1EY4A

Structure of s. nuclease stabilizing mutant s59a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey4A00
2F0IA 2EY2A 4EQOA 5CR3A 1STGA 2F0TA 4NP5A 4K5WA 2F0PA 2OEOA 2F0OA 4RKLA 1A3VA 2F0HA 3MZ5A 1EZ8A 3D4WA 2F0WA 5IIFA 3EJIA 1SYCA 2PYKA 5IOCA 1KDCA 1SNDA 4KTAA 5CV8A 5C5MA 5I6YA 4IALA 3D4DA 1F2ZA 3TP5A 5C4ZA 3MVVA 1IHZA 2F0LA 4KD4A 4WRDA 3LX0A 4K8JA 4ZUIA 1SNCA 2EYPA 2F0QA 3C1FA 5CGKA 5KEEA 2EYJA 2PW7A 4EQPA 5KGUA 3EVQA 2EYFA 1JORA 1TQOA 2ENBA 4NMZA 1SYDA 4TRDA 5DEHA 5C3XA 1AEXA 1STNA 2EY1A 2EY5A 5C6AA 3P1HA 2KQ3A 2F0UA 1STAA 3HZXA 1SNOA 3NUCA 4DF7A 5KYIA 3NK9A 5KRUA 5IGDA 1KDBA 3EROA 2PZTA 1JOKA 1ENAA 1EY5A 2SNSA 5EKKA 4IUNA 5EKLA 2HQEA 1EY7A 1STYA 3H6MA 4K2KA 5IGBA 1KDAA 4QF4A 3OWFA 2F0GA 3MEHA 3SR1A 2WACA 3PMFA 1KABA 3OSOA 5NUCA 3MXPA 2PQEA 2PW5A 1STHA 3ITPA 3BDLA 2F0KA 4K2LA 3TP6A 5IGFA 3D8GA 5JOBA 5ISRA 4QMGA 4RKBA 3SK5A 3SK4A 4NKLA 3TP8A 1RKNA 4K8IA 5JAVA 1JOQA 2SNMA 1II3A 5IODA 4K14A 4WORA 5I9OA 3SXHA 4IZ8A 5EGTA 1EY9A 3DMUA 1ENCA 5CV6A 5HGTA 1EQVA 3V2TA 4KY7A 3R3OA 5IGEA 2EYLA 2EY6A 2RKSA 3VA5A 1SNPA 3DHQA 4KJOA 2F0FA 3E5SA 4B9XA 4HMIA 5CV7A 1F2YA 4HMJA 3SK6A 2F0EA 2F3VA 4S3SA 5J39A 1TR5A 1SYGA 4YIJA 5E3FA 4PMBA 5J22A 1TT2A 5CV5A 2O4XA 3MHBA 4R8NA 5F2DA 4I65A 4KY5A 3RUZA 4K5VA 3BDCA 2SOBA 5C3WA 5IGGA 2EYMA 2OF1A 5J1ZA 4ODGA 4MIUA 4NDXA 4EVOA 4LAAA 4ZQ3A 2F0SA 1NUCA 4N9PA 4QB4A 1KAAA 2EYHA 1NSNS 4PNYA 3SHLA 2F0MA 4N9TA 2NUCA 4B9WA 1JOOA 5DAUA 3ERQA 1STBA 5CV4A 4DFAA 1EY6A 3NQTA 1A2TA 3NP8A 4DGZA 5I9PA 2PZUA 2RBMA 5CV9A 1EY4A 1A2UA 2EXZA 5C5LA 4F7XA 3T16A 1EY8A 3S9WA 5IGCA 1SNMA 4ME5A 1EY0A 1SYFA 1SYBA 1SYEA 2F0JA 4KJNA 4OL7A 2F0DA 5C4HA 4KY6A 1A3TA 3NXWA 5KIXA 3OMGA 1EYAA 4G57A 3OMCA 4J1MA 3NHHA 4EQNA 4KV6A 2QDBA 5I6WA 5M9OA 2F3WA 4F8MA 3U9OA 1EYCA 4KHVA 3TMEA 2F0VA 1F2MA 3C1EA 5CC4A 2OXPA 5K5PA 5KYLA 3P75A 3QB3A 3SK8A 3T13A 3HEJA 4E6IA 2EYOA 1EZ6A 4H7BA 4K6DA 2PZWA 4KD3A 1EYDA 4ID6A 2LKVA 5E1FA 2KHSA 4K5XA 3TP7A 2F0NA 1U9RA 3D6CA 3QOJA 4PMCA 4ZUJA 2M00A 3QOLA 4HTHA 1SNQA 5HURA 1A3UA 2RDFA 4J6HA 4DU9A
chains in the Genus database with same CATH superfamily
4Q0FA 2EY2A 5ELFA 1HNXL 4HIDA 4G7ZC 1LTBD 1FGBD 3M9BA 1STGA 4MZ9A 1B4OA 4C3IG 4AQYQ 5GAHC 4ME3A 5IOCA 4LWCA 4KTAA 3H3VH 3RNUA 1HPCA 1HR0W 1H9RA 2B2YA 2I46A 4O2DA 4WRDA 1XPUA 2R92B 2Y0SG 4CJ2C 1JORA 1V1QA 1AZPA 1L2FA 3HZXA 1KQSA 3F2BA 3FEWX 3CC7A 1Q81C 5EKLA 1HTPA 3H6MA 4JOIC 4JI4L 1BVSA 2K05A 4ZRZA 1G2TA 2B2VC 1EFWA 2Z9HA 3OWFA 4LF4Q 4FDBA 1SRUA 1WD1A 3KLSA 3UDXA 4A3LG 4NB3A 4FXKC 1PZKD 5GADC 1HNWQ 4F87A 4IQZA 3SXHA 2IHFA 4OX9L 1N32L 4G7OC 1I94Q 3TS0A 1TY2A 4L8JA 5FOBB 1XMOQ 1I4XA 1HUMA 3TDQA 4DR5L 1VQGA 2XIWA 1E0BA 1PV4A 3CC4A 1QJOA 4FF1A 1PH9A 3M4OB 1UUPA 1OTCA 2K33A 5CMDA 2NN6I 2OQ0A 4CDEC 5AFWA 5IWAQ 3MHBA 4JV5L 2B2WA 3I91A 5JEAJ 1UAPA 3JAML 4R9WA 2B63G 4A3DB 1KLGD 4BY1G 4JCVE 3CCVA 3OIQA 2QKIC 3S9WA 4DR2L 2UXCL 3R8BA 1VQ9A 4DA2A 4DAYB 5C4HA 2LS01 3OTOQ 4X3TA 4KK7A 3NHHA 4TSSA 1V1OA 2B2YC 1R9TB 2ALYB 1BNZA 1TS4A 4YHHL 2EYOA 1EZ6A 3KK7A 2CH4A 4ID6A 4GNXA 1IYVA 1HTLD 4OHJA 3H15A 1VCIA 3CCMA 4R4CA 2DUDA 3K5OA 4RKLA 5D65A 3S15B 1DXMA 3M4QA 3MFGA 3NBHB 4JK1C 4K0KL 3AQQA 4NXMQ 5KNDA 2CW0D 3E0EA 4JI7Q 2C5CA 2L0CA 5IP9H 3VR6A 4LF5Q 2WFWA 4GOPA 3SGIA 2CQOA 5IT9E 1SJHD 2XWBB 1ZEQX 1VQCA 2XNAC 4QUCA 4IFDG 4OWTB 1K83H 3NK9A 5GQOA 2K1BA 2SNSA 1EIGA 4IUNA 2IWHA 2HQEA 4IPCA 3BZCA 4QF4A 5EKIA 3JAMc 2B2WC 1W3SA 1FGUA 1QUQB 2EIFA 2Z0SA 3BVZA 4JI5L 3DUZA 3PUYA 4IO9A 5AJ3L 2VUMG 4IPDA 2LMCB 1VF7A 2H5XA 5LMUL 2D62A 1HFNA 4JG2A 3HFZB 2KEEA 2EY6A 2RKSA 3ULLA 2LXJA 1DJRD 1LM0A 2Q8TA 1SYGA 4AYBB 3KBXA 1HUNA 2R7ZB 1Y1WG 3CQZH 4JBJA 3PSIA 2J4XA 4KY5A 5EQ0A 2YU9H 4Z9CB 1Y69U 2KUMA 2EJGC 2OF1A 1EEFD 1W2BA 4A3BB 2Q8RE 5CBEE 3IAYA 1Y8PB 3R2IA 4BWGB 1GD7A 4G4KA 5EAYA 4IJLA 5FO7B 1B53A 1O80A 1L1OB 5C0XJ 2E2DC 4F88A 4GNXC 4DFAA 1KD1C 1A2TA 3W1BA 3K0YA 4IURA 1AW7A 4DKAC 1SEBD 4DV0L 4X3UA 1OXUA 1STEA 1SYEA 1SYBA 1D7QA 3KDFB 3UE1A 3GTLB 3FVQA 1H9JA 2IJ0A 3AEVA 4FNFA 2VQFL 3K5LA 1X55A 3EQLC 1WTHA 2VZAA 3HOWH 3UE0A 5C4XG 1GOZA 2QDBA 5M3FB 4P71A 1EYCA 1MD2D 2HHHQ 4BBRH 4RAUC 4GOPC 1K73C 2PZWA 4KD3A 5IYCH 1EEID 2E2JB 1Q8KA 1SNQA 1PTOF 2R61A 3I4OA 2KJXA 3DM1A 4GN5A 1QVCA 4LF6Q 3IFTA 4JI1Q 1HA6A 3MZ5A 1PH7A 2NN6H 1TS2A 1EL0A 3NENA 1SNDA 2BA0A 4YCWA 3UDFA 1KNAA 1YHBA 4RCNA 2JA7H 3CW2C 3C1FA 1ET9A 1YJNA 4J15A 1K0SA 1B3AA 3KF6A 4C3JB 2MJ8A 2YYZA 4NMZA 4LFCQ 3KLSX 2NTSA 3S2HH 5LMNQ 2PNHA 1NBWA 3I70A 2PZTA 4DR3L 2LSSA 2DN8A 1CK1A 2B8FA 5EJWA 4A3MB 4XT1B 2AWOA 1HQMC 4IUUA 4UDUC 5CBAE 2DY8A 3X3NA 3PMFA 2IX3A 2PQEA 4HJ8A 3I55A 1EFID 1VF5C 1RD9D 4A3JH 1OXTA 1B70B 3SK4A 2XRSD 1RKNA 3BVGA 3PIPA 4OEMB 5JAVA 1MJCA 4A3KG 1TWCH 4A3KB 1J5EQ 1ENCA 4IUTA 1I4RA 1YHAA 1EQVA 5IGEA 2SEBD 4LF9Q 4X66L 3QR8A 3VA5A 3KJOA 4DXFA 3VR4A 2NZHA 3WDNA 2IY5B 1LABA 4YIJA 2F1MA 4A3FB 4QQBX 2D9UA 1TWGH 3OIPA 3CXCA 4OO1I 4X3SA 3KLRA 1HZ9A 2ZTCA 4QB4A 2L15A 2PO4A 3LWUA 3A56A 2KECA 4R4QA 4B3RL 1KC8C 3D3RA 1N36Q 4TKOB 4F7XA 2E74C 1HJPA 1EU3A 4UP9A 1O7IA 1UNSA 1WTRA 1PH6A 2JA6G 4LK1C 4BY7H 3HOYG 4OWXB 2DNCA 2L1BA 5C4JH 1ESFA 4NXNL 3HOYB 2YTVA 2B3GA 4LFBQ 1PA6A 2UUBL 2CH4W 1DZ1A 2JQOA 2BDNA 2F0VA 1C7YA 5KYLA 4CKBA 1LACA 1WCMH 3RZDB 2JN4A 4DR6Q 3D6WA 1WTVA 1P8LA 3TP7A 4UPAA 2EPBA 1YNJC 4KHPL 4X65Q 3K80C 1U4MA 2K01A 3F2DA 1LTTD 2MQHA 2ASBA 1AP0A 3GV6A 1G8ZD 2F0HA 3HKZB 2WV6D 1XNQL 5M3MH 4DV6L 2PYKA 5I6YA 3CF5A 3LX0A 1M1KC 2VB2X 2F0QA 1FR3A 1KRTA 5BR8L 2M9VA 3NEMA 1I4HA 5BN5A 1TWAH 1RIPA 3T53B 1SSOA 1LUZA 1MSHA 1SMYC 4DF7A 2JYOA 3I4MH 1KDBA 3PUVA 4I7ZC 4QY7A 3VA7A 5JVH3 2FHTA 3GTPH 2WINB 1S5CD 3M4YA 2WACA 4HEDA 1STHA 3H0GH 5IT9L 1JOQA 1Q7YC 1G6PA 4DV7L 4JYAQ 2E5LQ 3DMUA 2L4NA 3CAMA 5HGTA 1PTOC 1X3EA 4Q5VA 2SDFA 2MHVA 1S5DD 1HHVA 2E76C 4DUZL 1F2YA 1A15A 4S3SA 3U4VA 1PHJA 2N88A 3GTQB 2VL6A 2BE5C 2OQKA 1MGSA 1VMCA 4GKJL 1CKNA 3BDCA 1AN8A 2ZT9C 1B50A 1SDFA 3IRBA 1XTDA 3EN2A 4A75A 3CCLA 3TRZA 4N9PA 3NTHA 4A3EB 2JP1A 4DGZA 1HR0L 3NP8A 2PZUA 1X3PA 1A2UA 1VQJA 1FNWA 1K9MC 2HDLA 3K59A 2N55A 2J0TD 5I2XA 3A8JE 2GA4B 4EQNA 1ZKOA 3D0FA 1VQBA 1F9SA 1X54A 3J7A5 1L0XB 3HEJA 1G291 3MXUA 3FKIB 3URYA 1UEAB 4BA1I 5IP9G 3U9OA 5C0XI 1BQQT 3T1HL 3CKIB 1I50B 1PRTF 3HOZH 3IL8A 4DV5L 3S1NH 2AQ1B 2K5NA 1VQKA 3OOCA 5IT9c 4NP5A 4X62Q 2B2UA 2B29A 2K32A 5IIFA 4A3CH 4C3HH 4HCEA 1H9KA 2MP1A 3G71A 3J7ZC 1ZXTA 4KD4A 4AH6A 2A69C 4OO1H 4B3MQ 1PFSA 3A8IE 2KHJA 1X56A 1TWFH 1BF4A 2LFNA 4BBSH 4DV4L 2FINB 4IOCA 3J81j 3I4NB 3VYTA 1G91A 5ELOA 1I6VC 1PVOA 1D8LA 1VQMA 2VQEQ 2E2HH 1SE3A 3GD7A 2ATWA 2PW5A 3C2PA 1W6KA 1D5ZC 1Y8NB 3H09A 1NJIC 3HP3A 3GTGB 4K8IA 1RTNA 1LTID 5A2QL 1SAPA 5M5WH 5JEAH 3J81L 3BJUA 1Q1EA 1YIJA 3GTMH 2N49A 3SK6A 3K5NA 2HCCA 3S1MB 4AYBE 2LXKA 1BCPD 1DYQA 3JC66 5IP7H 3PO3H 2O4XA 1M8AA 2UU9L 3FRPB 1CT1D 3S17H 2A68C 4K5VA 1EUJA 1V43A 3PIOA 1A8VA 4JVZA 3U50C 4U673 3HOWG 5EPJA 2F0MA 4L6TB 1JOOA 3CCJA 4CHTB 2BH8A 1STBA 1VQIA 2NYZD 4IJHA 3PUZA 1EY4A 2NVTH 2UXBQ 1WTXA 2QEJC 5FJ8H 5IYCG 1CZWA 3K7AH 2B2UC 3TBIB 3BDOA 5C44B 3S1RH 2NN6G 1F2MA 3NPPA 3QB3A 2KCTA 1HNWL 2WB1B 2EDGA 3QIAA 2PQAA 2IX1A 1I94L 2JA7G 3HOXB 1QZGA 4HN7A 3CMEA 2RA4A 3BS1A 1XPRA 1TS3A 1KLUD 4CKCA 1GUTA 3A55A 5IWAL 1Y1VH 3RLNA 4HJ9A 2AUJD 3KF8A 5M5XH 2D0PA 3D4DA 4JI0Q 4DR7Q 2F0LA 1D1KA 3GQBA 4DK1A 4A3JG 4XIGS 1QWYA 1SBBB 2ENBA 1PZID 2XSCA 5GAGC 1PZJD 1G51A 1O78A 3Q23A 1TWCB 2YTYA 1SLJA 1GUSA 1VQPA 1I3QB 4C3IB 2NZ1D 2WIIB 4L5QA 1JJCB 2N78A 3GP7A 2UXDQ 2NVQH 3RMHA 1S3OA 1B9MA 3TP8A 1VQHA 3KF8B 3F1ZA 3ER0A 5I9OA 1BXTA 2DNEA 4CJ0B 2UUAQ 2Z6BA 2Y0SB 1MSGA 1PRTC 4V190 4A3GH 5C0XH 2I5LX 2F0FA 2I5MX 3BVMA 4HMJA 1FD7D 4CDDC 1WFQA 3PCOB 5J39A 1L0WA 4R4IA 3S1QH 4QGUA 1TT2A 3HKSA 3AFQA 1B3QA 1X32A 4DV1Q 1EQRA 4BY7G 1GKHA 3FP9A 4LF5L 1PTOH 1TVXA 1PYBA 2JEBI 1YITA 2JK8A 2R93H 1KRSA 4LMQD 5I9PA 3I90A 1J6QA 2D2CC 2A6EC 4NPSA 3X3MA 1WCMG 4C1NI 1X6OA 1JR0D 2O5IC 4DAYA 1QVGA 4A93G 2X6LA 4OL7A 4A93B 3T51B 2A74C 1AZQA 1Q82C 3A54A 3L2PA 4LF7Q 4DR1Q 5CC4A 1YNND 1IBLL 5M3MG 3P75A 1PH5A 2G5DA 2M2LA 4H7BA 1WD0A 2FFKB 1D2BA 3K58A 1LTGD 1U9RA 1K3RA 3BZDB 1SE2A 2B63B 4KHZA 4BY1B 3V05A 2IT1A 3M4PA 4RH6A 4DU9A 3Q22A 3NBHA 1XX8A 4XT3B 1FVIA 3I4MG 3HKZE 3K0XA 4Y52H 1SE4A 4BS9A 2UUCQ 3I4MB 1SFOH 1Q86C 4AIMA 1CHPD 1E22A 4KN4C 1PH1A 1SNCA 2K5HA 1A62A 2Q2HA 3H0GG 1STNA 2EY1A 1T5XD 1RHPA 1STAA 1WJJA 2KENA 4OIKA 1HNXQ 2VY3A 1ENAA 3FMCA 4IUQA 1K8OA 4K2KA 5IGBA 1QUQA 2ZJPA 1B8AA 3J7YW 5JVG3 3U9SA 2RF4A 2VW9A 1DOKA 2K04A 4ILWA 2N3SA 4RHRA 1VQLA 3NQIA 1FYCA 4L63B 1EY9A 2GVBA 3MTSA 1QG7A 1RDPD 2XTIA 1SNPA 3DHQA 4B3TQ 1GUGA 4CDCC 2F0EA 4C56C 4JI4Q 4LF6L 1TR5A 4GKKL 2CQAA 1BUVT 4YY3L 3S16B 1DCZA 2IHEA 5F2DA 2JA8H 3RUZA 2R7DA 2SOBA 1SR3A 2H1EA 5EBCA 1N33L 1L1OA 5ELEA 1X3FA 2RDGA 2NVXH 3M7NA 4OX9Q 1YVCA 1NMGA 2VUMB 2K7VA 1PFBA 3GTOB 5CV9A 5C5LA 3KDFA 4DR5Q 4ME5A 1ML0D 3RD4A 5BN3A 4LUZA 5K36H 1TWHH 3HOZG 1X3QA 2HIVA 1Y1WB 4POGA 3TMEA 3C1EA 1CSQA 4KMUC 4A3CG 4C3HG 1PYSB 3T13A 4C2MH 2F52A 4K5XA 3P20A 2OCEA 4OO1G 1S4ZA 5HURA 4GLAC 4DR2Q 1F77A 2DGYA 2F4VL 2F0TA 4K5WA 4BBSG 2ZXPA 3S2DB 3C46A 4BBSB 2ZTDA 2MNAA 2CWAA 2IPKD 3OYYA 4H44C 1JWUD 5LHY1 3AFPA 5C4XB 1F2ZA 3FPUB 5I2YA 4IPHA 3E9IA 2I5HA 4YHHQ 4EQPA 4FO2A 5D14A 1LTLA 2IX0A 5JJKA 3KFUA 2OTJA 3Q6SA 1WTPA 3CRKC 5JEAG 1XPOA 3LNNA 2FMMA 1RCVD 4DK3C 2B8GA 4DNRB 1Z9FA 3CPFA 4DNIA 3HOUH 3K6OA 4K0KQ 2KCCA 4JI6Q 3ZYYX 4LFBL 1S5ED 1XWEA 3ERSX 3G6EA 4JW0A 2K4KA 2QCPX 2N8NA 5IP7G 3PO3G 1L1OC 4X64L 4DAVA 4IN3A 5COYA 2KEDA 2CHBD 2A73B 1GHKA 4HIKA 1D5XC 3DXJC 2KBNA 3ULJA 2WAQG 1IBML 4FF4A 4MHEA 4O1NA 4KKSA 4R1JA 4Y7NB 1YJWA 2WAQB 3S14H 4OGQC 5FO8B 4JI2Q 5LL6S 2NVTB 1QNKA 4B08A 5FJ8G 1BKBA 2PNRC 1I6HB 1VQNA 4JI5Q 4MIUA 2MO0A 3FDTA 1JCKB 1PXUA 1SN8A 4UY8C 5LMUQ 1UWVA 3MWYW 5IE8A 5DAUA 5CV4A 4LF8Q 5FLMH 3S1RB 3I56A 1EQTA 4HJAA 4WFN3 4ZK9B 4EGVA 4L5TA 1M90C 4QCLA 3SVMA 1ZYRC 1WVLA 4ULLA 1OXSC 5I6WA 4BXXH 2F3WA 4UP7A 5I4DA 1Y1VG 1Z6HA 4CDFC 1RTOA 2O5JC 2WB1E 3A5ZB 5M5YB 5ELNA 1B9NA 1JC7A 1UE6A 1WTWA 5M5XB 4LFAL 1KNEA 3DEOA 1U4PA 5HY6A 2RCNA 2E2IB 1X9NA 4DV0Q 1LTSD 2ICEC 2R92H 1OO9B 3KOJA 2VQFQ 5EPKA 1K28A 2JA6B 3O13A 1IYJB 3VYSA 1WYDA 4KKTA 1N34L 2F3IA 1JICA 2AMCB 3I3CA 3I4LA 2JSOA 1A6XA 1O7YA 4HR7B 1BCPB 1AEXA 4QIWB 5C3EH 2NVQB 1GHJA 5E4WC 5IY0A 3AMUA 3EROA 4IUPA 1LT4D 3K8AA 5EBDA 4A3GG 3HRZC 5C0XG 2E75C 1CKMA 4TQUS 4RWSC 4JBWA 4DN4M 1IBKL 2AHOB 3LWEA 3RLOA 2F0KA 2BA1A 5ISRA 3GV3A 3CPWA 2GN5A 1IKLA 1Z47A 1XTCD 3PO2H 1C48A 2SNMA 3BZKA 3IFDA 3M4OH 3UI2A 5LMNW 4IZ8A 3AYHB 4RHSA 5CV6A 2Y0SE 4HJ5A 1GVPA 3CMAA 1NAPA 2R93G 3A5UA 2QGQA 5CV7A 5EPLA 3KLWA 1N8RC 1LTRD 2OTLA 1KIXA 1WI5A 1FNVA 5CV5A 4B3SL 1XXGA 3BG3A 4A3DH 3DM3A 3SDZA 1ASYA 2EYMA 2Q8IB 2IW3A 2NBFA 3HOVH 4LAAA 3TZDA 4GN4B 4B3ML 2G9DA 1H9SA 4RGOS 4DV2L 1KAAA 3H3VC 4DV3L 2ZXRA 2H4OA 3NTIA 1Q1BA 3Q0AA 4LUVA 1H9MA 2RBMA 4X66Q 2L12A 1QNUA 1HNZL 1AE3A 1EY8A 2A6HC 1D5MC 2F0JA 3V96A 1HFGA 1R9TH 2QILA 4KY6A 5H1SE 3R2TA 4UAIA 1L0YB 2ZJRA 3MXNB 1CA6A 3OMCA 1EU4A 1IW7C 4XQNA 1K8GA 1PDQA 1JMCA 5JPNC 1AH9A 3SK8A 2C35B 3CCSA 3S15H 1EYDA 4B3RQ 1SFOB 3PV0A 1H9SB 3D6CA 4ZUJA 1ASZA 1DOLA 2VB3X 4HTHA 3VR3A 3P1HA 4PG3A 1S72A 3CRLC 1RL2A 4EQOA 3A7LA 3F8TA 3T1YQ 2BOSA 3FHWA 4NXNQ 2LY7A 2ZXOA 2UUBQ 5T1IA 2MPMA 1QILA 3STBC 1M4VA 4K8JA 1S5FD 2I0QA 2K5DA 3I2ZA 3HGBA 1XJVA 2EYJA 2TMPA 5KGUA 3CCEA 3G6JB 1E2ZA 5CYUA 3EFXD 2UXBL 1MBYA 1SNOA 2CCZA 2NTTA 1EY5A 2GVAA 2PMZB 2AWNA 3J7AF 2K5WA 3R93A 1TXYA 1O7LA 1XNQQ 1VQEA 3H3VI 3SR1A 4DV6Q 4DR4L 1KABA 1Z7TA 4XDXA 1K83B 5IGFA 4NKLA 5KNBA 4N8FA 2ZM6L 2WP8J 5BR8Q 4KLKA 3E6ZX 5EGTA 2R7ZH 4PZ7A 3D31A 2MO1A 2A1AA 4OXPA 4WJ3M 1K3BC 3QO2A 4A3BH 4YCUA 2F3VA 4ABNA 2JEAI 5E3FA 1VQDA 2P5ZX 4JI8L 1DM0B 4R8NA 5IGGA 5IGCA 2XGTA 1OXXK 5K36G 1HQRD 4NDXA 1YNJD 3A0JA 4ZAIA 4DUYL 4DR7L 2F0SA 3L3OC 2OWOA 3K57A 1NR4A 4B9WA 4DV7Q 1PH8A 2K14A 3CQZB 4POFA 1EY6A 3OPOA 2YU9B 3W3AA 1XMQL 5M3FH 1FJGL 1SNMA 2XWJB 1EY0A 2MUYA 1ET6A 4G7HC 4AQYL 2ZJQA 3NXWA 1JT8A 5JJIA 3OW2A 5BN4A 1GXDC 4GLXA 1UEBA 2E2JH 2UXDL 1SMYD 5A35A 1YI2A 2JA9A 2L5TA 2PPBC 4ZKBB 3PUXA 3G7LA 3VR2A 1NNXA 2L11A 4FXGC 1HR0Q 3HOWB 3GTJH 2RHSB 4BBRG 3B6YA 5FKAC 1JQYD 4BBRB 4H13C 2B2TA 1XYIA 2KHIA 3D4WA 4LF4L 2R3ZA 1PTOD 4C3JH 1FL0A 3HOUG 3MVVA 4ZKCB 1MIUA 1Q12A 4A3MH 3DWAA 4XQQA 2BE5D 3RN2A 3PF5A 1TQOA 2MGSA 4QJFA 4TRDA 5DEHA 3T1HQ 3QJYA 1SMXA 1XMOL 4DV5Q 2BCOA 2JA7B 3W1GA 2QA4A 5EKKA 4JOIA 2RVLA 2B2VA 2L9HA 4KKUA 4XQJA 2RCFA 3KBGA 1Q90A 2YV5A 3GTKH 5NUCA 3S2HB 1XNRQ 2BDOA 4QMGA 1PH4A 1U5KA 3S14B 1DD2A 2JA5H 4WJ4A 1G2SA 1JE5A 3M3YH 5IODA 4K14A 4YWMA 4X3KA 4YWLA 1QVFA 4A3FH 3N52A 4QL5A 1CHQD 2CW0C 4DV4Q 4A3JB 4FF2A 3E5SA 4YCVA 4GN3B 1F9QA 3DEPA 4K6LA 3KYHC 5FLMG 2WAQE 1V1PB 2OT2A 3OTOL 4ODGA 4XYQA 3UDIA 2XRQD 4IFDJ 2A5HA 4RG1A 1CI3M 3J80i 4BXXG 3W5OA 3L7ZC 3CCUA 1TWGB 2DJFC 4A3IH 3QWNA 3PIO3 3CCRA 4JI3Q 1RJTA 2NZOA 1NE3A 4J8QA 1YJ9A 3W2DA 4KJNA 2B2TC 2A69D 1B44D 1HZAA 2F0DA 3RZDH 2UU9Q 4IUVA 1QOHA 1LT5D 4J1MA 3AU7A 2R92G 4NXML 4PQXA 3TSSA 4JI7L 5DM73 4BY7B 4RGTA 1C8CA 1LT3D 4N8X1 2FJ2A 4K6DA 5C4JB 5IYBH 5IYDH 3EA6A 2PI2E 3RLFA 2KHSA 3NTKA 3J81i 4V0BA 3QOJA 5KNCA 4BA2I 1Q8IA 4B3TL 1A3UA 1K8MA 2RDFA 3CC2A 2F0IA 1F9PA 2Z4HA 3CD6A 4RMFA 5CR3A 1WCMB 2JXMB 5C3EG 1SJED 2F0PA 2F0OA 1C0AA 2WKCA 5C3EB 1I4GA 1V8QA 3RN5A 2CKZB 5C5MA 2X6GA 4P73A 2CVRA 1PLFA 4ZCKA 3TP5A 3TN2A 1IHZA 3Q8DA 5CGKA 1BR9A 4P74A 1F2LA 3SEBA 1YHQA 5M3MB 2EYFA 2AKWB 3K81C 2EVBA 5C3XA 1EOTA 1I5FA 5GAEC 2EY5A 4QIWE 3MC0B 3PO2G 2A68D 1W6JA 3E0JA 1GM5A 3LGJA 4PMWA 1VQ7A 3PO2B 2AQ2B 2XN9C 4HIMA 1V9PA 1Y8OB 1TWAB 2DJGC 4CKEA 1RODA 1G6ZA 1UE5A 1MJEA 4A3DG 2AUKA 3GTQH 4WORA 1E1OA 3GTPB 4MTKA 1I4PA 2RQXA 4RGMA 3WWVA 3HOVG 3RZOH 1BO0A 3HOVB 1CZGA 3M7GA 3H0GB 4U68A 3E3XA 4HIOA 3PUWA 4P72A 4YWKA 1CUKA 1J9OA 1N9WA 2Z1CA 4A3EH 2TSSA 4HCSA 1VQOA 1NMFA 1KTKA 1QE6A 3CHBD 4FVMA 4L5RC 4DPGA 1NUCA 1JJ2A 2HHHL 2RSOA 2EYHA 3SHLA 4JBKA 1LV9A 5FLXE 2MFIA 3L9AX 1YZ6A 5D3IB 2Z6KA 3DWQA 4CBVA 4IOAA 4UP8A 1I4QA 2R6GA 4JI1L 5KIXA 3FKIH 4JI6L 2K28A 3MFYA 1R4QB 4F8MA 1I50H 2XVSA 1BBXC 5JJLA 5DNFA 2CFMA 1X3GA 1A63A 2HQLA 2D5DA 5E1FA 1F9RA 1N32Q 1E24A 3WOFA 2M00A 4LFCL 4RCOA 4GNXB 5HGQA 3EBEA 5LMNL 2Q2TA 4MNOA 2B39A 1HH2P 1KXLA 4RA8A 2PCFB 1A3VA 4OELB 4JI2L 1VMPA 1SE8A 4JV5Q 5CV8A 1PRTD 4CJ1B 3HOZB 1EQQA 1GUOA 3S1NB 1QB5D 1NTGA 1CM9A 1TIID 1IBLQ 4X6AH 3I4NH 2EYPA 5KEEA 3CCQA 4H0LC 3K5MA 1UE1A 3EVQA 4C3HB 1IZ6A 4LF8L 1J5EL 1CQVA 4ZYSA 4GOPB 4LF9L 5KYIA 4OIJA 2EQSA 1TKWB 4AYBG 5IGDA 1T9HA 4WJWA 3F2CA 2R7ZG 2UXCQ 3NWTA 1EY7A 2PMZE 3GTGH 2VNUD 1TWFB 4M8AA 4A3BG 2F0GA 4LJZC 2EZVA 1U4RA 5DLQE 1QZHA 2HT1A 2A6ED 3MA2B 2QF7A 4H02A 3ICEA 2NVYH 3F2UA 4R4TA 1II3A 2K6AA 2E2HB 3S1MH 3JAMi 1BCPF 1N36L 1CFMA 4KJOA 1SROA 1EOVA 3NBIA 2Z6KC 4O42A 2G9HD 4P75A 1P16A 3PQIA 1D6EC 5M5WB 5M3FG 2KOLA 5C3WA 3GTMB 1CQFA 3SE0A 1JB7A 2K5VA 3UDGA 2VS1A 4ZLTF 3PO3B 5G3LD 5JPMC 4DR6L 2E8GA 3ERQA 5J3BA 3J80E 3S17B 5ELDA 4LW1A 4GLVB 1OXVA 4JC0A 2EXZA 4PZ8A 1CKOA 4DAPA 4X65L 1SYFA 1AE2A 5C44H 4OWWB 1EWIA 3H91A 4GKKQ 1VQAA 3GTJB 1TY0A 4YY3Q 4RFBA 1C9OA 2RSNA 4G57A 3P7JA 1PFMA 2KA7A 4KV6A 3U4ZA 3HOXH 3MEFA 3OWEB 1J8IA 2A19A 1N33Q 4O0AA 5GROA 4IFDI 3K7AB 2PI2A 5AJ3Q 4I7AA 4C3JG 4JBMA 2K50A 3BYYB 1Q46A 3I7FA 4DXGA 5A2QE 3M85A 1JE4A 5M9OA 4A3MG 2Q2UA 2BH2A 3J81E 1SXTA 1LLRD 1TU2B 4GS3A 3T4AC 1Q3LA 1GO3E 1EZ8A 2DY7A 2HD3A 2F03A 3G4SA 1KDCA 2AQ3B 4IALA 5DM63 2K5QA 4A4IA 3I8ZA 1E3PA 1Y1VB 3GTKB 4JYAL 2E5LL 1LYLA 2K03A 1SYDA 2JA5G 1I3QH 4C3IH 3KF6B 2KQ3A 2F0UA 3NUCA 2JA5B 1BOSA 3RR5A 3M3YB 4A3FG 2F4VQ 2EOTA 1VQFA 3DWPA 1IKMA 3OSOA 2QEXA 1VQ4A 4P2CB 3TP6A 2QW7A 2RDHA 1VQ6A 5FO9B 4IPGA 1JWMD 1BBUA 3HG9A 1EYGA 2HDMA 3EIVA 4B9XA 1VQ5A 1PH3A 4HMIA 1CTMA 4A3IG 4FP5D 3T1YL 4A3IB 3GDEA 2JJQA 4PMBA 5LL6X 4A3LH 1HZBA 4A3GB 5E7NA 2EJMA 3CU7A 1HRJA 4ZQ3A 2ZTEA 3BYTB 1O7ZA 3S24A 4HJ7A 4X64Q 3S1QB 1NSNS 4MN3A 2NUCA 1CA5A 4A93H 1PH2A 3T16A 5IYDG 5IYBG 1IBMQ 1PTOB 5L37A 3PIP3 3MAQA 4DR3Q 3HKZG 3MXNA 2R93B 4X62L 1E2VA 5ELBA 3E9HA 3CP0A 1JB3A 3TREA 1EIYB 2B63H 1DOMA 4BY1H 4KHVA 1HXYD 4GZYC 1YNXA 5FLXL 1ICWA 1BCPC 2HCIA 2C9OA 2RHQB 1E1TA 3D4RA 3A74A 2LKVA 4L5SA 2F0NA 4OONA 1C4QA 3ULPA 2KCMA 1H95A 4XYOA 4E6IA 1WOCA 1HCZA 1E7ZA 1NCVA 2VQEL 1ILQA 1R4PB 3EJIA 1SYCA 1MKHA 4EQ5A 1PYWD 3U58A 3TS2A 4HSPA 2I07B 3NELA 2PW7A 3J7AV 4DK0A 3DLLA 1K8AC 4LFAQ 1IL2A 2HIXA 3Q24A 5ELCA 5C6AA 2KCNA 2IL8A 1JOKA 1GUWA 3ZJYC 1EWHA 2KVMA 3RZOB 1T5EA 1IYUA 1ESRA 3MEHA 2NB0A 2L55A 1BBWA 1B2TA 3MXPA 1N34Q 3ITPA 3NSWA 4MTNA 3BU2A 5JOBA 1MHWC 4A3EG 2D0OA 2FXQA 4KN7C 4IFDH 1ZYRD 4UHVA 1CSPA 1S40A 1KHIA 1PMRA 3S16H 2EYLA 1WTQA 3JAME 4KHPQ 3VR5A 4DAMA 4HSVA 1D1IA 2YTXA 1HA5A 5J22A 5FLXc 4FXDA 4TVAB 2VUMH 4I65A 1IBKQ 1YBYA 5J1ZA 3GTOH 3A7AB 1CKNB 3FKIG 2HUGA 1VS0A 2JE6I 2JA8G 1NY4A 4PNYA 4N9TA 1MI2A 1ENFA 2JA8B 1AFPA 3H94A 1X65A 4ALPA 3OW7A 3VYRA 1B7YB 3FPPA 1Y1WH 2NVXB 4PZ6A 3KJPA 2VXWA 4FF3A 1Y14B 4B3SQ 1A3TA 3OMGA 1EYAA 2Q2IA 2R7FA 3VYUA 1XNRL 1ICFB 4JI0L 3ND8A 1UE7A 3J80L 2OXPA 3NE5B 4DV2Q 4DV3Q 1TWHB 2J7ZA 3GTLH 3S2DH 4PMCA 3TEHB 3A8KE 3I4NG 1HNZQ 4J6HA 1EIHA 4DUZQ 1VQ8A 5C4XH 4C2MB 1ONLA 2OEOA 2Z8LA 3ND9A 4R4OA 2F0WA 4GKJQ 5CORA 3GO5A 4RGNA 2EE1A 3AB9A 5C4ZA 5TSSA 4ZUIA 4M1UB 1B1ZA 4JI3L 4LUOA 4QUFA 2UUAL 4NW2A 4PV1C 5E4XA 1LT6D 1YNNC 5KRUA 2NVYB 2O2LD 4LNQA 4JPBW 2X69A 1TS5A 3MXGA 1STYA 3L0OA 4C1NK 5JJZA 1YEZA 5G3LF 4R8IA 1KDAA 1JJGA 1WTOA 3IKJA 3PF4A 3HS0C 3PGZA 1A0IA 4DV1L 1QCBD 1U4LA 3BDLA 4K2LA 3D8GA 1LTAD 1EIFA 2A6HD 4RKBA 3SK5A 2V4DA 1NR2A 1IL8A 4DK6C 2EJFC 3HOUB 4Y7NH 5T1GA 4FYDA 1K0RA 1GUNA 3V2TA 4KY7A 3OHXC 3R3OA 1IW7D 3I72A 1I6HH 3K7UC 5D3DA 1GJXA 1V1PA 1EWCA 3T56B 3J80c 1FNUA 1JWSD 1E2WA 4XTCS 3TZUA 4DR4Q 5C44G 3KUPA 4A3KH 1KAWA 2ICIA 3G48A 1S5BD 4CGYB 1VDZA 4LF7L 4EVOA 2WB1G 4HAEA 2WKDA 4DR1L 1PFNA 1RF2D 2ZM6Q 3HOXG 2CWPA 1IXRA 1U0LA 3QG1A 2QDLA 3NQTA 3NWSA 3I73A 1ILPA 1DGSA 3N6RA 3VDYA 1PRTB 2Z4IA 3STBD 2V1CC 2EXDA 2NWGA 2FMCA 1LO5D 2K75A 4JI8Q 5M5YH 3J81c 4KI0A 2UUCL 3ONAB 2K52A 4EX5A 2E2IH 4DUYQ 4A76A 5K5PA 1BDOA 2F4IA 2ES2A 5FK9C 4APVA 1DONA 1KL9A 4DNTB 3C3LA 2JA6H 3TQYA 3QOLA 1XMQQ 2ID0A 2PQAB 1FJGQ 3HOYH 3WOEA 2A8VA 1HZCA 4XXEA
chains in the Genus database with same CATH topology
4Q0FA 2EY2A 5ELFA 4G7ZC 1LTBD 1FGBD 1STGA 1B4OA 4C3IG 5IOCA 4KTAA 1HPCA 1H9RA 2B2YA 2I46A 4WRDA 2R92B 4CJ2C 1JORA 1AZPA 3HZXA 3FEWX 5EKLA 1HTPA 3H6MA 2K05A 4ZRZA 1G2TA 2B2VC 3OWFA 1WD1A 3KLSA 4FXKC 1PZKD 4F87A 4IQZA 3SXHA 4G7OC 1TY2A 4L8JA 5FOBB 1I4XA 1HUMA 3TDQA 2XIWA 1E0BA 4FF1A 1QJOA 3M4OB 1UUPA 2K33A 5CMDA 2NN6I 5AFWA 3MHBA 2B2WA 3I91A 5JEAJ 1UAPA 3JAML 4R9WA 4A3DB 1KLGD 3OIQA 2QKIC 3S9WA 3R8BA 4DA2A 5C4HA 2LS01 4X3TA 4KK7A 3NHHA 4TSSA 1V1OA 2B2YC 1R9TB 1BNZA 1TS4A 2EYOA 1EZ6A 3KK7A 4ID6A 1IYVA 1HTLD 4OHJA 1VCIA 3K5OA 4RKLA 5D65A 3S15B 1DXMA 3MFGA 4JK1C 5KNDA 2CW0D 2C5CA 2L0CA 3VR6A 5IT9E 1SJHD 2XWBB 1ZEQX 2XNAC 4QUCA 4IFDG 3NK9A 2K1BA 2SNSA 1EIGA 4IUNA 2IWHA 2HQEA 4QF4A 5EKIA 2B2WC 3BVZA 3DUZA 3PUYA 2LMCB 1VF7A 2D62A 1HFNA 2KEEA 2EY6A 2RKSA 1DJRD 2Q8TA 1SYGA 4AYBB 3KBXA 1HUNA 2R7ZB 5EQ0A 2J4XA 4KY5A 4Z9CB 1Y69U 2KUMA 2EJGC 2OF1A 1EEFD 4A3BB 2Q8RE 5CBEE 3IAYA 1Y8PB 3R2IA 4BWGB 4G4KA 5FO7B 1B53A 1O80A 5C0XJ 2E2DC 4F88A 4DFAA 1A2TA 3K0YA 4IURA 1AW7A 1SEBD 4X3UA 1OXUA 1STEA 1SYEA 1SYBA 3GTLB 3FVQA 1H9JA 2IJ0A 4FNFA 3K5LA 3EQLC 1GOZA 2QDBA 5M3FB 1EYCA 1MD2D 4RAUC 2PZWA 4KD3A 1EEID 2E2JB 1SNQA 1PTOF 2R61A 2KJXA 3DM1A 3IFTA 1HA6A 3MZ5A 2NN6H 1TS2A 1EL0A 1SNDA 2BA0A 1KNAA 4RCNA 3C1FA 1ET9A 1B3AA 4C3JB 2MJ8A 2YYZA 4NMZA 3KLSX 2NTSA 3I70A 2PZTA 2DN8A 1CK1A 2B8FA 5EJWA 4A3MB 4XT1B 2AWOA 1HQMC 4IUUA 4UDUC 5CBAE 2DY8A 3X3NA 3PMFA 2IX3A 2PQEA 1EFID 1VF5C 1RD9D 1OXTA 3SK4A 2XRSD 1RKNA 3BVGA 5JAVA 4A3KB 1ENCA 4IUTA 1I4RA 1EQVA 5IGEA 2SEBD 3VA5A 4DXFA 3VR4A 3WDNA 1LABA 4YIJA 2F1MA 4A3FB 2D9UA 3OIPA 4OO1I 4X3SA 3KLRA 4QB4A 2PO4A 3LWUA 3A56A 2KECA 3D3RA 4TKOB 4F7XA 2E74C 1EU3A 1UNSA 1WTRA 4LK1C 2DNCA 2L1BA 1ESFA 3HOYB 1DZ1A 2BDNA 2F0VA 5KYLA 4CKBA 1LACA 3RZDB 3D6WA 1WTVA 3TP7A 2EPBA 1YNJC 1U4MA 2K01A 1LTTD 1AP0A 3GV6A 1G8ZD 2F0HA 3HKZB 2WV6D 2PYKA 5I6YA 3LX0A 2VB2X 2F0QA 1FR3A 2M9VA 5BN5A 1I4HA 3T53B 1SSOA 1MSHA 4DF7A 1SMYC 2JYOA 1KDBA 3PUVA 4I7ZC 3VA7A 5JVH3 2FHTA 2WINB 1S5CD 3M4YA 2WACA 4HEDA 1STHA 5IT9L 1JOQA 3DMUA 2L4NA 5HGTA 1PTOC 4Q5VA 2SDFA 2MHVA 1S5DD 1HHVA 2E76C 1F2YA 1A15A 4S3SA 2N88A 3GTQB 2BE5C 1MGSA 1VMCA 3BDCA 1AN8A 2ZT9C 1B50A 1SDFA 4N9PA 3NTHA 4A3EB 2JP1A 4DGZA 3NP8A 2PZUA 1X3PA 1A2UA 1FNWA 2HDLA 3K59A 2N55A 2J0TD 5I2XA 3A8JE 2GA4B 4EQNA 1ZKOA 1F9SA 1L0XB 3HEJA 1G291 3MXUA 3FKIB 3URYA 1UEAB 4BA1I 3U9OA 5C0XI 1BQQT 3CKIB 1I50B 1PRTF 3IL8A 2AQ1B 3OOCA 4NP5A 2B2UA 2K32A 5IIFA 4HCEA 1H9KA 2MP1A 1ZXTA 4KD4A 4OO1H 2A69C 3A8IE 1BF4A 2LFNA 2FINB 3I4NB 3VYTA 1G91A 1I6VC 1SE3A 3GD7A 2PW5A 3C2PA 1W6KA 1D5ZC 1Y8NB 3H09A 3HP3A 3GTGB 4K8IA 1RTNA 1LTID 5A2QL 1SAPA 5JEAH 3J81L 1Q1EA 3SK6A 3K5NA 2HCCA 3S1MB 1BCPD 1DYQA 2O4XA 1M8AA 3FRPB 1CT1D 2A68C 4K5VA 1V43A 4U673 5EPJA 2F0MA 4L6TB 1JOOA 4CHTB 1STBA 2NYZD 3PUZA 1EY4A 1WTXA 2QEJC 1CZWA 2B2UC 3TBIB 3BDOA 5C44B 2NN6G 1F2MA 3NPPA 3QB3A 2WB1B 2EDGA 3QIAA 2IX1A 3HOXB 4HN7A 3BS1A 2RA4A 1TS3A 1KLUD 4CKCA 1GUTA 3A55A 2AUJD 3KF8A 3D4DA 2F0LA 1D1KA 3GQBA 4DK1A 4XIGS 1QWYA 1SBBB 2ENBA 1PZID 2XSCA 1PZJD 1O78A 3Q23A 1TWCB 1GUSA 1I3QB 4C3IB 2NZ1D 2WIIB 3GP7A 3RMHA 1B9MA 3TP8A 5I9OA 1BXTA 2DNEA 4CJ0B 2Y0SB 1MSGA 1PRTC 4V190 5C0XH 2F0FA 3BVMA 4HMJA 1FD7D 5J39A 1TT2A 1X32A 1PTOH 1TVXA 2JEBI 4LMQD 5I9PA 3I90A 2D2CC 2A6EC 4C1NI 3X3MA 1JR0D 2O5IC 4DAYA 2X6LA 4OL7A 4A93B 3T51B 2A74C 1AZQA 3A54A 5CC4A 1YNND 3P75A 2M2LA 4H7BA 1WD0A 2FFKB 1D2BA 3K58A 1LTGD 1U9RA 3BZDB 1SE2A 2B63B 4KHZA 4BY1B 3V05A 2IT1A 4RH6A 4DU9A 3Q22A 3NBHA 1XX8A 4XT3B 1SE4A 4BS9A 3I4MB 1CHPD 4KN4C 1SNCA 1STNA 2EY1A 1T5XD 1RHPA 1STAA 4OIKA 1ENAA 3FMCA 4IUQA 1K8OA 4K2KA 5IGBA 3J7YW 5JVG3 3U9SA 1DOKA 2K04A 4ILWA 4RHRA 3NQIA 1FYCA 4L63B 1EY9A 1QG7A 3MTSA 1RDPD 1SNPA 3DHQA 1GUGA 2F0EA 4C56C 1TR5A 2CQAA 1BUVT 3S16B 1DCZA 5F2DA 3RUZA 2SOBA 2H1EA 5EBCA 5ELEA 2RDGA 3M7NA 2VUMB 2K7VA 1PFBA 3GTOB 5CV9A 5C5LA 4ME5A 1ML0D 3RD4A 5BN3A 5K36H 1X3QA 1Y1WB 3TMEA 3C1EA 4KMUC 4C3HG 3T13A 4K5XA 3P20A 4OO1G 1S4ZA 5HURA 1F77A 2F0TA 4K5WA 2ZXPA 3S2DB 3C46A 4BBSB 2IPKD 4H44C 1JWUD 5LHY1 5C4XB 1F2ZA 3FPUB 5I2YA 4EQPA 4FO2A 5D14A 2IX0A 3Q6SA 1WTPA 3CRKC 5JEAG 3LNNA 2FMMA 1RCVD 2B8GA 4DNRB 3K6OA 2KCCA 3ZYYX 1S5ED 1XWEA 2QCPX 4DAVA 4IN3A 5COYA 2KEDA 2CHBD 2A73B 1GHKA 1D5XC 3DXJC 4FF4A 4MHEA 4O1NA 4KKSA 4Y7NB 2WAQB 4OGQC 5FO8B 5LL6S 2NVTB 1QNKA 4B08A 2PNRC 1I6HB 4MIUA 3FDTA 1JCKB 1PXUA 3MWYW 5DAUA 5CV4A 3S1RB 1EQTA 4WFN3 4ZK9B 4EGVA 4QCLA 3SVMA 1ZYRC 1WVLA 4ULLA 1OXSC 5I6WA 2F3WA 5I4DA 1Z6HA 1RTOA 2O5JC 5M5YB 1B9NA 1JC7A 1WTWA 5M5XB 1KNEA 3DEOA 1U4PA 2E2IB 1LTSD 2ICEC 1OO9B 5EPKA 2JA6B 3O13A 3VYSA 4KKTA 1JICA 3I3CA 3I4LA 2JSOA 1A6XA 1O7YA 4HR7B 1BCPB 1AEXA 4QIWB 2NVQB 1GHJA 5E4WC 3AMUA 3EROA 4IUPA 1LT4D 5EBDA 3HRZC 5C0XG 2E75C 4TQUS 4RWSC 4JBWA 4DN4M 3LWEA 2F0KA 2BA1A 5ISRA 3GV3A 1IKLA 1Z47A 1XTCD 1C48A 2SNMA 3IFDA 3UI2A 4IZ8A 4RHSA 5CV6A 1NAPA 5CV7A 5EPLA 1LTRD 1FNVA 5CV5A 1XXGA 3BG3A 3SDZA 2EYMA 2Q8IB 2IW3A 2NBFA 4LAAA 3TZDA 2G9DA 1H9SA 4RGOS 1KAAA 3H3VC 2ZXRA 2H4OA 3NTIA 1Q1BA 3Q0AA 1H9MA 2RBMA 2L12A 1QNUA 1EY8A 2A6HC 1D5MC 2F0JA 3V96A 1HFGA 2QILA 4KY6A 3R2TA 4UAIA 1L0YB 1CA6A 3OMCA 1EU4A 1IW7C 4XQNA 1PDQA 5JPNC 3SK8A 1EYDA 1SFOB 3PV0A 1H9SB 3D6CA 4ZUJA 1DOLA 2VB3X 4HTHA 3VR3A 3P1HA 3CRLC 4EQOA 3A7LA 2BOSA 2LY7A 2ZXOA 5T1IA 2MPMA 1QILA 1M4VA 4K8JA 1S5FD 2K5DA 3HGBA 2EYJA 2TMPA 5KGUA 3G6JB 1E2ZA 5CYUA 3EFXD 1MBYA 1SNOA 2NTTA 1EY5A 2PMZB 2AWNA 3J7AF 2K5WA 3R93A 1O7LA 3SR1A 1KABA 1Z7TA 4XDXA 1K83B 5IGFA 4NKLA 5KNBA 2WP8J 3E6ZX 5EGTA 3D31A 3QO2A 2F3VA 4ABNA 2JEAI 5E3FA 1DM0B 4R8NA 5IGGA 5IGCA 1OXXK 5K36G 1HQRD 4NDXA 1YNJD 4ZAIA 2F0SA 3L3OC 3K57A 1NR4A 4B9WA 3CQZB 1EY6A 3OPOA 2YU9B 3W3AA 1SNMA 2XWJB 1EY0A 2MUYA 1ET6A 4G7HC 3NXWA 5BN4A 1GXDC 1SMYD 5A35A 2L5TA 2PPBC 4ZKBB 3PUXA 3G7LA 3VR2A 2L11A 4FXGC 3HOWB 5FKAC 1JQYD 4BBRB 4H13C 2B2TA 1XYIA 3D4WA 2R3ZA 1PTOD 3MVVA 4ZKCB 1Q12A 3DWAA 4XQQA 2BE5D 1TQOA 2MGSA 4TRDA 5DEHA 3QJYA 2BCOA 2JA7B 5EKKA 2RVLA 2B2VA 2L9HA 4KKUA 4XQJA 3KBGA 1Q90A 5NUCA 3S2HB 2BDOA 4QMGA 3S14B 1DD2A 1G2SA 5IODA 4K14A 4X3KA 3N52A 1CHQD 2CW0C 4A3JB 4FF2A 3E5SA 1F9QA 3DEPA 4K6LA 1V1PB 2OT2A 4ODGA 4XYQA 4IFDJ 2XRQD 2A5HA 1CI3M 3L7ZC 1TWGB 3QWNA 3PIO3 1RJTA 4J8QA 3W2DA 4KJNA 2B2TC 2A69D 1B44D 2F0DA 4IUVA 1QOHA 1LT5D 4J1MA 3AU7A 4PQXA 3TSSA 5DM73 4BY7B 4RGTA 1C8CA 1LT3D 2FJ2A 4K6DA 5C4JB 3EA6A 3RLFA 2KHSA 3NTKA 4V0BA 3QOJA 5KNCA 4BA2I 1Q8IA 1A3UA 1K8MA 2RDFA 2F0IA 1F9PA 2Z4HA 5CR3A 1WCMB 2JXMB 1SJED 2F0PA 2F0OA 2WKCA 5C3EB 1I4GA 1V8QA 5C5MA 2X6GA 2CVRA 1PLFA 3TP5A 3TN2A 1IHZA 5CGKA 1BR9A 1F2LA 3SEBA 5M3MB 2EYFA 2EVBA 5C3XA 1EOTA 2EY5A 3MC0B 2A68D 1W6JA 3E0JA 4PMWA 3PO2B 2AQ2B 2XN9C 1Y8OB 1TWAB 4CKEA 1RODA 1G6ZA 2AUKA 4WORA 3GTPB 1I4PA 2RQXA 4RGMA 1BO0A 3HOVB 1CZGA 3M7GA 3H0GB 4U68A 3PUWA 1J9OA 2Z1CA 2TSSA 4HCSA 1KTKA 1QE6A 3CHBD 4FVMA 1NUCA 2RSOA 2EYHA 3SHLA 1LV9A 5FLXE 3L9AX 5D3IB 3DWQA 4CBVA 1I4QA 2R6GA 5KIXA 2K28A 3MFYA 1R4QB 4F8MA 2XVSA 1BBXC 5DNFA 2D5DA 5E1FA 1F9RA 3WOFA 2M00A 4RCOA 2B39A 4RA8A 2PCFB 1A3VA 1VMPA 5CV8A 1PRTD 4CJ1B 3HOZB 1GUOA 3S1NB 1QB5D 1CM9A 1TIID 2EYPA 5KEEA 4H0LC 3K5MA 3EVQA 4C3HB 1CQVA 4ZYSA 5KYIA 4OIJA 1TKWB 5IGDA 4WJWA 3NWTA 1EY7A 2VNUD 1TWFB 4M8AA 2F0GA 4LJZC 2EZVA 1U4RA 2A6ED 3MA2B 2QF7A 3F2UA 1II3A 2K6AA 2E2HB 1BCPF 1CFMA 4KJOA 4O42A 3NBIA 2G9HD 1D6EC 5M5WB 2KOLA 5C3WA 3GTMB 1CQFA 3SE0A 4ZLTF 3PO3B 5G3LD 5JPMC 3ERQA 3S17B 3J80E 5ELDA 1OXVA 2EXZA 4DAPA 1SYFA 3H91A 3GTJB 1TY0A 4RFBA 2RSNA 4G57A 3P7JA 1PFMA 2KA7A 4KV6A 1J8IA 3OWEB 4IFDI 3K7AB 4C3JG 3BYYB 4DXGA 5A2QE 3M85A 1JE4A 5M9OA 3J81E 1SXTA 1LLRD 1TU2B 3T4AC 1Q3LA 1EZ8A 2DY7A 2F03A 1KDCA 2AQ3B 4IALA 5DM63 2K5QA 3I8ZA 1Y1VB 3GTKB 2K03A 1SYDA 2KQ3A 2F0UA 3NUCA 2JA5B 1BOSA 3M3YB 2EOTA 3DWPA 1IKMA 3OSOA 4P2CB 3TP6A 2RDHA 5FO9B 1JWMD 3HG9A 2HDMA 4B9XA 4HMIA 1CTMA 4FP5D 4A3IB 4PMBA 5LL6X 4A3GB 2EJMA 3CU7A 1HRJA 4ZQ3A 3BYTB 1O7ZA 3S1QB 1NSNS 4MN3A 2NUCA 1CA5A 3T16A 1PTOB 3PIP3 3MAQA 3MXNA 2R93B 1E2VA 5ELBA 1JB3A 1DOMA 4KHVA 1HXYD 4GZYC 5FLXL 1ICWA 1BCPC 2HCIA 2C9OA 3D4RA 2LKVA 2F0NA 1C4QA 4XYOA 4E6IA 1HCZA 1NCVA 1ILQA 1R4PB 3EJIA 1SYCA 1PYWD 4HSPA 2I07B 2PW7A 3J7AV 4DK0A 3Q24A 5ELCA 5C6AA 2KCNA 2IL8A 1JOKA 1GUWA 1EWHA 2KVMA 3RZOB 1T5EA 1IYUA 1ESRA 3MEHA 2NB0A 2L55A 1B2TA 3MXPA 3ITPA 3NSWA 5JOBA 4KN7C 4IFDH 1ZYRD 1PMRA 2EYLA 1WTQA 3JAME 3VR5A 4HSVA 1D1IA 5J22A 1HA5A 4FXDA 4I65A 5J1ZA 3A7AB 2HUGA 2JE6I 4PNYA 4N9TA 1MI2A 1ENFA 2JA8B 1AFPA 3H94A 3OW7A 3VYRA 3FPPA 2NVXB 2VXWA 4FF3A 1A3TA 3OMGA 1EYAA 3VYUA 3ND8A 3J80L 2OXPA 3NE5B 1TWHB 2J7ZA 4PMCA 3A8KE 4J6HA 1EIHA 4C2MB 1ONLA 2OEOA 2Z8LA 3ND9A 2F0WA 5CORA 3GO5A 4RGNA 2EE1A 3AB9A 5C4ZA 5TSSA 4ZUIA 4M1UB 1B1ZA 4QUFA 4NW2A 4PV1C 5E4XA 1LT6D 1YNNC 5KRUA 2NVYB 2O2LD 2X69A 1TS5A 3MXGA 1STYA 4C1NK 5JJZA 5G3LF 4R8IA 1KDAA 1WTOA 3IKJA 3HS0C 1QCBD 1U4LA 3BDLA 4K2LA 3D8GA 1LTAD 2A6HD 4RKBA 3SK5A 2V4DA 1NR2A 1IL8A 2EJFC 3HOUB 5T1GA 4FYDA 1GUNA 3V2TA 4KY7A 3OHXC 3R3OA 1IW7D 3I72A 5D3DA 1GJXA 1V1PA 1EWCA 3T56B 1FNUA 1JWSD 1E2WA 4XTCS 3TZUA 3KUPA 2ICIA 1S5BD 4CGYB 1VDZA 4EVOA 4HAEA 2WKDA 1PFNA 1RF2D 3QG1A 3NQTA 3NWSA 3I73A 1ILPA 3N6RA 1PRTB 2Z4IA 2NWGA 2FMCA 1LO5D 4KI0A 3ONAB 5K5PA 1BDOA 2F4IA 5FK9C 1DONA 4DNTB 3C3LA 3QOLA 2ID0A 3WOEA 4XXEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0I A;  2EY2 A;  4EQO A;  5CR3 A;  1STG A;  2F0T A;  4NP5 A;  4K5W A;  2F0P A;  2OEO A;  2F0O A;  4RKL A;  1A3V A;  2F0H A;  3MZ5 A;  1EZ8 A;  3D4W A;  2F0W A;  5IIF A;  3EJI A;  1SYC A;  2PYK A;  5IOC A;  1KDC A;  1SND A;  4KTA A;  5CV8 A;  5C5M A;  5I6Y A;  4IAL A;  3D4D A;  1F2Z A;  3TP5 A;  5C4Z A;  3MVV A;  1IHZ A;  2F0L A;  4KD4 A;  4WRD A;  3LX0 A;  4K8J A;  4ZUI A;  1SNC A;  2EYP A;  2F0Q A;  3C1F A;  5CGK A;  5KEE A;  2EYJ A;  2PW7 A;  4EQP A;  5KGU A;  3EVQ A;  2EYF A;  1JOR A;  1TQO A;  2ENB A;  4NMZ A;  1SYD A;  4TRD A;  5DEH A;  5C3X A;  1AEX A;  1STN A;  2EY1 A;  2EY5 A;  5C6A A;  3P1H A;  2KQ3 A;  2F0U A;  1STA A;  3HZX A;  1SNO A;  3NUC A;  4DF7 A;  5KYI A;  3NK9 A;  5KRU A;  5IGD A;  1KDB A;  3ERO A;  2PZT A;  1JOK A;  1ENA A;  1EY5 A;  2SNS A;  5EKK A;  4IUN A;  5EKL A;  2HQE A;  1EY7 A;  1STY A;  3H6M A;  4K2K A;  5IGB A;  1KDA A;  4QF4 A;  3OWF A;  2F0G A;  3MEH A;  3SR1 A;  2WAC A;  3PMF A;  1KAB A;  3OSO A;  5NUC A;  3MXP A;  2PQE A;  2PW5 A;  1STH A;  3ITP A;  3BDL A;  2F0K A;  4K2L A;  3TP6 A;  5IGF A;  3D8G A;  5JOB A;  5ISR A;  4QMG A;  4RKB A;  3SK5 A;  3SK4 A;  4NKL A;  3TP8 A;  1RKN A;  4K8I A;  5JAV A;  1JOQ A;  2SNM A;  1II3 A;  5IOD A;  4K14 A;  4WOR A;  5I9O A;  3SXH A;  4IZ8 A;  5EGT A;  1EY9 A;  3DMU A;  1ENC A;  5CV6 A;  5HGT A;  1EQV A;  3V2T A;  4KY7 A;  3R3O A;  5IGE A;  2EYL A;  2EY6 A;  2RKS A;  3VA5 A;  1SNP A;  3DHQ A;  4KJO A;  2F0F A;  3E5S A;  4B9X A;  4HMI A;  5CV7 A;  1F2Y A;  4HMJ A;  3SK6 A;  2F0E A;  2F3V A;  4S3S A;  5J39 A;  1TR5 A;  1SYG A;  4YIJ A;  5E3F A;  4PMB A;  5J22 A;  1TT2 A;  5CV5 A;  2O4X A;  3MHB A;  4R8N A;  5F2D A;  4I65 A;  4KY5 A;  3RUZ A;  4K5V A;  3BDC A;  2SOB A;  5C3W A;  5IGG A;  2EYM A;  2OF1 A;  5J1Z A;  4ODG A;  4MIU A;  4NDX A;  4EVO A;  4LAA A;  4ZQ3 A;  2F0S A;  1NUC A;  4N9P A;  4QB4 A;  1KAA A;  2EYH A;  1NSN S;  4PNY A;  3SHL A;  2F0M A;  4N9T A;  2NUC A;  4B9W A;  1JOO A;  5DAU A;  3ERQ A;  1STB A;  5CV4 A;  4DFA A;  1EY6 A;  3NQT A;  1A2T A;  3NP8 A;  4DGZ A;  5I9P A;  2PZU A;  2RBM A;  5CV9 A;  1EY4 A;  1A2U A;  2EXZ A;  5C5L A;  4F7X A;  3T16 A;  1EY8 A;  3S9W A;  5IGC A;  1SNM A;  4ME5 A;  1EY0 A;  1SYF A;  1SYB A;  1SYE A;  2F0J A;  4KJN A;  4OL7 A;  2F0D A;  5C4H A;  4KY6 A;  1A3T A;  3NXW A;  5KIX A;  3OMG A;  1EYA A;  4G57 A;  3OMC A;  4J1M A;  3NHH A;  4EQN A;  4KV6 A;  2QDB A;  5I6W A;  5M9O A;  2F3W A;  4F8M A;  3U9O A;  1EYC A;  4KHV A;  3TME A;  2F0V A;  1F2M A;  3C1E A;  5CC4 A;  2OXP A;  5K5P A;  5KYL A;  3P75 A;  3QB3 A;  3SK8 A;  3T13 A;  3HEJ A;  4E6I A;  2EYO A;  1EZ6 A;  4H7B A;  4K6D A;  2PZW A;  4KD3 A;  1EYD A;  4ID6 A;  2LKV A;  5E1F A;  2KHS A;  4K5X A;  3TP7 A;  2F0N A;  1U9R A;  3D6C A;  3QOJ A;  4PMC A;  4ZUJ A;  2M00 A;  3QOL A;  4HTH A;  1SNQ A;  5HUR A;  1A3U A;  2RDF A;  4J6H A;  4DU9 A; 
#chains in the Genus database with same CATH topology
 4Q0F A;  2EY2 A;  5ELF A;  1HNX L;  4HID A;  4G7Z C;  1LTB D;  1FGB D;  3M9B A;  1STG A;  4MZ9 A;  1B4O A;  4C3I G;  4AQY Q;  5GAH C;  4ME3 A;  5IOC A;  4LWC A;  4KTA A;  3H3V H;  3RNU A;  1HPC A;  1HR0 W;  1H9R A;  2B2Y A;  2I46 A;  4O2D A;  4WRD A;  1XPU A;  2R92 B;  2Y0S G;  4CJ2 C;  1JOR A;  1V1Q A;  1AZP A;  1L2F A;  3HZX A;  1KQS A;  3F2B A;  3FEW X;  3CC7 A;  1Q81 C;  5EKL A;  1HTP A;  3H6M A;  4JOI C;  4JI4 L;  1BVS A;  2K05 A;  4ZRZ A;  1G2T A;  2B2V C;  1EFW A;  2Z9H A;  3OWF A;  4LF4 Q;  4FDB A;  1SRU A;  1WD1 A;  3KLS A;  3UDX A;  4A3L G;  4NB3 A;  4FXK C;  1PZK D;  5GAD C;  1HNW Q;  4F87 A;  4IQZ A;  3SXH A;  2IHF A;  4OX9 L;  1N32 L;  4G7O C;  1I94 Q;  3TS0 A;  1TY2 A;  4L8J A;  5FOB B;  1XMO Q;  1I4X A;  1HUM A;  3TDQ A;  4DR5 L;  1VQG A;  2XIW A;  1E0B A;  1PV4 A;  3CC4 A;  1QJO A;  4FF1 A;  1PH9 A;  3M4O B;  1UUP A;  1OTC A;  2K33 A;  5CMD A;  2NN6 I;  2OQ0 A;  4CDE C;  5AFW A;  5IWA Q;  3MHB A;  4JV5 L;  2B2W A;  3I91 A;  5JEA J;  1UAP A;  3JAM L;  4R9W A;  2B63 G;  4A3D B;  1KLG D;  4BY1 G;  4JCV E;  3CCV A;  3OIQ A;  2QKI C;  3S9W A;  4DR2 L;  2UXC L;  3R8B A;  1VQ9 A;  4DA2 A;  4DAY B;  5C4H A;  2LS0 1;  3OTO Q;  4X3T A;  4KK7 A;  3NHH A;  4TSS A;  1V1O A;  2B2Y C;  1R9T B;  2ALY B;  1BNZ A;  1TS4 A;  4YHH L;  2EYO A;  1EZ6 A;  3KK7 A;  2CH4 A;  4ID6 A;  4GNX A;  1IYV A;  1HTL D;  4OHJ A;  3H15 A;  1VCI A;  3CCM A;  4R4C A;  2DUD A;  3K5O A;  4RKL A;  5D65 A;  3S15 B;  1DXM A;  3M4Q A;  3MFG A;  3NBH B;  4JK1 C;  4K0K L;  3AQQ A;  4NXM Q;  5KND A;  2CW0 D;  3E0E A;  4JI7 Q;  2C5C A;  2L0C A;  5IP9 H;  3VR6 A;  4LF5 Q;  2WFW A;  4GOP A;  3SGI A;  2CQO A;  5IT9 E;  1SJH D;  2XWB B;  1ZEQ X;  1VQC A;  2XNA C;  4QUC A;  4IFD G;  4OWT B;  1K83 H;  3NK9 A;  5GQO A;  2K1B A;  2SNS A;  1EIG A;  4IUN A;  2IWH A;  2HQE A;  4IPC A;  3BZC A;  4QF4 A;  5EKI A;  3JAM c;  2B2W C;  1W3S A;  1FGU A;  1QUQ B;  2EIF A;  2Z0S A;  3BVZ A;  4JI5 L;  3DUZ A;  3PUY A;  4IO9 A;  5AJ3 L;  2VUM G;  4IPD A;  2LMC B;  1VF7 A;  2H5X A;  5LMU L;  2D62 A;  1HFN A;  4JG2 A;  3HFZ B;  2KEE A;  2EY6 A;  2RKS A;  3ULL A;  2LXJ A;  1DJR D;  1LM0 A;  2Q8T A;  1SYG A;  4AYB B;  3KBX A;  1HUN A;  2R7Z B;  1Y1W G;  3CQZ H;  4JBJ A;  3PSI A;  2J4X A;  4KY5 A;  5EQ0 A;  2YU9 H;  4Z9C B;  1Y69 U;  2KUM A;  2EJG C;  2OF1 A;  1EEF D;  1W2B A;  4A3B B;  2Q8R E;  5CBE E;  3IAY A;  1Y8P B;  3R2I A;  4BWG B;  1GD7 A;  4G4K A;  5EAY A;  4IJL A;  5FO7 B;  1B53 A;  1O80 A;  1L1O B;  5C0X J;  2E2D C;  4F88 A;  4GNX C;  4DFA A;  1KD1 C;  1A2T A;  3W1B A;  3K0Y A;  4IUR A;  1AW7 A;  4DKA C;  1SEB D;  4DV0 L;  4X3U A;  1OXU A;  1STE A;  1SYE A;  1SYB A;  1D7Q A;  3KDF B;  3UE1 A;  3GTL B;  3FVQ A;  1H9J A;  2IJ0 A;  3AEV A;  4FNF A;  2VQF L;  3K5L A;  1X55 A;  3EQL C;  1WTH A;  2VZA A;  3HOW H;  3UE0 A;  5C4X G;  1GOZ A;  2QDB A;  5M3F B;  4P71 A;  1EYC A;  1MD2 D;  2HHH Q;  4BBR H;  4RAU C;  4GOP C;  1K73 C;  2PZW A;  4KD3 A;  5IYC H;  1EEI D;  2E2J B;  1Q8K A;  1SNQ A;  1PTO F;  2R61 A;  3I4O A;  2KJX A;  3DM1 A;  4GN5 A;  1QVC A;  4LF6 Q;  3IFT A;  4JI1 Q;  1HA6 A;  3MZ5 A;  1PH7 A;  2NN6 H;  1TS2 A;  1EL0 A;  3NEN A;  1SND A;  2BA0 A;  4YCW A;  3UDF A;  1KNA A;  1YHB A;  4RCN A;  2JA7 H;  3CW2 C;  3C1F A;  1ET9 A;  1YJN A;  4J15 A;  1K0S A;  1B3A A;  3KF6 A;  4C3J B;  2MJ8 A;  2YYZ A;  4NMZ A;  4LFC Q;  3KLS X;  2NTS A;  3S2H H;  5LMN Q;  2PNH A;  1NBW A;  3I70 A;  2PZT A;  4DR3 L;  2LSS A;  2DN8 A;  1CK1 A;  2B8F A;  5EJW A;  4A3M B;  4XT1 B;  2AWO A;  1HQM C;  4IUU A;  4UDU C;  5CBA E;  2DY8 A;  3X3N A;  3PMF A;  2IX3 A;  2PQE A;  4HJ8 A;  3I55 A;  1EFI D;  1VF5 C;  1RD9 D;  4A3J H;  1OXT A;  1B70 B;  3SK4 A;  2XRS D;  1RKN A;  3BVG A;  3PIP A;  4OEM B;  5JAV A;  1MJC A;  4A3K G;  1TWC H;  4A3K B;  1J5E Q;  1ENC A;  4IUT A;  1I4R A;  1YHA A;  1EQV A;  5IGE A;  2SEB D;  4LF9 Q;  4X66 L;  3QR8 A;  3VA5 A;  3KJO A;  4DXF A;  3VR4 A;  2NZH A;  3WDN A;  2IY5 B;  1LAB A;  4YIJ A;  2F1M A;  4A3F B;  4QQB X;  2D9U A;  1TWG H;  3OIP A;  3CXC A;  4OO1 I;  4X3S A;  3KLR A;  1HZ9 A;  2ZTC A;  4QB4 A;  2L15 A;  2PO4 A;  3LWU A;  3A56 A;  2KEC A;  4R4Q A;  4B3R L;  1KC8 C;  3D3R A;  1N36 Q;  4TKO B;  4F7X A;  2E74 C;  1HJP A;  1EU3 A;  4UP9 A;  1O7I A;  1UNS A;  1WTR A;  1PH6 A;  2JA6 G;  4LK1 C;  4BY7 H;  3HOY G;  4OWX B;  2DNC A;  2L1B A;  5C4J H;  1ESF A;  4NXN L;  3HOY B;  2YTV A;  2B3G A;  4LFB Q;  1PA6 A;  2UUB L;  2CH4 W;  1DZ1 A;  2JQO A;  2BDN A;  2F0V A;  1C7Y A;  5KYL A;  4CKB A;  1LAC A;  1WCM H;  3RZD B;  2JN4 A;  4DR6 Q;  3D6W A;  1WTV A;  1P8L A;  3TP7 A;  4UPA A;  2EPB A;  1YNJ C;  4KHP L;  4X65 Q;  3K80 C;  1U4M A;  2K01 A;  3F2D A;  1LTT D;  2MQH A;  2ASB A;  1AP0 A;  3GV6 A;  1G8Z D;  2F0H A;  3HKZ B;  2WV6 D;  1XNQ L;  5M3M H;  4DV6 L;  2PYK A;  5I6Y A;  3CF5 A;  3LX0 A;  1M1K C;  2VB2 X;  2F0Q A;  1FR3 A;  1KRT A;  5BR8 L;  2M9V A;  3NEM A;  1I4H A;  5BN5 A;  1TWA H;  1RIP A;  3T53 B;  1SSO A;  1LUZ A;  1MSH A;  1SMY C;  4DF7 A;  2JYO A;  3I4M H;  1KDB A;  3PUV A;  4I7Z C;  4QY7 A;  3VA7 A;  5JVH 3;  2FHT A;  3GTP H;  2WIN B;  1S5C D;  3M4Y A;  2WAC A;  4HED A;  1STH A;  3H0G H;  5IT9 L;  1JOQ A;  1Q7Y C;  1G6P A;  4DV7 L;  4JYA Q;  2E5L Q;  3DMU A;  2L4N A;  3CAM A;  5HGT A;  1PTO C;  1X3E A;  4Q5V A;  2SDF A;  2MHV A;  1S5D D;  1HHV A;  2E76 C;  4DUZ L;  1F2Y A;  1A15 A;  4S3S A;  3U4V A;  1PHJ A;  2N88 A;  3GTQ B;  2VL6 A;  2BE5 C;  2OQK A;  1MGS A;  1VMC A;  4GKJ L;  1CKN A;  3BDC A;  1AN8 A;  2ZT9 C;  1B50 A;  1SDF A;  3IRB A;  1XTD A;  3EN2 A;  4A75 A;  3CCL A;  3TRZ A;  4N9P A;  3NTH A;  4A3E B;  2JP1 A;  4DGZ A;  1HR0 L;  3NP8 A;  2PZU A;  1X3P A;  1A2U A;  1VQJ A;  1FNW A;  1K9M C;  2HDL A;  3K59 A;  2N55 A;  2J0T D;  5I2X A;  3A8J E;  2GA4 B;  4EQN A;  1ZKO A;  3D0F A;  1VQB A;  1F9S A;  1X54 A;  3J7A 5;  1L0X B;  3HEJ A;  1G29 1;  3MXU A;  3FKI B;  3URY A;  1UEA B;  4BA1 I;  5IP9 G;  3U9O A;  5C0X I;  1BQQ T;  3T1H L;  3CKI B;  1I50 B;  1PRT F;  3HOZ H;  3IL8 A;  4DV5 L;  3S1N H;  2AQ1 B;  2K5N A;  1VQK A;  3OOC A;  5IT9 c;  4NP5 A;  4X62 Q;  2B2U A;  2B29 A;  2K32 A;  5IIF A;  4A3C H;  4C3H H;  4HCE A;  1H9K A;  2MP1 A;  3G71 A;  3J7Z C;  1ZXT A;  4KD4 A;  4AH6 A;  2A69 C;  4OO1 H;  4B3M Q;  1PFS A;  3A8I E;  2KHJ A;  1X56 A;  1TWF H;  1BF4 A;  2LFN A;  4BBS H;  4DV4 L;  2FIN B;  4IOC A;  3J81 j;  3I4N B;  3VYT A;  1G91 A;  5ELO A;  1I6V C;  1PVO A;  1D8L A;  1VQM A;  2VQE Q;  2E2H H;  1SE3 A;  3GD7 A;  2ATW A;  2PW5 A;  3C2P A;  1W6K A;  1D5Z C;  1Y8N B;  3H09 A;  1NJI C;  3HP3 A;  3GTG B;  4K8I A;  1RTN A;  1LTI D;  5A2Q L;  1SAP A;  5M5W H;  5JEA H;  3J81 L;  3BJU A;  1Q1E A;  1YIJ A;  3GTM H;  2N49 A;  3SK6 A;  3K5N A;  2HCC A;  3S1M B;  4AYB E;  2LXK A;  1BCP D;  1DYQ A;  3JC6 6;  5IP7 H;  3PO3 H;  2O4X A;  1M8A A;  2UU9 L;  3FRP B;  1CT1 D;  3S17 H;  2A68 C;  4K5V A;  1EUJ A;  1V43 A;  3PIO A;  1A8V A;  4JVZ A;  3U50 C;  4U67 3;  3HOW G;  5EPJ A;  2F0M A;  4L6T B;  1JOO A;  3CCJ A;  4CHT B;  2BH8 A;  1STB A;  1VQI A;  2NYZ D;  4IJH A;  3PUZ A;  1EY4 A;  2NVT H;  2UXB Q;  1WTX A;  2QEJ C;  5FJ8 H;  5IYC G;  1CZW A;  3K7A H;  2B2U C;  3TBI B;  3BDO A;  5C44 B;  3S1R H;  2NN6 G;  1F2M A;  3NPP A;  3QB3 A;  2KCT A;  1HNW L;  2WB1 B;  2EDG A;  3QIA A;  2PQA A;  2IX1 A;  1I94 L;  2JA7 G;  3HOX B;  1QZG A;  4HN7 A;  3CME A;  2RA4 A;  3BS1 A;  1XPR A;  1TS3 A;  1KLU D;  4CKC A;  1GUT A;  3A55 A;  5IWA L;  1Y1V H;  3RLN A;  4HJ9 A;  2AUJ D;  3KF8 A;  5M5X H;  2D0P A;  3D4D A;  4JI0 Q;  4DR7 Q;  2F0L A;  1D1K A;  3GQB A;  4DK1 A;  4A3J G;  4XIG S;  1QWY A;  1SBB B;  2ENB A;  1PZI D;  2XSC A;  5GAG C;  1PZJ D;  1G51 A;  1O78 A;  3Q23 A;  1TWC B;  2YTY A;  1SLJ A;  1GUS A;  1VQP A;  1I3Q B;  4C3I B;  2NZ1 D;  2WII B;  4L5Q A;  1JJC B;  2N78 A;  3GP7 A;  2UXD Q;  2NVQ H;  3RMH A;  1S3O A;  1B9M A;  3TP8 A;  1VQH A;  3KF8 B;  3F1Z A;  3ER0 A;  5I9O A;  1BXT A;  2DNE A;  4CJ0 B;  2UUA Q;  2Z6B A;  2Y0S B;  1MSG A;  1PRT C;  4V19 0;  4A3G H;  5C0X H;  2I5L X;  2F0F A;  2I5M X;  3BVM A;  4HMJ A;  1FD7 D;  4CDD C;  1WFQ A;  3PCO B;  5J39 A;  1L0W A;  4R4I A;  3S1Q H;  4QGU A;  1TT2 A;  3HKS A;  3AFQ A;  1B3Q A;  1X32 A;  4DV1 Q;  1EQR A;  4BY7 G;  1GKH A;  3FP9 A;  4LF5 L;  1PTO H;  1TVX A;  1PYB A;  2JEB I;  1YIT A;  2JK8 A;  2R93 H;  1KRS A;  4LMQ D;  5I9P A;  3I90 A;  1J6Q A;  2D2C C;  2A6E C;  4NPS A;  3X3M A;  1WCM G;  4C1N I;  1X6O A;  1JR0 D;  2O5I C;  4DAY A;  1QVG A;  4A93 G;  2X6L A;  4OL7 A;  4A93 B;  3T51 B;  2A74 C;  1AZQ A;  1Q82 C;  3A54 A;  3L2P A;  4LF7 Q;  4DR1 Q;  5CC4 A;  1YNN D;  1IBL L;  5M3M G;  3P75 A;  1PH5 A;  2G5D A;  2M2L A;  4H7B A;  1WD0 A;  2FFK B;  1D2B A;  3K58 A;  1LTG D;  1U9R A;  1K3R A;  3BZD B;  1SE2 A;  2B63 B;  4KHZ A;  4BY1 B;  3V05 A;  2IT1 A;  3M4P A;  4RH6 A;  4DU9 A;  3Q22 A;  3NBH A;  1XX8 A;  4XT3 B;  1FVI A;  3I4M G;  3HKZ E;  3K0X A;  4Y52 H;  1SE4 A;  4BS9 A;  2UUC Q;  3I4M B;  1SFO H;  1Q86 C;  4AIM A;  1CHP D;  1E22 A;  4KN4 C;  1PH1 A;  1SNC A;  2K5H A;  1A62 A;  2Q2H A;  3H0G G;  1STN A;  2EY1 A;  1T5X D;  1RHP A;  1STA A;  1WJJ A;  2KEN A;  4OIK A;  1HNX Q;  2VY3 A;  1ENA A;  3FMC A;  4IUQ A;  1K8O A;  4K2K A;  5IGB A;  1QUQ A;  2ZJP A;  1B8A A;  3J7Y W;  5JVG 3;  3U9S A;  2RF4 A;  2VW9 A;  1DOK A;  2K04 A;  4ILW A;  2N3S A;  4RHR A;  1VQL A;  3NQI A;  1FYC A;  4L63 B;  1EY9 A;  2GVB A;  3MTS A;  1QG7 A;  1RDP D;  2XTI A;  1SNP A;  3DHQ A;  4B3T Q;  1GUG A;  4CDC C;  2F0E A;  4C56 C;  4JI4 Q;  4LF6 L;  1TR5 A;  4GKK L;  2CQA A;  1BUV T;  4YY3 L;  3S16 B;  1DCZ A;  2IHE A;  5F2D A;  2JA8 H;  3RUZ A;  2R7D A;  2SOB A;  1SR3 A;  2H1E A;  5EBC A;  1N33 L;  1L1O A;  5ELE A;  1X3F A;  2RDG A;  2NVX H;  3M7N A;  4OX9 Q;  1YVC A;  1NMG A;  2VUM B;  2K7V A;  1PFB A;  3GTO B;  5CV9 A;  5C5L A;  3KDF A;  4DR5 Q;  4ME5 A;  1ML0 D;  3RD4 A;  5BN3 A;  4LUZ A;  5K36 H;  1TWH H;  3HOZ G;  1X3Q A;  2HIV A;  1Y1W B;  4POG A;  3TME A;  3C1E A;  1CSQ A;  4KMU C;  4A3C G;  4C3H G;  1PYS B;  3T13 A;  4C2M H;  2F52 A;  4K5X A;  3P20 A;  2OCE A;  4OO1 G;  1S4Z A;  5HUR A;  4GLA C;  4DR2 Q;  1F77 A;  2DGY A;  2F4V L;  2F0T A;  4K5W A;  4BBS G;  2ZXP A;  3S2D B;  3C46 A;  4BBS B;  2ZTD A;  2MNA A;  2CWA A;  2IPK D;  3OYY A;  4H44 C;  1JWU D;  5LHY 1;  3AFP A;  5C4X B;  1F2Z A;  3FPU B;  5I2Y A;  4IPH A;  3E9I A;  2I5H A;  4YHH Q;  4EQP A;  4FO2 A;  5D14 A;  1LTL A;  2IX0 A;  5JJK A;  3KFU A;  2OTJ A;  3Q6S A;  1WTP A;  3CRK C;  5JEA G;  1XPO A;  3LNN A;  2FMM A;  1RCV D;  4DK3 C;  2B8G A;  4DNR B;  1Z9F A;  3CPF A;  4DNI A;  3HOU H;  3K6O A;  4K0K Q;  2KCC A;  4JI6 Q;  3ZYY X;  4LFB L;  1S5E D;  1XWE A;  3ERS X;  3G6E A;  4JW0 A;  2K4K A;  2QCP X;  2N8N A;  5IP7 G;  3PO3 G;  1L1O C;  4X64 L;  4DAV A;  4IN3 A;  5COY A;  2KED A;  2CHB D;  2A73 B;  1GHK A;  4HIK A;  1D5X C;  3DXJ C;  2KBN A;  3ULJ A;  2WAQ G;  1IBM L;  4FF4 A;  4MHE A;  4O1N A;  4KKS A;  4R1J A;  4Y7N B;  1YJW A;  2WAQ B;  3S14 H;  4OGQ C;  5FO8 B;  4JI2 Q;  5LL6 S;  2NVT B;  1QNK A;  4B08 A;  5FJ8 G;  1BKB A;  2PNR C;  1I6H B;  1VQN A;  4JI5 Q;  4MIU A;  2MO0 A;  3FDT A;  1JCK B;  1PXU A;  1SN8 A;  4UY8 C;  5LMU Q;  1UWV A;  3MWY W;  5IE8 A;  5DAU A;  5CV4 A;  4LF8 Q;  5FLM H;  3S1R B;  3I56 A;  1EQT A;  4HJA A;  4WFN 3;  4ZK9 B;  4EGV A;  4L5T A;  1M90 C;  4QCL A;  3SVM A;  1ZYR C;  1WVL A;  4ULL A;  1OXS C;  5I6W A;  4BXX H;  2F3W A;  4UP7 A;  5I4D A;  1Y1V G;  1Z6H A;  4CDF C;  1RTO A;  2O5J C;  2WB1 E;  3A5Z B;  5M5Y B;  5ELN A;  1B9N A;  1JC7 A;  1UE6 A;  1WTW A;  5M5X B;  4LFA L;  1KNE A;  3DEO A;  1U4P A;  5HY6 A;  2RCN A;  2E2I B;  1X9N A;  4DV0 Q;  1LTS D;  2ICE C;  2R92 H;  1OO9 B;  3KOJ A;  2VQF Q;  5EPK A;  1K28 A;  2JA6 B;  3O13 A;  1IYJ B;  3VYS A;  1WYD A;  4KKT A;  1N34 L;  2F3I A;  1JIC A;  2AMC B;  3I3C A;  3I4L A;  2JSO A;  1A6X A;  1O7Y A;  4HR7 B;  1BCP B;  1AEX A;  4QIW B;  5C3E H;  2NVQ B;  1GHJ A;  5E4W C;  5IY0 A;  3AMU A;  3ERO A;  4IUP A;  1LT4 D;  3K8A A;  5EBD A;  4A3G G;  3HRZ C;  5C0X G;  2E75 C;  1CKM A;  4TQU S;  4RWS C;  4JBW A;  4DN4 M;  1IBK L;  2AHO B;  3LWE A;  3RLO A;  2F0K A;  2BA1 A;  5ISR A;  3GV3 A;  3CPW A;  2GN5 A;  1IKL A;  1Z47 A;  1XTC D;  3PO2 H;  1C48 A;  2SNM A;  3BZK A;  3IFD A;  3M4O H;  3UI2 A;  5LMN W;  4IZ8 A;  3AYH B;  4RHS A;  5CV6 A;  2Y0S E;  4HJ5 A;  1GVP A;  3CMA A;  1NAP A;  2R93 G;  3A5U A;  2QGQ A;  5CV7 A;  5EPL A;  3KLW A;  1N8R C;  1LTR D;  2OTL A;  1KIX A;  1WI5 A;  1FNV A;  5CV5 A;  4B3S L;  1XXG A;  3BG3 A;  4A3D H;  3DM3 A;  3SDZ A;  1ASY A;  2EYM A;  2Q8I B;  2IW3 A;  2NBF A;  3HOV H;  4LAA A;  3TZD A;  4GN4 B;  4B3M L;  2G9D A;  1H9S A;  4RGO S;  4DV2 L;  1KAA A;  3H3V C;  4DV3 L;  2ZXR A;  2H4O A;  3NTI A;  1Q1B A;  3Q0A A;  4LUV A;  1H9M A;  2RBM A;  4X66 Q;  2L12 A;  1QNU A;  1HNZ L;  1AE3 A;  1EY8 A;  2A6H C;  1D5M C;  2F0J A;  3V96 A;  1HFG A;  1R9T H;  2QIL A;  4KY6 A;  5H1S E;  3R2T A;  4UAI A;  1L0Y B;  2ZJR A;  3MXN B;  1CA6 A;  3OMC A;  1EU4 A;  1IW7 C;  4XQN A;  1K8G A;  1PDQ A;  1JMC A;  5JPN C;  1AH9 A;  3SK8 A;  2C35 B;  3CCS A;  3S15 H;  1EYD A;  4B3R Q;  1SFO B;  3PV0 A;  1H9S B;  3D6C A;  4ZUJ A;  1ASZ A;  1DOL A;  2VB3 X;  4HTH A;  3VR3 A;  3P1H A;  4PG3 A;  1S72 A;  3CRL C;  1RL2 A;  4EQO A;  3A7L A;  3F8T A;  3T1Y Q;  2BOS A;  3FHW A;  4NXN Q;  2LY7 A;  2ZXO A;  2UUB Q;  5T1I A;  2MPM A;  1QIL A;  3STB C;  1M4V A;  4K8J A;  1S5F D;  2I0Q A;  2K5D A;  3I2Z A;  3HGB A;  1XJV A;  2EYJ A;  2TMP A;  5KGU A;  3CCE A;  3G6J B;  1E2Z A;  5CYU A;  3EFX D;  2UXB L;  1MBY A;  1SNO A;  2CCZ A;  2NTT A;  1EY5 A;  2GVA A;  2PMZ B;  2AWN A;  3J7A F;  2K5W A;  3R93 A;  1TXY A;  1O7L A;  1XNQ Q;  1VQE A;  3H3V I;  3SR1 A;  4DV6 Q;  4DR4 L;  1KAB A;  1Z7T A;  4XDX A;  1K83 B;  5IGF A;  4NKL A;  5KNB A;  4N8F A;  2ZM6 L;  2WP8 J;  5BR8 Q;  4KLK A;  3E6Z X;  5EGT A;  2R7Z H;  4PZ7 A;  3D31 A;  2MO1 A;  2A1A A;  4OXP A;  4WJ3 M;  1K3B C;  3QO2 A;  4A3B H;  4YCU A;  2F3V A;  4ABN A;  2JEA I;  5E3F A;  1VQD A;  2P5Z X;  4JI8 L;  1DM0 B;  4R8N A;  5IGG A;  5IGC A;  2XGT A;  1OXX K;  5K36 G;  1HQR D;  4NDX A;  1YNJ D;  3A0J A;  4ZAI A;  4DUY L;  4DR7 L;  2F0S A;  3L3O C;  2OWO A;  3K57 A;  1NR4 A;  4B9W A;  4DV7 Q;  1PH8 A;  2K14 A;  3CQZ B;  4POF A;  1EY6 A;  3OPO A;  2YU9 B;  3W3A A;  1XMQ L;  5M3F H;  1FJG L;  1SNM A;  2XWJ B;  1EY0 A;  2MUY A;  1ET6 A;  4G7H C;  4AQY L;  2ZJQ A;  3NXW A;  1JT8 A;  5JJI A;  3OW2 A;  5BN4 A;  1GXD C;  4GLX A;  1UEB A;  2E2J H;  2UXD L;  1SMY D;  5A35 A;  1YI2 A;  2JA9 A;  2L5T A;  2PPB C;  4ZKB B;  3PUX A;  3G7L A;  3VR2 A;  1NNX A;  2L11 A;  4FXG C;  1HR0 Q;  3HOW B;  3GTJ H;  2RHS B;  4BBR G;  3B6Y A;  5FKA C;  1JQY D;  4BBR B;  4H13 C;  2B2T A;  1XYI A;  2KHI A;  3D4W A;  4LF4 L;  2R3Z A;  1PTO D;  4C3J H;  1FL0 A;  3HOU G;  3MVV A;  4ZKC B;  1MIU A;  1Q12 A;  4A3M H;  3DWA A;  4XQQ A;  2BE5 D;  3RN2 A;  3PF5 A;  1TQO A;  2MGS A;  4QJF A;  4TRD A;  5DEH A;  3T1H Q;  3QJY A;  1SMX A;  1XMO L;  4DV5 Q;  2BCO A;  2JA7 B;  3W1G A;  2QA4 A;  5EKK A;  4JOI A;  2RVL A;  2B2V A;  2L9H A;  4KKU A;  4XQJ A;  2RCF A;  3KBG A;  1Q90 A;  2YV5 A;  3GTK H;  5NUC A;  3S2H B;  1XNR Q;  2BDO A;  4QMG A;  1PH4 A;  1U5K A;  3S14 B;  1DD2 A;  2JA5 H;  4WJ4 A;  1G2S A;  1JE5 A;  3M3Y H;  5IOD A;  4K14 A;  4YWM A;  4X3K A;  4YWL A;  1QVF A;  4A3F H;  3N52 A;  4QL5 A;  1CHQ D;  2CW0 C;  4DV4 Q;  4A3J B;  4FF2 A;  3E5S A;  4YCV A;  4GN3 B;  1F9Q A;  3DEP A;  4K6L A;  3KYH C;  5FLM G;  2WAQ E;  1V1P B;  2OT2 A;  3OTO L;  4ODG A;  4XYQ A;  3UDI A;  2XRQ D;  4IFD J;  2A5H A;  4RG1 A;  1CI3 M;  3J80 i;  4BXX G;  3W5O A;  3L7Z C;  3CCU A;  1TWG B;  2DJF C;  4A3I H;  3QWN A;  3PIO 3;  3CCR A;  4JI3 Q;  1RJT A;  2NZO A;  1NE3 A;  4J8Q A;  1YJ9 A;  3W2D A;  4KJN A;  2B2T C;  2A69 D;  1B44 D;  1HZA A;  2F0D A;  3RZD H;  2UU9 Q;  4IUV A;  1QOH A;  1LT5 D;  4J1M A;  3AU7 A;  2R92 G;  4NXM L;  4PQX A;  3TSS A;  4JI7 L;  5DM7 3;  4BY7 B;  4RGT A;  1C8C A;  1LT3 D;  4N8X 1;  2FJ2 A;  4K6D A;  5C4J B;  5IYB H;  5IYD H;  3EA6 A;  2PI2 E;  3RLF A;  2KHS A;  3NTK A;  3J81 i;  4V0B A;  3QOJ A;  5KNC A;  4BA2 I;  1Q8I A;  4B3T L;  1A3U A;  1K8M A;  2RDF A;  3CC2 A;  2F0I A;  1F9P A;  2Z4H A;  3CD6 A;  4RMF A;  5CR3 A;  1WCM B;  2JXM B;  5C3E G;  1SJE D;  2F0P A;  2F0O A;  1C0A A;  2WKC A;  5C3E B;  1I4G A;  1V8Q A;  3RN5 A;  2CKZ B;  5C5M A;  2X6G A;  4P73 A;  2CVR A;  1PLF A;  4ZCK A;  3TP5 A;  3TN2 A;  1IHZ A;  3Q8D A;  5CGK A;  1BR9 A;  4P74 A;  1F2L A;  3SEB A;  1YHQ A;  5M3M B;  2EYF A;  2AKW B;  3K81 C;  2EVB A;  5C3X A;  1EOT A;  1I5F A;  5GAE C;  2EY5 A;  4QIW E;  3MC0 B;  3PO2 G;  2A68 D;  1W6J A;  3E0J A;  1GM5 A;  3LGJ A;  4PMW A;  1VQ7 A;  3PO2 B;  2AQ2 B;  2XN9 C;  4HIM A;  1V9P A;  1Y8O B;  1TWA B;  2DJG C;  4CKE A;  1ROD A;  1G6Z A;  1UE5 A;  1MJE A;  4A3D G;  2AUK A;  3GTQ H;  4WOR A;  1E1O A;  3GTP B;  4MTK A;  1I4P A;  2RQX A;  4RGM A;  3WWV A;  3HOV G;  3RZO H;  1BO0 A;  3HOV B;  1CZG A;  3M7G A;  3H0G B;  4U68 A;  3E3X A;  4HIO A;  3PUW A;  4P72 A;  4YWK A;  1CUK A;  1J9O A;  1N9W A;  2Z1C A;  4A3E H;  2TSS A;  4HCS A;  1VQO A;  1NMF A;  1KTK A;  1QE6 A;  3CHB D;  4FVM A;  4L5R C;  4DPG A;  1NUC A;  1JJ2 A;  2HHH L;  2RSO A;  2EYH A;  3SHL A;  4JBK A;  1LV9 A;  5FLX E;  2MFI A;  3L9A X;  1YZ6 A;  5D3I B;  2Z6K A;  3DWQ A;  4CBV A;  4IOA A;  4UP8 A;  1I4Q A;  2R6G A;  4JI1 L;  5KIX A;  3FKI H;  4JI6 L;  2K28 A;  3MFY A;  1R4Q B;  4F8M A;  1I50 H;  2XVS A;  1BBX C;  5JJL A;  5DNF A;  2CFM A;  1X3G A;  1A63 A;  2HQL A;  2D5D A;  5E1F A;  1F9R A;  1N32 Q;  1E24 A;  3WOF A;  2M00 A;  4LFC L;  4RCO A;  4GNX B;  5HGQ A;  3EBE A;  5LMN L;  2Q2T A;  4MNO A;  2B39 A;  1HH2 P;  1KXL A;  4RA8 A;  2PCF B;  1A3V A;  4OEL B;  4JI2 L;  1VMP A;  1SE8 A;  4JV5 Q;  5CV8 A;  1PRT D;  4CJ1 B;  3HOZ B;  1EQQ A;  1GUO A;  3S1N B;  1QB5 D;  1NTG A;  1CM9 A;  1TII D;  1IBL Q;  4X6A H;  3I4N H;  2EYP A;  5KEE A;  3CCQ A;  4H0L C;  3K5M A;  1UE1 A;  3EVQ A;  4C3H B;  1IZ6 A;  4LF8 L;  1J5E L;  1CQV A;  4ZYS A;  4GOP B;  4LF9 L;  5KYI A;  4OIJ A;  2EQS A;  1TKW B;  4AYB G;  5IGD A;  1T9H A;  4WJW A;  3F2C A;  2R7Z G;  2UXC Q;  3NWT A;  1EY7 A;  2PMZ E;  3GTG H;  2VNU D;  1TWF B;  4M8A A;  4A3B G;  2F0G A;  4LJZ C;  2EZV A;  1U4R A;  5DLQ E;  1QZH A;  2HT1 A;  2A6E D;  3MA2 B;  2QF7 A;  4H02 A;  3ICE A;  2NVY H;  3F2U A;  4R4T A;  1II3 A;  2K6A A;  2E2H B;  3S1M H;  3JAM i;  1BCP F;  1N36 L;  1CFM A;  4KJO A;  1SRO A;  1EOV A;  3NBI A;  2Z6K C;  4O42 A;  2G9H D;  4P75 A;  1P16 A;  3PQI A;  1D6E C;  5M5W B;  5M3F G;  2KOL A;  5C3W A;  3GTM B;  1CQF A;  3SE0 A;  1JB7 A;  2K5V A;  3UDG A;  2VS1 A;  4ZLT F;  3PO3 B;  5G3L D;  5JPM C;  4DR6 L;  2E8G A;  3ERQ A;  5J3B A;  3J80 E;  3S17 B;  5ELD A;  4LW1 A;  4GLV B;  1OXV A;  4JC0 A;  2EXZ A;  4PZ8 A;  1CKO A;  4DAP A;  4X65 L;  1SYF A;  1AE2 A;  5C44 H;  4OWW B;  1EWI A;  3H91 A;  4GKK Q;  1VQA A;  3GTJ B;  1TY0 A;  4YY3 Q;  4RFB A;  1C9O A;  2RSN A;  4G57 A;  3P7J A;  1PFM A;  2KA7 A;  4KV6 A;  3U4Z A;  3HOX H;  3MEF A;  3OWE B;  1J8I A;  2A19 A;  1N33 Q;  4O0A A;  5GRO A;  4IFD I;  3K7A B;  2PI2 A;  5AJ3 Q;  4I7A A;  4C3J G;  4JBM A;  2K50 A;  3BYY B;  1Q46 A;  3I7F A;  4DXG A;  5A2Q E;  3M85 A;  1JE4 A;  5M9O A;  4A3M G;  2Q2U A;  2BH2 A;  3J81 E;  1SXT A;  1LLR D;  1TU2 B;  4GS3 A;  3T4A C;  1Q3L A;  1GO3 E;  1EZ8 A;  2DY7 A;  2HD3 A;  2F03 A;  3G4S A;  1KDC A;  2AQ3 B;  4IAL A;  5DM6 3;  2K5Q A;  4A4I A;  3I8Z A;  1E3P A;  1Y1V B;  3GTK B;  4JYA L;  2E5L L;  1LYL A;  2K03 A;  1SYD A;  2JA5 G;  1I3Q H;  4C3I H;  3KF6 B;  2KQ3 A;  2F0U A;  3NUC A;  2JA5 B;  1BOS A;  3RR5 A;  3M3Y B;  4A3F G;  2F4V Q;  2EOT A;  1VQF A;  3DWP A;  1IKM A;  3OSO A;  2QEX A;  1VQ4 A;  4P2C B;  3TP6 A;  2QW7 A;  2RDH A;  1VQ6 A;  5FO9 B;  4IPG A;  1JWM D;  1BBU A;  3HG9 A;  1EYG A;  2HDM A;  3EIV A;  4B9X A;  1VQ5 A;  1PH3 A;  4HMI A;  1CTM A;  4A3I G;  4FP5 D;  3T1Y L;  4A3I B;  3GDE A;  2JJQ A;  4PMB A;  5LL6 X;  4A3L H;  1HZB A;  4A3G B;  5E7N A;  2EJM A;  3CU7 A;  1HRJ A;  4ZQ3 A;  2ZTE A;  3BYT B;  1O7Z A;  3S24 A;  4HJ7 A;  4X64 Q;  3S1Q B;  1NSN S;  4MN3 A;  2NUC A;  1CA5 A;  4A93 H;  1PH2 A;  3T16 A;  5IYD G;  5IYB G;  1IBM Q;  1PTO B;  5L37 A;  3PIP 3;  3MAQ A;  4DR3 Q;  3HKZ G;  3MXN A;  2R93 B;  4X62 L;  1E2V A;  5ELB A;  3E9H A;  3CP0 A;  1JB3 A;  3TRE A;  1EIY B;  2B63 H;  1DOM A;  4BY1 H;  4KHV A;  1HXY D;  4GZY C;  1YNX A;  5FLX L;  1ICW A;  1BCP C;  2HCI A;  2C9O A;  2RHQ B;  1E1T A;  3D4R A;  3A74 A;  2LKV A;  4L5S A;  2F0N A;  4OON A;  1C4Q A;  3ULP A;  2KCM A;  1H95 A;  4XYO A;  4E6I A;  1WOC A;  1HCZ A;  1E7Z A;  1NCV A;  2VQE L;  1ILQ A;  1R4P B;  3EJI A;  1SYC A;  1MKH A;  4EQ5 A;  1PYW D;  3U58 A;  3TS2 A;  4HSP A;  2I07 B;  3NEL A;  2PW7 A;  3J7A V;  4DK0 A;  3DLL A;  1K8A C;  4LFA Q;  1IL2 A;  2HIX A;  3Q24 A;  5ELC A;  5C6A A;  2KCN A;  2IL8 A;  1JOK A;  1GUW A;  3ZJY C;  1EWH A;  2KVM A;  3RZO B;  1T5E A;  1IYU A;  1ESR A;  3MEH A;  2NB0 A;  2L55 A;  1BBW A;  1B2T A;  3MXP A;  1N34 Q;  3ITP A;  3NSW A;  4MTN A;  3BU2 A;  5JOB A;  1MHW C;  4A3E G;  2D0O A;  2FXQ A;  4KN7 C;  4IFD H;  1ZYR D;  4UHV A;  1CSP A;  1S40 A;  1KHI A;  1PMR A;  3S16 H;  2EYL A;  1WTQ A;  3JAM E;  4KHP Q;  3VR5 A;  4DAM A;  4HSV A;  1D1I A;  2YTX A;  1HA5 A;  5J22 A;  5FLX c;  4FXD A;  4TVA B;  2VUM H;  4I65 A;  1IBK Q;  1YBY A;  5J1Z A;  3GTO H;  3A7A B;  1CKN B;  3FKI G;  2HUG A;  1VS0 A;  2JE6 I;  2JA8 G;  1NY4 A;  4PNY A;  4N9T A;  1MI2 A;  1ENF A;  2JA8 B;  1AFP A;  3H94 A;  1X65 A;  4ALP A;  3OW7 A;  3VYR A;  1B7Y B;  3FPP A;  1Y1W H;  2NVX B;  4PZ6 A;  3KJP A;  2VXW A;  4FF3 A;  1Y14 B;  4B3S Q;  1A3T A;  3OMG A;  1EYA A;  2Q2I A;  2R7F A;  3VYU A;  1XNR L;  1ICF B;  4JI0 L;  3ND8 A;  1UE7 A;  3J80 L;  2OXP A;  3NE5 B;  4DV2 Q;  4DV3 Q;  1TWH B;  2J7Z A;  3GTL H;  3S2D H;  4PMC A;  3TEH B;  3A8K E;  3I4N G;  1HNZ Q;  4J6H A;  1EIH A;  4DUZ Q;  1VQ8 A;  5C4X H;  4C2M B;  1ONL A;  2OEO A;  2Z8L A;  3ND9 A;  4R4O A;  2F0W A;  4GKJ Q;  5COR A;  3GO5 A;  4RGN A;  2EE1 A;  3AB9 A;  5C4Z A;  5TSS A;  4ZUI A;  4M1U B;  1B1Z A;  4JI3 L;  4LUO A;  4QUF A;  2UUA L;  4NW2 A;  4PV1 C;  5E4X A;  1LT6 D;  1YNN C;  5KRU A;  2NVY B;  2O2L D;  4LNQ A;  4JPB W;  2X69 A;  1TS5 A;  3MXG A;  1STY A;  3L0O A;  4C1N K;  5JJZ A;  1YEZ A;  5G3L F;  4R8I A;  1KDA A;  1JJG A;  1WTO A;  3IKJ A;  3PF4 A;  3HS0 C;  3PGZ A;  1A0I A;  4DV1 L;  1QCB D;  1U4L A;  3BDL A;  4K2L A;  3D8G A;  1LTA D;  1EIF A;  2A6H D;  4RKB A;  3SK5 A;  2V4D A;  1NR2 A;  1IL8 A;  4DK6 C;  2EJF C;  3HOU B;  4Y7N H;  5T1G A;  4FYD A;  1K0R A;  1GUN A;  3V2T A;  4KY7 A;  3OHX C;  3R3O A;  1IW7 D;  3I72 A;  1I6H H;  3K7U C;  5D3D A;  1GJX A;  1V1P A;  1EWC A;  3T56 B;  3J80 c;  1FNU A;  1JWS D;  1E2W A;  4XTC S;  3TZU A;  4DR4 Q;  5C44 G;  3KUP A;  4A3K H;  1KAW A;  2ICI A;  3G48 A;  1S5B D;  4CGY B;  1VDZ A;  4LF7 L;  4EVO A;  2WB1 G;  4HAE A;  2WKD A;  4DR1 L;  1PFN A;  1RF2 D;  2ZM6 Q;  3HOX G;  2CWP A;  1IXR A;  1U0L A;  3QG1 A;  2QDL A;  3NQT A;  3NWS A;  3I73 A;  1ILP A;  1DGS A;  3N6R A;  3VDY A;  1PRT B;  2Z4I A;  3STB D;  2V1C C;  2EXD A;  2NWG A;  2FMC A;  1LO5 D;  2K75 A;  4JI8 Q;  5M5Y H;  3J81 c;  4KI0 A;  2UUC L;  3ONA B;  2K52 A;  4EX5 A;  2E2I H;  4DUY Q;  4A76 A;  5K5P A;  1BDO A;  2F4I A;  2ES2 A;  5FK9 C;  4APV A;  1DON A;  1KL9 A;  4DNT B;  3C3L A;  2JA6 H;  3TQY A;  3QOL A;  1XMQ Q;  2ID0 A;  2PQA B;  1FJG Q;  3HOY H;  3WOE A;  2A8V A;  1HZC A;  4XXE A; 
#chains in the Genus database with same CATH homology
 4Q0F A;  2EY2 A;  5ELF A;  4G7Z C;  1LTB D;  1FGB D;  1STG A;  1B4O A;  4C3I G;  5IOC A;  4KTA A;  1HPC A;  1H9R A;  2B2Y A;  2I46 A;  4WRD A;  2R92 B;  4CJ2 C;  1JOR A;  1AZP A;  3HZX A;  3FEW X;  5EKL A;  1HTP A;  3H6M A;  2K05 A;  4ZRZ A;  1G2T A;  2B2V C;  3OWF A;  1WD1 A;  3KLS A;  4FXK C;  1PZK D;  4F87 A;  4IQZ A;  3SXH A;  4G7O C;  1TY2 A;  4L8J A;  5FOB B;  1I4X A;  1HUM A;  3TDQ A;  2XIW A;  1E0B A;  4FF1 A;  1QJO A;  3M4O B;  1UUP A;  2K33 A;  5CMD A;  2NN6 I;  5AFW A;  3MHB A;  2B2W A;  3I91 A;  5JEA J;  1UAP A;  3JAM L;  4R9W A;  4A3D B;  1KLG D;  3OIQ A;  2QKI C;  3S9W A;  3R8B A;  4DA2 A;  5C4H A;  2LS0 1;  4X3T A;  4KK7 A;  3NHH A;  4TSS A;  1V1O A;  2B2Y C;  1R9T B;  1BNZ A;  1TS4 A;  2EYO A;  1EZ6 A;  3KK7 A;  4ID6 A;  1IYV A;  1HTL D;  4OHJ A;  1VCI A;  3K5O A;  4RKL A;  5D65 A;  3S15 B;  1DXM A;  3MFG A;  4JK1 C;  5KND A;  2CW0 D;  2C5C A;  2L0C A;  3VR6 A;  5IT9 E;  1SJH D;  2XWB B;  1ZEQ X;  2XNA C;  4QUC A;  4IFD G;  3NK9 A;  2K1B A;  2SNS A;  1EIG A;  4IUN A;  2IWH A;  2HQE A;  4QF4 A;  5EKI A;  2B2W C;  3BVZ A;  3DUZ A;  3PUY A;  2LMC B;  1VF7 A;  2D62 A;  1HFN A;  2KEE A;  2EY6 A;  2RKS A;  1DJR D;  2Q8T A;  1SYG A;  4AYB B;  3KBX A;  1HUN A;  2R7Z B;  5EQ0 A;  2J4X A;  4KY5 A;  4Z9C B;  1Y69 U;  2KUM A;  2EJG C;  2OF1 A;  1EEF D;  4A3B B;  2Q8R E;  5CBE E;  3IAY A;  1Y8P B;  3R2I A;  4BWG B;  4G4K A;  5FO7 B;  1B53 A;  1O80 A;  5C0X J;  2E2D C;  4F88 A;  4DFA A;  1A2T A;  3K0Y A;  4IUR A;  1AW7 A;  1SEB D;  4X3U A;  1OXU A;  1STE A;  1SYE A;  1SYB A;  3GTL B;  3FVQ A;  1H9J A;  2IJ0 A;  4FNF A;  3K5L A;  3EQL C;  1GOZ A;  2QDB A;  5M3F B;  1EYC A;  1MD2 D;  4RAU C;  2PZW A;  4KD3 A;  1EEI D;  2E2J B;  1SNQ A;  1PTO F;  2R61 A;  2KJX A;  3DM1 A;  3IFT A;  1HA6 A;  3MZ5 A;  2NN6 H;  1TS2 A;  1EL0 A;  1SND A;  2BA0 A;  1KNA A;  4RCN A;  3C1F A;  1ET9 A;  1B3A A;  4C3J B;  2MJ8 A;  2YYZ A;  4NMZ A;  3KLS X;  2NTS A;  3I70 A;  2PZT A;  2DN8 A;  1CK1 A;  2B8F A;  5EJW A;  4A3M B;  4XT1 B;  2AWO A;  1HQM C;  4IUU A;  4UDU C;  5CBA E;  2DY8 A;  3X3N A;  3PMF A;  2IX3 A;  2PQE A;  1EFI D;  1VF5 C;  1RD9 D;  1OXT A;  3SK4 A;  2XRS D;  1RKN A;  3BVG A;  5JAV A;  4A3K B;  1ENC A;  4IUT A;  1I4R A;  1EQV A;  5IGE A;  2SEB D;  3VA5 A;  4DXF A;  3VR4 A;  3WDN A;  1LAB A;  4YIJ A;  2F1M A;  4A3F B;  2D9U A;  3OIP A;  4OO1 I;  4X3S A;  3KLR A;  4QB4 A;  2PO4 A;  3LWU A;  3A56 A;  2KEC A;  3D3R A;  4TKO B;  4F7X A;  2E74 C;  1EU3 A;  1UNS A;  1WTR A;  4LK1 C;  2DNC A;  2L1B A;  1ESF A;  3HOY B;  1DZ1 A;  2BDN A;  2F0V A;  5KYL A;  4CKB A;  1LAC A;  3RZD B;  3D6W A;  1WTV A;  3TP7 A;  2EPB A;  1YNJ C;  1U4M A;  2K01 A;  1LTT D;  1AP0 A;  3GV6 A;  1G8Z D;  2F0H A;  3HKZ B;  2WV6 D;  2PYK A;  5I6Y A;  3LX0 A;  2VB2 X;  2F0Q A;  1FR3 A;  2M9V A;  5BN5 A;  1I4H A;  3T53 B;  1SSO A;  1MSH A;  4DF7 A;  1SMY C;  2JYO A;  1KDB A;  3PUV A;  4I7Z C;  3VA7 A;  5JVH 3;  2FHT A;  2WIN B;  1S5C D;  3M4Y A;  2WAC A;  4HED A;  1STH A;  5IT9 L;  1JOQ A;  3DMU A;  2L4N A;  5HGT A;  1PTO C;  4Q5V A;  2SDF A;  2MHV A;  1S5D D;  1HHV A;  2E76 C;  1F2Y A;  1A15 A;  4S3S A;  2N88 A;  3GTQ B;  2BE5 C;  1MGS A;  1VMC A;  3BDC A;  1AN8 A;  2ZT9 C;  1B50 A;  1SDF A;  4N9P A;  3NTH A;  4A3E B;  2JP1 A;  4DGZ A;  3NP8 A;  2PZU A;  1X3P A;  1A2U A;  1FNW A;  2HDL A;  3K59 A;  2N55 A;  2J0T D;  5I2X A;  3A8J E;  2GA4 B;  4EQN A;  1ZKO A;  1F9S A;  1L0X B;  3HEJ A;  1G29 1;  3MXU A;  3FKI B;  3URY A;  1UEA B;  4BA1 I;  3U9O A;  5C0X I;  1BQQ T;  3CKI B;  1I50 B;  1PRT F;  3IL8 A;  2AQ1 B;  3OOC A;  4NP5 A;  2B2U A;  2K32 A;  5IIF A;  4HCE A;  1H9K A;  2MP1 A;  1ZXT A;  4KD4 A;  4OO1 H;  2A69 C;  3A8I E;  1BF4 A;  2LFN A;  2FIN B;  3I4N B;  3VYT A;  1G91 A;  1I6V C;  1SE3 A;  3GD7 A;  2PW5 A;  3C2P A;  1W6K A;  1D5Z C;  1Y8N B;  3H09 A;  3HP3 A;  3GTG B;  4K8I A;  1RTN A;  1LTI D;  5A2Q L;  1SAP A;  5JEA H;  3J81 L;  1Q1E A;  3SK6 A;  3K5N A;  2HCC A;  3S1M B;  1BCP D;  1DYQ A;  2O4X A;  1M8A A;  3FRP B;  1CT1 D;  2A68 C;  4K5V A;  1V43 A;  4U67 3;  5EPJ A;  2F0M A;  4L6T B;  1JOO A;  4CHT B;  1STB A;  2NYZ D;  3PUZ A;  1EY4 A;  1WTX A;  2QEJ C;  1CZW A;  2B2U C;  3TBI B;  3BDO A;  5C44 B;  2NN6 G;  1F2M A;  3NPP A;  3QB3 A;  2WB1 B;  2EDG A;  3QIA A;  2IX1 A;  3HOX B;  4HN7 A;  3BS1 A;  2RA4 A;  1TS3 A;  1KLU D;  4CKC A;  1GUT A;  3A55 A;  2AUJ D;  3KF8 A;  3D4D A;  2F0L A;  1D1K A;  3GQB A;  4DK1 A;  4XIG S;  1QWY A;  1SBB B;  2ENB A;  1PZI D;  2XSC A;  1PZJ D;  1O78 A;  3Q23 A;  1TWC B;  1GUS A;  1I3Q B;  4C3I B;  2NZ1 D;  2WII B;  3GP7 A;  3RMH A;  1B9M A;  3TP8 A;  5I9O A;  1BXT A;  2DNE A;  4CJ0 B;  2Y0S B;  1MSG A;  1PRT C;  4V19 0;  5C0X H;  2F0F A;  3BVM A;  4HMJ A;  1FD7 D;  5J39 A;  1TT2 A;  1X32 A;  1PTO H;  1TVX A;  2JEB I;  4LMQ D;  5I9P A;  3I90 A;  2D2C C;  2A6E C;  4C1N I;  3X3M A;  1JR0 D;  2O5I C;  4DAY A;  2X6L A;  4OL7 A;  4A93 B;  3T51 B;  2A74 C;  1AZQ A;  3A54 A;  5CC4 A;  1YNN D;  3P75 A;  2M2L A;  4H7B A;  1WD0 A;  2FFK B;  1D2B A;  3K58 A;  1LTG D;  1U9R A;  3BZD B;  1SE2 A;  2B63 B;  4KHZ A;  4BY1 B;  3V05 A;  2IT1 A;  4RH6 A;  4DU9 A;  3Q22 A;  3NBH A;  1XX8 A;  4XT3 B;  1SE4 A;  4BS9 A;  3I4M B;  1CHP D;  4KN4 C;  1SNC A;  1STN A;  2EY1 A;  1T5X D;  1RHP A;  1STA A;  4OIK A;  1ENA A;  3FMC A;  4IUQ A;  1K8O A;  4K2K A;  5IGB A;  3J7Y W;  5JVG 3;  3U9S A;  1DOK A;  2K04 A;  4ILW A;  4RHR A;  3NQI A;  1FYC A;  4L63 B;  1EY9 A;  1QG7 A;  3MTS A;  1RDP D;  1SNP A;  3DHQ A;  1GUG A;  2F0E A;  4C56 C;  1TR5 A;  2CQA A;  1BUV T;  3S16 B;  1DCZ A;  5F2D A;  3RUZ A;  2SOB A;  2H1E A;  5EBC A;  5ELE A;  2RDG A;  3M7N A;  2VUM B;  2K7V A;  1PFB A;  3GTO B;  5CV9 A;  5C5L A;  4ME5 A;  1ML0 D;  3RD4 A;  5BN3 A;  5K36 H;  1X3Q A;  1Y1W B;  3TME A;  3C1E A;  4KMU C;  4C3H G;  3T13 A;  4K5X A;  3P20 A;  4OO1 G;  1S4Z A;  5HUR A;  1F77 A;  2F0T A;  4K5W A;  2ZXP A;  3S2D B;  3C46 A;  4BBS B;  2IPK D;  4H44 C;  1JWU D;  5LHY 1;  5C4X B;  1F2Z A;  3FPU B;  5I2Y A;  4EQP A;  4FO2 A;  5D14 A;  2IX0 A;  3Q6S A;  1WTP A;  3CRK C;  5JEA G;  3LNN A;  2FMM A;  1RCV D;  2B8G A;  4DNR B;  3K6O A;  2KCC A;  3ZYY X;  1S5E D;  1XWE A;  2QCP X;  4DAV A;  4IN3 A;  5COY A;  2KED A;  2CHB D;  2A73 B;  1GHK A;  1D5X C;  3DXJ C;  4FF4 A;  4MHE A;  4O1N A;  4KKS A;  4Y7N B;  2WAQ B;  4OGQ C;  5FO8 B;  5LL6 S;  2NVT B;  1QNK A;  4B08 A;  2PNR C;  1I6H B;  4MIU A;  3FDT A;  1JCK B;  1PXU A;  3MWY W;  5DAU A;  5CV4 A;  3S1R B;  1EQT A;  4WFN 3;  4ZK9 B;  4EGV A;  4QCL A;  3SVM A;  1ZYR C;  1WVL A;  4ULL A;  1OXS C;  5I6W A;  2F3W A;  5I4D A;  1Z6H A;  1RTO A;  2O5J C;  5M5Y B;  1B9N A;  1JC7 A;  1WTW A;  5M5X B;  1KNE A;  3DEO A;  1U4P A;  2E2I B;  1LTS D;  2ICE C;  1OO9 B;  5EPK A;  2JA6 B;  3O13 A;  3VYS A;  4KKT A;  1JIC A;  3I3C A;  3I4L A;  2JSO A;  1A6X A;  1O7Y A;  4HR7 B;  1BCP B;  1AEX A;  4QIW B;  2NVQ B;  1GHJ A;  5E4W C;  3AMU A;  3ERO A;  4IUP A;  1LT4 D;  5EBD A;  3HRZ C;  5C0X G;  2E75 C;  4TQU S;  4RWS C;  4JBW A;  4DN4 M;  3LWE A;  2F0K A;  2BA1 A;  5ISR A;  3GV3 A;  1IKL A;  1Z47 A;  1XTC D;  1C48 A;  2SNM A;  3IFD A;  3UI2 A;  4IZ8 A;  4RHS A;  5CV6 A;  1NAP A;  5CV7 A;  5EPL A;  1LTR D;  1FNV A;  5CV5 A;  1XXG A;  3BG3 A;  3SDZ A;  2EYM A;  2Q8I B;  2IW3 A;  2NBF A;  4LAA A;  3TZD A;  2G9D A;  1H9S A;  4RGO S;  1KAA A;  3H3V C;  2ZXR A;  2H4O A;  3NTI A;  1Q1B A;  3Q0A A;  1H9M A;  2RBM A;  2L12 A;  1QNU A;  1EY8 A;  2A6H C;  1D5M C;  2F0J A;  3V96 A;  1HFG A;  2QIL A;  4KY6 A;  3R2T A;  4UAI A;  1L0Y B;  1CA6 A;  3OMC A;  1EU4 A;  1IW7 C;  4XQN A;  1PDQ A;  5JPN C;  3SK8 A;  1EYD A;  1SFO B;  3PV0 A;  1H9S B;  3D6C A;  4ZUJ A;  1DOL A;  2VB3 X;  4HTH A;  3VR3 A;  3P1H A;  3CRL C;  4EQO A;  3A7L A;  2BOS A;  2LY7 A;  2ZXO A;  5T1I A;  2MPM A;  1QIL A;  1M4V A;  4K8J A;  1S5F D;  2K5D A;  3HGB A;  2EYJ A;  2TMP A;  5KGU A;  3G6J B;  1E2Z A;  5CYU A;  3EFX D;  1MBY A;  1SNO A;  2NTT A;  1EY5 A;  2PMZ B;  2AWN A;  3J7A F;  2K5W A;  3R93 A;  1O7L A;  3SR1 A;  1KAB A;  1Z7T A;  4XDX A;  1K83 B;  5IGF A;  4NKL A;  5KNB A;  2WP8 J;  3E6Z X;  5EGT A;  3D31 A;  3QO2 A;  2F3V A;  4ABN A;  2JEA I;  5E3F A;  1DM0 B;  4R8N A;  5IGG A;  5IGC A;  1OXX K;  5K36 G;  1HQR D;  4NDX A;  1YNJ D;  4ZAI A;  2F0S A;  3L3O C;  3K57 A;  1NR4 A;  4B9W A;  3CQZ B;  1EY6 A;  3OPO A;  2YU9 B;  3W3A A;  1SNM A;  2XWJ B;  1EY0 A;  2MUY A;  1ET6 A;  4G7H C;  3NXW A;  5BN4 A;  1GXD C;  1SMY D;  5A35 A;  2L5T A;  2PPB C;  4ZKB B;  3PUX A;  3G7L A;  3VR2 A;  2L11 A;  4FXG C;  3HOW B;  5FKA C;  1JQY D;  4BBR B;  4H13 C;  2B2T A;  1XYI A;  3D4W A;  2R3Z A;  1PTO D;  3MVV A;  4ZKC B;  1Q12 A;  3DWA A;  4XQQ A;  2BE5 D;  1TQO A;  2MGS A;  4TRD A;  5DEH A;  3QJY A;  2BCO A;  2JA7 B;  5EKK A;  2RVL A;  2B2V A;  2L9H A;  4KKU A;  4XQJ A;  3KBG A;  1Q90 A;  5NUC A;  3S2H B;  2BDO A;  4QMG A;  3S14 B;  1DD2 A;  1G2S A;  5IOD A;  4K14 A;  4X3K A;  3N52 A;  1CHQ D;  2CW0 C;  4A3J B;  4FF2 A;  3E5S A;  1F9Q A;  3DEP A;  4K6L A;  1V1P B;  2OT2 A;  4ODG A;  4XYQ A;  4IFD J;  2XRQ D;  2A5H A;  1CI3 M;  3L7Z C;  1TWG B;  3QWN A;  3PIO 3;  1RJT A;  4J8Q A;  3W2D A;  4KJN A;  2B2T C;  2A69 D;  1B44 D;  2F0D A;  4IUV A;  1QOH A;  1LT5 D;  4J1M A;  3AU7 A;  4PQX A;  3TSS A;  5DM7 3;  4BY7 B;  4RGT A;  1C8C A;  1LT3 D;  2FJ2 A;  4K6D A;  5C4J B;  3EA6 A;  3RLF A;  2KHS A;  3NTK A;  4V0B A;  3QOJ A;  5KNC A;  4BA2 I;  1Q8I A;  1A3U A;  1K8M A;  2RDF A;  2F0I A;  1F9P A;  2Z4H A;  5CR3 A;  1WCM B;  2JXM B;  1SJE D;  2F0P A;  2F0O A;  2WKC A;  5C3E B;  1I4G A;  1V8Q A;  5C5M A;  2X6G A;  2CVR A;  1PLF A;  3TP5 A;  3TN2 A;  1IHZ A;  5CGK A;  1BR9 A;  1F2L A;  3SEB A;  5M3M B;  2EYF A;  2EVB A;  5C3X A;  1EOT A;  2EY5 A;  3MC0 B;  2A68 D;  1W6J A;  3E0J A;  4PMW A;  3PO2 B;  2AQ2 B;  2XN9 C;  1Y8O B;  1TWA B;  4CKE A;  1ROD A;  1G6Z A;  2AUK A;  4WOR A;  3GTP B;  1I4P A;  2RQX A;  4RGM A;  1BO0 A;  3HOV B;  1CZG A;  3M7G A;  3H0G B;  4U68 A;  3PUW A;  1J9O A;  2Z1C A;  2TSS A;  4HCS A;  1KTK A;  1QE6 A;  3CHB D;  4FVM A;  1NUC A;  2RSO A;  2EYH A;  3SHL A;  1LV9 A;  5FLX E;  3L9A X;  5D3I B;  3DWQ A;  4CBV A;  1I4Q A;  2R6G A;  5KIX A;  2K28 A;  3MFY A;  1R4Q B;  4F8M A;  2XVS A;  1BBX C;  5DNF A;  2D5D A;  5E1F A;  1F9R A;  3WOF A;  2M00 A;  4RCO A;  2B39 A;  4RA8 A;  2PCF B;  1A3V A;  1VMP A;  5CV8 A;  1PRT D;  4CJ1 B;  3HOZ B;  1GUO A;  3S1N B;  1QB5 D;  1CM9 A;  1TII D;  2EYP A;  5KEE A;  4H0L C;  3K5M A;  3EVQ A;  4C3H B;  1CQV A;  4ZYS A;  5KYI A;  4OIJ A;  1TKW B;  5IGD A;  4WJW A;  3NWT A;  1EY7 A;  2VNU D;  1TWF B;  4M8A A;  2F0G A;  4LJZ C;  2EZV A;  1U4R A;  2A6E D;  3MA2 B;  2QF7 A;  3F2U A;  1II3 A;  2K6A A;  2E2H B;  1BCP F;  1CFM A;  4KJO A;  4O42 A;  3NBI A;  2G9H D;  1D6E C;  5M5W B;  2KOL A;  5C3W A;  3GTM B;  1CQF A;  3SE0 A;  4ZLT F;  3PO3 B;  5G3L D;  5JPM C;  3ERQ A;  3S17 B;  3J80 E;  5ELD A;  1OXV A;  2EXZ A;  4DAP A;  1SYF A;  3H91 A;  3GTJ B;  1TY0 A;  4RFB A;  2RSN A;  4G57 A;  3P7J A;  1PFM A;  2KA7 A;  4KV6 A;  1J8I A;  3OWE B;  4IFD I;  3K7A B;  4C3J G;  3BYY B;  4DXG A;  5A2Q E;  3M85 A;  1JE4 A;  5M9O A;  3J81 E;  1SXT A;  1LLR D;  1TU2 B;  3T4A C;  1Q3L A;  1EZ8 A;  2DY7 A;  2F03 A;  1KDC A;  2AQ3 B;  4IAL A;  5DM6 3;  2K5Q A;  3I8Z A;  1Y1V B;  3GTK B;  2K03 A;  1SYD A;  2KQ3 A;  2F0U A;  3NUC A;  2JA5 B;  1BOS A;  3M3Y B;  2EOT A;  3DWP A;  1IKM A;  3OSO A;  4P2C B;  3TP6 A;  2RDH A;  5FO9 B;  1JWM D;  3HG9 A;  2HDM A;  4B9X A;  4HMI A;  1CTM A;  4FP5 D;  4A3I B;  4PMB A;  5LL6 X;  4A3G B;  2EJM A;  3CU7 A;  1HRJ A;  4ZQ3 A;  3BYT B;  1O7Z A;  3S1Q B;  1NSN S;  4MN3 A;  2NUC A;  1CA5 A;  3T16 A;  1PTO B;  3PIP 3;  3MAQ A;  3MXN A;  2R93 B;  1E2V A;  5ELB A;  1JB3 A;  1DOM A;  4KHV A;  1HXY D;  4GZY C;  5FLX L;  1ICW A;  1BCP C;  2HCI A;  2C9O A;  3D4R A;  2LKV A;  2F0N A;  1C4Q A;  4XYO A;  4E6I A;  1HCZ A;  1NCV A;  1ILQ A;  1R4P B;  3EJI A;  1SYC A;  1PYW D;  4HSP A;  2I07 B;  2PW7 A;  3J7A V;  4DK0 A;  3Q24 A;  5ELC A;  5C6A A;  2KCN A;  2IL8 A;  1JOK A;  1GUW A;  1EWH A;  2KVM A;  3RZO B;  1T5E A;  1IYU A;  1ESR A;  3MEH A;  2NB0 A;  2L55 A;  1B2T A;  3MXP A;  3ITP A;  3NSW A;  5JOB A;  4KN7 C;  4IFD H;  1ZYR D;  1PMR A;  2EYL A;  1WTQ A;  3JAM E;  3VR5 A;  4HSV A;  1D1I A;  5J22 A;  1HA5 A;  4FXD A;  4I65 A;  5J1Z A;  3A7A B;  2HUG A;  2JE6 I;  4PNY A;  4N9T A;  1MI2 A;  1ENF A;  2JA8 B;  1AFP A;  3H94 A;  3OW7 A;  3VYR A;  3FPP A;  2NVX B;  2VXW A;  4FF3 A;  1A3T A;  3OMG A;  1EYA A;  3VYU A;  3ND8 A;  3J80 L;  2OXP A;  3NE5 B;  1TWH B;  2J7Z A;  4PMC A;  3A8K E;  4J6H A;  1EIH A;  4C2M B;  1ONL A;  2OEO A;  2Z8L A;  3ND9 A;  2F0W A;  5COR A;  3GO5 A;  4RGN A;  2EE1 A;  3AB9 A;  5C4Z A;  5TSS A;  4ZUI A;  4M1U B;  1B1Z A;  4QUF A;  4NW2 A;  4PV1 C;  5E4X A;  1LT6 D;  1YNN C;  5KRU A;  2NVY B;  2O2L D;  2X69 A;  1TS5 A;  3MXG A;  1STY A;  4C1N K;  5JJZ A;  5G3L F;  4R8I A;  1KDA A;  1WTO A;  3IKJ A;  3HS0 C;  1QCB D;  1U4L A;  3BDL A;  4K2L A;  3D8G A;  1LTA D;  2A6H D;  4RKB A;  3SK5 A;  2V4D A;  1NR2 A;  1IL8 A;  2EJF C;  3HOU B;  5T1G A;  4FYD A;  1GUN A;  3V2T A;  4KY7 A;  3OHX C;  3R3O A;  1IW7 D;  3I72 A;  5D3D A;  1GJX A;  1V1P A;  1EWC A;  3T56 B;  1FNU A;  1JWS D;  1E2W A;  4XTC S;  3TZU A;  3KUP A;  2ICI A;  1S5B D;  4CGY B;  1VDZ A;  4EVO A;  4HAE A;  2WKD A;  1PFN A;  1RF2 D;  3QG1 A;  3NQT A;  3NWS A;  3I73 A;  1ILP A;  3N6R A;  1PRT B;  2Z4I A;  2NWG A;  2FMC A;  1LO5 D;  4KI0 A;  3ONA B;  5K5P A;  1BDO A;  2F4I A;  5FK9 C;  1DON A;  4DNT B;  3C3L A;  3QOL A;  2ID0 A;  3WOE A;  4XXE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...