2HCIA

Structure of human mip-3a chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
SNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A20
publication title Structure of human MIP-3alpha chemokine.
pubmed doi rcsb
molecule tags Immune system
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2hciA00
1U4PA 1F9RA 2MP1A 5DNFA 4HSVA 1DOKA 2HDLA 4CJ0B 1CA6A 1WD0A 2NWGA 4MN3A 5D65A 1O7YA 1GUWA 3DEPA 5D14A 1ILQA 1M8AA 1WTXA 3MTSA 4XDXA 1WTPA 1QNKA 4DN4M 4R8IA 3KUPA 1G6ZA 3FPUB 1VMCA 1DONA 4MHEA 4U68A 2EE1A 1WTVA 4IUUA 1NR4A 1ILPA 1HUNA 1MSGA 2K04A 1G2TA 5EKIA 1B4OA 4X3TA 1B3AA 4ZKCB 5CORA 1B53A 2DY8A 1E0BA 2N55A 4IURA 1ICWA 3H91A 1G2SA 2X6LA 2VXWA 1U4LA 1U4RA 2K01A 2MPMA 5EQ0A 5CBEE 1BO0A 2KOLA 1PDQA 1WTQA 1HRJA 3FDTA 1EL0A 4HCSA 4X3KA 1NCVA 2K1BA 1ML0D 2L4NA 4IUPA 5COYA 5EPJA 2B2WA 2RSOA 2KVMA 1J8IA 1PLFA 3P7JA 3SVMA 2B2TC 1WTWA 3TN2A 1XX8A 1KNEA 2L9HA 2N88A 1F9SA 1RHPA 1NR2A 2EPBA 1LV9A 1VMPA 1ZXTA 3DEOA 3I91A 1IKMA 2B2UA 4QUFA 1Q3LA 5E4XA 1C8CA 1HA6A 5T1IA 1EIGA 3I3CA 1AZPA 2HUGA 3DM1A 4ZKBB 2RVLA 2B2WC 1AZQA 2R3ZA 1CM9A 4HEDA 1JE4A 1MI2A 3MWYW 2NYZD 2B2TA 2SDFA 1DOMA 1WD1A 3I90A 3UI2A 1HFGA 4IUQA 2MJ8A 1RODA 3R93A 2K03A 3N52A 1NAPA 1O80A 1RTNA 1QE6A 1F9QA 2J7ZA 2X6GA 3LWEA 2B2UC 3GV6A 2FJ2A 2Q8TA 4RWSC 1BNZA 4XT3B 2IL8A 1SSOA 1BBXC 1G91A 2MGSA 5EPKA 1MSHA 2HCIA 3IFDA 1KNAA 2EOTA 1PFMA 4HAEA 1EQTA 2KEDA 2K05A 4IUTA 2FHTA 5CBAE 1IL8A 4RAUC 2KECA 3IL8A 4UAIA 2KEEA 2BDNA 1JICA 1X32A 2H1EA 4ZLTF 3TZDA 2RSNA 1PFNA 5T1GA 1EOTA 1WTOA 3Q6SA 1AP0A 2XIWA 2DY7A 2L12A 5AFWA 3QO2A 1X3PA 3KBXA 2K28A 3G7LA 5JJZA 1DZ1A 2X69A 2D9UA 2B2YA 2NZ1D 1MGSA 2JYOA 2HCCA 4RA8A 1SDFA 4R9WA 5EPLA 4ZK9B 4CJ1B 1B50A 2HDMA 5E4WC 2B2VA 4OIJA 1EIHA 3D6WA 1U4MA 4XT1B 1F9PA 1RTOA 4LMQD 3ONAB 1BF4A 1QG7A 2Q8RE 4X3UA 4IUVA 1CA5A 1PFBA 1SAPA 1J9OA 1TVXA 2FINB 2M2LA 1DOLA 2RA4A 1ESRA 1O7ZA 2B2YC 4CJ2C 3GV3A 2L1BA 4ZAIA 1WVLA 2CVRA 1B2TA 4O42A 2FFKB 5CMDA 2B2VC 5EJWA 3HP3A 1S4ZA 2KUMA 1IKLA 2FMMA 3F2UA 1XYIA 1HHVA 2JP1A 1WTRA 3I8ZA 4OIKA 4QUCA 1A15A 1RJTA 4NW2A 1X3QA 1HUMA 1HFNA 2L11A 4X3SA 1F2LA
chains in the Genus database with same CATH superfamily
2BOSA 2KENA 2XSCA 3GTLB 2R6GA 5FO8B 1KQSA 3TQYA 2EJFC 3J80i 4ME5A 1VQAA 2ENBA 4DN4M 3HOXB 1G6ZA 1RCVD 1NSNS 4U68A 5BR8Q 4U673 3U9SA 3MFGA 1OTCA 2CQAA 1SE3A 1G51A 2N55A 4JOIA 2WAQB 2EY6A 3E3XA 3CQZB 2CQOA 1BO0A 1PDQA 1Q12A 1S5ED 5E1FA 4K8JA 2B63H 1EL0A 4QGUA 4UP8A 2K1BA 1VQPA 1GOZA 1KDBA 5BN4A 3TN2A 2F0DA 4HJ8A 1F9SA 2RDHA 1HNZL 3MEFA 1IKMA 1VF5C 4EQOA 4A3EG 3E9IA 1HA6A 3URYA 1E2WA 1BCPB 3QB3A 4PQXA 4KY5A 5KNCA 2XN9C 1Q90A 2K6AA 4K0KQ 4NMZA 1GD7A 2HIVA 5JJKA 1H9JA 1Z6HA 3K7UC 5JEAG 1K83B 1BVSA 4DK3C 2KEDA 2F0JA 1VQCA 2E74C 1EY5A 3BZKA 4H0LC 5DM73 2UUAQ 1Y1VB 4IFDH 1EOTA 2UU9Q 3VR4A 2L12A 1QWYA 3G7LA 2BCOA 4HTHA 4DUZL 3S9WA 2PQEA 1N8RC 1HNWQ 4HR7B 3G6EA 4LF7L 4X65Q 4XQNA 1BF4A 2XRSD 4KHVA 3M4YA 3U4ZA 1QOHA 1H9SA 3BZDB 1D5XC 4JI3Q 5CV9A 4ID6A 2VQFL 1XJVA 4Q0FA 4ME3A 4BBRG 5IWAQ 4A3KB 2F0WA 5FO7B 1HUMA 1HFNA 3CCJA 2EY1A 1VF7A 4KJOA 4R1JA 4A4IA 2R7DA 3M4QA 5K36H 3UE0A 5C5MA 4GOPC 1WD0A 5AJ3Q 1O7YA 2R93B 5IGGA 5I9PA 4R8IA 1VQ8A 3HOVG 1STGA 3I4OA 3TDQA 4JI6Q 1SMYD 1B3AA 1E24A 1HNXL 1NTGA 2CHBD 1LTAD 1PTOH 2UUBL 1ASZA 5IP7H 2K01A 3M4PA 4ZCKA 4DAMA 4XQJA 1LTBD 1LABA 2F0LA 4BY1H 3KF8B 4DAVA 4IUPA 1STEA 5EPJA 1E3PA 3S2DH 3BDLA 1WTWA 5LMNW 3J7A5 2RBMA 1PH3A 4MTNA 3C46A 4QUFA 2QDLA 1QCBD 2ATWA 4C3IG 3GTGB 2KBNA 3QWNA 1LT6D 4JI0L 3WOEA 3I90A 2ZXRA 3B6YA 5C3XA 1N34Q 4JI5L 5E3FA 2Q8TA 5L37A 1D1IA 1N36Q 3IFTA 1SYBA 3CPFA 3Q24A 4GKKL 4QF4A 3VR5A 1XMQQ 2EOTA 5TSSA 2K05A 4TKOB 3PO3B 2H1EA 2RDFA 5JJLA 3KF6A 5JJZA 1EFWA 2D9UA 4GOPB 1JB3A 1I3QB 2R7ZH 3NBHB 1JB7A 3T4AC 4LF4Q 2F1MA 4A3IB 3D6WA 3NE5B 4XT1B 1PH1A 4A3GG 3TZUA 1X55A 1TS4A 3F8TA 4DR1Q 2A1AA 2FINB 1SE2A 2D5DA 1YEZA 2B2YC 5M3FG 3L7ZC 3AMUA 2L1BA 4JI1Q 2HQEA 4O42A 4RCNA 3AQQA 1WCMB 2PO4A 1CFMA 2N49A 1YITA 1XNRQ 3CAMA 5EKLA 3A0JA 2K52A 1JCKB 4PZ7A 1Y1WG 4DV6L 3TBIB 1LYLA 4HSVA 2OQ0A 4ZUIA 2NBFA 1N32Q 3H0GH 5D65A 1YIJA 3RR5A 5ELFA 1M8AA 3D0FA 3QOJA 1D5MC 3M3YB 2YU9H 2D62A 3A5ZB 1ILPA 2Z4HA 1CHQD 1B8AA 2CH4W 4JG2A 3STBD 1LT5D 4MIUA 4X62L 2NTTA 3J7AV 3MA2B 3SDZA 3AU7A 5M3MH 4A3CG 3I4MB 3T1HQ 2MO1A 1VQ5A 4LWCA 1QVCA 4GNXC 4HIKA 4YY3L 1PLFA 2VUMG 3NWTA 3BU2A 2N88A 3NTHA 1VMPA 1UE7A 3DEOA 4ZQ3A 2I5HA 3A8JE 4DNIA 3RZOH 1C8CA 2IJ0A 1H95A 3I3CA 2BH2A 3T16A 2B2WC 5IGCA 1XMOL 1ET6A 3MWYW 1DOMA 1UE1A 5EAYA 1C7YA 1IBKL 1A8VA 2PNRC 1DD2A 1QE6A 2WV6D 1N33L 1SYDA 3R2TA 2QF7A 3H3VC 4IPCA 4JI2Q 5C3EH 5IP9H 1YNNC 4BS9A 1X32A 4P75A 1HR0W 3HOWB 4JI4Q 2VY3A 1K28A 4B3TL 5C4XB 1S5FD 2AMCB 2HCCA 5IT9L 4DPGA 2ID0A 1QG7A 3NWSA 4DR6Q 4A3BB 5IY0A 1JMCA 3T1YL 1FGBD 1S5BD 3FKIG 3L3OC 1EYDA 4OX9L 5ELBA 3RN2A 2E5LQ 4IUNA 3BS1A 1KL9A 1HPCA 1S40A 4FXDA 2KUMA 3O13A 1TQOA 3HZXA 3I8ZA 4XTCS 1EWIA 3IRBA 4C2MH 2MP1A 4GNXB 3GTJB 3WWVA 2AWNA 1GKHA 3D4DA 3NPPA 1G291 3J81j 1GHJA 3SR1A 4DA2A 2ZT9C 2XGTA 3S15H 2G9DA 2AKWB 5C44G 2YYZA 4Y52H 1EY6A 1E1OA 5GROA 1B4OA 1KABA 2CH4A 1DM0B 1JORA 4B9WA 1L2FA 1VQFA 1EYGA 1KRTA 2F0SA 3KDFB 5C4JH 5GADC 4H13C 2PZTA 3EA6A 1UNSA 2PW5A 4IFDJ 4KKSA 4KY7A 3J81L 1TT2A 1RKNA 4X64Q 4K5XA 3U9OA 2KCCA 5D3IB 3RD4A 3SGIA 3GTQH 5COYA 4A3EB 2NVTB 2KVMA 3NTKA 3SVMA 1BBUA 2KA7A 3S14H 2ZJRA 5I2YA 2JK8A 4ZUJA 1HNWL 4XQQA 1O7LA 5IYBG 4DV1Q 4X65L 4HJAA 2R93G 1W2BA 4HEDA 2QGQA 3K5LA 3KF8A 1T9HA 5M5YH 1V1PA 2ZTCA 1QZHA 1GVPA 2K03A 2HD3A 2WFWA 3FVQA 3NBIA 4B3ML 1WOCA 2Q8IB 4DAPA 1LTTD 2GN5A 4L5SA 3NUCA 3U4VA 2MGSA 3L0OA 2PNHA 4XYOA 1KNAA 1RIPA 1ZKOA 2TMPA 3NXWA 4IJHA 5IWAL 2DUDA 1VQ9A 1X6OA 2D2CC 4UAIA 2KEEA 4DR3Q 2ZM6Q 4DV5L 2Z9HA 4LFBQ 1E2VA 1X3PA 5AJ3L 3E0JA 4M1UB 1X54A 4UDUC 4PNYA 4PV1C 4FP5D 4LK1C 3CD6A 3W2DA 3ONAB 1KIXA 4BBRB 3KLWA 1I94Q 1LO5D 3HGBA 2RA4A 4YCUA 2IHFA 1N9WA 3EIVA 4BY7G 3HOYH 3GTPH 4GOPA 3HOUG 3U50C 4UY8C 3OIPA 3S1RB 1SNPA 3NBHA 1VQEA 4IOAA 3JC66 2B39A 3CP0A 1VQHA 3V96A 2E8GA 1K3RA 3HOVB 2KQ3A 3S16H 3F2DA 3TS2A 2BH8A 1K8MA 3VR3A 3KJOA 5J39A 3M4OB 4KHZA 3F1ZA 5EBCA 1DONA 1NNXA 2NB0A 1YI2A 4CGYB 2V4DA 4DV0Q 3QJYA 4NB3A 4G7ZC 2MUYA 1MKHA 3K5OA 3HOXH 4HSPA 2OF1A 2X6LA 2I0QA 1I4PA 3C2PA 4NXMQ 1SNOA 4UP7A 2DJGC 1JWSD 2F0VA 1XMQL 3BJUA 2F0MA 1ML0D 1IW7C 1NMGA 4DNRB 3CQZH 2RSOA 1J6QA 1EOVA 2MHVA 2B2TC 4DR5L 4C3IB 4BBSB 3L2PA 1RDPD 5EBDA 1HCZA 2QILA 1FVIA 1XTDA 5E4XA 5C0XI 3GDEA 4IFDG 3K7AH 2R92G 1G6PA 5M5XB 2JSOA 2EYFA 1PH4A 4KY6A 1V9PA 2QEJC 2A8VA 4DUYQ 1M90C 4YIJA 2FMCA 4ZYSA 4IPDA 5C0XH 2G9HD 3A8KE 4DR7L 1K9MC 1S72A 4LFCQ 1G91A 5EPKA 1VQGA 5HURA 3I72A 3GTKB 4AIMA 1TWGB 1A2UA 5J1ZA 1XNRL 2ICIA 1VQ4A 1JJ2A 4OWXB 3BVZA 1STAA 3S2HH 1SMYC 4J1MA 4DV3Q 1GHKA 2BDNA 2K50A 3U58A 4DR4Q 1W6KA 1LTLA 4A3GB 5JJIA 2ALYB 2B2YA 1Y1VH 1I50H 4RKLA 5M3FB 1B50A 5C3WA 1VQIA 1W6JA 2YV5A 4H7BA 4M8AA 4OIJA 4P74A 2QW7A 1Q8IA 4EQ5A 2NVYB 1PFBA 2F0UA 4IJLA 2LMCB 4LF8L 1WI5A 3RLFA 1B2TA 1Y1WB 3RMHA 1UEAB 4DK0A 5CV8A 3F2UA 3GQBA 1XPRA 4BA2I 3T1HL 1XNQL 1HQRD 1B3QA 3M7GA 3OHXC 2PZUA 2NTSA 3S1NH 4BY1G 4LW1A 4OWWB 3SK5A 2HHHQ 3GO5A 4B3SL 1GUWA 3I7FA 1A3TA 2A6HD 2NZHA 2VB2X 3BYYB 3K0YA 5C4XG 3OIQA 4IUUA 4QL5A 3NSWA 4DXGA 2WP8J 1G2TA 2K75A 2AQ2B 4LUOA 1EUJA 1B53A 2ICEC 4YHHQ 5IT9c 2E76C 4JI2L 1D2BA 2RHSB 5M5WH 3CC4A 3MEHA 1V1QA 2F3WA 3EBEA 1NCVA 3OWFA 2SOBA 2A69C 2JXMB 2B2WA 2ASBA 2E2DC 5I9OA 4R4OA 4CBVA 4NDXA 3VYUA 3KDFA 2OT2A 3AFQA 5CYUA 2O4XA 1XTCD 4DV7Q 4DV2L 4TRDA 4XYQA 4JYAQ 4JBWA 2JA7B 4LUZA 1X65A 3UDIA 1EIYB 2B2UC 1EWHA 3BG3A 1SLJA 3CMAA 4IOCA 1PRTF 4IUTA 3DHQA 1L1OC 2O5IC 1HJPA 3VA7A 3J81c 2RSNA 4E6IA 3M9BA 4UPAA 4L5QA 4CDCC 1PH8A 1QZGA 3FKIB 5C6AA 3PO3H 3BVMA 3UE1A 1BXTA 1DJRD 3HG9A 4KMUC 3CCRA 4A93G 3N6RA 1KAWA 2IX3A 1F9PA 1YNJC 3VR2A 3I4NB 1MIUA 4RGTA 4C3HG 2LKVA 1XWEA 1I3QH 1LTRD 2ZXPA 3GV3A 4A3IH 2CVRA 3EN2A 1PRTD 3HKZG 4LFAQ 3PUWA 2FMMA 4IO9A 1IYJB 3CC2A 2VNUD 2WIIB 1A15A 3I4LA 1KC8C 4NXNL 1GUSA 3C1EA 3K5MA 3QIAA 5C44B 5M3MG 1QUQB 1KLGD 2EYPA 2JA5G 3KK7A 1EY8A 2XTIA 2XRQD 2VW9A 1FNUA 4A3FG 1HZBA 1ZYRC 5KIXA 3RZDH 2QDBA 1HUNA 3V2TA 2Z6BA 2F03A 1D6EC 2JE6I 1UAPA 3SEBA 4RH6A 3CCVA 4LF9Q 4FVMA 4H02A 3DM3A 2DJFC 2YTXA 3CHBD 5H1SE 4RGMA 2QEXA 1L1OB 5C3EG 1SBBB 4DR3L 1AW7A 4X66L 1PYSB 1D8LA 3H15A 3RLOA 5IP9G 2K5WA 1CSQA 3TREA 5JPNC 5FKAC 3Q8DA 4Y7NH 1EIGA 2OQKA 4ZKBB 3PGZA 5BN3A 5FO9B 5LL6X 4K5VA 3GP7A 2BA0A 2G5DA 5FLMG 2TSSA 3KLRA 2VQEL 3I70A 4AYBG 4A3JH 2WKDA 2J7ZA 4OONA 1DGSA 3GTOH 1TWHB 3DLLA 3VA5A 4KJNA 1SE8A 4IALA 4UP9A 1X3EA 2SNMA 3MAQA 1H9RA 4JV5Q 4G7HC 4RAUC 3IL8A 4QMGA 1TWCB 1WTOA 2JQOA 4A3LH 2O2LD 4QB4A 3Q6SA 2EIFA 4KLKA 3ZYYX 3X3NA 5J22A 3S1MH 1CZGA 4BBSG 1DZ1A 4L5RC 2NN6G 5LMUQ 4HJ9A 4DR2Q 1IL2A 2ZTDA 4RFBA 2JYOA 3ULLA 2J4XA 1BCPF 3J7AF 3PMFA 4BY7B 4KD4A 1KLUD 3PF4A 1J5EQ 3HOWH 3HOUB 4X3UA 2A6ED 3MC0B 1ESRA 1TWAH 2E2IB 3HOZH 1EEFD 3W5OA 2B2VC 4KHPQ 4NXML 1XPUA 5GQOA 1OXXK 3OYYA 3JAME 3FRPB 4A3BH 4LAAA 2UXDL 3E5SA 1VQKA 4PZ8A 2YTVA 4P72A 4G57A 4KV6A 1JWMD 1VQ6A 2HT1A 1BDOA 4X3SA 3TP5A 1BCPD 4FF3A 2MQHA 1FD7D 4DGZA 3AB9A 1E22A 1U9RA 4PMWA 4DKAC 3J7ZC 4XDXA 2UXCQ 1JJCB 2AHOB 1KD1C 2FXQA 4JBKA 5FLXL 2EYMA 2ZJPA 3A54A 5IT9E 3NELA 1ASYA 4BA1I 2CFMA 1PTOC 1PYWD 1Q1BA 1TY2A 1EY4A 4F8MA 4HIOA 3H3VI 1TU2B 5KNDA 4OL7A 2PPBC 5JVG3 2KOLA 4KK7A 3NENA 1HA5A 4F88A 1H9MA 2RKSA 4K6DA 2L4NA 3GTMB 4GKJL 2SNSA 2F0TA 2R92B 4OO1G 3H3VH 1EIFA 2F4IA 2JA6G 2RHQB 4KN4C 1FGUA 1DXMA 4A3MH 5IIFA 4LF5L 3HKZE 1P8LA 2NVTH 1CK1A 3LGJA 5T1IA 1KAAA 1EEID 5HY6A 4G4KA 1MI2A 2KJXA 3ULPA 3R93A 4CDDC 1NAPA 1YHBA 3I55A 1YZ6A 2EXDA 1BR9A 3ND9A 5JEAH 1IBMQ 1MSHA 1VQBA 2K5QA 3F2BA 1OXSC 3J81E 3CMEA 1EU4A 2Z1CA 3PQIA 2P5ZX 1FNVA 4CKBA 3K81C 5KNBA 1NBWA 2HHHL 3D3RA 1Z9FA 5KGUA 1R4QB 5EPLA 4TSSA 4XIGS 1KDCA 3ER0A 3UDXA 2XVSA 3A7LA 2UUCQ 5CV4A 4LUVA 3JAML 2LS01 1FJGQ 2K32A 2F4VQ 4B3RL 4PZ6A 2LFNA 4RKBA 2JA7G 1PTOB 2LSSA 1A63A 3G71A 1WVLA 3CU7A 1STNA 1TS2A 2FFKB 3K5NA 1S3OA 3CXCA 4LF6Q 4BY1B 1EZ6A 1CT1D 3VR6A 1SYEA 4OIKA 3ULJA 1AE3A 3S2DB 3S1QB 1MHWC 1CZWA 2JEAI 1LLRD 4AQYQ 4AYBE 2IY5B 4CKEA 3EJIA 4O2DA 4JI7Q 4RHSA 3CC7A 3WOFA 5BR8L 1WTPA 1YHQA 2Q2UA 4RMFA 5IYDH 1JJGA 1A0IA 1HH2P 5JPMC 3I4NG 5GAEC 3M4OH 3KFUA 4O1NA 1QUQA 4IURA 1SEBD 2CWAA 1B44D 2K5DA 1A3VA 2VXWA 3VDYA 3H09A 5FOBB 2EY5A 3Q22A 3KOJA 2EZVA 1GUOA 4DFAA 4DU9A 1TKWB 1AN8A 1CUKA 1V1OA 3MXGA 4HIMA 4EGVA 1BBWA 1YBYA 4N8FA 4J15A 5I6YA 2OEOA 3S17B 1BKBA 2GVBA 2B2UA 1QVGA 3IKJA 1CTMA 1I4HA 2DGYA 4C3IH 3BZCA 2RVLA 3T13A 2CW0C 4RGOS 4K0KL 1HNZQ 5DEHA 3RLNA 2SDFA 1WD1A 2KCNA 4WFN3 1L1OA 3TRZA 3EQLC 3N52A 4H44C 3K6OA 3RUZA 3PIOA 1BNZA 2DNEA 4A3DG 2F0HA 1RL2A 4JBJA 3S24A 2NVXB 2YTYA 2UUAL 1A2TA 1TWFH 3LWUA 2PYKA 2OXPA 5ELCA 2UU9L 1SROA 3D4WA 1G8ZD 5CBAE 1JE5A 2A73B 1ENCA 2QA4A 1EY9A 3PO2G 1L0WA 4A93B 5G3LD 3H0GB 4C3HB 1MJEA 3G48A 1K8AC 1AH9A 2L55A 1WTHA 1SDFA 4KD3A 2Y0SG 1F2ZA 4DUZQ 1E1TA 3HKZB 4JI3L 5EKKA 4A3GH 2OCEA 2JA8H 4MNOA 3DWAA 1CA5A 4EQPA 1JR0D 4CJ2C 2F0KA 4OXPA 1HZCA 2BDOA 5M3MB 1A3UA 2F0IA 1IKLA 2KHJA 2JA5B 2JP1A 1EY7A 3NQTA 3W1BA 4V0BA 4YWKA 2VQFQ 1Y1WH 5FJ8G 4A3FB 3J80c 4C3JH 3RZOB 1HR0Q 3NQIA 3DEPA 1IYUA 2IT1A 3C1FA 3RN5A 1I6HH 4JI6L 1SNCA 1IHZA 1MSGA 1DYQA 2E2HB 2DY8A 3P75A 2Q2IA 3DUZA 5C3EB 3WDNA 1NUCA 1NJIC 2R61A 1VQMA 1HNXQ 3L9AX 2WKCA 3W3AA 2B63G 4LNQA 3FPPA 2VUMH 4I7AA 5KYLA 1Q7YC 3CF5A 1C0AA 3VYRA 1WYDA 1B9MA 2C35B 3GTLH 5C4ZA 3HRZC 3PUXA 4GZYC 3MXNB 5LMUL 1H9SB 4DR2L 4AYBB 5F2DA 4V190 3FEWX 5BN5A 2R3ZA 1N34L 1II3A 1CI3M 3UI2A 1HFGA 1N36L 1D5ZC 1SNMA 1HZAA 1RTNA 2EXZA 1YNXA 2JJQA 4JI0Q 1Y8NB 3K58A 2IL8A 5FLXc 4F7XA 4KHPL 4BWGB 1QNUA 1GJXA 4JI5Q 1EQRA 1TS3A 1PH5A 3CCMA 1F2MA 3MXPA 5NUCA 4GKKQ 4IN3A 1YJNA 4LF4L 1LTGD 2VS1A 3S15B 1S5CD 3HKSA 1LT4D 2UXCL 1C4QA 3IAYA 4DR1L 2B2VA 1EQQA 4Q5VA 4GN4B 4YWLA 5CV7A 4JI1L 2WB1G 2EYJA 1J9OA 2M2LA 3MVVA 3R2IA 4FNFA 1WFQA 5I4DA 2QCPX 4QQBX 4I65A 3AEVA 1YNND 4LJZC 4JPBW 1K83H 5A2QE 1HHVA 1NY4A 1KHIA 1N32L 1RF2D 2Z0SA 2EQSA 1TR5A 2L11A 3DXJC 5I6WA 1IYVA 5HGTA 4UHVA 3E0EA 3F2CA 1CQVA 1UEBA 5EGTA 5K36G 2A19A 1B9NA 1B7YB 2NWGA 1LTID 2IX1A 1ILQA 4DV6Q 2L0CA 5IYCH 1FR3A 1VMCA 4P73A 1V43A 3KLSA 4CKCA 3BYTB 1JQYD 4GLAC 5IGEA 2PMZE 4TVAB 4PMCA 3QG1A 1T5XD 2QKIC 1NMFA 2NUCA 3I2ZA 3JAMc 4CDEC 5IP7G 5IE8A 3TP6A 1VDZA 2JA6B 1F77A 3M85A 2EJMA 2K5NA 2A74C 2Y0SE 1RD9D 3KYHC 4A3KH 4B9XA 5K5PA 1J8IA 1MJCA 4R4IA 4A76A 2Z4IA 1K73C 1SJHD 1K0RA 1KNEA 1GO3E 2NVQB 2CKZB 4YY3Q 2EJGC 2R93H 4A3LG 1AZPA 2L15A 1HTPA 5ELEA 1TXYA 3G4SA 4GNXA 1AZQA 2UUCL 4WJWA 1H9KA 4HMIA 1FJGL 1F2LA 3K8AA 4ABNA 1BCPC 1RODA 1TS5A 4JCVE 1XMOQ 3AYHB 4R4QA 2B8GA 4XT3B 2UXBQ 1SSOA 1IBKQ 1BBXC 3EFXD 3BDOA 4GN3B 1D7QA 1QB5D 3HOZG 1TWHH 4PG3A 4JI4L 1EYCA 4R8NA 1JC7A 1Y69U 3TZDA 4O0AA 5T1GA 3T51B 3PIO3 2Z6KC 3S16B 1Q46A 2K33A 5AFWA 3KJPA 5C5LA 4JI7L 1R9TB 1R4PB 4RA8A 4CJ1B 1TWCH 2R7ZG 4DR6L 5E4WC 4B3TQ 1OXUA 3GTGH 2K4KA 2E5LL 5A2QL 5CV5A 4F87A 3MHBA 2IPKD 4L8JA 1PZJD 4BY7H 2F0QA 1FNWA 1E2ZA 2PQAB 4DAYB 3HOUH 2JN4A 4K6LA 4N9TA 5KYIA 3T1YQ 2XWJB 4OX9Q 3STBC 4QUCA 2E2IH 1A62A 3J80E 4IQZA 1T5EA 4K8IA 1JOQA 3MZ5A 2HDLA 4I7ZC 3H0GG 4RHRA 1SRUA 3TS0A 1C9OA 3MTSA 3K7AB 1FYCA 2E75C 3PF5A 1QVFA 3SHLA 1LT3D 1ENAA 2M9VA 2IW3A 2EE1A 2J0TD 1K3BC 4A3MG 1SFOB 1X3FA 4X3TA 3LX0A 3EVQA 5D3DA 5JVH3 3NP8A 4X64L 2E2JB 4EVOA 3H91A 1G2SA 1JT8A 1YVCA 4AH6A 2N78A 3TP7A 4HJ7A 3KLSX 1WCMH 1GM5A 1WTQA 3S2HB 4HCSA 1O7IA 2F0OA 4IFDI 3ZJYC 3A56A 3PUZA 3AFPA 2WB1E 4RGNA 4DV1L 1VQNA 2HQLA 1RHPA 5GAHC 3I91A 4NKLA 3ND8A 1I50B 3GTMH 2R92H 4A3DB 3M3YH 1KRSA 2PCFB 1YHAA 2NYZD 4QJFA 4FYDA 1SE4A 5FLXE 3GV6A 2FJ2A 2EYLA 4RWSC 2PMZB 1IW7D 3PO2B 3DWQA 3MXNA 4S3SA 4B3MQ 2HCIA 1Q1EA 2Q2HA 1I4QA 2ZM6L 1X9NA 4LFBL 4HAEA 3A8IE 1SN8A 3I4MH 1LTSD 3T56B 1BQQT 2KECA 3S1NB 3W1GA 1Q86C 2Y0SB 1AP0A 2VL6A 3G6JB 3KBXA 2K28A 1UWVA 4FXKC 3SK4A 1HR0L 4YWMA 2AWOA 4DV5Q 1XPOA 4L5TA 1Z47A 4HJ5A 1I94L 4DV4Q 3OPOA 4CDFC 2RDGA 2BE5D 5JAVA 1SAPA 3J80L 5IYDG 5ELNA 1KTKA 2IHEA 4ZAIA 2A68D 1CKNB 5M5WB 3OOCA 4NP5A 1IBLQ 4WJ3M 1STBA 3HS0C 3D8GA 1XYIA 3TSSA 3JAMi 2MNAA 2WINB 1PZKD 1X56A 3PIPA 4KI0A 1PH6A 3UDGA 1V1PB 4K2LA 3S1QH 5D14A 1PVOA 2B8FA 4QIWE 2LXJA 5C4XH 4APVA 4FF2A 4BXXH 4DV0L 4MHEA 4N8X1 1NR4A 1MBYA 3ERQA 1PH7A 2MFIA 2I5MX 3CCEA 2K5HA 4FF4A 5EKIA 1K8OA 4ZKCB 1A6XA 2B63B 5ELDA 1PZID 4ZRZA 5CC4A 3C3LA 5I2XA 4YCWA 3DMUA 4DNTB 3HEJA 1U4LA 5DM63 1PHJA 4FXGC 1ONLA 4OELB 4POGA 3MXUA 1SR3A 1VS0A 5A35A 2VZAA 3FDTA 2PI2E 2DNCA 1JOOA 2O5JC 5KEEA 5C0XJ 1IXRA 4JC0A 3GTJH 3CRLC 2HIXA 5IGFA 1W3SA 3SK8A 4DR5Q 1Q3LA 3ITPA 1X3GA 4L6TB 4DUYL 1STYA 1CM9A 1JE4A 1CKOA 5JOBA 2B2TA 4DK6C 4LFCL 4A75A 3S17H 5LL6S 2MJ8A 2R7FA 2N8NA 1F9QA 2F0NA 2OWOA 5CGKA 2KHSA 3ERSX 2JA8G 4IPGA 1QILA 2A69D 2H4OA 4C56C 2V1CC 4DV3L 1OO9B 4RCOA 4DR7Q 1PFMA 4DR4L 2FHTA 2NVXH 3VYTA 4C1NI 4A3EH 3NK9A 1O78A 1PFNA 2C9OA 3J81i 3QO2A 2EYOA 1DCZA 1CQFA 2WB1B 1Z7TA 2NZ1D 4DK1A 1Q8KA 3NTIA 1PA6A 1EWCA 1IZ6A 3PSIA 3OTOQ 4C3JG 3RZDB 4A93H 2RCNA 1MD2D 4LMQD 2F0FA 4C3HH 4HCEA 1CKMA 1XXGA 1TVXA 2A5HA 3PCOB 1I6VC 3HP3A 1S4ZA 3HOYG 1LACA 3H6MA 4WRDA 1HQMC 4R4CA 4LF8Q 4NW2A 4P71A 5LMNQ 4YCVA 2Q2TA 2JEBI 5DNFA 1DOKA 2F0PA 2JA5H 1XNQQ 1PXUA 1CA6A 4ULLA 4OHJA 2ZTEA 3UDFA 4OWTB 1YNJD 1WTXA 4Y7NB 4IPHA 2PQAA 4DAYA 4JI8Q 1SNDA 1QNKA 4KKTA 4DF7A 4A3FH 3R8BA 4P2CB 4YHHL 4PMBA 1PMRA 4B3SQ 2F3IA 2PZWA 4OEMB 4JBMA 4A3JB 3QR8A 4QY7A 5CORA 4BBRH 3GTOB 1E0BA 3P20A 3D31A 3HOXG 5J3BA 1Q82C 2UXBL 3A7AB 2K14A 4J8QA 1OXTA 3BDCA 4QCLA 3Q23A 2E2HH 1GUGA 3PV0A 3FP9A 3S1RH 5CV6A 3M7NA 4K2KA 2WAQG 1EQVA 1Y8PB 4JOIC 1M4VA 3S1MB 2BA1A 1BOSA 1XX8A 3K59A 1K8GA 5GAGC 1ZYRD 2EPBA 3HOVH 4DV7L 4JYAL 2AUJD 3P1HA 2HUGA 3PUVA 1HXYD 1PH2A 4POFA 4QIWB 3CRKC 5FLMH 3OWEB 4EQNA 1VQJA 2AQ1B 1P16A 1VQ7A 1TWAB 3OW7A 1UE6A 2EY2A 3HOZB 3LWEA 5C0XG 4DV2Q 1KXLA 1VQOA 5E7NA 2B29A 2Z6KA 4GS3A 1GUTA 3E6ZX 4KN7C 4JW0A 1AE2A 2LXKA 2NN6I 3I73A 1EQTA 4ALPA 4K14A 2R7ZB 2LY7A 1NE3A 2K5VA 3CPWA 5G3LF 4BBSH 4WORA 2NN6H 2X69A 5KRUA 3ICEA 1MGSA 4EX5A 2CWPA 1Y1VG 2HDMA 1L0XB 1AEXA 5M5XH 3LNNA 2A6HC 4IUVA 4LFAL 3MFYA 2NZOA 5IYCG 1Q81C 1DOLA 1EU3A 1SYFA 2Z8LA 4C1NK 2I46A 3HFZB 4FF1A 3T53B 2I5LX 1QJOA 3GTKH 4X6AH 1TWGH 1TY0A 1ENFA 2ZJQA 3RNUA 3D6CA 2YU9B 1SNQA 1U4PA 1F9RA 3K57A 4CJ0B 4A3MB 4NXNQ 5CR3A 4MN3A 4A3KG 1YJWA 4LF7Q 1CKNA 2D0PA 2SEBD 2XNAC 3KUPA 5M3FH 1WTVA 3V05A 1JOKA 4GN5A 4LF9L 1PTOF 3PIP3 2KCTA 2NVYH 1JWUD 3J7YW 1BUVT 1ICWA 4OO1I 5EQ0A 2GA4B 4XXEA 2MPMA 2ZXOA 5CBEE 1SYGA 1OXVA 1LUZA 2AUKA 5ISRA 1HTLD 1HRJA 1EFID 4X3KA 4FO2A 1PH9A 2EVBA 1VQLA 4OO1H 3BVGA 1B1ZA 5DLQE 2JA6H 3K0XA 2L9HA 1NR2A 1LV9A 3TMEA 4NPSA 4B08A 4X66Q 2F0EA 1TIID 1CSPA 3DM1A 1PTOD 5IOCA 4DV4L 5HGQA 3H94A 2NVQH 3FHWA 3DWPA 4IUQA 4A3CH 2X6GA 2RF4A 4Z9CB 1UUPA 3X3MA 2L5TA 2UUBQ 4HMJA 2VQEQ 4TQUS 4JV5L 1IBLL 3OMCA 1ICFB 3CKIB 1PRTC 2I07B 4HN7A 4ZLTF 3PUYA 4MZ9A 2XIWA 1Y14B 2F3VA 2WACA 3VYSA 4GLXA 3SXHA 3I56A 1J5EL 5ELOA 1HZ9A 2MO0A 3PO3G 3NEMA 1U4MA 2D0OA 1RTOA 2N3SA 3CCQA 2WAQE 2F52A 1I5FA 2OTLA 1R9TH 3OMGA 2KCMA 2M00A 1EY0A 1PFSA 3A55A 5IODA 2JA7H 1ESFA 1O7ZA 5C4HA 1E7ZA 2DN8A 4C2MB 4A3IG 5EJWA 3QOLA 1ET9A 2H5XA 2F0GA 4R4TA 1V8QA 3GD7A 4GLVB 1WTRA 2JA9A 4KTAA 1X3QA 4ILWA 3SE0A 3CCSA 3OW2A 2UXDQ 1WCMG 1SXTA 2OTJA 5IGBA 1PYBA 1M1KC 4HIDA 3SK6A 3OSOA 3FMCA 4MTKA 1ZEQX 4FDBA 1C48A 4IZ8A 2CCZA 2VB3X 1F2YA 3FPUB 3FKIH 5C4JB 4G7OC 1SYCA 2K7VA 3TEHB 2K04A 3I4NH 3Q0AA 3GTQB 1YJ9A 3EROA 2RQXA 1TWFB 1SFOH 1U4RA 1EYAA 4ODGA 3S14B 3KBGA 5IGDA 1S5DD 3A74A 1FL0A 5M9OA 2XWBB 1PV4A 2BE5C 2E2JH 3E9HA 3K80C 1PRTB 3P7JA 5FK9C 1U0LA 2A68C 3A5UA 5C44H 1EZ8A 5JEAJ 4GKJQ 3I4MG 1L0YB 1ZXTA 2B3GA 5M5YB 1GUNA 3OTOL 5LHY1 2EDGA 3NHHA 2JA8B 4LF5Q 2GVAA 1U5KA 4JVZA 4DXFA 1I4XA 2IWHA 1IBML 1O80A 3KF6B 4JK1C 4A3DH 4A3JG 1WJJA 5DAUA 1SMXA 4X62Q 2A6EC 4RG1A 4L63B 4KKUA 3IFDA 4WJ4A 4K5WA 1VCIA 1Y8OB 2KHIA 1B70B 3D4RA 1IL8A 5LMNL 4C3JB 2EYHA 1UE5A 3PO2H 1JICA 1GXDC 5IYBH 2DY7A 1K0SA 2CW0D 1AFPA 2IX0A 2AQ3B 4CHTB 1I6HB 4JI8L 4ZK9B 2F4VL 4R9WA 1VQDA 1D1KA 1EIHA 1LM0A 2C5CA 2Q8RE 3HOYB 3GTPB 3HOWG 2PW7A 4J6HA 2ES2A 4LF6L 2PI2A 4BXXG 3CCUA 1N33Q 1I4RA 3TP8A 4B3RQ 5CMDA 3R3OA 1KDAA 4A3BG 1CHPD 2RCFA 4AQYL 2VUMB 4OGQC 1RJTA 1STHA 1SJED 4N9PA 5FJ8H 1I4GA 3CCLA 3CW2C
chains in the Genus database with same CATH topology
2BOSA 2XSCA 3GTLB 2R6GA 5FO8B 2EJFC 4ME5A 2ENBA 4DN4M 3HOXB 1G6ZA 1RCVD 1NSNS 4U68A 4U673 3U9SA 3MFGA 2CQAA 1SE3A 2N55A 2WAQB 2EY6A 3CQZB 1BO0A 1PDQA 1Q12A 1S5ED 5E1FA 4K8JA 1EL0A 2K1BA 1GOZA 1KDBA 5BN4A 3TN2A 2F0DA 1F9SA 2RDHA 1IKMA 1VF5C 4EQOA 1HA6A 3URYA 1E2WA 1BCPB 3QB3A 4PQXA 4KY5A 5KNCA 2XN9C 1Q90A 2K6AA 4NMZA 1H9JA 1Z6HA 5JEAG 1K83B 2KEDA 2F0JA 2E74C 1EY5A 4H0LC 5DM73 1Y1VB 4IFDH 1EOTA 3VR4A 2L12A 1QWYA 3G7LA 2BCOA 4HTHA 3S9WA 2PQEA 4HR7B 4XQNA 1BF4A 2XRSD 4KHVA 3M4YA 1QOHA 1H9SA 3BZDB 1D5XC 5CV9A 4ID6A 4Q0FA 4A3KB 2F0WA 5FO7B 1HUMA 1HFNA 2EY1A 1VF7A 4KJOA 5K36H 5C5MA 1WD0A 1O7YA 2R93B 5IGGA 5I9PA 4R8IA 1STGA 3TDQA 1SMYD 1B3AA 2CHBD 1LTAD 1PTOH 2K01A 4XQJA 1LTBD 1LABA 2F0LA 4DAVA 4IUPA 1STEA 5EPJA 3BDLA 1WTWA 2RBMA 3C46A 4QUFA 1QCBD 4C3IG 3GTGB 3QWNA 1LT6D 3I90A 2ZXRA 5C3XA 5E3FA 2Q8TA 1D1IA 3IFTA 1SYBA 3Q24A 4QF4A 3VR5A 2EOTA 5TSSA 2K05A 4TKOB 3PO3B 2H1EA 2RDFA 5JJZA 2D9UA 1JB3A 1I3QB 3T4AC 2F1MA 4A3IB 3D6WA 3NE5B 4XT1B 3TZUA 1TS4A 2FINB 1SE2A 2D5DA 2B2YC 3AMUA 3L7ZC 2L1BA 2HQEA 4O42A 4RCNA 1WCMB 2PO4A 1CFMA 5EKLA 1JCKB 3TBIB 4HSVA 4ZUIA 2NBFA 5D65A 5ELFA 1M8AA 3QOJA 1D5MC 3M3YB 2D62A 1ILPA 2Z4HA 1CHQD 1LT5D 4MIUA 2NTTA 3J7AV 3MA2B 3SDZA 3AU7A 3I4MB 1PLFA 3NWTA 2N88A 3NTHA 1VMPA 3DEOA 4ZQ3A 3A8JE 1C8CA 2IJ0A 3I3CA 3T16A 2B2WC 5IGCA 1ET6A 3MWYW 1DOMA 2PNRC 1DD2A 1QE6A 2WV6D 1SYDA 3R2TA 2QF7A 3H3VC 1YNNC 4BS9A 1X32A 3HOWB 5C4XB 1S5FD 2HCCA 5IT9L 2ID0A 1QG7A 3NWSA 4A3BB 1FGBD 1S5BD 3L3OC 1EYDA 5ELBA 4IUNA 3BS1A 1HPCA 4FXDA 2KUMA 3O13A 1TQOA 3HZXA 3I8ZA 4XTCS 2MP1A 3GTJB 2AWNA 3D4DA 3NPPA 1G291 1GHJA 3SR1A 4DA2A 2ZT9C 2G9DA 2YYZA 1EY6A 1B4OA 1KABA 1DM0B 1JORA 4B9WA 2F0SA 4H13C 2PZTA 3EA6A 1UNSA 2PW5A 4IFDJ 4KKSA 4KY7A 3J81L 1TT2A 1RKNA 4K5XA 3U9OA 2KCCA 5D3IB 3RD4A 5COYA 4A3EB 2NVTB 2KVMA 3NTKA 3SVMA 2KA7A 5I2YA 4ZUJA 4XQQA 1O7LA 4HEDA 3K5LA 3KF8A 1V1PA 2K03A 3FVQA 3NBIA 4DAPA 2Q8IB 1LTTD 3NUCA 2MGSA 4XYOA 1KNAA 1ZKOA 2TMPA 3NXWA 2D2CC 4UAIA 2KEEA 1E2VA 1X3PA 3E0JA 4M1UB 4UDUC 4PNYA 4PV1C 4FP5D 4LK1C 3W2DA 3ONAB 4BBRB 1LO5D 3HGBA 2RA4A 3OIPA 3S1RB 1SNPA 3NBHA 2B39A 3V96A 3HOVB 2KQ3A 1K8MA 3VR3A 5J39A 3M4OB 4KHZA 5EBCA 1DONA 2NB0A 4CGYB 2V4DA 4G7ZC 3QJYA 2MUYA 3K5OA 4HSPA 2OF1A 2X6LA 1I4PA 3C2PA 1SNOA 1JWSD 2F0VA 2F0MA 1ML0D 1IW7C 4DNRB 2RSOA 2MHVA 4BBSB 2B2TC 4C3IB 1RDPD 5EBDA 1HCZA 2QILA 5E4XA 5C0XI 4IFDG 5M5XB 2JSOA 2EYFA 4KY6A 2QEJC 4YIJA 2FMCA 4ZYSA 5C0XH 2G9HD 3A8KE 1G91A 5EPKA 5HURA 3GTKB 3I72A 1TWGB 1A2UA 5J1ZA 2ICIA 3BVZA 1STAA 1SMYC 4J1MA 1GHKA 2BDNA 1W6KA 4A3GB 2B2YA 4RKLA 5M3FB 1B50A 5C3WA 1W6JA 4M8AA 4H7BA 4OIJA 1Q8IA 2NVYB 1PFBA 2F0UA 2LMCB 3RLFA 1B2TA 1Y1WB 3RMHA 1UEAB 4DK0A 5CV8A 3F2UA 3GQBA 4BA2I 1HQRD 3M7GA 3OHXC 2PZUA 2NTSA 3SK5A 3GO5A 1GUWA 1A3TA 2A6HD 2VB2X 3BYYB 3K0YA 3OIQA 4IUUA 3NSWA 4DXGA 2WP8J 1G2TA 2AQ2B 1B53A 2ICEC 2E76C 1D2BA 3MEHA 2F3WA 1NCVA 3OWFA 2SOBA 2A69C 2JXMB 2B2WA 2E2DC 5I9OA 4CBVA 4NDXA 3VYUA 2OT2A 5CYUA 2O4XA 1XTCD 4TRDA 4XYQA 2JA7B 4JBWA 2B2UC 1EWHA 3BG3A 1PRTF 4IUTA 3DHQA 2O5IC 3VA7A 2RSNA 4E6IA 3FKIB 5C6AA 3BVMA 1BXTA 1DJRD 3HG9A 4KMUC 3N6RA 2IX3A 1F9PA 1YNJC 3VR2A 3I4NB 4RGTA 4C3HG 2LKVA 1XWEA 1LTRD 2ZXPA 3GV3A 2CVRA 1PRTD 3PUWA 2FMMA 2VNUD 2WIIB 1A15A 3I4LA 1GUSA 3C1EA 3K5MA 3QIAA 5C44B 1KLGD 2EYPA 3KK7A 1EY8A 2XRQD 1FNUA 1ZYRC 5KIXA 2QDBA 1HUNA 3V2TA 2F03A 1D6EC 2JE6I 1UAPA 3SEBA 4RH6A 4FVMA 3CHBD 4RGMA 1SBBB 1AW7A 2K5WA 5JPNC 5FKAC 1EIGA 4ZKBB 5BN3A 5FO9B 5LL6X 4K5VA 3GP7A 2BA0A 2TSSA 3KLRA 3I70A 2WKDA 2J7ZA 1TWHB 3VA5A 4KJNA 4IALA 2SNMA 3MAQA 1H9RA 4G7HC 4RAUC 3IL8A 4QMGA 1TWCB 1WTOA 2O2LD 4QB4A 3Q6SA 3ZYYX 3X3NA 5J22A 1CZGA 1DZ1A 2NN6G 4RFBA 2JYOA 2J4XA 1BCPF 3J7AF 3PMFA 4BY7B 4KD4A 1KLUD 3HOUB 4X3UA 2A6ED 3MC0B 1ESRA 2E2IB 1EEFD 2B2VC 3JAME 1OXXK 3FRPB 4LAAA 3E5SA 4G57A 4KV6A 1JWMD 1BDOA 4X3SA 3TP5A 1BCPD 4FF3A 1FD7D 4DGZA 4PMWA 1U9RA 3AB9A 4XDXA 5FLXL 2EYMA 3A54A 5IT9E 4BA1I 1PTOC 1PYWD 1Q1BA 1TY2A 1EY4A 4F8MA 5KNDA 1TU2B 4OL7A 2PPBC 5JVG3 2KOLA 4KK7A 1HA5A 4F88A 1H9MA 2RKSA 4K6DA 2L4NA 3GTMB 2SNSA 2F0TA 2R92B 4OO1G 2F4IA 4KN4C 1DXMA 5IIFA 1CK1A 5T1IA 1KAAA 1EEID 4G4KA 1MI2A 2KJXA 3R93A 1NAPA 5JEAH 1BR9A 3ND9A 1MSHA 2K5QA 1OXSC 3J81E 1EU4A 2Z1CA 1FNVA 4CKBA 5KNBA 3D3RA 5KGUA 1R4QB 5EPLA 4TSSA 4XIGS 1KDCA 2XVSA 3A7LA 5CV4A 3JAML 2LS01 2K32A 2LFNA 4RKBA 1PTOB 1WVLA 3CU7A 1STNA 1TS2A 2FFKB 3K5NA 4BY1B 1EZ6A 1CT1D 3VR6A 1SYEA 4OIKA 3S2DB 3S1QB 1CZWA 2JEAI 1LLRD 4CKEA 3EJIA 4RHSA 3WOFA 1WTPA 5JPMC 4O1NA 4IURA 1SEBD 1B44D 2K5DA 1A3VA 2VXWA 3H09A 5FOBB 2EY5A 3Q22A 2EZVA 1GUOA 4DFAA 4DU9A 1TKWB 1AN8A 1V1OA 3MXGA 4EGVA 5I6YA 2OEOA 3S17B 2B2UA 3IKJA 1CTMA 1I4HA 2RVLA 3T13A 2CW0C 4RGOS 5DEHA 2SDFA 1WD1A 2KCNA 4WFN3 3EQLC 3N52A 4H44C 3K6OA 3RUZA 1BNZA 2DNEA 2F0HA 2NVXB 1A2TA 3LWUA 2PYKA 2OXPA 5ELCA 3D4WA 1G8ZD 5CBAE 2A73B 1ENCA 1EY9A 4A93B 5G3LD 3H0GB 4C3HB 2L55A 1SDFA 4KD3A 1F2ZA 3HKZB 5EKKA 3DWAA 1CA5A 4EQPA 1JR0D 4CJ2C 2F0KA 2BDOA 5M3MB 1A3UA 2F0IA 1IKLA 2JA5B 2JP1A 1EY7A 3NQTA 4V0BA 4A3FB 3RZOB 3NQIA 3DEPA 1IYUA 2IT1A 3C1FA 1SNCA 1IHZA 1MSGA 1DYQA 2E2HB 2DY8A 3P75A 3DUZA 5C3EB 3WDNA 1NUCA 2R61A 3L9AX 2WKCA 3W3AA 3FPPA 5KYLA 3VYRA 1B9MA 5C4ZA 3HRZC 3PUXA 4GZYC 1H9SB 4AYBB 5F2DA 4V190 3FEWX 5BN5A 2R3ZA 1II3A 1CI3M 3UI2A 1HFGA 1D5ZC 1SNMA 1RTNA 2EXZA 1Y8NB 3K58A 2IL8A 4F7XA 4BWGB 1QNUA 1GJXA 1TS3A 1F2MA 3MXPA 5NUCA 4IN3A 1LTGD 3S15B 1S5CD 1LT4D 1C4QA 3IAYA 2B2VA 4Q5VA 5CV7A 2EYJA 1J9OA 2M2LA 3MVVA 3R2IA 4FNFA 5I4DA 2QCPX 4I65A 1YNND 4LJZC 5A2QE 1HHVA 1RF2D 5I6WA 1TR5A 2L11A 3DXJC 1IYVA 5HGTA 1CQVA 5EGTA 5K36G 1B9NA 2NWGA 1LTID 2IX1A 1ILQA 2L0CA 1FR3A 1VMCA 1V43A 3KLSA 4CKCA 3BYTB 1JQYD 5IGEA 4PMCA 3QG1A 1T5XD 2QKIC 2NUCA 3TP6A 1VDZA 2JA6B 1F77A 3M85A 2EJMA 2A74C 1RD9D 4B9XA 5K5PA 1J8IA 2Z4IA 1SJHD 1KNEA 2NVQB 2EJGC 1AZPA 1HTPA 5ELEA 1AZQA 4WJWA 1H9KA 4HMIA 1F2LA 4ABNA 1BCPC 1RODA 1TS5A 2B8GA 4XT3B 1SSOA 1BBXC 3EFXD 3BDOA 1QB5D 1EYCA 4R8NA 1JC7A 1Y69U 3TZDA 5T1GA 3T51B 3PIO3 3S16B 2K33A 5AFWA 5C5LA 1R9TB 1R4PB 4RA8A 4CJ1B 5E4WC 1OXUA 5A2QL 5CV5A 4F87A 3MHBA 2IPKD 4L8JA 1PZJD 2F0QA 1FNWA 1E2ZA 4K6LA 4N9TA 5KYIA 2XWJB 4QUCA 3J80E 4IQZA 1T5EA 4K8IA 1JOQA 3MZ5A 2HDLA 4I7ZC 4RHRA 3MTSA 3K7AB 1FYCA 2E75C 3SHLA 1LT3D 1ENAA 2M9VA 2IW3A 2EE1A 2J0TD 1SFOB 4X3TA 3LX0A 3EVQA 5D3DA 5JVH3 3NP8A 2E2JB 4EVOA 3H91A 1G2SA 3TP7A 3KLSX 1WTQA 3S2HB 4HCSA 2F0OA 4IFDI 3A56A 3PUZA 4RGNA 1RHPA 3I91A 4NKLA 3ND8A 1I50B 4A3DB 2PCFB 2NYZD 4FYDA 1SE4A 5FLXE 3GV6A 2FJ2A 2EYLA 4RWSC 2PMZB 1IW7D 3PO2B 3DWQA 3MXNA 4S3SA 2HCIA 1Q1EA 1I4QA 4HAEA 3A8IE 1LTSD 3T56B 1BQQT 2KECA 3S1NB 2Y0SB 1AP0A 3G6JB 3KBXA 2K28A 4FXKC 3SK4A 2AWOA 1Z47A 3OPOA 2RDGA 2BE5D 5JAVA 1SAPA 3J80L 1KTKA 4ZAIA 2A68D 5M5WB 3OOCA 4NP5A 1STBA 3HS0C 3D8GA 1XYIA 3TSSA 2WINB 1PZKD 4KI0A 1V1PB 4K2LA 5D14A 2B8FA 4FF2A 4MHEA 1NR4A 1MBYA 3ERQA 4FF4A 5EKIA 1K8OA 4ZKCB 1A6XA 2B63B 5ELDA 1PZID 4ZRZA 5CC4A 3C3LA 5I2XA 3DMUA 4DNTB 3HEJA 1U4LA 5DM63 4FXGC 1ONLA 3MXUA 5A35A 3FDTA 2DNCA 1JOOA 2O5JC 5KEEA 5C0XJ 3CRLC 5IGFA 3SK8A 1Q3LA 3ITPA 4L6TB 1STYA 1CM9A 1JE4A 5JOBA 2B2TA 5LL6S 2MJ8A 1F9QA 2F0NA 5CGKA 2KHSA 1QILA 2A69D 2H4OA 4C56C 1OO9B 4RCOA 1PFMA 2FHTA 3VYTA 4C1NI 3NK9A 1O78A 1PFNA 2C9OA 3QO2A 2EYOA 1DCZA 1CQFA 2WB1B 1Z7TA 2NZ1D 4DK1A 3NTIA 1EWCA 4C3JG 3RZDB 1MD2D 4LMQD 2F0FA 4HCEA 1XXGA 1TVXA 2A5HA 1I6VC 3HP3A 1S4ZA 1LACA 3H6MA 4WRDA 1HQMC 4NW2A 2JEBI 5DNFA 1DOKA 2F0PA 1PXUA 1CA6A 4ULLA 4OHJA 1YNJD 1WTXA 4Y7NB 4DAYA 1SNDA 1QNKA 4KKTA 4DF7A 3R8BA 4P2CB 4PMBA 1PMRA 2PZWA 4A3JB 5CORA 3GTOB 1E0BA 3P20A 3D31A 3A7AB 4J8QA 1OXTA 3BDCA 4QCLA 3Q23A 1GUGA 3PV0A 5CV6A 3M7NA 4K2KA 1EQVA 1Y8PB 1M4VA 3S1MB 2BA1A 1BOSA 1XX8A 3K59A 1ZYRD 2EPBA 2AUJD 3P1HA 2HUGA 3PUVA 1HXYD 4QIWB 3CRKC 3OWEB 4EQNA 2AQ1B 1TWAB 3OW7A 3HOZB 2EY2A 3LWEA 5C0XG 1GUTA 3E6ZX 4KN7C 2NN6I 3I73A 1EQTA 4K14A 2R7ZB 2LY7A 5G3LF 4WORA 2NN6H 2X69A 5KRUA 1MGSA 2HDMA 1L0XB 1AEXA 3LNNA 2A6HC 4IUVA 3MFYA 1DOLA 1EU3A 1SYFA 2Z8LA 4C1NK 2I46A 4FF1A 3T53B 1QJOA 1TY0A 1ENFA 3D6CA 2YU9B 1SNQA 1U4PA 1F9RA 3K57A 4CJ0B 4A3MB 5CR3A 4MN3A 2SEBD 2XNAC 3KUPA 1WTVA 3V05A 1JOKA 1PTOF 3PIP3 1JWUD 3J7YW 1BUVT 1ICWA 4OO1I 5EQ0A 2GA4B 4XXEA 2MPMA 2ZXOA 5CBEE 1SYGA 1OXVA 2AUKA 5ISRA 1HTLD 1HRJA 1EFID 4X3KA 4FO2A 2EVBA 4OO1H 3BVGA 1B1ZA 2L9HA 1NR2A 1LV9A 3TMEA 4B08A 2F0EA 1TIID 5IOCA 3DM1A 1PTOD 3H94A 3DWPA 4IUQA 2X6GA 4Z9CB 3X3MA 1UUPA 2L5TA 4HMJA 4TQUS 3OMCA 3CKIB 1PRTC 2I07B 4HN7A 4ZLTF 3PUYA 2XIWA 2F3VA 2WACA 3VYSA 3SXHA 1U4MA 1RTOA 2M00A 3OMGA 1EY0A 3A55A 5IODA 1ESFA 1O7ZA 5C4HA 2DN8A 4C2MB 5EJWA 3QOLA 1ET9A 2F0GA 1V8QA 3GD7A 1WTRA 4KTAA 1X3QA 4ILWA 3SE0A 1SXTA 5IGBA 3SK6A 3OSOA 3FMCA 1ZEQX 1C48A 4IZ8A 2VB3X 1F2YA 3FPUB 4G7OC 5C4JB 1SYCA 2K7VA 2K04A 3Q0AA 3GTQB 3EROA 2RQXA 1TWFB 1U4RA 1EYAA 4ODGA 3S14B 3KBGA 5IGDA 1S5DD 5M9OA 2XWBB 2BE5C 1PRTB 3P7JA 5FK9C 2A68C 1EZ8A 5JEAJ 1L0YB 1ZXTA 5M5YB 1GUNA 5LHY1 2EDGA 3NHHA 2JA8B 4DXFA 1I4XA 2IWHA 1O80A 4JK1C 5DAUA 2A6EC 4L63B 4KKUA 3IFDA 4K5WA 1VCIA 1Y8OB 1IL8A 3D4RA 4C3JB 2EYHA 1JICA 1GXDC 2DY7A 2CW0D 1AFPA 2IX0A 2AQ3B 4CHTB 1I6HB 4ZK9B 4R9WA 1D1KA 1EIHA 2C5CA 2Q8RE 3HOYB 3GTPB 2PW7A 4J6HA 1I4RA 3TP8A 5CMDA 3R3OA 1KDAA 1CHPD 2VUMB 4OGQC 1RJTA 1STHA 1SJED 4N9PA 1I4GA 3WOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4P A;  1F9R A;  2MP1 A;  5DNF A;  4HSV A;  1DOK A;  2HDL A;  4CJ0 B;  1CA6 A;  1WD0 A;  2NWG A;  4MN3 A;  5D65 A;  1O7Y A;  1GUW A;  3DEP A;  5D14 A;  1ILQ A;  1M8A A;  1WTX A;  3MTS A;  4XDX A;  1WTP A;  1QNK A;  4DN4 M;  4R8I A;  3KUP A;  1G6Z A;  3FPU B;  1VMC A;  1DON A;  4MHE A;  4U68 A;  2EE1 A;  1WTV A;  4IUU A;  1NR4 A;  1ILP A;  1HUN A;  1MSG A;  2K04 A;  1G2T A;  5EKI A;  1B4O A;  4X3T A;  1B3A A;  4ZKC B;  5COR A;  1B53 A;  2DY8 A;  1E0B A;  2N55 A;  4IUR A;  1ICW A;  3H91 A;  1G2S A;  2X6L A;  2VXW A;  1U4L A;  1U4R A;  2K01 A;  2MPM A;  5EQ0 A;  5CBE E;  1BO0 A;  2KOL A;  1PDQ A;  1WTQ A;  1HRJ A;  3FDT A;  1EL0 A;  4HCS A;  4X3K A;  1NCV A;  2K1B A;  1ML0 D;  2L4N A;  4IUP A;  5COY A;  5EPJ A;  2B2W A;  2RSO A;  2KVM A;  1J8I A;  1PLF A;  3P7J A;  3SVM A;  2B2T C;  1WTW A;  3TN2 A;  1XX8 A;  1KNE A;  2L9H A;  2N88 A;  1F9S A;  1RHP A;  1NR2 A;  2EPB A;  1LV9 A;  1VMP A;  1ZXT A;  3DEO A;  3I91 A;  1IKM A;  2B2U A;  4QUF A;  1Q3L A;  5E4X A;  1C8C A;  1HA6 A;  5T1I A;  1EIG A;  3I3C A;  1AZP A;  2HUG A;  3DM1 A;  4ZKB B;  2RVL A;  2B2W C;  1AZQ A;  2R3Z A;  1CM9 A;  4HED A;  1JE4 A;  1MI2 A;  3MWY W;  2NYZ D;  2B2T A;  2SDF A;  1DOM A;  1WD1 A;  3I90 A;  3UI2 A;  1HFG A;  4IUQ A;  2MJ8 A;  1ROD A;  3R93 A;  2K03 A;  3N52 A;  1NAP A;  1O80 A;  1RTN A;  1QE6 A;  1F9Q A;  2J7Z A;  2X6G A;  3LWE A;  2B2U C;  3GV6 A;  2FJ2 A;  2Q8T A;  4RWS C;  1BNZ A;  4XT3 B;  2IL8 A;  1SSO A;  1BBX C;  1G91 A;  2MGS A;  5EPK A;  1MSH A;  2HCI A;  3IFD A;  1KNA A;  2EOT A;  1PFM A;  4HAE A;  1EQT A;  2KED A;  2K05 A;  4IUT A;  2FHT A;  5CBA E;  1IL8 A;  4RAU C;  2KEC A;  3IL8 A;  4UAI A;  2KEE A;  2BDN A;  1JIC A;  1X32 A;  2H1E A;  4ZLT F;  3TZD A;  2RSN A;  1PFN A;  5T1G A;  1EOT A;  1WTO A;  3Q6S A;  1AP0 A;  2XIW A;  2DY7 A;  2L12 A;  5AFW A;  3QO2 A;  1X3P A;  3KBX A;  2K28 A;  3G7L A;  5JJZ A;  1DZ1 A;  2X69 A;  2D9U A;  2B2Y A;  2NZ1 D;  1MGS A;  2JYO A;  2HCC A;  4RA8 A;  1SDF A;  4R9W A;  5EPL A;  4ZK9 B;  4CJ1 B;  1B50 A;  2HDM A;  5E4W C;  2B2V A;  4OIJ A;  1EIH A;  3D6W A;  1U4M A;  4XT1 B;  1F9P A;  1RTO A;  4LMQ D;  3ONA B;  1BF4 A;  1QG7 A;  2Q8R E;  4X3U A;  4IUV A;  1CA5 A;  1PFB A;  1SAP A;  1J9O A;  1TVX A;  2FIN B;  2M2L A;  1DOL A;  2RA4 A;  1ESR A;  1O7Z A;  2B2Y C;  4CJ2 C;  3GV3 A;  2L1B A;  4ZAI A;  1WVL A;  2CVR A;  1B2T A;  4O42 A;  2FFK B;  5CMD A;  2B2V C;  5EJW A;  3HP3 A;  1S4Z A;  2KUM A;  1IKL A;  2FMM A;  3F2U A;  1XYI A;  1HHV A;  2JP1 A;  1WTR A;  3I8Z A;  4OIK A;  4QUC A;  1A15 A;  1RJT A;  4NW2 A;  1X3Q A;  1HUM A;  1HFN A;  2L11 A;  4X3S A;  1F2L A; 
#chains in the Genus database with same CATH topology
 2BOS A;  2KEN A;  2XSC A;  3GTL B;  2R6G A;  5FO8 B;  1KQS A;  3TQY A;  2EJF C;  3J80 i;  4ME5 A;  1VQA A;  2ENB A;  4DN4 M;  3HOX B;  1G6Z A;  1RCV D;  1NSN S;  4U68 A;  5BR8 Q;  4U67 3;  3U9S A;  3MFG A;  1OTC A;  2CQA A;  1SE3 A;  1G51 A;  2N55 A;  4JOI A;  2WAQ B;  2EY6 A;  3E3X A;  3CQZ B;  2CQO A;  1BO0 A;  1PDQ A;  1Q12 A;  1S5E D;  5E1F A;  4K8J A;  2B63 H;  1EL0 A;  4QGU A;  4UP8 A;  2K1B A;  1VQP A;  1GOZ A;  1KDB A;  5BN4 A;  3TN2 A;  2F0D A;  4HJ8 A;  1F9S A;  2RDH A;  1HNZ L;  3MEF A;  1IKM A;  1VF5 C;  4EQO A;  4A3E G;  3E9I A;  1HA6 A;  3URY A;  1E2W A;  1BCP B;  3QB3 A;  4PQX A;  4KY5 A;  5KNC A;  2XN9 C;  1Q90 A;  2K6A A;  4K0K Q;  4NMZ A;  1GD7 A;  2HIV A;  5JJK A;  1H9J A;  1Z6H A;  3K7U C;  5JEA G;  1K83 B;  1BVS A;  4DK3 C;  2KED A;  2F0J A;  1VQC A;  2E74 C;  1EY5 A;  3BZK A;  4H0L C;  5DM7 3;  2UUA Q;  1Y1V B;  4IFD H;  1EOT A;  2UU9 Q;  3VR4 A;  2L12 A;  1QWY A;  3G7L A;  2BCO A;  4HTH A;  4DUZ L;  3S9W A;  2PQE A;  1N8R C;  1HNW Q;  4HR7 B;  3G6E A;  4LF7 L;  4X65 Q;  4XQN A;  1BF4 A;  2XRS D;  4KHV A;  3M4Y A;  3U4Z A;  1QOH A;  1H9S A;  3BZD B;  1D5X C;  4JI3 Q;  5CV9 A;  4ID6 A;  2VQF L;  1XJV A;  4Q0F A;  4ME3 A;  4BBR G;  5IWA Q;  4A3K B;  2F0W A;  5FO7 B;  1HUM A;  1HFN A;  3CCJ A;  2EY1 A;  1VF7 A;  4KJO A;  4R1J A;  4A4I A;  2R7D A;  3M4Q A;  5K36 H;  3UE0 A;  5C5M A;  4GOP C;  1WD0 A;  5AJ3 Q;  1O7Y A;  2R93 B;  5IGG A;  5I9P A;  4R8I A;  1VQ8 A;  3HOV G;  1STG A;  3I4O A;  3TDQ A;  4JI6 Q;  1SMY D;  1B3A A;  1E24 A;  1HNX L;  1NTG A;  2CHB D;  1LTA D;  1PTO H;  2UUB L;  1ASZ A;  5IP7 H;  2K01 A;  3M4P A;  4ZCK A;  4DAM A;  4XQJ A;  1LTB D;  1LAB A;  2F0L A;  4BY1 H;  3KF8 B;  4DAV A;  4IUP A;  1STE A;  5EPJ A;  1E3P A;  3S2D H;  3BDL A;  1WTW A;  5LMN W;  3J7A 5;  2RBM A;  1PH3 A;  4MTN A;  3C46 A;  4QUF A;  2QDL A;  1QCB D;  2ATW A;  4C3I G;  3GTG B;  2KBN A;  3QWN A;  1LT6 D;  4JI0 L;  3WOE A;  3I90 A;  2ZXR A;  3B6Y A;  5C3X A;  1N34 Q;  4JI5 L;  5E3F A;  2Q8T A;  5L37 A;  1D1I A;  1N36 Q;  3IFT A;  1SYB A;  3CPF A;  3Q24 A;  4GKK L;  4QF4 A;  3VR5 A;  1XMQ Q;  2EOT A;  5TSS A;  2K05 A;  4TKO B;  3PO3 B;  2H1E A;  2RDF A;  5JJL A;  3KF6 A;  5JJZ A;  1EFW A;  2D9U A;  4GOP B;  1JB3 A;  1I3Q B;  2R7Z H;  3NBH B;  1JB7 A;  3T4A C;  4LF4 Q;  2F1M A;  4A3I B;  3D6W A;  3NE5 B;  4XT1 B;  1PH1 A;  4A3G G;  3TZU A;  1X55 A;  1TS4 A;  3F8T A;  4DR1 Q;  2A1A A;  2FIN B;  1SE2 A;  2D5D A;  1YEZ A;  2B2Y C;  5M3F G;  3L7Z C;  3AMU A;  2L1B A;  4JI1 Q;  2HQE A;  4O42 A;  4RCN A;  3AQQ A;  1WCM B;  2PO4 A;  1CFM A;  2N49 A;  1YIT A;  1XNR Q;  3CAM A;  5EKL A;  3A0J A;  2K52 A;  1JCK B;  4PZ7 A;  1Y1W G;  4DV6 L;  3TBI B;  1LYL A;  4HSV A;  2OQ0 A;  4ZUI A;  2NBF A;  1N32 Q;  3H0G H;  5D65 A;  1YIJ A;  3RR5 A;  5ELF A;  1M8A A;  3D0F A;  3QOJ A;  1D5M C;  3M3Y B;  2YU9 H;  2D62 A;  3A5Z B;  1ILP A;  2Z4H A;  1CHQ D;  1B8A A;  2CH4 W;  4JG2 A;  3STB D;  1LT5 D;  4MIU A;  4X62 L;  2NTT A;  3J7A V;  3MA2 B;  3SDZ A;  3AU7 A;  5M3M H;  4A3C G;  3I4M B;  3T1H Q;  2MO1 A;  1VQ5 A;  4LWC A;  1QVC A;  4GNX C;  4HIK A;  4YY3 L;  1PLF A;  2VUM G;  3NWT A;  3BU2 A;  2N88 A;  3NTH A;  1VMP A;  1UE7 A;  3DEO A;  4ZQ3 A;  2I5H A;  3A8J E;  4DNI A;  3RZO H;  1C8C A;  2IJ0 A;  1H95 A;  3I3C A;  2BH2 A;  3T16 A;  2B2W C;  5IGC A;  1XMO L;  1ET6 A;  3MWY W;  1DOM A;  1UE1 A;  5EAY A;  1C7Y A;  1IBK L;  1A8V A;  2PNR C;  1DD2 A;  1QE6 A;  2WV6 D;  1N33 L;  1SYD A;  3R2T A;  2QF7 A;  3H3V C;  4IPC A;  4JI2 Q;  5C3E H;  5IP9 H;  1YNN C;  4BS9 A;  1X32 A;  4P75 A;  1HR0 W;  3HOW B;  4JI4 Q;  2VY3 A;  1K28 A;  4B3T L;  5C4X B;  1S5F D;  2AMC B;  2HCC A;  5IT9 L;  4DPG A;  2ID0 A;  1QG7 A;  3NWS A;  4DR6 Q;  4A3B B;  5IY0 A;  1JMC A;  3T1Y L;  1FGB D;  1S5B D;  3FKI G;  3L3O C;  1EYD A;  4OX9 L;  5ELB A;  3RN2 A;  2E5L Q;  4IUN A;  3BS1 A;  1KL9 A;  1HPC A;  1S40 A;  4FXD A;  2KUM A;  3O13 A;  1TQO A;  3HZX A;  3I8Z A;  4XTC S;  1EWI A;  3IRB A;  4C2M H;  2MP1 A;  4GNX B;  3GTJ B;  3WWV A;  2AWN A;  1GKH A;  3D4D A;  3NPP A;  1G29 1;  3J81 j;  1GHJ A;  3SR1 A;  4DA2 A;  2ZT9 C;  2XGT A;  3S15 H;  2G9D A;  2AKW B;  5C44 G;  2YYZ A;  4Y52 H;  1EY6 A;  1E1O A;  5GRO A;  1B4O A;  1KAB A;  2CH4 A;  1DM0 B;  1JOR A;  4B9W A;  1L2F A;  1VQF A;  1EYG A;  1KRT A;  2F0S A;  3KDF B;  5C4J H;  5GAD C;  4H13 C;  2PZT A;  3EA6 A;  1UNS A;  2PW5 A;  4IFD J;  4KKS A;  4KY7 A;  3J81 L;  1TT2 A;  1RKN A;  4X64 Q;  4K5X A;  3U9O A;  2KCC A;  5D3I B;  3RD4 A;  3SGI A;  3GTQ H;  5COY A;  4A3E B;  2NVT B;  2KVM A;  3NTK A;  3SVM A;  1BBU A;  2KA7 A;  3S14 H;  2ZJR A;  5I2Y A;  2JK8 A;  4ZUJ A;  1HNW L;  4XQQ A;  1O7L A;  5IYB G;  4DV1 Q;  4X65 L;  4HJA A;  2R93 G;  1W2B A;  4HED A;  2QGQ A;  3K5L A;  3KF8 A;  1T9H A;  5M5Y H;  1V1P A;  2ZTC A;  1QZH A;  1GVP A;  2K03 A;  2HD3 A;  2WFW A;  3FVQ A;  3NBI A;  4B3M L;  1WOC A;  2Q8I B;  4DAP A;  1LTT D;  2GN5 A;  4L5S A;  3NUC A;  3U4V A;  2MGS A;  3L0O A;  2PNH A;  4XYO A;  1KNA A;  1RIP A;  1ZKO A;  2TMP A;  3NXW A;  4IJH A;  5IWA L;  2DUD A;  1VQ9 A;  1X6O A;  2D2C C;  4UAI A;  2KEE A;  4DR3 Q;  2ZM6 Q;  4DV5 L;  2Z9H A;  4LFB Q;  1E2V A;  1X3P A;  5AJ3 L;  3E0J A;  4M1U B;  1X54 A;  4UDU C;  4PNY A;  4PV1 C;  4FP5 D;  4LK1 C;  3CD6 A;  3W2D A;  3ONA B;  1KIX A;  4BBR B;  3KLW A;  1I94 Q;  1LO5 D;  3HGB A;  2RA4 A;  4YCU A;  2IHF A;  1N9W A;  3EIV A;  4BY7 G;  3HOY H;  3GTP H;  4GOP A;  3HOU G;  3U50 C;  4UY8 C;  3OIP A;  3S1R B;  1SNP A;  3NBH A;  1VQE A;  4IOA A;  3JC6 6;  2B39 A;  3CP0 A;  1VQH A;  3V96 A;  2E8G A;  1K3R A;  3HOV B;  2KQ3 A;  3S16 H;  3F2D A;  3TS2 A;  2BH8 A;  1K8M A;  3VR3 A;  3KJO A;  5J39 A;  3M4O B;  4KHZ A;  3F1Z A;  5EBC A;  1DON A;  1NNX A;  2NB0 A;  1YI2 A;  4CGY B;  2V4D A;  4DV0 Q;  3QJY A;  4NB3 A;  4G7Z C;  2MUY A;  1MKH A;  3K5O A;  3HOX H;  4HSP A;  2OF1 A;  2X6L A;  2I0Q A;  1I4P A;  3C2P A;  4NXM Q;  1SNO A;  4UP7 A;  2DJG C;  1JWS D;  2F0V A;  1XMQ L;  3BJU A;  2F0M A;  1ML0 D;  1IW7 C;  1NMG A;  4DNR B;  3CQZ H;  2RSO A;  1J6Q A;  1EOV A;  2MHV A;  2B2T C;  4DR5 L;  4C3I B;  4BBS B;  3L2P A;  1RDP D;  5EBD A;  1HCZ A;  2QIL A;  1FVI A;  1XTD A;  5E4X A;  5C0X I;  3GDE A;  4IFD G;  3K7A H;  2R92 G;  1G6P A;  5M5X B;  2JSO A;  2EYF A;  1PH4 A;  4KY6 A;  1V9P A;  2QEJ C;  2A8V A;  4DUY Q;  1M90 C;  4YIJ A;  2FMC A;  4ZYS A;  4IPD A;  5C0X H;  2G9H D;  3A8K E;  4DR7 L;  1K9M C;  1S72 A;  4LFC Q;  1G91 A;  5EPK A;  1VQG A;  5HUR A;  3I72 A;  3GTK B;  4AIM A;  1TWG B;  1A2U A;  5J1Z A;  1XNR L;  2ICI A;  1VQ4 A;  1JJ2 A;  4OWX B;  3BVZ A;  1STA A;  3S2H H;  1SMY C;  4J1M A;  4DV3 Q;  1GHK A;  2BDN A;  2K50 A;  3U58 A;  4DR4 Q;  1W6K A;  1LTL A;  4A3G B;  5JJI A;  2ALY B;  2B2Y A;  1Y1V H;  1I50 H;  4RKL A;  5M3F B;  1B50 A;  5C3W A;  1VQI A;  1W6J A;  2YV5 A;  4H7B A;  4M8A A;  4OIJ A;  4P74 A;  2QW7 A;  1Q8I A;  4EQ5 A;  2NVY B;  1PFB A;  2F0U A;  4IJL A;  2LMC B;  4LF8 L;  1WI5 A;  3RLF A;  1B2T A;  1Y1W B;  3RMH A;  1UEA B;  4DK0 A;  5CV8 A;  3F2U A;  3GQB A;  1XPR A;  4BA2 I;  3T1H L;  1XNQ L;  1HQR D;  1B3Q A;  3M7G A;  3OHX C;  2PZU A;  2NTS A;  3S1N H;  4BY1 G;  4LW1 A;  4OWW B;  3SK5 A;  2HHH Q;  3GO5 A;  4B3S L;  1GUW A;  3I7F A;  1A3T A;  2A6H D;  2NZH A;  2VB2 X;  3BYY B;  3K0Y A;  5C4X G;  3OIQ A;  4IUU A;  4QL5 A;  3NSW A;  4DXG A;  2WP8 J;  1G2T A;  2K75 A;  2AQ2 B;  4LUO A;  1EUJ A;  1B53 A;  2ICE C;  4YHH Q;  5IT9 c;  2E76 C;  4JI2 L;  1D2B A;  2RHS B;  5M5W H;  3CC4 A;  3MEH A;  1V1Q A;  2F3W A;  3EBE A;  1NCV A;  3OWF A;  2SOB A;  2A69 C;  2JXM B;  2B2W A;  2ASB A;  2E2D C;  5I9O A;  4R4O A;  4CBV A;  4NDX A;  3VYU A;  3KDF A;  2OT2 A;  3AFQ A;  5CYU A;  2O4X A;  1XTC D;  4DV7 Q;  4DV2 L;  4TRD A;  4XYQ A;  4JYA Q;  4JBW A;  2JA7 B;  4LUZ A;  1X65 A;  3UDI A;  1EIY B;  2B2U C;  1EWH A;  3BG3 A;  1SLJ A;  3CMA A;  4IOC A;  1PRT F;  4IUT A;  3DHQ A;  1L1O C;  2O5I C;  1HJP A;  3VA7 A;  3J81 c;  2RSN A;  4E6I A;  3M9B A;  4UPA A;  4L5Q A;  4CDC C;  1PH8 A;  1QZG A;  3FKI B;  5C6A A;  3PO3 H;  3BVM A;  3UE1 A;  1BXT A;  1DJR D;  3HG9 A;  4KMU C;  3CCR A;  4A93 G;  3N6R A;  1KAW A;  2IX3 A;  1F9P A;  1YNJ C;  3VR2 A;  3I4N B;  1MIU A;  4RGT A;  4C3H G;  2LKV A;  1XWE A;  1I3Q H;  1LTR D;  2ZXP A;  3GV3 A;  4A3I H;  2CVR A;  3EN2 A;  1PRT D;  3HKZ G;  4LFA Q;  3PUW A;  2FMM A;  4IO9 A;  1IYJ B;  3CC2 A;  2VNU D;  2WII B;  1A15 A;  3I4L A;  1KC8 C;  4NXN L;  1GUS A;  3C1E A;  3K5M A;  3QIA A;  5C44 B;  5M3M G;  1QUQ B;  1KLG D;  2EYP A;  2JA5 G;  3KK7 A;  1EY8 A;  2XTI A;  2XRQ D;  2VW9 A;  1FNU A;  4A3F G;  1HZB A;  1ZYR C;  5KIX A;  3RZD H;  2QDB A;  1HUN A;  3V2T A;  2Z6B A;  2F03 A;  1D6E C;  2JE6 I;  1UAP A;  3SEB A;  4RH6 A;  3CCV A;  4LF9 Q;  4FVM A;  4H02 A;  3DM3 A;  2DJF C;  2YTX A;  3CHB D;  5H1S E;  4RGM A;  2QEX A;  1L1O B;  5C3E G;  1SBB B;  4DR3 L;  1AW7 A;  4X66 L;  1PYS B;  1D8L A;  3H15 A;  3RLO A;  5IP9 G;  2K5W A;  1CSQ A;  3TRE A;  5JPN C;  5FKA C;  3Q8D A;  4Y7N H;  1EIG A;  2OQK A;  4ZKB B;  3PGZ A;  5BN3 A;  5FO9 B;  5LL6 X;  4K5V A;  3GP7 A;  2BA0 A;  2G5D A;  5FLM G;  2TSS A;  3KLR A;  2VQE L;  3I70 A;  4AYB G;  4A3J H;  2WKD A;  2J7Z A;  4OON A;  1DGS A;  3GTO H;  1TWH B;  3DLL A;  3VA5 A;  4KJN A;  1SE8 A;  4IAL A;  4UP9 A;  1X3E A;  2SNM A;  3MAQ A;  1H9R A;  4JV5 Q;  4G7H C;  4RAU C;  3IL8 A;  4QMG A;  1TWC B;  1WTO A;  2JQO A;  4A3L H;  2O2L D;  4QB4 A;  3Q6S A;  2EIF A;  4KLK A;  3ZYY X;  3X3N A;  5J22 A;  3S1M H;  1CZG A;  4BBS G;  1DZ1 A;  4L5R C;  2NN6 G;  5LMU Q;  4HJ9 A;  4DR2 Q;  1IL2 A;  2ZTD A;  4RFB A;  2JYO A;  3ULL A;  2J4X A;  1BCP F;  3J7A F;  3PMF A;  4BY7 B;  4KD4 A;  1KLU D;  3PF4 A;  1J5E Q;  3HOW H;  3HOU B;  4X3U A;  2A6E D;  3MC0 B;  1ESR A;  1TWA H;  2E2I B;  3HOZ H;  1EEF D;  3W5O A;  2B2V C;  4KHP Q;  4NXM L;  1XPU A;  5GQO A;  1OXX K;  3OYY A;  3JAM E;  3FRP B;  4A3B H;  4LAA A;  2UXD L;  3E5S A;  1VQK A;  4PZ8 A;  2YTV A;  4P72 A;  4G57 A;  4KV6 A;  1JWM D;  1VQ6 A;  2HT1 A;  1BDO A;  4X3S A;  3TP5 A;  1BCP D;  4FF3 A;  2MQH A;  1FD7 D;  4DGZ A;  3AB9 A;  1E22 A;  1U9R A;  4PMW A;  4DKA C;  3J7Z C;  4XDX A;  2UXC Q;  1JJC B;  2AHO B;  1KD1 C;  2FXQ A;  4JBK A;  5FLX L;  2EYM A;  2ZJP A;  3A54 A;  5IT9 E;  3NEL A;  1ASY A;  4BA1 I;  2CFM A;  1PTO C;  1PYW D;  1Q1B A;  1TY2 A;  1EY4 A;  4F8M A;  4HIO A;  3H3V I;  1TU2 B;  5KND A;  4OL7 A;  2PPB C;  5JVG 3;  2KOL A;  4KK7 A;  3NEN A;  1HA5 A;  4F88 A;  1H9M A;  2RKS A;  4K6D A;  2L4N A;  3GTM B;  4GKJ L;  2SNS A;  2F0T A;  2R92 B;  4OO1 G;  3H3V H;  1EIF A;  2F4I A;  2JA6 G;  2RHQ B;  4KN4 C;  1FGU A;  1DXM A;  4A3M H;  5IIF A;  4LF5 L;  3HKZ E;  1P8L A;  2NVT H;  1CK1 A;  3LGJ A;  5T1I A;  1KAA A;  1EEI D;  5HY6 A;  4G4K A;  1MI2 A;  2KJX A;  3ULP A;  3R93 A;  4CDD C;  1NAP A;  1YHB A;  3I55 A;  1YZ6 A;  2EXD A;  1BR9 A;  3ND9 A;  5JEA H;  1IBM Q;  1MSH A;  1VQB A;  2K5Q A;  3F2B A;  1OXS C;  3J81 E;  3CME A;  1EU4 A;  2Z1C A;  3PQI A;  2P5Z X;  1FNV A;  4CKB A;  3K81 C;  5KNB A;  1NBW A;  2HHH L;  3D3R A;  1Z9F A;  5KGU A;  1R4Q B;  5EPL A;  4TSS A;  4XIG S;  1KDC A;  3ER0 A;  3UDX A;  2XVS A;  3A7L A;  2UUC Q;  5CV4 A;  4LUV A;  3JAM L;  2LS0 1;  1FJG Q;  2K32 A;  2F4V Q;  4B3R L;  4PZ6 A;  2LFN A;  4RKB A;  2JA7 G;  1PTO B;  2LSS A;  1A63 A;  3G71 A;  1WVL A;  3CU7 A;  1STN A;  1TS2 A;  2FFK B;  3K5N A;  1S3O A;  3CXC A;  4LF6 Q;  4BY1 B;  1EZ6 A;  1CT1 D;  3VR6 A;  1SYE A;  4OIK A;  3ULJ A;  1AE3 A;  3S2D B;  3S1Q B;  1MHW C;  1CZW A;  2JEA I;  1LLR D;  4AQY Q;  4AYB E;  2IY5 B;  4CKE A;  3EJI A;  4O2D A;  4JI7 Q;  4RHS A;  3CC7 A;  3WOF A;  5BR8 L;  1WTP A;  1YHQ A;  2Q2U A;  4RMF A;  5IYD H;  1JJG A;  1A0I A;  1HH2 P;  5JPM C;  3I4N G;  5GAE C;  3M4O H;  3KFU A;  4O1N A;  1QUQ A;  4IUR A;  1SEB D;  2CWA A;  1B44 D;  2K5D A;  1A3V A;  2VXW A;  3VDY A;  3H09 A;  5FOB B;  2EY5 A;  3Q22 A;  3KOJ A;  2EZV A;  1GUO A;  4DFA A;  4DU9 A;  1TKW B;  1AN8 A;  1CUK A;  1V1O A;  3MXG A;  4HIM A;  4EGV A;  1BBW A;  1YBY A;  4N8F A;  4J15 A;  5I6Y A;  2OEO A;  3S17 B;  1BKB A;  2GVB A;  2B2U A;  1QVG A;  3IKJ A;  1CTM A;  1I4H A;  2DGY A;  4C3I H;  3BZC A;  2RVL A;  3T13 A;  2CW0 C;  4RGO S;  4K0K L;  1HNZ Q;  5DEH A;  3RLN A;  2SDF A;  1WD1 A;  2KCN A;  4WFN 3;  1L1O A;  3TRZ A;  3EQL C;  3N52 A;  4H44 C;  3K6O A;  3RUZ A;  3PIO A;  1BNZ A;  2DNE A;  4A3D G;  2F0H A;  1RL2 A;  4JBJ A;  3S24 A;  2NVX B;  2YTY A;  2UUA L;  1A2T A;  1TWF H;  3LWU A;  2PYK A;  2OXP A;  5ELC A;  2UU9 L;  1SRO A;  3D4W A;  1G8Z D;  5CBA E;  1JE5 A;  2A73 B;  1ENC A;  2QA4 A;  1EY9 A;  3PO2 G;  1L0W A;  4A93 B;  5G3L D;  3H0G B;  4C3H B;  1MJE A;  3G48 A;  1K8A C;  1AH9 A;  2L55 A;  1WTH A;  1SDF A;  4KD3 A;  2Y0S G;  1F2Z A;  4DUZ Q;  1E1T A;  3HKZ B;  4JI3 L;  5EKK A;  4A3G H;  2OCE A;  2JA8 H;  4MNO A;  3DWA A;  1CA5 A;  4EQP A;  1JR0 D;  4CJ2 C;  2F0K A;  4OXP A;  1HZC A;  2BDO A;  5M3M B;  1A3U A;  2F0I A;  1IKL A;  2KHJ A;  2JA5 B;  2JP1 A;  1EY7 A;  3NQT A;  3W1B A;  4V0B A;  4YWK A;  2VQF Q;  1Y1W H;  5FJ8 G;  4A3F B;  3J80 c;  4C3J H;  3RZO B;  1HR0 Q;  3NQI A;  3DEP A;  1IYU A;  2IT1 A;  3C1F A;  3RN5 A;  1I6H H;  4JI6 L;  1SNC A;  1IHZ A;  1MSG A;  1DYQ A;  2E2H B;  2DY8 A;  3P75 A;  2Q2I A;  3DUZ A;  5C3E B;  3WDN A;  1NUC A;  1NJI C;  2R61 A;  1VQM A;  1HNX Q;  3L9A X;  2WKC A;  3W3A A;  2B63 G;  4LNQ A;  3FPP A;  2VUM H;  4I7A A;  5KYL A;  1Q7Y C;  3CF5 A;  1C0A A;  3VYR A;  1WYD A;  1B9M A;  2C35 B;  3GTL H;  5C4Z A;  3HRZ C;  3PUX A;  4GZY C;  3MXN B;  5LMU L;  1H9S B;  4DR2 L;  4AYB B;  5F2D A;  4V19 0;  3FEW X;  5BN5 A;  2R3Z A;  1N34 L;  1II3 A;  1CI3 M;  3UI2 A;  1HFG A;  1N36 L;  1D5Z C;  1SNM A;  1HZA A;  1RTN A;  2EXZ A;  1YNX A;  2JJQ A;  4JI0 Q;  1Y8N B;  3K58 A;  2IL8 A;  5FLX c;  4F7X A;  4KHP L;  4BWG B;  1QNU A;  1GJX A;  4JI5 Q;  1EQR A;  1TS3 A;  1PH5 A;  3CCM A;  1F2M A;  3MXP A;  5NUC A;  4GKK Q;  4IN3 A;  1YJN A;  4LF4 L;  1LTG D;  2VS1 A;  3S15 B;  1S5C D;  3HKS A;  1LT4 D;  2UXC L;  1C4Q A;  3IAY A;  4DR1 L;  2B2V A;  1EQQ A;  4Q5V A;  4GN4 B;  4YWL A;  5CV7 A;  4JI1 L;  2WB1 G;  2EYJ A;  1J9O A;  2M2L A;  3MVV A;  3R2I A;  4FNF A;  1WFQ A;  5I4D A;  2QCP X;  4QQB X;  4I65 A;  3AEV A;  1YNN D;  4LJZ C;  4JPB W;  1K83 H;  5A2Q E;  1HHV A;  1NY4 A;  1KHI A;  1N32 L;  1RF2 D;  2Z0S A;  2EQS A;  1TR5 A;  2L11 A;  3DXJ C;  5I6W A;  1IYV A;  5HGT A;  4UHV A;  3E0E A;  3F2C A;  1CQV A;  1UEB A;  5EGT A;  5K36 G;  2A19 A;  1B9N A;  1B7Y B;  2NWG A;  1LTI D;  2IX1 A;  1ILQ A;  4DV6 Q;  2L0C A;  5IYC H;  1FR3 A;  1VMC A;  4P73 A;  1V43 A;  3KLS A;  4CKC A;  3BYT B;  1JQY D;  4GLA C;  5IGE A;  2PMZ E;  4TVA B;  4PMC A;  3QG1 A;  1T5X D;  2QKI C;  1NMF A;  2NUC A;  3I2Z A;  3JAM c;  4CDE C;  5IP7 G;  5IE8 A;  3TP6 A;  1VDZ A;  2JA6 B;  1F77 A;  3M85 A;  2EJM A;  2K5N A;  2A74 C;  2Y0S E;  1RD9 D;  3KYH C;  4A3K H;  4B9X A;  5K5P A;  1J8I A;  1MJC A;  4R4I A;  4A76 A;  2Z4I A;  1K73 C;  1SJH D;  1K0R A;  1KNE A;  1GO3 E;  2NVQ B;  2CKZ B;  4YY3 Q;  2EJG C;  2R93 H;  4A3L G;  1AZP A;  2L15 A;  1HTP A;  5ELE A;  1TXY A;  3G4S A;  4GNX A;  1AZQ A;  2UUC L;  4WJW A;  1H9K A;  4HMI A;  1FJG L;  1F2L A;  3K8A A;  4ABN A;  1BCP C;  1ROD A;  1TS5 A;  4JCV E;  1XMO Q;  3AYH B;  4R4Q A;  2B8G A;  4XT3 B;  2UXB Q;  1SSO A;  1IBK Q;  1BBX C;  3EFX D;  3BDO A;  4GN3 B;  1D7Q A;  1QB5 D;  3HOZ G;  1TWH H;  4PG3 A;  4JI4 L;  1EYC A;  4R8N A;  1JC7 A;  1Y69 U;  3TZD A;  4O0A A;  5T1G A;  3T51 B;  3PIO 3;  2Z6K C;  3S16 B;  1Q46 A;  2K33 A;  5AFW A;  3KJP A;  5C5L A;  4JI7 L;  1R9T B;  1R4P B;  4RA8 A;  4CJ1 B;  1TWC H;  2R7Z G;  4DR6 L;  5E4W C;  4B3T Q;  1OXU A;  3GTG H;  2K4K A;  2E5L L;  5A2Q L;  5CV5 A;  4F87 A;  3MHB A;  2IPK D;  4L8J A;  1PZJ D;  4BY7 H;  2F0Q A;  1FNW A;  1E2Z A;  2PQA B;  4DAY B;  3HOU H;  2JN4 A;  4K6L A;  4N9T A;  5KYI A;  3T1Y Q;  2XWJ B;  4OX9 Q;  3STB C;  4QUC A;  2E2I H;  1A62 A;  3J80 E;  4IQZ A;  1T5E A;  4K8I A;  1JOQ A;  3MZ5 A;  2HDL A;  4I7Z C;  3H0G G;  4RHR A;  1SRU A;  3TS0 A;  1C9O A;  3MTS A;  3K7A B;  1FYC A;  2E75 C;  3PF5 A;  1QVF A;  3SHL A;  1LT3 D;  1ENA A;  2M9V A;  2IW3 A;  2EE1 A;  2J0T D;  1K3B C;  4A3M G;  1SFO B;  1X3F A;  4X3T A;  3LX0 A;  3EVQ A;  5D3D A;  5JVH 3;  3NP8 A;  4X64 L;  2E2J B;  4EVO A;  3H91 A;  1G2S A;  1JT8 A;  1YVC A;  4AH6 A;  2N78 A;  3TP7 A;  4HJ7 A;  3KLS X;  1WCM H;  1GM5 A;  1WTQ A;  3S2H B;  4HCS A;  1O7I A;  2F0O A;  4IFD I;  3ZJY C;  3A56 A;  3PUZ A;  3AFP A;  2WB1 E;  4RGN A;  4DV1 L;  1VQN A;  2HQL A;  1RHP A;  5GAH C;  3I91 A;  4NKL A;  3ND8 A;  1I50 B;  3GTM H;  2R92 H;  4A3D B;  3M3Y H;  1KRS A;  2PCF B;  1YHA A;  2NYZ D;  4QJF A;  4FYD A;  1SE4 A;  5FLX E;  3GV6 A;  2FJ2 A;  2EYL A;  4RWS C;  2PMZ B;  1IW7 D;  3PO2 B;  3DWQ A;  3MXN A;  4S3S A;  4B3M Q;  2HCI A;  1Q1E A;  2Q2H A;  1I4Q A;  2ZM6 L;  1X9N A;  4LFB L;  4HAE A;  3A8I E;  1SN8 A;  3I4M H;  1LTS D;  3T56 B;  1BQQ T;  2KEC A;  3S1N B;  3W1G A;  1Q86 C;  2Y0S B;  1AP0 A;  2VL6 A;  3G6J B;  3KBX A;  2K28 A;  1UWV A;  4FXK C;  3SK4 A;  1HR0 L;  4YWM A;  2AWO A;  4DV5 Q;  1XPO A;  4L5T A;  1Z47 A;  4HJ5 A;  1I94 L;  4DV4 Q;  3OPO A;  4CDF C;  2RDG A;  2BE5 D;  5JAV A;  1SAP A;  3J80 L;  5IYD G;  5ELN A;  1KTK A;  2IHE A;  4ZAI A;  2A68 D;  1CKN B;  5M5W B;  3OOC A;  4NP5 A;  1IBL Q;  4WJ3 M;  1STB A;  3HS0 C;  3D8G A;  1XYI A;  3TSS A;  3JAM i;  2MNA A;  2WIN B;  1PZK D;  1X56 A;  3PIP A;  4KI0 A;  1PH6 A;  3UDG A;  1V1P B;  4K2L A;  3S1Q H;  5D14 A;  1PVO A;  2B8F A;  4QIW E;  2LXJ A;  5C4X H;  4APV A;  4FF2 A;  4BXX H;  4DV0 L;  4MHE A;  4N8X 1;  1NR4 A;  1MBY A;  3ERQ A;  1PH7 A;  2MFI A;  2I5M X;  3CCE A;  2K5H A;  4FF4 A;  5EKI A;  1K8O A;  4ZKC B;  1A6X A;  2B63 B;  5ELD A;  1PZI D;  4ZRZ A;  5CC4 A;  3C3L A;  5I2X A;  4YCW A;  3DMU A;  4DNT B;  3HEJ A;  1U4L A;  5DM6 3;  1PHJ A;  4FXG C;  1ONL A;  4OEL B;  4POG A;  3MXU A;  1SR3 A;  1VS0 A;  5A35 A;  2VZA A;  3FDT A;  2PI2 E;  2DNC A;  1JOO A;  2O5J C;  5KEE A;  5C0X J;  1IXR A;  4JC0 A;  3GTJ H;  3CRL C;  2HIX A;  5IGF A;  1W3S A;  3SK8 A;  4DR5 Q;  1Q3L A;  3ITP A;  1X3G A;  4L6T B;  4DUY L;  1STY A;  1CM9 A;  1JE4 A;  1CKO A;  5JOB A;  2B2T A;  4DK6 C;  4LFC L;  4A75 A;  3S17 H;  5LL6 S;  2MJ8 A;  2R7F A;  2N8N A;  1F9Q A;  2F0N A;  2OWO A;  5CGK A;  2KHS A;  3ERS X;  2JA8 G;  4IPG A;  1QIL A;  2A69 D;  2H4O A;  4C56 C;  2V1C C;  4DV3 L;  1OO9 B;  4RCO A;  4DR7 Q;  1PFM A;  4DR4 L;  2FHT A;  2NVX H;  3VYT A;  4C1N I;  4A3E H;  3NK9 A;  1O78 A;  1PFN A;  2C9O A;  3J81 i;  3QO2 A;  2EYO A;  1DCZ A;  1CQF A;  2WB1 B;  1Z7T A;  2NZ1 D;  4DK1 A;  1Q8K A;  3NTI A;  1PA6 A;  1EWC A;  1IZ6 A;  3PSI A;  3OTO Q;  4C3J G;  3RZD B;  4A93 H;  2RCN A;  1MD2 D;  4LMQ D;  2F0F A;  4C3H H;  4HCE A;  1CKM A;  1XXG A;  1TVX A;  2A5H A;  3PCO B;  1I6V C;  3HP3 A;  1S4Z A;  3HOY G;  1LAC A;  3H6M A;  4WRD A;  1HQM C;  4R4C A;  4LF8 Q;  4NW2 A;  4P71 A;  5LMN Q;  4YCV A;  2Q2T A;  2JEB I;  5DNF A;  1DOK A;  2F0P A;  2JA5 H;  1XNQ Q;  1PXU A;  1CA6 A;  4ULL A;  4OHJ A;  2ZTE A;  3UDF A;  4OWT B;  1YNJ D;  1WTX A;  4Y7N B;  4IPH A;  2PQA A;  4DAY A;  4JI8 Q;  1SND A;  1QNK A;  4KKT A;  4DF7 A;  4A3F H;  3R8B A;  4P2C B;  4YHH L;  4PMB A;  1PMR A;  4B3S Q;  2F3I A;  2PZW A;  4OEM B;  4JBM A;  4A3J B;  3QR8 A;  4QY7 A;  5COR A;  4BBR H;  3GTO B;  1E0B A;  3P20 A;  3D31 A;  3HOX G;  5J3B A;  1Q82 C;  2UXB L;  3A7A B;  2K14 A;  4J8Q A;  1OXT A;  3BDC A;  4QCL A;  3Q23 A;  2E2H H;  1GUG A;  3PV0 A;  3FP9 A;  3S1R H;  5CV6 A;  3M7N A;  4K2K A;  2WAQ G;  1EQV A;  1Y8P B;  4JOI C;  1M4V A;  3S1M B;  2BA1 A;  1BOS A;  1XX8 A;  3K59 A;  1K8G A;  5GAG C;  1ZYR D;  2EPB A;  3HOV H;  4DV7 L;  4JYA L;  2AUJ D;  3P1H A;  2HUG A;  3PUV A;  1HXY D;  1PH2 A;  4POF A;  4QIW B;  3CRK C;  5FLM H;  3OWE B;  4EQN A;  1VQJ A;  2AQ1 B;  1P16 A;  1VQ7 A;  1TWA B;  3OW7 A;  1UE6 A;  2EY2 A;  3HOZ B;  3LWE A;  5C0X G;  4DV2 Q;  1KXL A;  1VQO A;  5E7N A;  2B29 A;  2Z6K A;  4GS3 A;  1GUT A;  3E6Z X;  4KN7 C;  4JW0 A;  1AE2 A;  2LXK A;  2NN6 I;  3I73 A;  1EQT A;  4ALP A;  4K14 A;  2R7Z B;  2LY7 A;  1NE3 A;  2K5V A;  3CPW A;  5G3L F;  4BBS H;  4WOR A;  2NN6 H;  2X69 A;  5KRU A;  3ICE A;  1MGS A;  4EX5 A;  2CWP A;  1Y1V G;  2HDM A;  1L0X B;  1AEX A;  5M5X H;  3LNN A;  2A6H C;  4IUV A;  4LFA L;  3MFY A;  2NZO A;  5IYC G;  1Q81 C;  1DOL A;  1EU3 A;  1SYF A;  2Z8L A;  4C1N K;  2I46 A;  3HFZ B;  4FF1 A;  3T53 B;  2I5L X;  1QJO A;  3GTK H;  4X6A H;  1TWG H;  1TY0 A;  1ENF A;  2ZJQ A;  3RNU A;  3D6C A;  2YU9 B;  1SNQ A;  1U4P A;  1F9R A;  3K57 A;  4CJ0 B;  4A3M B;  4NXN Q;  5CR3 A;  4MN3 A;  4A3K G;  1YJW A;  4LF7 Q;  1CKN A;  2D0P A;  2SEB D;  2XNA C;  3KUP A;  5M3F H;  1WTV A;  3V05 A;  1JOK A;  4GN5 A;  4LF9 L;  1PTO F;  3PIP 3;  2KCT A;  2NVY H;  1JWU D;  3J7Y W;  1BUV T;  1ICW A;  4OO1 I;  5EQ0 A;  2GA4 B;  4XXE A;  2MPM A;  2ZXO A;  5CBE E;  1SYG A;  1OXV A;  1LUZ A;  2AUK A;  5ISR A;  1HTL D;  1HRJ A;  1EFI D;  4X3K A;  4FO2 A;  1PH9 A;  2EVB A;  1VQL A;  4OO1 H;  3BVG A;  1B1Z A;  5DLQ E;  2JA6 H;  3K0X A;  2L9H A;  1NR2 A;  1LV9 A;  3TME A;  4NPS A;  4B08 A;  4X66 Q;  2F0E A;  1TII D;  1CSP A;  3DM1 A;  1PTO D;  5IOC A;  4DV4 L;  5HGQ A;  3H94 A;  2NVQ H;  3FHW A;  3DWP A;  4IUQ A;  4A3C H;  2X6G A;  2RF4 A;  4Z9C B;  1UUP A;  3X3M A;  2L5T A;  2UUB Q;  4HMJ A;  2VQE Q;  4TQU S;  4JV5 L;  1IBL L;  3OMC A;  1ICF B;  3CKI B;  1PRT C;  2I07 B;  4HN7 A;  4ZLT F;  3PUY A;  4MZ9 A;  2XIW A;  1Y14 B;  2F3V A;  2WAC A;  3VYS A;  4GLX A;  3SXH A;  3I56 A;  1J5E L;  5ELO A;  1HZ9 A;  2MO0 A;  3PO3 G;  3NEM A;  1U4M A;  2D0O A;  1RTO A;  2N3S A;  3CCQ A;  2WAQ E;  2F52 A;  1I5F A;  2OTL A;  1R9T H;  3OMG A;  2KCM A;  2M00 A;  1EY0 A;  1PFS A;  3A55 A;  5IOD A;  2JA7 H;  1ESF A;  1O7Z A;  5C4H A;  1E7Z A;  2DN8 A;  4C2M B;  4A3I G;  5EJW A;  3QOL A;  1ET9 A;  2H5X A;  2F0G A;  4R4T A;  1V8Q A;  3GD7 A;  4GLV B;  1WTR A;  2JA9 A;  4KTA A;  1X3Q A;  4ILW A;  3SE0 A;  3CCS A;  3OW2 A;  2UXD Q;  1WCM G;  1SXT A;  2OTJ A;  5IGB A;  1PYB A;  1M1K C;  4HID A;  3SK6 A;  3OSO A;  3FMC A;  4MTK A;  1ZEQ X;  4FDB A;  1C48 A;  4IZ8 A;  2CCZ A;  2VB3 X;  1F2Y A;  3FPU B;  3FKI H;  5C4J B;  4G7O C;  1SYC A;  2K7V A;  3TEH B;  2K04 A;  3I4N H;  3Q0A A;  3GTQ B;  1YJ9 A;  3ERO A;  2RQX A;  1TWF B;  1SFO H;  1U4R A;  1EYA A;  4ODG A;  3S14 B;  3KBG A;  5IGD A;  1S5D D;  3A74 A;  1FL0 A;  5M9O A;  2XWB B;  1PV4 A;  2BE5 C;  2E2J H;  3E9H A;  3K80 C;  1PRT B;  3P7J A;  5FK9 C;  1U0L A;  2A68 C;  3A5U A;  5C44 H;  1EZ8 A;  5JEA J;  4GKJ Q;  3I4M G;  1L0Y B;  1ZXT A;  2B3G A;  5M5Y B;  1GUN A;  3OTO L;  5LHY 1;  2EDG A;  3NHH A;  2JA8 B;  4LF5 Q;  2GVA A;  1U5K A;  4JVZ A;  4DXF A;  1I4X A;  2IWH A;  1IBM L;  1O80 A;  3KF6 B;  4JK1 C;  4A3D H;  4A3J G;  1WJJ A;  5DAU A;  1SMX A;  4X62 Q;  2A6E C;  4RG1 A;  4L63 B;  4KKU A;  3IFD A;  4WJ4 A;  4K5W A;  1VCI A;  1Y8O B;  2KHI A;  1B70 B;  3D4R A;  1IL8 A;  5LMN L;  4C3J B;  2EYH A;  1UE5 A;  3PO2 H;  1JIC A;  1GXD C;  5IYB H;  2DY7 A;  1K0S A;  2CW0 D;  1AFP A;  2IX0 A;  2AQ3 B;  4CHT B;  1I6H B;  4JI8 L;  4ZK9 B;  2F4V L;  4R9W A;  1VQD A;  1D1K A;  1EIH A;  1LM0 A;  2C5C A;  2Q8R E;  3HOY B;  3GTP B;  3HOW G;  2PW7 A;  4J6H A;  2ES2 A;  4LF6 L;  2PI2 A;  4BXX G;  3CCU A;  1N33 Q;  1I4R A;  3TP8 A;  4B3R Q;  5CMD A;  3R3O A;  1KDA A;  4A3B G;  1CHP D;  2RCF A;  4AQY L;  2VUM B;  4OGQ C;  1RJT A;  1STH A;  1SJE D;  4N9P A;  5FJ8 H;  1I4G A;  3CCL A;  3CW2 C; 
#chains in the Genus database with same CATH homology
 2BOS A;  2XSC A;  3GTL B;  2R6G A;  5FO8 B;  2EJF C;  4ME5 A;  2ENB A;  4DN4 M;  3HOX B;  1G6Z A;  1RCV D;  1NSN S;  4U68 A;  4U67 3;  3U9S A;  3MFG A;  2CQA A;  1SE3 A;  2N55 A;  2WAQ B;  2EY6 A;  3CQZ B;  1BO0 A;  1PDQ A;  1Q12 A;  1S5E D;  5E1F A;  4K8J A;  1EL0 A;  2K1B A;  1GOZ A;  1KDB A;  5BN4 A;  3TN2 A;  2F0D A;  1F9S A;  2RDH A;  1IKM A;  1VF5 C;  4EQO A;  1HA6 A;  3URY A;  1E2W A;  1BCP B;  3QB3 A;  4PQX A;  4KY5 A;  5KNC A;  2XN9 C;  1Q90 A;  2K6A A;  4NMZ A;  1H9J A;  1Z6H A;  5JEA G;  1K83 B;  2KED A;  2F0J A;  2E74 C;  1EY5 A;  4H0L C;  5DM7 3;  1Y1V B;  4IFD H;  1EOT A;  3VR4 A;  2L12 A;  1QWY A;  3G7L A;  2BCO A;  4HTH A;  3S9W A;  2PQE A;  4HR7 B;  4XQN A;  1BF4 A;  2XRS D;  4KHV A;  3M4Y A;  1QOH A;  1H9S A;  3BZD B;  1D5X C;  5CV9 A;  4ID6 A;  4Q0F A;  4A3K B;  2F0W A;  5FO7 B;  1HUM A;  1HFN A;  2EY1 A;  1VF7 A;  4KJO A;  5K36 H;  5C5M A;  1WD0 A;  1O7Y A;  2R93 B;  5IGG A;  5I9P A;  4R8I A;  1STG A;  3TDQ A;  1SMY D;  1B3A A;  2CHB D;  1LTA D;  1PTO H;  2K01 A;  4XQJ A;  1LTB D;  1LAB A;  2F0L A;  4DAV A;  4IUP A;  1STE A;  5EPJ A;  3BDL A;  1WTW A;  2RBM A;  3C46 A;  4QUF A;  1QCB D;  4C3I G;  3GTG B;  3QWN A;  1LT6 D;  3I90 A;  2ZXR A;  5C3X A;  5E3F A;  2Q8T A;  1D1I A;  3IFT A;  1SYB A;  3Q24 A;  4QF4 A;  3VR5 A;  2EOT A;  5TSS A;  2K05 A;  4TKO B;  3PO3 B;  2H1E A;  2RDF A;  5JJZ A;  2D9U A;  1JB3 A;  1I3Q B;  3T4A C;  2F1M A;  4A3I B;  3D6W A;  3NE5 B;  4XT1 B;  3TZU A;  1TS4 A;  2FIN B;  1SE2 A;  2D5D A;  2B2Y C;  3AMU A;  3L7Z C;  2L1B A;  2HQE A;  4O42 A;  4RCN A;  1WCM B;  2PO4 A;  1CFM A;  5EKL A;  1JCK B;  3TBI B;  4HSV A;  4ZUI A;  2NBF A;  5D65 A;  5ELF A;  1M8A A;  3QOJ A;  1D5M C;  3M3Y B;  2D62 A;  1ILP A;  2Z4H A;  1CHQ D;  1LT5 D;  4MIU A;  2NTT A;  3J7A V;  3MA2 B;  3SDZ A;  3AU7 A;  3I4M B;  1PLF A;  3NWT A;  2N88 A;  3NTH A;  1VMP A;  3DEO A;  4ZQ3 A;  3A8J E;  1C8C A;  2IJ0 A;  3I3C A;  3T16 A;  2B2W C;  5IGC A;  1ET6 A;  3MWY W;  1DOM A;  2PNR C;  1DD2 A;  1QE6 A;  2WV6 D;  1SYD A;  3R2T A;  2QF7 A;  3H3V C;  1YNN C;  4BS9 A;  1X32 A;  3HOW B;  5C4X B;  1S5F D;  2HCC A;  5IT9 L;  2ID0 A;  1QG7 A;  3NWS A;  4A3B B;  1FGB D;  1S5B D;  3L3O C;  1EYD A;  5ELB A;  4IUN A;  3BS1 A;  1HPC A;  4FXD A;  2KUM A;  3O13 A;  1TQO A;  3HZX A;  3I8Z A;  4XTC S;  2MP1 A;  3GTJ B;  2AWN A;  3D4D A;  3NPP A;  1G29 1;  1GHJ A;  3SR1 A;  4DA2 A;  2ZT9 C;  2G9D A;  2YYZ A;  1EY6 A;  1B4O A;  1KAB A;  1DM0 B;  1JOR A;  4B9W A;  2F0S A;  4H13 C;  2PZT A;  3EA6 A;  1UNS A;  2PW5 A;  4IFD J;  4KKS A;  4KY7 A;  3J81 L;  1TT2 A;  1RKN A;  4K5X A;  3U9O A;  2KCC A;  5D3I B;  3RD4 A;  5COY A;  4A3E B;  2NVT B;  2KVM A;  3NTK A;  3SVM A;  2KA7 A;  5I2Y A;  4ZUJ A;  4XQQ A;  1O7L A;  4HED A;  3K5L A;  3KF8 A;  1V1P A;  2K03 A;  3FVQ A;  3NBI A;  4DAP A;  2Q8I B;  1LTT D;  3NUC A;  2MGS A;  4XYO A;  1KNA A;  1ZKO A;  2TMP A;  3NXW A;  2D2C C;  4UAI A;  2KEE A;  1E2V A;  1X3P A;  3E0J A;  4M1U B;  4UDU C;  4PNY A;  4PV1 C;  4FP5 D;  4LK1 C;  3W2D A;  3ONA B;  4BBR B;  1LO5 D;  3HGB A;  2RA4 A;  3OIP A;  3S1R B;  1SNP A;  3NBH A;  2B39 A;  3V96 A;  3HOV B;  2KQ3 A;  1K8M A;  3VR3 A;  5J39 A;  3M4O B;  4KHZ A;  5EBC A;  1DON A;  2NB0 A;  4CGY B;  2V4D A;  4G7Z C;  3QJY A;  2MUY A;  3K5O A;  4HSP A;  2OF1 A;  2X6L A;  1I4P A;  3C2P A;  1SNO A;  1JWS D;  2F0V A;  2F0M A;  1ML0 D;  1IW7 C;  4DNR B;  2RSO A;  2MHV A;  4BBS B;  2B2T C;  4C3I B;  1RDP D;  5EBD A;  1HCZ A;  2QIL A;  5E4X A;  5C0X I;  4IFD G;  5M5X B;  2JSO A;  2EYF A;  4KY6 A;  2QEJ C;  4YIJ A;  2FMC A;  4ZYS A;  5C0X H;  2G9H D;  3A8K E;  1G91 A;  5EPK A;  5HUR A;  3GTK B;  3I72 A;  1TWG B;  1A2U A;  5J1Z A;  2ICI A;  3BVZ A;  1STA A;  1SMY C;  4J1M A;  1GHK A;  2BDN A;  1W6K A;  4A3G B;  2B2Y A;  4RKL A;  5M3F B;  1B50 A;  5C3W A;  1W6J A;  4M8A A;  4H7B A;  4OIJ A;  1Q8I A;  2NVY B;  1PFB A;  2F0U A;  2LMC B;  3RLF A;  1B2T A;  1Y1W B;  3RMH A;  1UEA B;  4DK0 A;  5CV8 A;  3F2U A;  3GQB A;  4BA2 I;  1HQR D;  3M7G A;  3OHX C;  2PZU A;  2NTS A;  3SK5 A;  3GO5 A;  1GUW A;  1A3T A;  2A6H D;  2VB2 X;  3BYY B;  3K0Y A;  3OIQ A;  4IUU A;  3NSW A;  4DXG A;  2WP8 J;  1G2T A;  2AQ2 B;  1B53 A;  2ICE C;  2E76 C;  1D2B A;  3MEH A;  2F3W A;  1NCV A;  3OWF A;  2SOB A;  2A69 C;  2JXM B;  2B2W A;  2E2D C;  5I9O A;  4CBV A;  4NDX A;  3VYU A;  2OT2 A;  5CYU A;  2O4X A;  1XTC D;  4TRD A;  4XYQ A;  2JA7 B;  4JBW A;  2B2U C;  1EWH A;  3BG3 A;  1PRT F;  4IUT A;  3DHQ A;  2O5I C;  3VA7 A;  2RSN A;  4E6I A;  3FKI B;  5C6A A;  3BVM A;  1BXT A;  1DJR D;  3HG9 A;  4KMU C;  3N6R A;  2IX3 A;  1F9P A;  1YNJ C;  3VR2 A;  3I4N B;  4RGT A;  4C3H G;  2LKV A;  1XWE A;  1LTR D;  2ZXP A;  3GV3 A;  2CVR A;  1PRT D;  3PUW A;  2FMM A;  2VNU D;  2WII B;  1A15 A;  3I4L A;  1GUS A;  3C1E A;  3K5M A;  3QIA A;  5C44 B;  1KLG D;  2EYP A;  3KK7 A;  1EY8 A;  2XRQ D;  1FNU A;  1ZYR C;  5KIX A;  2QDB A;  1HUN A;  3V2T A;  2F03 A;  1D6E C;  2JE6 I;  1UAP A;  3SEB A;  4RH6 A;  4FVM A;  3CHB D;  4RGM A;  1SBB B;  1AW7 A;  2K5W A;  5JPN C;  5FKA C;  1EIG A;  4ZKB B;  5BN3 A;  5FO9 B;  5LL6 X;  4K5V A;  3GP7 A;  2BA0 A;  2TSS A;  3KLR A;  3I70 A;  2WKD A;  2J7Z A;  1TWH B;  3VA5 A;  4KJN A;  4IAL A;  2SNM A;  3MAQ A;  1H9R A;  4G7H C;  4RAU C;  3IL8 A;  4QMG A;  1TWC B;  1WTO A;  2O2L D;  4QB4 A;  3Q6S A;  3ZYY X;  3X3N A;  5J22 A;  1CZG A;  1DZ1 A;  2NN6 G;  4RFB A;  2JYO A;  2J4X A;  1BCP F;  3J7A F;  3PMF A;  4BY7 B;  4KD4 A;  1KLU D;  3HOU B;  4X3U A;  2A6E D;  3MC0 B;  1ESR A;  2E2I B;  1EEF D;  2B2V C;  3JAM E;  1OXX K;  3FRP B;  4LAA A;  3E5S A;  4G57 A;  4KV6 A;  1JWM D;  1BDO A;  4X3S A;  3TP5 A;  1BCP D;  4FF3 A;  1FD7 D;  4DGZ A;  4PMW A;  1U9R A;  3AB9 A;  4XDX A;  5FLX L;  2EYM A;  3A54 A;  5IT9 E;  4BA1 I;  1PTO C;  1PYW D;  1Q1B A;  1TY2 A;  1EY4 A;  4F8M A;  5KND A;  1TU2 B;  4OL7 A;  2PPB C;  5JVG 3;  2KOL A;  4KK7 A;  1HA5 A;  4F88 A;  1H9M A;  2RKS A;  4K6D A;  2L4N A;  3GTM B;  2SNS A;  2F0T A;  2R92 B;  4OO1 G;  2F4I A;  4KN4 C;  1DXM A;  5IIF A;  1CK1 A;  5T1I A;  1KAA A;  1EEI D;  4G4K A;  1MI2 A;  2KJX A;  3R93 A;  1NAP A;  5JEA H;  1BR9 A;  3ND9 A;  1MSH A;  2K5Q A;  1OXS C;  3J81 E;  1EU4 A;  2Z1C A;  1FNV A;  4CKB A;  5KNB A;  3D3R A;  5KGU A;  1R4Q B;  5EPL A;  4TSS A;  4XIG S;  1KDC A;  2XVS A;  3A7L A;  5CV4 A;  3JAM L;  2LS0 1;  2K32 A;  2LFN A;  4RKB A;  1PTO B;  1WVL A;  3CU7 A;  1STN A;  1TS2 A;  2FFK B;  3K5N A;  4BY1 B;  1EZ6 A;  1CT1 D;  3VR6 A;  1SYE A;  4OIK A;  3S2D B;  3S1Q B;  1CZW A;  2JEA I;  1LLR D;  4CKE A;  3EJI A;  4RHS A;  3WOF A;  1WTP A;  5JPM C;  4O1N A;  4IUR A;  1SEB D;  1B44 D;  2K5D A;  1A3V A;  2VXW A;  3H09 A;  5FOB B;  2EY5 A;  3Q22 A;  2EZV A;  1GUO A;  4DFA A;  4DU9 A;  1TKW B;  1AN8 A;  1V1O A;  3MXG A;  4EGV A;  5I6Y A;  2OEO A;  3S17 B;  2B2U A;  3IKJ A;  1CTM A;  1I4H A;  2RVL A;  3T13 A;  2CW0 C;  4RGO S;  5DEH A;  2SDF A;  1WD1 A;  2KCN A;  4WFN 3;  3EQL C;  3N52 A;  4H44 C;  3K6O A;  3RUZ A;  1BNZ A;  2DNE A;  2F0H A;  2NVX B;  1A2T A;  3LWU A;  2PYK A;  2OXP A;  5ELC A;  3D4W A;  1G8Z D;  5CBA E;  2A73 B;  1ENC A;  1EY9 A;  4A93 B;  5G3L D;  3H0G B;  4C3H B;  2L55 A;  1SDF A;  4KD3 A;  1F2Z A;  3HKZ B;  5EKK A;  3DWA A;  1CA5 A;  4EQP A;  1JR0 D;  4CJ2 C;  2F0K A;  2BDO A;  5M3M B;  1A3U A;  2F0I A;  1IKL A;  2JA5 B;  2JP1 A;  1EY7 A;  3NQT A;  4V0B A;  4A3F B;  3RZO B;  3NQI A;  3DEP A;  1IYU A;  2IT1 A;  3C1F A;  1SNC A;  1IHZ A;  1MSG A;  1DYQ A;  2E2H B;  2DY8 A;  3P75 A;  3DUZ A;  5C3E B;  3WDN A;  1NUC A;  2R61 A;  3L9A X;  2WKC A;  3W3A A;  3FPP A;  5KYL A;  3VYR A;  1B9M A;  5C4Z A;  3HRZ C;  3PUX A;  4GZY C;  1H9S B;  4AYB B;  5F2D A;  4V19 0;  3FEW X;  5BN5 A;  2R3Z A;  1II3 A;  1CI3 M;  3UI2 A;  1HFG A;  1D5Z C;  1SNM A;  1RTN A;  2EXZ A;  1Y8N B;  3K58 A;  2IL8 A;  4F7X A;  4BWG B;  1QNU A;  1GJX A;  1TS3 A;  1F2M A;  3MXP A;  5NUC A;  4IN3 A;  1LTG D;  3S15 B;  1S5C D;  1LT4 D;  1C4Q A;  3IAY A;  2B2V A;  4Q5V A;  5CV7 A;  2EYJ A;  1J9O A;  2M2L A;  3MVV A;  3R2I A;  4FNF A;  5I4D A;  2QCP X;  4I65 A;  1YNN D;  4LJZ C;  5A2Q E;  1HHV A;  1RF2 D;  5I6W A;  1TR5 A;  2L11 A;  3DXJ C;  1IYV A;  5HGT A;  1CQV A;  5EGT A;  5K36 G;  1B9N A;  2NWG A;  1LTI D;  2IX1 A;  1ILQ A;  2L0C A;  1FR3 A;  1VMC A;  1V43 A;  3KLS A;  4CKC A;  3BYT B;  1JQY D;  5IGE A;  4PMC A;  3QG1 A;  1T5X D;  2QKI C;  2NUC A;  3TP6 A;  1VDZ A;  2JA6 B;  1F77 A;  3M85 A;  2EJM A;  2A74 C;  1RD9 D;  4B9X A;  5K5P A;  1J8I A;  2Z4I A;  1SJH D;  1KNE A;  2NVQ B;  2EJG C;  1AZP A;  1HTP A;  5ELE A;  1AZQ A;  4WJW A;  1H9K A;  4HMI A;  1F2L A;  4ABN A;  1BCP C;  1ROD A;  1TS5 A;  2B8G A;  4XT3 B;  1SSO A;  1BBX C;  3EFX D;  3BDO A;  1QB5 D;  1EYC A;  4R8N A;  1JC7 A;  1Y69 U;  3TZD A;  5T1G A;  3T51 B;  3PIO 3;  3S16 B;  2K33 A;  5AFW A;  5C5L A;  1R9T B;  1R4P B;  4RA8 A;  4CJ1 B;  5E4W C;  1OXU A;  5A2Q L;  5CV5 A;  4F87 A;  3MHB A;  2IPK D;  4L8J A;  1PZJ D;  2F0Q A;  1FNW A;  1E2Z A;  4K6L A;  4N9T A;  5KYI A;  2XWJ B;  4QUC A;  3J80 E;  4IQZ A;  1T5E A;  4K8I A;  1JOQ A;  3MZ5 A;  2HDL A;  4I7Z C;  4RHR A;  3MTS A;  3K7A B;  1FYC A;  2E75 C;  3SHL A;  1LT3 D;  1ENA A;  2M9V A;  2IW3 A;  2EE1 A;  2J0T D;  1SFO B;  4X3T A;  3LX0 A;  3EVQ A;  5D3D A;  5JVH 3;  3NP8 A;  2E2J B;  4EVO A;  3H91 A;  1G2S A;  3TP7 A;  3KLS X;  1WTQ A;  3S2H B;  4HCS A;  2F0O A;  4IFD I;  3A56 A;  3PUZ A;  4RGN A;  1RHP A;  3I91 A;  4NKL A;  3ND8 A;  1I50 B;  4A3D B;  2PCF B;  2NYZ D;  4FYD A;  1SE4 A;  5FLX E;  3GV6 A;  2FJ2 A;  2EYL A;  4RWS C;  2PMZ B;  1IW7 D;  3PO2 B;  3DWQ A;  3MXN A;  4S3S A;  2HCI A;  1Q1E A;  1I4Q A;  4HAE A;  3A8I E;  1LTS D;  3T56 B;  1BQQ T;  2KEC A;  3S1N B;  2Y0S B;  1AP0 A;  3G6J B;  3KBX A;  2K28 A;  4FXK C;  3SK4 A;  2AWO A;  1Z47 A;  3OPO A;  2RDG A;  2BE5 D;  5JAV A;  1SAP A;  3J80 L;  1KTK A;  4ZAI A;  2A68 D;  5M5W B;  3OOC A;  4NP5 A;  1STB A;  3HS0 C;  3D8G A;  1XYI A;  3TSS A;  2WIN B;  1PZK D;  4KI0 A;  1V1P B;  4K2L A;  5D14 A;  2B8F A;  4FF2 A;  4MHE A;  1NR4 A;  1MBY A;  3ERQ A;  4FF4 A;  5EKI A;  1K8O A;  4ZKC B;  1A6X A;  2B63 B;  5ELD A;  1PZI D;  4ZRZ A;  5CC4 A;  3C3L A;  5I2X A;  3DMU A;  4DNT B;  3HEJ A;  1U4L A;  5DM6 3;  4FXG C;  1ONL A;  3MXU A;  5A35 A;  3FDT A;  2DNC A;  1JOO A;  2O5J C;  5KEE A;  5C0X J;  3CRL C;  5IGF A;  3SK8 A;  1Q3L A;  3ITP A;  4L6T B;  1STY A;  1CM9 A;  1JE4 A;  5JOB A;  2B2T A;  5LL6 S;  2MJ8 A;  1F9Q A;  2F0N A;  5CGK A;  2KHS A;  1QIL A;  2A69 D;  2H4O A;  4C56 C;  1OO9 B;  4RCO A;  1PFM A;  2FHT A;  3VYT A;  4C1N I;  3NK9 A;  1O78 A;  1PFN A;  2C9O A;  3QO2 A;  2EYO A;  1DCZ A;  1CQF A;  2WB1 B;  1Z7T A;  2NZ1 D;  4DK1 A;  3NTI A;  1EWC A;  4C3J G;  3RZD B;  1MD2 D;  4LMQ D;  2F0F A;  4HCE A;  1XXG A;  1TVX A;  2A5H A;  1I6V C;  3HP3 A;  1S4Z A;  1LAC A;  3H6M A;  4WRD A;  1HQM C;  4NW2 A;  2JEB I;  5DNF A;  1DOK A;  2F0P A;  1PXU A;  1CA6 A;  4ULL A;  4OHJ A;  1YNJ D;  1WTX A;  4Y7N B;  4DAY A;  1SND A;  1QNK A;  4KKT A;  4DF7 A;  3R8B A;  4P2C B;  4PMB A;  1PMR A;  2PZW A;  4A3J B;  5COR A;  3GTO B;  1E0B A;  3P20 A;  3D31 A;  3A7A B;  4J8Q A;  1OXT A;  3BDC A;  4QCL A;  3Q23 A;  1GUG A;  3PV0 A;  5CV6 A;  3M7N A;  4K2K A;  1EQV A;  1Y8P B;  1M4V A;  3S1M B;  2BA1 A;  1BOS A;  1XX8 A;  3K59 A;  1ZYR D;  2EPB A;  2AUJ D;  3P1H A;  2HUG A;  3PUV A;  1HXY D;  4QIW B;  3CRK C;  3OWE B;  4EQN A;  2AQ1 B;  1TWA B;  3OW7 A;  3HOZ B;  2EY2 A;  3LWE A;  5C0X G;  1GUT A;  3E6Z X;  4KN7 C;  2NN6 I;  3I73 A;  1EQT A;  4K14 A;  2R7Z B;  2LY7 A;  5G3L F;  4WOR A;  2NN6 H;  2X69 A;  5KRU A;  1MGS A;  2HDM A;  1L0X B;  1AEX A;  3LNN A;  2A6H C;  4IUV A;  3MFY A;  1DOL A;  1EU3 A;  1SYF A;  2Z8L A;  4C1N K;  2I46 A;  4FF1 A;  3T53 B;  1QJO A;  1TY0 A;  1ENF A;  3D6C A;  2YU9 B;  1SNQ A;  1U4P A;  1F9R A;  3K57 A;  4CJ0 B;  4A3M B;  5CR3 A;  4MN3 A;  2SEB D;  2XNA C;  3KUP A;  1WTV A;  3V05 A;  1JOK A;  1PTO F;  3PIP 3;  1JWU D;  3J7Y W;  1BUV T;  1ICW A;  4OO1 I;  5EQ0 A;  2GA4 B;  4XXE A;  2MPM A;  2ZXO A;  5CBE E;  1SYG A;  1OXV A;  2AUK A;  5ISR A;  1HTL D;  1HRJ A;  1EFI D;  4X3K A;  4FO2 A;  2EVB A;  4OO1 H;  3BVG A;  1B1Z A;  2L9H A;  1NR2 A;  1LV9 A;  3TME A;  4B08 A;  2F0E A;  1TII D;  5IOC A;  3DM1 A;  1PTO D;  3H94 A;  3DWP A;  4IUQ A;  2X6G A;  4Z9C B;  3X3M A;  1UUP A;  2L5T A;  4HMJ A;  4TQU S;  3OMC A;  3CKI B;  1PRT C;  2I07 B;  4HN7 A;  4ZLT F;  3PUY A;  2XIW A;  2F3V A;  2WAC A;  3VYS A;  3SXH A;  1U4M A;  1RTO A;  2M00 A;  3OMG A;  1EY0 A;  3A55 A;  5IOD A;  1ESF A;  1O7Z A;  5C4H A;  2DN8 A;  4C2M B;  5EJW A;  3QOL A;  1ET9 A;  2F0G A;  1V8Q A;  3GD7 A;  1WTR A;  4KTA A;  1X3Q A;  4ILW A;  3SE0 A;  1SXT A;  5IGB A;  3SK6 A;  3OSO A;  3FMC A;  1ZEQ X;  1C48 A;  4IZ8 A;  2VB3 X;  1F2Y A;  3FPU B;  4G7O C;  5C4J B;  1SYC A;  2K7V A;  2K04 A;  3Q0A A;  3GTQ B;  3ERO A;  2RQX A;  1TWF B;  1U4R A;  1EYA A;  4ODG A;  3S14 B;  3KBG A;  5IGD A;  1S5D D;  5M9O A;  2XWB B;  2BE5 C;  1PRT B;  3P7J A;  5FK9 C;  2A68 C;  1EZ8 A;  5JEA J;  1L0Y B;  1ZXT A;  5M5Y B;  1GUN A;  5LHY 1;  2EDG A;  3NHH A;  2JA8 B;  4DXF A;  1I4X A;  2IWH A;  1O80 A;  4JK1 C;  5DAU A;  2A6E C;  4L63 B;  4KKU A;  3IFD A;  4K5W A;  1VCI A;  1Y8O B;  1IL8 A;  3D4R A;  4C3J B;  2EYH A;  1JIC A;  1GXD C;  2DY7 A;  2CW0 D;  1AFP A;  2IX0 A;  2AQ3 B;  4CHT B;  1I6H B;  4ZK9 B;  4R9W A;  1D1K A;  1EIH A;  2C5C A;  2Q8R E;  3HOY B;  3GTP B;  2PW7 A;  4J6H A;  1I4R A;  3TP8 A;  5CMD A;  3R3O A;  1KDA A;  1CHP D;  2VUM B;  4OGQ C;  1RJT A;  1STH A;  1SJE D;  4N9P A;  1I4G A;  3WOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...