2JA7H

Cpd lesion containing rna polymerase ii elongation complex c
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
135
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*AP*GP*TP*AP*CP*TP*TP*GP *AP*GP*CP*T)-3'
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 16
structure length 135
sequence length 145
chains with identical sequence T
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ja7H00
1SR3A 2CWAA 3I4MG 4LUZA 3PUVA 2HQLA 4YWKA 5FJ8H 2JE6I 5GAHC 1B70B 1BBUA 1VQHA 1NE3A 1VQCA 5HGQA 3CXCA 2CFMA 1CUKA 4DV2L 3HOUH 3J81i 2R7ZG 2BH8A 4DV2Q 3J81c 5M3MG 4DR3L 1C0AA 2VQFL 2PI2E 4GOPB 4P75A 3H0GH 4B3SL 3AFPA 3A5ZB 4DR3Q 2K5HA 2VQFQ 4JI3L 3H3VH 1XNQQ 2IHEA 2EQSA 4B3SQ 3CMAA 4GLAC 3JAMi 2K5VA 4HJ8A 4JI3Q 2I5MX 4DV3L 4A3DG 3MEFA 4IJHA 4PMWA 4DV3Q 3ULPA 3OYYA 1PH4A 4DR6L 4DV5Q 1KQSA 1VQAA 3BZCA 4IPDA 4UP7A 1YEZA 3W5OA 5IYCG 3M85A 2BH2A 4DR6Q 2QA4A 2F3IA 1XMQL 3AQQA 4QL5A 2L15A 1EIFA 3RZOH 4MTNA 1XMQQ 4KHZA 1N8RC 1VQ6A 4GLXA 4JBMA 4A3MH 3ULLA 4DKAC 4JI7L 4LF5L 1P8LA 1OXTA 4EX5A 1JE5A 4JI7Q 4LF5Q 3KFUA 2F4VL 5C4XG 2C35B 2JJQA 2NN6G 2AMCB 2PQAB 4DR2L 1J5EL 2F4VQ 4K0KL 4DR2Q 1J5EQ 4JYAL 3GD7A 4DUZL 4K0KQ 2R7DA 1VQOA 4JYAQ 1J6QA 4DUZQ 3CCEA 1KRSA 3GTKH 3L7ZC 3NEMA 1GM5A 4C3HH 3AEVA 4P71A 1N36L 3L0OA 3U4ZA 5M3FG 1VQPA 4QIWE 1E1TA 4A3IG 5HY6A 1N36Q 2UXCL 1HNWL 1T9HA 1XPRA 3KDFB 2NVQH 4DV1L 2UXCQ 5ELOA 1CSQA 2XGTA 1HNWQ 1TWGH 4R4TA 1A0IA 3OTOL 4DV1Q 1YHQA 4Y7NH 5C0XI 1KL9A 1UE6A 3OTOQ 2HT1A 2I5LX 2JA7H 5JJKA 5H1SE 1VQDA 3UE1A 2VQEL 3UDFA 2B3GA 1CKNB 3T1HL 1N34L 2VQEQ 2QGQA 4LW1A 3T1HQ 4HIKA 3CAMA 4PZ8A 1N34Q 3S2DH 3H0GG 1PYSB 2ALYB 4ME3A 3PF4A 1SN8A 1Y1VG 4JCVE 5AJ3L 3K0XA 2E2HH 2VZAA 1FL0A 2EIFA 3PUYA 2KBNA 5AJ3Q 4LF8L 2ID0A 4QGUA 3HOYH 2AWOA 4A3BG 3F2DA 3J7ZC 1X3GA 4LF8Q 1D7QA 3TS0A 2D0PA 4DAYB 3FHWA 4A3CH 4JG2A 3TS2A 3TEHB 1G291 1IXRA 2K14A 4QJFA 5IE8A 4LFAL 4YCUA 3W1BA 1UE7A 4DPGA 4LFAQ 3CP0A 5LMUL 3CCJA 4A3FG 3CCMA 2ES2A 1EQRA 1Q1EA 5LMUQ 3I4NH 4J15A 2R6GA 2CWPA 1YJ9A 4NB3A 2UU9L 5C3EH 1YI2A 4OX9L 2R7FA 4IOCA 4NXNL 3S1RH 2UU9Q 1K9MC 4IFDJ 1VQFA 1A8VA 1CKOA 4AH6A 1PV4A 4LFCL 4NXNQ 4OX9Q 1HR0L 3M3YH 4WJ3M 1VQGA 1YJWA 1V43A 3JC66 4BY1G 4BBRG 3CW2C 4LFCQ 1HR0Q 2BA1A 4OONA 3HOXH 1R9TH 4GNXC 1XMOL 1B8AA 1ASZA 3TREA 3CCUA 1VQ9A 4A3KH 2WAQE 3I2ZA 4LWCA 3HOWH 4OO1G 1JT8A 5FLMH 1W2BA 1V9PA 1CSPA 3PO3G 4P74A 2IX0A 2ATWA 4BY7G 1WI5A 1DGSA 3M4PA 2RF4A 2DGYA 1K8AC 5ELNA 1N9WA 1TWFH 1AE3A 1JB7A 1IBKL 2NVTH 2R93G 2VUMH 1IBKQ 5JEAJ 1IL2A 4HIMA 3KF8B 3KLWA 5LMNL 2GVAA 3EN2A 1VQKA 2IHFA 1Q86C 5LMNQ 2JA5G 1IBLL 1GKHA 1B7YB 3FKIG 1XJVA 4LUOA 2NVYH 1IBLQ 3L2PA 3ZJYC 2B63G 1S40A 2K50A 2VL6A 4A75A 1KRTA 1XNRL 1EWIA 1VQMA 1MKHA 3PUZA 2QEXA 4BA1I 4LF7L 1XNRQ 3STBD 4LF7Q 3EBEA 4R4CA 4BXXG 1YITA 1HNZL 1PH2A 4AIMA 1PVOA 4XIGS 3SGIA 3HOZG 1HNZQ 3S14H 4PZ7A 5C44H 2MNAA 2OWOA 4R4OA 2VNUD 1Q8KA 4X6AH 4JC0A 2BA0A 3CF5A 4A93G 4JOIA 1PH6A 2OQKA 1UEBA 2Q2UA 1OXXK 3M4OH 4JI4L 1OXUA 1KXLA 2N8NA 4X64L 4JI4Q 1NBWA 4GOPA 1KHIA 1VS0A 4X64Q 4DR4L 3JAMc 5DLQE 2IX1A 3KJPA 4DR4Q 3KYHC 1VQBA 1E22A 5IYDH 4IPGA 3GO5A 5JJLA 4A3LH 5IP9H 4GS3A 4IJLA 4GLVB 1Z9FA 1WCMH 3CMEA 4L5RC 1X3FA 4C3JH 5IWAL 4UP8A 1K3RA 4YHHL 3PSIA 2GN5A 5IWAQ 4ALPA 4YHHQ 2AHOB 1U5KA 1VQLA 1PA6A 1XTDA 4C3IH 2WAQG 2AWNA 2JA9A 3UDIA 1VQNA 4JOIC 1PH8A 1HNXL 4L5SA 3GTGH 4HJAA 1HNXQ 4APVA 5C0XJ 1WOCA 2PQAA 1VQEA 3RN5A 1BKBA 4GOPC 2JA8H 3GTMH 1O7IA 4PZ6A 3Q8DA 1Q46A 2KENA 5J3BA 5IT9c 3S17H 3CD6A 1K73C 3GDEA 3S16H 1TXYA 2H5XA 3CQZH 4O0AA 3PO2H 3ICEA 2JA6H 4DR5L 1M90C 4UY8C 1Q7YC 3D0FA 5FJ8G 2CKZB 3KDFA 3IRBA 2VY3A 5GADC 4DR5Q 4DR7Q 1GD7A 2ZTCA 5IYBH 3OW2A 1NJIC 5C4JH 4B3TL 3RLOA 5BR8L 5IP7H 3HOUG 1E1OA 1QUQB 4B3TQ 5BR8Q 3AYHB 4UP9A 1VQJA 3HOVH 1HZCA 5K36G 1CKNA 3ER0A 3S15H 1W3SA 3F1ZA 4RMFA 1M1KC 4A3EH 4X62L 1Q82C 3PV0A 3TQYA 5E7NA 3E9HA 4X62Q 3CC7A 1L1OB 1Q12A 3F2CA 1X55A 2UUCL 3A74A 5JJIA 1AH9A 2K52A 4JBWA 2UUCQ 4HJ7A 2NZOA 1EIYB 5IYDG 5EAYA 4BBSH 1LUZA 4DV6L 1EYGA 3HFZB 4OO1I 1NTGA 1JMCA 3CC4A 4DV6Q 2ZJRA 2KCMA 1WCMG 2R92H 3E9IA 2UXDL 1K8GA 3RN2A 2UXDQ 4RG1A 4MZ9A 4A3MG 1I5FA 4JI5L 4Y52H 1FJGL 4GNXB 1LTLA 3PIPA 4JI5Q 1E3PA 2Y0SE 1FJGQ 3S1MH 3J80i 3F2BA 1Q81C 2OTJA 1PH7A 1QVCA 3U58A 1P16A 4YY3L 4OXPA 3J80c 1OXVA 4YY3Q 4DR1L 2UUBL 4POGA 1BVSA 4DR1Q 2UUBQ 1XNQL 1KAWA 1VQ5A 1IYJB 1CKMA 4DV5L 1XMOQ 2E2IH 3UDGA 3PCOB 1H95A 3I4OA 1PYBA 2Q2HA 4X65L 1SE8A 1UWVA 2RHQB 3AFQA 4UPAA 4DK3C 4X65Q 4QY7A 1TWHH 5M5WH 2JA7G 3G48A 1QVFA 4GN3B 2PNHA 2R7ZH 4LF9L 3S2HH 4AYBE 1JJ2A 4GKKL 5M3MH 4B3ML 4LF9Q 4GKKQ 1WJJA 4JI8L 3A5UA 2XTIA 4LNQA 4B3MQ 3HOVG 2PI2A 1V1QA 1NMGA 2E8GA 4JI8Q 2D62A 4A3EG 4A3DH 1JJCB 3TRZA 2JEBI 2V1CC 5GAGC 1EUJA 2MQHA 2ASBA 3I55A 2LXJA 3HOYG 3PUWA 4JI1L 3RLFA 1HZBA 2Q2IA 2MO0A 5IYCH 3J81j 2ZJPA 4JI1Q 1RIPA 4A3GH 4R1JA 3KOJA 1VQ4A 4A3CG 4JI0L 4OWXB 4DUYL 1I50H 4KI0A 3CCQA 2MO1A 1C7YA 1OXSC 4YCVA 4DUYQ 4AQYL 2I0QA 4JI0Q 4NXML 1WFQA 3GTOH 4NXMQ 3KF6B 4AQYQ 2LSSA 1PFSA 3U50C 4DV4L 3DM3A 1YHAA 1MJEA 3A0JA 5FLXc 4DV4Q 3I4NG 1QVGA 2KCTA 5C3EG 2NN6I 1X3EA 5GQOA 3VDYA 3RR5A 1S72A 1L0WA 1KIXA 4WJ4A 1LYLA 3GTQH 1N32L 2YTYA 2WP8J 1X54A 3K8AA 5IY0A 4TQUS 2LXKA 1L2FA 4P73A 3I56A 3HOXG 1N32Q 1SROA 2IT1A 2NZHA 3I7FA 4DAMA 5M5XH 5M3FH 1QZHA 2E5LL 2JEAI 4A3IH 1TWAH 2EXDA 1AE2A 1IZ6A 2WFWA 1MJCA 2E5LQ 4A3KG 4IFDG 2RHSB 1XPUA 2Y0SG 1KC8C 2UXBL 3DLLA 3HOWG 3W1GA 1X9NA 2UXBQ 5FLMG 4A76A 2VS1A 3ERSX 3CCSA 3D31A 4PG3A 3G71A 1I94L 1K0RA 3G6EA 2PMZE 3M7NA 4DR7L 1SRUA 1I94Q 2KHJA 4B3RL 3T1YL 1HZ9A 4B3RQ 1E24A 3T1YQ 2VUMG 1Y1VH 4LFBL 2N49A 3H3VI 1C9OA 4POFA 4LFBQ 3K7AH 1A62A 4JI2L 1HJPA 1S3OA 1EFWA 1X6OA 4IO9A 1UE5A 4A3BH 3MXNB 1TWCH 4JI2Q 4IPCA 1PH1A 2OTLA 1FVIA 4AYBG 1QZGA 1SMXA 4A3GG 5JEAG 4YWMA 4DV0L 3J7A5 3FP9A 2DUDA 5GROA 1I3QH 4R4IA 4DV0Q 3M4QA 4HIDA 1X56A 4GN4B 2OQ0A 1VQ7A 1Z47A 2K75A 4A3FH 1HZAA 1LM0A 2A1AA 2B29A 3HKZG 1SFOH 2E2JH 1X65A 4L5TA 1K83H 2UUAL 4IOAA 3RNUA 4LF6L 3K81C 2K5NA 5C44G 2UUAQ 4A4IA 1N33L 4LF6Q 3S1NH 3RLNA 3PF5A 2CQOA 3BU2A 1N33Q 4BY1H 1SLJA 2ZTDA 4BBRH 4IPHA 1QUQA 2RCNA 2I5HA 3S24A 3GTJH 3HKSA 3NELA 4JBKA 2YV5A 1E7ZA 2WB1E 4FDBA 2YYZA 2D0OA 3G4SA 2HIVA 4A3JH 3BJUA 3KJOA 3F8TA 2A19A 3E0EA 4YWLA 5GAEC 2VW9A 1L1OA 2YTXA 2YU9H 3CC2A 3PO3H 1HR0W 2Z6KA 4GKJL 4R4QA 1Y14B 4HIOA 1MIUA 3K7UC 1PHJA 5IP9G 4A3LG 4OWTB 4BY7H 4GKJQ 2YTVA 4DV7L 1Y1WH 4DV7Q 3CPWA 2R93H 3K80C 3PIOA 1PH5A 3UE0A 3PGZA 1GVPA 3GTPH 2CCZA 4L5QA 1YJNA 4O2DA 2JA5H 1OTCA 5M5YH 2HHHL 4GNXA 3FKIH 1HH2P 2K4KA 2GVBA 3CPFA 3LGJA 4C2MH 2HHHQ 3CCLA 1A63A 3B6YA 1FGUA 3WWVA 2NVXH 2B63H 2JA8G 1PH9A 1YHBA 1RL2A 3UDXA 1KD1C 2N78A 1L1OC 4BA2I 4BXXH 2ZM6L 2Z6KC 3I4MH 1YZ6A 1ASYA 5LMNW 5C0XG 1XPOA 2N3SA 2ZM6Q 3PO2G 3M9BA 3HOZH 2JA6G 2JQOA 4XTCS 1VQ8A 1YBYA 2FXQA 4P72A 3NBHB 5IYBG 4JI6L 3U4VA 2AKWB 5IP7G 4A93H 4JV5L 4JI6Q 1YIJA 1G6PA 4JV5Q 4JBJA 3H15A 4HJ5A 4LF4L 1GO3E 3NENA 4NPSA 2KHIA 3CCVA 4LF4Q 3ULJA 1U0LA 2ZTEA 1VQIA 3HKZE 2F52A 4A3JG 3PUXA 1JJGA 4GN5A 4IFDI 3CCRA 1EOVA 3STBC 3S1QH 4LUVA 1BBWA 4BBSG 4QQBX 4X66L 1Q1BA 3GTLH 4X66Q 1G51A 2HIXA 2R92G 1NY4A 3RZDH 2WB1G 1Y1WG 1PH3A 4KLKA 2JK8A 5C4XH 4HJ9A 1EQQA 4EQ5A 3KF6A 1IBML 2Z0SA 1IBMQ 4OWWB 4YCWA 4KHPL 1YVCA 4H02A 4TVAB 4KHPQ 4DNIA 2ZJQA 1I6HH 4DK6C 1VCIA 3EIVA 2IY5B 2Q2TA 2MFIA 1D8LA 2OCEA 1NMFA 1YNXA 4MNOA 1WYDA 2A8VA 3BZKA 1UE1A
chains in the Genus database with same CATH superfamily
3I4MG 4LUZA 4YWKA 1EWHA 2JE6I 2LS01 3GV3A 4DXFA 1VQHA 5BN4A 5IGGA 1LTRD 1IW7D 2RA4A 2F0VA 4K5XA 3J81i 2R7ZG 4KMUC 3ND9A 1K8MA 3J81c 1C0AA 1HQMC 2XIWA 2HUGA 4L8JA 1GJXA 3H0GH 4B3SL 4DR3Q 2F0NA 2G9HD 1XNQQ 4GLAC 4JI3Q 5I9PA 1CQFA 3ULPA 3SK4A 1PH4A 3M3YB 3BZCA 3M85A 1YEZA 3C1EA 1MSGA 2CW0C 1EIFA 5IT9L 1TS3A 4GLXA 2H4OA 3AU7A 4YIJA 1BQQT 4JBMA 2RSNA 2Y0SB 3ULLA 3D4RA 4DKAC 1HFGA 1JE5A 3KFUA 5C4XG 1DZ1A 2F4VL 2C35B 2JJQA 2NN6G 2PQAB 1J5EL 2F3WA 5IT9E 1BO0A 1LTTD 1BBXC 3GD7A 3M4YA 2R7DA 3T51B 2F3VA 4JYAQ 4DUZQ 1KRSA 1SNDA 4C3HH 1FNUA 3VR4A 2K5DA 4DV1L 2UXCQ 1CSQA 2XGTA 1A0IA 4C56C 1SE4A 1ET9A 5CMDA 3UE1A 2MHVA 2B3GA 3NWTA 3T1HL 4FXGC 3EA6A 5KYIA 2VQEQ 1N34Q 1Y69U 4CKEA 2FFKB 4ZKBB 1SE2A 3PF4A 4ME3A 1SN8A 2HDLA 2F0MA 2KBNA 3NHHA 3J7ZC 3F2DA 2LKVA 4OEMB 4H13C 3FHWA 4QUFA 4A3CH 3N52A 3MHBA 1SYFA 3VA5A 3W1BA 4DPGA 1TWAB 4LFAQ 5EKKA 3I4NH 2ES2A 1Q1EA 2UU9L 4NP5A 3SE0A 1C4QA 5C3EH 2C5CA 4WRDA 4NXNL 1K9MC 4IFDJ 1CKOA 5KYLA 3NBHA 4BY1G 1R9TH 4OONA 3DWPA 1ZYRD 3TREA 1VQ9A 2WAQE 3I2ZA 3C3LA 1FD7D 2JP1A 3CKIB 2PW7A 3PO3G 4IURA 4DA2A 4L6TB 2JA8B 4FF2A 2B2YA 2DJGC 5ELNA 1JB7A 1AE3A 2ZXRA 3VYRA 1IBKQ 4X3TA 1FR3A 2JA6B 3S14B 3KUPA 3KF8B 5LMNL 2IHFA 3A54A 1B7YB 4KKSA 4LUOA 1NAPA 1IBLQ 2DY8A 4HCEA 3ZJYC 1BCPB 2WACA 3PIP3 2FHTA 1STGA 2EYOA 4WFN3 4LF7Q 3SHLA 3SGIA 1B9NA 1Q8KA 1G91A 4KY5A 3CF5A 1PH6A 5IGEA 2EPBA 1OXXK 4IUVA 4ZLTF 2N8NA 3KLSA 4FO2A 4GOPA 3GTPB 1VS0A 3KJPA 4DR4Q 5ELCA 3IFTA 3ND8A 2KEDA 1UNSA 3QO2A 1S5DD 5JJLA 4K5WA 2E74C 4L5RC 4IJLA 1WCMH 1X3FA 5IWAL 2E2IB 3OWEB 4HR7B 2X69A 2BDNA 1S5ED 4YHHQ 2CHBD 1U5KA 3OSOA 4C3IH 3TP6A 2PO4A 2OXPA 1HUNA 1WTOA 1HNXQ 1WOCA 1BKBA 5IOCA 4GOPC 1SXTA 4PZ6A 3Q8DA 2KENA 5IT9c 3OIQA 3MTSA 3S16H 1D5ZC 2F0GA 3D0FA 5GADC 1GD7A 1NJIC 4DF7A 2X6LA 5C3XA 5IP7H 1E1OA 5DAUA 4B3TQ 5BR8Q 4UP9A 3HOVH 2PZTA 1CKNA 1QB5D 1M8AA 3F1ZA 4DXGA 1PXUA 2L0CA 1M1KC 4X62L 1D5MC 1EYCA 4FF1A 1K8OA 4OIJA 3CC7A 3E9HA 2PW5A 4BWGB 1BXTA 3CRKC 3VR6A 1AH9A 5JJIA 1JOKA 3KLRA 2NZOA 1JWMD 4HMJA 1EYGA 3HFZB 1KDCA 2KCMA 2L12A 2RKSA 2D5DA 3E9IA 2FJ2A 2JYOA 2UXDQ 4A3MG 1FJGL 1ZXTA 1E3PA 3S1MH 1PRTC 3N6RA 1BOSA 3HOUB 5EKLA 4YY3L 4OXPA 2V4DA 2EJFC 1NNXA 3I90A 1DM0B 1VQ5A 1IYJB 1CKMA 4R8NA 5KNDA 1H95A 1KTKA 2WIIB 4X65L 1PYBA 4DV5Q 3AFQA 4A3BB 3T4AC 4CHTB 2NWGA 5EGTA 4IUNA 1TWHH 5M5WH 2JA7G 1O80A 4GN3B 4ZAIA 3BVGA 3G7LA 5IODA 1NR4A 4LF9L 3Q6SA 1ILPA 5CV7A 3RZOB 5M3MH 4GKKQ 1T5EA 1V1QA 5EPLA 4A3FB 1MHWC 2E2JB 5J39A 4A3EG 1JJCB 1TS4A 5GAGC 2MQHA 3Q24A 3I55A 3BYTB 3HOYG 1EIHA 1HZBA 2MO0A 4JI1Q 1HA5A 4JI0L 4IN3A 4NDXA 1C7YA 2I0QA 5LHY1 2IX3A 4DGZA 5T1GA 1PFSA 3U50C 1YNNC 4DV4Q 2IJ0A 3WOEA 5HURA 3RR5A 1KIXA 1L0WA 2RVLA 2L55A 5IY0A 1F2LA 3E5SA 2LXKA 1L2FA 4P73A 2BOSA 1N32Q 2VXWA 3S2DB 1SROA 2IT1A 1PFMA 4A3IH 1TWAH 2Z9HA 1U4LA 1AE2A 1YNJD 2JA5B 1KC8C 3QG1A 3DLLA 3HOWG 1AW7A 2NTSA 2SOBA 1BUVT 3W3AA 2VS1A 1K0RA 1SRUA 4B3RL 1KDBA 1STEA 2QCPX 2K33A 3FPUB 4ABNA 5I2XA 2VUMG 1Y1VH 3VA7A 4RHRA 3HOZB 4LFBL 3H3VI 4POFA 1JR0D 3MXNB 1TY0A 1PH1A 5ELDA 4IUUA 3RMHA 1SMXA 3LX0A 5JEAG 4DV0L 2F0IA 1B1ZA 5GROA 5IIFA 3SDZA 2K75A 1L0YB 5CV8A 1HZAA 3NBIA 2E2DC 1SFOH 3IAYA 1PFNA 3RNUA 1TS5A 2UUAQ 4EQOA 3RLNA 2CQOA 1SLJA 4BBRH 1QUQA 3HKSA 1VMCA 1E7ZA 4FDBA 2D0OA 3K5LA 1BF4A 3R3OA 2ENBA 1U4MA 2A19A 1O7ZA 3E6ZX 1EL0A 1L1OA 2XRSD 3GP7A 4GKJQ 1SJED 1GUOA 4OWTB 1KLGD 3GQBA 4FXKC 3PGZA 3TMEA 3GTPH 2CCZA 4L5QA 1YJNA 2WKCA 3BDCA 1JCKB 5M5YH 3FKIH 1HH2P 2K4KA 3LGJA 3CPFA 1DJRD 3CCLA 1QWYA 3WWVA 2NVXH 2B63H 1JB3A 1MI2A 1PH9A 2PQEA 2NUCA 2FINB 1RL2A 5DM73 2L9HA 1KD1C 1L1OC 5DM63 4BXXH 2N3SA 3M9BA 2JQOA 2AQ2B 1S5BD 1GOZA 2FXQA 5IGBA 5IYBG 4F88A 4JI6L 1ENAA 2AKWB 4Q0FA 4JV5L 1YIJA 1G6PA 4XQNA 5I9OA 1AP0A 4HJ5A 4LF4L 2QKIC 4NPSA 3CCVA 2ZTEA 4KY6A 2F52A 4A3JG 3PUXA 3J7AF 5M9OA 1MD2D 3AMUA 3STBC 3P20A 1BBWA 1RCVD 4BBSG 2KECA 4X66L 4QQBX 5A35A 1C8CA 2F0UA 2WB1G 5EQ0A 3J7YW 1STAA 1Y8PB 2F0SA 2QEJC 4K6DA 5EKIA 2EYJA 2XVSA 4KHPQ 5EBCA 3S15B 2A6HD 2A8VA 1WYDA 1ML0D 1DYQA 1UE1A 3J81E 1SMYC 3PUVA 4IQZA 3OHXC 3TBIB 5D3IB 5GAHC 1BBUA 3T53B 3CXCA 3HOUH 1B2TA 2BH8A 4DV2Q 4DR3L 5K36H 1XNQL 1EY7A 3AFPA 3H3VH 4JI3L 4P2CB 2IHEA 2EQSA 1WTQA 3CMAA 3I4NB 2EXZA 5E3FA 5FO9B 3KK7A 5C3EB 4A3DG 4DV3Q 3OYYA 1KQSA 4DR6Q 3W5OA 5IYCG 3MC0B 2O2LD 3P75A 2L15A 3RZOH 1N8RC 4X3UA 5FKAC 1CK1A 2B2UA 2C9OA 4JI7Q 1XYIA 4JYAL 4DUZL 3V05A 1TIID 1VQOA 1V1OA 2BCOA 3L7ZC 3D4WA 3NEMA 1GM5A 3AEVA 1SSOA 1EU4A 1H9KA 3L0OA 1VQPA 1I4GA 2UXCL 2NVQH 5ISRA 5JJZA 1EYAA 3SK5A 5ELOA 1HPCA 4CDCC 1UE6A 5C0XI 3OTOQ 2I5LX 2Z8LA 2VQEL 3UDFA 1LT5D 1N34L 4CDFC 1JC7A 3S2DH 3CAMA 4PZ8A 4JPBW 3NUCA 1TQOA 3H0GG 1PYSB 1LACA 4RWSC 1EQVA 3HKZB 1IL8A 1CHPD 1XWEA 2VZAA 1EU3A 1FL0A 4CJ1B 5COYA 1ONLA 2B2VA 4QGUA 3J80L 4B9XA 1D7QA 2PYKA 1PLFA 2HCCA 2SNMA 4XQQA 3TEHB 5IE8A 2A69C 1JOQA 4LFAL 1RKNA 1BR9A 3K0YA 1DOMA 3H91A 3CCJA 1NSNS 5LMUQ 3NQTA 4Q5VA 1YI2A 2R7FA 4OGQC 3S1RH 5CV5A 1PV4A 4OX9Q 4AH6A 1C48A 1IYUA 1VQGA 1YJWA 3A7AB 3TP5A 3HOXH 1QE6A 4GNXC 1PTOH 5EJWA 2B2VC 1XMOL 4JVZA 1ASZA 1WTPA 3L9AX 4A3KH 2EJMA 2A68C 2R3ZA 4OO1G 1JT8A 5FLMH 1CSPA 2OT2A 1EY9A 4BY7G 1WI5A 3DUZA 3M4PA 1I3QB 1IYVA 3S16B 1K8AC 1IBKL 2R93G 5FLXL 1STYA 1IL2A 1RF2D 4KK7A 3E3XA 1IBLL 4NKLA 1XJVA 4BY1B 1RDPD 4NMZA 4KV6A 3L2PA 5FLXE 2JSOA 1S40A 2K50A 4A75A 1MKHA 2N55A 2QEXA 4LF7L 1XNRQ 3U9OA 4AIMA 2RDGA 4DK1A 4PZ7A 3W2DA 5C44H 2OWOA 4R4OA 1V1PB 2DJFC 4JC0A 2BA0A 4A93G 2OQKA 1UEBA 1Y1WB 1CT1D 2DNCA 1K3BC 4UHVA 4DAPA 3BS1A 2LMCB 4JI4Q 4GZYC 1KHIA 4X64Q 4DR4L 3RUZA 3S1MB 3KYHC 2X6GA 1VQBA 5J22A 5CV6A 2RDHA 2Q8RE 4MN3A 4A3LH 1L0XB 5IP9H 4GLVB 1WTRA 4C3JH 1K3RA 4YHHL 5LL6X 1BCPD 2GN5A 2F0HA 1PA6A 5BN3A 1TWHB 3HGBA 3UDIA 5M5WB 1WD0A 1PH8A 1HNXL 2QW7A 4L5SA 1EY5A 3GTGH 4HJAA 1UEAB 5C4HA 2PQAA 3RN5A 5M3MB 1UUPA 1K0SA 3WOFA 4KJNA 3GTMH 1W6JA 1Q46A 2G5DA 3BDOA 4HN7A 1K73C 5E1FA 3GDEA 5C0XH 3PO2H 4O0AA 1TR5A 1EY4A 4RKLA 5KNBA 1M90C 5FJ8G 4UY8C 2CKZB 3IRBA 2VY3A 3OW2A 4PQXA 5C4JH 3RLOA 5BR8L 4B3TL 3ER0A 3S15H 1W3SA 1KNAA 1HTPA 1Q12A 1G6ZA 5C5MA 2K52A 1WTWA 2UUCQ 3VR2A 5EAYA 2A6ED 1NTGA 3CC4A 4XT1B 1MSHA 2ZJRA 3TP8A 1QJOA 1WCMG 4A3IB 2UXDL 1K8GA 1TVXA 4ULLA 1ESFA 1I5FA 2O5IC 4C3IG 4JI5Q 2NTTA 3IL8A 2N88A 3PIPA 3J80i 1Q81C 1SEBD 3ERQA 3J80c 4CKBA 1KAAA 1BVSA 2LFNA 4DR1Q 1QOHA 4ZRZA 2UUBQ 1Y1VB 4DV5L 1XMOQ 3UDGA 2Q2HA 4UPAA 1UWVA 5JAVA 1CTMA 2G9DA 2XWJB 2PNHA 4IUPA 2R7ZH 3S2HH 4GKKL 2ICIA 4KN7C 2K5WA 4J8QA 3HOVG 1NMGA 2FMCA 2O4XA 1SFOB 1EUJA 1Z6HA 1RJTA 3KF8A 4JI1L 3TP7A 4BBRB 2ZJPA 4XT3B 3PIO3 1RIPA 1F9QA 1F2YA 1D1KA 2L4NA 4DNRB 4OHJA 1I50H 1IW7C 3GTOH 2B2WA 1SNOA 2F0WA 3NTKA 3KF6B 3SK6A 4DV4L 3PQIA 4RHSA 3QR8A 4CJ0B 5FLXc 1TWGB 2KCTA 2NN6H 2B2YC 1X3EA 1LYLA 1N32L 2YTYA 3OMGA 1X54A 4QMGA 2J7ZA 1GHKA 2DY7A 2NZHA 2RSOA 3P7JA 3I7FA 5HGTA 1GUGA 1QZHA 1A2TA 2RBMA 1HCZA 1MJCA 4IFDG 5M5YB 1XPUA 2Y0SG 3FKIB 3I72A 3HOYB 2UXBQ 1X9NA 2B63B 2NVXB 3M7NA 3D31A 3ZYYX 3G6EA 2TMPA 1I94Q 2BE5D 3BVMA 3URYA 4HEDA 1IKLA 3DEPA 2N49A 3M4OB 1CHQD 1EFWA 1X6OA 4OL7A 4IO9A 3MEHA 1TWCH 2KCCA 4IPCA 3H09A 1FVIA 4AYBG 2EE1A 2D9UA 1I3QH 4R4IA 4U673 4GN4B 4R9WA 5G3LD 2A1AA 2PCFB 1G2TA 4L5TA 2UUAL 2K5NA 3KBXA 1WVLA 4BY1H 5C3WA 1FNWA 3SEBA 5AFWA 3S24A 2XRQD 1EY6A 2NVTB 5D14A 2VUMB 2YYZA 3BJUA 3F8TA 1KABA 1EYDA 3EFXD 2WV6D 1E2VA 1H9JA 2KVMA 5GAEC 1B9MA 2YU9H 3CC2A 3PO3H 2Z6KA 4GKJL 3NTIA 1PHJA 4CDEC 4QCLA 5I2YA 5ELEA 1Y1WH 2K5QA 4DV7Q 4RCNA 4ZKCB 3CPWA 1PTOD 4KD3A 5ELFA 2NZ1D 1LTSD 1ZYRC 1DONA 4FF4A 1A63A 1I4QA 4X3SA 2JA8G 1YHBA 2EOTA 4R8IA 1FNVA 2Z6KC 3K5NA 4RGMA 2ZM6Q 1NCVA 2JA6G 4XTCS 1VQ8A 1QILA 4IALA 2AUJD 2HQEA 2Z4IA 2M2LA 5FOBB 4UDUC 3RD4A 3MFYA 4H7BA 1GO3E 2MGSA 3MWYW 4RGNA 2L11A 3ULJA 3T13A 1VQIA 4G7ZC 3HKZE 4PMCA 1QCBD 2EVBA 4F8MA 3GTLH 1V8QA 1G51A 2HIXA 2R92G 3WDNA 1SNMA 1NY4A 1X3QA 5FO7B 2NVQB 5ELBA 1CQVA 2HDMA 2QDLA 1EY8A 2B2TA 1HRJA 2Z0SA 1CA5A 4X3KA 2Z4HA 2IL8A 4YCWA 1S5CD 4KHPL 1YVCA 3A7LA 1NMFA 3BZKA 3DM1A 3EROA 1SR3A 4ODGA 5JPMC 1B70B 3H94A 2NB0A 2CFMA 1CUKA 4DV2L 3Q0AA 3FPPA 3J7AV 2KOLA 2B2TC 3FRPB 2WB1B 3K59A 4P75A 5D65A 2VQFQ 5E4WC 3JAMi 4HJ8A 2I5MX 4DV3L 3S1RB 4IJHA 3D6CA 4DR6L 1TKWB 4UP7A 4IPDA 4HSPA 4ZK9B 2VB2X 2BH2A 3HOXB 3MVVA 3MXNA 2F3IA 3ONAB 1WTXA 1PTOB 2EY6A 3AQQA 1XMQQ 2K05A 4KHZA 2EY1A 4A3KB 4HMIA 1TT2A 3QJYA 4A3MH 4JI7L 1OXTA 3FEWX 4LF5Q 1LT3D 1WTHA 1VDZA 3E0JA 3TZDA 4DR2Q 4K0KQ 3CCEA 3GTKH 3CU7A 3OW7A 3SXHA 4P71A 5M3FG 4MIUA 4QIWE 1N36Q 5HY6A 3K57A 1T9HA 1SYBA 3KDFB 4E6IA 1HNWQ 4TSSA 1TWGH 3OTOL 1YHQA 4Y7NH 2HT1A 1KL9A 5KGUA 2JA7H 2QF7A 3QOLA 5JJKA 5H1SE 4A3GB 2IW3A 3R2IA 3A56A 1OO9B 3EVQA 3O13A 3UI2A 1JORA 3VR5A 4JCVE 3K0XA 2E2HH 5IGFA 2EIFA 3PUYA 5C44B 5AJ3Q 2MJ8A 3VYSA 3FMCA 3HOYH 4A3BG 4LF8Q 1X3GA 4ZUJA 1JQYD 2K04A 2D0PA 3QB3A 4DAYB 1M4VA 3D4DA 3TS2A 2K14A 1IXRA 4QJFA 4YCUA 1AFPA 1JOOA 5C4ZA 5LMUL 1PZID 3IFDA 4A3FG 1EQRA 5EPKA 3HZXA 4J15A 2R6GA 2CWPA 1YJ9A 4NB3A 3M4OH 1HHVA 1KXLA 4OX9L 3I8ZA 1STHA 1VQFA 1A8VA 1T5XD 3L3OC 2D2CC 4I7AA 4RFBA 4WJ3M 4LJZC 4C3JB 3JC66 4LFCQ 1HR0Q 4KKUA 1B44D 1R4QB 2E75C 3CCUA 3GTGB 4LK1C 3HOWH 1U4PA 3U9SA 2L1BA 1W2BA 2CQAA 2IX0A 2ATWA 3GTMB 3CRLC 3PMFA 1B4OA 4CGYB 1N9WA 1TWFH 3PO2B 2NVTH 1F9PA 5CBEE 2VUMH 4CJ2C 3KLWA 1VQKA 5C4JB 1Q86C 2JA5G 1GKHA 1WTVA 1D5XC 4ZQ3A 1YNJC 3TN2A 5JEAH 1CFMA 2VL6A 1XNRL 1HUMA 2H1EA 1D2BA 4R4CA 3VYUA 5NUCA 3NPPA 3HOZG 1HNZQ 2L5TA 3DWAA 3I70A 3H6MA 2MNAA 5IGDA 4X6AH 1O78A 2EJGC 2Q2UA 2MPMA 1G2SA 4JI4L 4X64L 1Q90A 2KHSA 4DK0A 5DLQE 2IX1A 2NYZD 3R8BA 2RDFA 1E22A 5IYDH 4IPGA 1D1IA 4C2MB 2F0KA 2F0LA 1JWUD 5DNFA 1MGSA 3GV6A 4GS3A 3CMEA 1Z9FA 2DNEA 3D8GA 2IPKD 3Q22A 1BCPF 2PNRC 1X32A 3V2TA 2AHOB 4ALPA 3I4MB 4XXEA 1A3UA 1VQLA 2SEBD 1XTDA 1DD2A 2KA7A 2AWNA 2JA9A 2WAQG 1VQNA 1D6EC 2R7ZB 5C0XJ 3S2HB 1VQEA 3C2PA 4M1UB 1O7IA 4K6LA 5J3BA 3S17H 1WD1A 3CD6A 5C5LA 2IWHA 1GUTA 3CQZH 3ICEA 1F77A 2CW0D 4BS9A 4DR5Q 4DR7Q 4RKBA 5IYBH 5I4DA 1I50B 2B2UC 1EY0A 3GTOB 1VQJA 1ET6A 1HZCA 4MTKA 3MXPA 3RZDB 2Z1CA 1BNZA 4RMFA 5C4XB 3TQYA 2UUCL 1X55A 4RAUC 3OPOA 3A74A 4JBWA 1NUCA 4KHVA 4BBSH 1LUZA 4OO1I 1JMCA 1XTCD 4DV6Q 1ZEQX 3J80E 4RG1A 4MZ9A 4JI5L 2CH4A 4GNXB 1LTLA 1E2ZA 4HTHA 1Q3LA 1PH7A 3U58A 4LAAA 1P16A 5T1IA 1HA6A 3ITPA 4DR1L 2UUBL 1KLUD 4C3HG 1PFBA 2R61A 1SE8A 2RHQB 2J4XA 4DK3C 1TWCB 4QY7A 3KLSX 5I6YA 1LABA 3G48A 1QVFA 5J1ZA 4QF4A 5EPJA 4RA8A 1WJJA 3A5UA 2XTIA 4B3MQ 4J1MA 1XX8A 2E8GA 4JI8Q 2D62A 1Z7TA 3SR1A 4A3DH 1H9MA 2V1CC 1E2WA 2ASBA 2A6HC 2LXJA 2I07B 3RLFA 3J81j 5IYCH 1ILQA 4A3GH 4R1JA 2WINB 1VQ4A 4A3CG 4OWXB 1R4PB 5KEEA 2AQ3B 3CCQA 1I4HA 4UAIA 4DUYQ 4NXMQ 1B50A 3CHBD 4AQYQ 2LSSA 3A0JA 3I4NG 1TS2A 2EYHA 2YU9B 3PO3B 2K1BA 4IUQA 5C3EG 2NN6I 5GQOA 1S72A 1PDQA 4WJ4A 4TKOB 4CDDC 3GTQH 2WP8J 3K8AA 4TQUS 3MXUA 4JK1C 3I56A 3I73A 1V1PA 4QIWB 3DXJC 4DAMA 5M5XH 2F0JA 3OIPA 3BVZA 1K28A 1IZ6A 2WFWA 2E5LQ 2F0DA 1Y8OB 2QDBA 3QWNA 2UXBL 3NP8A 3W1GA 4DN4M 1HFNA 3ERSX 1I94L 3G71A 4PG3A 2M9VA 2PMZE 2QILA 2KHJA 2F0OA 1A6XA 2J0TD 3T1YQ 3SK8A 5FO8B 2OEOA 3NQIA 4Z9CB 1C9OA 2E76C 2EYMA 1A62A 1CI3M 1UE5A 4JI2Q 2Q8TA 4B9WA 1J8IA 1RD9D 1U9RA 4XYOA 1SYGA 4FYDA 3DEOA 3J7A5 3FP9A 2DUDA 1AZPA 1BDOA 5G3LF 3M4QA 4HIDA 4G7OC 1X56A 1VQ7A 1Z47A 1EIGA 1SYEA 1QNUA 3HKZG 3LWUA 1X65A 5CGKA 1K83H 4IOAA 3A8KE 3K81C 4K2KA 1EEFD 4LF6Q 3GTLB 1JWSD 4KTAA 1N33Q 4M8AA 4IPHA 3GTJH 1CZGA 2YV5A 2WB1E 3G4SA 3KJOA 5CV9A 3E0EA 4XDXA 4YWLA 4OO1H 2VW9A 1B3QA 1KNEA 2B8FA 2NVYB 1HR0W 4OELB 4AYBB 5A2QL 4HIOA 3K7UC 4BY7H 1I4PA 5CR3A 2YTVA 2XWBB 4DV7L 3R2TA 3VYTA 1PTOF 2R93H 3K80C 3PIOA 3NWSA 3UE0A 1EFID 1GVPA 4K5VA 5A2QE 1IKMA 5CC4A 3QIAA 4QB4A 1JICA 2GVBA 2HHHQ 4C2MH 4C1NK 2A5HA 3K5MA 1FGUA 2EYPA 2Q8IB 2P5ZX 2N78A 2EY5A 2NBFA 2ZM6L 3I4MH 3K58A 5JPNC 4XQJA 4P72A 3NBHB 1SNPA 2CH4W 1CM9A 5IP7G 4H44C 4A93H 4A3MB 3H15A 1PRTD 1AEXA 2KHIA 3M7GA 3EQLC 1U0LA 1EEID 1JJGA 4GN5A 4IFDI 4ID6A 3S1QH 3D6WA 3GTKB 1Q1BA 2CVRA 2PZUA 4U68A 1ICWA 3RZDH 1VF5C 1Y1WG 4G7HC 5K5PA 1G8ZD 4KLKA 2JK8A 3MFGA 5C4XH 4HJ9A 1EQQA 4EQ5A 4Y7NB 2JA7B 3KF6A 5FK9C 3X3NA 2K03A 1IBMQ 1F9SA 3KBGA 4DU9A 1SYDA 5CBAE 3BZDB 4TVAB 4DNIA 2ZJQA 4O1NA 5E4XA 1VCIA 4DK6C 2M00A 2IY5B 2MFIA 3SVMA 1E0BA 1YNXA 4A3EB 3JAML 2E2HB 2CWAA 2Z6BA 2HQLA 5FJ8H 1BCPC 1NE3A 1VQCA 2B2WC 1HTLD 3DHQA 4DNTB 5HGQA 5CYUA 1RHPA 3JAME 1GHJA 5LL6S 1YNND 2R92B 1A15A 4ZUIA 5M3MG 2VQFL 2LY7A 2PI2E 4GOPB 3A5ZB 2K5HA 4B3SQ 2K5VA 3MEFA 4PMWA 1NR2A 2HD3A 4HAEA 1DOKA 1VQAA 2QA4A 1LTBD 5KNCA 4QL5A 1XMQL 5KIXA 1GUNA 1QG7A 4MTNA 3OOCA 1VQ6A 2AQ1B 4LF5L 1P8LA 1ENFA 3HOWB 4EX5A 2AMCB 4DR2L 3C1FA 4RGOS 2F4VQ 4CKCA 4K0KL 1J5EQ 1F2MA 2FMMA 1J6QA 1LTGD 1TWFB 4I65A 2VB3X 1N36L 4ILWA 3U4ZA 1E1TA 2A6EC 4A3IG 1HNWL 1XPRA 1VMPA 4R4TA 1LTID 4PMBA 4DV1Q 1VQDA 1PRTB 4ME5A 1CKNB 2QGQA 4LW1A 2EYFA 5IGCA 3T1HQ 4HIKA 1AZQA 1B3AA 2ALYB 1Y1VG 1II3A 2A73B 4K14A 5AJ3L 1ENCA 4KJOA 4LF8L 4CBVA 2ID0A 2XN9C 2AWOA 5EBDA 1EZ6A 1J9OA 2JN4A 3TS0A 1ESRA 1SYCA 4JG2A 1G291 3IKJA 4K2LA 4PV1C 5M3FB 2KJXA 1PYWD 1UE7A 3CP0A 3HP3A 1B53A 3CCMA 4HSVA 1GXDC 4IOCA 1LLRD 2UU9Q 5JOBA 1EWCA 4NXNQ 4LFCL 1HR0L 3M3YH 1V43A 4BBRG 3CW2C 5JVG3 2BA1A 5CV4A 2SNSA 2KEEA 1SBBB 2F0PA 3OWFA 1B8AA 1SJHD 3P1HA 2KQ3A 2MP1A 4IFDH 1ICFB 4PNYA 4XYQA 3K7AB 3F2UA 4LWCA 2XSCA 1V9PA 4ZCKA 2PMZB 4P74A 3H3VC 4EGVA 1DGSA 2RF4A 3S17B 2DGYA 3CQZB 2K28A 5JEAJ 1O7YA 4HIMA 2GVAA 3EN2A 3I3CA 5LMNQ 3S1NB 3FKIG 2NVYH 3NTHA 2ICEC 2B63G 1KRTA 1EWIA 5DEHA 1VQMA 3PUZA 4BA1I 3STBD 4A3JB 2XNAC 3EBEA 4BXXG 1YITA 1HNZL 1PH2A 1PVOA 4XIGS 1XXGA 2BE5C 4V0BA 4MHEA 4BBSB 3MAQA 2VNUD 3LWEA 3A8JE 4JOIA 1STNA 5JVH3 1Q8IA 1OXUA 3LNNA 1NBWA 2B39A 4N8FA 1UAPA 3JAMc 3GO5A 4RCOA 1LT6D 3HRZC 1SMYD 1HQRD 4UP8A 2PPBC 3PSIA 5IWAQ 3TDQA 3VR3A 4JOIC 4APVA 3R93A 4WORA 3MZ5A 1F9RA 4L63B 2JA8H 4A3DB 3BDLA 1TXYA 2H5XA 1I4XA 4F87A 2JA6H 4DR5L 1F2ZA 3S14H 1Q7YC 4DR7L 3KDFA 2ZTCA 2HCIA 1ZKOA 2DN8A 1PTOC 3HOUG 1QUQB 3AYHB 3FDTA 1PZKD 5K36G 4EQNA 2F0FA 4A3EH 4B08A 2WAQB 1Q82C 1JE4A 2F03A 3PV0A 5E7NA 4X62Q 1L1OB 3F2CA 3OMCA 4HJ7A 3GTQB 1FYCA 4J6HA 5IYDG 1EIYB 2JXMB 2WKDA 4DV6L 1QNKA 1I6HB 3QOJA 4DAYA 5M5XB 2R92H 5D3DA 4FNFA 3C46A 1SE3A 3RN2A 2PZWA 4Y52H 2Y0SE 1CZWA 1FJGQ 4WJWA 2K01A 3F2BA 2OTJA 1QVCA 1EZ8A 1OXVA 4YY3Q 1SAPA 1TY2A 4POGA 2F1MA 1W6KA 3H0GB 1KAWA 2E2IH 3DMUA 3PCOB 3I4OA 3K5OA 4N9PA 5F2DA 3X3MA 4X65Q 5BN5A 2A69D 2ZXOA 1EOTA 2KCNA 4AYBE 1JJ2A 4LF9Q 2AUKA 4B3ML 4JI8L 4LNQA 1VF7A 5C6AA 1Y8NB 2PI2A 4K8IA 3MXGA 1MBYA 4RGTA 2I46A 1DOLA 1K83B 2MUYA 4RH6A 3TRZA 1RODA 2JEBI 1LT4D 3PUWA 2Q2IA 3BG3A 3GTJB 3KOJA 1X3PA 3NSWA 3DWQA 4DUYL 1EQTA 4KI0A 2A68D 4N9TA 2MO1A 4C3HB 1OXSC 4YCVA 4JI0Q 4AQYL 4NXML 1AN8A 1WFQA 1S5FD 1DXMA 1GUSA 4FVMA 3A55A 3DM3A 1YHAA 1MJEA 2K6AA 1STBA 2EY2A 1QVGA 2K32A 2F0QA 4HCSA 4LMQD 4BY7B 2B8GA 3VDYA 3J81L 3HOXG 2R93B 3T16A 3AB9A 3HG9A 3BYYB 4V190 2E5LL 2EYLA 5M3FH 2JEAI 4F7XA 1I6VC 2EXDA 4A3KG 2RHSB 2ZXPA 1IHZA 2TSSA 4C1NI 1A3TA 3I91A 5FLMG 1DCZA 4A76A 1H9SB 1SNCA 3CCSA 1H9SA 1A3VA 3T1YL 1HZ9A 1PZJD 3MA2B 4EVOA 4FF3A 4B3RQ 1E24A 1LV9A 2BDOA 4TRDA 4LFBQ 3K7AH 4JI2L 1HJPA 1S3OA 4IUTA 4A3BH 2O5JC 1A2UA 1RTOA 2F4IA 4A93B 2OTLA 3TSSA 1QZGA 1R9TB 3HEJA 4A3GG 3T56B 4S3SA 4YWMA 3G6JB 4NW2A 4G57A 4DV0Q 2OQ0A 2K7VA 4FP5D 4A3FH 4I7ZC 1LM0A 2B29A 3Q23A 3A8IE 1FGBD 2E2JH 3S1QB 4LF6L 5C44G 4A4IA 1N33L 3S1NH 3PF5A 3BU2A 1GUWA 2ZTDA 2RCNA 2I5HA 2SDFA 3NELA 4JBKA 2RCFA 2HIVA 4JW0A 4A3JH 4OIKA 2F0TA 4QUCA 5KRUA 1S4ZA 1TU2B 1PMRA 2RQXA 2YTXA 5I6WA 4R4QA 1SNQA 1U4RA 1Y14B 1MIUA 4A3LG 5IP9G 1I4RA 4C3JG 2ZT9C 4KN4C 1SDFA 3S9WA 1PH5A 1CA6A 4IZ8A 3FVQA 4O2DA 2JA5H 1OTCA 2HHHL 4GNXA 1KDAA 4H0LC 4K8JA 3B6YA 4KD4A 3NXWA 2KUMA 3UDXA 5CORA 5L37A 4BA2I 3HS0C 1YZ6A 3NE5B 1ASYA 5LMNW 5C0XG 1XPOA 3PO2G 3HOZH 1O7LA 3I4LA 3NK9A 1YBYA 3TZUA 3V96A 2GA4B 3U4VA 1WCMB 4JI6Q 1PRTF 4JV5Q 2A74C 3K6OA 4JBJA 4N8X1 3NENA 1HXYD 4LF4Q 4C3IB 3EJIA 1RTNA 4G4KA 3CCRA 1EOVA 4LUVA 4EQPA 4KY7A 4X66Q 1PH3A 2EDGA 4KKTA 4DFAA 4ZYSA 1IBML 3D3RA 1H9RA 4OWWB 4FXDA 2OF1A 4DAVA 1LO5D 4H02A 1LTAD 3HOVB 4O42A 3EIVA 1I6HH 2Q2TA 1D8LA 2OCEA 2F0EA 4MNOA 5TSSA 2EZVA
chains in the Genus database with same CATH topology
1SR3A 2CWAA 3I4MG 4LUZA 3PUVA 2HQLA 4YWKA 5FJ8H 2JE6I 5GAHC 1B70B 1BBUA 1VQHA 1NE3A 1VQCA 5HGQA 3CXCA 2CFMA 1CUKA 4DV2L 3HOUH 3J81i 2R7ZG 2BH8A 4DV2Q 3J81c 5M3MG 4DR3L 1C0AA 2VQFL 2PI2E 4GOPB 4P75A 3H0GH 4B3SL 3AFPA 3A5ZB 4DR3Q 2K5HA 2VQFQ 4JI3L 3H3VH 1XNQQ 2IHEA 2EQSA 4B3SQ 3CMAA 4GLAC 3JAMi 2K5VA 4HJ8A 4JI3Q 2I5MX 4DV3L 4A3DG 3MEFA 4IJHA 4PMWA 4DV3Q 3ULPA 3OYYA 1PH4A 4DR6L 4DV5Q 1KQSA 1VQAA 3BZCA 4IPDA 4UP7A 1YEZA 3W5OA 5IYCG 3M85A 2BH2A 4DR6Q 2QA4A 2F3IA 1XMQL 3AQQA 4QL5A 2L15A 1EIFA 3RZOH 4MTNA 1XMQQ 4KHZA 1N8RC 1VQ6A 4GLXA 4JBMA 4A3MH 3ULLA 4DKAC 4JI7L 4LF5L 1P8LA 1OXTA 4EX5A 1JE5A 4JI7Q 4LF5Q 3KFUA 2F4VL 5C4XG 2C35B 2JJQA 2NN6G 2AMCB 2PQAB 4DR2L 1J5EL 2F4VQ 4K0KL 4DR2Q 1J5EQ 4JYAL 3GD7A 4DUZL 4K0KQ 2R7DA 1VQOA 4JYAQ 1J6QA 4DUZQ 3CCEA 1KRSA 3GTKH 3L7ZC 3NEMA 1GM5A 4C3HH 3AEVA 4P71A 1N36L 3L0OA 3U4ZA 5M3FG 1VQPA 4QIWE 1E1TA 4A3IG 5HY6A 1N36Q 2UXCL 1HNWL 1T9HA 1XPRA 3KDFB 2NVQH 4DV1L 2UXCQ 5ELOA 1CSQA 2XGTA 1HNWQ 1TWGH 4R4TA 1A0IA 3OTOL 4DV1Q 1YHQA 4Y7NH 5C0XI 1KL9A 1UE6A 3OTOQ 2HT1A 2I5LX 2JA7H 5JJKA 5H1SE 1VQDA 3UE1A 2VQEL 3UDFA 2B3GA 1CKNB 3T1HL 1N34L 2VQEQ 2QGQA 4LW1A 3T1HQ 4HIKA 3CAMA 4PZ8A 1N34Q 3S2DH 3H0GG 1PYSB 2ALYB 4ME3A 3PF4A 1SN8A 1Y1VG 4JCVE 5AJ3L 3K0XA 2E2HH 2VZAA 1FL0A 2EIFA 3PUYA 2KBNA 5AJ3Q 4LF8L 2ID0A 4QGUA 3HOYH 2AWOA 4A3BG 3F2DA 3J7ZC 1X3GA 4LF8Q 1D7QA 3TS0A 2D0PA 4DAYB 3FHWA 4A3CH 4JG2A 3TS2A 3TEHB 1G291 1IXRA 2K14A 4QJFA 5IE8A 4LFAL 4YCUA 3W1BA 1UE7A 4DPGA 4LFAQ 3CP0A 5LMUL 3CCJA 4A3FG 3CCMA 2ES2A 1EQRA 1Q1EA 5LMUQ 3I4NH 4J15A 2R6GA 2CWPA 1YJ9A 4NB3A 2UU9L 5C3EH 1YI2A 4OX9L 2R7FA 4IOCA 4NXNL 3S1RH 2UU9Q 1K9MC 4IFDJ 1VQFA 1A8VA 1CKOA 4AH6A 1PV4A 4LFCL 4NXNQ 4OX9Q 1HR0L 3M3YH 4WJ3M 1VQGA 1YJWA 1V43A 3JC66 4BY1G 4BBRG 3CW2C 4LFCQ 1HR0Q 2BA1A 4OONA 3HOXH 1R9TH 4GNXC 1XMOL 1B8AA 1ASZA 3TREA 3CCUA 1VQ9A 4A3KH 2WAQE 3I2ZA 4LWCA 3HOWH 4OO1G 1JT8A 5FLMH 1W2BA 1V9PA 1CSPA 3PO3G 4P74A 2IX0A 2ATWA 4BY7G 1WI5A 1DGSA 3M4PA 2RF4A 2DGYA 1K8AC 5ELNA 1N9WA 1TWFH 1AE3A 1JB7A 1IBKL 2NVTH 2R93G 2VUMH 1IBKQ 5JEAJ 1IL2A 4HIMA 3KF8B 3KLWA 5LMNL 2GVAA 3EN2A 1VQKA 2IHFA 1Q86C 5LMNQ 2JA5G 1IBLL 1GKHA 1B7YB 3FKIG 1XJVA 4LUOA 2NVYH 1IBLQ 3L2PA 3ZJYC 2B63G 1S40A 2K50A 2VL6A 4A75A 1KRTA 1XNRL 1EWIA 1VQMA 1MKHA 3PUZA 2QEXA 4BA1I 4LF7L 1XNRQ 3STBD 4LF7Q 3EBEA 4R4CA 4BXXG 1YITA 1HNZL 1PH2A 4AIMA 1PVOA 4XIGS 3SGIA 3HOZG 1HNZQ 3S14H 4PZ7A 5C44H 2MNAA 2OWOA 4R4OA 2VNUD 1Q8KA 4X6AH 4JC0A 2BA0A 3CF5A 4A93G 4JOIA 1PH6A 2OQKA 1UEBA 2Q2UA 1OXXK 3M4OH 4JI4L 1OXUA 1KXLA 2N8NA 4X64L 4JI4Q 1NBWA 4GOPA 1KHIA 1VS0A 4X64Q 4DR4L 3JAMc 5DLQE 2IX1A 3KJPA 4DR4Q 3KYHC 1VQBA 1E22A 5IYDH 4IPGA 3GO5A 5JJLA 4A3LH 5IP9H 4GS3A 4IJLA 4GLVB 1Z9FA 1WCMH 3CMEA 4L5RC 1X3FA 4C3JH 5IWAL 4UP8A 1K3RA 4YHHL 3PSIA 2GN5A 5IWAQ 4ALPA 4YHHQ 2AHOB 1U5KA 1VQLA 1PA6A 1XTDA 4C3IH 2WAQG 2AWNA 2JA9A 3UDIA 1VQNA 4JOIC 1PH8A 1HNXL 4L5SA 3GTGH 4HJAA 1HNXQ 4APVA 5C0XJ 1WOCA 2PQAA 1VQEA 3RN5A 1BKBA 4GOPC 2JA8H 3GTMH 1O7IA 4PZ6A 3Q8DA 1Q46A 2KENA 5J3BA 5IT9c 3S17H 3CD6A 1K73C 3GDEA 3S16H 1TXYA 2H5XA 3CQZH 4O0AA 3PO2H 3ICEA 2JA6H 4DR5L 1M90C 4UY8C 1Q7YC 3D0FA 5FJ8G 2CKZB 3KDFA 3IRBA 2VY3A 5GADC 4DR5Q 4DR7Q 1GD7A 2ZTCA 5IYBH 3OW2A 1NJIC 5C4JH 4B3TL 3RLOA 5BR8L 5IP7H 3HOUG 1E1OA 1QUQB 4B3TQ 5BR8Q 3AYHB 4UP9A 1VQJA 3HOVH 1HZCA 5K36G 1CKNA 3ER0A 3S15H 1W3SA 3F1ZA 4RMFA 1M1KC 4A3EH 4X62L 1Q82C 3PV0A 3TQYA 5E7NA 3E9HA 4X62Q 3CC7A 1L1OB 1Q12A 3F2CA 1X55A 2UUCL 3A74A 5JJIA 1AH9A 2K52A 4JBWA 2UUCQ 4HJ7A 2NZOA 1EIYB 5IYDG 5EAYA 4BBSH 1LUZA 4DV6L 1EYGA 3HFZB 4OO1I 1NTGA 1JMCA 3CC4A 4DV6Q 2ZJRA 2KCMA 1WCMG 2R92H 3E9IA 2UXDL 1K8GA 3RN2A 2UXDQ 4RG1A 4MZ9A 4A3MG 1I5FA 4JI5L 4Y52H 1FJGL 4GNXB 1LTLA 3PIPA 4JI5Q 1E3PA 2Y0SE 1FJGQ 3S1MH 3J80i 3F2BA 1Q81C 2OTJA 1PH7A 1QVCA 3U58A 1P16A 4YY3L 4OXPA 3J80c 1OXVA 4YY3Q 4DR1L 2UUBL 4POGA 1BVSA 4DR1Q 2UUBQ 1XNQL 1KAWA 1VQ5A 1IYJB 1CKMA 4DV5L 1XMOQ 2E2IH 3UDGA 3PCOB 1H95A 3I4OA 1PYBA 2Q2HA 4X65L 1SE8A 1UWVA 2RHQB 3AFQA 4UPAA 4DK3C 4X65Q 4QY7A 1TWHH 5M5WH 2JA7G 3G48A 1QVFA 4GN3B 2PNHA 2R7ZH 4LF9L 3S2HH 4AYBE 1JJ2A 4GKKL 5M3MH 4B3ML 4LF9Q 4GKKQ 1WJJA 4JI8L 3A5UA 2XTIA 4LNQA 4B3MQ 3HOVG 2PI2A 1V1QA 1NMGA 2E8GA 4JI8Q 2D62A 4A3EG 4A3DH 1JJCB 3TRZA 2JEBI 2V1CC 5GAGC 1EUJA 2MQHA 2ASBA 3I55A 2LXJA 3HOYG 3PUWA 4JI1L 3RLFA 1HZBA 2Q2IA 2MO0A 5IYCH 3J81j 2ZJPA 4JI1Q 1RIPA 4A3GH 4R1JA 3KOJA 1VQ4A 4A3CG 4JI0L 4OWXB 4DUYL 1I50H 4KI0A 3CCQA 2MO1A 1C7YA 1OXSC 4YCVA 4DUYQ 4AQYL 2I0QA 4JI0Q 4NXML 1WFQA 3GTOH 4NXMQ 3KF6B 4AQYQ 2LSSA 1PFSA 3U50C 4DV4L 3DM3A 1YHAA 1MJEA 3A0JA 5FLXc 4DV4Q 3I4NG 1QVGA 2KCTA 5C3EG 2NN6I 1X3EA 5GQOA 3VDYA 3RR5A 1S72A 1L0WA 1KIXA 4WJ4A 1LYLA 3GTQH 1N32L 2YTYA 2WP8J 1X54A 3K8AA 5IY0A 4TQUS 2LXKA 1L2FA 4P73A 3I56A 3HOXG 1N32Q 1SROA 2IT1A 2NZHA 3I7FA 4DAMA 5M5XH 5M3FH 1QZHA 2E5LL 2JEAI 4A3IH 1TWAH 2EXDA 1AE2A 1IZ6A 2WFWA 1MJCA 2E5LQ 4A3KG 4IFDG 2RHSB 1XPUA 2Y0SG 1KC8C 2UXBL 3DLLA 3HOWG 3W1GA 1X9NA 2UXBQ 5FLMG 4A76A 2VS1A 3ERSX 3CCSA 3D31A 4PG3A 3G71A 1I94L 1K0RA 3G6EA 2PMZE 3M7NA 4DR7L 1SRUA 1I94Q 2KHJA 4B3RL 3T1YL 1HZ9A 4B3RQ 1E24A 3T1YQ 2VUMG 1Y1VH 4LFBL 2N49A 3H3VI 1C9OA 4POFA 4LFBQ 3K7AH 1A62A 4JI2L 1HJPA 1S3OA 1EFWA 1X6OA 4IO9A 1UE5A 4A3BH 3MXNB 1TWCH 4JI2Q 4IPCA 1PH1A 2OTLA 1FVIA 4AYBG 1QZGA 1SMXA 4A3GG 5JEAG 4YWMA 4DV0L 3J7A5 3FP9A 2DUDA 5GROA 1I3QH 4R4IA 4DV0Q 3M4QA 4HIDA 1X56A 4GN4B 2OQ0A 1VQ7A 1Z47A 2K75A 4A3FH 1HZAA 1LM0A 2A1AA 2B29A 3HKZG 1SFOH 2E2JH 1X65A 4L5TA 1K83H 2UUAL 4IOAA 3RNUA 4LF6L 3K81C 2K5NA 5C44G 2UUAQ 4A4IA 1N33L 4LF6Q 3S1NH 3RLNA 3PF5A 2CQOA 3BU2A 1N33Q 4BY1H 1SLJA 2ZTDA 4BBRH 4IPHA 1QUQA 2RCNA 2I5HA 3S24A 3GTJH 3HKSA 3NELA 4JBKA 2YV5A 1E7ZA 2WB1E 4FDBA 2YYZA 2D0OA 3G4SA 2HIVA 4A3JH 3BJUA 3KJOA 3F8TA 2A19A 3E0EA 4YWLA 5GAEC 2VW9A 1L1OA 2YTXA 2YU9H 3CC2A 3PO3H 1HR0W 2Z6KA 4GKJL 4R4QA 1Y14B 4HIOA 1MIUA 3K7UC 1PHJA 5IP9G 4A3LG 4OWTB 4BY7H 4GKJQ 2YTVA 4DV7L 1Y1WH 4DV7Q 3CPWA 2R93H 3K80C 3PIOA 1PH5A 3UE0A 3PGZA 1GVPA 3GTPH 2CCZA 4L5QA 1YJNA 4O2DA 2JA5H 1OTCA 5M5YH 2HHHL 4GNXA 3FKIH 1HH2P 2K4KA 2GVBA 3CPFA 3LGJA 4C2MH 2HHHQ 3CCLA 1A63A 3B6YA 1FGUA 3WWVA 2NVXH 2B63H 2JA8G 1PH9A 1YHBA 1RL2A 3UDXA 1KD1C 2N78A 1L1OC 4BA2I 4BXXH 2ZM6L 2Z6KC 3I4MH 1YZ6A 1ASYA 5LMNW 5C0XG 1XPOA 2N3SA 2ZM6Q 3PO2G 3M9BA 3HOZH 2JA6G 2JQOA 4XTCS 1VQ8A 1YBYA 2FXQA 4P72A 3NBHB 5IYBG 4JI6L 3U4VA 2AKWB 5IP7G 4A93H 4JV5L 4JI6Q 1YIJA 1G6PA 4JV5Q 4JBJA 3H15A 4HJ5A 4LF4L 1GO3E 3NENA 4NPSA 2KHIA 3CCVA 4LF4Q 3ULJA 1U0LA 2ZTEA 1VQIA 3HKZE 2F52A 4A3JG 3PUXA 1JJGA 4GN5A 4IFDI 3CCRA 1EOVA 3STBC 3S1QH 4LUVA 1BBWA 4BBSG 4QQBX 4X66L 1Q1BA 3GTLH 4X66Q 1G51A 2HIXA 2R92G 1NY4A 3RZDH 2WB1G 1Y1WG 1PH3A 4KLKA 2JK8A 5C4XH 4HJ9A 1EQQA 4EQ5A 3KF6A 1IBML 2Z0SA 1IBMQ 4OWWB 4YCWA 4KHPL 1YVCA 4H02A 4TVAB 4KHPQ 4DNIA 2ZJQA 1I6HH 4DK6C 1VCIA 3EIVA 2IY5B 2Q2TA 2MFIA 1D8LA 2OCEA 1NMFA 1YNXA 4MNOA 1WYDA 2A8VA 3BZKA 1UE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SR3 A;  2CWA A;  3I4M G;  4LUZ A;  3PUV A;  2HQL A;  4YWK A;  5FJ8 H;  2JE6 I;  5GAH C;  1B70 B;  1BBU A;  1VQH A;  1NE3 A;  1VQC A;  5HGQ A;  3CXC A;  2CFM A;  1CUK A;  4DV2 L;  3HOU H;  3J81 i;  2R7Z G;  2BH8 A;  4DV2 Q;  3J81 c;  5M3M G;  4DR3 L;  1C0A A;  2VQF L;  2PI2 E;  4GOP B;  4P75 A;  3H0G H;  4B3S L;  3AFP A;  3A5Z B;  4DR3 Q;  2K5H A;  2VQF Q;  4JI3 L;  3H3V H;  1XNQ Q;  2IHE A;  2EQS A;  4B3S Q;  3CMA A;  4GLA C;  3JAM i;  2K5V A;  4HJ8 A;  4JI3 Q;  2I5M X;  4DV3 L;  4A3D G;  3MEF A;  4IJH A;  4PMW A;  4DV3 Q;  3ULP A;  3OYY A;  1PH4 A;  4DR6 L;  4DV5 Q;  1KQS A;  1VQA A;  3BZC A;  4IPD A;  4UP7 A;  1YEZ A;  3W5O A;  5IYC G;  3M85 A;  2BH2 A;  4DR6 Q;  2QA4 A;  2F3I A;  1XMQ L;  3AQQ A;  4QL5 A;  2L15 A;  1EIF A;  3RZO H;  4MTN A;  1XMQ Q;  4KHZ A;  1N8R C;  1VQ6 A;  4GLX A;  4JBM A;  4A3M H;  3ULL A;  4DKA C;  4JI7 L;  4LF5 L;  1P8L A;  1OXT A;  4EX5 A;  1JE5 A;  4JI7 Q;  4LF5 Q;  3KFU A;  2F4V L;  5C4X G;  2C35 B;  2JJQ A;  2NN6 G;  2AMC B;  2PQA B;  4DR2 L;  1J5E L;  2F4V Q;  4K0K L;  4DR2 Q;  1J5E Q;  4JYA L;  3GD7 A;  4DUZ L;  4K0K Q;  2R7D A;  1VQO A;  4JYA Q;  1J6Q A;  4DUZ Q;  3CCE A;  1KRS A;  3GTK H;  3L7Z C;  3NEM A;  1GM5 A;  4C3H H;  3AEV A;  4P71 A;  1N36 L;  3L0O A;  3U4Z A;  5M3F G;  1VQP A;  4QIW E;  1E1T A;  4A3I G;  5HY6 A;  1N36 Q;  2UXC L;  1HNW L;  1T9H A;  1XPR A;  3KDF B;  2NVQ H;  4DV1 L;  2UXC Q;  5ELO A;  1CSQ A;  2XGT A;  1HNW Q;  1TWG H;  4R4T A;  1A0I A;  3OTO L;  4DV1 Q;  1YHQ A;  4Y7N H;  5C0X I;  1KL9 A;  1UE6 A;  3OTO Q;  2HT1 A;  2I5L X;  2JA7 H;  5JJK A;  5H1S E;  1VQD A;  3UE1 A;  2VQE L;  3UDF A;  2B3G A;  1CKN B;  3T1H L;  1N34 L;  2VQE Q;  2QGQ A;  4LW1 A;  3T1H Q;  4HIK A;  3CAM A;  4PZ8 A;  1N34 Q;  3S2D H;  3H0G G;  1PYS B;  2ALY B;  4ME3 A;  3PF4 A;  1SN8 A;  1Y1V G;  4JCV E;  5AJ3 L;  3K0X A;  2E2H H;  2VZA A;  1FL0 A;  2EIF A;  3PUY A;  2KBN A;  5AJ3 Q;  4LF8 L;  2ID0 A;  4QGU A;  3HOY H;  2AWO A;  4A3B G;  3F2D A;  3J7Z C;  1X3G A;  4LF8 Q;  1D7Q A;  3TS0 A;  2D0P A;  4DAY B;  3FHW A;  4A3C H;  4JG2 A;  3TS2 A;  3TEH B;  1G29 1;  1IXR A;  2K14 A;  4QJF A;  5IE8 A;  4LFA L;  4YCU A;  3W1B A;  1UE7 A;  4DPG A;  4LFA Q;  3CP0 A;  5LMU L;  3CCJ A;  4A3F G;  3CCM A;  2ES2 A;  1EQR A;  1Q1E A;  5LMU Q;  3I4N H;  4J15 A;  2R6G A;  2CWP A;  1YJ9 A;  4NB3 A;  2UU9 L;  5C3E H;  1YI2 A;  4OX9 L;  2R7F A;  4IOC A;  4NXN L;  3S1R H;  2UU9 Q;  1K9M C;  4IFD J;  1VQF A;  1A8V A;  1CKO A;  4AH6 A;  1PV4 A;  4LFC L;  4NXN Q;  4OX9 Q;  1HR0 L;  3M3Y H;  4WJ3 M;  1VQG A;  1YJW A;  1V43 A;  3JC6 6;  4BY1 G;  4BBR G;  3CW2 C;  4LFC Q;  1HR0 Q;  2BA1 A;  4OON A;  3HOX H;  1R9T H;  4GNX C;  1XMO L;  1B8A A;  1ASZ A;  3TRE A;  3CCU A;  1VQ9 A;  4A3K H;  2WAQ E;  3I2Z A;  4LWC A;  3HOW H;  4OO1 G;  1JT8 A;  5FLM H;  1W2B A;  1V9P A;  1CSP A;  3PO3 G;  4P74 A;  2IX0 A;  2ATW A;  4BY7 G;  1WI5 A;  1DGS A;  3M4P A;  2RF4 A;  2DGY A;  1K8A C;  5ELN A;  1N9W A;  1TWF H;  1AE3 A;  1JB7 A;  1IBK L;  2NVT H;  2R93 G;  2VUM H;  1IBK Q;  5JEA J;  1IL2 A;  4HIM A;  3KF8 B;  3KLW A;  5LMN L;  2GVA A;  3EN2 A;  1VQK A;  2IHF A;  1Q86 C;  5LMN Q;  2JA5 G;  1IBL L;  1GKH A;  1B7Y B;  3FKI G;  1XJV A;  4LUO A;  2NVY H;  1IBL Q;  3L2P A;  3ZJY C;  2B63 G;  1S40 A;  2K50 A;  2VL6 A;  4A75 A;  1KRT A;  1XNR L;  1EWI A;  1VQM A;  1MKH A;  3PUZ A;  2QEX A;  4BA1 I;  4LF7 L;  1XNR Q;  3STB D;  4LF7 Q;  3EBE A;  4R4C A;  4BXX G;  1YIT A;  1HNZ L;  1PH2 A;  4AIM A;  1PVO A;  4XIG S;  3SGI A;  3HOZ G;  1HNZ Q;  3S14 H;  4PZ7 A;  5C44 H;  2MNA A;  2OWO A;  4R4O A;  2VNU D;  1Q8K A;  4X6A H;  4JC0 A;  2BA0 A;  3CF5 A;  4A93 G;  4JOI A;  1PH6 A;  2OQK A;  1UEB A;  2Q2U A;  1OXX K;  3M4O H;  4JI4 L;  1OXU A;  1KXL A;  2N8N A;  4X64 L;  4JI4 Q;  1NBW A;  4GOP A;  1KHI A;  1VS0 A;  4X64 Q;  4DR4 L;  3JAM c;  5DLQ E;  2IX1 A;  3KJP A;  4DR4 Q;  3KYH C;  1VQB A;  1E22 A;  5IYD H;  4IPG A;  3GO5 A;  5JJL A;  4A3L H;  5IP9 H;  4GS3 A;  4IJL A;  4GLV B;  1Z9F A;  1WCM H;  3CME A;  4L5R C;  1X3F A;  4C3J H;  5IWA L;  4UP8 A;  1K3R A;  4YHH L;  3PSI A;  2GN5 A;  5IWA Q;  4ALP A;  4YHH Q;  2AHO B;  1U5K A;  1VQL A;  1PA6 A;  1XTD A;  4C3I H;  2WAQ G;  2AWN A;  2JA9 A;  3UDI A;  1VQN A;  4JOI C;  1PH8 A;  1HNX L;  4L5S A;  3GTG H;  4HJA A;  1HNX Q;  4APV A;  5C0X J;  1WOC A;  2PQA A;  1VQE A;  3RN5 A;  1BKB A;  4GOP C;  2JA8 H;  3GTM H;  1O7I A;  4PZ6 A;  3Q8D A;  1Q46 A;  2KEN A;  5J3B A;  5IT9 c;  3S17 H;  3CD6 A;  1K73 C;  3GDE A;  3S16 H;  1TXY A;  2H5X A;  3CQZ H;  4O0A A;  3PO2 H;  3ICE A;  2JA6 H;  4DR5 L;  1M90 C;  4UY8 C;  1Q7Y C;  3D0F A;  5FJ8 G;  2CKZ B;  3KDF A;  3IRB A;  2VY3 A;  5GAD C;  4DR5 Q;  4DR7 Q;  1GD7 A;  2ZTC A;  5IYB H;  3OW2 A;  1NJI C;  5C4J H;  4B3T L;  3RLO A;  5BR8 L;  5IP7 H;  3HOU G;  1E1O A;  1QUQ B;  4B3T Q;  5BR8 Q;  3AYH B;  4UP9 A;  1VQJ A;  3HOV H;  1HZC A;  5K36 G;  1CKN A;  3ER0 A;  3S15 H;  1W3S A;  3F1Z A;  4RMF A;  1M1K C;  4A3E H;  4X62 L;  1Q82 C;  3PV0 A;  3TQY A;  5E7N A;  3E9H A;  4X62 Q;  3CC7 A;  1L1O B;  1Q12 A;  3F2C A;  1X55 A;  2UUC L;  3A74 A;  5JJI A;  1AH9 A;  2K52 A;  4JBW A;  2UUC Q;  4HJ7 A;  2NZO A;  1EIY B;  5IYD G;  5EAY A;  4BBS H;  1LUZ A;  4DV6 L;  1EYG A;  3HFZ B;  4OO1 I;  1NTG A;  1JMC A;  3CC4 A;  4DV6 Q;  2ZJR A;  2KCM A;  1WCM G;  2R92 H;  3E9I A;  2UXD L;  1K8G A;  3RN2 A;  2UXD Q;  4RG1 A;  4MZ9 A;  4A3M G;  1I5F A;  4JI5 L;  4Y52 H;  1FJG L;  4GNX B;  1LTL A;  3PIP A;  4JI5 Q;  1E3P A;  2Y0S E;  1FJG Q;  3S1M H;  3J80 i;  3F2B A;  1Q81 C;  2OTJ A;  1PH7 A;  1QVC A;  3U58 A;  1P16 A;  4YY3 L;  4OXP A;  3J80 c;  1OXV A;  4YY3 Q;  4DR1 L;  2UUB L;  4POG A;  1BVS A;  4DR1 Q;  2UUB Q;  1XNQ L;  1KAW A;  1VQ5 A;  1IYJ B;  1CKM A;  4DV5 L;  1XMO Q;  2E2I H;  3UDG A;  3PCO B;  1H95 A;  3I4O A;  1PYB A;  2Q2H A;  4X65 L;  1SE8 A;  1UWV A;  2RHQ B;  3AFQ A;  4UPA A;  4DK3 C;  4X65 Q;  4QY7 A;  1TWH H;  5M5W H;  2JA7 G;  3G48 A;  1QVF A;  4GN3 B;  2PNH A;  2R7Z H;  4LF9 L;  3S2H H;  4AYB E;  1JJ2 A;  4GKK L;  5M3M H;  4B3M L;  4LF9 Q;  4GKK Q;  1WJJ A;  4JI8 L;  3A5U A;  2XTI A;  4LNQ A;  4B3M Q;  3HOV G;  2PI2 A;  1V1Q A;  1NMG A;  2E8G A;  4JI8 Q;  2D62 A;  4A3E G;  4A3D H;  1JJC B;  3TRZ A;  2JEB I;  2V1C C;  5GAG C;  1EUJ A;  2MQH A;  2ASB A;  3I55 A;  2LXJ A;  3HOY G;  3PUW A;  4JI1 L;  3RLF A;  1HZB A;  2Q2I A;  2MO0 A;  5IYC H;  3J81 j;  2ZJP A;  4JI1 Q;  1RIP A;  4A3G H;  4R1J A;  3KOJ A;  1VQ4 A;  4A3C G;  4JI0 L;  4OWX B;  4DUY L;  1I50 H;  4KI0 A;  3CCQ A;  2MO1 A;  1C7Y A;  1OXS C;  4YCV A;  4DUY Q;  4AQY L;  2I0Q A;  4JI0 Q;  4NXM L;  1WFQ A;  3GTO H;  4NXM Q;  3KF6 B;  4AQY Q;  2LSS A;  1PFS A;  3U50 C;  4DV4 L;  3DM3 A;  1YHA A;  1MJE A;  3A0J A;  5FLX c;  4DV4 Q;  3I4N G;  1QVG A;  2KCT A;  5C3E G;  2NN6 I;  1X3E A;  5GQO A;  3VDY A;  3RR5 A;  1S72 A;  1L0W A;  1KIX A;  4WJ4 A;  1LYL A;  3GTQ H;  1N32 L;  2YTY A;  2WP8 J;  1X54 A;  3K8A A;  5IY0 A;  4TQU S;  2LXK A;  1L2F A;  4P73 A;  3I56 A;  3HOX G;  1N32 Q;  1SRO A;  2IT1 A;  2NZH A;  3I7F A;  4DAM A;  5M5X H;  5M3F H;  1QZH A;  2E5L L;  2JEA I;  4A3I H;  1TWA H;  2EXD A;  1AE2 A;  1IZ6 A;  2WFW A;  1MJC A;  2E5L Q;  4A3K G;  4IFD G;  2RHS B;  1XPU A;  2Y0S G;  1KC8 C;  2UXB L;  3DLL A;  3HOW G;  3W1G A;  1X9N A;  2UXB Q;  5FLM G;  4A76 A;  2VS1 A;  3ERS X;  3CCS A;  3D31 A;  4PG3 A;  3G71 A;  1I94 L;  1K0R A;  3G6E A;  2PMZ E;  3M7N A;  4DR7 L;  1SRU A;  1I94 Q;  2KHJ A;  4B3R L;  3T1Y L;  1HZ9 A;  4B3R Q;  1E24 A;  3T1Y Q;  2VUM G;  1Y1V H;  4LFB L;  2N49 A;  3H3V I;  1C9O A;  4POF A;  4LFB Q;  3K7A H;  1A62 A;  4JI2 L;  1HJP A;  1S3O A;  1EFW A;  1X6O A;  4IO9 A;  1UE5 A;  4A3B H;  3MXN B;  1TWC H;  4JI2 Q;  4IPC A;  1PH1 A;  2OTL A;  1FVI A;  4AYB G;  1QZG A;  1SMX A;  4A3G G;  5JEA G;  4YWM A;  4DV0 L;  3J7A 5;  3FP9 A;  2DUD A;  5GRO A;  1I3Q H;  4R4I A;  4DV0 Q;  3M4Q A;  4HID A;  1X56 A;  4GN4 B;  2OQ0 A;  1VQ7 A;  1Z47 A;  2K75 A;  4A3F H;  1HZA A;  1LM0 A;  2A1A A;  2B29 A;  3HKZ G;  1SFO H;  2E2J H;  1X65 A;  4L5T A;  1K83 H;  2UUA L;  4IOA A;  3RNU A;  4LF6 L;  3K81 C;  2K5N A;  5C44 G;  2UUA Q;  4A4I A;  1N33 L;  4LF6 Q;  3S1N H;  3RLN A;  3PF5 A;  2CQO A;  3BU2 A;  1N33 Q;  4BY1 H;  1SLJ A;  2ZTD A;  4BBR H;  4IPH A;  1QUQ A;  2RCN A;  2I5H A;  3S24 A;  3GTJ H;  3HKS A;  3NEL A;  4JBK A;  2YV5 A;  1E7Z A;  2WB1 E;  4FDB A;  2YYZ A;  2D0O A;  3G4S A;  2HIV A;  4A3J H;  3BJU A;  3KJO A;  3F8T A;  2A19 A;  3E0E A;  4YWL A;  5GAE C;  2VW9 A;  1L1O A;  2YTX A;  2YU9 H;  3CC2 A;  3PO3 H;  1HR0 W;  2Z6K A;  4GKJ L;  4R4Q A;  1Y14 B;  4HIO A;  1MIU A;  3K7U C;  1PHJ A;  5IP9 G;  4A3L G;  4OWT B;  4BY7 H;  4GKJ Q;  2YTV A;  4DV7 L;  1Y1W H;  4DV7 Q;  3CPW A;  2R93 H;  3K80 C;  3PIO A;  1PH5 A;  3UE0 A;  3PGZ A;  1GVP A;  3GTP H;  2CCZ A;  4L5Q A;  1YJN A;  4O2D A;  2JA5 H;  1OTC A;  5M5Y H;  2HHH L;  4GNX A;  3FKI H;  1HH2 P;  2K4K A;  2GVB A;  3CPF A;  3LGJ A;  4C2M H;  2HHH Q;  3CCL A;  1A63 A;  3B6Y A;  1FGU A;  3WWV A;  2NVX H;  2B63 H;  2JA8 G;  1PH9 A;  1YHB A;  1RL2 A;  3UDX A;  1KD1 C;  2N78 A;  1L1O C;  4BA2 I;  4BXX H;  2ZM6 L;  2Z6K C;  3I4M H;  1YZ6 A;  1ASY A;  5LMN W;  5C0X G;  1XPO A;  2N3S A;  2ZM6 Q;  3PO2 G;  3M9B A;  3HOZ H;  2JA6 G;  2JQO A;  4XTC S;  1VQ8 A;  1YBY A;  2FXQ A;  4P72 A;  3NBH B;  5IYB G;  4JI6 L;  3U4V A;  2AKW B;  5IP7 G;  4A93 H;  4JV5 L;  4JI6 Q;  1YIJ A;  1G6P A;  4JV5 Q;  4JBJ A;  3H15 A;  4HJ5 A;  4LF4 L;  1GO3 E;  3NEN A;  4NPS A;  2KHI A;  3CCV A;  4LF4 Q;  3ULJ A;  1U0L A;  2ZTE A;  1VQI A;  3HKZ E;  2F52 A;  4A3J G;  3PUX A;  1JJG A;  4GN5 A;  4IFD I;  3CCR A;  1EOV A;  3STB C;  3S1Q H;  4LUV A;  1BBW A;  4BBS G;  4QQB X;  4X66 L;  1Q1B A;  3GTL H;  4X66 Q;  1G51 A;  2HIX A;  2R92 G;  1NY4 A;  3RZD H;  2WB1 G;  1Y1W G;  1PH3 A;  4KLK A;  2JK8 A;  5C4X H;  4HJ9 A;  1EQQ A;  4EQ5 A;  3KF6 A;  1IBM L;  2Z0S A;  1IBM Q;  4OWW B;  4YCW A;  4KHP L;  1YVC A;  4H02 A;  4TVA B;  4KHP Q;  4DNI A;  2ZJQ A;  1I6H H;  4DK6 C;  1VCI A;  3EIV A;  2IY5 B;  2Q2T A;  2MFI A;  1D8L A;  2OCE A;  1NMF A;  1YNX A;  4MNO A;  1WYD A;  2A8V A;  3BZK A;  1UE1 A; 
#chains in the Genus database with same CATH topology
 3I4M G;  4LUZ A;  4YWK A;  1EWH A;  2JE6 I;  2LS0 1;  3GV3 A;  4DXF A;  1VQH A;  5BN4 A;  5IGG A;  1LTR D;  1IW7 D;  2RA4 A;  2F0V A;  4K5X A;  3J81 i;  2R7Z G;  4KMU C;  3ND9 A;  1K8M A;  3J81 c;  1C0A A;  1HQM C;  2XIW A;  2HUG A;  4L8J A;  1GJX A;  3H0G H;  4B3S L;  4DR3 Q;  2F0N A;  2G9H D;  1XNQ Q;  4GLA C;  4JI3 Q;  5I9P A;  1CQF A;  3ULP A;  3SK4 A;  1PH4 A;  3M3Y B;  3BZC A;  3M85 A;  1YEZ A;  3C1E A;  1MSG A;  2CW0 C;  1EIF A;  5IT9 L;  1TS3 A;  4GLX A;  2H4O A;  3AU7 A;  4YIJ A;  1BQQ T;  4JBM A;  2RSN A;  2Y0S B;  3ULL A;  3D4R A;  4DKA C;  1HFG A;  1JE5 A;  3KFU A;  5C4X G;  1DZ1 A;  2F4V L;  2C35 B;  2JJQ A;  2NN6 G;  2PQA B;  1J5E L;  2F3W A;  5IT9 E;  1BO0 A;  1LTT D;  1BBX C;  3GD7 A;  3M4Y A;  2R7D A;  3T51 B;  2F3V A;  4JYA Q;  4DUZ Q;  1KRS A;  1SND A;  4C3H H;  1FNU A;  3VR4 A;  2K5D A;  4DV1 L;  2UXC Q;  1CSQ A;  2XGT A;  1A0I A;  4C56 C;  1SE4 A;  1ET9 A;  5CMD A;  3UE1 A;  2MHV A;  2B3G A;  3NWT A;  3T1H L;  4FXG C;  3EA6 A;  5KYI A;  2VQE Q;  1N34 Q;  1Y69 U;  4CKE A;  2FFK B;  4ZKB B;  1SE2 A;  3PF4 A;  4ME3 A;  1SN8 A;  2HDL A;  2F0M A;  2KBN A;  3NHH A;  3J7Z C;  3F2D A;  2LKV A;  4OEM B;  4H13 C;  3FHW A;  4QUF A;  4A3C H;  3N52 A;  3MHB A;  1SYF A;  3VA5 A;  3W1B A;  4DPG A;  1TWA B;  4LFA Q;  5EKK A;  3I4N H;  2ES2 A;  1Q1E A;  2UU9 L;  4NP5 A;  3SE0 A;  1C4Q A;  5C3E H;  2C5C A;  4WRD A;  4NXN L;  1K9M C;  4IFD J;  1CKO A;  5KYL A;  3NBH A;  4BY1 G;  1R9T H;  4OON A;  3DWP A;  1ZYR D;  3TRE A;  1VQ9 A;  2WAQ E;  3I2Z A;  3C3L A;  1FD7 D;  2JP1 A;  3CKI B;  2PW7 A;  3PO3 G;  4IUR A;  4DA2 A;  4L6T B;  2JA8 B;  4FF2 A;  2B2Y A;  2DJG C;  5ELN A;  1JB7 A;  1AE3 A;  2ZXR A;  3VYR A;  1IBK Q;  4X3T A;  1FR3 A;  2JA6 B;  3S14 B;  3KUP A;  3KF8 B;  5LMN L;  2IHF A;  3A54 A;  1B7Y B;  4KKS A;  4LUO A;  1NAP A;  1IBL Q;  2DY8 A;  4HCE A;  3ZJY C;  1BCP B;  2WAC A;  3PIP 3;  2FHT A;  1STG A;  2EYO A;  4WFN 3;  4LF7 Q;  3SHL A;  3SGI A;  1B9N A;  1Q8K A;  1G91 A;  4KY5 A;  3CF5 A;  1PH6 A;  5IGE A;  2EPB A;  1OXX K;  4IUV A;  4ZLT F;  2N8N A;  3KLS A;  4FO2 A;  4GOP A;  3GTP B;  1VS0 A;  3KJP A;  4DR4 Q;  5ELC A;  3IFT A;  3ND8 A;  2KED A;  1UNS A;  3QO2 A;  1S5D D;  5JJL A;  4K5W A;  2E74 C;  4L5R C;  4IJL A;  1WCM H;  1X3F A;  5IWA L;  2E2I B;  3OWE B;  4HR7 B;  2X69 A;  2BDN A;  1S5E D;  4YHH Q;  2CHB D;  1U5K A;  3OSO A;  4C3I H;  3TP6 A;  2PO4 A;  2OXP A;  1HUN A;  1WTO A;  1HNX Q;  1WOC A;  1BKB A;  5IOC A;  4GOP C;  1SXT A;  4PZ6 A;  3Q8D A;  2KEN A;  5IT9 c;  3OIQ A;  3MTS A;  3S16 H;  1D5Z C;  2F0G A;  3D0F A;  5GAD C;  1GD7 A;  1NJI C;  4DF7 A;  2X6L A;  5C3X A;  5IP7 H;  1E1O A;  5DAU A;  4B3T Q;  5BR8 Q;  4UP9 A;  3HOV H;  2PZT A;  1CKN A;  1QB5 D;  1M8A A;  3F1Z A;  4DXG A;  1PXU A;  2L0C A;  1M1K C;  4X62 L;  1D5M C;  1EYC A;  4FF1 A;  1K8O A;  4OIJ A;  3CC7 A;  3E9H A;  2PW5 A;  4BWG B;  1BXT A;  3CRK C;  3VR6 A;  1AH9 A;  5JJI A;  1JOK A;  3KLR A;  2NZO A;  1JWM D;  4HMJ A;  1EYG A;  3HFZ B;  1KDC A;  2KCM A;  2L12 A;  2RKS A;  2D5D A;  3E9I A;  2FJ2 A;  2JYO A;  2UXD Q;  4A3M G;  1FJG L;  1ZXT A;  1E3P A;  3S1M H;  1PRT C;  3N6R A;  1BOS A;  3HOU B;  5EKL A;  4YY3 L;  4OXP A;  2V4D A;  2EJF C;  1NNX A;  3I90 A;  1DM0 B;  1VQ5 A;  1IYJ B;  1CKM A;  4R8N A;  5KND A;  1H95 A;  1KTK A;  2WII B;  4X65 L;  1PYB A;  4DV5 Q;  3AFQ A;  4A3B B;  3T4A C;  4CHT B;  2NWG A;  5EGT A;  4IUN A;  1TWH H;  5M5W H;  2JA7 G;  1O80 A;  4GN3 B;  4ZAI A;  3BVG A;  3G7L A;  5IOD A;  1NR4 A;  4LF9 L;  3Q6S A;  1ILP A;  5CV7 A;  3RZO B;  5M3M H;  4GKK Q;  1T5E A;  1V1Q A;  5EPL A;  4A3F B;  1MHW C;  2E2J B;  5J39 A;  4A3E G;  1JJC B;  1TS4 A;  5GAG C;  2MQH A;  3Q24 A;  3I55 A;  3BYT B;  3HOY G;  1EIH A;  1HZB A;  2MO0 A;  4JI1 Q;  1HA5 A;  4JI0 L;  4IN3 A;  4NDX A;  1C7Y A;  2I0Q A;  5LHY 1;  2IX3 A;  4DGZ A;  5T1G A;  1PFS A;  3U50 C;  1YNN C;  4DV4 Q;  2IJ0 A;  3WOE A;  5HUR A;  3RR5 A;  1KIX A;  1L0W A;  2RVL A;  2L55 A;  5IY0 A;  1F2L A;  3E5S A;  2LXK A;  1L2F A;  4P73 A;  2BOS A;  1N32 Q;  2VXW A;  3S2D B;  1SRO A;  2IT1 A;  1PFM A;  4A3I H;  1TWA H;  2Z9H A;  1U4L A;  1AE2 A;  1YNJ D;  2JA5 B;  1KC8 C;  3QG1 A;  3DLL A;  3HOW G;  1AW7 A;  2NTS A;  2SOB A;  1BUV T;  3W3A A;  2VS1 A;  1K0R A;  1SRU A;  4B3R L;  1KDB A;  1STE A;  2QCP X;  2K33 A;  3FPU B;  4ABN A;  5I2X A;  2VUM G;  1Y1V H;  3VA7 A;  4RHR A;  3HOZ B;  4LFB L;  3H3V I;  4POF A;  1JR0 D;  3MXN B;  1TY0 A;  1PH1 A;  5ELD A;  4IUU A;  3RMH A;  1SMX A;  3LX0 A;  5JEA G;  4DV0 L;  2F0I A;  1B1Z A;  5GRO A;  5IIF A;  3SDZ A;  2K75 A;  1L0Y B;  5CV8 A;  1HZA A;  3NBI A;  2E2D C;  1SFO H;  3IAY A;  1PFN A;  3RNU A;  1TS5 A;  2UUA Q;  4EQO A;  3RLN A;  2CQO A;  1SLJ A;  4BBR H;  1QUQ A;  3HKS A;  1VMC A;  1E7Z A;  4FDB A;  2D0O A;  3K5L A;  1BF4 A;  3R3O A;  2ENB A;  1U4M A;  2A19 A;  1O7Z A;  3E6Z X;  1EL0 A;  1L1O A;  2XRS D;  3GP7 A;  4GKJ Q;  1SJE D;  1GUO A;  4OWT B;  1KLG D;  3GQB A;  4FXK C;  3PGZ A;  3TME A;  3GTP H;  2CCZ A;  4L5Q A;  1YJN A;  2WKC A;  3BDC A;  1JCK B;  5M5Y H;  3FKI H;  1HH2 P;  2K4K A;  3LGJ A;  3CPF A;  1DJR D;  3CCL A;  1QWY A;  3WWV A;  2NVX H;  2B63 H;  1JB3 A;  1MI2 A;  1PH9 A;  2PQE A;  2NUC A;  2FIN B;  1RL2 A;  5DM7 3;  2L9H A;  1KD1 C;  1L1O C;  5DM6 3;  4BXX H;  2N3S A;  3M9B A;  2JQO A;  2AQ2 B;  1S5B D;  1GOZ A;  2FXQ A;  5IGB A;  5IYB G;  4F88 A;  4JI6 L;  1ENA A;  2AKW B;  4Q0F A;  4JV5 L;  1YIJ A;  1G6P A;  4XQN A;  5I9O A;  1AP0 A;  4HJ5 A;  4LF4 L;  2QKI C;  4NPS A;  3CCV A;  2ZTE A;  4KY6 A;  2F52 A;  4A3J G;  3PUX A;  3J7A F;  5M9O A;  1MD2 D;  3AMU A;  3STB C;  3P20 A;  1BBW A;  1RCV D;  4BBS G;  2KEC A;  4X66 L;  4QQB X;  5A35 A;  1C8C A;  2F0U A;  2WB1 G;  5EQ0 A;  3J7Y W;  1STA A;  1Y8P B;  2F0S A;  2QEJ C;  4K6D A;  5EKI A;  2EYJ A;  2XVS A;  4KHP Q;  5EBC A;  3S15 B;  2A6H D;  2A8V A;  1WYD A;  1ML0 D;  1DYQ A;  1UE1 A;  3J81 E;  1SMY C;  3PUV A;  4IQZ A;  3OHX C;  3TBI B;  5D3I B;  5GAH C;  1BBU A;  3T53 B;  3CXC A;  3HOU H;  1B2T A;  2BH8 A;  4DV2 Q;  4DR3 L;  5K36 H;  1XNQ L;  1EY7 A;  3AFP A;  3H3V H;  4JI3 L;  4P2C B;  2IHE A;  2EQS A;  1WTQ A;  3CMA A;  3I4N B;  2EXZ A;  5E3F A;  5FO9 B;  3KK7 A;  5C3E B;  4A3D G;  4DV3 Q;  3OYY A;  1KQS A;  4DR6 Q;  3W5O A;  5IYC G;  3MC0 B;  2O2L D;  3P75 A;  2L15 A;  3RZO H;  1N8R C;  4X3U A;  5FKA C;  1CK1 A;  2B2U A;  2C9O A;  4JI7 Q;  1XYI A;  4JYA L;  4DUZ L;  3V05 A;  1TII D;  1VQO A;  1V1O A;  2BCO A;  3L7Z C;  3D4W A;  3NEM A;  1GM5 A;  3AEV A;  1SSO A;  1EU4 A;  1H9K A;  3L0O A;  1VQP A;  1I4G A;  2UXC L;  2NVQ H;  5ISR A;  5JJZ A;  1EYA A;  3SK5 A;  5ELO A;  1HPC A;  4CDC C;  1UE6 A;  5C0X I;  3OTO Q;  2I5L X;  2Z8L A;  2VQE L;  3UDF A;  1LT5 D;  1N34 L;  4CDF C;  1JC7 A;  3S2D H;  3CAM A;  4PZ8 A;  4JPB W;  3NUC A;  1TQO A;  3H0G G;  1PYS B;  1LAC A;  4RWS C;  1EQV A;  3HKZ B;  1IL8 A;  1CHP D;  1XWE A;  2VZA A;  1EU3 A;  1FL0 A;  4CJ1 B;  5COY A;  1ONL A;  2B2V A;  4QGU A;  3J80 L;  4B9X A;  1D7Q A;  2PYK A;  1PLF A;  2HCC A;  2SNM A;  4XQQ A;  3TEH B;  5IE8 A;  2A69 C;  1JOQ A;  4LFA L;  1RKN A;  1BR9 A;  3K0Y A;  1DOM A;  3H91 A;  3CCJ A;  1NSN S;  5LMU Q;  3NQT A;  4Q5V A;  1YI2 A;  2R7F A;  4OGQ C;  3S1R H;  5CV5 A;  1PV4 A;  4OX9 Q;  4AH6 A;  1C48 A;  1IYU A;  1VQG A;  1YJW A;  3A7A B;  3TP5 A;  3HOX H;  1QE6 A;  4GNX C;  1PTO H;  5EJW A;  2B2V C;  1XMO L;  4JVZ A;  1ASZ A;  1WTP A;  3L9A X;  4A3K H;  2EJM A;  2A68 C;  2R3Z A;  4OO1 G;  1JT8 A;  5FLM H;  1CSP A;  2OT2 A;  1EY9 A;  4BY7 G;  1WI5 A;  3DUZ A;  3M4P A;  1I3Q B;  1IYV A;  3S16 B;  1K8A C;  1IBK L;  2R93 G;  5FLX L;  1STY A;  1IL2 A;  1RF2 D;  4KK7 A;  3E3X A;  1IBL L;  4NKL A;  1XJV A;  4BY1 B;  1RDP D;  4NMZ A;  4KV6 A;  3L2P A;  5FLX E;  2JSO A;  1S40 A;  2K50 A;  4A75 A;  1MKH A;  2N55 A;  2QEX A;  4LF7 L;  1XNR Q;  3U9O A;  4AIM A;  2RDG A;  4DK1 A;  4PZ7 A;  3W2D A;  5C44 H;  2OWO A;  4R4O A;  1V1P B;  2DJF C;  4JC0 A;  2BA0 A;  4A93 G;  2OQK A;  1UEB A;  1Y1W B;  1CT1 D;  2DNC A;  1K3B C;  4UHV A;  4DAP A;  3BS1 A;  2LMC B;  4JI4 Q;  4GZY C;  1KHI A;  4X64 Q;  4DR4 L;  3RUZ A;  3S1M B;  3KYH C;  2X6G A;  1VQB A;  5J22 A;  5CV6 A;  2RDH A;  2Q8R E;  4MN3 A;  4A3L H;  1L0X B;  5IP9 H;  4GLV B;  1WTR A;  4C3J H;  1K3R A;  4YHH L;  5LL6 X;  1BCP D;  2GN5 A;  2F0H A;  1PA6 A;  5BN3 A;  1TWH B;  3HGB A;  3UDI A;  5M5W B;  1WD0 A;  1PH8 A;  1HNX L;  2QW7 A;  4L5S A;  1EY5 A;  3GTG H;  4HJA A;  1UEA B;  5C4H A;  2PQA A;  3RN5 A;  5M3M B;  1UUP A;  1K0S A;  3WOF A;  4KJN A;  3GTM H;  1W6J A;  1Q46 A;  2G5D A;  3BDO A;  4HN7 A;  1K73 C;  5E1F A;  3GDE A;  5C0X H;  3PO2 H;  4O0A A;  1TR5 A;  1EY4 A;  4RKL A;  5KNB A;  1M90 C;  5FJ8 G;  4UY8 C;  2CKZ B;  3IRB A;  2VY3 A;  3OW2 A;  4PQX A;  5C4J H;  3RLO A;  5BR8 L;  4B3T L;  3ER0 A;  3S15 H;  1W3S A;  1KNA A;  1HTP A;  1Q12 A;  1G6Z A;  5C5M A;  2K52 A;  1WTW A;  2UUC Q;  3VR2 A;  5EAY A;  2A6E D;  1NTG A;  3CC4 A;  4XT1 B;  1MSH A;  2ZJR A;  3TP8 A;  1QJO A;  1WCM G;  4A3I B;  2UXD L;  1K8G A;  1TVX A;  4ULL A;  1ESF A;  1I5F A;  2O5I C;  4C3I G;  4JI5 Q;  2NTT A;  3IL8 A;  2N88 A;  3PIP A;  3J80 i;  1Q81 C;  1SEB D;  3ERQ A;  3J80 c;  4CKB A;  1KAA A;  1BVS A;  2LFN A;  4DR1 Q;  1QOH A;  4ZRZ A;  2UUB Q;  1Y1V B;  4DV5 L;  1XMO Q;  3UDG A;  2Q2H A;  4UPA A;  1UWV A;  5JAV A;  1CTM A;  2G9D A;  2XWJ B;  2PNH A;  4IUP A;  2R7Z H;  3S2H H;  4GKK L;  2ICI A;  4KN7 C;  2K5W A;  4J8Q A;  3HOV G;  1NMG A;  2FMC A;  2O4X A;  1SFO B;  1EUJ A;  1Z6H A;  1RJT A;  3KF8 A;  4JI1 L;  3TP7 A;  4BBR B;  2ZJP A;  4XT3 B;  3PIO 3;  1RIP A;  1F9Q A;  1F2Y A;  1D1K A;  2L4N A;  4DNR B;  4OHJ A;  1I50 H;  1IW7 C;  3GTO H;  2B2W A;  1SNO A;  2F0W A;  3NTK A;  3KF6 B;  3SK6 A;  4DV4 L;  3PQI A;  4RHS A;  3QR8 A;  4CJ0 B;  5FLX c;  1TWG B;  2KCT A;  2NN6 H;  2B2Y C;  1X3E A;  1LYL A;  1N32 L;  2YTY A;  3OMG A;  1X54 A;  4QMG A;  2J7Z A;  1GHK A;  2DY7 A;  2NZH A;  2RSO A;  3P7J A;  3I7F A;  5HGT A;  1GUG A;  1QZH A;  1A2T A;  2RBM A;  1HCZ A;  1MJC A;  4IFD G;  5M5Y B;  1XPU A;  2Y0S G;  3FKI B;  3I72 A;  3HOY B;  2UXB Q;  1X9N A;  2B63 B;  2NVX B;  3M7N A;  3D31 A;  3ZYY X;  3G6E A;  2TMP A;  1I94 Q;  2BE5 D;  3BVM A;  3URY A;  4HED A;  1IKL A;  3DEP A;  2N49 A;  3M4O B;  1CHQ D;  1EFW A;  1X6O A;  4OL7 A;  4IO9 A;  3MEH A;  1TWC H;  2KCC A;  4IPC A;  3H09 A;  1FVI A;  4AYB G;  2EE1 A;  2D9U A;  1I3Q H;  4R4I A;  4U67 3;  4GN4 B;  4R9W A;  5G3L D;  2A1A A;  2PCF B;  1G2T A;  4L5T A;  2UUA L;  2K5N A;  3KBX A;  1WVL A;  4BY1 H;  5C3W A;  1FNW A;  3SEB A;  5AFW A;  3S24 A;  2XRQ D;  1EY6 A;  2NVT B;  5D14 A;  2VUM B;  2YYZ A;  3BJU A;  3F8T A;  1KAB A;  1EYD A;  3EFX D;  2WV6 D;  1E2V A;  1H9J A;  2KVM A;  5GAE C;  1B9M A;  2YU9 H;  3CC2 A;  3PO3 H;  2Z6K A;  4GKJ L;  3NTI A;  1PHJ A;  4CDE C;  4QCL A;  5I2Y A;  5ELE A;  1Y1W H;  2K5Q A;  4DV7 Q;  4RCN A;  4ZKC B;  3CPW A;  1PTO D;  4KD3 A;  5ELF A;  2NZ1 D;  1LTS D;  1ZYR C;  1DON A;  4FF4 A;  1A63 A;  1I4Q A;  4X3S A;  2JA8 G;  1YHB A;  2EOT A;  4R8I A;  1FNV A;  2Z6K C;  3K5N A;  4RGM A;  2ZM6 Q;  1NCV A;  2JA6 G;  4XTC S;  1VQ8 A;  1QIL A;  4IAL A;  2AUJ D;  2HQE A;  2Z4I A;  2M2L A;  5FOB B;  4UDU C;  3RD4 A;  3MFY A;  4H7B A;  1GO3 E;  2MGS A;  3MWY W;  4RGN A;  2L11 A;  3ULJ A;  3T13 A;  1VQI A;  4G7Z C;  3HKZ E;  4PMC A;  1QCB D;  2EVB A;  4F8M A;  3GTL H;  1V8Q A;  1G51 A;  2HIX A;  2R92 G;  3WDN A;  1SNM A;  1NY4 A;  1X3Q A;  5FO7 B;  2NVQ B;  5ELB A;  1CQV A;  2HDM A;  2QDL A;  1EY8 A;  2B2T A;  1HRJ A;  2Z0S A;  1CA5 A;  4X3K A;  2Z4H A;  2IL8 A;  4YCW A;  1S5C D;  4KHP L;  1YVC A;  3A7L A;  1NMF A;  3BZK A;  3DM1 A;  3ERO A;  1SR3 A;  4ODG A;  5JPM C;  1B70 B;  3H94 A;  2NB0 A;  2CFM A;  1CUK A;  4DV2 L;  3Q0A A;  3FPP A;  3J7A V;  2KOL A;  2B2T C;  3FRP B;  2WB1 B;  3K59 A;  4P75 A;  5D65 A;  2VQF Q;  5E4W C;  3JAM i;  4HJ8 A;  2I5M X;  4DV3 L;  3S1R B;  4IJH A;  3D6C A;  4DR6 L;  1TKW B;  4UP7 A;  4IPD A;  4HSP A;  4ZK9 B;  2VB2 X;  2BH2 A;  3HOX B;  3MVV A;  3MXN A;  2F3I A;  3ONA B;  1WTX A;  1PTO B;  2EY6 A;  3AQQ A;  1XMQ Q;  2K05 A;  4KHZ A;  2EY1 A;  4A3K B;  4HMI A;  1TT2 A;  3QJY A;  4A3M H;  4JI7 L;  1OXT A;  3FEW X;  4LF5 Q;  1LT3 D;  1WTH A;  1VDZ A;  3E0J A;  3TZD A;  4DR2 Q;  4K0K Q;  3CCE A;  3GTK H;  3CU7 A;  3OW7 A;  3SXH A;  4P71 A;  5M3F G;  4MIU A;  4QIW E;  1N36 Q;  5HY6 A;  3K57 A;  1T9H A;  1SYB A;  3KDF B;  4E6I A;  1HNW Q;  4TSS A;  1TWG H;  3OTO L;  1YHQ A;  4Y7N H;  2HT1 A;  1KL9 A;  5KGU A;  2JA7 H;  2QF7 A;  3QOL A;  5JJK A;  5H1S E;  4A3G B;  2IW3 A;  3R2I A;  3A56 A;  1OO9 B;  3EVQ A;  3O13 A;  3UI2 A;  1JOR A;  3VR5 A;  4JCV E;  3K0X A;  2E2H H;  5IGF A;  2EIF A;  3PUY A;  5C44 B;  5AJ3 Q;  2MJ8 A;  3VYS A;  3FMC A;  3HOY H;  4A3B G;  4LF8 Q;  1X3G A;  4ZUJ A;  1JQY D;  2K04 A;  2D0P A;  3QB3 A;  4DAY B;  1M4V A;  3D4D A;  3TS2 A;  2K14 A;  1IXR A;  4QJF A;  4YCU A;  1AFP A;  1JOO A;  5C4Z A;  5LMU L;  1PZI D;  3IFD A;  4A3F G;  1EQR A;  5EPK A;  3HZX A;  4J15 A;  2R6G A;  2CWP A;  1YJ9 A;  4NB3 A;  3M4O H;  1HHV A;  1KXL A;  4OX9 L;  3I8Z A;  1STH A;  1VQF A;  1A8V A;  1T5X D;  3L3O C;  2D2C C;  4I7A A;  4RFB A;  4WJ3 M;  4LJZ C;  4C3J B;  3JC6 6;  4LFC Q;  1HR0 Q;  4KKU A;  1B44 D;  1R4Q B;  2E75 C;  3CCU A;  3GTG B;  4LK1 C;  3HOW H;  1U4P A;  3U9S A;  2L1B A;  1W2B A;  2CQA A;  2IX0 A;  2ATW A;  3GTM B;  3CRL C;  3PMF A;  1B4O A;  4CGY B;  1N9W A;  1TWF H;  3PO2 B;  2NVT H;  1F9P A;  5CBE E;  2VUM H;  4CJ2 C;  3KLW A;  1VQK A;  5C4J B;  1Q86 C;  2JA5 G;  1GKH A;  1WTV A;  1D5X C;  4ZQ3 A;  1YNJ C;  3TN2 A;  5JEA H;  1CFM A;  2VL6 A;  1XNR L;  1HUM A;  2H1E A;  1D2B A;  4R4C A;  3VYU A;  5NUC A;  3NPP A;  3HOZ G;  1HNZ Q;  2L5T A;  3DWA A;  3I70 A;  3H6M A;  2MNA A;  5IGD A;  4X6A H;  1O78 A;  2EJG C;  2Q2U A;  2MPM A;  1G2S A;  4JI4 L;  4X64 L;  1Q90 A;  2KHS A;  4DK0 A;  5DLQ E;  2IX1 A;  2NYZ D;  3R8B A;  2RDF A;  1E22 A;  5IYD H;  4IPG A;  1D1I A;  4C2M B;  2F0K A;  2F0L A;  1JWU D;  5DNF A;  1MGS A;  3GV6 A;  4GS3 A;  3CME A;  1Z9F A;  2DNE A;  3D8G A;  2IPK D;  3Q22 A;  1BCP F;  2PNR C;  1X32 A;  3V2T A;  2AHO B;  4ALP A;  3I4M B;  4XXE A;  1A3U A;  1VQL A;  2SEB D;  1XTD A;  1DD2 A;  2KA7 A;  2AWN A;  2JA9 A;  2WAQ G;  1VQN A;  1D6E C;  2R7Z B;  5C0X J;  3S2H B;  1VQE A;  3C2P A;  4M1U B;  1O7I A;  4K6L A;  5J3B A;  3S17 H;  1WD1 A;  3CD6 A;  5C5L A;  2IWH A;  1GUT A;  3CQZ H;  3ICE A;  1F77 A;  2CW0 D;  4BS9 A;  4DR5 Q;  4DR7 Q;  4RKB A;  5IYB H;  5I4D A;  1I50 B;  2B2U C;  1EY0 A;  3GTO B;  1VQJ A;  1ET6 A;  1HZC A;  4MTK A;  3MXP A;  3RZD B;  2Z1C A;  1BNZ A;  4RMF A;  5C4X B;  3TQY A;  2UUC L;  1X55 A;  4RAU C;  3OPO A;  3A74 A;  4JBW A;  1NUC A;  4KHV A;  4BBS H;  1LUZ A;  4OO1 I;  1JMC A;  1XTC D;  4DV6 Q;  1ZEQ X;  3J80 E;  4RG1 A;  4MZ9 A;  4JI5 L;  2CH4 A;  4GNX B;  1LTL A;  1E2Z A;  4HTH A;  1Q3L A;  1PH7 A;  3U58 A;  4LAA A;  1P16 A;  5T1I A;  1HA6 A;  3ITP A;  4DR1 L;  2UUB L;  1KLU D;  4C3H G;  1PFB A;  2R61 A;  1SE8 A;  2RHQ B;  2J4X A;  4DK3 C;  1TWC B;  4QY7 A;  3KLS X;  5I6Y A;  1LAB A;  3G48 A;  1QVF A;  5J1Z A;  4QF4 A;  5EPJ A;  4RA8 A;  1WJJ A;  3A5U A;  2XTI A;  4B3M Q;  4J1M A;  1XX8 A;  2E8G A;  4JI8 Q;  2D62 A;  1Z7T A;  3SR1 A;  4A3D H;  1H9M A;  2V1C C;  1E2W A;  2ASB A;  2A6H C;  2LXJ A;  2I07 B;  3RLF A;  3J81 j;  5IYC H;  1ILQ A;  4A3G H;  4R1J A;  2WIN B;  1VQ4 A;  4A3C G;  4OWX B;  1R4P B;  5KEE A;  2AQ3 B;  3CCQ A;  1I4H A;  4UAI A;  4DUY Q;  4NXM Q;  1B50 A;  3CHB D;  4AQY Q;  2LSS A;  3A0J A;  3I4N G;  1TS2 A;  2EYH A;  2YU9 B;  3PO3 B;  2K1B A;  4IUQ A;  5C3E G;  2NN6 I;  5GQO A;  1S72 A;  1PDQ A;  4WJ4 A;  4TKO B;  4CDD C;  3GTQ H;  2WP8 J;  3K8A A;  4TQU S;  3MXU A;  4JK1 C;  3I56 A;  3I73 A;  1V1P A;  4QIW B;  3DXJ C;  4DAM A;  5M5X H;  2F0J A;  3OIP A;  3BVZ A;  1K28 A;  1IZ6 A;  2WFW A;  2E5L Q;  2F0D A;  1Y8O B;  2QDB A;  3QWN A;  2UXB L;  3NP8 A;  3W1G A;  4DN4 M;  1HFN A;  3ERS X;  1I94 L;  3G71 A;  4PG3 A;  2M9V A;  2PMZ E;  2QIL A;  2KHJ A;  2F0O A;  1A6X A;  2J0T D;  3T1Y Q;  3SK8 A;  5FO8 B;  2OEO A;  3NQI A;  4Z9C B;  1C9O A;  2E76 C;  2EYM A;  1A62 A;  1CI3 M;  1UE5 A;  4JI2 Q;  2Q8T A;  4B9W A;  1J8I A;  1RD9 D;  1U9R A;  4XYO A;  1SYG A;  4FYD A;  3DEO A;  3J7A 5;  3FP9 A;  2DUD A;  1AZP A;  1BDO A;  5G3L F;  3M4Q A;  4HID A;  4G7O C;  1X56 A;  1VQ7 A;  1Z47 A;  1EIG A;  1SYE A;  1QNU A;  3HKZ G;  3LWU A;  1X65 A;  5CGK A;  1K83 H;  4IOA A;  3A8K E;  3K81 C;  4K2K A;  1EEF D;  4LF6 Q;  3GTL B;  1JWS D;  4KTA A;  1N33 Q;  4M8A A;  4IPH A;  3GTJ H;  1CZG A;  2YV5 A;  2WB1 E;  3G4S A;  3KJO A;  5CV9 A;  3E0E A;  4XDX A;  4YWL A;  4OO1 H;  2VW9 A;  1B3Q A;  1KNE A;  2B8F A;  2NVY B;  1HR0 W;  4OEL B;  4AYB B;  5A2Q L;  4HIO A;  3K7U C;  4BY7 H;  1I4P A;  5CR3 A;  2YTV A;  2XWB B;  4DV7 L;  3R2T A;  3VYT A;  1PTO F;  2R93 H;  3K80 C;  3PIO A;  3NWS A;  3UE0 A;  1EFI D;  1GVP A;  4K5V A;  5A2Q E;  1IKM A;  5CC4 A;  3QIA A;  4QB4 A;  1JIC A;  2GVB A;  2HHH Q;  4C2M H;  4C1N K;  2A5H A;  3K5M A;  1FGU A;  2EYP A;  2Q8I B;  2P5Z X;  2N78 A;  2EY5 A;  2NBF A;  2ZM6 L;  3I4M H;  3K58 A;  5JPN C;  4XQJ A;  4P72 A;  3NBH B;  1SNP A;  2CH4 W;  1CM9 A;  5IP7 G;  4H44 C;  4A93 H;  4A3M B;  3H15 A;  1PRT D;  1AEX A;  2KHI A;  3M7G A;  3EQL C;  1U0L A;  1EEI D;  1JJG A;  4GN5 A;  4IFD I;  4ID6 A;  3S1Q H;  3D6W A;  3GTK B;  1Q1B A;  2CVR A;  2PZU A;  4U68 A;  1ICW A;  3RZD H;  1VF5 C;  1Y1W G;  4G7H C;  5K5P A;  1G8Z D;  4KLK A;  2JK8 A;  3MFG A;  5C4X H;  4HJ9 A;  1EQQ A;  4EQ5 A;  4Y7N B;  2JA7 B;  3KF6 A;  5FK9 C;  3X3N A;  2K03 A;  1IBM Q;  1F9S A;  3KBG A;  4DU9 A;  1SYD A;  5CBA E;  3BZD B;  4TVA B;  4DNI A;  2ZJQ A;  4O1N A;  5E4X A;  1VCI A;  4DK6 C;  2M00 A;  2IY5 B;  2MFI A;  3SVM A;  1E0B A;  1YNX A;  4A3E B;  3JAM L;  2E2H B;  2CWA A;  2Z6B A;  2HQL A;  5FJ8 H;  1BCP C;  1NE3 A;  1VQC A;  2B2W C;  1HTL D;  3DHQ A;  4DNT B;  5HGQ A;  5CYU A;  1RHP A;  3JAM E;  1GHJ A;  5LL6 S;  1YNN D;  2R92 B;  1A15 A;  4ZUI A;  5M3M G;  2VQF L;  2LY7 A;  2PI2 E;  4GOP B;  3A5Z B;  2K5H A;  4B3S Q;  2K5V A;  3MEF A;  4PMW A;  1NR2 A;  2HD3 A;  4HAE A;  1DOK A;  1VQA A;  2QA4 A;  1LTB D;  5KNC A;  4QL5 A;  1XMQ L;  5KIX A;  1GUN A;  1QG7 A;  4MTN A;  3OOC A;  1VQ6 A;  2AQ1 B;  4LF5 L;  1P8L A;  1ENF A;  3HOW B;  4EX5 A;  2AMC B;  4DR2 L;  3C1F A;  4RGO S;  2F4V Q;  4CKC A;  4K0K L;  1J5E Q;  1F2M A;  2FMM A;  1J6Q A;  1LTG D;  1TWF B;  4I65 A;  2VB3 X;  1N36 L;  4ILW A;  3U4Z A;  1E1T A;  2A6E C;  4A3I G;  1HNW L;  1XPR A;  1VMP A;  4R4T A;  1LTI D;  4PMB A;  4DV1 Q;  1VQD A;  1PRT B;  4ME5 A;  1CKN B;  2QGQ A;  4LW1 A;  2EYF A;  5IGC A;  3T1H Q;  4HIK A;  1AZQ A;  1B3A A;  2ALY B;  1Y1V G;  1II3 A;  2A73 B;  4K14 A;  5AJ3 L;  1ENC A;  4KJO A;  4LF8 L;  4CBV A;  2ID0 A;  2XN9 C;  2AWO A;  5EBD A;  1EZ6 A;  1J9O A;  2JN4 A;  3TS0 A;  1ESR A;  1SYC A;  4JG2 A;  1G29 1;  3IKJ A;  4K2L A;  4PV1 C;  5M3F B;  2KJX A;  1PYW D;  1UE7 A;  3CP0 A;  3HP3 A;  1B53 A;  3CCM A;  4HSV A;  1GXD C;  4IOC A;  1LLR D;  2UU9 Q;  5JOB A;  1EWC A;  4NXN Q;  4LFC L;  1HR0 L;  3M3Y H;  1V43 A;  4BBR G;  3CW2 C;  5JVG 3;  2BA1 A;  5CV4 A;  2SNS A;  2KEE A;  1SBB B;  2F0P A;  3OWF A;  1B8A A;  1SJH D;  3P1H A;  2KQ3 A;  2MP1 A;  4IFD H;  1ICF B;  4PNY A;  4XYQ A;  3K7A B;  3F2U A;  4LWC A;  2XSC A;  1V9P A;  4ZCK A;  2PMZ B;  4P74 A;  3H3V C;  4EGV A;  1DGS A;  2RF4 A;  3S17 B;  2DGY A;  3CQZ B;  2K28 A;  5JEA J;  1O7Y A;  4HIM A;  2GVA A;  3EN2 A;  3I3C A;  5LMN Q;  3S1N B;  3FKI G;  2NVY H;  3NTH A;  2ICE C;  2B63 G;  1KRT A;  1EWI A;  5DEH A;  1VQM A;  3PUZ A;  4BA1 I;  3STB D;  4A3J B;  2XNA C;  3EBE A;  4BXX G;  1YIT A;  1HNZ L;  1PH2 A;  1PVO A;  4XIG S;  1XXG A;  2BE5 C;  4V0B A;  4MHE A;  4BBS B;  3MAQ A;  2VNU D;  3LWE A;  3A8J E;  4JOI A;  1STN A;  5JVH 3;  1Q8I A;  1OXU A;  3LNN A;  1NBW A;  2B39 A;  4N8F A;  1UAP A;  3JAM c;  3GO5 A;  4RCO A;  1LT6 D;  3HRZ C;  1SMY D;  1HQR D;  4UP8 A;  2PPB C;  3PSI A;  5IWA Q;  3TDQ A;  3VR3 A;  4JOI C;  4APV A;  3R93 A;  4WOR A;  3MZ5 A;  1F9R A;  4L63 B;  2JA8 H;  4A3D B;  3BDL A;  1TXY A;  2H5X A;  1I4X A;  4F87 A;  2JA6 H;  4DR5 L;  1F2Z A;  3S14 H;  1Q7Y C;  4DR7 L;  3KDF A;  2ZTC A;  2HCI A;  1ZKO A;  2DN8 A;  1PTO C;  3HOU G;  1QUQ B;  3AYH B;  3FDT A;  1PZK D;  5K36 G;  4EQN A;  2F0F A;  4A3E H;  4B08 A;  2WAQ B;  1Q82 C;  1JE4 A;  2F03 A;  3PV0 A;  5E7N A;  4X62 Q;  1L1O B;  3F2C A;  3OMC A;  4HJ7 A;  3GTQ B;  1FYC A;  4J6H A;  5IYD G;  1EIY B;  2JXM B;  2WKD A;  4DV6 L;  1QNK A;  1I6H B;  3QOJ A;  4DAY A;  5M5X B;  2R92 H;  5D3D A;  4FNF A;  3C46 A;  1SE3 A;  3RN2 A;  2PZW A;  4Y52 H;  2Y0S E;  1CZW A;  1FJG Q;  4WJW A;  2K01 A;  3F2B A;  2OTJ A;  1QVC A;  1EZ8 A;  1OXV A;  4YY3 Q;  1SAP A;  1TY2 A;  4POG A;  2F1M A;  1W6K A;  3H0G B;  1KAW A;  2E2I H;  3DMU A;  3PCO B;  3I4O A;  3K5O A;  4N9P A;  5F2D A;  3X3M A;  4X65 Q;  5BN5 A;  2A69 D;  2ZXO A;  1EOT A;  2KCN A;  4AYB E;  1JJ2 A;  4LF9 Q;  2AUK A;  4B3M L;  4JI8 L;  4LNQ A;  1VF7 A;  5C6A A;  1Y8N B;  2PI2 A;  4K8I A;  3MXG A;  1MBY A;  4RGT A;  2I46 A;  1DOL A;  1K83 B;  2MUY A;  4RH6 A;  3TRZ A;  1ROD A;  2JEB I;  1LT4 D;  3PUW A;  2Q2I A;  3BG3 A;  3GTJ B;  3KOJ A;  1X3P A;  3NSW A;  3DWQ A;  4DUY L;  1EQT A;  4KI0 A;  2A68 D;  4N9T A;  2MO1 A;  4C3H B;  1OXS C;  4YCV A;  4JI0 Q;  4AQY L;  4NXM L;  1AN8 A;  1WFQ A;  1S5F D;  1DXM A;  1GUS A;  4FVM A;  3A55 A;  3DM3 A;  1YHA A;  1MJE A;  2K6A A;  1STB A;  2EY2 A;  1QVG A;  2K32 A;  2F0Q A;  4HCS A;  4LMQ D;  4BY7 B;  2B8G A;  3VDY A;  3J81 L;  3HOX G;  2R93 B;  3T16 A;  3AB9 A;  3HG9 A;  3BYY B;  4V19 0;  2E5L L;  2EYL A;  5M3F H;  2JEA I;  4F7X A;  1I6V C;  2EXD A;  4A3K G;  2RHS B;  2ZXP A;  1IHZ A;  2TSS A;  4C1N I;  1A3T A;  3I91 A;  5FLM G;  1DCZ A;  4A76 A;  1H9S B;  1SNC A;  3CCS A;  1H9S A;  1A3V A;  3T1Y L;  1HZ9 A;  1PZJ D;  3MA2 B;  4EVO A;  4FF3 A;  4B3R Q;  1E24 A;  1LV9 A;  2BDO A;  4TRD A;  4LFB Q;  3K7A H;  4JI2 L;  1HJP A;  1S3O A;  4IUT A;  4A3B H;  2O5J C;  1A2U A;  1RTO A;  2F4I A;  4A93 B;  2OTL A;  3TSS A;  1QZG A;  1R9T B;  3HEJ A;  4A3G G;  3T56 B;  4S3S A;  4YWM A;  3G6J B;  4NW2 A;  4G57 A;  4DV0 Q;  2OQ0 A;  2K7V A;  4FP5 D;  4A3F H;  4I7Z C;  1LM0 A;  2B29 A;  3Q23 A;  3A8I E;  1FGB D;  2E2J H;  3S1Q B;  4LF6 L;  5C44 G;  4A4I A;  1N33 L;  3S1N H;  3PF5 A;  3BU2 A;  1GUW A;  2ZTD A;  2RCN A;  2I5H A;  2SDF A;  3NEL A;  4JBK A;  2RCF A;  2HIV A;  4JW0 A;  4A3J H;  4OIK A;  2F0T A;  4QUC A;  5KRU A;  1S4Z A;  1TU2 B;  1PMR A;  2RQX A;  2YTX A;  5I6W A;  4R4Q A;  1SNQ A;  1U4R A;  1Y14 B;  1MIU A;  4A3L G;  5IP9 G;  1I4R A;  4C3J G;  2ZT9 C;  4KN4 C;  1SDF A;  3S9W A;  1PH5 A;  1CA6 A;  4IZ8 A;  3FVQ A;  4O2D A;  2JA5 H;  1OTC A;  2HHH L;  4GNX A;  1KDA A;  4H0L C;  4K8J A;  3B6Y A;  4KD4 A;  3NXW A;  2KUM A;  3UDX A;  5COR A;  5L37 A;  4BA2 I;  3HS0 C;  1YZ6 A;  3NE5 B;  1ASY A;  5LMN W;  5C0X G;  1XPO A;  3PO2 G;  3HOZ H;  1O7L A;  3I4L A;  3NK9 A;  1YBY A;  3TZU A;  3V96 A;  2GA4 B;  3U4V A;  1WCM B;  4JI6 Q;  1PRT F;  4JV5 Q;  2A74 C;  3K6O A;  4JBJ A;  4N8X 1;  3NEN A;  1HXY D;  4LF4 Q;  4C3I B;  3EJI A;  1RTN A;  4G4K A;  3CCR A;  1EOV A;  4LUV A;  4EQP A;  4KY7 A;  4X66 Q;  1PH3 A;  2EDG A;  4KKT A;  4DFA A;  4ZYS A;  1IBM L;  3D3R A;  1H9R A;  4OWW B;  4FXD A;  2OF1 A;  4DAV A;  1LO5 D;  4H02 A;  1LTA D;  3HOV B;  4O42 A;  3EIV A;  1I6H H;  2Q2T A;  1D8L A;  2OCE A;  2F0E A;  4MNO A;  5TSS A;  2EZV A; 
#chains in the Genus database with same CATH homology
 1SR3 A;  2CWA A;  3I4M G;  4LUZ A;  3PUV A;  2HQL A;  4YWK A;  5FJ8 H;  2JE6 I;  5GAH C;  1B70 B;  1BBU A;  1VQH A;  1NE3 A;  1VQC A;  5HGQ A;  3CXC A;  2CFM A;  1CUK A;  4DV2 L;  3HOU H;  3J81 i;  2R7Z G;  2BH8 A;  4DV2 Q;  3J81 c;  5M3M G;  4DR3 L;  1C0A A;  2VQF L;  2PI2 E;  4GOP B;  4P75 A;  3H0G H;  4B3S L;  3AFP A;  3A5Z B;  4DR3 Q;  2K5H A;  2VQF Q;  4JI3 L;  3H3V H;  1XNQ Q;  2IHE A;  2EQS A;  4B3S Q;  3CMA A;  4GLA C;  3JAM i;  2K5V A;  4HJ8 A;  4JI3 Q;  2I5M X;  4DV3 L;  4A3D G;  3MEF A;  4IJH A;  4PMW A;  4DV3 Q;  3ULP A;  3OYY A;  1PH4 A;  4DR6 L;  4DV5 Q;  1KQS A;  1VQA A;  3BZC A;  4IPD A;  4UP7 A;  1YEZ A;  3W5O A;  5IYC G;  3M85 A;  2BH2 A;  4DR6 Q;  2QA4 A;  2F3I A;  1XMQ L;  3AQQ A;  4QL5 A;  2L15 A;  1EIF A;  3RZO H;  4MTN A;  1XMQ Q;  4KHZ A;  1N8R C;  1VQ6 A;  4GLX A;  4JBM A;  4A3M H;  3ULL A;  4DKA C;  4JI7 L;  4LF5 L;  1P8L A;  1OXT A;  4EX5 A;  1JE5 A;  4JI7 Q;  4LF5 Q;  3KFU A;  2F4V L;  5C4X G;  2C35 B;  2JJQ A;  2NN6 G;  2AMC B;  2PQA B;  4DR2 L;  1J5E L;  2F4V Q;  4K0K L;  4DR2 Q;  1J5E Q;  4JYA L;  3GD7 A;  4DUZ L;  4K0K Q;  2R7D A;  1VQO A;  4JYA Q;  1J6Q A;  4DUZ Q;  3CCE A;  1KRS A;  3GTK H;  3L7Z C;  3NEM A;  1GM5 A;  4C3H H;  3AEV A;  4P71 A;  1N36 L;  3L0O A;  3U4Z A;  5M3F G;  1VQP A;  4QIW E;  1E1T A;  4A3I G;  5HY6 A;  1N36 Q;  2UXC L;  1HNW L;  1T9H A;  1XPR A;  3KDF B;  2NVQ H;  4DV1 L;  2UXC Q;  5ELO A;  1CSQ A;  2XGT A;  1HNW Q;  1TWG H;  4R4T A;  1A0I A;  3OTO L;  4DV1 Q;  1YHQ A;  4Y7N H;  5C0X I;  1KL9 A;  1UE6 A;  3OTO Q;  2HT1 A;  2I5L X;  2JA7 H;  5JJK A;  5H1S E;  1VQD A;  3UE1 A;  2VQE L;  3UDF A;  2B3G A;  1CKN B;  3T1H L;  1N34 L;  2VQE Q;  2QGQ A;  4LW1 A;  3T1H Q;  4HIK A;  3CAM A;  4PZ8 A;  1N34 Q;  3S2D H;  3H0G G;  1PYS B;  2ALY B;  4ME3 A;  3PF4 A;  1SN8 A;  1Y1V G;  4JCV E;  5AJ3 L;  3K0X A;  2E2H H;  2VZA A;  1FL0 A;  2EIF A;  3PUY A;  2KBN A;  5AJ3 Q;  4LF8 L;  2ID0 A;  4QGU A;  3HOY H;  2AWO A;  4A3B G;  3F2D A;  3J7Z C;  1X3G A;  4LF8 Q;  1D7Q A;  3TS0 A;  2D0P A;  4DAY B;  3FHW A;  4A3C H;  4JG2 A;  3TS2 A;  3TEH B;  1G29 1;  1IXR A;  2K14 A;  4QJF A;  5IE8 A;  4LFA L;  4YCU A;  3W1B A;  1UE7 A;  4DPG A;  4LFA Q;  3CP0 A;  5LMU L;  3CCJ A;  4A3F G;  3CCM A;  2ES2 A;  1EQR A;  1Q1E A;  5LMU Q;  3I4N H;  4J15 A;  2R6G A;  2CWP A;  1YJ9 A;  4NB3 A;  2UU9 L;  5C3E H;  1YI2 A;  4OX9 L;  2R7F A;  4IOC A;  4NXN L;  3S1R H;  2UU9 Q;  1K9M C;  4IFD J;  1VQF A;  1A8V A;  1CKO A;  4AH6 A;  1PV4 A;  4LFC L;  4NXN Q;  4OX9 Q;  1HR0 L;  3M3Y H;  4WJ3 M;  1VQG A;  1YJW A;  1V43 A;  3JC6 6;  4BY1 G;  4BBR G;  3CW2 C;  4LFC Q;  1HR0 Q;  2BA1 A;  4OON A;  3HOX H;  1R9T H;  4GNX C;  1XMO L;  1B8A A;  1ASZ A;  3TRE A;  3CCU A;  1VQ9 A;  4A3K H;  2WAQ E;  3I2Z A;  4LWC A;  3HOW H;  4OO1 G;  1JT8 A;  5FLM H;  1W2B A;  1V9P A;  1CSP A;  3PO3 G;  4P74 A;  2IX0 A;  2ATW A;  4BY7 G;  1WI5 A;  1DGS A;  3M4P A;  2RF4 A;  2DGY A;  1K8A C;  5ELN A;  1N9W A;  1TWF H;  1AE3 A;  1JB7 A;  1IBK L;  2NVT H;  2R93 G;  2VUM H;  1IBK Q;  5JEA J;  1IL2 A;  4HIM A;  3KF8 B;  3KLW A;  5LMN L;  2GVA A;  3EN2 A;  1VQK A;  2IHF A;  1Q86 C;  5LMN Q;  2JA5 G;  1IBL L;  1GKH A;  1B7Y B;  3FKI G;  1XJV A;  4LUO A;  2NVY H;  1IBL Q;  3L2P A;  3ZJY C;  2B63 G;  1S40 A;  2K50 A;  2VL6 A;  4A75 A;  1KRT A;  1XNR L;  1EWI A;  1VQM A;  1MKH A;  3PUZ A;  2QEX A;  4BA1 I;  4LF7 L;  1XNR Q;  3STB D;  4LF7 Q;  3EBE A;  4R4C A;  4BXX G;  1YIT A;  1HNZ L;  1PH2 A;  4AIM A;  1PVO A;  4XIG S;  3SGI A;  3HOZ G;  1HNZ Q;  3S14 H;  4PZ7 A;  5C44 H;  2MNA A;  2OWO A;  4R4O A;  2VNU D;  1Q8K A;  4X6A H;  4JC0 A;  2BA0 A;  3CF5 A;  4A93 G;  4JOI A;  1PH6 A;  2OQK A;  1UEB A;  2Q2U A;  1OXX K;  3M4O H;  4JI4 L;  1OXU A;  1KXL A;  2N8N A;  4X64 L;  4JI4 Q;  1NBW A;  4GOP A;  1KHI A;  1VS0 A;  4X64 Q;  4DR4 L;  3JAM c;  5DLQ E;  2IX1 A;  3KJP A;  4DR4 Q;  3KYH C;  1VQB A;  1E22 A;  5IYD H;  4IPG A;  3GO5 A;  5JJL A;  4A3L H;  5IP9 H;  4GS3 A;  4IJL A;  4GLV B;  1Z9F A;  1WCM H;  3CME A;  4L5R C;  1X3F A;  4C3J H;  5IWA L;  4UP8 A;  1K3R A;  4YHH L;  3PSI A;  2GN5 A;  5IWA Q;  4ALP A;  4YHH Q;  2AHO B;  1U5K A;  1VQL A;  1PA6 A;  1XTD A;  4C3I H;  2WAQ G;  2AWN A;  2JA9 A;  3UDI A;  1VQN A;  4JOI C;  1PH8 A;  1HNX L;  4L5S A;  3GTG H;  4HJA A;  1HNX Q;  4APV A;  5C0X J;  1WOC A;  2PQA A;  1VQE A;  3RN5 A;  1BKB A;  4GOP C;  2JA8 H;  3GTM H;  1O7I A;  4PZ6 A;  3Q8D A;  1Q46 A;  2KEN A;  5J3B A;  5IT9 c;  3S17 H;  3CD6 A;  1K73 C;  3GDE A;  3S16 H;  1TXY A;  2H5X A;  3CQZ H;  4O0A A;  3PO2 H;  3ICE A;  2JA6 H;  4DR5 L;  1M90 C;  4UY8 C;  1Q7Y C;  3D0F A;  5FJ8 G;  2CKZ B;  3KDF A;  3IRB A;  2VY3 A;  5GAD C;  4DR5 Q;  4DR7 Q;  1GD7 A;  2ZTC A;  5IYB H;  3OW2 A;  1NJI C;  5C4J H;  4B3T L;  3RLO A;  5BR8 L;  5IP7 H;  3HOU G;  1E1O A;  1QUQ B;  4B3T Q;  5BR8 Q;  3AYH B;  4UP9 A;  1VQJ A;  3HOV H;  1HZC A;  5K36 G;  1CKN A;  3ER0 A;  3S15 H;  1W3S A;  3F1Z A;  4RMF A;  1M1K C;  4A3E H;  4X62 L;  1Q82 C;  3PV0 A;  3TQY A;  5E7N A;  3E9H A;  4X62 Q;  3CC7 A;  1L1O B;  1Q12 A;  3F2C A;  1X55 A;  2UUC L;  3A74 A;  5JJI A;  1AH9 A;  2K52 A;  4JBW A;  2UUC Q;  4HJ7 A;  2NZO A;  1EIY B;  5IYD G;  5EAY A;  4BBS H;  1LUZ A;  4DV6 L;  1EYG A;  3HFZ B;  4OO1 I;  1NTG A;  1JMC A;  3CC4 A;  4DV6 Q;  2ZJR A;  2KCM A;  1WCM G;  2R92 H;  3E9I A;  2UXD L;  1K8G A;  3RN2 A;  2UXD Q;  4RG1 A;  4MZ9 A;  4A3M G;  1I5F A;  4JI5 L;  4Y52 H;  1FJG L;  4GNX B;  1LTL A;  3PIP A;  4JI5 Q;  1E3P A;  2Y0S E;  1FJG Q;  3S1M H;  3J80 i;  3F2B A;  1Q81 C;  2OTJ A;  1PH7 A;  1QVC A;  3U58 A;  1P16 A;  4YY3 L;  4OXP A;  3J80 c;  1OXV A;  4YY3 Q;  4DR1 L;  2UUB L;  4POG A;  1BVS A;  4DR1 Q;  2UUB Q;  1XNQ L;  1KAW A;  1VQ5 A;  1IYJ B;  1CKM A;  4DV5 L;  1XMO Q;  2E2I H;  3UDG A;  3PCO B;  1H95 A;  3I4O A;  1PYB A;  2Q2H A;  4X65 L;  1SE8 A;  1UWV A;  2RHQ B;  3AFQ A;  4UPA A;  4DK3 C;  4X65 Q;  4QY7 A;  1TWH H;  5M5W H;  2JA7 G;  3G48 A;  1QVF A;  4GN3 B;  2PNH A;  2R7Z H;  4LF9 L;  3S2H H;  4AYB E;  1JJ2 A;  4GKK L;  5M3M H;  4B3M L;  4LF9 Q;  4GKK Q;  1WJJ A;  4JI8 L;  3A5U A;  2XTI A;  4LNQ A;  4B3M Q;  3HOV G;  2PI2 A;  1V1Q A;  1NMG A;  2E8G A;  4JI8 Q;  2D62 A;  4A3E G;  4A3D H;  1JJC B;  3TRZ A;  2JEB I;  2V1C C;  5GAG C;  1EUJ A;  2MQH A;  2ASB A;  3I55 A;  2LXJ A;  3HOY G;  3PUW A;  4JI1 L;  3RLF A;  1HZB A;  2Q2I A;  2MO0 A;  5IYC H;  3J81 j;  2ZJP A;  4JI1 Q;  1RIP A;  4A3G H;  4R1J A;  3KOJ A;  1VQ4 A;  4A3C G;  4JI0 L;  4OWX B;  4DUY L;  1I50 H;  4KI0 A;  3CCQ A;  2MO1 A;  1C7Y A;  1OXS C;  4YCV A;  4DUY Q;  4AQY L;  2I0Q A;  4JI0 Q;  4NXM L;  1WFQ A;  3GTO H;  4NXM Q;  3KF6 B;  4AQY Q;  2LSS A;  1PFS A;  3U50 C;  4DV4 L;  3DM3 A;  1YHA A;  1MJE A;  3A0J A;  5FLX c;  4DV4 Q;  3I4N G;  1QVG A;  2KCT A;  5C3E G;  2NN6 I;  1X3E A;  5GQO A;  3VDY A;  3RR5 A;  1S72 A;  1L0W A;  1KIX A;  4WJ4 A;  1LYL A;  3GTQ H;  1N32 L;  2YTY A;  2WP8 J;  1X54 A;  3K8A A;  5IY0 A;  4TQU S;  2LXK A;  1L2F A;  4P73 A;  3I56 A;  3HOX G;  1N32 Q;  1SRO A;  2IT1 A;  2NZH A;  3I7F A;  4DAM A;  5M5X H;  5M3F H;  1QZH A;  2E5L L;  2JEA I;  4A3I H;  1TWA H;  2EXD A;  1AE2 A;  1IZ6 A;  2WFW A;  1MJC A;  2E5L Q;  4A3K G;  4IFD G;  2RHS B;  1XPU A;  2Y0S G;  1KC8 C;  2UXB L;  3DLL A;  3HOW G;  3W1G A;  1X9N A;  2UXB Q;  5FLM G;  4A76 A;  2VS1 A;  3ERS X;  3CCS A;  3D31 A;  4PG3 A;  3G71 A;  1I94 L;  1K0R A;  3G6E A;  2PMZ E;  3M7N A;  4DR7 L;  1SRU A;  1I94 Q;  2KHJ A;  4B3R L;  3T1Y L;  1HZ9 A;  4B3R Q;  1E24 A;  3T1Y Q;  2VUM G;  1Y1V H;  4LFB L;  2N49 A;  3H3V I;  1C9O A;  4POF A;  4LFB Q;  3K7A H;  1A62 A;  4JI2 L;  1HJP A;  1S3O A;  1EFW A;  1X6O A;  4IO9 A;  1UE5 A;  4A3B H;  3MXN B;  1TWC H;  4JI2 Q;  4IPC A;  1PH1 A;  2OTL A;  1FVI A;  4AYB G;  1QZG A;  1SMX A;  4A3G G;  5JEA G;  4YWM A;  4DV0 L;  3J7A 5;  3FP9 A;  2DUD A;  5GRO A;  1I3Q H;  4R4I A;  4DV0 Q;  3M4Q A;  4HID A;  1X56 A;  4GN4 B;  2OQ0 A;  1VQ7 A;  1Z47 A;  2K75 A;  4A3F H;  1HZA A;  1LM0 A;  2A1A A;  2B29 A;  3HKZ G;  1SFO H;  2E2J H;  1X65 A;  4L5T A;  1K83 H;  2UUA L;  4IOA A;  3RNU A;  4LF6 L;  3K81 C;  2K5N A;  5C44 G;  2UUA Q;  4A4I A;  1N33 L;  4LF6 Q;  3S1N H;  3RLN A;  3PF5 A;  2CQO A;  3BU2 A;  1N33 Q;  4BY1 H;  1SLJ A;  2ZTD A;  4BBR H;  4IPH A;  1QUQ A;  2RCN A;  2I5H A;  3S24 A;  3GTJ H;  3HKS A;  3NEL A;  4JBK A;  2YV5 A;  1E7Z A;  2WB1 E;  4FDB A;  2YYZ A;  2D0O A;  3G4S A;  2HIV A;  4A3J H;  3BJU A;  3KJO A;  3F8T A;  2A19 A;  3E0E A;  4YWL A;  5GAE C;  2VW9 A;  1L1O A;  2YTX A;  2YU9 H;  3CC2 A;  3PO3 H;  1HR0 W;  2Z6K A;  4GKJ L;  4R4Q A;  1Y14 B;  4HIO A;  1MIU A;  3K7U C;  1PHJ A;  5IP9 G;  4A3L G;  4OWT B;  4BY7 H;  4GKJ Q;  2YTV A;  4DV7 L;  1Y1W H;  4DV7 Q;  3CPW A;  2R93 H;  3K80 C;  3PIO A;  1PH5 A;  3UE0 A;  3PGZ A;  1GVP A;  3GTP H;  2CCZ A;  4L5Q A;  1YJN A;  4O2D A;  2JA5 H;  1OTC A;  5M5Y H;  2HHH L;  4GNX A;  3FKI H;  1HH2 P;  2K4K A;  2GVB A;  3CPF A;  3LGJ A;  4C2M H;  2HHH Q;  3CCL A;  1A63 A;  3B6Y A;  1FGU A;  3WWV A;  2NVX H;  2B63 H;  2JA8 G;  1PH9 A;  1YHB A;  1RL2 A;  3UDX A;  1KD1 C;  2N78 A;  1L1O C;  4BA2 I;  4BXX H;  2ZM6 L;  2Z6K C;  3I4M H;  1YZ6 A;  1ASY A;  5LMN W;  5C0X G;  1XPO A;  2N3S A;  2ZM6 Q;  3PO2 G;  3M9B A;  3HOZ H;  2JA6 G;  2JQO A;  4XTC S;  1VQ8 A;  1YBY A;  2FXQ A;  4P72 A;  3NBH B;  5IYB G;  4JI6 L;  3U4V A;  2AKW B;  5IP7 G;  4A93 H;  4JV5 L;  4JI6 Q;  1YIJ A;  1G6P A;  4JV5 Q;  4JBJ A;  3H15 A;  4HJ5 A;  4LF4 L;  1GO3 E;  3NEN A;  4NPS A;  2KHI A;  3CCV A;  4LF4 Q;  3ULJ A;  1U0L A;  2ZTE A;  1VQI A;  3HKZ E;  2F52 A;  4A3J G;  3PUX A;  1JJG A;  4GN5 A;  4IFD I;  3CCR A;  1EOV A;  3STB C;  3S1Q H;  4LUV A;  1BBW A;  4BBS G;  4QQB X;  4X66 L;  1Q1B A;  3GTL H;  4X66 Q;  1G51 A;  2HIX A;  2R92 G;  1NY4 A;  3RZD H;  2WB1 G;  1Y1W G;  1PH3 A;  4KLK A;  2JK8 A;  5C4X H;  4HJ9 A;  1EQQ A;  4EQ5 A;  3KF6 A;  1IBM L;  2Z0S A;  1IBM Q;  4OWW B;  4YCW A;  4KHP L;  1YVC A;  4H02 A;  4TVA B;  4KHP Q;  4DNI A;  2ZJQ A;  1I6H H;  4DK6 C;  1VCI A;  3EIV A;  2IY5 B;  2Q2T A;  2MFI A;  1D8L A;  2OCE A;  1NMF A;  1YNX A;  4MNO A;  1WYD A;  2A8V A;  3BZK A;  1UE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...