2JA7H

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
135
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
total genus 16
structure length 135
sequence length 145
chains with identical sequence T
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja7H00
1S40A 4KHPL 1BBWA 4GNXB 3GO5A 1Q86C 2R7DA 1EIFA 3KLWA 1PH4A 1CUKA 3TQYA 3M7NA 3U4VA 3L2PA 4JI6L 2K14A 2K5HA 1A8VA 2WFWA 3I4OA 1CKOA 4JI6Q 5IYBH 3HOWG 2HHHQ 4A3LG 2D0PA 1VQ5A 2JA8H 1FL0A 1LTLA 3RLOA 4DV3L 1Y1WG 2IHEA 4LUZA 1VQEA 5GROA 1I94L 1WYDA 2VZAA 3CW2C 2WAQG 1N36Q 4OX9Q 1SROA 5IYCH 5LMUL 2D0OA 3ULJA 2Q2UA 4LF7L 4YY3L 3K81C 3GTJH 4LF7Q 2WB1E 3BZCA 4QQBX 2Q2IA 1XTDA 1YNXA 3CPFA 5H1SE 3CPWA 3OW2A 3M3YH 3PIOA 5M3MG 3J81i 1HR0L 3J80c 3UE1A 2R93H 2B63H 4BY1G 1LM0A 2UXDQ 5GAHC 1YHQA 3S17H 2QGQA 1VQGA 2KENA 3HKZG 1EUJA 3ER0A 3RLNA 3HOYH 4A3GH 3STBC 2ZM6L 3ZJYC 4LWCA 3TS2A 2WP8J 3KFUA 1SMXA 3CC7A 1PA6A 4LF5L 2Z6KA 4JBWA 4POFA 4DV7L 4JI7Q 4IJLA 1QVGA 1QVCA 3LGJA 1TWHH 1UE7A 4A3FG 4P71A 5JJLA 1HNXL 4GN4B 4H02A 3KDFA 4JOIA 1XPRA 1WCMH 3TS0A 5M5YH 5IT9c 4A3DH 1PV4A 3CP0A 1MJEA 2R92G 1PHJA 4BBSH 3RN5A 3PF4A 1BKBA 4WJ4A 4LFAQ 2PQAA 3H3VH 4JI3L 1X3EA 3Q8DA 4NB3A 3HOXG 3ICEA 1TXYA 2NVYH 1W2BA 2UUAL 3S1QH 1V9PA 4A3GG 3PUXA 1QZHA 1IBKQ 3GDEA 3PV0A 4MNOA 1PH3A 2MO0A 4RMFA 2QEXA 1Q81C 1IBLQ 1VQAA 1VQBA 2F4VL 4FDBA 4QGUA 2ZJPA 2UXCQ 1Y1VG 2EIFA 4A3FH 3M4OH 3S14H 1MKHA 4A3JH 1GO3E 1HH2P 5ELOA 4DR5Q 4B3TQ 4LUOA 4QL5A 1WFQA 1NMGA 1QZGA 1XNQQ 2GVAA 1WI5A 1N8RC 2VQEL 4DV6Q 3GTOH 3NEMA 1PH9A 1KIXA 1C9OA 3G71A 1KQSA 2N78A 1VQLA 1EWIA 2PMZE 4GKJL 4A3JG 5JJKA 3NBHB 4C3IH 2PI2A 4PMWA 1ASYA 1FJGQ 3I4MG 1B8AA 5IWAL 2E5LL 1MJCA 5LMUQ 3RZOH 4O2DA 3U4ZA 1N33L 4AYBG 3ULPA 2PI2E 3HOZH 4HJ9A 5DLQE 1VQHA 3HKZE 5IP7H 1VS0A 1JMCA 4X65Q 5HGQA 2IT1A 2R7FA 2EXDA 1E22A 4P75A 4X65L 1V1QA 5IYCG 2UXBL 1I5FA 1JJ2A 4IOCA 4KHPQ 4IFDG 3M4QA 3S24A 3CCEA 3CCQA 2UUAQ 4DV4L 5AJ3Q 1NBWA 5FLXc 5GADC 2GVBA 2JJQA 2ZM6Q 1NTGA 1IBML 4JV5L 1LYLA 5IYBG 1YJ9A 4BXXG 4OO1G 2HHHL 2VQEQ 4DV6L 1TWGH 4DAMA 1CSQA 1UWVA 4B3MQ 4GOPC 2GN5A 4XTCS 1L2FA 1NY4A 1T9HA 4P74A 2JA7H 1HNXQ 1X3GA 4OWTB 1H95A 3S15H 4NXML 1CKMA 3I2ZA 1XMQL 1RL2A 4MTNA 3EBEA 3KF6A 4A3CG 4KI0A 5C4JH 4K0KQ 2C35B 3E9HA 5IP9H 1Z9FA 4K0KL 3I7FA 2VW9A 2Y0SG 3CCVA 4LFBL 1K0RA 4DPGA 4C3HH 3HFZB 4JOIC 4GNXA 1XMOL 4LFBQ 4OXPA 2ZTCA 5C4XG 1YHAA 2UXDL 2CKZB 3AFQA 4MZ9A 1P8LA 2BA0A 1PYBA 5C44H 4LF9Q 1XNRL 3A5ZB 1G291 3KF6B 5M5XH 3U58A 1SFOH 4L5SA 3BU2A 4GKKL 4A93G 1SR3A 1IBMQ 2E2IH 4GNXC 2KHIA 2N49A 1VQMA 1KAWA 1MIUA 1L0WA 3F2DA 4B3SQ 3UDIA 1X6OA 1VQKA 1C0AA 1GD7A 2HT1A 3HOWH 2AMCB 4A93H 1YIJA 1OTCA 1UE1A 2B29A 4NXMQ 2VUMH 4DR5L 2YTYA 4OWWB 4DV5Q 5IYDG 2RF4A 2VQFL 2D62A 1E1TA 2E2JH 2ZTEA 4A3KH 1YJNA 4DR7Q 4JI3Q 3I4NG 1RIPA 1VCIA 2RCNA 1Y14B 4X62L 1NJIC 2CWPA 4JCVE 4ME3A 4A75A 1M1KC 4APVA 5JEAJ 4YY3Q 1EYGA 2JA8G 4A3BH 1QUQB 1N33Q 4YCUA 4LF6Q 2BH8A 3GTQH 3PGZA 4IPGA 4JBJA 3I4NH 2E2HH 1AE2A 2ATWA 2UU9L 3CMAA 5FJ8G 2K5NA 2OQ0A 4LF9L 5IE8A 4JI5Q 3KDFB 4GKKQ 3CAMA 3S1MH 3F1ZA 2RHSB 4B3TL 1YVCA 4DUZQ 2H5XA 2NN6I 1S72A 1X56A 2JQOA 5M3FH 4GS3A 2YTXA 4BY1H 3CCSA 3FP9A 4NPSA 1VQ7A 2CCZA 4XIGS 3M4PA 3S2HH 5C0XJ 1JT8A 1N36L 4LF8L 2JK8A 4OX9L 2UUBL 2I5MX 2OTLA 2AKWB 2VY3A 5GAGC 3GTGH 5GQOA 3S2DH 5FLMH 4AH6A 2AHOB 2JA5H 4JC0A 4YWMA 1E1OA 1JE5A 3A74A 1WJJA 1Q7YC 2ZJRA 4OWXB 1VQ8A 1L1OA 4HIDA 1UE5A 3CQZH 4LFAL 4X62Q 4JI1L 2UU9Q 4GLAC 1K8AC 3T1YQ 1K73C 2KCMA 4DR1L 1B70B 3J81j 2IX0A 4LF6L 4DV1L 1XNRQ 1L1OC 2LXKA 5C44G 1O7IA 4YWKA 1JB7A 3IRBA 3G6EA 5JJIA 1L1OB 1VQOA 2A8VA 1UE6A 4OO1I 3PUZA 4Y7NH 2UXCL 3RLFA 4X64L 1KC8C 4JI5L 3ERSX 4JI8L 5BR8L 2MNAA 1E3PA 3PO3H 4X6AH 3MXNB 3H0GG 5BR8Q 3S1NH 3STBD 4IFDI 1IYJB 2HIXA 1Z47A 3KOJA 3J7A5 4JBKA 4LW1A 1CKNA 2Q2TA 2CQOA 4IOAA 1JJCB 3PUWA 3CD6A 2AWNA 1JJGA 1YHBA 1E7ZA 3I55A 4A3IG 1J5EL 4IPDA 3UE0A 2A19A 3HKSA 3OYYA 1HZAA 1PH5A 3K8AA 4BY7G 1HNZL 4JI2L 1KRSA 2YV5A 1WCMG 4DK3C 4C3JH 2K52A 3F2CA 1VQCA 4UP8A 1HZCA 3I4MH 5HY6A 4HIMA 3SGIA 4LFCQ 3GTMH 1OXUA 2UXBQ 4LFCL 4EX5A 4DV4Q 4R4CA 3A5UA 1YI2A 4DV1Q 2Q2HA 2WB1G 3EN2A 1SE8A 3G4SA 4JG2A 3PF5A 1X55A 3PSIA 2IY5B 4A4IA 4PZ6A 3WWVA 3W5OA 1FGUA 4DV2L 4DV7Q 4JI7L 1Q8KA 4GN5A 3HOUG 2Y0SE 4JI0Q 2I5LX 3I56A 1N34L 4GLXA 1TWFH 5IY0A 2CWAA 4DKAC 1K9MC 1BVSA 2KBNA 4DR3Q 1Q46A 1GM5A 5C4XH 1HJPA 1KD1C 1VQDA 4IJHA 1Y1WH 4Y52H 4DR6L 2ZTDA 2N3SA 3U50C 4QJFA 4C2MH 4BBSG 4A76A 3T1YL 2K5VA 1HNWL 3AQQA 4L5RC 4DUZL 3E0EA 2A1AA 4DR4L 5M3FG 1VQNA 3GTKH 3K7UC 3PUYA 4DV2Q 1M90C 2ID0A 3J81c 3H15A 1N9WA 1J6QA 3FKIH 4LNQA 4HIOA 5FJ8H 2JA6G 3JAMi 1I3QH 1HZBA 3K7AH 3PUVA 4A3KG 1VQ6A 2NZHA 1QUQA 4KHZA 2LSSA 2HQLA 1X9NA 3L7ZC 3BZKA 2AWOA 3D0FA 3OTOQ 1VQ9A 5M5WH 4DR3L 4A3BG 2OTJA 3OTOL 3T1HL 2ASBA 1VQFA 4P72A 1SLJA 1CSPA 1G51A 2XGTA 4UPAA 3M9BA 5EAYA 2BH2A 4QY7A 1N34Q 3PO2G 3RR5A 3J80i 4AQYL 2QA4A 3RZDH 1EQQA 2B63G 2R7ZG 5IYDH 3HOVG 1KL9A 4HJ7A 4LUVA 1HNZQ 4JI2Q 4JYAL 2NVQH 1PH6A 1VQ4A 1BBUA 3NENA 2Z0SA 2IHFA 2VL6A 3CF5A 2ALYB 1LUZA 2F52A 4UY8C 1G6PA 4GOPA 1XJVA 3CCMA 4WJ3M 1K83H 5M3MH 4JI4Q 1U5KA 2MO1A 1PH2A 3CCJA 3K80C 3PCOB 3AFPA 4DR4Q 4NXNL 1PH7A 2IX1A 1EFWA 1SRUA 1N32L 2JEAI 4L5TA 3TRZA 1TWCH 3RN2A 2NVTH 1YBYA 4JI0L 1QVFA 4DK6C 4LF4Q 1IL2A 1V43A 2DUDA 1HR0W 4LF4L 4R4QA 4PZ7A 2E5LQ 4TVAB 4JYAQ 2K75A 5J3BA 1HZ9A 1SN8A 3CMEA 2N8NA 5C0XG 3NELA 1OXXK 3B6YA 4DUYL 2XTIA 4DR2L 1PYSB 3ULLA 4DUYQ 4DR2Q 1HR0Q 1VQPA 4BY7H 1OXTA 3F8TA 3CCLA 1HNWQ 5AJ3L 3CCUA 1AE3A 2JA9A 3RNUA 4A3EH 1CKNB 1A0IA 2DGYA 3F2BA 1Q12A 4IO9A 2R6GA 4AYBE 2I5HA 4AIMA 1UEBA 4R4OA 4HIKA 1EIYB 4PZ8A 4PG3A 4DV0Q 3GTPH 2R93G 4X66L 2VNUD 4DV0L 1PVOA 3FHWA 3JAMc 3H3VI 1X54A 3EIVA 2MFIA 2F3IA 3TEHB 1YJWA 1YZ6A 4GLVB 2KHJA 2JA5G 3AEVA 3MEFA 1XMQQ 4YHHL 2OWOA 4HJ8A 2UUCL 3HOZG 4YHHQ 3PIPA 1YITA 4KLKA 4DR6Q 4JI1Q 2VUMG 1D7QA 3KF8B 3W1GA 3M85A 3HOVH 4GKJQ 4RG1A 1K3RA 1X3FA 1I94Q 1XMOQ 1Q82C 1P16A 1FJGL 3UDXA 1S3OA 4A3CH 1IZ6A 2V1CC 5FLMG 1EQRA 4A3EG 3CCRA 4POGA 4UP9A 3D31A 2E8GA 3KYHC 3UDFA 4TQUS 4R4IA 4YCWA 4BA1I 3BJUA 4X64Q 4GN3B 5GAEC 3S16H 4JI8Q 4A3MG 2K50A 4JI4L 4A3LH 2PQAB 4B3RQ 3DLLA 4OONA 2WAQE 5C3EG 4NXNQ 1I50H 1DGSA 4YWLA 1XNQL 3GTLH 3AYHB 4JV5Q 3KJPA 4DV5L 5C3EH 4IPCA 4X66Q 1ASZA 1N32Q 1KHIA 1W3SA 5JEAG 1J5EQ 2YU9H 4LF8Q 4DAYB 3HOUH 2BA1A 4AQYQ 2UUBQ 4B3ML 3PO3G 2EQSA 3HOXH 4DR7L 1X65A 1GKHA 2ES2A 3E9IA 1PFSA 1VQJA 2K4KA 4A3DG 3CC4A 1TWAH 2RHQB 2L15A 2VS1A 1A63A 3CXCA 1Q1EA 4A3MH 3UDGA 3VDYA 4IPHA 4JBMA 1KXLA 2OCEA 1FVIA 5IP7G 1XPOA 4B3RL 1EOVA 1OXVA 1NMFA 2FXQA 3W1BA 3S1RH 1IXRA 3G48A 3GD7A 4YCVA 5ELNA 4B3SL 1GVPA 1IBKL 1C7YA 1K8GA 4IFDJ 2JE6I 4L5QA 2OQKA 4LF5Q 5LMNQ 4BBRH 4ALPA 1R9TH 3HOYG 2PNHA 3A0JA 3TREA 3L0OA 3JC66 4HJAA 5E7NA 2I0QA 2ZJQA 4DV3Q 1Y1VH 1YEZA 4R4TA 4P73A 2NN6G 1VQIA 3PO2H 2NZOA 2KCTA 1AH9A 2MQHA 4BBRG 5LMNW 3J7ZC 3T1HQ 2CFMA 2R7ZH 2B3GA 1OXSC 2UUCQ 2NVXH 2JA6H 1B7YB 1D8LA 5C0XI 4HJ5A 4GOPB 4R1JA 4EQ5A 4DNIA 3DM3A 2JA7G 3KJOA 2VQFQ 1XPUA 2YYZA 1PH8A 3CC2A 1U0LA 5IP9G 2R92H 1I6HH 2Z6KC 4J15A 5IWAQ 4A3IH 4BA2I 1NE3A 1KRTA 4DR1Q 2HIVA 5K36G 2YTVA 2JEBI 1Q1BA 1PH1A 4BXXH 1E24A 5LMNL 1WOCA 3FKIG 4O0AA 1A62A 1IBLL 3K0XA 4UP7A 2F4VQ 2LXJA 4QIWE 3H0GH
chains in the Genus database with same CATH superfamily
4KHPL 1BBWA 1EQTA 3GO5A 4LJZC 4IFDH 2K04A 1EIFA 2R7DA 2E2JB 3L2PA 1NAPA 2K5HA 1A8VA 4C3HB 1Y8NB 1GUWA 1LO5D 4JI6Q 3HOWG 4O42A 4LUZA 3GTLB 2A73B 1EOTA 1CT1D 1SROA 5IYCH 1EIGA 2D0OA 3ULJA 1H9MA 2AQ1B 1SNPA 3M3YH 3OW2A 2DJFC 3IFTA 4IURA 2I07B 2A74C 3J81i 5JVH3 1HR0L 3N6RA 3H6MA 2B63H 2UXDQ 2EYJA 3S17H 1XWEA 4A3GH 1SYBA 2B2UA 1Y69U 1DM0B 1DYQA 4IUUA 2I46A 2Z6KA 4JI7Q 1ILPA 1FR3A 3LGJA 1UE7A 4P71A 3SR1A 1SDFA 3IKJA 2F3VA 4H02A 4JOIA 5C5LA 1CI3M 1XPRA 4FVMA 3D4WA 4ULLA 1A15A 2PCFB 3CP0A 2BDNA 3PF4A 3D6WA 4WJ4A 1CTMA 3CKIB 1F2YA 1TXYA 4DK0A 4KY6A 4PV1C 1ONLA 1IBKQ 3A56A 1MBYA 1PH3A 2E2HB 1A2UA 2ZJPA 4RHSA 2F3WA 2IL8A 2PYKA 4FO2A 1EY9A 4QL5A 2GVAA 1WI5A 2LS01 4DV6Q 5EBDA 3D4DA 4GKJL 1C9OA 1Y8OB 4FXDA 5CYUA 1IW7C 1NCVA 1ASYA 1JCKB 1MJCA 1QE6A 3A8KE 3MXNA 4XT1B 3U4ZA 3RZOH 5J22A 3HOZH 1SE4A 3HKZE 3P75A 3BYTB 1V1QA 1JJ2A 4IFDG 1W6KA 3N52A 2AQ2B 1NBWA 5FLXc 2DY8A 1IBML 5IYBG 4OO1G 4DV6L 4GZYC 5FLXE 1EL0A 4XTCS 4EVOA 4FF1A 1L2FA 1T9HA 1G8ZD 4QMGA 1A3UA 1XMQL 1RL2A 1F9SA 2E74C 2MGSA 3EBEA 4MTNA 4KI0A 4K0KQ 3E9HA 4PMCA 1EY4A 5EJWA 2F0TA 2A6ED 1SYCA 1NR4A 1S4ZA 3U9OA 1XMOL 2ZTCA 4ILWA 5G3LF 4TRDA 4CBVA 2BA0A 2CHBD 1HQRD 1G291 1SYFA 3FKIB 3BU2A 4A93G 1SR3A 1IBMQ 4KN4C 1KNAA 1FNUA 2KHIA 2N49A 1MIUA 1VQMA 1LABA 3F2DA 1VQKA 2QDBA 2KCNA 1SNQA 4EQPA 4A93H 1KDCA 2VUMH 1LT6D 2L55A 1O80A 1AFPA 2K28A 4C3JG 1SNMA 1MHWC 2VQFL 3V96A 1E1TA 5DEHA 5EGTA 1YJNA 2K5WA 3HOXB 2G9HD 3DUZA 3A54A 4RFBA 4A3BH 4RGTA 1EWHA 2AUJD 1YNJC 3QO2A 2ZT9C 1N33Q 4LF6Q 2O5JC 3V05A 4IPGA 1Q8IA 4JBJA 2E2HH 4G7OC 3EA6A 3MAQA 2OQ0A 1JE4A 5IE8A 4JI5Q 3KDFB 3F1ZA 2NN6I 3JAME 2JQOA 5M3FH 2YTXA 4BY1H 2Z4IA 2EJGC 4AYBB 2CCZA 3CU7A 2JN4A 3VYSA 5C0XJ 1JT8A 4LF8L 2I5MX 1F9RA 1EQVA 5GAGC 4HMJA 2AHOB 2JA5H 1VF5C 5KEEA 1E1OA 4BY1B 2B39A 2ZJRA 3JAML 1BR9A 2F0GA 3T16A 4RCOA 4GLAC 1K8AC 3T1YQ 1BUVT 1K73C 2F0WA 5C44G 1WTHA 3S16B 3H09A 5M5YB 4X64L 1KC8C 3ERSX 3AB9A 5KYIA 5BR8L 3H0GG 2HCIA 3DWPA 5CR3A 2IX3A 2HIXA 1Z47A 3KOJA 4JBKA 4A3KB 1PZJD 3GTOB 4IOAA 3NQTA 3CD6A 2Q8RE 1YHBA 4K2LA 3I55A 5M5WB 1R4PB 1B1ZA 1LTGD 1PH5A 2D2CC 4X3UA 4JI2L 1WD1A 2F03A 2K52A 3F2CA 3H91A 4UP8A 1UUPA 3GTMH 1OXUA 3Q22A 4V0BA 1YI2A 3BDOA 2L5TA 2Q2HA 1X3PA 4JPBW 3BG3A 3WWVA 4FP5D 4DV7Q 2RDHA 3GTGB 1PTOD 4JI0Q 4WJWA 1TWFH 5IY0A 2CWAA 4DKAC 1K9MC 2NVTB 1QG7A 1Q46A 4CJ2C 1GM5A 2XSCA 4OGQC 1HJPA 1EZ6A 1VQDA 4IJHA 4Y52H 5FO9B 4QJFA 4N9TA 4A76A 3I91A 4FNFA 1RTOA 4QUFA 1VQNA 3KLRA 3VA7A 2EE1A 3K7UC 3PUYA 1M90C 5CV7A 2ID0A 4L63B 3H15A 4LNQA 5TSSA 1NSNS 4HIOA 3W2DA 5FJ8H 2KA7A 1VQ6A 2JA7B 3J81E 1X9NA 2LSSA 2HQLA 3L7ZC 5EKIA 3OTOQ 3HOVB 4A3BG 2CVRA 3VA5A 1I4GA 4J6HA 2F0VA 1LLRD 2XGTA 3SHLA 3PO2G 2E75C 3RR5A 3URYA 5IYDH 5C4ZA 3T51B 4LUVA 4HJ7A 2NVQH 4KKUA 3BDLA 4B9XA 1BBUA 1LV9A 2Z0SA 1EYDA 3GV3A 1LUZA 3CCMA 1TS3A 2MPMA 2H4OA 2VXWA 3CCJA 3K80C 2Z8LA 5KNBA 3GTMB 1SJED 2XIWA 1HUMA 3A8IE 1PH7A 2BDOA 1SRUA 3TRZA 1ZXTA 2CQAA 1YBYA 5JJZA 1QVFA 1JWUD 1IL2A 2DUDA 2KVMA 4LF4L 2FMMA 4TVAB 2B8FA 3K5NA 4FF3A 2K75A 1DCZA 5C0XG 3QOJA 3B6YA 5IGGA 1U4PA 4DR2L 1IYVA 1SAPA 4PQXA 2EY1A 5IT9E 2LKVA 5JOBA 3SK8A 1HNWQ 3CCUA 4DNRB 4IO9A 2NN6H 4AYBE 1UEBA 4R4OA 3GTPH 1TWAB 2VNUD 3H3VI 2KEEA 4K8JA 2MFIA 2F3IA 4GLVB 2KHJA 4HJ8A 1EU3A 3A55A 3BVGA 4JI1Q 3LX0A 4WRDA 1K3RA 1TR5A 1XTCD 3PO2B 1S3OA 2V1CC 1CQFA 4POGA 1EY6A 1C8CA 3D31A 2E8GA 3KYHC 2JXMB 2RKSA 1EZ8A 3TMEA 3BJUA 5GAEC 3S16H 4JI8Q 4A3MG 1TVXA 3K59A 2PQAB 2VB2X 3AMUA 1TKWB 5K5PA 4C2MB 3NBIA 3R93A 1I50H 3K6OA 4YWLA 3GTLH 3KJPA 4DV5L 2QF7A 4IPCA 4X66Q 1J5EQ 2EY5A 2BA1A 1JORA 3PO3G 2EQSA 5LL6S 3ZYYX 3HOXH 2RDGA 3MXPA 5D14A 5ELFA 5EQ0A 5I2XA 1PFSA 4HN7A 1TWAH 2L15A 1CM9A 3CXCA 3UDGA 4N8X1 3MEHA 3VDYA 2EDGA 5CGKA 1KXLA 1XPOA 1OXVA 1NMFA 1BBXC 1GUOA 2KJXA 3C3LA 1GVPA 1F9QA 4IFDJ 2OQKA 3MC0B 5M9OA 2ZXRA 4ALPA 3G7LA 1S5CD 1QOHA 2FHTA 4P73A 2NN6G 3PO2H 1I6HB 2NZOA 2YU9B 2KCTA 1TWHB 5LMNW 3D6CA 1CHPD 4CJ0B 2PZTA 1RCVD 1R9TB 2NVXH 1ET6A 5C0XI 2XRSD 4EQ5A 1TS2A 1EY8A 1CZGA 3BYYB 3J7YW 1PH8A 2R92H 2Z6KC 3T13A 5IWAQ 4BA2I 2K05A 1BF4A 1E24A 4OHJA 4JVZA 1WOCA 1PYWD 2LXJA 3HOYB 2FINB 4GNXB 1QWYA 2PW5A 1PH4A 3M7NA 1CUKA 2K14A 3I4OA 5IYBH 4KJOA 3G6JB 2HHHQ 2QCPX 4K6LA 4OO1H 2JA8H 1TWCB 1A3VA 1PMRA 3NPPA 4DV3L 5C4HA 4C56C 3HOWB 4A3DB 1WYDA 2VZAA 3OMCA 4OX9Q 4A3JB 4LF7L 4YY3L 3K81C 3GTJH 1SMYD 3I4LA 2DNEA 3NSWA 2B2TA 2Q2IA 1YNXA 5H1SE 2RDFA 5M5XB 4EGVA 2XRQD 4Q0FA 4J8QA 3CRLC 5D65A 5GAHC 3KUPA 1YHQA 1VQGA 2NB0A 3HKZG 5EBCA 3RLNA 5IGCA 3STBC 3ZJYC 4LWCA 4K5WA 3CC7A 3RZDB 4LF5L 5IOCA 3KF8A 1VMPA 1TWHH 2OXPA 4GN4B 4RAUC 1WCMH 1R4QB 1MJEA 2R92G 1PHJA 3S9WA 4BBSH 1B9MA 2NTTA 1GUSA 2PQAA 4JI3L 1T5XD 1X3EA 3Q8DA 2KCCA 3HOXG 2UUAL 3QJYA 3VR3A 1V9PA 2NUCA 3EROA 5FOBB 4S3SA 4RMFA 1Q81C 4A3GB 2B2UC 1Y1VG 2EIFA 1EU4A 3M4OH 1DJRD 3S14H 1GO3E 5ELOA 4B3TQ 5IGEA 1M4VA 4CGYB 1N8RC 1HHVA 2VQEL 3BVZA 1PH9A 1KIXA 1KQSA 1S5DD 5LL6X 4DU9A 3GQBA 1YNND 1V1PB 1I50B 2V4DA 3OSOA 3I4MG 5LMUQ 4K2KA 4O2DA 1N33L 3C1EA 3ULPA 2EYHA 2PI2E 1D5ZC 1E0BA 4I7ZC 4HJ9A 2B63B 5J1ZA 5IP7H 1JMCA 4X65Q 1QB5D 2IT1A 4NMZA 5HGQA 4A3MB 5IYCG 4KHPQ 3CCEA 5AJ3Q 3FVQA 2GVBA 4KY7A 2ZM6Q 1NTGA 4JV5L 1YJ9A 3GV6A 5I9PA 2VQEQ 1TWGH 2J0TD 4DAMA 1UWVA 4B3MQ 2GN5A 1HA5A 3D3RA 4OWTB 3S15H 3I2ZA 1B3QA 1D6EC 5C4JH 3J80E 4TKOB 2C35B 5DM73 1Z9FA 1UNSA 2VW9A 1JOOA 2EYPA 2Y0SG 3IAYA 4LFBL 3HFZB 4GNXA 4OXPA 2OEOA 1Q90A 1STHA 2UXDL 3AFQA 5C44H 1PYBA 4LF9Q 3GTKH 4OL7A 4CDEC 5M5XH 1E2VA 3U58A 3SEBA 1SFOH 4L5SA 1HTPA 4IN3A 4EQNA 4GNXC 2WINB 3HGBA 3MTSA 2NVQB 1O7ZA 3MFYA 1GD7A 3HOWH 1CA5A 1QCBD 1GJXA 1YIJA 3FEWX 1PRTB 4DR5L 2TSSA 2PMZB 3CHBD 4BBSB 3GP7A 2D62A 1L0YB 2ZTEA 4DR7Q 4DK1A 2RCNA 3OOCA 1HPCA 3PO3B 4ME3A 2M9VA 4A75A 4APVA 4YY3Q 2CH4W 1ESFA 1K83B 5M3MB 2EJMA 3MA2B 1B3AA 2BH8A 1JR0D 1PXUA 2K5QA 2GA4B 2F0IA 1RTNA 1RHPA 2A6EC 3CMAA 2UU9L 2K5NA 1DXMA 2RHSB 4DUZQ 3KBXA 5COYA 2F0KA 4NPSA 1VQ7A 1N36L 2JK8A 4DXFA 2UUBL 3L9AX 3NUCA 4IZ8A 3GTGH 3S2DH 5FLMH 4AH6A 4JC0A 4YWMA 2B2YC 4OWXB 5C6AA 1L1OA 3CQZH 2HQEA 2UU9Q 2PZWA 1QILA 2F0HA 3O13A 4DAVA 2KCMA 4A93B 1B70B 4LF6L 1IKMA 1AN8A 2K7VA 1TIID 2LXKA 4YWKA 1ZYRD 2N88A 2OF1A 4RGNA 1PTOC 4Y7NH 3RLFA 4JI5L 4G57A 3MXNB 2EXZA 2K03A 3S1NH 4IFDI 3WDNA 2QW7A 4LW1A 2Q2TA 2JA6B 1JJCB 3NTKA 1BO0A 2AWNA 3PMFA 4A3IG 4IPDA 1SNOA 2A19A 4BY7G 3HG9A 4UDUC 1A6XA 1KRSA 4C3JH 5I9OA 2NZ1D 2D9UA 4XT3B 1BDOA 5IGBA 4LFCQ 3SGIA 2DNCA 3RD4A 4KV6A 1F2LA 4R4CA 2WB1G 3RUZA 1FNWA 2B2VA 4JG2A 1HUNA 3PF5A 1EY5A 1PZID 1X55A 3PSIA 4QF4A 3I4MB 1FGUA 4DV2L 4JI7L 2KHSA 1Q8KA 2Y0SE 4ZKBB 2WAQB 1N34L 1PFMA 3C1FA 4I65A 4GLXA 4DR3Q 4NW2A 3NTIA 4A3FB 5KIXA 3NWSA 3K5OA 1Y1WH 3BVMA 3MXUA 4C2MH 3E6ZX 1H9SB 3NWTA 2K5VA 1RDPD 1HNWL 3AQQA 5C44B 5EPKA 2H1EA 1RF2D 4I7AA 5NUCA 3E0EA 3MHBA 1ILQA 1TS5A 4DV2Q 2EJFC 2EYFA 1J6QA 1SFOB 2JA6G 2J4XA 3JAMi 4DGZA 1I3QH 3PUVA 4A3KG 1WTXA 2A68C 2BE5C 2AWOA 3FMCA 3OWEB 5M5WH 4DR3L 2ASBA 1TU2B 1F9PA 1VQFA 4P72A 5I6WA 1G51A 2BH2A 5ELBA 4AQYL 5I4DA 2R7ZG 3SK6A 4DNTB 2HUGA 1PH6A 2IHFA 2ALYB 3K0YA 3P1HA 4GOPA 1IYUA 2XN9C 1K0SA 3S17B 3HEJA 3PCOB 3AFPA 1UAPA 4OIKA 2PPBC 1EFWA 4FF2A 4L5TA 2JEAI 3TP8A 1HR0W 1SBBB 4R4QA 5JEAH 2E5LQ 1B2TA 3X3NA 1HCZA 2RA4A 3NELA 5CMDA 1OXXK 4DUYL 1U9RA 1ESRA 4BY7H 1OXTA 1PRTC 1AE3A 2JA9A 4ZCKA 2DGYA 1A0IA 3KLSX 3CRKC 2EOTA 4PZ8A 4DV0Q 5J39A 1TQOA 3AU7A 3PQIA 5I6YA 2QKIC 3EIVA 3TEHB 5CV9A 2JA5G 3AEVA 1JOQA 2WACA 3HOZG 4YHHQ 1RKNA 3HOVH 4GKJQ 4RG1A 1CQVA 3E0JA 1I94Q 1STGA 3UDXA 1IZ6A 1U4RA 4A3EG 3CCRA 4UP9A 4KMUC 4R4IA 4BA1I 1JICA 2K50A 1SYDA 4A3LH 4B3RQ 2DJGC 3A7LA 3F2UA 4KKSA 1EYAA 4KKTA 1XNQL 3AYHB 3DWAA 1TT2A 1KTKA 1KHIA 5JEAG 3DHQA 4LF8Q 4DAYB 2L9HA 4LAAA 4E6IA 5FLXL 2PO4A 1TWFB 1GKHA 2PW7A 3NP8A 4YIJA 2ES2A 2VB3X 2A69C 4HR7B 2F0NA 1WTOA 3Q0AA 3CC4A 4C3IG 1U4MA 4JBMA 2OCEA 3E5SA 4B3RL 2FXQA 3ERQA 2F4IA 1EWCA 5C3XA 1K8GA 1C7YA 2JE6I 4LF5Q 3J7AF 5KRUA 5LMNQ 1R9TH 2NVXB 2C9OA 2K32A 1PRTD 3L0OA 5C4JB 5CORA 4HJAA 5BN5A 1Y1VH 1VQIA 2C5CA 4ZRZA 4BBRG 5T1IA 2UUCQ 1TWGB 1IHZA 4GOPB 4R1JA 1ENAA 2F0EA 2JA7G 3VYRA 2VQFQ 2E2IB 1EEFD 4MN3A 1I6HH 4ME5A 2ICIA 1KRTA 4DR1Q 1F77A 3ND8A 4ID6A 1KABA 4BXXH 4BY7B 5LMNL 1A62A 3K0XA 4UP7A 4B3SL 4P2CB 4XYQA 1S40A 3TSSA 2BOSA 1Q86C 4KTAA 3KLWA 1DOKA 2SNMA 2Y0SB 4JI6L 1WVLA 3LNNA 1CKOA 4CJ1B 4A3LG 2D0PA 2G9DA 1VQ5A 1FL0A 2WAQG 2ZXOA 4B08A 3VR2A 5LMUL 3HOUH 2Q2UA 1E2WA 2WB1E 3CPFA 3CPWA 2IPKD 3DEOA 3UE1A 3QR8A 3BZDB 4BY1G 2ENBA 2KENA 1EUJA 2ZM6L 1L0XB 2HDMA 2WP8J 3KFUA 2ZXPA 2MUYA 5D3IB 1PA6A 4XXEA 4OEMB 4JBWA 4IJLA 1QVCA 4RWSC 1JWSD 1K8MA 5JJLA 3S1NB 3TS0A 5G3LD 1PV4A 1KDBA 3RN5A 5BN3A 2O5IC 1BCPF 4FXKC 3J7AV 1Y1VB 2QEJC 1W2BA 3MVVA 1AZQA 4A3GG 4R8NA 4JW0A 2QEXA 1IBLQ 2F4VL 1WTVA 1HXYD 4C3JB 4QGUA 4J1MA 4A3FH 4IALA 4PMBA 2XWJB 4A3JH 4X3TA 1HH2P 4A3IB 4DR5Q 3L3OC 1QZGA 1WFQA 1NMGA 1XNQQ 2NWGA 3NEMA 4HMIA 1EWIA 2PMZE 4A3JG 4C3IH 1ML0D 4H13C 1FJGQ 1D1IA 1B8AA 1V8QA 5IWAL 2B2WA 1D2BA 4AYBG 3I70A 3R8BA 2PZUA 2EYOA 1MD2D 1E22A 4P75A 2UXBL 1V1PA 1I5FA 3S24A 1SE2A 4RHRA 3CCQA 2UUAQ 1TY2A 3RZOB 1HTLD 1Y8PB 4BXXG 2HHHL 4HTHA 4GOPC 3S2DB 4DFAA 2JA7H 2FJ2A 1X3GA 1HNXQ 3OMGA 3KF6A 4IUPA 4DXGA 2R7ZB 3D4RA 4K0KL 3I7FA 1STNA 1K0RA 5FK9C 5A2QE 4M1UB 2F0UA 3FPPA 1Z7TA 4JOIC 1PFNA 2RVLA 5C4XG 4DN4M 1H95A 3H94A 4GKKL 4XQNA 2R61A 1G2SA 1RJTA 1X3QA 1KAWA 1L0WA 4B3SQ 3UDIA 1X6OA 1C0AA 4TSSA 2HT1A 2F0OA 2AMCB 2PQEA 3I73A 5HGTA 1UE1A 3DXJC 2YTYA 1T5EA 4F8MA 4DV5Q 5IYDG 1ZKOA 2RF4A 2F1MA 1YNJD 2E2JH 3SK4A 4A3KH 1B9NA 5HURA 2M00A 4JI3Q 1RIPA 1Y14B 4X62L 1NJIC 2CWPA 3DM1A 3NE5B 4JCVE 4RGMA 1M1KC 5JEAJ 1EYGA 4HEDA 1QUQB 3C46A 4YCUA 5D3DA 2Q8IB 1WTRA 3GTQH 3C2PA 4IUVA 3I4NH 2ATWA 1O78A 3EJIA 4CDFC 3EQLC 3K5MA 1PDQA 4KY5A 4LF9L 3R3OA 4IUNA 3S1MH 2XNAC 1PTOF 3Q24A 4B3TL 3OPOA 1S72A 5C4XB 1LTSD 3FP9A 2SOBA 4XIGS 3J80L 5L37A 5IGFA 5EKKA 3S2HH 2OTLA 5GQOA 1O7LA 2KEDA 3A74A 3I90A 3NTHA 2JP1A 3TN2A 2HD3A 4HIDA 2LMCB 1UE5A 4JI1L 1A2TA 5ELCA 5DNFA 3D8GA 3QWNA 1I3QB 3J81j 1XNRQ 4DV1L 1AEXA 3ONAB 2F0PA 1L1OC 1O7IA 4C1NK 1JB7A 5JJIA 3G6EA 1GHKA 1L1OB 2M2LA 3HP3A 4K6DA 4OO1I 3PUZA 3HS0C 3S1QB 4JI8L 1E3PA 4X6AH 1G2TA 4A3BB 5BR8Q 3STBD 1MSGA 5C5MA 3J7A5 5DM63 2CQOA 4MTKA 1RD9D 2JA5B 1J5EL 3UE0A 3HKSA 1IL8A 1HZAA 3K8AA 2KQ3A 5KGUA 1IW7D 3NXWA 4DK3C 2EVBA 1B50A 4QIWB 3I4MH 1HZCA 1LTBD 1PTOH 5CBEE 2UXBQ 4EX5A 2E2DC 3A5UA 1KNEA 2Z1CA 3BS1A 3G4SA 3DMUA 2IY5B 2KECA 4A4IA 3W5OA 5C3EB 3I56A 3K58A 4ODGA 3QOLA 1GUTA 1GXDC 4DR6L 2ZTDA 2N3SA 2AUKA 4BBSG 4B9WA 4DUZL 5CV6A 4Y7NB 2A1AA 4DR4L 4H7BA 2A6HD 1B4OA 3FKIH 3LWUA 3MZ5A 4ZYSA 1HZBA 4Z9CB 2NZHA 3D0FA 1LACA 4KN7C 5ELDA 3OTOL 1SLJA 2L1BA 5I2YA 3R2TA 3I3CA 1LT3D 3M9BA 4QY7A 4MHEA 1N34Q 3RZDH 1EQQA 2B63G 4N8FA 1HNZQ 1A3TA 4JYAL 1PTOB 1LTAD 4H44C 3NENA 3T4AC 2VL6A 2QILA 2A69D 4UY8C 2MP1A 1G6PA 2F0QA 1K83H 5CC4A 5M3MH 1U5KA 4WJ3M 1PH2A 4CKBA 2IX1A 5ISRA 1B44D 1TWCH 4L6TB 2NVTH 4LF4Q 1V43A 4PZ7A 4JYAQ 5K36H 2A68D 2BE5D 1HZ9A 1SN8A 3SE0A 1SYEA 2RSOA 1LT5D 2XTIA 1PLFA 3ULLA 4DR2Q 1VQPA 1DONA 3CCLA 5EPLA 4A3EH 1Q12A 3EVQA 1ENFA 1Q3LA 2I5HA 1SXTA 1DD2A 4PG3A 4PNYA 3NK9A 2FFKB 1PVOA 3QG1A 3FHWA 3JAMc 1ICWA 1YJWA 1XYIA 2WKCA 2F0FA 2JYOA 3FRPB 2A6HC 1XMQQ 1CHQD 1VMCA 1D5MC 2UUCL 3FPUB 3GTPB 5IGDA 1UEAB 1FYCA 4DAPA 2VUMG 5CBAE 1DOLA 3OIQA 1XMOQ 1Q82C 1AW7A 1P16A 3VR6A 3K7AB 4KD4A 3KLSA 4A3CH 2O2LD 5FLMG 1HFNA 2KUMA 5EPJA 2EYLA 2F0LA 1KLGD 4TQUS 2B2YA 4YCWA 4KK7A 3SVMA 4X64Q 4A3EB 4G4KA 4JI4L 2HDLA 1KAAA 3E3XA 3TP7A 3DLLA 2Q8TA 1VDZA 5C3EG 2D5DA 4NXNQ 2EY2A 2A5HA 1ET9A 4JV5Q 4HAEA 1N32Q 1I4HA 3ITPA 2WB1B 1G91A 1FGBD 1H9SA 4AQYQ 2UUBQ 3A8JE 4B3ML 4CDCC 1X65A 2K5DA 3E9IA 4IQZA 4A3DG 1DOMA 1YNNC 2VS1A 4R8IA 1Q1EA 4A3MH 3NBHA 1WTPA 1EOVA 3S1RH 3H3VC 2K6AA 5ELNA 3G48A 3GD7A 4X3KA 1IBKL 4L5QA 4BBRH 3HOYG 2PNHA 3A0JA 3TREA 1MSHA 5KYLA 2WIIB 5ELEA 1U4LA 2MQHA 3J7ZC 2R7ZH 1OXSC 2JA6H 3J81L 4UHVA 1D8LA 3SXHA 2BCOA 1WCMB 3HKZB 4K8IA 3DM3A 4DNIA 4XQQA 1XPUA 1V1OA 1U0LA 5IP9G 1NE3A 3TZUA 1NR2A 1SEBD 2HIVA 1J9OA 1XXGA 5K36G 1SE3A 2LY7A 1HFGA 4ZK9B 3DEPA 3MXGA 4HSPA 4O0AA 1IBLL 2F4VQ 4QIWE 3H0GH 3KBGA 4EQOA 4R9WA 3I72A 1LTRD 3TQYA 2NVYB 3U4VA 1BQQT 4RH6A 1BOSA 2WFWA 3P7JA 4IUQA 1LTLA 3RLOA 1Y1WG 1K8OA 2IHEA 1VQEA 5GROA 1I94L 5IIFA 3CW2C 1N36Q 2EPBA 4LF7Q 1Z6HA 5BN4A 1WTWA 5JPMC 3BZCA 4QQBX 1XTDA 5CV5A 4WORA 3TZDA 5M3MG 3PIOA 2MHVA 3J80c 3IL8A 2R93H 5E3FA 1TY0A 5EKLA 1K28A 1LM0A 4G7HC 5T1GA 2QGQA 3GTJB 3ER0A 3HOYH 3TS2A 1SMXA 2ICEC 5C3WA 1ENCA 4POFA 4DV7L 2MJ8A 1QVGA 3MWYW 5FKAC 2Z9HA 4ZUJA 4A3FG 5E4XA 3UI2A 1HNXL 1G6ZA 4C3HG 3KDFA 4U68A 2EYMA 5M5YH 5IT9c 3SK5A 5KNCA 4A3DH 2KOLA 1BKBA 3NHHA 4LFAQ 3H3VH 4NB3A 2F0DA 3ICEA 2SDFA 1EY0A 2NVYH 3S1QH 3PUXA 1QZHA 3GDEA 4F88A 3PV0A 4MNOA 4O1NA 2MO0A 2J7ZA 1VQAA 1K3BC 1VQBA 3ND9A 4DAYA 1HA6A 1EEID 4FDBA 2UXCQ 1MKHA 2X6GA 3LWEA 4IUTA 2RCFA 4LUOA 1I6VC 4QCLA 3GTOH 1S5BD 3G71A 1VQLA 2N78A 5JJKA 3NBHB 2PI2A 4PMWA 3TP6A 3OHXC 2E5LL 3OW7A 1OO9B 1FD7D 5DLQE 1VQHA 1VS0A 3PIO3 1STYA 2R7FA 2EXDA 4X65L 2B2WC 4XYOA 4IOCA 3M4QA 4DV4L 4WFN3 1E2ZA 1WTQA 5GADC 4QUCA 2JJQA 3RMHA 1LYLA 1JC7A 1CSQA 3M7GA 4FYDA 4F87A 3DWQA 1NY4A 4P74A 3QB3A 2B2TC 4NXML 1CKMA 2G5DA 3V2TA 3HZXA 4A3CG 2P5ZX 5KNDA 5IP9H 4RKBA 3CCVA 4DPGA 3EFXD 4C3HH 4LFBQ 3S14B 1YHAA 2CKZB 4MZ9A 1XNRL 3FDTA 1GUNA 1P8LA 3HOVG 3A5ZB 3KF6B 3TDQA 1SYGA 5JPNC 2E2IH 4HSVA 3T56B 2R3ZA 3A7AB 1D5XC 3M3YB 1OTCA 2B29A 2SEBD 4NXMQ 4OWWB 1BNZA 1IKLA 2EY6A 4Q5VA 3I4NG 1VCIA 4ZAIA 1AZPA 1BCPC 1VF7A 2JA8G 1S5FD 3IFDA 1BCPD 1LTID 3PGZA 1X32A 1AE2A 1JB3A 4X3SA 2CW0C 2Z4HA 5FJ8G 1EY7A 4GKKQ 3CAMA 3VR4A 1II3A 4MIUA 4FF4A 1YVCA 2H5XA 1X56A 4GS3A 3CCSA 3I4NB 4CKEA 3M4PA 4OX9L 2AKWB 2VY3A 4LMQD 1NNXA 3WOFA 1HRJA 5FO8B 2NTSA 1JE5A 1WJJA 2XVSA 5E1FA 1Q7YC 1VQ8A 3HRZC 4LFAL 2L0CA 4X62Q 1ZYRC 3Q6SA 2CH4A 4DR1L 2IX0A 2F0JA 1QNKA 3IRBA 4RKLA 1VQOA 2A8VA 1UE6A 1QNUA 2OT2A 2UXCL 4NP5A 3MFGA 5A2QL 2MNAA 3PO3H 1O7YA 1IYJB 2AQ3B 2E76C 1CKNA 5C0XH 1ZEQX 4UAIA 1H9RA 3PUWA 1JJGA 2JA8B 1SSOA 1E7ZA 2F0MA 3NQIA 1KLUD 3OYYA 1HNZL 5IODA 2WV6D 2YV5A 1WCMG 1H9JA 2XWBB 1VQCA 2B2VC 2WKDA 4L8JA 5HY6A 4HIMA 1QJOA 2X6LA 4LFCL 3I8ZA 4DV4Q 4DV1Q 3S1RB 3EN2A 1SE8A 1F2MA 4ZUIA 1RODA 2R92B 4PZ6A 2CW0D 1JOKA 1SNCA 3U9SA 4GN5A 3HOUG 4DF7A 2I5LX 4HCEA 3OWFA 1BVSA 1CA6A 2KBNA 4BWGB 4NKLA 5C4XH 1KD1C 3R2IA 5A35A 3U50C 3W3AA 3T1YL 4L5RC 2NBFA 4N9PA 2DN8A 1S5ED 1PRTF 5M3FG 1GUGA 2F0SA 1I4PA 2TMPA 1I4RA 4OIJA 3J81c 1N9WA 1MI2A 1NUCA 2K01A 5FO7B 2K1BA 3K7AH 5JAVA 1AP0A 1LTTD 4KHZA 1QUQA 1PFBA 3S15B 3BZKA 1VQ9A 4F7XA 1WD0A 3S2HB 3T1HL 2OTJA 2HCCA 1CSPA 3PIP3 2Z6BA 4UPAA 5EAYA 1W6JA 3J80i 3M4YA 2QA4A 1BCPB 1KL9A 2X69A 4JI2Q 2RSNA 1VQ4A 3CF5A 5CV4A 5M3FB 4RGOS 1J8IA 2F52A 1FNVA 5LHY1 1XJVA 4JI4Q 2MO1A 1BXTA 1C48A 3TP5A 4DR4Q 2RQXA 4NXNL 1EYCA 1H9KA 1Y1WB 1N32L 3RN2A 4JI0L 1LT4D 4DK6C 5JVG3 5CV8A 3HOUB 5J3BA 3CMEA 4RA8A 3M4OB 2N8NA 2N55A 2DY7A 1PYSB 4QB4A 4DUYQ 1HR0Q 4ABNA 4RCNA 3F8TA 3VR5A 4HCSA 2L4NA 3S1MB 1TS4A 5AJ3L 4XDXA 3RNUA 3CQZB 1CKNB 4XQJA 3F2BA 2SNSA 2IJ0A 5AFWA 1I4QA 2R6GA 5IT9L 4AIMA 1EIYB 4HIKA 3K5LA 1CK1A 2R93G 4X66L 4ZQ3A 4DV0L 4CKCA 4K5VA 1X54A 4KHVA 1B53A 2L11A 1YZ6A 4K5XA 4JK1C 5DAUA 2B8GA 2VUMB 1CFMA 3MEFA 4YHHL 2OWOA 2NYZD 2LFNA 4U673 3SDZA 4G7ZC 3PIPA 1YITA 5E4WC 2QDLA 4KLKA 4V190 4CHTB 4DR6Q 1KDAA 1D7QA 3KF8B 3W1GA 3M85A 4NDXA 1X3FA 3TBIB 4M8AA 4H0LC 4LK1C 1FJGL 1EQRA 1STBA 2R93B 3H0GB 3UDFA 3T53B 2FMCA 5F2DA 2O4XA 4C1NI 1STAA 4GN3B 2PNRC 2EZVA 3VYTA 3BDCA 1JQYD 4K14A 4OONA 2WAQE 1GHJA 3P20A 3Q23A 1DGSA 1PZKD 5C3EH 1ASZA 1EIHA 1W3SA 1ICFB 2YU9H 2IW3A 2RBMA 4DR7L 1JWMD 1VQJA 2K4KA 3WOEA 1SNDA 2JSOA 2RHQB 3VYUA 4BBRB 1A63A 4IPHA 1FVIA 5IP7G 3K57A 3W1BA 1IXRA 4YCVA 4BS9A 4DA2A 3OIPA 1EFID 2L12A 3JC66 4OELB 5E7NA 2I0QA 1STEA 2ZJQA 4DV3Q 3HOZB 4R4TA 1YEZA 1DZ1A 1HQMC 1M8AA 1SMYC 1AH9A 4C3IB 4ZLTF 2K33A 3T1HQ 2CFMA 2B3GA 3KK7A 4ZKCB 1B7YB 3X3MA 1XX8A 4HJ5A 1MGSA 3QIAA 1GOZA 3KJOA 1CZWA 1D1KA 2YYZA 3CC2A 4KJNA 4J15A 4A3IH 2IWHA 1C4QA 4KD3A 4CDDC 3GTKB 2YTVA 2JEBI 1I4XA 1Q1BA 1PH1A 3GTQB 3FKIG 1SJHD 4FXGC 1F2ZA
chains in the Genus database with same CATH topology
1S40A 4KHPL 1BBWA 4GNXB 3GO5A 1Q86C 2R7DA 1EIFA 3KLWA 1PH4A 1CUKA 3TQYA 3M7NA 3U4VA 3L2PA 4JI6L 2K14A 2K5HA 1A8VA 2WFWA 3I4OA 1CKOA 4JI6Q 5IYBH 3HOWG 2HHHQ 4A3LG 2D0PA 1VQ5A 2JA8H 1FL0A 1LTLA 3RLOA 4DV3L 1Y1WG 2IHEA 4LUZA 1VQEA 5GROA 1I94L 1WYDA 2VZAA 3CW2C 2WAQG 1N36Q 4OX9Q 1SROA 5IYCH 5LMUL 2D0OA 3ULJA 2Q2UA 4LF7L 4YY3L 3K81C 3GTJH 4LF7Q 2WB1E 3BZCA 4QQBX 2Q2IA 1XTDA 1YNXA 3CPFA 5H1SE 3CPWA 3OW2A 3M3YH 3PIOA 5M3MG 3J81i 1HR0L 3J80c 3UE1A 2R93H 2B63H 4BY1G 1LM0A 2UXDQ 5GAHC 1YHQA 3S17H 2QGQA 1VQGA 2KENA 3HKZG 1EUJA 3ER0A 3RLNA 3HOYH 4A3GH 3STBC 2ZM6L 3ZJYC 4LWCA 3TS2A 2WP8J 3KFUA 1SMXA 3CC7A 1PA6A 4LF5L 2Z6KA 4JBWA 4POFA 4DV7L 4JI7Q 4IJLA 1QVGA 1QVCA 3LGJA 1TWHH 1UE7A 4A3FG 4P71A 5JJLA 1HNXL 4GN4B 4H02A 3KDFA 4JOIA 1XPRA 1WCMH 3TS0A 5M5YH 5IT9c 4A3DH 1PV4A 3CP0A 1MJEA 2R92G 1PHJA 4BBSH 3RN5A 3PF4A 1BKBA 4WJ4A 4LFAQ 2PQAA 3H3VH 4JI3L 1X3EA 3Q8DA 4NB3A 3HOXG 3ICEA 1TXYA 2NVYH 1W2BA 2UUAL 3S1QH 1V9PA 4A3GG 3PUXA 1QZHA 1IBKQ 3GDEA 3PV0A 4MNOA 1PH3A 2MO0A 4RMFA 2QEXA 1Q81C 1IBLQ 1VQAA 1VQBA 2F4VL 4FDBA 4QGUA 2ZJPA 2UXCQ 1Y1VG 2EIFA 4A3FH 3M4OH 3S14H 1MKHA 4A3JH 1GO3E 1HH2P 5ELOA 4DR5Q 4B3TQ 4LUOA 4QL5A 1WFQA 1NMGA 1QZGA 1XNQQ 2GVAA 1WI5A 1N8RC 2VQEL 4DV6Q 3GTOH 3NEMA 1PH9A 1KIXA 1C9OA 3G71A 1KQSA 2N78A 1VQLA 1EWIA 2PMZE 4GKJL 4A3JG 5JJKA 3NBHB 4C3IH 2PI2A 4PMWA 1ASYA 1FJGQ 3I4MG 1B8AA 5IWAL 2E5LL 1MJCA 5LMUQ 3RZOH 4O2DA 3U4ZA 1N33L 4AYBG 3ULPA 2PI2E 3HOZH 4HJ9A 5DLQE 1VQHA 3HKZE 5IP7H 1VS0A 1JMCA 4X65Q 5HGQA 2IT1A 2R7FA 2EXDA 1E22A 4P75A 4X65L 1V1QA 5IYCG 2UXBL 1I5FA 1JJ2A 4IOCA 4KHPQ 4IFDG 3M4QA 3S24A 3CCEA 3CCQA 2UUAQ 4DV4L 5AJ3Q 1NBWA 5FLXc 5GADC 2GVBA 2JJQA 2ZM6Q 1NTGA 1IBML 4JV5L 1LYLA 5IYBG 1YJ9A 4BXXG 4OO1G 2HHHL 2VQEQ 4DV6L 1TWGH 4DAMA 1CSQA 1UWVA 4B3MQ 4GOPC 2GN5A 4XTCS 1L2FA 1NY4A 1T9HA 4P74A 2JA7H 1HNXQ 1X3GA 4OWTB 1H95A 3S15H 4NXML 1CKMA 3I2ZA 1XMQL 1RL2A 4MTNA 3EBEA 3KF6A 4A3CG 4KI0A 5C4JH 4K0KQ 2C35B 3E9HA 5IP9H 1Z9FA 4K0KL 3I7FA 2VW9A 2Y0SG 3CCVA 4LFBL 1K0RA 4DPGA 4C3HH 3HFZB 4JOIC 4GNXA 1XMOL 4LFBQ 4OXPA 2ZTCA 5C4XG 1YHAA 2UXDL 2CKZB 3AFQA 4MZ9A 1P8LA 2BA0A 1PYBA 5C44H 4LF9Q 1XNRL 3A5ZB 1G291 3KF6B 5M5XH 3U58A 1SFOH 4L5SA 3BU2A 4GKKL 4A93G 1SR3A 1IBMQ 2E2IH 4GNXC 2KHIA 2N49A 1VQMA 1KAWA 1MIUA 1L0WA 3F2DA 4B3SQ 3UDIA 1X6OA 1VQKA 1C0AA 1GD7A 2HT1A 3HOWH 2AMCB 4A93H 1YIJA 1OTCA 1UE1A 2B29A 4NXMQ 2VUMH 4DR5L 2YTYA 4OWWB 4DV5Q 5IYDG 2RF4A 2VQFL 2D62A 1E1TA 2E2JH 2ZTEA 4A3KH 1YJNA 4DR7Q 4JI3Q 3I4NG 1RIPA 1VCIA 2RCNA 1Y14B 4X62L 1NJIC 2CWPA 4JCVE 4ME3A 4A75A 1M1KC 4APVA 5JEAJ 4YY3Q 1EYGA 2JA8G 4A3BH 1QUQB 1N33Q 4YCUA 4LF6Q 2BH8A 3GTQH 3PGZA 4IPGA 4JBJA 3I4NH 2E2HH 1AE2A 2ATWA 2UU9L 3CMAA 5FJ8G 2K5NA 2OQ0A 4LF9L 5IE8A 4JI5Q 3KDFB 4GKKQ 3CAMA 3S1MH 3F1ZA 2RHSB 4B3TL 1YVCA 4DUZQ 2H5XA 2NN6I 1S72A 1X56A 2JQOA 5M3FH 4GS3A 2YTXA 4BY1H 3CCSA 3FP9A 4NPSA 1VQ7A 2CCZA 4XIGS 3M4PA 3S2HH 5C0XJ 1JT8A 1N36L 4LF8L 2JK8A 4OX9L 2UUBL 2I5MX 2OTLA 2AKWB 2VY3A 5GAGC 3GTGH 5GQOA 3S2DH 5FLMH 4AH6A 2AHOB 2JA5H 4JC0A 4YWMA 1E1OA 1JE5A 3A74A 1WJJA 1Q7YC 2ZJRA 4OWXB 1VQ8A 1L1OA 4HIDA 1UE5A 3CQZH 4LFAL 4X62Q 4JI1L 2UU9Q 4GLAC 1K8AC 3T1YQ 1K73C 2KCMA 4DR1L 1B70B 3J81j 2IX0A 4LF6L 4DV1L 1XNRQ 1L1OC 2LXKA 5C44G 1O7IA 4YWKA 1JB7A 3IRBA 3G6EA 5JJIA 1L1OB 1VQOA 2A8VA 1UE6A 4OO1I 3PUZA 4Y7NH 2UXCL 3RLFA 4X64L 1KC8C 4JI5L 3ERSX 4JI8L 5BR8L 2MNAA 1E3PA 3PO3H 4X6AH 3MXNB 3H0GG 5BR8Q 3S1NH 3STBD 4IFDI 1IYJB 2HIXA 1Z47A 3KOJA 3J7A5 4JBKA 4LW1A 1CKNA 2Q2TA 2CQOA 4IOAA 1JJCB 3PUWA 3CD6A 2AWNA 1JJGA 1YHBA 1E7ZA 3I55A 4A3IG 1J5EL 4IPDA 3UE0A 2A19A 3HKSA 3OYYA 1HZAA 1PH5A 3K8AA 4BY7G 1HNZL 4JI2L 1KRSA 2YV5A 1WCMG 4DK3C 4C3JH 2K52A 3F2CA 1VQCA 4UP8A 1HZCA 3I4MH 5HY6A 4HIMA 3SGIA 4LFCQ 3GTMH 1OXUA 2UXBQ 4LFCL 4EX5A 4DV4Q 4R4CA 3A5UA 1YI2A 4DV1Q 2Q2HA 2WB1G 3EN2A 1SE8A 3G4SA 4JG2A 3PF5A 1X55A 3PSIA 2IY5B 4A4IA 4PZ6A 3WWVA 3W5OA 1FGUA 4DV2L 4DV7Q 4JI7L 1Q8KA 4GN5A 3HOUG 2Y0SE 4JI0Q 2I5LX 3I56A 1N34L 4GLXA 1TWFH 5IY0A 2CWAA 4DKAC 1K9MC 1BVSA 2KBNA 4DR3Q 1Q46A 1GM5A 5C4XH 1HJPA 1KD1C 1VQDA 4IJHA 1Y1WH 4Y52H 4DR6L 2ZTDA 2N3SA 3U50C 4QJFA 4C2MH 4BBSG 4A76A 3T1YL 2K5VA 1HNWL 3AQQA 4L5RC 4DUZL 3E0EA 2A1AA 4DR4L 5M3FG 1VQNA 3GTKH 3K7UC 3PUYA 4DV2Q 1M90C 2ID0A 3J81c 3H15A 1N9WA 1J6QA 3FKIH 4LNQA 4HIOA 5FJ8H 2JA6G 3JAMi 1I3QH 1HZBA 3K7AH 3PUVA 4A3KG 1VQ6A 2NZHA 1QUQA 4KHZA 2LSSA 2HQLA 1X9NA 3L7ZC 3BZKA 2AWOA 3D0FA 3OTOQ 1VQ9A 5M5WH 4DR3L 4A3BG 2OTJA 3OTOL 3T1HL 2ASBA 1VQFA 4P72A 1SLJA 1CSPA 1G51A 2XGTA 4UPAA 3M9BA 5EAYA 2BH2A 4QY7A 1N34Q 3PO2G 3RR5A 3J80i 4AQYL 2QA4A 3RZDH 1EQQA 2B63G 2R7ZG 5IYDH 3HOVG 1KL9A 4HJ7A 4LUVA 1HNZQ 4JI2Q 4JYAL 2NVQH 1PH6A 1VQ4A 1BBUA 3NENA 2Z0SA 2IHFA 2VL6A 3CF5A 2ALYB 1LUZA 2F52A 4UY8C 1G6PA 4GOPA 1XJVA 3CCMA 4WJ3M 1K83H 5M3MH 4JI4Q 1U5KA 2MO1A 1PH2A 3CCJA 3K80C 3PCOB 3AFPA 4DR4Q 4NXNL 1PH7A 2IX1A 1EFWA 1SRUA 1N32L 2JEAI 4L5TA 3TRZA 1TWCH 3RN2A 2NVTH 1YBYA 4JI0L 1QVFA 4DK6C 4LF4Q 1IL2A 1V43A 2DUDA 1HR0W 4LF4L 4R4QA 4PZ7A 2E5LQ 4TVAB 4JYAQ 2K75A 5J3BA 1HZ9A 1SN8A 3CMEA 2N8NA 5C0XG 3NELA 1OXXK 3B6YA 4DUYL 2XTIA 4DR2L 1PYSB 3ULLA 4DUYQ 4DR2Q 1HR0Q 1VQPA 4BY7H 1OXTA 3F8TA 3CCLA 1HNWQ 5AJ3L 3CCUA 1AE3A 2JA9A 3RNUA 4A3EH 1CKNB 1A0IA 2DGYA 3F2BA 1Q12A 4IO9A 2R6GA 4AYBE 2I5HA 4AIMA 1UEBA 4R4OA 4HIKA 1EIYB 4PZ8A 4PG3A 4DV0Q 3GTPH 2R93G 4X66L 2VNUD 4DV0L 1PVOA 3FHWA 3JAMc 3H3VI 1X54A 3EIVA 2MFIA 2F3IA 3TEHB 1YJWA 1YZ6A 4GLVB 2KHJA 2JA5G 3AEVA 3MEFA 1XMQQ 4YHHL 2OWOA 4HJ8A 2UUCL 3HOZG 4YHHQ 3PIPA 1YITA 4KLKA 4DR6Q 4JI1Q 2VUMG 1D7QA 3KF8B 3W1GA 3M85A 3HOVH 4GKJQ 4RG1A 1K3RA 1X3FA 1I94Q 1XMOQ 1Q82C 1P16A 1FJGL 3UDXA 1S3OA 4A3CH 1IZ6A 2V1CC 5FLMG 1EQRA 4A3EG 3CCRA 4POGA 4UP9A 3D31A 2E8GA 3KYHC 3UDFA 4TQUS 4R4IA 4YCWA 4BA1I 3BJUA 4X64Q 4GN3B 5GAEC 3S16H 4JI8Q 4A3MG 2K50A 4JI4L 4A3LH 2PQAB 4B3RQ 3DLLA 4OONA 2WAQE 5C3EG 4NXNQ 1I50H 1DGSA 4YWLA 1XNQL 3GTLH 3AYHB 4JV5Q 3KJPA 4DV5L 5C3EH 4IPCA 4X66Q 1ASZA 1N32Q 1KHIA 1W3SA 5JEAG 1J5EQ 2YU9H 4LF8Q 4DAYB 3HOUH 2BA1A 4AQYQ 2UUBQ 4B3ML 3PO3G 2EQSA 3HOXH 4DR7L 1X65A 1GKHA 2ES2A 3E9IA 1PFSA 1VQJA 2K4KA 4A3DG 3CC4A 1TWAH 2RHQB 2L15A 2VS1A 1A63A 3CXCA 1Q1EA 4A3MH 3UDGA 3VDYA 4IPHA 4JBMA 1KXLA 2OCEA 1FVIA 5IP7G 1XPOA 4B3RL 1EOVA 1OXVA 1NMFA 2FXQA 3W1BA 3S1RH 1IXRA 3G48A 3GD7A 4YCVA 5ELNA 4B3SL 1GVPA 1IBKL 1C7YA 1K8GA 4IFDJ 2JE6I 4L5QA 2OQKA 4LF5Q 5LMNQ 4BBRH 4ALPA 1R9TH 3HOYG 2PNHA 3A0JA 3TREA 3L0OA 3JC66 4HJAA 5E7NA 2I0QA 2ZJQA 4DV3Q 1Y1VH 1YEZA 4R4TA 4P73A 2NN6G 1VQIA 3PO2H 2NZOA 2KCTA 1AH9A 2MQHA 4BBRG 5LMNW 3J7ZC 3T1HQ 2CFMA 2R7ZH 2B3GA 1OXSC 2UUCQ 2NVXH 2JA6H 1B7YB 1D8LA 5C0XI 4HJ5A 4GOPB 4R1JA 4EQ5A 4DNIA 3DM3A 2JA7G 3KJOA 2VQFQ 1XPUA 2YYZA 1PH8A 3CC2A 1U0LA 5IP9G 2R92H 1I6HH 2Z6KC 4J15A 5IWAQ 4A3IH 4BA2I 1NE3A 1KRTA 4DR1Q 2HIVA 5K36G 2YTVA 2JEBI 1Q1BA 1PH1A 4BXXH 1E24A 5LMNL 1WOCA 3FKIG 4O0AA 1A62A 1IBLL 3K0XA 4UP7A 2F4VQ 2LXJA 4QIWE 3H0GH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S40 A;  4KHP L;  1BBW A;  4GNX B;  3GO5 A;  1Q86 C;  2R7D A;  1EIF A;  3KLW A;  1PH4 A;  1CUK A;  3TQY A;  3M7N A;  3U4V A;  3L2P A;  4JI6 L;  2K14 A;  2K5H A;  1A8V A;  2WFW A;  3I4O A;  1CKO A;  4JI6 Q;  5IYB H;  3HOW G;  2HHH Q;  4A3L G;  2D0P A;  1VQ5 A;  2JA8 H;  1FL0 A;  1LTL A;  3RLO A;  4DV3 L;  1Y1W G;  2IHE A;  4LUZ A;  1VQE A;  5GRO A;  1I94 L;  1WYD A;  2VZA A;  3CW2 C;  2WAQ G;  1N36 Q;  4OX9 Q;  1SRO A;  5IYC H;  5LMU L;  2D0O A;  3ULJ A;  2Q2U A;  4LF7 L;  4YY3 L;  3K81 C;  3GTJ H;  4LF7 Q;  2WB1 E;  3BZC A;  4QQB X;  2Q2I A;  1XTD A;  1YNX A;  3CPF A;  5H1S E;  3CPW A;  3OW2 A;  3M3Y H;  3PIO A;  5M3M G;  3J81 i;  1HR0 L;  3J80 c;  3UE1 A;  2R93 H;  2B63 H;  4BY1 G;  1LM0 A;  2UXD Q;  5GAH C;  1YHQ A;  3S17 H;  2QGQ A;  1VQG A;  2KEN A;  3HKZ G;  1EUJ A;  3ER0 A;  3RLN A;  3HOY H;  4A3G H;  3STB C;  2ZM6 L;  3ZJY C;  4LWC A;  3TS2 A;  2WP8 J;  3KFU A;  1SMX A;  3CC7 A;  1PA6 A;  4LF5 L;  2Z6K A;  4JBW A;  4POF A;  4DV7 L;  4JI7 Q;  4IJL A;  1QVG A;  1QVC A;  3LGJ A;  1TWH H;  1UE7 A;  4A3F G;  4P71 A;  5JJL A;  1HNX L;  4GN4 B;  4H02 A;  3KDF A;  4JOI A;  1XPR A;  1WCM H;  3TS0 A;  5M5Y H;  5IT9 c;  4A3D H;  1PV4 A;  3CP0 A;  1MJE A;  2R92 G;  1PHJ A;  4BBS H;  3RN5 A;  3PF4 A;  1BKB A;  4WJ4 A;  4LFA Q;  2PQA A;  3H3V H;  4JI3 L;  1X3E A;  3Q8D A;  4NB3 A;  3HOX G;  3ICE A;  1TXY A;  2NVY H;  1W2B A;  2UUA L;  3S1Q H;  1V9P A;  4A3G G;  3PUX A;  1QZH A;  1IBK Q;  3GDE A;  3PV0 A;  4MNO A;  1PH3 A;  2MO0 A;  4RMF A;  2QEX A;  1Q81 C;  1IBL Q;  1VQA A;  1VQB A;  2F4V L;  4FDB A;  4QGU A;  2ZJP A;  2UXC Q;  1Y1V G;  2EIF A;  4A3F H;  3M4O H;  3S14 H;  1MKH A;  4A3J H;  1GO3 E;  1HH2 P;  5ELO A;  4DR5 Q;  4B3T Q;  4LUO A;  4QL5 A;  1WFQ A;  1NMG A;  1QZG A;  1XNQ Q;  2GVA A;  1WI5 A;  1N8R C;  2VQE L;  4DV6 Q;  3GTO H;  3NEM A;  1PH9 A;  1KIX A;  1C9O A;  3G71 A;  1KQS A;  2N78 A;  1VQL A;  1EWI A;  2PMZ E;  4GKJ L;  4A3J G;  5JJK A;  3NBH B;  4C3I H;  2PI2 A;  4PMW A;  1ASY A;  1FJG Q;  3I4M G;  1B8A A;  5IWA L;  2E5L L;  1MJC A;  5LMU Q;  3RZO H;  4O2D A;  3U4Z A;  1N33 L;  4AYB G;  3ULP A;  2PI2 E;  3HOZ H;  4HJ9 A;  5DLQ E;  1VQH A;  3HKZ E;  5IP7 H;  1VS0 A;  1JMC A;  4X65 Q;  5HGQ A;  2IT1 A;  2R7F A;  2EXD A;  1E22 A;  4P75 A;  4X65 L;  1V1Q A;  5IYC G;  2UXB L;  1I5F A;  1JJ2 A;  4IOC A;  4KHP Q;  4IFD G;  3M4Q A;  3S24 A;  3CCE A;  3CCQ A;  2UUA Q;  4DV4 L;  5AJ3 Q;  1NBW A;  5FLX c;  5GAD C;  2GVB A;  2JJQ A;  2ZM6 Q;  1NTG A;  1IBM L;  4JV5 L;  1LYL A;  5IYB G;  1YJ9 A;  4BXX G;  4OO1 G;  2HHH L;  2VQE Q;  4DV6 L;  1TWG H;  4DAM A;  1CSQ A;  1UWV A;  4B3M Q;  4GOP C;  2GN5 A;  4XTC S;  1L2F A;  1NY4 A;  1T9H A;  4P74 A;  2JA7 H;  1HNX Q;  1X3G A;  4OWT B;  1H95 A;  3S15 H;  4NXM L;  1CKM A;  3I2Z A;  1XMQ L;  1RL2 A;  4MTN A;  3EBE A;  3KF6 A;  4A3C G;  4KI0 A;  5C4J H;  4K0K Q;  2C35 B;  3E9H A;  5IP9 H;  1Z9F A;  4K0K L;  3I7F A;  2VW9 A;  2Y0S G;  3CCV A;  4LFB L;  1K0R A;  4DPG A;  4C3H H;  3HFZ B;  4JOI C;  4GNX A;  1XMO L;  4LFB Q;  4OXP A;  2ZTC A;  5C4X G;  1YHA A;  2UXD L;  2CKZ B;  3AFQ A;  4MZ9 A;  1P8L A;  2BA0 A;  1PYB A;  5C44 H;  4LF9 Q;  1XNR L;  3A5Z B;  1G29 1;  3KF6 B;  5M5X H;  3U58 A;  1SFO H;  4L5S A;  3BU2 A;  4GKK L;  4A93 G;  1SR3 A;  1IBM Q;  2E2I H;  4GNX C;  2KHI A;  2N49 A;  1VQM A;  1KAW A;  1MIU A;  1L0W A;  3F2D A;  4B3S Q;  3UDI A;  1X6O A;  1VQK A;  1C0A A;  1GD7 A;  2HT1 A;  3HOW H;  2AMC B;  4A93 H;  1YIJ A;  1OTC A;  1UE1 A;  2B29 A;  4NXM Q;  2VUM H;  4DR5 L;  2YTY A;  4OWW B;  4DV5 Q;  5IYD G;  2RF4 A;  2VQF L;  2D62 A;  1E1T A;  2E2J H;  2ZTE A;  4A3K H;  1YJN A;  4DR7 Q;  4JI3 Q;  3I4N G;  1RIP A;  1VCI A;  2RCN A;  1Y14 B;  4X62 L;  1NJI C;  2CWP A;  4JCV E;  4ME3 A;  4A75 A;  1M1K C;  4APV A;  5JEA J;  4YY3 Q;  1EYG A;  2JA8 G;  4A3B H;  1QUQ B;  1N33 Q;  4YCU A;  4LF6 Q;  2BH8 A;  3GTQ H;  3PGZ A;  4IPG A;  4JBJ A;  3I4N H;  2E2H H;  1AE2 A;  2ATW A;  2UU9 L;  3CMA A;  5FJ8 G;  2K5N A;  2OQ0 A;  4LF9 L;  5IE8 A;  4JI5 Q;  3KDF B;  4GKK Q;  3CAM A;  3S1M H;  3F1Z A;  2RHS B;  4B3T L;  1YVC A;  4DUZ Q;  2H5X A;  2NN6 I;  1S72 A;  1X56 A;  2JQO A;  5M3F H;  4GS3 A;  2YTX A;  4BY1 H;  3CCS A;  3FP9 A;  4NPS A;  1VQ7 A;  2CCZ A;  4XIG S;  3M4P A;  3S2H H;  5C0X J;  1JT8 A;  1N36 L;  4LF8 L;  2JK8 A;  4OX9 L;  2UUB L;  2I5M X;  2OTL A;  2AKW B;  2VY3 A;  5GAG C;  3GTG H;  5GQO A;  3S2D H;  5FLM H;  4AH6 A;  2AHO B;  2JA5 H;  4JC0 A;  4YWM A;  1E1O A;  1JE5 A;  3A74 A;  1WJJ A;  1Q7Y C;  2ZJR A;  4OWX B;  1VQ8 A;  1L1O A;  4HID A;  1UE5 A;  3CQZ H;  4LFA L;  4X62 Q;  4JI1 L;  2UU9 Q;  4GLA C;  1K8A C;  3T1Y Q;  1K73 C;  2KCM A;  4DR1 L;  1B70 B;  3J81 j;  2IX0 A;  4LF6 L;  4DV1 L;  1XNR Q;  1L1O C;  2LXK A;  5C44 G;  1O7I A;  4YWK A;  1JB7 A;  3IRB A;  3G6E A;  5JJI A;  1L1O B;  1VQO A;  2A8V A;  1UE6 A;  4OO1 I;  3PUZ A;  4Y7N H;  2UXC L;  3RLF A;  4X64 L;  1KC8 C;  4JI5 L;  3ERS X;  4JI8 L;  5BR8 L;  2MNA A;  1E3P A;  3PO3 H;  4X6A H;  3MXN B;  3H0G G;  5BR8 Q;  3S1N H;  3STB D;  4IFD I;  1IYJ B;  2HIX A;  1Z47 A;  3KOJ A;  3J7A 5;  4JBK A;  4LW1 A;  1CKN A;  2Q2T A;  2CQO A;  4IOA A;  1JJC B;  3PUW A;  3CD6 A;  2AWN A;  1JJG A;  1YHB A;  1E7Z A;  3I55 A;  4A3I G;  1J5E L;  4IPD A;  3UE0 A;  2A19 A;  3HKS A;  3OYY A;  1HZA A;  1PH5 A;  3K8A A;  4BY7 G;  1HNZ L;  4JI2 L;  1KRS A;  2YV5 A;  1WCM G;  4DK3 C;  4C3J H;  2K52 A;  3F2C A;  1VQC A;  4UP8 A;  1HZC A;  3I4M H;  5HY6 A;  4HIM A;  3SGI A;  4LFC Q;  3GTM H;  1OXU A;  2UXB Q;  4LFC L;  4EX5 A;  4DV4 Q;  4R4C A;  3A5U A;  1YI2 A;  4DV1 Q;  2Q2H A;  2WB1 G;  3EN2 A;  1SE8 A;  3G4S A;  4JG2 A;  3PF5 A;  1X55 A;  3PSI A;  2IY5 B;  4A4I A;  4PZ6 A;  3WWV A;  3W5O A;  1FGU A;  4DV2 L;  4DV7 Q;  4JI7 L;  1Q8K A;  4GN5 A;  3HOU G;  2Y0S E;  4JI0 Q;  2I5L X;  3I56 A;  1N34 L;  4GLX A;  1TWF H;  5IY0 A;  2CWA A;  4DKA C;  1K9M C;  1BVS A;  2KBN A;  4DR3 Q;  1Q46 A;  1GM5 A;  5C4X H;  1HJP A;  1KD1 C;  1VQD A;  4IJH A;  1Y1W H;  4Y52 H;  4DR6 L;  2ZTD A;  2N3S A;  3U50 C;  4QJF A;  4C2M H;  4BBS G;  4A76 A;  3T1Y L;  2K5V A;  1HNW L;  3AQQ A;  4L5R C;  4DUZ L;  3E0E A;  2A1A A;  4DR4 L;  5M3F G;  1VQN A;  3GTK H;  3K7U C;  3PUY A;  4DV2 Q;  1M90 C;  2ID0 A;  3J81 c;  3H15 A;  1N9W A;  1J6Q A;  3FKI H;  4LNQ A;  4HIO A;  5FJ8 H;  2JA6 G;  3JAM i;  1I3Q H;  1HZB A;  3K7A H;  3PUV A;  4A3K G;  1VQ6 A;  2NZH A;  1QUQ A;  4KHZ A;  2LSS A;  2HQL A;  1X9N A;  3L7Z C;  3BZK A;  2AWO A;  3D0F A;  3OTO Q;  1VQ9 A;  5M5W H;  4DR3 L;  4A3B G;  2OTJ A;  3OTO L;  3T1H L;  2ASB A;  1VQF A;  4P72 A;  1SLJ A;  1CSP A;  1G51 A;  2XGT A;  4UPA A;  3M9B A;  5EAY A;  2BH2 A;  4QY7 A;  1N34 Q;  3PO2 G;  3RR5 A;  3J80 i;  4AQY L;  2QA4 A;  3RZD H;  1EQQ A;  2B63 G;  2R7Z G;  5IYD H;  3HOV G;  1KL9 A;  4HJ7 A;  4LUV A;  1HNZ Q;  4JI2 Q;  4JYA L;  2NVQ H;  1PH6 A;  1VQ4 A;  1BBU A;  3NEN A;  2Z0S A;  2IHF A;  2VL6 A;  3CF5 A;  2ALY B;  1LUZ A;  2F52 A;  4UY8 C;  1G6P A;  4GOP A;  1XJV A;  3CCM A;  4WJ3 M;  1K83 H;  5M3M H;  4JI4 Q;  1U5K A;  2MO1 A;  1PH2 A;  3CCJ A;  3K80 C;  3PCO B;  3AFP A;  4DR4 Q;  4NXN L;  1PH7 A;  2IX1 A;  1EFW A;  1SRU A;  1N32 L;  2JEA I;  4L5T A;  3TRZ A;  1TWC H;  3RN2 A;  2NVT H;  1YBY A;  4JI0 L;  1QVF A;  4DK6 C;  4LF4 Q;  1IL2 A;  1V43 A;  2DUD A;  1HR0 W;  4LF4 L;  4R4Q A;  4PZ7 A;  2E5L Q;  4TVA B;  4JYA Q;  2K75 A;  5J3B A;  1HZ9 A;  1SN8 A;  3CME A;  2N8N A;  5C0X G;  3NEL A;  1OXX K;  3B6Y A;  4DUY L;  2XTI A;  4DR2 L;  1PYS B;  3ULL A;  4DUY Q;  4DR2 Q;  1HR0 Q;  1VQP A;  4BY7 H;  1OXT A;  3F8T A;  3CCL A;  1HNW Q;  5AJ3 L;  3CCU A;  1AE3 A;  2JA9 A;  3RNU A;  4A3E H;  1CKN B;  1A0I A;  2DGY A;  3F2B A;  1Q12 A;  4IO9 A;  2R6G A;  4AYB E;  2I5H A;  4AIM A;  1UEB A;  4R4O A;  4HIK A;  1EIY B;  4PZ8 A;  4PG3 A;  4DV0 Q;  3GTP H;  2R93 G;  4X66 L;  2VNU D;  4DV0 L;  1PVO A;  3FHW A;  3JAM c;  3H3V I;  1X54 A;  3EIV A;  2MFI A;  2F3I A;  3TEH B;  1YJW A;  1YZ6 A;  4GLV B;  2KHJ A;  2JA5 G;  3AEV A;  3MEF A;  1XMQ Q;  4YHH L;  2OWO A;  4HJ8 A;  2UUC L;  3HOZ G;  4YHH Q;  3PIP A;  1YIT A;  4KLK A;  4DR6 Q;  4JI1 Q;  2VUM G;  1D7Q A;  3KF8 B;  3W1G A;  3M85 A;  3HOV H;  4GKJ Q;  4RG1 A;  1K3R A;  1X3F A;  1I94 Q;  1XMO Q;  1Q82 C;  1P16 A;  1FJG L;  3UDX A;  1S3O A;  4A3C H;  1IZ6 A;  2V1C C;  5FLM G;  1EQR A;  4A3E G;  3CCR A;  4POG A;  4UP9 A;  3D31 A;  2E8G A;  3KYH C;  3UDF A;  4TQU S;  4R4I A;  4YCW A;  4BA1 I;  3BJU A;  4X64 Q;  4GN3 B;  5GAE C;  3S16 H;  4JI8 Q;  4A3M G;  2K50 A;  4JI4 L;  4A3L H;  2PQA B;  4B3R Q;  3DLL A;  4OON A;  2WAQ E;  5C3E G;  4NXN Q;  1I50 H;  1DGS A;  4YWL A;  1XNQ L;  3GTL H;  3AYH B;  4JV5 Q;  3KJP A;  4DV5 L;  5C3E H;  4IPC A;  4X66 Q;  1ASZ A;  1N32 Q;  1KHI A;  1W3S A;  5JEA G;  1J5E Q;  2YU9 H;  4LF8 Q;  4DAY B;  3HOU H;  2BA1 A;  4AQY Q;  2UUB Q;  4B3M L;  3PO3 G;  2EQS A;  3HOX H;  4DR7 L;  1X65 A;  1GKH A;  2ES2 A;  3E9I A;  1PFS A;  1VQJ A;  2K4K A;  4A3D G;  3CC4 A;  1TWA H;  2RHQ B;  2L15 A;  2VS1 A;  1A63 A;  3CXC A;  1Q1E A;  4A3M H;  3UDG A;  3VDY A;  4IPH A;  4JBM A;  1KXL A;  2OCE A;  1FVI A;  5IP7 G;  1XPO A;  4B3R L;  1EOV A;  1OXV A;  1NMF A;  2FXQ A;  3W1B A;  3S1R H;  1IXR A;  3G48 A;  3GD7 A;  4YCV A;  5ELN A;  4B3S L;  1GVP A;  1IBK L;  1C7Y A;  1K8G A;  4IFD J;  2JE6 I;  4L5Q A;  2OQK A;  4LF5 Q;  5LMN Q;  4BBR H;  4ALP A;  1R9T H;  3HOY G;  2PNH A;  3A0J A;  3TRE A;  3L0O A;  3JC6 6;  4HJA A;  5E7N A;  2I0Q A;  2ZJQ A;  4DV3 Q;  1Y1V H;  1YEZ A;  4R4T A;  4P73 A;  2NN6 G;  1VQI A;  3PO2 H;  2NZO A;  2KCT A;  1AH9 A;  2MQH A;  4BBR G;  5LMN W;  3J7Z C;  3T1H Q;  2CFM A;  2R7Z H;  2B3G A;  1OXS C;  2UUC Q;  2NVX H;  2JA6 H;  1B7Y B;  1D8L A;  5C0X I;  4HJ5 A;  4GOP B;  4R1J A;  4EQ5 A;  4DNI A;  3DM3 A;  2JA7 G;  3KJO A;  2VQF Q;  1XPU A;  2YYZ A;  1PH8 A;  3CC2 A;  1U0L A;  5IP9 G;  2R92 H;  1I6H H;  2Z6K C;  4J15 A;  5IWA Q;  4A3I H;  4BA2 I;  1NE3 A;  1KRT A;  4DR1 Q;  2HIV A;  5K36 G;  2YTV A;  2JEB I;  1Q1B A;  1PH1 A;  4BXX H;  1E24 A;  5LMN L;  1WOC A;  3FKI G;  4O0A A;  1A62 A;  1IBL L;  3K0X A;  4UP7 A;  2F4V Q;  2LXJ A;  4QIW E;  3H0G H; 
#chains in the Genus database with same CATH topology
 4KHP L;  1BBW A;  1EQT A;  3GO5 A;  4LJZ C;  4IFD H;  2K04 A;  1EIF A;  2R7D A;  2E2J B;  3L2P A;  1NAP A;  2K5H A;  1A8V A;  4C3H B;  1Y8N B;  1GUW A;  1LO5 D;  4JI6 Q;  3HOW G;  4O42 A;  4LUZ A;  3GTL B;  2A73 B;  1EOT A;  1CT1 D;  1SRO A;  5IYC H;  1EIG A;  2D0O A;  3ULJ A;  1H9M A;  2AQ1 B;  1SNP A;  3M3Y H;  3OW2 A;  2DJF C;  3IFT A;  4IUR A;  2I07 B;  2A74 C;  3J81 i;  5JVH 3;  1HR0 L;  3N6R A;  3H6M A;  2B63 H;  2UXD Q;  2EYJ A;  3S17 H;  1XWE A;  4A3G H;  1SYB A;  2B2U A;  1Y69 U;  1DM0 B;  1DYQ A;  4IUU A;  2I46 A;  2Z6K A;  4JI7 Q;  1ILP A;  1FR3 A;  3LGJ A;  1UE7 A;  4P71 A;  3SR1 A;  1SDF A;  3IKJ A;  2F3V A;  4H02 A;  4JOI A;  5C5L A;  1CI3 M;  1XPR A;  4FVM A;  3D4W A;  4ULL A;  1A15 A;  2PCF B;  3CP0 A;  2BDN A;  3PF4 A;  3D6W A;  4WJ4 A;  1CTM A;  3CKI B;  1F2Y A;  1TXY A;  4DK0 A;  4KY6 A;  4PV1 C;  1ONL A;  1IBK Q;  3A56 A;  1MBY A;  1PH3 A;  2E2H B;  1A2U A;  2ZJP A;  4RHS A;  2F3W A;  2IL8 A;  2PYK A;  4FO2 A;  1EY9 A;  4QL5 A;  2GVA A;  1WI5 A;  2LS0 1;  4DV6 Q;  5EBD A;  3D4D A;  4GKJ L;  1C9O A;  1Y8O B;  4FXD A;  5CYU A;  1IW7 C;  1NCV A;  1ASY A;  1JCK B;  1MJC A;  1QE6 A;  3A8K E;  3MXN A;  4XT1 B;  3U4Z A;  3RZO H;  5J22 A;  3HOZ H;  1SE4 A;  3HKZ E;  3P75 A;  3BYT B;  1V1Q A;  1JJ2 A;  4IFD G;  1W6K A;  3N52 A;  2AQ2 B;  1NBW A;  5FLX c;  2DY8 A;  1IBM L;  5IYB G;  4OO1 G;  4DV6 L;  4GZY C;  5FLX E;  1EL0 A;  4XTC S;  4EVO A;  4FF1 A;  1L2F A;  1T9H A;  1G8Z D;  4QMG A;  1A3U A;  1XMQ L;  1RL2 A;  1F9S A;  2E74 C;  2MGS A;  3EBE A;  4MTN A;  4KI0 A;  4K0K Q;  3E9H A;  4PMC A;  1EY4 A;  5EJW A;  2F0T A;  2A6E D;  1SYC A;  1NR4 A;  1S4Z A;  3U9O A;  1XMO L;  2ZTC A;  4ILW A;  5G3L F;  4TRD A;  4CBV A;  2BA0 A;  2CHB D;  1HQR D;  1G29 1;  1SYF A;  3FKI B;  3BU2 A;  4A93 G;  1SR3 A;  1IBM Q;  4KN4 C;  1KNA A;  1FNU A;  2KHI A;  2N49 A;  1MIU A;  1VQM A;  1LAB A;  3F2D A;  1VQK A;  2QDB A;  2KCN A;  1SNQ A;  4EQP A;  4A93 H;  1KDC A;  2VUM H;  1LT6 D;  2L55 A;  1O80 A;  1AFP A;  2K28 A;  4C3J G;  1SNM A;  1MHW C;  2VQF L;  3V96 A;  1E1T A;  5DEH A;  5EGT A;  1YJN A;  2K5W A;  3HOX B;  2G9H D;  3DUZ A;  3A54 A;  4RFB A;  4A3B H;  4RGT A;  1EWH A;  2AUJ D;  1YNJ C;  3QO2 A;  2ZT9 C;  1N33 Q;  4LF6 Q;  2O5J C;  3V05 A;  4IPG A;  1Q8I A;  4JBJ A;  2E2H H;  4G7O C;  3EA6 A;  3MAQ A;  2OQ0 A;  1JE4 A;  5IE8 A;  4JI5 Q;  3KDF B;  3F1Z A;  2NN6 I;  3JAM E;  2JQO A;  5M3F H;  2YTX A;  4BY1 H;  2Z4I A;  2EJG C;  4AYB B;  2CCZ A;  3CU7 A;  2JN4 A;  3VYS A;  5C0X J;  1JT8 A;  4LF8 L;  2I5M X;  1F9R A;  1EQV A;  5GAG C;  4HMJ A;  2AHO B;  2JA5 H;  1VF5 C;  5KEE A;  1E1O A;  4BY1 B;  2B39 A;  2ZJR A;  3JAM L;  1BR9 A;  2F0G A;  3T16 A;  4RCO A;  4GLA C;  1K8A C;  3T1Y Q;  1BUV T;  1K73 C;  2F0W A;  5C44 G;  1WTH A;  3S16 B;  3H09 A;  5M5Y B;  4X64 L;  1KC8 C;  3ERS X;  3AB9 A;  5KYI A;  5BR8 L;  3H0G G;  2HCI A;  3DWP A;  5CR3 A;  2IX3 A;  2HIX A;  1Z47 A;  3KOJ A;  4JBK A;  4A3K B;  1PZJ D;  3GTO B;  4IOA A;  3NQT A;  3CD6 A;  2Q8R E;  1YHB A;  4K2L A;  3I55 A;  5M5W B;  1R4P B;  1B1Z A;  1LTG D;  1PH5 A;  2D2C C;  4X3U A;  4JI2 L;  1WD1 A;  2F03 A;  2K52 A;  3F2C A;  3H91 A;  4UP8 A;  1UUP A;  3GTM H;  1OXU A;  3Q22 A;  4V0B A;  1YI2 A;  3BDO A;  2L5T A;  2Q2H A;  1X3P A;  4JPB W;  3BG3 A;  3WWV A;  4FP5 D;  4DV7 Q;  2RDH A;  3GTG B;  1PTO D;  4JI0 Q;  4WJW A;  1TWF H;  5IY0 A;  2CWA A;  4DKA C;  1K9M C;  2NVT B;  1QG7 A;  1Q46 A;  4CJ2 C;  1GM5 A;  2XSC A;  4OGQ C;  1HJP A;  1EZ6 A;  1VQD A;  4IJH A;  4Y52 H;  5FO9 B;  4QJF A;  4N9T A;  4A76 A;  3I91 A;  4FNF A;  1RTO A;  4QUF A;  1VQN A;  3KLR A;  3VA7 A;  2EE1 A;  3K7U C;  3PUY A;  1M90 C;  5CV7 A;  2ID0 A;  4L63 B;  3H15 A;  4LNQ A;  5TSS A;  1NSN S;  4HIO A;  3W2D A;  5FJ8 H;  2KA7 A;  1VQ6 A;  2JA7 B;  3J81 E;  1X9N A;  2LSS A;  2HQL A;  3L7Z C;  5EKI A;  3OTO Q;  3HOV B;  4A3B G;  2CVR A;  3VA5 A;  1I4G A;  4J6H A;  2F0V A;  1LLR D;  2XGT A;  3SHL A;  3PO2 G;  2E75 C;  3RR5 A;  3URY A;  5IYD H;  5C4Z A;  3T51 B;  4LUV A;  4HJ7 A;  2NVQ H;  4KKU A;  3BDL A;  4B9X A;  1BBU A;  1LV9 A;  2Z0S A;  1EYD A;  3GV3 A;  1LUZ A;  3CCM A;  1TS3 A;  2MPM A;  2H4O A;  2VXW A;  3CCJ A;  3K80 C;  2Z8L A;  5KNB A;  3GTM B;  1SJE D;  2XIW A;  1HUM A;  3A8I E;  1PH7 A;  2BDO A;  1SRU A;  3TRZ A;  1ZXT A;  2CQA A;  1YBY A;  5JJZ A;  1QVF A;  1JWU D;  1IL2 A;  2DUD A;  2KVM A;  4LF4 L;  2FMM A;  4TVA B;  2B8F A;  3K5N A;  4FF3 A;  2K75 A;  1DCZ A;  5C0X G;  3QOJ A;  3B6Y A;  5IGG A;  1U4P A;  4DR2 L;  1IYV A;  1SAP A;  4PQX A;  2EY1 A;  5IT9 E;  2LKV A;  5JOB A;  3SK8 A;  1HNW Q;  3CCU A;  4DNR B;  4IO9 A;  2NN6 H;  4AYB E;  1UEB A;  4R4O A;  3GTP H;  1TWA B;  2VNU D;  3H3V I;  2KEE A;  4K8J A;  2MFI A;  2F3I A;  4GLV B;  2KHJ A;  4HJ8 A;  1EU3 A;  3A55 A;  3BVG A;  4JI1 Q;  3LX0 A;  4WRD A;  1K3R A;  1TR5 A;  1XTC D;  3PO2 B;  1S3O A;  2V1C C;  1CQF A;  4POG A;  1EY6 A;  1C8C A;  3D31 A;  2E8G A;  3KYH C;  2JXM B;  2RKS A;  1EZ8 A;  3TME A;  3BJU A;  5GAE C;  3S16 H;  4JI8 Q;  4A3M G;  1TVX A;  3K59 A;  2PQA B;  2VB2 X;  3AMU A;  1TKW B;  5K5P A;  4C2M B;  3NBI A;  3R93 A;  1I50 H;  3K6O A;  4YWL A;  3GTL H;  3KJP A;  4DV5 L;  2QF7 A;  4IPC A;  4X66 Q;  1J5E Q;  2EY5 A;  2BA1 A;  1JOR A;  3PO3 G;  2EQS A;  5LL6 S;  3ZYY X;  3HOX H;  2RDG A;  3MXP A;  5D14 A;  5ELF A;  5EQ0 A;  5I2X A;  1PFS A;  4HN7 A;  1TWA H;  2L15 A;  1CM9 A;  3CXC A;  3UDG A;  4N8X 1;  3MEH A;  3VDY A;  2EDG A;  5CGK A;  1KXL A;  1XPO A;  1OXV A;  1NMF A;  1BBX C;  1GUO A;  2KJX A;  3C3L A;  1GVP A;  1F9Q A;  4IFD J;  2OQK A;  3MC0 B;  5M9O A;  2ZXR A;  4ALP A;  3G7L A;  1S5C D;  1QOH A;  2FHT A;  4P73 A;  2NN6 G;  3PO2 H;  1I6H B;  2NZO A;  2YU9 B;  2KCT A;  1TWH B;  5LMN W;  3D6C A;  1CHP D;  4CJ0 B;  2PZT A;  1RCV D;  1R9T B;  2NVX H;  1ET6 A;  5C0X I;  2XRS D;  4EQ5 A;  1TS2 A;  1EY8 A;  1CZG A;  3BYY B;  3J7Y W;  1PH8 A;  2R92 H;  2Z6K C;  3T13 A;  5IWA Q;  4BA2 I;  2K05 A;  1BF4 A;  1E24 A;  4OHJ A;  4JVZ A;  1WOC A;  1PYW D;  2LXJ A;  3HOY B;  2FIN B;  4GNX B;  1QWY A;  2PW5 A;  1PH4 A;  3M7N A;  1CUK A;  2K14 A;  3I4O A;  5IYB H;  4KJO A;  3G6J B;  2HHH Q;  2QCP X;  4K6L A;  4OO1 H;  2JA8 H;  1TWC B;  1A3V A;  1PMR A;  3NPP A;  4DV3 L;  5C4H A;  4C56 C;  3HOW B;  4A3D B;  1WYD A;  2VZA A;  3OMC A;  4OX9 Q;  4A3J B;  4LF7 L;  4YY3 L;  3K81 C;  3GTJ H;  1SMY D;  3I4L A;  2DNE A;  3NSW A;  2B2T A;  2Q2I A;  1YNX A;  5H1S E;  2RDF A;  5M5X B;  4EGV A;  2XRQ D;  4Q0F A;  4J8Q A;  3CRL C;  5D65 A;  5GAH C;  3KUP A;  1YHQ A;  1VQG A;  2NB0 A;  3HKZ G;  5EBC A;  3RLN A;  5IGC A;  3STB C;  3ZJY C;  4LWC A;  4K5W A;  3CC7 A;  3RZD B;  4LF5 L;  5IOC A;  3KF8 A;  1VMP A;  1TWH H;  2OXP A;  4GN4 B;  4RAU C;  1WCM H;  1R4Q B;  1MJE A;  2R92 G;  1PHJ A;  3S9W A;  4BBS H;  1B9M A;  2NTT A;  1GUS A;  2PQA A;  4JI3 L;  1T5X D;  1X3E A;  3Q8D A;  2KCC A;  3HOX G;  2UUA L;  3QJY A;  3VR3 A;  1V9P A;  2NUC A;  3ERO A;  5FOB B;  4S3S A;  4RMF A;  1Q81 C;  4A3G B;  2B2U C;  1Y1V G;  2EIF A;  1EU4 A;  3M4O H;  1DJR D;  3S14 H;  1GO3 E;  5ELO A;  4B3T Q;  5IGE A;  1M4V A;  4CGY B;  1N8R C;  1HHV A;  2VQE L;  3BVZ A;  1PH9 A;  1KIX A;  1KQS A;  1S5D D;  5LL6 X;  4DU9 A;  3GQB A;  1YNN D;  1V1P B;  1I50 B;  2V4D A;  3OSO A;  3I4M G;  5LMU Q;  4K2K A;  4O2D A;  1N33 L;  3C1E A;  3ULP A;  2EYH A;  2PI2 E;  1D5Z C;  1E0B A;  4I7Z C;  4HJ9 A;  2B63 B;  5J1Z A;  5IP7 H;  1JMC A;  4X65 Q;  1QB5 D;  2IT1 A;  4NMZ A;  5HGQ A;  4A3M B;  5IYC G;  4KHP Q;  3CCE A;  5AJ3 Q;  3FVQ A;  2GVB A;  4KY7 A;  2ZM6 Q;  1NTG A;  4JV5 L;  1YJ9 A;  3GV6 A;  5I9P A;  2VQE Q;  1TWG H;  2J0T D;  4DAM A;  1UWV A;  4B3M Q;  2GN5 A;  1HA5 A;  3D3R A;  4OWT B;  3S15 H;  3I2Z A;  1B3Q A;  1D6E C;  5C4J H;  3J80 E;  4TKO B;  2C35 B;  5DM7 3;  1Z9F A;  1UNS A;  2VW9 A;  1JOO A;  2EYP A;  2Y0S G;  3IAY A;  4LFB L;  3HFZ B;  4GNX A;  4OXP A;  2OEO A;  1Q90 A;  1STH A;  2UXD L;  3AFQ A;  5C44 H;  1PYB A;  4LF9 Q;  3GTK H;  4OL7 A;  4CDE C;  5M5X H;  1E2V A;  3U58 A;  3SEB A;  1SFO H;  4L5S A;  1HTP A;  4IN3 A;  4EQN A;  4GNX C;  2WIN B;  3HGB A;  3MTS A;  2NVQ B;  1O7Z A;  3MFY A;  1GD7 A;  3HOW H;  1CA5 A;  1QCB D;  1GJX A;  1YIJ A;  3FEW X;  1PRT B;  4DR5 L;  2TSS A;  2PMZ B;  3CHB D;  4BBS B;  3GP7 A;  2D62 A;  1L0Y B;  2ZTE A;  4DR7 Q;  4DK1 A;  2RCN A;  3OOC A;  1HPC A;  3PO3 B;  4ME3 A;  2M9V A;  4A75 A;  4APV A;  4YY3 Q;  2CH4 W;  1ESF A;  1K83 B;  5M3M B;  2EJM A;  3MA2 B;  1B3A A;  2BH8 A;  1JR0 D;  1PXU A;  2K5Q A;  2GA4 B;  2F0I A;  1RTN A;  1RHP A;  2A6E C;  3CMA A;  2UU9 L;  2K5N A;  1DXM A;  2RHS B;  4DUZ Q;  3KBX A;  5COY A;  2F0K A;  4NPS A;  1VQ7 A;  1N36 L;  2JK8 A;  4DXF A;  2UUB L;  3L9A X;  3NUC A;  4IZ8 A;  3GTG H;  3S2D H;  5FLM H;  4AH6 A;  4JC0 A;  4YWM A;  2B2Y C;  4OWX B;  5C6A A;  1L1O A;  3CQZ H;  2HQE A;  2UU9 Q;  2PZW A;  1QIL A;  2F0H A;  3O13 A;  4DAV A;  2KCM A;  4A93 B;  1B70 B;  4LF6 L;  1IKM A;  1AN8 A;  2K7V A;  1TII D;  2LXK A;  4YWK A;  1ZYR D;  2N88 A;  2OF1 A;  4RGN A;  1PTO C;  4Y7N H;  3RLF A;  4JI5 L;  4G57 A;  3MXN B;  2EXZ A;  2K03 A;  3S1N H;  4IFD I;  3WDN A;  2QW7 A;  4LW1 A;  2Q2T A;  2JA6 B;  1JJC B;  3NTK A;  1BO0 A;  2AWN A;  3PMF A;  4A3I G;  4IPD A;  1SNO A;  2A19 A;  4BY7 G;  3HG9 A;  4UDU C;  1A6X A;  1KRS A;  4C3J H;  5I9O A;  2NZ1 D;  2D9U A;  4XT3 B;  1BDO A;  5IGB A;  4LFC Q;  3SGI A;  2DNC A;  3RD4 A;  4KV6 A;  1F2L A;  4R4C A;  2WB1 G;  3RUZ A;  1FNW A;  2B2V A;  4JG2 A;  1HUN A;  3PF5 A;  1EY5 A;  1PZI D;  1X55 A;  3PSI A;  4QF4 A;  3I4M B;  1FGU A;  4DV2 L;  4JI7 L;  2KHS A;  1Q8K A;  2Y0S E;  4ZKB B;  2WAQ B;  1N34 L;  1PFM A;  3C1F A;  4I65 A;  4GLX A;  4DR3 Q;  4NW2 A;  3NTI A;  4A3F B;  5KIX A;  3NWS A;  3K5O A;  1Y1W H;  3BVM A;  3MXU A;  4C2M H;  3E6Z X;  1H9S B;  3NWT A;  2K5V A;  1RDP D;  1HNW L;  3AQQ A;  5C44 B;  5EPK A;  2H1E A;  1RF2 D;  4I7A A;  5NUC A;  3E0E A;  3MHB A;  1ILQ A;  1TS5 A;  4DV2 Q;  2EJF C;  2EYF A;  1J6Q A;  1SFO B;  2JA6 G;  2J4X A;  3JAM i;  4DGZ A;  1I3Q H;  3PUV A;  4A3K G;  1WTX A;  2A68 C;  2BE5 C;  2AWO A;  3FMC A;  3OWE B;  5M5W H;  4DR3 L;  2ASB A;  1TU2 B;  1F9P A;  1VQF A;  4P72 A;  5I6W A;  1G51 A;  2BH2 A;  5ELB A;  4AQY L;  5I4D A;  2R7Z G;  3SK6 A;  4DNT B;  2HUG A;  1PH6 A;  2IHF A;  2ALY B;  3K0Y A;  3P1H A;  4GOP A;  1IYU A;  2XN9 C;  1K0S A;  3S17 B;  3HEJ A;  3PCO B;  3AFP A;  1UAP A;  4OIK A;  2PPB C;  1EFW A;  4FF2 A;  4L5T A;  2JEA I;  3TP8 A;  1HR0 W;  1SBB B;  4R4Q A;  5JEA H;  2E5L Q;  1B2T A;  3X3N A;  1HCZ A;  2RA4 A;  3NEL A;  5CMD A;  1OXX K;  4DUY L;  1U9R A;  1ESR A;  4BY7 H;  1OXT A;  1PRT C;  1AE3 A;  2JA9 A;  4ZCK A;  2DGY A;  1A0I A;  3KLS X;  3CRK C;  2EOT A;  4PZ8 A;  4DV0 Q;  5J39 A;  1TQO A;  3AU7 A;  3PQI A;  5I6Y A;  2QKI C;  3EIV A;  3TEH B;  5CV9 A;  2JA5 G;  3AEV A;  1JOQ A;  2WAC A;  3HOZ G;  4YHH Q;  1RKN A;  3HOV H;  4GKJ Q;  4RG1 A;  1CQV A;  3E0J A;  1I94 Q;  1STG A;  3UDX A;  1IZ6 A;  1U4R A;  4A3E G;  3CCR A;  4UP9 A;  4KMU C;  4R4I A;  4BA1 I;  1JIC A;  2K50 A;  1SYD A;  4A3L H;  4B3R Q;  2DJG C;  3A7L A;  3F2U A;  4KKS A;  1EYA A;  4KKT A;  1XNQ L;  3AYH B;  3DWA A;  1TT2 A;  1KTK A;  1KHI A;  5JEA G;  3DHQ A;  4LF8 Q;  4DAY B;  2L9H A;  4LAA A;  4E6I A;  5FLX L;  2PO4 A;  1TWF B;  1GKH A;  2PW7 A;  3NP8 A;  4YIJ A;  2ES2 A;  2VB3 X;  2A69 C;  4HR7 B;  2F0N A;  1WTO A;  3Q0A A;  3CC4 A;  4C3I G;  1U4M A;  4JBM A;  2OCE A;  3E5S A;  4B3R L;  2FXQ A;  3ERQ A;  2F4I A;  1EWC A;  5C3X A;  1K8G A;  1C7Y A;  2JE6 I;  4LF5 Q;  3J7A F;  5KRU A;  5LMN Q;  1R9T H;  2NVX B;  2C9O A;  2K32 A;  1PRT D;  3L0O A;  5C4J B;  5COR A;  4HJA A;  5BN5 A;  1Y1V H;  1VQI A;  2C5C A;  4ZRZ A;  4BBR G;  5T1I A;  2UUC Q;  1TWG B;  1IHZ A;  4GOP B;  4R1J A;  1ENA A;  2F0E A;  2JA7 G;  3VYR A;  2VQF Q;  2E2I B;  1EEF D;  4MN3 A;  1I6H H;  4ME5 A;  2ICI A;  1KRT A;  4DR1 Q;  1F77 A;  3ND8 A;  4ID6 A;  1KAB A;  4BXX H;  4BY7 B;  5LMN L;  1A62 A;  3K0X A;  4UP7 A;  4B3S L;  4P2C B;  4XYQ A;  1S40 A;  3TSS A;  2BOS A;  1Q86 C;  4KTA A;  3KLW A;  1DOK A;  2SNM A;  2Y0S B;  4JI6 L;  1WVL A;  3LNN A;  1CKO A;  4CJ1 B;  4A3L G;  2D0P A;  2G9D A;  1VQ5 A;  1FL0 A;  2WAQ G;  2ZXO A;  4B08 A;  3VR2 A;  5LMU L;  3HOU H;  2Q2U A;  1E2W A;  2WB1 E;  3CPF A;  3CPW A;  2IPK D;  3DEO A;  3UE1 A;  3QR8 A;  3BZD B;  4BY1 G;  2ENB A;  2KEN A;  1EUJ A;  2ZM6 L;  1L0X B;  2HDM A;  2WP8 J;  3KFU A;  2ZXP A;  2MUY A;  5D3I B;  1PA6 A;  4XXE A;  4OEM B;  4JBW A;  4IJL A;  1QVC A;  4RWS C;  1JWS D;  1K8M A;  5JJL A;  3S1N B;  3TS0 A;  5G3L D;  1PV4 A;  1KDB A;  3RN5 A;  5BN3 A;  2O5I C;  1BCP F;  4FXK C;  3J7A V;  1Y1V B;  2QEJ C;  1W2B A;  3MVV A;  1AZQ A;  4A3G G;  4R8N A;  4JW0 A;  2QEX A;  1IBL Q;  2F4V L;  1WTV A;  1HXY D;  4C3J B;  4QGU A;  4J1M A;  4A3F H;  4IAL A;  4PMB A;  2XWJ B;  4A3J H;  4X3T A;  1HH2 P;  4A3I B;  4DR5 Q;  3L3O C;  1QZG A;  1WFQ A;  1NMG A;  1XNQ Q;  2NWG A;  3NEM A;  4HMI A;  1EWI A;  2PMZ E;  4A3J G;  4C3I H;  1ML0 D;  4H13 C;  1FJG Q;  1D1I A;  1B8A A;  1V8Q A;  5IWA L;  2B2W A;  1D2B A;  4AYB G;  3I70 A;  3R8B A;  2PZU A;  2EYO A;  1MD2 D;  1E22 A;  4P75 A;  2UXB L;  1V1P A;  1I5F A;  3S24 A;  1SE2 A;  4RHR A;  3CCQ A;  2UUA Q;  1TY2 A;  3RZO B;  1HTL D;  1Y8P B;  4BXX G;  2HHH L;  4HTH A;  4GOP C;  3S2D B;  4DFA A;  2JA7 H;  2FJ2 A;  1X3G A;  1HNX Q;  3OMG A;  3KF6 A;  4IUP A;  4DXG A;  2R7Z B;  3D4R A;  4K0K L;  3I7F A;  1STN A;  1K0R A;  5FK9 C;  5A2Q E;  4M1U B;  2F0U A;  3FPP A;  1Z7T A;  4JOI C;  1PFN A;  2RVL A;  5C4X G;  4DN4 M;  1H95 A;  3H94 A;  4GKK L;  4XQN A;  2R61 A;  1G2S A;  1RJT A;  1X3Q A;  1KAW A;  1L0W A;  4B3S Q;  3UDI A;  1X6O A;  1C0A A;  4TSS A;  2HT1 A;  2F0O A;  2AMC B;  2PQE A;  3I73 A;  5HGT A;  1UE1 A;  3DXJ C;  2YTY A;  1T5E A;  4F8M A;  4DV5 Q;  5IYD G;  1ZKO A;  2RF4 A;  2F1M A;  1YNJ D;  2E2J H;  3SK4 A;  4A3K H;  1B9N A;  5HUR A;  2M00 A;  4JI3 Q;  1RIP A;  1Y14 B;  4X62 L;  1NJI C;  2CWP A;  3DM1 A;  3NE5 B;  4JCV E;  4RGM A;  1M1K C;  5JEA J;  1EYG A;  4HED A;  1QUQ B;  3C46 A;  4YCU A;  5D3D A;  2Q8I B;  1WTR A;  3GTQ H;  3C2P A;  4IUV A;  3I4N H;  2ATW A;  1O78 A;  3EJI A;  4CDF C;  3EQL C;  3K5M A;  1PDQ A;  4KY5 A;  4LF9 L;  3R3O A;  4IUN A;  3S1M H;  2XNA C;  1PTO F;  3Q24 A;  4B3T L;  3OPO A;  1S72 A;  5C4X B;  1LTS D;  3FP9 A;  2SOB A;  4XIG S;  3J80 L;  5L37 A;  5IGF A;  5EKK A;  3S2H H;  2OTL A;  5GQO A;  1O7L A;  2KED A;  3A74 A;  3I90 A;  3NTH A;  2JP1 A;  3TN2 A;  2HD3 A;  4HID A;  2LMC B;  1UE5 A;  4JI1 L;  1A2T A;  5ELC A;  5DNF A;  3D8G A;  3QWN A;  1I3Q B;  3J81 j;  1XNR Q;  4DV1 L;  1AEX A;  3ONA B;  2F0P A;  1L1O C;  1O7I A;  4C1N K;  1JB7 A;  5JJI A;  3G6E A;  1GHK A;  1L1O B;  2M2L A;  3HP3 A;  4K6D A;  4OO1 I;  3PUZ A;  3HS0 C;  3S1Q B;  4JI8 L;  1E3P A;  4X6A H;  1G2T A;  4A3B B;  5BR8 Q;  3STB D;  1MSG A;  5C5M A;  3J7A 5;  5DM6 3;  2CQO A;  4MTK A;  1RD9 D;  2JA5 B;  1J5E L;  3UE0 A;  3HKS A;  1IL8 A;  1HZA A;  3K8A A;  2KQ3 A;  5KGU A;  1IW7 D;  3NXW A;  4DK3 C;  2EVB A;  1B50 A;  4QIW B;  3I4M H;  1HZC A;  1LTB D;  1PTO H;  5CBE E;  2UXB Q;  4EX5 A;  2E2D C;  3A5U A;  1KNE A;  2Z1C A;  3BS1 A;  3G4S A;  3DMU A;  2IY5 B;  2KEC A;  4A4I A;  3W5O A;  5C3E B;  3I56 A;  3K58 A;  4ODG A;  3QOL A;  1GUT A;  1GXD C;  4DR6 L;  2ZTD A;  2N3S A;  2AUK A;  4BBS G;  4B9W A;  4DUZ L;  5CV6 A;  4Y7N B;  2A1A A;  4DR4 L;  4H7B A;  2A6H D;  1B4O A;  3FKI H;  3LWU A;  3MZ5 A;  4ZYS A;  1HZB A;  4Z9C B;  2NZH A;  3D0F A;  1LAC A;  4KN7 C;  5ELD A;  3OTO L;  1SLJ A;  2L1B A;  5I2Y A;  3R2T A;  3I3C A;  1LT3 D;  3M9B A;  4QY7 A;  4MHE A;  1N34 Q;  3RZD H;  1EQQ A;  2B63 G;  4N8F A;  1HNZ Q;  1A3T A;  4JYA L;  1PTO B;  1LTA D;  4H44 C;  3NEN A;  3T4A C;  2VL6 A;  2QIL A;  2A69 D;  4UY8 C;  2MP1 A;  1G6P A;  2F0Q A;  1K83 H;  5CC4 A;  5M3M H;  1U5K A;  4WJ3 M;  1PH2 A;  4CKB A;  2IX1 A;  5ISR A;  1B44 D;  1TWC H;  4L6T B;  2NVT H;  4LF4 Q;  1V43 A;  4PZ7 A;  4JYA Q;  5K36 H;  2A68 D;  2BE5 D;  1HZ9 A;  1SN8 A;  3SE0 A;  1SYE A;  2RSO A;  1LT5 D;  2XTI A;  1PLF A;  3ULL A;  4DR2 Q;  1VQP A;  1DON A;  3CCL A;  5EPL A;  4A3E H;  1Q12 A;  3EVQ A;  1ENF A;  1Q3L A;  2I5H A;  1SXT A;  1DD2 A;  4PG3 A;  4PNY A;  3NK9 A;  2FFK B;  1PVO A;  3QG1 A;  3FHW A;  3JAM c;  1ICW A;  1YJW A;  1XYI A;  2WKC A;  2F0F A;  2JYO A;  3FRP B;  2A6H C;  1XMQ Q;  1CHQ D;  1VMC A;  1D5M C;  2UUC L;  3FPU B;  3GTP B;  5IGD A;  1UEA B;  1FYC A;  4DAP A;  2VUM G;  5CBA E;  1DOL A;  3OIQ A;  1XMO Q;  1Q82 C;  1AW7 A;  1P16 A;  3VR6 A;  3K7A B;  4KD4 A;  3KLS A;  4A3C H;  2O2L D;  5FLM G;  1HFN A;  2KUM A;  5EPJ A;  2EYL A;  2F0L A;  1KLG D;  4TQU S;  2B2Y A;  4YCW A;  4KK7 A;  3SVM A;  4X64 Q;  4A3E B;  4G4K A;  4JI4 L;  2HDL A;  1KAA A;  3E3X A;  3TP7 A;  3DLL A;  2Q8T A;  1VDZ A;  5C3E G;  2D5D A;  4NXN Q;  2EY2 A;  2A5H A;  1ET9 A;  4JV5 Q;  4HAE A;  1N32 Q;  1I4H A;  3ITP A;  2WB1 B;  1G91 A;  1FGB D;  1H9S A;  4AQY Q;  2UUB Q;  3A8J E;  4B3M L;  4CDC C;  1X65 A;  2K5D A;  3E9I A;  4IQZ A;  4A3D G;  1DOM A;  1YNN C;  2VS1 A;  4R8I A;  1Q1E A;  4A3M H;  3NBH A;  1WTP A;  1EOV A;  3S1R H;  3H3V C;  2K6A A;  5ELN A;  3G48 A;  3GD7 A;  4X3K A;  1IBK L;  4L5Q A;  4BBR H;  3HOY G;  2PNH A;  3A0J A;  3TRE A;  1MSH A;  5KYL A;  2WII B;  5ELE A;  1U4L A;  2MQH A;  3J7Z C;  2R7Z H;  1OXS C;  2JA6 H;  3J81 L;  4UHV A;  1D8L A;  3SXH A;  2BCO A;  1WCM B;  3HKZ B;  4K8I A;  3DM3 A;  4DNI A;  4XQQ A;  1XPU A;  1V1O A;  1U0L A;  5IP9 G;  1NE3 A;  3TZU A;  1NR2 A;  1SEB D;  2HIV A;  1J9O A;  1XXG A;  5K36 G;  1SE3 A;  2LY7 A;  1HFG A;  4ZK9 B;  3DEP A;  3MXG A;  4HSP A;  4O0A A;  1IBL L;  2F4V Q;  4QIW E;  3H0G H;  3KBG A;  4EQO A;  4R9W A;  3I72 A;  1LTR D;  3TQY A;  2NVY B;  3U4V A;  1BQQ T;  4RH6 A;  1BOS A;  2WFW A;  3P7J A;  4IUQ A;  1LTL A;  3RLO A;  1Y1W G;  1K8O A;  2IHE A;  1VQE A;  5GRO A;  1I94 L;  5IIF A;  3CW2 C;  1N36 Q;  2EPB A;  4LF7 Q;  1Z6H A;  5BN4 A;  1WTW A;  5JPM C;  3BZC A;  4QQB X;  1XTD A;  5CV5 A;  4WOR A;  3TZD A;  5M3M G;  3PIO A;  2MHV A;  3J80 c;  3IL8 A;  2R93 H;  5E3F A;  1TY0 A;  5EKL A;  1K28 A;  1LM0 A;  4G7H C;  5T1G A;  2QGQ A;  3GTJ B;  3ER0 A;  3HOY H;  3TS2 A;  1SMX A;  2ICE C;  5C3W A;  1ENC A;  4POF A;  4DV7 L;  2MJ8 A;  1QVG A;  3MWY W;  5FKA C;  2Z9H A;  4ZUJ A;  4A3F G;  5E4X A;  3UI2 A;  1HNX L;  1G6Z A;  4C3H G;  3KDF A;  4U68 A;  2EYM A;  5M5Y H;  5IT9 c;  3SK5 A;  5KNC A;  4A3D H;  2KOL A;  1BKB A;  3NHH A;  4LFA Q;  3H3V H;  4NB3 A;  2F0D A;  3ICE A;  2SDF A;  1EY0 A;  2NVY H;  3S1Q H;  3PUX A;  1QZH A;  3GDE A;  4F88 A;  3PV0 A;  4MNO A;  4O1N A;  2MO0 A;  2J7Z A;  1VQA A;  1K3B C;  1VQB A;  3ND9 A;  4DAY A;  1HA6 A;  1EEI D;  4FDB A;  2UXC Q;  1MKH A;  2X6G A;  3LWE A;  4IUT A;  2RCF A;  4LUO A;  1I6V C;  4QCL A;  3GTO H;  1S5B D;  3G71 A;  1VQL A;  2N78 A;  5JJK A;  3NBH B;  2PI2 A;  4PMW A;  3TP6 A;  3OHX C;  2E5L L;  3OW7 A;  1OO9 B;  1FD7 D;  5DLQ E;  1VQH A;  1VS0 A;  3PIO 3;  1STY A;  2R7F A;  2EXD A;  4X65 L;  2B2W C;  4XYO A;  4IOC A;  3M4Q A;  4DV4 L;  4WFN 3;  1E2Z A;  1WTQ A;  5GAD C;  4QUC A;  2JJQ A;  3RMH A;  1LYL A;  1JC7 A;  1CSQ A;  3M7G A;  4FYD A;  4F87 A;  3DWQ A;  1NY4 A;  4P74 A;  3QB3 A;  2B2T C;  4NXM L;  1CKM A;  2G5D A;  3V2T A;  3HZX A;  4A3C G;  2P5Z X;  5KND A;  5IP9 H;  4RKB A;  3CCV A;  4DPG A;  3EFX D;  4C3H H;  4LFB Q;  3S14 B;  1YHA A;  2CKZ B;  4MZ9 A;  1XNR L;  3FDT A;  1GUN A;  1P8L A;  3HOV G;  3A5Z B;  3KF6 B;  3TDQ A;  1SYG A;  5JPN C;  2E2I H;  4HSV A;  3T56 B;  2R3Z A;  3A7A B;  1D5X C;  3M3Y B;  1OTC A;  2B29 A;  2SEB D;  4NXM Q;  4OWW B;  1BNZ A;  1IKL A;  2EY6 A;  4Q5V A;  3I4N G;  1VCI A;  4ZAI A;  1AZP A;  1BCP C;  1VF7 A;  2JA8 G;  1S5F D;  3IFD A;  1BCP D;  1LTI D;  3PGZ A;  1X32 A;  1AE2 A;  1JB3 A;  4X3S A;  2CW0 C;  2Z4H A;  5FJ8 G;  1EY7 A;  4GKK Q;  3CAM A;  3VR4 A;  1II3 A;  4MIU A;  4FF4 A;  1YVC A;  2H5X A;  1X56 A;  4GS3 A;  3CCS A;  3I4N B;  4CKE A;  3M4P A;  4OX9 L;  2AKW B;  2VY3 A;  4LMQ D;  1NNX A;  3WOF A;  1HRJ A;  5FO8 B;  2NTS A;  1JE5 A;  1WJJ A;  2XVS A;  5E1F A;  1Q7Y C;  1VQ8 A;  3HRZ C;  4LFA L;  2L0C A;  4X62 Q;  1ZYR C;  3Q6S A;  2CH4 A;  4DR1 L;  2IX0 A;  2F0J A;  1QNK A;  3IRB A;  4RKL A;  1VQO A;  2A8V A;  1UE6 A;  1QNU A;  2OT2 A;  2UXC L;  4NP5 A;  3MFG A;  5A2Q L;  2MNA A;  3PO3 H;  1O7Y A;  1IYJ B;  2AQ3 B;  2E76 C;  1CKN A;  5C0X H;  1ZEQ X;  4UAI A;  1H9R A;  3PUW A;  1JJG A;  2JA8 B;  1SSO A;  1E7Z A;  2F0M A;  3NQI A;  1KLU D;  3OYY A;  1HNZ L;  5IOD A;  2WV6 D;  2YV5 A;  1WCM G;  1H9J A;  2XWB B;  1VQC A;  2B2V C;  2WKD A;  4L8J A;  5HY6 A;  4HIM A;  1QJO A;  2X6L A;  4LFC L;  3I8Z A;  4DV4 Q;  4DV1 Q;  3S1R B;  3EN2 A;  1SE8 A;  1F2M A;  4ZUI A;  1ROD A;  2R92 B;  4PZ6 A;  2CW0 D;  1JOK A;  1SNC A;  3U9S A;  4GN5 A;  3HOU G;  4DF7 A;  2I5L X;  4HCE A;  3OWF A;  1BVS A;  1CA6 A;  2KBN A;  4BWG B;  4NKL A;  5C4X H;  1KD1 C;  3R2I A;  5A35 A;  3U50 C;  3W3A A;  3T1Y L;  4L5R C;  2NBF A;  4N9P A;  2DN8 A;  1S5E D;  1PRT F;  5M3F G;  1GUG A;  2F0S A;  1I4P A;  2TMP A;  1I4R A;  4OIJ A;  3J81 c;  1N9W A;  1MI2 A;  1NUC A;  2K01 A;  5FO7 B;  2K1B A;  3K7A H;  5JAV A;  1AP0 A;  1LTT D;  4KHZ A;  1QUQ A;  1PFB A;  3S15 B;  3BZK A;  1VQ9 A;  4F7X A;  1WD0 A;  3S2H B;  3T1H L;  2OTJ A;  2HCC A;  1CSP A;  3PIP 3;  2Z6B A;  4UPA A;  5EAY A;  1W6J A;  3J80 i;  3M4Y A;  2QA4 A;  1BCP B;  1KL9 A;  2X69 A;  4JI2 Q;  2RSN A;  1VQ4 A;  3CF5 A;  5CV4 A;  5M3F B;  4RGO S;  1J8I A;  2F52 A;  1FNV A;  5LHY 1;  1XJV A;  4JI4 Q;  2MO1 A;  1BXT A;  1C48 A;  3TP5 A;  4DR4 Q;  2RQX A;  4NXN L;  1EYC A;  1H9K A;  1Y1W B;  1N32 L;  3RN2 A;  4JI0 L;  1LT4 D;  4DK6 C;  5JVG 3;  5CV8 A;  3HOU B;  5J3B A;  3CME A;  4RA8 A;  3M4O B;  2N8N A;  2N55 A;  2DY7 A;  1PYS B;  4QB4 A;  4DUY Q;  1HR0 Q;  4ABN A;  4RCN A;  3F8T A;  3VR5 A;  4HCS A;  2L4N A;  3S1M B;  1TS4 A;  5AJ3 L;  4XDX A;  3RNU A;  3CQZ B;  1CKN B;  4XQJ A;  3F2B A;  2SNS A;  2IJ0 A;  5AFW A;  1I4Q A;  2R6G A;  5IT9 L;  4AIM A;  1EIY B;  4HIK A;  3K5L A;  1CK1 A;  2R93 G;  4X66 L;  4ZQ3 A;  4DV0 L;  4CKC A;  4K5V A;  1X54 A;  4KHV A;  1B53 A;  2L11 A;  1YZ6 A;  4K5X A;  4JK1 C;  5DAU A;  2B8G A;  2VUM B;  1CFM A;  3MEF A;  4YHH L;  2OWO A;  2NYZ D;  2LFN A;  4U67 3;  3SDZ A;  4G7Z C;  3PIP A;  1YIT A;  5E4W C;  2QDL A;  4KLK A;  4V19 0;  4CHT B;  4DR6 Q;  1KDA A;  1D7Q A;  3KF8 B;  3W1G A;  3M85 A;  4NDX A;  1X3F A;  3TBI B;  4M8A A;  4H0L C;  4LK1 C;  1FJG L;  1EQR A;  1STB A;  2R93 B;  3H0G B;  3UDF A;  3T53 B;  2FMC A;  5F2D A;  2O4X A;  4C1N I;  1STA A;  4GN3 B;  2PNR C;  2EZV A;  3VYT A;  3BDC A;  1JQY D;  4K14 A;  4OON A;  2WAQ E;  1GHJ A;  3P20 A;  3Q23 A;  1DGS A;  1PZK D;  5C3E H;  1ASZ A;  1EIH A;  1W3S A;  1ICF B;  2YU9 H;  2IW3 A;  2RBM A;  4DR7 L;  1JWM D;  1VQJ A;  2K4K A;  3WOE A;  1SND A;  2JSO A;  2RHQ B;  3VYU A;  4BBR B;  1A63 A;  4IPH A;  1FVI A;  5IP7 G;  3K57 A;  3W1B A;  1IXR A;  4YCV A;  4BS9 A;  4DA2 A;  3OIP A;  1EFI D;  2L12 A;  3JC6 6;  4OEL B;  5E7N A;  2I0Q A;  1STE A;  2ZJQ A;  4DV3 Q;  3HOZ B;  4R4T A;  1YEZ A;  1DZ1 A;  1HQM C;  1M8A A;  1SMY C;  1AH9 A;  4C3I B;  4ZLT F;  2K33 A;  3T1H Q;  2CFM A;  2B3G A;  3KK7 A;  4ZKC B;  1B7Y B;  3X3M A;  1XX8 A;  4HJ5 A;  1MGS A;  3QIA A;  1GOZ A;  3KJO A;  1CZW A;  1D1K A;  2YYZ A;  3CC2 A;  4KJN A;  4J15 A;  4A3I H;  2IWH A;  1C4Q A;  4KD3 A;  4CDD C;  3GTK B;  2YTV A;  2JEB I;  1I4X A;  1Q1B A;  1PH1 A;  3GTQ B;  3FKI G;  1SJH D;  4FXG C;  1F2Z A; 
#chains in the Genus database with same CATH homology
 1S40 A;  4KHP L;  1BBW A;  4GNX B;  3GO5 A;  1Q86 C;  2R7D A;  1EIF A;  3KLW A;  1PH4 A;  1CUK A;  3TQY A;  3M7N A;  3U4V A;  3L2P A;  4JI6 L;  2K14 A;  2K5H A;  1A8V A;  2WFW A;  3I4O A;  1CKO A;  4JI6 Q;  5IYB H;  3HOW G;  2HHH Q;  4A3L G;  2D0P A;  1VQ5 A;  2JA8 H;  1FL0 A;  1LTL A;  3RLO A;  4DV3 L;  1Y1W G;  2IHE A;  4LUZ A;  1VQE A;  5GRO A;  1I94 L;  1WYD A;  2VZA A;  3CW2 C;  2WAQ G;  1N36 Q;  4OX9 Q;  1SRO A;  5IYC H;  5LMU L;  2D0O A;  3ULJ A;  2Q2U A;  4LF7 L;  4YY3 L;  3K81 C;  3GTJ H;  4LF7 Q;  2WB1 E;  3BZC A;  4QQB X;  2Q2I A;  1XTD A;  1YNX A;  3CPF A;  5H1S E;  3CPW A;  3OW2 A;  3M3Y H;  3PIO A;  5M3M G;  3J81 i;  1HR0 L;  3J80 c;  3UE1 A;  2R93 H;  2B63 H;  4BY1 G;  1LM0 A;  2UXD Q;  5GAH C;  1YHQ A;  3S17 H;  2QGQ A;  1VQG A;  2KEN A;  3HKZ G;  1EUJ A;  3ER0 A;  3RLN A;  3HOY H;  4A3G H;  3STB C;  2ZM6 L;  3ZJY C;  4LWC A;  3TS2 A;  2WP8 J;  3KFU A;  1SMX A;  3CC7 A;  1PA6 A;  4LF5 L;  2Z6K A;  4JBW A;  4POF A;  4DV7 L;  4JI7 Q;  4IJL A;  1QVG A;  1QVC A;  3LGJ A;  1TWH H;  1UE7 A;  4A3F G;  4P71 A;  5JJL A;  1HNX L;  4GN4 B;  4H02 A;  3KDF A;  4JOI A;  1XPR A;  1WCM H;  3TS0 A;  5M5Y H;  5IT9 c;  4A3D H;  1PV4 A;  3CP0 A;  1MJE A;  2R92 G;  1PHJ A;  4BBS H;  3RN5 A;  3PF4 A;  1BKB A;  4WJ4 A;  4LFA Q;  2PQA A;  3H3V H;  4JI3 L;  1X3E A;  3Q8D A;  4NB3 A;  3HOX G;  3ICE A;  1TXY A;  2NVY H;  1W2B A;  2UUA L;  3S1Q H;  1V9P A;  4A3G G;  3PUX A;  1QZH A;  1IBK Q;  3GDE A;  3PV0 A;  4MNO A;  1PH3 A;  2MO0 A;  4RMF A;  2QEX A;  1Q81 C;  1IBL Q;  1VQA A;  1VQB A;  2F4V L;  4FDB A;  4QGU A;  2ZJP A;  2UXC Q;  1Y1V G;  2EIF A;  4A3F H;  3M4O H;  3S14 H;  1MKH A;  4A3J H;  1GO3 E;  1HH2 P;  5ELO A;  4DR5 Q;  4B3T Q;  4LUO A;  4QL5 A;  1WFQ A;  1NMG A;  1QZG A;  1XNQ Q;  2GVA A;  1WI5 A;  1N8R C;  2VQE L;  4DV6 Q;  3GTO H;  3NEM A;  1PH9 A;  1KIX A;  1C9O A;  3G71 A;  1KQS A;  2N78 A;  1VQL A;  1EWI A;  2PMZ E;  4GKJ L;  4A3J G;  5JJK A;  3NBH B;  4C3I H;  2PI2 A;  4PMW A;  1ASY A;  1FJG Q;  3I4M G;  1B8A A;  5IWA L;  2E5L L;  1MJC A;  5LMU Q;  3RZO H;  4O2D A;  3U4Z A;  1N33 L;  4AYB G;  3ULP A;  2PI2 E;  3HOZ H;  4HJ9 A;  5DLQ E;  1VQH A;  3HKZ E;  5IP7 H;  1VS0 A;  1JMC A;  4X65 Q;  5HGQ A;  2IT1 A;  2R7F A;  2EXD A;  1E22 A;  4P75 A;  4X65 L;  1V1Q A;  5IYC G;  2UXB L;  1I5F A;  1JJ2 A;  4IOC A;  4KHP Q;  4IFD G;  3M4Q A;  3S24 A;  3CCE A;  3CCQ A;  2UUA Q;  4DV4 L;  5AJ3 Q;  1NBW A;  5FLX c;  5GAD C;  2GVB A;  2JJQ A;  2ZM6 Q;  1NTG A;  1IBM L;  4JV5 L;  1LYL A;  5IYB G;  1YJ9 A;  4BXX G;  4OO1 G;  2HHH L;  2VQE Q;  4DV6 L;  1TWG H;  4DAM A;  1CSQ A;  1UWV A;  4B3M Q;  4GOP C;  2GN5 A;  4XTC S;  1L2F A;  1NY4 A;  1T9H A;  4P74 A;  2JA7 H;  1HNX Q;  1X3G A;  4OWT B;  1H95 A;  3S15 H;  4NXM L;  1CKM A;  3I2Z A;  1XMQ L;  1RL2 A;  4MTN A;  3EBE A;  3KF6 A;  4A3C G;  4KI0 A;  5C4J H;  4K0K Q;  2C35 B;  3E9H A;  5IP9 H;  1Z9F A;  4K0K L;  3I7F A;  2VW9 A;  2Y0S G;  3CCV A;  4LFB L;  1K0R A;  4DPG A;  4C3H H;  3HFZ B;  4JOI C;  4GNX A;  1XMO L;  4LFB Q;  4OXP A;  2ZTC A;  5C4X G;  1YHA A;  2UXD L;  2CKZ B;  3AFQ A;  4MZ9 A;  1P8L A;  2BA0 A;  1PYB A;  5C44 H;  4LF9 Q;  1XNR L;  3A5Z B;  1G29 1;  3KF6 B;  5M5X H;  3U58 A;  1SFO H;  4L5S A;  3BU2 A;  4GKK L;  4A93 G;  1SR3 A;  1IBM Q;  2E2I H;  4GNX C;  2KHI A;  2N49 A;  1VQM A;  1KAW A;  1MIU A;  1L0W A;  3F2D A;  4B3S Q;  3UDI A;  1X6O A;  1VQK A;  1C0A A;  1GD7 A;  2HT1 A;  3HOW H;  2AMC B;  4A93 H;  1YIJ A;  1OTC A;  1UE1 A;  2B29 A;  4NXM Q;  2VUM H;  4DR5 L;  2YTY A;  4OWW B;  4DV5 Q;  5IYD G;  2RF4 A;  2VQF L;  2D62 A;  1E1T A;  2E2J H;  2ZTE A;  4A3K H;  1YJN A;  4DR7 Q;  4JI3 Q;  3I4N G;  1RIP A;  1VCI A;  2RCN A;  1Y14 B;  4X62 L;  1NJI C;  2CWP A;  4JCV E;  4ME3 A;  4A75 A;  1M1K C;  4APV A;  5JEA J;  4YY3 Q;  1EYG A;  2JA8 G;  4A3B H;  1QUQ B;  1N33 Q;  4YCU A;  4LF6 Q;  2BH8 A;  3GTQ H;  3PGZ A;  4IPG A;  4JBJ A;  3I4N H;  2E2H H;  1AE2 A;  2ATW A;  2UU9 L;  3CMA A;  5FJ8 G;  2K5N A;  2OQ0 A;  4LF9 L;  5IE8 A;  4JI5 Q;  3KDF B;  4GKK Q;  3CAM A;  3S1M H;  3F1Z A;  2RHS B;  4B3T L;  1YVC A;  4DUZ Q;  2H5X A;  2NN6 I;  1S72 A;  1X56 A;  2JQO A;  5M3F H;  4GS3 A;  2YTX A;  4BY1 H;  3CCS A;  3FP9 A;  4NPS A;  1VQ7 A;  2CCZ A;  4XIG S;  3M4P A;  3S2H H;  5C0X J;  1JT8 A;  1N36 L;  4LF8 L;  2JK8 A;  4OX9 L;  2UUB L;  2I5M X;  2OTL A;  2AKW B;  2VY3 A;  5GAG C;  3GTG H;  5GQO A;  3S2D H;  5FLM H;  4AH6 A;  2AHO B;  2JA5 H;  4JC0 A;  4YWM A;  1E1O A;  1JE5 A;  3A74 A;  1WJJ A;  1Q7Y C;  2ZJR A;  4OWX B;  1VQ8 A;  1L1O A;  4HID A;  1UE5 A;  3CQZ H;  4LFA L;  4X62 Q;  4JI1 L;  2UU9 Q;  4GLA C;  1K8A C;  3T1Y Q;  1K73 C;  2KCM A;  4DR1 L;  1B70 B;  3J81 j;  2IX0 A;  4LF6 L;  4DV1 L;  1XNR Q;  1L1O C;  2LXK A;  5C44 G;  1O7I A;  4YWK A;  1JB7 A;  3IRB A;  3G6E A;  5JJI A;  1L1O B;  1VQO A;  2A8V A;  1UE6 A;  4OO1 I;  3PUZ A;  4Y7N H;  2UXC L;  3RLF A;  4X64 L;  1KC8 C;  4JI5 L;  3ERS X;  4JI8 L;  5BR8 L;  2MNA A;  1E3P A;  3PO3 H;  4X6A H;  3MXN B;  3H0G G;  5BR8 Q;  3S1N H;  3STB D;  4IFD I;  1IYJ B;  2HIX A;  1Z47 A;  3KOJ A;  3J7A 5;  4JBK A;  4LW1 A;  1CKN A;  2Q2T A;  2CQO A;  4IOA A;  1JJC B;  3PUW A;  3CD6 A;  2AWN A;  1JJG A;  1YHB A;  1E7Z A;  3I55 A;  4A3I G;  1J5E L;  4IPD A;  3UE0 A;  2A19 A;  3HKS A;  3OYY A;  1HZA A;  1PH5 A;  3K8A A;  4BY7 G;  1HNZ L;  4JI2 L;  1KRS A;  2YV5 A;  1WCM G;  4DK3 C;  4C3J H;  2K52 A;  3F2C A;  1VQC A;  4UP8 A;  1HZC A;  3I4M H;  5HY6 A;  4HIM A;  3SGI A;  4LFC Q;  3GTM H;  1OXU A;  2UXB Q;  4LFC L;  4EX5 A;  4DV4 Q;  4R4C A;  3A5U A;  1YI2 A;  4DV1 Q;  2Q2H A;  2WB1 G;  3EN2 A;  1SE8 A;  3G4S A;  4JG2 A;  3PF5 A;  1X55 A;  3PSI A;  2IY5 B;  4A4I A;  4PZ6 A;  3WWV A;  3W5O A;  1FGU A;  4DV2 L;  4DV7 Q;  4JI7 L;  1Q8K A;  4GN5 A;  3HOU G;  2Y0S E;  4JI0 Q;  2I5L X;  3I56 A;  1N34 L;  4GLX A;  1TWF H;  5IY0 A;  2CWA A;  4DKA C;  1K9M C;  1BVS A;  2KBN A;  4DR3 Q;  1Q46 A;  1GM5 A;  5C4X H;  1HJP A;  1KD1 C;  1VQD A;  4IJH A;  1Y1W H;  4Y52 H;  4DR6 L;  2ZTD A;  2N3S A;  3U50 C;  4QJF A;  4C2M H;  4BBS G;  4A76 A;  3T1Y L;  2K5V A;  1HNW L;  3AQQ A;  4L5R C;  4DUZ L;  3E0E A;  2A1A A;  4DR4 L;  5M3F G;  1VQN A;  3GTK H;  3K7U C;  3PUY A;  4DV2 Q;  1M90 C;  2ID0 A;  3J81 c;  3H15 A;  1N9W A;  1J6Q A;  3FKI H;  4LNQ A;  4HIO A;  5FJ8 H;  2JA6 G;  3JAM i;  1I3Q H;  1HZB A;  3K7A H;  3PUV A;  4A3K G;  1VQ6 A;  2NZH A;  1QUQ A;  4KHZ A;  2LSS A;  2HQL A;  1X9N A;  3L7Z C;  3BZK A;  2AWO A;  3D0F A;  3OTO Q;  1VQ9 A;  5M5W H;  4DR3 L;  4A3B G;  2OTJ A;  3OTO L;  3T1H L;  2ASB A;  1VQF A;  4P72 A;  1SLJ A;  1CSP A;  1G51 A;  2XGT A;  4UPA A;  3M9B A;  5EAY A;  2BH2 A;  4QY7 A;  1N34 Q;  3PO2 G;  3RR5 A;  3J80 i;  4AQY L;  2QA4 A;  3RZD H;  1EQQ A;  2B63 G;  2R7Z G;  5IYD H;  3HOV G;  1KL9 A;  4HJ7 A;  4LUV A;  1HNZ Q;  4JI2 Q;  4JYA L;  2NVQ H;  1PH6 A;  1VQ4 A;  1BBU A;  3NEN A;  2Z0S A;  2IHF A;  2VL6 A;  3CF5 A;  2ALY B;  1LUZ A;  2F52 A;  4UY8 C;  1G6P A;  4GOP A;  1XJV A;  3CCM A;  4WJ3 M;  1K83 H;  5M3M H;  4JI4 Q;  1U5K A;  2MO1 A;  1PH2 A;  3CCJ A;  3K80 C;  3PCO B;  3AFP A;  4DR4 Q;  4NXN L;  1PH7 A;  2IX1 A;  1EFW A;  1SRU A;  1N32 L;  2JEA I;  4L5T A;  3TRZ A;  1TWC H;  3RN2 A;  2NVT H;  1YBY A;  4JI0 L;  1QVF A;  4DK6 C;  4LF4 Q;  1IL2 A;  1V43 A;  2DUD A;  1HR0 W;  4LF4 L;  4R4Q A;  4PZ7 A;  2E5L Q;  4TVA B;  4JYA Q;  2K75 A;  5J3B A;  1HZ9 A;  1SN8 A;  3CME A;  2N8N A;  5C0X G;  3NEL A;  1OXX K;  3B6Y A;  4DUY L;  2XTI A;  4DR2 L;  1PYS B;  3ULL A;  4DUY Q;  4DR2 Q;  1HR0 Q;  1VQP A;  4BY7 H;  1OXT A;  3F8T A;  3CCL A;  1HNW Q;  5AJ3 L;  3CCU A;  1AE3 A;  2JA9 A;  3RNU A;  4A3E H;  1CKN B;  1A0I A;  2DGY A;  3F2B A;  1Q12 A;  4IO9 A;  2R6G A;  4AYB E;  2I5H A;  4AIM A;  1UEB A;  4R4O A;  4HIK A;  1EIY B;  4PZ8 A;  4PG3 A;  4DV0 Q;  3GTP H;  2R93 G;  4X66 L;  2VNU D;  4DV0 L;  1PVO A;  3FHW A;  3JAM c;  3H3V I;  1X54 A;  3EIV A;  2MFI A;  2F3I A;  3TEH B;  1YJW A;  1YZ6 A;  4GLV B;  2KHJ A;  2JA5 G;  3AEV A;  3MEF A;  1XMQ Q;  4YHH L;  2OWO A;  4HJ8 A;  2UUC L;  3HOZ G;  4YHH Q;  3PIP A;  1YIT A;  4KLK A;  4DR6 Q;  4JI1 Q;  2VUM G;  1D7Q A;  3KF8 B;  3W1G A;  3M85 A;  3HOV H;  4GKJ Q;  4RG1 A;  1K3R A;  1X3F A;  1I94 Q;  1XMO Q;  1Q82 C;  1P16 A;  1FJG L;  3UDX A;  1S3O A;  4A3C H;  1IZ6 A;  2V1C C;  5FLM G;  1EQR A;  4A3E G;  3CCR A;  4POG A;  4UP9 A;  3D31 A;  2E8G A;  3KYH C;  3UDF A;  4TQU S;  4R4I A;  4YCW A;  4BA1 I;  3BJU A;  4X64 Q;  4GN3 B;  5GAE C;  3S16 H;  4JI8 Q;  4A3M G;  2K50 A;  4JI4 L;  4A3L H;  2PQA B;  4B3R Q;  3DLL A;  4OON A;  2WAQ E;  5C3E G;  4NXN Q;  1I50 H;  1DGS A;  4YWL A;  1XNQ L;  3GTL H;  3AYH B;  4JV5 Q;  3KJP A;  4DV5 L;  5C3E H;  4IPC A;  4X66 Q;  1ASZ A;  1N32 Q;  1KHI A;  1W3S A;  5JEA G;  1J5E Q;  2YU9 H;  4LF8 Q;  4DAY B;  3HOU H;  2BA1 A;  4AQY Q;  2UUB Q;  4B3M L;  3PO3 G;  2EQS A;  3HOX H;  4DR7 L;  1X65 A;  1GKH A;  2ES2 A;  3E9I A;  1PFS A;  1VQJ A;  2K4K A;  4A3D G;  3CC4 A;  1TWA H;  2RHQ B;  2L15 A;  2VS1 A;  1A63 A;  3CXC A;  1Q1E A;  4A3M H;  3UDG A;  3VDY A;  4IPH A;  4JBM A;  1KXL A;  2OCE A;  1FVI A;  5IP7 G;  1XPO A;  4B3R L;  1EOV A;  1OXV A;  1NMF A;  2FXQ A;  3W1B A;  3S1R H;  1IXR A;  3G48 A;  3GD7 A;  4YCV A;  5ELN A;  4B3S L;  1GVP A;  1IBK L;  1C7Y A;  1K8G A;  4IFD J;  2JE6 I;  4L5Q A;  2OQK A;  4LF5 Q;  5LMN Q;  4BBR H;  4ALP A;  1R9T H;  3HOY G;  2PNH A;  3A0J A;  3TRE A;  3L0O A;  3JC6 6;  4HJA A;  5E7N A;  2I0Q A;  2ZJQ A;  4DV3 Q;  1Y1V H;  1YEZ A;  4R4T A;  4P73 A;  2NN6 G;  1VQI A;  3PO2 H;  2NZO A;  2KCT A;  1AH9 A;  2MQH A;  4BBR G;  5LMN W;  3J7Z C;  3T1H Q;  2CFM A;  2R7Z H;  2B3G A;  1OXS C;  2UUC Q;  2NVX H;  2JA6 H;  1B7Y B;  1D8L A;  5C0X I;  4HJ5 A;  4GOP B;  4R1J A;  4EQ5 A;  4DNI A;  3DM3 A;  2JA7 G;  3KJO A;  2VQF Q;  1XPU A;  2YYZ A;  1PH8 A;  3CC2 A;  1U0L A;  5IP9 G;  2R92 H;  1I6H H;  2Z6K C;  4J15 A;  5IWA Q;  4A3I H;  4BA2 I;  1NE3 A;  1KRT A;  4DR1 Q;  2HIV A;  5K36 G;  2YTV A;  2JEB I;  1Q1B A;  1PH1 A;  4BXX H;  1E24 A;  5LMN L;  1WOC A;  3FKI G;  4O0A A;  1A62 A;  1IBL L;  3K0X A;  4UP7 A;  2F4V Q;  2LXJ A;  4QIW E;  3H0G H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...