2JA7H

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
135
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
total genus 16
structure length 135
sequence length 145
chains with identical sequence T
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja7H00
4DV7Q 1VS0A 2I0QA 2ALYB 4L5SA 1A63A 3DM3A 2Z0SA 4A3IH 4ME3A 1XJVA 5M5XH 4A93G 1Q82C 4QQBX 3UDXA 3RLOA 2HHHL 2UUBQ 1RL2A 2KCMA 3D0FA 4O2DA 3GTGH 3I2ZA 3T1YQ 5JJLA 1N34Q 3TRZA 1QUQB 4DV1L 1EUJA 4LF5L 1BKBA 2QA4A 2Q2UA 2OCEA 3GTKH 1HH2P 1CSQA 3W5OA 5HGQA 5IWAL 5GAGC 4HJ5A 4HIKA 5IYDG 4JG2A 2B29A 3G4SA 3CCMA 4LF9L 2BA1A 4B3SQ 4P73A 1K9MC 3M9BA 4QY7A 4IPHA 3I4MG 1N33L 1XNRL 1O7IA 1FJGQ 1PH5A 2QEXA 4DV5L 3K80C 2B3GA 2UUCL 1NBWA 1Q46A 1HNXL 1XMOQ 2VS1A 3TS2A 2CQOA 1VQEA 2AHOB 5LMNQ 3GD7A 1HNZQ 1VQ7A 1OXVA 1UE1A 3TEHB 2JA6H 4R4IA 1KHIA 1SRUA 2ZJRA 4BA2I 3E9HA 2NVTH 4K0KL 1K0RA 2IY5B 2YTYA 3TS0A 1OXUA 2OWOA 3GDEA 2A8VA 1OXSC 2YTVA 4JI7Q 3ZJYC 3PUXA 4PZ8A 2A1AA 2PNHA 2WAQE 4OONA 5AJ3L 4A3BH 1PH1A 3M7NA 3CC2A 2VZAA 4JI0Q 2ASBA 3MEFA 1HR0L 4BY1H 4IFDI 4P72A 3A5ZB 1VQ9A 3F1ZA 1EIFA 4DR7L 4GOPC 4NB3A 2JA8H 2K52A 2JA6G 2VW9A 2F52A 2GVBA 3AFPA 4YCWA 3ULPA 2Q2IA 4ALPA 1N36L 4YHHL 3JAMi 4C3IH 2R92H 5IP9H 2D0OA 4A76A 1OXTA 2AWNA 4P71A 5FLMH 1YITA 1B70B 1PH8A 4BBSH 3JC66 4A3MH 4A3BG 4JYAQ 3L2PA 2UUAQ 1KRSA 4BY1G 3CCSA 4OWXB 2LXJA 3J81i 2PMZE 2JA8G 2RCNA 1QVFA 2KHJA 4X6AH 1WOCA 1PH7A 4HIMA 2ZM6L 4LF6L 4NXNQ 4R4QA 2GVAA 2ID0A 4MTNA 1T9HA 2RHSB 4R4CA 4GNXB 4JI2L 3I4NH 3PO2H 4WJ3M 1MJEA 2RHQB 4LFCL 2EXDA 3CCEA 1NMFA 1YEZA 3CQZH 1JMCA 5FLMG 5LMUL 4BBSG 1WYDA 4QGUA 1Q7YC 2VL6A 2BA0A 1WI5A 2F3IA 3D31A 4DUZQ 1K8AC 4NXML 3M4OH 1A8VA 2NZHA 1PFSA 2Y0SE 4EQ5A 3CCJA 5C44H 1E24A 3PGZA 4DUYL 1TXYA 4GNXC 4BY7H 3L0OA 1VQPA 4Y7NH 2E2IH 2MNAA 1J5EQ 1YHAA 1I6HH 4JV5L 2N3SA 3KF6B 1CKMA 3CXCA 3S1MH 4JCVE 2JE6I 2IX1A 3EN2A 4A3CH 3B6YA 3J80i 1GO3E 1ASZA 3KDFA 4WJ4A 2OQKA 5IE8A 3I4NG 2VUMH 3CF5A 4O0AA 3PO2G 4Y52H 1TWFH 3I56A 4A3EH 1M90C 5E7NA 3RZOH 3CPFA 3G48A 4C3HH 3PO3H 4X62Q 2ES2A 2Q2HA 3CC4A 2BH2A 1GVPA 2JEBI 1JT8A 2CWAA 1YI2A 2AWOA 4DR2L 1VQCA 1YHQA 4BY7G 1U5KA 5C44G 1IZ6A 4JBJA 3K8AA 4YWLA 5C0XG 4OXPA 1H95A 1KRTA 4X65Q 2K5VA 3RLFA 4A4IA 5FLXc 1AE2A 1HZ9A 1X55A 1QZHA 2YV5A 1G291 1SFOH 3PUWA 2ZTDA 2VQEL 1HZBA 4IO9A 3RN5A 1XPRA 2VUMG 4B3RL 4A3EG 4UPAA 1N33Q 1IXRA 1IBLL 5M3MH 4J15A 5IYBH 4DV5Q 3FHWA 2MFIA 3PO3G 1N9WA 3I7FA 3KF8B 1VQJA 2MO0A 5JEAG 5BR8L 4JI4L 1UE5A 1VQFA 1Y14B 4UP7A 1VQGA 1L0WA 1Y1WH 3PV0A 5C4XG 4LW1A 4LNQA 1G51A 2H5XA 2LSSA 2K50A 4DR6Q 1L1OB 1IBKL 2N78A 1E1TA 2R93H 3HOUH 1AH9A 3J7ZC 1V43A 1YJWA 3F2DA 2K75A 2MO1A 1VQ4A 4HJ8A 4DV0Q 1L1OC 1XMQL 5IYDH 3J7A5 2HIVA 4GS3A 5AJ3Q 2E8GA 4HIOA 1VQAA 5M3MG 5IYBG 1K8GA 1LYLA 2V1CC 4LF7Q 1CKNB 3AFQA 3M3YH 1C9OA 4A3GH 2WFWA 2Z6KA 1Y1WG 1KC8C 1QVGA 4DPGA 4JI8Q 2D0PA 2PQAB 2R93G 1EIYB 3HOUG 1V9PA 1YNXA 4NPSA 3K0XA 3PF4A 3CP0A 3M85A 4YHHQ 2Y0SG 1HNWQ 4YY3L 3H15A 1KD1C 2JJQA 3F2CA 3T1HL 1YVCA 4P75A 1S40A 4IFDJ 3DLLA 2IHEA 3NELA 4X66L 4BBRH 1SR3A 2YYZA 1YIJA 4LF8L 1VQIA 4RG1A 5H1SE 3CMEA 1W3SA 3CCRA 3FP9A 3S1QH 1N32Q 3GTJH 3ULLA 4DR5Q 1IL2A 4A3GG 1I5FA 1XNQQ 4DR1L 4DR4Q 1P8LA 4PMWA 1VQBA 1FVIA 1A0IA 1LM0A 2NN6I 4TQUS 1QZGA 1OTCA 1EFWA 4LF6Q 1NE3A 2JEAI 3CPWA 1K73C 2ZJQA 1J6QA 4X64L 1Q1BA 2K4KA 1YBYA 3RZDH 1HR0W 3GTQH 1VQHA 4LF4L 3U4VA 2E5LQ 3MXNB 4DNIA 3IRBA 5LMUQ 4GKJL 4KHPL 1TWCH 2ZTEA 4BBRG 4C3JH 1IBML 4JI4Q 2F4VL 4JC0A 1SMXA 4JI5L 3HOWH 5J3BA 5GAEC 2C35B 2JK8A 1UWVA 3M4PA 2CFMA 3H3VI 4GKKL 3EBEA 1C0AA 4DV2L 3RN2A 3PIOA 4AQYL 1DGSA 3PIPA 4LFAL 4B3ML 2KENA 1VQMA 2IHFA 4XTCS 2UU9L 5M3FH 5JJIA 3HOZG 4AYBE 4IFDG 4A3JH 4DAYB 1VQKA 1WJJA 1TWHH 4YWKA 3PUYA 1N8RC 4B3TQ 3U50C 1JJGA 1Q81C 4JOIA 4JI6L 4KHZA 2WP8J 3H0GH 4DR3Q 5M5WH 1PH2A 1CKOA 3HOWG 3SGIA 4OX9L 3VDYA 4L5TA 4DV7L 1UE7A 3F2BA 1PHJA 2HIXA 1SN8A 1AE3A 1GKHA 4DV6Q 3KOJA 3OTOL 3GTLH 3PF5A 3KJOA 4R4OA 3K7AH 5M3FG 4H02A 4DV4Q 3JAMc 2UUBL 3K81C 5JJKA 4JI3L 4B3RQ 1FL0A 1XPUA 3TQYA 4A3JG 1SROA 1N34L 5IYCH 3FKIH 1EQQA 2UXBL 3A5UA 3NENA 1E1OA 2VY3A 4LFBQ 1B8AA 3H0GG 2NVXH 3GTPH 3CCQA 2VQFL 1OXXK 4DK6C 4B3SL 3J81c 1I94Q 3STBD 1FJGL 4A3DG 4JI1Q 1E7ZA 1P16A 1D8LA 3GTMH 4A3LH 2XTIA 1XMOL 3HOVH 2OQ0A 5LMNL 2JA5G 3CAMA 3AQQA 4TVAB 1HZCA 2R6GA 3S17H 4R1JA 3GO5A 4BXXH 2OTJA 4L5RC 2GN5A 3FKIG 5IYCG 3RNUA 1Z47A 3E0EA 3UDFA 5IP7H 2JQOA 4JI7L 4OWTB 3S16H 1EYGA 3S14H 4IPDA 5C4XH 2HHHQ 4IOAA 1SE8A 3KYHC 3J80c 4JI0L 1MKHA 4DV1Q 2WAQG 4LF5Q 3ERSX 2CWPA 4A3LG 3HOVG 4AH6A 1S72A 4POGA 5IWAQ 3LGJA 1UEBA 4LF9Q 4JBWA 1M1KC 4BXXG 2WB1E 1XNRQ 3U58A 1HJPA 4PG3A 3BZCA 2UUCQ 5IP7G 1V1QA 1HNXQ 1KAWA 3ER0A 1MJCA 3RLNA 3UE0A 1NMGA 4AYBG 4A3KH 1ASYA 2I5LX 5HY6A 1JB7A 1VQ5A 4JYAL 1NTGA 1EWIA 1CUKA 2R7DA 3HOXH 4GOPA 1R9TH 4K0KQ 2UUAL 5FJ8H 4EX5A 2UXCL 3ICEA 1EOVA 1Q12A 3G71A 4GLAC 2D62A 2K14A 5EAYA 3PSIA 1IBMQ 2F4VQ 4C2MH 4OO1I 1UE6A 3CCVA 4GKKQ 1K3RA 1HR0Q 4KLKA 1EQRA 4DV2Q 4LFAQ 4A3KG 4DR7Q 1X3EA 1SLJA 1Y1VH 4KI0A 1PH6A 4OWWB 3I55A 1PYBA 2PI2E 3ULJA 1Q1EA 3HOXG 1W2BA 4UP9A 3PUVA 1VQ8A 5FJ8G 4XIGS 4LUVA 1N36Q 1J5EL 1X9NA 1Q8KA 2I5MX 5DLQE 5C4JH 4YWMA 2R92G 1NY4A 4AIMA 3K7UC 4DV3L 1K83H 5GAHC 1JJCB 2OTLA 4UY8C 3U4ZA 4LWCA 4JBMA 3UDGA 4GN5A 4APVA 1VQDA 4QJFA 3CCUA 2B63G 3E9IA 1HZAA 2R7FA 3PUZA 1JJ2A 3S1NH 3RR5A 4X62L 3STBC 2DGYA 4GNXA 1XPOA 1VQLA 2K5NA 3I4OA 3KDFB 2LXKA 3OTOQ 1Y1VG 1X56A 5GROA 2ZM6Q 4HJAA 2R7ZH 1X3GA 3HOZH 4JI2Q 2ZJPA 4JI3Q 3H3VH 2E2JH 4JBKA 4LFCQ 5ELOA 3AEVA 2UXBQ 4X65L 2IX0A 4L5QA 3HFZB 2NN6G 3HOYH 2IT1A 1GD7A 3KF6A 4NXMQ 1Z9FA 3CCLA 4DUYQ 5GADC 2VQFQ 1YZ6A 2JA9A 1TWGH 2UXDL 1TWAH 4IPGA 1PH3A 1KQSA 1G6PA 4JV5Q 4A3IG 2WB1G 2K5HA 1LTLA 1KIXA 2ATWA 2R7ZG 1PH9A 1QVCA 1XTDA 4LUZA 1PYSB 2CKZB 3WWVA 1GM5A 3HKZE 4DR6L 2N8NA 3S15H 1PVOA 4DK3C 4POFA 3J81j 1BBWA 5C3EH 3HOYG 4GLVB 4DR2Q 4DV0L 4IOCA 4GOPB 2N49A 5GQOA 4A3FH 3UE1A 4A3DH 2I5HA 4P74A 2HQLA 2BH8A 1YJ9A 4LF7L 1VQ6A 1X54A 1E22A 2FXQA 1MIUA 1VCIA 1NJIC 1U0LA 2JA5H 5ELNA 1RIPA 4JI8L 2VQEQ 3AYHB 1A62A 4DKAC 1PA6A 1WCMH 5M5YH 3T1YL 1IBLQ 2CCZA 1I3QH 1L1OA 1BBUA 3F8TA 3M4QA 5C3EG 5BR8Q 3PCOB 5C0XJ 1HNWL 2KHIA 2MQHA 2NVQH 4BA1I 5LMNW 2QGQA 3BJUA 3S2DH 1IBKQ 2DUDA 4A3FG 4GN4B 3HKSA 2Q2TA 2Z6KC 1KXLA 2XGTA 2L15A 2E2HH 1N32L 4DR5L 2UXCQ 2VNUD 5JEAJ 1XNQL 4DR4L 3W1GA 1CKNA 1XMQQ 2NVYH 1HNZL 3OW2A 3Q8DA 1S3OA 1WCMG 4DAMA 4QIWE 5IT9c 1IYJB 1X65A 3G6EA 3CC7A 1VQNA 2PQAA 3NBHB 3S1RH 3KFUA 4HIDA 5IP9G 2E5LL 1QUQA 2EQSA 1PH4A 3S2HH 4A3MG 1D7QA 1BVSA 1I50H 4PZ6A 2AKWB 3NEMA 1YJNA 2RF4A 2KCTA 4YY3Q 1E3PA 3EIVA 3T1HQ 4HJ9A 2A19A 4DV3Q 3CMAA 2YU9H 4X66Q 3OYYA 4RMFA 2HT1A 3KLWA 4IJLA 2JA7H 4LUOA 4LF8Q 3KJPA 1CSPA 4B3TL 4QL5A 3L7ZC 5C0XI 3CW2C 3HKZG 4DR1Q 1PV4A 3TREA 2EIFA 3W1BA 4HJ7A 4GLXA 4R4TA 2YTXA 4A75A 4DR3L 1FGUA 4UP8A 2KBNA 4PZ7A 4YCVA 1VQOA 2AMCB 1B7YB 4X64Q 1C7YA 4LF4Q 4KHPQ 2NZOA 3BZKA 1LUZA 4DV6L 4A3CG 4GKJQ 4NXNL 1JE5A 3BU2A 4MNOA 4DV4L 2JA7G 4JI5Q 4JOIC 2UXDQ 3GTOH 1WFQA 2B63H 3A0JA 4IPCA 4IJHA 4AQYQ 3S24A 4FDBA 4B3MQ 3CD6A 4LFBL 4DUZL 2UU9Q 4A93H 5K36G 3UDIA 5IY0A 4OO1G 4GN3B 1X3FA 1I94L 3A74A 2ZTCA 4JI1L 1Q86C 1X6OA 1L2FA 4YCUA 4JI6Q 1KL9A 1YHBA 4MZ9A 3I4MH 4OX9Q 2PI2A
chains in the Genus database with same CATH superfamily
5IT9E 4CKBA 1VS0A 1QWYA 2B2WA 1FYCA 4N8FA 4DV7Q 1PRTD 2Z0SA 1XJVA 1JE4A 4IUTA 4A93G 1AN8A 1EY8A 3UDXA 3RLOA 2HHHL 4OGQC 3FVQA 4X3KA 2KCMA 3D0FA 3GTGH 4DV1L 1EUJA 4PMBA 2QA4A 2B63B 5J39A 1CSQA 5IWAL 5IYDG 4K6DA 2PCFB 4LF9L 1K9MC 3I4MG 4QY7A 1XNRL 5I2YA 1PH5A 2B3GA 2PZUA 1NBWA 1ESRA 4IUNA 1OXVA 1UE1A 3BDOA 2JA6H 4E6IA 3MZ5A 5I9OA 3VR5A 4LAAA 2YTYA 3TS0A 2OWOA 3GDEA 3NXWA 5M9OA 3QR8A 4A3IB 4RHSA 2A1AA 2PNHA 2WB1B 1LT6D 3KBXA 1PH1A 1EU3A 5F2DA 3T16A 2RSNA 2X69A 5EPLA 1TS2A 1KNEA 4MIUA 2JA8H 1A15A 5JAVA 1IHZA 2F1MA 2F52A 2GVBA 3ULPA 2Q2IA 4ALPA 2AUKA 1SE2A 3VYSA 3C46A 2R92H 5IP9H 1I6VC 1YITA 1OXTA 2AWNA 4P71A 4R9WA 2EYPA 2PW5A 1HQMC 1G2SA 1PRTF 1CZWA 3IFDA 1IL8A 2UUAQ 3CCSA 2A6EC 3HRZC 2MHVA 3H94A 4X6AH 4FF3A 1PH7A 4NXNQ 2ZM6L 3NHHA 3BS1A 3OSOA 1D5MC 3BYTB 5C5MA 1E2ZA 1MJEA 1YEZA 4BBSG 1K8AC 3D6WA 4EQ5A 4BY7H 3H91A 1JC7A 2RVLA 2KCNA 2WKCA 1J5EQ 1YHAA 2E2IH 5M5YB 1JWMD 2N3SA 1CKMA 1I3QB 1EQTA 3TP8A 2HCIA 2CQAA 1SJED 3CF5A 4Y52H 3I56A 4M8AA 3RZOH 5E7NA 1D2BA 3CPFA 2JEBI 2E2HB 4DR2L 5CBAE 1U5KA 1S5FD 5ELEA 5CV7A 5C0XG 4OXPA 1KAAA 4X65Q 1X55A 1SBBB 1G291 5CBEE 2ZTDA 3HKZB 4A3EG 2EJFC 3S2HB 1IXRA 3C1FA 4C3HG 1N9WA 2MO0A 5JEAG 1DONA 1VQFA 1L0WA 3D4DA 4HSPA 3KLRA 2K50A 4DR6Q 3A55A 1H9MA 2Q8RE 3J7ZC 1V43A 1YJWA 3F2DA 2K75A 4ZQ3A 1ILQA 2MO1A 5IYDH 4GS3A 5M3MG 1LYLA 2V1CC 1ENFA 4LF7Q 4JW0A 1C9OA 4A3GH 5I6WA 4HMIA 1Y1WG 4ABNA 1XTCD 2KJXA 3DHQA 1EIYB 3HOUG 2K28A 2RBMA 2EYLA 2WKDA 4YHHQ 1IYUA 2B2UA 3H15A 2JJQA 1KD1C 1XWEA 1S40A 2E75C 4QIWB 2FMCA 4LF8L 1VQIA 1O78A 3QJYA 3CCRA 1W3SA 1N32Q 3ULLA 1IL2A 1PDQA 2EPBA 1XNQQ 2M9VA 3FPPA 3DEOA 2NN6I 1YNJC 5KNDA 4IFDH 3GTQH 2EYOA 4BBRG 2K1BA 4RCNA 2K32A 4JI4Q 4JC0A 4JI5L 1EL0A 5J3BA 2C35B 2JK8A 5EBCA 2CFMA 2ZXOA 3EBEA 4DV2L 3RN2A 4JVZA 1EIGA 4K5VA 5JJIA 1N8RC 1QILA 3PUYA 1JJGA 3GV6A 4JI6L 1A3VA 1UAPA 5M5WH 3VDYA 4DV7L 1A2TA 1AE3A 3OTOL 3PF5A 1HA5A 4IZ8A 3TDQA 4FO2A 1KLUD 3H0GG 2B2WC 2NVXH 3GTPH 2VQFL 2IWHA 1I94Q 2A68D 1O7LA 3OOCA 3VA7A 4IURA 2R3ZA 4A3LH 1M4VA 4O42A 4C3IB 1PZID 3MFGA 4R1JA 3GO5A 2GN5A 3FKIG 3RNUA 3E0EA 3MTSA 3QIAA 4OWTB 2Z4IA 1RDPD 4IPDA 1F2ZA 4IOAA 1GUWA 3KYHC 4K5WA 3FEWX 2KUMA 1Y8OB 1I4HA 1GXDC 3I4NB 4C1NK 2CWPA 3D8GA 1RD9D 2RDFA 3LGJA 4M1UB 2HQEA 1MSHA 5IP7G 1WVLA 3ER0A 3RLNA 3KLSX 1NMGA 2PZWA 4A3KH 2I5LX 1NR4A 1VQ5A 1H9JA 1I4RA 3HOXH 4K0KQ 2UUAL 4IUQA 5C4HA 2L5TA 1Q12A 3PO3B 4WRDA 2Q8TA 3P20A 3JAME 2EY2A 5EAYA 3PSIA 1SNQA 2L1BA 3S14B 3I4LA 1RCVD 3TP6A 1EQRA 3QG1A 1X3EA 1PH6A 3I55A 2PI2E 2J4XA 1SFOB 1Q1EA 1W2BA 4UP9A 1VQ8A 2K6AA 5FO7B 5FJ8G 1N36Q 1J5EL 1Q8KA 2PMZB 5C4JH 4MN3A 2K5WA 1F9SA 3DUZA 4AIMA 2F0LA 5ELFA 4OHJA 4UY8C 1LTRD 4GN5A 4QJFA 1JJ2A 1EYCA 4X3TA 4IFDJ 1B2TA 3AMUA 4WORA 1Y1VG 1X3GA 2AUJD 3DM1A 2EJGC 1PFBA 3AEVA 1MGSA 4X65L 2IT1A 3KF6A 4NXMQ 1Z9FA 1DXMA 5D65A 5FO8B 3CRKC 5GADC 2JA9A 2UXDL 5JJZA 2DN8A 5CC4A 1JOKA 4HSVA 1WD0A 2F0GA 3K5NA 1XTDA 4DR6L 3WWVA 1GM5A 3Q6SA 1DOKA 4DAPA 3I70A 4POFA 5ELCA 3S1NB 1TVXA 2TSSA 4GOPB 2N49A 1X3PA 4A3FH 5LL6X 1ZKOA 4CDDC 2I5HA 1YJ9A 4LF7L 1VQ6A 1E22A 2FXQA 3KF8A 1U0LA 1TWCB 3DWPA 5M5YH 4NW2A 1TY2A 4IUVA 1IBLQ 1I3QH 1L1OA 5C3EG 5C0XJ 3LWUA 3OMGA 2MQHA 4BA1I 1M8AA 4GN4B 1KXLA 2Q2TA 1LTID 2L15A 2E2HH 1N32L 3KLSA 5CORA 4DNTB 2VNUD 5JEAJ 1TWHB 1XNQL 1HA6A 2LMCB 1NR2A 3VR6A 1HNZL 3OW2A 1SNPA 3I73A 4Q0FA 4O1NA 2G9DA 2GA4B 4A3DB 3E0JA 3SK6A 4A3MG 3S2HH 3IL8A 4PZ6A 1L0YB 2AKWB 1YJNA 1WCMB 2F0KA 4YY3Q 1E3PA 3BZDB 3EIVA 5EKKA 2A19A 1T5EA 2OXPA 3MXGA 4IJLA 1U4RA 2F03A 3CW2C 4FXKC 2SEBD 1PV4A 3TREA 1R4PB 2EIFA 3W1BA 2DNCA 2YTXA 3HOVB 4R8IA 1HTPA 1FGUA 4NKLA 1VQOA 4OO1H 2AMCB 4K6LA 3S17B 4LF4Q 4KHPQ 2NZOA 3OPOA 1LUZA 4GKJQ 1HHVA 3T13A 1JE5A 3QO2A 4AYBB 3S16B 4N9TA 1GOZA 3GTOH 1WFQA 4S3SA 4FF2A 4IJHA 1BQQT 2L55A 3T51B 3HEJA 3UDIA 5IY0A 4GN3B 2F0VA 1I94L 1Q3LA 2ZTCA 4TSSA 2H4OA 4YCUA 3BDCA 3RMHA 1U4LA 1VF7A 3SVMA 1KL9A 3KBGA 3E6ZX 3VA5A 1B53A 2ALYB 1BCPD 2WINB 1MI2A 2EVBA 4RAUC 3MXPA 3AU7A 1EY7A 1RL2A 3T1YQ 5JJLA 5KIXA 1GHJA 1SSOA 2Q2UA 5HGQA 2IL8A 4HIKA 3CCMA 2B29A 2BA1A 5IGDA 4H44C 1N33L 4A93B 1O7IA 1FJGQ 2QEXA 4DV5L 3K80C 4QMGA 1RKNA 2DY7A 5E4WC 3TS2A 2AHOB 3GD7A 3NQIA 1KHIA 1SRUA 4BA2I 1SYGA 4K0KL 2IY5B 2R61A 3I4MB 4RKBA 3GQBA 4ZUJA 5FLXE 4JI7Q 2F0EA 2L0CA 5M5XB 2WAQE 1DD2A 5AJ3L 2HDLA 1GUGA 5EGTA 4JI0Q 2ASBA 4BY1H 1VQ9A 1EIFA 2K52A 4DA2A 1KNAA 2JA6G 3AFPA 3PMFA 1O7YA 4YCWA 1WTVA 2KHSA 1N36L 1VMCA 5K5PA 1TWAB 4C3IH 1II3A 2D0OA 3JC66 4A3MH 1BCPF 3L2PA 3QWNA 3NQTA 2Z9HA 2LXJA 5I2XA 3J81i 2JA8G 2F0NA 3TBIB 4DXGA 4L63B 4MTNA 2RHSB 3I4NH 1KTKA 2P5ZX 2RHQB 2R92G 1PFNA 5LMUL 5JOBA 3EVQA 1WI5A 3D31A 4NXML 4XDXA 3Q0AA 1CHQD 1A8VA 3C1EA 3CCJA 2B8GA 3PGZA 2DJGC 4PQXA 3TMEA 3OWEB 3TSSA 3KF6B 3OMCA 2IX1A 1E0BA 2OQKA 2VUMH 4O0AA 1M90C 3G48A 3PO3H 1KLGD 1KDCA 2Q2HA 1AZPA 2CWAA 1VQCA 4BY7G 5G3LD 1B1ZA 4YWLA 1KRTA 2PPBC 4A4IA 5FLXc 4KMUC 1AE2A 1HZ9A 1SE4A 3CQZB 1QZHA 1SFOH 3PUWA 4IO9A 1HZBA 4B3RL 1IBLL 4J15A 1TS3A 3KF8B 4QCLA 1UE5A 1CQFA 1Y14B 1VQGA 3V05A 5C4XG 3K5LA 1G51A 2H5XA 2LSSA 3DEPA 1L1OB 1Q8IA 1E2VA 2YU9B 2A6ED 2R93H 2JA7B 5KGUA 2CH4A 4V0BA 4MHEA 5DM73 5I9PA 4C3HB 1VQ4A 1L1OC 4HIOA 1JR0D 1V1PB 5EJWA 1K8GA 1FNVA 5C6AA 2F0TA 3H6MA 4HMJA 3M3YH 1DM0B 2Z6KA 4DGZA 4IN3A 1QVGA 2D0PA 1V9PA 1YNXA 4KY7A 2Y0SG 1HNWQ 4YY3L 5M3MB 1PMRA 4RFBA 1YVCA 5IIFA 3K5MA 1FNWA 1JQYD 3NELA 2K33A 5T1GA 4K14A 2KOLA 1SR3A 2YYZA 2PZTA 2SOBA 5EKLA 3X3MA 4FVMA 1H9KA 3HOUB 4A3GG 1I5FA 1HQRD 4DR4Q 1S5DD 2L4NA 3J81L 1P8LA 1VQBA 1FVIA 4TQUS 1QZGA 4LF6Q 3CPWA 3QOLA 1XYIA 2ZJQA 2NBFA 3RD4A 1JICA 4B9XA 1NAPA 1YBYA 2PQEA 4LF4L 4KHPL 3U4VA 5C3XA 2E5LQ 3IRBA 4GKJL 1TWCH 4CJ1B 2PNRC 4JPBW 1IBML 2K7VA 4EQNA 3KK7A 2LS01 3NP8A 4GKKL 5BN3A 4R8NA 2IPKD 2KENA 2V4DA 1BOSA 3VR3A 4IFDG 4A3JH 1TWHH 4RGMA 1Q81C 4JOIA 3S1QB 3GTJB 1DJRD 2WP8J 3SE0A 4JK1C 2EZVA 1UE7A 3FMCA 4ZUIA 5BN5A 3RZDB 2D5DA 1HUNA 4DV4Q 3H09A 3K81C 2XWJB 4C3JB 4A3BB 1SROA 3BYYB 5IYCH 1EQQA 4PV1C 3T4AC 1B8AA 2JXMB 5KYLA 3J81c 2ZT9C 1AEXA 1LABA 3STBD 1FJGL 1FR3A 1E7ZA 2H1EA 1D8LA 3HOVH 1YNJD 5NUCA 3CAMA 1SAPA 2LKVA 4TVAB 2AQ2B 3S17H 2N88A 4BXXH 1SNMA 2XN9C 3UDFA 4RWSC 4KD3A 4JI7L 2F0SA 3S16H 1HFNA 2B2TA 5C4XH 2Z8LA 1SE8A 5DAUA 4ZYSA 1BBXC 2ENBA 4IUPA 2F0QA 1MKHA 1H9RA 2WAQG 4JI0L 3PO2B 2BDNA 5D14A 4LF5Q 4A3LG 1S72A 4XYOA 4CKEA 4POGA 3FKIB 3A56A 3SK4A 2F3VA 1TT2A 4ZLTF 3R2IA 5E4XA 3M4OB 5C44B 3W3AA 1KAWA 4KK7A 3UE0A 3CRLC 4K5XA 3GTMB 4FP5D 2CVRA 1ICFB 4GOPA 2R7DA 3C3LA 3RUZA 1BNZA 1PZKD 1A3UA 5J1ZA 1BUVT 3GV3A 2F4VQ 3P7JA 1CFMA 1KDBA 1UE6A 5CGKA 3IKJA 4LFAQ 4A3KG 2CHBD 5KEEA 2M00A 1QJOA 3HOXG 3URYA 4F88A 2I5MX 2NN6H 1NY4A 1QE6A 2QF7A 4DV3L 2Z1CA 1GUSA 1JJCB 2RKSA 2OTLA 4JBMA 2B63G 3CCUA 1S5BD 3RR5A 4GNXA 3STBC 2DGYA 1XPOA 4HR7B 3N6RA 4DF7A 5CR3A 3EQLC 4HJAA 4F7XA 3BDLA 4JI2Q 2ZJPA 4JI3Q 5ELOA 1Z6HA 2UXBQ 3TN2A 2EYFA 4L5QA 1R4QB 4ZCKA 3CCLA 4OEMB 1GUOA 4G7ZC 1TWGH 1LT4D 1TWAH 1PH3A 2Z6BA 1MD2D 4JV5Q 4A3IG 1ET6A 3K5OA 1I4XA 1V1OA 2WB1G 2K5HA 1G2TA 1KIXA 2ATWA 1B44D 4LUZA 4KV6A 5I6YA 3A8KE 2N8NA 4GZYC 4ZRZA 3J81j 3VYRA 3D3RA 2IW3A 2X6GA 3NPPA 5GQOA 2O4XA 1BDOA 2PW7A 4KY6A 3HOZB 2E2JB 1MIUA 1VCIA 1G8ZD 1NJIC 1I6HB 1MSGA 3QB3A 2VQEQ 1PA6A 2CCZA 3F8TA 4KY5A 3I90A 1JORA 3HOWB 1Z7TA 3PCOB 1HNWL 2KHIA 2KQ3A 1UUPA 4G4KA 1EZ8A 2O5JC 5LMNW 3PIO3 3PIP3 2DUDA 4A3FG 3HKSA 5M3FB 2Z6KC 2XGTA 3S15B 2UXCQ 4DR4L 3W1GA 5AFWA 1XMQQ 5C3EB 3P1HA 3A8IE 4RHRA 3G6EA 2PQAA 3S1RH 4HIDA 4ILWA 2E5LL 2EQSA 1QG7A 4FXGC 1BVSA 1I50H 3K7AB 2WACA 2JA5B 4ID6A 3I72A 1TIID 3GP7A 1HFGA 4UDUC 2YU9H 4X66Q 1K8OA 2MPMA 4RMFA 1JOQA 2HT1A 2JA7H 4LUOA 2HCCA 3K57A 1CSPA 3L7ZC 5C0XI 3HKZG 4DR1Q 4A75A 4HEDA 2NVYB 2KBNA 4PZ7A 4X64Q 4H0LC 2NZ1D 1PLFA 3I8ZA 4A3CG 4NXNL 4MNOA 4DV4L 3LNNA 3OHXC 4KD4A 1HPCA 4JOIC 2B63H 4IPCA 1UEAB 4K8JA 2PYKA 4B3MQ 3HZXA 2UU9Q 4OO1G 1DOLA 1X3FA 3A74A 2A69C 4C56C 5C5LA 1X6OA 2HD3A 4DFAA 2NYZD 1U4MA 2F0DA 5CV9A 2I0QA 3DM3A 4H13C 4A3IH 1R9TB 1Q82C 4LJZC 2UUBQ 4O2DA 3KUPA 3I2ZA 1N34Q 3TRZA 1BXTA 4C2MB 4LF5L 1BKBA 2OCEA 1HH2P 2XVSA 3M4YA 2JSOA 5GAGC 4JG2A 3G4SA 4P73A 3M9BA 1LACA 2B39A 2B2TC 5A2QL 3E5SA 1XMOQ 2VS1A 2CQOA 1VQEA 5LMNQ 2K03A 3K0YA 4B9WA 5E3FA 2ZJRA 3E9HA 1K83B 1EYAA 1K0RA 3EJIA 1ET9A 5KNCA 1OXUA 1WTPA 2A8VA 1OXSC 2YTVA 3ZJYC 4ODGA 1SEBD 3SDZA 4PZ8A 4A3BH 2XSCA 2R7ZB 4LMQD 1SYEA 2VZAA 3CC2A 1A2UA 3MEFA 4P72A 3A5ZB 1JCKB 4GOPC 3HOYB 1SYCA 5I4DA 3J80L 1QCBD 1TS4A 3NTKA 4NMZA 2I46A 4YHHL 1KDAA 5JPNC 4U68A 4J1MA 5IGEA 4A76A 1PH8A 5FLMH 1G91A 3Q22A 2G9HD 2QDBA 2JA6B 1QNUA 4BY1G 1V1PA 2RCNA 1RF2D 1WOCA 4HIMA 2XNAC 4R4QA 2EYMA 4R4CA 4GNXB 4JI2L 3PO2H 4C3IG 2EXDA 1NMFA 4RCOA 1BR9A 1WYDA 4QGUA 1Q7YC 2BA0A 2I07B 4DUZQ 3M4OH 2NZHA 2Y0SE 4GNXC 4JI4L 5C44H 5COYA 3L0OA 2QKIC 4JV5L 3CXCA 2JE6I 1ENCA 1JWSD 3EN2A 1B9NA 4A3CH 2R92B 3DXJC 1GO3E 5IOCA 3KDFA 4I7ZC 3I4NG 3S2DB 1FGBD 2JYOA 4HN7A 4QF4A 3CC4A 2BH2A 1Y8NB 1GVPA 3MEHA 5CYUA 3MAQA 1JT8A 1CT1D 4FF1A 3NTIA 1RTNA 3U9OA 1IZ6A 2ICIA 4JBJA 3BVMA 2K05A 1H95A 1I4PA 1ZYRD 3RLFA 2F3WA 4KHVA 4DK1A 1XPRA 2VQEL 2VUMG 3RN5A 2RQXA 4UPAA 3SHLA 5IYBH 3PO3G 3FHWA 2MFIA 3I7FA 3EA6A 2QEJC 2E2IB 4UP7A 3PV0A 5A35A 2EYHA 2LY7A 2C5CA 1E1TA 1VDZA 1O7ZA 2CH4W 2KECA 1AH9A 2EE1A 3DWAA 5IGBA 1AP0A 4CHTB 5EKIA 1XMQL 4HJ8A 2ICEC 2HIVA 3NSWA 4J6HA 1IW7D 1BO0A 3WDNA 2WFWA 2M2LA 4ZKCB 4DPGA 1C8CA 1RTOA 2PQAB 2R93G 2XRSD 3CP0A 2PO4A 2C9OA 3M85A 4HTHA 3I91A 4P75A 2IHEA 4X66L 2SDFA 3X3NA 5H1SE 2FINB 1D1KA 3NBHA 3T56B 4DR1L 2SNMA 4K8IA 1A0IA 1EFWA 2JEAI 3HS0C 1K73C 1J6QA 5EBDA 4X64L 1GJXA 1HR0W 1VQHA 4L6TB 1NNXA 1W6KA 3C2PA 5FO9B 3HOWH 5GAEC 3H3VI 1S5CD 4PNYA 3PIOA 1DGSA 3M7GA 3PIPA 4B3ML 4OIJA 4XTCS 2EY1A 2UU9L 1TR5A 5HGTA 1PTOB 1ZYRC 4QUCA 5M3FH 3GTKB 2CW0C 3MFYA 3ZYYX 4B3TQ 3NE5B 4YWKA 3U50C 4KHZA 1PTOC 4DR3Q 3EFXD 1CKOA 1STHA 3SGIA 1K0SA 4L5TA 1RHPA 2HIXA 1SN8A 2NVTB 1GKHA 2EXZA 2FJ2A 3K7AH 4R4OA 4H02A 2DNEA 2UUBL 2FMMA 1FL0A 1XPUA 4A3JG 4RA8A 3CHBD 1N34L 1WTWA 2A6HC 1E1OA 2VY3A 1IW7C 4LFBQ 2NUCA 2O2LD 3CCQA 1OXXK 4NDXA 5HURA 3ONAB 4QB4A 4A3DG 4JI1Q 3PQIA 4DXFA 2XTIA 1XMOL 2OQ0A 5LMNL 1PFMA 4BBSB 1FNUA 1XX8A 2A5HA 4IUUA 3TP7A 1HZCA 2OTJA 4L5RC 5IYCG 4UAIA 1YNNC 1Z47A 1EYGA 4FNFA 3S14H 3D4RA 2QDLA 2NTTA 3A8JE 3ERSX 3HOVG 1SDFA 5JPMC 2HUGA 4JBWA 4XYQA 3MWYW 1W6JA 4BXXG 2WB1E 2OT2A 3GTPB 3U58A 4XQJA 1K28A 5CV5A 1HJPA 3BZCA 2UUCQ 4Y7NB 3P75A 4XT3B 1V1QA 4EVOA 1HNXQ 1MHWC 4Q5VA 4AYBG 1MJCA 5DNFA 3S1MB 1ASYA 2WAQB 2MP1A 2MJ8A 5HY6A 1JB7A 2BE5C 5ELBA 1SMYC 1NTGA 1EWIA 1CUKA 1WTRA 1R9TH 1TWFB 4A3EB 1EOVA 3G71A 1EY0A 4GLAC 2D62A 2WV6D 2K14A 1UNSA 2ZXRA 1HUMA 1WD1A 4C2MH 3CCVA 1GHKA 1HR0Q 1EWHA 4DAVA 4DV2Q 2E76C 4DR7Q 1SLJA 3A54A 1LTAD 4KI0A 4OWWB 1PYBA 3J81E 1STGA 3F2UA 4LUVA 4XIGS 3TZDA 1X9NA 5IGCA 5DLQE 2K5DA 3K7UC 3AB9A 1K83H 2E74C 1F2LA 1Y1WB 1Y8PB 2N55A 3U4ZA 4LWCA 3UDGA 4APVA 1E2WA 3E9IA 1HZAA 2R7FA 3S1NH 1VQLA 3HOXB 3KDFB 3OTOQ 1X56A 4BS9A 5G3LF 2NTSA 1F9PA 2R7ZH 3ND9A 4C1NI 2VXWA 4LFCQ 2IX0A 1STYA 2NN6G 3HOYH 1GD7A 5IT9L 5EPJA 4DUYQ 2VQFQ 5EQ0A 1DCZA 4IPGA 1KQSA 1G6PA 3VYUA 2IJ0A 1B3QA 5C4JB 1PH9A 1PYSB 2CKZB 3HKZE 4BBRB 1PVOA 3ND8A 1J8IA 1BBWA 4GLVB 5CMDA 2KCCA 3K58A 4I7AA 2FHTA 3UE1A 4A3DH 2MUYA 4CDFC 1X54A 3TP5A 5C4ZA 3J7YW 4CKCA 1A62A 5DEHA 5FOBB 1WCMH 3T1YL 3M4QA 5BR8Q 3WOEA 2QGQA 3BJUA 3S2DH 1IBKQ 4UHVA 1X32A 1CKNA 1VMPA 3SK5A 4J8QA 1PRTB 1S3OA 4DAMA 1G6ZA 3H0GB 4G57A 4QIWE 5IT9c 1IYJB 1X65A 3CC7A 3NBHB 4DNRB 3KFUA 4H7BA 4A3FB 4N9PA 4EQPA 1SNDA 4F8MA 1PRTC 3GTLB 1D7QA 1LTBD 1TQOA 3NEMA 1B50A 3CU7A 2RF4A 3ITPA 3T1HQ 4HJ9A 3CMAA 2WIIB 5J22A 3QOJA 3KJPA 2B2VA 4B3TL 4QL5A 4ZAIA 1XXGA 2F0FA 4HJ7A 4GLXA 2KEDA 3MXNA 4DR3L 5K36H 1B7YB 1D6EC 2EY6A 1C7YA 4KN7C 3U9SA 3EROA 4G7OC 1NCVA 3BU2A 3HGBA 2JA7G 3SEBA 1C48A 2KA7A 2UXDQ 3A0JA 4AQYQ 3S24A 4DAYA 4LFBL 4A93H 1QB5D 3MC0B 1NUCA 1SNCA 2NB0A 4JI1L 1Q86C 4ZKBB 1F77A 1L2FA 4KKSA 4K2LA 1YHBA 4MZ9A 4XXEA 2F0JA 3I4MH 1V8QA 4OX9Q 2PI2A 1ILPA 4L5SA 1A63A 1EWCA 2ZXPA 4CDEC 4ME3A 5M5XH 3BVGA 1QOHA 4QQBX 4Z9CB 1AFPA 3A7LA 5FKAC 1LTSD 1QUQB 1KABA 2EDGA 4NP5A 3GTOB 3GTKH 3W5OA 1PTOH 4HJ5A 5ELDA 1S4ZA 4B3SQ 1TY0A 1Y1VB 4IPHA 3J7AV 1HTLD 2G5DA 1RODA 2XIWA 2UUCL 1Q46A 1HNXL 5IODA 3WOFA 1VQ7A 3LWEA 1HNZQ 3TEHB 4R4IA 2NVTH 1LTTD 3DWQA 4K2KA 2E2DC 1DOMA 1EY9A 3PUXA 4KJNA 4OONA 5CV6A 2RCFA 3IAYA 3M7NA 5BN4A 1CK1A 1HR0L 4IFDI 3F1ZA 1K8MA 1K3BC 3L3OC 4NB3A 4DR7L 2OEOA 4X3UA 2A69D 2VW9A 1EQVA 3H3VC 2J0TD 3JAMi 3K6OA 3D4WA 4BBSH 1B70B 4C3JG 4A3BG 2L11A 4JYAQ 4XQQA 1KRSA 2Z4HA 4TKOB 4OWXB 2PMZE 1QVFA 1EU4A 2FFKB 2KHJA 2RDHA 2EY5A 4LF6L 2GVAA 2ID0A 1T9HA 4WJ3M 1IYVA 3BG3A 4LFCL 3CCEA 3CQZH 4CJ0B 1JMCA 5FLMG 4IALA 2VL6A 2F3IA 4WJWA 4BY1B 4DUYL 1PFSA 1E24A 4V190 1TXYA 1F2MA 2SNSA 1VQPA 1I6HH 4Y7NH 4L8JA 2MNAA 5C0XH 3S1MH 4RGTA 1PXUA 1IKLA 4JCVE 3B6YA 3J80i 1ASZA 2NVQB 4WJ4A 5FK9C 5IE8A 1T5XD 3PO2G 1TWFH 4A3EH 5JVG3 4A3MB 4B08A 4C3HH 3L9AX 4X62Q 2ES2A 4FF4A 5JEAH 4HAEA 1YI2A 2AWOA 4YIJA 1YHQA 5C44G 1D5ZC 3K8AA 5T1IA 2IX3A 1VF5C 2LFNA 2K5VA 4FXDA 2YV5A 1LO5D 2B2YA 1N33Q 4X3SA 5M3MH 4DV5Q 1TS5A 4G7HC 3FPUB 1VQJA 5BR8L 4RGOS 4CDCC 1H9SA 1EEFD 1I4QA 4BWGB 1Y1WH 4LW1A 4LNQA 2QCPX 1WTXA 1IBKL 2RDGA 2N78A 2F0PA 1SYFA 3S9WA 3HOUH 4ULLA 2VUMB 1U9RA 4DU9A 5IGGA 3R8BA 4DV0Q 3J7A5 1SXTA 5AJ3Q 2E8GA 2K5QA 1VQAA 5IYBG 1PYWD 4TRDA 3TZUA 1CKNB 3AFQA 3E3XA 1KC8C 3K59A 1DZ1A 5A2QE 3CKIB 3IFTA 4JI8Q 1EEID 5CV4A 4NPSA 3K0XA 3PF4A 2L12A 3JAML 3F2CA 3T1HL 1JB3A 3NTHA 4WFN3 3DLLA 3NUCA 2KVMA 4BBRH 1CTMA 1WTQA 2RA4A 1YIJA 2DJFC 4RG1A 4MTKA 2L9HA 2JN4A 3CMEA 3FP9A 4EQOA 3S1QH 2R93B 3GTJH 1ICWA 4DR5Q 2A68C 4PMWA 1CI3M 1LM0A 1OTCA 2MGSA 4EGVA 1NE3A 1NSNS 3J80E 1Q1BA 2K4KA 3RZDH 3MXNB 4DNIA 5LMUQ 1STBA 2ZTEA 2XRQD 1A6XA 5D3DA 4C3JH 2JP1A 3M3YB 2B2VC 4PMCA 2F4VL 1SMXA 1D5XC 1UWVA 3M4PA 3GTGB 4U673 1C0AA 4LFAL 4AQYL 1OO9B 1HCZA 1VQMA 2IHFA 5C3WA 1ZXTA 5L37A 4OIKA 3HOZG 4AYBE 4QUFA 5LL6S 4CGYB 2VB3X 2A73B 4KJOA 1WJJA 3VR4A 4DAYB 1VQKA 1MBYA 3H0GH 1PH2A 3HOWG 4OX9L 1AW7A 1U4PA 1CM9A 3F2BA 2K04A 1PHJA 2TMPA 3FRPB 5D3IB 4DV6Q 3KOJA 4KN4C 1ONLA 3GTLH 3KJOA 5M3FG 3JAMc 4CBVA 1DYQA 1F9RA 5JJKA 4JI3L 4B3RQ 3TQYA 3FDTA 3I3CA 1LLRD 3FKIH 3Q23A 2UXBL 3A5UA 3NENA 5IGFA 4B3SL 3SR1A 1B3AA 4DK6C 2JA8B 3SK8A 2K01A 3NBIA 3SXHA 4KTAA 1P16A 1JOOA 3D6CA 2EYJA 4LK1C 4A3JB 3GTMH 2JA5G 2F0IA 1STEA 3AQQA 1A3TA 1CHPD 1ENAA 4XT1B 5JVH3 1RJTA 2R6GA 2B2UC 4F87A 1EIHA 1X3QA 1PZJD 3HP3A 3MXUA 1WTHA 3MA2B 4FYDA 5IP7H 2JQOA 2VB2X 2HHHQ 1SNOA 1EY6A 3J80c 4DV1Q 1J9OA 2F0UA 4AH6A 2CW0D 1B4OA 5IWAQ 1UEBA 4RKLA 3VR2A 4LF9Q 1M1KC 1XNRQ 2AQ1B 5CV8A 4BY7B 1PTOD 4PG3A 1AZQA 1B9MA 3V96A 1LTGD 4RH6A 4KKUA 4ME5A 4JYAL 4XQNA 2NWGA 2B8FA 3UI2A 5FJ8H 4EX5A 2HDMA 4RGNA 4OL7A 3RZOB 3ICEA 3J7AF 2UXCL 2O5IC 1SJHD 1LT3D 1STNA 1IBMQ 2A6HD 5C4XB 4OO1I 4P2CB 4GKKQ 1K3RA 3G7LA 4KLKA 2RSOA 3R93A 3V2TA 1Y1VH 1EOTA 3ULJA 2Q8IB 3PUVA 1QNKA 2XWBB 2OF1A 4YWMA 1WTOA 5GAHC 1EZ6A 1YNND 3NWSA 1VQDA 3T53B 3PUZA 4X62L 2K5NA 1O80A 3I4OA 2LXKA 5GROA 1EY5A 2Y0SB 2ZM6Q 3HOZH 1C4QA 3H3VH 2E2JH 4DN4M 4JBKA 3OIQA 3HFZB 1ESFA 2KEEA 4A3GB 1Y69U 3MVVA 1YZ6A 1PTOF 2BDOA 3DMUA 3R3OA 3VYTA 2BE5D 5E1FA 3N52A 1LTLA 1SMYD 4CJ2C 5KYIA 2R7ZG 1SE3A 1HXYD 1QVCA 3S15H 4DK3C 3O13A 1H9SB 2F0HA 3BVZA 5C3EH 3HOYG 1STAA 2B2YC 2A74C 4DR2Q 3R2TA 4DV0L 4IOCA 2D9UA 4P74A 1ML0D 2HQLA 2BH8A 3GTQB 2JA5H 5ELNA 1RIPA 4JI8L 5KNBA 3AYHB 4DKAC 1CZGA 5FLXL 1BBUA 1TWGB 4KKTA 5ISRA 4I65A 4IQZA 2BCOA 3ERQA 2NVQH 2J7ZA 2QW7A 5LHY1 1JWUD 5EPKA 1F2YA 1TU2B 4DR5L 1LV9A 1EFID 2NVYH 2X6LA 1BCPB 3Q8DA 1FD7D 1WCMG 2EOTA 5M5WB 1VQNA 3OIPA 1F9QA 1BF4A 5IP9G 1QUQA 1SYDA 3Q24A 1PH4A 1BCPC 3NWTA 1IKMA 1TKWB 3A7AB 5KRUA 2DY8A 1GUTA 1S5ED 2QILA 2KCTA 4N8X1 2AQ3B 4DV3Q 3HG9A 3OYYA 3LX0A 2NVXB 3OW7A 1D1IA 3KLWA 4LF8Q 1HRJA 2F0MA 4R4TA 1EYDA 4DK0A 2D2CC 3NK9A 4UP8A 4YCVA 3W2DA 5DM63 1CA6A 1LT5D 1CQVA 3BZKA 5TSSA 1GUNA 3OWFA 4DV6L 3S1RB 2F0OA 1SYBA 4HCSA 2EJMA 4JI5Q 4ZK9B 1L0XB 1I50B 3MHBA 4FDBA 2F4IA 2BOSA 1I4GA 3CD6A 4DUZL 5K36G 4HCEA 1EY4A 1CA5A 4OELB 1Q90A 2F0WA 4JI6Q 3G6JB 4A3KB 1ZEQX
chains in the Genus database with same CATH topology
4DV7Q 1VS0A 2I0QA 2ALYB 4L5SA 1A63A 3DM3A 2Z0SA 4A3IH 4ME3A 1XJVA 5M5XH 4A93G 1Q82C 4QQBX 3UDXA 3RLOA 2HHHL 2UUBQ 1RL2A 2KCMA 3D0FA 4O2DA 3GTGH 3I2ZA 3T1YQ 5JJLA 1N34Q 3TRZA 1QUQB 4DV1L 1EUJA 4LF5L 1BKBA 2QA4A 2Q2UA 2OCEA 3GTKH 1HH2P 1CSQA 3W5OA 5HGQA 5IWAL 5GAGC 4HJ5A 4HIKA 5IYDG 4JG2A 2B29A 3G4SA 3CCMA 4LF9L 2BA1A 4B3SQ 4P73A 1K9MC 3M9BA 4QY7A 4IPHA 3I4MG 1N33L 1XNRL 1O7IA 1FJGQ 1PH5A 2QEXA 4DV5L 3K80C 2B3GA 2UUCL 1NBWA 1Q46A 1HNXL 1XMOQ 2VS1A 3TS2A 2CQOA 1VQEA 2AHOB 5LMNQ 3GD7A 1HNZQ 1VQ7A 1OXVA 1UE1A 3TEHB 2JA6H 4R4IA 1KHIA 1SRUA 2ZJRA 4BA2I 3E9HA 2NVTH 4K0KL 1K0RA 2IY5B 2YTYA 3TS0A 1OXUA 2OWOA 3GDEA 2A8VA 1OXSC 2YTVA 4JI7Q 3ZJYC 3PUXA 4PZ8A 2A1AA 2PNHA 2WAQE 4OONA 5AJ3L 4A3BH 1PH1A 3M7NA 3CC2A 2VZAA 4JI0Q 2ASBA 3MEFA 1HR0L 4BY1H 4IFDI 4P72A 3A5ZB 1VQ9A 3F1ZA 1EIFA 4DR7L 4GOPC 4NB3A 2JA8H 2K52A 2JA6G 2VW9A 2F52A 2GVBA 3AFPA 4YCWA 3ULPA 2Q2IA 4ALPA 1N36L 4YHHL 3JAMi 4C3IH 2R92H 5IP9H 2D0OA 4A76A 1OXTA 2AWNA 4P71A 5FLMH 1YITA 1B70B 1PH8A 4BBSH 3JC66 4A3MH 4A3BG 4JYAQ 3L2PA 2UUAQ 1KRSA 4BY1G 3CCSA 4OWXB 2LXJA 3J81i 2PMZE 2JA8G 2RCNA 1QVFA 2KHJA 4X6AH 1WOCA 1PH7A 4HIMA 2ZM6L 4LF6L 4NXNQ 4R4QA 2GVAA 2ID0A 4MTNA 1T9HA 2RHSB 4R4CA 4GNXB 4JI2L 3I4NH 3PO2H 4WJ3M 1MJEA 2RHQB 4LFCL 2EXDA 3CCEA 1NMFA 1YEZA 3CQZH 1JMCA 5FLMG 5LMUL 4BBSG 1WYDA 4QGUA 1Q7YC 2VL6A 2BA0A 1WI5A 2F3IA 3D31A 4DUZQ 1K8AC 4NXML 3M4OH 1A8VA 2NZHA 1PFSA 2Y0SE 4EQ5A 3CCJA 5C44H 1E24A 3PGZA 4DUYL 1TXYA 4GNXC 4BY7H 3L0OA 1VQPA 4Y7NH 2E2IH 2MNAA 1J5EQ 1YHAA 1I6HH 4JV5L 2N3SA 3KF6B 1CKMA 3CXCA 3S1MH 4JCVE 2JE6I 2IX1A 3EN2A 4A3CH 3B6YA 3J80i 1GO3E 1ASZA 3KDFA 4WJ4A 2OQKA 5IE8A 3I4NG 2VUMH 3CF5A 4O0AA 3PO2G 4Y52H 1TWFH 3I56A 4A3EH 1M90C 5E7NA 3RZOH 3CPFA 3G48A 4C3HH 3PO3H 4X62Q 2ES2A 2Q2HA 3CC4A 2BH2A 1GVPA 2JEBI 1JT8A 2CWAA 1YI2A 2AWOA 4DR2L 1VQCA 1YHQA 4BY7G 1U5KA 5C44G 1IZ6A 4JBJA 3K8AA 4YWLA 5C0XG 4OXPA 1H95A 1KRTA 4X65Q 2K5VA 3RLFA 4A4IA 5FLXc 1AE2A 1HZ9A 1X55A 1QZHA 2YV5A 1G291 1SFOH 3PUWA 2ZTDA 2VQEL 1HZBA 4IO9A 3RN5A 1XPRA 2VUMG 4B3RL 4A3EG 4UPAA 1N33Q 1IXRA 1IBLL 5M3MH 4J15A 5IYBH 4DV5Q 3FHWA 2MFIA 3PO3G 1N9WA 3I7FA 3KF8B 1VQJA 2MO0A 5JEAG 5BR8L 4JI4L 1UE5A 1VQFA 1Y14B 4UP7A 1VQGA 1L0WA 1Y1WH 3PV0A 5C4XG 4LW1A 4LNQA 1G51A 2H5XA 2LSSA 2K50A 4DR6Q 1L1OB 1IBKL 2N78A 1E1TA 2R93H 3HOUH 1AH9A 3J7ZC 1V43A 1YJWA 3F2DA 2K75A 2MO1A 1VQ4A 4HJ8A 4DV0Q 1L1OC 1XMQL 5IYDH 3J7A5 2HIVA 4GS3A 5AJ3Q 2E8GA 4HIOA 1VQAA 5M3MG 5IYBG 1K8GA 1LYLA 2V1CC 4LF7Q 1CKNB 3AFQA 3M3YH 1C9OA 4A3GH 2WFWA 2Z6KA 1Y1WG 1KC8C 1QVGA 4DPGA 4JI8Q 2D0PA 2PQAB 2R93G 1EIYB 3HOUG 1V9PA 1YNXA 4NPSA 3K0XA 3PF4A 3CP0A 3M85A 4YHHQ 2Y0SG 1HNWQ 4YY3L 3H15A 1KD1C 2JJQA 3F2CA 3T1HL 1YVCA 4P75A 1S40A 4IFDJ 3DLLA 2IHEA 3NELA 4X66L 4BBRH 1SR3A 2YYZA 1YIJA 4LF8L 1VQIA 4RG1A 5H1SE 3CMEA 1W3SA 3CCRA 3FP9A 3S1QH 1N32Q 3GTJH 3ULLA 4DR5Q 1IL2A 4A3GG 1I5FA 1XNQQ 4DR1L 4DR4Q 1P8LA 4PMWA 1VQBA 1FVIA 1A0IA 1LM0A 2NN6I 4TQUS 1QZGA 1OTCA 1EFWA 4LF6Q 1NE3A 2JEAI 3CPWA 1K73C 2ZJQA 1J6QA 4X64L 1Q1BA 2K4KA 1YBYA 3RZDH 1HR0W 3GTQH 1VQHA 4LF4L 3U4VA 2E5LQ 3MXNB 4DNIA 3IRBA 5LMUQ 4GKJL 4KHPL 1TWCH 2ZTEA 4BBRG 4C3JH 1IBML 4JI4Q 2F4VL 4JC0A 1SMXA 4JI5L 3HOWH 5J3BA 5GAEC 2C35B 2JK8A 1UWVA 3M4PA 2CFMA 3H3VI 4GKKL 3EBEA 1C0AA 4DV2L 3RN2A 3PIOA 4AQYL 1DGSA 3PIPA 4LFAL 4B3ML 2KENA 1VQMA 2IHFA 4XTCS 2UU9L 5M3FH 5JJIA 3HOZG 4AYBE 4IFDG 4A3JH 4DAYB 1VQKA 1WJJA 1TWHH 4YWKA 3PUYA 1N8RC 4B3TQ 3U50C 1JJGA 1Q81C 4JOIA 4JI6L 4KHZA 2WP8J 3H0GH 4DR3Q 5M5WH 1PH2A 1CKOA 3HOWG 3SGIA 4OX9L 3VDYA 4L5TA 4DV7L 1UE7A 3F2BA 1PHJA 2HIXA 1SN8A 1AE3A 1GKHA 4DV6Q 3KOJA 3OTOL 3GTLH 3PF5A 3KJOA 4R4OA 3K7AH 5M3FG 4H02A 4DV4Q 3JAMc 2UUBL 3K81C 5JJKA 4JI3L 4B3RQ 1FL0A 1XPUA 3TQYA 4A3JG 1SROA 1N34L 5IYCH 3FKIH 1EQQA 2UXBL 3A5UA 3NENA 1E1OA 2VY3A 4LFBQ 1B8AA 3H0GG 2NVXH 3GTPH 3CCQA 2VQFL 1OXXK 4DK6C 4B3SL 3J81c 1I94Q 3STBD 1FJGL 4A3DG 4JI1Q 1E7ZA 1P16A 1D8LA 3GTMH 4A3LH 2XTIA 1XMOL 3HOVH 2OQ0A 5LMNL 2JA5G 3CAMA 3AQQA 4TVAB 1HZCA 2R6GA 3S17H 4R1JA 3GO5A 4BXXH 2OTJA 4L5RC 2GN5A 3FKIG 5IYCG 3RNUA 1Z47A 3E0EA 3UDFA 5IP7H 2JQOA 4JI7L 4OWTB 3S16H 1EYGA 3S14H 4IPDA 5C4XH 2HHHQ 4IOAA 1SE8A 3KYHC 3J80c 4JI0L 1MKHA 4DV1Q 2WAQG 4LF5Q 3ERSX 2CWPA 4A3LG 3HOVG 4AH6A 1S72A 4POGA 5IWAQ 3LGJA 1UEBA 4LF9Q 4JBWA 1M1KC 4BXXG 2WB1E 1XNRQ 3U58A 1HJPA 4PG3A 3BZCA 2UUCQ 5IP7G 1V1QA 1HNXQ 1KAWA 3ER0A 1MJCA 3RLNA 3UE0A 1NMGA 4AYBG 4A3KH 1ASYA 2I5LX 5HY6A 1JB7A 1VQ5A 4JYAL 1NTGA 1EWIA 1CUKA 2R7DA 3HOXH 4GOPA 1R9TH 4K0KQ 2UUAL 5FJ8H 4EX5A 2UXCL 3ICEA 1EOVA 1Q12A 3G71A 4GLAC 2D62A 2K14A 5EAYA 3PSIA 1IBMQ 2F4VQ 4C2MH 4OO1I 1UE6A 3CCVA 4GKKQ 1K3RA 1HR0Q 4KLKA 1EQRA 4DV2Q 4LFAQ 4A3KG 4DR7Q 1X3EA 1SLJA 1Y1VH 4KI0A 1PH6A 4OWWB 3I55A 1PYBA 2PI2E 3ULJA 1Q1EA 3HOXG 1W2BA 4UP9A 3PUVA 1VQ8A 5FJ8G 4XIGS 4LUVA 1N36Q 1J5EL 1X9NA 1Q8KA 2I5MX 5DLQE 5C4JH 4YWMA 2R92G 1NY4A 4AIMA 3K7UC 4DV3L 1K83H 5GAHC 1JJCB 2OTLA 4UY8C 3U4ZA 4LWCA 4JBMA 3UDGA 4GN5A 4APVA 1VQDA 4QJFA 3CCUA 2B63G 3E9IA 1HZAA 2R7FA 3PUZA 1JJ2A 3S1NH 3RR5A 4X62L 3STBC 2DGYA 4GNXA 1XPOA 1VQLA 2K5NA 3I4OA 3KDFB 2LXKA 3OTOQ 1Y1VG 1X56A 5GROA 2ZM6Q 4HJAA 2R7ZH 1X3GA 3HOZH 4JI2Q 2ZJPA 4JI3Q 3H3VH 2E2JH 4JBKA 4LFCQ 5ELOA 3AEVA 2UXBQ 4X65L 2IX0A 4L5QA 3HFZB 2NN6G 3HOYH 2IT1A 1GD7A 3KF6A 4NXMQ 1Z9FA 3CCLA 4DUYQ 5GADC 2VQFQ 1YZ6A 2JA9A 1TWGH 2UXDL 1TWAH 4IPGA 1PH3A 1KQSA 1G6PA 4JV5Q 4A3IG 2WB1G 2K5HA 1LTLA 1KIXA 2ATWA 2R7ZG 1PH9A 1QVCA 1XTDA 4LUZA 1PYSB 2CKZB 3WWVA 1GM5A 3HKZE 4DR6L 2N8NA 3S15H 1PVOA 4DK3C 4POFA 3J81j 1BBWA 5C3EH 3HOYG 4GLVB 4DR2Q 4DV0L 4IOCA 4GOPB 2N49A 5GQOA 4A3FH 3UE1A 4A3DH 2I5HA 4P74A 2HQLA 2BH8A 1YJ9A 4LF7L 1VQ6A 1X54A 1E22A 2FXQA 1MIUA 1VCIA 1NJIC 1U0LA 2JA5H 5ELNA 1RIPA 4JI8L 2VQEQ 3AYHB 1A62A 4DKAC 1PA6A 1WCMH 5M5YH 3T1YL 1IBLQ 2CCZA 1I3QH 1L1OA 1BBUA 3F8TA 3M4QA 5C3EG 5BR8Q 3PCOB 5C0XJ 1HNWL 2KHIA 2MQHA 2NVQH 4BA1I 5LMNW 2QGQA 3BJUA 3S2DH 1IBKQ 2DUDA 4A3FG 4GN4B 3HKSA 2Q2TA 2Z6KC 1KXLA 2XGTA 2L15A 2E2HH 1N32L 4DR5L 2UXCQ 2VNUD 5JEAJ 1XNQL 4DR4L 3W1GA 1CKNA 1XMQQ 2NVYH 1HNZL 3OW2A 3Q8DA 1S3OA 1WCMG 4DAMA 4QIWE 5IT9c 1IYJB 1X65A 3G6EA 3CC7A 1VQNA 2PQAA 3NBHB 3S1RH 3KFUA 4HIDA 5IP9G 2E5LL 1QUQA 2EQSA 1PH4A 3S2HH 4A3MG 1D7QA 1BVSA 1I50H 4PZ6A 2AKWB 3NEMA 1YJNA 2RF4A 2KCTA 4YY3Q 1E3PA 3EIVA 3T1HQ 4HJ9A 2A19A 4DV3Q 3CMAA 2YU9H 4X66Q 3OYYA 4RMFA 2HT1A 3KLWA 4IJLA 2JA7H 4LUOA 4LF8Q 3KJPA 1CSPA 4B3TL 4QL5A 3L7ZC 5C0XI 3CW2C 3HKZG 4DR1Q 1PV4A 3TREA 2EIFA 3W1BA 4HJ7A 4GLXA 4R4TA 2YTXA 4A75A 4DR3L 1FGUA 4UP8A 2KBNA 4PZ7A 4YCVA 1VQOA 2AMCB 1B7YB 4X64Q 1C7YA 4LF4Q 4KHPQ 2NZOA 3BZKA 1LUZA 4DV6L 4A3CG 4GKJQ 4NXNL 1JE5A 3BU2A 4MNOA 4DV4L 2JA7G 4JI5Q 4JOIC 2UXDQ 3GTOH 1WFQA 2B63H 3A0JA 4IPCA 4IJHA 4AQYQ 3S24A 4FDBA 4B3MQ 3CD6A 4LFBL 4DUZL 2UU9Q 4A93H 5K36G 3UDIA 5IY0A 4OO1G 4GN3B 1X3FA 1I94L 3A74A 2ZTCA 4JI1L 1Q86C 1X6OA 1L2FA 4YCUA 4JI6Q 1KL9A 1YHBA 4MZ9A 3I4MH 4OX9Q 2PI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 Q;  1VS0 A;  2I0Q A;  2ALY B;  4L5S A;  1A63 A;  3DM3 A;  2Z0S A;  4A3I H;  4ME3 A;  1XJV A;  5M5X H;  4A93 G;  1Q82 C;  4QQB X;  3UDX A;  3RLO A;  2HHH L;  2UUB Q;  1RL2 A;  2KCM A;  3D0F A;  4O2D A;  3GTG H;  3I2Z A;  3T1Y Q;  5JJL A;  1N34 Q;  3TRZ A;  1QUQ B;  4DV1 L;  1EUJ A;  4LF5 L;  1BKB A;  2QA4 A;  2Q2U A;  2OCE A;  3GTK H;  1HH2 P;  1CSQ A;  3W5O A;  5HGQ A;  5IWA L;  5GAG C;  4HJ5 A;  4HIK A;  5IYD G;  4JG2 A;  2B29 A;  3G4S A;  3CCM A;  4LF9 L;  2BA1 A;  4B3S Q;  4P73 A;  1K9M C;  3M9B A;  4QY7 A;  4IPH A;  3I4M G;  1N33 L;  1XNR L;  1O7I A;  1FJG Q;  1PH5 A;  2QEX A;  4DV5 L;  3K80 C;  2B3G A;  2UUC L;  1NBW A;  1Q46 A;  1HNX L;  1XMO Q;  2VS1 A;  3TS2 A;  2CQO A;  1VQE A;  2AHO B;  5LMN Q;  3GD7 A;  1HNZ Q;  1VQ7 A;  1OXV A;  1UE1 A;  3TEH B;  2JA6 H;  4R4I A;  1KHI A;  1SRU A;  2ZJR A;  4BA2 I;  3E9H A;  2NVT H;  4K0K L;  1K0R A;  2IY5 B;  2YTY A;  3TS0 A;  1OXU A;  2OWO A;  3GDE A;  2A8V A;  1OXS C;  2YTV A;  4JI7 Q;  3ZJY C;  3PUX A;  4PZ8 A;  2A1A A;  2PNH A;  2WAQ E;  4OON A;  5AJ3 L;  4A3B H;  1PH1 A;  3M7N A;  3CC2 A;  2VZA A;  4JI0 Q;  2ASB A;  3MEF A;  1HR0 L;  4BY1 H;  4IFD I;  4P72 A;  3A5Z B;  1VQ9 A;  3F1Z A;  1EIF A;  4DR7 L;  4GOP C;  4NB3 A;  2JA8 H;  2K52 A;  2JA6 G;  2VW9 A;  2F52 A;  2GVB A;  3AFP A;  4YCW A;  3ULP A;  2Q2I A;  4ALP A;  1N36 L;  4YHH L;  3JAM i;  4C3I H;  2R92 H;  5IP9 H;  2D0O A;  4A76 A;  1OXT A;  2AWN A;  4P71 A;  5FLM H;  1YIT A;  1B70 B;  1PH8 A;  4BBS H;  3JC6 6;  4A3M H;  4A3B G;  4JYA Q;  3L2P A;  2UUA Q;  1KRS A;  4BY1 G;  3CCS A;  4OWX B;  2LXJ A;  3J81 i;  2PMZ E;  2JA8 G;  2RCN A;  1QVF A;  2KHJ A;  4X6A H;  1WOC A;  1PH7 A;  4HIM A;  2ZM6 L;  4LF6 L;  4NXN Q;  4R4Q A;  2GVA A;  2ID0 A;  4MTN A;  1T9H A;  2RHS B;  4R4C A;  4GNX B;  4JI2 L;  3I4N H;  3PO2 H;  4WJ3 M;  1MJE A;  2RHQ B;  4LFC L;  2EXD A;  3CCE A;  1NMF A;  1YEZ A;  3CQZ H;  1JMC A;  5FLM G;  5LMU L;  4BBS G;  1WYD A;  4QGU A;  1Q7Y C;  2VL6 A;  2BA0 A;  1WI5 A;  2F3I A;  3D31 A;  4DUZ Q;  1K8A C;  4NXM L;  3M4O H;  1A8V A;  2NZH A;  1PFS A;  2Y0S E;  4EQ5 A;  3CCJ A;  5C44 H;  1E24 A;  3PGZ A;  4DUY L;  1TXY A;  4GNX C;  4BY7 H;  3L0O A;  1VQP A;  4Y7N H;  2E2I H;  2MNA A;  1J5E Q;  1YHA A;  1I6H H;  4JV5 L;  2N3S A;  3KF6 B;  1CKM A;  3CXC A;  3S1M H;  4JCV E;  2JE6 I;  2IX1 A;  3EN2 A;  4A3C H;  3B6Y A;  3J80 i;  1GO3 E;  1ASZ A;  3KDF A;  4WJ4 A;  2OQK A;  5IE8 A;  3I4N G;  2VUM H;  3CF5 A;  4O0A A;  3PO2 G;  4Y52 H;  1TWF H;  3I56 A;  4A3E H;  1M90 C;  5E7N A;  3RZO H;  3CPF A;  3G48 A;  4C3H H;  3PO3 H;  4X62 Q;  2ES2 A;  2Q2H A;  3CC4 A;  2BH2 A;  1GVP A;  2JEB I;  1JT8 A;  2CWA A;  1YI2 A;  2AWO A;  4DR2 L;  1VQC A;  1YHQ A;  4BY7 G;  1U5K A;  5C44 G;  1IZ6 A;  4JBJ A;  3K8A A;  4YWL A;  5C0X G;  4OXP A;  1H95 A;  1KRT A;  4X65 Q;  2K5V A;  3RLF A;  4A4I A;  5FLX c;  1AE2 A;  1HZ9 A;  1X55 A;  1QZH A;  2YV5 A;  1G29 1;  1SFO H;  3PUW A;  2ZTD A;  2VQE L;  1HZB A;  4IO9 A;  3RN5 A;  1XPR A;  2VUM G;  4B3R L;  4A3E G;  4UPA A;  1N33 Q;  1IXR A;  1IBL L;  5M3M H;  4J15 A;  5IYB H;  4DV5 Q;  3FHW A;  2MFI A;  3PO3 G;  1N9W A;  3I7F A;  3KF8 B;  1VQJ A;  2MO0 A;  5JEA G;  5BR8 L;  4JI4 L;  1UE5 A;  1VQF A;  1Y14 B;  4UP7 A;  1VQG A;  1L0W A;  1Y1W H;  3PV0 A;  5C4X G;  4LW1 A;  4LNQ A;  1G51 A;  2H5X A;  2LSS A;  2K50 A;  4DR6 Q;  1L1O B;  1IBK L;  2N78 A;  1E1T A;  2R93 H;  3HOU H;  1AH9 A;  3J7Z C;  1V43 A;  1YJW A;  3F2D A;  2K75 A;  2MO1 A;  1VQ4 A;  4HJ8 A;  4DV0 Q;  1L1O C;  1XMQ L;  5IYD H;  3J7A 5;  2HIV A;  4GS3 A;  5AJ3 Q;  2E8G A;  4HIO A;  1VQA A;  5M3M G;  5IYB G;  1K8G A;  1LYL A;  2V1C C;  4LF7 Q;  1CKN B;  3AFQ A;  3M3Y H;  1C9O A;  4A3G H;  2WFW A;  2Z6K A;  1Y1W G;  1KC8 C;  1QVG A;  4DPG A;  4JI8 Q;  2D0P A;  2PQA B;  2R93 G;  1EIY B;  3HOU G;  1V9P A;  1YNX A;  4NPS A;  3K0X A;  3PF4 A;  3CP0 A;  3M85 A;  4YHH Q;  2Y0S G;  1HNW Q;  4YY3 L;  3H15 A;  1KD1 C;  2JJQ A;  3F2C A;  3T1H L;  1YVC A;  4P75 A;  1S40 A;  4IFD J;  3DLL A;  2IHE A;  3NEL A;  4X66 L;  4BBR H;  1SR3 A;  2YYZ A;  1YIJ A;  4LF8 L;  1VQI A;  4RG1 A;  5H1S E;  3CME A;  1W3S A;  3CCR A;  3FP9 A;  3S1Q H;  1N32 Q;  3GTJ H;  3ULL A;  4DR5 Q;  1IL2 A;  4A3G G;  1I5F A;  1XNQ Q;  4DR1 L;  4DR4 Q;  1P8L A;  4PMW A;  1VQB A;  1FVI A;  1A0I A;  1LM0 A;  2NN6 I;  4TQU S;  1QZG A;  1OTC A;  1EFW A;  4LF6 Q;  1NE3 A;  2JEA I;  3CPW A;  1K73 C;  2ZJQ A;  1J6Q A;  4X64 L;  1Q1B A;  2K4K A;  1YBY A;  3RZD H;  1HR0 W;  3GTQ H;  1VQH A;  4LF4 L;  3U4V A;  2E5L Q;  3MXN B;  4DNI A;  3IRB A;  5LMU Q;  4GKJ L;  4KHP L;  1TWC H;  2ZTE A;  4BBR G;  4C3J H;  1IBM L;  4JI4 Q;  2F4V L;  4JC0 A;  1SMX A;  4JI5 L;  3HOW H;  5J3B A;  5GAE C;  2C35 B;  2JK8 A;  1UWV A;  3M4P A;  2CFM A;  3H3V I;  4GKK L;  3EBE A;  1C0A A;  4DV2 L;  3RN2 A;  3PIO A;  4AQY L;  1DGS A;  3PIP A;  4LFA L;  4B3M L;  2KEN A;  1VQM A;  2IHF A;  4XTC S;  2UU9 L;  5M3F H;  5JJI A;  3HOZ G;  4AYB E;  4IFD G;  4A3J H;  4DAY B;  1VQK A;  1WJJ A;  1TWH H;  4YWK A;  3PUY A;  1N8R C;  4B3T Q;  3U50 C;  1JJG A;  1Q81 C;  4JOI A;  4JI6 L;  4KHZ A;  2WP8 J;  3H0G H;  4DR3 Q;  5M5W H;  1PH2 A;  1CKO A;  3HOW G;  3SGI A;  4OX9 L;  3VDY A;  4L5T A;  4DV7 L;  1UE7 A;  3F2B A;  1PHJ A;  2HIX A;  1SN8 A;  1AE3 A;  1GKH A;  4DV6 Q;  3KOJ A;  3OTO L;  3GTL H;  3PF5 A;  3KJO A;  4R4O A;  3K7A H;  5M3F G;  4H02 A;  4DV4 Q;  3JAM c;  2UUB L;  3K81 C;  5JJK A;  4JI3 L;  4B3R Q;  1FL0 A;  1XPU A;  3TQY A;  4A3J G;  1SRO A;  1N34 L;  5IYC H;  3FKI H;  1EQQ A;  2UXB L;  3A5U A;  3NEN A;  1E1O A;  2VY3 A;  4LFB Q;  1B8A A;  3H0G G;  2NVX H;  3GTP H;  3CCQ A;  2VQF L;  1OXX K;  4DK6 C;  4B3S L;  3J81 c;  1I94 Q;  3STB D;  1FJG L;  4A3D G;  4JI1 Q;  1E7Z A;  1P16 A;  1D8L A;  3GTM H;  4A3L H;  2XTI A;  1XMO L;  3HOV H;  2OQ0 A;  5LMN L;  2JA5 G;  3CAM A;  3AQQ A;  4TVA B;  1HZC A;  2R6G A;  3S17 H;  4R1J A;  3GO5 A;  4BXX H;  2OTJ A;  4L5R C;  2GN5 A;  3FKI G;  5IYC G;  3RNU A;  1Z47 A;  3E0E A;  3UDF A;  5IP7 H;  2JQO A;  4JI7 L;  4OWT B;  3S16 H;  1EYG A;  3S14 H;  4IPD A;  5C4X H;  2HHH Q;  4IOA A;  1SE8 A;  3KYH C;  3J80 c;  4JI0 L;  1MKH A;  4DV1 Q;  2WAQ G;  4LF5 Q;  3ERS X;  2CWP A;  4A3L G;  3HOV G;  4AH6 A;  1S72 A;  4POG A;  5IWA Q;  3LGJ A;  1UEB A;  4LF9 Q;  4JBW A;  1M1K C;  4BXX G;  2WB1 E;  1XNR Q;  3U58 A;  1HJP A;  4PG3 A;  3BZC A;  2UUC Q;  5IP7 G;  1V1Q A;  1HNX Q;  1KAW A;  3ER0 A;  1MJC A;  3RLN A;  3UE0 A;  1NMG A;  4AYB G;  4A3K H;  1ASY A;  2I5L X;  5HY6 A;  1JB7 A;  1VQ5 A;  4JYA L;  1NTG A;  1EWI A;  1CUK A;  2R7D A;  3HOX H;  4GOP A;  1R9T H;  4K0K Q;  2UUA L;  5FJ8 H;  4EX5 A;  2UXC L;  3ICE A;  1EOV A;  1Q12 A;  3G71 A;  4GLA C;  2D62 A;  2K14 A;  5EAY A;  3PSI A;  1IBM Q;  2F4V Q;  4C2M H;  4OO1 I;  1UE6 A;  3CCV A;  4GKK Q;  1K3R A;  1HR0 Q;  4KLK A;  1EQR A;  4DV2 Q;  4LFA Q;  4A3K G;  4DR7 Q;  1X3E A;  1SLJ A;  1Y1V H;  4KI0 A;  1PH6 A;  4OWW B;  3I55 A;  1PYB A;  2PI2 E;  3ULJ A;  1Q1E A;  3HOX G;  1W2B A;  4UP9 A;  3PUV A;  1VQ8 A;  5FJ8 G;  4XIG S;  4LUV A;  1N36 Q;  1J5E L;  1X9N A;  1Q8K A;  2I5M X;  5DLQ E;  5C4J H;  4YWM A;  2R92 G;  1NY4 A;  4AIM A;  3K7U C;  4DV3 L;  1K83 H;  5GAH C;  1JJC B;  2OTL A;  4UY8 C;  3U4Z A;  4LWC A;  4JBM A;  3UDG A;  4GN5 A;  4APV A;  1VQD A;  4QJF A;  3CCU A;  2B63 G;  3E9I A;  1HZA A;  2R7F A;  3PUZ A;  1JJ2 A;  3S1N H;  3RR5 A;  4X62 L;  3STB C;  2DGY A;  4GNX A;  1XPO A;  1VQL A;  2K5N A;  3I4O A;  3KDF B;  2LXK A;  3OTO Q;  1Y1V G;  1X56 A;  5GRO A;  2ZM6 Q;  4HJA A;  2R7Z H;  1X3G A;  3HOZ H;  4JI2 Q;  2ZJP A;  4JI3 Q;  3H3V H;  2E2J H;  4JBK A;  4LFC Q;  5ELO A;  3AEV A;  2UXB Q;  4X65 L;  2IX0 A;  4L5Q A;  3HFZ B;  2NN6 G;  3HOY H;  2IT1 A;  1GD7 A;  3KF6 A;  4NXM Q;  1Z9F A;  3CCL A;  4DUY Q;  5GAD C;  2VQF Q;  1YZ6 A;  2JA9 A;  1TWG H;  2UXD L;  1TWA H;  4IPG A;  1PH3 A;  1KQS A;  1G6P A;  4JV5 Q;  4A3I G;  2WB1 G;  2K5H A;  1LTL A;  1KIX A;  2ATW A;  2R7Z G;  1PH9 A;  1QVC A;  1XTD A;  4LUZ A;  1PYS B;  2CKZ B;  3WWV A;  1GM5 A;  3HKZ E;  4DR6 L;  2N8N A;  3S15 H;  1PVO A;  4DK3 C;  4POF A;  3J81 j;  1BBW A;  5C3E H;  3HOY G;  4GLV B;  4DR2 Q;  4DV0 L;  4IOC A;  4GOP B;  2N49 A;  5GQO A;  4A3F H;  3UE1 A;  4A3D H;  2I5H A;  4P74 A;  2HQL A;  2BH8 A;  1YJ9 A;  4LF7 L;  1VQ6 A;  1X54 A;  1E22 A;  2FXQ A;  1MIU A;  1VCI A;  1NJI C;  1U0L A;  2JA5 H;  5ELN A;  1RIP A;  4JI8 L;  2VQE Q;  3AYH B;  1A62 A;  4DKA C;  1PA6 A;  1WCM H;  5M5Y H;  3T1Y L;  1IBL Q;  2CCZ A;  1I3Q H;  1L1O A;  1BBU A;  3F8T A;  3M4Q A;  5C3E G;  5BR8 Q;  3PCO B;  5C0X J;  1HNW L;  2KHI A;  2MQH A;  2NVQ H;  4BA1 I;  5LMN W;  2QGQ A;  3BJU A;  3S2D H;  1IBK Q;  2DUD A;  4A3F G;  4GN4 B;  3HKS A;  2Q2T A;  2Z6K C;  1KXL A;  2XGT A;  2L15 A;  2E2H H;  1N32 L;  4DR5 L;  2UXC Q;  2VNU D;  5JEA J;  1XNQ L;  4DR4 L;  3W1G A;  1CKN A;  1XMQ Q;  2NVY H;  1HNZ L;  3OW2 A;  3Q8D A;  1S3O A;  1WCM G;  4DAM A;  4QIW E;  5IT9 c;  1IYJ B;  1X65 A;  3G6E A;  3CC7 A;  1VQN A;  2PQA A;  3NBH B;  3S1R H;  3KFU A;  4HID A;  5IP9 G;  2E5L L;  1QUQ A;  2EQS A;  1PH4 A;  3S2H H;  4A3M G;  1D7Q A;  1BVS A;  1I50 H;  4PZ6 A;  2AKW B;  3NEM A;  1YJN A;  2RF4 A;  2KCT A;  4YY3 Q;  1E3P A;  3EIV A;  3T1H Q;  4HJ9 A;  2A19 A;  4DV3 Q;  3CMA A;  2YU9 H;  4X66 Q;  3OYY A;  4RMF A;  2HT1 A;  3KLW A;  4IJL A;  2JA7 H;  4LUO A;  4LF8 Q;  3KJP A;  1CSP A;  4B3T L;  4QL5 A;  3L7Z C;  5C0X I;  3CW2 C;  3HKZ G;  4DR1 Q;  1PV4 A;  3TRE A;  2EIF A;  3W1B A;  4HJ7 A;  4GLX A;  4R4T A;  2YTX A;  4A75 A;  4DR3 L;  1FGU A;  4UP8 A;  2KBN A;  4PZ7 A;  4YCV A;  1VQO A;  2AMC B;  1B7Y B;  4X64 Q;  1C7Y A;  4LF4 Q;  4KHP Q;  2NZO A;  3BZK A;  1LUZ A;  4DV6 L;  4A3C G;  4GKJ Q;  4NXN L;  1JE5 A;  3BU2 A;  4MNO A;  4DV4 L;  2JA7 G;  4JI5 Q;  4JOI C;  2UXD Q;  3GTO H;  1WFQ A;  2B63 H;  3A0J A;  4IPC A;  4IJH A;  4AQY Q;  3S24 A;  4FDB A;  4B3M Q;  3CD6 A;  4LFB L;  4DUZ L;  2UU9 Q;  4A93 H;  5K36 G;  3UDI A;  5IY0 A;  4OO1 G;  4GN3 B;  1X3F A;  1I94 L;  3A74 A;  2ZTC A;  4JI1 L;  1Q86 C;  1X6O A;  1L2F A;  4YCU A;  4JI6 Q;  1KL9 A;  1YHB A;  4MZ9 A;  3I4M H;  4OX9 Q;  2PI2 A; 
#chains in the Genus database with same CATH topology
 5IT9 E;  4CKB A;  1VS0 A;  1QWY A;  2B2W A;  1FYC A;  4N8F A;  4DV7 Q;  1PRT D;  2Z0S A;  1XJV A;  1JE4 A;  4IUT A;  4A93 G;  1AN8 A;  1EY8 A;  3UDX A;  3RLO A;  2HHH L;  4OGQ C;  3FVQ A;  4X3K A;  2KCM A;  3D0F A;  3GTG H;  4DV1 L;  1EUJ A;  4PMB A;  2QA4 A;  2B63 B;  5J39 A;  1CSQ A;  5IWA L;  5IYD G;  4K6D A;  2PCF B;  4LF9 L;  1K9M C;  3I4M G;  4QY7 A;  1XNR L;  5I2Y A;  1PH5 A;  2B3G A;  2PZU A;  1NBW A;  1ESR A;  4IUN A;  1OXV A;  1UE1 A;  3BDO A;  2JA6 H;  4E6I A;  3MZ5 A;  5I9O A;  3VR5 A;  4LAA A;  2YTY A;  3TS0 A;  2OWO A;  3GDE A;  3NXW A;  5M9O A;  3QR8 A;  4A3I B;  4RHS A;  2A1A A;  2PNH A;  2WB1 B;  1LT6 D;  3KBX A;  1PH1 A;  1EU3 A;  5F2D A;  3T16 A;  2RSN A;  2X69 A;  5EPL A;  1TS2 A;  1KNE A;  4MIU A;  2JA8 H;  1A15 A;  5JAV A;  1IHZ A;  2F1M A;  2F52 A;  2GVB A;  3ULP A;  2Q2I A;  4ALP A;  2AUK A;  1SE2 A;  3VYS A;  3C46 A;  2R92 H;  5IP9 H;  1I6V C;  1YIT A;  1OXT A;  2AWN A;  4P71 A;  4R9W A;  2EYP A;  2PW5 A;  1HQM C;  1G2S A;  1PRT F;  1CZW A;  3IFD A;  1IL8 A;  2UUA Q;  3CCS A;  2A6E C;  3HRZ C;  2MHV A;  3H94 A;  4X6A H;  4FF3 A;  1PH7 A;  4NXN Q;  2ZM6 L;  3NHH A;  3BS1 A;  3OSO A;  1D5M C;  3BYT B;  5C5M A;  1E2Z A;  1MJE A;  1YEZ A;  4BBS G;  1K8A C;  3D6W A;  4EQ5 A;  4BY7 H;  3H91 A;  1JC7 A;  2RVL A;  2KCN A;  2WKC A;  1J5E Q;  1YHA A;  2E2I H;  5M5Y B;  1JWM D;  2N3S A;  1CKM A;  1I3Q B;  1EQT A;  3TP8 A;  2HCI A;  2CQA A;  1SJE D;  3CF5 A;  4Y52 H;  3I56 A;  4M8A A;  3RZO H;  5E7N A;  1D2B A;  3CPF A;  2JEB I;  2E2H B;  4DR2 L;  5CBA E;  1U5K A;  1S5F D;  5ELE A;  5CV7 A;  5C0X G;  4OXP A;  1KAA A;  4X65 Q;  1X55 A;  1SBB B;  1G29 1;  5CBE E;  2ZTD A;  3HKZ B;  4A3E G;  2EJF C;  3S2H B;  1IXR A;  3C1F A;  4C3H G;  1N9W A;  2MO0 A;  5JEA G;  1DON A;  1VQF A;  1L0W A;  3D4D A;  4HSP A;  3KLR A;  2K50 A;  4DR6 Q;  3A55 A;  1H9M A;  2Q8R E;  3J7Z C;  1V43 A;  1YJW A;  3F2D A;  2K75 A;  4ZQ3 A;  1ILQ A;  2MO1 A;  5IYD H;  4GS3 A;  5M3M G;  1LYL A;  2V1C C;  1ENF A;  4LF7 Q;  4JW0 A;  1C9O A;  4A3G H;  5I6W A;  4HMI A;  1Y1W G;  4ABN A;  1XTC D;  2KJX A;  3DHQ A;  1EIY B;  3HOU G;  2K28 A;  2RBM A;  2EYL A;  2WKD A;  4YHH Q;  1IYU A;  2B2U A;  3H15 A;  2JJQ A;  1KD1 C;  1XWE A;  1S40 A;  2E75 C;  4QIW B;  2FMC A;  4LF8 L;  1VQI A;  1O78 A;  3QJY A;  3CCR A;  1W3S A;  1N32 Q;  3ULL A;  1IL2 A;  1PDQ A;  2EPB A;  1XNQ Q;  2M9V A;  3FPP A;  3DEO A;  2NN6 I;  1YNJ C;  5KND A;  4IFD H;  3GTQ H;  2EYO A;  4BBR G;  2K1B A;  4RCN A;  2K32 A;  4JI4 Q;  4JC0 A;  4JI5 L;  1EL0 A;  5J3B A;  2C35 B;  2JK8 A;  5EBC A;  2CFM A;  2ZXO A;  3EBE A;  4DV2 L;  3RN2 A;  4JVZ A;  1EIG A;  4K5V A;  5JJI A;  1N8R C;  1QIL A;  3PUY A;  1JJG A;  3GV6 A;  4JI6 L;  1A3V A;  1UAP A;  5M5W H;  3VDY A;  4DV7 L;  1A2T A;  1AE3 A;  3OTO L;  3PF5 A;  1HA5 A;  4IZ8 A;  3TDQ A;  4FO2 A;  1KLU D;  3H0G G;  2B2W C;  2NVX H;  3GTP H;  2VQF L;  2IWH A;  1I94 Q;  2A68 D;  1O7L A;  3OOC A;  3VA7 A;  4IUR A;  2R3Z A;  4A3L H;  1M4V A;  4O42 A;  4C3I B;  1PZI D;  3MFG A;  4R1J A;  3GO5 A;  2GN5 A;  3FKI G;  3RNU A;  3E0E A;  3MTS A;  3QIA A;  4OWT B;  2Z4I A;  1RDP D;  4IPD A;  1F2Z A;  4IOA A;  1GUW A;  3KYH C;  4K5W A;  3FEW X;  2KUM A;  1Y8O B;  1I4H A;  1GXD C;  3I4N B;  4C1N K;  2CWP A;  3D8G A;  1RD9 D;  2RDF A;  3LGJ A;  4M1U B;  2HQE A;  1MSH A;  5IP7 G;  1WVL A;  3ER0 A;  3RLN A;  3KLS X;  1NMG A;  2PZW A;  4A3K H;  2I5L X;  1NR4 A;  1VQ5 A;  1H9J A;  1I4R A;  3HOX H;  4K0K Q;  2UUA L;  4IUQ A;  5C4H A;  2L5T A;  1Q12 A;  3PO3 B;  4WRD A;  2Q8T A;  3P20 A;  3JAM E;  2EY2 A;  5EAY A;  3PSI A;  1SNQ A;  2L1B A;  3S14 B;  3I4L A;  1RCV D;  3TP6 A;  1EQR A;  3QG1 A;  1X3E A;  1PH6 A;  3I55 A;  2PI2 E;  2J4X A;  1SFO B;  1Q1E A;  1W2B A;  4UP9 A;  1VQ8 A;  2K6A A;  5FO7 B;  5FJ8 G;  1N36 Q;  1J5E L;  1Q8K A;  2PMZ B;  5C4J H;  4MN3 A;  2K5W A;  1F9S A;  3DUZ A;  4AIM A;  2F0L A;  5ELF A;  4OHJ A;  4UY8 C;  1LTR D;  4GN5 A;  4QJF A;  1JJ2 A;  1EYC A;  4X3T A;  4IFD J;  1B2T A;  3AMU A;  4WOR A;  1Y1V G;  1X3G A;  2AUJ D;  3DM1 A;  2EJG C;  1PFB A;  3AEV A;  1MGS A;  4X65 L;  2IT1 A;  3KF6 A;  4NXM Q;  1Z9F A;  1DXM A;  5D65 A;  5FO8 B;  3CRK C;  5GAD C;  2JA9 A;  2UXD L;  5JJZ A;  2DN8 A;  5CC4 A;  1JOK A;  4HSV A;  1WD0 A;  2F0G A;  3K5N A;  1XTD A;  4DR6 L;  3WWV A;  1GM5 A;  3Q6S A;  1DOK A;  4DAP A;  3I70 A;  4POF A;  5ELC A;  3S1N B;  1TVX A;  2TSS A;  4GOP B;  2N49 A;  1X3P A;  4A3F H;  5LL6 X;  1ZKO A;  4CDD C;  2I5H A;  1YJ9 A;  4LF7 L;  1VQ6 A;  1E22 A;  2FXQ A;  3KF8 A;  1U0L A;  1TWC B;  3DWP A;  5M5Y H;  4NW2 A;  1TY2 A;  4IUV A;  1IBL Q;  1I3Q H;  1L1O A;  5C3E G;  5C0X J;  3LWU A;  3OMG A;  2MQH A;  4BA1 I;  1M8A A;  4GN4 B;  1KXL A;  2Q2T A;  1LTI D;  2L15 A;  2E2H H;  1N32 L;  3KLS A;  5COR A;  4DNT B;  2VNU D;  5JEA J;  1TWH B;  1XNQ L;  1HA6 A;  2LMC B;  1NR2 A;  3VR6 A;  1HNZ L;  3OW2 A;  1SNP A;  3I73 A;  4Q0F A;  4O1N A;  2G9D A;  2GA4 B;  4A3D B;  3E0J A;  3SK6 A;  4A3M G;  3S2H H;  3IL8 A;  4PZ6 A;  1L0Y B;  2AKW B;  1YJN A;  1WCM B;  2F0K A;  4YY3 Q;  1E3P A;  3BZD B;  3EIV A;  5EKK A;  2A19 A;  1T5E A;  2OXP A;  3MXG A;  4IJL A;  1U4R A;  2F03 A;  3CW2 C;  4FXK C;  2SEB D;  1PV4 A;  3TRE A;  1R4P B;  2EIF A;  3W1B A;  2DNC A;  2YTX A;  3HOV B;  4R8I A;  1HTP A;  1FGU A;  4NKL A;  1VQO A;  4OO1 H;  2AMC B;  4K6L A;  3S17 B;  4LF4 Q;  4KHP Q;  2NZO A;  3OPO A;  1LUZ A;  4GKJ Q;  1HHV A;  3T13 A;  1JE5 A;  3QO2 A;  4AYB B;  3S16 B;  4N9T A;  1GOZ A;  3GTO H;  1WFQ A;  4S3S A;  4FF2 A;  4IJH A;  1BQQ T;  2L55 A;  3T51 B;  3HEJ A;  3UDI A;  5IY0 A;  4GN3 B;  2F0V A;  1I94 L;  1Q3L A;  2ZTC A;  4TSS A;  2H4O A;  4YCU A;  3BDC A;  3RMH A;  1U4L A;  1VF7 A;  3SVM A;  1KL9 A;  3KBG A;  3E6Z X;  3VA5 A;  1B53 A;  2ALY B;  1BCP D;  2WIN B;  1MI2 A;  2EVB A;  4RAU C;  3MXP A;  3AU7 A;  1EY7 A;  1RL2 A;  3T1Y Q;  5JJL A;  5KIX A;  1GHJ A;  1SSO A;  2Q2U A;  5HGQ A;  2IL8 A;  4HIK A;  3CCM A;  2B29 A;  2BA1 A;  5IGD A;  4H44 C;  1N33 L;  4A93 B;  1O7I A;  1FJG Q;  2QEX A;  4DV5 L;  3K80 C;  4QMG A;  1RKN A;  2DY7 A;  5E4W C;  3TS2 A;  2AHO B;  3GD7 A;  3NQI A;  1KHI A;  1SRU A;  4BA2 I;  1SYG A;  4K0K L;  2IY5 B;  2R61 A;  3I4M B;  4RKB A;  3GQB A;  4ZUJ A;  5FLX E;  4JI7 Q;  2F0E A;  2L0C A;  5M5X B;  2WAQ E;  1DD2 A;  5AJ3 L;  2HDL A;  1GUG A;  5EGT A;  4JI0 Q;  2ASB A;  4BY1 H;  1VQ9 A;  1EIF A;  2K52 A;  4DA2 A;  1KNA A;  2JA6 G;  3AFP A;  3PMF A;  1O7Y A;  4YCW A;  1WTV A;  2KHS A;  1N36 L;  1VMC A;  5K5P A;  1TWA B;  4C3I H;  1II3 A;  2D0O A;  3JC6 6;  4A3M H;  1BCP F;  3L2P A;  3QWN A;  3NQT A;  2Z9H A;  2LXJ A;  5I2X A;  3J81 i;  2JA8 G;  2F0N A;  3TBI B;  4DXG A;  4L63 B;  4MTN A;  2RHS B;  3I4N H;  1KTK A;  2P5Z X;  2RHQ B;  2R92 G;  1PFN A;  5LMU L;  5JOB A;  3EVQ A;  1WI5 A;  3D31 A;  4NXM L;  4XDX A;  3Q0A A;  1CHQ D;  1A8V A;  3C1E A;  3CCJ A;  2B8G A;  3PGZ A;  2DJG C;  4PQX A;  3TME A;  3OWE B;  3TSS A;  3KF6 B;  3OMC A;  2IX1 A;  1E0B A;  2OQK A;  2VUM H;  4O0A A;  1M90 C;  3G48 A;  3PO3 H;  1KLG D;  1KDC A;  2Q2H A;  1AZP A;  2CWA A;  1VQC A;  4BY7 G;  5G3L D;  1B1Z A;  4YWL A;  1KRT A;  2PPB C;  4A4I A;  5FLX c;  4KMU C;  1AE2 A;  1HZ9 A;  1SE4 A;  3CQZ B;  1QZH A;  1SFO H;  3PUW A;  4IO9 A;  1HZB A;  4B3R L;  1IBL L;  4J15 A;  1TS3 A;  3KF8 B;  4QCL A;  1UE5 A;  1CQF A;  1Y14 B;  1VQG A;  3V05 A;  5C4X G;  3K5L A;  1G51 A;  2H5X A;  2LSS A;  3DEP A;  1L1O B;  1Q8I A;  1E2V A;  2YU9 B;  2A6E D;  2R93 H;  2JA7 B;  5KGU A;  2CH4 A;  4V0B A;  4MHE A;  5DM7 3;  5I9P A;  4C3H B;  1VQ4 A;  1L1O C;  4HIO A;  1JR0 D;  1V1P B;  5EJW A;  1K8G A;  1FNV A;  5C6A A;  2F0T A;  3H6M A;  4HMJ A;  3M3Y H;  1DM0 B;  2Z6K A;  4DGZ A;  4IN3 A;  1QVG A;  2D0P A;  1V9P A;  1YNX A;  4KY7 A;  2Y0S G;  1HNW Q;  4YY3 L;  5M3M B;  1PMR A;  4RFB A;  1YVC A;  5IIF A;  3K5M A;  1FNW A;  1JQY D;  3NEL A;  2K33 A;  5T1G A;  4K14 A;  2KOL A;  1SR3 A;  2YYZ A;  2PZT A;  2SOB A;  5EKL A;  3X3M A;  4FVM A;  1H9K A;  3HOU B;  4A3G G;  1I5F A;  1HQR D;  4DR4 Q;  1S5D D;  2L4N A;  3J81 L;  1P8L A;  1VQB A;  1FVI A;  4TQU S;  1QZG A;  4LF6 Q;  3CPW A;  3QOL A;  1XYI A;  2ZJQ A;  2NBF A;  3RD4 A;  1JIC A;  4B9X A;  1NAP A;  1YBY A;  2PQE A;  4LF4 L;  4KHP L;  3U4V A;  5C3X A;  2E5L Q;  3IRB A;  4GKJ L;  1TWC H;  4CJ1 B;  2PNR C;  4JPB W;  1IBM L;  2K7V A;  4EQN A;  3KK7 A;  2LS0 1;  3NP8 A;  4GKK L;  5BN3 A;  4R8N A;  2IPK D;  2KEN A;  2V4D A;  1BOS A;  3VR3 A;  4IFD G;  4A3J H;  1TWH H;  4RGM A;  1Q81 C;  4JOI A;  3S1Q B;  3GTJ B;  1DJR D;  2WP8 J;  3SE0 A;  4JK1 C;  2EZV A;  1UE7 A;  3FMC A;  4ZUI A;  5BN5 A;  3RZD B;  2D5D A;  1HUN A;  4DV4 Q;  3H09 A;  3K81 C;  2XWJ B;  4C3J B;  4A3B B;  1SRO A;  3BYY B;  5IYC H;  1EQQ A;  4PV1 C;  3T4A C;  1B8A A;  2JXM B;  5KYL A;  3J81 c;  2ZT9 C;  1AEX A;  1LAB A;  3STB D;  1FJG L;  1FR3 A;  1E7Z A;  2H1E A;  1D8L A;  3HOV H;  1YNJ D;  5NUC A;  3CAM A;  1SAP A;  2LKV A;  4TVA B;  2AQ2 B;  3S17 H;  2N88 A;  4BXX H;  1SNM A;  2XN9 C;  3UDF A;  4RWS C;  4KD3 A;  4JI7 L;  2F0S A;  3S16 H;  1HFN A;  2B2T A;  5C4X H;  2Z8L A;  1SE8 A;  5DAU A;  4ZYS A;  1BBX C;  2ENB A;  4IUP A;  2F0Q A;  1MKH A;  1H9R A;  2WAQ G;  4JI0 L;  3PO2 B;  2BDN A;  5D14 A;  4LF5 Q;  4A3L G;  1S72 A;  4XYO A;  4CKE A;  4POG A;  3FKI B;  3A56 A;  3SK4 A;  2F3V A;  1TT2 A;  4ZLT F;  3R2I A;  5E4X A;  3M4O B;  5C44 B;  3W3A A;  1KAW A;  4KK7 A;  3UE0 A;  3CRL C;  4K5X A;  3GTM B;  4FP5 D;  2CVR A;  1ICF B;  4GOP A;  2R7D A;  3C3L A;  3RUZ A;  1BNZ A;  1PZK D;  1A3U A;  5J1Z A;  1BUV T;  3GV3 A;  2F4V Q;  3P7J A;  1CFM A;  1KDB A;  1UE6 A;  5CGK A;  3IKJ A;  4LFA Q;  4A3K G;  2CHB D;  5KEE A;  2M00 A;  1QJO A;  3HOX G;  3URY A;  4F88 A;  2I5M X;  2NN6 H;  1NY4 A;  1QE6 A;  2QF7 A;  4DV3 L;  2Z1C A;  1GUS A;  1JJC B;  2RKS A;  2OTL A;  4JBM A;  2B63 G;  3CCU A;  1S5B D;  3RR5 A;  4GNX A;  3STB C;  2DGY A;  1XPO A;  4HR7 B;  3N6R A;  4DF7 A;  5CR3 A;  3EQL C;  4HJA A;  4F7X A;  3BDL A;  4JI2 Q;  2ZJP A;  4JI3 Q;  5ELO A;  1Z6H A;  2UXB Q;  3TN2 A;  2EYF A;  4L5Q A;  1R4Q B;  4ZCK A;  3CCL A;  4OEM B;  1GUO A;  4G7Z C;  1TWG H;  1LT4 D;  1TWA H;  1PH3 A;  2Z6B A;  1MD2 D;  4JV5 Q;  4A3I G;  1ET6 A;  3K5O A;  1I4X A;  1V1O A;  2WB1 G;  2K5H A;  1G2T A;  1KIX A;  2ATW A;  1B44 D;  4LUZ A;  4KV6 A;  5I6Y A;  3A8K E;  2N8N A;  4GZY C;  4ZRZ A;  3J81 j;  3VYR A;  3D3R A;  2IW3 A;  2X6G A;  3NPP A;  5GQO A;  2O4X A;  1BDO A;  2PW7 A;  4KY6 A;  3HOZ B;  2E2J B;  1MIU A;  1VCI A;  1G8Z D;  1NJI C;  1I6H B;  1MSG A;  3QB3 A;  2VQE Q;  1PA6 A;  2CCZ A;  3F8T A;  4KY5 A;  3I90 A;  1JOR A;  3HOW B;  1Z7T A;  3PCO B;  1HNW L;  2KHI A;  2KQ3 A;  1UUP A;  4G4K A;  1EZ8 A;  2O5J C;  5LMN W;  3PIO 3;  3PIP 3;  2DUD A;  4A3F G;  3HKS A;  5M3F B;  2Z6K C;  2XGT A;  3S15 B;  2UXC Q;  4DR4 L;  3W1G A;  5AFW A;  1XMQ Q;  5C3E B;  3P1H A;  3A8I E;  4RHR A;  3G6E A;  2PQA A;  3S1R H;  4HID A;  4ILW A;  2E5L L;  2EQS A;  1QG7 A;  4FXG C;  1BVS A;  1I50 H;  3K7A B;  2WAC A;  2JA5 B;  4ID6 A;  3I72 A;  1TII D;  3GP7 A;  1HFG A;  4UDU C;  2YU9 H;  4X66 Q;  1K8O A;  2MPM A;  4RMF A;  1JOQ A;  2HT1 A;  2JA7 H;  4LUO A;  2HCC A;  3K57 A;  1CSP A;  3L7Z C;  5C0X I;  3HKZ G;  4DR1 Q;  4A75 A;  4HED A;  2NVY B;  2KBN A;  4PZ7 A;  4X64 Q;  4H0L C;  2NZ1 D;  1PLF A;  3I8Z A;  4A3C G;  4NXN L;  4MNO A;  4DV4 L;  3LNN A;  3OHX C;  4KD4 A;  1HPC A;  4JOI C;  2B63 H;  4IPC A;  1UEA B;  4K8J A;  2PYK A;  4B3M Q;  3HZX A;  2UU9 Q;  4OO1 G;  1DOL A;  1X3F A;  3A74 A;  2A69 C;  4C56 C;  5C5L A;  1X6O A;  2HD3 A;  4DFA A;  2NYZ D;  1U4M A;  2F0D A;  5CV9 A;  2I0Q A;  3DM3 A;  4H13 C;  4A3I H;  1R9T B;  1Q82 C;  4LJZ C;  2UUB Q;  4O2D A;  3KUP A;  3I2Z A;  1N34 Q;  3TRZ A;  1BXT A;  4C2M B;  4LF5 L;  1BKB A;  2OCE A;  1HH2 P;  2XVS A;  3M4Y A;  2JSO A;  5GAG C;  4JG2 A;  3G4S A;  4P73 A;  3M9B A;  1LAC A;  2B39 A;  2B2T C;  5A2Q L;  3E5S A;  1XMO Q;  2VS1 A;  2CQO A;  1VQE A;  5LMN Q;  2K03 A;  3K0Y A;  4B9W A;  5E3F A;  2ZJR A;  3E9H A;  1K83 B;  1EYA A;  1K0R A;  3EJI A;  1ET9 A;  5KNC A;  1OXU A;  1WTP A;  2A8V A;  1OXS C;  2YTV A;  3ZJY C;  4ODG A;  1SEB D;  3SDZ A;  4PZ8 A;  4A3B H;  2XSC A;  2R7Z B;  4LMQ D;  1SYE A;  2VZA A;  3CC2 A;  1A2U A;  3MEF A;  4P72 A;  3A5Z B;  1JCK B;  4GOP C;  3HOY B;  1SYC A;  5I4D A;  3J80 L;  1QCB D;  1TS4 A;  3NTK A;  4NMZ A;  2I46 A;  4YHH L;  1KDA A;  5JPN C;  4U68 A;  4J1M A;  5IGE A;  4A76 A;  1PH8 A;  5FLM H;  1G91 A;  3Q22 A;  2G9H D;  2QDB A;  2JA6 B;  1QNU A;  4BY1 G;  1V1P A;  2RCN A;  1RF2 D;  1WOC A;  4HIM A;  2XNA C;  4R4Q A;  2EYM A;  4R4C A;  4GNX B;  4JI2 L;  3PO2 H;  4C3I G;  2EXD A;  1NMF A;  4RCO A;  1BR9 A;  1WYD A;  4QGU A;  1Q7Y C;  2BA0 A;  2I07 B;  4DUZ Q;  3M4O H;  2NZH A;  2Y0S E;  4GNX C;  4JI4 L;  5C44 H;  5COY A;  3L0O A;  2QKI C;  4JV5 L;  3CXC A;  2JE6 I;  1ENC A;  1JWS D;  3EN2 A;  1B9N A;  4A3C H;  2R92 B;  3DXJ C;  1GO3 E;  5IOC A;  3KDF A;  4I7Z C;  3I4N G;  3S2D B;  1FGB D;  2JYO A;  4HN7 A;  4QF4 A;  3CC4 A;  2BH2 A;  1Y8N B;  1GVP A;  3MEH A;  5CYU A;  3MAQ A;  1JT8 A;  1CT1 D;  4FF1 A;  3NTI A;  1RTN A;  3U9O A;  1IZ6 A;  2ICI A;  4JBJ A;  3BVM A;  2K05 A;  1H95 A;  1I4P A;  1ZYR D;  3RLF A;  2F3W A;  4KHV A;  4DK1 A;  1XPR A;  2VQE L;  2VUM G;  3RN5 A;  2RQX A;  4UPA A;  3SHL A;  5IYB H;  3PO3 G;  3FHW A;  2MFI A;  3I7F A;  3EA6 A;  2QEJ C;  2E2I B;  4UP7 A;  3PV0 A;  5A35 A;  2EYH A;  2LY7 A;  2C5C A;  1E1T A;  1VDZ A;  1O7Z A;  2CH4 W;  2KEC A;  1AH9 A;  2EE1 A;  3DWA A;  5IGB A;  1AP0 A;  4CHT B;  5EKI A;  1XMQ L;  4HJ8 A;  2ICE C;  2HIV A;  3NSW A;  4J6H A;  1IW7 D;  1BO0 A;  3WDN A;  2WFW A;  2M2L A;  4ZKC B;  4DPG A;  1C8C A;  1RTO A;  2PQA B;  2R93 G;  2XRS D;  3CP0 A;  2PO4 A;  2C9O A;  3M85 A;  4HTH A;  3I91 A;  4P75 A;  2IHE A;  4X66 L;  2SDF A;  3X3N A;  5H1S E;  2FIN B;  1D1K A;  3NBH A;  3T56 B;  4DR1 L;  2SNM A;  4K8I A;  1A0I A;  1EFW A;  2JEA I;  3HS0 C;  1K73 C;  1J6Q A;  5EBD A;  4X64 L;  1GJX A;  1HR0 W;  1VQH A;  4L6T B;  1NNX A;  1W6K A;  3C2P A;  5FO9 B;  3HOW H;  5GAE C;  3H3V I;  1S5C D;  4PNY A;  3PIO A;  1DGS A;  3M7G A;  3PIP A;  4B3M L;  4OIJ A;  4XTC S;  2EY1 A;  2UU9 L;  1TR5 A;  5HGT A;  1PTO B;  1ZYR C;  4QUC A;  5M3F H;  3GTK B;  2CW0 C;  3MFY A;  3ZYY X;  4B3T Q;  3NE5 B;  4YWK A;  3U50 C;  4KHZ A;  1PTO C;  4DR3 Q;  3EFX D;  1CKO A;  1STH A;  3SGI A;  1K0S A;  4L5T A;  1RHP A;  2HIX A;  1SN8 A;  2NVT B;  1GKH A;  2EXZ A;  2FJ2 A;  3K7A H;  4R4O A;  4H02 A;  2DNE A;  2UUB L;  2FMM A;  1FL0 A;  1XPU A;  4A3J G;  4RA8 A;  3CHB D;  1N34 L;  1WTW A;  2A6H C;  1E1O A;  2VY3 A;  1IW7 C;  4LFB Q;  2NUC A;  2O2L D;  3CCQ A;  1OXX K;  4NDX A;  5HUR A;  3ONA B;  4QB4 A;  4A3D G;  4JI1 Q;  3PQI A;  4DXF A;  2XTI A;  1XMO L;  2OQ0 A;  5LMN L;  1PFM A;  4BBS B;  1FNU A;  1XX8 A;  2A5H A;  4IUU A;  3TP7 A;  1HZC A;  2OTJ A;  4L5R C;  5IYC G;  4UAI A;  1YNN C;  1Z47 A;  1EYG A;  4FNF A;  3S14 H;  3D4R A;  2QDL A;  2NTT A;  3A8J E;  3ERS X;  3HOV G;  1SDF A;  5JPM C;  2HUG A;  4JBW A;  4XYQ A;  3MWY W;  1W6J A;  4BXX G;  2WB1 E;  2OT2 A;  3GTP B;  3U58 A;  4XQJ A;  1K28 A;  5CV5 A;  1HJP A;  3BZC A;  2UUC Q;  4Y7N B;  3P75 A;  4XT3 B;  1V1Q A;  4EVO A;  1HNX Q;  1MHW C;  4Q5V A;  4AYB G;  1MJC A;  5DNF A;  3S1M B;  1ASY A;  2WAQ B;  2MP1 A;  2MJ8 A;  5HY6 A;  1JB7 A;  2BE5 C;  5ELB A;  1SMY C;  1NTG A;  1EWI A;  1CUK A;  1WTR A;  1R9T H;  1TWF B;  4A3E B;  1EOV A;  3G71 A;  1EY0 A;  4GLA C;  2D62 A;  2WV6 D;  2K14 A;  1UNS A;  2ZXR A;  1HUM A;  1WD1 A;  4C2M H;  3CCV A;  1GHK A;  1HR0 Q;  1EWH A;  4DAV A;  4DV2 Q;  2E76 C;  4DR7 Q;  1SLJ A;  3A54 A;  1LTA D;  4KI0 A;  4OWW B;  1PYB A;  3J81 E;  1STG A;  3F2U A;  4LUV A;  4XIG S;  3TZD A;  1X9N A;  5IGC A;  5DLQ E;  2K5D A;  3K7U C;  3AB9 A;  1K83 H;  2E74 C;  1F2L A;  1Y1W B;  1Y8P B;  2N55 A;  3U4Z A;  4LWC A;  3UDG A;  4APV A;  1E2W A;  3E9I A;  1HZA A;  2R7F A;  3S1N H;  1VQL A;  3HOX B;  3KDF B;  3OTO Q;  1X56 A;  4BS9 A;  5G3L F;  2NTS A;  1F9P A;  2R7Z H;  3ND9 A;  4C1N I;  2VXW A;  4LFC Q;  2IX0 A;  1STY A;  2NN6 G;  3HOY H;  1GD7 A;  5IT9 L;  5EPJ A;  4DUY Q;  2VQF Q;  5EQ0 A;  1DCZ A;  4IPG A;  1KQS A;  1G6P A;  3VYU A;  2IJ0 A;  1B3Q A;  5C4J B;  1PH9 A;  1PYS B;  2CKZ B;  3HKZ E;  4BBR B;  1PVO A;  3ND8 A;  1J8I A;  1BBW A;  4GLV B;  5CMD A;  2KCC A;  3K58 A;  4I7A A;  2FHT A;  3UE1 A;  4A3D H;  2MUY A;  4CDF C;  1X54 A;  3TP5 A;  5C4Z A;  3J7Y W;  4CKC A;  1A62 A;  5DEH A;  5FOB B;  1WCM H;  3T1Y L;  3M4Q A;  5BR8 Q;  3WOE A;  2QGQ A;  3BJU A;  3S2D H;  1IBK Q;  4UHV A;  1X32 A;  1CKN A;  1VMP A;  3SK5 A;  4J8Q A;  1PRT B;  1S3O A;  4DAM A;  1G6Z A;  3H0G B;  4G57 A;  4QIW E;  5IT9 c;  1IYJ B;  1X65 A;  3CC7 A;  3NBH B;  4DNR B;  3KFU A;  4H7B A;  4A3F B;  4N9P A;  4EQP A;  1SND A;  4F8M A;  1PRT C;  3GTL B;  1D7Q A;  1LTB D;  1TQO A;  3NEM A;  1B50 A;  3CU7 A;  2RF4 A;  3ITP A;  3T1H Q;  4HJ9 A;  3CMA A;  2WII B;  5J22 A;  3QOJ A;  3KJP A;  2B2V A;  4B3T L;  4QL5 A;  4ZAI A;  1XXG A;  2F0F A;  4HJ7 A;  4GLX A;  2KED A;  3MXN A;  4DR3 L;  5K36 H;  1B7Y B;  1D6E C;  2EY6 A;  1C7Y A;  4KN7 C;  3U9S A;  3ERO A;  4G7O C;  1NCV A;  3BU2 A;  3HGB A;  2JA7 G;  3SEB A;  1C48 A;  2KA7 A;  2UXD Q;  3A0J A;  4AQY Q;  3S24 A;  4DAY A;  4LFB L;  4A93 H;  1QB5 D;  3MC0 B;  1NUC A;  1SNC A;  2NB0 A;  4JI1 L;  1Q86 C;  4ZKB B;  1F77 A;  1L2F A;  4KKS A;  4K2L A;  1YHB A;  4MZ9 A;  4XXE A;  2F0J A;  3I4M H;  1V8Q A;  4OX9 Q;  2PI2 A;  1ILP A;  4L5S A;  1A63 A;  1EWC A;  2ZXP A;  4CDE C;  4ME3 A;  5M5X H;  3BVG A;  1QOH A;  4QQB X;  4Z9C B;  1AFP A;  3A7L A;  5FKA C;  1LTS D;  1QUQ B;  1KAB A;  2EDG A;  4NP5 A;  3GTO B;  3GTK H;  3W5O A;  1PTO H;  4HJ5 A;  5ELD A;  1S4Z A;  4B3S Q;  1TY0 A;  1Y1V B;  4IPH A;  3J7A V;  1HTL D;  2G5D A;  1ROD A;  2XIW A;  2UUC L;  1Q46 A;  1HNX L;  5IOD A;  3WOF A;  1VQ7 A;  3LWE A;  1HNZ Q;  3TEH B;  4R4I A;  2NVT H;  1LTT D;  3DWQ A;  4K2K A;  2E2D C;  1DOM A;  1EY9 A;  3PUX A;  4KJN A;  4OON A;  5CV6 A;  2RCF A;  3IAY A;  3M7N A;  5BN4 A;  1CK1 A;  1HR0 L;  4IFD I;  3F1Z A;  1K8M A;  1K3B C;  3L3O C;  4NB3 A;  4DR7 L;  2OEO A;  4X3U A;  2A69 D;  2VW9 A;  1EQV A;  3H3V C;  2J0T D;  3JAM i;  3K6O A;  3D4W A;  4BBS H;  1B70 B;  4C3J G;  4A3B G;  2L11 A;  4JYA Q;  4XQQ A;  1KRS A;  2Z4H A;  4TKO B;  4OWX B;  2PMZ E;  1QVF A;  1EU4 A;  2FFK B;  2KHJ A;  2RDH A;  2EY5 A;  4LF6 L;  2GVA A;  2ID0 A;  1T9H A;  4WJ3 M;  1IYV A;  3BG3 A;  4LFC L;  3CCE A;  3CQZ H;  4CJ0 B;  1JMC A;  5FLM G;  4IAL A;  2VL6 A;  2F3I A;  4WJW A;  4BY1 B;  4DUY L;  1PFS A;  1E24 A;  4V19 0;  1TXY A;  1F2M A;  2SNS A;  1VQP A;  1I6H H;  4Y7N H;  4L8J A;  2MNA A;  5C0X H;  3S1M H;  4RGT A;  1PXU A;  1IKL A;  4JCV E;  3B6Y A;  3J80 i;  1ASZ A;  2NVQ B;  4WJ4 A;  5FK9 C;  5IE8 A;  1T5X D;  3PO2 G;  1TWF H;  4A3E H;  5JVG 3;  4A3M B;  4B08 A;  4C3H H;  3L9A X;  4X62 Q;  2ES2 A;  4FF4 A;  5JEA H;  4HAE A;  1YI2 A;  2AWO A;  4YIJ A;  1YHQ A;  5C44 G;  1D5Z C;  3K8A A;  5T1I A;  2IX3 A;  1VF5 C;  2LFN A;  2K5V A;  4FXD A;  2YV5 A;  1LO5 D;  2B2Y A;  1N33 Q;  4X3S A;  5M3M H;  4DV5 Q;  1TS5 A;  4G7H C;  3FPU B;  1VQJ A;  5BR8 L;  4RGO S;  4CDC C;  1H9S A;  1EEF D;  1I4Q A;  4BWG B;  1Y1W H;  4LW1 A;  4LNQ A;  2QCP X;  1WTX A;  1IBK L;  2RDG A;  2N78 A;  2F0P A;  1SYF A;  3S9W A;  3HOU H;  4ULL A;  2VUM B;  1U9R A;  4DU9 A;  5IGG A;  3R8B A;  4DV0 Q;  3J7A 5;  1SXT A;  5AJ3 Q;  2E8G A;  2K5Q A;  1VQA A;  5IYB G;  1PYW D;  4TRD A;  3TZU A;  1CKN B;  3AFQ A;  3E3X A;  1KC8 C;  3K59 A;  1DZ1 A;  5A2Q E;  3CKI B;  3IFT A;  4JI8 Q;  1EEI D;  5CV4 A;  4NPS A;  3K0X A;  3PF4 A;  2L12 A;  3JAM L;  3F2C A;  3T1H L;  1JB3 A;  3NTH A;  4WFN 3;  3DLL A;  3NUC A;  2KVM A;  4BBR H;  1CTM A;  1WTQ A;  2RA4 A;  1YIJ A;  2DJF C;  4RG1 A;  4MTK A;  2L9H A;  2JN4 A;  3CME A;  3FP9 A;  4EQO A;  3S1Q H;  2R93 B;  3GTJ H;  1ICW A;  4DR5 Q;  2A68 C;  4PMW A;  1CI3 M;  1LM0 A;  1OTC A;  2MGS A;  4EGV A;  1NE3 A;  1NSN S;  3J80 E;  1Q1B A;  2K4K A;  3RZD H;  3MXN B;  4DNI A;  5LMU Q;  1STB A;  2ZTE A;  2XRQ D;  1A6X A;  5D3D A;  4C3J H;  2JP1 A;  3M3Y B;  2B2V C;  4PMC A;  2F4V L;  1SMX A;  1D5X C;  1UWV A;  3M4P A;  3GTG B;  4U67 3;  1C0A A;  4LFA L;  4AQY L;  1OO9 B;  1HCZ A;  1VQM A;  2IHF A;  5C3W A;  1ZXT A;  5L37 A;  4OIK A;  3HOZ G;  4AYB E;  4QUF A;  5LL6 S;  4CGY B;  2VB3 X;  2A73 B;  4KJO A;  1WJJ A;  3VR4 A;  4DAY B;  1VQK A;  1MBY A;  3H0G H;  1PH2 A;  3HOW G;  4OX9 L;  1AW7 A;  1U4P A;  1CM9 A;  3F2B A;  2K04 A;  1PHJ A;  2TMP A;  3FRP B;  5D3I B;  4DV6 Q;  3KOJ A;  4KN4 C;  1ONL A;  3GTL H;  3KJO A;  5M3F G;  3JAM c;  4CBV A;  1DYQ A;  1F9R A;  5JJK A;  4JI3 L;  4B3R Q;  3TQY A;  3FDT A;  3I3C A;  1LLR D;  3FKI H;  3Q23 A;  2UXB L;  3A5U A;  3NEN A;  5IGF A;  4B3S L;  3SR1 A;  1B3A A;  4DK6 C;  2JA8 B;  3SK8 A;  2K01 A;  3NBI A;  3SXH A;  4KTA A;  1P16 A;  1JOO A;  3D6C A;  2EYJ A;  4LK1 C;  4A3J B;  3GTM H;  2JA5 G;  2F0I A;  1STE A;  3AQQ A;  1A3T A;  1CHP D;  1ENA A;  4XT1 B;  5JVH 3;  1RJT A;  2R6G A;  2B2U C;  4F87 A;  1EIH A;  1X3Q A;  1PZJ D;  3HP3 A;  3MXU A;  1WTH A;  3MA2 B;  4FYD A;  5IP7 H;  2JQO A;  2VB2 X;  2HHH Q;  1SNO A;  1EY6 A;  3J80 c;  4DV1 Q;  1J9O A;  2F0U A;  4AH6 A;  2CW0 D;  1B4O A;  5IWA Q;  1UEB A;  4RKL A;  3VR2 A;  4LF9 Q;  1M1K C;  1XNR Q;  2AQ1 B;  5CV8 A;  4BY7 B;  1PTO D;  4PG3 A;  1AZQ A;  1B9M A;  3V96 A;  1LTG D;  4RH6 A;  4KKU A;  4ME5 A;  4JYA L;  4XQN A;  2NWG A;  2B8F A;  3UI2 A;  5FJ8 H;  4EX5 A;  2HDM A;  4RGN A;  4OL7 A;  3RZO B;  3ICE A;  3J7A F;  2UXC L;  2O5I C;  1SJH D;  1LT3 D;  1STN A;  1IBM Q;  2A6H D;  5C4X B;  4OO1 I;  4P2C B;  4GKK Q;  1K3R A;  3G7L A;  4KLK A;  2RSO A;  3R93 A;  3V2T A;  1Y1V H;  1EOT A;  3ULJ A;  2Q8I B;  3PUV A;  1QNK A;  2XWB B;  2OF1 A;  4YWM A;  1WTO A;  5GAH C;  1EZ6 A;  1YNN D;  3NWS A;  1VQD A;  3T53 B;  3PUZ A;  4X62 L;  2K5N A;  1O80 A;  3I4O A;  2LXK A;  5GRO A;  1EY5 A;  2Y0S B;  2ZM6 Q;  3HOZ H;  1C4Q A;  3H3V H;  2E2J H;  4DN4 M;  4JBK A;  3OIQ A;  3HFZ B;  1ESF A;  2KEE A;  4A3G B;  1Y69 U;  3MVV A;  1YZ6 A;  1PTO F;  2BDO A;  3DMU A;  3R3O A;  3VYT A;  2BE5 D;  5E1F A;  3N52 A;  1LTL A;  1SMY D;  4CJ2 C;  5KYI A;  2R7Z G;  1SE3 A;  1HXY D;  1QVC A;  3S15 H;  4DK3 C;  3O13 A;  1H9S B;  2F0H A;  3BVZ A;  5C3E H;  3HOY G;  1STA A;  2B2Y C;  2A74 C;  4DR2 Q;  3R2T A;  4DV0 L;  4IOC A;  2D9U A;  4P74 A;  1ML0 D;  2HQL A;  2BH8 A;  3GTQ B;  2JA5 H;  5ELN A;  1RIP A;  4JI8 L;  5KNB A;  3AYH B;  4DKA C;  1CZG A;  5FLX L;  1BBU A;  1TWG B;  4KKT A;  5ISR A;  4I65 A;  4IQZ A;  2BCO A;  3ERQ A;  2NVQ H;  2J7Z A;  2QW7 A;  5LHY 1;  1JWU D;  5EPK A;  1F2Y A;  1TU2 B;  4DR5 L;  1LV9 A;  1EFI D;  2NVY H;  2X6L A;  1BCP B;  3Q8D A;  1FD7 D;  1WCM G;  2EOT A;  5M5W B;  1VQN A;  3OIP A;  1F9Q A;  1BF4 A;  5IP9 G;  1QUQ A;  1SYD A;  3Q24 A;  1PH4 A;  1BCP C;  3NWT A;  1IKM A;  1TKW B;  3A7A B;  5KRU A;  2DY8 A;  1GUT A;  1S5E D;  2QIL A;  2KCT A;  4N8X 1;  2AQ3 B;  4DV3 Q;  3HG9 A;  3OYY A;  3LX0 A;  2NVX B;  3OW7 A;  1D1I A;  3KLW A;  4LF8 Q;  1HRJ A;  2F0M A;  4R4T A;  1EYD A;  4DK0 A;  2D2C C;  3NK9 A;  4UP8 A;  4YCV A;  3W2D A;  5DM6 3;  1CA6 A;  1LT5 D;  1CQV A;  3BZK A;  5TSS A;  1GUN A;  3OWF A;  4DV6 L;  3S1R B;  2F0O A;  1SYB A;  4HCS A;  2EJM A;  4JI5 Q;  4ZK9 B;  1L0X B;  1I50 B;  3MHB A;  4FDB A;  2F4I A;  2BOS A;  1I4G A;  3CD6 A;  4DUZ L;  5K36 G;  4HCE A;  1EY4 A;  1CA5 A;  4OEL B;  1Q90 A;  2F0W A;  4JI6 Q;  3G6J B;  4A3K B;  1ZEQ X; 
#chains in the Genus database with same CATH homology
 4DV7 Q;  1VS0 A;  2I0Q A;  2ALY B;  4L5S A;  1A63 A;  3DM3 A;  2Z0S A;  4A3I H;  4ME3 A;  1XJV A;  5M5X H;  4A93 G;  1Q82 C;  4QQB X;  3UDX A;  3RLO A;  2HHH L;  2UUB Q;  1RL2 A;  2KCM A;  3D0F A;  4O2D A;  3GTG H;  3I2Z A;  3T1Y Q;  5JJL A;  1N34 Q;  3TRZ A;  1QUQ B;  4DV1 L;  1EUJ A;  4LF5 L;  1BKB A;  2QA4 A;  2Q2U A;  2OCE A;  3GTK H;  1HH2 P;  1CSQ A;  3W5O A;  5HGQ A;  5IWA L;  5GAG C;  4HJ5 A;  4HIK A;  5IYD G;  4JG2 A;  2B29 A;  3G4S A;  3CCM A;  4LF9 L;  2BA1 A;  4B3S Q;  4P73 A;  1K9M C;  3M9B A;  4QY7 A;  4IPH A;  3I4M G;  1N33 L;  1XNR L;  1O7I A;  1FJG Q;  1PH5 A;  2QEX A;  4DV5 L;  3K80 C;  2B3G A;  2UUC L;  1NBW A;  1Q46 A;  1HNX L;  1XMO Q;  2VS1 A;  3TS2 A;  2CQO A;  1VQE A;  2AHO B;  5LMN Q;  3GD7 A;  1HNZ Q;  1VQ7 A;  1OXV A;  1UE1 A;  3TEH B;  2JA6 H;  4R4I A;  1KHI A;  1SRU A;  2ZJR A;  4BA2 I;  3E9H A;  2NVT H;  4K0K L;  1K0R A;  2IY5 B;  2YTY A;  3TS0 A;  1OXU A;  2OWO A;  3GDE A;  2A8V A;  1OXS C;  2YTV A;  4JI7 Q;  3ZJY C;  3PUX A;  4PZ8 A;  2A1A A;  2PNH A;  2WAQ E;  4OON A;  5AJ3 L;  4A3B H;  1PH1 A;  3M7N A;  3CC2 A;  2VZA A;  4JI0 Q;  2ASB A;  3MEF A;  1HR0 L;  4BY1 H;  4IFD I;  4P72 A;  3A5Z B;  1VQ9 A;  3F1Z A;  1EIF A;  4DR7 L;  4GOP C;  4NB3 A;  2JA8 H;  2K52 A;  2JA6 G;  2VW9 A;  2F52 A;  2GVB A;  3AFP A;  4YCW A;  3ULP A;  2Q2I A;  4ALP A;  1N36 L;  4YHH L;  3JAM i;  4C3I H;  2R92 H;  5IP9 H;  2D0O A;  4A76 A;  1OXT A;  2AWN A;  4P71 A;  5FLM H;  1YIT A;  1B70 B;  1PH8 A;  4BBS H;  3JC6 6;  4A3M H;  4A3B G;  4JYA Q;  3L2P A;  2UUA Q;  1KRS A;  4BY1 G;  3CCS A;  4OWX B;  2LXJ A;  3J81 i;  2PMZ E;  2JA8 G;  2RCN A;  1QVF A;  2KHJ A;  4X6A H;  1WOC A;  1PH7 A;  4HIM A;  2ZM6 L;  4LF6 L;  4NXN Q;  4R4Q A;  2GVA A;  2ID0 A;  4MTN A;  1T9H A;  2RHS B;  4R4C A;  4GNX B;  4JI2 L;  3I4N H;  3PO2 H;  4WJ3 M;  1MJE A;  2RHQ B;  4LFC L;  2EXD A;  3CCE A;  1NMF A;  1YEZ A;  3CQZ H;  1JMC A;  5FLM G;  5LMU L;  4BBS G;  1WYD A;  4QGU A;  1Q7Y C;  2VL6 A;  2BA0 A;  1WI5 A;  2F3I A;  3D31 A;  4DUZ Q;  1K8A C;  4NXM L;  3M4O H;  1A8V A;  2NZH A;  1PFS A;  2Y0S E;  4EQ5 A;  3CCJ A;  5C44 H;  1E24 A;  3PGZ A;  4DUY L;  1TXY A;  4GNX C;  4BY7 H;  3L0O A;  1VQP A;  4Y7N H;  2E2I H;  2MNA A;  1J5E Q;  1YHA A;  1I6H H;  4JV5 L;  2N3S A;  3KF6 B;  1CKM A;  3CXC A;  3S1M H;  4JCV E;  2JE6 I;  2IX1 A;  3EN2 A;  4A3C H;  3B6Y A;  3J80 i;  1GO3 E;  1ASZ A;  3KDF A;  4WJ4 A;  2OQK A;  5IE8 A;  3I4N G;  2VUM H;  3CF5 A;  4O0A A;  3PO2 G;  4Y52 H;  1TWF H;  3I56 A;  4A3E H;  1M90 C;  5E7N A;  3RZO H;  3CPF A;  3G48 A;  4C3H H;  3PO3 H;  4X62 Q;  2ES2 A;  2Q2H A;  3CC4 A;  2BH2 A;  1GVP A;  2JEB I;  1JT8 A;  2CWA A;  1YI2 A;  2AWO A;  4DR2 L;  1VQC A;  1YHQ A;  4BY7 G;  1U5K A;  5C44 G;  1IZ6 A;  4JBJ A;  3K8A A;  4YWL A;  5C0X G;  4OXP A;  1H95 A;  1KRT A;  4X65 Q;  2K5V A;  3RLF A;  4A4I A;  5FLX c;  1AE2 A;  1HZ9 A;  1X55 A;  1QZH A;  2YV5 A;  1G29 1;  1SFO H;  3PUW A;  2ZTD A;  2VQE L;  1HZB A;  4IO9 A;  3RN5 A;  1XPR A;  2VUM G;  4B3R L;  4A3E G;  4UPA A;  1N33 Q;  1IXR A;  1IBL L;  5M3M H;  4J15 A;  5IYB H;  4DV5 Q;  3FHW A;  2MFI A;  3PO3 G;  1N9W A;  3I7F A;  3KF8 B;  1VQJ A;  2MO0 A;  5JEA G;  5BR8 L;  4JI4 L;  1UE5 A;  1VQF A;  1Y14 B;  4UP7 A;  1VQG A;  1L0W A;  1Y1W H;  3PV0 A;  5C4X G;  4LW1 A;  4LNQ A;  1G51 A;  2H5X A;  2LSS A;  2K50 A;  4DR6 Q;  1L1O B;  1IBK L;  2N78 A;  1E1T A;  2R93 H;  3HOU H;  1AH9 A;  3J7Z C;  1V43 A;  1YJW A;  3F2D A;  2K75 A;  2MO1 A;  1VQ4 A;  4HJ8 A;  4DV0 Q;  1L1O C;  1XMQ L;  5IYD H;  3J7A 5;  2HIV A;  4GS3 A;  5AJ3 Q;  2E8G A;  4HIO A;  1VQA A;  5M3M G;  5IYB G;  1K8G A;  1LYL A;  2V1C C;  4LF7 Q;  1CKN B;  3AFQ A;  3M3Y H;  1C9O A;  4A3G H;  2WFW A;  2Z6K A;  1Y1W G;  1KC8 C;  1QVG A;  4DPG A;  4JI8 Q;  2D0P A;  2PQA B;  2R93 G;  1EIY B;  3HOU G;  1V9P A;  1YNX A;  4NPS A;  3K0X A;  3PF4 A;  3CP0 A;  3M85 A;  4YHH Q;  2Y0S G;  1HNW Q;  4YY3 L;  3H15 A;  1KD1 C;  2JJQ A;  3F2C A;  3T1H L;  1YVC A;  4P75 A;  1S40 A;  4IFD J;  3DLL A;  2IHE A;  3NEL A;  4X66 L;  4BBR H;  1SR3 A;  2YYZ A;  1YIJ A;  4LF8 L;  1VQI A;  4RG1 A;  5H1S E;  3CME A;  1W3S A;  3CCR A;  3FP9 A;  3S1Q H;  1N32 Q;  3GTJ H;  3ULL A;  4DR5 Q;  1IL2 A;  4A3G G;  1I5F A;  1XNQ Q;  4DR1 L;  4DR4 Q;  1P8L A;  4PMW A;  1VQB A;  1FVI A;  1A0I A;  1LM0 A;  2NN6 I;  4TQU S;  1QZG A;  1OTC A;  1EFW A;  4LF6 Q;  1NE3 A;  2JEA I;  3CPW A;  1K73 C;  2ZJQ A;  1J6Q A;  4X64 L;  1Q1B A;  2K4K A;  1YBY A;  3RZD H;  1HR0 W;  3GTQ H;  1VQH A;  4LF4 L;  3U4V A;  2E5L Q;  3MXN B;  4DNI A;  3IRB A;  5LMU Q;  4GKJ L;  4KHP L;  1TWC H;  2ZTE A;  4BBR G;  4C3J H;  1IBM L;  4JI4 Q;  2F4V L;  4JC0 A;  1SMX A;  4JI5 L;  3HOW H;  5J3B A;  5GAE C;  2C35 B;  2JK8 A;  1UWV A;  3M4P A;  2CFM A;  3H3V I;  4GKK L;  3EBE A;  1C0A A;  4DV2 L;  3RN2 A;  3PIO A;  4AQY L;  1DGS A;  3PIP A;  4LFA L;  4B3M L;  2KEN A;  1VQM A;  2IHF A;  4XTC S;  2UU9 L;  5M3F H;  5JJI A;  3HOZ G;  4AYB E;  4IFD G;  4A3J H;  4DAY B;  1VQK A;  1WJJ A;  1TWH H;  4YWK A;  3PUY A;  1N8R C;  4B3T Q;  3U50 C;  1JJG A;  1Q81 C;  4JOI A;  4JI6 L;  4KHZ A;  2WP8 J;  3H0G H;  4DR3 Q;  5M5W H;  1PH2 A;  1CKO A;  3HOW G;  3SGI A;  4OX9 L;  3VDY A;  4L5T A;  4DV7 L;  1UE7 A;  3F2B A;  1PHJ A;  2HIX A;  1SN8 A;  1AE3 A;  1GKH A;  4DV6 Q;  3KOJ A;  3OTO L;  3GTL H;  3PF5 A;  3KJO A;  4R4O A;  3K7A H;  5M3F G;  4H02 A;  4DV4 Q;  3JAM c;  2UUB L;  3K81 C;  5JJK A;  4JI3 L;  4B3R Q;  1FL0 A;  1XPU A;  3TQY A;  4A3J G;  1SRO A;  1N34 L;  5IYC H;  3FKI H;  1EQQ A;  2UXB L;  3A5U A;  3NEN A;  1E1O A;  2VY3 A;  4LFB Q;  1B8A A;  3H0G G;  2NVX H;  3GTP H;  3CCQ A;  2VQF L;  1OXX K;  4DK6 C;  4B3S L;  3J81 c;  1I94 Q;  3STB D;  1FJG L;  4A3D G;  4JI1 Q;  1E7Z A;  1P16 A;  1D8L A;  3GTM H;  4A3L H;  2XTI A;  1XMO L;  3HOV H;  2OQ0 A;  5LMN L;  2JA5 G;  3CAM A;  3AQQ A;  4TVA B;  1HZC A;  2R6G A;  3S17 H;  4R1J A;  3GO5 A;  4BXX H;  2OTJ A;  4L5R C;  2GN5 A;  3FKI G;  5IYC G;  3RNU A;  1Z47 A;  3E0E A;  3UDF A;  5IP7 H;  2JQO A;  4JI7 L;  4OWT B;  3S16 H;  1EYG A;  3S14 H;  4IPD A;  5C4X H;  2HHH Q;  4IOA A;  1SE8 A;  3KYH C;  3J80 c;  4JI0 L;  1MKH A;  4DV1 Q;  2WAQ G;  4LF5 Q;  3ERS X;  2CWP A;  4A3L G;  3HOV G;  4AH6 A;  1S72 A;  4POG A;  5IWA Q;  3LGJ A;  1UEB A;  4LF9 Q;  4JBW A;  1M1K C;  4BXX G;  2WB1 E;  1XNR Q;  3U58 A;  1HJP A;  4PG3 A;  3BZC A;  2UUC Q;  5IP7 G;  1V1Q A;  1HNX Q;  1KAW A;  3ER0 A;  1MJC A;  3RLN A;  3UE0 A;  1NMG A;  4AYB G;  4A3K H;  1ASY A;  2I5L X;  5HY6 A;  1JB7 A;  1VQ5 A;  4JYA L;  1NTG A;  1EWI A;  1CUK A;  2R7D A;  3HOX H;  4GOP A;  1R9T H;  4K0K Q;  2UUA L;  5FJ8 H;  4EX5 A;  2UXC L;  3ICE A;  1EOV A;  1Q12 A;  3G71 A;  4GLA C;  2D62 A;  2K14 A;  5EAY A;  3PSI A;  1IBM Q;  2F4V Q;  4C2M H;  4OO1 I;  1UE6 A;  3CCV A;  4GKK Q;  1K3R A;  1HR0 Q;  4KLK A;  1EQR A;  4DV2 Q;  4LFA Q;  4A3K G;  4DR7 Q;  1X3E A;  1SLJ A;  1Y1V H;  4KI0 A;  1PH6 A;  4OWW B;  3I55 A;  1PYB A;  2PI2 E;  3ULJ A;  1Q1E A;  3HOX G;  1W2B A;  4UP9 A;  3PUV A;  1VQ8 A;  5FJ8 G;  4XIG S;  4LUV A;  1N36 Q;  1J5E L;  1X9N A;  1Q8K A;  2I5M X;  5DLQ E;  5C4J H;  4YWM A;  2R92 G;  1NY4 A;  4AIM A;  3K7U C;  4DV3 L;  1K83 H;  5GAH C;  1JJC B;  2OTL A;  4UY8 C;  3U4Z A;  4LWC A;  4JBM A;  3UDG A;  4GN5 A;  4APV A;  1VQD A;  4QJF A;  3CCU A;  2B63 G;  3E9I A;  1HZA A;  2R7F A;  3PUZ A;  1JJ2 A;  3S1N H;  3RR5 A;  4X62 L;  3STB C;  2DGY A;  4GNX A;  1XPO A;  1VQL A;  2K5N A;  3I4O A;  3KDF B;  2LXK A;  3OTO Q;  1Y1V G;  1X56 A;  5GRO A;  2ZM6 Q;  4HJA A;  2R7Z H;  1X3G A;  3HOZ H;  4JI2 Q;  2ZJP A;  4JI3 Q;  3H3V H;  2E2J H;  4JBK A;  4LFC Q;  5ELO A;  3AEV A;  2UXB Q;  4X65 L;  2IX0 A;  4L5Q A;  3HFZ B;  2NN6 G;  3HOY H;  2IT1 A;  1GD7 A;  3KF6 A;  4NXM Q;  1Z9F A;  3CCL A;  4DUY Q;  5GAD C;  2VQF Q;  1YZ6 A;  2JA9 A;  1TWG H;  2UXD L;  1TWA H;  4IPG A;  1PH3 A;  1KQS A;  1G6P A;  4JV5 Q;  4A3I G;  2WB1 G;  2K5H A;  1LTL A;  1KIX A;  2ATW A;  2R7Z G;  1PH9 A;  1QVC A;  1XTD A;  4LUZ A;  1PYS B;  2CKZ B;  3WWV A;  1GM5 A;  3HKZ E;  4DR6 L;  2N8N A;  3S15 H;  1PVO A;  4DK3 C;  4POF A;  3J81 j;  1BBW A;  5C3E H;  3HOY G;  4GLV B;  4DR2 Q;  4DV0 L;  4IOC A;  4GOP B;  2N49 A;  5GQO A;  4A3F H;  3UE1 A;  4A3D H;  2I5H A;  4P74 A;  2HQL A;  2BH8 A;  1YJ9 A;  4LF7 L;  1VQ6 A;  1X54 A;  1E22 A;  2FXQ A;  1MIU A;  1VCI A;  1NJI C;  1U0L A;  2JA5 H;  5ELN A;  1RIP A;  4JI8 L;  2VQE Q;  3AYH B;  1A62 A;  4DKA C;  1PA6 A;  1WCM H;  5M5Y H;  3T1Y L;  1IBL Q;  2CCZ A;  1I3Q H;  1L1O A;  1BBU A;  3F8T A;  3M4Q A;  5C3E G;  5BR8 Q;  3PCO B;  5C0X J;  1HNW L;  2KHI A;  2MQH A;  2NVQ H;  4BA1 I;  5LMN W;  2QGQ A;  3BJU A;  3S2D H;  1IBK Q;  2DUD A;  4A3F G;  4GN4 B;  3HKS A;  2Q2T A;  2Z6K C;  1KXL A;  2XGT A;  2L15 A;  2E2H H;  1N32 L;  4DR5 L;  2UXC Q;  2VNU D;  5JEA J;  1XNQ L;  4DR4 L;  3W1G A;  1CKN A;  1XMQ Q;  2NVY H;  1HNZ L;  3OW2 A;  3Q8D A;  1S3O A;  1WCM G;  4DAM A;  4QIW E;  5IT9 c;  1IYJ B;  1X65 A;  3G6E A;  3CC7 A;  1VQN A;  2PQA A;  3NBH B;  3S1R H;  3KFU A;  4HID A;  5IP9 G;  2E5L L;  1QUQ A;  2EQS A;  1PH4 A;  3S2H H;  4A3M G;  1D7Q A;  1BVS A;  1I50 H;  4PZ6 A;  2AKW B;  3NEM A;  1YJN A;  2RF4 A;  2KCT A;  4YY3 Q;  1E3P A;  3EIV A;  3T1H Q;  4HJ9 A;  2A19 A;  4DV3 Q;  3CMA A;  2YU9 H;  4X66 Q;  3OYY A;  4RMF A;  2HT1 A;  3KLW A;  4IJL A;  2JA7 H;  4LUO A;  4LF8 Q;  3KJP A;  1CSP A;  4B3T L;  4QL5 A;  3L7Z C;  5C0X I;  3CW2 C;  3HKZ G;  4DR1 Q;  1PV4 A;  3TRE A;  2EIF A;  3W1B A;  4HJ7 A;  4GLX A;  4R4T A;  2YTX A;  4A75 A;  4DR3 L;  1FGU A;  4UP8 A;  2KBN A;  4PZ7 A;  4YCV A;  1VQO A;  2AMC B;  1B7Y B;  4X64 Q;  1C7Y A;  4LF4 Q;  4KHP Q;  2NZO A;  3BZK A;  1LUZ A;  4DV6 L;  4A3C G;  4GKJ Q;  4NXN L;  1JE5 A;  3BU2 A;  4MNO A;  4DV4 L;  2JA7 G;  4JI5 Q;  4JOI C;  2UXD Q;  3GTO H;  1WFQ A;  2B63 H;  3A0J A;  4IPC A;  4IJH A;  4AQY Q;  3S24 A;  4FDB A;  4B3M Q;  3CD6 A;  4LFB L;  4DUZ L;  2UU9 Q;  4A93 H;  5K36 G;  3UDI A;  5IY0 A;  4OO1 G;  4GN3 B;  1X3F A;  1I94 L;  3A74 A;  2ZTC A;  4JI1 L;  1Q86 C;  1X6O A;  1L2F A;  4YCU A;  4JI6 Q;  1KL9 A;  1YHB A;  4MZ9 A;  3I4M H;  4OX9 Q;  2PI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...