1SAPA

Hyperthermophile protein, relaxation matrix refinement structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVWRVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAC7D
publication title Solution structure of the DNA-binding protein Sac7d from the hyperthermophile Sulfolobus acidocaldarius.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1995-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sapA00
4MHEA 5CORA 2KUMA 1BF4A 2N55A 1HUNA 1NR4A 1E0BA 3N52A 1CA6A 2N88A 1U4MA 1NR2A 4IUTA 5E4XA 2HUGA 5CBEE 4IURA 1WTQA 1G2SA 1MSGA 1WD1A 1RHPA 1EIGA 2B2WA 1B50A 1WTPA 2XIWA 2K28A 3QO2A 5COYA 2HDLA 3IL8A 1QG7A 4HAEA 2DY7A 1WTRA 1EOTA 2FFKB 3I90A 4R9WA 2FHTA 4IUVA 1NAPA 2EPBA 1VMCA 2D9UA 2KOLA 5EPKA 1DOKA 1F9RA 3KBXA 2IL8A 4HEDA 2HCCA 2HDMA 3H91A 3I3CA 4ZK9B 1X32A 4OIKA 1WVLA 1TVXA 1O7YA 1B4OA 1WTVA 1IL8A 2HCIA 2KEDA 3UI2A 4QUCA 5T1IA 1LV9A 1PLFA 3I91A 1B53A 1HUMA 2L4NA 5D14A 1WTXA 5EQ0A 4DN4M 4HCSA 4LMQD 2MPMA 4RAUC 2RVLA 1XX8A 2H1EA 2B2VC 1U4RA 1X3PA 4ZAIA 3P7JA 2EE1A 2CVRA 1G91A 5CMDA 2MGSA 1CM9A 1BBXC 1PFBA 2X6GA 4CJ1B 4ZKBB 1JE4A 1F2LA 1X3QA 2B2TC 1AZPA 1BNZA 2X69A 1EIHA 5CBAE 2BDNA 3HP3A 1U4LA 2Q8RE 1QNKA 1O7ZA 1PFNA 5EPJA 2B2YC 1ILQA 3MWYW 2JP1A 4IUUA 5JJZA 1GUWA 3FPUB 4O42A 2MP1A 2Q8TA 2FINB 3IFDA 4ZLTF 2FJ2A 1JICA 5EKIA 1ZXTA 1ESRA 3LWEA 1F9SA 4U68A 1B3AA 4XT1B 1U4PA 1VMPA 2RSOA 5D65A 1EL0A 1F9PA 4X3SA 2EOTA 1DOMA 1WTWA 1MGSA 1IKMA 2KVMA 1F9QA 1B2TA 1DZ1A 4R8IA 2X6LA 1BO0A 4CJ2C 4XT3B 4IUPA 3MTSA 1HA6A 1A15A 1QE6A 3DEPA 2NYZD 2RA4A 5E4WC 5EJWA 3TZDA 3D6WA 3GV3A 2FMMA 3GV6A 4NW2A 1MSHA 1O80A 1DOLA 2DY8A 2VXWA 2B2UC 5AFWA 1KNEA 2B2VA 2L1BA 1ILPA 1RTNA 1G6ZA 2SDFA 2KEEA 1IKLA 4IUQA 1G2TA 3DM1A 1HHVA 1HFGA 2K03A 1HFNA 1SDFA 1RTOA 4X3UA 3Q6SA 2NWGA 1KNAA 1NCVA 2B2TA 2K04A 3ONAB 2K05A 4HSVA 1RJTA 1C8CA 1SAPA 2MJ8A 2K1BA 1XYIA 2RSNA 1WD0A 1CA5A 2J7ZA 2M2LA 2B2WC 1HRJA 4XDXA 2B2YA 2K01A 2L11A 1PFMA 4X3KA 4CJ0B 4RA8A 5DNFA 1MI2A 3F2UA 2R3ZA 1J8IA 3R93A 1ML0D 4RWSC 4UAIA 1RODA 2JYOA 5T1GA 4QUFA 4MN3A 4X3TA 1AZQA 3DEOA 1S4ZA 3FDTA 1EQTA 1J9OA 5EPLA 1AP0A 2L12A 3G7LA 1M8AA 4ZKCB 2L9HA 3KUPA 1WTOA 1DONA 1ICWA 4OIJA 1PDQA 1SSOA 2KECA 2NZ1D 2B2UA 3TN2A 3I8ZA 3SVMA 1Q3LA
chains in the Genus database with same CATH superfamily
3PF5A 4DV3L 1K28A 1VQ5A 1BF4A 1V1QA 2NVTH 4K2LA 1BCPD 3C1FA 4EQPA 3PIO3 1B9NA 1IYVA 3BJUA 4DV1Q 2LXKA 1Y1VH 1YJ9A 4V190 1CQVA 3QO2A 1WTRA 1TWHB 5M5XH 2NVQB 3KBXA 4C3IG 3HOYH 4DR4L 2XRQD 4NB3A 1I3QB 1I94L 4C1NK 3NWTA 4A3MH 1PH9A 1B4OA 1TWAH 2XTIA 1YZ6A 4MZ9A 2ZJQA 2IX1A 1G51A 3EVQA 4C3JG 1JOOA 1JWSD 3RMHA 5LMUQ 4A3FB 2MPMA 3NSWA 3T56B 3P75A 1X3PA 1Y8OB 3I4NB 4GN5A 1CM9A 1EYAA 4A4IA 1PFBA 4DAPA 3JAMc 1KAAA 2Z0SA 5DM63 2E2HH 3HP3A 4K6LA 4A3KG 2ICEC 2Z6KC 1Y14B 1O7ZA 3ER0A 1TWFH 4IPHA 5FJ8G 5C3EH 2KHSA 2PW7A 3KF8B 4G7OC 1F9SA 2EJGC 4GLAC 3S16B 3BS1A 4P2CB 4A93H 1MGSA 1DZ1A 2KBNA 1SNQA 3RLNA 1YJNA 5E4WC 1K3RA 5CV9A 3DHQA 1C4QA 1O80A 4LK1C 3HOWG 1K8MA 5JVH3 3I56A 2I5LX 1F77A 3J81j 1Z7TA 1HFGA 3DWAA 3CCJA 2TMPA 1X6OA 1SDFA 2NUCA 1NCVA 1QZGA 5E3FA 4OO1H 3ONAB 2PO4A 2K05A 2BE5D 4A3EH 1RL2A 1Q90A 2O4XA 3Q8DA 3IRBA 2IY5B 4XDXA 1DJRD 1VQHA 1CSQA 4X3KA 1SE4A 4L63B 1VQBA 3H3VC 2VB3X 3BVZA 4Z9CB 2OTJA 3BDCA 1NJIC 3MC0B 1SR3A 5ELNA 1HNXL 3FDTA 2F0MA 2BCOA 3TREA 3WWVA 3ULJA 2JA8B 1QWYA 4OIJA 2KQ3A 1K9MC 2KECA 2NZ1D 1ZYRD 4DR7Q 4X66L 3L2PA 4MHEA 2I5MX 3C3LA 4IN3A 1FNUA 1E0BA 1NR4A 2QW7A 3UE1A 1KLGD 2R7FA 3GTQH 2SNMA 4DR1Q 4DNTB 2Z8LA 2K28A 5COYA 4C2MB 3J81c 3AYHB 1EOTA 3LWUA 1U9RA 3PSIA 2RCFA 3D3RA 2WKDA 3FRPB 5E7NA 1PTOF 4DAVA 2F0IA 2HCCA 2CWAA 3A55A 4NPSA 1L1OB 3P20A 2KCNA 4YCUA 5KNBA 1SNPA 3OHXC 5IYCG 1EZ8A 3K7AH 4K6DA 5J3BA 3V05A 2DNEA 3CAMA 1JQYD 4GNXC 1RKNA 2WKCA 2B63G 3T1YQ 3P7JA 4JI7Q 2WAQB 3R8BA 5H1SE 1AN8A 2K5QA 4ZKBB 1EEID 1CUKA 1BNZA 3M4OH 4GN4B 1OTCA 3A8IE 2PZTA 2EY2A 3G4SA 1PFNA 5LMNL 3KDFA 3RR5A 4ZLTF 2FJ2A 1TY0A 5IOCA 3H3VH 4L6TB 5ELEA 1XJVA 2AQ1B 1I4GA 4OGQC 4QL5A 1NTGA 4NXNL 1EY8A 5CV5A 1XNQQ 5IGBA 2PI2A 4L5TA 2NVXB 2A19A 4CKCA 1LYLA 2K32A 1YHQA 3P1HA 4B3SL 2JA7B 1MJEA 4F7XA 1TWGB 2JEBI 3VYUA 1SMYC 2VL6A 4GKKQ 3HOVB 4B9WA 1K8AC 1PH5A 1HRJA 4L5RC 1TWHH 2MUYA 2NVQH 2JXMB 1MIUA 2K01A 3MHBA 3CCEA 1N34Q 4NMZA 3UDIA 1I3QH 4DV5Q 3M4PA 2FMCA 1RODA 4JBWA 4X3TA 3DEOA 3S15H 1A3TA 2Y0SG 3SR1A 3HKZG 2L12A 4FXKC 3KUPA 3ZJYC 1JOQA 4KHVA 3GTLB 4JI4L 2CH4W 3I4NH 3CXCA 2E8GA 2F4VL 3F1ZA 3QIAA 3TS2A 3EJIA 3U9SA 5M3FB 4B08A 1SRUA 3AEVA 2DUDA 4PV1C 3CD6A 2PCFB 3GTGB 1LTAD 4JVZA 1HZAA 4C3HB 2D0PA 4EQNA 4L5QA 3S16H 1UEBA 2EPBA 2KCTA 4X62Q 2IL8A 1L1OC 2NVYB 3HOUG 1RCVD 4AQYQ 3I3CA 4DU9A 3WOFA 1NE3A 4DV1L 4QCLA 5JPMC 3KLSX 1JJ2A 4YWKA 3S2HB 3I91A 3OMCA 3CPFA 1VQ4A 4RAUC 4KD4A 2F0KA 1TWCH 3HKSA 1XPUA 1F2LA 1K73C 4H0LC 1AW7A 4GOPC 2K5VA 3VYRA 2F0PA 2ZXRA 4P74A 1X55A 2B2YC 5EPJA 1S5FD 1V9PA 4LAAA 3N6RA 2YYZA 3LWEA 4J6HA 4FF1A 1IBKQ 3S14H 2L0CA 2EOTA 3NTIA 4MTNA 2JA8H 3OW2A 1F9QA 5TSSA 1O7LA 5BN3A 3D6WA 3KYHC 3J7ZC 4NW2A 1MSHA 5M3MG 4OWWB 1PH3A 4IFDJ 1VQLA 1EIFA 2J0TD 4N8FA 2IWHA 2MNAA 1B7YB 2JK8A 3VR4A 4C2MH 1A3VA 3TZUA 4HIOA 1NNXA 2N8NA 1ENAA 1TR5A 4CJ0B 4EVOA 1V43A 3HG9A 2R3ZA 3H94A 2EYJA 3CCSA 3DWPA 3DXJC 5LMNW 3U50C 1B3QA 4OWTB 3SK5A 3NTKA 4E6IA 1HNWQ 1I50B 3L7ZC 4BXXH 1T5EA 2ALYB 4PMWA 3RUZA 2Q2IA 4J8QA 1CA6A 4C3JB 1U4MA 3CQZB 1CKOA 2WB1E 5M5WH 4S3SA 5E4XA 5CC4A 2ZXOA 5LHY1 4LF8L 4BS9A 3VA5A 1JWUD 1EIGA 2NN6H 4DV3Q 1LM0A 3VDYA 3AFQA 4DR7L 4N9PA 2K4KA 5IP7G 1H9SB 3KDFB 2ZT9C 5I4DA 4DUYL 1GO3E 4ZK9B 1X32A 2NVXH 5L37A 2E2JB 1AFPA 1H95A 1V1OA 4TQUS 1WTVA 1CHQD 4DR1L 1M1KC 2KEDA 1RIPA 5JEAH 4DK6C 5HY6A 1LV9A 4CDCC 3U58A 1LO5D 2JA7H 4DR4Q 1EYDA 1TWGH 4JPBW 1HQMC 1I4QA 5C0XG 3HOVH 3X3NA 2X6GA 2MO1A 2DJFC 3HOWB 4KLKA 2UXCL 1KDAA 1D8LA 1SNMA 4KY7A 3TP8A 5IP9G 2F0GA 3MXNA 4Y52H 4JI7L 1U4PA 1VMPA 1FYCA 2OF1A 2SNSA 3CCVA 2C5CA 3PUYA 2G5DA 2ZTDA 2A6EC 5GAHC 2PW5A 1VQIA 2X6LA 5C5MA 3L0OA 3GTLH 4B3TQ 3CCQA 1LT4D 5D3IB 3OTOL 1KNEA 4RKLA 5HGQA 3KOJA 5M3FH 4K8IA 3NQIA 3RN5A 3GTGH 1K0RA 3GDEA 1XNQL 5C44G 4QMGA 4C3HH 4YWLA 2J7ZA 1STYA 1TKWB 5CV8A 5A2QL 2LKVA 2OQ0A 3KF6B 2F0UA 2K52A 2NVYH 1SE8A 1S40A 1E1TA 5IGCA 5M9OA 5DM73 2K5NA 4GKKL 1STGA 3S2HH 1K8OA 2GVBA 3GP7A 2EYFA 4QIWB 1KQSA 4IPCA 1YHBA 1N34L 1D1KA 2XVSA 4DFAA 4BY7G 4DV5L 2N55A 3W3AA 1LLRD 1KDBA 1S5BD 4ILWA 2HQEA 4XYQA 2HD3A 5C3EB 5K36G 2CQOA 3RZOH 5KIXA 4IFDH 1TIID 4IUVA 1EYCA 1R9TB 1L0YB 1VMCA 1L0XB 3URYA 3NP8A 4HEDA 2F52A 3FEWX 3FP9A 1EQVA 3C2PA 1LT3D 1C48A 3K57A 3ULPA 1KL9A 3TEHB 1JJCB 5J22A 2XGTA 1YNJD 3J7A5 4K14A 4X62L 4LNQA 1MJCA 3WOEA 1A6XA 4POFA 1LTID 5IT9L 4AQYL 2HHHL 3Q24A 1Y69U 1AZPA 5A2QE 3S17B 2EXZA 2H4OA 2MQHA 4FXGC 4YWMA 1LTRD 3QWNA 4JI5L 2F0VA 3MFGA 4JBJA 4DAYB 2EIFA 3JAMi 1W2BA 1UE1A 3J7AV 2Q8TA 5M5YH 2QEJC 1I6VC 5JOBA 3NQTA 5G3LF 4KMUC 5D65A 1MKHA 4ULLA 1I50H 1WTWA 1IKMA 5LMNQ 5A35A 2NTTA 4CJ2C 2F0QA 3OSOA 1LTLA 4DF7A 5C4JB 3K0YA 4HJ8A 1TY2A 2Q2UA 1XPRA 5AFWA 1LABA 3T53B 2Y0SB 4C3JH 2SDFA 5IYBH 4JI2L 1UNSA 3CQZH 1G2TA 4AYBB 1IBKL 3RZDB 4OHJA 1KTKA 3Q0AA 1WD0A 4A3GB 2GVAA 2WV6D 5IYDG 1DM0B 2L11A 1HCZA 3FMCA 2V1CC 5EKLA 2HT1A 3D0FA 5FJ8H 3I2ZA 4DUZL 2E2JH 4FDBA 2CH4A 1BOSA 1JR0D 1SYEA 1IHZA 1J9OA 2R7ZG 5ELBA 2ID0A 1QNUA 1CZGA 1ENCA 2Q2TA 4PG3A 3ULLA 5IT9E 1PH4A 3CRLC 1LACA 3T51B 1DCZA 3HOWH 2R92G 2VQFQ 4TKOB 2K33A 3QJYA 2PQEA 2NB0A 2RQXA 4RG1A 4HIMA 4MTKA 3KJPA 1XXGA 1XPOA 2F4VQ 2HDLA 4J15A 1HXYD 4HMJA 3JAML 4BBRB 3OPOA 1Q8KA 5GAGC 2FHTA 2L5TA 3NHHA 3EBEA 4DV7L 1VQ6A 1DOKA 3A8JE 2SOBA 3MXNB 2HDMA 4P71A 2ZTEA 1B9MA 3D4WA 3MA2B 4YIJA 1BKBA 4LUOA 1CZWA 1ESFA 2AMCB 3VA7A 4JBMA 1XX8A 4KHPL 3JC66 3OWFA 3STBC 1XWEA 1PZID 2CVRA 4PMCA 5CMDA 4CJ1B 4CBVA 5C6AA 2F0SA 3CP0A 1SNDA 2JP1A 2NZHA 2UXBQ 3RN2A 5EKIA 1ZXTA 1ESRA 1QCBD 1H9JA 3S15B 3SDZA 2F4IA 1EL0A 1GUSA 2UUAL 4DPGA 2KVMA 3D6CA 2R6GA 4AH6A 2AKWB 4U673 3DEPA 2NYZD 1TS5A 2FMMA 4GZYC 1DOLA 1A62A 2B29A 2DY8A 4N9TA 4GNXB 1LTSD 2CW0C 2L1BA 3HZXA 2WB1G 3S1QB 3M9BA 2K04A 3BDOA 2B63H 3JAME 3FPPA 4B3TL 1BBWA 3HOZG 3NTHA 4LF6L 4G7HC 1R9TH 4HMIA 2F0NA 4XYOA 5DNFA 1YVCA 1KLUD 3R93A 4RWSC 5EGTA 3T1HQ 1I6HB 3J81L 2KCCA 4Y7NH 3CW2C 2MHVA 3CMEA 1YHAA 5EPLA 1EWCA 1P16A 4DXGA 4OX9Q 2EJMA 4A75A 4DXFA 3VYTA 1TWCB 1JJGA 1Q3LA 1LT5D 1VQFA 3I4MB 3S17H 2EXDA 2D2CC 3H0GG 5JPNC 4IURA 1VS0A 1EY5A 2N3SA 2DY7A 2FFKB 3CMAA 2UUCQ 1H9KA 1SEBD 1NAPA 3S14B 1PVOA 4LF8Q 3NBHA 3R2TA 4R4TA 2BH2A 2D0OA 1U0LA 3J7AF 2MFIA 4LF9L 4RMFA 5C4JH 4WFN3 1PTOB 5ELDA 1D5ZC 3UI2A 3K8AA 4DN4M 4DUYQ 1PYSB 5C5LA 5C0XJ 1T9HA 3RZDH 3S1RH 1ICFB 4CDFC 1AE3A 4A3GH 1JE4A 3VR2A 3GD7A 2ICIA 3EN2A 1SYBA 3CC2A 1SYFA 1ILQA 4P73A 1CFMA 2DN8A 1VF5C 2MP1A 4RHSA 1CHPD 1VQ7A 4CKEA 4XT1B 2OTLA 4DV2L 2K5WA 2DGYA 1HH2P 3I55A 2UXCQ 2AHOB 1YBYA 4A3MG 2FXQA 1HA6A 1SMXA 1D2BA 3BZCA 2QDBA 1QVGA 4A3IG 5EBCA 4KY5A 1SE2A 3PMFA 3TP7A 3KJOA 1PV4A 3GTJB 4DR6Q 4RKBA 1PA6A 3HS0C 1IYJB 2KEEA 4ABNA 3DM1A 5M5WB 3BYTB 4GOPB 3TQYA 4DK3C 5LL6X 4QB4A 3OTOQ 1VQ8A 1RJTA 3BU2A 1BCPF 2M2LA 4BBRH 4BY7B 5I9PA 3CC7A 4ZCKA 4BY1G 4DA2A 2K50A 4EGVA 4R4OA 3FVQA 2SEBD 2JJQA 4RA8A 1STEA 3K80C 1ML0D 4QF4A 1L2FA 3MFYA 1PH7A 4RGNA 3PO3G 4IZ8A 4MN3A 4HN7A 2A8VA 5JJIA 3BVMA 4A93G 4A3LG 5I2XA 3GTPH 1F2YA 1KD1C 1PXUA 2A69C 2LSSA 3TP5A 3NWSA 1E22A 1PH2A 2L55A 5M3MH 4HJ9A 4DV0Q 2F0WA 4IUTA 3OOCA 4A3EG 1NSNS 2B8FA 1BVSA 2QA4A 1SJHD 1QG7A 3IL8A 3I90A 2VB2X 5EAYA 2K75A 2KOLA 2EY5A 1UAPA 1C9OA 1JWMD 2VQFL 4DR2L 1PTOC 2R93B 4A3BG 4H7BA 1VQDA 1S72A 4K2KA 2QCPX 1F2ZA 1K83B 2EYLA 2L4NA 3W2DA 4LMQD 2PZWA 2F0DA 2E5LL 1VCIA 4I7AA 1D7QA 4KKUA 1HZCA 1A0IA 2VZAA 3MEFA 3S1NB 3S1QH 1M4VA 4IQZA 1I4XA 1UUPA 4FYDA 4H02A 2F3VA 1HPCA 2VY3A 4WORA 2N78A 5FO9B 1CKMA 3K5NA 1HTLD 3FPUB 4DR5L 2HHHQ 2ZJPA 1FGUA 1EFID 3F2CA 1I6HH 4K5VA 1IW7C 1BCPC 5GROA 5NUCA 4JI5Q 1IYUA 5IP7H 3E9IA 2JQOA 2PMZE 1QOHA 4XQQA 4JI3Q 1UE6A 3E9HA 3OW7A 1QE6A 2RA4A 1G291 3TS0A 3D4RA 1VQAA 1OXSC 2ES2A 4WJWA 5CV7A 2LS01 3I4MH 2UXBL 1EQRA 2PYKA 3MZ5A 4IUQA 1S3OA 5E1FA 1X3GA 3KLSA 3Q6SA 2NWGA 3SK4A 4WJ3M 1D1IA 2B2TA 4R8NA 5C0XH 1EUJA 1C8CA 4YHHQ 2UUBQ 1SROA 4ZRZA 3RZOB 2CQAA 1N8RC 3SE0A 1YIJA 4XXEA 4JI2Q 3M85A 2C9OA 5DAUA 4PZ6A 1WCMG 2IW3A 1MI2A 2OCEA 1KDCA 4H13C 5IP9H 1PTOH 3I70A 5FO8B 2A6HC 5C4XB 2CHBD 4JI6Q 3NXWA 4B9XA 4HTHA 2K5HA 4DUZQ 3NELA 2PQAA 2B3GA 2QILA 3EFXD 3FKIG 4IO9A 3T1HL 3T16A 1HZBA 2EYOA 2EYHA 1NR2A 4OX9L 2EY6A 4A3DG 1PRTF 4DNIA 5CBEE 5J1ZA 3MXPA 5M5YB 3E6ZX 2A73B 5DLQE 5K5PA 2KJXA 1Q46A 3KK7A 3PV0A 2D9UA 3OIPA 5J39A 3QB3A 3PCOB 3H91A 3BDLA 4C3IB 3QOLA 4ME5A 4LUZA 4DV6L 3HOXG 3J80c 1EOVA 4KV6A 1K0SA 3EA6A 4O0AA 3GTJH 5CGKA 4DV7Q 4HJ7A 1B53A 1CKNA 4A3FG 1I4HA 3LGJA 4OL7A 4HCSA 5JVG3 3MAQA 2UUCL 3KFUA 2E74C 3OIQA 1ZKOA 2F0LA 4CGYB 3DLLA 1Y8NB 4BY7H 1FVIA 2KENA 5CBAE 2BDNA 4JW0A 2HQLA 4ME3A 4KHPQ 3UE0A 4A3KB 2WINB 1X56A 3K59A 2BDOA 3DWQA 4QY7A 2OEOA 5LL6S 1B70B 5K36H 1X3FA 1QZHA 4K5XA 4R4QA 1B3AA 4M8AA 1Q12A 4KTAA 3CPWA 3HOZB 2BOSA 4IJHA 1LTTD 1B2TA 1MD2D 3STBD 1A15A 1GD7A 3K81C 2RBMA 4V0BA 4A3JG 5FKAC 4JI8Q 3AU7A 2UUAQ 4ALPA 1V1PA 2B8GA 2JEAI 2XWBB 1OO9B 2IX0A 3LX0A 1SAPA 3AMUA 2RSNA 1J6QA 1SYDA 4NXMQ 4JOIA 5I9OA 4XQJA 1EU3A 4B3RQ 4DR6L 5JJKA 2EYMA 1PRTC 2JA9A 3H0GB 2R93H 1I4PA 4UAIA 1CT1D 1DD2A 2ASBA 3VR3A 1AZQA 5BR8Q 1S4ZA 4LF6Q 4OO1I 1K83H 4KJNA 1FJGL 2Z6BA 4WRDA 2JA8G 1AP0A 3MEHA 3G7LA 4BWGB 2A74C 5AJ3Q 1PYWD 2A68C 3TP6A 1SFOH 3S1NH 5ISRA 3OMGA 2LXJA 3TMEA 1BUVT 2KUMA 1HUNA 2N88A 1SNCA 4KKSA 2ZTCA 5FO7B 3F2BA 1JMCA 5ELFA 2HIVA 2XN9C 1YI2A 1G2SA 4A3CG 1B50A 1T5XD 4HAEA 2GA4B 5IGEA 4RH6A 3CCLA 4G4KA 2IPKD 2WFWA 4PNYA 4PZ7A 1E2VA 4DV0L 1O7YA 3AFPA 1VQCA 2LFNA 2R7DA 4QIWE 4R1JA 5CV4A 4F87A 3VYSA 3ITPA 4QJFA 5BN5A 2WIIB 1JE5A 4MNOA 5FLXc 4LF9Q 2BH8A 4ZAIA 1EY4A 3SK8A 2B63B 1Q8IA 4A3IB 3EQLC 1N9WA 1FL0A 4DKAC 1KAWA 2R92H 3I4LA 1TU2B 3H6MA 2NN6G 1WFQA 2A1AA 3GTOB 3PO2G 3TSSA 1A63A 3KF8A 1GUOA 4IUNA 4Y7NB 4XTCS 1STNA 5C4XH 5F2DA 3A56A 2JSOA 2EY1A 1GHJA 5IIFA 4KN4C 3H09A 1BO0A 5FLMH 4XT3B 1NUCA 3MTSA 3OWEB 1O7IA 4EQOA 5JEAG 5KNDA 4DV2Q 2DJGC 2JA6G 3A74A 4ZUIA 1WJJA 3PO3B 4RCOA 3CHBD 3H3VI 3T4AC 5KNCA 1F2MA 3G48A 1VQNA 3D31A 2K03A 2IJ0A 4BBSG 1RTOA 1GUTA 4JI3L 3W1GA 1PFSA 1DYQA 2IHEA 1KIXA 4CDEC 1PH8A 1ONLA 2Q8IB 2BA0A 1JOKA 2D5DA 4C3IH 2M9VA 2TSSA 3HGBA 2Z4HA 1OXTA 1E24A 4J1MA 2OT2A 4MIUA 2F0EA 3S1MB 4FNFA 5FOBB 4FF3A 2UUBL 4YHHL 4YY3Q 3ERQA 3A5UA 2L9HA 3UDFA 3HKZB 4ZYSA 1ICWA 5EBDA 3M7GA 1PDQA 1SSOA 3HFZB 3S1RB 4A3BB 1KHIA 4FO2A 1CKNB 2Y0SE 3CCRA 3V96A 4AYBE 5KEEA 5M3FG 4IPDA 1UE5A 1KABA 2Q2HA 1EZ6A 3K6OA 4EX5A 1PZJD 2HUGA 4A3KH 4JI6L 3KLWA 1WD1A 4C3HG 1RHPA 2B2WA 2O5IC 2HIXA 3WDNA 1PHJA 3EIVA 1Q1BA 3SK6A 3ND8A 4AIMA 1YNNC 1HNZQ 3HOZH 4KHZA 1JT8A 2UU9Q 5GAEC 2JA5G 2ZM6Q 4HCEA 1SMYD 3HOUB 4KD3A 1ENFA 4BA1I 2A69D 5KRUA 1N36L 3L9AX 1IZ6A 4UP9A 1YNXA 5D14A 1GHKA 2CWPA 2KHIA 1X54A 5CR3A 4DR2Q 1VQMA 1II3A 2RVLA 3EROA 2H1EA 4B3MQ 1U4RA 1SNOA 4KY6A 1LUZA 5IT9c 2GN5A 1RF2D 1R4QB 5JJLA 2B2TC 2E5LQ 1XMOQ 1FD7D 3V2TA 4M1UB 1HQRD 1PTOD 3A7AB 3H0GH 3J81i 2RF4A 2PZUA 1PH6A 4U68A 4K5WA 1JC7A 3MXUA 1F9PA 4YCVA 2BA1A 4JCVE 1I5FA 4DR5Q 4TVAB 3GTPB 1WCMB 2AUJD 1ASZA 3MVVA 5EJWA 3GV3A 4OWXB 3AQQA 2V4DA 4YCWA 2VUMG 3PF4A 1O78A 1ILPA 1HHVA 1CTMA 1IKLA 2K14A 5M3MB 1XMQQ 4UP8A 1Q7YC 1Q81C 1QUQA 2YU9B 1JCKB 5C4ZA 1D6EC 3C1EA 4F88A 2YTXA 1CA5A 1EY7A 1IW7D 2Z4IA 3FKIB 4IPGA 1OXUA 3Q23A 2RDGA 4JYAQ 4JI8L 4A3DB 4JI0Q 1KXLA 3CF5A 2NBFA 5T1GA 4JK1C 1EQTA 3BVGA 1SJED 3CCUA 2PNHA 1PZKD 4ZUJA 5IYCH 1WTOA 4NXML 3CRKC 4B3RL 3TN2A 3I8ZA 3SEBA 1X9NA 2RCNA 2XNAC 3HOXB 5CORA 4A3IH 4C56C 4L5SA 1E2WA 5IYBG 4WJ4A 2XRSD 2AWOA 5IE8A 5BR8L 3GTKB 4JI1L 1A2TA 2MO0A 4FP5D 4KN7C 1WTHA 3GTOH 2AWNA 1TQOA 5AJ3L 1WTPA 2NZOA 1XNRQ 2F1MA 5I6WA 1TS4A 2A6HD 4BY1H 5EPKA 4ID6A 4JV5Q 1BQQT 2G9DA 5KYIA 5GADC 1CK1A 1WVLA 1HR0W 2HCIA 3PO3H 1B1ZA 1YEZA 2NN6I 4KJOA 3ERSX 2P5ZX 4A3LH 2CCZA 1B44D 4DV6Q 3R2IA 2R61A 1S5DD 2CKZB 2EE1A 2B39A 4POGA 1A2UA 2MGSA 3TDQA 4UPAA 4HIDA 4IALA 4LWCA 5GQOA 3KLRA 2X69A 4A3JB 4RFBA 2RDHA 5JJZA 4JOIC 3KBGA 1KC8C 1N32L 1Y1WG 1GUWA 3PQIA 1HJPA 1STBA 3S2DB 2OQKA 2VQEQ 2F0FA 1X3EA 3S1MH 1QB5D 1SXTA 2WACA 5IWAL 1G6PA 4A3BH 4X64L 2EZVA 1EWHA 1STAA 3Q22A 1K3BC 2F0JA 1RTNA 3E0EA 3QR8A 1UEAB 4QQBX 1Y1VG 5I2YA 5C3WA 4UY8C 2G9HD 4X3UA 3L3OC 1AEXA 1SBBB 3J81E 5I6YA 1STHA 5C44B 1GXDC 5ELCA 5HURA 3HOYG 1W6KA 1YNJC 1BCPB 1TXYA 1J8IA 2IT1A 3HOUH 4QUFA 3U4ZA 1E7ZA 4RGOS 3BZKA 1EEFD 1NBWA 3A5ZB 3IFTA 1EYGA 2WAQE 3E5SA 4P75A 2B2UA 3UDGA 3NPPA 1HTPA 1FJGQ 4UDUC 4A76A 4X65L 3NUCA 1C0AA 3N52A 5IODA 2YTVA 2ZJRA 4YY3L 4OXPA 1PRTD 2A6ED 1E1OA 3E0JA 4XIGS 5C3EG 4F8MA 4UP7A 5IGGA 3CKIB 3GO5A 3B6YA 2F3WA 3GTMB 4ODGA 2EJFC 2RDFA 4IOAA 1IBLQ 1H9SA 4LFAQ 2A68D 1WCMH 1ZEQX 3D4DA 1FR3A 3M3YB 3PO2B 3M4YA 3NENA 1Q86C 4DK0A 5D3DA 1HUMA 4BA2I 5ELOA 5IGFA 3J80i 4IFDI 1SYGA 2DNCA 1HNZL 2YU9H 1SN8A 2D62A 4C1NI 4OO1G 3I72A 2UU9L 1G91A 4LF4Q 4IJLA 1S5CD 4HIKA 2ZXPA 2ZM6L 2JA6B 1N33Q 3VR5A 3W5OA 1EIHA 1QUQB 3FKIH 3CU7A 4KKTA 4GLXA 2EQSA 1CI3M 4A3DH 2RHQB 4BBSB 4K0KQ 1G8ZD 1GOZA 4B3ML 1S5ED 1IBML 5DEHA 3PUZA 1PH1A 5JEAJ 3K7UC 3F2DA 1XMOL 3IAYA 4IUPA 1HZ9A 2JN4A 1SFOB 4LF5Q 1Q82C 1J5EL 1EU4A 2IHFA 3HOXH 3AB9A 1WOCA 1EY9A 1Q1EA 3U9OA 4LFBQ 1TS2A 3M4QA 2VNUD 2B2VA 4AYBG 4A3FH 3GTKH 1FGBD 4RHRA 2VS1A 3GQBA 1VQJA 4A3GG 1XYIA 4LW1A 2VW9A 2B2WC 3K5OA 2E76C 1E3PA 3KF6A 4DNRB 5KYLA 1XMQL 2L15A 4UHVA 2JYOA 2WP8J 4KK7A 1SLJA 2H5XA 2RHSB 4FXDA 1BBUA 1HR0Q 1M8AA 4ZKCB 1DONA 2R7ZB 1E2ZA 4NDXA 1U5KA 2PMZB 2O5JC 2JA5B 1GUGA 3J80L 4JYAL 1FNWA 4JI0L 3PUXA 4A3JH 3BZDB 2R92B 1NY4A 3RLFA 5IY0A 4I7ZC 3G6EA 1WTQA 4LUVA 1MSGA 3W1BA 4PMBA 4BBRG 2XIWA 3S2DH 2E2DC 1PYBA 1C7YA 1PRTB 4R9WA 1AE2A 3NBHB 3HRZC 1F9RA 2UXDQ 4TRDA 1QJOA 5LMUL 1EQQA 2YV5A 1H9RA 3A54A 1XTCD 4OIKA 4NKLA 1TVXA 1QVFA 1QVCA 5KGUA 2N49A 1IL8A 3CC4A 4DK1A 2E75C 1XNRL 2AUKA 3I73A 3PIPA 2QEXA 4JV5L 3LNNA 4HR7B 1RDPD 1N36Q 1ET6A 1BBXC 2I0QA 3S9WA 1GUNA 1MBYA 2VUMB 5C44H 4GKJQ 1YNND 3RLOA 1ASYA 1JB3A 2XSCA 4IUUA 5EKKA 4NP5A 4O42A 4DAYA 1HA5A 3BG3A 1DGSA 1VQPA 1NMGA 2BE5C 4A3CH 3SXHA 5IGDA 2Z9HA 2E2IB 4LFCQ 1A8VA 4DGZA 4R4IA 3IKJA 4IOCA 4LF7Q 1RD9D 4ZQ3A 4DV4Q 3J80E 3I4NG 1X65A 2F0TA 3X3MA 2QDLA 3GV6A 1W6JA 3G71A 3HEJA 4K8JA 2VXWA 1SE3A 2VQEL 1EWIA 1UWVA 4DR3Q 2WB1B 1ZYRC 1IL2A 5BN4A 2M00A 3DUZA 3PGZA 4OEMB 3ICEA 3GTMH 2Z6KA 4GLVB 5G3LD 5C3XA 1UE7A 1GKHA 3NEMA 3PUVA 1JORA 3A7LA 3M3YH 3E3XA 3C46A 3PO2H 1IXRA 1R4PB 2PI2E 4CKBA 1GJXA 3RNUA 2AQ2B 3SVMA 3I4MG 5FK9C 5JAVA 2JA6H 3VR6A 2O2LD 1BDOA 1I94Q 1YJWA 3PIP3 1OXVA 5FLXL 4BBSH 2AQ3B 2EYPA 4JI1Q 1TS3A 2C35B 2CW0D 2QF7A 3BYYB 4EQ5A 3R3OA 3TBIB 1I4RA 1Y1WB 3T1YL 2KHJA 2F03A 3K58A 4HSPA 3D8GA 4APVA 4I65A 1WTXA 2LMCB 1P8LA 3PUWA 1IBLL 4Q0FA 3ND9A 4GS3A 3TRZA 1M90C 4LFAL 2CFMA 1X3QA 2NVTB 5CYUA 1JB7A 2EVBA 3K5LA 5IYDH 2Q8RE 1Y1VB 1DXMA 2K5DA 4O1NA 1GM5A 2FINB 1LTBD 1JICA 1B8AA 2OWOA 2RSOA 4LF4L 5M5XB 2RKSA 4X3SA 2JE6I 4G57A 1N33L 1N32Q 3HOYB 2ATWA 2R7ZH 1TT2A 4OELB 4BXXG 2WAQG 3F8TA 3T13A 4A3MB 1LTGD 2JA5H 4FF4A 2KCMA 3ZYYX 1FNVA 1TWAB 3O13A 4GN3B 1VQOA 4K0KL 4R4CA 2B2UC 2EDGA 4RGTA 1G6ZA 4GNXA 5IWAQ 3SGIA 3A0JA 5FLXE 3NE5B 4X64Q 4P72A 1WYDA 1WI5A 1KNAA 1VDZA 3K0XA 1HNXQ 4FVMA 4HSVA 1Z6HA 4LF5L 1LT6D 1V8QA 4RCNA 2E2HB 1K8GA 4BY1B 4LFBL 1KRTA 1TWFB 3QG1A 1VF7A 3F2UA 4X66Q 1W3SA 3DM3A 2K6AA 2JA7G 3M7NA 1NMFA 4A93B 3I7FA 4CDDC 2QKIC 1EFWA 3HOVG 2PQAB 1CQFA 1EIYB 1EY0A 3NK9A 2VUMH 3J7YW 4O2DA 4RGMA 1A3UA 3G6JB 3MXGA 1HR0L 3U4VA 4A3EB 4TSSA 4X65Q 1AH9A 3SHLA 2E2IH 1OXXK 4XQNA 3RD4A 2R93G 2I5HA 2KA7A 3A8KE 1XTDA 1Z47A 4X6AH 2PNRC 2J4XA 4PZ8A 4QUCA 5T1IA 1PLFA 3HKZE 3S24A 2A5HA 1H9MA 1VQEA 3DMUA 1VQGA 2I07B 5EQ0A 3PIOA 2F3IA 4PQXA 1D5XC 2F0OA 1YITA 1PMRA 2B2VC 1CSPA 1D5MC 5HGTA 2UXDL 1GVPA 1MHWC 4NXNQ 2I46A 4DAMA 1U4LA 1Y8PB 2XWJB 1QILA 1QNKA 3FHWA 3GTQB 3K5MA 2LY7A 1BR9A 3MWYW 1L0WA 1Z9FA 2ENBA 4JG2A 3IFDA 4B3SQ 2QGQA 3H15A 1VQ9A 5CV6A 1L1OA 2F0HA 1DOMA 4FF2A 4GKJL 4R8IA 2IX3A 4KI0A 3TZDA 1IBMQ 2YTYA 3K7AB 3UDXA 1V1PB 4LFCL 1ET9A 4Q5VA 1HFNA 1J5EQ 3NBIA 4CHTB 4LF7L 4JBKA 4GOPA 4JC0A 4DV4L 1KRSA 2MJ8A 2K1BA 2PPBC 4IFDG 3CCMA 4L8JA 3M4OB 2B2YA 1PFMA 5C4HA 2K7VA 2OXPA 3OYYA 4JI4Q 1HNWL 4QGUA 4LJZC 1Y1WH 2Z1CA 2NTSA 1BXTA 4DR3L 5C4XG 4G7ZC 1SYCA 4OONA 3QOJA 4H44C 5C0XI 5FLMG 3I4OA 4HJAA 1VQKA 1EY6A 4HJ5A 4N8X1
chains in the Genus database with same CATH topology
1BF4A 4K2LA 1BCPD 3C1FA 4EQPA 3PIO3 1B9NA 1IYVA 4V190 1CQVA 3QO2A 1WTRA 1TWHB 2NVQB 3KBXA 4C3IG 2XRQD 1I3QB 4C1NK 3NWTA 1B4OA 2IX1A 3EVQA 4C3JG 1JOOA 1JWSD 3RMHA 4A3FB 2MPMA 3NSWA 3T56B 3P75A 1X3PA 1Y8OB 3I4NB 1CM9A 1EYAA 1PFBA 4DAPA 1KAAA 5DM63 3HP3A 4K6LA 2ICEC 1O7ZA 2KHSA 2PW7A 4G7OC 1F9SA 2EJGC 3S16B 3BS1A 4P2CB 1MGSA 1DZ1A 1SNQA 5E4WC 5CV9A 3DHQA 1C4QA 1O80A 4LK1C 1K8MA 5JVH3 1F77A 1Z7TA 1HFGA 3DWAA 2TMPA 1SDFA 2NUCA 1NCVA 4OO1H 5E3FA 3ONAB 2PO4A 2K05A 2BE5D 1Q90A 2O4XA 4XDXA 1DJRD 4X3KA 1SE4A 4L63B 3H3VC 2VB3X 3BVZA 4Z9CB 3BDCA 3MC0B 3FDTA 2F0MA 2BCOA 2JA8B 1QWYA 4OIJA 2KQ3A 2KECA 2NZ1D 1ZYRD 4MHEA 3C3LA 4IN3A 1FNUA 1E0BA 1NR4A 1KLGD 2SNMA 4DNTB 2Z8LA 2K28A 5COYA 4C2MB 1EOTA 3LWUA 1U9RA 3D3RA 2WKDA 3FRPB 1PTOF 4DAVA 2F0IA 2HCCA 3A55A 3P20A 2KCNA 5KNBA 1SNPA 3OHXC 1EZ8A 4K6DA 3V05A 2DNEA 1JQYD 1RKNA 2WKCA 3P7JA 2WAQB 3R8BA 1AN8A 2K5QA 4ZKBB 1EEID 1BNZA 3A8IE 2PZTA 2EY2A 1PFNA 4ZLTF 2FJ2A 1TY0A 5IOCA 4L6TB 5ELEA 2AQ1B 1I4GA 4OGQC 1EY8A 5CV5A 5IGBA 2NVXB 4CKCA 2K32A 3P1HA 2JA7B 4F7XA 1TWGB 2JEBI 3VYUA 1SMYC 3HOVB 4B9WA 1HRJA 2MUYA 2JXMB 2K01A 3MHBA 4NMZA 2FMCA 1RODA 4JBWA 4X3TA 3DEOA 1A3TA 3SR1A 2L12A 4FXKC 3KUPA 1JOQA 4KHVA 3GTLB 3QIAA 3EJIA 3U9SA 5M3FB 4B08A 4PV1C 2PCFB 3GTGB 1LTAD 4C3HB 4EQNA 2EPBA 2IL8A 2NVYB 1RCVD 3I3CA 4DU9A 3WOFA 4QCLA 5JPMC 3KLSX 3S2HB 3I91A 3OMCA 4RAUC 4KD4A 2F0KA 1F2LA 4H0LC 1AW7A 3VYRA 2F0PA 2ZXRA 5EPJA 2B2YC 1S5FD 4LAAA 3N6RA 2YYZA 3LWEA 4J6HA 4FF1A 2L0CA 2EOTA 3NTIA 1F9QA 5TSSA 1O7LA 5BN3A 3D6WA 4NW2A 1MSHA 4IFDJ 2J0TD 2IWHA 3VR4A 1A3VA 3TZUA 1ENAA 1TR5A 4CJ0B 4EVOA 1V43A 3HG9A 2R3ZA 3H94A 2EYJA 3DWPA 3DXJC 4E6IA 3SK5A 3NTKA 1I50B 3L7ZC 1T5EA 4PMWA 3RUZA 4J8QA 1CA6A 4C3JB 1U4MA 3CQZB 4S3SA 5E4XA 5CC4A 2ZXOA 5LHY1 4BS9A 3VA5A 1JWUD 1EIGA 2NN6H 4N9PA 1H9SB 2ZT9C 5I4DA 4ZK9B 1X32A 1AFPA 2E2JB 1V1OA 4TQUS 1WTVA 1CHQD 2KEDA 5JEAH 1LV9A 1LO5D 1EYDA 1HQMC 1I4QA 5C0XG 3X3NA 2X6GA 3HOWB 1KDAA 1SNMA 4KY7A 3TP8A 2F0GA 3MXNA 1U4PA 1VMPA 1FYCA 2OF1A 2SNSA 2C5CA 3PUYA 2A6EC 2PW5A 2X6LA 5C5MA 1LT4D 5D3IB 1KNEA 4RKLA 4K8IA 3NQIA 4QMGA 2J7ZA 1STYA 1TKWB 5CV8A 5A2QL 2LKVA 2F0UA 5IGCA 5M9OA 5DM73 1STGA 1K8OA 3GP7A 2EYFA 4QIWB 1D1KA 2XVSA 4DFAA 2N55A 3W3AA 1LLRD 1KDBA 1S5BD 4ILWA 2HQEA 4XYQA 5C3EB 5K36G 5KIXA 4IFDH 1TIID 4IUVA 1EYCA 1R9TB 1L0YB 1VMCA 1L0XB 3URYA 3NP8A 4HEDA 3FEWX 1EQVA 3C2PA 1LT3D 1C48A 3K57A 5J22A 1YNJD 4K14A 3WOEA 1A6XA 1LTID 5IT9L 3Q24A 1Y69U 1AZPA 5A2QE 3S17B 2EXZA 2H4OA 4FXGC 1LTRD 3QWNA 2F0VA 3MFGA 3J7AV 2Q8TA 2QEJC 1I6VC 5JOBA 3NQTA 5G3LF 4KMUC 5D65A 4ULLA 1WTWA 1IKMA 5A35A 2NTTA 4CJ2C 2F0QA 3OSOA 4DF7A 5C4JB 3K0YA 1TY2A 5AFWA 1LABA 3T53B 2Y0SB 2SDFA 1G2TA 1UNSA 4AYBB 3RZDB 4OHJA 1KTKA 3Q0AA 1WD0A 4A3GB 2WV6D 1DM0B 2L11A 1HCZA 3FMCA 5EKLA 1BOSA 1JR0D 1SYEA 1IHZA 1J9OA 5ELBA 2ID0A 1QNUA 1CZGA 1ENCA 5IT9E 3CRLC 1LACA 3T51B 1DCZA 4TKOB 2K33A 3QJYA 2PQEA 2NB0A 2RQXA 1XXGA 2HDLA 1HXYD 4HMJA 3JAML 4BBRB 3OPOA 2FHTA 2L5TA 3NHHA 1DOKA 3A8JE 2SOBA 2HDMA 1B9MA 3D4WA 3MA2B 4YIJA 1CZWA 1ESFA 3VA7A 1XX8A 3OWFA 1XWEA 1PZID 2CVRA 4PMCA 5CMDA 4CJ1B 4CBVA 5C6AA 2F0SA 1SNDA 2JP1A 5EKIA 1ZXTA 1ESRA 1QCBD 1H9JA 3S15B 3SDZA 2F4IA 1EL0A 1GUSA 2KVMA 3D6CA 2R6GA 4U673 3DEPA 2NYZD 1TS5A 2FMMA 4GZYC 1DOLA 2DY8A 4N9TA 1LTSD 2CW0C 2L1BA 3HZXA 3S1QB 2K04A 3BDOA 3JAME 3FPPA 3NTHA 4G7HC 4HMIA 2F0NA 4XYOA 5DNFA 1KLUD 3R93A 4RWSC 5EGTA 1I6HB 3J81L 2KCCA 2MHVA 5EPLA 1EWCA 4DXGA 2EJMA 4DXFA 3VYTA 1TWCB 1Q3LA 1LT5D 3I4MB 2D2CC 5JPNC 4IURA 1EY5A 2DY7A 2FFKB 1H9KA 1SEBD 1NAPA 3S14B 3NBHA 3R2TA 3J7AF 4WFN3 1PTOB 5ELDA 1D5ZC 3UI2A 4DN4M 5C5LA 5C0XJ 1JE4A 3VR2A 3GD7A 2ICIA 1SYBA 1SYFA 1ILQA 1CFMA 2DN8A 1VF5C 2MP1A 4RHSA 1CHPD 4CKEA 4XT1B 2K5WA 1HA6A 1D2BA 2QDBA 5EBCA 4KY5A 1SE2A 3PMFA 3TP7A 3GTJB 4RKBA 3HS0C 2KEEA 4ABNA 3DM1A 5M5WB 3BYTB 5LL6X 4QB4A 1RJTA 1BCPF 2M2LA 4BY7B 5I9PA 4DA2A 4EGVA 3FVQA 2SEBD 4RA8A 1STEA 1ML0D 4QF4A 3MFYA 4RGNA 4IZ8A 4MN3A 4HN7A 3BVMA 5I2XA 1F2YA 1PXUA 2A69C 3TP5A 3NWSA 2L55A 2F0WA 4IUTA 3OOCA 1NSNS 2B8FA 1SJHD 1QG7A 3IL8A 3I90A 2VB2X 2KOLA 2EY5A 1UAPA 1JWMD 1PTOC 2R93B 4H7BA 4K2KA 2QCPX 1F2ZA 1K83B 2EYLA 2L4NA 3W2DA 4LMQD 2PZWA 2F0DA 1VCIA 4KKUA 3S1NB 1M4VA 4IQZA 1I4XA 1UUPA 4FYDA 2F3VA 1HPCA 4WORA 5FO9B 3K5NA 1HTLD 3FPUB 1EFID 4K5VA 1IW7C 1BCPC 5NUCA 1IYUA 4XQQA 1QOHA 3OW7A 1QE6A 2RA4A 1G291 3D4RA 1OXSC 4WJWA 5CV7A 2LS01 2PYKA 3MZ5A 4IUQA 5E1FA 3KLSA 3Q6SA 2NWGA 3SK4A 1D1IA 2B2TA 4R8NA 5C0XH 1C8CA 4ZRZA 3RZOB 2CQAA 3SE0A 4XXEA 3M85A 2C9OA 5DAUA 2IW3A 1MI2A 1KDCA 4H13C 1PTOH 3I70A 5FO8B 2A6HC 5C4XB 2CHBD 3NXWA 4B9XA 4HTHA 2QILA 3EFXD 3T16A 2EYOA 2EYHA 1NR2A 2EY6A 1PRTF 5CBEE 5J1ZA 3MXPA 5M5YB 3E6ZX 2A73B 5K5PA 2KJXA 3KK7A 3PV0A 2D9UA 3OIPA 5J39A 3QB3A 3H91A 3BDLA 4C3IB 3QOLA 4ME5A 4KV6A 3EA6A 5CGKA 1B53A 1I4HA 4OL7A 4HCSA 5JVG3 3MAQA 2E74C 3OIQA 1ZKOA 2F0LA 4CGYB 1Y8NB 5CBAE 2BDNA 4A3KB 2WINB 3K59A 2BDOA 3DWQA 2OEOA 5LL6S 5K36H 4K5XA 1B3AA 4M8AA 1Q12A 4KTAA 3HOZB 2BOSA 1LTTD 1B2TA 1MD2D 1A15A 2RBMA 4V0BA 5FKAC 3AU7A 1V1PA 2B8GA 2JEAI 2XWBB 1OO9B 2IX0A 3LX0A 1SAPA 3AMUA 2RSNA 1SYDA 5I9OA 4XQJA 1EU3A 2EYMA 1PRTC 3H0GB 1I4PA 4UAIA 1CT1D 1DD2A 3VR3A 1AZQA 1S4ZA 4OO1I 4KJNA 4WRDA 1AP0A 3MEHA 3G7LA 4BWGB 2A74C 1PYWD 2A68C 3TP6A 5ISRA 3OMGA 3TMEA 1BUVT 2KUMA 1HUNA 2N88A 1SNCA 4KKSA 5FO7B 5ELFA 2XN9C 1B50A 1G2SA 1T5XD 4HAEA 2GA4B 5IGEA 4RH6A 4G4KA 2IPKD 4PNYA 1E2VA 1O7YA 2LFNA 5CV4A 4F87A 3VYSA 3ITPA 5BN5A 2WIIB 4ZAIA 1EY4A 3SK8A 2B63B 1Q8IA 4A3IB 3EQLC 3I4LA 1TU2B 3H6MA 2NN6G 3GTOB 3TSSA 3KF8A 1GUOA 4IUNA 4Y7NB 4XTCS 1STNA 5F2DA 3A56A 2JSOA 2EY1A 1GHJA 5IIFA 4KN4C 3H09A 1BO0A 4XT3B 1NUCA 3MTSA 3OWEB 4EQOA 5JEAG 5KNDA 4ZUIA 3PO3B 4RCOA 3CHBD 3T4AC 5KNCA 1F2MA 3D31A 2K03A 2IJ0A 1RTOA 1GUTA 1DYQA 1ONLA 2Q8IB 2BA0A 1JOKA 2D5DA 2M9VA 2TSSA 3HGBA 2Z4HA 1OXTA 4J1MA 2OT2A 4MIUA 2F0EA 3S1MB 4FNFA 5FOBB 4FF3A 3ERQA 2L9HA 4ZYSA 3HKZB 1ICWA 5EBDA 3M7GA 1PDQA 1SSOA 3S1RB 4A3BB 4FO2A 3V96A 5KEEA 1KABA 1EZ6A 3K6OA 1PZJD 2HUGA 1WD1A 4C3HG 1RHPA 2B2WA 2O5IC 3WDNA 1Q1BA 3SK6A 3ND8A 1YNNC 4KHZA 4HCEA 1SMYD 3HOUB 4KD3A 1ENFA 4BA1I 2A69D 5KRUA 3L9AX 1GHKA 5D14A 5CR3A 1II3A 2RVLA 3EROA 2H1EA 1U4RA 1SNOA 4KY6A 1RF2D 1R4QB 2B2TC 1FD7D 3V2TA 4M1UB 1HQRD 1PTOD 3A7AB 2PZUA 4U68A 4K5WA 1JC7A 3MXUA 1F9PA 2BA1A 3GTPB 1WCMB 2AUJD 3MVVA 5EJWA 3GV3A 2V4DA 1O78A 1ILPA 1HHVA 1CTMA 1IKLA 5M3MB 2YU9B 1JCKB 5C4ZA 1D6EC 3C1EA 4F88A 1CA5A 1EY7A 1IW7D 2Z4IA 3FKIB 1OXUA 3Q23A 2RDGA 4A3DB 2NBFA 5T1GA 4JK1C 1EQTA 3BVGA 1SJED 1PZKD 4ZUJA 1WTOA 3CRKC 3TN2A 3I8ZA 3SEBA 3HOXB 2XNAC 5CORA 4C56C 1E2WA 2XRSD 2AWOA 3GTKB 1A2TA 4FP5D 4KN7C 2AWNA 1TQOA 1WTPA 2F1MA 5I6WA 1TS4A 2A6HD 5EPKA 4ID6A 1BQQT 2G9DA 5KYIA 1CK1A 1WVLA 2HCIA 1B1ZA 2NN6I 4KJOA 1B44D 3R2IA 2R61A 1S5DD 2EE1A 2B39A 1A2UA 2MGSA 3TDQA 4IALA 3KLRA 2X69A 4A3JB 4RFBA 2RDHA 5JJZA 3KBGA 1GUWA 1STBA 3S2DB 2F0FA 1QB5D 1SXTA 2WACA 2EZVA 1EWHA 1STAA 3Q22A 2F0JA 1RTNA 1UEAB 5I2YA 5C3WA 2G9HD 4X3UA 3L3OC 1AEXA 1SBBB 3J81E 5I6YA 1STHA 5C44B 1GXDC 5ELCA 5HURA 1W6KA 1YNJC 1BCPB 1J8IA 2IT1A 4QUFA 4RGOS 1EEFD 3IFTA 3E5SA 2B2UA 3NPPA 1HTPA 4UDUC 3NUCA 3N52A 5IODA 1PRTD 2A6ED 3E0JA 4XIGS 4F8MA 5IGGA 3CKIB 3GO5A 2F3WA 3GTMB 4ODGA 2EJFC 2RDFA 1H9SA 2A68D 1ZEQX 3D4DA 1FR3A 3M3YB 3PO2B 3M4YA 4DK0A 5D3DA 1HUMA 4BA2I 5IGFA 4IFDI 1SYGA 2DNCA 2D62A 4C1NI 4OO1G 3I72A 1G91A 1S5CD 2ZXPA 2JA6B 3VR5A 1EIHA 3CU7A 4KKTA 1CI3M 4BBSB 1G8ZD 1GOZA 1S5ED 5DEHA 3PUZA 5JEAJ 3IAYA 4IUPA 1SFOB 1EU4A 3AB9A 1EY9A 1Q1EA 3U9OA 1TS2A 2VNUD 2B2VA 1FGBD 4RHRA 3GQBA 1XYIA 2B2WC 3K5OA 2E76C 4DNRB 5KYLA 2JYOA 2WP8J 4KK7A 4FXDA 1M8AA 4ZKCB 1DONA 2R7ZB 1E2ZA 4NDXA 2PMZB 2O5JC 2JA5B 1GUGA 3J80L 1FNWA 3PUXA 3BZDB 2R92B 3RLFA 4I7ZC 1WTQA 1MSGA 4PMBA 2XIWA 2E2DC 1PRTB 4R9WA 3HRZC 1F9RA 4TRDA 1QJOA 3A54A 1H9RA 1XTCD 4OIKA 4NKLA 1TVXA 5KGUA 1IL8A 4DK1A 2E75C 2AUKA 3I73A 3LNNA 4HR7B 1RDPD 1ET6A 1BBXC 3S9WA 1GUNA 1MBYA 2VUMB 1YNND 1JB3A 2XSCA 4IUUA 5EKKA 4NP5A 4O42A 4DAYA 1HA5A 3BG3A 2BE5C 5IGDA 3SXHA 2E2IB 4DGZA 3IKJA 1RD9D 4ZQ3A 3J80E 2F0TA 3X3MA 3GV6A 1W6JA 3HEJA 4K8JA 2VXWA 1SE3A 2WB1B 1ZYRC 5BN4A 2M00A 3DUZA 5G3LD 5C3XA 3PUVA 1JORA 3A7LA 3C46A 1R4PB 4CKBA 1GJXA 2AQ2B 3SVMA 5FK9C 5JAVA 3VR6A 2O2LD 1BDOA 3PIP3 1OXVA 5FLXL 2AQ3B 2EYPA 1TS3A 2CW0D 2QF7A 3BYYB 3R3OA 3TBIB 1I4RA 1Y1WB 2F03A 3K58A 4HSPA 3D8GA 4I65A 1WTXA 2LMCB 3PUWA 4Q0FA 3ND9A 1X3QA 2NVTB 5CYUA 2EVBA 3K5LA 2Q8RE 1Y1VB 1DXMA 2K5DA 4O1NA 2FINB 1LTBD 1JICA 2RSOA 5M5XB 2RKSA 4X3SA 2JE6I 4G57A 3HOYB 1TT2A 3T13A 4A3MB 1LTGD 4FF4A 3ZYYX 1FNVA 1TWAB 3O13A 2B2UC 2EDGA 4RGTA 1G6ZA 5FLXE 3NE5B 1KNAA 1VDZA 4FVMA 4HSVA 1Z6HA 1LT6D 1V8QA 4RCNA 2E2HB 4BY1B 1TWFB 3QG1A 1VF7A 3F2UA 2K6AA 3M7NA 4A93B 2QKIC 1CQFA 1EY0A 3NK9A 3J7YW 4RGMA 1A3UA 3G6JB 3MXGA 4A3EB 4TSSA 3SHLA 1OXXK 4XQNA 3RD4A 2KA7A 3A8KE 1Z47A 2PNRC 2J4XA 4QUCA 5T1IA 1PLFA 2A5HA 1H9MA 3DMUA 2I07B 5EQ0A 4PQXA 1D5XC 2F0OA 1PMRA 2B2VC 1D5MC 5HGTA 2I46A 1U4LA 1Y8PB 2XWJB 1QILA 1QNKA 3GTQB 3K5MA 2LY7A 1BR9A 3MWYW 2ENBA 3IFDA 5CV6A 2F0HA 1DOMA 4FF2A 4R8IA 2IX3A 4KI0A 3TZDA 3K7AB 1V1PB 1ET9A 4Q5VA 1HFNA 3NBIA 4CHTB 2MJ8A 2K1BA 2PPBC 4IFDG 4L8JA 3M4OB 2B2YA 1PFMA 5C4HA 2K7VA 2OXPA 4LJZC 2Z1CA 2NTSA 1BXTA 4G7ZC 1SYCA 3QOJA 4H44C 5C0XI 1EY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHE A;  5COR A;  2KUM A;  1BF4 A;  2N55 A;  1HUN A;  1NR4 A;  1E0B A;  3N52 A;  1CA6 A;  2N88 A;  1U4M A;  1NR2 A;  4IUT A;  5E4X A;  2HUG A;  5CBE E;  4IUR A;  1WTQ A;  1G2S A;  1MSG A;  1WD1 A;  1RHP A;  1EIG A;  2B2W A;  1B50 A;  1WTP A;  2XIW A;  2K28 A;  3QO2 A;  5COY A;  2HDL A;  3IL8 A;  1QG7 A;  4HAE A;  2DY7 A;  1WTR A;  1EOT A;  2FFK B;  3I90 A;  4R9W A;  2FHT A;  4IUV A;  1NAP A;  2EPB A;  1VMC A;  2D9U A;  2KOL A;  5EPK A;  1DOK A;  1F9R A;  3KBX A;  2IL8 A;  4HED A;  2HCC A;  2HDM A;  3H91 A;  3I3C A;  4ZK9 B;  1X32 A;  4OIK A;  1WVL A;  1TVX A;  1O7Y A;  1B4O A;  1WTV A;  1IL8 A;  2HCI A;  2KED A;  3UI2 A;  4QUC A;  5T1I A;  1LV9 A;  1PLF A;  3I91 A;  1B53 A;  1HUM A;  2L4N A;  5D14 A;  1WTX A;  5EQ0 A;  4DN4 M;  4HCS A;  4LMQ D;  2MPM A;  4RAU C;  2RVL A;  1XX8 A;  2H1E A;  2B2V C;  1U4R A;  1X3P A;  4ZAI A;  3P7J A;  2EE1 A;  2CVR A;  1G91 A;  5CMD A;  2MGS A;  1CM9 A;  1BBX C;  1PFB A;  2X6G A;  4CJ1 B;  4ZKB B;  1JE4 A;  1F2L A;  1X3Q A;  2B2T C;  1AZP A;  1BNZ A;  2X69 A;  1EIH A;  5CBA E;  2BDN A;  3HP3 A;  1U4L A;  2Q8R E;  1QNK A;  1O7Z A;  1PFN A;  5EPJ A;  2B2Y C;  1ILQ A;  3MWY W;  2JP1 A;  4IUU A;  5JJZ A;  1GUW A;  3FPU B;  4O42 A;  2MP1 A;  2Q8T A;  2FIN B;  3IFD A;  4ZLT F;  2FJ2 A;  1JIC A;  5EKI A;  1ZXT A;  1ESR A;  3LWE A;  1F9S A;  4U68 A;  1B3A A;  4XT1 B;  1U4P A;  1VMP A;  2RSO A;  5D65 A;  1EL0 A;  1F9P A;  4X3S A;  2EOT A;  1DOM A;  1WTW A;  1MGS A;  1IKM A;  2KVM A;  1F9Q A;  1B2T A;  1DZ1 A;  4R8I A;  2X6L A;  1BO0 A;  4CJ2 C;  4XT3 B;  4IUP A;  3MTS A;  1HA6 A;  1A15 A;  1QE6 A;  3DEP A;  2NYZ D;  2RA4 A;  5E4W C;  5EJW A;  3TZD A;  3D6W A;  3GV3 A;  2FMM A;  3GV6 A;  4NW2 A;  1MSH A;  1O80 A;  1DOL A;  2DY8 A;  2VXW A;  2B2U C;  5AFW A;  1KNE A;  2B2V A;  2L1B A;  1ILP A;  1RTN A;  1G6Z A;  2SDF A;  2KEE A;  1IKL A;  4IUQ A;  1G2T A;  3DM1 A;  1HHV A;  1HFG A;  2K03 A;  1HFN A;  1SDF A;  1RTO A;  4X3U A;  3Q6S A;  2NWG A;  1KNA A;  1NCV A;  2B2T A;  2K04 A;  3ONA B;  2K05 A;  4HSV A;  1RJT A;  1C8C A;  1SAP A;  2MJ8 A;  2K1B A;  1XYI A;  2RSN A;  1WD0 A;  1CA5 A;  2J7Z A;  2M2L A;  2B2W C;  1HRJ A;  4XDX A;  2B2Y A;  2K01 A;  2L11 A;  1PFM A;  4X3K A;  4CJ0 B;  4RA8 A;  5DNF A;  1MI2 A;  3F2U A;  2R3Z A;  1J8I A;  3R93 A;  1ML0 D;  4RWS C;  4UAI A;  1ROD A;  2JYO A;  5T1G A;  4QUF A;  4MN3 A;  4X3T A;  1AZQ A;  3DEO A;  1S4Z A;  3FDT A;  1EQT A;  1J9O A;  5EPL A;  1AP0 A;  2L12 A;  3G7L A;  1M8A A;  4ZKC B;  2L9H A;  3KUP A;  1WTO A;  1DON A;  1ICW A;  4OIJ A;  1PDQ A;  1SSO A;  2KEC A;  2NZ1 D;  2B2U A;  3TN2 A;  3I8Z A;  3SVM A;  1Q3L A; 
#chains in the Genus database with same CATH topology
 3PF5 A;  4DV3 L;  1K28 A;  1VQ5 A;  1BF4 A;  1V1Q A;  2NVT H;  4K2L A;  1BCP D;  3C1F A;  4EQP A;  3PIO 3;  1B9N A;  1IYV A;  3BJU A;  4DV1 Q;  2LXK A;  1Y1V H;  1YJ9 A;  4V19 0;  1CQV A;  3QO2 A;  1WTR A;  1TWH B;  5M5X H;  2NVQ B;  3KBX A;  4C3I G;  3HOY H;  4DR4 L;  2XRQ D;  4NB3 A;  1I3Q B;  1I94 L;  4C1N K;  3NWT A;  4A3M H;  1PH9 A;  1B4O A;  1TWA H;  2XTI A;  1YZ6 A;  4MZ9 A;  2ZJQ A;  2IX1 A;  1G51 A;  3EVQ A;  4C3J G;  1JOO A;  1JWS D;  3RMH A;  5LMU Q;  4A3F B;  2MPM A;  3NSW A;  3T56 B;  3P75 A;  1X3P A;  1Y8O B;  3I4N B;  4GN5 A;  1CM9 A;  1EYA A;  4A4I A;  1PFB A;  4DAP A;  3JAM c;  1KAA A;  2Z0S A;  5DM6 3;  2E2H H;  3HP3 A;  4K6L A;  4A3K G;  2ICE C;  2Z6K C;  1Y14 B;  1O7Z A;  3ER0 A;  1TWF H;  4IPH A;  5FJ8 G;  5C3E H;  2KHS A;  2PW7 A;  3KF8 B;  4G7O C;  1F9S A;  2EJG C;  4GLA C;  3S16 B;  3BS1 A;  4P2C B;  4A93 H;  1MGS A;  1DZ1 A;  2KBN A;  1SNQ A;  3RLN A;  1YJN A;  5E4W C;  1K3R A;  5CV9 A;  3DHQ A;  1C4Q A;  1O80 A;  4LK1 C;  3HOW G;  1K8M A;  5JVH 3;  3I56 A;  2I5L X;  1F77 A;  3J81 j;  1Z7T A;  1HFG A;  3DWA A;  3CCJ A;  2TMP A;  1X6O A;  1SDF A;  2NUC A;  1NCV A;  1QZG A;  5E3F A;  4OO1 H;  3ONA B;  2PO4 A;  2K05 A;  2BE5 D;  4A3E H;  1RL2 A;  1Q90 A;  2O4X A;  3Q8D A;  3IRB A;  2IY5 B;  4XDX A;  1DJR D;  1VQH A;  1CSQ A;  4X3K A;  1SE4 A;  4L63 B;  1VQB A;  3H3V C;  2VB3 X;  3BVZ A;  4Z9C B;  2OTJ A;  3BDC A;  1NJI C;  3MC0 B;  1SR3 A;  5ELN A;  1HNX L;  3FDT A;  2F0M A;  2BCO A;  3TRE A;  3WWV A;  3ULJ A;  2JA8 B;  1QWY A;  4OIJ A;  2KQ3 A;  1K9M C;  2KEC A;  2NZ1 D;  1ZYR D;  4DR7 Q;  4X66 L;  3L2P A;  4MHE A;  2I5M X;  3C3L A;  4IN3 A;  1FNU A;  1E0B A;  1NR4 A;  2QW7 A;  3UE1 A;  1KLG D;  2R7F A;  3GTQ H;  2SNM A;  4DR1 Q;  4DNT B;  2Z8L A;  2K28 A;  5COY A;  4C2M B;  3J81 c;  3AYH B;  1EOT A;  3LWU A;  1U9R A;  3PSI A;  2RCF A;  3D3R A;  2WKD A;  3FRP B;  5E7N A;  1PTO F;  4DAV A;  2F0I A;  2HCC A;  2CWA A;  3A55 A;  4NPS A;  1L1O B;  3P20 A;  2KCN A;  4YCU A;  5KNB A;  1SNP A;  3OHX C;  5IYC G;  1EZ8 A;  3K7A H;  4K6D A;  5J3B A;  3V05 A;  2DNE A;  3CAM A;  1JQY D;  4GNX C;  1RKN A;  2WKC A;  2B63 G;  3T1Y Q;  3P7J A;  4JI7 Q;  2WAQ B;  3R8B A;  5H1S E;  1AN8 A;  2K5Q A;  4ZKB B;  1EEI D;  1CUK A;  1BNZ A;  3M4O H;  4GN4 B;  1OTC A;  3A8I E;  2PZT A;  2EY2 A;  3G4S A;  1PFN A;  5LMN L;  3KDF A;  3RR5 A;  4ZLT F;  2FJ2 A;  1TY0 A;  5IOC A;  3H3V H;  4L6T B;  5ELE A;  1XJV A;  2AQ1 B;  1I4G A;  4OGQ C;  4QL5 A;  1NTG A;  4NXN L;  1EY8 A;  5CV5 A;  1XNQ Q;  5IGB A;  2PI2 A;  4L5T A;  2NVX B;  2A19 A;  4CKC A;  1LYL A;  2K32 A;  1YHQ A;  3P1H A;  4B3S L;  2JA7 B;  1MJE A;  4F7X A;  1TWG B;  2JEB I;  3VYU A;  1SMY C;  2VL6 A;  4GKK Q;  3HOV B;  4B9W A;  1K8A C;  1PH5 A;  1HRJ A;  4L5R C;  1TWH H;  2MUY A;  2NVQ H;  2JXM B;  1MIU A;  2K01 A;  3MHB A;  3CCE A;  1N34 Q;  4NMZ A;  3UDI A;  1I3Q H;  4DV5 Q;  3M4P A;  2FMC A;  1ROD A;  4JBW A;  4X3T A;  3DEO A;  3S15 H;  1A3T A;  2Y0S G;  3SR1 A;  3HKZ G;  2L12 A;  4FXK C;  3KUP A;  3ZJY C;  1JOQ A;  4KHV A;  3GTL B;  4JI4 L;  2CH4 W;  3I4N H;  3CXC A;  2E8G A;  2F4V L;  3F1Z A;  3QIA A;  3TS2 A;  3EJI A;  3U9S A;  5M3F B;  4B08 A;  1SRU A;  3AEV A;  2DUD A;  4PV1 C;  3CD6 A;  2PCF B;  3GTG B;  1LTA D;  4JVZ A;  1HZA A;  4C3H B;  2D0P A;  4EQN A;  4L5Q A;  3S16 H;  1UEB A;  2EPB A;  2KCT A;  4X62 Q;  2IL8 A;  1L1O C;  2NVY B;  3HOU G;  1RCV D;  4AQY Q;  3I3C A;  4DU9 A;  3WOF A;  1NE3 A;  4DV1 L;  4QCL A;  5JPM C;  3KLS X;  1JJ2 A;  4YWK A;  3S2H B;  3I91 A;  3OMC A;  3CPF A;  1VQ4 A;  4RAU C;  4KD4 A;  2F0K A;  1TWC H;  3HKS A;  1XPU A;  1F2L A;  1K73 C;  4H0L C;  1AW7 A;  4GOP C;  2K5V A;  3VYR A;  2F0P A;  2ZXR A;  4P74 A;  1X55 A;  2B2Y C;  5EPJ A;  1S5F D;  1V9P A;  4LAA A;  3N6R A;  2YYZ A;  3LWE A;  4J6H A;  4FF1 A;  1IBK Q;  3S14 H;  2L0C A;  2EOT A;  3NTI A;  4MTN A;  2JA8 H;  3OW2 A;  1F9Q A;  5TSS A;  1O7L A;  5BN3 A;  3D6W A;  3KYH C;  3J7Z C;  4NW2 A;  1MSH A;  5M3M G;  4OWW B;  1PH3 A;  4IFD J;  1VQL A;  1EIF A;  2J0T D;  4N8F A;  2IWH A;  2MNA A;  1B7Y B;  2JK8 A;  3VR4 A;  4C2M H;  1A3V A;  3TZU A;  4HIO A;  1NNX A;  2N8N A;  1ENA A;  1TR5 A;  4CJ0 B;  4EVO A;  1V43 A;  3HG9 A;  2R3Z A;  3H94 A;  2EYJ A;  3CCS A;  3DWP A;  3DXJ C;  5LMN W;  3U50 C;  1B3Q A;  4OWT B;  3SK5 A;  3NTK A;  4E6I A;  1HNW Q;  1I50 B;  3L7Z C;  4BXX H;  1T5E A;  2ALY B;  4PMW A;  3RUZ A;  2Q2I A;  4J8Q A;  1CA6 A;  4C3J B;  1U4M A;  3CQZ B;  1CKO A;  2WB1 E;  5M5W H;  4S3S A;  5E4X A;  5CC4 A;  2ZXO A;  5LHY 1;  4LF8 L;  4BS9 A;  3VA5 A;  1JWU D;  1EIG A;  2NN6 H;  4DV3 Q;  1LM0 A;  3VDY A;  3AFQ A;  4DR7 L;  4N9P A;  2K4K A;  5IP7 G;  1H9S B;  3KDF B;  2ZT9 C;  5I4D A;  4DUY L;  1GO3 E;  4ZK9 B;  1X32 A;  2NVX H;  5L37 A;  2E2J B;  1AFP A;  1H95 A;  1V1O A;  4TQU S;  1WTV A;  1CHQ D;  4DR1 L;  1M1K C;  2KED A;  1RIP A;  5JEA H;  4DK6 C;  5HY6 A;  1LV9 A;  4CDC C;  3U58 A;  1LO5 D;  2JA7 H;  4DR4 Q;  1EYD A;  1TWG H;  4JPB W;  1HQM C;  1I4Q A;  5C0X G;  3HOV H;  3X3N A;  2X6G A;  2MO1 A;  2DJF C;  3HOW B;  4KLK A;  2UXC L;  1KDA A;  1D8L A;  1SNM A;  4KY7 A;  3TP8 A;  5IP9 G;  2F0G A;  3MXN A;  4Y52 H;  4JI7 L;  1U4P A;  1VMP A;  1FYC A;  2OF1 A;  2SNS A;  3CCV A;  2C5C A;  3PUY A;  2G5D A;  2ZTD A;  2A6E C;  5GAH C;  2PW5 A;  1VQI A;  2X6L A;  5C5M A;  3L0O A;  3GTL H;  4B3T Q;  3CCQ A;  1LT4 D;  5D3I B;  3OTO L;  1KNE A;  4RKL A;  5HGQ A;  3KOJ A;  5M3F H;  4K8I A;  3NQI A;  3RN5 A;  3GTG H;  1K0R A;  3GDE A;  1XNQ L;  5C44 G;  4QMG A;  4C3H H;  4YWL A;  2J7Z A;  1STY A;  1TKW B;  5CV8 A;  5A2Q L;  2LKV A;  2OQ0 A;  3KF6 B;  2F0U A;  2K52 A;  2NVY H;  1SE8 A;  1S40 A;  1E1T A;  5IGC A;  5M9O A;  5DM7 3;  2K5N A;  4GKK L;  1STG A;  3S2H H;  1K8O A;  2GVB A;  3GP7 A;  2EYF A;  4QIW B;  1KQS A;  4IPC A;  1YHB A;  1N34 L;  1D1K A;  2XVS A;  4DFA A;  4BY7 G;  4DV5 L;  2N55 A;  3W3A A;  1LLR D;  1KDB A;  1S5B D;  4ILW A;  2HQE A;  4XYQ A;  2HD3 A;  5C3E B;  5K36 G;  2CQO A;  3RZO H;  5KIX A;  4IFD H;  1TII D;  4IUV A;  1EYC A;  1R9T B;  1L0Y B;  1VMC A;  1L0X B;  3URY A;  3NP8 A;  4HED A;  2F52 A;  3FEW X;  3FP9 A;  1EQV A;  3C2P A;  1LT3 D;  1C48 A;  3K57 A;  3ULP A;  1KL9 A;  3TEH B;  1JJC B;  5J22 A;  2XGT A;  1YNJ D;  3J7A 5;  4K14 A;  4X62 L;  4LNQ A;  1MJC A;  3WOE A;  1A6X A;  4POF A;  1LTI D;  5IT9 L;  4AQY L;  2HHH L;  3Q24 A;  1Y69 U;  1AZP A;  5A2Q E;  3S17 B;  2EXZ A;  2H4O A;  2MQH A;  4FXG C;  4YWM A;  1LTR D;  3QWN A;  4JI5 L;  2F0V A;  3MFG A;  4JBJ A;  4DAY B;  2EIF A;  3JAM i;  1W2B A;  1UE1 A;  3J7A V;  2Q8T A;  5M5Y H;  2QEJ C;  1I6V C;  5JOB A;  3NQT A;  5G3L F;  4KMU C;  5D65 A;  1MKH A;  4ULL A;  1I50 H;  1WTW A;  1IKM A;  5LMN Q;  5A35 A;  2NTT A;  4CJ2 C;  2F0Q A;  3OSO A;  1LTL A;  4DF7 A;  5C4J B;  3K0Y A;  4HJ8 A;  1TY2 A;  2Q2U A;  1XPR A;  5AFW A;  1LAB A;  3T53 B;  2Y0S B;  4C3J H;  2SDF A;  5IYB H;  4JI2 L;  1UNS A;  3CQZ H;  1G2T A;  4AYB B;  1IBK L;  3RZD B;  4OHJ A;  1KTK A;  3Q0A A;  1WD0 A;  4A3G B;  2GVA A;  2WV6 D;  5IYD G;  1DM0 B;  2L11 A;  1HCZ A;  3FMC A;  2V1C C;  5EKL A;  2HT1 A;  3D0F A;  5FJ8 H;  3I2Z A;  4DUZ L;  2E2J H;  4FDB A;  2CH4 A;  1BOS A;  1JR0 D;  1SYE A;  1IHZ A;  1J9O A;  2R7Z G;  5ELB A;  2ID0 A;  1QNU A;  1CZG A;  1ENC A;  2Q2T A;  4PG3 A;  3ULL A;  5IT9 E;  1PH4 A;  3CRL C;  1LAC A;  3T51 B;  1DCZ A;  3HOW H;  2R92 G;  2VQF Q;  4TKO B;  2K33 A;  3QJY A;  2PQE A;  2NB0 A;  2RQX A;  4RG1 A;  4HIM A;  4MTK A;  3KJP A;  1XXG A;  1XPO A;  2F4V Q;  2HDL A;  4J15 A;  1HXY D;  4HMJ A;  3JAM L;  4BBR B;  3OPO A;  1Q8K A;  5GAG C;  2FHT A;  2L5T A;  3NHH A;  3EBE A;  4DV7 L;  1VQ6 A;  1DOK A;  3A8J E;  2SOB A;  3MXN B;  2HDM A;  4P71 A;  2ZTE A;  1B9M A;  3D4W A;  3MA2 B;  4YIJ A;  1BKB A;  4LUO A;  1CZW A;  1ESF A;  2AMC B;  3VA7 A;  4JBM A;  1XX8 A;  4KHP L;  3JC6 6;  3OWF A;  3STB C;  1XWE A;  1PZI D;  2CVR A;  4PMC A;  5CMD A;  4CJ1 B;  4CBV A;  5C6A A;  2F0S A;  3CP0 A;  1SND A;  2JP1 A;  2NZH A;  2UXB Q;  3RN2 A;  5EKI A;  1ZXT A;  1ESR A;  1QCB D;  1H9J A;  3S15 B;  3SDZ A;  2F4I A;  1EL0 A;  1GUS A;  2UUA L;  4DPG A;  2KVM A;  3D6C A;  2R6G A;  4AH6 A;  2AKW B;  4U67 3;  3DEP A;  2NYZ D;  1TS5 A;  2FMM A;  4GZY C;  1DOL A;  1A62 A;  2B29 A;  2DY8 A;  4N9T A;  4GNX B;  1LTS D;  2CW0 C;  2L1B A;  3HZX A;  2WB1 G;  3S1Q B;  3M9B A;  2K04 A;  3BDO A;  2B63 H;  3JAM E;  3FPP A;  4B3T L;  1BBW A;  3HOZ G;  3NTH A;  4LF6 L;  4G7H C;  1R9T H;  4HMI A;  2F0N A;  4XYO A;  5DNF A;  1YVC A;  1KLU D;  3R93 A;  4RWS C;  5EGT A;  3T1H Q;  1I6H B;  3J81 L;  2KCC A;  4Y7N H;  3CW2 C;  2MHV A;  3CME A;  1YHA A;  5EPL A;  1EWC A;  1P16 A;  4DXG A;  4OX9 Q;  2EJM A;  4A75 A;  4DXF A;  3VYT A;  1TWC B;  1JJG A;  1Q3L A;  1LT5 D;  1VQF A;  3I4M B;  3S17 H;  2EXD A;  2D2C C;  3H0G G;  5JPN C;  4IUR A;  1VS0 A;  1EY5 A;  2N3S A;  2DY7 A;  2FFK B;  3CMA A;  2UUC Q;  1H9K A;  1SEB D;  1NAP A;  3S14 B;  1PVO A;  4LF8 Q;  3NBH A;  3R2T A;  4R4T A;  2BH2 A;  2D0O A;  1U0L A;  3J7A F;  2MFI A;  4LF9 L;  4RMF A;  5C4J H;  4WFN 3;  1PTO B;  5ELD A;  1D5Z C;  3UI2 A;  3K8A A;  4DN4 M;  4DUY Q;  1PYS B;  5C5L A;  5C0X J;  1T9H A;  3RZD H;  3S1R H;  1ICF B;  4CDF C;  1AE3 A;  4A3G H;  1JE4 A;  3VR2 A;  3GD7 A;  2ICI A;  3EN2 A;  1SYB A;  3CC2 A;  1SYF A;  1ILQ A;  4P73 A;  1CFM A;  2DN8 A;  1VF5 C;  2MP1 A;  4RHS A;  1CHP D;  1VQ7 A;  4CKE A;  4XT1 B;  2OTL A;  4DV2 L;  2K5W A;  2DGY A;  1HH2 P;  3I55 A;  2UXC Q;  2AHO B;  1YBY A;  4A3M G;  2FXQ A;  1HA6 A;  1SMX A;  1D2B A;  3BZC A;  2QDB A;  1QVG A;  4A3I G;  5EBC A;  4KY5 A;  1SE2 A;  3PMF A;  3TP7 A;  3KJO A;  1PV4 A;  3GTJ B;  4DR6 Q;  4RKB A;  1PA6 A;  3HS0 C;  1IYJ B;  2KEE A;  4ABN A;  3DM1 A;  5M5W B;  3BYT B;  4GOP B;  3TQY A;  4DK3 C;  5LL6 X;  4QB4 A;  3OTO Q;  1VQ8 A;  1RJT A;  3BU2 A;  1BCP F;  2M2L A;  4BBR H;  4BY7 B;  5I9P A;  3CC7 A;  4ZCK A;  4BY1 G;  4DA2 A;  2K50 A;  4EGV A;  4R4O A;  3FVQ A;  2SEB D;  2JJQ A;  4RA8 A;  1STE A;  3K80 C;  1ML0 D;  4QF4 A;  1L2F A;  3MFY A;  1PH7 A;  4RGN A;  3PO3 G;  4IZ8 A;  4MN3 A;  4HN7 A;  2A8V A;  5JJI A;  3BVM A;  4A93 G;  4A3L G;  5I2X A;  3GTP H;  1F2Y A;  1KD1 C;  1PXU A;  2A69 C;  2LSS A;  3TP5 A;  3NWS A;  1E22 A;  1PH2 A;  2L55 A;  5M3M H;  4HJ9 A;  4DV0 Q;  2F0W A;  4IUT A;  3OOC A;  4A3E G;  1NSN S;  2B8F A;  1BVS A;  2QA4 A;  1SJH D;  1QG7 A;  3IL8 A;  3I90 A;  2VB2 X;  5EAY A;  2K75 A;  2KOL A;  2EY5 A;  1UAP A;  1C9O A;  1JWM D;  2VQF L;  4DR2 L;  1PTO C;  2R93 B;  4A3B G;  4H7B A;  1VQD A;  1S72 A;  4K2K A;  2QCP X;  1F2Z A;  1K83 B;  2EYL A;  2L4N A;  3W2D A;  4LMQ D;  2PZW A;  2F0D A;  2E5L L;  1VCI A;  4I7A A;  1D7Q A;  4KKU A;  1HZC A;  1A0I A;  2VZA A;  3MEF A;  3S1N B;  3S1Q H;  1M4V A;  4IQZ A;  1I4X A;  1UUP A;  4FYD A;  4H02 A;  2F3V A;  1HPC A;  2VY3 A;  4WOR A;  2N78 A;  5FO9 B;  1CKM A;  3K5N A;  1HTL D;  3FPU B;  4DR5 L;  2HHH Q;  2ZJP A;  1FGU A;  1EFI D;  3F2C A;  1I6H H;  4K5V A;  1IW7 C;  1BCP C;  5GRO A;  5NUC A;  4JI5 Q;  1IYU A;  5IP7 H;  3E9I A;  2JQO A;  2PMZ E;  1QOH A;  4XQQ A;  4JI3 Q;  1UE6 A;  3E9H A;  3OW7 A;  1QE6 A;  2RA4 A;  1G29 1;  3TS0 A;  3D4R A;  1VQA A;  1OXS C;  2ES2 A;  4WJW A;  5CV7 A;  2LS0 1;  3I4M H;  2UXB L;  1EQR A;  2PYK A;  3MZ5 A;  4IUQ A;  1S3O A;  5E1F A;  1X3G A;  3KLS A;  3Q6S A;  2NWG A;  3SK4 A;  4WJ3 M;  1D1I A;  2B2T A;  4R8N A;  5C0X H;  1EUJ A;  1C8C A;  4YHH Q;  2UUB Q;  1SRO A;  4ZRZ A;  3RZO B;  2CQA A;  1N8R C;  3SE0 A;  1YIJ A;  4XXE A;  4JI2 Q;  3M85 A;  2C9O A;  5DAU A;  4PZ6 A;  1WCM G;  2IW3 A;  1MI2 A;  2OCE A;  1KDC A;  4H13 C;  5IP9 H;  1PTO H;  3I70 A;  5FO8 B;  2A6H C;  5C4X B;  2CHB D;  4JI6 Q;  3NXW A;  4B9X A;  4HTH A;  2K5H A;  4DUZ Q;  3NEL A;  2PQA A;  2B3G A;  2QIL A;  3EFX D;  3FKI G;  4IO9 A;  3T1H L;  3T16 A;  1HZB A;  2EYO A;  2EYH A;  1NR2 A;  4OX9 L;  2EY6 A;  4A3D G;  1PRT F;  4DNI A;  5CBE E;  5J1Z A;  3MXP A;  5M5Y B;  3E6Z X;  2A73 B;  5DLQ E;  5K5P A;  2KJX A;  1Q46 A;  3KK7 A;  3PV0 A;  2D9U A;  3OIP A;  5J39 A;  3QB3 A;  3PCO B;  3H91 A;  3BDL A;  4C3I B;  3QOL A;  4ME5 A;  4LUZ A;  4DV6 L;  3HOX G;  3J80 c;  1EOV A;  4KV6 A;  1K0S A;  3EA6 A;  4O0A A;  3GTJ H;  5CGK A;  4DV7 Q;  4HJ7 A;  1B53 A;  1CKN A;  4A3F G;  1I4H A;  3LGJ A;  4OL7 A;  4HCS A;  5JVG 3;  3MAQ A;  2UUC L;  3KFU A;  2E74 C;  3OIQ A;  1ZKO A;  2F0L A;  4CGY B;  3DLL A;  1Y8N B;  4BY7 H;  1FVI A;  2KEN A;  5CBA E;  2BDN A;  4JW0 A;  2HQL A;  4ME3 A;  4KHP Q;  3UE0 A;  4A3K B;  2WIN B;  1X56 A;  3K59 A;  2BDO A;  3DWQ A;  4QY7 A;  2OEO A;  5LL6 S;  1B70 B;  5K36 H;  1X3F A;  1QZH A;  4K5X A;  4R4Q A;  1B3A A;  4M8A A;  1Q12 A;  4KTA A;  3CPW A;  3HOZ B;  2BOS A;  4IJH A;  1LTT D;  1B2T A;  1MD2 D;  3STB D;  1A15 A;  1GD7 A;  3K81 C;  2RBM A;  4V0B A;  4A3J G;  5FKA C;  4JI8 Q;  3AU7 A;  2UUA Q;  4ALP A;  1V1P A;  2B8G A;  2JEA I;  2XWB B;  1OO9 B;  2IX0 A;  3LX0 A;  1SAP A;  3AMU A;  2RSN A;  1J6Q A;  1SYD A;  4NXM Q;  4JOI A;  5I9O A;  4XQJ A;  1EU3 A;  4B3R Q;  4DR6 L;  5JJK A;  2EYM A;  1PRT C;  2JA9 A;  3H0G B;  2R93 H;  1I4P A;  4UAI A;  1CT1 D;  1DD2 A;  2ASB A;  3VR3 A;  1AZQ A;  5BR8 Q;  1S4Z A;  4LF6 Q;  4OO1 I;  1K83 H;  4KJN A;  1FJG L;  2Z6B A;  4WRD A;  2JA8 G;  1AP0 A;  3MEH A;  3G7L A;  4BWG B;  2A74 C;  5AJ3 Q;  1PYW D;  2A68 C;  3TP6 A;  1SFO H;  3S1N H;  5ISR A;  3OMG A;  2LXJ A;  3TME A;  1BUV T;  2KUM A;  1HUN A;  2N88 A;  1SNC A;  4KKS A;  2ZTC A;  5FO7 B;  3F2B A;  1JMC A;  5ELF A;  2HIV A;  2XN9 C;  1YI2 A;  1G2S A;  4A3C G;  1B50 A;  1T5X D;  4HAE A;  2GA4 B;  5IGE A;  4RH6 A;  3CCL A;  4G4K A;  2IPK D;  2WFW A;  4PNY A;  4PZ7 A;  1E2V A;  4DV0 L;  1O7Y A;  3AFP A;  1VQC A;  2LFN A;  2R7D A;  4QIW E;  4R1J A;  5CV4 A;  4F87 A;  3VYS A;  3ITP A;  4QJF A;  5BN5 A;  2WII B;  1JE5 A;  4MNO A;  5FLX c;  4LF9 Q;  2BH8 A;  4ZAI A;  1EY4 A;  3SK8 A;  2B63 B;  1Q8I A;  4A3I B;  3EQL C;  1N9W A;  1FL0 A;  4DKA C;  1KAW A;  2R92 H;  3I4L A;  1TU2 B;  3H6M A;  2NN6 G;  1WFQ A;  2A1A A;  3GTO B;  3PO2 G;  3TSS A;  1A63 A;  3KF8 A;  1GUO A;  4IUN A;  4Y7N B;  4XTC S;  1STN A;  5C4X H;  5F2D A;  3A56 A;  2JSO A;  2EY1 A;  1GHJ A;  5IIF A;  4KN4 C;  3H09 A;  1BO0 A;  5FLM H;  4XT3 B;  1NUC A;  3MTS A;  3OWE B;  1O7I A;  4EQO A;  5JEA G;  5KND A;  4DV2 Q;  2DJG C;  2JA6 G;  3A74 A;  4ZUI A;  1WJJ A;  3PO3 B;  4RCO A;  3CHB D;  3H3V I;  3T4A C;  5KNC A;  1F2M A;  3G48 A;  1VQN A;  3D31 A;  2K03 A;  2IJ0 A;  4BBS G;  1RTO A;  1GUT A;  4JI3 L;  3W1G A;  1PFS A;  1DYQ A;  2IHE A;  1KIX A;  4CDE C;  1PH8 A;  1ONL A;  2Q8I B;  2BA0 A;  1JOK A;  2D5D A;  4C3I H;  2M9V A;  2TSS A;  3HGB A;  2Z4H A;  1OXT A;  1E24 A;  4J1M A;  2OT2 A;  4MIU A;  2F0E A;  3S1M B;  4FNF A;  5FOB B;  4FF3 A;  2UUB L;  4YHH L;  4YY3 Q;  3ERQ A;  3A5U A;  2L9H A;  3UDF A;  3HKZ B;  4ZYS A;  1ICW A;  5EBD A;  3M7G A;  1PDQ A;  1SSO A;  3HFZ B;  3S1R B;  4A3B B;  1KHI A;  4FO2 A;  1CKN B;  2Y0S E;  3CCR A;  3V96 A;  4AYB E;  5KEE A;  5M3F G;  4IPD A;  1UE5 A;  1KAB A;  2Q2H A;  1EZ6 A;  3K6O A;  4EX5 A;  1PZJ D;  2HUG A;  4A3K H;  4JI6 L;  3KLW A;  1WD1 A;  4C3H G;  1RHP A;  2B2W A;  2O5I C;  2HIX A;  3WDN A;  1PHJ A;  3EIV A;  1Q1B A;  3SK6 A;  3ND8 A;  4AIM A;  1YNN C;  1HNZ Q;  3HOZ H;  4KHZ A;  1JT8 A;  2UU9 Q;  5GAE C;  2JA5 G;  2ZM6 Q;  4HCE A;  1SMY D;  3HOU B;  4KD3 A;  1ENF A;  4BA1 I;  2A69 D;  5KRU A;  1N36 L;  3L9A X;  1IZ6 A;  4UP9 A;  1YNX A;  5D14 A;  1GHK A;  2CWP A;  2KHI A;  1X54 A;  5CR3 A;  4DR2 Q;  1VQM A;  1II3 A;  2RVL A;  3ERO A;  2H1E A;  4B3M Q;  1U4R A;  1SNO A;  4KY6 A;  1LUZ A;  5IT9 c;  2GN5 A;  1RF2 D;  1R4Q B;  5JJL A;  2B2T C;  2E5L Q;  1XMO Q;  1FD7 D;  3V2T A;  4M1U B;  1HQR D;  1PTO D;  3A7A B;  3H0G H;  3J81 i;  2RF4 A;  2PZU A;  1PH6 A;  4U68 A;  4K5W A;  1JC7 A;  3MXU A;  1F9P A;  4YCV A;  2BA1 A;  4JCV E;  1I5F A;  4DR5 Q;  4TVA B;  3GTP B;  1WCM B;  2AUJ D;  1ASZ A;  3MVV A;  5EJW A;  3GV3 A;  4OWX B;  3AQQ A;  2V4D A;  4YCW A;  2VUM G;  3PF4 A;  1O78 A;  1ILP A;  1HHV A;  1CTM A;  1IKL A;  2K14 A;  5M3M B;  1XMQ Q;  4UP8 A;  1Q7Y C;  1Q81 C;  1QUQ A;  2YU9 B;  1JCK B;  5C4Z A;  1D6E C;  3C1E A;  4F88 A;  2YTX A;  1CA5 A;  1EY7 A;  1IW7 D;  2Z4I A;  3FKI B;  4IPG A;  1OXU A;  3Q23 A;  2RDG A;  4JYA Q;  4JI8 L;  4A3D B;  4JI0 Q;  1KXL A;  3CF5 A;  2NBF A;  5T1G A;  4JK1 C;  1EQT A;  3BVG A;  1SJE D;  3CCU A;  2PNH A;  1PZK D;  4ZUJ A;  5IYC H;  1WTO A;  4NXM L;  3CRK C;  4B3R L;  3TN2 A;  3I8Z A;  3SEB A;  1X9N A;  2RCN A;  2XNA C;  3HOX B;  5COR A;  4A3I H;  4C56 C;  4L5S A;  1E2W A;  5IYB G;  4WJ4 A;  2XRS D;  2AWO A;  5IE8 A;  5BR8 L;  3GTK B;  4JI1 L;  1A2T A;  2MO0 A;  4FP5 D;  4KN7 C;  1WTH A;  3GTO H;  2AWN A;  1TQO A;  5AJ3 L;  1WTP A;  2NZO A;  1XNR Q;  2F1M A;  5I6W A;  1TS4 A;  2A6H D;  4BY1 H;  5EPK A;  4ID6 A;  4JV5 Q;  1BQQ T;  2G9D A;  5KYI A;  5GAD C;  1CK1 A;  1WVL A;  1HR0 W;  2HCI A;  3PO3 H;  1B1Z A;  1YEZ A;  2NN6 I;  4KJO A;  3ERS X;  2P5Z X;  4A3L H;  2CCZ A;  1B44 D;  4DV6 Q;  3R2I A;  2R61 A;  1S5D D;  2CKZ B;  2EE1 A;  2B39 A;  4POG A;  1A2U A;  2MGS A;  3TDQ A;  4UPA A;  4HID A;  4IAL A;  4LWC A;  5GQO A;  3KLR A;  2X69 A;  4A3J B;  4RFB A;  2RDH A;  5JJZ A;  4JOI C;  3KBG A;  1KC8 C;  1N32 L;  1Y1W G;  1GUW A;  3PQI A;  1HJP A;  1STB A;  3S2D B;  2OQK A;  2VQE Q;  2F0F A;  1X3E A;  3S1M H;  1QB5 D;  1SXT A;  2WAC A;  5IWA L;  1G6P A;  4A3B H;  4X64 L;  2EZV A;  1EWH A;  1STA A;  3Q22 A;  1K3B C;  2F0J A;  1RTN A;  3E0E A;  3QR8 A;  1UEA B;  4QQB X;  1Y1V G;  5I2Y A;  5C3W A;  4UY8 C;  2G9H D;  4X3U A;  3L3O C;  1AEX A;  1SBB B;  3J81 E;  5I6Y A;  1STH A;  5C44 B;  1GXD C;  5ELC A;  5HUR A;  3HOY G;  1W6K A;  1YNJ C;  1BCP B;  1TXY A;  1J8I A;  2IT1 A;  3HOU H;  4QUF A;  3U4Z A;  1E7Z A;  4RGO S;  3BZK A;  1EEF D;  1NBW A;  3A5Z B;  3IFT A;  1EYG A;  2WAQ E;  3E5S A;  4P75 A;  2B2U A;  3UDG A;  3NPP A;  1HTP A;  1FJG Q;  4UDU C;  4A76 A;  4X65 L;  3NUC A;  1C0A A;  3N52 A;  5IOD A;  2YTV A;  2ZJR A;  4YY3 L;  4OXP A;  1PRT D;  2A6E D;  1E1O A;  3E0J A;  4XIG S;  5C3E G;  4F8M A;  4UP7 A;  5IGG A;  3CKI B;  3GO5 A;  3B6Y A;  2F3W A;  3GTM B;  4ODG A;  2EJF C;  2RDF A;  4IOA A;  1IBL Q;  1H9S A;  4LFA Q;  2A68 D;  1WCM H;  1ZEQ X;  3D4D A;  1FR3 A;  3M3Y B;  3PO2 B;  3M4Y A;  3NEN A;  1Q86 C;  4DK0 A;  5D3D A;  1HUM A;  4BA2 I;  5ELO A;  5IGF A;  3J80 i;  4IFD I;  1SYG A;  2DNC A;  1HNZ L;  2YU9 H;  1SN8 A;  2D62 A;  4C1N I;  4OO1 G;  3I72 A;  2UU9 L;  1G91 A;  4LF4 Q;  4IJL A;  1S5C D;  4HIK A;  2ZXP A;  2ZM6 L;  2JA6 B;  1N33 Q;  3VR5 A;  3W5O A;  1EIH A;  1QUQ B;  3FKI H;  3CU7 A;  4KKT A;  4GLX A;  2EQS A;  1CI3 M;  4A3D H;  2RHQ B;  4BBS B;  4K0K Q;  1G8Z D;  1GOZ A;  4B3M L;  1S5E D;  1IBM L;  5DEH A;  3PUZ A;  1PH1 A;  5JEA J;  3K7U C;  3F2D A;  1XMO L;  3IAY A;  4IUP A;  1HZ9 A;  2JN4 A;  1SFO B;  4LF5 Q;  1Q82 C;  1J5E L;  1EU4 A;  2IHF A;  3HOX H;  3AB9 A;  1WOC A;  1EY9 A;  1Q1E A;  3U9O A;  4LFB Q;  1TS2 A;  3M4Q A;  2VNU D;  2B2V A;  4AYB G;  4A3F H;  3GTK H;  1FGB D;  4RHR A;  2VS1 A;  3GQB A;  1VQJ A;  4A3G G;  1XYI A;  4LW1 A;  2VW9 A;  2B2W C;  3K5O A;  2E76 C;  1E3P A;  3KF6 A;  4DNR B;  5KYL A;  1XMQ L;  2L15 A;  4UHV A;  2JYO A;  2WP8 J;  4KK7 A;  1SLJ A;  2H5X A;  2RHS B;  4FXD A;  1BBU A;  1HR0 Q;  1M8A A;  4ZKC B;  1DON A;  2R7Z B;  1E2Z A;  4NDX A;  1U5K A;  2PMZ B;  2O5J C;  2JA5 B;  1GUG A;  3J80 L;  4JYA L;  1FNW A;  4JI0 L;  3PUX A;  4A3J H;  3BZD B;  2R92 B;  1NY4 A;  3RLF A;  5IY0 A;  4I7Z C;  3G6E A;  1WTQ A;  4LUV A;  1MSG A;  3W1B A;  4PMB A;  4BBR G;  2XIW A;  3S2D H;  2E2D C;  1PYB A;  1C7Y A;  1PRT B;  4R9W A;  1AE2 A;  3NBH B;  3HRZ C;  1F9R A;  2UXD Q;  4TRD A;  1QJO A;  5LMU L;  1EQQ A;  2YV5 A;  1H9R A;  3A54 A;  1XTC D;  4OIK A;  4NKL A;  1TVX A;  1QVF A;  1QVC A;  5KGU A;  2N49 A;  1IL8 A;  3CC4 A;  4DK1 A;  2E75 C;  1XNR L;  2AUK A;  3I73 A;  3PIP A;  2QEX A;  4JV5 L;  3LNN A;  4HR7 B;  1RDP D;  1N36 Q;  1ET6 A;  1BBX C;  2I0Q A;  3S9W A;  1GUN A;  1MBY A;  2VUM B;  5C44 H;  4GKJ Q;  1YNN D;  3RLO A;  1ASY A;  1JB3 A;  2XSC A;  4IUU A;  5EKK A;  4NP5 A;  4O42 A;  4DAY A;  1HA5 A;  3BG3 A;  1DGS A;  1VQP A;  1NMG A;  2BE5 C;  4A3C H;  3SXH A;  5IGD A;  2Z9H A;  2E2I B;  4LFC Q;  1A8V A;  4DGZ A;  4R4I A;  3IKJ A;  4IOC A;  4LF7 Q;  1RD9 D;  4ZQ3 A;  4DV4 Q;  3J80 E;  3I4N G;  1X65 A;  2F0T A;  3X3M A;  2QDL A;  3GV6 A;  1W6J A;  3G71 A;  3HEJ A;  4K8J A;  2VXW A;  1SE3 A;  2VQE L;  1EWI A;  1UWV A;  4DR3 Q;  2WB1 B;  1ZYR C;  1IL2 A;  5BN4 A;  2M00 A;  3DUZ A;  3PGZ A;  4OEM B;  3ICE A;  3GTM H;  2Z6K A;  4GLV B;  5G3L D;  5C3X A;  1UE7 A;  1GKH A;  3NEM A;  3PUV A;  1JOR A;  3A7L A;  3M3Y H;  3E3X A;  3C46 A;  3PO2 H;  1IXR A;  1R4P B;  2PI2 E;  4CKB A;  1GJX A;  3RNU A;  2AQ2 B;  3SVM A;  3I4M G;  5FK9 C;  5JAV A;  2JA6 H;  3VR6 A;  2O2L D;  1BDO A;  1I94 Q;  1YJW A;  3PIP 3;  1OXV A;  5FLX L;  4BBS H;  2AQ3 B;  2EYP A;  4JI1 Q;  1TS3 A;  2C35 B;  2CW0 D;  2QF7 A;  3BYY B;  4EQ5 A;  3R3O A;  3TBI B;  1I4R A;  1Y1W B;  3T1Y L;  2KHJ A;  2F03 A;  3K58 A;  4HSP A;  3D8G A;  4APV A;  4I65 A;  1WTX A;  2LMC B;  1P8L A;  3PUW A;  1IBL L;  4Q0F A;  3ND9 A;  4GS3 A;  3TRZ A;  1M90 C;  4LFA L;  2CFM A;  1X3Q A;  2NVT B;  5CYU A;  1JB7 A;  2EVB A;  3K5L A;  5IYD H;  2Q8R E;  1Y1V B;  1DXM A;  2K5D A;  4O1N A;  1GM5 A;  2FIN B;  1LTB D;  1JIC A;  1B8A A;  2OWO A;  2RSO A;  4LF4 L;  5M5X B;  2RKS A;  4X3S A;  2JE6 I;  4G57 A;  1N33 L;  1N32 Q;  3HOY B;  2ATW A;  2R7Z H;  1TT2 A;  4OEL B;  4BXX G;  2WAQ G;  3F8T A;  3T13 A;  4A3M B;  1LTG D;  2JA5 H;  4FF4 A;  2KCM A;  3ZYY X;  1FNV A;  1TWA B;  3O13 A;  4GN3 B;  1VQO A;  4K0K L;  4R4C A;  2B2U C;  2EDG A;  4RGT A;  1G6Z A;  4GNX A;  5IWA Q;  3SGI A;  3A0J A;  5FLX E;  3NE5 B;  4X64 Q;  4P72 A;  1WYD A;  1WI5 A;  1KNA A;  1VDZ A;  3K0X A;  1HNX Q;  4FVM A;  4HSV A;  1Z6H A;  4LF5 L;  1LT6 D;  1V8Q A;  4RCN A;  2E2H B;  1K8G A;  4BY1 B;  4LFB L;  1KRT A;  1TWF B;  3QG1 A;  1VF7 A;  3F2U A;  4X66 Q;  1W3S A;  3DM3 A;  2K6A A;  2JA7 G;  3M7N A;  1NMF A;  4A93 B;  3I7F A;  4CDD C;  2QKI C;  1EFW A;  3HOV G;  2PQA B;  1CQF A;  1EIY B;  1EY0 A;  3NK9 A;  2VUM H;  3J7Y W;  4O2D A;  4RGM A;  1A3U A;  3G6J B;  3MXG A;  1HR0 L;  3U4V A;  4A3E B;  4TSS A;  4X65 Q;  1AH9 A;  3SHL A;  2E2I H;  1OXX K;  4XQN A;  3RD4 A;  2R93 G;  2I5H A;  2KA7 A;  3A8K E;  1XTD A;  1Z47 A;  4X6A H;  2PNR C;  2J4X A;  4PZ8 A;  4QUC A;  5T1I A;  1PLF A;  3HKZ E;  3S24 A;  2A5H A;  1H9M A;  1VQE A;  3DMU A;  1VQG A;  2I07 B;  5EQ0 A;  3PIO A;  2F3I A;  4PQX A;  1D5X C;  2F0O A;  1YIT A;  1PMR A;  2B2V C;  1CSP A;  1D5M C;  5HGT A;  2UXD L;  1GVP A;  1MHW C;  4NXN Q;  2I46 A;  4DAM A;  1U4L A;  1Y8P B;  2XWJ B;  1QIL A;  1QNK A;  3FHW A;  3GTQ B;  3K5M A;  2LY7 A;  1BR9 A;  3MWY W;  1L0W A;  1Z9F A;  2ENB A;  4JG2 A;  3IFD A;  4B3S Q;  2QGQ A;  3H15 A;  1VQ9 A;  5CV6 A;  1L1O A;  2F0H A;  1DOM A;  4FF2 A;  4GKJ L;  4R8I A;  2IX3 A;  4KI0 A;  3TZD A;  1IBM Q;  2YTY A;  3K7A B;  3UDX A;  1V1P B;  4LFC L;  1ET9 A;  4Q5V A;  1HFN A;  1J5E Q;  3NBI A;  4CHT B;  4LF7 L;  4JBK A;  4GOP A;  4JC0 A;  4DV4 L;  1KRS A;  2MJ8 A;  2K1B A;  2PPB C;  4IFD G;  3CCM A;  4L8J A;  3M4O B;  2B2Y A;  1PFM A;  5C4H A;  2K7V A;  2OXP A;  3OYY A;  4JI4 Q;  1HNW L;  4QGU A;  4LJZ C;  1Y1W H;  2Z1C A;  2NTS A;  1BXT A;  4DR3 L;  5C4X G;  4G7Z C;  1SYC A;  4OON A;  3QOJ A;  4H44 C;  5C0X I;  5FLM G;  3I4O A;  4HJA A;  1VQK A;  1EY6 A;  4HJ5 A;  4N8X 1; 
#chains in the Genus database with same CATH homology
 1BF4 A;  4K2L A;  1BCP D;  3C1F A;  4EQP A;  3PIO 3;  1B9N A;  1IYV A;  4V19 0;  1CQV A;  3QO2 A;  1WTR A;  1TWH B;  2NVQ B;  3KBX A;  4C3I G;  2XRQ D;  1I3Q B;  4C1N K;  3NWT A;  1B4O A;  2IX1 A;  3EVQ A;  4C3J G;  1JOO A;  1JWS D;  3RMH A;  4A3F B;  2MPM A;  3NSW A;  3T56 B;  3P75 A;  1X3P A;  1Y8O B;  3I4N B;  1CM9 A;  1EYA A;  1PFB A;  4DAP A;  1KAA A;  5DM6 3;  3HP3 A;  4K6L A;  2ICE C;  1O7Z A;  2KHS A;  2PW7 A;  4G7O C;  1F9S A;  2EJG C;  3S16 B;  3BS1 A;  4P2C B;  1MGS A;  1DZ1 A;  1SNQ A;  5E4W C;  5CV9 A;  3DHQ A;  1C4Q A;  1O80 A;  4LK1 C;  1K8M A;  5JVH 3;  1F77 A;  1Z7T A;  1HFG A;  3DWA A;  2TMP A;  1SDF A;  2NUC A;  1NCV A;  4OO1 H;  5E3F A;  3ONA B;  2PO4 A;  2K05 A;  2BE5 D;  1Q90 A;  2O4X A;  4XDX A;  1DJR D;  4X3K A;  1SE4 A;  4L63 B;  3H3V C;  2VB3 X;  3BVZ A;  4Z9C B;  3BDC A;  3MC0 B;  3FDT A;  2F0M A;  2BCO A;  2JA8 B;  1QWY A;  4OIJ A;  2KQ3 A;  2KEC A;  2NZ1 D;  1ZYR D;  4MHE A;  3C3L A;  4IN3 A;  1FNU A;  1E0B A;  1NR4 A;  1KLG D;  2SNM A;  4DNT B;  2Z8L A;  2K28 A;  5COY A;  4C2M B;  1EOT A;  3LWU A;  1U9R A;  3D3R A;  2WKD A;  3FRP B;  1PTO F;  4DAV A;  2F0I A;  2HCC A;  3A55 A;  3P20 A;  2KCN A;  5KNB A;  1SNP A;  3OHX C;  1EZ8 A;  4K6D A;  3V05 A;  2DNE A;  1JQY D;  1RKN A;  2WKC A;  3P7J A;  2WAQ B;  3R8B A;  1AN8 A;  2K5Q A;  4ZKB B;  1EEI D;  1BNZ A;  3A8I E;  2PZT A;  2EY2 A;  1PFN A;  4ZLT F;  2FJ2 A;  1TY0 A;  5IOC A;  4L6T B;  5ELE A;  2AQ1 B;  1I4G A;  4OGQ C;  1EY8 A;  5CV5 A;  5IGB A;  2NVX B;  4CKC A;  2K32 A;  3P1H A;  2JA7 B;  4F7X A;  1TWG B;  2JEB I;  3VYU A;  1SMY C;  3HOV B;  4B9W A;  1HRJ A;  2MUY A;  2JXM B;  2K01 A;  3MHB A;  4NMZ A;  2FMC A;  1ROD A;  4JBW A;  4X3T A;  3DEO A;  1A3T A;  3SR1 A;  2L12 A;  4FXK C;  3KUP A;  1JOQ A;  4KHV A;  3GTL B;  3QIA A;  3EJI A;  3U9S A;  5M3F B;  4B08 A;  4PV1 C;  2PCF B;  3GTG B;  1LTA D;  4C3H B;  4EQN A;  2EPB A;  2IL8 A;  2NVY B;  1RCV D;  3I3C A;  4DU9 A;  3WOF A;  4QCL A;  5JPM C;  3KLS X;  3S2H B;  3I91 A;  3OMC A;  4RAU C;  4KD4 A;  2F0K A;  1F2L A;  4H0L C;  1AW7 A;  3VYR A;  2F0P A;  2ZXR A;  5EPJ A;  2B2Y C;  1S5F D;  4LAA A;  3N6R A;  2YYZ A;  3LWE A;  4J6H A;  4FF1 A;  2L0C A;  2EOT A;  3NTI A;  1F9Q A;  5TSS A;  1O7L A;  5BN3 A;  3D6W A;  4NW2 A;  1MSH A;  4IFD J;  2J0T D;  2IWH A;  3VR4 A;  1A3V A;  3TZU A;  1ENA A;  1TR5 A;  4CJ0 B;  4EVO A;  1V43 A;  3HG9 A;  2R3Z A;  3H94 A;  2EYJ A;  3DWP A;  3DXJ C;  4E6I A;  3SK5 A;  3NTK A;  1I50 B;  3L7Z C;  1T5E A;  4PMW A;  3RUZ A;  4J8Q A;  1CA6 A;  4C3J B;  1U4M A;  3CQZ B;  4S3S A;  5E4X A;  5CC4 A;  2ZXO A;  5LHY 1;  4BS9 A;  3VA5 A;  1JWU D;  1EIG A;  2NN6 H;  4N9P A;  1H9S B;  2ZT9 C;  5I4D A;  4ZK9 B;  1X32 A;  1AFP A;  2E2J B;  1V1O A;  4TQU S;  1WTV A;  1CHQ D;  2KED A;  5JEA H;  1LV9 A;  1LO5 D;  1EYD A;  1HQM C;  1I4Q A;  5C0X G;  3X3N A;  2X6G A;  3HOW B;  1KDA A;  1SNM A;  4KY7 A;  3TP8 A;  2F0G A;  3MXN A;  1U4P A;  1VMP A;  1FYC A;  2OF1 A;  2SNS A;  2C5C A;  3PUY A;  2A6E C;  2PW5 A;  2X6L A;  5C5M A;  1LT4 D;  5D3I B;  1KNE A;  4RKL A;  4K8I A;  3NQI A;  4QMG A;  2J7Z A;  1STY A;  1TKW B;  5CV8 A;  5A2Q L;  2LKV A;  2F0U A;  5IGC A;  5M9O A;  5DM7 3;  1STG A;  1K8O A;  3GP7 A;  2EYF A;  4QIW B;  1D1K A;  2XVS A;  4DFA A;  2N55 A;  3W3A A;  1LLR D;  1KDB A;  1S5B D;  4ILW A;  2HQE A;  4XYQ A;  5C3E B;  5K36 G;  5KIX A;  4IFD H;  1TII D;  4IUV A;  1EYC A;  1R9T B;  1L0Y B;  1VMC A;  1L0X B;  3URY A;  3NP8 A;  4HED A;  3FEW X;  1EQV A;  3C2P A;  1LT3 D;  1C48 A;  3K57 A;  5J22 A;  1YNJ D;  4K14 A;  3WOE A;  1A6X A;  1LTI D;  5IT9 L;  3Q24 A;  1Y69 U;  1AZP A;  5A2Q E;  3S17 B;  2EXZ A;  2H4O A;  4FXG C;  1LTR D;  3QWN A;  2F0V A;  3MFG A;  3J7A V;  2Q8T A;  2QEJ C;  1I6V C;  5JOB A;  3NQT A;  5G3L F;  4KMU C;  5D65 A;  4ULL A;  1WTW A;  1IKM A;  5A35 A;  2NTT A;  4CJ2 C;  2F0Q A;  3OSO A;  4DF7 A;  5C4J B;  3K0Y A;  1TY2 A;  5AFW A;  1LAB A;  3T53 B;  2Y0S B;  2SDF A;  1G2T A;  1UNS A;  4AYB B;  3RZD B;  4OHJ A;  1KTK A;  3Q0A A;  1WD0 A;  4A3G B;  2WV6 D;  1DM0 B;  2L11 A;  1HCZ A;  3FMC A;  5EKL A;  1BOS A;  1JR0 D;  1SYE A;  1IHZ A;  1J9O A;  5ELB A;  2ID0 A;  1QNU A;  1CZG A;  1ENC A;  5IT9 E;  3CRL C;  1LAC A;  3T51 B;  1DCZ A;  4TKO B;  2K33 A;  3QJY A;  2PQE A;  2NB0 A;  2RQX A;  1XXG A;  2HDL A;  1HXY D;  4HMJ A;  3JAM L;  4BBR B;  3OPO A;  2FHT A;  2L5T A;  3NHH A;  1DOK A;  3A8J E;  2SOB A;  2HDM A;  1B9M A;  3D4W A;  3MA2 B;  4YIJ A;  1CZW A;  1ESF A;  3VA7 A;  1XX8 A;  3OWF A;  1XWE A;  1PZI D;  2CVR A;  4PMC A;  5CMD A;  4CJ1 B;  4CBV A;  5C6A A;  2F0S A;  1SND A;  2JP1 A;  5EKI A;  1ZXT A;  1ESR A;  1QCB D;  1H9J A;  3S15 B;  3SDZ A;  2F4I A;  1EL0 A;  1GUS A;  2KVM A;  3D6C A;  2R6G A;  4U67 3;  3DEP A;  2NYZ D;  1TS5 A;  2FMM A;  4GZY C;  1DOL A;  2DY8 A;  4N9T A;  1LTS D;  2CW0 C;  2L1B A;  3HZX A;  3S1Q B;  2K04 A;  3BDO A;  3JAM E;  3FPP A;  3NTH A;  4G7H C;  4HMI A;  2F0N A;  4XYO A;  5DNF A;  1KLU D;  3R93 A;  4RWS C;  5EGT A;  1I6H B;  3J81 L;  2KCC A;  2MHV A;  5EPL A;  1EWC A;  4DXG A;  2EJM A;  4DXF A;  3VYT A;  1TWC B;  1Q3L A;  1LT5 D;  3I4M B;  2D2C C;  5JPN C;  4IUR A;  1EY5 A;  2DY7 A;  2FFK B;  1H9K A;  1SEB D;  1NAP A;  3S14 B;  3NBH A;  3R2T A;  3J7A F;  4WFN 3;  1PTO B;  5ELD A;  1D5Z C;  3UI2 A;  4DN4 M;  5C5L A;  5C0X J;  1JE4 A;  3VR2 A;  3GD7 A;  2ICI A;  1SYB A;  1SYF A;  1ILQ A;  1CFM A;  2DN8 A;  1VF5 C;  2MP1 A;  4RHS A;  1CHP D;  4CKE A;  4XT1 B;  2K5W A;  1HA6 A;  1D2B A;  2QDB A;  5EBC A;  4KY5 A;  1SE2 A;  3PMF A;  3TP7 A;  3GTJ B;  4RKB A;  3HS0 C;  2KEE A;  4ABN A;  3DM1 A;  5M5W B;  3BYT B;  5LL6 X;  4QB4 A;  1RJT A;  1BCP F;  2M2L A;  4BY7 B;  5I9P A;  4DA2 A;  4EGV A;  3FVQ A;  2SEB D;  4RA8 A;  1STE A;  1ML0 D;  4QF4 A;  3MFY A;  4RGN A;  4IZ8 A;  4MN3 A;  4HN7 A;  3BVM A;  5I2X A;  1F2Y A;  1PXU A;  2A69 C;  3TP5 A;  3NWS A;  2L55 A;  2F0W A;  4IUT A;  3OOC A;  1NSN S;  2B8F A;  1SJH D;  1QG7 A;  3IL8 A;  3I90 A;  2VB2 X;  2KOL A;  2EY5 A;  1UAP A;  1JWM D;  1PTO C;  2R93 B;  4H7B A;  4K2K A;  2QCP X;  1F2Z A;  1K83 B;  2EYL A;  2L4N A;  3W2D A;  4LMQ D;  2PZW A;  2F0D A;  1VCI A;  4KKU A;  3S1N B;  1M4V A;  4IQZ A;  1I4X A;  1UUP A;  4FYD A;  2F3V A;  1HPC A;  4WOR A;  5FO9 B;  3K5N A;  1HTL D;  3FPU B;  1EFI D;  4K5V A;  1IW7 C;  1BCP C;  5NUC A;  1IYU A;  4XQQ A;  1QOH A;  3OW7 A;  1QE6 A;  2RA4 A;  1G29 1;  3D4R A;  1OXS C;  4WJW A;  5CV7 A;  2LS0 1;  2PYK A;  3MZ5 A;  4IUQ A;  5E1F A;  3KLS A;  3Q6S A;  2NWG A;  3SK4 A;  1D1I A;  2B2T A;  4R8N A;  5C0X H;  1C8C A;  4ZRZ A;  3RZO B;  2CQA A;  3SE0 A;  4XXE A;  3M85 A;  2C9O A;  5DAU A;  2IW3 A;  1MI2 A;  1KDC A;  4H13 C;  1PTO H;  3I70 A;  5FO8 B;  2A6H C;  5C4X B;  2CHB D;  3NXW A;  4B9X A;  4HTH A;  2QIL A;  3EFX D;  3T16 A;  2EYO A;  2EYH A;  1NR2 A;  2EY6 A;  1PRT F;  5CBE E;  5J1Z A;  3MXP A;  5M5Y B;  3E6Z X;  2A73 B;  5K5P A;  2KJX A;  3KK7 A;  3PV0 A;  2D9U A;  3OIP A;  5J39 A;  3QB3 A;  3H91 A;  3BDL A;  4C3I B;  3QOL A;  4ME5 A;  4KV6 A;  3EA6 A;  5CGK A;  1B53 A;  1I4H A;  4OL7 A;  4HCS A;  5JVG 3;  3MAQ A;  2E74 C;  3OIQ A;  1ZKO A;  2F0L A;  4CGY B;  1Y8N B;  5CBA E;  2BDN A;  4A3K B;  2WIN B;  3K59 A;  2BDO A;  3DWQ A;  2OEO A;  5LL6 S;  5K36 H;  4K5X A;  1B3A A;  4M8A A;  1Q12 A;  4KTA A;  3HOZ B;  2BOS A;  1LTT D;  1B2T A;  1MD2 D;  1A15 A;  2RBM A;  4V0B A;  5FKA C;  3AU7 A;  1V1P A;  2B8G A;  2JEA I;  2XWB B;  1OO9 B;  2IX0 A;  3LX0 A;  1SAP A;  3AMU A;  2RSN A;  1SYD A;  5I9O A;  4XQJ A;  1EU3 A;  2EYM A;  1PRT C;  3H0G B;  1I4P A;  4UAI A;  1CT1 D;  1DD2 A;  3VR3 A;  1AZQ A;  1S4Z A;  4OO1 I;  4KJN A;  4WRD A;  1AP0 A;  3MEH A;  3G7L A;  4BWG B;  2A74 C;  1PYW D;  2A68 C;  3TP6 A;  5ISR A;  3OMG A;  3TME A;  1BUV T;  2KUM A;  1HUN A;  2N88 A;  1SNC A;  4KKS A;  5FO7 B;  5ELF A;  2XN9 C;  1B50 A;  1G2S A;  1T5X D;  4HAE A;  2GA4 B;  5IGE A;  4RH6 A;  4G4K A;  2IPK D;  4PNY A;  1E2V A;  1O7Y A;  2LFN A;  5CV4 A;  4F87 A;  3VYS A;  3ITP A;  5BN5 A;  2WII B;  4ZAI A;  1EY4 A;  3SK8 A;  2B63 B;  1Q8I A;  4A3I B;  3EQL C;  3I4L A;  1TU2 B;  3H6M A;  2NN6 G;  3GTO B;  3TSS A;  3KF8 A;  1GUO A;  4IUN A;  4Y7N B;  4XTC S;  1STN A;  5F2D A;  3A56 A;  2JSO A;  2EY1 A;  1GHJ A;  5IIF A;  4KN4 C;  3H09 A;  1BO0 A;  4XT3 B;  1NUC A;  3MTS A;  3OWE B;  4EQO A;  5JEA G;  5KND A;  4ZUI A;  3PO3 B;  4RCO A;  3CHB D;  3T4A C;  5KNC A;  1F2M A;  3D31 A;  2K03 A;  2IJ0 A;  1RTO A;  1GUT A;  1DYQ A;  1ONL A;  2Q8I B;  2BA0 A;  1JOK A;  2D5D A;  2M9V A;  2TSS A;  3HGB A;  2Z4H A;  1OXT A;  4J1M A;  2OT2 A;  4MIU A;  2F0E A;  3S1M B;  4FNF A;  5FOB B;  4FF3 A;  3ERQ A;  2L9H A;  4ZYS A;  3HKZ B;  1ICW A;  5EBD A;  3M7G A;  1PDQ A;  1SSO A;  3S1R B;  4A3B B;  4FO2 A;  3V96 A;  5KEE A;  1KAB A;  1EZ6 A;  3K6O A;  1PZJ D;  2HUG A;  1WD1 A;  4C3H G;  1RHP A;  2B2W A;  2O5I C;  3WDN A;  1Q1B A;  3SK6 A;  3ND8 A;  1YNN C;  4KHZ A;  4HCE A;  1SMY D;  3HOU B;  4KD3 A;  1ENF A;  4BA1 I;  2A69 D;  5KRU A;  3L9A X;  1GHK A;  5D14 A;  5CR3 A;  1II3 A;  2RVL A;  3ERO A;  2H1E A;  1U4R A;  1SNO A;  4KY6 A;  1RF2 D;  1R4Q B;  2B2T C;  1FD7 D;  3V2T A;  4M1U B;  1HQR D;  1PTO D;  3A7A B;  2PZU A;  4U68 A;  4K5W A;  1JC7 A;  3MXU A;  1F9P A;  2BA1 A;  3GTP B;  1WCM B;  2AUJ D;  3MVV A;  5EJW A;  3GV3 A;  2V4D A;  1O78 A;  1ILP A;  1HHV A;  1CTM A;  1IKL A;  5M3M B;  2YU9 B;  1JCK B;  5C4Z A;  1D6E C;  3C1E A;  4F88 A;  1CA5 A;  1EY7 A;  1IW7 D;  2Z4I A;  3FKI B;  1OXU A;  3Q23 A;  2RDG A;  4A3D B;  2NBF A;  5T1G A;  4JK1 C;  1EQT A;  3BVG A;  1SJE D;  1PZK D;  4ZUJ A;  1WTO A;  3CRK C;  3TN2 A;  3I8Z A;  3SEB A;  3HOX B;  2XNA C;  5COR A;  4C56 C;  1E2W A;  2XRS D;  2AWO A;  3GTK B;  1A2T A;  4FP5 D;  4KN7 C;  2AWN A;  1TQO A;  1WTP A;  2F1M A;  5I6W A;  1TS4 A;  2A6H D;  5EPK A;  4ID6 A;  1BQQ T;  2G9D A;  5KYI A;  1CK1 A;  1WVL A;  2HCI A;  1B1Z A;  2NN6 I;  4KJO A;  1B44 D;  3R2I A;  2R61 A;  1S5D D;  2EE1 A;  2B39 A;  1A2U A;  2MGS A;  3TDQ A;  4IAL A;  3KLR A;  2X69 A;  4A3J B;  4RFB A;  2RDH A;  5JJZ A;  3KBG A;  1GUW A;  1STB A;  3S2D B;  2F0F A;  1QB5 D;  1SXT A;  2WAC A;  2EZV A;  1EWH A;  1STA A;  3Q22 A;  2F0J A;  1RTN A;  1UEA B;  5I2Y A;  5C3W A;  2G9H D;  4X3U A;  3L3O C;  1AEX A;  1SBB B;  3J81 E;  5I6Y A;  1STH A;  5C44 B;  1GXD C;  5ELC A;  5HUR A;  1W6K A;  1YNJ C;  1BCP B;  1J8I A;  2IT1 A;  4QUF A;  4RGO S;  1EEF D;  3IFT A;  3E5S A;  2B2U A;  3NPP A;  1HTP A;  4UDU C;  3NUC A;  3N52 A;  5IOD A;  1PRT D;  2A6E D;  3E0J A;  4XIG S;  4F8M A;  5IGG A;  3CKI B;  3GO5 A;  2F3W A;  3GTM B;  4ODG A;  2EJF C;  2RDF A;  1H9S A;  2A68 D;  1ZEQ X;  3D4D A;  1FR3 A;  3M3Y B;  3PO2 B;  3M4Y A;  4DK0 A;  5D3D A;  1HUM A;  4BA2 I;  5IGF A;  4IFD I;  1SYG A;  2DNC A;  2D62 A;  4C1N I;  4OO1 G;  3I72 A;  1G91 A;  1S5C D;  2ZXP A;  2JA6 B;  3VR5 A;  1EIH A;  3CU7 A;  4KKT A;  1CI3 M;  4BBS B;  1G8Z D;  1GOZ A;  1S5E D;  5DEH A;  3PUZ A;  5JEA J;  3IAY A;  4IUP A;  1SFO B;  1EU4 A;  3AB9 A;  1EY9 A;  1Q1E A;  3U9O A;  1TS2 A;  2VNU D;  2B2V A;  1FGB D;  4RHR A;  3GQB A;  1XYI A;  2B2W C;  3K5O A;  2E76 C;  4DNR B;  5KYL A;  2JYO A;  2WP8 J;  4KK7 A;  4FXD A;  1M8A A;  4ZKC B;  1DON A;  2R7Z B;  1E2Z A;  4NDX A;  2PMZ B;  2O5J C;  2JA5 B;  1GUG A;  3J80 L;  1FNW A;  3PUX A;  3BZD B;  2R92 B;  3RLF A;  4I7Z C;  1WTQ A;  1MSG A;  4PMB A;  2XIW A;  2E2D C;  1PRT B;  4R9W A;  3HRZ C;  1F9R A;  4TRD A;  1QJO A;  3A54 A;  1H9R A;  1XTC D;  4OIK A;  4NKL A;  1TVX A;  5KGU A;  1IL8 A;  4DK1 A;  2E75 C;  2AUK A;  3I73 A;  3LNN A;  4HR7 B;  1RDP D;  1ET6 A;  1BBX C;  3S9W A;  1GUN A;  1MBY A;  2VUM B;  1YNN D;  1JB3 A;  2XSC A;  4IUU A;  5EKK A;  4NP5 A;  4O42 A;  4DAY A;  1HA5 A;  3BG3 A;  2BE5 C;  5IGD A;  3SXH A;  2E2I B;  4DGZ A;  3IKJ A;  1RD9 D;  4ZQ3 A;  3J80 E;  2F0T A;  3X3M A;  3GV6 A;  1W6J A;  3HEJ A;  4K8J A;  2VXW A;  1SE3 A;  2WB1 B;  1ZYR C;  5BN4 A;  2M00 A;  3DUZ A;  5G3L D;  5C3X A;  3PUV A;  1JOR A;  3A7L A;  3C46 A;  1R4P B;  4CKB A;  1GJX A;  2AQ2 B;  3SVM A;  5FK9 C;  5JAV A;  3VR6 A;  2O2L D;  1BDO A;  3PIP 3;  1OXV A;  5FLX L;  2AQ3 B;  2EYP A;  1TS3 A;  2CW0 D;  2QF7 A;  3BYY B;  3R3O A;  3TBI B;  1I4R A;  1Y1W B;  2F03 A;  3K58 A;  4HSP A;  3D8G A;  4I65 A;  1WTX A;  2LMC B;  3PUW A;  4Q0F A;  3ND9 A;  1X3Q A;  2NVT B;  5CYU A;  2EVB A;  3K5L A;  2Q8R E;  1Y1V B;  1DXM A;  2K5D A;  4O1N A;  2FIN B;  1LTB D;  1JIC A;  2RSO A;  5M5X B;  2RKS A;  4X3S A;  2JE6 I;  4G57 A;  3HOY B;  1TT2 A;  3T13 A;  4A3M B;  1LTG D;  4FF4 A;  3ZYY X;  1FNV A;  1TWA B;  3O13 A;  2B2U C;  2EDG A;  4RGT A;  1G6Z A;  5FLX E;  3NE5 B;  1KNA A;  1VDZ A;  4FVM A;  4HSV A;  1Z6H A;  1LT6 D;  1V8Q A;  4RCN A;  2E2H B;  4BY1 B;  1TWF B;  3QG1 A;  1VF7 A;  3F2U A;  2K6A A;  3M7N A;  4A93 B;  2QKI C;  1CQF A;  1EY0 A;  3NK9 A;  3J7Y W;  4RGM A;  1A3U A;  3G6J B;  3MXG A;  4A3E B;  4TSS A;  3SHL A;  1OXX K;  4XQN A;  3RD4 A;  2KA7 A;  3A8K E;  1Z47 A;  2PNR C;  2J4X A;  4QUC A;  5T1I A;  1PLF A;  2A5H A;  1H9M A;  3DMU A;  2I07 B;  5EQ0 A;  4PQX A;  1D5X C;  2F0O A;  1PMR A;  2B2V C;  1D5M C;  5HGT A;  2I46 A;  1U4L A;  1Y8P B;  2XWJ B;  1QIL A;  1QNK A;  3GTQ B;  3K5M A;  2LY7 A;  1BR9 A;  3MWY W;  2ENB A;  3IFD A;  5CV6 A;  2F0H A;  1DOM A;  4FF2 A;  4R8I A;  2IX3 A;  4KI0 A;  3TZD A;  3K7A B;  1V1P B;  1ET9 A;  4Q5V A;  1HFN A;  3NBI A;  4CHT B;  2MJ8 A;  2K1B A;  2PPB C;  4IFD G;  4L8J A;  3M4O B;  2B2Y A;  1PFM A;  5C4H A;  2K7V A;  2OXP A;  4LJZ C;  2Z1C A;  2NTS A;  1BXT A;  4G7Z C;  1SYC A;  3QOJ A;  4H44 C;  5C0X I;  1EY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...