1EY4A

Structure of s. nuclease stabilizing mutant s59a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey4A00
2F0TA 3ITPA 5IGFA 5CV4A 1F2MA 2F0PA 2F0WA 4F7XA 4TRDA 4PMCA 3SK5A 5CV6A 4ME5A 4EQOA 1EY7A 4K5XA 3DHQA 4N9TA 4PMBA 5NUCA 3DMUA 3H6MA 4N9PA 4S3SA 4WRDA 5M9OA 5KRUA 2EXZA 1KDCA 2F0FA 1SYGA 5IGGA 1KAAA 2EYLA 2RKSA 2KHSA 4KTAA 4OL7A 5IGCA 2EYHA 4ODGA 3RUZA 3NQTA 3R3OA 1SYFA 1A3VA 3D4WA 4K5WA 3T13A 1JORA 5C5LA 1STNA 2M00A 3EROA 4DFAA 1SNPA 1STBA 1JOKA 4ZQ3A 2RBMA 3TP8A 5KYIA 4PNYA 1STAA 3HZXA 3LX0A 1A2TA 5CV5A 4R8NA 1SYDA 3MEHA 4K8IA 5ISRA 1NUCA 4K5VA 1EY9A 3NUCA 5EKKA 4DU9A 4J6HA 1JOOA 4KJOA 1TT2A 2OEOA 5CGKA 3BDCA 2SOBA 1EYCA 2F0SA 4K2KA 1EZ6A 1SNQA 1KDBA 2EYJA 1EQVA 2F0LA 3D4DA 4KHVA 3TP6A 4E6IA 2PZUA 3T16A 4NDXA 1SNDA 1F2YA 2F0IA 3MZ5A 5C6AA 1EY6A 3QOLA 5IIFA 5KGUA 1AEXA 2HQEA 5C4HA 3S9WA 4KD4A 1II3A 5CC4A 1NSNS 2F3VA 1TQOA 5E3FA 2F0OA 3SHLA 2EY2A 2RDFA 3MVVA 3SXHA 5C3XA 4G57A 3SK8A 1SNCA 4ID6A 3EJIA 2PYKA 3C1FA 4K8JA 4LAAA 3NHHA 4IUNA 3SK4A 5JAVA 4NMZA 3NXWA 3QOJA 2F0HA 2F3WA 4F8MA 4HTHA 4EQPA 1EY0A 1SNMA 5DAUA 4NP5A 2PW7A 3D6CA 4KJNA 4K2LA 1KABA 5EKLA 1ENAA 3E5SA 5IOCA 2EY6A 5EGTA 2F0KA 1KDAA 2SNMA 1EY4A 5CR3A 1RKNA 4I65A 1SYBA 1TR5A 5CV9A 4H7BA 2F0UA 5E1FA 3SR1A 3OMGA 1SYCA 4B9WA 1EY5A 5IGEA 1EYAA 1STHA 2F0GA 3OMCA 4ZUJA 4DGZA 1A2UA 4YIJA 2NUCA 2EYFA 2F0NA 4RKLA 4HMIA 1EYDA 2EY1A 3D8GA 3MHBA 3OSOA 3U9OA 4RKBA 3SK6A 5C4ZA 5J22A 3ERQA 2ENBA 2EYOA 3HEJA 3NK9A 4IZ8A 1STYA 2F0DA 3NP8A 4K6DA 1EZ8A 4KV6A 4QF4A 5I9OA 5IGDA 4EVOA 5K5PA 3V2TA 4QB4A 1A3TA 1IHZA 2F0EA 4MIUA 4QMGA 5HURA 1JOQA 1A3UA 1ENCA 2F0MA 3EVQA 5IGBA 2EY5A 2KQ3A 3TMEA 1SNOA 1SYEA 3P75A 5IODA 3P1HA 4ZUIA 3VA5A 4B9XA 2F0QA 2O4XA 5I6YA 4EQNA 5DEHA 2LKVA 2F0JA 3OWFA 1U9RA 3PMFA 1F2ZA 4NKLA 5J1ZA 2F0VA 2PZTA 4KY7A 2QDBA 4KY5A 4KD3A 5I9PA 2OF1A 2PQEA 5C3WA 3TP5A 4K14A 5KIXA 5I6WA 5KYLA 3MXPA 1STGA 4KY6A 5JOBA 5HGTA 5J39A 2EYMA 3QB3A 2PW5A 4IALA 2PZWA 2WACA 5F2DA 5KEEA 3C1EA 3TP7A 5CV7A 2OXPA 4WORA 2SNSA 3BDLA 4DF7A 4HMJA 1EY8A 4J1MA 2EYPA 5C5MA 5CV8A
chains in the Genus database with same CATH superfamily
1XWEA 1N34Q 2Q8RE 2FHTA 3SK5A 1UNSA 1A62A 4ILWA 1A15A 3DMUA 4R4CA 1EU3A 2Z6BA 1GVPA 2ZTCA 5IYCG 3V05A 2UUBQ 3HKSA 3NQTA 3RR5A 4JI3L 4CJ1B 2BA1A 2F1MA 2ZJQA 5DLQE 1K8AC 1IBKQ 5E4XA 4DR5L 1WTXA 5EKKA 1DZ1A 5CGKA 1BR9A 4WJ4A 1SNQA 4ZKBB 5ELDA 1EQVA 4DR7L 3PUVA 3PO2B 3UDIA 1CQFA 3EN2A 4TVAB 1WYDA 3SGIA 1HTLD 4C3HB 4KD4A 3TSSA 1FGUA 1VMCA 4JPBW 2E5LL 2PYKA 3KK7A 2IX1A 1X3EA 2EDGA 1CSQA 1QB5D 3PUXA 3G4SA 3TQYA 3HOUB 2QGQA 2KA7A 1BCPF 1ICWA 1AP0A 2EY6A 4RAUC 4A3MH 5JPMC 5C4XG 1VQEA 5IYBH 2VZAA 1O80A 2GVAA 5IGEA 1PHJA 5IWAQ 3NBHA 4XTCS 1A2UA 2RQXA 5GROA 3Q8DA 5J22A 2Q2HA 4HIOA 3I4MB 1YNJC 4OIJA 4DXGA 1V1QA 3NWTA 1J9OA 3JAMi 3OTOQ 1B2TA 3KF8B 4X65Q 3NELA 4TQUS 4F87A 4A3FG 4OWXB 1IL8A 5C3EB 1J5EL 3KF8A 2BE5C 1BCPB 5AFWA 3S15H 3PO3H 1ET9A 5M5WB 4V0BA 5IE8A 1KRTA 5CMDA 5I6YA 1STEA 1YIJA 2N78A 1EWCA 2A68D 5J1ZA 1VQCA 2WKCA 2OF1A 4K14A 3CCMA 1UAPA 4GLXA 4KY6A 4R8IA 2EYMA 1PFSA 1GJXA 4CKEA 2WACA 2PPBC 4DF7A 2AKWB 2NB0A 4A3JH 4OO1H 1F2MA 2EIFA 1XTCD 3MFGA 4XT3B 4C3JB 5IP7H 4ME5A 3L3OC 1EY7A 1HA6A 4GKJQ 4WRDA 2F03A 2Z4IA 1WFQA 2DNEA 5IGGA 4R4QA 1JB3A 2LMCB 1OO9B 4X3TA 1XJVA 4XXEA 1TY0A 3CP0A 2PI2A 3F2UA 1VQ4A 3BVGA 2DJGC 1GOZA 1VQPA 1JWMD 2IX3A 3EFXD 4FF3A 2SOBA 1I50H 1AH9A 4OIKA 4OWTB 1RDPD 1KNEA 5IY0A 2OT2A 3HP3A 5C0XG 3FPPA 5FLMG 5CORA 3F2BA 3M3YB 3MVVA 2K6AA 4LAAA 1QE6A 2LFNA 1CI3M 5E4WC 2JA5B 3M4YA 4Y7NH 4MNOA 5EKLA 4DV7Q 1B70B 1D5MC 1EEFD 2HIVA 1RKNA 1EU4A 4WJ3M 3U50C 5KNDA 4DUYQ 4LF6L 3FHWA 3E9HA 3OHXC 1PDQA 4JW0A 3GTLH 3OMCA 2F0NA 1F9QA 2EY1A 3E0EA 1GHJA 1X3PA 5GADC 2EYOA 2MUYA 4YWKA 2QF7A 4KV6A 2R7ZG 2MJ8A 4MIUA 5LMNQ 3TN2A 3X3NA 2F0MA 2H4OA 3EVQA 4KK7A 4JI6Q 3P75A 4AYBG 3A8JE 3P1HA 4PMWA 2NVQB 1WTVA 5GAEC 2C35B 1QCBD 2VB2X 3KJOA 2HCIA 2B63G 1JE4A 3HOXG 5I2YA 4KHPQ 4IALA 4IPGA 3MXGA 1VQLA 2Q2IA 1HZAA 1QG7A 1D6EC 2FXQA 2K5NA 3G71A 1Y1WG 2EYPA 3ITPA 5IGFA 4HJAA 3ULLA 1E3PA 2A5HA 2A6HD 4OWWB 2JXMB 3TMEA 5E7NA 5NUCA 4OL7A 3NTIA 3R3OA 2JA5H 3J7AV 1HQMC 1N33L 4A3BB 5IGBA 4RWSC 4ZQ3A 4HSPA 3GTMB 4GOPB 4LF6Q 2I5LX 5D3DA 5ELOA 3S2HB 2K5VA 1E7ZA 2B2TC 4ME3A 1NUCA 4O1NA 3E9IA 1HFNA 4J6HA 2N55A 2K75A 4X6AH 1LV9A 5FO9B 4K2KA 4GKKL 3J81j 4LF4L 3K0YA 1VQMA 1DOLA 3S17H 4QUCA 1QZGA 1WD0A 2QKIC 2HT1A 2XIWA 1PH1A 2BDNA 1UWVA 3EJIA 3I91A 1TWCB 5BR8Q 3PV0A 3GTLB 1OXVA 3M4OH 5IWAL 1HJPA 1WTHA 4A3KH 3E5SA 5G3LD 1TVXA 1MJEA 2JA8H 4I65A 2F3IA 1ZYRD 2I07B 3BZDB 1T9HA 5M3FB 3WOFA 5JJIA 2LXKA 2JQOA 2L0CA 2NTTA 1EQRA 3HGBA 3LWEA 4UP9A 4C1NK 4JI0Q 4KHZA 2EYFA 4IPCA 1CFMA 4B3TQ 2J4XA 1WCMG 2L5TA 4DV0Q 2L4NA 3H91A 4QB4A 5M3MB 4A93B 3NBIA 1X56A 1ZKOA 2K5HA 3IL8A 2M9VA 2Z9HA 3BS1A 3HOXH 2QEXA 1CUKA 1C48A 1B50A 1IYJB 3CCEA 2GVBA 2F0JA 3S2HH 1VF7A 3GTOB 2JA7B 3S14B 3HOZB 1NR4A 1UE7A 1PRTD 1TWHB 3HOWG 5KYLA 2WIIB 1I4PA 5J39A 5IYDH 1PTOB 2AMCB 1HR0W 1BO0A 4GN3B 3MEFA 3WWVA 1XMQL 2OXPA 5CBEE 1WVLA 4B3SQ 3GTPB 3IFDA 1LTBD 1PYBA 1GUWA 5EQ0A 4JG2A 1FGBD 2MHVA 5BN4A 2WKDA 4N9TA 1TS3A 3H94A 1YJNA 2RKSA 2KHSA 2CQOA 3D4WA 3VR6A 1STNA 1QUQA 3CQZH 3OIQA 1E1OA 4X3SA 2SEBD 2K05A 3ZYYX 2IHEA 3NUCA 2OEOA 1V43A 3BDCA 1YITA 4GLVB 1PFMA 2VS1A 2CWPA 1O7YA 1M90C 1FR3A 3HOWH 2PZUA 2F0IA 3S1RB 1I6HB 3HOYG 1BKBA 2A19A 2QCPX 2EQSA 3C46A 2EVBA 1KC8C 5C0XJ 4JI4Q 2VUMG 1DXMA 4G57A 1C0AA 1LT4D 3S1MB 4K0KQ 1GO3E 3GV6A 4QJFA 1HA5A 2F3WA 2IW3A 2IX0A 1N33Q 2PW7A 1XTDA 3AFPA 3BZCA 1CKOA 2RA4A 1PYSB 4OONA 4FP5D 3STBD 4DAYB 2I46A 3VYTA 3A0JA 1R9TH 5DM63 1X3QA 2A8VA 2E2JB 3HOXB 2NTSA 1S5ED 2KBNA 1O78A 1EYDA 3R93A 3NEMA 3L7ZC 4A3JG 4ZRZA 2I5MX 4EVOA 2YU9H 1NJIC 4L6TB 5HURA 4GNXB 4DR6L 3I7FA 1TWGH 1L0WA 1A3UA 2EXDA 1TWAB 1YNNC 2JYOA 4A4IA 4KN4C 4EQNA 2LKVA 3OIPA 4QIWB 1BOSA 2G9DA 4TSSA 1MHWC 3PIP3 2MO1A 2L11A 1E1TA 2KCTA 1HR0Q 3A7AB 1TKWB 1H95A 2BH8A 3GQBA 4WORA 5ELFA 4XQQA 1MSGA 5C5MA 5CV8A 2MGSA 3KF6B 5M5XB 4JV5Q 1PH9A 4R4TA 5CV6A 2B63H 2K01A 2K7VA 3DHQA 1MIUA 2R92G 1GUOA 2OQ0A 4L5SA 1G8ZD 4JBJA 2D2CC 5FO7B 1PH4A 4IFDH 4KTAA 1HNZQ 4H02A 1FD7D 2EJGC 3M7GA 3ULJA 3QR8A 2M00A 3URYA 3EROA 4IFDJ 4M8AA 4IN3A 3CCQA 4DV2L 5K36G 4FVMA 3CW2C 1TU2B 1Y1WH 4DN4M 2B2YC 3RD4A 1GHKA 1PFNA 1AFPA 2R93G 2NWGA 2D0OA 3K6OA 4DAYA 4HJ9A 3ND8A 4QCLA 1VQKA 1K8GA 2O5IC 1IYUA 2CW0D 4IJLA 1C7YA 4LF5Q 4DNTB 1KD1C 5KGUA 4FXDA 2XGTA 3K5MA 1NSNS 3SDZA 1IXRA 2RDFA 3SXHA 5C3XA 4DR1L 1WTWA 5C0XI 2Y0SE 1S4ZA 3GD7A 1KNAA 4NP5A 1PZID 2R92B 4C56C 3KLRA 2F0KA 5LMNW 1LUZA 1HTPA 3HOYH 2IY5B 2E2HB 1LTRD 3OMGA 3NWSA 4BY1H 1STHA 3A8IE 1WTPA 2MPMA 1OXUA 2AQ1B 1VQ9A 4PG3A 2R61A 4LNQA 5ELBA 5IT9L 3NP8A 3VA7A 3D31A 4BWGB 2BOSA 3BDOA 4L5QA 4IJHA 5JJZA 1F9RA 1XMQQ 4ZUIA 1Y69U 1HUNA 5C3EG 4A3FB 1KLGD 1QILA 3L9AX 1RTOA 1HCZA 4A3JB 3J7AF 1CK1A 2R6GA 2QW7A 3LGJA 4JOIA 5I6WA 5HGTA 4CGYB 4A3KG 2KCCA 2JA8B 2A1AA 1F9PA 4UAIA 3Q24A 4JI2L 4A3LH 4NXNL 3CU7A 1EY5A 4J1MA 4PZ7A 4JBWA 1PXUA 2A69C 2VQFL 4LF8Q 2F0WA 2R7DA 4TRDA 5AJ3Q 3ULPA 1KL9A 5M5YH 1D5ZC 3WDNA 4DR2Q 5IGCA 1B44D 1K0RA 4X62L 1G51A 1FVIA 3I4OA 3JC66 3T1YL 4DR2L 3U9SA 1EOVA 3LX0A 4FXKC 4GKJL 5IP9G 4HN7A 1MI2A 2BE5D 3NTHA 4R8NA 5I2XA 1RJTA 3MEHA 3HOYB 1LTID 3WOEA 2HHHL 1FYCA 4CDCC 1HNXQ 1B9NA 1LTTD 1SE8A 2ID0A 1ILPA 3M3YH 5TSSA 2MFIA 2EYJA 3K8AA 4E6IA 5FLMH 4N8FA 4V190 3A54A 2EPBA 5FO8B 2D62A 1WTQA 1CKMA 2R92H 2JA6G 1WTRA 2XRQD 2KVMA 1BBWA 3K7UC 1LM0A 2IHFA 3NHHA 2X6GA 1MGSA 4NMZA 1YHQA 4KN7C 1JJGA 1EY0A 1IKMA 2RCNA 5EKIA 1I94L 1D1KA 1SAPA 1PZJD 1WJJA 1WOCA 1PYWD 3D3RA 4KJNA 1OTCA 1N32Q 4LFAL 4JI7L 4A3CG 1AN8A 5CV9A 4JI7Q 4MTKA 1D8LA 2AUKA 3S1NH 1B4OA 2NVYB 2NUCA 4RKLA 4HMIA 3KOJA 3D8GA 3CCLA 3HOWB 4CDFC 1RHPA 2KEDA 4JI8L 1ENFA 2R7FA 3S1RH 3NTKA 1I6HH 3AMUA 4OGQC 2JA7G 2X6LA 2WB1E 3VYUA 2UUCQ 2A6HC 3PSIA 4CJ2C 2KECA 5IODA 5LHY1 4FF4A 4KHPL 5DM73 3UI2A 1KQSA 3W5OA 5M3MG 4A93G 2HUGA 2E5LQ 3KF6A 3P7JA 3CKIB 2B39A 3I70A 4R4IA 3K5LA 2VL6A 4HAEA 1SFOB 1JB7A 1Y8NB 1B8AA 3K81C 5JOBA 4RCOA 2H1EA 2IPKD 2ZTEA 2K50A 2Q2TA 3NQIA 1YEZA 1PLFA 2KCNA 3BG3A 4JOIC 4X64L 3J7ZC 4HJ8A 3HG9A 1PTOD 1DYQA 2UU9L 1W2BA 2G5DA 3CPWA 4PMBA 2QEJC 5DNFA 4S3SA 4XQNA 5M9OA 2F0FA 2JJQA 5IYBG 1HFGA 3HS0C 1JR0D 2WAQG 4MTNA 4A3MG 1NCVA 1HHVA 1E2VA 4GNXA 3LWUA 3O13A 1DGSA 4RHRA 5CV5A 1Q7YC 4LFAQ 1B3QA 1EY9A 1U4LA 3MXNA 3V96A 1F77A 4KJOA 1T5XD 1LT3D 4LF7L 1BXTA 2FJ2A 2CQAA 1CM9A 1KDBA 4R4OA 1K3RA 3A5ZB 2F0LA 2Q8IB 4GLAC 1ASYA 4NDXA 1B1ZA 2JP1A 3J7YW 1YBYA 4G7OC 3QOLA 3IKJA 2DN8A 1NY4A 2I5HA 1BNZA 5M5XH 4FF2A 1U4RA 3HFZB 1SMXA 4A3BG 2HIXA 2P5ZX 3EA6A 1YVCA 2EJFC 1L0XB 4RA8A 4LWCA 2Q2UA 2B2UC 1CA5A 2NVYH 2QILA 1HNXL 5BN5A 3GTKH 1EY4A 3D4RA 4UP7A 5J3BA 1SJHD 3JAMc 2JSOA 4H7BA 1Y1WB 3H3VI 3ZJYC 4O0AA 2K04A 3OYYA 2K52A 1EUJA 4R1JA 3RN2A 3DEOA 2K5WA 3KBGA 2K03A 1UEBA 3KYHC 4QF4A 4A3MB 4BBSH 3C2PA 3L2PA 4A3DH 4ULLA 1IW7D 2F0EA 3F2CA 1FNWA 1ENCA 2L1BA 2EY5A 2YV5A 3D0FA 2K1BA 2K4KA 2M2LA 3QIAA 4AYBB 2Z6KA 4MHEA 4HJ5A 3TEHB 3PIPA 5DEHA 3STBC 1G2SA 4Y7NB 2R7ZB 1QVGA 4BY7H 4QL5A 1SSOA 5FKAC 3RNUA 1P16A 3J80E 1QVFA 1OXSC 3CRKC 1IBKL 1VQAA 5KEEA 1JJCB 2L9HA 1J5EQ 3TP8A 4ZLTF 4IO9A 4LUZA 2NBFA 3J81L 1CSPA 1DOMA 4DA2A 1KDCA 4IPHA 4DR3Q 2EYLA 1VQ8A 1JORA 1Q1EA 2WAQE 3DXJC 2N3SA 3G48A 4DR3L 3Q22A 3GTQH 4DV5Q 1RL2A 3VYSA 4XDXA 2EZVA 4YCVA 1XX8A 4DU9A 1XMOQ 1L1OC 2AUJD 1HQRD 3CHBD 3RLNA 3TP6A 1VS0A 3AQQA 4ZK9B 1X3FA 3F1ZA 1X55A 1F9SA 2UXDQ 2IJ0A 2F0OA 4IPDA 5JVG3 3FKIG 3GV3A 2XN9C 2KHIA 1SNCA 3K5OA 3M7NA 2JA6B 4Z9CB 1GXDC 3R2TA 3QOJA 1QOHA 2CFMA 1V8QA 3P20A 2NVTB 1X3GA 1CHQD 2VNUD 5CBAE 3GTMH 1ONLA 1E2ZA 1ENAA 1LT6D 2FINB 1V1PB 1PH6A 4BXXG 2IWHA 1CQVA 4HIKA 1YZ6A 1TWGB 1EYAA 1P8LA 1CZWA 1LT5D 5A35A 1EOTA 5JPNC 3H15A 4LF9Q 4DNRB 4M1UB 1HNZL 2JN4A 3N52A 3OSOA 2PNRC 1VQNA 2R93H 3T4AC 2R3ZA 4POGA 1YHAA 1A3TA 4JV5L 1JOQA 1IZ6A 1JE5A 2E2DC 4UHVA 4DK1A 2A74C 2BA0A 4GN5A 3U4VA 2J0TD 1M1KC 1EFID 4JBKA 1R4PB 3SVMA 4FYDA 1K0SA 5KNCA 4DNIA 1ZYRC 2XWJB 2VQEL 3OWFA 4YCUA 1NBWA 2KUMA 1UE1A 4DK3C 4KY7A 4KY5A 4KD3A 1XMOL 2WB1G 3W2DA 3LNNA 2KOLA 1SBBB 3M85A 4DV6Q 4J15A 1KLUD 4P74A 3I72A 3TBIB 1HUMA 1EYGA 1UEAB 3C3LA 2TSSA 3D6WA 2XRSD 2PCFB 3FP9A 5G3LF 1MBYA 3FKIH 4FF1A 4RGNA 2K32A 4OX9Q 2KEEA 2PNHA 1VF5C 1ICFB 1S5CD 1Z9FA 3OW7A 4RHSA 5M3MH 4A93H 1W6JA 4MZ9A 4ODGA 2NVTH 3PF4A 4K5WA 1TIID 5C5LA 4KLKA 1VCIA 4XYQA 2CWAA 4PNYA 4ZKCB 3MAQA 4DV3L 2ZXOA 1TS2A 1YNND 2JA7H 3GTOH 2RVLA 4A3GB 2WFWA 3RLOA 2K5QA 1J8IA 1IBLL 1SE3A 1AE2A 3KLSA 1SFOH 5IP9H 3PO2G 4A3BH 1BBUA 2YTYA 1YNJD 1JQYD 3A55A 1KHIA 1RCVD 1I3QB 3PUYA 3CF5A 5D3IB 2F52A 1PV4A 3SE0A 1ILQA 1V1OA 5E3FA 1K73C 2EY2A 5LL6X 1HH2P 1EWIA 4K8JA 4B08A 1UE6A 4POFA 4IUNA 1Y1VH 1PH5A 4JI6L 4LK1C 4EQPA 1XNRQ 3RMHA 5DAUA 1U4PA 5IOCA 2ES2A 5EGTA 4HEDA 3W1GA 1BCPC 2R93B 1AW7A 2A68C 2C5CA 4DV5L 4YHHQ 1Q46A 1KTKA 5FLXc 1K8OA 3KLSX 2NVQH 3VR4A 5C4ZA 1NE3A 1MD2D 2B2TA 1CKNB 4K6DA 4A3FH 3TREA 4HR7B 3K57A 1LYLA 3A7LA 3L0OA 1IHZA 3I73A 4I7ZC 4KMUC 4ZCKA 5FJ8H 2DNCA 1RF2D 4OELB 2Z1CA 3VR5A 2UUAL 3S1MH 2RCFA 2LY7A 1CKNA 2GA4B 4AQYQ 1Q3LA 3PMFA 1I4QA 3JAME 1GUNA 1G291 2E75C 1I50B 3TP5A 4X65L 1SMYD 4U68A 4CJ0B 5EBDA 1FL0A 3I56A 3QB3A 4DR4Q 2IT1A 2KENA 3IAYA 2PZWA 1I5FA 2A69D 5F2DA 3BDLA 2ALYB 4JK1C 1PMRA 3J80L 2F0TA 3B6YA 2MP1A 2AQ2B 4FXGC 1TY2A 1DONA 3U58A 1GUSA 4L5RC 2YU9B 4JCVE 3E6ZX 4YWMA 2EYHA 4IURA 4RH6A 3QO2A 4C3IH 5C3EH 1SYFA 1A3VA 3UDFA 4P2CB 1XNRL 3FDTA 1D7QA 1STAA 3DM1A 1LTAD 4H0LC 2G9HD 4GN4B 1W3SA 3KUPA 4RGOS 3T1HL 1VQ7A 2VQFQ 4LF8L 4JVZA 4JI1Q 4JYAQ 1PA6A 4G7HC 3NBHB 3RN5A 2RHSB 4KI0A 1F2YA 1Y1VB 4IFDI 3EQLC 3K80C 1II3A 5CC4A 1MKHA 3KJPA 4N8X1 2VUMB 1H9JA 5C44H 4ID6A 1X32A 3W1BA 4DR5Q 1F2LA 1GUGA 1G2TA 3I4NH 2UUAQ 1ESRA 3NXWA 3CPFA 5FOBB 2BDOA 2F4VL 4GZYC 3JAML 3HOVB 4NXML 2HQLA 1BUVT 4NXMQ 1I6VC 3GO5A 3EIVA 3GTGB 1QZHA 4A3CH 3TZUA 4U673 1JICA 3CC7A 3U9OA 3K7AH 3MHBA 4RKBA 3SK6A 2RSNA 4IZ8A 3ERSX 2DGYA 3HKZG 1LABA 3H3VH 1XNQL 2ATWA 2O5JC 1SNOA 1SYEA 1M4VA 1PRTB 2OQKA 2C9OA 4DR1Q 2E76C 1U9RA 3S1QH 4G4KA 1Q8IA 1IW7C 1OXTA 5I9PA 3S16B 2VY3A 2ZXRA 3A74A 2B29A 3FRPB 4X66Q 1LTLA 2XSCA 4LFCQ 3HOZG 3M9BA 1D2BA 2B8GA 2JEBI 4TKOB 1G6ZA 4HMJA 2UUCL 1EIFA 2B3GA 5LL6S 4BBRG 1IBLQ 1MJCA 3ER0A 4EQOA 1BCPD 1RD9D 4L8JA 1K8MA 4LFBQ 3H6MA 3K58A 4DV3Q 4UDUC 4BY1G 5L37A 3F2DA 1LTSD 1CA6A 1G6PA 4DAVA 1WCMB 1N36Q 3CCUA 2D9UA 1SNPA 1SN8A 1K83B 2PI2E 4C3JH 3DUZA 3HZXA 1AZPA 3K0XA 1S5FD 2B2UA 3TRZA 4IOCA 4K0KL 4A3LG 4DV7L 4RGTA 5ISRA 5M3FG 4H44C 1Z6HA 4RGMA 3J81c 2F0SA 5KNBA 3KBXA 1S3OA 1IL2A 2FFKB 2D0PA 3K7AB 2LSSA 3G7LA 1UUPA 4IUTA 1SROA 1EY6A 1QUQB 3OPOA 2ZM6L 1DOKA 2ZXPA 5LMUL 3I3CA 3PIOA 1L0YB 3PQIA 2F3VA 2MQHA 1YJ9A 3T51B 1WD1A 1HNWQ 3FVQA 3HOVH 2VB3X 3GTKB 3C1FA 5HY6A 3I8ZA 3SK4A 1L1OB 4DUZQ 5IT9c 4CDDC 2YTVA 3K5NA 1BBXC 3S1QB 2JK8A 1J6QA 3A5UA 4DR6Q 1GKHA 1Z7TA 4K2LA 5IYDG 1CZGA 3I4MH 1TS5A 1KDAA 1SE4A 1PTOH 3G6JB 1SYBA 4YY3L 4A3GH 3DLLA 2DJFC 4NB3A 5C0XH 4LF9L 4IFDG 3S2DH 4X62Q 2CVRA 1RTNA 5EBCA 4QQBX 1TWAH 3J80i 3S15B 1PH7A 1A63A 3NK9A 1DCZA 2CHBD 4BBRH 3OWEB 1ASZA 1O7ZA 1TWFH 3ND9A 2ICIA 3S16H 3CRLC 1ZXTA 3GTJH 1SXTA 1PFBA 1K83H 1JWUD 3I55A 4X3KA 3A8KE 4DK6C 4ZYSA 4JI4L 4R9WA 2CH4A 4CHTB 3CC4A 1NAPA 1JJ2A 5ELNA 1ZEQX 2JA8G 1IYVA 4A3KB 3CD6A 2B63B 5IP7G 2OTJA 1PRTC 4OO1I 1IBMQ 3U4ZA 1KAWA 4G7ZC 2UXCQ 2SNSA 5K36H 1E2WA 2AQ3B 4JI3Q 1QVCA 4O2DA 1SYGA 3PIO3 2JE6I 3RUZA 1E22A 1N34L 1I4RA 2ZJPA 4PV1C 5M5YB 5I4DA 4B3ML 2B2WC 4C1NI 3S14H 2D5DA 3TS0A 2XWBB 4PQXA 1EIYB 3R8BA 5A2QL 3MXNB 2KJXA 5C44G 2XNAC 4B3RL 1C9OA 3N6RA 4RMFA 1PH3A 3IRBA 2JA5G 1TWFB 4Q0FA 2CCZA 3SEBA 2Z8LA 2RDGA 4A3EH 1TQOA 3CMAA 3GTJB 2EJMA 5EAYA 1TXYA 3NSWA 4DR7Q 2VW9A 4P73A 4HTHA 1BVSA 4WFN3 2K33A 3S17B 4FNFA 2L12A 1PRTF 1KABA 2SNMA 2L55A 3AU7A 4X3UA 4CDEC 2DUDA 3CXCA 4PZ8A 1QJOA 1VQHA 2OWOA 4ZUJA 2Y0SG 4YY3Q 3HEJA 1H9SB 1D5XC 1RODA 4X66L 4GOPA 1VQJA 1B3AA 4LUOA 5M3FH 3BYTB 1YI2A 3BZKA 3PUZA 1B9MA 2OTLA 1SRUA 2KQ3A 5BR8L 4C3JG 1HR0L 3VA5A 4RG1A 2XTIA 1DJRD 1N9WA 3I4NB 1JT8A 1HZCA 4UPAA 1SDFA 2NYZD 1CT1D 5IYCH 5D65A 2HDLA 1IKLA 2VQEQ 5T1GA 1VQGA 2PO4A 2PW5A 1FJGQ 4A76A 2ASBA 3J81E 1H9RA 1VQBA 2ZT9C 5CV7A 1U4MA 4WJWA 1HPCA 2WV6D 4F7XA 4A3EB 1M8AA 1EQQA 4JC0A 5KRUA 4GNXC 1KAAA 3F8TA 2LXJA 4ZAIA 1TS4A 4B3SL 2XVSA 4DFAA 1PH8A 3I4MG 2UXCL 4A75A 1JOKA 1WTOA 1R4QB 4BS9A 1X54A 4P71A 2JEAI 1A2TA 3NPPA 3RZOB 2UU9Q 1EIGA 1Y1VG 4DAMA 1JOOA 3Q0AA 5C4XB 4X64Q 4NPSA 1EZ6A 3CC2A 1C4QA 1E24A 3HOUG 4YCWA 2NZ1D 3VR3A 4QUFA 3MZ5A 1TWCH 5C6AA 5A2QE 1AEXA 1LO5D 1Y8PB 4LUVA 3S9WA 2UXDL 2CKZB 3MTSA 1O7IA 4ABNA 3CCVA 1YHBA 4XQJA 1X9NA 3T1HQ 5FJ8G 2B2YA 4DV0L 4OO1G 4C3HG 5JAVA 3G6EA 4ALPA 3S1NB 4F8MA 4HIMA 4DKAC 4JI0L 1V9PA 1C8CA 4HIDA 1VQOA 2JA9A 4A3EG 5GAGC 1ESFA 4DV4L 1PTOF 1K3BC 3DEPA 4LJZC 1A8VA 3AEVA 4JI8Q 1H9KA 2Z4HA 3SR1A 5AJ3L 1N8RC 2CH4W 2B2VA 3T53B 4NW2A 4PZ6A 1I4XA 4KKTA 4DUYL 1JMCA 5FLXL 4DUZL 1HRJA 1FNVA 2NN6I 2NN6G 1JCKB 4DR4L 1AE3A 3V2TA 3E0JA 1Y8OB 4QMGA 3HOZH 2NN6H 4A3IH 2F4VQ 1XPRA 4J8QA 4OHJA 5IT9E 3I4NG 1WI5A 2ZM6Q 3RZDH 3I2ZA 2RHQB 2F0QA 4XT1B 1EQTA 1IBML 2O4XA 2IL8A 2ZTDA 3EBEA 2ICEC 1F2ZA 1VQ6A 1A6XA 2F0VA 2PZTA 2QDBA 1CHPD 5C4XH 2KCMA 2E2IB 3A56A 3OTOL 2Y0SB 4CBVA 3FMCA 1EEID 1G91A 2A6EC 3S2DB 4FO2A 2NZOA 1EY8A 4DV1L 4JI1L 4JYAL 5CV4A 1VQ5A 1XPUA 5ELCA 3NENA 4PMCA 3CQZB 3H0GH 1X6OA 2CW0C 2EXZA 4B3TL 2HCCA 2MNAA 1Q1BA 1NTGA 4QY7A 2BH2A 1LTGD 2V1CC 3I90A 4DK0A 5KYIA 3MXUA 4LFCL 5GQOA 3CCRA 5EPJA 1SYDA 4K8IA 4K5VA 3PGZA 4OXPA 3K59A 3QJYA 5JEAJ 3CCJA 2VUMH 5C44B 4KHVA 3PCOB 2B2VC 3UE0A 4EGVA 1EIHA 1EWHA 5FK9C 1JWSD 4A3GG 5IIFA 4KKUA 2HQEA 5JVH3 2K28A 1XNQQ 3SHLA 5LMNL 4BA1I 3SK8A 1L1OA 4C2MH 3S24A 4DV2Q 4O42A 3BYYB 4UP8A 3GTGH 2BCOA 1SNMA 3KLWA 4LMQD 1Q12A 4JI5L 1KXLA 2E2IH 1S40A 5CR3A 1W6KA 1HXYD 1NNXA 3OW2A 1TR5A 1NR2A 3UDXA 2DY8A 1SYCA 4A3IB 1BQQT 4OX9L 1S5BD 3DWAA 3RLFA 1N32L 2F0GA 3CMEA 4DGZA 4JI5Q 3GTPH 2A73B 4EX5A 1SEBD 1O7LA 3TZDA 3RZDB 2WB1B 5JEAG 2F0DA 2OCEA 2TMPA 4FDBA 3DM3A 4Y52H 1I3QH 2E2HH 3J7A5 2R7ZH 1X65A 2N49A 3TDQA 4YWLA 4B9XA 1SJED 1XXGA 2O2LD 4DAPA 4CKCA 3PF5A 5JJKA 2A6ED 2DY7A 1HZBA 1PVOA 3UDGA 4DXFA 3VYRA 1YJWA 3R2IA 1PH2A 2Z0SA 1A0IA 2HD3A 1K9MC 3CAMA 2Z6KC 4F88A 3NE5B 5KIXA 1LLRD 4CKBA 3MXPA 1STGA 3H0GB 2V4DA 4IUPA 4KKSA 3AB9A 5HGQA 4I7AA 2WINB 1WCMH 4L63B 2F0PA 1EL0A 2RDHA 4K5XA 2NZHA 1SR3A 2AWNA 4N9PA 4C2MB 4IUVA 4BA2I 4IOAA 3Q6SA 2YTXA 1B7YB 2F4IA 3VR2A 3DWQA 1MSHA 4DV1Q 1SLJA 3FKIB 2RBMA 1PZKD 1H9SA 5H1SE 1I94Q 2N88A 1TT2A 2QDLA 2E2JH 2PQAB 1EYCA 1B53A 5JEAH 1Y14B 1U0LA 4P72A 3D4DA 4BY7G 3T16A 4AQYL 4P75A 4C3IG 4BBSB 2KHJA 4A3DB 1ET6A 5FLXE 3Q23A 4BXXH 2J7ZA 3HKZE 1I4GA 1PTOC 3PO3G 4HCSA 3X3MA 3PO3B 3QWNA 5ELEA 4B3MQ 2HDMA 5M5WH 2NVXB 2F0HA 4BY1B 4A3DG 2EOTA 4C3IB 1GM5A 4BBSG 3T56B 3D6CA 4BY7B 4Q5VA 2HHHQ 2UXBL 1VQFA 1JC7A 4HSVA 4YHHL 4BBRB 1L2FA 3RZOH 1DM0B 3T1YQ 1KIXA 3KDFA 4YIJA 4K6LA 3M4OB 5T1IA 1STYA 1EZ8A 3I4LA 1AZQA 5IGDA 2RF4A 3FEWX 2H5XA 1CTMA 2L15A 3FPUB 4NXNQ 4JI2Q 1VQIA 3MWYW 4DPGA 1QNKA 4IUUA 1NMGA 1RIPA 2X69A 3HKZB 2B8FA 3W3AA 2SDFA 1FNUA 3KDFB 5C4JB 3AFQA 1NMFA 1BDOA 2PQEA 5C3WA 4RFBA 3H0GG 3BJUA 5CYUA 2EE1A 4OEMB 2Q8TA 1KRSA 1H9MA 3C1EA 3AYHB 3IFTA 3M4PA 3BVMA 1TWHH 3HOVG 3CCSA 2LS01 3QG1A 1XPOA 1VMPA 2WP8J 3TS2A 2NVXH 3J81i 3H3VC 2YYZA 2UXBQ 1GD7A 2PMZE 1Q82C 1Q81C 3T13A 3PUWA 1STBA 4GOPC 5EPLA 4L5TA 4QGUA 3OOCA 1VDZA 2K14A 4DV4Q 3DWPA 4A3IG 1EFWA 1XYIA 4AIMA 1HNWL 1QNUA 2PQAA 3UE1A 2E74C 1Q86C 5LMUQ 4APVA 1BF4A 1T5EA 3M4QA 4XYOA 2B2WA 1HZ9A 1GUTA 4LF4Q 5EPKA 1SNDA 2MO0A 3MC0B 4IQZA 4RCNA 4HJ7A 1UE5A 5C4HA 3VDYA 4LF7Q 4QIWE 4GS3A 1SE2A 4EQ5A 1U5KA 4LF5L 3J80c 5BN3A 1QWYA 1ML0D 2WAQB 4H13C 1Q90A 2VXWA 4XIGS 4JBMA 4C3HH 4AH6A 1N36L 2E8GA 2GN5A 3H09A 1E0BA 3GTQB 3ONAB 1VQDA 5D14A 2QA4A 1S5DD 4UY8C 2ZJRA 4LFBL 2F0UA 5E1FA 3HRZC 2RSOA 3MA2B 4B9WA 3BVZA 1YNXA 2UUBL 3HOUH 5K5PA 3PO2H 3ERQA 2ENBA 1SMYC 3KFUA 5I9OA 2I0QA 4LW1A 4MN3A 1Z47A 1D1IA 5C4JH 2AHOB 1R9TB 3GP7A 2K5DA 1DD2A 4IUQA 1FJGL 2JA6H 4HCEA 3E3XA 1S72A 1K28A 4DV6L 4B3RQ 4NKLA 2FMCA 1Q8KA 5EJWA 4AYBE 3GDEA 3ICEA 3BU2A 2AWOA 1LACA 5COYA 1I4HA 2N8NA 5JJLA 1OXXK 4GKKQ 1V1PA 2PMZB 3TP7A 3MFYA 5GAHC 2FMMA
chains in the Genus database with same CATH topology
1XWEA 2Q8RE 2FHTA 3SK5A 1UNSA 4ILWA 1A15A 3DMUA 1EU3A 3V05A 3NQTA 4CJ1B 2BA1A 2F1MA 5E4XA 1WTXA 5EKKA 1DZ1A 5CGKA 1BR9A 1SNQA 4ZKBB 5ELDA 1EQVA 3PUVA 3PO2B 1CQFA 1HTLD 4C3HB 4KD4A 3TSSA 1VMCA 2PYKA 3KK7A 2IX1A 2EDGA 1QB5D 3PUXA 3HOUB 2KA7A 1BCPF 1ICWA 1AP0A 2EY6A 4RAUC 5JPMC 1O80A 5IGEA 3NBHA 4XTCS 1A2UA 2RQXA 5J22A 3I4MB 1YNJC 4OIJA 4DXGA 3NWTA 1J9OA 1B2TA 4TQUS 4F87A 1IL8A 5C3EB 3KF8A 2BE5C 1BCPB 5AFWA 1ET9A 5M5WB 4V0BA 5CMDA 5I6YA 1STEA 1EWCA 2A68D 5J1ZA 2WKCA 2OF1A 4K14A 1UAPA 4KY6A 4R8IA 2EYMA 1GJXA 4CKEA 2WACA 2PPBC 4DF7A 2NB0A 4OO1H 1F2MA 1XTCD 3MFGA 4XT3B 4C3JB 4ME5A 3L3OC 1EY7A 1HA6A 4WRDA 2F03A 2Z4IA 2DNEA 5IGGA 1JB3A 2LMCB 1OO9B 4X3TA 4XXEA 1TY0A 3F2UA 3BVGA 1GOZA 1JWMD 2IX3A 3EFXD 4FF3A 2SOBA 4OIKA 1RDPD 1KNEA 2OT2A 3HP3A 5C0XG 3FPPA 5CORA 3M3YB 3MVVA 2K6AA 4LAAA 1QE6A 2LFNA 1CI3M 5E4WC 2JA5B 3M4YA 5EKLA 1D5MC 1EEFD 1RKNA 1EU4A 5KNDA 3OHXC 1PDQA 3OMCA 2F0NA 1F9QA 2EY1A 1GHJA 1X3PA 2EYOA 2MUYA 2QF7A 4KV6A 2MJ8A 4MIUA 3TN2A 3X3NA 2F0MA 2H4OA 3EVQA 4KK7A 3P75A 3A8JE 3P1HA 4PMWA 2NVQB 1WTVA 1QCBD 2VB2X 2HCIA 1JE4A 5I2YA 4IALA 3MXGA 1QG7A 1D6EC 2EYPA 3ITPA 5IGFA 2A5HA 2A6HD 2JXMB 3TMEA 5NUCA 4OL7A 3NTIA 3R3OA 3J7AV 1HQMC 4A3BB 5IGBA 4RWSC 4ZQ3A 4HSPA 3GTMB 5D3DA 3S2HB 2B2TC 1NUCA 4O1NA 1HFNA 4J6HA 2N55A 1LV9A 5FO9B 4K2KA 3K0YA 1DOLA 4QUCA 1WD0A 2QKIC 2XIWA 2BDNA 3EJIA 3I91A 1TWCB 3PV0A 3GTLB 1OXVA 3E5SA 5G3LD 1TVXA 4I65A 1ZYRD 2I07B 3BZDB 5M3FB 3WOFA 2L0CA 2NTTA 3HGBA 3LWEA 4C1NK 4KHZA 2EYFA 1CFMA 2J4XA 2L5TA 2L4NA 3H91A 4QB4A 5M3MB 4A93B 3NBIA 1ZKOA 3IL8A 2M9VA 3BS1A 1C48A 1B50A 2F0JA 1VF7A 3GTOB 2JA7B 3S14B 3HOZB 1NR4A 1PRTD 1TWHB 5KYLA 2WIIB 1I4PA 5J39A 1PTOB 1BO0A 2OXPA 5CBEE 1WVLA 3GTPB 3IFDA 1LTBD 1GUWA 5EQ0A 1FGBD 2MHVA 5BN4A 2WKDA 4N9TA 1TS3A 3H94A 2RKSA 2KHSA 3D4WA 3VR6A 1STNA 3OIQA 4X3SA 2SEBD 2K05A 3ZYYX 3NUCA 2OEOA 1V43A 3BDCA 1PFMA 1O7YA 1FR3A 2PZUA 2F0IA 3S1RB 1I6HB 2QCPX 3C46A 2EVBA 5C0XJ 1DXMA 4G57A 1LT4D 3S1MB 3GV6A 1HA5A 2F3WA 2IW3A 2IX0A 2PW7A 2RA4A 4FP5D 2I46A 3VYTA 5DM63 1X3QA 2E2JB 3HOXB 2NTSA 1S5ED 1O78A 1EYDA 3R93A 3L7ZC 4ZRZA 4EVOA 4L6TB 5HURA 1A3UA 1TWAB 1YNNC 2JYOA 4KN4C 4EQNA 2LKVA 3OIPA 4QIWB 1BOSA 2G9DA 4TSSA 3PIP3 2L11A 3A7AB 1TKWB 3GQBA 4WORA 5ELFA 4XQQA 1MSGA 5C5MA 5CV8A 2MGSA 5M5XB 5CV6A 2K01A 2K7VA 3DHQA 1GUOA 1G8ZD 5FO7B 2D2CC 4IFDH 4KTAA 1FD7D 2EJGC 3M7GA 2M00A 3URYA 3EROA 4IFDJ 4M8AA 4IN3A 5K36G 4FVMA 1TU2B 4DN4M 2B2YC 3RD4A 1GHKA 1PFNA 1AFPA 2NWGA 3K6OA 4DAYA 3ND8A 4QCLA 2O5IC 1IYUA 2CW0D 4DNTB 5KGUA 4FXDA 3K5MA 1NSNS 3SDZA 2RDFA 3SXHA 5C3XA 1WTWA 5C0XI 1S4ZA 3GD7A 1KNAA 4NP5A 1PZID 2R92B 4C56C 3KLRA 2F0KA 1HTPA 2E2HB 1LTRD 3OMGA 3NWSA 1STHA 3A8IE 1WTPA 2MPMA 1OXUA 2AQ1B 2R61A 5ELBA 5IT9L 3NP8A 3VA7A 3D31A 4BWGB 2BOSA 3BDOA 5JJZA 1F9RA 4ZUIA 1Y69U 1HUNA 4A3FB 1KLGD 1QILA 3L9AX 1RTOA 1HCZA 4A3JB 3J7AF 1CK1A 2R6GA 5I6WA 5HGTA 4CGYB 2KCCA 2JA8B 1F9PA 4UAIA 3Q24A 3CU7A 1EY5A 4J1MA 4JBWA 1PXUA 2A69C 2F0WA 4TRDA 1D5ZC 3WDNA 5IGCA 1B44D 3U9SA 3LX0A 4FXKC 4HN7A 1MI2A 4R8NA 2BE5D 3NTHA 5I2XA 1RJTA 3MEHA 3HOYB 1LTID 3WOEA 1FYCA 1B9NA 1LTTD 2ID0A 1ILPA 5TSSA 2EYJA 4E6IA 4V190 3A54A 2EPBA 5FO8B 2D62A 1WTQA 1WTRA 2XRQD 2KVMA 3NHHA 2X6GA 1MGSA 4NMZA 4KN7C 1EY0A 1IKMA 5EKIA 1D1KA 1SAPA 1PZJD 3D3RA 4KJNA 1PYWD 1AN8A 5CV9A 2AUKA 1B4OA 2NVYB 2NUCA 4RKLA 4HMIA 3D8GA 3HOWB 1RHPA 2KEDA 1ENFA 3NTKA 3AMUA 4OGQC 2X6LA 3VYUA 2A6HC 4CJ2C 2KECA 5IODA 5LHY1 4FF4A 5DM73 3UI2A 2HUGA 3K5LA 3CKIB 3P7JA 2B39A 3I70A 4HAEA 1SFOB 1Y8NB 5JOBA 4RCOA 2H1EA 2IPKD 3NQIA 1PLFA 2KCNA 3BG3A 3HG9A 1PTOD 1DYQA 4PMBA 2QEJC 5DNFA 4S3SA 4XQNA 5M9OA 2F0FA 1HFGA 3HS0C 1JR0D 1NCVA 1HHVA 1E2VA 3LWUA 3O13A 4RHRA 5CV5A 1EY9A 1U4LA 3MXNA 3V96A 1F77A 4KJOA 1T5XD 1LT3D 1BXTA 2FJ2A 2CQAA 1CM9A 1KDBA 2F0LA 2Q8IB 4NDXA 1B1ZA 2JP1A 3J7YW 4G7OC 3QOLA 3IKJA 2DN8A 1BNZA 4FF2A 1U4RA 3EA6A 2EJFC 1L0XB 4RA8A 2B2UC 1CA5A 2QILA 5BN5A 1EY4A 3D4RA 1SJHD 2JSOA 4H7BA 1Y1WB 2K04A 3DEOA 2K5WA 3KBGA 2K03A 4QF4A 4A3MB 3C2PA 4ULLA 1IW7D 2F0EA 1FNWA 1ENCA 2L1BA 2EY5A 2K1BA 2M2LA 3QIAA 4AYBB 4MHEA 5DEHA 1G2SA 4Y7NB 2R7ZB 1SSOA 5FKAC 3J80E 1OXSC 3CRKC 5KEEA 2L9HA 3TP8A 4ZLTF 2NBFA 3J81L 1DOMA 4DA2A 1KDCA 2EYLA 1JORA 1Q1EA 3DXJC 3Q22A 3VYSA 4XDXA 2EZVA 1XX8A 4DU9A 2AUJD 1HQRD 3CHBD 3TP6A 4ZK9B 1F9SA 2IJ0A 2F0OA 5JVG3 3GV3A 2XN9C 1SNCA 3K5OA 3M7NA 2JA6B 4Z9CB 1GXDC 3R2TA 3QOJA 1QOHA 1V8QA 3P20A 2NVTB 1CHQD 2VNUD 5CBAE 1E2ZA 1ENAA 1LT6D 1ONLA 2FINB 1V1PB 2IWHA 1CQVA 1TWGB 1EYAA 1CZWA 1LT5D 5A35A 1EOTA 5JPNC 4DNRB 4M1UB 3N52A 3OSOA 2PNRC 3T4AC 2R3ZA 1A3TA 1JOQA 2E2DC 4DK1A 2A74C 2BA0A 2J0TD 1EFID 1R4PB 3SVMA 4FYDA 5KNCA 1ZYRC 2XWJB 3OWFA 2KUMA 4KY7A 4KY5A 4KD3A 3W2DA 3LNNA 2KOLA 1SBBB 3M85A 1KLUD 3I72A 3TBIB 1HUMA 1UEAB 3C3LA 2TSSA 3D6WA 2XRSD 2PCFB 5G3LF 1MBYA 4FF1A 4RGNA 2K32A 2KEEA 1VF5C 1S5CD 3OW7A 4RHSA 1W6JA 4ODGA 4K5WA 1TIID 5C5LA 1VCIA 4XYQA 4PNYA 4ZKCB 3MAQA 2ZXOA 1TS2A 1YNND 2RVLA 4A3GB 1J8IA 2K5QA 1SE3A 3KLSA 1YNJD 1JQYD 3A55A 1RCVD 1I3QB 3PUYA 5D3IB 3SE0A 1ILQA 1V1OA 5E3FA 2EY2A 5LL6X 4K8JA 4B08A 4IUNA 4LK1C 4EQPA 3RMHA 5DAUA 1U4PA 5IOCA 5EGTA 4HEDA 2R93B 1BCPC 1AW7A 2A68C 2C5CA 1KTKA 1K8OA 3KLSX 3VR4A 5C4ZA 2B2TA 1MD2D 4K6DA 4HR7B 3K57A 3A7LA 1IHZA 3I73A 4I7ZC 4KMUC 2DNCA 1RF2D 2Z1CA 3VR5A 2LY7A 2GA4B 1Q3LA 3PMFA 1I4QA 3JAME 1GUNA 1G291 2E75C 1I50B 3TP5A 1SMYD 4U68A 4CJ0B 5EBDA 3QB3A 2IT1A 3IAYA 2PZWA 2A69D 5F2DA 3BDLA 4JK1C 1PMRA 3J80L 2F0TA 2MP1A 2AQ2B 4FXGC 1TY2A 1DONA 1GUSA 2YU9B 3E6ZX 2EYHA 4IURA 4RH6A 3QO2A 1SYFA 1A3VA 4P2CB 3FDTA 1STAA 3DM1A 1LTAD 4H0LC 2G9HD 3KUPA 4RGOS 4G7HC 4KI0A 1F2YA 1Y1VB 4IFDI 3EQLC 1II3A 5CC4A 2VUMB 1H9JA 4ID6A 1X32A 1F2LA 1GUGA 1G2TA 1ESRA 3NXWA 5FOBB 2BDOA 4GZYC 3JAML 3HOVB 1BUVT 1I6VC 3GO5A 3GTGB 3TZUA 4U673 1JICA 3U9OA 3MHBA 4RKBA 3SK6A 2RSNA 4IZ8A 1LABA 2O5JC 1SNOA 1SYEA 1M4VA 1PRTB 2C9OA 2E76C 1U9RA 1Q8IA 4G4KA 1IW7C 1OXTA 5I9PA 3S16B 2ZXRA 3FRPB 2XSCA 1D2BA 2B8GA 2JEBI 4TKOB 1G6ZA 4HMJA 5LL6S 4EQOA 1BCPD 1RD9D 4L8JA 1K8MA 3K58A 3H6MA 4UDUC 1LTSD 1CA6A 4DAVA 1WCMB 2D9UA 1SNPA 1K83B 1AZPA 3DUZA 3HZXA 1S5FD 2B2UA 4RGTA 5ISRA 4H44C 1Z6HA 4RGMA 2F0SA 5KNBA 3KBXA 2FFKB 3K7AB 3G7LA 1UUPA 4IUTA 1EY6A 3OPOA 1DOKA 2ZXPA 3I3CA 1L0YB 2F3VA 3T51B 1WD1A 3FVQA 2VB3X 3GTKB 3C1FA 3I8ZA 3SK4A 3K5NA 1BBXC 3S1QB 1Z7TA 4K2LA 1CZGA 1TS5A 1KDAA 1SE4A 1PTOH 3G6JB 1SYBA 5C0XH 4IFDG 2CVRA 1RTNA 5EBCA 3S15B 3NK9A 1DCZA 2CHBD 3OWEB 1O7ZA 3ND9A 2ICIA 3CRLC 1ZXTA 1SXTA 1PFBA 1JWUD 4X3KA 3A8KE 4ZYSA 4R9WA 4CHTB 1NAPA 1ZEQX 1IYVA 4A3KB 2B63B 1PRTC 4OO1I 4G7ZC 2SNSA 5K36H 1E2WA 2AQ3B 1SYGA 3PIO3 2JE6I 3RUZA 1I4RA 4PV1C 5M5YB 5I4DA 2B2WC 4C1NI 2D5DA 2XWBB 4PQXA 3R8BA 5A2QL 2KJXA 2XNAC 3N6RA 1TWFB 4Q0FA 3SEBA 2Z8LA 2RDGA 1TQOA 3GTJB 2EJMA 3NSWA 4HTHA 4WFN3 2K33A 3S17B 4FNFA 2L12A 1PRTF 1KABA 2SNMA 2L55A 3AU7A 4X3UA 1QJOA 4ZUJA 3HEJA 1H9SB 1D5XC 1RODA 1B3AA 3BYTB 3PUZA 1B9MA 2KQ3A 4C3JG 3VA5A 1DJRD 3I4NB 1SDFA 2NYZD 1CT1D 5D65A 2HDLA 1IKLA 5T1GA 2PO4A 2PW5A 3J81E 1H9RA 2ZT9C 5CV7A 1U4MA 4WJWA 1HPCA 2WV6D 4F7XA 4A3EB 1M8AA 5KRUA 1KAAA 4ZAIA 1TS4A 4DFAA 2XVSA 1JOKA 1WTOA 1R4QB 4BS9A 2JEAI 1A2TA 3NPPA 3RZOB 1EIGA 1JOOA 3Q0AA 5C4XB 1EZ6A 1C4QA 2NZ1D 3VR3A 4QUFA 3MZ5A 5C6AA 5A2QE 1AEXA 1LO5D 1Y8PB 3S9WA 3MTSA 4ABNA 4XQJA 2B2YA 4OO1G 4C3HG 5JAVA 3S1NB 4F8MA 1C8CA 1ESFA 1PTOF 3DEPA 4LJZC 1H9KA 2Z4HA 3SR1A 2B2VA 3T53B 4NW2A 1I4XA 4KKTA 5FLXL 1HRJA 1FNVA 2NN6I 2NN6G 1JCKB 3V2TA 3E0JA 1Y8OB 4QMGA 2NN6H 4J8QA 4OHJA 5IT9E 2F0QA 4XT1B 1EQTA 2O4XA 2IL8A 2ICEC 1F2ZA 1A6XA 2F0VA 2PZTA 2QDBA 1CHPD 2E2IB 3A56A 2Y0SB 4CBVA 3FMCA 1EEID 1G91A 2A6EC 3S2DB 4FO2A 1EY8A 5CV4A 5ELCA 4PMCA 3CQZB 2CW0C 2EXZA 2HCCA 1Q1BA 1LTGD 3I90A 4DK0A 5KYIA 3MXUA 5EPJA 1SYDA 4K8IA 4K5VA 3K59A 3QJYA 5JEAJ 5C44B 4KHVA 2B2VC 4EGVA 1EIHA 1EWHA 5FK9C 1JWSD 5IIFA 4KKUA 2HQEA 5JVH3 2K28A 3SHLA 4BA1I 3SK8A 4O42A 3BYYB 2BCOA 1SNMA 4LMQD 1Q12A 5CR3A 1W6KA 1HXYD 1TR5A 1NR2A 2DY8A 1SYCA 4A3IB 1BQQT 1S5BD 3DWAA 3RLFA 2F0GA 4DGZA 2A73B 3RZDB 1SEBD 1O7LA 3TZDA 2WB1B 5JEAG 2F0DA 2TMPA 3TDQA 4B9XA 1SJED 1XXGA 2O2LD 4DAPA 4CKCA 2A6ED 2DY7A 4DXFA 3VYRA 3R2IA 4F88A 3NE5B 5KIXA 1LLRD 4CKBA 3MXPA 1STGA 3H0GB 2V4DA 4IUPA 4KKSA 3AB9A 2WINB 4L63B 2F0PA 1EL0A 2RDHA 4K5XA 2AWNA 4N9PA 4C2MB 4IUVA 4BA2I 3Q6SA 2F4IA 3VR2A 3DWQA 1MSHA 3FKIB 2RBMA 1PZKD 1H9SA 2N88A 1TT2A 1EYCA 1B53A 5JEAH 3D4DA 3T16A 4C3IG 4BBSB 4A3DB 1ET6A 5FLXE 3Q23A 2J7ZA 1I4GA 1PTOC 4HCSA 3X3MA 3PO3B 3QWNA 5ELEA 2HDMA 2NVXB 2F0HA 4BY1B 2EOTA 4C3IB 3T56B 3D6CA 4BY7B 4Q5VA 1JC7A 4HSVA 4BBRB 1DM0B 4YIJA 4K6LA 3M4OB 5T1IA 1STYA 1EZ8A 3I4LA 1AZQA 5IGDA 3FEWX 1CTMA 3FPUB 3MWYW 1QNKA 4IUUA 2X69A 3HKZB 2B8FA 3W3AA 2SDFA 1FNUA 5C4JB 1BDOA 2PQEA 5C3WA 4RFBA 5CYUA 2EE1A 2Q8TA 1H9MA 3C1EA 3IFTA 3BVMA 2LS01 3QG1A 1VMPA 2WP8J 3H3VC 2YYZA 3T13A 3PUWA 1STBA 5EPLA 3OOCA 1VDZA 3DWPA 1XYIA 1QNUA 2E74C 1BF4A 1T5EA 4XYOA 2B2WA 1GUTA 5EPKA 1SNDA 3MC0B 4IQZA 4RCNA 5C4HA 1SE2A 5BN3A 1QWYA 1ML0D 2WAQB 4H13C 1Q90A 2VXWA 4XIGS 3H09A 1E0BA 3GTQB 3ONAB 5D14A 1S5DD 2F0UA 5E1FA 3HRZC 2RSOA 3MA2B 4B9WA 3BVZA 5K5PA 3ERQA 2ENBA 1SMYC 5I9OA 4MN3A 1Z47A 1D1IA 1R9TB 3GP7A 2K5DA 1DD2A 4IUQA 4HCEA 4NKLA 2FMCA 5EJWA 2AWOA 1LACA 5COYA 1I4HA 1OXXK 1V1PA 2PMZB 3TP7A 3MFYA 2FMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0T A;  3ITP A;  5IGF A;  5CV4 A;  1F2M A;  2F0P A;  2F0W A;  4F7X A;  4TRD A;  4PMC A;  3SK5 A;  5CV6 A;  4ME5 A;  4EQO A;  1EY7 A;  4K5X A;  3DHQ A;  4N9T A;  4PMB A;  5NUC A;  3DMU A;  3H6M A;  4N9P A;  4S3S A;  4WRD A;  5M9O A;  5KRU A;  2EXZ A;  1KDC A;  2F0F A;  1SYG A;  5IGG A;  1KAA A;  2EYL A;  2RKS A;  2KHS A;  4KTA A;  4OL7 A;  5IGC A;  2EYH A;  4ODG A;  3RUZ A;  3NQT A;  3R3O A;  1SYF A;  1A3V A;  3D4W A;  4K5W A;  3T13 A;  1JOR A;  5C5L A;  1STN A;  2M00 A;  3ERO A;  4DFA A;  1SNP A;  1STB A;  1JOK A;  4ZQ3 A;  2RBM A;  3TP8 A;  5KYI A;  4PNY A;  1STA A;  3HZX A;  3LX0 A;  1A2T A;  5CV5 A;  4R8N A;  1SYD A;  3MEH A;  4K8I A;  5ISR A;  1NUC A;  4K5V A;  1EY9 A;  3NUC A;  5EKK A;  4DU9 A;  4J6H A;  1JOO A;  4KJO A;  1TT2 A;  2OEO A;  5CGK A;  3BDC A;  2SOB A;  1EYC A;  2F0S A;  4K2K A;  1EZ6 A;  1SNQ A;  1KDB A;  2EYJ A;  1EQV A;  2F0L A;  3D4D A;  4KHV A;  3TP6 A;  4E6I A;  2PZU A;  3T16 A;  4NDX A;  1SND A;  1F2Y A;  2F0I A;  3MZ5 A;  5C6A A;  1EY6 A;  3QOL A;  5IIF A;  5KGU A;  1AEX A;  2HQE A;  5C4H A;  3S9W A;  4KD4 A;  1II3 A;  5CC4 A;  1NSN S;  2F3V A;  1TQO A;  5E3F A;  2F0O A;  3SHL A;  2EY2 A;  2RDF A;  3MVV A;  3SXH A;  5C3X A;  4G57 A;  3SK8 A;  1SNC A;  4ID6 A;  3EJI A;  2PYK A;  3C1F A;  4K8J A;  4LAA A;  3NHH A;  4IUN A;  3SK4 A;  5JAV A;  4NMZ A;  3NXW A;  3QOJ A;  2F0H A;  2F3W A;  4F8M A;  4HTH A;  4EQP A;  1EY0 A;  1SNM A;  5DAU A;  4NP5 A;  2PW7 A;  3D6C A;  4KJN A;  4K2L A;  1KAB A;  5EKL A;  1ENA A;  3E5S A;  5IOC A;  2EY6 A;  5EGT A;  2F0K A;  1KDA A;  2SNM A;  1EY4 A;  5CR3 A;  1RKN A;  4I65 A;  1SYB A;  1TR5 A;  5CV9 A;  4H7B A;  2F0U A;  5E1F A;  3SR1 A;  3OMG A;  1SYC A;  4B9W A;  1EY5 A;  5IGE A;  1EYA A;  1STH A;  2F0G A;  3OMC A;  4ZUJ A;  4DGZ A;  1A2U A;  4YIJ A;  2NUC A;  2EYF A;  2F0N A;  4RKL A;  4HMI A;  1EYD A;  2EY1 A;  3D8G A;  3MHB A;  3OSO A;  3U9O A;  4RKB A;  3SK6 A;  5C4Z A;  5J22 A;  3ERQ A;  2ENB A;  2EYO A;  3HEJ A;  3NK9 A;  4IZ8 A;  1STY A;  2F0D A;  3NP8 A;  4K6D A;  1EZ8 A;  4KV6 A;  4QF4 A;  5I9O A;  5IGD A;  4EVO A;  5K5P A;  3V2T A;  4QB4 A;  1A3T A;  1IHZ A;  2F0E A;  4MIU A;  4QMG A;  5HUR A;  1JOQ A;  1A3U A;  1ENC A;  2F0M A;  3EVQ A;  5IGB A;  2EY5 A;  2KQ3 A;  3TME A;  1SNO A;  1SYE A;  3P75 A;  5IOD A;  3P1H A;  4ZUI A;  3VA5 A;  4B9X A;  2F0Q A;  2O4X A;  5I6Y A;  4EQN A;  5DEH A;  2LKV A;  2F0J A;  3OWF A;  1U9R A;  3PMF A;  1F2Z A;  4NKL A;  5J1Z A;  2F0V A;  2PZT A;  4KY7 A;  2QDB A;  4KY5 A;  4KD3 A;  5I9P A;  2OF1 A;  2PQE A;  5C3W A;  3TP5 A;  4K14 A;  5KIX A;  5I6W A;  5KYL A;  3MXP A;  1STG A;  4KY6 A;  5JOB A;  5HGT A;  5J39 A;  2EYM A;  3QB3 A;  2PW5 A;  4IAL A;  2PZW A;  2WAC A;  5F2D A;  5KEE A;  3C1E A;  3TP7 A;  5CV7 A;  2OXP A;  4WOR A;  2SNS A;  3BDL A;  4DF7 A;  4HMJ A;  1EY8 A;  4J1M A;  2EYP A;  5C5M A;  5CV8 A; 
#chains in the Genus database with same CATH topology
 1XWE A;  1N34 Q;  2Q8R E;  2FHT A;  3SK5 A;  1UNS A;  1A62 A;  4ILW A;  1A15 A;  3DMU A;  4R4C A;  1EU3 A;  2Z6B A;  1GVP A;  2ZTC A;  5IYC G;  3V05 A;  2UUB Q;  3HKS A;  3NQT A;  3RR5 A;  4JI3 L;  4CJ1 B;  2BA1 A;  2F1M A;  2ZJQ A;  5DLQ E;  1K8A C;  1IBK Q;  5E4X A;  4DR5 L;  1WTX A;  5EKK A;  1DZ1 A;  5CGK A;  1BR9 A;  4WJ4 A;  1SNQ A;  4ZKB B;  5ELD A;  1EQV A;  4DR7 L;  3PUV A;  3PO2 B;  3UDI A;  1CQF A;  3EN2 A;  4TVA B;  1WYD A;  3SGI A;  1HTL D;  4C3H B;  4KD4 A;  3TSS A;  1FGU A;  1VMC A;  4JPB W;  2E5L L;  2PYK A;  3KK7 A;  2IX1 A;  1X3E A;  2EDG A;  1CSQ A;  1QB5 D;  3PUX A;  3G4S A;  3TQY A;  3HOU B;  2QGQ A;  2KA7 A;  1BCP F;  1ICW A;  1AP0 A;  2EY6 A;  4RAU C;  4A3M H;  5JPM C;  5C4X G;  1VQE A;  5IYB H;  2VZA A;  1O80 A;  2GVA A;  5IGE A;  1PHJ A;  5IWA Q;  3NBH A;  4XTC S;  1A2U A;  2RQX A;  5GRO A;  3Q8D A;  5J22 A;  2Q2H A;  4HIO A;  3I4M B;  1YNJ C;  4OIJ A;  4DXG A;  1V1Q A;  3NWT A;  1J9O A;  3JAM i;  3OTO Q;  1B2T A;  3KF8 B;  4X65 Q;  3NEL A;  4TQU S;  4F87 A;  4A3F G;  4OWX B;  1IL8 A;  5C3E B;  1J5E L;  3KF8 A;  2BE5 C;  1BCP B;  5AFW A;  3S15 H;  3PO3 H;  1ET9 A;  5M5W B;  4V0B A;  5IE8 A;  1KRT A;  5CMD A;  5I6Y A;  1STE A;  1YIJ A;  2N78 A;  1EWC A;  2A68 D;  5J1Z A;  1VQC A;  2WKC A;  2OF1 A;  4K14 A;  3CCM A;  1UAP A;  4GLX A;  4KY6 A;  4R8I A;  2EYM A;  1PFS A;  1GJX A;  4CKE A;  2WAC A;  2PPB C;  4DF7 A;  2AKW B;  2NB0 A;  4A3J H;  4OO1 H;  1F2M A;  2EIF A;  1XTC D;  3MFG A;  4XT3 B;  4C3J B;  5IP7 H;  4ME5 A;  3L3O C;  1EY7 A;  1HA6 A;  4GKJ Q;  4WRD A;  2F03 A;  2Z4I A;  1WFQ A;  2DNE A;  5IGG A;  4R4Q A;  1JB3 A;  2LMC B;  1OO9 B;  4X3T A;  1XJV A;  4XXE A;  1TY0 A;  3CP0 A;  2PI2 A;  3F2U A;  1VQ4 A;  3BVG A;  2DJG C;  1GOZ A;  1VQP A;  1JWM D;  2IX3 A;  3EFX D;  4FF3 A;  2SOB A;  1I50 H;  1AH9 A;  4OIK A;  4OWT B;  1RDP D;  1KNE A;  5IY0 A;  2OT2 A;  3HP3 A;  5C0X G;  3FPP A;  5FLM G;  5COR A;  3F2B A;  3M3Y B;  3MVV A;  2K6A A;  4LAA A;  1QE6 A;  2LFN A;  1CI3 M;  5E4W C;  2JA5 B;  3M4Y A;  4Y7N H;  4MNO A;  5EKL A;  4DV7 Q;  1B70 B;  1D5M C;  1EEF D;  2HIV A;  1RKN A;  1EU4 A;  4WJ3 M;  3U50 C;  5KND A;  4DUY Q;  4LF6 L;  3FHW A;  3E9H A;  3OHX C;  1PDQ A;  4JW0 A;  3GTL H;  3OMC A;  2F0N A;  1F9Q A;  2EY1 A;  3E0E A;  1GHJ A;  1X3P A;  5GAD C;  2EYO A;  2MUY A;  4YWK A;  2QF7 A;  4KV6 A;  2R7Z G;  2MJ8 A;  4MIU A;  5LMN Q;  3TN2 A;  3X3N A;  2F0M A;  2H4O A;  3EVQ A;  4KK7 A;  4JI6 Q;  3P75 A;  4AYB G;  3A8J E;  3P1H A;  4PMW A;  2NVQ B;  1WTV A;  5GAE C;  2C35 B;  1QCB D;  2VB2 X;  3KJO A;  2HCI A;  2B63 G;  1JE4 A;  3HOX G;  5I2Y A;  4KHP Q;  4IAL A;  4IPG A;  3MXG A;  1VQL A;  2Q2I A;  1HZA A;  1QG7 A;  1D6E C;  2FXQ A;  2K5N A;  3G71 A;  1Y1W G;  2EYP A;  3ITP A;  5IGF A;  4HJA A;  3ULL A;  1E3P A;  2A5H A;  2A6H D;  4OWW B;  2JXM B;  3TME A;  5E7N A;  5NUC A;  4OL7 A;  3NTI A;  3R3O A;  2JA5 H;  3J7A V;  1HQM C;  1N33 L;  4A3B B;  5IGB A;  4RWS C;  4ZQ3 A;  4HSP A;  3GTM B;  4GOP B;  4LF6 Q;  2I5L X;  5D3D A;  5ELO A;  3S2H B;  2K5V A;  1E7Z A;  2B2T C;  4ME3 A;  1NUC A;  4O1N A;  3E9I A;  1HFN A;  4J6H A;  2N55 A;  2K75 A;  4X6A H;  1LV9 A;  5FO9 B;  4K2K A;  4GKK L;  3J81 j;  4LF4 L;  3K0Y A;  1VQM A;  1DOL A;  3S17 H;  4QUC A;  1QZG A;  1WD0 A;  2QKI C;  2HT1 A;  2XIW A;  1PH1 A;  2BDN A;  1UWV A;  3EJI A;  3I91 A;  1TWC B;  5BR8 Q;  3PV0 A;  3GTL B;  1OXV A;  3M4O H;  5IWA L;  1HJP A;  1WTH A;  4A3K H;  3E5S A;  5G3L D;  1TVX A;  1MJE A;  2JA8 H;  4I65 A;  2F3I A;  1ZYR D;  2I07 B;  3BZD B;  1T9H A;  5M3F B;  3WOF A;  5JJI A;  2LXK A;  2JQO A;  2L0C A;  2NTT A;  1EQR A;  3HGB A;  3LWE A;  4UP9 A;  4C1N K;  4JI0 Q;  4KHZ A;  2EYF A;  4IPC A;  1CFM A;  4B3T Q;  2J4X A;  1WCM G;  2L5T A;  4DV0 Q;  2L4N A;  3H91 A;  4QB4 A;  5M3M B;  4A93 B;  3NBI A;  1X56 A;  1ZKO A;  2K5H A;  3IL8 A;  2M9V A;  2Z9H A;  3BS1 A;  3HOX H;  2QEX A;  1CUK A;  1C48 A;  1B50 A;  1IYJ B;  3CCE A;  2GVB A;  2F0J A;  3S2H H;  1VF7 A;  3GTO B;  2JA7 B;  3S14 B;  3HOZ B;  1NR4 A;  1UE7 A;  1PRT D;  1TWH B;  3HOW G;  5KYL A;  2WII B;  1I4P A;  5J39 A;  5IYD H;  1PTO B;  2AMC B;  1HR0 W;  1BO0 A;  4GN3 B;  3MEF A;  3WWV A;  1XMQ L;  2OXP A;  5CBE E;  1WVL A;  4B3S Q;  3GTP B;  3IFD A;  1LTB D;  1PYB A;  1GUW A;  5EQ0 A;  4JG2 A;  1FGB D;  2MHV A;  5BN4 A;  2WKD A;  4N9T A;  1TS3 A;  3H94 A;  1YJN A;  2RKS A;  2KHS A;  2CQO A;  3D4W A;  3VR6 A;  1STN A;  1QUQ A;  3CQZ H;  3OIQ A;  1E1O A;  4X3S A;  2SEB D;  2K05 A;  3ZYY X;  2IHE A;  3NUC A;  2OEO A;  1V43 A;  3BDC A;  1YIT A;  4GLV B;  1PFM A;  2VS1 A;  2CWP A;  1O7Y A;  1M90 C;  1FR3 A;  3HOW H;  2PZU A;  2F0I A;  3S1R B;  1I6H B;  3HOY G;  1BKB A;  2A19 A;  2QCP X;  2EQS A;  3C46 A;  2EVB A;  1KC8 C;  5C0X J;  4JI4 Q;  2VUM G;  1DXM A;  4G57 A;  1C0A A;  1LT4 D;  3S1M B;  4K0K Q;  1GO3 E;  3GV6 A;  4QJF A;  1HA5 A;  2F3W A;  2IW3 A;  2IX0 A;  1N33 Q;  2PW7 A;  1XTD A;  3AFP A;  3BZC A;  1CKO A;  2RA4 A;  1PYS B;  4OON A;  4FP5 D;  3STB D;  4DAY B;  2I46 A;  3VYT A;  3A0J A;  1R9T H;  5DM6 3;  1X3Q A;  2A8V A;  2E2J B;  3HOX B;  2NTS A;  1S5E D;  2KBN A;  1O78 A;  1EYD A;  3R93 A;  3NEM A;  3L7Z C;  4A3J G;  4ZRZ A;  2I5M X;  4EVO A;  2YU9 H;  1NJI C;  4L6T B;  5HUR A;  4GNX B;  4DR6 L;  3I7F A;  1TWG H;  1L0W A;  1A3U A;  2EXD A;  1TWA B;  1YNN C;  2JYO A;  4A4I A;  4KN4 C;  4EQN A;  2LKV A;  3OIP A;  4QIW B;  1BOS A;  2G9D A;  4TSS A;  1MHW C;  3PIP 3;  2MO1 A;  2L11 A;  1E1T A;  2KCT A;  1HR0 Q;  3A7A B;  1TKW B;  1H95 A;  2BH8 A;  3GQB A;  4WOR A;  5ELF A;  4XQQ A;  1MSG A;  5C5M A;  5CV8 A;  2MGS A;  3KF6 B;  5M5X B;  4JV5 Q;  1PH9 A;  4R4T A;  5CV6 A;  2B63 H;  2K01 A;  2K7V A;  3DHQ A;  1MIU A;  2R92 G;  1GUO A;  2OQ0 A;  4L5S A;  1G8Z D;  4JBJ A;  2D2C C;  5FO7 B;  1PH4 A;  4IFD H;  4KTA A;  1HNZ Q;  4H02 A;  1FD7 D;  2EJG C;  3M7G A;  3ULJ A;  3QR8 A;  2M00 A;  3URY A;  3ERO A;  4IFD J;  4M8A A;  4IN3 A;  3CCQ A;  4DV2 L;  5K36 G;  4FVM A;  3CW2 C;  1TU2 B;  1Y1W H;  4DN4 M;  2B2Y C;  3RD4 A;  1GHK A;  1PFN A;  1AFP A;  2R93 G;  2NWG A;  2D0O A;  3K6O A;  4DAY A;  4HJ9 A;  3ND8 A;  4QCL A;  1VQK A;  1K8G A;  2O5I C;  1IYU A;  2CW0 D;  4IJL A;  1C7Y A;  4LF5 Q;  4DNT B;  1KD1 C;  5KGU A;  4FXD A;  2XGT A;  3K5M A;  1NSN S;  3SDZ A;  1IXR A;  2RDF A;  3SXH A;  5C3X A;  4DR1 L;  1WTW A;  5C0X I;  2Y0S E;  1S4Z A;  3GD7 A;  1KNA A;  4NP5 A;  1PZI D;  2R92 B;  4C56 C;  3KLR A;  2F0K A;  5LMN W;  1LUZ A;  1HTP A;  3HOY H;  2IY5 B;  2E2H B;  1LTR D;  3OMG A;  3NWS A;  4BY1 H;  1STH A;  3A8I E;  1WTP A;  2MPM A;  1OXU A;  2AQ1 B;  1VQ9 A;  4PG3 A;  2R61 A;  4LNQ A;  5ELB A;  5IT9 L;  3NP8 A;  3VA7 A;  3D31 A;  4BWG B;  2BOS A;  3BDO A;  4L5Q A;  4IJH A;  5JJZ A;  1F9R A;  1XMQ Q;  4ZUI A;  1Y69 U;  1HUN A;  5C3E G;  4A3F B;  1KLG D;  1QIL A;  3L9A X;  1RTO A;  1HCZ A;  4A3J B;  3J7A F;  1CK1 A;  2R6G A;  2QW7 A;  3LGJ A;  4JOI A;  5I6W A;  5HGT A;  4CGY B;  4A3K G;  2KCC A;  2JA8 B;  2A1A A;  1F9P A;  4UAI A;  3Q24 A;  4JI2 L;  4A3L H;  4NXN L;  3CU7 A;  1EY5 A;  4J1M A;  4PZ7 A;  4JBW A;  1PXU A;  2A69 C;  2VQF L;  4LF8 Q;  2F0W A;  2R7D A;  4TRD A;  5AJ3 Q;  3ULP A;  1KL9 A;  5M5Y H;  1D5Z C;  3WDN A;  4DR2 Q;  5IGC A;  1B44 D;  1K0R A;  4X62 L;  1G51 A;  1FVI A;  3I4O A;  3JC6 6;  3T1Y L;  4DR2 L;  3U9S A;  1EOV A;  3LX0 A;  4FXK C;  4GKJ L;  5IP9 G;  4HN7 A;  1MI2 A;  2BE5 D;  3NTH A;  4R8N A;  5I2X A;  1RJT A;  3MEH A;  3HOY B;  1LTI D;  3WOE A;  2HHH L;  1FYC A;  4CDC C;  1HNX Q;  1B9N A;  1LTT D;  1SE8 A;  2ID0 A;  1ILP A;  3M3Y H;  5TSS A;  2MFI A;  2EYJ A;  3K8A A;  4E6I A;  5FLM H;  4N8F A;  4V19 0;  3A54 A;  2EPB A;  5FO8 B;  2D62 A;  1WTQ A;  1CKM A;  2R92 H;  2JA6 G;  1WTR A;  2XRQ D;  2KVM A;  1BBW A;  3K7U C;  1LM0 A;  2IHF A;  3NHH A;  2X6G A;  1MGS A;  4NMZ A;  1YHQ A;  4KN7 C;  1JJG A;  1EY0 A;  1IKM A;  2RCN A;  5EKI A;  1I94 L;  1D1K A;  1SAP A;  1PZJ D;  1WJJ A;  1WOC A;  1PYW D;  3D3R A;  4KJN A;  1OTC A;  1N32 Q;  4LFA L;  4JI7 L;  4A3C G;  1AN8 A;  5CV9 A;  4JI7 Q;  4MTK A;  1D8L A;  2AUK A;  3S1N H;  1B4O A;  2NVY B;  2NUC A;  4RKL A;  4HMI A;  3KOJ A;  3D8G A;  3CCL A;  3HOW B;  4CDF C;  1RHP A;  2KED A;  4JI8 L;  1ENF A;  2R7F A;  3S1R H;  3NTK A;  1I6H H;  3AMU A;  4OGQ C;  2JA7 G;  2X6L A;  2WB1 E;  3VYU A;  2UUC Q;  2A6H C;  3PSI A;  4CJ2 C;  2KEC A;  5IOD A;  5LHY 1;  4FF4 A;  4KHP L;  5DM7 3;  3UI2 A;  1KQS A;  3W5O A;  5M3M G;  4A93 G;  2HUG A;  2E5L Q;  3KF6 A;  3P7J A;  3CKI B;  2B39 A;  3I70 A;  4R4I A;  3K5L A;  2VL6 A;  4HAE A;  1SFO B;  1JB7 A;  1Y8N B;  1B8A A;  3K81 C;  5JOB A;  4RCO A;  2H1E A;  2IPK D;  2ZTE A;  2K50 A;  2Q2T A;  3NQI A;  1YEZ A;  1PLF A;  2KCN A;  3BG3 A;  4JOI C;  4X64 L;  3J7Z C;  4HJ8 A;  3HG9 A;  1PTO D;  1DYQ A;  2UU9 L;  1W2B A;  2G5D A;  3CPW A;  4PMB A;  2QEJ C;  5DNF A;  4S3S A;  4XQN A;  5M9O A;  2F0F A;  2JJQ A;  5IYB G;  1HFG A;  3HS0 C;  1JR0 D;  2WAQ G;  4MTN A;  4A3M G;  1NCV A;  1HHV A;  1E2V A;  4GNX A;  3LWU A;  3O13 A;  1DGS A;  4RHR A;  5CV5 A;  1Q7Y C;  4LFA Q;  1B3Q A;  1EY9 A;  1U4L A;  3MXN A;  3V96 A;  1F77 A;  4KJO A;  1T5X D;  1LT3 D;  4LF7 L;  1BXT A;  2FJ2 A;  2CQA A;  1CM9 A;  1KDB A;  4R4O A;  1K3R A;  3A5Z B;  2F0L A;  2Q8I B;  4GLA C;  1ASY A;  4NDX A;  1B1Z A;  2JP1 A;  3J7Y W;  1YBY A;  4G7O C;  3QOL A;  3IKJ A;  2DN8 A;  1NY4 A;  2I5H A;  1BNZ A;  5M5X H;  4FF2 A;  1U4R A;  3HFZ B;  1SMX A;  4A3B G;  2HIX A;  2P5Z X;  3EA6 A;  1YVC A;  2EJF C;  1L0X B;  4RA8 A;  4LWC A;  2Q2U A;  2B2U C;  1CA5 A;  2NVY H;  2QIL A;  1HNX L;  5BN5 A;  3GTK H;  1EY4 A;  3D4R A;  4UP7 A;  5J3B A;  1SJH D;  3JAM c;  2JSO A;  4H7B A;  1Y1W B;  3H3V I;  3ZJY C;  4O0A A;  2K04 A;  3OYY A;  2K52 A;  1EUJ A;  4R1J A;  3RN2 A;  3DEO A;  2K5W A;  3KBG A;  2K03 A;  1UEB A;  3KYH C;  4QF4 A;  4A3M B;  4BBS H;  3C2P A;  3L2P A;  4A3D H;  4ULL A;  1IW7 D;  2F0E A;  3F2C A;  1FNW A;  1ENC A;  2L1B A;  2EY5 A;  2YV5 A;  3D0F A;  2K1B A;  2K4K A;  2M2L A;  3QIA A;  4AYB B;  2Z6K A;  4MHE A;  4HJ5 A;  3TEH B;  3PIP A;  5DEH A;  3STB C;  1G2S A;  4Y7N B;  2R7Z B;  1QVG A;  4BY7 H;  4QL5 A;  1SSO A;  5FKA C;  3RNU A;  1P16 A;  3J80 E;  1QVF A;  1OXS C;  3CRK C;  1IBK L;  1VQA A;  5KEE A;  1JJC B;  2L9H A;  1J5E Q;  3TP8 A;  4ZLT F;  4IO9 A;  4LUZ A;  2NBF A;  3J81 L;  1CSP A;  1DOM A;  4DA2 A;  1KDC A;  4IPH A;  4DR3 Q;  2EYL A;  1VQ8 A;  1JOR A;  1Q1E A;  2WAQ E;  3DXJ C;  2N3S A;  3G48 A;  4DR3 L;  3Q22 A;  3GTQ H;  4DV5 Q;  1RL2 A;  3VYS A;  4XDX A;  2EZV A;  4YCV A;  1XX8 A;  4DU9 A;  1XMO Q;  1L1O C;  2AUJ D;  1HQR D;  3CHB D;  3RLN A;  3TP6 A;  1VS0 A;  3AQQ A;  4ZK9 B;  1X3F A;  3F1Z A;  1X55 A;  1F9S A;  2UXD Q;  2IJ0 A;  2F0O A;  4IPD A;  5JVG 3;  3FKI G;  3GV3 A;  2XN9 C;  2KHI A;  1SNC A;  3K5O A;  3M7N A;  2JA6 B;  4Z9C B;  1GXD C;  3R2T A;  3QOJ A;  1QOH A;  2CFM A;  1V8Q A;  3P20 A;  2NVT B;  1X3G A;  1CHQ D;  2VNU D;  5CBA E;  3GTM H;  1ONL A;  1E2Z A;  1ENA A;  1LT6 D;  2FIN B;  1V1P B;  1PH6 A;  4BXX G;  2IWH A;  1CQV A;  4HIK A;  1YZ6 A;  1TWG B;  1EYA A;  1P8L A;  1CZW A;  1LT5 D;  5A35 A;  1EOT A;  5JPN C;  3H15 A;  4LF9 Q;  4DNR B;  4M1U B;  1HNZ L;  2JN4 A;  3N52 A;  3OSO A;  2PNR C;  1VQN A;  2R93 H;  3T4A C;  2R3Z A;  4POG A;  1YHA A;  1A3T A;  4JV5 L;  1JOQ A;  1IZ6 A;  1JE5 A;  2E2D C;  4UHV A;  4DK1 A;  2A74 C;  2BA0 A;  4GN5 A;  3U4V A;  2J0T D;  1M1K C;  1EFI D;  4JBK A;  1R4P B;  3SVM A;  4FYD A;  1K0S A;  5KNC A;  4DNI A;  1ZYR C;  2XWJ B;  2VQE L;  3OWF A;  4YCU A;  1NBW A;  2KUM A;  1UE1 A;  4DK3 C;  4KY7 A;  4KY5 A;  4KD3 A;  1XMO L;  2WB1 G;  3W2D A;  3LNN A;  2KOL A;  1SBB B;  3M85 A;  4DV6 Q;  4J15 A;  1KLU D;  4P74 A;  3I72 A;  3TBI B;  1HUM A;  1EYG A;  1UEA B;  3C3L A;  2TSS A;  3D6W A;  2XRS D;  2PCF B;  3FP9 A;  5G3L F;  1MBY A;  3FKI H;  4FF1 A;  4RGN A;  2K32 A;  4OX9 Q;  2KEE A;  2PNH A;  1VF5 C;  1ICF B;  1S5C D;  1Z9F A;  3OW7 A;  4RHS A;  5M3M H;  4A93 H;  1W6J A;  4MZ9 A;  4ODG A;  2NVT H;  3PF4 A;  4K5W A;  1TII D;  5C5L A;  4KLK A;  1VCI A;  4XYQ A;  2CWA A;  4PNY A;  4ZKC B;  3MAQ A;  4DV3 L;  2ZXO A;  1TS2 A;  1YNN D;  2JA7 H;  3GTO H;  2RVL A;  4A3G B;  2WFW A;  3RLO A;  2K5Q A;  1J8I A;  1IBL L;  1SE3 A;  1AE2 A;  3KLS A;  1SFO H;  5IP9 H;  3PO2 G;  4A3B H;  1BBU A;  2YTY A;  1YNJ D;  1JQY D;  3A55 A;  1KHI A;  1RCV D;  1I3Q B;  3PUY A;  3CF5 A;  5D3I B;  2F52 A;  1PV4 A;  3SE0 A;  1ILQ A;  1V1O A;  5E3F A;  1K73 C;  2EY2 A;  5LL6 X;  1HH2 P;  1EWI A;  4K8J A;  4B08 A;  1UE6 A;  4POF A;  4IUN A;  1Y1V H;  1PH5 A;  4JI6 L;  4LK1 C;  4EQP A;  1XNR Q;  3RMH A;  5DAU A;  1U4P A;  5IOC A;  2ES2 A;  5EGT A;  4HED A;  3W1G A;  1BCP C;  2R93 B;  1AW7 A;  2A68 C;  2C5C A;  4DV5 L;  4YHH Q;  1Q46 A;  1KTK A;  5FLX c;  1K8O A;  3KLS X;  2NVQ H;  3VR4 A;  5C4Z A;  1NE3 A;  1MD2 D;  2B2T A;  1CKN B;  4K6D A;  4A3F H;  3TRE A;  4HR7 B;  3K57 A;  1LYL A;  3A7L A;  3L0O A;  1IHZ A;  3I73 A;  4I7Z C;  4KMU C;  4ZCK A;  5FJ8 H;  2DNC A;  1RF2 D;  4OEL B;  2Z1C A;  3VR5 A;  2UUA L;  3S1M H;  2RCF A;  2LY7 A;  1CKN A;  2GA4 B;  4AQY Q;  1Q3L A;  3PMF A;  1I4Q A;  3JAM E;  1GUN A;  1G29 1;  2E75 C;  1I50 B;  3TP5 A;  4X65 L;  1SMY D;  4U68 A;  4CJ0 B;  5EBD A;  1FL0 A;  3I56 A;  3QB3 A;  4DR4 Q;  2IT1 A;  2KEN A;  3IAY A;  2PZW A;  1I5F A;  2A69 D;  5F2D A;  3BDL A;  2ALY B;  4JK1 C;  1PMR A;  3J80 L;  2F0T A;  3B6Y A;  2MP1 A;  2AQ2 B;  4FXG C;  1TY2 A;  1DON A;  3U58 A;  1GUS A;  4L5R C;  2YU9 B;  4JCV E;  3E6Z X;  4YWM A;  2EYH A;  4IUR A;  4RH6 A;  3QO2 A;  4C3I H;  5C3E H;  1SYF A;  1A3V A;  3UDF A;  4P2C B;  1XNR L;  3FDT A;  1D7Q A;  1STA A;  3DM1 A;  1LTA D;  4H0L C;  2G9H D;  4GN4 B;  1W3S A;  3KUP A;  4RGO S;  3T1H L;  1VQ7 A;  2VQF Q;  4LF8 L;  4JVZ A;  4JI1 Q;  4JYA Q;  1PA6 A;  4G7H C;  3NBH B;  3RN5 A;  2RHS B;  4KI0 A;  1F2Y A;  1Y1V B;  4IFD I;  3EQL C;  3K80 C;  1II3 A;  5CC4 A;  1MKH A;  3KJP A;  4N8X 1;  2VUM B;  1H9J A;  5C44 H;  4ID6 A;  1X32 A;  3W1B A;  4DR5 Q;  1F2L A;  1GUG A;  1G2T A;  3I4N H;  2UUA Q;  1ESR A;  3NXW A;  3CPF A;  5FOB B;  2BDO A;  2F4V L;  4GZY C;  3JAM L;  3HOV B;  4NXM L;  2HQL A;  1BUV T;  4NXM Q;  1I6V C;  3GO5 A;  3EIV A;  3GTG B;  1QZH A;  4A3C H;  3TZU A;  4U67 3;  1JIC A;  3CC7 A;  3U9O A;  3K7A H;  3MHB A;  4RKB A;  3SK6 A;  2RSN A;  4IZ8 A;  3ERS X;  2DGY A;  3HKZ G;  1LAB A;  3H3V H;  1XNQ L;  2ATW A;  2O5J C;  1SNO A;  1SYE A;  1M4V A;  1PRT B;  2OQK A;  2C9O A;  4DR1 Q;  2E76 C;  1U9R A;  3S1Q H;  4G4K A;  1Q8I A;  1IW7 C;  1OXT A;  5I9P A;  3S16 B;  2VY3 A;  2ZXR A;  3A74 A;  2B29 A;  3FRP B;  4X66 Q;  1LTL A;  2XSC A;  4LFC Q;  3HOZ G;  3M9B A;  1D2B A;  2B8G A;  2JEB I;  4TKO B;  1G6Z A;  4HMJ A;  2UUC L;  1EIF A;  2B3G A;  5LL6 S;  4BBR G;  1IBL Q;  1MJC A;  3ER0 A;  4EQO A;  1BCP D;  1RD9 D;  4L8J A;  1K8M A;  4LFB Q;  3H6M A;  3K58 A;  4DV3 Q;  4UDU C;  4BY1 G;  5L37 A;  3F2D A;  1LTS D;  1CA6 A;  1G6P A;  4DAV A;  1WCM B;  1N36 Q;  3CCU A;  2D9U A;  1SNP A;  1SN8 A;  1K83 B;  2PI2 E;  4C3J H;  3DUZ A;  3HZX A;  1AZP A;  3K0X A;  1S5F D;  2B2U A;  3TRZ A;  4IOC A;  4K0K L;  4A3L G;  4DV7 L;  4RGT A;  5ISR A;  5M3F G;  4H44 C;  1Z6H A;  4RGM A;  3J81 c;  2F0S A;  5KNB A;  3KBX A;  1S3O A;  1IL2 A;  2FFK B;  2D0P A;  3K7A B;  2LSS A;  3G7L A;  1UUP A;  4IUT A;  1SRO A;  1EY6 A;  1QUQ B;  3OPO A;  2ZM6 L;  1DOK A;  2ZXP A;  5LMU L;  3I3C A;  3PIO A;  1L0Y B;  3PQI A;  2F3V A;  2MQH A;  1YJ9 A;  3T51 B;  1WD1 A;  1HNW Q;  3FVQ A;  3HOV H;  2VB3 X;  3GTK B;  3C1F A;  5HY6 A;  3I8Z A;  3SK4 A;  1L1O B;  4DUZ Q;  5IT9 c;  4CDD C;  2YTV A;  3K5N A;  1BBX C;  3S1Q B;  2JK8 A;  1J6Q A;  3A5U A;  4DR6 Q;  1GKH A;  1Z7T A;  4K2L A;  5IYD G;  1CZG A;  3I4M H;  1TS5 A;  1KDA A;  1SE4 A;  1PTO H;  3G6J B;  1SYB A;  4YY3 L;  4A3G H;  3DLL A;  2DJF C;  4NB3 A;  5C0X H;  4LF9 L;  4IFD G;  3S2D H;  4X62 Q;  2CVR A;  1RTN A;  5EBC A;  4QQB X;  1TWA H;  3J80 i;  3S15 B;  1PH7 A;  1A63 A;  3NK9 A;  1DCZ A;  2CHB D;  4BBR H;  3OWE B;  1ASZ A;  1O7Z A;  1TWF H;  3ND9 A;  2ICI A;  3S16 H;  3CRL C;  1ZXT A;  3GTJ H;  1SXT A;  1PFB A;  1K83 H;  1JWU D;  3I55 A;  4X3K A;  3A8K E;  4DK6 C;  4ZYS A;  4JI4 L;  4R9W A;  2CH4 A;  4CHT B;  3CC4 A;  1NAP A;  1JJ2 A;  5ELN A;  1ZEQ X;  2JA8 G;  1IYV A;  4A3K B;  3CD6 A;  2B63 B;  5IP7 G;  2OTJ A;  1PRT C;  4OO1 I;  1IBM Q;  3U4Z A;  1KAW A;  4G7Z C;  2UXC Q;  2SNS A;  5K36 H;  1E2W A;  2AQ3 B;  4JI3 Q;  1QVC A;  4O2D A;  1SYG A;  3PIO 3;  2JE6 I;  3RUZ A;  1E22 A;  1N34 L;  1I4R A;  2ZJP A;  4PV1 C;  5M5Y B;  5I4D A;  4B3M L;  2B2W C;  4C1N I;  3S14 H;  2D5D A;  3TS0 A;  2XWB B;  4PQX A;  1EIY B;  3R8B A;  5A2Q L;  3MXN B;  2KJX A;  5C44 G;  2XNA C;  4B3R L;  1C9O A;  3N6R A;  4RMF A;  1PH3 A;  3IRB A;  2JA5 G;  1TWF B;  4Q0F A;  2CCZ A;  3SEB A;  2Z8L A;  2RDG A;  4A3E H;  1TQO A;  3CMA A;  3GTJ B;  2EJM A;  5EAY A;  1TXY A;  3NSW A;  4DR7 Q;  2VW9 A;  4P73 A;  4HTH A;  1BVS A;  4WFN 3;  2K33 A;  3S17 B;  4FNF A;  2L12 A;  1PRT F;  1KAB A;  2SNM A;  2L55 A;  3AU7 A;  4X3U A;  4CDE C;  2DUD A;  3CXC A;  4PZ8 A;  1QJO A;  1VQH A;  2OWO A;  4ZUJ A;  2Y0S G;  4YY3 Q;  3HEJ A;  1H9S B;  1D5X C;  1ROD A;  4X66 L;  4GOP A;  1VQJ A;  1B3A A;  4LUO A;  5M3F H;  3BYT B;  1YI2 A;  3BZK A;  3PUZ A;  1B9M A;  2OTL A;  1SRU A;  2KQ3 A;  5BR8 L;  4C3J G;  1HR0 L;  3VA5 A;  4RG1 A;  2XTI A;  1DJR D;  1N9W A;  3I4N B;  1JT8 A;  1HZC A;  4UPA A;  1SDF A;  2NYZ D;  1CT1 D;  5IYC H;  5D65 A;  2HDL A;  1IKL A;  2VQE Q;  5T1G A;  1VQG A;  2PO4 A;  2PW5 A;  1FJG Q;  4A76 A;  2ASB A;  3J81 E;  1H9R A;  1VQB A;  2ZT9 C;  5CV7 A;  1U4M A;  4WJW A;  1HPC A;  2WV6 D;  4F7X A;  4A3E B;  1M8A A;  1EQQ A;  4JC0 A;  5KRU A;  4GNX C;  1KAA A;  3F8T A;  2LXJ A;  4ZAI A;  1TS4 A;  4B3S L;  2XVS A;  4DFA A;  1PH8 A;  3I4M G;  2UXC L;  4A75 A;  1JOK A;  1WTO A;  1R4Q B;  4BS9 A;  1X54 A;  4P71 A;  2JEA I;  1A2T A;  3NPP A;  3RZO B;  2UU9 Q;  1EIG A;  1Y1V G;  4DAM A;  1JOO A;  3Q0A A;  5C4X B;  4X64 Q;  4NPS A;  1EZ6 A;  3CC2 A;  1C4Q A;  1E24 A;  3HOU G;  4YCW A;  2NZ1 D;  3VR3 A;  4QUF A;  3MZ5 A;  1TWC H;  5C6A A;  5A2Q E;  1AEX A;  1LO5 D;  1Y8P B;  4LUV A;  3S9W A;  2UXD L;  2CKZ B;  3MTS A;  1O7I A;  4ABN A;  3CCV A;  1YHB A;  4XQJ A;  1X9N A;  3T1H Q;  5FJ8 G;  2B2Y A;  4DV0 L;  4OO1 G;  4C3H G;  5JAV A;  3G6E A;  4ALP A;  3S1N B;  4F8M A;  4HIM A;  4DKA C;  4JI0 L;  1V9P A;  1C8C A;  4HID A;  1VQO A;  2JA9 A;  4A3E G;  5GAG C;  1ESF A;  4DV4 L;  1PTO F;  1K3B C;  3DEP A;  4LJZ C;  1A8V A;  3AEV A;  4JI8 Q;  1H9K A;  2Z4H A;  3SR1 A;  5AJ3 L;  1N8R C;  2CH4 W;  2B2V A;  3T53 B;  4NW2 A;  4PZ6 A;  1I4X A;  4KKT A;  4DUY L;  1JMC A;  5FLX L;  4DUZ L;  1HRJ A;  1FNV A;  2NN6 I;  2NN6 G;  1JCK B;  4DR4 L;  1AE3 A;  3V2T A;  3E0J A;  1Y8O B;  4QMG A;  3HOZ H;  2NN6 H;  4A3I H;  2F4V Q;  1XPR A;  4J8Q A;  4OHJ A;  5IT9 E;  3I4N G;  1WI5 A;  2ZM6 Q;  3RZD H;  3I2Z A;  2RHQ B;  2F0Q A;  4XT1 B;  1EQT A;  1IBM L;  2O4X A;  2IL8 A;  2ZTD A;  3EBE A;  2ICE C;  1F2Z A;  1VQ6 A;  1A6X A;  2F0V A;  2PZT A;  2QDB A;  1CHP D;  5C4X H;  2KCM A;  2E2I B;  3A56 A;  3OTO L;  2Y0S B;  4CBV A;  3FMC A;  1EEI D;  1G91 A;  2A6E C;  3S2D B;  4FO2 A;  2NZO A;  1EY8 A;  4DV1 L;  4JI1 L;  4JYA L;  5CV4 A;  1VQ5 A;  1XPU A;  5ELC A;  3NEN A;  4PMC A;  3CQZ B;  3H0G H;  1X6O A;  2CW0 C;  2EXZ A;  4B3T L;  2HCC A;  2MNA A;  1Q1B A;  1NTG A;  4QY7 A;  2BH2 A;  1LTG D;  2V1C C;  3I90 A;  4DK0 A;  5KYI A;  3MXU A;  4LFC L;  5GQO A;  3CCR A;  5EPJ A;  1SYD A;  4K8I A;  4K5V A;  3PGZ A;  4OXP A;  3K59 A;  3QJY A;  5JEA J;  3CCJ A;  2VUM H;  5C44 B;  4KHV A;  3PCO B;  2B2V C;  3UE0 A;  4EGV A;  1EIH A;  1EWH A;  5FK9 C;  1JWS D;  4A3G G;  5IIF A;  4KKU A;  2HQE A;  5JVH 3;  2K28 A;  1XNQ Q;  3SHL A;  5LMN L;  4BA1 I;  3SK8 A;  1L1O A;  4C2M H;  3S24 A;  4DV2 Q;  4O42 A;  3BYY B;  4UP8 A;  3GTG H;  2BCO A;  1SNM A;  3KLW A;  4LMQ D;  1Q12 A;  4JI5 L;  1KXL A;  2E2I H;  1S40 A;  5CR3 A;  1W6K A;  1HXY D;  1NNX A;  3OW2 A;  1TR5 A;  1NR2 A;  3UDX A;  2DY8 A;  1SYC A;  4A3I B;  1BQQ T;  4OX9 L;  1S5B D;  3DWA A;  3RLF A;  1N32 L;  2F0G A;  3CME A;  4DGZ A;  4JI5 Q;  3GTP H;  2A73 B;  4EX5 A;  1SEB D;  1O7L A;  3TZD A;  3RZD B;  2WB1 B;  5JEA G;  2F0D A;  2OCE A;  2TMP A;  4FDB A;  3DM3 A;  4Y52 H;  1I3Q H;  2E2H H;  3J7A 5;  2R7Z H;  1X65 A;  2N49 A;  3TDQ A;  4YWL A;  4B9X A;  1SJE D;  1XXG A;  2O2L D;  4DAP A;  4CKC A;  3PF5 A;  5JJK A;  2A6E D;  2DY7 A;  1HZB A;  1PVO A;  3UDG A;  4DXF A;  3VYR A;  1YJW A;  3R2I A;  1PH2 A;  2Z0S A;  1A0I A;  2HD3 A;  1K9M C;  3CAM A;  2Z6K C;  4F88 A;  3NE5 B;  5KIX A;  1LLR D;  4CKB A;  3MXP A;  1STG A;  3H0G B;  2V4D A;  4IUP A;  4KKS A;  3AB9 A;  5HGQ A;  4I7A A;  2WIN B;  1WCM H;  4L63 B;  2F0P A;  1EL0 A;  2RDH A;  4K5X A;  2NZH A;  1SR3 A;  2AWN A;  4N9P A;  4C2M B;  4IUV A;  4BA2 I;  4IOA A;  3Q6S A;  2YTX A;  1B7Y B;  2F4I A;  3VR2 A;  3DWQ A;  1MSH A;  4DV1 Q;  1SLJ A;  3FKI B;  2RBM A;  1PZK D;  1H9S A;  5H1S E;  1I94 Q;  2N88 A;  1TT2 A;  2QDL A;  2E2J H;  2PQA B;  1EYC A;  1B53 A;  5JEA H;  1Y14 B;  1U0L A;  4P72 A;  3D4D A;  4BY7 G;  3T16 A;  4AQY L;  4P75 A;  4C3I G;  4BBS B;  2KHJ A;  4A3D B;  1ET6 A;  5FLX E;  3Q23 A;  4BXX H;  2J7Z A;  3HKZ E;  1I4G A;  1PTO C;  3PO3 G;  4HCS A;  3X3M A;  3PO3 B;  3QWN A;  5ELE A;  4B3M Q;  2HDM A;  5M5W H;  2NVX B;  2F0H A;  4BY1 B;  4A3D G;  2EOT A;  4C3I B;  1GM5 A;  4BBS G;  3T56 B;  3D6C A;  4BY7 B;  4Q5V A;  2HHH Q;  2UXB L;  1VQF A;  1JC7 A;  4HSV A;  4YHH L;  4BBR B;  1L2F A;  3RZO H;  1DM0 B;  3T1Y Q;  1KIX A;  3KDF A;  4YIJ A;  4K6L A;  3M4O B;  5T1I A;  1STY A;  1EZ8 A;  3I4L A;  1AZQ A;  5IGD A;  2RF4 A;  3FEW X;  2H5X A;  1CTM A;  2L15 A;  3FPU B;  4NXN Q;  4JI2 Q;  1VQI A;  3MWY W;  4DPG A;  1QNK A;  4IUU A;  1NMG A;  1RIP A;  2X69 A;  3HKZ B;  2B8F A;  3W3A A;  2SDF A;  1FNU A;  3KDF B;  5C4J B;  3AFQ A;  1NMF A;  1BDO A;  2PQE A;  5C3W A;  4RFB A;  3H0G G;  3BJU A;  5CYU A;  2EE1 A;  4OEM B;  2Q8T A;  1KRS A;  1H9M A;  3C1E A;  3AYH B;  3IFT A;  3M4P A;  3BVM A;  1TWH H;  3HOV G;  3CCS A;  2LS0 1;  3QG1 A;  1XPO A;  1VMP A;  2WP8 J;  3TS2 A;  2NVX H;  3J81 i;  3H3V C;  2YYZ A;  2UXB Q;  1GD7 A;  2PMZ E;  1Q82 C;  1Q81 C;  3T13 A;  3PUW A;  1STB A;  4GOP C;  5EPL A;  4L5T A;  4QGU A;  3OOC A;  1VDZ A;  2K14 A;  4DV4 Q;  3DWP A;  4A3I G;  1EFW A;  1XYI A;  4AIM A;  1HNW L;  1QNU A;  2PQA A;  3UE1 A;  2E74 C;  1Q86 C;  5LMU Q;  4APV A;  1BF4 A;  1T5E A;  3M4Q A;  4XYO A;  2B2W A;  1HZ9 A;  1GUT A;  4LF4 Q;  5EPK A;  1SND A;  2MO0 A;  3MC0 B;  4IQZ A;  4RCN A;  4HJ7 A;  1UE5 A;  5C4H A;  3VDY A;  4LF7 Q;  4QIW E;  4GS3 A;  1SE2 A;  4EQ5 A;  1U5K A;  4LF5 L;  3J80 c;  5BN3 A;  1QWY A;  1ML0 D;  2WAQ B;  4H13 C;  1Q90 A;  2VXW A;  4XIG S;  4JBM A;  4C3H H;  4AH6 A;  1N36 L;  2E8G A;  2GN5 A;  3H09 A;  1E0B A;  3GTQ B;  3ONA B;  1VQD A;  5D14 A;  2QA4 A;  1S5D D;  4UY8 C;  2ZJR A;  4LFB L;  2F0U A;  5E1F A;  3HRZ C;  2RSO A;  3MA2 B;  4B9W A;  3BVZ A;  1YNX A;  2UUB L;  3HOU H;  5K5P A;  3PO2 H;  3ERQ A;  2ENB A;  1SMY C;  3KFU A;  5I9O A;  2I0Q A;  4LW1 A;  4MN3 A;  1Z47 A;  1D1I A;  5C4J H;  2AHO B;  1R9T B;  3GP7 A;  2K5D A;  1DD2 A;  4IUQ A;  1FJG L;  2JA6 H;  4HCE A;  3E3X A;  1S72 A;  1K28 A;  4DV6 L;  4B3R Q;  4NKL A;  2FMC A;  1Q8K A;  5EJW A;  4AYB E;  3GDE A;  3ICE A;  3BU2 A;  2AWO A;  1LAC A;  5COY A;  1I4H A;  2N8N A;  5JJL A;  1OXX K;  4GKK Q;  1V1P A;  2PMZ B;  3TP7 A;  3MFY A;  5GAH C;  2FMM A; 
#chains in the Genus database with same CATH homology
 1XWE A;  2Q8R E;  2FHT A;  3SK5 A;  1UNS A;  4ILW A;  1A15 A;  3DMU A;  1EU3 A;  3V05 A;  3NQT A;  4CJ1 B;  2BA1 A;  2F1M A;  5E4X A;  1WTX A;  5EKK A;  1DZ1 A;  5CGK A;  1BR9 A;  1SNQ A;  4ZKB B;  5ELD A;  1EQV A;  3PUV A;  3PO2 B;  1CQF A;  1HTL D;  4C3H B;  4KD4 A;  3TSS A;  1VMC A;  2PYK A;  3KK7 A;  2IX1 A;  2EDG A;  1QB5 D;  3PUX A;  3HOU B;  2KA7 A;  1BCP F;  1ICW A;  1AP0 A;  2EY6 A;  4RAU C;  5JPM C;  1O80 A;  5IGE A;  3NBH A;  4XTC S;  1A2U A;  2RQX A;  5J22 A;  3I4M B;  1YNJ C;  4OIJ A;  4DXG A;  3NWT A;  1J9O A;  1B2T A;  4TQU S;  4F87 A;  1IL8 A;  5C3E B;  3KF8 A;  2BE5 C;  1BCP B;  5AFW A;  1ET9 A;  5M5W B;  4V0B A;  5CMD A;  5I6Y A;  1STE A;  1EWC A;  2A68 D;  5J1Z A;  2WKC A;  2OF1 A;  4K14 A;  1UAP A;  4KY6 A;  4R8I A;  2EYM A;  1GJX A;  4CKE A;  2WAC A;  2PPB C;  4DF7 A;  2NB0 A;  4OO1 H;  1F2M A;  1XTC D;  3MFG A;  4XT3 B;  4C3J B;  4ME5 A;  3L3O C;  1EY7 A;  1HA6 A;  4WRD A;  2F03 A;  2Z4I A;  2DNE A;  5IGG A;  1JB3 A;  2LMC B;  1OO9 B;  4X3T A;  4XXE A;  1TY0 A;  3F2U A;  3BVG A;  1GOZ A;  1JWM D;  2IX3 A;  3EFX D;  4FF3 A;  2SOB A;  4OIK A;  1RDP D;  1KNE A;  2OT2 A;  3HP3 A;  5C0X G;  3FPP A;  5COR A;  3M3Y B;  3MVV A;  2K6A A;  4LAA A;  1QE6 A;  2LFN A;  1CI3 M;  5E4W C;  2JA5 B;  3M4Y A;  5EKL A;  1D5M C;  1EEF D;  1RKN A;  1EU4 A;  5KND A;  3OHX C;  1PDQ A;  3OMC A;  2F0N A;  1F9Q A;  2EY1 A;  1GHJ A;  1X3P A;  2EYO A;  2MUY A;  2QF7 A;  4KV6 A;  2MJ8 A;  4MIU A;  3TN2 A;  3X3N A;  2F0M A;  2H4O A;  3EVQ A;  4KK7 A;  3P75 A;  3A8J E;  3P1H A;  4PMW A;  2NVQ B;  1WTV A;  1QCB D;  2VB2 X;  2HCI A;  1JE4 A;  5I2Y A;  4IAL A;  3MXG A;  1QG7 A;  1D6E C;  2EYP A;  3ITP A;  5IGF A;  2A5H A;  2A6H D;  2JXM B;  3TME A;  5NUC A;  4OL7 A;  3NTI A;  3R3O A;  3J7A V;  1HQM C;  4A3B B;  5IGB A;  4RWS C;  4ZQ3 A;  4HSP A;  3GTM B;  5D3D A;  3S2H B;  2B2T C;  1NUC A;  4O1N A;  1HFN A;  4J6H A;  2N55 A;  1LV9 A;  5FO9 B;  4K2K A;  3K0Y A;  1DOL A;  4QUC A;  1WD0 A;  2QKI C;  2XIW A;  2BDN A;  3EJI A;  3I91 A;  1TWC B;  3PV0 A;  3GTL B;  1OXV A;  3E5S A;  5G3L D;  1TVX A;  4I65 A;  1ZYR D;  2I07 B;  3BZD B;  5M3F B;  3WOF A;  2L0C A;  2NTT A;  3HGB A;  3LWE A;  4C1N K;  4KHZ A;  2EYF A;  1CFM A;  2J4X A;  2L5T A;  2L4N A;  3H91 A;  4QB4 A;  5M3M B;  4A93 B;  3NBI A;  1ZKO A;  3IL8 A;  2M9V A;  3BS1 A;  1C48 A;  1B50 A;  2F0J A;  1VF7 A;  3GTO B;  2JA7 B;  3S14 B;  3HOZ B;  1NR4 A;  1PRT D;  1TWH B;  5KYL A;  2WII B;  1I4P A;  5J39 A;  1PTO B;  1BO0 A;  2OXP A;  5CBE E;  1WVL A;  3GTP B;  3IFD A;  1LTB D;  1GUW A;  5EQ0 A;  1FGB D;  2MHV A;  5BN4 A;  2WKD A;  4N9T A;  1TS3 A;  3H94 A;  2RKS A;  2KHS A;  3D4W A;  3VR6 A;  1STN A;  3OIQ A;  4X3S A;  2SEB D;  2K05 A;  3ZYY X;  3NUC A;  2OEO A;  1V43 A;  3BDC A;  1PFM A;  1O7Y A;  1FR3 A;  2PZU A;  2F0I A;  3S1R B;  1I6H B;  2QCP X;  3C46 A;  2EVB A;  5C0X J;  1DXM A;  4G57 A;  1LT4 D;  3S1M B;  3GV6 A;  1HA5 A;  2F3W A;  2IW3 A;  2IX0 A;  2PW7 A;  2RA4 A;  4FP5 D;  2I46 A;  3VYT A;  5DM6 3;  1X3Q A;  2E2J B;  3HOX B;  2NTS A;  1S5E D;  1O78 A;  1EYD A;  3R93 A;  3L7Z C;  4ZRZ A;  4EVO A;  4L6T B;  5HUR A;  1A3U A;  1TWA B;  1YNN C;  2JYO A;  4KN4 C;  4EQN A;  2LKV A;  3OIP A;  4QIW B;  1BOS A;  2G9D A;  4TSS A;  3PIP 3;  2L11 A;  3A7A B;  1TKW B;  3GQB A;  4WOR A;  5ELF A;  4XQQ A;  1MSG A;  5C5M A;  5CV8 A;  2MGS A;  5M5X B;  5CV6 A;  2K01 A;  2K7V A;  3DHQ A;  1GUO A;  1G8Z D;  5FO7 B;  2D2C C;  4IFD H;  4KTA A;  1FD7 D;  2EJG C;  3M7G A;  2M00 A;  3URY A;  3ERO A;  4IFD J;  4M8A A;  4IN3 A;  5K36 G;  4FVM A;  1TU2 B;  4DN4 M;  2B2Y C;  3RD4 A;  1GHK A;  1PFN A;  1AFP A;  2NWG A;  3K6O A;  4DAY A;  3ND8 A;  4QCL A;  2O5I C;  1IYU A;  2CW0 D;  4DNT B;  5KGU A;  4FXD A;  3K5M A;  1NSN S;  3SDZ A;  2RDF A;  3SXH A;  5C3X A;  1WTW A;  5C0X I;  1S4Z A;  3GD7 A;  1KNA A;  4NP5 A;  1PZI D;  2R92 B;  4C56 C;  3KLR A;  2F0K A;  1HTP A;  2E2H B;  1LTR D;  3OMG A;  3NWS A;  1STH A;  3A8I E;  1WTP A;  2MPM A;  1OXU A;  2AQ1 B;  2R61 A;  5ELB A;  5IT9 L;  3NP8 A;  3VA7 A;  3D31 A;  4BWG B;  2BOS A;  3BDO A;  5JJZ A;  1F9R A;  4ZUI A;  1Y69 U;  1HUN A;  4A3F B;  1KLG D;  1QIL A;  3L9A X;  1RTO A;  1HCZ A;  4A3J B;  3J7A F;  1CK1 A;  2R6G A;  5I6W A;  5HGT A;  4CGY B;  2KCC A;  2JA8 B;  1F9P A;  4UAI A;  3Q24 A;  3CU7 A;  1EY5 A;  4J1M A;  4JBW A;  1PXU A;  2A69 C;  2F0W A;  4TRD A;  1D5Z C;  3WDN A;  5IGC A;  1B44 D;  3U9S A;  3LX0 A;  4FXK C;  4HN7 A;  1MI2 A;  4R8N A;  2BE5 D;  3NTH A;  5I2X A;  1RJT A;  3MEH A;  3HOY B;  1LTI D;  3WOE A;  1FYC A;  1B9N A;  1LTT D;  2ID0 A;  1ILP A;  5TSS A;  2EYJ A;  4E6I A;  4V19 0;  3A54 A;  2EPB A;  5FO8 B;  2D62 A;  1WTQ A;  1WTR A;  2XRQ D;  2KVM A;  3NHH A;  2X6G A;  1MGS A;  4NMZ A;  4KN7 C;  1EY0 A;  1IKM A;  5EKI A;  1D1K A;  1SAP A;  1PZJ D;  3D3R A;  4KJN A;  1PYW D;  1AN8 A;  5CV9 A;  2AUK A;  1B4O A;  2NVY B;  2NUC A;  4RKL A;  4HMI A;  3D8G A;  3HOW B;  1RHP A;  2KED A;  1ENF A;  3NTK A;  3AMU A;  4OGQ C;  2X6L A;  3VYU A;  2A6H C;  4CJ2 C;  2KEC A;  5IOD A;  5LHY 1;  4FF4 A;  5DM7 3;  3UI2 A;  2HUG A;  3K5L A;  3CKI B;  3P7J A;  2B39 A;  3I70 A;  4HAE A;  1SFO B;  1Y8N B;  5JOB A;  4RCO A;  2H1E A;  2IPK D;  3NQI A;  1PLF A;  2KCN A;  3BG3 A;  3HG9 A;  1PTO D;  1DYQ A;  4PMB A;  2QEJ C;  5DNF A;  4S3S A;  4XQN A;  5M9O A;  2F0F A;  1HFG A;  3HS0 C;  1JR0 D;  1NCV A;  1HHV A;  1E2V A;  3LWU A;  3O13 A;  4RHR A;  5CV5 A;  1EY9 A;  1U4L A;  3MXN A;  3V96 A;  1F77 A;  4KJO A;  1T5X D;  1LT3 D;  1BXT A;  2FJ2 A;  2CQA A;  1CM9 A;  1KDB A;  2F0L A;  2Q8I B;  4NDX A;  1B1Z A;  2JP1 A;  3J7Y W;  4G7O C;  3QOL A;  3IKJ A;  2DN8 A;  1BNZ A;  4FF2 A;  1U4R A;  3EA6 A;  2EJF C;  1L0X B;  4RA8 A;  2B2U C;  1CA5 A;  2QIL A;  5BN5 A;  1EY4 A;  3D4R A;  1SJH D;  2JSO A;  4H7B A;  1Y1W B;  2K04 A;  3DEO A;  2K5W A;  3KBG A;  2K03 A;  4QF4 A;  4A3M B;  3C2P A;  4ULL A;  1IW7 D;  2F0E A;  1FNW A;  1ENC A;  2L1B A;  2EY5 A;  2K1B A;  2M2L A;  3QIA A;  4AYB B;  4MHE A;  5DEH A;  1G2S A;  4Y7N B;  2R7Z B;  1SSO A;  5FKA C;  3J80 E;  1OXS C;  3CRK C;  5KEE A;  2L9H A;  3TP8 A;  4ZLT F;  2NBF A;  3J81 L;  1DOM A;  4DA2 A;  1KDC A;  2EYL A;  1JOR A;  1Q1E A;  3DXJ C;  3Q22 A;  3VYS A;  4XDX A;  2EZV A;  1XX8 A;  4DU9 A;  2AUJ D;  1HQR D;  3CHB D;  3TP6 A;  4ZK9 B;  1F9S A;  2IJ0 A;  2F0O A;  5JVG 3;  3GV3 A;  2XN9 C;  1SNC A;  3K5O A;  3M7N A;  2JA6 B;  4Z9C B;  1GXD C;  3R2T A;  3QOJ A;  1QOH A;  1V8Q A;  3P20 A;  2NVT B;  1CHQ D;  2VNU D;  5CBA E;  1E2Z A;  1ENA A;  1LT6 D;  1ONL A;  2FIN B;  1V1P B;  2IWH A;  1CQV A;  1TWG B;  1EYA A;  1CZW A;  1LT5 D;  5A35 A;  1EOT A;  5JPN C;  4DNR B;  4M1U B;  3N52 A;  3OSO A;  2PNR C;  3T4A C;  2R3Z A;  1A3T A;  1JOQ A;  2E2D C;  4DK1 A;  2A74 C;  2BA0 A;  2J0T D;  1EFI D;  1R4P B;  3SVM A;  4FYD A;  5KNC A;  1ZYR C;  2XWJ B;  3OWF A;  2KUM A;  4KY7 A;  4KY5 A;  4KD3 A;  3W2D A;  3LNN A;  2KOL A;  1SBB B;  3M85 A;  1KLU D;  3I72 A;  3TBI B;  1HUM A;  1UEA B;  3C3L A;  2TSS A;  3D6W A;  2XRS D;  2PCF B;  5G3L F;  1MBY A;  4FF1 A;  4RGN A;  2K32 A;  2KEE A;  1VF5 C;  1S5C D;  3OW7 A;  4RHS A;  1W6J A;  4ODG A;  4K5W A;  1TII D;  5C5L A;  1VCI A;  4XYQ A;  4PNY A;  4ZKC B;  3MAQ A;  2ZXO A;  1TS2 A;  1YNN D;  2RVL A;  4A3G B;  1J8I A;  2K5Q A;  1SE3 A;  3KLS A;  1YNJ D;  1JQY D;  3A55 A;  1RCV D;  1I3Q B;  3PUY A;  5D3I B;  3SE0 A;  1ILQ A;  1V1O A;  5E3F A;  2EY2 A;  5LL6 X;  4K8J A;  4B08 A;  4IUN A;  4LK1 C;  4EQP A;  3RMH A;  5DAU A;  1U4P A;  5IOC A;  5EGT A;  4HED A;  2R93 B;  1BCP C;  1AW7 A;  2A68 C;  2C5C A;  1KTK A;  1K8O A;  3KLS X;  3VR4 A;  5C4Z A;  2B2T A;  1MD2 D;  4K6D A;  4HR7 B;  3K57 A;  3A7L A;  1IHZ A;  3I73 A;  4I7Z C;  4KMU C;  2DNC A;  1RF2 D;  2Z1C A;  3VR5 A;  2LY7 A;  2GA4 B;  1Q3L A;  3PMF A;  1I4Q A;  3JAM E;  1GUN A;  1G29 1;  2E75 C;  1I50 B;  3TP5 A;  1SMY D;  4U68 A;  4CJ0 B;  5EBD A;  3QB3 A;  2IT1 A;  3IAY A;  2PZW A;  2A69 D;  5F2D A;  3BDL A;  4JK1 C;  1PMR A;  3J80 L;  2F0T A;  2MP1 A;  2AQ2 B;  4FXG C;  1TY2 A;  1DON A;  1GUS A;  2YU9 B;  3E6Z X;  2EYH A;  4IUR A;  4RH6 A;  3QO2 A;  1SYF A;  1A3V A;  4P2C B;  3FDT A;  1STA A;  3DM1 A;  1LTA D;  4H0L C;  2G9H D;  3KUP A;  4RGO S;  4G7H C;  4KI0 A;  1F2Y A;  1Y1V B;  4IFD I;  3EQL C;  1II3 A;  5CC4 A;  2VUM B;  1H9J A;  4ID6 A;  1X32 A;  1F2L A;  1GUG A;  1G2T A;  1ESR A;  3NXW A;  5FOB B;  2BDO A;  4GZY C;  3JAM L;  3HOV B;  1BUV T;  1I6V C;  3GO5 A;  3GTG B;  3TZU A;  4U67 3;  1JIC A;  3U9O A;  3MHB A;  4RKB A;  3SK6 A;  2RSN A;  4IZ8 A;  1LAB A;  2O5J C;  1SNO A;  1SYE A;  1M4V A;  1PRT B;  2C9O A;  2E76 C;  1U9R A;  1Q8I A;  4G4K A;  1IW7 C;  1OXT A;  5I9P A;  3S16 B;  2ZXR A;  3FRP B;  2XSC A;  1D2B A;  2B8G A;  2JEB I;  4TKO B;  1G6Z A;  4HMJ A;  5LL6 S;  4EQO A;  1BCP D;  1RD9 D;  4L8J A;  1K8M A;  3K58 A;  3H6M A;  4UDU C;  1LTS D;  1CA6 A;  4DAV A;  1WCM B;  2D9U A;  1SNP A;  1K83 B;  1AZP A;  3DUZ A;  3HZX A;  1S5F D;  2B2U A;  4RGT A;  5ISR A;  4H44 C;  1Z6H A;  4RGM A;  2F0S A;  5KNB A;  3KBX A;  2FFK B;  3K7A B;  3G7L A;  1UUP A;  4IUT A;  1EY6 A;  3OPO A;  1DOK A;  2ZXP A;  3I3C A;  1L0Y B;  2F3V A;  3T51 B;  1WD1 A;  3FVQ A;  2VB3 X;  3GTK B;  3C1F A;  3I8Z A;  3SK4 A;  3K5N A;  1BBX C;  3S1Q B;  1Z7T A;  4K2L A;  1CZG A;  1TS5 A;  1KDA A;  1SE4 A;  1PTO H;  3G6J B;  1SYB A;  5C0X H;  4IFD G;  2CVR A;  1RTN A;  5EBC A;  3S15 B;  3NK9 A;  1DCZ A;  2CHB D;  3OWE B;  1O7Z A;  3ND9 A;  2ICI A;  3CRL C;  1ZXT A;  1SXT A;  1PFB A;  1JWU D;  4X3K A;  3A8K E;  4ZYS A;  4R9W A;  4CHT B;  1NAP A;  1ZEQ X;  1IYV A;  4A3K B;  2B63 B;  1PRT C;  4OO1 I;  4G7Z C;  2SNS A;  5K36 H;  1E2W A;  2AQ3 B;  1SYG A;  3PIO 3;  2JE6 I;  3RUZ A;  1I4R A;  4PV1 C;  5M5Y B;  5I4D A;  2B2W C;  4C1N I;  2D5D A;  2XWB B;  4PQX A;  3R8B A;  5A2Q L;  2KJX A;  2XNA C;  3N6R A;  1TWF B;  4Q0F A;  3SEB A;  2Z8L A;  2RDG A;  1TQO A;  3GTJ B;  2EJM A;  3NSW A;  4HTH A;  4WFN 3;  2K33 A;  3S17 B;  4FNF A;  2L12 A;  1PRT F;  1KAB A;  2SNM A;  2L55 A;  3AU7 A;  4X3U A;  1QJO A;  4ZUJ A;  3HEJ A;  1H9S B;  1D5X C;  1ROD A;  1B3A A;  3BYT B;  3PUZ A;  1B9M A;  2KQ3 A;  4C3J G;  3VA5 A;  1DJR D;  3I4N B;  1SDF A;  2NYZ D;  1CT1 D;  5D65 A;  2HDL A;  1IKL A;  5T1G A;  2PO4 A;  2PW5 A;  3J81 E;  1H9R A;  2ZT9 C;  5CV7 A;  1U4M A;  4WJW A;  1HPC A;  2WV6 D;  4F7X A;  4A3E B;  1M8A A;  5KRU A;  1KAA A;  4ZAI A;  1TS4 A;  4DFA A;  2XVS A;  1JOK A;  1WTO A;  1R4Q B;  4BS9 A;  2JEA I;  1A2T A;  3NPP A;  3RZO B;  1EIG A;  1JOO A;  3Q0A A;  5C4X B;  1EZ6 A;  1C4Q A;  2NZ1 D;  3VR3 A;  4QUF A;  3MZ5 A;  5C6A A;  5A2Q E;  1AEX A;  1LO5 D;  1Y8P B;  3S9W A;  3MTS A;  4ABN A;  4XQJ A;  2B2Y A;  4OO1 G;  4C3H G;  5JAV A;  3S1N B;  4F8M A;  1C8C A;  1ESF A;  1PTO F;  3DEP A;  4LJZ C;  1H9K A;  2Z4H A;  3SR1 A;  2B2V A;  3T53 B;  4NW2 A;  1I4X A;  4KKT A;  5FLX L;  1HRJ A;  1FNV A;  2NN6 I;  2NN6 G;  1JCK B;  3V2T A;  3E0J A;  1Y8O B;  4QMG A;  2NN6 H;  4J8Q A;  4OHJ A;  5IT9 E;  2F0Q A;  4XT1 B;  1EQT A;  2O4X A;  2IL8 A;  2ICE C;  1F2Z A;  1A6X A;  2F0V A;  2PZT A;  2QDB A;  1CHP D;  2E2I B;  3A56 A;  2Y0S B;  4CBV A;  3FMC A;  1EEI D;  1G91 A;  2A6E C;  3S2D B;  4FO2 A;  1EY8 A;  5CV4 A;  5ELC A;  4PMC A;  3CQZ B;  2CW0 C;  2EXZ A;  2HCC A;  1Q1B A;  1LTG D;  3I90 A;  4DK0 A;  5KYI A;  3MXU A;  5EPJ A;  1SYD A;  4K8I A;  4K5V A;  3K59 A;  3QJY A;  5JEA J;  5C44 B;  4KHV A;  2B2V C;  4EGV A;  1EIH A;  1EWH A;  5FK9 C;  1JWS D;  5IIF A;  4KKU A;  2HQE A;  5JVH 3;  2K28 A;  3SHL A;  4BA1 I;  3SK8 A;  4O42 A;  3BYY B;  2BCO A;  1SNM A;  4LMQ D;  1Q12 A;  5CR3 A;  1W6K A;  1HXY D;  1TR5 A;  1NR2 A;  2DY8 A;  1SYC A;  4A3I B;  1BQQ T;  1S5B D;  3DWA A;  3RLF A;  2F0G A;  4DGZ A;  2A73 B;  3RZD B;  1SEB D;  1O7L A;  3TZD A;  2WB1 B;  5JEA G;  2F0D A;  2TMP A;  3TDQ A;  4B9X A;  1SJE D;  1XXG A;  2O2L D;  4DAP A;  4CKC A;  2A6E D;  2DY7 A;  4DXF A;  3VYR A;  3R2I A;  4F88 A;  3NE5 B;  5KIX A;  1LLR D;  4CKB A;  3MXP A;  1STG A;  3H0G B;  2V4D A;  4IUP A;  4KKS A;  3AB9 A;  2WIN B;  4L63 B;  2F0P A;  1EL0 A;  2RDH A;  4K5X A;  2AWN A;  4N9P A;  4C2M B;  4IUV A;  4BA2 I;  3Q6S A;  2F4I A;  3VR2 A;  3DWQ A;  1MSH A;  3FKI B;  2RBM A;  1PZK D;  1H9S A;  2N88 A;  1TT2 A;  1EYC A;  1B53 A;  5JEA H;  3D4D A;  3T16 A;  4C3I G;  4BBS B;  4A3D B;  1ET6 A;  5FLX E;  3Q23 A;  2J7Z A;  1I4G A;  1PTO C;  4HCS A;  3X3M A;  3PO3 B;  3QWN A;  5ELE A;  2HDM A;  2NVX B;  2F0H A;  4BY1 B;  2EOT A;  4C3I B;  3T56 B;  3D6C A;  4BY7 B;  4Q5V A;  1JC7 A;  4HSV A;  4BBR B;  1DM0 B;  4YIJ A;  4K6L A;  3M4O B;  5T1I A;  1STY A;  1EZ8 A;  3I4L A;  1AZQ A;  5IGD A;  3FEW X;  1CTM A;  3FPU B;  3MWY W;  1QNK A;  4IUU A;  2X69 A;  3HKZ B;  2B8F A;  3W3A A;  2SDF A;  1FNU A;  5C4J B;  1BDO A;  2PQE A;  5C3W A;  4RFB A;  5CYU A;  2EE1 A;  2Q8T A;  1H9M A;  3C1E A;  3IFT A;  3BVM A;  2LS0 1;  3QG1 A;  1VMP A;  2WP8 J;  3H3V C;  2YYZ A;  3T13 A;  3PUW A;  1STB A;  5EPL A;  3OOC A;  1VDZ A;  3DWP A;  1XYI A;  1QNU A;  2E74 C;  1BF4 A;  1T5E A;  4XYO A;  2B2W A;  1GUT A;  5EPK A;  1SND A;  3MC0 B;  4IQZ A;  4RCN A;  5C4H A;  1SE2 A;  5BN3 A;  1QWY A;  1ML0 D;  2WAQ B;  4H13 C;  1Q90 A;  2VXW A;  4XIG S;  3H09 A;  1E0B A;  3GTQ B;  3ONA B;  5D14 A;  1S5D D;  2F0U A;  5E1F A;  3HRZ C;  2RSO A;  3MA2 B;  4B9W A;  3BVZ A;  5K5P A;  3ERQ A;  2ENB A;  1SMY C;  5I9O A;  4MN3 A;  1Z47 A;  1D1I A;  1R9T B;  3GP7 A;  2K5D A;  1DD2 A;  4IUQ A;  4HCE A;  4NKL A;  2FMC A;  5EJW A;  2AWO A;  1LAC A;  5COY A;  1I4H A;  1OXX K;  1V1P A;  2PMZ B;  3TP7 A;  3MFY A;  2FMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...