2NWGA

Structure of cxcl12:heparin disaccharide complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
MKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine,signaling protein
molecule keywords Stromal cell-derived factor 1
publication title Structural and Functional Basis of CXCL12 (Stromal Cell-derived Factor-1{alpha}) Binding to Heparin
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 68
sequence length 68
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2nwgA00
2BDNA 2KUMA 2RSOA 2MGSA 4IUQA 1VMCA 2KEDA 4IURA 4IUPA 3FDTA 1EOTA 1PDQA 1O80A 3I91A 5EKIA 1IKMA 1GUWA 3I8ZA 4X3KA 4HEDA 2NWGA 5EPKA 1U4MA 2HUGA 3HP3A 5EPLA 2B2WA 3FPUB 4ZLTF 1HRJA 4CJ2C 3N52A 4LMQD 1U4RA 1B53A 1ESRA 4X3SA 1QE6A 2K1BA 4CJ0B 1HUNA 1EL0A 3R93A 2HDLA 1WTRA 2HCCA 5CORA 4QUFA 1DOLA 1U4PA 2FFKB 4NW2A 2DY7A 3KUPA 3P7JA 3Q6SA 5CBAE 3TZDA 3I90A 3MTSA 5EJWA 1MSGA 3G7LA 2L4NA 1F9QA 1NR2A 3GV3A 3H91A 2RSNA 4RA8A 4DN4M 1PFNA 2HCIA 1HHVA 2N88A 1IKLA 5AFWA 2B2WC 2DY8A 3KBXA 1VMPA 1QNKA 2K28A 1RTNA 3IFDA 4IUUA 5D65A 4HAEA 1NCVA 2B2YA 2NYZD 2FJ2A 1A15A 3UI2A 1CA5A 1EIHA 4UAIA 4O42A 4X3UA 4ZK9B 4XT1B 1F2LA 1Q3LA 1WTQA 1G91A 1EQTA 1WTOA 1RJTA 1JICA 2RA4A 5T1GA 2MPMA 3I3CA 2EOTA 4MHEA 1HUMA 1ML0D 4ZKCB 1WTVA 5JJZA 3MWYW 4XT3B 3SVMA 1B50A 4MN3A 1G6ZA 1ICWA 2B2UA 4IUTA 3IL8A 5CBEE 3DEPA 1WTPA 4ZAIA 1AZQA 1BO0A 4R8IA 2HDMA 1MGSA 1BBXC 1BF4A 1ILPA 3QO2A 3DEOA 4OIKA 4RAUC 5EPJA 2X6LA 2B2YC 2K01A 2KECA 1O7YA 3D6WA 4U68A 2Q8TA 5E4XA 2KVMA 1TVXA 1AP0A 2K04A 1B4OA 3ONAB 1DZ1A 1F9PA 3TN2A 4ZKBB 1KNEA 1X3QA 1PLFA 1X32A 2SDFA 2EE1A 5DNFA 1DONA 1S4ZA 1PFBA 2K03A 2MJ8A 5T1IA 1WD0A 1DOKA 1SAPA 2RVLA 2B2TA 2D9UA 2L11A 2M2LA 1U4LA 1KNAA 4HCSA 2J7ZA 1QG7A 1CA6A 2FHTA 1F9SA 1EIGA 1MSHA 2EPBA 4RWSC 5EQ0A 1WVLA 2KOLA 1ILQA 1F9RA 1HFGA 2B2VA 1PFMA 1G2SA 4CJ1B 1J8IA 2H1EA 1G2TA 4IUVA 1HFNA 1J9OA 1AZPA 2N55A 3F2UA 5E4WC 2L12A 1RTOA 2X6GA 5D14A 1B2TA 1X3PA 1LV9A 4OIJA 1XYIA 1NR4A 1MI2A 1RHPA 1SDFA 3GV6A 1WTXA 2VXWA 4XDXA 4QUCA 1NAPA 1WD1A 2JYOA 1WTWA 2FINB 4HSVA 1IL8A 3DM1A 1B3AA 2B2TC 2FMMA 1M8AA 1XX8A 1JE4A 2K05A 1SSOA 2R3ZA 5COYA 2L9HA 1O7ZA 2CVRA 2B2UC 2MP1A 1CM9A 1ZXTA 2JP1A 2NZ1D 1E0BA 2B2VC 4R9WA 1C8CA 2XIWA 1DOMA 2KEEA 1HA6A 4X3TA 2X69A 5CMDA 1BNZA 3LWEA 2Q8RE 1RODA 2L1BA 2IL8A
chains in the Genus database with same CATH superfamily
2KUMA 5C0XJ 1O80A 3CMAA 2E2HB 2IJ0A 3S16H 4RGMA 2MHVA 3PIP3 2PO4A 1HRJA 3NTHA 4C2MB 1SFOH 3S2DH 3M4PA 1SNPA 3S1RH 5BN5A 1D5ZC 1E24A 3S14B 1I4QA 3AB9A 2OT2A 5AJ3L 3I90A 5C3EH 3G7LA 1D5MC 4GLVB 1XPRA 2F4VL 1STHA 3GV3A 4LFAL 1AE3A 1VQAA 3OWFA 4A3FB 4QQBX 3KF6B 1EY0A 1IKLA 1K3RA 1OXVA 1PZID 2KBNA 4LW1A 5KRUA 1GHJA 4RH6A 2DNEA 3DHQA 4A3CG 3EFXD 3HOZH 3D31A 4J15A 4AQYQ 4LK1C 5DEHA 4FYDA 1UUPA 5IYCG 4DAYA 5E1FA 4CBVA 4R4TA 2HHHQ 2VUMH 1MJEA 3CCEA 1B44D 3CPWA 1SJED 4JI1L 4OO1H 3VYTA 5FLXc 2NVYB 1EWIA 1MIUA 3J81L 2YU9B 4OIKA 4ALPA 3HOYB 5JVH3 4RG1A 2R61A 3BJUA 4DV4L 1G51A 4JCVE 3PO3H 1LTRD 2CHBD 2HIVA 3HKSA 4JOIC 4P74A 2K5DA 1WCMB 1NJIC 3HOXH 3CRLC 2VW9A 4IALA 3K81C 1KHIA 1PFMA 4C3JB 3PMFA 1Z47A 1AZPA 3F2UA 1GHKA 2XVSA 1I6VC 1JR0D 3NPPA 4N8FA 3T56B 1XNRL 1VQ4A 3MEFA 3L3OC 2R7ZB 3D4WA 5CYUA 5A2QL 4A3DG 1D7QA 1YBYA 1SMYC 2K05A 2SNSA 1I4XA 3QOLA 4FO2A 1A3UA 2HQLA 1PV4A 2MP1A 1CM9A 4A3MH 1DCZA 4UY8C 1WFQA 2RDHA 4C3IH 1STGA 2NN6I 3LWEA 1V8QA 2F4VQ 4B3MQ 4LFAQ 4A3JG 2VY3A 2QKIC 4MZ9A 2DUDA 5J39A 2ASBA 3AMUA 2B29A 1UE5A 3M3YB 1NUCA 3NHHA 4K5VA 1QE6A 2K1BA 3STBC 1NNXA 2YV5A 2UXDL 1ENFA 2JA7B 3MXUA 4BS9A 5LMNW 4DV2L 1N33L 5HGTA 1K28A 2PW5A 4JI1Q 1B8AA 2D62A 2BA0A 1O7IA 5M5XB 2B8GA 4ULLA 3PO2G 5FOBB 3PUWA 2OEOA 5CV7A 1S5DD 3FRPB 1Q90A 2A6HC 3E0JA 4HJ9A 2ZTEA 4QIWE 1MKHA 2WIIB 5C3WA 2PNHA 4EVOA 2XWJB 3CHBD 5H1SE 4DV4Q 1RJTA 1EY4A 1UEAB 3NEMA 2EOTA 3RLOA 2IT1A 1PYSB 2N78A 2C5CA 2KCTA 1BQQT 2EDGA 4HR7B 4YY3Q 2V4DA 3GTGH 2A68C 3D4DA 1CZGA 2Z9HA 3G6EA 4RAUC 1PZKD 4X65L 1C9OA 4ZQ3A 2K04A 2ZM6L 1XNRQ 3T4AC 3W1GA 1TWAH 4YIJA 2K75A 3BS1A 3X3MA 5C0XH 5NUCA 1PH3A 4G4KA 2F0IA 5C4JB 3RZDB 1ASZA 2CH4W 4L5QA 5C3EG 1S5CD 2JXMB 1J8IA 1KLUD 4XXEA 3FHWA 3MAQA 2ZJPA 1PH1A 3PF4A 5C4HA 4MNOA 2XNAC 1GXDC 4UP8A 4DAMA 1B2TA 1F2YA 1IW7D 2DJFC 3NBHA 4EQNA 4J6HA 5LHY1 1MI2A 2EYOA 3G4SA 4CDFC 4WFN3 3BDLA 1GKHA 3T1YL 3HOZG 3P20A 1H9SB 3QWNA 3NXWA 3K58A 2FMMA 4DFAA 5JOBA 2G9DA 1FYCA 2JQOA 2JA8H 4L6TB 4WRDA 1C8CA 2XIWA 1A62A 4HMJA 4IPCA 1RD9D 1RODA 1TQOA 3A5ZB 2RSOA 1N33Q 1HCZA 1VMCA 4LF8L 2Y0SE 1LTID 5EPKA 2LFNA 5M3FB 3N6RA 3K5NA 3F2DA 1DM0B 1O78A 5JVG3 1XXGA 2PPBC 4XYOA 1ZYRC 3PO3G 2KCCA 3OHXC 5JAVA 1D1KA 2E74C 4GOPA 4QUFA 1U4PA 3HOUH 1JJCB 4Z9CB 3HOXG 5EJWA 1MSGA 5D3DA 3CCJA 1F9QA 3ITPA 3PGZA 1PFNA 5CV6A 4LFCL 4DR3L 2Q2TA 2E8GA 4A93H 3A74A 4L8JA 2H4OA 2ZM6Q 2K6AA 3M85A 4IFDI 4GOPC 1PRTC 1EY9A 3RNUA 1EIYB 4KN4C 2RA4A 1NE3A 1JB7A 2IX1A 2YTVA 1D2BA 3MWYW 4HSPA 4MTKA 4DU9A 3AEVA 2EJFC 4A3MG 1FR3A 2R93H 1E1OA 3BDOA 4C3IG 2CQOA 4POGA 2EY1A 3M7NA 1HZ9A 4IUNA 3DEOA 4U68A 3K80C 5KIXA 4BBRB 3IAYA 1I4RA 4KKTA 3CF5A 1X32A 2GA4B 1ESFA 1BBUA 2C9OA 1WTHA 4NPSA 1CA6A 2Y0SG 1F9SA 3M9BA 3HOVH 3TDQA 3CCVA 2JEAI 2D0PA 1F9RA 3Q22A 5FJ8H 1XMOL 2ICEC 2OF1A 2H1EA 3OWEB 2NVXH 4DV6Q 3M4YA 3S16B 4QGUA 3A5UA 1X65A 1I6HH 1R9TH 3AQQA 3CKIB 1PH7A 4EX5A 3U58A 4B3TL 4LF8Q 1A0IA 2I5MX 1CKNB 2F0JA 3NK9A 3S1RB 3LGJA 4IZ8A 4QMGA 5COYA 1VQ5A 2CWAA 4FXDA 3EN2A 4O2DA 1O7ZA 3E5SA 1I3QB 1SLJA 2PMZE 4IOAA 3H3VI 1N9WA 4HIOA 1BR9A 2QEXA 5C44B 1YNJC 1JWUD 1Y1WB 1QCBD 3IFTA 4DR3Q 2NZOA 4LFCQ 3TREA 3ZYYX 3HOZB 1AFPA 2UUCQ 1EY8A 1U4RA 3PIO3 1M1KC 4IQZA 1HZCA 1LM0A 4CKEA 2VZAA 2VUMB 4R4CA 5IGCA 5C0XG 2AWOA 1PYBA 1CK1A 1OTCA 3KUPA 2OQKA 4QIWB 5DM73 3VR6A 2EYJA 4A3KH 4JV5L 2HCIA 2Z4IA 3JAML 5AFWA 4A3BH 1DXMA 1SRUA 4OEMB 2NVTH 2E5LL 4OX9L 1IYJB 3VA7A 2RKSA 2Z6KA 2K5HA 2JA9A 3KLSA 1AW7A 3ERSX 3PSIA 1N32L 1RF2D 1VQCA 3STBD 4BY7H 2JA5G 1B9MA 1FNVA 2PYKA 4UDUC 1AH9A 1GUGA 4DF7A 2KQ3A 5FLMH 3QO2A 1XMOQ 1PH9A 4KLKA 5C4XH 3A55A 4DNTB 5DM63 2MFIA 2R7FA 2RCFA 4B3TQ 4YWMA 2TSSA 1UAPA 3CCUA 4C3IB 2OQ0A 5C3XA 1SJHD 2J7ZA 3HOUG 4DUZL 2EPBA 4K8JA 5GAHC 2AUKA 1B1ZA 2K5WA 3KYHC 1QB5D 1CHQD 3OSOA 1J9OA 1LABA 3UDXA 2O5IC 2F0HA 2L12A 1TU2B 3EQLC 4A3EH 2B63H 2X6GA 4C56C 1U0LA 1NTGA 4A93G 2EYHA 1WTWA 4HSVA 3OMCA 1JJGA 4PZ8A 5IP7H 2LKVA 2CVRA 4KTAA 3KLWA 3GO5A 1SMXA 3E6ZX 2R93G 1YZ6A 4X3TA 4A3GH 1PTOH 2HD3A 1E1TA 2NVQH 2F0FA 4R4QA 1L0WA 4IURA 2KHIA 4OWWB 4JV5Q 4PV1C 3J81c 4DPGA 5M3MG 2Z4HA 3U50C 4BA2I 1EOVA 1PRTB 1YNNC 2E5LQ 4OX9Q 1S5BD 1TWGH 1XTDA 2QF7A 4LF6L 2ZXRA 5EKLA 2L0CA 2I46A 4DNIA 4JW0A 3GTOB 3P7JA 1KDCA 1N32Q 2DN8A 3J7A5 3MTSA 3SDZA 3GTGB 3PUZA 3SK8A 2L4NA 3HOVG 2JA6H 2F0GA 4DR1L 5K36H 3CP0A 1M4VA 4RA8A 1S5ED 1ICFB 2R92H 2CW0C 5FJ8G 3U4ZA 3S1MH 5J1ZA 2N88A 3FKIB 5C4ZA 2YTXA 3I55A 4UP7A 1STBA 2K33A 1V1PB 3LWUA 4UAIA 2JN4A 3S1QH 2YYZA 4XQNA 3VYSA 2CH4A 4MHEA 4ZKCB 1T5EA 2PZTA 3ZJYC 5FLXE 4NXNQ 4DV1L 3I4OA 2DNCA 2ES2A 4IPHA 1W6KA 4DUZQ 4F7XA 3GTKH 4YWLA 4DV0L 1K0RA 2E2IB 5I2YA 2Q8TA 2RF4A 3K7AH 4OONA 1R4PB 1KLGD 3HKZE 2VNUD 3MXNA 1JOQA 4BY1B 2JA8B 1DONA 3S2HH 2B2TA 3HEJA 3O13A 3T13A 2R7DA 3TP8A 4DAVA 3BVGA 1QG7A 4AIMA 2CQAA 1HFGA 2B2VA 1G2SA 5KYLA 2A1AA 4A3KG 1EFWA 1JCKB 1GUNA 5IT9L 2N55A 3I73A 4WORA 1QOHA 1H9MA 3VR4A 4A3JH 4DUYL 3I4MH 2OXPA 5D14A 1X3PA 1CT1D 2PMZB 5TSSA 1NR4A 3S1NH 3TZUA 2EYMA 3K6OA 2FINB 3DM1A 1B3AA 2K5VA 2B2TC 1HQMC 4KV6A 1JOOA 2R3ZA 1SNDA 4JG2A 1LTAD 2ZXPA 1LLRD 2BH2A 3E0EA 2BA1A 2K4KA 3GTMB 2B2VC 4R9WA 3RLFA 4BY7G 1EU4A 3TP5A 2UXBL 3L0OA 3HZXA 1BNZA 2SOBA 4HJ8A 4QJFA 4R4OA 4DR1Q 3U4VA 1SNQA 5C4XG 2XGTA 3TSSA 4RFBA 4CJ0B 3J7ZC 1Y1VH 4KY5A 2RQXA 2F0TA 2EJGC 4LF5Q 4HCEA 2FFKB 1SE4A 1Q7YC 4QF4A 1KDBA 4A3LG 1GO3E 1GJXA 4CDDC 4UHVA 4JI5L 4KKUA 3A56A 3WDNA 3J7AF 4DV1Q 3HKZG 3IKJA 1YNXA 1KQSA 4BBSB 4DV0Q 4A3EG 2B63G 1VQHA 2B2YA 2A69C 2D5DA 1YHQA 3EIVA 2WKCA 1STYA 5IP7G 2F0PA 4FDBA 1ML0D 3HOVB 2DGYA 2B2UA 5I9OA 2AQ1B 3IL8A 1EYDA 2CFMA 4FP5D 3R8BA 1JORA 5IYDG 3K0XA 1VQOA 4A3GG 1A2UA 1I6HB 1HA5A 2G5DA 1I4PA 3G6JB 2B2YC 4ZRZA 2KVMA 1TVXA 1GM5A 4Y7NH 5FK9C 1STAA 1TS2A 4CKBA 3NTKA 2I5LX 4DUYQ 4KHZA 1DGSA 5BN3A 1L1OA 1DZ1A 3KDFA 4ZKBB 1FD7D 2D2CC 4YCUA 3UDFA 4DK0A 4DGZA 2EE1A 1Z7TA 1S4ZA 3MXGA 4ABNA 4JC0A 4K2KA 1MSHA 5KNCA 1VQ7A 3HS0C 1UNSA 5BR8L 4BXXH 4P71A 2JA6G 5K36G 2UXBQ 2R92G 2FMCA 1Q1EA 4QY7A 3CMEA 2I0QA 1XNQL 1RHPA 1F2MA 1IXRA 4F87A 4LNQA 2PZUA 1R4QB 1SYEA 1GUOA 3BVZA 1I50B 1T9HA 1JB3A 1E3PA 1ZKOA 1SE2A 3SHLA 1HJPA 1E0BA 3AFQA 4X64L 4A3KB 1V1OA 3K5MA 4A3BB 4JI5Q 3PIOA 5LL6S 1LTSD 3I91A 1LTLA 1CFMA 3KFUA 2E76C 2A6EC 3R3OA 3HOWH 3I7FA 2EJMA 4DNRB 5GAEC 3R93A 3J81i 3GTLB 1SNOA 4KHVA 2EXDA 3DWPA 1EWCA 1EQRA 3H0GH 4RCNA 5ELNA 4EQPA 5AJ3Q 2BE5D 2LXJA 4EQ5A 1QVCA 1XWEA 5M5WH 3MA2B 3I4MG 2QW7A 1NMGA 2PQAB 4P73A 1LTBD 2EIFA 4IOCA 4FNFA 5ISRA 1PH6A 3I70A 3G71A 1EQTA 1SE3A 3I4NB 1CKNA 5IYBH 1EFID 1Q1BA 1QVFA 5ELOA 4JBJA 3OPOA 5M5YB 5HGQA 3HKZB 4NP5A 1WTPA 1K3BC 3CC2A 4KJOA 2JJQA 2JE6I 4DK1A 4LF7L 5EPJA 3Q23A 1BBWA 1O7YA 1EEFD 1FGUA 1D8LA 2FXQA 3GP7A 4CDEC 4UPAA 1GUSA 1X9NA 3RUZA 1PLFA 1TWFH 1Y1VG 4HN7A 3FPPA 1P16A 4OO1I 1TWCH 1PVOA 3M4OH 1SEBD 1PTOB 5I4DA 2WP8J 1TWHH 2FHTA 1K8AC 4A3GB 5EQ0A 4DK6C 2NVQB 1AN8A 4K6LA 1STEA 1G2TA 2JSOA 4A3IH 1K8GA 3W5OA 3L2PA 4LFBL 4XIGS 3JAMc 5E7NA 1XYIA 2EYPA 4NB3A 3GV6A 3UE0A 1BVSA 4L5SA 3ND8A 2D0OA 4DR6L 3M4QA 3NELA 1RL2A 3V2TA 3D6CA 1K8OA 2RDGA 1CKMA 2A8VA 2ID0A 5GQOA 4B9XA 4A75A 1WI5A 2LXKA 3S17H 3ND9A 1YJ9A 3V96A 3CCRA 2XSCA 5CV4A 4JI4L 1W2BA 4DR5L 1GUWA 4PMCA 3TS2A 1TR5A 2EQSA 3S9WA 4DR4L 3N52A 4LMQD 3S1QB 4C3HH 3NE5B 5LMUL 2HDLA 1NSNS 2AQ3B 3NQIA 5EAYA 2DY7A 2UXDQ 2JA5H 4WJWA 2XTIA 4BXXG 1NR2A 3H91A 1VQGA 3RD4A 3CU7A 3T51B 1CHPD 4DV2Q 1LT4D 1STNA 2N8NA 2DY8A 3AFPA 2HT1A 3K7AB 2UUBL 4ME5A 2EY5A 4LF7Q 2ENBA 2NYZD 3E3XA 1PTOD 2I5HA 4OXPA 2XN9C 5KNBA 4O1NA 4A3DB 1D1IA 1DD2A 1OXXK 2F0EA 1I94L 2BOSA 2KA7A 4PMBA 3S2HB 2GVAA 4IPGA 1HR0L 5K5PA 2M00A 3SVMA 4P2CB 1VQEA 4IO9A 1LYLA 1VQIA 1PZJD 2VL6A 4PMWA 4ZAIA 4CGYB 4TRDA 4A3JB 1OXUA 3R2IA 1BF4A 4JI3L 3S24A 2GN5A 3TMEA 3S1NB 1VQLA 2EYLA 5E4XA 1VDZA 4DAPA 2K5NA 3EVQA 4BA1I 2B39A 4X65Q 4DAYB 3HOWG 1IYUA 3UDIA 1FJGL 1SNCA 4KK7A 4RGTA 4JBMA 3GTPB 4DR6Q 3G48A 2D9UA 3J80L 1QILA 5EBCA 1BCPC 1VQ8A 4TVAB 3H0GG 1B7YB 5EKKA 4KKSA 5CC4A 3PO2B 1Q8KA 1WOCA 1F2ZA 3TS0A 2LS01 5M3MH 3GTQH 3J7AV 4JI4Q 1ONLA 4DR5Q 4OELB 5C0XI 3SEBA 2QGQA 1FNWA 2JYOA 2NUCA 3GTJB 4DR4Q 1XX8A 2OWOA 3T1YQ 4OWXB 2L9HA 5LMUQ 3MC0B 2Z6BA 1Z9FA 5IYBG 4K14A 3A8JE 4PZ7A 1ENCA 4JVZA 1TKWB 2BDNA 4IUQA 3J81E 2KEDA 5D3IB 3DLLA 4IJHA 2C35B 1G291 1WJJA 4HEDA 2E2HH 2ZXOA 2UU9L 1VF7A 2UUBQ 1N34L 1SFOB 1S40A 3S2DB 4X66L 3FMCA 3KF8A 5IODA 4C2MH 1L0XB 2EY6A 1I94Q 1PMRA 1PH4A 4XYQA 3VDYA 1HR0Q 5C3EB 3ULLA 3TZDA 5ELBA 2A19A 2PW7A 1Q82C 2P5ZX 4A3IG 5DAUA 2WKDA 1XMQL 1C4QA 4RGOS 5IT9c 2MO0A 3I72A 3NWTA 2ZJRA 2QA4A 1EIHA 1WYDA 3CAMA 3X3NA 1J6QA 1VQBA 2F3IA 5A2QE 2G9HD 2VQEL 1GD7A 3JC66 1CSPA 4M8AA 4AYBE 3ICEA 1HUMA 1X55A 5JJZA 4R4IA 1TY2A 4XQJA 1AZQA 3H94A 1HZBA 1SMYD 3I56A 1MGSA 3FEWX 4GNXA 2NTTA 1QUQA 2K01A 2YU9H 4N9TA 4LF9L 3HOYH 2IWHA 1KC8C 3PO3B 4C3HG 1EQQA 1Q46A 4JPBW 1OXTA 3OW2A 4XQQA 4JBKA 5DNFA 1B9NA 1PFBA 1WD0A 1SAPA 3HOXB 1W6JA 1L2FA 3OTOL 1UE1A 3HG9A 2PI2A 2Q2IA 4GNXC 4C3JH 2PI2E 2QDBA 1EYAA 2Z6KC 4OIJA 4FF3A 3C1FA 1QZGA 2F3VA 3HRZC 4QUCA 4I7AA 2E2DC 1WD1A 2R7ZH 1QJOA 1IBML 1N34Q 5GROA 1M8AA 1UWVA 3JAMi 5JJIA 3CQZH 4A3MB 2A6HD 3H0GB 4A3LH 5DLQE 4G7OC 3NBHB 2KHJA 3W3AA 3GD7A 2Q2UA 5I2XA 1HPCA 1EIFA 1X6OA 4A76A 1IKMA 4GKKL 3OYYA 3I8ZA 4X3KA 1EYGA 1EU3A 4AYBG 3KF6A 1XMQQ 1JC7A 2A68D 4V190 3PUXA 4X3SA 4V0BA 3M3YH 3AU7A 4GN4B 2VQEQ 2Y0SB 1XTCD 5G3LD 1FNUA 3C3LA 2JA7H 4LUOA 3ERQA 5IE8A 5IYDH 1JT8A 4DK3C 4A4IA 4DN4M 4ZCKA 4QB4A 1VQ6A 2IW3A 2K28A 3IFDA 4DR2L 4WJ3M 4GOPB 2AQ2B 4JI8L 4O42A 1JQYD 1WTQA 1C0AA 1BCPB 4BWGB 3VR5A 1SE8A 2WAQE 2O5JC 1TWHB 1JJ2A 1QVGA 4MN3A 4S3SA 3DEPA 3OTOQ 4JYAL 2JEBI 4ZUJA 3UDGA 1X56A 1PRTF 4KMUC 3RN5A 2B3GA 4HJ7A 2H5XA 3AYHB 3D6WA 1II3A 1RIPA 4N8X1 3PUVA 4L63B 1E2WA 5ELDA 3A7AB 1TWAB 1Y8OB 2MQHA 2V1CC 2BCOA 2Z1CA 3C46A 1V1QA 5IGBA 3QOJA 1VQDA 1IBLL 3NSWA 1K0SA 3LX0A 3L7ZC 3CC7A 5C5LA 3K59A 3RN2A 4DV7L 3D4RA 5EBDA 1U4LA 1KNAA 2O4XA 2RDFA 1BUVT 5C4JH 5ELEA 3S17B 2IHFA 1ZYRD 2TMPA 3BZCA 3K7UC 1UEBA 4KI0A 4KY6A 3RR5A 2UUAL 1HTPA 4E6IA 4JI2L 1VQPA 3MFYA 3F1ZA 1YI2A 2EXZA 1G6PA 2ICIA 2K5QA 2LSSA 3WWVA 1YHBA 4GKKQ 4J8QA 1QZHA 1LUZA 4WJ4A 5IGEA 4KD4A 1JE4A 2IX3A 1GOZA 1JMCA 1EEID 1YIJA 3TRZA 2JA5B 2F0SA 4J1MA 2JP1A 1SR3A 1DOMA 3WOEA 1PRTD 2Q8RE 1KD1C 3BDCA 3DM3A 1E2ZA 2KHSA 5JJLA 4IUPA 4LJZC 1EOTA 5FO8B 4ILWA 2O2LD 2Q2HA 5LL6X 2NWGA 2HUGA 2WAQG 1C48A 4K5XA 3FP9A 3HOYG 3W2DA 5GAGC 1ESRA 4DR2Q 4OHJA 2CCZA 3H09A 4JI8Q 3TP7A 3Q0AA 3HOUB 4NW2A 5IGGA 1HNZL 4LF6Q 4LWCA 1PXUA 5IIFA 1YHAA 3DXJC 1IW7C 2WACA 1HZAA 5BN4A 4JYAQ 1C7YA 2L5TA 4AYBB 4C3JG 4X62L 1Z6HA 3A8KE 3BG3A 3E9HA 4RHRA 4K5WA 5ELCA 5D65A 4A93B 1NCVA 4X3UA 2R7ZG 3CD6A 1G91A 1WTOA 1SNMA 1IBLQ 3CXCA 2R93B 1KRSA 4DV7Q 5CBEE 3KLRA 3SXHA 3TP6A 1TY0A 1ENAA 3K8AA 5M3MB 1MJCA 1EZ8A 2UUAQ 4CDCC 2KECA 4JI2Q 4G7HC 2XRSD 3T16A 4IFDJ 1YNJD 4BBRH 4UP9A 2J0TD 4QL5A 1DJRD 4AH6A 1H9SA 4APVA 1YJWA 1SROA 2JA7G 4RWSC 2IY5B 2KOLA 2K32A 2NVXB 2R6GA 4OGQC 1BXTA 1FL0A 5CV5A 4H13C 4KY7A 3JAME 2NN6H 1R9TB 1IL2A 1EZ6A 1PH8A 1ET6A 2NBFA 1SDFA 1PYWD 3L9AX 1YVCA 3SK6A 4XDXA 1NAPA 4ODGA 1IL8A 1OXSC 1N8RC 1O7LA 3EROA 1EQVA 2B2UC 2F0WA 4X6AH 1I3QH 1LTTD 4B3ML 2KEEA 2RHSB 1HNZQ 5KNDA 3BYYB 4DV3L 1LV9A 4RCOA 4POFA 5C44H 2MGSA 3MEHA 1Y1WH 4R8NA 3DWAA 2LY7A 3HFZB 4X62Q 3BVMA 1L1OC 3FPUB 3Q8DA 1CZWA 3H6MA 3RMHA 1HTLD 4EQOA 4FVMA 4RGNA 2KJXA 3DMUA 4JOIA 2OCEA 4DXGA 1S72A 3P75A 4F88A 4GKJL 1VS0A 2K14A 4GN5A 4PG3A 4K8IA 5JPNC 3TQYA 4FXKC 5E3FA 3J80c 3F2BA 1NY4A 2WAQB 3M7GA 4PNYA 1BKBA 2NVTB 3ER0A 3C2PA 3V05A 5IY0A 2GVBA 2SEBD 3OOCA 1T5XD 3S15H 4FF1A 3KJPA 3CCLA 1HH2P 1K83H 1LTGD 4H02A 2F0NA 1IBKL 3NUCA 3RZOH 5T1GA 4YY3L 2BH8A 1KABA 4BY7B 2L55A 4YWKA 4YHHL 3MHBA 3GQBA 4Y52H 2WFWA 1VQFA 4YCVA 2HDMA 2BDOA 5C4XB 3K5OA 2X6LA 1KDAA 4EGVA 1SBBB 1PHJA 1LACA 5M3FG 5HY6A 4C1NK 1X3FA 2NZHA 3Q24A 3CQZB 1CI3M 1Y69U 2F1MA 3VYUA 2F0LA 5JEAJ 3QIAA 1YNND 2M2LA 2MNAA 2E2JH 4HCSA 3LNNA 4H0LC 2A5HA 4DXFA 4GS3A 4JBWA 2EVBA 3C1EA 1CKOA 4IUVA 4HIKA 5BR8Q 4DV3Q 4A3EB 2B63B 3MXNB 1RTOA 5IGFA 4CHTB 3VYRA 4HIMA 1WTXA 4KHPL 2CW0D 1CSQA 1VF5C 1XNQQ 1Q86C 1JWSD 1EUJA 1LT3D 1P8LA 4DA2A 1S3OA 4B3RL 2QILA 4HIDA 4N9PA 4NDXA 4TQUS 3CCMA 4GKJQ 1ASYA 2ZJQA 1H9KA 4YCWA 3BU2A 2K50A 4TKOB 4X64Q 1XJVA 2AWNA 3FDTA 2RBMA 3DWQA 1KIXA 4JI6L 1SYDA 2VB2X 3HP3A 3MFGA 1TWGB 4LUVA 4BBRG 2LMCB 1E7ZA 1PTOF 4ID6A 1JOKA 1HR0W 3CCSA 5I9PA 2F4IA 4RKBA 5HURA 3K5LA 1DOLA 2I07B 4IFDH 1IBKQ 1H9RA 3KLSX 3Q6SA 2JA6B 3GTOH 2Q8IB 1AEXA 2R92B 1X54A 1K9MC 2RSNA 3BZDB 4YHHQ 2MO1A 5IWAL 3S1MB 2EYFA 3EJIA 4LUZA 5IT9E 2NN6G 4HJ5A 1TXYA 1VMPA 4OWTB 3FKIH 1A8VA 3D3RA 5CV9A 4NKLA 3KJOA 5FO7B 1S5FD 1B70B 3J7YW 1X3EA 2AUJD 1E22A 2A74C 4FXGC 1B50A 4DKAC 3SGIA 4Q0FA 4G7ZC 5LMNL 3GTKB 5JJKA 1ILPA 3U9SA 5C44G 4XTCS 1Y1WG 1NBWA 3A54A 2E2IH 1YJNA 2PQEA 2F0VA 2IPKD 1I5FA 4H7BA 2ZTDA 1F9PA 3OMGA 1KNEA 4KHPQ 3VR2A 2SDFA 3QB3A 4BY1H 3OIPA 3NWSA 2QDLA 1MD2D 5I6YA 5KYIA 2VUMG 4B3RQ 4DV6L 2KENA 1WVLA 4OO1G 3EBEA 3NQTA 1V9PA 1TIID 2AHOB 3OIQA 1OO9B 2J4XA 3H3VH 1L1OB 5KGUA 3I4MB 4GZYC 3KDFB 3KBGA 4KN7C 3QR8A 4GLAC 2VS1A 1HXYD 1IZ6A 4JI6Q 4LFBQ 1XPOA 1EWHA 2A69D 1K8MA 1VQMA 1ZXTA 5FLXL 1G8ZD 2NZ1D 2B8FA 3GTMH 4F8MA 2Z0SA 2WINB 3MXPA 2UUCL 3T1HL 5IWAQ 1PDQA 4TSSA 1CUKA 4B3SL 2B2WA 4CJ2C 3A8IE 1Y1VB 4KD3A 2F03A 1WTRA 1V1PA 3TEHB 5CBAE 2K7VA 1VQKA 3MZ5A 5J22A 2L15A 1A3VA 1Y14B 3VR3A 2RHQB 5LMNQ 5FKAC 3E9IA 5JEAH 4IN3A 1U9RA 2B2WC 1QNKA 3J80i 4BBSH 1CA5A 1KAWA 4GLXA 4ZK9B 3BZKA 1JICA 2MPMA 3I3CA 1RKNA 4H44C 1GVPA 2WB1E 3KK7A 4IUTA 3S14H 2RCNA 3R2TA 2F52A 2KCMA 2VQFL 3MVVA 2E75C 4ZUIA 2ZTCA 3ULPA 3WOFA 2F3WA 5IGDA 4A3FH 4Y7NB 1PH2A 3RLNA 4I65A 4JI3Q 1IYVA 3QJYA 4K6DA 1TS4A 5IP9H 3BYTB 3TN2A 1PFSA 3NP8A 1EYCA 2MUYA 1SXTA 1E2VA 3CPFA 2F0DA 1H95A 2A6ED 4HTHA 1FJGQ 1DOKA 3ULJA 1LT6D 4IFDG 3PIPA 4HMIA 1UE6A 1KRTA 1XPUA 3CW2C 4CJ1B 4RKLA 5I6WA 2NVYH 1F77A 1VQJA 3CCQA 1ET9A 3H3VC 3T1HQ 1U5KA 3KOJA 3FKIG 1GUTA 1YEZA 4DR7L 1HQRD 4B3SQ 4FF2A 1L0YB 3OW7A 1SSOA 4G57A 1N36L 1I50H 3F2CA 1V43A 3T53B 1WCMH 5G3LF 1FGBD 2ZT9C 1IHZA 4FF4A 4R1JA 4CKCA 3UE1A 1W3SA 1SYBA 4C1NI 5C6AA 5CV8A 3J81j 2M9VA 1BOSA 1Y8PB 3HOWB 1TS3A 3H15A 3S15B 5EPLA 5CR3A 1RCVD 1KL9A 1K83B 1LT5D 2WB1G 3P1HA 2F0QA 1FVIA 3RZOB 1HUNA 1EL0A 2UU9Q 2A73B 1SN8A 2HCCA 2F0MA 1D6EC 5CORA 4BY1G 4X66Q 4JI0L 2JA8G 3GTLH 1JE5A 4RMFA 2EZVA 3CC4A 5FO9B 1Q12A 3K57A 5CGKA 1TS5A 4QCLA 5M5WB 2N49A 2YTYA 2VQFQ 3KBXA 1RTNA 4HAEA 2JK8A 2QEJC 1A15A 4NXML 1F2LA 1J5EL 4DV5L 2E2JB 4NXNL 1CQVA 4ME3A 3I4NH 1G6ZA 4XT3B 1SYFA 1ICWA 2ATWA 2F0OA 5M5YH 2NTSA 1X3GA 3SE0A 4R8IA 1BBXC 2HIXA 3IRBA 2AKWB 1HNXL 3PUYA 1AE2A 5M5XH 1AP0A 3NENA 1A3TA 1B4OA 2CWPA 3PCOB 1TWFB 3PV0A 3SK5A 3W1BA 4LF9Q 4DR7Q 1A63A 1TWCB 3SK4A 2MJ8A 5T1IA 3M4OB 4MIUA 2BE5C 2RVLA 1MBYA 2L11A 1YITA 4B08A 1BDOA 4JI7L 4RHSA 5A35A 4NMZA 1N36Q 1EIGA 1UE7A 2AMCB 2CKZB 2UXCL 4A3IB 2OTJA 1MHWC 1H9JA 1KTKA 3D0FA 5JEAG 4K0KL 1BCPF 3TBIB 4LF4L 4A3CH 4BBSG 4OL7A 2N3SA 1PA6A 5IYCH 4JK1C 3I4LA 4LAAA 4P72A 1SYGA 2PCFB 1IBMQ 4M1UB 2K52A 4JI0Q 3RZDH 1HA6A 2X69A 3URYA 1CQFA 2L1BA 2IL8A 1KAAA 4I7ZC 1HNWL 1VQNA 5EKIA 4A3FG 1U4MA 3SR1A 4C3HB 2PZWA 4ZLTF 1SYCA 2ALYB 5KEEA 2QCPX 1B53A 2F0UA 5IP9G 4LF5L 2PQAA 4NXMQ 1QWYA 1J5EQ 4DV5Q 3J80E 4L5TA 1JWMD 1I4GA 2XWBB 3CRKC 2IX0A 4ZYSA 4PZ6A 1HHVA 1BCPD 1EY5A 2VB3X 3KF8B 2WB1B 5GADC 1B3QA 4IUUA 3PF5A 3VA5A 4KJNA 3NTIA 2FJ2A 3UI2A 1HNXQ 2HQEA 1A6XA 1EY6A 1LO5D 5M3FH 1ZEQX 4A3DH 4XT1B 1Q3LA 4K2LA 1Q81C 4P75A 3F8TA 5J3BA 1EY7A 3I2ZA 2KCNA 2Z8LA 1WTVA 3K0YA 5IOCA 3FVQA 4JI7Q 1WCMG 1K73C 2IHEA 5EGTA 4IJLA 1BO0A 1NMFA 2SNMA 3A0JA 2UXCQ 1A2TA 3U9OA 4A3BG 4B9WA 1RDPD 2WV6D 4AQYL 4IPDA 4K0KQ 3ONAB 2OTLA 4LF4Q 1X3QA 3HGBA 5C5MA 4MTNA 4U673 2HHHL 2K03A 5JPMC 3NBIA 2DJGC 3GTPH 1TT2A 3GDEA 2NB0A 5F2DA 4GNXB 4L5RC 1QUQB 5ELFA 1ILQA 1D5XC 2PNRC 1PTOC 1QNUA 5M9OA 1DYQA 1VQ9A 1HFNA 1KXLA 3D8GA 1I4HA 5FLMG 3PQIA 5E4WC 3PO2H 3GTQB 1CTMA 3QG1A 4PQXA 5L37A 3A7LA 1HNWQ 1M90C 3EA6A 2VXWA 4O0AA 4HJAA 3GTJH 1PH5A 3B6YA 4GN3B 1Y8NB 3DUZA 1VCIA 3I4NG 2F0KA 4Q5VA 1Q8IA 5CMDA 2XRQD 2EY2A
chains in the Genus database with same CATH topology
2KUMA 5C0XJ 1O80A 2E2HB 2IJ0A 4RGMA 2MHVA 3PIP3 2PO4A 1HRJA 3NTHA 4C2MB 1SNPA 5BN5A 1D5ZC 3S14B 1I4QA 3AB9A 2OT2A 3I90A 3G7LA 1D5MC 1STHA 3GV3A 3OWFA 4A3FB 1EY0A 1IKLA 1OXVA 1PZID 5KRUA 1GHJA 4RH6A 2DNEA 3DHQA 3EFXD 3D31A 4LK1C 5DEHA 4FYDA 1UUPA 4DAYA 5E1FA 4CBVA 1B44D 1SJED 4OO1H 3VYTA 2NVYB 3J81L 2YU9B 4OIKA 3HOYB 5JVH3 2R61A 1LTRD 2CHBD 2K5DA 1WCMB 3CRLC 4IALA 4C3JB 1PFMA 3PMFA 1Z47A 1AZPA 3F2UA 1GHKA 2XVSA 1I6VC 1JR0D 3NPPA 3T56B 3L3OC 2R7ZB 3D4WA 5CYUA 5A2QL 1SMYC 2K05A 2SNSA 1I4XA 3QOLA 4FO2A 1A3UA 2MP1A 1CM9A 1DCZA 2RDHA 1STGA 2NN6I 3LWEA 1V8QA 2QKIC 5J39A 3AMUA 3M3YB 1NUCA 3NHHA 4K5VA 1QE6A 2K1BA 1ENFA 2JA7B 3MXUA 4BS9A 5HGTA 2PW5A 2D62A 2BA0A 5M5XB 2B8GA 4ULLA 5FOBB 3PUWA 2OEOA 5CV7A 1S5DD 3FRPB 1Q90A 2A6HC 3E0JA 2WIIB 5C3WA 4EVOA 2XWJB 3CHBD 1RJTA 1EY4A 1UEAB 2EOTA 2IT1A 2C5CA 1BQQT 2EDGA 4HR7B 2V4DA 2A68C 3D4DA 1CZGA 4RAUC 1PZKD 4ZQ3A 2K04A 3T4AC 4YIJA 3BS1A 3X3MA 5C0XH 5NUCA 4G4KA 2F0IA 5C4JB 3RZDB 1S5CD 2JXMB 1J8IA 1KLUD 4XXEA 3MAQA 5C4HA 2XNAC 1GXDC 1B2TA 1F2YA 1IW7D 4EQNA 3NBHA 5LHY1 4J6HA 1MI2A 2EYOA 4WFN3 3BDLA 3P20A 1H9SB 3QWNA 3NXWA 3K58A 2FMMA 4DFAA 5JOBA 2G9DA 1FYCA 4L6TB 4WRDA 1C8CA 2XIWA 4HMJA 1RD9D 1RODA 1TQOA 2RSOA 1HCZA 1VMCA 1LTID 5EPKA 2LFNA 5M3FB 3N6RA 3K5NA 1DM0B 1O78A 5JVG3 1XXGA 2PPBC 4XYOA 1ZYRC 2KCCA 3OHXC 5JAVA 1D1KA 2E74C 4QUFA 1U4PA 4Z9CB 5EJWA 1MSGA 5D3DA 1F9QA 3ITPA 1PFNA 5CV6A 4L8JA 2H4OA 2K6AA 3M85A 4IFDI 1PRTC 1EY9A 4KN4C 2RA4A 2IX1A 1D2BA 3MWYW 4HSPA 4DU9A 2EJFC 1FR3A 3BDOA 4C3IG 2EY1A 3M7NA 4IUNA 3DEOA 4U68A 5KIXA 4BBRB 3IAYA 1I4RA 4KKTA 1X32A 2GA4B 1ESFA 2C9OA 1CA6A 1F9SA 3TDQA 2JEAI 1F9RA 3Q22A 2ICEC 2OF1A 2H1EA 3OWEB 3M4YA 3S16B 3CKIB 2F0JA 3NK9A 3S1RB 4IZ8A 4QMGA 5COYA 4FXDA 1O7ZA 3E5SA 1I3QB 1BR9A 5C44B 1YNJC 1JWUD 1Y1WB 1QCBD 3IFTA 3ZYYX 3HOZB 1AFPA 1EY8A 1U4RA 3PIO3 4IQZA 4CKEA 2VUMB 5IGCA 5C0XG 2AWOA 1CK1A 3KUPA 4QIWB 5DM73 3VR6A 2EYJA 2HCIA 2Z4IA 3JAML 5AFWA 1DXMA 3VA7A 2RKSA 3KLSA 1AW7A 1RF2D 1B9MA 1FNVA 2PYKA 4UDUC 1GUGA 4DF7A 2KQ3A 3QO2A 3A55A 4DNTB 5DM63 2TSSA 1UAPA 4C3IB 5C3XA 1SJHD 2J7ZA 2EPBA 4K8JA 2AUKA 1B1ZA 2K5WA 1QB5D 1CHQD 3OSOA 1J9OA 1LABA 2O5IC 2F0HA 2L12A 1TU2B 3EQLC 2X6GA 4C56C 2EYHA 1WTWA 4HSVA 3OMCA 2LKVA 2CVRA 4KTAA 3GO5A 3E6ZX 4X3TA 1PTOH 2F0FA 4IURA 4PV1C 2Z4HA 4BA2I 1PRTB 1YNNC 1S5BD 2QF7A 2ZXRA 5EKLA 2L0CA 2I46A 3GTOB 3P7JA 1KDCA 2DN8A 3GTGB 3MTSA 3SDZA 3PUZA 3SK8A 2L4NA 2F0GA 5K36H 1M4VA 4RA8A 1S5ED 2CW0C 5J1ZA 2N88A 3FKIB 5C4ZA 1STBA 2K33A 1V1PB 3LWUA 4UAIA 2YYZA 4XQNA 3VYSA 4MHEA 4ZKCB 1T5EA 2PZTA 5FLXE 2DNCA 1W6KA 4F7XA 2E2IB 5I2YA 2Q8TA 1R4PB 1KLGD 2VNUD 3MXNA 1JOQA 4BY1B 2JA8B 1DONA 2B2TA 3HEJA 3O13A 3T13A 3TP8A 4DAVA 3BVGA 1QG7A 2CQAA 1HFGA 2B2VA 1G2SA 5KYLA 1JCKB 1GUNA 5IT9L 2N55A 3I73A 4WORA 1QOHA 1H9MA 3VR4A 2OXPA 5D14A 1X3PA 1CT1D 2PMZB 5TSSA 1NR4A 3TZUA 2EYMA 3K6OA 2FINB 3DM1A 1B3AA 2B2TC 1HQMC 4KV6A 1JOOA 2R3ZA 1SNDA 1LTAD 2ZXPA 1LLRD 2BA1A 3GTMB 2B2VC 4R9WA 3RLFA 1EU4A 3TP5A 3HZXA 1BNZA 2SOBA 1SNQA 3TSSA 4RFBA 4CJ0B 4KY5A 2RQXA 2F0TA 2EJGC 4HCEA 2FFKB 1SE4A 4QF4A 1KDBA 1GJXA 4KKUA 3A56A 3WDNA 3J7AF 3IKJA 4BBSB 2B2YA 2A69C 2D5DA 2WKCA 1STYA 2F0PA 1ML0D 3HOVB 2B2UA 5I9OA 2AQ1B 3IL8A 1EYDA 4FP5D 3R8BA 1JORA 1A2UA 1I6HB 1HA5A 1I4PA 3G6JB 2B2YC 4ZRZA 2KVMA 1TVXA 5FK9C 1STAA 4CKBA 1TS2A 3NTKA 4KHZA 5BN3A 1DZ1A 4ZKBB 1FD7D 2D2CC 4DK0A 4DGZA 2EE1A 1Z7TA 1S4ZA 3MXGA 4ABNA 4K2KA 1MSHA 5KNCA 3HS0C 1UNSA 5K36G 2FMCA 1Q1EA 1RHPA 1F2MA 4F87A 2PZUA 1R4QB 1SYEA 1GUOA 3BVZA 1I50B 1JB3A 1ZKOA 1SE2A 3SHLA 1E0BA 4A3KB 1V1OA 3K5MA 4A3BB 5LL6S 1LTSD 3I91A 1CFMA 2E76C 2A6EC 3R3OA 2EJMA 4DNRB 3R93A 3GTLB 1SNOA 4KHVA 3DWPA 1EWCA 4RCNA 4EQPA 2BE5D 1XWEA 3MA2B 1LTBD 4FNFA 5ISRA 3I70A 1EQTA 1SE3A 3I4NB 1EFID 1Q1BA 3OPOA 5M5YB 3HKZB 4NP5A 1WTPA 4KJOA 2JE6I 4DK1A 5EPJA 3Q23A 1O7YA 1EEFD 3GP7A 1GUSA 3RUZA 1PLFA 4HN7A 3FPPA 4OO1I 1SEBD 1PTOB 5I4DA 2WP8J 2FHTA 4A3GB 5EQ0A 2NVQB 1AN8A 4K6LA 1STEA 1G2TA 2JSOA 4XIGS 1XYIA 2EYPA 3GV6A 3ND8A 3V2TA 3D6CA 1K8OA 2RDGA 2ID0A 4B9XA 3ND9A 3V96A 2XSCA 5CV4A 1GUWA 4PMCA 1TR5A 3S9WA 3N52A 4LMQD 3S1QB 3NE5B 2HDLA 1NSNS 2AQ3B 3NQIA 2DY7A 4WJWA 1NR2A 3H91A 3RD4A 3CU7A 3T51B 1CHPD 1LT4D 1STNA 2DY8A 3K7AB 4ME5A 2EY5A 2ENBA 2NYZD 1PTOD 5KNBA 2XN9C 4O1NA 4A3DB 1D1IA 1DD2A 1OXXK 2F0EA 2BOSA 2KA7A 4PMBA 3S2HB 5K5PA 2M00A 3SVMA 4P2CB 1PZJD 4PMWA 4ZAIA 4CGYB 4TRDA 4A3JB 1OXUA 3R2IA 1BF4A 3TMEA 3S1NB 2EYLA 5E4XA 1VDZA 4DAPA 3EVQA 4BA1I 2B39A 1IYUA 1SNCA 4KK7A 4RGTA 3GTPB 2D9UA 3J80L 1QILA 5EBCA 1BCPC 5EKKA 5CC4A 4KKSA 3PO2B 1F2ZA 2LS01 3J7AV 1ONLA 5C0XI 3SEBA 1FNWA 2JYOA 2NUCA 3GTJB 1XX8A 2L9HA 3MC0B 4K14A 3A8JE 1ENCA 1TKWB 2BDNA 4IUQA 3J81E 2KEDA 5D3IB 1G291 4HEDA 2ZXOA 1VF7A 1SFOB 3S2DB 3FMCA 3KF8A 5IODA 1L0XB 2EY6A 1PMRA 4XYQA 5C3EB 3TZDA 5ELBA 2PW7A 5DAUA 2WKDA 1C4QA 4RGOS 3I72A 3NWTA 1EIHA 3X3NA 5A2QE 2G9HD 4M8AA 1HUMA 5JJZA 1TY2A 4XQJA 1AZQA 3H94A 1SMYD 1MGSA 3FEWX 2NTTA 2K01A 4N9TA 2IWHA 3PO3B 4C3HG 1OXTA 4XQQA 5DNFA 1B9NA 1PFBA 1WD0A 1SAPA 3HOXB 1W6JA 3HG9A 2QDBA 1EYAA 4OIJA 4FF3A 3C1FA 2F3VA 3HRZC 4QUCA 2E2DC 1WD1A 1QJOA 1M8AA 4A3MB 2A6HD 3H0GB 4G7OC 3W3AA 3GD7A 5I2XA 1HPCA 1IKMA 3I8ZA 4X3KA 1EU3A 1JC7A 2A68D 4V190 3PUXA 4X3SA 4V0BA 3AU7A 2Y0SB 1XTCD 5G3LD 1FNUA 3C3LA 3ERQA 4DN4M 4QB4A 2IW3A 2K28A 3IFDA 2AQ2B 4O42A 1JQYD 1WTQA 1BCPB 4BWGB 3VR5A 2O5JC 1TWHB 4MN3A 4S3SA 3DEPA 2JEBI 4ZUJA 1PRTF 4KMUC 3D6WA 1II3A 3PUVA 5ELDA 1E2WA 4L63B 3A7AB 1TWAB 1Y8OB 2BCOA 2Z1CA 3C46A 5IGBA 3QOJA 3NSWA 3LX0A 3L7ZC 5C5LA 3K59A 3D4RA 5EBDA 1U4LA 1KNAA 2O4XA 2RDFA 1BUVT 5ELEA 3S17B 1ZYRD 2TMPA 4KI0A 4KY6A 1HTPA 4E6IA 3MFYA 2EXZA 2ICIA 2K5QA 4J8QA 5IGEA 4KD4A 1JE4A 2IX3A 1GOZA 1EEID 2JA5B 2F0SA 4J1MA 2JP1A 1DOMA 3WOEA 1PRTD 2Q8RE 3BDCA 1E2ZA 2KHSA 4IUPA 4LJZC 1EOTA 5FO8B 4ILWA 2O2LD 5LL6X 2NWGA 2HUGA 1C48A 4K5XA 3W2DA 1ESRA 4OHJA 3H09A 3TP7A 3Q0AA 3HOUB 4NW2A 5IGGA 1PXUA 5IIFA 3DXJC 1IW7C 2WACA 5BN4A 2L5TA 4AYBB 4C3JG 1Z6HA 3A8KE 3BG3A 4RHRA 4K5WA 5ELCA 5D65A 4A93B 1NCVA 4X3UA 1G91A 1WTOA 1SNMA 2R93B 5CBEE 3KLRA 3SXHA 3TP6A 1TY0A 1ENAA 5M3MB 1EZ8A 2KECA 4G7HC 2XRSD 3T16A 4IFDJ 1YNJD 2J0TD 1DJRD 1H9SA 4RWSC 2KOLA 2K32A 2NVXB 2R6GA 4OGQC 1BXTA 5CV5A 3JAME 4H13C 4KY7A 1R9TB 2NN6H 1EZ6A 1ET6A 2NBFA 1SDFA 1PYWD 3L9AX 3SK6A 4XDXA 1NAPA 4ODGA 1IL8A 1OXSC 1O7LA 3EROA 1EQVA 2B2UC 2F0WA 1LTTD 2KEEA 5KNDA 3BYYB 1LV9A 4RCOA 2MGSA 3MEHA 4R8NA 3DWAA 2LY7A 3BVMA 3FPUB 1CZWA 3H6MA 3RMHA 1HTLD 4EQOA 4FVMA 4RGNA 2KJXA 3DMUA 4DXGA 3P75A 4F88A 4K8IA 5JPNC 4FXKC 5E3FA 2WAQB 3M7GA 4PNYA 2NVTB 3C2PA 3V05A 2SEBD 3OOCA 1T5XD 4FF1A 1LTGD 2F0NA 3NUCA 5T1GA 1KABA 4BY7B 2L55A 3MHBA 3GQBA 2HDMA 2BDOA 5C4XB 3K5OA 2X6LA 1KDAA 4EGVA 1SBBB 1LACA 4C1NK 3Q24A 3CQZB 1CI3M 1Y69U 2F1MA 3VYUA 2F0LA 5JEAJ 3QIAA 1YNND 2M2LA 4HCSA 3LNNA 4H0LC 2A5HA 4DXFA 4JBWA 2EVBA 3C1EA 4IUVA 4A3EB 2B63B 1RTOA 5IGFA 4CHTB 3VYRA 1WTXA 2CW0D 1VF5C 1JWSD 1LT3D 4DA2A 2QILA 4N9PA 4NDXA 4TQUS 1H9KA 4TKOB 2AWNA 3FDTA 2RBMA 3DWQA 1SYDA 2VB2X 3HP3A 3MFGA 1TWGB 2LMCB 1PTOF 4ID6A 1JOKA 5I9PA 2F4IA 4RKBA 5HURA 3K5LA 1DOLA 2I07B 4IFDH 1H9RA 3KLSX 3Q6SA 2JA6B 2Q8IB 1AEXA 2R92B 2RSNA 3BZDB 3S1MB 2EYFA 3EJIA 5IT9E 2NN6G 1VMPA 3D3RA 5CV9A 4NKLA 5FO7B 1S5FD 3J7YW 2AUJD 2A74C 4FXGC 1B50A 4G7ZC 4Q0FA 3GTKB 1ILPA 3U9SA 4XTCS 3A54A 2PQEA 2F0VA 2IPKD 4H7BA 1F9PA 3OMGA 1KNEA 3VR2A 2SDFA 3QB3A 3OIPA 3NWSA 1MD2D 5I6YA 5KYIA 1WVLA 4OO1G 3NQTA 1TIID 3OIQA 1OO9B 2J4XA 3I4MB 5KGUA 4GZYC 3KBGA 4KN7C 1HXYD 1EWHA 2A69D 1K8MA 1ZXTA 5FLXL 1G8ZD 2NZ1D 2B8FA 4F8MA 2WINB 3MXPA 1PDQA 4TSSA 2B2WA 4CJ2C 3A8IE 1Y1VB 4KD3A 2F03A 1WTRA 1V1PA 5CBAE 2K7VA 3MZ5A 5J22A 1A3VA 3VR3A 5FKAC 5JEAH 4IN3A 1U9RA 2B2WC 1QNKA 1CA5A 4ZK9B 1JICA 2MPMA 3I3CA 1RKNA 4H44C 3KK7A 4IUTA 3R2TA 3MVVA 2E75C 4ZUIA 3WOFA 2F3WA 5IGDA 4Y7NB 4I65A 1IYVA 3QJYA 4K6DA 1TS4A 3BYTB 3TN2A 3NP8A 1EYCA 2MUYA 1SXTA 1E2VA 2F0DA 2A6ED 4HTHA 1DOKA 1LT6D 4IFDG 4HMIA 4CJ1B 4RKLA 5I6WA 1F77A 1ET9A 3H3VC 1GUTA 1HQRD 4FF2A 1L0YB 3OW7A 1SSOA 4G57A 1V43A 3T53B 5G3LF 1FGBD 2ZT9C 1IHZA 4FF4A 4CKCA 1SYBA 5C6AA 4C1NI 5CV8A 2M9VA 1BOSA 1Y8PB 3HOWB 1TS3A 3S15B 5EPLA 5CR3A 1RCVD 1K83B 1LT5D 3P1HA 2F0QA 3RZOB 1HUNA 1EL0A 2A73B 2HCCA 2F0MA 1D6EC 5CORA 2EZVA 5FO9B 1Q12A 3K57A 5CGKA 1TS5A 4QCLA 5M5WB 3KBXA 1RTNA 4HAEA 2QEJC 1A15A 1F2LA 2E2JB 1CQVA 1G6ZA 4XT3B 1SYFA 1ICWA 2F0OA 2NTSA 3SE0A 4R8IA 1BBXC 3PUYA 1AP0A 1A3TA 1B4OA 1TWFB 3PV0A 3SK5A 1TWCB 3SK4A 2MJ8A 5T1IA 3M4OB 4MIUA 2BE5C 2RVLA 1MBYA 2L11A 4B08A 1BDOA 4RHSA 5A35A 4NMZA 1EIGA 4A3IB 1H9JA 1KTKA 5JEAG 1BCPF 3TBIB 4OL7A 4JK1C 3I4LA 4LAAA 1SYGA 2PCFB 4M1UB 1HA6A 2X69A 3URYA 1CQFA 2L1BA 2IL8A 1KAAA 4I7ZC 5EKIA 1U4MA 3SR1A 4C3HB 2PZWA 4ZLTF 1SYCA 5KEEA 2QCPX 1B53A 2F0UA 1QWYA 3J80E 1JWMD 1I4GA 2XWBB 3CRKC 2IX0A 4ZYSA 1HHVA 1BCPD 1EY5A 2VB3X 2WB1B 4IUUA 3VA5A 4KJNA 3NTIA 2FJ2A 3UI2A 2HQEA 1A6XA 1EY6A 1LO5D 1ZEQX 4XT1B 1Q3LA 4K2LA 1EY7A 2KCNA 2Z8LA 1WTVA 3K0YA 5IOCA 3FVQA 5EGTA 1BO0A 2SNMA 1A2TA 3U9OA 4B9WA 1RDPD 2WV6D 3ONAB 1X3QA 3HGBA 5C5MA 4U673 2K03A 5JPMC 3NBIA 1TT2A 5F2DA 2NB0A 5ELFA 1ILQA 1D5XC 2PNRC 1PTOC 1QNUA 5M9OA 1DYQA 1HFNA 3D8GA 1I4HA 5E4WC 3GTQB 1CTMA 3QG1A 4PQXA 3A7LA 3EA6A 2VXWA 1Y8NB 3DUZA 1VCIA 2F0KA 4Q5VA 1Q8IA 5CMDA 2XRQD 2EY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BDN A;  2KUM A;  2RSO A;  2MGS A;  4IUQ A;  1VMC A;  2KED A;  4IUR A;  4IUP A;  3FDT A;  1EOT A;  1PDQ A;  1O80 A;  3I91 A;  5EKI A;  1IKM A;  1GUW A;  3I8Z A;  4X3K A;  4HED A;  2NWG A;  5EPK A;  1U4M A;  2HUG A;  3HP3 A;  5EPL A;  2B2W A;  3FPU B;  4ZLT F;  1HRJ A;  4CJ2 C;  3N52 A;  4LMQ D;  1U4R A;  1B53 A;  1ESR A;  4X3S A;  1QE6 A;  2K1B A;  4CJ0 B;  1HUN A;  1EL0 A;  3R93 A;  2HDL A;  1WTR A;  2HCC A;  5COR A;  4QUF A;  1DOL A;  1U4P A;  2FFK B;  4NW2 A;  2DY7 A;  3KUP A;  3P7J A;  3Q6S A;  5CBA E;  3TZD A;  3I90 A;  3MTS A;  5EJW A;  1MSG A;  3G7L A;  2L4N A;  1F9Q A;  1NR2 A;  3GV3 A;  3H91 A;  2RSN A;  4RA8 A;  4DN4 M;  1PFN A;  2HCI A;  1HHV A;  2N88 A;  1IKL A;  5AFW A;  2B2W C;  2DY8 A;  3KBX A;  1VMP A;  1QNK A;  2K28 A;  1RTN A;  3IFD A;  4IUU A;  5D65 A;  4HAE A;  1NCV A;  2B2Y A;  2NYZ D;  2FJ2 A;  1A15 A;  3UI2 A;  1CA5 A;  1EIH A;  4UAI A;  4O42 A;  4X3U A;  4ZK9 B;  4XT1 B;  1F2L A;  1Q3L A;  1WTQ A;  1G91 A;  1EQT A;  1WTO A;  1RJT A;  1JIC A;  2RA4 A;  5T1G A;  2MPM A;  3I3C A;  2EOT A;  4MHE A;  1HUM A;  1ML0 D;  4ZKC B;  1WTV A;  5JJZ A;  3MWY W;  4XT3 B;  3SVM A;  1B50 A;  4MN3 A;  1G6Z A;  1ICW A;  2B2U A;  4IUT A;  3IL8 A;  5CBE E;  3DEP A;  1WTP A;  4ZAI A;  1AZQ A;  1BO0 A;  4R8I A;  2HDM A;  1MGS A;  1BBX C;  1BF4 A;  1ILP A;  3QO2 A;  3DEO A;  4OIK A;  4RAU C;  5EPJ A;  2X6L A;  2B2Y C;  2K01 A;  2KEC A;  1O7Y A;  3D6W A;  4U68 A;  2Q8T A;  5E4X A;  2KVM A;  1TVX A;  1AP0 A;  2K04 A;  1B4O A;  3ONA B;  1DZ1 A;  1F9P A;  3TN2 A;  4ZKB B;  1KNE A;  1X3Q A;  1PLF A;  1X32 A;  2SDF A;  2EE1 A;  5DNF A;  1DON A;  1S4Z A;  1PFB A;  2K03 A;  2MJ8 A;  5T1I A;  1WD0 A;  1DOK A;  1SAP A;  2RVL A;  2B2T A;  2D9U A;  2L11 A;  2M2L A;  1U4L A;  1KNA A;  4HCS A;  2J7Z A;  1QG7 A;  1CA6 A;  2FHT A;  1F9S A;  1EIG A;  1MSH A;  2EPB A;  4RWS C;  5EQ0 A;  1WVL A;  2KOL A;  1ILQ A;  1F9R A;  1HFG A;  2B2V A;  1PFM A;  1G2S A;  4CJ1 B;  1J8I A;  2H1E A;  1G2T A;  4IUV A;  1HFN A;  1J9O A;  1AZP A;  2N55 A;  3F2U A;  5E4W C;  2L12 A;  1RTO A;  2X6G A;  5D14 A;  1B2T A;  1X3P A;  1LV9 A;  4OIJ A;  1XYI A;  1NR4 A;  1MI2 A;  1RHP A;  1SDF A;  3GV6 A;  1WTX A;  2VXW A;  4XDX A;  4QUC A;  1NAP A;  1WD1 A;  2JYO A;  1WTW A;  2FIN B;  4HSV A;  1IL8 A;  3DM1 A;  1B3A A;  2B2T C;  2FMM A;  1M8A A;  1XX8 A;  1JE4 A;  2K05 A;  1SSO A;  2R3Z A;  5COY A;  2L9H A;  1O7Z A;  2CVR A;  2B2U C;  2MP1 A;  1CM9 A;  1ZXT A;  2JP1 A;  2NZ1 D;  1E0B A;  2B2V C;  4R9W A;  1C8C A;  2XIW A;  1DOM A;  2KEE A;  1HA6 A;  4X3T A;  2X69 A;  5CMD A;  1BNZ A;  3LWE A;  2Q8R E;  1ROD A;  2L1B A;  2IL8 A; 
#chains in the Genus database with same CATH topology
 2KUM A;  5C0X J;  1O80 A;  3CMA A;  2E2H B;  2IJ0 A;  3S16 H;  4RGM A;  2MHV A;  3PIP 3;  2PO4 A;  1HRJ A;  3NTH A;  4C2M B;  1SFO H;  3S2D H;  3M4P A;  1SNP A;  3S1R H;  5BN5 A;  1D5Z C;  1E24 A;  3S14 B;  1I4Q A;  3AB9 A;  2OT2 A;  5AJ3 L;  3I90 A;  5C3E H;  3G7L A;  1D5M C;  4GLV B;  1XPR A;  2F4V L;  1STH A;  3GV3 A;  4LFA L;  1AE3 A;  1VQA A;  3OWF A;  4A3F B;  4QQB X;  3KF6 B;  1EY0 A;  1IKL A;  1K3R A;  1OXV A;  1PZI D;  2KBN A;  4LW1 A;  5KRU A;  1GHJ A;  4RH6 A;  2DNE A;  3DHQ A;  4A3C G;  3EFX D;  3HOZ H;  3D31 A;  4J15 A;  4AQY Q;  4LK1 C;  5DEH A;  4FYD A;  1UUP A;  5IYC G;  4DAY A;  5E1F A;  4CBV A;  4R4T A;  2HHH Q;  2VUM H;  1MJE A;  3CCE A;  1B44 D;  3CPW A;  1SJE D;  4JI1 L;  4OO1 H;  3VYT A;  5FLX c;  2NVY B;  1EWI A;  1MIU A;  3J81 L;  2YU9 B;  4OIK A;  4ALP A;  3HOY B;  5JVH 3;  4RG1 A;  2R61 A;  3BJU A;  4DV4 L;  1G51 A;  4JCV E;  3PO3 H;  1LTR D;  2CHB D;  2HIV A;  3HKS A;  4JOI C;  4P74 A;  2K5D A;  1WCM B;  1NJI C;  3HOX H;  3CRL C;  2VW9 A;  4IAL A;  3K81 C;  1KHI A;  1PFM A;  4C3J B;  3PMF A;  1Z47 A;  1AZP A;  3F2U A;  1GHK A;  2XVS A;  1I6V C;  1JR0 D;  3NPP A;  4N8F A;  3T56 B;  1XNR L;  1VQ4 A;  3MEF A;  3L3O C;  2R7Z B;  3D4W A;  5CYU A;  5A2Q L;  4A3D G;  1D7Q A;  1YBY A;  1SMY C;  2K05 A;  2SNS A;  1I4X A;  3QOL A;  4FO2 A;  1A3U A;  2HQL A;  1PV4 A;  2MP1 A;  1CM9 A;  4A3M H;  1DCZ A;  4UY8 C;  1WFQ A;  2RDH A;  4C3I H;  1STG A;  2NN6 I;  3LWE A;  1V8Q A;  2F4V Q;  4B3M Q;  4LFA Q;  4A3J G;  2VY3 A;  2QKI C;  4MZ9 A;  2DUD A;  5J39 A;  2ASB A;  3AMU A;  2B29 A;  1UE5 A;  3M3Y B;  1NUC A;  3NHH A;  4K5V A;  1QE6 A;  2K1B A;  3STB C;  1NNX A;  2YV5 A;  2UXD L;  1ENF A;  2JA7 B;  3MXU A;  4BS9 A;  5LMN W;  4DV2 L;  1N33 L;  5HGT A;  1K28 A;  2PW5 A;  4JI1 Q;  1B8A A;  2D62 A;  2BA0 A;  1O7I A;  5M5X B;  2B8G A;  4ULL A;  3PO2 G;  5FOB B;  3PUW A;  2OEO A;  5CV7 A;  1S5D D;  3FRP B;  1Q90 A;  2A6H C;  3E0J A;  4HJ9 A;  2ZTE A;  4QIW E;  1MKH A;  2WII B;  5C3W A;  2PNH A;  4EVO A;  2XWJ B;  3CHB D;  5H1S E;  4DV4 Q;  1RJT A;  1EY4 A;  1UEA B;  3NEM A;  2EOT A;  3RLO A;  2IT1 A;  1PYS B;  2N78 A;  2C5C A;  2KCT A;  1BQQ T;  2EDG A;  4HR7 B;  4YY3 Q;  2V4D A;  3GTG H;  2A68 C;  3D4D A;  1CZG A;  2Z9H A;  3G6E A;  4RAU C;  1PZK D;  4X65 L;  1C9O A;  4ZQ3 A;  2K04 A;  2ZM6 L;  1XNR Q;  3T4A C;  3W1G A;  1TWA H;  4YIJ A;  2K75 A;  3BS1 A;  3X3M A;  5C0X H;  5NUC A;  1PH3 A;  4G4K A;  2F0I A;  5C4J B;  3RZD B;  1ASZ A;  2CH4 W;  4L5Q A;  5C3E G;  1S5C D;  2JXM B;  1J8I A;  1KLU D;  4XXE A;  3FHW A;  3MAQ A;  2ZJP A;  1PH1 A;  3PF4 A;  5C4H A;  4MNO A;  2XNA C;  1GXD C;  4UP8 A;  4DAM A;  1B2T A;  1F2Y A;  1IW7 D;  2DJF C;  3NBH A;  4EQN A;  4J6H A;  5LHY 1;  1MI2 A;  2EYO A;  3G4S A;  4CDF C;  4WFN 3;  3BDL A;  1GKH A;  3T1Y L;  3HOZ G;  3P20 A;  1H9S B;  3QWN A;  3NXW A;  3K58 A;  2FMM A;  4DFA A;  5JOB A;  2G9D A;  1FYC A;  2JQO A;  2JA8 H;  4L6T B;  4WRD A;  1C8C A;  2XIW A;  1A62 A;  4HMJ A;  4IPC A;  1RD9 D;  1ROD A;  1TQO A;  3A5Z B;  2RSO A;  1N33 Q;  1HCZ A;  1VMC A;  4LF8 L;  2Y0S E;  1LTI D;  5EPK A;  2LFN A;  5M3F B;  3N6R A;  3K5N A;  3F2D A;  1DM0 B;  1O78 A;  5JVG 3;  1XXG A;  2PPB C;  4XYO A;  1ZYR C;  3PO3 G;  2KCC A;  3OHX C;  5JAV A;  1D1K A;  2E74 C;  4GOP A;  4QUF A;  1U4P A;  3HOU H;  1JJC B;  4Z9C B;  3HOX G;  5EJW A;  1MSG A;  5D3D A;  3CCJ A;  1F9Q A;  3ITP A;  3PGZ A;  1PFN A;  5CV6 A;  4LFC L;  4DR3 L;  2Q2T A;  2E8G A;  4A93 H;  3A74 A;  4L8J A;  2H4O A;  2ZM6 Q;  2K6A A;  3M85 A;  4IFD I;  4GOP C;  1PRT C;  1EY9 A;  3RNU A;  1EIY B;  4KN4 C;  2RA4 A;  1NE3 A;  1JB7 A;  2IX1 A;  2YTV A;  1D2B A;  3MWY W;  4HSP A;  4MTK A;  4DU9 A;  3AEV A;  2EJF C;  4A3M G;  1FR3 A;  2R93 H;  1E1O A;  3BDO A;  4C3I G;  2CQO A;  4POG A;  2EY1 A;  3M7N A;  1HZ9 A;  4IUN A;  3DEO A;  4U68 A;  3K80 C;  5KIX A;  4BBR B;  3IAY A;  1I4R A;  4KKT A;  3CF5 A;  1X32 A;  2GA4 B;  1ESF A;  1BBU A;  2C9O A;  1WTH A;  4NPS A;  1CA6 A;  2Y0S G;  1F9S A;  3M9B A;  3HOV H;  3TDQ A;  3CCV A;  2JEA I;  2D0P A;  1F9R A;  3Q22 A;  5FJ8 H;  1XMO L;  2ICE C;  2OF1 A;  2H1E A;  3OWE B;  2NVX H;  4DV6 Q;  3M4Y A;  3S16 B;  4QGU A;  3A5U A;  1X65 A;  1I6H H;  1R9T H;  3AQQ A;  3CKI B;  1PH7 A;  4EX5 A;  3U58 A;  4B3T L;  4LF8 Q;  1A0I A;  2I5M X;  1CKN B;  2F0J A;  3NK9 A;  3S1R B;  3LGJ A;  4IZ8 A;  4QMG A;  5COY A;  1VQ5 A;  2CWA A;  4FXD A;  3EN2 A;  4O2D A;  1O7Z A;  3E5S A;  1I3Q B;  1SLJ A;  2PMZ E;  4IOA A;  3H3V I;  1N9W A;  4HIO A;  1BR9 A;  2QEX A;  5C44 B;  1YNJ C;  1JWU D;  1Y1W B;  1QCB D;  3IFT A;  4DR3 Q;  2NZO A;  4LFC Q;  3TRE A;  3ZYY X;  3HOZ B;  1AFP A;  2UUC Q;  1EY8 A;  1U4R A;  3PIO 3;  1M1K C;  4IQZ A;  1HZC A;  1LM0 A;  4CKE A;  2VZA A;  2VUM B;  4R4C A;  5IGC A;  5C0X G;  2AWO A;  1PYB A;  1CK1 A;  1OTC A;  3KUP A;  2OQK A;  4QIW B;  5DM7 3;  3VR6 A;  2EYJ A;  4A3K H;  4JV5 L;  2HCI A;  2Z4I A;  3JAM L;  5AFW A;  4A3B H;  1DXM A;  1SRU A;  4OEM B;  2NVT H;  2E5L L;  4OX9 L;  1IYJ B;  3VA7 A;  2RKS A;  2Z6K A;  2K5H A;  2JA9 A;  3KLS A;  1AW7 A;  3ERS X;  3PSI A;  1N32 L;  1RF2 D;  1VQC A;  3STB D;  4BY7 H;  2JA5 G;  1B9M A;  1FNV A;  2PYK A;  4UDU C;  1AH9 A;  1GUG A;  4DF7 A;  2KQ3 A;  5FLM H;  3QO2 A;  1XMO Q;  1PH9 A;  4KLK A;  5C4X H;  3A55 A;  4DNT B;  5DM6 3;  2MFI A;  2R7F A;  2RCF A;  4B3T Q;  4YWM A;  2TSS A;  1UAP A;  3CCU A;  4C3I B;  2OQ0 A;  5C3X A;  1SJH D;  2J7Z A;  3HOU G;  4DUZ L;  2EPB A;  4K8J A;  5GAH C;  2AUK A;  1B1Z A;  2K5W A;  3KYH C;  1QB5 D;  1CHQ D;  3OSO A;  1J9O A;  1LAB A;  3UDX A;  2O5I C;  2F0H A;  2L12 A;  1TU2 B;  3EQL C;  4A3E H;  2B63 H;  2X6G A;  4C56 C;  1U0L A;  1NTG A;  4A93 G;  2EYH A;  1WTW A;  4HSV A;  3OMC A;  1JJG A;  4PZ8 A;  5IP7 H;  2LKV A;  2CVR A;  4KTA A;  3KLW A;  3GO5 A;  1SMX A;  3E6Z X;  2R93 G;  1YZ6 A;  4X3T A;  4A3G H;  1PTO H;  2HD3 A;  1E1T A;  2NVQ H;  2F0F A;  4R4Q A;  1L0W A;  4IUR A;  2KHI A;  4OWW B;  4JV5 Q;  4PV1 C;  3J81 c;  4DPG A;  5M3M G;  2Z4H A;  3U50 C;  4BA2 I;  1EOV A;  1PRT B;  1YNN C;  2E5L Q;  4OX9 Q;  1S5B D;  1TWG H;  1XTD A;  2QF7 A;  4LF6 L;  2ZXR A;  5EKL A;  2L0C A;  2I46 A;  4DNI A;  4JW0 A;  3GTO B;  3P7J A;  1KDC A;  1N32 Q;  2DN8 A;  3J7A 5;  3MTS A;  3SDZ A;  3GTG B;  3PUZ A;  3SK8 A;  2L4N A;  3HOV G;  2JA6 H;  2F0G A;  4DR1 L;  5K36 H;  3CP0 A;  1M4V A;  4RA8 A;  1S5E D;  1ICF B;  2R92 H;  2CW0 C;  5FJ8 G;  3U4Z A;  3S1M H;  5J1Z A;  2N88 A;  3FKI B;  5C4Z A;  2YTX A;  3I55 A;  4UP7 A;  1STB A;  2K33 A;  1V1P B;  3LWU A;  4UAI A;  2JN4 A;  3S1Q H;  2YYZ A;  4XQN A;  3VYS A;  2CH4 A;  4MHE A;  4ZKC B;  1T5E A;  2PZT A;  3ZJY C;  5FLX E;  4NXN Q;  4DV1 L;  3I4O A;  2DNC A;  2ES2 A;  4IPH A;  1W6K A;  4DUZ Q;  4F7X A;  3GTK H;  4YWL A;  4DV0 L;  1K0R A;  2E2I B;  5I2Y A;  2Q8T A;  2RF4 A;  3K7A H;  4OON A;  1R4P B;  1KLG D;  3HKZ E;  2VNU D;  3MXN A;  1JOQ A;  4BY1 B;  2JA8 B;  1DON A;  3S2H H;  2B2T A;  3HEJ A;  3O13 A;  3T13 A;  2R7D A;  3TP8 A;  4DAV A;  3BVG A;  1QG7 A;  4AIM A;  2CQA A;  1HFG A;  2B2V A;  1G2S A;  5KYL A;  2A1A A;  4A3K G;  1EFW A;  1JCK B;  1GUN A;  5IT9 L;  2N55 A;  3I73 A;  4WOR A;  1QOH A;  1H9M A;  3VR4 A;  4A3J H;  4DUY L;  3I4M H;  2OXP A;  5D14 A;  1X3P A;  1CT1 D;  2PMZ B;  5TSS A;  1NR4 A;  3S1N H;  3TZU A;  2EYM A;  3K6O A;  2FIN B;  3DM1 A;  1B3A A;  2K5V A;  2B2T C;  1HQM C;  4KV6 A;  1JOO A;  2R3Z A;  1SND A;  4JG2 A;  1LTA D;  2ZXP A;  1LLR D;  2BH2 A;  3E0E A;  2BA1 A;  2K4K A;  3GTM B;  2B2V C;  4R9W A;  3RLF A;  4BY7 G;  1EU4 A;  3TP5 A;  2UXB L;  3L0O A;  3HZX A;  1BNZ A;  2SOB A;  4HJ8 A;  4QJF A;  4R4O A;  4DR1 Q;  3U4V A;  1SNQ A;  5C4X G;  2XGT A;  3TSS A;  4RFB A;  4CJ0 B;  3J7Z C;  1Y1V H;  4KY5 A;  2RQX A;  2F0T A;  2EJG C;  4LF5 Q;  4HCE A;  2FFK B;  1SE4 A;  1Q7Y C;  4QF4 A;  1KDB A;  4A3L G;  1GO3 E;  1GJX A;  4CDD C;  4UHV A;  4JI5 L;  4KKU A;  3A56 A;  3WDN A;  3J7A F;  4DV1 Q;  3HKZ G;  3IKJ A;  1YNX A;  1KQS A;  4BBS B;  4DV0 Q;  4A3E G;  2B63 G;  1VQH A;  2B2Y A;  2A69 C;  2D5D A;  1YHQ A;  3EIV A;  2WKC A;  1STY A;  5IP7 G;  2F0P A;  4FDB A;  1ML0 D;  3HOV B;  2DGY A;  2B2U A;  5I9O A;  2AQ1 B;  3IL8 A;  1EYD A;  2CFM A;  4FP5 D;  3R8B A;  1JOR A;  5IYD G;  3K0X A;  1VQO A;  4A3G G;  1A2U A;  1I6H B;  1HA5 A;  2G5D A;  1I4P A;  3G6J B;  2B2Y C;  4ZRZ A;  2KVM A;  1TVX A;  1GM5 A;  4Y7N H;  5FK9 C;  1STA A;  1TS2 A;  4CKB A;  3NTK A;  2I5L X;  4DUY Q;  4KHZ A;  1DGS A;  5BN3 A;  1L1O A;  1DZ1 A;  3KDF A;  4ZKB B;  1FD7 D;  2D2C C;  4YCU A;  3UDF A;  4DK0 A;  4DGZ A;  2EE1 A;  1Z7T A;  1S4Z A;  3MXG A;  4ABN A;  4JC0 A;  4K2K A;  1MSH A;  5KNC A;  1VQ7 A;  3HS0 C;  1UNS A;  5BR8 L;  4BXX H;  4P71 A;  2JA6 G;  5K36 G;  2UXB Q;  2R92 G;  2FMC A;  1Q1E A;  4QY7 A;  3CME A;  2I0Q A;  1XNQ L;  1RHP A;  1F2M A;  1IXR A;  4F87 A;  4LNQ A;  2PZU A;  1R4Q B;  1SYE A;  1GUO A;  3BVZ A;  1I50 B;  1T9H A;  1JB3 A;  1E3P A;  1ZKO A;  1SE2 A;  3SHL A;  1HJP A;  1E0B A;  3AFQ A;  4X64 L;  4A3K B;  1V1O A;  3K5M A;  4A3B B;  4JI5 Q;  3PIO A;  5LL6 S;  1LTS D;  3I91 A;  1LTL A;  1CFM A;  3KFU A;  2E76 C;  2A6E C;  3R3O A;  3HOW H;  3I7F A;  2EJM A;  4DNR B;  5GAE C;  3R93 A;  3J81 i;  3GTL B;  1SNO A;  4KHV A;  2EXD A;  3DWP A;  1EWC A;  1EQR A;  3H0G H;  4RCN A;  5ELN A;  4EQP A;  5AJ3 Q;  2BE5 D;  2LXJ A;  4EQ5 A;  1QVC A;  1XWE A;  5M5W H;  3MA2 B;  3I4M G;  2QW7 A;  1NMG A;  2PQA B;  4P73 A;  1LTB D;  2EIF A;  4IOC A;  4FNF A;  5ISR A;  1PH6 A;  3I70 A;  3G71 A;  1EQT A;  1SE3 A;  3I4N B;  1CKN A;  5IYB H;  1EFI D;  1Q1B A;  1QVF A;  5ELO A;  4JBJ A;  3OPO A;  5M5Y B;  5HGQ A;  3HKZ B;  4NP5 A;  1WTP A;  1K3B C;  3CC2 A;  4KJO A;  2JJQ A;  2JE6 I;  4DK1 A;  4LF7 L;  5EPJ A;  3Q23 A;  1BBW A;  1O7Y A;  1EEF D;  1FGU A;  1D8L A;  2FXQ A;  3GP7 A;  4CDE C;  4UPA A;  1GUS A;  1X9N A;  3RUZ A;  1PLF A;  1TWF H;  1Y1V G;  4HN7 A;  3FPP A;  1P16 A;  4OO1 I;  1TWC H;  1PVO A;  3M4O H;  1SEB D;  1PTO B;  5I4D A;  2WP8 J;  1TWH H;  2FHT A;  1K8A C;  4A3G B;  5EQ0 A;  4DK6 C;  2NVQ B;  1AN8 A;  4K6L A;  1STE A;  1G2T A;  2JSO A;  4A3I H;  1K8G A;  3W5O A;  3L2P A;  4LFB L;  4XIG S;  3JAM c;  5E7N A;  1XYI A;  2EYP A;  4NB3 A;  3GV6 A;  3UE0 A;  1BVS A;  4L5S A;  3ND8 A;  2D0O A;  4DR6 L;  3M4Q A;  3NEL A;  1RL2 A;  3V2T A;  3D6C A;  1K8O A;  2RDG A;  1CKM A;  2A8V A;  2ID0 A;  5GQO A;  4B9X A;  4A75 A;  1WI5 A;  2LXK A;  3S17 H;  3ND9 A;  1YJ9 A;  3V96 A;  3CCR A;  2XSC A;  5CV4 A;  4JI4 L;  1W2B A;  4DR5 L;  1GUW A;  4PMC A;  3TS2 A;  1TR5 A;  2EQS A;  3S9W A;  4DR4 L;  3N52 A;  4LMQ D;  3S1Q B;  4C3H H;  3NE5 B;  5LMU L;  2HDL A;  1NSN S;  2AQ3 B;  3NQI A;  5EAY A;  2DY7 A;  2UXD Q;  2JA5 H;  4WJW A;  2XTI A;  4BXX G;  1NR2 A;  3H91 A;  1VQG A;  3RD4 A;  3CU7 A;  3T51 B;  1CHP D;  4DV2 Q;  1LT4 D;  1STN A;  2N8N A;  2DY8 A;  3AFP A;  2HT1 A;  3K7A B;  2UUB L;  4ME5 A;  2EY5 A;  4LF7 Q;  2ENB A;  2NYZ D;  3E3X A;  1PTO D;  2I5H A;  4OXP A;  2XN9 C;  5KNB A;  4O1N A;  4A3D B;  1D1I A;  1DD2 A;  1OXX K;  2F0E A;  1I94 L;  2BOS A;  2KA7 A;  4PMB A;  3S2H B;  2GVA A;  4IPG A;  1HR0 L;  5K5P A;  2M00 A;  3SVM A;  4P2C B;  1VQE A;  4IO9 A;  1LYL A;  1VQI A;  1PZJ D;  2VL6 A;  4PMW A;  4ZAI A;  4CGY B;  4TRD A;  4A3J B;  1OXU A;  3R2I A;  1BF4 A;  4JI3 L;  3S24 A;  2GN5 A;  3TME A;  3S1N B;  1VQL A;  2EYL A;  5E4X A;  1VDZ A;  4DAP A;  2K5N A;  3EVQ A;  4BA1 I;  2B39 A;  4X65 Q;  4DAY B;  3HOW G;  1IYU A;  3UDI A;  1FJG L;  1SNC A;  4KK7 A;  4RGT A;  4JBM A;  3GTP B;  4DR6 Q;  3G48 A;  2D9U A;  3J80 L;  1QIL A;  5EBC A;  1BCP C;  1VQ8 A;  4TVA B;  3H0G G;  1B7Y B;  5EKK A;  4KKS A;  5CC4 A;  3PO2 B;  1Q8K A;  1WOC A;  1F2Z A;  3TS0 A;  2LS0 1;  5M3M H;  3GTQ H;  3J7A V;  4JI4 Q;  1ONL A;  4DR5 Q;  4OEL B;  5C0X I;  3SEB A;  2QGQ A;  1FNW A;  2JYO A;  2NUC A;  3GTJ B;  4DR4 Q;  1XX8 A;  2OWO A;  3T1Y Q;  4OWX B;  2L9H A;  5LMU Q;  3MC0 B;  2Z6B A;  1Z9F A;  5IYB G;  4K14 A;  3A8J E;  4PZ7 A;  1ENC A;  4JVZ A;  1TKW B;  2BDN A;  4IUQ A;  3J81 E;  2KED A;  5D3I B;  3DLL A;  4IJH A;  2C35 B;  1G29 1;  1WJJ A;  4HED A;  2E2H H;  2ZXO A;  2UU9 L;  1VF7 A;  2UUB Q;  1N34 L;  1SFO B;  1S40 A;  3S2D B;  4X66 L;  3FMC A;  3KF8 A;  5IOD A;  4C2M H;  1L0X B;  2EY6 A;  1I94 Q;  1PMR A;  1PH4 A;  4XYQ A;  3VDY A;  1HR0 Q;  5C3E B;  3ULL A;  3TZD A;  5ELB A;  2A19 A;  2PW7 A;  1Q82 C;  2P5Z X;  4A3I G;  5DAU A;  2WKD A;  1XMQ L;  1C4Q A;  4RGO S;  5IT9 c;  2MO0 A;  3I72 A;  3NWT A;  2ZJR A;  2QA4 A;  1EIH A;  1WYD A;  3CAM A;  3X3N A;  1J6Q A;  1VQB A;  2F3I A;  5A2Q E;  2G9H D;  2VQE L;  1GD7 A;  3JC6 6;  1CSP A;  4M8A A;  4AYB E;  3ICE A;  1HUM A;  1X55 A;  5JJZ A;  4R4I A;  1TY2 A;  4XQJ A;  1AZQ A;  3H94 A;  1HZB A;  1SMY D;  3I56 A;  1MGS A;  3FEW X;  4GNX A;  2NTT A;  1QUQ A;  2K01 A;  2YU9 H;  4N9T A;  4LF9 L;  3HOY H;  2IWH A;  1KC8 C;  3PO3 B;  4C3H G;  1EQQ A;  1Q46 A;  4JPB W;  1OXT A;  3OW2 A;  4XQQ A;  4JBK A;  5DNF A;  1B9N A;  1PFB A;  1WD0 A;  1SAP A;  3HOX B;  1W6J A;  1L2F A;  3OTO L;  1UE1 A;  3HG9 A;  2PI2 A;  2Q2I A;  4GNX C;  4C3J H;  2PI2 E;  2QDB A;  1EYA A;  2Z6K C;  4OIJ A;  4FF3 A;  3C1F A;  1QZG A;  2F3V A;  3HRZ C;  4QUC A;  4I7A A;  2E2D C;  1WD1 A;  2R7Z H;  1QJO A;  1IBM L;  1N34 Q;  5GRO A;  1M8A A;  1UWV A;  3JAM i;  5JJI A;  3CQZ H;  4A3M B;  2A6H D;  3H0G B;  4A3L H;  5DLQ E;  4G7O C;  3NBH B;  2KHJ A;  3W3A A;  3GD7 A;  2Q2U A;  5I2X A;  1HPC A;  1EIF A;  1X6O A;  4A76 A;  1IKM A;  4GKK L;  3OYY A;  3I8Z A;  4X3K A;  1EYG A;  1EU3 A;  4AYB G;  3KF6 A;  1XMQ Q;  1JC7 A;  2A68 D;  4V19 0;  3PUX A;  4X3S A;  4V0B A;  3M3Y H;  3AU7 A;  4GN4 B;  2VQE Q;  2Y0S B;  1XTC D;  5G3L D;  1FNU A;  3C3L A;  2JA7 H;  4LUO A;  3ERQ A;  5IE8 A;  5IYD H;  1JT8 A;  4DK3 C;  4A4I A;  4DN4 M;  4ZCK A;  4QB4 A;  1VQ6 A;  2IW3 A;  2K28 A;  3IFD A;  4DR2 L;  4WJ3 M;  4GOP B;  2AQ2 B;  4JI8 L;  4O42 A;  1JQY D;  1WTQ A;  1C0A A;  1BCP B;  4BWG B;  3VR5 A;  1SE8 A;  2WAQ E;  2O5J C;  1TWH B;  1JJ2 A;  1QVG A;  4MN3 A;  4S3S A;  3DEP A;  3OTO Q;  4JYA L;  2JEB I;  4ZUJ A;  3UDG A;  1X56 A;  1PRT F;  4KMU C;  3RN5 A;  2B3G A;  4HJ7 A;  2H5X A;  3AYH B;  3D6W A;  1II3 A;  1RIP A;  4N8X 1;  3PUV A;  4L63 B;  1E2W A;  5ELD A;  3A7A B;  1TWA B;  1Y8O B;  2MQH A;  2V1C C;  2BCO A;  2Z1C A;  3C46 A;  1V1Q A;  5IGB A;  3QOJ A;  1VQD A;  1IBL L;  3NSW A;  1K0S A;  3LX0 A;  3L7Z C;  3CC7 A;  5C5L A;  3K59 A;  3RN2 A;  4DV7 L;  3D4R A;  5EBD A;  1U4L A;  1KNA A;  2O4X A;  2RDF A;  1BUV T;  5C4J H;  5ELE A;  3S17 B;  2IHF A;  1ZYR D;  2TMP A;  3BZC A;  3K7U C;  1UEB A;  4KI0 A;  4KY6 A;  3RR5 A;  2UUA L;  1HTP A;  4E6I A;  4JI2 L;  1VQP A;  3MFY A;  3F1Z A;  1YI2 A;  2EXZ A;  1G6P A;  2ICI A;  2K5Q A;  2LSS A;  3WWV A;  1YHB A;  4GKK Q;  4J8Q A;  1QZH A;  1LUZ A;  4WJ4 A;  5IGE A;  4KD4 A;  1JE4 A;  2IX3 A;  1GOZ A;  1JMC A;  1EEI D;  1YIJ A;  3TRZ A;  2JA5 B;  2F0S A;  4J1M A;  2JP1 A;  1SR3 A;  1DOM A;  3WOE A;  1PRT D;  2Q8R E;  1KD1 C;  3BDC A;  3DM3 A;  1E2Z A;  2KHS A;  5JJL A;  4IUP A;  4LJZ C;  1EOT A;  5FO8 B;  4ILW A;  2O2L D;  2Q2H A;  5LL6 X;  2NWG A;  2HUG A;  2WAQ G;  1C48 A;  4K5X A;  3FP9 A;  3HOY G;  3W2D A;  5GAG C;  1ESR A;  4DR2 Q;  4OHJ A;  2CCZ A;  3H09 A;  4JI8 Q;  3TP7 A;  3Q0A A;  3HOU B;  4NW2 A;  5IGG A;  1HNZ L;  4LF6 Q;  4LWC A;  1PXU A;  5IIF A;  1YHA A;  3DXJ C;  1IW7 C;  2WAC A;  1HZA A;  5BN4 A;  4JYA Q;  1C7Y A;  2L5T A;  4AYB B;  4C3J G;  4X62 L;  1Z6H A;  3A8K E;  3BG3 A;  3E9H A;  4RHR A;  4K5W A;  5ELC A;  5D65 A;  4A93 B;  1NCV A;  4X3U A;  2R7Z G;  3CD6 A;  1G91 A;  1WTO A;  1SNM A;  1IBL Q;  3CXC A;  2R93 B;  1KRS A;  4DV7 Q;  5CBE E;  3KLR A;  3SXH A;  3TP6 A;  1TY0 A;  1ENA A;  3K8A A;  5M3M B;  1MJC A;  1EZ8 A;  2UUA Q;  4CDC C;  2KEC A;  4JI2 Q;  4G7H C;  2XRS D;  3T16 A;  4IFD J;  1YNJ D;  4BBR H;  4UP9 A;  2J0T D;  4QL5 A;  1DJR D;  4AH6 A;  1H9S A;  4APV A;  1YJW A;  1SRO A;  2JA7 G;  4RWS C;  2IY5 B;  2KOL A;  2K32 A;  2NVX B;  2R6G A;  4OGQ C;  1BXT A;  1FL0 A;  5CV5 A;  4H13 C;  4KY7 A;  3JAM E;  2NN6 H;  1R9T B;  1IL2 A;  1EZ6 A;  1PH8 A;  1ET6 A;  2NBF A;  1SDF A;  1PYW D;  3L9A X;  1YVC A;  3SK6 A;  4XDX A;  1NAP A;  4ODG A;  1IL8 A;  1OXS C;  1N8R C;  1O7L A;  3ERO A;  1EQV A;  2B2U C;  2F0W A;  4X6A H;  1I3Q H;  1LTT D;  4B3M L;  2KEE A;  2RHS B;  1HNZ Q;  5KND A;  3BYY B;  4DV3 L;  1LV9 A;  4RCO A;  4POF A;  5C44 H;  2MGS A;  3MEH A;  1Y1W H;  4R8N A;  3DWA A;  2LY7 A;  3HFZ B;  4X62 Q;  3BVM A;  1L1O C;  3FPU B;  3Q8D A;  1CZW A;  3H6M A;  3RMH A;  1HTL D;  4EQO A;  4FVM A;  4RGN A;  2KJX A;  3DMU A;  4JOI A;  2OCE A;  4DXG A;  1S72 A;  3P75 A;  4F88 A;  4GKJ L;  1VS0 A;  2K14 A;  4GN5 A;  4PG3 A;  4K8I A;  5JPN C;  3TQY A;  4FXK C;  5E3F A;  3J80 c;  3F2B A;  1NY4 A;  2WAQ B;  3M7G A;  4PNY A;  1BKB A;  2NVT B;  3ER0 A;  3C2P A;  3V05 A;  5IY0 A;  2GVB A;  2SEB D;  3OOC A;  1T5X D;  3S15 H;  4FF1 A;  3KJP A;  3CCL A;  1HH2 P;  1K83 H;  1LTG D;  4H02 A;  2F0N A;  1IBK L;  3NUC A;  3RZO H;  5T1G A;  4YY3 L;  2BH8 A;  1KAB A;  4BY7 B;  2L55 A;  4YWK A;  4YHH L;  3MHB A;  3GQB A;  4Y52 H;  2WFW A;  1VQF A;  4YCV A;  2HDM A;  2BDO A;  5C4X B;  3K5O A;  2X6L A;  1KDA A;  4EGV A;  1SBB B;  1PHJ A;  1LAC A;  5M3F G;  5HY6 A;  4C1N K;  1X3F A;  2NZH A;  3Q24 A;  3CQZ B;  1CI3 M;  1Y69 U;  2F1M A;  3VYU A;  2F0L A;  5JEA J;  3QIA A;  1YNN D;  2M2L A;  2MNA A;  2E2J H;  4HCS A;  3LNN A;  4H0L C;  2A5H A;  4DXF A;  4GS3 A;  4JBW A;  2EVB A;  3C1E A;  1CKO A;  4IUV A;  4HIK A;  5BR8 Q;  4DV3 Q;  4A3E B;  2B63 B;  3MXN B;  1RTO A;  5IGF A;  4CHT B;  3VYR A;  4HIM A;  1WTX A;  4KHP L;  2CW0 D;  1CSQ A;  1VF5 C;  1XNQ Q;  1Q86 C;  1JWS D;  1EUJ A;  1LT3 D;  1P8L A;  4DA2 A;  1S3O A;  4B3R L;  2QIL A;  4HID A;  4N9P A;  4NDX A;  4TQU S;  3CCM A;  4GKJ Q;  1ASY A;  2ZJQ A;  1H9K A;  4YCW A;  3BU2 A;  2K50 A;  4TKO B;  4X64 Q;  1XJV A;  2AWN A;  3FDT A;  2RBM A;  3DWQ A;  1KIX A;  4JI6 L;  1SYD A;  2VB2 X;  3HP3 A;  3MFG A;  1TWG B;  4LUV A;  4BBR G;  2LMC B;  1E7Z A;  1PTO F;  4ID6 A;  1JOK A;  1HR0 W;  3CCS A;  5I9P A;  2F4I A;  4RKB A;  5HUR A;  3K5L A;  1DOL A;  2I07 B;  4IFD H;  1IBK Q;  1H9R A;  3KLS X;  3Q6S A;  2JA6 B;  3GTO H;  2Q8I B;  1AEX A;  2R92 B;  1X54 A;  1K9M C;  2RSN A;  3BZD B;  4YHH Q;  2MO1 A;  5IWA L;  3S1M B;  2EYF A;  3EJI A;  4LUZ A;  5IT9 E;  2NN6 G;  4HJ5 A;  1TXY A;  1VMP A;  4OWT B;  3FKI H;  1A8V A;  3D3R A;  5CV9 A;  4NKL A;  3KJO A;  5FO7 B;  1S5F D;  1B70 B;  3J7Y W;  1X3E A;  2AUJ D;  1E22 A;  2A74 C;  4FXG C;  1B50 A;  4DKA C;  3SGI A;  4Q0F A;  4G7Z C;  5LMN L;  3GTK B;  5JJK A;  1ILP A;  3U9S A;  5C44 G;  4XTC S;  1Y1W G;  1NBW A;  3A54 A;  2E2I H;  1YJN A;  2PQE A;  2F0V A;  2IPK D;  1I5F A;  4H7B A;  2ZTD A;  1F9P A;  3OMG A;  1KNE A;  4KHP Q;  3VR2 A;  2SDF A;  3QB3 A;  4BY1 H;  3OIP A;  3NWS A;  2QDL A;  1MD2 D;  5I6Y A;  5KYI A;  2VUM G;  4B3R Q;  4DV6 L;  2KEN A;  1WVL A;  4OO1 G;  3EBE A;  3NQT A;  1V9P A;  1TII D;  2AHO B;  3OIQ A;  1OO9 B;  2J4X A;  3H3V H;  1L1O B;  5KGU A;  3I4M B;  4GZY C;  3KDF B;  3KBG A;  4KN7 C;  3QR8 A;  4GLA C;  2VS1 A;  1HXY D;  1IZ6 A;  4JI6 Q;  4LFB Q;  1XPO A;  1EWH A;  2A69 D;  1K8M A;  1VQM A;  1ZXT A;  5FLX L;  1G8Z D;  2NZ1 D;  2B8F A;  3GTM H;  4F8M A;  2Z0S A;  2WIN B;  3MXP A;  2UUC L;  3T1H L;  5IWA Q;  1PDQ A;  4TSS A;  1CUK A;  4B3S L;  2B2W A;  4CJ2 C;  3A8I E;  1Y1V B;  4KD3 A;  2F03 A;  1WTR A;  1V1P A;  3TEH B;  5CBA E;  2K7V A;  1VQK A;  3MZ5 A;  5J22 A;  2L15 A;  1A3V A;  1Y14 B;  3VR3 A;  2RHQ B;  5LMN Q;  5FKA C;  3E9I A;  5JEA H;  4IN3 A;  1U9R A;  2B2W C;  1QNK A;  3J80 i;  4BBS H;  1CA5 A;  1KAW A;  4GLX A;  4ZK9 B;  3BZK A;  1JIC A;  2MPM A;  3I3C A;  1RKN A;  4H44 C;  1GVP A;  2WB1 E;  3KK7 A;  4IUT A;  3S14 H;  2RCN A;  3R2T A;  2F52 A;  2KCM A;  2VQF L;  3MVV A;  2E75 C;  4ZUI A;  2ZTC A;  3ULP A;  3WOF A;  2F3W A;  5IGD A;  4A3F H;  4Y7N B;  1PH2 A;  3RLN A;  4I65 A;  4JI3 Q;  1IYV A;  3QJY A;  4K6D A;  1TS4 A;  5IP9 H;  3BYT B;  3TN2 A;  1PFS A;  3NP8 A;  1EYC A;  2MUY A;  1SXT A;  1E2V A;  3CPF A;  2F0D A;  1H95 A;  2A6E D;  4HTH A;  1FJG Q;  1DOK A;  3ULJ A;  1LT6 D;  4IFD G;  3PIP A;  4HMI A;  1UE6 A;  1KRT A;  1XPU A;  3CW2 C;  4CJ1 B;  4RKL A;  5I6W A;  2NVY H;  1F77 A;  1VQJ A;  3CCQ A;  1ET9 A;  3H3V C;  3T1H Q;  1U5K A;  3KOJ A;  3FKI G;  1GUT A;  1YEZ A;  4DR7 L;  1HQR D;  4B3S Q;  4FF2 A;  1L0Y B;  3OW7 A;  1SSO A;  4G57 A;  1N36 L;  1I50 H;  3F2C A;  1V43 A;  3T53 B;  1WCM H;  5G3L F;  1FGB D;  2ZT9 C;  1IHZ A;  4FF4 A;  4R1J A;  4CKC A;  3UE1 A;  1W3S A;  1SYB A;  4C1N I;  5C6A A;  5CV8 A;  3J81 j;  2M9V A;  1BOS A;  1Y8P B;  3HOW B;  1TS3 A;  3H15 A;  3S15 B;  5EPL A;  5CR3 A;  1RCV D;  1KL9 A;  1K83 B;  1LT5 D;  2WB1 G;  3P1H A;  2F0Q A;  1FVI A;  3RZO B;  1HUN A;  1EL0 A;  2UU9 Q;  2A73 B;  1SN8 A;  2HCC A;  2F0M A;  1D6E C;  5COR A;  4BY1 G;  4X66 Q;  4JI0 L;  2JA8 G;  3GTL H;  1JE5 A;  4RMF A;  2EZV A;  3CC4 A;  5FO9 B;  1Q12 A;  3K57 A;  5CGK A;  1TS5 A;  4QCL A;  5M5W B;  2N49 A;  2YTY A;  2VQF Q;  3KBX A;  1RTN A;  4HAE A;  2JK8 A;  2QEJ C;  1A15 A;  4NXM L;  1F2L A;  1J5E L;  4DV5 L;  2E2J B;  4NXN L;  1CQV A;  4ME3 A;  3I4N H;  1G6Z A;  4XT3 B;  1SYF A;  1ICW A;  2ATW A;  2F0O A;  5M5Y H;  2NTS A;  1X3G A;  3SE0 A;  4R8I A;  1BBX C;  2HIX A;  3IRB A;  2AKW B;  1HNX L;  3PUY A;  1AE2 A;  5M5X H;  1AP0 A;  3NEN A;  1A3T A;  1B4O A;  2CWP A;  3PCO B;  1TWF B;  3PV0 A;  3SK5 A;  3W1B A;  4LF9 Q;  4DR7 Q;  1A63 A;  1TWC B;  3SK4 A;  2MJ8 A;  5T1I A;  3M4O B;  4MIU A;  2BE5 C;  2RVL A;  1MBY A;  2L11 A;  1YIT A;  4B08 A;  1BDO A;  4JI7 L;  4RHS A;  5A35 A;  4NMZ A;  1N36 Q;  1EIG A;  1UE7 A;  2AMC B;  2CKZ B;  2UXC L;  4A3I B;  2OTJ A;  1MHW C;  1H9J A;  1KTK A;  3D0F A;  5JEA G;  4K0K L;  1BCP F;  3TBI B;  4LF4 L;  4A3C H;  4BBS G;  4OL7 A;  2N3S A;  1PA6 A;  5IYC H;  4JK1 C;  3I4L A;  4LAA A;  4P72 A;  1SYG A;  2PCF B;  1IBM Q;  4M1U B;  2K52 A;  4JI0 Q;  3RZD H;  1HA6 A;  2X69 A;  3URY A;  1CQF A;  2L1B A;  2IL8 A;  1KAA A;  4I7Z C;  1HNW L;  1VQN A;  5EKI A;  4A3F G;  1U4M A;  3SR1 A;  4C3H B;  2PZW A;  4ZLT F;  1SYC A;  2ALY B;  5KEE A;  2QCP X;  1B53 A;  2F0U A;  5IP9 G;  4LF5 L;  2PQA A;  4NXM Q;  1QWY A;  1J5E Q;  4DV5 Q;  3J80 E;  4L5T A;  1JWM D;  1I4G A;  2XWB B;  3CRK C;  2IX0 A;  4ZYS A;  4PZ6 A;  1HHV A;  1BCP D;  1EY5 A;  2VB3 X;  3KF8 B;  2WB1 B;  5GAD C;  1B3Q A;  4IUU A;  3PF5 A;  3VA5 A;  4KJN A;  3NTI A;  2FJ2 A;  3UI2 A;  1HNX Q;  2HQE A;  1A6X A;  1EY6 A;  1LO5 D;  5M3F H;  1ZEQ X;  4A3D H;  4XT1 B;  1Q3L A;  4K2L A;  1Q81 C;  4P75 A;  3F8T A;  5J3B A;  1EY7 A;  3I2Z A;  2KCN A;  2Z8L A;  1WTV A;  3K0Y A;  5IOC A;  3FVQ A;  4JI7 Q;  1WCM G;  1K73 C;  2IHE A;  5EGT A;  4IJL A;  1BO0 A;  1NMF A;  2SNM A;  3A0J A;  2UXC Q;  1A2T A;  3U9O A;  4A3B G;  4B9W A;  1RDP D;  2WV6 D;  4AQY L;  4IPD A;  4K0K Q;  3ONA B;  2OTL A;  4LF4 Q;  1X3Q A;  3HGB A;  5C5M A;  4MTN A;  4U67 3;  2HHH L;  2K03 A;  5JPM C;  3NBI A;  2DJG C;  3GTP H;  1TT2 A;  3GDE A;  2NB0 A;  5F2D A;  4GNX B;  4L5R C;  1QUQ B;  5ELF A;  1ILQ A;  1D5X C;  2PNR C;  1PTO C;  1QNU A;  5M9O A;  1DYQ A;  1VQ9 A;  1HFN A;  1KXL A;  3D8G A;  1I4H A;  5FLM G;  3PQI A;  5E4W C;  3PO2 H;  3GTQ B;  1CTM A;  3QG1 A;  4PQX A;  5L37 A;  3A7L A;  1HNW Q;  1M90 C;  3EA6 A;  2VXW A;  4O0A A;  4HJA A;  3GTJ H;  1PH5 A;  3B6Y A;  4GN3 B;  1Y8N B;  3DUZ A;  1VCI A;  3I4N G;  2F0K A;  4Q5V A;  1Q8I A;  5CMD A;  2XRQ D;  2EY2 A; 
#chains in the Genus database with same CATH homology
 2KUM A;  5C0X J;  1O80 A;  2E2H B;  2IJ0 A;  4RGM A;  2MHV A;  3PIP 3;  2PO4 A;  1HRJ A;  3NTH A;  4C2M B;  1SNP A;  5BN5 A;  1D5Z C;  3S14 B;  1I4Q A;  3AB9 A;  2OT2 A;  3I90 A;  3G7L A;  1D5M C;  1STH A;  3GV3 A;  3OWF A;  4A3F B;  1EY0 A;  1IKL A;  1OXV A;  1PZI D;  5KRU A;  1GHJ A;  4RH6 A;  2DNE A;  3DHQ A;  3EFX D;  3D31 A;  4LK1 C;  5DEH A;  4FYD A;  1UUP A;  4DAY A;  5E1F A;  4CBV A;  1B44 D;  1SJE D;  4OO1 H;  3VYT A;  2NVY B;  3J81 L;  2YU9 B;  4OIK A;  3HOY B;  5JVH 3;  2R61 A;  1LTR D;  2CHB D;  2K5D A;  1WCM B;  3CRL C;  4IAL A;  4C3J B;  1PFM A;  3PMF A;  1Z47 A;  1AZP A;  3F2U A;  1GHK A;  2XVS A;  1I6V C;  1JR0 D;  3NPP A;  3T56 B;  3L3O C;  2R7Z B;  3D4W A;  5CYU A;  5A2Q L;  1SMY C;  2K05 A;  2SNS A;  1I4X A;  3QOL A;  4FO2 A;  1A3U A;  2MP1 A;  1CM9 A;  1DCZ A;  2RDH A;  1STG A;  2NN6 I;  3LWE A;  1V8Q A;  2QKI C;  5J39 A;  3AMU A;  3M3Y B;  1NUC A;  3NHH A;  4K5V A;  1QE6 A;  2K1B A;  1ENF A;  2JA7 B;  3MXU A;  4BS9 A;  5HGT A;  2PW5 A;  2D62 A;  2BA0 A;  5M5X B;  2B8G A;  4ULL A;  5FOB B;  3PUW A;  2OEO A;  5CV7 A;  1S5D D;  3FRP B;  1Q90 A;  2A6H C;  3E0J A;  2WII B;  5C3W A;  4EVO A;  2XWJ B;  3CHB D;  1RJT A;  1EY4 A;  1UEA B;  2EOT A;  2IT1 A;  2C5C A;  1BQQ T;  2EDG A;  4HR7 B;  2V4D A;  2A68 C;  3D4D A;  1CZG A;  4RAU C;  1PZK D;  4ZQ3 A;  2K04 A;  3T4A C;  4YIJ A;  3BS1 A;  3X3M A;  5C0X H;  5NUC A;  4G4K A;  2F0I A;  5C4J B;  3RZD B;  1S5C D;  2JXM B;  1J8I A;  1KLU D;  4XXE A;  3MAQ A;  5C4H A;  2XNA C;  1GXD C;  1B2T A;  1F2Y A;  1IW7 D;  4EQN A;  3NBH A;  5LHY 1;  4J6H A;  1MI2 A;  2EYO A;  4WFN 3;  3BDL A;  3P20 A;  1H9S B;  3QWN A;  3NXW A;  3K58 A;  2FMM A;  4DFA A;  5JOB A;  2G9D A;  1FYC A;  4L6T B;  4WRD A;  1C8C A;  2XIW A;  4HMJ A;  1RD9 D;  1ROD A;  1TQO A;  2RSO A;  1HCZ A;  1VMC A;  1LTI D;  5EPK A;  2LFN A;  5M3F B;  3N6R A;  3K5N A;  1DM0 B;  1O78 A;  5JVG 3;  1XXG A;  2PPB C;  4XYO A;  1ZYR C;  2KCC A;  3OHX C;  5JAV A;  1D1K A;  2E74 C;  4QUF A;  1U4P A;  4Z9C B;  5EJW A;  1MSG A;  5D3D A;  1F9Q A;  3ITP A;  1PFN A;  5CV6 A;  4L8J A;  2H4O A;  2K6A A;  3M85 A;  4IFD I;  1PRT C;  1EY9 A;  4KN4 C;  2RA4 A;  2IX1 A;  1D2B A;  3MWY W;  4HSP A;  4DU9 A;  2EJF C;  1FR3 A;  3BDO A;  4C3I G;  2EY1 A;  3M7N A;  4IUN A;  3DEO A;  4U68 A;  5KIX A;  4BBR B;  3IAY A;  1I4R A;  4KKT A;  1X32 A;  2GA4 B;  1ESF A;  2C9O A;  1CA6 A;  1F9S A;  3TDQ A;  2JEA I;  1F9R A;  3Q22 A;  2ICE C;  2OF1 A;  2H1E A;  3OWE B;  3M4Y A;  3S16 B;  3CKI B;  2F0J A;  3NK9 A;  3S1R B;  4IZ8 A;  4QMG A;  5COY A;  4FXD A;  1O7Z A;  3E5S A;  1I3Q B;  1BR9 A;  5C44 B;  1YNJ C;  1JWU D;  1Y1W B;  1QCB D;  3IFT A;  3ZYY X;  3HOZ B;  1AFP A;  1EY8 A;  1U4R A;  3PIO 3;  4IQZ A;  4CKE A;  2VUM B;  5IGC A;  5C0X G;  2AWO A;  1CK1 A;  3KUP A;  4QIW B;  5DM7 3;  3VR6 A;  2EYJ A;  2HCI A;  2Z4I A;  3JAM L;  5AFW A;  1DXM A;  3VA7 A;  2RKS A;  3KLS A;  1AW7 A;  1RF2 D;  1B9M A;  1FNV A;  2PYK A;  4UDU C;  1GUG A;  4DF7 A;  2KQ3 A;  3QO2 A;  3A55 A;  4DNT B;  5DM6 3;  2TSS A;  1UAP A;  4C3I B;  5C3X A;  1SJH D;  2J7Z A;  2EPB A;  4K8J A;  2AUK A;  1B1Z A;  2K5W A;  1QB5 D;  1CHQ D;  3OSO A;  1J9O A;  1LAB A;  2O5I C;  2F0H A;  2L12 A;  1TU2 B;  3EQL C;  2X6G A;  4C56 C;  2EYH A;  1WTW A;  4HSV A;  3OMC A;  2LKV A;  2CVR A;  4KTA A;  3GO5 A;  3E6Z X;  4X3T A;  1PTO H;  2F0F A;  4IUR A;  4PV1 C;  2Z4H A;  4BA2 I;  1PRT B;  1YNN C;  1S5B D;  2QF7 A;  2ZXR A;  5EKL A;  2L0C A;  2I46 A;  3GTO B;  3P7J A;  1KDC A;  2DN8 A;  3GTG B;  3MTS A;  3SDZ A;  3PUZ A;  3SK8 A;  2L4N A;  2F0G A;  5K36 H;  1M4V A;  4RA8 A;  1S5E D;  2CW0 C;  5J1Z A;  2N88 A;  3FKI B;  5C4Z A;  1STB A;  2K33 A;  1V1P B;  3LWU A;  4UAI A;  2YYZ A;  4XQN A;  3VYS A;  4MHE A;  4ZKC B;  1T5E A;  2PZT A;  5FLX E;  2DNC A;  1W6K A;  4F7X A;  2E2I B;  5I2Y A;  2Q8T A;  1R4P B;  1KLG D;  2VNU D;  3MXN A;  1JOQ A;  4BY1 B;  2JA8 B;  1DON A;  2B2T A;  3HEJ A;  3O13 A;  3T13 A;  3TP8 A;  4DAV A;  3BVG A;  1QG7 A;  2CQA A;  1HFG A;  2B2V A;  1G2S A;  5KYL A;  1JCK B;  1GUN A;  5IT9 L;  2N55 A;  3I73 A;  4WOR A;  1QOH A;  1H9M A;  3VR4 A;  2OXP A;  5D14 A;  1X3P A;  1CT1 D;  2PMZ B;  5TSS A;  1NR4 A;  3TZU A;  2EYM A;  3K6O A;  2FIN B;  3DM1 A;  1B3A A;  2B2T C;  1HQM C;  4KV6 A;  1JOO A;  2R3Z A;  1SND A;  1LTA D;  2ZXP A;  1LLR D;  2BA1 A;  3GTM B;  2B2V C;  4R9W A;  3RLF A;  1EU4 A;  3TP5 A;  3HZX A;  1BNZ A;  2SOB A;  1SNQ A;  3TSS A;  4RFB A;  4CJ0 B;  4KY5 A;  2RQX A;  2F0T A;  2EJG C;  4HCE A;  2FFK B;  1SE4 A;  4QF4 A;  1KDB A;  1GJX A;  4KKU A;  3A56 A;  3WDN A;  3J7A F;  3IKJ A;  4BBS B;  2B2Y A;  2A69 C;  2D5D A;  2WKC A;  1STY A;  2F0P A;  1ML0 D;  3HOV B;  2B2U A;  5I9O A;  2AQ1 B;  3IL8 A;  1EYD A;  4FP5 D;  3R8B A;  1JOR A;  1A2U A;  1I6H B;  1HA5 A;  1I4P A;  3G6J B;  2B2Y C;  4ZRZ A;  2KVM A;  1TVX A;  5FK9 C;  1STA A;  4CKB A;  1TS2 A;  3NTK A;  4KHZ A;  5BN3 A;  1DZ1 A;  4ZKB B;  1FD7 D;  2D2C C;  4DK0 A;  4DGZ A;  2EE1 A;  1Z7T A;  1S4Z A;  3MXG A;  4ABN A;  4K2K A;  1MSH A;  5KNC A;  3HS0 C;  1UNS A;  5K36 G;  2FMC A;  1Q1E A;  1RHP A;  1F2M A;  4F87 A;  2PZU A;  1R4Q B;  1SYE A;  1GUO A;  3BVZ A;  1I50 B;  1JB3 A;  1ZKO A;  1SE2 A;  3SHL A;  1E0B A;  4A3K B;  1V1O A;  3K5M A;  4A3B B;  5LL6 S;  1LTS D;  3I91 A;  1CFM A;  2E76 C;  2A6E C;  3R3O A;  2EJM A;  4DNR B;  3R93 A;  3GTL B;  1SNO A;  4KHV A;  3DWP A;  1EWC A;  4RCN A;  4EQP A;  2BE5 D;  1XWE A;  3MA2 B;  1LTB D;  4FNF A;  5ISR A;  3I70 A;  1EQT A;  1SE3 A;  3I4N B;  1EFI D;  1Q1B A;  3OPO A;  5M5Y B;  3HKZ B;  4NP5 A;  1WTP A;  4KJO A;  2JE6 I;  4DK1 A;  5EPJ A;  3Q23 A;  1O7Y A;  1EEF D;  3GP7 A;  1GUS A;  3RUZ A;  1PLF A;  4HN7 A;  3FPP A;  4OO1 I;  1SEB D;  1PTO B;  5I4D A;  2WP8 J;  2FHT A;  4A3G B;  5EQ0 A;  2NVQ B;  1AN8 A;  4K6L A;  1STE A;  1G2T A;  2JSO A;  4XIG S;  1XYI A;  2EYP A;  3GV6 A;  3ND8 A;  3V2T A;  3D6C A;  1K8O A;  2RDG A;  2ID0 A;  4B9X A;  3ND9 A;  3V96 A;  2XSC A;  5CV4 A;  1GUW A;  4PMC A;  1TR5 A;  3S9W A;  3N52 A;  4LMQ D;  3S1Q B;  3NE5 B;  2HDL A;  1NSN S;  2AQ3 B;  3NQI A;  2DY7 A;  4WJW A;  1NR2 A;  3H91 A;  3RD4 A;  3CU7 A;  3T51 B;  1CHP D;  1LT4 D;  1STN A;  2DY8 A;  3K7A B;  4ME5 A;  2EY5 A;  2ENB A;  2NYZ D;  1PTO D;  5KNB A;  2XN9 C;  4O1N A;  4A3D B;  1D1I A;  1DD2 A;  1OXX K;  2F0E A;  2BOS A;  2KA7 A;  4PMB A;  3S2H B;  5K5P A;  2M00 A;  3SVM A;  4P2C B;  1PZJ D;  4PMW A;  4ZAI A;  4CGY B;  4TRD A;  4A3J B;  1OXU A;  3R2I A;  1BF4 A;  3TME A;  3S1N B;  2EYL A;  5E4X A;  1VDZ A;  4DAP A;  3EVQ A;  4BA1 I;  2B39 A;  1IYU A;  1SNC A;  4KK7 A;  4RGT A;  3GTP B;  2D9U A;  3J80 L;  1QIL A;  5EBC A;  1BCP C;  5EKK A;  5CC4 A;  4KKS A;  3PO2 B;  1F2Z A;  2LS0 1;  3J7A V;  1ONL A;  5C0X I;  3SEB A;  1FNW A;  2JYO A;  2NUC A;  3GTJ B;  1XX8 A;  2L9H A;  3MC0 B;  4K14 A;  3A8J E;  1ENC A;  1TKW B;  2BDN A;  4IUQ A;  3J81 E;  2KED A;  5D3I B;  1G29 1;  4HED A;  2ZXO A;  1VF7 A;  1SFO B;  3S2D B;  3FMC A;  3KF8 A;  5IOD A;  1L0X B;  2EY6 A;  1PMR A;  4XYQ A;  5C3E B;  3TZD A;  5ELB A;  2PW7 A;  5DAU A;  2WKD A;  1C4Q A;  4RGO S;  3I72 A;  3NWT A;  1EIH A;  3X3N A;  5A2Q E;  2G9H D;  4M8A A;  1HUM A;  5JJZ A;  1TY2 A;  4XQJ A;  1AZQ A;  3H94 A;  1SMY D;  1MGS A;  3FEW X;  2NTT A;  2K01 A;  4N9T A;  2IWH A;  3PO3 B;  4C3H G;  1OXT A;  4XQQ A;  5DNF A;  1B9N A;  1PFB A;  1WD0 A;  1SAP A;  3HOX B;  1W6J A;  3HG9 A;  2QDB A;  1EYA A;  4OIJ A;  4FF3 A;  3C1F A;  2F3V A;  3HRZ C;  4QUC A;  2E2D C;  1WD1 A;  1QJO A;  1M8A A;  4A3M B;  2A6H D;  3H0G B;  4G7O C;  3W3A A;  3GD7 A;  5I2X A;  1HPC A;  1IKM A;  3I8Z A;  4X3K A;  1EU3 A;  1JC7 A;  2A68 D;  4V19 0;  3PUX A;  4X3S A;  4V0B A;  3AU7 A;  2Y0S B;  1XTC D;  5G3L D;  1FNU A;  3C3L A;  3ERQ A;  4DN4 M;  4QB4 A;  2IW3 A;  2K28 A;  3IFD A;  2AQ2 B;  4O42 A;  1JQY D;  1WTQ A;  1BCP B;  4BWG B;  3VR5 A;  2O5J C;  1TWH B;  4MN3 A;  4S3S A;  3DEP A;  2JEB I;  4ZUJ A;  1PRT F;  4KMU C;  3D6W A;  1II3 A;  3PUV A;  5ELD A;  1E2W A;  4L63 B;  3A7A B;  1TWA B;  1Y8O B;  2BCO A;  2Z1C A;  3C46 A;  5IGB A;  3QOJ A;  3NSW A;  3LX0 A;  3L7Z C;  5C5L A;  3K59 A;  3D4R A;  5EBD A;  1U4L A;  1KNA A;  2O4X A;  2RDF A;  1BUV T;  5ELE A;  3S17 B;  1ZYR D;  2TMP A;  4KI0 A;  4KY6 A;  1HTP A;  4E6I A;  3MFY A;  2EXZ A;  2ICI A;  2K5Q A;  4J8Q A;  5IGE A;  4KD4 A;  1JE4 A;  2IX3 A;  1GOZ A;  1EEI D;  2JA5 B;  2F0S A;  4J1M A;  2JP1 A;  1DOM A;  3WOE A;  1PRT D;  2Q8R E;  3BDC A;  1E2Z A;  2KHS A;  4IUP A;  4LJZ C;  1EOT A;  5FO8 B;  4ILW A;  2O2L D;  5LL6 X;  2NWG A;  2HUG A;  1C48 A;  4K5X A;  3W2D A;  1ESR A;  4OHJ A;  3H09 A;  3TP7 A;  3Q0A A;  3HOU B;  4NW2 A;  5IGG A;  1PXU A;  5IIF A;  3DXJ C;  1IW7 C;  2WAC A;  5BN4 A;  2L5T A;  4AYB B;  4C3J G;  1Z6H A;  3A8K E;  3BG3 A;  4RHR A;  4K5W A;  5ELC A;  5D65 A;  4A93 B;  1NCV A;  4X3U A;  1G91 A;  1WTO A;  1SNM A;  2R93 B;  5CBE E;  3KLR A;  3SXH A;  3TP6 A;  1TY0 A;  1ENA A;  5M3M B;  1EZ8 A;  2KEC A;  4G7H C;  2XRS D;  3T16 A;  4IFD J;  1YNJ D;  2J0T D;  1DJR D;  1H9S A;  4RWS C;  2KOL A;  2K32 A;  2NVX B;  2R6G A;  4OGQ C;  1BXT A;  5CV5 A;  3JAM E;  4H13 C;  4KY7 A;  1R9T B;  2NN6 H;  1EZ6 A;  1ET6 A;  2NBF A;  1SDF A;  1PYW D;  3L9A X;  3SK6 A;  4XDX A;  1NAP A;  4ODG A;  1IL8 A;  1OXS C;  1O7L A;  3ERO A;  1EQV A;  2B2U C;  2F0W A;  1LTT D;  2KEE A;  5KND A;  3BYY B;  1LV9 A;  4RCO A;  2MGS A;  3MEH A;  4R8N A;  3DWA A;  2LY7 A;  3BVM A;  3FPU B;  1CZW A;  3H6M A;  3RMH A;  1HTL D;  4EQO A;  4FVM A;  4RGN A;  2KJX A;  3DMU A;  4DXG A;  3P75 A;  4F88 A;  4K8I A;  5JPN C;  4FXK C;  5E3F A;  2WAQ B;  3M7G A;  4PNY A;  2NVT B;  3C2P A;  3V05 A;  2SEB D;  3OOC A;  1T5X D;  4FF1 A;  1LTG D;  2F0N A;  3NUC A;  5T1G A;  1KAB A;  4BY7 B;  2L55 A;  3MHB A;  3GQB A;  2HDM A;  2BDO A;  5C4X B;  3K5O A;  2X6L A;  1KDA A;  4EGV A;  1SBB B;  1LAC A;  4C1N K;  3Q24 A;  3CQZ B;  1CI3 M;  1Y69 U;  2F1M A;  3VYU A;  2F0L A;  5JEA J;  3QIA A;  1YNN D;  2M2L A;  4HCS A;  3LNN A;  4H0L C;  2A5H A;  4DXF A;  4JBW A;  2EVB A;  3C1E A;  4IUV A;  4A3E B;  2B63 B;  1RTO A;  5IGF A;  4CHT B;  3VYR A;  1WTX A;  2CW0 D;  1VF5 C;  1JWS D;  1LT3 D;  4DA2 A;  2QIL A;  4N9P A;  4NDX A;  4TQU S;  1H9K A;  4TKO B;  2AWN A;  3FDT A;  2RBM A;  3DWQ A;  1SYD A;  2VB2 X;  3HP3 A;  3MFG A;  1TWG B;  2LMC B;  1PTO F;  4ID6 A;  1JOK A;  5I9P A;  2F4I A;  4RKB A;  5HUR A;  3K5L A;  1DOL A;  2I07 B;  4IFD H;  1H9R A;  3KLS X;  3Q6S A;  2JA6 B;  2Q8I B;  1AEX A;  2R92 B;  2RSN A;  3BZD B;  3S1M B;  2EYF A;  3EJI A;  5IT9 E;  2NN6 G;  1VMP A;  3D3R A;  5CV9 A;  4NKL A;  5FO7 B;  1S5F D;  3J7Y W;  2AUJ D;  2A74 C;  4FXG C;  1B50 A;  4G7Z C;  4Q0F A;  3GTK B;  1ILP A;  3U9S A;  4XTC S;  3A54 A;  2PQE A;  2F0V A;  2IPK D;  4H7B A;  1F9P A;  3OMG A;  1KNE A;  3VR2 A;  2SDF A;  3QB3 A;  3OIP A;  3NWS A;  1MD2 D;  5I6Y A;  5KYI A;  1WVL A;  4OO1 G;  3NQT A;  1TII D;  3OIQ A;  1OO9 B;  2J4X A;  3I4M B;  5KGU A;  4GZY C;  3KBG A;  4KN7 C;  1HXY D;  1EWH A;  2A69 D;  1K8M A;  1ZXT A;  5FLX L;  1G8Z D;  2NZ1 D;  2B8F A;  4F8M A;  2WIN B;  3MXP A;  1PDQ A;  4TSS A;  2B2W A;  4CJ2 C;  3A8I E;  1Y1V B;  4KD3 A;  2F03 A;  1WTR A;  1V1P A;  5CBA E;  2K7V A;  3MZ5 A;  5J22 A;  1A3V A;  3VR3 A;  5FKA C;  5JEA H;  4IN3 A;  1U9R A;  2B2W C;  1QNK A;  1CA5 A;  4ZK9 B;  1JIC A;  2MPM A;  3I3C A;  1RKN A;  4H44 C;  3KK7 A;  4IUT A;  3R2T A;  3MVV A;  2E75 C;  4ZUI A;  3WOF A;  2F3W A;  5IGD A;  4Y7N B;  4I65 A;  1IYV A;  3QJY A;  4K6D A;  1TS4 A;  3BYT B;  3TN2 A;  3NP8 A;  1EYC A;  2MUY A;  1SXT A;  1E2V A;  2F0D A;  2A6E D;  4HTH A;  1DOK A;  1LT6 D;  4IFD G;  4HMI A;  4CJ1 B;  4RKL A;  5I6W A;  1F77 A;  1ET9 A;  3H3V C;  1GUT A;  1HQR D;  4FF2 A;  1L0Y B;  3OW7 A;  1SSO A;  4G57 A;  1V43 A;  3T53 B;  5G3L F;  1FGB D;  2ZT9 C;  1IHZ A;  4FF4 A;  4CKC A;  1SYB A;  5C6A A;  4C1N I;  5CV8 A;  2M9V A;  1BOS A;  1Y8P B;  3HOW B;  1TS3 A;  3S15 B;  5EPL A;  5CR3 A;  1RCV D;  1K83 B;  1LT5 D;  3P1H A;  2F0Q A;  3RZO B;  1HUN A;  1EL0 A;  2A73 B;  2HCC A;  2F0M A;  1D6E C;  5COR A;  2EZV A;  5FO9 B;  1Q12 A;  3K57 A;  5CGK A;  1TS5 A;  4QCL A;  5M5W B;  3KBX A;  1RTN A;  4HAE A;  2QEJ C;  1A15 A;  1F2L A;  2E2J B;  1CQV A;  1G6Z A;  4XT3 B;  1SYF A;  1ICW A;  2F0O A;  2NTS A;  3SE0 A;  4R8I A;  1BBX C;  3PUY A;  1AP0 A;  1A3T A;  1B4O A;  1TWF B;  3PV0 A;  3SK5 A;  1TWC B;  3SK4 A;  2MJ8 A;  5T1I A;  3M4O B;  4MIU A;  2BE5 C;  2RVL A;  1MBY A;  2L11 A;  4B08 A;  1BDO A;  4RHS A;  5A35 A;  4NMZ A;  1EIG A;  4A3I B;  1H9J A;  1KTK A;  5JEA G;  1BCP F;  3TBI B;  4OL7 A;  4JK1 C;  3I4L A;  4LAA A;  1SYG A;  2PCF B;  4M1U B;  1HA6 A;  2X69 A;  3URY A;  1CQF A;  2L1B A;  2IL8 A;  1KAA A;  4I7Z C;  5EKI A;  1U4M A;  3SR1 A;  4C3H B;  2PZW A;  4ZLT F;  1SYC A;  5KEE A;  2QCP X;  1B53 A;  2F0U A;  1QWY A;  3J80 E;  1JWM D;  1I4G A;  2XWB B;  3CRK C;  2IX0 A;  4ZYS A;  1HHV A;  1BCP D;  1EY5 A;  2VB3 X;  2WB1 B;  4IUU A;  3VA5 A;  4KJN A;  3NTI A;  2FJ2 A;  3UI2 A;  2HQE A;  1A6X A;  1EY6 A;  1LO5 D;  1ZEQ X;  4XT1 B;  1Q3L A;  4K2L A;  1EY7 A;  2KCN A;  2Z8L A;  1WTV A;  3K0Y A;  5IOC A;  3FVQ A;  5EGT A;  1BO0 A;  2SNM A;  1A2T A;  3U9O A;  4B9W A;  1RDP D;  2WV6 D;  3ONA B;  1X3Q A;  3HGB A;  5C5M A;  4U67 3;  2K03 A;  5JPM C;  3NBI A;  1TT2 A;  5F2D A;  2NB0 A;  5ELF A;  1ILQ A;  1D5X C;  2PNR C;  1PTO C;  1QNU A;  5M9O A;  1DYQ A;  1HFN A;  3D8G A;  1I4H A;  5E4W C;  3GTQ B;  1CTM A;  3QG1 A;  4PQX A;  3A7L A;  3EA6 A;  2VXW A;  1Y8N B;  3DUZ A;  1VCI A;  2F0K A;  4Q5V A;  1Q8I A;  5CMD A;  2XRQ D;  2EY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...