1EY4A

Structure of s. nuclease stabilizing mutant s59a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey4A00
4J1MA 4ME5A 4ID6A 4PNYA 3TP6A 2F0TA 5C3XA 5CV6A 2F0OA 3SK4A 3T16A 1A2UA 2LKVA 4K5XA 2F0EA 5F2DA 1JOKA 5KGUA 5CV7A 5JOBA 2RBMA 2F0QA 5CV8A 1KDCA 2EY2A 3QOLA 1ENAA 5IGDA 3R3OA 4MIUA 5IODA 2O4XA 2PZWA 4QB4A 4J6HA 3U9OA 3OMCA 3P75A 4EVOA 5I9OA 3C1FA 3BDLA 4KV6A 5IGCA 5DEHA 1EZ8A 4LAAA 1SNPA 3D4WA 2SNSA 3C1EA 4EQNA 5IGGA 2F0IA 1F2ZA 1A3VA 3ERQA 3QOJA 4HMJA 4RKLA 5K5PA 3DMUA 4NMZA 1JOQA 1TQOA 2KHSA 1EYDA 3SK6A 5KEEA 2ENBA 4K5WA 1SNDA 3TMEA 1KDBA 5KRUA 4OL7A 1NUCA 3OMGA 4IUNA 4K14A 3DHQA 1SNMA 2F0SA 1SYDA 3NUCA 1F2MA 3SXHA 2EYHA 1IHZA 1RKNA 5IGEA 3NP8A 1ENCA 2PZTA 4ZQ3A 1SYBA 3VA5A 4B9WA 5IOCA 4PMCA 2PZUA 2F0JA 1STNA 4KY7A 3ITPA 2EYMA 4E6IA 3SHLA 4QF4A 1A2TA 1EY4A 1EY7A 1SNQA 1F2YA 2F0FA 4ZUIA 2HQEA 1EY5A 1EZ6A 3P1HA 3QB3A 2F0UA 4QMGA 3SK5A 1AEXA 4DGZA 1EY6A 2F0VA 4NDXA 4K2LA 5CGKA 5KYLA 1EY0A 1SYCA 2RDFA 1JORA 5HURA 1EYCA 1KABA 1SYGA 3H6MA 4H7BA 5C4HA 5I6WA 1SNCA 2PYKA 2QDBA 4K6DA 5NUCA 2F3VA 4YIJA 3EROA 2PW7A 1TR5A 5M9OA 4K8JA 3NXWA 3T13A 5CV4A 2EYLA 5EKKA 4KTAA 4RKBA 3NQTA 3LX0A 2EY5A 1STBA 1A3UA 1STYA 4KJOA 3EVQA 1EQVA 3D6CA 2F0MA 4WORA 5EGTA 3TP7A 4DFAA 5C3WA 5IIFA 1KAAA 1STGA 4G57A 5KYIA 1NSNS 3MXPA 5DAUA 4KY6A 5CR3A 3V2TA 2M00A 4EQOA 5C6AA 1EYAA 4I65A 4EQPA 3BDCA 5KIXA 3OWFA 5I6YA 2F3WA 4KY5A 5J1ZA 1SYEA 3MZ5A 4IZ8A 4WRDA 2KQ3A 5CV5A 1STHA 5EKLA 4HTHA 5ISRA 4F8MA 3NK9A 4R8NA 3HEJA 3PMFA 4N9TA 1EY9A 2F0HA 2OF1A 3MVVA 5JAVA 4KD4A 1TT2A 5J39A 4NKLA 5IGFA 4K5VA 3HZXA 2F0PA 5C4ZA 4HMIA 2PW5A 1SYFA 4NP5A 5I9PA 2F0LA 5HGTA 3D8GA 1II3A 2F0GA 3E5SA 1A3TA 3MHBA 2EYPA 1EY8A 4K8IA 2F0KA 2EYJA 5C5MA 2EXZA 4DU9A 3MEHA 2WACA 4ODGA 1STAA 5CV9A 4PMBA 2OXPA 5E1FA 4K2KA 4B9XA 1U9RA 2F0DA 3EJIA 3TP5A 5J22A 4F7XA 5CC4A 2NUCA 2SNMA 2F0NA 4KD3A 5C5LA 1SNOA 3SR1A 2EY6A 3D4DA 4DF7A 1JOOA 3SK8A 2OEOA 4ZUJA 3TP8A 3S9WA 2EYFA 1KDAA 2SOBA 3NHHA 2EY1A 3OSOA 2PQEA 4KJNA 4S3SA 5E3FA 4TRDA 4KHVA 4IALA 4N9PA 2F0WA 2EYOA 5IGBA 2RKSA 3RUZA
chains in the Genus database with same CATH superfamily
5AJ3Q 1ZKOA 1SN8A 1A2UA 3BVGA 1Y1VH 4LF9L 1TVXA 5ELNA 5IGDA 3PGZA 3S1NH 4DR4Q 1IBKL 1ML0D 5E4XA 1VQ4A 2JA9A 1UE5A 2R7ZG 2JK8A 3D4WA 3S1QH 3G48A 4HMJA 3J7ZC 3I91A 3KF8B 2RCNA 4P71A 2K5HA 3HOUB 1AE3A 4HR7B 3TMEA 4OIJA 5JEAH 3Q0AA 4IUNA 4A3JB 5JJKA 3H0GB 4BBRB 3VR4A 5C0XJ 1B3AA 3CCJA 4ZQ3A 3W3AA 4BS9A 1STNA 2A73B 2K6AA 4ULLA 1X3PA 1NNXA 5M3FB 4LFAQ 1EY5A 1X3QA 2UXDL 3A0JA 4CDFC 1LO5D 3A54A 1SROA 1V43A 5CYUA 2VXWA 3GTMB 5ELDA 3UE0A 1F9PA 3RMHA 2ICIA 3PF4A 2VQFL 3RZOB 2AMCB 4JW0A 5EKKA 2BDOA 1I94L 5COYA 2ZM6Q 4ZCKA 2Z6KA 4BBSH 3OHXC 5K36G 2E75C 2MO1A 5EPKA 4PV1C 4IFDJ 3H3VI 2I46A 1BCPC 2K5NA 1ILPA 3QO2A 2EXDA 2JA5G 4DXGA 1CHQD 4YWKA 1JR0D 4A3LH 4R8NA 4KMUC 1PH1A 3KJOA 1NAPA 1S5FD 1RD9D 1XPRA 2WKCA 1TWAB 3F2UA 4FXKC 3HP3A 1QNKA 3QG1A 3D8GA 2B2VA 2BA1A 2JYOA 4LK1C 2BH2A 2EE1A 5A35A 2FINB 4ODGA 2P5ZX 5JVG3 3M4PA 4OIKA 1MIUA 1H95A 4MN3A 1G2SA 2K01A 5BR8Q 2A6HC 3A56A 1M90C 4TQUS 3ULLA 3CRKC 1R4PB 4A3DH 1IKLA 4A3JH 4RCOA 1G91A 4LNQA 1LTGD 3TBIB 4BBRH 1E1OA 2RBMA 5C3EB 3FDTA 1V1QA 1EIFA 3Q23A 3OTOL 4N8X1 2PZWA 1MSGA 4J6HA 4O1NA 3P75A 2QW7A 5IWAL 5M3FH 3HKZE 3DUZA 1HQMC 2BE5D 5C4JB 1O80A 3GTMH 1HNWL 4EX5A 5LMNL 1NMFA 1TWGB 4DAMA 4JBKA 3RZOH 1NCVA 5A2QL 1YNXA 3TS0A 4DV1Q 1X3EA 3ICEA 1A2TA 1EY4A 2ICEC 5DM63 5FLMH 5IE8A 1PDQA 1BF4A 4ZUIA 4JV5L 2HQEA 4DGZA 5KYLA 1N32Q 3PUVA 2X6GA 1SYCA 2Q8IB 2NB0A 1XMOQ 2PYKA 1GUSA 2Z6KC 3CD6A 3HKZG 4IUUA 1TR5A 4NXML 3HOYB 3GTLB 1PA6A 1UE6A 2Z1CA 3ULPA 2UUCQ 4KN7C 3CC7A 2A19A 5FLXL 3MXNA 2A5HA 2HD3A 1TWAH 4ZKBB 4DFAA 3ULJA 1PTOF 1CFMA 5KNCA 1MBYA 3ND8A 4DR2Q 1BDOA 4OO1I 2E76C 5GAHC 1M4VA 1HA6A 2AQ1B 3H94A 2B2VC 4LF4Q 2L4NA 4NB3A 4ZAIA 1B1ZA 3TDQA 4G7HC 3LGJA 1SYFA 2F4VL 4A3MG 3CC2A 3AU7A 2Z0SA 4KKSA 4Z9CB 1I4PA 2ZTEA 1E0BA 4Y52H 1STAA 4JG2A 3H3VH 3H15A 2VB2X 2EOTA 3SVMA 2Q8RE 2SNMA 1LUZA 3I8ZA 2MFIA 3ZJYC 2EY6A 1E2ZA 2R3ZA 3A8IE 4DV2L 4B3RQ 5C4JH 2YV5A 2RKSA 4GKJL 4HAEA 3T16A 1XWEA 5FJ8H 1TWGH 4A3FH 1QVGA 4MZ9A 2HIVA 1D8LA 1TWFB 2Q2UA 4KKTA 5I2XA 4A3GB 5LMUL 1KLUD 4IOCA 4F88A 3WWVA 1XXGA 3NTKA 3J81j 1C8CA 3AYHB 4KHPL 1YITA 2D0OA 2CW0C 2CQOA 1WVLA 3RN2A 4BY7G 1Z7TA 2WFWA 2ENBA 5KRUA 4BA1I 2YYZA 4C3IB 4K14A 3J80L 3SXHA 3PUXA 2HCCA 3GTLH 1TS3A 1JMCA 2XWJB 1NJIC 3CAMA 4N8FA 1B3QA 4LF7L 1Q1EA 4DAVA 2VZAA 3NSWA 4AH6A 3P1HA 4ZK9B 1EY6A 3EIVA 3WDNA 1JORA 4C3HG 3H6MA 3T53B 5A2QE 1RL2A 4PZ7A 3UDIA 4RFBA 3EROA 1QG7A 3S2HH 4DPGA 3HOXB 3J7A5 3NXWA 2Q2HA 3CQZH 4A3CG 2UXBQ 4KKUA 1TY0A 1OXTA 1XX8A 1D6EC 2ZJPA 2E2JB 2XSCA 2KCNA 5C6AA 2IL8A 1PRTD 4L63B 3PUWA 4GKKL 1DJRD 2NZHA 3E9IA 5IP9H 2IJ0A 3FMCA 2AHOB 3SGIA 2VY3A 3BYTB 4UP7A 4N9TA 3PO2G 3O13A 2HHHL 1VQ7A 4RCNA 3U50C 3JAML 2UU9Q 3G6EA 5IYBH 1DXMA 1SE2A 1PTOD 1EY8A 2F0KA 1HXYD 3BYYB 2NTTA 1TWFH 4A3GH 2YU9B 1HRJA 4UP9A 4OO1H 3IL8A 3BVZA 4FNFA 1V1PB 2XIWA 4K0KQ 1TS4A 1VMCA 2L12A 1Y1WG 3E3XA 3W2DA 1XPOA 1PHJA 1CSQA 5FO8B 3DLLA 1U0LA 4C3IH 1Q3LA 2XTIA 4OXPA 2D0PA 1SMYD 2A1AA 4P74A 2E2DC 4X64L 5C0XI 2EY2A 1CQVA 3CCMA 2MO0A 3OMCA 3KDFA 3WOFA 2RDGA 3ERQA 2JA7G 3T4AC 2KHSA 3L7ZC 1DD2A 4YCVA 3M4OH 1IXRA 1C9OA 3FPUB 1HFGA 2MUYA 1E3PA 1PYWD 1LT6D 2QKIC 2PMZB 5CBEE 4YY3L 1DOKA 5IGEA 5G3LF 3NTIA 4UHVA 4RG1A 3BDOA 3ITPA 5IP7H 5ELFA 1PH4A 1UAPA 1NR2A 1EZ6A 1A63A 3T1YQ 1AEXA 4R4QA 3G7LA 3J80E 2E2JH 4IFDI 4DNIA 1L0WA 5HURA 1KABA 1WTVA 5I6WA 4C3JG 3A8JE 1IW7D 2EJGC 2QEJC 2K5QA 3VYSA 4DR1Q 5FLXc 2LXKA 4DR6Q 4UPAA 4HIKA 1S4ZA 3EVQA 3KF6A 2R7DA 5IIFA 2E5LQ 1AFPA 2QCPX 5BN3A 2JEBI 2E74C 2M00A 1R9TB 3OWEB 1J5EL 1Q82C 3OWFA 1UEBA 3HOVG 1EYGA 4A75A 4RHSA 3M9BA 1VQBA 2XNAC 1GHJA 4UP8A 4NXNL 1WD0A 4BWGB 3I4NG 2JQOA 1ZXTA 1SSOA 1HFNA 5AFWA 4TVAB 4PG3A 3Q22A 3NEMA 4DUYQ 1WTOA 5E1FA 2VL6A 4HJ8A 3F2CA 5M3MB 4F7XA 3I4OA 2R92B 4X3SA 3JAME 1W3SA 4JC0A 4G7ZC 1XMQL 3SR1A 4DV0L 1AZPA 1PVOA 2OEOA 3I4LA 2EJFC 2NZ1D 3KLRA 1XTDA 2PQEA 4IALA 4MTKA 4A93H 1I4XA 2B3GA 4IUTA 1QUQA 1IL8A 2R6GA 5EPJA 2F0EA 4FVMA 5FO7B 3EN2A 2OWOA 3HOZG 1I50B 1EOVA 3EFXD 1OO9B 3L9AX 3FVQA 3FKIG 3C1FA 1IL2A 5DEHA 1EZ8A 2HCIA 4O0AA 1LM0A 4NMZA 3VR2A 3J80c 5IYDH 1ZYRD 2KUMA 3L0OA 4DV4Q 3TZDA 3AEVA 1V9PA 3D3RA 5E7NA 3CMEA 3C3LA 1SDFA 2WB1G 2D5DA 1ICWA 4QF4A 5C0XH 1EY7A 1SE8A 3S17B 4QMGA 2CCZA 4LFAL 4RWSC 1HZAA 1SFOB 3T51B 1R9TH 1LT4D 5C4HA 4CKEA 2AQ3B 2VUMB 2QDBA 2HIXA 1PFNA 2ZTCA 4QL5A 4OHJA 2L1BA 1XNQQ 2L9HA 5M9OA 2UUBQ 1HHVA 3ER0A 1N34Q 1MD2D 3LX0A 1A3UA 3KF8A 1UE7A 2ZM6L 5C3WA 1GD7A 2JA6G 2A69D 4ALPA 1STGA 4H02A 1L2FA 3V2TA 2AQ2B 3GTQH 3K8AA 4JI6Q 2HDLA 3MEFA 3J81L 3S1QB 1RHPA 5ELOA 4OWXB 3K5MA 1HZCA 4IFDH 2AKWB 2R92H 2Y0SG 1KNAA 3B6YA 3JAMc 1EIGA 3T56B 3DWPA 3VDYA 1D2BA 3M7GA 2KCMA 2PW5A 1WTQA 4NP5A 5I9PA 1O7ZA 2F0GA 2B2UA 4OX9Q 1A3TA 3OPOA 1ONLA 3I4MG 1ESFA 2KOLA 1WCMB 3AFPA 2EXZA 4YWLA 2EJMA 2HQLA 4K2KA 1A62A 3DEPA 2AWOA 3PIP3 1I50H 4JI0Q 1VQMA 3TP5A 5CC4A 1KNEA 2NUCA 1A6XA 1I4HA 1GUGA 1EU3A 1KHIA 1UUPA 1T9HA 5BR8L 4X62L 1Z47A 1K73C 1VQDA 2F0WA 1YNND 1G51A 5T1IA 3TP6A 1LTID 4AIMA 2LKVA 1C48A 4LWCA 1CKNA 4XT1B 5KGUA 1JOKA 2KBNA 1BXTA 2JXMB 3PQIA 3GTKB 2I5MX 4UDUC 3E9HA 4XQQA 3D6WA 1GVPA 4JOIA 4RKLA 1A0IA 1SFOH 1RJTA 1EQRA 1EYDA 3RR5A 3SK6A 1G2TA 2VUMH 1D1IA 1HR0W 2EYHA 1PXUA 3UI2A 1KC8C 1S5DD 2L5TA 1K0SA 5IOCA 3MFGA 2ZJRA 1SR3A 5M5YB 3N52A 4DV1L 1EQTA 2ZXPA 1GUNA 4FXGC 3HFZB 5J3BA 5CGKA 5D65A 1N32L 1ET6A 2WV6D 1Y8NB 1ILQA 1XMOL 1WI5A 3VR5A 4IUVA 1KIXA 5L37A 1JWSD 4A3DB 1YHBA 3FHWA 1ASZA 1DM0B 1KQSA 2UUCL 4KTAA 2EY5A 1QWYA 1YHAA 3STBC 3FRPB 5IYCG 5E4WC 2L55A 1RTOA 1MHWC 1U4PA 3DEOA 2RHQB 1AN8A 1SRUA 3OIQA 1WCMH 1SAPA 2MP1A 2XRSD 1EOTA 2XGTA 4Q0FA 2GVAA 4DR2L 2ZJQA 3ONAB 5I6YA 1BCPD 4KY5A 5EAYA 3CC4A 3GV6A 1STEA 2FJ2A 2F4IA 5ISRA 1VQGA 2B2UC 3TZUA 4LF4L 3RZDB 3RLNA 3MVVA 2ZXOA 3I72A 1CA5A 1D1KA 3J81E 4ZYSA 4BBSG 3IAYA 2R93B 5GAGC 4LUOA 3K5NA 1HZBA 5CORA 1B2TA 1GUOA 2WACA 3V96A 3GTKH 3U4VA 1YVCA 2QEXA 1Y14B 4A3LG 3D4DA 3W1BA 2JA8B 2UUAQ 2EYFA 1AW7A 3J80i 1CKNB 2A68C 1DGSA 2A6HD 5GQOA 1HUNA 5IGBA 4DK0A 3RUZA 4PNYA 5CV6A 4K5XA 2H1EA 4JOIC 2C9OA 4A76A 4OONA 5M5YH 1I4RA 5EBCA 3PO3B 4QB4A 3G4SA 3FP9A 3EA6A 3U4ZA 1OXSC 4A3KB 4LUVA 4B3SL 3C1EA 2N49A 2A6EC 1JOQA 3FPPA 1VF5C 1W6JA 3HOUG 2A8VA 1K83B 2EPBA 1S72A 4ZKCB 4A3JG 3H0GG 2KHJA 4BBRG 1QE6A 1JICA 1XYIA 2OQ0A 2PNHA 1VQ6A 1CM9A 3VA5A 4IOAA 4LFBQ 3H3VC 1C4QA 4JYAQ 5M3FG 4BXXG 3I70A 3KBGA 1CZWA 4LUZA 4A3IG 4LF6Q 5JVH3 1UEAB 4K6LA 1NR4A 1MKHA 3PIPA 2F52A 3S1RB 4K6DA 3CP0A 1IBMQ 1S5CD 3JAMi 4Y7NH 1MSHA 3RZDH 4DR5L 2IWHA 2OCEA 3LWUA 1DZ1A 4A3FB 4L5TA 2J0TD 3CW2C 2XN9C 3E0EA 2UXBL 1FL0A 1LTTD 4WORA 5FLMG 4CDDC 5CMDA 2R93H 1SE4A 3Q6SA 3J81c 1RIPA 3S1MB 1YI2A 2QF7A 1EYAA 1SLJA 3BDCA 2IHEA 5J1ZA 4DV3Q 1VQKA 1FJGQ 1N9WA 1PZKD 1LTAD 4X3TA 3LNNA 2KQ3A 2KCCA 3NK9A 2YTYA 1O78A 2JA8H 5JAVA 4HCEA 4HIMA 3HG9A 1H9SB 3NE5B 2PPBC 2UU9L 4LF9Q 4XYQA 4HIDA 1CTMA 1KD1C 4DV6Q 1I5FA 4JK1C 3S15B 3PO3H 3S14B 4WJ3M 4A3KH 4DF7A 4K0KL 2FXQA 2SOBA 2G9DA 3S2HB 4DR3Q 3R8BA 3CQZB 1YBYA 3TS2A 1K83H 1VQEA 1LTLA 4MNOA 5C3EG 2H4OA 2WAQB 1ENAA 2B39A 1FD7D 3R3OA 2ATWA 2O4XA 2DY8A 4KV6A 3UE1A 5IGCA 1HR0L 4LAAA 4OWTB 1QOHA 5IY0A 4X66Q 2CW0D 3S1RH 2VQFQ 3GV3A 3FEWX 3H09A 4JI7Q 1XNRQ 5FJ8G 1SYDA 3CKIB 1F2MA 1V1PA 1XPUA 4XYOA 2RHSB 1ZEQX 3PIO3 2MQHA 4PMCA 1JWMD 2PCFB 1G291 5ELEA 3DWAA 4MTNA 2DNCA 4KLKA 1J9OA 1F2YA 2NYZD 4JI1Q 3HRZC 2F0UA 4QUFA 2NWGA 3S1MH 3T1YL 1X56A 1PYSB 4AYBB 2BDNA 4IUQA 1E2VA 3HOYG 3GTOB 3CF5A 3TEHB 3CCQA 4DR1L 4JI4L 1VMPA 1X54A 4FF2A 5C44B 4DR6L 1LV9A 1WTWA 4GNXB 3CCVA 4RGOS 3OIPA 1EU4A 1K8AC 4P2CB 2L0CA 4L8JA 3HKSA 4XQJA 1YIJA 1P8LA 4EQOA 1N33Q 3PUYA 4BY1B 4RGNA 3S15H 3S14H 3MA2B 1X3GA 2PNRC 1IYJB 3M4OB 3CU7A 1EY9A 3IRBA 1HJPA 1I6VC 3UDXA 2E2HB 4R4TA 2Z8LA 1B8AA 2IY5B 2X6LA 4FF1A 4DNRB 4NW2A 5LL6S 2FMCA 4CBVA 2Z6BA 3E5SA 3MHBA 4A3BB 1JE4A 5I4DA 4DU9A 2L11A 5IP9G 2FMMA 4PMBA 1TU2B 3CPFA 1J8IA 2L15A 1YHQA 3K7AB 4NPSA 1KXLA 4C3HH 4JBWA 1BKBA 2O2LD 4JI8L 1Z6HA 4N9PA 5IYBG 3I2ZA 4R9WA 2PQAB 4ME5A 2F0TA 1O7IA 3F1ZA 5CV7A 1L1OB 4A3GG 5CV8A 2TMPA 5I2YA 2EIFA 2HDMA 5IODA 5GADC 1BVSA 4DV5Q 3WOEA 3IFDA 1PMRA 3CCEA 3GTJB 3CPWA 1F2ZA 1A3VA 1TIID 1TS5A 4U68A 4DN4M 5JPMC 1XJVA 4LFCQ 5KEEA 4NXMQ 1PH2A 2Q2TA 1B50A 1QB5D 4C3IG 5FKAC 4DV4L 3RLOA 2C35B 3GTOH 2LSSA 3J7AV 2K03A 4ZLTF 4POFA 1SJED 1EIYB 1X3FA 5C44H 1Y8PB 4KY7A 2EYMA 3NTHA 3J81i 1PRTB 4RGTA 3TRZA 4DAYB 5JPNC 4BY1H 1VQNA 2QDLA 1M8AA 2EQSA 5CBAE 1U4LA 5NUCA 3AB9A 1SEBD 4DAPA 4A93B 1LT5D 3HOXG 1XNQL 3ERSX 2UUBL 5IT9L 2EYLA 4POGA 2E2HH 5C4XB 2NVYB 5IP7G 1STYA 1AP0A 1PTOB 4M8AA 1GO3E 1CHPD 4A3BH 4APVA 5EQ0A 3K81C 4B3MQ 2UXCQ 5KNDA 1CT1D 5M5XB 4FF4A 3L2PA 4JI6L 2I5HA 3K7AH 4UY8C 4XQNA 1WOCA 4GN4B 2DY7A 2VS1A 4JCVE 4NKLA 1DCZA 1O7YA 2K52A 4XTCS 2AUKA 1IBLQ 3MC0B 3KFUA 1U4RA 1S40A 2KVMA 4OX9L 1UE1A 2EYJA 5C5MA 3PIOA 3MEHA 5DM73 4YCWA 1U9RA 2F0DA 2NN6G 1KTKA 4JI0L 4KHPQ 1LT3D 5C5LA 2EVBA 2LY7A 2NBFA 2PMZE 3SK8A 4CKBA 3GTJH 4C3JH 1C7YA 2EY1A 4KJNA 3I73A 1HNXQ 2A74C 5H1SE 4ID6A 4R8IA 1PH9A 3SK4A 5JJIA 2DUDA 2WB1B 1ENFA 2DGYA 3KOJA 4TSSA 3NBHB 3GTQB 4QUCA 3C2PA 1I3QB 4GN3B 2B63B 3MAQA 1LLRD 3CCRA 2WINB 5IGGA 3HOVH 4DK3C 4X6AH 4JI2Q 1GXDC 1X65A 2RDHA 1S5ED 2VQEQ 4FF3A 5AJ3L 3NP8A 1I4QA 5C4XH 2NVYH 1PH3A 3KYHC 1PTOH 3EBEA 2VB3X 1VQJA 1SNQA 1ICFB 2HT1A 2KEEA 1BBUA 4A4IA 1L0YB 3QB3A 4CDCC 3SK5A 3K5LA 3GP7A 4DR4L 2OTJA 2J7ZA 4K2LA 3F8TA 1E1TA 5EPLA 1EYCA 2E8GA 1B7YB 4H7BA 4OEMB 5M5XH 5IYDG 4CJ1B 2Y0SB 2ZXRA 2NVTB 1NMGA 2KCTA 4K8JA 3T13A 3JC66 5CV4A 4DA2A 1STBA 3HOWB 2ALYB 5C0XG 1MI2A 5FK9C 5KYIA 1B70B 3BU2A 4HN7A 1TKWB 4B3TL 4I65A 3BVMA 4CHTB 5IT9E 1Q90A 4JI3Q 2G9HD 1HNZQ 3TREA 1QZHA 1M1KC 1S3OA 1VQPA 1FR3A 2DN8A 3GQBA 4X3UA 2JJQA 5IGFA 1QZGA 2ZT9C 5C4ZA 5G3LD 1ESRA 2RSNA 1II3A 1E24A 2I0QA 1K8OA 1CQFA 4EQ5A 5EKIA 4LMQD 5M3MG 2R92G 1I3QH 5LHY1 4P75A 4ABNA 2B63H 1TXYA 1Q1BA 2D62A 2FHTA 3ZYYX 1Q46A 4TKOB 4A3EB 3K0XA 1KDAA 3F2DA 1JC7A 2UUAL 3BZDB 2F03A 4WFN3 4BA2I 4GOPA 1CI3M 1YJ9A 3HGBA 2NTSA 1YNJC 5DLQE 4HCSA 3CMAA 2OT2A 2N8NA 3I90A 5JOBA 2F0QA 3TSSA 2CFMA 1I4GA 1VQ8A 1U4MA 4LF5Q 1LYLA 1KL9A 3NBIA 4X3KA 2R7ZB 4IJHA 1GUTA 1QNUA 1JQYD 1L0XB 3DMUA 4RHRA 4PZ8A 1BBWA 4HEDA 1CA6A 1FGBD 2NVTH 4U673 1R4QB 1IKMA 1PH8A 1VCIA 1HTPA 2JEAI 1LTSD 3DHQA 4L6TB 1IYVA 2DJGC 4XT3B 1E22A 1SYBA 3AMUA 3A7AB 4LFBL 3SHLA 3HOWH 4XXEA 4JYAL 1CKOA 1SBBB 4HSVA 4LF6L 3W5OA 1N36Q 2RA4A 5D3DA 3L3OC 1G6PA 2VUMG 1SNCA 2K05A 2MGSA 1PFBA 3K5OA 1IBML 5IT9c 1YJWA 1RODA 2JP1A 2K5WA 3CHBD 1Y1VG 1VQLA 3KK7A 3C46A 1SE3A 1EQVA 3STBD 4LF8Q 1F77A 4X65Q 2DNEA 5CR3A 4FYDA 3GD7A 4DUZQ 1NTGA 2Z9HA 1JJCB 4IURA 4P73A 4QGUA 4KHZA 2JA5B 1FJGL 1WTRA 1STHA 4C2MB 2BA0A 3PMFA 5JEAG 4YHHQ 4A3EH 1P16A 4L5RC 1MJEA 1UWVA 1EWCA 1HZ9A 1F9RA 3OW2A 1WCMG 1EEFD 1VQIA 1UNSA 4JBJA 1OXXK 4DV6L 4PZ6A 1AZQA 1Y69U 3UDGA 1GJXA 2MJ8A 1CK1A 4GOPC 4KN4C 1NE3A 4JI5Q 2QA4A 4GOPB 2R7ZH 1H9MA 1JT8A 2BOSA 3K80C 4Y7NB 1VDZA 4DR3L 4HMIA 2EYOA 3G71A 1V8QA 2N78A 3A5UA 2A68D 2B29A 2F0OA 3M4YA 3S16B 4WJWA 4QY7A 5F2DA 1I6HB 5IYCH 4DNTB 1GM5A 4A3IB 1H9SA 1VQ9A 1EWHA 3U9OA 3GTPH 1E7ZA 1JJ2A 4RGMA 4GS3A 2K5VA 3QOJA 2YTVA 4X66L 2A6ED 3QWNA 1KDBA 3A55A 4OL7A 4B3RL 4JI7L 1XNRL 1TS2A 1B53A 3KLSX 4RMFA 1IHZA 2GN5A 2QILA 1JWUD 1OTCA 4HSPA 5EJWA 5K36H 1CUKA 4JI1L 1BCPB 4NDXA 2OTLA 2RDFA 4OELB 2B2WA 2JA5H 1BUVT 3URYA 3K59A 3HKZB 4DV7Q 4A3DG 2CWPA 2NVQB 4C2MH 4J15A 2I5LX 4R4CA 2RVLA 1VQFA 4KI0A 2KEDA 4KJOA 2XVSA 4DR7Q 2PO4A 2M9VA 3V05A 3MXPA 1PH5A 3GO5A 4KY6A 1K28A 1N33L 3G6JB 4IPGA 5KIXA 1U5KA 3NENA 1SYEA 4OGQC 4Q5VA 4X62Q 1HQRD 5GAEC 2OF1A 2DJFC 3HOUH 4KD4A 5BN5A 4IJLA 5HY6A 4H13C 1VF7A 2QGQA 3H0GH 3T1HQ 2R93G 2K28A 4A3MB 1EWIA 3M3YB 3S16H 5FO9B 3VR3A 1I6HH 5CV9A 4B9XA 1KAWA 4JPBW 4R4OA 4RH6A 4BXXH 1NY4A 2Q8TA 4GNXA 4A3IH 3BJUA 1BNZA 4AQYQ 1EUJA 2NVXB 1DONA 2JA8G 1EEID 1QILA 1T5EA 4EQNA 2EZVA 2JE6I 2PZUA 3M4QA 4WJ4A 3RNUA 5C3XA 4YWMA 1FNWA 1YZ6A 2F3IA 1F9QA 2CH4W 1IBKQ 4CDEC 3PO3G 5I9OA 2JN4A 4EVOA 1PRTF 4DV5L 4A3KG 1BBXC 1C0AA 2BE5C 5JEAJ 1VQHA 5KNBA 3A7LA 4QQBX 4BY7B 4K5WA 4LFCL 4IUPA 4EGVA 1G6ZA 1ET9A 4R1JA 3NWTA 1SNMA 3LWEA 3M7NA 2NVQH 3PV0A 4B9WA 2F0JA 2B2WC 2PI2A 2B2TA 3NPPA 4E6IA 3PSIA 1CSPA 4IPDA 2PQAA 1H9KA 4GLVB 2UXDQ 2GA4B 1HUMA 1PV4A 2K32A 2K1BA 4C3HB 1T5XD 1L1OA 3SE0A 1MGSA 1FNUA 1QVCA 4HJ7A 2MNAA 3OOCA 2F3VA 2HUGA 2K75A 1EFID 2KJXA 4YIJA 2PW7A 2WKDA 4ME3A 1I94Q 4A3FG 1E2WA 2MPMA 3K7UC 3X3MA 4OWWB 3TP7A 2K5DA 5EGTA 5ELBA 4V190 4A3MH 2K50A 4G57A 1D5XC 3M3YH 5C3EH 1PYBA 5DAUA 1FGUA 3PCOB 1H9RA 2EDGA 4B3ML 2UXCL 2O5IC 1QJOA 2F3WA 3A74A 3ND9A 4C1NK 4F8MA 2D2CC 2NVXH 3PO2B 2F0HA 1J6QA 1TT2A 2WAQE 5J39A 1X32A 4H0LC 1VS0A 4DAYA 3KBXA 4GNXC 1IBLL 4K8IA 4KK7A 3K0YA 1K0RA 2E5LL 3VYTA 4B3SQ 2IX0A 4KD3A 1WTXA 2SDFA 1JOOA 1HTLD 1LTRD 1PFMA 1Y1WB 5JJLA 3OSOA 2K7VA 5E3FA 3PF5A 4IQZA 3K58A 4BY7H 3E6ZX 1HNXL 3RLFA 1IZ6A 3HOYH 3EQLC 2CWAA 2N88A 3KLSA 1HCZA 2Z4IA 4F87A 1BR9A 1WD1A 2B8GA 1JB3A 5T1GA 4AYBE 2WAQG 2RQXA 3QOLA 2AWNA 2K33A 1ASYA 2KENA 3OTOQ 2B8FA 3CCSA 4P72A 4IN3A 4DUYL 5IWAQ 2NN6I 3U9SA 3BDLA 2ZTDA 2H5XA 2IX3A 1AH9A 2M2LA 2JA7B 1DOMA 2VW9A 2B2TC 3MXNB 2YTXA 1HNWQ 3MWYW 4JI2L 1SNDA 4DR5Q 5LMNQ 2LXJA 2O5JC 2F0SA 3E0JA 1F2LA 1RKNA 4JVZA 1HPCA 2VQEL 3S2DB 1L1OC 4A3CH 5D3IB 1TY2A 2JSOA 3VYUA 1WYDA 4JV5Q 4LJZC 4OO1G 2RSOA 1A8VA 3I56A 2F0VA 3I55A 4AYBG 3P20A 5FLXE 4C3JB 3NBHA 4IO9A 4GLXA 2GVBA 4G4KA 1EQQA 4M1UB 2BH8A 2RF4A 3NELA 3P7JA 3PO2H 1Q81C 1IYUA 5JJZA 5C44G 3GDEA 1K9MC 3RN5A 4FP5D 2F0MA 1FYCA 4PQXA 2ASBA 1KAAA 4HIOA 1Q8KA 4HJ5A 3VYRA 1HH2P 1PRTC 4QIWB 3CCUA 2PI2E 1X55A 4BY1G 1F9SA 3HOVB 3AQQA 3IKJA 4B08A 4JI3L 5EKLA 1HNZL 1D5ZC 2J4XA 3DWQA 4MHEA 2BCOA 3MXGA 1JB7A 1FVIA 3HEJA 1JE5A 1SMXA 1Y1WH 2CQAA 1WTHA 1K3RA 4O42A 3I4NB 1GHKA 4K5VA 3HZXA 1N34L 2F4VQ 1PTOC 2CH4A 1EFWA 3GTGB 1KRSA 4A3BG 2N3SA 2CKZB 3SDZA 1RCVD 2FFKB 3KUPA 1HR0Q 1G8ZD 3EJIA 1A15A 2CVRA 2TSSA 1CKMA 3W1GA 3R93A 4DV2Q 3TP8A 3S9WA 3HS0C 3KLWA 3NHHA 4L5QA 1KRTA 2JA7H 3Q8DA 4GKJQ 3DM3A 4QIWE 3UDFA 3U58A 3QIAA 1AE2A 1SMYC 3HOXH 1FNVA 4CKCA 2N55A 4HJ9A 5LMUQ 3HOZB 2IHFA 1KDCA 1TWHB 3S2DH 3D0FA 4HJAA 1OXUA 3FKIB 4LF5L 1W2BA 1SNPA 2SNSA 5K5PA 2F0IA 1LACA 3BZKA 2MHVA 3NWSA 5FOBB 1D5MC 2XRQD 4FDBA 4DK1A 1VQOA 1KLGD 2V1CC 4B3TQ 1N8RC 4JI4Q 3NUCA 3I7FA 4GLAC 4FXDA 4CJ2C 4J8QA 5D14A 4LW1A 4LF7Q 4JBMA 3R2TA 4ZRZA 1W6KA 2YU9H 2NN6H 1WFQA 1EY0A 1IW7C 1N36L 3SEBA 1LTBD 2I07B 2D9UA 2IW3A 4A93G 1B9NA 3AFQA 1D7QA 5C4XG 3D31A 3I4NH 1B9MA 1NBWA 3D6CA 2OQKA 2JA6B 4GZYC 2V4DA 3DXJC 4LF8L 3GTGH 1NSNS 2IPKD 4X65L 2K14A 3Q24A 3BZCA 4GKKQ 2CHBD 4EQPA 4DUZL 1WJJA 5HGQA 1Q7YC 4IPCA 1Q8IA 4PMWA 1TWCB 4R4IA 1MJCA 3H91A 3MZ5A 4IZ8A 2E2IB 2F1MA 3I3CA 2K04A 4XIGS 4JI8Q 5M5WB 2WB1E 3BS1A 2HHHQ 2B2YA 4ILWA 4DK6C 4YHHL 3PUZA 1H9JA 3QJYA 2K4KA 3S24A 1Q86C 1PLFA 3KDFB 3M85A 2F0LA 2KHIA 5ELCA 4RAUC 4V0BA 2EYPA 3I4MB 2RCFA 1X9NA 1GKHA 1VQCA 2OXPA 3HOZH 1TWHH 3K6OA 5J22A 1Q12A 1LABA 1SJHD 4C1NI 2F0NA 1EL0A 3FKIH 1SNOA 2IX1A 1K8MA 4JI5L 4ZUJA 1RF2D 1SXTA 4YCUA 2LFNA 4S3SA 4L5SA 4TRDA 4J1MA 3MFYA 4IPHA 4G7OC 3DM1A 1QVFA 1K3BC 4X64Q 1YNJD 1EIHA 1PZJD 3A8KE 2KA7A 2Y0SE 1O7LA 4MIUA 2XWBB 3K57A 2ES2A 2B63G 4IFDG 1BCPF 3OW7A 2G5DA 4GN5A 1ZYRC 1X6OA 1TQOA 3KF6B 1OXVA 2AUJD 3F2BA 5BN4A 1JCKB 1CZGA 3D4RA 1NUCA 2LS01 3OMGA 5TSSA 2C5CA 1B44D 5LL6X 4DXFA 3J7YW 1Y1VB 4YY3Q 1WTPA 1ENCA 2PZTA 3QR8A 1VQAA 3S1NB 1RDPD 3MTSA 3BG3A 5LMNW 2ID0A 2JA6H 1GOZA 2F0FA 3X3NA 3R2IA 4QJFA 1K8GA 1YEZA 4I7AA 3RD4A 5M3MH 4QCLA 2IT1A 4C56C 1SYGA 1TWCH 1BQQT 2E2IH 1DYQA 5M5WH 4FO2A 4DV7L 3IFTA 4RA8A 4RKBA 2WP8J 3NQTA 5GROA 2A69C 3HOWG 5EBDA 3CCLA 1XTCD 3KJPA 1BOSA 4DR7L 4DKAC 1RTNA 1Z9FA 3N6RA 3I4MH 3GTPB 2B2YC 1J5EQ 4XDXA 3MXUA 2SEBD 4H44C 3NQIA 1B4OA 4WRDA 2X69A 5CV5A 1QUQB 4HTHA 1QCBD 5DNFA 1YJNA 1PH7A 4UAIA 4NXNQ 3A5ZB 1PZID 4O2DA 2VNUD 1Y8OB 2KECA 1HA5A 2F0PA 3CRLC 3T1HL 4BBSB 5HGTA 1PFSA 2WIIB 2R7FA 2LMCB 3CXCA 1PH6A 1JJGA 2NZOA 2Q2IA 3S17H 3TN2A 1S5BD 2R61A 3TQYA 1XMQQ 4DV0Q 4CJ0B 1BO0A 3J7AF 4DV3L 4AQYL 1VQ5A 1GUWA 3VR6A 4A3EG 1YNNC 3VA7A 2Z4HA 4I7ZC 4KHVA 1V1OA 3OYYA 4CGYB 1DOLA
chains in the Genus database with same CATH topology
1ZKOA 1A2UA 3BVGA 1TVXA 5IGDA 1ML0D 5E4XA 3D4WA 4HMJA 3I91A 3HOUB 3TMEA 4HR7B 4OIJA 5JEAH 3Q0AA 4IUNA 4A3JB 3H0GB 4BBRB 3VR4A 5C0XJ 1B3AA 4ZQ3A 3W3AA 4BS9A 1STNA 2A73B 2K6AA 4ULLA 1X3PA 5M3FB 1EY5A 1X3QA 1LO5D 3A54A 1V43A 5CYUA 2VXWA 3GTMB 5ELDA 1F9PA 3RMHA 2ICIA 3RZOB 5EKKA 2BDOA 5COYA 3OHXC 5K36G 2E75C 5EPKA 4PV1C 4IFDJ 2I46A 1BCPC 1ILPA 3QO2A 4DXGA 1CHQD 1JR0D 4R8NA 4KMUC 1NAPA 1S5FD 1RD9D 2WKCA 1TWAB 3F2UA 4FXKC 3HP3A 1QNKA 3QG1A 3D8GA 2B2VA 2BA1A 2JYOA 4LK1C 5A35A 2EE1A 2FINB 4ODGA 5JVG3 4OIKA 4MN3A 1G2SA 2K01A 2A6HC 3A56A 4TQUS 3CRKC 1R4PB 1IKLA 4RCOA 1G91A 1LTGD 3TBIB 2RBMA 5C3EB 3FDTA 3Q23A 2PZWA 1MSGA 4J6HA 4O1NA 3P75A 3DUZA 1HQMC 2BE5D 5C4JB 1O80A 1TWGB 1NCVA 5A2QL 1A2TA 1EY4A 2ICEC 5DM63 1BF4A 1PDQA 4ZUIA 2HQEA 4DGZA 5KYLA 3PUVA 2X6GA 1SYCA 2Q8IB 2NB0A 2PYKA 1GUSA 4IUUA 1TR5A 3HOYB 3GTLB 2Z1CA 4KN7C 5FLXL 3MXNA 2A5HA 4ZKBB 4DFAA 1PTOF 1CFMA 5KNCA 1MBYA 3ND8A 1BDOA 4OO1I 2E76C 1M4VA 1HA6A 2AQ1B 3H94A 2B2VC 2L4NA 4ZAIA 1B1ZA 3TDQA 4G7HC 1SYFA 3AU7A 4KKSA 4Z9CB 1I4PA 1E0BA 1STAA 2VB2X 2EOTA 3SVMA 2Q8RE 2SNMA 3I8ZA 2EY6A 1E2ZA 2R3ZA 3A8IE 2RKSA 4HAEA 3T16A 1XWEA 1TWFB 4KKTA 5I2XA 4A3GB 1KLUD 4F88A 1XXGA 3NTKA 1C8CA 2CW0C 1WVLA 1Z7TA 2ENBA 5KRUA 4BA1I 2YYZA 4C3IB 4K14A 3J80L 3SXHA 3PUXA 2HCCA 1TS3A 2XWJB 1Q1EA 4DAVA 3NSWA 3P1HA 4ZK9B 1EY6A 3WDNA 1JORA 4C3HG 3H6MA 3T53B 5A2QE 4RFBA 3EROA 1QG7A 3HOXB 3NXWA 4KKUA 1TY0A 1OXTA 1XX8A 1D6EC 2E2JB 2XSCA 2KCNA 5C6AA 2IL8A 1PRTD 4L63B 3PUWA 1DJRD 2IJ0A 3FMCA 3BYTB 4N9TA 3O13A 4RCNA 3JAML 1DXMA 1SE2A 1PTOD 1EY8A 2F0KA 1HXYD 3BYYB 2NTTA 2YU9B 1HRJA 4OO1H 3IL8A 3BVZA 4FNFA 1V1PB 2XIWA 1TS4A 1VMCA 2L12A 3W2DA 5FO8B 1Q3LA 1SMYD 2E2DC 5C0XI 2EY2A 1CQVA 3OMCA 3WOFA 2RDGA 3ERQA 3T4AC 2KHSA 3L7ZC 1DD2A 3FPUB 1HFGA 2MUYA 1PYWD 1LT6D 2QKIC 2PMZB 5CBEE 1DOKA 5IGEA 5G3LF 3NTIA 3BDOA 3ITPA 5ELFA 1UAPA 1NR2A 1EZ6A 1AEXA 3G7LA 3J80E 4IFDI 5HURA 1KABA 1WTVA 5I6WA 4C3JG 3A8JE 1IW7D 2EJGC 2QEJC 2K5QA 3VYSA 1S4ZA 3EVQA 5IIFA 1AFPA 5BN3A 2QCPX 2JEBI 2E74C 2M00A 1R9TB 3OWEB 3OWFA 4RHSA 2XNAC 1GHJA 1WD0A 4BWGB 1ZXTA 1SSOA 1HFNA 5AFWA 3Q22A 1WTOA 5E1FA 5M3MB 4F7XA 2R92B 4X3SA 3JAME 4G7ZC 1AZPA 3SR1A 2OEOA 3I4LA 2EJFC 2NZ1D 3KLRA 2PQEA 4IALA 1I4XA 4IUTA 1IL8A 2R6GA 5EPJA 2F0EA 4FVMA 5FO7B 1I50B 3EFXD 1OO9B 3L9AX 3FVQA 3C1FA 5DEHA 1EZ8A 2HCIA 4NMZA 3VR2A 1ZYRD 2KUMA 3TZDA 3D3RA 3C3LA 1SDFA 2D5DA 1ICWA 4QF4A 5C0XH 1EY7A 3S17B 4QMGA 4RWSC 1SFOB 3T51B 1LT4D 5C4HA 4CKEA 2AQ3B 2VUMB 2QDBA 1PFNA 4OHJA 2L1BA 2L9HA 5M9OA 1HHVA 1MD2D 3LX0A 1A3UA 3KF8A 5C3WA 2A69D 1STGA 3V2TA 2AQ2B 2HDLA 3J81L 3S1QB 1RHPA 3K5MA 4IFDH 1KNAA 1EIGA 3T56B 3DWPA 1D2BA 3M7GA 2PW5A 1WTQA 4NP5A 5I9PA 1O7ZA 2F0GA 2B2UA 1A3TA 3OPOA 1ONLA 1ESFA 2KOLA 1WCMB 2EXZA 2EJMA 4K2KA 3DEPA 3PIP3 2AWOA 3TP5A 5CC4A 1KNEA 2NUCA 1A6XA 1I4HA 1GUGA 1EU3A 1UUPA 1Z47A 2F0WA 1YNND 5T1IA 3TP6A 1LTID 2LKVA 1C48A 4XT1B 5KGUA 1JOKA 1BXTA 2JXMB 3GTKB 4UDUC 4XQQA 3D6WA 4RKLA 1RJTA 1EYDA 3SK6A 1G2TA 1D1IA 2EYHA 1PXUA 3UI2A 1S5DD 2L5TA 5IOCA 3MFGA 5M5YB 3N52A 1EQTA 2ZXPA 1GUNA 4FXGC 5CGKA 5D65A 1ET6A 2WV6D 1Y8NB 1ILQA 3VR5A 4IUVA 1JWSD 4A3DB 1DM0B 4KTAA 2EY5A 1QWYA 3FRPB 5E4WC 2L55A 1RTOA 1U4PA 3DEOA 1AN8A 2MP1A 2XRSD 3OIQA 1SAPA 4Q0FA 1EOTA 3ONAB 5I6YA 1BCPD 4KY5A 3GV6A 1STEA 2FJ2A 2F4IA 5ISRA 2B2UC 3TZUA 3RZDB 3MVVA 2ZXOA 3I72A 1CA5A 1D1KA 3J81E 4ZYSA 3IAYA 2R93B 3K5NA 5CORA 1B2TA 1GUOA 2WACA 3V96A 3D4DA 2JA8B 2EYFA 1AW7A 2A68C 2A6HD 1HUNA 5IGBA 4DK0A 3RUZA 4PNYA 5CV6A 4K5XA 2H1EA 2C9OA 1I4RA 5EBCA 3PO3B 4QB4A 3EA6A 4A3KB 1OXSC 3C1EA 2A6EC 1JOQA 1VF5C 3FPPA 1W6JA 1K83B 2EPBA 4ZKCB 1QE6A 1JICA 1XYIA 1CM9A 3VA5A 3H3VC 1C4QA 3I70A 3KBGA 1CZWA 5JVH3 1UEAB 4K6LA 1NR4A 3S1RB 4K6DA 1S5CD 1MSHA 2IWHA 3LWUA 1DZ1A 4A3FB 2J0TD 2XN9C 4WORA 1LTTD 5CMDA 1SE4A 3Q6SA 3S1MB 2QF7A 1EYAA 3BDCA 5J1ZA 1PZKD 1LTAD 4X3TA 3LNNA 2KQ3A 2KCCA 3NK9A 1O78A 5JAVA 4HCEA 3HG9A 1H9SB 3NE5B 2PPBC 4XYQA 1CTMA 4JK1C 3S15B 3S14B 4DF7A 2SOBA 2G9DA 3S2HB 3R8BA 3CQZB 2H4OA 2WAQB 1ENAA 2B39A 1FD7D 3R3OA 2O4XA 2DY8A 4KV6A 5IGCA 4LAAA 1QOHA 2CW0D 3FEWX 3GV3A 3H09A 1SYDA 3CKIB 1F2MA 1V1PA 4XYOA 1ZEQX 3PIO3 4PMCA 1JWMD 2PCFB 1G291 5ELEA 3DWAA 2DNCA 1J9OA 1F2YA 2NYZD 3HRZC 2F0UA 4QUFA 2NWGA 4AYBB 2BDNA 4IUQA 1E2VA 3GTOB 1VMPA 4FF2A 5C44B 1LV9A 1WTWA 4RGOS 3OIPA 1EU4A 4P2CB 2L0CA 4L8JA 4XQJA 4EQOA 3PUYA 4BY1B 4RGNA 3MA2B 2PNRC 3M4OB 3CU7A 1EY9A 2E2HB 1I6VC 2Z8LA 2X6LA 4FF1A 4DNRB 4NW2A 5LL6S 2FMCA 4CBVA 3MHBA 3E5SA 4A3BB 1JE4A 5I4DA 4DU9A 2L11A 2FMMA 4PMBA 1TU2B 1J8IA 3K7AB 4JBWA 2O2LD 1Z6HA 4N9PA 4R9WA 4ME5A 2F0TA 5CV7A 5CV8A 2TMPA 5I2YA 2HDMA 5IODA 3WOEA 3IFDA 1PMRA 3GTJB 1F2ZA 1A3VA 1TIID 1TS5A 4U68A 4DN4M 5JPMC 5KEEA 1B50A 1QB5D 4C3IG 5FKAC 3J7AV 2K03A 4ZLTF 1SJED 1Y8PB 4KY7A 2EYMA 3NTHA 1PRTB 4RGTA 5JPNC 1M8AA 5CBAE 1U4LA 5NUCA 3AB9A 1SEBD 4DAPA 4A93B 1LT5D 5IT9L 2EYLA 5C4XB 2NVYB 1AP0A 1STYA 1PTOB 4M8AA 1CHPD 5EQ0A 5KNDA 1CT1D 5M5XB 4FF4A 4XQNA 2DY7A 4NKLA 1DCZA 1O7YA 4XTCS 2AUKA 3MC0B 1U4RA 2KVMA 2EYJA 5C5MA 3MEHA 5DM73 1U9RA 2F0DA 2NN6G 1KTKA 1LT3D 5C5LA 2EVBA 2LY7A 2NBFA 3SK8A 4CKBA 2EY1A 4KJNA 3I73A 2A74C 4ID6A 4R8IA 3SK4A 2WB1B 1ENFA 4TSSA 3GTQB 4QUCA 3C2PA 1I3QB 2B63B 3MAQA 1LLRD 2WINB 5IGGA 1GXDC 2RDHA 1S5ED 4FF3A 3NP8A 1I4QA 1PTOH 2VB3X 1SNQA 2KEEA 1L0YB 3QB3A 3SK5A 3K5LA 3GP7A 2J7ZA 4K2LA 5EPLA 1EYCA 4H7BA 2NVTB 4CJ1B 2Y0SB 2ZXRA 4K8JA 3T13A 5CV4A 4DA2A 1STBA 3HOWB 5C0XG 1MI2A 5FK9C 5KYIA 4HN7A 1TKWB 4I65A 3BVMA 4CHTB 5IT9E 1Q90A 2G9HD 1FR3A 2DN8A 3GQBA 4X3UA 5IGFA 2ZT9C 5C4ZA 5G3LD 1ESRA 2RSNA 1II3A 1K8OA 1CQFA 5EKIA 4LMQD 5LHY1 4ABNA 2D62A 1Q1BA 2FHTA 3ZYYX 4TKOB 4A3EB 1KDAA 1JC7A 3BZDB 2F03A 4WFN3 4BA2I 1CI3M 3HGBA 2NTSA 1YNJC 4HCSA 2OT2A 3I90A 5JOBA 2F0QA 3TSSA 1I4GA 1U4MA 3NBIA 4X3KA 2R7ZB 1GUTA 1QNUA 1JQYD 1L0XB 3DMUA 4RHRA 4HEDA 1CA6A 1FGBD 4U673 1R4QB 1IKMA 2JEAI 1VCIA 1HTPA 1LTSD 3DHQA 4L6TB 1IYVA 4XT3B 1SYBA 3AMUA 3A7AB 3SHLA 4XXEA 1SBBB 4HSVA 2RA4A 5D3DA 3L3OC 1SNCA 2K05A 2MGSA 1PFBA 3K5OA 1RODA 2JP1A 2K5WA 3CHBD 3KK7A 3C46A 1SE3A 1EQVA 1F77A 2DNEA 5CR3A 4FYDA 3GD7A 4IURA 4KHZA 2JA5B 1WTRA 1STHA 4C2MB 2BA0A 3PMFA 5JEAG 1EWCA 1F9RA 1EEFD 1UNSA 1OXXK 1AZQA 1Y69U 1GJXA 2MJ8A 1CK1A 4KN4C 1H9MA 2BOSA 4Y7NB 1VDZA 4HMIA 2EYOA 1V8QA 2A68D 2F0OA 3M4YA 3S16B 4WJWA 5F2DA 1I6HB 4DNTB 4A3IB 1H9SA 1EWHA 3U9OA 4RGMA 3QOJA 2A6ED 3QWNA 1KDBA 3A55A 4OL7A 1TS2A 1B53A 3KLSX 1IHZA 2QILA 1JWUD 5EJWA 4HSPA 5K36H 1BCPB 4NDXA 2RDFA 2B2WA 1BUVT 3URYA 3K59A 3HKZB 2NVQB 2RVLA 4KI0A 2KEDA 4KJOA 2XVSA 2PO4A 2M9VA 3V05A 3MXPA 3GO5A 4KY6A 3G6JB 5KIXA 1SYEA 4OGQC 4Q5VA 1HQRD 2OF1A 4KD4A 5BN5A 4H13C 1VF7A 2K28A 4A3MB 3M3YB 5FO9B 3VR3A 5CV9A 4B9XA 4RH6A 2Q8TA 1BNZA 2NVXB 1DONA 1EEID 1QILA 1T5EA 4EQNA 2EZVA 2JE6I 2PZUA 5C3XA 1FNWA 1F9QA 5I9OA 4EVOA 1PRTF 1BBXC 2BE5C 5JEAJ 5KNBA 3A7LA 4BY7B 4K5WA 4IUPA 4EGVA 1G6ZA 1ET9A 3NWTA 1SNMA 3LWEA 3M7NA 3PV0A 4B9WA 2F0JA 2B2WC 2B2TA 3NPPA 4E6IA 1H9KA 2GA4B 1HUMA 2K32A 2K1BA 4C3HB 1T5XD 3SE0A 1MGSA 1FNUA 3OOCA 2F3VA 2HUGA 4YIJA 1EFID 2KJXA 2PW7A 2WKDA 1E2WA 2MPMA 3X3MA 3TP7A 2K5DA 5EGTA 5ELBA 4V190 4G57A 1D5XC 5DAUA 1H9RA 2EDGA 2O5IC 1QJOA 2F3WA 3ND9A 4C1NK 4F8MA 2D2CC 3PO2B 2F0HA 1TT2A 5J39A 1X32A 4H0LC 4DAYA 3KBXA 4K8IA 4KK7A 3K0YA 3VYTA 2IX0A 4KD3A 1WTXA 2SDFA 1JOOA 1HTLD 1LTRD 1PFMA 1Y1WB 3OSOA 2K7VA 5E3FA 4IQZA 3K58A 3E6ZX 3RLFA 3EQLC 2N88A 3KLSA 1HCZA 2Z4IA 4F87A 1BR9A 1WD1A 2B8GA 1JB3A 5T1GA 2RQXA 3QOLA 2AWNA 2K33A 2B8FA 4IN3A 2NN6I 3U9SA 3BDLA 2IX3A 2M2LA 2JA7B 1DOMA 2B2TC 3MWYW 1SNDA 2O5JC 2F0SA 3E0JA 1F2LA 1RKNA 1HPCA 3S2DB 5D3IB 1TY2A 2JSOA 3VYUA 4LJZC 4OO1G 2RSOA 2F0VA 3P20A 5FLXE 4C3JB 3NBHA 4G4KA 4M1UB 3P7JA 1IYUA 5JJZA 4FP5D 2F0MA 1FYCA 4PQXA 1KAAA 3VYRA 1PRTC 4QIWB 1F9SA 3HOVB 3IKJA 4B08A 5EKLA 1D5ZC 2J4XA 3DWQA 4MHEA 2BCOA 3MXGA 3HEJA 2CQAA 4O42A 3I4NB 1GHKA 4K5VA 3HZXA 1PTOC 3GTGB 3SDZA 1RCVD 2FFKB 3KUPA 1G8ZD 3EJIA 1A15A 2CVRA 2TSSA 3R93A 3TP8A 3S9WA 3HS0C 3NHHA 3QIAA 1SMYC 1FNVA 4CKCA 2N55A 3HOZB 1KDCA 1TWHB 1OXUA 3FKIB 1SNPA 2SNSA 5K5PA 2F0IA 1LACA 2MHVA 3NWSA 5FOBB 1D5MC 2XRQD 4DK1A 1KLGD 3NUCA 4FXDA 4CJ2C 4J8QA 5D14A 3R2TA 4ZRZA 1W6KA 2NN6H 1EY0A 1IW7C 3SEBA 1LTBD 2I07B 2D9UA 2IW3A 1B9NA 3D31A 1B9MA 3D6CA 2JA6B 4GZYC 2V4DA 3DXJC 1NSNS 2IPKD 3Q24A 2CHBD 4EQPA 1Q8IA 4PMWA 1TWCB 3H91A 3MZ5A 4IZ8A 2E2IB 2F1MA 3I3CA 2K04A 4XIGS 5M5WB 3BS1A 2B2YA 4ILWA 3PUZA 1H9JA 3QJYA 1PLFA 3M85A 2F0LA 5ELCA 4RAUC 4V0BA 2EYPA 3I4MB 2OXPA 3K6OA 5J22A 1Q12A 1LABA 1SJHD 4C1NI 2F0NA 1EL0A 2IX1A 1SNOA 1K8MA 4ZUJA 1RF2D 1SXTA 2LFNA 4S3SA 4TRDA 4J1MA 3MFYA 4G7OC 3DM1A 1YNJD 1EIHA 1PZJD 3A8KE 2KA7A 4MIUA 1O7LA 2XWBB 3K57A 4IFDG 1BCPF 3OW7A 1ZYRC 1TQOA 1OXVA 2AUJD 5BN4A 1JCKB 1CZGA 3D4RA 1NUCA 2LS01 3OMGA 5TSSA 2C5CA 1B44D 5LL6X 4DXFA 3J7YW 1Y1VB 1WTPA 1ENCA 2PZTA 3S1NB 1RDPD 3MTSA 3BG3A 2ID0A 1GOZA 2F0FA 3X3NA 3R2IA 3RD4A 4QCLA 2IT1A 4C56C 1SYGA 1BQQT 1DYQA 4FO2A 3IFTA 4RA8A 4RKBA 2WP8J 3NQTA 2A69C 5EBDA 1XTCD 1BOSA 1RTNA 3N6RA 3GTPB 2B2YC 4XDXA 3MXUA 2SEBD 4H44C 3NQIA 1B4OA 4WRDA 2X69A 5CV5A 4HTHA 1QCBD 5DNFA 4UAIA 2VNUD 1PZID 1Y8OB 2KECA 1HA5A 2F0PA 3CRLC 4BBSB 5HGTA 2WIIB 2LMCB 3TN2A 1S5BD 2R61A 4CJ0B 1BO0A 3J7AF 1GUWA 3VR6A 1YNNC 3VA7A 2Z4HA 4I7ZC 4KHVA 1V1OA 4CGYB 1DOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J1M A;  4ME5 A;  4ID6 A;  4PNY A;  3TP6 A;  2F0T A;  5C3X A;  5CV6 A;  2F0O A;  3SK4 A;  3T16 A;  1A2U A;  2LKV A;  4K5X A;  2F0E A;  5F2D A;  1JOK A;  5KGU A;  5CV7 A;  5JOB A;  2RBM A;  2F0Q A;  5CV8 A;  1KDC A;  2EY2 A;  3QOL A;  1ENA A;  5IGD A;  3R3O A;  4MIU A;  5IOD A;  2O4X A;  2PZW A;  4QB4 A;  4J6H A;  3U9O A;  3OMC A;  3P75 A;  4EVO A;  5I9O A;  3C1F A;  3BDL A;  4KV6 A;  5IGC A;  5DEH A;  1EZ8 A;  4LAA A;  1SNP A;  3D4W A;  2SNS A;  3C1E A;  4EQN A;  5IGG A;  2F0I A;  1F2Z A;  1A3V A;  3ERQ A;  3QOJ A;  4HMJ A;  4RKL A;  5K5P A;  3DMU A;  4NMZ A;  1JOQ A;  1TQO A;  2KHS A;  1EYD A;  3SK6 A;  5KEE A;  2ENB A;  4K5W A;  1SND A;  3TME A;  1KDB A;  5KRU A;  4OL7 A;  1NUC A;  3OMG A;  4IUN A;  4K14 A;  3DHQ A;  1SNM A;  2F0S A;  1SYD A;  3NUC A;  1F2M A;  3SXH A;  2EYH A;  1IHZ A;  1RKN A;  5IGE A;  3NP8 A;  1ENC A;  2PZT A;  4ZQ3 A;  1SYB A;  3VA5 A;  4B9W A;  5IOC A;  4PMC A;  2PZU A;  2F0J A;  1STN A;  4KY7 A;  3ITP A;  2EYM A;  4E6I A;  3SHL A;  4QF4 A;  1A2T A;  1EY4 A;  1EY7 A;  1SNQ A;  1F2Y A;  2F0F A;  4ZUI A;  2HQE A;  1EY5 A;  1EZ6 A;  3P1H A;  3QB3 A;  2F0U A;  4QMG A;  3SK5 A;  1AEX A;  4DGZ A;  1EY6 A;  2F0V A;  4NDX A;  4K2L A;  5CGK A;  5KYL A;  1EY0 A;  1SYC A;  2RDF A;  1JOR A;  5HUR A;  1EYC A;  1KAB A;  1SYG A;  3H6M A;  4H7B A;  5C4H A;  5I6W A;  1SNC A;  2PYK A;  2QDB A;  4K6D A;  5NUC A;  2F3V A;  4YIJ A;  3ERO A;  2PW7 A;  1TR5 A;  5M9O A;  4K8J A;  3NXW A;  3T13 A;  5CV4 A;  2EYL A;  5EKK A;  4KTA A;  4RKB A;  3NQT A;  3LX0 A;  2EY5 A;  1STB A;  1A3U A;  1STY A;  4KJO A;  3EVQ A;  1EQV A;  3D6C A;  2F0M A;  4WOR A;  5EGT A;  3TP7 A;  4DFA A;  5C3W A;  5IIF A;  1KAA A;  1STG A;  4G57 A;  5KYI A;  1NSN S;  3MXP A;  5DAU A;  4KY6 A;  5CR3 A;  3V2T A;  2M00 A;  4EQO A;  5C6A A;  1EYA A;  4I65 A;  4EQP A;  3BDC A;  5KIX A;  3OWF A;  5I6Y A;  2F3W A;  4KY5 A;  5J1Z A;  1SYE A;  3MZ5 A;  4IZ8 A;  4WRD A;  2KQ3 A;  5CV5 A;  1STH A;  5EKL A;  4HTH A;  5ISR A;  4F8M A;  3NK9 A;  4R8N A;  3HEJ A;  3PMF A;  4N9T A;  1EY9 A;  2F0H A;  2OF1 A;  3MVV A;  5JAV A;  4KD4 A;  1TT2 A;  5J39 A;  4NKL A;  5IGF A;  4K5V A;  3HZX A;  2F0P A;  5C4Z A;  4HMI A;  2PW5 A;  1SYF A;  4NP5 A;  5I9P A;  2F0L A;  5HGT A;  3D8G A;  1II3 A;  2F0G A;  3E5S A;  1A3T A;  3MHB A;  2EYP A;  1EY8 A;  4K8I A;  2F0K A;  2EYJ A;  5C5M A;  2EXZ A;  4DU9 A;  3MEH A;  2WAC A;  4ODG A;  1STA A;  5CV9 A;  4PMB A;  2OXP A;  5E1F A;  4K2K A;  4B9X A;  1U9R A;  2F0D A;  3EJI A;  3TP5 A;  5J22 A;  4F7X A;  5CC4 A;  2NUC A;  2SNM A;  2F0N A;  4KD3 A;  5C5L A;  1SNO A;  3SR1 A;  2EY6 A;  3D4D A;  4DF7 A;  1JOO A;  3SK8 A;  2OEO A;  4ZUJ A;  3TP8 A;  3S9W A;  2EYF A;  1KDA A;  2SOB A;  3NHH A;  2EY1 A;  3OSO A;  2PQE A;  4KJN A;  4S3S A;  5E3F A;  4TRD A;  4KHV A;  4IAL A;  4N9P A;  2F0W A;  2EYO A;  5IGB A;  2RKS A;  3RUZ A; 
#chains in the Genus database with same CATH topology
 5AJ3 Q;  1ZKO A;  1SN8 A;  1A2U A;  3BVG A;  1Y1V H;  4LF9 L;  1TVX A;  5ELN A;  5IGD A;  3PGZ A;  3S1N H;  4DR4 Q;  1IBK L;  1ML0 D;  5E4X A;  1VQ4 A;  2JA9 A;  1UE5 A;  2R7Z G;  2JK8 A;  3D4W A;  3S1Q H;  3G48 A;  4HMJ A;  3J7Z C;  3I91 A;  3KF8 B;  2RCN A;  4P71 A;  2K5H A;  3HOU B;  1AE3 A;  4HR7 B;  3TME A;  4OIJ A;  5JEA H;  3Q0A A;  4IUN A;  4A3J B;  5JJK A;  3H0G B;  4BBR B;  3VR4 A;  5C0X J;  1B3A A;  3CCJ A;  4ZQ3 A;  3W3A A;  4BS9 A;  1STN A;  2A73 B;  2K6A A;  4ULL A;  1X3P A;  1NNX A;  5M3F B;  4LFA Q;  1EY5 A;  1X3Q A;  2UXD L;  3A0J A;  4CDF C;  1LO5 D;  3A54 A;  1SRO A;  1V43 A;  5CYU A;  2VXW A;  3GTM B;  5ELD A;  3UE0 A;  1F9P A;  3RMH A;  2ICI A;  3PF4 A;  2VQF L;  3RZO B;  2AMC B;  4JW0 A;  5EKK A;  2BDO A;  1I94 L;  5COY A;  2ZM6 Q;  4ZCK A;  2Z6K A;  4BBS H;  3OHX C;  5K36 G;  2E75 C;  2MO1 A;  5EPK A;  4PV1 C;  4IFD J;  3H3V I;  2I46 A;  1BCP C;  2K5N A;  1ILP A;  3QO2 A;  2EXD A;  2JA5 G;  4DXG A;  1CHQ D;  4YWK A;  1JR0 D;  4A3L H;  4R8N A;  4KMU C;  1PH1 A;  3KJO A;  1NAP A;  1S5F D;  1RD9 D;  1XPR A;  2WKC A;  1TWA B;  3F2U A;  4FXK C;  3HP3 A;  1QNK A;  3QG1 A;  3D8G A;  2B2V A;  2BA1 A;  2JYO A;  4LK1 C;  2BH2 A;  2EE1 A;  5A35 A;  2FIN B;  4ODG A;  2P5Z X;  5JVG 3;  3M4P A;  4OIK A;  1MIU A;  1H95 A;  4MN3 A;  1G2S A;  2K01 A;  5BR8 Q;  2A6H C;  3A56 A;  1M90 C;  4TQU S;  3ULL A;  3CRK C;  1R4P B;  4A3D H;  1IKL A;  4A3J H;  4RCO A;  1G91 A;  4LNQ A;  1LTG D;  3TBI B;  4BBR H;  1E1O A;  2RBM A;  5C3E B;  3FDT A;  1V1Q A;  1EIF A;  3Q23 A;  3OTO L;  4N8X 1;  2PZW A;  1MSG A;  4J6H A;  4O1N A;  3P75 A;  2QW7 A;  5IWA L;  5M3F H;  3HKZ E;  3DUZ A;  1HQM C;  2BE5 D;  5C4J B;  1O80 A;  3GTM H;  1HNW L;  4EX5 A;  5LMN L;  1NMF A;  1TWG B;  4DAM A;  4JBK A;  3RZO H;  1NCV A;  5A2Q L;  1YNX A;  3TS0 A;  4DV1 Q;  1X3E A;  3ICE A;  1A2T A;  1EY4 A;  2ICE C;  5DM6 3;  5FLM H;  5IE8 A;  1PDQ A;  1BF4 A;  4ZUI A;  4JV5 L;  2HQE A;  4DGZ A;  5KYL A;  1N32 Q;  3PUV A;  2X6G A;  1SYC A;  2Q8I B;  2NB0 A;  1XMO Q;  2PYK A;  1GUS A;  2Z6K C;  3CD6 A;  3HKZ G;  4IUU A;  1TR5 A;  4NXM L;  3HOY B;  3GTL B;  1PA6 A;  1UE6 A;  2Z1C A;  3ULP A;  2UUC Q;  4KN7 C;  3CC7 A;  2A19 A;  5FLX L;  3MXN A;  2A5H A;  2HD3 A;  1TWA H;  4ZKB B;  4DFA A;  3ULJ A;  1PTO F;  1CFM A;  5KNC A;  1MBY A;  3ND8 A;  4DR2 Q;  1BDO A;  4OO1 I;  2E76 C;  5GAH C;  1M4V A;  1HA6 A;  2AQ1 B;  3H94 A;  2B2V C;  4LF4 Q;  2L4N A;  4NB3 A;  4ZAI A;  1B1Z A;  3TDQ A;  4G7H C;  3LGJ A;  1SYF A;  2F4V L;  4A3M G;  3CC2 A;  3AU7 A;  2Z0S A;  4KKS A;  4Z9C B;  1I4P A;  2ZTE A;  1E0B A;  4Y52 H;  1STA A;  4JG2 A;  3H3V H;  3H15 A;  2VB2 X;  2EOT A;  3SVM A;  2Q8R E;  2SNM A;  1LUZ A;  3I8Z A;  2MFI A;  3ZJY C;  2EY6 A;  1E2Z A;  2R3Z A;  3A8I E;  4DV2 L;  4B3R Q;  5C4J H;  2YV5 A;  2RKS A;  4GKJ L;  4HAE A;  3T16 A;  1XWE A;  5FJ8 H;  1TWG H;  4A3F H;  1QVG A;  4MZ9 A;  2HIV A;  1D8L A;  1TWF B;  2Q2U A;  4KKT A;  5I2X A;  4A3G B;  5LMU L;  1KLU D;  4IOC A;  4F88 A;  3WWV A;  1XXG A;  3NTK A;  3J81 j;  1C8C A;  3AYH B;  4KHP L;  1YIT A;  2D0O A;  2CW0 C;  2CQO A;  1WVL A;  3RN2 A;  4BY7 G;  1Z7T A;  2WFW A;  2ENB A;  5KRU A;  4BA1 I;  2YYZ A;  4C3I B;  4K14 A;  3J80 L;  3SXH A;  3PUX A;  2HCC A;  3GTL H;  1TS3 A;  1JMC A;  2XWJ B;  1NJI C;  3CAM A;  4N8F A;  1B3Q A;  4LF7 L;  1Q1E A;  4DAV A;  2VZA A;  3NSW A;  4AH6 A;  3P1H A;  4ZK9 B;  1EY6 A;  3EIV A;  3WDN A;  1JOR A;  4C3H G;  3H6M A;  3T53 B;  5A2Q E;  1RL2 A;  4PZ7 A;  3UDI A;  4RFB A;  3ERO A;  1QG7 A;  3S2H H;  4DPG A;  3HOX B;  3J7A 5;  3NXW A;  2Q2H A;  3CQZ H;  4A3C G;  2UXB Q;  4KKU A;  1TY0 A;  1OXT A;  1XX8 A;  1D6E C;  2ZJP A;  2E2J B;  2XSC A;  2KCN A;  5C6A A;  2IL8 A;  1PRT D;  4L63 B;  3PUW A;  4GKK L;  1DJR D;  2NZH A;  3E9I A;  5IP9 H;  2IJ0 A;  3FMC A;  2AHO B;  3SGI A;  2VY3 A;  3BYT B;  4UP7 A;  4N9T A;  3PO2 G;  3O13 A;  2HHH L;  1VQ7 A;  4RCN A;  3U50 C;  3JAM L;  2UU9 Q;  3G6E A;  5IYB H;  1DXM A;  1SE2 A;  1PTO D;  1EY8 A;  2F0K A;  1HXY D;  3BYY B;  2NTT A;  1TWF H;  4A3G H;  2YU9 B;  1HRJ A;  4UP9 A;  4OO1 H;  3IL8 A;  3BVZ A;  4FNF A;  1V1P B;  2XIW A;  4K0K Q;  1TS4 A;  1VMC A;  2L12 A;  1Y1W G;  3E3X A;  3W2D A;  1XPO A;  1PHJ A;  1CSQ A;  5FO8 B;  3DLL A;  1U0L A;  4C3I H;  1Q3L A;  2XTI A;  4OXP A;  2D0P A;  1SMY D;  2A1A A;  4P74 A;  2E2D C;  4X64 L;  5C0X I;  2EY2 A;  1CQV A;  3CCM A;  2MO0 A;  3OMC A;  3KDF A;  3WOF A;  2RDG A;  3ERQ A;  2JA7 G;  3T4A C;  2KHS A;  3L7Z C;  1DD2 A;  4YCV A;  3M4O H;  1IXR A;  1C9O A;  3FPU B;  1HFG A;  2MUY A;  1E3P A;  1PYW D;  1LT6 D;  2QKI C;  2PMZ B;  5CBE E;  4YY3 L;  1DOK A;  5IGE A;  5G3L F;  3NTI A;  4UHV A;  4RG1 A;  3BDO A;  3ITP A;  5IP7 H;  5ELF A;  1PH4 A;  1UAP A;  1NR2 A;  1EZ6 A;  1A63 A;  3T1Y Q;  1AEX A;  4R4Q A;  3G7L A;  3J80 E;  2E2J H;  4IFD I;  4DNI A;  1L0W A;  5HUR A;  1KAB A;  1WTV A;  5I6W A;  4C3J G;  3A8J E;  1IW7 D;  2EJG C;  2QEJ C;  2K5Q A;  3VYS A;  4DR1 Q;  5FLX c;  2LXK A;  4DR6 Q;  4UPA A;  4HIK A;  1S4Z A;  3EVQ A;  3KF6 A;  2R7D A;  5IIF A;  2E5L Q;  1AFP A;  2QCP X;  5BN3 A;  2JEB I;  2E74 C;  2M00 A;  1R9T B;  3OWE B;  1J5E L;  1Q82 C;  3OWF A;  1UEB A;  3HOV G;  1EYG A;  4A75 A;  4RHS A;  3M9B A;  1VQB A;  2XNA C;  1GHJ A;  4UP8 A;  4NXN L;  1WD0 A;  4BWG B;  3I4N G;  2JQO A;  1ZXT A;  1SSO A;  1HFN A;  5AFW A;  4TVA B;  4PG3 A;  3Q22 A;  3NEM A;  4DUY Q;  1WTO A;  5E1F A;  2VL6 A;  4HJ8 A;  3F2C A;  5M3M B;  4F7X A;  3I4O A;  2R92 B;  4X3S A;  3JAM E;  1W3S A;  4JC0 A;  4G7Z C;  1XMQ L;  3SR1 A;  4DV0 L;  1AZP A;  1PVO A;  2OEO A;  3I4L A;  2EJF C;  2NZ1 D;  3KLR A;  1XTD A;  2PQE A;  4IAL A;  4MTK A;  4A93 H;  1I4X A;  2B3G A;  4IUT A;  1QUQ A;  1IL8 A;  2R6G A;  5EPJ A;  2F0E A;  4FVM A;  5FO7 B;  3EN2 A;  2OWO A;  3HOZ G;  1I50 B;  1EOV A;  3EFX D;  1OO9 B;  3L9A X;  3FVQ A;  3FKI G;  3C1F A;  1IL2 A;  5DEH A;  1EZ8 A;  2HCI A;  4O0A A;  1LM0 A;  4NMZ A;  3VR2 A;  3J80 c;  5IYD H;  1ZYR D;  2KUM A;  3L0O A;  4DV4 Q;  3TZD A;  3AEV A;  1V9P A;  3D3R A;  5E7N A;  3CME A;  3C3L A;  1SDF A;  2WB1 G;  2D5D A;  1ICW A;  4QF4 A;  5C0X H;  1EY7 A;  1SE8 A;  3S17 B;  4QMG A;  2CCZ A;  4LFA L;  4RWS C;  1HZA A;  1SFO B;  3T51 B;  1R9T H;  1LT4 D;  5C4H A;  4CKE A;  2AQ3 B;  2VUM B;  2QDB A;  2HIX A;  1PFN A;  2ZTC A;  4QL5 A;  4OHJ A;  2L1B A;  1XNQ Q;  2L9H A;  5M9O A;  2UUB Q;  1HHV A;  3ER0 A;  1N34 Q;  1MD2 D;  3LX0 A;  1A3U A;  3KF8 A;  1UE7 A;  2ZM6 L;  5C3W A;  1GD7 A;  2JA6 G;  2A69 D;  4ALP A;  1STG A;  4H02 A;  1L2F A;  3V2T A;  2AQ2 B;  3GTQ H;  3K8A A;  4JI6 Q;  2HDL A;  3MEF A;  3J81 L;  3S1Q B;  1RHP A;  5ELO A;  4OWX B;  3K5M A;  1HZC A;  4IFD H;  2AKW B;  2R92 H;  2Y0S G;  1KNA A;  3B6Y A;  3JAM c;  1EIG A;  3T56 B;  3DWP A;  3VDY A;  1D2B A;  3M7G A;  2KCM A;  2PW5 A;  1WTQ A;  4NP5 A;  5I9P A;  1O7Z A;  2F0G A;  2B2U A;  4OX9 Q;  1A3T A;  3OPO A;  1ONL A;  3I4M G;  1ESF A;  2KOL A;  1WCM B;  3AFP A;  2EXZ A;  4YWL A;  2EJM A;  2HQL A;  4K2K A;  1A62 A;  3DEP A;  2AWO A;  3PIP 3;  1I50 H;  4JI0 Q;  1VQM A;  3TP5 A;  5CC4 A;  1KNE A;  2NUC A;  1A6X A;  1I4H A;  1GUG A;  1EU3 A;  1KHI A;  1UUP A;  1T9H A;  5BR8 L;  4X62 L;  1Z47 A;  1K73 C;  1VQD A;  2F0W A;  1YNN D;  1G51 A;  5T1I A;  3TP6 A;  1LTI D;  4AIM A;  2LKV A;  1C48 A;  4LWC A;  1CKN A;  4XT1 B;  5KGU A;  1JOK A;  2KBN A;  1BXT A;  2JXM B;  3PQI A;  3GTK B;  2I5M X;  4UDU C;  3E9H A;  4XQQ A;  3D6W A;  1GVP A;  4JOI A;  4RKL A;  1A0I A;  1SFO H;  1RJT A;  1EQR A;  1EYD A;  3RR5 A;  3SK6 A;  1G2T A;  2VUM H;  1D1I A;  1HR0 W;  2EYH A;  1PXU A;  3UI2 A;  1KC8 C;  1S5D D;  2L5T A;  1K0S A;  5IOC A;  3MFG A;  2ZJR A;  1SR3 A;  5M5Y B;  3N52 A;  4DV1 L;  1EQT A;  2ZXP A;  1GUN A;  4FXG C;  3HFZ B;  5J3B A;  5CGK A;  5D65 A;  1N32 L;  1ET6 A;  2WV6 D;  1Y8N B;  1ILQ A;  1XMO L;  1WI5 A;  3VR5 A;  4IUV A;  1KIX A;  5L37 A;  1JWS D;  4A3D B;  1YHB A;  3FHW A;  1ASZ A;  1DM0 B;  1KQS A;  2UUC L;  4KTA A;  2EY5 A;  1QWY A;  1YHA A;  3STB C;  3FRP B;  5IYC G;  5E4W C;  2L55 A;  1RTO A;  1MHW C;  1U4P A;  3DEO A;  2RHQ B;  1AN8 A;  1SRU A;  3OIQ A;  1WCM H;  1SAP A;  2MP1 A;  2XRS D;  1EOT A;  2XGT A;  4Q0F A;  2GVA A;  4DR2 L;  2ZJQ A;  3ONA B;  5I6Y A;  1BCP D;  4KY5 A;  5EAY A;  3CC4 A;  3GV6 A;  1STE A;  2FJ2 A;  2F4I A;  5ISR A;  1VQG A;  2B2U C;  3TZU A;  4LF4 L;  3RZD B;  3RLN A;  3MVV A;  2ZXO A;  3I72 A;  1CA5 A;  1D1K A;  3J81 E;  4ZYS A;  4BBS G;  3IAY A;  2R93 B;  5GAG C;  4LUO A;  3K5N A;  1HZB A;  5COR A;  1B2T A;  1GUO A;  2WAC A;  3V96 A;  3GTK H;  3U4V A;  1YVC A;  2QEX A;  1Y14 B;  4A3L G;  3D4D A;  3W1B A;  2JA8 B;  2UUA Q;  2EYF A;  1AW7 A;  3J80 i;  1CKN B;  2A68 C;  1DGS A;  2A6H D;  5GQO A;  1HUN A;  5IGB A;  4DK0 A;  3RUZ A;  4PNY A;  5CV6 A;  4K5X A;  2H1E A;  4JOI C;  2C9O A;  4A76 A;  4OON A;  5M5Y H;  1I4R A;  5EBC A;  3PO3 B;  4QB4 A;  3G4S A;  3FP9 A;  3EA6 A;  3U4Z A;  1OXS C;  4A3K B;  4LUV A;  4B3S L;  3C1E A;  2N49 A;  2A6E C;  1JOQ A;  3FPP A;  1VF5 C;  1W6J A;  3HOU G;  2A8V A;  1K83 B;  2EPB A;  1S72 A;  4ZKC B;  4A3J G;  3H0G G;  2KHJ A;  4BBR G;  1QE6 A;  1JIC A;  1XYI A;  2OQ0 A;  2PNH A;  1VQ6 A;  1CM9 A;  3VA5 A;  4IOA A;  4LFB Q;  3H3V C;  1C4Q A;  4JYA Q;  5M3F G;  4BXX G;  3I70 A;  3KBG A;  1CZW A;  4LUZ A;  4A3I G;  4LF6 Q;  5JVH 3;  1UEA B;  4K6L A;  1NR4 A;  1MKH A;  3PIP A;  2F52 A;  3S1R B;  4K6D A;  3CP0 A;  1IBM Q;  1S5C D;  3JAM i;  4Y7N H;  1MSH A;  3RZD H;  4DR5 L;  2IWH A;  2OCE A;  3LWU A;  1DZ1 A;  4A3F B;  4L5T A;  2J0T D;  3CW2 C;  2XN9 C;  3E0E A;  2UXB L;  1FL0 A;  1LTT D;  4WOR A;  5FLM G;  4CDD C;  5CMD A;  2R93 H;  1SE4 A;  3Q6S A;  3J81 c;  1RIP A;  3S1M B;  1YI2 A;  2QF7 A;  1EYA A;  1SLJ A;  3BDC A;  2IHE A;  5J1Z A;  4DV3 Q;  1VQK A;  1FJG Q;  1N9W A;  1PZK D;  1LTA D;  4X3T A;  3LNN A;  2KQ3 A;  2KCC A;  3NK9 A;  2YTY A;  1O78 A;  2JA8 H;  5JAV A;  4HCE A;  4HIM A;  3HG9 A;  1H9S B;  3NE5 B;  2PPB C;  2UU9 L;  4LF9 Q;  4XYQ A;  4HID A;  1CTM A;  1KD1 C;  4DV6 Q;  1I5F A;  4JK1 C;  3S15 B;  3PO3 H;  3S14 B;  4WJ3 M;  4A3K H;  4DF7 A;  4K0K L;  2FXQ A;  2SOB A;  2G9D A;  3S2H B;  4DR3 Q;  3R8B A;  3CQZ B;  1YBY A;  3TS2 A;  1K83 H;  1VQE A;  1LTL A;  4MNO A;  5C3E G;  2H4O A;  2WAQ B;  1ENA A;  2B39 A;  1FD7 D;  3R3O A;  2ATW A;  2O4X A;  2DY8 A;  4KV6 A;  3UE1 A;  5IGC A;  1HR0 L;  4LAA A;  4OWT B;  1QOH A;  5IY0 A;  4X66 Q;  2CW0 D;  3S1R H;  2VQF Q;  3GV3 A;  3FEW X;  3H09 A;  4JI7 Q;  1XNR Q;  5FJ8 G;  1SYD A;  3CKI B;  1F2M A;  1V1P A;  1XPU A;  4XYO A;  2RHS B;  1ZEQ X;  3PIO 3;  2MQH A;  4PMC A;  1JWM D;  2PCF B;  1G29 1;  5ELE A;  3DWA A;  4MTN A;  2DNC A;  4KLK A;  1J9O A;  1F2Y A;  2NYZ D;  4JI1 Q;  3HRZ C;  2F0U A;  4QUF A;  2NWG A;  3S1M H;  3T1Y L;  1X56 A;  1PYS B;  4AYB B;  2BDN A;  4IUQ A;  1E2V A;  3HOY G;  3GTO B;  3CF5 A;  3TEH B;  3CCQ A;  4DR1 L;  4JI4 L;  1VMP A;  1X54 A;  4FF2 A;  5C44 B;  4DR6 L;  1LV9 A;  1WTW A;  4GNX B;  3CCV A;  4RGO S;  3OIP A;  1EU4 A;  1K8A C;  4P2C B;  2L0C A;  4L8J A;  3HKS A;  4XQJ A;  1YIJ A;  1P8L A;  4EQO A;  1N33 Q;  3PUY A;  4BY1 B;  4RGN A;  3S15 H;  3S14 H;  3MA2 B;  1X3G A;  2PNR C;  1IYJ B;  3M4O B;  3CU7 A;  1EY9 A;  3IRB A;  1HJP A;  1I6V C;  3UDX A;  2E2H B;  4R4T A;  2Z8L A;  1B8A A;  2IY5 B;  2X6L A;  4FF1 A;  4DNR B;  4NW2 A;  5LL6 S;  2FMC A;  4CBV A;  2Z6B A;  3E5S A;  3MHB A;  4A3B B;  1JE4 A;  5I4D A;  4DU9 A;  2L11 A;  5IP9 G;  2FMM A;  4PMB A;  1TU2 B;  3CPF A;  1J8I A;  2L15 A;  1YHQ A;  3K7A B;  4NPS A;  1KXL A;  4C3H H;  4JBW A;  1BKB A;  2O2L D;  4JI8 L;  1Z6H A;  4N9P A;  5IYB G;  3I2Z A;  4R9W A;  2PQA B;  4ME5 A;  2F0T A;  1O7I A;  3F1Z A;  5CV7 A;  1L1O B;  4A3G G;  5CV8 A;  2TMP A;  5I2Y A;  2EIF A;  2HDM A;  5IOD A;  5GAD C;  1BVS A;  4DV5 Q;  3WOE A;  3IFD A;  1PMR A;  3CCE A;  3GTJ B;  3CPW A;  1F2Z A;  1A3V A;  1TII D;  1TS5 A;  4U68 A;  4DN4 M;  5JPM C;  1XJV A;  4LFC Q;  5KEE A;  4NXM Q;  1PH2 A;  2Q2T A;  1B50 A;  1QB5 D;  4C3I G;  5FKA C;  4DV4 L;  3RLO A;  2C35 B;  3GTO H;  2LSS A;  3J7A V;  2K03 A;  4ZLT F;  4POF A;  1SJE D;  1EIY B;  1X3F A;  5C44 H;  1Y8P B;  4KY7 A;  2EYM A;  3NTH A;  3J81 i;  1PRT B;  4RGT A;  3TRZ A;  4DAY B;  5JPN C;  4BY1 H;  1VQN A;  2QDL A;  1M8A A;  2EQS A;  5CBA E;  1U4L A;  5NUC A;  3AB9 A;  1SEB D;  4DAP A;  4A93 B;  1LT5 D;  3HOX G;  1XNQ L;  3ERS X;  2UUB L;  5IT9 L;  2EYL A;  4POG A;  2E2H H;  5C4X B;  2NVY B;  5IP7 G;  1STY A;  1AP0 A;  1PTO B;  4M8A A;  1GO3 E;  1CHP D;  4A3B H;  4APV A;  5EQ0 A;  3K81 C;  4B3M Q;  2UXC Q;  5KND A;  1CT1 D;  5M5X B;  4FF4 A;  3L2P A;  4JI6 L;  2I5H A;  3K7A H;  4UY8 C;  4XQN A;  1WOC A;  4GN4 B;  2DY7 A;  2VS1 A;  4JCV E;  4NKL A;  1DCZ A;  1O7Y A;  2K52 A;  4XTC S;  2AUK A;  1IBL Q;  3MC0 B;  3KFU A;  1U4R A;  1S40 A;  2KVM A;  4OX9 L;  1UE1 A;  2EYJ A;  5C5M A;  3PIO A;  3MEH A;  5DM7 3;  4YCW A;  1U9R A;  2F0D A;  2NN6 G;  1KTK A;  4JI0 L;  4KHP Q;  1LT3 D;  5C5L A;  2EVB A;  2LY7 A;  2NBF A;  2PMZ E;  3SK8 A;  4CKB A;  3GTJ H;  4C3J H;  1C7Y A;  2EY1 A;  4KJN A;  3I73 A;  1HNX Q;  2A74 C;  5H1S E;  4ID6 A;  4R8I A;  1PH9 A;  3SK4 A;  5JJI A;  2DUD A;  2WB1 B;  1ENF A;  2DGY A;  3KOJ A;  4TSS A;  3NBH B;  3GTQ B;  4QUC A;  3C2P A;  1I3Q B;  4GN3 B;  2B63 B;  3MAQ A;  1LLR D;  3CCR A;  2WIN B;  5IGG A;  3HOV H;  4DK3 C;  4X6A H;  4JI2 Q;  1GXD C;  1X65 A;  2RDH A;  1S5E D;  2VQE Q;  4FF3 A;  5AJ3 L;  3NP8 A;  1I4Q A;  5C4X H;  2NVY H;  1PH3 A;  3KYH C;  1PTO H;  3EBE A;  2VB3 X;  1VQJ A;  1SNQ A;  1ICF B;  2HT1 A;  2KEE A;  1BBU A;  4A4I A;  1L0Y B;  3QB3 A;  4CDC C;  3SK5 A;  3K5L A;  3GP7 A;  4DR4 L;  2OTJ A;  2J7Z A;  4K2L A;  3F8T A;  1E1T A;  5EPL A;  1EYC A;  2E8G A;  1B7Y B;  4H7B A;  4OEM B;  5M5X H;  5IYD G;  4CJ1 B;  2Y0S B;  2ZXR A;  2NVT B;  1NMG A;  2KCT A;  4K8J A;  3T13 A;  3JC6 6;  5CV4 A;  4DA2 A;  1STB A;  3HOW B;  2ALY B;  5C0X G;  1MI2 A;  5FK9 C;  5KYI A;  1B70 B;  3BU2 A;  4HN7 A;  1TKW B;  4B3T L;  4I65 A;  3BVM A;  4CHT B;  5IT9 E;  1Q90 A;  4JI3 Q;  2G9H D;  1HNZ Q;  3TRE A;  1QZH A;  1M1K C;  1S3O A;  1VQP A;  1FR3 A;  2DN8 A;  3GQB A;  4X3U A;  2JJQ A;  5IGF A;  1QZG A;  2ZT9 C;  5C4Z A;  5G3L D;  1ESR A;  2RSN A;  1II3 A;  1E24 A;  2I0Q A;  1K8O A;  1CQF A;  4EQ5 A;  5EKI A;  4LMQ D;  5M3M G;  2R92 G;  1I3Q H;  5LHY 1;  4P75 A;  4ABN A;  2B63 H;  1TXY A;  1Q1B A;  2D62 A;  2FHT A;  3ZYY X;  1Q46 A;  4TKO B;  4A3E B;  3K0X A;  1KDA A;  3F2D A;  1JC7 A;  2UUA L;  3BZD B;  2F03 A;  4WFN 3;  4BA2 I;  4GOP A;  1CI3 M;  1YJ9 A;  3HGB A;  2NTS A;  1YNJ C;  5DLQ E;  4HCS A;  3CMA A;  2OT2 A;  2N8N A;  3I90 A;  5JOB A;  2F0Q A;  3TSS A;  2CFM A;  1I4G A;  1VQ8 A;  1U4M A;  4LF5 Q;  1LYL A;  1KL9 A;  3NBI A;  4X3K A;  2R7Z B;  4IJH A;  1GUT A;  1QNU A;  1JQY D;  1L0X B;  3DMU A;  4RHR A;  4PZ8 A;  1BBW A;  4HED A;  1CA6 A;  1FGB D;  2NVT H;  4U67 3;  1R4Q B;  1IKM A;  1PH8 A;  1VCI A;  1HTP A;  2JEA I;  1LTS D;  3DHQ A;  4L6T B;  1IYV A;  2DJG C;  4XT3 B;  1E22 A;  1SYB A;  3AMU A;  3A7A B;  4LFB L;  3SHL A;  3HOW H;  4XXE A;  4JYA L;  1CKO A;  1SBB B;  4HSV A;  4LF6 L;  3W5O A;  1N36 Q;  2RA4 A;  5D3D A;  3L3O C;  1G6P A;  2VUM G;  1SNC A;  2K05 A;  2MGS A;  1PFB A;  3K5O A;  1IBM L;  5IT9 c;  1YJW A;  1ROD A;  2JP1 A;  2K5W A;  3CHB D;  1Y1V G;  1VQL A;  3KK7 A;  3C46 A;  1SE3 A;  1EQV A;  3STB D;  4LF8 Q;  1F77 A;  4X65 Q;  2DNE A;  5CR3 A;  4FYD A;  3GD7 A;  4DUZ Q;  1NTG A;  2Z9H A;  1JJC B;  4IUR A;  4P73 A;  4QGU A;  4KHZ A;  2JA5 B;  1FJG L;  1WTR A;  1STH A;  4C2M B;  2BA0 A;  3PMF A;  5JEA G;  4YHH Q;  4A3E H;  1P16 A;  4L5R C;  1MJE A;  1UWV A;  1EWC A;  1HZ9 A;  1F9R A;  3OW2 A;  1WCM G;  1EEF D;  1VQI A;  1UNS A;  4JBJ A;  1OXX K;  4DV6 L;  4PZ6 A;  1AZQ A;  1Y69 U;  3UDG A;  1GJX A;  2MJ8 A;  1CK1 A;  4GOP C;  4KN4 C;  1NE3 A;  4JI5 Q;  2QA4 A;  4GOP B;  2R7Z H;  1H9M A;  1JT8 A;  2BOS A;  3K80 C;  4Y7N B;  1VDZ A;  4DR3 L;  4HMI A;  2EYO A;  3G71 A;  1V8Q A;  2N78 A;  3A5U A;  2A68 D;  2B29 A;  2F0O A;  3M4Y A;  3S16 B;  4WJW A;  4QY7 A;  5F2D A;  1I6H B;  5IYC H;  4DNT B;  1GM5 A;  4A3I B;  1H9S A;  1VQ9 A;  1EWH A;  3U9O A;  3GTP H;  1E7Z A;  1JJ2 A;  4RGM A;  4GS3 A;  2K5V A;  3QOJ A;  2YTV A;  4X66 L;  2A6E D;  3QWN A;  1KDB A;  3A55 A;  4OL7 A;  4B3R L;  4JI7 L;  1XNR L;  1TS2 A;  1B53 A;  3KLS X;  4RMF A;  1IHZ A;  2GN5 A;  2QIL A;  1JWU D;  1OTC A;  4HSP A;  5EJW A;  5K36 H;  1CUK A;  4JI1 L;  1BCP B;  4NDX A;  2OTL A;  2RDF A;  4OEL B;  2B2W A;  2JA5 H;  1BUV T;  3URY A;  3K59 A;  3HKZ B;  4DV7 Q;  4A3D G;  2CWP A;  2NVQ B;  4C2M H;  4J15 A;  2I5L X;  4R4C A;  2RVL A;  1VQF A;  4KI0 A;  2KED A;  4KJO A;  2XVS A;  4DR7 Q;  2PO4 A;  2M9V A;  3V05 A;  3MXP A;  1PH5 A;  3GO5 A;  4KY6 A;  1K28 A;  1N33 L;  3G6J B;  4IPG A;  5KIX A;  1U5K A;  3NEN A;  1SYE A;  4OGQ C;  4Q5V A;  4X62 Q;  1HQR D;  5GAE C;  2OF1 A;  2DJF C;  3HOU H;  4KD4 A;  5BN5 A;  4IJL A;  5HY6 A;  4H13 C;  1VF7 A;  2QGQ A;  3H0G H;  3T1H Q;  2R93 G;  2K28 A;  4A3M B;  1EWI A;  3M3Y B;  3S16 H;  5FO9 B;  3VR3 A;  1I6H H;  5CV9 A;  4B9X A;  1KAW A;  4JPB W;  4R4O A;  4RH6 A;  4BXX H;  1NY4 A;  2Q8T A;  4GNX A;  4A3I H;  3BJU A;  1BNZ A;  4AQY Q;  1EUJ A;  2NVX B;  1DON A;  2JA8 G;  1EEI D;  1QIL A;  1T5E A;  4EQN A;  2EZV A;  2JE6 I;  2PZU A;  3M4Q A;  4WJ4 A;  3RNU A;  5C3X A;  4YWM A;  1FNW A;  1YZ6 A;  2F3I A;  1F9Q A;  2CH4 W;  1IBK Q;  4CDE C;  3PO3 G;  5I9O A;  2JN4 A;  4EVO A;  1PRT F;  4DV5 L;  4A3K G;  1BBX C;  1C0A A;  2BE5 C;  5JEA J;  1VQH A;  5KNB A;  3A7L A;  4QQB X;  4BY7 B;  4K5W A;  4LFC L;  4IUP A;  4EGV A;  1G6Z A;  1ET9 A;  4R1J A;  3NWT A;  1SNM A;  3LWE A;  3M7N A;  2NVQ H;  3PV0 A;  4B9W A;  2F0J A;  2B2W C;  2PI2 A;  2B2T A;  3NPP A;  4E6I A;  3PSI A;  1CSP A;  4IPD A;  2PQA A;  1H9K A;  4GLV B;  2UXD Q;  2GA4 B;  1HUM A;  1PV4 A;  2K32 A;  2K1B A;  4C3H B;  1T5X D;  1L1O A;  3SE0 A;  1MGS A;  1FNU A;  1QVC A;  4HJ7 A;  2MNA A;  3OOC A;  2F3V A;  2HUG A;  2K75 A;  1EFI D;  2KJX A;  4YIJ A;  2PW7 A;  2WKD A;  4ME3 A;  1I94 Q;  4A3F G;  1E2W A;  2MPM A;  3K7U C;  3X3M A;  4OWW B;  3TP7 A;  2K5D A;  5EGT A;  5ELB A;  4V19 0;  4A3M H;  2K50 A;  4G57 A;  1D5X C;  3M3Y H;  5C3E H;  1PYB A;  5DAU A;  1FGU A;  3PCO B;  1H9R A;  2EDG A;  4B3M L;  2UXC L;  2O5I C;  1QJO A;  2F3W A;  3A74 A;  3ND9 A;  4C1N K;  4F8M A;  2D2C C;  2NVX H;  3PO2 B;  2F0H A;  1J6Q A;  1TT2 A;  2WAQ E;  5J39 A;  1X32 A;  4H0L C;  1VS0 A;  4DAY A;  3KBX A;  4GNX C;  1IBL L;  4K8I A;  4KK7 A;  3K0Y A;  1K0R A;  2E5L L;  3VYT A;  4B3S Q;  2IX0 A;  4KD3 A;  1WTX A;  2SDF A;  1JOO A;  1HTL D;  1LTR D;  1PFM A;  1Y1W B;  5JJL A;  3OSO A;  2K7V A;  5E3F A;  3PF5 A;  4IQZ A;  3K58 A;  4BY7 H;  3E6Z X;  1HNX L;  3RLF A;  1IZ6 A;  3HOY H;  3EQL C;  2CWA A;  2N88 A;  3KLS A;  1HCZ A;  2Z4I A;  4F87 A;  1BR9 A;  1WD1 A;  2B8G A;  1JB3 A;  5T1G A;  4AYB E;  2WAQ G;  2RQX A;  3QOL A;  2AWN A;  2K33 A;  1ASY A;  2KEN A;  3OTO Q;  2B8F A;  3CCS A;  4P72 A;  4IN3 A;  4DUY L;  5IWA Q;  2NN6 I;  3U9S A;  3BDL A;  2ZTD A;  2H5X A;  2IX3 A;  1AH9 A;  2M2L A;  2JA7 B;  1DOM A;  2VW9 A;  2B2T C;  3MXN B;  2YTX A;  1HNW Q;  3MWY W;  4JI2 L;  1SND A;  4DR5 Q;  5LMN Q;  2LXJ A;  2O5J C;  2F0S A;  3E0J A;  1F2L A;  1RKN A;  4JVZ A;  1HPC A;  2VQE L;  3S2D B;  1L1O C;  4A3C H;  5D3I B;  1TY2 A;  2JSO A;  3VYU A;  1WYD A;  4JV5 Q;  4LJZ C;  4OO1 G;  2RSO A;  1A8V A;  3I56 A;  2F0V A;  3I55 A;  4AYB G;  3P20 A;  5FLX E;  4C3J B;  3NBH A;  4IO9 A;  4GLX A;  2GVB A;  4G4K A;  1EQQ A;  4M1U B;  2BH8 A;  2RF4 A;  3NEL A;  3P7J A;  3PO2 H;  1Q81 C;  1IYU A;  5JJZ A;  5C44 G;  3GDE A;  1K9M C;  3RN5 A;  4FP5 D;  2F0M A;  1FYC A;  4PQX A;  2ASB A;  1KAA A;  4HIO A;  1Q8K A;  4HJ5 A;  3VYR A;  1HH2 P;  1PRT C;  4QIW B;  3CCU A;  2PI2 E;  1X55 A;  4BY1 G;  1F9S A;  3HOV B;  3AQQ A;  3IKJ A;  4B08 A;  4JI3 L;  5EKL A;  1HNZ L;  1D5Z C;  2J4X A;  3DWQ A;  4MHE A;  2BCO A;  3MXG A;  1JB7 A;  1FVI A;  3HEJ A;  1JE5 A;  1SMX A;  1Y1W H;  2CQA A;  1WTH A;  1K3R A;  4O42 A;  3I4N B;  1GHK A;  4K5V A;  3HZX A;  1N34 L;  2F4V Q;  1PTO C;  2CH4 A;  1EFW A;  3GTG B;  1KRS A;  4A3B G;  2N3S A;  2CKZ B;  3SDZ A;  1RCV D;  2FFK B;  3KUP A;  1HR0 Q;  1G8Z D;  3EJI A;  1A15 A;  2CVR A;  2TSS A;  1CKM A;  3W1G A;  3R93 A;  4DV2 Q;  3TP8 A;  3S9W A;  3HS0 C;  3KLW A;  3NHH A;  4L5Q A;  1KRT A;  2JA7 H;  3Q8D A;  4GKJ Q;  3DM3 A;  4QIW E;  3UDF A;  3U58 A;  3QIA A;  1AE2 A;  1SMY C;  3HOX H;  1FNV A;  4CKC A;  2N55 A;  4HJ9 A;  5LMU Q;  3HOZ B;  2IHF A;  1KDC A;  1TWH B;  3S2D H;  3D0F A;  4HJA A;  1OXU A;  3FKI B;  4LF5 L;  1W2B A;  1SNP A;  2SNS A;  5K5P A;  2F0I A;  1LAC A;  3BZK A;  2MHV A;  3NWS A;  5FOB B;  1D5M C;  2XRQ D;  4FDB A;  4DK1 A;  1VQO A;  1KLG D;  2V1C C;  4B3T Q;  1N8R C;  4JI4 Q;  3NUC A;  3I7F A;  4GLA C;  4FXD A;  4CJ2 C;  4J8Q A;  5D14 A;  4LW1 A;  4LF7 Q;  4JBM A;  3R2T A;  4ZRZ A;  1W6K A;  2YU9 H;  2NN6 H;  1WFQ A;  1EY0 A;  1IW7 C;  1N36 L;  3SEB A;  1LTB D;  2I07 B;  2D9U A;  2IW3 A;  4A93 G;  1B9N A;  3AFQ A;  1D7Q A;  5C4X G;  3D31 A;  3I4N H;  1B9M A;  1NBW A;  3D6C A;  2OQK A;  2JA6 B;  4GZY C;  2V4D A;  3DXJ C;  4LF8 L;  3GTG H;  1NSN S;  2IPK D;  4X65 L;  2K14 A;  3Q24 A;  3BZC A;  4GKK Q;  2CHB D;  4EQP A;  4DUZ L;  1WJJ A;  5HGQ A;  1Q7Y C;  4IPC A;  1Q8I A;  4PMW A;  1TWC B;  4R4I A;  1MJC A;  3H91 A;  3MZ5 A;  4IZ8 A;  2E2I B;  2F1M A;  3I3C A;  2K04 A;  4XIG S;  4JI8 Q;  5M5W B;  2WB1 E;  3BS1 A;  2HHH Q;  2B2Y A;  4ILW A;  4DK6 C;  4YHH L;  3PUZ A;  1H9J A;  3QJY A;  2K4K A;  3S24 A;  1Q86 C;  1PLF A;  3KDF B;  3M85 A;  2F0L A;  2KHI A;  5ELC A;  4RAU C;  4V0B A;  2EYP A;  3I4M B;  2RCF A;  1X9N A;  1GKH A;  1VQC A;  2OXP A;  3HOZ H;  1TWH H;  3K6O A;  5J22 A;  1Q12 A;  1LAB A;  1SJH D;  4C1N I;  2F0N A;  1EL0 A;  3FKI H;  1SNO A;  2IX1 A;  1K8M A;  4JI5 L;  4ZUJ A;  1RF2 D;  1SXT A;  4YCU A;  2LFN A;  4S3S A;  4L5S A;  4TRD A;  4J1M A;  3MFY A;  4IPH A;  4G7O C;  3DM1 A;  1QVF A;  1K3B C;  4X64 Q;  1YNJ D;  1EIH A;  1PZJ D;  3A8K E;  2KA7 A;  2Y0S E;  1O7L A;  4MIU A;  2XWB B;  3K57 A;  2ES2 A;  2B63 G;  4IFD G;  1BCP F;  3OW7 A;  2G5D A;  4GN5 A;  1ZYR C;  1X6O A;  1TQO A;  3KF6 B;  1OXV A;  2AUJ D;  3F2B A;  5BN4 A;  1JCK B;  1CZG A;  3D4R A;  1NUC A;  2LS0 1;  3OMG A;  5TSS A;  2C5C A;  1B44 D;  5LL6 X;  4DXF A;  3J7Y W;  1Y1V B;  4YY3 Q;  1WTP A;  1ENC A;  2PZT A;  3QR8 A;  1VQA A;  3S1N B;  1RDP D;  3MTS A;  3BG3 A;  5LMN W;  2ID0 A;  2JA6 H;  1GOZ A;  2F0F A;  3X3N A;  3R2I A;  4QJF A;  1K8G A;  1YEZ A;  4I7A A;  3RD4 A;  5M3M H;  4QCL A;  2IT1 A;  4C56 C;  1SYG A;  1TWC H;  1BQQ T;  2E2I H;  1DYQ A;  5M5W H;  4FO2 A;  4DV7 L;  3IFT A;  4RA8 A;  4RKB A;  2WP8 J;  3NQT A;  5GRO A;  2A69 C;  3HOW G;  5EBD A;  3CCL A;  1XTC D;  3KJP A;  1BOS A;  4DR7 L;  4DKA C;  1RTN A;  1Z9F A;  3N6R A;  3I4M H;  3GTP B;  2B2Y C;  1J5E Q;  4XDX A;  3MXU A;  2SEB D;  4H44 C;  3NQI A;  1B4O A;  4WRD A;  2X69 A;  5CV5 A;  1QUQ B;  4HTH A;  1QCB D;  5DNF A;  1YJN A;  1PH7 A;  4UAI A;  4NXN Q;  3A5Z B;  1PZI D;  4O2D A;  2VNU D;  1Y8O B;  2KEC A;  1HA5 A;  2F0P A;  3CRL C;  3T1H L;  4BBS B;  5HGT A;  1PFS A;  2WII B;  2R7F A;  2LMC B;  3CXC A;  1PH6 A;  1JJG A;  2NZO A;  2Q2I A;  3S17 H;  3TN2 A;  1S5B D;  2R61 A;  3TQY A;  1XMQ Q;  4DV0 Q;  4CJ0 B;  1BO0 A;  3J7A F;  4DV3 L;  4AQY L;  1VQ5 A;  1GUW A;  3VR6 A;  4A3E G;  1YNN C;  3VA7 A;  2Z4H A;  4I7Z C;  4KHV A;  1V1O A;  3OYY A;  4CGY B;  1DOL A; 
#chains in the Genus database with same CATH homology
 1ZKO A;  1A2U A;  3BVG A;  1TVX A;  5IGD A;  1ML0 D;  5E4X A;  3D4W A;  4HMJ A;  3I91 A;  3HOU B;  3TME A;  4HR7 B;  4OIJ A;  5JEA H;  3Q0A A;  4IUN A;  4A3J B;  3H0G B;  4BBR B;  3VR4 A;  5C0X J;  1B3A A;  4ZQ3 A;  3W3A A;  4BS9 A;  1STN A;  2A73 B;  2K6A A;  4ULL A;  1X3P A;  5M3F B;  1EY5 A;  1X3Q A;  1LO5 D;  3A54 A;  1V43 A;  5CYU A;  2VXW A;  3GTM B;  5ELD A;  1F9P A;  3RMH A;  2ICI A;  3RZO B;  5EKK A;  2BDO A;  5COY A;  3OHX C;  5K36 G;  2E75 C;  5EPK A;  4PV1 C;  4IFD J;  2I46 A;  1BCP C;  1ILP A;  3QO2 A;  4DXG A;  1CHQ D;  1JR0 D;  4R8N A;  4KMU C;  1NAP A;  1S5F D;  1RD9 D;  2WKC A;  1TWA B;  3F2U A;  4FXK C;  3HP3 A;  1QNK A;  3QG1 A;  3D8G A;  2B2V A;  2BA1 A;  2JYO A;  4LK1 C;  5A35 A;  2EE1 A;  2FIN B;  4ODG A;  5JVG 3;  4OIK A;  4MN3 A;  1G2S A;  2K01 A;  2A6H C;  3A56 A;  4TQU S;  3CRK C;  1R4P B;  1IKL A;  4RCO A;  1G91 A;  1LTG D;  3TBI B;  2RBM A;  5C3E B;  3FDT A;  3Q23 A;  2PZW A;  1MSG A;  4J6H A;  4O1N A;  3P75 A;  3DUZ A;  1HQM C;  2BE5 D;  5C4J B;  1O80 A;  1TWG B;  1NCV A;  5A2Q L;  1A2T A;  1EY4 A;  2ICE C;  5DM6 3;  1BF4 A;  1PDQ A;  4ZUI A;  2HQE A;  4DGZ A;  5KYL A;  3PUV A;  2X6G A;  1SYC A;  2Q8I B;  2NB0 A;  2PYK A;  1GUS A;  4IUU A;  1TR5 A;  3HOY B;  3GTL B;  2Z1C A;  4KN7 C;  5FLX L;  3MXN A;  2A5H A;  4ZKB B;  4DFA A;  1PTO F;  1CFM A;  5KNC A;  1MBY A;  3ND8 A;  1BDO A;  4OO1 I;  2E76 C;  1M4V A;  1HA6 A;  2AQ1 B;  3H94 A;  2B2V C;  2L4N A;  4ZAI A;  1B1Z A;  3TDQ A;  4G7H C;  1SYF A;  3AU7 A;  4KKS A;  4Z9C B;  1I4P A;  1E0B A;  1STA A;  2VB2 X;  2EOT A;  3SVM A;  2Q8R E;  2SNM A;  3I8Z A;  2EY6 A;  1E2Z A;  2R3Z A;  3A8I E;  2RKS A;  4HAE A;  3T16 A;  1XWE A;  1TWF B;  4KKT A;  5I2X A;  4A3G B;  1KLU D;  4F88 A;  1XXG A;  3NTK A;  1C8C A;  2CW0 C;  1WVL A;  1Z7T A;  2ENB A;  5KRU A;  4BA1 I;  2YYZ A;  4C3I B;  4K14 A;  3J80 L;  3SXH A;  3PUX A;  2HCC A;  1TS3 A;  2XWJ B;  1Q1E A;  4DAV A;  3NSW A;  3P1H A;  4ZK9 B;  1EY6 A;  3WDN A;  1JOR A;  4C3H G;  3H6M A;  3T53 B;  5A2Q E;  4RFB A;  3ERO A;  1QG7 A;  3HOX B;  3NXW A;  4KKU A;  1TY0 A;  1OXT A;  1XX8 A;  1D6E C;  2E2J B;  2XSC A;  2KCN A;  5C6A A;  2IL8 A;  1PRT D;  4L63 B;  3PUW A;  1DJR D;  2IJ0 A;  3FMC A;  3BYT B;  4N9T A;  3O13 A;  4RCN A;  3JAM L;  1DXM A;  1SE2 A;  1PTO D;  1EY8 A;  2F0K A;  1HXY D;  3BYY B;  2NTT A;  2YU9 B;  1HRJ A;  4OO1 H;  3IL8 A;  3BVZ A;  4FNF A;  1V1P B;  2XIW A;  1TS4 A;  1VMC A;  2L12 A;  3W2D A;  5FO8 B;  1Q3L A;  1SMY D;  2E2D C;  5C0X I;  2EY2 A;  1CQV A;  3OMC A;  3WOF A;  2RDG A;  3ERQ A;  3T4A C;  2KHS A;  3L7Z C;  1DD2 A;  3FPU B;  1HFG A;  2MUY A;  1PYW D;  1LT6 D;  2QKI C;  2PMZ B;  5CBE E;  1DOK A;  5IGE A;  5G3L F;  3NTI A;  3BDO A;  3ITP A;  5ELF A;  1UAP A;  1NR2 A;  1EZ6 A;  1AEX A;  3G7L A;  3J80 E;  4IFD I;  5HUR A;  1KAB A;  1WTV A;  5I6W A;  4C3J G;  3A8J E;  1IW7 D;  2EJG C;  2QEJ C;  2K5Q A;  3VYS A;  1S4Z A;  3EVQ A;  5IIF A;  1AFP A;  5BN3 A;  2QCP X;  2JEB I;  2E74 C;  2M00 A;  1R9T B;  3OWE B;  3OWF A;  4RHS A;  2XNA C;  1GHJ A;  1WD0 A;  4BWG B;  1ZXT A;  1SSO A;  1HFN A;  5AFW A;  3Q22 A;  1WTO A;  5E1F A;  5M3M B;  4F7X A;  2R92 B;  4X3S A;  3JAM E;  4G7Z C;  1AZP A;  3SR1 A;  2OEO A;  3I4L A;  2EJF C;  2NZ1 D;  3KLR A;  2PQE A;  4IAL A;  1I4X A;  4IUT A;  1IL8 A;  2R6G A;  5EPJ A;  2F0E A;  4FVM A;  5FO7 B;  1I50 B;  3EFX D;  1OO9 B;  3L9A X;  3FVQ A;  3C1F A;  5DEH A;  1EZ8 A;  2HCI A;  4NMZ A;  3VR2 A;  1ZYR D;  2KUM A;  3TZD A;  3D3R A;  3C3L A;  1SDF A;  2D5D A;  1ICW A;  4QF4 A;  5C0X H;  1EY7 A;  3S17 B;  4QMG A;  4RWS C;  1SFO B;  3T51 B;  1LT4 D;  5C4H A;  4CKE A;  2AQ3 B;  2VUM B;  2QDB A;  1PFN A;  4OHJ A;  2L1B A;  2L9H A;  5M9O A;  1HHV A;  1MD2 D;  3LX0 A;  1A3U A;  3KF8 A;  5C3W A;  2A69 D;  1STG A;  3V2T A;  2AQ2 B;  2HDL A;  3J81 L;  3S1Q B;  1RHP A;  3K5M A;  4IFD H;  1KNA A;  1EIG A;  3T56 B;  3DWP A;  1D2B A;  3M7G A;  2PW5 A;  1WTQ A;  4NP5 A;  5I9P A;  1O7Z A;  2F0G A;  2B2U A;  1A3T A;  3OPO A;  1ONL A;  1ESF A;  2KOL A;  1WCM B;  2EXZ A;  2EJM A;  4K2K A;  3DEP A;  3PIP 3;  2AWO A;  3TP5 A;  5CC4 A;  1KNE A;  2NUC A;  1A6X A;  1I4H A;  1GUG A;  1EU3 A;  1UUP A;  1Z47 A;  2F0W A;  1YNN D;  5T1I A;  3TP6 A;  1LTI D;  2LKV A;  1C48 A;  4XT1 B;  5KGU A;  1JOK A;  1BXT A;  2JXM B;  3GTK B;  4UDU C;  4XQQ A;  3D6W A;  4RKL A;  1RJT A;  1EYD A;  3SK6 A;  1G2T A;  1D1I A;  2EYH A;  1PXU A;  3UI2 A;  1S5D D;  2L5T A;  5IOC A;  3MFG A;  5M5Y B;  3N52 A;  1EQT A;  2ZXP A;  1GUN A;  4FXG C;  5CGK A;  5D65 A;  1ET6 A;  2WV6 D;  1Y8N B;  1ILQ A;  3VR5 A;  4IUV A;  1JWS D;  4A3D B;  1DM0 B;  4KTA A;  2EY5 A;  1QWY A;  3FRP B;  5E4W C;  2L55 A;  1RTO A;  1U4P A;  3DEO A;  1AN8 A;  2MP1 A;  2XRS D;  3OIQ A;  1SAP A;  4Q0F A;  1EOT A;  3ONA B;  5I6Y A;  1BCP D;  4KY5 A;  3GV6 A;  1STE A;  2FJ2 A;  2F4I A;  5ISR A;  2B2U C;  3TZU A;  3RZD B;  3MVV A;  2ZXO A;  3I72 A;  1CA5 A;  1D1K A;  3J81 E;  4ZYS A;  3IAY A;  2R93 B;  3K5N A;  5COR A;  1B2T A;  1GUO A;  2WAC A;  3V96 A;  3D4D A;  2JA8 B;  2EYF A;  1AW7 A;  2A68 C;  2A6H D;  1HUN A;  5IGB A;  4DK0 A;  3RUZ A;  4PNY A;  5CV6 A;  4K5X A;  2H1E A;  2C9O A;  1I4R A;  5EBC A;  3PO3 B;  4QB4 A;  3EA6 A;  4A3K B;  1OXS C;  3C1E A;  2A6E C;  1JOQ A;  1VF5 C;  3FPP A;  1W6J A;  1K83 B;  2EPB A;  4ZKC B;  1QE6 A;  1JIC A;  1XYI A;  1CM9 A;  3VA5 A;  3H3V C;  1C4Q A;  3I70 A;  3KBG A;  1CZW A;  5JVH 3;  1UEA B;  4K6L A;  1NR4 A;  3S1R B;  4K6D A;  1S5C D;  1MSH A;  2IWH A;  3LWU A;  1DZ1 A;  4A3F B;  2J0T D;  2XN9 C;  4WOR A;  1LTT D;  5CMD A;  1SE4 A;  3Q6S A;  3S1M B;  2QF7 A;  1EYA A;  3BDC A;  5J1Z A;  1PZK D;  1LTA D;  4X3T A;  3LNN A;  2KQ3 A;  2KCC A;  3NK9 A;  1O78 A;  5JAV A;  4HCE A;  3HG9 A;  1H9S B;  3NE5 B;  2PPB C;  4XYQ A;  1CTM A;  4JK1 C;  3S15 B;  3S14 B;  4DF7 A;  2SOB A;  2G9D A;  3S2H B;  3R8B A;  3CQZ B;  2H4O A;  2WAQ B;  1ENA A;  2B39 A;  1FD7 D;  3R3O A;  2O4X A;  2DY8 A;  4KV6 A;  5IGC A;  4LAA A;  1QOH A;  2CW0 D;  3FEW X;  3GV3 A;  3H09 A;  1SYD A;  3CKI B;  1F2M A;  1V1P A;  4XYO A;  1ZEQ X;  3PIO 3;  4PMC A;  1JWM D;  2PCF B;  1G29 1;  5ELE A;  3DWA A;  2DNC A;  1J9O A;  1F2Y A;  2NYZ D;  3HRZ C;  2F0U A;  4QUF A;  2NWG A;  4AYB B;  2BDN A;  4IUQ A;  1E2V A;  3GTO B;  1VMP A;  4FF2 A;  5C44 B;  1LV9 A;  1WTW A;  4RGO S;  3OIP A;  1EU4 A;  4P2C B;  2L0C A;  4L8J A;  4XQJ A;  4EQO A;  3PUY A;  4BY1 B;  4RGN A;  3MA2 B;  2PNR C;  3M4O B;  3CU7 A;  1EY9 A;  2E2H B;  1I6V C;  2Z8L A;  2X6L A;  4FF1 A;  4DNR B;  4NW2 A;  5LL6 S;  2FMC A;  4CBV A;  3MHB A;  3E5S A;  4A3B B;  1JE4 A;  5I4D A;  4DU9 A;  2L11 A;  2FMM A;  4PMB A;  1TU2 B;  1J8I A;  3K7A B;  4JBW A;  2O2L D;  1Z6H A;  4N9P A;  4R9W A;  4ME5 A;  2F0T A;  5CV7 A;  5CV8 A;  2TMP A;  5I2Y A;  2HDM A;  5IOD A;  3WOE A;  3IFD A;  1PMR A;  3GTJ B;  1F2Z A;  1A3V A;  1TII D;  1TS5 A;  4U68 A;  4DN4 M;  5JPM C;  5KEE A;  1B50 A;  1QB5 D;  4C3I G;  5FKA C;  3J7A V;  2K03 A;  4ZLT F;  1SJE D;  1Y8P B;  4KY7 A;  2EYM A;  3NTH A;  1PRT B;  4RGT A;  5JPN C;  1M8A A;  5CBA E;  1U4L A;  5NUC A;  3AB9 A;  1SEB D;  4DAP A;  4A93 B;  1LT5 D;  5IT9 L;  2EYL A;  5C4X B;  2NVY B;  1AP0 A;  1STY A;  1PTO B;  4M8A A;  1CHP D;  5EQ0 A;  5KND A;  1CT1 D;  5M5X B;  4FF4 A;  4XQN A;  2DY7 A;  4NKL A;  1DCZ A;  1O7Y A;  4XTC S;  2AUK A;  3MC0 B;  1U4R A;  2KVM A;  2EYJ A;  5C5M A;  3MEH A;  5DM7 3;  1U9R A;  2F0D A;  2NN6 G;  1KTK A;  1LT3 D;  5C5L A;  2EVB A;  2LY7 A;  2NBF A;  3SK8 A;  4CKB A;  2EY1 A;  4KJN A;  3I73 A;  2A74 C;  4ID6 A;  4R8I A;  3SK4 A;  2WB1 B;  1ENF A;  4TSS A;  3GTQ B;  4QUC A;  3C2P A;  1I3Q B;  2B63 B;  3MAQ A;  1LLR D;  2WIN B;  5IGG A;  1GXD C;  2RDH A;  1S5E D;  4FF3 A;  3NP8 A;  1I4Q A;  1PTO H;  2VB3 X;  1SNQ A;  2KEE A;  1L0Y B;  3QB3 A;  3SK5 A;  3K5L A;  3GP7 A;  2J7Z A;  4K2L A;  5EPL A;  1EYC A;  4H7B A;  2NVT B;  4CJ1 B;  2Y0S B;  2ZXR A;  4K8J A;  3T13 A;  5CV4 A;  4DA2 A;  1STB A;  3HOW B;  5C0X G;  1MI2 A;  5FK9 C;  5KYI A;  4HN7 A;  1TKW B;  4I65 A;  3BVM A;  4CHT B;  5IT9 E;  1Q90 A;  2G9H D;  1FR3 A;  2DN8 A;  3GQB A;  4X3U A;  5IGF A;  2ZT9 C;  5C4Z A;  5G3L D;  1ESR A;  2RSN A;  1II3 A;  1K8O A;  1CQF A;  5EKI A;  4LMQ D;  5LHY 1;  4ABN A;  2D62 A;  1Q1B A;  2FHT A;  3ZYY X;  4TKO B;  4A3E B;  1KDA A;  1JC7 A;  3BZD B;  2F03 A;  4WFN 3;  4BA2 I;  1CI3 M;  3HGB A;  2NTS A;  1YNJ C;  4HCS A;  2OT2 A;  3I90 A;  5JOB A;  2F0Q A;  3TSS A;  1I4G A;  1U4M A;  3NBI A;  4X3K A;  2R7Z B;  1GUT A;  1QNU A;  1JQY D;  1L0X B;  3DMU A;  4RHR A;  4HED A;  1CA6 A;  1FGB D;  4U67 3;  1R4Q B;  1IKM A;  2JEA I;  1VCI A;  1HTP A;  1LTS D;  3DHQ A;  4L6T B;  1IYV A;  4XT3 B;  1SYB A;  3AMU A;  3A7A B;  3SHL A;  4XXE A;  1SBB B;  4HSV A;  2RA4 A;  5D3D A;  3L3O C;  1SNC A;  2K05 A;  2MGS A;  1PFB A;  3K5O A;  1ROD A;  2JP1 A;  2K5W A;  3CHB D;  3KK7 A;  3C46 A;  1SE3 A;  1EQV A;  1F77 A;  2DNE A;  5CR3 A;  4FYD A;  3GD7 A;  4IUR A;  4KHZ A;  2JA5 B;  1WTR A;  1STH A;  4C2M B;  2BA0 A;  3PMF A;  5JEA G;  1EWC A;  1F9R A;  1EEF D;  1UNS A;  1OXX K;  1AZQ A;  1Y69 U;  1GJX A;  2MJ8 A;  1CK1 A;  4KN4 C;  1H9M A;  2BOS A;  4Y7N B;  1VDZ A;  4HMI A;  2EYO A;  1V8Q A;  2A68 D;  2F0O A;  3M4Y A;  3S16 B;  4WJW A;  5F2D A;  1I6H B;  4DNT B;  4A3I B;  1H9S A;  1EWH A;  3U9O A;  4RGM A;  3QOJ A;  2A6E D;  3QWN A;  1KDB A;  3A55 A;  4OL7 A;  1TS2 A;  1B53 A;  3KLS X;  1IHZ A;  2QIL A;  1JWU D;  5EJW A;  4HSP A;  5K36 H;  1BCP B;  4NDX A;  2RDF A;  2B2W A;  1BUV T;  3URY A;  3K59 A;  3HKZ B;  2NVQ B;  2RVL A;  4KI0 A;  2KED A;  4KJO A;  2XVS A;  2PO4 A;  2M9V A;  3V05 A;  3MXP A;  3GO5 A;  4KY6 A;  3G6J B;  5KIX A;  1SYE A;  4OGQ C;  4Q5V A;  1HQR D;  2OF1 A;  4KD4 A;  5BN5 A;  4H13 C;  1VF7 A;  2K28 A;  4A3M B;  3M3Y B;  5FO9 B;  3VR3 A;  5CV9 A;  4B9X A;  4RH6 A;  2Q8T A;  1BNZ A;  2NVX B;  1DON A;  1EEI D;  1QIL A;  1T5E A;  4EQN A;  2EZV A;  2JE6 I;  2PZU A;  5C3X A;  1FNW A;  1F9Q A;  5I9O A;  4EVO A;  1PRT F;  1BBX C;  2BE5 C;  5JEA J;  5KNB A;  3A7L A;  4BY7 B;  4K5W A;  4IUP A;  4EGV A;  1G6Z A;  1ET9 A;  3NWT A;  1SNM A;  3LWE A;  3M7N A;  3PV0 A;  4B9W A;  2F0J A;  2B2W C;  2B2T A;  3NPP A;  4E6I A;  1H9K A;  2GA4 B;  1HUM A;  2K32 A;  2K1B A;  4C3H B;  1T5X D;  3SE0 A;  1MGS A;  1FNU A;  3OOC A;  2F3V A;  2HUG A;  4YIJ A;  1EFI D;  2KJX A;  2PW7 A;  2WKD A;  1E2W A;  2MPM A;  3X3M A;  3TP7 A;  2K5D A;  5EGT A;  5ELB A;  4V19 0;  4G57 A;  1D5X C;  5DAU A;  1H9R A;  2EDG A;  2O5I C;  1QJO A;  2F3W A;  3ND9 A;  4C1N K;  4F8M A;  2D2C C;  3PO2 B;  2F0H A;  1TT2 A;  5J39 A;  1X32 A;  4H0L C;  4DAY A;  3KBX A;  4K8I A;  4KK7 A;  3K0Y A;  3VYT A;  2IX0 A;  4KD3 A;  1WTX A;  2SDF A;  1JOO A;  1HTL D;  1LTR D;  1PFM A;  1Y1W B;  3OSO A;  2K7V A;  5E3F A;  4IQZ A;  3K58 A;  3E6Z X;  3RLF A;  3EQL C;  2N88 A;  3KLS A;  1HCZ A;  2Z4I A;  4F87 A;  1BR9 A;  1WD1 A;  2B8G A;  1JB3 A;  5T1G A;  2RQX A;  3QOL A;  2AWN A;  2K33 A;  2B8F A;  4IN3 A;  2NN6 I;  3U9S A;  3BDL A;  2IX3 A;  2M2L A;  2JA7 B;  1DOM A;  2B2T C;  3MWY W;  1SND A;  2O5J C;  2F0S A;  3E0J A;  1F2L A;  1RKN A;  1HPC A;  3S2D B;  5D3I B;  1TY2 A;  2JSO A;  3VYU A;  4LJZ C;  4OO1 G;  2RSO A;  2F0V A;  3P20 A;  5FLX E;  4C3J B;  3NBH A;  4G4K A;  4M1U B;  3P7J A;  1IYU A;  5JJZ A;  4FP5 D;  2F0M A;  1FYC A;  4PQX A;  1KAA A;  3VYR A;  1PRT C;  4QIW B;  1F9S A;  3HOV B;  3IKJ A;  4B08 A;  5EKL A;  1D5Z C;  2J4X A;  3DWQ A;  4MHE A;  2BCO A;  3MXG A;  3HEJ A;  2CQA A;  4O42 A;  3I4N B;  1GHK A;  4K5V A;  3HZX A;  1PTO C;  3GTG B;  3SDZ A;  1RCV D;  2FFK B;  3KUP A;  1G8Z D;  3EJI A;  1A15 A;  2CVR A;  2TSS A;  3R93 A;  3TP8 A;  3S9W A;  3HS0 C;  3NHH A;  3QIA A;  1SMY C;  1FNV A;  4CKC A;  2N55 A;  3HOZ B;  1KDC A;  1TWH B;  1OXU A;  3FKI B;  1SNP A;  2SNS A;  5K5P A;  2F0I A;  1LAC A;  2MHV A;  3NWS A;  5FOB B;  1D5M C;  2XRQ D;  4DK1 A;  1KLG D;  3NUC A;  4FXD A;  4CJ2 C;  4J8Q A;  5D14 A;  3R2T A;  4ZRZ A;  1W6K A;  2NN6 H;  1EY0 A;  1IW7 C;  3SEB A;  1LTB D;  2I07 B;  2D9U A;  2IW3 A;  1B9N A;  3D31 A;  1B9M A;  3D6C A;  2JA6 B;  4GZY C;  2V4D A;  3DXJ C;  1NSN S;  2IPK D;  3Q24 A;  2CHB D;  4EQP A;  1Q8I A;  4PMW A;  1TWC B;  3H91 A;  3MZ5 A;  4IZ8 A;  2E2I B;  2F1M A;  3I3C A;  2K04 A;  4XIG S;  5M5W B;  3BS1 A;  2B2Y A;  4ILW A;  3PUZ A;  1H9J A;  3QJY A;  1PLF A;  3M85 A;  2F0L A;  5ELC A;  4RAU C;  4V0B A;  2EYP A;  3I4M B;  2OXP A;  3K6O A;  5J22 A;  1Q12 A;  1LAB A;  1SJH D;  4C1N I;  2F0N A;  1EL0 A;  2IX1 A;  1SNO A;  1K8M A;  4ZUJ A;  1RF2 D;  1SXT A;  2LFN A;  4S3S A;  4TRD A;  4J1M A;  3MFY A;  4G7O C;  3DM1 A;  1YNJ D;  1EIH A;  1PZJ D;  3A8K E;  2KA7 A;  4MIU A;  1O7L A;  2XWB B;  3K57 A;  4IFD G;  1BCP F;  3OW7 A;  1ZYR C;  1TQO A;  1OXV A;  2AUJ D;  5BN4 A;  1JCK B;  1CZG A;  3D4R A;  1NUC A;  2LS0 1;  3OMG A;  5TSS A;  2C5C A;  1B44 D;  5LL6 X;  4DXF A;  3J7Y W;  1Y1V B;  1WTP A;  1ENC A;  2PZT A;  3S1N B;  1RDP D;  3MTS A;  3BG3 A;  2ID0 A;  1GOZ A;  2F0F A;  3X3N A;  3R2I A;  3RD4 A;  4QCL A;  2IT1 A;  4C56 C;  1SYG A;  1BQQ T;  1DYQ A;  4FO2 A;  3IFT A;  4RA8 A;  4RKB A;  2WP8 J;  3NQT A;  2A69 C;  5EBD A;  1XTC D;  1BOS A;  1RTN A;  3N6R A;  3GTP B;  2B2Y C;  4XDX A;  3MXU A;  2SEB D;  4H44 C;  3NQI A;  1B4O A;  4WRD A;  2X69 A;  5CV5 A;  4HTH A;  1QCB D;  5DNF A;  4UAI A;  2VNU D;  1PZI D;  1Y8O B;  2KEC A;  1HA5 A;  2F0P A;  3CRL C;  4BBS B;  5HGT A;  2WII B;  2LMC B;  3TN2 A;  1S5B D;  2R61 A;  4CJ0 B;  1BO0 A;  3J7A F;  1GUW A;  3VR6 A;  1YNN C;  3VA7 A;  2Z4H A;  4I7Z C;  4KHV A;  1V1O A;  4CGY B;  1DOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...