WFQ A;  4P71 A;  3NQT A;  4ME3 A;  2R61 A;  5C4X G;  5EBD A;  3QWN A;  4LF6 L;  1LT6 D;  3I4N B;  4AIM A;  4R8N A;  4JBJ A;  1LTB D;  3H94 A;  4KHP L;  1SXT A;  2WB1 B;  1A3U A;  5JPM C;  1RTO A;  3DWP A;  1YIT A;  4H44 C;  1HR0 Q;  3GTG H;  3OPO A;  1BQQ T;  5LMN L;  4FO2 A;  5M5W B;  1EIF A;  1PTO B;  1SMY D;  2V1C C;  5J3B A;  2KVM A;  1D7Q A;  3ZYY X;  4S3S A;  3S2D B;  1DCZ A;  1U4R A;  1SYC A;  1MBY A;  2GVA A;  5IT9 E;  1HNZ L;  2WII B;  2Y0S B;  1FJG Q;  1N33 Q;  5FO7 B;  3M7N A;  2X69 A;  1L0Y B;  2EZV A;  4RAU C;  2A6E C;  3ICE A;  3S14 H;  1EY9 A;  3Q22 A;  2F0E A;  1U4M A;  2A1A A;  2RDG A;  5CV4 A;  2RCN A;  3NQI A;  1LO5 D;  1PTO D;  1JR0 D;  1XXG A;  2VUM B;  3SK6 A;  3D4R A;  1PZK D;  3OTO L;  5JJK A;  1HPC A;  1ENA A;  2VNU D;  3FP9 A;  4G7Z C;  4A3C G;  3PF4 A;  4GOP C;  1FNU A;  5DNF A;  4XQQ A;  1H95 A;  4MIU A;  4C1N K;  1DOL A;  2I46 A;  3N52 A;  4A3D B;  4B3T Q;  2PZT A;  3E6Z X;  1STB A;  4A76 A;  1LT5 D;  2WKD A;  4NKL A;  1GJX A;  2BE5 D;  4LF6 Q;  3CCV A;  3I7F A;  2K28 A;  5JEA J;  1HFG A;  4KHP Q;  2WP8 J;  5I6Y A;  3H3V I;  1STY A;  1EEF D;  1SMX A;  5H1S E;  2I5H A;  4DNT B;  3M9B A;  1MKH A;  3LNN A;  5LMN Q;  3NE5 B;  2B8G A;  3BYT B;  3FDT A;  5EKK A;  1YBY A;  1TWF H;  4OON A;  4UHV A;  3C1F A;  1K9M C;  1E2W A;  1STN A;  1HNX L;  3B6Y A;  3JC6 6;  3P1H A;  1AE2 A;  4ODG A;  2MO1 A;  1VQO A;  5IOD A;  3D8G A;  1HNZ Q;  1CI3 M;  3GTM B;  1M1K C;  4DR7 L;  1U4L A;  3KF6 B;  3T13 A;  4IOC A;  4A3I B;  2DY8 A;  1V43 A;  2NVQ B;  2VXW A;  4JI3 Q;  1I6H B;  1GUO A;  3E9H A;  1A3T A;  5JPN C;  2KA7 A;  1JB7 A;  4CDF C;  1RF2 D;  2JYO A;  1ILQ A;  3KJO A;  2TMP A;  1U0L A;  4NXM L;  1HJP A;  1BR9 A;  3FPU B;  3PO2 G;  1C8C A;  3M7G A;  1EY8 A;  1WJJ A;  1A15 A;  1KIX A;  1ZKO A;  4XIG S;  5IYC G;  5EPJ A;  1SYG A;  2QKI C;  1I94 L;  3NWT A;  3OTO Q;  4CKB A;  1CKN B;  1U9R A;  1MJC A;  3AQQ A;  2PNR C;  5EBC A;  5KGU A;  3Q6S A;  3OHX C;  1Q8K A;  2ICI A;  5FJ8 H;  4K14 A;  2OWO A;  1VMP A;  3MEH A;  4BBS G;  1HZA A;  2A8V A;  1DYQ A;  4V0B A;  2MHV A;  4YIJ A;  1VQ7 A;  1KHI A;  4X65 L;  1EOT A;  4KJN A;  2RF4 A;  4KN7 C;  1W6J A;  4ID6 A;  4BY7 G;  1WTR A;  1NE3 A;  1FNV A;  4GKK L;  1RL2 A;  4CKE A;  2HHH L;  1ENC A;  1TWC B;  2WFW A;  1DOK A;  5JEA G;  3RLN A;  2LKV A;  2NVT H;  5HUR A;  4JI7 L;  1B4O A;  5COY A;  5J22 A;  1HTP A;  4M1U B;  2XTI A;  5IP7 H;  2E2H H;  2E8G A;  2F1M A;  2EY6 A;  2WKC A;  5IYB G;  3KLR A;  1HNX Q;  2R7Z G;  3JAM c;  2HUG A;  5C4H A;  4IO9 A;  1TQO A;  1TVX A;  3CCQ A;  3R8B A;  4DR7 Q;  1WVL A;  3M4Y A;  2F0O A;  2AMC B;  4DUY Q;  3AMU A;  2I5L X;  5I2Y A;  2WV6 D;  3HRZ C;  1Z6H A;  3E0J A;  3H3V H;  1KDA A;  1CA6 A;  4LF7 L;  1IBL L;  3D4D A;  1QZH A;  4OGQ C;  2ZT9 C;  1I3Q B;  4NXM Q;  1OO9 B;  5F2D A;  1B70 B;  1SRO A;  2B2V C;  3R93 A;  1K83 H;  2EXD A;  1CHP D;  2KCM A;  1TKW B;  3L0O A;  3KFU A;  2R92 B;  1PRT C;  4A3L H;  1Z47 A;  1WTW A;  3BZC A;  1WTP A;  4RMF A;  2NTT A;  3OIQ A;  1U5K A;  3NXW A;  5HGQ A;  1Y1V H;  2B39 A;  4N9P A;  5CYU A;  2B63 B;  4A93 B;  5M5Y B;  4F8M A;  5HGT A;  2F0N A;  1CZW A;  3CAM A;  1OXV A;  2CW0 C;  3L3O C;  4TSS A;  2B29 A;  1EWH A;  4HIK A;  4IPD A;  2L0C A;  2QDB A;  3DHQ A;  3FKI G;  2BOS A;  1AH9 A;  1QVG A;  4IPG A;  1BKB A;  2NZH A;  2CQO A;  3PIP 3;  2Q2U A;  3STB D;  3D6W A;  3S1R B;  4GKK Q;  2F03 A;  4KK7 A;  2HHH Q;  4FXK C;  3VA7 A;  3I56 A;  5DM7 3;  2IJ0 A;  4GOP B;  1RTN A;  2ZM6 L;  1V1O A;  2MQH A;  3UDF A;  3PV0 A;  2B2W A;  4RKL A;  4TQU S;  4FXD A;  1BNZ A;  1YZ6 A;  1VF7 A;  4RGO S;  1X3P A;  1YHB A;  1ESF A;  4JVZ A;  3S2H H;  4AH6 A;  4CHT B;  1CUK A;  2Q2H A;  1N8R C;  2A6E D;  4Q0F A;  4A3F G;  1BBW A;  1VQ6 A;  1DON A;  4GLV B;  2JJQ A;  1GUG A;  1JOQ A;  3CCR A;  2L12 A;  1WD1 A;  5K36 G;  3J7Y W;  3ERS X;  5CBA E;  5ELC A;  1TWH H;  2NVX B;  2E2J H;  3KLS X;  2PW5 A;  4DV5 L;  4LF7 Q;  1GXD C;  1IBL Q;  2JA8 H;  4DV3 L;  3HOZ H;  1OXU A;  4I7Z C;  2M2L A;  1EY4 A;  3AB9 A;  1B8A A;  5IYD H;  4EVO A;  2Z0S A;  3I4M B;  3K6O A;  1EUJ A;  2LS0 1;  4QCL A;  1LT3 D;  2N49 A;  3S1Q H;  5A2Q E;  4QL5 A;  3J81 i;  1FR3 A;  4IFD I;  1SNQ A;  1B7Y B;  3CHB D;  2YTY A;  4X62 L;  4A4I A;  4HID A;  2KCN A;  2ZXR A;  2K01 A;  1ONL A;  5ELE A;  3S15 B;  1SLJ A;  2F0W A;  2M9V A;  3S1M H;  5COR A;  2JA5 G;  1DXM A;  4C3J G;  5C44 B;  4DR1 L;  3A7A B;  5A35 A;  1X3Q A;  4X6A H;  1G2T A;  4LNQ A;  5M3F B;  2I0Q A;  4R4I A;  3G4S A;  1HH2 P;  3F1Z A;  4X3U A;  2PI2 E;  5C4J H;  3K7A H;  1D5X C;  4ILW A;  3HOY H;  1NBW A;  2OF1 A;  3TRE A;  1VCI A;  2IL8 A;  2NYZ D;  3HOX H;  1SFO H;  4PG3 A;  1QWY A;  1XWE A;  1CTM A;  1R9T B;  4CJ0 B;  1IKL A;  5M3M G;  3WOF A;  5JJL A;  1SE2 A;  4JOI A;  3NPP A;  2ZM6 Q;  4WJ3 M;  1J6Q A;  3T16 A;  2YV5 A;  1QVF A;  5M5X B;  5C4X B;  3RZD H;  1PVO A;  2K5H A;  2N88 A;  2BH2 A;  2AWO A;  3MHB A;  1QNU A;  4JK1 C;  2SDF A;  1XNQ L;  1G6Z A;  2R7F A;  1PRT F;  2G9D A;  1IYU A;  3URY A;  4IUU A;  1AN8 A;  1HQM C;  4RHS A;  3BS1 A;  3PQI A;  2NZO A;  4DV5 Q;  3V96 A;  5JOB A;  2P5Z X;  4DV3 Q;  2DNE A;  3SVM A;  3AFP A;  1PFS A;  4EQ5 A;  1K3R A;  1QCB D;  3ONA B;  2MUY A;  2XN9 C;  1BBU A;  2RSO A;  4U68 A;  3UE1 A;  1TS5 A;  2ES2 A;  5TSS A;  1S5E D;  4PZ6 A;  2EYJ A;  4BY1 H;  1B2T A;  3A8I E;  3J81 j;  4HMJ A;  3G48 A;  4X62 Q;  3K80 C;  5K5P A;  3NK9 A;  1XX8 A;  2PNH A;  3NEN A;  3K5L A;  2XGT A;  1KTK A;  2G9H D;  1SEB D;  1CQV A;  1YHQ A;  3M4O B;  1RIP A;  3ULJ A;  3QR8 A;  5J39 A;  2UUB L;  3X3N A;  5ELO A;  3VYU A;  1G8Z D;  3TS0 A;  1PRT B;  3I4N H;  1HQR D;  1K8O A;  2PYK A;  1K0R A;  2QCP X;  3CCJ A;  3Q0A A;  2AWN A;  4IFD H;  2ZTC A;  4TVA B;  4A3E H;  2EVB A;  1PH7 A;  3FVQ A;  1PYS B;  1XNQ Q;  1B3A A;  1SNC A;  3SGI A;  3MXU A;  5M5W H;  1EL0 A;  4DAY B;  3NTH A;  3TP5 A;  2H5X A;  1IZ6 A;  4HIM A;  1DZ1 A;  2B8F A;  3S2D H;  1J8I A;  3F2D A;  3G71 A;  1I4X A;  1KQS A;  1UNS A;  1PRT D;  4FF3 A;  1Q7Y C;  2JA6 B;  5KIX A;  1UAP A;  4MNO A;  1B9N A;  3HEJ A;  1STH A;  2HDM A;  4BXX G;  4DR6 L;  2Q8R E;  3VYT A;  3LX0 A;  4O42 A;  1O7Y A;  4OX9 L;  4QQB X;  2CW0 D;  1TXY A;  3TEH B;  4DR3 L;  2VUM H;  5D3D A;  3NP8 A;  2JEB I;  3H91 A;  4U67 3;  2GA4 B;  1PH9 A;  1FVI A;  2L4N A;  3IRB A;  4KTA A;  1S5C D;  1SYE A;  4HED A;  1L2F A;  5EGT A;  1YNJ C;  5BR8 L;  3RD4 A;  4DV4 L;  3PO2 B;  2PQA B;  3HKS A;  1OXT A;  3G6E A;  1PXU A;  4A3D H;  5L37 A;  2UUB Q;  2OXP A;  2BCO A;  4A3K G;  2JA9 A;  4R4T A;  3K5N A;  2FFK B;  1G29 1;  2G5D A;  1NCV A;  3Q8D A;  1S5F D;  1TWA B;  5E4X A;  4P72 A;  1JOR A;  2EOT A;  1QIL A;  2YYZ A;  3J81 L;  1M90 C;  1BUV T;  4BBS B;  3DEP A;  3NUC A;  5FKA C;  4IUV A;  1F2Z A;  5IIF A;  1E2V A;  4RGN A;  4YY3 L;  1T5X D;  2XWJ B;  1VS0 A;  2RCF A;  2CWA A;  1NMG A;  3QJY A;  4C3I H;  4BBR G;  4BY7 B;  2F0D A;  4DFA A;  3HS0 C;  2JA7 H;  3HP3 A;  1HA5 A;  2SEB D;  1ZYR C;  1PLF A;  2K5W A;  2LXJ A;  1AFP A;  3PUZ A;  4MTN A;  1IHZ A;  1E2Z A;  5J1Z A;  3IKJ A;  5CV8 A;  1VQF A;  3GTM H;  1W2B A;  1QE6 A;  4DR5 L;  1EY7 A;  3RLO A;  3HG9 A;  2JP1 A;  5FLX c;  4KHZ A;  2F3W A;  5C5L A;  1B50 A;  2R7Z B;  2A19 A;  2F0S A;  4DR6 Q;  1IYJ B;  1I5F A;  2D9U A;  3GV6 A;  3RN5 A;  3I70 A;  4OX9 Q;  1F2Y A;  5HY6 A;  2R93 H;  4XXE A;  3J81 c;  3PUV A;  2EYL A;  1JIC A;  4L5R C;  3DWQ A;  4DR3 Q;  4HJA A;  3PCO B;  3P75 A;  3HOU G;  1KLG D;  2L5T A;  1L1O B;  1CKO A;  2F0H A;  1XPU A;  1EWI A;  3S16 B;  1LLR D;  3KF8 B;  1KAA A;  2EQS A;  5IP7 G;  1R4P B;  2VZA A;  4QIW E;  2KHS A;  5D14 A;  4OL7 A;  5BR8 Q;  4DV4 Q;  3PUW A;  4ZUI A;  5CC4 A;  1V8Q A;  5CV7 A;  3MFG A;  3W3A A;  5I2X A;  4KV6 A;  1T9H A;  1AW7 A;  3OW7 A;  3BVM A;  2PCF B;  3J80 c;  3OMC A;  5AJ3 L;  1QUQ A;  5KNC A;  1TS4 A;  4NDX A;  3VR4 A;  4R4C A;  2A68 C;  1EWC A;  2UXB L;  1P16 A;  5CV5 A;  4DV1 L;  4RGT A;  4A3J B;  1VQA A;  2IHF A;  2KQ3 A;  1SAP A;  1AZQ A;  1SE3 A;  4PMB A;  4YY3 Q;  1N36 L;  1I4H A;  3FKI B;  4X3T A;  5EJW A;  1K8A C;  3SE0 A;  2A74 C;  2CQA A;  4JI0 L;  1LTL A;  3NSW A;  2XVS A;  2B2W C;  2HDL A;  1DJR D;  3BYY B;  5GAH C;  4KLK A;  2RHQ B;  3K58 A;  3T1H L;  2F0K A;  3KF8 A;  3WWV A;  5JAV A;  4DR5 Q;  3BJU A;  1D2B A;  1A3V A;  1Q82 C;  4UP9 A;  1SNM A;  5CMD A;  2XSC A;  2EY1 A;  3ZJY C;  4JI8 L;  4NW2 A;  4XYQ A;  3U50 C;  4A3F B;  4L63 B;  2HQE A;  1EIY B;  5M9O A;  1V9P A;  3HKZ E;  2O5J C;  3NEM A;  1EYG A;  2R92 H;  4C2M B;  4A3G G;  2CFM A;  1I6V C;  5I6W A;  4DK0 A;  1RHP A;  3I2Z A;  4GN3 B;  4WOR A;  4RG1 A;  2B63 H;  2PMZ E;  5M5Y H;  1MSH A;  4N9T A;  1BCP C;  3NBH B;  2HCI A;  1PFB A;  5ELF A;  2NVY B;  4LFB L;  5AJ3 Q;  1PH6 A;  2JEA I;  3QOL A;  1EZ6 A;  3BDL A;  3L7Z C;  3UE0 A;  1UE1 A;  3EQL C;  2EYF A;  2IT1 A;  2UXB Q;  2VW9 A;  3SK5 A;  2ZJP A;  1F77 A;  2JA6 G;  3GTK B;  3BDC A;  4RWS C;  3S1R H;  3IAY A;  2HIV A;  2JA5 B;  4C3J B;  1Y14 B;  2F4V L;  4OO1 I;  1GVP A;  1SYF A;  1XMO L;  1SND A;  3V2T A;  1UUP A;  2EYH A;  4WFN 3;  2UUA L;  1VQP A;  3Q23 A;  4JI0 Q;  2E5L L;  2K33 A;  1NR4 A;  1E3P A;  3K0Y A;  1UE7 A;  1GUW A;  5M3M B;  3GTJ B;  3DXJ C;  3T1H Q;  1Y1W H;  4K6D A;  1B9M A;  1EY6 A;  3FEW X;  2QDL A;  3TME A;  2F0Q A;  2FMM A;  3V05 A;  4A75 A;  2NVX H;  1YNN D;  2Z1C A;  1I4P A;  5JVG 3;  4Y52 H;  1ZXT A;  1NSN S;  2K05 A;  1X3E A;  4TKO B;  1ET9 A;  3TS2 A;  1UE6 A;  3A8J E;  1F2M A;  4K8I A;  1H9S B;  3BDO A;  1YNJ D;  2BA1 A;  3KBX A;  3FMC A;  4ZQ3 A;  3KJP A;  4OEL B;  3VR6 A;  4DKA C;  1I4R A;  5KYI A;  4KN4 C;  1WCM G;  1ROD A;  2DJF C;  2LSS A;  4GZY C;  5IOC A;  1V1P B;  2WAC A;  4L6T B;  4HIO A;  5EPK A;  2NN6 G;  3S15 H;  1VQM A;  1ET6 A;  3F8T A;  4LJZ C;  4ZUJ A;  1RJT A;  4KJO A;  5C44 H;  3RN2 A;  2ENB A;  4R1J A;  2PZU A;  2CVR A;  1GUT A;  3KF6 A;  4J15 A;  4LFB Q;  5G3L F;  4GNX B;  3DMU A;  5GRO A;  5M3F H;  3H3V C;  3CCU A;  3GP7 A;  3GTG B;  2JSO A;  5KND A;  1IBM L;  5JVH 3;  4H7B A;  5C3E H;  4MHE A;  2O2L D;  2RDH A;  1ZYR D;  4AQY L;  1XMO Q;  2L1B A;  1Q90 A;  2VQF L;  3I72 A;  3SXH A;  2UUA Q;  1CKN A;  4IPH A;  2E5L Q;  1PFM A;  5IT9 L;  3RZO H;  4QB4 A;  5M5X H;  3NEL A;  1A63 A;  5C4X H;  4UP7 A;  4E6I A;  1YJ9 A;  3A7L A;  1AP0 A;  1PMR A;  3DUZ A;  2OCE A;  4UAI A;  3I4O A;  3U4V A;  1JE5 A;  1EZ8 A;  4C3H G;  2MJ8 A;  3M3Y B;  4H0L C;  2B2Y A;  2RKS A;  5T1I A;  5T1G A;  1I50 B;  1X3F A;  5EPL A;  3L9A X;  1ASY A;  2CH4 W;  2K1B A;  2C9O A;  3GTO B;  1TT2 A;  2WIN B;  1DD2 A;  3D31 A;  4OO1 H;  2DUD A;  1I94 Q;  4A3B G;  1BCP F;  4XQJ A;  1MD2 D;  5FO8 B;  3MFY A;  4DGZ A;  1HHV A;  4B3M L;  3HOW G;  2Z8L A;  4P74 A;  4GNX A;  2MNA A;  4RGM A;  4JPB W;  3OW2 A;  4G7O C;  3OYY A;  4POF A;  4L5S A;  4A3J G;  3I4L A;  1CSP A;  5FLM H;  3DLL A;  1EIH A;  3PO3 G;  3K57 A;  2KED A;  5BN5 A;  1WI5 A;  2L11 A;  4A3M G;  1CHQ D;  4X65 Q;  4A3E G;  3TQY A;  1D1K A;  5C0X G;  1ZEQ X;  3MXP A;  2UXD L;  3I55 A;  1H9R A;  2ATW A;  2B2T A;  3BZK A;  5D3I B;  3F2U A;  1SR3 A;  3TZU A;  1VQD A;  3TP7 A;  4JI7 Q;  4O0A A;  2F3I A;  2K14 A;  3GTQ B;  5DAU A;  2KBN A;  1X65 A;  1WTQ A;  3OWF A;  1NMF A;  4JBM A;  2O5I C;  1C0A A;  3H0G G;  1IBM Q;  2H4O A;  4IUQ A;  1XYI A;  4DAV A;  5G3L D;  4V19 0;  4POG A;  4AQY Q;  3A5U A;  3OOC A;  1Q81 C;  1SNP A;  4N8X 1;  1EQR A;  4C1N I;  2D5D A;  2VQF Q;  5C3W A;  2HD3 A;  2TSS A;  2F0T A;  3D6C A;  4A3K B;  3NTK A;  1LAB A;  3PF5 A;  1IXR A;  4I7A A;  4X64 L;  3HGB A;  5EAY A;  1Q1E A;  3CQZ H;  2L9H A;  3AYH B;  1TY2 A;  4M8A A;  3C2P A;  4IUP A;  2HT1 A;  3S1N B;  4APV A;  3CW2 C;  4LF4 L;  1Q1B A;  5IP9 G;  1SN8 A;  5NUC A;  3RUZ A;  4QIW B;  4K5X A;  1I4Q A;  2E2D C;  3MC0 B;  3W1B A;  3QOJ A;  3KOJ A;  4BBR B;  1Z9F A;  2F4I A;  1F9R A;  2JN4 A;  1DOM A;  2ZXO A;  5FOB B;  1PDQ A;  1LTG D;  2QIL A;  1VQ4 A;  3MXN B;  4GOP A;  2DNC A;  1HA6 A;  3H15 A;  3A8K E;  4ZKB B;  2F0L A;  1BCP D;  3OMG A;  4RA8 A;  2KEC A;  1SDF A;  1XPR A;  2A69 C;  3MA2 B;  1EQV A;  3G6J B;  4PNY A;  4MZ9 A;  2ICE C;  1T5E A;  2E2I H;  1QB5 D;  1XPO A;  4DAP A;  4C3I G;  1LTR D;  2EJM A;  1K73 C;  4J6H A;  1W3S A;  2JA7 G;  3UDX A;  1STG A;  3C1E A;  5E4W C;  4DR2 L;  1H9M A;  2A6H C;  2VY3 A;  3PO2 H;  4LWC A;  3KBG A;  5CV9 A;  4HCS A;  1WTX A;  3HOV H;  3HOU B;  4GLA C;  1TY0 A;  2K6A A;  2NVT B;  4WJW A;  1EQQ A;  2Q8I B;  1TWA H;  2VB3 X;  5DM6 3;  5FLX E;  3A55 A;  1KNE A;  3BVG A;  3TDQ A;  5LMU L;  1EQT A;  1JOO A;  3TN2 A;  3E0E A;  2MPM A;  2D0O A;  3T4A C;  1PH4 A;  4BBS H;  5CV6 A;  3GTL B;  3C46 A;  3ULL A;  1YHA A;  2R93 G;  4X64 Q;  2HIX A;  1SYD A;  2EJF C;  1TWG B;  4KMU C;  3HKZ B;  2V4D A;  5E7N A;  4F7X A;  1CFM A;  2ASB A;  3QG1 A;  1SMY C;  1YIJ A;  1NAP A;  3IL8 A;  4KKS A;  1TU2 B;  5JEA H;  1SBB B;  3DEO A;  1FGB D;  1WYD A;  3J80 E;  5KNB A;  5KYL A;  4Y7N B;  1EFW A;  2PMZ B;  4EGV A;  1H9J A;  1Q46 A;  1DGS A;  3RMH A;  3RLF A;  1YEZ A;  2A73 B;  4ZAI A;  1LAC A;  2R7Z H;  2RQX A;  4OIK A;  4DR1 Q;  3A5Z B;  1Y1V B;  1VQ5 A;  1UEB A;  3VDY A;  1IYV A;  3RNU A;  3CCS A;  4JYA L;  4JBW A;  1UWV A;  5GAG C;  4UY8 C;  1VQI A;  4KKT A;  1EY0 A;  1TS3 A;  5ISR A;  3S16 H;  3I73 A;  3TP8 A;  4NXN L;  5GQO A;  3CMA A;  2KHI A;  2OQK A;  5JJI A;  4DR2 Q;  4JV5 L;  4DUZ L;  3CU7 A;  4KHV A;  1P8L A;  4KY5 A;  1G91 A;  4A3G B;  1SNO A;  2E75 C;  2CKZ B;  1JJG A;  3VR3 A;  2C35 B;  4TRD A;  1FNW A;  1PFN A;  1PTO H;  2DY7 A;  5I4D A;  2I5M X;  1BVS A;  1OXX K;  3VYS A;  1WTH A;  2CWP A;  4CJ2 C;  1JJ2 A;  1N32 L;  4EX5 A;  2YTV A;  3BG3 A; 
#chains in the Genus database with same CATH homology
 1PYW D;  4I65 A;  3BVZ A;  3MXG A;  2KEE A;  3S17 B;  4CKC A;  2B2V A;  4FF4 A;  1F9P A;  4IUR A;  2NB0 A;  2PPB C;  2K7V A;  4DXF A;  2JXM B;  5A2Q L;  4C56 C;  3S1Q B;  3J7A V;  2F3V A;  4HSV A;  3C3L A;  1XTC D;  4IUT A;  2RBM A;  4IUN A;  2Z4I A;  2FIN B;  1EU3 A;  5K36 H;  1EYA A;  5C4Z A;  1HXY D;  2B2U A;  3CRK C;  3GD7 A;  4DAY A;  4IZ8 A;  2LFN A;  4FXG C;  4RKB A;  2K5D A;  4KD3 A;  2F0P A;  3NTI A;  3K7A B;  1BO0 A;  3OWE B;  2NWG A;  2EPB A;  4J8Q A;  3P7J A;  3U9O A;  4DK1 A;  2AUK A;  3GQB A;  4RH6 A;  4QUC A;  1CQF A;  1WCM B;  1WD0 A;  1RD9 D;  2SNS A;  2K5Q A;  2OT2 A;  3FPP A;  2YU9 B;  3SK8 A;  2EE1 A;  4FP5 D;  4DU9 A;  3A56 A;  2F0F A;  4HSP A;  2ID0 A;  2NUC A;  1F9Q A;  3G7L A;  3VYR A;  3PUY A;  1LV9 A;  1MGS A;  1EYC A;  5FK9 C;  4KKU A;  1A6X A;  1PTO F;  4KY7 A;  2B2Y C;  4K8J A;  3DM1 A;  5KEE A;  5BN4 A;  3WOE A;  4C3H B;  5E1F A;  3JAM E;  3D4W A;  4ZK9 B;  3E5S A;  2EY2 A;  3EVQ A;  3KK7 A;  3K59 A;  1SJE D;  1M8A A;  4FNF A;  4A3B B;  4HR7 B;  5IGE A;  1G2S A;  4H13 C;  4F87 A;  2AQ1 B;  4DF7 A;  3HOW B;  1GHJ A;  2K32 A;  4XQN A;  1AZP A;  2B2T C;  4EQO A;  3PO3 B;  1WTV A;  1EY5 A;  3TSS A;  1STA A;  1EU4 A;  2RSN A;  4A3M B;  4X3K A;  2RA4 A;  4K2L A;  4A3E B;  1I4G A;  4OO1 G;  4CJ1 B;  1O7L A;  5C5M A;  3GTP B;  3T53 B;  1C48 A;  3VA5 A;  1JC7 A;  1MI2 A;  1VDZ A;  3I91 A;  1O7Z A;  2RVL A;  5CBE E;  3PIO 3;  3H0G B;  3H09 A;  5C3X A;  2X6L A;  1BOS A;  2K04 A;  4FVM A;  5BN3 A;  1GHK A;  2EXZ A;  4ABN A;  1O80 A;  3HZX A;  3PMF A;  4BA2 I;  3NWS A;  4HCE A;  1NR2 A;  1ML0 D;  3A54 A;  4HTH A;  2O4X A;  1RKN A;  1IL8 A;  1K8M A;  1GOZ A;  2EY5 A;  1JQY D;  4IN3 A;  4HN7 A;  2I07 B;  3MTS A;  1LTT D;  2LY7 A;  1IW7 C;  1PZJ D;  1STE A;  2EDG A;  1SYB A;  2L55 A;  3BZD B;  3CKI B;  3I90 A;  1B1Z A;  1SSO A;  3MAQ A;  2PQE A;  2E74 C;  1RCV D;  3ERQ A;  4C3I B;  4HAE A;  2J0T D;  2JA7 B;  3I8Z A;  4PMC A;  3SDZ A;  4ZYS A;  1Y8O B;  1HCZ A;  1HFN A;  3KLS A;  1UEA B;  2N55 A;  2C5C A;  1II3 A;  1S4Z A;  4XTC S;  4X3S A;  4RFB A;  3ITP A;  3NBH A;  4IFD J;  3R2T A;  2IWH A;  2M00 A;  2F0G A;  5C0X J;  4OHJ A;  1JWM D;  2R93 B;  4IAL A;  1Y8P B;  4CBV A;  1Q8I A;  1KDB A;  5IGC A;  1LTA D;  3PUX A;  4QF4 A;  4DNR B;  2XIW A;  3JAM L;  1WTO A;  2J4X A;  4Z9C B;  2F0M A;  2IX3 A;  1TR5 A;  5IGD A;  3H6M A;  3UI2 A;  4ULL A;  2BDO A;  3O13 A;  1O78 A;  4CGY B;  2F0I A;  2AQ3 B;  4LK1 C;  1OXS C;  1VF5 C;  4PQX A;  5ELB A;  4XYO A;  1HRJ A;  1D6E C;  4BWG B;  2PW7 A;  1ILP A;  3D3R A;  1H9S A;  4G4K A;  3QIA A;  2AQ2 B;  3OIP A;  1QJO A;  4UDU C;  3S14 B;  5D65 A;  2XWB B;  1CT1 D;  2NZ1 D;  1F9S A;  1V1P A;  4ZLT F;  2QEJ C;  4OIJ A;  3GO5 A;  4L8J A;  2XNA C;  3SK4 A;  4B9X A;  1JOK A;  5LL6 X;  2F0U A;  2EYM A;  1KLU D;  5IGB A;  5CR3 A;  4IQZ A;  4IFD G;  3W2D A;  2EYO A;  1VMC A;  2XRS D;  1LT4 D;  2FHT A;  5LL6 S;  1EFI D;  5IGG A;  4WRD A;  2MP1 A;  2A68 D;  2WAQ B;  2Q8T A;  2RDF A;  3ERO A;  5I9P A;  1QG7 A;  2NN6 I;  1L0X B;  3NHH A;  4PMW A;  1JWU D;  4BA1 I;  1Q12 A;  4B08 A;  1HTL D;  2D62 A;  2B2U C;  1EYD A;  1JWS D;  2KJX A;  1TWF B;  3R2I A;  1KNA A;  1X32 A;  2QF7 A;  1BCP B;  4B9W A;  3WDN A;  5JJZ A;  4Q5V A;  4K5V A;  3K5M A;  4QUF A;  3EJI A;  1ICW A;  1EIG A;  1FD7 D;  1JCK B;  3EA6 A;  4MN3 A;  1B53 A;  1Y1W B;  1MSG A;  3U9S A;  1Y69 U;  4NMZ A;  2K03 A;  4R9W A;  5ELD A;  2X6G A;  1W6K A;  2AUJ D;  1DM0 B;  1A2U A;  4XDX A;  3SHL A;  4XT1 B;  2H1E A;  4FF2 A;  5KRU A;  5C6A A;  1KAB A;  1IW7 D;  2E76 C;  4RCN A;  2OEO A;  2KUM A;  5C0X I;  3T56 B;  1U4P A;  1HUN A;  2D2C C;  1ENF A;  2R6G A;  1BDO A;  3OSO A;  4KI0 A;  3QB3 A;  1RDP D;  4BS9 A;  4G7H C;  2E2H B;  5CGK A;  3R3O A;  1KDC A;  5C3E B;  3Q24 A;  1TS2 A;  4DN4 M;  3J81 E;  5EKI A;  1A2T A;  2F0J A;  4R8I A;  1PZI D;  1IKM A;  3MXN A;  3RZO B;  5I9O A;  4F88 A;  2NN6 H;  4EQP A;  1JB3 A;  1FYC A;  1BF4 A;  3TBI B;  2FMC A;  2IPK D;  1K83 B;  3KUP A;  2PZW A;  5EQ0 A;  4FYD A;  3P20 A;  1Z7T A;  1C4Q A;  1M4V A;  3VR2 A;  1Q3L A;  1EEI D;  3CRL C;  3FRP B;  3M85 A;  1SJH D;  1JE4 A;  3K5O A;  4FF1 A;  3MWY W;  4XT3 B;  4K2K A;  1PTO C;  1F2L A;  1J9O A;  4KD4 A;  4RCO A;  4ZKC B;  3TP6 A;  1SE4 A;  1Y8N B;  3IFT A;  1CZG A;  2ZXP A;  4LAA A;  2BE5 C;  3IFD A;  4KY6 A;  3S2H B;  3MZ5 A;  4K6L A;  2BA0 A;  4QMG A;  3N6R A;  1HUM A;  3I3C A;  1QOH A;  1B44 D;  5C0X H;  4J1M A;  2NBF A;  1TWH B;  4DXG A;  2E2J B;  3CQZ B;  2MGS A;  2JA8 B;  3HOZ B;  1AEX A;  3SEB A;  3GV3 A;  1D1I A;  4RHR A;  4G57 A;  2FJ2 A;  1CM9 A;  5EKL A;  3MVV A;  3ND9 A;  1BXT A;  4DA2 A;  2PO4 A;  3S1M B;  1NUC A;  3NBI A;  1CK1 A;  2A5H A;  2CHB D;  1GUS A;  1E0B A;  1YNN C;  2NTS A;  5IGF A;  5C4J B;  2E2I B;  2R3Z A;  3HOY B;  1S5B D;  1SFO B;  3HOX B;  1BBX C;  5AFW A;  3QO2 A;  4P2C B;  1R4Q B;  2J7Z A;  3HOV B;  1LTS D;  2Z4H A;  3DWA A;  1ESR A;  4ME5 A;  3T51 B;  5FLX L;  3RZD B;  1CA5 A;  5FO9 B;  2VB2 X;  4K5W A;  2IX0 A;  3J7A F;  1GUN A;  2EYP A;  2KCC A;  3SR1 A;  3EFX D;  4NP5 A;  2KOL A;  2IW3 A;  2SOB A;  5E3F A;  2DN8 A;  2EJG C;  3VR5 A;  4EQN A;  2BDN A;  3TZD A;  4LMQ D;  3LWE A;  3X3M A;  2SNM A;  5DEH A;  3J80 L;  1TII D;  2A69 D;  1LTI D;  2JE6 I;  3LWU A;  1D5Z C;  4BY1 B;  2LMC B;  1QNK A;  4HMI A;  3ND8 A;  2HCC A;  2F0V A;  4PV1 C;  2IX1 A;  2A6H D;  4AYB B;  3AU7 A;  5LHY 1;  2XRQ D;  4O1N A;  1H9K A;  1D5M C;  1S5D D;  4ZRZ A;  3S9W A;  3NQT A;  2R61 A;  5EBD A;  3QWN A;  1LT6 D;  3I4N B;  4R8N A;  1LTB D;  3H94 A;  1SXT A;  2WB1 B;  1A3U A;  5JPM C;  1RTO A;  3DWP A;  4H44 C;  3OPO A;  1BQQ T;  4FO2 A;  5M5W B;  1PTO B;  1SMY D;  2KVM A;  3ZYY X;  4S3S A;  3S2D B;  1DCZ A;  1U4R A;  1SYC A;  1MBY A;  5IT9 E;  2WII B;  2Y0S B;  5FO7 B;  3M7N A;  2X69 A;  1L0Y B;  2EZV A;  4RAU C;  2A6E C;  1EY9 A;  3Q22 A;  2F0E A;  1U4M A;  2RDG A;  5CV4 A;  3NQI A;  1LO5 D;  1PTO D;  1JR0 D;  1XXG A;  2VUM B;  3SK6 A;  3D4R A;  1PZK D;  1HPC A;  1ENA A;  2VNU D;  4G7Z C;  1FNU A;  5DNF A;  4XQQ A;  4MIU A;  4C1N K;  1DOL A;  2I46 A;  3N52 A;  4A3D B;  2PZT A;  3E6Z X;  1STB A;  1LT5 D;  2WKD A;  4NKL A;  1GJX A;  2BE5 D;  2K28 A;  5JEA J;  1HFG A;  2WP8 J;  5I6Y A;  1STY A;  1EEF D;  4DNT B;  3LNN A;  3NE5 B;  2B8G A;  3BYT B;  3FDT A;  5EKK A;  3C1F A;  1E2W A;  1STN A;  3P1H A;  4ODG A;  5IOD A;  3D8G A;  1CI3 M;  3GTM B;  1U4L A;  3T13 A;  4A3I B;  2DY8 A;  1V43 A;  2NVQ B;  2VXW A;  1I6H B;  1GUO A;  1A3T A;  5JPN C;  2KA7 A;  1RF2 D;  2JYO A;  1ILQ A;  2TMP A;  1BR9 A;  3FPU B;  1C8C A;  3M7G A;  1EY8 A;  1A15 A;  1ZKO A;  4XIG S;  5EPJ A;  1SYG A;  2QKI C;  3NWT A;  4CKB A;  1U9R A;  2PNR C;  5EBC A;  5KGU A;  3Q6S A;  3OHX C;  2ICI A;  4K14 A;  1VMP A;  3MEH A;  1DYQ A;  4V0B A;  2MHV A;  4YIJ A;  1EOT A;  4KJN A;  4KN7 C;  1W6J A;  4ID6 A;  1WTR A;  1FNV A;  4CKE A;  1ENC A;  1TWC B;  5JEA G;  1DOK A;  2LKV A;  5HUR A;  1B4O A;  5COY A;  5J22 A;  1HTP A;  4M1U B;  2F1M A;  2EY6 A;  2WKC A;  3KLR A;  2HUG A;  5C4H A;  1TQO A;  1TVX A;  3R8B A;  1WVL A;  3M4Y A;  2F0O A;  3AMU A;  5I2Y A;  2WV6 D;  3HRZ C;  1Z6H A;  3E0J A;  1KDA A;  1CA6 A;  3D4D A;  4OGQ C;  2ZT9 C;  1I3Q B;  1OO9 B;  5F2D A;  2B2V C;  3R93 A;  1CHP D;  1TKW B;  2R92 B;  1PRT C;  1Z47 A;  1WTW A;  1WTP A;  2NTT A;  3OIQ A;  3NXW A;  2B39 A;  4N9P A;  5CYU A;  2B63 B;  4A93 B;  5M5Y B;  4F8M A;  5HGT A;  2F0N A;  1CZW A;  1OXV A;  2CW0 C;  3L3O C;  4TSS A;  1EWH A;  2L0C A;  2QDB A;  3DHQ A;  2BOS A;  3PIP 3;  3D6W A;  3S1R B;  2F03 A;  4KK7 A;  4FXK C;  3VA7 A;  5DM7 3;  2IJ0 A;  1RTN A;  1V1O A;  3PV0 A;  2B2W A;  4RKL A;  4TQU S;  4FXD A;  1BNZ A;  1VF7 A;  4RGO S;  1X3P A;  1ESF A;  4CHT B;  2A6E D;  4Q0F A;  1DON A;  1GUG A;  1JOQ A;  2L12 A;  1WD1 A;  5K36 G;  3J7Y W;  5CBA E;  5ELC A;  2NVX B;  3KLS X;  2PW5 A;  1GXD C;  1OXU A;  4I7Z C;  2M2L A;  1EY4 A;  3AB9 A;  4EVO A;  3I4M B;  3K6O A;  4QCL A;  2LS0 1;  1LT3 D;  5A2Q E;  1FR3 A;  4IFD I;  1SNQ A;  3CHB D;  2KCN A;  2ZXR A;  2K01 A;  1ONL A;  5ELE A;  3S15 B;  2F0W A;  2M9V A;  5COR A;  1DXM A;  4C3J G;  5C44 B;  3A7A B;  5A35 A;  1X3Q A;  1G2T A;  5M3F B;  4X3U A;  1D5X C;  4ILW A;  2OF1 A;  1VCI A;  2IL8 A;  2NYZ D;  1QWY A;  1XWE A;  1CTM A;  1R9T B;  4CJ0 B;  1IKL A;  3WOF A;  1SE2 A;  3NPP A;  3T16 A;  5M5X B;  5C4X B;  2N88 A;  2AWO A;  3MHB A;  1QNU A;  4JK1 C;  2SDF A;  1G6Z A;  1PRT F;  2G9D A;  1IYU A;  3URY A;  4IUU A;  1AN8 A;  1HQM C;  4RHS A;  3BS1 A;  3V96 A;  5JOB A;  2DNE A;  3SVM A;  1QCB D;  3ONA B;  2MUY A;  2XN9 C;  2RSO A;  4U68 A;  1TS5 A;  5TSS A;  1S5E D;  2EYJ A;  1B2T A;  3A8I E;  4HMJ A;  5K5P A;  3NK9 A;  1XX8 A;  3K5L A;  1KTK A;  2G9H D;  1SEB D;  1CQV A;  3M4O B;  5J39 A;  3X3N A;  3VYU A;  1G8Z D;  1PRT B;  1HQR D;  1K8O A;  2PYK A;  2QCP X;  3Q0A A;  2AWN A;  4IFD H;  2EVB A;  3FVQ A;  1B3A A;  1SNC A;  3MXU A;  1EL0 A;  3NTH A;  3TP5 A;  1DZ1 A;  2B8F A;  1J8I A;  1I4X A;  1UNS A;  1PRT D;  4FF3 A;  2JA6 B;  5KIX A;  1UAP A;  1B9N A;  3HEJ A;  1STH A;  2HDM A;  2Q8R E;  3VYT A;  3LX0 A;  4O42 A;  1O7Y A;  2CW0 D;  5D3D A;  3NP8 A;  2JEB I;  3H91 A;  4U67 3;  2GA4 B;  2L4N A;  4KTA A;  1S5C D;  1SYE A;  4HED A;  5EGT A;  1YNJ C;  3RD4 A;  3PO2 B;  1OXT A;  1PXU A;  2OXP A;  2BCO A;  3K5N A;  2FFK B;  1G29 1;  1NCV A;  1S5F D;  1TWA B;  5E4X A;  1JOR A;  2EOT A;  1QIL A;  2YYZ A;  3J81 L;  1BUV T;  4BBS B;  3DEP A;  3NUC A;  5FKA C;  4IUV A;  1F2Z A;  5IIF A;  1E2V A;  4RGN A;  1T5X D;  2XWJ B;  3QJY A;  4BY7 B;  2F0D A;  4DFA A;  3HS0 C;  3HP3 A;  1HA5 A;  2SEB D;  1ZYR C;  1PLF A;  2K5W A;  1AFP A;  3PUZ A;  1IHZ A;  1E2Z A;  5J1Z A;  3IKJ A;  5CV8 A;  1QE6 A;  1EY7 A;  3HG9 A;  2JP1 A;  4KHZ A;  2F3W A;  5C5L A;  1B50 A;  2R7Z B;  2F0S A;  2D9U A;  3GV6 A;  3I70 A;  1F2Y A;  4XXE A;  3PUV A;  2EYL A;  1JIC A;  3DWQ A;  3P75 A;  1KLG D;  2L5T A;  2F0H A;  3S16 B;  1LLR D;  1KAA A;  1R4P B;  2KHS A;  5D14 A;  4OL7 A;  3PUW A;  4ZUI A;  5CC4 A;  1V8Q A;  5CV7 A;  3MFG A;  3W3A A;  5I2X A;  4KV6 A;  3OW7 A;  1AW7 A;  3BVM A;  2PCF B;  3OMC A;  5KNC A;  1TS4 A;  4NDX A;  3VR4 A;  2A68 C;  1EWC A;  5CV5 A;  4RGT A;  4A3J B;  2KQ3 A;  1SAP A;  1AZQ A;  1SE3 A;  4PMB A;  1I4H A;  3FKI B;  4X3T A;  5EJW A;  3SE0 A;  2A74 C;  2CQA A;  3NSW A;  2XVS A;  2B2W C;  2HDL A;  1DJR D;  3BYY B;  3K58 A;  2F0K A;  3KF8 A;  5JAV A;  1D2B A;  1A3V A;  1SNM A;  5CMD A;  2XSC A;  2EY1 A;  4NW2 A;  4XYQ A;  4A3F B;  4L63 B;  2HQE A;  5M9O A;  2O5J C;  4C2M B;  1I6V C;  5I6W A;  4DK0 A;  1RHP A;  4WOR A;  1MSH A;  4N9T A;  1BCP C;  2HCI A;  1PFB A;  5ELF A;  2NVY B;  2JEA I;  3QOL A;  1EZ6 A;  3BDL A;  3L7Z C;  3EQL C;  2EYF A;  2IT1 A;  3SK5 A;  1F77 A;  3GTK B;  3BDC A;  4RWS C;  3IAY A;  2JA5 B;  4C3J B;  4OO1 I;  1SYF A;  1SND A;  3V2T A;  1UUP A;  2EYH A;  4WFN 3;  3Q23 A;  2K33 A;  1NR4 A;  3K0Y A;  1GUW A;  5M3M B;  3GTJ B;  3DXJ C;  4K6D A;  1B9M A;  1EY6 A;  3FEW X;  3TME A;  2F0Q A;  2FMM A;  3V05 A;  1YNN D;  2Z1C A;  1I4P A;  5JVG 3;  1ZXT A;  1NSN S;  2K05 A;  4TKO B;  1ET9 A;  3A8J E;  1F2M A;  4K8I A;  1H9S B;  3BDO A;  1YNJ D;  2BA1 A;  3KBX A;  3FMC A;  4ZQ3 A;  3VR6 A;  1I4R A;  5KYI A;  4KN4 C;  1ROD A;  4GZY C;  5IOC A;  1V1P B;  2WAC A;  4L6T B;  5EPK A;  2NN6 G;  1ET6 A;  4LJZ C;  4ZUJ A;  1RJT A;  4KJO A;  2ENB A;  2PZU A;  2CVR A;  1GUT A;  5G3L F;  3DMU A;  3H3V C;  3GP7 A;  3GTG B;  2JSO A;  5KND A;  5JVH 3;  4H7B A;  4MHE A;  2O2L D;  2RDH A;  1ZYR D;  2L1B A;  1Q90 A;  3I72 A;  3SXH A;  1PFM A;  5IT9 L;  4QB4 A;  4E6I A;  3A7L A;  1AP0 A;  1PMR A;  3DUZ A;  4UAI A;  4C3H G;  1EZ8 A;  2MJ8 A;  3M3Y B;  4H0L C;  2B2Y A;  2RKS A;  5T1I A;  5T1G A;  1I50 B;  5EPL A;  3L9A X;  2K1B A;  2C9O A;  3GTO B;  1TT2 A;  2WIN B;  1DD2 A;  3D31 A;  4OO1 H;  1BCP F;  4XQJ A;  1MD2 D;  5FO8 B;  3MFY A;  4DGZ A;  1HHV A;  2Z8L A;  4RGM A;  4G7O C;  3I4L A;  1EIH A;  3K57 A;  2KED A;  5BN5 A;  2L11 A;  1CHQ D;  1D1K A;  5C0X G;  1ZEQ X;  3MXP A;  1H9R A;  2B2T A;  5D3I B;  3F2U A;  3TZU A;  3TP7 A;  3GTQ B;  5DAU A;  1WTQ A;  3OWF A;  2O5I C;  2H4O A;  4IUQ A;  1XYI A;  4DAV A;  5G3L D;  4V19 0;  3OOC A;  1SNP A;  4C1N I;  2D5D A;  5C3W A;  2TSS A;  2F0T A;  3D6C A;  4A3K B;  3NTK A;  1LAB A;  3HGB A;  1Q1E A;  2L9H A;  4M8A A;  1TY2 A;  3C2P A;  4IUP A;  3S1N B;  1Q1B A;  5NUC A;  3RUZ A;  4QIW B;  4K5X A;  1I4Q A;  2E2D C;  3MC0 B;  3QOJ A;  4BBR B;  2F4I A;  1F9R A;  5FOB B;  1DOM A;  2ZXO A;  1PDQ A;  1LTG D;  2QIL A;  2DNC A;  1HA6 A;  3A8K E;  4ZKB B;  2F0L A;  1BCP D;  3OMG A;  4RA8 A;  2KEC A;  1SDF A;  2A69 C;  3MA2 B;  1EQV A;  3G6J B;  4PNY A;  2ICE C;  1T5E A;  1QB5 D;  4DAP A;  4C3I G;  1LTR D;  2EJM A;  4J6H A;  1STG A;  3C1E A;  5E4W C;  1H9M A;  2A6H C;  3KBG A;  5CV9 A;  4HCS A;  1WTX A;  3HOU B;  1TY0 A;  2K6A A;  2NVT B;  4WJW A;  2Q8I B;  2VB3 X;  5DM6 3;  5FLX E;  3A55 A;  1KNE A;  3BVG A;  3TDQ A;  1EQT A;  1JOO A;  3TN2 A;  2MPM A;  3T4A C;  5CV6 A;  3GTL B;  3C46 A;  1SYD A;  2EJF C;  1TWG B;  4KMU C;  3HKZ B;  2V4D A;  4F7X A;  1CFM A;  3QG1 A;  1SMY C;  1NAP A;  3IL8 A;  4KKS A;  1TU2 B;  5JEA H;  1SBB B;  3DEO A;  1FGB D;  3J80 E;  5KNB A;  5KYL A;  4Y7N B;  2PMZ B;  4EGV A;  1H9J A;  3RMH A;  3RLF A;  2A73 B;  4ZAI A;  1LAC A;  2RQX A;  4OIK A;  1Y1V B;  1IYV A;  4JBW A;  4KKT A;  1EY0 A;  1TS3 A;  5ISR A;  3I73 A;  3TP8 A;  3CU7 A;  4KHV A;  4KY5 A;  1G91 A;  4A3G B;  1SNO A;  2E75 C;  3VR3 A;  4TRD A;  1FNW A;  1PFN A;  1PTO H;  2DY7 A;  5I4D A;  1OXX K;  3VYS A;  4CJ2 C;  3BG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...