3DM1A

Crystal structure of the complex of human chromobox homolog 3 (cbx3) with peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
52
structure length
52
Chain Sequence
b'EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 3
publication title Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 12
structure length 52
sequence length 52
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dm1A00
1DZ1A 4NW2A 1VMCA 4OIJA 5CBAE 3KBXA 1EL0A 1U4MA 3P7JA 1PFMA 1F9RA 2RSNA 3MTSA 3QO2A 4IUUA 1EIHA 2K05A 5D65A 1IKMA 2KUMA 2MGSA 5DNFA 2B2YA 2L12A 1DOMA 3I91A 1ESRA 1WTOA 2K28A 1HUNA 2B2UC 1MSHA 1E0BA 2K03A 1M8AA 3FPUB 5COYA 2D9UA 2KVMA 1Q3LA 1GUWA 2MP1A 1WD0A 1A15A 2DY7A 1EQTA 5EQ0A 2HUGA 3FDTA 1BBXC 3KUPA 5EPJA 2EPBA 4HAEA 1O7YA 4OIKA 4ZLTF 1F2LA 4R8IA 3DEOA 2X6LA 4X3TA 1F9SA 1F9PA 2B2WC 1VMPA 2L4NA 5CORA 5T1IA 4RWSC 4IUQA 2HDLA 2BDNA 1MI2A 1LV9A 1RODA 2SDFA 2VXWA 3N52A 1NAPA 1ICWA 1NCVA 1NR2A 1MGSA 1RHPA 2HDMA 4LMQD 1WD1A 1HFNA 1AZPA 1ML0D 3IFDA 4IUPA 4CJ1B 1HHVA 3DEPA 1DOKA 2N55A 1B4OA 2B2WA 2NZ1D 3G7LA 1RTNA 2FHTA 2Q8RE 1DOLA 1ZXTA 1XX8A 1B53A 2J7ZA 1G91A 1CM9A 1QNKA 4XT1B 2B2VC 2JYOA 3HP3A 3GV3A 4MN3A 1HA6A 4ZKCB 1DONA 2RA4A 1PFNA 4HSVA 1B3AA 2K1BA 5AFWA 2B2UA 1MSGA 1RJTA 1WTPA 1KNEA 3ONAB 1XYIA 3D6WA 2XIWA 1ILQA 4IURA 5EPKA 4HEDA 1QG7A 5EKIA 2B2VA 4U68A 2DY8A 1SAPA 3SVMA 1B50A 2H1EA 2R3ZA 1KNAA 5JJZA 4DN4M 2KEEA 1RTOA 2HCIA 4ZKBB 3F2UA 4X3SA 1AZQA 1WTQA 1PDQA 1SDFA 1WTXA 3H91A 1U4RA 4X3UA 2X6GA 3TN2A 1WTWA 4CJ0B 1JICA 2L9HA 3I3CA 3R93A 4ZK9B 4MHEA 2RVLA 2Q8TA 1J9OA 1SSOA 1J8IA 1S4ZA 1TVXA 1G2SA 1G2TA 1CA5A 1X32A 4ZAIA 1B2TA 1G6ZA 4RA8A 4UAIA 1AP0A 4QUCA 1IL8A 1PLFA 5T1GA 2CVRA 1PFBA 3IL8A 1WVLA 1BF4A 1X3QA 2B2YC 2FJ2A 2K01A 5E4XA 1JE4A 4HCSA 1WTRA 3UI2A 1F9QA 1U4LA 1C8CA 1O7ZA 2FFKB 1X3PA 1BO0A 5CMDA 2FMMA 4O42A 2JP1A 2X69A 5EPLA 2L11A 1U4PA 1O80A 1WTVA 4X3KA 1ILPA 4CJ2C 1EOTA 3I90A 4IUVA 4XT3B 4IUTA 5D14A 2B2TC 3MWYW 1EIGA 2MPMA 2HCCA 4QUFA 2L1BA 1HFGA 1HUMA 2NYZD 2FINB 2K04A 2N88A 2EE1A 1NR4A 2IL8A 2NWGA 3Q6SA 3I8ZA 5EJWA 2EOTA 3GV6A 1HRJA 1BNZA 2M2LA 1CA6A 2B2TA 4RAUC 5E4WC 2KOLA 2KECA 1QE6A 2MJ8A 2RSOA 3DM1A 4XDXA 3TZDA 3LWEA 2KEDA 5CBEE 4R9WA 1IKLA
chains in the Genus database with same CATH superfamily
3D31A 1M90C 3C1EA 4HCEA 2WB1E 3KK7A 4GKJL 4YWKA 3A8IE 2A5HA 2N3SA 1DOMA 5C3XA 3CRKC 4IPHA 1Z7TA 1II3A 4ME3A 1ENAA 1EYGA 3CCQA 2O2LD 4XXEA 1IBLQ 3HOXH 1PTOB 1CI3M 3LWUA 5D3DA 4Y52H 5C0XG 2AUJD 1LO5D 2VUMB 3S1QH 4A3FH 4BBRB 3OYYA 4A3BH 1U5KA 1UAPA 4RWSC 1VQ8A 1TWAH 1MI2A 1LT3D 1SNQA 4LF4Q 2L55A 4R4IA 4JBMA 2D0PA 3D0FA 4DV3L 1AZPA 3L3OC 3GTLH 5IIFA 3UE0A 5IGBA 4K5VA 3URYA 1N33Q 3GTQH 2A8VA 2J7ZA 4KKTA 3AQQA 4RHSA 4LNQA 4C3IB 1Q90A 2B2UA 2VQEL 4A3JG 2TMPA 1EUJA 4XQQA 4AH6A 3S2HH 3HKSA 1B50A 4B3MQ 4GZYC 2ZM6Q 4ZKBB 1WTQA 2XGTA 4YWMA 2E5LL 2BH2A 3HOWH 1G51A 4DV4L 1SSOA 3R2IA 1YNJC 2WAQG 1B2TA 1XNRQ 1D6EC 3PUYA 3OHXC 3BYYB 2R93G 1LUZA 4DV2L 4Y7NH 3OOCA 1WI5A 3S17H 4A3MG 3FVQA 1ENFA 1C8CA 2WV6D 2CQAA 4LUVA 1EY9A 2F0OA 2F0IA 5EAYA 4GS3A 2OF1A 1I50B 4IUVA 2A6EC 5D14A 2ES2A 5IWAQ 2EYLA 1EIGA 1H9KA 1NSNS 4B3TQ 3K81C 4QCLA 1MJEA 1LTGD 3AB9A 3U58A 1KL9A 1SJHD 2MJ8A 5CV6A 1QE6A 3K6OA 2VW9A 5C44G 3CCLA 1RD9D 4XYQA 1DZ1A 1CTMA 5EKLA 1OXVA 3I4MB 1C0AA 1PFMA 3OTOQ 2J0TD 3QO2A 1UE5A 4ZYSA 4BS9A 1Q1EA 5M5XH 4N8FA 3G6EA 4LF5Q 3CD6A 1MSHA 1HNZQ 2GA4B 3OIPA 2RF4A 3SK5A 1VQKA 1QB5D 2NN6H 3FDTA 2RDHA 4GOPC 3DWAA 3J7A5 4X66L 3NENA 3I4NB 2ID0A 2ZXRA 1QJOA 2EYMA 2L4NA 2DJGC 2HDLA 4IO9A 3I70A 5BN5A 2R92H 1QUQB 1ONLA 2N49A 1MGSA 3K8AA 4HIOA 3IFDA 3UDXA 4DV7L 3EQLC 3KOJA 5IY0A 4OX9L 3CW2C 4ZCKA 2KJXA 4HSVA 5JEAH 3E3XA 2N78A 5AFWA 4QJFA 1VF7A 1KNEA 3EJIA 1XYIA 3MXUA 1A63A 2L5TA 5IGCA 5FLMG 1S5DD 3A54A 5KYIA 1RDPD 4U673 2DJFC 4X3SA 1EQRA 4FF2A 2X6GA 4OXPA 3J80E 5FO9B 4POFA 4CBVA 1TVXA 1G2SA 1Q46A 3AMUA 1IL8A 5EKKA 2PMZB 3QG1A 4B3RQ 1W6KA 1X55A 4HCSA 5J1ZA 4DA2A 2A19A 4F8MA 5GADC 2JEAI 1SN8A 5AJ3Q 2F3WA 2FFKB 2OT2A 3I4OA 2X69A 4IFDI 3U9SA 4X3KA 1ILPA 3JAML 2VY3A 3AYHB 3RMHA 3EN2A 4A3DB 3GTGB 2UUCL 4C2MH 3GDEA 4CKEA 3UE1A 3W1BA 4RMFA 2QF7A 1DXMA 1H9SB 3VA5A 4C3JG 2PI2A 3OWFA 4JI7Q 2EDGA 1EL0A 5CBAE 1K28A 2OQKA 3HOYG 3P7JA 2HT1A 2IWHA 1F9RA 4K2KA 4X62L 2R7FA 5G3LF 4FVMA 1IBKQ 3M7NA 2PZTA 5I9OA 2MNAA 1HNWL 3GTKH 5FLXc 2CH4W 1SR3A 1TU2B 2KVMA 1HXYD 3FKIG 3Q22A 5LMNQ 2JA8H 2NVTB 1FNVA 1Z47A 1VQOA 4K8JA 3WDNA 3M3YB 3P75A 1HR0L 1D5XC 4OO1G 4LF6L 4FF3A 1VDZA 1X65A 2PMZE 3VR6A 2CH4A 1Q86C 1Y8OB 1JJCB 4UP7A 1HHVA 3ERQA 1JR0D 5J3BA 4K8IA 2OTJA 3ITPA 1XX8A 1HZCA 4NP5A 4LF7Q 1CUKA 1IZ6A 3CPWA 5HY6A 1MSGA 3U9OA 3CQZB 2F3VA 4DV1L 3OSOA 2NVQH 1TWCH 4A93B 4P75A 4XTCS 1Y8PB 1B7YB 2K75A 3TP8A 5C3EB 4GOPB 1CZGA 4JI1Q 3WWVA 3BDLA 2PNHA 1QILA 3CC2A 1EY6A 4FF4A 5IP7H 5EGTA 2JA5H 2A69C 1J9OA 2Y0SG 3K0YA 3RZOH 4Q0FA 1C7YA 3X3NA 2BOSA 2Z6KA 4DR4L 2FJ2A 1WTRA 4A3EG 1AE2A 4A76A 3UI2A 1S5BD 3T53B 3F8TA 1YJWA 1YNND 3DWPA 3CCVA 2HD3A 2JP1A 3SHLA 2K5WA 5EPLA 4WJ3M 2DNEA 1XTCD 4JI8L 2KCMA 4ZUJA 1EY7A 4XYOA 3J81L 1D1KA 1STAA 1ET9A 4XIGS 4C3HH 2OTLA 3HOZG 4CDCC 4PZ8A 3NP8A 5IOCA 3H6MA 4G7OC 1XMQL 4X64L 4HR7B 4XDXA 3EFXD 4EQPA 5JVH3 2JQOA 1VQDA 4NW2A 1NY4A 3MTSA 3NK9A 2XVSA 1XMOQ 4GKKQ 2NVXB 5DNFA 2B2YA 3I91A 4C1NI 5C4HA 2YV5A 2EYJA 4AYBB 1JB7A 1Y1VH 3S1MB 2VQFQ 1NE3A 2F0VA 1A6XA 2LS01 1A15A 3HOXG 4HMJA 2XWJB 1K83B 1TWHH 2E2HH 1V1PB 3G6JB 3KUPA 2AQ1B 2ENBA 1PH1A 3RLOA 1F2LA 4DXGA 1KC8C 3KF6B 1Q1BA 2RDFA 4A3BG 5EBCA 3L7ZC 3S1NH 2WACA 1RHPA 4DR5L 1NMGA 3HKZG 5FO7B 2LMCB 3G7LA 4GNXA 3VDYA 4UDUC 1B53A 3PUXA 1AE3A 3PIP3 1PFNA 5BN3A 1TWFB 2IX1A 2NTSA 4X65Q 1D7QA 4AIMA 1RTOA 3TMEA 3I2ZA 4DV0L 2F4VL 1PDQA 3UDGA 1KLGD 4LFBQ 3KFUA 3HOWG 3PO2H 2L9HA 3KDFA 4RHRA 2Q8TA 4JV5L 4IZ8A 5M3FH 1ZYRC 3A8JE 1S5CD 4BA1I 4AYBE 2OXPA 2B63B 3MHBA 4B3SQ 2KHJA 4FXDA 1BQQT 3B6YA 3K7UC 2BA0A 5HURA 4DUZQ 1FD7D 2HHHQ 1PRTD 3G71A 3NQIA 1I94Q 1PHJA 1RCVD 2F52A 3I90A 5M3MG 1WTHA 1A3TA 2R93B 1GHKA 5IT9L 3J7AV 1XNQL 1N36Q 4DR6Q 2E76C 1KLUD 1TY2A 3GV6A 4KHPQ 4PNYA 3ULPA 1SFOH 3TDQA 1K8GA 4DAYB 2DUDA 2F3IA 2F0EA 4GKJQ 2EVBA 4NMZA 1PH6A 5JAVA 3QOLA 1S72A 3U4VA 1VQEA 3R8BA 1B70B 2IX3A 2K05A 2E2IB 1YJNA 4BY1B 2WINB 1G8ZD 3KLSX 4K2LA 3TREA 4YY3L 2YU9B 1EIFA 3STBC 5H1SE 4BY7B 1HZAA 2Z0SA 4BBSB 2DY7A 1EQTA 1PFSA 3WOFA 2NN6G 1V8QA 5CR3A 1CFMA 3GTOB 3ZJYC 1K9MC 1WJJA 4LF9L 1A3UA 5KNBA 2EYFA 2F03A 5IODA 4WJ4A 4O1NA 1LV9A 1UE7A 4YHHL 4K0KL 2F0FA 4JI4L 2R92G 2Z8LA 1HFNA 3M4YA 5TSSA 4KN7C 1XPOA 3K7AH 1BDOA 4PMWA 2BE5C 4QL5A 1Y1WH 2UUBL 1DONA 1B3AA 3PO3G 5JEAG 1JT8A 1UEAB 2XIWA 4KMUC 1PH4A 2B2VA 5DEHA 2C35B 2VL6A 1CT1D 1KNAA 4A3CG 4H7BA 3J7AF 4IFDH 3OPOA 3L2PA 3F2UA 5JOBA 1SEBD 2H4OA 3NHHA 2E5LQ 3IFTA 2JA6G 2LXKA 4A3IG 3S14B 3W5OA 1OO9B 5A35A 4NXNL 1A2UA 3TEHB 2UXDQ 5IGDA 4MIUA 4P74A 1EZ8A 4CDFC 2UUAL 1AW7A 3BVGA 2OCEA 1MJCA 1PFBA 4YWLA 1PTOH 4HJ5A 3BZDB 1F9QA 5FLXE 1PZID 2FMMA 2VUMH 4KY7A 1N9WA 4A3GB 4JYAQ 1MBYA 4BBRH 1O80A 3BDCA 4CJ2C 4FNFA 4RG1A 4APVA 1HA5A 5IYCH 3Q23A 4OEMB 4JVZA 5IE8A 2FINB 3PIO3 3QR8A 2F0UA 4WFN3 1NR4A 2NWGA 4RCNA 1NBWA 3C1FA 4JG2A 2KOLA 1VQ7A 4DR2L 4L5RC 4DR7Q 4C3IH 1VMCA 4UHVA 5C3WA 1GUOA 4DUYQ 3F2CA 4IUUA 2B3GA 2RHQB 1JB3A 5D65A 1FNWA 4H13C 2L12A 4NXMQ 1SLJA 1H9JA 4KHZA 1MHWC 4LUZA 2QDBA 2B2UC 2KENA 2VB2X 1KTKA 1E0BA 1B9MA 1AN8A 3FEWX 1YJ9A 3A7LA 1STGA 4BWGB 3NBIA 3HOYB 4RH6A 1VQAA 5KGUA 1A62A 4CKCA 4M8AA 1I4HA 5M5WB 2UXCQ 1DCZA 3DEOA 2QEXA 2X6LA 4F7XA 2B2WC 5T1IA 1WCMG 4OELB 1X9NA 1DYQA 1SROA 3H3VC 1NR2A 1EFID 2IHEA 1EFWA 3AU7A 4O2DA 1G6PA 2NZ1D 4JBWA 4K6LA 1VQ5A 2Q2HA 1I50H 2XWBB 1AEXA 2O5JC 2N8NA 4XT1B 4RGNA 5LL6X 1PA6A 3TZUA 5HGQA 3DM3A 1B3QA 3SR1A 1W2BA 1TR5A 1E24A 1YEZA 3CCJA 1IXRA 3S1RB 3PIOA 2ZXPA 2AHOB 2KCNA 5C5LA 2ALYB 1SRUA 4IQZA 3CCSA 1SYBA 3I4MH 1JWUD 1JMCA 3H91A 1U4RA 2Z6BA 3D4WA 4L5QA 5D3IB 3G4SA 1IYUA 3A0JA 1H95A 1K3RA 1SXTA 2G5DA 5IP7G 3J80L 1JJGA 1PH5A 1E3PA 3GTJB 2K5VA 2IJ0A 5BN4A 1I6HB 1VQPA 1S5ED 1JE4A 4JW0A 2NB0A 2OWOA 1SYGA 1SYEA 4KK7A 5I6WA 3I4NH 2QGQA 4JI5L 1MIUA 4IUTA 2B2TC 2AMCB 4DAMA 4A3EB 4KY6A 4R8NA 2WFWA 4C3HG 1JOOA 3Q6SA 3W2DA 5J39A 4LF8L 5IYBH 2Z4IA 1LACA 3PSIA 3H15A 1JOQA 2A6HD 2FXQA 4UPAA 3IKJA 4L6TB 3H0GB 2K33A 3K59A 4J8QA 1QWYA 3K0XA 1QUQA 4KLKA 4PMCA 3RR5A 1WYDA 2A6HC 4KJNA 1R4QB 2JA7B 1L0WA 1VQBA 1VQHA 2F0MA 2F0LA 1SMXA 1Q3LA 4XQNA 2MP1A 1T5XD 2O4XA 1R9TB 2Z4HA 4IUNA 3PMFA 1BOSA 3L0OA 1HR0Q 1W6JA 4QB4A 4JI2L 1CHQD 1PH7A 2K50A 1MKHA 4HTHA 5CORA 5C5MA 1KDAA 1VQ4A 3HOVG 4R4CA 1HCZA 1YHBA 4GN5A 4QGUA 1LTTD 3W3AA 1IHZA 2AWNA 1KRTA 4NPSA 3V2TA 1G291 1SE8A 3HP3A 4JOIC 1TQOA 3GV3A 2ATWA 1PRTF 4ZKCB 4A3DH 3J7YW 1UE1A 1ZEQX 2IX0A 3GTGH 5BR8L 3K5MA 2L15A 3A5UA 2K5QA 1N34L 2DY8A 2IPKD 3S2DB 4LAAA 1EYCA 3TP6A 4HIMA 4DR1L 3PF5A 3T1YL 2E2JB 4X3UA 3HG9A 3TN2A 4RCOA 2I5LX 1LM0A 3N6RA 1K8MA 4JI0L 3SEBA 5M3FG 4ZAIA 1H9SA 1RKNA 3ERSX 3QOJA 1EEID 4DR4Q 3K57A 1HNXL 1FGBD 2RQXA 4OONA 1LT5D 2AWOA 2NVTH 3S9WA 3BZKA 1LT6D 4DF7A 5CC4A 3M3YH 2R7ZG 4OHJA 1FL0A 2WKCA 3MFYA 4XT3B 2RDGA 5DAUA 3VYUA 1KDCA 3CP0A 1IYJB 1OXTA 2I07B 5L37A 5ELNA 3DMUA 4OL7A 5JJKA 1Q8KA 3SE0A 2HQEA 5GQOA 1M1KC 5M3MB 3NBHB 2WB1G 2CFMA 5E3FA 4I7ZC 1FJGL 5KNCA 3CQZH 2RSNA 4IPDA 1WTOA 1C48A 4HIDA 4A93H 2MO0A 4G4KA 1A8VA 5C3EH 1OXXK 1WD0A 2O5IC 1K8OA 1HPCA 3QIAA 4G7ZC 5CV7A 4A4IA 3Q8DA 1GHJA 2PNRC 4EX5A 2LFNA 3IAYA 2JEBI 4B3ML 2ZM6L 4GOPA 5E7NA 5IGFA 3N52A 1GKHA 4I65A 1BR9A 1VQGA 4LMQD 1ML0D 1DOKA 3RLNA 5FKAC 2Q8RE 4PQXA 4JI3Q 1EWHA 2NTTA 1Y1WG 3PUWA 5FJ8H 2D62A 3TSSA 1XNRL 3HS0C 1QOHA 3RN5A 4IOAA 1CKOA 4AQYQ 3MAQA 3T56B 3OWEB 4LUOA 5GAEC 4K6DA 1X56A 4DV0Q 4HJ7A 2F4VQ 4WJWA 3FPPA 1BVSA 3TQYA 3JAMi 3J81j 3K58A 3PO3B 3NWSA 1X54A 3CMAA 2NVXH 5IWAL 3HOUG 4FF1A 2F0KA 4B3TL 4LJZC 2VZAA 1S4ZA 2PZUA 3AEVA 4OWXB 1FVIA 3P1HA 3S1MH 1X3QA 2B2YC 2SNSA 2JA6B 3UDIA 4K14A 4LW1A 3GD7A 1A3VA 1K83H 4A3IB 4K5XA 2ZT9C 4N9PA 2JXMB 1LTAD 3OTOL 1X3GA 1RIPA 2VUMG 1YZ6A 2UU9Q 1EOTA 4KHVA 4JCVE 2KCTA 2Q2UA 3DHQA 3VYRA 5IYCG 2SEBD 1HUMA 3AFQA 2PQAB 1J6QA 1NUCA 1V1PA 5C0XJ 2EOTA 1PH2A 2M2LA 1T9HA 4B08A 1JOKA 1M4VA 2F0QA 3KF6A 1O7LA 1IBML 2VS1A 4JPBW 4GNXC 4R4OA 3C2PA 1TWFH 3E0JA 1F2ZA 3CMEA 3K5LA 3D3RA 4FXGC 1IKMA 1EQQA 5C4XG 5C6AA 5I2YA 2ZTEA 2D0OA 5I6YA 1M8AA 1YNNC 2KCCA 2G9HD 3LNNA 3TP7A 4WORA 3BG3A 1JJ2A 2EJMA 3VR3A 3KF8B 4E6IA 3RUZA 3CU7A 3Q24A 1PYWD 3HFZB 3A8KE 4S3SA 4LF9Q 1EYDA 4DR3Q 4A3KB 4ODGA 1EY0A 4R8IA 3HEJA 3NELA 2B63H 2DN8A 1F9PA 3GTPB 4N9TA 2CQOA 2IW3A 1TIID 2F0JA 5LHY1 3DEPA 3GP7A 1RTNA 2FHTA 2CWPA 3IRBA 4EQNA 1ZXTA 1QNKA 2R93H 1WCMB 2K5NA 2F0HA 1S5FD 2BDOA 4B3RL 1STBA 1A2TA 1YI2A 1STYA 3H3VI 5AJ3L 5EKIA 1L1OC 4U68A 5A2QE 3VR5A 1A0IA 4A3FG 2K4KA 4P72A 1VQNA 3FRPB 2NBFA 1J5EQ 2E8GA 1WTXA 3I4MG 3J81i 1EU4A 2E2IH 4BY1H 3I3CA 3R93A 4MHEA 5CV5A 1TS5A 1CA5A 2YU9H 1AP0A 3J7ZC 2YTYA 4DV5Q 4DAYA 4BY7H 2KQ3A 3IL8A 4BBSH 4KN4C 1PZJD 5E4XA 4DNTB 3BDOA 4DAVA 4DV6Q 2QDLA 1BCPD 3GTOH 5FLXL 2NVYB 2D2CC 3C3LA 1B9NA 3I4NG 1U4PA 2F0DA 3PGZA 4QQBX 1C4QA 1SJED 4I7AA 1TXYA 5LMNW 5I4DA 1HFGA 3I4LA 4A3JB 3OW7A 1BBUA 5IGEA 2RCFA 1Q7YC 3KLSA 2E74C 5LMNL 1SNDA 3NWTA 5IYBG 2XN9C 2CW0D 3I72A 1QVFA 4KV6A 5K5PA 4BXXH 2IY5B 4RKLA 1IKLA 2NZHA 4LWCA 2WIIB 1SE2A 2JK8A 2MGSA 2JN4A 3S16B 1V1QA 4H0LC 2WAQB 4L63B 1LTLA 2EZVA 2K03A 2R6GA 4ME5A 3S14H 3V05A 1EZ6A 3OMCA 1PRTC 1SNPA 3OMGA 4IPCA 1KD1C 4LF7L 4A3MB 3VYTA 1EIYB 4LFAQ 4DK1A 2K7VA 1KAWA 5FLMH 3KLRA 2M00A 3T13A 1GXDC 4X3TA 1VMPA 2VXWA 2MHVA 2HDMA 5DLQE 1AFPA 3TBIB 2EYOA 5IP9H 3PIPA 3ND9A 2Z1CA 3K80C 4A3GH 3E5SA 1HJPA 4ID6A 4HJ9A 2LY7A 3NPPA 3U50C 1DOLA 2WKDA 5C44B 1LTSD 3GO5A 3D6CA 2E2DC 2AUKA 1PTOD 1N32L 4L8JA 4P73A 3PV0A 3HOVB 1GM5A 1ILQA 2F4IA 2TSSA 1CK1A 4H02A 4DK0A 1PTOC 4CKBA 3C46A 2PW7A 3SK6A 3TRZA 1LABA 1Q81C 4DV3Q 2EY2A 1I4XA 1SE4A 1KDBA 4X6AH 4NB3A 3O13A 2ZTDA 2HQLA 1B44D 3R2TA 4RA8A 1ASYA 2EJFC 2WAQE 3SK4A 1Y69U 2VQEQ 4LFCL 1WVLA 1CHPD 5CV8A 1STNA 1R4PB 3HOYH 4MTKA 1U4LA 1TT2A 4CHTB 1TS4A 1UWVA 4B9WA 1LT4D 5M5WH 1EU3A 1CKNB 1XMOL 2K5HA 1KAAA 2EY1A 2PYKA 3MXPA 1EWIA 2XSCA 4YCVA 2NYZD 1NTGA 3VR4A 4DV4Q 2VQFL 1L1OB 2K14A 1XXGA 2EE1A 4LF8Q 4UY8C 1HRJA 3D4DA 4RGTA 5E4WC 4DV2Q 2R7ZB 1HTLD 3DM1A 5KIXA 3KJOA 1ZKOA 2ZTCA 3NQTA 1L0XB 5ELDA 1KRSA 3I55A 3RN2A 1EIHA 4A3LH 1PYSB 5CV9A 5JPMC 3CCRA 3P20A 3SGIA 3S1RH 5KNDA 4B9XA 3KLWA 4A93G 3E9IA 1I5FA 1I4GA 3RZDB 1YITA 1ASZA 5E1FA 4F88A 3NEMA 5EQ0A 1HZ9A 1U9RA 3MVVA 1PVOA 1K3BC 5IGGA 1I4RA 2EPBA 3A74A 3PUVA 4QMGA 4ZLTF 3Q0AA 3ICEA 1JWMD 3GTJH 2PPBC 1V1OA 1I6HH 1S40A 4X65L 1LTRD 3F2BA 1O78A 4GLVB 3MFGA 1NAPA 1ICWA 4GLXA 1GUGA 3CPFA 2H5XA 2SNMA 5M5YH 3BVMA 4LFBL 3BVZA 2ZJPA 4C3JB 2PQEA 1RF2D 5C0XI 5FJ8G 4A3EH 5BR8Q 2JA8G 4X66Q 4O0AA 3CCMA 1YHAA 2EYHA 2ICEC 4WRDA 4IURA 2UXBL 2EIFA 2Q2TA 3MXNB 1PRTB 5JJZA 4DUZL 1VQMA 2A68D 2HCIA 3H0GH 1I3QB 2HHHL 1Z9FA 1D2BA 4IOCA 1I94L 2JJQA 4DV7Q 3FKIB 5C4ZA 4PZ6A 1WTWA 4OX9Q 2RBMA 2JA7H 2DNCA 4DR6L 1SNMA 4AYBG 1DD2A 4UAIA 4ALPA 1SMYD 4KHPL 1E1OA 2XTIA 2K01A 3ULLA 1R9TH 3KBGA 1EEFD 1SMYC 2AKWB 3HOUB 5K36H 4FDBA 2L11A 3GTMB 2A73B 4MZ9A 1WTVA 3CCUA 4HIKA 2QCPX 2K5DA 2KHSA 3T1HL 1CSPA 2JA5G 3CCEA 2IHFA 4L5SA 3VR2A 3T4AC 1IW7D 1STHA 3FHWA 4DXFA 1FJGQ 4OIJA 3KBXA 3MC0B 4POGA 1BBWA 1IW7C 4QY7A 3DWQA 1I4PA 3DUZA 3BJUA 3ULJA 5M5YB 4ILWA 3T16A 5C4JB 2Y0SB 2OQ0A 3S2DH 1TWGB 1KQSA 5COYA 3FPUB 3K5NA 2G9DA 5KYLA 1GUWA 1E22A 2E2JH 5HGTA 2UUCQ 3QJYA 3JAMc 1UEBA 5EPJA 4DNIA 1ESFA 3I7FA 1ET6A 1F2MA 4OIKA 4Q5VA 1XJVA 2MUYA 4IJHA 5F2DA 5C4XB 3H3VH 3E0EA 2B63G 4P71A 4EQ5A 4DU9A 4X62Q 4EGVA 5DM63 1BUVT 1RODA 1QNUA 4NKLA 1YNJD 1NCVA 2NZOA 5FK9C 3HOZB 1Q82C 1CZWA 1HNWQ 4DPGA 4FYDA 4YCUA 1U0LA 1E2VA 2B2WA 1CQVA 4KTAA 1BCPF 3J80i 2IT1A 2YTVA 4FO2A 1Y1VG 3M4OB 2UXDL 1E1TA 1V9PA 2I5HA 4OWTB 4GLAC 2CWAA 2NUCA 4GN4B 4KKSA 4J15A 2A6ED 4HEDA 1QG7A 3ER0A 1HQRD 4EVOA 1P16A 4LF6Q 1CQFA 1H9MA 2H1EA 1GO3E 5M3MH 4JYAL 4H44C 4N8X1 3MXGA 5JJIA 2EXZA 1VQLA 3HOXB 3RD4A 3QWNA 2HIXA 4BY1G 2RVLA 3A7AB 4TVAB 2F0GA 3S1QB 4A3FB 2Y0SE 5T1GA 3CC7A 4A3BB 3NBHA 4BY7G 3ND8A 2R61A 4BBSG 3MA2B 1TWAB 4DV1Q 4KKUA 4DR7L 2MFIA 1X3PA 3HKZB 4DUYL 1P8LA 3GTLB 3TS2A 4NXML 4JI6L 5NUCA 2F0NA 3BYTB 1GUNA 3GTQB 3M9BA 3RLFA 4DNRB 3R3OA 1B1ZA 4QUFA 1TS3A 3PO2G 3K5OA 2IL8A 2GN5A 2WP8J 3S2HB 2B2TA 3UDFA 1EY4A 3LWEA 1IBMQ 1X6OA 1L2FA 1SNOA 1JC7A 5CBEE 2YYZA 1HH2P 4BXXG 2UXCL 3VYSA 5LMUL 4EQOA 3HOWB 1VQ6A 1PTOF 1O7IA 4JI8Q 4ABNA 4QF4A 4CGYB 1HUNA 3NSWA 1EY8A 1YVCA 2B29A 1H9RA 2OEOA 4IN3A 4OWWB 2D9UA 1E2WA 5JEAJ 3PO3H 4Y7NB 1IBLL 3KJPA 3S17B 1XMQQ 2RKSA 3E9HA 4X64Q 4CDDC 3J81c 1O7YA 4QIWB 4P2CB 1JORA 5FOBB 2ASBA 1GUSA 4A3CH 1EOVA 5ELBA 2EY6A 3G48A 1PMRA 2JA6H 4DGZA 2BDNA 2RCNA 4A3IH 1STEA 3A56A 4LF4L 1WD1A 5IP9G 4CJ1B 4IUPA 4NDXA 1B4OA 3EVQA 1XPRA 4A3GG 3HKZE 1AH9A 1G91A 1N33L 3M85A 2JYOA 1EWCA 3S24A 1V43A 2I46A 4K5WA 2RA4A 5ELCA 3CF5A 3TS0A 2EXDA 3I73A 4OO1I 1TY0A 1BXTA 4JBJA 4JOIA 1SAPA 5A2QL 5M5XB 4DKAC 2R3ZA 2HIVA 1E2ZA 3A5ZB 4HMIA 1YBYA 5ISRA 2PZWA 4V190 3M4QA 4DR5Q 1SDFA 4MTNA 1XWEA 4JBKA 2PQAA 2SOBA 2Z6KC 2FMCA 3M7GA 3MEHA 4ZK9B 3PUZA 1EYAA 1X32A 2JE6I 5JPNC 1G6ZA 1GJXA 4XQJA 1IL2A 1K8AC 4YCWA 1GOZA 4HJ8A 1SNCA 2ZJQA 5IYDH 3CKIB 2QA4A 2R92B 5CMDA 3EBEA 4A3KH 2Q8IB 1DM0B 2ZXOA 4QIWE 4F87A 2Q2IA 4IFDG 1CSQA 5CV4A 4DK3C 3GTPH 1GUTA 2LKVA 3MWYW 4IALA 3H94A 3S15H 3KF8A 1HQMC 3HZXA 2QEJC 2P5ZX 4JV5Q 2BH8A 5DM73 1W3SA 5EJWA 2K32A 2V1CC 1HR0W 3W1GA 1D5ZC 3CC4A 4RAUC 2LSSA 2E75C 1SBBB 2PCFB 1GVPA 1WCMH 2BA1A 2CKZB 1Q12A 2I0QA 1QZGA 1VF5C 4A3LG 2KUMA 2RHSB 4IPGA 1ESRA 3EIVA 4BBRG 1SE3A 1WOCA 3WOEA 4TQUS 1XNQQ 1RL2A 4LF5L 1HNZL 2CCZA 5J22A 3X3MA 2HUGA 5C0XH 1D1IA 3OIQA 4HAEA 5IT9c 2QW7A 1PV4A 1EQVA 4DFAA 3D8GA 4C3IG 4IUQA 1OXUA 2A69D 4R1JA 3GQBA 2XNAC 1PXUA 2QKIC 2NVYH 4YY3Q 1VQCA 2N55A 3LGJA 4DK6C 4C2MB 4MNOA 5ELOA 4IJLA 1N32Q 1CM9A 1QCBD 4HN7A 3V96A 3PF4A 3H09A 2K1BA 4A3JH 4FXKC 1WTPA 3ONAB 4ZUIA 4R4TA 4JK1C 4YHHQ 1SYFA 3GTKB 3U4ZA 4JI4Q 4K0KQ 2LXJA 3H0GG 5ELEA 3S15B 2JA8B 1I6VC 3KYHC 3S16H 4CJ0B 1YIJA 2MQHA 2JA7G 2UUBQ 1UE6A 5JJLA 3SDZA 4LFCQ 1D5MC 4QUCA 4A75A 1E7ZA 4UP9A 3BZCA 4A3MH 1PH3A 1PH8A 1QVGA 5K36G 1PYBA 1UNSA 5CYUA 4OGQC 3JAME 2KBNA 4NXNQ 3FP9A 2PI2E 2L1BA 3F1ZA 4RFBA 2K04A 2UUAQ 2F0SA 1OTCA 1LTID 3F2DA 5C44H 2NVQB 2RSOA 1TWCB 3EROA 4ZQ3A 1HA6A 4JI7L 2KHIA 1BKBA 1JE5A 3HOVH 1S3OA 5GROA 1F2YA 3FMCA 3ZYYX 2JA5B 1B8AA 1TKWB 1VQJA 4G7HC 4L5TA 1BCPC 1IBKL 3RZOB 5GAGC 1YNXA 1DGSA 4JI3L 2I5MX 3E6ZX 3OW2A 4TRDA 1BBXC 2L0CA 5I9PA 2QILA 4DR2Q 4AQYL 2EYPA 1VS0A 3T51B 2ZJRA 2SDFA 1ZYRD 2CW0C 4C3HB 5GAHC 2ICIA 2XRSD 1N8RC 1ENCA 1C9OA 2JA9A 3D4RA 3A55A 5LL6S 1Z6HA 4HJAA 2B2VC 2NN6I 4MN3A 4RKBA 2VNUD 2UXBQ 3VA7A 5M9OA 3D6WA 1EY5A 1DJRD 1NNXA 5EPKA 5JVG3 2M9VA 3L9AX 3MZ5A 2R7ZH 4FP5D 1CKNA 1UUPA 2K52A 1F77A 2KEEA 1K0RA 1T5EA 1Y1VB 1TS2A 5EBDA 1Y8NB 2UU9L 1L1OA 1LYLA 4JI1L 2B8GA 2D5DA 1TWHB 3M4PA 2E2HB 1JCKB 1XTDA 1J8IA 4PMBA 1G2TA 4GNXB 1X3EA 2A74C 4BA2I 1HTPA 3RZDH 4KJOA 4KY5A 2CVRA 4RGMA 2B8FA 4A3DG 4Z9CB 4GN3B 4UP8A 3S1NB 4HSPA 3STBD 1NJIC 1BO0A 4O42A 2EY5A 2A1AA 3NUCA 3TP5A 3BS1A 4KI0A 1HZBA 2PW5A 3J81E 1FYCA 2MPMA 2HCCA 3T1HQ 1GD7A 3PCOB 5FO8B 2N88A 2BCOA 2EQSA 4J1MA 2YTXA 1QZHA 4C1NK 3KDFB 1CA6A 1K73C 4M1UB 1QVCA 2F0PA 4C3JH 3DLLA 1FR3A 4DR3L 4R9WA 1LTBD 3J80c 2JSOA 4YIJA 2V4DA 1IYVA 2B39A 5I2XA 1U4MA 3NTHA 2F1MA 2Z9HA 3DXJC 1NMFA 2BE5D 1Q8IA 2F0TA 3BU2A 4RGOS 3PO2B 4JI5Q 1CKMA 3LX0A 4TKOB 2K28A 4GKKL 2CHBD 4KD4A 5M3FB 3CRLC 2R7DA 1I3QH 1WFQA 1X3FA 3FKIH 3CXCA 1KHIA 3NTIA 2VB3X 3AFPA 3HGBA 5KRUA 3MXNA 1KIXA 4OO1H 4ULLA 4ZRZA 1F9SA 1YHQA 4IFDJ 1PH9A 1J5EL 3HOUH 3SK8A 3JC66 1L0YB 3GTMH 4G57A 3EA6A 1SFOB 1MD2D 1D8LA 1VCIA 1FNUA 3PQIA 5C3EG 2AQ2B 5G3LD 2EJGC 2WB1B 4DV5L 2DGYA 1RJTA 2J4XA 1BCPB 4JI2Q 2XRQD 4V0BA 4DV6L 3SVMA 3QB3A 1ICFB 1LLRD 3HRZC 4DN4M 4DAPA 4PV1C 2AQ3B 1I4QA 1AZQA 5ELFA 1VQFA 2GVAA 4C56C 4LK1C 2PO4A 1JWSD 5KEEA 1JICA 1SYDA 3RNUA 5C4JH 3I56A 1TWGH 3SXHA 1SYCA 1OXSC 1PLFA 1BF4A 3CHBD 1Y14B 1N34Q 3NE5B 4B3SL 1XPUA 1O7ZA 3NXWA 5IYDG 4PG3A 1JQYD 4A3KG 2K6AA 4JC0A 5C4XH 4JI6Q 3K7AB 4DR1Q 1KABA 3T1YQ 4J6HA 4CDEC 2C9OA 1Y1WB 1PZKD 5IT9E 1K0SA 4KD3A 3HOZH 4JI0Q 2A68C 2KA7A 2MO1A 4PZ7A 3MEFA 1N36L 1VQ9A 2F0WA 3I8ZA 1BNZA 1FGUA 5CGKA 1HNXQ 2C5CA 3NTKA 2GVBA 2KECA 3TZDA 3M4OH 4TSSA 1VQIA 4LFAL 1KXLA 4R4QA 2KEDA 3CAMA 5LMUQ
chains in the Genus database with same CATH topology
3D31A 3C1EA 4HCEA 3KK7A 3A8IE 2A5HA 1DOMA 5C3XA 3CRKC 1Z7TA 1II3A 1ENAA 2O2LD 4XXEA 1PTOB 1CI3M 3LWUA 5D3DA 5C0XG 2AUJD 1LO5D 2VUMB 4BBRB 1UAPA 4RWSC 1MI2A 1LT3D 1SNQA 2L55A 1AZPA 3L3OC 5IIFA 5IGBA 4K5VA 3URYA 2J7ZA 4KKTA 4RHSA 4C3IB 1Q90A 2B2UA 2TMPA 4XQQA 1B50A 4GZYC 4ZKBB 1WTQA 1SSOA 3R2IA 1YNJC 1B2TA 1D6EC 3PUYA 3OHXC 3BYYB 3OOCA 3FVQA 1ENFA 1C8CA 2WV6D 2CQAA 1EY9A 2F0OA 2F0IA 2OF1A 1I50B 4IUVA 2A6EC 5D14A 2EYLA 1EIGA 1H9KA 1NSNS 4QCLA 1LTGD 3AB9A 1SJHD 2MJ8A 5CV6A 1QE6A 3K6OA 1RD9D 4XYQA 1DZ1A 1CTMA 5EKLA 1OXVA 3I4MB 1PFMA 2J0TD 3QO2A 4ZYSA 4BS9A 1Q1EA 1MSHA 2GA4B 3OIPA 3SK5A 1QB5D 2NN6H 3FDTA 2RDHA 3DWAA 3I4NB 2ID0A 2ZXRA 1QJOA 2EYMA 2L4NA 2HDLA 3I70A 5BN5A 1ONLA 1MGSA 3IFDA 3EQLC 2KJXA 4HSVA 5JEAH 5AFWA 1VF7A 1KNEA 3EJIA 1XYIA 3MXUA 2L5TA 5IGCA 1S5DD 3A54A 5KYIA 1RDPD 4U673 4X3SA 4FF2A 2X6GA 3J80E 5FO9B 4CBVA 1TVXA 1G2SA 3AMUA 1IL8A 5EKKA 2PMZB 3QG1A 1W6KA 4HCSA 5J1ZA 4DA2A 4F8MA 2JEAI 2F3WA 2FFKB 2OT2A 2X69A 4IFDI 3U9SA 4X3KA 1ILPA 3JAML 3RMHA 4A3DB 3GTGB 4CKEA 2QF7A 1DXMA 1H9SB 3VA5A 4C3JG 3OWFA 1EL0A 2EDGA 5CBAE 3P7JA 2IWHA 1F9RA 4K2KA 5G3LF 4FVMA 3M7NA 2PZTA 5I9OA 1TU2B 2KVMA 1HXYD 3Q22A 2NVTB 1FNVA 1Z47A 4K8JA 3WDNA 3M3YB 3P75A 1D5XC 4OO1G 4FF3A 1VDZA 3VR6A 1Y8OB 1HHVA 3ERQA 1JR0D 4K8IA 3ITPA 1XX8A 4NP5A 1MSGA 3U9OA 3CQZB 2F3VA 3OSOA 4A93B 4XTCS 1Y8PB 3TP8A 5C3EB 1CZGA 3BDLA 1QILA 1EY6A 4FF4A 5EGTA 2A69C 1J9OA 3K0YA 4Q0FA 3X3NA 2BOSA 2FJ2A 1WTRA 3UI2A 1S5BD 3T53B 1YNND 3DWPA 2JP1A 3SHLA 2K5WA 5EPLA 2DNEA 1XTCD 4ZUJA 1EY7A 4XYOA 3J81L 1D1KA 1STAA 1ET9A 4XIGS 5IOCA 3NP8A 3H6MA 4G7OC 4HR7B 4XDXA 3EFXD 4EQPA 5JVH3 4NW2A 3MTSA 3NK9A 2XVSA 2NVXB 5DNFA 2B2YA 3I91A 4C1NI 5C4HA 2EYJA 4AYBB 3S1MB 2F0VA 1A6XA 2LS01 1A15A 4HMJA 2XWJB 1K83B 1V1PB 3G6JB 3KUPA 2AQ1B 2ENBA 1F2LA 4DXGA 1Q1BA 2RDFA 5EBCA 3L7ZC 2WACA 1RHPA 5FO7B 2LMCB 3G7LA 4UDUC 1B53A 3PUXA 3PIP3 1PFNA 5BN3A 1TWFB 2IX1A 2NTSA 1RTOA 3TMEA 1PDQA 1KLGD 2L9HA 4RHRA 2Q8TA 4IZ8A 1ZYRC 3A8JE 1S5CD 4BA1I 2OXPA 2B63B 3MHBA 4FXDA 1BQQT 2BA0A 5HURA 1FD7D 1PRTD 3NQIA 1RCVD 3I90A 1A3TA 2R93B 1GHKA 5IT9L 3J7AV 2E76C 1KLUD 1TY2A 3GV6A 4PNYA 3TDQA 2F0EA 2EVBA 4NMZA 5JAVA 3QOLA 3R8BA 2IX3A 2K05A 2E2IB 4BY1B 2WINB 1G8ZD 3KLSX 4K2LA 2YU9B 4BY7B 4BBSB 2DY7A 1EQTA 3WOFA 2NN6G 1V8QA 5CR3A 1CFMA 3GTOB 1A3UA 5KNBA 2EYFA 2F03A 5IODA 4O1NA 1LV9A 2F0FA 2Z8LA 1HFNA 3M4YA 5TSSA 4KN7C 1BDOA 4PMWA 2BE5C 1DONA 1B3AA 5JEAG 1UEAB 2XIWA 4KMUC 2B2VA 5DEHA 1CT1D 1KNAA 4H7BA 3J7AF 4IFDH 3OPOA 3F2UA 5JOBA 1SEBD 2H4OA 3NHHA 3IFTA 3S14B 5A35A 1OO9B 1A2UA 5IGDA 4MIUA 1EZ8A 1AW7A 3BVGA 1PFBA 1PTOH 3BZDB 1F9QA 5FLXE 1PZID 2FMMA 4KY7A 4A3GB 1MBYA 1O80A 3BDCA 4CJ2C 4FNFA 1HA5A 3Q23A 2FINB 3PIO3 2F0UA 4WFN3 1NR4A 2NWGA 4RCNA 3C1FA 2KOLA 1VMCA 5C3WA 1GUOA 4IUUA 1JB3A 5D65A 1FNWA 4H13C 2L12A 1H9JA 4KHZA 2QDBA 2B2UC 2VB2X 1KTKA 1E0BA 1B9MA 1AN8A 3FEWX 3A7LA 1STGA 4BWGB 3NBIA 3HOYB 4RH6A 5KGUA 4CKCA 4M8AA 1I4HA 5M5WB 1DCZA 3DEOA 2X6LA 4F7XA 2B2WC 5T1IA 1DYQA 3H3VC 1NR2A 1EFID 3AU7A 2NZ1D 4JBWA 4K6LA 2XWBB 1AEXA 2O5JC 4XT1B 4RGNA 5LL6X 3TZUA 3SR1A 1TR5A 3S1RB 2ZXPA 2KCNA 5C5LA 4IQZA 1SYBA 1JWUD 3H91A 1U4RA 3D4WA 5D3IB 1IYUA 1SXTA 3J80L 3GTJB 2IJ0A 5BN4A 1I6HB 1S5ED 1JE4A 2NB0A 1SYGA 1SYEA 4KK7A 5I6WA 4IUTA 2B2TC 4A3EB 4KY6A 4R8NA 4C3HG 1JOOA 3Q6SA 3W2DA 5J39A 2Z4IA 1LACA 1JOQA 2A6HD 3IKJA 4L6TB 3H0GB 2K33A 3K59A 4J8QA 1QWYA 4PMCA 2A6HC 4KJNA 1R4QB 2JA7B 2F0MA 2F0LA 1Q3LA 4XQNA 2MP1A 1T5XD 2O4XA 1R9TB 2Z4HA 4IUNA 3PMFA 1BOSA 1W6JA 4QB4A 1CHQD 4HTHA 5CORA 5C5MA 1KDAA 1HCZA 1LTTD 3W3AA 1IHZA 2AWNA 3V2TA 1G291 3HP3A 1TQOA 3GV3A 1PRTF 4ZKCB 3J7YW 1ZEQX 2IX0A 3K5MA 2K5QA 2DY8A 2IPKD 3S2DB 4LAAA 1EYCA 3TP6A 2E2JB 4X3UA 3HG9A 3TN2A 4RCOA 3N6RA 1K8MA 3SEBA 4ZAIA 1H9SA 1RKNA 3QOJA 1EEID 3K57A 1FGBD 2RQXA 1LT5D 2AWOA 3S9WA 1LT6D 4DF7A 5CC4A 4OHJA 2WKCA 3MFYA 4XT3B 2RDGA 5DAUA 3VYUA 1KDCA 1OXTA 2I07B 3DMUA 4OL7A 3SE0A 2HQEA 5M3MB 5E3FA 4I7ZC 5KNCA 2RSNA 1WTOA 1C48A 4G4KA 1OXXK 1WD0A 2O5IC 1K8OA 1HPCA 3QIAA 4G7ZC 5CV7A 1GHJA 2PNRC 3IAYA 2LFNA 2JEBI 5IGFA 3N52A 4I65A 1BR9A 4LMQD 1ML0D 1DOKA 5FKAC 2Q8RE 4PQXA 1EWHA 2NTTA 3PUWA 2D62A 3TSSA 3HS0C 1QOHA 3MAQA 3T56B 3OWEB 4K6DA 4WJWA 3FPPA 3K58A 3PO3B 3NWSA 4FF1A 2F0KA 4LJZC 1S4ZA 2PZUA 3P1HA 1X3QA 2B2YC 2SNSA 2JA6B 4K14A 3GD7A 1A3VA 4A3IB 4K5XA 2ZT9C 4N9PA 2JXMB 1LTAD 1EOTA 4KHVA 3DHQA 3VYRA 2SEBD 1HUMA 1NUCA 1V1PA 5C0XJ 2EOTA 2M2LA 4B08A 1JOKA 1M4VA 2F0QA 1O7LA 3C2PA 3E0JA 1F2ZA 3K5LA 3D3RA 4FXGC 1IKMA 5C6AA 5I2YA 5I6YA 1M8AA 1YNNC 2KCCA 2G9HD 3LNNA 3TP7A 4WORA 3BG3A 2EJMA 3VR3A 4E6IA 3RUZA 3CU7A 3Q24A 1PYWD 3A8KE 4S3SA 1EYDA 4A3KB 4ODGA 1EY0A 4R8IA 3HEJA 2DN8A 1F9PA 3GTPB 4N9TA 2IW3A 1TIID 2F0JA 5LHY1 3DEPA 3GP7A 1RTNA 2FHTA 4EQNA 1ZXTA 1QNKA 1WCMB 2F0HA 1S5FD 2BDOA 1STBA 1A2TA 1STYA 5EKIA 4U68A 5A2QE 3VR5A 3FRPB 2NBFA 1WTXA 1EU4A 3I3CA 3R93A 4MHEA 5CV5A 1TS5A 1CA5A 1AP0A 4DAYA 2KQ3A 3IL8A 4KN4C 1PZJD 5E4XA 4DNTB 3BDOA 4DAVA 1BCPD 5FLXL 2NVYB 2D2CC 3C3LA 1B9NA 1U4PA 2F0DA 1C4QA 1SJED 5I4DA 1HFGA 3I4LA 4A3JB 3OW7A 5IGEA 3KLSA 2E74C 1SNDA 3NWTA 2XN9C 2CW0D 3I72A 4KV6A 5K5PA 4RKLA 1IKLA 2WIIB 1SE2A 2MGSA 3S16B 4H0LC 2WAQB 4L63B 2EZVA 2K03A 2R6GA 4ME5A 3V05A 1EZ6A 3OMCA 1PRTC 1SNPA 3OMGA 4A3MB 3VYTA 4DK1A 2K7VA 3KLRA 2M00A 3T13A 1GXDC 4X3TA 1VMPA 2VXWA 2MHVA 2HDMA 1AFPA 3TBIB 2EYOA 3ND9A 2Z1CA 3E5SA 4ID6A 2LY7A 3NPPA 1DOLA 2WKDA 5C44B 1LTSD 3GO5A 3D6CA 2E2DC 2AUKA 1PTOD 4L8JA 3PV0A 3HOVB 1ILQA 2F4IA 2TSSA 1CK1A 4DK0A 1PTOC 4CKBA 3C46A 2PW7A 3SK6A 1LABA 2EY2A 1I4XA 1SE4A 1KDBA 3O13A 1B44D 3R2TA 4RA8A 2EJFC 3SK4A 1Y69U 1WVLA 1CHPD 5CV8A 1STNA 1R4PB 1U4LA 1TT2A 4CHTB 1TS4A 4B9WA 1LT4D 1EU3A 1KAAA 2EY1A 2PYKA 3MXPA 2XSCA 2NYZD 3VR4A 1XXGA 2EE1A 1HRJA 3D4DA 4RGTA 5E4WC 2R7ZB 1HTLD 3DM1A 5KIXA 1ZKOA 3NQTA 1L0XB 5ELDA 1EIHA 5CV9A 5JPMC 3P20A 5KNDA 4B9XA 1I4GA 3RZDB 5E1FA 4F88A 5EQ0A 1U9RA 3MVVA 5IGGA 1I4RA 2EPBA 4QMGA 3PUVA 4ZLTF 3Q0AA 1JWMD 2PPBC 1V1OA 1LTRD 1O78A 3MFGA 1NAPA 1ICWA 1GUGA 2SNMA 3BVMA 3BVZA 4C3JB 2PQEA 1RF2D 5C0XI 2EYHA 2ICEC 4WRDA 4IURA 1PRTB 5JJZA 2A68D 2HCIA 1I3QB 1D2BA 3FKIB 5C4ZA 1WTWA 2RBMA 2DNCA 1SNMA 1DD2A 4UAIA 1SMYD 2K01A 3KBGA 1EEFD 1SMYC 3HOUB 5K36H 3GTMB 2L11A 2A73B 1WTVA 2QCPX 2K5DA 2KHSA 3VR2A 3T4AC 1IW7D 1STHA 4DXFA 4OIJA 3KBXA 3MC0B 1IW7C 3DWQA 1I4PA 3DUZA 5M5YB 4ILWA 3T16A 5C4JB 2Y0SB 1TWGB 5COYA 3FPUB 3K5NA 2G9DA 5KYLA 1GUWA 5HGTA 3QJYA 5EPJA 1ESFA 4OIKA 1ET6A 1F2MA 4Q5VA 2MUYA 5F2DA 5C4XB 5DM63 4DU9A 4EGVA 1BUVT 1RODA 1QNUA 4NKLA 1YNJD 1NCVA 5FK9C 3HOZB 1CZWA 4FYDA 1E2VA 2B2WA 1CQVA 4KTAA 1BCPF 2IT1A 4FO2A 3M4OB 2NUCA 4KKSA 2A6ED 4HEDA 1QG7A 4EVOA 1HQRD 1CQFA 1H9MA 2H1EA 4H44C 3MXGA 2EXZA 3HOXB 3RD4A 3QWNA 2RVLA 3A7AB 2F0GA 3S1QB 4A3FB 5T1GA 4A3BB 3NBHA 3ND8A 2R61A 3MA2B 1TWAB 4KKUA 1X3PA 3HKZB 3GTLB 5NUCA 2F0NA 3BYTB 1GUNA 3GTQB 3RLFA 4DNRB 3R3OA 1B1ZA 4QUFA 1TS3A 3K5OA 2IL8A 2WP8J 3S2HB 2B2TA 1EY4A 3LWEA 5CBEE 1JC7A 1SNOA 2YYZA 3VYSA 4EQOA 3HOWB 1PTOF 4ABNA 4QF4A 4CGYB 1HUNA 3NSWA 1EY8A 1H9RA 2OEOA 4IN3A 2D9UA 1E2WA 5JEAJ 4Y7NB 3S17B 2RKSA 1O7YA 4QIWB 4P2CB 1JORA 5FOBB 1GUSA 5ELBA 2EY6A 1PMRA 4DGZA 2BDNA 1STEA 3A56A 1WD1A 4CJ1B 4IUPA 4NDXA 1B4OA 3EVQA 1G91A 3M85A 2JYOA 1EWCA 1V43A 2I46A 4K5WA 2RA4A 5ELCA 3I73A 4OO1I 1TY0A 1BXTA 1SAPA 5A2QL 5M5XB 2R3ZA 1E2ZA 5ISRA 4HMIA 2PZWA 4V190 1SDFA 1XWEA 2SOBA 2FMCA 3M7GA 3MEHA 4ZK9B 3PUZA 1EYAA 1X32A 2JE6I 5JPNC 1G6ZA 1GJXA 4XQJA 1GOZA 1SNCA 3CKIB 2R92B 5CMDA 2Q8IB 1DM0B 2ZXOA 4F87A 4IFDG 5CV4A 1GUTA 2LKVA 3MWYW 4IALA 3H94A 3KF8A 1HQMC 3HZXA 2QEJC 5DM73 5EJWA 2K32A 1D5ZC 4RAUC 2E75C 1SBBB 2PCFB 2BA1A 1Q12A 1VF5C 2KUMA 1ESRA 1SE3A 3WOEA 4TQUS 5J22A 3X3MA 2HUGA 5C0XH 1D1IA 3OIQA 4HAEA 1EQVA 4DFAA 3D8GA 4C3IG 4IUQA 1OXUA 2A69D 3GQBA 2XNAC 1PXUA 2QKIC 2N55A 4C2MB 1CM9A 1QCBD 4HN7A 3V96A 3H09A 2K1BA 4FXKC 1WTPA 3ONAB 4ZUIA 4JK1C 3GTKB 1SYFA 5ELEA 3S15B 2JA8B 1I6VC 4CJ0B 3SDZA 1D5MC 4QUCA 5K36G 1UNSA 5CYUA 4OGQC 3JAME 2L1BA 4RFBA 2K04A 2F0SA 1LTID 2NVQB 2RSOA 1TWCB 3EROA 4ZQ3A 1HA6A 1F2YA 3FMCA 3ZYYX 2JA5B 1TKWB 4G7HC 1BCPC 3RZOB 3E6ZX 4TRDA 1BBXC 2L0CA 5I9PA 2QILA 2EYPA 3T51B 2SDFA 1ZYRD 2CW0C 4C3HB 2ICIA 2XRSD 1ENCA 3D4RA 3A55A 5LL6S 1Z6HA 2B2VC 2NN6I 4MN3A 4RKBA 2VNUD 3VA7A 5M9OA 3D6WA 1EY5A 1DJRD 5EPKA 5JVG3 2M9VA 3L9AX 3MZ5A 4FP5D 1UUPA 1F77A 2KEEA 1T5EA 1Y1VB 1TS2A 5EBDA 1Y8NB 2B8GA 2D5DA 1TWHB 2E2HB 1JCKB 1J8IA 4PMBA 1G2TA 4BA2I 2A74C 1HTPA 4KJOA 4KY5A 2CVRA 4RGMA 2B8FA 4Z9CB 3S1NB 4HSPA 1BO0A 4O42A 2EY5A 3NUCA 3TP5A 3BS1A 4KI0A 2PW5A 3J81E 1FYCA 2MPMA 2HCCA 5FO8B 2N88A 2BCOA 4J1MA 4C1NK 1CA6A 4M1UB 2F0PA 1FR3A 4R9WA 1LTBD 2JSOA 4YIJA 2V4DA 1IYVA 2B39A 5I2XA 1U4MA 3NTHA 2F1MA 3DXJC 2BE5D 1Q8IA 2F0TA 4RGOS 3PO2B 3LX0A 4TKOB 2K28A 2CHBD 4KD4A 5M3FB 3CRLC 3NTIA 2VB3X 3HGBA 5KRUA 3MXNA 4OO1H 4ULLA 4ZRZA 1F9SA 4IFDJ 3SK8A 1L0YB 4G57A 3EA6A 1SFOB 1MD2D 1VCIA 1FNUA 2AQ2B 5G3LD 2EJGC 2WB1B 1RJTA 2J4XA 1BCPB 2XRQD 4V0BA 3SVMA 3QB3A 1LLRD 3HRZC 4DN4M 4DAPA 4PV1C 2AQ3B 1I4QA 1AZQA 5ELFA 4C56C 4LK1C 2PO4A 1JWSD 5KEEA 1JICA 1SYDA 3SXHA 1SYCA 1OXSC 1PLFA 1BF4A 3CHBD 3NE5B 1O7ZA 3NXWA 1JQYD 2K6AA 3K7AB 1KABA 4J6HA 2C9OA 1Y1WB 1PZKD 5IT9E 4KD3A 2A68C 2KA7A 2F0WA 3I8ZA 1BNZA 5CGKA 2C5CA 3NTKA 2KECA 3TZDA 4TSSA 2KEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DZ1 A;  4NW2 A;  1VMC A;  4OIJ A;  5CBA E;  3KBX A;  1EL0 A;  1U4M A;  3P7J A;  1PFM A;  1F9R A;  2RSN A;  3MTS A;  3QO2 A;  4IUU A;  1EIH A;  2K05 A;  5D65 A;  1IKM A;  2KUM A;  2MGS A;  5DNF A;  2B2Y A;  2L12 A;  1DOM A;  3I91 A;  1ESR A;  1WTO A;  2K28 A;  1HUN A;  2B2U C;  1MSH A;  1E0B A;  2K03 A;  1M8A A;  3FPU B;  5COY A;  2D9U A;  2KVM A;  1Q3L A;  1GUW A;  2MP1 A;  1WD0 A;  1A15 A;  2DY7 A;  1EQT A;  5EQ0 A;  2HUG A;  3FDT A;  1BBX C;  3KUP A;  5EPJ A;  2EPB A;  4HAE A;  1O7Y A;  4OIK A;  4ZLT F;  1F2L A;  4R8I A;  3DEO A;  2X6L A;  4X3T A;  1F9S A;  1F9P A;  2B2W C;  1VMP A;  2L4N A;  5COR A;  5T1I A;  4RWS C;  4IUQ A;  2HDL A;  2BDN A;  1MI2 A;  1LV9 A;  1ROD A;  2SDF A;  2VXW A;  3N52 A;  1NAP A;  1ICW A;  1NCV A;  1NR2 A;  1MGS A;  1RHP A;  2HDM A;  4LMQ D;  1WD1 A;  1HFN A;  1AZP A;  1ML0 D;  3IFD A;  4IUP A;  4CJ1 B;  1HHV A;  3DEP A;  1DOK A;  2N55 A;  1B4O A;  2B2W A;  2NZ1 D;  3G7L A;  1RTN A;  2FHT A;  2Q8R E;  1DOL A;  1ZXT A;  1XX8 A;  1B53 A;  2J7Z A;  1G91 A;  1CM9 A;  1QNK A;  4XT1 B;  2B2V C;  2JYO A;  3HP3 A;  3GV3 A;  4MN3 A;  1HA6 A;  4ZKC B;  1DON A;  2RA4 A;  1PFN A;  4HSV A;  1B3A A;  2K1B A;  5AFW A;  2B2U A;  1MSG A;  1RJT A;  1WTP A;  1KNE A;  3ONA B;  1XYI A;  3D6W A;  2XIW A;  1ILQ A;  4IUR A;  5EPK A;  4HED A;  1QG7 A;  5EKI A;  2B2V A;  4U68 A;  2DY8 A;  1SAP A;  3SVM A;  1B50 A;  2H1E A;  2R3Z A;  1KNA A;  5JJZ A;  4DN4 M;  2KEE A;  1RTO A;  2HCI A;  4ZKB B;  3F2U A;  4X3S A;  1AZQ A;  1WTQ A;  1PDQ A;  1SDF A;  1WTX A;  3H91 A;  1U4R A;  4X3U A;  2X6G A;  3TN2 A;  1WTW A;  4CJ0 B;  1JIC A;  2L9H A;  3I3C A;  3R93 A;  4ZK9 B;  4MHE A;  2RVL A;  2Q8T A;  1J9O A;  1SSO A;  1J8I A;  1S4Z A;  1TVX A;  1G2S A;  1G2T A;  1CA5 A;  1X32 A;  4ZAI A;  1B2T A;  1G6Z A;  4RA8 A;  4UAI A;  1AP0 A;  4QUC A;  1IL8 A;  1PLF A;  5T1G A;  2CVR A;  1PFB A;  3IL8 A;  1WVL A;  1BF4 A;  1X3Q A;  2B2Y C;  2FJ2 A;  2K01 A;  5E4X A;  1JE4 A;  4HCS A;  1WTR A;  3UI2 A;  1F9Q A;  1U4L A;  1C8C A;  1O7Z A;  2FFK B;  1X3P A;  1BO0 A;  5CMD A;  2FMM A;  4O42 A;  2JP1 A;  2X69 A;  5EPL A;  2L11 A;  1U4P A;  1O80 A;  1WTV A;  4X3K A;  1ILP A;  4CJ2 C;  1EOT A;  3I90 A;  4IUV A;  4XT3 B;  4IUT A;  5D14 A;  2B2T C;  3MWY W;  1EIG A;  2MPM A;  2HCC A;  4QUF A;  2L1B A;  1HFG A;  1HUM A;  2NYZ D;  2FIN B;  2K04 A;  2N88 A;  2EE1 A;  1NR4 A;  2IL8 A;  2NWG A;  3Q6S A;  3I8Z A;  5EJW A;  2EOT A;  3GV6 A;  1HRJ A;  1BNZ A;  2M2L A;  1CA6 A;  2B2T A;  4RAU C;  5E4W C;  2KOL A;  2KEC A;  1QE6 A;  2MJ8 A;  2RSO A;  3DM1 A;  4XDX A;  3TZD A;  3LWE A;  2KED A;  5CBE E;  4R9W A;  1IKL A; 
#chains in the Genus database with same CATH topology
 3D31 A;  1M90 C;  3C1E A;  4HCE A;  2WB1 E;  3KK7 A;  4GKJ L;  4YWK A;  3A8I E;  2A5H A;  2N3S A;  1DOM A;  5C3X A;  3CRK C;  4IPH A;  1Z7T A;  1II3 A;  4ME3 A;  1ENA A;  1EYG A;  3CCQ A;  2O2L D;  4XXE A;  1IBL Q;  3HOX H;  1PTO B;  1CI3 M;  3LWU A;  5D3D A;  4Y52 H;  5C0X G;  2AUJ D;  1LO5 D;  2VUM B;  3S1Q H;  4A3F H;  4BBR B;  3OYY A;  4A3B H;  1U5K A;  1UAP A;  4RWS C;  1VQ8 A;  1TWA H;  1MI2 A;  1LT3 D;  1SNQ A;  4LF4 Q;  2L55 A;  4R4I A;  4JBM A;  2D0P A;  3D0F A;  4DV3 L;  1AZP A;  3L3O C;  3GTL H;  5IIF A;  3UE0 A;  5IGB A;  4K5V A;  3URY A;  1N33 Q;  3GTQ H;  2A8V A;  2J7Z A;  4KKT A;  3AQQ A;  4RHS A;  4LNQ A;  4C3I B;  1Q90 A;  2B2U A;  2VQE L;  4A3J G;  2TMP A;  1EUJ A;  4XQQ A;  4AH6 A;  3S2H H;  3HKS A;  1B50 A;  4B3M Q;  4GZY C;  2ZM6 Q;  4ZKB B;  1WTQ A;  2XGT A;  4YWM A;  2E5L L;  2BH2 A;  3HOW H;  1G51 A;  4DV4 L;  1SSO A;  3R2I A;  1YNJ C;  2WAQ G;  1B2T A;  1XNR Q;  1D6E C;  3PUY A;  3OHX C;  3BYY B;  2R93 G;  1LUZ A;  4DV2 L;  4Y7N H;  3OOC A;  1WI5 A;  3S17 H;  4A3M G;  3FVQ A;  1ENF A;  1C8C A;  2WV6 D;  2CQA A;  4LUV A;  1EY9 A;  2F0O A;  2F0I A;  5EAY A;  4GS3 A;  2OF1 A;  1I50 B;  4IUV A;  2A6E C;  5D14 A;  2ES2 A;  5IWA Q;  2EYL A;  1EIG A;  1H9K A;  1NSN S;  4B3T Q;  3K81 C;  4QCL A;  1MJE A;  1LTG D;  3AB9 A;  3U58 A;  1KL9 A;  1SJH D;  2MJ8 A;  5CV6 A;  1QE6 A;  3K6O A;  2VW9 A;  5C44 G;  3CCL A;  1RD9 D;  4XYQ A;  1DZ1 A;  1CTM A;  5EKL A;  1OXV A;  3I4M B;  1C0A A;  1PFM A;  3OTO Q;  2J0T D;  3QO2 A;  1UE5 A;  4ZYS A;  4BS9 A;  1Q1E A;  5M5X H;  4N8F A;  3G6E A;  4LF5 Q;  3CD6 A;  1MSH A;  1HNZ Q;  2GA4 B;  3OIP A;  2RF4 A;  3SK5 A;  1VQK A;  1QB5 D;  2NN6 H;  3FDT A;  2RDH A;  4GOP C;  3DWA A;  3J7A 5;  4X66 L;  3NEN A;  3I4N B;  2ID0 A;  2ZXR A;  1QJO A;  2EYM A;  2L4N A;  2DJG C;  2HDL A;  4IO9 A;  3I70 A;  5BN5 A;  2R92 H;  1QUQ B;  1ONL A;  2N49 A;  1MGS A;  3K8A A;  4HIO A;  3IFD A;  3UDX A;  4DV7 L;  3EQL C;  3KOJ A;  5IY0 A;  4OX9 L;  3CW2 C;  4ZCK A;  2KJX A;  4HSV A;  5JEA H;  3E3X A;  2N78 A;  5AFW A;  4QJF A;  1VF7 A;  1KNE A;  3EJI A;  1XYI A;  3MXU A;  1A63 A;  2L5T A;  5IGC A;  5FLM G;  1S5D D;  3A54 A;  5KYI A;  1RDP D;  4U67 3;  2DJF C;  4X3S A;  1EQR A;  4FF2 A;  2X6G A;  4OXP A;  3J80 E;  5FO9 B;  4POF A;  4CBV A;  1TVX A;  1G2S A;  1Q46 A;  3AMU A;  1IL8 A;  5EKK A;  2PMZ B;  3QG1 A;  4B3R Q;  1W6K A;  1X55 A;  4HCS A;  5J1Z A;  4DA2 A;  2A19 A;  4F8M A;  5GAD C;  2JEA I;  1SN8 A;  5AJ3 Q;  2F3W A;  2FFK B;  2OT2 A;  3I4O A;  2X69 A;  4IFD I;  3U9S A;  4X3K A;  1ILP A;  3JAM L;  2VY3 A;  3AYH B;  3RMH A;  3EN2 A;  4A3D B;  3GTG B;  2UUC L;  4C2M H;  3GDE A;  4CKE A;  3UE1 A;  3W1B A;  4RMF A;  2QF7 A;  1DXM A;  1H9S B;  3VA5 A;  4C3J G;  2PI2 A;  3OWF A;  4JI7 Q;  2EDG A;  1EL0 A;  5CBA E;  1K28 A;  2OQK A;  3HOY G;  3P7J A;  2HT1 A;  2IWH A;  1F9R A;  4K2K A;  4X62 L;  2R7F A;  5G3L F;  4FVM A;  1IBK Q;  3M7N A;  2PZT A;  5I9O A;  2MNA A;  1HNW L;  3GTK H;  5FLX c;  2CH4 W;  1SR3 A;  1TU2 B;  2KVM A;  1HXY D;  3FKI G;  3Q22 A;  5LMN Q;  2JA8 H;  2NVT B;  1FNV A;  1Z47 A;  1VQO A;  4K8J A;  3WDN A;  3M3Y B;  3P75 A;  1HR0 L;  1D5X C;  4OO1 G;  4LF6 L;  4FF3 A;  1VDZ A;  1X65 A;  2PMZ E;  3VR6 A;  2CH4 A;  1Q86 C;  1Y8O B;  1JJC B;  4UP7 A;  1HHV A;  3ERQ A;  1JR0 D;  5J3B A;  4K8I A;  2OTJ A;  3ITP A;  1XX8 A;  1HZC A;  4NP5 A;  4LF7 Q;  1CUK A;  1IZ6 A;  3CPW A;  5HY6 A;  1MSG A;  3U9O A;  3CQZ B;  2F3V A;  4DV1 L;  3OSO A;  2NVQ H;  1TWC H;  4A93 B;  4P75 A;  4XTC S;  1Y8P B;  1B7Y B;  2K75 A;  3TP8 A;  5C3E B;  4GOP B;  1CZG A;  4JI1 Q;  3WWV A;  3BDL A;  2PNH A;  1QIL A;  3CC2 A;  1EY6 A;  4FF4 A;  5IP7 H;  5EGT A;  2JA5 H;  2A69 C;  1J9O A;  2Y0S G;  3K0Y A;  3RZO H;  4Q0F A;  1C7Y A;  3X3N A;  2BOS A;  2Z6K A;  4DR4 L;  2FJ2 A;  1WTR A;  4A3E G;  1AE2 A;  4A76 A;  3UI2 A;  1S5B D;  3T53 B;  3F8T A;  1YJW A;  1YNN D;  3DWP A;  3CCV A;  2HD3 A;  2JP1 A;  3SHL A;  2K5W A;  5EPL A;  4WJ3 M;  2DNE A;  1XTC D;  4JI8 L;  2KCM A;  4ZUJ A;  1EY7 A;  4XYO A;  3J81 L;  1D1K A;  1STA A;  1ET9 A;  4XIG S;  4C3H H;  2OTL A;  3HOZ G;  4CDC C;  4PZ8 A;  3NP8 A;  5IOC A;  3H6M A;  4G7O C;  1XMQ L;  4X64 L;  4HR7 B;  4XDX A;  3EFX D;  4EQP A;  5JVH 3;  2JQO A;  1VQD A;  4NW2 A;  1NY4 A;  3MTS A;  3NK9 A;  2XVS A;  1XMO Q;  4GKK Q;  2NVX B;  5DNF A;  2B2Y A;  3I91 A;  4C1N I;  5C4H A;  2YV5 A;  2EYJ A;  4AYB B;  1JB7 A;  1Y1V H;  3S1M B;  2VQF Q;  1NE3 A;  2F0V A;  1A6X A;  2LS0 1;  1A15 A;  3HOX G;  4HMJ A;  2XWJ B;  1K83 B;  1TWH H;  2E2H H;  1V1P B;  3G6J B;  3KUP A;  2AQ1 B;  2ENB A;  1PH1 A;  3RLO A;  1F2L A;  4DXG A;  1KC8 C;  3KF6 B;  1Q1B A;  2RDF A;  4A3B G;  5EBC A;  3L7Z C;  3S1N H;  2WAC A;  1RHP A;  4DR5 L;  1NMG A;  3HKZ G;  5FO7 B;  2LMC B;  3G7L A;  4GNX A;  3VDY A;  4UDU C;  1B53 A;  3PUX A;  1AE3 A;  3PIP 3;  1PFN A;  5BN3 A;  1TWF B;  2IX1 A;  2NTS A;  4X65 Q;  1D7Q A;  4AIM A;  1RTO A;  3TME A;  3I2Z A;  4DV0 L;  2F4V L;  1PDQ A;  3UDG A;  1KLG D;  4LFB Q;  3KFU A;  3HOW G;  3PO2 H;  2L9H A;  3KDF A;  4RHR A;  2Q8T A;  4JV5 L;  4IZ8 A;  5M3F H;  1ZYR C;  3A8J E;  1S5C D;  4BA1 I;  4AYB E;  2OXP A;  2B63 B;  3MHB A;  4B3S Q;  2KHJ A;  4FXD A;  1BQQ T;  3B6Y A;  3K7U C;  2BA0 A;  5HUR A;  4DUZ Q;  1FD7 D;  2HHH Q;  1PRT D;  3G71 A;  3NQI A;  1I94 Q;  1PHJ A;  1RCV D;  2F52 A;  3I90 A;  5M3M G;  1WTH A;  1A3T A;  2R93 B;  1GHK A;  5IT9 L;  3J7A V;  1XNQ L;  1N36 Q;  4DR6 Q;  2E76 C;  1KLU D;  1TY2 A;  3GV6 A;  4KHP Q;  4PNY A;  3ULP A;  1SFO H;  3TDQ A;  1K8G A;  4DAY B;  2DUD A;  2F3I A;  2F0E A;  4GKJ Q;  2EVB A;  4NMZ A;  1PH6 A;  5JAV A;  3QOL A;  1S72 A;  3U4V A;  1VQE A;  3R8B A;  1B70 B;  2IX3 A;  2K05 A;  2E2I B;  1YJN A;  4BY1 B;  2WIN B;  1G8Z D;  3KLS X;  4K2L A;  3TRE A;  4YY3 L;  2YU9 B;  1EIF A;  3STB C;  5H1S E;  4BY7 B;  1HZA A;  2Z0S A;  4BBS B;  2DY7 A;  1EQT A;  1PFS A;  3WOF A;  2NN6 G;  1V8Q A;  5CR3 A;  1CFM A;  3GTO B;  3ZJY C;  1K9M C;  1WJJ A;  4LF9 L;  1A3U A;  5KNB A;  2EYF A;  2F03 A;  5IOD A;  4WJ4 A;  4O1N A;  1LV9 A;  1UE7 A;  4YHH L;  4K0K L;  2F0F A;  4JI4 L;  2R92 G;  2Z8L A;  1HFN A;  3M4Y A;  5TSS A;  4KN7 C;  1XPO A;  3K7A H;  1BDO A;  4PMW A;  2BE5 C;  4QL5 A;  1Y1W H;  2UUB L;  1DON A;  1B3A A;  3PO3 G;  5JEA G;  1JT8 A;  1UEA B;  2XIW A;  4KMU C;  1PH4 A;  2B2V A;  5DEH A;  2C35 B;  2VL6 A;  1CT1 D;  1KNA A;  4A3C G;  4H7B A;  3J7A F;  4IFD H;  3OPO A;  3L2P A;  3F2U A;  5JOB A;  1SEB D;  2H4O A;  3NHH A;  2E5L Q;  3IFT A;  2JA6 G;  2LXK A;  4A3I G;  3S14 B;  3W5O A;  1OO9 B;  5A35 A;  4NXN L;  1A2U A;  3TEH B;  2UXD Q;  5IGD A;  4MIU A;  4P74 A;  1EZ8 A;  4CDF C;  2UUA L;  1AW7 A;  3BVG A;  2OCE A;  1MJC A;  1PFB A;  4YWL A;  1PTO H;  4HJ5 A;  3BZD B;  1F9Q A;  5FLX E;  1PZI D;  2FMM A;  2VUM H;  4KY7 A;  1N9W A;  4A3G B;  4JYA Q;  1MBY A;  4BBR H;  1O80 A;  3BDC A;  4CJ2 C;  4FNF A;  4RG1 A;  4APV A;  1HA5 A;  5IYC H;  3Q23 A;  4OEM B;  4JVZ A;  5IE8 A;  2FIN B;  3PIO 3;  3QR8 A;  2F0U A;  4WFN 3;  1NR4 A;  2NWG A;  4RCN A;  1NBW A;  3C1F A;  4JG2 A;  2KOL A;  1VQ7 A;  4DR2 L;  4L5R C;  4DR7 Q;  4C3I H;  1VMC A;  4UHV A;  5C3W A;  1GUO A;  4DUY Q;  3F2C A;  4IUU A;  2B3G A;  2RHQ B;  1JB3 A;  5D65 A;  1FNW A;  4H13 C;  2L12 A;  4NXM Q;  1SLJ A;  1H9J A;  4KHZ A;  1MHW C;  4LUZ A;  2QDB A;  2B2U C;  2KEN A;  2VB2 X;  1KTK A;  1E0B A;  1B9M A;  1AN8 A;  3FEW X;  1YJ9 A;  3A7L A;  1STG A;  4BWG B;  3NBI A;  3HOY B;  4RH6 A;  1VQA A;  5KGU A;  1A62 A;  4CKC A;  4M8A A;  1I4H A;  5M5W B;  2UXC Q;  1DCZ A;  3DEO A;  2QEX A;  2X6L A;  4F7X A;  2B2W C;  5T1I A;  1WCM G;  4OEL B;  1X9N A;  1DYQ A;  1SRO A;  3H3V C;  1NR2 A;  1EFI D;  2IHE A;  1EFW A;  3AU7 A;  4O2D A;  1G6P A;  2NZ1 D;  4JBW A;  4K6L A;  1VQ5 A;  2Q2H A;  1I50 H;  2XWB B;  1AEX A;  2O5J C;  2N8N A;  4XT1 B;  4RGN A;  5LL6 X;  1PA6 A;  3TZU A;  5HGQ A;  3DM3 A;  1B3Q A;  3SR1 A;  1W2B A;  1TR5 A;  1E24 A;  1YEZ A;  3CCJ A;  1IXR A;  3S1R B;  3PIO A;  2ZXP A;  2AHO B;  2KCN A;  5C5L A;  2ALY B;  1SRU A;  4IQZ A;  3CCS A;  1SYB A;  3I4M H;  1JWU D;  1JMC A;  3H91 A;  1U4R A;  2Z6B A;  3D4W A;  4L5Q A;  5D3I B;  3G4S A;  1IYU A;  3A0J A;  1H95 A;  1K3R A;  1SXT A;  2G5D A;  5IP7 G;  3J80 L;  1JJG A;  1PH5 A;  1E3P A;  3GTJ B;  2K5V A;  2IJ0 A;  5BN4 A;  1I6H B;  1VQP A;  1S5E D;  1JE4 A;  4JW0 A;  2NB0 A;  2OWO A;  1SYG A;  1SYE A;  4KK7 A;  5I6W A;  3I4N H;  2QGQ A;  4JI5 L;  1MIU A;  4IUT A;  2B2T C;  2AMC B;  4DAM A;  4A3E B;  4KY6 A;  4R8N A;  2WFW A;  4C3H G;  1JOO A;  3Q6S A;  3W2D A;  5J39 A;  4LF8 L;  5IYB H;  2Z4I A;  1LAC A;  3PSI A;  3H15 A;  1JOQ A;  2A6H D;  2FXQ A;  4UPA A;  3IKJ A;  4L6T B;  3H0G B;  2K33 A;  3K59 A;  4J8Q A;  1QWY A;  3K0X A;  1QUQ A;  4KLK A;  4PMC A;  3RR5 A;  1WYD A;  2A6H C;  4KJN A;  1R4Q B;  2JA7 B;  1L0W A;  1VQB A;  1VQH A;  2F0M A;  2F0L A;  1SMX A;  1Q3L A;  4XQN A;  2MP1 A;  1T5X D;  2O4X A;  1R9T B;  2Z4H A;  4IUN A;  3PMF A;  1BOS A;  3L0O A;  1HR0 Q;  1W6J A;  4QB4 A;  4JI2 L;  1CHQ D;  1PH7 A;  2K50 A;  1MKH A;  4HTH A;  5COR A;  5C5M A;  1KDA A;  1VQ4 A;  3HOV G;  4R4C A;  1HCZ A;  1YHB A;  4GN5 A;  4QGU A;  1LTT D;  3W3A A;  1IHZ A;  2AWN A;  1KRT A;  4NPS A;  3V2T A;  1G29 1;  1SE8 A;  3HP3 A;  4JOI C;  1TQO A;  3GV3 A;  2ATW A;  1PRT F;  4ZKC B;  4A3D H;  3J7Y W;  1UE1 A;  1ZEQ X;  2IX0 A;  3GTG H;  5BR8 L;  3K5M A;  2L15 A;  3A5U A;  2K5Q A;  1N34 L;  2DY8 A;  2IPK D;  3S2D B;  4LAA A;  1EYC A;  3TP6 A;  4HIM A;  4DR1 L;  3PF5 A;  3T1Y L;  2E2J B;  4X3U A;  3HG9 A;  3TN2 A;  4RCO A;  2I5L X;  1LM0 A;  3N6R A;  1K8M A;  4JI0 L;  3SEB A;  5M3F G;  4ZAI A;  1H9S A;  1RKN A;  3ERS X;  3QOJ A;  1EEI D;  4DR4 Q;  3K57 A;  1HNX L;  1FGB D;  2RQX A;  4OON A;  1LT5 D;  2AWO A;  2NVT H;  3S9W A;  3BZK A;  1LT6 D;  4DF7 A;  5CC4 A;  3M3Y H;  2R7Z G;  4OHJ A;  1FL0 A;  2WKC A;  3MFY A;  4XT3 B;  2RDG A;  5DAU A;  3VYU A;  1KDC A;  3CP0 A;  1IYJ B;  1OXT A;  2I07 B;  5L37 A;  5ELN A;  3DMU A;  4OL7 A;  5JJK A;  1Q8K A;  3SE0 A;  2HQE A;  5GQO A;  1M1K C;  5M3M B;  3NBH B;  2WB1 G;  2CFM A;  5E3F A;  4I7Z C;  1FJG L;  5KNC A;  3CQZ H;  2RSN A;  4IPD A;  1WTO A;  1C48 A;  4HID A;  4A93 H;  2MO0 A;  4G4K A;  1A8V A;  5C3E H;  1OXX K;  1WD0 A;  2O5I C;  1K8O A;  1HPC A;  3QIA A;  4G7Z C;  5CV7 A;  4A4I A;  3Q8D A;  1GHJ A;  2PNR C;  4EX5 A;  2LFN A;  3IAY A;  2JEB I;  4B3M L;  2ZM6 L;  4GOP A;  5E7N A;  5IGF A;  3N52 A;  1GKH A;  4I65 A;  1BR9 A;  1VQG A;  4LMQ D;  1ML0 D;  1DOK A;  3RLN A;  5FKA C;  2Q8R E;  4PQX A;  4JI3 Q;  1EWH A;  2NTT A;  1Y1W G;  3PUW A;  5FJ8 H;  2D62 A;  3TSS A;  1XNR L;  3HS0 C;  1QOH A;  3RN5 A;  4IOA A;  1CKO A;  4AQY Q;  3MAQ A;  3T56 B;  3OWE B;  4LUO A;  5GAE C;  4K6D A;  1X56 A;  4DV0 Q;  4HJ7 A;  2F4V Q;  4WJW A;  3FPP A;  1BVS A;  3TQY A;  3JAM i;  3J81 j;  3K58 A;  3PO3 B;  3NWS A;  1X54 A;  3CMA A;  2NVX H;  5IWA L;  3HOU G;  4FF1 A;  2F0K A;  4B3T L;  4LJZ C;  2VZA A;  1S4Z A;  2PZU A;  3AEV A;  4OWX B;  1FVI A;  3P1H A;  3S1M H;  1X3Q A;  2B2Y C;  2SNS A;  2JA6 B;  3UDI A;  4K14 A;  4LW1 A;  3GD7 A;  1A3V A;  1K83 H;  4A3I B;  4K5X A;  2ZT9 C;  4N9P A;  2JXM B;  1LTA D;  3OTO L;  1X3G A;  1RIP A;  2VUM G;  1YZ6 A;  2UU9 Q;  1EOT A;  4KHV A;  4JCV E;  2KCT A;  2Q2U A;  3DHQ A;  3VYR A;  5IYC G;  2SEB D;  1HUM A;  3AFQ A;  2PQA B;  1J6Q A;  1NUC A;  1V1P A;  5C0X J;  2EOT A;  1PH2 A;  2M2L A;  1T9H A;  4B08 A;  1JOK A;  1M4V A;  2F0Q A;  3KF6 A;  1O7L A;  1IBM L;  2VS1 A;  4JPB W;  4GNX C;  4R4O A;  3C2P A;  1TWF H;  3E0J A;  1F2Z A;  3CME A;  3K5L A;  3D3R A;  4FXG C;  1IKM A;  1EQQ A;  5C4X G;  5C6A A;  5I2Y A;  2ZTE A;  2D0O A;  5I6Y A;  1M8A A;  1YNN C;  2KCC A;  2G9H D;  3LNN A;  3TP7 A;  4WOR A;  3BG3 A;  1JJ2 A;  2EJM A;  3VR3 A;  3KF8 B;  4E6I A;  3RUZ A;  3CU7 A;  3Q24 A;  1PYW D;  3HFZ B;  3A8K E;  4S3S A;  4LF9 Q;  1EYD A;  4DR3 Q;  4A3K B;  4ODG A;  1EY0 A;  4R8I A;  3HEJ A;  3NEL A;  2B63 H;  2DN8 A;  1F9P A;  3GTP B;  4N9T A;  2CQO A;  2IW3 A;  1TII D;  2F0J A;  5LHY 1;  3DEP A;  3GP7 A;  1RTN A;  2FHT A;  2CWP A;  3IRB A;  4EQN A;  1ZXT A;  1QNK A;  2R93 H;  1WCM B;  2K5N A;  2F0H A;  1S5F D;  2BDO A;  4B3R L;  1STB A;  1A2T A;  1YI2 A;  1STY A;  3H3V I;  5AJ3 L;  5EKI A;  1L1O C;  4U68 A;  5A2Q E;  3VR5 A;  1A0I A;  4A3F G;  2K4K A;  4P72 A;  1VQN A;  3FRP B;  2NBF A;  1J5E Q;  2E8G A;  1WTX A;  3I4M G;  3J81 i;  1EU4 A;  2E2I H;  4BY1 H;  3I3C A;  3R93 A;  4MHE A;  5CV5 A;  1TS5 A;  1CA5 A;  2YU9 H;  1AP0 A;  3J7Z C;  2YTY A;  4DV5 Q;  4DAY A;  4BY7 H;  2KQ3 A;  3IL8 A;  4BBS H;  4KN4 C;  1PZJ D;  5E4X A;  4DNT B;  3BDO A;  4DAV A;  4DV6 Q;  2QDL A;  1BCP D;  3GTO H;  5FLX L;  2NVY B;  2D2C C;  3C3L A;  1B9N A;  3I4N G;  1U4P A;  2F0D A;  3PGZ A;  4QQB X;  1C4Q A;  1SJE D;  4I7A A;  1TXY A;  5LMN W;  5I4D A;  1HFG A;  3I4L A;  4A3J B;  3OW7 A;  1BBU A;  5IGE A;  2RCF A;  1Q7Y C;  3KLS A;  2E74 C;  5LMN L;  1SND A;  3NWT A;  5IYB G;  2XN9 C;  2CW0 D;  3I72 A;  1QVF A;  4KV6 A;  5K5P A;  4BXX H;  2IY5 B;  4RKL A;  1IKL A;  2NZH A;  4LWC A;  2WII B;  1SE2 A;  2JK8 A;  2MGS A;  2JN4 A;  3S16 B;  1V1Q A;  4H0L C;  2WAQ B;  4L63 B;  1LTL A;  2EZV A;  2K03 A;  2R6G A;  4ME5 A;  3S14 H;  3V05 A;  1EZ6 A;  3OMC A;  1PRT C;  1SNP A;  3OMG A;  4IPC A;  1KD1 C;  4LF7 L;  4A3M B;  3VYT A;  1EIY B;  4LFA Q;  4DK1 A;  2K7V A;  1KAW A;  5FLM H;  3KLR A;  2M00 A;  3T13 A;  1GXD C;  4X3T A;  1VMP A;  2VXW A;  2MHV A;  2HDM A;  5DLQ E;  1AFP A;  3TBI B;  2EYO A;  5IP9 H;  3PIP A;  3ND9 A;  2Z1C A;  3K80 C;  4A3G H;  3E5S A;  1HJP A;  4ID6 A;  4HJ9 A;  2LY7 A;  3NPP A;  3U50 C;  1DOL A;  2WKD A;  5C44 B;  1LTS D;  3GO5 A;  3D6C A;  2E2D C;  2AUK A;  1PTO D;  1N32 L;  4L8J A;  4P73 A;  3PV0 A;  3HOV B;  1GM5 A;  1ILQ A;  2F4I A;  2TSS A;  1CK1 A;  4H02 A;  4DK0 A;  1PTO C;  4CKB A;  3C46 A;  2PW7 A;  3SK6 A;  3TRZ A;  1LAB A;  1Q81 C;  4DV3 Q;  2EY2 A;  1I4X A;  1SE4 A;  1KDB A;  4X6A H;  4NB3 A;  3O13 A;  2ZTD A;  2HQL A;  1B44 D;  3R2T A;  4RA8 A;  1ASY A;  2EJF C;  2WAQ E;  3SK4 A;  1Y69 U;  2VQE Q;  4LFC L;  1WVL A;  1CHP D;  5CV8 A;  1STN A;  1R4P B;  3HOY H;  4MTK A;  1U4L A;  1TT2 A;  4CHT B;  1TS4 A;  1UWV A;  4B9W A;  1LT4 D;  5M5W H;  1EU3 A;  1CKN B;  1XMO L;  2K5H A;  1KAA A;  2EY1 A;  2PYK A;  3MXP A;  1EWI A;  2XSC A;  4YCV A;  2NYZ D;  1NTG A;  3VR4 A;  4DV4 Q;  2VQF L;  1L1O B;  2K14 A;  1XXG A;  2EE1 A;  4LF8 Q;  4UY8 C;  1HRJ A;  3D4D A;  4RGT A;  5E4W C;  4DV2 Q;  2R7Z B;  1HTL D;  3DM1 A;  5KIX A;  3KJO A;  1ZKO A;  2ZTC A;  3NQT A;  1L0X B;  5ELD A;  1KRS A;  3I55 A;  3RN2 A;  1EIH A;  4A3L H;  1PYS B;  5CV9 A;  5JPM C;  3CCR A;  3P20 A;  3SGI A;  3S1R H;  5KND A;  4B9X A;  3KLW A;  4A93 G;  3E9I A;  1I5F A;  1I4G A;  3RZD B;  1YIT A;  1ASZ A;  5E1F A;  4F88 A;  3NEM A;  5EQ0 A;  1HZ9 A;  1U9R A;  3MVV A;  1PVO A;  1K3B C;  5IGG A;  1I4R A;  2EPB A;  3A74 A;  3PUV A;  4QMG A;  4ZLT F;  3Q0A A;  3ICE A;  1JWM D;  3GTJ H;  2PPB C;  1V1O A;  1I6H H;  1S40 A;  4X65 L;  1LTR D;  3F2B A;  1O78 A;  4GLV B;  3MFG A;  1NAP A;  1ICW A;  4GLX A;  1GUG A;  3CPF A;  2H5X A;  2SNM A;  5M5Y H;  3BVM A;  4LFB L;  3BVZ A;  2ZJP A;  4C3J B;  2PQE A;  1RF2 D;  5C0X I;  5FJ8 G;  4A3E H;  5BR8 Q;  2JA8 G;  4X66 Q;  4O0A A;  3CCM A;  1YHA A;  2EYH A;  2ICE C;  4WRD A;  4IUR A;  2UXB L;  2EIF A;  2Q2T A;  3MXN B;  1PRT B;  5JJZ A;  4DUZ L;  1VQM A;  2A68 D;  2HCI A;  3H0G H;  1I3Q B;  2HHH L;  1Z9F A;  1D2B A;  4IOC A;  1I94 L;  2JJQ A;  4DV7 Q;  3FKI B;  5C4Z A;  4PZ6 A;  1WTW A;  4OX9 Q;  2RBM A;  2JA7 H;  2DNC A;  4DR6 L;  1SNM A;  4AYB G;  1DD2 A;  4UAI A;  4ALP A;  1SMY D;  4KHP L;  1E1O A;  2XTI A;  2K01 A;  3ULL A;  1R9T H;  3KBG A;  1EEF D;  1SMY C;  2AKW B;  3HOU B;  5K36 H;  4FDB A;  2L11 A;  3GTM B;  2A73 B;  4MZ9 A;  1WTV A;  3CCU A;  4HIK A;  2QCP X;  2K5D A;  2KHS A;  3T1H L;  1CSP A;  2JA5 G;  3CCE A;  2IHF A;  4L5S A;  3VR2 A;  3T4A C;  1IW7 D;  1STH A;  3FHW A;  4DXF A;  1FJG Q;  4OIJ A;  3KBX A;  3MC0 B;  4POG A;  1BBW A;  1IW7 C;  4QY7 A;  3DWQ A;  1I4P A;  3DUZ A;  3BJU A;  3ULJ A;  5M5Y B;  4ILW A;  3T16 A;  5C4J B;  2Y0S B;  2OQ0 A;  3S2D H;  1TWG B;  1KQS A;  5COY A;  3FPU B;  3K5N A;  2G9D A;  5KYL A;  1GUW A;  1E22 A;  2E2J H;  5HGT A;  2UUC Q;  3QJY A;  3JAM c;  1UEB A;  5EPJ A;  4DNI A;  1ESF A;  3I7F A;  1ET6 A;  1F2M A;  4OIK A;  4Q5V A;  1XJV A;  2MUY A;  4IJH A;  5F2D A;  5C4X B;  3H3V H;  3E0E A;  2B63 G;  4P71 A;  4EQ5 A;  4DU9 A;  4X62 Q;  4EGV A;  5DM6 3;  1BUV T;  1ROD A;  1QNU A;  4NKL A;  1YNJ D;  1NCV A;  2NZO A;  5FK9 C;  3HOZ B;  1Q82 C;  1CZW A;  1HNW Q;  4DPG A;  4FYD A;  4YCU A;  1U0L A;  1E2V A;  2B2W A;  1CQV A;  4KTA A;  1BCP F;  3J80 i;  2IT1 A;  2YTV A;  4FO2 A;  1Y1V G;  3M4O B;  2UXD L;  1E1T A;  1V9P A;  2I5H A;  4OWT B;  4GLA C;  2CWA A;  2NUC A;  4GN4 B;  4KKS A;  4J15 A;  2A6E D;  4HED A;  1QG7 A;  3ER0 A;  1HQR D;  4EVO A;  1P16 A;  4LF6 Q;  1CQF A;  1H9M A;  2H1E A;  1GO3 E;  5M3M H;  4JYA L;  4H44 C;  4N8X 1;  3MXG A;  5JJI A;  2EXZ A;  1VQL A;  3HOX B;  3RD4 A;  3QWN A;  2HIX A;  4BY1 G;  2RVL A;  3A7A B;  4TVA B;  2F0G A;  3S1Q B;  4A3F B;  2Y0S E;  5T1G A;  3CC7 A;  4A3B B;  3NBH A;  4BY7 G;  3ND8 A;  2R61 A;  4BBS G;  3MA2 B;  1TWA B;  4DV1 Q;  4KKU A;  4DR7 L;  2MFI A;  1X3P A;  3HKZ B;  4DUY L;  1P8L A;  3GTL B;  3TS2 A;  4NXM L;  4JI6 L;  5NUC A;  2F0N A;  3BYT B;  1GUN A;  3GTQ B;  3M9B A;  3RLF A;  4DNR B;  3R3O A;  1B1Z A;  4QUF A;  1TS3 A;  3PO2 G;  3K5O A;  2IL8 A;  2GN5 A;  2WP8 J;  3S2H B;  2B2T A;  3UDF A;  1EY4 A;  3LWE A;  1IBM Q;  1X6O A;  1L2F A;  1SNO A;  1JC7 A;  5CBE E;  2YYZ A;  1HH2 P;  4BXX G;  2UXC L;  3VYS A;  5LMU L;  4EQO A;  3HOW B;  1VQ6 A;  1PTO F;  1O7I A;  4JI8 Q;  4ABN A;  4QF4 A;  4CGY B;  1HUN A;  3NSW A;  1EY8 A;  1YVC A;  2B29 A;  1H9R A;  2OEO A;  4IN3 A;  4OWW B;  2D9U A;  1E2W A;  5JEA J;  3PO3 H;  4Y7N B;  1IBL L;  3KJP A;  3S17 B;  1XMQ Q;  2RKS A;  3E9H A;  4X64 Q;  4CDD C;  3J81 c;  1O7Y A;  4QIW B;  4P2C B;  1JOR A;  5FOB B;  2ASB A;  1GUS A;  4A3C H;  1EOV A;  5ELB A;  2EY6 A;  3G48 A;  1PMR A;  2JA6 H;  4DGZ A;  2BDN A;  2RCN A;  4A3I H;  1STE A;  3A56 A;  4LF4 L;  1WD1 A;  5IP9 G;  4CJ1 B;  4IUP A;  4NDX A;  1B4O A;  3EVQ A;  1XPR A;  4A3G G;  3HKZ E;  1AH9 A;  1G91 A;  1N33 L;  3M85 A;  2JYO A;  1EWC A;  3S24 A;  1V43 A;  2I46 A;  4K5W A;  2RA4 A;  5ELC A;  3CF5 A;  3TS0 A;  2EXD A;  3I73 A;  4OO1 I;  1TY0 A;  1BXT A;  4JBJ A;  4JOI A;  1SAP A;  5A2Q L;  5M5X B;  4DKA C;  2R3Z A;  2HIV A;  1E2Z A;  3A5Z B;  4HMI A;  1YBY A;  5ISR A;  2PZW A;  4V19 0;  3M4Q A;  4DR5 Q;  1SDF A;  4MTN A;  1XWE A;  4JBK A;  2PQA A;  2SOB A;  2Z6K C;  2FMC A;  3M7G A;  3MEH A;  4ZK9 B;  3PUZ A;  1EYA A;  1X32 A;  2JE6 I;  5JPN C;  1G6Z A;  1GJX A;  4XQJ A;  1IL2 A;  1K8A C;  4YCW A;  1GOZ A;  4HJ8 A;  1SNC A;  2ZJQ A;  5IYD H;  3CKI B;  2QA4 A;  2R92 B;  5CMD A;  3EBE A;  4A3K H;  2Q8I B;  1DM0 B;  2ZXO A;  4QIW E;  4F87 A;  2Q2I A;  4IFD G;  1CSQ A;  5CV4 A;  4DK3 C;  3GTP H;  1GUT A;  2LKV A;  3MWY W;  4IAL A;  3H94 A;  3S15 H;  3KF8 A;  1HQM C;  3HZX A;  2QEJ C;  2P5Z X;  4JV5 Q;  2BH8 A;  5DM7 3;  1W3S A;  5EJW A;  2K32 A;  2V1C C;  1HR0 W;  3W1G A;  1D5Z C;  3CC4 A;  4RAU C;  2LSS A;  2E75 C;  1SBB B;  2PCF B;  1GVP A;  1WCM H;  2BA1 A;  2CKZ B;  1Q12 A;  2I0Q A;  1QZG A;  1VF5 C;  4A3L G;  2KUM A;  2RHS B;  4IPG A;  1ESR A;  3EIV A;  4BBR G;  1SE3 A;  1WOC A;  3WOE A;  4TQU S;  1XNQ Q;  1RL2 A;  4LF5 L;  1HNZ L;  2CCZ A;  5J22 A;  3X3M A;  2HUG A;  5C0X H;  1D1I A;  3OIQ A;  4HAE A;  5IT9 c;  2QW7 A;  1PV4 A;  1EQV A;  4DFA A;  3D8G A;  4C3I G;  4IUQ A;  1OXU A;  2A69 D;  4R1J A;  3GQB A;  2XNA C;  1PXU A;  2QKI C;  2NVY H;  4YY3 Q;  1VQC A;  2N55 A;  3LGJ A;  4DK6 C;  4C2M B;  4MNO A;  5ELO A;  4IJL A;  1N32 Q;  1CM9 A;  1QCB D;  4HN7 A;  3V96 A;  3PF4 A;  3H09 A;  2K1B A;  4A3J H;  4FXK C;  1WTP A;  3ONA B;  4ZUI A;  4R4T A;  4JK1 C;  4YHH Q;  1SYF A;  3GTK B;  3U4Z A;  4JI4 Q;  4K0K Q;  2LXJ A;  3H0G G;  5ELE A;  3S15 B;  2JA8 B;  1I6V C;  3KYH C;  3S16 H;  4CJ0 B;  1YIJ A;  2MQH A;  2JA7 G;  2UUB Q;  1UE6 A;  5JJL A;  3SDZ A;  4LFC Q;  1D5M C;  4QUC A;  4A75 A;  1E7Z A;  4UP9 A;  3BZC A;  4A3M H;  1PH3 A;  1PH8 A;  1QVG A;  5K36 G;  1PYB A;  1UNS A;  5CYU A;  4OGQ C;  3JAM E;  2KBN A;  4NXN Q;  3FP9 A;  2PI2 E;  2L1B A;  3F1Z A;  4RFB A;  2K04 A;  2UUA Q;  2F0S A;  1OTC A;  1LTI D;  3F2D A;  5C44 H;  2NVQ B;  2RSO A;  1TWC B;  3ERO A;  4ZQ3 A;  1HA6 A;  4JI7 L;  2KHI A;  1BKB A;  1JE5 A;  3HOV H;  1S3O A;  5GRO A;  1F2Y A;  3FMC A;  3ZYY X;  2JA5 B;  1B8A A;  1TKW B;  1VQJ A;  4G7H C;  4L5T A;  1BCP C;  1IBK L;  3RZO B;  5GAG C;  1YNX A;  1DGS A;  4JI3 L;  2I5M X;  3E6Z X;  3OW2 A;  4TRD A;  1BBX C;  2L0C A;  5I9P A;  2QIL A;  4DR2 Q;  4AQY L;  2EYP A;  1VS0 A;  3T51 B;  2ZJR A;  2SDF A;  1ZYR D;  2CW0 C;  4C3H B;  5GAH C;  2ICI A;  2XRS D;  1N8R C;  1ENC A;  1C9O A;  2JA9 A;  3D4R A;  3A55 A;  5LL6 S;  1Z6H A;  4HJA A;  2B2V C;  2NN6 I;  4MN3 A;  4RKB A;  2VNU D;  2UXB Q;  3VA7 A;  5M9O A;  3D6W A;  1EY5 A;  1DJR D;  1NNX A;  5EPK A;  5JVG 3;  2M9V A;  3L9A X;  3MZ5 A;  2R7Z H;  4FP5 D;  1CKN A;  1UUP A;  2K52 A;  1F77 A;  2KEE A;  1K0R A;  1T5E A;  1Y1V B;  1TS2 A;  5EBD A;  1Y8N B;  2UU9 L;  1L1O A;  1LYL A;  4JI1 L;  2B8G A;  2D5D A;  1TWH B;  3M4P A;  2E2H B;  1JCK B;  1XTD A;  1J8I A;  4PMB A;  1G2T A;  4GNX B;  1X3E A;  2A74 C;  4BA2 I;  1HTP A;  3RZD H;  4KJO A;  4KY5 A;  2CVR A;  4RGM A;  2B8F A;  4A3D G;  4Z9C B;  4GN3 B;  4UP8 A;  3S1N B;  4HSP A;  3STB D;  1NJI C;  1BO0 A;  4O42 A;  2EY5 A;  2A1A A;  3NUC A;  3TP5 A;  3BS1 A;  4KI0 A;  1HZB A;  2PW5 A;  3J81 E;  1FYC A;  2MPM A;  2HCC A;  3T1H Q;  1GD7 A;  3PCO B;  5FO8 B;  2N88 A;  2BCO A;  2EQS A;  4J1M A;  2YTX A;  1QZH A;  4C1N K;  3KDF B;  1CA6 A;  1K73 C;  4M1U B;  1QVC A;  2F0P A;  4C3J H;  3DLL A;  1FR3 A;  4DR3 L;  4R9W A;  1LTB D;  3J80 c;  2JSO A;  4YIJ A;  2V4D A;  1IYV A;  2B39 A;  5I2X A;  1U4M A;  3NTH A;  2F1M A;  2Z9H A;  3DXJ C;  1NMF A;  2BE5 D;  1Q8I A;  2F0T A;  3BU2 A;  4RGO S;  3PO2 B;  4JI5 Q;  1CKM A;  3LX0 A;  4TKO B;  2K28 A;  4GKK L;  2CHB D;  4KD4 A;  5M3F B;  3CRL C;  2R7D A;  1I3Q H;  1WFQ A;  1X3F A;  3FKI H;  3CXC A;  1KHI A;  3NTI A;  2VB3 X;  3AFP A;  3HGB A;  5KRU A;  3MXN A;  1KIX A;  4OO1 H;  4ULL A;  4ZRZ A;  1F9S A;  1YHQ A;  4IFD J;  1PH9 A;  1J5E L;  3HOU H;  3SK8 A;  3JC6 6;  1L0Y B;  3GTM H;  4G57 A;  3EA6 A;  1SFO B;  1MD2 D;  1D8L A;  1VCI A;  1FNU A;  3PQI A;  5C3E G;  2AQ2 B;  5G3L D;  2EJG C;  2WB1 B;  4DV5 L;  2DGY A;  1RJT A;  2J4X A;  1BCP B;  4JI2 Q;  2XRQ D;  4V0B A;  4DV6 L;  3SVM A;  3QB3 A;  1ICF B;  1LLR D;  3HRZ C;  4DN4 M;  4DAP A;  4PV1 C;  2AQ3 B;  1I4Q A;  1AZQ A;  5ELF A;  1VQF A;  2GVA A;  4C56 C;  4LK1 C;  2PO4 A;  1JWS D;  5KEE A;  1JIC A;  1SYD A;  3RNU A;  5C4J H;  3I56 A;  1TWG H;  3SXH A;  1SYC A;  1OXS C;  1PLF A;  1BF4 A;  3CHB D;  1Y14 B;  1N34 Q;  3NE5 B;  4B3S L;  1XPU A;  1O7Z A;  3NXW A;  5IYD G;  4PG3 A;  1JQY D;  4A3K G;  2K6A A;  4JC0 A;  5C4X H;  4JI6 Q;  3K7A B;  4DR1 Q;  1KAB A;  3T1Y Q;  4J6H A;  4CDE C;  2C9O A;  1Y1W B;  1PZK D;  5IT9 E;  1K0S A;  4KD3 A;  3HOZ H;  4JI0 Q;  2A68 C;  2KA7 A;  2MO1 A;  4PZ7 A;  3MEF A;  1N36 L;  1VQ9 A;  2F0W A;  3I8Z A;  1BNZ A;  1FGU A;  5CGK A;  1HNX Q;  2C5C A;  3NTK A;  2GVB A;  2KEC A;  3TZD A;  3M4O H;  4TSS A;  1VQI A;  4LFA L;  1KXL A;  4R4Q A;  2KED A;  3CAM A;  5LMU Q; 
#chains in the Genus database with same CATH homology
 3D31 A;  3C1E A;  4HCE A;  3KK7 A;  3A8I E;  2A5H A;  1DOM A;  5C3X A;  3CRK C;  1Z7T A;  1II3 A;  1ENA A;  2O2L D;  4XXE A;  1PTO B;  1CI3 M;  3LWU A;  5D3D A;  5C0X G;  2AUJ D;  1LO5 D;  2VUM B;  4BBR B;  1UAP A;  4RWS C;  1MI2 A;  1LT3 D;  1SNQ A;  2L55 A;  1AZP A;  3L3O C;  5IIF A;  5IGB A;  4K5V A;  3URY A;  2J7Z A;  4KKT A;  4RHS A;  4C3I B;  1Q90 A;  2B2U A;  2TMP A;  4XQQ A;  1B50 A;  4GZY C;  4ZKB B;  1WTQ A;  1SSO A;  3R2I A;  1YNJ C;  1B2T A;  1D6E C;  3PUY A;  3OHX C;  3BYY B;  3OOC A;  3FVQ A;  1ENF A;  1C8C A;  2WV6 D;  2CQA A;  1EY9 A;  2F0O A;  2F0I A;  2OF1 A;  1I50 B;  4IUV A;  2A6E C;  5D14 A;  2EYL A;  1EIG A;  1H9K A;  1NSN S;  4QCL A;  1LTG D;  3AB9 A;  1SJH D;  2MJ8 A;  5CV6 A;  1QE6 A;  3K6O A;  1RD9 D;  4XYQ A;  1DZ1 A;  1CTM A;  5EKL A;  1OXV A;  3I4M B;  1PFM A;  2J0T D;  3QO2 A;  4ZYS A;  4BS9 A;  1Q1E A;  1MSH A;  2GA4 B;  3OIP A;  3SK5 A;  1QB5 D;  2NN6 H;  3FDT A;  2RDH A;  3DWA A;  3I4N B;  2ID0 A;  2ZXR A;  1QJO A;  2EYM A;  2L4N A;  2HDL A;  3I70 A;  5BN5 A;  1ONL A;  1MGS A;  3IFD A;  3EQL C;  2KJX A;  4HSV A;  5JEA H;  5AFW A;  1VF7 A;  1KNE A;  3EJI A;  1XYI A;  3MXU A;  2L5T A;  5IGC A;  1S5D D;  3A54 A;  5KYI A;  1RDP D;  4U67 3;  4X3S A;  4FF2 A;  2X6G A;  3J80 E;  5FO9 B;  4CBV A;  1TVX A;  1G2S A;  3AMU A;  1IL8 A;  5EKK A;  2PMZ B;  3QG1 A;  1W6K A;  4HCS A;  5J1Z A;  4DA2 A;  4F8M A;  2JEA I;  2F3W A;  2FFK B;  2OT2 A;  2X69 A;  4IFD I;  3U9S A;  4X3K A;  1ILP A;  3JAM L;  3RMH A;  4A3D B;  3GTG B;  4CKE A;  2QF7 A;  1DXM A;  1H9S B;  3VA5 A;  4C3J G;  3OWF A;  1EL0 A;  2EDG A;  5CBA E;  3P7J A;  2IWH A;  1F9R A;  4K2K A;  5G3L F;  4FVM A;  3M7N A;  2PZT A;  5I9O A;  1TU2 B;  2KVM A;  1HXY D;  3Q22 A;  2NVT B;  1FNV A;  1Z47 A;  4K8J A;  3WDN A;  3M3Y B;  3P75 A;  1D5X C;  4OO1 G;  4FF3 A;  1VDZ A;  3VR6 A;  1Y8O B;  1HHV A;  3ERQ A;  1JR0 D;  4K8I A;  3ITP A;  1XX8 A;  4NP5 A;  1MSG A;  3U9O A;  3CQZ B;  2F3V A;  3OSO A;  4A93 B;  4XTC S;  1Y8P B;  3TP8 A;  5C3E B;  1CZG A;  3BDL A;  1QIL A;  1EY6 A;  4FF4 A;  5EGT A;  2A69 C;  1J9O A;  3K0Y A;  4Q0F A;  3X3N A;  2BOS A;  2FJ2 A;  1WTR A;  3UI2 A;  1S5B D;  3T53 B;  1YNN D;  3DWP A;  2JP1 A;  3SHL A;  2K5W A;  5EPL A;  2DNE A;  1XTC D;  4ZUJ A;  1EY7 A;  4XYO A;  3J81 L;  1D1K A;  1STA A;  1ET9 A;  4XIG S;  5IOC A;  3NP8 A;  3H6M A;  4G7O C;  4HR7 B;  4XDX A;  3EFX D;  4EQP A;  5JVH 3;  4NW2 A;  3MTS A;  3NK9 A;  2XVS A;  2NVX B;  5DNF A;  2B2Y A;  3I91 A;  4C1N I;  5C4H A;  2EYJ A;  4AYB B;  3S1M B;  2F0V A;  1A6X A;  2LS0 1;  1A15 A;  4HMJ A;  2XWJ B;  1K83 B;  1V1P B;  3G6J B;  3KUP A;  2AQ1 B;  2ENB A;  1F2L A;  4DXG A;  1Q1B A;  2RDF A;  5EBC A;  3L7Z C;  2WAC A;  1RHP A;  5FO7 B;  2LMC B;  3G7L A;  4UDU C;  1B53 A;  3PUX A;  3PIP 3;  1PFN A;  5BN3 A;  1TWF B;  2IX1 A;  2NTS A;  1RTO A;  3TME A;  1PDQ A;  1KLG D;  2L9H A;  4RHR A;  2Q8T A;  4IZ8 A;  1ZYR C;  3A8J E;  1S5C D;  4BA1 I;  2OXP A;  2B63 B;  3MHB A;  4FXD A;  1BQQ T;  2BA0 A;  5HUR A;  1FD7 D;  1PRT D;  3NQI A;  1RCV D;  3I90 A;  1A3T A;  2R93 B;  1GHK A;  5IT9 L;  3J7A V;  2E76 C;  1KLU D;  1TY2 A;  3GV6 A;  4PNY A;  3TDQ A;  2F0E A;  2EVB A;  4NMZ A;  5JAV A;  3QOL A;  3R8B A;  2IX3 A;  2K05 A;  2E2I B;  4BY1 B;  2WIN B;  1G8Z D;  3KLS X;  4K2L A;  2YU9 B;  4BY7 B;  4BBS B;  2DY7 A;  1EQT A;  3WOF A;  2NN6 G;  1V8Q A;  5CR3 A;  1CFM A;  3GTO B;  1A3U A;  5KNB A;  2EYF A;  2F03 A;  5IOD A;  4O1N A;  1LV9 A;  2F0F A;  2Z8L A;  1HFN A;  3M4Y A;  5TSS A;  4KN7 C;  1BDO A;  4PMW A;  2BE5 C;  1DON A;  1B3A A;  5JEA G;  1UEA B;  2XIW A;  4KMU C;  2B2V A;  5DEH A;  1CT1 D;  1KNA A;  4H7B A;  3J7A F;  4IFD H;  3OPO A;  3F2U A;  5JOB A;  1SEB D;  2H4O A;  3NHH A;  3IFT A;  3S14 B;  5A35 A;  1OO9 B;  1A2U A;  5IGD A;  4MIU A;  1EZ8 A;  1AW7 A;  3BVG A;  1PFB A;  1PTO H;  3BZD B;  1F9Q A;  5FLX E;  1PZI D;  2FMM A;  4KY7 A;  4A3G B;  1MBY A;  1O80 A;  3BDC A;  4CJ2 C;  4FNF A;  1HA5 A;  3Q23 A;  2FIN B;  3PIO 3;  2F0U A;  4WFN 3;  1NR4 A;  2NWG A;  4RCN A;  3C1F A;  2KOL A;  1VMC A;  5C3W A;  1GUO A;  4IUU A;  1JB3 A;  5D65 A;  1FNW A;  4H13 C;  2L12 A;  1H9J A;  4KHZ A;  2QDB A;  2B2U C;  2VB2 X;  1KTK A;  1E0B A;  1B9M A;  1AN8 A;  3FEW X;  3A7L A;  1STG A;  4BWG B;  3NBI A;  3HOY B;  4RH6 A;  5KGU A;  4CKC A;  4M8A A;  1I4H A;  5M5W B;  1DCZ A;  3DEO A;  2X6L A;  4F7X A;  2B2W C;  5T1I A;  1DYQ A;  3H3V C;  1NR2 A;  1EFI D;  3AU7 A;  2NZ1 D;  4JBW A;  4K6L A;  2XWB B;  1AEX A;  2O5J C;  4XT1 B;  4RGN A;  5LL6 X;  3TZU A;  3SR1 A;  1TR5 A;  3S1R B;  2ZXP A;  2KCN A;  5C5L A;  4IQZ A;  1SYB A;  1JWU D;  3H91 A;  1U4R A;  3D4W A;  5D3I B;  1IYU A;  1SXT A;  3J80 L;  3GTJ B;  2IJ0 A;  5BN4 A;  1I6H B;  1S5E D;  1JE4 A;  2NB0 A;  1SYG A;  1SYE A;  4KK7 A;  5I6W A;  4IUT A;  2B2T C;  4A3E B;  4KY6 A;  4R8N A;  4C3H G;  1JOO A;  3Q6S A;  3W2D A;  5J39 A;  2Z4I A;  1LAC A;  1JOQ A;  2A6H D;  3IKJ A;  4L6T B;  3H0G B;  2K33 A;  3K59 A;  4J8Q A;  1QWY A;  4PMC A;  2A6H C;  4KJN A;  1R4Q B;  2JA7 B;  2F0M A;  2F0L A;  1Q3L A;  4XQN A;  2MP1 A;  1T5X D;  2O4X A;  1R9T B;  2Z4H A;  4IUN A;  3PMF A;  1BOS A;  1W6J A;  4QB4 A;  1CHQ D;  4HTH A;  5COR A;  5C5M A;  1KDA A;  1HCZ A;  1LTT D;  3W3A A;  1IHZ A;  2AWN A;  3V2T A;  1G29 1;  3HP3 A;  1TQO A;  3GV3 A;  1PRT F;  4ZKC B;  3J7Y W;  1ZEQ X;  2IX0 A;  3K5M A;  2K5Q A;  2DY8 A;  2IPK D;  3S2D B;  4LAA A;  1EYC A;  3TP6 A;  2E2J B;  4X3U A;  3HG9 A;  3TN2 A;  4RCO A;  3N6R A;  1K8M A;  3SEB A;  4ZAI A;  1H9S A;  1RKN A;  3QOJ A;  1EEI D;  3K57 A;  1FGB D;  2RQX A;  1LT5 D;  2AWO A;  3S9W A;  1LT6 D;  4DF7 A;  5CC4 A;  4OHJ A;  2WKC A;  3MFY A;  4XT3 B;  2RDG A;  5DAU A;  3VYU A;  1KDC A;  1OXT A;  2I07 B;  3DMU A;  4OL7 A;  3SE0 A;  2HQE A;  5M3M B;  5E3F A;  4I7Z C;  5KNC A;  2RSN A;  1WTO A;  1C48 A;  4G4K A;  1OXX K;  1WD0 A;  2O5I C;  1K8O A;  1HPC A;  3QIA A;  4G7Z C;  5CV7 A;  1GHJ A;  2PNR C;  3IAY A;  2LFN A;  2JEB I;  5IGF A;  3N52 A;  4I65 A;  1BR9 A;  4LMQ D;  1ML0 D;  1DOK A;  5FKA C;  2Q8R E;  4PQX A;  1EWH A;  2NTT A;  3PUW A;  2D62 A;  3TSS A;  3HS0 C;  1QOH A;  3MAQ A;  3T56 B;  3OWE B;  4K6D A;  4WJW A;  3FPP A;  3K58 A;  3PO3 B;  3NWS A;  4FF1 A;  2F0K A;  4LJZ C;  1S4Z A;  2PZU A;  3P1H A;  1X3Q A;  2B2Y C;  2SNS A;  2JA6 B;  4K14 A;  3GD7 A;  1A3V A;  4A3I B;  4K5X A;  2ZT9 C;  4N9P A;  2JXM B;  1LTA D;  1EOT A;  4KHV A;  3DHQ A;  3VYR A;  2SEB D;  1HUM A;  1NUC A;  1V1P A;  5C0X J;  2EOT A;  2M2L A;  4B08 A;  1JOK A;  1M4V A;  2F0Q A;  1O7L A;  3C2P A;  3E0J A;  1F2Z A;  3K5L A;  3D3R A;  4FXG C;  1IKM A;  5C6A A;  5I2Y A;  5I6Y A;  1M8A A;  1YNN C;  2KCC A;  2G9H D;  3LNN A;  3TP7 A;  4WOR A;  3BG3 A;  2EJM A;  3VR3 A;  4E6I A;  3RUZ A;  3CU7 A;  3Q24 A;  1PYW D;  3A8K E;  4S3S A;  1EYD A;  4A3K B;  4ODG A;  1EY0 A;  4R8I A;  3HEJ A;  2DN8 A;  1F9P A;  3GTP B;  4N9T A;  2IW3 A;  1TII D;  2F0J A;  5LHY 1;  3DEP A;  3GP7 A;  1RTN A;  2FHT A;  4EQN A;  1ZXT A;  1QNK A;  1WCM B;  2F0H A;  1S5F D;  2BDO A;  1STB A;  1A2T A;  1STY A;  5EKI A;  4U68 A;  5A2Q E;  3VR5 A;  3FRP B;  2NBF A;  1WTX A;  1EU4 A;  3I3C A;  3R93 A;  4MHE A;  5CV5 A;  1TS5 A;  1CA5 A;  1AP0 A;  4DAY A;  2KQ3 A;  3IL8 A;  4KN4 C;  1PZJ D;  5E4X A;  4DNT B;  3BDO A;  4DAV A;  1BCP D;  5FLX L;  2NVY B;  2D2C C;  3C3L A;  1B9N A;  1U4P A;  2F0D A;  1C4Q A;  1SJE D;  5I4D A;  1HFG A;  3I4L A;  4A3J B;  3OW7 A;  5IGE A;  3KLS A;  2E74 C;  1SND A;  3NWT A;  2XN9 C;  2CW0 D;  3I72 A;  4KV6 A;  5K5P A;  4RKL A;  1IKL A;  2WII B;  1SE2 A;  2MGS A;  3S16 B;  4H0L C;  2WAQ B;  4L63 B;  2EZV A;  2K03 A;  2R6G A;  4ME5 A;  3V05 A;  1EZ6 A;  3OMC A;  1PRT C;  1SNP A;  3OMG A;  4A3M B;  3VYT A;  4DK1 A;  2K7V A;  3KLR A;  2M00 A;  3T13 A;  1GXD C;  4X3T A;  1VMP A;  2VXW A;  2MHV A;  2HDM A;  1AFP A;  3TBI B;  2EYO A;  3ND9 A;  2Z1C A;  3E5S A;  4ID6 A;  2LY7 A;  3NPP A;  1DOL A;  2WKD A;  5C44 B;  1LTS D;  3GO5 A;  3D6C A;  2E2D C;  2AUK A;  1PTO D;  4L8J A;  3PV0 A;  3HOV B;  1ILQ A;  2F4I A;  2TSS A;  1CK1 A;  4DK0 A;  1PTO C;  4CKB A;  3C46 A;  2PW7 A;  3SK6 A;  1LAB A;  2EY2 A;  1I4X A;  1SE4 A;  1KDB A;  3O13 A;  1B44 D;  3R2T A;  4RA8 A;  2EJF C;  3SK4 A;  1Y69 U;  1WVL A;  1CHP D;  5CV8 A;  1STN A;  1R4P B;  1U4L A;  1TT2 A;  4CHT B;  1TS4 A;  4B9W A;  1LT4 D;  1EU3 A;  1KAA A;  2EY1 A;  2PYK A;  3MXP A;  2XSC A;  2NYZ D;  3VR4 A;  1XXG A;  2EE1 A;  1HRJ A;  3D4D A;  4RGT A;  5E4W C;  2R7Z B;  1HTL D;  3DM1 A;  5KIX A;  1ZKO A;  3NQT A;  1L0X B;  5ELD A;  1EIH A;  5CV9 A;  5JPM C;  3P20 A;  5KND A;  4B9X A;  1I4G A;  3RZD B;  5E1F A;  4F88 A;  5EQ0 A;  1U9R A;  3MVV A;  5IGG A;  1I4R A;  2EPB A;  4QMG A;  3PUV A;  4ZLT F;  3Q0A A;  1JWM D;  2PPB C;  1V1O A;  1LTR D;  1O78 A;  3MFG A;  1NAP A;  1ICW A;  1GUG A;  2SNM A;  3BVM A;  3BVZ A;  4C3J B;  2PQE A;  1RF2 D;  5C0X I;  2EYH A;  2ICE C;  4WRD A;  4IUR A;  1PRT B;  5JJZ A;  2A68 D;  2HCI A;  1I3Q B;  1D2B A;  3FKI B;  5C4Z A;  1WTW A;  2RBM A;  2DNC A;  1SNM A;  1DD2 A;  4UAI A;  1SMY D;  2K01 A;  3KBG A;  1EEF D;  1SMY C;  3HOU B;  5K36 H;  3GTM B;  2L11 A;  2A73 B;  1WTV A;  2QCP X;  2K5D A;  2KHS A;  3VR2 A;  3T4A C;  1IW7 D;  1STH A;  4DXF A;  4OIJ A;  3KBX A;  3MC0 B;  1IW7 C;  3DWQ A;  1I4P A;  3DUZ A;  5M5Y B;  4ILW A;  3T16 A;  5C4J B;  2Y0S B;  1TWG B;  5COY A;  3FPU B;  3K5N A;  2G9D A;  5KYL A;  1GUW A;  5HGT A;  3QJY A;  5EPJ A;  1ESF A;  4OIK A;  1ET6 A;  1F2M A;  4Q5V A;  2MUY A;  5F2D A;  5C4X B;  5DM6 3;  4DU9 A;  4EGV A;  1BUV T;  1ROD A;  1QNU A;  4NKL A;  1YNJ D;  1NCV A;  5FK9 C;  3HOZ B;  1CZW A;  4FYD A;  1E2V A;  2B2W A;  1CQV A;  4KTA A;  1BCP F;  2IT1 A;  4FO2 A;  3M4O B;  2NUC A;  4KKS A;  2A6E D;  4HED A;  1QG7 A;  4EVO A;  1HQR D;  1CQF A;  1H9M A;  2H1E A;  4H44 C;  3MXG A;  2EXZ A;  3HOX B;  3RD4 A;  3QWN A;  2RVL A;  3A7A B;  2F0G A;  3S1Q B;  4A3F B;  5T1G A;  4A3B B;  3NBH A;  3ND8 A;  2R61 A;  3MA2 B;  1TWA B;  4KKU A;  1X3P A;  3HKZ B;  3GTL B;  5NUC A;  2F0N A;  3BYT B;  1GUN A;  3GTQ B;  3RLF A;  4DNR B;  3R3O A;  1B1Z A;  4QUF A;  1TS3 A;  3K5O A;  2IL8 A;  2WP8 J;  3S2H B;  2B2T A;  1EY4 A;  3LWE A;  5CBE E;  1JC7 A;  1SNO A;  2YYZ A;  3VYS A;  4EQO A;  3HOW B;  1PTO F;  4ABN A;  4QF4 A;  4CGY B;  1HUN A;  3NSW A;  1EY8 A;  1H9R A;  2OEO A;  4IN3 A;  2D9U A;  1E2W A;  5JEA J;  4Y7N B;  3S17 B;  2RKS A;  1O7Y A;  4QIW B;  4P2C B;  1JOR A;  5FOB B;  1GUS A;  5ELB A;  2EY6 A;  1PMR A;  4DGZ A;  2BDN A;  1STE A;  3A56 A;  1WD1 A;  4CJ1 B;  4IUP A;  4NDX A;  1B4O A;  3EVQ A;  1G91 A;  3M85 A;  2JYO A;  1EWC A;  1V43 A;  2I46 A;  4K5W A;  2RA4 A;  5ELC A;  3I73 A;  4OO1 I;  1TY0 A;  1BXT A;  1SAP A;  5A2Q L;  5M5X B;  2R3Z A;  1E2Z A;  5ISR A;  4HMI A;  2PZW A;  4V19 0;  1SDF A;  1XWE A;  2SOB A;  2FMC A;  3M7G A;  3MEH A;  4ZK9 B;  3PUZ A;  1EYA A;  1X32 A;  2JE6 I;  5JPN C;  1G6Z A;  1GJX A;  4XQJ A;  1GOZ A;  1SNC A;  3CKI B;  2R92 B;  5CMD A;  2Q8I B;  1DM0 B;  2ZXO A;  4F87 A;  4IFD G;  5CV4 A;  1GUT A;  2LKV A;  3MWY W;  4IAL A;  3H94 A;  3KF8 A;  1HQM C;  3HZX A;  2QEJ C;  5DM7 3;  5EJW A;  2K32 A;  1D5Z C;  4RAU C;  2E75 C;  1SBB B;  2PCF B;  2BA1 A;  1Q12 A;  1VF5 C;  2KUM A;  1ESR A;  1SE3 A;  3WOE A;  4TQU S;  5J22 A;  3X3M A;  2HUG A;  5C0X H;  1D1I A;  3OIQ A;  4HAE A;  1EQV A;  4DFA A;  3D8G A;  4C3I G;  4IUQ A;  1OXU A;  2A69 D;  3GQB A;  2XNA C;  1PXU A;  2QKI C;  2N55 A;  4C2M B;  1CM9 A;  1QCB D;  4HN7 A;  3V96 A;  3H09 A;  2K1B A;  4FXK C;  1WTP A;  3ONA B;  4ZUI A;  4JK1 C;  3GTK B;  1SYF A;  5ELE A;  3S15 B;  2JA8 B;  1I6V C;  4CJ0 B;  3SDZ A;  1D5M C;  4QUC A;  5K36 G;  1UNS A;  5CYU A;  4OGQ C;  3JAM E;  2L1B A;  4RFB A;  2K04 A;  2F0S A;  1LTI D;  2NVQ B;  2RSO A;  1TWC B;  3ERO A;  4ZQ3 A;  1HA6 A;  1F2Y A;  3FMC A;  3ZYY X;  2JA5 B;  1TKW B;  4G7H C;  1BCP C;  3RZO B;  3E6Z X;  4TRD A;  1BBX C;  2L0C A;  5I9P A;  2QIL A;  2EYP A;  3T51 B;  2SDF A;  1ZYR D;  2CW0 C;  4C3H B;  2ICI A;  2XRS D;  1ENC A;  3D4R A;  3A55 A;  5LL6 S;  1Z6H A;  2B2V C;  2NN6 I;  4MN3 A;  4RKB A;  2VNU D;  3VA7 A;  5M9O A;  3D6W A;  1EY5 A;  1DJR D;  5EPK A;  5JVG 3;  2M9V A;  3L9A X;  3MZ5 A;  4FP5 D;  1UUP A;  1F77 A;  2KEE A;  1T5E A;  1Y1V B;  1TS2 A;  5EBD A;  1Y8N B;  2B8G A;  2D5D A;  1TWH B;  2E2H B;  1JCK B;  1J8I A;  4PMB A;  1G2T A;  4BA2 I;  2A74 C;  1HTP A;  4KJO A;  4KY5 A;  2CVR A;  4RGM A;  2B8F A;  4Z9C B;  3S1N B;  4HSP A;  1BO0 A;  4O42 A;  2EY5 A;  3NUC A;  3TP5 A;  3BS1 A;  4KI0 A;  2PW5 A;  3J81 E;  1FYC A;  2MPM A;  2HCC A;  5FO8 B;  2N88 A;  2BCO A;  4J1M A;  4C1N K;  1CA6 A;  4M1U B;  2F0P A;  1FR3 A;  4R9W A;  1LTB D;  2JSO A;  4YIJ A;  2V4D A;  1IYV A;  2B39 A;  5I2X A;  1U4M A;  3NTH A;  2F1M A;  3DXJ C;  2BE5 D;  1Q8I A;  2F0T A;  4RGO S;  3PO2 B;  3LX0 A;  4TKO B;  2K28 A;  2CHB D;  4KD4 A;  5M3F B;  3CRL C;  3NTI A;  2VB3 X;  3HGB A;  5KRU A;  3MXN A;  4OO1 H;  4ULL A;  4ZRZ A;  1F9S A;  4IFD J;  3SK8 A;  1L0Y B;  4G57 A;  3EA6 A;  1SFO B;  1MD2 D;  1VCI A;  1FNU A;  2AQ2 B;  5G3L D;  2EJG C;  2WB1 B;  1RJT A;  2J4X A;  1BCP B;  2XRQ D;  4V0B A;  3SVM A;  3QB3 A;  1LLR D;  3HRZ C;  4DN4 M;  4DAP A;  4PV1 C;  2AQ3 B;  1I4Q A;  1AZQ A;  5ELF A;  4C56 C;  4LK1 C;  2PO4 A;  1JWS D;  5KEE A;  1JIC A;  1SYD A;  3SXH A;  1SYC A;  1OXS C;  1PLF A;  1BF4 A;  3CHB D;  3NE5 B;  1O7Z A;  3NXW A;  1JQY D;  2K6A A;  3K7A B;  1KAB A;  4J6H A;  2C9O A;  1Y1W B;  1PZK D;  5IT9 E;  4KD3 A;  2A68 C;  2KA7 A;  2F0W A;  3I8Z A;  1BNZ A;  5CGK A;  2C5C A;  3NTK A;  2KEC A;  3TZD A;  4TSS A;  2KED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...