4MZ9A

Revised structure of e. coli ssb
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Intramolecular binding mode of the C-terminus of Escherichia coli single-stranded DNA binding protein determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 18
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4mz9A00
1FJGQ 1YEZA 4APVA 2FXQA 1N9WA 4DV0L 1IBLQ 3FHWA 4JOIC 2NVTH 3I4OA 4NPSA 5IP7H 4C3IH 3L0OA 1XMOL 2DGYA 1IZ6A 4YCUA 4IPDA 2QEXA 2KCTA 4DV2Q 4JBMA 1K83H 4AIMA 4AYBG 2VQFL 4DR3L 3D0FA 1Q7YC 2B3GA 2Z0SA 4L5TA 4DV0Q 4JBKA 1RIPA 3UE1A 1Z47A 1VQJA 2F3IA 1XMOQ 1JJCB 1N33L 4DR1L 4LFAL 2VQFQ 4DR3Q 3GO5A 2HHHL 5ELNA 2CKZB 3GTLH 4R4CA 4A3MG 4RMFA 1FL0A 2VQEL 4IOCA 3GTKH 4GLVB 4BY1H 4POFA 2ZJPA 1YJWA 2OWOA 1N33Q 4DR1Q 4TVAB 4LFAQ 3EN2A 4DV3L 3CCVA 1IL2A 3PO2G 1PH1A 4IOAA 1N32L 2HHHQ 4X66L 1PV4A 2VQEQ 4LFBL 2JA5H 4BBSH 5M5XH 2R7FA 4DV3Q 4A3EG 1N32Q 2AWOA 2QA4A 1I6HH 1OXXK 3A5UA 1B7YB 4JI3L 4X66Q 4LF9L 1LYLA 1Y1WH 4HIOA 3S1RH 4LF6L 2IY5B 1BVSA 4GLXA 3TQYA 1WOCA 1I50H 2N8NA 1G291 2K4KA 1Y1VG 4JI3Q 3NENA 4LF9Q 1C9OA 3MXNB 4LF6Q 1QZHA 1A8VA 2ZTEA 3OYYA 3BJUA 3RZOH 3F2CA 1FGUA 4TQUS 4YCWA 4YHHL 1YBYA 2MO0A 5FLMG 2WP8J 3J81j 4JI7L 3TRZA 4JG2A 3BZCA 4DV4L 5ELOA 2D0PA 2K75A 4P75A 4LUZA 1L2FA 2R7DA 4IPHA 4DAYB 3I7FA 3TREA 1N34L 1UEBA 1IBKL 2ZTCA 4YHHQ 4YY3L 5C0XJ 5HGQA 2CWPA 3T1YL 1HR0L 1EIYB 4HJAA 4JI7Q 4X65L 5BR8L 1NY4A 4DV4Q 4HJ5A 1C7YA 4A3JH 1X56A 4NXML 5HY6A 2HIVA 1M1KC 5LMNW 4LF5L 2R92H 4BXXH 4A3KH 1N34Q 1IBKQ 3AFPA 5GROA 4YY3Q 3RLFA 1HR0Q 3AYHB 1SN8A 2CQOA 3T1YQ 4LF4L 3FKIG 4X65Q 5BR8Q 4LFCQ 4NXMQ 3HOZH 2WB1G 4A75A 1YIJA 2JA7H 4LF5Q 3H0GH 4RG1A 4UP7A 4LF4Q 5C0XG 2HQLA 5GAHC 1QVCA 4DV1Q 2KHIA 4DUZL 4LUVA 4OX9L 4PG3A 3GTMH 2EQSA 2IT1A 4KHZA 2BA1A 2A19A 1PH8A 4A3GG 2MQHA 3T1HL 1L0WA 1H95A 3D31A 2I5LX 3DLLA 1PH7A 3EIVA 4C2MH 4L5RC 1VQBA 4KLKA 3CF5A 4DUZQ 4A3FH 4OX9Q 1X54A 1OXSC 2A8VA 1PA6A 1NJIC 3CD6A 3T1HQ 1K8AC 2UUBL 3KJPA 3ULLA 1GO3E 3PV0A 4A3LH 4UPAA 3MEFA 1AH9A 3PF4A 3S14H 3S1MH 2AKWB 2N78A 1SRUA 3HOWH 3W5OA 3CQZH 4IO9A 2UUBQ 4DV5L 2HIXA 4DPGA 3G6EA 4JYAL 1G6PA 2B63H 3OTOL 2JEBI 2JA8H 4BBRG 4X6AH 2ES2A 2IX0A 1Q46A 4P71A 2E2IH 2VUMG 3I56A 4DV5Q 5C44H 3HOYG 1TWGH 1KHIA 1YNXA 3SGIA 2AWNA 3CPFA 2ZJRA 1VQKA 3OTOQ 4BA2I 4JYAQ 1CSQA 4P73A 4JI1L 3PUZA 3CW2C 4GNXC 3UDGA 4OWWB 1SROA 4DV7L 4OO1G 4JI1Q 2NN6G 4R4OA 1RL2A 1MKHA 4DV7Q 1JT8A 4J15A 4A3IH 4GOPC 3HKZG 5E7NA 2UXCL 1PH5A 3I2ZA 1XNQL 1OTCA 3UDXA 5C3EG 4JOIA 2DUDA 2I5MX 2VZAA 2PI2A 2Q2HA 1X3FA 1VQPA 3HOUG 1GM5A 3A0JA 2UXCQ 1XNQQ 4IJLA 2YTXA 3KYHC 1XPUA 4A3CH 1EUJA 5M5WH 3ZJYC 1SLJA 3PF5A 1HH2P 3U4VA 1S40A 5M5YH 4UP8A 2Z6KA 3K80C 4AYBE 1VQ7A 3M85A 1HNWL 4DR7Q 3PUYA 3PUXA 2NVQH 3UE0A 1OXUA 3CC7A 3RZDH 1EQQA 1K8GA 1GD7A 3E9HA 2ID0A 1D7QA 3S17H 3F2DA 5AJ3Q 5K36G 3KJOA 4LNQA 1HNWQ 1PFSA 1SR3A 4O2DA 5IYCH 5GAEC 1SMXA 3JAMi 5LMNL 3HOVH 2I0QA 2RHSB 1J6QA 4A3BH 3E9IA 4GS3A 3GTJH 4BY7G 4K0KL 1QVGA 2VW9A 1Z9FA 4P74A 1W3SA 2KENA 2OCEA 2Z6KC 4LUOA 5IP7G 5LMNQ 4MZ9A 3Q8DA 5GAGC 4QGUA 3GD7A 4K0KQ 1Q81C 1HZAA 3GTPH 3WWVA 3CCJA 4MTNA 4GN3B 1NMGA 4DR5L 3I55A 4GLAC 3JAMc 3U58A 1VQEA 3GTOH 3CCEA 4EX5A 1MJCA 5M3MH 1VQMA 1D8LA 3CPWA 1L1OB 4XTCS 1CKOA 3KFUA 5IYBH 1QUQB 2R93H 1UE6A 4BY1G 4LFBQ 1KIXA 3G71A 1GKHA 3PUWA 5C4XH 1S72A 2D0OA 2L15A 2Q2TA 2JEAI 5H1SE 2JA5G 4YWKA 3CCUA 1KQSA 2A1AA 1PH4A 1XJVA 4QJFA 4BBSG 4C3HH 3I4MH 1J5EL 3RR5A 2R7ZH 1YZ6A 4ME3A 3RNUA 3M3YH 1Q12A 4R4QA 1YHQA 1Y1WG 2GVAA 2Q2UA 1E24A 3CCSA 1LUZA 1J5EQ 3LGJA 1VQLA 3UDIA 3W1BA 2BH2A 1FVIA 2OQ0A 4GNXB 1IBML 3FP9A 2CWAA 3B6YA 4NB3A 3HOXH 4AH6A 1KD1C 1K9MC 4IFDG 3CCLA 2WB1E 1VCIA 1B70B 1IBMQ 1VQ6A 2VNUD 1NTGA 4DR6Q 4DK3C 1L1OA 4JI2L 1Q86C 4B3RL 3CP0A 1XMQL 3ERSX 1KL9A 1EYGA 1TWCH 4IJHA 4MNOA 4GOPB 2UXBL 5C0XI 1P16A 1A63A 1QUQA 1VQFA 1XTDA 4JI2Q 4HJ8A 4A3JG 4B3RQ 4QY7A 1XMQQ 4LF8L 3H15A 2R92G 4BXXG 4A3KG 2UXBQ 3M4OH 1QZGA 2YTVA 3J80i 3HOZG 4JV5Q 1L1OC 4LF8Q 3CCQA 2JA7G 4GN5A 4PZ8A 1LTLA 3H0GG 4FDBA 4QL5A 1VQ8A 4JV5L 4P72A 5EAYA 1LM0A 4HIDA 3AFQA 4BA1I 4GNXA 1VQOA 1PH9A 4POGA 3E0EA 3HFZB 3U4ZA 1EWIA 1P8LA 5IP9H 5FLXc 3PCOB 4R4IA 4A4IA 3J80c 2CFMA 1YITA 3S1NH 3JC66 4DNIA 4A3FG 1N8RC 4UY8C 4A3DH 2WFWA 1KAWA 3PO3H 4DR2L 4JI0L 3S15H 3DM3A 4GKJL 3KDFA 4YCVA 1DGSA 4QIWE 3ULJA 2E2HH 4A3LG 4GOPA 4JI5L 2IX1A 1UE1A 2OTLA 1JJ2A 4DR2Q 1TWAH 1WYDA 4JI0Q 3HOWG 4GKJQ 4OO1I 4ALPA 1W2BA 5FJ8H 2GN5A 1Q82C 2MNAA 1V43A 5M3FH 1PHJA 2C35B 2CCZA 4GKKL 1E1TA 4OWTB 4JI8L 3UDFA 4JI5Q 1AE2A 3HKZE 1VQHA 2LSSA 4LF7L 1I3QH 2RCNA 2VY3A 3M4PA 4H02A 4GKKQ 1A62A 3CMAA 5C44G 1EQRA 3S1QH 2LXJA 1E1OA 2RF4A 2PNHA 4JI8Q 4DV6L 3M4QA 1JMCA 1ASZA 4HJ7A 4BY7H 1CKMA 5IYDH 1HJPA 2PMZE 2JA9A 4IPCA 2PI2E 3G4SA 3G48A 3AQQA 4DV6Q 3RN5A 2OTJA 2E5LL 5C4JH 3F2BA 3S2DH 4A3IG 3K8AA 4QQBX 4KI0A 1JE5A 2XTIA 3H3VI 4A93H 3J81i 4R4TA 4PZ6A 2E5LQ 5DLQE 2KCMA 2I5HA 5IY0A 4NXNL 1WCMH 3A5ZB 1QVFA 2RHQB 4A3CG 3I4NH 1Y14B 1I5FA 2LXKA 1ASYA 3KOJA 3CXCA 1KXLA 1X3GA 1PVOA 1CSPA 1YVCA 1NMFA 4DK6C 1KC8C 4NXNQ 3J7A5 1CUKA 1YHAA 3BU2A 5JJIA 1VQ9A 3NBHB 4X62L 2VS1A 2NVXH 2F52A 1SFOH 3S2HH 2EXDA 1MJEA 2VL6A 2WAQG 1BBWA 2ZM6L 3KLWA 1E7ZA 2JK8A 3KF8B 3W1GA 1M90C 2ALYB 3M7NA 4L5SA 1O7IA 5IYCG 4X62Q 4DV2L 1XNRL 1X55A 3HOVG 1XPOA 5GQOA 1HZCA 1PYSB 1U0LA 1YHBA 4OXPA 3CC2A 4A3BG 2ZM6Q 2Y0SG 1IYJB 1VQCA 2N49A 4C3JH 3GTQH 3ER0A 2Q2IA 4A3MH 4XIGS 2ASBA 1XNRQ 4AQYL 4DR5Q 3VDYA 3CAMA 2MO1A 3GDEA 3L2PA 3CCRA 1U5KA 1VQ5A 3PO2H 1NBWA 1EOVA 4HIMA 2K5VA 1HNZL 1KRSA 4HJ9A 5IWAL 4AQYQ 2K5HA 4L5QA 5M3MG 2B29A 4WJ3M 4A3EH 4IFDJ 1A0IA 1UE7A 2ZJQA 1GVPA 1HNZQ 1X9NA 5IYBG 2R93G 5IWAQ 3PSIA 3RLOA 2R6GA 3K0XA 5C4XG 2JA8G 1NE3A 1BBUA 1Y1VH 4HIKA 1JB7A 3GTGH 4IFDI 2AHOB 2JE6I 4LW1A 2BA0A 1VQDA 3NELA 3I4MG 4GN4B 1X3EA 3KF6B 4IPGA 1X6OA 4JBWA 2R7ZG 4DR4L 3CC4A 2UUCL 5FLMH 2K14A 3A74A 2YU9H 2B63G 1VQAA 3KDFB 1I94L 1EIFA 2E8GA 1V9PA 3K7AH 4DR4Q 5JJLA 2JA6G 1UE5A 2UUCQ 1S3OA 1TWHH 3HOXG 3RLNA 3AEVA 1K0RA 3TS2A 3L7ZC 4B3TL 1I94Q 3S24A 4O0AA 4Y52H 4R1JA 1PH2A 3FKIH 1Q1BA 4Y7NH 1K73C 2NZHA 2EIFA 3BZKA 2UUAL 4B3TQ 1BKBA 1CKNB 2KBNA 1UWVA 5JJKA 2K50A 3ICEA 3S16H 1TWFH 1OXTA 1OXVA 1VQNA 2UUAQ 4JCVE 2JA6H 2D62A 3F1ZA 4DV1L 1YJNA 1R9TH 3HOYH 2HT1A 4A3GH 3KF6A 4OWXB 1HZBA 1T9HA 2AMCB 2JJQA 3J7ZC 1Q1EA 2BH8A 1YJ9A 3TEHB 3IRBA 3PIPA 1WI5A 1JJGA 1B8AA 1PH6A 4X64L 5IE8A 1G51A 1Q8KA 2OQKA 4UP9A 5LMUL 3F8TA 4JI6L 1C0AA 5IP9G 4X64Q 4A3DG 2NVYH 3PO3G 1V1QA 2NN6I 3PGZA 4BBRH 5LMUQ 1WJJA 4JI6Q 1IXRA 2VUMH 4EQ5A 3OW2A 3U50C 2YV5A 1N36L 2JQOA 1PH3A 1CKNA 4B3SL 4DAMA 2PQAB 3M9BA 4JI4L 4YWLA 2UU9L 2N3SA 2E2JH 4LF7Q 4JBJA 4JC0A 5FJ8G 1TXYA 4LWCA 5M3FG 3TS0A 1N36Q 2NZOA 4KHPL 1KRTA 4B3SQ 2IHEA 4JI4Q 4DR6L 4LFCL 1E22A 2UU9Q 1HNXL 2V1CC 3PUVA 2ATWA 4KHPQ 1HR0W 4B3ML 2K52A 3EBEA 3STBD 3RN2A 1YI2A 5IYDG 1AE3A 1K3RA 1WFQA 5C3EH 1SE8A 2XGTA 4YWMA 5JEAJ 4DKAC 3PIOA 1VQ4A 1HNXQ 3CCMA 2F4VL 3STBC 1XPRA 4PZ7A 3HOUH 2IHFA 2ZTDA 2K5NA 3ULPA 4B3MQ 1E3PA 1MIUA 4OONA 3NEMA 2YYZA 2F4VQ 2QGQA 1PYBA 3HKSA 1HZ9A 2UXDL 5IT9c 2WAQE 3CMEA 4DUYL 4A93G 3K81C 2H5XA 2YTYA 2GVBA 1VQGA 3H3VH 3J81c 5JEAG 2MFIA 3K7UC 2KHJA 4A76A 1WCMG 2UXDQ 5J3BA 4DR7L 1VQIA 2PQAA 4PMWA 4DUYQ 1IBLL 1X65A 2Y0SE 1FJGL 4WJ4A 3I4NG 1VS0A 5AJ3L 1EFWA 5GADC
chains in the Genus database with same CATH superfamily
3T16A 1IBLQ 4APVA 2IPKD 4DV0L 3FHWA 3S1RB 3I4OA 5IT9L 5IP7H 2LKVA 2F3VA 3L0OA 4YCUA 2YU9B 2EY5A 3VYUA 4AIMA 2Z0SA 3OSOA 5I4DA 1Z47A 3CRLC 3D8GA 4WORA 2VQFQ 3R2IA 3GTKH 3NBIA 4GLVB 3FKIB 2OWOA 3I73A 4DR1Q 4DV3L 1IL2A 4J1MA 4LFBL 1EL0A 5DNFA 3AB9A 4QF4A 3R93A 4EQPA 4EQOA 4BBSH 4WRDA 2QA4A 1HXYD 1KABA 2PCFB 2RKSA 1Y1WH 4QMGA 1OO9B 3S1RH 3HP3A 1BVSA 2N8NA 1G291 5A2QL 3NENA 4K8IA 4LF9Q 1I4RA 4BS9A 1QZHA 4LF6Q 1FGUA 2KJXA 4YCWA 4YHHL 1YBYA 2MO0A 4JI7L 3IKJA 2K7VA 4DV4L 4P75A 1A3UA 1L2FA 2B39A 2R7DA 2Z1CA 1PTOF 4IPHA 5IIFA 1MGSA 1UEBA 2VB2X 2HIVA 1M1KC 5LMNW 4LF5L 1N34Q 4K2LA 1D1KA 1M8AA 3AFPA 5GROA 4LF4L 2E2JB 3BVZA 4QIWB 5BR8Q 1S5ED 1DYQA 1E2VA 1STGA 2RCFA 2JA7H 2EYHA 1PDQA 4RG1A 3MC0B 5C0XG 3FRPB 2EDGA 5GAHC 1QVCA 4DV1Q 1HUNA 4I7AA 5D14A 1Y69U 5DM63 4JW0A 1PH8A 1I4HA 1H95A 3NXWA 3D31A 1PRTC 3FDTA 4L5RC 4C2MH 4A3GG 3DMUA 4DF7A 3CF5A 4DUZQ 4A3FH 3HOUB 1H9KA 2B2YC 1PA6A 3T1HQ 4HTHA 2FMCA 3VR4A 1HQMC 1HFGA 1GO3E 3PV0A 1EOTA 3MEFA 3H91A 3C1FA 5E3FA 3W5OA 3EVQA 1TY0A 4RWSC 2JA8H 2XSCA 4BBRG 4F8MA 2O5IC 2VUMG 3HGBA 4X3TA 4DV5Q 4LMQD 1VQKA 2ZJRA 2NVQB 3Q23A 1S4ZA 3UDGA 4OWWB 1SROA 1S5CD 2FINB 1CA5A 4NKLA 1TS5A 4JI1Q 4A3BB 4RCOA 1XXGA 4RA8A 4XQNA 3HKZG 2B2TC 1OTCA 2RQXA 1U4LA 2PI2A 3UI2A 2HQEA 3KBXA 1XNQQ 4IJLA 2YTXA 3WOEA 4A3CH 3PF5A 2JA5B 1B44D 1VDZA 5JOBA 1NR2A 3SK6A 1DOKA 1AW7A 5M5XB 5C4HA 2Z6KA 3K80C 2F0NA 1I6HB 3AU7A 3PUXA 2NVQH 3RZDH 2Z4HA 3F2DA 5AJ3Q 4KJNA 3KJOA 1HNWQ 1SR3A 1SMXA 4K6LA 4A3BH 3EA6A 3RZOB 3M3YB 5IP7G 5GAGC 4K0KQ 1LACA 1Q81C 3L3OC 4GN3B 4DR5L 2JYOA 3JAMc 3U58A 1W6JA 3DWPA 3GV3A 4DXFA 2Z6BA 1UE6A 4LFBQ 2MHVA 1KIXA 3HOZB 1STNA 3PUWA 1EIHA 5C4XH 1SXTA 2Q8RE 2L15A 2K5QA 4RGOS 5ELDA 1KQSA 1ESFA 4BBSG 3GTMB 3JAML 1C4QA 1IW7C 1JR0D 3M3YH 1KAAA 1JOQA 3QR8A 1Y1WG 4E6IA 1LUZA 5KYIA 3DWAA 3UDIA 1LLRD 2JA6H 2EYJA 2CWAA 3HOXH 3X3NA 3S1NB 3I4LA 2XWBB 2LS01 1H9SB 4A3DB 2VNUD 2XN9C 3D3RA 1HA5A 1XMQL 3ERSX 3MEHA 1EIGA 2F1MA 2RDGA 1A63A 3PMFA 1XTDA 1TWAB 3H09A 4LF8L 2UXBQ 1QZGA 3C1EA 2EJGC 1ZYRC 1L1OC 1I3QB 2JA7G 3BYTB 3OPOA 1J9OA 4OELB 4QL5A 4JV5L 4A3IB 4P72A 4UHVA 2XIWA 2F0IA 3H94A 3R2TA 3AFQA 1VQOA 3U4ZA 3S1NH 4R4IA 2EYFA 1EY6A 4A4IA 3J80c 4A3FG 4A3DH 4UY8C 2FJ2A 3S2DB 2V4DA 4JI0L 1H9SA 4RAUC 1ZKOA 1DGSA 4QIWE 2DNCA 1SBBB 4DR2Q 1TWAH 1WYDA 1FR3A 3A7AB 1GUWA 3VR5A 5M3FH 3IAYA 4CDCC 2JA8G 4LF7L 1AE2A 3J80L 1I3QH 2RCNA 5J39A 1TS2A 2EJMA 3CMAA 3GTJB 1YNND 5JPMC 1YNJC 3FPPA 4DGZA 4DV6L 1ASZA 1MD2D 4BY7H 5IYDH 3NHHA 2HD3A 2K33A 2PI2E 5CV5A 3RN5A 5TSSA 2OTJA 3EJIA 2Z4IA 4IZ8A 3S2DH 4B9XA 5M3MB 5C5LA 1NSNS 4A93H 4PZ6A 2NTTA 5JEAH 4NXNL 4A3CG 5EGTA 2LXKA 1KXLA 5IOCA 1YVCA 1KC8C 4XYOA 1DJRD 1SJED 3K0YA 2ICIA 1G91A 2SOBA 2NVXH 2ZXRA 1X3QA 2VL6A 2WAQG 3KLWA 4DU9A 1HTPA 1WTOA 3K6OA 1O7IA 4UAIA 4DV2L 1QCBD 4IUVA 1EYDA 1YHBA 1U0LA 3CC2A 4A3BG 2FHTA 2Q2IA 1JQYD 4XIGS 1XNRQ 4AQYL 4DR5Q 3VDYA 4HAEA 3CAMA 3E5SA 3K7AB 3GDEA 3L2PA 3CCRA 1U5KA 1VQ5A 5KYLA 4KY5A 3SEBA 1EOVA 2K5VA 5IWAL 2K5HA 2B29A 4A3EH 2A6ED 4IFDJ 2MGSA 5T1IA 3M4OB 1HNZQ 1LTID 4Y7NB 3T13A 4ABNA 5C4XG 1JE4A 2TMPA 1TVXA 2VB3X 1JC7A 1B2TA 4XT3B 1ENAA 3M7GA 1SNDA 4U68A 1VQDA 4K5VA 4GN4B 3KF6B 2QILA 1JB3A 2UUCL 3SE0A 1KLGD 4M8AA 1SDFA 3A74A 1VQAA 4DK1A 3VA7A 4DR4Q 3K7AH 4JPBW 2JA6G 1UE5A 3HOXG 3AEVA 2PZWA 5J1ZA 1KNEA 3L7ZC 3TS2A 1RD9D 1WTXA 3S24A 4Y52H 1G6ZA 2O4XA 4Y7NH 3D6CA 3BZKA 4IQZA 1QILA 5JJKA 1A3VA 1LTRD 2BOSA 1OXVA 3S1QB 1S5FD 5C5MA 4PQXA 2UUAQ 1JOKA 3NUCA 2D62A 2HCCA 5CORA 1R9TH 3MZ5A 3KF6A 2E2DC 2AMCB 1Y8PB 1AN8A 1JJGA 2A69C 1FNWA 5IE8A 2RDFA 5C3EB 2NYZD 2OQKA 1PZID 3F8TA 4B9WA 1GHKA 4V0BA 4A3DG 1STBA 2NVYH 1GOZA 1R4PB 1V1QA 1LABA 4EQ5A 5M9OA 4DFAA 4C56C 1YNJD 2JQOA 1EY8A 1MHWC 2KCNA 3IFTA 1BCPB 2L12A 1U4RA 1SFOB 4LF7Q 5M3FG 3TS0A 1QWYA 2F3WA 1KRTA 4B3SQ 1E22A 2UU9Q 1HNXL 3W2DA 1E2ZA 5K5PA 4B3ML 3SDZA 4DR6Q 5IYDG 5C3EH 4ZRZA 1WFQA 4BY7G 1K83B 2F4VL 2DJFC 1VQ4A 4PZ7A 2K5NA 3C3LA 4KV6A 1PTOD 1MIUA 2NUCA 2QGQA 3G7LA 3GTLB 3FMCA 1TKWB 3CMEA 4A93G 2YTYA 1CZWA 2BE5D 1VQGA 4ID6A 5JEAG 5G3LF 2KHJA 2OF1A 3T51B 4DR7L 1VQIA 1IBLL 5K36H 1X65A 2Y0SE 4ZYSA 1F9PA 1RJTA 1LTBD 1EFWA 2IL8A 1QG7A 1FJGQ 4YIJA 5D65A 4JBMA 2DGYA 4DV2Q 3GQBA 2KCTA 1K83H 1HUMA 4AYBG 2VQFL 3QO2A 3D0FA 3Q24A 1T5EA 3RD4A 1TWHB 2BDOA 2XRSD 2F3IA 1VQJA 1XMOQ 5C3XA 1NUCA 4DR1L 1FGBD 2CKZB 3GTLH 4IOCA 1E0BA 1Z7TA 1YJWA 3NTIA 1LTTD 4TVAB 4IOAA 2HDLA 3I3CA 4FXGC 1PV4A 1F9SA 1DOLA 1PZKD 3TN2A 4A3EG 2Z8LA 1N32Q 4PMBA 1FYCA 2B2WC 5FLXE 5I9PA 4LF9L 1AZPA 2PPBC 4LF6L 4FF3A 4A3GB 4GLXA 3TQYA 3BYYB 5JAVA 2IWHA 4JI3Q 1O7LA 5EKIA 1C9OA 3ITPA 3MXNB 1A8VA 3I8ZA 4M1UB 4IFDH 3F2CA 5KNCA 2D2CC 1U4MA 5ELOA 2EY1A 1BUVT 4LUZA 4DAYB 1N34L 2VUMB 1W6KA 5BR8L 2F0QA 2BCOA 1C7YA 3S1MB 3CQZB 2CW0D 1M4VA 1F77A 1O78A 4XDXA 4X65Q 3OWFA 4A75A 1YIJA 2DY7A 4ZCKA 5CGKA 4UP7A 3NPPA 2A69D 5CV9A 5J22A 4QCLA 4DUZL 3HKZB 2QEJC 2EQSA 2IT1A 2XWJB 2MQHA 3MXNA 4C1NK 5BN3A 3T1HL 2O5JC 2MUYA 3DLLA 5KNDA 1PH7A 1VQBA 1X54A 2A8VA 2K04A 3OWEB 3CD6A 1K8AC 1R4QB 3SK8A 3KJPA 4DAYA 3S1MH 5HURA 4S3SA 3CQZH 4DV5L 2HIXA 4I7ZC 4DPGA 3G6EA 2B63H 4OIKA 2F4IA 1Q46A 4P71A 1GUSA 4OIJA 3I56A 1DZ1A 1B3QA 1TWGH 1KHIA 1LT6D 4JYAQ 3WOFA 1CSQA 4JI1L 3D6WA 3CW2C 3NK9A 2RVLA 5BN4A 2ZXOA 1G2SA 4R4OA 1MKHA 5LL6S 1RCVD 1B4OA 3VR6A 1XNQL 5C3EG 2A74C 3GTKB 2Q2HA 2M9VA 2UXCQ 3MAQA 3KYHC 1XPUA 4C1NI 3TBIB 4BBSB 4FF2A 4UP8A 1VQ7A 5DM73 1HNWL 4DR7Q 3NWSA 3PUYA 3UE0A 3K57A 1Y1WB 1K8GA 2RDHA 1ENCA 5K36G 4O2DA 3JAMi 5ELFA 4C3HB 1F9RA 2B8FA 4K0KL 4GS3A 1NCVA 1D5ZC 4P74A 1W3SA 2KENA 2OCEA 4MZ9A 3GD7A 3GTPH 2B2UA 4MTNA 1NMGA 4GLAC 1VQEA 3DXJC 1D8LA 3QIAA 2R93H 2F0SA 2JA7B 2L11A 2F0KA 4YWKA 1I4PA 1XJVA 4QJFA 4C3HH 3N52A 3RR5A 3BDCA 4H7BA 4H0LC 4C2MB 4QUFA 3CCSA 4A3FB 5IGBA 3OIQA 4ZUJA 4GNXB 4AH6A 1C48A 4IFDG 2K5WA 4ILWA 2AUKA 4DN4M 3MXPA 1SNQA 4EVOA 1SNPA 1VQ6A 4DK3C 3CP0A 2RSNA 4TSSA 2JA8B 1TWCH 4GOPB 2KEDA 5C0XI 2UXBL 2M00A 5EBCA 1XYIA 1TR5A 4HJ8A 3WDNA 4B3RQ 1HFNA 1WTVA 3H15A 1KDBA 2AQ3B 2YTVA 1IHZA 4FNFA 3J80i 4PZ8A 5EKLA 1LTLA 2KVMA 3QG1A 2CHBD 1CHPD 4NDXA 5EAYA 5IT9E 2X6LA 1HTLD 3MXGA 2WKDA 4HIDA 1JORA 4GNXA 3CHBD 1EWIA 2EYOA 3PCOB 2QCPX 2CFMA 3JC66 3F2UA 2L0CA 4K2KA 1VMCA 4DR2L 3DM3A 4XYQA 3KDFA 2NBFA 4GOPA 1UE1A 5FKAC 2OTLA 1JJ2A 4O1NA 1SNCA 1WCMB 3OIPA 4MTKA 5FJ8H 3RZDB 2WAQB 2MNAA 1Q82C 1E1TA 4OWTB 3UDFA 4JI5Q 2B63G 3HKZE 1UEAB 2VY3A 1SYCA 4XQJA 5EPLA 2RF4A 1EY9A 2PNHA 3M4QA 4LK1C 1AEXA 1YNNC 5A2QE 2JA9A 3NE5B 3BVGA 3DWQA 3G4SA 4FXKC 4R8NA 3SK4A 3F2BA 1NR4A 2Z9HA 3H3VI 4MHEA 4L63B 1X3PA 2E5LQ 2F0UA 3G6JB 5DLQE 3PO2B 5I9OA 2I5HA 5IY0A 1WCMH 5C4XB 1QVFA 1I4QA 1Y14B 1X3GA 2F0MA 4DK6C 1NMFA 1CUKA 2B2VA 3NBHB 2VS1A 2F52A 3BG3A 1BBWA 2SNMA 2JK8A 1Y1VB 3M7NA 2PZTA 1SJHD 2JA6B 1XNRL 4N8X1 3HOXB 5GQOA 3SR1A 5JJZA 1IYJB 3PIP3 5ELEA 5CBAE 1BDOA 3PO2H 2SDFA 1SE3A 4HIMA 1HNZL 1DM0B 2KQ3A 2EZVA 1A15A 2KCCA 2F0VA 1X9NA 1B9NA 2R93G 1CT1D 2A6EC 2WB1B 4ZUIA 3RLOA 3E3XA 2R6GA 2WACA 1V1PB 3S16B 3NBHA 1BBUA 2OEOA 3T53B 1Y1VH 4HIKA 3GTGH 4LAAA 4FP5D 2JE6I 4LW1A 3NELA 4C3HG 2H1EA 4HEDA 4JBWA 4IPGA 2CH4A 4DR4L 1NNXA 5FLMH 2EE1A 1SE2A 1EIFA 1DXMA 3DHQA 3LNNA 4RGMA 1Q8IA 1BOSA 1PH2A 5M3FB 2UUAL 4B3TQ 5G3LD 1LT3D 1BKBA 2KBNA 1UWVA 2K50A 1AP0A 1F2MA 3ICEA 3S16H 3J7YW 5I6WA 1V1PA 1HRJA 3U9OA 4HMJA 4BY7B 1B3AA 4FF4A 3HOYH 1HCZA 1YJ9A 1O80A 4F87A 3IRBA 1KDAA 4XQQA 5C4ZA 3ONAB 4A93B 1G51A 1Q8KA 3NQIA 2SNSA 1K8OA 5D3DA 5I6YA 5FO8B 2QW7A 4HSPA 2NN6I 4DA2A 4JI6Q 1FD7D 3U50C 1K8MA 2F0HA 2YV5A 5EJWA 3BZDB 4B3SL 2PQAB 2UU9L 2NVXB 2N3SA 4JC0A 5FJ8G 1N36Q 2NZOA 4OO1H 5JPNC 4AYBB 2GA4B 1SNOA 1WD0A 4DR6L 3JAME 2AQ2B 1QNUA 2RSOA 1D2BA 1DCZA 1V1OA 2ATWA 1AE3A 1K3RA 1U9RA 4DKAC 4G7HC 2RA4A 1BBXC 3FEWX 1PFBA 3EQLC 2YYZA 3KLSA 3HKSA 1F2ZA 3PQIA 4A3EB 1PTOC 2WAQE 4KD4A 3RMHA 2EYMA 1EWHA 2GVBA 3FPUB 3MVVA 1EY0A 1WCMG 2BE5C 4PMWA 2PQAA 2K6AA 5CC4A 1FJGL 4WJ4A 3KK7A 2JXMB 1I4GA 1N9WA 2NB0A 4XXEA 2NVTH 1ZEQX 3NTHA 4NPSA 4C3IH 4TKOB 1XMOL 4IPDA 2HCIA 1DD2A 1BCPD 1Q7YC 3H3VC 4ZKBB 1QE6A 1JJCB 3QWNA 2EOTA 3GO5A 4DR3Q 3EFXD 4R4CA 4IN3A 4CDDC 4BY1H 3P7JA 5KNBA 4HR7B 1IKLA 1N33Q 4LFAQ 1N32L 3PO2G 4KKSA 4ODGA 2HHHQ 4NP5A 2VQEQ 1GUTA 1X32A 2HUGA 1PRTB 3S9WA 1FNUA 2R92B 2PYKA 2AWOA 1D1IA 1OXXK 4JK1C 4JI3L 4DAPA 4X66Q 1LYLA 3J80E 1R9TB 4HIOA 2EVBA 2F0OA 2IY5B 2B2UC 1B53A 1I50H 2DN8A 1Y1VG 1V8QA 3MXUA 5KGUA 1BF4A 3V96A 1GHJA 4RKBA 3NWTA 4Z9CB 2IX3A 5FLMG 3J81j 1DOMA 1K28A 2K75A 4IUNA 2NVYB 4KKTA 3TREA 5C0XJ 1WTPA 2CWPA 1EIYB 1XTCD 3DUZA 4X65L 1F2YA 1NY4A 1ESRA 1HQRD 3OHXC 2R92H 4BXXH 1IBKQ 2Q8TA 4ZKCB 4LJZC 3RLFA 4YY3Q 1HR0Q 1SN8A 2CQOA 3T1YQ 4NXMQ 2CW0C 4G7OC 2WB1G 2HDMA 2B2YA 2CQAA 4K8JA 2E2IB 3H0GH 3ZYYX 4MIUA 4KMUC 2HQLA 2KHIA 4LUVA 4PG3A 2NWGA 4KHZA 2A19A 2EYPA 3HOYG 3EIVA 4KLKA 4OX9Q 4L8JA 1NJIC 4K5WA 1G2TA 3RUZA 3ULLA 5AFWA 4A3LH 4UPAA 3PF4A 3S14H 2AKWB 2A6HD 4FVMA 1SRUA 2K01A 2PQEA 3HOWH 4IO9A 2UUBQ 4IURA 2KUMA 1WTRA 4JYAL 1G6PA 4OHJA 4RHRA 2KECA 4N9PA 4X6AH 1LV9A 3TP8A 2E2IH 3C2PA 3BDOA 2KEEA 2B2TA 2PW7A 3P20A 1YNXA 2LY7A 2AWNA 2EXZA 3OTOQ 4P73A 1RDPD 4GNXC 3PUZA 1UNSA 3VA5A 4OO1G 5HGTA 3QOLA 4GZYC 1LTAD 1RL2A 4DV7Q 3ERQA 1JWMD 4GOPC 4KD3A 4RFBA 2UXCL 1PH5A 3I2ZA 5I2YA 2F0DA 3UDXA 4JOIA 2I5MX 1AFPA 1VF7A 1GUNA 1X3FA 4KK7A 1SYEA 1CFMA 5M5WH 1HH2P 4NW2A 3ND9A 4AYBE 4K6DA 1OXUA 3CC7A 1EQQA 3E9HA 3S17H 5KRUA 1EQTA 1PFSA 2B8GA 5IYCH 4TRDA 2R3ZA 3HOVH 2I0QA 2RHSB 4RHSA 3TP6A 3E9IA 4RH6A 4ZLTF 1Z9FA 4J6HA 2Z6KC 4FYDA 5LMNQ 4C3IG 4QGUA 3Q8DA 3HRZC 3MFGA 3H6MA 1HZAA 3OOCA 3WWVA 1B50A 1CM9A 3GTOH 3CCEA 1MJCA 1BQQT 1L1OB 4XTCS 3DEPA 4PNYA 2B2VC 5CR3A 3KFUA 5BN5A 1QUQB 4BY1G 4DK0A 1GKHA 1D5MC 1S72A 2JSOA 2D0OA 1EZ8A 5H1SE 2JEAI 3CCUA 1J8IA 3QOJA 3I4MH 3D4WA 2R7ZH 4ME3A 2QDLA 4R4QA 3LX0A 2GVAA 2Q2UA 1DONA 1E24A 1LT4D 1J5EQ 3LGJA 1EU4A 3W1BA 1RTOA 3K5MA 3B6YA 3TDQA 1KD1C 4ME5A 3TZUA 3CCLA 4CBVA 3O13A 4UDUC 1EEID 1B70B 1VCIA 1C8CA 1IBMQ 1GJXA 1L1OA 4B3RL 2B63B 2NTSA 4IJHA 1P16A 1QUQA 1VQFA 2L1BA 1IKMA 3HS0C 4JI2Q 1TWGB 4QY7A 2A73B 2EPBA 1GUOA 2R92G 4BXXG 2ZT9C 2F0PA 4I65A 5L37A 1BCPF 3CCQA 1CZGA 3H0GG 2X6GA 2L4NA 4K14A 4MN3A 1SMYD 2E74C 4POGA 3E0EA 1P8LA 2OXPA 1YITA 4DNIA 1L0YB 2WFWA 2L55A 4RGNA 3PO3H 3TP7A 5IODA 1B9MA 4YCVA 4A3LG 4JI5L 5IGGA 2IX1A 1HHVA 2K03A 3HOWG 4GKJQ 4ALPA 2GN5A 1A2TA 2C35B 4NMZA 2NZ1D 5FOBB 2M2LA 3M4YA 3V2TA 1PYWD 3IL8A 1CI3M 4H02A 4GKKQ 1EQRA 2LXJA 4JI8Q 3OW7A 1JMCA 1TY2A 1L0XB 4HJ7A 1CKMA 1SYFA 2LFNA 3OMGA 4IPCA 1CQFA 3GTPB 4G4KA 4DXGA 2E5LL 5I2XA 5C4JH 1QNKA 2WINB 4QQBX 4KI0A 1H9JA 4A3MB 2XTIA 3J81i 5IGFA 2R93B 3Q0AA 1STYA 5C6AA 3A5ZB 2F03A 2F0FA 2K1BA 1GUGA 3U9SA 5EQ0A 3I4NH 1I5FA 5FK9C 1CSPA 4RCNA 1YHAA 3BU2A 4P2CB 2WV6D 4ULLA 5JJIA 5F2DA 1VQ9A 2PW5A 3S2HH 2EXDA 1MJEA 2C9OA 1E7ZA 2ALYB 4L5SA 5IYCG 3KLSX 4X62Q 3HOVG 1XPOA 1HZCA 4OXPA 2ZM6Q 3K58A 4WJWA 5CV8A 1VQCA 2N49A 2CH4W 4C3JH 1ICWA 5COYA 4A3MH 5E4XA 4CKCA 2MO1A 2E76C 1TWCB 1D5XC 1NBWA 5IGEA 4HJ9A 1B1ZA 4DNTB 1UE7A 3VR3A 2F0LA 1SYDA 1NE3A 5KIXA 4IFDI 2AHOB 2BA0A 1ENFA 3I4MG 1X3EA 2R7ZG 2O2LD 3CC4A 2KA7A 3KLRA 1TS3A 2YU9H 2G9DA 1EU3A 3KDFB 2E8GA 1V9PA 3PIO3 1NAPA 2AQ1B 1S3OA 1UAPA 4B3TL 1I94Q 2EYLA 1VF5C 4ZAIA 4F7XA 4R1JA 3FKIH 2I07B 1HA6A 1CKNB 3K5OA 5DAUA 3P1HA 1VQNA 5CV6A 1KDCA 2QF7A 4KY7A 2G5DA 3F1ZA 1YJNA 2KHSA 4R8IA 2HT1A 4OWXB 1HZBA 1T9HA 3J7ZC 1Q1EA 2BH8A 5EPKA 3TEHB 3PIPA 2J7ZA 2L9HA 1B8AA 3LWEA 3P75A 5EBDA 4CHTB 4UP9A 3I70A 4JI6L 1C0AA 1CQVA 3W3AA 3A7LA 4X64Q 1A6XA 5JVG3 2P5ZX 3PO3G 4CGYB 3PGZA 5LMUQ 1WVLA 1WJJA 2A68D 1IXRA 3BS1A 4JVZA 1N36L 4Q0FA 1CKNA 4DAMA 1F9QA 4YWLA 1Q3LA 1QOHA 5LHY1 1AZQA 2E2JH 1TXYA 4LWCA 2IHEA 4JI4Q 2NN6H 3PUVA 1RTNA 4KHPQ 1CK1A 1KTKA 3STBD 3D4DA 5IGDA 4LFCQ 1RKNA 5JEAJ 3CCMA 1XPRA 3HOUH 2IHFA 2TSSA 2ZTDA 2L5TA 3ULPA 1KNAA 1IL8A 1E3PA 2I46A 3HZXA 2ICEC 4OONA 5ISRA 3NEMA 1PYBA 1HZ9A 1ONLA 1KLUD 3K81C 4EGVA 4CKEA 3J81c 2UXDQ 4A76A 5J3BA 4DUYQ 3I72A 3I4NG 3GTGB 1VS0A 4X3KA 3E0JA 1K0SA 1YEZA 3X3MA 2FXQA 4JOIC 1STHA 1STAA 2PZUA 1JCKB 4IUPA 1IZ6A 2DY8A 2QEXA 2K05A 1BNZA 4DR3L 2B3GA 1PMRA 3J81L 4L5TA 4DV0Q 4JBKA 3A56A 1RIPA 3UE1A 1BCPC 2R61A 4R9WA 1N33L 4LFAL 2ENBA 4C3JG 2B2WA 2HHHL 5ELNA 4A3MG 2G9HD 4RMFA 1FL0A 2VQEL 4POFA 2ZJPA 3EN2A 3CCVA 1U4PA 4X66L 4A3JB 2JA5H 2X69A 1EQVA 5M5XH 1O7YA 1ET6A 1JICA 2R7FA 4DV3Q 4A3KB 1SAPA 4CJ1B 1K3BC 1TS4A 3C46A 1I6HH 1Z6HA 3A5UA 1B7YB 1IYUA 2WIIB 3HOYB 4DAVA 3A8KE 2OT2A 2PO4A 1WOCA 2K4KA 5E4WC 4CDEC 1LT5D 4CJ0B 3K5NA 1S5DD 2ZTEA 3OYYA 3BJUA 3RZOH 4TQUS 4PV1C 2WP8J 3TRZA 4JG2A 3BZCA 2D0PA 4KN4C 4FXDA 3I7FA 1IBKL 2ES2A 2ZTCA 4YHHQ 1UUPA 4YY3L 5HGQA 1HR0L 3T1YL 4JI7Q 4FF1A 4HJAA 1IYVA 3NSWA 4HJ5A 4DV4Q 4NXML 1SYGA 1X56A 4A3JH 1SNMA 5HY6A 5EKKA 4A3KH 1FNVA 3AYHB 3NTKA 1LTSD 3FKIG 3HOZH 4LF5Q 3E6ZX 5C44B 4LF4Q 2Q8IB 4OX9L 3GTMH 1PRTD 2BA1A 1A2UA 1L0WA 2I5LX 3SK5A 5CV7A 1OXSC 2PMZB 3HEJA 2F0JA 1ML0D 3Q22A 2UUBL 1BXTA 1SYBA 1AH9A 1Y8OB 3J81E 2N78A 4HN7A 1LTGD 1PZJD 3AMUA 2A6HC 3L9AX 3OTOL 2JEBI 1TIID 2IX0A 5M5YB 5C44H 4HCEA 3SGIA 3CPFA 5DEHA 4BA2I 4HSVA 2NVTB 4C3IB 4DV7L 1PLFA 1MSGA 1ZXTA 1PFMA 2MPMA 2QKIC 1QJOA 2NN6G 2Y0SB 4J15A 4A3IH 1JT8A 3ND8A 1EWCA 5E7NA 3J7AV 1O7ZA 2K5DA 2DUDA 2VZAA 1RHPA 4BY1B 1VQPA 3HOUG 1GM5A 3A0JA 1EUJA 3ZJYC 1SLJA 3U4VA 3V05A 1S40A 5M5YH 2RBMA 3M85A 2DNEA 3SXHA 2E75C 2AUJD 2XRQD 3R3OA 1GD7A 2ID0A 4KJOA 5CMDA 4U673 1I50B 4LNQA 2F0TA 3GP7A 3KUPA 5GAEC 5LMNL 2FFKB 3J7AF 3QJYA 1J6QA 4EQNA 3GTJH 4WFN3 1JOOA 1QVGA 1GXDC 2N55A 2VW9A 3MA2B 4KHVA 4LUOA 1WTHA 3TZDA 2FMMA 3MWYW 4H13C 5FO7B 2ZXPA 3KBGA 3CCJA 3I55A 1H9RA 4EX5A 5M3MH 1VQMA 3CPWA 1CKOA 5IYBH 2N88A 3I91A 5T1GA 4B08A 3G71A 3K5LA 3H0GB 5EPJA 2Q2TA 2JA5G 1WTWA 2A1AA 1PH4A 1IW7D 3I90A 1J5EL 1QB5D 1YZ6A 3RNUA 3A8IE 1Q12A 1YHQA 3EROA 3URYA 1MBYA 2A5HA 1VQLA 3DM1A 2CVRA 5CBEE 1FVIA 2OQ0A 2MP1A 1IBML 3FP9A 4NB3A 2BH2A 1K9MC 2WB1E 3S14B 3HOWB 3IFDA 5NUCA 1NTGA 3A8JE 4JI2L 1Q86C 1MI2A 1EYGA 1KL9A 2K32A 4MNOA 3S15B 3TMEA 2LMCB 2SEBD 2E2HB 1BO0A 4A3JG 1XMQQ 1Y8NB 4DNRB 4A3KG 1ZYRD 1I6VC 1CTMA 3M4OH 4N9TA 1EEFD 5CYUA 3HOZG 4QB4A 1SE4A 4LF8Q 1ILQA 4GN5A 3SHLA 4FDBA 1VQ8A 1LM0A 5FO9B 2PNRC 3A54A 1S5BD 2JN4A 4BA1I 1PH9A 1SMYC 3HFZB 5FLXc 4JV5Q 5IP9H 2J0TD 4BWGB 1I4XA 4X3UA 1N8RC 1EZ6A 1KAWA 3S15H 5M5WB 4GKJL 1TU2B 3ULJA 2E2HH 4JI0Q 4OO1I 1W2BA 4GKKL 1V43A 1XX8A 4HCSA 3S17B 5FLXL 4JI8L 3T4AC 1VQHA 2LSSA 5LL6X 3HOVB 2H4OA 3M4PA 3MHBA 1VMPA 1A62A 3A55A 5C44G 3S1QH 4FO2A 4XT1B 1E1OA 1XWEA 3K59A 1PXUA 4KKUA 1TT2A 2KOLA 1HJPA 2PMZE 1T5XD 2XVSA 3G48A 3AQQA 4DV6Q 2EY2A 3GTOB 5A35A 4A3IG 3K8AA 1SEBD 3GTQB 3OMCA 1JE5A 3BVMA 4R4TA 4OL7A 4KN7C 1EYCA 1EFID 2KCMA 4KY6A 1WTQA 2RHQB 1ASYA 3KOJA 3CXCA 1TQOA 4O42A 4Q5VA 1PVOA 4NXNQ 3I4MB 3J7A5 2R7ZB 1PRTF 1RF2D 4X62L 1SFOH 4ZK9B 2ZM6L 3W1GA 3KF8B 3VYRA 1M90C 2D9UA 1X55A 3TP5A 1ILPA 1PYSB 4QUCA 3TSSA 1PFNA 5C3WA 2K28A 1EYAA 2Y0SG 1E2WA 2IJ0A 4H44C 3LWUA 3ER0A 3GTQH 2ASBA 1D6EC 4L6TB 5CV4A 1RODA 1SSOA 2F0EA 1KRSA 4AQYQ 3CU7A 4L5QA 5M3MG 2JP1A 4WJ3M 1A0IA 1II3A 3SVMA 2ZJQA 1GVPA 2F0GA 5IYBG 5IWAQ 3PSIA 3K0XA 4KTAA 1TWFB 3DEOA 4V190 1JB7A 3VR2A 5IGCA 3KF8A 1X6OA 3BDLA 4N8FA 1Q90A 2K14A 1HPCA 4G57A 4G7ZC 3FVQA 1I94L 3PO3B 5JJLA 2UUCQ 1TWHH 3RLNA 1K0RA 3GV6A 4O0AA 1F2LA 3CKIB 4RGTA 1Q1BA 1K73C 2NZHA 2EIFA 4BBRB 1JWSD 1G8ZD 1TWFH 1OXTA 5C0XH 2WKCA 4HMIA 1WD1A 3NP8A 4JCVE 2XNAC 3T56B 4OEMB 4PMCA 4DV1L 1LO5D 2IW3A 2C5CA 4A3GH 1PTOB 3VYTA 2JJQA 1BR9A 5C4JB 1WI5A 1EY4A 1PH6A 4X64L 3N6RA 4J8QA 4X3SA 5LMUL 4CKBA 5IP9G 2EJFC 1ET9A 1H9MA 1ICFB 2D5DA 4IUQA 3I4NB 4BBRH 1A3TA 2VUMH 3OW2A 4F88A 1PH3A 2A68C 3CRKC 3M9BA 4JI4L 4JBJA 3S2HB 3VYSA 4IUUA 5JVH3 4KHPL 4OGQC 5ELBA 2EY6A 1PTOH 4LFCL 3D4RA 4CJ2C 2V1CC 3QB3A 2J4XA 3MFYA 5D3IB 4C3JB 5KEEA 2VXWA 1HR0W 2BDNA 2K52A 3EBEA 3Q6SA 3R8BA 3RN2A 1YI2A 1PH1A 1PHJA 1HNXQ 1SE8A 2XGTA 4YWMA 3PIOA 2CCZA 1D7QA 3HG9A 3STBC 1EY5A 4IUTA 1EY7A 4B3MQ 2DJGC 5ELCA 1STEA 3MTSA 2F4VQ 2UXDL 1JWUD 5IT9c 4DUYL 2H5XA 3H3VH 1CA6A 2QDBA 2MFIA 3K7UC 3NQTA 2MJ8A 4CDFC 4IALA 2F0WA 4RKLA 1MSHA 4K5XA 1CHQD 4ZQ3A 5E1FA 5AJ3L 5GADC
chains in the Genus database with same CATH topology
1FJGQ 1YEZA 4APVA 2FXQA 1N9WA 4DV0L 1IBLQ 3FHWA 4JOIC 2NVTH 3I4OA 4NPSA 5IP7H 4C3IH 3L0OA 1XMOL 2DGYA 1IZ6A 4YCUA 4IPDA 2QEXA 2KCTA 4DV2Q 4JBMA 1K83H 4AIMA 4AYBG 2VQFL 4DR3L 3D0FA 1Q7YC 2B3GA 2Z0SA 4L5TA 4DV0Q 4JBKA 1RIPA 3UE1A 1Z47A 1VQJA 2F3IA 1XMOQ 1JJCB 1N33L 4DR1L 4LFAL 2VQFQ 4DR3Q 3GO5A 2HHHL 5ELNA 2CKZB 3GTLH 4R4CA 4A3MG 4RMFA 1FL0A 2VQEL 4IOCA 3GTKH 4GLVB 4BY1H 4POFA 2ZJPA 1YJWA 2OWOA 1N33Q 4DR1Q 4TVAB 4LFAQ 3EN2A 4DV3L 3CCVA 1IL2A 3PO2G 1PH1A 4IOAA 1N32L 2HHHQ 4X66L 1PV4A 2VQEQ 4LFBL 2JA5H 4BBSH 5M5XH 2R7FA 4DV3Q 4A3EG 1N32Q 2AWOA 2QA4A 1I6HH 1OXXK 3A5UA 1B7YB 4JI3L 4X66Q 4LF9L 1LYLA 1Y1WH 4HIOA 3S1RH 4LF6L 2IY5B 1BVSA 4GLXA 3TQYA 1WOCA 1I50H 2N8NA 1G291 2K4KA 1Y1VG 4JI3Q 3NENA 4LF9Q 1C9OA 3MXNB 4LF6Q 1QZHA 1A8VA 2ZTEA 3OYYA 3BJUA 3RZOH 3F2CA 1FGUA 4TQUS 4YCWA 4YHHL 1YBYA 2MO0A 5FLMG 2WP8J 3J81j 4JI7L 3TRZA 4JG2A 3BZCA 4DV4L 5ELOA 2D0PA 2K75A 4P75A 4LUZA 1L2FA 2R7DA 4IPHA 4DAYB 3I7FA 3TREA 1N34L 1UEBA 1IBKL 2ZTCA 4YHHQ 4YY3L 5C0XJ 5HGQA 2CWPA 3T1YL 1HR0L 1EIYB 4HJAA 4JI7Q 4X65L 5BR8L 1NY4A 4DV4Q 4HJ5A 1C7YA 4A3JH 1X56A 4NXML 5HY6A 2HIVA 1M1KC 5LMNW 4LF5L 2R92H 4BXXH 4A3KH 1N34Q 1IBKQ 3AFPA 5GROA 4YY3Q 3RLFA 1HR0Q 3AYHB 1SN8A 2CQOA 3T1YQ 4LF4L 3FKIG 4X65Q 5BR8Q 4LFCQ 4NXMQ 3HOZH 2WB1G 4A75A 1YIJA 2JA7H 4LF5Q 3H0GH 4RG1A 4UP7A 4LF4Q 5C0XG 2HQLA 5GAHC 1QVCA 4DV1Q 2KHIA 4DUZL 4LUVA 4OX9L 4PG3A 3GTMH 2EQSA 2IT1A 4KHZA 2BA1A 2A19A 1PH8A 4A3GG 2MQHA 3T1HL 1L0WA 1H95A 3D31A 2I5LX 3DLLA 1PH7A 3EIVA 4C2MH 4L5RC 1VQBA 4KLKA 3CF5A 4DUZQ 4A3FH 4OX9Q 1X54A 1OXSC 2A8VA 1PA6A 1NJIC 3CD6A 3T1HQ 1K8AC 2UUBL 3KJPA 3ULLA 1GO3E 3PV0A 4A3LH 4UPAA 3MEFA 1AH9A 3PF4A 3S14H 3S1MH 2AKWB 2N78A 1SRUA 3HOWH 3W5OA 3CQZH 4IO9A 2UUBQ 4DV5L 2HIXA 4DPGA 3G6EA 4JYAL 1G6PA 2B63H 3OTOL 2JEBI 2JA8H 4BBRG 4X6AH 2ES2A 2IX0A 1Q46A 4P71A 2E2IH 2VUMG 3I56A 4DV5Q 5C44H 3HOYG 1TWGH 1KHIA 1YNXA 3SGIA 2AWNA 3CPFA 2ZJRA 1VQKA 3OTOQ 4BA2I 4JYAQ 1CSQA 4P73A 4JI1L 3PUZA 3CW2C 4GNXC 3UDGA 4OWWB 1SROA 4DV7L 4OO1G 4JI1Q 2NN6G 4R4OA 1RL2A 1MKHA 4DV7Q 1JT8A 4J15A 4A3IH 4GOPC 3HKZG 5E7NA 2UXCL 1PH5A 3I2ZA 1XNQL 1OTCA 3UDXA 5C3EG 4JOIA 2DUDA 2I5MX 2VZAA 2PI2A 2Q2HA 1X3FA 1VQPA 3HOUG 1GM5A 3A0JA 2UXCQ 1XNQQ 4IJLA 2YTXA 3KYHC 1XPUA 4A3CH 1EUJA 5M5WH 3ZJYC 1SLJA 3PF5A 1HH2P 3U4VA 1S40A 5M5YH 4UP8A 2Z6KA 3K80C 4AYBE 1VQ7A 3M85A 1HNWL 4DR7Q 3PUYA 3PUXA 2NVQH 3UE0A 1OXUA 3CC7A 3RZDH 1EQQA 1K8GA 1GD7A 3E9HA 2ID0A 1D7QA 3S17H 3F2DA 5AJ3Q 5K36G 3KJOA 4LNQA 1HNWQ 1PFSA 1SR3A 4O2DA 5IYCH 5GAEC 1SMXA 3JAMi 5LMNL 3HOVH 2I0QA 2RHSB 1J6QA 4A3BH 3E9IA 4GS3A 3GTJH 4BY7G 4K0KL 1QVGA 2VW9A 1Z9FA 4P74A 1W3SA 2KENA 2OCEA 2Z6KC 4LUOA 5IP7G 5LMNQ 4MZ9A 3Q8DA 5GAGC 4QGUA 3GD7A 4K0KQ 1Q81C 1HZAA 3GTPH 3WWVA 3CCJA 4MTNA 4GN3B 1NMGA 4DR5L 3I55A 4GLAC 3JAMc 3U58A 1VQEA 3GTOH 3CCEA 4EX5A 1MJCA 5M3MH 1VQMA 1D8LA 3CPWA 1L1OB 4XTCS 1CKOA 3KFUA 5IYBH 1QUQB 2R93H 1UE6A 4BY1G 4LFBQ 1KIXA 3G71A 1GKHA 3PUWA 5C4XH 1S72A 2D0OA 2L15A 2Q2TA 2JEAI 5H1SE 2JA5G 4YWKA 3CCUA 1KQSA 2A1AA 1PH4A 1XJVA 4QJFA 4BBSG 4C3HH 3I4MH 1J5EL 3RR5A 2R7ZH 1YZ6A 4ME3A 3RNUA 3M3YH 1Q12A 4R4QA 1YHQA 1Y1WG 2GVAA 2Q2UA 1E24A 3CCSA 1LUZA 1J5EQ 3LGJA 1VQLA 3UDIA 3W1BA 2BH2A 1FVIA 2OQ0A 4GNXB 1IBML 3FP9A 2CWAA 3B6YA 4NB3A 3HOXH 4AH6A 1KD1C 1K9MC 4IFDG 3CCLA 2WB1E 1VCIA 1B70B 1IBMQ 1VQ6A 2VNUD 1NTGA 4DR6Q 4DK3C 1L1OA 4JI2L 1Q86C 4B3RL 3CP0A 1XMQL 3ERSX 1KL9A 1EYGA 1TWCH 4IJHA 4MNOA 4GOPB 2UXBL 5C0XI 1P16A 1A63A 1QUQA 1VQFA 1XTDA 4JI2Q 4HJ8A 4A3JG 4B3RQ 4QY7A 1XMQQ 4LF8L 3H15A 2R92G 4BXXG 4A3KG 2UXBQ 3M4OH 1QZGA 2YTVA 3J80i 3HOZG 4JV5Q 1L1OC 4LF8Q 3CCQA 2JA7G 4GN5A 4PZ8A 1LTLA 3H0GG 4FDBA 4QL5A 1VQ8A 4JV5L 4P72A 5EAYA 1LM0A 4HIDA 3AFQA 4BA1I 4GNXA 1VQOA 1PH9A 4POGA 3E0EA 3HFZB 3U4ZA 1EWIA 1P8LA 5IP9H 5FLXc 3PCOB 4R4IA 4A4IA 3J80c 2CFMA 1YITA 3S1NH 3JC66 4DNIA 4A3FG 1N8RC 4UY8C 4A3DH 2WFWA 1KAWA 3PO3H 4DR2L 4JI0L 3S15H 3DM3A 4GKJL 3KDFA 4YCVA 1DGSA 4QIWE 3ULJA 2E2HH 4A3LG 4GOPA 4JI5L 2IX1A 1UE1A 2OTLA 1JJ2A 4DR2Q 1TWAH 1WYDA 4JI0Q 3HOWG 4GKJQ 4OO1I 4ALPA 1W2BA 5FJ8H 2GN5A 1Q82C 2MNAA 1V43A 5M3FH 1PHJA 2C35B 2CCZA 4GKKL 1E1TA 4OWTB 4JI8L 3UDFA 4JI5Q 1AE2A 3HKZE 1VQHA 2LSSA 4LF7L 1I3QH 2RCNA 2VY3A 3M4PA 4H02A 4GKKQ 1A62A 3CMAA 5C44G 1EQRA 3S1QH 2LXJA 1E1OA 2RF4A 2PNHA 4JI8Q 4DV6L 3M4QA 1JMCA 1ASZA 4HJ7A 4BY7H 1CKMA 5IYDH 1HJPA 2PMZE 2JA9A 4IPCA 2PI2E 3G4SA 3G48A 3AQQA 4DV6Q 3RN5A 2OTJA 2E5LL 5C4JH 3F2BA 3S2DH 4A3IG 3K8AA 4QQBX 4KI0A 1JE5A 2XTIA 3H3VI 4A93H 3J81i 4R4TA 4PZ6A 2E5LQ 5DLQE 2KCMA 2I5HA 5IY0A 4NXNL 1WCMH 3A5ZB 1QVFA 2RHQB 4A3CG 3I4NH 1Y14B 1I5FA 2LXKA 1ASYA 3KOJA 3CXCA 1KXLA 1X3GA 1PVOA 1CSPA 1YVCA 1NMFA 4DK6C 1KC8C 4NXNQ 3J7A5 1CUKA 1YHAA 3BU2A 5JJIA 1VQ9A 3NBHB 4X62L 2VS1A 2NVXH 2F52A 1SFOH 3S2HH 2EXDA 1MJEA 2VL6A 2WAQG 1BBWA 2ZM6L 3KLWA 1E7ZA 2JK8A 3KF8B 3W1GA 1M90C 2ALYB 3M7NA 4L5SA 1O7IA 5IYCG 4X62Q 4DV2L 1XNRL 1X55A 3HOVG 1XPOA 5GQOA 1HZCA 1PYSB 1U0LA 1YHBA 4OXPA 3CC2A 4A3BG 2ZM6Q 2Y0SG 1IYJB 1VQCA 2N49A 4C3JH 3GTQH 3ER0A 2Q2IA 4A3MH 4XIGS 2ASBA 1XNRQ 4AQYL 4DR5Q 3VDYA 3CAMA 2MO1A 3GDEA 3L2PA 3CCRA 1U5KA 1VQ5A 3PO2H 1NBWA 1EOVA 4HIMA 2K5VA 1HNZL 1KRSA 4HJ9A 5IWAL 4AQYQ 2K5HA 4L5QA 5M3MG 2B29A 4WJ3M 4A3EH 4IFDJ 1A0IA 1UE7A 2ZJQA 1GVPA 1HNZQ 1X9NA 5IYBG 2R93G 5IWAQ 3PSIA 3RLOA 2R6GA 3K0XA 5C4XG 2JA8G 1NE3A 1BBUA 1Y1VH 4HIKA 1JB7A 3GTGH 4IFDI 2AHOB 2JE6I 4LW1A 2BA0A 1VQDA 3NELA 3I4MG 4GN4B 1X3EA 3KF6B 4IPGA 1X6OA 4JBWA 2R7ZG 4DR4L 3CC4A 2UUCL 5FLMH 2K14A 3A74A 2YU9H 2B63G 1VQAA 3KDFB 1I94L 1EIFA 2E8GA 1V9PA 3K7AH 4DR4Q 5JJLA 2JA6G 1UE5A 2UUCQ 1S3OA 1TWHH 3HOXG 3RLNA 3AEVA 1K0RA 3TS2A 3L7ZC 4B3TL 1I94Q 3S24A 4O0AA 4Y52H 4R1JA 1PH2A 3FKIH 1Q1BA 4Y7NH 1K73C 2NZHA 2EIFA 3BZKA 2UUAL 4B3TQ 1BKBA 1CKNB 2KBNA 1UWVA 5JJKA 2K50A 3ICEA 3S16H 1TWFH 1OXTA 1OXVA 1VQNA 2UUAQ 4JCVE 2JA6H 2D62A 3F1ZA 4DV1L 1YJNA 1R9TH 3HOYH 2HT1A 4A3GH 3KF6A 4OWXB 1HZBA 1T9HA 2AMCB 2JJQA 3J7ZC 1Q1EA 2BH8A 1YJ9A 3TEHB 3IRBA 3PIPA 1WI5A 1JJGA 1B8AA 1PH6A 4X64L 5IE8A 1G51A 1Q8KA 2OQKA 4UP9A 5LMUL 3F8TA 4JI6L 1C0AA 5IP9G 4X64Q 4A3DG 2NVYH 3PO3G 1V1QA 2NN6I 3PGZA 4BBRH 5LMUQ 1WJJA 4JI6Q 1IXRA 2VUMH 4EQ5A 3OW2A 3U50C 2YV5A 1N36L 2JQOA 1PH3A 1CKNA 4B3SL 4DAMA 2PQAB 3M9BA 4JI4L 4YWLA 2UU9L 2N3SA 2E2JH 4LF7Q 4JBJA 4JC0A 5FJ8G 1TXYA 4LWCA 5M3FG 3TS0A 1N36Q 2NZOA 4KHPL 1KRTA 4B3SQ 2IHEA 4JI4Q 4DR6L 4LFCL 1E22A 2UU9Q 1HNXL 2V1CC 3PUVA 2ATWA 4KHPQ 1HR0W 4B3ML 2K52A 3EBEA 3STBD 3RN2A 1YI2A 5IYDG 1AE3A 1K3RA 1WFQA 5C3EH 1SE8A 2XGTA 4YWMA 5JEAJ 4DKAC 3PIOA 1VQ4A 1HNXQ 3CCMA 2F4VL 3STBC 1XPRA 4PZ7A 3HOUH 2IHFA 2ZTDA 2K5NA 3ULPA 4B3MQ 1E3PA 1MIUA 4OONA 3NEMA 2YYZA 2F4VQ 2QGQA 1PYBA 3HKSA 1HZ9A 2UXDL 5IT9c 2WAQE 3CMEA 4DUYL 4A93G 3K81C 2H5XA 2YTYA 2GVBA 1VQGA 3H3VH 3J81c 5JEAG 2MFIA 3K7UC 2KHJA 4A76A 1WCMG 2UXDQ 5J3BA 4DR7L 1VQIA 2PQAA 4PMWA 4DUYQ 1IBLL 1X65A 2Y0SE 1FJGL 4WJ4A 3I4NG 1VS0A 5AJ3L 1EFWA 5GADC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG Q;  1YEZ A;  4APV A;  2FXQ A;  1N9W A;  4DV0 L;  1IBL Q;  3FHW A;  4JOI C;  2NVT H;  3I4O A;  4NPS A;  5IP7 H;  4C3I H;  3L0O A;  1XMO L;  2DGY A;  1IZ6 A;  4YCU A;  4IPD A;  2QEX A;  2KCT A;  4DV2 Q;  4JBM A;  1K83 H;  4AIM A;  4AYB G;  2VQF L;  4DR3 L;  3D0F A;  1Q7Y C;  2B3G A;  2Z0S A;  4L5T A;  4DV0 Q;  4JBK A;  1RIP A;  3UE1 A;  1Z47 A;  1VQJ A;  2F3I A;  1XMO Q;  1JJC B;  1N33 L;  4DR1 L;  4LFA L;  2VQF Q;  4DR3 Q;  3GO5 A;  2HHH L;  5ELN A;  2CKZ B;  3GTL H;  4R4C A;  4A3M G;  4RMF A;  1FL0 A;  2VQE L;  4IOC A;  3GTK H;  4GLV B;  4BY1 H;  4POF A;  2ZJP A;  1YJW A;  2OWO A;  1N33 Q;  4DR1 Q;  4TVA B;  4LFA Q;  3EN2 A;  4DV3 L;  3CCV A;  1IL2 A;  3PO2 G;  1PH1 A;  4IOA A;  1N32 L;  2HHH Q;  4X66 L;  1PV4 A;  2VQE Q;  4LFB L;  2JA5 H;  4BBS H;  5M5X H;  2R7F A;  4DV3 Q;  4A3E G;  1N32 Q;  2AWO A;  2QA4 A;  1I6H H;  1OXX K;  3A5U A;  1B7Y B;  4JI3 L;  4X66 Q;  4LF9 L;  1LYL A;  1Y1W H;  4HIO A;  3S1R H;  4LF6 L;  2IY5 B;  1BVS A;  4GLX A;  3TQY A;  1WOC A;  1I50 H;  2N8N A;  1G29 1;  2K4K A;  1Y1V G;  4JI3 Q;  3NEN A;  4LF9 Q;  1C9O A;  3MXN B;  4LF6 Q;  1QZH A;  1A8V A;  2ZTE A;  3OYY A;  3BJU A;  3RZO H;  3F2C A;  1FGU A;  4TQU S;  4YCW A;  4YHH L;  1YBY A;  2MO0 A;  5FLM G;  2WP8 J;  3J81 j;  4JI7 L;  3TRZ A;  4JG2 A;  3BZC A;  4DV4 L;  5ELO A;  2D0P A;  2K75 A;  4P75 A;  4LUZ A;  1L2F A;  2R7D A;  4IPH A;  4DAY B;  3I7F A;  3TRE A;  1N34 L;  1UEB A;  1IBK L;  2ZTC A;  4YHH Q;  4YY3 L;  5C0X J;  5HGQ A;  2CWP A;  3T1Y L;  1HR0 L;  1EIY B;  4HJA A;  4JI7 Q;  4X65 L;  5BR8 L;  1NY4 A;  4DV4 Q;  4HJ5 A;  1C7Y A;  4A3J H;  1X56 A;  4NXM L;  5HY6 A;  2HIV A;  1M1K C;  5LMN W;  4LF5 L;  2R92 H;  4BXX H;  4A3K H;  1N34 Q;  1IBK Q;  3AFP A;  5GRO A;  4YY3 Q;  3RLF A;  1HR0 Q;  3AYH B;  1SN8 A;  2CQO A;  3T1Y Q;  4LF4 L;  3FKI G;  4X65 Q;  5BR8 Q;  4LFC Q;  4NXM Q;  3HOZ H;  2WB1 G;  4A75 A;  1YIJ A;  2JA7 H;  4LF5 Q;  3H0G H;  4RG1 A;  4UP7 A;  4LF4 Q;  5C0X G;  2HQL A;  5GAH C;  1QVC A;  4DV1 Q;  2KHI A;  4DUZ L;  4LUV A;  4OX9 L;  4PG3 A;  3GTM H;  2EQS A;  2IT1 A;  4KHZ A;  2BA1 A;  2A19 A;  1PH8 A;  4A3G G;  2MQH A;  3T1H L;  1L0W A;  1H95 A;  3D31 A;  2I5L X;  3DLL A;  1PH7 A;  3EIV A;  4C2M H;  4L5R C;  1VQB A;  4KLK A;  3CF5 A;  4DUZ Q;  4A3F H;  4OX9 Q;  1X54 A;  1OXS C;  2A8V A;  1PA6 A;  1NJI C;  3CD6 A;  3T1H Q;  1K8A C;  2UUB L;  3KJP A;  3ULL A;  1GO3 E;  3PV0 A;  4A3L H;  4UPA A;  3MEF A;  1AH9 A;  3PF4 A;  3S14 H;  3S1M H;  2AKW B;  2N78 A;  1SRU A;  3HOW H;  3W5O A;  3CQZ H;  4IO9 A;  2UUB Q;  4DV5 L;  2HIX A;  4DPG A;  3G6E A;  4JYA L;  1G6P A;  2B63 H;  3OTO L;  2JEB I;  2JA8 H;  4BBR G;  4X6A H;  2ES2 A;  2IX0 A;  1Q46 A;  4P71 A;  2E2I H;  2VUM G;  3I56 A;  4DV5 Q;  5C44 H;  3HOY G;  1TWG H;  1KHI A;  1YNX A;  3SGI A;  2AWN A;  3CPF A;  2ZJR A;  1VQK A;  3OTO Q;  4BA2 I;  4JYA Q;  1CSQ A;  4P73 A;  4JI1 L;  3PUZ A;  3CW2 C;  4GNX C;  3UDG A;  4OWW B;  1SRO A;  4DV7 L;  4OO1 G;  4JI1 Q;  2NN6 G;  4R4O A;  1RL2 A;  1MKH A;  4DV7 Q;  1JT8 A;  4J15 A;  4A3I H;  4GOP C;  3HKZ G;  5E7N A;  2UXC L;  1PH5 A;  3I2Z A;  1XNQ L;  1OTC A;  3UDX A;  5C3E G;  4JOI A;  2DUD A;  2I5M X;  2VZA A;  2PI2 A;  2Q2H A;  1X3F A;  1VQP A;  3HOU G;  1GM5 A;  3A0J A;  2UXC Q;  1XNQ Q;  4IJL A;  2YTX A;  3KYH C;  1XPU A;  4A3C H;  1EUJ A;  5M5W H;  3ZJY C;  1SLJ A;  3PF5 A;  1HH2 P;  3U4V A;  1S40 A;  5M5Y H;  4UP8 A;  2Z6K A;  3K80 C;  4AYB E;  1VQ7 A;  3M85 A;  1HNW L;  4DR7 Q;  3PUY A;  3PUX A;  2NVQ H;  3UE0 A;  1OXU A;  3CC7 A;  3RZD H;  1EQQ A;  1K8G A;  1GD7 A;  3E9H A;  2ID0 A;  1D7Q A;  3S17 H;  3F2D A;  5AJ3 Q;  5K36 G;  3KJO A;  4LNQ A;  1HNW Q;  1PFS A;  1SR3 A;  4O2D A;  5IYC H;  5GAE C;  1SMX A;  3JAM i;  5LMN L;  3HOV H;  2I0Q A;  2RHS B;  1J6Q A;  4A3B H;  3E9I A;  4GS3 A;  3GTJ H;  4BY7 G;  4K0K L;  1QVG A;  2VW9 A;  1Z9F A;  4P74 A;  1W3S A;  2KEN A;  2OCE A;  2Z6K C;  4LUO A;  5IP7 G;  5LMN Q;  4MZ9 A;  3Q8D A;  5GAG C;  4QGU A;  3GD7 A;  4K0K Q;  1Q81 C;  1HZA A;  3GTP H;  3WWV A;  3CCJ A;  4MTN A;  4GN3 B;  1NMG A;  4DR5 L;  3I55 A;  4GLA C;  3JAM c;  3U58 A;  1VQE A;  3GTO H;  3CCE A;  4EX5 A;  1MJC A;  5M3M H;  1VQM A;  1D8L A;  3CPW A;  1L1O B;  4XTC S;  1CKO A;  3KFU A;  5IYB H;  1QUQ B;  2R93 H;  1UE6 A;  4BY1 G;  4LFB Q;  1KIX A;  3G71 A;  1GKH A;  3PUW A;  5C4X H;  1S72 A;  2D0O A;  2L15 A;  2Q2T A;  2JEA I;  5H1S E;  2JA5 G;  4YWK A;  3CCU A;  1KQS A;  2A1A A;  1PH4 A;  1XJV A;  4QJF A;  4BBS G;  4C3H H;  3I4M H;  1J5E L;  3RR5 A;  2R7Z H;  1YZ6 A;  4ME3 A;  3RNU A;  3M3Y H;  1Q12 A;  4R4Q A;  1YHQ A;  1Y1W G;  2GVA A;  2Q2U A;  1E24 A;  3CCS A;  1LUZ A;  1J5E Q;  3LGJ A;  1VQL A;  3UDI A;  3W1B A;  2BH2 A;  1FVI A;  2OQ0 A;  4GNX B;  1IBM L;  3FP9 A;  2CWA A;  3B6Y A;  4NB3 A;  3HOX H;  4AH6 A;  1KD1 C;  1K9M C;  4IFD G;  3CCL A;  2WB1 E;  1VCI A;  1B70 B;  1IBM Q;  1VQ6 A;  2VNU D;  1NTG A;  4DR6 Q;  4DK3 C;  1L1O A;  4JI2 L;  1Q86 C;  4B3R L;  3CP0 A;  1XMQ L;  3ERS X;  1KL9 A;  1EYG A;  1TWC H;  4IJH A;  4MNO A;  4GOP B;  2UXB L;  5C0X I;  1P16 A;  1A63 A;  1QUQ A;  1VQF A;  1XTD A;  4JI2 Q;  4HJ8 A;  4A3J G;  4B3R Q;  4QY7 A;  1XMQ Q;  4LF8 L;  3H15 A;  2R92 G;  4BXX G;  4A3K G;  2UXB Q;  3M4O H;  1QZG A;  2YTV A;  3J80 i;  3HOZ G;  4JV5 Q;  1L1O C;  4LF8 Q;  3CCQ A;  2JA7 G;  4GN5 A;  4PZ8 A;  1LTL A;  3H0G G;  4FDB A;  4QL5 A;  1VQ8 A;  4JV5 L;  4P72 A;  5EAY A;  1LM0 A;  4HID A;  3AFQ A;  4BA1 I;  4GNX A;  1VQO A;  1PH9 A;  4POG A;  3E0E A;  3HFZ B;  3U4Z A;  1EWI A;  1P8L A;  5IP9 H;  5FLX c;  3PCO B;  4R4I A;  4A4I A;  3J80 c;  2CFM A;  1YIT A;  3S1N H;  3JC6 6;  4DNI A;  4A3F G;  1N8R C;  4UY8 C;  4A3D H;  2WFW A;  1KAW A;  3PO3 H;  4DR2 L;  4JI0 L;  3S15 H;  3DM3 A;  4GKJ L;  3KDF A;  4YCV A;  1DGS A;  4QIW E;  3ULJ A;  2E2H H;  4A3L G;  4GOP A;  4JI5 L;  2IX1 A;  1UE1 A;  2OTL A;  1JJ2 A;  4DR2 Q;  1TWA H;  1WYD A;  4JI0 Q;  3HOW G;  4GKJ Q;  4OO1 I;  4ALP A;  1W2B A;  5FJ8 H;  2GN5 A;  1Q82 C;  2MNA A;  1V43 A;  5M3F H;  1PHJ A;  2C35 B;  2CCZ A;  4GKK L;  1E1T A;  4OWT B;  4JI8 L;  3UDF A;  4JI5 Q;  1AE2 A;  3HKZ E;  1VQH A;  2LSS A;  4LF7 L;  1I3Q H;  2RCN A;  2VY3 A;  3M4P A;  4H02 A;  4GKK Q;  1A62 A;  3CMA A;  5C44 G;  1EQR A;  3S1Q H;  2LXJ A;  1E1O A;  2RF4 A;  2PNH A;  4JI8 Q;  4DV6 L;  3M4Q A;  1JMC A;  1ASZ A;  4HJ7 A;  4BY7 H;  1CKM A;  5IYD H;  1HJP A;  2PMZ E;  2JA9 A;  4IPC A;  2PI2 E;  3G4S A;  3G48 A;  3AQQ A;  4DV6 Q;  3RN5 A;  2OTJ A;  2E5L L;  5C4J H;  3F2B A;  3S2D H;  4A3I G;  3K8A A;  4QQB X;  4KI0 A;  1JE5 A;  2XTI A;  3H3V I;  4A93 H;  3J81 i;  4R4T A;  4PZ6 A;  2E5L Q;  5DLQ E;  2KCM A;  2I5H A;  5IY0 A;  4NXN L;  1WCM H;  3A5Z B;  1QVF A;  2RHQ B;  4A3C G;  3I4N H;  1Y14 B;  1I5F A;  2LXK A;  1ASY A;  3KOJ A;  3CXC A;  1KXL A;  1X3G A;  1PVO A;  1CSP A;  1YVC A;  1NMF A;  4DK6 C;  1KC8 C;  4NXN Q;  3J7A 5;  1CUK A;  1YHA A;  3BU2 A;  5JJI A;  1VQ9 A;  3NBH B;  4X62 L;  2VS1 A;  2NVX H;  2F52 A;  1SFO H;  3S2H H;  2EXD A;  1MJE A;  2VL6 A;  2WAQ G;  1BBW A;  2ZM6 L;  3KLW A;  1E7Z A;  2JK8 A;  3KF8 B;  3W1G A;  1M90 C;  2ALY B;  3M7N A;  4L5S A;  1O7I A;  5IYC G;  4X62 Q;  4DV2 L;  1XNR L;  1X55 A;  3HOV G;  1XPO A;  5GQO A;  1HZC A;  1PYS B;  1U0L A;  1YHB A;  4OXP A;  3CC2 A;  4A3B G;  2ZM6 Q;  2Y0S G;  1IYJ B;  1VQC A;  2N49 A;  4C3J H;  3GTQ H;  3ER0 A;  2Q2I A;  4A3M H;  4XIG S;  2ASB A;  1XNR Q;  4AQY L;  4DR5 Q;  3VDY A;  3CAM A;  2MO1 A;  3GDE A;  3L2P A;  3CCR A;  1U5K A;  1VQ5 A;  3PO2 H;  1NBW A;  1EOV A;  4HIM A;  2K5V A;  1HNZ L;  1KRS A;  4HJ9 A;  5IWA L;  4AQY Q;  2K5H A;  4L5Q A;  5M3M G;  2B29 A;  4WJ3 M;  4A3E H;  4IFD J;  1A0I A;  1UE7 A;  2ZJQ A;  1GVP A;  1HNZ Q;  1X9N A;  5IYB G;  2R93 G;  5IWA Q;  3PSI A;  3RLO A;  2R6G A;  3K0X A;  5C4X G;  2JA8 G;  1NE3 A;  1BBU A;  1Y1V H;  4HIK A;  1JB7 A;  3GTG H;  4IFD I;  2AHO B;  2JE6 I;  4LW1 A;  2BA0 A;  1VQD A;  3NEL A;  3I4M G;  4GN4 B;  1X3E A;  3KF6 B;  4IPG A;  1X6O A;  4JBW A;  2R7Z G;  4DR4 L;  3CC4 A;  2UUC L;  5FLM H;  2K14 A;  3A74 A;  2YU9 H;  2B63 G;  1VQA A;  3KDF B;  1I94 L;  1EIF A;  2E8G A;  1V9P A;  3K7A H;  4DR4 Q;  5JJL A;  2JA6 G;  1UE5 A;  2UUC Q;  1S3O A;  1TWH H;  3HOX G;  3RLN A;  3AEV A;  1K0R A;  3TS2 A;  3L7Z C;  4B3T L;  1I94 Q;  3S24 A;  4O0A A;  4Y52 H;  4R1J A;  1PH2 A;  3FKI H;  1Q1B A;  4Y7N H;  1K73 C;  2NZH A;  2EIF A;  3BZK A;  2UUA L;  4B3T Q;  1BKB A;  1CKN B;  2KBN A;  1UWV A;  5JJK A;  2K50 A;  3ICE A;  3S16 H;  1TWF H;  1OXT A;  1OXV A;  1VQN A;  2UUA Q;  4JCV E;  2JA6 H;  2D62 A;  3F1Z A;  4DV1 L;  1YJN A;  1R9T H;  3HOY H;  2HT1 A;  4A3G H;  3KF6 A;  4OWX B;  1HZB A;  1T9H A;  2AMC B;  2JJQ A;  3J7Z C;  1Q1E A;  2BH8 A;  1YJ9 A;  3TEH B;  3IRB A;  3PIP A;  1WI5 A;  1JJG A;  1B8A A;  1PH6 A;  4X64 L;  5IE8 A;  1G51 A;  1Q8K A;  2OQK A;  4UP9 A;  5LMU L;  3F8T A;  4JI6 L;  1C0A A;  5IP9 G;  4X64 Q;  4A3D G;  2NVY H;  3PO3 G;  1V1Q A;  2NN6 I;  3PGZ A;  4BBR H;  5LMU Q;  1WJJ A;  4JI6 Q;  1IXR A;  2VUM H;  4EQ5 A;  3OW2 A;  3U50 C;  2YV5 A;  1N36 L;  2JQO A;  1PH3 A;  1CKN A;  4B3S L;  4DAM A;  2PQA B;  3M9B A;  4JI4 L;  4YWL A;  2UU9 L;  2N3S A;  2E2J H;  4LF7 Q;  4JBJ A;  4JC0 A;  5FJ8 G;  1TXY A;  4LWC A;  5M3F G;  3TS0 A;  1N36 Q;  2NZO A;  4KHP L;  1KRT A;  4B3S Q;  2IHE A;  4JI4 Q;  4DR6 L;  4LFC L;  1E22 A;  2UU9 Q;  1HNX L;  2V1C C;  3PUV A;  2ATW A;  4KHP Q;  1HR0 W;  4B3M L;  2K52 A;  3EBE A;  3STB D;  3RN2 A;  1YI2 A;  5IYD G;  1AE3 A;  1K3R A;  1WFQ A;  5C3E H;  1SE8 A;  2XGT A;  4YWM A;  5JEA J;  4DKA C;  3PIO A;  1VQ4 A;  1HNX Q;  3CCM A;  2F4V L;  3STB C;  1XPR A;  4PZ7 A;  3HOU H;  2IHF A;  2ZTD A;  2K5N A;  3ULP A;  4B3M Q;  1E3P A;  1MIU A;  4OON A;  3NEM A;  2YYZ A;  2F4V Q;  2QGQ A;  1PYB A;  3HKS A;  1HZ9 A;  2UXD L;  5IT9 c;  2WAQ E;  3CME A;  4DUY L;  4A93 G;  3K81 C;  2H5X A;  2YTY A;  2GVB A;  1VQG A;  3H3V H;  3J81 c;  5JEA G;  2MFI A;  3K7U C;  2KHJ A;  4A76 A;  1WCM G;  2UXD Q;  5J3B A;  4DR7 L;  1VQI A;  2PQA A;  4PMW A;  4DUY Q;  1IBL L;  1X65 A;  2Y0S E;  1FJG L;  4WJ4 A;  3I4N G;  1VS0 A;  5AJ3 L;  1EFW A;  5GAD C; 
#chains in the Genus database with same CATH topology
 3T16 A;  1IBL Q;  4APV A;  2IPK D;  4DV0 L;  3FHW A;  3S1R B;  3I4O A;  5IT9 L;  5IP7 H;  2LKV A;  2F3V A;  3L0O A;  4YCU A;  2YU9 B;  2EY5 A;  3VYU A;  4AIM A;  2Z0S A;  3OSO A;  5I4D A;  1Z47 A;  3CRL C;  3D8G A;  4WOR A;  2VQF Q;  3R2I A;  3GTK H;  3NBI A;  4GLV B;  3FKI B;  2OWO A;  3I73 A;  4DR1 Q;  4DV3 L;  1IL2 A;  4J1M A;  4LFB L;  1EL0 A;  5DNF A;  3AB9 A;  4QF4 A;  3R93 A;  4EQP A;  4EQO A;  4BBS H;  4WRD A;  2QA4 A;  1HXY D;  1KAB A;  2PCF B;  2RKS A;  1Y1W H;  4QMG A;  1OO9 B;  3S1R H;  3HP3 A;  1BVS A;  2N8N A;  1G29 1;  5A2Q L;  3NEN A;  4K8I A;  4LF9 Q;  1I4R A;  4BS9 A;  1QZH A;  4LF6 Q;  1FGU A;  2KJX A;  4YCW A;  4YHH L;  1YBY A;  2MO0 A;  4JI7 L;  3IKJ A;  2K7V A;  4DV4 L;  4P75 A;  1A3U A;  1L2F A;  2B39 A;  2R7D A;  2Z1C A;  1PTO F;  4IPH A;  5IIF A;  1MGS A;  1UEB A;  2VB2 X;  2HIV A;  1M1K C;  5LMN W;  4LF5 L;  1N34 Q;  4K2L A;  1D1K A;  1M8A A;  3AFP A;  5GRO A;  4LF4 L;  2E2J B;  3BVZ A;  4QIW B;  5BR8 Q;  1S5E D;  1DYQ A;  1E2V A;  1STG A;  2RCF A;  2JA7 H;  2EYH A;  1PDQ A;  4RG1 A;  3MC0 B;  5C0X G;  3FRP B;  2EDG A;  5GAH C;  1QVC A;  4DV1 Q;  1HUN A;  4I7A A;  5D14 A;  1Y69 U;  5DM6 3;  4JW0 A;  1PH8 A;  1I4H A;  1H95 A;  3NXW A;  3D31 A;  1PRT C;  3FDT A;  4L5R C;  4C2M H;  4A3G G;  3DMU A;  4DF7 A;  3CF5 A;  4DUZ Q;  4A3F H;  3HOU B;  1H9K A;  2B2Y C;  1PA6 A;  3T1H Q;  4HTH A;  2FMC A;  3VR4 A;  1HQM C;  1HFG A;  1GO3 E;  3PV0 A;  1EOT A;  3MEF A;  3H91 A;  3C1F A;  5E3F A;  3W5O A;  3EVQ A;  1TY0 A;  4RWS C;  2JA8 H;  2XSC A;  4BBR G;  4F8M A;  2O5I C;  2VUM G;  3HGB A;  4X3T A;  4DV5 Q;  4LMQ D;  1VQK A;  2ZJR A;  2NVQ B;  3Q23 A;  1S4Z A;  3UDG A;  4OWW B;  1SRO A;  1S5C D;  2FIN B;  1CA5 A;  4NKL A;  1TS5 A;  4JI1 Q;  4A3B B;  4RCO A;  1XXG A;  4RA8 A;  4XQN A;  3HKZ G;  2B2T C;  1OTC A;  2RQX A;  1U4L A;  2PI2 A;  3UI2 A;  2HQE A;  3KBX A;  1XNQ Q;  4IJL A;  2YTX A;  3WOE A;  4A3C H;  3PF5 A;  2JA5 B;  1B44 D;  1VDZ A;  5JOB A;  1NR2 A;  3SK6 A;  1DOK A;  1AW7 A;  5M5X B;  5C4H A;  2Z6K A;  3K80 C;  2F0N A;  1I6H B;  3AU7 A;  3PUX A;  2NVQ H;  3RZD H;  2Z4H A;  3F2D A;  5AJ3 Q;  4KJN A;  3KJO A;  1HNW Q;  1SR3 A;  1SMX A;  4K6L A;  4A3B H;  3EA6 A;  3RZO B;  3M3Y B;  5IP7 G;  5GAG C;  4K0K Q;  1LAC A;  1Q81 C;  3L3O C;  4GN3 B;  4DR5 L;  2JYO A;  3JAM c;  3U58 A;  1W6J A;  3DWP A;  3GV3 A;  4DXF A;  2Z6B A;  1UE6 A;  4LFB Q;  2MHV A;  1KIX A;  3HOZ B;  1STN A;  3PUW A;  1EIH A;  5C4X H;  1SXT A;  2Q8R E;  2L15 A;  2K5Q A;  4RGO S;  5ELD A;  1KQS A;  1ESF A;  4BBS G;  3GTM B;  3JAM L;  1C4Q A;  1IW7 C;  1JR0 D;  3M3Y H;  1KAA A;  1JOQ A;  3QR8 A;  1Y1W G;  4E6I A;  1LUZ A;  5KYI A;  3DWA A;  3UDI A;  1LLR D;  2JA6 H;  2EYJ A;  2CWA A;  3HOX H;  3X3N A;  3S1N B;  3I4L A;  2XWB B;  2LS0 1;  1H9S B;  4A3D B;  2VNU D;  2XN9 C;  3D3R A;  1HA5 A;  1XMQ L;  3ERS X;  3MEH A;  1EIG A;  2F1M A;  2RDG A;  1A63 A;  3PMF A;  1XTD A;  1TWA B;  3H09 A;  4LF8 L;  2UXB Q;  1QZG A;  3C1E A;  2EJG C;  1ZYR C;  1L1O C;  1I3Q B;  2JA7 G;  3BYT B;  3OPO A;  1J9O A;  4OEL B;  4QL5 A;  4JV5 L;  4A3I B;  4P72 A;  4UHV A;  2XIW A;  2F0I A;  3H94 A;  3R2T A;  3AFQ A;  1VQO A;  3U4Z A;  3S1N H;  4R4I A;  2EYF A;  1EY6 A;  4A4I A;  3J80 c;  4A3F G;  4A3D H;  4UY8 C;  2FJ2 A;  3S2D B;  2V4D A;  4JI0 L;  1H9S A;  4RAU C;  1ZKO A;  1DGS A;  4QIW E;  2DNC A;  1SBB B;  4DR2 Q;  1TWA H;  1WYD A;  1FR3 A;  3A7A B;  1GUW A;  3VR5 A;  5M3F H;  3IAY A;  4CDC C;  2JA8 G;  4LF7 L;  1AE2 A;  3J80 L;  1I3Q H;  2RCN A;  5J39 A;  1TS2 A;  2EJM A;  3CMA A;  3GTJ B;  1YNN D;  5JPM C;  1YNJ C;  3FPP A;  4DGZ A;  4DV6 L;  1ASZ A;  1MD2 D;  4BY7 H;  5IYD H;  3NHH A;  2HD3 A;  2K33 A;  2PI2 E;  5CV5 A;  3RN5 A;  5TSS A;  2OTJ A;  3EJI A;  2Z4I A;  4IZ8 A;  3S2D H;  4B9X A;  5M3M B;  5C5L A;  1NSN S;  4A93 H;  4PZ6 A;  2NTT A;  5JEA H;  4NXN L;  4A3C G;  5EGT A;  2LXK A;  1KXL A;  5IOC A;  1YVC A;  1KC8 C;  4XYO A;  1DJR D;  1SJE D;  3K0Y A;  2ICI A;  1G91 A;  2SOB A;  2NVX H;  2ZXR A;  1X3Q A;  2VL6 A;  2WAQ G;  3KLW A;  4DU9 A;  1HTP A;  1WTO A;  3K6O A;  1O7I A;  4UAI A;  4DV2 L;  1QCB D;  4IUV A;  1EYD A;  1YHB A;  1U0L A;  3CC2 A;  4A3B G;  2FHT A;  2Q2I A;  1JQY D;  4XIG S;  1XNR Q;  4AQY L;  4DR5 Q;  3VDY A;  4HAE A;  3CAM A;  3E5S A;  3K7A B;  3GDE A;  3L2P A;  3CCR A;  1U5K A;  1VQ5 A;  5KYL A;  4KY5 A;  3SEB A;  1EOV A;  2K5V A;  5IWA L;  2K5H A;  2B29 A;  4A3E H;  2A6E D;  4IFD J;  2MGS A;  5T1I A;  3M4O B;  1HNZ Q;  1LTI D;  4Y7N B;  3T13 A;  4ABN A;  5C4X G;  1JE4 A;  2TMP A;  1TVX A;  2VB3 X;  1JC7 A;  1B2T A;  4XT3 B;  1ENA A;  3M7G A;  1SND A;  4U68 A;  1VQD A;  4K5V A;  4GN4 B;  3KF6 B;  2QIL A;  1JB3 A;  2UUC L;  3SE0 A;  1KLG D;  4M8A A;  1SDF A;  3A74 A;  1VQA A;  4DK1 A;  3VA7 A;  4DR4 Q;  3K7A H;  4JPB W;  2JA6 G;  1UE5 A;  3HOX G;  3AEV A;  2PZW A;  5J1Z A;  1KNE A;  3L7Z C;  3TS2 A;  1RD9 D;  1WTX A;  3S24 A;  4Y52 H;  1G6Z A;  2O4X A;  4Y7N H;  3D6C A;  3BZK A;  4IQZ A;  1QIL A;  5JJK A;  1A3V A;  1LTR D;  2BOS A;  1OXV A;  3S1Q B;  1S5F D;  5C5M A;  4PQX A;  2UUA Q;  1JOK A;  3NUC A;  2D62 A;  2HCC A;  5COR A;  1R9T H;  3MZ5 A;  3KF6 A;  2E2D C;  2AMC B;  1Y8P B;  1AN8 A;  1JJG A;  2A69 C;  1FNW A;  5IE8 A;  2RDF A;  5C3E B;  2NYZ D;  2OQK A;  1PZI D;  3F8T A;  4B9W A;  1GHK A;  4V0B A;  4A3D G;  1STB A;  2NVY H;  1GOZ A;  1R4P B;  1V1Q A;  1LAB A;  4EQ5 A;  5M9O A;  4DFA A;  4C56 C;  1YNJ D;  2JQO A;  1EY8 A;  1MHW C;  2KCN A;  3IFT A;  1BCP B;  2L12 A;  1U4R A;  1SFO B;  4LF7 Q;  5M3F G;  3TS0 A;  1QWY A;  2F3W A;  1KRT A;  4B3S Q;  1E22 A;  2UU9 Q;  1HNX L;  3W2D A;  1E2Z A;  5K5P A;  4B3M L;  3SDZ A;  4DR6 Q;  5IYD G;  5C3E H;  4ZRZ A;  1WFQ A;  4BY7 G;  1K83 B;  2F4V L;  2DJF C;  1VQ4 A;  4PZ7 A;  2K5N A;  3C3L A;  4KV6 A;  1PTO D;  1MIU A;  2NUC A;  2QGQ A;  3G7L A;  3GTL B;  3FMC A;  1TKW B;  3CME A;  4A93 G;  2YTY A;  1CZW A;  2BE5 D;  1VQG A;  4ID6 A;  5JEA G;  5G3L F;  2KHJ A;  2OF1 A;  3T51 B;  4DR7 L;  1VQI A;  1IBL L;  5K36 H;  1X65 A;  2Y0S E;  4ZYS A;  1F9P A;  1RJT A;  1LTB D;  1EFW A;  2IL8 A;  1QG7 A;  1FJG Q;  4YIJ A;  5D65 A;  4JBM A;  2DGY A;  4DV2 Q;  3GQB A;  2KCT A;  1K83 H;  1HUM A;  4AYB G;  2VQF L;  3QO2 A;  3D0F A;  3Q24 A;  1T5E A;  3RD4 A;  1TWH B;  2BDO A;  2XRS D;  2F3I A;  1VQJ A;  1XMO Q;  5C3X A;  1NUC A;  4DR1 L;  1FGB D;  2CKZ B;  3GTL H;  4IOC A;  1E0B A;  1Z7T A;  1YJW A;  3NTI A;  1LTT D;  4TVA B;  4IOA A;  2HDL A;  3I3C A;  4FXG C;  1PV4 A;  1F9S A;  1DOL A;  1PZK D;  3TN2 A;  4A3E G;  2Z8L A;  1N32 Q;  4PMB A;  1FYC A;  2B2W C;  5FLX E;  5I9P A;  4LF9 L;  1AZP A;  2PPB C;  4LF6 L;  4FF3 A;  4A3G B;  4GLX A;  3TQY A;  3BYY B;  5JAV A;  2IWH A;  4JI3 Q;  1O7L A;  5EKI A;  1C9O A;  3ITP A;  3MXN B;  1A8V A;  3I8Z A;  4M1U B;  4IFD H;  3F2C A;  5KNC A;  2D2C C;  1U4M A;  5ELO A;  2EY1 A;  1BUV T;  4LUZ A;  4DAY B;  1N34 L;  2VUM B;  1W6K A;  5BR8 L;  2F0Q A;  2BCO A;  1C7Y A;  3S1M B;  3CQZ B;  2CW0 D;  1M4V A;  1F77 A;  1O78 A;  4XDX A;  4X65 Q;  3OWF A;  4A75 A;  1YIJ A;  2DY7 A;  4ZCK A;  5CGK A;  4UP7 A;  3NPP A;  2A69 D;  5CV9 A;  5J22 A;  4QCL A;  4DUZ L;  3HKZ B;  2QEJ C;  2EQS A;  2IT1 A;  2XWJ B;  2MQH A;  3MXN A;  4C1N K;  5BN3 A;  3T1H L;  2O5J C;  2MUY A;  3DLL A;  5KND A;  1PH7 A;  1VQB A;  1X54 A;  2A8V A;  2K04 A;  3OWE B;  3CD6 A;  1K8A C;  1R4Q B;  3SK8 A;  3KJP A;  4DAY A;  3S1M H;  5HUR A;  4S3S A;  3CQZ H;  4DV5 L;  2HIX A;  4I7Z C;  4DPG A;  3G6E A;  2B63 H;  4OIK A;  2F4I A;  1Q46 A;  4P71 A;  1GUS A;  4OIJ A;  3I56 A;  1DZ1 A;  1B3Q A;  1TWG H;  1KHI A;  1LT6 D;  4JYA Q;  3WOF A;  1CSQ A;  4JI1 L;  3D6W A;  3CW2 C;  3NK9 A;  2RVL A;  5BN4 A;  2ZXO A;  1G2S A;  4R4O A;  1MKH A;  5LL6 S;  1RCV D;  1B4O A;  3VR6 A;  1XNQ L;  5C3E G;  2A74 C;  3GTK B;  2Q2H A;  2M9V A;  2UXC Q;  3MAQ A;  3KYH C;  1XPU A;  4C1N I;  3TBI B;  4BBS B;  4FF2 A;  4UP8 A;  1VQ7 A;  5DM7 3;  1HNW L;  4DR7 Q;  3NWS A;  3PUY A;  3UE0 A;  3K57 A;  1Y1W B;  1K8G A;  2RDH A;  1ENC A;  5K36 G;  4O2D A;  3JAM i;  5ELF A;  4C3H B;  1F9R A;  2B8F A;  4K0K L;  4GS3 A;  1NCV A;  1D5Z C;  4P74 A;  1W3S A;  2KEN A;  2OCE A;  4MZ9 A;  3GD7 A;  3GTP H;  2B2U A;  4MTN A;  1NMG A;  4GLA C;  1VQE A;  3DXJ C;  1D8L A;  3QIA A;  2R93 H;  2F0S A;  2JA7 B;  2L11 A;  2F0K A;  4YWK A;  1I4P A;  1XJV A;  4QJF A;  4C3H H;  3N52 A;  3RR5 A;  3BDC A;  4H7B A;  4H0L C;  4C2M B;  4QUF A;  3CCS A;  4A3F B;  5IGB A;  3OIQ A;  4ZUJ A;  4GNX B;  4AH6 A;  1C48 A;  4IFD G;  2K5W A;  4ILW A;  2AUK A;  4DN4 M;  3MXP A;  1SNQ A;  4EVO A;  1SNP A;  1VQ6 A;  4DK3 C;  3CP0 A;  2RSN A;  4TSS A;  2JA8 B;  1TWC H;  4GOP B;  2KED A;  5C0X I;  2UXB L;  2M00 A;  5EBC A;  1XYI A;  1TR5 A;  4HJ8 A;  3WDN A;  4B3R Q;  1HFN A;  1WTV A;  3H15 A;  1KDB A;  2AQ3 B;  2YTV A;  1IHZ A;  4FNF A;  3J80 i;  4PZ8 A;  5EKL A;  1LTL A;  2KVM A;  3QG1 A;  2CHB D;  1CHP D;  4NDX A;  5EAY A;  5IT9 E;  2X6L A;  1HTL D;  3MXG A;  2WKD A;  4HID A;  1JOR A;  4GNX A;  3CHB D;  1EWI A;  2EYO A;  3PCO B;  2QCP X;  2CFM A;  3JC6 6;  3F2U A;  2L0C A;  4K2K A;  1VMC A;  4DR2 L;  3DM3 A;  4XYQ A;  3KDF A;  2NBF A;  4GOP A;  1UE1 A;  5FKA C;  2OTL A;  1JJ2 A;  4O1N A;  1SNC A;  1WCM B;  3OIP A;  4MTK A;  5FJ8 H;  3RZD B;  2WAQ B;  2MNA A;  1Q82 C;  1E1T A;  4OWT B;  3UDF A;  4JI5 Q;  2B63 G;  3HKZ E;  1UEA B;  2VY3 A;  1SYC A;  4XQJ A;  5EPL A;  2RF4 A;  1EY9 A;  2PNH A;  3M4Q A;  4LK1 C;  1AEX A;  1YNN C;  5A2Q E;  2JA9 A;  3NE5 B;  3BVG A;  3DWQ A;  3G4S A;  4FXK C;  4R8N A;  3SK4 A;  3F2B A;  1NR4 A;  2Z9H A;  3H3V I;  4MHE A;  4L63 B;  1X3P A;  2E5L Q;  2F0U A;  3G6J B;  5DLQ E;  3PO2 B;  5I9O A;  2I5H A;  5IY0 A;  1WCM H;  5C4X B;  1QVF A;  1I4Q A;  1Y14 B;  1X3G A;  2F0M A;  4DK6 C;  1NMF A;  1CUK A;  2B2V A;  3NBH B;  2VS1 A;  2F52 A;  3BG3 A;  1BBW A;  2SNM A;  2JK8 A;  1Y1V B;  3M7N A;  2PZT A;  1SJH D;  2JA6 B;  1XNR L;  4N8X 1;  3HOX B;  5GQO A;  3SR1 A;  5JJZ A;  1IYJ B;  3PIP 3;  5ELE A;  5CBA E;  1BDO A;  3PO2 H;  2SDF A;  1SE3 A;  4HIM A;  1HNZ L;  1DM0 B;  2KQ3 A;  2EZV A;  1A15 A;  2KCC A;  2F0V A;  1X9N A;  1B9N A;  2R93 G;  1CT1 D;  2A6E C;  2WB1 B;  4ZUI A;  3RLO A;  3E3X A;  2R6G A;  2WAC A;  1V1P B;  3S16 B;  3NBH A;  1BBU A;  2OEO A;  3T53 B;  1Y1V H;  4HIK A;  3GTG H;  4LAA A;  4FP5 D;  2JE6 I;  4LW1 A;  3NEL A;  4C3H G;  2H1E A;  4HED A;  4JBW A;  4IPG A;  2CH4 A;  4DR4 L;  1NNX A;  5FLM H;  2EE1 A;  1SE2 A;  1EIF A;  1DXM A;  3DHQ A;  3LNN A;  4RGM A;  1Q8I A;  1BOS A;  1PH2 A;  5M3F B;  2UUA L;  4B3T Q;  5G3L D;  1LT3 D;  1BKB A;  2KBN A;  1UWV A;  2K50 A;  1AP0 A;  1F2M A;  3ICE A;  3S16 H;  3J7Y W;  5I6W A;  1V1P A;  1HRJ A;  3U9O A;  4HMJ A;  4BY7 B;  1B3A A;  4FF4 A;  3HOY H;  1HCZ A;  1YJ9 A;  1O80 A;  4F87 A;  3IRB A;  1KDA A;  4XQQ A;  5C4Z A;  3ONA B;  4A93 B;  1G51 A;  1Q8K A;  3NQI A;  2SNS A;  1K8O A;  5D3D A;  5I6Y A;  5FO8 B;  2QW7 A;  4HSP A;  2NN6 I;  4DA2 A;  4JI6 Q;  1FD7 D;  3U50 C;  1K8M A;  2F0H A;  2YV5 A;  5EJW A;  3BZD B;  4B3S L;  2PQA B;  2UU9 L;  2NVX B;  2N3S A;  4JC0 A;  5FJ8 G;  1N36 Q;  2NZO A;  4OO1 H;  5JPN C;  4AYB B;  2GA4 B;  1SNO A;  1WD0 A;  4DR6 L;  3JAM E;  2AQ2 B;  1QNU A;  2RSO A;  1D2B A;  1DCZ A;  1V1O A;  2ATW A;  1AE3 A;  1K3R A;  1U9R A;  4DKA C;  4G7H C;  2RA4 A;  1BBX C;  3FEW X;  1PFB A;  3EQL C;  2YYZ A;  3KLS A;  3HKS A;  1F2Z A;  3PQI A;  4A3E B;  1PTO C;  2WAQ E;  4KD4 A;  3RMH A;  2EYM A;  1EWH A;  2GVB A;  3FPU B;  3MVV A;  1EY0 A;  1WCM G;  2BE5 C;  4PMW A;  2PQA A;  2K6A A;  5CC4 A;  1FJG L;  4WJ4 A;  3KK7 A;  2JXM B;  1I4G A;  1N9W A;  2NB0 A;  4XXE A;  2NVT H;  1ZEQ X;  3NTH A;  4NPS A;  4C3I H;  4TKO B;  1XMO L;  4IPD A;  2HCI A;  1DD2 A;  1BCP D;  1Q7Y C;  3H3V C;  4ZKB B;  1QE6 A;  1JJC B;  3QWN A;  2EOT A;  3GO5 A;  4DR3 Q;  3EFX D;  4R4C A;  4IN3 A;  4CDD C;  4BY1 H;  3P7J A;  5KNB A;  4HR7 B;  1IKL A;  1N33 Q;  4LFA Q;  1N32 L;  3PO2 G;  4KKS A;  4ODG A;  2HHH Q;  4NP5 A;  2VQE Q;  1GUT A;  1X32 A;  2HUG A;  1PRT B;  3S9W A;  1FNU A;  2R92 B;  2PYK A;  2AWO A;  1D1I A;  1OXX K;  4JK1 C;  4JI3 L;  4DAP A;  4X66 Q;  1LYL A;  3J80 E;  1R9T B;  4HIO A;  2EVB A;  2F0O A;  2IY5 B;  2B2U C;  1B53 A;  1I50 H;  2DN8 A;  1Y1V G;  1V8Q A;  3MXU A;  5KGU A;  1BF4 A;  3V96 A;  1GHJ A;  4RKB A;  3NWT A;  4Z9C B;  2IX3 A;  5FLM G;  3J81 j;  1DOM A;  1K28 A;  2K75 A;  4IUN A;  2NVY B;  4KKT A;  3TRE A;  5C0X J;  1WTP A;  2CWP A;  1EIY B;  1XTC D;  3DUZ A;  4X65 L;  1F2Y A;  1NY4 A;  1ESR A;  1HQR D;  3OHX C;  2R92 H;  4BXX H;  1IBK Q;  2Q8T A;  4ZKC B;  4LJZ C;  3RLF A;  4YY3 Q;  1HR0 Q;  1SN8 A;  2CQO A;  3T1Y Q;  4NXM Q;  2CW0 C;  4G7O C;  2WB1 G;  2HDM A;  2B2Y A;  2CQA A;  4K8J A;  2E2I B;  3H0G H;  3ZYY X;  4MIU A;  4KMU C;  2HQL A;  2KHI A;  4LUV A;  4PG3 A;  2NWG A;  4KHZ A;  2A19 A;  2EYP A;  3HOY G;  3EIV A;  4KLK A;  4OX9 Q;  4L8J A;  1NJI C;  4K5W A;  1G2T A;  3RUZ A;  3ULL A;  5AFW A;  4A3L H;  4UPA A;  3PF4 A;  3S14 H;  2AKW B;  2A6H D;  4FVM A;  1SRU A;  2K01 A;  2PQE A;  3HOW H;  4IO9 A;  2UUB Q;  4IUR A;  2KUM A;  1WTR A;  4JYA L;  1G6P A;  4OHJ A;  4RHR A;  2KEC A;  4N9P A;  4X6A H;  1LV9 A;  3TP8 A;  2E2I H;  3C2P A;  3BDO A;  2KEE A;  2B2T A;  2PW7 A;  3P20 A;  1YNX A;  2LY7 A;  2AWN A;  2EXZ A;  3OTO Q;  4P73 A;  1RDP D;  4GNX C;  3PUZ A;  1UNS A;  3VA5 A;  4OO1 G;  5HGT A;  3QOL A;  4GZY C;  1LTA D;  1RL2 A;  4DV7 Q;  3ERQ A;  1JWM D;  4GOP C;  4KD3 A;  4RFB A;  2UXC L;  1PH5 A;  3I2Z A;  5I2Y A;  2F0D A;  3UDX A;  4JOI A;  2I5M X;  1AFP A;  1VF7 A;  1GUN A;  1X3F A;  4KK7 A;  1SYE A;  1CFM A;  5M5W H;  1HH2 P;  4NW2 A;  3ND9 A;  4AYB E;  4K6D A;  1OXU A;  3CC7 A;  1EQQ A;  3E9H A;  3S17 H;  5KRU A;  1EQT A;  1PFS A;  2B8G A;  5IYC H;  4TRD A;  2R3Z A;  3HOV H;  2I0Q A;  2RHS B;  4RHS A;  3TP6 A;  3E9I A;  4RH6 A;  4ZLT F;  1Z9F A;  4J6H A;  2Z6K C;  4FYD A;  5LMN Q;  4C3I G;  4QGU A;  3Q8D A;  3HRZ C;  3MFG A;  3H6M A;  1HZA A;  3OOC A;  3WWV A;  1B50 A;  1CM9 A;  3GTO H;  3CCE A;  1MJC A;  1BQQ T;  1L1O B;  4XTC S;  3DEP A;  4PNY A;  2B2V C;  5CR3 A;  3KFU A;  5BN5 A;  1QUQ B;  4BY1 G;  4DK0 A;  1GKH A;  1D5M C;  1S72 A;  2JSO A;  2D0O A;  1EZ8 A;  5H1S E;  2JEA I;  3CCU A;  1J8I A;  3QOJ A;  3I4M H;  3D4W A;  2R7Z H;  4ME3 A;  2QDL A;  4R4Q A;  3LX0 A;  2GVA A;  2Q2U A;  1DON A;  1E24 A;  1LT4 D;  1J5E Q;  3LGJ A;  1EU4 A;  3W1B A;  1RTO A;  3K5M A;  3B6Y A;  3TDQ A;  1KD1 C;  4ME5 A;  3TZU A;  3CCL A;  4CBV A;  3O13 A;  4UDU C;  1EEI D;  1B70 B;  1VCI A;  1C8C A;  1IBM Q;  1GJX A;  1L1O A;  4B3R L;  2B63 B;  2NTS A;  4IJH A;  1P16 A;  1QUQ A;  1VQF A;  2L1B A;  1IKM A;  3HS0 C;  4JI2 Q;  1TWG B;  4QY7 A;  2A73 B;  2EPB A;  1GUO A;  2R92 G;  4BXX G;  2ZT9 C;  2F0P A;  4I65 A;  5L37 A;  1BCP F;  3CCQ A;  1CZG A;  3H0G G;  2X6G A;  2L4N A;  4K14 A;  4MN3 A;  1SMY D;  2E74 C;  4POG A;  3E0E A;  1P8L A;  2OXP A;  1YIT A;  4DNI A;  1L0Y B;  2WFW A;  2L55 A;  4RGN A;  3PO3 H;  3TP7 A;  5IOD A;  1B9M A;  4YCV A;  4A3L G;  4JI5 L;  5IGG A;  2IX1 A;  1HHV A;  2K03 A;  3HOW G;  4GKJ Q;  4ALP A;  2GN5 A;  1A2T A;  2C35 B;  4NMZ A;  2NZ1 D;  5FOB B;  2M2L A;  3M4Y A;  3V2T A;  1PYW D;  3IL8 A;  1CI3 M;  4H02 A;  4GKK Q;  1EQR A;  2LXJ A;  4JI8 Q;  3OW7 A;  1JMC A;  1TY2 A;  1L0X B;  4HJ7 A;  1CKM A;  1SYF A;  2LFN A;  3OMG A;  4IPC A;  1CQF A;  3GTP B;  4G4K A;  4DXG A;  2E5L L;  5I2X A;  5C4J H;  1QNK A;  2WIN B;  4QQB X;  4KI0 A;  1H9J A;  4A3M B;  2XTI A;  3J81 i;  5IGF A;  2R93 B;  3Q0A A;  1STY A;  5C6A A;  3A5Z B;  2F03 A;  2F0F A;  2K1B A;  1GUG A;  3U9S A;  5EQ0 A;  3I4N H;  1I5F A;  5FK9 C;  1CSP A;  4RCN A;  1YHA A;  3BU2 A;  4P2C B;  2WV6 D;  4ULL A;  5JJI A;  5F2D A;  1VQ9 A;  2PW5 A;  3S2H H;  2EXD A;  1MJE A;  2C9O A;  1E7Z A;  2ALY B;  4L5S A;  5IYC G;  3KLS X;  4X62 Q;  3HOV G;  1XPO A;  1HZC A;  4OXP A;  2ZM6 Q;  3K58 A;  4WJW A;  5CV8 A;  1VQC A;  2N49 A;  2CH4 W;  4C3J H;  1ICW A;  5COY A;  4A3M H;  5E4X A;  4CKC A;  2MO1 A;  2E76 C;  1TWC B;  1D5X C;  1NBW A;  5IGE A;  4HJ9 A;  1B1Z A;  4DNT B;  1UE7 A;  3VR3 A;  2F0L A;  1SYD A;  1NE3 A;  5KIX A;  4IFD I;  2AHO B;  2BA0 A;  1ENF A;  3I4M G;  1X3E A;  2R7Z G;  2O2L D;  3CC4 A;  2KA7 A;  3KLR A;  1TS3 A;  2YU9 H;  2G9D A;  1EU3 A;  3KDF B;  2E8G A;  1V9P A;  3PIO 3;  1NAP A;  2AQ1 B;  1S3O A;  1UAP A;  4B3T L;  1I94 Q;  2EYL A;  1VF5 C;  4ZAI A;  4F7X A;  4R1J A;  3FKI H;  2I07 B;  1HA6 A;  1CKN B;  3K5O A;  5DAU A;  3P1H A;  1VQN A;  5CV6 A;  1KDC A;  2QF7 A;  4KY7 A;  2G5D A;  3F1Z A;  1YJN A;  2KHS A;  4R8I A;  2HT1 A;  4OWX B;  1HZB A;  1T9H A;  3J7Z C;  1Q1E A;  2BH8 A;  5EPK A;  3TEH B;  3PIP A;  2J7Z A;  2L9H A;  1B8A A;  3LWE A;  3P75 A;  5EBD A;  4CHT B;  4UP9 A;  3I70 A;  4JI6 L;  1C0A A;  1CQV A;  3W3A A;  3A7L A;  4X64 Q;  1A6X A;  5JVG 3;  2P5Z X;  3PO3 G;  4CGY B;  3PGZ A;  5LMU Q;  1WVL A;  1WJJ A;  2A68 D;  1IXR A;  3BS1 A;  4JVZ A;  1N36 L;  4Q0F A;  1CKN A;  4DAM A;  1F9Q A;  4YWL A;  1Q3L A;  1QOH A;  5LHY 1;  1AZQ A;  2E2J H;  1TXY A;  4LWC A;  2IHE A;  4JI4 Q;  2NN6 H;  3PUV A;  1RTN A;  4KHP Q;  1CK1 A;  1KTK A;  3STB D;  3D4D A;  5IGD A;  4LFC Q;  1RKN A;  5JEA J;  3CCM A;  1XPR A;  3HOU H;  2IHF A;  2TSS A;  2ZTD A;  2L5T A;  3ULP A;  1KNA A;  1IL8 A;  1E3P A;  2I46 A;  3HZX A;  2ICE C;  4OON A;  5ISR A;  3NEM A;  1PYB A;  1HZ9 A;  1ONL A;  1KLU D;  3K81 C;  4EGV A;  4CKE A;  3J81 c;  2UXD Q;  4A76 A;  5J3B A;  4DUY Q;  3I72 A;  3I4N G;  3GTG B;  1VS0 A;  4X3K A;  3E0J A;  1K0S A;  1YEZ A;  3X3M A;  2FXQ A;  4JOI C;  1STH A;  1STA A;  2PZU A;  1JCK B;  4IUP A;  1IZ6 A;  2DY8 A;  2QEX A;  2K05 A;  1BNZ A;  4DR3 L;  2B3G A;  1PMR A;  3J81 L;  4L5T A;  4DV0 Q;  4JBK A;  3A56 A;  1RIP A;  3UE1 A;  1BCP C;  2R61 A;  4R9W A;  1N33 L;  4LFA L;  2ENB A;  4C3J G;  2B2W A;  2HHH L;  5ELN A;  4A3M G;  2G9H D;  4RMF A;  1FL0 A;  2VQE L;  4POF A;  2ZJP A;  3EN2 A;  3CCV A;  1U4P A;  4X66 L;  4A3J B;  2JA5 H;  2X69 A;  1EQV A;  5M5X H;  1O7Y A;  1ET6 A;  1JIC A;  2R7F A;  4DV3 Q;  4A3K B;  1SAP A;  4CJ1 B;  1K3B C;  1TS4 A;  3C46 A;  1I6H H;  1Z6H A;  3A5U A;  1B7Y B;  1IYU A;  2WII B;  3HOY B;  4DAV A;  3A8K E;  2OT2 A;  2PO4 A;  1WOC A;  2K4K A;  5E4W C;  4CDE C;  1LT5 D;  4CJ0 B;  3K5N A;  1S5D D;  2ZTE A;  3OYY A;  3BJU A;  3RZO H;  4TQU S;  4PV1 C;  2WP8 J;  3TRZ A;  4JG2 A;  3BZC A;  2D0P A;  4KN4 C;  4FXD A;  3I7F A;  1IBK L;  2ES2 A;  2ZTC A;  4YHH Q;  1UUP A;  4YY3 L;  5HGQ A;  1HR0 L;  3T1Y L;  4JI7 Q;  4FF1 A;  4HJA A;  1IYV A;  3NSW A;  4HJ5 A;  4DV4 Q;  4NXM L;  1SYG A;  1X56 A;  4A3J H;  1SNM A;  5HY6 A;  5EKK A;  4A3K H;  1FNV A;  3AYH B;  3NTK A;  1LTS D;  3FKI G;  3HOZ H;  4LF5 Q;  3E6Z X;  5C44 B;  4LF4 Q;  2Q8I B;  4OX9 L;  3GTM H;  1PRT D;  2BA1 A;  1A2U A;  1L0W A;  2I5L X;  3SK5 A;  5CV7 A;  1OXS C;  2PMZ B;  3HEJ A;  2F0J A;  1ML0 D;  3Q22 A;  2UUB L;  1BXT A;  1SYB A;  1AH9 A;  1Y8O B;  3J81 E;  2N78 A;  4HN7 A;  1LTG D;  1PZJ D;  3AMU A;  2A6H C;  3L9A X;  3OTO L;  2JEB I;  1TII D;  2IX0 A;  5M5Y B;  5C44 H;  4HCE A;  3SGI A;  3CPF A;  5DEH A;  4BA2 I;  4HSV A;  2NVT B;  4C3I B;  4DV7 L;  1PLF A;  1MSG A;  1ZXT A;  1PFM A;  2MPM A;  2QKI C;  1QJO A;  2NN6 G;  2Y0S B;  4J15 A;  4A3I H;  1JT8 A;  3ND8 A;  1EWC A;  5E7N A;  3J7A V;  1O7Z A;  2K5D A;  2DUD A;  2VZA A;  1RHP A;  4BY1 B;  1VQP A;  3HOU G;  1GM5 A;  3A0J A;  1EUJ A;  3ZJY C;  1SLJ A;  3U4V A;  3V05 A;  1S40 A;  5M5Y H;  2RBM A;  3M85 A;  2DNE A;  3SXH A;  2E75 C;  2AUJ D;  2XRQ D;  3R3O A;  1GD7 A;  2ID0 A;  4KJO A;  5CMD A;  4U67 3;  1I50 B;  4LNQ A;  2F0T A;  3GP7 A;  3KUP A;  5GAE C;  5LMN L;  2FFK B;  3J7A F;  3QJY A;  1J6Q A;  4EQN A;  3GTJ H;  4WFN 3;  1JOO A;  1QVG A;  1GXD C;  2N55 A;  2VW9 A;  3MA2 B;  4KHV A;  4LUO A;  1WTH A;  3TZD A;  2FMM A;  3MWY W;  4H13 C;  5FO7 B;  2ZXP A;  3KBG A;  3CCJ A;  3I55 A;  1H9R A;  4EX5 A;  5M3M H;  1VQM A;  3CPW A;  1CKO A;  5IYB H;  2N88 A;  3I91 A;  5T1G A;  4B08 A;  3G71 A;  3K5L A;  3H0G B;  5EPJ A;  2Q2T A;  2JA5 G;  1WTW A;  2A1A A;  1PH4 A;  1IW7 D;  3I90 A;  1J5E L;  1QB5 D;  1YZ6 A;  3RNU A;  3A8I E;  1Q12 A;  1YHQ A;  3ERO A;  3URY A;  1MBY A;  2A5H A;  1VQL A;  3DM1 A;  2CVR A;  5CBE E;  1FVI A;  2OQ0 A;  2MP1 A;  1IBM L;  3FP9 A;  4NB3 A;  2BH2 A;  1K9M C;  2WB1 E;  3S14 B;  3HOW B;  3IFD A;  5NUC A;  1NTG A;  3A8J E;  4JI2 L;  1Q86 C;  1MI2 A;  1EYG A;  1KL9 A;  2K32 A;  4MNO A;  3S15 B;  3TME A;  2LMC B;  2SEB D;  2E2H B;  1BO0 A;  4A3J G;  1XMQ Q;  1Y8N B;  4DNR B;  4A3K G;  1ZYR D;  1I6V C;  1CTM A;  3M4O H;  4N9T A;  1EEF D;  5CYU A;  3HOZ G;  4QB4 A;  1SE4 A;  4LF8 Q;  1ILQ A;  4GN5 A;  3SHL A;  4FDB A;  1VQ8 A;  1LM0 A;  5FO9 B;  2PNR C;  3A54 A;  1S5B D;  2JN4 A;  4BA1 I;  1PH9 A;  1SMY C;  3HFZ B;  5FLX c;  4JV5 Q;  5IP9 H;  2J0T D;  4BWG B;  1I4X A;  4X3U A;  1N8R C;  1EZ6 A;  1KAW A;  3S15 H;  5M5W B;  4GKJ L;  1TU2 B;  3ULJ A;  2E2H H;  4JI0 Q;  4OO1 I;  1W2B A;  4GKK L;  1V43 A;  1XX8 A;  4HCS A;  3S17 B;  5FLX L;  4JI8 L;  3T4A C;  1VQH A;  2LSS A;  5LL6 X;  3HOV B;  2H4O A;  3M4P A;  3MHB A;  1VMP A;  1A62 A;  3A55 A;  5C44 G;  3S1Q H;  4FO2 A;  4XT1 B;  1E1O A;  1XWE A;  3K59 A;  1PXU A;  4KKU A;  1TT2 A;  2KOL A;  1HJP A;  2PMZ E;  1T5X D;  2XVS A;  3G48 A;  3AQQ A;  4DV6 Q;  2EY2 A;  3GTO B;  5A35 A;  4A3I G;  3K8A A;  1SEB D;  3GTQ B;  3OMC A;  1JE5 A;  3BVM A;  4R4T A;  4OL7 A;  4KN7 C;  1EYC A;  1EFI D;  2KCM A;  4KY6 A;  1WTQ A;  2RHQ B;  1ASY A;  3KOJ A;  3CXC A;  1TQO A;  4O42 A;  4Q5V A;  1PVO A;  4NXN Q;  3I4M B;  3J7A 5;  2R7Z B;  1PRT F;  1RF2 D;  4X62 L;  1SFO H;  4ZK9 B;  2ZM6 L;  3W1G A;  3KF8 B;  3VYR A;  1M90 C;  2D9U A;  1X55 A;  3TP5 A;  1ILP A;  1PYS B;  4QUC A;  3TSS A;  1PFN A;  5C3W A;  2K28 A;  1EYA A;  2Y0S G;  1E2W A;  2IJ0 A;  4H44 C;  3LWU A;  3ER0 A;  3GTQ H;  2ASB A;  1D6E C;  4L6T B;  5CV4 A;  1ROD A;  1SSO A;  2F0E A;  1KRS A;  4AQY Q;  3CU7 A;  4L5Q A;  5M3M G;  2JP1 A;  4WJ3 M;  1A0I A;  1II3 A;  3SVM A;  2ZJQ A;  1GVP A;  2F0G A;  5IYB G;  5IWA Q;  3PSI A;  3K0X A;  4KTA A;  1TWF B;  3DEO A;  4V19 0;  1JB7 A;  3VR2 A;  5IGC A;  3KF8 A;  1X6O A;  3BDL A;  4N8F A;  1Q90 A;  2K14 A;  1HPC A;  4G57 A;  4G7Z C;  3FVQ A;  1I94 L;  3PO3 B;  5JJL A;  2UUC Q;  1TWH H;  3RLN A;  1K0R A;  3GV6 A;  4O0A A;  1F2L A;  3CKI B;  4RGT A;  1Q1B A;  1K73 C;  2NZH A;  2EIF A;  4BBR B;  1JWS D;  1G8Z D;  1TWF H;  1OXT A;  5C0X H;  2WKC A;  4HMI A;  1WD1 A;  3NP8 A;  4JCV E;  2XNA C;  3T56 B;  4OEM B;  4PMC A;  4DV1 L;  1LO5 D;  2IW3 A;  2C5C A;  4A3G H;  1PTO B;  3VYT A;  2JJQ A;  1BR9 A;  5C4J B;  1WI5 A;  1EY4 A;  1PH6 A;  4X64 L;  3N6R A;  4J8Q A;  4X3S A;  5LMU L;  4CKB A;  5IP9 G;  2EJF C;  1ET9 A;  1H9M A;  1ICF B;  2D5D A;  4IUQ A;  3I4N B;  4BBR H;  1A3T A;  2VUM H;  3OW2 A;  4F88 A;  1PH3 A;  2A68 C;  3CRK C;  3M9B A;  4JI4 L;  4JBJ A;  3S2H B;  3VYS A;  4IUU A;  5JVH 3;  4KHP L;  4OGQ C;  5ELB A;  2EY6 A;  1PTO H;  4LFC L;  3D4R A;  4CJ2 C;  2V1C C;  3QB3 A;  2J4X A;  3MFY A;  5D3I B;  4C3J B;  5KEE A;  2VXW A;  1HR0 W;  2BDN A;  2K52 A;  3EBE A;  3Q6S A;  3R8B A;  3RN2 A;  1YI2 A;  1PH1 A;  1PHJ A;  1HNX Q;  1SE8 A;  2XGT A;  4YWM A;  3PIO A;  2CCZ A;  1D7Q A;  3HG9 A;  3STB C;  1EY5 A;  4IUT A;  1EY7 A;  4B3M Q;  2DJG C;  5ELC A;  1STE A;  3MTS A;  2F4V Q;  2UXD L;  1JWU D;  5IT9 c;  4DUY L;  2H5X A;  3H3V H;  1CA6 A;  2QDB A;  2MFI A;  3K7U C;  3NQT A;  2MJ8 A;  4CDF C;  4IAL A;  2F0W A;  4RKL A;  1MSH A;  4K5X A;  1CHQ D;  4ZQ3 A;  5E1F A;  5AJ3 L;  5GAD C; 
#chains in the Genus database with same CATH homology
 1FJG Q;  1YEZ A;  4APV A;  2FXQ A;  1N9W A;  4DV0 L;  1IBL Q;  3FHW A;  4JOI C;  2NVT H;  3I4O A;  4NPS A;  5IP7 H;  4C3I H;  3L0O A;  1XMO L;  2DGY A;  1IZ6 A;  4YCU A;  4IPD A;  2QEX A;  2KCT A;  4DV2 Q;  4JBM A;  1K83 H;  4AIM A;  4AYB G;  2VQF L;  4DR3 L;  3D0F A;  1Q7Y C;  2B3G A;  2Z0S A;  4L5T A;  4DV0 Q;  4JBK A;  1RIP A;  3UE1 A;  1Z47 A;  1VQJ A;  2F3I A;  1XMO Q;  1JJC B;  1N33 L;  4DR1 L;  4LFA L;  2VQF Q;  4DR3 Q;  3GO5 A;  2HHH L;  5ELN A;  2CKZ B;  3GTL H;  4R4C A;  4A3M G;  4RMF A;  1FL0 A;  2VQE L;  4IOC A;  3GTK H;  4GLV B;  4BY1 H;  4POF A;  2ZJP A;  1YJW A;  2OWO A;  1N33 Q;  4DR1 Q;  4TVA B;  4LFA Q;  3EN2 A;  4DV3 L;  3CCV A;  1IL2 A;  3PO2 G;  1PH1 A;  4IOA A;  1N32 L;  2HHH Q;  4X66 L;  1PV4 A;  2VQE Q;  4LFB L;  2JA5 H;  4BBS H;  5M5X H;  2R7F A;  4DV3 Q;  4A3E G;  1N32 Q;  2AWO A;  2QA4 A;  1I6H H;  1OXX K;  3A5U A;  1B7Y B;  4JI3 L;  4X66 Q;  4LF9 L;  1LYL A;  1Y1W H;  4HIO A;  3S1R H;  4LF6 L;  2IY5 B;  1BVS A;  4GLX A;  3TQY A;  1WOC A;  1I50 H;  2N8N A;  1G29 1;  2K4K A;  1Y1V G;  4JI3 Q;  3NEN A;  4LF9 Q;  1C9O A;  3MXN B;  4LF6 Q;  1QZH A;  1A8V A;  2ZTE A;  3OYY A;  3BJU A;  3RZO H;  3F2C A;  1FGU A;  4TQU S;  4YCW A;  4YHH L;  1YBY A;  2MO0 A;  5FLM G;  2WP8 J;  3J81 j;  4JI7 L;  3TRZ A;  4JG2 A;  3BZC A;  4DV4 L;  5ELO A;  2D0P A;  2K75 A;  4P75 A;  4LUZ A;  1L2F A;  2R7D A;  4IPH A;  4DAY B;  3I7F A;  3TRE A;  1N34 L;  1UEB A;  1IBK L;  2ZTC A;  4YHH Q;  4YY3 L;  5C0X J;  5HGQ A;  2CWP A;  3T1Y L;  1HR0 L;  1EIY B;  4HJA A;  4JI7 Q;  4X65 L;  5BR8 L;  1NY4 A;  4DV4 Q;  4HJ5 A;  1C7Y A;  4A3J H;  1X56 A;  4NXM L;  5HY6 A;  2HIV A;  1M1K C;  5LMN W;  4LF5 L;  2R92 H;  4BXX H;  4A3K H;  1N34 Q;  1IBK Q;  3AFP A;  5GRO A;  4YY3 Q;  3RLF A;  1HR0 Q;  3AYH B;  1SN8 A;  2CQO A;  3T1Y Q;  4LF4 L;  3FKI G;  4X65 Q;  5BR8 Q;  4LFC Q;  4NXM Q;  3HOZ H;  2WB1 G;  4A75 A;  1YIJ A;  2JA7 H;  4LF5 Q;  3H0G H;  4RG1 A;  4UP7 A;  4LF4 Q;  5C0X G;  2HQL A;  5GAH C;  1QVC A;  4DV1 Q;  2KHI A;  4DUZ L;  4LUV A;  4OX9 L;  4PG3 A;  3GTM H;  2EQS A;  2IT1 A;  4KHZ A;  2BA1 A;  2A19 A;  1PH8 A;  4A3G G;  2MQH A;  3T1H L;  1L0W A;  1H95 A;  3D31 A;  2I5L X;  3DLL A;  1PH7 A;  3EIV A;  4C2M H;  4L5R C;  1VQB A;  4KLK A;  3CF5 A;  4DUZ Q;  4A3F H;  4OX9 Q;  1X54 A;  1OXS C;  2A8V A;  1PA6 A;  1NJI C;  3CD6 A;  3T1H Q;  1K8A C;  2UUB L;  3KJP A;  3ULL A;  1GO3 E;  3PV0 A;  4A3L H;  4UPA A;  3MEF A;  1AH9 A;  3PF4 A;  3S14 H;  3S1M H;  2AKW B;  2N78 A;  1SRU A;  3HOW H;  3W5O A;  3CQZ H;  4IO9 A;  2UUB Q;  4DV5 L;  2HIX A;  4DPG A;  3G6E A;  4JYA L;  1G6P A;  2B63 H;  3OTO L;  2JEB I;  2JA8 H;  4BBR G;  4X6A H;  2ES2 A;  2IX0 A;  1Q46 A;  4P71 A;  2E2I H;  2VUM G;  3I56 A;  4DV5 Q;  5C44 H;  3HOY G;  1TWG H;  1KHI A;  1YNX A;  3SGI A;  2AWN A;  3CPF A;  2ZJR A;  1VQK A;  3OTO Q;  4BA2 I;  4JYA Q;  1CSQ A;  4P73 A;  4JI1 L;  3PUZ A;  3CW2 C;  4GNX C;  3UDG A;  4OWW B;  1SRO A;  4DV7 L;  4OO1 G;  4JI1 Q;  2NN6 G;  4R4O A;  1RL2 A;  1MKH A;  4DV7 Q;  1JT8 A;  4J15 A;  4A3I H;  4GOP C;  3HKZ G;  5E7N A;  2UXC L;  1PH5 A;  3I2Z A;  1XNQ L;  1OTC A;  3UDX A;  5C3E G;  4JOI A;  2DUD A;  2I5M X;  2VZA A;  2PI2 A;  2Q2H A;  1X3F A;  1VQP A;  3HOU G;  1GM5 A;  3A0J A;  2UXC Q;  1XNQ Q;  4IJL A;  2YTX A;  3KYH C;  1XPU A;  4A3C H;  1EUJ A;  5M5W H;  3ZJY C;  1SLJ A;  3PF5 A;  1HH2 P;  3U4V A;  1S40 A;  5M5Y H;  4UP8 A;  2Z6K A;  3K80 C;  4AYB E;  1VQ7 A;  3M85 A;  1HNW L;  4DR7 Q;  3PUY A;  3PUX A;  2NVQ H;  3UE0 A;  1OXU A;  3CC7 A;  3RZD H;  1EQQ A;  1K8G A;  1GD7 A;  3E9H A;  2ID0 A;  1D7Q A;  3S17 H;  3F2D A;  5AJ3 Q;  5K36 G;  3KJO A;  4LNQ A;  1HNW Q;  1PFS A;  1SR3 A;  4O2D A;  5IYC H;  5GAE C;  1SMX A;  3JAM i;  5LMN L;  3HOV H;  2I0Q A;  2RHS B;  1J6Q A;  4A3B H;  3E9I A;  4GS3 A;  3GTJ H;  4BY7 G;  4K0K L;  1QVG A;  2VW9 A;  1Z9F A;  4P74 A;  1W3S A;  2KEN A;  2OCE A;  2Z6K C;  4LUO A;  5IP7 G;  5LMN Q;  4MZ9 A;  3Q8D A;  5GAG C;  4QGU A;  3GD7 A;  4K0K Q;  1Q81 C;  1HZA A;  3GTP H;  3WWV A;  3CCJ A;  4MTN A;  4GN3 B;  1NMG A;  4DR5 L;  3I55 A;  4GLA C;  3JAM c;  3U58 A;  1VQE A;  3GTO H;  3CCE A;  4EX5 A;  1MJC A;  5M3M H;  1VQM A;  1D8L A;  3CPW A;  1L1O B;  4XTC S;  1CKO A;  3KFU A;  5IYB H;  1QUQ B;  2R93 H;  1UE6 A;  4BY1 G;  4LFB Q;  1KIX A;  3G71 A;  1GKH A;  3PUW A;  5C4X H;  1S72 A;  2D0O A;  2L15 A;  2Q2T A;  2JEA I;  5H1S E;  2JA5 G;  4YWK A;  3CCU A;  1KQS A;  2A1A A;  1PH4 A;  1XJV A;  4QJF A;  4BBS G;  4C3H H;  3I4M H;  1J5E L;  3RR5 A;  2R7Z H;  1YZ6 A;  4ME3 A;  3RNU A;  3M3Y H;  1Q12 A;  4R4Q A;  1YHQ A;  1Y1W G;  2GVA A;  2Q2U A;  1E24 A;  3CCS A;  1LUZ A;  1J5E Q;  3LGJ A;  1VQL A;  3UDI A;  3W1B A;  2BH2 A;  1FVI A;  2OQ0 A;  4GNX B;  1IBM L;  3FP9 A;  2CWA A;  3B6Y A;  4NB3 A;  3HOX H;  4AH6 A;  1KD1 C;  1K9M C;  4IFD G;  3CCL A;  2WB1 E;  1VCI A;  1B70 B;  1IBM Q;  1VQ6 A;  2VNU D;  1NTG A;  4DR6 Q;  4DK3 C;  1L1O A;  4JI2 L;  1Q86 C;  4B3R L;  3CP0 A;  1XMQ L;  3ERS X;  1KL9 A;  1EYG A;  1TWC H;  4IJH A;  4MNO A;  4GOP B;  2UXB L;  5C0X I;  1P16 A;  1A63 A;  1QUQ A;  1VQF A;  1XTD A;  4JI2 Q;  4HJ8 A;  4A3J G;  4B3R Q;  4QY7 A;  1XMQ Q;  4LF8 L;  3H15 A;  2R92 G;  4BXX G;  4A3K G;  2UXB Q;  3M4O H;  1QZG A;  2YTV A;  3J80 i;  3HOZ G;  4JV5 Q;  1L1O C;  4LF8 Q;  3CCQ A;  2JA7 G;  4GN5 A;  4PZ8 A;  1LTL A;  3H0G G;  4FDB A;  4QL5 A;  1VQ8 A;  4JV5 L;  4P72 A;  5EAY A;  1LM0 A;  4HID A;  3AFQ A;  4BA1 I;  4GNX A;  1VQO A;  1PH9 A;  4POG A;  3E0E A;  3HFZ B;  3U4Z A;  1EWI A;  1P8L A;  5IP9 H;  5FLX c;  3PCO B;  4R4I A;  4A4I A;  3J80 c;  2CFM A;  1YIT A;  3S1N H;  3JC6 6;  4DNI A;  4A3F G;  1N8R C;  4UY8 C;  4A3D H;  2WFW A;  1KAW A;  3PO3 H;  4DR2 L;  4JI0 L;  3S15 H;  3DM3 A;  4GKJ L;  3KDF A;  4YCV A;  1DGS A;  4QIW E;  3ULJ A;  2E2H H;  4A3L G;  4GOP A;  4JI5 L;  2IX1 A;  1UE1 A;  2OTL A;  1JJ2 A;  4DR2 Q;  1TWA H;  1WYD A;  4JI0 Q;  3HOW G;  4GKJ Q;  4OO1 I;  4ALP A;  1W2B A;  5FJ8 H;  2GN5 A;  1Q82 C;  2MNA A;  1V43 A;  5M3F H;  1PHJ A;  2C35 B;  2CCZ A;  4GKK L;  1E1T A;  4OWT B;  4JI8 L;  3UDF A;  4JI5 Q;  1AE2 A;  3HKZ E;  1VQH A;  2LSS A;  4LF7 L;  1I3Q H;  2RCN A;  2VY3 A;  3M4P A;  4H02 A;  4GKK Q;  1A62 A;  3CMA A;  5C44 G;  1EQR A;  3S1Q H;  2LXJ A;  1E1O A;  2RF4 A;  2PNH A;  4JI8 Q;  4DV6 L;  3M4Q A;  1JMC A;  1ASZ A;  4HJ7 A;  4BY7 H;  1CKM A;  5IYD H;  1HJP A;  2PMZ E;  2JA9 A;  4IPC A;  2PI2 E;  3G4S A;  3G48 A;  3AQQ A;  4DV6 Q;  3RN5 A;  2OTJ A;  2E5L L;  5C4J H;  3F2B A;  3S2D H;  4A3I G;  3K8A A;  4QQB X;  4KI0 A;  1JE5 A;  2XTI A;  3H3V I;  4A93 H;  3J81 i;  4R4T A;  4PZ6 A;  2E5L Q;  5DLQ E;  2KCM A;  2I5H A;  5IY0 A;  4NXN L;  1WCM H;  3A5Z B;  1QVF A;  2RHQ B;  4A3C G;  3I4N H;  1Y14 B;  1I5F A;  2LXK A;  1ASY A;  3KOJ A;  3CXC A;  1KXL A;  1X3G A;  1PVO A;  1CSP A;  1YVC A;  1NMF A;  4DK6 C;  1KC8 C;  4NXN Q;  3J7A 5;  1CUK A;  1YHA A;  3BU2 A;  5JJI A;  1VQ9 A;  3NBH B;  4X62 L;  2VS1 A;  2NVX H;  2F52 A;  1SFO H;  3S2H H;  2EXD A;  1MJE A;  2VL6 A;  2WAQ G;  1BBW A;  2ZM6 L;  3KLW A;  1E7Z A;  2JK8 A;  3KF8 B;  3W1G A;  1M90 C;  2ALY B;  3M7N A;  4L5S A;  1O7I A;  5IYC G;  4X62 Q;  4DV2 L;  1XNR L;  1X55 A;  3HOV G;  1XPO A;  5GQO A;  1HZC A;  1PYS B;  1U0L A;  1YHB A;  4OXP A;  3CC2 A;  4A3B G;  2ZM6 Q;  2Y0S G;  1IYJ B;  1VQC A;  2N49 A;  4C3J H;  3GTQ H;  3ER0 A;  2Q2I A;  4A3M H;  4XIG S;  2ASB A;  1XNR Q;  4AQY L;  4DR5 Q;  3VDY A;  3CAM A;  2MO1 A;  3GDE A;  3L2P A;  3CCR A;  1U5K A;  1VQ5 A;  3PO2 H;  1NBW A;  1EOV A;  4HIM A;  2K5V A;  1HNZ L;  1KRS A;  4HJ9 A;  5IWA L;  4AQY Q;  2K5H A;  4L5Q A;  5M3M G;  2B29 A;  4WJ3 M;  4A3E H;  4IFD J;  1A0I A;  1UE7 A;  2ZJQ A;  1GVP A;  1HNZ Q;  1X9N A;  5IYB G;  2R93 G;  5IWA Q;  3PSI A;  3RLO A;  2R6G A;  3K0X A;  5C4X G;  2JA8 G;  1NE3 A;  1BBU A;  1Y1V H;  4HIK A;  1JB7 A;  3GTG H;  4IFD I;  2AHO B;  2JE6 I;  4LW1 A;  2BA0 A;  1VQD A;  3NEL A;  3I4M G;  4GN4 B;  1X3E A;  3KF6 B;  4IPG A;  1X6O A;  4JBW A;  2R7Z G;  4DR4 L;  3CC4 A;  2UUC L;  5FLM H;  2K14 A;  3A74 A;  2YU9 H;  2B63 G;  1VQA A;  3KDF B;  1I94 L;  1EIF A;  2E8G A;  1V9P A;  3K7A H;  4DR4 Q;  5JJL A;  2JA6 G;  1UE5 A;  2UUC Q;  1S3O A;  1TWH H;  3HOX G;  3RLN A;  3AEV A;  1K0R A;  3TS2 A;  3L7Z C;  4B3T L;  1I94 Q;  3S24 A;  4O0A A;  4Y52 H;  4R1J A;  1PH2 A;  3FKI H;  1Q1B A;  4Y7N H;  1K73 C;  2NZH A;  2EIF A;  3BZK A;  2UUA L;  4B3T Q;  1BKB A;  1CKN B;  2KBN A;  1UWV A;  5JJK A;  2K50 A;  3ICE A;  3S16 H;  1TWF H;  1OXT A;  1OXV A;  1VQN A;  2UUA Q;  4JCV E;  2JA6 H;  2D62 A;  3F1Z A;  4DV1 L;  1YJN A;  1R9T H;  3HOY H;  2HT1 A;  4A3G H;  3KF6 A;  4OWX B;  1HZB A;  1T9H A;  2AMC B;  2JJQ A;  3J7Z C;  1Q1E A;  2BH8 A;  1YJ9 A;  3TEH B;  3IRB A;  3PIP A;  1WI5 A;  1JJG A;  1B8A A;  1PH6 A;  4X64 L;  5IE8 A;  1G51 A;  1Q8K A;  2OQK A;  4UP9 A;  5LMU L;  3F8T A;  4JI6 L;  1C0A A;  5IP9 G;  4X64 Q;  4A3D G;  2NVY H;  3PO3 G;  1V1Q A;  2NN6 I;  3PGZ A;  4BBR H;  5LMU Q;  1WJJ A;  4JI6 Q;  1IXR A;  2VUM H;  4EQ5 A;  3OW2 A;  3U50 C;  2YV5 A;  1N36 L;  2JQO A;  1PH3 A;  1CKN A;  4B3S L;  4DAM A;  2PQA B;  3M9B A;  4JI4 L;  4YWL A;  2UU9 L;  2N3S A;  2E2J H;  4LF7 Q;  4JBJ A;  4JC0 A;  5FJ8 G;  1TXY A;  4LWC A;  5M3F G;  3TS0 A;  1N36 Q;  2NZO A;  4KHP L;  1KRT A;  4B3S Q;  2IHE A;  4JI4 Q;  4DR6 L;  4LFC L;  1E22 A;  2UU9 Q;  1HNX L;  2V1C C;  3PUV A;  2ATW A;  4KHP Q;  1HR0 W;  4B3M L;  2K52 A;  3EBE A;  3STB D;  3RN2 A;  1YI2 A;  5IYD G;  1AE3 A;  1K3R A;  1WFQ A;  5C3E H;  1SE8 A;  2XGT A;  4YWM A;  5JEA J;  4DKA C;  3PIO A;  1VQ4 A;  1HNX Q;  3CCM A;  2F4V L;  3STB C;  1XPR A;  4PZ7 A;  3HOU H;  2IHF A;  2ZTD A;  2K5N A;  3ULP A;  4B3M Q;  1E3P A;  1MIU A;  4OON A;  3NEM A;  2YYZ A;  2F4V Q;  2QGQ A;  1PYB A;  3HKS A;  1HZ9 A;  2UXD L;  5IT9 c;  2WAQ E;  3CME A;  4DUY L;  4A93 G;  3K81 C;  2H5X A;  2YTY A;  2GVB A;  1VQG A;  3H3V H;  3J81 c;  5JEA G;  2MFI A;  3K7U C;  2KHJ A;  4A76 A;  1WCM G;  2UXD Q;  5J3B A;  4DR7 L;  1VQI A;  2PQA A;  4PMW A;  4DUY Q;  1IBL L;  1X65 A;  2Y0S E;  1FJG L;  4WJ4 A;  3I4N G;  1VS0 A;  5AJ3 L;  1EFW A;  5GAD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...