4MZ9A

Revised structure of e. coli ssb
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Intramolecular binding mode of the C-terminus of Escherichia coli single-stranded DNA binding protein determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
total genus 18
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4mz9A00
1N34Q 1LUZA 4AIMA 4JBJA 3GTKH 2E5LL 2AKWB 1X55A 4X62L 4DR7Q 5JJKA 1K83H 4PMWA 5IY0A 1S3OA 2Q2TA 2IX1A 1PH4A 4A3CH 1Q81C 4DV2Q 1PH6A 4L5QA 1E3PA 3ULLA 3GTLH 1FL0A 3TQYA 1XMOQ 3F2DA 2VUMH 3CCVA 2A1AA 4B3TQ 1VQ8A 1JJ2A 4JI2L 4LUVA 3UDIA 4DV1L 1R9TH 2WB1E 4BY1H 4LF8L 1SE8A 3AEVA 1VQDA 4DAYB 5M3MH 3CMEA 2UXBL 2R93H 4LF7Q 2R7ZH 1X56A 1YVCA 2BA0A 4DV5Q 1KRTA 3JAMc 1VQOA 3PO3G 4BA1I 1RL2A 4JI1L 4JBMA 3ER0A 4GKJQ 4LF9L 1V43A 1XMQL 1IBML 5C4JH 4GKKQ 4LFBQ 4DR5L 4PZ7A 4GOPB 1Z47A 1IYJB 1HZCA 2UU9L 3J81j 1XNRL 4HJAA 3K7AH 1AH9A 1BBWA 1YEZA 1VQ5A 4BXXH 1YJWA 5M5WH 1K3RA 1Y1VH 2PNHA 2ZJQA 4A3GG 2E2JH 4GLAC 3K80C 3FKIH 3T1YQ 3A0JA 3I4MG 1VQCA 3KDFA 1SRUA 2K5VA 2OWOA 2CCZA 4GNXA 4O0AA 1VQAA 1QVCA 3EN2A 1PH3A 1GVPA 3ERSX 5GAEC 1I94Q 2AWNA 4GNXB 3CCMA 1SR3A 1TWAH 3CQZH 4JI4L 4A3IH 4DV3Q 2Y0SE 4J15A 4NXML 3PUVA 4C3HH 1BKBA 1WOCA 4HIOA 3ULJA 1S72A 3S17H 2UXDL 4DV1Q 1V9PA 1Y1WH 4UP9A 2JA8G 2GVAA 1VS0A 3PCOB 3CAMA 4QIWE 2YV5A 4TVAB 4HJ5A 4PZ6A 3H3VI 3GTPH 4DV3L 2ZM6L 5C4XH 2JEAI 2B63H 4LF8Q 2NVXH 4QQBX 4R4OA 4MTNA 1N32L 3HOXH 1SROA 4DR1L 2OQ0A 1VQ6A 4GOPC 3KF6B 1YJNA 3KFUA 4RG1A 1KHIA 1WCMH 1YHBA 1N36Q 2OQKA 3BZKA 4X66Q 4O2DA 1XMQQ 4LFBL 4A3BG 1V1QA 3M7NA 1VQNA 1SFOH 1FGUA 4LF6Q 3MEFA 5K36G 1NJIC 1GM5A 1PH9A 3E9HA 5M5YH 1N9WA 4L5RC 2UXCL 1KL9A 1A62A 5HY6A 2YTXA 4NXNQ 4UPAA 1L1OA 2E2HH 2YU9H 1L1OC 3BU2A 1LYLA 2IY5B 3W1GA 1Q46A 3PUXA 4JOIC 4DV7L 2VZAA 5IYCG 4ALPA 1HH2P 4JI5L 4EX5A 4C3JH 3RN5A 3S1QH 4BBSH 4A3DG 2Y0SG 1EIYB 4IJHA 3I7FA 4AYBE 5ELOA 4RMFA 1QUQB 1CKOA 1RIPA 1JJCB 2YTVA 1IBLL 4OWWB 4B3RQ 1I6HH 2K52A 4OO1I 5LMUL 3PO2G 3CCUA 4YY3Q 1N33Q 4YHHQ 2F52A 5IP9H 2HQLA 3UDFA 1EQQA 4LNQA 2PQAB 2CFMA 2CKZB 4MNOA 4JG2A 1IBLQ 4B3RL 2MO1A 3CC4A 1PFSA 4DR3L 4LW1A 2ZTDA 3HOYH 4P74A 4YY3L 3JAMi 5FJ8G 2UUAQ 1UWVA 5IE8A 5IYBG 1K8AC 1VQEA 1YNXA 3I2ZA 3H0GH 4QJFA 2D0OA 1CKNB 4X6AH 3GO5A 1BBUA 2D62A 2NN6G 4A3FH 4X66L 2WAQE 3L0OA 3J81i 2WB1G 4JI0Q 5JJIA 1VQGA 1UE6A 5BR8Q 1WFQA 3W1BA 4LWCA 1GO3E 2VL6A 2B29A 3S14H 4R4CA 1IXRA 2PI2A 1QVGA 4POGA 4A75A 2ZTCA 4P72A 1HR0W 2JE6I 1EQRA 4YWLA 3CC7A 1OXTA 1SMXA 1Y14B 1OXVA 4JI8Q 4DPGA 1H95A 3UDGA 2Q2HA 5AJ3L 4K0KQ 1Q1EA 1YBYA 3CCRA 3S16H 2JA5G 4DV4Q 1HNZL 1JJGA 1X3GA 2K5HA 3SGIA 2UUBQ 2N8NA 3CPFA 3A5UA 1A0IA 3DM3A 5C0XJ 3F8TA 3AYHB 3RLFA 4WJ4A 1X54A 3HOUH 1XPRA 4JBWA 3TS2A 3M3YH 1YITA 1C0AA 3W5OA 3RZOH 2DUDA 3F2BA 4UP8A 3F2CA 2V1CC 5JEAJ 4HIDA 3HOVG 1P16A 1O7IA 4DR5Q 4GKKL 3PUZA 1A8VA 5ELNA 5E7NA 4LFAL 4X64L 2OTJA 3FHWA 3PUYA 2CWPA 2HHHL 2NVQH 3ZJYC 1X9NA 4OONA 1NMFA 3G71A 4JI0L 4PZ8A 1JE5A 1TWCH 1VQJA 1VQ7A 4IFDG 4LFAQ 2QEXA 4A76A 4KHPQ 4FDBA 2Z0SA 4POFA 3HOWH 1X3EA 3KF6A 1J5EL 4YCVA 4DUZQ 4A3KH 4JI7Q 2VW9A 4JCVE 2A19A 3GDEA 1Q1BA 3DLLA 2N78A 4JI3L 4DV0Q 1HNXQ 2F4VQ 2AMCB 4A3MG 3PIPA 5IYDH 1OXUA 4NXMQ 4X62Q 4DR7L 3M4QA 1U0LA 1VQMA 5AJ3Q 4K0KL 3NELA 3KDFB 3F1ZA 1NE3A 1TWGH 1XJVA 1G51A 2KHIA 1U5KA 2WP8J 4JI5Q 2JA6G 5M3FH 4L5TA 1L1OB 3PGZA 3RLOA 4A3CG 4NB3A 2AHOB 3I4OA 3K0XA 3AFPA 5IP7G 5C3EH 5LMNW 4A93H 1YHAA 4JV5Q 2FXQA 4R4IA 4DNIA 4HJ7A 3ULPA 4A3LG 1HZ9A 2VUMG 4DR6L 4X65L 5LMNQ 1D8LA 4QGUA 3S2HH 3I4NH 3HKZG 3J81c 2VQEQ 3I56A 1PYBA 3S1MH 4JOIA 3CD6A 4YHHL 1UEBA 1AE3A 2I5LX 2NZHA 5M3MG 2R7ZG 1P8LA 2QGQA 2Q2IA 1VQHA 3NBHB 5C44G 4HIKA 1VQPA 1ASYA 1JB7A 3HOZH 1IBMQ 2UXCQ 2VQEL 2JQOA 4A3JH 5H1SE 4JI1Q 3STBD 2YTYA 2KCTA 4DKAC 5M5XH 2CQOA 2MNAA 4UY8C 1XNRQ 2BA1A 3GTOH 2BH2A 1IZ6A 1OTCA 1J5EQ 4AYBG 2VS1A 4BBRH 1IL2A 1JT8A 1DGSA 4KHPL 2JA6H 4BXXG 1Y1VG 1XPOA 2ZJRA 1M90C 1HNXL 1ASZA 2F4VL 1MKHA 1Q8KA 2R7DA 4C2MH 4OO1G 1GKHA 3FKIG 5DLQE 1EUJA 3AQQA 2K14A 4DK6C 3TRZA 4YCWA 4WJ3M 3GTJH 3L7ZC 4JI2Q 2RF4A 1NMGA 3M4PA 2BH8A 1PH8A 1AE2A 1QVFA 1QUQA 2K5NA 1TWFH 3NENA 1EYGA 2KHJA 4TQUS 3H15A 4JI4Q 4AH6A 4GOPA 3S2DH 2WFWA 2I5HA 4LFCL 1PH1A 4OX9Q 1KXLA 1XTDA 1E24A 4DV6L 1VQIA 2F3IA 3Q8DA 2AWOA 4GLVB 3E0EA 2XTIA 2NN6I 2JA7H 4IOAA 1SLJA 3CP0A 3T1HQ 1Q7YC 2R92G 4UP7A 4IPCA 3A5ZB 3LGJA 3K7UC 1HZBA 5FLMH 1WCMG 1EWIA 1KIXA 1N36L 4Y7NH 4AQYQ 4A3EH 3ICEA 3OYYA 4LF5Q 3KLWA 4JC0A 5EAYA 4A3BH 1NTGA 2B3GA 1HR0L 2HT1A 2PMZE 3I55A 4BY7G 3RNUA 2K4KA 2KCMA 1E1TA 3JC66 4YCUA 4DV4L 2QA4A 2IHFA 3STBC 4HIMA 1HNZQ 1E1OA 3S24A 1L0WA 3S1RH 1VQKA 4JYAQ 4GNXC 1FVIA 2R7FA 1MJCA 4DV7Q 1EOVA 3S15H 4BBSG 3RR5A 4BA2I 4DUZL 2ZJPA 3CW2C 2RHQB 3MXNB 5GADC 1WJJA 1HJPA 3T1YL 1KQSA 1K0RA 1X6OA 2PI2E 1FJGQ 3KOJA 4JYAL 3B6YA 1OXXK 3J7A5 4IPDA 4B3TL 1BVSA 1C9OA 2DGYA 4NPSA 4BY1G 4IO9A 2ES2A 2R93G 5IP9G 2HIVA 1N33L 3H3VH 1FJGL 1NBWA 4IPHA 4A4IA 1W2BA 1E7ZA 1EIFA 4IJLA 5IWAL 3PO3H 2UXDQ 3TREA 4P75A 4HJ8A 4DV5L 2NVTH 3HOYG 1LM0A 5IYBH 2KENA 4NXNL 2VQFQ 1IBKL 2EQSA 3H0GG 3FP9A 3UE1A 2UU9Q 2ALYB 4DR4Q 4IOCA 2VNUD 2ATWA 4DK3C 1HR0Q 2R6GA 5JJLA 4A3FG 2JJQA 5FLXc 2Q2UA 2ZTEA 1I50H 3GTMH 4A3GH 4QL5A 1XNQQ 3AFQA 1B70B 4YWKA 1K9MC 3I4MH 1VQFA 2EIFA 4EQ5A 3KJPA 3J7ZC 4LF6L 1TWHH 4ME3A 2PQAA 4JBKA 3U50C 3RZDH 1W3SA 3CF5A 2I0QA 3UE0A 3J80i 2RHSB 4A3IG 1PYSB 2JEBI 2LXKA 3HKZE 2MFIA 2D0PA 2JA5H 4JI7L 1G291 1SN8A 2K50A 2NVYH 1CKNA 3KYHC 4X65Q 3OTOQ 3CCEA 5LMNL 4R4QA 1Y1WG 1X65A 1S40A 2JA8H 1KC8C 1D7QA 4QY7A 1PA6A 3PV0A 2LXJA 2WAQG 2ASBA 2UUCL 5GAHC 1EFWA 1I3QH 4P73A 3HOUG 5C4XG 3GD7A 2RCNA 2B63G 1N32Q 3PIOA 5LMUQ 4HJ9A 3HOXG 4OXPA 1KAWA 1CSPA 4KI0A 1G6PA 1KD1C 5GAGC 2E8GA 2VQFL 4DR1Q 3A74A 1IBKQ 2VY3A 3HOVH 3OW2A 1WI5A 2OTLA 4DR4L 1VQ9A 5IT9c 3U4ZA 3WWVA 4LF7L 3BJUA 3T1HL 4PG3A 4GS3A 4DR2L 4GLXA 5JEAG 3PUWA 3KJOA 3CCQA 1MJEA 5IYCH 1XNQL 1QZHA 3HOWG 3G4SA 3HKSA 3CCLA 1Z9FA 4A3DH 1UE1A 1LTLA 5BR8L 1YHQA 1CUKA 4DV0L 4A3MH 4JI3Q 3GTQH 4MZ9A 1XMOL 3EIVA 4IFDJ 3K81C 1NY4A 1UE7A 4R1JA 4LFCQ 3G48A 4OX9L 3M85A 3PO2H 4B3MQ 4LF4Q 4JI8L 2IX0A 3KF8B 3G6EA 1HZAA 5M3FG 3OTOL 2Z6KA 1K8GA 1A63A 3PF5A 5IP7H 5C3EG 3VDYA 4A93G 3CMAA 2UUCQ 4A3LH 1C7YA 2UUBL 4B3SL 4B3ML 1TXYA 4LF4L 2UUAL 4P71A 4YWMA 1HNWL 2A8VA 1MIUA 3D31A 5FJ8H 4DUYQ 2GN5A 1QZGA 3I4NG 4DR3Q 4GKJL 3BZCA 5J3BA 3HFZB 1YJ9A 3PF4A 1WYDA 2I5MX 2C35B 1PH5A 1CKMA 5HGQA 4AQYL 1VCIA 4LUOA 2ZM6Q 4IPGA 4OWTB 5IWAQ 5GQOA 5C44H 4B3SQ 1HNWQ 1K73C 3HOZG 4DR2Q 2CWAA 4DUYL 1PVOA 4OWXB 4H02A 3RLNA 4A3JG 1XPUA 3TEHB 4XIGS 3CCJA 1VQ4A 3U58A 1PH2A 1OXSC 4L5SA 4R4TA 4APVA 2GVBA 2HHHQ 4BBRG 1Q12A 5C0XI 4GN4B 2E2IH 2N3SA 1N34L 1I94L 1UE5A 4XTCS 4GN5A 2IT1A 1X3FA 2NZOA 1Q86C 3CXCA 3CPWA 2JA9A 4KHZA 2E5LQ 1JMCA 4Y52H 2KBNA 4KLKA 3CCSA 3NEMA 3J80c 3TS0A 2IHEA 4GN3B 1B7YB 2LSSA 4DV2L 3PSIA 1J6QA 3S1NH 1T9HA 3M4OH 1YZ6A 3CC2A 2EXDA 3UDXA 1B8AA 2XGTA 1KRSA 1PH7A 4LUZA 1YI2A 2ID0A 1GD7A 3M9BA 3D0FA 1L2FA 2YYZA 4DV6Q 3U4VA 2JA7G 4JV5L 2MQHA 2K75A 1Q82C 2UXBQ 4DR6Q 4JI6Q 3RN2A 2OCEA 3E9IA 4X64Q 1M1KC 1PV4A 4LF9Q 2R92H 2H5XA 1VQLA 2JK8A 3L2PA 1N8RC 4C3IH 1E22A 1VQBA 2N49A 5FLMG 1I5FA 4LF5L 2L15A 2Z6KC 4DAMA 3EBEA 3GTGH 4IFDI 4A3EG 1YIJA 4JI6L 3IRBA 1PHJA 5C0XG 2MO0A 1CSQA 4A3KG 5GROA 3K8AA 4BY7H 2HIXA 5IYDG
chains in the Genus database with same CATH superfamily
1RJTA 1PFNA 5KIXA 4KY7A 3GTKH 3HOUB 4X62L 5M5WB 4DR7Q 3S2HB 2VB2X 2NUCA 1Q81C 1MSHA 1PH6A 4A3BB 3GTLH 1FL0A 3KLSX 3CCVA 2A1AA 1CZGA 5D3DA 1WD1A 1JJ2A 1F2LA 2F0KA 4LUVA 5D14A 2WB1E 5C44B 3JAME 3KLSA 4DU9A 5FKAC 2UXBL 4LF7Q 1X56A 2BA0A 5EPLA 2QDLA 1CHQD 3JAMc 4R8IA 3EVQA 1LT3D 5M9OA 4KN4C 4LF9L 1V43A 3QIAA 3RUZA 1HA5A 1IBML 3TN2A 2JN4A 4GOPB 1IYJB 1BBWA 1Y1VH 2ZJQA 3R2TA 2B2VA 4GLAC 3K80C 4OEMB 4CGYB 3KDFA 1SYBA 2K5VA 2OWOA 4GNXA 1QVCA 1PH3A 5GAEC 4NKLA 4NXML 2R7ZB 4C3HH 1WOCA 4DV1Q 4RHSA 1SAPA 2A6EC 2GVAA 2G9DA 4RKLA 4HJ5A 2A74C 3H3VI 4KY5A 1G8ZD 2B2UC 5C4XH 4BY7B 1CT1D 2B63H 4R4OA 1N32L 1I4GA 1SROA 3LNNA 2OQ0A 4GOPC 3KF6B 3OMCA 1RD9D 2K03A 3H0GB 3MHBA 1YHBA 1N36Q 3BZKA 4FF3A 4A3BG 1V1QA 4XQQA 1FGUA 1NJIC 1JOQA 1A2TA 1PH9A 3E9HA 2UXCL 1KL9A 1Y1VB 4NXNQ 4UPAA 2YU9H 2WV6D 1LYLA 2O5JC 5ELBA 4ALPA 4JOIC 3U9OA 1HH2P 4JI5L 4EX5A 5M3MB 3D4DA 3VR3A 1SEBD 5C3EB 3I7FA 1JWMD 5E4WC 1CKOA 1RIPA 2MP1A 2YTVA 1IBLL 4OWWB 4OO1I 5LMUL 3AB9A 4FXKC 2QCPX 1FD7D 4LNQA 1UNSA 3QOLA 2CFMA 4MNOA 4K5WA 1HPCA 1XYIA 3CC4A 2HDMA 3E5SA 3S1MB 4LW1A 4P74A 3GTOB 4DFAA 1Z6HA 1W6KA 3I2ZA 1WCMB 4DAPA 1CKNB 4X6AH 5C6AA 2D62A 2NN6G 2IW3A 1WD0A 2WAQE 3L0OA 2L9HA 5BR8Q 4LWCA 5IGEA 4QUCA 2PO4A 3KLRA 4A75A 1DONA 4P72A 1HR0W 4FYDA 1KAAA 2JE6I 4YWLA 4CJ1B 1Y14B 4DPGA 2B63B 3LWEA 4K0KQ 1F9PA 1YBYA 4O42A 3S16H 1PXUA 3I72A 3VR5A 1B9NA 5I2XA 1JJGA 3SGIA 2UUBQ 1UAPA 2N8NA 3CPFA 4UAIA 2K7VA 3RLFA 3BZDB 3HOUH 3TSSA 2DJGC 1YITA 4OHJA 5IT9L 5EKLA 4BY1B 2V1CC 3C1EA 2KCCA 4KK7A 1C48A 1A8VA 5ELNA 3NHHA 4X64L 2OTJA 1H9SB 3FHWA 1WTRA 1GUWA 1TIID 1QNUA 2BE5D 1VQJA 5JEAH 2EJFC 1I50B 1MI2A 4LFAQ 4XQNA 1ILPA 1SE3A 3HKZB 4FDBA 1TKWB 3K5MA 2B2UA 4YCVA 4DUZQ 1ONLA 2N78A 4DV0Q 1HNXQ 2J0TD 1H9KA 2AMCB 3PIPA 5IYDH 4NXMQ 4X3TA 4HCSA 4K0KL 2E2HB 2CH4W 4X3SA 1TWGH 1XJVA 2WP8J 1JR0D 3P20A 2AHOB 3I4OA 3J80L 5C3EH 4MHEA 1JWUD 3S15B 1PZID 1PTOB 3ULPA 5EQ0A 2VUMG 4X65L 5LMNQ 4QB4A 1B3QA 4DR6L 3S2HH 2K05A 3J81c 3Q6SA 5DNFA 4C3HB 1SMYC 2I5LX 1SNQA 1P8LA 3GTMB 1VQHA 3NBHB 3HOZH 2WB1B 2JQOA 3NQIA 4DKAC 5M5XH 1XNRQ 2IWHA 4B08A 2VS1A 1JT8A 2B2YC 1G2SA 1GKHA 3M4YA 1EUJA 3TRZA 2K14A 4DK6C 5JJZA 3GTJH 3L7ZC 5BN3A 5F2DA 3CQZB 4X3KA 2Z4IA 1AE2A 1QVFA 3V96A 1EYGA 1NR4A 1FNUA 2QW7A 4IUUA 2I5HA 3SK4A 1I6VC 1LTRD 4DV6L 3IAYA 2F3IA 4ZK9B 3T1HQ 5EKIA 2R92G 4UP7A 4IPCA 3DEOA 2Z4HA 3A5ZB 3N52A 1CFMA 4HMIA 3ICEA 4Y7NH 1SSOA 2F1MA 1RTNA 2HT1A 4L8JA 3I55A 4BY7G 1KLGD 2B39A 2K4KA 1R4QB 3FVQA 3NXWA 2QA4A 3I91A 1E1OA 3S24A 4JYAQ 1RODA 4XQJA 3RR5A 1SBBB 4KD4A 3MXNB 1HJPA 2F0IA 3TP5A 1L0YB 3QO2A 2AQ3B 3EROA 4MTKA 5C5LA 4KN7C 1I4RA 2B8GA 1BVSA 2ES2A 2HIVA 2ICEC 1VMCA 2H4OA 3A8IE 1PRTB 4P75A 2O5IC 2JSOA 3D8GA 1ET9A 4NXNL 2VQFQ 2UU9Q 4Y7NB 1EYCA 5JVH3 2JJQA 1DXMA 2F0DA 4CBVA 1LT4D 4I7ZC 4EQ5A 4NMZA 2TMPA 2NTSA 4NW2A 3U50C 2IPKD 1J8IA 3MVVA 1PYSB 2JEBI 3HKZE 2MFIA 2L4NA 2JA5H 4JI7L 2XWBB 4K5XA 2K50A 3KYHC 1CKNA 3TP8A 1E2WA 4R4QA 1KC8C 1D7QA 4RAUC 3PV0A 1G6ZA 1T5EA 1D1IA 2RCNA 5A2QL 4HJ9A 2CQAA 1CSPA 4KI0A 2Z8LA 1IBKQ 4HN7A 3M4OH 3HOVH 3OW2A 1STEA 1VQ9A 1SYDA 2BDOA 3G6JB 2EYHA 3V05A 4PG3A 3S1NB 4RCNA 4GS3A 1O7YA 1E0BA 4GLXA 3K6OA 3U9SA 3HOZB 3CCQA 2R92B 2M9VA 2SNSA 1EU3A 5IYCH 1XNQL 5CBEE 3G4SA 1GOZA 1Z9FA 2FHTA 1YHQA 5IGCA 1SJED 1NY4A 1UE7A 5KNCA 2IX0A 3KF8B 2Z6KA 5G3LD 2EY2A 1A63A 2D5DA 3VDYA 1BF4A 5E4XA 5CORA 1ZYRC 4B3ML 4P71A 2A8VA 2H1EA 3D31A 2GN5A 4GKJL 5J3BA 1EWCA 3PF4A 1YJ9A 5M5YB 1C8CA 5HGQA 5FO9B 1IHZA 2X6GA 4J1MA 3A8KE 4IPGA 5IWAQ 4ILWA 1ZXTA 3J7AF 3PIP3 4DUYL 4OWXB 3HP3A 1BDOA 1IW7D 4XIGS 3CCJA 1VQ4A 1OXSC 4APVA 2EPBA 5C0XI 4GN4B 2E2IH 3P7JA 1LTSD 1N34L 1SNPA 3S1QB 3PQIA 3CPWA 1NR2A 1JMCA 1ESFA 1HUMA 1U9RA 3ERQA 3NEMA 5CV8A 2NTTA 3NBHA 4DV2L 5TSSA 1AP0A 5C3WA 2MPMA 3VA7A 4CJ0B 2EXDA 3UDXA 2XGTA 4U68A 4LUZA 3JAML 1L2FA 3FDTA 3DWPA 2BOSA 2JA7G 4IUPA 2OCEA 3AMUA 2H5XA 1VQLA 5C4JB 4IN3A 1E22A 1U4LA 4LF5L 3GTLB 4DAMA 4TKOB 1SNMA 1PHJA 5DEHA 1CSQA 4HAEA 1GUTA 5FO8B 3NE5B 3K8AA 1N34Q 2C5CA 3SK6A 5FK9C 2RQXA 2E5LL 3MWYW 1CA5A 1X55A 1PZJD 5JJKA 2OXPA 1K83H 2DJFC 2KCNA 5IY0A 4ZYSA 2K5QA 1PH4A 2L5TA 1B4OA 4DV2Q 1E3PA 2B2WC 3ULLA 4F8MA 1XMOQ 4K5VA 4N9PA 4JI2L 3UDIA 1R9TH 1NSNS 3NWSA 1SE8A 3AEVA 4DAYB 5M3MH 3CMEA 3R93A 4RHRA 4DV5Q 1YVCA 2L0CA 4BWGB 4F87A 2E75C 1VQOA 3PO3G 3KK7A 4DF7A 2D2CC 4JI1L 1YNND 2ZXOA 1XMQL 4CDDC 5C4JH 1TWGB 4PZ7A 1SYCA 3K59A 3MXNA 3BS1A 4HJAA 3K7AH 1ZEQX 4BXXH 5IGGA 1HA6A 4HEDA 3OPOA 5FLXL 1SFOB 3A0JA 5HGTA 3G7LA 1SR3A 3H09A 2VXWA 2Y0SE 3A7LA 4DV3Q 4Q0FA 4UHVA 1PLFA 4IALA 3ULJA 4DA2A 4UP9A 3FPPA 4QIWE 3R8BA 3GTPH 1G91A 2F0UA 2ZM6L 5IGDA 4MTNA 3HOXH 3S1RB 1STNA 1VQ6A 3A7AB 1YJNA 5CV7A 1WCMH 1XX8A 4A3JB 1XMQQ 1EZ6A 3M7NA 4B9WA 3T51B 4LF6Q 5K36G 2O2LD 1W6JA 5M5YH 4ME5A 5HY6A 1V8QA 2JA5B 1L1OC 3BU2A 4JI7Q 5JOBA 3RN5A 1WTVA 4C3JH 1PFMA 4BBSH 4AYBE 3QR8A 4ZKBB 3HG9A 4I7AA 2KECA 4LMQD 1B2TA 4C56C 2QDBA 2K52A 1CK1A 4G7HC 1F9QA 3D3RA 4PQXA 3CCUA 5J39A 1N33Q 2F52A 4WORA 2PQAB 4B3RL 4JG2A 2F3VA 1Q90A 1PFSA 2ZTDA 3HOYH 4YY3L 1JOOA 4AYBB 1O80A 2LMCB 3SE0A 3JAMi 2UUAQ 3ND8A 4A3GB 1DZ1A 2SOBA 4QJFA 1GUGA 1JORA 1BBUA 2F0MA 2P5ZX 3QG1A 2K32A 3J81i 5JJIA 2VB3X 1UE6A 1L0XB 3W1BA 2VL6A 1QVGA 1I4PA 2F0WA 2ZTCA 1EQRA 4JVZA 1MHWC 1OXVA 5AJ3L 1JWSD 3CCRA 2JA5G 1HNZL 4PMBA 3FPUB 3EQLC 3A5UA 1A0IA 3DM3A 3F8TA 1ICWA 4EGVA 5JAVA 4FF1A 2EE1A 4JBWA 1XTCD 1C0AA 3RZOH 2DUDA 3EJIA 3F2CA 1SE2A 3C1FA 3PUZA 3K0YA 1F2MA 3GP7A 5LL6X 2HCIA 2NVQH 1WTQA 1TR5A 3PO2B 2EYOA 2RDGA 4PZ8A 4C3IG 1JE5A 4XT3B 2NVTB 1K28A 2Z0SA 1X3EA 1J5EL 4A3KH 4UDUC 4JCVE 1VF7A 1Z7TA 1BCPC 1U0LA 3M4QA 1QNKA 5AJ3Q 4QMGA 2YU9B 1NE3A 2EJGC 1G51A 2KHIA 5M3FH 4L5TA 3RLOA 4A3CG 1U4MA 3AFPA 1ENAA 1EY6A 3HRZC 1YHAA 5EPKA 2FMCA 2FXQA 4R4IA 4DNIA 5LMNW 4JV5Q 1JOKA 1PYBA 3MZ5A 2JA8B 4H0LC 2Y0SB 4IUQA 1AE3A 2NZHA 2WKDA 1IKMA 2QGQA 2Q2IA 4HIKA 1ASYA 5I6YA 1JB7A 2VQEL 2YTYA 2KCTA 2MNAA 3GTOH 1IZ6A 5I9OA 1OTCA 2PPBC 1J5EQ 4KV6A 3PMFA 1E2ZA 2JA6H 3IFTA 1STYA 3S9WA 4BS9A 2ZJRA 1HNXL 1RHPA 1Q8KA 2Z6BA 4FF2A 1STGA 1CQVA 4YCWA 1MD2D 4NDXA 4WJ3M 1U4PA 4JI2Q 1NMGA 4RKBA 4V0BA 2K5NA 2EY6A 3H3VC 3WOEA 4JI4Q 2N88A 3H91A 2PCFB 1KXLA 1VMPA 4ID6A 3DEPA 2QKIC 5FOBB 2ZT9C 1D5ZC 4IOAA 3CP0A 3VYRA 1Q7YC 2MHVA 1EWIA 4A3EH 4A3BH 2QEJC 5D65A 2L1BA 4LF5Q 2PMZE 3CRKC 1HFGA 1E1TA 3I4NB 1HNZQ 4HIMA 3PO3B 3T53B 1Q8IA 1L0WA 3X3NA 4DV7Q 1MJCA 3QOJA 1EOVA 4WRDA 4C3JG 3S15H 4BBSG 4BA2I 2PZWA 3CW2C 1SMYD 1EQVA 1KQSA 4IQZA 1X6OA 1Q3LA 2V4DA 3H94A 2L12A 1Y69U 2R93G 5IP9G 1F77A 3H3VH 1FJGL 4IPHA 4A4IA 3NP8A 5J22A 1E7ZA 3PO3H 3TREA 4HJ8A 2RA4A 2XSCA 3HOYG 4OIKA 5IGFA 5IYBH 4DR4Q 5KGUA 2K5WA 3FP9A 1WTPA 2KOLA 2R6GA 4A3EB 1IL8A 4A3FG 4C2MB 3QJYA 3X3MA 3GTMH 4A3GH 1B50A 3AU7A 1X32A 4EQPA 5KRUA 1XNQQ 1B70B 1BOSA 1LACA 1VQFA 2EIFA 1IYUA 4LF6L 4KD3A 4IZ8A 1W3SA 3UE0A 3NPPA 1CI3M 3ONAB 3J80E 4A3IG 2D0PA 2F0VA 1G291 1SN8A 2CHBD 1EY8A 1S40A 2JA8H 1HTLD 4QY7A 4DNTB 4FVMA 1LTBD 5GAHC 1EFWA 3GQBA 3GTPB 1N32Q 1I4QA 1AW7A 3HOXG 2LKVA 3K5NA 1KD1C 1EIGA 2VQFL 5IT9c 5IGBA 3D4RA 4PNYA 3T1HL 2LS01 2RVLA 4DR2L 1H9RA 2A69C 4HCEA 1FR3A 3OWFA 1UE1A 4DV0L 3GTQH 4OX9L 4R1JA 3I90A 4C3IB 4B3MQ 3G6EA 5M3FG 3OIQA 4ULLA 1K8GA 1CQFA 2EY5A 3PF5A 1KDAA 4LK1C 1C7YA 1KNAA 2PZUA 3BYYB 1TXYA 1R9TB 4B3SL 4LF4L 1JCKB 4DUYQ 3I4NG 5JPNC 3E0JA 2I5MX 1CKMA 2ZM6Q 3J81L 2F0GA 1HNWQ 5GQOA 5C44H 1K73C 3HOZG 4DR2Q 1XWEA 1TT2A 4A3JG 1XPUA 3TEHB 4L5SA 2F3WA 1WVLA 2BE5C 4R4TA 2HQEA 5DAUA 4BBRG 2I46A 3O13A 2XIWA 2N3SA 1I94L 2JA6G 4XTCS 3A55A 1GHJA 2F0SA 2JA9A 2HDLA 2E5LQ 5K5PA 2R3ZA 2KBNA 4KLKA 3TS0A 1D6EC 1EYAA 4J8QA 2EVBA 5FO7B 4OIJA 1GJXA 1M4VA 1F2YA 1FGBD 3OW7A 4QIWB 2A6ED 2OT2A 1PH7A 5T1IA 2ID0A 1YNJC 3R2IA 1ZKOA 3I73A 2AQ2B 4JV5L 2MQHA 2F4IA 1Q82C 3C3LA 3FRPB 3E9IA 4X64Q 5EJWA 2R92H 5I6WA 1N8RC 4C3IH 2N49A 5FLMG 4IFDI 1HCZA 4A3EG 1YIJA 4JI6L 2MO0A 4A3KG 5COYA 1DM0B 1LABA 4AIMA 1YNNC 4FO2A 2AKWB 2B8FA 1ENCA 1M8AA 1I4XA 2Q2TA 4A3CH 2M00A 3TQYA 2VUMH 4RA8A 1WTWA 3TZDA 3GV3A 1WTOA 4BY1H 2R93H 4CDFC 3DWQA 1KRTA 3KF8A 4K8JA 4BA1I 3S14B 3HEJA 3ER0A 4K2KA 4PV1C 1PTOF 2RBMA 1Z47A 1HZCA 2UU9L 1XNRL 1AH9A 1TQOA 1YEZA 1YJWA 5M5WH 1K3RA 4HSPA 2RSNA 3OHXC 2PNHA 3T1YQ 1HQMC 3S2DB 2CCZA 3K57A 1VQAA 1GVPA 2PYKA 3OOCA 2AWNA 4GNXB 3CQZH 4Z9CB 4J15A 1I6HB 2LY7A 4I65A 1DCZA 3TMEA 3Q0AA 4RCOA 4K14A 4IURA 5CBAE 1V9PA 1Y1WH 2JA8G 3RMHA 4DXFA 1VS0A 3PCOB 3CAMA 2YV5A 3BG3A 1G2TA 2TSSA 3TDQA 4XYQA 2XWJB 2F0NA 4LF8Q 2NVXH 1S5DD 4CJ2C 3ND9A 5JPMC 4RFBA 3KFUA 4MIUA 1KHIA 3VR4A 1STAA 4H7BA 1VQNA 3D4WA 3ZYYX 4RGOS 4L5RC 4TSSA 2YTXA 1BQQT 3FMCA 2IY5B 1Q46A 2L11A 2PQEA 1F9SA 4A3DG 2Y0SG 3Q24A 1EIYB 4IJHA 3CU7A 3L3OC 2Z9HA 4B3RQ 1I6HH 4RH6A 4V190 4YHHQ 1EQQA 1K83B 2HQLA 2CKZB 1EWHA 3OMGA 3DM1A 4DR3L 1BUVT 4O1NA 5IE8A 5IYBG 1K8AC 1YNXA 1X3QA 3FEWX 2QF7A 3GO5A 2AQ1B 4A3FH 4X66L 1IKLA 1VQGA 1QJOA 1WFQA 2F0HA 1GO3E 2B29A 3S14H 1IXRA 1LTTD 4POGA 1PRTC 1SMXA 4FP5D 4JI8Q 1SNOA 1H95A 3UDGA 3M4OB 1SXTA 1SYFA 2RSOA 1HHVA 4DV4Q 2K5HA 2XRQD 4ZLTF 1QILA 5C0XJ 3AYHB 3VR6A 2K5DA 2KA7A 1X54A 2ZXPA 3IFDA 1B3AA 4XDXA 5EBCA 3V2TA 3TS2A 4KTAA 3TZUA 1HXYD 3W5OA 4G4KA 4X3UA 4UP8A 2SNMA 5JEAJ 4IUVA 3HOVG 4GKKL 1BCPD 1BXTA 5E7NA 5A35A 4LFAL 1NUCA 2HHHL 5M3FB 4XYOA 1O78A 3RZDB 1LO5D 3S16B 4KHPQ 1IW7C 2XRSD 3T4AC 3M3YB 2B2TC 1LT5D 3DLLA 4JI3L 2F4VQ 1O7ZA 3K7AB 4A3MG 1HTPA 1EFID 3NELA 3KDFB 1LTGD 3F1ZA 4JI5Q 4MN3A 1L1OB 4NB3A 4DGZA 2EOTA 4K8IA 2DN8A 4A93H 1FNVA 3BVZA 3MTSA 1LLRD 4B9XA 1ET6A 2CVRA 2CW0C 1KDBA 3NTHA 1HZ9A 1DOLA 2BDNA 1D8LA 5NUCA 4QGUA 3I4NH 2VQEQ 3S1MH 1PYWD 4JOIA 3K5OA 1S5ED 5LL6S 2RDHA 2K33A 5M3MG 2NZ1D 2R7ZG 1VQPA 5C44G 4N8X1 4K6DA 2Q8TA 1IBMQ 2SDFA 5H1SE 1PTOD 4UY8C 2F0JA 2CQOA 2BA1A 2BH2A 1GUNA 1IL2A 4BBRH 2PMZB 1DGSA 3CHBD 5CR3A 2F0EA 4KHPL 3BVGA 1Y1VG 1M90C 1O7LA 1RF2D 2KJXA 5BN5A 3FKIG 2KEDA 5DLQE 3AQQA 3TBIB 2Z1CA 3NTKA 2ICIA 1BBXC 2BH8A 3NENA 1RDPD 4TQUS 4AH6A 4GOPA 1TWCB 3S2DH 1LTAD 2WFWA 4OX9Q 3L9AX 3WDNA 3BYTB 2EYFA 1XTDA 2K28A 4KHVA 1TY0A 1VQIA 3Q8DA 2AWOA 2F0OA 4GLVB 2XTIA 2NN6I 2JA7H 5C4XB 1H9MA 1SLJA 2EDGA 5EGTA 1U4RA 1BNZA 1HZBA 1CTMA 4PMCA 5FLMH 1WCMG 1N36L 4AQYQ 4RGTA 1EIHA 3OYYA 2B3GA 3SK5A 4GZYC 5K36H 3MFYA 4EQNA 3RNUA 2KCMA 3JC66 4DV4L 1JC7A 3STBC 1VQKA 3M7GA 4HR7B 2EYJA 2VUMB 2R7FA 3SR1A 4DUZL 2X69A 4QCLA 2RHQB 1SDFA 3HGBA 1NNXA 5GADC 4RGNA 3T1YL 1K0RA 1FJGQ 1YNJD 4JYAL 1B53A 3OIPA 1A3VA 1AN8A 4IPDA 1C9OA 2DGYA 2PNRC 4JW0A 4K6LA 4KY6A 1NBWA 1EIFA 5IWAL 3J7AV 1ENFA 3DWAA 4DV5L 2NVTH 3EFXD 5CV9A 1SYEA 2KENA 2WIIB 2EQSA 3W3AA 2ALYB 1RKNA 4IOCA 4L63B 4DK3C 2ATWA 5C5MA 3R3OA 3DUZA 1D1KA 2ZTEA 1I50H 1F9RA 1B44D 1QB5D 3AFQA 4H13C 3D6WA 4YWKA 1K9MC 3I4MH 2ZXRA 1AZQA 3KJPA 3J7ZC 3J7YW 2A68C 2JA7B 3CF5A 3MXGA 4BBRB 4DK1A 1TS4A 3J80i 1SYGA 4ZCKA 4C1NI 2LXKA 2ENBA 1A3UA 5E1FA 2NVYH 3SHLA 3OTOQ 3CCEA 1Y1WG 1X65A 1V1PA 3DHQA 1PA6A 2LXJA 2WAQG 4OL7A 2UUCL 2ASBA 3K5LA 2JP1A 4P73A 3HOUG 3GD7A 2B63G 3NQTA 4OXPA 1K8OA 3GV6A 1TWHB 1KAWA 5ISRA 1G6PA 2LFNA 5GAGC 2E8GA 4DR4L 3PIO3 3A74A 3TP7A 4DK0A 2KUMA 1NAPA 3J81E 1R4PB 2OF1A 3BJUA 2XNAC 5CMDA 1TU2B 3NSWA 1F2ZA 2EYLA 2A69D 3HOVB 2C9OA 5JEAG 4IFDH 3PUWA 3KJOA 3I4MB 4ZUIA 4HMJA 1S5CD 1TWAB 1QZHA 1QE6A 5EKKA 3CCLA 1LTLA 5EPJA 2PW5A 2WACA 1XMOL 4LFCQ 3T16A 2BCOA 2NVYB 4LF4Q 5M5XB 4JI8L 1HZAA 3OTOL 2NBFA 5C3EG 3CMAA 2UUCQ 3E6ZX 1HRJA 2FMMA 4YWMA 1MIUA 4WJWA 4DR3Q 5IOCA 3BZCA 4N8FA 4FXDA 2XVSA 1JB3A 4AQYL 2E2DC 4OWTB 1HQRD 1PVOA 2CWAA 5IODA 2B2WA 3RLNA 1SE4A 4HTHA 3Q23A 5L37A 1SNDA 1PH2A 2GVBA 2HHHQ 1Q12A 3UI2A 2N55A 4GN5A 1JICA 2NZOA 2EXZA 4R8NA 3CXCA 2OEOA 3KBXA 3S17B 2K01A 1A3TA 1RTOA 3NBIA 2IHEA 1B7YB 4A3FB 3PSIA 1J6QA 2E74C 4KJNA 1T9HA 3A8JE 1YZ6A 2I07B 5C4HA 1FYCA 4DN4M 3A56A 4ODGA 2MUYA 4RWSC 1YI2A 1AZPA 1GD7A 2YYZA 4DV6Q 5LHY1 3U4VA 2UXBQ 3H6MA 2NVQB 1PV4A 2IJ0A 3L2PA 2K04A 3ITPA 1VQBA 2DY7A 2L15A 3TP6A 1JE4A 2F0LA 4ABNA 1VF5C 2KQ3A 5GROA 2NWGA 4A3KB 2HIXA 3Q22A 5IYDG 4H44C 1LUZA 3FKIB 4JBJA 1PZKD 1D5XC 3I3CA 5CV4A 3GTGB 2QILA 3I70A 5KNDA 4PMWA 1EQTA 1S3OA 5CV5A 4IUNA 2IX1A 4JPBW 3W2DA 4L5QA 2Q8RE 3F2DA 2FINB 4B3TQ 1VQ8A 5E3FA 4DV1L 4P2CB 4WFN3 4LF8L 1VQDA 3BDLA 3VYSA 2R7ZH 1TWFB 1EZ8A 1RL2A 4R9WA 1EY5A 4JBMA 3VYUA 2EZVA 4GKJQ 4LFBQ 1KDCA 1V1OA 4GKKQ 4DR5L 5ELEA 1EY7A 2IX3A 1CM9A 3J81j 4DXGA 2EYPA 4JK1C 1VQ5A 1PFBA 1QG7A 3EA6A 2JA6B 4A3GG 2E2JH 1DOMA 4OO1H 1ESRA 3FKIH 3I4MG 1VQCA 1SRUA 4O0AA 2FJ2A 5D3IB 3EN2A 1I94Q 3ERSX 4ZUJA 1A6XA 2EJMA 3CCMA 1TWAH 4JI4L 4A3IH 1QWYA 2B2YA 4OGQC 3PUVA 1BKBA 4HIOA 2UXDL 1S72A 3S17H 1EEID 2MGSA 2RCFA 1Y8OB 4TVAB 4PZ6A 4FNFA 4DV3L 4A3DB 1VDZA 1STBA 2JEAI 1Y8PB 4OELB 4NP5A 1KLUD 4DR1L 1EEFD 1LV9A 4RG1A 1A2UA 1II3A 2OQKA 4X66Q 4LFBL 4O2DA 5C4ZA 1SFOH 3MEFA 1OO9B 1GM5A 1PRTF 1N9WA 1A62A 1FNWA 3BDCA 1L1OA 2E2HH 3NTIA 3W1GA 3PUXA 2NB0A 5FLXE 4DV7L 2VZAA 5IYCG 3S1QH 2PW7A 1NCVA 1S4ZA 5ELOA 4RMFA 1QUQB 5DM63 3F2UA 4YIJA 2M2LA 1JJCB 1Y8NB 3PO2G 2AUKA 4EVOA 4YY3Q 3HS0C 4CKCA 5IP9H 1HFNA 3UDFA 1D2BA 4CDCC 1IBLQ 5ELDA 5CYUA 2MO1A 1WTXA 2RKSA 5FJ8G 3E3XA 1UWVA 4M8AA 4G57A 1VQEA 3H0GH 2D0OA 1DJRD 1I3QB 4G7OC 4CDEC 1KNEA 4A3IB 4JI0Q 2WB1G 2JYOA 3HZXA 2MJ8A 4ZQ3A 4R4CA 1UUPA 2PI2A 3CC7A 1OXTA 3SEBA 2A5HA 3C2PA 1QOHA 2Q2HA 1EY0A 1Q1EA 3LWUA 1X3GA 3SK8A 3KUPA 3HOYB 4CKEA 3OSOA 4WJ4A 1PDQA 1XPRA 4ZAIA 4C1NK 3M3YH 3T13A 4CKBA 5T1GA 2KHSA 2D9UA 3F2BA 4HIDA 5CC4A 1P16A 1O7IA 4DR5Q 3QB3A 1I4HA 2PZTA 4DAYA 2G9HD 5CV6A 3PUYA 2J4XA 2CWPA 3DMUA 3ZJYC 1X9NA 4OONA 2HUGA 1NMFA 4E6IA 3G71A 4JI0L 4KJOA 4C3JB 4BBSB 1TWCH 1VQ7A 2J7ZA 4IFDG 2QEXA 4A76A 2WINB 4POFA 3HOWH 3KF6A 1H9JA 2R61A 5C0XH 3MC0B 1KTKA 4KKTA 1CZWA 2VW9A 1WTHA 2A19A 3GDEA 1Q1BA 4L6TB 1LT6D 4XT1B 1OXUA 4X62Q 4DR7L 1VQMA 1Y1WB 1MGSA 1U5KA 3MEHA 3PGZA 3K0XA 2IL8A 3I8ZA 5IP7G 4A3LG 1GXDC 2FFKB 4HJ7A 1XXGA 2Q8IB 3HKZG 5HURA 5IT9E 3I56A 3CD6A 4YHHL 3D6CA 1UEBA 5JVG3 5A2QE 3VYTA 1TS3A 1RCVD 2UXCQ 4A3JH 4JI1Q 3STBD 1JQYD 3NK9A 5I9PA 1BO0A 4AYBG 1MSGA 4A3MB 4EQOA 4BXXG 5BN4A 1T5XD 2B2TA 1XPOA 1ASZA 3A54A 2F4VL 1GHKA 2R93B 1MKHA 2F0TA 1K3BC 2R7DA 3URYA 4C2MH 2XN9C 4OO1G 1DD2A 2RF4A 3M4PA 1PH8A 1GUOA 1QUQA 1TWFH 2KHJA 3I4LA 3H15A 5AFWA 4XXEA 3OWEB 4LFCL 4C3HG 1PH1A 1X3PA 1E24A 2AUJD 3SVMA 3E0EA 2A73B 5J1ZA 2EYMA 3NWTA 1K0SA 3LGJA 2A68D 3K7UC 2F0FA 2DY8A 4F7XA 2JXMB 5I4DA 1KIXA 3BVMA 3KLWA 4JC0A 5EAYA 1NTGA 3QWNA 1EYDA 1HR0L 1EOTA 3C46A 3SXHA 1K8MA 2NYZD 1BR9A 3MAQA 4YCUA 2IHFA 2E76C 2CH4A 4TRDA 3S1RH 3HOXB 4GNXC 1FVIA 4A93B 1B1ZA 3BDOA 3GTQB 2ZJPA 4S3SA 1WJJA 2DNCA 4K2LA 2B2VC 2PI2E 3KOJA 1MBYA 4M1UB 3B6YA 1TS5A 1OXXK 3J7A5 1PMRA 4LJZC 4B3TL 1ML0D 4NPSA 3VR2A 4BY1G 4IO9A 1N33L 1W2BA 4IJLA 2UXDQ 1EY9A 1LM0A 3DXJC 4FXGC 1IBKL 3H0GG 3UE1A 3MXPA 2VNUD 1TS2A 1HR0Q 5JJLA 2NN6H 5FLXc 2Q2UA 1EU4A 2WKCA 4QL5A 1AFPA 5IIFA 1BCPB 1DYQA 1TWHH 4ME3A 2PQAA 4IUTA 4JBKA 1S5FD 4FF4A 2NVXB 1SNCA 4KKUA 1AEXA 3RZDH 3N6RA 2I0QA 1ILQA 2RHSB 3VA5A 3T56B 4CHTB 1S5BD 1J9OA 4X65Q 5LMNL 2EY1A 1C4QA 1DOKA 5G3LF 1I3QH 1EL0A 5C4XG 3PIOA 5KEEA 5LMUQ 4DAVA 5KYLA 4QQBX 1STHA 4DR1Q 2VY3A 1BCPF 1CHPD 1E2VA 1WI5A 3MXUA 2OTLA 2F0PA 3U4ZA 3WWVA 4LF7L 5I2YA 3K58A 1PRTD 4QF4A 5KNBA 4KMUC 1UEAB 3GTKB 4F88A 4HSVA 1LTID 2KEEA 1MJEA 1CA6A 1PTOC 1EY4A 2E2JB 3HOWG 3NUCA 3HKSA 4A3DH 3CKIB 5BR8L 3MFGA 1CUKA 4A3MH 4JI3Q 4MZ9A 3EIVA 4N9TA 4IFDJ 3K81C 2G5DA 3G48A 3M85A 3PO2H 2GA4B 2CW0D 2O4XA 3P75A 2A6HC 5IP7H 4A93G 1GUSA 2RDFA 2X6LA 4A3LH 2UUBL 1HNWL 3P1HA 2UUAL 1A15A 5FJ8H 1QZGA 3HFZB 4QUFA 3LX0A 1WYDA 3KBGA 2C35B 1PH5A 2L55A 2K1BA 3HOWB 1VCIA 4LUOA 4B3SQ 2K6AA 2F03A 1D5MC 4H02A 4KKSA 4RGMA 3U58A 5DM73 3WOFA 5EBDA 1TVXA 3RZOB 4LAAA 1UE5A 3SDZA 1Q86C 2IT1A 1X3FA 1H9SA 4KHZA 4Y52H 3IL8A 1IYVA 1ICFB 4ZKCB 1PTOH 3CCSA 3J80c 3MA2B 3CRLC 4GN3B 1HUNA 3IKJA 2LSSA 1ZYRD 2SEBD 5KYIA 3S1NH 4Q5VA 2A6HD 3RD4A 2F0QA 3CC2A 3GTJB 5ELFA 1B8AA 1KRSA 2WAQB 4J6HA 3M9BA 3D0FA 4DNRB 1SJHD 5CGKA 2K75A 5ELCA 4DR6Q 4JI6Q 1V1PB 3RN2A 4LF9Q 1M1KC 2JK8A 2HD3A 1B9MA 1I5FA 1QCBD 5C3XA 2Z6KC 2HCCA 3EBEA 3GTGH 1TY2A 3IRBA 5C0XG 4ZRZA 4G7ZC 2DNEA 2KVMA 2E2IB 4U673 1KABA 4BY7H
chains in the Genus database with same CATH topology
1N34Q 1LUZA 4AIMA 4JBJA 3GTKH 2E5LL 2AKWB 1X55A 4X62L 4DR7Q 5JJKA 1K83H 4PMWA 5IY0A 1S3OA 2Q2TA 2IX1A 1PH4A 4A3CH 1Q81C 4DV2Q 1PH6A 4L5QA 1E3PA 3ULLA 3GTLH 1FL0A 3TQYA 1XMOQ 3F2DA 2VUMH 3CCVA 2A1AA 4B3TQ 1VQ8A 1JJ2A 4JI2L 4LUVA 3UDIA 4DV1L 1R9TH 2WB1E 4BY1H 4LF8L 1SE8A 3AEVA 1VQDA 4DAYB 5M3MH 3CMEA 2UXBL 2R93H 4LF7Q 2R7ZH 1X56A 1YVCA 2BA0A 4DV5Q 1KRTA 3JAMc 1VQOA 3PO3G 4BA1I 1RL2A 4JI1L 4JBMA 3ER0A 4GKJQ 4LF9L 1V43A 1XMQL 1IBML 5C4JH 4GKKQ 4LFBQ 4DR5L 4PZ7A 4GOPB 1Z47A 1IYJB 1HZCA 2UU9L 3J81j 1XNRL 4HJAA 3K7AH 1AH9A 1BBWA 1YEZA 1VQ5A 4BXXH 1YJWA 5M5WH 1K3RA 1Y1VH 2PNHA 2ZJQA 4A3GG 2E2JH 4GLAC 3K80C 3FKIH 3T1YQ 3A0JA 3I4MG 1VQCA 3KDFA 1SRUA 2K5VA 2OWOA 2CCZA 4GNXA 4O0AA 1VQAA 1QVCA 3EN2A 1PH3A 1GVPA 3ERSX 5GAEC 1I94Q 2AWNA 4GNXB 3CCMA 1SR3A 1TWAH 3CQZH 4JI4L 4A3IH 4DV3Q 2Y0SE 4J15A 4NXML 3PUVA 4C3HH 1BKBA 1WOCA 4HIOA 3ULJA 1S72A 3S17H 2UXDL 4DV1Q 1V9PA 1Y1WH 4UP9A 2JA8G 2GVAA 1VS0A 3PCOB 3CAMA 4QIWE 2YV5A 4TVAB 4HJ5A 4PZ6A 3H3VI 3GTPH 4DV3L 2ZM6L 5C4XH 2JEAI 2B63H 4LF8Q 2NVXH 4QQBX 4R4OA 4MTNA 1N32L 3HOXH 1SROA 4DR1L 2OQ0A 1VQ6A 4GOPC 3KF6B 1YJNA 3KFUA 4RG1A 1KHIA 1WCMH 1YHBA 1N36Q 2OQKA 3BZKA 4X66Q 4O2DA 1XMQQ 4LFBL 4A3BG 1V1QA 3M7NA 1VQNA 1SFOH 1FGUA 4LF6Q 3MEFA 5K36G 1NJIC 1GM5A 1PH9A 3E9HA 5M5YH 1N9WA 4L5RC 2UXCL 1KL9A 1A62A 5HY6A 2YTXA 4NXNQ 4UPAA 1L1OA 2E2HH 2YU9H 1L1OC 3BU2A 1LYLA 2IY5B 3W1GA 1Q46A 3PUXA 4JOIC 4DV7L 2VZAA 5IYCG 4ALPA 1HH2P 4JI5L 4EX5A 4C3JH 3RN5A 3S1QH 4BBSH 4A3DG 2Y0SG 1EIYB 4IJHA 3I7FA 4AYBE 5ELOA 4RMFA 1QUQB 1CKOA 1RIPA 1JJCB 2YTVA 1IBLL 4OWWB 4B3RQ 1I6HH 2K52A 4OO1I 5LMUL 3PO2G 3CCUA 4YY3Q 1N33Q 4YHHQ 2F52A 5IP9H 2HQLA 3UDFA 1EQQA 4LNQA 2PQAB 2CFMA 2CKZB 4MNOA 4JG2A 1IBLQ 4B3RL 2MO1A 3CC4A 1PFSA 4DR3L 4LW1A 2ZTDA 3HOYH 4P74A 4YY3L 3JAMi 5FJ8G 2UUAQ 1UWVA 5IE8A 5IYBG 1K8AC 1VQEA 1YNXA 3I2ZA 3H0GH 4QJFA 2D0OA 1CKNB 4X6AH 3GO5A 1BBUA 2D62A 2NN6G 4A3FH 4X66L 2WAQE 3L0OA 3J81i 2WB1G 4JI0Q 5JJIA 1VQGA 1UE6A 5BR8Q 1WFQA 3W1BA 4LWCA 1GO3E 2VL6A 2B29A 3S14H 4R4CA 1IXRA 2PI2A 1QVGA 4POGA 4A75A 2ZTCA 4P72A 1HR0W 2JE6I 1EQRA 4YWLA 3CC7A 1OXTA 1SMXA 1Y14B 1OXVA 4JI8Q 4DPGA 1H95A 3UDGA 2Q2HA 5AJ3L 4K0KQ 1Q1EA 1YBYA 3CCRA 3S16H 2JA5G 4DV4Q 1HNZL 1JJGA 1X3GA 2K5HA 3SGIA 2UUBQ 2N8NA 3CPFA 3A5UA 1A0IA 3DM3A 5C0XJ 3F8TA 3AYHB 3RLFA 4WJ4A 1X54A 3HOUH 1XPRA 4JBWA 3TS2A 3M3YH 1YITA 1C0AA 3W5OA 3RZOH 2DUDA 3F2BA 4UP8A 3F2CA 2V1CC 5JEAJ 4HIDA 3HOVG 1P16A 1O7IA 4DR5Q 4GKKL 3PUZA 1A8VA 5ELNA 5E7NA 4LFAL 4X64L 2OTJA 3FHWA 3PUYA 2CWPA 2HHHL 2NVQH 3ZJYC 1X9NA 4OONA 1NMFA 3G71A 4JI0L 4PZ8A 1JE5A 1TWCH 1VQJA 1VQ7A 4IFDG 4LFAQ 2QEXA 4A76A 4KHPQ 4FDBA 2Z0SA 4POFA 3HOWH 1X3EA 3KF6A 1J5EL 4YCVA 4DUZQ 4A3KH 4JI7Q 2VW9A 4JCVE 2A19A 3GDEA 1Q1BA 3DLLA 2N78A 4JI3L 4DV0Q 1HNXQ 2F4VQ 2AMCB 4A3MG 3PIPA 5IYDH 1OXUA 4NXMQ 4X62Q 4DR7L 3M4QA 1U0LA 1VQMA 5AJ3Q 4K0KL 3NELA 3KDFB 3F1ZA 1NE3A 1TWGH 1XJVA 1G51A 2KHIA 1U5KA 2WP8J 4JI5Q 2JA6G 5M3FH 4L5TA 1L1OB 3PGZA 3RLOA 4A3CG 4NB3A 2AHOB 3I4OA 3K0XA 3AFPA 5IP7G 5C3EH 5LMNW 4A93H 1YHAA 4JV5Q 2FXQA 4R4IA 4DNIA 4HJ7A 3ULPA 4A3LG 1HZ9A 2VUMG 4DR6L 4X65L 5LMNQ 1D8LA 4QGUA 3S2HH 3I4NH 3HKZG 3J81c 2VQEQ 3I56A 1PYBA 3S1MH 4JOIA 3CD6A 4YHHL 1UEBA 1AE3A 2I5LX 2NZHA 5M3MG 2R7ZG 1P8LA 2QGQA 2Q2IA 1VQHA 3NBHB 5C44G 4HIKA 1VQPA 1ASYA 1JB7A 3HOZH 1IBMQ 2UXCQ 2VQEL 2JQOA 4A3JH 5H1SE 4JI1Q 3STBD 2YTYA 2KCTA 4DKAC 5M5XH 2CQOA 2MNAA 4UY8C 1XNRQ 2BA1A 3GTOH 2BH2A 1IZ6A 1OTCA 1J5EQ 4AYBG 2VS1A 4BBRH 1IL2A 1JT8A 1DGSA 4KHPL 2JA6H 4BXXG 1Y1VG 1XPOA 2ZJRA 1M90C 1HNXL 1ASZA 2F4VL 1MKHA 1Q8KA 2R7DA 4C2MH 4OO1G 1GKHA 3FKIG 5DLQE 1EUJA 3AQQA 2K14A 4DK6C 3TRZA 4YCWA 4WJ3M 3GTJH 3L7ZC 4JI2Q 2RF4A 1NMGA 3M4PA 2BH8A 1PH8A 1AE2A 1QVFA 1QUQA 2K5NA 1TWFH 3NENA 1EYGA 2KHJA 4TQUS 3H15A 4JI4Q 4AH6A 4GOPA 3S2DH 2WFWA 2I5HA 4LFCL 1PH1A 4OX9Q 1KXLA 1XTDA 1E24A 4DV6L 1VQIA 2F3IA 3Q8DA 2AWOA 4GLVB 3E0EA 2XTIA 2NN6I 2JA7H 4IOAA 1SLJA 3CP0A 3T1HQ 1Q7YC 2R92G 4UP7A 4IPCA 3A5ZB 3LGJA 3K7UC 1HZBA 5FLMH 1WCMG 1EWIA 1KIXA 1N36L 4Y7NH 4AQYQ 4A3EH 3ICEA 3OYYA 4LF5Q 3KLWA 4JC0A 5EAYA 4A3BH 1NTGA 2B3GA 1HR0L 2HT1A 2PMZE 3I55A 4BY7G 3RNUA 2K4KA 2KCMA 1E1TA 3JC66 4YCUA 4DV4L 2QA4A 2IHFA 3STBC 4HIMA 1HNZQ 1E1OA 3S24A 1L0WA 3S1RH 1VQKA 4JYAQ 4GNXC 1FVIA 2R7FA 1MJCA 4DV7Q 1EOVA 3S15H 4BBSG 3RR5A 4BA2I 4DUZL 2ZJPA 3CW2C 2RHQB 3MXNB 5GADC 1WJJA 1HJPA 3T1YL 1KQSA 1K0RA 1X6OA 2PI2E 1FJGQ 3KOJA 4JYAL 3B6YA 1OXXK 3J7A5 4IPDA 4B3TL 1BVSA 1C9OA 2DGYA 4NPSA 4BY1G 4IO9A 2ES2A 2R93G 5IP9G 2HIVA 1N33L 3H3VH 1FJGL 1NBWA 4IPHA 4A4IA 1W2BA 1E7ZA 1EIFA 4IJLA 5IWAL 3PO3H 2UXDQ 3TREA 4P75A 4HJ8A 4DV5L 2NVTH 3HOYG 1LM0A 5IYBH 2KENA 4NXNL 2VQFQ 1IBKL 2EQSA 3H0GG 3FP9A 3UE1A 2UU9Q 2ALYB 4DR4Q 4IOCA 2VNUD 2ATWA 4DK3C 1HR0Q 2R6GA 5JJLA 4A3FG 2JJQA 5FLXc 2Q2UA 2ZTEA 1I50H 3GTMH 4A3GH 4QL5A 1XNQQ 3AFQA 1B70B 4YWKA 1K9MC 3I4MH 1VQFA 2EIFA 4EQ5A 3KJPA 3J7ZC 4LF6L 1TWHH 4ME3A 2PQAA 4JBKA 3U50C 3RZDH 1W3SA 3CF5A 2I0QA 3UE0A 3J80i 2RHSB 4A3IG 1PYSB 2JEBI 2LXKA 3HKZE 2MFIA 2D0PA 2JA5H 4JI7L 1G291 1SN8A 2K50A 2NVYH 1CKNA 3KYHC 4X65Q 3OTOQ 3CCEA 5LMNL 4R4QA 1Y1WG 1X65A 1S40A 2JA8H 1KC8C 1D7QA 4QY7A 1PA6A 3PV0A 2LXJA 2WAQG 2ASBA 2UUCL 5GAHC 1EFWA 1I3QH 4P73A 3HOUG 5C4XG 3GD7A 2RCNA 2B63G 1N32Q 3PIOA 5LMUQ 4HJ9A 3HOXG 4OXPA 1KAWA 1CSPA 4KI0A 1G6PA 1KD1C 5GAGC 2E8GA 2VQFL 4DR1Q 3A74A 1IBKQ 2VY3A 3HOVH 3OW2A 1WI5A 2OTLA 4DR4L 1VQ9A 5IT9c 3U4ZA 3WWVA 4LF7L 3BJUA 3T1HL 4PG3A 4GS3A 4DR2L 4GLXA 5JEAG 3PUWA 3KJOA 3CCQA 1MJEA 5IYCH 1XNQL 1QZHA 3HOWG 3G4SA 3HKSA 3CCLA 1Z9FA 4A3DH 1UE1A 1LTLA 5BR8L 1YHQA 1CUKA 4DV0L 4A3MH 4JI3Q 3GTQH 4MZ9A 1XMOL 3EIVA 4IFDJ 3K81C 1NY4A 1UE7A 4R1JA 4LFCQ 3G48A 4OX9L 3M85A 3PO2H 4B3MQ 4LF4Q 4JI8L 2IX0A 3KF8B 3G6EA 1HZAA 5M3FG 3OTOL 2Z6KA 1K8GA 1A63A 3PF5A 5IP7H 5C3EG 3VDYA 4A93G 3CMAA 2UUCQ 4A3LH 1C7YA 2UUBL 4B3SL 4B3ML 1TXYA 4LF4L 2UUAL 4P71A 4YWMA 1HNWL 2A8VA 1MIUA 3D31A 5FJ8H 4DUYQ 2GN5A 1QZGA 3I4NG 4DR3Q 4GKJL 3BZCA 5J3BA 3HFZB 1YJ9A 3PF4A 1WYDA 2I5MX 2C35B 1PH5A 1CKMA 5HGQA 4AQYL 1VCIA 4LUOA 2ZM6Q 4IPGA 4OWTB 5IWAQ 5GQOA 5C44H 4B3SQ 1HNWQ 1K73C 3HOZG 4DR2Q 2CWAA 4DUYL 1PVOA 4OWXB 4H02A 3RLNA 4A3JG 1XPUA 3TEHB 4XIGS 3CCJA 1VQ4A 3U58A 1PH2A 1OXSC 4L5SA 4R4TA 4APVA 2GVBA 2HHHQ 4BBRG 1Q12A 5C0XI 4GN4B 2E2IH 2N3SA 1N34L 1I94L 1UE5A 4XTCS 4GN5A 2IT1A 1X3FA 2NZOA 1Q86C 3CXCA 3CPWA 2JA9A 4KHZA 2E5LQ 1JMCA 4Y52H 2KBNA 4KLKA 3CCSA 3NEMA 3J80c 3TS0A 2IHEA 4GN3B 1B7YB 2LSSA 4DV2L 3PSIA 1J6QA 3S1NH 1T9HA 3M4OH 1YZ6A 3CC2A 2EXDA 3UDXA 1B8AA 2XGTA 1KRSA 1PH7A 4LUZA 1YI2A 2ID0A 1GD7A 3M9BA 3D0FA 1L2FA 2YYZA 4DV6Q 3U4VA 2JA7G 4JV5L 2MQHA 2K75A 1Q82C 2UXBQ 4DR6Q 4JI6Q 3RN2A 2OCEA 3E9IA 4X64Q 1M1KC 1PV4A 4LF9Q 2R92H 2H5XA 1VQLA 2JK8A 3L2PA 1N8RC 4C3IH 1E22A 1VQBA 2N49A 5FLMG 1I5FA 4LF5L 2L15A 2Z6KC 4DAMA 3EBEA 3GTGH 4IFDI 4A3EG 1YIJA 4JI6L 3IRBA 1PHJA 5C0XG 2MO0A 1CSQA 4A3KG 5GROA 3K8AA 4BY7H 2HIXA 5IYDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 Q;  1LUZ A;  4AIM A;  4JBJ A;  3GTK H;  2E5L L;  2AKW B;  1X55 A;  4X62 L;  4DR7 Q;  5JJK A;  1K83 H;  4PMW A;  5IY0 A;  1S3O A;  2Q2T A;  2IX1 A;  1PH4 A;  4A3C H;  1Q81 C;  4DV2 Q;  1PH6 A;  4L5Q A;  1E3P A;  3ULL A;  3GTL H;  1FL0 A;  3TQY A;  1XMO Q;  3F2D A;  2VUM H;  3CCV A;  2A1A A;  4B3T Q;  1VQ8 A;  1JJ2 A;  4JI2 L;  4LUV A;  3UDI A;  4DV1 L;  1R9T H;  2WB1 E;  4BY1 H;  4LF8 L;  1SE8 A;  3AEV A;  1VQD A;  4DAY B;  5M3M H;  3CME A;  2UXB L;  2R93 H;  4LF7 Q;  2R7Z H;  1X56 A;  1YVC A;  2BA0 A;  4DV5 Q;  1KRT A;  3JAM c;  1VQO A;  3PO3 G;  4BA1 I;  1RL2 A;  4JI1 L;  4JBM A;  3ER0 A;  4GKJ Q;  4LF9 L;  1V43 A;  1XMQ L;  1IBM L;  5C4J H;  4GKK Q;  4LFB Q;  4DR5 L;  4PZ7 A;  4GOP B;  1Z47 A;  1IYJ B;  1HZC A;  2UU9 L;  3J81 j;  1XNR L;  4HJA A;  3K7A H;  1AH9 A;  1BBW A;  1YEZ A;  1VQ5 A;  4BXX H;  1YJW A;  5M5W H;  1K3R A;  1Y1V H;  2PNH A;  2ZJQ A;  4A3G G;  2E2J H;  4GLA C;  3K80 C;  3FKI H;  3T1Y Q;  3A0J A;  3I4M G;  1VQC A;  3KDF A;  1SRU A;  2K5V A;  2OWO A;  2CCZ A;  4GNX A;  4O0A A;  1VQA A;  1QVC A;  3EN2 A;  1PH3 A;  1GVP A;  3ERS X;  5GAE C;  1I94 Q;  2AWN A;  4GNX B;  3CCM A;  1SR3 A;  1TWA H;  3CQZ H;  4JI4 L;  4A3I H;  4DV3 Q;  2Y0S E;  4J15 A;  4NXM L;  3PUV A;  4C3H H;  1BKB A;  1WOC A;  4HIO A;  3ULJ A;  1S72 A;  3S17 H;  2UXD L;  4DV1 Q;  1V9P A;  1Y1W H;  4UP9 A;  2JA8 G;  2GVA A;  1VS0 A;  3PCO B;  3CAM A;  4QIW E;  2YV5 A;  4TVA B;  4HJ5 A;  4PZ6 A;  3H3V I;  3GTP H;  4DV3 L;  2ZM6 L;  5C4X H;  2JEA I;  2B63 H;  4LF8 Q;  2NVX H;  4QQB X;  4R4O A;  4MTN A;  1N32 L;  3HOX H;  1SRO A;  4DR1 L;  2OQ0 A;  1VQ6 A;  4GOP C;  3KF6 B;  1YJN A;  3KFU A;  4RG1 A;  1KHI A;  1WCM H;  1YHB A;  1N36 Q;  2OQK A;  3BZK A;  4X66 Q;  4O2D A;  1XMQ Q;  4LFB L;  4A3B G;  1V1Q A;  3M7N A;  1VQN A;  1SFO H;  1FGU A;  4LF6 Q;  3MEF A;  5K36 G;  1NJI C;  1GM5 A;  1PH9 A;  3E9H A;  5M5Y H;  1N9W A;  4L5R C;  2UXC L;  1KL9 A;  1A62 A;  5HY6 A;  2YTX A;  4NXN Q;  4UPA A;  1L1O A;  2E2H H;  2YU9 H;  1L1O C;  3BU2 A;  1LYL A;  2IY5 B;  3W1G A;  1Q46 A;  3PUX A;  4JOI C;  4DV7 L;  2VZA A;  5IYC G;  4ALP A;  1HH2 P;  4JI5 L;  4EX5 A;  4C3J H;  3RN5 A;  3S1Q H;  4BBS H;  4A3D G;  2Y0S G;  1EIY B;  4IJH A;  3I7F A;  4AYB E;  5ELO A;  4RMF A;  1QUQ B;  1CKO A;  1RIP A;  1JJC B;  2YTV A;  1IBL L;  4OWW B;  4B3R Q;  1I6H H;  2K52 A;  4OO1 I;  5LMU L;  3PO2 G;  3CCU A;  4YY3 Q;  1N33 Q;  4YHH Q;  2F52 A;  5IP9 H;  2HQL A;  3UDF A;  1EQQ A;  4LNQ A;  2PQA B;  2CFM A;  2CKZ B;  4MNO A;  4JG2 A;  1IBL Q;  4B3R L;  2MO1 A;  3CC4 A;  1PFS A;  4DR3 L;  4LW1 A;  2ZTD A;  3HOY H;  4P74 A;  4YY3 L;  3JAM i;  5FJ8 G;  2UUA Q;  1UWV A;  5IE8 A;  5IYB G;  1K8A C;  1VQE A;  1YNX A;  3I2Z A;  3H0G H;  4QJF A;  2D0O A;  1CKN B;  4X6A H;  3GO5 A;  1BBU A;  2D62 A;  2NN6 G;  4A3F H;  4X66 L;  2WAQ E;  3L0O A;  3J81 i;  2WB1 G;  4JI0 Q;  5JJI A;  1VQG A;  1UE6 A;  5BR8 Q;  1WFQ A;  3W1B A;  4LWC A;  1GO3 E;  2VL6 A;  2B29 A;  3S14 H;  4R4C A;  1IXR A;  2PI2 A;  1QVG A;  4POG A;  4A75 A;  2ZTC A;  4P72 A;  1HR0 W;  2JE6 I;  1EQR A;  4YWL A;  3CC7 A;  1OXT A;  1SMX A;  1Y14 B;  1OXV A;  4JI8 Q;  4DPG A;  1H95 A;  3UDG A;  2Q2H A;  5AJ3 L;  4K0K Q;  1Q1E A;  1YBY A;  3CCR A;  3S16 H;  2JA5 G;  4DV4 Q;  1HNZ L;  1JJG A;  1X3G A;  2K5H A;  3SGI A;  2UUB Q;  2N8N A;  3CPF A;  3A5U A;  1A0I A;  3DM3 A;  5C0X J;  3F8T A;  3AYH B;  3RLF A;  4WJ4 A;  1X54 A;  3HOU H;  1XPR A;  4JBW A;  3TS2 A;  3M3Y H;  1YIT A;  1C0A A;  3W5O A;  3RZO H;  2DUD A;  3F2B A;  4UP8 A;  3F2C A;  2V1C C;  5JEA J;  4HID A;  3HOV G;  1P16 A;  1O7I A;  4DR5 Q;  4GKK L;  3PUZ A;  1A8V A;  5ELN A;  5E7N A;  4LFA L;  4X64 L;  2OTJ A;  3FHW A;  3PUY A;  2CWP A;  2HHH L;  2NVQ H;  3ZJY C;  1X9N A;  4OON A;  1NMF A;  3G71 A;  4JI0 L;  4PZ8 A;  1JE5 A;  1TWC H;  1VQJ A;  1VQ7 A;  4IFD G;  4LFA Q;  2QEX A;  4A76 A;  4KHP Q;  4FDB A;  2Z0S A;  4POF A;  3HOW H;  1X3E A;  3KF6 A;  1J5E L;  4YCV A;  4DUZ Q;  4A3K H;  4JI7 Q;  2VW9 A;  4JCV E;  2A19 A;  3GDE A;  1Q1B A;  3DLL A;  2N78 A;  4JI3 L;  4DV0 Q;  1HNX Q;  2F4V Q;  2AMC B;  4A3M G;  3PIP A;  5IYD H;  1OXU A;  4NXM Q;  4X62 Q;  4DR7 L;  3M4Q A;  1U0L A;  1VQM A;  5AJ3 Q;  4K0K L;  3NEL A;  3KDF B;  3F1Z A;  1NE3 A;  1TWG H;  1XJV A;  1G51 A;  2KHI A;  1U5K A;  2WP8 J;  4JI5 Q;  2JA6 G;  5M3F H;  4L5T A;  1L1O B;  3PGZ A;  3RLO A;  4A3C G;  4NB3 A;  2AHO B;  3I4O A;  3K0X A;  3AFP A;  5IP7 G;  5C3E H;  5LMN W;  4A93 H;  1YHA A;  4JV5 Q;  2FXQ A;  4R4I A;  4DNI A;  4HJ7 A;  3ULP A;  4A3L G;  1HZ9 A;  2VUM G;  4DR6 L;  4X65 L;  5LMN Q;  1D8L A;  4QGU A;  3S2H H;  3I4N H;  3HKZ G;  3J81 c;  2VQE Q;  3I56 A;  1PYB A;  3S1M H;  4JOI A;  3CD6 A;  4YHH L;  1UEB A;  1AE3 A;  2I5L X;  2NZH A;  5M3M G;  2R7Z G;  1P8L A;  2QGQ A;  2Q2I A;  1VQH A;  3NBH B;  5C44 G;  4HIK A;  1VQP A;  1ASY A;  1JB7 A;  3HOZ H;  1IBM Q;  2UXC Q;  2VQE L;  2JQO A;  4A3J H;  5H1S E;  4JI1 Q;  3STB D;  2YTY A;  2KCT A;  4DKA C;  5M5X H;  2CQO A;  2MNA A;  4UY8 C;  1XNR Q;  2BA1 A;  3GTO H;  2BH2 A;  1IZ6 A;  1OTC A;  1J5E Q;  4AYB G;  2VS1 A;  4BBR H;  1IL2 A;  1JT8 A;  1DGS A;  4KHP L;  2JA6 H;  4BXX G;  1Y1V G;  1XPO A;  2ZJR A;  1M90 C;  1HNX L;  1ASZ A;  2F4V L;  1MKH A;  1Q8K A;  2R7D A;  4C2M H;  4OO1 G;  1GKH A;  3FKI G;  5DLQ E;  1EUJ A;  3AQQ A;  2K14 A;  4DK6 C;  3TRZ A;  4YCW A;  4WJ3 M;  3GTJ H;  3L7Z C;  4JI2 Q;  2RF4 A;  1NMG A;  3M4P A;  2BH8 A;  1PH8 A;  1AE2 A;  1QVF A;  1QUQ A;  2K5N A;  1TWF H;  3NEN A;  1EYG A;  2KHJ A;  4TQU S;  3H15 A;  4JI4 Q;  4AH6 A;  4GOP A;  3S2D H;  2WFW A;  2I5H A;  4LFC L;  1PH1 A;  4OX9 Q;  1KXL A;  1XTD A;  1E24 A;  4DV6 L;  1VQI A;  2F3I A;  3Q8D A;  2AWO A;  4GLV B;  3E0E A;  2XTI A;  2NN6 I;  2JA7 H;  4IOA A;  1SLJ A;  3CP0 A;  3T1H Q;  1Q7Y C;  2R92 G;  4UP7 A;  4IPC A;  3A5Z B;  3LGJ A;  3K7U C;  1HZB A;  5FLM H;  1WCM G;  1EWI A;  1KIX A;  1N36 L;  4Y7N H;  4AQY Q;  4A3E H;  3ICE A;  3OYY A;  4LF5 Q;  3KLW A;  4JC0 A;  5EAY A;  4A3B H;  1NTG A;  2B3G A;  1HR0 L;  2HT1 A;  2PMZ E;  3I55 A;  4BY7 G;  3RNU A;  2K4K A;  2KCM A;  1E1T A;  3JC6 6;  4YCU A;  4DV4 L;  2QA4 A;  2IHF A;  3STB C;  4HIM A;  1HNZ Q;  1E1O A;  3S24 A;  1L0W A;  3S1R H;  1VQK A;  4JYA Q;  4GNX C;  1FVI A;  2R7F A;  1MJC A;  4DV7 Q;  1EOV A;  3S15 H;  4BBS G;  3RR5 A;  4BA2 I;  4DUZ L;  2ZJP A;  3CW2 C;  2RHQ B;  3MXN B;  5GAD C;  1WJJ A;  1HJP A;  3T1Y L;  1KQS A;  1K0R A;  1X6O A;  2PI2 E;  1FJG Q;  3KOJ A;  4JYA L;  3B6Y A;  1OXX K;  3J7A 5;  4IPD A;  4B3T L;  1BVS A;  1C9O A;  2DGY A;  4NPS A;  4BY1 G;  4IO9 A;  2ES2 A;  2R93 G;  5IP9 G;  2HIV A;  1N33 L;  3H3V H;  1FJG L;  1NBW A;  4IPH A;  4A4I A;  1W2B A;  1E7Z A;  1EIF A;  4IJL A;  5IWA L;  3PO3 H;  2UXD Q;  3TRE A;  4P75 A;  4HJ8 A;  4DV5 L;  2NVT H;  3HOY G;  1LM0 A;  5IYB H;  2KEN A;  4NXN L;  2VQF Q;  1IBK L;  2EQS A;  3H0G G;  3FP9 A;  3UE1 A;  2UU9 Q;  2ALY B;  4DR4 Q;  4IOC A;  2VNU D;  2ATW A;  4DK3 C;  1HR0 Q;  2R6G A;  5JJL A;  4A3F G;  2JJQ A;  5FLX c;  2Q2U A;  2ZTE A;  1I50 H;  3GTM H;  4A3G H;  4QL5 A;  1XNQ Q;  3AFQ A;  1B70 B;  4YWK A;  1K9M C;  3I4M H;  1VQF A;  2EIF A;  4EQ5 A;  3KJP A;  3J7Z C;  4LF6 L;  1TWH H;  4ME3 A;  2PQA A;  4JBK A;  3U50 C;  3RZD H;  1W3S A;  3CF5 A;  2I0Q A;  3UE0 A;  3J80 i;  2RHS B;  4A3I G;  1PYS B;  2JEB I;  2LXK A;  3HKZ E;  2MFI A;  2D0P A;  2JA5 H;  4JI7 L;  1G29 1;  1SN8 A;  2K50 A;  2NVY H;  1CKN A;  3KYH C;  4X65 Q;  3OTO Q;  3CCE A;  5LMN L;  4R4Q A;  1Y1W G;  1X65 A;  1S40 A;  2JA8 H;  1KC8 C;  1D7Q A;  4QY7 A;  1PA6 A;  3PV0 A;  2LXJ A;  2WAQ G;  2ASB A;  2UUC L;  5GAH C;  1EFW A;  1I3Q H;  4P73 A;  3HOU G;  5C4X G;  3GD7 A;  2RCN A;  2B63 G;  1N32 Q;  3PIO A;  5LMU Q;  4HJ9 A;  3HOX G;  4OXP A;  1KAW A;  1CSP A;  4KI0 A;  1G6P A;  1KD1 C;  5GAG C;  2E8G A;  2VQF L;  4DR1 Q;  3A74 A;  1IBK Q;  2VY3 A;  3HOV H;  3OW2 A;  1WI5 A;  2OTL A;  4DR4 L;  1VQ9 A;  5IT9 c;  3U4Z A;  3WWV A;  4LF7 L;  3BJU A;  3T1H L;  4PG3 A;  4GS3 A;  4DR2 L;  4GLX A;  5JEA G;  3PUW A;  3KJO A;  3CCQ A;  1MJE A;  5IYC H;  1XNQ L;  1QZH A;  3HOW G;  3G4S A;  3HKS A;  3CCL A;  1Z9F A;  4A3D H;  1UE1 A;  1LTL A;  5BR8 L;  1YHQ A;  1CUK A;  4DV0 L;  4A3M H;  4JI3 Q;  3GTQ H;  4MZ9 A;  1XMO L;  3EIV A;  4IFD J;  3K81 C;  1NY4 A;  1UE7 A;  4R1J A;  4LFC Q;  3G48 A;  4OX9 L;  3M85 A;  3PO2 H;  4B3M Q;  4LF4 Q;  4JI8 L;  2IX0 A;  3KF8 B;  3G6E A;  1HZA A;  5M3F G;  3OTO L;  2Z6K A;  1K8G A;  1A63 A;  3PF5 A;  5IP7 H;  5C3E G;  3VDY A;  4A93 G;  3CMA A;  2UUC Q;  4A3L H;  1C7Y A;  2UUB L;  4B3S L;  4B3M L;  1TXY A;  4LF4 L;  2UUA L;  4P71 A;  4YWM A;  1HNW L;  2A8V A;  1MIU A;  3D31 A;  5FJ8 H;  4DUY Q;  2GN5 A;  1QZG A;  3I4N G;  4DR3 Q;  4GKJ L;  3BZC A;  5J3B A;  3HFZ B;  1YJ9 A;  3PF4 A;  1WYD A;  2I5M X;  2C35 B;  1PH5 A;  1CKM A;  5HGQ A;  4AQY L;  1VCI A;  4LUO A;  2ZM6 Q;  4IPG A;  4OWT B;  5IWA Q;  5GQO A;  5C44 H;  4B3S Q;  1HNW Q;  1K73 C;  3HOZ G;  4DR2 Q;  2CWA A;  4DUY L;  1PVO A;  4OWX B;  4H02 A;  3RLN A;  4A3J G;  1XPU A;  3TEH B;  4XIG S;  3CCJ A;  1VQ4 A;  3U58 A;  1PH2 A;  1OXS C;  4L5S A;  4R4T A;  4APV A;  2GVB A;  2HHH Q;  4BBR G;  1Q12 A;  5C0X I;  4GN4 B;  2E2I H;  2N3S A;  1N34 L;  1I94 L;  1UE5 A;  4XTC S;  4GN5 A;  2IT1 A;  1X3F A;  2NZO A;  1Q86 C;  3CXC A;  3CPW A;  2JA9 A;  4KHZ A;  2E5L Q;  1JMC A;  4Y52 H;  2KBN A;  4KLK A;  3CCS A;  3NEM A;  3J80 c;  3TS0 A;  2IHE A;  4GN3 B;  1B7Y B;  2LSS A;  4DV2 L;  3PSI A;  1J6Q A;  3S1N H;  1T9H A;  3M4O H;  1YZ6 A;  3CC2 A;  2EXD A;  3UDX A;  1B8A A;  2XGT A;  1KRS A;  1PH7 A;  4LUZ A;  1YI2 A;  2ID0 A;  1GD7 A;  3M9B A;  3D0F A;  1L2F A;  2YYZ A;  4DV6 Q;  3U4V A;  2JA7 G;  4JV5 L;  2MQH A;  2K75 A;  1Q82 C;  2UXB Q;  4DR6 Q;  4JI6 Q;  3RN2 A;  2OCE A;  3E9I A;  4X64 Q;  1M1K C;  1PV4 A;  4LF9 Q;  2R92 H;  2H5X A;  1VQL A;  2JK8 A;  3L2P A;  1N8R C;  4C3I H;  1E22 A;  1VQB A;  2N49 A;  5FLM G;  1I5F A;  4LF5 L;  2L15 A;  2Z6K C;  4DAM A;  3EBE A;  3GTG H;  4IFD I;  4A3E G;  1YIJ A;  4JI6 L;  3IRB A;  1PHJ A;  5C0X G;  2MO0 A;  1CSQ A;  4A3K G;  5GRO A;  3K8A A;  4BY7 H;  2HIX A;  5IYD G; 
#chains in the Genus database with same CATH topology
 1RJT A;  1PFN A;  5KIX A;  4KY7 A;  3GTK H;  3HOU B;  4X62 L;  5M5W B;  4DR7 Q;  3S2H B;  2VB2 X;  2NUC A;  1Q81 C;  1MSH A;  1PH6 A;  4A3B B;  3GTL H;  1FL0 A;  3KLS X;  3CCV A;  2A1A A;  1CZG A;  5D3D A;  1WD1 A;  1JJ2 A;  1F2L A;  2F0K A;  4LUV A;  5D14 A;  2WB1 E;  5C44 B;  3JAM E;  3KLS A;  4DU9 A;  5FKA C;  2UXB L;  4LF7 Q;  1X56 A;  2BA0 A;  5EPL A;  2QDL A;  1CHQ D;  3JAM c;  4R8I A;  3EVQ A;  1LT3 D;  5M9O A;  4KN4 C;  4LF9 L;  1V43 A;  3QIA A;  3RUZ A;  1HA5 A;  1IBM L;  3TN2 A;  2JN4 A;  4GOP B;  1IYJ B;  1BBW A;  1Y1V H;  2ZJQ A;  3R2T A;  2B2V A;  4GLA C;  3K80 C;  4OEM B;  4CGY B;  3KDF A;  1SYB A;  2K5V A;  2OWO A;  4GNX A;  1QVC A;  1PH3 A;  5GAE C;  4NKL A;  4NXM L;  2R7Z B;  4C3H H;  1WOC A;  4DV1 Q;  4RHS A;  1SAP A;  2A6E C;  2GVA A;  2G9D A;  4RKL A;  4HJ5 A;  2A74 C;  3H3V I;  4KY5 A;  1G8Z D;  2B2U C;  5C4X H;  4BY7 B;  1CT1 D;  2B63 H;  4R4O A;  1N32 L;  1I4G A;  1SRO A;  3LNN A;  2OQ0 A;  4GOP C;  3KF6 B;  3OMC A;  1RD9 D;  2K03 A;  3H0G B;  3MHB A;  1YHB A;  1N36 Q;  3BZK A;  4FF3 A;  4A3B G;  1V1Q A;  4XQQ A;  1FGU A;  1NJI C;  1JOQ A;  1A2T A;  1PH9 A;  3E9H A;  2UXC L;  1KL9 A;  1Y1V B;  4NXN Q;  4UPA A;  2YU9 H;  2WV6 D;  1LYL A;  2O5J C;  5ELB A;  4ALP A;  4JOI C;  3U9O A;  1HH2 P;  4JI5 L;  4EX5 A;  5M3M B;  3D4D A;  3VR3 A;  1SEB D;  5C3E B;  3I7F A;  1JWM D;  5E4W C;  1CKO A;  1RIP A;  2MP1 A;  2YTV A;  1IBL L;  4OWW B;  4OO1 I;  5LMU L;  3AB9 A;  4FXK C;  2QCP X;  1FD7 D;  4LNQ A;  1UNS A;  3QOL A;  2CFM A;  4MNO A;  4K5W A;  1HPC A;  1XYI A;  3CC4 A;  2HDM A;  3E5S A;  3S1M B;  4LW1 A;  4P74 A;  3GTO B;  4DFA A;  1Z6H A;  1W6K A;  3I2Z A;  1WCM B;  4DAP A;  1CKN B;  4X6A H;  5C6A A;  2D62 A;  2NN6 G;  2IW3 A;  1WD0 A;  2WAQ E;  3L0O A;  2L9H A;  5BR8 Q;  4LWC A;  5IGE A;  4QUC A;  2PO4 A;  3KLR A;  4A75 A;  1DON A;  4P72 A;  1HR0 W;  4FYD A;  1KAA A;  2JE6 I;  4YWL A;  4CJ1 B;  1Y14 B;  4DPG A;  2B63 B;  3LWE A;  4K0K Q;  1F9P A;  1YBY A;  4O42 A;  3S16 H;  1PXU A;  3I72 A;  3VR5 A;  1B9N A;  5I2X A;  1JJG A;  3SGI A;  2UUB Q;  1UAP A;  2N8N A;  3CPF A;  4UAI A;  2K7V A;  3RLF A;  3BZD B;  3HOU H;  3TSS A;  2DJG C;  1YIT A;  4OHJ A;  5IT9 L;  5EKL A;  4BY1 B;  2V1C C;  3C1E A;  2KCC A;  4KK7 A;  1C48 A;  1A8V A;  5ELN A;  3NHH A;  4X64 L;  2OTJ A;  1H9S B;  3FHW A;  1WTR A;  1GUW A;  1TII D;  1QNU A;  2BE5 D;  1VQJ A;  5JEA H;  2EJF C;  1I50 B;  1MI2 A;  4LFA Q;  4XQN A;  1ILP A;  1SE3 A;  3HKZ B;  4FDB A;  1TKW B;  3K5M A;  2B2U A;  4YCV A;  4DUZ Q;  1ONL A;  2N78 A;  4DV0 Q;  1HNX Q;  2J0T D;  1H9K A;  2AMC B;  3PIP A;  5IYD H;  4NXM Q;  4X3T A;  4HCS A;  4K0K L;  2E2H B;  2CH4 W;  4X3S A;  1TWG H;  1XJV A;  2WP8 J;  1JR0 D;  3P20 A;  2AHO B;  3I4O A;  3J80 L;  5C3E H;  4MHE A;  1JWU D;  3S15 B;  1PZI D;  1PTO B;  3ULP A;  5EQ0 A;  2VUM G;  4X65 L;  5LMN Q;  4QB4 A;  1B3Q A;  4DR6 L;  3S2H H;  2K05 A;  3J81 c;  3Q6S A;  5DNF A;  4C3H B;  1SMY C;  2I5L X;  1SNQ A;  1P8L A;  3GTM B;  1VQH A;  3NBH B;  3HOZ H;  2WB1 B;  2JQO A;  3NQI A;  4DKA C;  5M5X H;  1XNR Q;  2IWH A;  4B08 A;  2VS1 A;  1JT8 A;  2B2Y C;  1G2S A;  1GKH A;  3M4Y A;  1EUJ A;  3TRZ A;  2K14 A;  4DK6 C;  5JJZ A;  3GTJ H;  3L7Z C;  5BN3 A;  5F2D A;  3CQZ B;  4X3K A;  2Z4I A;  1AE2 A;  1QVF A;  3V96 A;  1EYG A;  1NR4 A;  1FNU A;  2QW7 A;  4IUU A;  2I5H A;  3SK4 A;  1I6V C;  1LTR D;  4DV6 L;  3IAY A;  2F3I A;  4ZK9 B;  3T1H Q;  5EKI A;  2R92 G;  4UP7 A;  4IPC A;  3DEO A;  2Z4H A;  3A5Z B;  3N52 A;  1CFM A;  4HMI A;  3ICE A;  4Y7N H;  1SSO A;  2F1M A;  1RTN A;  2HT1 A;  4L8J A;  3I55 A;  4BY7 G;  1KLG D;  2B39 A;  2K4K A;  1R4Q B;  3FVQ A;  3NXW A;  2QA4 A;  3I91 A;  1E1O A;  3S24 A;  4JYA Q;  1ROD A;  4XQJ A;  3RR5 A;  1SBB B;  4KD4 A;  3MXN B;  1HJP A;  2F0I A;  3TP5 A;  1L0Y B;  3QO2 A;  2AQ3 B;  3ERO A;  4MTK A;  5C5L A;  4KN7 C;  1I4R A;  2B8G A;  1BVS A;  2ES2 A;  2HIV A;  2ICE C;  1VMC A;  2H4O A;  3A8I E;  1PRT B;  4P75 A;  2O5I C;  2JSO A;  3D8G A;  1ET9 A;  4NXN L;  2VQF Q;  2UU9 Q;  4Y7N B;  1EYC A;  5JVH 3;  2JJQ A;  1DXM A;  2F0D A;  4CBV A;  1LT4 D;  4I7Z C;  4EQ5 A;  4NMZ A;  2TMP A;  2NTS A;  4NW2 A;  3U50 C;  2IPK D;  1J8I A;  3MVV A;  1PYS B;  2JEB I;  3HKZ E;  2MFI A;  2L4N A;  2JA5 H;  4JI7 L;  2XWB B;  4K5X A;  2K50 A;  3KYH C;  1CKN A;  3TP8 A;  1E2W A;  4R4Q A;  1KC8 C;  1D7Q A;  4RAU C;  3PV0 A;  1G6Z A;  1T5E A;  1D1I A;  2RCN A;  5A2Q L;  4HJ9 A;  2CQA A;  1CSP A;  4KI0 A;  2Z8L A;  1IBK Q;  4HN7 A;  3M4O H;  3HOV H;  3OW2 A;  1STE A;  1VQ9 A;  1SYD A;  2BDO A;  3G6J B;  2EYH A;  3V05 A;  4PG3 A;  3S1N B;  4RCN A;  4GS3 A;  1O7Y A;  1E0B A;  4GLX A;  3K6O A;  3U9S A;  3HOZ B;  3CCQ A;  2R92 B;  2M9V A;  2SNS A;  1EU3 A;  5IYC H;  1XNQ L;  5CBE E;  3G4S A;  1GOZ A;  1Z9F A;  2FHT A;  1YHQ A;  5IGC A;  1SJE D;  1NY4 A;  1UE7 A;  5KNC A;  2IX0 A;  3KF8 B;  2Z6K A;  5G3L D;  2EY2 A;  1A63 A;  2D5D A;  3VDY A;  1BF4 A;  5E4X A;  5COR A;  1ZYR C;  4B3M L;  4P71 A;  2A8V A;  2H1E A;  3D31 A;  2GN5 A;  4GKJ L;  5J3B A;  1EWC A;  3PF4 A;  1YJ9 A;  5M5Y B;  1C8C A;  5HGQ A;  5FO9 B;  1IHZ A;  2X6G A;  4J1M A;  3A8K E;  4IPG A;  5IWA Q;  4ILW A;  1ZXT A;  3J7A F;  3PIP 3;  4DUY L;  4OWX B;  3HP3 A;  1BDO A;  1IW7 D;  4XIG S;  3CCJ A;  1VQ4 A;  1OXS C;  4APV A;  2EPB A;  5C0X I;  4GN4 B;  2E2I H;  3P7J A;  1LTS D;  1N34 L;  1SNP A;  3S1Q B;  3PQI A;  3CPW A;  1NR2 A;  1JMC A;  1ESF A;  1HUM A;  1U9R A;  3ERQ A;  3NEM A;  5CV8 A;  2NTT A;  3NBH A;  4DV2 L;  5TSS A;  1AP0 A;  5C3W A;  2MPM A;  3VA7 A;  4CJ0 B;  2EXD A;  3UDX A;  2XGT A;  4U68 A;  4LUZ A;  3JAM L;  1L2F A;  3FDT A;  3DWP A;  2BOS A;  2JA7 G;  4IUP A;  2OCE A;  3AMU A;  2H5X A;  1VQL A;  5C4J B;  4IN3 A;  1E22 A;  1U4L A;  4LF5 L;  3GTL B;  4DAM A;  4TKO B;  1SNM A;  1PHJ A;  5DEH A;  1CSQ A;  4HAE A;  1GUT A;  5FO8 B;  3NE5 B;  3K8A A;  1N34 Q;  2C5C A;  3SK6 A;  5FK9 C;  2RQX A;  2E5L L;  3MWY W;  1CA5 A;  1X55 A;  1PZJ D;  5JJK A;  2OXP A;  1K83 H;  2DJF C;  2KCN A;  5IY0 A;  4ZYS A;  2K5Q A;  1PH4 A;  2L5T A;  1B4O A;  4DV2 Q;  1E3P A;  2B2W C;  3ULL A;  4F8M A;  1XMO Q;  4K5V A;  4N9P A;  4JI2 L;  3UDI A;  1R9T H;  1NSN S;  3NWS A;  1SE8 A;  3AEV A;  4DAY B;  5M3M H;  3CME A;  3R93 A;  4RHR A;  4DV5 Q;  1YVC A;  2L0C A;  4BWG B;  4F87 A;  2E75 C;  1VQO A;  3PO3 G;  3KK7 A;  4DF7 A;  2D2C C;  4JI1 L;  1YNN D;  2ZXO A;  1XMQ L;  4CDD C;  5C4J H;  1TWG B;  4PZ7 A;  1SYC A;  3K59 A;  3MXN A;  3BS1 A;  4HJA A;  3K7A H;  1ZEQ X;  4BXX H;  5IGG A;  1HA6 A;  4HED A;  3OPO A;  5FLX L;  1SFO B;  3A0J A;  5HGT A;  3G7L A;  1SR3 A;  3H09 A;  2VXW A;  2Y0S E;  3A7L A;  4DV3 Q;  4Q0F A;  4UHV A;  1PLF A;  4IAL A;  3ULJ A;  4DA2 A;  4UP9 A;  3FPP A;  4QIW E;  3R8B A;  3GTP H;  1G91 A;  2F0U A;  2ZM6 L;  5IGD A;  4MTN A;  3HOX H;  3S1R B;  1STN A;  1VQ6 A;  3A7A B;  1YJN A;  5CV7 A;  1WCM H;  1XX8 A;  4A3J B;  1XMQ Q;  1EZ6 A;  3M7N A;  4B9W A;  3T51 B;  4LF6 Q;  5K36 G;  2O2L D;  1W6J A;  5M5Y H;  4ME5 A;  5HY6 A;  1V8Q A;  2JA5 B;  1L1O C;  3BU2 A;  4JI7 Q;  5JOB A;  3RN5 A;  1WTV A;  4C3J H;  1PFM A;  4BBS H;  4AYB E;  3QR8 A;  4ZKB B;  3HG9 A;  4I7A A;  2KEC A;  4LMQ D;  1B2T A;  4C56 C;  2QDB A;  2K52 A;  1CK1 A;  4G7H C;  1F9Q A;  3D3R A;  4PQX A;  3CCU A;  5J39 A;  1N33 Q;  2F52 A;  4WOR A;  2PQA B;  4B3R L;  4JG2 A;  2F3V A;  1Q90 A;  1PFS A;  2ZTD A;  3HOY H;  4YY3 L;  1JOO A;  4AYB B;  1O80 A;  2LMC B;  3SE0 A;  3JAM i;  2UUA Q;  3ND8 A;  4A3G B;  1DZ1 A;  2SOB A;  4QJF A;  1GUG A;  1JOR A;  1BBU A;  2F0M A;  2P5Z X;  3QG1 A;  2K32 A;  3J81 i;  5JJI A;  2VB3 X;  1UE6 A;  1L0X B;  3W1B A;  2VL6 A;  1QVG A;  1I4P A;  2F0W A;  2ZTC A;  1EQR A;  4JVZ A;  1MHW C;  1OXV A;  5AJ3 L;  1JWS D;  3CCR A;  2JA5 G;  1HNZ L;  4PMB A;  3FPU B;  3EQL C;  3A5U A;  1A0I A;  3DM3 A;  3F8T A;  1ICW A;  4EGV A;  5JAV A;  4FF1 A;  2EE1 A;  4JBW A;  1XTC D;  1C0A A;  3RZO H;  2DUD A;  3EJI A;  3F2C A;  1SE2 A;  3C1F A;  3PUZ A;  3K0Y A;  1F2M A;  3GP7 A;  5LL6 X;  2HCI A;  2NVQ H;  1WTQ A;  1TR5 A;  3PO2 B;  2EYO A;  2RDG A;  4PZ8 A;  4C3I G;  1JE5 A;  4XT3 B;  2NVT B;  1K28 A;  2Z0S A;  1X3E A;  1J5E L;  4A3K H;  4UDU C;  4JCV E;  1VF7 A;  1Z7T A;  1BCP C;  1U0L A;  3M4Q A;  1QNK A;  5AJ3 Q;  4QMG A;  2YU9 B;  1NE3 A;  2EJG C;  1G51 A;  2KHI A;  5M3F H;  4L5T A;  3RLO A;  4A3C G;  1U4M A;  3AFP A;  1ENA A;  1EY6 A;  3HRZ C;  1YHA A;  5EPK A;  2FMC A;  2FXQ A;  4R4I A;  4DNI A;  5LMN W;  4JV5 Q;  1JOK A;  1PYB A;  3MZ5 A;  2JA8 B;  4H0L C;  2Y0S B;  4IUQ A;  1AE3 A;  2NZH A;  2WKD A;  1IKM A;  2QGQ A;  2Q2I A;  4HIK A;  1ASY A;  5I6Y A;  1JB7 A;  2VQE L;  2YTY A;  2KCT A;  2MNA A;  3GTO H;  1IZ6 A;  5I9O A;  1OTC A;  2PPB C;  1J5E Q;  4KV6 A;  3PMF A;  1E2Z A;  2JA6 H;  3IFT A;  1STY A;  3S9W A;  4BS9 A;  2ZJR A;  1HNX L;  1RHP A;  1Q8K A;  2Z6B A;  4FF2 A;  1STG A;  1CQV A;  4YCW A;  1MD2 D;  4NDX A;  4WJ3 M;  1U4P A;  4JI2 Q;  1NMG A;  4RKB A;  4V0B A;  2K5N A;  2EY6 A;  3H3V C;  3WOE A;  4JI4 Q;  2N88 A;  3H91 A;  2PCF B;  1KXL A;  1VMP A;  4ID6 A;  3DEP A;  2QKI C;  5FOB B;  2ZT9 C;  1D5Z C;  4IOA A;  3CP0 A;  3VYR A;  1Q7Y C;  2MHV A;  1EWI A;  4A3E H;  4A3B H;  2QEJ C;  5D65 A;  2L1B A;  4LF5 Q;  2PMZ E;  3CRK C;  1HFG A;  1E1T A;  3I4N B;  1HNZ Q;  4HIM A;  3PO3 B;  3T53 B;  1Q8I A;  1L0W A;  3X3N A;  4DV7 Q;  1MJC A;  3QOJ A;  1EOV A;  4WRD A;  4C3J G;  3S15 H;  4BBS G;  4BA2 I;  2PZW A;  3CW2 C;  1SMY D;  1EQV A;  1KQS A;  4IQZ A;  1X6O A;  1Q3L A;  2V4D A;  3H94 A;  2L12 A;  1Y69 U;  2R93 G;  5IP9 G;  1F77 A;  3H3V H;  1FJG L;  4IPH A;  4A4I A;  3NP8 A;  5J22 A;  1E7Z A;  3PO3 H;  3TRE A;  4HJ8 A;  2RA4 A;  2XSC A;  3HOY G;  4OIK A;  5IGF A;  5IYB H;  4DR4 Q;  5KGU A;  2K5W A;  3FP9 A;  1WTP A;  2KOL A;  2R6G A;  4A3E B;  1IL8 A;  4A3F G;  4C2M B;  3QJY A;  3X3M A;  3GTM H;  4A3G H;  1B50 A;  3AU7 A;  1X32 A;  4EQP A;  5KRU A;  1XNQ Q;  1B70 B;  1BOS A;  1LAC A;  1VQF A;  2EIF A;  1IYU A;  4LF6 L;  4KD3 A;  4IZ8 A;  1W3S A;  3UE0 A;  3NPP A;  1CI3 M;  3ONA B;  3J80 E;  4A3I G;  2D0P A;  2F0V A;  1G29 1;  1SN8 A;  2CHB D;  1EY8 A;  1S40 A;  2JA8 H;  1HTL D;  4QY7 A;  4DNT B;  4FVM A;  1LTB D;  5GAH C;  1EFW A;  3GQB A;  3GTP B;  1N32 Q;  1I4Q A;  1AW7 A;  3HOX G;  2LKV A;  3K5N A;  1KD1 C;  1EIG A;  2VQF L;  5IT9 c;  5IGB A;  3D4R A;  4PNY A;  3T1H L;  2LS0 1;  2RVL A;  4DR2 L;  1H9R A;  2A69 C;  4HCE A;  1FR3 A;  3OWF A;  1UE1 A;  4DV0 L;  3GTQ H;  4OX9 L;  4R1J A;  3I90 A;  4C3I B;  4B3M Q;  3G6E A;  5M3F G;  3OIQ A;  4ULL A;  1K8G A;  1CQF A;  2EY5 A;  3PF5 A;  1KDA A;  4LK1 C;  1C7Y A;  1KNA A;  2PZU A;  3BYY B;  1TXY A;  1R9T B;  4B3S L;  4LF4 L;  1JCK B;  4DUY Q;  3I4N G;  5JPN C;  3E0J A;  2I5M X;  1CKM A;  2ZM6 Q;  3J81 L;  2F0G A;  1HNW Q;  5GQO A;  5C44 H;  1K73 C;  3HOZ G;  4DR2 Q;  1XWE A;  1TT2 A;  4A3J G;  1XPU A;  3TEH B;  4L5S A;  2F3W A;  1WVL A;  2BE5 C;  4R4T A;  2HQE A;  5DAU A;  4BBR G;  2I46 A;  3O13 A;  2XIW A;  2N3S A;  1I94 L;  2JA6 G;  4XTC S;  3A55 A;  1GHJ A;  2F0S A;  2JA9 A;  2HDL A;  2E5L Q;  5K5P A;  2R3Z A;  2KBN A;  4KLK A;  3TS0 A;  1D6E C;  1EYA A;  4J8Q A;  2EVB A;  5FO7 B;  4OIJ A;  1GJX A;  1M4V A;  1F2Y A;  1FGB D;  3OW7 A;  4QIW B;  2A6E D;  2OT2 A;  1PH7 A;  5T1I A;  2ID0 A;  1YNJ C;  3R2I A;  1ZKO A;  3I73 A;  2AQ2 B;  4JV5 L;  2MQH A;  2F4I A;  1Q82 C;  3C3L A;  3FRP B;  3E9I A;  4X64 Q;  5EJW A;  2R92 H;  5I6W A;  1N8R C;  4C3I H;  2N49 A;  5FLM G;  4IFD I;  1HCZ A;  4A3E G;  1YIJ A;  4JI6 L;  2MO0 A;  4A3K G;  5COY A;  1DM0 B;  1LAB A;  4AIM A;  1YNN C;  4FO2 A;  2AKW B;  2B8F A;  1ENC A;  1M8A A;  1I4X A;  2Q2T A;  4A3C H;  2M00 A;  3TQY A;  2VUM H;  4RA8 A;  1WTW A;  3TZD A;  3GV3 A;  1WTO A;  4BY1 H;  2R93 H;  4CDF C;  3DWQ A;  1KRT A;  3KF8 A;  4K8J A;  4BA1 I;  3S14 B;  3HEJ A;  3ER0 A;  4K2K A;  4PV1 C;  1PTO F;  2RBM A;  1Z47 A;  1HZC A;  2UU9 L;  1XNR L;  1AH9 A;  1TQO A;  1YEZ A;  1YJW A;  5M5W H;  1K3R A;  4HSP A;  2RSN A;  3OHX C;  2PNH A;  3T1Y Q;  1HQM C;  3S2D B;  2CCZ A;  3K57 A;  1VQA A;  1GVP A;  2PYK A;  3OOC A;  2AWN A;  4GNX B;  3CQZ H;  4Z9C B;  4J15 A;  1I6H B;  2LY7 A;  4I65 A;  1DCZ A;  3TME A;  3Q0A A;  4RCO A;  4K14 A;  4IUR A;  5CBA E;  1V9P A;  1Y1W H;  2JA8 G;  3RMH A;  4DXF A;  1VS0 A;  3PCO B;  3CAM A;  2YV5 A;  3BG3 A;  1G2T A;  2TSS A;  3TDQ A;  4XYQ A;  2XWJ B;  2F0N A;  4LF8 Q;  2NVX H;  1S5D D;  4CJ2 C;  3ND9 A;  5JPM C;  4RFB A;  3KFU A;  4MIU A;  1KHI A;  3VR4 A;  1STA A;  4H7B A;  1VQN A;  3D4W A;  3ZYY X;  4RGO S;  4L5R C;  4TSS A;  2YTX A;  1BQQ T;  3FMC A;  2IY5 B;  1Q46 A;  2L11 A;  2PQE A;  1F9S A;  4A3D G;  2Y0S G;  3Q24 A;  1EIY B;  4IJH A;  3CU7 A;  3L3O C;  2Z9H A;  4B3R Q;  1I6H H;  4RH6 A;  4V19 0;  4YHH Q;  1EQQ A;  1K83 B;  2HQL A;  2CKZ B;  1EWH A;  3OMG A;  3DM1 A;  4DR3 L;  1BUV T;  4O1N A;  5IE8 A;  5IYB G;  1K8A C;  1YNX A;  1X3Q A;  3FEW X;  2QF7 A;  3GO5 A;  2AQ1 B;  4A3F H;  4X66 L;  1IKL A;  1VQG A;  1QJO A;  1WFQ A;  2F0H A;  1GO3 E;  2B29 A;  3S14 H;  1IXR A;  1LTT D;  4POG A;  1PRT C;  1SMX A;  4FP5 D;  4JI8 Q;  1SNO A;  1H95 A;  3UDG A;  3M4O B;  1SXT A;  1SYF A;  2RSO A;  1HHV A;  4DV4 Q;  2K5H A;  2XRQ D;  4ZLT F;  1QIL A;  5C0X J;  3AYH B;  3VR6 A;  2K5D A;  2KA7 A;  1X54 A;  2ZXP A;  3IFD A;  1B3A A;  4XDX A;  5EBC A;  3V2T A;  3TS2 A;  4KTA A;  3TZU A;  1HXY D;  3W5O A;  4G4K A;  4X3U A;  4UP8 A;  2SNM A;  5JEA J;  4IUV A;  3HOV G;  4GKK L;  1BCP D;  1BXT A;  5E7N A;  5A35 A;  4LFA L;  1NUC A;  2HHH L;  5M3F B;  4XYO A;  1O78 A;  3RZD B;  1LO5 D;  3S16 B;  4KHP Q;  1IW7 C;  2XRS D;  3T4A C;  3M3Y B;  2B2T C;  1LT5 D;  3DLL A;  4JI3 L;  2F4V Q;  1O7Z A;  3K7A B;  4A3M G;  1HTP A;  1EFI D;  3NEL A;  3KDF B;  1LTG D;  3F1Z A;  4JI5 Q;  4MN3 A;  1L1O B;  4NB3 A;  4DGZ A;  2EOT A;  4K8I A;  2DN8 A;  4A93 H;  1FNV A;  3BVZ A;  3MTS A;  1LLR D;  4B9X A;  1ET6 A;  2CVR A;  2CW0 C;  1KDB A;  3NTH A;  1HZ9 A;  1DOL A;  2BDN A;  1D8L A;  5NUC A;  4QGU A;  3I4N H;  2VQE Q;  3S1M H;  1PYW D;  4JOI A;  3K5O A;  1S5E D;  5LL6 S;  2RDH A;  2K33 A;  5M3M G;  2NZ1 D;  2R7Z G;  1VQP A;  5C44 G;  4N8X 1;  4K6D A;  2Q8T A;  1IBM Q;  2SDF A;  5H1S E;  1PTO D;  4UY8 C;  2F0J A;  2CQO A;  2BA1 A;  2BH2 A;  1GUN A;  1IL2 A;  4BBR H;  2PMZ B;  1DGS A;  3CHB D;  5CR3 A;  2F0E A;  4KHP L;  3BVG A;  1Y1V G;  1M90 C;  1O7L A;  1RF2 D;  2KJX A;  5BN5 A;  3FKI G;  2KED A;  5DLQ E;  3AQQ A;  3TBI B;  2Z1C A;  3NTK A;  2ICI A;  1BBX C;  2BH8 A;  3NEN A;  1RDP D;  4TQU S;  4AH6 A;  4GOP A;  1TWC B;  3S2D H;  1LTA D;  2WFW A;  4OX9 Q;  3L9A X;  3WDN A;  3BYT B;  2EYF A;  1XTD A;  2K28 A;  4KHV A;  1TY0 A;  1VQI A;  3Q8D A;  2AWO A;  2F0O A;  4GLV B;  2XTI A;  2NN6 I;  2JA7 H;  5C4X B;  1H9M A;  1SLJ A;  2EDG A;  5EGT A;  1U4R A;  1BNZ A;  1HZB A;  1CTM A;  4PMC A;  5FLM H;  1WCM G;  1N36 L;  4AQY Q;  4RGT A;  1EIH A;  3OYY A;  2B3G A;  3SK5 A;  4GZY C;  5K36 H;  3MFY A;  4EQN A;  3RNU A;  2KCM A;  3JC6 6;  4DV4 L;  1JC7 A;  3STB C;  1VQK A;  3M7G A;  4HR7 B;  2EYJ A;  2VUM B;  2R7F A;  3SR1 A;  4DUZ L;  2X69 A;  4QCL A;  2RHQ B;  1SDF A;  3HGB A;  1NNX A;  5GAD C;  4RGN A;  3T1Y L;  1K0R A;  1FJG Q;  1YNJ D;  4JYA L;  1B53 A;  3OIP A;  1A3V A;  1AN8 A;  4IPD A;  1C9O A;  2DGY A;  2PNR C;  4JW0 A;  4K6L A;  4KY6 A;  1NBW A;  1EIF A;  5IWA L;  3J7A V;  1ENF A;  3DWA A;  4DV5 L;  2NVT H;  3EFX D;  5CV9 A;  1SYE A;  2KEN A;  2WII B;  2EQS A;  3W3A A;  2ALY B;  1RKN A;  4IOC A;  4L63 B;  4DK3 C;  2ATW A;  5C5M A;  3R3O A;  3DUZ A;  1D1K A;  2ZTE A;  1I50 H;  1F9R A;  1B44 D;  1QB5 D;  3AFQ A;  4H13 C;  3D6W A;  4YWK A;  1K9M C;  3I4M H;  2ZXR A;  1AZQ A;  3KJP A;  3J7Z C;  3J7Y W;  2A68 C;  2JA7 B;  3CF5 A;  3MXG A;  4BBR B;  4DK1 A;  1TS4 A;  3J80 i;  1SYG A;  4ZCK A;  4C1N I;  2LXK A;  2ENB A;  1A3U A;  5E1F A;  2NVY H;  3SHL A;  3OTO Q;  3CCE A;  1Y1W G;  1X65 A;  1V1P A;  3DHQ A;  1PA6 A;  2LXJ A;  2WAQ G;  4OL7 A;  2UUC L;  2ASB A;  3K5L A;  2JP1 A;  4P73 A;  3HOU G;  3GD7 A;  2B63 G;  3NQT A;  4OXP A;  1K8O A;  3GV6 A;  1TWH B;  1KAW A;  5ISR A;  1G6P A;  2LFN A;  5GAG C;  2E8G A;  4DR4 L;  3PIO 3;  3A74 A;  3TP7 A;  4DK0 A;  2KUM A;  1NAP A;  3J81 E;  1R4P B;  2OF1 A;  3BJU A;  2XNA C;  5CMD A;  1TU2 B;  3NSW A;  1F2Z A;  2EYL A;  2A69 D;  3HOV B;  2C9O A;  5JEA G;  4IFD H;  3PUW A;  3KJO A;  3I4M B;  4ZUI A;  4HMJ A;  1S5C D;  1TWA B;  1QZH A;  1QE6 A;  5EKK A;  3CCL A;  1LTL A;  5EPJ A;  2PW5 A;  2WAC A;  1XMO L;  4LFC Q;  3T16 A;  2BCO A;  2NVY B;  4LF4 Q;  5M5X B;  4JI8 L;  1HZA A;  3OTO L;  2NBF A;  5C3E G;  3CMA A;  2UUC Q;  3E6Z X;  1HRJ A;  2FMM A;  4YWM A;  1MIU A;  4WJW A;  4DR3 Q;  5IOC A;  3BZC A;  4N8F A;  4FXD A;  2XVS A;  1JB3 A;  4AQY L;  2E2D C;  4OWT B;  1HQR D;  1PVO A;  2CWA A;  5IOD A;  2B2W A;  3RLN A;  1SE4 A;  4HTH A;  3Q23 A;  5L37 A;  1SND A;  1PH2 A;  2GVB A;  2HHH Q;  1Q12 A;  3UI2 A;  2N55 A;  4GN5 A;  1JIC A;  2NZO A;  2EXZ A;  4R8N A;  3CXC A;  2OEO A;  3KBX A;  3S17 B;  2K01 A;  1A3T A;  1RTO A;  3NBI A;  2IHE A;  1B7Y B;  4A3F B;  3PSI A;  1J6Q A;  2E74 C;  4KJN A;  1T9H A;  3A8J E;  1YZ6 A;  2I07 B;  5C4H A;  1FYC A;  4DN4 M;  3A56 A;  4ODG A;  2MUY A;  4RWS C;  1YI2 A;  1AZP A;  1GD7 A;  2YYZ A;  4DV6 Q;  5LHY 1;  3U4V A;  2UXB Q;  3H6M A;  2NVQ B;  1PV4 A;  2IJ0 A;  3L2P A;  2K04 A;  3ITP A;  1VQB A;  2DY7 A;  2L15 A;  3TP6 A;  1JE4 A;  2F0L A;  4ABN A;  1VF5 C;  2KQ3 A;  5GRO A;  2NWG A;  4A3K B;  2HIX A;  3Q22 A;  5IYD G;  4H44 C;  1LUZ A;  3FKI B;  4JBJ A;  1PZK D;  1D5X C;  3I3C A;  5CV4 A;  3GTG B;  2QIL A;  3I70 A;  5KND A;  4PMW A;  1EQT A;  1S3O A;  5CV5 A;  4IUN A;  2IX1 A;  4JPB W;  3W2D A;  4L5Q A;  2Q8R E;  3F2D A;  2FIN B;  4B3T Q;  1VQ8 A;  5E3F A;  4DV1 L;  4P2C B;  4WFN 3;  4LF8 L;  1VQD A;  3BDL A;  3VYS A;  2R7Z H;  1TWF B;  1EZ8 A;  1RL2 A;  4R9W A;  1EY5 A;  4JBM A;  3VYU A;  2EZV A;  4GKJ Q;  4LFB Q;  1KDC A;  1V1O A;  4GKK Q;  4DR5 L;  5ELE A;  1EY7 A;  2IX3 A;  1CM9 A;  3J81 j;  4DXG A;  2EYP A;  4JK1 C;  1VQ5 A;  1PFB A;  1QG7 A;  3EA6 A;  2JA6 B;  4A3G G;  2E2J H;  1DOM A;  4OO1 H;  1ESR A;  3FKI H;  3I4M G;  1VQC A;  1SRU A;  4O0A A;  2FJ2 A;  5D3I B;  3EN2 A;  1I94 Q;  3ERS X;  4ZUJ A;  1A6X A;  2EJM A;  3CCM A;  1TWA H;  4JI4 L;  4A3I H;  1QWY A;  2B2Y A;  4OGQ C;  3PUV A;  1BKB A;  4HIO A;  2UXD L;  1S72 A;  3S17 H;  1EEI D;  2MGS A;  2RCF A;  1Y8O B;  4TVA B;  4PZ6 A;  4FNF A;  4DV3 L;  4A3D B;  1VDZ A;  1STB A;  2JEA I;  1Y8P B;  4OEL B;  4NP5 A;  1KLU D;  4DR1 L;  1EEF D;  1LV9 A;  4RG1 A;  1A2U A;  1II3 A;  2OQK A;  4X66 Q;  4LFB L;  4O2D A;  5C4Z A;  1SFO H;  3MEF A;  1OO9 B;  1GM5 A;  1PRT F;  1N9W A;  1A62 A;  1FNW A;  3BDC A;  1L1O A;  2E2H H;  3NTI A;  3W1G A;  3PUX A;  2NB0 A;  5FLX E;  4DV7 L;  2VZA A;  5IYC G;  3S1Q H;  2PW7 A;  1NCV A;  1S4Z A;  5ELO A;  4RMF A;  1QUQ B;  5DM6 3;  3F2U A;  4YIJ A;  2M2L A;  1JJC B;  1Y8N B;  3PO2 G;  2AUK A;  4EVO A;  4YY3 Q;  3HS0 C;  4CKC A;  5IP9 H;  1HFN A;  3UDF A;  1D2B A;  4CDC C;  1IBL Q;  5ELD A;  5CYU A;  2MO1 A;  1WTX A;  2RKS A;  5FJ8 G;  3E3X A;  1UWV A;  4M8A A;  4G57 A;  1VQE A;  3H0G H;  2D0O A;  1DJR D;  1I3Q B;  4G7O C;  4CDE C;  1KNE A;  4A3I B;  4JI0 Q;  2WB1 G;  2JYO A;  3HZX A;  2MJ8 A;  4ZQ3 A;  4R4C A;  1UUP A;  2PI2 A;  3CC7 A;  1OXT A;  3SEB A;  2A5H A;  3C2P A;  1QOH A;  2Q2H A;  1EY0 A;  1Q1E A;  3LWU A;  1X3G A;  3SK8 A;  3KUP A;  3HOY B;  4CKE A;  3OSO A;  4WJ4 A;  1PDQ A;  1XPR A;  4ZAI A;  4C1N K;  3M3Y H;  3T13 A;  4CKB A;  5T1G A;  2KHS A;  2D9U A;  3F2B A;  4HID A;  5CC4 A;  1P16 A;  1O7I A;  4DR5 Q;  3QB3 A;  1I4H A;  2PZT A;  4DAY A;  2G9H D;  5CV6 A;  3PUY A;  2J4X A;  2CWP A;  3DMU A;  3ZJY C;  1X9N A;  4OON A;  2HUG A;  1NMF A;  4E6I A;  3G71 A;  4JI0 L;  4KJO A;  4C3J B;  4BBS B;  1TWC H;  1VQ7 A;  2J7Z A;  4IFD G;  2QEX A;  4A76 A;  2WIN B;  4POF A;  3HOW H;  3KF6 A;  1H9J A;  2R61 A;  5C0X H;  3MC0 B;  1KTK A;  4KKT A;  1CZW A;  2VW9 A;  1WTH A;  2A19 A;  3GDE A;  1Q1B A;  4L6T B;  1LT6 D;  4XT1 B;  1OXU A;  4X62 Q;  4DR7 L;  1VQM A;  1Y1W B;  1MGS A;  1U5K A;  3MEH A;  3PGZ A;  3K0X A;  2IL8 A;  3I8Z A;  5IP7 G;  4A3L G;  1GXD C;  2FFK B;  4HJ7 A;  1XXG A;  2Q8I B;  3HKZ G;  5HUR A;  5IT9 E;  3I56 A;  3CD6 A;  4YHH L;  3D6C A;  1UEB A;  5JVG 3;  5A2Q E;  3VYT A;  1TS3 A;  1RCV D;  2UXC Q;  4A3J H;  4JI1 Q;  3STB D;  1JQY D;  3NK9 A;  5I9P A;  1BO0 A;  4AYB G;  1MSG A;  4A3M B;  4EQO A;  4BXX G;  5BN4 A;  1T5X D;  2B2T A;  1XPO A;  1ASZ A;  3A54 A;  2F4V L;  1GHK A;  2R93 B;  1MKH A;  2F0T A;  1K3B C;  2R7D A;  3URY A;  4C2M H;  2XN9 C;  4OO1 G;  1DD2 A;  2RF4 A;  3M4P A;  1PH8 A;  1GUO A;  1QUQ A;  1TWF H;  2KHJ A;  3I4L A;  3H15 A;  5AFW A;  4XXE A;  3OWE B;  4LFC L;  4C3H G;  1PH1 A;  1X3P A;  1E24 A;  2AUJ D;  3SVM A;  3E0E A;  2A73 B;  5J1Z A;  2EYM A;  3NWT A;  1K0S A;  3LGJ A;  2A68 D;  3K7U C;  2F0F A;  2DY8 A;  4F7X A;  2JXM B;  5I4D A;  1KIX A;  3BVM A;  3KLW A;  4JC0 A;  5EAY A;  1NTG A;  3QWN A;  1EYD A;  1HR0 L;  1EOT A;  3C46 A;  3SXH A;  1K8M A;  2NYZ D;  1BR9 A;  3MAQ A;  4YCU A;  2IHF A;  2E76 C;  2CH4 A;  4TRD A;  3S1R H;  3HOX B;  4GNX C;  1FVI A;  4A93 B;  1B1Z A;  3BDO A;  3GTQ B;  2ZJP A;  4S3S A;  1WJJ A;  2DNC A;  4K2L A;  2B2V C;  2PI2 E;  3KOJ A;  1MBY A;  4M1U B;  3B6Y A;  1TS5 A;  1OXX K;  3J7A 5;  1PMR A;  4LJZ C;  4B3T L;  1ML0 D;  4NPS A;  3VR2 A;  4BY1 G;  4IO9 A;  1N33 L;  1W2B A;  4IJL A;  2UXD Q;  1EY9 A;  1LM0 A;  3DXJ C;  4FXG C;  1IBK L;  3H0G G;  3UE1 A;  3MXP A;  2VNU D;  1TS2 A;  1HR0 Q;  5JJL A;  2NN6 H;  5FLX c;  2Q2U A;  1EU4 A;  2WKC A;  4QL5 A;  1AFP A;  5IIF A;  1BCP B;  1DYQ A;  1TWH H;  4ME3 A;  2PQA A;  4IUT A;  4JBK A;  1S5F D;  4FF4 A;  2NVX B;  1SNC A;  4KKU A;  1AEX A;  3RZD H;  3N6R A;  2I0Q A;  1ILQ A;  2RHS B;  3VA5 A;  3T56 B;  4CHT B;  1S5B D;  1J9O A;  4X65 Q;  5LMN L;  2EY1 A;  1C4Q A;  1DOK A;  5G3L F;  1I3Q H;  1EL0 A;  5C4X G;  3PIO A;  5KEE A;  5LMU Q;  4DAV A;  5KYL A;  4QQB X;  1STH A;  4DR1 Q;  2VY3 A;  1BCP F;  1CHP D;  1E2V A;  1WI5 A;  3MXU A;  2OTL A;  2F0P A;  3U4Z A;  3WWV A;  4LF7 L;  5I2Y A;  3K58 A;  1PRT D;  4QF4 A;  5KNB A;  4KMU C;  1UEA B;  3GTK B;  4F88 A;  4HSV A;  1LTI D;  2KEE A;  1MJE A;  1CA6 A;  1PTO C;  1EY4 A;  2E2J B;  3HOW G;  3NUC A;  3HKS A;  4A3D H;  3CKI B;  5BR8 L;  3MFG A;  1CUK A;  4A3M H;  4JI3 Q;  4MZ9 A;  3EIV A;  4N9T A;  4IFD J;  3K81 C;  2G5D A;  3G48 A;  3M85 A;  3PO2 H;  2GA4 B;  2CW0 D;  2O4X A;  3P75 A;  2A6H C;  5IP7 H;  4A93 G;  1GUS A;  2RDF A;  2X6L A;  4A3L H;  2UUB L;  1HNW L;  3P1H A;  2UUA L;  1A15 A;  5FJ8 H;  1QZG A;  3HFZ B;  4QUF A;  3LX0 A;  1WYD A;  3KBG A;  2C35 B;  1PH5 A;  2L55 A;  2K1B A;  3HOW B;  1VCI A;  4LUO A;  4B3S Q;  2K6A A;  2F03 A;  1D5M C;  4H02 A;  4KKS A;  4RGM A;  3U58 A;  5DM7 3;  3WOF A;  5EBD A;  1TVX A;  3RZO B;  4LAA A;  1UE5 A;  3SDZ A;  1Q86 C;  2IT1 A;  1X3F A;  1H9S A;  4KHZ A;  4Y52 H;  3IL8 A;  1IYV A;  1ICF B;  4ZKC B;  1PTO H;  3CCS A;  3J80 c;  3MA2 B;  3CRL C;  4GN3 B;  1HUN A;  3IKJ A;  2LSS A;  1ZYR D;  2SEB D;  5KYI A;  3S1N H;  4Q5V A;  2A6H D;  3RD4 A;  2F0Q A;  3CC2 A;  3GTJ B;  5ELF A;  1B8A A;  1KRS A;  2WAQ B;  4J6H A;  3M9B A;  3D0F A;  4DNR B;  1SJH D;  5CGK A;  2K75 A;  5ELC A;  4DR6 Q;  4JI6 Q;  1V1P B;  3RN2 A;  4LF9 Q;  1M1K C;  2JK8 A;  2HD3 A;  1B9M A;  1I5F A;  1QCB D;  5C3X A;  2Z6K C;  2HCC A;  3EBE A;  3GTG H;  1TY2 A;  3IRB A;  5C0X G;  4ZRZ A;  4G7Z C;  2DNE A;  2KVM A;  2E2I B;  4U67 3;  1KAB A;  4BY7 H; 
#chains in the Genus database with same CATH homology
 1N34 Q;  1LUZ A;  4AIM A;  4JBJ A;  3GTK H;  2E5L L;  2AKW B;  1X55 A;  4X62 L;  4DR7 Q;  5JJK A;  1K83 H;  4PMW A;  5IY0 A;  1S3O A;  2Q2T A;  2IX1 A;  1PH4 A;  4A3C H;  1Q81 C;  4DV2 Q;  1PH6 A;  4L5Q A;  1E3P A;  3ULL A;  3GTL H;  1FL0 A;  3TQY A;  1XMO Q;  3F2D A;  2VUM H;  3CCV A;  2A1A A;  4B3T Q;  1VQ8 A;  1JJ2 A;  4JI2 L;  4LUV A;  3UDI A;  4DV1 L;  1R9T H;  2WB1 E;  4BY1 H;  4LF8 L;  1SE8 A;  3AEV A;  1VQD A;  4DAY B;  5M3M H;  3CME A;  2UXB L;  2R93 H;  4LF7 Q;  2R7Z H;  1X56 A;  1YVC A;  2BA0 A;  4DV5 Q;  1KRT A;  3JAM c;  1VQO A;  3PO3 G;  4BA1 I;  1RL2 A;  4JI1 L;  4JBM A;  3ER0 A;  4GKJ Q;  4LF9 L;  1V43 A;  1XMQ L;  1IBM L;  5C4J H;  4GKK Q;  4LFB Q;  4DR5 L;  4PZ7 A;  4GOP B;  1Z47 A;  1IYJ B;  1HZC A;  2UU9 L;  3J81 j;  1XNR L;  4HJA A;  3K7A H;  1AH9 A;  1BBW A;  1YEZ A;  1VQ5 A;  4BXX H;  1YJW A;  5M5W H;  1K3R A;  1Y1V H;  2PNH A;  2ZJQ A;  4A3G G;  2E2J H;  4GLA C;  3K80 C;  3FKI H;  3T1Y Q;  3A0J A;  3I4M G;  1VQC A;  3KDF A;  1SRU A;  2K5V A;  2OWO A;  2CCZ A;  4GNX A;  4O0A A;  1VQA A;  1QVC A;  3EN2 A;  1PH3 A;  1GVP A;  3ERS X;  5GAE C;  1I94 Q;  2AWN A;  4GNX B;  3CCM A;  1SR3 A;  1TWA H;  3CQZ H;  4JI4 L;  4A3I H;  4DV3 Q;  2Y0S E;  4J15 A;  4NXM L;  3PUV A;  4C3H H;  1BKB A;  1WOC A;  4HIO A;  3ULJ A;  1S72 A;  3S17 H;  2UXD L;  4DV1 Q;  1V9P A;  1Y1W H;  4UP9 A;  2JA8 G;  2GVA A;  1VS0 A;  3PCO B;  3CAM A;  4QIW E;  2YV5 A;  4TVA B;  4HJ5 A;  4PZ6 A;  3H3V I;  3GTP H;  4DV3 L;  2ZM6 L;  5C4X H;  2JEA I;  2B63 H;  4LF8 Q;  2NVX H;  4QQB X;  4R4O A;  4MTN A;  1N32 L;  3HOX H;  1SRO A;  4DR1 L;  2OQ0 A;  1VQ6 A;  4GOP C;  3KF6 B;  1YJN A;  3KFU A;  4RG1 A;  1KHI A;  1WCM H;  1YHB A;  1N36 Q;  2OQK A;  3BZK A;  4X66 Q;  4O2D A;  1XMQ Q;  4LFB L;  4A3B G;  1V1Q A;  3M7N A;  1VQN A;  1SFO H;  1FGU A;  4LF6 Q;  3MEF A;  5K36 G;  1NJI C;  1GM5 A;  1PH9 A;  3E9H A;  5M5Y H;  1N9W A;  4L5R C;  2UXC L;  1KL9 A;  1A62 A;  5HY6 A;  2YTX A;  4NXN Q;  4UPA A;  1L1O A;  2E2H H;  2YU9 H;  1L1O C;  3BU2 A;  1LYL A;  2IY5 B;  3W1G A;  1Q46 A;  3PUX A;  4JOI C;  4DV7 L;  2VZA A;  5IYC G;  4ALP A;  1HH2 P;  4JI5 L;  4EX5 A;  4C3J H;  3RN5 A;  3S1Q H;  4BBS H;  4A3D G;  2Y0S G;  1EIY B;  4IJH A;  3I7F A;  4AYB E;  5ELO A;  4RMF A;  1QUQ B;  1CKO A;  1RIP A;  1JJC B;  2YTV A;  1IBL L;  4OWW B;  4B3R Q;  1I6H H;  2K52 A;  4OO1 I;  5LMU L;  3PO2 G;  3CCU A;  4YY3 Q;  1N33 Q;  4YHH Q;  2F52 A;  5IP9 H;  2HQL A;  3UDF A;  1EQQ A;  4LNQ A;  2PQA B;  2CFM A;  2CKZ B;  4MNO A;  4JG2 A;  1IBL Q;  4B3R L;  2MO1 A;  3CC4 A;  1PFS A;  4DR3 L;  4LW1 A;  2ZTD A;  3HOY H;  4P74 A;  4YY3 L;  3JAM i;  5FJ8 G;  2UUA Q;  1UWV A;  5IE8 A;  5IYB G;  1K8A C;  1VQE A;  1YNX A;  3I2Z A;  3H0G H;  4QJF A;  2D0O A;  1CKN B;  4X6A H;  3GO5 A;  1BBU A;  2D62 A;  2NN6 G;  4A3F H;  4X66 L;  2WAQ E;  3L0O A;  3J81 i;  2WB1 G;  4JI0 Q;  5JJI A;  1VQG A;  1UE6 A;  5BR8 Q;  1WFQ A;  3W1B A;  4LWC A;  1GO3 E;  2VL6 A;  2B29 A;  3S14 H;  4R4C A;  1IXR A;  2PI2 A;  1QVG A;  4POG A;  4A75 A;  2ZTC A;  4P72 A;  1HR0 W;  2JE6 I;  1EQR A;  4YWL A;  3CC7 A;  1OXT A;  1SMX A;  1Y14 B;  1OXV A;  4JI8 Q;  4DPG A;  1H95 A;  3UDG A;  2Q2H A;  5AJ3 L;  4K0K Q;  1Q1E A;  1YBY A;  3CCR A;  3S16 H;  2JA5 G;  4DV4 Q;  1HNZ L;  1JJG A;  1X3G A;  2K5H A;  3SGI A;  2UUB Q;  2N8N A;  3CPF A;  3A5U A;  1A0I A;  3DM3 A;  5C0X J;  3F8T A;  3AYH B;  3RLF A;  4WJ4 A;  1X54 A;  3HOU H;  1XPR A;  4JBW A;  3TS2 A;  3M3Y H;  1YIT A;  1C0A A;  3W5O A;  3RZO H;  2DUD A;  3F2B A;  4UP8 A;  3F2C A;  2V1C C;  5JEA J;  4HID A;  3HOV G;  1P16 A;  1O7I A;  4DR5 Q;  4GKK L;  3PUZ A;  1A8V A;  5ELN A;  5E7N A;  4LFA L;  4X64 L;  2OTJ A;  3FHW A;  3PUY A;  2CWP A;  2HHH L;  2NVQ H;  3ZJY C;  1X9N A;  4OON A;  1NMF A;  3G71 A;  4JI0 L;  4PZ8 A;  1JE5 A;  1TWC H;  1VQJ A;  1VQ7 A;  4IFD G;  4LFA Q;  2QEX A;  4A76 A;  4KHP Q;  4FDB A;  2Z0S A;  4POF A;  3HOW H;  1X3E A;  3KF6 A;  1J5E L;  4YCV A;  4DUZ Q;  4A3K H;  4JI7 Q;  2VW9 A;  4JCV E;  2A19 A;  3GDE A;  1Q1B A;  3DLL A;  2N78 A;  4JI3 L;  4DV0 Q;  1HNX Q;  2F4V Q;  2AMC B;  4A3M G;  3PIP A;  5IYD H;  1OXU A;  4NXM Q;  4X62 Q;  4DR7 L;  3M4Q A;  1U0L A;  1VQM A;  5AJ3 Q;  4K0K L;  3NEL A;  3KDF B;  3F1Z A;  1NE3 A;  1TWG H;  1XJV A;  1G51 A;  2KHI A;  1U5K A;  2WP8 J;  4JI5 Q;  2JA6 G;  5M3F H;  4L5T A;  1L1O B;  3PGZ A;  3RLO A;  4A3C G;  4NB3 A;  2AHO B;  3I4O A;  3K0X A;  3AFP A;  5IP7 G;  5C3E H;  5LMN W;  4A93 H;  1YHA A;  4JV5 Q;  2FXQ A;  4R4I A;  4DNI A;  4HJ7 A;  3ULP A;  4A3L G;  1HZ9 A;  2VUM G;  4DR6 L;  4X65 L;  5LMN Q;  1D8L A;  4QGU A;  3S2H H;  3I4N H;  3HKZ G;  3J81 c;  2VQE Q;  3I56 A;  1PYB A;  3S1M H;  4JOI A;  3CD6 A;  4YHH L;  1UEB A;  1AE3 A;  2I5L X;  2NZH A;  5M3M G;  2R7Z G;  1P8L A;  2QGQ A;  2Q2I A;  1VQH A;  3NBH B;  5C44 G;  4HIK A;  1VQP A;  1ASY A;  1JB7 A;  3HOZ H;  1IBM Q;  2UXC Q;  2VQE L;  2JQO A;  4A3J H;  5H1S E;  4JI1 Q;  3STB D;  2YTY A;  2KCT A;  4DKA C;  5M5X H;  2CQO A;  2MNA A;  4UY8 C;  1XNR Q;  2BA1 A;  3GTO H;  2BH2 A;  1IZ6 A;  1OTC A;  1J5E Q;  4AYB G;  2VS1 A;  4BBR H;  1IL2 A;  1JT8 A;  1DGS A;  4KHP L;  2JA6 H;  4BXX G;  1Y1V G;  1XPO A;  2ZJR A;  1M90 C;  1HNX L;  1ASZ A;  2F4V L;  1MKH A;  1Q8K A;  2R7D A;  4C2M H;  4OO1 G;  1GKH A;  3FKI G;  5DLQ E;  1EUJ A;  3AQQ A;  2K14 A;  4DK6 C;  3TRZ A;  4YCW A;  4WJ3 M;  3GTJ H;  3L7Z C;  4JI2 Q;  2RF4 A;  1NMG A;  3M4P A;  2BH8 A;  1PH8 A;  1AE2 A;  1QVF A;  1QUQ A;  2K5N A;  1TWF H;  3NEN A;  1EYG A;  2KHJ A;  4TQU S;  3H15 A;  4JI4 Q;  4AH6 A;  4GOP A;  3S2D H;  2WFW A;  2I5H A;  4LFC L;  1PH1 A;  4OX9 Q;  1KXL A;  1XTD A;  1E24 A;  4DV6 L;  1VQI A;  2F3I A;  3Q8D A;  2AWO A;  4GLV B;  3E0E A;  2XTI A;  2NN6 I;  2JA7 H;  4IOA A;  1SLJ A;  3CP0 A;  3T1H Q;  1Q7Y C;  2R92 G;  4UP7 A;  4IPC A;  3A5Z B;  3LGJ A;  3K7U C;  1HZB A;  5FLM H;  1WCM G;  1EWI A;  1KIX A;  1N36 L;  4Y7N H;  4AQY Q;  4A3E H;  3ICE A;  3OYY A;  4LF5 Q;  3KLW A;  4JC0 A;  5EAY A;  4A3B H;  1NTG A;  2B3G A;  1HR0 L;  2HT1 A;  2PMZ E;  3I55 A;  4BY7 G;  3RNU A;  2K4K A;  2KCM A;  1E1T A;  3JC6 6;  4YCU A;  4DV4 L;  2QA4 A;  2IHF A;  3STB C;  4HIM A;  1HNZ Q;  1E1O A;  3S24 A;  1L0W A;  3S1R H;  1VQK A;  4JYA Q;  4GNX C;  1FVI A;  2R7F A;  1MJC A;  4DV7 Q;  1EOV A;  3S15 H;  4BBS G;  3RR5 A;  4BA2 I;  4DUZ L;  2ZJP A;  3CW2 C;  2RHQ B;  3MXN B;  5GAD C;  1WJJ A;  1HJP A;  3T1Y L;  1KQS A;  1K0R A;  1X6O A;  2PI2 E;  1FJG Q;  3KOJ A;  4JYA L;  3B6Y A;  1OXX K;  3J7A 5;  4IPD A;  4B3T L;  1BVS A;  1C9O A;  2DGY A;  4NPS A;  4BY1 G;  4IO9 A;  2ES2 A;  2R93 G;  5IP9 G;  2HIV A;  1N33 L;  3H3V H;  1FJG L;  1NBW A;  4IPH A;  4A4I A;  1W2B A;  1E7Z A;  1EIF A;  4IJL A;  5IWA L;  3PO3 H;  2UXD Q;  3TRE A;  4P75 A;  4HJ8 A;  4DV5 L;  2NVT H;  3HOY G;  1LM0 A;  5IYB H;  2KEN A;  4NXN L;  2VQF Q;  1IBK L;  2EQS A;  3H0G G;  3FP9 A;  3UE1 A;  2UU9 Q;  2ALY B;  4DR4 Q;  4IOC A;  2VNU D;  2ATW A;  4DK3 C;  1HR0 Q;  2R6G A;  5JJL A;  4A3F G;  2JJQ A;  5FLX c;  2Q2U A;  2ZTE A;  1I50 H;  3GTM H;  4A3G H;  4QL5 A;  1XNQ Q;  3AFQ A;  1B70 B;  4YWK A;  1K9M C;  3I4M H;  1VQF A;  2EIF A;  4EQ5 A;  3KJP A;  3J7Z C;  4LF6 L;  1TWH H;  4ME3 A;  2PQA A;  4JBK A;  3U50 C;  3RZD H;  1W3S A;  3CF5 A;  2I0Q A;  3UE0 A;  3J80 i;  2RHS B;  4A3I G;  1PYS B;  2JEB I;  2LXK A;  3HKZ E;  2MFI A;  2D0P A;  2JA5 H;  4JI7 L;  1G29 1;  1SN8 A;  2K50 A;  2NVY H;  1CKN A;  3KYH C;  4X65 Q;  3OTO Q;  3CCE A;  5LMN L;  4R4Q A;  1Y1W G;  1X65 A;  1S40 A;  2JA8 H;  1KC8 C;  1D7Q A;  4QY7 A;  1PA6 A;  3PV0 A;  2LXJ A;  2WAQ G;  2ASB A;  2UUC L;  5GAH C;  1EFW A;  1I3Q H;  4P73 A;  3HOU G;  5C4X G;  3GD7 A;  2RCN A;  2B63 G;  1N32 Q;  3PIO A;  5LMU Q;  4HJ9 A;  3HOX G;  4OXP A;  1KAW A;  1CSP A;  4KI0 A;  1G6P A;  1KD1 C;  5GAG C;  2E8G A;  2VQF L;  4DR1 Q;  3A74 A;  1IBK Q;  2VY3 A;  3HOV H;  3OW2 A;  1WI5 A;  2OTL A;  4DR4 L;  1VQ9 A;  5IT9 c;  3U4Z A;  3WWV A;  4LF7 L;  3BJU A;  3T1H L;  4PG3 A;  4GS3 A;  4DR2 L;  4GLX A;  5JEA G;  3PUW A;  3KJO A;  3CCQ A;  1MJE A;  5IYC H;  1XNQ L;  1QZH A;  3HOW G;  3G4S A;  3HKS A;  3CCL A;  1Z9F A;  4A3D H;  1UE1 A;  1LTL A;  5BR8 L;  1YHQ A;  1CUK A;  4DV0 L;  4A3M H;  4JI3 Q;  3GTQ H;  4MZ9 A;  1XMO L;  3EIV A;  4IFD J;  3K81 C;  1NY4 A;  1UE7 A;  4R1J A;  4LFC Q;  3G48 A;  4OX9 L;  3M85 A;  3PO2 H;  4B3M Q;  4LF4 Q;  4JI8 L;  2IX0 A;  3KF8 B;  3G6E A;  1HZA A;  5M3F G;  3OTO L;  2Z6K A;  1K8G A;  1A63 A;  3PF5 A;  5IP7 H;  5C3E G;  3VDY A;  4A93 G;  3CMA A;  2UUC Q;  4A3L H;  1C7Y A;  2UUB L;  4B3S L;  4B3M L;  1TXY A;  4LF4 L;  2UUA L;  4P71 A;  4YWM A;  1HNW L;  2A8V A;  1MIU A;  3D31 A;  5FJ8 H;  4DUY Q;  2GN5 A;  1QZG A;  3I4N G;  4DR3 Q;  4GKJ L;  3BZC A;  5J3B A;  3HFZ B;  1YJ9 A;  3PF4 A;  1WYD A;  2I5M X;  2C35 B;  1PH5 A;  1CKM A;  5HGQ A;  4AQY L;  1VCI A;  4LUO A;  2ZM6 Q;  4IPG A;  4OWT B;  5IWA Q;  5GQO A;  5C44 H;  4B3S Q;  1HNW Q;  1K73 C;  3HOZ G;  4DR2 Q;  2CWA A;  4DUY L;  1PVO A;  4OWX B;  4H02 A;  3RLN A;  4A3J G;  1XPU A;  3TEH B;  4XIG S;  3CCJ A;  1VQ4 A;  3U58 A;  1PH2 A;  1OXS C;  4L5S A;  4R4T A;  4APV A;  2GVB A;  2HHH Q;  4BBR G;  1Q12 A;  5C0X I;  4GN4 B;  2E2I H;  2N3S A;  1N34 L;  1I94 L;  1UE5 A;  4XTC S;  4GN5 A;  2IT1 A;  1X3F A;  2NZO A;  1Q86 C;  3CXC A;  3CPW A;  2JA9 A;  4KHZ A;  2E5L Q;  1JMC A;  4Y52 H;  2KBN A;  4KLK A;  3CCS A;  3NEM A;  3J80 c;  3TS0 A;  2IHE A;  4GN3 B;  1B7Y B;  2LSS A;  4DV2 L;  3PSI A;  1J6Q A;  3S1N H;  1T9H A;  3M4O H;  1YZ6 A;  3CC2 A;  2EXD A;  3UDX A;  1B8A A;  2XGT A;  1KRS A;  1PH7 A;  4LUZ A;  1YI2 A;  2ID0 A;  1GD7 A;  3M9B A;  3D0F A;  1L2F A;  2YYZ A;  4DV6 Q;  3U4V A;  2JA7 G;  4JV5 L;  2MQH A;  2K75 A;  1Q82 C;  2UXB Q;  4DR6 Q;  4JI6 Q;  3RN2 A;  2OCE A;  3E9I A;  4X64 Q;  1M1K C;  1PV4 A;  4LF9 Q;  2R92 H;  2H5X A;  1VQL A;  2JK8 A;  3L2P A;  1N8R C;  4C3I H;  1E22 A;  1VQB A;  2N49 A;  5FLM G;  1I5F A;  4LF5 L;  2L15 A;  2Z6K C;  4DAM A;  3EBE A;  3GTG H;  4IFD I;  4A3E G;  1YIJ A;  4JI6 L;  3IRB A;  1PHJ A;  5C0X G;  2MO0 A;  1CSQ A;  4A3K G;  5GRO A;  3K8A A;  4BY7 H;  2HIX A;  5IYD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...