3DM1A

Crystal structure of the complex of human chromobox homolog 3 (cbx3) with peptide
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
52
structure length
52
Chain Sequence
EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromobox protein homolog 3
publication title Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 52
sequence length 52
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3dm1A00
2EPBA 2KEDA 1ZXTA 4RA8A 2N88A 3LWEA 3G7LA 2MGSA 2L1BA 1EL0A 1F2LA 3I90A 1DONA 2HDLA 4MN3A 1EIGA 4IUPA 1BO0A 2B2YC 1RODA 1X3PA 1U4RA 1JICA 3FDTA 4X3KA 2B2TA 4XT3B 2D9UA 2M2LA 2B2TC 2B2VA 5CBAE 4HSVA 2XIWA 1WVLA 1AP0A 5T1IA 1WD0A 1J8IA 1HRJA 1U4MA 2KUMA 1G91A 2HCIA 3DM1A 1BBXC 3MWYW 1SAPA 3R93A 2B2UA 4HEDA 2NZ1D 2L11A 2NYZD 4X3TA 1QG7A 2FJ2A 1G2TA 1LV9A 1ICWA 1U4PA 2HDMA 2X6GA 5AFWA 1CA6A 3FPUB 1GUWA 1F9PA 1RTOA 2K03A 5EPLA 1B2TA 1Q3LA 1WD1A 1F9RA 1B50A 1DOMA 2JP1A 4QUCA 4U68A 1U4LA 2B2WA 1HUMA 1TVXA 4IUQA 3MTSA 2B2WC 3UI2A 1NCVA 2H1EA 3DEOA 3HP3A 5EQ0A 4ZKCB 1XX8A 1RTNA 3GV6A 4XDXA 1XYIA 1MI2A 1PFMA 4HAEA 4XT1B 1ILQA 1PFBA 4LMQD 1MGSA 4NW2A 3D6WA 4ZLTF 2IL8A 4O42A 3IL8A 4IUUA 2B2VC 2DY7A 2L9HA 3Q6SA 5COYA 2X69A 1SDFA 1IL8A 1EQTA 1WTWA 2JYOA 2MJ8A 2Q8TA 4CJ1B 5EKIA 4ZAIA 2B2UC 2SDFA 2K01A 3I8ZA 2L12A 1M8AA 5EPKA 5D65A 3QO2A 3ONAB 2BDNA 1WTOA 1O7ZA 4IUTA 2RA4A 3N52A 4ZK9B 1B4OA 1AZPA 1VMPA 2KOLA 1F9SA 3DEPA 4CJ2C 5CBEE 3KBXA 3TZDA 1MSGA 2K1BA 4OIJA 4RAUC 3TN2A 1C8CA 1HA6A 1O80A 1WTVA 2EOTA 1PFNA 1BNZA 1KNAA 3GV3A 1X32A 1ESRA 1DOLA 2RSOA 1J9OA 1VMCA 2HCCA 5D14A 1G6ZA 2KVMA 1CA5A 4QUFA 1KNEA 5EJWA 1PDQA 5E4XA 5EPJA 4RWSC 1JE4A 3I91A 2FINB 1HUNA 3F2UA 1EOTA 4MHEA 2Q8RE 1QNKA 2HUGA 4DN4M 4ZKBB 1AZQA 1CM9A 4OIKA 1WTQA 2FHTA 1QE6A 2CVRA 2J7ZA 2K28A 2VXWA 1WTPA 1EIHA 5E4WC 2EE1A 1B53A 1S4ZA 4IUVA 2KEEA 5CORA 5JJZA 2B2YA 2MP1A 1A15A 2NWGA 4HCSA 1ILPA 2K04A 4R8IA 2K05A 1WTRA 2RSNA 2FMMA 4X3UA 1O7YA 3IFDA 2L4NA 3KUPA 1DZ1A 5CMDA 1NR2A 4R9WA 2DY8A 1HFGA 1IKMA 1F9QA 3SVMA 1E0BA 1RJTA 2N55A 4X3SA 1IKLA 2R3ZA 1WTXA 1NR4A 3I3CA 3P7JA 1B3AA 2X6LA 4CJ0B 1DOKA 1RHPA 1SSOA 2RVLA 2KECA 1HFNA 1HHVA 1PLFA 1NAPA 1G2SA 1X3QA 1ML0D 2MPMA 4IURA 1BF4A 4UAIA 2FFKB 5DNFA 3H91A 5T1GA 1MSHA
chains in the Genus database with same CATH superfamily
4DR2Q 2VB2X 2B63B 3G7LA 3I4LA 2L1BA 3DLLA 2K5VA 3ZYYX 3OSOA 1RDPD 1X3PA 3SK5A 3GTQB 4DXFA 1ESFA 1O7LA 2F0JA 4RKLA 5C5MA 4OL7A 5BR8L 2EDGA 2UUBQ 1PXUA 3NEMA 2O4XA 4XYQA 4OX9Q 1QG7A 5IWAQ 1OTCA 3S17B 5C0XH 4HMJA 2K03A 2XVSA 2RDGA 4IPHA 5IYCG 2K33A 1AW7A 4LF7Q 4V190 1U0LA 4KKUA 3CD6A 1NCVA 2H1EA 2VQFQ 4IFDJ 2F0DA 1ILQA 1VQOA 1C4QA 2B2VC 4QL5A 4EQPA 1JWSD 4TVAB 1VQFA 3ICEA 1I94L 3AU7A 3RMHA 1SMXA 5BN3A 5IOCA 3ONAB 2D0OA 2BDNA 3S2DB 5I4DA 1F9SA 2PNHA 1XXGA 1GO3E 4YCUA 1HA6A 4OONA 1KD1C 3D4RA 4RGNA 2KCNA 4YCWA 1VQGA 2R7ZB 5JVH3 1NY4A 3M4PA 1D1KA 3QWNA 1SE8A 1HJPA 3P20A 2K6AA 4BBRB 1JOKA 4UP7A 1QE6A 2J7ZA 2A68D 1LT5D 3IFTA 1VQAA 2IT1A 3Q22A 1DZ1A 4JI3Q 1E1TA 2E2JB 1SMYD 4GNXA 2BA1A 4ABNA 5HURA 3ULLA 1EFWA 3PF4A 1DOKA 4NXNL 1B8AA 2WKCA 4I7AA 1X3QA 2K5NA 2MPMA 2UU9Q 3A54A 2V4DA 3NPPA 1NMFA 1WCMG 4ILWA 4EVOA 2ZXRA 4PMCA 4WRDA 2GVAA 2WB1G 3TP7A 1SNCA 2EYLA 3QB3A 2K50A 4B3SQ 3ZJYC 3AFQA 2JA5B 2VQEL 4B3RL 4C3IG 1TWCH 2OQKA 1WTHA 3UE1A 1PFSA 2IX1A 4A3GH 1JJCB 3STBC 1GUWA 1F9PA 2SOBA 2PW7A 5CV8A 5ELCA 2XRQD 4DR3L 2QDLA 4ZCKA 4OO1H 4DAPA 3GV6A 3TSSA 2NVQH 1GHKA 4MNOA 1TQOA 4BY7H 4HSPA 4YY3L 3NWSA 3D31A 1SBBB 2X69A 2R7ZG 1SRUA 1SDFA 3WOFA 4A3IH 1WTWA 4DF7A 1IBLQ 3RUZA 4DV2L 4R4CA 3HOUG 3J80L 2BA0A 3NTIA 4POGA 4I7ZC 1IW7C 4PV1C 1VQHA 3J80E 3FEWX 4DUYQ 4B3ML 4CBVA 1E24A 3M7GA 1FNVA 2NN6H 5GAGC 1SROA 5K36G 2CKZB 1AEXA 4X62L 1J9OA 5ELOA 3I72A 2PPBC 3J7A5 2HIVA 3KJPA 1K8GA 3C3LA 4GLAC 1K8OA 2F0OA 2HUGA 2B29A 1K3BC 5C0XI 3M85A 3CW2C 4A3DH 3PF5A 1S40A 1SE3A 3LNNA 3FKIH 3PUZA 3KUPA 2DY8A 3B6YA 2DJFC 2WFWA 5FO8B 5JEAJ 4RHSA 5KNCA 2JA5G 1E2WA 4TSSA 4K2LA 5LL6X 4KLKA 5BN5A 4JBJA 5FLXc 4IQZA 2GA4B 1BF4A 4I65A 1YJ9A 1EWHA 3SEBA 4A3KH 3K59A 2NUCA 3G6EA 3VA5A 1H9SB 1X65A 4G7OC 2YTVA 4L5RC 1BO0A 4DXGA 4C3JG 2LFNA 3J7ZC 4QY7A 5LMNQ 4R4QA 3HOWH 1WOCA 4A93H 2XN9C 3VYRA 1TWCB 1I4HA 4A3CG 2ICEC 3CC7A 1XNQQ 1X9NA 4BXXH 3E0EA 2JJQA 1STAA 4LUVA 4PMBA 2QEJC 3DM1A 4A3GB 2FMCA 4NDXA 4IJHA 1SAPA 1Y1VH 2L11A 1F2ZA 4X3TA 5D3IB 4CHTB 3CAMA 1LV9A 3U9OA 4EQOA 1TXYA 1YIJA 3F2BA 1SJED 3TBIB 1BBUA 4BY7B 1OO9B 5I9PA 4LMQD 4DR7L 4A3IB 5CYUA 3KOJA 2K5QA 3VR4A 1I50H 4JCVE 3C46A 1VF7A 1HTLD 3RZDH 3CCRA 1EYGA 5EKIA 5IE8A 4ZAIA 3PUWA 3T1YL 4KMUC 4JI1L 1Y1WH 1YVCA 2A19A 1O7IA 2N49A 4A3MG 4GOPC 3CPFA 3NBHB 2L0CA 1D6EC 4IPCA 1K8MA 4OIJA 2E2HH 4DKAC 4BBSG 2C5CA 3PQIA 1IYJB 3CMEA 4IN3A 2RSOA 1HQMC 1SYGA 4DR4L 5C4ZA 4A3BG 1YBYA 2K5DA 4RWSC 3I91A 3VR3A 4A3DB 1BXTA 4HCEA 2N3SA 5C3EB 4LW1A 3FKIB 2VQFL 4G7ZC 1JCKB 5JJZA 1JQYD 4F8MA 3PMFA 1WTRA 1VCIA 2EVBA 4X3UA 3IFDA 3LX0A 4DNIA 4OO1I 3J81E 2AMCB 4FF2A 3LWUA 4PG3A 2TMPA 4X3SA 1IKLA 2F3IA 5IT9L 5I2XA 2X6LA 2HIXA 4A3KB 1OXVA 1EY7A 3DMUA 1S3OA 2NVXH 4KKTA 4C3HG 5IGFA 1KDAA 1VQCA 1N34L 1QVFA 2VUMG 2CH4W 3HOWB 1I4RA 2E8GA 4HIOA 4L63B 4KHZA 1LT3D 3HKSA 3PIOA 1VQPA 1T5EA 1CKMA 3J7AV 2NN6I 3A5ZB 2R92H 1S5DD 4HN7A 4FYDA 4OELB 2Q2HA 1YNJC 4KHVA 2JXMB 2AQ3B 4YIJA 4DV3Q 2KENA 1JOOA 3MEFA 4DV5Q 1TWHH 4A3JG 1TS5A 3E3XA 1RTOA 2IY5B 1B2TA 1TIID 4P2CB 3MXPA 4U68A 4A3LH 4LFCL 3GDEA 1HR0L 1VQBA 3D4WA 2CHBD 2XRSD 1ZYRD 2F0WA 1E1OA 2JA8H 1I50B 4CKEA 1Y14B 3RZDB 4FVMA 1AFPA 2DY7A 3OWFA 4YCVA 1QZHA 4CGYB 3VYSA 4P71A 4A3DG 4AIMA 3I8ZA 2D5DA 2ASBA 1H9MA 1UUPA 1LABA 1Q8IA 5EPKA 1PVOA 1Y8PB 5C4XH 5C3EG 3OPOA 4HJ8A 4IUTA 2RA4A 1HNXQ 2E2HB 1Z6HA 4TQUS 1CK1A 4NXMQ 3W2DA 3KF8A 4EQNA 2F52A 1RIPA 4B3TL 1VQ9A 4LF4L 4LF8L 3FP9A 1LTID 1B9MA 3R3OA 4QUFA 2F3VA 4NKLA 3U58A 1CHQD 5ELDA 3S1NH 1SJHD 1QNKA 4E6IA 4K5XA 1JR0D 4UP8A 1WTQA 4AQYQ 3NUCA 1HCZA 1EFID 2AKWB 4DR5L 2EY1A 3JAMc 1CKOA 5GQOA 5E1FA 2MP1A 1HNZQ 1GUTA 4FXKC 3KF6B 2PQAB 2KCMA 5IYCH 1SYDA 5CMDA 3H0GB 3SHLA 5LMUQ 2NVXB 1TY0A 4OWWB 4K0KL 3SVMA 2IJ0A 2CQOA 2R3ZA 4GKKQ 3MZ5A 5C3WA 3HKZE 4TKOB 1S5FD 3FHWA 1CSPA 2KEDA 4L5TA 4CKCA 2PI2A 2MHVA 1H95A 1SFOH 2Y0SB 2R92B 3BDLA 3S1QH 2H5XA 3SK4A 2B2YC 3S2HH 4B9XA 1ET9A 3T16A 3FDTA 3TP6A 3GTKH 1LACA 2Z6KA 4JYAL 1SYFA 1BCPC 2KCCA 3V2TA 2E2DC 4PZ8A 3K8AA 5HY6A 3VYTA 4LF6Q 1TWHB 4PMWA 3TZUA 1Q8KA 4N9PA 4HJAA 2I46A 4DV0L 4JOIA 4V0BA 2EYHA 1PH9A 2UXBQ 4GKJQ 2HDMA 2EY6A 2LXJA 4J1MA 4GOPB 4DV7L 3EIVA 1A6XA 2B3GA 4KD3A 1EOVA 2JA8B 1P8LA 4P74A 2KCTA 2EYJA 1PFBA 2A6EC 3F2CA 4LFAQ 1F2YA 3IL8A 4U673 2J0TD 3V05A 2XSCA 3FPPA 1QJOA 3HOZB 1I4XA 3RN5A 5FO9B 4PZ7A 1BBWA 2R6GA 4IUNA 2CW0D 4DV6Q 4LK1C 3TQYA 3KF6A 2MO0A 2RCNA 4K14A 2F0PA 3S17H 1L0YB 1NMGA 1WCMH 4Q5VA 1MD2D 1Z9FA 4JC0A 1KAWA 1O80A 3H0GG 2EXDA 3GV3A 1HXYD 5KNDA 3GTPH 3SGIA 3KBGA 1N32Q 3H3VH 3TEHB 2XTIA 2QKIC 1V43A 4QQBX 2ZJPA 1HUNA 1QB5D 2IW3A 2E5LQ 1N33L 4EGVA 1EOTA 4ZYSA 2OTJA 2A73B 2JSOA 3P75A 2Q2IA 4C3IH 5JPNC 4JK1C 4O0AA 2VXWA 5E4WC 2K04A 2EJMA 4LF5Q 5EAYA 2F0GA 4HTHA 4UHVA 3WDNA 4FF1A 5GROA 2NTTA 3BDOA 3QR8A 1PH1A 1RJTA 3WWVA 4BS9A 1B3AA 2RVLA 4MTNA 4UPAA 1SFOB 4RGMA 1A3VA 1JWUD 4X64L 4HMIA 3KDFA 1LTLA 2HHHL 2R7DA 4QCLA 2R7ZH 1DOLA 3NQIA 3S2HB 3LWEA 3GTKB 4YHHL 3HOUH 3H6MA 3E0JA 3AYHB 3Q0AA 5KIXA 4JI4Q 3KFUA 2F0UA 1AH9A 4ZRZA 5F2DA 1UE6A 4O2DA 1YITA 2O5IC 1A3UA 2HCIA 3PUYA 5K36H 2DGYA 1BBXC 1TY2A 1AE3A 5CV7A 1T9HA 5IYBG 2UXDL 3HOZG 1G2TA 1X3GA 3VYUA 4UP9A 4JBKA 1I6VC 2MUYA 3GTMB 2AWOA 4AYBE 2B2WA 1W3SA 5FJ8G 4ZUIA 3C2PA 3UI2A 3OTOQ 3A8JE 1QZGA 2A6HD 3S16H 1MKHA 4JI2Q 3HGBA 3GP7A 3Q6SA 2P5ZX 2FXQA 3GTLH 2N78A 2K7VA 4KJNA 4M8AA 4Y52H 4J6HA 1HZBA 2JA5H 4ALPA 5C3XA 1WCMB 3OMGA 1FJGQ 5EGTA 1S5ED 4DGZA 2A5HA 3A74A 1L1OB 3K80C 1YI2A 2K1BA 3GTPB 3IAYA 3CU7A 2WB1B 2Q8IB 4DR1L 1V1PB 3EJIA 4RHRA 4C3JH 2K5HA 4DR6L 1PZKD 3T4AC 4C3IB 2UXCQ 2BOSA 2C9OA 1UE1A 5EJWA 5EPJA 4HIMA 4A3CH 4RGTA 2FINB 1SNDA 3T56B 4MHEA 1S72A 2IPKD 1CM9A 4OIKA 1AN8A 2KQ3A 1XMQQ 5KGUA 2A74C 4JI8Q 4JI5L 1TS4A 3K5OA 1HZAA 2F4VL 3H09A 1O7YA 2M00A 5CV9A 1IXRA 3T1HL 5ELFA 3UDXA 3W3AA 4JI6L 4QIWE 1HQRD 2F3WA 1NR4A 3KLSX 1SEBD 4CJ0B 3K57A 3SDZA 1ASYA 3PIP3 2G9DA 2M9VA 2CQAA 1GHJA 1PTOH 3S24A 2OEOA 3K7UC 2FFKB 2A69D 4EX5A 1J6QA 2ENBA 3HOUB 2KJXA 2OF1A 3EBEA 1KNEA 5KEEA 3MAQA 1OXXK 4EQ5A 1I3QB 5C0XJ 3M4QA 3I90A 2OT2A 2AWNA 1H9JA 1O78A 4A3FG 5EBCA 4A3MH 2BE5D 4H7BA 1Q1BA 1C7YA 3JC66 3TS2A 3CCSA 2F0KA 4DK0A 1WD0A 3ULPA 3H3VI 4BBSH 2BDOA 2NTSA 4H44C 1HTPA 1EEID 2NYZD 4K2KA 3JAMi 3UE0A 5M5YH 2KBNA 3MVVA 5IP9G 2I5MX 1G51A 3AB9A 3RN2A 1X3FA 3U9SA 4BA1I 4A3BH 4LF9L 3K0XA 1WD1A 3S16B 1DOMA 3OMCA 4JV5L 1YNNC 1K8AC 1I6HH 1HNWQ 1ASZA 1E22A 4Y7NH 1LTRD 2PNRC 2Z1CA 3F8TA 3R2IA 1V1PA 2EY2A 3GTLB 4GN3B 5LL6S 3CCJA 2ES2A 3HKZG 2QILA 5EKLA 4ULLA 4TRDA 4F88A 2MJ8A 2YTYA 4C56C 4CJ1B 4O1NA 2WV6D 3C1FA 1JJ2A 1VQ7A 2L12A 3PV0A 1RCVD 3CKIB 3QO2A 3F2DA 3W5OA 4C3HH 4KJOA 1EY5A 3I70A 5CV6A 4ZK9B 2L5TA 3R2TA 4Q0FA 2VUMH 4C3JB 1MSGA 5FK9C 4FP5D 3HOXG 3TDQA 2JQOA 4DV1L 4PQXA 2EOTA 2HD3A 2PO4A 3ER0A 2D62A 3V96A 3GD7A 1N9WA 5M5XH 5JAVA 2WINB 2Q8RE 4JI0L 1LO5D 3L3OC 3HS0C 1XMOQ 4A3JH 4OWXB 3VR6A 3QOLA 3PUXA 1NR2A 2F0HA 3Q23A 1S5BD 2ZM6L 2JA9A 1VQEA 1PTOB 2K75A 1PTOD 1XJVA 2I07B 4JI7L 3EFXD 3GQBA 2JN4A 3W1GA 1MBYA 3I2ZA 2ZT9C 1A62A 1PLFA 4X65Q 2CH4A 4DV4Q 1LTSD 1UE7A 1EYCA 5IYDH 1QVGA 5CC4A 4KN7C 1K73C 4IFDG 4XQJA 1MJCA 3F1ZA 2PI2E 3CC4A 4A3MB 2I0QA 5FOBB 1F2LA 5C3EH 2NVTH 3SE0A 2CFMA 1X55A 1U4RA 1QVCA 2VW9A 1FGUA 4UY8C 2Z6KC 2E5LL 2UUAQ 1V8QA 4BBSB 3I4OA 1AE2A 2D9UA 3ERQA 2XNAC 1IZ6A 5M5YB 1VDZA 4LUOA 4A3BB 1PZID 1RKNA 2EIFA 4KHPL 3Q24A 3NQTA 3RLOA 2OCEA 5AFWA 1I6HB 4J15A 3FPUB 5M9OA 3BG3A 3G6JB 4Y7NB 1GM5A 1BR9A 4BY1H 1GKHA 1W6KA 1PRTC 1F9RA 3SK8A 3HP3A 2H4OA 4OWTB 1LUZA 4NW2A 3E6ZX 3D6WA 5EKKA 1KLUD 3CCVA 1EQRA 3VDYA 3DWPA 4R4OA 3DWAA 1LTGD 1EQTA 4UDUC 3RLFA 4C3HB 2Q8TA 3KJOA 1CKNB 1NUCA 3KLSA 2O2LD 2B2UC 3H94A 1XNRQ 1X6OA 4DUZQ 1W2BA 5D65A 1D2BA 4L8JA 2VUMB 1KRTA 2UUCQ 4DA2A 4XIGS 1Q46A 4X6AH 1STGA 1EZ8A 2DUDA 2CWPA 1NTGA 1IBKQ 1D8LA 5FLXL 5ELBA 4CDFC 5M5XB 1ESRA 3URYA 3L2PA 4DR2L 3DUZA 4H02A 1LLRD 5FLXE 1IHZA 1QILA 1N36Q 4ZKBB 3CCUA 4A3JB 3DHQA 3J7AF 4LFBQ 1EZ6A 1Q82C 2ZXOA 1IBMQ 2LXKA 4FF4A 5AJ3Q 4AYBG 1VQDA 2Z9HA 2FMMA 4XQNA 2UUBL 2RQXA 1HH2P 2RHQB 2QF7A 3J81c 3K5MA 2QGQA 3J81j 4OX9L 1HA5A 1ZKOA 1SR3A 3HRZC 5IWAL 1KC8C 1KAAA 3E5SA 1STYA 4LF7L 1R4QB 1KDBA 1ML0D 4UAIA 2PMZE 3AFPA 3H91A 5FLMG 2NVTB 1H9SA 4KI0A 4X66Q 4BWGB 4L5QA 1G8ZD 1LT4D 1PV4A 3MFYA 4X3KA 4LUZA 1II3A 1PH3A 4R1JA 2B2VA 2PYKA 1PHJA 3A56A 4LAAA 4P72A 4GZYC 4KKSA 5M3FG 1J5EQ 3S14B 3H0GH 4BY1B 1GD7A 1EYAA 3OIQA 3OW2A 4QGUA 3MXUA 1KTKA 5IT9E 2IWHA 1STEA 3STBD 2IHFA 4WJWA 5C44G 2GVBA 1EQQA 1WJJA 1JE5A 5KYLA 5HGTA 2B2WC 1EEFD 1K9MC 1VQIA 1XWEA 4C2MH 4XDXA 2F0NA 3S1MH 3BS1A 1XPUA 3BDCA 1VQMA 2EYOA 5JJKA 2XWBB 3CF5A 1IL8A 2R7FA 1LM0A 2SDFA 3TP5A 4WFN3 3G4SA 4KV6A 5BR8Q 5A2QL 1ZEQX 2QA4A 4JI3L 1JOQA 5E7NA 3NBHA 1IW7D 3W1BA 4GS3A 5A2QE 5DEHA 4RAUC 2Z4HA 5DM63 1VQ6A 2UU9L 4A3EH 5KRUA 1X32A 1E2ZA 3BJUA 2RDHA 3DXJC 1SYCA 2CCZA 3T13A 3MFGA 2YU9B 2J4XA 5IYDG 3S1RH 3SK6A 1QUQB 3J7YW 1Y69U 2OWOA 1B44D 2R61A 4IUVA 3L7ZC 5IYBH 4B3SL 2Z6BA 3HOZH 1I94Q 3RNUA 4H13C 2IX3A 1M1KC 3OW7A 3KK7A 3EQLC 4DNRB 1JJGA 2ZJQA 4MTKA 5FJ8H 1IYUA 1LYLA 1KQSA 3HZXA 2EYFA 5CV5A 4BY1G 3RD4A 1N8RC 4JPBW 3KLWA 1PRTB 2PZTA 5DAUA 1TKWB 3M3YH 3A7AB 3D8GA 1EL0A 4WJ3M 3M4OH 2HDLA 2LSSA 3KLRA 3WOEA 4HR7B 1PH2A 4XT3B 1ENAA 4KY6A 1IBLL 1TWFB 1L0WA 4GNXC 1WVLA 1ENCA 4DUYL 4RFBA 1CA6A 1A63A 4NXNQ 3UDGA 3E9HA 4HJ9A 1Q3LA 4C2MB 1F77A 1FL0A 1TU2B 1TVXA 4H0LC 3X3NA 3S1MB 2F0FA 1PTOF 2OQ0A 1HZ9A 1EIFA 4IOAA 2NZOA 1LTBD 1DM0B 3TRZA 3JAML 4KK7A 3HFZB 1DD2A 3PSIA 2VQEQ 4NPSA 2YYZA 1R9TB 3H15A 3JAME 4KD4A 3D4DA 4ME3A 2V1CC 4DAYB 5CBEE 1EWCA 4NMZA 4A3EB 1GXDC 3TZDA 2SNSA 3N6RA 1C8CA 1S5CD 3GTMH 3S1RB 4A3FH 4DR3Q 3NE5B 4WORA 1Q12A 1YZ6A 4K5VA 2EQSA 1JE4A 1Z47A 2PMZB 3TP8A 5LMNL 1HZCA 3CHBD 3I4NB 2VB3X 3RR5A 1GUSA 2A68C 1XNQL 2WP8J 4L6TB 4R8IA 2PQAA 5IP9H 4DV2Q 2YTXA 1CUKA 2RF4A 2XWJB 1T5XD 5IGCA 1IKMA 1SMYC 3OWEB 5CGKA 1E0BA 1PH8A 1LT6D 2AQ2B 3P7JA 5JVG3 4B3MQ 3HG9A 2G9HD 3NHHA 1JORA 2AUJD 1G2SA 4X62Q 3M3YB 3IRBA 5DNFA 2K5WA 3EROA 3M4OB 1MSHA 2OXPA 2RCFA 5HGQA 3R8BA 5C4HA 3U4ZA 1C48A 4C1NK 4IUPA 3G71A 1JICA 1EU4A 4ZUJA 5K5PA 1Q81C 3RZOH 4LNQA 3BYYB 1SN8A 3OHXC 1YNJD 2XIWA 3MXNB 2C35B 2F0TA 3MA2B 2JA7G 4DNTB 3HOXH 4K6LA 4GN5A 3PO3G 1CHPD 2NZ1D 3BZKA 1G6PA 2Z4IA 1U9RA 1ICFB 4GOPA 5G3LF 3A5UA 2F0QA 4RH6A 3CQZH 3K7AB 1C9OA 1PH7A 1CT1D 2EYPA 2F0LA 5M5WH 3J81i 4B08A 4A3EG 1EWIA 2F03A 2OTLA 4ZQ3A 1I3QH 1BKBA 1MGSA 2LKVA 4XYOA 3HEJA 2E75C 5KNBA 1L2FA 2JYOA 3SR1A 1Y8NB 1CQFA 1IL2A 5FKAC 2K01A 1E3PA 1JC7A 3I4NG 1WTOA 1O7ZA 4IZ8A 5C6AA 2EYMA 1CZGA 3ERSX 1VMPA 2KOLA 4NP5A 5A35A 1SNMA 1PZJD 4IFDH 1J5EL 4A3FB 1B1ZA 3TN2A 2RHSB 4A76A 1LTTD 2B8FA 2KHIA 5CR3A 5GADC 1PFNA 3PO2G 1I4GA 1SNQA 4NB3A 4APVA 2G5DA 2ZTCA 1QOHA 4POFA 1A8VA 5J39A 3I4MB 1TS3A 3F2UA 4DR7Q 5M3MG 1BDOA 2IHEA 3M7NA 1K3RA 1BQQT 1X56A 1ILPA 3NELA 3T1YQ 4JI1Q 4A4IA 1D1IA 3NTHA 4DV3L 4YWKA 1EY9A 1STBA 1UEBA 3MXNA 4DV5L 4GNXB 1TT2A 3CP0A 3EN2A 3K5LA 4GN4B 3HKZB 1GUOA 4Z9CB 4JBMA 1VQ4A 3HOYH 4XTCS 2RBMA 2I5HA 4DR4Q 1G291 1ZXTA 1VF5C 4OGQC 4ODGA 3NWTA 3RZOB 4YWLA 1NSNS 4FDBA 5DM73 1RODA 2K52A 2NB0A 2F0VA 4DU9A 3HOVG 2D2CC 4G4KA 1EY6A 3HOXB 1YEZA 1BCPB 1JB7A 1BCPD 1TWAH 1ENFA 2M2LA 3GO5A 1J8IA 2WIIB 2KUMA 1JWMD 1HNXL 1WYDA 5NUCA 3CQZB 2X6GA 5M5WB 4NXML 1EY8A 1K0RA 2A8VA 4P75A 2DN8A 2SEBD 1N34Q 1HUMA 5L37A 3NBIA 3NP8A 1DJRD 3GTJH 3BZCA 4ZKCB 3CC2A 2F0EA 1F2MA 3BVZA 1XYIA 4FNFA 2E2IH 4XT1B 1MHWC 2A6ED 1VQKA 1OXSC 3NTKA 4O42A 4AQYL 1V1QA 5JJLA 3K6OA 5COYA 1OXUA 2K14A 3K58A 3I4MG 3S15H 1FVIA 2BCOA 1HNZL 1JT8A 1W6JA 3CPWA 1DGSA 1MIUA 1PRTF 1M8AA 2JA6G 1BUVT 2WKDA 2B63G 5LMUL 4IPDA 1AZPA 1B4OA 3DEPA 4K5WA 5IGEA 3DM3A 1TWGH 1L1OA 2JEBI 3CCMA 4GKKL 5FLMH 3PIO3 2EJGC 4J8QA 1K83H 1FYCA 1YJNA 3P1HA 2NBFA 2HQEA 3NSWA 1B9NA 4LFCQ 5C5LA 1YNXA 4F7XA 1D5XC 1HR0Q 1PDQA 2PCFB 1UNSA 1SE4A 3A8IE 2QDBA 4DN4M 4RMFA 4HIKA 5KYIA 5M3FH 2CVRA 2L55A 1FNUA 5IP7G 2B2YA 1A15A 2WACA 4LF6L 4N8X1 5C44H 3J80c 1V1OA 4KTAA 2F0MA 1ONLA 4IO9A 1F9QA 4DK1A 3D3RA 2UXBL 4GKJL 1I4PA 3X3MA 3I3CA 4K8IA 1FD7D 1ET6A 2PQEA 1SSOA 3HOYB 3U4VA 1DCZA 5EBDA 4B3TQ 4LF4Q 4LF8Q 4IALA 1TR5A 4S3SA 2ZTEA 1DONA 1SNOA 4LFAL 2D0PA 1TWAB 4IFDI 2KA7A 4DR5Q 2A1AA 5JEAH 2R93H 2B2TA 4RCOA 1AP0A 5T1IA 4CDEC 1XTDA 3CXCA 4DV6L 1HRJA 1WI5A 1G91A 5E3FA 4G57A 3AMUA 5GAEC 2F0SA 5DLQE 4K0KQ 2FJ2A 1U4PA 4BBRG 1UE5A 3I56A 5ISRA 2B8GA 5EPLA 3GTJB 3O13A 4FO2A 3A8KE 4QUCA 2E2IB 1U4LA 3M9BA 4AYBB 1N32L 3DEOA 4ID6A 5EQ0A 3BYTB 1XX8A 3G48A 1ZYRC 4RGOS 1BVSA 2Z0SA 1PFMA 3S15B 2MO1A 1KXLA 1EUJA 3CCEA 4JYAQ 1KLGD 1QCBD 4JOIC 1HR0W 1UEAB 1A3TA 2LY7A 4LF5L 2VL6A 2I5LX 1L0XB 3BZDB 1TWGB 2VY3A 3S14H 2PW5A 4DV0Q 3A55A 2JEAI 1K83B 3FRPB 4CJ2C 3CCLA 1VQLA 1P16A 4FF3A 4DV7Q 2VNUD 1SYEA 4HIDA 1PYBA 1STNA 5I6YA 4B9WA 1QNUA 1KNAA 3TMEA 1CA5A 5C0XG 3HOYG 5M3FB 2F0IA 1A2UA 1PA6A 1AZQA 2DJGC 3GTGH 3L9AX 2JE6I 5C44B 4JI4L 2KHJA 1B53A 2KEEA 5J1ZA 1KDCA 4LJZC 4HCSA 4PNYA 2F1MA 5IODA 2RSNA 1DXMA 4CKBA 3EA6A 1X3EA 2ZXPA 2WAQE 1YHBA 1KABA 3IKJA 2SNMA 3BVMA 2DNCA 4QIWB 5JOBA 1BOSA 4QMGA 1SNPA 4ME5A 4IURA 2EZVA 3NK9A 3OTOL 3VR2A 2YU9H 3PUVA 5CV4A 2Y0SE 3L0OA 2NVQB 4JW0A 5G3LD 1N33Q 2R93B 4JI2L 4MN3A 2VZAA 3PCOB 2HQLA 2ZTDA 1CSQA 4RG1A 4K6DA 3FVQA 3QJYA 4MIUA 4IJLA 1HPCA 2EXZA 5I6WA 1FJGL 3R93A 4HEDA 1MJEA 3UDIA 5IT9c 3D6CA 3RLNA 1RF2D 1NBWA 3I7FA 5H1SE 1GVPA 1B50A 2JP1A 1YNND 1K28A 4JBWA 4X64Q 4IUQA 2HHHQ 3GTOH 4QB4A 2UXCL 1RTNA 1U5KA 3OIPA 4YHHQ 2AHOB 3PIPA 1RD9D 2ICIA 5ELNA 1XMQL 1X54A 1B3QA 4JI8L 1CKNA 1CTMA 1TWFH 2PZWA 2RKSA 1PH5A 4DPGA 3A0JA 2CW0C 3KYHC 1WFQA 3J81L 4GLVB 1E2VA 5GAHC 2E76C 4HJ7A 2UXDQ 5ELEA 1Z7TA 4N9TA 1M90C 1PYWD 1BCPF 5LMNW 2MFIA 3KF8B 2Z8LA 1LTAD 4OEMB 1VQNA 2BH2A 5D14A 5FO7B 1PH6A 2QEXA 3TREA 3GTGB 4A3GG 3I73A 5E4XA 4IOCA 2MQHA 3EVQA 3ND9A 3ULJA 1KIXA 2JA7H 4DK6C 3E9IA 4IPGA 1EIHA 2K28A 4A93B 2EE1A 3PO3H 4OO1G 2L15A 5CORA 2NWGA 5C4JH 5JEAG 1K0SA 1H9RA 2R93G 1R9TH 4AH6A 4BY7G 2L4NA 4DK3C 2PZUA 4GLXA 3CMAA 4A3IG 1NJIC 1Y1VB 3M4YA 4N8FA 5TSSA 1WTXA 1QWYA 2XGTA 1EY0A 3FMCA 3VR5A 1HFNA 1IYVA 1FNWA 4DR1Q 4PZ6A 1HNWL 4R4TA 4DR6Q 2F4IA 2GN5A 3D0FA 2O5JC 4K8JA 4RA8A 2MGSA 1B7YB 2NN6G 3AQQA 1KHIA 4FXGC 1XPOA 4RKBA 5IGDA 1EIGA 4M1UB 1Y8OB 1SE2A 3I4NH 1XTCD 2NVYH 1VQ5A 4JI5Q 5D3DA 3TS0A 2F4VQ 1A2TA 1CI3M 4P73A 2ALYB 3UDFA 1Y1WB 5BN4A 3BVGA 3PO2H 1NE3A 3T1HQ 2RDFA 3K0YA 1Q1EA 2N8NA 4JI6Q 3FKIG 3GTOB 3J80i 2KHSA 1PRTD 2B39A 4MZ9A 2MNAA 5JJIA 5M3MH 3T51B 3MTSA 1I4QA 4R8NA 2A6HC 4C1NI 4HAEA 1JB3A 2TSSA 4JVZA 3A7LA 1KRSA 5I9OA 2HT1A 4A3KG 3ITPA 3QIAA 4L5SA 3S9WA 1EYDA 1XMOL 2AUKA 3LGJA 4DAVA 1EIYB 4OHJA 2Q2TA 3PGZA 2BH8A 3HOWG 4A93G 4F87A 3QG1A 4BXXG 1Q86C 3KBXA 1YJWA 1L1OC 1VS0A 5JPMC 2WB1E 4X65L 3H3VC 4LF9Q 2WAQB 2QCPX 3BU2A 3K7AH 1WTVA 4DV4L 1BNZA 1Y1VG 4JV5Q 3HOVH 5LHY1 2KVMA 2JA7B 5IY0A 1JMCA 3ND8A 1SXTA 3PO3B 1QUQA 2EY5A 2NZHA 4WJ4A 4G7HC 3C1EA 3U50C 5C4JB 5IGBA 1CFMA 5IIFA 5J3BA 4B3RQ 2UUAL 1S4ZA 1PMRA 3MHBA 3I55A 1TS2A 2E74C 5I2YA 5J22A 3OOCA 1HFGA 1UWVA 1SYBA 3OYYA 2ATWA 1Y1WG 2KECA 1HHVA 4DV1Q 3K5NA 2A69C 4KN4C 4RCNA 4JG2A 2ID0A 3KDFB 1GOZA 1B70B 5T1GA 4YY3Q 2EPBA 3CCQA 3I4MH 2K4KA 2N88A 2CWAA 2VS1A 4QF4A 2K32A 2NVYB 1D7QA 2JA6H 4JI0Q 1GUGA 4HJ5A 2B63H 2BE5C 3K81C 3PO2B 1STHA 2B2TC 1XNRL 5CBAE 4HSVA 4DUZL 1R4PB 2JK8A 4KY7A 3GTQH 1U4MA 3NXWA 5C4XB 2UUCL 4LWCA 3MWYW 2EJFC 2B2UA 1CQVA 2QW7A 1VQJA 2ZM6Q 5IGGA 1ICWA 1UAPA 1Q7YC 1NNXA 4JI7Q 5M3MB 4CDCC 1CZWA 1IBKL 1M4VA 4XXEA 1SLJA 1H9KA 1Q90A 1PYSB 4QJFA 1YHQA 4KY5A 1EU3A 4DAMA 3T53B 5IP7H 1MI2A 4ZLTF 2WAQG 4FXDA 3S1NB 1N36L 4YWMA 1YHAA 1D5MC 2IL8A 2YV5A 4IUUA 4LFBL 2L9HA 1IBML 1RL2A 1FR3A 2DNEA 5AJ3L 1GUNA 1EQVA 1VQ8A 1A0IA 2Y0SG 3N52A 1DYQA 4DAYA 2R92G 4KHPQ 1GJXA 3MXGA 4R4IA 3HOVB 3S2DH 3DWQA 3SXHA 3AEVA 1EY4A 4OXPA 1VMCA 1E7ZA 2HCCA 4DFAA 1I5FA 1G6ZA 4X66L 2LS01 3VA7A 2Q2UA 3S1QB 1KL9A 3NENA 4A3LG 2FHTA 1WTPA 2ZJRA 1XPRA 2JA8G 4XQQA 1C0AA 4BBRH 1PH4A 2K05A 4CDDC 3QOJA 3MC0B 2IX0A 4R9WA 3MEHA 2N55A 1PTOC 3Q8DA 2AQ1B 1RHPA 3CRKC 4A75A 1FGBD 5C4XG 2E2JH 1OXTA 4BA2I 1NAPA 1V9PA 1D5ZC 2JA6B 3CRLC 2LMCB
chains in the Genus database with same CATH topology
2VB2X 2B63B 3G7LA 3I4LA 2L1BA 3ZYYX 3OSOA 1RDPD 1X3PA 3SK5A 3GTQB 4DXFA 1ESFA 1O7LA 2F0JA 4RKLA 5C5MA 4OL7A 2EDGA 1PXUA 2O4XA 4XYQA 1QG7A 3S17B 5C0XH 4HMJA 2K03A 2XVSA 2RDGA 2K33A 1AW7A 4V190 4KKUA 1NCVA 2H1EA 4IFDJ 2F0DA 1ILQA 1C4QA 2B2VC 4EQPA 1JWSD 3AU7A 3RMHA 5BN3A 5IOCA 3ONAB 2BDNA 3S2DB 5I4DA 1F9SA 1XXGA 1HA6A 3D4RA 4RGNA 2KCNA 2R7ZB 5JVH3 1D1KA 3QWNA 3P20A 2K6AA 4BBRB 1JOKA 1QE6A 2J7ZA 2A68D 1LT5D 3IFTA 2IT1A 3Q22A 1DZ1A 2E2JB 1SMYD 2BA1A 4ABNA 5HURA 1DOKA 2WKCA 1X3QA 2MPMA 3A54A 2V4DA 3NPPA 4ILWA 4EVOA 2ZXRA 4PMCA 4WRDA 3TP7A 1SNCA 2EYLA 3QB3A 2JA5B 4C3IG 2IX1A 1GUWA 1F9PA 2SOBA 2PW7A 5CV8A 5ELCA 2XRQD 4OO1H 4DAPA 3GV6A 3TSSA 1GHKA 1TQOA 4HSPA 3NWSA 3D31A 1SBBB 2X69A 1SDFA 3WOFA 1WTWA 4DF7A 3RUZA 3J80L 2BA0A 3NTIA 4I7ZC 1IW7C 4PV1C 3J80E 3FEWX 4CBVA 3M7GA 1FNVA 2NN6H 5K36G 1AEXA 1J9OA 3I72A 2PPBC 3C3LA 1K8OA 2F0OA 2HUGA 5C0XI 3M85A 1SE3A 3LNNA 3PUZA 3KUPA 2DY8A 5FO8B 5JEAJ 4RHSA 5KNCA 1E2WA 4TSSA 4K2LA 5LL6X 5BN5A 4IQZA 2GA4B 1BF4A 4I65A 1EWHA 3SEBA 3K59A 2NUCA 3VA5A 1H9SB 4G7OC 1BO0A 4DXGA 4C3JG 2LFNA 2XN9C 3VYRA 1TWCB 1I4HA 2ICEC 1STAA 4PMBA 2QEJC 3DM1A 4A3GB 2FMCA 4NDXA 1SAPA 5D3IB 2L11A 1F2ZA 4X3TA 4CHTB 1LV9A 3U9OA 4EQOA 1SJED 3TBIB 4BY7B 1OO9B 5I9PA 4LMQD 4A3IB 5CYUA 2K5QA 3VR4A 3C46A 1VF7A 1HTLD 5EKIA 4ZAIA 3PUWA 4KMUC 2L0CA 1D6EC 1K8MA 4OIJA 2C5CA 4IN3A 2RSOA 1HQMC 1SYGA 5C4ZA 2K5DA 4RWSC 3I91A 3VR3A 4A3DB 1BXTA 4HCEA 5C3EB 3FKIB 4G7ZC 1JCKB 5JJZA 1JQYD 4F8MA 3PMFA 1WTRA 1VCIA 2EVBA 4X3UA 3IFDA 3LX0A 4OO1I 3J81E 4FF2A 3LWUA 2TMPA 4X3SA 1IKLA 5IT9L 5I2XA 2X6LA 4A3KB 1OXVA 1EY7A 3DMUA 4KKTA 4C3HG 5IGFA 1KDAA 3HOWB 1I4RA 4L63B 4KHZA 1LT3D 1T5EA 3J7AV 2NN6I 1S5DD 4HN7A 4FYDA 1YNJC 4KHVA 2JXMB 2AQ3B 4YIJA 1JOOA 1TS5A 1RTOA 1B2TA 1TIID 4P2CB 3MXPA 4U68A 3D4WA 2CHBD 2XRSD 1ZYRD 2F0WA 1I50B 4CKEA 3RZDB 4FVMA 1AFPA 2DY7A 3OWFA 4CGYB 3VYSA 3I8ZA 2D5DA 1H9MA 5EPKA 1LABA 1Q8IA 1UUPA 1Y8PB 3OPOA 4IUTA 2RA4A 2E2HB 1Z6HA 4TQUS 1CK1A 3W2DA 3KF8A 4EQNA 1LTID 1B9MA 3R3OA 4QUFA 2F3VA 4NKLA 1CHQD 5ELDA 1SJHD 1QNKA 4E6IA 4K5XA 1JR0D 1WTQA 3NUCA 1HCZA 1EFID 2EY1A 5E1FA 2MP1A 1GUTA 4FXKC 1SYDA 5CMDA 3H0GB 3SHLA 2NVXB 1TY0A 3SVMA 2IJ0A 2R3ZA 3MZ5A 5C3WA 4TKOB 1S5FD 2KEDA 4CKCA 2MHVA 2Y0SB 2R92B 3BDLA 3SK4A 2B2YC 4B9XA 1ET9A 3T16A 3FDTA 3TP6A 1LACA 1SYFA 1BCPC 2KCCA 3V2TA 2E2DC 3VYTA 1TWHB 4PMWA 3TZUA 4N9PA 2I46A 4V0BA 2EYHA 2HDMA 2EY6A 4J1MA 1A6XA 4KD3A 2JA8B 2EYJA 1PFBA 2A6EC 1F2YA 3IL8A 4U673 2J0TD 3V05A 2XSCA 3FPPA 1QJOA 3HOZB 1I4XA 5FO9B 2R6GA 4IUNA 2CW0D 4LK1C 4K14A 2F0PA 1L0YB 4Q5VA 1MD2D 1O80A 3GV3A 1HXYD 5KNDA 3KBGA 2QKIC 1V43A 1HUNA 1QB5D 2IW3A 4EGVA 1EOTA 4ZYSA 2A73B 2JSOA 3P75A 5JPNC 4JK1C 2VXWA 5E4WC 2K04A 2EJMA 2F0GA 4HTHA 3WDNA 4FF1A 2NTTA 3BDOA 1RJTA 4BS9A 1B3AA 2RVLA 1SFOB 4RGMA 1A3VA 1JWUD 4HMIA 4QCLA 1DOLA 3NQIA 3S2HB 3LWEA 3GTKB 3H6MA 3E0JA 3Q0AA 5KIXA 2F0UA 4ZRZA 5F2DA 2O5IC 1A3UA 2HCIA 3PUYA 5K36H 1BBXC 1TY2A 5CV7A 1G2TA 3VYUA 1I6VC 2MUYA 3GTMB 2AWOA 2B2WA 4ZUIA 3C2PA 3UI2A 3A8JE 2A6HD 3HGBA 3GP7A 3Q6SA 2K7VA 4KJNA 4M8AA 4J6HA 5C3XA 1WCMB 3OMGA 5EGTA 1S5ED 4DGZA 2A5HA 2K1BA 3GTPB 3IAYA 3CU7A 2WB1B 2Q8IB 1V1PB 3EJIA 4RHRA 1PZKD 3T4AC 4C3IB 2BOSA 2C9OA 5EJWA 5EPJA 4RGTA 2FINB 1SNDA 3T56B 4MHEA 2IPKD 1CM9A 4OIKA 1AN8A 2KQ3A 5KGUA 2A74C 1TS4A 3K5OA 3H09A 1O7YA 2M00A 5CV9A 5ELFA 3W3AA 1HQRD 2F3WA 1NR4A 3KLSX 1SEBD 4CJ0B 3K57A 3SDZA 3PIP3 2G9DA 2M9VA 2CQAA 1GHJA 1PTOH 2OEOA 2FFKB 2A69D 2ENBA 3HOUB 2KJXA 2OF1A 1KNEA 5KEEA 3MAQA 1OXXK 1I3QB 5C0XJ 3I90A 2OT2A 2AWNA 1H9JA 1O78A 5EBCA 2BE5D 4H7BA 1Q1BA 2F0KA 4DK0A 1WD0A 2BDOA 2NTSA 4H44C 1HTPA 1EEID 2NYZD 4K2KA 3MVVA 3AB9A 4BA1I 3U9SA 1WD1A 3S16B 1DOMA 3OMCA 1YNNC 1LTRD 2PNRC 2Z1CA 3R2IA 1V1PA 2EY2A 3GTLB 5LL6S 2QILA 5EKLA 4ULLA 4TRDA 4F88A 2MJ8A 4C56C 4CJ1B 4O1NA 2WV6D 3C1FA 2L12A 3PV0A 1RCVD 3CKIB 3QO2A 4KJOA 1EY5A 3I70A 5CV6A 4ZK9B 2L5TA 3R2TA 4Q0FA 4C3JB 1MSGA 5FK9C 4FP5D 3TDQA 4PQXA 2EOTA 2PO4A 2D62A 3V96A 3GD7A 5JAVA 2WINB 2Q8RE 1LO5D 3L3OC 3HS0C 3VR6A 3QOLA 3PUXA 1NR2A 2F0HA 3Q23A 1S5BD 1PTOB 1PTOD 2I07B 3EFXD 3GQBA 1MBYA 2ZT9C 1PLFA 1LTSD 1EYCA 5CC4A 4KN7C 4IFDG 4XQJA 4A3MB 5FOBB 1F2LA 3SE0A 1U4RA 4BBSB 1V8QA 2D9UA 3ERQA 2XNAC 5M5YB 1VDZA 4A3BB 1PZID 1RKNA 3Q24A 3NQTA 5AFWA 1I6HB 3FPUB 5M9OA 3BG3A 3G6JB 4Y7NB 1BR9A 1W6KA 1PRTC 1F9RA 3SK8A 3HP3A 2H4OA 4NW2A 3E6ZX 3D6WA 5EKKA 1KLUD 3DWPA 3DWAA 1LTGD 1EQTA 4UDUC 3RLFA 4C3HB 2Q8TA 1NUCA 3KLSA 2B2UC 2O2LD 3H94A 5D65A 1D2BA 4L8JA 2VUMB 4DA2A 4XIGS 1STGA 1EZ8A 5FLXL 5ELBA 5M5XB 1ESRA 3URYA 3DUZA 1LLRD 5FLXE 1IHZA 1QILA 4ZKBB 4A3JB 3DHQA 3J7AF 1EZ6A 2ZXOA 4FF4A 2FMMA 4XQNA 2RQXA 2QF7A 3K5MA 1HA5A 1ZKOA 3HRZC 1KAAA 3E5SA 1STYA 1R4QB 1KDBA 1ML0D 4UAIA 3H91A 2NVTB 1H9SA 4KI0A 4BWGB 1G8ZD 1LT4D 3MFYA 4X3KA 1II3A 2B2VA 2PYKA 3A56A 4LAAA 4GZYC 4KKSA 3S14B 4BY1B 1EYAA 3OIQA 3MXUA 1KTKA 5IT9E 2IWHA 1STEA 4WJWA 5KYLA 5HGTA 2B2WC 1EEFD 1XWEA 4XDXA 2F0NA 3BS1A 3BDCA 2EYOA 2XWBB 1IL8A 4WFN3 2SDFA 3TP5A 4KV6A 5A2QL 1ZEQX 1JOQA 3NBHA 1IW7D 5A2QE 5DEHA 4RAUC 2Z4HA 5DM63 5KRUA 1X32A 1E2ZA 3DXJC 2RDHA 1SYCA 3T13A 3MFGA 2YU9B 2J4XA 3SK6A 3J7YW 1Y69U 1B44D 2R61A 4IUVA 3L7ZC 4H13C 2IX3A 3OW7A 3KK7A 3EQLC 4DNRB 1IYUA 3HZXA 2EYFA 5CV5A 3RD4A 1PRTB 2PZTA 5DAUA 1TKWB 1EL0A 3A7AB 3D8GA 2HDLA 3WOEA 3KLRA 4HR7B 4XT3B 1ENAA 4KY6A 1TWFB 1WVLA 1ENCA 4RFBA 1CA6A 1Q3LA 4C2MB 1F77A 1TU2B 1TVXA 4H0LC 3X3NA 3S1MB 2F0FA 1PTOF 1LTBD 1DM0B 3JAML 4KK7A 1DD2A 2YYZA 1R9TB 3JAME 4KD4A 3D4DA 5CBEE 1EWCA 4NMZA 4A3EB 1GXDC 3TZDA 2SNSA 3N6RA 1C8CA 1S5CD 3S1RB 3NE5B 4WORA 1Q12A 4K5VA 1JE4A 1Z47A 2PMZB 3TP8A 3CHBD 3I4NB 2VB3X 1GUSA 2A68C 2WP8J 4L6TB 4R8IA 2XWJB 1T5XD 5IGCA 1IKMA 1SMYC 3OWEB 5CGKA 1E0BA 1LT6D 2AQ2B 3P7JA 5JVG3 3HG9A 2G9HD 3NHHA 1JORA 2AUJD 1G2SA 3M3YB 5DNFA 2K5WA 3EROA 3M4OB 1MSHA 2OXPA 3R8BA 5C4HA 1C48A 4C1NK 4IUPA 1JICA 1EU4A 4ZUJA 5K5PA 3BYYB 3OHXC 1YNJD 2XIWA 3MA2B 2F0TA 4DNTB 4K6LA 1CHPD 2NZ1D 2Z4IA 1U9RA 5G3LF 2F0QA 4RH6A 3K7AB 1CT1D 2EYPA 2F0LA 4B08A 2F03A 4ZQ3A 1MGSA 2LKVA 4XYOA 3HEJA 2E75C 5KNBA 2JYOA 3SR1A 1Y8NB 1CQFA 5FKAC 2K01A 1JC7A 1WTOA 1O7ZA 4IZ8A 5C6AA 2EYMA 1CZGA 1VMPA 2KOLA 4NP5A 5A35A 1SNMA 1PZJD 4IFDH 4A3FB 1B1ZA 3TN2A 1LTTD 2B8FA 5CR3A 1PFNA 1I4GA 1SNQA 1QOHA 5J39A 3I4MB 1TS3A 3F2UA 1BDOA 3M7NA 1BQQT 1ILPA 1D1IA 3NTHA 1EY9A 1STBA 3MXNA 1TT2A 3K5LA 3HKZB 1GUOA 4Z9CB 4XTCS 2RBMA 1G291 1ZXTA 1VF5C 4OGQC 4ODGA 3NWTA 3RZOB 1NSNS 5DM73 1RODA 2NB0A 2F0VA 4DU9A 2D2CC 4G4KA 1EY6A 3HOXB 1BCPB 1BCPD 1ENFA 2M2LA 3GO5A 1J8IA 2WIIB 2KUMA 1JWMD 5NUCA 3CQZB 2X6GA 5M5WB 1EY8A 2DN8A 2SEBD 1HUMA 3NBIA 3NP8A 1DJRD 4ZKCB 2F0EA 1F2MA 3BVZA 1XYIA 4FNFA 4XT1B 2A6ED 1OXSC 3NTKA 4O42A 3K6OA 5COYA 1OXUA 3K58A 2BCOA 1W6JA 1PRTF 1M8AA 1BUVT 2WKDA 1AZPA 1B4OA 3DEPA 4K5WA 5IGEA 2JEBI 3PIO3 2EJGC 4J8QA 1FYCA 3P1HA 2NBFA 2HQEA 3NSWA 1B9NA 5C5LA 4F7XA 1D5XC 1PDQA 2PCFB 1UNSA 1SE4A 3A8IE 2QDBA 4DN4M 5KYIA 2CVRA 2L55A 1FNUA 2B2YA 1A15A 2WACA 1V1OA 4KTAA 2F0MA 1ONLA 1F9QA 4DK1A 3D3RA 1I4PA 3X3MA 3I3CA 4K8IA 1FD7D 1ET6A 2PQEA 1SSOA 3HOYB 1DCZA 5EBDA 4IALA 1TR5A 4S3SA 1DONA 1SNOA 1TWAB 4IFDI 2KA7A 5JEAH 2B2TA 4RCOA 1AP0A 5T1IA 1HRJA 1G91A 5E3FA 4G57A 3AMUA 2F0SA 2FJ2A 1U4PA 5ISRA 2B8GA 5EPLA 3GTJB 3O13A 4FO2A 3A8KE 4QUCA 2E2IB 1U4LA 4AYBB 3DEOA 4ID6A 5EQ0A 3BYTB 1XX8A 1ZYRC 4RGOS 1PFMA 3S15B 1KLGD 1QCBD 1UEAB 1A3TA 2LY7A 1L0XB 3BZDB 1TWGB 2PW5A 3A55A 2JEAI 1K83B 3FRPB 4CJ2C 4FF3A 2VNUD 1SYEA 1STNA 5I6YA 4B9WA 1QNUA 1KNAA 3TMEA 1CA5A 5C0XG 5M3FB 2F0IA 1A2UA 1AZQA 3L9AX 2JE6I 5C44B 1B53A 2KEEA 5J1ZA 1KDCA 4LJZC 4HCSA 4PNYA 2F1MA 5IODA 2RSNA 1DXMA 4CKBA 3EA6A 2ZXPA 1KABA 3IKJA 2SNMA 3BVMA 2DNCA 4QIWB 5JOBA 1BOSA 4QMGA 1SNPA 4ME5A 4IURA 2EZVA 3NK9A 3VR2A 3PUVA 5CV4A 2NVQB 5G3LD 2R93B 4MN3A 4K6DA 3FVQA 3QJYA 4MIUA 1HPCA 2EXZA 5I6WA 3R93A 4HEDA 3D6CA 1RF2D 1B50A 2JP1A 1YNND 4JBWA 4IUQA 4QB4A 1RTNA 3OIPA 1RD9D 2ICIA 1CTMA 2PZWA 2RKSA 2CW0C 3J81L 1E2VA 2E76C 5ELEA 1Z7TA 4N9TA 1PYWD 1BCPF 2Z8LA 1LTAD 5D14A 5FO7B 3GTGB 3I73A 5E4XA 3EVQA 3ND9A 1EIHA 2K28A 4A93B 2EE1A 4OO1G 5CORA 2NWGA 5JEAG 1H9RA 2L4NA 2PZUA 1Y1VB 3M4YA 5TSSA 1WTXA 1QWYA 3FMCA 1EY0A 3VR5A 1HFNA 1IYVA 1FNWA 2F4IA 2O5JC 4K8JA 4RA8A 2MGSA 2NN6G 4FXGC 4RKBA 5IGDA 1EIGA 4M1UB 1Y8OB 1SE2A 1XTCD 5D3DA 1A2TA 1CI3M 1Y1WB 5BN4A 3BVGA 2RDFA 3K0YA 1Q1EA 3GTOB 2KHSA 1PRTD 2B39A 3T51B 3MTSA 1I4QA 4R8NA 2A6HC 4C1NI 4HAEA 1JB3A 2TSSA 3A7LA 5I9OA 3ITPA 3QIAA 3S9WA 1EYDA 2AUKA 4DAVA 4OHJA 4F87A 3QG1A 3KBXA 5JPMC 3H3VC 2WAQB 2QCPX 1WTVA 1BNZA 5LHY1 2KVMA 2JA7B 3ND8A 1SXTA 3PO3B 2EY5A 4G7HC 3C1EA 5C4JB 5IGBA 1CFMA 5IIFA 1S4ZA 1PMRA 3MHBA 1TS2A 2E74C 5I2YA 5J22A 3OOCA 1HFGA 1SYBA 2KECA 1HHVA 3K5NA 2A69C 4KN4C 4RCNA 2ID0A 1GOZA 5T1GA 2EPBA 2N88A 4QF4A 2K32A 2NVYB 1GUGA 2BE5C 3PO2B 1STHA 2B2TC 5CBAE 4HSVA 1R4PB 4KY7A 1U4MA 3NXWA 5C4XB 3MWYW 2EJFC 2B2UA 1CQVA 5IGGA 1ICWA 1UAPA 5M3MB 1CZWA 1M4VA 4XXEA 1H9KA 1Q90A 4KY5A 1EU3A 3T53B 1MI2A 4ZLTF 4FXDA 3S1NB 1D5MC 2IL8A 4IUUA 2L9HA 1FR3A 2DNEA 1GUNA 1EQVA 3N52A 1DYQA 4DAYA 1GJXA 3MXGA 3HOVB 3DWQA 3SXHA 1EY4A 1VMCA 4DFAA 2HCCA 1G6ZA 2LS01 3VA7A 3S1QB 2FHTA 1WTPA 4XQQA 2K05A 3QOJA 3MC0B 2IX0A 4R9WA 3MEHA 2N55A 1PTOC 2AQ1B 1RHPA 3CRKC 1FGBD 1OXTA 4BA2I 1NAPA 1D5ZC 2JA6B 3CRLC 2LMCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EPB A;  2KED A;  1ZXT A;  4RA8 A;  2N88 A;  3LWE A;  3G7L A;  2MGS A;  2L1B A;  1EL0 A;  1F2L A;  3I90 A;  1DON A;  2HDL A;  4MN3 A;  1EIG A;  4IUP A;  1BO0 A;  2B2Y C;  1ROD A;  1X3P A;  1U4R A;  1JIC A;  3FDT A;  4X3K A;  2B2T A;  4XT3 B;  2D9U A;  2M2L A;  2B2T C;  2B2V A;  5CBA E;  4HSV A;  2XIW A;  1WVL A;  1AP0 A;  5T1I A;  1WD0 A;  1J8I A;  1HRJ A;  1U4M A;  2KUM A;  1G91 A;  2HCI A;  3DM1 A;  1BBX C;  3MWY W;  1SAP A;  3R93 A;  2B2U A;  4HED A;  2NZ1 D;  2L11 A;  2NYZ D;  4X3T A;  1QG7 A;  2FJ2 A;  1G2T A;  1LV9 A;  1ICW A;  1U4P A;  2HDM A;  2X6G A;  5AFW A;  1CA6 A;  3FPU B;  1GUW A;  1F9P A;  1RTO A;  2K03 A;  5EPL A;  1B2T A;  1Q3L A;  1WD1 A;  1F9R A;  1B50 A;  1DOM A;  2JP1 A;  4QUC A;  4U68 A;  1U4L A;  2B2W A;  1HUM A;  1TVX A;  4IUQ A;  3MTS A;  2B2W C;  3UI2 A;  1NCV A;  2H1E A;  3DEO A;  3HP3 A;  5EQ0 A;  4ZKC B;  1XX8 A;  1RTN A;  3GV6 A;  4XDX A;  1XYI A;  1MI2 A;  1PFM A;  4HAE A;  4XT1 B;  1ILQ A;  1PFB A;  4LMQ D;  1MGS A;  4NW2 A;  3D6W A;  4ZLT F;  2IL8 A;  4O42 A;  3IL8 A;  4IUU A;  2B2V C;  2DY7 A;  2L9H A;  3Q6S A;  5COY A;  2X69 A;  1SDF A;  1IL8 A;  1EQT A;  1WTW A;  2JYO A;  2MJ8 A;  2Q8T A;  4CJ1 B;  5EKI A;  4ZAI A;  2B2U C;  2SDF A;  2K01 A;  3I8Z A;  2L12 A;  1M8A A;  5EPK A;  5D65 A;  3QO2 A;  3ONA B;  2BDN A;  1WTO A;  1O7Z A;  4IUT A;  2RA4 A;  3N52 A;  4ZK9 B;  1B4O A;  1AZP A;  1VMP A;  2KOL A;  1F9S A;  3DEP A;  4CJ2 C;  5CBE E;  3KBX A;  3TZD A;  1MSG A;  2K1B A;  4OIJ A;  4RAU C;  3TN2 A;  1C8C A;  1HA6 A;  1O80 A;  1WTV A;  2EOT A;  1PFN A;  1BNZ A;  1KNA A;  3GV3 A;  1X32 A;  1ESR A;  1DOL A;  2RSO A;  1J9O A;  1VMC A;  2HCC A;  5D14 A;  1G6Z A;  2KVM A;  1CA5 A;  4QUF A;  1KNE A;  5EJW A;  1PDQ A;  5E4X A;  5EPJ A;  4RWS C;  1JE4 A;  3I91 A;  2FIN B;  1HUN A;  3F2U A;  1EOT A;  4MHE A;  2Q8R E;  1QNK A;  2HUG A;  4DN4 M;  4ZKB B;  1AZQ A;  1CM9 A;  4OIK A;  1WTQ A;  2FHT A;  1QE6 A;  2CVR A;  2J7Z A;  2K28 A;  2VXW A;  1WTP A;  1EIH A;  5E4W C;  2EE1 A;  1B53 A;  1S4Z A;  4IUV A;  2KEE A;  5COR A;  5JJZ A;  2B2Y A;  2MP1 A;  1A15 A;  2NWG A;  4HCS A;  1ILP A;  2K04 A;  4R8I A;  2K05 A;  1WTR A;  2RSN A;  2FMM A;  4X3U A;  1O7Y A;  3IFD A;  2L4N A;  3KUP A;  1DZ1 A;  5CMD A;  1NR2 A;  4R9W A;  2DY8 A;  1HFG A;  1IKM A;  1F9Q A;  3SVM A;  1E0B A;  1RJT A;  2N55 A;  4X3S A;  1IKL A;  2R3Z A;  1WTX A;  1NR4 A;  3I3C A;  3P7J A;  1B3A A;  2X6L A;  4CJ0 B;  1DOK A;  1RHP A;  1SSO A;  2RVL A;  2KEC A;  1HFN A;  1HHV A;  1PLF A;  1NAP A;  1G2S A;  1X3Q A;  1ML0 D;  2MPM A;  4IUR A;  1BF4 A;  4UAI A;  2FFK B;  5DNF A;  3H91 A;  5T1G A;  1MSH A; 
#chains in the Genus database with same CATH topology
 4DR2 Q;  2VB2 X;  2B63 B;  3G7L A;  3I4L A;  2L1B A;  3DLL A;  2K5V A;  3ZYY X;  3OSO A;  1RDP D;  1X3P A;  3SK5 A;  3GTQ B;  4DXF A;  1ESF A;  1O7L A;  2F0J A;  4RKL A;  5C5M A;  4OL7 A;  5BR8 L;  2EDG A;  2UUB Q;  1PXU A;  3NEM A;  2O4X A;  4XYQ A;  4OX9 Q;  1QG7 A;  5IWA Q;  1OTC A;  3S17 B;  5C0X H;  4HMJ A;  2K03 A;  2XVS A;  2RDG A;  4IPH A;  5IYC G;  2K33 A;  1AW7 A;  4LF7 Q;  4V19 0;  1U0L A;  4KKU A;  3CD6 A;  1NCV A;  2H1E A;  2VQF Q;  4IFD J;  2F0D A;  1ILQ A;  1VQO A;  1C4Q A;  2B2V C;  4QL5 A;  4EQP A;  1JWS D;  4TVA B;  1VQF A;  3ICE A;  1I94 L;  3AU7 A;  3RMH A;  1SMX A;  5BN3 A;  5IOC A;  3ONA B;  2D0O A;  2BDN A;  3S2D B;  5I4D A;  1F9S A;  2PNH A;  1XXG A;  1GO3 E;  4YCU A;  1HA6 A;  4OON A;  1KD1 C;  3D4R A;  4RGN A;  2KCN A;  4YCW A;  1VQG A;  2R7Z B;  5JVH 3;  1NY4 A;  3M4P A;  1D1K A;  3QWN A;  1SE8 A;  1HJP A;  3P20 A;  2K6A A;  4BBR B;  1JOK A;  4UP7 A;  1QE6 A;  2J7Z A;  2A68 D;  1LT5 D;  3IFT A;  1VQA A;  2IT1 A;  3Q22 A;  1DZ1 A;  4JI3 Q;  1E1T A;  2E2J B;  1SMY D;  4GNX A;  2BA1 A;  4ABN A;  5HUR A;  3ULL A;  1EFW A;  3PF4 A;  1DOK A;  4NXN L;  1B8A A;  2WKC A;  4I7A A;  1X3Q A;  2K5N A;  2MPM A;  2UU9 Q;  3A54 A;  2V4D A;  3NPP A;  1NMF A;  1WCM G;  4ILW A;  4EVO A;  2ZXR A;  4PMC A;  4WRD A;  2GVA A;  2WB1 G;  3TP7 A;  1SNC A;  2EYL A;  3QB3 A;  2K50 A;  4B3S Q;  3ZJY C;  3AFQ A;  2JA5 B;  2VQE L;  4B3R L;  4C3I G;  1TWC H;  2OQK A;  1WTH A;  3UE1 A;  1PFS A;  2IX1 A;  4A3G H;  1JJC B;  3STB C;  1GUW A;  1F9P A;  2SOB A;  2PW7 A;  5CV8 A;  5ELC A;  2XRQ D;  4DR3 L;  2QDL A;  4ZCK A;  4OO1 H;  4DAP A;  3GV6 A;  3TSS A;  2NVQ H;  1GHK A;  4MNO A;  1TQO A;  4BY7 H;  4HSP A;  4YY3 L;  3NWS A;  3D31 A;  1SBB B;  2X69 A;  2R7Z G;  1SRU A;  1SDF A;  3WOF A;  4A3I H;  1WTW A;  4DF7 A;  1IBL Q;  3RUZ A;  4DV2 L;  4R4C A;  3HOU G;  3J80 L;  2BA0 A;  3NTI A;  4POG A;  4I7Z C;  1IW7 C;  4PV1 C;  1VQH A;  3J80 E;  3FEW X;  4DUY Q;  4B3M L;  4CBV A;  1E24 A;  3M7G A;  1FNV A;  2NN6 H;  5GAG C;  1SRO A;  5K36 G;  2CKZ B;  1AEX A;  4X62 L;  1J9O A;  5ELO A;  3I72 A;  2PPB C;  3J7A 5;  2HIV A;  3KJP A;  1K8G A;  3C3L A;  4GLA C;  1K8O A;  2F0O A;  2HUG A;  2B29 A;  1K3B C;  5C0X I;  3M85 A;  3CW2 C;  4A3D H;  3PF5 A;  1S40 A;  1SE3 A;  3LNN A;  3FKI H;  3PUZ A;  3KUP A;  2DY8 A;  3B6Y A;  2DJF C;  2WFW A;  5FO8 B;  5JEA J;  4RHS A;  5KNC A;  2JA5 G;  1E2W A;  4TSS A;  4K2L A;  5LL6 X;  4KLK A;  5BN5 A;  4JBJ A;  5FLX c;  4IQZ A;  2GA4 B;  1BF4 A;  4I65 A;  1YJ9 A;  1EWH A;  3SEB A;  4A3K H;  3K59 A;  2NUC A;  3G6E A;  3VA5 A;  1H9S B;  1X65 A;  4G7O C;  2YTV A;  4L5R C;  1BO0 A;  4DXG A;  4C3J G;  2LFN A;  3J7Z C;  4QY7 A;  5LMN Q;  4R4Q A;  3HOW H;  1WOC A;  4A93 H;  2XN9 C;  3VYR A;  1TWC B;  1I4H A;  4A3C G;  2ICE C;  3CC7 A;  1XNQ Q;  1X9N A;  4BXX H;  3E0E A;  2JJQ A;  1STA A;  4LUV A;  4PMB A;  2QEJ C;  3DM1 A;  4A3G B;  2FMC A;  4NDX A;  4IJH A;  1SAP A;  1Y1V H;  2L11 A;  1F2Z A;  4X3T A;  5D3I B;  4CHT B;  3CAM A;  1LV9 A;  3U9O A;  4EQO A;  1TXY A;  1YIJ A;  3F2B A;  1SJE D;  3TBI B;  1BBU A;  4BY7 B;  1OO9 B;  5I9P A;  4LMQ D;  4DR7 L;  4A3I B;  5CYU A;  3KOJ A;  2K5Q A;  3VR4 A;  1I50 H;  4JCV E;  3C46 A;  1VF7 A;  1HTL D;  3RZD H;  3CCR A;  1EYG A;  5EKI A;  5IE8 A;  4ZAI A;  3PUW A;  3T1Y L;  4KMU C;  4JI1 L;  1Y1W H;  1YVC A;  2A19 A;  1O7I A;  2N49 A;  4A3M G;  4GOP C;  3CPF A;  3NBH B;  2L0C A;  1D6E C;  4IPC A;  1K8M A;  4OIJ A;  2E2H H;  4DKA C;  4BBS G;  2C5C A;  3PQI A;  1IYJ B;  3CME A;  4IN3 A;  2RSO A;  1HQM C;  1SYG A;  4DR4 L;  5C4Z A;  4A3B G;  1YBY A;  2K5D A;  4RWS C;  3I91 A;  3VR3 A;  4A3D B;  1BXT A;  4HCE A;  2N3S A;  5C3E B;  4LW1 A;  3FKI B;  2VQF L;  4G7Z C;  1JCK B;  5JJZ A;  1JQY D;  4F8M A;  3PMF A;  1WTR A;  1VCI A;  2EVB A;  4X3U A;  3IFD A;  3LX0 A;  4DNI A;  4OO1 I;  3J81 E;  2AMC B;  4FF2 A;  3LWU A;  4PG3 A;  2TMP A;  4X3S A;  1IKL A;  2F3I A;  5IT9 L;  5I2X A;  2X6L A;  2HIX A;  4A3K B;  1OXV A;  1EY7 A;  3DMU A;  1S3O A;  2NVX H;  4KKT A;  4C3H G;  5IGF A;  1KDA A;  1VQC A;  1N34 L;  1QVF A;  2VUM G;  2CH4 W;  3HOW B;  1I4R A;  2E8G A;  4HIO A;  4L63 B;  4KHZ A;  1LT3 D;  3HKS A;  3PIO A;  1VQP A;  1T5E A;  1CKM A;  3J7A V;  2NN6 I;  3A5Z B;  2R92 H;  1S5D D;  4HN7 A;  4FYD A;  4OEL B;  2Q2H A;  1YNJ C;  4KHV A;  2JXM B;  2AQ3 B;  4YIJ A;  4DV3 Q;  2KEN A;  1JOO A;  3MEF A;  4DV5 Q;  1TWH H;  4A3J G;  1TS5 A;  3E3X A;  1RTO A;  2IY5 B;  1B2T A;  1TII D;  4P2C B;  3MXP A;  4U68 A;  4A3L H;  4LFC L;  3GDE A;  1HR0 L;  1VQB A;  3D4W A;  2CHB D;  2XRS D;  1ZYR D;  2F0W A;  1E1O A;  2JA8 H;  1I50 B;  4CKE A;  1Y14 B;  3RZD B;  4FVM A;  1AFP A;  2DY7 A;  3OWF A;  4YCV A;  1QZH A;  4CGY B;  3VYS A;  4P71 A;  4A3D G;  4AIM A;  3I8Z A;  2D5D A;  2ASB A;  1H9M A;  1UUP A;  1LAB A;  1Q8I A;  5EPK A;  1PVO A;  1Y8P B;  5C4X H;  5C3E G;  3OPO A;  4HJ8 A;  4IUT A;  2RA4 A;  1HNX Q;  2E2H B;  1Z6H A;  4TQU S;  1CK1 A;  4NXM Q;  3W2D A;  3KF8 A;  4EQN A;  2F52 A;  1RIP A;  4B3T L;  1VQ9 A;  4LF4 L;  4LF8 L;  3FP9 A;  1LTI D;  1B9M A;  3R3O A;  4QUF A;  2F3V A;  4NKL A;  3U58 A;  1CHQ D;  5ELD A;  3S1N H;  1SJH D;  1QNK A;  4E6I A;  4K5X A;  1JR0 D;  4UP8 A;  1WTQ A;  4AQY Q;  3NUC A;  1HCZ A;  1EFI D;  2AKW B;  4DR5 L;  2EY1 A;  3JAM c;  1CKO A;  5GQO A;  5E1F A;  2MP1 A;  1HNZ Q;  1GUT A;  4FXK C;  3KF6 B;  2PQA B;  2KCM A;  5IYC H;  1SYD A;  5CMD A;  3H0G B;  3SHL A;  5LMU Q;  2NVX B;  1TY0 A;  4OWW B;  4K0K L;  3SVM A;  2IJ0 A;  2CQO A;  2R3Z A;  4GKK Q;  3MZ5 A;  5C3W A;  3HKZ E;  4TKO B;  1S5F D;  3FHW A;  1CSP A;  2KED A;  4L5T A;  4CKC A;  2PI2 A;  2MHV A;  1H95 A;  1SFO H;  2Y0S B;  2R92 B;  3BDL A;  3S1Q H;  2H5X A;  3SK4 A;  2B2Y C;  3S2H H;  4B9X A;  1ET9 A;  3T16 A;  3FDT A;  3TP6 A;  3GTK H;  1LAC A;  2Z6K A;  4JYA L;  1SYF A;  1BCP C;  2KCC A;  3V2T A;  2E2D C;  4PZ8 A;  3K8A A;  5HY6 A;  3VYT A;  4LF6 Q;  1TWH B;  4PMW A;  3TZU A;  1Q8K A;  4N9P A;  4HJA A;  2I46 A;  4DV0 L;  4JOI A;  4V0B A;  2EYH A;  1PH9 A;  2UXB Q;  4GKJ Q;  2HDM A;  2EY6 A;  2LXJ A;  4J1M A;  4GOP B;  4DV7 L;  3EIV A;  1A6X A;  2B3G A;  4KD3 A;  1EOV A;  2JA8 B;  1P8L A;  4P74 A;  2KCT A;  2EYJ A;  1PFB A;  2A6E C;  3F2C A;  4LFA Q;  1F2Y A;  3IL8 A;  4U67 3;  2J0T D;  3V05 A;  2XSC A;  3FPP A;  1QJO A;  3HOZ B;  1I4X A;  3RN5 A;  5FO9 B;  4PZ7 A;  1BBW A;  2R6G A;  4IUN A;  2CW0 D;  4DV6 Q;  4LK1 C;  3TQY A;  3KF6 A;  2MO0 A;  2RCN A;  4K14 A;  2F0P A;  3S17 H;  1L0Y B;  1NMG A;  1WCM H;  4Q5V A;  1MD2 D;  1Z9F A;  4JC0 A;  1KAW A;  1O80 A;  3H0G G;  2EXD A;  3GV3 A;  1HXY D;  5KND A;  3GTP H;  3SGI A;  3KBG A;  1N32 Q;  3H3V H;  3TEH B;  2XTI A;  2QKI C;  1V43 A;  4QQB X;  2ZJP A;  1HUN A;  1QB5 D;  2IW3 A;  2E5L Q;  1N33 L;  4EGV A;  1EOT A;  4ZYS A;  2OTJ A;  2A73 B;  2JSO A;  3P75 A;  2Q2I A;  4C3I H;  5JPN C;  4JK1 C;  4O0A A;  2VXW A;  5E4W C;  2K04 A;  2EJM A;  4LF5 Q;  5EAY A;  2F0G A;  4HTH A;  4UHV A;  3WDN A;  4FF1 A;  5GRO A;  2NTT A;  3BDO A;  3QR8 A;  1PH1 A;  1RJT A;  3WWV A;  4BS9 A;  1B3A A;  2RVL A;  4MTN A;  4UPA A;  1SFO B;  4RGM A;  1A3V A;  1JWU D;  4X64 L;  4HMI A;  3KDF A;  1LTL A;  2HHH L;  2R7D A;  4QCL A;  2R7Z H;  1DOL A;  3NQI A;  3S2H B;  3LWE A;  3GTK B;  4YHH L;  3HOU H;  3H6M A;  3E0J A;  3AYH B;  3Q0A A;  5KIX A;  4JI4 Q;  3KFU A;  2F0U A;  1AH9 A;  4ZRZ A;  5F2D A;  1UE6 A;  4O2D A;  1YIT A;  2O5I C;  1A3U A;  2HCI A;  3PUY A;  5K36 H;  2DGY A;  1BBX C;  1TY2 A;  1AE3 A;  5CV7 A;  1T9H A;  5IYB G;  2UXD L;  3HOZ G;  1G2T A;  1X3G A;  3VYU A;  4UP9 A;  4JBK A;  1I6V C;  2MUY A;  3GTM B;  2AWO A;  4AYB E;  2B2W A;  1W3S A;  5FJ8 G;  4ZUI A;  3C2P A;  3UI2 A;  3OTO Q;  3A8J E;  1QZG A;  2A6H D;  3S16 H;  1MKH A;  4JI2 Q;  3HGB A;  3GP7 A;  3Q6S A;  2P5Z X;  2FXQ A;  3GTL H;  2N78 A;  2K7V A;  4KJN A;  4M8A A;  4Y52 H;  4J6H A;  1HZB A;  2JA5 H;  4ALP A;  5C3X A;  1WCM B;  3OMG A;  1FJG Q;  5EGT A;  1S5E D;  4DGZ A;  2A5H A;  3A74 A;  1L1O B;  3K80 C;  1YI2 A;  2K1B A;  3GTP B;  3IAY A;  3CU7 A;  2WB1 B;  2Q8I B;  4DR1 L;  1V1P B;  3EJI A;  4RHR A;  4C3J H;  2K5H A;  4DR6 L;  1PZK D;  3T4A C;  4C3I B;  2UXC Q;  2BOS A;  2C9O A;  1UE1 A;  5EJW A;  5EPJ A;  4HIM A;  4A3C H;  4RGT A;  2FIN B;  1SND A;  3T56 B;  4MHE A;  1S72 A;  2IPK D;  1CM9 A;  4OIK A;  1AN8 A;  2KQ3 A;  1XMQ Q;  5KGU A;  2A74 C;  4JI8 Q;  4JI5 L;  1TS4 A;  3K5O A;  1HZA A;  2F4V L;  3H09 A;  1O7Y A;  2M00 A;  5CV9 A;  1IXR A;  3T1H L;  5ELF A;  3UDX A;  3W3A A;  4JI6 L;  4QIW E;  1HQR D;  2F3W A;  1NR4 A;  3KLS X;  1SEB D;  4CJ0 B;  3K57 A;  3SDZ A;  1ASY A;  3PIP 3;  2G9D A;  2M9V A;  2CQA A;  1GHJ A;  1PTO H;  3S24 A;  2OEO A;  3K7U C;  2FFK B;  2A69 D;  4EX5 A;  1J6Q A;  2ENB A;  3HOU B;  2KJX A;  2OF1 A;  3EBE A;  1KNE A;  5KEE A;  3MAQ A;  1OXX K;  4EQ5 A;  1I3Q B;  5C0X J;  3M4Q A;  3I90 A;  2OT2 A;  2AWN A;  1H9J A;  1O78 A;  4A3F G;  5EBC A;  4A3M H;  2BE5 D;  4H7B A;  1Q1B A;  1C7Y A;  3JC6 6;  3TS2 A;  3CCS A;  2F0K A;  4DK0 A;  1WD0 A;  3ULP A;  3H3V I;  4BBS H;  2BDO A;  2NTS A;  4H44 C;  1HTP A;  1EEI D;  2NYZ D;  4K2K A;  3JAM i;  3UE0 A;  5M5Y H;  2KBN A;  3MVV A;  5IP9 G;  2I5M X;  1G51 A;  3AB9 A;  3RN2 A;  1X3F A;  3U9S A;  4BA1 I;  4A3B H;  4LF9 L;  3K0X A;  1WD1 A;  3S16 B;  1DOM A;  3OMC A;  4JV5 L;  1YNN C;  1K8A C;  1I6H H;  1HNW Q;  1ASZ A;  1E22 A;  4Y7N H;  1LTR D;  2PNR C;  2Z1C A;  3F8T A;  3R2I A;  1V1P A;  2EY2 A;  3GTL B;  4GN3 B;  5LL6 S;  3CCJ A;  2ES2 A;  3HKZ G;  2QIL A;  5EKL A;  4ULL A;  4TRD A;  4F88 A;  2MJ8 A;  2YTY A;  4C56 C;  4CJ1 B;  4O1N A;  2WV6 D;  3C1F A;  1JJ2 A;  1VQ7 A;  2L12 A;  3PV0 A;  1RCV D;  3CKI B;  3QO2 A;  3F2D A;  3W5O A;  4C3H H;  4KJO A;  1EY5 A;  3I70 A;  5CV6 A;  4ZK9 B;  2L5T A;  3R2T A;  4Q0F A;  2VUM H;  4C3J B;  1MSG A;  5FK9 C;  4FP5 D;  3HOX G;  3TDQ A;  2JQO A;  4DV1 L;  4PQX A;  2EOT A;  2HD3 A;  2PO4 A;  3ER0 A;  2D62 A;  3V96 A;  3GD7 A;  1N9W A;  5M5X H;  5JAV A;  2WIN B;  2Q8R E;  4JI0 L;  1LO5 D;  3L3O C;  3HS0 C;  1XMO Q;  4A3J H;  4OWX B;  3VR6 A;  3QOL A;  3PUX A;  1NR2 A;  2F0H A;  3Q23 A;  1S5B D;  2ZM6 L;  2JA9 A;  1VQE A;  1PTO B;  2K75 A;  1PTO D;  1XJV A;  2I07 B;  4JI7 L;  3EFX D;  3GQB A;  2JN4 A;  3W1G A;  1MBY A;  3I2Z A;  2ZT9 C;  1A62 A;  1PLF A;  4X65 Q;  2CH4 A;  4DV4 Q;  1LTS D;  1UE7 A;  1EYC A;  5IYD H;  1QVG A;  5CC4 A;  4KN7 C;  1K73 C;  4IFD G;  4XQJ A;  1MJC A;  3F1Z A;  2PI2 E;  3CC4 A;  4A3M B;  2I0Q A;  5FOB B;  1F2L A;  5C3E H;  2NVT H;  3SE0 A;  2CFM A;  1X55 A;  1U4R A;  1QVC A;  2VW9 A;  1FGU A;  4UY8 C;  2Z6K C;  2E5L L;  2UUA Q;  1V8Q A;  4BBS B;  3I4O A;  1AE2 A;  2D9U A;  3ERQ A;  2XNA C;  1IZ6 A;  5M5Y B;  1VDZ A;  4LUO A;  4A3B B;  1PZI D;  1RKN A;  2EIF A;  4KHP L;  3Q24 A;  3NQT A;  3RLO A;  2OCE A;  5AFW A;  1I6H B;  4J15 A;  3FPU B;  5M9O A;  3BG3 A;  3G6J B;  4Y7N B;  1GM5 A;  1BR9 A;  4BY1 H;  1GKH A;  1W6K A;  1PRT C;  1F9R A;  3SK8 A;  3HP3 A;  2H4O A;  4OWT B;  1LUZ A;  4NW2 A;  3E6Z X;  3D6W A;  5EKK A;  1KLU D;  3CCV A;  1EQR A;  3VDY A;  3DWP A;  4R4O A;  3DWA A;  1LTG D;  1EQT A;  4UDU C;  3RLF A;  4C3H B;  2Q8T A;  3KJO A;  1CKN B;  1NUC A;  3KLS A;  2O2L D;  2B2U C;  3H94 A;  1XNR Q;  1X6O A;  4DUZ Q;  1W2B A;  5D65 A;  1D2B A;  4L8J A;  2VUM B;  1KRT A;  2UUC Q;  4DA2 A;  4XIG S;  1Q46 A;  4X6A H;  1STG A;  1EZ8 A;  2DUD A;  2CWP A;  1NTG A;  1IBK Q;  1D8L A;  5FLX L;  5ELB A;  4CDF C;  5M5X B;  1ESR A;  3URY A;  3L2P A;  4DR2 L;  3DUZ A;  4H02 A;  1LLR D;  5FLX E;  1IHZ A;  1QIL A;  1N36 Q;  4ZKB B;  3CCU A;  4A3J B;  3DHQ A;  3J7A F;  4LFB Q;  1EZ6 A;  1Q82 C;  2ZXO A;  1IBM Q;  2LXK A;  4FF4 A;  5AJ3 Q;  4AYB G;  1VQD A;  2Z9H A;  2FMM A;  4XQN A;  2UUB L;  2RQX A;  1HH2 P;  2RHQ B;  2QF7 A;  3J81 c;  3K5M A;  2QGQ A;  3J81 j;  4OX9 L;  1HA5 A;  1ZKO A;  1SR3 A;  3HRZ C;  5IWA L;  1KC8 C;  1KAA A;  3E5S A;  1STY A;  4LF7 L;  1R4Q B;  1KDB A;  1ML0 D;  4UAI A;  2PMZ E;  3AFP A;  3H91 A;  5FLM G;  2NVT B;  1H9S A;  4KI0 A;  4X66 Q;  4BWG B;  4L5Q A;  1G8Z D;  1LT4 D;  1PV4 A;  3MFY A;  4X3K A;  4LUZ A;  1II3 A;  1PH3 A;  4R1J A;  2B2V A;  2PYK A;  1PHJ A;  3A56 A;  4LAA A;  4P72 A;  4GZY C;  4KKS A;  5M3F G;  1J5E Q;  3S14 B;  3H0G H;  4BY1 B;  1GD7 A;  1EYA A;  3OIQ A;  3OW2 A;  4QGU A;  3MXU A;  1KTK A;  5IT9 E;  2IWH A;  1STE A;  3STB D;  2IHF A;  4WJW A;  5C44 G;  2GVB A;  1EQQ A;  1WJJ A;  1JE5 A;  5KYL A;  5HGT A;  2B2W C;  1EEF D;  1K9M C;  1VQI A;  1XWE A;  4C2M H;  4XDX A;  2F0N A;  3S1M H;  3BS1 A;  1XPU A;  3BDC A;  1VQM A;  2EYO A;  5JJK A;  2XWB B;  3CF5 A;  1IL8 A;  2R7F A;  1LM0 A;  2SDF A;  3TP5 A;  4WFN 3;  3G4S A;  4KV6 A;  5BR8 Q;  5A2Q L;  1ZEQ X;  2QA4 A;  4JI3 L;  1JOQ A;  5E7N A;  3NBH A;  1IW7 D;  3W1B A;  4GS3 A;  5A2Q E;  5DEH A;  4RAU C;  2Z4H A;  5DM6 3;  1VQ6 A;  2UU9 L;  4A3E H;  5KRU A;  1X32 A;  1E2Z A;  3BJU A;  2RDH A;  3DXJ C;  1SYC A;  2CCZ A;  3T13 A;  3MFG A;  2YU9 B;  2J4X A;  5IYD G;  3S1R H;  3SK6 A;  1QUQ B;  3J7Y W;  1Y69 U;  2OWO A;  1B44 D;  2R61 A;  4IUV A;  3L7Z C;  5IYB H;  4B3S L;  2Z6B A;  3HOZ H;  1I94 Q;  3RNU A;  4H13 C;  2IX3 A;  1M1K C;  3OW7 A;  3KK7 A;  3EQL C;  4DNR B;  1JJG A;  2ZJQ A;  4MTK A;  5FJ8 H;  1IYU A;  1LYL A;  1KQS A;  3HZX A;  2EYF A;  5CV5 A;  4BY1 G;  3RD4 A;  1N8R C;  4JPB W;  3KLW A;  1PRT B;  2PZT A;  5DAU A;  1TKW B;  3M3Y H;  3A7A B;  3D8G A;  1EL0 A;  4WJ3 M;  3M4O H;  2HDL A;  2LSS A;  3KLR A;  3WOE A;  4HR7 B;  1PH2 A;  4XT3 B;  1ENA A;  4KY6 A;  1IBL L;  1TWF B;  1L0W A;  4GNX C;  1WVL A;  1ENC A;  4DUY L;  4RFB A;  1CA6 A;  1A63 A;  4NXN Q;  3UDG A;  3E9H A;  4HJ9 A;  1Q3L A;  4C2M B;  1F77 A;  1FL0 A;  1TU2 B;  1TVX A;  4H0L C;  3X3N A;  3S1M B;  2F0F A;  1PTO F;  2OQ0 A;  1HZ9 A;  1EIF A;  4IOA A;  2NZO A;  1LTB D;  1DM0 B;  3TRZ A;  3JAM L;  4KK7 A;  3HFZ B;  1DD2 A;  3PSI A;  2VQE Q;  4NPS A;  2YYZ A;  1R9T B;  3H15 A;  3JAM E;  4KD4 A;  3D4D A;  4ME3 A;  2V1C C;  4DAY B;  5CBE E;  1EWC A;  4NMZ A;  4A3E B;  1GXD C;  3TZD A;  2SNS A;  3N6R A;  1C8C A;  1S5C D;  3GTM H;  3S1R B;  4A3F H;  4DR3 Q;  3NE5 B;  4WOR A;  1Q12 A;  1YZ6 A;  4K5V A;  2EQS A;  1JE4 A;  1Z47 A;  2PMZ B;  3TP8 A;  5LMN L;  1HZC A;  3CHB D;  3I4N B;  2VB3 X;  3RR5 A;  1GUS A;  2A68 C;  1XNQ L;  2WP8 J;  4L6T B;  4R8I A;  2PQA A;  5IP9 H;  4DV2 Q;  2YTX A;  1CUK A;  2RF4 A;  2XWJ B;  1T5X D;  5IGC A;  1IKM A;  1SMY C;  3OWE B;  5CGK A;  1E0B A;  1PH8 A;  1LT6 D;  2AQ2 B;  3P7J A;  5JVG 3;  4B3M Q;  3HG9 A;  2G9H D;  3NHH A;  1JOR A;  2AUJ D;  1G2S A;  4X62 Q;  3M3Y B;  3IRB A;  5DNF A;  2K5W A;  3ERO A;  3M4O B;  1MSH A;  2OXP A;  2RCF A;  5HGQ A;  3R8B A;  5C4H A;  3U4Z A;  1C48 A;  4C1N K;  4IUP A;  3G71 A;  1JIC A;  1EU4 A;  4ZUJ A;  5K5P A;  1Q81 C;  3RZO H;  4LNQ A;  3BYY B;  1SN8 A;  3OHX C;  1YNJ D;  2XIW A;  3MXN B;  2C35 B;  2F0T A;  3MA2 B;  2JA7 G;  4DNT B;  3HOX H;  4K6L A;  4GN5 A;  3PO3 G;  1CHP D;  2NZ1 D;  3BZK A;  1G6P A;  2Z4I A;  1U9R A;  1ICF B;  4GOP A;  5G3L F;  3A5U A;  2F0Q A;  4RH6 A;  3CQZ H;  3K7A B;  1C9O A;  1PH7 A;  1CT1 D;  2EYP A;  2F0L A;  5M5W H;  3J81 i;  4B08 A;  4A3E G;  1EWI A;  2F03 A;  2OTL A;  4ZQ3 A;  1I3Q H;  1BKB A;  1MGS A;  2LKV A;  4XYO A;  3HEJ A;  2E75 C;  5KNB A;  1L2F A;  2JYO A;  3SR1 A;  1Y8N B;  1CQF A;  1IL2 A;  5FKA C;  2K01 A;  1E3P A;  1JC7 A;  3I4N G;  1WTO A;  1O7Z A;  4IZ8 A;  5C6A A;  2EYM A;  1CZG A;  3ERS X;  1VMP A;  2KOL A;  4NP5 A;  5A35 A;  1SNM A;  1PZJ D;  4IFD H;  1J5E L;  4A3F B;  1B1Z A;  3TN2 A;  2RHS B;  4A76 A;  1LTT D;  2B8F A;  2KHI A;  5CR3 A;  5GAD C;  1PFN A;  3PO2 G;  1I4G A;  1SNQ A;  4NB3 A;  4APV A;  2G5D A;  2ZTC A;  1QOH A;  4POF A;  1A8V A;  5J39 A;  3I4M B;  1TS3 A;  3F2U A;  4DR7 Q;  5M3M G;  1BDO A;  2IHE A;  3M7N A;  1K3R A;  1BQQ T;  1X56 A;  1ILP A;  3NEL A;  3T1Y Q;  4JI1 Q;  4A4I A;  1D1I A;  3NTH A;  4DV3 L;  4YWK A;  1EY9 A;  1STB A;  1UEB A;  3MXN A;  4DV5 L;  4GNX B;  1TT2 A;  3CP0 A;  3EN2 A;  3K5L A;  4GN4 B;  3HKZ B;  1GUO A;  4Z9C B;  4JBM A;  1VQ4 A;  3HOY H;  4XTC S;  2RBM A;  2I5H A;  4DR4 Q;  1G29 1;  1ZXT A;  1VF5 C;  4OGQ C;  4ODG A;  3NWT A;  3RZO B;  4YWL A;  1NSN S;  4FDB A;  5DM7 3;  1ROD A;  2K52 A;  2NB0 A;  2F0V A;  4DU9 A;  3HOV G;  2D2C C;  4G4K A;  1EY6 A;  3HOX B;  1YEZ A;  1BCP B;  1JB7 A;  1BCP D;  1TWA H;  1ENF A;  2M2L A;  3GO5 A;  1J8I A;  2WII B;  2KUM A;  1JWM D;  1HNX L;  1WYD A;  5NUC A;  3CQZ B;  2X6G A;  5M5W B;  4NXM L;  1EY8 A;  1K0R A;  2A8V A;  4P75 A;  2DN8 A;  2SEB D;  1N34 Q;  1HUM A;  5L37 A;  3NBI A;  3NP8 A;  1DJR D;  3GTJ H;  3BZC A;  4ZKC B;  3CC2 A;  2F0E A;  1F2M A;  3BVZ A;  1XYI A;  4FNF A;  2E2I H;  4XT1 B;  1MHW C;  2A6E D;  1VQK A;  1OXS C;  3NTK A;  4O42 A;  4AQY L;  1V1Q A;  5JJL A;  3K6O A;  5COY A;  1OXU A;  2K14 A;  3K58 A;  3I4M G;  3S15 H;  1FVI A;  2BCO A;  1HNZ L;  1JT8 A;  1W6J A;  3CPW A;  1DGS A;  1MIU A;  1PRT F;  1M8A A;  2JA6 G;  1BUV T;  2WKD A;  2B63 G;  5LMU L;  4IPD A;  1AZP A;  1B4O A;  3DEP A;  4K5W A;  5IGE A;  3DM3 A;  1TWG H;  1L1O A;  2JEB I;  3CCM A;  4GKK L;  5FLM H;  3PIO 3;  2EJG C;  4J8Q A;  1K83 H;  1FYC A;  1YJN A;  3P1H A;  2NBF A;  2HQE A;  3NSW A;  1B9N A;  4LFC Q;  5C5L A;  1YNX A;  4F7X A;  1D5X C;  1HR0 Q;  1PDQ A;  2PCF B;  1UNS A;  1SE4 A;  3A8I E;  2QDB A;  4DN4 M;  4RMF A;  4HIK A;  5KYI A;  5M3F H;  2CVR A;  2L55 A;  1FNU A;  5IP7 G;  2B2Y A;  1A15 A;  2WAC A;  4LF6 L;  4N8X 1;  5C44 H;  3J80 c;  1V1O A;  4KTA A;  2F0M A;  1ONL A;  4IO9 A;  1F9Q A;  4DK1 A;  3D3R A;  2UXB L;  4GKJ L;  1I4P A;  3X3M A;  3I3C A;  4K8I A;  1FD7 D;  1ET6 A;  2PQE A;  1SSO A;  3HOY B;  3U4V A;  1DCZ A;  5EBD A;  4B3T Q;  4LF4 Q;  4LF8 Q;  4IAL A;  1TR5 A;  4S3S A;  2ZTE A;  1DON A;  1SNO A;  4LFA L;  2D0P A;  1TWA B;  4IFD I;  2KA7 A;  4DR5 Q;  2A1A A;  5JEA H;  2R93 H;  2B2T A;  4RCO A;  1AP0 A;  5T1I A;  4CDE C;  1XTD A;  3CXC A;  4DV6 L;  1HRJ A;  1WI5 A;  1G91 A;  5E3F A;  4G57 A;  3AMU A;  5GAE C;  2F0S A;  5DLQ E;  4K0K Q;  2FJ2 A;  1U4P A;  4BBR G;  1UE5 A;  3I56 A;  5ISR A;  2B8G A;  5EPL A;  3GTJ B;  3O13 A;  4FO2 A;  3A8K E;  4QUC A;  2E2I B;  1U4L A;  3M9B A;  4AYB B;  1N32 L;  3DEO A;  4ID6 A;  5EQ0 A;  3BYT B;  1XX8 A;  3G48 A;  1ZYR C;  4RGO S;  1BVS A;  2Z0S A;  1PFM A;  3S15 B;  2MO1 A;  1KXL A;  1EUJ A;  3CCE A;  4JYA Q;  1KLG D;  1QCB D;  4JOI C;  1HR0 W;  1UEA B;  1A3T A;  2LY7 A;  4LF5 L;  2VL6 A;  2I5L X;  1L0X B;  3BZD B;  1TWG B;  2VY3 A;  3S14 H;  2PW5 A;  4DV0 Q;  3A55 A;  2JEA I;  1K83 B;  3FRP B;  4CJ2 C;  3CCL A;  1VQL A;  1P16 A;  4FF3 A;  4DV7 Q;  2VNU D;  1SYE A;  4HID A;  1PYB A;  1STN A;  5I6Y A;  4B9W A;  1QNU A;  1KNA A;  3TME A;  1CA5 A;  5C0X G;  3HOY G;  5M3F B;  2F0I A;  1A2U A;  1PA6 A;  1AZQ A;  2DJG C;  3GTG H;  3L9A X;  2JE6 I;  5C44 B;  4JI4 L;  2KHJ A;  1B53 A;  2KEE A;  5J1Z A;  1KDC A;  4LJZ C;  4HCS A;  4PNY A;  2F1M A;  5IOD A;  2RSN A;  1DXM A;  4CKB A;  3EA6 A;  1X3E A;  2ZXP A;  2WAQ E;  1YHB A;  1KAB A;  3IKJ A;  2SNM A;  3BVM A;  2DNC A;  4QIW B;  5JOB A;  1BOS A;  4QMG A;  1SNP A;  4ME5 A;  4IUR A;  2EZV A;  3NK9 A;  3OTO L;  3VR2 A;  2YU9 H;  3PUV A;  5CV4 A;  2Y0S E;  3L0O A;  2NVQ B;  4JW0 A;  5G3L D;  1N33 Q;  2R93 B;  4JI2 L;  4MN3 A;  2VZA A;  3PCO B;  2HQL A;  2ZTD A;  1CSQ A;  4RG1 A;  4K6D A;  3FVQ A;  3QJY A;  4MIU A;  4IJL A;  1HPC A;  2EXZ A;  5I6W A;  1FJG L;  3R93 A;  4HED A;  1MJE A;  3UDI A;  5IT9 c;  3D6C A;  3RLN A;  1RF2 D;  1NBW A;  3I7F A;  5H1S E;  1GVP A;  1B50 A;  2JP1 A;  1YNN D;  1K28 A;  4JBW A;  4X64 Q;  4IUQ A;  2HHH Q;  3GTO H;  4QB4 A;  2UXC L;  1RTN A;  1U5K A;  3OIP A;  4YHH Q;  2AHO B;  3PIP A;  1RD9 D;  2ICI A;  5ELN A;  1XMQ L;  1X54 A;  1B3Q A;  4JI8 L;  1CKN A;  1CTM A;  1TWF H;  2PZW A;  2RKS A;  1PH5 A;  4DPG A;  3A0J A;  2CW0 C;  3KYH C;  1WFQ A;  3J81 L;  4GLV B;  1E2V A;  5GAH C;  2E76 C;  4HJ7 A;  2UXD Q;  5ELE A;  1Z7T A;  4N9T A;  1M90 C;  1PYW D;  1BCP F;  5LMN W;  2MFI A;  3KF8 B;  2Z8L A;  1LTA D;  4OEM B;  1VQN A;  2BH2 A;  5D14 A;  5FO7 B;  1PH6 A;  2QEX A;  3TRE A;  3GTG B;  4A3G G;  3I73 A;  5E4X A;  4IOC A;  2MQH A;  3EVQ A;  3ND9 A;  3ULJ A;  1KIX A;  2JA7 H;  4DK6 C;  3E9I A;  4IPG A;  1EIH A;  2K28 A;  4A93 B;  2EE1 A;  3PO3 H;  4OO1 G;  2L15 A;  5COR A;  2NWG A;  5C4J H;  5JEA G;  1K0S A;  1H9R A;  2R93 G;  1R9T H;  4AH6 A;  4BY7 G;  2L4N A;  4DK3 C;  2PZU A;  4GLX A;  3CMA A;  4A3I G;  1NJI C;  1Y1V B;  3M4Y A;  4N8F A;  5TSS A;  1WTX A;  1QWY A;  2XGT A;  1EY0 A;  3FMC A;  3VR5 A;  1HFN A;  1IYV A;  1FNW A;  4DR1 Q;  4PZ6 A;  1HNW L;  4R4T A;  4DR6 Q;  2F4I A;  2GN5 A;  3D0F A;  2O5J C;  4K8J A;  4RA8 A;  2MGS A;  1B7Y B;  2NN6 G;  3AQQ A;  1KHI A;  4FXG C;  1XPO A;  4RKB A;  5IGD A;  1EIG A;  4M1U B;  1Y8O B;  1SE2 A;  3I4N H;  1XTC D;  2NVY H;  1VQ5 A;  4JI5 Q;  5D3D A;  3TS0 A;  2F4V Q;  1A2T A;  1CI3 M;  4P73 A;  2ALY B;  3UDF A;  1Y1W B;  5BN4 A;  3BVG A;  3PO2 H;  1NE3 A;  3T1H Q;  2RDF A;  3K0Y A;  1Q1E A;  2N8N A;  4JI6 Q;  3FKI G;  3GTO B;  3J80 i;  2KHS A;  1PRT D;  2B39 A;  4MZ9 A;  2MNA A;  5JJI A;  5M3M H;  3T51 B;  3MTS A;  1I4Q A;  4R8N A;  2A6H C;  4C1N I;  4HAE A;  1JB3 A;  2TSS A;  4JVZ A;  3A7L A;  1KRS A;  5I9O A;  2HT1 A;  4A3K G;  3ITP A;  3QIA A;  4L5S A;  3S9W A;  1EYD A;  1XMO L;  2AUK A;  3LGJ A;  4DAV A;  1EIY B;  4OHJ A;  2Q2T A;  3PGZ A;  2BH8 A;  3HOW G;  4A93 G;  4F87 A;  3QG1 A;  4BXX G;  1Q86 C;  3KBX A;  1YJW A;  1L1O C;  1VS0 A;  5JPM C;  2WB1 E;  4X65 L;  3H3V C;  4LF9 Q;  2WAQ B;  2QCP X;  3BU2 A;  3K7A H;  1WTV A;  4DV4 L;  1BNZ A;  1Y1V G;  4JV5 Q;  3HOV H;  5LHY 1;  2KVM A;  2JA7 B;  5IY0 A;  1JMC A;  3ND8 A;  1SXT A;  3PO3 B;  1QUQ A;  2EY5 A;  2NZH A;  4WJ4 A;  4G7H C;  3C1E A;  3U50 C;  5C4J B;  5IGB A;  1CFM A;  5IIF A;  5J3B A;  4B3R Q;  2UUA L;  1S4Z A;  1PMR A;  3MHB A;  3I55 A;  1TS2 A;  2E74 C;  5I2Y A;  5J22 A;  3OOC A;  1HFG A;  1UWV A;  1SYB A;  3OYY A;  2ATW A;  1Y1W G;  2KEC A;  1HHV A;  4DV1 Q;  3K5N A;  2A69 C;  4KN4 C;  4RCN A;  4JG2 A;  2ID0 A;  3KDF B;  1GOZ A;  1B70 B;  5T1G A;  4YY3 Q;  2EPB A;  3CCQ A;  3I4M H;  2K4K A;  2N88 A;  2CWA A;  2VS1 A;  4QF4 A;  2K32 A;  2NVY B;  1D7Q A;  2JA6 H;  4JI0 Q;  1GUG A;  4HJ5 A;  2B63 H;  2BE5 C;  3K81 C;  3PO2 B;  1STH A;  2B2T C;  1XNR L;  5CBA E;  4HSV A;  4DUZ L;  1R4P B;  2JK8 A;  4KY7 A;  3GTQ H;  1U4M A;  3NXW A;  5C4X B;  2UUC L;  4LWC A;  3MWY W;  2EJF C;  2B2U A;  1CQV A;  2QW7 A;  1VQJ A;  2ZM6 Q;  5IGG A;  1ICW A;  1UAP A;  1Q7Y C;  1NNX A;  4JI7 Q;  5M3M B;  4CDC C;  1CZW A;  1IBK L;  1M4V A;  4XXE A;  1SLJ A;  1H9K A;  1Q90 A;  1PYS B;  4QJF A;  1YHQ A;  4KY5 A;  1EU3 A;  4DAM A;  3T53 B;  5IP7 H;  1MI2 A;  4ZLT F;  2WAQ G;  4FXD A;  3S1N B;  1N36 L;  4YWM A;  1YHA A;  1D5M C;  2IL8 A;  2YV5 A;  4IUU A;  4LFB L;  2L9H A;  1IBM L;  1RL2 A;  1FR3 A;  2DNE A;  5AJ3 L;  1GUN A;  1EQV A;  1VQ8 A;  1A0I A;  2Y0S G;  3N52 A;  1DYQ A;  4DAY A;  2R92 G;  4KHP Q;  1GJX A;  3MXG A;  4R4I A;  3HOV B;  3S2D H;  3DWQ A;  3SXH A;  3AEV A;  1EY4 A;  4OXP A;  1VMC A;  1E7Z A;  2HCC A;  4DFA A;  1I5F A;  1G6Z A;  4X66 L;  2LS0 1;  3VA7 A;  2Q2U A;  3S1Q B;  1KL9 A;  3NEN A;  4A3L G;  2FHT A;  1WTP A;  2ZJR A;  1XPR A;  2JA8 G;  4XQQ A;  1C0A A;  4BBR H;  1PH4 A;  2K05 A;  4CDD C;  3QOJ A;  3MC0 B;  2IX0 A;  4R9W A;  3MEH A;  2N55 A;  1PTO C;  3Q8D A;  2AQ1 B;  1RHP A;  3CRK C;  4A75 A;  1FGB D;  5C4X G;  2E2J H;  1OXT A;  4BA2 I;  1NAP A;  1V9P A;  1D5Z C;  2JA6 B;  3CRL C;  2LMC B; 
#chains in the Genus database with same CATH homology
 2VB2 X;  2B63 B;  3G7L A;  3I4L A;  2L1B A;  3ZYY X;  3OSO A;  1RDP D;  1X3P A;  3SK5 A;  3GTQ B;  4DXF A;  1ESF A;  1O7L A;  2F0J A;  4RKL A;  5C5M A;  4OL7 A;  2EDG A;  1PXU A;  2O4X A;  4XYQ A;  1QG7 A;  3S17 B;  5C0X H;  4HMJ A;  2K03 A;  2XVS A;  2RDG A;  2K33 A;  1AW7 A;  4V19 0;  4KKU A;  1NCV A;  2H1E A;  4IFD J;  2F0D A;  1ILQ A;  1C4Q A;  2B2V C;  4EQP A;  1JWS D;  3AU7 A;  3RMH A;  5BN3 A;  5IOC A;  3ONA B;  2BDN A;  3S2D B;  5I4D A;  1F9S A;  1XXG A;  1HA6 A;  3D4R A;  4RGN A;  2KCN A;  2R7Z B;  5JVH 3;  1D1K A;  3QWN A;  3P20 A;  2K6A A;  4BBR B;  1JOK A;  1QE6 A;  2J7Z A;  2A68 D;  1LT5 D;  3IFT A;  2IT1 A;  3Q22 A;  1DZ1 A;  2E2J B;  1SMY D;  2BA1 A;  4ABN A;  5HUR A;  1DOK A;  2WKC A;  1X3Q A;  2MPM A;  3A54 A;  2V4D A;  3NPP A;  4ILW A;  4EVO A;  2ZXR A;  4PMC A;  4WRD A;  3TP7 A;  1SNC A;  2EYL A;  3QB3 A;  2JA5 B;  4C3I G;  2IX1 A;  1GUW A;  1F9P A;  2SOB A;  2PW7 A;  5CV8 A;  5ELC A;  2XRQ D;  4OO1 H;  4DAP A;  3GV6 A;  3TSS A;  1GHK A;  1TQO A;  4HSP A;  3NWS A;  3D31 A;  1SBB B;  2X69 A;  1SDF A;  3WOF A;  1WTW A;  4DF7 A;  3RUZ A;  3J80 L;  2BA0 A;  3NTI A;  4I7Z C;  1IW7 C;  4PV1 C;  3J80 E;  3FEW X;  4CBV A;  3M7G A;  1FNV A;  2NN6 H;  5K36 G;  1AEX A;  1J9O A;  3I72 A;  2PPB C;  3C3L A;  1K8O A;  2F0O A;  2HUG A;  5C0X I;  3M85 A;  1SE3 A;  3LNN A;  3PUZ A;  3KUP A;  2DY8 A;  5FO8 B;  5JEA J;  4RHS A;  5KNC A;  1E2W A;  4TSS A;  4K2L A;  5LL6 X;  5BN5 A;  4IQZ A;  2GA4 B;  1BF4 A;  4I65 A;  1EWH A;  3SEB A;  3K59 A;  2NUC A;  3VA5 A;  1H9S B;  4G7O C;  1BO0 A;  4DXG A;  4C3J G;  2LFN A;  2XN9 C;  3VYR A;  1TWC B;  1I4H A;  2ICE C;  1STA A;  4PMB A;  2QEJ C;  3DM1 A;  4A3G B;  2FMC A;  4NDX A;  1SAP A;  5D3I B;  2L11 A;  1F2Z A;  4X3T A;  4CHT B;  1LV9 A;  3U9O A;  4EQO A;  1SJE D;  3TBI B;  4BY7 B;  1OO9 B;  5I9P A;  4LMQ D;  4A3I B;  5CYU A;  2K5Q A;  3VR4 A;  3C46 A;  1VF7 A;  1HTL D;  5EKI A;  4ZAI A;  3PUW A;  4KMU C;  2L0C A;  1D6E C;  1K8M A;  4OIJ A;  2C5C A;  4IN3 A;  2RSO A;  1HQM C;  1SYG A;  5C4Z A;  2K5D A;  4RWS C;  3I91 A;  3VR3 A;  4A3D B;  1BXT A;  4HCE A;  5C3E B;  3FKI B;  4G7Z C;  1JCK B;  5JJZ A;  1JQY D;  4F8M A;  3PMF A;  1WTR A;  1VCI A;  2EVB A;  4X3U A;  3IFD A;  3LX0 A;  4OO1 I;  3J81 E;  4FF2 A;  3LWU A;  2TMP A;  4X3S A;  1IKL A;  5IT9 L;  5I2X A;  2X6L A;  4A3K B;  1OXV A;  1EY7 A;  3DMU A;  4KKT A;  4C3H G;  5IGF A;  1KDA A;  3HOW B;  1I4R A;  4L63 B;  4KHZ A;  1LT3 D;  1T5E A;  3J7A V;  2NN6 I;  1S5D D;  4HN7 A;  4FYD A;  1YNJ C;  4KHV A;  2JXM B;  2AQ3 B;  4YIJ A;  1JOO A;  1TS5 A;  1RTO A;  1B2T A;  1TII D;  4P2C B;  3MXP A;  4U68 A;  3D4W A;  2CHB D;  2XRS D;  1ZYR D;  2F0W A;  1I50 B;  4CKE A;  3RZD B;  4FVM A;  1AFP A;  2DY7 A;  3OWF A;  4CGY B;  3VYS A;  3I8Z A;  2D5D A;  1H9M A;  5EPK A;  1LAB A;  1Q8I A;  1UUP A;  1Y8P B;  3OPO A;  4IUT A;  2RA4 A;  2E2H B;  1Z6H A;  4TQU S;  1CK1 A;  3W2D A;  3KF8 A;  4EQN A;  1LTI D;  1B9M A;  3R3O A;  4QUF A;  2F3V A;  4NKL A;  1CHQ D;  5ELD A;  1SJH D;  1QNK A;  4E6I A;  4K5X A;  1JR0 D;  1WTQ A;  3NUC A;  1HCZ A;  1EFI D;  2EY1 A;  5E1F A;  2MP1 A;  1GUT A;  4FXK C;  1SYD A;  5CMD A;  3H0G B;  3SHL A;  2NVX B;  1TY0 A;  3SVM A;  2IJ0 A;  2R3Z A;  3MZ5 A;  5C3W A;  4TKO B;  1S5F D;  2KED A;  4CKC A;  2MHV A;  2Y0S B;  2R92 B;  3BDL A;  3SK4 A;  2B2Y C;  4B9X A;  1ET9 A;  3T16 A;  3FDT A;  3TP6 A;  1LAC A;  1SYF A;  1BCP C;  2KCC A;  3V2T A;  2E2D C;  3VYT A;  1TWH B;  4PMW A;  3TZU A;  4N9P A;  2I46 A;  4V0B A;  2EYH A;  2HDM A;  2EY6 A;  4J1M A;  1A6X A;  4KD3 A;  2JA8 B;  2EYJ A;  1PFB A;  2A6E C;  1F2Y A;  3IL8 A;  4U67 3;  2J0T D;  3V05 A;  2XSC A;  3FPP A;  1QJO A;  3HOZ B;  1I4X A;  5FO9 B;  2R6G A;  4IUN A;  2CW0 D;  4LK1 C;  4K14 A;  2F0P A;  1L0Y B;  4Q5V A;  1MD2 D;  1O80 A;  3GV3 A;  1HXY D;  5KND A;  3KBG A;  2QKI C;  1V43 A;  1HUN A;  1QB5 D;  2IW3 A;  4EGV A;  1EOT A;  4ZYS A;  2A73 B;  2JSO A;  3P75 A;  5JPN C;  4JK1 C;  2VXW A;  5E4W C;  2K04 A;  2EJM A;  2F0G A;  4HTH A;  3WDN A;  4FF1 A;  2NTT A;  3BDO A;  1RJT A;  4BS9 A;  1B3A A;  2RVL A;  1SFO B;  4RGM A;  1A3V A;  1JWU D;  4HMI A;  4QCL A;  1DOL A;  3NQI A;  3S2H B;  3LWE A;  3GTK B;  3H6M A;  3E0J A;  3Q0A A;  5KIX A;  2F0U A;  4ZRZ A;  5F2D A;  2O5I C;  1A3U A;  2HCI A;  3PUY A;  5K36 H;  1BBX C;  1TY2 A;  5CV7 A;  1G2T A;  3VYU A;  1I6V C;  2MUY A;  3GTM B;  2AWO A;  2B2W A;  4ZUI A;  3C2P A;  3UI2 A;  3A8J E;  2A6H D;  3HGB A;  3GP7 A;  3Q6S A;  2K7V A;  4KJN A;  4M8A A;  4J6H A;  5C3X A;  1WCM B;  3OMG A;  5EGT A;  1S5E D;  4DGZ A;  2A5H A;  2K1B A;  3GTP B;  3IAY A;  3CU7 A;  2WB1 B;  2Q8I B;  1V1P B;  3EJI A;  4RHR A;  1PZK D;  3T4A C;  4C3I B;  2BOS A;  2C9O A;  5EJW A;  5EPJ A;  4RGT A;  2FIN B;  1SND A;  3T56 B;  4MHE A;  2IPK D;  1CM9 A;  4OIK A;  1AN8 A;  2KQ3 A;  5KGU A;  2A74 C;  1TS4 A;  3K5O A;  3H09 A;  1O7Y A;  2M00 A;  5CV9 A;  5ELF A;  3W3A A;  1HQR D;  2F3W A;  1NR4 A;  3KLS X;  1SEB D;  4CJ0 B;  3K57 A;  3SDZ A;  3PIP 3;  2G9D A;  2M9V A;  2CQA A;  1GHJ A;  1PTO H;  2OEO A;  2FFK B;  2A69 D;  2ENB A;  3HOU B;  2KJX A;  2OF1 A;  1KNE A;  5KEE A;  3MAQ A;  1OXX K;  1I3Q B;  5C0X J;  3I90 A;  2OT2 A;  2AWN A;  1H9J A;  1O78 A;  5EBC A;  2BE5 D;  4H7B A;  1Q1B A;  2F0K A;  4DK0 A;  1WD0 A;  2BDO A;  2NTS A;  4H44 C;  1HTP A;  1EEI D;  2NYZ D;  4K2K A;  3MVV A;  3AB9 A;  4BA1 I;  3U9S A;  1WD1 A;  3S16 B;  1DOM A;  3OMC A;  1YNN C;  1LTR D;  2PNR C;  2Z1C A;  3R2I A;  1V1P A;  2EY2 A;  3GTL B;  5LL6 S;  2QIL A;  5EKL A;  4ULL A;  4TRD A;  4F88 A;  2MJ8 A;  4C56 C;  4CJ1 B;  4O1N A;  2WV6 D;  3C1F A;  2L12 A;  3PV0 A;  1RCV D;  3CKI B;  3QO2 A;  4KJO A;  1EY5 A;  3I70 A;  5CV6 A;  4ZK9 B;  2L5T A;  3R2T A;  4Q0F A;  4C3J B;  1MSG A;  5FK9 C;  4FP5 D;  3TDQ A;  4PQX A;  2EOT A;  2PO4 A;  2D62 A;  3V96 A;  3GD7 A;  5JAV A;  2WIN B;  2Q8R E;  1LO5 D;  3L3O C;  3HS0 C;  3VR6 A;  3QOL A;  3PUX A;  1NR2 A;  2F0H A;  3Q23 A;  1S5B D;  1PTO B;  1PTO D;  2I07 B;  3EFX D;  3GQB A;  1MBY A;  2ZT9 C;  1PLF A;  1LTS D;  1EYC A;  5CC4 A;  4KN7 C;  4IFD G;  4XQJ A;  4A3M B;  5FOB B;  1F2L A;  3SE0 A;  1U4R A;  4BBS B;  1V8Q A;  2D9U A;  3ERQ A;  2XNA C;  5M5Y B;  1VDZ A;  4A3B B;  1PZI D;  1RKN A;  3Q24 A;  3NQT A;  5AFW A;  1I6H B;  3FPU B;  5M9O A;  3BG3 A;  3G6J B;  4Y7N B;  1BR9 A;  1W6K A;  1PRT C;  1F9R A;  3SK8 A;  3HP3 A;  2H4O A;  4NW2 A;  3E6Z X;  3D6W A;  5EKK A;  1KLU D;  3DWP A;  3DWA A;  1LTG D;  1EQT A;  4UDU C;  3RLF A;  4C3H B;  2Q8T A;  1NUC A;  3KLS A;  2B2U C;  2O2L D;  3H94 A;  5D65 A;  1D2B A;  4L8J A;  2VUM B;  4DA2 A;  4XIG S;  1STG A;  1EZ8 A;  5FLX L;  5ELB A;  5M5X B;  1ESR A;  3URY A;  3DUZ A;  1LLR D;  5FLX E;  1IHZ A;  1QIL A;  4ZKB B;  4A3J B;  3DHQ A;  3J7A F;  1EZ6 A;  2ZXO A;  4FF4 A;  2FMM A;  4XQN A;  2RQX A;  2QF7 A;  3K5M A;  1HA5 A;  1ZKO A;  3HRZ C;  1KAA A;  3E5S A;  1STY A;  1R4Q B;  1KDB A;  1ML0 D;  4UAI A;  3H91 A;  2NVT B;  1H9S A;  4KI0 A;  4BWG B;  1G8Z D;  1LT4 D;  3MFY A;  4X3K A;  1II3 A;  2B2V A;  2PYK A;  3A56 A;  4LAA A;  4GZY C;  4KKS A;  3S14 B;  4BY1 B;  1EYA A;  3OIQ A;  3MXU A;  1KTK A;  5IT9 E;  2IWH A;  1STE A;  4WJW A;  5KYL A;  5HGT A;  2B2W C;  1EEF D;  1XWE A;  4XDX A;  2F0N A;  3BS1 A;  3BDC A;  2EYO A;  2XWB B;  1IL8 A;  4WFN 3;  2SDF A;  3TP5 A;  4KV6 A;  5A2Q L;  1ZEQ X;  1JOQ A;  3NBH A;  1IW7 D;  5A2Q E;  5DEH A;  4RAU C;  2Z4H A;  5DM6 3;  5KRU A;  1X32 A;  1E2Z A;  3DXJ C;  2RDH A;  1SYC A;  3T13 A;  3MFG A;  2YU9 B;  2J4X A;  3SK6 A;  3J7Y W;  1Y69 U;  1B44 D;  2R61 A;  4IUV A;  3L7Z C;  4H13 C;  2IX3 A;  3OW7 A;  3KK7 A;  3EQL C;  4DNR B;  1IYU A;  3HZX A;  2EYF A;  5CV5 A;  3RD4 A;  1PRT B;  2PZT A;  5DAU A;  1TKW B;  1EL0 A;  3A7A B;  3D8G A;  2HDL A;  3WOE A;  3KLR A;  4HR7 B;  4XT3 B;  1ENA A;  4KY6 A;  1TWF B;  1WVL A;  1ENC A;  4RFB A;  1CA6 A;  1Q3L A;  4C2M B;  1F77 A;  1TU2 B;  1TVX A;  4H0L C;  3X3N A;  3S1M B;  2F0F A;  1PTO F;  1LTB D;  1DM0 B;  3JAM L;  4KK7 A;  1DD2 A;  2YYZ A;  1R9T B;  3JAM E;  4KD4 A;  3D4D A;  5CBE E;  1EWC A;  4NMZ A;  4A3E B;  1GXD C;  3TZD A;  2SNS A;  3N6R A;  1C8C A;  1S5C D;  3S1R B;  3NE5 B;  4WOR A;  1Q12 A;  4K5V A;  1JE4 A;  1Z47 A;  2PMZ B;  3TP8 A;  3CHB D;  3I4N B;  2VB3 X;  1GUS A;  2A68 C;  2WP8 J;  4L6T B;  4R8I A;  2XWJ B;  1T5X D;  5IGC A;  1IKM A;  1SMY C;  3OWE B;  5CGK A;  1E0B A;  1LT6 D;  2AQ2 B;  3P7J A;  5JVG 3;  3HG9 A;  2G9H D;  3NHH A;  1JOR A;  2AUJ D;  1G2S A;  3M3Y B;  5DNF A;  2K5W A;  3ERO A;  3M4O B;  1MSH A;  2OXP A;  3R8B A;  5C4H A;  1C48 A;  4C1N K;  4IUP A;  1JIC A;  1EU4 A;  4ZUJ A;  5K5P A;  3BYY B;  3OHX C;  1YNJ D;  2XIW A;  3MA2 B;  2F0T A;  4DNT B;  4K6L A;  1CHP D;  2NZ1 D;  2Z4I A;  1U9R A;  5G3L F;  2F0Q A;  4RH6 A;  3K7A B;  1CT1 D;  2EYP A;  2F0L A;  4B08 A;  2F03 A;  4ZQ3 A;  1MGS A;  2LKV A;  4XYO A;  3HEJ A;  2E75 C;  5KNB A;  2JYO A;  3SR1 A;  1Y8N B;  1CQF A;  5FKA C;  2K01 A;  1JC7 A;  1WTO A;  1O7Z A;  4IZ8 A;  5C6A A;  2EYM A;  1CZG A;  1VMP A;  2KOL A;  4NP5 A;  5A35 A;  1SNM A;  1PZJ D;  4IFD H;  4A3F B;  1B1Z A;  3TN2 A;  1LTT D;  2B8F A;  5CR3 A;  1PFN A;  1I4G A;  1SNQ A;  1QOH A;  5J39 A;  3I4M B;  1TS3 A;  3F2U A;  1BDO A;  3M7N A;  1BQQ T;  1ILP A;  1D1I A;  3NTH A;  1EY9 A;  1STB A;  3MXN A;  1TT2 A;  3K5L A;  3HKZ B;  1GUO A;  4Z9C B;  4XTC S;  2RBM A;  1G29 1;  1ZXT A;  1VF5 C;  4OGQ C;  4ODG A;  3NWT A;  3RZO B;  1NSN S;  5DM7 3;  1ROD A;  2NB0 A;  2F0V A;  4DU9 A;  2D2C C;  4G4K A;  1EY6 A;  3HOX B;  1BCP B;  1BCP D;  1ENF A;  2M2L A;  3GO5 A;  1J8I A;  2WII B;  2KUM A;  1JWM D;  5NUC A;  3CQZ B;  2X6G A;  5M5W B;  1EY8 A;  2DN8 A;  2SEB D;  1HUM A;  3NBI A;  3NP8 A;  1DJR D;  4ZKC B;  2F0E A;  1F2M A;  3BVZ A;  1XYI A;  4FNF A;  4XT1 B;  2A6E D;  1OXS C;  3NTK A;  4O42 A;  3K6O A;  5COY A;  1OXU A;  3K58 A;  2BCO A;  1W6J A;  1PRT F;  1M8A A;  1BUV T;  2WKD A;  1AZP A;  1B4O A;  3DEP A;  4K5W A;  5IGE A;  2JEB I;  3PIO 3;  2EJG C;  4J8Q A;  1FYC A;  3P1H A;  2NBF A;  2HQE A;  3NSW A;  1B9N A;  5C5L A;  4F7X A;  1D5X C;  1PDQ A;  2PCF B;  1UNS A;  1SE4 A;  3A8I E;  2QDB A;  4DN4 M;  5KYI A;  2CVR A;  2L55 A;  1FNU A;  2B2Y A;  1A15 A;  2WAC A;  1V1O A;  4KTA A;  2F0M A;  1ONL A;  1F9Q A;  4DK1 A;  3D3R A;  1I4P A;  3X3M A;  3I3C A;  4K8I A;  1FD7 D;  1ET6 A;  2PQE A;  1SSO A;  3HOY B;  1DCZ A;  5EBD A;  4IAL A;  1TR5 A;  4S3S A;  1DON A;  1SNO A;  1TWA B;  4IFD I;  2KA7 A;  5JEA H;  2B2T A;  4RCO A;  1AP0 A;  5T1I A;  1HRJ A;  1G91 A;  5E3F A;  4G57 A;  3AMU A;  2F0S A;  2FJ2 A;  1U4P A;  5ISR A;  2B8G A;  5EPL A;  3GTJ B;  3O13 A;  4FO2 A;  3A8K E;  4QUC A;  2E2I B;  1U4L A;  4AYB B;  3DEO A;  4ID6 A;  5EQ0 A;  3BYT B;  1XX8 A;  1ZYR C;  4RGO S;  1PFM A;  3S15 B;  1KLG D;  1QCB D;  1UEA B;  1A3T A;  2LY7 A;  1L0X B;  3BZD B;  1TWG B;  2PW5 A;  3A55 A;  2JEA I;  1K83 B;  3FRP B;  4CJ2 C;  4FF3 A;  2VNU D;  1SYE A;  1STN A;  5I6Y A;  4B9W A;  1QNU A;  1KNA A;  3TME A;  1CA5 A;  5C0X G;  5M3F B;  2F0I A;  1A2U A;  1AZQ A;  3L9A X;  2JE6 I;  5C44 B;  1B53 A;  2KEE A;  5J1Z A;  1KDC A;  4LJZ C;  4HCS A;  4PNY A;  2F1M A;  5IOD A;  2RSN A;  1DXM A;  4CKB A;  3EA6 A;  2ZXP A;  1KAB A;  3IKJ A;  2SNM A;  3BVM A;  2DNC A;  4QIW B;  5JOB A;  1BOS A;  4QMG A;  1SNP A;  4ME5 A;  4IUR A;  2EZV A;  3NK9 A;  3VR2 A;  3PUV A;  5CV4 A;  2NVQ B;  5G3L D;  2R93 B;  4MN3 A;  4K6D A;  3FVQ A;  3QJY A;  4MIU A;  1HPC A;  2EXZ A;  5I6W A;  3R93 A;  4HED A;  3D6C A;  1RF2 D;  1B50 A;  2JP1 A;  1YNN D;  4JBW A;  4IUQ A;  4QB4 A;  1RTN A;  3OIP A;  1RD9 D;  2ICI A;  1CTM A;  2PZW A;  2RKS A;  2CW0 C;  3J81 L;  1E2V A;  2E76 C;  5ELE A;  1Z7T A;  4N9T A;  1PYW D;  1BCP F;  2Z8L A;  1LTA D;  5D14 A;  5FO7 B;  3GTG B;  3I73 A;  5E4X A;  3EVQ A;  3ND9 A;  1EIH A;  2K28 A;  4A93 B;  2EE1 A;  4OO1 G;  5COR A;  2NWG A;  5JEA G;  1H9R A;  2L4N A;  2PZU A;  1Y1V B;  3M4Y A;  5TSS A;  1WTX A;  1QWY A;  3FMC A;  1EY0 A;  3VR5 A;  1HFN A;  1IYV A;  1FNW A;  2F4I A;  2O5J C;  4K8J A;  4RA8 A;  2MGS A;  2NN6 G;  4FXG C;  4RKB A;  5IGD A;  1EIG A;  4M1U B;  1Y8O B;  1SE2 A;  1XTC D;  5D3D A;  1A2T A;  1CI3 M;  1Y1W B;  5BN4 A;  3BVG A;  2RDF A;  3K0Y A;  1Q1E A;  3GTO B;  2KHS A;  1PRT D;  2B39 A;  3T51 B;  3MTS A;  1I4Q A;  4R8N A;  2A6H C;  4C1N I;  4HAE A;  1JB3 A;  2TSS A;  3A7L A;  5I9O A;  3ITP A;  3QIA A;  3S9W A;  1EYD A;  2AUK A;  4DAV A;  4OHJ A;  4F87 A;  3QG1 A;  3KBX A;  5JPM C;  3H3V C;  2WAQ B;  2QCP X;  1WTV A;  1BNZ A;  5LHY 1;  2KVM A;  2JA7 B;  3ND8 A;  1SXT A;  3PO3 B;  2EY5 A;  4G7H C;  3C1E A;  5C4J B;  5IGB A;  1CFM A;  5IIF A;  1S4Z A;  1PMR A;  3MHB A;  1TS2 A;  2E74 C;  5I2Y A;  5J22 A;  3OOC A;  1HFG A;  1SYB A;  2KEC A;  1HHV A;  3K5N A;  2A69 C;  4KN4 C;  4RCN A;  2ID0 A;  1GOZ A;  5T1G A;  2EPB A;  2N88 A;  4QF4 A;  2K32 A;  2NVY B;  1GUG A;  2BE5 C;  3PO2 B;  1STH A;  2B2T C;  5CBA E;  4HSV A;  1R4P B;  4KY7 A;  1U4M A;  3NXW A;  5C4X B;  3MWY W;  2EJF C;  2B2U A;  1CQV A;  5IGG A;  1ICW A;  1UAP A;  5M3M B;  1CZW A;  1M4V A;  4XXE A;  1H9K A;  1Q90 A;  4KY5 A;  1EU3 A;  3T53 B;  1MI2 A;  4ZLT F;  4FXD A;  3S1N B;  1D5M C;  2IL8 A;  4IUU A;  2L9H A;  1FR3 A;  2DNE A;  1GUN A;  1EQV A;  3N52 A;  1DYQ A;  4DAY A;  1GJX A;  3MXG A;  3HOV B;  3DWQ A;  3SXH A;  1EY4 A;  1VMC A;  4DFA A;  2HCC A;  1G6Z A;  2LS0 1;  3VA7 A;  3S1Q B;  2FHT A;  1WTP A;  4XQQ A;  2K05 A;  3QOJ A;  3MC0 B;  2IX0 A;  4R9W A;  3MEH A;  2N55 A;  1PTO C;  2AQ1 B;  1RHP A;  3CRK C;  1FGB D;  1OXT A;  4BA2 I;  1NAP A;  1D5Z C;  2JA6 B;  3CRL C;  2LMC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...