3MXPA

Crystal structure of staphylococcal nuclease variant delta+phs t62a at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFAKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxpA00
3C1EA 1ENCA 1EYCA 1STAA 3HZXA 2NUCA 4KY7A 5CV8A 4K8JA 4PMBA 3DMUA 5JAVA 4HTHA 1KDCA 5C5MA 3NK9A 2F0TA 2RBMA 5E3FA 3SK5A 3NUCA 5C4HA 5I6WA 5CV6A 1EY8A 2F0NA 4DGZA 5C6AA 1SYEA 4K5VA 3EJIA 5C3WA 2PZWA 3T13A 5IGCA 4ID6A 5ISRA 3PMFA 4MIUA 4G57A 1F2MA 4I65A 2F3VA 5E1FA 4HMJA 3MZ5A 2EYMA 4KD4A 5CGKA 5J1ZA 2PW7A 2OEOA 1JOOA 2F0DA 1TR5A 4IUNA 4J6HA 3SK4A 4K14A 3TP6A 4N9PA 3NQTA 3OMGA 4K5XA 4EQNA 3HEJA 4RKBA 1KABA 1SNDA 2OF1A 1STBA 1KDAA 4E6IA 3SK6A 5IGFA 4ODGA 5IODA 4J1MA 4KJNA 5KIXA 4NP5A 5KRUA 1A3TA 3D4WA 3D6CA 3RUZA 4F8MA 5IGEA 5IOCA 4IALA 1IHZA 4B9XA 1SNQA 5EGTA 4IZ8A 3SXHA 1EY9A 4ME5A 4N9TA 4RKLA 3SHLA 5KYLA 4QMGA 5K5PA 1JOQA 3NP8A 1A2UA 2LKVA 5DAUA 2HQEA 3OSOA 4B9WA 4DFAA 4DU9A 5J22A 3TP8A 2QDBA 3S9WA 2F0HA 5EKKA 4KY5A 2EYJA 3TP5A 1NSNS 1TT2A 1EY4A 5CV9A 1EQVA 1II3A 5I6YA 4PMCA 1SYBA 3E5SA 5CV5A 3P75A 1EY6A 2M00A 2PYKA 4EQOA 5IGGA 4YIJA 4KJOA 5KYIA 1KDBA 3P1HA 5C5LA 2SNSA 2EYLA 3BDCA 4H7BA 5IGDA 5KGUA 3QOLA 5CV7A 2ENBA 2PQEA 2RKSA 1EZ8A 2EXZA 2F0VA 2F0WA 2RDFA 4K8IA 3VA5A 4R8NA 1A3UA 1EY5A 1SYFA 2PZTA 2EYFA 4S3SA 2F3WA 3SR1A 1A3VA 5HGTA 1JORA 1EY0A 2F0UA 2F0FA 5I9PA 2PZUA 2EYOA 4QB4A 4DF7A 2F0JA 2KHSA 3OMCA 2F0SA 3R3OA 4NMZA 1SNPA 3EROA 2F0LA 5DEHA 5C4ZA 2EYHA 1U9RA 4NDXA 3U9OA 5HURA 1SNMA 5J39A 4WORA 2EY2A 2O4XA 2EY6A 2F0EA 4NKLA 3MXPA 1ENAA 2PW5A 4K2LA 4ZQ3A 3BDLA 2F0IA 3H6MA 3NHHA 5F2DA 2WACA 2KQ3A 4KTAA 4LAAA 5IGBA 1F2ZA 1SNCA 2OXPA 3MVVA 4K2KA 3D8GA 1NUCA 1RKNA 3LX0A 3TMEA 2EY1A 1KAAA 3C1FA 4QF4A 5M9OA 3QB3A 1STHA 2F0QA 3QOJA 2F0PA 4KD3A 4OL7A 3NXWA 5JOBA 4KY6A 4F7XA 5CC4A 2EY5A 4K6DA 4ZUIA 5EKLA 5CR3A 1SYGA 3V2TA 3SK8A 1EYDA 1STNA 5IIFA 1STGA 2SOBA 3ERQA 1EY7A 2F0MA 3MEHA 2EYPA 1F2YA 2F0GA 4KHVA 4KV6A 3EVQA 4TRDA 3T16A 3TP7A 1AEXA 1SNOA 5KEEA 5NUCA 5CV4A 3OWFA 3D4DA 1A2TA 4K5WA 4HMIA 4ZUJA 2F0OA 5C3XA 3DHQA 1EZ6A 1STYA 3ITPA 1SYCA 2F0KA 1TQOA 2SNMA 1EYAA 4EQPA 3MHBA 4EVOA 1SYDA 4PNYA 4WRDA 1JOKA 5I9OA
chains in the Genus database with same CATH superfamily
1SMYC 3G6JB 3MFGA 4DUYQ 3SK5A 3QG1A 3G48A 1N32L 1RHPA 4JBKA 3PUVA 2I46A 3DWPA 1BUVT 4MIUA 1XNQL 3J7AF 1LT6D 1IXRA 1YHQA 1AW7A 3RN5A 1VDZA 3KLSA 4GNXC 3S14B 4U68A 3I2ZA 5IYDG 4FF4A 5IGFA 2B8GA 4NP5A 2E2DC 3CXCA 5KNCA 1QUQB 2XTIA 4BBSH 4FXGC 1TS2A 5COYA 2D62A 2F4VQ 4CKEA 3OW2A 4FXKC 1EY4A 1TWFB 1EQVA 2NVYB 2R3ZA 5C44G 2GVAA 2EPBA 1UEBA 2PYKA 3S24A 2QA4A 1DD2A 2NN6I 3IRBA 1SROA 3LWEA 4O42A 5IGDA 4DV5L 3S17B 1G2SA 2JP1A 5C44H 2B8FA 4R8NA 3Q8DA 3S15H 2A74C 3CW2C 1SYFA 2FHTA 2IX1A 1R4QB 1KQSA 2PQAB 3EIVA 1SE3A 1UE5A 2UXDQ 1VMPA 1PH4A 5J39A 4JW0A 2JA6B 1S72A 4YWLA 2O4XA 1QB5D 4FNFA 4I7ZC 1GUGA 3KBGA 2B2VC 4LF5L 3PUYA 3MVVA 3T1HL 3CCJA 1RKNA 2FINB 4AH6A 4UP7A 2L55A 4BS9A 3K5MA 1PYWD 3TS2A 3QOJA 4IFDH 4KD3A 4OL7A 1D5MC 3VDYA 4B3TL 3HFZB 3KLWA 2L15A 3ERSX 1EY7A 1PFMA 3L9AX 3TP7A 2A6ED 1IW7C 5FLXL 2BOSA 3MC0B 4MN3A 3HOZG 3CQZH 2R7ZB 3UI2A 2IY5B 1PYSB 1EZ6A 1EOVA 1W6JA 3M3YB 1X65A 2B39A 3SDZA 3R93A 1PFSA 5I9OA 3NE5B 4LFBL 2MQHA 3TS0A 4C3HG 2X6GA 1AH9A 5C5MA 2FJ2A 4RHSA 5K36G 1H95A 3DEOA 4DV4Q 1B8AA 1WTWA 3KUPA 3VYUA 1B2TA 2PCFB 1OXXK 2Z6KA 3QO2A 3UDFA 1CQVA 1JWUD 3I7FA 4XYQA 1B53A 3KDFB 4IPCA 2NZOA 4DR4Q 1NBWA 1PH7A 5KRUA 1A3TA 5J3BA 4GNXB 5GROA 4C3JG 1GXDC 4DR5L 2CQAA 1B9MA 5EGTA 2WIIB 4H13C 4LFAL 4BBRB 2OQ0A 3DLLA 4IUVA 1EWHA 5K5PA 5KYLA 1O7YA 2DJGC 5DAUA 3HOVB 1NE3A 4XYOA 2EJFC 3TBIB 3GTMH 4Y52H 1Y14B 3PIPA 4JI7Q 1NSNS 5CV9A 4JYAQ 3F2DA 2WAQE 5KNDA 5C4JB 2DY8A 2BDNA 1EY6A 3J81i 1FGBD 1IYJB 1WJJA 3CU7A 1K83H 2V1CC 2M9VA 4IPHA 1EZ8A 2K05A 4DR6Q 4Q5VA 1HNXL 5LMUL 3NWSA 1J8IA 1GUWA 1XJVA 3C2PA 1C9OA 3K81C 3EA6A 4L6TB 3S1MH 4JV5Q 1FNWA 3J80E 4ALPA 4ZQ3A 5JJLA 4FF1A 2WACA 2KHJA 4OWXB 4F87A 1LV9A 2DN8A 1F2LA 3C46A 3S16H 2EY1A 3CPFA 1SE2A 1E3PA 3D31A 5JEAH 1JE5A 1SE8A 3OHXC 4PZ7A 5IIFA 4BY7B 1FJGQ 4FF2A 4NB3A 1VQDA 2LS01 4C3IG 4BBSB 4K5WA 3NTHA 1VQLA 1SYCA 3FKIG 1NMFA 3U50C 2EDGA 1WTRA 2MJ8A 1Q82C 1PA6A 3HOYH 4LUVA 1WTQA 4HEDA 2I5MX 3SE0A 1D5ZC 4C3IH 4PMBA 2RCNA 1KDCA 2L1BA 2LXJA 3GTOB 1M90C 3FKIH 4CDFC 4KHPL 4UP8A 4DXGA 4Y7NH 5KNBA 5BN3A 4HJ7A 1WTOA 1LYLA 4LW1A 3S15B 1EWCA 3SVMA 1HUMA 4N9PA 4K5XA 2CH4A 2RHSB 3GTQH 2G9HD 3I91A 1EQRA 3D6WA 1YHAA 3DM1A 1E0BA 4LF6Q 2Q2UA 2YU9H 4IZ8A 4DV7L 3KFUA 4A3BG 4IJHA 3S1RH 3PO3G 1A2UA 1PTOD 1EIFA 5AJ3Q 3MTSA 5EKKA 4X3TA 1HFGA 1RODA 3FPPA 1BR9A 1M8AA 1J9OA 4PZ8A 4OEMB 1FNUA 4JI5L 1HNWL 3QWNA 2F03A 2BH8A 1HA6A 4DV1L 4HCSA 3TZDA 2B2UA 3PUZA 2PQEA 1IYUA 5IYBH 3VA5A 3NELA 3CQZB 2R7FA 1QG7A 2N8NA 3Q24A 1JICA 2A73B 3H3VH 2Y0SG 4GKKQ 1PHJA 4POFA 2UU9L 1AN8A 4A3IG 1ONLA 1XWEA 2CCZA 3S2DH 1UE7A 1JR0D 2B2YC 1MHWC 1PZID 4NKLA 1K8MA 3BDLA 1YIJA 3V96A 2A1AA 3E0JA 2JSOA 4EQ5A 2F4IA 2E75C 5M3MG 3QIAA 1TS4A 1C48A 4ABNA 2EJGC 2Q8RE 4KI0A 2GN5A 4X64L 2AQ1B 2F0PA 1EWIA 3U4ZA 4JI6L 1MKHA 3L0OA 3CAMA 2K33A 2EY5A 5ELEA 3A5UA 4HIOA 3JAME 1WOCA 4ZKBB 3R2TA 4GOPA 3HS0C 3BZDB 1AEXA 3A55A 2L4NA 3D4DA 3M4OH 4LUOA 1L0XB 3GD7A 4MNOA 5EJWA 5ELNA 4BY1G 3VR2A 3GTMB 2UUAQ 2A68D 1ZEQX 1JB3A 1VQAA 1O7IA 3NTIA 2MUYA 3HZXA 2AQ3B 1SJHD 5E3FA 4CDEC 4ZKCB 1XNRL 2F0NA 1QNKA 4OX9L 5C0XH 4R4QA 1K83B 4P2CB 4AQYL 3I4LA 3Q0AA 4FYDA 2VZAA 3A0JA 3UDXA 2Q8TA 2B63B 4A3DH 2K5HA 3M85A 3HEJA 3TSSA 4JCVE 1LTBD 2EE1A 1VQ4A 1X9NA 5IODA 4NXNQ 1PH1A 2H5XA 4K0KQ 1WVLA 1YI2A 1PTOF 2QCPX 5HGQA 2Q2TA 2BA1A 1FNVA 4LFCL 4B9WA 1I4HA 2PNRC 1E22A 3S2HH 3S9WA 4ZAIA 1SLJA 2CVRA 3J7YW 2E2HH 1SE4A 1QCBD 2JA5B 3ULJA 1SYBA 1VS0A 4OO1G 3Q23A 3U58A 1QVFA 3K59A 1C7YA 5M5XB 1Y1WB 2R93B 3I55A 1JQYD 3EFXD 1A15A 1B50A 3CCQA 2ASBA 4OO1H 2PZUA 4IFDJ 2E5LL 1E2VA 4X66L 1S40A 3HOYB 5C4ZA 1GUSA 1SNMA 1SXTA 4WORA 5IP9G 2EVBA 1FVIA 1ML0D 2PW5A 3PGZA 3H6MA 3KJOA 4TVAB 3HOUH 4JI1Q 1CKMA 3VR5A 4WJ3M 3MEFA 2E74C 1S4ZA 4QF4A 1KD1C 5IP9H 3CC7A 3QB3A 2FXQA 2WB1B 1JJ2A 1H9SA 4X3SA 2IX3A 2CW0C 5CC4A 3GTQB 1L1OC 1ASZA 2KA7A 4K6DA 3ZJYC 1U0LA 2QILA 4F88A 4UY8C 1N8RC 3A8JE 3EQLC 2YU9B 4R4TA 1D7QA 1PRTD 4HMIA 5EQ0A 3OIQA 3GTLH 2NN6G 1PH2A 2F0KA 3GQBA 3J81L 1O80A 1HZ9A 2NTTA 3H0GH 5A2QL 1EYCA 1X6OA 2VB3X 1E2WA 4JPBW 4L5TA 4HTHA 1BXTA 1G51A 2WB1E 2ZTEA 1TKWB 4DR7L 2NN6H 4C1NK 1H9JA 4MTNA 1U4RA 4XDXA 5C3EH 3T13A 5ISRA 1HZAA 4G57A 3FHWA 5DM63 3RR5A 1QJOA 1D2BA 1BDOA 1RDPD 3NQTA 4A75A 1KABA 1SNDA 3I4MH 3E9IA 3S2DB 3AFPA 4F8MA 1I6HH 3DWAA 1SNQA 1MGSA 1Z9FA 3BYYB 1JT8A 1CA6A 2ZJQA 4DNTB 4JI8Q 1K9MC 2DJFC 1YNND 3TP8A 1KTKA 1RD9D 1I4QA 2UXCQ 5GADC 1AZQA 1TT2A 1E1OA 2LXKA 4B3ML 2I0QA 3E5SA 1XPRA 4HJ9A 2XSCA 2RF4A 1HQMC 2UUCL 1ILPA 4RGNA 3QOLA 2JXMB 5E4XA 1ICFB 3M4OB 4XQNA 2Z6KC 2EYFA 1EEID 4LF7Q 4A3JB 5JEAJ 1I94Q 2SEBD 2EYHA 1CQFA 1G8ZD 5LMNL 1X3EA 2R7ZG 3AU7A 1HZBA 4A3GH 4CGYB 2Z8LA 1N34Q 1FGUA 4JI3L 2E76C 4UDUC 4A3DB 4YY3Q 4JI2L 4N8X1 3STBD 3BVMA 4A3MB 2L9HA 2VQFL 3SK8A 4CDDC 4DV0L 4HIMA 4DAVA 2SOBA 2WAQG 5IE8A 1YZ6A 1PRTF 3EVQA 1L1OB 1NMGA 1NR4A 1NNXA 1N33Q 2ICEC 4GKJL 1Y1VH 2EIFA 2IW3A 2KCMA 1SSOA 4XT3B 3ITPA 2K6AA 3U4VA 1PTOH 5L37A 2J4XA 5G3LD 2ZT9C 3IFTA 2R61A 1ENCA 3BDOA 4JI4L 4BBRG 5CBAE 3R2IA 2HD3A 2H4OA 2F0TA 1B1ZA 1G6PA 1GOZA 2UXBQ 1A63A 2AKWB 5C6AA 3J80i 5IP7G 2E2JH 1I50B 3HOWG 3QJYA 4TKOB 4X62L 2JA8G 5M5WH 4KD4A 1Z47A 4OIJA 3UE1A 4OGQC 2XGTA 1CKNB 3VYRA 4X65Q 2QEJC 1ET6A 2N78A 1NTGA 1CHPD 1X3GA 1Y8OB 2C9OA 5IP7H 4UAIA 3NPPA 5KIXA 1SBBB 3HOWH 3RUZA 1EL0A 2UUBQ 4LF4L 4B9XA 3TRZA 4A3EG 1A0IA 4DV3Q 3BU2A 1VQFA 1TWAH 3HOUB 1HXYD 1EY9A 4QMGA 4A76A 1NJIC 1WYDA 2EZVA 3DUZA 2NWGA 5AFWA 4POGA 4A93H 5E4WC 4A3EH 1QVCA 1CI3M 1CZGA 4WFN3 1EU4A 2Q8IB 4YIJA 3VA7A 1QVGA 1HR0L 1DONA 4GN5A 1ICWA 4GS3A 3M7NA 2Z0SA 1Q86C 1U4LA 4KHZA 2K32A 3TQYA 1K28A 2MHVA 1EY5A 1B3AA 2PZTA 2B29A 1KRSA 2EOTA 2IHEA 4IN3A 4BY7G 4QB4A 5IYDH 3H0GB 1YNJD 4LUZA 4DV2Q 3HP3A 4DV6Q 5CBEE 5DM73 1Q81C 1GM5A 3G6EA 3KF8B 3PO2G 1BKBA 1V1PB 5CORA 1S5FD 4C2MH 5C3EB 1FYCA 4DPGA 2B2WA 2DNEA 1TS5A 3E3XA 5D65A 3GTKH 3MXGA 3CHBD 3C1FA 4DNRB 1CK1A 4P75A 4PV1C 1CSPA 3I4MB 1WCMG 1N32Q 3URYA 1EYDA 5EBDA 3MEHA 1XNQQ 3JC66 1N36L 4LF9L 1I6HB 2NVXB 1CZWA 5C0XJ 2B2UC 5IWAL 4ZUJA 1XX8A 1BBUA 3J80c 2XNAC 5G3LF 1WCMH 1TQOA 2A6HD 3BVGA 3GP7A 2HCCA 1PYBA 2YTXA 2E2IH 4HJ8A 3I4NB 1JOKA 1K8AC 2PI2E 1IBML 2DGYA 4QUCA 3KLSX 1O7ZA 1QE6A 1QILA 2VNUD 4IUUA 1A8VA 4RCOA 4NW2A 1LUZA 1TY2A 1SYEA 2R92G 2IL8A 2N55A 4IQZA 2RVLA 3N52A 1LLRD 2K5QA 3OWEB 1J6QA 4J6HA 3SK4A 3FP9A 3KLRA 2BCOA 3I8ZA 1B7YB 2R92H 1LACA 2EQSA 4P74A 3GTJB 5IGEA 4DV5Q 2IJ0A 1MBYA 1K3BC 4GOPC 1TWGH 3JAMi 2ZXPA 1KAWA 2AWNA 4TQUS 1GHJA 1H9MA 5FJ8G 1MSHA 1VQCA 4QGUA 3HOZH 2OT2A 4DU9A 2NVQB 3KF6B 4QL5A 1WTVA 4AYBB 5GAEC 3PSIA 1II3A 3U9SA 4C3HH 5T1IA 1RCVD 3P75A 2XWBB 4LF5Q 4KJOA 5K36H 1D1KA 3T1HQ 5C4XG 1LTGD 3MXUA 3OTOL 2ENBA 3J7AV 2D5DA 3KOJA 1Y1VB 2XWJB 1STEA 3HRZC 4B3TQ 1EY0A 1SAPA 1PZJD 3NBIA 2F0SA 1SFOH 1Y8NB 2QF7A 1KXLA 3HG9A 1TWHB 4C3JH 5IY0A 4DR2L 3IKJA 3OIPA 4AYBE 1WTPA 3H15A 2KQ3A 5M5YH 2FMMA 3RZOB 1TWCH 1AP0A 1VQ9A 4LF8L 3X3NA 5M5WB 1VQ7A 4LFBQ 1TU2B 3E9HA 2NZ1D 3TDQA 1LT3D 2D2CC 2YV5A 5FLMG 2PQAA 3A74A 2D0PA 5CMDA 1DOLA 3K0YA 3BYTB 4Q0FA 5FO7B 2B63G 3PV0A 4JVZA 4V0BA 1ZYRD 3MWYW 4BXXG 4A3KG 4A93B 1V9PA 3KJPA 4DR5Q 3C1EA 1IKMA 4B08A 2SDFA 4KY7A 2OTLA 4LFAQ 1BVSA 4JC0A 5CV6A 1PRTC 2XRQD 4K5VA 3F2UA 2RHQB 1MD2D 1ESRA 3JAMc 2F3VA 4HMJA 3SEBA 2KJXA 2KBNA 3RLFA 2AWOA 1NR2A 1GKHA 4CDCC 3OMGA 4RKBA 2IWHA 2OF1A 3D3RA 2LSSA 4ODGA 4J1MA 2PMZB 1BCPC 3D4WA 3D6CA 1Y1WG 3IAYA 3NSWA 2VL6A 2JE6I 1HNXQ 4PZ6A 5LMUQ 1CKOA 2BE5D 4FF3A 1PXUA 1RIPA 4C2MB 3OOCA 1J5EL 3NWTA 1HPCA 1QZHA 4GOPB 4H44C 3GTKB 1IKLA 1K73C 1DZ1A 4WJWA 1XMQL 4AIMA 1VQ5A 5C44B 2K5DA 4IUQA 4G7ZC 5IGGA 3FRPB 3KDFA 3QR8A 2NVTH 2O5JC 1S5BD 4PG3A 1SDFA 3P1HA 2ID0A 1IL8A 1YNNC 1E1TA 2WB1G 4DR3L 2MNAA 2KEEA 2D9UA 3SGIA 3PUWA 3E6ZX 1F9PA 4R4OA 4JG2A 1B4OA 5LL6S 3OMCA 1V43A 4YHHL 1X55A 3NBHA 4HIDA 4NDXA 1U9RA 3J80L 3A5ZB 2ZM6L 1Y69U 4J15A 3CCSA 4A3BH 1YNXA 3PO3H 1FD7D 5LHY1 2N3SA 4XQQA 1KNAA 2X6LA 4YCWA 2MP1A 4R9WA 1ENFA 3HOXG 4KHPQ 2Z4IA 5EPJA 1TWGB 5CV4A 3OWFA 1OO9B 2HQLA 5C3XA 4DAPA 1GO3E 1DGSA 3STBC 2CH4W 1LTTD 3ULPA 1E7ZA 1P16A 4A3IH 4C3HB 1YHBA 4DV7Q 1HTPA 5D14A 2RBMA 2ZTDA 5C4HA 2VUMG 2MO1A 3J81j 5I6WA 1XMOL 5GAHC 1HUNA 5M3MH 1BOSA 3PMFA 3GV6A 1DCZA 4L8JA 5J1ZA 1X56A 5ELFA 1M4VA 2VUMH 4GN4B 2K5WA 4JI5Q 1HNWQ 5JPMC 1R9TH 3S1QH 2MPMA 4U673 4DV1Q 1SR3A 3CCEA 4RGTA 2JA9A 1H9SB 5EAYA 4BA2I 3G7LA 1BCPB 2EJMA 4IURA 1F9RA 2UU9Q 1TWCB 2LKVA 1JOQA 3MAQA 2A5HA 4BY1H 4FVMA 4IOCA 4KKSA 2K7VA 3H3VC 2KCNA 1HRJA 2I5HA 3OYYA 2LY7A 1IBKL 1OTCA 3MXNB 5H1SE 1V1QA 4PMCA 4QQBX 2XVSA 3OPOA 4B3SL 2M00A 5T1GA 4RGMA 1MI2A 1RL2A 1MIUA 1Q1EA 3WOFA 1W3SA 4H7BA 2Z4HA 3FPUB 4X64Q 3S1MB 2KHIA 4R8IA 3V05A 2N49A 3X3MA 4JI6Q 5JJZA 2IT1A 4A3MG 1EUJA 1EIGA 1JORA 1PFNA 3FEWX 4TSSA 5DLQE 1HFNA 2HHHL 3B6YA 4QY7A 2R6GA 4O1NA 4C1NI 1K0RA 4A3CG 4LWCA 4HJ5A 3S16B 4CKCA 5IT9E 1WTXA 1E2ZA 4GN3B 1ENAA 3M4PA 1YEZA 4K2KA 3T56B 4RA8A 3M4YA 3I4OA 3TMEA 1YNJC 3I3CA 3M4QA 1G2TA 2CWPA 2ES2A 2ICIA 4ILWA 4KK7A 1XNRQ 1I5FA 2VQEL 4OX9Q 2MGSA 4XIGS 3DXJC 4AQYQ 3TZUA 1F2YA 2JJQA 2K75A 1RTNA 5M3FG 3I70A 2HIVA 3I90A 5EBCA 4C3IB 1WTHA 2KENA 4OELB 2J7ZA 3DHQA 2K04A 1EFID 4A3FG 3FKIB 3K7AH 2ZTCA 1Q46A 4EQPA 4DUZL 5LL6X 2JA7G 1T5EA 4L63B 4Y7NB 5M3FH 1PH3A 1G91A 2AMCB 2IX0A 5CV8A 4DR1L 4ME3A 4A3FH 4LFCQ 1VMCA 2B3GA 1WFQA 2A6HC 5JVH3 1X3FA 2B2WC 1JWSD 1N9WA 2OEOA 2F0DA 2L12A 2ZJRA 3S1RB 4JI0L 3CRLC 5DNFA 3GTPH 4YWKA 2K03A 4G4KA 4IALA 1IHZA 1IBLL 1KC8C 1TVXA 4DXFA 3S14H 4A3BB 2Q2IA 3SXHA 1K8OA 2A6EC 2FFKB 4MTKA 4O0AA 3PO3B 2RA4A 4FP5D 2E5LQ 4X66Q 2AQ2B 4GZYC 3HKZB 4HAEA 4A3LG 2QDLA 4DK0A 1S3OA 4LJZC 2RCFA 2SNSA 2JQOA 5JVG3 2WKCA 5CV7A 3K6OA 1PV4A 2P5ZX 2EXZA 1TWFH 2O2LD 4K8IA 2F3IA 4S3SA 5ELBA 5TSSA 2Y0SB 2F0FA 4YWMA 4CJ0B 2KOLA 1KL9A 3LNNA 4A3IB 4HSPA 2F0LA 2JA6G 1T5XD 3HGBA 3C3LA 4NXML 3S17H 2EY2A 1A62A 3PIO3 1Q12A 3NHHA 4B3RL 4RWSC 3G71A 4L5RC 3HKZE 3T51B 5IGBA 5BR8L 3D8GA 3CCVA 5FKAC 3RN2A 4DNIA 3LX0A 3F8TA 1VQGA 4EX5A 2JA6H 1X32A 2ATWA 4J8QA 4DR7Q 3T1YL 4LK1C 1F9QA 4ZK9B 2Y0SE 2F0MA 3K5OA 4JK1C 3DM3A 2EYPA 4KHVA 3T16A 3VR6A 1YJNA 4HIKA 3IFDA 1NY4A 4IJLA 1VCIA 2Z1CA 3Q6SA 1DOKA 4QIWB 4BY1B 1BF4A 1AZPA 2B2YA 1KIXA 1SYDA 2K14A 2XRSD 4KKUA 4WRDA 1VQIA 1JMCA 4HR7B 2R7ZH 1H9KA 1CT1D 2C5CA 1ZKOA 3M3YH 3EJIA 1IYVA 1X3QA 4ULLA 5IGCA 1F2MA 1XYIA 4B3MQ 1TR5A 1HH2P 2AUKA 1ASYA 2RDHA 4GLVB 4X3UA 2UUCQ 3S2HB 1QZGA 5IOCA 2VB2X 2E2HB 3W1BA 4ZCKA 3MFYA 1UAPA 3W2DA 4DUYL 2YTVA 3ULLA 3N6RA 4RFBA 1EQQA 3HOVG 4IPDA 3WOEA 1OXSC 2CKZB 2PO4A 1C4QA 5LMNQ 1I6VC 5LMNW 1YJ9A 4BBRH 1LO5D 4NPSA 3A7AB 2NB0A 3FDTA 5C5LA 2M2LA 4KN7C 4JI3Q 1V8QA 4MHEA 1I4PA 2RKSA 4QJFA 1VQKA 2RDFA 4HJAA 2JA8H 4JI2Q 1DJRD 2F3WA 5HGTA 2A19A 1D6EC 2VQFQ 2F0UA 3KBXA 4DV0Q 2F4VL 1NCVA 3S1NH 1SNPA 5HURA 5IYCG 1B70B 4DN4M 4JBWA 1X3PA 3BZKA 3O13A 2EY6A 3CF5A 4DK6C 4GKJQ 5ELDA 4KMUC 4LAAA 1SNCA 3RZDH 3UDIA 1GVPA 5IYCH 1L0YB 1IL2A 1PTOC 4JI4Q 1LTID 2KCTA 1KHIA 4PMWA 4KY6A 4F7XA 1PH8A 1R4PB 1PZKD 3GTLB 3T53B 3VR4A 4ZUIA 3GTPB 2UXDL 2MO0A 1EFWA 4CHTB 2CHBD 4X62Q 1ILQA 1XPUA 4DAYA 2NBFA 4CJ2C 4BBSG 1Y8PB 1A2TA 2QGQA 5FLXE 3KYHC 3L3OC 2SNMA 1ESFA 4BY7H 2D0OA 1M1KC 4PNYA 4R4IA 4LF4Q 4QCLA 2NUCA 1Q1BA 3PO2H 3H91A 3NK9A 1JJCB 2ALYB 1GD7A 1AE2A 3K8AA 2DNCA 3BVZA 4I65A 4JOIA 1YITA 3M9BA 1OXTA 1L1OA 2EYMA 2XIWA 1JOOA 4IUNA 1TY0A 3GTOH 3J7ZC 1S5DD 1HR0Q 4XTCS 1LABA 1W6KA 1HR0W 4UHVA 2PNHA 5FK9C 2K52A 1KNEA 2HUGA 1TXYA 2RSOA 4RMFA 2JEAI 3ER0A 1GHKA 3VYSA 4DV4L 4DFAA 2QDBA 1I4XA 1EQTA 4K6LA 1S5ED 2CW0D 2JN4A 1VF7A 1RTOA 4IFDG 2HDLA 1GJXA 3CCMA 2A68C 2GA4B 4H02A 1CKNA 4DR4L 5EPKA 3CMEA 1VQNA 2QW7A 2KECA 3D0FA 4RHRA 1TIID 4A3GB 4L5SA 4DAMA 3PF4A 2RQXA 3K5LA 2F0JA 2JK8A 3BJUA 3VR3A 1N36Q 4LF9Q 4JI7L 1F77A 2I5LX 1JC7A 3FMCA 4DGZA 3MXPA 5IWAQ 4JYAL 2TSSA 1EU3A 5FJ8H 4DK3C 1NUCA 1VQ6A 1LTLA 5JJIA 1HCZA 4IOAA 2F0QA 2QKIC 4DR6L 1RF2D 1IBMQ 2IHFA 3W5OA 1QUQA 4XXEA 1PTOB 3V2TA 2V4DA 1STGA 4RAUC 2K50A 2WAQB 4YCUA 5C4XH 4O2DA 4JV5L 1A6XA 1SRUA 3KF8A 2F0OA 1V1PA 3A8IE 3K5NA 1STYA 4HSVA 3J7A5 1CA5A 2E2JB 1K0SA 1JJGA 2PI2A 4GLAC 4UPAA 1Q3LA 1W2BA 1PVOA 1O78A 1F9SA 1STAA 1KLGD 2Z6BA 3EBEA 2VW9A 5JAVA 2WINB 1FR3A 2B2TA 1IZ6A 1PFBA 5D3IB 1VQMA 5JJKA 3NBHB 3OW7A 5C3WA 3HOWB 1YJWA 1FJGL 2ZXRA 2JA8B 1ET9A 3MZ5A 3A7LA 1U4MA 1WI5A 1TWAB 4DA2A 4K14A 5D3DA 1DYQA 3GV3A 2ZJPA 3UDGA 1STBA 2K5VA 3SK6A 5FLMH 3S1NB 3I73A 3RLNA 1K3RA 3OTOQ 4A3EB 1YBYA 1D8LA 2B63H 5EPLA 1K8GA 1P8LA 2K01A 4ME5A 3SHLA 3RZDB 4HN7A 4QUFA 3ZYYX 4KY5A 4BXXH 4A3KH 1PLFA 4IO9A 1VQHA 2JA5G 4DR2Q 5JEAG 5CV5A 2I07B 1QWYA 2E8GA 5KYIA 1Q7YC 4LF8Q 4MZ9A 4LF6L 3NTKA 2VXWA 2R93G 2F0WA 2JA5H 1BO0A 1A3VA 1WD1A 5I9PA 2OTJA 5AJ3L 3KF6A 3HOYG 4KN4C 1KRTA 5M5XH 1VQOA 1Y1WH 2R93H 5GQOA 4G7OC 3PO2B 5F2DA 2A69D 4KTAA 1BNZA 4R4CA 1F2ZA 2OXPA 2OWOA 1CHQD 4XQJA 3AFQA 4GNXA 2PMZE 1LTRD 2WP8J 4R1JA 1G6ZA 2CFMA 1WCMB 2LFNA 3PIOA 4GKKL 3WWVA 3AEVA 1SMYD 1VQPA 2E2IB 2F0GA 1I4RA 3I72A 4KV6A 3AQQA 5NUCA 3CC2A 5IT9c 3F2CA 1LT5D 2PPBC 2JEBI 1PH5A 4UP9A 1H9RA 4OIKA 2F1MA 4EVOA 4ZLTF 1C0AA 1GUOA 4CKBA 1XPOA 3PQIA 3J81c 2YYZA 2HDMA 3DMUA 3BG3A 3ND9A 1J5EQ 1JCKB 1AFPA 3H09A 1BBWA 3M7GA 1UUPA 3CCUA 2ZXOA 3ICEA 2R92B 4IUTA 4ID6A 2N88A 5IYBG 3HKZG 1XMQQ 5CGKA 1C8CA 2PW7A 4IFDI 3VYTA 3HOZB 3L7ZC 1B3QA 3D4RA 2K4KA 4XT1B 4KJNA 2TMPA 2HCIA 2UUAL 3HOXH 4RGOS 4RG1A 1DXMA 4DR3Q 2B2VA 1DOMA 1XTDA 2K1BA 3GTGH 4N9TA 2MFIA 4GLXA 1QNUA 4YHHQ 2F0HA 4OHJA 2ZM6Q 5EKIA 5I6YA 1PRTB 2L0CA 1SEBD 5GAGC 5FO8B 3LWUA 4DKAC 1KDBA 4NXNL 1CSQA 3RD4A 5C4XB 5KGUA 3Q22A 1SFOB 5BN4A 1LM0A 4OWWB 4C3JB 2F0VA 4K0KL 2AUJD 1PMRA 1L0WA 1A3UA 3TEHB 5M5YB 4C56C 4LMQD 4DF7A 3DWQA 1GUTA 1Z6HA 4A3JG 4NMZA 1QOHA 1RJTA 4IUPA 4JBJA 5DEHA 5E7NA 1OXUA 2G9DA 3T4AC 3CMAA 2A8VA 3A56A 2DY7A 4YCVA 4LNQA 3A8KE 5C0XG 4RCNA 2WKDA 1T9HA 4A3JH 1IW7D 1HA5A 1MJCA 4WJ4A 1VF5C 4N8FA 4A3DG 3NXWA 3BZCA 3LGJA 4HCEA 1Z7TA 5EKLA 5CR3A 1SYGA 1XMOQ 3RNUA 5I2XA 3PF5A 5FOBB 3P7JA 3TREA 1Q8KA 1HNZL 1SNOA 3AYHB 4A3MH 4JI1L 3L2PA 4H0LC 2AHOB 2F52A 3J81E 4A3KB 1SMXA 4A3CH 2L5TA 1X54A 3K80C 5A2QE 4FDBA 4K8JA 2BH2A 1XTCD 2K28A 4M1UB 3NENA 1GUNA 3NUCA 3JAML 5I2YA 3CKIB 1Q90A 5E1FA 3CCLA 1UNSA 1IBKQ 3GDEA 4B3SQ 4EQNA 3TP6A 3CRKC 2QEXA 3PIP3 1KDAA 3CPWA 1I50H 3G4SA 3KK7A 1I3QH 2WV6D 1I4GA 3HOUG 3CCRA 2NVTB 1VQEA 1YVCA 2HHHQ 3CC4A 1HHVA 2BA0A 1HNZQ 2EYJA 2JA7H 3W3AA 4JBMA 5ELOA 2Q2HA 4BWGB 1U5KA 5JPNC 3MA2B 2R7DA 1CFMA 4EQOA 1NAPA 1UWVA 2HT1A 3AB9A 2GVBA 2G5DA 3BDCA 2OQKA 1SN8A 3K57A 4APVA 3FVQA 4JOIC 5BN5A 4Z9CB 2VY3A 3SR1A 1CTMA 1D5XC 3WDNA 1EOTA 2NTSA 4JI8L 2VQEQ 2EYOA 2KHSA 3H0GG 3R3OA 5IT9L 3HKSA 1B9NA 3EROA 4CBVA 1MSGA 2UXCL 1PH6A 3MXNA 1UE1A 3TN2A 1VQBA 1BBXC 4P73A 5C3EG 4DUZQ 1VQ8A 2KEDA 2IPKD 1KAAA 1LTSD 1EYGA 1STHA 4V190 5JOBA 4DR1Q 2NVYH 5HY6A 1D1IA 1BCPD 4A3LH 4L5QA 3I4MG 4LF7L 1STNA 4OONA 3NQIA 3HOXB 1I94L 4TRDA 4M8AA 1PH9A 5KEEA 2KUMA 4X6AH 1V1OA 1KLUD 1AE3A 3GTGB 4JI0Q 3H3VI 1HJPA 4OXPA 1LTAD 4P72A 3EN2A 1BQQT 5M3MB 2J0TD 1N34L 4PQXA 3I4NG 1OXVA 2NVXH 1IBLQ 2H1EA 4YY3L 4RH6A 1HTLD 3F1ZA 2VUMB 1EY8A 1HQRD 3PCOB 1MJEA 2L11A 2NZHA 2NYZD 1R9TB 1UE6A 1CM9A 3S1QB 2PZWA 3I4NH 4DK1A 1TS3A 2CWAA 1N33L 2BDOA 1E24A 2K5NA 3CD6A 2EXDA 4E6IA 2C35B 2KVMA 4A4IA 1PDQA 5FLXc 3K58A 3W1GA 5CYUA 5I4DA 3K7UC 4KKTA 4IPGA 4BA1I 2FMCA 4A3GG 3PUXA 1U4PA 4RKLA 5FO9B 2UXBL 1S5CD 3NP8A 5J22A 2KCCA 2HQEA 3A54A 3OSOA 2X69A 2YTYA 5ELCA 3GTJH 1ZYRC 4DAYB 4AYBG 3TP5A 2OCEA 4NXMQ 4CJ1B 3ONAB 4X65L 4B3RQ 1WD0A 2RDGA 2RSNA 5BR8Q 2NVQH 2B2TC 2HIXA 2EYLA 5C0XI 1JE4A 4QIWE 5A35A 4EGVA 2UUBL 2VS1A 1HZCA 4G7HC 4DV3L 1Y1VG 2Z9HA 4ZRZA 3I56A 3T1YQ 1EIYB 1JB7A 4P71A 2LMCB 1SJED 1FL0A 3NEMA 3U9OA 3RMHA 3UE0A 2F0EA 4K2LA 3R8BA 2F0IA 1CUKA 1L2FA 1XXGA 4KLKA 2BE5C 3HOVH 1EEFD 2JYOA 3P20A 3IL8A 5M9OA 3AMUA 1TWHH 1BCPF 3F2BA 3ND8A 1B44D 1LT4D 1O7LA 5C4JH 4I7AA 2CQOA 3BS1A 2A69C 4FXDA 3RZOH 3K7AB 3E0EA 1G291 4FO2A 3ERQA 3K0XA 3CP0A 4DV2L 1I3QB 4DV6L 5M3FB 1DM0B 1Q8IA 4OWTB 1JWMD 2WFWA 3DEPA 1ZXTA 2XN9C 4A3FB 4OO1I 2DUDA 3H94A 1EYAA 1UEAB 3MHBA 3RLOA 4ZYSA 1VQJA 4A93G 2JA7B 2O5IC 3GO5A 4X3KA 1EIHA
chains in the Genus database with same CATH topology
1SMYC 3G6JB 3MFGA 3SK5A 3QG1A 1RHPA 3PUVA 2I46A 3DWPA 1BUVT 4MIUA 3J7AF 1LT6D 1AW7A 1VDZA 3KLSA 3S14B 4U68A 4FF4A 5IGFA 2B8GA 4NP5A 2E2DC 5KNCA 4FXGC 1TS2A 5COYA 2D62A 4CKEA 4FXKC 1EY4A 1TWFB 1EQVA 2NVYB 2R3ZA 2EPBA 1DD2A 2PYKA 2NN6I 3LWEA 4O42A 5IGDA 3S17B 1G2SA 2JP1A 2B8FA 4R8NA 2A74C 1SYFA 2FHTA 2IX1A 1R4QB 1SE3A 1VMPA 5J39A 2JA6B 2O4XA 1QB5D 4FNFA 4I7ZC 1GUGA 3KBGA 2B2VC 3PUYA 3MVVA 1RKNA 2FINB 2L55A 4BS9A 3K5MA 1PYWD 3QOJA 4IFDH 4KD3A 4OL7A 1D5MC 1EY7A 1PFMA 3L9AX 3TP7A 2A6ED 1IW7C 5FLXL 2BOSA 3MC0B 4MN3A 2R7ZB 3UI2A 1EZ6A 1W6JA 3M3YB 2B39A 3SDZA 3R93A 5I9OA 3NE5B 4C3HG 2X6GA 5C5MA 2FJ2A 4RHSA 5K36G 3DEOA 1WTWA 3KUPA 3VYUA 1B2TA 2PCFB 1OXXK 3QO2A 1CQVA 1JWUD 4XYQA 1B53A 5KRUA 1A3TA 4C3JG 1GXDC 2CQAA 1B9MA 5EGTA 2WIIB 4H13C 4BBRB 4IUVA 1EWHA 5K5PA 5KYLA 1O7YA 5DAUA 3HOVB 4XYOA 2EJFC 3TBIB 1NSNS 5CV9A 5KNDA 5C4JB 2DY8A 2BDNA 1EY6A 1FGBD 3CU7A 2M9VA 1EZ8A 2K05A 4Q5VA 3NWSA 1J8IA 1GUWA 3C2PA 3EA6A 4L6TB 1FNWA 3J80E 4ZQ3A 4FF1A 2WACA 4F87A 1LV9A 2DN8A 1F2LA 3C46A 2EY1A 1SE2A 3D31A 5JEAH 3OHXC 5IIFA 4BY7B 4FF2A 2LS01 4C3IG 4BBSB 4K5WA 3NTHA 1SYCA 2EDGA 1WTRA 2MJ8A 1WTQA 4HEDA 3SE0A 1D5ZC 4PMBA 1KDCA 2L1BA 3GTOB 4DXGA 5KNBA 5BN3A 1WTOA 3S15B 1EWCA 3SVMA 1HUMA 4N9PA 4K5XA 2G9HD 3I91A 3D6WA 3DM1A 1E0BA 4IZ8A 1A2UA 1PTOD 3MTSA 5EKKA 4X3TA 1HFGA 1RODA 3FPPA 1BR9A 1M8AA 1J9OA 1FNUA 3QWNA 2F03A 1HA6A 4HCSA 3TZDA 2B2UA 3PUZA 2PQEA 1IYUA 3VA5A 3CQZB 1QG7A 3Q24A 1JICA 2A73B 1AN8A 1ONLA 1XWEA 1JR0D 2B2YC 1PZID 4NKLA 1K8MA 3BDLA 3V96A 3E0JA 2JSOA 2F4IA 2E75C 3QIAA 1TS4A 1C48A 4ABNA 2EJGC 2Q8RE 4KI0A 2AQ1B 2F0PA 2K33A 2EY5A 5ELEA 3JAME 4ZKBB 3R2TA 3HS0C 3BZDB 1AEXA 3A55A 2L4NA 3D4DA 1L0XB 3GD7A 5EJWA 3VR2A 3GTMB 2A68D 1ZEQX 1JB3A 3NTIA 2MUYA 3HZXA 2AQ3B 1SJHD 5E3FA 4ZKCB 2F0NA 1QNKA 5C0XH 1K83B 4P2CB 3I4LA 3Q0AA 4FYDA 2Q8TA 2B63B 3M85A 3HEJA 3TSSA 1LTBD 2EE1A 5IODA 1WVLA 1PTOF 2QCPX 2BA1A 1FNVA 4B9WA 1I4HA 2PNRC 3S9WA 4ZAIA 2CVRA 3J7YW 1SE4A 1QCBD 2JA5B 1SYBA 4OO1G 3Q23A 3K59A 5M5XB 1Y1WB 2R93B 1JQYD 3EFXD 1A15A 1B50A 4OO1H 4IFDJ 2PZUA 1E2VA 3HOYB 5C4ZA 1GUSA 1SNMA 1SXTA 4WORA 2EVBA 1ML0D 2PW5A 3H6MA 3VR5A 2E74C 1S4ZA 4QF4A 3QB3A 2WB1B 1H9SA 4X3SA 2IX3A 2CW0C 5CC4A 3GTQB 2KA7A 4K6DA 2QILA 4F88A 3A8JE 3EQLC 2YU9B 1PRTD 4HMIA 5EQ0A 3OIQA 2NN6G 2F0KA 3GQBA 3J81L 1O80A 2NTTA 5A2QL 1EYCA 2VB3X 1E2WA 4HTHA 1BXTA 1TKWB 2NN6H 4C1NK 1H9JA 1U4RA 4XDXA 3T13A 5ISRA 4G57A 5DM63 1QJOA 1D2BA 1BDOA 1RDPD 3NQTA 1KABA 1SNDA 3S2DB 4F8MA 3DWAA 1SNQA 1MGSA 3BYYB 1CA6A 4DNTB 1YNND 3TP8A 1KTKA 1RD9D 1I4QA 1AZQA 1TT2A 3E5SA 2XSCA 1HQMC 1ILPA 4RGNA 3QOLA 2JXMB 5E4XA 3M4OB 4XQNA 2EYFA 1EEID 4A3JB 5JEAJ 2SEBD 2EYHA 1CQFA 1G8ZD 3AU7A 4CGYB 2Z8LA 2E76C 4UDUC 4A3DB 3BVMA 4A3MB 2L9HA 3SK8A 4DAVA 2SOBA 1PRTF 3EVQA 1NR4A 2ICEC 2IW3A 1SSOA 4XT3B 3ITPA 2K6AA 1PTOH 2J4XA 5G3LD 2ZT9C 3IFTA 2R61A 1ENCA 3BDOA 5CBAE 3R2IA 2H4OA 2F0TA 1B1ZA 1GOZA 5C6AA 1I50B 3QJYA 4TKOB 4KD4A 1Z47A 4OIJA 4OGQC 3VYRA 2QEJC 1ET6A 1CHPD 1Y8OB 2C9OA 4UAIA 3NPPA 5KIXA 1SBBB 3RUZA 1EL0A 4B9XA 3HOUB 1HXYD 1EY9A 4QMGA 2EZVA 3DUZA 2NWGA 5AFWA 5E4WC 1CI3M 1CZGA 4WFN3 1EU4A 2Q8IB 4YIJA 3VA7A 1DONA 3M7NA 1ICWA 1U4LA 4KHZA 2K32A 2MHVA 1EY5A 1B3AA 2PZTA 2EOTA 4IN3A 4QB4A 3H0GB 1YNJD 3HP3A 5CBEE 5DM73 1V1PB 5CORA 1S5FD 5C3EB 1FYCA 2B2WA 2DNEA 1TS5A 5D65A 3MXGA 3CHBD 3C1FA 4DNRB 1CK1A 4PV1C 3I4MB 3URYA 1EYDA 5EBDA 3MEHA 1I6HB 2NVXB 1CZWA 5C0XJ 2B2UC 4ZUJA 1XX8A 2XNAC 5G3LF 1TQOA 2A6HD 3BVGA 3GP7A 2HCCA 3I4NB 1JOKA 2VNUD 4QUCA 3KLSX 1O7ZA 1QILA 1QE6A 4IUUA 4RCOA 4NW2A 1TY2A 1SYEA 2IL8A 2N55A 4IQZA 2RVLA 3N52A 1LLRD 2K5QA 3OWEB 4J6HA 3SK4A 3KLRA 2BCOA 3I8ZA 1LACA 3GTJB 5IGEA 2IJ0A 1MBYA 2ZXPA 2AWNA 4TQUS 1GHJA 1H9MA 1MSHA 2OT2A 4DU9A 2NVQB 1WTVA 4AYBB 1II3A 3U9SA 5T1IA 1RCVD 3P75A 2XWBB 4KJOA 5K36H 1D1KA 1LTGD 3MXUA 2ENBA 3J7AV 2D5DA 1Y1VB 2XWJB 1STEA 3HRZC 1EY0A 1SAPA 1PZJD 3NBIA 2F0SA 1Y8NB 2QF7A 3HG9A 1TWHB 3IKJA 3OIPA 1WTPA 2KQ3A 2FMMA 3RZOB 1AP0A 3X3NA 5M5WB 1TU2B 2NZ1D 3TDQA 1LT3D 2D2CC 5CMDA 1DOLA 3K0YA 3BYTB 4Q0FA 5FO7B 3PV0A 4V0BA 1ZYRD 3MWYW 4A93B 3C1EA 1IKMA 4B08A 2SDFA 4KY7A 5CV6A 1PRTC 2XRQD 4K5VA 3F2UA 1MD2D 1ESRA 2F3VA 4HMJA 3SEBA 2KJXA 3RLFA 2AWOA 1NR2A 3OMGA 4RKBA 2IWHA 2OF1A 3D3RA 4ODGA 4J1MA 2PMZB 1BCPC 3D4WA 3D6CA 3IAYA 3NSWA 2JE6I 2BE5D 4FF3A 1PXUA 4C2MB 3OOCA 3NWTA 1HPCA 4H44C 3GTKB 1IKLA 1DZ1A 4WJWA 5C44B 2K5DA 4IUQA 4G7ZC 5IGGA 3FRPB 2O5JC 1S5BD 1SDFA 3P1HA 2ID0A 1IL8A 1YNNC 2KEEA 2D9UA 3PUWA 3E6ZX 1F9PA 1B4OA 5LL6S 3OMCA 1V43A 3NBHA 4NDXA 1U9RA 3J80L 1Y69U 1FD7D 5LHY1 4XQQA 1KNAA 2X6LA 2MP1A 4R9WA 1ENFA 2Z4IA 5EPJA 1TWGB 5CV4A 3OWFA 5C3XA 1OO9B 4DAPA 1LTTD 4C3HB 1HTPA 5D14A 2RBMA 5C4HA 5I6WA 1HUNA 1BOSA 3PMFA 3GV6A 1DCZA 4L8JA 5J1ZA 5ELFA 1M4VA 2K5WA 5JPMC 2MPMA 4U673 4RGTA 1H9SB 4BA2I 3G7LA 1BCPB 2EJMA 4IURA 1F9RA 1JOQA 1TWCB 2LKVA 3MAQA 2A5HA 4FVMA 4KKSA 2K7VA 3H3VC 2KCNA 1HRJA 2LY7A 4PMCA 2XVSA 3OPOA 2M00A 5T1GA 4RGMA 1MI2A 1Q1EA 3WOFA 4H7BA 2Z4HA 3FPUB 3S1MB 4R8IA 3V05A 3X3MA 5JJZA 2IT1A 1EIGA 1JORA 1PFNA 3FEWX 4TSSA 1HFNA 2R6GA 4O1NA 4C1NI 3S16B 4CKCA 5IT9E 1WTXA 1E2ZA 1ENAA 4K2KA 3T56B 4RA8A 3M4YA 3TMEA 1YNJC 3I3CA 1G2TA 2ICIA 4ILWA 4KK7A 2MGSA 4XIGS 3DXJC 3TZUA 1F2YA 1RTNA 3I70A 3I90A 5EBCA 4C3IB 2J7ZA 3DHQA 2K04A 1EFID 3FKIB 4EQPA 5LL6X 1T5EA 4L63B 4Y7NB 1G91A 2IX0A 5CV8A 1VMCA 2A6HC 5JVH3 2B2WC 1JWSD 2OEOA 2F0DA 2L12A 3S1RB 3CRLC 5DNFA 2K03A 4G4KA 4IALA 1IHZA 1TVXA 4DXFA 4A3BB 3SXHA 1K8OA 2A6EC 2FFKB 3PO3B 2RA4A 4FP5D 2AQ2B 4GZYC 3HKZB 4HAEA 4DK0A 4LJZC 2SNSA 5JVG3 2WKCA 5CV7A 3K6OA 2EXZA 2O2LD 4K8IA 4S3SA 5ELBA 5TSSA 2Y0SB 2F0FA 4CJ0B 2KOLA 3LNNA 4A3IB 4HSPA 2F0LA 1T5XD 3HGBA 3C3LA 2EY2A 3PIO3 1Q12A 3NHHA 4RWSC 3T51B 5IGBA 3D8GA 5FKAC 3LX0A 1X32A 4J8QA 4LK1C 1F9QA 4ZK9B 2F0MA 3K5OA 4JK1C 2EYPA 4KHVA 3T16A 3VR6A 3IFDA 1VCIA 2Z1CA 3Q6SA 1DOKA 4QIWB 4BY1B 1BF4A 1AZPA 2B2YA 1SYDA 2XRSD 4KKUA 4WRDA 4HR7B 1H9KA 1CT1D 2C5CA 1ZKOA 3EJIA 1IYVA 1X3QA 4ULLA 5IGCA 1F2MA 1XYIA 1TR5A 2AUKA 2RDHA 4X3UA 3S2HB 5IOCA 2VB2X 2E2HB 3MFYA 1UAPA 3W2DA 3N6RA 4RFBA 3WOEA 1OXSC 2PO4A 1C4QA 1I6VC 1LO5D 3A7AB 2NB0A 3FDTA 5C5LA 2M2LA 4KN7C 1V8QA 4MHEA 1I4PA 2RKSA 2RDFA 1DJRD 2F3WA 5HGTA 1D6EC 2F0UA 3KBXA 1NCVA 1SNPA 5HURA 4DN4M 4JBWA 1X3PA 3O13A 2EY6A 5ELDA 4KMUC 4LAAA 1SNCA 1L0YB 1PTOC 1LTID 4PMWA 4KY6A 4F7XA 1R4PB 1PZKD 3GTLB 3T53B 3VR4A 4ZUIA 3GTPB 4CHTB 2CHBD 1ILQA 4DAYA 2NBFA 4CJ2C 1Y8PB 1A2TA 5FLXE 3L3OC 2SNMA 1ESFA 4PNYA 4QCLA 2NUCA 1Q1BA 3H91A 3NK9A 2DNCA 3BVZA 4I65A 1OXTA 2EYMA 2XIWA 1JOOA 4IUNA 1TY0A 1S5DD 4XTCS 1LABA 1W6KA 5FK9C 1KNEA 2HUGA 2RSOA 2JEAI 1GHKA 3VYSA 4DFAA 2QDBA 1I4XA 1EQTA 4K6LA 1S5ED 2CW0D 1VF7A 1RTOA 4IFDG 2HDLA 1GJXA 2A68C 2GA4B 5EPKA 2KECA 4RHRA 1TIID 4A3GB 2RQXA 3K5LA 2F0JA 3VR3A 1F77A 1JC7A 3FMCA 4DGZA 3MXPA 2TSSA 1EU3A 1NUCA 1HCZA 2F0QA 2QKIC 1RF2D 4XXEA 1PTOB 3V2TA 2V4DA 1STGA 4RAUC 2WAQB 1A6XA 3KF8A 2F0OA 1V1PA 3A8IE 3K5NA 1STYA 4HSVA 1CA5A 2E2JB 1Q3LA 1O78A 1F9SA 1STAA 1KLGD 5JAVA 2WINB 1FR3A 2B2TA 1PFBA 5D3IB 3OW7A 5C3WA 3HOWB 2ZXRA 2JA8B 1ET9A 3MZ5A 3A7LA 1U4MA 1TWAB 4DA2A 4K14A 5D3DA 1DYQA 3GV3A 1STBA 3SK6A 3S1NB 3I73A 4A3EB 5EPLA 4ME5A 2K01A 3SHLA 3RZDB 4HN7A 4QUFA 3ZYYX 4KY5A 1PLFA 5JEAG 5CV5A 2I07B 1QWYA 5KYIA 3NTKA 2VXWA 2F0WA 1BO0A 1A3VA 1WD1A 5I9PA 4KN4C 4G7OC 3PO2B 5F2DA 2A69D 4KTAA 1BNZA 1F2ZA 2OXPA 1CHQD 4XQJA 1LTRD 2WP8J 1G6ZA 1WCMB 2LFNA 1SMYD 2E2IB 2F0GA 1I4RA 3I72A 4KV6A 5NUCA 1LT5D 2PPBC 2JEBI 1H9RA 4OIKA 2F1MA 4EVOA 4ZLTF 1GUOA 4CKBA 2YYZA 2HDMA 3DMUA 3BG3A 3ND9A 1AFPA 1JCKB 3H09A 3M7GA 1UUPA 2ZXOA 2R92B 4IUTA 4ID6A 2N88A 5CGKA 1C8CA 2PW7A 4IFDI 3VYTA 3HOZB 3L7ZC 3D4RA 4XT1B 4KJNA 2TMPA 2HCIA 4RGOS 1DXMA 2B2VA 1DOMA 2K1BA 4N9TA 1QNUA 2F0HA 4OHJA 5EKIA 5I6YA 1PRTB 2L0CA 1SEBD 5FO8B 3LWUA 1KDBA 3RD4A 5C4XB 5KGUA 3Q22A 1SFOB 5BN4A 4C3JB 2F0VA 2AUJD 1PMRA 1A3UA 5M5YB 4C56C 4LMQD 4DF7A 3DWQA 1GUTA 1Z6HA 4NMZA 1QOHA 1RJTA 4IUPA 5DEHA 1OXUA 2G9DA 3T4AC 3A56A 2DY7A 3A8KE 5C0XG 4RCNA 2WKDA 1IW7D 1HA5A 1VF5C 3NXWA 4HCEA 1Z7TA 5EKLA 5CR3A 1SYGA 5I2XA 5FOBB 3P7JA 1SNOA 4H0LC 3J81E 4A3KB 2L5TA 5A2QE 4K8JA 1XTCD 2K28A 4M1UB 3NUCA 1GUNA 3JAML 5I2YA 3CKIB 1Q90A 5E1FA 1UNSA 4EQNA 3TP6A 3CRKC 3PIP3 1KDAA 3KK7A 2WV6D 1I4GA 2NVTB 1HHVA 2BA0A 2EYJA 3W3AA 4BWGB 5JPNC 3MA2B 1CFMA 4EQOA 1NAPA 3AB9A 3BDCA 3K57A 3FVQA 5BN5A 4Z9CB 3SR1A 1CTMA 1D5XC 3WDNA 1EOTA 2NTSA 2EYOA 2KHSA 3R3OA 5IT9L 1B9NA 3EROA 4CBVA 1MSGA 3MXNA 3TN2A 1BBXC 2KEDA 2IPKD 1KAAA 1LTSD 1STHA 4V190 5JOBA 1D1IA 1BCPD 1STNA 3NQIA 3HOXB 4TRDA 4M8AA 5KEEA 2KUMA 1V1OA 1KLUD 3GTGB 1LTAD 1BQQT 5M3MB 2J0TD 4PQXA 1OXVA 2H1EA 4RH6A 1HTLD 2VUMB 1EY8A 1HQRD 2L11A 2NYZD 1R9TB 3S1QB 1CM9A 2PZWA 4DK1A 1TS3A 2BDOA 4E6IA 2KVMA 1PDQA 3K58A 5CYUA 5I4DA 4KKTA 4BA1I 2FMCA 3PUXA 1U4PA 4RKLA 5FO9B 1S5CD 3NP8A 5J22A 2KCCA 2HQEA 3A54A 3OSOA 2X69A 5ELCA 1ZYRC 3TP5A 4CJ1B 3ONAB 1WD0A 2RDGA 2RSNA 2B2TC 2EYLA 5C0XI 1JE4A 5A35A 4EGVA 4G7HC 4ZRZA 2LMCB 1SJED 3U9OA 3RMHA 2F0EA 4K2LA 3R8BA 2F0IA 1XXGA 2BE5C 1EEFD 2JYOA 3P20A 3IL8A 5M9OA 3AMUA 1BCPF 3ND8A 1B44D 1LT4D 1O7LA 3BS1A 2A69C 4FXDA 3K7AB 1G291 4FO2A 3ERQA 1I3QB 5M3FB 1DM0B 1Q8IA 1JWMD 3DEPA 1ZXTA 2XN9C 4A3FB 4OO1I 3H94A 1EYAA 1UEAB 3MHBA 4ZYSA 2JA7B 2O5IC 3GO5A 4X3KA 1EIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1E A;  1ENC A;  1EYC A;  1STA A;  3HZX A;  2NUC A;  4KY7 A;  5CV8 A;  4K8J A;  4PMB A;  3DMU A;  5JAV A;  4HTH A;  1KDC A;  5C5M A;  3NK9 A;  2F0T A;  2RBM A;  5E3F A;  3SK5 A;  3NUC A;  5C4H A;  5I6W A;  5CV6 A;  1EY8 A;  2F0N A;  4DGZ A;  5C6A A;  1SYE A;  4K5V A;  3EJI A;  5C3W A;  2PZW A;  3T13 A;  5IGC A;  4ID6 A;  5ISR A;  3PMF A;  4MIU A;  4G57 A;  1F2M A;  4I65 A;  2F3V A;  5E1F A;  4HMJ A;  3MZ5 A;  2EYM A;  4KD4 A;  5CGK A;  5J1Z A;  2PW7 A;  2OEO A;  1JOO A;  2F0D A;  1TR5 A;  4IUN A;  4J6H A;  3SK4 A;  4K14 A;  3TP6 A;  4N9P A;  3NQT A;  3OMG A;  4K5X A;  4EQN A;  3HEJ A;  4RKB A;  1KAB A;  1SND A;  2OF1 A;  1STB A;  1KDA A;  4E6I A;  3SK6 A;  5IGF A;  4ODG A;  5IOD A;  4J1M A;  4KJN A;  5KIX A;  4NP5 A;  5KRU A;  1A3T A;  3D4W A;  3D6C A;  3RUZ A;  4F8M A;  5IGE A;  5IOC A;  4IAL A;  1IHZ A;  4B9X A;  1SNQ A;  5EGT A;  4IZ8 A;  3SXH A;  1EY9 A;  4ME5 A;  4N9T A;  4RKL A;  3SHL A;  5KYL A;  4QMG A;  5K5P A;  1JOQ A;  3NP8 A;  1A2U A;  2LKV A;  5DAU A;  2HQE A;  3OSO A;  4B9W A;  4DFA A;  4DU9 A;  5J22 A;  3TP8 A;  2QDB A;  3S9W A;  2F0H A;  5EKK A;  4KY5 A;  2EYJ A;  3TP5 A;  1NSN S;  1TT2 A;  1EY4 A;  5CV9 A;  1EQV A;  1II3 A;  5I6Y A;  4PMC A;  1SYB A;  3E5S A;  5CV5 A;  3P75 A;  1EY6 A;  2M00 A;  2PYK A;  4EQO A;  5IGG A;  4YIJ A;  4KJO A;  5KYI A;  1KDB A;  3P1H A;  5C5L A;  2SNS A;  2EYL A;  3BDC A;  4H7B A;  5IGD A;  5KGU A;  3QOL A;  5CV7 A;  2ENB A;  2PQE A;  2RKS A;  1EZ8 A;  2EXZ A;  2F0V A;  2F0W A;  2RDF A;  4K8I A;  3VA5 A;  4R8N A;  1A3U A;  1EY5 A;  1SYF A;  2PZT A;  2EYF A;  4S3S A;  2F3W A;  3SR1 A;  1A3V A;  5HGT A;  1JOR A;  1EY0 A;  2F0U A;  2F0F A;  5I9P A;  2PZU A;  2EYO A;  4QB4 A;  4DF7 A;  2F0J A;  2KHS A;  3OMC A;  2F0S A;  3R3O A;  4NMZ A;  1SNP A;  3ERO A;  2F0L A;  5DEH A;  5C4Z A;  2EYH A;  1U9R A;  4NDX A;  3U9O A;  5HUR A;  1SNM A;  5J39 A;  4WOR A;  2EY2 A;  2O4X A;  2EY6 A;  2F0E A;  4NKL A;  3MXP A;  1ENA A;  2PW5 A;  4K2L A;  4ZQ3 A;  3BDL A;  2F0I A;  3H6M A;  3NHH A;  5F2D A;  2WAC A;  2KQ3 A;  4KTA A;  4LAA A;  5IGB A;  1F2Z A;  1SNC A;  2OXP A;  3MVV A;  4K2K A;  3D8G A;  1NUC A;  1RKN A;  3LX0 A;  3TME A;  2EY1 A;  1KAA A;  3C1F A;  4QF4 A;  5M9O A;  3QB3 A;  1STH A;  2F0Q A;  3QOJ A;  2F0P A;  4KD3 A;  4OL7 A;  3NXW A;  5JOB A;  4KY6 A;  4F7X A;  5CC4 A;  2EY5 A;  4K6D A;  4ZUI A;  5EKL A;  5CR3 A;  1SYG A;  3V2T A;  3SK8 A;  1EYD A;  1STN A;  5IIF A;  1STG A;  2SOB A;  3ERQ A;  1EY7 A;  2F0M A;  3MEH A;  2EYP A;  1F2Y A;  2F0G A;  4KHV A;  4KV6 A;  3EVQ A;  4TRD A;  3T16 A;  3TP7 A;  1AEX A;  1SNO A;  5KEE A;  5NUC A;  5CV4 A;  3OWF A;  3D4D A;  1A2T A;  4K5W A;  4HMI A;  4ZUJ A;  2F0O A;  5C3X A;  3DHQ A;  1EZ6 A;  1STY A;  3ITP A;  1SYC A;  2F0K A;  1TQO A;  2SNM A;  1EYA A;  4EQP A;  3MHB A;  4EVO A;  1SYD A;  4PNY A;  4WRD A;  1JOK A;  5I9O A; 
#chains in the Genus database with same CATH topology
 1SMY C;  3G6J B;  3MFG A;  4DUY Q;  3SK5 A;  3QG1 A;  3G48 A;  1N32 L;  1RHP A;  4JBK A;  3PUV A;  2I46 A;  3DWP A;  1BUV T;  4MIU A;  1XNQ L;  3J7A F;  1LT6 D;  1IXR A;  1YHQ A;  1AW7 A;  3RN5 A;  1VDZ A;  3KLS A;  4GNX C;  3S14 B;  4U68 A;  3I2Z A;  5IYD G;  4FF4 A;  5IGF A;  2B8G A;  4NP5 A;  2E2D C;  3CXC A;  5KNC A;  1QUQ B;  2XTI A;  4BBS H;  4FXG C;  1TS2 A;  5COY A;  2D62 A;  2F4V Q;  4CKE A;  3OW2 A;  4FXK C;  1EY4 A;  1TWF B;  1EQV A;  2NVY B;  2R3Z A;  5C44 G;  2GVA A;  2EPB A;  1UEB A;  2PYK A;  3S24 A;  2QA4 A;  1DD2 A;  2NN6 I;  3IRB A;  1SRO A;  3LWE A;  4O42 A;  5IGD A;  4DV5 L;  3S17 B;  1G2S A;  2JP1 A;  5C44 H;  2B8F A;  4R8N A;  3Q8D A;  3S15 H;  2A74 C;  3CW2 C;  1SYF A;  2FHT A;  2IX1 A;  1R4Q B;  1KQS A;  2PQA B;  3EIV A;  1SE3 A;  1UE5 A;  2UXD Q;  1VMP A;  1PH4 A;  5J39 A;  4JW0 A;  2JA6 B;  1S72 A;  4YWL A;  2O4X A;  1QB5 D;  4FNF A;  4I7Z C;  1GUG A;  3KBG A;  2B2V C;  4LF5 L;  3PUY A;  3MVV A;  3T1H L;  3CCJ A;  1RKN A;  2FIN B;  4AH6 A;  4UP7 A;  2L55 A;  4BS9 A;  3K5M A;  1PYW D;  3TS2 A;  3QOJ A;  4IFD H;  4KD3 A;  4OL7 A;  1D5M C;  3VDY A;  4B3T L;  3HFZ B;  3KLW A;  2L15 A;  3ERS X;  1EY7 A;  1PFM A;  3L9A X;  3TP7 A;  2A6E D;  1IW7 C;  5FLX L;  2BOS A;  3MC0 B;  4MN3 A;  3HOZ G;  3CQZ H;  2R7Z B;  3UI2 A;  2IY5 B;  1PYS B;  1EZ6 A;  1EOV A;  1W6J A;  3M3Y B;  1X65 A;  2B39 A;  3SDZ A;  3R93 A;  1PFS A;  5I9O A;  3NE5 B;  4LFB L;  2MQH A;  3TS0 A;  4C3H G;  2X6G A;  1AH9 A;  5C5M A;  2FJ2 A;  4RHS A;  5K36 G;  1H95 A;  3DEO A;  4DV4 Q;  1B8A A;  1WTW A;  3KUP A;  3VYU A;  1B2T A;  2PCF B;  1OXX K;  2Z6K A;  3QO2 A;  3UDF A;  1CQV A;  1JWU D;  3I7F A;  4XYQ A;  1B53 A;  3KDF B;  4IPC A;  2NZO A;  4DR4 Q;  1NBW A;  1PH7 A;  5KRU A;  1A3T A;  5J3B A;  4GNX B;  5GRO A;  4C3J G;  1GXD C;  4DR5 L;  2CQA A;  1B9M A;  5EGT A;  2WII B;  4H13 C;  4LFA L;  4BBR B;  2OQ0 A;  3DLL A;  4IUV A;  1EWH A;  5K5P A;  5KYL A;  1O7Y A;  2DJG C;  5DAU A;  3HOV B;  1NE3 A;  4XYO A;  2EJF C;  3TBI B;  3GTM H;  4Y52 H;  1Y14 B;  3PIP A;  4JI7 Q;  1NSN S;  5CV9 A;  4JYA Q;  3F2D A;  2WAQ E;  5KND A;  5C4J B;  2DY8 A;  2BDN A;  1EY6 A;  3J81 i;  1FGB D;  1IYJ B;  1WJJ A;  3CU7 A;  1K83 H;  2V1C C;  2M9V A;  4IPH A;  1EZ8 A;  2K05 A;  4DR6 Q;  4Q5V A;  1HNX L;  5LMU L;  3NWS A;  1J8I A;  1GUW A;  1XJV A;  3C2P A;  1C9O A;  3K81 C;  3EA6 A;  4L6T B;  3S1M H;  4JV5 Q;  1FNW A;  3J80 E;  4ALP A;  4ZQ3 A;  5JJL A;  4FF1 A;  2WAC A;  2KHJ A;  4OWX B;  4F87 A;  1LV9 A;  2DN8 A;  1F2L A;  3C46 A;  3S16 H;  2EY1 A;  3CPF A;  1SE2 A;  1E3P A;  3D31 A;  5JEA H;  1JE5 A;  1SE8 A;  3OHX C;  4PZ7 A;  5IIF A;  4BY7 B;  1FJG Q;  4FF2 A;  4NB3 A;  1VQD A;  2LS0 1;  4C3I G;  4BBS B;  4K5W A;  3NTH A;  1VQL A;  1SYC A;  3FKI G;  1NMF A;  3U50 C;  2EDG A;  1WTR A;  2MJ8 A;  1Q82 C;  1PA6 A;  3HOY H;  4LUV A;  1WTQ A;  4HED A;  2I5M X;  3SE0 A;  1D5Z C;  4C3I H;  4PMB A;  2RCN A;  1KDC A;  2L1B A;  2LXJ A;  3GTO B;  1M90 C;  3FKI H;  4CDF C;  4KHP L;  4UP8 A;  4DXG A;  4Y7N H;  5KNB A;  5BN3 A;  4HJ7 A;  1WTO A;  1LYL A;  4LW1 A;  3S15 B;  1EWC A;  3SVM A;  1HUM A;  4N9P A;  4K5X A;  2CH4 A;  2RHS B;  3GTQ H;  2G9H D;  3I91 A;  1EQR A;  3D6W A;  1YHA A;  3DM1 A;  1E0B A;  4LF6 Q;  2Q2U A;  2YU9 H;  4IZ8 A;  4DV7 L;  3KFU A;  4A3B G;  4IJH A;  3S1R H;  3PO3 G;  1A2U A;  1PTO D;  1EIF A;  5AJ3 Q;  3MTS A;  5EKK A;  4X3T A;  1HFG A;  1ROD A;  3FPP A;  1BR9 A;  1M8A A;  1J9O A;  4PZ8 A;  4OEM B;  1FNU A;  4JI5 L;  1HNW L;  3QWN A;  2F03 A;  2BH8 A;  1HA6 A;  4DV1 L;  4HCS A;  3TZD A;  2B2U A;  3PUZ A;  2PQE A;  1IYU A;  5IYB H;  3VA5 A;  3NEL A;  3CQZ B;  2R7F A;  1QG7 A;  2N8N A;  3Q24 A;  1JIC A;  2A73 B;  3H3V H;  2Y0S G;  4GKK Q;  1PHJ A;  4POF A;  2UU9 L;  1AN8 A;  4A3I G;  1ONL A;  1XWE A;  2CCZ A;  3S2D H;  1UE7 A;  1JR0 D;  2B2Y C;  1MHW C;  1PZI D;  4NKL A;  1K8M A;  3BDL A;  1YIJ A;  3V96 A;  2A1A A;  3E0J A;  2JSO A;  4EQ5 A;  2F4I A;  2E75 C;  5M3M G;  3QIA A;  1TS4 A;  1C48 A;  4ABN A;  2EJG C;  2Q8R E;  4KI0 A;  2GN5 A;  4X64 L;  2AQ1 B;  2F0P A;  1EWI A;  3U4Z A;  4JI6 L;  1MKH A;  3L0O A;  3CAM A;  2K33 A;  2EY5 A;  5ELE A;  3A5U A;  4HIO A;  3JAM E;  1WOC A;  4ZKB B;  3R2T A;  4GOP A;  3HS0 C;  3BZD B;  1AEX A;  3A55 A;  2L4N A;  3D4D A;  3M4O H;  4LUO A;  1L0X B;  3GD7 A;  4MNO A;  5EJW A;  5ELN A;  4BY1 G;  3VR2 A;  3GTM B;  2UUA Q;  2A68 D;  1ZEQ X;  1JB3 A;  1VQA A;  1O7I A;  3NTI A;  2MUY A;  3HZX A;  2AQ3 B;  1SJH D;  5E3F A;  4CDE C;  4ZKC B;  1XNR L;  2F0N A;  1QNK A;  4OX9 L;  5C0X H;  4R4Q A;  1K83 B;  4P2C B;  4AQY L;  3I4L A;  3Q0A A;  4FYD A;  2VZA A;  3A0J A;  3UDX A;  2Q8T A;  2B63 B;  4A3D H;  2K5H A;  3M85 A;  3HEJ A;  3TSS A;  4JCV E;  1LTB D;  2EE1 A;  1VQ4 A;  1X9N A;  5IOD A;  4NXN Q;  1PH1 A;  2H5X A;  4K0K Q;  1WVL A;  1YI2 A;  1PTO F;  2QCP X;  5HGQ A;  2Q2T A;  2BA1 A;  1FNV A;  4LFC L;  4B9W A;  1I4H A;  2PNR C;  1E22 A;  3S2H H;  3S9W A;  4ZAI A;  1SLJ A;  2CVR A;  3J7Y W;  2E2H H;  1SE4 A;  1QCB D;  2JA5 B;  3ULJ A;  1SYB A;  1VS0 A;  4OO1 G;  3Q23 A;  3U58 A;  1QVF A;  3K59 A;  1C7Y A;  5M5X B;  1Y1W B;  2R93 B;  3I55 A;  1JQY D;  3EFX D;  1A15 A;  1B50 A;  3CCQ A;  2ASB A;  4OO1 H;  2PZU A;  4IFD J;  2E5L L;  1E2V A;  4X66 L;  1S40 A;  3HOY B;  5C4Z A;  1GUS A;  1SNM A;  1SXT A;  4WOR A;  5IP9 G;  2EVB A;  1FVI A;  1ML0 D;  2PW5 A;  3PGZ A;  3H6M A;  3KJO A;  4TVA B;  3HOU H;  4JI1 Q;  1CKM A;  3VR5 A;  4WJ3 M;  3MEF A;  2E74 C;  1S4Z A;  4QF4 A;  1KD1 C;  5IP9 H;  3CC7 A;  3QB3 A;  2FXQ A;  2WB1 B;  1JJ2 A;  1H9S A;  4X3S A;  2IX3 A;  2CW0 C;  5CC4 A;  3GTQ B;  1L1O C;  1ASZ A;  2KA7 A;  4K6D A;  3ZJY C;  1U0L A;  2QIL A;  4F88 A;  4UY8 C;  1N8R C;  3A8J E;  3EQL C;  2YU9 B;  4R4T A;  1D7Q A;  1PRT D;  4HMI A;  5EQ0 A;  3OIQ A;  3GTL H;  2NN6 G;  1PH2 A;  2F0K A;  3GQB A;  3J81 L;  1O80 A;  1HZ9 A;  2NTT A;  3H0G H;  5A2Q L;  1EYC A;  1X6O A;  2VB3 X;  1E2W A;  4JPB W;  4L5T A;  4HTH A;  1BXT A;  1G51 A;  2WB1 E;  2ZTE A;  1TKW B;  4DR7 L;  2NN6 H;  4C1N K;  1H9J A;  4MTN A;  1U4R A;  4XDX A;  5C3E H;  3T13 A;  5ISR A;  1HZA A;  4G57 A;  3FHW A;  5DM6 3;  3RR5 A;  1QJO A;  1D2B A;  1BDO A;  1RDP D;  3NQT A;  4A75 A;  1KAB A;  1SND A;  3I4M H;  3E9I A;  3S2D B;  3AFP A;  4F8M A;  1I6H H;  3DWA A;  1SNQ A;  1MGS A;  1Z9F A;  3BYY B;  1JT8 A;  1CA6 A;  2ZJQ A;  4DNT B;  4JI8 Q;  1K9M C;  2DJF C;  1YNN D;  3TP8 A;  1KTK A;  1RD9 D;  1I4Q A;  2UXC Q;  5GAD C;  1AZQ A;  1TT2 A;  1E1O A;  2LXK A;  4B3M L;  2I0Q A;  3E5S A;  1XPR A;  4HJ9 A;  2XSC A;  2RF4 A;  1HQM C;  2UUC L;  1ILP A;  4RGN A;  3QOL A;  2JXM B;  5E4X A;  1ICF B;  3M4O B;  4XQN A;  2Z6K C;  2EYF A;  1EEI D;  4LF7 Q;  4A3J B;  5JEA J;  1I94 Q;  2SEB D;  2EYH A;  1CQF A;  1G8Z D;  5LMN L;  1X3E A;  2R7Z G;  3AU7 A;  1HZB A;  4A3G H;  4CGY B;  2Z8L A;  1N34 Q;  1FGU A;  4JI3 L;  2E76 C;  4UDU C;  4A3D B;  4YY3 Q;  4JI2 L;  4N8X 1;  3STB D;  3BVM A;  4A3M B;  2L9H A;  2VQF L;  3SK8 A;  4CDD C;  4DV0 L;  4HIM A;  4DAV A;  2SOB A;  2WAQ G;  5IE8 A;  1YZ6 A;  1PRT F;  3EVQ A;  1L1O B;  1NMG A;  1NR4 A;  1NNX A;  1N33 Q;  2ICE C;  4GKJ L;  1Y1V H;  2EIF A;  2IW3 A;  2KCM A;  1SSO A;  4XT3 B;  3ITP A;  2K6A A;  3U4V A;  1PTO H;  5L37 A;  2J4X A;  5G3L D;  2ZT9 C;  3IFT A;  2R61 A;  1ENC A;  3BDO A;  4JI4 L;  4BBR G;  5CBA E;  3R2I A;  2HD3 A;  2H4O A;  2F0T A;  1B1Z A;  1G6P A;  1GOZ A;  2UXB Q;  1A63 A;  2AKW B;  5C6A A;  3J80 i;  5IP7 G;  2E2J H;  1I50 B;  3HOW G;  3QJY A;  4TKO B;  4X62 L;  2JA8 G;  5M5W H;  4KD4 A;  1Z47 A;  4OIJ A;  3UE1 A;  4OGQ C;  2XGT A;  1CKN B;  3VYR A;  4X65 Q;  2QEJ C;  1ET6 A;  2N78 A;  1NTG A;  1CHP D;  1X3G A;  1Y8O B;  2C9O A;  5IP7 H;  4UAI A;  3NPP A;  5KIX A;  1SBB B;  3HOW H;  3RUZ A;  1EL0 A;  2UUB Q;  4LF4 L;  4B9X A;  3TRZ A;  4A3E G;  1A0I A;  4DV3 Q;  3BU2 A;  1VQF A;  1TWA H;  3HOU B;  1HXY D;  1EY9 A;  4QMG A;  4A76 A;  1NJI C;  1WYD A;  2EZV A;  3DUZ A;  2NWG A;  5AFW A;  4POG A;  4A93 H;  5E4W C;  4A3E H;  1QVC A;  1CI3 M;  1CZG A;  4WFN 3;  1EU4 A;  2Q8I B;  4YIJ A;  3VA7 A;  1QVG A;  1HR0 L;  1DON A;  4GN5 A;  1ICW A;  4GS3 A;  3M7N A;  2Z0S A;  1Q86 C;  1U4L A;  4KHZ A;  2K32 A;  3TQY A;  1K28 A;  2MHV A;  1EY5 A;  1B3A A;  2PZT A;  2B29 A;  1KRS A;  2EOT A;  2IHE A;  4IN3 A;  4BY7 G;  4QB4 A;  5IYD H;  3H0G B;  1YNJ D;  4LUZ A;  4DV2 Q;  3HP3 A;  4DV6 Q;  5CBE E;  5DM7 3;  1Q81 C;  1GM5 A;  3G6E A;  3KF8 B;  3PO2 G;  1BKB A;  1V1P B;  5COR A;  1S5F D;  4C2M H;  5C3E B;  1FYC A;  4DPG A;  2B2W A;  2DNE A;  1TS5 A;  3E3X A;  5D65 A;  3GTK H;  3MXG A;  3CHB D;  3C1F A;  4DNR B;  1CK1 A;  4P75 A;  4PV1 C;  1CSP A;  3I4M B;  1WCM G;  1N32 Q;  3URY A;  1EYD A;  5EBD A;  3MEH A;  1XNQ Q;  3JC6 6;  1N36 L;  4LF9 L;  1I6H B;  2NVX B;  1CZW A;  5C0X J;  2B2U C;  5IWA L;  4ZUJ A;  1XX8 A;  1BBU A;  3J80 c;  2XNA C;  5G3L F;  1WCM H;  1TQO A;  2A6H D;  3BVG A;  3GP7 A;  2HCC A;  1PYB A;  2YTX A;  2E2I H;  4HJ8 A;  3I4N B;  1JOK A;  1K8A C;  2PI2 E;  1IBM L;  2DGY A;  4QUC A;  3KLS X;  1O7Z A;  1QE6 A;  1QIL A;  2VNU D;  4IUU A;  1A8V A;  4RCO A;  4NW2 A;  1LUZ A;  1TY2 A;  1SYE A;  2R92 G;  2IL8 A;  2N55 A;  4IQZ A;  2RVL A;  3N52 A;  1LLR D;  2K5Q A;  3OWE B;  1J6Q A;  4J6H A;  3SK4 A;  3FP9 A;  3KLR A;  2BCO A;  3I8Z A;  1B7Y B;  2R92 H;  1LAC A;  2EQS A;  4P74 A;  3GTJ B;  5IGE A;  4DV5 Q;  2IJ0 A;  1MBY A;  1K3B C;  4GOP C;  1TWG H;  3JAM i;  2ZXP A;  1KAW A;  2AWN A;  4TQU S;  1GHJ A;  1H9M A;  5FJ8 G;  1MSH A;  1VQC A;  4QGU A;  3HOZ H;  2OT2 A;  4DU9 A;  2NVQ B;  3KF6 B;  4QL5 A;  1WTV A;  4AYB B;  5GAE C;  3PSI A;  1II3 A;  3U9S A;  4C3H H;  5T1I A;  1RCV D;  3P75 A;  2XWB B;  4LF5 Q;  4KJO A;  5K36 H;  1D1K A;  3T1H Q;  5C4X G;  1LTG D;  3MXU A;  3OTO L;  2ENB A;  3J7A V;  2D5D A;  3KOJ A;  1Y1V B;  2XWJ B;  1STE A;  3HRZ C;  4B3T Q;  1EY0 A;  1SAP A;  1PZJ D;  3NBI A;  2F0S A;  1SFO H;  1Y8N B;  2QF7 A;  1KXL A;  3HG9 A;  1TWH B;  4C3J H;  5IY0 A;  4DR2 L;  3IKJ A;  3OIP A;  4AYB E;  1WTP A;  3H15 A;  2KQ3 A;  5M5Y H;  2FMM A;  3RZO B;  1TWC H;  1AP0 A;  1VQ9 A;  4LF8 L;  3X3N A;  5M5W B;  1VQ7 A;  4LFB Q;  1TU2 B;  3E9H A;  2NZ1 D;  3TDQ A;  1LT3 D;  2D2C C;  2YV5 A;  5FLM G;  2PQA A;  3A74 A;  2D0P A;  5CMD A;  1DOL A;  3K0Y A;  3BYT B;  4Q0F A;  5FO7 B;  2B63 G;  3PV0 A;  4JVZ A;  4V0B A;  1ZYR D;  3MWY W;  4BXX G;  4A3K G;  4A93 B;  1V9P A;  3KJP A;  4DR5 Q;  3C1E A;  1IKM A;  4B08 A;  2SDF A;  4KY7 A;  2OTL A;  4LFA Q;  1BVS A;  4JC0 A;  5CV6 A;  1PRT C;  2XRQ D;  4K5V A;  3F2U A;  2RHQ B;  1MD2 D;  1ESR A;  3JAM c;  2F3V A;  4HMJ A;  3SEB A;  2KJX A;  2KBN A;  3RLF A;  2AWO A;  1NR2 A;  1GKH A;  4CDC C;  3OMG A;  4RKB A;  2IWH A;  2OF1 A;  3D3R A;  2LSS A;  4ODG A;  4J1M A;  2PMZ B;  1BCP C;  3D4W A;  3D6C A;  1Y1W G;  3IAY A;  3NSW A;  2VL6 A;  2JE6 I;  1HNX Q;  4PZ6 A;  5LMU Q;  1CKO A;  2BE5 D;  4FF3 A;  1PXU A;  1RIP A;  4C2M B;  3OOC A;  1J5E L;  3NWT A;  1HPC A;  1QZH A;  4GOP B;  4H44 C;  3GTK B;  1IKL A;  1K73 C;  1DZ1 A;  4WJW A;  1XMQ L;  4AIM A;  1VQ5 A;  5C44 B;  2K5D A;  4IUQ A;  4G7Z C;  5IGG A;  3FRP B;  3KDF A;  3QR8 A;  2NVT H;  2O5J C;  1S5B D;  4PG3 A;  1SDF A;  3P1H A;  2ID0 A;  1IL8 A;  1YNN C;  1E1T A;  2WB1 G;  4DR3 L;  2MNA A;  2KEE A;  2D9U A;  3SGI A;  3PUW A;  3E6Z X;  1F9P A;  4R4O A;  4JG2 A;  1B4O A;  5LL6 S;  3OMC A;  1V43 A;  4YHH L;  1X55 A;  3NBH A;  4HID A;  4NDX A;  1U9R A;  3J80 L;  3A5Z B;  2ZM6 L;  1Y69 U;  4J15 A;  3CCS A;  4A3B H;  1YNX A;  3PO3 H;  1FD7 D;  5LHY 1;  2N3S A;  4XQQ A;  1KNA A;  2X6L A;  4YCW A;  2MP1 A;  4R9W A;  1ENF A;  3HOX G;  4KHP Q;  2Z4I A;  5EPJ A;  1TWG B;  5CV4 A;  3OWF A;  1OO9 B;  2HQL A;  5C3X A;  4DAP A;  1GO3 E;  1DGS A;  3STB C;  2CH4 W;  1LTT D;  3ULP A;  1E7Z A;  1P16 A;  4A3I H;  4C3H B;  1YHB A;  4DV7 Q;  1HTP A;  5D14 A;  2RBM A;  2ZTD A;  5C4H A;  2VUM G;  2MO1 A;  3J81 j;  5I6W A;  1XMO L;  5GAH C;  1HUN A;  5M3M H;  1BOS A;  3PMF A;  3GV6 A;  1DCZ A;  4L8J A;  5J1Z A;  1X56 A;  5ELF A;  1M4V A;  2VUM H;  4GN4 B;  2K5W A;  4JI5 Q;  1HNW Q;  5JPM C;  1R9T H;  3S1Q H;  2MPM A;  4U67 3;  4DV1 Q;  1SR3 A;  3CCE A;  4RGT A;  2JA9 A;  1H9S B;  5EAY A;  4BA2 I;  3G7L A;  1BCP B;  2EJM A;  4IUR A;  1F9R A;  2UU9 Q;  1TWC B;  2LKV A;  1JOQ A;  3MAQ A;  2A5H A;  4BY1 H;  4FVM A;  4IOC A;  4KKS A;  2K7V A;  3H3V C;  2KCN A;  1HRJ A;  2I5H A;  3OYY A;  2LY7 A;  1IBK L;  1OTC A;  3MXN B;  5H1S E;  1V1Q A;  4PMC A;  4QQB X;  2XVS A;  3OPO A;  4B3S L;  2M00 A;  5T1G A;  4RGM A;  1MI2 A;  1RL2 A;  1MIU A;  1Q1E A;  3WOF A;  1W3S A;  4H7B A;  2Z4H A;  3FPU B;  4X64 Q;  3S1M B;  2KHI A;  4R8I A;  3V05 A;  2N49 A;  3X3M A;  4JI6 Q;  5JJZ A;  2IT1 A;  4A3M G;  1EUJ A;  1EIG A;  1JOR A;  1PFN A;  3FEW X;  4TSS A;  5DLQ E;  1HFN A;  2HHH L;  3B6Y A;  4QY7 A;  2R6G A;  4O1N A;  4C1N I;  1K0R A;  4A3C G;  4LWC A;  4HJ5 A;  3S16 B;  4CKC A;  5IT9 E;  1WTX A;  1E2Z A;  4GN3 B;  1ENA A;  3M4P A;  1YEZ A;  4K2K A;  3T56 B;  4RA8 A;  3M4Y A;  3I4O A;  3TME A;  1YNJ C;  3I3C A;  3M4Q A;  1G2T A;  2CWP A;  2ES2 A;  2ICI A;  4ILW A;  4KK7 A;  1XNR Q;  1I5F A;  2VQE L;  4OX9 Q;  2MGS A;  4XIG S;  3DXJ C;  4AQY Q;  3TZU A;  1F2Y A;  2JJQ A;  2K75 A;  1RTN A;  5M3F G;  3I70 A;  2HIV A;  3I90 A;  5EBC A;  4C3I B;  1WTH A;  2KEN A;  4OEL B;  2J7Z A;  3DHQ A;  2K04 A;  1EFI D;  4A3F G;  3FKI B;  3K7A H;  2ZTC A;  1Q46 A;  4EQP A;  4DUZ L;  5LL6 X;  2JA7 G;  1T5E A;  4L63 B;  4Y7N B;  5M3F H;  1PH3 A;  1G91 A;  2AMC B;  2IX0 A;  5CV8 A;  4DR1 L;  4ME3 A;  4A3F H;  4LFC Q;  1VMC A;  2B3G A;  1WFQ A;  2A6H C;  5JVH 3;  1X3F A;  2B2W C;  1JWS D;  1N9W A;  2OEO A;  2F0D A;  2L12 A;  2ZJR A;  3S1R B;  4JI0 L;  3CRL C;  5DNF A;  3GTP H;  4YWK A;  2K03 A;  4G4K A;  4IAL A;  1IHZ A;  1IBL L;  1KC8 C;  1TVX A;  4DXF A;  3S14 H;  4A3B B;  2Q2I A;  3SXH A;  1K8O A;  2A6E C;  2FFK B;  4MTK A;  4O0A A;  3PO3 B;  2RA4 A;  4FP5 D;  2E5L Q;  4X66 Q;  2AQ2 B;  4GZY C;  3HKZ B;  4HAE A;  4A3L G;  2QDL A;  4DK0 A;  1S3O A;  4LJZ C;  2RCF A;  2SNS A;  2JQO A;  5JVG 3;  2WKC A;  5CV7 A;  3K6O A;  1PV4 A;  2P5Z X;  2EXZ A;  1TWF H;  2O2L D;  4K8I A;  2F3I A;  4S3S A;  5ELB A;  5TSS A;  2Y0S B;  2F0F A;  4YWM A;  4CJ0 B;  2KOL A;  1KL9 A;  3LNN A;  4A3I B;  4HSP A;  2F0L A;  2JA6 G;  1T5X D;  3HGB A;  3C3L A;  4NXM L;  3S17 H;  2EY2 A;  1A62 A;  3PIO 3;  1Q12 A;  3NHH A;  4B3R L;  4RWS C;  3G71 A;  4L5R C;  3HKZ E;  3T51 B;  5IGB A;  5BR8 L;  3D8G A;  3CCV A;  5FKA C;  3RN2 A;  4DNI A;  3LX0 A;  3F8T A;  1VQG A;  4EX5 A;  2JA6 H;  1X32 A;  2ATW A;  4J8Q A;  4DR7 Q;  3T1Y L;  4LK1 C;  1F9Q A;  4ZK9 B;  2Y0S E;  2F0M A;  3K5O A;  4JK1 C;  3DM3 A;  2EYP A;  4KHV A;  3T16 A;  3VR6 A;  1YJN A;  4HIK A;  3IFD A;  1NY4 A;  4IJL A;  1VCI A;  2Z1C A;  3Q6S A;  1DOK A;  4QIW B;  4BY1 B;  1BF4 A;  1AZP A;  2B2Y A;  1KIX A;  1SYD A;  2K14 A;  2XRS D;  4KKU A;  4WRD A;  1VQI A;  1JMC A;  4HR7 B;  2R7Z H;  1H9K A;  1CT1 D;  2C5C A;  1ZKO A;  3M3Y H;  3EJI A;  1IYV A;  1X3Q A;  4ULL A;  5IGC A;  1F2M A;  1XYI A;  4B3M Q;  1TR5 A;  1HH2 P;  2AUK A;  1ASY A;  2RDH A;  4GLV B;  4X3U A;  2UUC Q;  3S2H B;  1QZG A;  5IOC A;  2VB2 X;  2E2H B;  3W1B A;  4ZCK A;  3MFY A;  1UAP A;  3W2D A;  4DUY L;  2YTV A;  3ULL A;  3N6R A;  4RFB A;  1EQQ A;  3HOV G;  4IPD A;  3WOE A;  1OXS C;  2CKZ B;  2PO4 A;  1C4Q A;  5LMN Q;  1I6V C;  5LMN W;  1YJ9 A;  4BBR H;  1LO5 D;  4NPS A;  3A7A B;  2NB0 A;  3FDT A;  5C5L A;  2M2L A;  4KN7 C;  4JI3 Q;  1V8Q A;  4MHE A;  1I4P A;  2RKS A;  4QJF A;  1VQK A;  2RDF A;  4HJA A;  2JA8 H;  4JI2 Q;  1DJR D;  2F3W A;  5HGT A;  2A19 A;  1D6E C;  2VQF Q;  2F0U A;  3KBX A;  4DV0 Q;  2F4V L;  1NCV A;  3S1N H;  1SNP A;  5HUR A;  5IYC G;  1B70 B;  4DN4 M;  4JBW A;  1X3P A;  3BZK A;  3O13 A;  2EY6 A;  3CF5 A;  4DK6 C;  4GKJ Q;  5ELD A;  4KMU C;  4LAA A;  1SNC A;  3RZD H;  3UDI A;  1GVP A;  5IYC H;  1L0Y B;  1IL2 A;  1PTO C;  4JI4 Q;  1LTI D;  2KCT A;  1KHI A;  4PMW A;  4KY6 A;  4F7X A;  1PH8 A;  1R4P B;  1PZK D;  3GTL B;  3T53 B;  3VR4 A;  4ZUI A;  3GTP B;  2UXD L;  2MO0 A;  1EFW A;  4CHT B;  2CHB D;  4X62 Q;  1ILQ A;  1XPU A;  4DAY A;  2NBF A;  4CJ2 C;  4BBS G;  1Y8P B;  1A2T A;  2QGQ A;  5FLX E;  3KYH C;  3L3O C;  2SNM A;  1ESF A;  4BY7 H;  2D0O A;  1M1K C;  4PNY A;  4R4I A;  4LF4 Q;  4QCL A;  2NUC A;  1Q1B A;  3PO2 H;  3H91 A;  3NK9 A;  1JJC B;  2ALY B;  1GD7 A;  1AE2 A;  3K8A A;  2DNC A;  3BVZ A;  4I65 A;  4JOI A;  1YIT A;  3M9B A;  1OXT A;  1L1O A;  2EYM A;  2XIW A;  1JOO A;  4IUN A;  1TY0 A;  3GTO H;  3J7Z C;  1S5D D;  1HR0 Q;  4XTC S;  1LAB A;  1W6K A;  1HR0 W;  4UHV A;  2PNH A;  5FK9 C;  2K52 A;  1KNE A;  2HUG A;  1TXY A;  2RSO A;  4RMF A;  2JEA I;  3ER0 A;  1GHK A;  3VYS A;  4DV4 L;  4DFA A;  2QDB A;  1I4X A;  1EQT A;  4K6L A;  1S5E D;  2CW0 D;  2JN4 A;  1VF7 A;  1RTO A;  4IFD G;  2HDL A;  1GJX A;  3CCM A;  2A68 C;  2GA4 B;  4H02 A;  1CKN A;  4DR4 L;  5EPK A;  3CME A;  1VQN A;  2QW7 A;  2KEC A;  3D0F A;  4RHR A;  1TII D;  4A3G B;  4L5S A;  4DAM A;  3PF4 A;  2RQX A;  3K5L A;  2F0J A;  2JK8 A;  3BJU A;  3VR3 A;  1N36 Q;  4LF9 Q;  4JI7 L;  1F77 A;  2I5L X;  1JC7 A;  3FMC A;  4DGZ A;  3MXP A;  5IWA Q;  4JYA L;  2TSS A;  1EU3 A;  5FJ8 H;  4DK3 C;  1NUC A;  1VQ6 A;  1LTL A;  5JJI A;  1HCZ A;  4IOA A;  2F0Q A;  2QKI C;  4DR6 L;  1RF2 D;  1IBM Q;  2IHF A;  3W5O A;  1QUQ A;  4XXE A;  1PTO B;  3V2T A;  2V4D A;  1STG A;  4RAU C;  2K50 A;  2WAQ B;  4YCU A;  5C4X H;  4O2D A;  4JV5 L;  1A6X A;  1SRU A;  3KF8 A;  2F0O A;  1V1P A;  3A8I E;  3K5N A;  1STY A;  4HSV A;  3J7A 5;  1CA5 A;  2E2J B;  1K0S A;  1JJG A;  2PI2 A;  4GLA C;  4UPA A;  1Q3L A;  1W2B A;  1PVO A;  1O78 A;  1F9S A;  1STA A;  1KLG D;  2Z6B A;  3EBE A;  2VW9 A;  5JAV A;  2WIN B;  1FR3 A;  2B2T A;  1IZ6 A;  1PFB A;  5D3I B;  1VQM A;  5JJK A;  3NBH B;  3OW7 A;  5C3W A;  3HOW B;  1YJW A;  1FJG L;  2ZXR A;  2JA8 B;  1ET9 A;  3MZ5 A;  3A7L A;  1U4M A;  1WI5 A;  1TWA B;  4DA2 A;  4K14 A;  5D3D A;  1DYQ A;  3GV3 A;  2ZJP A;  3UDG A;  1STB A;  2K5V A;  3SK6 A;  5FLM H;  3S1N B;  3I73 A;  3RLN A;  1K3R A;  3OTO Q;  4A3E B;  1YBY A;  1D8L A;  2B63 H;  5EPL A;  1K8G A;  1P8L A;  2K01 A;  4ME5 A;  3SHL A;  3RZD B;  4HN7 A;  4QUF A;  3ZYY X;  4KY5 A;  4BXX H;  4A3K H;  1PLF A;  4IO9 A;  1VQH A;  2JA5 G;  4DR2 Q;  5JEA G;  5CV5 A;  2I07 B;  1QWY A;  2E8G A;  5KYI A;  1Q7Y C;  4LF8 Q;  4MZ9 A;  4LF6 L;  3NTK A;  2VXW A;  2R93 G;  2F0W A;  2JA5 H;  1BO0 A;  1A3V A;  1WD1 A;  5I9P A;  2OTJ A;  5AJ3 L;  3KF6 A;  3HOY G;  4KN4 C;  1KRT A;  5M5X H;  1VQO A;  1Y1W H;  2R93 H;  5GQO A;  4G7O C;  3PO2 B;  5F2D A;  2A69 D;  4KTA A;  1BNZ A;  4R4C A;  1F2Z A;  2OXP A;  2OWO A;  1CHQ D;  4XQJ A;  3AFQ A;  4GNX A;  2PMZ E;  1LTR D;  2WP8 J;  4R1J A;  1G6Z A;  2CFM A;  1WCM B;  2LFN A;  3PIO A;  4GKK L;  3WWV A;  3AEV A;  1SMY D;  1VQP A;  2E2I B;  2F0G A;  1I4R A;  3I72 A;  4KV6 A;  3AQQ A;  5NUC A;  3CC2 A;  5IT9 c;  3F2C A;  1LT5 D;  2PPB C;  2JEB I;  1PH5 A;  4UP9 A;  1H9R A;  4OIK A;  2F1M A;  4EVO A;  4ZLT F;  1C0A A;  1GUO A;  4CKB A;  1XPO A;  3PQI A;  3J81 c;  2YYZ A;  2HDM A;  3DMU A;  3BG3 A;  3ND9 A;  1J5E Q;  1JCK B;  1AFP A;  3H09 A;  1BBW A;  3M7G A;  1UUP A;  3CCU A;  2ZXO A;  3ICE A;  2R92 B;  4IUT A;  4ID6 A;  2N88 A;  5IYB G;  3HKZ G;  1XMQ Q;  5CGK A;  1C8C A;  2PW7 A;  4IFD I;  3VYT A;  3HOZ B;  3L7Z C;  1B3Q A;  3D4R A;  2K4K A;  4XT1 B;  4KJN A;  2TMP A;  2HCI A;  2UUA L;  3HOX H;  4RGO S;  4RG1 A;  1DXM A;  4DR3 Q;  2B2V A;  1DOM A;  1XTD A;  2K1B A;  3GTG H;  4N9T A;  2MFI A;  4GLX A;  1QNU A;  4YHH Q;  2F0H A;  4OHJ A;  2ZM6 Q;  5EKI A;  5I6Y A;  1PRT B;  2L0C A;  1SEB D;  5GAG C;  5FO8 B;  3LWU A;  4DKA C;  1KDB A;  4NXN L;  1CSQ A;  3RD4 A;  5C4X B;  5KGU A;  3Q22 A;  1SFO B;  5BN4 A;  1LM0 A;  4OWW B;  4C3J B;  2F0V A;  4K0K L;  2AUJ D;  1PMR A;  1L0W A;  1A3U A;  3TEH B;  5M5Y B;  4C56 C;  4LMQ D;  4DF7 A;  3DWQ A;  1GUT A;  1Z6H A;  4A3J G;  4NMZ A;  1QOH A;  1RJT A;  4IUP A;  4JBJ A;  5DEH A;  5E7N A;  1OXU A;  2G9D A;  3T4A C;  3CMA A;  2A8V A;  3A56 A;  2DY7 A;  4YCV A;  4LNQ A;  3A8K E;  5C0X G;  4RCN A;  2WKD A;  1T9H A;  4A3J H;  1IW7 D;  1HA5 A;  1MJC A;  4WJ4 A;  1VF5 C;  4N8F A;  4A3D G;  3NXW A;  3BZC A;  3LGJ A;  4HCE A;  1Z7T A;  5EKL A;  5CR3 A;  1SYG A;  1XMO Q;  3RNU A;  5I2X A;  3PF5 A;  5FOB B;  3P7J A;  3TRE A;  1Q8K A;  1HNZ L;  1SNO A;  3AYH B;  4A3M H;  4JI1 L;  3L2P A;  4H0L C;  2AHO B;  2F52 A;  3J81 E;  4A3K B;  1SMX A;  4A3C H;  2L5T A;  1X54 A;  3K80 C;  5A2Q E;  4FDB A;  4K8J A;  2BH2 A;  1XTC D;  2K28 A;  4M1U B;  3NEN A;  1GUN A;  3NUC A;  3JAM L;  5I2Y A;  3CKI B;  1Q90 A;  5E1F A;  3CCL A;  1UNS A;  1IBK Q;  3GDE A;  4B3S Q;  4EQN A;  3TP6 A;  3CRK C;  2QEX A;  3PIP 3;  1KDA A;  3CPW A;  1I50 H;  3G4S A;  3KK7 A;  1I3Q H;  2WV6 D;  1I4G A;  3HOU G;  3CCR A;  2NVT B;  1VQE A;  1YVC A;  2HHH Q;  3CC4 A;  1HHV A;  2BA0 A;  1HNZ Q;  2EYJ A;  2JA7 H;  3W3A A;  4JBM A;  5ELO A;  2Q2H A;  4BWG B;  1U5K A;  5JPN C;  3MA2 B;  2R7D A;  1CFM A;  4EQO A;  1NAP A;  1UWV A;  2HT1 A;  3AB9 A;  2GVB A;  2G5D A;  3BDC A;  2OQK A;  1SN8 A;  3K57 A;  4APV A;  3FVQ A;  4JOI C;  5BN5 A;  4Z9C B;  2VY3 A;  3SR1 A;  1CTM A;  1D5X C;  3WDN A;  1EOT A;  2NTS A;  4JI8 L;  2VQE Q;  2EYO A;  2KHS A;  3H0G G;  3R3O A;  5IT9 L;  3HKS A;  1B9N A;  3ERO A;  4CBV A;  1MSG A;  2UXC L;  1PH6 A;  3MXN A;  1UE1 A;  3TN2 A;  1VQB A;  1BBX C;  4P73 A;  5C3E G;  4DUZ Q;  1VQ8 A;  2KED A;  2IPK D;  1KAA A;  1LTS D;  1EYG A;  1STH A;  4V19 0;  5JOB A;  4DR1 Q;  2NVY H;  5HY6 A;  1D1I A;  1BCP D;  4A3L H;  4L5Q A;  3I4M G;  4LF7 L;  1STN A;  4OON A;  3NQI A;  3HOX B;  1I94 L;  4TRD A;  4M8A A;  1PH9 A;  5KEE A;  2KUM A;  4X6A H;  1V1O A;  1KLU D;  1AE3 A;  3GTG B;  4JI0 Q;  3H3V I;  1HJP A;  4OXP A;  1LTA D;  4P72 A;  3EN2 A;  1BQQ T;  5M3M B;  2J0T D;  1N34 L;  4PQX A;  3I4N G;  1OXV A;  2NVX H;  1IBL Q;  2H1E A;  4YY3 L;  4RH6 A;  1HTL D;  3F1Z A;  2VUM B;  1EY8 A;  1HQR D;  3PCO B;  1MJE A;  2L11 A;  2NZH A;  2NYZ D;  1R9T B;  1UE6 A;  1CM9 A;  3S1Q B;  2PZW A;  3I4N H;  4DK1 A;  1TS3 A;  2CWA A;  1N33 L;  2BDO A;  1E24 A;  2K5N A;  3CD6 A;  2EXD A;  4E6I A;  2C35 B;  2KVM A;  4A4I A;  1PDQ A;  5FLX c;  3K58 A;  3W1G A;  5CYU A;  5I4D A;  3K7U C;  4KKT A;  4IPG A;  4BA1 I;  2FMC A;  4A3G G;  3PUX A;  1U4P A;  4RKL A;  5FO9 B;  2UXB L;  1S5C D;  3NP8 A;  5J22 A;  2KCC A;  2HQE A;  3A54 A;  3OSO A;  2X69 A;  2YTY A;  5ELC A;  3GTJ H;  1ZYR C;  4DAY B;  4AYB G;  3TP5 A;  2OCE A;  4NXM Q;  4CJ1 B;  3ONA B;  4X65 L;  4B3R Q;  1WD0 A;  2RDG A;  2RSN A;  5BR8 Q;  2NVQ H;  2B2T C;  2HIX A;  2EYL A;  5C0X I;  1JE4 A;  4QIW E;  5A35 A;  4EGV A;  2UUB L;  2VS1 A;  1HZC A;  4G7H C;  4DV3 L;  1Y1V G;  2Z9H A;  4ZRZ A;  3I56 A;  3T1Y Q;  1EIY B;  1JB7 A;  4P71 A;  2LMC B;  1SJE D;  1FL0 A;  3NEM A;  3U9O A;  3RMH A;  3UE0 A;  2F0E A;  4K2L A;  3R8B A;  2F0I A;  1CUK A;  1L2F A;  1XXG A;  4KLK A;  2BE5 C;  3HOV H;  1EEF D;  2JYO A;  3P20 A;  3IL8 A;  5M9O A;  3AMU A;  1TWH H;  1BCP F;  3F2B A;  3ND8 A;  1B44 D;  1LT4 D;  1O7L A;  5C4J H;  4I7A A;  2CQO A;  3BS1 A;  2A69 C;  4FXD A;  3RZO H;  3K7A B;  3E0E A;  1G29 1;  4FO2 A;  3ERQ A;  3K0X A;  3CP0 A;  4DV2 L;  1I3Q B;  4DV6 L;  5M3F B;  1DM0 B;  1Q8I A;  4OWT B;  1JWM D;  2WFW A;  3DEP A;  1ZXT A;  2XN9 C;  4A3F B;  4OO1 I;  2DUD A;  3H94 A;  1EYA A;  1UEA B;  3MHB A;  3RLO A;  4ZYS A;  1VQJ A;  4A93 G;  2JA7 B;  2O5I C;  3GO5 A;  4X3K A;  1EIH A; 
#chains in the Genus database with same CATH homology
 1SMY C;  3G6J B;  3MFG A;  3SK5 A;  3QG1 A;  1RHP A;  3PUV A;  2I46 A;  3DWP A;  1BUV T;  4MIU A;  3J7A F;  1LT6 D;  1AW7 A;  1VDZ A;  3KLS A;  3S14 B;  4U68 A;  4FF4 A;  5IGF A;  2B8G A;  4NP5 A;  2E2D C;  5KNC A;  4FXG C;  1TS2 A;  5COY A;  2D62 A;  4CKE A;  4FXK C;  1EY4 A;  1TWF B;  1EQV A;  2NVY B;  2R3Z A;  2EPB A;  1DD2 A;  2PYK A;  2NN6 I;  3LWE A;  4O42 A;  5IGD A;  3S17 B;  1G2S A;  2JP1 A;  2B8F A;  4R8N A;  2A74 C;  1SYF A;  2FHT A;  2IX1 A;  1R4Q B;  1SE3 A;  1VMP A;  5J39 A;  2JA6 B;  2O4X A;  1QB5 D;  4FNF A;  4I7Z C;  1GUG A;  3KBG A;  2B2V C;  3PUY A;  3MVV A;  1RKN A;  2FIN B;  2L55 A;  4BS9 A;  3K5M A;  1PYW D;  3QOJ A;  4IFD H;  4KD3 A;  4OL7 A;  1D5M C;  1EY7 A;  1PFM A;  3L9A X;  3TP7 A;  2A6E D;  1IW7 C;  5FLX L;  2BOS A;  3MC0 B;  4MN3 A;  2R7Z B;  3UI2 A;  1EZ6 A;  1W6J A;  3M3Y B;  2B39 A;  3SDZ A;  3R93 A;  5I9O A;  3NE5 B;  4C3H G;  2X6G A;  5C5M A;  2FJ2 A;  4RHS A;  5K36 G;  3DEO A;  1WTW A;  3KUP A;  3VYU A;  1B2T A;  2PCF B;  1OXX K;  3QO2 A;  1CQV A;  1JWU D;  4XYQ A;  1B53 A;  5KRU A;  1A3T A;  4C3J G;  1GXD C;  2CQA A;  1B9M A;  5EGT A;  2WII B;  4H13 C;  4BBR B;  4IUV A;  1EWH A;  5K5P A;  5KYL A;  1O7Y A;  5DAU A;  3HOV B;  4XYO A;  2EJF C;  3TBI B;  1NSN S;  5CV9 A;  5KND A;  5C4J B;  2DY8 A;  2BDN A;  1EY6 A;  1FGB D;  3CU7 A;  2M9V A;  1EZ8 A;  2K05 A;  4Q5V A;  3NWS A;  1J8I A;  1GUW A;  3C2P A;  3EA6 A;  4L6T B;  1FNW A;  3J80 E;  4ZQ3 A;  4FF1 A;  2WAC A;  4F87 A;  1LV9 A;  2DN8 A;  1F2L A;  3C46 A;  2EY1 A;  1SE2 A;  3D31 A;  5JEA H;  3OHX C;  5IIF A;  4BY7 B;  4FF2 A;  2LS0 1;  4C3I G;  4BBS B;  4K5W A;  3NTH A;  1SYC A;  2EDG A;  1WTR A;  2MJ8 A;  1WTQ A;  4HED A;  3SE0 A;  1D5Z C;  4PMB A;  1KDC A;  2L1B A;  3GTO B;  4DXG A;  5KNB A;  5BN3 A;  1WTO A;  3S15 B;  1EWC A;  3SVM A;  1HUM A;  4N9P A;  4K5X A;  2G9H D;  3I91 A;  3D6W A;  3DM1 A;  1E0B A;  4IZ8 A;  1A2U A;  1PTO D;  3MTS A;  5EKK A;  4X3T A;  1HFG A;  1ROD A;  3FPP A;  1BR9 A;  1M8A A;  1J9O A;  1FNU A;  3QWN A;  2F03 A;  1HA6 A;  4HCS A;  3TZD A;  2B2U A;  3PUZ A;  2PQE A;  1IYU A;  3VA5 A;  3CQZ B;  1QG7 A;  3Q24 A;  1JIC A;  2A73 B;  1AN8 A;  1ONL A;  1XWE A;  1JR0 D;  2B2Y C;  1PZI D;  4NKL A;  1K8M A;  3BDL A;  3V96 A;  3E0J A;  2JSO A;  2F4I A;  2E75 C;  3QIA A;  1TS4 A;  1C48 A;  4ABN A;  2EJG C;  2Q8R E;  4KI0 A;  2AQ1 B;  2F0P A;  2K33 A;  2EY5 A;  5ELE A;  3JAM E;  4ZKB B;  3R2T A;  3HS0 C;  3BZD B;  1AEX A;  3A55 A;  2L4N A;  3D4D A;  1L0X B;  3GD7 A;  5EJW A;  3VR2 A;  3GTM B;  2A68 D;  1ZEQ X;  1JB3 A;  3NTI A;  2MUY A;  3HZX A;  2AQ3 B;  1SJH D;  5E3F A;  4ZKC B;  2F0N A;  1QNK A;  5C0X H;  1K83 B;  4P2C B;  3I4L A;  3Q0A A;  4FYD A;  2Q8T A;  2B63 B;  3M85 A;  3HEJ A;  3TSS A;  1LTB D;  2EE1 A;  5IOD A;  1WVL A;  1PTO F;  2QCP X;  2BA1 A;  1FNV A;  4B9W A;  1I4H A;  2PNR C;  3S9W A;  4ZAI A;  2CVR A;  3J7Y W;  1SE4 A;  1QCB D;  2JA5 B;  1SYB A;  4OO1 G;  3Q23 A;  3K59 A;  5M5X B;  1Y1W B;  2R93 B;  1JQY D;  3EFX D;  1A15 A;  1B50 A;  4OO1 H;  4IFD J;  2PZU A;  1E2V A;  3HOY B;  5C4Z A;  1GUS A;  1SNM A;  1SXT A;  4WOR A;  2EVB A;  1ML0 D;  2PW5 A;  3H6M A;  3VR5 A;  2E74 C;  1S4Z A;  4QF4 A;  3QB3 A;  2WB1 B;  1H9S A;  4X3S A;  2IX3 A;  2CW0 C;  5CC4 A;  3GTQ B;  2KA7 A;  4K6D A;  2QIL A;  4F88 A;  3A8J E;  3EQL C;  2YU9 B;  1PRT D;  4HMI A;  5EQ0 A;  3OIQ A;  2NN6 G;  2F0K A;  3GQB A;  3J81 L;  1O80 A;  2NTT A;  5A2Q L;  1EYC A;  2VB3 X;  1E2W A;  4HTH A;  1BXT A;  1TKW B;  2NN6 H;  4C1N K;  1H9J A;  1U4R A;  4XDX A;  3T13 A;  5ISR A;  4G57 A;  5DM6 3;  1QJO A;  1D2B A;  1BDO A;  1RDP D;  3NQT A;  1KAB A;  1SND A;  3S2D B;  4F8M A;  3DWA A;  1SNQ A;  1MGS A;  3BYY B;  1CA6 A;  4DNT B;  1YNN D;  3TP8 A;  1KTK A;  1RD9 D;  1I4Q A;  1AZQ A;  1TT2 A;  3E5S A;  2XSC A;  1HQM C;  1ILP A;  4RGN A;  3QOL A;  2JXM B;  5E4X A;  3M4O B;  4XQN A;  2EYF A;  1EEI D;  4A3J B;  5JEA J;  2SEB D;  2EYH A;  1CQF A;  1G8Z D;  3AU7 A;  4CGY B;  2Z8L A;  2E76 C;  4UDU C;  4A3D B;  3BVM A;  4A3M B;  2L9H A;  3SK8 A;  4DAV A;  2SOB A;  1PRT F;  3EVQ A;  1NR4 A;  2ICE C;  2IW3 A;  1SSO A;  4XT3 B;  3ITP A;  2K6A A;  1PTO H;  2J4X A;  5G3L D;  2ZT9 C;  3IFT A;  2R61 A;  1ENC A;  3BDO A;  5CBA E;  3R2I A;  2H4O A;  2F0T A;  1B1Z A;  1GOZ A;  5C6A A;  1I50 B;  3QJY A;  4TKO B;  4KD4 A;  1Z47 A;  4OIJ A;  4OGQ C;  3VYR A;  2QEJ C;  1ET6 A;  1CHP D;  1Y8O B;  2C9O A;  4UAI A;  3NPP A;  5KIX A;  1SBB B;  3RUZ A;  1EL0 A;  4B9X A;  3HOU B;  1HXY D;  1EY9 A;  4QMG A;  2EZV A;  3DUZ A;  2NWG A;  5AFW A;  5E4W C;  1CI3 M;  1CZG A;  4WFN 3;  1EU4 A;  2Q8I B;  4YIJ A;  3VA7 A;  1DON A;  3M7N A;  1ICW A;  1U4L A;  4KHZ A;  2K32 A;  2MHV A;  1EY5 A;  1B3A A;  2PZT A;  2EOT A;  4IN3 A;  4QB4 A;  3H0G B;  1YNJ D;  3HP3 A;  5CBE E;  5DM7 3;  1V1P B;  5COR A;  1S5F D;  5C3E B;  1FYC A;  2B2W A;  2DNE A;  1TS5 A;  5D65 A;  3MXG A;  3CHB D;  3C1F A;  4DNR B;  1CK1 A;  4PV1 C;  3I4M B;  3URY A;  1EYD A;  5EBD A;  3MEH A;  1I6H B;  2NVX B;  1CZW A;  5C0X J;  2B2U C;  4ZUJ A;  1XX8 A;  2XNA C;  5G3L F;  1TQO A;  2A6H D;  3BVG A;  3GP7 A;  2HCC A;  3I4N B;  1JOK A;  2VNU D;  4QUC A;  3KLS X;  1O7Z A;  1QIL A;  1QE6 A;  4IUU A;  4RCO A;  4NW2 A;  1TY2 A;  1SYE A;  2IL8 A;  2N55 A;  4IQZ A;  2RVL A;  3N52 A;  1LLR D;  2K5Q A;  3OWE B;  4J6H A;  3SK4 A;  3KLR A;  2BCO A;  3I8Z A;  1LAC A;  3GTJ B;  5IGE A;  2IJ0 A;  1MBY A;  2ZXP A;  2AWN A;  4TQU S;  1GHJ A;  1H9M A;  1MSH A;  2OT2 A;  4DU9 A;  2NVQ B;  1WTV A;  4AYB B;  1II3 A;  3U9S A;  5T1I A;  1RCV D;  3P75 A;  2XWB B;  4KJO A;  5K36 H;  1D1K A;  1LTG D;  3MXU A;  2ENB A;  3J7A V;  2D5D A;  1Y1V B;  2XWJ B;  1STE A;  3HRZ C;  1EY0 A;  1SAP A;  1PZJ D;  3NBI A;  2F0S A;  1Y8N B;  2QF7 A;  3HG9 A;  1TWH B;  3IKJ A;  3OIP A;  1WTP A;  2KQ3 A;  2FMM A;  3RZO B;  1AP0 A;  3X3N A;  5M5W B;  1TU2 B;  2NZ1 D;  3TDQ A;  1LT3 D;  2D2C C;  5CMD A;  1DOL A;  3K0Y A;  3BYT B;  4Q0F A;  5FO7 B;  3PV0 A;  4V0B A;  1ZYR D;  3MWY W;  4A93 B;  3C1E A;  1IKM A;  4B08 A;  2SDF A;  4KY7 A;  5CV6 A;  1PRT C;  2XRQ D;  4K5V A;  3F2U A;  1MD2 D;  1ESR A;  2F3V A;  4HMJ A;  3SEB A;  2KJX A;  3RLF A;  2AWO A;  1NR2 A;  3OMG A;  4RKB A;  2IWH A;  2OF1 A;  3D3R A;  4ODG A;  4J1M A;  2PMZ B;  1BCP C;  3D4W A;  3D6C A;  3IAY A;  3NSW A;  2JE6 I;  2BE5 D;  4FF3 A;  1PXU A;  4C2M B;  3OOC A;  3NWT A;  1HPC A;  4H44 C;  3GTK B;  1IKL A;  1DZ1 A;  4WJW A;  5C44 B;  2K5D A;  4IUQ A;  4G7Z C;  5IGG A;  3FRP B;  2O5J C;  1S5B D;  1SDF A;  3P1H A;  2ID0 A;  1IL8 A;  1YNN C;  2KEE A;  2D9U A;  3PUW A;  3E6Z X;  1F9P A;  1B4O A;  5LL6 S;  3OMC A;  1V43 A;  3NBH A;  4NDX A;  1U9R A;  3J80 L;  1Y69 U;  1FD7 D;  5LHY 1;  4XQQ A;  1KNA A;  2X6L A;  2MP1 A;  4R9W A;  1ENF A;  2Z4I A;  5EPJ A;  1TWG B;  5CV4 A;  3OWF A;  5C3X A;  1OO9 B;  4DAP A;  1LTT D;  4C3H B;  1HTP A;  5D14 A;  2RBM A;  5C4H A;  5I6W A;  1HUN A;  1BOS A;  3PMF A;  3GV6 A;  1DCZ A;  4L8J A;  5J1Z A;  5ELF A;  1M4V A;  2K5W A;  5JPM C;  2MPM A;  4U67 3;  4RGT A;  1H9S B;  4BA2 I;  3G7L A;  1BCP B;  2EJM A;  4IUR A;  1F9R A;  1JOQ A;  1TWC B;  2LKV A;  3MAQ A;  2A5H A;  4FVM A;  4KKS A;  2K7V A;  3H3V C;  2KCN A;  1HRJ A;  2LY7 A;  4PMC A;  2XVS A;  3OPO A;  2M00 A;  5T1G A;  4RGM A;  1MI2 A;  1Q1E A;  3WOF A;  4H7B A;  2Z4H A;  3FPU B;  3S1M B;  4R8I A;  3V05 A;  3X3M A;  5JJZ A;  2IT1 A;  1EIG A;  1JOR A;  1PFN A;  3FEW X;  4TSS A;  1HFN A;  2R6G A;  4O1N A;  4C1N I;  3S16 B;  4CKC A;  5IT9 E;  1WTX A;  1E2Z A;  1ENA A;  4K2K A;  3T56 B;  4RA8 A;  3M4Y A;  3TME A;  1YNJ C;  3I3C A;  1G2T A;  2ICI A;  4ILW A;  4KK7 A;  2MGS A;  4XIG S;  3DXJ C;  3TZU A;  1F2Y A;  1RTN A;  3I70 A;  3I90 A;  5EBC A;  4C3I B;  2J7Z A;  3DHQ A;  2K04 A;  1EFI D;  3FKI B;  4EQP A;  5LL6 X;  1T5E A;  4L63 B;  4Y7N B;  1G91 A;  2IX0 A;  5CV8 A;  1VMC A;  2A6H C;  5JVH 3;  2B2W C;  1JWS D;  2OEO A;  2F0D A;  2L12 A;  3S1R B;  3CRL C;  5DNF A;  2K03 A;  4G4K A;  4IAL A;  1IHZ A;  1TVX A;  4DXF A;  4A3B B;  3SXH A;  1K8O A;  2A6E C;  2FFK B;  3PO3 B;  2RA4 A;  4FP5 D;  2AQ2 B;  4GZY C;  3HKZ B;  4HAE A;  4DK0 A;  4LJZ C;  2SNS A;  5JVG 3;  2WKC A;  5CV7 A;  3K6O A;  2EXZ A;  2O2L D;  4K8I A;  4S3S A;  5ELB A;  5TSS A;  2Y0S B;  2F0F A;  4CJ0 B;  2KOL A;  3LNN A;  4A3I B;  4HSP A;  2F0L A;  1T5X D;  3HGB A;  3C3L A;  2EY2 A;  3PIO 3;  1Q12 A;  3NHH A;  4RWS C;  3T51 B;  5IGB A;  3D8G A;  5FKA C;  3LX0 A;  1X32 A;  4J8Q A;  4LK1 C;  1F9Q A;  4ZK9 B;  2F0M A;  3K5O A;  4JK1 C;  2EYP A;  4KHV A;  3T16 A;  3VR6 A;  3IFD A;  1VCI A;  2Z1C A;  3Q6S A;  1DOK A;  4QIW B;  4BY1 B;  1BF4 A;  1AZP A;  2B2Y A;  1SYD A;  2XRS D;  4KKU A;  4WRD A;  4HR7 B;  1H9K A;  1CT1 D;  2C5C A;  1ZKO A;  3EJI A;  1IYV A;  1X3Q A;  4ULL A;  5IGC A;  1F2M A;  1XYI A;  1TR5 A;  2AUK A;  2RDH A;  4X3U A;  3S2H B;  5IOC A;  2VB2 X;  2E2H B;  3MFY A;  1UAP A;  3W2D A;  3N6R A;  4RFB A;  3WOE A;  1OXS C;  2PO4 A;  1C4Q A;  1I6V C;  1LO5 D;  3A7A B;  2NB0 A;  3FDT A;  5C5L A;  2M2L A;  4KN7 C;  1V8Q A;  4MHE A;  1I4P A;  2RKS A;  2RDF A;  1DJR D;  2F3W A;  5HGT A;  1D6E C;  2F0U A;  3KBX A;  1NCV A;  1SNP A;  5HUR A;  4DN4 M;  4JBW A;  1X3P A;  3O13 A;  2EY6 A;  5ELD A;  4KMU C;  4LAA A;  1SNC A;  1L0Y B;  1PTO C;  1LTI D;  4PMW A;  4KY6 A;  4F7X A;  1R4P B;  1PZK D;  3GTL B;  3T53 B;  3VR4 A;  4ZUI A;  3GTP B;  4CHT B;  2CHB D;  1ILQ A;  4DAY A;  2NBF A;  4CJ2 C;  1Y8P B;  1A2T A;  5FLX E;  3L3O C;  2SNM A;  1ESF A;  4PNY A;  4QCL A;  2NUC A;  1Q1B A;  3H91 A;  3NK9 A;  2DNC A;  3BVZ A;  4I65 A;  1OXT A;  2EYM A;  2XIW A;  1JOO A;  4IUN A;  1TY0 A;  1S5D D;  4XTC S;  1LAB A;  1W6K A;  5FK9 C;  1KNE A;  2HUG A;  2RSO A;  2JEA I;  1GHK A;  3VYS A;  4DFA A;  2QDB A;  1I4X A;  1EQT A;  4K6L A;  1S5E D;  2CW0 D;  1VF7 A;  1RTO A;  4IFD G;  2HDL A;  1GJX A;  2A68 C;  2GA4 B;  5EPK A;  2KEC A;  4RHR A;  1TII D;  4A3G B;  2RQX A;  3K5L A;  2F0J A;  3VR3 A;  1F77 A;  1JC7 A;  3FMC A;  4DGZ A;  3MXP A;  2TSS A;  1EU3 A;  1NUC A;  1HCZ A;  2F0Q A;  2QKI C;  1RF2 D;  4XXE A;  1PTO B;  3V2T A;  2V4D A;  1STG A;  4RAU C;  2WAQ B;  1A6X A;  3KF8 A;  2F0O A;  1V1P A;  3A8I E;  3K5N A;  1STY A;  4HSV A;  1CA5 A;  2E2J B;  1Q3L A;  1O78 A;  1F9S A;  1STA A;  1KLG D;  5JAV A;  2WIN B;  1FR3 A;  2B2T A;  1PFB A;  5D3I B;  3OW7 A;  5C3W A;  3HOW B;  2ZXR A;  2JA8 B;  1ET9 A;  3MZ5 A;  3A7L A;  1U4M A;  1TWA B;  4DA2 A;  4K14 A;  5D3D A;  1DYQ A;  3GV3 A;  1STB A;  3SK6 A;  3S1N B;  3I73 A;  4A3E B;  5EPL A;  4ME5 A;  2K01 A;  3SHL A;  3RZD B;  4HN7 A;  4QUF A;  3ZYY X;  4KY5 A;  1PLF A;  5JEA G;  5CV5 A;  2I07 B;  1QWY A;  5KYI A;  3NTK A;  2VXW A;  2F0W A;  1BO0 A;  1A3V A;  1WD1 A;  5I9P A;  4KN4 C;  4G7O C;  3PO2 B;  5F2D A;  2A69 D;  4KTA A;  1BNZ A;  1F2Z A;  2OXP A;  1CHQ D;  4XQJ A;  1LTR D;  2WP8 J;  1G6Z A;  1WCM B;  2LFN A;  1SMY D;  2E2I B;  2F0G A;  1I4R A;  3I72 A;  4KV6 A;  5NUC A;  1LT5 D;  2PPB C;  2JEB I;  1H9R A;  4OIK A;  2F1M A;  4EVO A;  4ZLT F;  1GUO A;  4CKB A;  2YYZ A;  2HDM A;  3DMU A;  3BG3 A;  3ND9 A;  1AFP A;  1JCK B;  3H09 A;  3M7G A;  1UUP A;  2ZXO A;  2R92 B;  4IUT A;  4ID6 A;  2N88 A;  5CGK A;  1C8C A;  2PW7 A;  4IFD I;  3VYT A;  3HOZ B;  3L7Z C;  3D4R A;  4XT1 B;  4KJN A;  2TMP A;  2HCI A;  4RGO S;  1DXM A;  2B2V A;  1DOM A;  2K1B A;  4N9T A;  1QNU A;  2F0H A;  4OHJ A;  5EKI A;  5I6Y A;  1PRT B;  2L0C A;  1SEB D;  5FO8 B;  3LWU A;  1KDB A;  3RD4 A;  5C4X B;  5KGU A;  3Q22 A;  1SFO B;  5BN4 A;  4C3J B;  2F0V A;  2AUJ D;  1PMR A;  1A3U A;  5M5Y B;  4C56 C;  4LMQ D;  4DF7 A;  3DWQ A;  1GUT A;  1Z6H A;  4NMZ A;  1QOH A;  1RJT A;  4IUP A;  5DEH A;  1OXU A;  2G9D A;  3T4A C;  3A56 A;  2DY7 A;  3A8K E;  5C0X G;  4RCN A;  2WKD A;  1IW7 D;  1HA5 A;  1VF5 C;  3NXW A;  4HCE A;  1Z7T A;  5EKL A;  5CR3 A;  1SYG A;  5I2X A;  5FOB B;  3P7J A;  1SNO A;  4H0L C;  3J81 E;  4A3K B;  2L5T A;  5A2Q E;  4K8J A;  1XTC D;  2K28 A;  4M1U B;  3NUC A;  1GUN A;  3JAM L;  5I2Y A;  3CKI B;  1Q90 A;  5E1F A;  1UNS A;  4EQN A;  3TP6 A;  3CRK C;  3PIP 3;  1KDA A;  3KK7 A;  2WV6 D;  1I4G A;  2NVT B;  1HHV A;  2BA0 A;  2EYJ A;  3W3A A;  4BWG B;  5JPN C;  3MA2 B;  1CFM A;  4EQO A;  1NAP A;  3AB9 A;  3BDC A;  3K57 A;  3FVQ A;  5BN5 A;  4Z9C B;  3SR1 A;  1CTM A;  1D5X C;  3WDN A;  1EOT A;  2NTS A;  2EYO A;  2KHS A;  3R3O A;  5IT9 L;  1B9N A;  3ERO A;  4CBV A;  1MSG A;  3MXN A;  3TN2 A;  1BBX C;  2KED A;  2IPK D;  1KAA A;  1LTS D;  1STH A;  4V19 0;  5JOB A;  1D1I A;  1BCP D;  1STN A;  3NQI A;  3HOX B;  4TRD A;  4M8A A;  5KEE A;  2KUM A;  1V1O A;  1KLU D;  3GTG B;  1LTA D;  1BQQ T;  5M3M B;  2J0T D;  4PQX A;  1OXV A;  2H1E A;  4RH6 A;  1HTL D;  2VUM B;  1EY8 A;  1HQR D;  2L11 A;  2NYZ D;  1R9T B;  3S1Q B;  1CM9 A;  2PZW A;  4DK1 A;  1TS3 A;  2BDO A;  4E6I A;  2KVM A;  1PDQ A;  3K58 A;  5CYU A;  5I4D A;  4KKT A;  4BA1 I;  2FMC A;  3PUX A;  1U4P A;  4RKL A;  5FO9 B;  1S5C D;  3NP8 A;  5J22 A;  2KCC A;  2HQE A;  3A54 A;  3OSO A;  2X69 A;  5ELC A;  1ZYR C;  3TP5 A;  4CJ1 B;  3ONA B;  1WD0 A;  2RDG A;  2RSN A;  2B2T C;  2EYL A;  5C0X I;  1JE4 A;  5A35 A;  4EGV A;  4G7H C;  4ZRZ A;  2LMC B;  1SJE D;  3U9O A;  3RMH A;  2F0E A;  4K2L A;  3R8B A;  2F0I A;  1XXG A;  2BE5 C;  1EEF D;  2JYO A;  3P20 A;  3IL8 A;  5M9O A;  3AMU A;  1BCP F;  3ND8 A;  1B44 D;  1LT4 D;  1O7L A;  3BS1 A;  2A69 C;  4FXD A;  3K7A B;  1G29 1;  4FO2 A;  3ERQ A;  1I3Q B;  5M3F B;  1DM0 B;  1Q8I A;  1JWM D;  3DEP A;  1ZXT A;  2XN9 C;  4A3F B;  4OO1 I;  3H94 A;  1EYA A;  1UEA B;  3MHB A;  4ZYS A;  2JA7 B;  2O5I C;  3GO5 A;  4X3K A;  1EIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...