3DM1A

Crystal structure of the complex of human chromobox homolog 3 (cbx3) with peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
52
structure length
52
Chain Sequence
EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 3
publication title Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 12
structure length 52
sequence length 52
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dm1A00
2B2WA 3GV6A 4QUCA 4R8IA 2CVRA 2HDMA 4IUTA 1XYIA 3F2UA 2K28A 1C8CA 1RTNA 1WTOA 2FINB 2L11A 3Q6SA 2L9HA 1CA6A 2RSOA 1F9RA 3P7JA 1CM9A 1NAPA 4HEDA 3LWEA 4DN4M 3I8ZA 4OIJA 1WTWA 2NZ1D 1BBXC 1B2TA 3FDTA 2FHTA 4RA8A 4X3UA 1BO0A 1HHVA 1JICA 1VMCA 1DOLA 1WTXA 3I90A 4RAUC 2K05A 2MP1A 4XDXA 1NR2A 5CBAE 2HCCA 1MI2A 1QE6A 5EQ0A 4ZAIA 2Q8RE 3N52A 1MGSA 1J9OA 1O7YA 2VXWA 4HAEA 1PFMA 1SDFA 1U4MA 5EPLA 1PLFA 4LMQD 3SVMA 1U4RA 4OIKA 5D14A 2M2LA 2B2UC 1O7ZA 1NCVA 1DONA 3DM1A 2NYZD 5D65A 2X69A 2L4NA 3D6WA 3UI2A 1SAPA 1G91A 4IUQA 1F9SA 5CORA 1PFBA 1B50A 1F9PA 2KOLA 1B4OA 2B2WC 2KUMA 2DY7A 2FJ2A 2D9UA 1SSOA 2RA4A 3MWYW 1AZPA 2X6LA 2K03A 1RHPA 1RODA 1WTPA 1IKLA 2EE1A 1AZQA 4RWSC 2B2VA 2B2YA 2HDLA 4O42A 1LV9A 5E4XA 1NR4A 1ICWA 1B53A 3DEPA 1HFNA 3R93A 2JP1A 4MN3A 3FPUB 1IL8A 4CJ2C 3KUPA 1G2SA 5EKIA 5CBEE 1EL0A 1PFNA 1QNKA 3TN2A 4CJ0B 4IURA 3IFDA 1PDQA 2RSNA 3IL8A 5T1IA 1JE4A 2NWGA 2HUGA 5JJZA 2MGSA 5DNFA 1WD0A 4HCSA 4X3KA 2B2TA 1GUWA 2RVLA 1KNEA 1EQTA 1U4PA 2KEDA 5EPKA 4IUPA 1KNAA 2EOTA 4R9WA 5AFWA 2MJ8A 4X3SA 2KVMA 4ZKBB 1WTRA 1F2LA 1ML0D 1ESRA 3HP3A 2L1BA 3I91A 4CJ1B 1XX8A 1DZ1A 1G2TA 1ZXTA 2FMMA 5EJWA 2MPMA 1TVXA 1S4ZA 1ILQA 3ONAB 2L12A 5EPJA 1BF4A 1DOMA 2K01A 2B2VC 1F9QA 2B2YC 5E4WC 3DEOA 5COYA 1WTVA 1VMPA 2H1EA 1HFGA 4XT1B 4ZKCB 1CA5A 1B3AA 1E0BA 2N88A 2N55A 3G7LA 1X3QA 4QUFA 4ZK9B 1M8AA 1ILPA 1U4LA 1RJTA 3TZDA 3MTSA 1G6ZA 2KEEA 2BDNA 4XT3B 2J7ZA 1DOKA 2XIWA 1QG7A 1J8IA 1HUMA 2R3ZA 3GV3A 4NW2A 1X32A 4UAIA 1WVLA 2HCIA 2FFKB 1WTQA 4IUUA 3KBXA 1EIGA 2B2TC 3H91A 1RTOA 2B2UA 1MSHA 1IKMA 1Q3LA 2JYOA 1AP0A 1HUNA 2Q8TA 1HA6A 2EPBA 2X6GA 4X3TA 4U68A 1HRJA 2K04A 4MHEA 1BNZA 1O80A 2K1BA 1WD1A 2SDFA 1MSGA 3QO2A 1EIHA 5T1GA 2DY8A 1EOTA 4IUVA 3I3CA 4ZLTF 1A15A 2IL8A 2KECA 4HSVA 1X3PA 5CMDA
chains in the Genus database with same CATH superfamily
4DK3C 1JQYD 4HJ8A 3BZKA 2XRSD 1EZ8A 3PCOB 1E1TA 5FO9B 1F9RA 3J80c 2NUCA 4KHPL 3OOCA 5IP7H 3CCVA 3PV0A 4QIWB 4X3UA 1TWGB 4GLVB 1VCIA 3UDFA 1DOLA 4DK1A 4JI0Q 4OWXB 2F0UA 3CP0A 3DUZA 1N34Q 2UUBQ 1MI2A 1F2YA 1KC8C 4FYDA 2EY6A 3MXGA 4HN7A 3C3LA 1A2TA 4P72A 4EVOA 1SFOH 2H5XA 5KNBA 4G4KA 4ZUJA 5D65A 3TP8A 2E2HB 3I2ZA 1EIFA 5C4XG 3J80E 2ZM6Q 2KCNA 4N8FA 1I50B 4OO1I 2B2WC 5CV6A 2D9UA 1E1OA 5AJ3Q 4RKLA 2R92B 1XPRA 4C3IB 1X3EA 2B2VA 4O42A 4HIMA 1OXSC 5A35A 2K14A 4XQJA 4A75A 5CV8A 4KN7C 2PCFB 4CDEC 1BBUA 4V190 1EWCA 2VUMH 5GAGC 1SBBB 2JA9A 1CSPA 4A3KH 3RZDH 1X55A 5IYCH 1CZWA 1EWIA 2I0QA 4GNXC 2JA5G 2V4DA 1SYDA 4BXXG 2GA4B 3G6JB 3VR6A 1BCPD 5FLXE 2F0PA 2RVLA 3FPPA 3HOXG 2KEDA 2K5VA 2F0HA 2UUCL 3HOWH 4JI1Q 4OO1H 2RDFA 1VQ4A 2PO4A 5EJWA 2MPMA 1Y1VG 4JI2Q 5M3MB 1SYBA 5F2DA 3A55A 2K6AA 3D3RA 1QVCA 3PMFA 1UWVA 3M85A 3U9OA 2RCFA 1UUPA 4BA1I 1YIJA 2GVBA 1PV4A 4JOIC 5TSSA 1Z9FA 4XT3B 3F2BA 4DNTB 3WDNA 3HOYG 1V9PA 4B3ML 4R4QA 2E2DC 3ER0A 4F7XA 4R4OA 5EBDA 1QB5D 3T1HQ 1V1QA 1XWEA 1WD1A 3NSWA 4A3BH 4KY5A 4UHVA 1ZKOA 3PUVA 1N8RC 2EJFC 1EIHA 4OWTB 4KKUA 1GHJA 2PMZB 4K8JA 2ZXRA 3PUZA 4A3MH 3S24A 1GUOA 1IYUA 4A93G 4C3HH 2IHFA 5C4ZA 2FXQA 4B3TQ 1SFOB 2JA8G 1Y8OB 1WTWA 3NENA 1JICA 1I4RA 5K36H 3W1GA 4RGTA 2B63G 4ZAIA 4IUVA 4A3IG 1LT5D 1O7YA 3AYHB 1HPCA 1QJOA 4JW0A 2MO1A 4TSSA 1G91A 2VUMB 4MIUA 2GN5A 3RZDB 1WCMG 4DAYB 1EIYB 3W3AA 4B08A 1HCZA 4RWSC 4BBSG 4LW1A 2HDLA 3S16H 4YY3Q 1LV9A 4OONA 2MNAA 5DAUA 4DF7A 4EQOA 4NB3A 2R7DA 1VS0A 2DGYA 2MQHA 5C4XH 4MN3A 1B3QA 1HNWL 1IL8A 2R6GA 3V96A 1NUCA 5E1FA 3VR3A 1PDQA 5D3IB 1JE4A 2NWGA 2MGSA 5DNFA 3S14H 3NEMA 4MTKA 2IHEA 4X65Q 3S15B 4R9WA 1KNAA 4X3SA 4TKOB 3OWEB 1CI3M 4NKLA 1SR3A 4NXNL 1VQPA 1QZHA 4K0KQ 5JEAG 4QL5A 3S1QH 4PMWA 3TDQA 1BF4A 4P2CB 2JA5H 2WACA 2OT2A 4LNQA 4BXXH 3KDFB 2EIFA 2ZJRA 3HOXH 3MXUA 3MFGA 4A3BB 2HHHQ 1U4LA 5KGUA 1PYSB 4A3MB 4GOPC 2NZHA 4DR3L 4C3HB 4K6DA 5IGCA 1WTQA 1Y1VH 2E2IH 2UXCL 4FXGC 3HKZG 4DU9A 1TU2B 2Y0SG 5IT9c 3GTLH 1AP0A 5C3EG 1KQSA 1VQ9A 1EOVA 2VQEL 1GKHA 2SDFA 4JPBW 1FNVA 2F0FA 1NMFA 5LMNW 4UPAA 3JAMi 4ZKBB 4JYAL 2Z6BA 5EAYA 1XNQL 3RR5A 5C4HA 2ZT9C 1VQIA 3HOYH 3FMCA 2EZVA 1VF7A 3ND8A 2Z6KA 1D5ZC 2E75C 2VY3A 5CV9A 3X3MA 3I56A 1SN8A 3KJPA 2ES2A 5IT9E 1QCBD 1WOCA 5C5LA 5CBAE 4POGA 2B39A 2KCMA 2LFNA 1F2ZA 1U4MA 4A93H 4LMQD 2DN8A 5LMNL 2JA8H 2D2CC 1DONA 1HQMC 3T56B 4CKEA 1FNUA 2EYLA 3BVZA 4DV6Q 1D6EC 3PIO3 2BE5C 1JOKA 1NNXA 2JA7G 5LL6X 3NTIA 4DAPA 4OWWB 4A3GB 2EYPA 4EX5A 2B63H 3AEVA 3GO5A 4A3IH 3TZUA 1AN8A 3S14B 5IP9G 4YWKA 1YZ6A 3MZ5A 3U9SA 3EN2A 1NR4A 3NQTA 3T1YL 3KLSX 1RIPA 4B3SQ 3SK8A 3J81j 1WCMH 5J39A 2E5LL 3J7AV 1UE5A 4DV7Q 2BH8A 5T1IA 4JI8L 5M5XH 4A4IA 2AUKA 1EY8A 2A19A 3EIVA 3KLRA 3TQYA 3DLLA 4BBSH 1G8ZD 2K50A 1MJEA 1AH9A 4TRDA 1F2LA 4BY1G 1EU4A 3BDCA 4DR7Q 1CK1A 2NTTA 1ENFA 1PH6A 1TS3A 3JAMc 2B2VC 1Q8KA 1IBLQ 5IWAQ 1OXTA 4C1NK 1VMPA 2H1EA 1I6VC 2AHOB 3EA6A 4LF5Q 1WI5A 1M8AA 1R9TH 2ASBA 3I4NB 5IE8A 1X9NA 4DV0L 3U4VA 3K0XA 3E3XA 2XIWA 1HUMA 5JEAH 3K59A 3HOYB 4X66L 3KBXA 1V8QA 1Q3LA 4X62L 1PHJA 3HOZG 3JAME 2XTIA 4ID6A 3QO2A 4JK1C 2F0JA 2A74C 3L9AX 2RHQB 3PUXA 4R8IA 4APVA 4A3EG 3A56A 4DPGA 1BXTA 1U9RA 2L11A 2L15A 5C3XA 3P7JA 1LACA 2JA8B 1QZGA 1D7QA 2EDGA 5HY6A 4RFBA 1BBXC 5C3EH 4KN4C 4LFBL 3SHLA 3VA5A 1WTXA 4Q0FA 3I90A 3SK5A 3VDYA 2F52A 1HXYD 1STEA 1VQ7A 3N52A 4I65A 3CMAA 2XVSA 4OIKA 5E7NA 1ICFB 3F1ZA 1HNZL 4RHSA 3PGZA 3LGJA 4N9PA 4GN3B 1SAPA 2OCEA 5J3BA 4JBKA 4I7AA 2KHSA 4DR1Q 4B9XA 2G9HD 2AWOA 2D62A 2B29A 1WCMB 3PQIA 1P16A 2Z8LA 1LTGD 3KLWA 5M5XB 3M7NA 1HR0Q 4BBSB 4IOCA 1ET9A 3MXNB 2F0OA 5BN3A 2NVTH 4E6IA 5HGQA 5IIFA 4JI0L 3DWPA 1EYAA 2IX0A 2JA7H 1N34L 2UUBL 1RD9D 4ODGA 3NTHA 3WOEA 5JPMC 4JBWA 1PH7A 1Q82C 1PTOF 2LXJA 3VYSA 1K8AC 5IP9H 2CWAA 3LNNA 2L55A 1OXVA 1GD7A 3KFUA 2ZM6L 4C3IG 1K0SA 1R9TB 2L0CA 4IFDJ 5AJ3L 5IGDA 4KY7A 5ELCA 1C7YA 3QJYA 1YJNA 1I4HA 4NMZA 3TP6A 4ULLA 4WJWA 5I9PA 2D0PA 2XNAC 1K8MA 4DR3Q 1NE3A 3AB9A 1MKHA 4ME5A 3H09A 5ELFA 3KF8B 4BY1H 2AKWB 1IXRA 1KTKA 3K81C 3IAYA 4JI4Q 2DNEA 1GVPA 1KRTA 1E3PA 1YI2A 4BWGB 1HRJA 2PQAA 1R4QB 2DY8A 4JI1L 5M3MG 4FF2A 4JVZA 4HIOA 3GTGB 2VL6A 5DLQE 4IUTA 3F2DA 4GLAC 4JI2L 3ULLA 5CGKA 1SNCA 2B8FA 2QF7A 1GUTA 3B6YA 2CWPA 2E74C 2NZ1D 3HOZH 4K5WA 4IFDG 1V1PB 1MIUA 2UXDQ 4XDXA 1BR9A 3EQLC 4N8X1 1S72A 2ZXOA 4DUZQ 2VXWA 4A3EH 3HOUG 4K8IA 4AYBB 2ZXPA 4LF8Q 1DM0B 3T1HL 3DM1A 2JEBI 2UU9Q 5CORA 3W1BA 3MVVA 4RGOS 4KHVA 3K80C 3E6ZX 4DV4Q 3TS0A 1WTHA 3Q22A 1HZCA 1UNSA 1L1OA 1SSOA 4B3TL 2RDGA 4FF3A 3TP5A 4WJ4A 1E24A 3KBGA 3MFYA 1BCPB 2Z6KC 3I72A 3OPOA 1C9OA 4DNIA 1VQHA 3QOJA 4S3SA 5JPNC 1E2VA 1K0RA 1JOQA 1WFQA 1N36Q 1TWCH 4ILWA 1TY2A 3DMUA 1QNKA 3IFDA 3D8GA 1TWGH 4H02A 1GUWA 3OTOQ 4NXMQ 1U4PA 1RDPD 4P74A 5GROA 4DGZA 1K9MC 1CSQA 1HZ9A 1ML0D 3ICEA 5E3FA 1WJJA 4BY1B 1JWMD 5M9OA 4RMFA 4YCWA 2K5QA 1TVXA 1MHWC 2E2HH 3QG1A 2NVXH 1SE4A 1N32Q 2K32A 4KY6A 4YY3L 2PYKA 1I50H 3FP9A 5GAEC 3U4ZA 3URYA 3G7LA 3K7UC 4C3IH 5BN4A 5IGEA 1L0YB 2VS1A 5KIXA 3BS1A 3F8TA 2EQSA 4Y52H 3RN2A 2VB3X 3GTQB 1FL0A 2B2UA 3IRBA 1OTCA 1XMQQ 4X65L 5ELBA 4X3TA 3M4YA 3G6EA 3HOZB 4YWMA 2TMPA 2K1BA 1F2MA 1A8VA 4QMGA 1TS2A 5EBCA 4IFDI 3R8BA 5CMDA 1VQBA 2YTVA 2OQ0A 3K5NA 4OIJA 2QGQA 2NZOA 4RH6A 3A7LA 4K0KL 4CDFC 4A3EB 4MTNA 4K6LA 1STYA 2F1MA 1EY9A 2GVAA 3UDGA 5IYBG 2WB1G 1JE5A 2HHHL 4EQ5A 1HHVA 2PNRC 3NBHB 5M3MH 1NR2A 3W2DA 1Y1WG 3CC4A 2HCCA 1B9MA 4DN4M 1PLFA 1SYFA 4NDXA 1O7ZA 4IUNA 1A3TA 3H94A 3HKSA 1VQFA 1B44D 4IFDH 1QILA 1PTOC 1TWCB 2M9VA 1SLJA 3I70A 1SJED 5JVH3 3S2HH 1RHPA 5CV7A 2EE1A 4DK0A 3HOUH 3MA2B 1B70B 4BBRG 3GTJH 3PIOA 3I4OA 5EKLA 3CXCA 4KD4A 3CC2A 1TS5A 3J7YW 1S5FD 1PH8A 2NVXB 3SR1A 4HSPA 3GD7A 5M5YB 3PIP3 4A3GG 3K5LA 4DV6L 1FD7D 1WTRA 3UE1A 3HP3A 1EU3A 1H9RA 4EQNA 1J6QA 2P5ZX 1DZ1A 2KBNA 4GNXB 4LUVA 3ONAB 1DOMA 1EEFD 5E4WC 5JOBA 4LF7Q 2I07B 3GTOB 1YHAA 1TIID 1STBA 1S40A 2N55A 4QUFA 1X3QA 1G6ZA 4B3SL 1RJTA 4DXFA 4KK7A 3HOVG 1YNNC 2J7ZA 4DV7L 3P1HA 2BH2A 4U673 3NELA 5JAVA 1LTID 2ZJQA 2BDOA 2SOBA 4CDCC 4DKAC 3VYRA 1O80A 2AUJD 2MUYA 4QCLA 4DR7L 3FEWX 2HIVA 3GV6A 4HJAA 3L0OA 1H9SB 1PH2A 2K28A 1C8CA 2IX3A 3S15H 1IBLL 3Q6SA 5IWAL 1SRUA 2EVBA 3I4NG 1LO5D 3KF6B 4R4IA 5LHY1 2FHTA 4LF5L 1NTGA 2ICEC 4HJ5A 3M9BA 5EKKA 2NVYB 3BYTB 5JJLA 3S2HB 1QWYA 1MGSA 1J9OA 4IPGA 3ERQA 1U4RA 5D3DA 3HOUB 2LS01 1A6XA 2M2LA 1MD2D 3GTJB 4DNRB 2AMCB 5IYBH 3I4LA 2I46A 2JJQA 1IL2A 3H6MA 4DUYL 4UP7A 4GS3A 1Z47A 1Y1WH 2V1CC 3BDLA 5KEEA 3HKZE 2B2YA 1T5XD 5BN5A 2K5NA 2RHSB 2UXBQ 2EYOA 3S1NB 3AFPA 1J5EQ 1HR0W 5FKAC 1EZ6A 1D1KA 5JEAJ 1PH4A 5IGFA 1EY4A 1SEBD 5KNDA 3IFTA 3H3VC 1KAAA 4KTAA 2CH4W 4IURA 1E2WA 3K5OA 2K5WA 2NB0A 3CCLA 1BUVT 5I6WA 5ELOA 2PNHA 3V2TA 2WAQB 1KNEA 4F88A 4BBRH 1HTLD 1PTOD 2N3SA 1H95A 4FF1A 1PMRA 4DR1L 4H0LC 3G48A 1SNQA 4R4CA 3RMHA 2A6HC 1PH3A 3S1MB 1CKNB 1D5XC 1L1OC 4RKBA 2OF1A 3D0FA 1ILQA 3G4SA 4C1NI 5DM73 5G3LF 1HR0L 1SNOA 3SEBA 3OIPA 2CQOA 1CHQD 4A3GH 1B3AA 1E7ZA 3I55A 1Q90A 3K5MA 3LX0A 1ENCA 3MTSA 4H13C 2F03A 4BS9A 2F0NA 4PG3A 1B9NA 1CTMA 3PO3G 3GV3A 4NW2A 3F2CA 2UUAQ 5IYDG 1B7YB 4DR4Q 1KDAA 3A8JE 4GOPB 3SE0A 1PYBA 3CD6A 1LABA 3A7AB 3M7GA 2EY2A 1ZXTA 3A5UA 4JBMA 1KD1C 3HOVH 4ZQ3A 3I73A 1BOSA 4O2DA 3KK7A 2F0MA 3TP7A 4DV3Q 1XNRQ 2Q2IA 2WB1B 1KHIA 1PYWD 1GJXA 1YNND 2OTLA 1JB3A 1HA5A 5J1ZA 1I6HB 1EWHA 5I2YA 1Q1EA 1PZKD 1Y1WB 2HT1A 2Z1CA 4RHRA 4JI4L 1PFMA 3TBIB 4TQUS 5BR8Q 3M4QA 2B2UC 4HR7B 1CKOA 1YVCA 4KHZA 2N49A 3I4NH 2EY1A 1F9SA 4PV1C 1S5ED 4OX9Q 2MHVA 2X6LA 4LF9L 1IKLA 4JV5Q 2CKZB 5JJKA 5NUCA 1K8OA 1KDBA 1V1PA 4BBRB 2Q8IB 4A3LG 4G7ZC 3RLOA 2UXDL 4AYBG 4OEMB 2KA7A 4RGMA 5CBEE 5IOCA 4DUZL 1NBWA 4I7ZC 5IY0A 2RSNA 1FJGQ 1TR5A 1Q8IA 4LF8L 4HCSA 1SNMA 2B2TA 1EQQA 3A0JA 3FRPB 3ITPA 1EQTA 2UU9L 1X6OA 4KLKA 1AEXA 3C46A 4IPCA 4J8QA 2Z4HA 1TXYA 2RQXA 4DV4L 4R4TA 5FLXL 1BDOA 2F0QA 4G57A 1PXUA 2Q2UA 3NUCA 2A6EC 2QKIC 3A5ZB 3DWQA 1ONLA 3HGBA 1Z7TA 4LWCA 1DXMA 1N36L 3V05A 1UE6A 2OQKA 1HTPA 3QR8A 3P20A 4QQBX 3HOVB 3PUWA 1KXLA 4QIWE 3DXJC 1C0AA 1JWSD 4LFAQ 4JI3Q 3OTOL 2DJFC 4EQPA 4NXML 4DA2A 4XQQA 2A6HD 5I4DA 2PI2A 3NWTA 1EOTA 2KECA 4R1JA 1L0XB 2PPBC 3QIAA 1N32L 1AE2A 2QA4A 3PO3H 1D1IA 1Q7YC 4KJNA 5IYDH 4LFCL 3MAQA 4ALPA 3S1RH 4RG1A 4X64Q 3UDXA 1YHBA 2Q2HA 4RAUC 2K05A 2MP1A 1HZBA 3GTMH 4HTHA 3HG9A 3K0YA 2A8VA 5D14A 1PRTF 1XMQL 3DM3A 1ENAA 4DUYQ 3E0EA 1GXDC 3MEFA 2EYHA 1EYCA 1B4OA 2NBFA 1RKNA 1FNWA 4LJZC 2LXKA 1TWHH 2JE6I 2XRQD 4M8AA 2B3GA 2J0TD 1Q86C 2F0IA 4MZ9A 4R8NA 4MNOA 3GTGH 1S3OA 1YNXA 2F0LA 4LK1C 4JI5Q 3TRZA 1IYVA 3AQQA 5H1SE 3FPUB 1KLGD 1AW7A 1G2SA 2G9DA 1HNXQ 2YTYA 1Y14B 4FVMA 1A0IA 3OW7A 5JJZA 2F4VQ 1A3VA 4FO2A 2BA1A 3HRZC 3RD4A 5A2QE 5IODA 2KVMA 4A3LH 2K52A 3RLFA 2Z9HA 1VQMA 1Q46A 2K7VA 3MHBA 5J22A 3U58A 3BVGA 3PIPA 3OWFA 2B2YC 1CHPD 5FLMG 4OL7A 1OXXK 2PMZE 1YNJC 1STAA 2F3WA 4CGYB 4QF4A 4LF4Q 1STHA 3TSSA 3VA7A 4K2LA 3PO3B 2ZTEA 1JT8A 5KNCA 2VNUD 4QJFA 4IZ8A 5C44B 2JYOA 1HUNA 3S1RB 1HZAA 1IBMQ 4F87A 1BNZA 4P73A 2A5HA 2K75A 4DXGA 3GTMB 2A6ED 1VQKA 2QW7A 5M5WH 1ZYRC 1ASZA 1WTOA 3D31A 2F0SA 4OXPA 4LF7L 4H7BA 2H4OA 4PMCA 2F0TA 1I4GA 1N33Q 2RCNA 4RCNA 3E5SA 5EQ0A 2WKCA 2Q8RE 1TWHB 1BQQT 1R4PB 3D6CA 4IPHA 4KKSA 5C0XJ 2E2JH 3H0GB 5ELNA 3HS0C 3D6WA 1S5BD 3GTPH 1UEBA 2KOLA 4LF9Q 3GTQH 5CV5A 1IBKQ 3K57A 2A68C 3S2DB 1V1OA 1Q12A 2ID0A 1CZGA 5CC4A 3CF5A 2Q2TA 4L6TB 1GUNA 1B53A 1N9WA 2VB2X 4HIKA 3R93A 5KYLA 4L8JA 3KYHC 4CJ2C 1STNA 4DV5Q 1VDZA 4JI6Q 3OHXC 1WD0A 3T4AC 1GUSA 3CQZH 4DV1Q 3ULPA 1EY6A 3PO2H 3JC66 3H15A 4A3JB 1I3QH 3I91A 1K73C 3BJUA 1EUJA 5C0XG 3HFZB 4L5TA 4BA2I 1LTRD 1AFPA 2JA6G 3DEOA 2UXBL 4O1NA 3STBD 1J5EL 4XXEA 5G3LD 4YHHQ 1ZEQX 3Q8DA 2N88A 5FOBB 1Y69U 2EJGC 3CC7A 3L3OC 2PZTA 2WP8J 2BDNA 2WAQG 1VQNA 4CBVA 1U5KA 1IW7D 5M5WB 1J8IA 2R3ZA 4B9WA 4DAYA 1EIGA 1UE1A 2B2TC 4KV6A 1RTOA 3K58A 5FLMH 1D2BA 2KHIA 2Q8TA 2X6GA 2K04A 1SJHD 2YU9H 2VZAA 2HIXA 3OMGA 4LUZA 4YCUA 4A3DB 2F0GA 1X3FA 4ZLTF 2NVQB 5C5MA 3J7AF 1PRTC 2ALYB 5M5YH 3U50C 3C2PA 4LF6Q 4LFCQ 4HMIA 1YNJD 2L9HA 3M3YB 3RUZA 2E2JB 1T9HA 4J6HA 3LWEA 2LY7A 4FP5D 1DGSA 4J15A 1BKBA 1KL9A 3GTKH 5JJIA 4QGUA 4RA8A 1BO0A 3GTPB 1A63A 4IQZA 1VQCA 1QUQB 1HJPA 2CW0C 4K5VA 3A8IE 3GTOH 1P8LA 5EPLA 2UUAL 4DR4L 4XTCS 1I94Q 1X65A 3EJIA 1EY5A 4FF4A 2CHBD 1EFWA 2ZTDA 4IUQA 3ERSX 1A62A 3KDFA 1ZYRD 1IYJB 1VQAA 1XTDA 3M4OB 2NN6G 1L2FA 2IY5B 3FKIB 3CCRA 4DV3L 3NQIA 1XNRL 3CQZB 3PO2B 1IZ6A 4CDDC 1PTOB 1GO3E 4BY7B 1I3QB 3H3VI 5HURA 1SYGA 1YJWA 5EKIA 1PFNA 2PW7A 5JVG3 5BR8L 5C0XI 1QOHA 1U0LA 1D5MC 4YCVA 2NVYH 2VQFQ 2MJ8A 4DAMA 2A68D 4L63B 1ESRA 2AQ1B 2EXDA 2IPKD 2L1BA 3ND9A 3CCEA 4OX9L 2RKSA 2ATWA 1F77A 2KHJA 2J4XA 5EPJA 4JV5L 3CCUA 1DYQA 4ME3A 3RNUA 3BYYB 1NJIC 4H44C 1GOZA 2YU9B 1K28A 1TS4A 5FK9C 2K4KA 1A3UA 3H3VH 4GN5A 3R3OA 1TT2A 1W2BA 1FJGL 3S1NH 4DR5Q 1X32A 4Y7NH 5C0XH 2FFKB 1SE8A 2I5LX 4Z9CB 4HJ9A 3Q23A 2IX1A 2PQEA 2JA6H 2WV6D 3A74A 3GTKB 2PZUA 1ET6A 2K33A 4G7OC 1RF2D 2BA0A 2WFWA 1ESFA 2WINB 1A15A 4RCOA 1CQFA 2IT1A 2CVRA 2HDMA 2KENA 4IN3A 1VF5C 2FINB 2OTJA 4A76A 3ZYYX 1TWFB 3NE5B 2MO0A 3BZDB 3J81L 4B3RQ 4POFA 5FLXc 1B2TA 4DFAA 2RDHA 3S1MH 2B8GA 2MFIA 1EQRA 2HQLA 2EYMA 3OW2A 1OXUA 2NN6I 4LFAL 4JI3L 2EY5A 4OELB 4XIGS 4A3FB 3MEHA 3RN5A 2L5TA 2CH4A 2X69A 1PRTD 3VYTA 1PH1A 4KI0A 1F9PA 1SROA 4ZYSA 2DY7A 4WJ3M 1RL2A 2YV5A 2JK8A 4OGQC 3DWAA 2PQAB 4NP5A 1O7IA 4JI7Q 4FDBA 1EYDA 2KQ3A 1NMGA 4X64L 2CW0D 3I7FA 5GAHC 5LMUQ 2JP1A 1B8AA 4CJ0B 2VW9A 1UE7A 4P71A 1PH5A 2NN6H 1CT1D 1G291 4ZUIA 4X3KA 1I6HH 2C5CA 1Q1BA 2KJXA 3GQBA 3D4WA 1SMYC 4IOAA 2SEBD 5GQOA 1W6KA 2Y0SE 3BU2A 4AQYQ 3NBIA 3E9IA 1QNUA 1LTBD 5C3WA 3PSIA 4JBJA 2XWJB 4Y7NB 3UE0A 1F9QA 1OO9B 2YTXA 2AWNA 1WTVA 2JA6B 2F4IA 5CV4A 1EEID 1LLRD 3R2TA 4XYQA 1L1OB 4JI5L 4DV2Q 2NTSA 2XGTA 1XTCD 1HNXL 2EYJA 2QEXA 1MJCA 1VQLA 1UEAB 1Q81C 3CMEA 3TEHB 2F4VL 3N6RA 4RGNA 2I5MX 2LMCB 2SNMA 1IKMA 3PF4A 3CCQA 1GUGA 1YEZA 2C35B 2K5DA 4QY7A 3EVQA 3CRLC 4AYBE 4A3CG 3MXNA 4WFN3 1VQ5A 1AE3A 1T5EA 1X3PA 2TSSA 1KAWA 2R7ZG 2O2LD 4QUCA 1TY0A 2IJ0A 1XYIA 3F2UA 4PMBA 3QOLA 1G6PA 1I4XA 1E22A 1EY7A 4GLXA 4A3KB 3WOFA 3OMCA 4C2MH 2C9OA 1M4VA 1VQDA 4KJOA 4LF4L 1VQ6A 1FGUA 1VMCA 1ASYA 1XMOQ 5IGBA 5C44G 1AZPA 1I5FA 1AZQA 3I4MG 3HOWB 1LYLA 1PH9A 3CPFA 1IBML 1PZID 2L4NA 4ZCKA 2WIIB 1S5CD 3BDOA 3EFXD 3MWYW 3KF8A 2ZTCA 3M4PA 4DR6L 1TWAH 2PI2E 2SNSA 4HCEA 1H9MA 1ICWA 5C4JH 4FNFA 1SYEA 4UP9A 1K8GA 2QCPX 3FVQA 3VYUA 5KRUA 1N33L 3H0GG 1YJ9A 3TS2A 3K7AH 5K5PA 5ELDA 3SGIA 1EL0A 4FXKC 2F0VA 2OWOA 1BVSA 2BOSA 4K2KA 1O7LA 4O0AA 5LL6S 3T16A 4DR2Q 5EPKA 4IUPA 1Y8PB 1CFMA 2O5IC 3J80L 5M3FG 1IBKL 1XPUA 4J1MA 2R61A 4GKJQ 2A1AA 2F0KA 3ULJA 2OEOA 5FO8B 5COYA 4KHPQ 4EGVA 1HFGA 2QDBA 1XXGA 1CA5A 5HGTA 1E0BA 2EXZA 4ZK9B 3X3NA 3SDZA 3CHBD 2HD3A 4DV5L 4TVAB 4JI6L 1QG7A 4JG2A 4A3JG 2HCIA 4YWLA 1DD2A 1L0WA 4DV1L 1II3A 1PZJD 1MSHA 1SMYD 3DHQA 4C2MB 4V0BA 4MHEA 5CR3A 3Q0AA 3S16B 3MC0B 5T1GA 5FO7B 3I3CA 1LT4D 4JC0A 4XYOA 4CHTB 2EJMA 2RBMA 3EROA 1KABA 1BBWA 1LT6D 5C4XB 1D8LA 1CA6A 2RSOA 3EBEA 3QB3A 4YHHL 2A73B 4ZRZA 3FDTA 4GKKL 5ISRA 2R93G 3BG3A 3LWUA 4A3CH 1W3SA 1LTSD 1RCVD 4M1UB 2R7ZH 2PZWA 1EQVA 1JCKB 1PFSA 2ICIA 4HAEA 3T53B 2HQEA 3NHHA 4A3DG 5EGTA 1TWAB 1CQVA 5I6YA 1TQOA 2NYZD 3S1QB 4ABNA 5C4JB 1G51A 2DNCA 5ELEA 2LSSA 1PFBA 2JA5B 1EFID 4HIDA 4P75A 4KMUC 2KUMA 2RF4A 3K7AB 2FJ2A 1E2ZA 2UUCQ 4LF6L 3A54A 3HOXB 5C44H 1LTAD 4PZ7A 2K03A 3VR5A 2N8NA 2CQAA 4GN4B 3I4MH 3UDIA 2Z4IA 1JB7A 1X56A 3SK4A 3CRKC 2XWBB 3QWNA 2F3VA 1Y1VB 1QUQA 1VQ8A 2E2IB 1HFNA 4Q5VA 4K5XA 2CCZA 2PW5A 3GTLB 2IW3A 1BCPF 3G71A 1C4QA 1CKMA 4B3MQ 1I94L 1NSNS 3HEJA 1O78A 2WKDA 5AFWA 2EOTA 3E9HA 1YHQA 1GHKA 3FKIG 3KLSA 4PZ8A 3PO2G 2JSOA 3H0GH 4UDUC 5FJ8G 4DK6C 1S4ZA 3NBHA 1QVGA 4BY7G 1WYDA 2F0WA 3STBC 1K3BC 4ZKCB 3J81i 4A93B 3S2DH 1HH2P 1VQJA 1STGA 4DAVA 4F8MA 4G7HC 1ILPA 1IW7C 2KEEA 5M3FH 1LUZA 3NP8A 1TKWB 1M90C 4AIMA 4IALA 4IUUA 3S17H 2B63B 1EY0A 1HA6A 2VQFL 2EPBA 4A3IB 3AFQA 2JQOA 4C3JG 5I2XA 1MSGA 1VQGA 3SK6A 1LT3D 4HSVA 2AQ3B 2B2WA 2R7ZB 4PQXA 4WORA 4A3JH 1SE2A 4HEDA 1CM9A 1NAPA 1VQOA 3I8ZA 1YITA 3CAMA 1SNPA 1JJ2A 1SNDA 1V43A 1JC7A 3A8KE 3T51B 1LTLA 2F0DA 2QILA 3K6OA 1DCZA 2DUDA 2XN9C 1HNWQ 2XSCA 4PNYA 4DR5L 1SDFA 3HZXA 5CYUA 3I4MB 1I4QA 3CW2C 4GNXA 3CCJA 1CUKA 2FMCA 1PVOA 1KDCA 3CKIB 3OSOA 3UI2A 4X6AH 3OYYA 2WAQE 2R93H 1K83H 4AH6A 3CPWA 2BE5D 4NXNQ 2R92G 4DR6Q 3VR2A 1X3GA 3E0JA 1FYCA 3PF5A 4B3RL 4A3DH 2O5JC 2NVQH 5E4XA 2A69C 1JOOA 3DEPA 4HMJA 4N9TA 4QB4A 2JXMB 3L2PA 3M3YH 5IT9L 4A3FG 3J81c 4K14A 1YBYA 1B1ZA 4JOIA 5I9OA 3TN2A 2O4XA 2EYFA 3IL8A 3NWSA 3O13A 4CKBA 2HUGA 2N78A 2UXCQ 3J7ZC 1H9SA 3RLNA 4CKCA 3PUYA 2VQEQ 1FR3A 3HKZB 3KF6A 2Y0SB 5M3FB 4L5SA 4WRDA 4LAAA 5C3EB 2FMMA 4JYAQ 3P75A 1JWUD 1XNQQ 3SXHA 1FVIA 2K01A 3S17B 4JI7L 3CU7A 1FGBD 3J81E 3BZCA 4PZ6A 3S9WA 1Y8NB 3RZOH 4XT1B 2KCTA 5LMUL 3M4OH 4HJ7A 3TZDA 2OXPA 3WWVA 4GZYC 3FKIH 3GP7A 1KLUD 2WB1E 3FHWA 1DJRD 3NPPA 2D0OA 5FJ8H 1PTOH 1WVLA 2QEJC 1K3RA 4BY7H 2M00A 1XJVA 1UAPA 3H91A 4C56C 4FXDA 5IP7G 5LMNQ 3T13A 4UP8A 1JMCA 1PA6A 1KIXA 4L5RC 1QVFA 1JR0D 2ENBA 1EYGA 2CFMA 4AQYL 2IL8A 1M1KC 2NVTB 1RTNA 2F0EA 5DEHA 4KD3A 2KCCA 1JJGA 2G5DA 2JA7B 4GKKQ 2Z0SA 2LKVA 1PRTB 2YYZA 3T1YQ 3R2IA 4C3JH 4DV2L 1W6JA 2QDLA 2R93B 1K83B 5DM63 1X54A 1QE6A 2E5LQ 3SVMA 3C1FA 4JI8Q 1CKNA 1NCVA 3D4RA 1SMXA 1HQRD 1KRSA 1SXTA 4IJHA 1VQEA 3W5OA 3JAML 2VUMG 5IGGA 1BCPC 3L7ZC 3TREA 3ZJYC 5KYIA 4UY8C 1B50A 4A3KG 5IYCG 3NXWA 3J80i 4XQNA 2RA4A 1RODA 1WTPA 3KJOA 2R7FA 1JORA 2ZJPA 3TMEA 3IKJA 5L37A 2F3IA 4KKTA 1I4PA 1XMOL 3HOWG 4OO1G 3NK9A 1TWFH 1SE3A 3NTKA 3KUPA 4NPSA 2D5DA 4DV0Q 1LTTD 4GOPA 2R92H 3BVMA 5GADC 3AU7A 1XPOA 1JJCB 1IHZA 3VR4A 4X66Q 2K5HA 3RZOB 1S5DD 4X62Q 4IPDA 3KOJA 1MBYA 2IWHA 1H9KA 2BCOA 3CCMA 1Z6HA 5C6AA 1XX8A 4CJ1B 3K8AA 4A3FH 1G2TA 5A2QL 3OIQA 2L12A 4IO9A 2JN4A 4L5QA 2JEAI 1C48A 3J7A5 2A69D 1GM5A 4JCVE 4A3BG 4LFBQ 2AQ2B 4LUOA 3MXPA 4A3MG 1LM0A 2I5HA 3Q24A 4C3HG 1DOKA 3CCSA 3C1EA 4UAIA 1NY4A 2E8GA 1H9JA 1A2UA 4IJLA 4DR2L 1HNZQ 4U68A 2E76C 5K36G 4C3JB 3D4DA 2DJGC 3GDEA 4YIJA 4OHJA 4GKJL 1SYCA 3AMUA
chains in the Genus database with same CATH topology
1JQYD 2XRSD 1EZ8A 5FO9B 1F9RA 2NUCA 3OOCA 3PV0A 4QIWB 4X3UA 1TWGB 1VCIA 1DOLA 4DK1A 2F0UA 3DUZA 1MI2A 1F2YA 4FYDA 2EY6A 3MXGA 4HN7A 3C3LA 1A2TA 4EVOA 5KNBA 4G4KA 4ZUJA 5D65A 3TP8A 2E2HB 3J80E 2KCNA 1I50B 4OO1I 2B2WC 5CV6A 2D9UA 2R92B 4RKLA 4C3IB 2B2VA 4O42A 1OXSC 5A35A 4XQJA 5CV8A 4KN7C 2PCFB 4V190 1EWCA 1SBBB 1CZWA 2V4DA 1SYDA 2GA4B 3G6JB 3VR6A 1BCPD 5FLXE 2F0PA 2RVLA 3FPPA 2KEDA 2F0HA 4OO1H 2RDFA 2PO4A 5EJWA 2MPMA 5M3MB 1SYBA 5F2DA 3A55A 2K6AA 3D3RA 3PMFA 3M85A 3U9OA 1UUPA 4BA1I 5TSSA 4XT3B 4DNTB 3WDNA 2E2DC 4F7XA 5EBDA 1QB5D 1XWEA 1WD1A 3NSWA 4KY5A 1EIHA 1ZKOA 3PUVA 2EJFC 4KKUA 1GHJA 2PMZB 4K8JA 2ZXRA 3PUZA 1GUOA 1IYUA 5C4ZA 1SFOB 1Y8OB 1WTWA 1JICA 1I4RA 5K36H 4RGTA 4ZAIA 4IUVA 1LT5D 1O7YA 1HPCA 1QJOA 4TSSA 1G91A 2VUMB 4MIUA 3RZDB 3W3AA 4B08A 1HCZA 4RWSC 2HDLA 1LV9A 5DAUA 4DF7A 4EQOA 4MN3A 1IL8A 2R6GA 3V96A 1NUCA 5E1FA 3VR3A 1PDQA 5D3IB 1JE4A 2NWGA 2MGSA 5DNFA 3S15B 4R9WA 1KNAA 4X3SA 4TKOB 3OWEB 1CI3M 4NKLA 5JEAG 4PMWA 3TDQA 1BF4A 4P2CB 2WACA 2OT2A 3MXUA 3MFGA 4A3BB 1U4LA 5KGUA 4A3MB 4C3HB 4K6DA 5IGCA 1WTQA 4FXGC 4DU9A 1TU2B 1AP0A 2SDFA 1FNVA 2F0FA 4ZKBB 5C4HA 2ZT9C 3FMCA 2EZVA 1VF7A 3ND8A 1D5ZC 2E75C 5CV9A 3X3MA 5IT9E 1QCBD 5C5LA 5CBAE 2B39A 2LFNA 1F2ZA 1U4MA 4LMQD 2DN8A 2D2CC 1DONA 1HQMC 3T56B 4CKEA 1FNUA 2EYLA 3BVZA 1D6EC 3PIO3 2BE5C 1JOKA 5LL6X 3NTIA 4DAPA 4A3GB 2EYPA 3GO5A 3TZUA 1AN8A 3S14B 3MZ5A 3U9SA 3NQTA 1NR4A 3KLSX 3SK8A 5J39A 3J7AV 5T1IA 2AUKA 1EY8A 3KLRA 1G8ZD 4TRDA 1F2LA 1EU4A 3BDCA 1CK1A 2NTTA 1ENFA 1TS3A 2B2VC 1OXTA 4C1NK 1VMPA 2H1EA 1I6VC 3EA6A 1M8AA 3I4NB 2XIWA 1HUMA 5JEAH 3K59A 3HOYB 3KBXA 1V8QA 1Q3LA 3JAME 4ID6A 3QO2A 4JK1C 2F0JA 2A74C 3L9AX 3PUXA 4R8IA 3A56A 1BXTA 1U9RA 2L11A 5C3XA 3P7JA 1LACA 2JA8B 2EDGA 1BBXC 4RFBA 4KN4C 3SHLA 3VA5A 1WTXA 4Q0FA 3I90A 3SK5A 1HXYD 1STEA 3N52A 4I65A 2XVSA 4OIKA 4RHSA 4N9PA 1SAPA 2KHSA 4B9XA 2G9HD 2AWOA 2D62A 1WCMB 2Z8LA 1LTGD 5M5XB 3M7NA 4BBSB 1ET9A 2F0OA 5BN3A 4E6IA 5IIFA 3DWPA 1EYAA 2IX0A 1RD9D 4ODGA 3NTHA 3WOEA 5JPMC 4JBWA 1PTOF 3VYSA 3LNNA 2L55A 1OXVA 4C3IG 1R9TB 2L0CA 4IFDJ 5IGDA 4KY7A 5ELCA 3QJYA 1I4HA 4NMZA 3TP6A 4ULLA 4WJWA 5I9PA 2XNAC 1K8MA 3AB9A 4ME5A 3H09A 5ELFA 1KTKA 3IAYA 2DNEA 4BWGB 1HRJA 1R4QB 2DY8A 4FF2A 3GTGB 4IUTA 5CGKA 1SNCA 2B8FA 2QF7A 1GUTA 2E74C 2NZ1D 4K5WA 4IFDG 1V1PB 4XDXA 1BR9A 3EQLC 2ZXOA 2VXWA 4K8IA 4AYBB 2ZXPA 1DM0B 3DM1A 2JEBI 5CORA 3MVVA 4RGOS 4KHVA 3E6ZX 3Q22A 1UNSA 1SSOA 2RDGA 4FF3A 3TP5A 3KBGA 3MFYA 1BCPB 3OPOA 3I72A 3QOJA 4S3SA 5JPNC 1E2VA 1JOQA 4ILWA 1TY2A 3DMUA 1QNKA 3IFDA 3D8GA 1GUWA 1U4PA 1RDPD 4DGZA 1ML0D 5E3FA 4BY1B 1JWMD 5M9OA 2K5QA 1TVXA 3QG1A 1SE4A 2K32A 4KY6A 2PYKA 3URYA 3G7LA 5BN4A 5IGEA 1L0YB 5KIXA 3BS1A 2VB3X 3GTQB 2B2UA 5ELBA 4X3TA 3M4YA 3HOZB 2TMPA 2K1BA 1F2MA 4QMGA 1TS2A 5EBCA 4IFDI 3R8BA 5CMDA 3K5NA 4OIJA 4RH6A 3A7LA 4A3EB 4K6LA 1STYA 2F1MA 1EY9A 1HHVA 2PNRC 1NR2A 3W2DA 2HCCA 1B9MA 4DN4M 1PLFA 1SYFA 4NDXA 1O7ZA 4IUNA 1A3TA 3H94A 1B44D 4IFDH 1QILA 1PTOC 1TWCB 2M9VA 3I70A 1SJED 5JVH3 1RHPA 5CV7A 2EE1A 4DK0A 3MA2B 5EKLA 4KD4A 1TS5A 3J7YW 1S5FD 2NVXB 3SR1A 4HSPA 3GD7A 5M5YB 3PIP3 3K5LA 1FD7D 1WTRA 3HP3A 1EU3A 1H9RA 4EQNA 1DZ1A 3ONAB 1DOMA 1EEFD 5E4WC 5JOBA 2I07B 3GTOB 1TIID 1STBA 2N55A 4QUFA 1X3QA 1G6ZA 1RJTA 4DXFA 4KK7A 1YNNC 2J7ZA 3P1HA 4U673 5JAVA 1LTID 2BDOA 2SOBA 3VYRA 1O80A 2AUJD 2MUYA 4QCLA 3FEWX 3GV6A 1H9SB 2K28A 1C8CA 2IX3A 3Q6SA 2EVBA 1LO5D 5LHY1 2FHTA 2ICEC 5EKKA 2NVYB 3BYTB 3S2HB 1QWYA 1MGSA 1J9OA 3ERQA 1U4RA 5D3DA 3HOUB 2LS01 1A6XA 2M2LA 1MD2D 3GTJB 4DNRB 3I4LA 2I46A 3H6MA 1Z47A 3BDLA 5KEEA 2B2YA 1T5XD 5BN5A 2EYOA 3S1NB 5FKAC 1EZ6A 1D1KA 5JEAJ 5IGFA 1EY4A 1SEBD 5KNDA 3IFTA 3H3VC 1KAAA 4KTAA 4IURA 1E2WA 3K5OA 2K5WA 2NB0A 1BUVT 5I6WA 3V2TA 2WAQB 1KNEA 4F88A 1HTLD 1PTOD 4FF1A 1PMRA 4H0LC 3RMHA 1SNQA 2A6HC 3S1MB 1D5XC 4RKBA 2OF1A 1ILQA 4C1NI 5DM73 5G3LF 1SNOA 3SEBA 3OIPA 1CHQD 1B3AA 1Q90A 3K5MA 3LX0A 1ENCA 3MTSA 4H13C 2F03A 4BS9A 2F0NA 1B9NA 1CTMA 3GV3A 4NW2A 1KDAA 3A8JE 3SE0A 1LABA 3A7AB 3M7GA 2EY2A 1ZXTA 4ZQ3A 3I73A 1BOSA 3KK7A 2F0MA 3TP7A 2WB1B 1PYWD 1GJXA 1YNND 1JB3A 1HA5A 5J1ZA 1I6HB 1EWHA 5I2YA 1Q1EA 1PZKD 1Y1WB 2Z1CA 4RHRA 1PFMA 3TBIB 4TQUS 2B2UC 4HR7B 4KHZA 2EY1A 1F9SA 4PV1C 1S5ED 2MHVA 2X6LA 1IKLA 5NUCA 1K8OA 1KDBA 1V1PA 4BBRB 2Q8IB 4G7ZC 2KA7A 4RGMA 5CBEE 5IOCA 4I7ZC 2RSNA 1TR5A 1Q8IA 4HCSA 1SNMA 2B2TA 3FRPB 3ITPA 1EQTA 1AEXA 3C46A 4J8QA 2Z4HA 2RQXA 5FLXL 1BDOA 2F0QA 4G57A 1PXUA 3NUCA 2A6EC 2QKIC 3DWQA 1ONLA 3HGBA 1Z7TA 1DXMA 3V05A 1HTPA 3P20A 3HOVB 3PUWA 3DXJC 1JWSD 4EQPA 4DA2A 4XQQA 2A6HD 5I4DA 3NWTA 1EOTA 2KECA 1L0XB 2PPBC 3QIAA 1D1IA 4KJNA 3MAQA 4RAUC 2K05A 2MP1A 4HTHA 3HG9A 3K0YA 5D14A 1PRTF 1ENAA 1GXDC 2EYHA 1EYCA 1B4OA 2NBFA 1RKNA 1FNWA 4LJZC 2JE6I 2XRQD 4M8AA 2J0TD 2F0IA 4R8NA 2F0LA 4LK1C 1IYVA 3FPUB 1KLGD 1AW7A 1G2SA 2G9DA 4FVMA 3OW7A 5JJZA 1A3VA 4FO2A 2BA1A 3HRZC 3RD4A 5A2QE 5IODA 2KVMA 3RLFA 2K7VA 3MHBA 5J22A 3BVGA 3OWFA 2B2YC 1CHPD 4OL7A 1OXXK 1YNJC 1STAA 2F3WA 4CGYB 4QF4A 1STHA 3TSSA 3VA7A 4K2LA 3PO3B 5KNCA 2VNUD 4IZ8A 5C44B 2JYOA 1HUNA 3S1RB 4F87A 1BNZA 2A5HA 4DXGA 3GTMB 2A6ED 1ZYRC 1WTOA 3D31A 2F0SA 4H7BA 2H4OA 4PMCA 2F0TA 1I4GA 4RCNA 3E5SA 5EQ0A 2WKCA 2Q8RE 1TWHB 1BQQT 1R4PB 3D6CA 5C0XJ 4KKSA 3H0GB 3HS0C 3D6WA 1S5BD 2KOLA 5CV5A 3K57A 2A68C 3S2DB 1V1OA 1Q12A 2ID0A 1CZGA 5CC4A 4L6TB 1GUNA 1B53A 2VB2X 3R93A 5KYLA 4L8JA 4CJ2C 1STNA 1VDZA 3OHXC 1WD0A 3T4AC 1GUSA 1EY6A 4A3JB 3I91A 5C0XG 4BA2I 1LTRD 1AFPA 3DEOA 4O1NA 4XXEA 5G3LD 1ZEQX 5FOBB 2N88A 1Y69U 2EJGC 3L3OC 2PZTA 2WP8J 2BDNA 4CBVA 1IW7D 5M5WB 1J8IA 2R3ZA 4B9WA 4DAYA 1EIGA 2B2TC 4KV6A 1RTOA 3K58A 1D2BA 2Q8TA 2X6GA 2K04A 1SJHD 3OMGA 4A3DB 2F0GA 4ZLTF 2NVQB 5C5MA 3J7AF 1PRTC 3C2PA 4HMIA 1YNJD 2L9HA 3M3YB 3RUZA 2E2JB 4J6HA 3LWEA 2LY7A 4FP5D 4RA8A 1BO0A 3GTPB 4IQZA 2CW0C 4K5VA 3A8IE 5EPLA 4XTCS 3EJIA 1EY5A 4FF4A 2CHBD 4IUQA 1ZYRD 3M4OB 2NN6G 3FKIB 3NQIA 3CQZB 3PO2B 1PTOB 4BY7B 1I3QB 5HURA 1SYGA 5EKIA 1PFNA 2PW7A 5JVG3 5C0XI 1QOHA 1D5MC 2MJ8A 2A68D 4L63B 1ESRA 2AQ1B 2IPKD 2L1BA 3ND9A 2RKSA 1F77A 2J4XA 5EPJA 1DYQA 3BYYB 4H44C 1GOZA 2YU9B 1TS4A 5FK9C 1A3UA 3R3OA 1TT2A 1X32A 5C0XH 2FFKB 4Z9CB 3Q23A 2IX1A 2PQEA 2WV6D 3GTKB 2PZUA 1ET6A 2K33A 4G7OC 1RF2D 2BA0A 1ESFA 2WINB 1A15A 4RCOA 1CQFA 2IT1A 2CVRA 2HDMA 4IN3A 1VF5C 2FINB 3ZYYX 1TWFB 3NE5B 3BZDB 3J81L 1B2TA 4DFAA 2RDHA 2B8GA 2EYMA 1OXUA 2NN6I 2EY5A 4XIGS 4A3FB 3MEHA 2L5TA 2X69A 1PRTD 3VYTA 4KI0A 1F9PA 4ZYSA 2DY7A 4OGQC 3DWAA 4NP5A 1EYDA 2KQ3A 2CW0D 2JP1A 4CJ0B 2NN6H 1CT1D 1G291 4ZUIA 4X3KA 2C5CA 1Q1BA 2KJXA 3GQBA 3D4WA 1SMYC 2SEBD 1W6KA 3NBIA 1QNUA 1LTBD 5C3WA 2XWJB 4Y7NB 1F9QA 1OO9B 2AWNA 1WTVA 2JA6B 2F4IA 5CV4A 1EEID 1LLRD 3R2TA 4XYQA 2NTSA 1XTCD 2EYJA 1UEAB 3N6RA 4RGNA 2LMCB 2SNMA 1IKMA 1GUGA 2K5DA 3EVQA 3CRLC 3MXNA 4WFN3 1T5EA 2TSSA 1X3PA 2O2LD 4QUCA 1TY0A 2IJ0A 1XYIA 3F2UA 4PMBA 3QOLA 1I4XA 1EY7A 4A3KB 3WOFA 3OMCA 2C9OA 1M4VA 4KJOA 1VMCA 5IGBA 1AZPA 1AZQA 3HOWB 1PZID 2L4NA 2WIIB 1S5CD 3BDOA 3EFXD 3MWYW 3KF8A 2SNSA 4HCEA 1H9MA 1ICWA 4FNFA 1SYEA 2QCPX 3FVQA 3VYUA 5KRUA 5K5PA 5ELDA 1EL0A 4FXKC 2F0VA 2BOSA 4K2KA 1O7LA 5LL6S 3T16A 5EPKA 4IUPA 1Y8PB 1CFMA 2O5IC 3J80L 4J1MA 2R61A 2F0KA 2OEOA 5FO8B 5COYA 4EGVA 1HFGA 2QDBA 1XXGA 1CA5A 5HGTA 1E0BA 2EXZA 4ZK9B 3X3NA 3SDZA 3CHBD 1QG7A 2HCIA 1DD2A 1II3A 1PZJD 1MSHA 1SMYD 3DHQA 4C2MB 4V0BA 4MHEA 5CR3A 3Q0AA 3S16B 3MC0B 5T1GA 5FO7B 3I3CA 1LT4D 4XYOA 4CHTB 2EJMA 2RBMA 3EROA 1KABA 1LT6D 5C4XB 1CA6A 2RSOA 3QB3A 2A73B 4ZRZA 3FDTA 5ISRA 3BG3A 3LWUA 1LTSD 1RCVD 4M1UB 2PZWA 1EQVA 1JCKB 2ICIA 4HAEA 3T53B 2HQEA 3NHHA 5EGTA 1TWAB 1CQVA 5I6YA 1TQOA 2NYZD 3S1QB 4ABNA 5C4JB 2DNCA 5ELEA 1PFBA 2JA5B 1EFID 4KMUC 2KUMA 3K7AB 2FJ2A 1E2ZA 3A54A 3HOXB 1LTAD 2K03A 3VR5A 2CQAA 2Z4IA 3SK4A 3CRKC 2XWBB 3QWNA 2F3VA 1Y1VB 2E2IB 1HFNA 4Q5VA 4K5XA 2PW5A 3GTLB 2IW3A 1BCPF 1C4QA 1NSNS 3HEJA 1O78A 2WKDA 5AFWA 2EOTA 1GHKA 3KLSA 2JSOA 4UDUC 1S4ZA 3NBHA 2F0WA 4ZKCB 4A93B 1STGA 4DAVA 4F8MA 4G7HC 1ILPA 1IW7C 2KEEA 3NP8A 1TKWB 4IALA 4IUUA 2B63B 1EY0A 1HA6A 2EPBA 4A3IB 4C3JG 5I2XA 1MSGA 3SK6A 1LT3D 4HSVA 2AQ3B 2B2WA 2R7ZB 4PQXA 4WORA 1SE2A 4HEDA 1CM9A 1NAPA 3I8ZA 1SNPA 1SNDA 1V43A 1JC7A 3A8KE 3T51B 2F0DA 2QILA 3K6OA 1DCZA 2XN9C 2XSCA 4PNYA 1SDFA 3HZXA 5CYUA 3I4MB 1I4QA 2FMCA 1KDCA 3CKIB 3OSOA 3UI2A 2BE5D 3VR2A 3E0JA 1FYCA 2O5JC 5E4XA 2A69C 1JOOA 3DEPA 4HMJA 4N9TA 4QB4A 2JXMB 5IT9L 4K14A 1B1ZA 5I9OA 3TN2A 2O4XA 2EYFA 3IL8A 3NWSA 3O13A 4CKBA 2HUGA 1H9SA 4CKCA 3PUYA 1FR3A 3HKZB 2Y0SB 5M3FB 4WRDA 4LAAA 5C3EB 2FMMA 3P75A 1JWUD 3SXHA 2K01A 3S17B 3CU7A 1FGBD 3J81E 3S9WA 1Y8NB 4XT1B 3TZDA 2OXPA 4GZYC 3GP7A 1KLUD 1DJRD 3NPPA 1PTOH 1WVLA 2QEJC 2M00A 4FXDA 1UAPA 3H91A 4C56C 3T13A 1JR0D 2ENBA 2IL8A 2NVTB 1RTNA 2F0EA 5DEHA 4KD3A 2KCCA 2JA7B 2LKVA 1PRTB 2YYZA 3R2IA 1W6JA 2R93B 1K83B 5DM63 1QE6A 3SVMA 3C1FA 1NCVA 3D4RA 1HQRD 1SXTA 3JAML 5IGGA 1BCPC 3L7ZC 5KYIA 1B50A 3NXWA 4XQNA 2RA4A 1RODA 1WTPA 1JORA 3TMEA 3IKJA 4KKTA 1I4PA 4OO1G 3NK9A 1SE3A 3NTKA 3KUPA 2D5DA 1LTTD 3BVMA 3AU7A 1IHZA 3VR4A 3RZOB 1S5DD 1MBYA 2IWHA 1H9KA 2BCOA 1Z6HA 5C6AA 1XX8A 4CJ1B 1G2TA 5A2QL 3OIQA 2L12A 2JEAI 1C48A 2A69D 2AQ2B 3MXPA 3Q24A 4C3HG 1DOKA 3C1EA 4UAIA 1H9JA 1A2UA 4U68A 2E76C 5K36G 4C3JB 3D4DA 4YIJA 4OHJA 1SYCA 3AMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2W A;  3GV6 A;  4QUC A;  4R8I A;  2CVR A;  2HDM A;  4IUT A;  1XYI A;  3F2U A;  2K28 A;  1C8C A;  1RTN A;  1WTO A;  2FIN B;  2L11 A;  3Q6S A;  2L9H A;  1CA6 A;  2RSO A;  1F9R A;  3P7J A;  1CM9 A;  1NAP A;  4HED A;  3LWE A;  4DN4 M;  3I8Z A;  4OIJ A;  1WTW A;  2NZ1 D;  1BBX C;  1B2T A;  3FDT A;  2FHT A;  4RA8 A;  4X3U A;  1BO0 A;  1HHV A;  1JIC A;  1VMC A;  1DOL A;  1WTX A;  3I90 A;  4RAU C;  2K05 A;  2MP1 A;  4XDX A;  1NR2 A;  5CBA E;  2HCC A;  1MI2 A;  1QE6 A;  5EQ0 A;  4ZAI A;  2Q8R E;  3N52 A;  1MGS A;  1J9O A;  1O7Y A;  2VXW A;  4HAE A;  1PFM A;  1SDF A;  1U4M A;  5EPL A;  1PLF A;  4LMQ D;  3SVM A;  1U4R A;  4OIK A;  5D14 A;  2M2L A;  2B2U C;  1O7Z A;  1NCV A;  1DON A;  3DM1 A;  2NYZ D;  5D65 A;  2X69 A;  2L4N A;  3D6W A;  3UI2 A;  1SAP A;  1G91 A;  4IUQ A;  1F9S A;  5COR A;  1PFB A;  1B50 A;  1F9P A;  2KOL A;  1B4O A;  2B2W C;  2KUM A;  2DY7 A;  2FJ2 A;  2D9U A;  1SSO A;  2RA4 A;  3MWY W;  1AZP A;  2X6L A;  2K03 A;  1RHP A;  1ROD A;  1WTP A;  1IKL A;  2EE1 A;  1AZQ A;  4RWS C;  2B2V A;  2B2Y A;  2HDL A;  4O42 A;  1LV9 A;  5E4X A;  1NR4 A;  1ICW A;  1B53 A;  3DEP A;  1HFN A;  3R93 A;  2JP1 A;  4MN3 A;  3FPU B;  1IL8 A;  4CJ2 C;  3KUP A;  1G2S A;  5EKI A;  5CBE E;  1EL0 A;  1PFN A;  1QNK A;  3TN2 A;  4CJ0 B;  4IUR A;  3IFD A;  1PDQ A;  2RSN A;  3IL8 A;  5T1I A;  1JE4 A;  2NWG A;  2HUG A;  5JJZ A;  2MGS A;  5DNF A;  1WD0 A;  4HCS A;  4X3K A;  2B2T A;  1GUW A;  2RVL A;  1KNE A;  1EQT A;  1U4P A;  2KED A;  5EPK A;  4IUP A;  1KNA A;  2EOT A;  4R9W A;  5AFW A;  2MJ8 A;  4X3S A;  2KVM A;  4ZKB B;  1WTR A;  1F2L A;  1ML0 D;  1ESR A;  3HP3 A;  2L1B A;  3I91 A;  4CJ1 B;  1XX8 A;  1DZ1 A;  1G2T A;  1ZXT A;  2FMM A;  5EJW A;  2MPM A;  1TVX A;  1S4Z A;  1ILQ A;  3ONA B;  2L12 A;  5EPJ A;  1BF4 A;  1DOM A;  2K01 A;  2B2V C;  1F9Q A;  2B2Y C;  5E4W C;  3DEO A;  5COY A;  1WTV A;  1VMP A;  2H1E A;  1HFG A;  4XT1 B;  4ZKC B;  1CA5 A;  1B3A A;  1E0B A;  2N88 A;  2N55 A;  3G7L A;  1X3Q A;  4QUF A;  4ZK9 B;  1M8A A;  1ILP A;  1U4L A;  1RJT A;  3TZD A;  3MTS A;  1G6Z A;  2KEE A;  2BDN A;  4XT3 B;  2J7Z A;  1DOK A;  2XIW A;  1QG7 A;  1J8I A;  1HUM A;  2R3Z A;  3GV3 A;  4NW2 A;  1X32 A;  4UAI A;  1WVL A;  2HCI A;  2FFK B;  1WTQ A;  4IUU A;  3KBX A;  1EIG A;  2B2T C;  3H91 A;  1RTO A;  2B2U A;  1MSH A;  1IKM A;  1Q3L A;  2JYO A;  1AP0 A;  1HUN A;  2Q8T A;  1HA6 A;  2EPB A;  2X6G A;  4X3T A;  4U68 A;  1HRJ A;  2K04 A;  4MHE A;  1BNZ A;  1O80 A;  2K1B A;  1WD1 A;  2SDF A;  1MSG A;  3QO2 A;  1EIH A;  5T1G A;  2DY8 A;  1EOT A;  4IUV A;  3I3C A;  4ZLT F;  1A15 A;  2IL8 A;  2KEC A;  4HSV A;  1X3P A;  5CMD A; 
#chains in the Genus database with same CATH topology
 4DK3 C;  1JQY D;  4HJ8 A;  3BZK A;  2XRS D;  1EZ8 A;  3PCO B;  1E1T A;  5FO9 B;  1F9R A;  3J80 c;  2NUC A;  4KHP L;  3OOC A;  5IP7 H;  3CCV A;  3PV0 A;  4QIW B;  4X3U A;  1TWG B;  4GLV B;  1VCI A;  3UDF A;  1DOL A;  4DK1 A;  4JI0 Q;  4OWX B;  2F0U A;  3CP0 A;  3DUZ A;  1N34 Q;  2UUB Q;  1MI2 A;  1F2Y A;  1KC8 C;  4FYD A;  2EY6 A;  3MXG A;  4HN7 A;  3C3L A;  1A2T A;  4P72 A;  4EVO A;  1SFO H;  2H5X A;  5KNB A;  4G4K A;  4ZUJ A;  5D65 A;  3TP8 A;  2E2H B;  3I2Z A;  1EIF A;  5C4X G;  3J80 E;  2ZM6 Q;  2KCN A;  4N8F A;  1I50 B;  4OO1 I;  2B2W C;  5CV6 A;  2D9U A;  1E1O A;  5AJ3 Q;  4RKL A;  2R92 B;  1XPR A;  4C3I B;  1X3E A;  2B2V A;  4O42 A;  4HIM A;  1OXS C;  5A35 A;  2K14 A;  4XQJ A;  4A75 A;  5CV8 A;  4KN7 C;  2PCF B;  4CDE C;  1BBU A;  4V19 0;  1EWC A;  2VUM H;  5GAG C;  1SBB B;  2JA9 A;  1CSP A;  4A3K H;  3RZD H;  1X55 A;  5IYC H;  1CZW A;  1EWI A;  2I0Q A;  4GNX C;  2JA5 G;  2V4D A;  1SYD A;  4BXX G;  2GA4 B;  3G6J B;  3VR6 A;  1BCP D;  5FLX E;  2F0P A;  2RVL A;  3FPP A;  3HOX G;  2KED A;  2K5V A;  2F0H A;  2UUC L;  3HOW H;  4JI1 Q;  4OO1 H;  2RDF A;  1VQ4 A;  2PO4 A;  5EJW A;  2MPM A;  1Y1V G;  4JI2 Q;  5M3M B;  1SYB A;  5F2D A;  3A55 A;  2K6A A;  3D3R A;  1QVC A;  3PMF A;  1UWV A;  3M85 A;  3U9O A;  2RCF A;  1UUP A;  4BA1 I;  1YIJ A;  2GVB A;  1PV4 A;  4JOI C;  5TSS A;  1Z9F A;  4XT3 B;  3F2B A;  4DNT B;  3WDN A;  3HOY G;  1V9P A;  4B3M L;  4R4Q A;  2E2D C;  3ER0 A;  4F7X A;  4R4O A;  5EBD A;  1QB5 D;  3T1H Q;  1V1Q A;  1XWE A;  1WD1 A;  3NSW A;  4A3B H;  4KY5 A;  4UHV A;  1ZKO A;  3PUV A;  1N8R C;  2EJF C;  1EIH A;  4OWT B;  4KKU A;  1GHJ A;  2PMZ B;  4K8J A;  2ZXR A;  3PUZ A;  4A3M H;  3S24 A;  1GUO A;  1IYU A;  4A93 G;  4C3H H;  2IHF A;  5C4Z A;  2FXQ A;  4B3T Q;  1SFO B;  2JA8 G;  1Y8O B;  1WTW A;  3NEN A;  1JIC A;  1I4R A;  5K36 H;  3W1G A;  4RGT A;  2B63 G;  4ZAI A;  4IUV A;  4A3I G;  1LT5 D;  1O7Y A;  3AYH B;  1HPC A;  1QJO A;  4JW0 A;  2MO1 A;  4TSS A;  1G91 A;  2VUM B;  4MIU A;  2GN5 A;  3RZD B;  1WCM G;  4DAY B;  1EIY B;  3W3A A;  4B08 A;  1HCZ A;  4RWS C;  4BBS G;  4LW1 A;  2HDL A;  3S16 H;  4YY3 Q;  1LV9 A;  4OON A;  2MNA A;  5DAU A;  4DF7 A;  4EQO A;  4NB3 A;  2R7D A;  1VS0 A;  2DGY A;  2MQH A;  5C4X H;  4MN3 A;  1B3Q A;  1HNW L;  1IL8 A;  2R6G A;  3V96 A;  1NUC A;  5E1F A;  3VR3 A;  1PDQ A;  5D3I B;  1JE4 A;  2NWG A;  2MGS A;  5DNF A;  3S14 H;  3NEM A;  4MTK A;  2IHE A;  4X65 Q;  3S15 B;  4R9W A;  1KNA A;  4X3S A;  4TKO B;  3OWE B;  1CI3 M;  4NKL A;  1SR3 A;  4NXN L;  1VQP A;  1QZH A;  4K0K Q;  5JEA G;  4QL5 A;  3S1Q H;  4PMW A;  3TDQ A;  1BF4 A;  4P2C B;  2JA5 H;  2WAC A;  2OT2 A;  4LNQ A;  4BXX H;  3KDF B;  2EIF A;  2ZJR A;  3HOX H;  3MXU A;  3MFG A;  4A3B B;  2HHH Q;  1U4L A;  5KGU A;  1PYS B;  4A3M B;  4GOP C;  2NZH A;  4DR3 L;  4C3H B;  4K6D A;  5IGC A;  1WTQ A;  1Y1V H;  2E2I H;  2UXC L;  4FXG C;  3HKZ G;  4DU9 A;  1TU2 B;  2Y0S G;  5IT9 c;  3GTL H;  1AP0 A;  5C3E G;  1KQS A;  1VQ9 A;  1EOV A;  2VQE L;  1GKH A;  2SDF A;  4JPB W;  1FNV A;  2F0F A;  1NMF A;  5LMN W;  4UPA A;  3JAM i;  4ZKB B;  4JYA L;  2Z6B A;  5EAY A;  1XNQ L;  3RR5 A;  5C4H A;  2ZT9 C;  1VQI A;  3HOY H;  3FMC A;  2EZV A;  1VF7 A;  3ND8 A;  2Z6K A;  1D5Z C;  2E75 C;  2VY3 A;  5CV9 A;  3X3M A;  3I56 A;  1SN8 A;  3KJP A;  2ES2 A;  5IT9 E;  1QCB D;  1WOC A;  5C5L A;  5CBA E;  4POG A;  2B39 A;  2KCM A;  2LFN A;  1F2Z A;  1U4M A;  4A93 H;  4LMQ D;  2DN8 A;  5LMN L;  2JA8 H;  2D2C C;  1DON A;  1HQM C;  3T56 B;  4CKE A;  1FNU A;  2EYL A;  3BVZ A;  4DV6 Q;  1D6E C;  3PIO 3;  2BE5 C;  1JOK A;  1NNX A;  2JA7 G;  5LL6 X;  3NTI A;  4DAP A;  4OWW B;  4A3G B;  2EYP A;  4EX5 A;  2B63 H;  3AEV A;  3GO5 A;  4A3I H;  3TZU A;  1AN8 A;  3S14 B;  5IP9 G;  4YWK A;  1YZ6 A;  3MZ5 A;  3U9S A;  3EN2 A;  1NR4 A;  3NQT A;  3T1Y L;  3KLS X;  1RIP A;  4B3S Q;  3SK8 A;  3J81 j;  1WCM H;  5J39 A;  2E5L L;  3J7A V;  1UE5 A;  4DV7 Q;  2BH8 A;  5T1I A;  4JI8 L;  5M5X H;  4A4I A;  2AUK A;  1EY8 A;  2A19 A;  3EIV A;  3KLR A;  3TQY A;  3DLL A;  4BBS H;  1G8Z D;  2K50 A;  1MJE A;  1AH9 A;  4TRD A;  1F2L A;  4BY1 G;  1EU4 A;  3BDC A;  4DR7 Q;  1CK1 A;  2NTT A;  1ENF A;  1PH6 A;  1TS3 A;  3JAM c;  2B2V C;  1Q8K A;  1IBL Q;  5IWA Q;  1OXT A;  4C1N K;  1VMP A;  2H1E A;  1I6V C;  2AHO B;  3EA6 A;  4LF5 Q;  1WI5 A;  1M8A A;  1R9T H;  2ASB A;  3I4N B;  5IE8 A;  1X9N A;  4DV0 L;  3U4V A;  3K0X A;  3E3X A;  2XIW A;  1HUM A;  5JEA H;  3K59 A;  3HOY B;  4X66 L;  3KBX A;  1V8Q A;  1Q3L A;  4X62 L;  1PHJ A;  3HOZ G;  3JAM E;  2XTI A;  4ID6 A;  3QO2 A;  4JK1 C;  2F0J A;  2A74 C;  3L9A X;  2RHQ B;  3PUX A;  4R8I A;  4APV A;  4A3E G;  3A56 A;  4DPG A;  1BXT A;  1U9R A;  2L11 A;  2L15 A;  5C3X A;  3P7J A;  1LAC A;  2JA8 B;  1QZG A;  1D7Q A;  2EDG A;  5HY6 A;  4RFB A;  1BBX C;  5C3E H;  4KN4 C;  4LFB L;  3SHL A;  3VA5 A;  1WTX A;  4Q0F A;  3I90 A;  3SK5 A;  3VDY A;  2F52 A;  1HXY D;  1STE A;  1VQ7 A;  3N52 A;  4I65 A;  3CMA A;  2XVS A;  4OIK A;  5E7N A;  1ICF B;  3F1Z A;  1HNZ L;  4RHS A;  3PGZ A;  3LGJ A;  4N9P A;  4GN3 B;  1SAP A;  2OCE A;  5J3B A;  4JBK A;  4I7A A;  2KHS A;  4DR1 Q;  4B9X A;  2G9H D;  2AWO A;  2D62 A;  2B29 A;  1WCM B;  3PQI A;  1P16 A;  2Z8L A;  1LTG D;  3KLW A;  5M5X B;  3M7N A;  1HR0 Q;  4BBS B;  4IOC A;  1ET9 A;  3MXN B;  2F0O A;  5BN3 A;  2NVT H;  4E6I A;  5HGQ A;  5IIF A;  4JI0 L;  3DWP A;  1EYA A;  2IX0 A;  2JA7 H;  1N34 L;  2UUB L;  1RD9 D;  4ODG A;  3NTH A;  3WOE A;  5JPM C;  4JBW A;  1PH7 A;  1Q82 C;  1PTO F;  2LXJ A;  3VYS A;  1K8A C;  5IP9 H;  2CWA A;  3LNN A;  2L55 A;  1OXV A;  1GD7 A;  3KFU A;  2ZM6 L;  4C3I G;  1K0S A;  1R9T B;  2L0C A;  4IFD J;  5AJ3 L;  5IGD A;  4KY7 A;  5ELC A;  1C7Y A;  3QJY A;  1YJN A;  1I4H A;  4NMZ A;  3TP6 A;  4ULL A;  4WJW A;  5I9P A;  2D0P A;  2XNA C;  1K8M A;  4DR3 Q;  1NE3 A;  3AB9 A;  1MKH A;  4ME5 A;  3H09 A;  5ELF A;  3KF8 B;  4BY1 H;  2AKW B;  1IXR A;  1KTK A;  3K81 C;  3IAY A;  4JI4 Q;  2DNE A;  1GVP A;  1KRT A;  1E3P A;  1YI2 A;  4BWG B;  1HRJ A;  2PQA A;  1R4Q B;  2DY8 A;  4JI1 L;  5M3M G;  4FF2 A;  4JVZ A;  4HIO A;  3GTG B;  2VL6 A;  5DLQ E;  4IUT A;  3F2D A;  4GLA C;  4JI2 L;  3ULL A;  5CGK A;  1SNC A;  2B8F A;  2QF7 A;  1GUT A;  3B6Y A;  2CWP A;  2E74 C;  2NZ1 D;  3HOZ H;  4K5W A;  4IFD G;  1V1P B;  1MIU A;  2UXD Q;  4XDX A;  1BR9 A;  3EQL C;  4N8X 1;  1S72 A;  2ZXO A;  4DUZ Q;  2VXW A;  4A3E H;  3HOU G;  4K8I A;  4AYB B;  2ZXP A;  4LF8 Q;  1DM0 B;  3T1H L;  3DM1 A;  2JEB I;  2UU9 Q;  5COR A;  3W1B A;  3MVV A;  4RGO S;  4KHV A;  3K80 C;  3E6Z X;  4DV4 Q;  3TS0 A;  1WTH A;  3Q22 A;  1HZC A;  1UNS A;  1L1O A;  1SSO A;  4B3T L;  2RDG A;  4FF3 A;  3TP5 A;  4WJ4 A;  1E24 A;  3KBG A;  3MFY A;  1BCP B;  2Z6K C;  3I72 A;  3OPO A;  1C9O A;  4DNI A;  1VQH A;  3QOJ A;  4S3S A;  5JPN C;  1E2V A;  1K0R A;  1JOQ A;  1WFQ A;  1N36 Q;  1TWC H;  4ILW A;  1TY2 A;  3DMU A;  1QNK A;  3IFD A;  3D8G A;  1TWG H;  4H02 A;  1GUW A;  3OTO Q;  4NXM Q;  1U4P A;  1RDP D;  4P74 A;  5GRO A;  4DGZ A;  1K9M C;  1CSQ A;  1HZ9 A;  1ML0 D;  3ICE A;  5E3F A;  1WJJ A;  4BY1 B;  1JWM D;  5M9O A;  4RMF A;  4YCW A;  2K5Q A;  1TVX A;  1MHW C;  2E2H H;  3QG1 A;  2NVX H;  1SE4 A;  1N32 Q;  2K32 A;  4KY6 A;  4YY3 L;  2PYK A;  1I50 H;  3FP9 A;  5GAE C;  3U4Z A;  3URY A;  3G7L A;  3K7U C;  4C3I H;  5BN4 A;  5IGE A;  1L0Y B;  2VS1 A;  5KIX A;  3BS1 A;  3F8T A;  2EQS A;  4Y52 H;  3RN2 A;  2VB3 X;  3GTQ B;  1FL0 A;  2B2U A;  3IRB A;  1OTC A;  1XMQ Q;  4X65 L;  5ELB A;  4X3T A;  3M4Y A;  3G6E A;  3HOZ B;  4YWM A;  2TMP A;  2K1B A;  1F2M A;  1A8V A;  4QMG A;  1TS2 A;  5EBC A;  4IFD I;  3R8B A;  5CMD A;  1VQB A;  2YTV A;  2OQ0 A;  3K5N A;  4OIJ A;  2QGQ A;  2NZO A;  4RH6 A;  3A7L A;  4K0K L;  4CDF C;  4A3E B;  4MTN A;  4K6L A;  1STY A;  2F1M A;  1EY9 A;  2GVA A;  3UDG A;  5IYB G;  2WB1 G;  1JE5 A;  2HHH L;  4EQ5 A;  1HHV A;  2PNR C;  3NBH B;  5M3M H;  1NR2 A;  3W2D A;  1Y1W G;  3CC4 A;  2HCC A;  1B9M A;  4DN4 M;  1PLF A;  1SYF A;  4NDX A;  1O7Z A;  4IUN A;  1A3T A;  3H94 A;  3HKS A;  1VQF A;  1B44 D;  4IFD H;  1QIL A;  1PTO C;  1TWC B;  2M9V A;  1SLJ A;  3I70 A;  1SJE D;  5JVH 3;  3S2H H;  1RHP A;  5CV7 A;  2EE1 A;  4DK0 A;  3HOU H;  3MA2 B;  1B70 B;  4BBR G;  3GTJ H;  3PIO A;  3I4O A;  5EKL A;  3CXC A;  4KD4 A;  3CC2 A;  1TS5 A;  3J7Y W;  1S5F D;  1PH8 A;  2NVX B;  3SR1 A;  4HSP A;  3GD7 A;  5M5Y B;  3PIP 3;  4A3G G;  3K5L A;  4DV6 L;  1FD7 D;  1WTR A;  3UE1 A;  3HP3 A;  1EU3 A;  1H9R A;  4EQN A;  1J6Q A;  2P5Z X;  1DZ1 A;  2KBN A;  4GNX B;  4LUV A;  3ONA B;  1DOM A;  1EEF D;  5E4W C;  5JOB A;  4LF7 Q;  2I07 B;  3GTO B;  1YHA A;  1TII D;  1STB A;  1S40 A;  2N55 A;  4QUF A;  1X3Q A;  1G6Z A;  4B3S L;  1RJT A;  4DXF A;  4KK7 A;  3HOV G;  1YNN C;  2J7Z A;  4DV7 L;  3P1H A;  2BH2 A;  4U67 3;  3NEL A;  5JAV A;  1LTI D;  2ZJQ A;  2BDO A;  2SOB A;  4CDC C;  4DKA C;  3VYR A;  1O80 A;  2AUJ D;  2MUY A;  4QCL A;  4DR7 L;  3FEW X;  2HIV A;  3GV6 A;  4HJA A;  3L0O A;  1H9S B;  1PH2 A;  2K28 A;  1C8C A;  2IX3 A;  3S15 H;  1IBL L;  3Q6S A;  5IWA L;  1SRU A;  2EVB A;  3I4N G;  1LO5 D;  3KF6 B;  4R4I A;  5LHY 1;  2FHT A;  4LF5 L;  1NTG A;  2ICE C;  4HJ5 A;  3M9B A;  5EKK A;  2NVY B;  3BYT B;  5JJL A;  3S2H B;  1QWY A;  1MGS A;  1J9O A;  4IPG A;  3ERQ A;  1U4R A;  5D3D A;  3HOU B;  2LS0 1;  1A6X A;  2M2L A;  1MD2 D;  3GTJ B;  4DNR B;  2AMC B;  5IYB H;  3I4L A;  2I46 A;  2JJQ A;  1IL2 A;  3H6M A;  4DUY L;  4UP7 A;  4GS3 A;  1Z47 A;  1Y1W H;  2V1C C;  3BDL A;  5KEE A;  3HKZ E;  2B2Y A;  1T5X D;  5BN5 A;  2K5N A;  2RHS B;  2UXB Q;  2EYO A;  3S1N B;  3AFP A;  1J5E Q;  1HR0 W;  5FKA C;  1EZ6 A;  1D1K A;  5JEA J;  1PH4 A;  5IGF A;  1EY4 A;  1SEB D;  5KND A;  3IFT A;  3H3V C;  1KAA A;  4KTA A;  2CH4 W;  4IUR A;  1E2W A;  3K5O A;  2K5W A;  2NB0 A;  3CCL A;  1BUV T;  5I6W A;  5ELO A;  2PNH A;  3V2T A;  2WAQ B;  1KNE A;  4F88 A;  4BBR H;  1HTL D;  1PTO D;  2N3S A;  1H95 A;  4FF1 A;  1PMR A;  4DR1 L;  4H0L C;  3G48 A;  1SNQ A;  4R4C A;  3RMH A;  2A6H C;  1PH3 A;  3S1M B;  1CKN B;  1D5X C;  1L1O C;  4RKB A;  2OF1 A;  3D0F A;  1ILQ A;  3G4S A;  4C1N I;  5DM7 3;  5G3L F;  1HR0 L;  1SNO A;  3SEB A;  3OIP A;  2CQO A;  1CHQ D;  4A3G H;  1B3A A;  1E7Z A;  3I55 A;  1Q90 A;  3K5M A;  3LX0 A;  1ENC A;  3MTS A;  4H13 C;  2F03 A;  4BS9 A;  2F0N A;  4PG3 A;  1B9N A;  1CTM A;  3PO3 G;  3GV3 A;  4NW2 A;  3F2C A;  2UUA Q;  5IYD G;  1B7Y B;  4DR4 Q;  1KDA A;  3A8J E;  4GOP B;  3SE0 A;  1PYB A;  3CD6 A;  1LAB A;  3A7A B;  3M7G A;  2EY2 A;  1ZXT A;  3A5U A;  4JBM A;  1KD1 C;  3HOV H;  4ZQ3 A;  3I73 A;  1BOS A;  4O2D A;  3KK7 A;  2F0M A;  3TP7 A;  4DV3 Q;  1XNR Q;  2Q2I A;  2WB1 B;  1KHI A;  1PYW D;  1GJX A;  1YNN D;  2OTL A;  1JB3 A;  1HA5 A;  5J1Z A;  1I6H B;  1EWH A;  5I2Y A;  1Q1E A;  1PZK D;  1Y1W B;  2HT1 A;  2Z1C A;  4RHR A;  4JI4 L;  1PFM A;  3TBI B;  4TQU S;  5BR8 Q;  3M4Q A;  2B2U C;  4HR7 B;  1CKO A;  1YVC A;  4KHZ A;  2N49 A;  3I4N H;  2EY1 A;  1F9S A;  4PV1 C;  1S5E D;  4OX9 Q;  2MHV A;  2X6L A;  4LF9 L;  1IKL A;  4JV5 Q;  2CKZ B;  5JJK A;  5NUC A;  1K8O A;  1KDB A;  1V1P A;  4BBR B;  2Q8I B;  4A3L G;  4G7Z C;  3RLO A;  2UXD L;  4AYB G;  4OEM B;  2KA7 A;  4RGM A;  5CBE E;  5IOC A;  4DUZ L;  1NBW A;  4I7Z C;  5IY0 A;  2RSN A;  1FJG Q;  1TR5 A;  1Q8I A;  4LF8 L;  4HCS A;  1SNM A;  2B2T A;  1EQQ A;  3A0J A;  3FRP B;  3ITP A;  1EQT A;  2UU9 L;  1X6O A;  4KLK A;  1AEX A;  3C46 A;  4IPC A;  4J8Q A;  2Z4H A;  1TXY A;  2RQX A;  4DV4 L;  4R4T A;  5FLX L;  1BDO A;  2F0Q A;  4G57 A;  1PXU A;  2Q2U A;  3NUC A;  2A6E C;  2QKI C;  3A5Z B;  3DWQ A;  1ONL A;  3HGB A;  1Z7T A;  4LWC A;  1DXM A;  1N36 L;  3V05 A;  1UE6 A;  2OQK A;  1HTP A;  3QR8 A;  3P20 A;  4QQB X;  3HOV B;  3PUW A;  1KXL A;  4QIW E;  3DXJ C;  1C0A A;  1JWS D;  4LFA Q;  4JI3 Q;  3OTO L;  2DJF C;  4EQP A;  4NXM L;  4DA2 A;  4XQQ A;  2A6H D;  5I4D A;  2PI2 A;  3NWT A;  1EOT A;  2KEC A;  4R1J A;  1L0X B;  2PPB C;  3QIA A;  1N32 L;  1AE2 A;  2QA4 A;  3PO3 H;  1D1I A;  1Q7Y C;  4KJN A;  5IYD H;  4LFC L;  3MAQ A;  4ALP A;  3S1R H;  4RG1 A;  4X64 Q;  3UDX A;  1YHB A;  2Q2H A;  4RAU C;  2K05 A;  2MP1 A;  1HZB A;  3GTM H;  4HTH A;  3HG9 A;  3K0Y A;  2A8V A;  5D14 A;  1PRT F;  1XMQ L;  3DM3 A;  1ENA A;  4DUY Q;  3E0E A;  1GXD C;  3MEF A;  2EYH A;  1EYC A;  1B4O A;  2NBF A;  1RKN A;  1FNW A;  4LJZ C;  2LXK A;  1TWH H;  2JE6 I;  2XRQ D;  4M8A A;  2B3G A;  2J0T D;  1Q86 C;  2F0I A;  4MZ9 A;  4R8N A;  4MNO A;  3GTG H;  1S3O A;  1YNX A;  2F0L A;  4LK1 C;  4JI5 Q;  3TRZ A;  1IYV A;  3AQQ A;  5H1S E;  3FPU B;  1KLG D;  1AW7 A;  1G2S A;  2G9D A;  1HNX Q;  2YTY A;  1Y14 B;  4FVM A;  1A0I A;  3OW7 A;  5JJZ A;  2F4V Q;  1A3V A;  4FO2 A;  2BA1 A;  3HRZ C;  3RD4 A;  5A2Q E;  5IOD A;  2KVM A;  4A3L H;  2K52 A;  3RLF A;  2Z9H A;  1VQM A;  1Q46 A;  2K7V A;  3MHB A;  5J22 A;  3U58 A;  3BVG A;  3PIP A;  3OWF A;  2B2Y C;  1CHP D;  5FLM G;  4OL7 A;  1OXX K;  2PMZ E;  1YNJ C;  1STA A;  2F3W A;  4CGY B;  4QF4 A;  4LF4 Q;  1STH A;  3TSS A;  3VA7 A;  4K2L A;  3PO3 B;  2ZTE A;  1JT8 A;  5KNC A;  2VNU D;  4QJF A;  4IZ8 A;  5C44 B;  2JYO A;  1HUN A;  3S1R B;  1HZA A;  1IBM Q;  4F87 A;  1BNZ A;  4P73 A;  2A5H A;  2K75 A;  4DXG A;  3GTM B;  2A6E D;  1VQK A;  2QW7 A;  5M5W H;  1ZYR C;  1ASZ A;  1WTO A;  3D31 A;  2F0S A;  4OXP A;  4LF7 L;  4H7B A;  2H4O A;  4PMC A;  2F0T A;  1I4G A;  1N33 Q;  2RCN A;  4RCN A;  3E5S A;  5EQ0 A;  2WKC A;  2Q8R E;  1TWH B;  1BQQ T;  1R4P B;  3D6C A;  4IPH A;  4KKS A;  5C0X J;  2E2J H;  3H0G B;  5ELN A;  3HS0 C;  3D6W A;  1S5B D;  3GTP H;  1UEB A;  2KOL A;  4LF9 Q;  3GTQ H;  5CV5 A;  1IBK Q;  3K57 A;  2A68 C;  3S2D B;  1V1O A;  1Q12 A;  2ID0 A;  1CZG A;  5CC4 A;  3CF5 A;  2Q2T A;  4L6T B;  1GUN A;  1B53 A;  1N9W A;  2VB2 X;  4HIK A;  3R93 A;  5KYL A;  4L8J A;  3KYH C;  4CJ2 C;  1STN A;  4DV5 Q;  1VDZ A;  4JI6 Q;  3OHX C;  1WD0 A;  3T4A C;  1GUS A;  3CQZ H;  4DV1 Q;  3ULP A;  1EY6 A;  3PO2 H;  3JC6 6;  3H15 A;  4A3J B;  1I3Q H;  3I91 A;  1K73 C;  3BJU A;  1EUJ A;  5C0X G;  3HFZ B;  4L5T A;  4BA2 I;  1LTR D;  1AFP A;  2JA6 G;  3DEO A;  2UXB L;  4O1N A;  3STB D;  1J5E L;  4XXE A;  5G3L D;  4YHH Q;  1ZEQ X;  3Q8D A;  2N88 A;  5FOB B;  1Y69 U;  2EJG C;  3CC7 A;  3L3O C;  2PZT A;  2WP8 J;  2BDN A;  2WAQ G;  1VQN A;  4CBV A;  1U5K A;  1IW7 D;  5M5W B;  1J8I A;  2R3Z A;  4B9W A;  4DAY A;  1EIG A;  1UE1 A;  2B2T C;  4KV6 A;  1RTO A;  3K58 A;  5FLM H;  1D2B A;  2KHI A;  2Q8T A;  2X6G A;  2K04 A;  1SJH D;  2YU9 H;  2VZA A;  2HIX A;  3OMG A;  4LUZ A;  4YCU A;  4A3D B;  2F0G A;  1X3F A;  4ZLT F;  2NVQ B;  5C5M A;  3J7A F;  1PRT C;  2ALY B;  5M5Y H;  3U50 C;  3C2P A;  4LF6 Q;  4LFC Q;  4HMI A;  1YNJ D;  2L9H A;  3M3Y B;  3RUZ A;  2E2J B;  1T9H A;  4J6H A;  3LWE A;  2LY7 A;  4FP5 D;  1DGS A;  4J15 A;  1BKB A;  1KL9 A;  3GTK H;  5JJI A;  4QGU A;  4RA8 A;  1BO0 A;  3GTP B;  1A63 A;  4IQZ A;  1VQC A;  1QUQ B;  1HJP A;  2CW0 C;  4K5V A;  3A8I E;  3GTO H;  1P8L A;  5EPL A;  2UUA L;  4DR4 L;  4XTC S;  1I94 Q;  1X65 A;  3EJI A;  1EY5 A;  4FF4 A;  2CHB D;  1EFW A;  2ZTD A;  4IUQ A;  3ERS X;  1A62 A;  3KDF A;  1ZYR D;  1IYJ B;  1VQA A;  1XTD A;  3M4O B;  2NN6 G;  1L2F A;  2IY5 B;  3FKI B;  3CCR A;  4DV3 L;  3NQI A;  1XNR L;  3CQZ B;  3PO2 B;  1IZ6 A;  4CDD C;  1PTO B;  1GO3 E;  4BY7 B;  1I3Q B;  3H3V I;  5HUR A;  1SYG A;  1YJW A;  5EKI A;  1PFN A;  2PW7 A;  5JVG 3;  5BR8 L;  5C0X I;  1QOH A;  1U0L A;  1D5M C;  4YCV A;  2NVY H;  2VQF Q;  2MJ8 A;  4DAM A;  2A68 D;  4L63 B;  1ESR A;  2AQ1 B;  2EXD A;  2IPK D;  2L1B A;  3ND9 A;  3CCE A;  4OX9 L;  2RKS A;  2ATW A;  1F77 A;  2KHJ A;  2J4X A;  5EPJ A;  4JV5 L;  3CCU A;  1DYQ A;  4ME3 A;  3RNU A;  3BYY B;  1NJI C;  4H44 C;  1GOZ A;  2YU9 B;  1K28 A;  1TS4 A;  5FK9 C;  2K4K A;  1A3U A;  3H3V H;  4GN5 A;  3R3O A;  1TT2 A;  1W2B A;  1FJG L;  3S1N H;  4DR5 Q;  1X32 A;  4Y7N H;  5C0X H;  2FFK B;  1SE8 A;  2I5L X;  4Z9C B;  4HJ9 A;  3Q23 A;  2IX1 A;  2PQE A;  2JA6 H;  2WV6 D;  3A74 A;  3GTK B;  2PZU A;  1ET6 A;  2K33 A;  4G7O C;  1RF2 D;  2BA0 A;  2WFW A;  1ESF A;  2WIN B;  1A15 A;  4RCO A;  1CQF A;  2IT1 A;  2CVR A;  2HDM A;  2KEN A;  4IN3 A;  1VF5 C;  2FIN B;  2OTJ A;  4A76 A;  3ZYY X;  1TWF B;  3NE5 B;  2MO0 A;  3BZD B;  3J81 L;  4B3R Q;  4POF A;  5FLX c;  1B2T A;  4DFA A;  2RDH A;  3S1M H;  2B8G A;  2MFI A;  1EQR A;  2HQL A;  2EYM A;  3OW2 A;  1OXU A;  2NN6 I;  4LFA L;  4JI3 L;  2EY5 A;  4OEL B;  4XIG S;  4A3F B;  3MEH A;  3RN5 A;  2L5T A;  2CH4 A;  2X69 A;  1PRT D;  3VYT A;  1PH1 A;  4KI0 A;  1F9P A;  1SRO A;  4ZYS A;  2DY7 A;  4WJ3 M;  1RL2 A;  2YV5 A;  2JK8 A;  4OGQ C;  3DWA A;  2PQA B;  4NP5 A;  1O7I A;  4JI7 Q;  4FDB A;  1EYD A;  2KQ3 A;  1NMG A;  4X64 L;  2CW0 D;  3I7F A;  5GAH C;  5LMU Q;  2JP1 A;  1B8A A;  4CJ0 B;  2VW9 A;  1UE7 A;  4P71 A;  1PH5 A;  2NN6 H;  1CT1 D;  1G29 1;  4ZUI A;  4X3K A;  1I6H H;  2C5C A;  1Q1B A;  2KJX A;  3GQB A;  3D4W A;  1SMY C;  4IOA A;  2SEB D;  5GQO A;  1W6K A;  2Y0S E;  3BU2 A;  4AQY Q;  3NBI A;  3E9I A;  1QNU A;  1LTB D;  5C3W A;  3PSI A;  4JBJ A;  2XWJ B;  4Y7N B;  3UE0 A;  1F9Q A;  1OO9 B;  2YTX A;  2AWN A;  1WTV A;  2JA6 B;  2F4I A;  5CV4 A;  1EEI D;  1LLR D;  3R2T A;  4XYQ A;  1L1O B;  4JI5 L;  4DV2 Q;  2NTS A;  2XGT A;  1XTC D;  1HNX L;  2EYJ A;  2QEX A;  1MJC A;  1VQL A;  1UEA B;  1Q81 C;  3CME A;  3TEH B;  2F4V L;  3N6R A;  4RGN A;  2I5M X;  2LMC B;  2SNM A;  1IKM A;  3PF4 A;  3CCQ A;  1GUG A;  1YEZ A;  2C35 B;  2K5D A;  4QY7 A;  3EVQ A;  3CRL C;  4AYB E;  4A3C G;  3MXN A;  4WFN 3;  1VQ5 A;  1AE3 A;  1T5E A;  1X3P A;  2TSS A;  1KAW A;  2R7Z G;  2O2L D;  4QUC A;  1TY0 A;  2IJ0 A;  1XYI A;  3F2U A;  4PMB A;  3QOL A;  1G6P A;  1I4X A;  1E22 A;  1EY7 A;  4GLX A;  4A3K B;  3WOF A;  3OMC A;  4C2M H;  2C9O A;  1M4V A;  1VQD A;  4KJO A;  4LF4 L;  1VQ6 A;  1FGU A;  1VMC A;  1ASY A;  1XMO Q;  5IGB A;  5C44 G;  1AZP A;  1I5F A;  1AZQ A;  3I4M G;  3HOW B;  1LYL A;  1PH9 A;  3CPF A;  1IBM L;  1PZI D;  2L4N A;  4ZCK A;  2WII B;  1S5C D;  3BDO A;  3EFX D;  3MWY W;  3KF8 A;  2ZTC A;  3M4P A;  4DR6 L;  1TWA H;  2PI2 E;  2SNS A;  4HCE A;  1H9M A;  1ICW A;  5C4J H;  4FNF A;  1SYE A;  4UP9 A;  1K8G A;  2QCP X;  3FVQ A;  3VYU A;  5KRU A;  1N33 L;  3H0G G;  1YJ9 A;  3TS2 A;  3K7A H;  5K5P A;  5ELD A;  3SGI A;  1EL0 A;  4FXK C;  2F0V A;  2OWO A;  1BVS A;  2BOS A;  4K2K A;  1O7L A;  4O0A A;  5LL6 S;  3T16 A;  4DR2 Q;  5EPK A;  4IUP A;  1Y8P B;  1CFM A;  2O5I C;  3J80 L;  5M3F G;  1IBK L;  1XPU A;  4J1M A;  2R61 A;  4GKJ Q;  2A1A A;  2F0K A;  3ULJ A;  2OEO A;  5FO8 B;  5COY A;  4KHP Q;  4EGV A;  1HFG A;  2QDB A;  1XXG A;  1CA5 A;  5HGT A;  1E0B A;  2EXZ A;  4ZK9 B;  3X3N A;  3SDZ A;  3CHB D;  2HD3 A;  4DV5 L;  4TVA B;  4JI6 L;  1QG7 A;  4JG2 A;  4A3J G;  2HCI A;  4YWL A;  1DD2 A;  1L0W A;  4DV1 L;  1II3 A;  1PZJ D;  1MSH A;  1SMY D;  3DHQ A;  4C2M B;  4V0B A;  4MHE A;  5CR3 A;  3Q0A A;  3S16 B;  3MC0 B;  5T1G A;  5FO7 B;  3I3C A;  1LT4 D;  4JC0 A;  4XYO A;  4CHT B;  2EJM A;  2RBM A;  3ERO A;  1KAB A;  1BBW A;  1LT6 D;  5C4X B;  1D8L A;  1CA6 A;  2RSO A;  3EBE A;  3QB3 A;  4YHH L;  2A73 B;  4ZRZ A;  3FDT A;  4GKK L;  5ISR A;  2R93 G;  3BG3 A;  3LWU A;  4A3C H;  1W3S A;  1LTS D;  1RCV D;  4M1U B;  2R7Z H;  2PZW A;  1EQV A;  1JCK B;  1PFS A;  2ICI A;  4HAE A;  3T53 B;  2HQE A;  3NHH A;  4A3D G;  5EGT A;  1TWA B;  1CQV A;  5I6Y A;  1TQO A;  2NYZ D;  3S1Q B;  4ABN A;  5C4J B;  1G51 A;  2DNC A;  5ELE A;  2LSS A;  1PFB A;  2JA5 B;  1EFI D;  4HID A;  4P75 A;  4KMU C;  2KUM A;  2RF4 A;  3K7A B;  2FJ2 A;  1E2Z A;  2UUC Q;  4LF6 L;  3A54 A;  3HOX B;  5C44 H;  1LTA D;  4PZ7 A;  2K03 A;  3VR5 A;  2N8N A;  2CQA A;  4GN4 B;  3I4M H;  3UDI A;  2Z4I A;  1JB7 A;  1X56 A;  3SK4 A;  3CRK C;  2XWB B;  3QWN A;  2F3V A;  1Y1V B;  1QUQ A;  1VQ8 A;  2E2I B;  1HFN A;  4Q5V A;  4K5X A;  2CCZ A;  2PW5 A;  3GTL B;  2IW3 A;  1BCP F;  3G71 A;  1C4Q A;  1CKM A;  4B3M Q;  1I94 L;  1NSN S;  3HEJ A;  1O78 A;  2WKD A;  5AFW A;  2EOT A;  3E9H A;  1YHQ A;  1GHK A;  3FKI G;  3KLS A;  4PZ8 A;  3PO2 G;  2JSO A;  3H0G H;  4UDU C;  5FJ8 G;  4DK6 C;  1S4Z A;  3NBH A;  1QVG A;  4BY7 G;  1WYD A;  2F0W A;  3STB C;  1K3B C;  4ZKC B;  3J81 i;  4A93 B;  3S2D H;  1HH2 P;  1VQJ A;  1STG A;  4DAV A;  4F8M A;  4G7H C;  1ILP A;  1IW7 C;  2KEE A;  5M3F H;  1LUZ A;  3NP8 A;  1TKW B;  1M90 C;  4AIM A;  4IAL A;  4IUU A;  3S17 H;  2B63 B;  1EY0 A;  1HA6 A;  2VQF L;  2EPB A;  4A3I B;  3AFQ A;  2JQO A;  4C3J G;  5I2X A;  1MSG A;  1VQG A;  3SK6 A;  1LT3 D;  4HSV A;  2AQ3 B;  2B2W A;  2R7Z B;  4PQX A;  4WOR A;  4A3J H;  1SE2 A;  4HED A;  1CM9 A;  1NAP A;  1VQO A;  3I8Z A;  1YIT A;  3CAM A;  1SNP A;  1JJ2 A;  1SND A;  1V43 A;  1JC7 A;  3A8K E;  3T51 B;  1LTL A;  2F0D A;  2QIL A;  3K6O A;  1DCZ A;  2DUD A;  2XN9 C;  1HNW Q;  2XSC A;  4PNY A;  4DR5 L;  1SDF A;  3HZX A;  5CYU A;  3I4M B;  1I4Q A;  3CW2 C;  4GNX A;  3CCJ A;  1CUK A;  2FMC A;  1PVO A;  1KDC A;  3CKI B;  3OSO A;  3UI2 A;  4X6A H;  3OYY A;  2WAQ E;  2R93 H;  1K83 H;  4AH6 A;  3CPW A;  2BE5 D;  4NXN Q;  2R92 G;  4DR6 Q;  3VR2 A;  1X3G A;  3E0J A;  1FYC A;  3PF5 A;  4B3R L;  4A3D H;  2O5J C;  2NVQ H;  5E4X A;  2A69 C;  1JOO A;  3DEP A;  4HMJ A;  4N9T A;  4QB4 A;  2JXM B;  3L2P A;  3M3Y H;  5IT9 L;  4A3F G;  3J81 c;  4K14 A;  1YBY A;  1B1Z A;  4JOI A;  5I9O A;  3TN2 A;  2O4X A;  2EYF A;  3IL8 A;  3NWS A;  3O13 A;  4CKB A;  2HUG A;  2N78 A;  2UXC Q;  3J7Z C;  1H9S A;  3RLN A;  4CKC A;  3PUY A;  2VQE Q;  1FR3 A;  3HKZ B;  3KF6 A;  2Y0S B;  5M3F B;  4L5S A;  4WRD A;  4LAA A;  5C3E B;  2FMM A;  4JYA Q;  3P75 A;  1JWU D;  1XNQ Q;  3SXH A;  1FVI A;  2K01 A;  3S17 B;  4JI7 L;  3CU7 A;  1FGB D;  3J81 E;  3BZC A;  4PZ6 A;  3S9W A;  1Y8N B;  3RZO H;  4XT1 B;  2KCT A;  5LMU L;  3M4O H;  4HJ7 A;  3TZD A;  2OXP A;  3WWV A;  4GZY C;  3FKI H;  3GP7 A;  1KLU D;  2WB1 E;  3FHW A;  1DJR D;  3NPP A;  2D0O A;  5FJ8 H;  1PTO H;  1WVL A;  2QEJ C;  1K3R A;  4BY7 H;  2M00 A;  1XJV A;  1UAP A;  3H91 A;  4C56 C;  4FXD A;  5IP7 G;  5LMN Q;  3T13 A;  4UP8 A;  1JMC A;  1PA6 A;  1KIX A;  4L5R C;  1QVF A;  1JR0 D;  2ENB A;  1EYG A;  2CFM A;  4AQY L;  2IL8 A;  1M1K C;  2NVT B;  1RTN A;  2F0E A;  5DEH A;  4KD3 A;  2KCC A;  1JJG A;  2G5D A;  2JA7 B;  4GKK Q;  2Z0S A;  2LKV A;  1PRT B;  2YYZ A;  3T1Y Q;  3R2I A;  4C3J H;  4DV2 L;  1W6J A;  2QDL A;  2R93 B;  1K83 B;  5DM6 3;  1X54 A;  1QE6 A;  2E5L Q;  3SVM A;  3C1F A;  4JI8 Q;  1CKN A;  1NCV A;  3D4R A;  1SMX A;  1HQR D;  1KRS A;  1SXT A;  4IJH A;  1VQE A;  3W5O A;  3JAM L;  2VUM G;  5IGG A;  1BCP C;  3L7Z C;  3TRE A;  3ZJY C;  5KYI A;  4UY8 C;  1B50 A;  4A3K G;  5IYC G;  3NXW A;  3J80 i;  4XQN A;  2RA4 A;  1ROD A;  1WTP A;  3KJO A;  2R7F A;  1JOR A;  2ZJP A;  3TME A;  3IKJ A;  5L37 A;  2F3I A;  4KKT A;  1I4P A;  1XMO L;  3HOW G;  4OO1 G;  3NK9 A;  1TWF H;  1SE3 A;  3NTK A;  3KUP A;  4NPS A;  2D5D A;  4DV0 Q;  1LTT D;  4GOP A;  2R92 H;  3BVM A;  5GAD C;  3AU7 A;  1XPO A;  1JJC B;  1IHZ A;  3VR4 A;  4X66 Q;  2K5H A;  3RZO B;  1S5D D;  4X62 Q;  4IPD A;  3KOJ A;  1MBY A;  2IWH A;  1H9K A;  2BCO A;  3CCM A;  1Z6H A;  5C6A A;  1XX8 A;  4CJ1 B;  3K8A A;  4A3F H;  1G2T A;  5A2Q L;  3OIQ A;  2L12 A;  4IO9 A;  2JN4 A;  4L5Q A;  2JEA I;  1C48 A;  3J7A 5;  2A69 D;  1GM5 A;  4JCV E;  4A3B G;  4LFB Q;  2AQ2 B;  4LUO A;  3MXP A;  4A3M G;  1LM0 A;  2I5H A;  3Q24 A;  4C3H G;  1DOK A;  3CCS A;  3C1E A;  4UAI A;  1NY4 A;  2E8G A;  1H9J A;  1A2U A;  4IJL A;  4DR2 L;  1HNZ Q;  4U68 A;  2E76 C;  5K36 G;  4C3J B;  3D4D A;  2DJG C;  3GDE A;  4YIJ A;  4OHJ A;  4GKJ L;  1SYC A;  3AMU A; 
#chains in the Genus database with same CATH homology
 1JQY D;  2XRS D;  1EZ8 A;  5FO9 B;  1F9R A;  2NUC A;  3OOC A;  3PV0 A;  4QIW B;  4X3U A;  1TWG B;  1VCI A;  1DOL A;  4DK1 A;  2F0U A;  3DUZ A;  1MI2 A;  1F2Y A;  4FYD A;  2EY6 A;  3MXG A;  4HN7 A;  3C3L A;  1A2T A;  4EVO A;  5KNB A;  4G4K A;  4ZUJ A;  5D65 A;  3TP8 A;  2E2H B;  3J80 E;  2KCN A;  1I50 B;  4OO1 I;  2B2W C;  5CV6 A;  2D9U A;  2R92 B;  4RKL A;  4C3I B;  2B2V A;  4O42 A;  1OXS C;  5A35 A;  4XQJ A;  5CV8 A;  4KN7 C;  2PCF B;  4V19 0;  1EWC A;  1SBB B;  1CZW A;  2V4D A;  1SYD A;  2GA4 B;  3G6J B;  3VR6 A;  1BCP D;  5FLX E;  2F0P A;  2RVL A;  3FPP A;  2KED A;  2F0H A;  4OO1 H;  2RDF A;  2PO4 A;  5EJW A;  2MPM A;  5M3M B;  1SYB A;  5F2D A;  3A55 A;  2K6A A;  3D3R A;  3PMF A;  3M85 A;  3U9O A;  1UUP A;  4BA1 I;  5TSS A;  4XT3 B;  4DNT B;  3WDN A;  2E2D C;  4F7X A;  5EBD A;  1QB5 D;  1XWE A;  1WD1 A;  3NSW A;  4KY5 A;  1EIH A;  1ZKO A;  3PUV A;  2EJF C;  4KKU A;  1GHJ A;  2PMZ B;  4K8J A;  2ZXR A;  3PUZ A;  1GUO A;  1IYU A;  5C4Z A;  1SFO B;  1Y8O B;  1WTW A;  1JIC A;  1I4R A;  5K36 H;  4RGT A;  4ZAI A;  4IUV A;  1LT5 D;  1O7Y A;  1HPC A;  1QJO A;  4TSS A;  1G91 A;  2VUM B;  4MIU A;  3RZD B;  3W3A A;  4B08 A;  1HCZ A;  4RWS C;  2HDL A;  1LV9 A;  5DAU A;  4DF7 A;  4EQO A;  4MN3 A;  1IL8 A;  2R6G A;  3V96 A;  1NUC A;  5E1F A;  3VR3 A;  1PDQ A;  5D3I B;  1JE4 A;  2NWG A;  2MGS A;  5DNF A;  3S15 B;  4R9W A;  1KNA A;  4X3S A;  4TKO B;  3OWE B;  1CI3 M;  4NKL A;  5JEA G;  4PMW A;  3TDQ A;  1BF4 A;  4P2C B;  2WAC A;  2OT2 A;  3MXU A;  3MFG A;  4A3B B;  1U4L A;  5KGU A;  4A3M B;  4C3H B;  4K6D A;  5IGC A;  1WTQ A;  4FXG C;  4DU9 A;  1TU2 B;  1AP0 A;  2SDF A;  1FNV A;  2F0F A;  4ZKB B;  5C4H A;  2ZT9 C;  3FMC A;  2EZV A;  1VF7 A;  3ND8 A;  1D5Z C;  2E75 C;  5CV9 A;  3X3M A;  5IT9 E;  1QCB D;  5C5L A;  5CBA E;  2B39 A;  2LFN A;  1F2Z A;  1U4M A;  4LMQ D;  2DN8 A;  2D2C C;  1DON A;  1HQM C;  3T56 B;  4CKE A;  1FNU A;  2EYL A;  3BVZ A;  1D6E C;  3PIO 3;  2BE5 C;  1JOK A;  5LL6 X;  3NTI A;  4DAP A;  4A3G B;  2EYP A;  3GO5 A;  3TZU A;  1AN8 A;  3S14 B;  3MZ5 A;  3U9S A;  3NQT A;  1NR4 A;  3KLS X;  3SK8 A;  5J39 A;  3J7A V;  5T1I A;  2AUK A;  1EY8 A;  3KLR A;  1G8Z D;  4TRD A;  1F2L A;  1EU4 A;  3BDC A;  1CK1 A;  2NTT A;  1ENF A;  1TS3 A;  2B2V C;  1OXT A;  4C1N K;  1VMP A;  2H1E A;  1I6V C;  3EA6 A;  1M8A A;  3I4N B;  2XIW A;  1HUM A;  5JEA H;  3K59 A;  3HOY B;  3KBX A;  1V8Q A;  1Q3L A;  3JAM E;  4ID6 A;  3QO2 A;  4JK1 C;  2F0J A;  2A74 C;  3L9A X;  3PUX A;  4R8I A;  3A56 A;  1BXT A;  1U9R A;  2L11 A;  5C3X A;  3P7J A;  1LAC A;  2JA8 B;  2EDG A;  1BBX C;  4RFB A;  4KN4 C;  3SHL A;  3VA5 A;  1WTX A;  4Q0F A;  3I90 A;  3SK5 A;  1HXY D;  1STE A;  3N52 A;  4I65 A;  2XVS A;  4OIK A;  4RHS A;  4N9P A;  1SAP A;  2KHS A;  4B9X A;  2G9H D;  2AWO A;  2D62 A;  1WCM B;  2Z8L A;  1LTG D;  5M5X B;  3M7N A;  4BBS B;  1ET9 A;  2F0O A;  5BN3 A;  4E6I A;  5IIF A;  3DWP A;  1EYA A;  2IX0 A;  1RD9 D;  4ODG A;  3NTH A;  3WOE A;  5JPM C;  4JBW A;  1PTO F;  3VYS A;  3LNN A;  2L55 A;  1OXV A;  4C3I G;  1R9T B;  2L0C A;  4IFD J;  5IGD A;  4KY7 A;  5ELC A;  3QJY A;  1I4H A;  4NMZ A;  3TP6 A;  4ULL A;  4WJW A;  5I9P A;  2XNA C;  1K8M A;  3AB9 A;  4ME5 A;  3H09 A;  5ELF A;  1KTK A;  3IAY A;  2DNE A;  4BWG B;  1HRJ A;  1R4Q B;  2DY8 A;  4FF2 A;  3GTG B;  4IUT A;  5CGK A;  1SNC A;  2B8F A;  2QF7 A;  1GUT A;  2E74 C;  2NZ1 D;  4K5W A;  4IFD G;  1V1P B;  4XDX A;  1BR9 A;  3EQL C;  2ZXO A;  2VXW A;  4K8I A;  4AYB B;  2ZXP A;  1DM0 B;  3DM1 A;  2JEB I;  5COR A;  3MVV A;  4RGO S;  4KHV A;  3E6Z X;  3Q22 A;  1UNS A;  1SSO A;  2RDG A;  4FF3 A;  3TP5 A;  3KBG A;  3MFY A;  1BCP B;  3OPO A;  3I72 A;  3QOJ A;  4S3S A;  5JPN C;  1E2V A;  1JOQ A;  4ILW A;  1TY2 A;  3DMU A;  1QNK A;  3IFD A;  3D8G A;  1GUW A;  1U4P A;  1RDP D;  4DGZ A;  1ML0 D;  5E3F A;  4BY1 B;  1JWM D;  5M9O A;  2K5Q A;  1TVX A;  3QG1 A;  1SE4 A;  2K32 A;  4KY6 A;  2PYK A;  3URY A;  3G7L A;  5BN4 A;  5IGE A;  1L0Y B;  5KIX A;  3BS1 A;  2VB3 X;  3GTQ B;  2B2U A;  5ELB A;  4X3T A;  3M4Y A;  3HOZ B;  2TMP A;  2K1B A;  1F2M A;  4QMG A;  1TS2 A;  5EBC A;  4IFD I;  3R8B A;  5CMD A;  3K5N A;  4OIJ A;  4RH6 A;  3A7L A;  4A3E B;  4K6L A;  1STY A;  2F1M A;  1EY9 A;  1HHV A;  2PNR C;  1NR2 A;  3W2D A;  2HCC A;  1B9M A;  4DN4 M;  1PLF A;  1SYF A;  4NDX A;  1O7Z A;  4IUN A;  1A3T A;  3H94 A;  1B44 D;  4IFD H;  1QIL A;  1PTO C;  1TWC B;  2M9V A;  3I70 A;  1SJE D;  5JVH 3;  1RHP A;  5CV7 A;  2EE1 A;  4DK0 A;  3MA2 B;  5EKL A;  4KD4 A;  1TS5 A;  3J7Y W;  1S5F D;  2NVX B;  3SR1 A;  4HSP A;  3GD7 A;  5M5Y B;  3PIP 3;  3K5L A;  1FD7 D;  1WTR A;  3HP3 A;  1EU3 A;  1H9R A;  4EQN A;  1DZ1 A;  3ONA B;  1DOM A;  1EEF D;  5E4W C;  5JOB A;  2I07 B;  3GTO B;  1TII D;  1STB A;  2N55 A;  4QUF A;  1X3Q A;  1G6Z A;  1RJT A;  4DXF A;  4KK7 A;  1YNN C;  2J7Z A;  3P1H A;  4U67 3;  5JAV A;  1LTI D;  2BDO A;  2SOB A;  3VYR A;  1O80 A;  2AUJ D;  2MUY A;  4QCL A;  3FEW X;  3GV6 A;  1H9S B;  2K28 A;  1C8C A;  2IX3 A;  3Q6S A;  2EVB A;  1LO5 D;  5LHY 1;  2FHT A;  2ICE C;  5EKK A;  2NVY B;  3BYT B;  3S2H B;  1QWY A;  1MGS A;  1J9O A;  3ERQ A;  1U4R A;  5D3D A;  3HOU B;  2LS0 1;  1A6X A;  2M2L A;  1MD2 D;  3GTJ B;  4DNR B;  3I4L A;  2I46 A;  3H6M A;  1Z47 A;  3BDL A;  5KEE A;  2B2Y A;  1T5X D;  5BN5 A;  2EYO A;  3S1N B;  5FKA C;  1EZ6 A;  1D1K A;  5JEA J;  5IGF A;  1EY4 A;  1SEB D;  5KND A;  3IFT A;  3H3V C;  1KAA A;  4KTA A;  4IUR A;  1E2W A;  3K5O A;  2K5W A;  2NB0 A;  1BUV T;  5I6W A;  3V2T A;  2WAQ B;  1KNE A;  4F88 A;  1HTL D;  1PTO D;  4FF1 A;  1PMR A;  4H0L C;  3RMH A;  1SNQ A;  2A6H C;  3S1M B;  1D5X C;  4RKB A;  2OF1 A;  1ILQ A;  4C1N I;  5DM7 3;  5G3L F;  1SNO A;  3SEB A;  3OIP A;  1CHQ D;  1B3A A;  1Q90 A;  3K5M A;  3LX0 A;  1ENC A;  3MTS A;  4H13 C;  2F03 A;  4BS9 A;  2F0N A;  1B9N A;  1CTM A;  3GV3 A;  4NW2 A;  1KDA A;  3A8J E;  3SE0 A;  1LAB A;  3A7A B;  3M7G A;  2EY2 A;  1ZXT A;  4ZQ3 A;  3I73 A;  1BOS A;  3KK7 A;  2F0M A;  3TP7 A;  2WB1 B;  1PYW D;  1GJX A;  1YNN D;  1JB3 A;  1HA5 A;  5J1Z A;  1I6H B;  1EWH A;  5I2Y A;  1Q1E A;  1PZK D;  1Y1W B;  2Z1C A;  4RHR A;  1PFM A;  3TBI B;  4TQU S;  2B2U C;  4HR7 B;  4KHZ A;  2EY1 A;  1F9S A;  4PV1 C;  1S5E D;  2MHV A;  2X6L A;  1IKL A;  5NUC A;  1K8O A;  1KDB A;  1V1P A;  4BBR B;  2Q8I B;  4G7Z C;  2KA7 A;  4RGM A;  5CBE E;  5IOC A;  4I7Z C;  2RSN A;  1TR5 A;  1Q8I A;  4HCS A;  1SNM A;  2B2T A;  3FRP B;  3ITP A;  1EQT A;  1AEX A;  3C46 A;  4J8Q A;  2Z4H A;  2RQX A;  5FLX L;  1BDO A;  2F0Q A;  4G57 A;  1PXU A;  3NUC A;  2A6E C;  2QKI C;  3DWQ A;  1ONL A;  3HGB A;  1Z7T A;  1DXM A;  3V05 A;  1HTP A;  3P20 A;  3HOV B;  3PUW A;  3DXJ C;  1JWS D;  4EQP A;  4DA2 A;  4XQQ A;  2A6H D;  5I4D A;  3NWT A;  1EOT A;  2KEC A;  1L0X B;  2PPB C;  3QIA A;  1D1I A;  4KJN A;  3MAQ A;  4RAU C;  2K05 A;  2MP1 A;  4HTH A;  3HG9 A;  3K0Y A;  5D14 A;  1PRT F;  1ENA A;  1GXD C;  2EYH A;  1EYC A;  1B4O A;  2NBF A;  1RKN A;  1FNW A;  4LJZ C;  2JE6 I;  2XRQ D;  4M8A A;  2J0T D;  2F0I A;  4R8N A;  2F0L A;  4LK1 C;  1IYV A;  3FPU B;  1KLG D;  1AW7 A;  1G2S A;  2G9D A;  4FVM A;  3OW7 A;  5JJZ A;  1A3V A;  4FO2 A;  2BA1 A;  3HRZ C;  3RD4 A;  5A2Q E;  5IOD A;  2KVM A;  3RLF A;  2K7V A;  3MHB A;  5J22 A;  3BVG A;  3OWF A;  2B2Y C;  1CHP D;  4OL7 A;  1OXX K;  1YNJ C;  1STA A;  2F3W A;  4CGY B;  4QF4 A;  1STH A;  3TSS A;  3VA7 A;  4K2L A;  3PO3 B;  5KNC A;  2VNU D;  4IZ8 A;  5C44 B;  2JYO A;  1HUN A;  3S1R B;  4F87 A;  1BNZ A;  2A5H A;  4DXG A;  3GTM B;  2A6E D;  1ZYR C;  1WTO A;  3D31 A;  2F0S A;  4H7B A;  2H4O A;  4PMC A;  2F0T A;  1I4G A;  4RCN A;  3E5S A;  5EQ0 A;  2WKC A;  2Q8R E;  1TWH B;  1BQQ T;  1R4P B;  3D6C A;  5C0X J;  4KKS A;  3H0G B;  3HS0 C;  3D6W A;  1S5B D;  2KOL A;  5CV5 A;  3K57 A;  2A68 C;  3S2D B;  1V1O A;  1Q12 A;  2ID0 A;  1CZG A;  5CC4 A;  4L6T B;  1GUN A;  1B53 A;  2VB2 X;  3R93 A;  5KYL A;  4L8J A;  4CJ2 C;  1STN A;  1VDZ A;  3OHX C;  1WD0 A;  3T4A C;  1GUS A;  1EY6 A;  4A3J B;  3I91 A;  5C0X G;  4BA2 I;  1LTR D;  1AFP A;  3DEO A;  4O1N A;  4XXE A;  5G3L D;  1ZEQ X;  5FOB B;  2N88 A;  1Y69 U;  2EJG C;  3L3O C;  2PZT A;  2WP8 J;  2BDN A;  4CBV A;  1IW7 D;  5M5W B;  1J8I A;  2R3Z A;  4B9W A;  4DAY A;  1EIG A;  2B2T C;  4KV6 A;  1RTO A;  3K58 A;  1D2B A;  2Q8T A;  2X6G A;  2K04 A;  1SJH D;  3OMG A;  4A3D B;  2F0G A;  4ZLT F;  2NVQ B;  5C5M A;  3J7A F;  1PRT C;  3C2P A;  4HMI A;  1YNJ D;  2L9H A;  3M3Y B;  3RUZ A;  2E2J B;  4J6H A;  3LWE A;  2LY7 A;  4FP5 D;  4RA8 A;  1BO0 A;  3GTP B;  4IQZ A;  2CW0 C;  4K5V A;  3A8I E;  5EPL A;  4XTC S;  3EJI A;  1EY5 A;  4FF4 A;  2CHB D;  4IUQ A;  1ZYR D;  3M4O B;  2NN6 G;  3FKI B;  3NQI A;  3CQZ B;  3PO2 B;  1PTO B;  4BY7 B;  1I3Q B;  5HUR A;  1SYG A;  5EKI A;  1PFN A;  2PW7 A;  5JVG 3;  5C0X I;  1QOH A;  1D5M C;  2MJ8 A;  2A68 D;  4L63 B;  1ESR A;  2AQ1 B;  2IPK D;  2L1B A;  3ND9 A;  2RKS A;  1F77 A;  2J4X A;  5EPJ A;  1DYQ A;  3BYY B;  4H44 C;  1GOZ A;  2YU9 B;  1TS4 A;  5FK9 C;  1A3U A;  3R3O A;  1TT2 A;  1X32 A;  5C0X H;  2FFK B;  4Z9C B;  3Q23 A;  2IX1 A;  2PQE A;  2WV6 D;  3GTK B;  2PZU A;  1ET6 A;  2K33 A;  4G7O C;  1RF2 D;  2BA0 A;  1ESF A;  2WIN B;  1A15 A;  4RCO A;  1CQF A;  2IT1 A;  2CVR A;  2HDM A;  4IN3 A;  1VF5 C;  2FIN B;  3ZYY X;  1TWF B;  3NE5 B;  3BZD B;  3J81 L;  1B2T A;  4DFA A;  2RDH A;  2B8G A;  2EYM A;  1OXU A;  2NN6 I;  2EY5 A;  4XIG S;  4A3F B;  3MEH A;  2L5T A;  2X69 A;  1PRT D;  3VYT A;  4KI0 A;  1F9P A;  4ZYS A;  2DY7 A;  4OGQ C;  3DWA A;  4NP5 A;  1EYD A;  2KQ3 A;  2CW0 D;  2JP1 A;  4CJ0 B;  2NN6 H;  1CT1 D;  1G29 1;  4ZUI A;  4X3K A;  2C5C A;  1Q1B A;  2KJX A;  3GQB A;  3D4W A;  1SMY C;  2SEB D;  1W6K A;  3NBI A;  1QNU A;  1LTB D;  5C3W A;  2XWJ B;  4Y7N B;  1F9Q A;  1OO9 B;  2AWN A;  1WTV A;  2JA6 B;  2F4I A;  5CV4 A;  1EEI D;  1LLR D;  3R2T A;  4XYQ A;  2NTS A;  1XTC D;  2EYJ A;  1UEA B;  3N6R A;  4RGN A;  2LMC B;  2SNM A;  1IKM A;  1GUG A;  2K5D A;  3EVQ A;  3CRL C;  3MXN A;  4WFN 3;  1T5E A;  2TSS A;  1X3P A;  2O2L D;  4QUC A;  1TY0 A;  2IJ0 A;  1XYI A;  3F2U A;  4PMB A;  3QOL A;  1I4X A;  1EY7 A;  4A3K B;  3WOF A;  3OMC A;  2C9O A;  1M4V A;  4KJO A;  1VMC A;  5IGB A;  1AZP A;  1AZQ A;  3HOW B;  1PZI D;  2L4N A;  2WII B;  1S5C D;  3BDO A;  3EFX D;  3MWY W;  3KF8 A;  2SNS A;  4HCE A;  1H9M A;  1ICW A;  4FNF A;  1SYE A;  2QCP X;  3FVQ A;  3VYU A;  5KRU A;  5K5P A;  5ELD A;  1EL0 A;  4FXK C;  2F0V A;  2BOS A;  4K2K A;  1O7L A;  5LL6 S;  3T16 A;  5EPK A;  4IUP A;  1Y8P B;  1CFM A;  2O5I C;  3J80 L;  4J1M A;  2R61 A;  2F0K A;  2OEO A;  5FO8 B;  5COY A;  4EGV A;  1HFG A;  2QDB A;  1XXG A;  1CA5 A;  5HGT A;  1E0B A;  2EXZ A;  4ZK9 B;  3X3N A;  3SDZ A;  3CHB D;  1QG7 A;  2HCI A;  1DD2 A;  1II3 A;  1PZJ D;  1MSH A;  1SMY D;  3DHQ A;  4C2M B;  4V0B A;  4MHE A;  5CR3 A;  3Q0A A;  3S16 B;  3MC0 B;  5T1G A;  5FO7 B;  3I3C A;  1LT4 D;  4XYO A;  4CHT B;  2EJM A;  2RBM A;  3ERO A;  1KAB A;  1LT6 D;  5C4X B;  1CA6 A;  2RSO A;  3QB3 A;  2A73 B;  4ZRZ A;  3FDT A;  5ISR A;  3BG3 A;  3LWU A;  1LTS D;  1RCV D;  4M1U B;  2PZW A;  1EQV A;  1JCK B;  2ICI A;  4HAE A;  3T53 B;  2HQE A;  3NHH A;  5EGT A;  1TWA B;  1CQV A;  5I6Y A;  1TQO A;  2NYZ D;  3S1Q B;  4ABN A;  5C4J B;  2DNC A;  5ELE A;  1PFB A;  2JA5 B;  1EFI D;  4KMU C;  2KUM A;  3K7A B;  2FJ2 A;  1E2Z A;  3A54 A;  3HOX B;  1LTA D;  2K03 A;  3VR5 A;  2CQA A;  2Z4I A;  3SK4 A;  3CRK C;  2XWB B;  3QWN A;  2F3V A;  1Y1V B;  2E2I B;  1HFN A;  4Q5V A;  4K5X A;  2PW5 A;  3GTL B;  2IW3 A;  1BCP F;  1C4Q A;  1NSN S;  3HEJ A;  1O78 A;  2WKD A;  5AFW A;  2EOT A;  1GHK A;  3KLS A;  2JSO A;  4UDU C;  1S4Z A;  3NBH A;  2F0W A;  4ZKC B;  4A93 B;  1STG A;  4DAV A;  4F8M A;  4G7H C;  1ILP A;  1IW7 C;  2KEE A;  3NP8 A;  1TKW B;  4IAL A;  4IUU A;  2B63 B;  1EY0 A;  1HA6 A;  2EPB A;  4A3I B;  4C3J G;  5I2X A;  1MSG A;  3SK6 A;  1LT3 D;  4HSV A;  2AQ3 B;  2B2W A;  2R7Z B;  4PQX A;  4WOR A;  1SE2 A;  4HED A;  1CM9 A;  1NAP A;  3I8Z A;  1SNP A;  1SND A;  1V43 A;  1JC7 A;  3A8K E;  3T51 B;  2F0D A;  2QIL A;  3K6O A;  1DCZ A;  2XN9 C;  2XSC A;  4PNY A;  1SDF A;  3HZX A;  5CYU A;  3I4M B;  1I4Q A;  2FMC A;  1KDC A;  3CKI B;  3OSO A;  3UI2 A;  2BE5 D;  3VR2 A;  3E0J A;  1FYC A;  2O5J C;  5E4X A;  2A69 C;  1JOO A;  3DEP A;  4HMJ A;  4N9T A;  4QB4 A;  2JXM B;  5IT9 L;  4K14 A;  1B1Z A;  5I9O A;  3TN2 A;  2O4X A;  2EYF A;  3IL8 A;  3NWS A;  3O13 A;  4CKB A;  2HUG A;  1H9S A;  4CKC A;  3PUY A;  1FR3 A;  3HKZ B;  2Y0S B;  5M3F B;  4WRD A;  4LAA A;  5C3E B;  2FMM A;  3P75 A;  1JWU D;  3SXH A;  2K01 A;  3S17 B;  3CU7 A;  1FGB D;  3J81 E;  3S9W A;  1Y8N B;  4XT1 B;  3TZD A;  2OXP A;  4GZY C;  3GP7 A;  1KLU D;  1DJR D;  3NPP A;  1PTO H;  1WVL A;  2QEJ C;  2M00 A;  4FXD A;  1UAP A;  3H91 A;  4C56 C;  3T13 A;  1JR0 D;  2ENB A;  2IL8 A;  2NVT B;  1RTN A;  2F0E A;  5DEH A;  4KD3 A;  2KCC A;  2JA7 B;  2LKV A;  1PRT B;  2YYZ A;  3R2I A;  1W6J A;  2R93 B;  1K83 B;  5DM6 3;  1QE6 A;  3SVM A;  3C1F A;  1NCV A;  3D4R A;  1HQR D;  1SXT A;  3JAM L;  5IGG A;  1BCP C;  3L7Z C;  5KYI A;  1B50 A;  3NXW A;  4XQN A;  2RA4 A;  1ROD A;  1WTP A;  1JOR A;  3TME A;  3IKJ A;  4KKT A;  1I4P A;  4OO1 G;  3NK9 A;  1SE3 A;  3NTK A;  3KUP A;  2D5D A;  1LTT D;  3BVM A;  3AU7 A;  1IHZ A;  3VR4 A;  3RZO B;  1S5D D;  1MBY A;  2IWH A;  1H9K A;  2BCO A;  1Z6H A;  5C6A A;  1XX8 A;  4CJ1 B;  1G2T A;  5A2Q L;  3OIQ A;  2L12 A;  2JEA I;  1C48 A;  2A69 D;  2AQ2 B;  3MXP A;  3Q24 A;  4C3H G;  1DOK A;  3C1E A;  4UAI A;  1H9J A;  1A2U A;  4U68 A;  2E76 C;  5K36 G;  4C3J B;  3D4D A;  4YIJ A;  4OHJ A;  1SYC A;  3AMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...