1EY4A

Structure of s. nuclease stabilizing mutant s59a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey4A00
2EY5A 2F0JA 4RKLA 2EYMA 5C5MA 3E5SA 5M9OA 3BDLA 3EVQA 3SXHA 1SNDA 3NK9A 3TP6A 5JAVA 5C4ZA 5KYLA 3S9WA 3NP8A 2SNSA 3T13A 5J39A 2EYPA 1IHZA 3H6MA 3PMFA 4QMGA 2F0MA 4KY5A 5DAUA 4OL7A 4B9WA 5C3WA 5CV9A 5EKKA 2OEOA 4J6HA 1U9RA 4RKBA 1TQOA 2F0LA 2PQEA 3EJIA 3R3OA 4H7BA 1SYCA 1ENAA 2F0OA 4EVOA 4PMCA 5K5PA 1EYCA 4KD4A 3C1EA 1A3TA 5I6WA 4KHVA 3MXPA 5C5LA 4IZ8A 4K5VA 2KQ3A 4EQOA 1SYBA 4B9XA 1RKNA 1SNQA 5CR3A 3TP5A 4I65A 5CV6A 2F0FA 4DFAA 1A2UA 1NSNS 3LX0A 2F0NA 3MHBA 3VA5A 4R8NA 4ID6A 2SOBA 4NP5A 1SYFA 2F0DA 1KDBA 4E6IA 4F7XA 4KV6A 4YIJA 4DGZA 5NUCA 5HGTA 4EQNA 2F3VA 3HEJA 3U9OA 1SYGA 1EYAA 1KDCA 3TP8A 4K2KA 3EROA 1SYEA 1STAA 2LKVA 1STGA 2PZWA 3D4DA 1A3UA 2KHSA 4IALA 4J1MA 3RUZA 5IOCA 1ENCA 3MVVA 3DHQA 3QOJA 1SYDA 5CC4A 3QB3A 4TRDA 4N9PA 1JOKA 1SNOA 2ENBA 5CV8A 4KD3A 2EYLA 5IGGA 2F0UA 3NXWA 2F0VA 1EY0A 4K5WA 5CV4A 5IGEA 2F0SA 2EY2A 3ERQA 5IIFA 2EYFA 2F0KA 4LAAA 4MIUA 1EYDA 4ZUIA 1TT2A 5C6AA 4NDXA 2RBMA 4QF4A 4WRDA 3ITPA 5EGTA 3TP7A 2NUCA 5E3FA 5KEEA 5ISRA 5CV5A 1A2TA 4K5XA 3P75A 3SK5A 4K8IA 4DU9A 2HQEA 2F0QA 1A3VA 2F0WA 4HMIA 1EY7A 3HZXA 5I6YA 2EYOA 4KJOA 1AEXA 5J1ZA 1F2ZA 2OXPA 2QDBA 5F2DA 5I9OA 1F2YA 2O4XA 1STBA 1STNA 4NMZA 4WORA 2PZUA 1EQVA 2RDFA 1SNMA 3OMCA 4K14A 1STYA 5I9PA 5IODA 2F3WA 1KAAA 5KYIA 4ME5A 5JOBA 4F8MA 1EY6A 3TMEA 3OMGA 4HMJA 1NUCA 2PZTA 1EY9A 1KDAA 3NUCA 3OSOA 3V2TA 1F2MA 5IGCA 5KIXA 1SNPA 4ZUJA 5EKLA 1II3A 3NHHA 4PMBA 5IGDA 2SNMA 3MZ5A 3QOLA 5KGUA 3DMUA 2EYHA 4NKLA 2F0HA 3NQTA 4K6DA 4KTAA 4KY7A 4S3SA 4PNYA 5C4HA 1JOQA 2F0TA 4K2LA 1EY4A 5C3XA 5IGBA 4QB4A 3SK6A 1STHA 5IGFA 2WACA 4KY6A 3D4WA 3D6CA 4ODGA 2PYKA 1EZ8A 3SR1A 4HTHA 5DEHA 4ZQ3A 3BDCA 3SK4A 4G57A 2EXZA 3SHLA 5E1FA 1JORA 4KJNA 2PW7A 2EYJA 2RKSA 2M00A 2F0GA 4N9TA 4K8JA 2F0EA 3OWFA 1EZ6A 1TR5A 1SNCA 3MEHA 3D8GA 2EY1A 5J22A 1EY8A 5HURA 2EY6A 1KABA 4IUNA 2OF1A 3C1FA 3P1HA 5KRUA 1JOOA 5CV7A 2F0PA 3T16A 4DF7A 1EY5A 4EQPA 2PW5A 2F0IA 3SK8A 5CGKA
chains in the Genus database with same CATH superfamily
2EY5A 1WTQA 5IE8A 4DNTB 1PLFA 1XYIA 3J80i 2IWHA 2K7VA 1SR3A 3DEOA 4KY5A 3G7LA 1AZPA 1AW7A 3HKZB 3IL8A 2JA5G 4C56C 1XPRA 1RKNA 2EJGC 5JVH3 4V0BA 4CDCC 4DFAA 4DV6Q 4LF8L 3DM3A 1WCMG 1ESFA 2MO0A 1SYFA 1SMYC 1HRJA 2D0PA 1R9TH 3HOVH 3F8TA 1CZWA 3RMHA 4DUYQ 4KI0A 3TP8A 4JV5L 1OXTA 1W6JA 3EROA 3VYSA 1Q7YC 2A68D 3RZDH 1IBKQ 3J81c 2B8GA 3J81E 1JE5A 5CV8A 3M4YA 2EYLA 1PYSB 5CV4A 2F0VA 1R9TB 1Q90A 4RHSA 4Q0FA 3J80c 4IPGA 3J80E 2F0KA 4A3LH 2Z4HA 1H9SB 1MD2D 4X3KA 1VMCA 4JPBW 3KDFA 1D5ZC 4CKEA 5C4XH 4K5XA 3SK5A 4DU9A 1VQEA 5JEAH 3RZDB 2Z8LA 4G7HC 3HZXA 3KK7A 1QB5D 1F2ZA 3OPOA 3NQIA 1XWEA 3CKIB 1RD9D 4DNIA 4DNRB 4AQYQ 3HOZH 5EPLA 3H3VC 1STBA 4WORA 1Z6HA 5C4XB 4GLXA 3UI2A 1MSGA 2IX0A 4F88A 3K5NA 1H9MA 1NUCA 1LT6D 2A6EC 4IJLA 1SROA 1VQOA 1RL2A 1D2BA 4CKBA 3HOZB 1IXRA 3TZDA 3DLLA 1LM0A 5FOBB 4GKJQ 1FGBD 2PNHA 3SGIA 4C2MB 1LTAD 1LV9A 2YU9H 3FKIH 1OXXK 2B3GA 4UY8C 2NVXH 1WOCA 2A1AA 1A15A 1QVFA 2K6AA 1M90C 1O7LA 2QDLA 2PNRC 4DV1L 1MHWC 1CSQA 3V96A 4LF9L 1TS4A 4KLKA 1YJWA 2F0PA 3KJOA 1JJ2A 1FGUA 2NVXB 5CGKA 2GN5A 2ZTCA 4HIKA 1XNRL 4DK0A 3BZKA 3GD7A 5JAVA 2VUMG 3K5MA 2XRSD 3T13A 2WB1B 3GTQH 1N8RC 4JV5Q 1L0WA 4XQNA 4DXGA 3PV0A 5D3DA 4A3DB 2OEOA 3KLSX 1PFMA 4MTNA 2R93H 3K80C 1BOSA 1V9PA 4OHJA 4LFAL 3MXPA 4DAYB 3GTQB 1XMOL 4YHHL 4KMUC 3Q8DA 3VDYA 3T51B 4WJ3M 2K5VA 3CCRA 4JI4Q 1ICWA 1X32A 1KDCA 5IWAQ 1UUPA 4HCSA 1O7YA 3CRKC 1E2ZA 2BDOA 4OX9Q 5M3MG 5A2QL 3MWYW 4N9PA 1JJCB 4DV7L 1EY0A 2P5ZX 4A3MG 2F0SA 4YWLA 2DY7A 2HCCA 4JI8L 1XTCD 3D6WA 3CU7A 3NELA 1MIUA 1B50A 4HR7B 2PI2E 2FFKB 4OWTB 1EWIA 2OXPA 5ELBA 1V1QA 4HCEA 1CK1A 3PIPA 1X9NA 4LUOA 3B6YA 5EBCA 1KAAA 5IODA 1LTRD 1AZQA 4NXNL 1KDAA 3BG3A 3AEVA 1G91A 2PQAA 5I4DA 4A3JG 3F2BA 3HGBA 2KENA 4DR6L 4NPSA 2IHEA 3G48A 2M2LA 1VQ9A 2L4NA 1N34Q 3FPPA 2ZXRA 3M4OH 1DOLA 2VQEQ 1HZAA 4BBSH 2E2DC 1EOTA 1K8OA 5FK9C 2OT2A 1NE3A 5ELEA 1K0SA 4U673 1SE3A 2XTIA 1HCZA 1LTSD 3QG1A 2KVMA 2MP1A 4ME3A 4N8X1 3OWFA 2E75C 2N88A 3M4OB 4UP7A 1QNUA 2LXJA 3K5OA 1XMOQ 1SE2A 3CP0A 1I4HA 1JWUD 4HIMA 4EQPA 3BVMA 2KHIA 1QCBD 1EOVA 2EYMA 3I3CA 1PH5A 3IFDA 5JJIA 1SNDA 1TWAH 5C4ZA 3ERSX 4H44C 1GVPA 1WD1A 1LT4D 2OTLA 3C2PA 4J8QA 2CW0D 1XMQQ 1KL9A 1EYCA 2WKCA 3ONAB 5I6WA 1LUZA 4GOPB 4DXFA 1I6HH 4JI8Q 1GHKA 4DR4L 3TP5A 1L1OC 1EIHA 2CQOA 1Q82C 3VA5A 2I5MX 2FXQA 3U50C 4GS3A 1JJGA 5NUCA 2UU9L 1I6HB 3U9OA 1Y1WH 1EEID 2CFMA 4GKKQ 3I7FA 3DHQA 1SYDA 2E8GA 2VUMB 1HFGA 2DUDA 4LAAA 1B9MA 3BU2A 4KKSA 1CKNB 3ITPA 1Y1WB 3I4NG 1YJNA 2UXCL 5M5XH 2EE1A 1QVGA 3GTPH 4KJOA 3NEMA 3CRLC 3L2PA 1CQFA 2F52A 4P73A 4O1NA 4QIWB 4DR1L 1IBMQ 1LABA 2B2YA 1K73C 2A69C 4QQBX 1ICFB 1Y1VG 2K5QA 4RGNA 3PCOB 4F8MA 2AWOA 4WFN3 1HA5A 4JI1L 5M5XB 2EVBA 2Q8TA 3D4RA 1S5BD 3QIAA 3RD4A 1SDFA 2EIFA 3KF6B 1UNSA 4A3KG 1TIID 3CQZH 1RCVD 1Q86C 3GO5A 3VYTA 1H9SA 1I4GA 2SDFA 3C3LA 4DV2L 3VR3A 2YYZA 4JI5L 4G57A 4A3FG 2AUKA 4GN3B 1SMYD 4KJNA 3ZJYC 3BVZA 1JB7A 1T9HA 1D8LA 1FNVA 3D8GA 3S24A 3W1BA 2B2UC 2NZOA 3E9IA 3R8BA 4DR4Q 3I4LA 4CJ1B 5CV7A 5LMNL 1TWHH 1VQAA 3F2CA 2E2JH 2LY7A 2CKZB 2B63G 5IT9L 3A5ZB 3E5SA 1S72A 4QY7A 5CBAE 3S9WA 4OXPA 1OXSC 4C3HH 2EYPA 1HPCA 2K01A 4A3JB 2VY3A 2HHHQ 1TWHB 4X65L 4KHZA 4OL7A 2E2JB 3DWAA 1RDPD 2Q2HA 2Q2IA 4PMCA 2RQXA 5EPKA 4L5RC 1TS2A 4C3HB 1E1TA 1DYQA 1F77A 2VQFL 5C0XI 1R4QB 2A6ED 1UE1A 2LS01 4DV4L 2RVLA 2O2LD 4QUCA 3A0JA 1QVCA 3Q23A 2CWPA 2ZJQA 3SE0A 1I50H 3DXJC 3N52A 4R4OA 2KHSA 3KOJA 5CC4A 4ZKCB 1PZJD 4M1UB 4TRDA 1SNOA 2VL6A 2PMZB 3CPFA 3KDFB 2VB3X 1UE6A 2HDLA 2FMCA 4V190 1KHIA 4WRDA 1ZYRC 5KEEA 1NCVA 1HZ9A 2YTXA 5C44H 4GZYC 2JEAI 4DR2Q 3RN5A 3OW7A 4K8IA 4KHPQ 4DAYA 4DV2Q 1EL0A 3RLOA 4AIMA 5I6YA 2XWJB 3CMAA 4JI5Q 4MNOA 2MO1A 2NTSA 1PZID 1CA5A 3A55A 3S15H 1C8CA 4KKTA 1BKBA 4DN4M 1Z7TA 5KYIA 5BR8L 5J3BA 3LWUA 4HEDA 1GUWA 3FEWX 1X3PA 5LMNQ 2K52A 1DJRD 1V43A 1J8IA 2ZJPA 3S15B 5IP9G 4FO2A 4DUZL 2WB1E 3D6CA 4LF4L 3GTGH 2CH4W 4JBWA 1HNZQ 3GTJB 1WTXA 3NPPA 4P75A 1M8AA 2D62A 2KA7A 3I4NB 2M9VA 1EQTA 2EYJA 5KNCA 4IPCA 5IP7G 1CT1D 3Q6SA 3WWVA 3S2DH 3BYYB 1JE4A 2EY1A 3PIO3 1B3AA 1JICA 1G2SA 3I4OA 2MPMA 4O42A 4BBRG 1VQCA 4B3TL 4B3ML 2F0JA 2Y0SE 4MZ9A 1Y1VB 2ZXOA 4ABNA 5JJLA 1AN8A 3VR5A 5FJ8H 3T4AC 3J7AV 3GV3A 1O78A 5IYBG 5KNBA 4Y7NH 2FHTA 1HQMC 4A3KB 4R4CA 5EAYA 2PQEA 3R3OA 5K5PA 1B1ZA 4KD4A 4XIGS 2RCFA 4DAVA 3K8AA 2QCPX 2F0FA 4Y7NB 4FXGC 1JWMD 1MSHA 1XTDA 2KOLA 2CVRA 3NSWA 1FJGL 2N78A 1ASYA 2HT1A 1J9OA 1K9MC 4YIJA 4KN4C 3IRBA 2BH8A 5H1SE 5CMDA 1GD7A 4DK6C 1ENCA 5I2YA 4P72A 1B53A 5BR8Q 2IX3A 1BCPF 1DCZA 4R1JA 1VQIA 2B2WC 1CKMA 1U0LA 2XN9C 4MIUA 4RGMA 1TT2A 4RAUC 4HJ9A 3TRZA 2N55A 4A93G 1WTPA 1E1OA 1EY7A 1PTOC 2E76C 3H94A 4LW1A 1RJTA 1VMPA 3H91A 1C7YA 1AEXA 2JSOA 3EQLC 5C4JB 1VQ4A 3HOWH 1A62A 4JI3L 1L0YB 1TWGH 4ZCKA 3J7AF 1OXUA 1U4MA 4TQUS 1DZ1A 3M4PA 1UEBA 4C3IG 2PQAB 4ME5A 3R2TA 2A8VA 1IBLQ 3DM1A 1YIJA 4B3MQ 2ZM6L 4HJAA 3S14H 1JT8A 1X3QA 2IPKD 2KCCA 3VYUA 5IGFA 2V1CC 2WINB 5C3EH 1W3SA 4DUYL 4UDUC 1YHQA 1WTWA 1I6VC 1BCPB 3S14B 4A3IG 1PYBA 4HJ5A 2I0QA 3J7A5 1BXTA 3I73A 4GN5A 5C3EB 2JA7G 1CHQD 3K7AH 2R92H 1FJGQ 3H15A 2CH4A 3BZCA 4GLVB 1Y8OB 1O80A 4Z9CB 3EVQA 1LT3D 3SXHA 3UDGA 1CTMA 5KYLA 3NP8A 1D1IA 3CCUA 1IHZA 4AQYL 3PMFA 2JA8G 1RIPA 2F0MA 4X3UA 1DM0B 4CDFC 4G4KA 3EJIA 4JBMA 4RH6A 1PTOH 2JJQA 4HJ7A 2WP8J 4I65A 2A69D 2DY8A 3FMCA 2B2TC 3K59A 4FXDA 3WOFA 1PYWD 5IY0A 3K81C 3S1RH 1SSOA 1SJED 2ZT9C 2XIWA 2QGQA 4A3CG 4DGZA 3PSIA 1PTOB 3A8IE 4GKJL 1K3RA 4QIWE 4L8JA 4JI3Q 4L63B 1L1OA 3PO3G 1STGA 4LWCA 4K0KQ 1GKHA 4LF6L 2AQ1B 3S1RB 2ENBA 4K5WA 3PUXA 3S1QH 1AH9A 2JN4A 3E9HA 1HUMA 2EOTA 4XTCS 1HXYD 2ZM6Q 2O5IC 3JC66 3TEHB 1A3VA 4HMIA 4NB3A 4OWWB 1XJVA 3AFQA 1N36Q 1Q8KA 4IFDG 4OIKA 3NTIA 4BY1H 4LF7L 1NMFA 4YWKA 1HZCA 3S1QB 1UE5A 2D0OA 5F2DA 2YTYA 1JMCA 1VQPA 2R7ZH 5E7NA 4LFBL 1O7ZA 3VR6A 5M5YB 1KTKA 1B70B 3V05A 1I4QA 4BY1B 2N3SA 4BWGB 5FKAC 2RF4A 1BF4A 1SN8A 2WAQG 1N9WA 4NKLA 3T1HL 2R7ZB 2F0TA 3HG9A 4CJ0B 2Z6KC 1YBYA 4UHVA 3D31A 3I2ZA 4JI4L 3ULJA 5DEHA 3PUZA 2KEEA 5E1FA 2UUBL 2F1MA 4PZ8A 5M3FG 5IWAL 2PW7A 1D5XC 4N9TA 1X3EA 4OX9L 1NR2A 4OO1H 3MEHA 3FHWA 3E6ZX 4C2MH 1ET6A 1YJ9A 5IYDG 1E7ZA 5FLMH 3SK8A 1UE7A 3P7JA 1WFQA 5EQ0A 3HOYG 2B2UA 1TY0A 3HOUG 1TXYA 1ZYRD 2SNSA 2AQ3B 2Z1CA 2VW9A 1FNUA 1NNXA 1X65A 3H6MA 3W1GA 4LF6Q 2IT1A 4JG2A 4ULLA 1EFID 3SEBA 4A3GG 5K36H 1DONA 4EQOA 1HA6A 1XNQQ 3I72A 1A2UA 2KEDA 2LFNA 4A3DH 2RCNA 3H0GH 4R8NA 1EQQA 2VZAA 4E6IA 3P20A 1N34L 5T1IA 4LF7Q 2X69A 5HGTA 1W6KA 2DGYA 1T5EA 2JA7B 2VQEL 2AWNA 2QKIC 3MFYA 3CHBD 2PZWA 4LUVA 1A3UA 3NBHB 3RUZA 4F87A 4LFBQ 4QCLA 3H0GB 1E2VA 4FF2A 1KQSA 5IGGA 1EUJA 1J5EQ 2RDHA 3A8JE 3ERQA 3K57A 4ZUIA 3K0YA 3I8ZA 3PO2H 1AE3A 5ISRA 3T1HQ 1A2TA 3H3VH 4BY7G 1EFWA 1EYGA 3ZYYX 1CKOA 1F2YA 3QWNA 4NMZA 1STNA 2UUBQ 3PO2B 2RDFA 1GUOA 4AYBG 1HUNA 4GLAC 1A6XA 1WVLA 4IUQA 2JA5H 3FDTA 3V2TA 1XMQL 1BCPD 3RZOH 2FJ2A 4FF4A 5EBDA 5KGUA 3DMUA 2RSOA 5C4HA 1BO0A 3M9BA 1WCMH 2ID0A 3QO2A 3UDIA 5IGBA 1Q8IA 1IZ6A 1MJEA 4KY6A 2JA6G 4PZ7A 1V1PA 4C1NK 2JA5B 1RODA 4HTHA 1A0IA 3RZOB 3K7UC 5IYCG 3SHLA 3MEFA 2Z9HA 1RHPA 1DD2A 2RKSA 4EX5A 1WCMB 3CCLA 4GKKL 2NN6I 4FVMA 1HNXL 1W2BA 1HHVA 4ZLTF 1OO9B 1R4PB 5G3LD 3WOEA 3KF8A 3C1FA 3I56A 5KRUA 4JBKA 4G7ZC 5D14A 2K32A 2Z4IA 2WV6D 1KD1C 2Q8RE 3S1NH 3CCMA 4DR7L 1IKLA 3D3RA 2WAQB 5FLXL 2WFWA 5C3WA 1PTOD 4B9WA 4X66L 3AQQA 4PQXA 4RKBA 1XPOA 5FO8B 1IBML 1B3QA 2QEJC 1HTPA 3GQBA 1S5DD 4O2DA 3F2DA 3S1NB 4IZ8A 1SYBA 2NN6G 1J6QA 5LMNW 1PH1A 2NBFA 3L7ZC 3OW2A 5A2QE 4LMQD 4HAEA 3W2DA 4A75A 3I4MG 2DJFC 5ELFA 3UE0A 3DWQA 2JYOA 1KAWA 4X64Q 4POGA 3L0OA 1SYEA 3I55A 1EQRA 3SDZA 3RLNA 3QB3A 1LO5D 1EIYB 2F0UA 1QOHA 3MXNB 2NB0A 2EJFC 2GVAA 1ML0D 1UWVA 1YNNC 2RA4A 1LLRD 2B2WA 3KBXA 3J7ZC 4A3GB 3AU7A 2VUMH 3G71A 3E0JA 3RN2A 4DPGA 1I4PA 2DNCA 1EQVA 1Q1EA 1EU4A 2JP1A 1IYVA 2HHHL 1HNXQ 4HSPA 1Y14B 3TMEA 1PH2A 1H9RA 2RSNA 2EJMA 1E2WA 1JC7A 3PQIA 2PZTA 3R93A 3TQYA 3A74A 3STBC 4CJ2C 5FLXc 1TWCH 3MZ5A 3G6JB 4CHTB 5GROA 1F9RA 4FNFA 3AB9A 1ILPA 1EIFA 3VR2A 5DLQE 1X6OA 4MHEA 3VR4A 1PA6A 4DR7Q 1NJIC 3A7AB 1TWCB 1D1KA 4X66Q 3NWSA 5GQOA 1VQ7A 5M3MH 2F0GA 4APVA 4K6LA 4C3JG 2F0EA 1EZ6A 4OIJA 1SNCA 2H4OA 4A3MH 5BN4A 1KABA 1JOOA 2JQOA 4JI2L 2NWGA 3HS0C 2NVTH 4DR2L 3KBGA 5M3MB 4KHPL 3ND8A 1MBYA 3I90A 2C35B 1GUTA 4A3MB 3S2HB 1I4RA 3JAML 1VQJA 1FNWA 3CF5A 2KJXA 4JI6L 5EKKA 2L12A 2NVTB 1TQOA 2F0LA 3HKZE 4H7BA 1ENAA 2B2VC 5FO7B 1WJJA 1A3TA 4KHVA 1ONLA 4A3JH 2R3ZA 4JI7Q 3LX0A 3CW2C 3K5LA 3MHBA 1F9PA 2K03A 1L1OB 4CDDC 4F7XA 1VF5C 4KV6A 2NVYB 2L5TA 4L5TA 4EQNA 1KC8C 1PV4A 4IURA 5BN5A 2UUCQ 2XWBB 4K2KA 1STAA 1HNZL 1KNEA 2B2TA 4PMWA 3BDOA 3D4DA 2MGSA 3RR5A 3QOJA 2K04A 3T1YL 1KXLA 2HIXA 5EJWA 1G6ZA 2KCNA 3NXWA 2BDNA 2EY2A 4JOIC 4X3TA 1VQMA 3QR8A 3ND9A 3C46A 4X3SA 1L2FA 1GJXA 3GV6A 4JVZA 2F0QA 2G9DA 2F0WA 2AQ2B 5ELDA 4YWMA 1JB3A 2OQ0A 1E24A 1ZXTA 1SE8A 4DAPA 2OWOA 3GTLB 4DR5Q 3OMCA 5T1GA 4BXXG 1TY2A 3OMGA 1N33L 3NBHA 1S3OA 3CC4A 4JI2Q 2MJ8A 1KRSA 1ZKOA 4A4IA 1AFPA 4CBVA 2BA1A 1C48A 5C3XA 3SK6A 1IYUA 4A3EG 1KLGD 2KCTA 5C0XG 3EFXD 2EXZA 5IT9c 4JI6Q 5IT9E 4P71A 5ELCA 1PMRA 1YI2A 2Z6KA 1YNJC 2FMMA 3GTJH 4DR3L 4PZ6A 3P1HA 1BUVT 1EY5A 3I4NH 2EQSA 3K58A 1K83H 1L0XB 1LTTD 1MI2A 1VQDA 4DK1A 5C5MA 2GVBA 1EEFD 3NK9A 1QZGA 2V4DA 4IJHA 1JQYD 4JK1C 3HP3A 2KBNA 1WTHA 4B3RL 5DAUA 1K0RA 3T1YQ 2JEBI 3U4VA 2JXMB 1HTLD 1HR0Q 4NXMQ 1K83B 1Y1VH 2F0OA 3C1EA 4XT3B 4A3BG 3OOCA 3PIOA 1SNQA 5CR3A 1IBLL 5M5WB 4YY3Q 5GAEC 4A3KH 5D3IB 2SOBA 1D7QA 4C3JB 1CUKA 2H5XA 1CHPD 1SE4A 4KN7C 4XYOA 4A3FH 1QZHA 2B29A 2DN8A 1PVOA 3MC0B 3OIQA 1N33Q 4WJWA 5JJZA 2K75A 4JCVE 4G7OC 2X6GA 4FF3A 4JC0A 4L5QA 2C5CA 2J0TD 1S5CD 2RBMA 1C4QA 2IX1A 1K8AC 3HOXG 1PH4A 2MUYA 4A3FB 3UDFA 4UP9A 2B63H 3HKZG 2K1BA 3MAQA 2NVQH 1MJCA 3PF4A 1Z9FA 3KLRA 1OXVA 2PZUA 2K05A 4LF5Q 2VS1A 4K14A 1STYA 3M4QA 2B63B 4L5SA 2R7FA 1UAPA 1VQGA 4XYQA 3NENA 2NVQB 4DR3Q 5HGQA 5C4JH 4ZUJA 1QILA 1ET9A 1VQLA 2F0HA 3O13A 1V1PB 3E3XA 3M7GA 3MXNA 3HOVG 3DEPA 4XQQA 4IFDJ 1Q3LA 1U4PA 4LK1C 5COYA 4B3RQ 1VQHA 1QG7A 1WYDA 1SFOH 4OO1I 1STEA 1CI3M 2SEBD 2MFIA 3J7YW 2M00A 3KF8B 5KNDA 3CCQA 5G3LF 4K8JA 4K0KL 1QUQA 3IFTA 1NAPA 1E3PA 1G51A 4A3LG 4RWSC 2BA0A 1HNWL 5LMUQ 4IO9A 3PUWA 2F0IA 1SFOB 5C4XG 2LXKA 5JEAG 1FR3A 2K5WA 1HZBA 3M3YH 1CZGA 3BS1A 2A6HC 4XT1B 1N36L 4MN3A 2AUJD 3HOZG 1PTOF 1GHJA 1Y8PB 1YNND 2L1BA 3A7LA 4J6HA 1OTCA 1SYCA 4LNQA 3M3YB 2TSSA 1PH8A 4P2CB 4K5VA 3L3OC 1FVIA 3OIPA 1B7YB 4NP5A 5DM63 1K8MA 3K6OA 5IP9H 3STBD 2N8NA 2IW3A 5GAHC 2D5DA 3FKIG 1DXMA 1PFBA 1EYAA 2ZTEA 1Q46A 4XXEA 4DV3L 1YZ6A 2QILA 2QF7A 3TREA 1WI5A 3MA2B 1JOKA 4FDBA 5IP7H 4OEMB 2WB1G 1ZEQX 3H3VI 2EYFA 2VNUD 1JR0D 4I7AA 5TSSA 1PDQA 2UUAQ 3BYTB 4QF4A 3TP7A 4Y52H 4BBRH 1YEZA 1MGSA 3J81L 2EYOA 4ALPA 2JA9A 4ZRZA 2L0CA 2FINB 3J80L 2HD3A 5IYBH 3AFPA 2F4IA 3CCJA 3A5UA 4BBRB 5L37A 2Y0SG 2X6LA 3I70A 3KLWA 2R93G 1EY9A 3FVQA 1HNWQ 1O7IA 5IGDA 2PO4A 2EYHA 4S3SA 3GTKH 1XNQL 2I07B 4K2LA 4DV5Q 2NZ1D 2K14A 2BCOA 5M5YH 2WACA 2MQHA 1S40A 1IYJB 2R7DA 1D6EC 3HOXB 2OCEA 2E2IH 3GTKB 5E4XA 3VA7A 4JI0Q 1J5EL 2OF1A 2NYZD 4BA1I 3LNNA 1GUGA 3CMEA 2PW5A 1SXTA 1H9KA 4CKCA 1NR4A 1TVXA 4A93H 2E2IB 4DV0Q 3BDLA 2DJGC 2HQLA 3G6EA 2ASBA 4DV3Q 1QJOA 1PXUA 1X3FA 4TVAB 3I91A 3LGJA 1X55A 4A93B 4C3IH 3HFZB 4NW2A 2R61A 2BE5C 3EN2A 1FL0A 3HOVB 2JK8A 1K8GA 2KQ3A 1C9OA 2XSCA 2NTTA 3R2IA 2YV5A 5LL6S 3KJPA 1YNXA 4FXKC 2F0DA 2B2VA 4CDEC 4C3IB 3TSSA 2ICEC 2IJ0A 2ICIA 4R4TA 1VF7A 2K5DA 1IL8A 5CBEE 4BBSG 4QL5A 3WDNA 1G6PA 4L6TB 2HIVA 2B39A 3BZDB 4H13C 3L9AX 2AMCB 2PMZE 3IKJA 1YVCA 4A3IH 4IQZA 1GO3E 3PUYA 2JA7H 3CCSA 3GTOH 3RNUA 1G8ZD 1S5FD 5HY6A 4A76A 1U4LA 1YNJD 2BOSA 3S16H 3M85A 2IHFA 3DWPA 2EXDA 4JOIA 4A3IB 1X3GA 4RCNA 2A5HA 2KHJA 3GTOB 4IUTA 2ZJRA 2JA8H 4X62L 1A8VA 3CCEA 3OYYA 3S16B 5JOBA 1P8LA 3OSOA 5KIXA 1LTBD 1EIGA 2YU9B 3FKIB 4DKAC 5EKLA 4LF8Q 1VQNA 1SLJA 2I5LX 3TN2A 4K6DA 1VQBA 2JA8B 1WD0A 1YHAA 2I46A 1JWSD 4Q5VA 3HRZC 1A63A 3D4WA 4A3CH 3U4ZA 1EZ8A 1G291 1Y1WG 4X64L 4OELB 1BNZA 1WTVA 3PO3H 3F1ZA 2CCZA 2PI2A 3GP7A 5CORA 1GOZA 1LTGD 1I3QH 3G4SA 2IL8A 1PRTC 5J22A 3W5OA 4ILWA 4IUNA 4JW0A 3PO3B 1VQFA 3H09A 1E0BA 2Y0SB 5M9OA 2R93B 3CXCA 1I3QB 4XQJA 4IFDH 5LL6X 1PZKD 2ES2A 2A73B 1KNAA 3TBIB 1RTNA 3Q0AA 1I5FA 4GOPC 1KRTA 2Q8IB 2XVSA 4EVOA 3CCVA 3VYRA 4GNXC 1EWHA 3NE5B 4DA2A 1PRTF 5CV6A 4DK3C 1H9JA 4RG1A 4DAMA 4JYAL 1SAPA 2J7ZA 4R4QA 3F2UA 4RCOA 1FYCA 1LACA 1IW7C 4J15A 4GN4B 4X62Q 1X56A 3PIP3 5E4WC 3MVVA 2G9HD 5M3FH 4DV1Q 1SJHD 2XRQD 1DGSA 2L9HA 1P16A 3FPUB 5DM73 4LF9Q 4KD3A 2AKWB 4KKUA 4YCVA 4N8FA 2DNEA 1C0AA 3TDQA 4H02A 5IYDH 3A56A 3CPWA 1LTID 1XNRQ 3CAMA 5CV5A 2K5NA 3P75A 2D2CC 3KYHC 4RGOS 5M3FB 1T5XD 3M7NA 1YHBA 3HOYH 4EGVA 3HOUH 1VCIA 1GUSA 4C3HG 1UEAB 5AFWA 5I9OA 1TS5A 4IOCA 1GM5A 4LFAQ 1HR0W 4A3GH 1EY6A 2A6HD 2K4KA 3HOYB 1B2TA 2UXBL 3HOUB 4BBSB 1F2MA 4YHHQ 1SNPA 4RA8A 1PRTB 4X6AH 1TWFH 3QOLA 1U5KA 5CYUA 1G2TA 1VS0A 4PNYA 4PV1C 4JI7L 1PH7A 1STHA 4M8AA 4ODGA 4HN7A 5JPMC 1V1OA 3CD6A 3BDCA 3GDEA 2UUCL 1CFMA 1QUQB 1TWFB 1JORA 2CQAA 5EKIA 5EPJA 4DV7Q 4WJ4A 2MHVA 3T56B 1CM9A 1Y69U 4EQ5A 5I2XA 1JCKB 1IKMA 2PCFB 1TR5A 1TWAB 3SVMA 3KUPA 1F9QA 4GNXB 5FLXE 4QJFA 5C44G 1LYLA 4I7ZC 4JYAQ 3OTOL 4BY7H 4RKLA 1E22A 4RMFA 3AMUA 4YCWA 4P74A 2D9UA 3KFUA 2A19A 2L55A 5C0XJ 1M4VA 3MFGA 5AJ3L 4IUVA 1SRUA 4DR5L 4BY7B 1B8AA 4NXNQ 4R4IA 4LFCL 4DR6Q 3S2HH 2CHBD 1ENFA 3MXGA 4ID6A 2QW7A 3MXUA 1QNKA 4AYBB 4ZK9B 5GADC 2JA6H 1DOMA 3NTKA 3S1MH 2I5HA 1SYGA 1GXDC 5IYCH 1PH3A 2WKDA 4AH6A 1QE6A 2H1EA 4ZAIA 1RTOA 4QGUA 3FRPB 5D65A 3X3NA 4TSSA 2UXBQ 3GTPB 2NVYH 5IIFA 2JA6B 3S1MB 3TZUA 3EBEA 2E5LL 5C6AA 5EGTA 3QJYA 1NBWA 1FD7D 2NUCA 2HQEA 3RLFA 1TS3A 3GTMH 1AP0A 4HSVA 4O0AA 3JAMi 5FJ8G 4MTKA 1EU3A 1PFSA 3EA6A 2LMCB 5J1ZA 3T53B 1NTGA 5ELNA 1IL2A 2TMPA 5A35A 1SNMA 2ALYB 1HFNA 3BVGA 3CQZB 4CGYB 3CC2A 2Q2UA 3FP9A 3GTMB 1U4RA 2KECA 1HR0L 2HCIA 4POFA 4NXML 2F03A 2PPBC 1TU2B 2NN6H 4PMBA 2UXDL 1Q81C 3GTLH 5JVG3 1VDZA 1PH9A 2EDGA 1Q1BA 3OWEB 1QWYA 2O5JC 3OTOQ 4KTAA 2BE5D 2A68C 4YY3L 1XX8A 3ULPA 4QB4A 2UU9Q 3I4MH 5JJKA 3URYA 3TS0A 2PYKA 5AJ3Q 3PUVA 3A8KE 4IPDA 4UAIA 1SMXA 3U58A 1BDOA 1Z47A 2JE6I 3I4MB 4LFCQ 3JAMc 1N32L 3JAME 1EY8A 5HURA 2L11A 3K0XA 2J4XA 3EIVA 3IAYA 4XDXA 2UXCQ 1SBBB 4OWXB 2Q2TA 4IUPA 5J39A 3HOWG 3ER0A 4DR1Q 4QMGA 2QEXA 4HIOA 5CV9A 1BBWA 3TS2A 4LUZA 4JI1Q 4IPHA 4LF5L 1F9SA 1SEBD 1HJPA 3DUZA 2E5LQ 2YTVA 4FP5D 3ICEA 1I50B 4OONA 4TKOB 1K3BC 4RFBA 1B9NA 1D5MC 5GAGC 2EPBA 5BN3A 5JEAJ 3ULLA 5C3EG 4BA2I 2KUMA 2RDGA 2Z6BA 3HEJA 3LWEA 3UE1A 3A54A 2LKVA 5M5WH 3MTSA 5C44B 5IOCA 1BBUA 2A74C 2B8FA 1PFNA 1I94L 4C3JH 5IGEA 2UXDQ 1EYDA 1ASZA 1DOKA 1LTLA 5E3FA 3CC7A 2R92G 2N49A 5LMUL 1WTOA 3X3MA 2E2HH 1PRTD 1KIXA 4BS9A 1NY4A 4UP8A 4X65Q 1GUNA 2XGTA 1I4XA 4C1NI 2F4VL 5I9PA 2F3WA 4RGTA 4ZYSA 4IN3A 2E2HB 2HDMA 1N32Q 4B3SL 1S5ED 4HMJA 3GTGB 4FF1A 5IGCA 3D0FA 2VQFQ 3S17H 1Q12A 1BQQT 1CSPA 2SNMA 1LT5D 4HIDA 3NQTA 2C9OA 4KY7A 1MKHA 1NMGA 4UPAA 1CA6A 4DV4Q 1JOQA 2NZHA 2CWAA 1HQRD 1HH2P 3S2DB 3OHXC 3BJUA 3SR1A 2RHSB 3S17B 1BCPC 2EZVA 4JBJA 4ZKBB 2VXWA 4LJZC 4HJ8A 4KK7A 2K5HA 1IW7D 2EY6A 1EWCA 1RF2D 3NWTA 3T16A 2K50A 4RHRA 1K28A 2UUAL 3Q24A 1WTRA 4PG3A 4FYDA 3TP6A 2AHOB 4BY1G 4H0LC 1H95A 1M1KC 2LSSA 1TKWB 2WAQE 2Z0SA 2L15A 2G5DA 2R7ZG 2RHQB 2VB2X 1U9RA 1I94Q 1VQKA 4BXXH 3PGZA 2R6GA 5C5LA 3Q22A 4B9XA 1NSNS 4GOPA 1BVSA 2F0NA 2MNAA 4R8IA 2QA4A 4DUZQ 4GNXA 1KDBA 4LF4Q 4DV5L 1BR9A 3NBIA 2F3VA 5LHY1 4A3EH 5C0XH 5FO9B 3W3AA 1XXGA 1B4OA 2ZXPA 3UDXA 2F4VQ 4IALA 4J1MA 2GA4B 1PH6A 4B3SQ 4OO1G 2K33A 3HKSA 4JI0L 3E0EA 1PHJA 3HOWB 2F3IA 4A3EB 5FLMG 4NDXA 1TWGB 4QUFA 4B3TQ 1BBXC 4DV6L 1X54A 2B2YC 1ILQA 1CKNA 4DV0L 3U9SA 2XNAC 2CW0C 2QDBA 2K28A 1F2LA 4OGQC 3PF5A 2O4XA 1XPUA 3N6RA 4IOAA 2OTJA 4U68A 4YCUA 1Y8NB 5DNFA 4R9WA 1IBKL 5K36G 1B44D 1CQVA 1VQ6A 4A3BH 5ELOA 3NUCA 3KLSA 1II3A 3NHHA 1ESRA 4A3DG 3H0GG 1KLUD 1VQ8A 5JPNC 1YITA 1EY4A 4IUUA 3KF6A 2ATWA 3AYHB 2BH2A 2E74C 2KCMA 2ZTDA 2WIIB 4A3BB 1S4ZA 4B08A 3K7AB 4ZQ3A 3SK4A 1VQ5A 2R92B 2OQKA 3J81j 2IY5B 3NTHA 1V8QA 3PO2G 4DF7A 2HUGA 4IFDI 1AE2A 3HOXH 4AYBE 3J81i
chains in the Genus database with same CATH topology
2EY5A 1WTQA 4DNTB 1PLFA 1XYIA 2IWHA 2K7VA 3DEOA 4KY5A 3G7LA 1AZPA 1AW7A 3HKZB 3IL8A 4C56C 1RKNA 2EJGC 5JVH3 4V0BA 4DFAA 1ESFA 1SYFA 1SMYC 1HRJA 1CZWA 3RMHA 4KI0A 3TP8A 1OXTA 1W6JA 3EROA 3VYSA 2A68D 2B8GA 3J81E 5CV8A 3M4YA 2EYLA 5CV4A 2F0VA 1R9TB 1Q90A 4RHSA 4Q0FA 3J80E 2F0KA 2Z4HA 1H9SB 1MD2D 4X3KA 1VMCA 4CKEA 1D5ZC 4K5XA 3SK5A 4DU9A 5JEAH 3RZDB 2Z8LA 4G7HC 3HZXA 3KK7A 1QB5D 1F2ZA 3NQIA 3OPOA 1XWEA 3CKIB 1RD9D 4DNRB 5EPLA 3H3VC 1STBA 4WORA 1Z6HA 5C4XB 3UI2A 1MSGA 2IX0A 4F88A 3K5NA 1H9MA 1NUCA 1LT6D 2A6EC 1D2BA 4CKBA 3HOZB 3TZDA 5FOBB 1FGBD 4C2MB 1LTAD 1LV9A 1OXXK 1A15A 2K6AA 1O7LA 2PNRC 3V96A 1TS4A 2F0PA 2NVXB 5CGKA 4DK0A 3GD7A 5JAVA 3K5MA 2XRSD 3T13A 2WB1B 4XQNA 4DXGA 3PV0A 5D3DA 4A3DB 2OEOA 3KLSX 1PFMA 4OHJA 1BOSA 3MXPA 3GTQB 4KMUC 3T51B 1ICWA 1X32A 1KDCA 1UUPA 4HCSA 1O7YA 3CRKC 1E2ZA 2BDOA 5A2QL 3MWYW 4N9PA 1EY0A 2F0SA 2DY7A 2HCCA 1XTCD 3D6WA 3CU7A 1B50A 4HR7B 2FFKB 2OXPA 5ELBA 4HCEA 1CK1A 5IODA 5EBCA 1KAAA 1LTRD 1AZQA 1KDAA 3BG3A 1G91A 5I4DA 3HGBA 2M2LA 2L4NA 3FPPA 2ZXRA 1DOLA 2E2DC 1EOTA 1K8OA 5FK9C 2OT2A 5ELEA 4U673 1SE3A 1HCZA 1LTSD 3QG1A 2KVMA 2MP1A 3OWFA 2E75C 2N88A 3M4OB 1QNUA 3K5OA 1SE2A 1I4HA 1JWUD 4EQPA 3BVMA 1QCBD 2EYMA 3I3CA 3IFDA 1SNDA 5C4ZA 4H44C 1WD1A 1LT4D 3C2PA 4J8QA 2CW0D 1EYCA 2WKCA 3ONAB 5I6WA 4DXFA 1GHKA 3TP5A 1EIHA 3VA5A 5NUCA 1I6HB 3U9OA 1EEID 3DHQA 1SYDA 2VUMB 1HFGA 4LAAA 1B9MA 4KKSA 3ITPA 1Y1WB 2EE1A 4KJOA 3CRLC 1CQFA 4QIWB 4O1NA 1LABA 2B2YA 2A69C 2K5QA 4RGNA 4F8MA 4WFN3 2AWOA 1HA5A 5M5XB 2EVBA 2Q8TA 3D4RA 1S5BD 3QIAA 3RD4A 1SDFA 1UNSA 1TIID 1RCVD 3GO5A 3VYTA 1H9SA 1I4GA 2SDFA 3C3LA 3VR3A 2YYZA 4G57A 2AUKA 1SMYD 4KJNA 3BVZA 1FNVA 3D8GA 2B2UC 3R8BA 3I4LA 4CJ1B 5CV7A 2LY7A 5IT9L 3E5SA 5CBAE 3S9WA 1OXSC 2EYPA 1HPCA 2K01A 4A3JB 1TWHB 4KHZA 4OL7A 2E2JB 3DWAA 1RDPD 4PMCA 2RQXA 5EPKA 1TS2A 4C3HB 1DYQA 1F77A 5C0XI 1R4QB 2A6ED 2LS01 2RVLA 2O2LD 4QUCA 3Q23A 3SE0A 3DXJC 3N52A 2KHSA 5CC4A 4ZKCB 1PZJD 4M1UB 4TRDA 1SNOA 2PMZB 2VB3X 2HDLA 2FMCA 4V190 4WRDA 1ZYRC 5KEEA 1NCVA 4GZYC 2JEAI 3OW7A 4K8IA 4DAYA 1EL0A 5I6YA 2XWJB 2NTSA 1PZID 1CA5A 3A55A 1C8CA 4KKTA 4DN4M 1Z7TA 5KYIA 3LWUA 4HEDA 1GUWA 3FEWX 1X3PA 1DJRD 1V43A 1J8IA 3S15B 4FO2A 3D6CA 4JBWA 3GTJB 1WTXA 3NPPA 1M8AA 2D62A 2KA7A 3I4NB 2M9VA 1EQTA 2EYJA 5KNCA 1CT1D 3Q6SA 3BYYB 1JE4A 2EY1A 3PIO3 1B3AA 1JICA 1G2SA 2MPMA 4O42A 2F0JA 1Y1VB 2ZXOA 4ABNA 1AN8A 3VR5A 3T4AC 3J7AV 3GV3A 1O78A 5KNBA 2FHTA 1HQMC 4A3KB 2PQEA 3R3OA 5K5PA 1B1ZA 4KD4A 4XIGS 4DAVA 2QCPX 2F0FA 4Y7NB 4FXGC 1JWMD 1MSHA 2KOLA 2CVRA 3NSWA 1J9OA 4YIJA 4KN4C 5CMDA 1ENCA 5I2YA 2IX3A 1B53A 1BCPF 1DCZA 2B2WC 2XN9C 4MIUA 4RGMA 1TT2A 4RAUC 2N55A 1WTPA 1EY7A 1PTOC 2E76C 3H94A 1RJTA 1VMPA 3H91A 1AEXA 2JSOA 3EQLC 5C4JB 1L0YB 3J7AF 1OXUA 1U4MA 4TQUS 1DZ1A 4C3IG 4ME5A 3R2TA 3DM1A 1X3QA 2IPKD 2KCCA 3VYUA 5IGFA 2WINB 4UDUC 1WTWA 1I6VC 1BCPB 3S14B 1BXTA 3I73A 5C3EB 1CHQD 1Y8OB 1O80A 4Z9CB 3EVQA 1LT3D 3SXHA 1CTMA 5KYLA 3NP8A 1D1IA 1IHZA 3PMFA 2F0MA 4X3UA 1DM0B 4G4KA 3EJIA 4RH6A 1PTOH 2WP8J 4I65A 2A69D 2DY8A 3FMCA 2B2TC 3K59A 4FXDA 3WOFA 1PYWD 1SSOA 1SJED 2ZT9C 2XIWA 4DGZA 1PTOB 3A8IE 4L8JA 4L63B 1STGA 2AQ1B 3S1RB 2ENBA 4K5WA 3PUXA 1HUMA 2EOTA 4XTCS 1HXYD 2O5IC 1A3VA 4HMIA 4IFDG 4OIKA 3NTIA 3S1QB 5F2DA 1O7ZA 3VR6A 5M5YB 1KTKA 3V05A 1I4QA 4BY1B 4BWGB 5FKAC 1BF4A 4NKLA 2R7ZB 2F0TA 3HG9A 4CJ0B 3D31A 5DEHA 3PUZA 2KEEA 5E1FA 2F1MA 2PW7A 1D5XC 4N9TA 1NR2A 4OO1H 3MEHA 3E6ZX 1ET6A 3SK8A 3P7JA 5EQ0A 2B2UA 1TY0A 1ZYRD 2SNSA 2AQ3B 2Z1CA 1FNUA 3H6MA 2IT1A 4ULLA 1EFID 3SEBA 5K36H 1DONA 4EQOA 1HA6A 3I72A 1A2UA 2KEDA 2LFNA 4R8NA 4E6IA 3P20A 5T1IA 5HGTA 2X69A 1W6KA 1T5EA 2JA7B 2AWNA 2QKIC 3MFYA 3CHBD 2PZWA 1A3UA 4QCLA 3RUZA 4F87A 3H0GB 1E2VA 4FF2A 5IGGA 2RDHA 3A8JE 3ERQA 3K57A 4ZUIA 3K0YA 3I8ZA 5ISRA 1A2TA 3ZYYX 1F2YA 3QWNA 4NMZA 1STNA 3PO2B 2RDFA 1GUOA 1HUNA 1A6XA 1WVLA 4IUQA 3FDTA 3V2TA 1BCPD 2FJ2A 4FF4A 5EBDA 5KGUA 3DMUA 2RSOA 5C4HA 1BO0A 2ID0A 3QO2A 5IGBA 1Q8IA 4KY6A 4C1NK 1V1PA 2JA5B 1RODA 4HTHA 3RZOB 3SHLA 1RHPA 1DD2A 2RKSA 1WCMB 2NN6I 4FVMA 1HHVA 4ZLTF 1OO9B 1R4PB 5G3LD 3WOEA 3KF8A 3C1FA 5KRUA 4G7ZC 5D14A 2K32A 2Z4IA 2WV6D 2Q8RE 1IKLA 3D3RA 2WAQB 5FLXL 5C3WA 1PTOD 4B9WA 4PQXA 4RKBA 5FO8B 2QEJC 1HTPA 3GQBA 1S5DD 3S1NB 4IZ8A 1SYBA 2NN6G 2NBFA 3L7ZC 5A2QE 4LMQD 4HAEA 3W2DA 5ELFA 3DWQA 2JYOA 1SYEA 3SDZA 3QB3A 1LO5D 2F0UA 1QOHA 2NB0A 2EJFC 1ML0D 1YNNC 2RA4A 1LLRD 2B2WA 3KBXA 4A3GB 3AU7A 3E0JA 1I4PA 2DNCA 1EQVA 1Q1EA 1EU4A 2JP1A 1IYVA 4HSPA 3TMEA 1H9RA 2RSNA 2EJMA 1E2WA 1JC7A 2PZTA 4CJ2C 3R93A 3MZ5A 3G6JB 4CHTB 1F9RA 4FNFA 3AB9A 1ILPA 3VR2A 4MHEA 3VR4A 3A7AB 1TWCB 1D1KA 3NWSA 2F0GA 4K6LA 4C3JG 2F0EA 1EZ6A 4OIJA 1SNCA 2H4OA 5BN4A 1KABA 1JOOA 2NWGA 3HS0C 3KBGA 5M3MB 3ND8A 1MBYA 3I90A 4A3MB 1GUTA 3S2HB 1I4RA 3JAML 1FNWA 2KJXA 5EKKA 2L12A 2NVTB 1TQOA 2F0LA 4H7BA 1ENAA 2B2VC 5FO7B 1A3TA 4KHVA 1ONLA 2R3ZA 3LX0A 3K5LA 3MHBA 1F9PA 2K03A 4F7XA 1VF5C 4KV6A 2NVYB 2L5TA 4EQNA 4IURA 5BN5A 2XWBB 4K2KA 1STAA 1KNEA 2B2TA 4PMWA 3BDOA 3D4DA 2MGSA 3QOJA 2K04A 5EJWA 1G6ZA 2KCNA 3NXWA 2BDNA 2EY2A 4X3TA 3ND9A 3C46A 4X3SA 1GJXA 3GV6A 2F0QA 2G9DA 2F0WA 2AQ2B 5ELDA 1JB3A 1ZXTA 4DAPA 3GTLB 3OMCA 5T1GA 1TY2A 3OMGA 3NBHA 2MJ8A 1ZKOA 1AFPA 4CBVA 2BA1A 1C48A 5C3XA 3SK6A 1IYUA 1KLGD 5C0XG 3EFXD 2EXZA 5IT9E 5ELCA 1PMRA 1YNJC 2FMMA 3P1HA 1BUVT 1EY5A 3K58A 1LTTD 1L0XB 1MI2A 4DK1A 5C5MA 1EEFD 3NK9A 2V4DA 1JQYD 4JK1C 3HP3A 5DAUA 2JEBI 2JXMB 1HTLD 1K83B 2F0OA 3C1EA 4XT3B 3OOCA 1SNQA 5CR3A 5M5WB 5D3IB 2SOBA 4C3JB 1CHPD 1SE4A 4KN7C 4XYOA 2DN8A 3MC0B 3OIQA 4WJWA 5JJZA 4G7OC 2X6GA 4FF3A 2C5CA 2J0TD 1S5CD 2RBMA 1C4QA 2IX1A 2MUYA 4A3FB 2K1BA 3MAQA 3KLRA 1OXVA 2PZUA 2K05A 4K14A 1STYA 2B63B 1UAPA 4XYQA 2NVQB 4ZUJA 1QILA 1ET9A 2F0HA 3O13A 1V1PB 3M7GA 3MXNA 3DEPA 4XQQA 4IFDJ 1Q3LA 1U4PA 4LK1C 5COYA 1QG7A 4OO1I 1STEA 1CI3M 2SEBD 3J7YW 2M00A 5KNDA 5G3LF 4K8JA 3IFTA 1NAPA 4RWSC 2BA0A 3PUWA 2F0IA 1SFOB 5JEAG 1FR3A 2K5WA 1CZGA 3BS1A 2A6HC 4XT1B 4MN3A 2AUJD 1PTOF 1GHJA 1Y8PB 1YNND 2L1BA 3A7LA 4J6HA 1SYCA 3M3YB 2TSSA 4P2CB 4K5VA 3L3OC 3OIPA 4NP5A 5DM63 1K8MA 3K6OA 2IW3A 2D5DA 1DXMA 1PFBA 1EYAA 4XXEA 2QILA 2QF7A 3MA2B 1JOKA 1ZEQX 2VNUD 2EYFA 1JR0D 5TSSA 1PDQA 3BYTB 4QF4A 3TP7A 1MGSA 3J81L 2EYOA 4ZRZA 2L0CA 2FINB 3J80L 2F4IA 4BBRB 2X6LA 3I70A 1EY9A 3FVQA 5IGDA 2PO4A 2EYHA 4S3SA 2I07B 4K2LA 2NZ1D 2BCOA 2WACA 1D6EC 3HOXB 3GTKB 5E4XA 3VA7A 2OF1A 2NYZD 4BA1I 3LNNA 1GUGA 2PW5A 1SXTA 1H9KA 4CKCA 1NR4A 1TVXA 2E2IB 3BDLA 1QJOA 1PXUA 3I91A 4A93B 4NW2A 2R61A 2BE5C 3HOVB 2KQ3A 2XSCA 2NTTA 3R2IA 5LL6S 4FXKC 2F0DA 2B2VA 4C3IB 3TSSA 2ICEC 2IJ0A 2ICIA 1VF7A 2K5DA 1IL8A 5CBEE 3WDNA 4L6TB 2B39A 3BZDB 4H13C 3L9AX 3IKJA 4IQZA 3PUYA 1G8ZD 1S5FD 1U4LA 1YNJD 2BOSA 3M85A 3DWPA 4A3IB 4RCNA 2A5HA 3GTOB 4IUTA 3S16B 5JOBA 3OSOA 5KIXA 1LTBD 1EIGA 2YU9B 3FKIB 5EKLA 3TN2A 4K6DA 2JA8B 1WD0A 2I46A 1JWSD 4Q5VA 3HRZC 3D4WA 1EZ8A 1G291 1BNZA 1WTVA 3GP7A 5CORA 1GOZA 1LTGD 2IL8A 1PRTC 5J22A 4ILWA 4IUNA 3PO3B 3H09A 1E0BA 2Y0SB 5M9OA 2R93B 1I3QB 4XQJA 4IFDH 5LL6X 1PZKD 2A73B 1KNAA 3TBIB 1RTNA 3Q0AA 2Q8IB 2XVSA 4EVOA 3VYRA 1EWHA 3NE5B 4DA2A 1PRTF 5CV6A 1H9JA 1SAPA 2J7ZA 3F2UA 4RCOA 1FYCA 1LACA 1IW7C 3PIP3 5E4WC 3MVVA 2G9HD 1SJHD 2XRQD 2L9HA 5DM73 3FPUB 4KD3A 4KKUA 2DNEA 3TDQA 3A56A 1LTID 5CV5A 3P75A 2D2CC 4RGOS 5M3FB 1T5XD 3M7NA 4EGVA 1VCIA 1GUSA 4C3HG 1UEAB 5AFWA 5I9OA 1TS5A 1EY6A 2A6HD 3HOYB 1B2TA 3HOUB 4BBSB 1F2MA 1SNPA 4RA8A 1PRTB 3QOLA 5CYUA 1G2TA 4PNYA 4PV1C 1STHA 4M8AA 4ODGA 4HN7A 5JPMC 1V1OA 3BDCA 1CFMA 1TWFB 1JORA 2CQAA 5EKIA 5EPJA 2MHVA 3T56B 1CM9A 1Y69U 5I2XA 1JCKB 1IKMA 2PCFB 1TR5A 1TWAB 3SVMA 3KUPA 1F9QA 5FLXE 4I7ZC 4RKLA 3AMUA 2D9UA 5C0XJ 2L55A 1M4VA 3MFGA 4IUVA 4BY7B 2CHBD 1ENFA 3MXGA 4ID6A 3MXUA 1QNKA 4AYBB 4ZK9B 1DOMA 3NTKA 1SYGA 1GXDC 2WKDA 1QE6A 2H1EA 4ZAIA 1RTOA 3FRPB 5D65A 3X3NA 4TSSA 3GTPB 5IIFA 2JA6B 3S1MB 3TZUA 5C6AA 5EGTA 3QJYA 1FD7D 2NUCA 2HQEA 3RLFA 1TS3A 1AP0A 4HSVA 1EU3A 3EA6A 2LMCB 5J1ZA 3T53B 2TMPA 5A35A 1SNMA 1HFNA 3BVGA 3CQZB 4CGYB 3GTMB 1U4RA 2KECA 2HCIA 2F03A 2PPBC 1TU2B 2NN6H 4PMBA 5JVG3 1VDZA 2O5JC 2EDGA 1Q1BA 3OWEB 1QWYA 4KTAA 2BE5D 2A68C 1XX8A 4QB4A 3URYA 2PYKA 3PUVA 3A8KE 4UAIA 1BDOA 1Z47A 2JE6I 3I4MB 3JAME 1EY8A 5HURA 2L11A 2J4XA 3IAYA 4XDXA 1SBBB 4IUPA 5J39A 4QMGA 5CV9A 1F9SA 1SEBD 3DUZA 4FP5D 1I50B 4TKOB 4RFBA 1B9NA 1D5MC 5BN3A 2EPBA 5JEAJ 4BA2I 2KUMA 2RDGA 3HEJA 3LWEA 3A54A 2LKVA 3MTSA 5C44B 5IOCA 2A74C 2B8FA 1PFNA 5IGEA 1EYDA 1DOKA 5E3FA 1WTOA 3X3MA 1PRTD 4BS9A 1GUNA 1I4XA 4C1NI 5I9PA 2F3WA 4RGTA 4ZYSA 4IN3A 2E2HB 2HDMA 1S5ED 4HMJA 3GTGB 4FF1A 5IGCA 1Q12A 1BQQT 2SNMA 1LT5D 3NQTA 2C9OA 4KY7A 1CA6A 1JOQA 1HQRD 3S2DB 3OHXC 3SR1A 3S17B 1BCPC 2EZVA 4ZKBB 2VXWA 4LJZC 4KK7A 1IW7D 2EY6A 1EWCA 1RF2D 3NWTA 3T16A 4RHRA 3Q24A 1WTRA 4FYDA 3TP6A 4H0LC 1TKWB 2VB2X 1U9RA 2R6GA 5C5LA 3Q22A 4B9XA 1NSNS 2F0NA 4R8IA 1KDBA 1BR9A 3NBIA 2F3VA 5LHY1 5C0XH 5FO9B 3W3AA 1XXGA 1B4OA 2ZXPA 4IALA 4J1MA 2GA4B 4OO1G 2K33A 3HOWB 4A3EB 4NDXA 1TWGB 4QUFA 1BBXC 2B2YC 1ILQA 3U9SA 2XNAC 2CW0C 2QDBA 2K28A 1F2LA 4OGQC 2O4XA 3N6RA 4U68A 1Y8NB 5DNFA 4R9WA 5K36G 1B44D 1CQVA 3NUCA 3KLSA 1II3A 3NHHA 1ESRA 1KLUD 5JPNC 1EY4A 4IUUA 2E74C 2WIIB 4A3BB 1S4ZA 4B08A 3K7AB 4ZQ3A 3SK4A 2R92B 3NTHA 1V8QA 4DF7A 2HUGA 4IFDI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY5 A;  2F0J A;  4RKL A;  2EYM A;  5C5M A;  3E5S A;  5M9O A;  3BDL A;  3EVQ A;  3SXH A;  1SND A;  3NK9 A;  3TP6 A;  5JAV A;  5C4Z A;  5KYL A;  3S9W A;  3NP8 A;  2SNS A;  3T13 A;  5J39 A;  2EYP A;  1IHZ A;  3H6M A;  3PMF A;  4QMG A;  2F0M A;  4KY5 A;  5DAU A;  4OL7 A;  4B9W A;  5C3W A;  5CV9 A;  5EKK A;  2OEO A;  4J6H A;  1U9R A;  4RKB A;  1TQO A;  2F0L A;  2PQE A;  3EJI A;  3R3O A;  4H7B A;  1SYC A;  1ENA A;  2F0O A;  4EVO A;  4PMC A;  5K5P A;  1EYC A;  4KD4 A;  3C1E A;  1A3T A;  5I6W A;  4KHV A;  3MXP A;  5C5L A;  4IZ8 A;  4K5V A;  2KQ3 A;  4EQO A;  1SYB A;  4B9X A;  1RKN A;  1SNQ A;  5CR3 A;  3TP5 A;  4I65 A;  5CV6 A;  2F0F A;  4DFA A;  1A2U A;  1NSN S;  3LX0 A;  2F0N A;  3MHB A;  3VA5 A;  4R8N A;  4ID6 A;  2SOB A;  4NP5 A;  1SYF A;  2F0D A;  1KDB A;  4E6I A;  4F7X A;  4KV6 A;  4YIJ A;  4DGZ A;  5NUC A;  5HGT A;  4EQN A;  2F3V A;  3HEJ A;  3U9O A;  1SYG A;  1EYA A;  1KDC A;  3TP8 A;  4K2K A;  3ERO A;  1SYE A;  1STA A;  2LKV A;  1STG A;  2PZW A;  3D4D A;  1A3U A;  2KHS A;  4IAL A;  4J1M A;  3RUZ A;  5IOC A;  1ENC A;  3MVV A;  3DHQ A;  3QOJ A;  1SYD A;  5CC4 A;  3QB3 A;  4TRD A;  4N9P A;  1JOK A;  1SNO A;  2ENB A;  5CV8 A;  4KD3 A;  2EYL A;  5IGG A;  2F0U A;  3NXW A;  2F0V A;  1EY0 A;  4K5W A;  5CV4 A;  5IGE A;  2F0S A;  2EY2 A;  3ERQ A;  5IIF A;  2EYF A;  2F0K A;  4LAA A;  4MIU A;  1EYD A;  4ZUI A;  1TT2 A;  5C6A A;  4NDX A;  2RBM A;  4QF4 A;  4WRD A;  3ITP A;  5EGT A;  3TP7 A;  2NUC A;  5E3F A;  5KEE A;  5ISR A;  5CV5 A;  1A2T A;  4K5X A;  3P75 A;  3SK5 A;  4K8I A;  4DU9 A;  2HQE A;  2F0Q A;  1A3V A;  2F0W A;  4HMI A;  1EY7 A;  3HZX A;  5I6Y A;  2EYO A;  4KJO A;  1AEX A;  5J1Z A;  1F2Z A;  2OXP A;  2QDB A;  5F2D A;  5I9O A;  1F2Y A;  2O4X A;  1STB A;  1STN A;  4NMZ A;  4WOR A;  2PZU A;  1EQV A;  2RDF A;  1SNM A;  3OMC A;  4K14 A;  1STY A;  5I9P A;  5IOD A;  2F3W A;  1KAA A;  5KYI A;  4ME5 A;  5JOB A;  4F8M A;  1EY6 A;  3TME A;  3OMG A;  4HMJ A;  1NUC A;  2PZT A;  1EY9 A;  1KDA A;  3NUC A;  3OSO A;  3V2T A;  1F2M A;  5IGC A;  5KIX A;  1SNP A;  4ZUJ A;  5EKL A;  1II3 A;  3NHH A;  4PMB A;  5IGD A;  2SNM A;  3MZ5 A;  3QOL A;  5KGU A;  3DMU A;  2EYH A;  4NKL A;  2F0H A;  3NQT A;  4K6D A;  4KTA A;  4KY7 A;  4S3S A;  4PNY A;  5C4H A;  1JOQ A;  2F0T A;  4K2L A;  1EY4 A;  5C3X A;  5IGB A;  4QB4 A;  3SK6 A;  1STH A;  5IGF A;  2WAC A;  4KY6 A;  3D4W A;  3D6C A;  4ODG A;  2PYK A;  1EZ8 A;  3SR1 A;  4HTH A;  5DEH A;  4ZQ3 A;  3BDC A;  3SK4 A;  4G57 A;  2EXZ A;  3SHL A;  5E1F A;  1JOR A;  4KJN A;  2PW7 A;  2EYJ A;  2RKS A;  2M00 A;  2F0G A;  4N9T A;  4K8J A;  2F0E A;  3OWF A;  1EZ6 A;  1TR5 A;  1SNC A;  3MEH A;  3D8G A;  2EY1 A;  5J22 A;  1EY8 A;  5HUR A;  2EY6 A;  1KAB A;  4IUN A;  2OF1 A;  3C1F A;  3P1H A;  5KRU A;  1JOO A;  5CV7 A;  2F0P A;  3T16 A;  4DF7 A;  1EY5 A;  4EQP A;  2PW5 A;  2F0I A;  3SK8 A;  5CGK A; 
#chains in the Genus database with same CATH topology
 2EY5 A;  1WTQ A;  5IE8 A;  4DNT B;  1PLF A;  1XYI A;  3J80 i;  2IWH A;  2K7V A;  1SR3 A;  3DEO A;  4KY5 A;  3G7L A;  1AZP A;  1AW7 A;  3HKZ B;  3IL8 A;  2JA5 G;  4C56 C;  1XPR A;  1RKN A;  2EJG C;  5JVH 3;  4V0B A;  4CDC C;  4DFA A;  4DV6 Q;  4LF8 L;  3DM3 A;  1WCM G;  1ESF A;  2MO0 A;  1SYF A;  1SMY C;  1HRJ A;  2D0P A;  1R9T H;  3HOV H;  3F8T A;  1CZW A;  3RMH A;  4DUY Q;  4KI0 A;  3TP8 A;  4JV5 L;  1OXT A;  1W6J A;  3ERO A;  3VYS A;  1Q7Y C;  2A68 D;  3RZD H;  1IBK Q;  3J81 c;  2B8G A;  3J81 E;  1JE5 A;  5CV8 A;  3M4Y A;  2EYL A;  1PYS B;  5CV4 A;  2F0V A;  1R9T B;  1Q90 A;  4RHS A;  4Q0F A;  3J80 c;  4IPG A;  3J80 E;  2F0K A;  4A3L H;  2Z4H A;  1H9S B;  1MD2 D;  4X3K A;  1VMC A;  4JPB W;  3KDF A;  1D5Z C;  4CKE A;  5C4X H;  4K5X A;  3SK5 A;  4DU9 A;  1VQE A;  5JEA H;  3RZD B;  2Z8L A;  4G7H C;  3HZX A;  3KK7 A;  1QB5 D;  1F2Z A;  3OPO A;  3NQI A;  1XWE A;  3CKI B;  1RD9 D;  4DNI A;  4DNR B;  4AQY Q;  3HOZ H;  5EPL A;  3H3V C;  1STB A;  4WOR A;  1Z6H A;  5C4X B;  4GLX A;  3UI2 A;  1MSG A;  2IX0 A;  4F88 A;  3K5N A;  1H9M A;  1NUC A;  1LT6 D;  2A6E C;  4IJL A;  1SRO A;  1VQO A;  1RL2 A;  1D2B A;  4CKB A;  3HOZ B;  1IXR A;  3TZD A;  3DLL A;  1LM0 A;  5FOB B;  4GKJ Q;  1FGB D;  2PNH A;  3SGI A;  4C2M B;  1LTA D;  1LV9 A;  2YU9 H;  3FKI H;  1OXX K;  2B3G A;  4UY8 C;  2NVX H;  1WOC A;  2A1A A;  1A15 A;  1QVF A;  2K6A A;  1M90 C;  1O7L A;  2QDL A;  2PNR C;  4DV1 L;  1MHW C;  1CSQ A;  3V96 A;  4LF9 L;  1TS4 A;  4KLK A;  1YJW A;  2F0P A;  3KJO A;  1JJ2 A;  1FGU A;  2NVX B;  5CGK A;  2GN5 A;  2ZTC A;  4HIK A;  1XNR L;  4DK0 A;  3BZK A;  3GD7 A;  5JAV A;  2VUM G;  3K5M A;  2XRS D;  3T13 A;  2WB1 B;  3GTQ H;  1N8R C;  4JV5 Q;  1L0W A;  4XQN A;  4DXG A;  3PV0 A;  5D3D A;  4A3D B;  2OEO A;  3KLS X;  1PFM A;  4MTN A;  2R93 H;  3K80 C;  1BOS A;  1V9P A;  4OHJ A;  4LFA L;  3MXP A;  4DAY B;  3GTQ B;  1XMO L;  4YHH L;  4KMU C;  3Q8D A;  3VDY A;  3T51 B;  4WJ3 M;  2K5V A;  3CCR A;  4JI4 Q;  1ICW A;  1X32 A;  1KDC A;  5IWA Q;  1UUP A;  4HCS A;  1O7Y A;  3CRK C;  1E2Z A;  2BDO A;  4OX9 Q;  5M3M G;  5A2Q L;  3MWY W;  4N9P A;  1JJC B;  4DV7 L;  1EY0 A;  2P5Z X;  4A3M G;  2F0S A;  4YWL A;  2DY7 A;  2HCC A;  4JI8 L;  1XTC D;  3D6W A;  3CU7 A;  3NEL A;  1MIU A;  1B50 A;  4HR7 B;  2PI2 E;  2FFK B;  4OWT B;  1EWI A;  2OXP A;  5ELB A;  1V1Q A;  4HCE A;  1CK1 A;  3PIP A;  1X9N A;  4LUO A;  3B6Y A;  5EBC A;  1KAA A;  5IOD A;  1LTR D;  1AZQ A;  4NXN L;  1KDA A;  3BG3 A;  3AEV A;  1G91 A;  2PQA A;  5I4D A;  4A3J G;  3F2B A;  3HGB A;  2KEN A;  4DR6 L;  4NPS A;  2IHE A;  3G48 A;  2M2L A;  1VQ9 A;  2L4N A;  1N34 Q;  3FPP A;  2ZXR A;  3M4O H;  1DOL A;  2VQE Q;  1HZA A;  4BBS H;  2E2D C;  1EOT A;  1K8O A;  5FK9 C;  2OT2 A;  1NE3 A;  5ELE A;  1K0S A;  4U67 3;  1SE3 A;  2XTI A;  1HCZ A;  1LTS D;  3QG1 A;  2KVM A;  2MP1 A;  4ME3 A;  4N8X 1;  3OWF A;  2E75 C;  2N88 A;  3M4O B;  4UP7 A;  1QNU A;  2LXJ A;  3K5O A;  1XMO Q;  1SE2 A;  3CP0 A;  1I4H A;  1JWU D;  4HIM A;  4EQP A;  3BVM A;  2KHI A;  1QCB D;  1EOV A;  2EYM A;  3I3C A;  1PH5 A;  3IFD A;  5JJI A;  1SND A;  1TWA H;  5C4Z A;  3ERS X;  4H44 C;  1GVP A;  1WD1 A;  1LT4 D;  2OTL A;  3C2P A;  4J8Q A;  2CW0 D;  1XMQ Q;  1KL9 A;  1EYC A;  2WKC A;  3ONA B;  5I6W A;  1LUZ A;  4GOP B;  4DXF A;  1I6H H;  4JI8 Q;  1GHK A;  4DR4 L;  3TP5 A;  1L1O C;  1EIH A;  2CQO A;  1Q82 C;  3VA5 A;  2I5M X;  2FXQ A;  3U50 C;  4GS3 A;  1JJG A;  5NUC A;  2UU9 L;  1I6H B;  3U9O A;  1Y1W H;  1EEI D;  2CFM A;  4GKK Q;  3I7F A;  3DHQ A;  1SYD A;  2E8G A;  2VUM B;  1HFG A;  2DUD A;  4LAA A;  1B9M A;  3BU2 A;  4KKS A;  1CKN B;  3ITP A;  1Y1W B;  3I4N G;  1YJN A;  2UXC L;  5M5X H;  2EE1 A;  1QVG A;  3GTP H;  4KJO A;  3NEM A;  3CRL C;  3L2P A;  1CQF A;  2F52 A;  4P73 A;  4O1N A;  4QIW B;  4DR1 L;  1IBM Q;  1LAB A;  2B2Y A;  1K73 C;  2A69 C;  4QQB X;  1ICF B;  1Y1V G;  2K5Q A;  4RGN A;  3PCO B;  4F8M A;  2AWO A;  4WFN 3;  1HA5 A;  4JI1 L;  5M5X B;  2EVB A;  2Q8T A;  3D4R A;  1S5B D;  3QIA A;  3RD4 A;  1SDF A;  2EIF A;  3KF6 B;  1UNS A;  4A3K G;  1TII D;  3CQZ H;  1RCV D;  1Q86 C;  3GO5 A;  3VYT A;  1H9S A;  1I4G A;  2SDF A;  3C3L A;  4DV2 L;  3VR3 A;  2YYZ A;  4JI5 L;  4G57 A;  4A3F G;  2AUK A;  4GN3 B;  1SMY D;  4KJN A;  3ZJY C;  3BVZ A;  1JB7 A;  1T9H A;  1D8L A;  1FNV A;  3D8G A;  3S24 A;  3W1B A;  2B2U C;  2NZO A;  3E9I A;  3R8B A;  4DR4 Q;  3I4L A;  4CJ1 B;  5CV7 A;  5LMN L;  1TWH H;  1VQA A;  3F2C A;  2E2J H;  2LY7 A;  2CKZ B;  2B63 G;  5IT9 L;  3A5Z B;  3E5S A;  1S72 A;  4QY7 A;  5CBA E;  3S9W A;  4OXP A;  1OXS C;  4C3H H;  2EYP A;  1HPC A;  2K01 A;  4A3J B;  2VY3 A;  2HHH Q;  1TWH B;  4X65 L;  4KHZ A;  4OL7 A;  2E2J B;  3DWA A;  1RDP D;  2Q2H A;  2Q2I A;  4PMC A;  2RQX A;  5EPK A;  4L5R C;  1TS2 A;  4C3H B;  1E1T A;  1DYQ A;  1F77 A;  2VQF L;  5C0X I;  1R4Q B;  2A6E D;  1UE1 A;  2LS0 1;  4DV4 L;  2RVL A;  2O2L D;  4QUC A;  3A0J A;  1QVC A;  3Q23 A;  2CWP A;  2ZJQ A;  3SE0 A;  1I50 H;  3DXJ C;  3N52 A;  4R4O A;  2KHS A;  3KOJ A;  5CC4 A;  4ZKC B;  1PZJ D;  4M1U B;  4TRD A;  1SNO A;  2VL6 A;  2PMZ B;  3CPF A;  3KDF B;  2VB3 X;  1UE6 A;  2HDL A;  2FMC A;  4V19 0;  1KHI A;  4WRD A;  1ZYR C;  5KEE A;  1NCV A;  1HZ9 A;  2YTX A;  5C44 H;  4GZY C;  2JEA I;  4DR2 Q;  3RN5 A;  3OW7 A;  4K8I A;  4KHP Q;  4DAY A;  4DV2 Q;  1EL0 A;  3RLO A;  4AIM A;  5I6Y A;  2XWJ B;  3CMA A;  4JI5 Q;  4MNO A;  2MO1 A;  2NTS A;  1PZI D;  1CA5 A;  3A55 A;  3S15 H;  1C8C A;  4KKT A;  1BKB A;  4DN4 M;  1Z7T A;  5KYI A;  5BR8 L;  5J3B A;  3LWU A;  4HED A;  1GUW A;  3FEW X;  1X3P A;  5LMN Q;  2K52 A;  1DJR D;  1V43 A;  1J8I A;  2ZJP A;  3S15 B;  5IP9 G;  4FO2 A;  4DUZ L;  2WB1 E;  3D6C A;  4LF4 L;  3GTG H;  2CH4 W;  4JBW A;  1HNZ Q;  3GTJ B;  1WTX A;  3NPP A;  4P75 A;  1M8A A;  2D62 A;  2KA7 A;  3I4N B;  2M9V A;  1EQT A;  2EYJ A;  5KNC A;  4IPC A;  5IP7 G;  1CT1 D;  3Q6S A;  3WWV A;  3S2D H;  3BYY B;  1JE4 A;  2EY1 A;  3PIO 3;  1B3A A;  1JIC A;  1G2S A;  3I4O A;  2MPM A;  4O42 A;  4BBR G;  1VQC A;  4B3T L;  4B3M L;  2F0J A;  2Y0S E;  4MZ9 A;  1Y1V B;  2ZXO A;  4ABN A;  5JJL A;  1AN8 A;  3VR5 A;  5FJ8 H;  3T4A C;  3J7A V;  3GV3 A;  1O78 A;  5IYB G;  5KNB A;  4Y7N H;  2FHT A;  1HQM C;  4A3K B;  4R4C A;  5EAY A;  2PQE A;  3R3O A;  5K5P A;  1B1Z A;  4KD4 A;  4XIG S;  2RCF A;  4DAV A;  3K8A A;  2QCP X;  2F0F A;  4Y7N B;  4FXG C;  1JWM D;  1MSH A;  1XTD A;  2KOL A;  2CVR A;  3NSW A;  1FJG L;  2N78 A;  1ASY A;  2HT1 A;  1J9O A;  1K9M C;  4YIJ A;  4KN4 C;  3IRB A;  2BH8 A;  5H1S E;  5CMD A;  1GD7 A;  4DK6 C;  1ENC A;  5I2Y A;  4P72 A;  1B53 A;  5BR8 Q;  2IX3 A;  1BCP F;  1DCZ A;  4R1J A;  1VQI A;  2B2W C;  1CKM A;  1U0L A;  2XN9 C;  4MIU A;  4RGM A;  1TT2 A;  4RAU C;  4HJ9 A;  3TRZ A;  2N55 A;  4A93 G;  1WTP A;  1E1O A;  1EY7 A;  1PTO C;  2E76 C;  3H94 A;  4LW1 A;  1RJT A;  1VMP A;  3H91 A;  1C7Y A;  1AEX A;  2JSO A;  3EQL C;  5C4J B;  1VQ4 A;  3HOW H;  1A62 A;  4JI3 L;  1L0Y B;  1TWG H;  4ZCK A;  3J7A F;  1OXU A;  1U4M A;  4TQU S;  1DZ1 A;  3M4P A;  1UEB A;  4C3I G;  2PQA B;  4ME5 A;  3R2T A;  2A8V A;  1IBL Q;  3DM1 A;  1YIJ A;  4B3M Q;  2ZM6 L;  4HJA A;  3S14 H;  1JT8 A;  1X3Q A;  2IPK D;  2KCC A;  3VYU A;  5IGF A;  2V1C C;  2WIN B;  5C3E H;  1W3S A;  4DUY L;  4UDU C;  1YHQ A;  1WTW A;  1I6V C;  1BCP B;  3S14 B;  4A3I G;  1PYB A;  4HJ5 A;  2I0Q A;  3J7A 5;  1BXT A;  3I73 A;  4GN5 A;  5C3E B;  2JA7 G;  1CHQ D;  3K7A H;  2R92 H;  1FJG Q;  3H15 A;  2CH4 A;  3BZC A;  4GLV B;  1Y8O B;  1O80 A;  4Z9C B;  3EVQ A;  1LT3 D;  3SXH A;  3UDG A;  1CTM A;  5KYL A;  3NP8 A;  1D1I A;  3CCU A;  1IHZ A;  4AQY L;  3PMF A;  2JA8 G;  1RIP A;  2F0M A;  4X3U A;  1DM0 B;  4CDF C;  4G4K A;  3EJI A;  4JBM A;  4RH6 A;  1PTO H;  2JJQ A;  4HJ7 A;  2WP8 J;  4I65 A;  2A69 D;  2DY8 A;  3FMC A;  2B2T C;  3K59 A;  4FXD A;  3WOF A;  1PYW D;  5IY0 A;  3K81 C;  3S1R H;  1SSO A;  1SJE D;  2ZT9 C;  2XIW A;  2QGQ A;  4A3C G;  4DGZ A;  3PSI A;  1PTO B;  3A8I E;  4GKJ L;  1K3R A;  4QIW E;  4L8J A;  4JI3 Q;  4L63 B;  1L1O A;  3PO3 G;  1STG A;  4LWC A;  4K0K Q;  1GKH A;  4LF6 L;  2AQ1 B;  3S1R B;  2ENB A;  4K5W A;  3PUX A;  3S1Q H;  1AH9 A;  2JN4 A;  3E9H A;  1HUM A;  2EOT A;  4XTC S;  1HXY D;  2ZM6 Q;  2O5I C;  3JC6 6;  3TEH B;  1A3V A;  4HMI A;  4NB3 A;  4OWW B;  1XJV A;  3AFQ A;  1N36 Q;  1Q8K A;  4IFD G;  4OIK A;  3NTI A;  4BY1 H;  4LF7 L;  1NMF A;  4YWK A;  1HZC A;  3S1Q B;  1UE5 A;  2D0O A;  5F2D A;  2YTY A;  1JMC A;  1VQP A;  2R7Z H;  5E7N A;  4LFB L;  1O7Z A;  3VR6 A;  5M5Y B;  1KTK A;  1B70 B;  3V05 A;  1I4Q A;  4BY1 B;  2N3S A;  4BWG B;  5FKA C;  2RF4 A;  1BF4 A;  1SN8 A;  2WAQ G;  1N9W A;  4NKL A;  3T1H L;  2R7Z B;  2F0T A;  3HG9 A;  4CJ0 B;  2Z6K C;  1YBY A;  4UHV A;  3D31 A;  3I2Z A;  4JI4 L;  3ULJ A;  5DEH A;  3PUZ A;  2KEE A;  5E1F A;  2UUB L;  2F1M A;  4PZ8 A;  5M3F G;  5IWA L;  2PW7 A;  1D5X C;  4N9T A;  1X3E A;  4OX9 L;  1NR2 A;  4OO1 H;  3MEH A;  3FHW A;  3E6Z X;  4C2M H;  1ET6 A;  1YJ9 A;  5IYD G;  1E7Z A;  5FLM H;  3SK8 A;  1UE7 A;  3P7J A;  1WFQ A;  5EQ0 A;  3HOY G;  2B2U A;  1TY0 A;  3HOU G;  1TXY A;  1ZYR D;  2SNS A;  2AQ3 B;  2Z1C A;  2VW9 A;  1FNU A;  1NNX A;  1X65 A;  3H6M A;  3W1G A;  4LF6 Q;  2IT1 A;  4JG2 A;  4ULL A;  1EFI D;  3SEB A;  4A3G G;  5K36 H;  1DON A;  4EQO A;  1HA6 A;  1XNQ Q;  3I72 A;  1A2U A;  2KED A;  2LFN A;  4A3D H;  2RCN A;  3H0G H;  4R8N A;  1EQQ A;  2VZA A;  4E6I A;  3P20 A;  1N34 L;  5T1I A;  4LF7 Q;  2X69 A;  5HGT A;  1W6K A;  2DGY A;  1T5E A;  2JA7 B;  2VQE L;  2AWN A;  2QKI C;  3MFY A;  3CHB D;  2PZW A;  4LUV A;  1A3U A;  3NBH B;  3RUZ A;  4F87 A;  4LFB Q;  4QCL A;  3H0G B;  1E2V A;  4FF2 A;  1KQS A;  5IGG A;  1EUJ A;  1J5E Q;  2RDH A;  3A8J E;  3ERQ A;  3K57 A;  4ZUI A;  3K0Y A;  3I8Z A;  3PO2 H;  1AE3 A;  5ISR A;  3T1H Q;  1A2T A;  3H3V H;  4BY7 G;  1EFW A;  1EYG A;  3ZYY X;  1CKO A;  1F2Y A;  3QWN A;  4NMZ A;  1STN A;  2UUB Q;  3PO2 B;  2RDF A;  1GUO A;  4AYB G;  1HUN A;  4GLA C;  1A6X A;  1WVL A;  4IUQ A;  2JA5 H;  3FDT A;  3V2T A;  1XMQ L;  1BCP D;  3RZO H;  2FJ2 A;  4FF4 A;  5EBD A;  5KGU A;  3DMU A;  2RSO A;  5C4H A;  1BO0 A;  3M9B A;  1WCM H;  2ID0 A;  3QO2 A;  3UDI A;  5IGB A;  1Q8I A;  1IZ6 A;  1MJE A;  4KY6 A;  2JA6 G;  4PZ7 A;  1V1P A;  4C1N K;  2JA5 B;  1ROD A;  4HTH A;  1A0I A;  3RZO B;  3K7U C;  5IYC G;  3SHL A;  3MEF A;  2Z9H A;  1RHP A;  1DD2 A;  2RKS A;  4EX5 A;  1WCM B;  3CCL A;  4GKK L;  2NN6 I;  4FVM A;  1HNX L;  1W2B A;  1HHV A;  4ZLT F;  1OO9 B;  1R4P B;  5G3L D;  3WOE A;  3KF8 A;  3C1F A;  3I56 A;  5KRU A;  4JBK A;  4G7Z C;  5D14 A;  2K32 A;  2Z4I A;  2WV6 D;  1KD1 C;  2Q8R E;  3S1N H;  3CCM A;  4DR7 L;  1IKL A;  3D3R A;  2WAQ B;  5FLX L;  2WFW A;  5C3W A;  1PTO D;  4B9W A;  4X66 L;  3AQQ A;  4PQX A;  4RKB A;  1XPO A;  5FO8 B;  1IBM L;  1B3Q A;  2QEJ C;  1HTP A;  3GQB A;  1S5D D;  4O2D A;  3F2D A;  3S1N B;  4IZ8 A;  1SYB A;  2NN6 G;  1J6Q A;  5LMN W;  1PH1 A;  2NBF A;  3L7Z C;  3OW2 A;  5A2Q E;  4LMQ D;  4HAE A;  3W2D A;  4A75 A;  3I4M G;  2DJF C;  5ELF A;  3UE0 A;  3DWQ A;  2JYO A;  1KAW A;  4X64 Q;  4POG A;  3L0O A;  1SYE A;  3I55 A;  1EQR A;  3SDZ A;  3RLN A;  3QB3 A;  1LO5 D;  1EIY B;  2F0U A;  1QOH A;  3MXN B;  2NB0 A;  2EJF C;  2GVA A;  1ML0 D;  1UWV A;  1YNN C;  2RA4 A;  1LLR D;  2B2W A;  3KBX A;  3J7Z C;  4A3G B;  3AU7 A;  2VUM H;  3G71 A;  3E0J A;  3RN2 A;  4DPG A;  1I4P A;  2DNC A;  1EQV A;  1Q1E A;  1EU4 A;  2JP1 A;  1IYV A;  2HHH L;  1HNX Q;  4HSP A;  1Y14 B;  3TME A;  1PH2 A;  1H9R A;  2RSN A;  2EJM A;  1E2W A;  1JC7 A;  3PQI A;  2PZT A;  3R93 A;  3TQY A;  3A74 A;  3STB C;  4CJ2 C;  5FLX c;  1TWC H;  3MZ5 A;  3G6J B;  4CHT B;  5GRO A;  1F9R A;  4FNF A;  3AB9 A;  1ILP A;  1EIF A;  3VR2 A;  5DLQ E;  1X6O A;  4MHE A;  3VR4 A;  1PA6 A;  4DR7 Q;  1NJI C;  3A7A B;  1TWC B;  1D1K A;  4X66 Q;  3NWS A;  5GQO A;  1VQ7 A;  5M3M H;  2F0G A;  4APV A;  4K6L A;  4C3J G;  2F0E A;  1EZ6 A;  4OIJ A;  1SNC A;  2H4O A;  4A3M H;  5BN4 A;  1KAB A;  1JOO A;  2JQO A;  4JI2 L;  2NWG A;  3HS0 C;  2NVT H;  4DR2 L;  3KBG A;  5M3M B;  4KHP L;  3ND8 A;  1MBY A;  3I90 A;  2C35 B;  1GUT A;  4A3M B;  3S2H B;  1I4R A;  3JAM L;  1VQJ A;  1FNW A;  3CF5 A;  2KJX A;  4JI6 L;  5EKK A;  2L12 A;  2NVT B;  1TQO A;  2F0L A;  3HKZ E;  4H7B A;  1ENA A;  2B2V C;  5FO7 B;  1WJJ A;  1A3T A;  4KHV A;  1ONL A;  4A3J H;  2R3Z A;  4JI7 Q;  3LX0 A;  3CW2 C;  3K5L A;  3MHB A;  1F9P A;  2K03 A;  1L1O B;  4CDD C;  4F7X A;  1VF5 C;  4KV6 A;  2NVY B;  2L5T A;  4L5T A;  4EQN A;  1KC8 C;  1PV4 A;  4IUR A;  5BN5 A;  2UUC Q;  2XWB B;  4K2K A;  1STA A;  1HNZ L;  1KNE A;  2B2T A;  4PMW A;  3BDO A;  3D4D A;  2MGS A;  3RR5 A;  3QOJ A;  2K04 A;  3T1Y L;  1KXL A;  2HIX A;  5EJW A;  1G6Z A;  2KCN A;  3NXW A;  2BDN A;  2EY2 A;  4JOI C;  4X3T A;  1VQM A;  3QR8 A;  3ND9 A;  3C46 A;  4X3S A;  1L2F A;  1GJX A;  3GV6 A;  4JVZ A;  2F0Q A;  2G9D A;  2F0W A;  2AQ2 B;  5ELD A;  4YWM A;  1JB3 A;  2OQ0 A;  1E24 A;  1ZXT A;  1SE8 A;  4DAP A;  2OWO A;  3GTL B;  4DR5 Q;  3OMC A;  5T1G A;  4BXX G;  1TY2 A;  3OMG A;  1N33 L;  3NBH A;  1S3O A;  3CC4 A;  4JI2 Q;  2MJ8 A;  1KRS A;  1ZKO A;  4A4I A;  1AFP A;  4CBV A;  2BA1 A;  1C48 A;  5C3X A;  3SK6 A;  1IYU A;  4A3E G;  1KLG D;  2KCT A;  5C0X G;  3EFX D;  2EXZ A;  5IT9 c;  4JI6 Q;  5IT9 E;  4P71 A;  5ELC A;  1PMR A;  1YI2 A;  2Z6K A;  1YNJ C;  2FMM A;  3GTJ H;  4DR3 L;  4PZ6 A;  3P1H A;  1BUV T;  1EY5 A;  3I4N H;  2EQS A;  3K58 A;  1K83 H;  1L0X B;  1LTT D;  1MI2 A;  1VQD A;  4DK1 A;  5C5M A;  2GVB A;  1EEF D;  3NK9 A;  1QZG A;  2V4D A;  4IJH A;  1JQY D;  4JK1 C;  3HP3 A;  2KBN A;  1WTH A;  4B3R L;  5DAU A;  1K0R A;  3T1Y Q;  2JEB I;  3U4V A;  2JXM B;  1HTL D;  1HR0 Q;  4NXM Q;  1K83 B;  1Y1V H;  2F0O A;  3C1E A;  4XT3 B;  4A3B G;  3OOC A;  3PIO A;  1SNQ A;  5CR3 A;  1IBL L;  5M5W B;  4YY3 Q;  5GAE C;  4A3K H;  5D3I B;  2SOB A;  1D7Q A;  4C3J B;  1CUK A;  2H5X A;  1CHP D;  1SE4 A;  4KN7 C;  4XYO A;  4A3F H;  1QZH A;  2B29 A;  2DN8 A;  1PVO A;  3MC0 B;  3OIQ A;  1N33 Q;  4WJW A;  5JJZ A;  2K75 A;  4JCV E;  4G7O C;  2X6G A;  4FF3 A;  4JC0 A;  4L5Q A;  2C5C A;  2J0T D;  1S5C D;  2RBM A;  1C4Q A;  2IX1 A;  1K8A C;  3HOX G;  1PH4 A;  2MUY A;  4A3F B;  3UDF A;  4UP9 A;  2B63 H;  3HKZ G;  2K1B A;  3MAQ A;  2NVQ H;  1MJC A;  3PF4 A;  1Z9F A;  3KLR A;  1OXV A;  2PZU A;  2K05 A;  4LF5 Q;  2VS1 A;  4K14 A;  1STY A;  3M4Q A;  2B63 B;  4L5S A;  2R7F A;  1UAP A;  1VQG A;  4XYQ A;  3NEN A;  2NVQ B;  4DR3 Q;  5HGQ A;  5C4J H;  4ZUJ A;  1QIL A;  1ET9 A;  1VQL A;  2F0H A;  3O13 A;  1V1P B;  3E3X A;  3M7G A;  3MXN A;  3HOV G;  3DEP A;  4XQQ A;  4IFD J;  1Q3L A;  1U4P A;  4LK1 C;  5COY A;  4B3R Q;  1VQH A;  1QG7 A;  1WYD A;  1SFO H;  4OO1 I;  1STE A;  1CI3 M;  2SEB D;  2MFI A;  3J7Y W;  2M00 A;  3KF8 B;  5KND A;  3CCQ A;  5G3L F;  4K8J A;  4K0K L;  1QUQ A;  3IFT A;  1NAP A;  1E3P A;  1G51 A;  4A3L G;  4RWS C;  2BA0 A;  1HNW L;  5LMU Q;  4IO9 A;  3PUW A;  2F0I A;  1SFO B;  5C4X G;  2LXK A;  5JEA G;  1FR3 A;  2K5W A;  1HZB A;  3M3Y H;  1CZG A;  3BS1 A;  2A6H C;  4XT1 B;  1N36 L;  4MN3 A;  2AUJ D;  3HOZ G;  1PTO F;  1GHJ A;  1Y8P B;  1YNN D;  2L1B A;  3A7L A;  4J6H A;  1OTC A;  1SYC A;  4LNQ A;  3M3Y B;  2TSS A;  1PH8 A;  4P2C B;  4K5V A;  3L3O C;  1FVI A;  3OIP A;  1B7Y B;  4NP5 A;  5DM6 3;  1K8M A;  3K6O A;  5IP9 H;  3STB D;  2N8N A;  2IW3 A;  5GAH C;  2D5D A;  3FKI G;  1DXM A;  1PFB A;  1EYA A;  2ZTE A;  1Q46 A;  4XXE A;  4DV3 L;  1YZ6 A;  2QIL A;  2QF7 A;  3TRE A;  1WI5 A;  3MA2 B;  1JOK A;  4FDB A;  5IP7 H;  4OEM B;  2WB1 G;  1ZEQ X;  3H3V I;  2EYF A;  2VNU D;  1JR0 D;  4I7A A;  5TSS A;  1PDQ A;  2UUA Q;  3BYT B;  4QF4 A;  3TP7 A;  4Y52 H;  4BBR H;  1YEZ A;  1MGS A;  3J81 L;  2EYO A;  4ALP A;  2JA9 A;  4ZRZ A;  2L0C A;  2FIN B;  3J80 L;  2HD3 A;  5IYB H;  3AFP A;  2F4I A;  3CCJ A;  3A5U A;  4BBR B;  5L37 A;  2Y0S G;  2X6L A;  3I70 A;  3KLW A;  2R93 G;  1EY9 A;  3FVQ A;  1HNW Q;  1O7I A;  5IGD A;  2PO4 A;  2EYH A;  4S3S A;  3GTK H;  1XNQ L;  2I07 B;  4K2L A;  4DV5 Q;  2NZ1 D;  2K14 A;  2BCO A;  5M5Y H;  2WAC A;  2MQH A;  1S40 A;  1IYJ B;  2R7D A;  1D6E C;  3HOX B;  2OCE A;  2E2I H;  3GTK B;  5E4X A;  3VA7 A;  4JI0 Q;  1J5E L;  2OF1 A;  2NYZ D;  4BA1 I;  3LNN A;  1GUG A;  3CME A;  2PW5 A;  1SXT A;  1H9K A;  4CKC A;  1NR4 A;  1TVX A;  4A93 H;  2E2I B;  4DV0 Q;  3BDL A;  2DJG C;  2HQL A;  3G6E A;  2ASB A;  4DV3 Q;  1QJO A;  1PXU A;  1X3F A;  4TVA B;  3I91 A;  3LGJ A;  1X55 A;  4A93 B;  4C3I H;  3HFZ B;  4NW2 A;  2R61 A;  2BE5 C;  3EN2 A;  1FL0 A;  3HOV B;  2JK8 A;  1K8G A;  2KQ3 A;  1C9O A;  2XSC A;  2NTT A;  3R2I A;  2YV5 A;  5LL6 S;  3KJP A;  1YNX A;  4FXK C;  2F0D A;  2B2V A;  4CDE C;  4C3I B;  3TSS A;  2ICE C;  2IJ0 A;  2ICI A;  4R4T A;  1VF7 A;  2K5D A;  1IL8 A;  5CBE E;  4BBS G;  4QL5 A;  3WDN A;  1G6P A;  4L6T B;  2HIV A;  2B39 A;  3BZD B;  4H13 C;  3L9A X;  2AMC B;  2PMZ E;  3IKJ A;  1YVC A;  4A3I H;  4IQZ A;  1GO3 E;  3PUY A;  2JA7 H;  3CCS A;  3GTO H;  3RNU A;  1G8Z D;  1S5F D;  5HY6 A;  4A76 A;  1U4L A;  1YNJ D;  2BOS A;  3S16 H;  3M85 A;  2IHF A;  3DWP A;  2EXD A;  4JOI A;  4A3I B;  1X3G A;  4RCN A;  2A5H A;  2KHJ A;  3GTO B;  4IUT A;  2ZJR A;  2JA8 H;  4X62 L;  1A8V A;  3CCE A;  3OYY A;  3S16 B;  5JOB A;  1P8L A;  3OSO A;  5KIX A;  1LTB D;  1EIG A;  2YU9 B;  3FKI B;  4DKA C;  5EKL A;  4LF8 Q;  1VQN A;  1SLJ A;  2I5L X;  3TN2 A;  4K6D A;  1VQB A;  2JA8 B;  1WD0 A;  1YHA A;  2I46 A;  1JWS D;  4Q5V A;  3HRZ C;  1A63 A;  3D4W A;  4A3C H;  3U4Z A;  1EZ8 A;  1G29 1;  1Y1W G;  4X64 L;  4OEL B;  1BNZ A;  1WTV A;  3PO3 H;  3F1Z A;  2CCZ A;  2PI2 A;  3GP7 A;  5COR A;  1GOZ A;  1LTG D;  1I3Q H;  3G4S A;  2IL8 A;  1PRT C;  5J22 A;  3W5O A;  4ILW A;  4IUN A;  4JW0 A;  3PO3 B;  1VQF A;  3H09 A;  1E0B A;  2Y0S B;  5M9O A;  2R93 B;  3CXC A;  1I3Q B;  4XQJ A;  4IFD H;  5LL6 X;  1PZK D;  2ES2 A;  2A73 B;  1KNA A;  3TBI B;  1RTN A;  3Q0A A;  1I5F A;  4GOP C;  1KRT A;  2Q8I B;  2XVS A;  4EVO A;  3CCV A;  3VYR A;  4GNX C;  1EWH A;  3NE5 B;  4DA2 A;  1PRT F;  5CV6 A;  4DK3 C;  1H9J A;  4RG1 A;  4DAM A;  4JYA L;  1SAP A;  2J7Z A;  4R4Q A;  3F2U A;  4RCO A;  1FYC A;  1LAC A;  1IW7 C;  4J15 A;  4GN4 B;  4X62 Q;  1X56 A;  3PIP 3;  5E4W C;  3MVV A;  2G9H D;  5M3F H;  4DV1 Q;  1SJH D;  2XRQ D;  1DGS A;  2L9H A;  1P16 A;  3FPU B;  5DM7 3;  4LF9 Q;  4KD3 A;  2AKW B;  4KKU A;  4YCV A;  4N8F A;  2DNE A;  1C0A A;  3TDQ A;  4H02 A;  5IYD H;  3A56 A;  3CPW A;  1LTI D;  1XNR Q;  3CAM A;  5CV5 A;  2K5N A;  3P75 A;  2D2C C;  3KYH C;  4RGO S;  5M3F B;  1T5X D;  3M7N A;  1YHB A;  3HOY H;  4EGV A;  3HOU H;  1VCI A;  1GUS A;  4C3H G;  1UEA B;  5AFW A;  5I9O A;  1TS5 A;  4IOC A;  1GM5 A;  4LFA Q;  1HR0 W;  4A3G H;  1EY6 A;  2A6H D;  2K4K A;  3HOY B;  1B2T A;  2UXB L;  3HOU B;  4BBS B;  1F2M A;  4YHH Q;  1SNP A;  4RA8 A;  1PRT B;  4X6A H;  1TWF H;  3QOL A;  1U5K A;  5CYU A;  1G2T A;  1VS0 A;  4PNY A;  4PV1 C;  4JI7 L;  1PH7 A;  1STH A;  4M8A A;  4ODG A;  4HN7 A;  5JPM C;  1V1O A;  3CD6 A;  3BDC A;  3GDE A;  2UUC L;  1CFM A;  1QUQ B;  1TWF B;  1JOR A;  2CQA A;  5EKI A;  5EPJ A;  4DV7 Q;  4WJ4 A;  2MHV A;  3T56 B;  1CM9 A;  1Y69 U;  4EQ5 A;  5I2X A;  1JCK B;  1IKM A;  2PCF B;  1TR5 A;  1TWA B;  3SVM A;  3KUP A;  1F9Q A;  4GNX B;  5FLX E;  4QJF A;  5C44 G;  1LYL A;  4I7Z C;  4JYA Q;  3OTO L;  4BY7 H;  4RKL A;  1E22 A;  4RMF A;  3AMU A;  4YCW A;  4P74 A;  2D9U A;  3KFU A;  2A19 A;  2L55 A;  5C0X J;  1M4V A;  3MFG A;  5AJ3 L;  4IUV A;  1SRU A;  4DR5 L;  4BY7 B;  1B8A A;  4NXN Q;  4R4I A;  4LFC L;  4DR6 Q;  3S2H H;  2CHB D;  1ENF A;  3MXG A;  4ID6 A;  2QW7 A;  3MXU A;  1QNK A;  4AYB B;  4ZK9 B;  5GAD C;  2JA6 H;  1DOM A;  3NTK A;  3S1M H;  2I5H A;  1SYG A;  1GXD C;  5IYC H;  1PH3 A;  2WKD A;  4AH6 A;  1QE6 A;  2H1E A;  4ZAI A;  1RTO A;  4QGU A;  3FRP B;  5D65 A;  3X3N A;  4TSS A;  2UXB Q;  3GTP B;  2NVY H;  5IIF A;  2JA6 B;  3S1M B;  3TZU A;  3EBE A;  2E5L L;  5C6A A;  5EGT A;  3QJY A;  1NBW A;  1FD7 D;  2NUC A;  2HQE A;  3RLF A;  1TS3 A;  3GTM H;  1AP0 A;  4HSV A;  4O0A A;  3JAM i;  5FJ8 G;  4MTK A;  1EU3 A;  1PFS A;  3EA6 A;  2LMC B;  5J1Z A;  3T53 B;  1NTG A;  5ELN A;  1IL2 A;  2TMP A;  5A35 A;  1SNM A;  2ALY B;  1HFN A;  3BVG A;  3CQZ B;  4CGY B;  3CC2 A;  2Q2U A;  3FP9 A;  3GTM B;  1U4R A;  2KEC A;  1HR0 L;  2HCI A;  4POF A;  4NXM L;  2F03 A;  2PPB C;  1TU2 B;  2NN6 H;  4PMB A;  2UXD L;  1Q81 C;  3GTL H;  5JVG 3;  1VDZ A;  1PH9 A;  2EDG A;  1Q1B A;  3OWE B;  1QWY A;  2O5J C;  3OTO Q;  4KTA A;  2BE5 D;  2A68 C;  4YY3 L;  1XX8 A;  3ULP A;  4QB4 A;  2UU9 Q;  3I4M H;  5JJK A;  3URY A;  3TS0 A;  2PYK A;  5AJ3 Q;  3PUV A;  3A8K E;  4IPD A;  4UAI A;  1SMX A;  3U58 A;  1BDO A;  1Z47 A;  2JE6 I;  3I4M B;  4LFC Q;  3JAM c;  1N32 L;  3JAM E;  1EY8 A;  5HUR A;  2L11 A;  3K0X A;  2J4X A;  3EIV A;  3IAY A;  4XDX A;  2UXC Q;  1SBB B;  4OWX B;  2Q2T A;  4IUP A;  5J39 A;  3HOW G;  3ER0 A;  4DR1 Q;  4QMG A;  2QEX A;  4HIO A;  5CV9 A;  1BBW A;  3TS2 A;  4LUZ A;  4JI1 Q;  4IPH A;  4LF5 L;  1F9S A;  1SEB D;  1HJP A;  3DUZ A;  2E5L Q;  2YTV A;  4FP5 D;  3ICE A;  1I50 B;  4OON A;  4TKO B;  1K3B C;  4RFB A;  1B9N A;  1D5M C;  5GAG C;  2EPB A;  5BN3 A;  5JEA J;  3ULL A;  5C3E G;  4BA2 I;  2KUM A;  2RDG A;  2Z6B A;  3HEJ A;  3LWE A;  3UE1 A;  3A54 A;  2LKV A;  5M5W H;  3MTS A;  5C44 B;  5IOC A;  1BBU A;  2A74 C;  2B8F A;  1PFN A;  1I94 L;  4C3J H;  5IGE A;  2UXD Q;  1EYD A;  1ASZ A;  1DOK A;  1LTL A;  5E3F A;  3CC7 A;  2R92 G;  2N49 A;  5LMU L;  1WTO A;  3X3M A;  2E2H H;  1PRT D;  1KIX A;  4BS9 A;  1NY4 A;  4UP8 A;  4X65 Q;  1GUN A;  2XGT A;  1I4X A;  4C1N I;  2F4V L;  5I9P A;  2F3W A;  4RGT A;  4ZYS A;  4IN3 A;  2E2H B;  2HDM A;  1N32 Q;  4B3S L;  1S5E D;  4HMJ A;  3GTG B;  4FF1 A;  5IGC A;  3D0F A;  2VQF Q;  3S17 H;  1Q12 A;  1BQQ T;  1CSP A;  2SNM A;  1LT5 D;  4HID A;  3NQT A;  2C9O A;  4KY7 A;  1MKH A;  1NMG A;  4UPA A;  1CA6 A;  4DV4 Q;  1JOQ A;  2NZH A;  2CWA A;  1HQR D;  1HH2 P;  3S2D B;  3OHX C;  3BJU A;  3SR1 A;  2RHS B;  3S17 B;  1BCP C;  2EZV A;  4JBJ A;  4ZKB B;  2VXW A;  4LJZ C;  4HJ8 A;  4KK7 A;  2K5H A;  1IW7 D;  2EY6 A;  1EWC A;  1RF2 D;  3NWT A;  3T16 A;  2K50 A;  4RHR A;  1K28 A;  2UUA L;  3Q24 A;  1WTR A;  4PG3 A;  4FYD A;  3TP6 A;  2AHO B;  4BY1 G;  4H0L C;  1H95 A;  1M1K C;  2LSS A;  1TKW B;  2WAQ E;  2Z0S A;  2L15 A;  2G5D A;  2R7Z G;  2RHQ B;  2VB2 X;  1U9R A;  1I94 Q;  1VQK A;  4BXX H;  3PGZ A;  2R6G A;  5C5L A;  3Q22 A;  4B9X A;  1NSN S;  4GOP A;  1BVS A;  2F0N A;  2MNA A;  4R8I A;  2QA4 A;  4DUZ Q;  4GNX A;  1KDB A;  4LF4 Q;  4DV5 L;  1BR9 A;  3NBI A;  2F3V A;  5LHY 1;  4A3E H;  5C0X H;  5FO9 B;  3W3A A;  1XXG A;  1B4O A;  2ZXP A;  3UDX A;  2F4V Q;  4IAL A;  4J1M A;  2GA4 B;  1PH6 A;  4B3S Q;  4OO1 G;  2K33 A;  3HKS A;  4JI0 L;  3E0E A;  1PHJ A;  3HOW B;  2F3I A;  4A3E B;  5FLM G;  4NDX A;  1TWG B;  4QUF A;  4B3T Q;  1BBX C;  4DV6 L;  1X54 A;  2B2Y C;  1ILQ A;  1CKN A;  4DV0 L;  3U9S A;  2XNA C;  2CW0 C;  2QDB A;  2K28 A;  1F2L A;  4OGQ C;  3PF5 A;  2O4X A;  1XPU A;  3N6R A;  4IOA A;  2OTJ A;  4U68 A;  4YCU A;  1Y8N B;  5DNF A;  4R9W A;  1IBK L;  5K36 G;  1B44 D;  1CQV A;  1VQ6 A;  4A3B H;  5ELO A;  3NUC A;  3KLS A;  1II3 A;  3NHH A;  1ESR A;  4A3D G;  3H0G G;  1KLU D;  1VQ8 A;  5JPN C;  1YIT A;  1EY4 A;  4IUU A;  3KF6 A;  2ATW A;  3AYH B;  2BH2 A;  2E74 C;  2KCM A;  2ZTD A;  2WII B;  4A3B B;  1S4Z A;  4B08 A;  3K7A B;  4ZQ3 A;  3SK4 A;  1VQ5 A;  2R92 B;  2OQK A;  3J81 j;  2IY5 B;  3NTH A;  1V8Q A;  3PO2 G;  4DF7 A;  2HUG A;  4IFD I;  1AE2 A;  3HOX H;  4AYB E;  3J81 i; 
#chains in the Genus database with same CATH homology
 2EY5 A;  1WTQ A;  4DNT B;  1PLF A;  1XYI A;  2IWH A;  2K7V A;  3DEO A;  4KY5 A;  3G7L A;  1AZP A;  1AW7 A;  3HKZ B;  3IL8 A;  4C56 C;  1RKN A;  2EJG C;  5JVH 3;  4V0B A;  4DFA A;  1ESF A;  1SYF A;  1SMY C;  1HRJ A;  1CZW A;  3RMH A;  4KI0 A;  3TP8 A;  1OXT A;  1W6J A;  3ERO A;  3VYS A;  2A68 D;  2B8G A;  3J81 E;  5CV8 A;  3M4Y A;  2EYL A;  5CV4 A;  2F0V A;  1R9T B;  1Q90 A;  4RHS A;  4Q0F A;  3J80 E;  2F0K A;  2Z4H A;  1H9S B;  1MD2 D;  4X3K A;  1VMC A;  4CKE A;  1D5Z C;  4K5X A;  3SK5 A;  4DU9 A;  5JEA H;  3RZD B;  2Z8L A;  4G7H C;  3HZX A;  3KK7 A;  1QB5 D;  1F2Z A;  3NQI A;  3OPO A;  1XWE A;  3CKI B;  1RD9 D;  4DNR B;  5EPL A;  3H3V C;  1STB A;  4WOR A;  1Z6H A;  5C4X B;  3UI2 A;  1MSG A;  2IX0 A;  4F88 A;  3K5N A;  1H9M A;  1NUC A;  1LT6 D;  2A6E C;  1D2B A;  4CKB A;  3HOZ B;  3TZD A;  5FOB B;  1FGB D;  4C2M B;  1LTA D;  1LV9 A;  1OXX K;  1A15 A;  2K6A A;  1O7L A;  2PNR C;  3V96 A;  1TS4 A;  2F0P A;  2NVX B;  5CGK A;  4DK0 A;  3GD7 A;  5JAV A;  3K5M A;  2XRS D;  3T13 A;  2WB1 B;  4XQN A;  4DXG A;  3PV0 A;  5D3D A;  4A3D B;  2OEO A;  3KLS X;  1PFM A;  4OHJ A;  1BOS A;  3MXP A;  3GTQ B;  4KMU C;  3T51 B;  1ICW A;  1X32 A;  1KDC A;  1UUP A;  4HCS A;  1O7Y A;  3CRK C;  1E2Z A;  2BDO A;  5A2Q L;  3MWY W;  4N9P A;  1EY0 A;  2F0S A;  2DY7 A;  2HCC A;  1XTC D;  3D6W A;  3CU7 A;  1B50 A;  4HR7 B;  2FFK B;  2OXP A;  5ELB A;  4HCE A;  1CK1 A;  5IOD A;  5EBC A;  1KAA A;  1LTR D;  1AZQ A;  1KDA A;  3BG3 A;  1G91 A;  5I4D A;  3HGB A;  2M2L A;  2L4N A;  3FPP A;  2ZXR A;  1DOL A;  2E2D C;  1EOT A;  1K8O A;  5FK9 C;  2OT2 A;  5ELE A;  4U67 3;  1SE3 A;  1HCZ A;  1LTS D;  3QG1 A;  2KVM A;  2MP1 A;  3OWF A;  2E75 C;  2N88 A;  3M4O B;  1QNU A;  3K5O A;  1SE2 A;  1I4H A;  1JWU D;  4EQP A;  3BVM A;  1QCB D;  2EYM A;  3I3C A;  3IFD A;  1SND A;  5C4Z A;  4H44 C;  1WD1 A;  1LT4 D;  3C2P A;  4J8Q A;  2CW0 D;  1EYC A;  2WKC A;  3ONA B;  5I6W A;  4DXF A;  1GHK A;  3TP5 A;  1EIH A;  3VA5 A;  5NUC A;  1I6H B;  3U9O A;  1EEI D;  3DHQ A;  1SYD A;  2VUM B;  1HFG A;  4LAA A;  1B9M A;  4KKS A;  3ITP A;  1Y1W B;  2EE1 A;  4KJO A;  3CRL C;  1CQF A;  4QIW B;  4O1N A;  1LAB A;  2B2Y A;  2A69 C;  2K5Q A;  4RGN A;  4F8M A;  4WFN 3;  2AWO A;  1HA5 A;  5M5X B;  2EVB A;  2Q8T A;  3D4R A;  1S5B D;  3QIA A;  3RD4 A;  1SDF A;  1UNS A;  1TII D;  1RCV D;  3GO5 A;  3VYT A;  1H9S A;  1I4G A;  2SDF A;  3C3L A;  3VR3 A;  2YYZ A;  4G57 A;  2AUK A;  1SMY D;  4KJN A;  3BVZ A;  1FNV A;  3D8G A;  2B2U C;  3R8B A;  3I4L A;  4CJ1 B;  5CV7 A;  2LY7 A;  5IT9 L;  3E5S A;  5CBA E;  3S9W A;  1OXS C;  2EYP A;  1HPC A;  2K01 A;  4A3J B;  1TWH B;  4KHZ A;  4OL7 A;  2E2J B;  3DWA A;  1RDP D;  4PMC A;  2RQX A;  5EPK A;  1TS2 A;  4C3H B;  1DYQ A;  1F77 A;  5C0X I;  1R4Q B;  2A6E D;  2LS0 1;  2RVL A;  2O2L D;  4QUC A;  3Q23 A;  3SE0 A;  3DXJ C;  3N52 A;  2KHS A;  5CC4 A;  4ZKC B;  1PZJ D;  4M1U B;  4TRD A;  1SNO A;  2PMZ B;  2VB3 X;  2HDL A;  2FMC A;  4V19 0;  4WRD A;  1ZYR C;  5KEE A;  1NCV A;  4GZY C;  2JEA I;  3OW7 A;  4K8I A;  4DAY A;  1EL0 A;  5I6Y A;  2XWJ B;  2NTS A;  1PZI D;  1CA5 A;  3A55 A;  1C8C A;  4KKT A;  4DN4 M;  1Z7T A;  5KYI A;  3LWU A;  4HED A;  1GUW A;  3FEW X;  1X3P A;  1DJR D;  1V43 A;  1J8I A;  3S15 B;  4FO2 A;  3D6C A;  4JBW A;  3GTJ B;  1WTX A;  3NPP A;  1M8A A;  2D62 A;  2KA7 A;  3I4N B;  2M9V A;  1EQT A;  2EYJ A;  5KNC A;  1CT1 D;  3Q6S A;  3BYY B;  1JE4 A;  2EY1 A;  3PIO 3;  1B3A A;  1JIC A;  1G2S A;  2MPM A;  4O42 A;  2F0J A;  1Y1V B;  2ZXO A;  4ABN A;  1AN8 A;  3VR5 A;  3T4A C;  3J7A V;  3GV3 A;  1O78 A;  5KNB A;  2FHT A;  1HQM C;  4A3K B;  2PQE A;  3R3O A;  5K5P A;  1B1Z A;  4KD4 A;  4XIG S;  4DAV A;  2QCP X;  2F0F A;  4Y7N B;  4FXG C;  1JWM D;  1MSH A;  2KOL A;  2CVR A;  3NSW A;  1J9O A;  4YIJ A;  4KN4 C;  5CMD A;  1ENC A;  5I2Y A;  2IX3 A;  1B53 A;  1BCP F;  1DCZ A;  2B2W C;  2XN9 C;  4MIU A;  4RGM A;  1TT2 A;  4RAU C;  2N55 A;  1WTP A;  1EY7 A;  1PTO C;  2E76 C;  3H94 A;  1RJT A;  1VMP A;  3H91 A;  1AEX A;  2JSO A;  3EQL C;  5C4J B;  1L0Y B;  3J7A F;  1OXU A;  1U4M A;  4TQU S;  1DZ1 A;  4C3I G;  4ME5 A;  3R2T A;  3DM1 A;  1X3Q A;  2IPK D;  2KCC A;  3VYU A;  5IGF A;  2WIN B;  4UDU C;  1WTW A;  1I6V C;  1BCP B;  3S14 B;  1BXT A;  3I73 A;  5C3E B;  1CHQ D;  1Y8O B;  1O80 A;  4Z9C B;  3EVQ A;  1LT3 D;  3SXH A;  1CTM A;  5KYL A;  3NP8 A;  1D1I A;  1IHZ A;  3PMF A;  2F0M A;  4X3U A;  1DM0 B;  4G4K A;  3EJI A;  4RH6 A;  1PTO H;  2WP8 J;  4I65 A;  2A69 D;  2DY8 A;  3FMC A;  2B2T C;  3K59 A;  4FXD A;  3WOF A;  1PYW D;  1SSO A;  1SJE D;  2ZT9 C;  2XIW A;  4DGZ A;  1PTO B;  3A8I E;  4L8J A;  4L63 B;  1STG A;  2AQ1 B;  3S1R B;  2ENB A;  4K5W A;  3PUX A;  1HUM A;  2EOT A;  4XTC S;  1HXY D;  2O5I C;  1A3V A;  4HMI A;  4IFD G;  4OIK A;  3NTI A;  3S1Q B;  5F2D A;  1O7Z A;  3VR6 A;  5M5Y B;  1KTK A;  3V05 A;  1I4Q A;  4BY1 B;  4BWG B;  5FKA C;  1BF4 A;  4NKL A;  2R7Z B;  2F0T A;  3HG9 A;  4CJ0 B;  3D31 A;  5DEH A;  3PUZ A;  2KEE A;  5E1F A;  2F1M A;  2PW7 A;  1D5X C;  4N9T A;  1NR2 A;  4OO1 H;  3MEH A;  3E6Z X;  1ET6 A;  3SK8 A;  3P7J A;  5EQ0 A;  2B2U A;  1TY0 A;  1ZYR D;  2SNS A;  2AQ3 B;  2Z1C A;  1FNU A;  3H6M A;  2IT1 A;  4ULL A;  1EFI D;  3SEB A;  5K36 H;  1DON A;  4EQO A;  1HA6 A;  3I72 A;  1A2U A;  2KED A;  2LFN A;  4R8N A;  4E6I A;  3P20 A;  5T1I A;  5HGT A;  2X69 A;  1W6K A;  1T5E A;  2JA7 B;  2AWN A;  2QKI C;  3MFY A;  3CHB D;  2PZW A;  1A3U A;  4QCL A;  3RUZ A;  4F87 A;  3H0G B;  1E2V A;  4FF2 A;  5IGG A;  2RDH A;  3A8J E;  3ERQ A;  3K57 A;  4ZUI A;  3K0Y A;  3I8Z A;  5ISR A;  1A2T A;  3ZYY X;  1F2Y A;  3QWN A;  4NMZ A;  1STN A;  3PO2 B;  2RDF A;  1GUO A;  1HUN A;  1A6X A;  1WVL A;  4IUQ A;  3FDT A;  3V2T A;  1BCP D;  2FJ2 A;  4FF4 A;  5EBD A;  5KGU A;  3DMU A;  2RSO A;  5C4H A;  1BO0 A;  2ID0 A;  3QO2 A;  5IGB A;  1Q8I A;  4KY6 A;  4C1N K;  1V1P A;  2JA5 B;  1ROD A;  4HTH A;  3RZO B;  3SHL A;  1RHP A;  1DD2 A;  2RKS A;  1WCM B;  2NN6 I;  4FVM A;  1HHV A;  4ZLT F;  1OO9 B;  1R4P B;  5G3L D;  3WOE A;  3KF8 A;  3C1F A;  5KRU A;  4G7Z C;  5D14 A;  2K32 A;  2Z4I A;  2WV6 D;  2Q8R E;  1IKL A;  3D3R A;  2WAQ B;  5FLX L;  5C3W A;  1PTO D;  4B9W A;  4PQX A;  4RKB A;  5FO8 B;  2QEJ C;  1HTP A;  3GQB A;  1S5D D;  3S1N B;  4IZ8 A;  1SYB A;  2NN6 G;  2NBF A;  3L7Z C;  5A2Q E;  4LMQ D;  4HAE A;  3W2D A;  5ELF A;  3DWQ A;  2JYO A;  1SYE A;  3SDZ A;  3QB3 A;  1LO5 D;  2F0U A;  1QOH A;  2NB0 A;  2EJF C;  1ML0 D;  1YNN C;  2RA4 A;  1LLR D;  2B2W A;  3KBX A;  4A3G B;  3AU7 A;  3E0J A;  1I4P A;  2DNC A;  1EQV A;  1Q1E A;  1EU4 A;  2JP1 A;  1IYV A;  4HSP A;  3TME A;  1H9R A;  2RSN A;  2EJM A;  1E2W A;  1JC7 A;  2PZT A;  4CJ2 C;  3R93 A;  3MZ5 A;  3G6J B;  4CHT B;  1F9R A;  4FNF A;  3AB9 A;  1ILP A;  3VR2 A;  4MHE A;  3VR4 A;  3A7A B;  1TWC B;  1D1K A;  3NWS A;  2F0G A;  4K6L A;  4C3J G;  2F0E A;  1EZ6 A;  4OIJ A;  1SNC A;  2H4O A;  5BN4 A;  1KAB A;  1JOO A;  2NWG A;  3HS0 C;  3KBG A;  5M3M B;  3ND8 A;  1MBY A;  3I90 A;  4A3M B;  1GUT A;  3S2H B;  1I4R A;  3JAM L;  1FNW A;  2KJX A;  5EKK A;  2L12 A;  2NVT B;  1TQO A;  2F0L A;  4H7B A;  1ENA A;  2B2V C;  5FO7 B;  1A3T A;  4KHV A;  1ONL A;  2R3Z A;  3LX0 A;  3K5L A;  3MHB A;  1F9P A;  2K03 A;  4F7X A;  1VF5 C;  4KV6 A;  2NVY B;  2L5T A;  4EQN A;  4IUR A;  5BN5 A;  2XWB B;  4K2K A;  1STA A;  1KNE A;  2B2T A;  4PMW A;  3BDO A;  3D4D A;  2MGS A;  3QOJ A;  2K04 A;  5EJW A;  1G6Z A;  2KCN A;  3NXW A;  2BDN A;  2EY2 A;  4X3T A;  3ND9 A;  3C46 A;  4X3S A;  1GJX A;  3GV6 A;  2F0Q A;  2G9D A;  2F0W A;  2AQ2 B;  5ELD A;  1JB3 A;  1ZXT A;  4DAP A;  3GTL B;  3OMC A;  5T1G A;  1TY2 A;  3OMG A;  3NBH A;  2MJ8 A;  1ZKO A;  1AFP A;  4CBV A;  2BA1 A;  1C48 A;  5C3X A;  3SK6 A;  1IYU A;  1KLG D;  5C0X G;  3EFX D;  2EXZ A;  5IT9 E;  5ELC A;  1PMR A;  1YNJ C;  2FMM A;  3P1H A;  1BUV T;  1EY5 A;  3K58 A;  1LTT D;  1L0X B;  1MI2 A;  4DK1 A;  5C5M A;  1EEF D;  3NK9 A;  2V4D A;  1JQY D;  4JK1 C;  3HP3 A;  5DAU A;  2JEB I;  2JXM B;  1HTL D;  1K83 B;  2F0O A;  3C1E A;  4XT3 B;  3OOC A;  1SNQ A;  5CR3 A;  5M5W B;  5D3I B;  2SOB A;  4C3J B;  1CHP D;  1SE4 A;  4KN7 C;  4XYO A;  2DN8 A;  3MC0 B;  3OIQ A;  4WJW A;  5JJZ A;  4G7O C;  2X6G A;  4FF3 A;  2C5C A;  2J0T D;  1S5C D;  2RBM A;  1C4Q A;  2IX1 A;  2MUY A;  4A3F B;  2K1B A;  3MAQ A;  3KLR A;  1OXV A;  2PZU A;  2K05 A;  4K14 A;  1STY A;  2B63 B;  1UAP A;  4XYQ A;  2NVQ B;  4ZUJ A;  1QIL A;  1ET9 A;  2F0H A;  3O13 A;  1V1P B;  3M7G A;  3MXN A;  3DEP A;  4XQQ A;  4IFD J;  1Q3L A;  1U4P A;  4LK1 C;  5COY A;  1QG7 A;  4OO1 I;  1STE A;  1CI3 M;  2SEB D;  3J7Y W;  2M00 A;  5KND A;  5G3L F;  4K8J A;  3IFT A;  1NAP A;  4RWS C;  2BA0 A;  3PUW A;  2F0I A;  1SFO B;  5JEA G;  1FR3 A;  2K5W A;  1CZG A;  3BS1 A;  2A6H C;  4XT1 B;  4MN3 A;  2AUJ D;  1PTO F;  1GHJ A;  1Y8P B;  1YNN D;  2L1B A;  3A7L A;  4J6H A;  1SYC A;  3M3Y B;  2TSS A;  4P2C B;  4K5V A;  3L3O C;  3OIP A;  4NP5 A;  5DM6 3;  1K8M A;  3K6O A;  2IW3 A;  2D5D A;  1DXM A;  1PFB A;  1EYA A;  4XXE A;  2QIL A;  2QF7 A;  3MA2 B;  1JOK A;  1ZEQ X;  2VNU D;  2EYF A;  1JR0 D;  5TSS A;  1PDQ A;  3BYT B;  4QF4 A;  3TP7 A;  1MGS A;  3J81 L;  2EYO A;  4ZRZ A;  2L0C A;  2FIN B;  3J80 L;  2F4I A;  4BBR B;  2X6L A;  3I70 A;  1EY9 A;  3FVQ A;  5IGD A;  2PO4 A;  2EYH A;  4S3S A;  2I07 B;  4K2L A;  2NZ1 D;  2BCO A;  2WAC A;  1D6E C;  3HOX B;  3GTK B;  5E4X A;  3VA7 A;  2OF1 A;  2NYZ D;  4BA1 I;  3LNN A;  1GUG A;  2PW5 A;  1SXT A;  1H9K A;  4CKC A;  1NR4 A;  1TVX A;  2E2I B;  3BDL A;  1QJO A;  1PXU A;  3I91 A;  4A93 B;  4NW2 A;  2R61 A;  2BE5 C;  3HOV B;  2KQ3 A;  2XSC A;  2NTT A;  3R2I A;  5LL6 S;  4FXK C;  2F0D A;  2B2V A;  4C3I B;  3TSS A;  2ICE C;  2IJ0 A;  2ICI A;  1VF7 A;  2K5D A;  1IL8 A;  5CBE E;  3WDN A;  4L6T B;  2B39 A;  3BZD B;  4H13 C;  3L9A X;  3IKJ A;  4IQZ A;  3PUY A;  1G8Z D;  1S5F D;  1U4L A;  1YNJ D;  2BOS A;  3M85 A;  3DWP A;  4A3I B;  4RCN A;  2A5H A;  3GTO B;  4IUT A;  3S16 B;  5JOB A;  3OSO A;  5KIX A;  1LTB D;  1EIG A;  2YU9 B;  3FKI B;  5EKL A;  3TN2 A;  4K6D A;  2JA8 B;  1WD0 A;  2I46 A;  1JWS D;  4Q5V A;  3HRZ C;  3D4W A;  1EZ8 A;  1G29 1;  1BNZ A;  1WTV A;  3GP7 A;  5COR A;  1GOZ A;  1LTG D;  2IL8 A;  1PRT C;  5J22 A;  4ILW A;  4IUN A;  3PO3 B;  3H09 A;  1E0B A;  2Y0S B;  5M9O A;  2R93 B;  1I3Q B;  4XQJ A;  4IFD H;  5LL6 X;  1PZK D;  2A73 B;  1KNA A;  3TBI B;  1RTN A;  3Q0A A;  2Q8I B;  2XVS A;  4EVO A;  3VYR A;  1EWH A;  3NE5 B;  4DA2 A;  1PRT F;  5CV6 A;  1H9J A;  1SAP A;  2J7Z A;  3F2U A;  4RCO A;  1FYC A;  1LAC A;  1IW7 C;  3PIP 3;  5E4W C;  3MVV A;  2G9H D;  1SJH D;  2XRQ D;  2L9H A;  5DM7 3;  3FPU B;  4KD3 A;  4KKU A;  2DNE A;  3TDQ A;  3A56 A;  1LTI D;  5CV5 A;  3P75 A;  2D2C C;  4RGO S;  5M3F B;  1T5X D;  3M7N A;  4EGV A;  1VCI A;  1GUS A;  4C3H G;  1UEA B;  5AFW A;  5I9O A;  1TS5 A;  1EY6 A;  2A6H D;  3HOY B;  1B2T A;  3HOU B;  4BBS B;  1F2M A;  1SNP A;  4RA8 A;  1PRT B;  3QOL A;  5CYU A;  1G2T A;  4PNY A;  4PV1 C;  1STH A;  4M8A A;  4ODG A;  4HN7 A;  5JPM C;  1V1O A;  3BDC A;  1CFM A;  1TWF B;  1JOR A;  2CQA A;  5EKI A;  5EPJ A;  2MHV A;  3T56 B;  1CM9 A;  1Y69 U;  5I2X A;  1JCK B;  1IKM A;  2PCF B;  1TR5 A;  1TWA B;  3SVM A;  3KUP A;  1F9Q A;  5FLX E;  4I7Z C;  4RKL A;  3AMU A;  2D9U A;  5C0X J;  2L55 A;  1M4V A;  3MFG A;  4IUV A;  4BY7 B;  2CHB D;  1ENF A;  3MXG A;  4ID6 A;  3MXU A;  1QNK A;  4AYB B;  4ZK9 B;  1DOM A;  3NTK A;  1SYG A;  1GXD C;  2WKD A;  1QE6 A;  2H1E A;  4ZAI A;  1RTO A;  3FRP B;  5D65 A;  3X3N A;  4TSS A;  3GTP B;  5IIF A;  2JA6 B;  3S1M B;  3TZU A;  5C6A A;  5EGT A;  3QJY A;  1FD7 D;  2NUC A;  2HQE A;  3RLF A;  1TS3 A;  1AP0 A;  4HSV A;  1EU3 A;  3EA6 A;  2LMC B;  5J1Z A;  3T53 B;  2TMP A;  5A35 A;  1SNM A;  1HFN A;  3BVG A;  3CQZ B;  4CGY B;  3GTM B;  1U4R A;  2KEC A;  2HCI A;  2F03 A;  2PPB C;  1TU2 B;  2NN6 H;  4PMB A;  5JVG 3;  1VDZ A;  2O5J C;  2EDG A;  1Q1B A;  3OWE B;  1QWY A;  4KTA A;  2BE5 D;  2A68 C;  1XX8 A;  4QB4 A;  3URY A;  2PYK A;  3PUV A;  3A8K E;  4UAI A;  1BDO A;  1Z47 A;  2JE6 I;  3I4M B;  3JAM E;  1EY8 A;  5HUR A;  2L11 A;  2J4X A;  3IAY A;  4XDX A;  1SBB B;  4IUP A;  5J39 A;  4QMG A;  5CV9 A;  1F9S A;  1SEB D;  3DUZ A;  4FP5 D;  1I50 B;  4TKO B;  4RFB A;  1B9N A;  1D5M C;  5BN3 A;  2EPB A;  5JEA J;  4BA2 I;  2KUM A;  2RDG A;  3HEJ A;  3LWE A;  3A54 A;  2LKV A;  3MTS A;  5C44 B;  5IOC A;  2A74 C;  2B8F A;  1PFN A;  5IGE A;  1EYD A;  1DOK A;  5E3F A;  1WTO A;  3X3M A;  1PRT D;  4BS9 A;  1GUN A;  1I4X A;  4C1N I;  5I9P A;  2F3W A;  4RGT A;  4ZYS A;  4IN3 A;  2E2H B;  2HDM A;  1S5E D;  4HMJ A;  3GTG B;  4FF1 A;  5IGC A;  1Q12 A;  1BQQ T;  2SNM A;  1LT5 D;  3NQT A;  2C9O A;  4KY7 A;  1CA6 A;  1JOQ A;  1HQR D;  3S2D B;  3OHX C;  3SR1 A;  3S17 B;  1BCP C;  2EZV A;  4ZKB B;  2VXW A;  4LJZ C;  4KK7 A;  1IW7 D;  2EY6 A;  1EWC A;  1RF2 D;  3NWT A;  3T16 A;  4RHR A;  3Q24 A;  1WTR A;  4FYD A;  3TP6 A;  4H0L C;  1TKW B;  2VB2 X;  1U9R A;  2R6G A;  5C5L A;  3Q22 A;  4B9X A;  1NSN S;  2F0N A;  4R8I A;  1KDB A;  1BR9 A;  3NBI A;  2F3V A;  5LHY 1;  5C0X H;  5FO9 B;  3W3A A;  1XXG A;  1B4O A;  2ZXP A;  4IAL A;  4J1M A;  2GA4 B;  4OO1 G;  2K33 A;  3HOW B;  4A3E B;  4NDX A;  1TWG B;  4QUF A;  1BBX C;  2B2Y C;  1ILQ A;  3U9S A;  2XNA C;  2CW0 C;  2QDB A;  2K28 A;  1F2L A;  4OGQ C;  2O4X A;  3N6R A;  4U68 A;  1Y8N B;  5DNF A;  4R9W A;  5K36 G;  1B44 D;  1CQV A;  3NUC A;  3KLS A;  1II3 A;  3NHH A;  1ESR A;  1KLU D;  5JPN C;  1EY4 A;  4IUU A;  2E74 C;  2WII B;  4A3B B;  1S4Z A;  4B08 A;  3K7A B;  4ZQ3 A;  3SK4 A;  2R92 B;  3NTH A;  1V8Q A;  4DF7 A;  2HUG A;  4IFD I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...