1SAPA

Hyperthermophile protein, relaxation matrix refinement structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords SAC7D
publication title Solution structure of the DNA-binding protein Sac7d from the hyperthermophile Sulfolobus acidocaldarius.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1995-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sapA00
1WD0A 1DOLA 1EIGA 3I3CA 1WVLA 3N52A 1TVXA 1F2LA 1B3AA 1QNKA 1HUMA 3P7JA 5T1IA 5EPJA 3KBXA 1PFNA 2B2WC 3D6WA 2B2UC 4NW2A 4OIJA 5EPKA 1NAPA 2B2YA 5CBAE 1RODA 1PLFA 1J9OA 1ILQA 5EPLA 2NWGA 1XX8A 2MPMA 1NCVA 1SAPA 1KNEA 2HCIA 2NZ1D 2R3ZA 1ESRA 4ZLTF 2EPBA 5E4XA 3H91A 2H1EA 4CJ2C 2MP1A 1HUNA 2FFKB 1NR2A 1QG7A 2HDLA 1A15A 1BBXC 1EL0A 2KOLA 1CM9A 3KUPA 1U4LA 1F9RA 4IUUA 1EOTA 3I8ZA 1EQTA 1B53A 1F9SA 1U4PA 1BNZA 1X3QA 1EIHA 2N55A 1U4MA 4IUPA 1DONA 1G2TA 1WTQA 1O7YA 2K05A 1O7ZA 2HDMA 1S4ZA 1E0BA 3IL8A 5COYA 1WTVA 3FPUB 2Q8RE 2J7ZA 4QUFA 3DEOA 1PFMA 1F9PA 2FHTA 2FMMA 1VMCA 1RTOA 4RA8A 1IKLA 5DNFA 3TN2A 2JYOA 2B2VA 2B2TC 1CA6A 1B2TA 1RHPA 4X3TA 1HFGA 2X6LA 2FINB 4ZK9B 5EQ0A 1SSOA 4MHEA 1VMPA 1MSHA 2L11A 3Q6SA 2L9HA 2B2WA 3GV3A 2D9UA 2B2UA 2EOTA 4XDXA 2HUGA 3HP3A 1BO0A 1JE4A 3R93A 4ZKCB 1WTOA 3MWYW 3F2UA 2DY8A 1QE6A 2RSNA 2Q8TA 5D65A 2IL8A 1HHVA 1G91A 1G6ZA 2SDFA 4R8IA 2KVMA 2M2LA 1GUWA 1IKMA 1O80A 4X3SA 1G2SA 1CA5A 1SDFA 1MI2A 2K01A 4HAEA 1DOKA 1Q3LA 1HFNA 4X3UA 1NR4A 4CJ1B 1ML0D 1KNAA 2K03A 3DM1A 1WTPA 2DY7A 1B50A 1C8CA 4RWSC 1AZPA 1LV9A 2FJ2A 5E4WC 1MGSA 4CJ0B 3G7LA 2VXWA 2L1BA 2RSOA 4HEDA 1RJTA 2RVLA 3MTSA 2K1BA 4IUQA 4UAIA 1WTWA 4R9WA 4ZAIA 1J8IA 2L4NA 5D14A 4XT1B 2XIWA 1ZXTA 2CVRA 1DZ1A 1ICWA 1M8AA 4IURA 1HA6A 4OIKA 4DN4M 3QO2A 1B4OA 1PFBA 2B2VC 5CBEE 5CORA 2X69A 2BDNA 1X3PA 5EJWA 2B2YC 4IUTA 4HSVA 5T1GA 1X32A 3UI2A 1AP0A 2X6GA 4QUCA 2K28A 4X3KA 1WTRA 5JJZA 3I91A 2NYZD 3LWEA 2MJ8A 1WTXA 3I90A 2L12A 1XYIA 3SVMA 4XT3B 2EE1A 1MSGA 2HCCA 2KEDA 4LMQD 5EKIA 2KECA 1BF4A 2RA4A 1ILPA 1HRJA 4O42A 2K04A 3DEPA 2KUMA 2N88A 3GV6A 3IFDA 4MN3A 1WD1A 2MGSA 4HCSA 4RAUC 3ONAB 1F9QA 1AZQA 2B2TA 1DOMA 1RTNA 2KEEA 3FDTA 2JP1A 4ZKBB 5CMDA 4U68A 1JICA 1U4RA 1PDQA 5AFWA 3TZDA 1IL8A 4IUVA
chains in the Genus database with same CATH superfamily
3K0XA 1EWIA 4CHTB 3U9SA 4A93H 3CAMA 4FXDA 3E9HA 1EY6A 3S1MB 4GOPA 2MNAA 1NAPA 3CC2A 1O7LA 4A3BH 3S2HH 5K36H 2E2IB 3CQZH 4XIGS 4QL5A 1FNWA 1F2MA 5E4XA 4C1NK 3VR6A 2JA8B 2F0PA 3CCRA 1AN8A 2C9OA 3F2DA 2HDLA 1PVOA 2AHOB 2EY6A 5HGTA 3CCLA 1U4PA 2F4IA 2F0JA 3BZDB 3PUVA 2UUCQ 2YTXA 2UU9L 1JCKB 3T1YL 1WTVA 2KBNA 1XPOA 2VQFQ 5CGKA 4QIWE 3RR5A 4EGVA 2FHTA 2JQOA 3MZ5A 3FHWA 1CZGA 3Q0AA 1ASZA 1EQRA 1B2TA 4DU9A 5JOBA 1C7YA 3HOZB 4OX9L 3GV3A 4GNXA 3HP3A 1JE4A 3ULLA 1HA5A 2PNRC 2LY7A 1G291 2Y0SB 5I2YA 4NDXA 5IGBA 2Z0SA 5EBCA 4DK6C 5C5MA 1LT6D 2QW7A 1NSNS 4RKBA 1L1OB 4CBVA 2HQEA 3DM1A 1Q8KA 1XWEA 3KF8A 1KD1C 1JORA 5C44B 1OTCA 1HR0L 3PO2H 1WTWA 4AYBE 1Y8PB 1ZXTA 2PZTA 2K32A 3BZCA 3ULPA 4BXXG 2RCFA 1PRTF 2KHJA 1AP0A 2VQEL 3D3RA 3CPFA 3KK7A 1CHPD 3CP0A 1VF7A 4IFDG 3JC66 1PH5A 2EZVA 1XYIA 1CKOA 4JI1L 4A3EG 2BA1A 1SR3A 4DV0Q 4MN3A 1V8QA 5C0XG 4P2CB 2IY5B 3CU7A 3KLWA 1DOMA 1K28A 4X66Q 1JICA 1SYCA 3CRLC 5C3EG 2E2HB 1AE3A 1FGBD 1K8MA 3I3CA 1XTCD 2B3GA 2ZJQA 5ELCA 1XNRL 2R6GA 1YIJA 2B2UC 5BN5A 5EPKA 4NXMQ 3PGZA 2I5HA 4JPBW 4OHJA 1NCVA 3OTOL 1DGSA 4CKBA 5JJIA 2CH4W 1E1OA 3OHXC 1YITA 2F0QA 1CKNA 1NMFA 2Q2IA 1XXGA 4KMUC 4G7OC 2J0TD 4IUUA 2A6HD 4KD3A 4HIOA 1GKHA 1SRUA 1SMYD 5C4XB 4A3DG 1QUQA 3M4PA 1EU4A 4QUFA 1VMCA 3EA6A 4QIWB 3PSIA 3S14H 4X65Q 2B8FA 2MO0A 1UNSA 1GUGA 2Z9HA 2IWHA 5C3WA 3S1NB 4FYDA 2O2LD 4N9TA 1BOSA 4XDXA 2WP8J 1Q8IA 1BUVT 3W2DA 4DK0A 4C2MB 3M4OB 4I7AA 1Q86C 3ITPA 3H15A 3VR5A 4PZ8A 1C48A 1MJCA 1SN8A 3Q23A 3I4MH 5JPNC 1LACA 3D31A 1EY9A 3MXNB 4C3HB 1CA5A 4JI0L 3BYYB 1MI2A 2JA5G 1LLRD 1HFNA 1I6HH 4F87A 1KNAA 4P72A 3SK4A 4CDCC 2CKZB 1D5XC 1QVGA 2JN4A 2NB0A 2OF1A 3K5MA 1D1KA 2D0OA 1SLJA 4FXGC 1TWAB 1HZAA 5IP9H 3R2IA 1H95A 1B4OA 1ZEQX 1EUJA 1A6XA 5T1GA 3JAML 4A3CG 3H6MA 1EY5A 3OMCA 3PO3G 2NYZD 4KKTA 1KDAA 4DUYL 3S1MH 1WCMB 3NHHA 3H3VI 4A3GG 3NWSA 4ZRZA 2E2IH 3EFXD 4IOAA 1EY4A 3GV6A 2I5LX 1Q90A 4A4IA 5C4HA 3EBEA 5ELDA 4IQZA 1RTNA 1YNXA 1E24A 1ENAA 4DNTB 1I4HA 3VA5A 2A69D 3QWNA 1I4PA 3I7FA 3KDFB 2F4VQ 4LUOA 3MXUA 4F7XA 3RNUA 2OCEA 1PH7A 1LTTD 2K4KA 2K33A 5KNBA 1EEFD 3DLLA 2UU9Q 5JEAH 1W3SA 3T1YQ 3ER0A 4DV3Q 3HOZH 1AFPA 1H9SB 2WIIB 4IUNA 4EQNA 5LL6S 5IIFA 4YCWA 3W1BA 1LM0A 3H3VC 1IW7C 1BXTA 2FFKB 3PIPA 1HNZL 1EL0A 3C1FA 1E2ZA 1B7YB 1LT4D 3I8ZA 4OX9Q 1YNND 1I4RA 4IUPA 2PQAB 1VQEA 3BVMA 1TWHB 1TS2A 4JVZA 5E7NA 3BVZA 1ESFA 2ASBA 3I4NB 3MXPA 1ONLA 2PO4A 1RTOA 2QDBA 5FLMG 4DV2L 1CA6A 1D2BA 1STAA 2ES2A 2F0NA 1A2UA 1I94L 2L11A 1UE1A 1VQIA 5C44H 2EOTA 4LF9L 1FR3A 1ENFA 3MWYW 3KJOA 1FNUA 2F0HA 1HR0Q 3I70A 3N6RA 3OWFA 4A3FB 4KHPQ 4B3RL 3IAYA 4A3KG 5IGCA 2NVQH 1NR4A 5IWAL 2PNHA 4LF7L 1SE4A 5BN3A 3STBC 4HJ8A 5C3EB 3ERQA 1MGSA 4X64Q 2PI2A 3MFYA 3DWQA 1UUPA 4DR7L 2ALYB 1HNWL 2ICIA 1DYQA 4JV5L 3GTGB 2K1BA 3V05A 4Z9CB 3L2PA 2BH2A 3CXCA 4L6TB 5CBEE 4C3JG 2E2HH 1EEID 2TSSA 5GADC 4LF6L 1QILA 4FF1A 5FO7B 1A62A 2WAQG 2E74C 3FMCA 2MJ8A 2MO1A 1EIFA 3FP9A 1Y1WB 2R93G 1X54A 1QNUA 4APVA 5EKLA 3C46A 3DEPA 1CUKA 1SNCA 3M7NA 4PZ7A 5LMNW 3J81c 4A3DB 2K7VA 3S1RB 1VQ8A 3ONAB 4V190 1M1KC 1I50B 2YTYA 2KEEA 3CCSA 4BBSG 1U4RA 5AFWA 1TS5A 4CKCA 3U50C 4DR3Q 4C3IG 2EYFA 1NBWA 4WRDA 1QOHA 2JSOA 5C4XH 5T1IA 5EPJA 2B2WC 2MQHA 5M3MG 4ODGA 3EVQA 3S1NH 1H9MA 1SAPA 2NZOA 3J7A5 4C2MH 1IBLQ 2JA5B 2A19A 5J1ZA 1EIHA 2A1AA 3PMFA 5DAUA 5M3FG 2UUAL 4DAPA 3Q22A 1E0BA 2F0VA 3DUZA 1MD2D 2AWOA 4RCNA 4YCVA 2EY5A 1BQQT 3J7AF 5L37A 4DFAA 3NPPA 3G48A 4BY1G 2IW3A 3NK9A 2UXBQ 2UXDL 2DY8A 3W1GA 1TWAH 3GTJB 2JE6I 1LO5D 3BG3A 5CV8A 4JI2Q 2YTVA 1T5EA 2SDFA 5IYCH 1SNMA 3MAQA 5KYLA 4HMIA 3GO5A 3ICEA 4KHVA 1PH3A 4HAEA 4B9WA 4X3UA 1W6KA 5IYBG 1WCMH 4DR2L 1XMOL 2DNCA 2EYJA 4RWSC 4K5WA 2UUBQ 4DV5Q 2HIVA 3CHBD 4DUYQ 2Z8LA 3MTSA 4UY8C 5LMUQ 4R4CA 4ZAIA 4DR1Q 4QCLA 3SK6A 4DV4L 4AQYL 3BDLA 2Q8IB 2H4OA 3QOJA 3RMHA 3TSSA 2I0QA 3QO2A 2BDNA 4BBRG 2ZT9C 1JC7A 4PQXA 3A74A 1MHWC 2EYPA 1PTOB 2EY2A 1LT5D 1SNPA 5CC4A 3SVMA 4XT3B 2HCCA 1J5EQ 2RA4A 5GQOA 2DJFC 4WJ4A 1YJWA 1P16A 1GUSA 1SE3A 2L0CA 2HHHQ 1VQOA 4B3TL 3VR3A 3PQIA 5FJ8H 4ZKBB 3K5NA 3ND8A 4DR6L 2BE5D 1PFSA 1VQHA 2EVBA 1IYVA 4TVAB 1Z9FA 4GLVB 1HUMA 3TZUA 1UE5A 4IN3A 1STEA 3I4NH 5M5YH 1UAPA 2B2YA 4HIKA 1K8GA 2RCNA 3VYSA 4CGYB 2B8GA 2EPBA 4I7ZC 1H9SA 4JBMA 1V43A 4A3KB 2MP1A 4CDFC 2LSSA 2F0MA 1LYLA 1PYBA 2F1MA 1X55A 1EOTA 4RGNA 1EQVA 5FLXE 5A35A 2N55A 1U4MA 4A3FH 2O5IC 1K3BC 3I56A 5AJ3L 3HZXA 1TT2A 2EYHA 3DEOA 1PH8A 1TWGH 2K5QA 1SE2A 4CDDC 3F8TA 1B9MA 2NUCA 1TY2A 3WOEA 1X9NA 2JA7G 4GS3A 5IWAQ 1LTBD 2WAQB 3ERSX 2WKCA 2XNAC 2C5CA 3FKIH 3NENA 2QF7A 1EYAA 2LMCB 1HNWQ 1I5FA 5CR3A 1A3UA 2WB1G 2Z6KA 3UDGA 1IKMA 1GO3E 1PYSB 1B1ZA 1SMXA 3HGBA 1TR5A 2XTIA 5CV7A 3K81C 3M7GA 2GVAA 4H0LC 4J15A 4MTKA 4KTAA 3H0GG 3HOUB 1Y1WH 1HH2P 2F3IA 4LF6Q 4BBSB 1NJIC 2G9HD 2M00A 3D4DA 1BCPB 1PRTC 3E3XA 1LTGD 4C3IB 1KABA 3RZDH 3MXGA 3S1RH 3TP8A 1I50H 3AEVA 3VR4A 4NB3A 4KY7A 5GAEC 5CORA 1KRTA 1GHKA 2HIXA 4BA1I 4J8QA 3RUZA 2L12A 1N34Q 1MSGA 1HRJA 5JPMC 2K04A 3F2CA 1Y1VG 3HOWG 2K50A 2KHIA 2R7ZB 1V1QA 1Y69U 1DJRD 4UP7A 1ZYRD 1E2WA 1PDQA 1SNQA 4IUVA 3ZYYX 3CCUA 3G71A 4JC0A 3A5UA 5M9OA 1VQ4A 2RDGA 4LUZA 1MJEA 2JA9A 4LW1A 1DM0B 2VUMB 2UUAQ 1Z47A 4V0BA 4LFAL 2RHQB 3J81i 2WACA 1NE3A 2VY3A 1DD2A 1CKMA 2NN6I 4IO9A 3OW7A 4IJHA 4X62Q 3BDOA 4ZUJA 1U4LA 1UWVA 2BA0A 2YU9H 1BNZA 1X3QA 3D4WA 4GKKQ 2R92B 2UXDQ 2K5VA 1VQMA 4JI3L 4JCVE 2Q8RE 2OWOA 4RA8A 5IGGA 4OXPA 3WOFA 4QB4A 3TN2A 4B3SQ 3HOVG 1SYEA 3PV0A 4FDBA 1VQNA 3R93A 3J80c 4A76A 1MBYA 3L7ZC 4PNYA 3HOXB 2JA6G 2F0GA 3GTMB 1PZID 3DWPA 1HXYD 1JQYD 4GKJQ 1Y8OB 3VYUA 2VZAA 1Z7TA 3S2DB 4XQQA 3HFZB 1Q7YC 5EAYA 5JVG3 1PTOH 4DNIA 1DOKA 2XRSD 4AYBG 4AQYQ 2EDGA 1TWFH 1P8LA 4LF5L 1PTOD 3T4AC 1SYBA 5IOCA 4A3JG 2CHBD 2PW7A 3URYA 3C3LA 1F77A 3S9WA 2E2JB 1XPRA 4KKSA 2B63G 1J8IA 2L4NA 2F0DA 5IT9c 1SJHD 2VB3X 3SEBA 1LUZA 1M8AA 5HY6A 4A3MG 1JB3A 4GOPC 1TU2B 5JEAJ 5EJWA 4DXGA 4B3TQ 2AMCB 1I4GA 4DV6L 5C3XA 4LFBQ 1VQ9A 4DR6Q 1J6QA 5EKIA 2KECA 5FO9B 3G6JB 1B70B 4KN7C 1N36L 2A74C 5I2XA 2Q2UA 1SFOB 2I5MX 2SEBD 4R4QA 3UDFA 3C2PA 5CMDA 2KCTA 2KA7A 3VDYA 1C8CA 4K5XA 4JG2A 1L2FA 3Q8DA 2JA7B 3NBHB 3KJPA 4O2DA 2YYZA 4GNXC 1DXMA 3OW2A 3NTKA 1JT8A 2XWJB 1TQOA 2PMZE 3KLSX 2HCIA 4ZLTF 1X6OA 4OONA 3NP8A 2H1EA 2KCNA 3J80E 1XNQL 3GTOB 1A15A 3S24A 4NXNL 4A3IG 1UEBA 3EROA 5IODA 3H0GB 5NUCA 3TQYA 1WI5A 4B3MQ 1K3RA 3GDEA 1FJGL 4JI8Q 2EIFA 4JYAQ 1LTAD 3HOUH 4RH6A 1RHPA 2NVXH 4MHEA 4KHZA 3E0EA 1SNOA 4C3IH 3BVGA 4G4KA 3CCMA 1BCPD 1VQBA 2ATWA 3AYHB 5IT9E 2B29A 5IYDH 2QEXA 3E9IA 3PUYA 2ENBA 1YI2A 1O80A 1X3EA 3WWVA 5DM63 1Y1VB 3HOWB 2NVTB 1YEZA 2ZM6L 3J7YW 3GTPB 5I4DA 2K75A 4CJ1B 2IHFA 3R8BA 1ICFB 1VS0A 2BDOA 1HPCA 1XPUA 4OGQC 4CJ0B 2PW5A 4LFCQ 2CWAA 2KJXA 3I2ZA 2R7ZH 4RFBA 3HOYG 2IHEA 1U0LA 2Z4HA 3A54A 1E22A 4HN7A 3Q24A 1W6JA 4DN4M 1STGA 1LTLA 3S15B 3GD7A 4BY7B 1X3PA 2UXCL 1D7QA 3I4LA 3B6YA 2H5XA 4X3KA 1B8AA 2LFNA 4O1NA 1E1TA 1V1PA 4F8MA 2VUMH 1KXLA 1GVPA 2A6ED 2A73B 2RDFA 4HCSA 4L5QA 2NN6G 2F0FA 4FVMA 3AFQA 4WORA 3FEWX 2B2TA 2J4XA 4LFAQ 2RF4A 1S5DD 2QKIC 1TS4A 4KD4A 5HGQA 2E8GA 1WD0A 1KHIA 1LTID 4OWTB 2R92H 4K6DA 3P7JA 1TIID 1PFNA 2G5DA 3TP5A 3KYHC 4UDUC 5ELFA 2OTLA 1R9TB 1XMQL 1CI3M 2LS01 3BS1A 1ILQA 2A6HC 3BJUA 3MA2B 4JI5L 2PMZB 1SMYC 4YY3L 5A2QL 4ABNA 3TP7A 1IYUA 5KNDA 2JA8H 3HOXH 3GTMH 4A3LH 2OXPA 4KN4C 4DV1L 1CM9A 2BCOA 3KUPA 3SHLA 4Y7NB 5IP7G 2ZXPA 5C4ZA 1WTQA 2K05A 2KCMA 3AB9A 5M5WB 4B9XA 1KDBA 5IGDA 3CPWA 2B2TC 3HRZC 1CQVA 1TXYA 3K5LA 3KLRA 3CMAA 4QY7A 5EQ0A 4OO1H 4A93G 4JI4L 3F2BA 3PF5A 4C1NI 1EWCA 4EQOA 4YCUA 1JWMD 2E2JH 3F2UA 5KIXA 4A3BG 4KY5A 3OMGA 5K36G 2F0UA 1G91A 1GHJA 4K8JA 3CKIB 3QR8A 5D3IB 1Q3LA 1E2VA 1JWUD 3L9AX 4OL7A 1K0RA 1Q12A 3RZOB 1X56A 1STHA 5BN4A 1LTRD 4OEMB 1KTKA 3J80i 2L1BA 4HEDA 4QMGA 1PRTB 1SFOH 5GROA 1N36Q 4IALA 2XIWA 1CHQD 1VDZA 1BVSA 4NP5A 1ICWA 1B9NA 1PH2A 1HNXL 2Z6BA 4A3EB 1UE6A 5DEHA 4HJ5A 1EFWA 1CTMA 3CF5A 3J81L 1BR9A 2ZJRA 4YWKA 2CQAA 5JJZA 5CV9A 2PCFB 1WTXA 2K5HA 4IFDJ 2Q2HA 1L1OA 2EE1A 1NUCA 2VQEQ 1CK1A 2A69C 3HEJA 3M9BA 4L63B 4BWGB 5EGTA 5C0XJ 3GTOH 4JI1Q 3KF6B 4JI6L 3L0OA 2E75C 1KLUD 4L5TA 5J3BA 5HURA 3N52A 1TVXA 3PO2G 4RHSA 2YV5A 2M9VA 1JR0D 1LABA 3NBHA 3M4YA 2F3VA 4NW2A 4YHHL 1B3QA 1RF2D 3HKZG 1NTGA 2NWGA 4ALPA 1YNNC 5ELBA 2E5LL 1XNRQ 3A56A 4K6LA 4DA2A 3H09A 4LF4L 3TRZA 2HQLA 3VR2A 1S5ED 1F9SA 3OTOQ 5JVH3 4K0KL 1L1OC 1DONA 3PUZA 3SK8A 5KNCA 1CZWA 4DXFA 1QWYA 1S4ZA 2NVTH 3HOWH 3A5ZB 1PH1A 2KCCA 3ND9A 1PH9A 4X3TA 5BR8L 4PG3A 3GTLB 4ZK9B 3JAME 1KIXA 5CV4A 1VQKA 4B08A 3KBGA 1EYCA 3FPPA 2I07B 2WV6D 1BCPF 3MEHA 3K7UC 3A8KE 3M4OH 5KRUA 1KRSA 4ME5A 2ZXRA 1U5KA 1XTDA 3S15H 2QCPX 3TP6A 4BY7H 1GUWA 4GN4B 1G2SA 1DCZA 1SDFA 5H1SE 1C9OA 4C3HH 3K7AB 4QQBX 3S16B 4K5VA 1OO9B 1GOZA 2ZXOA 1L0YB 5ISRA 3T16A 4JI0Q 2F52A 2BH8A 2RVLA 4QJFA 2WAQE 4HR7B 3MVVA 4R9WA 4JI7L 3PO3B 3AMUA 3ULJA 2CVRA 2Q2TA 1GD7A 1X3FA 5I9PA 5GAHC 1DZ1A 5FLXc 1K83B 1U9RA 3X3MA 3M3YB 4A3GB 1M90C 5FO8B 1QZHA 4HMJA 1OXTA 2VNUD 4QUCA 4DKAC 4OWWB 3P20A 1K9MC 3MXNA 3WDNA 1R9TH 2KEDA 2RKSA 1PH6A 2NTTA 1N33L 4O42A 4DK3C 3I4MG 4IPDA 2N88A 1SBBB 3QIAA 2MGSA 2L5TA 1ET6A 3LWUA 2D0PA 4RGMA 4Y7NH 4L5RC 1BBXC 1EIGA 1YNJD 3K8AA 1B3AA 1QNKA 3MC0B 4J6HA 4DV1Q 4K2KA 5M5WH 1SEBD 3D6WA 5IP9G 4RHRA 4Q5VA 3A55A 5EPLA 1EY8A 3P1HA 1NY4A 2MPMA 4ILWA 3VYRA 2F0TA 1UE7A 3OOCA 1QVFA 1PYWD 3IRBA 1F9RA 2D5DA 1B53A 3HS0C 1CSQA 5C4JB 2EYOA 1HQRD 2HDMA 5EKKA 1HNZQ 1TWHH 1PFMA 3MHBA 1YHAA 3DWAA 3UE1A 2B2VA 3KDFA 1XJVA 2A68D 1HFGA 4KI0A 2X6LA 1HR0W 3NELA 4M8AA 3RZOH 4BXXH 3KFUA 4K14A 3QJYA 1FD7D 4ZKCB 2FMCA 3U4VA 4DV2Q 3TS0A 1HJPA 2IT1A 1QE6A 4IFDH 5JEAG 4G7HC 3KLSA 5D65A 1I94Q 3HOZG 5KGUA 1G6ZA 4A3EH 4R8IA 4H02A 2M2LA 4KKUA 4LF9Q 1STNA 4X3SA 2ZTEA 2PQAA 4XYQA 2Y0SG 5C0XH 1HNXQ 1C0AA 2PYKA 4AIMA 2K6AA 3BZKA 2DY7A 1B50A 4X6AH 2DJGC 4B3RQ 5E4WC 2VXWA 4CKEA 4C3JB 5C3EH 3PO2B 2AUKA 5FK9C 4LF7Q 3V96A 3GTGH 1SROA 4XT1B 4FO2A 1S3OA 1OXVA 3A8JE 4OIKA 2B2VC 3J81j 5C44G 3K58A 2MFIA 2X69A 3GTQB 3UI2A 4DR7Q 2R93B 2B2YC 4IUTA 4JV5Q 4DV0L 1JOKA 1JJ2A 5DM73 3JAMi 2V1CC 2GA4B 1A2TA 4X66L 4TKOB 1YHBA 2BE5C 2KUMA 3AQQA 1CKNB 1VQ6A 4YHHQ 1PV4A 4A3DH 5F2DA 1OXSC 5M3MB 1QUQB 1EU3A 1SE8A 2CW0D 3I72A 3D0FA 1ET9A 1EY7A 5JAVA 5LHY1 1RODA 2PQEA 3RLOA 3VA7A 1LT3D 3DHQA 3H91A 2VS1A 5M3FB 1HUNA 2KHSA 2Z6KC 2KQ3A 5LMNL 2ZTCA 1PHJA 2JA5H 1E7ZA 4IPCA 3C1EA 1G2TA 1JJGA 3IL8A 3RD4A 1WJJA 3IFTA 3J80L 1CSPA 4BY1B 1K0SA 3K7AH 1BDOA 1FNVA 1FVIA 4HJAA 2F03A 5C4XG 5EBDA 1A0IA 4ME3A 3Q6SA 4EQ5A 1I4XA 4JOIA 2D9UA 3W3AA 4DR4L 2QDLA 2IX3A 4A3CH 3SXHA 3NTIA 3PO3H 3D4RA 1I3QB 1RKNA 2A8VA 3A0JA 3GTJH 2QA4A 3GTKB 2DNEA 4TRDA 3R2TA 1K83H 4HIMA 2EQSA 2MHVA 1GUNA 1GJXA 4A3GH 2PPBC 3CC4A 2LKVA 4LWCA 4KY6A 1R4QB 4ZCKA 5IT9L 1G8ZD 2NBFA 1T9HA 1QVCA 2F0IA 3SR1A 4BBRB 2RSOA 2RQXA 4UAIA 1SYDA 2HT1A 3GQBA 1Z6HA 4FXKC 4DR2Q 1XMOQ 1HQMC 1EY0A 3T13A 5KYIA 1HA6A 1JB7A 4KJOA 1S72A 3S17B 4QGUA 4PV1C 4DF7A 3QG1A 4JOIC 1TS3A 1CFMA 4DV4Q 3S1QB 3DMUA 1ILPA 2SNSA 5IYCG 5ELNA 1ZYRC 2K14A 5FKAC 1PH4A 1VQFA 1STYA 2E2DC 1WD1A 3FVQA 3V2TA 1AZQA 1WCMG 4GN5A 1RL2A 2F4VL 3NQIA 5FLMH 4IOCA 5C4JH 4DV3L 4ULLA 1QB5D 3LNNA 1GUTA 3M85A 4OIJA 2I46A 3NQTA 4O0AA 1PLFA 1J9OA 1D6EC 1XX8A 5G3LD 1SXTA 2K5DA 3A8IE 2ICEC 2F3WA 1F2YA 4CJ2C 1JOOA 4BA2I 4KJNA 1QCBD 1E3PA 4A3KH 3W5OA 1QG7A 4K8IA 3CD6A 2KOLA 2XVSA 1WFQA 3J7ZC 1II3A 3FPUB 1AE2A 5FJ8G 2VB2X 1IHZA 3LGJA 2IJ0A 2JYOA 4IJLA 1Q82C 4DV7L 3K80C 2FINB 2KENA 5AJ3Q 1VF5C 4C3JH 4ZYSA 2B2UA 2WB1B 3I4NG 4KHPL 1G51A 1YVCA 1BO0A 2LXJA 3E0JA 4IZ8A 3TEHB 2DGYA 2QILA 1PTOC 2V4DA 4H7BA 2SOBA 2R93H 1BBUA 3GTQH 4WJWA 4X64L 4UHVA 1AW7A 2NVQB 2K01A 2JEAI 4L8JA 3T1HL 3CCJA 4A3FG 1GXDC 1YBYA 3OPOA 2OTJA 2AQ3B 4EX5A 4BBSH 4LNQA 5IY0A 3L3OC 4GN3B 1WTHA 4P73A 3AU7A 1B44D 2EJGC 4Q0FA 2BOSA 2HD3A 1VQGA 5M3MH 4PMWA 4HSVA 4EVOA 1BBWA 1RDPD 2CQOA 1STBA 3X3NA 2K28A 3A7LA 3FKIG 1M4VA 3I91A 4S3SA 1IBKL 3NXWA 3T53B 1L0WA 4ID6A 1PZKD 2AQ1B 1PXUA 1SJED 4J1MA 1ZKOA 4PMCA 2LXKA 4C56C 1S5CD 2OEOA 5M3FH 4DR3L 4KLKA 3G4SA 1F9QA 4YWLA 4RG1A 1Y1WG 4U673 3CCVA 2N78A 4NMZA 3PUWA 5LMNQ 4JW0A 3BU2A 3KBXA 3TMEA 3M4QA 4BY1H 4HTHA 2F0SA 1MIUA 1PZJD 3NE5B 3PIO3 1IBLL 3OIPA 5CBAE 4XYOA 3CCQA 3EQLC 4R8NA 3FRPB 4N8X1 4AH6A 5IE8A 4R4OA 1Q81C 1JMCA 4FF2A 3UDXA 1Q1EA 1I3QH 3GTKH 3H3VH 5IYBH 4DR4Q 4JBJA 2RBMA 2SNMA 3K59A 3HOVB 1O7YA 1IW7D 1CT1D 2IX0A 3MEFA 1BCPC 3OWEB 2UXBL 2JA6B 4ZUIA 4JI2L 1SSOA 5I6YA 1VMPA 4JI3Q 2L9HA 4BBRH 4KV6A 5CV5A 1S40A 2IPKD 4GLAC 1F2ZA 4AYBB 4LK1C 2RSNA 4UP9A 2Q8TA 4HSPA 2F0KA 1HHVA 2KVMA 3S17H 4A3JB 3S2DH 4RMFA 1L0XB 2UUBL 4DV5L 3D8GA 1SYGA 2N49A 2JEBI 1ML0D 5LMUL 4TSSA 2B63B 5E3FA 1WTPA 1IXRA 3S1QH 4DR1L 1LV9A 1VCIA 3HKSA 2TMPA 4A3MB 4KK7A 3NWTA 3AFPA 4RGOS 1RJTA 1VQDA 1A3VA 3EIVA 4LF5Q 3SE0A 3STBD 2OQ0A 3TS2A 3A7AB 1R4PB 1Y8NB 2EJMA 2B39A 5GAGC 1J5EL 2NTSA 4DAVA 1HCZA 3F1ZA 2K52A 1CQFA 2A6EC 5DLQE 1KDCA 3BYTB 2HHHL 4UPAA 2CH4A 4UP8A 4DGZA 1BF4A 2JXMB 3TDQA 1PTOF 3JAMc 1IL2A 1RCVD 4DV6Q 1T5XD 2PZUA 4OELB 4RAUC 3HG9A 3K6OA 1H9KA 3I4OA 4LF8L 3TZDA 4OO1I 1FYCA 4DAYB 2JA7H 3OIQA 1KQSA 2L15A 1QJOA 1EQQA 5M5YB 3CC7A 2EJFC 2AQ2B 1HZCA 1C4QA 4A3IB 3PF4A 3CCEA 1TY0A 3NTHA 2NZ1D 1ESRA 5G3LF 1W2BA 3EJIA 4WJ3M 1VQPA 5LL6X 1TKWB 4DV7Q 1UEAB 2Z4IA 1H9JA 4GZYC 3CRKC 1K8OA 4DR5L 2NVYB 4YIJA 3H0GH 1YHQA 4L5SA 4DAMA 2DN8A 2F0LA 1XNQQ 2CFMA 2XSCA 3E6ZX 1TWGB 1GM5A 4NXNQ 3TBIB 2F0OA 1F9PA 1X3GA 2FMMA 5DNFA 2C35B 4DK1A 4PMBA 3DM3A 1FJGQ 3NSWA 1VQCA 2B2WA 3QOLA 1YZ6A 4G7ZC 2G9DA 3OSOA 3PUXA 1H9RA 3T1HQ 1WTOA 3FKIB 3ZJYC 5M5XB 4HJ7A 1QZGA 2OT2A 2IL8A 3OYYA 4R1JA 1TWCB 4DNRB 5TSSA 1WOCA 1Y1VH 2XN9C 1VQ7A 3SGIA 3E5SA 5C6AA 3DXJC 3GTPH 3HOYB 3G6EA 1G6PA 3RN5A 4OWXB 5FLXL 3RZDB 3U58A 1IBML 2ZM6Q 4RKLA 1IBKQ 4HJ9A 2A5HA 1N32L 1GUOA 4R4IA 3HOUG 1IYJB 1VQLA 2EY1A 1EWHA 2F0EA 4BS9A 1N34L 1EZ8A 1S5FD 1JWSD 5A2QE 2DUDA 2ZTDA 3P75A 1PMRA 5IYDG 1X65A 1HTPA 1AEXA 1SYFA 2JJQA 3I73A 1HZBA 4JK1C 2UXCQ 3IFDA 2XWBB 3K5OA 2F0WA 4P74A 4MTNA 3HKZE 4U68A 3NUCA 1WVLA 3HOVH 1O7IA 2MUYA 3VYTA 2R7ZG 2XRQD 4YWMA 5KEEA 5JJLA 1V1OA 4P75A 2K5NA 4GOPB 3K0YA 1HTLD 4X62L 2JA6H 3T56B 4FP5D 1V9PA 3MFGA 4DUZL 3NEMA 2RDHA 1KNEA 5ELOA 2R3ZA 4GKKL 2D62A 1KLGD 1AH9A 4WFN3 1VQAA 1XMQQ 2YU9B 1K73C 2VUMG 3I55A 1D8LA 1KAWA 1EQTA 5J22A 4JI5Q 4EQPA 1S5BD 5K5PA 4YY3Q 4B3SL 1MKHA 2K5WA 2EXDA 4A3JH 4A93B 2O4XA 4QF4A 5JJKA 5FOBB 1D5ZC 1JE5A 1WYDA 1IKLA 2AWNA 2R7DA 2B63H 4A3BB 3S2HB 2R92G 4G57A 3CQZB 3H94A 2AUJD 1MSHA 4GNXB 4A3MH 4LUVA 4GKJL 3J81E 1Q46A 3R3OA 1PA6A 2UUCL 3NBIA 2OQKA 5CV6A 1K8AC 1JOQA 1OXUA 2VQFL 4GLXA 4JI4Q 4P71A 1KAAA 2R7FA 2JA8G 3HOXG 1I4QA 4A3LG 1D5MC 4N9PA 1TWFB 5IGFA 2CWPA 1VQ5A 3KF8B 4XTCS 2EYMA 2FJ2A 1EYDA 3TREA 4IUQA 3BDCA 3PIP3 3GP7A 5J39A 4LFBL 5D14A 1YJ9A 4OO1G 2JK8A 1PRTD 2ID0A 3SDZA 1X32A 1EOVA 4Y52H 4JBKA 2X6GA 3RN2A 1IZ6A 3LWEA 4LF8Q 4IPHA 1EZ6A 5C5LA 5CYUA 4LMQD 3SK5A 4M1UB 4A3IH 1Y14B 1EYGA 2WINB 1KC8C 1YNJC 1A63A 2E76C 2QEJC 5IGEA 4K2LA 4RGTA 1EFID 2L55A 2NVYH 3HKZB 3U4ZA 1DOLA 4HCEA 2NZHA 3PCOB 1YJNA 1F2LA 2QGQA 5I9OA 3U9OA 4DAYA 4JI6Q 1FGUA 4DR5Q 5E1FA 1N9WA 3EN2A 4ZQ3A 4IFDI 5I6WA 4CDEC 2VL6A 4B3ML 2PZWA 2R61A 2Z1CA 3CW2C 5C0XI 2O5JC 1NR2A 4IPGA 2FXQA 4JBWA 1HZ9A 4JI8L 5M5XH 4MNOA 3KOJA 4F88A 3T51B 3KF6A 4JYAL 2A68C 1ENCA 2P5ZX 1A8VA 2E5LQ 4NXML 3K57A 1TWCH 1O7ZA 2GVBA 4LF4Q 4LJZC 5COYA 3UE0A 2J7ZA 4FF4A 4MZ9A 3LX0A 3RLFA 1D1IA 3HOYH 3RLNA 4K0KQ 4XQNA 2EXZA 2NVXB 1JJCB 4H44C 5ELEA 4E6IA 4TQUS 3O13A 3GTLH 2HUGA 4I65A 3J7AV 2N3SA 1NMGA 2Y0SE 3QB3A 5BR8Q 1IBMQ 1VQJA 3IKJA 4DPGA 4FNFA 1N32Q 2CCZA 4X65L 2N8NA 4NKLA 4LFCL 4N8FA 1O78A 2NN6H 4NPSA 3CMEA 1V1PB 3PIOA 3S14B 2K03A 2PI2E 1AZPA 3S16H 3G7LA 1A3TA 2ZJPA 2WB1E 4FF3A 1Q1BA 4RCOA 1EIYB 1ASYA 2IX1A 2WFWA 1I6VC 2XGTA 4H13C 3D6CA 4MIUA 4IURA 1PFBA 1SNDA 4HIDA 2GN5A 3I4MB 3M3YH 1OXXK 4JI7Q 2AKWB 1WTRA 1LTSD 3UDIA 1I6HB 3I90A 4A75A 1FL0A 4BY7G 4XXEA 2RHSB 2EYLA 5IP7H 1BKBA 4PZ6A 4POGA 2VW9A 1KL9A 4LAAA 4C3HG 1NNXA 5D3DA 2D2CC 2CW0C 1RD9D 4XQJA 4DUZQ 3FDTA 4R4TA 1RIPA 2JP1A 1N8RC 2WKDA 4POFA 1N33Q 1IL8A
chains in the Genus database with same CATH topology
4CHTB 3U9SA 4FXDA 1EY6A 3S1MB 1NAPA 1O7LA 5K36H 2E2IB 4XIGS 1FNWA 1F2MA 5E4XA 4C1NK 3VR6A 2JA8B 2F0PA 1AN8A 2C9OA 2HDLA 2EY6A 5HGTA 1U4PA 2F4IA 2F0JA 3BZDB 3PUVA 1JCKB 1WTVA 5CGKA 4EGVA 2FHTA 3MZ5A 3Q0AA 1CZGA 1B2TA 4DU9A 5JOBA 3HOZB 3GV3A 3HP3A 1JE4A 1HA5A 2PNRC 2LY7A 1G291 2Y0SB 5I2YA 4NDXA 5IGBA 5EBCA 5C5MA 1LT6D 1NSNS 4RKBA 4CBVA 2HQEA 3DM1A 1XWEA 3KF8A 1JORA 5C44B 1WTWA 1Y8PB 1ZXTA 2PZTA 2K32A 1PRTF 1AP0A 3D3RA 3KK7A 1CHPD 1VF7A 4IFDG 2EZVA 1XYIA 2BA1A 4MN3A 1V8QA 5C0XG 4P2CB 3CU7A 1DOMA 1JICA 1SYCA 3CRLC 2E2HB 1FGBD 1K8MA 3I3CA 1XTCD 5ELCA 2R6GA 2B2UC 5BN5A 5EPKA 4OHJA 1NCVA 4CKBA 3OHXC 2F0QA 1XXGA 4KMUC 4G7OC 2J0TD 4IUUA 2A6HD 4KD3A 1SMYD 5C4XB 1EU4A 4QUFA 1VMCA 3EA6A 4QIWB 2B8FA 1UNSA 1GUGA 3S1NB 2IWHA 5C3WA 4FYDA 2O2LD 4N9TA 1BOSA 4XDXA 2WP8J 1Q8IA 1BUVT 4C2MB 3W2DA 4DK0A 3M4OB 3ITPA 3VR5A 1C48A 3Q23A 5JPNC 1LACA 3D31A 1EY9A 4C3HB 1CA5A 3BYYB 1MI2A 1LLRD 1HFNA 4F87A 1KNAA 3SK4A 1D5XC 2NB0A 2OF1A 3K5MA 1D1KA 4FXGC 1TWAB 3R2IA 1B4OA 1ZEQX 1A6XA 5T1GA 3JAML 3H6MA 1EY5A 3OMCA 2NYZD 4KKTA 1KDAA 1WCMB 3NHHA 3NWSA 4ZRZA 3EFXD 1EY4A 3GV6A 1Q90A 5C4HA 5ELDA 4IQZA 1RTNA 1ENAA 4DNTB 1I4HA 3VA5A 2A69D 3QWNA 1I4PA 3MXUA 4F7XA 1LTTD 2K33A 5KNBA 1EEFD 5JEAH 1AFPA 1H9SB 2WIIB 4IUNA 4EQNA 5LL6S 5IIFA 3H3VC 1IW7C 1BXTA 2FFKB 1EL0A 3C1FA 1E2ZA 1LT4D 3I8ZA 1YNND 1I4RA 4IUPA 3BVMA 1TWHB 1TS2A 3BVZA 1ESFA 3I4NB 3MXPA 1ONLA 1RTOA 2PO4A 2QDBA 1CA6A 1D2BA 1STAA 2F0NA 1A2UA 2L11A 2EOTA 1FR3A 1ENFA 3MWYW 1FNUA 2F0HA 3I70A 3N6RA 3OWFA 4A3FB 3IAYA 5IGCA 1NR4A 1SE4A 5BN3A 5C3EB 3ERQA 1MGSA 3MFYA 3DWQA 1UUPA 2ICIA 1DYQA 3GTGB 2K1BA 3V05A 4Z9CB 4L6TB 5CBEE 4C3JG 1EEID 2TSSA 1QILA 4FF1A 5FO7B 2E74C 3FMCA 2MJ8A 1Y1WB 1QNUA 5EKLA 3C46A 3DEPA 1SNCA 3M7NA 4A3DB 2K7VA 3S1RB 3ONAB 4V190 1I50B 2KEEA 1U4RA 5AFWA 1TS5A 4CKCA 4C3IG 2EYFA 4WRDA 1QOHA 2JSOA 5T1IA 5EPJA 2B2WC 4ODGA 3EVQA 1H9MA 1SAPA 2JA5B 5J1ZA 1EIHA 3PMFA 5DAUA 4DAPA 3Q22A 1E0BA 2F0VA 3DUZA 1MD2D 2AWOA 4RCNA 2EY5A 1BQQT 3J7AF 4DFAA 3NPPA 2IW3A 3NK9A 2DY8A 3GTJB 2JE6I 1LO5D 3BG3A 5CV8A 1T5EA 2SDFA 1SNMA 3MAQA 5KYLA 4HMIA 3GO5A 4KHVA 4HAEA 4B9WA 4X3UA 1W6KA 2DNCA 2EYJA 4RWSC 4K5WA 3CHBD 2Z8LA 3MTSA 4ZAIA 4QCLA 3SK6A 3BDLA 2Q8IB 2H4OA 3QOJA 3RMHA 3TSSA 3QO2A 2BDNA 2ZT9C 1JC7A 4PQXA 2EYPA 1PTOB 2EY2A 1LT5D 1SNPA 5CC4A 3SVMA 4XT3B 2HCCA 2RA4A 1GUSA 1SE3A 2L0CA 3VR3A 4ZKBB 3K5NA 3ND8A 2BE5D 2EVBA 1IYVA 1HUMA 3TZUA 4IN3A 1STEA 1UAPA 2B2YA 3VYSA 4CGYB 2B8GA 2EPBA 4I7ZC 1H9SA 1V43A 4A3KB 2MP1A 2F0MA 2F1MA 4RGNA 1EOTA 1EQVA 5FLXE 5A35A 2N55A 1U4MA 2O5IC 3HZXA 1TT2A 2EYHA 3DEOA 2K5QA 1SE2A 1B9MA 2NUCA 1TY2A 3WOEA 1LTBD 2WAQB 2WKCA 2XNAC 2C5CA 2QF7A 1EYAA 2LMCB 5CR3A 1A3UA 1IKMA 1B1ZA 3HGBA 1TR5A 5CV7A 3M7GA 4H0LC 4KTAA 3HOUB 4BBSB 2G9HD 2M00A 3D4DA 1BCPB 1PRTC 1LTGD 4C3IB 1KABA 3MXGA 3TP8A 3VR4A 4KY7A 5CORA 1GHKA 4BA1I 4J8QA 3RUZA 2L12A 1MSGA 1HRJA 5JPMC 2K04A 2R7ZB 1Y69U 1DJRD 1ZYRD 1E2WA 1PDQA 1SNQA 4IUVA 3ZYYX 5M9OA 2RDGA 1DM0B 2VUMB 1Z47A 4V0BA 2WACA 1DD2A 2NN6I 3OW7A 3BDOA 4ZUJA 1U4LA 2BA0A 1BNZA 1X3QA 3D4WA 2R92B 2Q8RE 4RA8A 5IGGA 3WOFA 4QB4A 3TN2A 1SYEA 3PV0A 3R93A 1MBYA 3L7ZC 4PNYA 3HOXB 3GTMB 2F0GA 1PZID 3DWPA 1HXYD 1JQYD 1Y8OB 3VYUA 3S2DB 1Z7TA 4XQQA 5JVG3 1PTOH 1DOKA 2XRSD 2EDGA 1PTOD 3T4AC 1SYBA 5IOCA 2CHBD 2PW7A 3URYA 3C3LA 1F77A 3S9WA 2E2JB 4KKSA 1J8IA 2L4NA 2F0DA 1SJHD 2VB3X 3SEBA 1M8AA 1JB3A 1TU2B 5JEAJ 5EJWA 4DXGA 1I4GA 5C3XA 5EKIA 2KECA 5FO9B 3G6JB 4KN7C 2A74C 5I2XA 1SFOB 2SEBD 3C2PA 5CMDA 2KA7A 1C8CA 4K5XA 2JA7B 2YYZA 1DXMA 3NTKA 2XWJB 1TQOA 3KLSX 2HCIA 4ZLTF 3NP8A 2H1EA 2KCNA 3J80E 3GTOB 1A15A 3EROA 5IODA 3H0GB 5NUCA 1LTAD 4RH6A 1RHPA 4MHEA 4KHZA 1SNOA 3BVGA 4G4KA 1BCPD 5IT9E 3PUYA 2ENBA 1O80A 5DM63 2NVTB 1Y1VB 3HOWB 3J7YW 3GTPB 5I4DA 4CJ1B 3R8BA 2BDOA 1HPCA 4OGQC 4CJ0B 2PW5A 2KJXA 4RFBA 2Z4HA 3A54A 4HN7A 3Q24A 1W6JA 4DN4M 1STGA 3S15B 3GD7A 4BY7B 1X3PA 3I4LA 4X3KA 2LFNA 4O1NA 1V1PA 4F8MA 2A6ED 2A73B 2RDFA 4HCSA 2NN6G 2F0FA 4FVMA 4WORA 3FEWX 2B2TA 2J4XA 1S5DD 2QKIC 1TS4A 4KD4A 1WD0A 1LTID 4K6DA 3P7JA 1TIID 1PFNA 3TP5A 4UDUC 5ELFA 1R9TB 1CI3M 2LS01 3BS1A 1ILQA 2A6HC 3MA2B 2PMZB 1SMYC 5A2QL 4ABNA 3TP7A 1IYUA 5KNDA 2OXPA 4KN4C 1CM9A 2BCOA 3KUPA 3SHLA 4Y7NB 2ZXPA 5C4ZA 1WTQA 2K05A 3AB9A 5M5WB 4B9XA 1KDBA 5IGDA 2B2TC 3HRZC 1CQVA 3K5LA 3KLRA 5EQ0A 4OO1H 4C1NI 1EWCA 4EQOA 1JWMD 3F2UA 5KIXA 4KY5A 3OMGA 5K36G 2F0UA 1G91A 1GHJA 4K8JA 3CKIB 5D3IB 1Q3LA 1E2VA 1JWUD 3L9AX 4OL7A 1Q12A 3RZOB 1STHA 5BN4A 1LTRD 1KTKA 2L1BA 4HEDA 4QMGA 1PRTB 4IALA 2XIWA 4NP5A 1CHQD 1VDZA 1ICWA 1B9NA 4A3EB 5DEHA 1CTMA 3J81L 1BR9A 2CQAA 5JJZA 5CV9A 2PCFB 1WTXA 4IFDJ 2EE1A 1NUCA 1CK1A 2A69C 3HEJA 4L63B 4BWGB 5EGTA 5C0XJ 2E75C 1KLUD 5HURA 3N52A 1TVXA 4RHSA 2M9VA 1JR0D 1LABA 3NBHA 3M4YA 2F3VA 4NW2A 1RF2D 2NWGA 1YNNC 5ELBA 3A56A 4K6LA 4DA2A 3H09A 3VR2A 1S5ED 1F9SA 5JVH3 1DONA 3PUZA 3SK8A 5KNCA 1CZWA 4DXFA 1QWYA 1S4ZA 2KCCA 3ND9A 4X3TA 3GTLB 4ZK9B 3JAME 5CV4A 4B08A 3KBGA 1EYCA 3FPPA 2I07B 2WV6D 1BCPF 3MEHA 3A8KE 5KRUA 4ME5A 2ZXRA 2QCPX 3TP6A 1GUWA 1G2SA 1DCZA 1SDFA 3K7AB 3S16B 4K5VA 1OO9B 1GOZA 2ZXOA 1L0YB 5ISRA 3T16A 2RVLA 4HR7B 3MVVA 4R9WA 3PO3B 3AMUA 2CVRA 1DZ1A 5I9PA 1K83B 1U9RA 3X3MA 3M3YB 4A3GB 5FO8B 4HMJA 1OXTA 2VNUD 4QUCA 3P20A 3MXNA 3WDNA 2KEDA 2RKSA 2NTTA 4O42A 2N88A 1SBBB 3QIAA 2MGSA 2L5TA 1ET6A 3LWUA 4RGMA 1BBXC 1EIGA 1YNJD 1B3AA 1QNKA 3MC0B 4J6HA 4K2KA 1SEBD 3D6WA 4RHRA 4Q5VA 3A55A 5EPLA 1EY8A 3P1HA 4ILWA 2MPMA 3VYRA 2F0TA 3OOCA 1PYWD 1F9RA 2D5DA 1B53A 3HS0C 5C4JB 2EYOA 1HQRD 2HDMA 5EKKA 1PFMA 3MHBA 3DWAA 2B2VA 2A68D 1HFGA 4KI0A 2X6LA 4M8AA 4K14A 3QJYA 1FD7D 4ZKCB 2FMCA 2IT1A 1QE6A 4IFDH 5JEAG 4G7HC 3KLSA 5D65A 5KGUA 1G6ZA 4R8IA 4KKUA 2M2LA 1STNA 4X3SA 4XYQA 5C0XH 2PYKA 2K6AA 2DY7A 1B50A 5E4WC 2VXWA 4CKEA 4C3JB 3PO2B 2AUKA 5FK9C 3V96A 4XT1B 4FO2A 1OXVA 3A8JE 4OIKA 2B2VC 2R93B 3K58A 2X69A 3GTQB 3UI2A 2B2YC 4IUTA 1JOKA 5DM73 2GA4B 1A2TA 4TKOB 2BE5C 2KUMA 5F2DA 1OXSC 5M3MB 1EU3A 2CW0D 3I72A 1ET9A 1EY7A 5JAVA 5LHY1 1RODA 2PQEA 3VA7A 1LT3D 3DHQA 3H91A 5M3FB 1HUNA 2KHSA 2KQ3A 3C1EA 1G2TA 3IL8A 3RD4A 3IFTA 3J80L 4BY1B 1BDOA 1FNVA 2F03A 5EBDA 3Q6SA 1I4XA 2D9UA 3W3AA 2IX3A 3SXHA 3NTIA 3D4RA 1I3QB 1RKNA 3GTKB 2DNEA 4TRDA 3R2TA 2MHVA 1GUNA 1GJXA 2PPBC 2LKVA 4KY6A 1R4QB 5IT9L 1G8ZD 2NBFA 2F0IA 3SR1A 4BBRB 2RSOA 2RQXA 4UAIA 1SYDA 3GQBA 1Z6HA 4FXKC 1HQMC 1EY0A 3T13A 5KYIA 1HA6A 4KJOA 3S17B 4PV1C 4DF7A 3QG1A 1TS3A 1CFMA 3S1QB 3DMUA 1ILPA 2SNSA 1ZYRC 5FKAC 1STYA 2E2DC 1WD1A 3FVQA 3V2TA 1AZQA 3NQIA 4ULLA 1QB5D 3LNNA 1GUTA 3M85A 4OIJA 2I46A 3NQTA 1PLFA 1J9OA 1D6EC 1XX8A 5G3LD 1SXTA 2K5DA 3A8IE 2ICEC 2F3WA 1F2YA 4CJ2C 1JOOA 4BA2I 4KJNA 1QCBD 1QG7A 4K8IA 2KOLA 2XVSA 1II3A 3FPUB 2VB2X 1IHZA 2IJ0A 2JYOA 2FINB 1VF5C 4ZYSA 2B2UA 2WB1B 1BO0A 4IZ8A 3E0JA 2QILA 1PTOC 2V4DA 4H7BA 2SOBA 4WJWA 1AW7A 2NVQB 2K01A 2JEAI 4L8JA 1GXDC 3OPOA 2AQ3B 3L3OC 3AU7A 1B44D 2EJGC 4Q0FA 2BOSA 4PMWA 4HSVA 4EVOA 1RDPD 1STBA 3X3NA 2K28A 3A7LA 1M4VA 3I91A 4S3SA 3NXWA 3T53B 4ID6A 1PZKD 2AQ1B 1PXUA 1SJED 4J1MA 1ZKOA 4PMCA 4C56C 1S5CD 2OEOA 1F9QA 4U673 4NMZA 3PUWA 3KBXA 3TMEA 4HTHA 2F0SA 1PZJD 3NE5B 3PIO3 3OIPA 5CBAE 4XYOA 3EQLC 4R8NA 3FRPB 4FF2A 1Q1EA 2RBMA 2SNMA 3K59A 3HOVB 1O7YA 1IW7D 1CT1D 2IX0A 1BCPC 3OWEB 2JA6B 4ZUIA 1SSOA 5I6YA 1VMPA 2L9HA 4KV6A 5CV5A 2IPKD 1F2ZA 4AYBB 4LK1C 2RSNA 2Q8TA 4HSPA 2F0KA 1HHVA 2KVMA 4A3JB 1L0XB 3D8GA 1SYGA 2JEBI 1ML0D 4TSSA 2B63B 5E3FA 1WTPA 1LV9A 1VCIA 2TMPA 4A3MB 4KK7A 3NWTA 4RGOS 1RJTA 1A3VA 3SE0A 3A7AB 1R4PB 1Y8NB 2EJMA 2B39A 2NTSA 4DAVA 1HCZA 1CQFA 2A6EC 1KDCA 3BYTB 4DGZA 1BF4A 2JXMB 3TDQA 1PTOF 1RCVD 1T5XD 2PZUA 4RAUC 3HG9A 3K6OA 1H9KA 4OO1I 3TZDA 1FYCA 3OIQA 1QJOA 5M5YB 2EJFC 2AQ2B 1C4QA 4A3IB 1TY0A 3NTHA 2NZ1D 1ESRA 5G3LF 3EJIA 5LL6X 1TKWB 1UEAB 2Z4IA 1H9JA 4GZYC 3CRKC 1K8OA 2NVYB 4YIJA 2DN8A 2F0LA 2XSCA 3E6ZX 1TWGB 3TBIB 2F0OA 1F9PA 2FMMA 5DNFA 4DK1A 4PMBA 3NSWA 2B2WA 3QOLA 4G7ZC 2G9DA 3OSOA 3PUXA 1H9RA 1WTOA 3FKIB 5M5XB 2OT2A 2IL8A 1TWCB 4DNRB 5TSSA 2XN9C 3E5SA 5C6AA 3DXJC 3HOYB 5FLXL 3RZDB 4RKLA 2A5HA 1GUOA 2EY1A 1EWHA 2F0EA 4BS9A 1EZ8A 1S5FD 1JWSD 5A2QE 3P75A 1PMRA 1HTPA 1AEXA 1SYFA 3I73A 4JK1C 3IFDA 2XWBB 3K5OA 2F0WA 4U68A 3NUCA 1WVLA 2MUYA 3VYTA 2XRQD 5KEEA 1V1OA 3K0YA 1HTLD 3T56B 4FP5D 3MFGA 2RDHA 1KNEA 2R3ZA 2D62A 1KLGD 4WFN3 2YU9B 1EQTA 5J22A 4EQPA 1S5BD 5K5PA 2K5WA 4A93B 2O4XA 4QF4A 5FOBB 1D5ZC 1IKLA 2AWNA 4A3BB 3S2HB 4G57A 3CQZB 3H94A 2AUJD 1MSHA 3J81E 3R3OA 3NBIA 5CV6A 1JOQA 1OXUA 1KAAA 1I4QA 1D5MC 4N9PA 1TWFB 5IGFA 4XTCS 2EYMA 2FJ2A 1EYDA 4IUQA 3BDCA 3PIP3 3GP7A 5J39A 5D14A 4OO1G 1PRTD 2ID0A 3SDZA 1X32A 2X6GA 3LWEA 1EZ6A 5C5LA 5CYUA 4LMQD 3SK5A 4M1UB 2WINB 1YNJC 2E76C 2QEJC 5IGEA 4K2LA 4RGTA 1EFID 2L55A 3HKZB 1DOLA 4HCEA 1F2LA 5I9OA 3U9OA 4DAYA 5E1FA 4IFDI 4ZQ3A 5I6WA 2PZWA 2R61A 2Z1CA 5C0XI 2O5JC 1NR2A 4JBWA 4F88A 3T51B 2A68C 1ENCA 3K57A 1O7ZA 4LJZC 5COYA 2J7ZA 4FF4A 3LX0A 3RLFA 1D1IA 4XQNA 2EXZA 2NVXB 4H44C 5ELEA 4E6IA 4TQUS 3O13A 2HUGA 4I65A 3J7AV 3QB3A 3IKJA 4FNFA 4NKLA 1O78A 2NN6H 1V1PB 3S14B 2K03A 1AZPA 3G7LA 1A3TA 4FF3A 1Q1BA 4RCOA 2IX1A 4H13C 1I6VC 3D6CA 4MIUA 4IURA 1PFBA 1SNDA 3I4MB 1OXXK 1WTRA 1LTSD 1I6HB 3I90A 4XXEA 2EYLA 4LAAA 4C3HG 5D3DA 2D2CC 2CW0C 1RD9D 4XQJA 3FDTA 2JP1A 2WKDA 1IL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WD0 A;  1DOL A;  1EIG A;  3I3C A;  1WVL A;  3N52 A;  1TVX A;  1F2L A;  1B3A A;  1QNK A;  1HUM A;  3P7J A;  5T1I A;  5EPJ A;  3KBX A;  1PFN A;  2B2W C;  3D6W A;  2B2U C;  4NW2 A;  4OIJ A;  5EPK A;  1NAP A;  2B2Y A;  5CBA E;  1ROD A;  1PLF A;  1J9O A;  1ILQ A;  5EPL A;  2NWG A;  1XX8 A;  2MPM A;  1NCV A;  1SAP A;  1KNE A;  2HCI A;  2NZ1 D;  2R3Z A;  1ESR A;  4ZLT F;  2EPB A;  5E4X A;  3H91 A;  2H1E A;  4CJ2 C;  2MP1 A;  1HUN A;  2FFK B;  1NR2 A;  1QG7 A;  2HDL A;  1A15 A;  1BBX C;  1EL0 A;  2KOL A;  1CM9 A;  3KUP A;  1U4L A;  1F9R A;  4IUU A;  1EOT A;  3I8Z A;  1EQT A;  1B53 A;  1F9S A;  1U4P A;  1BNZ A;  1X3Q A;  1EIH A;  2N55 A;  1U4M A;  4IUP A;  1DON A;  1G2T A;  1WTQ A;  1O7Y A;  2K05 A;  1O7Z A;  2HDM A;  1S4Z A;  1E0B A;  3IL8 A;  5COY A;  1WTV A;  3FPU B;  2Q8R E;  2J7Z A;  4QUF A;  3DEO A;  1PFM A;  1F9P A;  2FHT A;  2FMM A;  1VMC A;  1RTO A;  4RA8 A;  1IKL A;  5DNF A;  3TN2 A;  2JYO A;  2B2V A;  2B2T C;  1CA6 A;  1B2T A;  1RHP A;  4X3T A;  1HFG A;  2X6L A;  2FIN B;  4ZK9 B;  5EQ0 A;  1SSO A;  4MHE A;  1VMP A;  1MSH A;  2L11 A;  3Q6S A;  2L9H A;  2B2W A;  3GV3 A;  2D9U A;  2B2U A;  2EOT A;  4XDX A;  2HUG A;  3HP3 A;  1BO0 A;  1JE4 A;  3R93 A;  4ZKC B;  1WTO A;  3MWY W;  3F2U A;  2DY8 A;  1QE6 A;  2RSN A;  2Q8T A;  5D65 A;  2IL8 A;  1HHV A;  1G91 A;  1G6Z A;  2SDF A;  4R8I A;  2KVM A;  2M2L A;  1GUW A;  1IKM A;  1O80 A;  4X3S A;  1G2S A;  1CA5 A;  1SDF A;  1MI2 A;  2K01 A;  4HAE A;  1DOK A;  1Q3L A;  1HFN A;  4X3U A;  1NR4 A;  4CJ1 B;  1ML0 D;  1KNA A;  2K03 A;  3DM1 A;  1WTP A;  2DY7 A;  1B50 A;  1C8C A;  4RWS C;  1AZP A;  1LV9 A;  2FJ2 A;  5E4W C;  1MGS A;  4CJ0 B;  3G7L A;  2VXW A;  2L1B A;  2RSO A;  4HED A;  1RJT A;  2RVL A;  3MTS A;  2K1B A;  4IUQ A;  4UAI A;  1WTW A;  4R9W A;  4ZAI A;  1J8I A;  2L4N A;  5D14 A;  4XT1 B;  2XIW A;  1ZXT A;  2CVR A;  1DZ1 A;  1ICW A;  1M8A A;  4IUR A;  1HA6 A;  4OIK A;  4DN4 M;  3QO2 A;  1B4O A;  1PFB A;  2B2V C;  5CBE E;  5COR A;  2X69 A;  2BDN A;  1X3P A;  5EJW A;  2B2Y C;  4IUT A;  4HSV A;  5T1G A;  1X32 A;  3UI2 A;  1AP0 A;  2X6G A;  4QUC A;  2K28 A;  4X3K A;  1WTR A;  5JJZ A;  3I91 A;  2NYZ D;  3LWE A;  2MJ8 A;  1WTX A;  3I90 A;  2L12 A;  1XYI A;  3SVM A;  4XT3 B;  2EE1 A;  1MSG A;  2HCC A;  2KED A;  4LMQ D;  5EKI A;  2KEC A;  1BF4 A;  2RA4 A;  1ILP A;  1HRJ A;  4O42 A;  2K04 A;  3DEP A;  2KUM A;  2N88 A;  3GV6 A;  3IFD A;  4MN3 A;  1WD1 A;  2MGS A;  4HCS A;  4RAU C;  3ONA B;  1F9Q A;  1AZQ A;  2B2T A;  1DOM A;  1RTN A;  2KEE A;  3FDT A;  2JP1 A;  4ZKB B;  5CMD A;  4U68 A;  1JIC A;  1U4R A;  1PDQ A;  5AFW A;  3TZD A;  1IL8 A;  4IUV A; 
#chains in the Genus database with same CATH topology
 3K0X A;  1EWI A;  4CHT B;  3U9S A;  4A93 H;  3CAM A;  4FXD A;  3E9H A;  1EY6 A;  3S1M B;  4GOP A;  2MNA A;  1NAP A;  3CC2 A;  1O7L A;  4A3B H;  3S2H H;  5K36 H;  2E2I B;  3CQZ H;  4XIG S;  4QL5 A;  1FNW A;  1F2M A;  5E4X A;  4C1N K;  3VR6 A;  2JA8 B;  2F0P A;  3CCR A;  1AN8 A;  2C9O A;  3F2D A;  2HDL A;  1PVO A;  2AHO B;  2EY6 A;  5HGT A;  3CCL A;  1U4P A;  2F4I A;  2F0J A;  3BZD B;  3PUV A;  2UUC Q;  2YTX A;  2UU9 L;  1JCK B;  3T1Y L;  1WTV A;  2KBN A;  1XPO A;  2VQF Q;  5CGK A;  4QIW E;  3RR5 A;  4EGV A;  2FHT A;  2JQO A;  3MZ5 A;  3FHW A;  1CZG A;  3Q0A A;  1ASZ A;  1EQR A;  1B2T A;  4DU9 A;  5JOB A;  1C7Y A;  3HOZ B;  4OX9 L;  3GV3 A;  4GNX A;  3HP3 A;  1JE4 A;  3ULL A;  1HA5 A;  2PNR C;  2LY7 A;  1G29 1;  2Y0S B;  5I2Y A;  4NDX A;  5IGB A;  2Z0S A;  5EBC A;  4DK6 C;  5C5M A;  1LT6 D;  2QW7 A;  1NSN S;  4RKB A;  1L1O B;  4CBV A;  2HQE A;  3DM1 A;  1Q8K A;  1XWE A;  3KF8 A;  1KD1 C;  1JOR A;  5C44 B;  1OTC A;  1HR0 L;  3PO2 H;  1WTW A;  4AYB E;  1Y8P B;  1ZXT A;  2PZT A;  2K32 A;  3BZC A;  3ULP A;  4BXX G;  2RCF A;  1PRT F;  2KHJ A;  1AP0 A;  2VQE L;  3D3R A;  3CPF A;  3KK7 A;  1CHP D;  3CP0 A;  1VF7 A;  4IFD G;  3JC6 6;  1PH5 A;  2EZV A;  1XYI A;  1CKO A;  4JI1 L;  4A3E G;  2BA1 A;  1SR3 A;  4DV0 Q;  4MN3 A;  1V8Q A;  5C0X G;  4P2C B;  2IY5 B;  3CU7 A;  3KLW A;  1DOM A;  1K28 A;  4X66 Q;  1JIC A;  1SYC A;  3CRL C;  5C3E G;  2E2H B;  1AE3 A;  1FGB D;  1K8M A;  3I3C A;  1XTC D;  2B3G A;  2ZJQ A;  5ELC A;  1XNR L;  2R6G A;  1YIJ A;  2B2U C;  5BN5 A;  5EPK A;  4NXM Q;  3PGZ A;  2I5H A;  4JPB W;  4OHJ A;  1NCV A;  3OTO L;  1DGS A;  4CKB A;  5JJI A;  2CH4 W;  1E1O A;  3OHX C;  1YIT A;  2F0Q A;  1CKN A;  1NMF A;  2Q2I A;  1XXG A;  4KMU C;  4G7O C;  2J0T D;  4IUU A;  2A6H D;  4KD3 A;  4HIO A;  1GKH A;  1SRU A;  1SMY D;  5C4X B;  4A3D G;  1QUQ A;  3M4P A;  1EU4 A;  4QUF A;  1VMC A;  3EA6 A;  4QIW B;  3PSI A;  3S14 H;  4X65 Q;  2B8F A;  2MO0 A;  1UNS A;  1GUG A;  2Z9H A;  2IWH A;  5C3W A;  3S1N B;  4FYD A;  2O2L D;  4N9T A;  1BOS A;  4XDX A;  2WP8 J;  1Q8I A;  1BUV T;  3W2D A;  4DK0 A;  4C2M B;  3M4O B;  4I7A A;  1Q86 C;  3ITP A;  3H15 A;  3VR5 A;  4PZ8 A;  1C48 A;  1MJC A;  1SN8 A;  3Q23 A;  3I4M H;  5JPN C;  1LAC A;  3D31 A;  1EY9 A;  3MXN B;  4C3H B;  1CA5 A;  4JI0 L;  3BYY B;  1MI2 A;  2JA5 G;  1LLR D;  1HFN A;  1I6H H;  4F87 A;  1KNA A;  4P72 A;  3SK4 A;  4CDC C;  2CKZ B;  1D5X C;  1QVG A;  2JN4 A;  2NB0 A;  2OF1 A;  3K5M A;  1D1K A;  2D0O A;  1SLJ A;  4FXG C;  1TWA B;  1HZA A;  5IP9 H;  3R2I A;  1H95 A;  1B4O A;  1ZEQ X;  1EUJ A;  1A6X A;  5T1G A;  3JAM L;  4A3C G;  3H6M A;  1EY5 A;  3OMC A;  3PO3 G;  2NYZ D;  4KKT A;  1KDA A;  4DUY L;  3S1M H;  1WCM B;  3NHH A;  3H3V I;  4A3G G;  3NWS A;  4ZRZ A;  2E2I H;  3EFX D;  4IOA A;  1EY4 A;  3GV6 A;  2I5L X;  1Q90 A;  4A4I A;  5C4H A;  3EBE A;  5ELD A;  4IQZ A;  1RTN A;  1YNX A;  1E24 A;  1ENA A;  4DNT B;  1I4H A;  3VA5 A;  2A69 D;  3QWN A;  1I4P A;  3I7F A;  3KDF B;  2F4V Q;  4LUO A;  3MXU A;  4F7X A;  3RNU A;  2OCE A;  1PH7 A;  1LTT D;  2K4K A;  2K33 A;  5KNB A;  1EEF D;  3DLL A;  2UU9 Q;  5JEA H;  1W3S A;  3T1Y Q;  3ER0 A;  4DV3 Q;  3HOZ H;  1AFP A;  1H9S B;  2WII B;  4IUN A;  4EQN A;  5LL6 S;  5IIF A;  4YCW A;  3W1B A;  1LM0 A;  3H3V C;  1IW7 C;  1BXT A;  2FFK B;  3PIP A;  1HNZ L;  1EL0 A;  3C1F A;  1E2Z A;  1B7Y B;  1LT4 D;  3I8Z A;  4OX9 Q;  1YNN D;  1I4R A;  4IUP A;  2PQA B;  1VQE A;  3BVM A;  1TWH B;  1TS2 A;  4JVZ A;  5E7N A;  3BVZ A;  1ESF A;  2ASB A;  3I4N B;  3MXP A;  1ONL A;  2PO4 A;  1RTO A;  2QDB A;  5FLM G;  4DV2 L;  1CA6 A;  1D2B A;  1STA A;  2ES2 A;  2F0N A;  1A2U A;  1I94 L;  2L11 A;  1UE1 A;  1VQI A;  5C44 H;  2EOT A;  4LF9 L;  1FR3 A;  1ENF A;  3MWY W;  3KJO A;  1FNU A;  2F0H A;  1HR0 Q;  3I70 A;  3N6R A;  3OWF A;  4A3F B;  4KHP Q;  4B3R L;  3IAY A;  4A3K G;  5IGC A;  2NVQ H;  1NR4 A;  5IWA L;  2PNH A;  4LF7 L;  1SE4 A;  5BN3 A;  3STB C;  4HJ8 A;  5C3E B;  3ERQ A;  1MGS A;  4X64 Q;  2PI2 A;  3MFY A;  3DWQ A;  1UUP A;  4DR7 L;  2ALY B;  1HNW L;  2ICI A;  1DYQ A;  4JV5 L;  3GTG B;  2K1B A;  3V05 A;  4Z9C B;  3L2P A;  2BH2 A;  3CXC A;  4L6T B;  5CBE E;  4C3J G;  2E2H H;  1EEI D;  2TSS A;  5GAD C;  4LF6 L;  1QIL A;  4FF1 A;  5FO7 B;  1A62 A;  2WAQ G;  2E74 C;  3FMC A;  2MJ8 A;  2MO1 A;  1EIF A;  3FP9 A;  1Y1W B;  2R93 G;  1X54 A;  1QNU A;  4APV A;  5EKL A;  3C46 A;  3DEP A;  1CUK A;  1SNC A;  3M7N A;  4PZ7 A;  5LMN W;  3J81 c;  4A3D B;  2K7V A;  3S1R B;  1VQ8 A;  3ONA B;  4V19 0;  1M1K C;  1I50 B;  2YTY A;  2KEE A;  3CCS A;  4BBS G;  1U4R A;  5AFW A;  1TS5 A;  4CKC A;  3U50 C;  4DR3 Q;  4C3I G;  2EYF A;  1NBW A;  4WRD A;  1QOH A;  2JSO A;  5C4X H;  5T1I A;  5EPJ A;  2B2W C;  2MQH A;  5M3M G;  4ODG A;  3EVQ A;  3S1N H;  1H9M A;  1SAP A;  2NZO A;  3J7A 5;  4C2M H;  1IBL Q;  2JA5 B;  2A19 A;  5J1Z A;  1EIH A;  2A1A A;  3PMF A;  5DAU A;  5M3F G;  2UUA L;  4DAP A;  3Q22 A;  1E0B A;  2F0V A;  3DUZ A;  1MD2 D;  2AWO A;  4RCN A;  4YCV A;  2EY5 A;  1BQQ T;  3J7A F;  5L37 A;  4DFA A;  3NPP A;  3G48 A;  4BY1 G;  2IW3 A;  3NK9 A;  2UXB Q;  2UXD L;  2DY8 A;  3W1G A;  1TWA H;  3GTJ B;  2JE6 I;  1LO5 D;  3BG3 A;  5CV8 A;  4JI2 Q;  2YTV A;  1T5E A;  2SDF A;  5IYC H;  1SNM A;  3MAQ A;  5KYL A;  4HMI A;  3GO5 A;  3ICE A;  4KHV A;  1PH3 A;  4HAE A;  4B9W A;  4X3U A;  1W6K A;  5IYB G;  1WCM H;  4DR2 L;  1XMO L;  2DNC A;  2EYJ A;  4RWS C;  4K5W A;  2UUB Q;  4DV5 Q;  2HIV A;  3CHB D;  4DUY Q;  2Z8L A;  3MTS A;  4UY8 C;  5LMU Q;  4R4C A;  4ZAI A;  4DR1 Q;  4QCL A;  3SK6 A;  4DV4 L;  4AQY L;  3BDL A;  2Q8I B;  2H4O A;  3QOJ A;  3RMH A;  3TSS A;  2I0Q A;  3QO2 A;  2BDN A;  4BBR G;  2ZT9 C;  1JC7 A;  4PQX A;  3A74 A;  1MHW C;  2EYP A;  1PTO B;  2EY2 A;  1LT5 D;  1SNP A;  5CC4 A;  3SVM A;  4XT3 B;  2HCC A;  1J5E Q;  2RA4 A;  5GQO A;  2DJF C;  4WJ4 A;  1YJW A;  1P16 A;  1GUS A;  1SE3 A;  2L0C A;  2HHH Q;  1VQO A;  4B3T L;  3VR3 A;  3PQI A;  5FJ8 H;  4ZKB B;  3K5N A;  3ND8 A;  4DR6 L;  2BE5 D;  1PFS A;  1VQH A;  2EVB A;  1IYV A;  4TVA B;  1Z9F A;  4GLV B;  1HUM A;  3TZU A;  1UE5 A;  4IN3 A;  1STE A;  3I4N H;  5M5Y H;  1UAP A;  2B2Y A;  4HIK A;  1K8G A;  2RCN A;  3VYS A;  4CGY B;  2B8G A;  2EPB A;  4I7Z C;  1H9S A;  4JBM A;  1V43 A;  4A3K B;  2MP1 A;  4CDF C;  2LSS A;  2F0M A;  1LYL A;  1PYB A;  2F1M A;  1X55 A;  1EOT A;  4RGN A;  1EQV A;  5FLX E;  5A35 A;  2N55 A;  1U4M A;  4A3F H;  2O5I C;  1K3B C;  3I56 A;  5AJ3 L;  3HZX A;  1TT2 A;  2EYH A;  3DEO A;  1PH8 A;  1TWG H;  2K5Q A;  1SE2 A;  4CDD C;  3F8T A;  1B9M A;  2NUC A;  1TY2 A;  3WOE A;  1X9N A;  2JA7 G;  4GS3 A;  5IWA Q;  1LTB D;  2WAQ B;  3ERS X;  2WKC A;  2XNA C;  2C5C A;  3FKI H;  3NEN A;  2QF7 A;  1EYA A;  2LMC B;  1HNW Q;  1I5F A;  5CR3 A;  1A3U A;  2WB1 G;  2Z6K A;  3UDG A;  1IKM A;  1GO3 E;  1PYS B;  1B1Z A;  1SMX A;  3HGB A;  1TR5 A;  2XTI A;  5CV7 A;  3K81 C;  3M7G A;  2GVA A;  4H0L C;  4J15 A;  4MTK A;  4KTA A;  3H0G G;  3HOU B;  1Y1W H;  1HH2 P;  2F3I A;  4LF6 Q;  4BBS B;  1NJI C;  2G9H D;  2M00 A;  3D4D A;  1BCP B;  1PRT C;  3E3X A;  1LTG D;  4C3I B;  1KAB A;  3RZD H;  3MXG A;  3S1R H;  3TP8 A;  1I50 H;  3AEV A;  3VR4 A;  4NB3 A;  4KY7 A;  5GAE C;  5COR A;  1KRT A;  1GHK A;  2HIX A;  4BA1 I;  4J8Q A;  3RUZ A;  2L12 A;  1N34 Q;  1MSG A;  1HRJ A;  5JPM C;  2K04 A;  3F2C A;  1Y1V G;  3HOW G;  2K50 A;  2KHI A;  2R7Z B;  1V1Q A;  1Y69 U;  1DJR D;  4UP7 A;  1ZYR D;  1E2W A;  1PDQ A;  1SNQ A;  4IUV A;  3ZYY X;  3CCU A;  3G71 A;  4JC0 A;  3A5U A;  5M9O A;  1VQ4 A;  2RDG A;  4LUZ A;  1MJE A;  2JA9 A;  4LW1 A;  1DM0 B;  2VUM B;  2UUA Q;  1Z47 A;  4V0B A;  4LFA L;  2RHQ B;  3J81 i;  2WAC A;  1NE3 A;  2VY3 A;  1DD2 A;  1CKM A;  2NN6 I;  4IO9 A;  3OW7 A;  4IJH A;  4X62 Q;  3BDO A;  4ZUJ A;  1U4L A;  1UWV A;  2BA0 A;  2YU9 H;  1BNZ A;  1X3Q A;  3D4W A;  4GKK Q;  2R92 B;  2UXD Q;  2K5V A;  1VQM A;  4JI3 L;  4JCV E;  2Q8R E;  2OWO A;  4RA8 A;  5IGG A;  4OXP A;  3WOF A;  4QB4 A;  3TN2 A;  4B3S Q;  3HOV G;  1SYE A;  3PV0 A;  4FDB A;  1VQN A;  3R93 A;  3J80 c;  4A76 A;  1MBY A;  3L7Z C;  4PNY A;  3HOX B;  2JA6 G;  2F0G A;  3GTM B;  1PZI D;  3DWP A;  1HXY D;  1JQY D;  4GKJ Q;  1Y8O B;  3VYU A;  2VZA A;  1Z7T A;  3S2D B;  4XQQ A;  3HFZ B;  1Q7Y C;  5EAY A;  5JVG 3;  1PTO H;  4DNI A;  1DOK A;  2XRS D;  4AYB G;  4AQY Q;  2EDG A;  1TWF H;  1P8L A;  4LF5 L;  1PTO D;  3T4A C;  1SYB A;  5IOC A;  4A3J G;  2CHB D;  2PW7 A;  3URY A;  3C3L A;  1F77 A;  3S9W A;  2E2J B;  1XPR A;  4KKS A;  2B63 G;  1J8I A;  2L4N A;  2F0D A;  5IT9 c;  1SJH D;  2VB3 X;  3SEB A;  1LUZ A;  1M8A A;  5HY6 A;  4A3M G;  1JB3 A;  4GOP C;  1TU2 B;  5JEA J;  5EJW A;  4DXG A;  4B3T Q;  2AMC B;  1I4G A;  4DV6 L;  5C3X A;  4LFB Q;  1VQ9 A;  4DR6 Q;  1J6Q A;  5EKI A;  2KEC A;  5FO9 B;  3G6J B;  1B70 B;  4KN7 C;  1N36 L;  2A74 C;  5I2X A;  2Q2U A;  1SFO B;  2I5M X;  2SEB D;  4R4Q A;  3UDF A;  3C2P A;  5CMD A;  2KCT A;  2KA7 A;  3VDY A;  1C8C A;  4K5X A;  4JG2 A;  1L2F A;  3Q8D A;  2JA7 B;  3NBH B;  3KJP A;  4O2D A;  2YYZ A;  4GNX C;  1DXM A;  3OW2 A;  3NTK A;  1JT8 A;  2XWJ B;  1TQO A;  2PMZ E;  3KLS X;  2HCI A;  4ZLT F;  1X6O A;  4OON A;  3NP8 A;  2H1E A;  2KCN A;  3J80 E;  1XNQ L;  3GTO B;  1A15 A;  3S24 A;  4NXN L;  4A3I G;  1UEB A;  3ERO A;  5IOD A;  3H0G B;  5NUC A;  3TQY A;  1WI5 A;  4B3M Q;  1K3R A;  3GDE A;  1FJG L;  4JI8 Q;  2EIF A;  4JYA Q;  1LTA D;  3HOU H;  4RH6 A;  1RHP A;  2NVX H;  4MHE A;  4KHZ A;  3E0E A;  1SNO A;  4C3I H;  3BVG A;  4G4K A;  3CCM A;  1BCP D;  1VQB A;  2ATW A;  3AYH B;  5IT9 E;  2B29 A;  5IYD H;  2QEX A;  3E9I A;  3PUY A;  2ENB A;  1YI2 A;  1O80 A;  1X3E A;  3WWV A;  5DM6 3;  1Y1V B;  3HOW B;  2NVT B;  1YEZ A;  2ZM6 L;  3J7Y W;  3GTP B;  5I4D A;  2K75 A;  4CJ1 B;  2IHF A;  3R8B A;  1ICF B;  1VS0 A;  2BDO A;  1HPC A;  1XPU A;  4OGQ C;  4CJ0 B;  2PW5 A;  4LFC Q;  2CWA A;  2KJX A;  3I2Z A;  2R7Z H;  4RFB A;  3HOY G;  2IHE A;  1U0L A;  2Z4H A;  3A54 A;  1E22 A;  4HN7 A;  3Q24 A;  1W6J A;  4DN4 M;  1STG A;  1LTL A;  3S15 B;  3GD7 A;  4BY7 B;  1X3P A;  2UXC L;  1D7Q A;  3I4L A;  3B6Y A;  2H5X A;  4X3K A;  1B8A A;  2LFN A;  4O1N A;  1E1T A;  1V1P A;  4F8M A;  2VUM H;  1KXL A;  1GVP A;  2A6E D;  2A73 B;  2RDF A;  4HCS A;  4L5Q A;  2NN6 G;  2F0F A;  4FVM A;  3AFQ A;  4WOR A;  3FEW X;  2B2T A;  2J4X A;  4LFA Q;  2RF4 A;  1S5D D;  2QKI C;  1TS4 A;  4KD4 A;  5HGQ A;  2E8G A;  1WD0 A;  1KHI A;  1LTI D;  4OWT B;  2R92 H;  4K6D A;  3P7J A;  1TII D;  1PFN A;  2G5D A;  3TP5 A;  3KYH C;  4UDU C;  5ELF A;  2OTL A;  1R9T B;  1XMQ L;  1CI3 M;  2LS0 1;  3BS1 A;  1ILQ A;  2A6H C;  3BJU A;  3MA2 B;  4JI5 L;  2PMZ B;  1SMY C;  4YY3 L;  5A2Q L;  4ABN A;  3TP7 A;  1IYU A;  5KND A;  2JA8 H;  3HOX H;  3GTM H;  4A3L H;  2OXP A;  4KN4 C;  4DV1 L;  1CM9 A;  2BCO A;  3KUP A;  3SHL A;  4Y7N B;  5IP7 G;  2ZXP A;  5C4Z A;  1WTQ A;  2K05 A;  2KCM A;  3AB9 A;  5M5W B;  4B9X A;  1KDB A;  5IGD A;  3CPW A;  2B2T C;  3HRZ C;  1CQV A;  1TXY A;  3K5L A;  3KLR A;  3CMA A;  4QY7 A;  5EQ0 A;  4OO1 H;  4A93 G;  4JI4 L;  3F2B A;  3PF5 A;  4C1N I;  1EWC A;  4EQO A;  4YCU A;  1JWM D;  2E2J H;  3F2U A;  5KIX A;  4A3B G;  4KY5 A;  3OMG A;  5K36 G;  2F0U A;  1G91 A;  1GHJ A;  4K8J A;  3CKI B;  3QR8 A;  5D3I B;  1Q3L A;  1E2V A;  1JWU D;  3L9A X;  4OL7 A;  1K0R A;  1Q12 A;  3RZO B;  1X56 A;  1STH A;  5BN4 A;  1LTR D;  4OEM B;  1KTK A;  3J80 i;  2L1B A;  4HED A;  4QMG A;  1PRT B;  1SFO H;  5GRO A;  1N36 Q;  4IAL A;  2XIW A;  1CHQ D;  1VDZ A;  1BVS A;  4NP5 A;  1ICW A;  1B9N A;  1PH2 A;  1HNX L;  2Z6B A;  4A3E B;  1UE6 A;  5DEH A;  4HJ5 A;  1EFW A;  1CTM A;  3CF5 A;  3J81 L;  1BR9 A;  2ZJR A;  4YWK A;  2CQA A;  5JJZ A;  5CV9 A;  2PCF B;  1WTX A;  2K5H A;  4IFD J;  2Q2H A;  1L1O A;  2EE1 A;  1NUC A;  2VQE Q;  1CK1 A;  2A69 C;  3HEJ A;  3M9B A;  4L63 B;  4BWG B;  5EGT A;  5C0X J;  3GTO H;  4JI1 Q;  3KF6 B;  4JI6 L;  3L0O A;  2E75 C;  1KLU D;  4L5T A;  5J3B A;  5HUR A;  3N52 A;  1TVX A;  3PO2 G;  4RHS A;  2YV5 A;  2M9V A;  1JR0 D;  1LAB A;  3NBH A;  3M4Y A;  2F3V A;  4NW2 A;  4YHH L;  1B3Q A;  1RF2 D;  3HKZ G;  1NTG A;  2NWG A;  4ALP A;  1YNN C;  5ELB A;  2E5L L;  1XNR Q;  3A56 A;  4K6L A;  4DA2 A;  3H09 A;  4LF4 L;  3TRZ A;  2HQL A;  3VR2 A;  1S5E D;  1F9S A;  3OTO Q;  5JVH 3;  4K0K L;  1L1O C;  1DON A;  3PUZ A;  3SK8 A;  5KNC A;  1CZW A;  4DXF A;  1QWY A;  1S4Z A;  2NVT H;  3HOW H;  3A5Z B;  1PH1 A;  2KCC A;  3ND9 A;  1PH9 A;  4X3T A;  5BR8 L;  4PG3 A;  3GTL B;  4ZK9 B;  3JAM E;  1KIX A;  5CV4 A;  1VQK A;  4B08 A;  3KBG A;  1EYC A;  3FPP A;  2I07 B;  2WV6 D;  1BCP F;  3MEH A;  3K7U C;  3A8K E;  3M4O H;  5KRU A;  1KRS A;  4ME5 A;  2ZXR A;  1U5K A;  1XTD A;  3S15 H;  2QCP X;  3TP6 A;  4BY7 H;  1GUW A;  4GN4 B;  1G2S A;  1DCZ A;  1SDF A;  5H1S E;  1C9O A;  4C3H H;  3K7A B;  4QQB X;  3S16 B;  4K5V A;  1OO9 B;  1GOZ A;  2ZXO A;  1L0Y B;  5ISR A;  3T16 A;  4JI0 Q;  2F52 A;  2BH8 A;  2RVL A;  4QJF A;  2WAQ E;  4HR7 B;  3MVV A;  4R9W A;  4JI7 L;  3PO3 B;  3AMU A;  3ULJ A;  2CVR A;  2Q2T A;  1GD7 A;  1X3F A;  5I9P A;  5GAH C;  1DZ1 A;  5FLX c;  1K83 B;  1U9R A;  3X3M A;  3M3Y B;  4A3G B;  1M90 C;  5FO8 B;  1QZH A;  4HMJ A;  1OXT A;  2VNU D;  4QUC A;  4DKA C;  4OWW B;  3P20 A;  1K9M C;  3MXN A;  3WDN A;  1R9T H;  2KED A;  2RKS A;  1PH6 A;  2NTT A;  1N33 L;  4O42 A;  4DK3 C;  3I4M G;  4IPD A;  2N88 A;  1SBB B;  3QIA A;  2MGS A;  2L5T A;  1ET6 A;  3LWU A;  2D0P A;  4RGM A;  4Y7N H;  4L5R C;  1BBX C;  1EIG A;  1YNJ D;  3K8A A;  1B3A A;  1QNK A;  3MC0 B;  4J6H A;  4DV1 Q;  4K2K A;  5M5W H;  1SEB D;  3D6W A;  5IP9 G;  4RHR A;  4Q5V A;  3A55 A;  5EPL A;  1EY8 A;  3P1H A;  1NY4 A;  2MPM A;  4ILW A;  3VYR A;  2F0T A;  1UE7 A;  3OOC A;  1QVF A;  1PYW D;  3IRB A;  1F9R A;  2D5D A;  1B53 A;  3HS0 C;  1CSQ A;  5C4J B;  2EYO A;  1HQR D;  2HDM A;  5EKK A;  1HNZ Q;  1TWH H;  1PFM A;  3MHB A;  1YHA A;  3DWA A;  3UE1 A;  2B2V A;  3KDF A;  1XJV A;  2A68 D;  1HFG A;  4KI0 A;  2X6L A;  1HR0 W;  3NEL A;  4M8A A;  3RZO H;  4BXX H;  3KFU A;  4K14 A;  3QJY A;  1FD7 D;  4ZKC B;  2FMC A;  3U4V A;  4DV2 Q;  3TS0 A;  1HJP A;  2IT1 A;  1QE6 A;  4IFD H;  5JEA G;  4G7H C;  3KLS A;  5D65 A;  1I94 Q;  3HOZ G;  5KGU A;  1G6Z A;  4A3E H;  4R8I A;  4H02 A;  2M2L A;  4KKU A;  4LF9 Q;  1STN A;  4X3S A;  2ZTE A;  2PQA A;  4XYQ A;  2Y0S G;  5C0X H;  1HNX Q;  1C0A A;  2PYK A;  4AIM A;  2K6A A;  3BZK A;  2DY7 A;  1B50 A;  4X6A H;  2DJG C;  4B3R Q;  5E4W C;  2VXW A;  4CKE A;  4C3J B;  5C3E H;  3PO2 B;  2AUK A;  5FK9 C;  4LF7 Q;  3V96 A;  3GTG H;  1SRO A;  4XT1 B;  4FO2 A;  1S3O A;  1OXV A;  3A8J E;  4OIK A;  2B2V C;  3J81 j;  5C44 G;  3K58 A;  2MFI A;  2X69 A;  3GTQ B;  3UI2 A;  4DR7 Q;  2R93 B;  2B2Y C;  4IUT A;  4JV5 Q;  4DV0 L;  1JOK A;  1JJ2 A;  5DM7 3;  3JAM i;  2V1C C;  2GA4 B;  1A2T A;  4X66 L;  4TKO B;  1YHB A;  2BE5 C;  2KUM A;  3AQQ A;  1CKN B;  1VQ6 A;  4YHH Q;  1PV4 A;  4A3D H;  5F2D A;  1OXS C;  5M3M B;  1QUQ B;  1EU3 A;  1SE8 A;  2CW0 D;  3I72 A;  3D0F A;  1ET9 A;  1EY7 A;  5JAV A;  5LHY 1;  1ROD A;  2PQE A;  3RLO A;  3VA7 A;  1LT3 D;  3DHQ A;  3H91 A;  2VS1 A;  5M3F B;  1HUN A;  2KHS A;  2Z6K C;  2KQ3 A;  5LMN L;  2ZTC A;  1PHJ A;  2JA5 H;  1E7Z A;  4IPC A;  3C1E A;  1G2T A;  1JJG A;  3IL8 A;  3RD4 A;  1WJJ A;  3IFT A;  3J80 L;  1CSP A;  4BY1 B;  1K0S A;  3K7A H;  1BDO A;  1FNV A;  1FVI A;  4HJA A;  2F03 A;  5C4X G;  5EBD A;  1A0I A;  4ME3 A;  3Q6S A;  4EQ5 A;  1I4X A;  4JOI A;  2D9U A;  3W3A A;  4DR4 L;  2QDL A;  2IX3 A;  4A3C H;  3SXH A;  3NTI A;  3PO3 H;  3D4R A;  1I3Q B;  1RKN A;  2A8V A;  3A0J A;  3GTJ H;  2QA4 A;  3GTK B;  2DNE A;  4TRD A;  3R2T A;  1K83 H;  4HIM A;  2EQS A;  2MHV A;  1GUN A;  1GJX A;  4A3G H;  2PPB C;  3CC4 A;  2LKV A;  4LWC A;  4KY6 A;  1R4Q B;  4ZCK A;  5IT9 L;  1G8Z D;  2NBF A;  1T9H A;  1QVC A;  2F0I A;  3SR1 A;  4BBR B;  2RSO A;  2RQX A;  4UAI A;  1SYD A;  2HT1 A;  3GQB A;  1Z6H A;  4FXK C;  4DR2 Q;  1XMO Q;  1HQM C;  1EY0 A;  3T13 A;  5KYI A;  1HA6 A;  1JB7 A;  4KJO A;  1S72 A;  3S17 B;  4QGU A;  4PV1 C;  4DF7 A;  3QG1 A;  4JOI C;  1TS3 A;  1CFM A;  4DV4 Q;  3S1Q B;  3DMU A;  1ILP A;  2SNS A;  5IYC G;  5ELN A;  1ZYR C;  2K14 A;  5FKA C;  1PH4 A;  1VQF A;  1STY A;  2E2D C;  1WD1 A;  3FVQ A;  3V2T A;  1AZQ A;  1WCM G;  4GN5 A;  1RL2 A;  2F4V L;  3NQI A;  5FLM H;  4IOC A;  5C4J H;  4DV3 L;  4ULL A;  1QB5 D;  3LNN A;  1GUT A;  3M85 A;  4OIJ A;  2I46 A;  3NQT A;  4O0A A;  1PLF A;  1J9O A;  1D6E C;  1XX8 A;  5G3L D;  1SXT A;  2K5D A;  3A8I E;  2ICE C;  2F3W A;  1F2Y A;  4CJ2 C;  1JOO A;  4BA2 I;  4KJN A;  1QCB D;  1E3P A;  4A3K H;  3W5O A;  1QG7 A;  4K8I A;  3CD6 A;  2KOL A;  2XVS A;  1WFQ A;  3J7Z C;  1II3 A;  3FPU B;  1AE2 A;  5FJ8 G;  2VB2 X;  1IHZ A;  3LGJ A;  2IJ0 A;  2JYO A;  4IJL A;  1Q82 C;  4DV7 L;  3K80 C;  2FIN B;  2KEN A;  5AJ3 Q;  1VF5 C;  4C3J H;  4ZYS A;  2B2U A;  2WB1 B;  3I4N G;  4KHP L;  1G51 A;  1YVC A;  1BO0 A;  2LXJ A;  3E0J A;  4IZ8 A;  3TEH B;  2DGY A;  2QIL A;  1PTO C;  2V4D A;  4H7B A;  2SOB A;  2R93 H;  1BBU A;  3GTQ H;  4WJW A;  4X64 L;  4UHV A;  1AW7 A;  2NVQ B;  2K01 A;  2JEA I;  4L8J A;  3T1H L;  3CCJ A;  4A3F G;  1GXD C;  1YBY A;  3OPO A;  2OTJ A;  2AQ3 B;  4EX5 A;  4BBS H;  4LNQ A;  5IY0 A;  3L3O C;  4GN3 B;  1WTH A;  4P73 A;  3AU7 A;  1B44 D;  2EJG C;  4Q0F A;  2BOS A;  2HD3 A;  1VQG A;  5M3M H;  4PMW A;  4HSV A;  4EVO A;  1BBW A;  1RDP D;  2CQO A;  1STB A;  3X3N A;  2K28 A;  3A7L A;  3FKI G;  1M4V A;  3I91 A;  4S3S A;  1IBK L;  3NXW A;  3T53 B;  1L0W A;  4ID6 A;  1PZK D;  2AQ1 B;  1PXU A;  1SJE D;  4J1M A;  1ZKO A;  4PMC A;  2LXK A;  4C56 C;  1S5C D;  2OEO A;  5M3F H;  4DR3 L;  4KLK A;  3G4S A;  1F9Q A;  4YWL A;  4RG1 A;  1Y1W G;  4U67 3;  3CCV A;  2N78 A;  4NMZ A;  3PUW A;  5LMN Q;  4JW0 A;  3BU2 A;  3KBX A;  3TME A;  3M4Q A;  4BY1 H;  4HTH A;  2F0S A;  1MIU A;  1PZJ D;  3NE5 B;  3PIO 3;  1IBL L;  3OIP A;  5CBA E;  4XYO A;  3CCQ A;  3EQL C;  4R8N A;  3FRP B;  4N8X 1;  4AH6 A;  5IE8 A;  4R4O A;  1Q81 C;  1JMC A;  4FF2 A;  3UDX A;  1Q1E A;  1I3Q H;  3GTK H;  3H3V H;  5IYB H;  4DR4 Q;  4JBJ A;  2RBM A;  2SNM A;  3K59 A;  3HOV B;  1O7Y A;  1IW7 D;  1CT1 D;  2IX0 A;  3MEF A;  1BCP C;  3OWE B;  2UXB L;  2JA6 B;  4ZUI A;  4JI2 L;  1SSO A;  5I6Y A;  1VMP A;  4JI3 Q;  2L9H A;  4BBR H;  4KV6 A;  5CV5 A;  1S40 A;  2IPK D;  4GLA C;  1F2Z A;  4AYB B;  4LK1 C;  2RSN A;  4UP9 A;  2Q8T A;  4HSP A;  2F0K A;  1HHV A;  2KVM A;  3S17 H;  4A3J B;  3S2D H;  4RMF A;  1L0X B;  2UUB L;  4DV5 L;  3D8G A;  1SYG A;  2N49 A;  2JEB I;  1ML0 D;  5LMU L;  4TSS A;  2B63 B;  5E3F A;  1WTP A;  1IXR A;  3S1Q H;  4DR1 L;  1LV9 A;  1VCI A;  3HKS A;  2TMP A;  4A3M B;  4KK7 A;  3NWT A;  3AFP A;  4RGO S;  1RJT A;  1VQD A;  1A3V A;  3EIV A;  4LF5 Q;  3SE0 A;  3STB D;  2OQ0 A;  3TS2 A;  3A7A B;  1R4P B;  1Y8N B;  2EJM A;  2B39 A;  5GAG C;  1J5E L;  2NTS A;  4DAV A;  1HCZ A;  3F1Z A;  2K52 A;  1CQF A;  2A6E C;  5DLQ E;  1KDC A;  3BYT B;  2HHH L;  4UPA A;  2CH4 A;  4UP8 A;  4DGZ A;  1BF4 A;  2JXM B;  3TDQ A;  1PTO F;  3JAM c;  1IL2 A;  1RCV D;  4DV6 Q;  1T5X D;  2PZU A;  4OEL B;  4RAU C;  3HG9 A;  3K6O A;  1H9K A;  3I4O A;  4LF8 L;  3TZD A;  4OO1 I;  1FYC A;  4DAY B;  2JA7 H;  3OIQ A;  1KQS A;  2L15 A;  1QJO A;  1EQQ A;  5M5Y B;  3CC7 A;  2EJF C;  2AQ2 B;  1HZC A;  1C4Q A;  4A3I B;  3PF4 A;  3CCE A;  1TY0 A;  3NTH A;  2NZ1 D;  1ESR A;  5G3L F;  1W2B A;  3EJI A;  4WJ3 M;  1VQP A;  5LL6 X;  1TKW B;  4DV7 Q;  1UEA B;  2Z4I A;  1H9J A;  4GZY C;  3CRK C;  1K8O A;  4DR5 L;  2NVY B;  4YIJ A;  3H0G H;  1YHQ A;  4L5S A;  4DAM A;  2DN8 A;  2F0L A;  1XNQ Q;  2CFM A;  2XSC A;  3E6Z X;  1TWG B;  1GM5 A;  4NXN Q;  3TBI B;  2F0O A;  1F9P A;  1X3G A;  2FMM A;  5DNF A;  2C35 B;  4DK1 A;  4PMB A;  3DM3 A;  1FJG Q;  3NSW A;  1VQC A;  2B2W A;  3QOL A;  1YZ6 A;  4G7Z C;  2G9D A;  3OSO A;  3PUX A;  1H9R A;  3T1H Q;  1WTO A;  3FKI B;  3ZJY C;  5M5X B;  4HJ7 A;  1QZG A;  2OT2 A;  2IL8 A;  3OYY A;  4R1J A;  1TWC B;  4DNR B;  5TSS A;  1WOC A;  1Y1V H;  2XN9 C;  1VQ7 A;  3SGI A;  3E5S A;  5C6A A;  3DXJ C;  3GTP H;  3HOY B;  3G6E A;  1G6P A;  3RN5 A;  4OWX B;  5FLX L;  3RZD B;  3U58 A;  1IBM L;  2ZM6 Q;  4RKL A;  1IBK Q;  4HJ9 A;  2A5H A;  1N32 L;  1GUO A;  4R4I A;  3HOU G;  1IYJ B;  1VQL A;  2EY1 A;  1EWH A;  2F0E A;  4BS9 A;  1N34 L;  1EZ8 A;  1S5F D;  1JWS D;  5A2Q E;  2DUD A;  2ZTD A;  3P75 A;  1PMR A;  5IYD G;  1X65 A;  1HTP A;  1AEX A;  1SYF A;  2JJQ A;  3I73 A;  1HZB A;  4JK1 C;  2UXC Q;  3IFD A;  2XWB B;  3K5O A;  2F0W A;  4P74 A;  4MTN A;  3HKZ E;  4U68 A;  3NUC A;  1WVL A;  3HOV H;  1O7I A;  2MUY A;  3VYT A;  2R7Z G;  2XRQ D;  4YWM A;  5KEE A;  5JJL A;  1V1O A;  4P75 A;  2K5N A;  4GOP B;  3K0Y A;  1HTL D;  4X62 L;  2JA6 H;  3T56 B;  4FP5 D;  1V9P A;  3MFG A;  4DUZ L;  3NEM A;  2RDH A;  1KNE A;  5ELO A;  2R3Z A;  4GKK L;  2D62 A;  1KLG D;  1AH9 A;  4WFN 3;  1VQA A;  1XMQ Q;  2YU9 B;  1K73 C;  2VUM G;  3I55 A;  1D8L A;  1KAW A;  1EQT A;  5J22 A;  4JI5 Q;  4EQP A;  1S5B D;  5K5P A;  4YY3 Q;  4B3S L;  1MKH A;  2K5W A;  2EXD A;  4A3J H;  4A93 B;  2O4X A;  4QF4 A;  5JJK A;  5FOB B;  1D5Z C;  1JE5 A;  1WYD A;  1IKL A;  2AWN A;  2R7D A;  2B63 H;  4A3B B;  3S2H B;  2R92 G;  4G57 A;  3CQZ B;  3H94 A;  2AUJ D;  1MSH A;  4GNX B;  4A3M H;  4LUV A;  4GKJ L;  3J81 E;  1Q46 A;  3R3O A;  1PA6 A;  2UUC L;  3NBI A;  2OQK A;  5CV6 A;  1K8A C;  1JOQ A;  1OXU A;  2VQF L;  4GLX A;  4JI4 Q;  4P71 A;  1KAA A;  2R7F A;  2JA8 G;  3HOX G;  1I4Q A;  4A3L G;  1D5M C;  4N9P A;  1TWF B;  5IGF A;  2CWP A;  1VQ5 A;  3KF8 B;  4XTC S;  2EYM A;  2FJ2 A;  1EYD A;  3TRE A;  4IUQ A;  3BDC A;  3PIP 3;  3GP7 A;  5J39 A;  4LFB L;  5D14 A;  1YJ9 A;  4OO1 G;  2JK8 A;  1PRT D;  2ID0 A;  3SDZ A;  1X32 A;  1EOV A;  4Y52 H;  4JBK A;  2X6G A;  3RN2 A;  1IZ6 A;  3LWE A;  4LF8 Q;  4IPH A;  1EZ6 A;  5C5L A;  5CYU A;  4LMQ D;  3SK5 A;  4M1U B;  4A3I H;  1Y14 B;  1EYG A;  2WIN B;  1KC8 C;  1YNJ C;  1A63 A;  2E76 C;  2QEJ C;  5IGE A;  4K2L A;  4RGT A;  1EFI D;  2L55 A;  2NVY H;  3HKZ B;  3U4Z A;  1DOL A;  4HCE A;  2NZH A;  3PCO B;  1YJN A;  1F2L A;  2QGQ A;  5I9O A;  3U9O A;  4DAY A;  4JI6 Q;  1FGU A;  4DR5 Q;  5E1F A;  1N9W A;  3EN2 A;  4ZQ3 A;  4IFD I;  5I6W A;  4CDE C;  2VL6 A;  4B3M L;  2PZW A;  2R61 A;  2Z1C A;  3CW2 C;  5C0X I;  2O5J C;  1NR2 A;  4IPG A;  2FXQ A;  4JBW A;  1HZ9 A;  4JI8 L;  5M5X H;  4MNO A;  3KOJ A;  4F88 A;  3T51 B;  3KF6 A;  4JYA L;  2A68 C;  1ENC A;  2P5Z X;  1A8V A;  2E5L Q;  4NXM L;  3K57 A;  1TWC H;  1O7Z A;  2GVB A;  4LF4 Q;  4LJZ C;  5COY A;  3UE0 A;  2J7Z A;  4FF4 A;  4MZ9 A;  3LX0 A;  3RLF A;  1D1I A;  3HOY H;  3RLN A;  4K0K Q;  4XQN A;  2EXZ A;  2NVX B;  1JJC B;  4H44 C;  5ELE A;  4E6I A;  4TQU S;  3O13 A;  3GTL H;  2HUG A;  4I65 A;  3J7A V;  2N3S A;  1NMG A;  2Y0S E;  3QB3 A;  5BR8 Q;  1IBM Q;  1VQJ A;  3IKJ A;  4DPG A;  4FNF A;  1N32 Q;  2CCZ A;  4X65 L;  2N8N A;  4NKL A;  4LFC L;  4N8F A;  1O78 A;  2NN6 H;  4NPS A;  3CME A;  1V1P B;  3PIO A;  3S14 B;  2K03 A;  2PI2 E;  1AZP A;  3S16 H;  3G7L A;  1A3T A;  2ZJP A;  2WB1 E;  4FF3 A;  1Q1B A;  4RCO A;  1EIY B;  1ASY A;  2IX1 A;  2WFW A;  1I6V C;  2XGT A;  4H13 C;  3D6C A;  4MIU A;  4IUR A;  1PFB A;  1SND A;  4HID A;  2GN5 A;  3I4M B;  3M3Y H;  1OXX K;  4JI7 Q;  2AKW B;  1WTR A;  1LTS D;  3UDI A;  1I6H B;  3I90 A;  4A75 A;  1FL0 A;  4BY7 G;  4XXE A;  2RHS B;  2EYL A;  5IP7 H;  1BKB A;  4PZ6 A;  4POG A;  2VW9 A;  1KL9 A;  4LAA A;  4C3H G;  1NNX A;  5D3D A;  2D2C C;  2CW0 C;  1RD9 D;  4XQJ A;  4DUZ Q;  3FDT A;  4R4T A;  1RIP A;  2JP1 A;  1N8R C;  2WKD A;  4POF A;  1N33 Q;  1IL8 A; 
#chains in the Genus database with same CATH homology
 4CHT B;  3U9S A;  4FXD A;  1EY6 A;  3S1M B;  1NAP A;  1O7L A;  5K36 H;  2E2I B;  4XIG S;  1FNW A;  1F2M A;  5E4X A;  4C1N K;  3VR6 A;  2JA8 B;  2F0P A;  1AN8 A;  2C9O A;  2HDL A;  2EY6 A;  5HGT A;  1U4P A;  2F4I A;  2F0J A;  3BZD B;  3PUV A;  1JCK B;  1WTV A;  5CGK A;  4EGV A;  2FHT A;  3MZ5 A;  3Q0A A;  1CZG A;  1B2T A;  4DU9 A;  5JOB A;  3HOZ B;  3GV3 A;  3HP3 A;  1JE4 A;  1HA5 A;  2PNR C;  2LY7 A;  1G29 1;  2Y0S B;  5I2Y A;  4NDX A;  5IGB A;  5EBC A;  5C5M A;  1LT6 D;  1NSN S;  4RKB A;  4CBV A;  2HQE A;  3DM1 A;  1XWE A;  3KF8 A;  1JOR A;  5C44 B;  1WTW A;  1Y8P B;  1ZXT A;  2PZT A;  2K32 A;  1PRT F;  1AP0 A;  3D3R A;  3KK7 A;  1CHP D;  1VF7 A;  4IFD G;  2EZV A;  1XYI A;  2BA1 A;  4MN3 A;  1V8Q A;  5C0X G;  4P2C B;  3CU7 A;  1DOM A;  1JIC A;  1SYC A;  3CRL C;  2E2H B;  1FGB D;  1K8M A;  3I3C A;  1XTC D;  5ELC A;  2R6G A;  2B2U C;  5BN5 A;  5EPK A;  4OHJ A;  1NCV A;  4CKB A;  3OHX C;  2F0Q A;  1XXG A;  4KMU C;  4G7O C;  2J0T D;  4IUU A;  2A6H D;  4KD3 A;  1SMY D;  5C4X B;  1EU4 A;  4QUF A;  1VMC A;  3EA6 A;  4QIW B;  2B8F A;  1UNS A;  1GUG A;  3S1N B;  2IWH A;  5C3W A;  4FYD A;  2O2L D;  4N9T A;  1BOS A;  4XDX A;  2WP8 J;  1Q8I A;  1BUV T;  4C2M B;  3W2D A;  4DK0 A;  3M4O B;  3ITP A;  3VR5 A;  1C48 A;  3Q23 A;  5JPN C;  1LAC A;  3D31 A;  1EY9 A;  4C3H B;  1CA5 A;  3BYY B;  1MI2 A;  1LLR D;  1HFN A;  4F87 A;  1KNA A;  3SK4 A;  1D5X C;  2NB0 A;  2OF1 A;  3K5M A;  1D1K A;  4FXG C;  1TWA B;  3R2I A;  1B4O A;  1ZEQ X;  1A6X A;  5T1G A;  3JAM L;  3H6M A;  1EY5 A;  3OMC A;  2NYZ D;  4KKT A;  1KDA A;  1WCM B;  3NHH A;  3NWS A;  4ZRZ A;  3EFX D;  1EY4 A;  3GV6 A;  1Q90 A;  5C4H A;  5ELD A;  4IQZ A;  1RTN A;  1ENA A;  4DNT B;  1I4H A;  3VA5 A;  2A69 D;  3QWN A;  1I4P A;  3MXU A;  4F7X A;  1LTT D;  2K33 A;  5KNB A;  1EEF D;  5JEA H;  1AFP A;  1H9S B;  2WII B;  4IUN A;  4EQN A;  5LL6 S;  5IIF A;  3H3V C;  1IW7 C;  1BXT A;  2FFK B;  1EL0 A;  3C1F A;  1E2Z A;  1LT4 D;  3I8Z A;  1YNN D;  1I4R A;  4IUP A;  3BVM A;  1TWH B;  1TS2 A;  3BVZ A;  1ESF A;  3I4N B;  3MXP A;  1ONL A;  1RTO A;  2PO4 A;  2QDB A;  1CA6 A;  1D2B A;  1STA A;  2F0N A;  1A2U A;  2L11 A;  2EOT A;  1FR3 A;  1ENF A;  3MWY W;  1FNU A;  2F0H A;  3I70 A;  3N6R A;  3OWF A;  4A3F B;  3IAY A;  5IGC A;  1NR4 A;  1SE4 A;  5BN3 A;  5C3E B;  3ERQ A;  1MGS A;  3MFY A;  3DWQ A;  1UUP A;  2ICI A;  1DYQ A;  3GTG B;  2K1B A;  3V05 A;  4Z9C B;  4L6T B;  5CBE E;  4C3J G;  1EEI D;  2TSS A;  1QIL A;  4FF1 A;  5FO7 B;  2E74 C;  3FMC A;  2MJ8 A;  1Y1W B;  1QNU A;  5EKL A;  3C46 A;  3DEP A;  1SNC A;  3M7N A;  4A3D B;  2K7V A;  3S1R B;  3ONA B;  4V19 0;  1I50 B;  2KEE A;  1U4R A;  5AFW A;  1TS5 A;  4CKC A;  4C3I G;  2EYF A;  4WRD A;  1QOH A;  2JSO A;  5T1I A;  5EPJ A;  2B2W C;  4ODG A;  3EVQ A;  1H9M A;  1SAP A;  2JA5 B;  5J1Z A;  1EIH A;  3PMF A;  5DAU A;  4DAP A;  3Q22 A;  1E0B A;  2F0V A;  3DUZ A;  1MD2 D;  2AWO A;  4RCN A;  2EY5 A;  1BQQ T;  3J7A F;  4DFA A;  3NPP A;  2IW3 A;  3NK9 A;  2DY8 A;  3GTJ B;  2JE6 I;  1LO5 D;  3BG3 A;  5CV8 A;  1T5E A;  2SDF A;  1SNM A;  3MAQ A;  5KYL A;  4HMI A;  3GO5 A;  4KHV A;  4HAE A;  4B9W A;  4X3U A;  1W6K A;  2DNC A;  2EYJ A;  4RWS C;  4K5W A;  3CHB D;  2Z8L A;  3MTS A;  4ZAI A;  4QCL A;  3SK6 A;  3BDL A;  2Q8I B;  2H4O A;  3QOJ A;  3RMH A;  3TSS A;  3QO2 A;  2BDN A;  2ZT9 C;  1JC7 A;  4PQX A;  2EYP A;  1PTO B;  2EY2 A;  1LT5 D;  1SNP A;  5CC4 A;  3SVM A;  4XT3 B;  2HCC A;  2RA4 A;  1GUS A;  1SE3 A;  2L0C A;  3VR3 A;  4ZKB B;  3K5N A;  3ND8 A;  2BE5 D;  2EVB A;  1IYV A;  1HUM A;  3TZU A;  4IN3 A;  1STE A;  1UAP A;  2B2Y A;  3VYS A;  4CGY B;  2B8G A;  2EPB A;  4I7Z C;  1H9S A;  1V43 A;  4A3K B;  2MP1 A;  2F0M A;  2F1M A;  4RGN A;  1EOT A;  1EQV A;  5FLX E;  5A35 A;  2N55 A;  1U4M A;  2O5I C;  3HZX A;  1TT2 A;  2EYH A;  3DEO A;  2K5Q A;  1SE2 A;  1B9M A;  2NUC A;  1TY2 A;  3WOE A;  1LTB D;  2WAQ B;  2WKC A;  2XNA C;  2C5C A;  2QF7 A;  1EYA A;  2LMC B;  5CR3 A;  1A3U A;  1IKM A;  1B1Z A;  3HGB A;  1TR5 A;  5CV7 A;  3M7G A;  4H0L C;  4KTA A;  3HOU B;  4BBS B;  2G9H D;  2M00 A;  3D4D A;  1BCP B;  1PRT C;  1LTG D;  4C3I B;  1KAB A;  3MXG A;  3TP8 A;  3VR4 A;  4KY7 A;  5COR A;  1GHK A;  4BA1 I;  4J8Q A;  3RUZ A;  2L12 A;  1MSG A;  1HRJ A;  5JPM C;  2K04 A;  2R7Z B;  1Y69 U;  1DJR D;  1ZYR D;  1E2W A;  1PDQ A;  1SNQ A;  4IUV A;  3ZYY X;  5M9O A;  2RDG A;  1DM0 B;  2VUM B;  1Z47 A;  4V0B A;  2WAC A;  1DD2 A;  2NN6 I;  3OW7 A;  3BDO A;  4ZUJ A;  1U4L A;  2BA0 A;  1BNZ A;  1X3Q A;  3D4W A;  2R92 B;  2Q8R E;  4RA8 A;  5IGG A;  3WOF A;  4QB4 A;  3TN2 A;  1SYE A;  3PV0 A;  3R93 A;  1MBY A;  3L7Z C;  4PNY A;  3HOX B;  3GTM B;  2F0G A;  1PZI D;  3DWP A;  1HXY D;  1JQY D;  1Y8O B;  3VYU A;  3S2D B;  1Z7T A;  4XQQ A;  5JVG 3;  1PTO H;  1DOK A;  2XRS D;  2EDG A;  1PTO D;  3T4A C;  1SYB A;  5IOC A;  2CHB D;  2PW7 A;  3URY A;  3C3L A;  1F77 A;  3S9W A;  2E2J B;  4KKS A;  1J8I A;  2L4N A;  2F0D A;  1SJH D;  2VB3 X;  3SEB A;  1M8A A;  1JB3 A;  1TU2 B;  5JEA J;  5EJW A;  4DXG A;  1I4G A;  5C3X A;  5EKI A;  2KEC A;  5FO9 B;  3G6J B;  4KN7 C;  2A74 C;  5I2X A;  1SFO B;  2SEB D;  3C2P A;  5CMD A;  2KA7 A;  1C8C A;  4K5X A;  2JA7 B;  2YYZ A;  1DXM A;  3NTK A;  2XWJ B;  1TQO A;  3KLS X;  2HCI A;  4ZLT F;  3NP8 A;  2H1E A;  2KCN A;  3J80 E;  3GTO B;  1A15 A;  3ERO A;  5IOD A;  3H0G B;  5NUC A;  1LTA D;  4RH6 A;  1RHP A;  4MHE A;  4KHZ A;  1SNO A;  3BVG A;  4G4K A;  1BCP D;  5IT9 E;  3PUY A;  2ENB A;  1O80 A;  5DM6 3;  2NVT B;  1Y1V B;  3HOW B;  3J7Y W;  3GTP B;  5I4D A;  4CJ1 B;  3R8B A;  2BDO A;  1HPC A;  4OGQ C;  4CJ0 B;  2PW5 A;  2KJX A;  4RFB A;  2Z4H A;  3A54 A;  4HN7 A;  3Q24 A;  1W6J A;  4DN4 M;  1STG A;  3S15 B;  3GD7 A;  4BY7 B;  1X3P A;  3I4L A;  4X3K A;  2LFN A;  4O1N A;  1V1P A;  4F8M A;  2A6E D;  2A73 B;  2RDF A;  4HCS A;  2NN6 G;  2F0F A;  4FVM A;  4WOR A;  3FEW X;  2B2T A;  2J4X A;  1S5D D;  2QKI C;  1TS4 A;  4KD4 A;  1WD0 A;  1LTI D;  4K6D A;  3P7J A;  1TII D;  1PFN A;  3TP5 A;  4UDU C;  5ELF A;  1R9T B;  1CI3 M;  2LS0 1;  3BS1 A;  1ILQ A;  2A6H C;  3MA2 B;  2PMZ B;  1SMY C;  5A2Q L;  4ABN A;  3TP7 A;  1IYU A;  5KND A;  2OXP A;  4KN4 C;  1CM9 A;  2BCO A;  3KUP A;  3SHL A;  4Y7N B;  2ZXP A;  5C4Z A;  1WTQ A;  2K05 A;  3AB9 A;  5M5W B;  4B9X A;  1KDB A;  5IGD A;  2B2T C;  3HRZ C;  1CQV A;  3K5L A;  3KLR A;  5EQ0 A;  4OO1 H;  4C1N I;  1EWC A;  4EQO A;  1JWM D;  3F2U A;  5KIX A;  4KY5 A;  3OMG A;  5K36 G;  2F0U A;  1G91 A;  1GHJ A;  4K8J A;  3CKI B;  5D3I B;  1Q3L A;  1E2V A;  1JWU D;  3L9A X;  4OL7 A;  1Q12 A;  3RZO B;  1STH A;  5BN4 A;  1LTR D;  1KTK A;  2L1B A;  4HED A;  4QMG A;  1PRT B;  4IAL A;  2XIW A;  4NP5 A;  1CHQ D;  1VDZ A;  1ICW A;  1B9N A;  4A3E B;  5DEH A;  1CTM A;  3J81 L;  1BR9 A;  2CQA A;  5JJZ A;  5CV9 A;  2PCF B;  1WTX A;  4IFD J;  2EE1 A;  1NUC A;  1CK1 A;  2A69 C;  3HEJ A;  4L63 B;  4BWG B;  5EGT A;  5C0X J;  2E75 C;  1KLU D;  5HUR A;  3N52 A;  1TVX A;  4RHS A;  2M9V A;  1JR0 D;  1LAB A;  3NBH A;  3M4Y A;  2F3V A;  4NW2 A;  1RF2 D;  2NWG A;  1YNN C;  5ELB A;  3A56 A;  4K6L A;  4DA2 A;  3H09 A;  3VR2 A;  1S5E D;  1F9S A;  5JVH 3;  1DON A;  3PUZ A;  3SK8 A;  5KNC A;  1CZW A;  4DXF A;  1QWY A;  1S4Z A;  2KCC A;  3ND9 A;  4X3T A;  3GTL B;  4ZK9 B;  3JAM E;  5CV4 A;  4B08 A;  3KBG A;  1EYC A;  3FPP A;  2I07 B;  2WV6 D;  1BCP F;  3MEH A;  3A8K E;  5KRU A;  4ME5 A;  2ZXR A;  2QCP X;  3TP6 A;  1GUW A;  1G2S A;  1DCZ A;  1SDF A;  3K7A B;  3S16 B;  4K5V A;  1OO9 B;  1GOZ A;  2ZXO A;  1L0Y B;  5ISR A;  3T16 A;  2RVL A;  4HR7 B;  3MVV A;  4R9W A;  3PO3 B;  3AMU A;  2CVR A;  1DZ1 A;  5I9P A;  1K83 B;  1U9R A;  3X3M A;  3M3Y B;  4A3G B;  5FO8 B;  4HMJ A;  1OXT A;  2VNU D;  4QUC A;  3P20 A;  3MXN A;  3WDN A;  2KED A;  2RKS A;  2NTT A;  4O42 A;  2N88 A;  1SBB B;  3QIA A;  2MGS A;  2L5T A;  1ET6 A;  3LWU A;  4RGM A;  1BBX C;  1EIG A;  1YNJ D;  1B3A A;  1QNK A;  3MC0 B;  4J6H A;  4K2K A;  1SEB D;  3D6W A;  4RHR A;  4Q5V A;  3A55 A;  5EPL A;  1EY8 A;  3P1H A;  4ILW A;  2MPM A;  3VYR A;  2F0T A;  3OOC A;  1PYW D;  1F9R A;  2D5D A;  1B53 A;  3HS0 C;  5C4J B;  2EYO A;  1HQR D;  2HDM A;  5EKK A;  1PFM A;  3MHB A;  3DWA A;  2B2V A;  2A68 D;  1HFG A;  4KI0 A;  2X6L A;  4M8A A;  4K14 A;  3QJY A;  1FD7 D;  4ZKC B;  2FMC A;  2IT1 A;  1QE6 A;  4IFD H;  5JEA G;  4G7H C;  3KLS A;  5D65 A;  5KGU A;  1G6Z A;  4R8I A;  4KKU A;  2M2L A;  1STN A;  4X3S A;  4XYQ A;  5C0X H;  2PYK A;  2K6A A;  2DY7 A;  1B50 A;  5E4W C;  2VXW A;  4CKE A;  4C3J B;  3PO2 B;  2AUK A;  5FK9 C;  3V96 A;  4XT1 B;  4FO2 A;  1OXV A;  3A8J E;  4OIK A;  2B2V C;  2R93 B;  3K58 A;  2X69 A;  3GTQ B;  3UI2 A;  2B2Y C;  4IUT A;  1JOK A;  5DM7 3;  2GA4 B;  1A2T A;  4TKO B;  2BE5 C;  2KUM A;  5F2D A;  1OXS C;  5M3M B;  1EU3 A;  2CW0 D;  3I72 A;  1ET9 A;  1EY7 A;  5JAV A;  5LHY 1;  1ROD A;  2PQE A;  3VA7 A;  1LT3 D;  3DHQ A;  3H91 A;  5M3F B;  1HUN A;  2KHS A;  2KQ3 A;  3C1E A;  1G2T A;  3IL8 A;  3RD4 A;  3IFT A;  3J80 L;  4BY1 B;  1BDO A;  1FNV A;  2F03 A;  5EBD A;  3Q6S A;  1I4X A;  2D9U A;  3W3A A;  2IX3 A;  3SXH A;  3NTI A;  3D4R A;  1I3Q B;  1RKN A;  3GTK B;  2DNE A;  4TRD A;  3R2T A;  2MHV A;  1GUN A;  1GJX A;  2PPB C;  2LKV A;  4KY6 A;  1R4Q B;  5IT9 L;  1G8Z D;  2NBF A;  2F0I A;  3SR1 A;  4BBR B;  2RSO A;  2RQX A;  4UAI A;  1SYD A;  3GQB A;  1Z6H A;  4FXK C;  1HQM C;  1EY0 A;  3T13 A;  5KYI A;  1HA6 A;  4KJO A;  3S17 B;  4PV1 C;  4DF7 A;  3QG1 A;  1TS3 A;  1CFM A;  3S1Q B;  3DMU A;  1ILP A;  2SNS A;  1ZYR C;  5FKA C;  1STY A;  2E2D C;  1WD1 A;  3FVQ A;  3V2T A;  1AZQ A;  3NQI A;  4ULL A;  1QB5 D;  3LNN A;  1GUT A;  3M85 A;  4OIJ A;  2I46 A;  3NQT A;  1PLF A;  1J9O A;  1D6E C;  1XX8 A;  5G3L D;  1SXT A;  2K5D A;  3A8I E;  2ICE C;  2F3W A;  1F2Y A;  4CJ2 C;  1JOO A;  4BA2 I;  4KJN A;  1QCB D;  1QG7 A;  4K8I A;  2KOL A;  2XVS A;  1II3 A;  3FPU B;  2VB2 X;  1IHZ A;  2IJ0 A;  2JYO A;  2FIN B;  1VF5 C;  4ZYS A;  2B2U A;  2WB1 B;  1BO0 A;  4IZ8 A;  3E0J A;  2QIL A;  1PTO C;  2V4D A;  4H7B A;  2SOB A;  4WJW A;  1AW7 A;  2NVQ B;  2K01 A;  2JEA I;  4L8J A;  1GXD C;  3OPO A;  2AQ3 B;  3L3O C;  3AU7 A;  1B44 D;  2EJG C;  4Q0F A;  2BOS A;  4PMW A;  4HSV A;  4EVO A;  1RDP D;  1STB A;  3X3N A;  2K28 A;  3A7L A;  1M4V A;  3I91 A;  4S3S A;  3NXW A;  3T53 B;  4ID6 A;  1PZK D;  2AQ1 B;  1PXU A;  1SJE D;  4J1M A;  1ZKO A;  4PMC A;  4C56 C;  1S5C D;  2OEO A;  1F9Q A;  4U67 3;  4NMZ A;  3PUW A;  3KBX A;  3TME A;  4HTH A;  2F0S A;  1PZJ D;  3NE5 B;  3PIO 3;  3OIP A;  5CBA E;  4XYO A;  3EQL C;  4R8N A;  3FRP B;  4FF2 A;  1Q1E A;  2RBM A;  2SNM A;  3K59 A;  3HOV B;  1O7Y A;  1IW7 D;  1CT1 D;  2IX0 A;  1BCP C;  3OWE B;  2JA6 B;  4ZUI A;  1SSO A;  5I6Y A;  1VMP A;  2L9H A;  4KV6 A;  5CV5 A;  2IPK D;  1F2Z A;  4AYB B;  4LK1 C;  2RSN A;  2Q8T A;  4HSP A;  2F0K A;  1HHV A;  2KVM A;  4A3J B;  1L0X B;  3D8G A;  1SYG A;  2JEB I;  1ML0 D;  4TSS A;  2B63 B;  5E3F A;  1WTP A;  1LV9 A;  1VCI A;  2TMP A;  4A3M B;  4KK7 A;  3NWT A;  4RGO S;  1RJT A;  1A3V A;  3SE0 A;  3A7A B;  1R4P B;  1Y8N B;  2EJM A;  2B39 A;  2NTS A;  4DAV A;  1HCZ A;  1CQF A;  2A6E C;  1KDC A;  3BYT B;  4DGZ A;  1BF4 A;  2JXM B;  3TDQ A;  1PTO F;  1RCV D;  1T5X D;  2PZU A;  4RAU C;  3HG9 A;  3K6O A;  1H9K A;  4OO1 I;  3TZD A;  1FYC A;  3OIQ A;  1QJO A;  5M5Y B;  2EJF C;  2AQ2 B;  1C4Q A;  4A3I B;  1TY0 A;  3NTH A;  2NZ1 D;  1ESR A;  5G3L F;  3EJI A;  5LL6 X;  1TKW B;  1UEA B;  2Z4I A;  1H9J A;  4GZY C;  3CRK C;  1K8O A;  2NVY B;  4YIJ A;  2DN8 A;  2F0L A;  2XSC A;  3E6Z X;  1TWG B;  3TBI B;  2F0O A;  1F9P A;  2FMM A;  5DNF A;  4DK1 A;  4PMB A;  3NSW A;  2B2W A;  3QOL A;  4G7Z C;  2G9D A;  3OSO A;  3PUX A;  1H9R A;  1WTO A;  3FKI B;  5M5X B;  2OT2 A;  2IL8 A;  1TWC B;  4DNR B;  5TSS A;  2XN9 C;  3E5S A;  5C6A A;  3DXJ C;  3HOY B;  5FLX L;  3RZD B;  4RKL A;  2A5H A;  1GUO A;  2EY1 A;  1EWH A;  2F0E A;  4BS9 A;  1EZ8 A;  1S5F D;  1JWS D;  5A2Q E;  3P75 A;  1PMR A;  1HTP A;  1AEX A;  1SYF A;  3I73 A;  4JK1 C;  3IFD A;  2XWB B;  3K5O A;  2F0W A;  4U68 A;  3NUC A;  1WVL A;  2MUY A;  3VYT A;  2XRQ D;  5KEE A;  1V1O A;  3K0Y A;  1HTL D;  3T56 B;  4FP5 D;  3MFG A;  2RDH A;  1KNE A;  2R3Z A;  2D62 A;  1KLG D;  4WFN 3;  2YU9 B;  1EQT A;  5J22 A;  4EQP A;  1S5B D;  5K5P A;  2K5W A;  4A93 B;  2O4X A;  4QF4 A;  5FOB B;  1D5Z C;  1IKL A;  2AWN A;  4A3B B;  3S2H B;  4G57 A;  3CQZ B;  3H94 A;  2AUJ D;  1MSH A;  3J81 E;  3R3O A;  3NBI A;  5CV6 A;  1JOQ A;  1OXU A;  1KAA A;  1I4Q A;  1D5M C;  4N9P A;  1TWF B;  5IGF A;  4XTC S;  2EYM A;  2FJ2 A;  1EYD A;  4IUQ A;  3BDC A;  3PIP 3;  3GP7 A;  5J39 A;  5D14 A;  4OO1 G;  1PRT D;  2ID0 A;  3SDZ A;  1X32 A;  2X6G A;  3LWE A;  1EZ6 A;  5C5L A;  5CYU A;  4LMQ D;  3SK5 A;  4M1U B;  2WIN B;  1YNJ C;  2E76 C;  2QEJ C;  5IGE A;  4K2L A;  4RGT A;  1EFI D;  2L55 A;  3HKZ B;  1DOL A;  4HCE A;  1F2L A;  5I9O A;  3U9O A;  4DAY A;  5E1F A;  4IFD I;  4ZQ3 A;  5I6W A;  2PZW A;  2R61 A;  2Z1C A;  5C0X I;  2O5J C;  1NR2 A;  4JBW A;  4F88 A;  3T51 B;  2A68 C;  1ENC A;  3K57 A;  1O7Z A;  4LJZ C;  5COY A;  2J7Z A;  4FF4 A;  3LX0 A;  3RLF A;  1D1I A;  4XQN A;  2EXZ A;  2NVX B;  4H44 C;  5ELE A;  4E6I A;  4TQU S;  3O13 A;  2HUG A;  4I65 A;  3J7A V;  3QB3 A;  3IKJ A;  4FNF A;  4NKL A;  1O78 A;  2NN6 H;  1V1P B;  3S14 B;  2K03 A;  1AZP A;  3G7L A;  1A3T A;  4FF3 A;  1Q1B A;  4RCO A;  2IX1 A;  4H13 C;  1I6V C;  3D6C A;  4MIU A;  4IUR A;  1PFB A;  1SND A;  3I4M B;  1OXX K;  1WTR A;  1LTS D;  1I6H B;  3I90 A;  4XXE A;  2EYL A;  4LAA A;  4C3H G;  5D3D A;  2D2C C;  2CW0 C;  1RD9 D;  4XQJ A;  3FDT A;  2JP1 A;  2WKD A;  1IL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...