4MZ9A

Revised structure of e. coli ssb
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
publication title Intramolecular binding mode of the C-terminus of Escherichia coli single-stranded DNA binding protein determined by nuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4mz9A00
2LXJA 3TREA 2E2JH 3J7ZC 3BZKA 4LF4L 1NE3A 2E2HH 3H3VH 4JI7L 4K0KQ 4GLAC 4Y7NH 4A3EG 4B3MQ 3NENA 3DM3A 5LMNQ 5IYDH 4JI5Q 4PMWA 4DR2Q 4B3SQ 5AJ3L 4C3IH 4HJ9A 4LFAQ 4MZ9A 2PQAB 1IBLQ 4DR4Q 4WJ3M 4X6AH 3G71A 2RF4A 2MO1A 4JBWA 3UDGA 4A3GG 3UDIA 3HOYG 2JA6H 4IOAA 2F52A 2JA8H 4LWCA 3HOWH 1TWCH 1VQIA 4AYBG 1N33L 3CPFA 4OWWB 3AEVA 3BJUA 4A3MH 5IWAQ 1N36Q 4A3BG 4A3JG 3K7AH 4X64Q 4K0KL 4B3ML 1W2BA 5LMNL 1IBKQ 3RZDH 1E7ZA 4DR2L 4B3SL 4KHPQ 4DAYB 4TQUS 2N3SA 2YTYA 5IY0A 4IPHA 1YI2A 1PH5A 4LFAL 1IBLL 2VW9A 4LNQA 1AE2A 1UEBA 1J6QA 4X65Q 3CD6A 1E3PA 2F3IA 1PV4A 2YV5A 1PYBA 1YJWA 1I94Q 5IYDG 2VQFQ 1N32Q 2BA0A 2VS1A 3CC7A 2ZTDA 1UE1A 1SR3A 3CC2A 4P74A 4JBMA 2ALYB 4X66Q 5IWAL 2IT1A 4MTNA 5IE8A 1VQOA 4X64L 1N36L 2CQOA 1KQSA 3E9HA 2JA6G 4UP9A 3VDYA 4DV1Q 2JA8G 3ICEA 1IBKL 1WJJA 4KHPL 1HZAA 1N9WA 4P71A 1M90C 2BH2A 3KFUA 2OCEA 2VL6A 1K73C 1KHIA 2VNUD 4LW1A 3PCOB 4X65L 5JEAJ 3AQQA 1MJEA 3L0OA 1L2FA 2Y0SE 2VQFL 1YEZA 1I94L 2JA5G 4JV5Q 1N32L 4Y52H 1BKBA 2D62A 2R6GA 1K83H 3PUYA 2HQLA 1PHJA 3D31A 1WOCA 3M4PA 1KD1C 4X66L 1PH1A 1VQKA 3K0XA 1YZ6A 1EOVA 2LXKA 4JI0Q 4DR6Q 2CWPA 4DV1L 4NXMQ 2YU9H 4LFBQ 2KHJA 2VZAA 5M3MG 2FXQA 1PH7A 1KAWA 1WCMG 1N34Q 2UUAQ 2NVQH 3J80c 4YWLA 3W1GA 1NMFA 2JE6I 3T1YQ 2ZJRA 1OXVA 2ASBA 4A93H 3STBC 2WB1G 3G48A 3EBEA 4JV5L 4UP7A 3PO3H 1K3RA 4P72A 1FJGQ 3S2DH 1L1OC 1CKNB 3KDFA 1QZHA 1Q7YC 3J7A5 4A3CH 4APVA 1CSQA 1E1TA 3F1ZA 3SGIA 4DR6L 1HZ9A 5H1SE 2UU9Q 3TEHB 3K8AA 1E24A 5EAYA 4BY1G 5C3EH 4LFBL 2Z0SA 3S15H 4UP8A 4JI3Q 2UUAL 4MNOA 4OWTB 2QA4A 3KYHC 2EIFA 4DKAC 3T1YL 3J81c 3A74A 1QVGA 1EFWA 1NY4A 2JEBI 4A75A 4DV6Q 3ER0A 1BBWA 3BZCA 2ZTCA 1XMQQ 1S72A 3HOVH 2KBNA 1T9HA 2XTIA 4JI6Q 1FJGL 3J80i 1XJVA 1C7YA 4PZ7A 4JI1Q 2L15A 4IPGA 2B63H 2ID0A 4A93G 2CFMA 4OXPA 3PO3G 4BXXG 1XPUA 2UU9L 3TS0A 1PH9A 1G6PA 4H02A 3ULJA 2K5VA 2VQEQ 4GOPB 4JI3L 1YITA 3CCLA 4BY7H 1MJCA 1JE5A 2UUBL 1Q46A 4DV2Q 1Z47A 4POGA 4DV7Q 5GQOA 3KLWA 3U4ZA 2PMZE 3NEMA 4DV6L 2MQHA 3G4SA 5C3EG 3CCSA 1XMQL 4PZ8A 3CCRA 1QVFA 4JI6L 1NBWA 4J15A 1YBYA 4HIKA 2CWAA 4LF9Q 2NVTH 2Y0SG 2A8VA 4LF7Q 1X9NA 3J81i 4A3LG 4JI8Q 1KRSA 2DGYA 3STBD 5M5WH 3HOVG 4A3IH 4A4IA 1L0WA 4GNXC 3HOYH 1C9OA 2VQEL 1Q12A 3M4OH 1WYDA 4JBKA 3I7FA 4JC0A 4DV2L 2B63G 4DV7L 1FVIA 1FGUA 1G291 1UE5A 3F2DA 4A3DG 4OWXB 3ZJYC 2K52A 1V9PA 1C0AA 2YTXA 3K7UC 4YWKA 4DV5Q 1QUQB 3RNUA 4OONA 2MNAA 1OXXK 4LF9L 1LTLA 4JBJA 4O0AA 1QUQA 1KRTA 3F2CA 1VS0A 4LF7L 1TWAH 1SROA 4AQYQ 2R92G 4JI8L 1A8VA 2IHEA 2NZOA 4GNXA 1FL0A 4JYAQ 1VCIA 3M85A 2XGTA 3BU2A 2WB1E 4QGUA 3KOJA 4GN4B 4JG2A 4WJ4A 1Z9FA 4YCWA 5IYCG 4GLXA 1HNZQ 1NJIC 1VQBA 4GN3B 4A3IG 4UY8C 3CAMA 4DV5L 3HOXG 3D0FA 1JB7A 4R1JA 1LM0A 2R93G 1GKHA 1AH9A 1PH8A 1KIXA 4PZ6A 1HR0L 3FHWA 4AQYL 3GTQH 1VQ4A 1G51A 4JYAL 2JA5H 2UXCQ 5JJLA 1X65A 4L5RC 2OTJA 3HFZB 3I4NG 1SMXA 3TRZA 4ME3A 4R4OA 1HNZL 1YJNA 2OWOA 3UE1A 1GVPA 3CPWA 3CMAA 1HZBA 2GVAA 2V1CC 2C35B 3AFPA 2B3GA 2Q2TA 5M3MH 1HH2P 1K8GA 1CSPA 1WCMH 2B29A 3HKSA 1XPOA 1UWVA 4YHHQ 2UXBQ 1V43A 3PUXA 1YNXA 1LYLA 2PNHA 1YHQA 1MKHA 1P8LA 2UXCL 2KENA 3U4VA 4QJFA 5C44G 1NTGA 1Q1BA 2D0OA 5C4XG 1W3SA 4HIOA 4OO1I 1EIFA 5K36G 1UE7A 5IP9G 3JC66 4P75A 1Y1WH 1EQRA 1Q86C 5M3FG 1PA6A 4BY1H 2AWNA 1A63A 3KF6A 3H0GG 1O7IA 4YHHL 2UXBL 4L5TA 1IL2A 1EUJA 2R7FA 4RMFA 1SLJA 4YY3Q 3L2PA 4DNIA 4DR5Q 2HT1A 4BA2I 1Y14B 4R4CA 3RN2A 4YWMA 1GM5A 2OQ0A 3LGJA 3PIOA 1WFQA 4YCUA 3ULLA 3GDEA 2K50A 5M5XH 4XTCS 1VQ9A 2N8NA 3KDFB 4PG3A 1VQEA 4BXXH 5M5YH 5GAHC 2NVXH 1X54A 1XNQQ 2MO0A 1N8RC 1CKMA 3I56A 1RL2A 3CCJA 1Y1WG 2Q2HA 1OTCA 4IFDG 4YY3L 4DR5L 3PUVA 4GN5A 3S2HH 1EYGA 4OO1G 2D0PA 1K0RA 1WI5A 4DR1Q 3CC4A 2I5MX 1TWFH 2UUBQ 1S40A 3KF8B 4DPGA 3GD7A 4DV3Q 1L1OB 5C4JH 4JI2Q 3S1MH 2A19A 4A3LH 3PO2H 1DGSA 5GROA 4BA1I 4DUYQ 2N78A 1L1OA 3HOZH 3AYHB 1XNQL 2JEAI 5IP7G 3GTMH 3UE0A 4IPCA 1HNXQ 4O2DA 5GADC 2IX1A 3CCUA 2OTLA 1KC8C 1AE3A 3CP0A 4A3DH 5J3BA 3PF4A 2JQOA 4C2MH 1OXTA 3S1NH 1HJPA 1Y1VH 1JJ2A 1LUZA 4DR1L 5ELNA 4C3HH 3U50C 5JJKA 3MEFA 4DV3L 3OW2A 1V1QA 2Z6KC 1KXLA 2JJQA 4GKKL 1XPRA 1D8LA 4IO9A 3RN5A 4NPSA 1RIPA 2ES2A 4JI2L 2R92H 3S24A 2E2IH 4DUYL 1YHBA 1OXSC 1SFOH 4NXNQ 1NMGA 1HNXL 5ELOA 2E5LQ 2E8GA 1JJCB 2HHHQ 2RHSB 2IHFA 5IYCH 4LF8Q 2JK8A 1VQCA 4C3JH 4HJAA 3S17H 3I55A 3HOZG 3B6YA 3PO2G 1IZ6A 3K81C 2R7ZH 4LUZA 2K75A 3H15A 1ASZA 3HOXH 4DK6C 5JJIA 1HZCA 2QGQA 3UDFA 5HY6A 2R93H 3AFQA 3CCVA 1HR0W 3K80C 2MFIA 1XNRQ 4TVAB 2WP8J 3CXCA 1YJ9A 1K9MC 2UUCQ 1Y1VG 1B7YB 1GO3E 1PFSA 1U5KA 1X3EA 4NXNL 1XMOQ 1Q82C 3J81j 1JT8A 5FJ8G 3FKIH 4HJ5A 2E5LL 4GNXB 2PI2A 2HHHL 4UPAA 1HR0Q 3I4NH 4LF8L 4GKJL 2WAQE 2ZJPA 1VQMA 3M4QA 1YHAA 1M1KC 4JI4Q 3GTPH 1OXUA 2NVYH 2Q2IA 3FP9A 5HGQA 1XNRL 2ZM6L 2AMCB 3GTKH 2UUCL 2R7ZG 4FDBA 1XMOL 1VQ6A 1TWHH 5C44H 3GTGH 2R7DA 1I50H 4BBSH 3PV0A 1IYJB 1Q1EA 4IJHA 2ZTEA 1VQPA 3HKZG 5IP9H 4GKJQ 2LSSA 3FKIG 2I5LX 1D7QA 1PH2A 4QQBX 5M3FH 4DV0Q 4LUOA 4JI4L 1MIUA 2I5HA 4NB3A 3JAMc 3T1HQ 3H0GH 5FLXc 2K4KA 2RHQB 3DLLA 4L5QA 4R4IA 1E1OA 2ZJQA 1YVCA 4EX5A 2PQAA 4DR3Q 3RLNA 1PH3A 1J5EQ 2VY3A 3GO5A 4JCVE 4R4QA 3TQYA 4KLKA 5LMUQ 5GAEC 1CKOA 1R9TH 2DUDA 4DR7Q 5IYBH 4A3FG 1VQFA 4B3TQ 5C0XI 1Q8KA 3PIPA 3CCQA 2JA7H 1JJGA 3RLOA 2IX0A 2K5HA 1PH4A 1JMCA 4IFDI 3PSIA 4IOCA 4DV0L 4JI5L 2K14A 3S1QH 4BBSG 3MXNB 3CCEA 3T1HL 3F2BA 1UE6A 3IRBA 1I6HH 4DR4L 1Q81C 4B3RQ 3KF6B 3CW2C 1IBMQ 3M3YH 1HNWQ 3CMEA 4DR3L 1VQ5A 3ULPA 1GD7A 2YTVA 3KJOA 3A0JA 2BH8A 5LMUL 1J5EL 4DR7L 2KHIA 3JAMi 1SRUA 2GN5A 4X62Q 4HJ8A 4LUVA 4B3TL 3OYYA 1K8AC 3RZOH 3UDXA 5IT9c 4POFA 3HOUH 1PH6A 1X6OA 2GVBA 1I3QH 3NBHB 3E0EA 4QIWE 3WWVA 3GTJH 3HOWG 2WAQG 5IP7H 2HIVA 3G6EA 5IYBG 3S16H 2HIXA 4DUZQ 4A3MG 1EQQA 1EIYB 2JA7G 3I4MH 3PF5A 2AHOB 4XIGS 3W1BA 3KJPA 4LF6Q 4B3RL 1IBML 1HNWL 2IY5B 2EXDA 4KHZA 3CCMA 5C0XG 2VUMH 3GTLH 1ASYA 3CF5A 1B70B 2KCTA 4X62L 3PUWA 2JA9A 3S1RH 2NN6I 5C4XH 4IJLA 3PUZA 4ALPA 1E22A 1TWGH 2N49A 1VQDA 1X55A 1VQHA 4DUZL 1X3GA 5FLMH 3GTOH 1XTDA 3ERSX 4BBRH 2K5NA 4GKKQ 1VQ7A 4L5SA 4LF6L 3HOUG 4DV4Q 5BR8Q 4QY7A 2F4VQ 4HJ7A 3HKZE 4IPDA 4GS3A 4OX9Q 3I4MG 3E9IA 2ATWA 3I2ZA 4JI0L 1VQJA 4JOIC 4P73A 1CKNA 4NXML 2VUMG 3M9BA 5FJ8H 1N34L 1CUKA 3EIVA 4GLVB 3S14H 4DV4L 1BBUA 4KI0A 4AYBE 2CKZB 2CCZA 3M7NA 5BR8L 1TXYA 1VQAA 1SE8A 4R4TA 4GOPC 1A62A 3U58A 2F4VL 1S3OA 4A3KH 2NN6G 2Q2UA 5FLMG 4OX9L 4BBRG 1A0IA 1EWIA 3OTOQ 4DAMA 2I0QA 2AKWB 1IXRA 4JOIA 4DK3C 1H95A 2RCNA 1I5FA 4HIMA 4YCVA 2UXDQ 2H5XA 2Z6KA 1SN8A 4EQ5A 1PYSB 3A5UA 4A3CG 4QL5A 4RG1A 1B8AA 2ZM6Q 1KL9A 3PGZA 3F8TA 4GOPA 4LF5Q 1VQ8A 3L7ZC 5DLQE 5JEAG 4LFCQ 1PVOA 2A1AA 4A3EH 2EQSA 3EN2A 1X3FA 3NELA 1VQNA 2BA1A 3OTOL 1BVSA 1QZGA 3W5OA 4JI1L 1P16A 4LF4Q 3A5ZB 1YIJA 1VQLA 4JI7Q 2QEXA 4AH6A 4A3KG 2UXDL 1U0LA 4A3GH 4HIDA 2NZHA 3Q8DA 2AWOA 3RLFA 1VQGA 3RR5A 4A76A 3TS2A 2WFWA 5AJ3Q 1QVCA 4A3FH 4LF5L 3I4OA 4LFCL 4A3BH 4A3JH 5C0XJ 2PI2E 1X56A 2KCMA 5E7NA 3H3VI 5LMNW 4BY7G 2OQKA 3CQZH 2YYZA 4AIMA 1N33Q 5GAGC 4IFDJ
chains in the Genus database with same CATH superfamily
3H3VH 3SK8A 1EL0A 4A3EG 5KRUA 3DM3A 5T1GA 2E75C 2K7VA 4K5XA 3DWQA 5AJ3L 2L9HA 1Y8PB 1PLFA 3LX0A 4DR4Q 2CW0C 5M5XB 2RF4A 4G7OC 4FYDA 2F52A 1VQIA 4KY6A 3CPFA 3BJUA 4A3MH 3K7AH 4B3ML 1W2BA 1Q8IA 3S2HB 4B3SL 1UUPA 4DAYB 4TQUS 2N3SA 5CC4A 4IPHA 1PH5A 4LNQA 1IBLL 3DEOA 1AE2A 1J6QA 4X65Q 5BN3A 1YJWA 2VQFQ 2VXWA 2BA0A 3PMFA 2ZTDA 4C3IG 3CC2A 3QWNA 1DXMA 1N36L 3CRKC 1VQOA 4NKLA 2KOLA 3E5SA 2JA6G 3VDYA 4DV1Q 3ICEA 4DF7A 1IBKL 4KHPL 1HZAA 4P71A 5KNDA 4ZRZA 4C3HB 1KHIA 2Y0SE 1I94L 1N32L 2KCCA 2Q8TA 1I4QA 2EOTA 4QMGA 1WOCA 1PTOD 3M4PA 3OWFA 1VQKA 1SAPA 1YZ6A 4DR6Q 3S17B 4N8FA 2JYOA 3H91A 4LFBQ 2FXQA 1PH7A 2O4XA 5EQ0A 2HUGA 1CZWA 3W1GA 1D2BA 1NMFA 1LTSD 2JE6I 2R93B 4F7XA 1TS2A 1OXVA 1PRTF 4JV5L 3EBEA 2EVBA 3OPOA 3MFYA 2PZWA 1K3RA 4P72A 1FJGQ 1AP0A 3FKIB 1L1OC 1CKNB 3KDFA 3J7A5 4A3CH 2PZUA 3OHXC 3SGIA 3I4NB 3VYTA 1HZ9A 4IZ8A 2A6HD 5EAYA 4BY1G 2Z0SA 4UP8A 2UUAL 2K05A 4OWTB 4OL7A 4DKAC 5FLXE 3A74A 1QVGA 1EFWA 1NY4A 4A75A 4DV6Q 3GTKB 5FO7B 1H9SB 2KBNA 2F0LA 5A2QL 4RHRA 5M9OA 2L15A 4IPGA 4A93G 2ID0A 1FYCA 1XPUA 1PH9A 2IL8A 5DEHA 4GOPB 4JI3L 1MJCA 4POGA 3KLWA 3NEMA 1XMQL 5EBCA 3BYTB 3NWTA 1NBWA 2Y0SG 4LF7Q 3J81i 4A3LG 4JI8Q 2DGYA 1KAAA 2A69C 1B3AA 1B9NA 4DV2L 2B63G 1HFNA 1FVIA 1G291 1QNUA 3TZDA 4OWXB 2BE5D 3EVQA 3R2IA 3BS1A 4YIJA 2NBFA 3SDZA 1CK1A 4L63B 2WACA 2F0PA 4ULLA 1DYQA 3F2CA 5CYUA 1QB5D 1SROA 3J7AV 4RA8A 1A8VA 2NZOA 1Y8NB 4KY5A 1VCIA 2WB1E 4QGUA 3KOJA 4JG2A 4FF4A 3JAML 4GLXA 4R9WA 4K5WA 1SNPA 3HOXG 1AN8A 3D0FA 1D5ZC 5CMDA 4ZUIA 1KIXA 5JPMC 4H7BA 1CZGA 5C4XB 3MZ5A 1H9RA 1EFID 1F2YA 1X65A 5JJLA 2O5IC 3HFZB 3TRZA 3MXGA 2RBMA 3X3NA 2EDGA 1YJNA 1HNZL 3DUZA 1B53A 3TBIB 1LABA 2D9UA 2C35B 2B2WC 4X3TA 1YNXA 4DK1A 1FNUA 1LYLA 1EYAA 4CKEA 1YHQA 3CRLC 4QJFA 5C44G 2D0OA 3LWEA 4XDXA 4DAVA 5F2DA 5EBDA 1UE7A 1Y1WH 5JVG3 1TR5A 2VB2X 2A6ED 5M3FG 3A55A 3AMUA 3FPUB 1C48A 1O7LA 1J8IA 2QEJC 4L5TA 1IL2A 1EUJA 1SLJA 4IURA 4YY3Q 1BR9A 3NQIA 1ET9A 3RN2A 2OQ0A 2V4DA 1LLRD 4IN3A 1WFQA 1PYWD 2Q8RE 2Q8IB 2N8NA 4BXXH 2QDBA 1HUMA 5E4XA 1XNQQ 1X54A 2QILA 2BOSA 4A3EB 2Q2HA 1K8OA 1PTOH 4DR5L 3PUVA 1CA6A 3FDTA 1K0RA 1WI5A 1NSNS 4DPGA 3GD7A 5ELEA 3R2TA 2B8FA 2N78A 3AYHB 2JEAI 4IPCA 4O2DA 2OTLA 1AE3A 3CP0A 4A3DH 5J3BA 4C2MH 3TN2A 1OXTA 3S1NH 2E2HB 1HJPA 3VR2A 5ELNA 3OW2A 1V1QA 2JJQA 2L55A 4C3IB 4GKKL 1XPRA 1D8LA 1EWCA 3RN5A 4NPSA 4JI2L 3EFXD 1OXSC 1SFOH 4NXNQ 1NMGA 1HNXL 1YNJC 5I6WA 2JA6B 2E8GA 3HOWB 1EYCA 1BCPD 1SJHD 4V190 4LF8Q 3NP8A 4HJAA 1TT2A 3C2PA 3B6YA 4K8JA 1IZ6A 3K59A 1AFPA 2R7ZH 2B2VC 5JJIA 2QGQA 4KV6A 5HY6A 4O1NA 3WDNA 1XNRQ 3CXCA 1K9MC 1I4PA 1Y1VG 3S9WA 1GO3E 1U5KA 3J81j 2SDFA 2VB3X 2PI2A 2BDNA 4QF4A 5A35A 3J7YW 4OEMB 1BOSA 2ZXOA 3GTPH 1UAPA 3EQLC 4C3JG 2CH4A 3FP9A 2B2TC 3HP3A 4FDBA 4XQQA 1PDQA 1ILPA 1TWHH 3I8ZA 2C5CA 4BBSH 1IYJB 1HTLD 4RGNA 2B2UC 1VQPA 3FPPA 5JVH3 2I5LX 3I70A 1TS5A 3U9SA 5KIXA 2AUKA 3H0GH 2K6AA 3URYA 1E1OA 3ND9A 4A93B 3BZDB 3TQYA 4KLKA 3M7GA 1CKOA 1R9TH 1STNA 3VA5A 1RDPD 4A3FG 5C0XI 1Q8KA 2X6GA 3CCQA 2F4IA 2K5HA 2K01A 4HTHA 3S1QH 4DV0L 4JPBW 3CCEA 2HD3A 1UE6A 2WV6D 1F9PA 4DK0A 1I6HH 3MXNA 2Y0SB 4B3RQ 3TP6A 3CW2C 3M3YH 2G9DA 1LV9A 4DR3L 2PYKA 3K57A 3ULPA 1J5EL 2F0FA 1EWHA 1ICWA 4DR7L 3V05A 2KHIA 4KJOA 4B3TL 3OYYA 1K8AC 3RZOH 4K6LA 3UDXA 2B63B 2TSSA 3NBHB 4QQBX 2HQEA 3G6EA 5IP7H 3S16H 4F8MA 2HIXA 4A3MG 1EQQA 2JA7G 3I4MH 3PF5A 2AHOB 3D6CA 3I91A 1IBML 1HNWL 2EXDA 4Q0FA 3CCMA 5C0XG 3GTLH 1ASYA 4H0LC 2OF1A 1B70B 2EYLA 1D5MC 2NN6I 2RVLA 1BCPB 2R61A 1S5CD 1SJED 2MP1A 1E22A 1TWGH 2EYHA 1VQDA 1TVXA 2HCIA 2KVMA 4OELB 1VQHA 2B39A 4U68A 3M4OB 3HOUG 4RGOS 1RF2D 4DV4Q 4QY7A 2F4VQ 4QUFA 4HJ7A 1G2TA 1LT5D 5CORA 4DNRB 4H44C 3E9IA 1QILA 1W6JA 5D65A 5LL6X 1VQJA 1TWAB 1CKNA 1PFBA 3RD4A 1A3UA 2Z4HA 1N34L 3HGBA 1CUKA 3S14H 1Z6HA 2K28A 4KI0A 4CDCC 1ZYRC 1VQAA 1SE8A 3U58A 1WTPA 1C8CA 2NN6G 2Q2UA 1A3TA 1A0IA 3OTOQ 2D2CC 4KD4A 1H9SA 1IXRA 4JOIA 4DK3C 3T4AC 2RCNA 3QO2A 2AQ3B 2F0TA 4HIMA 1G2SA 2H5XA 2Z6KA 4TKOB 4DU9A 3A5UA 4I7ZC 4A3CG 4QL5A 1JOOA 4IUPA 4RG1A 2Z4IA 1KL9A 3VYSA 4GOPA 5COYA 5DLQE 4LFCQ 2A1AA 1S4ZA 5FO8B 3RMHA 2K5DA 1G91A 4H13C 2KQ3A 3NELA 4ZYSA 3Q24A 5M3MB 4JI1L 1RTNA 1VQLA 4A3GH 2F0JA 2NZHA 2WB1B 3RLFA 1VQGA 5KYIA 3RR5A 4A76A 1WD1A 5AJ3Q 3MAQA 1QVCA 1A15A 4DXGA 5C0XJ 1VF5C 2PZTA 2M00A 2EJGC 3CQZH 4IOAA 2Z8LA 3BZKA 4XYQA 1EY8A 4DAPA 3E6ZX 3KLSA 4GLAC 4B3MQ 4WORA 2K03A 2KUMA 1G6ZA 1JQYD 4JI5Q 4PMWA 4B3SQ 2CQAA 3J81E 2PQAB 4R8IA 1IBLQ 4WJ3M 1CA5A 1WTWA 3UDGA 4FVMA 1L0YB 1MSGA 1N33L 1F9QA 1SMYC 4OWWB 1JE4A 1N36Q 4K0KL 5LMNL 1IBKQ 3RZDH 2NB0A 2L5TA 3RUZA 4KHPQ 1JOQA 4LFAL 1TWFB 3CD6A 2E76C 1E3PA 2F3IA 3TP7A 5C4JB 1I94Q 5IYDG 1N32Q 3S1MB 1S5BD 4LK1C 2LMCB 3GTMB 2ALYB 4V0BA 1KNEA 2EYFA 2F0GA 5IE8A 4X64L 3E9HA 3FEWX 2F0WA 2JA8G 1Y1VB 1N9WA 1EU4A 2OCEA 1K73C 2VNUD 3PCOB 1MJEA 3AQQA 4NDXA 1ONLA 2DY8A 3L0OA 4X3UA 1IYUA 4JV5Q 2R92B 3NSWA 4Y52H 4HR7B 2E2IB 1H9JA 2PW5A 3I3CA 2D62A 2RSOA 1KD1C 4X66L 1ENAA 2CW0D 2OT2A 3KUPA 4JI0Q 2CWPA 4C3JB 1AZPA 2A74C 1NR4A 1K28A 2KHJA 3QOJA 1KAWA 2UUAQ 3GQBA 1Y8OB 2ZJRA 4LAAA 3STBC 1KDCA 3S2DH 1QZHA 1BDOA 3F1ZA 1CI3M 3HS0C 1GUSA 5C5MA 1TS3A 1E24A 5C3EH 3S15H 4JI3Q 3SE0A 4MNOA 2ZXRA 4CJ0B 3KYHC 2EIFA 3T1YL 3J81c 2RDGA 2NVYB 1CM9A 3H3VC 2JEBI 3QOLA 3ER0A 1EIGA 2MHVA 1XMQQ 2XTIA 1NUCA 1EEID 1B9MA 3P1HA 1C4QA 4PZ7A 5DNFA 1E2VA 2P5ZX 4OXPA 3PO3G 4BXXG 3DM1A 4K8IA 1G6PA 1PMRA 4BY7H 1PFMA 1XXGA 2XWBB 4CJ2C 2F3VA 2EY2A 5I4DA 2L12A 4HMJA 2O2LD 4DV2Q 3U4ZA 2PMZE 5C3XA 3CCSA 2F03A 5ELDA 3TDQA 1QVFA 4JI6L 5E4WC 1ILQA 4HIKA 2CWAA 2A8VA 1X9NA 3DXJC 1KRSA 3HOVG 2JA7B 2CVRA 3G6JB 4GNXC 3HOYH 1LT4D 4I7AA 4DV7L 1FGUA 4A3DG 4IUNA 4RAUC 2K52A 1V9PA 3ZJYC 1C0AA 3K7UC 4YWKA 5JPNC 3RNUA 1STBA 4LF9L 3NQTA 4JBJA 1QUQA 4O0AA 1VS0A 2PO4A 1FL0A 2HCCA 4B9WA 3BU2A 3E3XA 4PQXA 3OIQA 3GTJB 1HNZQ 1NJIC 4IUUA 4A3IG 4UY8C 2H1EA 2A5HA 1ET6A 4RFBA 4DV5L 3VYRA 1JB7A 1B2TA 3X3MA 1HR0L 3A7AB 3FHWA 4AQYL 1JC7A 1YNNC 3MEHA 1EIHA 5EPKA 4K2KA 5K36H 3S1RB 1Q3LA 4JYAL 1G51A 4KK7A 2JA5H 4L5RC 1GXDC 3GTOB 1TIID 2G5DA 1F2MA 3WOEA 2Q2TA 2A69D 1K8GA 4EVOA 1WCMH 2SNMA 3BYYB 3W3AA 2K5QA 3V2TA 3D3RA 1MKHA 1P8LA 2KENA 4M1UB 4HIOA 1GUNA 2O5JC 1G8ZD 3H6MA 1D6EC 2FHTA 3KK7A 3NUCA 1PA6A 4OO1H 5E1FA 1FGBD 1K8MA 1O7IA 3H0GG 1EY4A 3HZXA 5DM63 2R7FA 4DR5Q 1WTXA 4DNIA 2HT1A 1Y14B 2KA7A 1EY7A 3LGJA 3PIOA 3GDEA 3NBHA 5M5XH 1PRTC 2WKCA 4G7HC 1KTKA 4KMUC 3T13A 3M4YA 1OTCA 4N8X1 4GN5A 3S2HH 4K2LA 1EYGA 3KLRA 1VMPA 3CC4A 3QG1A 2DY7A 3VR3A 2UUBQ 1L1OB 2DN8A 4JI2Q 2A19A 3GV6A 3NWSA 2Z9HA 4N9TA 5G3LF 5IP7G 1HNXQ 2F0EA 2IX1A 1KC8C 1A6XA 5NUCA 2E2JB 2JQOA 1JJ2A 4Y7NB 4C3HH 1O7YA 5JJKA 2Z6KC 3GP7A 5IGEA 3TP8A 2JA8B 1TWCB 2IHFA 4MHEA 2JK8A 5IT9E 3S17H 3PO2G 3HOZG 2HDMA 3D4DA 3K81C 2AQ2B 1ASZA 4XXEA 1T5EA 2R93H 3CCVA 1HR0W 3BDCA 2KECA 3QR8A 1MSHA 4TVAB 3N6RA 1YJ9A 1ZEQX 3OMCA 1X3EA 4QUCA 1RJTA 3FKIH 2EYJA 4HJ5A 1VMCA 3EJIA 2HHHL 5EKKA 5CV7A 1WTVA 3I4NH 5D3IB 1GUGA 2N88A 5AFWA 3M4QA 4HSPA 1I3QB 4HCSA 2K33A 4DNTB 1OXUA 3GTKH 3BVMA 5CV8A 2UUCL 1VQ6A 2JXMB 4CDFC 1U9RA 3BDOA 1K83B 3PV0A 1STYA 4IJHA 4C1NI 3HKZG 5IP9H 2PPBC 2LSSA 1U4PA 3PIP3 1PH2A 3SEBA 1YNJD 2YU9B 4DV0Q 5D14A 3K5OA 4JI4L 5C5LA 1MIUA 2I5HA 2ZT9C 4NB3A 2NVQB 1PTOF 1PTOC 5BN4A 2DJGC 5FLXc 1SE2A 2RHQB 4R4IA 1YVCA 4EX5A 1DOLA 2PQAA 5HGTA 3RLNA 4DR3Q 1PH3A 1J5EQ 3PO3B 4R4QA 4DR7Q 1E2ZA 5IYBH 2RCFA 4CDEC 1KDBA 4B3TQ 3PIPA 1WTOA 2EY1A 2SEBD 3NHHA 3RLOA 2IX0A 1PH4A 1TQOA 2QF7A 3PSIA 2NYZD 3T1HL 3F2BA 3IRBA 4DR4L 1SYCA 4IFDH 1CTMA 1TS4A 3KF6B 1IBMQ 1HNWQ 2A68C 3KBXA 3HOVB 2L4NA 2CH4W 3MA2B 4HJ8A 2B2YA 5IT9c 4POFA 2GVBA 3OW7A 1I3QH 4QIWE 3E0EA 1B4OA 2HIVA 1DD2A 4HEDA 2IY5B 2K32A 5ELFA 3K0YA 3CF5A 4WFN3 3PUWA 2NVTB 2RDFA 5C4XH 4ALPA 5M5WB 2GA4B 4A3IB 3ND8A 5I2XA 1X3GA 5FLMH 4DUZL 3ERSX 2K5NA 1VQ7A 3J81L 4LF6L 3BDLA 5I2YA 1QWYA 4TRDA 1DM0B 2F0MA 4CHTB 1RKNA 3NPPA 5EGTA 1F9SA 4P73A 2VUMG 1ZKOA 1DCZA 1RHPA 4FP5D 5KGUA 4GLVB 2PMZB 1B50A 4AYBE 3M7NA 2SNSA 3Q6SA 5BR8L 4QCLA 1S3OA 5IODA 4OX9L 4BBRG 3NXWA 4DAMA 3GTQB 4F88A 2KJXA 3T53B 1KNAA 1DONA 3OSOA 3F2UA 4FF2A 3A8JE 1B8AA 3OOCA 2ZM6Q 1GHJA 3F8TA 3NBIA 2SOBA 1NR2A 4A3EH 4J6HA 2EQSA 1FNVA 1QZGA 1V1PB 1P16A 1SDFA 3A5ZB 2QEXA 4A3KG 4KN4C 2UXDL 1U0LA 3Q8DA 2AWOA 1HUNA 4X3KA 1PZJD 1GOZA 1TU2B 4MN3A 2PI2E 1X56A 5E7NA 3H3VI 4BY7G 1D1KA 1FR3A 1NNXA 4BY1B 1N33Q 1QJOA 3TREA 4LF4L 2E2HH 3L9AX 4JI7L 4K0KQ 4ZAIA 5LMNQ 1F2LA 5FKAC 4C3IH 4LFAQ 3G71A 1HXYD 5KNCA 5J22A 4JBWA 3HOYG 2JA6H 3HOWH 4LJZC 4AYBG 2NVXB 3DMUA 3AEVA 1II3A 4A3BG 4A3JG 4X64Q 4G4KA 1O7ZA 4DGZA 1E7ZA 4DR2L 3IAYA 4J8QA 2L1BA 2YTYA 1B3QA 5KYLA 1BUVT 2VW9A 1UEBA 4DAYA 1ENFA 4KJNA 1PV4A 1PYBA 2VS1A 3CC7A 3PO2B 4DFAA 3HOZB 4FF1A 1UE1A 1SR3A 4P74A 1I4HA 1EEFD 4NW2A 1SYGA 3A54A 4X66Q 5IWAL 1T5XD 1HQMC 4UP9A 3MHBA 2IWHA 1WJJA 4FF3A 5ELCA 2BH2A 2VL6A 4LW1A 1YEZA 2JA5G 3I90A 5L37A 4ODGA 1BKBA 2R6GA 2HQLA 1PHJA 1PH1A 1EOVA 5EPJA 2WKDA 3P75A 2J7ZA 4NXMQ 1I4XA 3HOXB 1WCMG 1SMYD 3K6OA 3KLSX 4YWLA 1BCPF 3T1YQ 2ASBA 4C1NK 4A93H 2J4XA 1Q7YC 1E1TA 5H1SE 1HRJA 5JEAH 3WOFA 4OHJA 4CGYB 4NMZA 1RCVD 2QA4A 3D6WA 3BZCA 2ZTCA 1S72A 1T9HA 4JI6Q 1EZ8A 1WTHA 2L0CA 3GTGB 5C44B 3J80i 1XJVA 1C7YA 1UEAB 3C3LA 1I50B 2B63H 2CFMA 1ICFB 3H09A 2UU9L 3IFDA 3ULJA 2FMMA 2JN4A 3SVMA 2F0OA 5M3FB 1Q46A 4DV7Q 5GQOA 1LTRD 2MQHA 3G4SA 4Q5VA 1IW7D 4PZ8A 4J15A 4FXGC 4LF9Q 5CV5A 2XN9C 1CQFA 3STBD 4CJ1B 4PNYA 1XX8A 1C9OA 1SBBB 2VQEL 3M4OH 1WYDA 4JC0A 1UE5A 3U9OA 3W2DA 2YTXA 4DV5Q 4OONA 2MNAA 4C3HG 4M8AA 1KRTA 3A8IE 5TSSA 1TWAH 4AQYQ 2RA4A 2IHEA 2XRQD 4JYAQ 3M85A 5ELBA 2XGTA 3O13A 4GN4B 5CR3A 1S5DD 4HCEA 5FLXL 1BNZA 3FVQA 1HPCA 1DOKA 4PMCA 4C56C 4R1JA 5IIFA 2R93G 1AH9A 1PH8A 2K1BA 4PZ6A 1WTQA 1FD7D 1VQ4A 1R4PB 1EY6A 2IPKD 3I4NG 4ME3A 3UE1A 2ZXPA 3CPWA 1J9OA 4BBRB 1HZBA 3CMAA 2GVAA 4LMQD 3NTKA 2M2LA 3HEJA 3AFPA 2B3GA 4U673 5IGDA 1S5FD 5M3MH 2A73B 1HH2P 1CSPA 4XT1B 1XPOA 5C6AA 1UWVA 1PXUA 3PUXA 1V43A 3KBGA 2PNHA 5IT9L 1X3QA 2UXCL 4QIWB 1WD0A 3G7LA 1NTGA 5EKIA 2EJFC 1W3SA 4O42A 2PQEA 1EIFA 2LS01 5IP9G 3JC66 1B1ZA 3QIAA 2EYOA 2F3WA 5EJWA 3H94A 4KKSA 3VYUA 1A3VA 2B2WA 2AWNA 4A3KB 1A63A 3KF6A 2H4OA 1X3PA 4YHHL 2UXBL 1PZID 1AW7A 4BA2I 1O78A 4R4CA 1D1IA 1HFGA 4YWMA 4YCUA 3ULLA 1YNND 3NTHA 3VA7A 4PG3A 1VQEA 2PW7A 1EU3A 1ZXTA 2MO0A 1N8RC 3I56A 3CCJA 1RL2A 2AUJD 1Y1WG 4IFDG 2TMPA 4ILWA 1ENCA 1AZQA 1V1OA 4FXDA 1K0SA 2I5MX 1TWFH 3KF8B 2Z1CA 5C4JH 3Q22A 3S1MH 4A3FB 5CBAE 1DGSA 5GROA 1EZ6A 4BA1I 4A3BB 4A3JB 3GTMH 4RCOA 3FRPB 5GADC 4UAIA 1SNDA 1JR0D 1Y1VH 1LUZA 4DR1L 3U50C 3MEFA 4DV3L 1KXLA 5C4XG 1Q90A 2ES2A 1TY2A 2R92H 2E2IH 4DUYL 4ABNA 4XQNA 4RKBA 2EZVA 2HHHQ 1CHPD 2RHSB 3K5NA 2R3ZA 5IYCH 1VQCA 2IW3A 1PRTD 4C3JH 3I55A 4A3MB 1GUOA 3K7AB 2K75A 5FO9B 3R3OA 4WJWA 1IHZA 2X69A 3K80C 2MFIA 2WP8J 4KY7A 2UUCQ 1B7YB 1JWMD 1JT8A 4RCNA 2D5DA 2E5LL 4GNXB 1KLGD 1SYEA 4UPAA 3MFGA 3IFTA 1SYBA 4GKJL 1FNWA 2WAQE 2ZJPA 2B2VA 3QB3A 1VQMA 3HOUB 5LL6S 1BF4A 1YHAA 1V1PA 1M1KC 4JI4Q 2NVYH 2Q2IA 5HGQA 5JJZA 3AU7A 2AMCB 2R7ZG 5E3FA 1XMOL 1STEA 2R7DA 3OMGA 1Q1EA 1LO5D 4TSSA 2ZTEA 3D4RA 1U4LA 2PCFB 4P2CB 1I4GA 4LUOA 3T1HQ 2B2TA 4HAEA 2K4KA 3DLLA 4L5QA 1EYDA 2ZJQA 2KHSA 1STHA 2RKSA 4HMIA 2VY3A 4L8JA 4JCVE 1JCKB 5C4ZA 2B2UA 2F1MA 1L0XB 2JA7H 4GZYC 1JMCA 3OWEB 4IOCA 2ENBA 4BBSG 4JI5L 3MXNB 5C0XH 3PIO3 4KD3A 3CU7A 1CFMA 1QCBD 4KKTA 1VQ5A 1GD7A 1X32A 3A0JA 5LMUL 3JAMi 4PMBA 4I65A 3HOUH 1X6OA 1BXTA 3GTJH 3HOWG 3WWVA 1TKWB 3ITPA 2WAQG 4EQOA 3IL8A 1SXTA 3SXHA 4DUZQ 1EIYB 1BO0A 3W1BA 4XIGS 3KJPA 4LF6Q 4FXKC 3E0JA 4IQZA 1AEXA 1CQVA 3VR6A 5ISRA 4Z9CB 2KCTA 2E2DC 4X62L 2JA9A 3S1RH 1VF7A 3PUZA 1F77A 3UI2A 1PRTB 1X55A 2NN6H 5LHY1 3GTOH 4GKKQ 1M8AA 4L5SA 4UDUC 1HA5A 1NAPA 2F0HA 5BR8Q 1DZ1A 1O80A 3HKZE 4WRDA 5BN5A 4GS3A 4OX9Q 5CV4A 3I4MG 2NZ1D 1UNSA 1K3BC 4JI0L 1PFNA 4JOIC 5CBEE 3NE5B 3M9BA 2A68D 3TZUA 5FJ8H 2I07B 3EIVA 3CHBD 4ZUJA 2CKZB 4GOPC 1TXYA 4R4TA 3MWYW 1LTBD 2F0IA 4XQJA 1EWIA 4G57A 2I0QA 1H95A 4ME5A 4YCVA 2UXDQ 1SN8A 4OIJA 1GUWA 1RD9D 1PYSB 1VQ8A 1EQVA 1SSOA 5JEAG 5DM73 2EYMA 1LACA 1X3FA 2EY5A 3W5OA 3SHLA 4LF4Q 1Y69U 4JI7Q 4AH6A 4PV1C 4HIDA 4G7ZC 1MD2D 4EGVA 2HDLA 3J80E 3TS2A 2WFWA 4LF5L 1Y1WB 2NUCA 2KCMA 5T1IA 1SNCA 4OGQC 4K5VA 5CV6A 4AIMA 2YYZA 5JOBA 5I9PA 2LXJA 2E2JH 3J7ZC 1NE3A 4KHVA 3MXUA 3V96A 1LTGD 4EQNA 3C1EA 4Y7NH 4RH6A 3NENA 1SYFA 5IYDH 4RGTA 4DR2Q 4HJ9A 4MZ9A 4X6AH 2MO1A 2Z6BA 4A3GG 2ICIA 1IL8A 3UDIA 2IJ0A 2JA8H 4LWCA 1TWCH 2XWJB 1EY9A 5IWAQ 1S5ED 1PTOB 2XNAC 4EQPA 4F87A 5IY0A 1YI2A 1HA6A 2DNEA 2YV5A 1DOMA 2K5WA 4ID6A 2QW7A 2A6HC 5JAVA 4JBMA 1F9RA 5FOBB 1H9KA 2IT1A 4MTNA 1KQSA 1XWEA 2CQOA 1RODA 4A3DB 4C2MB 3S1NB 2IX3A 1M90C 3KFUA 3HRZC 3Q0AA 4K6DA 4X65L 1GJXA 5JEAJ 1STAA 1L2FA 1STGA 2VQFL 4FNFA 2MUYA 3PUYA 1SFOB 1K83H 3D31A 2AQ1B 3K0XA 2WINB 2LXKA 2EYPA 1JWSD 3EA6A 3ONAB 4DV1L 2YU9H 2R7ZB 2QDLA 2VZAA 5M3MG 1N34Q 2NVQH 3J80c 4N9PA 1EY0A 2J0TD 2WB1G 3G48A 4UP7A 3PO3H 2K04A 5IOCA 4APVA 1JORA 3NK9A 1CSQA 4DR6L 4CDDC 2BE5C 4KKUA 2UU9Q 3N52A 3TEHB 3K8AA 4LFBL 3A8KE 1OO9B 4NP5A 3GTPB 2JSOA 1BBWA 2F0UA 3KF8A 3HOVH 3A56A 2X6LA 1W6KA 1KLUD 4RKLA 3R93A 4ZK9B 1FJGL 3GV3A 1ESRA 1TWHB 3IKJA 3TP5A 1SNQA 4JI1Q 3R8BA 4BBSB 3VR5A 3TS0A 4H02A 3CKIB 2K5VA 2VQEQ 1YITA 5CV9A 3CCLA 4CKCA 1JE5A 2UUBL 1Z47A 4QB4A 3H0GB 1GHKA 2XRSD 4DV6L 5C3EG 4DN4M 1SYDA 4XT3B 3CCRA 1YBYA 2NVTH 3MXPA 2XSCA 4BS9A 1R9TB 2WAQB 5M5WH 4A3IH 4A4IA 1L0WA 1Q12A 4JBKA 3I7FA 3S1QB 3F2DA 1SE3A 3K58A 1I6HB 1QUQB 3M3YB 1OXXK 1LTLA 4LF7L 1WTRA 2R92G 3T51B 4JI8L 1ZYRD 4GNXA 3RZOB 3D8GA 2A6EC 2JP1A 1NCVA 1U4RA 2F0QA 4WJ4A 1Z9FA 5I9OA 3DWAA 4YCWA 5IYCG 3S16B 4KN7C 1VQBA 4GN3B 1QNKA 3I4MB 1MBYA 3CAMA 5M5YB 3K5MA 1CHQD 1LM0A 4J1MA 1GKHA 3GTLB 3I73A 3Q23A 3GTQH 5IGCA 2XVSA 1XTCD 2UXCQ 1TWGB 2OTJA 3C1FA 1BQQT 1SMXA 4R4OA 2OWOA 1GVPA 2V1CC 5A2QE 2XIWA 3MC0B 3P20A 1LTID 3HKSA 2B29A 4MIUA 2FINB 2RDHA 4YHHQ 2UXBQ 4ZKBB 2FFKB 3SK5A 4RHSA 3U4VA 1Q1BA 5C4HA 3NTIA 4B08A 2PNRC 3SR1A 4OO1I 4IUVA 1MI2A 5IGFA 5K36G 4P75A 1EQTA 3S14B 1EOTA 1EQRA 3QJYA 1Q86C 3SK6A 3BG3A 4BY1H 1V8QA 3SK4A 3L3OC 3MTSA 4RMFA 3L2PA 5IGBA 1IKMA 4CBVA 2BCOA 1GM5A 1QE6A 1BCPC 4ZLTF 1VQ9A 2K50A 4XTCS 2L11A 5CGKA 3KDFB 5M5YH 3HKZB 4IUTA 5GAHC 2NVXH 1CKMA 4RGMA 2QKIC 1HTPA 2G9HD 4S3SA 3DHQA 4YY3L 2MPMA 2EJMA 2WIIB 4OO1G 2D0PA 2RQXA 4DR1Q 1I4RA 4A3GB 3JAME 1Z7TA 1HQRD 4DV3Q 1S40A 3VR4A 1I6VC 4A3LH 3DWPA 1QOHA 3PO2H 3HOZH 4DUYQ 1L1OA 2ICEC 1XNQL 3UE0A 4L6TB 1KABA 4B9XA 3CQZB 3CCUA 3TMEA 2B8GA 3PF4A 1A2TA 1R4QB 5HURA 4FO2A 3EROA 2F0KA 4MTKA 1E2WA 3LWUA 4IO9A 1RIPA 2CHBD 2FJ2A 3S24A 1YHBA 1SE4A 2DJFC 1SNMA 5ELOA 2E5LQ 1EY5A 1JJCB 4X3SA 4GKJQ 1WVLA 2C9OA 4LUZA 3H15A 2F0DA 1JOKA 4DK6C 3HOXH 5C3WA 1HZCA 3UDFA 3RZDB 1JB3A 3AFQA 2MGSA 1LT3D 1PFSA 2FMCA 4NXNL 1XMOQ 1Q82C 1BBXC 1DJRD 5FJ8G 2KEEA 5EKLA 1HR0Q 4LF8L 5J39A 3OIPA 1VDZA 1F2ZA 4UHVA 5KNBA 5J1ZA 2EE1A 1XNRL 1XYIA 2ZM6L 2BDOA 5D3DA 3BVGA 4RWSC 3GTGH 5C44H 2VUMB 2M9VA 2MJ8A 1I50H 3ERQA 3ZYYX 1SEBD 4OIKA 2KCNA 2QCPX 4R8NA 4JW0A 3FKIG 2OEOA 3I4LA 1D7QA 5M3FH 2DNCA 2E74C 3JAMc 1SNOA 4HN7A 5DAUA 1CT1D 1H9MA 3GO5A 5LMUQ 1A2UA 5GAEC 2DUDA 3S2DB 1VQFA 3T16A 4CKBA 1JJGA 2B2YC 3C46A 2N55A 4IFDI 2K14A 5C3EB 1IKLA 4XYOA 4ZCKA 3S15B 1U4MA 1E0BA 3HG9A 2F0NA 1Q81C 1JICA 3CMEA 2YTVA 3KJOA 2BH8A 2EXZA 5EPLA 1SRUA 2GN5A 4X62Q 5I6YA 4LUVA 4IALA 1MHWC 1PH6A 3I72A 3LNNA 1LTTD 5IYBG 1QG7A 3J80L 4BY7B 1HCZA 4B3RL 3MVVA 4KHZA 2EPBA 2VUMH 5KEEA 3DEPA 4IUQA 5FK9C 1GUTA 1LT6D 1TY0A 4HSVA 4IJLA 4JK1C 2I46A 3K5LA 2N49A 1IW7C 3P7JA 4ZQ3A 3HOYB 2LY7A 4E6IA 1XTDA 4BBRH 4AYBB 4KTAA 2NWGA 4K14A 4IPDA 2NTSA 2ATWA 3I2ZA 3FMCA 4NXML 3J7AF 3TSSA 2OXPA 4ZKCB 3D4WA 1D5XC 4DV4L 1BBUA 3T56B 1ML0D 2LFNA 2CCZA 2F4VL 1A62A 1MGSA 4A3KH 3A7LA 5FLMG 5K5PA 2AKWB 1I5FA 1KDAA 2JA5B 4EQ5A 4JVZA 2F0VA 2RSNA 3PGZA 2EY6A 4LF5Q 3L7ZC 1PVOA 2LKVA 2KEDA 3EN2A 1VQNA 3BVZA 2BA1A 3OTOL 1BVSA 1WCMB 1ESFA 3AB9A 1RTOA 1YIJA 1B44D 5G3LD 3PQIA 4BWGB 1M4VA 4DXFA 1IYVA 1JWUD 1PZKD 4A3FH 3I4OA 5IGGA 4LFCL 4A3BH 4A3JH 1HHVA 2F0SA 5LMNW 2OQKA 4IFDJ 5GAGC 1LTAD 2NTTA 4DA2A
chains in the Genus database with same CATH topology
2LXJA 3TREA 2E2JH 3J7ZC 3BZKA 4LF4L 1NE3A 2E2HH 3H3VH 4JI7L 4K0KQ 4GLAC 4Y7NH 4A3EG 4B3MQ 3NENA 3DM3A 5LMNQ 5IYDH 4JI5Q 4PMWA 4DR2Q 4B3SQ 5AJ3L 4C3IH 4HJ9A 4LFAQ 4MZ9A 2PQAB 1IBLQ 4DR4Q 4WJ3M 4X6AH 3G71A 2RF4A 2MO1A 4JBWA 3UDGA 4A3GG 3UDIA 3HOYG 2JA6H 4IOAA 2F52A 2JA8H 4LWCA 3HOWH 1TWCH 1VQIA 4AYBG 1N33L 3CPFA 4OWWB 3AEVA 3BJUA 4A3MH 5IWAQ 1N36Q 4A3BG 4A3JG 3K7AH 4X64Q 4K0KL 4B3ML 1W2BA 5LMNL 1IBKQ 3RZDH 1E7ZA 4DR2L 4B3SL 4KHPQ 4DAYB 4TQUS 2N3SA 2YTYA 5IY0A 4IPHA 1YI2A 1PH5A 4LFAL 1IBLL 2VW9A 4LNQA 1AE2A 1UEBA 1J6QA 4X65Q 3CD6A 1E3PA 2F3IA 1PV4A 2YV5A 1PYBA 1YJWA 1I94Q 5IYDG 2VQFQ 1N32Q 2BA0A 2VS1A 3CC7A 2ZTDA 1UE1A 1SR3A 3CC2A 4P74A 4JBMA 2ALYB 4X66Q 5IWAL 2IT1A 4MTNA 5IE8A 1VQOA 4X64L 1N36L 2CQOA 1KQSA 3E9HA 2JA6G 4UP9A 3VDYA 4DV1Q 2JA8G 3ICEA 1IBKL 1WJJA 4KHPL 1HZAA 1N9WA 4P71A 1M90C 2BH2A 3KFUA 2OCEA 2VL6A 1K73C 1KHIA 2VNUD 4LW1A 3PCOB 4X65L 5JEAJ 3AQQA 1MJEA 3L0OA 1L2FA 2Y0SE 2VQFL 1YEZA 1I94L 2JA5G 4JV5Q 1N32L 4Y52H 1BKBA 2D62A 2R6GA 1K83H 3PUYA 2HQLA 1PHJA 3D31A 1WOCA 3M4PA 1KD1C 4X66L 1PH1A 1VQKA 3K0XA 1YZ6A 1EOVA 2LXKA 4JI0Q 4DR6Q 2CWPA 4DV1L 4NXMQ 2YU9H 4LFBQ 2KHJA 2VZAA 5M3MG 2FXQA 1PH7A 1KAWA 1WCMG 1N34Q 2UUAQ 2NVQH 3J80c 4YWLA 3W1GA 1NMFA 2JE6I 3T1YQ 2ZJRA 1OXVA 2ASBA 4A93H 3STBC 2WB1G 3G48A 3EBEA 4JV5L 4UP7A 3PO3H 1K3RA 4P72A 1FJGQ 3S2DH 1L1OC 1CKNB 3KDFA 1QZHA 1Q7YC 3J7A5 4A3CH 4APVA 1CSQA 1E1TA 3F1ZA 3SGIA 4DR6L 1HZ9A 5H1SE 2UU9Q 3TEHB 3K8AA 1E24A 5EAYA 4BY1G 5C3EH 4LFBL 2Z0SA 3S15H 4UP8A 4JI3Q 2UUAL 4MNOA 4OWTB 2QA4A 3KYHC 2EIFA 4DKAC 3T1YL 3J81c 3A74A 1QVGA 1EFWA 1NY4A 2JEBI 4A75A 4DV6Q 3ER0A 1BBWA 3BZCA 2ZTCA 1XMQQ 1S72A 3HOVH 2KBNA 1T9HA 2XTIA 4JI6Q 1FJGL 3J80i 1XJVA 1C7YA 4PZ7A 4JI1Q 2L15A 4IPGA 2B63H 2ID0A 4A93G 2CFMA 4OXPA 3PO3G 4BXXG 1XPUA 2UU9L 3TS0A 1PH9A 1G6PA 4H02A 3ULJA 2K5VA 2VQEQ 4GOPB 4JI3L 1YITA 3CCLA 4BY7H 1MJCA 1JE5A 2UUBL 1Q46A 4DV2Q 1Z47A 4POGA 4DV7Q 5GQOA 3KLWA 3U4ZA 2PMZE 3NEMA 4DV6L 2MQHA 3G4SA 5C3EG 3CCSA 1XMQL 4PZ8A 3CCRA 1QVFA 4JI6L 1NBWA 4J15A 1YBYA 4HIKA 2CWAA 4LF9Q 2NVTH 2Y0SG 2A8VA 4LF7Q 1X9NA 3J81i 4A3LG 4JI8Q 1KRSA 2DGYA 3STBD 5M5WH 3HOVG 4A3IH 4A4IA 1L0WA 4GNXC 3HOYH 1C9OA 2VQEL 1Q12A 3M4OH 1WYDA 4JBKA 3I7FA 4JC0A 4DV2L 2B63G 4DV7L 1FVIA 1FGUA 1G291 1UE5A 3F2DA 4A3DG 4OWXB 3ZJYC 2K52A 1V9PA 1C0AA 2YTXA 3K7UC 4YWKA 4DV5Q 1QUQB 3RNUA 4OONA 2MNAA 1OXXK 4LF9L 1LTLA 4JBJA 4O0AA 1QUQA 1KRTA 3F2CA 1VS0A 4LF7L 1TWAH 1SROA 4AQYQ 2R92G 4JI8L 1A8VA 2IHEA 2NZOA 4GNXA 1FL0A 4JYAQ 1VCIA 3M85A 2XGTA 3BU2A 2WB1E 4QGUA 3KOJA 4GN4B 4JG2A 4WJ4A 1Z9FA 4YCWA 5IYCG 4GLXA 1HNZQ 1NJIC 1VQBA 4GN3B 4A3IG 4UY8C 3CAMA 4DV5L 3HOXG 3D0FA 1JB7A 4R1JA 1LM0A 2R93G 1GKHA 1AH9A 1PH8A 1KIXA 4PZ6A 1HR0L 3FHWA 4AQYL 3GTQH 1VQ4A 1G51A 4JYAL 2JA5H 2UXCQ 5JJLA 1X65A 4L5RC 2OTJA 3HFZB 3I4NG 1SMXA 3TRZA 4ME3A 4R4OA 1HNZL 1YJNA 2OWOA 3UE1A 1GVPA 3CPWA 3CMAA 1HZBA 2GVAA 2V1CC 2C35B 3AFPA 2B3GA 2Q2TA 5M3MH 1HH2P 1K8GA 1CSPA 1WCMH 2B29A 3HKSA 1XPOA 1UWVA 4YHHQ 2UXBQ 1V43A 3PUXA 1YNXA 1LYLA 2PNHA 1YHQA 1MKHA 1P8LA 2UXCL 2KENA 3U4VA 4QJFA 5C44G 1NTGA 1Q1BA 2D0OA 5C4XG 1W3SA 4HIOA 4OO1I 1EIFA 5K36G 1UE7A 5IP9G 3JC66 4P75A 1Y1WH 1EQRA 1Q86C 5M3FG 1PA6A 4BY1H 2AWNA 1A63A 3KF6A 3H0GG 1O7IA 4YHHL 2UXBL 4L5TA 1IL2A 1EUJA 2R7FA 4RMFA 1SLJA 4YY3Q 3L2PA 4DNIA 4DR5Q 2HT1A 4BA2I 1Y14B 4R4CA 3RN2A 4YWMA 1GM5A 2OQ0A 3LGJA 3PIOA 1WFQA 4YCUA 3ULLA 3GDEA 2K50A 5M5XH 4XTCS 1VQ9A 2N8NA 3KDFB 4PG3A 1VQEA 4BXXH 5M5YH 5GAHC 2NVXH 1X54A 1XNQQ 2MO0A 1N8RC 1CKMA 3I56A 1RL2A 3CCJA 1Y1WG 2Q2HA 1OTCA 4IFDG 4YY3L 4DR5L 3PUVA 4GN5A 3S2HH 1EYGA 4OO1G 2D0PA 1K0RA 1WI5A 4DR1Q 3CC4A 2I5MX 1TWFH 2UUBQ 1S40A 3KF8B 4DPGA 3GD7A 4DV3Q 1L1OB 5C4JH 4JI2Q 3S1MH 2A19A 4A3LH 3PO2H 1DGSA 5GROA 4BA1I 4DUYQ 2N78A 1L1OA 3HOZH 3AYHB 1XNQL 2JEAI 5IP7G 3GTMH 3UE0A 4IPCA 1HNXQ 4O2DA 5GADC 2IX1A 3CCUA 2OTLA 1KC8C 1AE3A 3CP0A 4A3DH 5J3BA 3PF4A 2JQOA 4C2MH 1OXTA 3S1NH 1HJPA 1Y1VH 1JJ2A 1LUZA 4DR1L 5ELNA 4C3HH 3U50C 5JJKA 3MEFA 4DV3L 3OW2A 1V1QA 2Z6KC 1KXLA 2JJQA 4GKKL 1XPRA 1D8LA 4IO9A 3RN5A 4NPSA 1RIPA 2ES2A 4JI2L 2R92H 3S24A 2E2IH 4DUYL 1YHBA 1OXSC 1SFOH 4NXNQ 1NMGA 1HNXL 5ELOA 2E5LQ 2E8GA 1JJCB 2HHHQ 2RHSB 2IHFA 5IYCH 4LF8Q 2JK8A 1VQCA 4C3JH 4HJAA 3S17H 3I55A 3HOZG 3B6YA 3PO2G 1IZ6A 3K81C 2R7ZH 4LUZA 2K75A 3H15A 1ASZA 3HOXH 4DK6C 5JJIA 1HZCA 2QGQA 3UDFA 5HY6A 2R93H 3AFQA 3CCVA 1HR0W 3K80C 2MFIA 1XNRQ 4TVAB 2WP8J 3CXCA 1YJ9A 1K9MC 2UUCQ 1Y1VG 1B7YB 1GO3E 1PFSA 1U5KA 1X3EA 4NXNL 1XMOQ 1Q82C 3J81j 1JT8A 5FJ8G 3FKIH 4HJ5A 2E5LL 4GNXB 2PI2A 2HHHL 4UPAA 1HR0Q 3I4NH 4LF8L 4GKJL 2WAQE 2ZJPA 1VQMA 3M4QA 1YHAA 1M1KC 4JI4Q 3GTPH 1OXUA 2NVYH 2Q2IA 3FP9A 5HGQA 1XNRL 2ZM6L 2AMCB 3GTKH 2UUCL 2R7ZG 4FDBA 1XMOL 1VQ6A 1TWHH 5C44H 3GTGH 2R7DA 1I50H 4BBSH 3PV0A 1IYJB 1Q1EA 4IJHA 2ZTEA 1VQPA 3HKZG 5IP9H 4GKJQ 2LSSA 3FKIG 2I5LX 1D7QA 1PH2A 4QQBX 5M3FH 4DV0Q 4LUOA 4JI4L 1MIUA 2I5HA 4NB3A 3JAMc 3T1HQ 3H0GH 5FLXc 2K4KA 2RHQB 3DLLA 4L5QA 4R4IA 1E1OA 2ZJQA 1YVCA 4EX5A 2PQAA 4DR3Q 3RLNA 1PH3A 1J5EQ 2VY3A 3GO5A 4JCVE 4R4QA 3TQYA 4KLKA 5LMUQ 5GAEC 1CKOA 1R9TH 2DUDA 4DR7Q 5IYBH 4A3FG 1VQFA 4B3TQ 5C0XI 1Q8KA 3PIPA 3CCQA 2JA7H 1JJGA 3RLOA 2IX0A 2K5HA 1PH4A 1JMCA 4IFDI 3PSIA 4IOCA 4DV0L 4JI5L 2K14A 3S1QH 4BBSG 3MXNB 3CCEA 3T1HL 3F2BA 1UE6A 3IRBA 1I6HH 4DR4L 1Q81C 4B3RQ 3KF6B 3CW2C 1IBMQ 3M3YH 1HNWQ 3CMEA 4DR3L 1VQ5A 3ULPA 1GD7A 2YTVA 3KJOA 3A0JA 2BH8A 5LMUL 1J5EL 4DR7L 2KHIA 3JAMi 1SRUA 2GN5A 4X62Q 4HJ8A 4LUVA 4B3TL 3OYYA 1K8AC 3RZOH 3UDXA 5IT9c 4POFA 3HOUH 1PH6A 1X6OA 2GVBA 1I3QH 3NBHB 3E0EA 4QIWE 3WWVA 3GTJH 3HOWG 2WAQG 5IP7H 2HIVA 3G6EA 5IYBG 3S16H 2HIXA 4DUZQ 4A3MG 1EQQA 1EIYB 2JA7G 3I4MH 3PF5A 2AHOB 4XIGS 3W1BA 3KJPA 4LF6Q 4B3RL 1IBML 1HNWL 2IY5B 2EXDA 4KHZA 3CCMA 5C0XG 2VUMH 3GTLH 1ASYA 3CF5A 1B70B 2KCTA 4X62L 3PUWA 2JA9A 3S1RH 2NN6I 5C4XH 4IJLA 3PUZA 4ALPA 1E22A 1TWGH 2N49A 1VQDA 1X55A 1VQHA 4DUZL 1X3GA 5FLMH 3GTOH 1XTDA 3ERSX 4BBRH 2K5NA 4GKKQ 1VQ7A 4L5SA 4LF6L 3HOUG 4DV4Q 5BR8Q 4QY7A 2F4VQ 4HJ7A 3HKZE 4IPDA 4GS3A 4OX9Q 3I4MG 3E9IA 2ATWA 3I2ZA 4JI0L 1VQJA 4JOIC 4P73A 1CKNA 4NXML 2VUMG 3M9BA 5FJ8H 1N34L 1CUKA 3EIVA 4GLVB 3S14H 4DV4L 1BBUA 4KI0A 4AYBE 2CKZB 2CCZA 3M7NA 5BR8L 1TXYA 1VQAA 1SE8A 4R4TA 4GOPC 1A62A 3U58A 2F4VL 1S3OA 4A3KH 2NN6G 2Q2UA 5FLMG 4OX9L 4BBRG 1A0IA 1EWIA 3OTOQ 4DAMA 2I0QA 2AKWB 1IXRA 4JOIA 4DK3C 1H95A 2RCNA 1I5FA 4HIMA 4YCVA 2UXDQ 2H5XA 2Z6KA 1SN8A 4EQ5A 1PYSB 3A5UA 4A3CG 4QL5A 4RG1A 1B8AA 2ZM6Q 1KL9A 3PGZA 3F8TA 4GOPA 4LF5Q 1VQ8A 3L7ZC 5DLQE 5JEAG 4LFCQ 1PVOA 2A1AA 4A3EH 2EQSA 3EN2A 1X3FA 3NELA 1VQNA 2BA1A 3OTOL 1BVSA 1QZGA 3W5OA 4JI1L 1P16A 4LF4Q 3A5ZB 1YIJA 1VQLA 4JI7Q 2QEXA 4AH6A 4A3KG 2UXDL 1U0LA 4A3GH 4HIDA 2NZHA 3Q8DA 2AWOA 3RLFA 1VQGA 3RR5A 4A76A 3TS2A 2WFWA 5AJ3Q 1QVCA 4A3FH 4LF5L 3I4OA 4LFCL 4A3BH 4A3JH 5C0XJ 2PI2E 1X56A 2KCMA 5E7NA 3H3VI 5LMNW 4BY7G 2OQKA 3CQZH 2YYZA 4AIMA 1N33Q 5GAGC 4IFDJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXJ A;  3TRE A;  2E2J H;  3J7Z C;  3BZK A;  4LF4 L;  1NE3 A;  2E2H H;  3H3V H;  4JI7 L;  4K0K Q;  4GLA C;  4Y7N H;  4A3E G;  4B3M Q;  3NEN A;  3DM3 A;  5LMN Q;  5IYD H;  4JI5 Q;  4PMW A;  4DR2 Q;  4B3S Q;  5AJ3 L;  4C3I H;  4HJ9 A;  4LFA Q;  4MZ9 A;  2PQA B;  1IBL Q;  4DR4 Q;  4WJ3 M;  4X6A H;  3G71 A;  2RF4 A;  2MO1 A;  4JBW A;  3UDG A;  4A3G G;  3UDI A;  3HOY G;  2JA6 H;  4IOA A;  2F52 A;  2JA8 H;  4LWC A;  3HOW H;  1TWC H;  1VQI A;  4AYB G;  1N33 L;  3CPF A;  4OWW B;  3AEV A;  3BJU A;  4A3M H;  5IWA Q;  1N36 Q;  4A3B G;  4A3J G;  3K7A H;  4X64 Q;  4K0K L;  4B3M L;  1W2B A;  5LMN L;  1IBK Q;  3RZD H;  1E7Z A;  4DR2 L;  4B3S L;  4KHP Q;  4DAY B;  4TQU S;  2N3S A;  2YTY A;  5IY0 A;  4IPH A;  1YI2 A;  1PH5 A;  4LFA L;  1IBL L;  2VW9 A;  4LNQ A;  1AE2 A;  1UEB A;  1J6Q A;  4X65 Q;  3CD6 A;  1E3P A;  2F3I A;  1PV4 A;  2YV5 A;  1PYB A;  1YJW A;  1I94 Q;  5IYD G;  2VQF Q;  1N32 Q;  2BA0 A;  2VS1 A;  3CC7 A;  2ZTD A;  1UE1 A;  1SR3 A;  3CC2 A;  4P74 A;  4JBM A;  2ALY B;  4X66 Q;  5IWA L;  2IT1 A;  4MTN A;  5IE8 A;  1VQO A;  4X64 L;  1N36 L;  2CQO A;  1KQS A;  3E9H A;  2JA6 G;  4UP9 A;  3VDY A;  4DV1 Q;  2JA8 G;  3ICE A;  1IBK L;  1WJJ A;  4KHP L;  1HZA A;  1N9W A;  4P71 A;  1M90 C;  2BH2 A;  3KFU A;  2OCE A;  2VL6 A;  1K73 C;  1KHI A;  2VNU D;  4LW1 A;  3PCO B;  4X65 L;  5JEA J;  3AQQ A;  1MJE A;  3L0O A;  1L2F A;  2Y0S E;  2VQF L;  1YEZ A;  1I94 L;  2JA5 G;  4JV5 Q;  1N32 L;  4Y52 H;  1BKB A;  2D62 A;  2R6G A;  1K83 H;  3PUY A;  2HQL A;  1PHJ A;  3D31 A;  1WOC A;  3M4P A;  1KD1 C;  4X66 L;  1PH1 A;  1VQK A;  3K0X A;  1YZ6 A;  1EOV A;  2LXK A;  4JI0 Q;  4DR6 Q;  2CWP A;  4DV1 L;  4NXM Q;  2YU9 H;  4LFB Q;  2KHJ A;  2VZA A;  5M3M G;  2FXQ A;  1PH7 A;  1KAW A;  1WCM G;  1N34 Q;  2UUA Q;  2NVQ H;  3J80 c;  4YWL A;  3W1G A;  1NMF A;  2JE6 I;  3T1Y Q;  2ZJR A;  1OXV A;  2ASB A;  4A93 H;  3STB C;  2WB1 G;  3G48 A;  3EBE A;  4JV5 L;  4UP7 A;  3PO3 H;  1K3R A;  4P72 A;  1FJG Q;  3S2D H;  1L1O C;  1CKN B;  3KDF A;  1QZH A;  1Q7Y C;  3J7A 5;  4A3C H;  4APV A;  1CSQ A;  1E1T A;  3F1Z A;  3SGI A;  4DR6 L;  1HZ9 A;  5H1S E;  2UU9 Q;  3TEH B;  3K8A A;  1E24 A;  5EAY A;  4BY1 G;  5C3E H;  4LFB L;  2Z0S A;  3S15 H;  4UP8 A;  4JI3 Q;  2UUA L;  4MNO A;  4OWT B;  2QA4 A;  3KYH C;  2EIF A;  4DKA C;  3T1Y L;  3J81 c;  3A74 A;  1QVG A;  1EFW A;  1NY4 A;  2JEB I;  4A75 A;  4DV6 Q;  3ER0 A;  1BBW A;  3BZC A;  2ZTC A;  1XMQ Q;  1S72 A;  3HOV H;  2KBN A;  1T9H A;  2XTI A;  4JI6 Q;  1FJG L;  3J80 i;  1XJV A;  1C7Y A;  4PZ7 A;  4JI1 Q;  2L15 A;  4IPG A;  2B63 H;  2ID0 A;  4A93 G;  2CFM A;  4OXP A;  3PO3 G;  4BXX G;  1XPU A;  2UU9 L;  3TS0 A;  1PH9 A;  1G6P A;  4H02 A;  3ULJ A;  2K5V A;  2VQE Q;  4GOP B;  4JI3 L;  1YIT A;  3CCL A;  4BY7 H;  1MJC A;  1JE5 A;  2UUB L;  1Q46 A;  4DV2 Q;  1Z47 A;  4POG A;  4DV7 Q;  5GQO A;  3KLW A;  3U4Z A;  2PMZ E;  3NEM A;  4DV6 L;  2MQH A;  3G4S A;  5C3E G;  3CCS A;  1XMQ L;  4PZ8 A;  3CCR A;  1QVF A;  4JI6 L;  1NBW A;  4J15 A;  1YBY A;  4HIK A;  2CWA A;  4LF9 Q;  2NVT H;  2Y0S G;  2A8V A;  4LF7 Q;  1X9N A;  3J81 i;  4A3L G;  4JI8 Q;  1KRS A;  2DGY A;  3STB D;  5M5W H;  3HOV G;  4A3I H;  4A4I A;  1L0W A;  4GNX C;  3HOY H;  1C9O A;  2VQE L;  1Q12 A;  3M4O H;  1WYD A;  4JBK A;  3I7F A;  4JC0 A;  4DV2 L;  2B63 G;  4DV7 L;  1FVI A;  1FGU A;  1G29 1;  1UE5 A;  3F2D A;  4A3D G;  4OWX B;  3ZJY C;  2K52 A;  1V9P A;  1C0A A;  2YTX A;  3K7U C;  4YWK A;  4DV5 Q;  1QUQ B;  3RNU A;  4OON A;  2MNA A;  1OXX K;  4LF9 L;  1LTL A;  4JBJ A;  4O0A A;  1QUQ A;  1KRT A;  3F2C A;  1VS0 A;  4LF7 L;  1TWA H;  1SRO A;  4AQY Q;  2R92 G;  4JI8 L;  1A8V A;  2IHE A;  2NZO A;  4GNX A;  1FL0 A;  4JYA Q;  1VCI A;  3M85 A;  2XGT A;  3BU2 A;  2WB1 E;  4QGU A;  3KOJ A;  4GN4 B;  4JG2 A;  4WJ4 A;  1Z9F A;  4YCW A;  5IYC G;  4GLX A;  1HNZ Q;  1NJI C;  1VQB A;  4GN3 B;  4A3I G;  4UY8 C;  3CAM A;  4DV5 L;  3HOX G;  3D0F A;  1JB7 A;  4R1J A;  1LM0 A;  2R93 G;  1GKH A;  1AH9 A;  1PH8 A;  1KIX A;  4PZ6 A;  1HR0 L;  3FHW A;  4AQY L;  3GTQ H;  1VQ4 A;  1G51 A;  4JYA L;  2JA5 H;  2UXC Q;  5JJL A;  1X65 A;  4L5R C;  2OTJ A;  3HFZ B;  3I4N G;  1SMX A;  3TRZ A;  4ME3 A;  4R4O A;  1HNZ L;  1YJN A;  2OWO A;  3UE1 A;  1GVP A;  3CPW A;  3CMA A;  1HZB A;  2GVA A;  2V1C C;  2C35 B;  3AFP A;  2B3G A;  2Q2T A;  5M3M H;  1HH2 P;  1K8G A;  1CSP A;  1WCM H;  2B29 A;  3HKS A;  1XPO A;  1UWV A;  4YHH Q;  2UXB Q;  1V43 A;  3PUX A;  1YNX A;  1LYL A;  2PNH A;  1YHQ A;  1MKH A;  1P8L A;  2UXC L;  2KEN A;  3U4V A;  4QJF A;  5C44 G;  1NTG A;  1Q1B A;  2D0O A;  5C4X G;  1W3S A;  4HIO A;  4OO1 I;  1EIF A;  5K36 G;  1UE7 A;  5IP9 G;  3JC6 6;  4P75 A;  1Y1W H;  1EQR A;  1Q86 C;  5M3F G;  1PA6 A;  4BY1 H;  2AWN A;  1A63 A;  3KF6 A;  3H0G G;  1O7I A;  4YHH L;  2UXB L;  4L5T A;  1IL2 A;  1EUJ A;  2R7F A;  4RMF A;  1SLJ A;  4YY3 Q;  3L2P A;  4DNI A;  4DR5 Q;  2HT1 A;  4BA2 I;  1Y14 B;  4R4C A;  3RN2 A;  4YWM A;  1GM5 A;  2OQ0 A;  3LGJ A;  3PIO A;  1WFQ A;  4YCU A;  3ULL A;  3GDE A;  2K50 A;  5M5X H;  4XTC S;  1VQ9 A;  2N8N A;  3KDF B;  4PG3 A;  1VQE A;  4BXX H;  5M5Y H;  5GAH C;  2NVX H;  1X54 A;  1XNQ Q;  2MO0 A;  1N8R C;  1CKM A;  3I56 A;  1RL2 A;  3CCJ A;  1Y1W G;  2Q2H A;  1OTC A;  4IFD G;  4YY3 L;  4DR5 L;  3PUV A;  4GN5 A;  3S2H H;  1EYG A;  4OO1 G;  2D0P A;  1K0R A;  1WI5 A;  4DR1 Q;  3CC4 A;  2I5M X;  1TWF H;  2UUB Q;  1S40 A;  3KF8 B;  4DPG A;  3GD7 A;  4DV3 Q;  1L1O B;  5C4J H;  4JI2 Q;  3S1M H;  2A19 A;  4A3L H;  3PO2 H;  1DGS A;  5GRO A;  4BA1 I;  4DUY Q;  2N78 A;  1L1O A;  3HOZ H;  3AYH B;  1XNQ L;  2JEA I;  5IP7 G;  3GTM H;  3UE0 A;  4IPC A;  1HNX Q;  4O2D A;  5GAD C;  2IX1 A;  3CCU A;  2OTL A;  1KC8 C;  1AE3 A;  3CP0 A;  4A3D H;  5J3B A;  3PF4 A;  2JQO A;  4C2M H;  1OXT A;  3S1N H;  1HJP A;  1Y1V H;  1JJ2 A;  1LUZ A;  4DR1 L;  5ELN A;  4C3H H;  3U50 C;  5JJK A;  3MEF A;  4DV3 L;  3OW2 A;  1V1Q A;  2Z6K C;  1KXL A;  2JJQ A;  4GKK L;  1XPR A;  1D8L A;  4IO9 A;  3RN5 A;  4NPS A;  1RIP A;  2ES2 A;  4JI2 L;  2R92 H;  3S24 A;  2E2I H;  4DUY L;  1YHB A;  1OXS C;  1SFO H;  4NXN Q;  1NMG A;  1HNX L;  5ELO A;  2E5L Q;  2E8G A;  1JJC B;  2HHH Q;  2RHS B;  2IHF A;  5IYC H;  4LF8 Q;  2JK8 A;  1VQC A;  4C3J H;  4HJA A;  3S17 H;  3I55 A;  3HOZ G;  3B6Y A;  3PO2 G;  1IZ6 A;  3K81 C;  2R7Z H;  4LUZ A;  2K75 A;  3H15 A;  1ASZ A;  3HOX H;  4DK6 C;  5JJI A;  1HZC A;  2QGQ A;  3UDF A;  5HY6 A;  2R93 H;  3AFQ A;  3CCV A;  1HR0 W;  3K80 C;  2MFI A;  1XNR Q;  4TVA B;  2WP8 J;  3CXC A;  1YJ9 A;  1K9M C;  2UUC Q;  1Y1V G;  1B7Y B;  1GO3 E;  1PFS A;  1U5K A;  1X3E A;  4NXN L;  1XMO Q;  1Q82 C;  3J81 j;  1JT8 A;  5FJ8 G;  3FKI H;  4HJ5 A;  2E5L L;  4GNX B;  2PI2 A;  2HHH L;  4UPA A;  1HR0 Q;  3I4N H;  4LF8 L;  4GKJ L;  2WAQ E;  2ZJP A;  1VQM A;  3M4Q A;  1YHA A;  1M1K C;  4JI4 Q;  3GTP H;  1OXU A;  2NVY H;  2Q2I A;  3FP9 A;  5HGQ A;  1XNR L;  2ZM6 L;  2AMC B;  3GTK H;  2UUC L;  2R7Z G;  4FDB A;  1XMO L;  1VQ6 A;  1TWH H;  5C44 H;  3GTG H;  2R7D A;  1I50 H;  4BBS H;  3PV0 A;  1IYJ B;  1Q1E A;  4IJH A;  2ZTE A;  1VQP A;  3HKZ G;  5IP9 H;  4GKJ Q;  2LSS A;  3FKI G;  2I5L X;  1D7Q A;  1PH2 A;  4QQB X;  5M3F H;  4DV0 Q;  4LUO A;  4JI4 L;  1MIU A;  2I5H A;  4NB3 A;  3JAM c;  3T1H Q;  3H0G H;  5FLX c;  2K4K A;  2RHQ B;  3DLL A;  4L5Q A;  4R4I A;  1E1O A;  2ZJQ A;  1YVC A;  4EX5 A;  2PQA A;  4DR3 Q;  3RLN A;  1PH3 A;  1J5E Q;  2VY3 A;  3GO5 A;  4JCV E;  4R4Q A;  3TQY A;  4KLK A;  5LMU Q;  5GAE C;  1CKO A;  1R9T H;  2DUD A;  4DR7 Q;  5IYB H;  4A3F G;  1VQF A;  4B3T Q;  5C0X I;  1Q8K A;  3PIP A;  3CCQ A;  2JA7 H;  1JJG A;  3RLO A;  2IX0 A;  2K5H A;  1PH4 A;  1JMC A;  4IFD I;  3PSI A;  4IOC A;  4DV0 L;  4JI5 L;  2K14 A;  3S1Q H;  4BBS G;  3MXN B;  3CCE A;  3T1H L;  3F2B A;  1UE6 A;  3IRB A;  1I6H H;  4DR4 L;  1Q81 C;  4B3R Q;  3KF6 B;  3CW2 C;  1IBM Q;  3M3Y H;  1HNW Q;  3CME A;  4DR3 L;  1VQ5 A;  3ULP A;  1GD7 A;  2YTV A;  3KJO A;  3A0J A;  2BH8 A;  5LMU L;  1J5E L;  4DR7 L;  2KHI A;  3JAM i;  1SRU A;  2GN5 A;  4X62 Q;  4HJ8 A;  4LUV A;  4B3T L;  3OYY A;  1K8A C;  3RZO H;  3UDX A;  5IT9 c;  4POF A;  3HOU H;  1PH6 A;  1X6O A;  2GVB A;  1I3Q H;  3NBH B;  3E0E A;  4QIW E;  3WWV A;  3GTJ H;  3HOW G;  2WAQ G;  5IP7 H;  2HIV A;  3G6E A;  5IYB G;  3S16 H;  2HIX A;  4DUZ Q;  4A3M G;  1EQQ A;  1EIY B;  2JA7 G;  3I4M H;  3PF5 A;  2AHO B;  4XIG S;  3W1B A;  3KJP A;  4LF6 Q;  4B3R L;  1IBM L;  1HNW L;  2IY5 B;  2EXD A;  4KHZ A;  3CCM A;  5C0X G;  2VUM H;  3GTL H;  1ASY A;  3CF5 A;  1B70 B;  2KCT A;  4X62 L;  3PUW A;  2JA9 A;  3S1R H;  2NN6 I;  5C4X H;  4IJL A;  3PUZ A;  4ALP A;  1E22 A;  1TWG H;  2N49 A;  1VQD A;  1X55 A;  1VQH A;  4DUZ L;  1X3G A;  5FLM H;  3GTO H;  1XTD A;  3ERS X;  4BBR H;  2K5N A;  4GKK Q;  1VQ7 A;  4L5S A;  4LF6 L;  3HOU G;  4DV4 Q;  5BR8 Q;  4QY7 A;  2F4V Q;  4HJ7 A;  3HKZ E;  4IPD A;  4GS3 A;  4OX9 Q;  3I4M G;  3E9I A;  2ATW A;  3I2Z A;  4JI0 L;  1VQJ A;  4JOI C;  4P73 A;  1CKN A;  4NXM L;  2VUM G;  3M9B A;  5FJ8 H;  1N34 L;  1CUK A;  3EIV A;  4GLV B;  3S14 H;  4DV4 L;  1BBU A;  4KI0 A;  4AYB E;  2CKZ B;  2CCZ A;  3M7N A;  5BR8 L;  1TXY A;  1VQA A;  1SE8 A;  4R4T A;  4GOP C;  1A62 A;  3U58 A;  2F4V L;  1S3O A;  4A3K H;  2NN6 G;  2Q2U A;  5FLM G;  4OX9 L;  4BBR G;  1A0I A;  1EWI A;  3OTO Q;  4DAM A;  2I0Q A;  2AKW B;  1IXR A;  4JOI A;  4DK3 C;  1H95 A;  2RCN A;  1I5F A;  4HIM A;  4YCV A;  2UXD Q;  2H5X A;  2Z6K A;  1SN8 A;  4EQ5 A;  1PYS B;  3A5U A;  4A3C G;  4QL5 A;  4RG1 A;  1B8A A;  2ZM6 Q;  1KL9 A;  3PGZ A;  3F8T A;  4GOP A;  4LF5 Q;  1VQ8 A;  3L7Z C;  5DLQ E;  5JEA G;  4LFC Q;  1PVO A;  2A1A A;  4A3E H;  2EQS A;  3EN2 A;  1X3F A;  3NEL A;  1VQN A;  2BA1 A;  3OTO L;  1BVS A;  1QZG A;  3W5O A;  4JI1 L;  1P16 A;  4LF4 Q;  3A5Z B;  1YIJ A;  1VQL A;  4JI7 Q;  2QEX A;  4AH6 A;  4A3K G;  2UXD L;  1U0L A;  4A3G H;  4HID A;  2NZH A;  3Q8D A;  2AWO A;  3RLF A;  1VQG A;  3RR5 A;  4A76 A;  3TS2 A;  2WFW A;  5AJ3 Q;  1QVC A;  4A3F H;  4LF5 L;  3I4O A;  4LFC L;  4A3B H;  4A3J H;  5C0X J;  2PI2 E;  1X56 A;  2KCM A;  5E7N A;  3H3V I;  5LMN W;  4BY7 G;  2OQK A;  3CQZ H;  2YYZ A;  4AIM A;  1N33 Q;  5GAG C;  4IFD J; 
#chains in the Genus database with same CATH topology
 3H3V H;  3SK8 A;  1EL0 A;  4A3E G;  5KRU A;  3DM3 A;  5T1G A;  2E75 C;  2K7V A;  4K5X A;  3DWQ A;  5AJ3 L;  2L9H A;  1Y8P B;  1PLF A;  3LX0 A;  4DR4 Q;  2CW0 C;  5M5X B;  2RF4 A;  4G7O C;  4FYD A;  2F52 A;  1VQI A;  4KY6 A;  3CPF A;  3BJU A;  4A3M H;  3K7A H;  4B3M L;  1W2B A;  1Q8I A;  3S2H B;  4B3S L;  1UUP A;  4DAY B;  4TQU S;  2N3S A;  5CC4 A;  4IPH A;  1PH5 A;  4LNQ A;  1IBL L;  3DEO A;  1AE2 A;  1J6Q A;  4X65 Q;  5BN3 A;  1YJW A;  2VQF Q;  2VXW A;  2BA0 A;  3PMF A;  2ZTD A;  4C3I G;  3CC2 A;  3QWN A;  1DXM A;  1N36 L;  3CRK C;  1VQO A;  4NKL A;  2KOL A;  3E5S A;  2JA6 G;  3VDY A;  4DV1 Q;  3ICE A;  4DF7 A;  1IBK L;  4KHP L;  1HZA A;  4P71 A;  5KND A;  4ZRZ A;  4C3H B;  1KHI A;  2Y0S E;  1I94 L;  1N32 L;  2KCC A;  2Q8T A;  1I4Q A;  2EOT A;  4QMG A;  1WOC A;  1PTO D;  3M4P A;  3OWF A;  1VQK A;  1SAP A;  1YZ6 A;  4DR6 Q;  3S17 B;  4N8F A;  2JYO A;  3H91 A;  4LFB Q;  2FXQ A;  1PH7 A;  2O4X A;  5EQ0 A;  2HUG A;  1CZW A;  3W1G A;  1D2B A;  1NMF A;  1LTS D;  2JE6 I;  2R93 B;  4F7X A;  1TS2 A;  1OXV A;  1PRT F;  4JV5 L;  3EBE A;  2EVB A;  3OPO A;  3MFY A;  2PZW A;  1K3R A;  4P72 A;  1FJG Q;  1AP0 A;  3FKI B;  1L1O C;  1CKN B;  3KDF A;  3J7A 5;  4A3C H;  2PZU A;  3OHX C;  3SGI A;  3I4N B;  3VYT A;  1HZ9 A;  4IZ8 A;  2A6H D;  5EAY A;  4BY1 G;  2Z0S A;  4UP8 A;  2UUA L;  2K05 A;  4OWT B;  4OL7 A;  4DKA C;  5FLX E;  3A74 A;  1QVG A;  1EFW A;  1NY4 A;  4A75 A;  4DV6 Q;  3GTK B;  5FO7 B;  1H9S B;  2KBN A;  2F0L A;  5A2Q L;  4RHR A;  5M9O A;  2L15 A;  4IPG A;  4A93 G;  2ID0 A;  1FYC A;  1XPU A;  1PH9 A;  2IL8 A;  5DEH A;  4GOP B;  4JI3 L;  1MJC A;  4POG A;  3KLW A;  3NEM A;  1XMQ L;  5EBC A;  3BYT B;  3NWT A;  1NBW A;  2Y0S G;  4LF7 Q;  3J81 i;  4A3L G;  4JI8 Q;  2DGY A;  1KAA A;  2A69 C;  1B3A A;  1B9N A;  4DV2 L;  2B63 G;  1HFN A;  1FVI A;  1G29 1;  1QNU A;  3TZD A;  4OWX B;  2BE5 D;  3EVQ A;  3R2I A;  3BS1 A;  4YIJ A;  2NBF A;  3SDZ A;  1CK1 A;  4L63 B;  2WAC A;  2F0P A;  4ULL A;  1DYQ A;  3F2C A;  5CYU A;  1QB5 D;  1SRO A;  3J7A V;  4RA8 A;  1A8V A;  2NZO A;  1Y8N B;  4KY5 A;  1VCI A;  2WB1 E;  4QGU A;  3KOJ A;  4JG2 A;  4FF4 A;  3JAM L;  4GLX A;  4R9W A;  4K5W A;  1SNP A;  3HOX G;  1AN8 A;  3D0F A;  1D5Z C;  5CMD A;  4ZUI A;  1KIX A;  5JPM C;  4H7B A;  1CZG A;  5C4X B;  3MZ5 A;  1H9R A;  1EFI D;  1F2Y A;  1X65 A;  5JJL A;  2O5I C;  3HFZ B;  3TRZ A;  3MXG A;  2RBM A;  3X3N A;  2EDG A;  1YJN A;  1HNZ L;  3DUZ A;  1B53 A;  3TBI B;  1LAB A;  2D9U A;  2C35 B;  2B2W C;  4X3T A;  1YNX A;  4DK1 A;  1FNU A;  1LYL A;  1EYA A;  4CKE A;  1YHQ A;  3CRL C;  4QJF A;  5C44 G;  2D0O A;  3LWE A;  4XDX A;  4DAV A;  5F2D A;  5EBD A;  1UE7 A;  1Y1W H;  5JVG 3;  1TR5 A;  2VB2 X;  2A6E D;  5M3F G;  3A55 A;  3AMU A;  3FPU B;  1C48 A;  1O7L A;  1J8I A;  2QEJ C;  4L5T A;  1IL2 A;  1EUJ A;  1SLJ A;  4IUR A;  4YY3 Q;  1BR9 A;  3NQI A;  1ET9 A;  3RN2 A;  2OQ0 A;  2V4D A;  1LLR D;  4IN3 A;  1WFQ A;  1PYW D;  2Q8R E;  2Q8I B;  2N8N A;  4BXX H;  2QDB A;  1HUM A;  5E4X A;  1XNQ Q;  1X54 A;  2QIL A;  2BOS A;  4A3E B;  2Q2H A;  1K8O A;  1PTO H;  4DR5 L;  3PUV A;  1CA6 A;  3FDT A;  1K0R A;  1WI5 A;  1NSN S;  4DPG A;  3GD7 A;  5ELE A;  3R2T A;  2B8F A;  2N78 A;  3AYH B;  2JEA I;  4IPC A;  4O2D A;  2OTL A;  1AE3 A;  3CP0 A;  4A3D H;  5J3B A;  4C2M H;  3TN2 A;  1OXT A;  3S1N H;  2E2H B;  1HJP A;  3VR2 A;  5ELN A;  3OW2 A;  1V1Q A;  2JJQ A;  2L55 A;  4C3I B;  4GKK L;  1XPR A;  1D8L A;  1EWC A;  3RN5 A;  4NPS A;  4JI2 L;  3EFX D;  1OXS C;  1SFO H;  4NXN Q;  1NMG A;  1HNX L;  1YNJ C;  5I6W A;  2JA6 B;  2E8G A;  3HOW B;  1EYC A;  1BCP D;  1SJH D;  4V19 0;  4LF8 Q;  3NP8 A;  4HJA A;  1TT2 A;  3C2P A;  3B6Y A;  4K8J A;  1IZ6 A;  3K59 A;  1AFP A;  2R7Z H;  2B2V C;  5JJI A;  2QGQ A;  4KV6 A;  5HY6 A;  4O1N A;  3WDN A;  1XNR Q;  3CXC A;  1K9M C;  1I4P A;  1Y1V G;  3S9W A;  1GO3 E;  1U5K A;  3J81 j;  2SDF A;  2VB3 X;  2PI2 A;  2BDN A;  4QF4 A;  5A35 A;  3J7Y W;  4OEM B;  1BOS A;  2ZXO A;  3GTP H;  1UAP A;  3EQL C;  4C3J G;  2CH4 A;  3FP9 A;  2B2T C;  3HP3 A;  4FDB A;  4XQQ A;  1PDQ A;  1ILP A;  1TWH H;  3I8Z A;  2C5C A;  4BBS H;  1IYJ B;  1HTL D;  4RGN A;  2B2U C;  1VQP A;  3FPP A;  5JVH 3;  2I5L X;  3I70 A;  1TS5 A;  3U9S A;  5KIX A;  2AUK A;  3H0G H;  2K6A A;  3URY A;  1E1O A;  3ND9 A;  4A93 B;  3BZD B;  3TQY A;  4KLK A;  3M7G A;  1CKO A;  1R9T H;  1STN A;  3VA5 A;  1RDP D;  4A3F G;  5C0X I;  1Q8K A;  2X6G A;  3CCQ A;  2F4I A;  2K5H A;  2K01 A;  4HTH A;  3S1Q H;  4DV0 L;  4JPB W;  3CCE A;  2HD3 A;  1UE6 A;  2WV6 D;  1F9P A;  4DK0 A;  1I6H H;  3MXN A;  2Y0S B;  4B3R Q;  3TP6 A;  3CW2 C;  3M3Y H;  2G9D A;  1LV9 A;  4DR3 L;  2PYK A;  3K57 A;  3ULP A;  1J5E L;  2F0F A;  1EWH A;  1ICW A;  4DR7 L;  3V05 A;  2KHI A;  4KJO A;  4B3T L;  3OYY A;  1K8A C;  3RZO H;  4K6L A;  3UDX A;  2B63 B;  2TSS A;  3NBH B;  4QQB X;  2HQE A;  3G6E A;  5IP7 H;  3S16 H;  4F8M A;  2HIX A;  4A3M G;  1EQQ A;  2JA7 G;  3I4M H;  3PF5 A;  2AHO B;  3D6C A;  3I91 A;  1IBM L;  1HNW L;  2EXD A;  4Q0F A;  3CCM A;  5C0X G;  3GTL H;  1ASY A;  4H0L C;  2OF1 A;  1B70 B;  2EYL A;  1D5M C;  2NN6 I;  2RVL A;  1BCP B;  2R61 A;  1S5C D;  1SJE D;  2MP1 A;  1E22 A;  1TWG H;  2EYH A;  1VQD A;  1TVX A;  2HCI A;  2KVM A;  4OEL B;  1VQH A;  2B39 A;  4U68 A;  3M4O B;  3HOU G;  4RGO S;  1RF2 D;  4DV4 Q;  4QY7 A;  2F4V Q;  4QUF A;  4HJ7 A;  1G2T A;  1LT5 D;  5COR A;  4DNR B;  4H44 C;  3E9I A;  1QIL A;  1W6J A;  5D65 A;  5LL6 X;  1VQJ A;  1TWA B;  1CKN A;  1PFB A;  3RD4 A;  1A3U A;  2Z4H A;  1N34 L;  3HGB A;  1CUK A;  3S14 H;  1Z6H A;  2K28 A;  4KI0 A;  4CDC C;  1ZYR C;  1VQA A;  1SE8 A;  3U58 A;  1WTP A;  1C8C A;  2NN6 G;  2Q2U A;  1A3T A;  1A0I A;  3OTO Q;  2D2C C;  4KD4 A;  1H9S A;  1IXR A;  4JOI A;  4DK3 C;  3T4A C;  2RCN A;  3QO2 A;  2AQ3 B;  2F0T A;  4HIM A;  1G2S A;  2H5X A;  2Z6K A;  4TKO B;  4DU9 A;  3A5U A;  4I7Z C;  4A3C G;  4QL5 A;  1JOO A;  4IUP A;  4RG1 A;  2Z4I A;  1KL9 A;  3VYS A;  4GOP A;  5COY A;  5DLQ E;  4LFC Q;  2A1A A;  1S4Z A;  5FO8 B;  3RMH A;  2K5D A;  1G91 A;  4H13 C;  2KQ3 A;  3NEL A;  4ZYS A;  3Q24 A;  5M3M B;  4JI1 L;  1RTN A;  1VQL A;  4A3G H;  2F0J A;  2NZH A;  2WB1 B;  3RLF A;  1VQG A;  5KYI A;  3RR5 A;  4A76 A;  1WD1 A;  5AJ3 Q;  3MAQ A;  1QVC A;  1A15 A;  4DXG A;  5C0X J;  1VF5 C;  2PZT A;  2M00 A;  2EJG C;  3CQZ H;  4IOA A;  2Z8L A;  3BZK A;  4XYQ A;  1EY8 A;  4DAP A;  3E6Z X;  3KLS A;  4GLA C;  4B3M Q;  4WOR A;  2K03 A;  2KUM A;  1G6Z A;  1JQY D;  4JI5 Q;  4PMW A;  4B3S Q;  2CQA A;  3J81 E;  2PQA B;  4R8I A;  1IBL Q;  4WJ3 M;  1CA5 A;  1WTW A;  3UDG A;  4FVM A;  1L0Y B;  1MSG A;  1N33 L;  1F9Q A;  1SMY C;  4OWW B;  1JE4 A;  1N36 Q;  4K0K L;  5LMN L;  1IBK Q;  3RZD H;  2NB0 A;  2L5T A;  3RUZ A;  4KHP Q;  1JOQ A;  4LFA L;  1TWF B;  3CD6 A;  2E76 C;  1E3P A;  2F3I A;  3TP7 A;  5C4J B;  1I94 Q;  5IYD G;  1N32 Q;  3S1M B;  1S5B D;  4LK1 C;  2LMC B;  3GTM B;  2ALY B;  4V0B A;  1KNE A;  2EYF A;  2F0G A;  5IE8 A;  4X64 L;  3E9H A;  3FEW X;  2F0W A;  2JA8 G;  1Y1V B;  1N9W A;  1EU4 A;  2OCE A;  1K73 C;  2VNU D;  3PCO B;  1MJE A;  3AQQ A;  4NDX A;  1ONL A;  2DY8 A;  3L0O A;  4X3U A;  1IYU A;  4JV5 Q;  2R92 B;  3NSW A;  4Y52 H;  4HR7 B;  2E2I B;  1H9J A;  2PW5 A;  3I3C A;  2D62 A;  2RSO A;  1KD1 C;  4X66 L;  1ENA A;  2CW0 D;  2OT2 A;  3KUP A;  4JI0 Q;  2CWP A;  4C3J B;  1AZP A;  2A74 C;  1NR4 A;  1K28 A;  2KHJ A;  3QOJ A;  1KAW A;  2UUA Q;  3GQB A;  1Y8O B;  2ZJR A;  4LAA A;  3STB C;  1KDC A;  3S2D H;  1QZH A;  1BDO A;  3F1Z A;  1CI3 M;  3HS0 C;  1GUS A;  5C5M A;  1TS3 A;  1E24 A;  5C3E H;  3S15 H;  4JI3 Q;  3SE0 A;  4MNO A;  2ZXR A;  4CJ0 B;  3KYH C;  2EIF A;  3T1Y L;  3J81 c;  2RDG A;  2NVY B;  1CM9 A;  3H3V C;  2JEB I;  3QOL A;  3ER0 A;  1EIG A;  2MHV A;  1XMQ Q;  2XTI A;  1NUC A;  1EEI D;  1B9M A;  3P1H A;  1C4Q A;  4PZ7 A;  5DNF A;  1E2V A;  2P5Z X;  4OXP A;  3PO3 G;  4BXX G;  3DM1 A;  4K8I A;  1G6P A;  1PMR A;  4BY7 H;  1PFM A;  1XXG A;  2XWB B;  4CJ2 C;  2F3V A;  2EY2 A;  5I4D A;  2L12 A;  4HMJ A;  2O2L D;  4DV2 Q;  3U4Z A;  2PMZ E;  5C3X A;  3CCS A;  2F03 A;  5ELD A;  3TDQ A;  1QVF A;  4JI6 L;  5E4W C;  1ILQ A;  4HIK A;  2CWA A;  2A8V A;  1X9N A;  3DXJ C;  1KRS A;  3HOV G;  2JA7 B;  2CVR A;  3G6J B;  4GNX C;  3HOY H;  1LT4 D;  4I7A A;  4DV7 L;  1FGU A;  4A3D G;  4IUN A;  4RAU C;  2K52 A;  1V9P A;  3ZJY C;  1C0A A;  3K7U C;  4YWK A;  5JPN C;  3RNU A;  1STB A;  4LF9 L;  3NQT A;  4JBJ A;  1QUQ A;  4O0A A;  1VS0 A;  2PO4 A;  1FL0 A;  2HCC A;  4B9W A;  3BU2 A;  3E3X A;  4PQX A;  3OIQ A;  3GTJ B;  1HNZ Q;  1NJI C;  4IUU A;  4A3I G;  4UY8 C;  2H1E A;  2A5H A;  1ET6 A;  4RFB A;  4DV5 L;  3VYR A;  1JB7 A;  1B2T A;  3X3M A;  1HR0 L;  3A7A B;  3FHW A;  4AQY L;  1JC7 A;  1YNN C;  3MEH A;  1EIH A;  5EPK A;  4K2K A;  5K36 H;  3S1R B;  1Q3L A;  4JYA L;  1G51 A;  4KK7 A;  2JA5 H;  4L5R C;  1GXD C;  3GTO B;  1TII D;  2G5D A;  1F2M A;  3WOE A;  2Q2T A;  2A69 D;  1K8G A;  4EVO A;  1WCM H;  2SNM A;  3BYY B;  3W3A A;  2K5Q A;  3V2T A;  3D3R A;  1MKH A;  1P8L A;  2KEN A;  4M1U B;  4HIO A;  1GUN A;  2O5J C;  1G8Z D;  3H6M A;  1D6E C;  2FHT A;  3KK7 A;  3NUC A;  1PA6 A;  4OO1 H;  5E1F A;  1FGB D;  1K8M A;  1O7I A;  3H0G G;  1EY4 A;  3HZX A;  5DM6 3;  2R7F A;  4DR5 Q;  1WTX A;  4DNI A;  2HT1 A;  1Y14 B;  2KA7 A;  1EY7 A;  3LGJ A;  3PIO A;  3GDE A;  3NBH A;  5M5X H;  1PRT C;  2WKC A;  4G7H C;  1KTK A;  4KMU C;  3T13 A;  3M4Y A;  1OTC A;  4N8X 1;  4GN5 A;  3S2H H;  4K2L A;  1EYG A;  3KLR A;  1VMP A;  3CC4 A;  3QG1 A;  2DY7 A;  3VR3 A;  2UUB Q;  1L1O B;  2DN8 A;  4JI2 Q;  2A19 A;  3GV6 A;  3NWS A;  2Z9H A;  4N9T A;  5G3L F;  5IP7 G;  1HNX Q;  2F0E A;  2IX1 A;  1KC8 C;  1A6X A;  5NUC A;  2E2J B;  2JQO A;  1JJ2 A;  4Y7N B;  4C3H H;  1O7Y A;  5JJK A;  2Z6K C;  3GP7 A;  5IGE A;  3TP8 A;  2JA8 B;  1TWC B;  2IHF A;  4MHE A;  2JK8 A;  5IT9 E;  3S17 H;  3PO2 G;  3HOZ G;  2HDM A;  3D4D A;  3K81 C;  2AQ2 B;  1ASZ A;  4XXE A;  1T5E A;  2R93 H;  3CCV A;  1HR0 W;  3BDC A;  2KEC A;  3QR8 A;  1MSH A;  4TVA B;  3N6R A;  1YJ9 A;  1ZEQ X;  3OMC A;  1X3E A;  4QUC A;  1RJT A;  3FKI H;  2EYJ A;  4HJ5 A;  1VMC A;  3EJI A;  2HHH L;  5EKK A;  5CV7 A;  1WTV A;  3I4N H;  5D3I B;  1GUG A;  2N88 A;  5AFW A;  3M4Q A;  4HSP A;  1I3Q B;  4HCS A;  2K33 A;  4DNT B;  1OXU A;  3GTK H;  3BVM A;  5CV8 A;  2UUC L;  1VQ6 A;  2JXM B;  4CDF C;  1U9R A;  3BDO A;  1K83 B;  3PV0 A;  1STY A;  4IJH A;  4C1N I;  3HKZ G;  5IP9 H;  2PPB C;  2LSS A;  1U4P A;  3PIP 3;  1PH2 A;  3SEB A;  1YNJ D;  2YU9 B;  4DV0 Q;  5D14 A;  3K5O A;  4JI4 L;  5C5L A;  1MIU A;  2I5H A;  2ZT9 C;  4NB3 A;  2NVQ B;  1PTO F;  1PTO C;  5BN4 A;  2DJG C;  5FLX c;  1SE2 A;  2RHQ B;  4R4I A;  1YVC A;  4EX5 A;  1DOL A;  2PQA A;  5HGT A;  3RLN A;  4DR3 Q;  1PH3 A;  1J5E Q;  3PO3 B;  4R4Q A;  4DR7 Q;  1E2Z A;  5IYB H;  2RCF A;  4CDE C;  1KDB A;  4B3T Q;  3PIP A;  1WTO A;  2EY1 A;  2SEB D;  3NHH A;  3RLO A;  2IX0 A;  1PH4 A;  1TQO A;  2QF7 A;  3PSI A;  2NYZ D;  3T1H L;  3F2B A;  3IRB A;  4DR4 L;  1SYC A;  4IFD H;  1CTM A;  1TS4 A;  3KF6 B;  1IBM Q;  1HNW Q;  2A68 C;  3KBX A;  3HOV B;  2L4N A;  2CH4 W;  3MA2 B;  4HJ8 A;  2B2Y A;  5IT9 c;  4POF A;  2GVB A;  3OW7 A;  1I3Q H;  4QIW E;  3E0E A;  1B4O A;  2HIV A;  1DD2 A;  4HED A;  2IY5 B;  2K32 A;  5ELF A;  3K0Y A;  3CF5 A;  4WFN 3;  3PUW A;  2NVT B;  2RDF A;  5C4X H;  4ALP A;  5M5W B;  2GA4 B;  4A3I B;  3ND8 A;  5I2X A;  1X3G A;  5FLM H;  4DUZ L;  3ERS X;  2K5N A;  1VQ7 A;  3J81 L;  4LF6 L;  3BDL A;  5I2Y A;  1QWY A;  4TRD A;  1DM0 B;  2F0M A;  4CHT B;  1RKN A;  3NPP A;  5EGT A;  1F9S A;  4P73 A;  2VUM G;  1ZKO A;  1DCZ A;  1RHP A;  4FP5 D;  5KGU A;  4GLV B;  2PMZ B;  1B50 A;  4AYB E;  3M7N A;  2SNS A;  3Q6S A;  5BR8 L;  4QCL A;  1S3O A;  5IOD A;  4OX9 L;  4BBR G;  3NXW A;  4DAM A;  3GTQ B;  4F88 A;  2KJX A;  3T53 B;  1KNA A;  1DON A;  3OSO A;  3F2U A;  4FF2 A;  3A8J E;  1B8A A;  3OOC A;  2ZM6 Q;  1GHJ A;  3F8T A;  3NBI A;  2SOB A;  1NR2 A;  4A3E H;  4J6H A;  2EQS A;  1FNV A;  1QZG A;  1V1P B;  1P16 A;  1SDF A;  3A5Z B;  2QEX A;  4A3K G;  4KN4 C;  2UXD L;  1U0L A;  3Q8D A;  2AWO A;  1HUN A;  4X3K A;  1PZJ D;  1GOZ A;  1TU2 B;  4MN3 A;  2PI2 E;  1X56 A;  5E7N A;  3H3V I;  4BY7 G;  1D1K A;  1FR3 A;  1NNX A;  4BY1 B;  1N33 Q;  1QJO A;  3TRE A;  4LF4 L;  2E2H H;  3L9A X;  4JI7 L;  4K0K Q;  4ZAI A;  5LMN Q;  1F2L A;  5FKA C;  4C3I H;  4LFA Q;  3G71 A;  1HXY D;  5KNC A;  5J22 A;  4JBW A;  3HOY G;  2JA6 H;  3HOW H;  4LJZ C;  4AYB G;  2NVX B;  3DMU A;  3AEV A;  1II3 A;  4A3B G;  4A3J G;  4X64 Q;  4G4K A;  1O7Z A;  4DGZ A;  1E7Z A;  4DR2 L;  3IAY A;  4J8Q A;  2L1B A;  2YTY A;  1B3Q A;  5KYL A;  1BUV T;  2VW9 A;  1UEB A;  4DAY A;  1ENF A;  4KJN A;  1PV4 A;  1PYB A;  2VS1 A;  3CC7 A;  3PO2 B;  4DFA A;  3HOZ B;  4FF1 A;  1UE1 A;  1SR3 A;  4P74 A;  1I4H A;  1EEF D;  4NW2 A;  1SYG A;  3A54 A;  4X66 Q;  5IWA L;  1T5X D;  1HQM C;  4UP9 A;  3MHB A;  2IWH A;  1WJJ A;  4FF3 A;  5ELC A;  2BH2 A;  2VL6 A;  4LW1 A;  1YEZ A;  2JA5 G;  3I90 A;  5L37 A;  4ODG A;  1BKB A;  2R6G A;  2HQL A;  1PHJ A;  1PH1 A;  1EOV A;  5EPJ A;  2WKD A;  3P75 A;  2J7Z A;  4NXM Q;  1I4X A;  3HOX B;  1WCM G;  1SMY D;  3K6O A;  3KLS X;  4YWL A;  1BCP F;  3T1Y Q;  2ASB A;  4C1N K;  4A93 H;  2J4X A;  1Q7Y C;  1E1T A;  5H1S E;  1HRJ A;  5JEA H;  3WOF A;  4OHJ A;  4CGY B;  4NMZ A;  1RCV D;  2QA4 A;  3D6W A;  3BZC A;  2ZTC A;  1S72 A;  1T9H A;  4JI6 Q;  1EZ8 A;  1WTH A;  2L0C A;  3GTG B;  5C44 B;  3J80 i;  1XJV A;  1C7Y A;  1UEA B;  3C3L A;  1I50 B;  2B63 H;  2CFM A;  1ICF B;  3H09 A;  2UU9 L;  3IFD A;  3ULJ A;  2FMM A;  2JN4 A;  3SVM A;  2F0O A;  5M3F B;  1Q46 A;  4DV7 Q;  5GQO A;  1LTR D;  2MQH A;  3G4S A;  4Q5V A;  1IW7 D;  4PZ8 A;  4J15 A;  4FXG C;  4LF9 Q;  5CV5 A;  2XN9 C;  1CQF A;  3STB D;  4CJ1 B;  4PNY A;  1XX8 A;  1C9O A;  1SBB B;  2VQE L;  3M4O H;  1WYD A;  4JC0 A;  1UE5 A;  3U9O A;  3W2D A;  2YTX A;  4DV5 Q;  4OON A;  2MNA A;  4C3H G;  4M8A A;  1KRT A;  3A8I E;  5TSS A;  1TWA H;  4AQY Q;  2RA4 A;  2IHE A;  2XRQ D;  4JYA Q;  3M85 A;  5ELB A;  2XGT A;  3O13 A;  4GN4 B;  5CR3 A;  1S5D D;  4HCE A;  5FLX L;  1BNZ A;  3FVQ A;  1HPC A;  1DOK A;  4PMC A;  4C56 C;  4R1J A;  5IIF A;  2R93 G;  1AH9 A;  1PH8 A;  2K1B A;  4PZ6 A;  1WTQ A;  1FD7 D;  1VQ4 A;  1R4P B;  1EY6 A;  2IPK D;  3I4N G;  4ME3 A;  3UE1 A;  2ZXP A;  3CPW A;  1J9O A;  4BBR B;  1HZB A;  3CMA A;  2GVA A;  4LMQ D;  3NTK A;  2M2L A;  3HEJ A;  3AFP A;  2B3G A;  4U67 3;  5IGD A;  1S5F D;  5M3M H;  2A73 B;  1HH2 P;  1CSP A;  4XT1 B;  1XPO A;  5C6A A;  1UWV A;  1PXU A;  3PUX A;  1V43 A;  3KBG A;  2PNH A;  5IT9 L;  1X3Q A;  2UXC L;  4QIW B;  1WD0 A;  3G7L A;  1NTG A;  5EKI A;  2EJF C;  1W3S A;  4O42 A;  2PQE A;  1EIF A;  2LS0 1;  5IP9 G;  3JC6 6;  1B1Z A;  3QIA A;  2EYO A;  2F3W A;  5EJW A;  3H94 A;  4KKS A;  3VYU A;  1A3V A;  2B2W A;  2AWN A;  4A3K B;  1A63 A;  3KF6 A;  2H4O A;  1X3P A;  4YHH L;  2UXB L;  1PZI D;  1AW7 A;  4BA2 I;  1O78 A;  4R4C A;  1D1I A;  1HFG A;  4YWM A;  4YCU A;  3ULL A;  1YNN D;  3NTH A;  3VA7 A;  4PG3 A;  1VQE A;  2PW7 A;  1EU3 A;  1ZXT A;  2MO0 A;  1N8R C;  3I56 A;  3CCJ A;  1RL2 A;  2AUJ D;  1Y1W G;  4IFD G;  2TMP A;  4ILW A;  1ENC A;  1AZQ A;  1V1O A;  4FXD A;  1K0S A;  2I5M X;  1TWF H;  3KF8 B;  2Z1C A;  5C4J H;  3Q22 A;  3S1M H;  4A3F B;  5CBA E;  1DGS A;  5GRO A;  1EZ6 A;  4BA1 I;  4A3B B;  4A3J B;  3GTM H;  4RCO A;  3FRP B;  5GAD C;  4UAI A;  1SND A;  1JR0 D;  1Y1V H;  1LUZ A;  4DR1 L;  3U50 C;  3MEF A;  4DV3 L;  1KXL A;  5C4X G;  1Q90 A;  2ES2 A;  1TY2 A;  2R92 H;  2E2I H;  4DUY L;  4ABN A;  4XQN A;  4RKB A;  2EZV A;  2HHH Q;  1CHP D;  2RHS B;  3K5N A;  2R3Z A;  5IYC H;  1VQC A;  2IW3 A;  1PRT D;  4C3J H;  3I55 A;  4A3M B;  1GUO A;  3K7A B;  2K75 A;  5FO9 B;  3R3O A;  4WJW A;  1IHZ A;  2X69 A;  3K80 C;  2MFI A;  2WP8 J;  4KY7 A;  2UUC Q;  1B7Y B;  1JWM D;  1JT8 A;  4RCN A;  2D5D A;  2E5L L;  4GNX B;  1KLG D;  1SYE A;  4UPA A;  3MFG A;  3IFT A;  1SYB A;  4GKJ L;  1FNW A;  2WAQ E;  2ZJP A;  2B2V A;  3QB3 A;  1VQM A;  3HOU B;  5LL6 S;  1BF4 A;  1YHA A;  1V1P A;  1M1K C;  4JI4 Q;  2NVY H;  2Q2I A;  5HGQ A;  5JJZ A;  3AU7 A;  2AMC B;  2R7Z G;  5E3F A;  1XMO L;  1STE A;  2R7D A;  3OMG A;  1Q1E A;  1LO5 D;  4TSS A;  2ZTE A;  3D4R A;  1U4L A;  2PCF B;  4P2C B;  1I4G A;  4LUO A;  3T1H Q;  2B2T A;  4HAE A;  2K4K A;  3DLL A;  4L5Q A;  1EYD A;  2ZJQ A;  2KHS A;  1STH A;  2RKS A;  4HMI A;  2VY3 A;  4L8J A;  4JCV E;  1JCK B;  5C4Z A;  2B2U A;  2F1M A;  1L0X B;  2JA7 H;  4GZY C;  1JMC A;  3OWE B;  4IOC A;  2ENB A;  4BBS G;  4JI5 L;  3MXN B;  5C0X H;  3PIO 3;  4KD3 A;  3CU7 A;  1CFM A;  1QCB D;  4KKT A;  1VQ5 A;  1GD7 A;  1X32 A;  3A0J A;  5LMU L;  3JAM i;  4PMB A;  4I65 A;  3HOU H;  1X6O A;  1BXT A;  3GTJ H;  3HOW G;  3WWV A;  1TKW B;  3ITP A;  2WAQ G;  4EQO A;  3IL8 A;  1SXT A;  3SXH A;  4DUZ Q;  1EIY B;  1BO0 A;  3W1B A;  4XIG S;  3KJP A;  4LF6 Q;  4FXK C;  3E0J A;  4IQZ A;  1AEX A;  1CQV A;  3VR6 A;  5ISR A;  4Z9C B;  2KCT A;  2E2D C;  4X62 L;  2JA9 A;  3S1R H;  1VF7 A;  3PUZ A;  1F77 A;  3UI2 A;  1PRT B;  1X55 A;  2NN6 H;  5LHY 1;  3GTO H;  4GKK Q;  1M8A A;  4L5S A;  4UDU C;  1HA5 A;  1NAP A;  2F0H A;  5BR8 Q;  1DZ1 A;  1O80 A;  3HKZ E;  4WRD A;  5BN5 A;  4GS3 A;  4OX9 Q;  5CV4 A;  3I4M G;  2NZ1 D;  1UNS A;  1K3B C;  4JI0 L;  1PFN A;  4JOI C;  5CBE E;  3NE5 B;  3M9B A;  2A68 D;  3TZU A;  5FJ8 H;  2I07 B;  3EIV A;  3CHB D;  4ZUJ A;  2CKZ B;  4GOP C;  1TXY A;  4R4T A;  3MWY W;  1LTB D;  2F0I A;  4XQJ A;  1EWI A;  4G57 A;  2I0Q A;  1H95 A;  4ME5 A;  4YCV A;  2UXD Q;  1SN8 A;  4OIJ A;  1GUW A;  1RD9 D;  1PYS B;  1VQ8 A;  1EQV A;  1SSO A;  5JEA G;  5DM7 3;  2EYM A;  1LAC A;  1X3F A;  2EY5 A;  3W5O A;  3SHL A;  4LF4 Q;  1Y69 U;  4JI7 Q;  4AH6 A;  4PV1 C;  4HID A;  4G7Z C;  1MD2 D;  4EGV A;  2HDL A;  3J80 E;  3TS2 A;  2WFW A;  4LF5 L;  1Y1W B;  2NUC A;  2KCM A;  5T1I A;  1SNC A;  4OGQ C;  4K5V A;  5CV6 A;  4AIM A;  2YYZ A;  5JOB A;  5I9P A;  2LXJ A;  2E2J H;  3J7Z C;  1NE3 A;  4KHV A;  3MXU A;  3V96 A;  1LTG D;  4EQN A;  3C1E A;  4Y7N H;  4RH6 A;  3NEN A;  1SYF A;  5IYD H;  4RGT A;  4DR2 Q;  4HJ9 A;  4MZ9 A;  4X6A H;  2MO1 A;  2Z6B A;  4A3G G;  2ICI A;  1IL8 A;  3UDI A;  2IJ0 A;  2JA8 H;  4LWC A;  1TWC H;  2XWJ B;  1EY9 A;  5IWA Q;  1S5E D;  1PTO B;  2XNA C;  4EQP A;  4F87 A;  5IY0 A;  1YI2 A;  1HA6 A;  2DNE A;  2YV5 A;  1DOM A;  2K5W A;  4ID6 A;  2QW7 A;  2A6H C;  5JAV A;  4JBM A;  1F9R A;  5FOB B;  1H9K A;  2IT1 A;  4MTN A;  1KQS A;  1XWE A;  2CQO A;  1ROD A;  4A3D B;  4C2M B;  3S1N B;  2IX3 A;  1M90 C;  3KFU A;  3HRZ C;  3Q0A A;  4K6D A;  4X65 L;  1GJX A;  5JEA J;  1STA A;  1L2F A;  1STG A;  2VQF L;  4FNF A;  2MUY A;  3PUY A;  1SFO B;  1K83 H;  3D31 A;  2AQ1 B;  3K0X A;  2WIN B;  2LXK A;  2EYP A;  1JWS D;  3EA6 A;  3ONA B;  4DV1 L;  2YU9 H;  2R7Z B;  2QDL A;  2VZA A;  5M3M G;  1N34 Q;  2NVQ H;  3J80 c;  4N9P A;  1EY0 A;  2J0T D;  2WB1 G;  3G48 A;  4UP7 A;  3PO3 H;  2K04 A;  5IOC A;  4APV A;  1JOR A;  3NK9 A;  1CSQ A;  4DR6 L;  4CDD C;  2BE5 C;  4KKU A;  2UU9 Q;  3N52 A;  3TEH B;  3K8A A;  4LFB L;  3A8K E;  1OO9 B;  4NP5 A;  3GTP B;  2JSO A;  1BBW A;  2F0U A;  3KF8 A;  3HOV H;  3A56 A;  2X6L A;  1W6K A;  1KLU D;  4RKL A;  3R93 A;  4ZK9 B;  1FJG L;  3GV3 A;  1ESR A;  1TWH B;  3IKJ A;  3TP5 A;  1SNQ A;  4JI1 Q;  3R8B A;  4BBS B;  3VR5 A;  3TS0 A;  4H02 A;  3CKI B;  2K5V A;  2VQE Q;  1YIT A;  5CV9 A;  3CCL A;  4CKC A;  1JE5 A;  2UUB L;  1Z47 A;  4QB4 A;  3H0G B;  1GHK A;  2XRS D;  4DV6 L;  5C3E G;  4DN4 M;  1SYD A;  4XT3 B;  3CCR A;  1YBY A;  2NVT H;  3MXP A;  2XSC A;  4BS9 A;  1R9T B;  2WAQ B;  5M5W H;  4A3I H;  4A4I A;  1L0W A;  1Q12 A;  4JBK A;  3I7F A;  3S1Q B;  3F2D A;  1SE3 A;  3K58 A;  1I6H B;  1QUQ B;  3M3Y B;  1OXX K;  1LTL A;  4LF7 L;  1WTR A;  2R92 G;  3T51 B;  4JI8 L;  1ZYR D;  4GNX A;  3RZO B;  3D8G A;  2A6E C;  2JP1 A;  1NCV A;  1U4R A;  2F0Q A;  4WJ4 A;  1Z9F A;  5I9O A;  3DWA A;  4YCW A;  5IYC G;  3S16 B;  4KN7 C;  1VQB A;  4GN3 B;  1QNK A;  3I4M B;  1MBY A;  3CAM A;  5M5Y B;  3K5M A;  1CHQ D;  1LM0 A;  4J1M A;  1GKH A;  3GTL B;  3I73 A;  3Q23 A;  3GTQ H;  5IGC A;  2XVS A;  1XTC D;  2UXC Q;  1TWG B;  2OTJ A;  3C1F A;  1BQQ T;  1SMX A;  4R4O A;  2OWO A;  1GVP A;  2V1C C;  5A2Q E;  2XIW A;  3MC0 B;  3P20 A;  1LTI D;  3HKS A;  2B29 A;  4MIU A;  2FIN B;  2RDH A;  4YHH Q;  2UXB Q;  4ZKB B;  2FFK B;  3SK5 A;  4RHS A;  3U4V A;  1Q1B A;  5C4H A;  3NTI A;  4B08 A;  2PNR C;  3SR1 A;  4OO1 I;  4IUV A;  1MI2 A;  5IGF A;  5K36 G;  4P75 A;  1EQT A;  3S14 B;  1EOT A;  1EQR A;  3QJY A;  1Q86 C;  3SK6 A;  3BG3 A;  4BY1 H;  1V8Q A;  3SK4 A;  3L3O C;  3MTS A;  4RMF A;  3L2P A;  5IGB A;  1IKM A;  4CBV A;  2BCO A;  1GM5 A;  1QE6 A;  1BCP C;  4ZLT F;  1VQ9 A;  2K50 A;  4XTC S;  2L11 A;  5CGK A;  3KDF B;  5M5Y H;  3HKZ B;  4IUT A;  5GAH C;  2NVX H;  1CKM A;  4RGM A;  2QKI C;  1HTP A;  2G9H D;  4S3S A;  3DHQ A;  4YY3 L;  2MPM A;  2EJM A;  2WII B;  4OO1 G;  2D0P A;  2RQX A;  4DR1 Q;  1I4R A;  4A3G B;  3JAM E;  1Z7T A;  1HQR D;  4DV3 Q;  1S40 A;  3VR4 A;  1I6V C;  4A3L H;  3DWP A;  1QOH A;  3PO2 H;  3HOZ H;  4DUY Q;  1L1O A;  2ICE C;  1XNQ L;  3UE0 A;  4L6T B;  1KAB A;  4B9X A;  3CQZ B;  3CCU A;  3TME A;  2B8G A;  3PF4 A;  1A2T A;  1R4Q B;  5HUR A;  4FO2 A;  3ERO A;  2F0K A;  4MTK A;  1E2W A;  3LWU A;  4IO9 A;  1RIP A;  2CHB D;  2FJ2 A;  3S24 A;  1YHB A;  1SE4 A;  2DJF C;  1SNM A;  5ELO A;  2E5L Q;  1EY5 A;  1JJC B;  4X3S A;  4GKJ Q;  1WVL A;  2C9O A;  4LUZ A;  3H15 A;  2F0D A;  1JOK A;  4DK6 C;  3HOX H;  5C3W A;  1HZC A;  3UDF A;  3RZD B;  1JB3 A;  3AFQ A;  2MGS A;  1LT3 D;  1PFS A;  2FMC A;  4NXN L;  1XMO Q;  1Q82 C;  1BBX C;  1DJR D;  5FJ8 G;  2KEE A;  5EKL A;  1HR0 Q;  4LF8 L;  5J39 A;  3OIP A;  1VDZ A;  1F2Z A;  4UHV A;  5KNB A;  5J1Z A;  2EE1 A;  1XNR L;  1XYI A;  2ZM6 L;  2BDO A;  5D3D A;  3BVG A;  4RWS C;  3GTG H;  5C44 H;  2VUM B;  2M9V A;  2MJ8 A;  1I50 H;  3ERQ A;  3ZYY X;  1SEB D;  4OIK A;  2KCN A;  2QCP X;  4R8N A;  4JW0 A;  3FKI G;  2OEO A;  3I4L A;  1D7Q A;  5M3F H;  2DNC A;  2E74 C;  3JAM c;  1SNO A;  4HN7 A;  5DAU A;  1CT1 D;  1H9M A;  3GO5 A;  5LMU Q;  1A2U A;  5GAE C;  2DUD A;  3S2D B;  1VQF A;  3T16 A;  4CKB A;  1JJG A;  2B2Y C;  3C46 A;  2N55 A;  4IFD I;  2K14 A;  5C3E B;  1IKL A;  4XYO A;  4ZCK A;  3S15 B;  1U4M A;  1E0B A;  3HG9 A;  2F0N A;  1Q81 C;  1JIC A;  3CME A;  2YTV A;  3KJO A;  2BH8 A;  2EXZ A;  5EPL A;  1SRU A;  2GN5 A;  4X62 Q;  5I6Y A;  4LUV A;  4IAL A;  1MHW C;  1PH6 A;  3I72 A;  3LNN A;  1LTT D;  5IYB G;  1QG7 A;  3J80 L;  4BY7 B;  1HCZ A;  4B3R L;  3MVV A;  4KHZ A;  2EPB A;  2VUM H;  5KEE A;  3DEP A;  4IUQ A;  5FK9 C;  1GUT A;  1LT6 D;  1TY0 A;  4HSV A;  4IJL A;  4JK1 C;  2I46 A;  3K5L A;  2N49 A;  1IW7 C;  3P7J A;  4ZQ3 A;  3HOY B;  2LY7 A;  4E6I A;  1XTD A;  4BBR H;  4AYB B;  4KTA A;  2NWG A;  4K14 A;  4IPD A;  2NTS A;  2ATW A;  3I2Z A;  3FMC A;  4NXM L;  3J7A F;  3TSS A;  2OXP A;  4ZKC B;  3D4W A;  1D5X C;  4DV4 L;  1BBU A;  3T56 B;  1ML0 D;  2LFN A;  2CCZ A;  2F4V L;  1A62 A;  1MGS A;  4A3K H;  3A7L A;  5FLM G;  5K5P A;  2AKW B;  1I5F A;  1KDA A;  2JA5 B;  4EQ5 A;  4JVZ A;  2F0V A;  2RSN A;  3PGZ A;  2EY6 A;  4LF5 Q;  3L7Z C;  1PVO A;  2LKV A;  2KED A;  3EN2 A;  1VQN A;  3BVZ A;  2BA1 A;  3OTO L;  1BVS A;  1WCM B;  1ESF A;  3AB9 A;  1RTO A;  1YIJ A;  1B44 D;  5G3L D;  3PQI A;  4BWG B;  1M4V A;  4DXF A;  1IYV A;  1JWU D;  1PZK D;  4A3F H;  3I4O A;  5IGG A;  4LFC L;  4A3B H;  4A3J H;  1HHV A;  2F0S A;  5LMN W;  2OQK A;  4IFD J;  5GAG C;  1LTA D;  2NTT A;  4DA2 A; 
#chains in the Genus database with same CATH homology
 2LXJ A;  3TRE A;  2E2J H;  3J7Z C;  3BZK A;  4LF4 L;  1NE3 A;  2E2H H;  3H3V H;  4JI7 L;  4K0K Q;  4GLA C;  4Y7N H;  4A3E G;  4B3M Q;  3NEN A;  3DM3 A;  5LMN Q;  5IYD H;  4JI5 Q;  4PMW A;  4DR2 Q;  4B3S Q;  5AJ3 L;  4C3I H;  4HJ9 A;  4LFA Q;  4MZ9 A;  2PQA B;  1IBL Q;  4DR4 Q;  4WJ3 M;  4X6A H;  3G71 A;  2RF4 A;  2MO1 A;  4JBW A;  3UDG A;  4A3G G;  3UDI A;  3HOY G;  2JA6 H;  4IOA A;  2F52 A;  2JA8 H;  4LWC A;  3HOW H;  1TWC H;  1VQI A;  4AYB G;  1N33 L;  3CPF A;  4OWW B;  3AEV A;  3BJU A;  4A3M H;  5IWA Q;  1N36 Q;  4A3B G;  4A3J G;  3K7A H;  4X64 Q;  4K0K L;  4B3M L;  1W2B A;  5LMN L;  1IBK Q;  3RZD H;  1E7Z A;  4DR2 L;  4B3S L;  4KHP Q;  4DAY B;  4TQU S;  2N3S A;  2YTY A;  5IY0 A;  4IPH A;  1YI2 A;  1PH5 A;  4LFA L;  1IBL L;  2VW9 A;  4LNQ A;  1AE2 A;  1UEB A;  1J6Q A;  4X65 Q;  3CD6 A;  1E3P A;  2F3I A;  1PV4 A;  2YV5 A;  1PYB A;  1YJW A;  1I94 Q;  5IYD G;  2VQF Q;  1N32 Q;  2BA0 A;  2VS1 A;  3CC7 A;  2ZTD A;  1UE1 A;  1SR3 A;  3CC2 A;  4P74 A;  4JBM A;  2ALY B;  4X66 Q;  5IWA L;  2IT1 A;  4MTN A;  5IE8 A;  1VQO A;  4X64 L;  1N36 L;  2CQO A;  1KQS A;  3E9H A;  2JA6 G;  4UP9 A;  3VDY A;  4DV1 Q;  2JA8 G;  3ICE A;  1IBK L;  1WJJ A;  4KHP L;  1HZA A;  1N9W A;  4P71 A;  1M90 C;  2BH2 A;  3KFU A;  2OCE A;  2VL6 A;  1K73 C;  1KHI A;  2VNU D;  4LW1 A;  3PCO B;  4X65 L;  5JEA J;  3AQQ A;  1MJE A;  3L0O A;  1L2F A;  2Y0S E;  2VQF L;  1YEZ A;  1I94 L;  2JA5 G;  4JV5 Q;  1N32 L;  4Y52 H;  1BKB A;  2D62 A;  2R6G A;  1K83 H;  3PUY A;  2HQL A;  1PHJ A;  3D31 A;  1WOC A;  3M4P A;  1KD1 C;  4X66 L;  1PH1 A;  1VQK A;  3K0X A;  1YZ6 A;  1EOV A;  2LXK A;  4JI0 Q;  4DR6 Q;  2CWP A;  4DV1 L;  4NXM Q;  2YU9 H;  4LFB Q;  2KHJ A;  2VZA A;  5M3M G;  2FXQ A;  1PH7 A;  1KAW A;  1WCM G;  1N34 Q;  2UUA Q;  2NVQ H;  3J80 c;  4YWL A;  3W1G A;  1NMF A;  2JE6 I;  3T1Y Q;  2ZJR A;  1OXV A;  2ASB A;  4A93 H;  3STB C;  2WB1 G;  3G48 A;  3EBE A;  4JV5 L;  4UP7 A;  3PO3 H;  1K3R A;  4P72 A;  1FJG Q;  3S2D H;  1L1O C;  1CKN B;  3KDF A;  1QZH A;  1Q7Y C;  3J7A 5;  4A3C H;  4APV A;  1CSQ A;  1E1T A;  3F1Z A;  3SGI A;  4DR6 L;  1HZ9 A;  5H1S E;  2UU9 Q;  3TEH B;  3K8A A;  1E24 A;  5EAY A;  4BY1 G;  5C3E H;  4LFB L;  2Z0S A;  3S15 H;  4UP8 A;  4JI3 Q;  2UUA L;  4MNO A;  4OWT B;  2QA4 A;  3KYH C;  2EIF A;  4DKA C;  3T1Y L;  3J81 c;  3A74 A;  1QVG A;  1EFW A;  1NY4 A;  2JEB I;  4A75 A;  4DV6 Q;  3ER0 A;  1BBW A;  3BZC A;  2ZTC A;  1XMQ Q;  1S72 A;  3HOV H;  2KBN A;  1T9H A;  2XTI A;  4JI6 Q;  1FJG L;  3J80 i;  1XJV A;  1C7Y A;  4PZ7 A;  4JI1 Q;  2L15 A;  4IPG A;  2B63 H;  2ID0 A;  4A93 G;  2CFM A;  4OXP A;  3PO3 G;  4BXX G;  1XPU A;  2UU9 L;  3TS0 A;  1PH9 A;  1G6P A;  4H02 A;  3ULJ A;  2K5V A;  2VQE Q;  4GOP B;  4JI3 L;  1YIT A;  3CCL A;  4BY7 H;  1MJC A;  1JE5 A;  2UUB L;  1Q46 A;  4DV2 Q;  1Z47 A;  4POG A;  4DV7 Q;  5GQO A;  3KLW A;  3U4Z A;  2PMZ E;  3NEM A;  4DV6 L;  2MQH A;  3G4S A;  5C3E G;  3CCS A;  1XMQ L;  4PZ8 A;  3CCR A;  1QVF A;  4JI6 L;  1NBW A;  4J15 A;  1YBY A;  4HIK A;  2CWA A;  4LF9 Q;  2NVT H;  2Y0S G;  2A8V A;  4LF7 Q;  1X9N A;  3J81 i;  4A3L G;  4JI8 Q;  1KRS A;  2DGY A;  3STB D;  5M5W H;  3HOV G;  4A3I H;  4A4I A;  1L0W A;  4GNX C;  3HOY H;  1C9O A;  2VQE L;  1Q12 A;  3M4O H;  1WYD A;  4JBK A;  3I7F A;  4JC0 A;  4DV2 L;  2B63 G;  4DV7 L;  1FVI A;  1FGU A;  1G29 1;  1UE5 A;  3F2D A;  4A3D G;  4OWX B;  3ZJY C;  2K52 A;  1V9P A;  1C0A A;  2YTX A;  3K7U C;  4YWK A;  4DV5 Q;  1QUQ B;  3RNU A;  4OON A;  2MNA A;  1OXX K;  4LF9 L;  1LTL A;  4JBJ A;  4O0A A;  1QUQ A;  1KRT A;  3F2C A;  1VS0 A;  4LF7 L;  1TWA H;  1SRO A;  4AQY Q;  2R92 G;  4JI8 L;  1A8V A;  2IHE A;  2NZO A;  4GNX A;  1FL0 A;  4JYA Q;  1VCI A;  3M85 A;  2XGT A;  3BU2 A;  2WB1 E;  4QGU A;  3KOJ A;  4GN4 B;  4JG2 A;  4WJ4 A;  1Z9F A;  4YCW A;  5IYC G;  4GLX A;  1HNZ Q;  1NJI C;  1VQB A;  4GN3 B;  4A3I G;  4UY8 C;  3CAM A;  4DV5 L;  3HOX G;  3D0F A;  1JB7 A;  4R1J A;  1LM0 A;  2R93 G;  1GKH A;  1AH9 A;  1PH8 A;  1KIX A;  4PZ6 A;  1HR0 L;  3FHW A;  4AQY L;  3GTQ H;  1VQ4 A;  1G51 A;  4JYA L;  2JA5 H;  2UXC Q;  5JJL A;  1X65 A;  4L5R C;  2OTJ A;  3HFZ B;  3I4N G;  1SMX A;  3TRZ A;  4ME3 A;  4R4O A;  1HNZ L;  1YJN A;  2OWO A;  3UE1 A;  1GVP A;  3CPW A;  3CMA A;  1HZB A;  2GVA A;  2V1C C;  2C35 B;  3AFP A;  2B3G A;  2Q2T A;  5M3M H;  1HH2 P;  1K8G A;  1CSP A;  1WCM H;  2B29 A;  3HKS A;  1XPO A;  1UWV A;  4YHH Q;  2UXB Q;  1V43 A;  3PUX A;  1YNX A;  1LYL A;  2PNH A;  1YHQ A;  1MKH A;  1P8L A;  2UXC L;  2KEN A;  3U4V A;  4QJF A;  5C44 G;  1NTG A;  1Q1B A;  2D0O A;  5C4X G;  1W3S A;  4HIO A;  4OO1 I;  1EIF A;  5K36 G;  1UE7 A;  5IP9 G;  3JC6 6;  4P75 A;  1Y1W H;  1EQR A;  1Q86 C;  5M3F G;  1PA6 A;  4BY1 H;  2AWN A;  1A63 A;  3KF6 A;  3H0G G;  1O7I A;  4YHH L;  2UXB L;  4L5T A;  1IL2 A;  1EUJ A;  2R7F A;  4RMF A;  1SLJ A;  4YY3 Q;  3L2P A;  4DNI A;  4DR5 Q;  2HT1 A;  4BA2 I;  1Y14 B;  4R4C A;  3RN2 A;  4YWM A;  1GM5 A;  2OQ0 A;  3LGJ A;  3PIO A;  1WFQ A;  4YCU A;  3ULL A;  3GDE A;  2K50 A;  5M5X H;  4XTC S;  1VQ9 A;  2N8N A;  3KDF B;  4PG3 A;  1VQE A;  4BXX H;  5M5Y H;  5GAH C;  2NVX H;  1X54 A;  1XNQ Q;  2MO0 A;  1N8R C;  1CKM A;  3I56 A;  1RL2 A;  3CCJ A;  1Y1W G;  2Q2H A;  1OTC A;  4IFD G;  4YY3 L;  4DR5 L;  3PUV A;  4GN5 A;  3S2H H;  1EYG A;  4OO1 G;  2D0P A;  1K0R A;  1WI5 A;  4DR1 Q;  3CC4 A;  2I5M X;  1TWF H;  2UUB Q;  1S40 A;  3KF8 B;  4DPG A;  3GD7 A;  4DV3 Q;  1L1O B;  5C4J H;  4JI2 Q;  3S1M H;  2A19 A;  4A3L H;  3PO2 H;  1DGS A;  5GRO A;  4BA1 I;  4DUY Q;  2N78 A;  1L1O A;  3HOZ H;  3AYH B;  1XNQ L;  2JEA I;  5IP7 G;  3GTM H;  3UE0 A;  4IPC A;  1HNX Q;  4O2D A;  5GAD C;  2IX1 A;  3CCU A;  2OTL A;  1KC8 C;  1AE3 A;  3CP0 A;  4A3D H;  5J3B A;  3PF4 A;  2JQO A;  4C2M H;  1OXT A;  3S1N H;  1HJP A;  1Y1V H;  1JJ2 A;  1LUZ A;  4DR1 L;  5ELN A;  4C3H H;  3U50 C;  5JJK A;  3MEF A;  4DV3 L;  3OW2 A;  1V1Q A;  2Z6K C;  1KXL A;  2JJQ A;  4GKK L;  1XPR A;  1D8L A;  4IO9 A;  3RN5 A;  4NPS A;  1RIP A;  2ES2 A;  4JI2 L;  2R92 H;  3S24 A;  2E2I H;  4DUY L;  1YHB A;  1OXS C;  1SFO H;  4NXN Q;  1NMG A;  1HNX L;  5ELO A;  2E5L Q;  2E8G A;  1JJC B;  2HHH Q;  2RHS B;  2IHF A;  5IYC H;  4LF8 Q;  2JK8 A;  1VQC A;  4C3J H;  4HJA A;  3S17 H;  3I55 A;  3HOZ G;  3B6Y A;  3PO2 G;  1IZ6 A;  3K81 C;  2R7Z H;  4LUZ A;  2K75 A;  3H15 A;  1ASZ A;  3HOX H;  4DK6 C;  5JJI A;  1HZC A;  2QGQ A;  3UDF A;  5HY6 A;  2R93 H;  3AFQ A;  3CCV A;  1HR0 W;  3K80 C;  2MFI A;  1XNR Q;  4TVA B;  2WP8 J;  3CXC A;  1YJ9 A;  1K9M C;  2UUC Q;  1Y1V G;  1B7Y B;  1GO3 E;  1PFS A;  1U5K A;  1X3E A;  4NXN L;  1XMO Q;  1Q82 C;  3J81 j;  1JT8 A;  5FJ8 G;  3FKI H;  4HJ5 A;  2E5L L;  4GNX B;  2PI2 A;  2HHH L;  4UPA A;  1HR0 Q;  3I4N H;  4LF8 L;  4GKJ L;  2WAQ E;  2ZJP A;  1VQM A;  3M4Q A;  1YHA A;  1M1K C;  4JI4 Q;  3GTP H;  1OXU A;  2NVY H;  2Q2I A;  3FP9 A;  5HGQ A;  1XNR L;  2ZM6 L;  2AMC B;  3GTK H;  2UUC L;  2R7Z G;  4FDB A;  1XMO L;  1VQ6 A;  1TWH H;  5C44 H;  3GTG H;  2R7D A;  1I50 H;  4BBS H;  3PV0 A;  1IYJ B;  1Q1E A;  4IJH A;  2ZTE A;  1VQP A;  3HKZ G;  5IP9 H;  4GKJ Q;  2LSS A;  3FKI G;  2I5L X;  1D7Q A;  1PH2 A;  4QQB X;  5M3F H;  4DV0 Q;  4LUO A;  4JI4 L;  1MIU A;  2I5H A;  4NB3 A;  3JAM c;  3T1H Q;  3H0G H;  5FLX c;  2K4K A;  2RHQ B;  3DLL A;  4L5Q A;  4R4I A;  1E1O A;  2ZJQ A;  1YVC A;  4EX5 A;  2PQA A;  4DR3 Q;  3RLN A;  1PH3 A;  1J5E Q;  2VY3 A;  3GO5 A;  4JCV E;  4R4Q A;  3TQY A;  4KLK A;  5LMU Q;  5GAE C;  1CKO A;  1R9T H;  2DUD A;  4DR7 Q;  5IYB H;  4A3F G;  1VQF A;  4B3T Q;  5C0X I;  1Q8K A;  3PIP A;  3CCQ A;  2JA7 H;  1JJG A;  3RLO A;  2IX0 A;  2K5H A;  1PH4 A;  1JMC A;  4IFD I;  3PSI A;  4IOC A;  4DV0 L;  4JI5 L;  2K14 A;  3S1Q H;  4BBS G;  3MXN B;  3CCE A;  3T1H L;  3F2B A;  1UE6 A;  3IRB A;  1I6H H;  4DR4 L;  1Q81 C;  4B3R Q;  3KF6 B;  3CW2 C;  1IBM Q;  3M3Y H;  1HNW Q;  3CME A;  4DR3 L;  1VQ5 A;  3ULP A;  1GD7 A;  2YTV A;  3KJO A;  3A0J A;  2BH8 A;  5LMU L;  1J5E L;  4DR7 L;  2KHI A;  3JAM i;  1SRU A;  2GN5 A;  4X62 Q;  4HJ8 A;  4LUV A;  4B3T L;  3OYY A;  1K8A C;  3RZO H;  3UDX A;  5IT9 c;  4POF A;  3HOU H;  1PH6 A;  1X6O A;  2GVB A;  1I3Q H;  3NBH B;  3E0E A;  4QIW E;  3WWV A;  3GTJ H;  3HOW G;  2WAQ G;  5IP7 H;  2HIV A;  3G6E A;  5IYB G;  3S16 H;  2HIX A;  4DUZ Q;  4A3M G;  1EQQ A;  1EIY B;  2JA7 G;  3I4M H;  3PF5 A;  2AHO B;  4XIG S;  3W1B A;  3KJP A;  4LF6 Q;  4B3R L;  1IBM L;  1HNW L;  2IY5 B;  2EXD A;  4KHZ A;  3CCM A;  5C0X G;  2VUM H;  3GTL H;  1ASY A;  3CF5 A;  1B70 B;  2KCT A;  4X62 L;  3PUW A;  2JA9 A;  3S1R H;  2NN6 I;  5C4X H;  4IJL A;  3PUZ A;  4ALP A;  1E22 A;  1TWG H;  2N49 A;  1VQD A;  1X55 A;  1VQH A;  4DUZ L;  1X3G A;  5FLM H;  3GTO H;  1XTD A;  3ERS X;  4BBR H;  2K5N A;  4GKK Q;  1VQ7 A;  4L5S A;  4LF6 L;  3HOU G;  4DV4 Q;  5BR8 Q;  4QY7 A;  2F4V Q;  4HJ7 A;  3HKZ E;  4IPD A;  4GS3 A;  4OX9 Q;  3I4M G;  3E9I A;  2ATW A;  3I2Z A;  4JI0 L;  1VQJ A;  4JOI C;  4P73 A;  1CKN A;  4NXM L;  2VUM G;  3M9B A;  5FJ8 H;  1N34 L;  1CUK A;  3EIV A;  4GLV B;  3S14 H;  4DV4 L;  1BBU A;  4KI0 A;  4AYB E;  2CKZ B;  2CCZ A;  3M7N A;  5BR8 L;  1TXY A;  1VQA A;  1SE8 A;  4R4T A;  4GOP C;  1A62 A;  3U58 A;  2F4V L;  1S3O A;  4A3K H;  2NN6 G;  2Q2U A;  5FLM G;  4OX9 L;  4BBR G;  1A0I A;  1EWI A;  3OTO Q;  4DAM A;  2I0Q A;  2AKW B;  1IXR A;  4JOI A;  4DK3 C;  1H95 A;  2RCN A;  1I5F A;  4HIM A;  4YCV A;  2UXD Q;  2H5X A;  2Z6K A;  1SN8 A;  4EQ5 A;  1PYS B;  3A5U A;  4A3C G;  4QL5 A;  4RG1 A;  1B8A A;  2ZM6 Q;  1KL9 A;  3PGZ A;  3F8T A;  4GOP A;  4LF5 Q;  1VQ8 A;  3L7Z C;  5DLQ E;  5JEA G;  4LFC Q;  1PVO A;  2A1A A;  4A3E H;  2EQS A;  3EN2 A;  1X3F A;  3NEL A;  1VQN A;  2BA1 A;  3OTO L;  1BVS A;  1QZG A;  3W5O A;  4JI1 L;  1P16 A;  4LF4 Q;  3A5Z B;  1YIJ A;  1VQL A;  4JI7 Q;  2QEX A;  4AH6 A;  4A3K G;  2UXD L;  1U0L A;  4A3G H;  4HID A;  2NZH A;  3Q8D A;  2AWO A;  3RLF A;  1VQG A;  3RR5 A;  4A76 A;  3TS2 A;  2WFW A;  5AJ3 Q;  1QVC A;  4A3F H;  4LF5 L;  3I4O A;  4LFC L;  4A3B H;  4A3J H;  5C0X J;  2PI2 E;  1X56 A;  2KCM A;  5E7N A;  3H3V I;  5LMN W;  4BY7 G;  2OQK A;  3CQZ H;  2YYZ A;  4AIM A;  1N33 Q;  5GAG C;  4IFD J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...