4HIOA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggtaacggt)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
139
Chain Sequence
DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 36
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hioA00
3CPWA 3T1YL 3GTQH 4BBSG 1K3RA 2AKWB 4JI1Q 4X64Q 5H1SE 4LF9Q 4A3CG 2YU9H 4JI7Q 2JA9A 3KF6A 1C9OA 4B3RQ 1AH9A 1HZBA 5LMUQ 2ZJPA 1VQFA 4JG2A 4A3DH 5HGQA 1L1OB 4JYAQ 1NY4A 4A3FG 2NN6I 1U0LA 3PSIA 1UE1A 1K73C 1V1QA 3RLOA 1B70B 1WCMH 2IX0A 4LF6Q 4DR2Q 3I4NG 1CKMA 3Q8DA 4DUYQ 2UUCQ 3PO3H 3FP9A 1VQ8A 3H0GH 4LW1A 1EOVA 1Y1VG 3G4SA 2E5LL 2Q2HA 4JOIC 2V1CC 2JK8A 3TEHB 2YYZA 4DR6Q 2A1AA 4XIGS 2RCNA 1YJNA 2VZAA 2A19A 3HOXH 1EIFA 3HOUG 1QVGA 1M90C 4PG3A 3HKSA 3S2DH 3RLNA 3WWVA 5FLMH 2MFIA 1EQQA 2UXDL 5IY0A 4TQUS 1JJGA 2VY3A 4NB3A 1UWVA 3H3VH 4NXNQ 4QL5A 1VQJA 4DV1L 3B6YA 3S1MH 1N9WA 4IJHA 4C3HH 1IBMQ 2JA7H 2MQHA 1TXYA 1FVIA 1J5EL 2RF4A 3KF8B 1O7IA 3W1BA 5FJ8H 3U4ZA 1WJJA 1XJVA 1KXLA 4OX9L 4JOIA 2K75A 2YTXA 1I3QH 4YWLA 1XPRA 2RHSB 5JJIA 1DGSA 4A75A 1Z9FA 4PZ6A 3KLWA 1HNXL 1UE6A 4DV6L 1X3EA 2UUAQ 1Q7YC 3J7A5 3HOWG 1OXVA 4FDBA 4P73A 4C3JH 2N78A 1N36L 4EX5A 3SGIA 3ER0A 5C0XJ 3NENA 4QIWE 4LFCQ 3GTKH 4A3GH 4JI8L 3UDXA 4JV5L 1HH2P 1MKHA 4YCVA 3VDYA 1PH3A 4BBSH 4DAMA 3S1RH 1YJWA 2ALYB 2CCZA 1AE3A 4DV7L 2JJQA 4NXML 1A0IA 3ICEA 4DPGA 4P72A 2ID0A 5EAYA 5JJLA 4GLXA 3CF5A 2OCEA 4GN3B 4AQYL 1PH9A 2KBNA 4DR1Q 4DUZL 1Q12A 2ZJRA 4A3DG 1VQBA 2Q2TA 4AYBG 2VQEQ 1YEZA 2H5XA 2JA6G 5GAEC 2VQFQ 1TWCH 2Q2UA 1X6OA 3CCLA 4JI4Q 5JJKA 3U4VA 4QGUA 1I94Q 5J3BA 1VQKA 4JI1L 4X64L 1VQDA 3M85A 4LF9L 2QA4A 1WCMG 5ELNA 1Y1VH 2K14A 5LMNW 4B3RL 3CCQA 5LMUL 3M3YH 1IBKQ 4PMWA 3S16H 3PO3G 4X65Q 3BZKA 1EIYB 2OTLA 2R7ZH 1KAWA 3ULLA 1BVSA 5IYDG 4JYAL 4GLAC 4OO1I 3MXNB 2GVAA 3HOUH 4DK3C 4A4IA 2OWOA 4LF6L 1MJCA 1YBYA 4LFAQ 3CCSA 4DR2L 1XMQQ 2NZHA 1HR0Q 4LUOA 3L7ZC 2UUCL 1IXRA 5IP9H 1JE5A 1J6QA 1PYSB 4XTCS 5FLMG 4DV6Q 1E1TA 1X3FA 1HJPA 5GAGC 2OQKA 2A8VA 1N32Q 5C0XG 4KHPQ 5C4JH 1SFOH 2D62A 4DR6L 1UE7A 3TS2A 1RL2A 3G71A 2JEBI 2PI2A 1VQ4A 4JI6Q 2LXKA 3I4MG 2UXCQ 1G291 3PUYA 3T1HQ 4LF5Q 3K0XA 1M1KC 2FXQA 3A74A 4A3IG 4NXMQ 3GO5A 1KRSA 3KDFB 2R7FA 1SE8A 4R4TA 3S24A 3F2BA 3CCUA 4DR3Q 3K7AH 3AEVA 3HOWH 4NXNL 4MTNA 4DV5Q 1Q8KA 3EBEA 4JBKA 4DR5Q 1IBML 2OQ0A 3PIPA 2UUBQ 2NVQH 3L0OA 2B63G 1FGUA 1V43A 4QJFA 3I4OA 1K8GA 5M5YH 1JB7A 3AFPA 1KD1C 1VQGA 3U58A 1QZGA 1Z47A 4POGA 2IY5B 1XNRQ 1G6PA 1S3OA 2UUAL 1BBUA 1I5FA 3CMEA 1RIPA 2KCMA 1IBLQ 2HIVA 4B3TQ 5M3FG 3PCOB 4YWKA 1CKNA 1MIUA 3CD6A 1D7QA 2UU9Q 2JA6H 2KHJA 2PQAA 4LFCL 3HKZG 2QEXA 4JC0A 1QZHA 2AHOB 3BU2A 4HJAA 2DGYA 2MO1A 1YVCA 3RN5A 2VUMG 1SROA 4GOPC 4RMFA 1MJEA 4YWMA 1NJIC 3KFUA 1X56A 4MNOA 4B3MQ 4A3LG 4BXXH 3TREA 1TWFH 3HKZE 5IYDH 3F2CA 4POFA 1OXUA 1YI2A 3K7UC 4DR1L 1OXTA 2VS1A 3PUZA 1KL9A 3FKIH 4KI0A 1E22A 4X66Q 1HNWQ 2D0PA 5JEAJ 2VQEL 2R7ZG 3CCEA 2VNUD 1GO3E 1NMFA 2VQFL 1VQOA 4JI4L 5AJ3L 4A3JG 1YJ9A 1I94L 4R1JA 1JMCA 1NE3A 3UE0A 3GTPH 4C2MH 4UPAA 3KF6B 4YHHQ 1YITA 1PH7A 2KCTA 3G48A 1VQLA 5IYBG 4DR7Q 1CKNB 1Q81C 1IBKL 2QGQA 2R93G 4B3SQ 5IP9G 4GOPA 1QVCA 3MEFA 3CMAA 4X65L 1X65A 1JJ2A 1PVOA 2YTVA 4IO9A 1C7YA 1YNXA 4L5SA 3HOVH 3I4MH 4PZ7A 5DLQE 4APVA 1I50H 4X62L 1I6HH 4OWXB 1VQIA 4A3IH 1PA6A 4IPDA 4LFAL 1XMQL 4Y52H 2XGTA 4Y7NH 1HR0L 4LWCA 1WYDA 1K8AC 1E3PA 4HIKA 4IJLA 3RZOH 1SR3A 3J7ZC 3STBC 1W3SA 1EWIA 1VQ9A 1UEBA 4JI2Q 3JAMi 1CKOA 1XTDA 1N32L 2B63H 3NELA 4KHPL 2Z6KC 4A76A 3D31A 5GQOA 3S14H 2NVTH 1WOCA 4JI6L 3HOZH 3E0EA 4L5RC 1L0WA 3S1NH 2UXCL 2EQSA 3T1HL 2C35B 4A3MG 1FL0A 4LF5L 3F8TA 4P75A 4A93G 1HNWL 2NVXH 3PO2H 2K50A 2CWAA 5M3FH 4DR3L 1H95A 4DV5L 4HJ5A 4GN4B 4DR5L 2VL6A 3BJUA 1XNQQ 2IT1A 3J80i 4KHZA 2AWNA 5JEAG 2UUBL 2VUMH 2N49A 1EQRA 5LMNQ 4UP9A 1X3GA 5AJ3Q 1K0RA 2EIFA 4X6AH 2JA8G 1QUQA 1YZ6A 2Z6KA 4RG1A 5IP7G 2I0QA 4A3LH 1XNRL 2JQOA 1BBWA 1HZCA 2ZTDA 2IHEA 3E9HA 1L2FA 3K81C 4UP7A 1IBLL 4B3TL 4LUVA 4BXXG 3CQZH 4AIMA 2NZOA 2UU9L 4AH6A 2NVYH 3CC2A 4JBMA 4A3JH 1LM0A 4HIOA 4HIMA 2ZTCA 5HY6A 4X62Q 3FKIG 1A62A 3D0FA 1CSPA 1JT8A 1VQPA 1A8VA 2HIXA 1XMOQ 5IYBH 1VCIA 1VQNA 3LGJA 2I5MX 4NPSA 4B3ML 2UXBL 2R93H 5BR8Q 3JC66 1Q1EA 3H15A 2WP8J 4LF4L 3OTOQ 4BA1I 2PI2E 3OW2A 2WAQE 2XTIA 2ZTEA 4EQ5A 4ME3A 1L1OC 1TWGH 2CQOA 1N34Q 4LF7Q 4YY3Q 4X66L 5M5WH 2HQLA 2MNAA 3KJOA 1ASYA 2NN6G 3RN2A 1EFWA 3K80C 3PF5A 1YIJA 3UDIA 5M3MH 3M4OH 1CUKA 4A3BG 3E9IA 1QUQB 1HNZL 3HOVG 1HZ9A 2K5NA 3F2DA 5IWAQ 3EN2A 4J15A 1JJCB 4YHHL 3BZCA 4KLKA 2BA0A 2DUDA 2IHFA 2CKZB 4OWTB 3G6EA 1GVPA 1Q82C 4DR7L 4R4QA 2JEAI 2JA5G 3GTMH 3OYYA 1W2BA 3RLFA 4GNXC 3RNUA 1PH5A 4B3SL 3KYHC 2I5HA 3J81j 4BA2I 3GTOH 1U5KA 5GROA 4MZ9A 4A3MH 2K5VA 2K5HA 4HJ8A 1XPOA 4IFDI 4QQBX 4A93H 3HOZG 3CXCA 1L1OA 2F3IA 5ELOA 4OWWB 2KENA 3M4QA 2ZJQA 3KJPA 4JI2L 1GM5A 1SRUA 1KRTA 3GTLH 5C44G 2AMCB 3J81c 1UE5A 4JCVE 4LF8Q 4DV0L 1X9NA 3NEMA 1PFSA 4GKJQ 1WFQA 3AQQA 3GTJH 3I56A 5IP7H 4GNXA 2JA8H 1P8LA 1PH2A 4GS3A 4YCWA 1OXSC 3U50C 2ZM6Q 1VQHA 2CWPA 4JI3Q 2UXBQ 1NBWA 4LF4Q 3ULPA 5K36G 1K9MC 3UDFA 4JI0Q 1XNQL 3PUXA 1LTLA 4LUZA 1N33Q 3S2HH 4IOAA 3CCRA 3CAMA 4DV2Q 4DR4Q 4JI5L 4L5QA 4YCUA 5LMNL 2B3GA 3I2ZA 1FJGL 5GAHC 2KHIA 4QY7A 4R4OA 4L5TA 5C0XI 1HNZQ 3H3VI 4IPCA 4IPHA 3I55A 4LFBL 1TWHH 3RR5A 3DM3A 3L2PA 1PYBA 1NTGA 1Q86C 2PMZE 4GLVB 2PQAB 3K8AA 1VQMA 1XPUA 4A3EG 1KC8C 4DV3Q 1EYGA 4A3BH 4K0KQ 1OXXK 3EIVA 1VQCA 1YHBA 2L15A 4GNXB 1E24A 2Q2IA 3HOYG 2BH8A 2HHHL 1QVFA 4GKKQ 1WI5A 4DV4Q 3FHWA 4IFDJ 5M3MG 1XMOL 1PV4A 2F4VQ 1E1OA 1A63A 1X55A 2EXDA 3PGZA 4HIDA 2JA5H 1N8RC 5IT9c 2OTJA 5BR8L 2R7DA 1R9TH 3CC7A 3OTOL 3I7FA 3AFQA 4DAYB 1Q46A 5C3EH 3TS0A 4YY3L 1N34L 4LF7L 5IE8A 2D0OA 4DV0Q 4HJ7A 3A5ZB 1IL2A 4OO1G 3HOYH 1SN8A 1LYLA 2VW9A 1VS0A 4BBRG 3RZDH 1Y1WH 2I5LX 2CFMA 5IWAL 1SLJA 1SMXA 4A3KG 2ATWA 2E2JH 3ULJA 2N3SA 4O2DA 3PIOA 1ASZA 4GOPB 5IYCG 1S40A 3T1YQ 2E2IH 2HT1A 5C44H 2BA1A 1T9HA 1E7ZA 1YHQA 4UP8A 1C0AA 4TVAB 2R92H 3STBD 4JBJA 2ASBA 4WJ4A 4IPGA 4JI5Q 2AWOA 1TWAH 1VQ5A 4BY7G 1FJGQ 3CPFA 3PO2G 3S15H 2LXJA 4DK6C 4ALPA 2K4KA 3AYHB 3NBHB 4BY1G 4LFBQ 1KIXA 1LUZA 2E8GA 4DNIA 3M9BA 4A3CH 4OXPA 5C4XG 3PF4A 2WB1G 1GD7A 4LF8L 2WAQG 2E5LQ 3A0JA 4IOCA 4A3FH 4GKJL 2HHHQ 4IFDG 4OONA 1D8LA 2GN5A 3CCMA 4UY8C 1GKHA 2IX1A 4PZ8A 2R6GA 2ZM6L 3UDGA 1IZ6A 3I4NH 3PUWA 1PHJA 2F52A 2WB1E 2YTYA 1Q1BA 2Y0SG 3KOJA 2GVBA 2B29A 4JI3L 4A3EH 2Z0SA 1PH8A 4JBWA 3W1GA 4JI0L 4JI7L 1X54A 1N33L 2UXDQ 3A5UA 3J81i 3TQYA 3CCVA 3S17H 3JAMc 4DV2L 3GD7A 3KDFA 4DR4L 3PUVA 3W5OA 4GN5A 4AYBE 4DV1Q 1AE2A 3H0GG 1IYJB 1B7YB 1CSQA 1VQAA 1BKBA 3CC4A 3CW2C 1J5EQ 2K52A 2Y0SE 1PH1A 2LSSA 4DKAC 5FLXc 3GDEA 1S72A 1PH6A 4OX9Q 1OTCA 1G51A 1K83H 5E7NA 3HOXG 4DUYL 4DV3L 3GTGH 1HNXQ 3M4PA 4K0KL 1HZAA 1VQ6A 4BBRH 1NMGA 4P71A 2WFWA 2YV5A 5C3EG 4A3KH 4O0AA 3J80c 4WJ3M 1N36Q 4GKKL 3CCJA 4DV4L 1HR0W 3UE1A 5M5XH 1P16A 4R4IA 4R4CA 4JI8Q 1Y1WG 2BH2A 2F4VL 5IYCH 3IRBA 3HFZB 2JA7G 2JE6I 4JV5Q 4LNQA 1YHAA 1Y14B 2PNHA 3ZJYC 2N8NA 5FJ8G 3F1ZA 1PH4A 4DV7Q 4C3IH 4HJ9A 3S1QH 2ES2A 3CP0A 5GADC 4BY7H 3PV0A 4H02A 1V9PA 2R92G 1KQSA 4AQYQ 3DLLA 4BY1H 3TRZA 4DUZQ 2MO0A 1VQ7A 1VQEA 4P74A 2RHQB 2E2HH 3ERSX 1EUJA 1B8AA 5C4XH 4A3GG 3M7NA 1KHIA
chains in the Genus database with same CATH superfamily
3CPWA 3GTJB 2JA8B 4BBSG 1TS2A 1CI3M 2AKWB 4TKOB 2YU9H 2JA9A 2EYLA 1EY9A 4XYOA 1HXYD 4JG2A 5HGQA 1BQQT 1NY4A 5HURA 3SXHA 2CH4W 2PZUA 3PSIA 1K73C 1HQRD 4LF6Q 1B70B 1WCMH 3AMUA 1PRTC 1CKMA 4B9XA 5I6YA 4C2MB 1TWHB 3Q8DA 4DUYQ 3PO3H 3H0GH 4LW1A 1EOVA 1SJED 1Y1VG 4KKUA 2V1CC 1JQYD 2RCNA 1HFGA 1I4RA 2A19A 4H13C 4PNYA 5C6AA 2FMMA 3G7LA 3WWVA 5FLMH 2MFIA 5FO8B 4NB3A 1N9WA 4C3HH 1IBMQ 5E4XA 1FVIA 3KF8B 1GHJA 3S14B 3W1BA 1XJVA 1WJJA 1KXLA 2EOTA 4JOIA 1I3QH 3S1NB 1XPRA 1H9RA 1Q3LA 1Z9FA 2Z9HA 1DOMA 3P20A 5DM73 1HNXL 2UUAQ 3SK6A 4ZLTF 3HOWG 1OXVA 1PTOD 2N78A 4EX5A 3ER0A 3GTKH 4QIWE 1WTWA 4UDUC 3VDYA 3JAME 5CV7A 4DAMA 1WTXA 4K5WA 1YJWA 2ALYB 2BCOA 4LMQD 4NXML 4KD4A 4P72A 5JJLA 4AQYL 2F0TA 4DUZL 1Q12A 4AYBG 1YEZA 5GAEC 2VQFQ 5JJKA 4QGUA 1VQKA 3DUZA 1RHPA 4JI1L 4X64L 4LF9L 2EY6A 1WCMG 2F0FA 5ELNA 2R93B 2M2LA 3PO3G 3QOLA 4A3EB 3E3XA 4X65Q 1UAPA 1EIYB 4JYAL 2RSNA 1KAWA 3LNNA 4NMZA 3NE5B 2LKVA 1B9NA 2A6HC 4CKBA 1UUPA 2KVMA 3VR3A 4FF1A 4DR2L 1NR2A 1STYA 2NZHA 5A2QE 1HR0Q 1DONA 3L7ZC 1J6QA 1PYSB 4DV6Q 5FLMG 1CA5A 1HFNA 3ITPA 3VYSA 5GAGC 5C0XG 1SFOH 1UE7A 3G71A 3TMEA 1Y8OB 1EZ6A 3MXGA 5IOCA 2UXCQ 1B53A 3PUYA 3OMCA 2Z6BA 1M1KC 2G9HD 5K5PA 1KRSA 3S24A 3Q6SA 3P7JA 2AUKA 2PYKA 4DR3Q 4MTNA 1KDBA 4RAUC 2OQ0A 3GTLB 2XRQD 1PLFA 2Z4HA 3MTSA 4F7XA 1KD1C 1I4HA 1Z47A 5DAUA 1TKWB 1XNRQ 4RKBA 2KCMA 1A6XA 4RCNA 4YWKA 1DXMA 1GXDC 5M3FG 2UU9Q 2IX3A 4LFCL 2EY5A 3BU2A 4HJAA 1YVCA 3RN5A 4GOPC 4O1NA 2NTTA 3MVVA 4YWMA 1EY4A 3WOFA 3HZXA 1SDFA 4BXXH 2I07B 3DWAA 3Q23A 3HKZE 1ZXTA 5IYDH 1SMYC 2OT2A 5EPKA 3PUZA 1E22A 1XWEA 2D0PA 4A3BB 3NP8A 1LTTD 1YJ9A 1I94L 3GTPH 1NE3A 2K03A 3KF6B 1A3UA 4F8MA 5JPMC 1VQLA 4RGMA 4K5XA 4DR7Q 1Q81C 2R93G 3IKJA 3OMGA 1VF7A 3I4MH 2RVLA 1F2ZA 2AUJD 3HGBA 4APVA 1I50H 3MHBA 1K8MA 2XNAC 4OWXB 2MHVA 4IPDA 4LFAL 4Y52H 3RZOH 1WYDA 4HIKA 2KOLA 2F0KA 1VQ9A 1RTNA 1UEBA 3JAMi 1EEID 1Z7TA 1ENCA 1XTDA 1N32L 4A76A 3D31A 5ELEA 1FR3A 2NVTH 1WTHA 2BDOA 1WOCA 5CC4A 4JI6L 3HOZH 1D2BA 3E0EA 3KLRA 3T1HL 1FL0A 4HEDA 4P75A 4U68A 2K50A 4RA8A 3HEJA 4HJ5A 1PRTB 4GN4B 1EY6A 2B2TA 2IT1A 3UI2A 5JEAG 5LMNQ 4UP9A 3DEPA 4LK1C 1SYEA 5DNFA 2EIFA 4QF4A 2I0QA 2NYZD 4QB4A 1NNXA 5K36H 1F9QA 2KCCA 2IWHA 1LT5D 2O4XA 2K01A 1L2FA 3K81C 4UP7A 1IBLL 4BXXG 5IGBA 5JVH3 1SE2A 2NVYH 3A8JE 4HIMA 3OOCA 4X3SA 1WVLA 2K5QA 2EPBA 5IYBH 1VCIA 2PW5A 3LGJA 3JC66 1I4PA 3H15A 4LF4L 3GP7A 3H91A 2B2VC 2ZTEA 1JICA 1LABA 4BS9A 1K8OA 2CQOA 3D6WA 3HOYH 4X66L 5M5WH 2HQLA 2MNAA 3KJOA 4A3BG 5M3MH 4BBRB 5KNBA 2K5NA 3F2DA 4J15A 5C4JB 4FXDA 2HCIA 1GVPA 1Q82C 5CV9A 3OYYA 4B3SL 4ME5A 1MSGA 2A68D 2HUGA 4IZ8A 3K5LA 3S1QB 2DN8A 4PMCA 5G3LF 2K5HA 3MA2B 3AB9A 1MHWC 3HOZG 5CBEE 3M4QA 4OEMB 4ODGA 5IGGA 2XN9C 2A6EC 5I9PA 2A5HA 3J81c 1EU4A 3NEMA 1PFSA 3SK4A 4KN7C 4L8JA 4A3DB 1CZGA 1PH2A 3E0JA 4GS3A 4YCWA 1OXSC 3U50C 2ZM6Q 1G6ZA 1J9OA 1FYCA 4NKLA 4JI3Q 2EJMA 3ULPA 5K36G 2B8GA 4JI0Q 1N33Q 2JSOA 3CAMA 3T51B 4DR4Q 1EEFD 4CJ0B 2B3GA 5D14A 1FJGL 1TWFB 4L5TA 5C0XI 4NW2A 3I55A 3RR5A 3MC0B 1SNCA 3TP8A 2PQAB 1STGA 2XWJB 1SNDA 3TP6A 2NB0A 1H9JA 2RQXA 4K0KQ 3EIVA 1K0SA 1ILQA 4GNXB 3HOYG 1KAAA 1V1PB 1WI5A 4IFDJ 5D3IB 5M3MG 1F2LA 3PGZA 4JVZA 3DWPA 1ET6A 3CC7A 3I7FA 4A3IB 4IUUA 1ZYRC 1PTOC 1Q46A 1N34L 3TS0A 4DV0Q 1MI2A 4BBRG 2QDLA 5IWAL 1SLJA 1Y8NB 3VA5A 3PIOA 1ASZA 4HSVA 5EQ0A 1BCPF 4GOPB 2PQEA 1S40A 5C44H 4FVMA 2B8FA 2X69A 1YHQA 2A74C 5EPLA 4WJ4A 2JN4A 4JI5Q 2QKIC 5C3XA 3D4DA 4BY1G 4CKEA 1KABA 2E8GA 4DNIA 2F1MA 4X3UA 1D6EC 4A3CH 3NWSA 2EZVA 2F0VA 3NPPA 2KJXA 4LJZC 1QCBD 1STNA 4N8X1 4A3FH 2HHHQ 3ZYYX 4OONA 2GN5A 3R3OA 2R7ZB 4PZ8A 2F0EA 2F52A 3KOJA 1Q1BA 1EYCA 2B2WC 2UXBL 3Q24A 5COYA 1G2TA 1M8AA 4CHTB 4G57A 3P1HA 1GUGA 3TQYA 3JAMc 3PUVA 2EY2A 1AE2A 2RDGA 1CSQA 1LTRD 1VQAA 2P5ZX 2DJFC 3TSSA 4JPBW 1PH1A 2LSSA 4DKAC 4QIWB 5ELFA 3VR4A 5IGCA 3GTGH 1HNXQ 3M4PA 1J8IA 1CFMA 2WFWA 2YV5A 1PYWD 4A3KH 4WJ3M 3DHQA 4GKKL 1D5XC 3UE1A 2G5DA 5IYCH 4DK0A 1WD0A 1LLRD 1Y14B 4A3MB 1PH4A 2QF7A 4ZKBB 2CHBD 5GADC 2WINB 1EWCA 4HMIA 4H02A 1IKLA 4AQYQ 4QUFA 2PCFB 4DUZQ 1VQ7A 1S5FD 5KYIA 1DM0B 2N55A 2QCPX 1VMCA 1KHIA 2WKDA 1AZQA 4A3CG 4JI1Q 4X64Q 4LF9Q 5H1SE 4JI7Q 2DNCA 3KF6A 1C9OA 2B2YC 1TY0A 4IFDH 1HPCA 1VQFA 5IT9E 4DNTB 4JYAQ 2EYFA 3BVZA 4A3FG 5KRUA 3FKIB 4ZK9B 2IX0A 3K5MA 4DR2Q 3U9OA 1LTGD 1BNZA 1DJRD 4KV6A 1VQ8A 1B1ZA 5KYLA 3SDZA 2JK8A 3TEHB 5T1GA 2VZAA 3HOVB 4EGVA 5I2XA 1EIFA 3HOUG 3S2DH 5CORA 1B50A 3RLNA 2UXDL 5IY0A 1JJGA 1UWVA 1BXTA 3B6YA 3S1MH 2JA7H 2MQHA 1TXYA 2RF4A 5FJ8H 5EGTA 3KBXA 2K75A 2MJ8A 1YNNC 1VMPA 1SE3A 3KLWA 1GUWA 2NVXB 1Q7YC 2WIIB 4CKCA 4N8FA 4C3JH 1N36L 3HKZB 5C0XJ 4LFCQ 3TN2A 1D5MC 1HH2P 3I73A 4YCVA 4BBSH 4JV5L 4RWSC 3S1RH 1U9RA 1AE3A 2R61A 5A35A 2WACA 2KEDA 4TRDA 4DPGA 3ICEA 5EAYA 3CF5A 2XRSD 1PH9A 4OIJA 3EA6A 1Q90A 5JOBA 1VQBA 1CHQD 1TWCH 1I94Q 1GJXA 5BN3A 4N9PA 3M85A 1VQDA 3QIAA 3KLSA 2RDHA 1Y1VH 3BDLA 5LMUL 5AFWA 3J7AV 4PMWA 3M3YH 1EY0A 4IN3A 4CDFC 1PTOB 1B9MA 3DM1A 4Q0FA 1BOSA 1TWGB 2F0OA 3MXNB 4K8JA 1SNOA 4A4IA 1YBYA 2MGSA 4LFAQ 5FO9B 3GQBA 1RDPD 2KCNA 4FF2A 2A68C 3CU7A 3O13A 4XTCS 4K2LA 2KA7A 2HQEA 1N32Q 1K83B 4DAPA 1RF2D 1D5ZC 1OO9B 3E6ZX 4JI6Q 1O78A 3T1HQ 4OGQC 3K0XA 1B4OA 2FXQA 1R4PB 3A74A 1ESFA 1PMRA 4A93B 2HDMA 3CCUA 3HOWH 1QE6A 3AEVA 1TY2A 5F2DA 3D4WA 3L3OC 2Z8LA 5FO7B 3SK5A 1UEAB 3L0OA 4BY7B 1LT3D 5M5YH 3CHBD 4ZCKA 1QZGA 3H6MA 4HAEA 1I6VC 1DCZA 4G7ZC 2NZ1D 4FXGC 3OIQA 3N52A 4J6HA 1HHVA 5DM63 3CMEA 3PO2G 1IBLQ 1O80A 2HIVA 3PCOB 4HCSA 1MIUA 2PQAA 2XWBB 2YU9B 3HKZG 4JC0A 2D9UA 2J7ZA 3KUPA 1V1PA 4PQXA 1NJIC 2EJGC 5EKKA 1X56A 4XQQA 1BCPD 4MNOA 4A3LG 1T5EA 3FPPA 4POFA 1CZWA 4X66Q 5JEAJ 3CCEA 5J22A 1K28A 5AJ3L 4A3JG 1S5CD 4IUNA 5C4ZA 4C2MH 4KJNA 3KBGA 1YITA 3PIO3 4RFBA 3G48A 2QW7A 3PMFA 1CKNB 1IBKL 5C0XH 4B3SQ 4GOPA 3MEFA 3CMAA 3Q22A 1CQVA 3BDCA 2NN6H 1JJ2A 2YTVA 2VB2X 1C7YA 5C3EB 2Q8RE 5DLQE 2PZWA 5EKLA 1HCZA 1Z6HA 1XMQL 4Y7NH 2BE5D 4LWCA 1E3PA 1EWIA 2E2IB 1CKOA 2B2UC 3NELA 2IPKD 4KHPL 5GQOA 3S14H 1EY5A 4PV1C 3J81L 1K3BC 1L0WA 3S1NH 1TWAB 4LF5L 1VF5C 3GTKB 2TMPA 4A93G 1NCVA 5CV4A 2CWAA 5M3FH 1AP0A 3ND8A 4DV5L 3SE0A 3BJUA 4KHZA 4KY7A 2C5CA 3MFYA 4WORA 1BUVT 2SDFA 2DY8A 4X6AH 3C46A 2JA8G 1YZ6A 1BBWA 3I4NB 1CK1A 2K5DA 1PRTF 2NZOA 3TP5A 4AH6A 1LM0A 4X62Q 1PZKD 2H4OA 4QMGA 1VQPA 2R93H 2I5MX 4NPSA 1F9SA 5ELDA 3OW2A 1PDQA 2WAQE 2XTIA 4ME3A 1L1OC 4QUCA 3TZUA 1N34Q 2RSOA 2NN6G 1EFWA 3K80C 1YIJA 1QWYA 1CUKA 3E9IA 1QUQB 3PIP3 1II3A 4O42A 5IWAQ 5KGUA 1JJCB 1SYDA 3I70A 5I6WA 5M5XB 4OWTB 4XDXA 3NBIA 4GNXC 3OIPA 1BF4A 3H3VC 4C3IB 1U5KA 5GROA 3RMHA 4MZ9A 2B39A 1SAPA 4IURA 1V8QA 4HJ8A 2A69C 4IFDI 2B2VA 2RDFA 4NDXA 2E2HB 4JI2L 3BZDB 3GTLH 2PNRC 3GTQB 1GOZA 5JEAH 3RD4A 2AMCB 1UE5A 2WV6D 5E3FA 3T13A 1X9NA 1ICWA 1WFQA 1Y69U 2LFNA 4I65A 5KIXA 2CWPA 5C4HA 2UXBQ 1A15A 1K9MC 3QR8A 4FO2A 1H9SA 2HCCA 3BYYB 4YCUA 1G2SA 4KD3A 3JAML 1HNZQ 4IPHA 1HA5A 5FOBB 4FXKC 4LFBL 1FNUA 1NTGA 1Q86C 2PMZE 1QB5D 4L63B 3HOXB 3EVQA 2NTSA 1VQMA 4A3EG 4A3BH 4IUTA 1OXXK 1HUNA 1C48A 4E6IA 2L15A 3SHLA 4H0LC 4RGOS 1QVFA 4GKKQ 1XMOL 1PV4A 3V2TA 1A63A 1X55A 1U4LA 3NBHA 5IT9c 1N8RC 2OTJA 5BR8L 1I50B 2E74C 1M4VA 3AFQA 3MZ5A 3GV6A 1BDOA 4YY3L 2D0OA 3A5ZB 4ZUIA 1SN8A 2EYMA 1F9PA 4IQZA 1LYLA 2VW9A 1ET9A 1VS0A 2L0CA 1BO0A 1SMXA 1SEBD 5A2QL 2N3SA 4A3GB 4O2DA 2L9HA 2K33A 5CR3A 5D65A 1XYIA 2BA1A 2PO4A 1T9HA 1C0AA 3STBD 4JBJA 2ASBA 4IPGA 4DU9A 1VQ5A 2LXJA 4IALA 3V96A 4DK6C 1LUZA 2IW3A 1A2UA 3MXNA 1E0BA 1CQFA 2VB3X 3DMUA 4KY5A 1GD7A 2M00A 1IKMA 1IYVA 4MTKA 1IW7D 2NBFA 3S16B 1Y8PB 3CCMA 1D8LA 4UY8C 3C1EA 2R6GA 2J4XA 4FNFA 3T16A 2YTYA 2WB1E 4KY6A 2B29A 1KLGD 4JK1C 4JBWA 4R8NA 3NHHA 2UXDQ 3QJYA 4DV2L 3GD7A 4AYBE 2ENBA 4XYQA 2I46A 3T56B 2EY1A 4R8IA 1NUCA 2L5TA 1YNJD 5M5WB 5EKIA 4K8IA 1FNVA 3GDEA 5CMDA 1OTCA 1PFNA 1G51A 3HOXG 4DUYL 1JOOA 2EE1A 2F0SA 1HZAA 3FEWX 4BBRH 1NMGA 3K7AB 2B2WA 3DWQA 4O0AA 1N36Q 3EROA 3CCJA 4OELB 1HR0W 4R4IA 2SNSA 4R4CA 2K05A 3IRBA 4JV5Q 2NVQB 2PNHA 1B3AA 1EIGA 1EOTA 5CV5A 3BDOA 3S1QH 1STAA 1G91A 3TBIB 4UAIA 4CGYB 3LX0A 1KQSA 1WTPA 4BY1H 3TRZA 5BN4A 2JA6B 1CM9A 1EUJA 4A3GG 1JR0D 2CW0D 3T1YL 2ICIA 2CQAA 2V4DA 1BR9A 1QOHA 5LMUQ 2ZJPA 2KUMA 4A3DH 1L1OB 1QILA 3VYTA 1GUTA 1JWSD 2NN6I 5FKAC 1U0LA 1KNEA 2Z1CA 1STBA 2KEEA 2F03A 3KF8A 3FPUB 2LS01 5IGDA 1NSNS 4EQNA 4KKSA 2ZT9C 3FP9A 3H94A 3G4SA 2NWGA 3CKIB 2DJGC 5CV8A 5JJZA 4ABNA 2YYZA 1A3VA 3EQLC 1SNMA 2A1AA 2B2YA 4XIGS 1YJNA 2BE5C 3PQIA 1I6HB 1M90C 3HKSA 1ZKOA 5CV6A 2VY3A 4EQPA 4V190 3H3VH 1GUOA 3Q0AA 3WOEA 1VQJA 4DV1L 2FMCA 1J5EL 2B63B 2K5WA 1WTOA 1O7IA 3U4ZA 2EYJA 2YTXA 1TU2B 1LV9A 2RHSB 5TSSA 4PZ6A 3VR2A 3R2TA 1JCKB 4HCEA 2FHTA 4C1NI 4DV6L 3NQTA 4HSPA 3WDNA 4FP5D 4P73A 4YIJA 5EPJA 3NENA 4JI8L 3K5OA 3UDXA 2VUMB 4FF3A 5E1FA 2FJ2A 2C9OA 1ONLA 2JJQA 5L37A 4GN3B 5FLXE 2VXWA 4A3DG 2JA6G 1NR4A 2Q2UA 5J3BA 3HS0C 3J80E 2QA4A 1IHZA 1TQOA 2K14A 2EVBA 3OWFA 5LMNW 3CCQA 5JAVA 4B3RL 1IBKQ 3HP3A 3M7GA 2SEBD 2R7ZH 1BVSA 4GLAC 2GVAA 3HOUH 3S17B 4DK3C 3M4OB 1MJCA 3CCSA 1XMQQ 4OIKA 1G8ZD 4LUOA 2E75C 3BYTB 4X3KA 2UUCL 1JE5A 1AW7A 1E1TA 1X3FA 3GTMB 3DEOA 4KHPQ 1PTOF 2D62A 4DR6L 1RL2A 3GTOB 2PI2A 4M8AA 1VQ4A 4LF5Q 1X3PA 3NSWA 4F87A 4A3IG 4NXMQ 4FYDA 1SE8A 3F2BA 1TS4A 3U9SA 1PFMA 4NXNL 5I4DA 5LL6X 4DV5Q 3EBEA 5D3DA 3TDQA 4JBKA 3QWNA 1AN8A 1S4ZA 3PIPA 2B63G 1MSHA 2PZTA 1V43A 3I4OA 5KNDA 1GHKA 3AFPA 3U58A 4HR7B 4POGA 2IY5B 1G6PA 1KTKA 4ID6A 1I5FA 3RUZA 1D7QA 3CD6A 4HN7A 5CGKA 2KHJA 2WAQB 1QZHA 2AHOB 3S2HB 1DYQA 4RHSA 3M4YA 2DGYA 2VUMG 2SOBA 1SYCA 2N88A 3KFUA 3VR5A 4EQOA 3K7UC 4DR1L 3L9AX 1OXTA 2VS1A 1KL9A 3A7AB 3FKIH 4CDCC 3K5NA 2VQEL 2R7ZG 1GO3E 4JI4L 3NXWA 1IL8A 3UE0A 2KCTA 3NWTA 4U673 2JA5B 2QGQA 1R9TB 1EIHA 1QVCA 1X65A 1PVOA 2Q8TA 4IO9A 3HOVH 1S5BD 2G9DA 1EQTA 2L55A 3DXJC 1PA6A 2LMCB 4MHEA 4XQNA 1Y1WB 3RZDB 2XGTA 1Q8IA 2K6AA 2RKSA 4V0BA 2E2JB 3STBC 1S5DD 3NTHA 4JI2Q 3K58A 2Z6KC 2R92B 5ELCA 4ZAIA 4C3JB 1ESRA 3ERQA 4A3MG 3S15B 2NVXH 3PO2H 1ZEQX 3A55A 4BBSB 2PMZB 5E4WC 1IW7C 2VL6A 5KNCA 4WRDA 3J80i 4DR5L 3NTKA 2UUBL 3C3LA 4OHJA 2N49A 1EQRA 5G3LD 1O7ZA 3IFDA 4LAAA 2B2UA 3HG9A 5LHY1 4A3LH 5IP7G 1JWMD 1ENFA 2D2CC 4B3TL 3CQZH 4AIMA 3CC2A 4JBMA 4A3JH 1DOKA 4CJ2C 4HIOA 3FKIG 1A62A 3D0FA 1CSPA 1JT8A 1A8VA 2HIXA 1XMOQ 4WFN3 3BS1A 4B3ML 5BR8Q 4C1NK 1Q1EA 2WP8J 1MGSA 1PTOH 2OXPA 5IT9L 4EQ5A 1TWGH 4YY3Q 1HNWL 4IUPA 4DAVA 3RN2A 2QILA 3UDIA 2KECA 3HOVG 2K28A 4P2CB 4YHHL 3BZCA 4KLKA 2BA0A 2DUDA 2IHFA 3G6EA 2SNMA 2IJ0A 4R4QA 2JA5G 3RNUA 3KYHC 2I5HA 4OO1H 3J81j 1I4GA 3HOWB 2K5VA 1CHPD 2ZXRA 1XPOA 4QQBX 4A93H 3URYA 1L1OA 5ELOA 4OWWB 2KENA 2ZJQA 5C4XB 3SEBA 1EWHA 2F0HA 3KJPA 1GM5A 1SRUA 1KRTA 2WB1B 4DN4M 5J39A 4DV0L 2TSSA 4PMBA 3GTJH 2JA8H 3I56A 4GNXA 1WTVA 1P8LA 1SNQA 4AYBB 2CH4A 3IL8A 3I4LA 3IAYA 1SYFA 4LF4Q 1RODA 1F2YA 1WCMB 3N6RA 4CDEC 4DXFA 2OEOA 1XNQL 1LTLA 2HDLA 3CCRA 1BBXC 3I72A 4DV2Q 2A6ED 4L5QA 4JI5L 1PXUA 3PO3B 3I2ZA 1A3TA 3A8KE 3H0GB 5LL6S 4QY7A 3H3VI 1A2TA 2FINB 4ZQ3A 1TWHH 1QG7A 1TS5A 3DM3A 4QCLA 2M9VA 3X3NA 1MD2D 3K8AA 2RA4A 1FGBD 1KC8C 2PW7A 1EYGA 1VQCA 1E24A 2Q2IA 2BH8A 2HHHL 2F3WA 5NUCA 4C3HB 2K32A 3T4AC 1LO5D 4HIDA 1SXTA 2R7DA 5IGEA 3OTOL 2F0IA 1HTLD 4DAYB 1I3QB 3W2DA 5C3EH 4ZYSA 4B9WA 2DNEA 4Y7NB 4LF7L 3I8ZA 1XTCD 5IE8A 4HJ7A 4OO1G 2F0MA 2NUCA 2I5LX 3ULJA 2JP1A 2ZXPA 2F0GA 4DFAA 2F3VA 5EBCA 3T1YQ 2E2IH 2HT1A 4R9WA 4G7OC 1E7ZA 2AQ1B 3X3MA 3K59A 4TVAB 5JPNC 3A7LA 4DGZA 2JXMB 2AWOA 1TWAH 1ZYRD 4KMUC 3VR6A 5M3FB 1FJGQ 3CPFA 4BY7G 3AYHB 1TR5A 2L12A 4XT3B 4BWGB 1EYAA 1SJHD 2O2LD 1RCVD 3K0YA 2F0DA 5C4XG 2WB1G 4LF8L 1AFPA 1XX8A 3A0JA 4GKJL 3OSOA 4ZRZA 2IX1A 1GKHA 4IUQA 2X6LA 3I4NH 1L0YB 1PHJA 3M7NA 3MWYW 3LWUA 3H09A 4A3EH 1RJTA 5FK9C 5DEHA 3W1GA 4C56C 4JI7L 1JWUD 3J81i 2D5DA 3W5OA 1X32A 2K1BA 4DV1Q 3H0GG 3C2PA 1IYJB 3MXPA 3CC4A 3CW2C 1J5EQ 2Y0SE 1SFOB 5FLXc 4RGNA 1PH6A 1S72A 3IFTA 5E7NA 3J7YW 4DV3L 1VQ6A 4OL7A 4P71A 5C3EG 2L4NA 1PZJD 3J80c 1T5XD 4DV4L 5M5XH 1P16A 2F4VL 4JI8Q 4C3HG 3HFZB 2JE6I 4LNQA 3P75A 2N8NA 1ML0D 2E76C 1RKNA 4C3IH 4HJ9A 3KLSX 2ES2A 3CP0A 2H1EA 4X3TA 3R2IA 1V9PA 3VA7A 2O5JC 1QNKA 3I91A 3DLLA 2MO0A 4J1MA 2F0LA 4TSSA 1ILPA 2RHQB 4DNRB 2E2HH 3ERSX 1B8AA 2ICEC 3C1FA 3M9BA 3GTQH 1K3RA 4B3RQ 1E2WA 1HZBA 1AH9A 1LTSD 1O7YA 3MFGA 3VYUA 1B3QA 3OPOA 3V05A 4XXEA 1UE1A 1V1QA 3RLOA 4DK1A 3I4NG 3GTPB 2UUCQ 2F0NA 3EFXD 4KN4C 5IIFA 2ZXOA 2E5LL 1STEA 2Q2HA 4JOIC 2R3ZA 4DR6Q 3I4MB 1B44D 3HOXH 2IL8A 1U4PA 1AEXA 5JVG3 1QVGA 4Z9CB 4PG3A 1EQQA 4TQUS 3BVGA 3RZOB 2F0UA 4NXNQ 1KDCA 4QL5A 2DY7A 2GA4B 4IJHA 1DOLA 1SYBA 2EJFC 2NVTB 4J8QA 3HOZB 4OX9L 4N9TA 4YWLA 5JJIA 1DGSA 4A75A 1UE6A 1X3EA 4C3IG 3J7A5 4FDBA 3SGIA 4A3GH 2MP1A 2RBMA 1MKHA 1PH3A 1LT6D 4K6DA 2CCZA 2F0JA 4DV7L 1A0IA 5I2YA 2ID0A 4GLXA 2OCEA 1JOQA 1YNND 2CVRA 4EVOA 2KBNA 4DR1Q 2WKCA 2ZJRA 1EZ8A 3ONAB 2Q2TA 2VQEQ 2H5XA 2NVYB 3CCLA 1X6OA 4JI4Q 4ZUJA 3U4VA 2Z4IA 4UHVA 1EY7A 3R8BA 3A8IE 5IGFA 4XT1B 3NTIA 3S16H 1WTQA 3BZKA 2OTLA 3ULLA 5IYDG 4OO1I 3HOYB 1HUMA 1TS3A 2OWOA 5M3MB 4LF6L 1HRJA 1SYGA 4HMJA 1IXRA 4MN3A 5IP9H 1HJPA 3S9WA 2OQKA 2A8VA 5ISRA 5C4JH 4RCOA 5M9OA 3TS2A 4IUVA 2JEBI 3HRZC 1FNWA 2LXKA 3I4MG 1G291 3FVQA 1JE4A 3MEHA 4RKLA 1I4XA 3NUCA 3GO5A 1TVXA 3KDFB 2R7FA 4R4TA 4K5VA 1U4MA 3K7AH 1JORA 2J0TD 1Q8KA 4DR5Q 3AU7A 3G6JB 4K6LA 1IBML 3BVMA 4G7HC 5C5MA 2UUBQ 2NVQH 1FGUA 4QJFA 1BCPC 1K8GA 1JB7A 1H9MA 4BY1B 1VQGA 2OF1A 4RGTA 1S3OA 2UUAL 1BBUA 1RIPA 4B3TQ 4RHRA 4KK7A 1CKNA 1GUNA 2JA6H 4F88A 2KHSA 2QEXA 2MO1A 1SROA 3K6OA 4KTAA 4RMFA 1MJEA 1PFBA 2EYPA 4B3MQ 3TREA 4Q5VA 1TWFH 5EJWA 3F2CA 4L6TB 1OXUA 1YI2A 1SBBB 1ICFB 4KI0A 4DAYA 1HNWQ 1SE4A 1F2MA 1HA6A 3KK7A 2VNUD 1NMFA 2VQFL 1VQOA 2MUYA 4R1JA 1JMCA 1AZPA 4UPAA 4YHHQ 1PH7A 3SVMA 5IYBG 5J1ZA 1B2TA 5BN5A 5IP9G 1W6KA 1PRTD 4K2KA 4X65L 1KDAA 4L5SA 1YNXA 1LTAD 1F77A 1E2VA 4PZ7A 4X62L 1SSOA 1I6HH 1VQIA 4A3IH 3MXUA 3J7AF 2B2TC 1UNSA 1HR0L 4I7AA 1K8AC 4IJLA 1EL0A 1SR3A 3J7ZC 1W3SA 2EDGA 1HTPA 1JOKA 3TP7A 1DZ1A 5C44B 1U4RA 2B63H 3BG3A 2MPMA 3NQIA 4WJWA 3I3CA 4L5RC 1I4QA 2UXCL 2EQSA 2F0QA 3FDTA 2C35B 3OHXC 3F8TA 3SR1A 2L11A 2EYHA 4DR3L 1H95A 3QB3A 1XNQQ 1X3QA 2AWNA 1EFID 2VUMH 2JYOA 3QOJA 1X3GA 3LWEA 1LTID 1KLUD 5AJ3Q 2HD3A 1K0RA 4A3FB 1IYUA 1QUQA 2Z6KA 4RG1A 1XNRL 4KJOA 2JQOA 1HZCA 2F0PA 2ZTDA 2F0WA 2IHEA 3E9HA 1EYDA 4LUVA 2PPBC 4DF7A 3E5SA 2UU9L 2ZTCA 5HY6A 3QO2A 2XVSA 2Q8IB 3D8GA 1VQNA 3HOUB 2BOSA 3OTOQ 4BA1I 2PI2E 4MIUA 4LF7Q 3NK9A 4CDDC 5EBDA 4DXGA 4H7BA 1ASYA 1F9RA 3PF5A 3GTGB 2QEJC 3S17H 2AQ3B 3M4OH 1HNZL 1HZ9A 4A3KB 1TIID 3EN2A 2A6HD 2FFKB 2CKZB 1H9KA 4DR7L 2JEAI 1S5ED 3GTMH 1PH5A 4I7ZC 3RLFA 1W2BA 5ELBA 2RCFA 5CBAE 1C8CA 4BA2I 3GTOH 1GUSA 4A3MH 3TZDA 4GZYC 5HGTA 3CXCA 2F3IA 1VDZA 5C3WA 2EYOA 2X6GA 5C44G 4JCVE 3R93A 4LF8Q 1LTBD 1CA6A 4GKJQ 3AQQA 5IP7H 3I90A 2EXZA 4CJ1B 3OWEB 3CRKC 5IODA 4RH6A 1VQHA 2A69D 2Y0SB 5C5LA 5CYUA 1NBWA 1KNAA 1D1IA 3FRPB 3UDFA 1CTMA 4B08A 3PUXA 3D3RA 4LUZA 3S2HH 3W3AA 4IOAA 1RD9D 1MBYA 1V1OA 4ULLA 5LMNL 3A54A 5GAHC 2KHIA 4R4OA 3QG1A 4IPCA 3VYRA 3L2PA 1PYBA 1STHA 4GLVB 3OW7A 1LACA 2O5IC 2L1BA 4H44C 1TT2A 5FLXL 4G4KA 1XPUA 4NP5A 3S2DB 4M1UB 4DV3Q 3SK8A 1EY8A 1YHBA 1QNUA 2K7VA 1SMYD 2LY7A 4DV4Q 3FHWA 3S1MB 2JA7B 3J80L 2F4VQ 1E1OA 2EXDA 2JA5H 1BCPB 3T53B 1R9TH 4DA2A 1W6JA 1PZID 1H9SB 3D4RA 2KQ3A 5T1IA 1IL2A 2E2DC 1Y1WH 3RZDH 1ENAA 2CFMA 4A3KG 2ATWA 1DD2A 2E2JH 4ILWA 1FD7D 5IYCG 1L0XB 1EQVA 3S1RB 2QDBA 4UP8A 2R92H 3PO2B 3FMCA 1EU3A 4HTHA 4ZKCB 3S15H 4JW0A 4ALPA 3A56A 3EJIA 2K4KA 1HQMC 3NBHB 4LFBQ 1KIXA 4OXPA 1TWCB 1QJOA 1NAPA 3PF4A 2XIWA 1WTRA 1Y1VB 2WAQG 1YNJC 1WD1A 2E5LQ 4IOCA 3M3YB 4IFDG 1JC7A 1XXGA 3CQZB 2AQ2B 2ZM6L 3UDGA 1IZ6A 4A3JB 3PUWA 4JI3L 2Y0SG 2GVBA 1O7LA 1PH8A 2Z0SA 4JI0L 1X54A 1N33L 3A5UA 3CCVA 4DR4L 3KDFA 3K57A 2F4IA 4GN5A 5I9OA 1LT4D 2K04A 1B7YB 1BKBA 4FF4A 2K52A 3ND9A 3J81E 4KKTA 1E2ZA 1RTOA 4OX9Q 1K83H 2XSCA 3D6CA 4K0KL 1JB3A 1SNPA 3GV3A 4CBVA 2CW0C 2BH2A 1Y1WG 2JA7G 3F2UA 1YHAA 3ZJYC 5FJ8G 3F1ZA 5M5YB 4KHVA 1CT1D 4DV7Q 5KEEA 4XQJA 4BY7H 1R4QB 3PV0A 4S3SA 4K14A 2R92G 3MAQA 2BDNA 2A73B 4C3JG 1VQEA 4P74A 1C4QA 5C4XH 3CRLC 1D1KA
chains in the Genus database with same CATH topology
3CPWA 3T1YL 3GTQH 4BBSG 1K3RA 2AKWB 4JI1Q 4X64Q 5H1SE 4LF9Q 4A3CG 2YU9H 4JI7Q 2JA9A 3KF6A 1C9OA 4B3RQ 1AH9A 1HZBA 5LMUQ 2ZJPA 1VQFA 4JG2A 4A3DH 5HGQA 1L1OB 4JYAQ 1NY4A 4A3FG 2NN6I 1U0LA 3PSIA 1UE1A 1K73C 1V1QA 3RLOA 1B70B 1WCMH 2IX0A 4LF6Q 4DR2Q 3I4NG 1CKMA 3Q8DA 4DUYQ 2UUCQ 3PO3H 3FP9A 1VQ8A 3H0GH 4LW1A 1EOVA 1Y1VG 3G4SA 2E5LL 2Q2HA 4JOIC 2V1CC 2JK8A 3TEHB 2YYZA 4DR6Q 2A1AA 4XIGS 2RCNA 1YJNA 2VZAA 2A19A 3HOXH 1EIFA 3HOUG 1QVGA 1M90C 4PG3A 3HKSA 3S2DH 3RLNA 3WWVA 5FLMH 2MFIA 1EQQA 2UXDL 5IY0A 4TQUS 1JJGA 2VY3A 4NB3A 1UWVA 3H3VH 4NXNQ 4QL5A 1VQJA 4DV1L 3B6YA 3S1MH 1N9WA 4IJHA 4C3HH 1IBMQ 2JA7H 2MQHA 1TXYA 1FVIA 1J5EL 2RF4A 3KF8B 1O7IA 3W1BA 5FJ8H 3U4ZA 1WJJA 1XJVA 1KXLA 4OX9L 4JOIA 2K75A 2YTXA 1I3QH 4YWLA 1XPRA 2RHSB 5JJIA 1DGSA 4A75A 1Z9FA 4PZ6A 3KLWA 1HNXL 1UE6A 4DV6L 1X3EA 2UUAQ 1Q7YC 3J7A5 3HOWG 1OXVA 4FDBA 4P73A 4C3JH 2N78A 1N36L 4EX5A 3SGIA 3ER0A 5C0XJ 3NENA 4QIWE 4LFCQ 3GTKH 4A3GH 4JI8L 3UDXA 4JV5L 1HH2P 1MKHA 4YCVA 3VDYA 1PH3A 4BBSH 4DAMA 3S1RH 1YJWA 2ALYB 2CCZA 1AE3A 4DV7L 2JJQA 4NXML 1A0IA 3ICEA 4DPGA 4P72A 2ID0A 5EAYA 5JJLA 4GLXA 3CF5A 2OCEA 4GN3B 4AQYL 1PH9A 2KBNA 4DR1Q 4DUZL 1Q12A 2ZJRA 4A3DG 1VQBA 2Q2TA 4AYBG 2VQEQ 1YEZA 2H5XA 2JA6G 5GAEC 2VQFQ 1TWCH 2Q2UA 1X6OA 3CCLA 4JI4Q 5JJKA 3U4VA 4QGUA 1I94Q 5J3BA 1VQKA 4JI1L 4X64L 1VQDA 3M85A 4LF9L 2QA4A 1WCMG 5ELNA 1Y1VH 2K14A 5LMNW 4B3RL 3CCQA 5LMUL 3M3YH 1IBKQ 4PMWA 3S16H 3PO3G 4X65Q 3BZKA 1EIYB 2OTLA 2R7ZH 1KAWA 3ULLA 1BVSA 5IYDG 4JYAL 4GLAC 4OO1I 3MXNB 2GVAA 3HOUH 4DK3C 4A4IA 2OWOA 4LF6L 1MJCA 1YBYA 4LFAQ 3CCSA 4DR2L 1XMQQ 2NZHA 1HR0Q 4LUOA 3L7ZC 2UUCL 1IXRA 5IP9H 1JE5A 1J6QA 1PYSB 4XTCS 5FLMG 4DV6Q 1E1TA 1X3FA 1HJPA 5GAGC 2OQKA 2A8VA 1N32Q 5C0XG 4KHPQ 5C4JH 1SFOH 2D62A 4DR6L 1UE7A 3TS2A 1RL2A 3G71A 2JEBI 2PI2A 1VQ4A 4JI6Q 2LXKA 3I4MG 2UXCQ 1G291 3PUYA 3T1HQ 4LF5Q 3K0XA 1M1KC 2FXQA 3A74A 4A3IG 4NXMQ 3GO5A 1KRSA 3KDFB 2R7FA 1SE8A 4R4TA 3S24A 3F2BA 3CCUA 4DR3Q 3K7AH 3AEVA 3HOWH 4NXNL 4MTNA 4DV5Q 1Q8KA 3EBEA 4JBKA 4DR5Q 1IBML 2OQ0A 3PIPA 2UUBQ 2NVQH 3L0OA 2B63G 1FGUA 1V43A 4QJFA 3I4OA 1K8GA 5M5YH 1JB7A 3AFPA 1KD1C 1VQGA 3U58A 1QZGA 1Z47A 4POGA 2IY5B 1XNRQ 1G6PA 1S3OA 2UUAL 1BBUA 1I5FA 3CMEA 1RIPA 2KCMA 1IBLQ 2HIVA 4B3TQ 5M3FG 3PCOB 4YWKA 1CKNA 1MIUA 3CD6A 1D7QA 2UU9Q 2JA6H 2KHJA 2PQAA 4LFCL 3HKZG 2QEXA 4JC0A 1QZHA 2AHOB 3BU2A 4HJAA 2DGYA 2MO1A 1YVCA 3RN5A 2VUMG 1SROA 4GOPC 4RMFA 1MJEA 4YWMA 1NJIC 3KFUA 1X56A 4MNOA 4B3MQ 4A3LG 4BXXH 3TREA 1TWFH 3HKZE 5IYDH 3F2CA 4POFA 1OXUA 1YI2A 3K7UC 4DR1L 1OXTA 2VS1A 3PUZA 1KL9A 3FKIH 4KI0A 1E22A 4X66Q 1HNWQ 2D0PA 5JEAJ 2VQEL 2R7ZG 3CCEA 2VNUD 1GO3E 1NMFA 2VQFL 1VQOA 4JI4L 5AJ3L 4A3JG 1YJ9A 1I94L 4R1JA 1JMCA 1NE3A 3UE0A 3GTPH 4C2MH 4UPAA 3KF6B 4YHHQ 1YITA 1PH7A 2KCTA 3G48A 1VQLA 5IYBG 4DR7Q 1CKNB 1Q81C 1IBKL 2QGQA 2R93G 4B3SQ 5IP9G 4GOPA 1QVCA 3MEFA 3CMAA 4X65L 1X65A 1JJ2A 1PVOA 2YTVA 4IO9A 1C7YA 1YNXA 4L5SA 3HOVH 3I4MH 4PZ7A 5DLQE 4APVA 1I50H 4X62L 1I6HH 4OWXB 1VQIA 4A3IH 1PA6A 4IPDA 4LFAL 1XMQL 4Y52H 2XGTA 4Y7NH 1HR0L 4LWCA 1WYDA 1K8AC 1E3PA 4HIKA 4IJLA 3RZOH 1SR3A 3J7ZC 3STBC 1W3SA 1EWIA 1VQ9A 1UEBA 4JI2Q 3JAMi 1CKOA 1XTDA 1N32L 2B63H 3NELA 4KHPL 2Z6KC 4A76A 3D31A 5GQOA 3S14H 2NVTH 1WOCA 4JI6L 3HOZH 3E0EA 4L5RC 1L0WA 3S1NH 2UXCL 2EQSA 3T1HL 2C35B 4A3MG 1FL0A 4LF5L 3F8TA 4P75A 4A93G 1HNWL 2NVXH 3PO2H 2K50A 2CWAA 5M3FH 4DR3L 1H95A 4DV5L 4HJ5A 4GN4B 4DR5L 2VL6A 3BJUA 1XNQQ 2IT1A 3J80i 4KHZA 2AWNA 5JEAG 2UUBL 2VUMH 2N49A 1EQRA 5LMNQ 4UP9A 1X3GA 5AJ3Q 1K0RA 2EIFA 4X6AH 2JA8G 1QUQA 1YZ6A 2Z6KA 4RG1A 5IP7G 2I0QA 4A3LH 1XNRL 2JQOA 1BBWA 1HZCA 2ZTDA 2IHEA 3E9HA 1L2FA 3K81C 4UP7A 1IBLL 4B3TL 4LUVA 4BXXG 3CQZH 4AIMA 2NZOA 2UU9L 4AH6A 2NVYH 3CC2A 4JBMA 4A3JH 1LM0A 4HIOA 4HIMA 2ZTCA 5HY6A 4X62Q 3FKIG 1A62A 3D0FA 1CSPA 1JT8A 1VQPA 1A8VA 2HIXA 1XMOQ 5IYBH 1VCIA 1VQNA 3LGJA 2I5MX 4NPSA 4B3ML 2UXBL 2R93H 5BR8Q 3JC66 1Q1EA 3H15A 2WP8J 4LF4L 3OTOQ 4BA1I 2PI2E 3OW2A 2WAQE 2XTIA 2ZTEA 4EQ5A 4ME3A 1L1OC 1TWGH 2CQOA 1N34Q 4LF7Q 4YY3Q 4X66L 5M5WH 2HQLA 2MNAA 3KJOA 1ASYA 2NN6G 3RN2A 1EFWA 3K80C 3PF5A 1YIJA 3UDIA 5M3MH 3M4OH 1CUKA 4A3BG 3E9IA 1QUQB 1HNZL 3HOVG 1HZ9A 2K5NA 3F2DA 5IWAQ 3EN2A 4J15A 1JJCB 4YHHL 3BZCA 4KLKA 2BA0A 2DUDA 2IHFA 2CKZB 4OWTB 3G6EA 1GVPA 1Q82C 4DR7L 4R4QA 2JEAI 2JA5G 3GTMH 3OYYA 1W2BA 3RLFA 4GNXC 3RNUA 1PH5A 4B3SL 3KYHC 2I5HA 3J81j 4BA2I 3GTOH 1U5KA 5GROA 4MZ9A 4A3MH 2K5VA 2K5HA 4HJ8A 1XPOA 4IFDI 4QQBX 4A93H 3HOZG 3CXCA 1L1OA 2F3IA 5ELOA 4OWWB 2KENA 3M4QA 2ZJQA 3KJPA 4JI2L 1GM5A 1SRUA 1KRTA 3GTLH 5C44G 2AMCB 3J81c 1UE5A 4JCVE 4LF8Q 4DV0L 1X9NA 3NEMA 1PFSA 4GKJQ 1WFQA 3AQQA 3GTJH 3I56A 5IP7H 4GNXA 2JA8H 1P8LA 1PH2A 4GS3A 4YCWA 1OXSC 3U50C 2ZM6Q 1VQHA 2CWPA 4JI3Q 2UXBQ 1NBWA 4LF4Q 3ULPA 5K36G 1K9MC 3UDFA 4JI0Q 1XNQL 3PUXA 1LTLA 4LUZA 1N33Q 3S2HH 4IOAA 3CCRA 3CAMA 4DV2Q 4DR4Q 4JI5L 4L5QA 4YCUA 5LMNL 2B3GA 3I2ZA 1FJGL 5GAHC 2KHIA 4QY7A 4R4OA 4L5TA 5C0XI 1HNZQ 3H3VI 4IPCA 4IPHA 3I55A 4LFBL 1TWHH 3RR5A 3DM3A 3L2PA 1PYBA 1NTGA 1Q86C 2PMZE 4GLVB 2PQAB 3K8AA 1VQMA 1XPUA 4A3EG 1KC8C 4DV3Q 1EYGA 4A3BH 4K0KQ 1OXXK 3EIVA 1VQCA 1YHBA 2L15A 4GNXB 1E24A 2Q2IA 3HOYG 2BH8A 2HHHL 1QVFA 4GKKQ 1WI5A 4DV4Q 3FHWA 4IFDJ 5M3MG 1XMOL 1PV4A 2F4VQ 1E1OA 1A63A 1X55A 2EXDA 3PGZA 4HIDA 2JA5H 1N8RC 5IT9c 2OTJA 5BR8L 2R7DA 1R9TH 3CC7A 3OTOL 3I7FA 3AFQA 4DAYB 1Q46A 5C3EH 3TS0A 4YY3L 1N34L 4LF7L 5IE8A 2D0OA 4DV0Q 4HJ7A 3A5ZB 1IL2A 4OO1G 3HOYH 1SN8A 1LYLA 2VW9A 1VS0A 4BBRG 3RZDH 1Y1WH 2I5LX 2CFMA 5IWAL 1SLJA 1SMXA 4A3KG 2ATWA 2E2JH 3ULJA 2N3SA 4O2DA 3PIOA 1ASZA 4GOPB 5IYCG 1S40A 3T1YQ 2E2IH 2HT1A 5C44H 2BA1A 1T9HA 1E7ZA 1YHQA 4UP8A 1C0AA 4TVAB 2R92H 3STBD 4JBJA 2ASBA 4WJ4A 4IPGA 4JI5Q 2AWOA 1TWAH 1VQ5A 4BY7G 1FJGQ 3CPFA 3PO2G 3S15H 2LXJA 4DK6C 4ALPA 2K4KA 3AYHB 3NBHB 4BY1G 4LFBQ 1KIXA 1LUZA 2E8GA 4DNIA 3M9BA 4A3CH 4OXPA 5C4XG 3PF4A 2WB1G 1GD7A 4LF8L 2WAQG 2E5LQ 3A0JA 4IOCA 4A3FH 4GKJL 2HHHQ 4IFDG 4OONA 1D8LA 2GN5A 3CCMA 4UY8C 1GKHA 2IX1A 4PZ8A 2R6GA 2ZM6L 3UDGA 1IZ6A 3I4NH 3PUWA 1PHJA 2F52A 2WB1E 2YTYA 1Q1BA 2Y0SG 3KOJA 2GVBA 2B29A 4JI3L 4A3EH 2Z0SA 1PH8A 4JBWA 3W1GA 4JI0L 4JI7L 1X54A 1N33L 2UXDQ 3A5UA 3J81i 3TQYA 3CCVA 3S17H 3JAMc 4DV2L 3GD7A 3KDFA 4DR4L 3PUVA 3W5OA 4GN5A 4AYBE 4DV1Q 1AE2A 3H0GG 1IYJB 1B7YB 1CSQA 1VQAA 1BKBA 3CC4A 3CW2C 1J5EQ 2K52A 2Y0SE 1PH1A 2LSSA 4DKAC 5FLXc 3GDEA 1S72A 1PH6A 4OX9Q 1OTCA 1G51A 1K83H 5E7NA 3HOXG 4DUYL 4DV3L 3GTGH 1HNXQ 3M4PA 4K0KL 1HZAA 1VQ6A 4BBRH 1NMGA 4P71A 2WFWA 2YV5A 5C3EG 4A3KH 4O0AA 3J80c 4WJ3M 1N36Q 4GKKL 3CCJA 4DV4L 1HR0W 3UE1A 5M5XH 1P16A 4R4IA 4R4CA 4JI8Q 1Y1WG 2BH2A 2F4VL 5IYCH 3IRBA 3HFZB 2JA7G 2JE6I 4JV5Q 4LNQA 1YHAA 1Y14B 2PNHA 3ZJYC 2N8NA 5FJ8G 3F1ZA 1PH4A 4DV7Q 4C3IH 4HJ9A 3S1QH 2ES2A 3CP0A 5GADC 4BY7H 3PV0A 4H02A 1V9PA 2R92G 1KQSA 4AQYQ 3DLLA 4BY1H 3TRZA 4DUZQ 2MO0A 1VQ7A 1VQEA 4P74A 2RHQB 2E2HH 3ERSX 1EUJA 1B8AA 5C4XH 4A3GG 3M7NA 1KHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW A;  3T1Y L;  3GTQ H;  4BBS G;  1K3R A;  2AKW B;  4JI1 Q;  4X64 Q;  5H1S E;  4LF9 Q;  4A3C G;  2YU9 H;  4JI7 Q;  2JA9 A;  3KF6 A;  1C9O A;  4B3R Q;  1AH9 A;  1HZB A;  5LMU Q;  2ZJP A;  1VQF A;  4JG2 A;  4A3D H;  5HGQ A;  1L1O B;  4JYA Q;  1NY4 A;  4A3F G;  2NN6 I;  1U0L A;  3PSI A;  1UE1 A;  1K73 C;  1V1Q A;  3RLO A;  1B70 B;  1WCM H;  2IX0 A;  4LF6 Q;  4DR2 Q;  3I4N G;  1CKM A;  3Q8D A;  4DUY Q;  2UUC Q;  3PO3 H;  3FP9 A;  1VQ8 A;  3H0G H;  4LW1 A;  1EOV A;  1Y1V G;  3G4S A;  2E5L L;  2Q2H A;  4JOI C;  2V1C C;  2JK8 A;  3TEH B;  2YYZ A;  4DR6 Q;  2A1A A;  4XIG S;  2RCN A;  1YJN A;  2VZA A;  2A19 A;  3HOX H;  1EIF A;  3HOU G;  1QVG A;  1M90 C;  4PG3 A;  3HKS A;  3S2D H;  3RLN A;  3WWV A;  5FLM H;  2MFI A;  1EQQ A;  2UXD L;  5IY0 A;  4TQU S;  1JJG A;  2VY3 A;  4NB3 A;  1UWV A;  3H3V H;  4NXN Q;  4QL5 A;  1VQJ A;  4DV1 L;  3B6Y A;  3S1M H;  1N9W A;  4IJH A;  4C3H H;  1IBM Q;  2JA7 H;  2MQH A;  1TXY A;  1FVI A;  1J5E L;  2RF4 A;  3KF8 B;  1O7I A;  3W1B A;  5FJ8 H;  3U4Z A;  1WJJ A;  1XJV A;  1KXL A;  4OX9 L;  4JOI A;  2K75 A;  2YTX A;  1I3Q H;  4YWL A;  1XPR A;  2RHS B;  5JJI A;  1DGS A;  4A75 A;  1Z9F A;  4PZ6 A;  3KLW A;  1HNX L;  1UE6 A;  4DV6 L;  1X3E A;  2UUA Q;  1Q7Y C;  3J7A 5;  3HOW G;  1OXV A;  4FDB A;  4P73 A;  4C3J H;  2N78 A;  1N36 L;  4EX5 A;  3SGI A;  3ER0 A;  5C0X J;  3NEN A;  4QIW E;  4LFC Q;  3GTK H;  4A3G H;  4JI8 L;  3UDX A;  4JV5 L;  1HH2 P;  1MKH A;  4YCV A;  3VDY A;  1PH3 A;  4BBS H;  4DAM A;  3S1R H;  1YJW A;  2ALY B;  2CCZ A;  1AE3 A;  4DV7 L;  2JJQ A;  4NXM L;  1A0I A;  3ICE A;  4DPG A;  4P72 A;  2ID0 A;  5EAY A;  5JJL A;  4GLX A;  3CF5 A;  2OCE A;  4GN3 B;  4AQY L;  1PH9 A;  2KBN A;  4DR1 Q;  4DUZ L;  1Q12 A;  2ZJR A;  4A3D G;  1VQB A;  2Q2T A;  4AYB G;  2VQE Q;  1YEZ A;  2H5X A;  2JA6 G;  5GAE C;  2VQF Q;  1TWC H;  2Q2U A;  1X6O A;  3CCL A;  4JI4 Q;  5JJK A;  3U4V A;  4QGU A;  1I94 Q;  5J3B A;  1VQK A;  4JI1 L;  4X64 L;  1VQD A;  3M85 A;  4LF9 L;  2QA4 A;  1WCM G;  5ELN A;  1Y1V H;  2K14 A;  5LMN W;  4B3R L;  3CCQ A;  5LMU L;  3M3Y H;  1IBK Q;  4PMW A;  3S16 H;  3PO3 G;  4X65 Q;  3BZK A;  1EIY B;  2OTL A;  2R7Z H;  1KAW A;  3ULL A;  1BVS A;  5IYD G;  4JYA L;  4GLA C;  4OO1 I;  3MXN B;  2GVA A;  3HOU H;  4DK3 C;  4A4I A;  2OWO A;  4LF6 L;  1MJC A;  1YBY A;  4LFA Q;  3CCS A;  4DR2 L;  1XMQ Q;  2NZH A;  1HR0 Q;  4LUO A;  3L7Z C;  2UUC L;  1IXR A;  5IP9 H;  1JE5 A;  1J6Q A;  1PYS B;  4XTC S;  5FLM G;  4DV6 Q;  1E1T A;  1X3F A;  1HJP A;  5GAG C;  2OQK A;  2A8V A;  1N32 Q;  5C0X G;  4KHP Q;  5C4J H;  1SFO H;  2D62 A;  4DR6 L;  1UE7 A;  3TS2 A;  1RL2 A;  3G71 A;  2JEB I;  2PI2 A;  1VQ4 A;  4JI6 Q;  2LXK A;  3I4M G;  2UXC Q;  1G29 1;  3PUY A;  3T1H Q;  4LF5 Q;  3K0X A;  1M1K C;  2FXQ A;  3A74 A;  4A3I G;  4NXM Q;  3GO5 A;  1KRS A;  3KDF B;  2R7F A;  1SE8 A;  4R4T A;  3S24 A;  3F2B A;  3CCU A;  4DR3 Q;  3K7A H;  3AEV A;  3HOW H;  4NXN L;  4MTN A;  4DV5 Q;  1Q8K A;  3EBE A;  4JBK A;  4DR5 Q;  1IBM L;  2OQ0 A;  3PIP A;  2UUB Q;  2NVQ H;  3L0O A;  2B63 G;  1FGU A;  1V43 A;  4QJF A;  3I4O A;  1K8G A;  5M5Y H;  1JB7 A;  3AFP A;  1KD1 C;  1VQG A;  3U58 A;  1QZG A;  1Z47 A;  4POG A;  2IY5 B;  1XNR Q;  1G6P A;  1S3O A;  2UUA L;  1BBU A;  1I5F A;  3CME A;  1RIP A;  2KCM A;  1IBL Q;  2HIV A;  4B3T Q;  5M3F G;  3PCO B;  4YWK A;  1CKN A;  1MIU A;  3CD6 A;  1D7Q A;  2UU9 Q;  2JA6 H;  2KHJ A;  2PQA A;  4LFC L;  3HKZ G;  2QEX A;  4JC0 A;  1QZH A;  2AHO B;  3BU2 A;  4HJA A;  2DGY A;  2MO1 A;  1YVC A;  3RN5 A;  2VUM G;  1SRO A;  4GOP C;  4RMF A;  1MJE A;  4YWM A;  1NJI C;  3KFU A;  1X56 A;  4MNO A;  4B3M Q;  4A3L G;  4BXX H;  3TRE A;  1TWF H;  3HKZ E;  5IYD H;  3F2C A;  4POF A;  1OXU A;  1YI2 A;  3K7U C;  4DR1 L;  1OXT A;  2VS1 A;  3PUZ A;  1KL9 A;  3FKI H;  4KI0 A;  1E22 A;  4X66 Q;  1HNW Q;  2D0P A;  5JEA J;  2VQE L;  2R7Z G;  3CCE A;  2VNU D;  1GO3 E;  1NMF A;  2VQF L;  1VQO A;  4JI4 L;  5AJ3 L;  4A3J G;  1YJ9 A;  1I94 L;  4R1J A;  1JMC A;  1NE3 A;  3UE0 A;  3GTP H;  4C2M H;  4UPA A;  3KF6 B;  4YHH Q;  1YIT A;  1PH7 A;  2KCT A;  3G48 A;  1VQL A;  5IYB G;  4DR7 Q;  1CKN B;  1Q81 C;  1IBK L;  2QGQ A;  2R93 G;  4B3S Q;  5IP9 G;  4GOP A;  1QVC A;  3MEF A;  3CMA A;  4X65 L;  1X65 A;  1JJ2 A;  1PVO A;  2YTV A;  4IO9 A;  1C7Y A;  1YNX A;  4L5S A;  3HOV H;  3I4M H;  4PZ7 A;  5DLQ E;  4APV A;  1I50 H;  4X62 L;  1I6H H;  4OWX B;  1VQI A;  4A3I H;  1PA6 A;  4IPD A;  4LFA L;  1XMQ L;  4Y52 H;  2XGT A;  4Y7N H;  1HR0 L;  4LWC A;  1WYD A;  1K8A C;  1E3P A;  4HIK A;  4IJL A;  3RZO H;  1SR3 A;  3J7Z C;  3STB C;  1W3S A;  1EWI A;  1VQ9 A;  1UEB A;  4JI2 Q;  3JAM i;  1CKO A;  1XTD A;  1N32 L;  2B63 H;  3NEL A;  4KHP L;  2Z6K C;  4A76 A;  3D31 A;  5GQO A;  3S14 H;  2NVT H;  1WOC A;  4JI6 L;  3HOZ H;  3E0E A;  4L5R C;  1L0W A;  3S1N H;  2UXC L;  2EQS A;  3T1H L;  2C35 B;  4A3M G;  1FL0 A;  4LF5 L;  3F8T A;  4P75 A;  4A93 G;  1HNW L;  2NVX H;  3PO2 H;  2K50 A;  2CWA A;  5M3F H;  4DR3 L;  1H95 A;  4DV5 L;  4HJ5 A;  4GN4 B;  4DR5 L;  2VL6 A;  3BJU A;  1XNQ Q;  2IT1 A;  3J80 i;  4KHZ A;  2AWN A;  5JEA G;  2UUB L;  2VUM H;  2N49 A;  1EQR A;  5LMN Q;  4UP9 A;  1X3G A;  5AJ3 Q;  1K0R A;  2EIF A;  4X6A H;  2JA8 G;  1QUQ A;  1YZ6 A;  2Z6K A;  4RG1 A;  5IP7 G;  2I0Q A;  4A3L H;  1XNR L;  2JQO A;  1BBW A;  1HZC A;  2ZTD A;  2IHE A;  3E9H A;  1L2F A;  3K81 C;  4UP7 A;  1IBL L;  4B3T L;  4LUV A;  4BXX G;  3CQZ H;  4AIM A;  2NZO A;  2UU9 L;  4AH6 A;  2NVY H;  3CC2 A;  4JBM A;  4A3J H;  1LM0 A;  4HIO A;  4HIM A;  2ZTC A;  5HY6 A;  4X62 Q;  3FKI G;  1A62 A;  3D0F A;  1CSP A;  1JT8 A;  1VQP A;  1A8V A;  2HIX A;  1XMO Q;  5IYB H;  1VCI A;  1VQN A;  3LGJ A;  2I5M X;  4NPS A;  4B3M L;  2UXB L;  2R93 H;  5BR8 Q;  3JC6 6;  1Q1E A;  3H15 A;  2WP8 J;  4LF4 L;  3OTO Q;  4BA1 I;  2PI2 E;  3OW2 A;  2WAQ E;  2XTI A;  2ZTE A;  4EQ5 A;  4ME3 A;  1L1O C;  1TWG H;  2CQO A;  1N34 Q;  4LF7 Q;  4YY3 Q;  4X66 L;  5M5W H;  2HQL A;  2MNA A;  3KJO A;  1ASY A;  2NN6 G;  3RN2 A;  1EFW A;  3K80 C;  3PF5 A;  1YIJ A;  3UDI A;  5M3M H;  3M4O H;  1CUK A;  4A3B G;  3E9I A;  1QUQ B;  1HNZ L;  3HOV G;  1HZ9 A;  2K5N A;  3F2D A;  5IWA Q;  3EN2 A;  4J15 A;  1JJC B;  4YHH L;  3BZC A;  4KLK A;  2BA0 A;  2DUD A;  2IHF A;  2CKZ B;  4OWT B;  3G6E A;  1GVP A;  1Q82 C;  4DR7 L;  4R4Q A;  2JEA I;  2JA5 G;  3GTM H;  3OYY A;  1W2B A;  3RLF A;  4GNX C;  3RNU A;  1PH5 A;  4B3S L;  3KYH C;  2I5H A;  3J81 j;  4BA2 I;  3GTO H;  1U5K A;  5GRO A;  4MZ9 A;  4A3M H;  2K5V A;  2K5H A;  4HJ8 A;  1XPO A;  4IFD I;  4QQB X;  4A93 H;  3HOZ G;  3CXC A;  1L1O A;  2F3I A;  5ELO A;  4OWW B;  2KEN A;  3M4Q A;  2ZJQ A;  3KJP A;  4JI2 L;  1GM5 A;  1SRU A;  1KRT A;  3GTL H;  5C44 G;  2AMC B;  3J81 c;  1UE5 A;  4JCV E;  4LF8 Q;  4DV0 L;  1X9N A;  3NEM A;  1PFS A;  4GKJ Q;  1WFQ A;  3AQQ A;  3GTJ H;  3I56 A;  5IP7 H;  4GNX A;  2JA8 H;  1P8L A;  1PH2 A;  4GS3 A;  4YCW A;  1OXS C;  3U50 C;  2ZM6 Q;  1VQH A;  2CWP A;  4JI3 Q;  2UXB Q;  1NBW A;  4LF4 Q;  3ULP A;  5K36 G;  1K9M C;  3UDF A;  4JI0 Q;  1XNQ L;  3PUX A;  1LTL A;  4LUZ A;  1N33 Q;  3S2H H;  4IOA A;  3CCR A;  3CAM A;  4DV2 Q;  4DR4 Q;  4JI5 L;  4L5Q A;  4YCU A;  5LMN L;  2B3G A;  3I2Z A;  1FJG L;  5GAH C;  2KHI A;  4QY7 A;  4R4O A;  4L5T A;  5C0X I;  1HNZ Q;  3H3V I;  4IPC A;  4IPH A;  3I55 A;  4LFB L;  1TWH H;  3RR5 A;  3DM3 A;  3L2P A;  1PYB A;  1NTG A;  1Q86 C;  2PMZ E;  4GLV B;  2PQA B;  3K8A A;  1VQM A;  1XPU A;  4A3E G;  1KC8 C;  4DV3 Q;  1EYG A;  4A3B H;  4K0K Q;  1OXX K;  3EIV A;  1VQC A;  1YHB A;  2L15 A;  4GNX B;  1E24 A;  2Q2I A;  3HOY G;  2BH8 A;  2HHH L;  1QVF A;  4GKK Q;  1WI5 A;  4DV4 Q;  3FHW A;  4IFD J;  5M3M G;  1XMO L;  1PV4 A;  2F4V Q;  1E1O A;  1A63 A;  1X55 A;  2EXD A;  3PGZ A;  4HID A;  2JA5 H;  1N8R C;  5IT9 c;  2OTJ A;  5BR8 L;  2R7D A;  1R9T H;  3CC7 A;  3OTO L;  3I7F A;  3AFQ A;  4DAY B;  1Q46 A;  5C3E H;  3TS0 A;  4YY3 L;  1N34 L;  4LF7 L;  5IE8 A;  2D0O A;  4DV0 Q;  4HJ7 A;  3A5Z B;  1IL2 A;  4OO1 G;  3HOY H;  1SN8 A;  1LYL A;  2VW9 A;  1VS0 A;  4BBR G;  3RZD H;  1Y1W H;  2I5L X;  2CFM A;  5IWA L;  1SLJ A;  1SMX A;  4A3K G;  2ATW A;  2E2J H;  3ULJ A;  2N3S A;  4O2D A;  3PIO A;  1ASZ A;  4GOP B;  5IYC G;  1S40 A;  3T1Y Q;  2E2I H;  2HT1 A;  5C44 H;  2BA1 A;  1T9H A;  1E7Z A;  1YHQ A;  4UP8 A;  1C0A A;  4TVA B;  2R92 H;  3STB D;  4JBJ A;  2ASB A;  4WJ4 A;  4IPG A;  4JI5 Q;  2AWO A;  1TWA H;  1VQ5 A;  4BY7 G;  1FJG Q;  3CPF A;  3PO2 G;  3S15 H;  2LXJ A;  4DK6 C;  4ALP A;  2K4K A;  3AYH B;  3NBH B;  4BY1 G;  4LFB Q;  1KIX A;  1LUZ A;  2E8G A;  4DNI A;  3M9B A;  4A3C H;  4OXP A;  5C4X G;  3PF4 A;  2WB1 G;  1GD7 A;  4LF8 L;  2WAQ G;  2E5L Q;  3A0J A;  4IOC A;  4A3F H;  4GKJ L;  2HHH Q;  4IFD G;  4OON A;  1D8L A;  2GN5 A;  3CCM A;  4UY8 C;  1GKH A;  2IX1 A;  4PZ8 A;  2R6G A;  2ZM6 L;  3UDG A;  1IZ6 A;  3I4N H;  3PUW A;  1PHJ A;  2F52 A;  2WB1 E;  2YTY A;  1Q1B A;  2Y0S G;  3KOJ A;  2GVB A;  2B29 A;  4JI3 L;  4A3E H;  2Z0S A;  1PH8 A;  4JBW A;  3W1G A;  4JI0 L;  4JI7 L;  1X54 A;  1N33 L;  2UXD Q;  3A5U A;  3J81 i;  3TQY A;  3CCV A;  3S17 H;  3JAM c;  4DV2 L;  3GD7 A;  3KDF A;  4DR4 L;  3PUV A;  3W5O A;  4GN5 A;  4AYB E;  4DV1 Q;  1AE2 A;  3H0G G;  1IYJ B;  1B7Y B;  1CSQ A;  1VQA A;  1BKB A;  3CC4 A;  3CW2 C;  1J5E Q;  2K52 A;  2Y0S E;  1PH1 A;  2LSS A;  4DKA C;  5FLX c;  3GDE A;  1S72 A;  1PH6 A;  4OX9 Q;  1OTC A;  1G51 A;  1K83 H;  5E7N A;  3HOX G;  4DUY L;  4DV3 L;  3GTG H;  1HNX Q;  3M4P A;  4K0K L;  1HZA A;  1VQ6 A;  4BBR H;  1NMG A;  4P71 A;  2WFW A;  2YV5 A;  5C3E G;  4A3K H;  4O0A A;  3J80 c;  4WJ3 M;  1N36 Q;  4GKK L;  3CCJ A;  4DV4 L;  1HR0 W;  3UE1 A;  5M5X H;  1P16 A;  4R4I A;  4R4C A;  4JI8 Q;  1Y1W G;  2BH2 A;  2F4V L;  5IYC H;  3IRB A;  3HFZ B;  2JA7 G;  2JE6 I;  4JV5 Q;  4LNQ A;  1YHA A;  1Y14 B;  2PNH A;  3ZJY C;  2N8N A;  5FJ8 G;  3F1Z A;  1PH4 A;  4DV7 Q;  4C3I H;  4HJ9 A;  3S1Q H;  2ES2 A;  3CP0 A;  5GAD C;  4BY7 H;  3PV0 A;  4H02 A;  1V9P A;  2R92 G;  1KQS A;  4AQY Q;  3DLL A;  4BY1 H;  3TRZ A;  4DUZ Q;  2MO0 A;  1VQ7 A;  1VQE A;  4P74 A;  2RHQ B;  2E2H H;  3ERS X;  1EUJ A;  1B8A A;  5C4X H;  4A3G G;  3M7N A;  1KHI A; 
#chains in the Genus database with same CATH topology
 3CPW A;  3GTJ B;  2JA8 B;  4BBS G;  1TS2 A;  1CI3 M;  2AKW B;  4TKO B;  2YU9 H;  2JA9 A;  2EYL A;  1EY9 A;  4XYO A;  1HXY D;  4JG2 A;  5HGQ A;  1BQQ T;  1NY4 A;  5HUR A;  3SXH A;  2CH4 W;  2PZU A;  3PSI A;  1K73 C;  1HQR D;  4LF6 Q;  1B70 B;  1WCM H;  3AMU A;  1PRT C;  1CKM A;  4B9X A;  5I6Y A;  4C2M B;  1TWH B;  3Q8D A;  4DUY Q;  3PO3 H;  3H0G H;  4LW1 A;  1EOV A;  1SJE D;  1Y1V G;  4KKU A;  2V1C C;  1JQY D;  2RCN A;  1HFG A;  1I4R A;  2A19 A;  4H13 C;  4PNY A;  5C6A A;  2FMM A;  3G7L A;  3WWV A;  5FLM H;  2MFI A;  5FO8 B;  4NB3 A;  1N9W A;  4C3H H;  1IBM Q;  5E4X A;  1FVI A;  3KF8 B;  1GHJ A;  3S14 B;  3W1B A;  1XJV A;  1WJJ A;  1KXL A;  2EOT A;  4JOI A;  1I3Q H;  3S1N B;  1XPR A;  1H9R A;  1Q3L A;  1Z9F A;  2Z9H A;  1DOM A;  3P20 A;  5DM7 3;  1HNX L;  2UUA Q;  3SK6 A;  4ZLT F;  3HOW G;  1OXV A;  1PTO D;  2N78 A;  4EX5 A;  3ER0 A;  3GTK H;  4QIW E;  1WTW A;  4UDU C;  3VDY A;  3JAM E;  5CV7 A;  4DAM A;  1WTX A;  4K5W A;  1YJW A;  2ALY B;  2BCO A;  4LMQ D;  4NXM L;  4KD4 A;  4P72 A;  5JJL A;  4AQY L;  2F0T A;  4DUZ L;  1Q12 A;  4AYB G;  1YEZ A;  5GAE C;  2VQF Q;  5JJK A;  4QGU A;  1VQK A;  3DUZ A;  1RHP A;  4JI1 L;  4X64 L;  4LF9 L;  2EY6 A;  1WCM G;  2F0F A;  5ELN A;  2R93 B;  2M2L A;  3PO3 G;  3QOL A;  4A3E B;  3E3X A;  4X65 Q;  1UAP A;  1EIY B;  4JYA L;  2RSN A;  1KAW A;  3LNN A;  4NMZ A;  3NE5 B;  2LKV A;  1B9N A;  2A6H C;  4CKB A;  1UUP A;  2KVM A;  3VR3 A;  4FF1 A;  4DR2 L;  1NR2 A;  1STY A;  2NZH A;  5A2Q E;  1HR0 Q;  1DON A;  3L7Z C;  1J6Q A;  1PYS B;  4DV6 Q;  5FLM G;  1CA5 A;  1HFN A;  3ITP A;  3VYS A;  5GAG C;  5C0X G;  1SFO H;  1UE7 A;  3G71 A;  3TME A;  1Y8O B;  1EZ6 A;  3MXG A;  5IOC A;  2UXC Q;  1B53 A;  3PUY A;  3OMC A;  2Z6B A;  1M1K C;  2G9H D;  5K5P A;  1KRS A;  3S24 A;  3Q6S A;  3P7J A;  2AUK A;  2PYK A;  4DR3 Q;  4MTN A;  1KDB A;  4RAU C;  2OQ0 A;  3GTL B;  2XRQ D;  1PLF A;  2Z4H A;  3MTS A;  4F7X A;  1KD1 C;  1I4H A;  1Z47 A;  5DAU A;  1TKW B;  1XNR Q;  4RKB A;  2KCM A;  1A6X A;  4RCN A;  4YWK A;  1DXM A;  1GXD C;  5M3F G;  2UU9 Q;  2IX3 A;  4LFC L;  2EY5 A;  3BU2 A;  4HJA A;  1YVC A;  3RN5 A;  4GOP C;  4O1N A;  2NTT A;  3MVV A;  4YWM A;  1EY4 A;  3WOF A;  3HZX A;  1SDF A;  4BXX H;  2I07 B;  3DWA A;  3Q23 A;  3HKZ E;  1ZXT A;  5IYD H;  1SMY C;  2OT2 A;  5EPK A;  3PUZ A;  1E22 A;  1XWE A;  2D0P A;  4A3B B;  3NP8 A;  1LTT D;  1YJ9 A;  1I94 L;  3GTP H;  1NE3 A;  2K03 A;  3KF6 B;  1A3U A;  4F8M A;  5JPM C;  1VQL A;  4RGM A;  4K5X A;  4DR7 Q;  1Q81 C;  2R93 G;  3IKJ A;  3OMG A;  1VF7 A;  3I4M H;  2RVL A;  1F2Z A;  2AUJ D;  3HGB A;  4APV A;  1I50 H;  3MHB A;  1K8M A;  2XNA C;  4OWX B;  2MHV A;  4IPD A;  4LFA L;  4Y52 H;  3RZO H;  1WYD A;  4HIK A;  2KOL A;  2F0K A;  1VQ9 A;  1RTN A;  1UEB A;  3JAM i;  1EEI D;  1Z7T A;  1ENC A;  1XTD A;  1N32 L;  4A76 A;  3D31 A;  5ELE A;  1FR3 A;  2NVT H;  1WTH A;  2BDO A;  1WOC A;  5CC4 A;  4JI6 L;  3HOZ H;  1D2B A;  3E0E A;  3KLR A;  3T1H L;  1FL0 A;  4HED A;  4P75 A;  4U68 A;  2K50 A;  4RA8 A;  3HEJ A;  4HJ5 A;  1PRT B;  4GN4 B;  1EY6 A;  2B2T A;  2IT1 A;  3UI2 A;  5JEA G;  5LMN Q;  4UP9 A;  3DEP A;  4LK1 C;  1SYE A;  5DNF A;  2EIF A;  4QF4 A;  2I0Q A;  2NYZ D;  4QB4 A;  1NNX A;  5K36 H;  1F9Q A;  2KCC A;  2IWH A;  1LT5 D;  2O4X A;  2K01 A;  1L2F A;  3K81 C;  4UP7 A;  1IBL L;  4BXX G;  5IGB A;  5JVH 3;  1SE2 A;  2NVY H;  3A8J E;  4HIM A;  3OOC A;  4X3S A;  1WVL A;  2K5Q A;  2EPB A;  5IYB H;  1VCI A;  2PW5 A;  3LGJ A;  3JC6 6;  1I4P A;  3H15 A;  4LF4 L;  3GP7 A;  3H91 A;  2B2V C;  2ZTE A;  1JIC A;  1LAB A;  4BS9 A;  1K8O A;  2CQO A;  3D6W A;  3HOY H;  4X66 L;  5M5W H;  2HQL A;  2MNA A;  3KJO A;  4A3B G;  5M3M H;  4BBR B;  5KNB A;  2K5N A;  3F2D A;  4J15 A;  5C4J B;  4FXD A;  2HCI A;  1GVP A;  1Q82 C;  5CV9 A;  3OYY A;  4B3S L;  4ME5 A;  1MSG A;  2A68 D;  2HUG A;  4IZ8 A;  3K5L A;  3S1Q B;  2DN8 A;  4PMC A;  5G3L F;  2K5H A;  3MA2 B;  3AB9 A;  1MHW C;  3HOZ G;  5CBE E;  3M4Q A;  4OEM B;  4ODG A;  5IGG A;  2XN9 C;  2A6E C;  5I9P A;  2A5H A;  3J81 c;  1EU4 A;  3NEM A;  1PFS A;  3SK4 A;  4KN7 C;  4L8J A;  4A3D B;  1CZG A;  1PH2 A;  3E0J A;  4GS3 A;  4YCW A;  1OXS C;  3U50 C;  2ZM6 Q;  1G6Z A;  1J9O A;  1FYC A;  4NKL A;  4JI3 Q;  2EJM A;  3ULP A;  5K36 G;  2B8G A;  4JI0 Q;  1N33 Q;  2JSO A;  3CAM A;  3T51 B;  4DR4 Q;  1EEF D;  4CJ0 B;  2B3G A;  5D14 A;  1FJG L;  1TWF B;  4L5T A;  5C0X I;  4NW2 A;  3I55 A;  3RR5 A;  3MC0 B;  1SNC A;  3TP8 A;  2PQA B;  1STG A;  2XWJ B;  1SND A;  3TP6 A;  2NB0 A;  1H9J A;  2RQX A;  4K0K Q;  3EIV A;  1K0S A;  1ILQ A;  4GNX B;  3HOY G;  1KAA A;  1V1P B;  1WI5 A;  4IFD J;  5D3I B;  5M3M G;  1F2L A;  3PGZ A;  4JVZ A;  3DWP A;  1ET6 A;  3CC7 A;  3I7F A;  4A3I B;  4IUU A;  1ZYR C;  1PTO C;  1Q46 A;  1N34 L;  3TS0 A;  4DV0 Q;  1MI2 A;  4BBR G;  2QDL A;  5IWA L;  1SLJ A;  1Y8N B;  3VA5 A;  3PIO A;  1ASZ A;  4HSV A;  5EQ0 A;  1BCP F;  4GOP B;  2PQE A;  1S40 A;  5C44 H;  4FVM A;  2B8F A;  2X69 A;  1YHQ A;  2A74 C;  5EPL A;  4WJ4 A;  2JN4 A;  4JI5 Q;  2QKI C;  5C3X A;  3D4D A;  4BY1 G;  4CKE A;  1KAB A;  2E8G A;  4DNI A;  2F1M A;  4X3U A;  1D6E C;  4A3C H;  3NWS A;  2EZV A;  2F0V A;  3NPP A;  2KJX A;  4LJZ C;  1QCB D;  1STN A;  4N8X 1;  4A3F H;  2HHH Q;  3ZYY X;  4OON A;  2GN5 A;  3R3O A;  2R7Z B;  4PZ8 A;  2F0E A;  2F52 A;  3KOJ A;  1Q1B A;  1EYC A;  2B2W C;  2UXB L;  3Q24 A;  5COY A;  1G2T A;  1M8A A;  4CHT B;  4G57 A;  3P1H A;  1GUG A;  3TQY A;  3JAM c;  3PUV A;  2EY2 A;  1AE2 A;  2RDG A;  1CSQ A;  1LTR D;  1VQA A;  2P5Z X;  2DJF C;  3TSS A;  4JPB W;  1PH1 A;  2LSS A;  4DKA C;  4QIW B;  5ELF A;  3VR4 A;  5IGC A;  3GTG H;  1HNX Q;  3M4P A;  1J8I A;  1CFM A;  2WFW A;  2YV5 A;  1PYW D;  4A3K H;  4WJ3 M;  3DHQ A;  4GKK L;  1D5X C;  3UE1 A;  2G5D A;  5IYC H;  4DK0 A;  1WD0 A;  1LLR D;  1Y14 B;  4A3M B;  1PH4 A;  2QF7 A;  4ZKB B;  2CHB D;  5GAD C;  2WIN B;  1EWC A;  4HMI A;  4H02 A;  1IKL A;  4AQY Q;  4QUF A;  2PCF B;  4DUZ Q;  1VQ7 A;  1S5F D;  5KYI A;  1DM0 B;  2N55 A;  2QCP X;  1VMC A;  1KHI A;  2WKD A;  1AZQ A;  4A3C G;  4JI1 Q;  4X64 Q;  4LF9 Q;  5H1S E;  4JI7 Q;  2DNC A;  3KF6 A;  1C9O A;  2B2Y C;  1TY0 A;  4IFD H;  1HPC A;  1VQF A;  5IT9 E;  4DNT B;  4JYA Q;  2EYF A;  3BVZ A;  4A3F G;  5KRU A;  3FKI B;  4ZK9 B;  2IX0 A;  3K5M A;  4DR2 Q;  3U9O A;  1LTG D;  1BNZ A;  1DJR D;  4KV6 A;  1VQ8 A;  1B1Z A;  5KYL A;  3SDZ A;  2JK8 A;  3TEH B;  5T1G A;  2VZA A;  3HOV B;  4EGV A;  5I2X A;  1EIF A;  3HOU G;  3S2D H;  5COR A;  1B50 A;  3RLN A;  2UXD L;  5IY0 A;  1JJG A;  1UWV A;  1BXT A;  3B6Y A;  3S1M H;  2JA7 H;  2MQH A;  1TXY A;  2RF4 A;  5FJ8 H;  5EGT A;  3KBX A;  2K75 A;  2MJ8 A;  1YNN C;  1VMP A;  1SE3 A;  3KLW A;  1GUW A;  2NVX B;  1Q7Y C;  2WII B;  4CKC A;  4N8F A;  4C3J H;  1N36 L;  3HKZ B;  5C0X J;  4LFC Q;  3TN2 A;  1D5M C;  1HH2 P;  3I73 A;  4YCV A;  4BBS H;  4JV5 L;  4RWS C;  3S1R H;  1U9R A;  1AE3 A;  2R61 A;  5A35 A;  2WAC A;  2KED A;  4TRD A;  4DPG A;  3ICE A;  5EAY A;  3CF5 A;  2XRS D;  1PH9 A;  4OIJ A;  3EA6 A;  1Q90 A;  5JOB A;  1VQB A;  1CHQ D;  1TWC H;  1I94 Q;  1GJX A;  5BN3 A;  4N9P A;  3M85 A;  1VQD A;  3QIA A;  3KLS A;  2RDH A;  1Y1V H;  3BDL A;  5LMU L;  5AFW A;  3J7A V;  4PMW A;  3M3Y H;  1EY0 A;  4IN3 A;  4CDF C;  1PTO B;  1B9M A;  3DM1 A;  4Q0F A;  1BOS A;  1TWG B;  2F0O A;  3MXN B;  4K8J A;  1SNO A;  4A4I A;  1YBY A;  2MGS A;  4LFA Q;  5FO9 B;  3GQB A;  1RDP D;  2KCN A;  4FF2 A;  2A68 C;  3CU7 A;  3O13 A;  4XTC S;  4K2L A;  2KA7 A;  2HQE A;  1N32 Q;  1K83 B;  4DAP A;  1RF2 D;  1D5Z C;  1OO9 B;  3E6Z X;  4JI6 Q;  1O78 A;  3T1H Q;  4OGQ C;  3K0X A;  1B4O A;  2FXQ A;  1R4P B;  3A74 A;  1ESF A;  1PMR A;  4A93 B;  2HDM A;  3CCU A;  3HOW H;  1QE6 A;  3AEV A;  1TY2 A;  5F2D A;  3D4W A;  3L3O C;  2Z8L A;  5FO7 B;  3SK5 A;  1UEA B;  3L0O A;  4BY7 B;  1LT3 D;  5M5Y H;  3CHB D;  4ZCK A;  1QZG A;  3H6M A;  4HAE A;  1I6V C;  1DCZ A;  4G7Z C;  2NZ1 D;  4FXG C;  3OIQ A;  3N52 A;  4J6H A;  1HHV A;  5DM6 3;  3CME A;  3PO2 G;  1IBL Q;  1O80 A;  2HIV A;  3PCO B;  4HCS A;  1MIU A;  2PQA A;  2XWB B;  2YU9 B;  3HKZ G;  4JC0 A;  2D9U A;  2J7Z A;  3KUP A;  1V1P A;  4PQX A;  1NJI C;  2EJG C;  5EKK A;  1X56 A;  4XQQ A;  1BCP D;  4MNO A;  4A3L G;  1T5E A;  3FPP A;  4POF A;  1CZW A;  4X66 Q;  5JEA J;  3CCE A;  5J22 A;  1K28 A;  5AJ3 L;  4A3J G;  1S5C D;  4IUN A;  5C4Z A;  4C2M H;  4KJN A;  3KBG A;  1YIT A;  3PIO 3;  4RFB A;  3G48 A;  2QW7 A;  3PMF A;  1CKN B;  1IBK L;  5C0X H;  4B3S Q;  4GOP A;  3MEF A;  3CMA A;  3Q22 A;  1CQV A;  3BDC A;  2NN6 H;  1JJ2 A;  2YTV A;  2VB2 X;  1C7Y A;  5C3E B;  2Q8R E;  5DLQ E;  2PZW A;  5EKL A;  1HCZ A;  1Z6H A;  1XMQ L;  4Y7N H;  2BE5 D;  4LWC A;  1E3P A;  1EWI A;  2E2I B;  1CKO A;  2B2U C;  3NEL A;  2IPK D;  4KHP L;  5GQO A;  3S14 H;  1EY5 A;  4PV1 C;  3J81 L;  1K3B C;  1L0W A;  3S1N H;  1TWA B;  4LF5 L;  1VF5 C;  3GTK B;  2TMP A;  4A93 G;  1NCV A;  5CV4 A;  2CWA A;  5M3F H;  1AP0 A;  3ND8 A;  4DV5 L;  3SE0 A;  3BJU A;  4KHZ A;  4KY7 A;  2C5C A;  3MFY A;  4WOR A;  1BUV T;  2SDF A;  2DY8 A;  4X6A H;  3C46 A;  2JA8 G;  1YZ6 A;  1BBW A;  3I4N B;  1CK1 A;  2K5D A;  1PRT F;  2NZO A;  3TP5 A;  4AH6 A;  1LM0 A;  4X62 Q;  1PZK D;  2H4O A;  4QMG A;  1VQP A;  2R93 H;  2I5M X;  4NPS A;  1F9S A;  5ELD A;  3OW2 A;  1PDQ A;  2WAQ E;  2XTI A;  4ME3 A;  1L1O C;  4QUC A;  3TZU A;  1N34 Q;  2RSO A;  2NN6 G;  1EFW A;  3K80 C;  1YIJ A;  1QWY A;  1CUK A;  3E9I A;  1QUQ B;  3PIP 3;  1II3 A;  4O42 A;  5IWA Q;  5KGU A;  1JJC B;  1SYD A;  3I70 A;  5I6W A;  5M5X B;  4OWT B;  4XDX A;  3NBI A;  4GNX C;  3OIP A;  1BF4 A;  3H3V C;  4C3I B;  1U5K A;  5GRO A;  3RMH A;  4MZ9 A;  2B39 A;  1SAP A;  4IUR A;  1V8Q A;  4HJ8 A;  2A69 C;  4IFD I;  2B2V A;  2RDF A;  4NDX A;  2E2H B;  4JI2 L;  3BZD B;  3GTL H;  2PNR C;  3GTQ B;  1GOZ A;  5JEA H;  3RD4 A;  2AMC B;  1UE5 A;  2WV6 D;  5E3F A;  3T13 A;  1X9N A;  1ICW A;  1WFQ A;  1Y69 U;  2LFN A;  4I65 A;  5KIX A;  2CWP A;  5C4H A;  2UXB Q;  1A15 A;  1K9M C;  3QR8 A;  4FO2 A;  1H9S A;  2HCC A;  3BYY B;  4YCU A;  1G2S A;  4KD3 A;  3JAM L;  1HNZ Q;  4IPH A;  1HA5 A;  5FOB B;  4FXK C;  4LFB L;  1FNU A;  1NTG A;  1Q86 C;  2PMZ E;  1QB5 D;  4L63 B;  3HOX B;  3EVQ A;  2NTS A;  1VQM A;  4A3E G;  4A3B H;  4IUT A;  1OXX K;  1HUN A;  1C48 A;  4E6I A;  2L15 A;  3SHL A;  4H0L C;  4RGO S;  1QVF A;  4GKK Q;  1XMO L;  1PV4 A;  3V2T A;  1A63 A;  1X55 A;  1U4L A;  3NBH A;  5IT9 c;  1N8R C;  2OTJ A;  5BR8 L;  1I50 B;  2E74 C;  1M4V A;  3AFQ A;  3MZ5 A;  3GV6 A;  1BDO A;  4YY3 L;  2D0O A;  3A5Z B;  4ZUI A;  1SN8 A;  2EYM A;  1F9P A;  4IQZ A;  1LYL A;  2VW9 A;  1ET9 A;  1VS0 A;  2L0C A;  1BO0 A;  1SMX A;  1SEB D;  5A2Q L;  2N3S A;  4A3G B;  4O2D A;  2L9H A;  2K33 A;  5CR3 A;  5D65 A;  1XYI A;  2BA1 A;  2PO4 A;  1T9H A;  1C0A A;  3STB D;  4JBJ A;  2ASB A;  4IPG A;  4DU9 A;  1VQ5 A;  2LXJ A;  4IAL A;  3V96 A;  4DK6 C;  1LUZ A;  2IW3 A;  1A2U A;  3MXN A;  1E0B A;  1CQF A;  2VB3 X;  3DMU A;  4KY5 A;  1GD7 A;  2M00 A;  1IKM A;  1IYV A;  4MTK A;  1IW7 D;  2NBF A;  3S16 B;  1Y8P B;  3CCM A;  1D8L A;  4UY8 C;  3C1E A;  2R6G A;  2J4X A;  4FNF A;  3T16 A;  2YTY A;  2WB1 E;  4KY6 A;  2B29 A;  1KLG D;  4JK1 C;  4JBW A;  4R8N A;  3NHH A;  2UXD Q;  3QJY A;  4DV2 L;  3GD7 A;  4AYB E;  2ENB A;  4XYQ A;  2I46 A;  3T56 B;  2EY1 A;  4R8I A;  1NUC A;  2L5T A;  1YNJ D;  5M5W B;  5EKI A;  4K8I A;  1FNV A;  3GDE A;  5CMD A;  1OTC A;  1PFN A;  1G51 A;  3HOX G;  4DUY L;  1JOO A;  2EE1 A;  2F0S A;  1HZA A;  3FEW X;  4BBR H;  1NMG A;  3K7A B;  2B2W A;  3DWQ A;  4O0A A;  1N36 Q;  3ERO A;  3CCJ A;  4OEL B;  1HR0 W;  4R4I A;  2SNS A;  4R4C A;  2K05 A;  3IRB A;  4JV5 Q;  2NVQ B;  2PNH A;  1B3A A;  1EIG A;  1EOT A;  5CV5 A;  3BDO A;  3S1Q H;  1STA A;  1G91 A;  3TBI B;  4UAI A;  4CGY B;  3LX0 A;  1KQS A;  1WTP A;  4BY1 H;  3TRZ A;  5BN4 A;  2JA6 B;  1CM9 A;  1EUJ A;  4A3G G;  1JR0 D;  2CW0 D;  3T1Y L;  2ICI A;  2CQA A;  2V4D A;  1BR9 A;  1QOH A;  5LMU Q;  2ZJP A;  2KUM A;  4A3D H;  1L1O B;  1QIL A;  3VYT A;  1GUT A;  1JWS D;  2NN6 I;  5FKA C;  1U0L A;  1KNE A;  2Z1C A;  1STB A;  2KEE A;  2F03 A;  3KF8 A;  3FPU B;  2LS0 1;  5IGD A;  1NSN S;  4EQN A;  4KKS A;  2ZT9 C;  3FP9 A;  3H94 A;  3G4S A;  2NWG A;  3CKI B;  2DJG C;  5CV8 A;  5JJZ A;  4ABN A;  2YYZ A;  1A3V A;  3EQL C;  1SNM A;  2A1A A;  2B2Y A;  4XIG S;  1YJN A;  2BE5 C;  3PQI A;  1I6H B;  1M90 C;  3HKS A;  1ZKO A;  5CV6 A;  2VY3 A;  4EQP A;  4V19 0;  3H3V H;  1GUO A;  3Q0A A;  3WOE A;  1VQJ A;  4DV1 L;  2FMC A;  1J5E L;  2B63 B;  2K5W A;  1WTO A;  1O7I A;  3U4Z A;  2EYJ A;  2YTX A;  1TU2 B;  1LV9 A;  2RHS B;  5TSS A;  4PZ6 A;  3VR2 A;  3R2T A;  1JCK B;  4HCE A;  2FHT A;  4C1N I;  4DV6 L;  3NQT A;  4HSP A;  3WDN A;  4FP5 D;  4P73 A;  4YIJ A;  5EPJ A;  3NEN A;  4JI8 L;  3K5O A;  3UDX A;  2VUM B;  4FF3 A;  5E1F A;  2FJ2 A;  2C9O A;  1ONL A;  2JJQ A;  5L37 A;  4GN3 B;  5FLX E;  2VXW A;  4A3D G;  2JA6 G;  1NR4 A;  2Q2U A;  5J3B A;  3HS0 C;  3J80 E;  2QA4 A;  1IHZ A;  1TQO A;  2K14 A;  2EVB A;  3OWF A;  5LMN W;  3CCQ A;  5JAV A;  4B3R L;  1IBK Q;  3HP3 A;  3M7G A;  2SEB D;  2R7Z H;  1BVS A;  4GLA C;  2GVA A;  3HOU H;  3S17 B;  4DK3 C;  3M4O B;  1MJC A;  3CCS A;  1XMQ Q;  4OIK A;  1G8Z D;  4LUO A;  2E75 C;  3BYT B;  4X3K A;  2UUC L;  1JE5 A;  1AW7 A;  1E1T A;  1X3F A;  3GTM B;  3DEO A;  4KHP Q;  1PTO F;  2D62 A;  4DR6 L;  1RL2 A;  3GTO B;  2PI2 A;  4M8A A;  1VQ4 A;  4LF5 Q;  1X3P A;  3NSW A;  4F87 A;  4A3I G;  4NXM Q;  4FYD A;  1SE8 A;  3F2B A;  1TS4 A;  3U9S A;  1PFM A;  4NXN L;  5I4D A;  5LL6 X;  4DV5 Q;  3EBE A;  5D3D A;  3TDQ A;  4JBK A;  3QWN A;  1AN8 A;  1S4Z A;  3PIP A;  2B63 G;  1MSH A;  2PZT A;  1V43 A;  3I4O A;  5KND A;  1GHK A;  3AFP A;  3U58 A;  4HR7 B;  4POG A;  2IY5 B;  1G6P A;  1KTK A;  4ID6 A;  1I5F A;  3RUZ A;  1D7Q A;  3CD6 A;  4HN7 A;  5CGK A;  2KHJ A;  2WAQ B;  1QZH A;  2AHO B;  3S2H B;  1DYQ A;  4RHS A;  3M4Y A;  2DGY A;  2VUM G;  2SOB A;  1SYC A;  2N88 A;  3KFU A;  3VR5 A;  4EQO A;  3K7U C;  4DR1 L;  3L9A X;  1OXT A;  2VS1 A;  1KL9 A;  3A7A B;  3FKI H;  4CDC C;  3K5N A;  2VQE L;  2R7Z G;  1GO3 E;  4JI4 L;  3NXW A;  1IL8 A;  3UE0 A;  2KCT A;  3NWT A;  4U67 3;  2JA5 B;  2QGQ A;  1R9T B;  1EIH A;  1QVC A;  1X65 A;  1PVO A;  2Q8T A;  4IO9 A;  3HOV H;  1S5B D;  2G9D A;  1EQT A;  2L55 A;  3DXJ C;  1PA6 A;  2LMC B;  4MHE A;  4XQN A;  1Y1W B;  3RZD B;  2XGT A;  1Q8I A;  2K6A A;  2RKS A;  4V0B A;  2E2J B;  3STB C;  1S5D D;  3NTH A;  4JI2 Q;  3K58 A;  2Z6K C;  2R92 B;  5ELC A;  4ZAI A;  4C3J B;  1ESR A;  3ERQ A;  4A3M G;  3S15 B;  2NVX H;  3PO2 H;  1ZEQ X;  3A55 A;  4BBS B;  2PMZ B;  5E4W C;  1IW7 C;  2VL6 A;  5KNC A;  4WRD A;  3J80 i;  4DR5 L;  3NTK A;  2UUB L;  3C3L A;  4OHJ A;  2N49 A;  1EQR A;  5G3L D;  1O7Z A;  3IFD A;  4LAA A;  2B2U A;  3HG9 A;  5LHY 1;  4A3L H;  5IP7 G;  1JWM D;  1ENF A;  2D2C C;  4B3T L;  3CQZ H;  4AIM A;  3CC2 A;  4JBM A;  4A3J H;  1DOK A;  4CJ2 C;  4HIO A;  3FKI G;  1A62 A;  3D0F A;  1CSP A;  1JT8 A;  1A8V A;  2HIX A;  1XMO Q;  4WFN 3;  3BS1 A;  4B3M L;  5BR8 Q;  4C1N K;  1Q1E A;  2WP8 J;  1MGS A;  1PTO H;  2OXP A;  5IT9 L;  4EQ5 A;  1TWG H;  4YY3 Q;  1HNW L;  4IUP A;  4DAV A;  3RN2 A;  2QIL A;  3UDI A;  2KEC A;  3HOV G;  2K28 A;  4P2C B;  4YHH L;  3BZC A;  4KLK A;  2BA0 A;  2DUD A;  2IHF A;  3G6E A;  2SNM A;  2IJ0 A;  4R4Q A;  2JA5 G;  3RNU A;  3KYH C;  2I5H A;  4OO1 H;  3J81 j;  1I4G A;  3HOW B;  2K5V A;  1CHP D;  2ZXR A;  1XPO A;  4QQB X;  4A93 H;  3URY A;  1L1O A;  5ELO A;  4OWW B;  2KEN A;  2ZJQ A;  5C4X B;  3SEB A;  1EWH A;  2F0H A;  3KJP A;  1GM5 A;  1SRU A;  1KRT A;  2WB1 B;  4DN4 M;  5J39 A;  4DV0 L;  2TSS A;  4PMB A;  3GTJ H;  2JA8 H;  3I56 A;  4GNX A;  1WTV A;  1P8L A;  1SNQ A;  4AYB B;  2CH4 A;  3IL8 A;  3I4L A;  3IAY A;  1SYF A;  4LF4 Q;  1ROD A;  1F2Y A;  1WCM B;  3N6R A;  4CDE C;  4DXF A;  2OEO A;  1XNQ L;  1LTL A;  2HDL A;  3CCR A;  1BBX C;  3I72 A;  4DV2 Q;  2A6E D;  4L5Q A;  4JI5 L;  1PXU A;  3PO3 B;  3I2Z A;  1A3T A;  3A8K E;  3H0G B;  5LL6 S;  4QY7 A;  3H3V I;  1A2T A;  2FIN B;  4ZQ3 A;  1TWH H;  1QG7 A;  1TS5 A;  3DM3 A;  4QCL A;  2M9V A;  3X3N A;  1MD2 D;  3K8A A;  2RA4 A;  1FGB D;  1KC8 C;  2PW7 A;  1EYG A;  1VQC A;  1E24 A;  2Q2I A;  2BH8 A;  2HHH L;  2F3W A;  5NUC A;  4C3H B;  2K32 A;  3T4A C;  1LO5 D;  4HID A;  1SXT A;  2R7D A;  5IGE A;  3OTO L;  2F0I A;  1HTL D;  4DAY B;  1I3Q B;  3W2D A;  5C3E H;  4ZYS A;  4B9W A;  2DNE A;  4Y7N B;  4LF7 L;  3I8Z A;  1XTC D;  5IE8 A;  4HJ7 A;  4OO1 G;  2F0M A;  2NUC A;  2I5L X;  3ULJ A;  2JP1 A;  2ZXP A;  2F0G A;  4DFA A;  2F3V A;  5EBC A;  3T1Y Q;  2E2I H;  2HT1 A;  4R9W A;  4G7O C;  1E7Z A;  2AQ1 B;  3X3M A;  3K59 A;  4TVA B;  5JPN C;  3A7L A;  4DGZ A;  2JXM B;  2AWO A;  1TWA H;  1ZYR D;  4KMU C;  3VR6 A;  5M3F B;  1FJG Q;  3CPF A;  4BY7 G;  3AYH B;  1TR5 A;  2L12 A;  4XT3 B;  4BWG B;  1EYA A;  1SJH D;  2O2L D;  1RCV D;  3K0Y A;  2F0D A;  5C4X G;  2WB1 G;  4LF8 L;  1AFP A;  1XX8 A;  3A0J A;  4GKJ L;  3OSO A;  4ZRZ A;  2IX1 A;  1GKH A;  4IUQ A;  2X6L A;  3I4N H;  1L0Y B;  1PHJ A;  3M7N A;  3MWY W;  3LWU A;  3H09 A;  4A3E H;  1RJT A;  5FK9 C;  5DEH A;  3W1G A;  4C56 C;  4JI7 L;  1JWU D;  3J81 i;  2D5D A;  3W5O A;  1X32 A;  2K1B A;  4DV1 Q;  3H0G G;  3C2P A;  1IYJ B;  3MXP A;  3CC4 A;  3CW2 C;  1J5E Q;  2Y0S E;  1SFO B;  5FLX c;  4RGN A;  1PH6 A;  1S72 A;  3IFT A;  5E7N A;  3J7Y W;  4DV3 L;  1VQ6 A;  4OL7 A;  4P71 A;  5C3E G;  2L4N A;  1PZJ D;  3J80 c;  1T5X D;  4DV4 L;  5M5X H;  1P16 A;  2F4V L;  4JI8 Q;  4C3H G;  3HFZ B;  2JE6 I;  4LNQ A;  3P75 A;  2N8N A;  1ML0 D;  2E76 C;  1RKN A;  4C3I H;  4HJ9 A;  3KLS X;  2ES2 A;  3CP0 A;  2H1E A;  4X3T A;  3R2I A;  1V9P A;  3VA7 A;  2O5J C;  1QNK A;  3I91 A;  3DLL A;  2MO0 A;  4J1M A;  2F0L A;  4TSS A;  1ILP A;  2RHQ B;  4DNR B;  2E2H H;  3ERS X;  1B8A A;  2ICE C;  3C1F A;  3M9B A;  3GTQ H;  1K3R A;  4B3R Q;  1E2W A;  1HZB A;  1AH9 A;  1LTS D;  1O7Y A;  3MFG A;  3VYU A;  1B3Q A;  3OPO A;  3V05 A;  4XXE A;  1UE1 A;  1V1Q A;  3RLO A;  4DK1 A;  3I4N G;  3GTP B;  2UUC Q;  2F0N A;  3EFX D;  4KN4 C;  5IIF A;  2ZXO A;  2E5L L;  1STE A;  2Q2H A;  4JOI C;  2R3Z A;  4DR6 Q;  3I4M B;  1B44 D;  3HOX H;  2IL8 A;  1U4P A;  1AEX A;  5JVG 3;  1QVG A;  4Z9C B;  4PG3 A;  1EQQ A;  4TQU S;  3BVG A;  3RZO B;  2F0U A;  4NXN Q;  1KDC A;  4QL5 A;  2DY7 A;  2GA4 B;  4IJH A;  1DOL A;  1SYB A;  2EJF C;  2NVT B;  4J8Q A;  3HOZ B;  4OX9 L;  4N9T A;  4YWL A;  5JJI A;  1DGS A;  4A75 A;  1UE6 A;  1X3E A;  4C3I G;  3J7A 5;  4FDB A;  3SGI A;  4A3G H;  2MP1 A;  2RBM A;  1MKH A;  1PH3 A;  1LT6 D;  4K6D A;  2CCZ A;  2F0J A;  4DV7 L;  1A0I A;  5I2Y A;  2ID0 A;  4GLX A;  2OCE A;  1JOQ A;  1YNN D;  2CVR A;  4EVO A;  2KBN A;  4DR1 Q;  2WKC A;  2ZJR A;  1EZ8 A;  3ONA B;  2Q2T A;  2VQE Q;  2H5X A;  2NVY B;  3CCL A;  1X6O A;  4JI4 Q;  4ZUJ A;  3U4V A;  2Z4I A;  4UHV A;  1EY7 A;  3R8B A;  3A8I E;  5IGF A;  4XT1 B;  3NTI A;  3S16 H;  1WTQ A;  3BZK A;  2OTL A;  3ULL A;  5IYD G;  4OO1 I;  3HOY B;  1HUM A;  1TS3 A;  2OWO A;  5M3M B;  4LF6 L;  1HRJ A;  1SYG A;  4HMJ A;  1IXR A;  4MN3 A;  5IP9 H;  1HJP A;  3S9W A;  2OQK A;  2A8V A;  5ISR A;  5C4J H;  4RCO A;  5M9O A;  3TS2 A;  4IUV A;  2JEB I;  3HRZ C;  1FNW A;  2LXK A;  3I4M G;  1G29 1;  3FVQ A;  1JE4 A;  3MEH A;  4RKL A;  1I4X A;  3NUC A;  3GO5 A;  1TVX A;  3KDF B;  2R7F A;  4R4T A;  4K5V A;  1U4M A;  3K7A H;  1JOR A;  2J0T D;  1Q8K A;  4DR5 Q;  3AU7 A;  3G6J B;  4K6L A;  1IBM L;  3BVM A;  4G7H C;  5C5M A;  2UUB Q;  2NVQ H;  1FGU A;  4QJF A;  1BCP C;  1K8G A;  1JB7 A;  1H9M A;  4BY1 B;  1VQG A;  2OF1 A;  4RGT A;  1S3O A;  2UUA L;  1BBU A;  1RIP A;  4B3T Q;  4RHR A;  4KK7 A;  1CKN A;  1GUN A;  2JA6 H;  4F88 A;  2KHS A;  2QEX A;  2MO1 A;  1SRO A;  3K6O A;  4KTA A;  4RMF A;  1MJE A;  1PFB A;  2EYP A;  4B3M Q;  3TRE A;  4Q5V A;  1TWF H;  5EJW A;  3F2C A;  4L6T B;  1OXU A;  1YI2 A;  1SBB B;  1ICF B;  4KI0 A;  4DAY A;  1HNW Q;  1SE4 A;  1F2M A;  1HA6 A;  3KK7 A;  2VNU D;  1NMF A;  2VQF L;  1VQO A;  2MUY A;  4R1J A;  1JMC A;  1AZP A;  4UPA A;  4YHH Q;  1PH7 A;  3SVM A;  5IYB G;  5J1Z A;  1B2T A;  5BN5 A;  5IP9 G;  1W6K A;  1PRT D;  4K2K A;  4X65 L;  1KDA A;  4L5S A;  1YNX A;  1LTA D;  1F77 A;  1E2V A;  4PZ7 A;  4X62 L;  1SSO A;  1I6H H;  1VQI A;  4A3I H;  3MXU A;  3J7A F;  2B2T C;  1UNS A;  1HR0 L;  4I7A A;  1K8A C;  4IJL A;  1EL0 A;  1SR3 A;  3J7Z C;  1W3S A;  2EDG A;  1HTP A;  1JOK A;  3TP7 A;  1DZ1 A;  5C44 B;  1U4R A;  2B63 H;  3BG3 A;  2MPM A;  3NQI A;  4WJW A;  3I3C A;  4L5R C;  1I4Q A;  2UXC L;  2EQS A;  2F0Q A;  3FDT A;  2C35 B;  3OHX C;  3F8T A;  3SR1 A;  2L11 A;  2EYH A;  4DR3 L;  1H95 A;  3QB3 A;  1XNQ Q;  1X3Q A;  2AWN A;  1EFI D;  2VUM H;  2JYO A;  3QOJ A;  1X3G A;  3LWE A;  1LTI D;  1KLU D;  5AJ3 Q;  2HD3 A;  1K0R A;  4A3F B;  1IYU A;  1QUQ A;  2Z6K A;  4RG1 A;  1XNR L;  4KJO A;  2JQO A;  1HZC A;  2F0P A;  2ZTD A;  2F0W A;  2IHE A;  3E9H A;  1EYD A;  4LUV A;  2PPB C;  4DF7 A;  3E5S A;  2UU9 L;  2ZTC A;  5HY6 A;  3QO2 A;  2XVS A;  2Q8I B;  3D8G A;  1VQN A;  3HOU B;  2BOS A;  3OTO Q;  4BA1 I;  2PI2 E;  4MIU A;  4LF7 Q;  3NK9 A;  4CDD C;  5EBD A;  4DXG A;  4H7B A;  1ASY A;  1F9R A;  3PF5 A;  3GTG B;  2QEJ C;  3S17 H;  2AQ3 B;  3M4O H;  1HNZ L;  1HZ9 A;  4A3K B;  1TII D;  3EN2 A;  2A6H D;  2FFK B;  2CKZ B;  1H9K A;  4DR7 L;  2JEA I;  1S5E D;  3GTM H;  1PH5 A;  4I7Z C;  3RLF A;  1W2B A;  5ELB A;  2RCF A;  5CBA E;  1C8C A;  4BA2 I;  3GTO H;  1GUS A;  4A3M H;  3TZD A;  4GZY C;  5HGT A;  3CXC A;  2F3I A;  1VDZ A;  5C3W A;  2EYO A;  2X6G A;  5C44 G;  4JCV E;  3R93 A;  4LF8 Q;  1LTB D;  1CA6 A;  4GKJ Q;  3AQQ A;  5IP7 H;  3I90 A;  2EXZ A;  4CJ1 B;  3OWE B;  3CRK C;  5IOD A;  4RH6 A;  1VQH A;  2A69 D;  2Y0S B;  5C5L A;  5CYU A;  1NBW A;  1KNA A;  1D1I A;  3FRP B;  3UDF A;  1CTM A;  4B08 A;  3PUX A;  3D3R A;  4LUZ A;  3S2H H;  3W3A A;  4IOA A;  1RD9 D;  1MBY A;  1V1O A;  4ULL A;  5LMN L;  3A54 A;  5GAH C;  2KHI A;  4R4O A;  3QG1 A;  4IPC A;  3VYR A;  3L2P A;  1PYB A;  1STH A;  4GLV B;  3OW7 A;  1LAC A;  2O5I C;  2L1B A;  4H44 C;  1TT2 A;  5FLX L;  4G4K A;  1XPU A;  4NP5 A;  3S2D B;  4M1U B;  4DV3 Q;  3SK8 A;  1EY8 A;  1YHB A;  1QNU A;  2K7V A;  1SMY D;  2LY7 A;  4DV4 Q;  3FHW A;  3S1M B;  2JA7 B;  3J80 L;  2F4V Q;  1E1O A;  2EXD A;  2JA5 H;  1BCP B;  3T53 B;  1R9T H;  4DA2 A;  1W6J A;  1PZI D;  1H9S B;  3D4R A;  2KQ3 A;  5T1I A;  1IL2 A;  2E2D C;  1Y1W H;  3RZD H;  1ENA A;  2CFM A;  4A3K G;  2ATW A;  1DD2 A;  2E2J H;  4ILW A;  1FD7 D;  5IYC G;  1L0X B;  1EQV A;  3S1R B;  2QDB A;  4UP8 A;  2R92 H;  3PO2 B;  3FMC A;  1EU3 A;  4HTH A;  4ZKC B;  3S15 H;  4JW0 A;  4ALP A;  3A56 A;  3EJI A;  2K4K A;  1HQM C;  3NBH B;  4LFB Q;  1KIX A;  4OXP A;  1TWC B;  1QJO A;  1NAP A;  3PF4 A;  2XIW A;  1WTR A;  1Y1V B;  2WAQ G;  1YNJ C;  1WD1 A;  2E5L Q;  4IOC A;  3M3Y B;  4IFD G;  1JC7 A;  1XXG A;  3CQZ B;  2AQ2 B;  2ZM6 L;  3UDG A;  1IZ6 A;  4A3J B;  3PUW A;  4JI3 L;  2Y0S G;  2GVB A;  1O7L A;  1PH8 A;  2Z0S A;  4JI0 L;  1X54 A;  1N33 L;  3A5U A;  3CCV A;  4DR4 L;  3KDF A;  3K57 A;  2F4I A;  4GN5 A;  5I9O A;  1LT4 D;  2K04 A;  1B7Y B;  1BKB A;  4FF4 A;  2K52 A;  3ND9 A;  3J81 E;  4KKT A;  1E2Z A;  1RTO A;  4OX9 Q;  1K83 H;  2XSC A;  3D6C A;  4K0K L;  1JB3 A;  1SNP A;  3GV3 A;  4CBV A;  2CW0 C;  2BH2 A;  1Y1W G;  2JA7 G;  3F2U A;  1YHA A;  3ZJY C;  5FJ8 G;  3F1Z A;  5M5Y B;  4KHV A;  1CT1 D;  4DV7 Q;  5KEE A;  4XQJ A;  4BY7 H;  1R4Q B;  3PV0 A;  4S3S A;  4K14 A;  2R92 G;  3MAQ A;  2BDN A;  2A73 B;  4C3J G;  1VQE A;  4P74 A;  1C4Q A;  5C4X H;  3CRL C;  1D1K A; 
#chains in the Genus database with same CATH homology
 3CPW A;  3T1Y L;  3GTQ H;  4BBS G;  1K3R A;  2AKW B;  4JI1 Q;  4X64 Q;  5H1S E;  4LF9 Q;  4A3C G;  2YU9 H;  4JI7 Q;  2JA9 A;  3KF6 A;  1C9O A;  4B3R Q;  1AH9 A;  1HZB A;  5LMU Q;  2ZJP A;  1VQF A;  4JG2 A;  4A3D H;  5HGQ A;  1L1O B;  4JYA Q;  1NY4 A;  4A3F G;  2NN6 I;  1U0L A;  3PSI A;  1UE1 A;  1K73 C;  1V1Q A;  3RLO A;  1B70 B;  1WCM H;  2IX0 A;  4LF6 Q;  4DR2 Q;  3I4N G;  1CKM A;  3Q8D A;  4DUY Q;  2UUC Q;  3PO3 H;  3FP9 A;  1VQ8 A;  3H0G H;  4LW1 A;  1EOV A;  1Y1V G;  3G4S A;  2E5L L;  2Q2H A;  4JOI C;  2V1C C;  2JK8 A;  3TEH B;  2YYZ A;  4DR6 Q;  2A1A A;  4XIG S;  2RCN A;  1YJN A;  2VZA A;  2A19 A;  3HOX H;  1EIF A;  3HOU G;  1QVG A;  1M90 C;  4PG3 A;  3HKS A;  3S2D H;  3RLN A;  3WWV A;  5FLM H;  2MFI A;  1EQQ A;  2UXD L;  5IY0 A;  4TQU S;  1JJG A;  2VY3 A;  4NB3 A;  1UWV A;  3H3V H;  4NXN Q;  4QL5 A;  1VQJ A;  4DV1 L;  3B6Y A;  3S1M H;  1N9W A;  4IJH A;  4C3H H;  1IBM Q;  2JA7 H;  2MQH A;  1TXY A;  1FVI A;  1J5E L;  2RF4 A;  3KF8 B;  1O7I A;  3W1B A;  5FJ8 H;  3U4Z A;  1WJJ A;  1XJV A;  1KXL A;  4OX9 L;  4JOI A;  2K75 A;  2YTX A;  1I3Q H;  4YWL A;  1XPR A;  2RHS B;  5JJI A;  1DGS A;  4A75 A;  1Z9F A;  4PZ6 A;  3KLW A;  1HNX L;  1UE6 A;  4DV6 L;  1X3E A;  2UUA Q;  1Q7Y C;  3J7A 5;  3HOW G;  1OXV A;  4FDB A;  4P73 A;  4C3J H;  2N78 A;  1N36 L;  4EX5 A;  3SGI A;  3ER0 A;  5C0X J;  3NEN A;  4QIW E;  4LFC Q;  3GTK H;  4A3G H;  4JI8 L;  3UDX A;  4JV5 L;  1HH2 P;  1MKH A;  4YCV A;  3VDY A;  1PH3 A;  4BBS H;  4DAM A;  3S1R H;  1YJW A;  2ALY B;  2CCZ A;  1AE3 A;  4DV7 L;  2JJQ A;  4NXM L;  1A0I A;  3ICE A;  4DPG A;  4P72 A;  2ID0 A;  5EAY A;  5JJL A;  4GLX A;  3CF5 A;  2OCE A;  4GN3 B;  4AQY L;  1PH9 A;  2KBN A;  4DR1 Q;  4DUZ L;  1Q12 A;  2ZJR A;  4A3D G;  1VQB A;  2Q2T A;  4AYB G;  2VQE Q;  1YEZ A;  2H5X A;  2JA6 G;  5GAE C;  2VQF Q;  1TWC H;  2Q2U A;  1X6O A;  3CCL A;  4JI4 Q;  5JJK A;  3U4V A;  4QGU A;  1I94 Q;  5J3B A;  1VQK A;  4JI1 L;  4X64 L;  1VQD A;  3M85 A;  4LF9 L;  2QA4 A;  1WCM G;  5ELN A;  1Y1V H;  2K14 A;  5LMN W;  4B3R L;  3CCQ A;  5LMU L;  3M3Y H;  1IBK Q;  4PMW A;  3S16 H;  3PO3 G;  4X65 Q;  3BZK A;  1EIY B;  2OTL A;  2R7Z H;  1KAW A;  3ULL A;  1BVS A;  5IYD G;  4JYA L;  4GLA C;  4OO1 I;  3MXN B;  2GVA A;  3HOU H;  4DK3 C;  4A4I A;  2OWO A;  4LF6 L;  1MJC A;  1YBY A;  4LFA Q;  3CCS A;  4DR2 L;  1XMQ Q;  2NZH A;  1HR0 Q;  4LUO A;  3L7Z C;  2UUC L;  1IXR A;  5IP9 H;  1JE5 A;  1J6Q A;  1PYS B;  4XTC S;  5FLM G;  4DV6 Q;  1E1T A;  1X3F A;  1HJP A;  5GAG C;  2OQK A;  2A8V A;  1N32 Q;  5C0X G;  4KHP Q;  5C4J H;  1SFO H;  2D62 A;  4DR6 L;  1UE7 A;  3TS2 A;  1RL2 A;  3G71 A;  2JEB I;  2PI2 A;  1VQ4 A;  4JI6 Q;  2LXK A;  3I4M G;  2UXC Q;  1G29 1;  3PUY A;  3T1H Q;  4LF5 Q;  3K0X A;  1M1K C;  2FXQ A;  3A74 A;  4A3I G;  4NXM Q;  3GO5 A;  1KRS A;  3KDF B;  2R7F A;  1SE8 A;  4R4T A;  3S24 A;  3F2B A;  3CCU A;  4DR3 Q;  3K7A H;  3AEV A;  3HOW H;  4NXN L;  4MTN A;  4DV5 Q;  1Q8K A;  3EBE A;  4JBK A;  4DR5 Q;  1IBM L;  2OQ0 A;  3PIP A;  2UUB Q;  2NVQ H;  3L0O A;  2B63 G;  1FGU A;  1V43 A;  4QJF A;  3I4O A;  1K8G A;  5M5Y H;  1JB7 A;  3AFP A;  1KD1 C;  1VQG A;  3U58 A;  1QZG A;  1Z47 A;  4POG A;  2IY5 B;  1XNR Q;  1G6P A;  1S3O A;  2UUA L;  1BBU A;  1I5F A;  3CME A;  1RIP A;  2KCM A;  1IBL Q;  2HIV A;  4B3T Q;  5M3F G;  3PCO B;  4YWK A;  1CKN A;  1MIU A;  3CD6 A;  1D7Q A;  2UU9 Q;  2JA6 H;  2KHJ A;  2PQA A;  4LFC L;  3HKZ G;  2QEX A;  4JC0 A;  1QZH A;  2AHO B;  3BU2 A;  4HJA A;  2DGY A;  2MO1 A;  1YVC A;  3RN5 A;  2VUM G;  1SRO A;  4GOP C;  4RMF A;  1MJE A;  4YWM A;  1NJI C;  3KFU A;  1X56 A;  4MNO A;  4B3M Q;  4A3L G;  4BXX H;  3TRE A;  1TWF H;  3HKZ E;  5IYD H;  3F2C A;  4POF A;  1OXU A;  1YI2 A;  3K7U C;  4DR1 L;  1OXT A;  2VS1 A;  3PUZ A;  1KL9 A;  3FKI H;  4KI0 A;  1E22 A;  4X66 Q;  1HNW Q;  2D0P A;  5JEA J;  2VQE L;  2R7Z G;  3CCE A;  2VNU D;  1GO3 E;  1NMF A;  2VQF L;  1VQO A;  4JI4 L;  5AJ3 L;  4A3J G;  1YJ9 A;  1I94 L;  4R1J A;  1JMC A;  1NE3 A;  3UE0 A;  3GTP H;  4C2M H;  4UPA A;  3KF6 B;  4YHH Q;  1YIT A;  1PH7 A;  2KCT A;  3G48 A;  1VQL A;  5IYB G;  4DR7 Q;  1CKN B;  1Q81 C;  1IBK L;  2QGQ A;  2R93 G;  4B3S Q;  5IP9 G;  4GOP A;  1QVC A;  3MEF A;  3CMA A;  4X65 L;  1X65 A;  1JJ2 A;  1PVO A;  2YTV A;  4IO9 A;  1C7Y A;  1YNX A;  4L5S A;  3HOV H;  3I4M H;  4PZ7 A;  5DLQ E;  4APV A;  1I50 H;  4X62 L;  1I6H H;  4OWX B;  1VQI A;  4A3I H;  1PA6 A;  4IPD A;  4LFA L;  1XMQ L;  4Y52 H;  2XGT A;  4Y7N H;  1HR0 L;  4LWC A;  1WYD A;  1K8A C;  1E3P A;  4HIK A;  4IJL A;  3RZO H;  1SR3 A;  3J7Z C;  3STB C;  1W3S A;  1EWI A;  1VQ9 A;  1UEB A;  4JI2 Q;  3JAM i;  1CKO A;  1XTD A;  1N32 L;  2B63 H;  3NEL A;  4KHP L;  2Z6K C;  4A76 A;  3D31 A;  5GQO A;  3S14 H;  2NVT H;  1WOC A;  4JI6 L;  3HOZ H;  3E0E A;  4L5R C;  1L0W A;  3S1N H;  2UXC L;  2EQS A;  3T1H L;  2C35 B;  4A3M G;  1FL0 A;  4LF5 L;  3F8T A;  4P75 A;  4A93 G;  1HNW L;  2NVX H;  3PO2 H;  2K50 A;  2CWA A;  5M3F H;  4DR3 L;  1H95 A;  4DV5 L;  4HJ5 A;  4GN4 B;  4DR5 L;  2VL6 A;  3BJU A;  1XNQ Q;  2IT1 A;  3J80 i;  4KHZ A;  2AWN A;  5JEA G;  2UUB L;  2VUM H;  2N49 A;  1EQR A;  5LMN Q;  4UP9 A;  1X3G A;  5AJ3 Q;  1K0R A;  2EIF A;  4X6A H;  2JA8 G;  1QUQ A;  1YZ6 A;  2Z6K A;  4RG1 A;  5IP7 G;  2I0Q A;  4A3L H;  1XNR L;  2JQO A;  1BBW A;  1HZC A;  2ZTD A;  2IHE A;  3E9H A;  1L2F A;  3K81 C;  4UP7 A;  1IBL L;  4B3T L;  4LUV A;  4BXX G;  3CQZ H;  4AIM A;  2NZO A;  2UU9 L;  4AH6 A;  2NVY H;  3CC2 A;  4JBM A;  4A3J H;  1LM0 A;  4HIO A;  4HIM A;  2ZTC A;  5HY6 A;  4X62 Q;  3FKI G;  1A62 A;  3D0F A;  1CSP A;  1JT8 A;  1VQP A;  1A8V A;  2HIX A;  1XMO Q;  5IYB H;  1VCI A;  1VQN A;  3LGJ A;  2I5M X;  4NPS A;  4B3M L;  2UXB L;  2R93 H;  5BR8 Q;  3JC6 6;  1Q1E A;  3H15 A;  2WP8 J;  4LF4 L;  3OTO Q;  4BA1 I;  2PI2 E;  3OW2 A;  2WAQ E;  2XTI A;  2ZTE A;  4EQ5 A;  4ME3 A;  1L1O C;  1TWG H;  2CQO A;  1N34 Q;  4LF7 Q;  4YY3 Q;  4X66 L;  5M5W H;  2HQL A;  2MNA A;  3KJO A;  1ASY A;  2NN6 G;  3RN2 A;  1EFW A;  3K80 C;  3PF5 A;  1YIJ A;  3UDI A;  5M3M H;  3M4O H;  1CUK A;  4A3B G;  3E9I A;  1QUQ B;  1HNZ L;  3HOV G;  1HZ9 A;  2K5N A;  3F2D A;  5IWA Q;  3EN2 A;  4J15 A;  1JJC B;  4YHH L;  3BZC A;  4KLK A;  2BA0 A;  2DUD A;  2IHF A;  2CKZ B;  4OWT B;  3G6E A;  1GVP A;  1Q82 C;  4DR7 L;  4R4Q A;  2JEA I;  2JA5 G;  3GTM H;  3OYY A;  1W2B A;  3RLF A;  4GNX C;  3RNU A;  1PH5 A;  4B3S L;  3KYH C;  2I5H A;  3J81 j;  4BA2 I;  3GTO H;  1U5K A;  5GRO A;  4MZ9 A;  4A3M H;  2K5V A;  2K5H A;  4HJ8 A;  1XPO A;  4IFD I;  4QQB X;  4A93 H;  3HOZ G;  3CXC A;  1L1O A;  2F3I A;  5ELO A;  4OWW B;  2KEN A;  3M4Q A;  2ZJQ A;  3KJP A;  4JI2 L;  1GM5 A;  1SRU A;  1KRT A;  3GTL H;  5C44 G;  2AMC B;  3J81 c;  1UE5 A;  4JCV E;  4LF8 Q;  4DV0 L;  1X9N A;  3NEM A;  1PFS A;  4GKJ Q;  1WFQ A;  3AQQ A;  3GTJ H;  3I56 A;  5IP7 H;  4GNX A;  2JA8 H;  1P8L A;  1PH2 A;  4GS3 A;  4YCW A;  1OXS C;  3U50 C;  2ZM6 Q;  1VQH A;  2CWP A;  4JI3 Q;  2UXB Q;  1NBW A;  4LF4 Q;  3ULP A;  5K36 G;  1K9M C;  3UDF A;  4JI0 Q;  1XNQ L;  3PUX A;  1LTL A;  4LUZ A;  1N33 Q;  3S2H H;  4IOA A;  3CCR A;  3CAM A;  4DV2 Q;  4DR4 Q;  4JI5 L;  4L5Q A;  4YCU A;  5LMN L;  2B3G A;  3I2Z A;  1FJG L;  5GAH C;  2KHI A;  4QY7 A;  4R4O A;  4L5T A;  5C0X I;  1HNZ Q;  3H3V I;  4IPC A;  4IPH A;  3I55 A;  4LFB L;  1TWH H;  3RR5 A;  3DM3 A;  3L2P A;  1PYB A;  1NTG A;  1Q86 C;  2PMZ E;  4GLV B;  2PQA B;  3K8A A;  1VQM A;  1XPU A;  4A3E G;  1KC8 C;  4DV3 Q;  1EYG A;  4A3B H;  4K0K Q;  1OXX K;  3EIV A;  1VQC A;  1YHB A;  2L15 A;  4GNX B;  1E24 A;  2Q2I A;  3HOY G;  2BH8 A;  2HHH L;  1QVF A;  4GKK Q;  1WI5 A;  4DV4 Q;  3FHW A;  4IFD J;  5M3M G;  1XMO L;  1PV4 A;  2F4V Q;  1E1O A;  1A63 A;  1X55 A;  2EXD A;  3PGZ A;  4HID A;  2JA5 H;  1N8R C;  5IT9 c;  2OTJ A;  5BR8 L;  2R7D A;  1R9T H;  3CC7 A;  3OTO L;  3I7F A;  3AFQ A;  4DAY B;  1Q46 A;  5C3E H;  3TS0 A;  4YY3 L;  1N34 L;  4LF7 L;  5IE8 A;  2D0O A;  4DV0 Q;  4HJ7 A;  3A5Z B;  1IL2 A;  4OO1 G;  3HOY H;  1SN8 A;  1LYL A;  2VW9 A;  1VS0 A;  4BBR G;  3RZD H;  1Y1W H;  2I5L X;  2CFM A;  5IWA L;  1SLJ A;  1SMX A;  4A3K G;  2ATW A;  2E2J H;  3ULJ A;  2N3S A;  4O2D A;  3PIO A;  1ASZ A;  4GOP B;  5IYC G;  1S40 A;  3T1Y Q;  2E2I H;  2HT1 A;  5C44 H;  2BA1 A;  1T9H A;  1E7Z A;  1YHQ A;  4UP8 A;  1C0A A;  4TVA B;  2R92 H;  3STB D;  4JBJ A;  2ASB A;  4WJ4 A;  4IPG A;  4JI5 Q;  2AWO A;  1TWA H;  1VQ5 A;  4BY7 G;  1FJG Q;  3CPF A;  3PO2 G;  3S15 H;  2LXJ A;  4DK6 C;  4ALP A;  2K4K A;  3AYH B;  3NBH B;  4BY1 G;  4LFB Q;  1KIX A;  1LUZ A;  2E8G A;  4DNI A;  3M9B A;  4A3C H;  4OXP A;  5C4X G;  3PF4 A;  2WB1 G;  1GD7 A;  4LF8 L;  2WAQ G;  2E5L Q;  3A0J A;  4IOC A;  4A3F H;  4GKJ L;  2HHH Q;  4IFD G;  4OON A;  1D8L A;  2GN5 A;  3CCM A;  4UY8 C;  1GKH A;  2IX1 A;  4PZ8 A;  2R6G A;  2ZM6 L;  3UDG A;  1IZ6 A;  3I4N H;  3PUW A;  1PHJ A;  2F52 A;  2WB1 E;  2YTY A;  1Q1B A;  2Y0S G;  3KOJ A;  2GVB A;  2B29 A;  4JI3 L;  4A3E H;  2Z0S A;  1PH8 A;  4JBW A;  3W1G A;  4JI0 L;  4JI7 L;  1X54 A;  1N33 L;  2UXD Q;  3A5U A;  3J81 i;  3TQY A;  3CCV A;  3S17 H;  3JAM c;  4DV2 L;  3GD7 A;  3KDF A;  4DR4 L;  3PUV A;  3W5O A;  4GN5 A;  4AYB E;  4DV1 Q;  1AE2 A;  3H0G G;  1IYJ B;  1B7Y B;  1CSQ A;  1VQA A;  1BKB A;  3CC4 A;  3CW2 C;  1J5E Q;  2K52 A;  2Y0S E;  1PH1 A;  2LSS A;  4DKA C;  5FLX c;  3GDE A;  1S72 A;  1PH6 A;  4OX9 Q;  1OTC A;  1G51 A;  1K83 H;  5E7N A;  3HOX G;  4DUY L;  4DV3 L;  3GTG H;  1HNX Q;  3M4P A;  4K0K L;  1HZA A;  1VQ6 A;  4BBR H;  1NMG A;  4P71 A;  2WFW A;  2YV5 A;  5C3E G;  4A3K H;  4O0A A;  3J80 c;  4WJ3 M;  1N36 Q;  4GKK L;  3CCJ A;  4DV4 L;  1HR0 W;  3UE1 A;  5M5X H;  1P16 A;  4R4I A;  4R4C A;  4JI8 Q;  1Y1W G;  2BH2 A;  2F4V L;  5IYC H;  3IRB A;  3HFZ B;  2JA7 G;  2JE6 I;  4JV5 Q;  4LNQ A;  1YHA A;  1Y14 B;  2PNH A;  3ZJY C;  2N8N A;  5FJ8 G;  3F1Z A;  1PH4 A;  4DV7 Q;  4C3I H;  4HJ9 A;  3S1Q H;  2ES2 A;  3CP0 A;  5GAD C;  4BY7 H;  3PV0 A;  4H02 A;  1V9P A;  2R92 G;  1KQS A;  4AQY Q;  3DLL A;  4BY1 H;  3TRZ A;  4DUZ Q;  2MO0 A;  1VQ7 A;  1VQE A;  4P74 A;  2RHQ B;  2E2H H;  3ERS X;  1EUJ A;  1B8A A;  5C4X H;  4A3G G;  3M7N A;  1KHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...