2HCIA

Structure of human mip-3a chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
SNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Small inducible cytokine A20
publication title Structure of human MIP-3alpha chemokine.
pubmed doi rcsb
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2hciA00
4U68A 1M8AA 3HP3A 1ICWA 2K01A 4X3KA 3ONAB 4IUVA 1WTWA 1WTQA 1ESRA 2B2YC 2MPMA 4UAIA 3TZDA 1WTXA 1PLFA 3GV3A 4XT1B 2EPBA 2DY7A 2EOTA 5EJWA 1U4RA 1WTOA 1A15A 5CBAE 2KUMA 1BNZA 1KNEA 2RA4A 2L1BA 3IL8A 4IURA 4ZK9B 1X3PA 2MP1A 2N55A 1JE4A 1DONA 2JYOA 2MGSA 4R8IA 2L9HA 2KVMA 2Q8TA 1DZ1A 1VMPA 1PDQA 1O7ZA 1PFNA 1E0BA 1G2SA 1LV9A 2HCCA 1G91A 3DEOA 2IL8A 2HUGA 2SDFA 3D6WA 5DNFA 1MI2A 1QG7A 5EPLA 3KUPA 1B2TA 1G6ZA 2X6LA 1JICA 1PFMA 3I91A 1CA5A 1F9RA 2B2WC 5CORA 2X6GA 1ILQA 1B53A 1AZPA 4HEDA 4IUTA 4CJ2C 4RWSC 3DM1A 1PFBA 1SSOA 2K03A 3QO2A 1ML0D 2NWGA 3R93A 1B50A 1SDFA 3KBXA 1GUWA 5D14A 5CBEE 3Q6SA 4QUCA 1IKMA 1BO0A 1VMCA 1DOKA 2K04A 1KNAA 1NCVA 1ZXTA 2K28A 2B2TA 5D65A 2HDMA 1CA6A 3FPUB 2RVLA 2JP1A 2X69A 3I8ZA 4LMQD 5EPJA 5EKIA 4ZAIA 4X3TA 1EL0A 4X3UA 1HUNA 1AZQA 2N88A 4HSVA 1HHVA 1X3QA 1BF4A 3MWYW 1MSHA 3FDTA 3IFDA 1XYIA 1EIHA 3F2UA 2KEEA 2RSNA 3N52A 5JJZA 4ZKCB 4O42A 4XT3B 4RAUC 2K05A 1HFNA 2J7ZA 2RSOA 1IKLA 1Q3LA 2FMMA 1WTPA 4MN3A 2L4NA 1NR4A 4ZKBB 2CVRA 1WVLA 1WD1A 1DOLA 2B2VA 3P7JA 5CMDA 1F2LA 2L11A 5EQ0A 2B2UA 1HUMA 5T1IA 1QNKA 1MSGA 1C8CA 2KEDA 1B4OA 2B2YA 1RODA 1X32A 1G2TA 1HFGA 1J8IA 1WD0A 5AFWA 1NR2A 2DY8A 2KOLA 4NW2A 3TN2A 2M2LA 1WTVA 2FFKB 2EE1A 3I90A 2BDNA 1O80A 1EIGA 1AP0A 1IL8A 2KECA 1O7YA 4ZLTF 2R3ZA 4IUQA 1RHPA 2FJ2A 3UI2A 1U4PA 4XDXA 1U4LA 5EPKA 2FINB 1RJTA 4QUFA 1F9PA 1RTNA 1QE6A 1TVXA 2B2TC 3MTSA 1MGSA 3SVMA 2NYZD 1B3AA 1WTRA 4DN4M 2D9UA 2K1BA 4OIKA 1DOMA 1XX8A 1NAPA 3G7LA 3LWEA 1S4ZA 4HAEA 2B2WA 5COYA 1F9QA 1EQTA 4R9WA 3H91A 1SAPA 1CM9A 2Q8RE 3DEPA 1RTOA 4X3SA 4CJ0B 1ILPA 2H1EA 5T1GA 1HRJA 2VXWA 2NZ1D 4OIJA 1HA6A 4CJ1B 1U4MA 1J9OA 2FHTA 3I3CA 2MJ8A 2HDLA 2B2VC 4RA8A 5E4XA 2XIWA 4IUPA 2HCIA 1EOTA 3GV6A 4IUUA 1F9SA 4HCSA 4MHEA 5E4WC 1BBXC 2B2UC 2L12A
chains in the Genus database with same CATH superfamily
4X3KA 4LW1A 4YY3L 4ID6A 4UAIA 1WTXA 4CDEC 1OXXK 4G4KA 1PRTF 1A6XA 3BVMA 2EPBA 4Q0FA 1T9HA 4P74A 1PXUA 1N9WA 4ZK9B 1X3PA 2EYPA 4A3BB 5CR3A 4GZYC 2E75C 2R92G 3PQIA 3TP6A 3E9HA 4A3IH 1VQ9A 4C1NK 1DCZA 1JICA 3CCVA 3KF6A 4YIJA 1A0IA 3RN2A 2MNAA 2UUCL 4FYDA 1DYQA 4DK3C 3NEMA 5JJIA 1FD7D 1DOKA 2K14A 2F0JA 4J15A 3OIPA 3VYTA 3JC66 4IZ8A 2PZTA 4LUZA 1PTOH 4DV0Q 4OWWB 2J7ZA 1WTPA 5FO9B 4M8AA 2V1CC 2CVRA 1NUCA 2JQOA 1Q46A 2V4DA 3QJYA 2B2VA 1IXRA 2HHHL 4CDDC 2F0VA 3R3OA 1MJCA 4PZ7A 4P73A 4RH6A 3BU2A 3GTQB 4EQ5A 2Z1CA 3PF4A 1I4HA 2IY5B 1K3BC 2N3SA 1SNOA 3HOUB 4LF4Q 3NBHA 2JE6I 4MZ9A 3GTPB 1N32Q 1YEZA 4B9XA 2F4IA 1M90C 4MNOA 4J8QA 4F87A 2WFWA 1N36Q 4UP9A 3VR5A 4BY7B 4LFCL 1X3EA 5CYUA 1EOVA 5CV6A 2ICEC 3H0GG 1IHZA 3LWEA 4DKAC 1HZCA 4K0KQ 2B63H 2KQ3A 1SAPA 2Q8RE 5IYBH 1I4GA 1MBYA 2H1EA 4QJFA 5BN5A 3I4NG 3V05A 3JAMi 1GVPA 3QB3A 1W6KA 2FHTA 1NMGA 4K2LA 1G8ZD 3VR3A 1VQ6A 3U4ZA 4C3HH 1EOTA 1YJWA 1F9SA 3K8AA 1KDAA 4GOPB 2JA5H 4PV1C 2WAQG 3TZDA 3L7ZC 3PIPA 1D2BA 1HNXQ 3PGZA 5KIXA 4ODGA 3DHQA 3STBD 1QZGA 1E22A 3QG1A 1N32L 2L15A 3WOFA 4BA1I 1ENFA 3B6YA 4YCWA 5BN4A 1AN8A 1V1QA 1G91A 5IT9E 1N36L 5IT9c 1G6ZA 1IZ6A 4C3JB 3CQZB 4EX5A 4HJ7A 5FLMH 2AWNA 3MXNB 1PFBA 2J0TD 1X3FA 5IP9G 3EVQA 3BYYB 3Q6SA 3HFZB 2MHVA 5CV5A 2NVYB 4BBRH 2K04A 1R9TB 1Z7TA 3FMCA 4JW0A 2OWOA 2N49A 1V8QA 1AZQA 3A74A 1HHVA 4A3FB 1HNXL 3S17B 2FMMA 2NN6G 4AYBB 1JT8A 5IYDH 1DOLA 4KN4C 2YTXA 3ZJYC 3RZDB 4DK6C 2JK8A 4KD3A 5J3BA 3SR1A 2WB1B 5JVG3 1WTVA 2K52A 4JOIC 1WCMH 2ZXPA 1N33Q 4ZUJA 2SNMA 1RCVD 2OTLA 1F9PA 1Q8KA 1K3RA 1FJGQ 2VZAA 4C3IB 1CZGA 1YJNA 3OTOQ 1J6QA 1SJED 5DM63 3RLFA 1TWGH 3OOCA 1SYDA 2ZXRA 3GP7A 3I72A 4E6IA 2NN6I 1HRJA 5JEAH 3M4PA 4OIJA 1A3VA 1TY0A 1UEAB 3LGJA 1HA6A 4FF2A 4CDCC 3NTIA 1V1PA 4P2CB 4HJ8A 3HOZB 3RN5A 2B2UC 4DF7A 1PH9A 3HP3A 2JA8H 1HTLD 3E9IA 3BYTB 1PLFA 4XT1B 2KBNA 4IO9A 3X3NA 1U4RA 2L1BA 1EIFA 3GTJB 4A3EB 2EY1A 4AYBE 2L9HA 2Z6BA 3FEWX 4B08A 3AMUA 1N33L 1GD7A 1L1OC 4JI7Q 1TS2A 4AH6A 3D6WA 3MA2B 4DV4L 4WJWA 2DJGC 5IT9L 2ASBA 3HOXH 1FJGL 3ERSX 3P75A 4A3JH 3OTOL 2R92H 2EQSA 3MXGA 4N8X1 3M3YB 2QDBA 3M9BA 4PMCA 3S1NB 2L5TA 2WB1E 4BY1H 1PH6A 3A8KE 1VQHA 3NWSA 4QL5A 5IE8A 1HNZQ 1LT4D 4QMGA 4IJHA 4EQOA 2JP1A 1I6HH 2SNSA 3CU7A 2TSSA 3BDLA 1KHIA 4X3UA 5M9OA 1Q82C 3NWTA 4JVZA 3W1BA 2Z4HA 3T4AC 2PI2A 3T1HQ 1PRTC 4X66L 1Q3LA 3LX0A 1RD9D 4H7BA 4C1NI 5IIFA 1XMOQ 3BVGA 2Z9HA 5H1SE 2B2UA 2NVQH 5I6YA 2KEDA 3UE1A 4IOCA 1JQYD 5C5LA 5AFWA 5KYLA 5M5XB 2WKDA 4ALPA 3PO2H 1O7LA 3D4DA 3A56A 2NVXB 1HNZL 3S2DB 1L1OA 1TVXA 3A5ZB 1WI5A 2NTTA 3N6RA 1PYWD 1SBBB 1JR0D 1JJGA 4A3KG 1Y1WH 1PHJA 4A3MG 1S4ZA 4G7OC 5M5YB 2AKWB 2IJ0A 4R9WA 1D1IA 3J7A5 1TXYA 2JEAI 5DM73 2JA6G 5IGCA 3J7AF 1JOOA 2L0CA 1ENAA 3Q0AA 3S1MH 3D4RA 2HDLA 5IP7G 1PH7A 1ONLA 5JPMC 4LF7Q 4XQQA 2F0UA 1XMOL 4GLVB 1SRUA 1VQGA 4RCNA 2AWOA 2JA6B 5C0XG 2A68D 3GDEA 1BCPC 4BXXG 5EJWA 3W1GA 3RR5A 1WTOA 5CBAE 3S16H 2RA4A 1PYBA 4ZCKA 1Y1VG 3OWFA 2QGQA 3F1ZA 2ZTEA 2I46A 3AEVA 1I50H 5GROA 1L0WA 5LMNW 2IHFA 3U9SA 3S2HB 2Q2IA 3TP7A 1PFMA 1IBKL 2RCFA 4XYOA 4JPBW 1YHBA 4A3GB 4KTAA 2AQ3B 3G4SA 1Y1VB 3U9OA 1ML0D 3R93A 2EJMA 4JI5L 3NPPA 3GTGH 4LFAL 1IKMA 2XTIA 4A3IG 1LTLA 4LF7L 4NP5A 4ZQ3A 1LTTD 1SE3A 4A93H 5A2QE 3MWYW 3FDTA 1CKNB 1G51A 1BKBA 4A3IB 3ZYYX 4FDBA 4OL7A 2A6HD 2EYLA 2OEOA 4DV1Q 3HOVB 3NTHA 1MHWC 4K2KA 2NN6H 2HT1A 1T5XD 1TQOA 1TR5A 2AUJD 2PW7A 1QVGA 4DGZA 4O1NA 1I4QA 4NW2A 2DY8A 2C5CA 3TN2A 2F03A 1GUOA 2FFKB 4YWLA 3RNUA 2E76C 2OQKA 2KECA 4IUQA 4TQUS 4H44C 2A6ED 1EQVA 1SNDA 3MTSA 1IL2A 3SVMA 1JWSD 1PTOB 5LMUQ 2K4KA 3KLSA 4KD4A 2Q2TA 4LF9Q 5FKAC 1GUTA 5COYA 5I2YA 4WJ3M 5L37A 1C0AA 1PMRA 3H91A 4BWGB 5HY6A 1RTOA 3SK6A 2F0TA 4CJ0B 5T1GA 2JA7H 2EZVA 5FO8B 1D5XC 4RA8A 1SLJA 3MEHA 2NZOA 3D6CA 1XJVA 2DNCA 4DXGA 4NKLA 2E2IB 1G2TA 1WTWA 4MTKA 2B2YC 2B63G 3CC2A 1IYVA 5E3FA 4HIKA 5IYBG 2G9HD 3HOWB 1NY4A 1BNZA 1KNEA 2LS01 4IURA 5IGDA 3J80E 5C3EH 3J80c 4HJ9A 1GJXA 4OWTB 2NVTB 2ZT9C 3V96A 3QOJA 4C3HG 1HNWL 1KQSA 3RLNA 3UDIA 1UE5A 4GKKQ 5C44B 3NBIA 2JA5G 2PNHA 2B63B 1G2SA 3D4WA 1EZ6A 1E3PA 2SDFA 3G6JB 1SFOB 4B3TL 3I91A 1D1KA 5EBDA 2HQEA 5C4HA 2AQ1B 1GM5A 3IKJA 1KD1C 3BZDB 3I7FA 4DV2Q 2Y0SB 1JJCB 2PO4A 1QOHA 3NXWA 4HJAA 1S40A 3SK8A 4KI0A 1SMYD 3MEFA 1OXTA 1U0LA 4IPHA 1EL0A 3KF6B 2KCMA 5FLMG 1SJHD 4B3RL 5LMNQ 3MFYA 3F2UA 2RSNA 4PNYA 1GUNA 4DR3Q 3CF5A 2PCFB 2JSOA 2VNUD 4N9TA 4GN5A 3KDFA 3NE5B 1HTPA 3WDNA 1UNSA 1EFID 4C56C 1X6OA 4XTCS 4HMIA 2EVBA 1L0YB 3MFGA 2B2YA 4G7ZC 1FNWA 3S1RB 1U9RA 4F8MA 4HTHA 4BBRB 1ZYRC 4HIDA 5ELCA 1O80A 1EIGA 4BBSB 2LFNA 3DUZA 4DV2L 5IYDG 1STYA 3GTKH 4HN7A 4RMFA 3UI2A 1SNPA 4L8JA 1AEXA 3SK5A 1HZ9A 3K5OA 2B2TC 5C4JH 2VW9A 2A69D 4N8FA 1XXGA 4X64L 3G7LA 2R7ZB 1PFSA 2J4XA 1QILA 3TP8A 3TS0A 1XNQQ 4K5XA 1DD2A 5FJ8H 1WCMG 5BR8L 1LTID 3NBHB 2F0NA 1E2ZA 2F0MA 2F3WA 3CRLC 5ELOA 4A3MH 2Y0SE 2I0QA 3TP5A 1SMXA 3DXJC 3PUZA 3BZCA 5EAYA 4HCSA 4BS9A 3E0EA 4QB4A 4ULLA 1ESRA 1UWVA 1WCMB 3STBC 1UE6A 1AW7A 4FXKC 5JEAG 2EJFC 1EWCA 3FHWA 2UUCQ 2KCNA 5LL6X 3J80L 1B7YB 2JYOA 2ZTCA 1HQMC 1HCZA 2DGYA 1RDPD 4XXEA 3PUXA 2SEBD 1CI3M 1SE8A 1CHQD 1R4PB 1YZ6A 5C3XA 4KY6A 4HEDA 5IY0A 4DUZL 4LFBL 3GTLB 3ND9A 1XNQL 1SEBD 1JORA 1STEA 5IGEA 1K73C 3TQYA 3PO3H 4I65A 3J81j 3IAYA 1UE7A 1BO0A 2JA8B 4JBKA 2B2TA 4GN3B 1CHPD 3HOXG 2HHHQ 4A3JG 4NB3A 3EROA 2VB3X 1ZKOA 5EKIA 2UU9Q 1HUNA 1ESFA 2F4VL 1Z6HA 2H4OA 4BY1G 1LUZA 4PZ8A 5I9PA 3N52A 1YITA 3QWNA 4XT3B 4YCVA 4GKJQ 1J5EQ 4A3CG 1T5EA 2LSSA 2R92B 4QQBX 2EYFA 3I2ZA 2K32A 2QEJC 4K6DA 4GNXC 1I3QB 3F2CA 3MHBA 2K5NA 4IPDA 3SK4A 3D8GA 4LFCQ 4EQNA 1JOQA 4JYAQ 1YBYA 4JBWA 1I6HB 1X55A 3J81L 2FINB 3M4YA 5DEHA 1NTGA 2SOBA 5ELFA 1LO5D 1D8LA 3L0OA 2NYZD 1CFMA 1PTOD 1D6EC 4B9WA 3GTOB 4DV3L 1HPCA 1F77A 4HAEA 3PO2G 5IYCH 1F9QA 2UU9L 5DAUA 2ZJRA 2UXCL 1FNVA 4LF5L 5C4XG 1WYDA 1ILPA 4JBJA 4IQZA 1B9MA 2NVQB 4NMZA 4RGNA 4GKJL 1J5EL 3T56B 1HXYD 1WTHA 4DR1L 2HCIA 3GV6A 5E4WC 3PO2B 1EU4A 1Y1WG 1CQFA 2KHJA 4G7HC 3R2TA 4LAAA 1PV4A 4GN4B 4RHRA 2EOTA 4LUOA 4R4OA 2BE5D 4JYAL 3I4MH 2NUCA 5LHY1 3IL8A 3FKIH 1WOCA 3BS1A 2WV6D 4IFDJ 3ICEA 1V1PB 4HIOA 1PDQA 1CK1A 4GNXA 2CH4A 1QG7A 4R4TA 2UUAQ 1P16A 1Q90A 2X6LA 3H0GB 5CORA 4CJ2C 1C9OA 4BA2I 1YNJD 3TS2A 1A62A 1IW7C 2CW0C 3I4NB 4APVA 1HR0L 1EY0A 2K75A 1L0XB 2F0DA 4KKTA 2HQLA 3S15H 2ATWA 5IGFA 4Q5VA 3CCLA 4LMQD 4UHVA 2WAQB 1U5KA 4DV6Q 3IFDA 4DNTB 3ER0A 3SHLA 5G3LD 4O42A 2YU9B 2RSOA 3KJOA 5J1ZA 4PG3A 3GQBA 1I50B 4A3DH 1SYEA 1MJEA 4R1JA 1ZEQX 5CMDA 3NELA 4Y7NH 3M7GA 1KAAA 1V1OA 5IWAQ 4A93G 2KHSA 2NTSA 1FYCA 2K5DA 2UUAL 3U58A 1WD0A 1TWAH 1CSQA 3GTGB 1XNRQ 1TS3A 3CC4A 2XWJB 4IFDI 4NXMQ 1JOKA 2K50A 1SE4A 3MXPA 2LXJA 4A93B 3HKSA 1K83B 1TWFB 2A8VA 1B9NA 3A0JA 4L63B 3TMEA 1DOMA 1CQVA 2PQEA 4MIUA 2VUMH 1LACA 1YIJA 4DV6L 4LF6L 3VYUA 2BOSA 1XTCD 1U4MA 4U673 2PZWA 5E4XA 1L1OB 3UDFA 1G291 4H0LC 3UDXA 3FRPB 2WKCA 4DV4Q 5IWAL 2O4XA 3K7AH 1JMCA 2WAQE 3VR2A 2DY7A 2JA7G 2KUMA 4C2MH 1XNRL 3FPPA 1CKMA 3K81C 4JI2L 4NXML 3BVZA 3RMHA 4RGOS 1F2YA 2HCCA 1E0BA 1LV9A 1EY7A 2CQOA 3VA7A 2RHSB 3TBIB 3PIO3 1S72A 4DK1A 1CA5A 2YTYA 3CCRA 1AZPA 1C7YA 5HGQA 2VQEQ 2O5IC 5C3EG 1PRTB 1PTOF 2BH8A 3Q8DA 3A55A 2PI2E 1HH2P 1SROA 2F0HA 4QUCA 4X66Q 1KL9A 4M1UB 5M3FH 2IPKD 1TWCH 5D65A 3K7UC 3NQIA 2WIIB 3FPUB 1NE3A 5FOBB 1X9NA 4I7ZC 1AE3A 3O13A 4LNQA 1HJPA 1BBUA 1DGSA 4JC0A 4JI6Q 1JCKB 1YHQA 1KDCA 2UXDQ 1EWIA 1KXLA 3E6ZX 2KHIA 4A3BH 3PCOB 1AE2A 4JOIA 4JI3L 1RKNA 3KLSX 1FVIA 1GHJA 1IBML 4A3CH 4EQPA 4UPAA 1SYBA 4ZUIA 3KLRA 4JI0L 5M5WH 5EKLA 3U4VA 4X65Q 4XIGS 1CZWA 5CV9A 2F0FA 2O5JC 3T13A 2F0IA 2VQEL 4ZLTF 4FO2A 1U4PA 1KABA 1JWUD 1B70B 4CGYB 2EXZA 1VQ5A 1MGSA 2K5WA 1S5ED 5ISRA 3W3AA 2D9UA 3PUYA 3NQTA 1XX8A 2G5DA 3EIVA 1BCPB 2I5HA 5CV8A 1QUQA 4JI6L 2DN8A 1H9SA 2PZUA 2F0WA 3VR6A 4KKSA 1Y8NB 2F0KA 4JCVE 5C4XH 3J81i 2UXDL 3AU7A 4L5SA 1CSPA 5G3LF 4G57A 4S3SA 1ICWA 1I4RA 1CKOA 3GTQH 3T16A 3GTKB 1VQIA 1IYUA 4LK1C 5FJ8G 3LNNA 1IBKQ 4X65L 2PQAA 1B3QA 2OCEA 2PYKA 3D0FA 4JI5Q 2E2JH 1C4QA 2N8NA 4LFAQ 1A3UA 3HG9A 5I2XA 3M85A 3ERQA 4BY7H 2AQ2B 4A3KB 2ZJQA 3OW7A 1Y69U 1MIUA 3BG3A 5HGTA 4A3MB 1KDBA 1I5FA 1X3GA 2B2WC 1VQPA 1FGBD 2ICIA 1V43A 3DM1A 4A3LG 1B50A 4K5WA 1YNNC 4KJNA 4IUNA 4K14A 1VCIA 2RDFA 2IX1A 4YHHL 1LTGD 1K8MA 1NCVA 3FP9A 4R8NA 1JJ2A 3NSWA 2F1MA 3KYHC 5JAVA 1SYCA 4OX9Q 5A35A 4IFDH 4QY7A 3JAME 5EPJA 3JAMc 1HZBA 1KLUD 4QIWB 3EN2A 2ZM6L 1MSHA 1VS0A 2Q2HA 5IOCA 1EYGA 1A3TA 2YTVA 2M00A 3PO3G 1S5FD 1W6JA 3E5SA 3PF5A 1EWHA 3HKZG 1QJOA 3P7JA 4RKBA 3NTKA 4A4IA 1PH2A 1VQNA 1E1TA 3CCJA 5CC4A 1UAPA 2XRQD 1HUMA 1QNKA 1DJRD 4DNIA 1B4OA 1YHAA 3D3RA 3EQLC 1X32A 5D3IB 2KJXA 4C3JH 2EXDA 2R93H 2M2LA 3CQZH 1PH5A 3M7NA 1VQ4A 1YNXA 5IGBA 4IPGA 1Q7YC 3MVVA 3KDFB 2R3ZA 2FJ2A 3PV0A 5LL6S 1XPOA 2RBMA 2KENA 2NVYH 3KBGA 1Y8OB 1B3AA 2KCCA 2QW7A 2PMZB 3KLWA 4OX9L 3KFUA 1JC7A 4DXFA 2B2WA 1LM0A 4A3FH 5C6AA 5FLXE 5FLXc 4OELB 3RZOH 3S17H 1LT3D 3HOYH 1GUSA 2IWHA 2AMCB 1K9MC 1QB5D 1TS4A 1QWYA 2Q2UA 4AIMA 3F2DA 4LF8L 1HNWQ 3T53B 4U68A 3RZDH 4IOAA 1WTQA 3EA6A 5IYCG 1K8OA 2AUKA 2XSCA 1ET6A 4YWKA 2QA4A 4QIWE 4B3TQ 4DV5Q 2CKZB 2E8GA 3F2BA 1I94L 3HZXA 4YWMA 1JE5A 1S3OA 1VQMA 1Y14B 3DEOA 5E1FA 2RCNA 2A1AA 3ULPA 2OF1A 5K5PA 3A54A 4C3IH 1N34Q 2CHBD 4DPGA 4TSSA 1B53A 4RWSC 3I4MG 2JA9A 1SSOA 3FKIG 1PRTD 4JI1L 1W2BA 2NWGA 4B3RQ 1P8LA 1LT6D 4OGQC 4YCUA 3Q24A 3T1YQ 3TEHB 3HOZH 1EY8A 3J7ZC 3K5MA 3JAML 3PIOA 2PMZE 2D62A 4HSVA 4CKBA 2A73B 2NB0A 1UE1A 3S1QH 3AB9A 2E2HH 1PA6A 1VQ8A 3MXUA 3ULJA 4DV5L 2L4NA 3GTJH 4ZKBB 3BDCA 4A3EH 1RIPA 3GD7A 3R8BA 1ASZA 4QCLA 3K6OA 1BDOA 4C3HB 3K58A 4FXDA 4KN7C 1F2LA 2JA5B 4TKOB 2GVBA 1MSGA 5J22A 2EDGA 1RODA 1N34L 4X64Q 3KK7A 4L5QA 4DUYQ 4CBVA 3OWEB 3S24A 4A75A 2BCOA 1A2TA 2IT1A 4A3DG 4JV5L 3S15B 5A2QL 4QGUA 5BR8Q 3PUVA 1RJTA 2D0PA 4F7XA 3T1YL 1WTRA 4DN4M 3K57A 4IPCA 3VDYA 1N8RC 5JJLA 1BCPD 2F0SA 1A63A 1EQTA 2FMCA 1TIID 1D5ZC 1VQ7A 5FLXL 3AFPA 2K5VA 4V190 5KYIA 4P71A 1GHKA 4Y7NB 3X3MA 4R4CA 1HR0W 2BDOA 1GOZA 3L9AX 2F0OA 1C48A 1CUKA 1TWAB 2PPBC 1M8AA 2VUMG 4RGTA 2MPMA 1STGA 5K36H 4O0AA 3W5OA 4DUYL 2UUBQ 1M4VA 4FF3A 4DUZQ 1DM0B 3U50C 4LFBQ 2MGSA 3S14H 2XRSD 1VMPA 1SYGA 5ELDA 3R2IA 1IBLL 3CCQA 2JEBI 3GTMH 4ZRZA 3OIQA 1YNJC 5CV7A 1PH1A 3OYYA 2B8GA 5M5YH 1EEID 1AFPA 1SR3A 2F4VQ 3I55A 1X56A 1KAWA 3M4QA 4FP5D 1AH9A 1PYSB 4EVOA 4UY8C 2LKVA 1VMCA 3ITPA 2K28A 3K7AB 3H6MA 4A3LH 2RVLA 4GNXB 2VY3A 3I8ZA 1TWGB 4C2MB 1NJIC 4RG1A 4OWXB 2N88A 1SNMA 1B44D 1BBWA 3AQQA 3CCSA 1Q86C 2K05A 3TSSA 4QF4A 2UUBL 4H02A 5M3FG 2QKIC 2F52A 1SE2A 2EIFA 4DAVA 2B39A 5EQ0A 5T1IA 3CRKC 3ULLA 4PZ6A 2EY2A 2EJGC 3VR4A 4L5RC 2I07B 4V0BA 4DV3Q 5M3FB 1LTSD 2BDNA 4A3GH 5NUCA 2CWPA 2UXCQ 3KJPA 4LF5Q 1IL8A 5D3DA 1O7YA 1EYAA 2LY7A 4F88A 4DR5L 4RFBA 4A3BG 4JI4Q 3C1EA 3FVQA 3CHBD 1TWHH 2KCTA 4PMBA 4L6TB 3HOXB 1LTAD 4LJZC 2K1BA 4DR1Q 4A3JB 4OIKA 1NAPA 2EY6A 4DA2A 2B3GA 5JPNC 4BY1B 5BN3A 2K33A 1QVFA 2OQ0A 3E0JA 1FL0A 4K6LA 4XYQA 1VQFA 4RHSA 4B3SL 1Q1EA 1JB7A 5M5WB 4ME3A 3PUWA 3HOVH 3DM3A 1STAA 2JN4A 1BR9A 4EGVA 1G6PA 1L2FA 4IJLA 2RDHA 3SXHA 1QZHA 1K8GA 2Z0SA 1KRSA 4UP8A 1E1OA 2N55A 5I6WA 1TU2B 2VB2X 2A19A 4JI4L 1HR0Q 2CWAA 2K6AA 1E2WA 2IL8A 5DNFA 3CMAA 3C3LA 3SE0A 1EQQA 1B2TA 3UE0A 1O7IA 3DWQA 4GLAC 2WP8J 3HOUG 5C4XB 5TSSA 3TREA 1O78A 1FR3A 4J1MA 4ABNA 3CKIB 1KIXA 3I4OA 1FGUA 4RKLA 1ASYA 1BCPF 1KNAA 4O2DA 4BY7G 2RF4A 1CT1D 1GKHA 2X69A 1PZKD 2DNEA 3QIAA 1Y1WB 1VQCA 2E2IH 1S5BD 2HIXA 3HEJA 1YVCA 1ZYRD 1EIHA 1W3SA 2KEEA 2E2JB 1WFQA 4LWCA 3HOWH 4HIMA 1I4XA 1VF5C 1XPUA 2VQFQ 3S1MB 4DAYA 2OTJA 1BXTA 2NVTH 1BVSA 1MD2D 3SEBA 1D5MC 1EFWA 1K0SA 3IRBA 2MO1A 2AHOB 4IFDG 5C44H 4FF4A 3BJUA 2XWBB 2R6GA 5EKKA 1S5CD 4DAMA 2ALYB 4DV0L 1HFGA 1SFOH 2K7VA 3MZ5A 1EY5A 3S16B 3I90A 1HA5A 4KMUC 4LF6Q 2QILA 2VL6A 2G9DA 4XDXA 5GAHC 4QUFA 4IN3A 3KF8A 5ELBA 3EFXD 3HGBA 1TY2A 3I56A 4C3JG 3M4OH 2R93G 4LF4L 4A76A 1HQRD 1IYJB 4N9PA 4DAPA 2CQAA 1H9MA 2VXWA 1B1ZA 3I3CA 2VQFL 2MJ8A 1PVOA 2N78A 5M3MH 3H09A 1EY4A 4JI2Q 2R93B 2FXQA 1EU3A 2GVAA 4B3MQ 4K0KL 3ONAB 2XVSA 4CKEA 4A3FG 3S1RH 5KRUA 1VQOA 5JJKA 2E5LQ 1QUQB 1A15A 3HOYG 4AYBG 1A8VA 1H9SB 4BBSH 5AJ3Q 3HS0C 2E74C 4UDUC 2NZHA 4GOPC 5EPLA 1OXVA 3RZOB 1ICFB 5JVH3 4HR7B 4K5VA 4KK7A 2WB1G 4CHTB 3HOYB 1F9RA 2F0QA 2R7ZH 2A68C 4WORA 3G6EA 2K5QA 3CAMA 1BQQT 1XMQQ 2PQAB 3QO2A 3C2PA 2YYZA 3K0XA 4NXNQ 3HRZC 2QF7A 4KJOA 2DJFC 3BZKA 4RGMA 1CA6A 4KY5A 4C3IG 4JI3Q 1KC8C 1IBMQ 1OO9B 4X3TA 4P72A 1PZID 4WFN3 4B3ML 2YV5A 4KHPQ 1EIYB 1XYIA 2R61A 4JI0Q 1H9KA 2JA7B 5ELNA 4KHZA 3C46A 1IKLA 2E5LL 5KNCA 2IHEA 4FNFA 1CTMA 2R7DA 5KNDA 5AJ3L 3HOZG 3CPWA 2JJQA 1GO3E 2F0EA 4OONA 3J80i 4ME5A 4Y52H 4R4IA 1NR2A 2ZXOA 4ZYSA 5HURA 2C9OA 1Z9FA 3K5LA 2MO0A 1B8AA 3GTLH 1AP0A 4GS3A 5C3EB 4FXGC 4A3EG 1XMQL 1RHPA 3I70A 2BA0A 3CCMA 1U4LA 2A6HC 4AQYQ 2RQXA 4NXNL 3P20A 2ZJPA 3S1QB 4GOPA 2E2HB 1LLRD 3TZUA 4XQNA 4DK0A 4DNRB 1A2UA 1NNXA 4KHPL 4XQJA 4KHVA 1V9PA 5EGTA 5GADC 3QOLA 2A6EC 2XGTA 5I9OA 3TRZA 2EYOA 3A7AB 3I73A 3DMUA 5FK9C 4OO1G 3K80C 1TKWB 1I3QH 1LTBD 5CGKA 3I4LA 4OEMB 1EQRA 2IX3A 4DR7Q 1TS5A 3A8IE 1KTKA 4GLXA 3MXNA 1ENCA 1IW7D 1TT2A 2CW0D 1VQEA 3NENA 4IALA 2KVMA 4DR4Q 5GAEC 4AQYL 4JI8Q 4YHHQ 1E2VA 1RF2D 4DR2Q 5JOBA 5K36G 3GTOH 2X6GA 1HZAA 3K59A 4I7AA 2ZM6Q 2K03A 1Q8IA 1Y8PB 1EYCA 1XWEA 5D14A 2O2LD 1STHA 2D5DA 1VQAA 1SNQA 2IX0A 4JK1C 2JXMB 4JI7L 3QR8A 5C4JB 3HOUH 1UUPA 3BDOA 4K8JA 4OO1I 3GTPH 2B29A 2VS1A 2Z8LA 2QCPX 1JB3A 4OXPA 4ZAIA 3PMFA 3EBEA 1VF7A 3G71A 1X3QA 1X54A 3VA5A 2I5MX 3S14B 5JJZA 4DR7L 4RAUC 1I6VC 1H95A 1KRTA 4MN3A 4HCEA 5KGUA 3GTMB 2D2CC 1QCBD 1SMYC 2A74C 1DXMA 4KLKA 4DR4L 5C0XJ 2TMPA 2C35B 4JI8L 1C8CA 3H3VI 4L5TA 4LUVA 1LABA 2L55A 3CP0A 4HMJA 4DR2L 3H0GH 3T1HL 2EE1A 4PQXA 3CCEA 3IFTA 2F0PA 2EYHA 3L3OC 3I4NH 2F0LA 2D0OA 4J6HA 1OXUA 3W2DA 1MKHA 4DV7Q 3MAQA 2H5XA 4LF8Q 3K5NA 4H13C 3H3VC 3UDGA 4K8IA 4A3GG 2ID0A 3DEPA 2P5ZX 5ELEA 2M9VA 1LTRD 1QVCA 1PH8A 2YU9H 3PO3B 4P75A 1LYLA 1I94Q 3HKZB 4KV6A 4ILWA 2PNRC 2CCZA 1NBWA 1STBA 2A69C 2L12A 4JG2A 2K01A 4IUVA 1VQJA 3RD4A 1R9TH 3SDZA 1VDZA 4DFAA 3L2PA 3J7AV 1X65A 4HSPA 1TWHB 2RHQB 5IP9H 1JE4A 1DONA 3OW2A 4JI1Q 3NK9A 2Q8TA 3HOVG 1DZ1A 5C0XI 2B8FA 1SYFA 2XN9C 3K0YA 3VYRA 1MI2A 3RUZA 1SN8A 1K83H 3KUPA 3J7YW 3OMCA 1TWFH 2UXBQ 3D31A 3CXCA 4WRDA 4DV7L 3NHHA 1OTCA 2LMCB 4IUTA 5C3WA 4WJ4A 3A8JE 1SDFA 1EZ8A 5CBEE 3OHXC 1BOSA 3CD6A 2QDLA 1ZXTA 2ENBA 2HDMA 1EEFD 1K0RA 1Q81C 5DLQE 1YJ9A 4DR6Q 3NUCA 2CFMA 2RKSA 2I5LX 4NDXA 1JWMD 4CDFC 1H9RA 1Q1BA 1PH3A 1EUJA 1EY9A 4ZKCB 3CCUA 4MTNA 5KEEA 2Q8IB 1NR4A 1YI2A 2HD3A 1WVLA 4JV5Q 1WD1A 1D7QA 5KNBA 2EY5A 5GAGC 2F3VA 3HKZE 2L11A 2A5HA 3DLLA 2GN5A 1E24A 3RLOA 3OPOA 2Z6KC 3AFQA 2UXBL 2KOLA 4FVMA 4X62Q 3HOWG 2IW3A 1E7ZA 3I4MB 3FKIB 3SGIA 1NMFA 4DV1L 5EPKA 2LXKA 1RTNA 5C44G 1QE6A 4PMWA 5J39A 3H15A 1XTDA 4DR6L 2XNAC 2WACA 5CV4A 3GO5A 4DU9A 3PIP3 4POFA 1EYDA 3EJIA 4X3SA 5IODA 2Y0SG 1NSNS 2NZ1D 1KLGD 2ZTDA 3M3YH 2EYMA 3S1NH 3C1FA 4JBMA 2BA1A 2XIWA 4IUPA 5LMUL 1II3A 2GA4B 2F0GA 3WOEA 4LF9L 1PTOC 3URYA 5E7NA 1IBLQ 2BH2A 5FO7B 3H94A 1VQKA 1I4PA 3GV3A 4X6AH 1H9JA 4X62L 4OO1H 2DUDA 3T51B 1BUVT 3CPFA 1YNND 4A3DB 2MP1A 3CW2C 2MQHA 1QNUA 2HIVA 4NPSA 5M3MG 4R8IA 3E3XA 3M4OB 3P1HA 1O7ZA 1PFNA 3NP8A 2F3IA 1EY6A 2HUGA 5GQOA 1RL2A 2RDGA 1XPRA 3Q23A 2Z6KA 1SXTA 3VYSA 3PSIA 1K8AC 1ILQA 4BBRG 1CKNA 1FNUA 3V2TA 2QEXA 3AYHB 3WWVA 5M3MB 4BBSG 5C4ZA 2BE5C 3F8TA 3S9WA 3KBXA 1VQDA 1GUWA 3H3VH 1LT5D 1STNA 5I4DA 4GKKL 3DWAA 5M5XH 4POGA 1UEBA 1F2ZA 1GUGA 3OSOA 4RCOA 2WINB 4KY7A 1ET9A 2NVXH 2R7ZG 2VUMB 1F2MA 3S2DH 4HJ5A 2MFIA 1WJJA 1BF4A 3J81E 1S5DD 2Z4IA 3J81c 4R4QA 4KKUA 5C5MA 1HFNA 1VQBA 2NBFA 3LWUA 5IGGA 2OXPA 3ND8A 4CKCA 1PZJD 1PH4A 1GXDC 3TDQA 4DR5Q 1Z47A 4Z9CB 3KOJA 4YY3Q 1SNCA 3DWPA 1R4QB 2CH4W 4OHJA 1OXSC 5JEAJ 5LMNL 4A3KH 4DR3L 1J8IA 2E2DC 4UP7A 1Q12A 3A5UA 2JA6H 1K28A 1M1KC 3OMGA 4DAYB 3CMEA 2MUYA 5IP7H 2K5HA 4B3SQ 4FF1A 2EYJA 3CC7A 2OT2A 4TVAB 3Q22A 5C0XH 1CM9A 3S2HH 5EBCA 4BXXH 2PW5A 2KA7A 3G48A 2R7FA 5F2DA 3A7LA 1VQLA 3MC0B 2ES2A 4CJ1B 1J9OA 1TWCB 3KF8B 2JA8G 2B2VC 1Y1VH 4IUUA 4MHEA 4TRDA 1BBXC
chains in the Genus database with same CATH topology
4X3KA 4ID6A 4UAIA 1WTXA 1OXXK 4G4KA 1PRTF 1A6XA 3BVMA 2EPBA 4Q0FA 1PXUA 4ZK9B 1X3PA 2EYPA 4A3BB 5CR3A 4GZYC 2E75C 3TP6A 4C1NK 1DCZA 1JICA 4YIJA 4FYDA 1DYQA 1FD7D 1DOKA 2F0JA 3OIPA 3VYTA 4IZ8A 2PZTA 1PTOH 2J7ZA 1WTPA 5FO9B 4M8AA 2CVRA 1NUCA 2V4DA 3QJYA 2B2VA 2F0VA 3R3OA 4RH6A 3GTQB 2Z1CA 1I4HA 1SNOA 3HOUB 3NBHA 2JE6I 3GTPB 4B9XA 2F4IA 4J8QA 4F87A 3VR5A 4BY7B 5CYUA 5CV6A 2ICEC 3LWEA 1IHZA 2KQ3A 1SAPA 2Q8RE 1I4GA 1MBYA 2H1EA 5BN5A 3V05A 3QB3A 1W6KA 2FHTA 4K2LA 1G8ZD 3VR3A 1EOTA 1F9SA 1KDAA 4PV1C 3TZDA 3L7ZC 1D2BA 5KIXA 4ODGA 3DHQA 3QG1A 3WOFA 4BA1I 1ENFA 5BN4A 1AN8A 1G91A 5IT9E 1G6ZA 4C3JB 3CQZB 2AWNA 1PFBA 2J0TD 3EVQA 3BYYB 3Q6SA 2MHVA 5CV5A 2NVYB 2K04A 1R9TB 1Z7TA 3FMCA 1V8QA 1AZQA 1HHVA 4A3FB 3S17B 2FMMA 2NN6G 4AYBB 1DOLA 4KN4C 3RZDB 4KD3A 3SR1A 2WB1B 5JVG3 1WTVA 2ZXPA 4ZUJA 2SNMA 1RCVD 1F9PA 4C3IB 1CZGA 5DM63 1SJED 3RLFA 3OOCA 1SYDA 2ZXRA 3GP7A 3I72A 4E6IA 2NN6I 1HRJA 5JEAH 4OIJA 1A3VA 1TY0A 1UEAB 1HA6A 4FF2A 3NTIA 1V1PA 4P2CB 3HOZB 2B2UC 4DF7A 3HP3A 1HTLD 3BYTB 1PLFA 4XT1B 3X3NA 1U4RA 2L1BA 3GTJB 4A3EB 2EY1A 2L9HA 3FEWX 4B08A 3AMUA 1TS2A 3D6WA 3MA2B 4WJWA 5IT9L 3P75A 3MXGA 3M3YB 2QDBA 4PMCA 3S1NB 2L5TA 3A8KE 3NWSA 1LT4D 4QMGA 4EQOA 2JP1A 2SNSA 3CU7A 2TSSA 3BDLA 4X3UA 5M9OA 3NWTA 2Z4HA 3T4AC 1PRTC 1Q3LA 3LX0A 1RD9D 4H7BA 4C1NI 5IIFA 3BVGA 2B2UA 5I6YA 2KEDA 1JQYD 5C5LA 5AFWA 5KYLA 5M5XB 2WKDA 1O7LA 3D4DA 3A56A 2NVXB 3S2DB 1TVXA 2NTTA 3N6RA 1PYWD 1SBBB 1JR0D 1S4ZA 4G7OC 5M5YB 2IJ0A 4R9WA 1D1IA 2JEAI 5DM73 5IGCA 3J7AF 1JOOA 2L0CA 1ENAA 3Q0AA 3D4RA 2HDLA 1ONLA 5JPMC 4XQQA 2F0UA 4RCNA 2AWOA 2JA6B 5C0XG 2A68D 1BCPC 5EJWA 1WTOA 5CBAE 2RA4A 3OWFA 2I46A 3S2HB 3U9SA 3TP7A 1PFMA 4XYOA 4A3GB 4KTAA 2AQ3B 1Y1VB 3U9OA 1ML0D 3R93A 2EJMA 3NPPA 1IKMA 4NP5A 4ZQ3A 1LTTD 1SE3A 5A2QE 3MWYW 3FDTA 4A3IB 3ZYYX 4OL7A 2A6HD 2EYLA 2OEOA 3HOVB 3NTHA 4K2KA 2NN6H 1T5XD 1TQOA 1TR5A 2AUJD 2PW7A 4DGZA 4O1NA 1I4QA 4NW2A 2DY8A 2C5CA 3TN2A 2F03A 1GUOA 2FFKB 2E76C 2KECA 4IUQA 4TQUS 4H44C 2A6ED 1EQVA 1SNDA 3MTSA 3SVMA 1JWSD 1PTOB 3KLSA 4KD4A 5FKAC 1GUTA 5COYA 5I2YA 1PMRA 3H91A 4BWGB 1RTOA 3SK6A 2F0TA 4CJ0B 5T1GA 2EZVA 5FO8B 1D5XC 4RA8A 3MEHA 3D6CA 2DNCA 4DXGA 4NKLA 2E2IB 1G2TA 1WTWA 2B2YC 1IYVA 5E3FA 2G9HD 3HOWB 1BNZA 1KNEA 2LS01 4IURA 5IGDA 3J80E 1GJXA 2NVTB 2ZT9C 3V96A 3QOJA 4C3HG 5C44B 3NBIA 2B63B 1G2SA 3D4WA 1EZ6A 2SDFA 3G6JB 1SFOB 3I91A 1D1KA 5EBDA 2HQEA 5C4HA 2AQ1B 3IKJA 3BZDB 2Y0SB 2PO4A 1QOHA 3NXWA 3SK8A 4KI0A 1SMYD 1OXTA 1EL0A 1SJHD 3MFYA 3F2UA 2RSNA 4PNYA 1GUNA 2PCFB 2JSOA 2VNUD 4N9TA 3NE5B 1HTPA 3WDNA 1UNSA 1EFID 4C56C 4XTCS 4HMIA 2EVBA 1L0YB 3MFGA 2B2YA 4G7ZC 1FNWA 3S1RB 1U9RA 4F8MA 4HTHA 4BBRB 1ZYRC 5ELCA 1O80A 1EIGA 4BBSB 2LFNA 3DUZA 1STYA 4HN7A 3UI2A 1SNPA 4L8JA 1AEXA 3SK5A 3K5OA 2B2TC 2A69D 1XXGA 3G7LA 2R7ZB 2J4XA 1QILA 3TP8A 4K5XA 1DD2A 1LTID 2F0NA 1E2ZA 2F0MA 2F3WA 3CRLC 3TP5A 3DXJC 3PUZA 4HCSA 4BS9A 4QB4A 4ULLA 1ESRA 1WCMB 1AW7A 4FXKC 5JEAG 2EJFC 1EWCA 2KCNA 5LL6X 3J80L 2JYOA 1HQMC 1HCZA 4XXEA 1RDPD 3PUXA 2SEBD 1CI3M 1CHQD 1R4PB 5C3XA 4KY6A 4HEDA 3GTLB 3ND9A 1SEBD 1JORA 1STEA 5IGEA 4I65A 3IAYA 1BO0A 2JA8B 2B2TA 1CHPD 3EROA 2VB3X 1ZKOA 5EKIA 1HUNA 1ESFA 1Z6HA 2H4OA 5I9PA 3N52A 3QWNA 4XT3B 1T5EA 2R92B 2EYFA 2K32A 2QEJC 4K6DA 1I3QB 3MHBA 3SK4A 3D8GA 4EQNA 1JOQA 4JBWA 1I6HB 3J81L 2FINB 3M4YA 5DEHA 2SOBA 5ELFA 1LO5D 2NYZD 1CFMA 1PTOD 1D6EC 4B9WA 3GTOB 1HPCA 1F77A 4HAEA 1F9QA 5DAUA 1FNVA 1ILPA 4IQZA 1B9MA 2NVQB 4NMZA 4RGNA 3T56B 1HXYD 2HCIA 3GV6A 5E4WC 3PO2B 1EU4A 1CQFA 4G7HC 3R2TA 4LAAA 4RHRA 2EOTA 2BE5D 2NUCA 5LHY1 3IL8A 3BS1A 2WV6D 4IFDJ 1V1PB 1PDQA 1CK1A 1QG7A 1Q90A 2X6LA 3H0GB 5CORA 4CJ2C 4BA2I 1YNJD 1IW7C 2CW0C 3I4NB 1EY0A 1L0XB 2F0DA 4KKTA 5IGFA 4Q5VA 4LMQD 2WAQB 3IFDA 4DNTB 3SHLA 5G3LD 4O42A 2YU9B 2RSOA 5J1ZA 3GQBA 1I50B 1SYEA 1ZEQX 5CMDA 3M7GA 1KAAA 1V1OA 2KHSA 2NTSA 1FYCA 2K5DA 1WD0A 3GTGB 1TS3A 4IFDI 2XWJB 1JOKA 1SE4A 3MXPA 4A93B 1K83B 1TWFB 1B9NA 4L63B 3TMEA 1DOMA 1CQVA 2PQEA 4MIUA 1LACA 3VYUA 2BOSA 1XTCD 1U4MA 4U673 2PZWA 5E4XA 1G291 4H0LC 3FRPB 2WKCA 2O4XA 3VR2A 2DY7A 2KUMA 3FPPA 3BVZA 3RMHA 4RGOS 1F2YA 2HCCA 1E0BA 1LV9A 1EY7A 3VA7A 3TBIB 3PIO3 4DK1A 1CA5A 1AZPA 2O5IC 1PRTB 1PTOF 3A55A 2F0HA 4QUCA 4M1UB 2IPKD 5D65A 3NQIA 2WIIB 3FPUB 5FOBB 4I7ZC 3O13A 1JCKB 1KDCA 3E6ZX 1RKNA 3KLSX 1GHJA 4EQPA 1SYBA 4ZUIA 3KLRA 5EKLA 4XIGS 1CZWA 5CV9A 2F0FA 2O5JC 3T13A 2F0IA 4ZLTF 4FO2A 1U4PA 1KABA 1JWUD 4CGYB 2EXZA 1MGSA 2K5WA 1S5ED 5ISRA 3W3AA 2D9UA 3PUYA 3NQTA 1XX8A 1BCPB 5CV8A 2DN8A 1H9SA 2PZUA 2F0WA 3VR6A 4KKSA 1Y8NB 2F0KA 3AU7A 5G3LF 4G57A 4S3SA 1ICWA 1I4RA 3T16A 3GTKB 1IYUA 4LK1C 3LNNA 2PYKA 1C4QA 1A3UA 3HG9A 5I2XA 3M85A 3ERQA 2AQ2B 4A3KB 3OW7A 1Y69U 4A3MB 3BG3A 5HGTA 1KDBA 2B2WC 1FGBD 2ICIA 1V43A 3DM1A 1B50A 4K5WA 1YNNC 4KJNA 4IUNA 4K14A 1VCIA 2RDFA 2IX1A 1LTGD 1K8MA 1NCVA 4R8NA 3NSWA 2F1MA 5JAVA 1SYCA 5A35A 4IFDH 3JAME 5EPJA 1KLUD 4QIWB 1MSHA 5IOCA 1A3TA 2M00A 1S5FD 1W6JA 3E5SA 1EWHA 1QJOA 3P7JA 4RKBA 3NTKA 5CC4A 1UAPA 2XRQD 1HUMA 1QNKA 1DJRD 1B4OA 3D3RA 3EQLC 1X32A 5D3IB 2KJXA 2M2LA 3M7NA 5IGBA 3MVVA 2R3ZA 2FJ2A 3PV0A 5LL6S 2RBMA 3KBGA 1Y8OB 1B3AA 2KCCA 2PMZB 1JC7A 4DXFA 2B2WA 5C6AA 5FLXE 1LT3D 1GUSA 2IWHA 1QB5D 1TS4A 1QWYA 3T53B 4U68A 1WTQA 3EA6A 1K8OA 2AUKA 2XSCA 1ET6A 3HZXA 3DEOA 5E1FA 2OF1A 5K5PA 3A54A 2CHBD 4TSSA 1B53A 4RWSC 1SSOA 1PRTD 2NWGA 1LT6D 4OGQC 3Q24A 1EY8A 3K5MA 3JAML 2D62A 4HSVA 4CKBA 2A73B 2NB0A 3AB9A 3MXUA 2L4NA 4ZKBB 3BDCA 4QCLA 3GD7A 3R8BA 3K6OA 1BDOA 4C3HB 3K58A 4FXDA 4KN7C 1F2LA 2JA5B 4TKOB 1MSGA 5J22A 2EDGA 1RODA 3KK7A 4CBVA 3OWEB 2BCOA 1A2TA 2IT1A 3S15B 5A2QL 3PUVA 1RJTA 4F7XA 1WTRA 4DN4M 3K57A 1BCPD 2F0SA 1EQTA 2FMCA 1TIID 1D5ZC 4V190 5FLXL 1GHKA 5KYIA 4Y7NB 3X3MA 2BDOA 1GOZA 3L9AX 2F0OA 1C48A 1TWAB 2PPBC 1M8AA 4RGTA 2MPMA 1STGA 5K36H 1M4VA 4FF3A 1DM0B 2MGSA 2XRSD 1VMPA 1SYGA 5ELDA 3R2IA 2JEBI 4ZRZA 3OIQA 1YNJC 5CV7A 2B8GA 1EEID 1AFPA 4FP5D 4EVOA 2LKVA 1VMCA 3ITPA 2K28A 3K7AB 3H6MA 2RVLA 3I8ZA 1TWGB 4C2MB 2N88A 1SNMA 1B44D 2K05A 3TSSA 4QF4A 2QKIC 1SE2A 4DAVA 2B39A 5EQ0A 5T1IA 3CRKC 2EY2A 2EJGC 3VR4A 2I07B 4V0BA 5M3FB 1LTSD 2BDNA 5NUCA 1IL8A 5D3DA 1O7YA 1EYAA 2LY7A 4F88A 4RFBA 3C1EA 3FVQA 3CHBD 4PMBA 4L6TB 3HOXB 1LTAD 4LJZC 2K1BA 4A3JB 4OIKA 1NAPA 2EY6A 4DA2A 5JPNC 4BY1B 5BN3A 2K33A 3E0JA 4K6LA 4XYQA 4RHSA 1Q1EA 5M5WB 3PUWA 1STAA 1BR9A 4EGVA 2RDHA 3SXHA 2N55A 5I6WA 1TU2B 2VB2X 2K6AA 1E2WA 2IL8A 5DNFA 3C3LA 3SE0A 1B2TA 3DWQA 2WP8J 5C4XB 5TSSA 1O78A 1FR3A 4J1MA 4ABNA 3CKIB 4RKLA 1BCPF 1KNAA 1CT1D 2X69A 1PZKD 2DNEA 3QIAA 1Y1WB 1S5BD 3HEJA 1ZYRD 1EIHA 2KEEA 2E2JB 1I4XA 1VF5C 3S1MB 4DAYA 1BXTA 1MD2D 3SEBA 1D5MC 4IFDG 4FF4A 2XWBB 2R6GA 5EKKA 1S5CD 1HFGA 2K7VA 3MZ5A 1EY5A 3S16B 3I90A 1HA5A 4KMUC 2QILA 2G9DA 4XDXA 4QUFA 4IN3A 3KF8A 5ELBA 3EFXD 3HGBA 1TY2A 4C3JG 1HQRD 4N9PA 4DAPA 2CQAA 1H9MA 2VXWA 1B1ZA 3I3CA 2MJ8A 3H09A 1EY4A 2R93B 1EU3A 3ONAB 2XVSA 4CKEA 5KRUA 1A15A 1H9SB 3HS0C 2E74C 4UDUC 5EPLA 1OXVA 3RZOB 5JVH3 4HR7B 4K5VA 4KK7A 4CHTB 3HOYB 1F9RA 2F0QA 2A68C 4WORA 2K5QA 1BQQT 3QO2A 3C2PA 2YYZA 3HRZC 2QF7A 4KJOA 4RGMA 1CA6A 4KY5A 4C3IG 1OO9B 4X3TA 1PZID 4WFN3 1XYIA 2R61A 1H9KA 2JA7B 4KHZA 3C46A 1IKLA 5KNCA 4FNFA 1CTMA 5KNDA 2F0EA 4ME5A 1NR2A 2ZXOA 4ZYSA 5HURA 2C9OA 3K5LA 1AP0A 5C3EB 4FXGC 1RHPA 3I70A 2BA0A 1U4LA 2A6HC 2RQXA 3P20A 3S1QB 2E2HB 1LLRD 3TZUA 4XQNA 4DK0A 4DNRB 1A2UA 4XQJA 4KHVA 5EGTA 3QOLA 2A6EC 5I9OA 2EYOA 3A7AB 3I73A 3DMUA 5FK9C 4OO1G 1TKWB 1LTBD 5CGKA 3I4LA 2IX3A 1TS5A 3A8IE 1KTKA 3MXNA 1ENCA 1IW7D 1TT2A 2CW0D 4IALA 2KVMA 1E2VA 1RF2D 5K36G 5JOBA 2X6GA 3K59A 1Q8IA 2K03A 1Y8PB 1EYCA 1XWEA 5D14A 2O2LD 1STHA 2D5DA 4JK1C 1SNQA 2IX0A 2JXMB 5C4JB 1UUPA 3BDOA 4K8JA 4OO1I 2Z8LA 2QCPX 1JB3A 4ZAIA 3PMFA 1VF7A 1X3QA 3VA5A 3S14B 5JJZA 4RAUC 1I6VC 4MN3A 4HCEA 5KGUA 3GTMB 2D2CC 1QCBD 1SMYC 2A74C 1DXMA 5C0XJ 2TMPA 1C8CA 1LABA 2L55A 4HMJA 2EE1A 4PQXA 3IFTA 2F0PA 2EYHA 3L3OC 2F0LA 4J6HA 1OXUA 3W2DA 3MAQA 3K5NA 4H13C 3H3VC 4K8IA 2ID0A 3DEPA 5ELEA 2M9VA 1LTRD 3PO3B 3HKZB 4KV6A 4ILWA 2PNRC 1STBA 2A69C 2L12A 2K01A 4IUVA 3RD4A 3SDZA 1VDZA 4DFAA 3J7AV 4HSPA 1TWHB 1JE4A 1DONA 3NK9A 2Q8TA 1DZ1A 5C0XI 2B8FA 1SYFA 2XN9C 3K0YA 3VYRA 1MI2A 3RUZA 3J7YW 3KUPA 3OMCA 3D31A 4WRDA 3NHHA 2LMCB 4IUTA 5C3WA 3A8JE 1SDFA 1EZ8A 5CBEE 3OHXC 1BOSA 1ZXTA 2ENBA 2HDMA 1EEFD 3NUCA 2RKSA 4NDXA 1JWMD 1H9RA 1Q1BA 1EY9A 4ZKCB 5KEEA 2Q8IB 1NR4A 1WVLA 1WD1A 5KNBA 2EY5A 2F3VA 2L11A 2A5HA 3OPOA 2KOLA 4FVMA 2IW3A 3I4MB 3FKIB 5EPKA 1RTNA 1QE6A 4PMWA 5J39A 2XNAC 2WACA 4DU9A 3GO5A 5CV4A 3PIP3 1EYDA 3EJIA 4X3SA 5IODA 1NSNS 2NZ1D 1KLGD 2EYMA 3C1FA 2BA1A 2XIWA 4IUPA 1II3A 2GA4B 2F0GA 3WOEA 1PTOC 3URYA 5FO7B 3H94A 1I4PA 3GV3A 1H9JA 4OO1H 3T51B 1BUVT 1YNND 4A3DB 2MP1A 1QNUA 4R8IA 3M4OB 3P1HA 1O7ZA 1PFNA 3NP8A 1EY6A 2HUGA 2RDGA 3Q23A 1SXTA 3VYSA 1ILQA 1FNUA 3V2TA 5M3MB 5C4ZA 2BE5C 3S9WA 3KBXA 1GUWA 1LT5D 1STNA 5I4DA 3DWAA 1F2ZA 1GUGA 3OSOA 4RCOA 2WINB 4KY7A 1ET9A 2VUMB 1F2MA 1BF4A 3J81E 1S5DD 2Z4IA 4KKUA 5C5MA 1HFNA 2NBFA 3LWUA 5IGGA 2OXPA 3ND8A 4CKCA 1PZJD 1GXDC 3TDQA 1Z47A 4Z9CB 1SNCA 3DWPA 1R4QB 4OHJA 1OXSC 5JEAJ 1J8IA 2E2DC 1Q12A 3OMGA 2MUYA 4FF1A 2EYJA 2OT2A 3Q22A 5C0XH 1CM9A 5EBCA 2PW5A 2KA7A 5F2DA 3A7LA 3MC0B 4CJ1B 1J9OA 1TWCB 2B2VC 4IUUA 4MHEA 4TRDA 1BBXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U68 A;  1M8A A;  3HP3 A;  1ICW A;  2K01 A;  4X3K A;  3ONA B;  4IUV A;  1WTW A;  1WTQ A;  1ESR A;  2B2Y C;  2MPM A;  4UAI A;  3TZD A;  1WTX A;  1PLF A;  3GV3 A;  4XT1 B;  2EPB A;  2DY7 A;  2EOT A;  5EJW A;  1U4R A;  1WTO A;  1A15 A;  5CBA E;  2KUM A;  1BNZ A;  1KNE A;  2RA4 A;  2L1B A;  3IL8 A;  4IUR A;  4ZK9 B;  1X3P A;  2MP1 A;  2N55 A;  1JE4 A;  1DON A;  2JYO A;  2MGS A;  4R8I A;  2L9H A;  2KVM A;  2Q8T A;  1DZ1 A;  1VMP A;  1PDQ A;  1O7Z A;  1PFN A;  1E0B A;  1G2S A;  1LV9 A;  2HCC A;  1G91 A;  3DEO A;  2IL8 A;  2HUG A;  2SDF A;  3D6W A;  5DNF A;  1MI2 A;  1QG7 A;  5EPL A;  3KUP A;  1B2T A;  1G6Z A;  2X6L A;  1JIC A;  1PFM A;  3I91 A;  1CA5 A;  1F9R A;  2B2W C;  5COR A;  2X6G A;  1ILQ A;  1B53 A;  1AZP A;  4HED A;  4IUT A;  4CJ2 C;  4RWS C;  3DM1 A;  1PFB A;  1SSO A;  2K03 A;  3QO2 A;  1ML0 D;  2NWG A;  3R93 A;  1B50 A;  1SDF A;  3KBX A;  1GUW A;  5D14 A;  5CBE E;  3Q6S A;  4QUC A;  1IKM A;  1BO0 A;  1VMC A;  1DOK A;  2K04 A;  1KNA A;  1NCV A;  1ZXT A;  2K28 A;  2B2T A;  5D65 A;  2HDM A;  1CA6 A;  3FPU B;  2RVL A;  2JP1 A;  2X69 A;  3I8Z A;  4LMQ D;  5EPJ A;  5EKI A;  4ZAI A;  4X3T A;  1EL0 A;  4X3U A;  1HUN A;  1AZQ A;  2N88 A;  4HSV A;  1HHV A;  1X3Q A;  1BF4 A;  3MWY W;  1MSH A;  3FDT A;  3IFD A;  1XYI A;  1EIH A;  3F2U A;  2KEE A;  2RSN A;  3N52 A;  5JJZ A;  4ZKC B;  4O42 A;  4XT3 B;  4RAU C;  2K05 A;  1HFN A;  2J7Z A;  2RSO A;  1IKL A;  1Q3L A;  2FMM A;  1WTP A;  4MN3 A;  2L4N A;  1NR4 A;  4ZKB B;  2CVR A;  1WVL A;  1WD1 A;  1DOL A;  2B2V A;  3P7J A;  5CMD A;  1F2L A;  2L11 A;  5EQ0 A;  2B2U A;  1HUM A;  5T1I A;  1QNK A;  1MSG A;  1C8C A;  2KED A;  1B4O A;  2B2Y A;  1ROD A;  1X32 A;  1G2T A;  1HFG A;  1J8I A;  1WD0 A;  5AFW A;  1NR2 A;  2DY8 A;  2KOL A;  4NW2 A;  3TN2 A;  2M2L A;  1WTV A;  2FFK B;  2EE1 A;  3I90 A;  2BDN A;  1O80 A;  1EIG A;  1AP0 A;  1IL8 A;  2KEC A;  1O7Y A;  4ZLT F;  2R3Z A;  4IUQ A;  1RHP A;  2FJ2 A;  3UI2 A;  1U4P A;  4XDX A;  1U4L A;  5EPK A;  2FIN B;  1RJT A;  4QUF A;  1F9P A;  1RTN A;  1QE6 A;  1TVX A;  2B2T C;  3MTS A;  1MGS A;  3SVM A;  2NYZ D;  1B3A A;  1WTR A;  4DN4 M;  2D9U A;  2K1B A;  4OIK A;  1DOM A;  1XX8 A;  1NAP A;  3G7L A;  3LWE A;  1S4Z A;  4HAE A;  2B2W A;  5COY A;  1F9Q A;  1EQT A;  4R9W A;  3H91 A;  1SAP A;  1CM9 A;  2Q8R E;  3DEP A;  1RTO A;  4X3S A;  4CJ0 B;  1ILP A;  2H1E A;  5T1G A;  1HRJ A;  2VXW A;  2NZ1 D;  4OIJ A;  1HA6 A;  4CJ1 B;  1U4M A;  1J9O A;  2FHT A;  3I3C A;  2MJ8 A;  2HDL A;  2B2V C;  4RA8 A;  5E4X A;  2XIW A;  4IUP A;  2HCI A;  1EOT A;  3GV6 A;  4IUU A;  1F9S A;  4HCS A;  4MHE A;  5E4W C;  1BBX C;  2B2U C;  2L12 A; 
#chains in the Genus database with same CATH topology
 4X3K A;  4LW1 A;  4YY3 L;  4ID6 A;  4UAI A;  1WTX A;  4CDE C;  1OXX K;  4G4K A;  1PRT F;  1A6X A;  3BVM A;  2EPB A;  4Q0F A;  1T9H A;  4P74 A;  1PXU A;  1N9W A;  4ZK9 B;  1X3P A;  2EYP A;  4A3B B;  5CR3 A;  4GZY C;  2E75 C;  2R92 G;  3PQI A;  3TP6 A;  3E9H A;  4A3I H;  1VQ9 A;  4C1N K;  1DCZ A;  1JIC A;  3CCV A;  3KF6 A;  4YIJ A;  1A0I A;  3RN2 A;  2MNA A;  2UUC L;  4FYD A;  1DYQ A;  4DK3 C;  3NEM A;  5JJI A;  1FD7 D;  1DOK A;  2K14 A;  2F0J A;  4J15 A;  3OIP A;  3VYT A;  3JC6 6;  4IZ8 A;  2PZT A;  4LUZ A;  1PTO H;  4DV0 Q;  4OWW B;  2J7Z A;  1WTP A;  5FO9 B;  4M8A A;  2V1C C;  2CVR A;  1NUC A;  2JQO A;  1Q46 A;  2V4D A;  3QJY A;  2B2V A;  1IXR A;  2HHH L;  4CDD C;  2F0V A;  3R3O A;  1MJC A;  4PZ7 A;  4P73 A;  4RH6 A;  3BU2 A;  3GTQ B;  4EQ5 A;  2Z1C A;  3PF4 A;  1I4H A;  2IY5 B;  1K3B C;  2N3S A;  1SNO A;  3HOU B;  4LF4 Q;  3NBH A;  2JE6 I;  4MZ9 A;  3GTP B;  1N32 Q;  1YEZ A;  4B9X A;  2F4I A;  1M90 C;  4MNO A;  4J8Q A;  4F87 A;  2WFW A;  1N36 Q;  4UP9 A;  3VR5 A;  4BY7 B;  4LFC L;  1X3E A;  5CYU A;  1EOV A;  5CV6 A;  2ICE C;  3H0G G;  1IHZ A;  3LWE A;  4DKA C;  1HZC A;  4K0K Q;  2B63 H;  2KQ3 A;  1SAP A;  2Q8R E;  5IYB H;  1I4G A;  1MBY A;  2H1E A;  4QJF A;  5BN5 A;  3I4N G;  3V05 A;  3JAM i;  1GVP A;  3QB3 A;  1W6K A;  2FHT A;  1NMG A;  4K2L A;  1G8Z D;  3VR3 A;  1VQ6 A;  3U4Z A;  4C3H H;  1EOT A;  1YJW A;  1F9S A;  3K8A A;  1KDA A;  4GOP B;  2JA5 H;  4PV1 C;  2WAQ G;  3TZD A;  3L7Z C;  3PIP A;  1D2B A;  1HNX Q;  3PGZ A;  5KIX A;  4ODG A;  3DHQ A;  3STB D;  1QZG A;  1E22 A;  3QG1 A;  1N32 L;  2L15 A;  3WOF A;  4BA1 I;  1ENF A;  3B6Y A;  4YCW A;  5BN4 A;  1AN8 A;  1V1Q A;  1G91 A;  5IT9 E;  1N36 L;  5IT9 c;  1G6Z A;  1IZ6 A;  4C3J B;  3CQZ B;  4EX5 A;  4HJ7 A;  5FLM H;  2AWN A;  3MXN B;  1PFB A;  2J0T D;  1X3F A;  5IP9 G;  3EVQ A;  3BYY B;  3Q6S A;  3HFZ B;  2MHV A;  5CV5 A;  2NVY B;  4BBR H;  2K04 A;  1R9T B;  1Z7T A;  3FMC A;  4JW0 A;  2OWO A;  2N49 A;  1V8Q A;  1AZQ A;  3A74 A;  1HHV A;  4A3F B;  1HNX L;  3S17 B;  2FMM A;  2NN6 G;  4AYB B;  1JT8 A;  5IYD H;  1DOL A;  4KN4 C;  2YTX A;  3ZJY C;  3RZD B;  4DK6 C;  2JK8 A;  4KD3 A;  5J3B A;  3SR1 A;  2WB1 B;  5JVG 3;  1WTV A;  2K52 A;  4JOI C;  1WCM H;  2ZXP A;  1N33 Q;  4ZUJ A;  2SNM A;  1RCV D;  2OTL A;  1F9P A;  1Q8K A;  1K3R A;  1FJG Q;  2VZA A;  4C3I B;  1CZG A;  1YJN A;  3OTO Q;  1J6Q A;  1SJE D;  5DM6 3;  3RLF A;  1TWG H;  3OOC A;  1SYD A;  2ZXR A;  3GP7 A;  3I72 A;  4E6I A;  2NN6 I;  1HRJ A;  5JEA H;  3M4P A;  4OIJ A;  1A3V A;  1TY0 A;  1UEA B;  3LGJ A;  1HA6 A;  4FF2 A;  4CDC C;  3NTI A;  1V1P A;  4P2C B;  4HJ8 A;  3HOZ B;  3RN5 A;  2B2U C;  4DF7 A;  1PH9 A;  3HP3 A;  2JA8 H;  1HTL D;  3E9I A;  3BYT B;  1PLF A;  4XT1 B;  2KBN A;  4IO9 A;  3X3N A;  1U4R A;  2L1B A;  1EIF A;  3GTJ B;  4A3E B;  2EY1 A;  4AYB E;  2L9H A;  2Z6B A;  3FEW X;  4B08 A;  3AMU A;  1N33 L;  1GD7 A;  1L1O C;  4JI7 Q;  1TS2 A;  4AH6 A;  3D6W A;  3MA2 B;  4DV4 L;  4WJW A;  2DJG C;  5IT9 L;  2ASB A;  3HOX H;  1FJG L;  3ERS X;  3P75 A;  4A3J H;  3OTO L;  2R92 H;  2EQS A;  3MXG A;  4N8X 1;  3M3Y B;  2QDB A;  3M9B A;  4PMC A;  3S1N B;  2L5T A;  2WB1 E;  4BY1 H;  1PH6 A;  3A8K E;  1VQH A;  3NWS A;  4QL5 A;  5IE8 A;  1HNZ Q;  1LT4 D;  4QMG A;  4IJH A;  4EQO A;  2JP1 A;  1I6H H;  2SNS A;  3CU7 A;  2TSS A;  3BDL A;  1KHI A;  4X3U A;  5M9O A;  1Q82 C;  3NWT A;  4JVZ A;  3W1B A;  2Z4H A;  3T4A C;  2PI2 A;  3T1H Q;  1PRT C;  4X66 L;  1Q3L A;  3LX0 A;  1RD9 D;  4H7B A;  4C1N I;  5IIF A;  1XMO Q;  3BVG A;  2Z9H A;  5H1S E;  2B2U A;  2NVQ H;  5I6Y A;  2KED A;  3UE1 A;  4IOC A;  1JQY D;  5C5L A;  5AFW A;  5KYL A;  5M5X B;  2WKD A;  4ALP A;  3PO2 H;  1O7L A;  3D4D A;  3A56 A;  2NVX B;  1HNZ L;  3S2D B;  1L1O A;  1TVX A;  3A5Z B;  1WI5 A;  2NTT A;  3N6R A;  1PYW D;  1SBB B;  1JR0 D;  1JJG A;  4A3K G;  1Y1W H;  1PHJ A;  4A3M G;  1S4Z A;  4G7O C;  5M5Y B;  2AKW B;  2IJ0 A;  4R9W A;  1D1I A;  3J7A 5;  1TXY A;  2JEA I;  5DM7 3;  2JA6 G;  5IGC A;  3J7A F;  1JOO A;  2L0C A;  1ENA A;  3Q0A A;  3S1M H;  3D4R A;  2HDL A;  5IP7 G;  1PH7 A;  1ONL A;  5JPM C;  4LF7 Q;  4XQQ A;  2F0U A;  1XMO L;  4GLV B;  1SRU A;  1VQG A;  4RCN A;  2AWO A;  2JA6 B;  5C0X G;  2A68 D;  3GDE A;  1BCP C;  4BXX G;  5EJW A;  3W1G A;  3RR5 A;  1WTO A;  5CBA E;  3S16 H;  2RA4 A;  1PYB A;  4ZCK A;  1Y1V G;  3OWF A;  2QGQ A;  3F1Z A;  2ZTE A;  2I46 A;  3AEV A;  1I50 H;  5GRO A;  1L0W A;  5LMN W;  2IHF A;  3U9S A;  3S2H B;  2Q2I A;  3TP7 A;  1PFM A;  1IBK L;  2RCF A;  4XYO A;  4JPB W;  1YHB A;  4A3G B;  4KTA A;  2AQ3 B;  3G4S A;  1Y1V B;  3U9O A;  1ML0 D;  3R93 A;  2EJM A;  4JI5 L;  3NPP A;  3GTG H;  4LFA L;  1IKM A;  2XTI A;  4A3I G;  1LTL A;  4LF7 L;  4NP5 A;  4ZQ3 A;  1LTT D;  1SE3 A;  4A93 H;  5A2Q E;  3MWY W;  3FDT A;  1CKN B;  1G51 A;  1BKB A;  4A3I B;  3ZYY X;  4FDB A;  4OL7 A;  2A6H D;  2EYL A;  2OEO A;  4DV1 Q;  3HOV B;  3NTH A;  1MHW C;  4K2K A;  2NN6 H;  2HT1 A;  1T5X D;  1TQO A;  1TR5 A;  2AUJ D;  2PW7 A;  1QVG A;  4DGZ A;  4O1N A;  1I4Q A;  4NW2 A;  2DY8 A;  2C5C A;  3TN2 A;  2F03 A;  1GUO A;  2FFK B;  4YWL A;  3RNU A;  2E76 C;  2OQK A;  2KEC A;  4IUQ A;  4TQU S;  4H44 C;  2A6E D;  1EQV A;  1SND A;  3MTS A;  1IL2 A;  3SVM A;  1JWS D;  1PTO B;  5LMU Q;  2K4K A;  3KLS A;  4KD4 A;  2Q2T A;  4LF9 Q;  5FKA C;  1GUT A;  5COY A;  5I2Y A;  4WJ3 M;  5L37 A;  1C0A A;  1PMR A;  3H91 A;  4BWG B;  5HY6 A;  1RTO A;  3SK6 A;  2F0T A;  4CJ0 B;  5T1G A;  2JA7 H;  2EZV A;  5FO8 B;  1D5X C;  4RA8 A;  1SLJ A;  3MEH A;  2NZO A;  3D6C A;  1XJV A;  2DNC A;  4DXG A;  4NKL A;  2E2I B;  1G2T A;  1WTW A;  4MTK A;  2B2Y C;  2B63 G;  3CC2 A;  1IYV A;  5E3F A;  4HIK A;  5IYB G;  2G9H D;  3HOW B;  1NY4 A;  1BNZ A;  1KNE A;  2LS0 1;  4IUR A;  5IGD A;  3J80 E;  5C3E H;  3J80 c;  4HJ9 A;  1GJX A;  4OWT B;  2NVT B;  2ZT9 C;  3V96 A;  3QOJ A;  4C3H G;  1HNW L;  1KQS A;  3RLN A;  3UDI A;  1UE5 A;  4GKK Q;  5C44 B;  3NBI A;  2JA5 G;  2PNH A;  2B63 B;  1G2S A;  3D4W A;  1EZ6 A;  1E3P A;  2SDF A;  3G6J B;  1SFO B;  4B3T L;  3I91 A;  1D1K A;  5EBD A;  2HQE A;  5C4H A;  2AQ1 B;  1GM5 A;  3IKJ A;  1KD1 C;  3BZD B;  3I7F A;  4DV2 Q;  2Y0S B;  1JJC B;  2PO4 A;  1QOH A;  3NXW A;  4HJA A;  1S40 A;  3SK8 A;  4KI0 A;  1SMY D;  3MEF A;  1OXT A;  1U0L A;  4IPH A;  1EL0 A;  3KF6 B;  2KCM A;  5FLM G;  1SJH D;  4B3R L;  5LMN Q;  3MFY A;  3F2U A;  2RSN A;  4PNY A;  1GUN A;  4DR3 Q;  3CF5 A;  2PCF B;  2JSO A;  2VNU D;  4N9T A;  4GN5 A;  3KDF A;  3NE5 B;  1HTP A;  3WDN A;  1UNS A;  1EFI D;  4C56 C;  1X6O A;  4XTC S;  4HMI A;  2EVB A;  1L0Y B;  3MFG A;  2B2Y A;  4G7Z C;  1FNW A;  3S1R B;  1U9R A;  4F8M A;  4HTH A;  4BBR B;  1ZYR C;  4HID A;  5ELC A;  1O80 A;  1EIG A;  4BBS B;  2LFN A;  3DUZ A;  4DV2 L;  5IYD G;  1STY A;  3GTK H;  4HN7 A;  4RMF A;  3UI2 A;  1SNP A;  4L8J A;  1AEX A;  3SK5 A;  1HZ9 A;  3K5O A;  2B2T C;  5C4J H;  2VW9 A;  2A69 D;  4N8F A;  1XXG A;  4X64 L;  3G7L A;  2R7Z B;  1PFS A;  2J4X A;  1QIL A;  3TP8 A;  3TS0 A;  1XNQ Q;  4K5X A;  1DD2 A;  5FJ8 H;  1WCM G;  5BR8 L;  1LTI D;  3NBH B;  2F0N A;  1E2Z A;  2F0M A;  2F3W A;  3CRL C;  5ELO A;  4A3M H;  2Y0S E;  2I0Q A;  3TP5 A;  1SMX A;  3DXJ C;  3PUZ A;  3BZC A;  5EAY A;  4HCS A;  4BS9 A;  3E0E A;  4QB4 A;  4ULL A;  1ESR A;  1UWV A;  1WCM B;  3STB C;  1UE6 A;  1AW7 A;  4FXK C;  5JEA G;  2EJF C;  1EWC A;  3FHW A;  2UUC Q;  2KCN A;  5LL6 X;  3J80 L;  1B7Y B;  2JYO A;  2ZTC A;  1HQM C;  1HCZ A;  2DGY A;  1RDP D;  4XXE A;  3PUX A;  2SEB D;  1CI3 M;  1SE8 A;  1CHQ D;  1R4P B;  1YZ6 A;  5C3X A;  4KY6 A;  4HED A;  5IY0 A;  4DUZ L;  4LFB L;  3GTL B;  3ND9 A;  1XNQ L;  1SEB D;  1JOR A;  1STE A;  5IGE A;  1K73 C;  3TQY A;  3PO3 H;  4I65 A;  3J81 j;  3IAY A;  1UE7 A;  1BO0 A;  2JA8 B;  4JBK A;  2B2T A;  4GN3 B;  1CHP D;  3HOX G;  2HHH Q;  4A3J G;  4NB3 A;  3ERO A;  2VB3 X;  1ZKO A;  5EKI A;  2UU9 Q;  1HUN A;  1ESF A;  2F4V L;  1Z6H A;  2H4O A;  4BY1 G;  1LUZ A;  4PZ8 A;  5I9P A;  3N52 A;  1YIT A;  3QWN A;  4XT3 B;  4YCV A;  4GKJ Q;  1J5E Q;  4A3C G;  1T5E A;  2LSS A;  2R92 B;  4QQB X;  2EYF A;  3I2Z A;  2K32 A;  2QEJ C;  4K6D A;  4GNX C;  1I3Q B;  3F2C A;  3MHB A;  2K5N A;  4IPD A;  3SK4 A;  3D8G A;  4LFC Q;  4EQN A;  1JOQ A;  4JYA Q;  1YBY A;  4JBW A;  1I6H B;  1X55 A;  3J81 L;  2FIN B;  3M4Y A;  5DEH A;  1NTG A;  2SOB A;  5ELF A;  1LO5 D;  1D8L A;  3L0O A;  2NYZ D;  1CFM A;  1PTO D;  1D6E C;  4B9W A;  3GTO B;  4DV3 L;  1HPC A;  1F77 A;  4HAE A;  3PO2 G;  5IYC H;  1F9Q A;  2UU9 L;  5DAU A;  2ZJR A;  2UXC L;  1FNV A;  4LF5 L;  5C4X G;  1WYD A;  1ILP A;  4JBJ A;  4IQZ A;  1B9M A;  2NVQ B;  4NMZ A;  4RGN A;  4GKJ L;  1J5E L;  3T56 B;  1HXY D;  1WTH A;  4DR1 L;  2HCI A;  3GV6 A;  5E4W C;  3PO2 B;  1EU4 A;  1Y1W G;  1CQF A;  2KHJ A;  4G7H C;  3R2T A;  4LAA A;  1PV4 A;  4GN4 B;  4RHR A;  2EOT A;  4LUO A;  4R4O A;  2BE5 D;  4JYA L;  3I4M H;  2NUC A;  5LHY 1;  3IL8 A;  3FKI H;  1WOC A;  3BS1 A;  2WV6 D;  4IFD J;  3ICE A;  1V1P B;  4HIO A;  1PDQ A;  1CK1 A;  4GNX A;  2CH4 A;  1QG7 A;  4R4T A;  2UUA Q;  1P16 A;  1Q90 A;  2X6L A;  3H0G B;  5COR A;  4CJ2 C;  1C9O A;  4BA2 I;  1YNJ D;  3TS2 A;  1A62 A;  1IW7 C;  2CW0 C;  3I4N B;  4APV A;  1HR0 L;  1EY0 A;  2K75 A;  1L0X B;  2F0D A;  4KKT A;  2HQL A;  3S15 H;  2ATW A;  5IGF A;  4Q5V A;  3CCL A;  4LMQ D;  4UHV A;  2WAQ B;  1U5K A;  4DV6 Q;  3IFD A;  4DNT B;  3ER0 A;  3SHL A;  5G3L D;  4O42 A;  2YU9 B;  2RSO A;  3KJO A;  5J1Z A;  4PG3 A;  3GQB A;  1I50 B;  4A3D H;  1SYE A;  1MJE A;  4R1J A;  1ZEQ X;  5CMD A;  3NEL A;  4Y7N H;  3M7G A;  1KAA A;  1V1O A;  5IWA Q;  4A93 G;  2KHS A;  2NTS A;  1FYC A;  2K5D A;  2UUA L;  3U58 A;  1WD0 A;  1TWA H;  1CSQ A;  3GTG B;  1XNR Q;  1TS3 A;  3CC4 A;  2XWJ B;  4IFD I;  4NXM Q;  1JOK A;  2K50 A;  1SE4 A;  3MXP A;  2LXJ A;  4A93 B;  3HKS A;  1K83 B;  1TWF B;  2A8V A;  1B9N A;  3A0J A;  4L63 B;  3TME A;  1DOM A;  1CQV A;  2PQE A;  4MIU A;  2VUM H;  1LAC A;  1YIJ A;  4DV6 L;  4LF6 L;  3VYU A;  2BOS A;  1XTC D;  1U4M A;  4U67 3;  2PZW A;  5E4X A;  1L1O B;  3UDF A;  1G29 1;  4H0L C;  3UDX A;  3FRP B;  2WKC A;  4DV4 Q;  5IWA L;  2O4X A;  3K7A H;  1JMC A;  2WAQ E;  3VR2 A;  2DY7 A;  2JA7 G;  2KUM A;  4C2M H;  1XNR L;  3FPP A;  1CKM A;  3K81 C;  4JI2 L;  4NXM L;  3BVZ A;  3RMH A;  4RGO S;  1F2Y A;  2HCC A;  1E0B A;  1LV9 A;  1EY7 A;  2CQO A;  3VA7 A;  2RHS B;  3TBI B;  3PIO 3;  1S72 A;  4DK1 A;  1CA5 A;  2YTY A;  3CCR A;  1AZP A;  1C7Y A;  5HGQ A;  2VQE Q;  2O5I C;  5C3E G;  1PRT B;  1PTO F;  2BH8 A;  3Q8D A;  3A55 A;  2PI2 E;  1HH2 P;  1SRO A;  2F0H A;  4QUC A;  4X66 Q;  1KL9 A;  4M1U B;  5M3F H;  2IPK D;  1TWC H;  5D65 A;  3K7U C;  3NQI A;  2WII B;  3FPU B;  1NE3 A;  5FOB B;  1X9N A;  4I7Z C;  1AE3 A;  3O13 A;  4LNQ A;  1HJP A;  1BBU A;  1DGS A;  4JC0 A;  4JI6 Q;  1JCK B;  1YHQ A;  1KDC A;  2UXD Q;  1EWI A;  1KXL A;  3E6Z X;  2KHI A;  4A3B H;  3PCO B;  1AE2 A;  4JOI A;  4JI3 L;  1RKN A;  3KLS X;  1FVI A;  1GHJ A;  1IBM L;  4A3C H;  4EQP A;  4UPA A;  1SYB A;  4ZUI A;  3KLR A;  4JI0 L;  5M5W H;  5EKL A;  3U4V A;  4X65 Q;  4XIG S;  1CZW A;  5CV9 A;  2F0F A;  2O5J C;  3T13 A;  2F0I A;  2VQE L;  4ZLT F;  4FO2 A;  1U4P A;  1KAB A;  1JWU D;  1B70 B;  4CGY B;  2EXZ A;  1VQ5 A;  1MGS A;  2K5W A;  1S5E D;  5ISR A;  3W3A A;  2D9U A;  3PUY A;  3NQT A;  1XX8 A;  2G5D A;  3EIV A;  1BCP B;  2I5H A;  5CV8 A;  1QUQ A;  4JI6 L;  2DN8 A;  1H9S A;  2PZU A;  2F0W A;  3VR6 A;  4KKS A;  1Y8N B;  2F0K A;  4JCV E;  5C4X H;  3J81 i;  2UXD L;  3AU7 A;  4L5S A;  1CSP A;  5G3L F;  4G57 A;  4S3S A;  1ICW A;  1I4R A;  1CKO A;  3GTQ H;  3T16 A;  3GTK B;  1VQI A;  1IYU A;  4LK1 C;  5FJ8 G;  3LNN A;  1IBK Q;  4X65 L;  2PQA A;  1B3Q A;  2OCE A;  2PYK A;  3D0F A;  4JI5 Q;  2E2J H;  1C4Q A;  2N8N A;  4LFA Q;  1A3U A;  3HG9 A;  5I2X A;  3M85 A;  3ERQ A;  4BY7 H;  2AQ2 B;  4A3K B;  2ZJQ A;  3OW7 A;  1Y69 U;  1MIU A;  3BG3 A;  5HGT A;  4A3M B;  1KDB A;  1I5F A;  1X3G A;  2B2W C;  1VQP A;  1FGB D;  2ICI A;  1V43 A;  3DM1 A;  4A3L G;  1B50 A;  4K5W A;  1YNN C;  4KJN A;  4IUN A;  4K14 A;  1VCI A;  2RDF A;  2IX1 A;  4YHH L;  1LTG D;  1K8M A;  1NCV A;  3FP9 A;  4R8N A;  1JJ2 A;  3NSW A;  2F1M A;  3KYH C;  5JAV A;  1SYC A;  4OX9 Q;  5A35 A;  4IFD H;  4QY7 A;  3JAM E;  5EPJ A;  3JAM c;  1HZB A;  1KLU D;  4QIW B;  3EN2 A;  2ZM6 L;  1MSH A;  1VS0 A;  2Q2H A;  5IOC A;  1EYG A;  1A3T A;  2YTV A;  2M00 A;  3PO3 G;  1S5F D;  1W6J A;  3E5S A;  3PF5 A;  1EWH A;  3HKZ G;  1QJO A;  3P7J A;  4RKB A;  3NTK A;  4A4I A;  1PH2 A;  1VQN A;  1E1T A;  3CCJ A;  5CC4 A;  1UAP A;  2XRQ D;  1HUM A;  1QNK A;  1DJR D;  4DNI A;  1B4O A;  1YHA A;  3D3R A;  3EQL C;  1X32 A;  5D3I B;  2KJX A;  4C3J H;  2EXD A;  2R93 H;  2M2L A;  3CQZ H;  1PH5 A;  3M7N A;  1VQ4 A;  1YNX A;  5IGB A;  4IPG A;  1Q7Y C;  3MVV A;  3KDF B;  2R3Z A;  2FJ2 A;  3PV0 A;  5LL6 S;  1XPO A;  2RBM A;  2KEN A;  2NVY H;  3KBG A;  1Y8O B;  1B3A A;  2KCC A;  2QW7 A;  2PMZ B;  3KLW A;  4OX9 L;  3KFU A;  1JC7 A;  4DXF A;  2B2W A;  1LM0 A;  4A3F H;  5C6A A;  5FLX E;  5FLX c;  4OEL B;  3RZO H;  3S17 H;  1LT3 D;  3HOY H;  1GUS A;  2IWH A;  2AMC B;  1K9M C;  1QB5 D;  1TS4 A;  1QWY A;  2Q2U A;  4AIM A;  3F2D A;  4LF8 L;  1HNW Q;  3T53 B;  4U68 A;  3RZD H;  4IOA A;  1WTQ A;  3EA6 A;  5IYC G;  1K8O A;  2AUK A;  2XSC A;  1ET6 A;  4YWK A;  2QA4 A;  4QIW E;  4B3T Q;  4DV5 Q;  2CKZ B;  2E8G A;  3F2B A;  1I94 L;  3HZX A;  4YWM A;  1JE5 A;  1S3O A;  1VQM A;  1Y14 B;  3DEO A;  5E1F A;  2RCN A;  2A1A A;  3ULP A;  2OF1 A;  5K5P A;  3A54 A;  4C3I H;  1N34 Q;  2CHB D;  4DPG A;  4TSS A;  1B53 A;  4RWS C;  3I4M G;  2JA9 A;  1SSO A;  3FKI G;  1PRT D;  4JI1 L;  1W2B A;  2NWG A;  4B3R Q;  1P8L A;  1LT6 D;  4OGQ C;  4YCU A;  3Q24 A;  3T1Y Q;  3TEH B;  3HOZ H;  1EY8 A;  3J7Z C;  3K5M A;  3JAM L;  3PIO A;  2PMZ E;  2D62 A;  4HSV A;  4CKB A;  2A73 B;  2NB0 A;  1UE1 A;  3S1Q H;  3AB9 A;  2E2H H;  1PA6 A;  1VQ8 A;  3MXU A;  3ULJ A;  4DV5 L;  2L4N A;  3GTJ H;  4ZKB B;  3BDC A;  4A3E H;  1RIP A;  3GD7 A;  3R8B A;  1ASZ A;  4QCL A;  3K6O A;  1BDO A;  4C3H B;  3K58 A;  4FXD A;  4KN7 C;  1F2L A;  2JA5 B;  4TKO B;  2GVB A;  1MSG A;  5J22 A;  2EDG A;  1ROD A;  1N34 L;  4X64 Q;  3KK7 A;  4L5Q A;  4DUY Q;  4CBV A;  3OWE B;  3S24 A;  4A75 A;  2BCO A;  1A2T A;  2IT1 A;  4A3D G;  4JV5 L;  3S15 B;  5A2Q L;  4QGU A;  5BR8 Q;  3PUV A;  1RJT A;  2D0P A;  4F7X A;  3T1Y L;  1WTR A;  4DN4 M;  3K57 A;  4IPC A;  3VDY A;  1N8R C;  5JJL A;  1BCP D;  2F0S A;  1A63 A;  1EQT A;  2FMC A;  1TII D;  1D5Z C;  1VQ7 A;  5FLX L;  3AFP A;  2K5V A;  4V19 0;  5KYI A;  4P71 A;  1GHK A;  4Y7N B;  3X3M A;  4R4C A;  1HR0 W;  2BDO A;  1GOZ A;  3L9A X;  2F0O A;  1C48 A;  1CUK A;  1TWA B;  2PPB C;  1M8A A;  2VUM G;  4RGT A;  2MPM A;  1STG A;  5K36 H;  4O0A A;  3W5O A;  4DUY L;  2UUB Q;  1M4V A;  4FF3 A;  4DUZ Q;  1DM0 B;  3U50 C;  4LFB Q;  2MGS A;  3S14 H;  2XRS D;  1VMP A;  1SYG A;  5ELD A;  3R2I A;  1IBL L;  3CCQ A;  2JEB I;  3GTM H;  4ZRZ A;  3OIQ A;  1YNJ C;  5CV7 A;  1PH1 A;  3OYY A;  2B8G A;  5M5Y H;  1EEI D;  1AFP A;  1SR3 A;  2F4V Q;  3I55 A;  1X56 A;  1KAW A;  3M4Q A;  4FP5 D;  1AH9 A;  1PYS B;  4EVO A;  4UY8 C;  2LKV A;  1VMC A;  3ITP A;  2K28 A;  3K7A B;  3H6M A;  4A3L H;  2RVL A;  4GNX B;  2VY3 A;  3I8Z A;  1TWG B;  4C2M B;  1NJI C;  4RG1 A;  4OWX B;  2N88 A;  1SNM A;  1B44 D;  1BBW A;  3AQQ A;  3CCS A;  1Q86 C;  2K05 A;  3TSS A;  4QF4 A;  2UUB L;  4H02 A;  5M3F G;  2QKI C;  2F52 A;  1SE2 A;  2EIF A;  4DAV A;  2B39 A;  5EQ0 A;  5T1I A;  3CRK C;  3ULL A;  4PZ6 A;  2EY2 A;  2EJG C;  3VR4 A;  4L5R C;  2I07 B;  4V0B A;  4DV3 Q;  5M3F B;  1LTS D;  2BDN A;  4A3G H;  5NUC A;  2CWP A;  2UXC Q;  3KJP A;  4LF5 Q;  1IL8 A;  5D3D A;  1O7Y A;  1EYA A;  2LY7 A;  4F88 A;  4DR5 L;  4RFB A;  4A3B G;  4JI4 Q;  3C1E A;  3FVQ A;  3CHB D;  1TWH H;  2KCT A;  4PMB A;  4L6T B;  3HOX B;  1LTA D;  4LJZ C;  2K1B A;  4DR1 Q;  4A3J B;  4OIK A;  1NAP A;  2EY6 A;  4DA2 A;  2B3G A;  5JPN C;  4BY1 B;  5BN3 A;  2K33 A;  1QVF A;  2OQ0 A;  3E0J A;  1FL0 A;  4K6L A;  4XYQ A;  1VQF A;  4RHS A;  4B3S L;  1Q1E A;  1JB7 A;  5M5W B;  4ME3 A;  3PUW A;  3HOV H;  3DM3 A;  1STA A;  2JN4 A;  1BR9 A;  4EGV A;  1G6P A;  1L2F A;  4IJL A;  2RDH A;  3SXH A;  1QZH A;  1K8G A;  2Z0S A;  1KRS A;  4UP8 A;  1E1O A;  2N55 A;  5I6W A;  1TU2 B;  2VB2 X;  2A19 A;  4JI4 L;  1HR0 Q;  2CWA A;  2K6A A;  1E2W A;  2IL8 A;  5DNF A;  3CMA A;  3C3L A;  3SE0 A;  1EQQ A;  1B2T A;  3UE0 A;  1O7I A;  3DWQ A;  4GLA C;  2WP8 J;  3HOU G;  5C4X B;  5TSS A;  3TRE A;  1O78 A;  1FR3 A;  4J1M A;  4ABN A;  3CKI B;  1KIX A;  3I4O A;  1FGU A;  4RKL A;  1ASY A;  1BCP F;  1KNA A;  4O2D A;  4BY7 G;  2RF4 A;  1CT1 D;  1GKH A;  2X69 A;  1PZK D;  2DNE A;  3QIA A;  1Y1W B;  1VQC A;  2E2I H;  1S5B D;  2HIX A;  3HEJ A;  1YVC A;  1ZYR D;  1EIH A;  1W3S A;  2KEE A;  2E2J B;  1WFQ A;  4LWC A;  3HOW H;  4HIM A;  1I4X A;  1VF5 C;  1XPU A;  2VQF Q;  3S1M B;  4DAY A;  2OTJ A;  1BXT A;  2NVT H;  1BVS A;  1MD2 D;  3SEB A;  1D5M C;  1EFW A;  1K0S A;  3IRB A;  2MO1 A;  2AHO B;  4IFD G;  5C44 H;  4FF4 A;  3BJU A;  2XWB B;  2R6G A;  5EKK A;  1S5C D;  4DAM A;  2ALY B;  4DV0 L;  1HFG A;  1SFO H;  2K7V A;  3MZ5 A;  1EY5 A;  3S16 B;  3I90 A;  1HA5 A;  4KMU C;  4LF6 Q;  2QIL A;  2VL6 A;  2G9D A;  4XDX A;  5GAH C;  4QUF A;  4IN3 A;  3KF8 A;  5ELB A;  3EFX D;  3HGB A;  1TY2 A;  3I56 A;  4C3J G;  3M4O H;  2R93 G;  4LF4 L;  4A76 A;  1HQR D;  1IYJ B;  4N9P A;  4DAP A;  2CQA A;  1H9M A;  2VXW A;  1B1Z A;  3I3C A;  2VQF L;  2MJ8 A;  1PVO A;  2N78 A;  5M3M H;  3H09 A;  1EY4 A;  4JI2 Q;  2R93 B;  2FXQ A;  1EU3 A;  2GVA A;  4B3M Q;  4K0K L;  3ONA B;  2XVS A;  4CKE A;  4A3F G;  3S1R H;  5KRU A;  1VQO A;  5JJK A;  2E5L Q;  1QUQ B;  1A15 A;  3HOY G;  4AYB G;  1A8V A;  1H9S B;  4BBS H;  5AJ3 Q;  3HS0 C;  2E74 C;  4UDU C;  2NZH A;  4GOP C;  5EPL A;  1OXV A;  3RZO B;  1ICF B;  5JVH 3;  4HR7 B;  4K5V A;  4KK7 A;  2WB1 G;  4CHT B;  3HOY B;  1F9R A;  2F0Q A;  2R7Z H;  2A68 C;  4WOR A;  3G6E A;  2K5Q A;  3CAM A;  1BQQ T;  1XMQ Q;  2PQA B;  3QO2 A;  3C2P A;  2YYZ A;  3K0X A;  4NXN Q;  3HRZ C;  2QF7 A;  4KJO A;  2DJF C;  3BZK A;  4RGM A;  1CA6 A;  4KY5 A;  4C3I G;  4JI3 Q;  1KC8 C;  1IBM Q;  1OO9 B;  4X3T A;  4P72 A;  1PZI D;  4WFN 3;  4B3M L;  2YV5 A;  4KHP Q;  1EIY B;  1XYI A;  2R61 A;  4JI0 Q;  1H9K A;  2JA7 B;  5ELN A;  4KHZ A;  3C46 A;  1IKL A;  2E5L L;  5KNC A;  2IHE A;  4FNF A;  1CTM A;  2R7D A;  5KND A;  5AJ3 L;  3HOZ G;  3CPW A;  2JJQ A;  1GO3 E;  2F0E A;  4OON A;  3J80 i;  4ME5 A;  4Y52 H;  4R4I A;  1NR2 A;  2ZXO A;  4ZYS A;  5HUR A;  2C9O A;  1Z9F A;  3K5L A;  2MO0 A;  1B8A A;  3GTL H;  1AP0 A;  4GS3 A;  5C3E B;  4FXG C;  4A3E G;  1XMQ L;  1RHP A;  3I70 A;  2BA0 A;  3CCM A;  1U4L A;  2A6H C;  4AQY Q;  2RQX A;  4NXN L;  3P20 A;  2ZJP A;  3S1Q B;  4GOP A;  2E2H B;  1LLR D;  3TZU A;  4XQN A;  4DK0 A;  4DNR B;  1A2U A;  1NNX A;  4KHP L;  4XQJ A;  4KHV A;  1V9P A;  5EGT A;  5GAD C;  3QOL A;  2A6E C;  2XGT A;  5I9O A;  3TRZ A;  2EYO A;  3A7A B;  3I73 A;  3DMU A;  5FK9 C;  4OO1 G;  3K80 C;  1TKW B;  1I3Q H;  1LTB D;  5CGK A;  3I4L A;  4OEM B;  1EQR A;  2IX3 A;  4DR7 Q;  1TS5 A;  3A8I E;  1KTK A;  4GLX A;  3MXN A;  1ENC A;  1IW7 D;  1TT2 A;  2CW0 D;  1VQE A;  3NEN A;  4IAL A;  2KVM A;  4DR4 Q;  5GAE C;  4AQY L;  4JI8 Q;  4YHH Q;  1E2V A;  1RF2 D;  4DR2 Q;  5JOB A;  5K36 G;  3GTO H;  2X6G A;  1HZA A;  3K59 A;  4I7A A;  2ZM6 Q;  2K03 A;  1Q8I A;  1Y8P B;  1EYC A;  1XWE A;  5D14 A;  2O2L D;  1STH A;  2D5D A;  1VQA A;  1SNQ A;  2IX0 A;  4JK1 C;  2JXM B;  4JI7 L;  3QR8 A;  5C4J B;  3HOU H;  1UUP A;  3BDO A;  4K8J A;  4OO1 I;  3GTP H;  2B29 A;  2VS1 A;  2Z8L A;  2QCP X;  1JB3 A;  4OXP A;  4ZAI A;  3PMF A;  3EBE A;  1VF7 A;  3G71 A;  1X3Q A;  1X54 A;  3VA5 A;  2I5M X;  3S14 B;  5JJZ A;  4DR7 L;  4RAU C;  1I6V C;  1H95 A;  1KRT A;  4MN3 A;  4HCE A;  5KGU A;  3GTM B;  2D2C C;  1QCB D;  1SMY C;  2A74 C;  1DXM A;  4KLK A;  4DR4 L;  5C0X J;  2TMP A;  2C35 B;  4JI8 L;  1C8C A;  3H3V I;  4L5T A;  4LUV A;  1LAB A;  2L55 A;  3CP0 A;  4HMJ A;  4DR2 L;  3H0G H;  3T1H L;  2EE1 A;  4PQX A;  3CCE A;  3IFT A;  2F0P A;  2EYH A;  3L3O C;  3I4N H;  2F0L A;  2D0O A;  4J6H A;  1OXU A;  3W2D A;  1MKH A;  4DV7 Q;  3MAQ A;  2H5X A;  4LF8 Q;  3K5N A;  4H13 C;  3H3V C;  3UDG A;  4K8I A;  4A3G G;  2ID0 A;  3DEP A;  2P5Z X;  5ELE A;  2M9V A;  1LTR D;  1QVC A;  1PH8 A;  2YU9 H;  3PO3 B;  4P75 A;  1LYL A;  1I94 Q;  3HKZ B;  4KV6 A;  4ILW A;  2PNR C;  2CCZ A;  1NBW A;  1STB A;  2A69 C;  2L12 A;  4JG2 A;  2K01 A;  4IUV A;  1VQJ A;  3RD4 A;  1R9T H;  3SDZ A;  1VDZ A;  4DFA A;  3L2P A;  3J7A V;  1X65 A;  4HSP A;  1TWH B;  2RHQ B;  5IP9 H;  1JE4 A;  1DON A;  3OW2 A;  4JI1 Q;  3NK9 A;  2Q8T A;  3HOV G;  1DZ1 A;  5C0X I;  2B8F A;  1SYF A;  2XN9 C;  3K0Y A;  3VYR A;  1MI2 A;  3RUZ A;  1SN8 A;  1K83 H;  3KUP A;  3J7Y W;  3OMC A;  1TWF H;  2UXB Q;  3D31 A;  3CXC A;  4WRD A;  4DV7 L;  3NHH A;  1OTC A;  2LMC B;  4IUT A;  5C3W A;  4WJ4 A;  3A8J E;  1SDF A;  1EZ8 A;  5CBE E;  3OHX C;  1BOS A;  3CD6 A;  2QDL A;  1ZXT A;  2ENB A;  2HDM A;  1EEF D;  1K0R A;  1Q81 C;  5DLQ E;  1YJ9 A;  4DR6 Q;  3NUC A;  2CFM A;  2RKS A;  2I5L X;  4NDX A;  1JWM D;  4CDF C;  1H9R A;  1Q1B A;  1PH3 A;  1EUJ A;  1EY9 A;  4ZKC B;  3CCU A;  4MTN A;  5KEE A;  2Q8I B;  1NR4 A;  1YI2 A;  2HD3 A;  1WVL A;  4JV5 Q;  1WD1 A;  1D7Q A;  5KNB A;  2EY5 A;  5GAG C;  2F3V A;  3HKZ E;  2L11 A;  2A5H A;  3DLL A;  2GN5 A;  1E24 A;  3RLO A;  3OPO A;  2Z6K C;  3AFQ A;  2UXB L;  2KOL A;  4FVM A;  4X62 Q;  3HOW G;  2IW3 A;  1E7Z A;  3I4M B;  3FKI B;  3SGI A;  1NMF A;  4DV1 L;  5EPK A;  2LXK A;  1RTN A;  5C44 G;  1QE6 A;  4PMW A;  5J39 A;  3H15 A;  1XTD A;  4DR6 L;  2XNA C;  2WAC A;  5CV4 A;  3GO5 A;  4DU9 A;  3PIP 3;  4POF A;  1EYD A;  3EJI A;  4X3S A;  5IOD A;  2Y0S G;  1NSN S;  2NZ1 D;  1KLG D;  2ZTD A;  3M3Y H;  2EYM A;  3S1N H;  3C1F A;  4JBM A;  2BA1 A;  2XIW A;  4IUP A;  5LMU L;  1II3 A;  2GA4 B;  2F0G A;  3WOE A;  4LF9 L;  1PTO C;  3URY A;  5E7N A;  1IBL Q;  2BH2 A;  5FO7 B;  3H94 A;  1VQK A;  1I4P A;  3GV3 A;  4X6A H;  1H9J A;  4X62 L;  4OO1 H;  2DUD A;  3T51 B;  1BUV T;  3CPF A;  1YNN D;  4A3D B;  2MP1 A;  3CW2 C;  2MQH A;  1QNU A;  2HIV A;  4NPS A;  5M3M G;  4R8I A;  3E3X A;  3M4O B;  3P1H A;  1O7Z A;  1PFN A;  3NP8 A;  2F3I A;  1EY6 A;  2HUG A;  5GQO A;  1RL2 A;  2RDG A;  1XPR A;  3Q23 A;  2Z6K A;  1SXT A;  3VYS A;  3PSI A;  1K8A C;  1ILQ A;  4BBR G;  1CKN A;  1FNU A;  3V2T A;  2QEX A;  3AYH B;  3WWV A;  5M3M B;  4BBS G;  5C4Z A;  2BE5 C;  3F8T A;  3S9W A;  3KBX A;  1VQD A;  1GUW A;  3H3V H;  1LT5 D;  1STN A;  5I4D A;  4GKK L;  3DWA A;  5M5X H;  4POG A;  1UEB A;  1F2Z A;  1GUG A;  3OSO A;  4RCO A;  2WIN B;  4KY7 A;  1ET9 A;  2NVX H;  2R7Z G;  2VUM B;  1F2M A;  3S2D H;  4HJ5 A;  2MFI A;  1WJJ A;  1BF4 A;  3J81 E;  1S5D D;  2Z4I A;  3J81 c;  4R4Q A;  4KKU A;  5C5M A;  1HFN A;  1VQB A;  2NBF A;  3LWU A;  5IGG A;  2OXP A;  3ND8 A;  4CKC A;  1PZJ D;  1PH4 A;  1GXD C;  3TDQ A;  4DR5 Q;  1Z47 A;  4Z9C B;  3KOJ A;  4YY3 Q;  1SNC A;  3DWP A;  1R4Q B;  2CH4 W;  4OHJ A;  1OXS C;  5JEA J;  5LMN L;  4A3K H;  4DR3 L;  1J8I A;  2E2D C;  4UP7 A;  1Q12 A;  3A5U A;  2JA6 H;  1K28 A;  1M1K C;  3OMG A;  4DAY B;  3CME A;  2MUY A;  5IP7 H;  2K5H A;  4B3S Q;  4FF1 A;  2EYJ A;  3CC7 A;  2OT2 A;  4TVA B;  3Q22 A;  5C0X H;  1CM9 A;  3S2H H;  5EBC A;  4BXX H;  2PW5 A;  2KA7 A;  3G48 A;  2R7F A;  5F2D A;  3A7L A;  1VQL A;  3MC0 B;  2ES2 A;  4CJ1 B;  1J9O A;  1TWC B;  3KF8 B;  2JA8 G;  2B2V C;  1Y1V H;  4IUU A;  4MHE A;  4TRD A;  1BBX C; 
#chains in the Genus database with same CATH homology
 4X3K A;  4ID6 A;  4UAI A;  1WTX A;  1OXX K;  4G4K A;  1PRT F;  1A6X A;  3BVM A;  2EPB A;  4Q0F A;  1PXU A;  4ZK9 B;  1X3P A;  2EYP A;  4A3B B;  5CR3 A;  4GZY C;  2E75 C;  3TP6 A;  4C1N K;  1DCZ A;  1JIC A;  4YIJ A;  4FYD A;  1DYQ A;  1FD7 D;  1DOK A;  2F0J A;  3OIP A;  3VYT A;  4IZ8 A;  2PZT A;  1PTO H;  2J7Z A;  1WTP A;  5FO9 B;  4M8A A;  2CVR A;  1NUC A;  2V4D A;  3QJY A;  2B2V A;  2F0V A;  3R3O A;  4RH6 A;  3GTQ B;  2Z1C A;  1I4H A;  1SNO A;  3HOU B;  3NBH A;  2JE6 I;  3GTP B;  4B9X A;  2F4I A;  4J8Q A;  4F87 A;  3VR5 A;  4BY7 B;  5CYU A;  5CV6 A;  2ICE C;  3LWE A;  1IHZ A;  2KQ3 A;  1SAP A;  2Q8R E;  1I4G A;  1MBY A;  2H1E A;  5BN5 A;  3V05 A;  3QB3 A;  1W6K A;  2FHT A;  4K2L A;  1G8Z D;  3VR3 A;  1EOT A;  1F9S A;  1KDA A;  4PV1 C;  3TZD A;  3L7Z C;  1D2B A;  5KIX A;  4ODG A;  3DHQ A;  3QG1 A;  3WOF A;  4BA1 I;  1ENF A;  5BN4 A;  1AN8 A;  1G91 A;  5IT9 E;  1G6Z A;  4C3J B;  3CQZ B;  2AWN A;  1PFB A;  2J0T D;  3EVQ A;  3BYY B;  3Q6S A;  2MHV A;  5CV5 A;  2NVY B;  2K04 A;  1R9T B;  1Z7T A;  3FMC A;  1V8Q A;  1AZQ A;  1HHV A;  4A3F B;  3S17 B;  2FMM A;  2NN6 G;  4AYB B;  1DOL A;  4KN4 C;  3RZD B;  4KD3 A;  3SR1 A;  2WB1 B;  5JVG 3;  1WTV A;  2ZXP A;  4ZUJ A;  2SNM A;  1RCV D;  1F9P A;  4C3I B;  1CZG A;  5DM6 3;  1SJE D;  3RLF A;  3OOC A;  1SYD A;  2ZXR A;  3GP7 A;  3I72 A;  4E6I A;  2NN6 I;  1HRJ A;  5JEA H;  4OIJ A;  1A3V A;  1TY0 A;  1UEA B;  1HA6 A;  4FF2 A;  3NTI A;  1V1P A;  4P2C B;  3HOZ B;  2B2U C;  4DF7 A;  3HP3 A;  1HTL D;  3BYT B;  1PLF A;  4XT1 B;  3X3N A;  1U4R A;  2L1B A;  3GTJ B;  4A3E B;  2EY1 A;  2L9H A;  3FEW X;  4B08 A;  3AMU A;  1TS2 A;  3D6W A;  3MA2 B;  4WJW A;  5IT9 L;  3P75 A;  3MXG A;  3M3Y B;  2QDB A;  4PMC A;  3S1N B;  2L5T A;  3A8K E;  3NWS A;  1LT4 D;  4QMG A;  4EQO A;  2JP1 A;  2SNS A;  3CU7 A;  2TSS A;  3BDL A;  4X3U A;  5M9O A;  3NWT A;  2Z4H A;  3T4A C;  1PRT C;  1Q3L A;  3LX0 A;  1RD9 D;  4H7B A;  4C1N I;  5IIF A;  3BVG A;  2B2U A;  5I6Y A;  2KED A;  1JQY D;  5C5L A;  5AFW A;  5KYL A;  5M5X B;  2WKD A;  1O7L A;  3D4D A;  3A56 A;  2NVX B;  3S2D B;  1TVX A;  2NTT A;  3N6R A;  1PYW D;  1SBB B;  1JR0 D;  1S4Z A;  4G7O C;  5M5Y B;  2IJ0 A;  4R9W A;  1D1I A;  2JEA I;  5DM7 3;  5IGC A;  3J7A F;  1JOO A;  2L0C A;  1ENA A;  3Q0A A;  3D4R A;  2HDL A;  1ONL A;  5JPM C;  4XQQ A;  2F0U A;  4RCN A;  2AWO A;  2JA6 B;  5C0X G;  2A68 D;  1BCP C;  5EJW A;  1WTO A;  5CBA E;  2RA4 A;  3OWF A;  2I46 A;  3S2H B;  3U9S A;  3TP7 A;  1PFM A;  4XYO A;  4A3G B;  4KTA A;  2AQ3 B;  1Y1V B;  3U9O A;  1ML0 D;  3R93 A;  2EJM A;  3NPP A;  1IKM A;  4NP5 A;  4ZQ3 A;  1LTT D;  1SE3 A;  5A2Q E;  3MWY W;  3FDT A;  4A3I B;  3ZYY X;  4OL7 A;  2A6H D;  2EYL A;  2OEO A;  3HOV B;  3NTH A;  4K2K A;  2NN6 H;  1T5X D;  1TQO A;  1TR5 A;  2AUJ D;  2PW7 A;  4DGZ A;  4O1N A;  1I4Q A;  4NW2 A;  2DY8 A;  2C5C A;  3TN2 A;  2F03 A;  1GUO A;  2FFK B;  2E76 C;  2KEC A;  4IUQ A;  4TQU S;  4H44 C;  2A6E D;  1EQV A;  1SND A;  3MTS A;  3SVM A;  1JWS D;  1PTO B;  3KLS A;  4KD4 A;  5FKA C;  1GUT A;  5COY A;  5I2Y A;  1PMR A;  3H91 A;  4BWG B;  1RTO A;  3SK6 A;  2F0T A;  4CJ0 B;  5T1G A;  2EZV A;  5FO8 B;  1D5X C;  4RA8 A;  3MEH A;  3D6C A;  2DNC A;  4DXG A;  4NKL A;  2E2I B;  1G2T A;  1WTW A;  2B2Y C;  1IYV A;  5E3F A;  2G9H D;  3HOW B;  1BNZ A;  1KNE A;  2LS0 1;  4IUR A;  5IGD A;  3J80 E;  1GJX A;  2NVT B;  2ZT9 C;  3V96 A;  3QOJ A;  4C3H G;  5C44 B;  3NBI A;  2B63 B;  1G2S A;  3D4W A;  1EZ6 A;  2SDF A;  3G6J B;  1SFO B;  3I91 A;  1D1K A;  5EBD A;  2HQE A;  5C4H A;  2AQ1 B;  3IKJ A;  3BZD B;  2Y0S B;  2PO4 A;  1QOH A;  3NXW A;  3SK8 A;  4KI0 A;  1SMY D;  1OXT A;  1EL0 A;  1SJH D;  3MFY A;  3F2U A;  2RSN A;  4PNY A;  1GUN A;  2PCF B;  2JSO A;  2VNU D;  4N9T A;  3NE5 B;  1HTP A;  3WDN A;  1UNS A;  1EFI D;  4C56 C;  4XTC S;  4HMI A;  2EVB A;  1L0Y B;  3MFG A;  2B2Y A;  4G7Z C;  1FNW A;  3S1R B;  1U9R A;  4F8M A;  4HTH A;  4BBR B;  1ZYR C;  5ELC A;  1O80 A;  1EIG A;  4BBS B;  2LFN A;  3DUZ A;  1STY A;  4HN7 A;  3UI2 A;  1SNP A;  4L8J A;  1AEX A;  3SK5 A;  3K5O A;  2B2T C;  2A69 D;  1XXG A;  3G7L A;  2R7Z B;  2J4X A;  1QIL A;  3TP8 A;  4K5X A;  1DD2 A;  1LTI D;  2F0N A;  1E2Z A;  2F0M A;  2F3W A;  3CRL C;  3TP5 A;  3DXJ C;  3PUZ A;  4HCS A;  4BS9 A;  4QB4 A;  4ULL A;  1ESR A;  1WCM B;  1AW7 A;  4FXK C;  5JEA G;  2EJF C;  1EWC A;  2KCN A;  5LL6 X;  3J80 L;  2JYO A;  1HQM C;  1HCZ A;  4XXE A;  1RDP D;  3PUX A;  2SEB D;  1CI3 M;  1CHQ D;  1R4P B;  5C3X A;  4KY6 A;  4HED A;  3GTL B;  3ND9 A;  1SEB D;  1JOR A;  1STE A;  5IGE A;  4I65 A;  3IAY A;  1BO0 A;  2JA8 B;  2B2T A;  1CHP D;  3ERO A;  2VB3 X;  1ZKO A;  5EKI A;  1HUN A;  1ESF A;  1Z6H A;  2H4O A;  5I9P A;  3N52 A;  3QWN A;  4XT3 B;  1T5E A;  2R92 B;  2EYF A;  2K32 A;  2QEJ C;  4K6D A;  1I3Q B;  3MHB A;  3SK4 A;  3D8G A;  4EQN A;  1JOQ A;  4JBW A;  1I6H B;  3J81 L;  2FIN B;  3M4Y A;  5DEH A;  2SOB A;  5ELF A;  1LO5 D;  2NYZ D;  1CFM A;  1PTO D;  1D6E C;  4B9W A;  3GTO B;  1HPC A;  1F77 A;  4HAE A;  1F9Q A;  5DAU A;  1FNV A;  1ILP A;  4IQZ A;  1B9M A;  2NVQ B;  4NMZ A;  4RGN A;  3T56 B;  1HXY D;  2HCI A;  3GV6 A;  5E4W C;  3PO2 B;  1EU4 A;  1CQF A;  4G7H C;  3R2T A;  4LAA A;  4RHR A;  2EOT A;  2BE5 D;  2NUC A;  5LHY 1;  3IL8 A;  3BS1 A;  2WV6 D;  4IFD J;  1V1P B;  1PDQ A;  1CK1 A;  1QG7 A;  1Q90 A;  2X6L A;  3H0G B;  5COR A;  4CJ2 C;  4BA2 I;  1YNJ D;  1IW7 C;  2CW0 C;  3I4N B;  1EY0 A;  1L0X B;  2F0D A;  4KKT A;  5IGF A;  4Q5V A;  4LMQ D;  2WAQ B;  3IFD A;  4DNT B;  3SHL A;  5G3L D;  4O42 A;  2YU9 B;  2RSO A;  5J1Z A;  3GQB A;  1I50 B;  1SYE A;  1ZEQ X;  5CMD A;  3M7G A;  1KAA A;  1V1O A;  2KHS A;  2NTS A;  1FYC A;  2K5D A;  1WD0 A;  3GTG B;  1TS3 A;  4IFD I;  2XWJ B;  1JOK A;  1SE4 A;  3MXP A;  4A93 B;  1K83 B;  1TWF B;  1B9N A;  4L63 B;  3TME A;  1DOM A;  1CQV A;  2PQE A;  4MIU A;  1LAC A;  3VYU A;  2BOS A;  1XTC D;  1U4M A;  4U67 3;  2PZW A;  5E4X A;  1G29 1;  4H0L C;  3FRP B;  2WKC A;  2O4X A;  3VR2 A;  2DY7 A;  2KUM A;  3FPP A;  3BVZ A;  3RMH A;  4RGO S;  1F2Y A;  2HCC A;  1E0B A;  1LV9 A;  1EY7 A;  3VA7 A;  3TBI B;  3PIO 3;  4DK1 A;  1CA5 A;  1AZP A;  2O5I C;  1PRT B;  1PTO F;  3A55 A;  2F0H A;  4QUC A;  4M1U B;  2IPK D;  5D65 A;  3NQI A;  2WII B;  3FPU B;  5FOB B;  4I7Z C;  3O13 A;  1JCK B;  1KDC A;  3E6Z X;  1RKN A;  3KLS X;  1GHJ A;  4EQP A;  1SYB A;  4ZUI A;  3KLR A;  5EKL A;  4XIG S;  1CZW A;  5CV9 A;  2F0F A;  2O5J C;  3T13 A;  2F0I A;  4ZLT F;  4FO2 A;  1U4P A;  1KAB A;  1JWU D;  4CGY B;  2EXZ A;  1MGS A;  2K5W A;  1S5E D;  5ISR A;  3W3A A;  2D9U A;  3PUY A;  3NQT A;  1XX8 A;  1BCP B;  5CV8 A;  2DN8 A;  1H9S A;  2PZU A;  2F0W A;  3VR6 A;  4KKS A;  1Y8N B;  2F0K A;  3AU7 A;  5G3L F;  4G57 A;  4S3S A;  1ICW A;  1I4R A;  3T16 A;  3GTK B;  1IYU A;  4LK1 C;  3LNN A;  2PYK A;  1C4Q A;  1A3U A;  3HG9 A;  5I2X A;  3M85 A;  3ERQ A;  2AQ2 B;  4A3K B;  3OW7 A;  1Y69 U;  4A3M B;  3BG3 A;  5HGT A;  1KDB A;  2B2W C;  1FGB D;  2ICI A;  1V43 A;  3DM1 A;  1B50 A;  4K5W A;  1YNN C;  4KJN A;  4IUN A;  4K14 A;  1VCI A;  2RDF A;  2IX1 A;  1LTG D;  1K8M A;  1NCV A;  4R8N A;  3NSW A;  2F1M A;  5JAV A;  1SYC A;  5A35 A;  4IFD H;  3JAM E;  5EPJ A;  1KLU D;  4QIW B;  1MSH A;  5IOC A;  1A3T A;  2M00 A;  1S5F D;  1W6J A;  3E5S A;  1EWH A;  1QJO A;  3P7J A;  4RKB A;  3NTK A;  5CC4 A;  1UAP A;  2XRQ D;  1HUM A;  1QNK A;  1DJR D;  1B4O A;  3D3R A;  3EQL C;  1X32 A;  5D3I B;  2KJX A;  2M2L A;  3M7N A;  5IGB A;  3MVV A;  2R3Z A;  2FJ2 A;  3PV0 A;  5LL6 S;  2RBM A;  3KBG A;  1Y8O B;  1B3A A;  2KCC A;  2PMZ B;  1JC7 A;  4DXF A;  2B2W A;  5C6A A;  5FLX E;  1LT3 D;  1GUS A;  2IWH A;  1QB5 D;  1TS4 A;  1QWY A;  3T53 B;  4U68 A;  1WTQ A;  3EA6 A;  1K8O A;  2AUK A;  2XSC A;  1ET6 A;  3HZX A;  3DEO A;  5E1F A;  2OF1 A;  5K5P A;  3A54 A;  2CHB D;  4TSS A;  1B53 A;  4RWS C;  1SSO A;  1PRT D;  2NWG A;  1LT6 D;  4OGQ C;  3Q24 A;  1EY8 A;  3K5M A;  3JAM L;  2D62 A;  4HSV A;  4CKB A;  2A73 B;  2NB0 A;  3AB9 A;  3MXU A;  2L4N A;  4ZKB B;  3BDC A;  4QCL A;  3GD7 A;  3R8B A;  3K6O A;  1BDO A;  4C3H B;  3K58 A;  4FXD A;  4KN7 C;  1F2L A;  2JA5 B;  4TKO B;  1MSG A;  5J22 A;  2EDG A;  1ROD A;  3KK7 A;  4CBV A;  3OWE B;  2BCO A;  1A2T A;  2IT1 A;  3S15 B;  5A2Q L;  3PUV A;  1RJT A;  4F7X A;  1WTR A;  4DN4 M;  3K57 A;  1BCP D;  2F0S A;  1EQT A;  2FMC A;  1TII D;  1D5Z C;  4V19 0;  5FLX L;  1GHK A;  5KYI A;  4Y7N B;  3X3M A;  2BDO A;  1GOZ A;  3L9A X;  2F0O A;  1C48 A;  1TWA B;  2PPB C;  1M8A A;  4RGT A;  2MPM A;  1STG A;  5K36 H;  1M4V A;  4FF3 A;  1DM0 B;  2MGS A;  2XRS D;  1VMP A;  1SYG A;  5ELD A;  3R2I A;  2JEB I;  4ZRZ A;  3OIQ A;  1YNJ C;  5CV7 A;  2B8G A;  1EEI D;  1AFP A;  4FP5 D;  4EVO A;  2LKV A;  1VMC A;  3ITP A;  2K28 A;  3K7A B;  3H6M A;  2RVL A;  3I8Z A;  1TWG B;  4C2M B;  2N88 A;  1SNM A;  1B44 D;  2K05 A;  3TSS A;  4QF4 A;  2QKI C;  1SE2 A;  4DAV A;  2B39 A;  5EQ0 A;  5T1I A;  3CRK C;  2EY2 A;  2EJG C;  3VR4 A;  2I07 B;  4V0B A;  5M3F B;  1LTS D;  2BDN A;  5NUC A;  1IL8 A;  5D3D A;  1O7Y A;  1EYA A;  2LY7 A;  4F88 A;  4RFB A;  3C1E A;  3FVQ A;  3CHB D;  4PMB A;  4L6T B;  3HOX B;  1LTA D;  4LJZ C;  2K1B A;  4A3J B;  4OIK A;  1NAP A;  2EY6 A;  4DA2 A;  5JPN C;  4BY1 B;  5BN3 A;  2K33 A;  3E0J A;  4K6L A;  4XYQ A;  4RHS A;  1Q1E A;  5M5W B;  3PUW A;  1STA A;  1BR9 A;  4EGV A;  2RDH A;  3SXH A;  2N55 A;  5I6W A;  1TU2 B;  2VB2 X;  2K6A A;  1E2W A;  2IL8 A;  5DNF A;  3C3L A;  3SE0 A;  1B2T A;  3DWQ A;  2WP8 J;  5C4X B;  5TSS A;  1O78 A;  1FR3 A;  4J1M A;  4ABN A;  3CKI B;  4RKL A;  1BCP F;  1KNA A;  1CT1 D;  2X69 A;  1PZK D;  2DNE A;  3QIA A;  1Y1W B;  1S5B D;  3HEJ A;  1ZYR D;  1EIH A;  2KEE A;  2E2J B;  1I4X A;  1VF5 C;  3S1M B;  4DAY A;  1BXT A;  1MD2 D;  3SEB A;  1D5M C;  4IFD G;  4FF4 A;  2XWB B;  2R6G A;  5EKK A;  1S5C D;  1HFG A;  2K7V A;  3MZ5 A;  1EY5 A;  3S16 B;  3I90 A;  1HA5 A;  4KMU C;  2QIL A;  2G9D A;  4XDX A;  4QUF A;  4IN3 A;  3KF8 A;  5ELB A;  3EFX D;  3HGB A;  1TY2 A;  4C3J G;  1HQR D;  4N9P A;  4DAP A;  2CQA A;  1H9M A;  2VXW A;  1B1Z A;  3I3C A;  2MJ8 A;  3H09 A;  1EY4 A;  2R93 B;  1EU3 A;  3ONA B;  2XVS A;  4CKE A;  5KRU A;  1A15 A;  1H9S B;  3HS0 C;  2E74 C;  4UDU C;  5EPL A;  1OXV A;  3RZO B;  5JVH 3;  4HR7 B;  4K5V A;  4KK7 A;  4CHT B;  3HOY B;  1F9R A;  2F0Q A;  2A68 C;  4WOR A;  2K5Q A;  1BQQ T;  3QO2 A;  3C2P A;  2YYZ A;  3HRZ C;  2QF7 A;  4KJO A;  4RGM A;  1CA6 A;  4KY5 A;  4C3I G;  1OO9 B;  4X3T A;  1PZI D;  4WFN 3;  1XYI A;  2R61 A;  1H9K A;  2JA7 B;  4KHZ A;  3C46 A;  1IKL A;  5KNC A;  4FNF A;  1CTM A;  5KND A;  2F0E A;  4ME5 A;  1NR2 A;  2ZXO A;  4ZYS A;  5HUR A;  2C9O A;  3K5L A;  1AP0 A;  5C3E B;  4FXG C;  1RHP A;  3I70 A;  2BA0 A;  1U4L A;  2A6H C;  2RQX A;  3P20 A;  3S1Q B;  2E2H B;  1LLR D;  3TZU A;  4XQN A;  4DK0 A;  4DNR B;  1A2U A;  4XQJ A;  4KHV A;  5EGT A;  3QOL A;  2A6E C;  5I9O A;  2EYO A;  3A7A B;  3I73 A;  3DMU A;  5FK9 C;  4OO1 G;  1TKW B;  1LTB D;  5CGK A;  3I4L A;  2IX3 A;  1TS5 A;  3A8I E;  1KTK A;  3MXN A;  1ENC A;  1IW7 D;  1TT2 A;  2CW0 D;  4IAL A;  2KVM A;  1E2V A;  1RF2 D;  5K36 G;  5JOB A;  2X6G A;  3K59 A;  1Q8I A;  2K03 A;  1Y8P B;  1EYC A;  1XWE A;  5D14 A;  2O2L D;  1STH A;  2D5D A;  4JK1 C;  1SNQ A;  2IX0 A;  2JXM B;  5C4J B;  1UUP A;  3BDO A;  4K8J A;  4OO1 I;  2Z8L A;  2QCP X;  1JB3 A;  4ZAI A;  3PMF A;  1VF7 A;  1X3Q A;  3VA5 A;  3S14 B;  5JJZ A;  4RAU C;  1I6V C;  4MN3 A;  4HCE A;  5KGU A;  3GTM B;  2D2C C;  1QCB D;  1SMY C;  2A74 C;  1DXM A;  5C0X J;  2TMP A;  1C8C A;  1LAB A;  2L55 A;  4HMJ A;  2EE1 A;  4PQX A;  3IFT A;  2F0P A;  2EYH A;  3L3O C;  2F0L A;  4J6H A;  1OXU A;  3W2D A;  3MAQ A;  3K5N A;  4H13 C;  3H3V C;  4K8I A;  2ID0 A;  3DEP A;  5ELE A;  2M9V A;  1LTR D;  3PO3 B;  3HKZ B;  4KV6 A;  4ILW A;  2PNR C;  1STB A;  2A69 C;  2L12 A;  2K01 A;  4IUV A;  3RD4 A;  3SDZ A;  1VDZ A;  4DFA A;  3J7A V;  4HSP A;  1TWH B;  1JE4 A;  1DON A;  3NK9 A;  2Q8T A;  1DZ1 A;  5C0X I;  2B8F A;  1SYF A;  2XN9 C;  3K0Y A;  3VYR A;  1MI2 A;  3RUZ A;  3J7Y W;  3KUP A;  3OMC A;  3D31 A;  4WRD A;  3NHH A;  2LMC B;  4IUT A;  5C3W A;  3A8J E;  1SDF A;  1EZ8 A;  5CBE E;  3OHX C;  1BOS A;  1ZXT A;  2ENB A;  2HDM A;  1EEF D;  3NUC A;  2RKS A;  4NDX A;  1JWM D;  1H9R A;  1Q1B A;  1EY9 A;  4ZKC B;  5KEE A;  2Q8I B;  1NR4 A;  1WVL A;  1WD1 A;  5KNB A;  2EY5 A;  2F3V A;  2L11 A;  2A5H A;  3OPO A;  2KOL A;  4FVM A;  2IW3 A;  3I4M B;  3FKI B;  5EPK A;  1RTN A;  1QE6 A;  4PMW A;  5J39 A;  2XNA C;  2WAC A;  4DU9 A;  3GO5 A;  5CV4 A;  3PIP 3;  1EYD A;  3EJI A;  4X3S A;  5IOD A;  1NSN S;  2NZ1 D;  1KLG D;  2EYM A;  3C1F A;  2BA1 A;  2XIW A;  4IUP A;  1II3 A;  2GA4 B;  2F0G A;  3WOE A;  1PTO C;  3URY A;  5FO7 B;  3H94 A;  1I4P A;  3GV3 A;  1H9J A;  4OO1 H;  3T51 B;  1BUV T;  1YNN D;  4A3D B;  2MP1 A;  1QNU A;  4R8I A;  3M4O B;  3P1H A;  1O7Z A;  1PFN A;  3NP8 A;  1EY6 A;  2HUG A;  2RDG A;  3Q23 A;  1SXT A;  3VYS A;  1ILQ A;  1FNU A;  3V2T A;  5M3M B;  5C4Z A;  2BE5 C;  3S9W A;  3KBX A;  1GUW A;  1LT5 D;  1STN A;  5I4D A;  3DWA A;  1F2Z A;  1GUG A;  3OSO A;  4RCO A;  2WIN B;  4KY7 A;  1ET9 A;  2VUM B;  1F2M A;  1BF4 A;  3J81 E;  1S5D D;  2Z4I A;  4KKU A;  5C5M A;  1HFN A;  2NBF A;  3LWU A;  5IGG A;  2OXP A;  3ND8 A;  4CKC A;  1PZJ D;  1GXD C;  3TDQ A;  1Z47 A;  4Z9C B;  1SNC A;  3DWP A;  1R4Q B;  4OHJ A;  1OXS C;  5JEA J;  1J8I A;  2E2D C;  1Q12 A;  3OMG A;  2MUY A;  4FF1 A;  2EYJ A;  2OT2 A;  3Q22 A;  5C0X H;  1CM9 A;  5EBC A;  2PW5 A;  2KA7 A;  5F2D A;  3A7L A;  3MC0 B;  4CJ1 B;  1J9O A;  1TWC B;  2B2V C;  4IUU A;  4MHE A;  4TRD A;  1BBX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...