4HIOA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggtaacggt)
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
139
structure length
139
Chain Sequence
DSFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
total genus 36
structure length 139
sequence length 139
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hioA00
3J7ZC 3HKSA 3RZOH 2JK8A 3S1MH 2FXQA 4NPSA 2YYZA 3S2HH 2JA5H 4YWKA 4X64L 3CMEA 2Y0SE 2I5HA 1HZAA 1HNWL 4LF4L 2HHHQ 3HOWG 4LF9L 3PUXA 3CCSA 4OWXB 4NB3A 3VDYA 1WOCA 2OQKA 1J5EQ 4DV2Q 4JI6Q 3HOZG 3CP0A 3KLWA 4GLAC 1SE8A 4BY7H 2BA1A 5C3EH 3CCEA 4A3JG 3BU2A 1HH2P 4GOPA 2PI2E 3H15A 1KRSA 4JCVE 2YV5A 4HIKA 4A3MG 1EWIA 2JA8H 3M4QA 2R93H 3KFUA 4LFAQ 4JI6L 3I4MH 3KF6A 2MO0A 3IRBA 3PCOB 4C3IH 5JJIA 4HIDA 5GROA 1E22A 1VQKA 4DV5Q 1AH9A 2AKWB 1PH3A 1AE3A 1N8RC 1UE6A 1EIYB 2ZTDA 1OXSC 2BH2A 1PH2A 5C4XH 1NBWA 1XNQQ 2AHOB 2PQAA 1K9MC 5JJLA 1SRUA 2UU9Q 4GNXB 4DV7Q 4DR6L 4C3JH 1K0RA 4GLXA 4KHPL 3GTKH 1D8LA 4HIMA 2E8GA 3CXCA 1G51A 1DGSA 1WCMG 4JI2Q 2K14A 4A3CG 1U0LA 1I6HH 4A3BG 1I5FA 1Y1VH 1JJ2A 3KJOA 1RL2A 1GVPA 4DUYQ 2E5LL 4LF6L 1D7QA 4A3KG 4O0AA 3I4NG 3S1NH 2VQEQ 2N78A 4AIMA 4QGUA 1NY4A 1YITA 4LUOA 4XIGS 2PQAB 4A3FG 4AYBG 1VQFA 1V9PA 1IBKQ 1XNRL 3ICEA 1OXUA 2YTVA 4NXMQ 4IPGA 5AJ3Q 1WFQA 4PMWA 5C0XI 4DR5Q 1GKHA 1Y1WH 3GO5A 3PUWA 4LUVA 3TREA 5IP9G 4YCWA 1K8AC 4YHHQ 5JEAG 2JA6G 2IT1A 1VQOA 2ZTEA 4DR1Q 3J81i 2EQSA 2K5VA 3I4NH 4LF7Q 1VQNA 1C0AA 1R9TH 1C9OA 2VUMG 4A3GH 4YY3Q 1VQDA 4IOAA 3CC2A 2VL6A 1LYLA 5M5WH 2ZM6Q 4YHHL 4J15A 4GS3A 4UY8C 1VQ6A 1PYSB 4GOPB 3STBC 3A5ZB 1N36Q 2JA8G 3J7A5 1KL9A 2IX0A 4DR7Q 2Z6KC 3GTJH 3T1HQ 3GTLH 1SROA 2HIXA 4LW1A 1SLJA 2PMZE 1TWHH 1CKMA 1UE1A 1YHAA 5IT9c 5FLMG 1TWFH 3PIPA 1G6PA 1RIPA 3CC4A 1NMFA 4RG1A 1GM5A 4PG3A 2CKZB 1N32L 2CFMA 2ZJQA 1IBLQ 4OX9Q 5DLQE 5C0XG 1Q7YC 1VQJA 3AYHB 4OXPA 1U5KA 3RLOA 2QA4A 1E24A 3CPWA 4FDBA 2D62A 3ER0A 1B70B 2Q2IA 4NXML 5HGQA 1EQQA 1JMCA 3H3VH 4DK3C 1FL0A 4JYAL 2XTIA 3CCMA 4JI4Q 2D0OA 3LGJA 4JOIC 1PYBA 5C44G 3U4VA 2XGTA 1PH6A 4B3SL 3ULJA 1PVOA 2PNHA 1X56A 4DV2L 5IE8A 1J6QA 1XPOA 1SN8A 1PV4A 1YBYA 4IOCA 1K3RA 3M4PA 4QIWE 1IXRA 4TQUS 4POGA 3W1GA 4X64Q 4OO1I 1IZ6A 1VQ7A 2I5LX 3K80C 5ELNA 1BVSA 2NZHA 4X66L 1P8LA 3PSIA 4JOIA 4A4IA 2F4VL 2ZJRA 1N34Q 4B3TL 3PO2H 3OTOQ 3T1YQ 5IP9H 2N49A 4GKJL 4A3LG 5JJKA 2R7FA 3TRZA 3I2ZA 3PIOA 4BBRH 3J80i 4JYAQ 1WI5A 4O2DA 5EAYA 2ZJPA 2GVBA 4OWWB 3F1ZA 1KD1C 1X3GA 2H5XA 1MJCA 4OO1G 2MO1A 1UE7A 3CCJA 2ATWA 1IBLL 2AMCB 1VQBA 1PFSA 2A19A 3Q8DA 4DV4Q 3PO3H 4ALPA 3HKZE 4KLKA 5M3MG 4DAYB 5IYDH 3AQQA 3FHWA 4BY7G 1VQEA 1HR0L 3HOXG 1PA6A 5IP7H 5FJ8G 3TS2A 4HJ7A 4JI4L 4IPHA 1MJEA 3T1HL 2JA5G 1VQIA 1Y14B 4HIOA 4LF8Q 4GKJQ 2L15A 5LMUQ 1HZBA 4DV0Q 2F4VQ 4LF5L 1XNRQ 1Q82C 4LF4Q 5BR8Q 1YJNA 3F8TA 2JA7G 4A93G 4JI0L 3PO3G 3AFQA 5IYBG 1UE5A 4OONA 1HNXQ 3S15H 1L1OA 3UDGA 2F3IA 4BXXG 1JT8A 2RCNA 1MKHA 4BBSH 1M90C 2VY3A 3CQZH 4DR1L 1CSQA 3M4OH 2K52A 1X3EA 2B63G 3PUYA 5IY0A 1NTGA 3RLNA 4DUZQ 4X62L 1I50H 4AYBE 3KOJA 3M85A 4DR2L 1YI2A 1YJ9A 1B8AA 3W1BA 5GADC 3TEHB 1S72A 4DKAC 4DUZL 4LFBQ 3BZKA 4GN4B 1XPRA 4GKKL 1NMGA 1L1OB 3HOWH 1XMQQ 2NVQH 1XPUA 4KHPQ 1N9WA 5JEAJ 4BA1I 1G291 1QZGA 3CPFA 4R4IA 1EIFA 1Q12A 3TS0A 4LF7L 5GQOA 2F52A 4EX5A 1FVIA 1T9HA 2VW9A 5E7NA 1SR3A 4IPCA 3SGIA 1TXYA 1Y1VG 4DR5L 2AWOA 1HNZQ 1BBWA 2JA9A 3I56A 1YVCA 2UXDL 1YIJA 1IYJB 3F2DA 3OW2A 3OYYA 1K83H 2KBNA 2E2HH 1QVCA 1EQRA 2NVTH 4P72A 3K8AA 1JJGA 2K50A 2RHSB 1CKNA 4DV6L 1XMQL 1JB7A 2IX1A 5C4XG 3S16H 2OCEA 4NXNL 3G71A 5IYCG 2JEBI 3KJPA 3GTPH 2RF4A 4L5SA 1CSPA 4IJHA 3L2PA 4BY1H 4DR3Q 1A62A 1KC8C 4DV7L 3PF4A 4DR6Q 1V43A 3MXNB 3G6EA 4IO9A 5IYBH 3ULPA 4L5QA 4MNOA 4LFCL 3U58A 1Q1EA 4L5RC 4K0KQ 4DR3L 3RLFA 3M3YH 2UUCL 1HR0Q 4X6AH 3H3VI 3RR5A 3GDEA 4LF9Q 1MIUA 2HQLA 4DR7L 4OWTB 1CUKA 1KAWA 2IHFA 2IHEA 4JBKA 2DGYA 4LWCA 4Y52H 4B3RQ 1NE3A 4BBRG 1EYGA 3M9BA 5LMNW 3DM3A 1L2FA 4LF5Q 4KHZA 2LXJA 2AWNA 4DK6C 1VQHA 3UDFA 2UUAQ 4B3SQ 3GTGH 1UWVA 4KI0A 2K5NA 4UPAA 1XTDA 5LMNQ 2B29A 4R4OA 2Q2TA 2KCTA 3CCQA 3L0OA 3NBHB 4JBMA 2VNUD 2YTYA 5ELOA 4H02A 3ZJYC 3RZDH 4A3FH 1YJWA 4JI8L 3I7FA 3PF5A 4JC0A 4GLVB 1X54A 1FGUA 1UEBA 1E1OA 2D0PA 3CAMA 1HZCA 3EN2A 4YY3L 3TQYA 3F2CA 1QVGA 1I94Q 5C0XJ 3CCLA 4PZ7A 4DNIA 2IY5B 1VQCA 2HIVA 4C2MH 4A3DG 4AQYL 5C44H 3K7UC 3NENA 2UUBL 3ERSX 2KCMA 3UDIA 1EUJA 2E2IH 2VZAA 1QVFA 1PHJA 2A8VA 2MNAA 4K0KL 3BZCA 1KQSA 2UUAL 1N34L 4B3TQ 4YWLA 2E2JH 2K75A 3MEFA 3PV0A 1VCIA 4DR2Q 1VQ4A 4X66Q 1PH5A 1HZ9A 3J81j 3DLLA 3HOZH 3GTMH 2YU9H 4JI3Q 4JI7L 4YWMA 1CKNB 4JBWA 3KYHC 5M3MH 5IYDG 3KF8B 1K8GA 2R6GA 1EFWA 4Y7NH 1V1QA 4YCVA 1L1OC 1YHQA 4DAMA 1KRTA 3GTQH 3I4MG 2OTJA 1H95A 1WCMH 2DUDA 5M5XH 4JI5L 3M7NA 1YZ6A 4JI2L 3S1RH 2R7DA 2KENA 1PH8A 1PH9A 1A63A 4WJ4A 1Q81C 2LSSA 2NVYH 4IJLA 4ME3A 4HJ8A 2UU9L 2ASBA 3W5OA 3CD6A 4A3JH 4PZ6A 3KDFB 1N33Q 2EXDA 1XMOL 2JE6I 3HFZB 2ZM6L 1IBMQ 1XJVA 2R7ZH 1S3OA 4DV3L 4A3EG 1A8VA 2Z6KA 1Z9FA 3HOVH 4DR4Q 1O7IA 1YHBA 1ASZA 1HJPA 4DUYL 1X6OA 1YNXA 4DV5L 3PGZA 3WWVA 3HOUH 4A75A 5J3BA 4R1JA 3RN5A 4JI0Q 4GN5A 1X3FA 1QUQA 3PUVA 4A93H 1VS0A 4B3ML 4BXXH 2JEAI 2PI2A 4A3KH 1AE2A 4B3MQ 3A5UA 1B7YB 2R7ZG 2K4KA 3KDFA 1K73C 4LNQA 2Q2HA 4R4TA 4C3HH 2WB1G 1Q1BA 3UE1A 1EOVA 3B6YA 3U4ZA 4HJ9A 1I94L 4LF6Q 3EBEA 4DV4L 2E5LQ 2EIFA 2RHQB 3JAMi 4XTCS 4AH6A 5GAGC 3RNUA 1N33L 4JI8Q 4PZ8A 2R93G 2QEXA 5M5YH 5IWAQ 3JAMc 2C35B 4YCUA 5M3FG 3NELA 1ASYA 4UP9A 1QZHA 2VQFL 2HT1A 4LFCQ 5H1SE 3I55A 5C3EG 1X65A 3J81c 4APVA 2UUBQ 2VQFQ 2R92H 3A74A 2N3SA 1WYDA 4JV5Q 1A0IA 3E0EA 4NXNQ 2B3GA 3UDXA 5GAHC 4B3RL 4RMFA 1N32Q 4P73A 4POFA 5M3FH 4QQBX 1VQ8A 3HOYG 5FLMH 2KHIA 1FJGQ 3JC66 4GOPC 4MZ9A 2OWOA 1CKOA 3FKIG 1E1TA 4LF8L 2BH8A 5FLXc 3J80c 2JQOA 2K5HA 1SMXA 5LMNL 2GVAA 4BBSG 4GNXA 2LXKA 4AQYQ 1C7YA 1IL2A 3OTOL 3T1YL 5IWAL 3L7ZC 3S14H 1Q86C 3CMAA 1HNWQ 1KHIA 4IPDA 2WP8J 4GN3B 2OTLA 2I5MX 4A3MH 2NZOA 3HKZG 1VQ5A 4OX9L 2NN6G 1QUQB 4X65L 2CCZA 2UXCL 4A3BH 2UXBL 3CF5A 4P74A 4L5TA 3S2DH 2N8NA 1XMOQ 1IBML 1X9NA 2JA7H 1Z47A 4R4QA 2CWAA 2Y0SG 4QJFA 1P16A 1HNZL 2VUMH 4A3GG 4IFDI 1S40A 5AJ3L 2Q2UA 3H0GH 4IFDJ 2Z0SA 2CWPA 3E9HA 3EIVA 2NN6I 4GNXC 4JG2A 1L0WA 3CW2C 2JJQA 3BJUA 3RN2A 1HR0W 1TWCH 3GD7A 1E7ZA 4BY1G 3K7AH 4DR4L 1PH1A 2NVXH 2BA0A 4DV3Q 4HJ5A 2UUCQ 1HNXL 3K0XA 4UP8A 3CCUA 1TWGH 5K36G 1LM0A 4P75A 5BR8L 3S17H 4DV1Q 4A3IG 4IFDG 4LFBL 2UXDQ 4WJ3M 1OXTA 4A3EH 3HOVG 2QGQA 2WB1E 2WFWA 5LMUL 4DV0L 3STBD 2MQHA 1N36L 2I0QA 2B63H 3HOXH 1VQMA 4A3DH 3AFPA 4BA2I 3AEVA 1KIXA 4TVAB 1LUZA 3G4SA 1BKBA 4DV6Q 3KF6B 2VQEL 1SFOH 1NJIC 1BBUA 3CCRA 1Y1WG 2UXBQ 2WAQE 1JE5A 4X65Q 4LUZA 2UXCQ 1OXVA 3FKIH 4QL5A 2KHJA 3I4OA 4QY7A 4HJAA 1VQAA 4GKKQ 1PH4A 2V1CC 2MFIA 4JI3L 3CC7A 4A3IH 4JI1L 1PH7A 4JI7Q 1OTCA 3G48A 2JA6H 3GTOH 1E3PA 2OQ0A 3PUZA 1LTLA 5HY6A 1X55A 5C4JH 4X62Q 1I3QH 3D0FA 5FJ8H 3U50C 4DPGA 5IP7G 2VS1A 4DV1L 1VQ9A 4JI1Q 1TWAH 3E9IA 1M1KC 1WJJA 1VQGA 3F2BA 4EQ5A 4MTNA 2ALYB 4A76A 1FJGL 3PO2G 2ID0A 1VQLA 5GAEC 3D31A 2HHHL 2A1AA 3HOUG 3A0JA 1JJCB 4UP7A 1GD7A 2ES2A 1W3SA 3S1QH 1Q46A 1GO3E 2GN5A 1VQPA 4A3CH 2R92G 4JV5L 1YEZA 3FP9A 3H0GG 4LFAL 3S24A 2ZTCA 3CCVA 3K81C 3UE0A 1OXXK 3NEMA 1Q8KA 4JBJA 4P71A 1KXLA 1IBKL 1XNQL 4R4CA 4A3LH 4JI5Q 2CQOA 1W2BA 5IYCH 2YTXA 3ULLA 3HOYH 1J5EL 2WAQG
chains in the Genus database with same CATH superfamily
2EY2A 4B9WA 1NSNS 1SNOA 3S1MH 2FXQA 2JA5H 4IFDH 3AU7A 3NWTA 4QMGA 2V4DA 3MXUA 1HNWL 1KNAA 2HHHQ 4LF9L 1I4QA 3VDYA 1J5EQ 1FGBD 2P5ZX 4DV2Q 1S5ED 2AUJD 1ENAA 4BY7H 3CCEA 2WB1B 4ZAIA 4F88A 3J81E 2K5QA 1EEFD 2YV5A 1EWIA 1O80A 5JJIA 3OSOA 2IPKD 1CHQD 1AZQA 2NWGA 2RDHA 3SK5A 4U673 1UE6A 2BH2A 1PH2A 3FKIB 2SOBA 5JJLA 4I7AA 1HTLD 1G6ZA 2UU9Q 2RCFA 2E75C 1FNUA 1DOKA 4HIMA 3CXCA 3IAYA 1TKWB 3J80E 2KHSA 4L63B 1Y1VH 2E5LL 1RL2A 3MXGA 2IL8A 3I4NG 5ISRA 2L55A 2K5DA 4XIGS 4A3FG 2CHBD 3SK4A 1BF4A 1OXUA 1WFQA 4RHRA 2B2YC 3GO5A 3PUWA 5E3FA 1S5CD 2EQSA 2J7ZA 2PPBC 4A3GH 1IL8A 2E2HB 1VQDA 4IOAA 5CV7A 2ZM6Q 5C0XH 2LKVA 5IIFA 1ZKOA 1SROA 2VXWA 1RKNA 2F0UA 1BO0A 1W6JA 1RIPA 2MP1A 3CC4A 3HOUB 3D8GA 2AUKA 4PG3A 3QWNA 3GQBA 4OX9Q 1A6XA 2R61A 1X32A 4OXPA 2PNRC 3RLOA 3G6JB 4KHPQ 2Q2IA 1VF5C 1EY5A 4JYAL 4DK3C 2XTIA 1EY7A 2QEJC 2D0OA 2EZVA 4B3SL 1X56A 1F9RA 1FD7D 1I4RA 3M4PA 4TQUS 2SEBD 3W1GA 5EPKA 4X64Q 1IZ6A 2I5LX 5CORA 3PSIA 1N34Q 4B3TL 3T1YQ 3QO2A 1LO5D 3S2DB 1S5BD 5KNDA 3J80i 2F3WA 5EAYA 1I50B 1KD1C 4YIJA 4OO1G 2F0IA 3FVQA 3MFYA 5C3XA 5IOCA 2CH4A 2ATWA 1VQBA 2A19A 4DV4Q 4KLKA 2X6GA 1GOZA 1SJHD 2Z9HA 2A6HD 2HDMA 3FHWA 3R2TA 4BY7G 1BBXC 5K5PA 1CK1A 3E3XA 5IP7H 5FJ8G 3TS2A 3MEHA 1WCMB 4IPHA 2JA5G 2SDFA 5G3LD 2L15A 3CRKC 1XNRQ 1ET9A 5BR8Q 1PMRA 2JA7G 5JAVA 3PO3G 2EY1A 3I70A 4HMIA 1M90C 3M4OH 5IY0A 1SYFA 2EPBA 4KKTA 1EYCA 4OL7A 1DCZA 3M85A 3K5LA 3I8ZA 1B8AA 3TEHB 1B9MA 4GN4B 4GKKL 3K0YA 1D1KA 1F2LA 1XMQQ 3JAME 5JEAJ 4BA1I 2KQ3A 3CPFA 1EIFA 1Q12A 4EQNA 5D14A 4EX5A 1FVIA 4LK1C 1TXYA 1JWMD 4MN3A 4DR5L 1NNXA 1JOQA 1HNZQ 2JA9A 3WOFA 1YVCA 3JAML 2UXDL 3NE5B 1PTOC 3OW2A 3OYYA 3O13A 1JJGA 2K6AA 5C4XG 1CKNA 4RCOA 5BN3A 1BCPC 4ZK9B 4ZKCB 3FPUB 5IYCG 4KY7A 4L5SA 2B2YA 1H9JA 4DR6Q 3G6EA 3ULPA 4L5RC 1ZYRD 4DR3L 3Q22A 3M3YH 1R4PB 1HR0Q 3H3VI 4ZUJA 1LACA 3GDEA 2JA8B 1MIUA 1PRTF 1IW7D 4JBKA 2DGYA 5CV4A 1NE3A 4B3SQ 4KN7C 5E4WC 2F0VA 4UPAA 2K5NA 2EJMA 3CCQA 3F2UA 3L0OA 3NBHB 3DHQA 3CKIB 4LAAA 4J1MA 4N8X1 4A3FH 4JI8L 1L0YB 5LL6X 4JC0A 5C44H 1FGUA 1SE3A 1RDPD 1IW7C 5C0XJ 2RVLA 5JVG3 4DNIA 1A3VA 4IQZA 2KCMA 1QVFA 4IN3A 4FF4A 4X3SA 3MXNA 3W2DA 2XWBB 3HOZH 4K5VA 1HZ9A 2ZXRA 1ZEQX 3C1FA 4Y7NH 1L1OC 3I90A 2J0TD 3GTQH 1WCMH 4KKSA 5KYLA 2O4XA 4A3IB 3S14B 4ZCKA 1PH9A 2LSSA 2NVYH 3CRLC 4IJLA 4C1NI 4HJ8A 3CD6A 1CA6A 3KDFB 1XMOL 1QJOA 4A3EG 4DR4Q 1YHBA 1STBA 1Q90A 3U9SA 5IT9L 4DV5L 1SYCA 4GN5A 1X3FA 3EQLC 1Y1WB 1SMYD 3NBIA 3X3MA 3TSSA 1RTNA 1AE2A 4CKEA 3A5UA 1B7YB 3KDFA 4LNQA 2Q2HA 2OF1A 1C4QA 2WAQB 3QJYA 4B08A 1EOVA 3B6YA 4MTKA 3U4ZA 1FNVA 2FMMA 1GHKA 2EIFA 2QKIC 3KF8A 4JI8Q 4PZ8A 3SK8A 5KRUA 2R93G 2A73B 2C35B 2ENBA 1QZHA 5C3EG 2AQ2B 3J81c 1PFBA 4APVA 2PO4A 4DGZA 2G9DA 1WYDA 3UDXA 2RBMA 5GAHC 2A6HC 3AB9A 5EKIA 4P73A 3HOYG 2KHIA 1BUVT 5I2YA 4MZ9A 1F2YA 3FKIG 4LF8L 2BH8A 3J80c 2XVSA 4JPBW 1SMXA 2GVAA 4BBSG 1C7YA 4C56C 3QOJA 5IWAL 4ZUIA 5DAUA 3VR3A 1Q86C 1XTCD 3CMAA 4IPDA 1B44D 1K8MA 1DOLA 2B2WA 4GN3B 5IGBA 2I5MX 1AFPA 2EYOA 3HKZG 1PFMA 1K0SA 1QUQB 4X65L 2UXCL 2KCCA 3BG3A 3DWPA 4A3BH 1PZJD 2KJXA 1DONA 3ONAB 2CWAA 1PTOF 2RDFA 1WD1A 4QJFA 1P16A 1HNZL 1JC7A 3QR8A 4PQXA 2Q2UA 3OW7A 3E9HA 3R3OA 3WDNA 3EIVA 2TSSA 5M3FB 4JG2A 1NCVA 1Y8PB 1TWCH 1AP0A 1G2TA 3K7AH 4DR4L 1PH1A 4HJ5A 1HNXL 3CCUA 1F9SA 1LM0A 3HOVG 2QGQA 2WB1E 2WFWA 4IUTA 3STBD 5A35A 1N36L 4DAPA 2LS01 2F0EA 4A3DH 3MZ5A 4BA2I 3AEVA 1KIXA 4ZYSA 4A3BB 1D6EC 3KLSA 4DV6Q 3U9OA 1BBUA 2K04A 1JE5A 4LUZA 1B4OA 2BOSA 2OXPA 4IURA 1OTCA 1V8QA 3GTPB 5FJ8H 4DPGA 5IP7G 4DV1L 4RCNA 1TWAH 3E9IA 1M1KC 4MTNA 3C2PA 1FJGL 2ID0A 1VQLA 5GAEC 2EE1A 3A0JA 1BNZA 4ZLTF 1M4VA 1GD7A 1KDBA 2ES2A 1B3QA 5JPNC 2K1BA 1EWCA 3VR6A 2KEEA 2F0SA 4LFAL 1A15A 1Q8KA 1Y69U 1ESFA 4XT3B 5C5MA 1XNQL 4FF1A 2NVTB 2YTXA 2WAQG 3J81L 3J7ZC 4XYOA 2FMCA 2Z1CA 3S16B 3TN2A 2JK8A 3S2HH 4X64L 2Y0SE 5IGGA 3K6OA 4DN4M 4OWXB 1Q3LA 1WOCA 2OQKA 3HOZG 1LT6D 2MPMA 1SE8A 2BA1A 5C3EH 3BU2A 4GOPA 2PI2E 3P20A 1TWFB 2JA8H 1EY6A 3BYYB 4JI6L 2MO0A 1ZYRC 1XYIA 3PCOB 1E2ZA 4HIDA 1GUTA 1QCBD 3A54A 3BS1A 4C1NK 2ZTDA 1K28A 1PZKD 5ELDA 4HAEA 5C4XH 1XNQQ 1MGSA 2BDNA 1F2MA 1K0RA 3GTKH 1QNKA 2E8GA 3J7YW 5C4HA 1E2WA 1G51A 1DGSA 4NW2A 2F0DA 1JOKA 4A3BG 1I5FA 1JJ2A 4GZYC 2DY8A 2E2IB 1TIID 2G9HD 1NY4A 1YITA 1UNSA 2KCNA 1Y1WH 4DR5Q 5IP9G 1TS5A 2B8GA 4A3KB 1Y8OB 5JEAG 4YHHQ 2Z6BA 1VQOA 2O2LD 4HTHA 2ZTEA 5I9PA 3J81i 4DR1Q 1C0AA 1VQNA 1R9TH 3WOEA 1PTOD 4YY3Q 1IYVA 4WJWA 3H94A 2VL6A 2EJFC 4J15A 3K5MA 1PYSB 5ELCA 3STBC 3A5ZB 5DM73 1N36Q 2JA8G 1I4GA 2WKCA 3DEOA 2IX0A 1TVXA 5J1ZA 2Z6KC 3T1HQ 3GTLH 1CKMA 3D6CA 4BBSB 5IT9c 1HHVA 1D5XC 3S1NB 3PIPA 1G6PA 1GJXA 4CDFC 1EEID 4RGNA 2CKZB 2CFMA 5IGDA 1IBLQ 5BN4A 1VQJA 4IALA 2HD3A 3Q23A 2QA4A 3H3VH 4NXML 5KNCA 1FL0A 4C3HB 3L9AX 3ULJA 2PNHA 2XN9C 4QIWE 1IXRA 2IWHA 4POGA 5KYIA 4O1NA 4CGYB 5ELNA 1CT1D 2J4XA 3RUZA 4JOIA 4C3HG 2F4VL 3GTJB 3D4RA 1A2UA 4A3LG 2KEDA 3I2ZA 3CU7A 3NPPA 2JA7B 2ICIA 1RF2D 4O2DA 4OWWB 2CW0D 1X3GA 5M9OA 1PZID 1UE7A 2QDBA 4ALPA 1RHPA 1HFGA 1HR0L 5LL6S 1GUWA 4L8JA 1B3AA 1VQIA 1Y14B 4HIOA 4GKJQ 4HSPA 1Y8NB 1JQYD 1Q82C 3NP8A 3AFQA 4QIWB 1UE5A 2HCIA 1SJED 3HOXB 3S15H 3UDGA 2F3IA 2RCNA 5EGTA 5I6YA 4X3UA 5FLXE 1CSQA 4NDXA 3DEPA 3PUYA 1GHJA 4DR2L 1DZ1A 1T5XD 1PYWD 1SMYC 1LT5D 4DUZL 1T5EA 1C48A 1N9WA 3K59A 1QZGA 3TS0A 2F52A 4IPCA 1F9QA 3MA2B 3MFGA 3P7JA 4FXDA 2AWOA 2F0WA 3IL8A 4HMJA 3I91A 4A3DB 1CHPD 5M3MB 1HPCA 3F2DA 2KBNA 2E2HH 3PMFA 2NVTH 3K8AA 2IX1A 3S16H 3S1RB 1J9OA 3VYRA 3T13A 1WTWA 2JEBI 3KJPA 5KEEA 1QOHA 1CSPA 4NP5A 3L2PA 4DR3Q 1KC8C 3PF4A 4DV7L 1J8IA 2R7ZB 1XWEA 4IO9A 2NVQB 1RCVD 3RLFA 2UUCL 3ND9A 1RODA 4LF9Q 2F0FA 1U4RA 4OWTB 5T1IA 1G2SA 1OO9B 3MHBA 4LMQD 4BBRG 2YU9B 5LMNW 3DM3A 1L2FA 1LTTD 4LF5Q 4KHZA 2LXJA 3GTGH 1UWVA 4KI0A 1FR3A 2KCTA 1CZGA 1D5MC 4WORA 1LV9A 3I7FA 1O7LA 1A2TA 4DA2A 4YY3L 3EN2A 3TQYA 3ND8A 3L3OC 2F1MA 2BDOA 1VQCA 4C2MH 1SXTA 2DNEA 4AQYL 2DNCA 2UUBL 2E2IH 1HTPA 3UDIA 2VZAA 4S3SA 2MNAA 1V1OA 4KN4C 3NUCA 1B9NA 2K03A 1N34L 4B3TQ 1PH5A 2Y0SB 5D65A 4JI3Q 5TSSA 4FVMA 4JBWA 3VR2A 3X3NA 4MHEA 4R9WA 1PRTD 3I4MG 1SNPA 5M5XH 1ESRA 3BDLA 2A69D 4DNTB 1CFMA 1O7ZA 4ME3A 5EBDA 2UU9L 1CA5A 4A3JH 5C4JB 3BZDB 2ZM6L 2R7ZH 3HS0C 1A8VA 3CQZB 2TMPA 4RHSA 1HJPA 4DUYL 3AMUA 1X6OA 1CZWA 1YNXA 4RGTA 3OPOA 3PGZA 4A75A 5J3BA 3VYTA 1H9SA 5COYA 1VS0A 4BXXH 4ULLA 2ZXOA 2KA7A 4B3MQ 3BVZA 4UAIA 1XXGA 2EYPA 4C3HH 4XQQA 1ILPA 1I94L 4HJ9A 4RGMA 5M5WB 4LF6Q 3E0JA 2E5LQ 1KDCA 1KDAA 3OIQA 4N9TA 4AH6A 5GAGC 3JAMi 1H9SB 1N33L 2LY7A 4A3MB 2X6LA 5M3FG 3NELA 4UP9A 2PCFB 1IKMA 2K28A 2HT1A 3LNNA 1D5ZC 1X65A 1LT4D 2UUBQ 5I9OA 2R92H 2N3SA 3TBIB 4I65A 1A0IA 4P2CB 3OIPA 2H4OA 3A7AB 3DUZA 2B3GA 3PQIA 4DFAA 1K8OA 3NTKA 4NKLA 1ET6A 1FJGQ 3BDOA 3JC66 4GOPC 2DN8A 1E1TA 2JQOA 3M3YB 5I2XA 5I4DA 1IL2A 3OTOL 1STHA 2N88A 3GTKB 1HNWQ 2WP8J 1VF7A 4A3MH 2NZOA 1VQ5A 1M8AA 4FF2A 2UXBL 3SE0A 3NK9A 2F0JA 4P74A 1S4ZA 3T53B 3S2DH 1ONLA 3Q24A 4L6TB 1IBML 1Z47A 5CGKA 1MSHA 2Y0SG 2JA6B 2B2WC 4A3GG 3SEBA 1Q8IA 3H0GH 2Z0SA 2CWPA 3I3CA 4CJ1B 2JA5B 3D4WA 3DXJC 1KTKA 1MBYA 4FYDA 3GD7A 1E7ZA 4DU9A 4NMZA 2BA0A 4DV3Q 2UUCQ 1IKLA 3H3VC 1TWGH 5BR8L 4IFDG 2UXDQ 1JWUD 4A3IG 1EL0A 4A3EH 5FKAC 3PIP3 1AZPA 4DV0L 4K14A 1VQMA 3GP7A 1LUZA 1D1IA 1BKBA 2IX3A 1TWHB 1X3PA 3GTQB 3CCRA 1Y1WG 2UXBQ 2WAQE 1OXVA 4QL5A 3TP5A 2HCCA 1O78A 2V1CC 2B2VA 1EIHA 1TU2B 3EROA 2PW5A 1E3PA 2N55A 1LTLA 4CJ0B 3J7AF 1I3QH 2PYKA 3D0FA 2F0QA 2VS1A 3E6ZX 4JI1Q 5CBEE 1WJJA 1VQGA 2QDLA 3R8BA 4EQ5A 2ALYB 2RDGA 2A1AA 1MHWC 1TS2A 4QUCA 1KABA 4UP7A 4X3KA 1SEBD 4KY5A 3S1QH 1Q46A 1VQPA 4A3CH 4JV5L 1YEZA 3FP9A 3SVMA 5IODA 2XWJB 1KXLA 4R4CA 4R8IA 3UI2A 3ULLA 1J5EL 4ILWA 1BBWA 2K7VA 1BCPF 3HKSA 4NPSA 2YYZA 4YWKA 3TZUA 3CMEA 3RZDB 1HCZA 2I5HA 1HZAA 2SNMA 3BVMA 3HOWG 3PUXA 3LX0A 3CCSA 1Y1VB 4KTAA 2R3ZA 2MJ8A 3CP0A 1BR9A 2B2TA 1SYGA 1STYA 1HH2P 3KUPA 5C4ZA 3TZDA 1MD2D 1KRSA 3LWEA 3H15A 4HIKA 1EWHA 1PTOH 3M4QA 3KFUA 1CQFA 3I4MH 3KF6A 1O7YA 2B63B 5GROA 2Z4IA 1VQKA 1UUPA 3K5NA 2AKWB 1QG7A 1AE3A 4CDEC 3KLRA 1WVLA 1EIYB 2OEOA 1NBWA 1SYEA 1LTBD 2AHOB 3M4OB 5CBAE 3GTOB 2F0OA 4GNXB 3HOYB 4DR6L 3P75A 1TT2A 4C3JH 5D3IB 4KHPL 2Q8TA 4JI2Q 4EVOA 1HQRD 2K14A 4A3CG 1U0LA 1I6HH 4M1UB 5JOBA 3KJOA 4DUYQ 4LF6L 4UHVA 2A68D 4A3KG 4O0AA 4DK1A 3D3RA 2CQAA 4BBRB 4XT1B 2Z4HA 1V9PA 3TP8A 1IBKQ 3H0GB 3IFTA 1XNRL 1RD9D 2YTVA 2KVMA 4CDDC 4IPGA 5AJ3Q 2EYLA 1H9RA 3URYA 4DK0A 4LUVA 3TREA 4DF7A 1K8AC 2WIIB 2JA6G 5J22A 2K5VA 4LF7Q 1WTVA 1C9OA 1WTQA 2D5DA 1EIGA 2NYZD 1FYCA 2Q8IB 3CC2A 4UY8C 3S2HB 2NVYB 3J7A5 1GUNA 4ZKBB 1SDFA 5CMDA 4IUNA 5M5YB 1VDZA 5CV6A 3D6WA 1JICA 2HIXA 4LW1A 1SLJA 1TWHH 1UE1A 4JK1C 2M00A 1CI3M 1YHAA 3D4DA 5FLMG 1MI2A 1TWFH 1NMFA 1GM5A 4RA8A 2R93B 1N32L 4EQOA 2EYMA 1CQVA 1Q7YC 1JCKB 3AYHB 4CJ2C 2LFNA 4K8IA 3CPWA 2KOLA 4FDBA 3FPPA 3ER0A 5HGQA 1EY4A 4RKBA 2NUCA 1EQQA 1JMCA 3CCMA 2CH4W 1EZ6A 1SNMA 4JI4Q 3LGJA 5C44G 1PYBA 3M4YA 5IT9E 4KK7A 1LABA 5IE8A 5C6AA 1BCPD 1J6QA 1XPOA 1PV4A 3MVVA 1YBYA 3A8JE 1K3RA 4IOCA 2L1BA 5EPLA 4A3FB 1BVSA 2NZHA 4X66L 5EQ0A 1P8LA 4A4IA 3SK6A 3PO2H 4WFN3 5NUCA 2D2CC 1HUNA 2XRQD 4GKJL 2R7FA 2ZXPA 3TRZA 3G7LA 2RSNA 2K5WA 3PIOA 4BBRH 1ENCA 1GUSA 3RD4A 2OT2A 1EQVA 1S5FD 3BYTB 2VB2X 3Q8DA 4IUVA 2K01A 2XSCA 3QIAA 1H9MA 2NZ1D 4FNFA 1TWCB 3HOXG 4HJ7A 4OHJA 2BE5C 2NVXB 4JI4L 4QCLA 1FNWA 2JXMB 4LF8Q 4DV0Q 1HZBA 3C1EA 4LF5L 1YJNA 4G7HC 2EYHA 4JI0L 5IYBG 1HNXQ 4OONA 4K2KA 4BBSH 2B39A 3TP7A 1ICFB 2VY3A 3HZXA 3CQZH 1W6KA 1WTRA 1X3EA 3H09A 4C3JB 3RLNA 4DUZQ 1QB5D 2EXZA 4LJZC 4AYBE 4X62L 1BDOA 4A93B 1NR2A 4IUQA 4LFBQ 3A8KE 3OHXC 2PQEA 3BZKA 1I3QB 1NMGA 2NVQH 1XPUA 1G291 1RJTA 2K32A 4RWSC 4LF7L 2A5HA 5GQOA 1EYAA 5F2DA 1LT3D 3BVGA 5E7NA 3TDQA 3NXWA 3SGIA 2L4NA 1PXUA 2E2JB 1Y1VG 2F0NA 1HXYD 1CTMA 1AW7A 3PO2B 2CVRA 5FOBB 3I56A 1C8CA 4H0LC 1QNUA 1YIJA 1WTXA 1G91A 1F2ZA 3NTHA 2K50A 2RHSB 4BS9A 4DV6L 4I7ZC 2OCEA 4NXNL 4H13C 5AFWA 4IUUA 4BY1H 2DJGC 1A62A 1KLUD 1TWAB 1NAPA 5IYBH 5A2QL 4MNOA 2NN6H 4LFCL 4K0KQ 3H91A 3I73A 4DR7L 3IFDA 1PRTB 4B9XA 1SNDA 1YNJD 1CUKA 1KAWA 1V1PB 4LWCA 4B3RQ 1ICWA 1EYGA 3M9BA 3MXPA 1SE2A 4U68A 2AWNA 4M8AA 2UUAQ 1XTDA 4R4OA 3V05A 4XQNA 2Q2TA 4AYBB 5HGTA 4JBMA 2VNUD 4ABNA 2WV6D 2YTYA 5ELOA 4H02A 3RZDH 1WD0A 2L5TA 2C5CA 3PF5A 1EY8A 2MGSA 5C0XI 1E1OA 3F2CA 5JJKA 3C46A 4BY7B 3CCLA 1LTAD 4Q0FA 4A3DG 3NTIA 3ERSX 2A8VA 1AEXA 4K0KL 1HA5A 3I4MB 5EPJA 3Q0AA 4KKUA 4YWLA 2E2JH 2K75A 1VCIA 4X66Q 3DLLA 3PO3B 1E0BA 4QB4A 2QILA 5JJZA 2YU9H 5EKKA 4YWMA 1CKNB 4G7ZC 4JI7L 3GTMH 4TKOB 1GUGA 2R6GA 4YCVA 1JORA 4DAMA 1KRTA 2IW3A 2OTJA 1H95A 1R9TB 4DAVA 2DUDA 1YZ6A 4G7OC 2HDLA 5D3DA 3S1RH 2R7DA 5ELBA 3NHHA 5LHY1 4BY1B 2RQXA 2O5JC 5C44B 2EXDA 1IBMQ 1LTSD 5L37A 3MWYW 1S3OA 4RH6A 2Z6KA 1II3A 3KBGA 1ASZA 1BQQT 1JOOA 3WWVA 3HOUH 1ENFA 1QUQA 2A68C 3PUVA 1PLFA 2Z8LA 4B3ML 2PI2A 2GA4B 2BCOA 1UEAB 3GTGB 3DM1A 2B2TC 5EKLA 2K4KA 1K73C 2R7ZG 4RGOS 1Z7TA 4R4TA 3HRZC 4Y7NB 3J7AV 2EOTA 1Q1BA 3UE1A 1TWGB 4DV4L 3S17B 4CKCA 3HEJA 1U9RA 3W3AA 4QF4A 3MC0B 1B53A 2QEXA 5IWAQ 2KECA 4YCUA 1JWSD 2PZTA 3ITPA 2CW0C 2SNSA 2VQFQ 2EY5A 4ID6A 4JV5Q 2VUMB 1Z6HA 4EQPA 4NXNQ 4RMFA 4C3IG 4QUFA 5M3FH 1WTOA 4FXGC 2F0TA 1TR5A 3NSWA 1ZXTA 4RAUC 2OWOA 4CBVA 4V190 2H1EA 5M5XB 5IGEA 4GNXA 3T1YL 1LTRD 3S14H 4KY6A 1KHIA 1CM9A 1I4PA 1LTGD 2NN6G 2CCZA 1VMPA 3BDCA 2JA7H 3M7GA 1SSOA 1HA6A 2WINB 2VUMH 3EJIA 5AJ3L 1S5DD 1STGA 4V0BA 4OIKA 1AN8A 2JJQA 2RA4A 3BJUA 3RN2A 1HR0W 4C2MB 5C3EB 3N52A 2NVXH 1YNNC 3K0XA 4UP8A 5CV9A 4P75A 3S17H 4WJ3M 2F3VA 5C5LA 1TQOA 3HOZB 5LMUL 5BN5A 2MQHA 2B63H 4OGQC 1ML0D 5EBCA 3VR5A 1K3BC 3NQTA 2VQEL 1BXTA 2AQ3B 1SNQA 2B8FA 4X65Q 2UXCQ 3FKIH 4QY7A 4HJAA 1VQAA 3MTSA 4FXKC 3E5SA 3SDZA 4GKKQ 4TSSA 4A3IH 4JI3L 1PH7A 3GTOH 1UAPA 2JA6H 3KLSX 3G48A 5J39A 3SHLA 2OQ0A 4ZQ3A 3PUZA 2I46A 2JN4A 2NBFA 3A55A 3OMCA 3T4AC 1F9PA 1X55A 5C4JH 1SYDA 1TS4A 2QF7A 5E4XA 1VQ9A 4FP5D 2XNAC 4OEMB 5IGCA 3VR4A 5FLXL 2FFKB 3F2BA 3D31A 2HHHL 3HOUG 3SR1A 1JJCB 3FRPB 1W3SA 2F0LA 1GO3E 2GN5A 2EJGC 1DJRD 2R92G 1LTID 3S24A 3CCVA 1STEA 3UE0A 1OXXK 3NEMA 1QWYA 2B2VC 4P71A 4MIUA 5HURA 4A3LH 2M9VA 4JI5Q 3T56B 4EGVA 4TRDA 1W2BA 3RZOH 1EFID 2X69A 3HGBA 4LF4L 3OOCA 1HQMC 4NB3A 4JI6Q 3C3LA 3GTLB 3KLWA 4GLAC 3V2TA 3K7AB 4A3JG 4KMUC 4JCVE 4A3MG 3DMUA 4KD3A 2R93H 5E1FA 5IGFA 1NR4A 4LFAQ 4A3EB 3IRBA 3MAQA 4C3IH 2F0MA 2F0PA 2PZWA 3IKJA 1PRTC 1E22A 1HRJA 3OMGA 3P1HA 5FO8B 2JSOA 4DV5Q 4K8JA 4HR7B 1PH3A 3GTMB 1AH9A 3EA6A 1N8RC 2FHTA 2B2UA 3LWUA 2FJ2A 1OXSC 3TMEA 2F0HA 1A3TA 2PQAA 1K9MC 1SRUA 1YNND 4DV7Q 4XYQA 4GLXA 1D8LA 3QB3A 2PW7A 1XX8A 1WCMG 4J6HA 4HSVA 1MSGA 1D7QA 1GVPA 1U4LA 4KHVA 3S1NH 2VQEQ 2N78A 4AIMA 4QGUA 4LUOA 2PQAB 4AYBG 1VQFA 4PMBA 3ICEA 1HUMA 4RKLA 4NXMQ 3I4LA 4PMWA 1GKHA 1PFNA 1EQTA 4YCWA 1H9KA 2IT1A 1U4MA 3I4NH 2VUMG 4XQJA 1LYLA 5M5WH 1KAAA 4JVZA 4PNYA 4YHHL 4GS3A 1VQ6A 1A3UA 4GOPB 1KL9A 5KIXA 1KLGD 4F87A 3GTJH 1I6HB 2PMZE 3V96A 4J8QA 4KJOA 4WRDA 5CC4A 2HQEA 4RG1A 2R92B 3OWFA 2JYOA 2ZJQA 2XIWA 5DLQE 5C0XG 1SE4A 3H6MA 1U5KA 1DXMA 1YNJC 1B50A 1E24A 2D62A 2DJFC 1B70B 1DYQA 1QE6A 3HOWB 4JOIC 5C4XB 3I4NB 3U4VA 2XGTA 1PH6A 1PVOA 4DV2L 2DY7A 4DXFA 2K33A 1SN8A 3QOLA 1VMCA 2QW7A 3S1QB 4OO1I 5JPMC 1VQ7A 3K80C 2QCPX 1SBBB 2ZJRA 4HCEA 3OTOQ 1BOSA 2NTSA 2N49A 5IP9H 4HN7A 1B1ZA 4JYAQ 4CHTB 1WI5A 2ZJPA 2GVBA 5DNFA 3F1ZA 3HKZB 2H5XA 1MJCA 2MO1A 3CCJA 1EY9A 1IBLL 2AMCB 3PO3H 1PFSA 1I4XA 3HKZE 5M3MG 5IYDH 4DAYB 3AQQA 1VQEA 1D2BA 1PA6A 4A3GB 1PTOB 1MJEA 4N8FA 3T1HL 4OIJA 5LMUQ 1LLRD 2F4VQ 4C3IB 4OO1H 4LF4Q 3F8TA 4A93G 3A8IE 4N9PA 1L1OA 4A3JB 4BXXG 1JT8A 3R2IA 1MKHA 3T16A 3EVQA 4DAYA 4DR1L 4CDCC 2K52A 2B63G 1G8ZD 1NTGA 3KBXA 1I50H 3KOJA 1YI2A 1YJ9A 2AQ1B 5GADC 3W1BA 1S72A 2BE5D 4DKAC 2NTTA 2F0GA 1XPRA 1L1OB 3HOWH 1IHZA 1ILQA 2ICEC 2M2LA 4R4IA 2L11A 5ELEA 2PMZB 1T9HA 2VW9A 1SR3A 1KNEA 2F4IA 4O42A 4Z9CB 4BWGB 4XDXA 5T1GA 3NQIA 3ZYYX 1IYJB 1K83H 1QVCA 1EQRA 5A2QE 4P72A 4HEDA 1R4QB 4UDUC 1XMQL 3A7LA 3T51B 1JB7A 3RZOB 2E2DC 1TY0A 5FO9B 3G71A 3GTPH 2RF4A 4IJHA 2G5DA 1V43A 3MXNB 1WTPA 1E2VA 4RFBA 4L5QA 3U58A 1Q1EA 4X6AH 2MHVA 3RR5A 2HQLA 1WTHA 2IHFA 4Y52H 2IHEA 1STAA 2EY6A 3J80L 4Q5VA 4DK6C 1VQHA 3UDFA 3Q6SA 2ZT9C 2L9HA 3VYUA 5LMNQ 2B29A 2C9OA 4K6DA 1K83B 3ZJYC 1YJWA 2A6EC 4ME5A 2JP1A 4XXEA 4GLVB 1X54A 3CAMA 1UEBA 5KNBA 2D0PA 1QVGA 1HZCA 1I94Q 4DR7Q 4G57A 3OWEB 4PZ7A 2IY5B 2E76C 2HIVA 3RMHA 5JEAH 3K7UC 3NENA 5JVH3 1EUJA 1PHJA 1QILA 3BZCA 1EOTA 1KQSA 2UUAL 4F7XA 1EYDA 3MEFA 3FDTA 3PV0A 4DR2Q 1VQ4A 2IJ0A 5EJWA 3J81j 2B2UC 3KYHC 4K6LA 5M3MH 3N6RA 5IYDG 4C3JG 3KF8B 3TP6A 2KUMA 1K8GA 1EFWA 1GUOA 1V1QA 1YHQA 1IYUA 1V1PA 5C3WA 1TS3A 1EY0A 1SNCA 1EZ8A 3DWQA 4JI5L 4F8MA 3M7NA 4JI2L 5CV8A 2EYJA 1DOMA 1EU3A 2HUGA 2KENA 2EDGA 1SYBA 3FMCA 3GV3A 1Q81C 1PH8A 4WJ4A 1A63A 3HG9A 2ASBA 2K05A 1HFNA 3W5OA 4PZ6A 1N33Q 2JE6I 3HFZB 1XJVA 4DV3L 4K2LA 1Z9FA 3HOVH 1O7IA 4KD4A 5I6WA 2L12A 3EFXD 4R1JA 3RN5A 4JI0Q 2RSOA 4A93H 5DEHA 2PZUA 2JEAI 2LMCB 4A3KH 2A69C 3HP3A 2WB1G 4K5XA 4X3TA 5DM63 3EBEA 2RHQB 3VA5A 4XTCS 2XRSD 3VYSA 3RNUA 3S1MB 1JR0D 5CR3A 5M5YH 3JAMc 1I4HA 1ASYA 4ODGA 2VQFL 4LFCQ 5H1SE 3I55A 4R8NA 3K57A 5K36H 2F03A 3S9WA 3A74A 3K5OA 3E0EA 4B3RL 5ELFA 1N32Q 4POFA 4E6IA 4QQBX 1VQ8A 5FLMH 1SAPA 1JE4A 1CKOA 5FLXc 2EYFA 4PMCA 2FINB 2K5HA 4K5WA 5CV5A 3SXHA 5LMNL 2NB0A 4PV1C 2LXKA 4H44C 4AQYQ 3L7ZC 3CHBD 5CYUA 2OTLA 2L0CA 4OX9L 4JW0A 1PDQA 3R93A 3CF5A 2Q8RE 3PIO3 4L5TA 4FO2A 2N8NA 1I6VC 1XMOQ 2MUYA 1X9NA 4R4QA 3A56A 4ZRZA 5FO7B 1GXDC 3NBHA 1JB3A 4IFDI 1S40A 2A6ED 2EVBA 3QG1A 4IFDJ 1NUCA 5G3LF 1U4PA 4OELB 2NN6I 4IZ8A 4GNXC 1L0WA 3CW2C 1L0XB 4BY1G 4KJNA 1X3QA 4DNRB 5K36G 3NWSA 4DXGA 3K58A 2D9UA 4DV1Q 4LFBL 1OXTA 1DM0B 3GV6A 2WACA 2I0QA 3HOXH 3FEWX 3S15B 2RKSA 3AFPA 1B2TA 3DWAA 4TVAB 3G4SA 1EU4A 3VA7A 1NJIC 3KF6B 1SFOH 5FK9C 2O5IC 2E74C 2KHJA 3I4OA 1DD2A 1PH4A 3CC7A 2MFIA 4JI7Q 1RTOA 4JI1L 1BCPB 2F0KA 5HY6A 2I07B 4X62Q 4IUPA 1F77A 3U50C 4FF3A 4H7BA 4CKBA 2A74C 3HOVB 4A76A 4HCSA 3PO2G 2VB3X 3I72A 1STNA 3KK7A 4KV6A 5KGUA 1TY2A 3H0GG 2ZTCA 3K81C 2WKDA 4JBJA 1IBKL 1SFOB 2CQOA 3ERQA 5IYCH 4G4KA 3HOYH
chains in the Genus database with same CATH topology
3J7ZC 3HKSA 3RZOH 2JK8A 3S1MH 2FXQA 4NPSA 2YYZA 3S2HH 2JA5H 4YWKA 4X64L 3CMEA 2Y0SE 2I5HA 1HZAA 1HNWL 4LF4L 2HHHQ 3HOWG 4LF9L 3PUXA 3CCSA 4OWXB 4NB3A 3VDYA 1WOCA 2OQKA 1J5EQ 4DV2Q 4JI6Q 3HOZG 3CP0A 3KLWA 4GLAC 1SE8A 4BY7H 2BA1A 5C3EH 3CCEA 4A3JG 3BU2A 1HH2P 4GOPA 2PI2E 3H15A 1KRSA 4JCVE 2YV5A 4HIKA 4A3MG 1EWIA 2JA8H 3M4QA 2R93H 3KFUA 4LFAQ 4JI6L 3I4MH 3KF6A 2MO0A 3IRBA 3PCOB 4C3IH 5JJIA 4HIDA 5GROA 1E22A 1VQKA 4DV5Q 1AH9A 2AKWB 1PH3A 1AE3A 1N8RC 1UE6A 1EIYB 2ZTDA 1OXSC 2BH2A 1PH2A 5C4XH 1NBWA 1XNQQ 2AHOB 2PQAA 1K9MC 5JJLA 1SRUA 2UU9Q 4GNXB 4DV7Q 4DR6L 4C3JH 1K0RA 4GLXA 4KHPL 3GTKH 1D8LA 4HIMA 2E8GA 3CXCA 1G51A 1DGSA 1WCMG 4JI2Q 2K14A 4A3CG 1U0LA 1I6HH 4A3BG 1I5FA 1Y1VH 1JJ2A 3KJOA 1RL2A 1GVPA 4DUYQ 2E5LL 4LF6L 1D7QA 4A3KG 4O0AA 3I4NG 3S1NH 2VQEQ 2N78A 4AIMA 4QGUA 1NY4A 1YITA 4LUOA 4XIGS 2PQAB 4A3FG 4AYBG 1VQFA 1V9PA 1IBKQ 1XNRL 3ICEA 1OXUA 2YTVA 4NXMQ 4IPGA 5AJ3Q 1WFQA 4PMWA 5C0XI 4DR5Q 1GKHA 1Y1WH 3GO5A 3PUWA 4LUVA 3TREA 5IP9G 4YCWA 1K8AC 4YHHQ 5JEAG 2JA6G 2IT1A 1VQOA 2ZTEA 4DR1Q 3J81i 2EQSA 2K5VA 3I4NH 4LF7Q 1VQNA 1C0AA 1R9TH 1C9OA 2VUMG 4A3GH 4YY3Q 1VQDA 4IOAA 3CC2A 2VL6A 1LYLA 5M5WH 2ZM6Q 4YHHL 4J15A 4GS3A 4UY8C 1VQ6A 1PYSB 4GOPB 3STBC 3A5ZB 1N36Q 2JA8G 3J7A5 1KL9A 2IX0A 4DR7Q 2Z6KC 3GTJH 3T1HQ 3GTLH 1SROA 2HIXA 4LW1A 1SLJA 2PMZE 1TWHH 1CKMA 1UE1A 1YHAA 5IT9c 5FLMG 1TWFH 3PIPA 1G6PA 1RIPA 3CC4A 1NMFA 4RG1A 1GM5A 4PG3A 2CKZB 1N32L 2CFMA 2ZJQA 1IBLQ 4OX9Q 5DLQE 5C0XG 1Q7YC 1VQJA 3AYHB 4OXPA 1U5KA 3RLOA 2QA4A 1E24A 3CPWA 4FDBA 2D62A 3ER0A 1B70B 2Q2IA 4NXML 5HGQA 1EQQA 1JMCA 3H3VH 4DK3C 1FL0A 4JYAL 2XTIA 3CCMA 4JI4Q 2D0OA 3LGJA 4JOIC 1PYBA 5C44G 3U4VA 2XGTA 1PH6A 4B3SL 3ULJA 1PVOA 2PNHA 1X56A 4DV2L 5IE8A 1J6QA 1XPOA 1SN8A 1PV4A 1YBYA 4IOCA 1K3RA 3M4PA 4QIWE 1IXRA 4TQUS 4POGA 3W1GA 4X64Q 4OO1I 1IZ6A 1VQ7A 2I5LX 3K80C 5ELNA 1BVSA 2NZHA 4X66L 1P8LA 3PSIA 4JOIA 4A4IA 2F4VL 2ZJRA 1N34Q 4B3TL 3PO2H 3OTOQ 3T1YQ 5IP9H 2N49A 4GKJL 4A3LG 5JJKA 2R7FA 3TRZA 3I2ZA 3PIOA 4BBRH 3J80i 4JYAQ 1WI5A 4O2DA 5EAYA 2ZJPA 2GVBA 4OWWB 3F1ZA 1KD1C 1X3GA 2H5XA 1MJCA 4OO1G 2MO1A 1UE7A 3CCJA 2ATWA 1IBLL 2AMCB 1VQBA 1PFSA 2A19A 3Q8DA 4DV4Q 3PO3H 4ALPA 3HKZE 4KLKA 5M3MG 4DAYB 5IYDH 3AQQA 3FHWA 4BY7G 1VQEA 1HR0L 3HOXG 1PA6A 5IP7H 5FJ8G 3TS2A 4HJ7A 4JI4L 4IPHA 1MJEA 3T1HL 2JA5G 1VQIA 1Y14B 4HIOA 4LF8Q 4GKJQ 2L15A 5LMUQ 1HZBA 4DV0Q 2F4VQ 4LF5L 1XNRQ 1Q82C 4LF4Q 5BR8Q 1YJNA 3F8TA 2JA7G 4A93G 4JI0L 3PO3G 3AFQA 5IYBG 1UE5A 4OONA 1HNXQ 3S15H 1L1OA 3UDGA 2F3IA 4BXXG 1JT8A 2RCNA 1MKHA 4BBSH 1M90C 2VY3A 3CQZH 4DR1L 1CSQA 3M4OH 2K52A 1X3EA 2B63G 3PUYA 5IY0A 1NTGA 3RLNA 4DUZQ 4X62L 1I50H 4AYBE 3KOJA 3M85A 4DR2L 1YI2A 1YJ9A 1B8AA 3W1BA 5GADC 3TEHB 1S72A 4DKAC 4DUZL 4LFBQ 3BZKA 4GN4B 1XPRA 4GKKL 1NMGA 1L1OB 3HOWH 1XMQQ 2NVQH 1XPUA 4KHPQ 1N9WA 5JEAJ 4BA1I 1G291 1QZGA 3CPFA 4R4IA 1EIFA 1Q12A 3TS0A 4LF7L 5GQOA 2F52A 4EX5A 1FVIA 1T9HA 2VW9A 5E7NA 1SR3A 4IPCA 3SGIA 1TXYA 1Y1VG 4DR5L 2AWOA 1HNZQ 1BBWA 2JA9A 3I56A 1YVCA 2UXDL 1YIJA 1IYJB 3F2DA 3OW2A 3OYYA 1K83H 2KBNA 2E2HH 1QVCA 1EQRA 2NVTH 4P72A 3K8AA 1JJGA 2K50A 2RHSB 1CKNA 4DV6L 1XMQL 1JB7A 2IX1A 5C4XG 3S16H 2OCEA 4NXNL 3G71A 5IYCG 2JEBI 3KJPA 3GTPH 2RF4A 4L5SA 1CSPA 4IJHA 3L2PA 4BY1H 4DR3Q 1A62A 1KC8C 4DV7L 3PF4A 4DR6Q 1V43A 3MXNB 3G6EA 4IO9A 5IYBH 3ULPA 4L5QA 4MNOA 4LFCL 3U58A 1Q1EA 4L5RC 4K0KQ 4DR3L 3RLFA 3M3YH 2UUCL 1HR0Q 4X6AH 3H3VI 3RR5A 3GDEA 4LF9Q 1MIUA 2HQLA 4DR7L 4OWTB 1CUKA 1KAWA 2IHFA 2IHEA 4JBKA 2DGYA 4LWCA 4Y52H 4B3RQ 1NE3A 4BBRG 1EYGA 3M9BA 5LMNW 3DM3A 1L2FA 4LF5Q 4KHZA 2LXJA 2AWNA 4DK6C 1VQHA 3UDFA 2UUAQ 4B3SQ 3GTGH 1UWVA 4KI0A 2K5NA 4UPAA 1XTDA 5LMNQ 2B29A 4R4OA 2Q2TA 2KCTA 3CCQA 3L0OA 3NBHB 4JBMA 2VNUD 2YTYA 5ELOA 4H02A 3ZJYC 3RZDH 4A3FH 1YJWA 4JI8L 3I7FA 3PF5A 4JC0A 4GLVB 1X54A 1FGUA 1UEBA 1E1OA 2D0PA 3CAMA 1HZCA 3EN2A 4YY3L 3TQYA 3F2CA 1QVGA 1I94Q 5C0XJ 3CCLA 4PZ7A 4DNIA 2IY5B 1VQCA 2HIVA 4C2MH 4A3DG 4AQYL 5C44H 3K7UC 3NENA 2UUBL 3ERSX 2KCMA 3UDIA 1EUJA 2E2IH 2VZAA 1QVFA 1PHJA 2A8VA 2MNAA 4K0KL 3BZCA 1KQSA 2UUAL 1N34L 4B3TQ 4YWLA 2E2JH 2K75A 3MEFA 3PV0A 1VCIA 4DR2Q 1VQ4A 4X66Q 1PH5A 1HZ9A 3J81j 3DLLA 3HOZH 3GTMH 2YU9H 4JI3Q 4JI7L 4YWMA 1CKNB 4JBWA 3KYHC 5M3MH 5IYDG 3KF8B 1K8GA 2R6GA 1EFWA 4Y7NH 1V1QA 4YCVA 1L1OC 1YHQA 4DAMA 1KRTA 3GTQH 3I4MG 2OTJA 1H95A 1WCMH 2DUDA 5M5XH 4JI5L 3M7NA 1YZ6A 4JI2L 3S1RH 2R7DA 2KENA 1PH8A 1PH9A 1A63A 4WJ4A 1Q81C 2LSSA 2NVYH 4IJLA 4ME3A 4HJ8A 2UU9L 2ASBA 3W5OA 3CD6A 4A3JH 4PZ6A 3KDFB 1N33Q 2EXDA 1XMOL 2JE6I 3HFZB 2ZM6L 1IBMQ 1XJVA 2R7ZH 1S3OA 4DV3L 4A3EG 1A8VA 2Z6KA 1Z9FA 3HOVH 4DR4Q 1O7IA 1YHBA 1ASZA 1HJPA 4DUYL 1X6OA 1YNXA 4DV5L 3PGZA 3WWVA 3HOUH 4A75A 5J3BA 4R1JA 3RN5A 4JI0Q 4GN5A 1X3FA 1QUQA 3PUVA 4A93H 1VS0A 4B3ML 4BXXH 2JEAI 2PI2A 4A3KH 1AE2A 4B3MQ 3A5UA 1B7YB 2R7ZG 2K4KA 3KDFA 1K73C 4LNQA 2Q2HA 4R4TA 4C3HH 2WB1G 1Q1BA 3UE1A 1EOVA 3B6YA 3U4ZA 4HJ9A 1I94L 4LF6Q 3EBEA 4DV4L 2E5LQ 2EIFA 2RHQB 3JAMi 4XTCS 4AH6A 5GAGC 3RNUA 1N33L 4JI8Q 4PZ8A 2R93G 2QEXA 5M5YH 5IWAQ 3JAMc 2C35B 4YCUA 5M3FG 3NELA 1ASYA 4UP9A 1QZHA 2VQFL 2HT1A 4LFCQ 5H1SE 3I55A 5C3EG 1X65A 3J81c 4APVA 2UUBQ 2VQFQ 2R92H 3A74A 2N3SA 1WYDA 4JV5Q 1A0IA 3E0EA 4NXNQ 2B3GA 3UDXA 5GAHC 4B3RL 4RMFA 1N32Q 4P73A 4POFA 5M3FH 4QQBX 1VQ8A 3HOYG 5FLMH 2KHIA 1FJGQ 3JC66 4GOPC 4MZ9A 2OWOA 1CKOA 3FKIG 1E1TA 4LF8L 2BH8A 5FLXc 3J80c 2JQOA 2K5HA 1SMXA 5LMNL 2GVAA 4BBSG 4GNXA 2LXKA 4AQYQ 1C7YA 1IL2A 3OTOL 3T1YL 5IWAL 3L7ZC 3S14H 1Q86C 3CMAA 1HNWQ 1KHIA 4IPDA 2WP8J 4GN3B 2OTLA 2I5MX 4A3MH 2NZOA 3HKZG 1VQ5A 4OX9L 2NN6G 1QUQB 4X65L 2CCZA 2UXCL 4A3BH 2UXBL 3CF5A 4P74A 4L5TA 3S2DH 2N8NA 1XMOQ 1IBML 1X9NA 2JA7H 1Z47A 4R4QA 2CWAA 2Y0SG 4QJFA 1P16A 1HNZL 2VUMH 4A3GG 4IFDI 1S40A 5AJ3L 2Q2UA 3H0GH 4IFDJ 2Z0SA 2CWPA 3E9HA 3EIVA 2NN6I 4GNXC 4JG2A 1L0WA 3CW2C 2JJQA 3BJUA 3RN2A 1HR0W 1TWCH 3GD7A 1E7ZA 4BY1G 3K7AH 4DR4L 1PH1A 2NVXH 2BA0A 4DV3Q 4HJ5A 2UUCQ 1HNXL 3K0XA 4UP8A 3CCUA 1TWGH 5K36G 1LM0A 4P75A 5BR8L 3S17H 4DV1Q 4A3IG 4IFDG 4LFBL 2UXDQ 4WJ3M 1OXTA 4A3EH 3HOVG 2QGQA 2WB1E 2WFWA 5LMUL 4DV0L 3STBD 2MQHA 1N36L 2I0QA 2B63H 3HOXH 1VQMA 4A3DH 3AFPA 4BA2I 3AEVA 1KIXA 4TVAB 1LUZA 3G4SA 1BKBA 4DV6Q 3KF6B 2VQEL 1SFOH 1NJIC 1BBUA 3CCRA 1Y1WG 2UXBQ 2WAQE 1JE5A 4X65Q 4LUZA 2UXCQ 1OXVA 3FKIH 4QL5A 2KHJA 3I4OA 4QY7A 4HJAA 1VQAA 4GKKQ 1PH4A 2V1CC 2MFIA 4JI3L 3CC7A 4A3IH 4JI1L 1PH7A 4JI7Q 1OTCA 3G48A 2JA6H 3GTOH 1E3PA 2OQ0A 3PUZA 1LTLA 5HY6A 1X55A 5C4JH 4X62Q 1I3QH 3D0FA 5FJ8H 3U50C 4DPGA 5IP7G 2VS1A 4DV1L 1VQ9A 4JI1Q 1TWAH 3E9IA 1M1KC 1WJJA 1VQGA 3F2BA 4EQ5A 4MTNA 2ALYB 4A76A 1FJGL 3PO2G 2ID0A 1VQLA 5GAEC 3D31A 2HHHL 2A1AA 3HOUG 3A0JA 1JJCB 4UP7A 1GD7A 2ES2A 1W3SA 3S1QH 1Q46A 1GO3E 2GN5A 1VQPA 4A3CH 2R92G 4JV5L 1YEZA 3FP9A 3H0GG 4LFAL 3S24A 2ZTCA 3CCVA 3K81C 3UE0A 1OXXK 3NEMA 1Q8KA 4JBJA 4P71A 1KXLA 1IBKL 1XNQL 4R4CA 4A3LH 4JI5Q 2CQOA 1W2BA 5IYCH 2YTXA 3ULLA 3HOYH 1J5EL 2WAQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7Z C;  3HKS A;  3RZO H;  2JK8 A;  3S1M H;  2FXQ A;  4NPS A;  2YYZ A;  3S2H H;  2JA5 H;  4YWK A;  4X64 L;  3CME A;  2Y0S E;  2I5H A;  1HZA A;  1HNW L;  4LF4 L;  2HHH Q;  3HOW G;  4LF9 L;  3PUX A;  3CCS A;  4OWX B;  4NB3 A;  3VDY A;  1WOC A;  2OQK A;  1J5E Q;  4DV2 Q;  4JI6 Q;  3HOZ G;  3CP0 A;  3KLW A;  4GLA C;  1SE8 A;  4BY7 H;  2BA1 A;  5C3E H;  3CCE A;  4A3J G;  3BU2 A;  1HH2 P;  4GOP A;  2PI2 E;  3H15 A;  1KRS A;  4JCV E;  2YV5 A;  4HIK A;  4A3M G;  1EWI A;  2JA8 H;  3M4Q A;  2R93 H;  3KFU A;  4LFA Q;  4JI6 L;  3I4M H;  3KF6 A;  2MO0 A;  3IRB A;  3PCO B;  4C3I H;  5JJI A;  4HID A;  5GRO A;  1E22 A;  1VQK A;  4DV5 Q;  1AH9 A;  2AKW B;  1PH3 A;  1AE3 A;  1N8R C;  1UE6 A;  1EIY B;  2ZTD A;  1OXS C;  2BH2 A;  1PH2 A;  5C4X H;  1NBW A;  1XNQ Q;  2AHO B;  2PQA A;  1K9M C;  5JJL A;  1SRU A;  2UU9 Q;  4GNX B;  4DV7 Q;  4DR6 L;  4C3J H;  1K0R A;  4GLX A;  4KHP L;  3GTK H;  1D8L A;  4HIM A;  2E8G A;  3CXC A;  1G51 A;  1DGS A;  1WCM G;  4JI2 Q;  2K14 A;  4A3C G;  1U0L A;  1I6H H;  4A3B G;  1I5F A;  1Y1V H;  1JJ2 A;  3KJO A;  1RL2 A;  1GVP A;  4DUY Q;  2E5L L;  4LF6 L;  1D7Q A;  4A3K G;  4O0A A;  3I4N G;  3S1N H;  2VQE Q;  2N78 A;  4AIM A;  4QGU A;  1NY4 A;  1YIT A;  4LUO A;  4XIG S;  2PQA B;  4A3F G;  4AYB G;  1VQF A;  1V9P A;  1IBK Q;  1XNR L;  3ICE A;  1OXU A;  2YTV A;  4NXM Q;  4IPG A;  5AJ3 Q;  1WFQ A;  4PMW A;  5C0X I;  4DR5 Q;  1GKH A;  1Y1W H;  3GO5 A;  3PUW A;  4LUV A;  3TRE A;  5IP9 G;  4YCW A;  1K8A C;  4YHH Q;  5JEA G;  2JA6 G;  2IT1 A;  1VQO A;  2ZTE A;  4DR1 Q;  3J81 i;  2EQS A;  2K5V A;  3I4N H;  4LF7 Q;  1VQN A;  1C0A A;  1R9T H;  1C9O A;  2VUM G;  4A3G H;  4YY3 Q;  1VQD A;  4IOA A;  3CC2 A;  2VL6 A;  1LYL A;  5M5W H;  2ZM6 Q;  4YHH L;  4J15 A;  4GS3 A;  4UY8 C;  1VQ6 A;  1PYS B;  4GOP B;  3STB C;  3A5Z B;  1N36 Q;  2JA8 G;  3J7A 5;  1KL9 A;  2IX0 A;  4DR7 Q;  2Z6K C;  3GTJ H;  3T1H Q;  3GTL H;  1SRO A;  2HIX A;  4LW1 A;  1SLJ A;  2PMZ E;  1TWH H;  1CKM A;  1UE1 A;  1YHA A;  5IT9 c;  5FLM G;  1TWF H;  3PIP A;  1G6P A;  1RIP A;  3CC4 A;  1NMF A;  4RG1 A;  1GM5 A;  4PG3 A;  2CKZ B;  1N32 L;  2CFM A;  2ZJQ A;  1IBL Q;  4OX9 Q;  5DLQ E;  5C0X G;  1Q7Y C;  1VQJ A;  3AYH B;  4OXP A;  1U5K A;  3RLO A;  2QA4 A;  1E24 A;  3CPW A;  4FDB A;  2D62 A;  3ER0 A;  1B70 B;  2Q2I A;  4NXM L;  5HGQ A;  1EQQ A;  1JMC A;  3H3V H;  4DK3 C;  1FL0 A;  4JYA L;  2XTI A;  3CCM A;  4JI4 Q;  2D0O A;  3LGJ A;  4JOI C;  1PYB A;  5C44 G;  3U4V A;  2XGT A;  1PH6 A;  4B3S L;  3ULJ A;  1PVO A;  2PNH A;  1X56 A;  4DV2 L;  5IE8 A;  1J6Q A;  1XPO A;  1SN8 A;  1PV4 A;  1YBY A;  4IOC A;  1K3R A;  3M4P A;  4QIW E;  1IXR A;  4TQU S;  4POG A;  3W1G A;  4X64 Q;  4OO1 I;  1IZ6 A;  1VQ7 A;  2I5L X;  3K80 C;  5ELN A;  1BVS A;  2NZH A;  4X66 L;  1P8L A;  3PSI A;  4JOI A;  4A4I A;  2F4V L;  2ZJR A;  1N34 Q;  4B3T L;  3PO2 H;  3OTO Q;  3T1Y Q;  5IP9 H;  2N49 A;  4GKJ L;  4A3L G;  5JJK A;  2R7F A;  3TRZ A;  3I2Z A;  3PIO A;  4BBR H;  3J80 i;  4JYA Q;  1WI5 A;  4O2D A;  5EAY A;  2ZJP A;  2GVB A;  4OWW B;  3F1Z A;  1KD1 C;  1X3G A;  2H5X A;  1MJC A;  4OO1 G;  2MO1 A;  1UE7 A;  3CCJ A;  2ATW A;  1IBL L;  2AMC B;  1VQB A;  1PFS A;  2A19 A;  3Q8D A;  4DV4 Q;  3PO3 H;  4ALP A;  3HKZ E;  4KLK A;  5M3M G;  4DAY B;  5IYD H;  3AQQ A;  3FHW A;  4BY7 G;  1VQE A;  1HR0 L;  3HOX G;  1PA6 A;  5IP7 H;  5FJ8 G;  3TS2 A;  4HJ7 A;  4JI4 L;  4IPH A;  1MJE A;  3T1H L;  2JA5 G;  1VQI A;  1Y14 B;  4HIO A;  4LF8 Q;  4GKJ Q;  2L15 A;  5LMU Q;  1HZB A;  4DV0 Q;  2F4V Q;  4LF5 L;  1XNR Q;  1Q82 C;  4LF4 Q;  5BR8 Q;  1YJN A;  3F8T A;  2JA7 G;  4A93 G;  4JI0 L;  3PO3 G;  3AFQ A;  5IYB G;  1UE5 A;  4OON A;  1HNX Q;  3S15 H;  1L1O A;  3UDG A;  2F3I A;  4BXX G;  1JT8 A;  2RCN A;  1MKH A;  4BBS H;  1M90 C;  2VY3 A;  3CQZ H;  4DR1 L;  1CSQ A;  3M4O H;  2K52 A;  1X3E A;  2B63 G;  3PUY A;  5IY0 A;  1NTG A;  3RLN A;  4DUZ Q;  4X62 L;  1I50 H;  4AYB E;  3KOJ A;  3M85 A;  4DR2 L;  1YI2 A;  1YJ9 A;  1B8A A;  3W1B A;  5GAD C;  3TEH B;  1S72 A;  4DKA C;  4DUZ L;  4LFB Q;  3BZK A;  4GN4 B;  1XPR A;  4GKK L;  1NMG A;  1L1O B;  3HOW H;  1XMQ Q;  2NVQ H;  1XPU A;  4KHP Q;  1N9W A;  5JEA J;  4BA1 I;  1G29 1;  1QZG A;  3CPF A;  4R4I A;  1EIF A;  1Q12 A;  3TS0 A;  4LF7 L;  5GQO A;  2F52 A;  4EX5 A;  1FVI A;  1T9H A;  2VW9 A;  5E7N A;  1SR3 A;  4IPC A;  3SGI A;  1TXY A;  1Y1V G;  4DR5 L;  2AWO A;  1HNZ Q;  1BBW A;  2JA9 A;  3I56 A;  1YVC A;  2UXD L;  1YIJ A;  1IYJ B;  3F2D A;  3OW2 A;  3OYY A;  1K83 H;  2KBN A;  2E2H H;  1QVC A;  1EQR A;  2NVT H;  4P72 A;  3K8A A;  1JJG A;  2K50 A;  2RHS B;  1CKN A;  4DV6 L;  1XMQ L;  1JB7 A;  2IX1 A;  5C4X G;  3S16 H;  2OCE A;  4NXN L;  3G71 A;  5IYC G;  2JEB I;  3KJP A;  3GTP H;  2RF4 A;  4L5S A;  1CSP A;  4IJH A;  3L2P A;  4BY1 H;  4DR3 Q;  1A62 A;  1KC8 C;  4DV7 L;  3PF4 A;  4DR6 Q;  1V43 A;  3MXN B;  3G6E A;  4IO9 A;  5IYB H;  3ULP A;  4L5Q A;  4MNO A;  4LFC L;  3U58 A;  1Q1E A;  4L5R C;  4K0K Q;  4DR3 L;  3RLF A;  3M3Y H;  2UUC L;  1HR0 Q;  4X6A H;  3H3V I;  3RR5 A;  3GDE A;  4LF9 Q;  1MIU A;  2HQL A;  4DR7 L;  4OWT B;  1CUK A;  1KAW A;  2IHF A;  2IHE A;  4JBK A;  2DGY A;  4LWC A;  4Y52 H;  4B3R Q;  1NE3 A;  4BBR G;  1EYG A;  3M9B A;  5LMN W;  3DM3 A;  1L2F A;  4LF5 Q;  4KHZ A;  2LXJ A;  2AWN A;  4DK6 C;  1VQH A;  3UDF A;  2UUA Q;  4B3S Q;  3GTG H;  1UWV A;  4KI0 A;  2K5N A;  4UPA A;  1XTD A;  5LMN Q;  2B29 A;  4R4O A;  2Q2T A;  2KCT A;  3CCQ A;  3L0O A;  3NBH B;  4JBM A;  2VNU D;  2YTY A;  5ELO A;  4H02 A;  3ZJY C;  3RZD H;  4A3F H;  1YJW A;  4JI8 L;  3I7F A;  3PF5 A;  4JC0 A;  4GLV B;  1X54 A;  1FGU A;  1UEB A;  1E1O A;  2D0P A;  3CAM A;  1HZC A;  3EN2 A;  4YY3 L;  3TQY A;  3F2C A;  1QVG A;  1I94 Q;  5C0X J;  3CCL A;  4PZ7 A;  4DNI A;  2IY5 B;  1VQC A;  2HIV A;  4C2M H;  4A3D G;  4AQY L;  5C44 H;  3K7U C;  3NEN A;  2UUB L;  3ERS X;  2KCM A;  3UDI A;  1EUJ A;  2E2I H;  2VZA A;  1QVF A;  1PHJ A;  2A8V A;  2MNA A;  4K0K L;  3BZC A;  1KQS A;  2UUA L;  1N34 L;  4B3T Q;  4YWL A;  2E2J H;  2K75 A;  3MEF A;  3PV0 A;  1VCI A;  4DR2 Q;  1VQ4 A;  4X66 Q;  1PH5 A;  1HZ9 A;  3J81 j;  3DLL A;  3HOZ H;  3GTM H;  2YU9 H;  4JI3 Q;  4JI7 L;  4YWM A;  1CKN B;  4JBW A;  3KYH C;  5M3M H;  5IYD G;  3KF8 B;  1K8G A;  2R6G A;  1EFW A;  4Y7N H;  1V1Q A;  4YCV A;  1L1O C;  1YHQ A;  4DAM A;  1KRT A;  3GTQ H;  3I4M G;  2OTJ A;  1H95 A;  1WCM H;  2DUD A;  5M5X H;  4JI5 L;  3M7N A;  1YZ6 A;  4JI2 L;  3S1R H;  2R7D A;  2KEN A;  1PH8 A;  1PH9 A;  1A63 A;  4WJ4 A;  1Q81 C;  2LSS A;  2NVY H;  4IJL A;  4ME3 A;  4HJ8 A;  2UU9 L;  2ASB A;  3W5O A;  3CD6 A;  4A3J H;  4PZ6 A;  3KDF B;  1N33 Q;  2EXD A;  1XMO L;  2JE6 I;  3HFZ B;  2ZM6 L;  1IBM Q;  1XJV A;  2R7Z H;  1S3O A;  4DV3 L;  4A3E G;  1A8V A;  2Z6K A;  1Z9F A;  3HOV H;  4DR4 Q;  1O7I A;  1YHB A;  1ASZ A;  1HJP A;  4DUY L;  1X6O A;  1YNX A;  4DV5 L;  3PGZ A;  3WWV A;  3HOU H;  4A75 A;  5J3B A;  4R1J A;  3RN5 A;  4JI0 Q;  4GN5 A;  1X3F A;  1QUQ A;  3PUV A;  4A93 H;  1VS0 A;  4B3M L;  4BXX H;  2JEA I;  2PI2 A;  4A3K H;  1AE2 A;  4B3M Q;  3A5U A;  1B7Y B;  2R7Z G;  2K4K A;  3KDF A;  1K73 C;  4LNQ A;  2Q2H A;  4R4T A;  4C3H H;  2WB1 G;  1Q1B A;  3UE1 A;  1EOV A;  3B6Y A;  3U4Z A;  4HJ9 A;  1I94 L;  4LF6 Q;  3EBE A;  4DV4 L;  2E5L Q;  2EIF A;  2RHQ B;  3JAM i;  4XTC S;  4AH6 A;  5GAG C;  3RNU A;  1N33 L;  4JI8 Q;  4PZ8 A;  2R93 G;  2QEX A;  5M5Y H;  5IWA Q;  3JAM c;  2C35 B;  4YCU A;  5M3F G;  3NEL A;  1ASY A;  4UP9 A;  1QZH A;  2VQF L;  2HT1 A;  4LFC Q;  5H1S E;  3I55 A;  5C3E G;  1X65 A;  3J81 c;  4APV A;  2UUB Q;  2VQF Q;  2R92 H;  3A74 A;  2N3S A;  1WYD A;  4JV5 Q;  1A0I A;  3E0E A;  4NXN Q;  2B3G A;  3UDX A;  5GAH C;  4B3R L;  4RMF A;  1N32 Q;  4P73 A;  4POF A;  5M3F H;  4QQB X;  1VQ8 A;  3HOY G;  5FLM H;  2KHI A;  1FJG Q;  3JC6 6;  4GOP C;  4MZ9 A;  2OWO A;  1CKO A;  3FKI G;  1E1T A;  4LF8 L;  2BH8 A;  5FLX c;  3J80 c;  2JQO A;  2K5H A;  1SMX A;  5LMN L;  2GVA A;  4BBS G;  4GNX A;  2LXK A;  4AQY Q;  1C7Y A;  1IL2 A;  3OTO L;  3T1Y L;  5IWA L;  3L7Z C;  3S14 H;  1Q86 C;  3CMA A;  1HNW Q;  1KHI A;  4IPD A;  2WP8 J;  4GN3 B;  2OTL A;  2I5M X;  4A3M H;  2NZO A;  3HKZ G;  1VQ5 A;  4OX9 L;  2NN6 G;  1QUQ B;  4X65 L;  2CCZ A;  2UXC L;  4A3B H;  2UXB L;  3CF5 A;  4P74 A;  4L5T A;  3S2D H;  2N8N A;  1XMO Q;  1IBM L;  1X9N A;  2JA7 H;  1Z47 A;  4R4Q A;  2CWA A;  2Y0S G;  4QJF A;  1P16 A;  1HNZ L;  2VUM H;  4A3G G;  4IFD I;  1S40 A;  5AJ3 L;  2Q2U A;  3H0G H;  4IFD J;  2Z0S A;  2CWP A;  3E9H A;  3EIV A;  2NN6 I;  4GNX C;  4JG2 A;  1L0W A;  3CW2 C;  2JJQ A;  3BJU A;  3RN2 A;  1HR0 W;  1TWC H;  3GD7 A;  1E7Z A;  4BY1 G;  3K7A H;  4DR4 L;  1PH1 A;  2NVX H;  2BA0 A;  4DV3 Q;  4HJ5 A;  2UUC Q;  1HNX L;  3K0X A;  4UP8 A;  3CCU A;  1TWG H;  5K36 G;  1LM0 A;  4P75 A;  5BR8 L;  3S17 H;  4DV1 Q;  4A3I G;  4IFD G;  4LFB L;  2UXD Q;  4WJ3 M;  1OXT A;  4A3E H;  3HOV G;  2QGQ A;  2WB1 E;  2WFW A;  5LMU L;  4DV0 L;  3STB D;  2MQH A;  1N36 L;  2I0Q A;  2B63 H;  3HOX H;  1VQM A;  4A3D H;  3AFP A;  4BA2 I;  3AEV A;  1KIX A;  4TVA B;  1LUZ A;  3G4S A;  1BKB A;  4DV6 Q;  3KF6 B;  2VQE L;  1SFO H;  1NJI C;  1BBU A;  3CCR A;  1Y1W G;  2UXB Q;  2WAQ E;  1JE5 A;  4X65 Q;  4LUZ A;  2UXC Q;  1OXV A;  3FKI H;  4QL5 A;  2KHJ A;  3I4O A;  4QY7 A;  4HJA A;  1VQA A;  4GKK Q;  1PH4 A;  2V1C C;  2MFI A;  4JI3 L;  3CC7 A;  4A3I H;  4JI1 L;  1PH7 A;  4JI7 Q;  1OTC A;  3G48 A;  2JA6 H;  3GTO H;  1E3P A;  2OQ0 A;  3PUZ A;  1LTL A;  5HY6 A;  1X55 A;  5C4J H;  4X62 Q;  1I3Q H;  3D0F A;  5FJ8 H;  3U50 C;  4DPG A;  5IP7 G;  2VS1 A;  4DV1 L;  1VQ9 A;  4JI1 Q;  1TWA H;  3E9I A;  1M1K C;  1WJJ A;  1VQG A;  3F2B A;  4EQ5 A;  4MTN A;  2ALY B;  4A76 A;  1FJG L;  3PO2 G;  2ID0 A;  1VQL A;  5GAE C;  3D31 A;  2HHH L;  2A1A A;  3HOU G;  3A0J A;  1JJC B;  4UP7 A;  1GD7 A;  2ES2 A;  1W3S A;  3S1Q H;  1Q46 A;  1GO3 E;  2GN5 A;  1VQP A;  4A3C H;  2R92 G;  4JV5 L;  1YEZ A;  3FP9 A;  3H0G G;  4LFA L;  3S24 A;  2ZTC A;  3CCV A;  3K81 C;  3UE0 A;  1OXX K;  3NEM A;  1Q8K A;  4JBJ A;  4P71 A;  1KXL A;  1IBK L;  1XNQ L;  4R4C A;  4A3L H;  4JI5 Q;  2CQO A;  1W2B A;  5IYC H;  2YTX A;  3ULL A;  3HOY H;  1J5E L;  2WAQ G; 
#chains in the Genus database with same CATH topology
 2EY2 A;  4B9W A;  1NSN S;  1SNO A;  3S1M H;  2FXQ A;  2JA5 H;  4IFD H;  3AU7 A;  3NWT A;  4QMG A;  2V4D A;  3MXU A;  1HNW L;  1KNA A;  2HHH Q;  4LF9 L;  1I4Q A;  3VDY A;  1J5E Q;  1FGB D;  2P5Z X;  4DV2 Q;  1S5E D;  2AUJ D;  1ENA A;  4BY7 H;  3CCE A;  2WB1 B;  4ZAI A;  4F88 A;  3J81 E;  2K5Q A;  1EEF D;  2YV5 A;  1EWI A;  1O80 A;  5JJI A;  3OSO A;  2IPK D;  1CHQ D;  1AZQ A;  2NWG A;  2RDH A;  3SK5 A;  4U67 3;  1UE6 A;  2BH2 A;  1PH2 A;  3FKI B;  2SOB A;  5JJL A;  4I7A A;  1HTL D;  1G6Z A;  2UU9 Q;  2RCF A;  2E75 C;  1FNU A;  1DOK A;  4HIM A;  3CXC A;  3IAY A;  1TKW B;  3J80 E;  2KHS A;  4L63 B;  1Y1V H;  2E5L L;  1RL2 A;  3MXG A;  2IL8 A;  3I4N G;  5ISR A;  2L55 A;  2K5D A;  4XIG S;  4A3F G;  2CHB D;  3SK4 A;  1BF4 A;  1OXU A;  1WFQ A;  4RHR A;  2B2Y C;  3GO5 A;  3PUW A;  5E3F A;  1S5C D;  2EQS A;  2J7Z A;  2PPB C;  4A3G H;  1IL8 A;  2E2H B;  1VQD A;  4IOA A;  5CV7 A;  2ZM6 Q;  5C0X H;  2LKV A;  5IIF A;  1ZKO A;  1SRO A;  2VXW A;  1RKN A;  2F0U A;  1BO0 A;  1W6J A;  1RIP A;  2MP1 A;  3CC4 A;  3HOU B;  3D8G A;  2AUK A;  4PG3 A;  3QWN A;  3GQB A;  4OX9 Q;  1A6X A;  2R61 A;  1X32 A;  4OXP A;  2PNR C;  3RLO A;  3G6J B;  4KHP Q;  2Q2I A;  1VF5 C;  1EY5 A;  4JYA L;  4DK3 C;  2XTI A;  1EY7 A;  2QEJ C;  2D0O A;  2EZV A;  4B3S L;  1X56 A;  1F9R A;  1FD7 D;  1I4R A;  3M4P A;  4TQU S;  2SEB D;  3W1G A;  5EPK A;  4X64 Q;  1IZ6 A;  2I5L X;  5COR A;  3PSI A;  1N34 Q;  4B3T L;  3T1Y Q;  3QO2 A;  1LO5 D;  3S2D B;  1S5B D;  5KND A;  3J80 i;  2F3W A;  5EAY A;  1I50 B;  1KD1 C;  4YIJ A;  4OO1 G;  2F0I A;  3FVQ A;  3MFY A;  5C3X A;  5IOC A;  2CH4 A;  2ATW A;  1VQB A;  2A19 A;  4DV4 Q;  4KLK A;  2X6G A;  1GOZ A;  1SJH D;  2Z9H A;  2A6H D;  2HDM A;  3FHW A;  3R2T A;  4BY7 G;  1BBX C;  5K5P A;  1CK1 A;  3E3X A;  5IP7 H;  5FJ8 G;  3TS2 A;  3MEH A;  1WCM B;  4IPH A;  2JA5 G;  2SDF A;  5G3L D;  2L15 A;  3CRK C;  1XNR Q;  1ET9 A;  5BR8 Q;  1PMR A;  2JA7 G;  5JAV A;  3PO3 G;  2EY1 A;  3I70 A;  4HMI A;  1M90 C;  3M4O H;  5IY0 A;  1SYF A;  2EPB A;  4KKT A;  1EYC A;  4OL7 A;  1DCZ A;  3M85 A;  3K5L A;  3I8Z A;  1B8A A;  3TEH B;  1B9M A;  4GN4 B;  4GKK L;  3K0Y A;  1D1K A;  1F2L A;  1XMQ Q;  3JAM E;  5JEA J;  4BA1 I;  2KQ3 A;  3CPF A;  1EIF A;  1Q12 A;  4EQN A;  5D14 A;  4EX5 A;  1FVI A;  4LK1 C;  1TXY A;  1JWM D;  4MN3 A;  4DR5 L;  1NNX A;  1JOQ A;  1HNZ Q;  2JA9 A;  3WOF A;  1YVC A;  3JAM L;  2UXD L;  3NE5 B;  1PTO C;  3OW2 A;  3OYY A;  3O13 A;  1JJG A;  2K6A A;  5C4X G;  1CKN A;  4RCO A;  5BN3 A;  1BCP C;  4ZK9 B;  4ZKC B;  3FPU B;  5IYC G;  4KY7 A;  4L5S A;  2B2Y A;  1H9J A;  4DR6 Q;  3G6E A;  3ULP A;  4L5R C;  1ZYR D;  4DR3 L;  3Q22 A;  3M3Y H;  1R4P B;  1HR0 Q;  3H3V I;  4ZUJ A;  1LAC A;  3GDE A;  2JA8 B;  1MIU A;  1PRT F;  1IW7 D;  4JBK A;  2DGY A;  5CV4 A;  1NE3 A;  4B3S Q;  4KN7 C;  5E4W C;  2F0V A;  4UPA A;  2K5N A;  2EJM A;  3CCQ A;  3F2U A;  3L0O A;  3NBH B;  3DHQ A;  3CKI B;  4LAA A;  4J1M A;  4N8X 1;  4A3F H;  4JI8 L;  1L0Y B;  5LL6 X;  4JC0 A;  5C44 H;  1FGU A;  1SE3 A;  1RDP D;  1IW7 C;  5C0X J;  2RVL A;  5JVG 3;  4DNI A;  1A3V A;  4IQZ A;  2KCM A;  1QVF A;  4IN3 A;  4FF4 A;  4X3S A;  3MXN A;  3W2D A;  2XWB B;  3HOZ H;  4K5V A;  1HZ9 A;  2ZXR A;  1ZEQ X;  3C1F A;  4Y7N H;  1L1O C;  3I90 A;  2J0T D;  3GTQ H;  1WCM H;  4KKS A;  5KYL A;  2O4X A;  4A3I B;  3S14 B;  4ZCK A;  1PH9 A;  2LSS A;  2NVY H;  3CRL C;  4IJL A;  4C1N I;  4HJ8 A;  3CD6 A;  1CA6 A;  3KDF B;  1XMO L;  1QJO A;  4A3E G;  4DR4 Q;  1YHB A;  1STB A;  1Q90 A;  3U9S A;  5IT9 L;  4DV5 L;  1SYC A;  4GN5 A;  1X3F A;  3EQL C;  1Y1W B;  1SMY D;  3NBI A;  3X3M A;  3TSS A;  1RTN A;  1AE2 A;  4CKE A;  3A5U A;  1B7Y B;  3KDF A;  4LNQ A;  2Q2H A;  2OF1 A;  1C4Q A;  2WAQ B;  3QJY A;  4B08 A;  1EOV A;  3B6Y A;  4MTK A;  3U4Z A;  1FNV A;  2FMM A;  1GHK A;  2EIF A;  2QKI C;  3KF8 A;  4JI8 Q;  4PZ8 A;  3SK8 A;  5KRU A;  2R93 G;  2A73 B;  2C35 B;  2ENB A;  1QZH A;  5C3E G;  2AQ2 B;  3J81 c;  1PFB A;  4APV A;  2PO4 A;  4DGZ A;  2G9D A;  1WYD A;  3UDX A;  2RBM A;  5GAH C;  2A6H C;  3AB9 A;  5EKI A;  4P73 A;  3HOY G;  2KHI A;  1BUV T;  5I2Y A;  4MZ9 A;  1F2Y A;  3FKI G;  4LF8 L;  2BH8 A;  3J80 c;  2XVS A;  4JPB W;  1SMX A;  2GVA A;  4BBS G;  1C7Y A;  4C56 C;  3QOJ A;  5IWA L;  4ZUI A;  5DAU A;  3VR3 A;  1Q86 C;  1XTC D;  3CMA A;  4IPD A;  1B44 D;  1K8M A;  1DOL A;  2B2W A;  4GN3 B;  5IGB A;  2I5M X;  1AFP A;  2EYO A;  3HKZ G;  1PFM A;  1K0S A;  1QUQ B;  4X65 L;  2UXC L;  2KCC A;  3BG3 A;  3DWP A;  4A3B H;  1PZJ D;  2KJX A;  1DON A;  3ONA B;  2CWA A;  1PTO F;  2RDF A;  1WD1 A;  4QJF A;  1P16 A;  1HNZ L;  1JC7 A;  3QR8 A;  4PQX A;  2Q2U A;  3OW7 A;  3E9H A;  3R3O A;  3WDN A;  3EIV A;  2TSS A;  5M3F B;  4JG2 A;  1NCV A;  1Y8P B;  1TWC H;  1AP0 A;  1G2T A;  3K7A H;  4DR4 L;  1PH1 A;  4HJ5 A;  1HNX L;  3CCU A;  1F9S A;  1LM0 A;  3HOV G;  2QGQ A;  2WB1 E;  2WFW A;  4IUT A;  3STB D;  5A35 A;  1N36 L;  4DAP A;  2LS0 1;  2F0E A;  4A3D H;  3MZ5 A;  4BA2 I;  3AEV A;  1KIX A;  4ZYS A;  4A3B B;  1D6E C;  3KLS A;  4DV6 Q;  3U9O A;  1BBU A;  2K04 A;  1JE5 A;  4LUZ A;  1B4O A;  2BOS A;  2OXP A;  4IUR A;  1OTC A;  1V8Q A;  3GTP B;  5FJ8 H;  4DPG A;  5IP7 G;  4DV1 L;  4RCN A;  1TWA H;  3E9I A;  1M1K C;  4MTN A;  3C2P A;  1FJG L;  2ID0 A;  1VQL A;  5GAE C;  2EE1 A;  3A0J A;  1BNZ A;  4ZLT F;  1M4V A;  1GD7 A;  1KDB A;  2ES2 A;  1B3Q A;  5JPN C;  2K1B A;  1EWC A;  3VR6 A;  2KEE A;  2F0S A;  4LFA L;  1A15 A;  1Q8K A;  1Y69 U;  1ESF A;  4XT3 B;  5C5M A;  1XNQ L;  4FF1 A;  2NVT B;  2YTX A;  2WAQ G;  3J81 L;  3J7Z C;  4XYO A;  2FMC A;  2Z1C A;  3S16 B;  3TN2 A;  2JK8 A;  3S2H H;  4X64 L;  2Y0S E;  5IGG A;  3K6O A;  4DN4 M;  4OWX B;  1Q3L A;  1WOC A;  2OQK A;  3HOZ G;  1LT6 D;  2MPM A;  1SE8 A;  2BA1 A;  5C3E H;  3BU2 A;  4GOP A;  2PI2 E;  3P20 A;  1TWF B;  2JA8 H;  1EY6 A;  3BYY B;  4JI6 L;  2MO0 A;  1ZYR C;  1XYI A;  3PCO B;  1E2Z A;  4HID A;  1GUT A;  1QCB D;  3A54 A;  3BS1 A;  4C1N K;  2ZTD A;  1K28 A;  1PZK D;  5ELD A;  4HAE A;  5C4X H;  1XNQ Q;  1MGS A;  2BDN A;  1F2M A;  1K0R A;  3GTK H;  1QNK A;  2E8G A;  3J7Y W;  5C4H A;  1E2W A;  1G51 A;  1DGS A;  4NW2 A;  2F0D A;  1JOK A;  4A3B G;  1I5F A;  1JJ2 A;  4GZY C;  2DY8 A;  2E2I B;  1TII D;  2G9H D;  1NY4 A;  1YIT A;  1UNS A;  2KCN A;  1Y1W H;  4DR5 Q;  5IP9 G;  1TS5 A;  2B8G A;  4A3K B;  1Y8O B;  5JEA G;  4YHH Q;  2Z6B A;  1VQO A;  2O2L D;  4HTH A;  2ZTE A;  5I9P A;  3J81 i;  4DR1 Q;  1C0A A;  1VQN A;  1R9T H;  3WOE A;  1PTO D;  4YY3 Q;  1IYV A;  4WJW A;  3H94 A;  2VL6 A;  2EJF C;  4J15 A;  3K5M A;  1PYS B;  5ELC A;  3STB C;  3A5Z B;  5DM7 3;  1N36 Q;  2JA8 G;  1I4G A;  2WKC A;  3DEO A;  2IX0 A;  1TVX A;  5J1Z A;  2Z6K C;  3T1H Q;  3GTL H;  1CKM A;  3D6C A;  4BBS B;  5IT9 c;  1HHV A;  1D5X C;  3S1N B;  3PIP A;  1G6P A;  1GJX A;  4CDF C;  1EEI D;  4RGN A;  2CKZ B;  2CFM A;  5IGD A;  1IBL Q;  5BN4 A;  1VQJ A;  4IAL A;  2HD3 A;  3Q23 A;  2QA4 A;  3H3V H;  4NXM L;  5KNC A;  1FL0 A;  4C3H B;  3L9A X;  3ULJ A;  2PNH A;  2XN9 C;  4QIW E;  1IXR A;  2IWH A;  4POG A;  5KYI A;  4O1N A;  4CGY B;  5ELN A;  1CT1 D;  2J4X A;  3RUZ A;  4JOI A;  4C3H G;  2F4V L;  3GTJ B;  3D4R A;  1A2U A;  4A3L G;  2KED A;  3I2Z A;  3CU7 A;  3NPP A;  2JA7 B;  2ICI A;  1RF2 D;  4O2D A;  4OWW B;  2CW0 D;  1X3G A;  5M9O A;  1PZI D;  1UE7 A;  2QDB A;  4ALP A;  1RHP A;  1HFG A;  1HR0 L;  5LL6 S;  1GUW A;  4L8J A;  1B3A A;  1VQI A;  1Y14 B;  4HIO A;  4GKJ Q;  4HSP A;  1Y8N B;  1JQY D;  1Q82 C;  3NP8 A;  3AFQ A;  4QIW B;  1UE5 A;  2HCI A;  1SJE D;  3HOX B;  3S15 H;  3UDG A;  2F3I A;  2RCN A;  5EGT A;  5I6Y A;  4X3U A;  5FLX E;  1CSQ A;  4NDX A;  3DEP A;  3PUY A;  1GHJ A;  4DR2 L;  1DZ1 A;  1T5X D;  1PYW D;  1SMY C;  1LT5 D;  4DUZ L;  1T5E A;  1C48 A;  1N9W A;  3K59 A;  1QZG A;  3TS0 A;  2F52 A;  4IPC A;  1F9Q A;  3MA2 B;  3MFG A;  3P7J A;  4FXD A;  2AWO A;  2F0W A;  3IL8 A;  4HMJ A;  3I91 A;  4A3D B;  1CHP D;  5M3M B;  1HPC A;  3F2D A;  2KBN A;  2E2H H;  3PMF A;  2NVT H;  3K8A A;  2IX1 A;  3S16 H;  3S1R B;  1J9O A;  3VYR A;  3T13 A;  1WTW A;  2JEB I;  3KJP A;  5KEE A;  1QOH A;  1CSP A;  4NP5 A;  3L2P A;  4DR3 Q;  1KC8 C;  3PF4 A;  4DV7 L;  1J8I A;  2R7Z B;  1XWE A;  4IO9 A;  2NVQ B;  1RCV D;  3RLF A;  2UUC L;  3ND9 A;  1ROD A;  4LF9 Q;  2F0F A;  1U4R A;  4OWT B;  5T1I A;  1G2S A;  1OO9 B;  3MHB A;  4LMQ D;  4BBR G;  2YU9 B;  5LMN W;  3DM3 A;  1L2F A;  1LTT D;  4LF5 Q;  4KHZ A;  2LXJ A;  3GTG H;  1UWV A;  4KI0 A;  1FR3 A;  2KCT A;  1CZG A;  1D5M C;  4WOR A;  1LV9 A;  3I7F A;  1O7L A;  1A2T A;  4DA2 A;  4YY3 L;  3EN2 A;  3TQY A;  3ND8 A;  3L3O C;  2F1M A;  2BDO A;  1VQC A;  4C2M H;  1SXT A;  2DNE A;  4AQY L;  2DNC A;  2UUB L;  2E2I H;  1HTP A;  3UDI A;  2VZA A;  4S3S A;  2MNA A;  1V1O A;  4KN4 C;  3NUC A;  1B9N A;  2K03 A;  1N34 L;  4B3T Q;  1PH5 A;  2Y0S B;  5D65 A;  4JI3 Q;  5TSS A;  4FVM A;  4JBW A;  3VR2 A;  3X3N A;  4MHE A;  4R9W A;  1PRT D;  3I4M G;  1SNP A;  5M5X H;  1ESR A;  3BDL A;  2A69 D;  4DNT B;  1CFM A;  1O7Z A;  4ME3 A;  5EBD A;  2UU9 L;  1CA5 A;  4A3J H;  5C4J B;  3BZD B;  2ZM6 L;  2R7Z H;  3HS0 C;  1A8V A;  3CQZ B;  2TMP A;  4RHS A;  1HJP A;  4DUY L;  3AMU A;  1X6O A;  1CZW A;  1YNX A;  4RGT A;  3OPO A;  3PGZ A;  4A75 A;  5J3B A;  3VYT A;  1H9S A;  5COY A;  1VS0 A;  4BXX H;  4ULL A;  2ZXO A;  2KA7 A;  4B3M Q;  3BVZ A;  4UAI A;  1XXG A;  2EYP A;  4C3H H;  4XQQ A;  1ILP A;  1I94 L;  4HJ9 A;  4RGM A;  5M5W B;  4LF6 Q;  3E0J A;  2E5L Q;  1KDC A;  1KDA A;  3OIQ A;  4N9T A;  4AH6 A;  5GAG C;  3JAM i;  1H9S B;  1N33 L;  2LY7 A;  4A3M B;  2X6L A;  5M3F G;  3NEL A;  4UP9 A;  2PCF B;  1IKM A;  2K28 A;  2HT1 A;  3LNN A;  1D5Z C;  1X65 A;  1LT4 D;  2UUB Q;  5I9O A;  2R92 H;  2N3S A;  3TBI B;  4I65 A;  1A0I A;  4P2C B;  3OIP A;  2H4O A;  3A7A B;  3DUZ A;  2B3G A;  3PQI A;  4DFA A;  1K8O A;  3NTK A;  4NKL A;  1ET6 A;  1FJG Q;  3BDO A;  3JC6 6;  4GOP C;  2DN8 A;  1E1T A;  2JQO A;  3M3Y B;  5I2X A;  5I4D A;  1IL2 A;  3OTO L;  1STH A;  2N88 A;  3GTK B;  1HNW Q;  2WP8 J;  1VF7 A;  4A3M H;  2NZO A;  1VQ5 A;  1M8A A;  4FF2 A;  2UXB L;  3SE0 A;  3NK9 A;  2F0J A;  4P74 A;  1S4Z A;  3T53 B;  3S2D H;  1ONL A;  3Q24 A;  4L6T B;  1IBM L;  1Z47 A;  5CGK A;  1MSH A;  2Y0S G;  2JA6 B;  2B2W C;  4A3G G;  3SEB A;  1Q8I A;  3H0G H;  2Z0S A;  2CWP A;  3I3C A;  4CJ1 B;  2JA5 B;  3D4W A;  3DXJ C;  1KTK A;  1MBY A;  4FYD A;  3GD7 A;  1E7Z A;  4DU9 A;  4NMZ A;  2BA0 A;  4DV3 Q;  2UUC Q;  1IKL A;  3H3V C;  1TWG H;  5BR8 L;  4IFD G;  2UXD Q;  1JWU D;  4A3I G;  1EL0 A;  4A3E H;  5FKA C;  3PIP 3;  1AZP A;  4DV0 L;  4K14 A;  1VQM A;  3GP7 A;  1LUZ A;  1D1I A;  1BKB A;  2IX3 A;  1TWH B;  1X3P A;  3GTQ B;  3CCR A;  1Y1W G;  2UXB Q;  2WAQ E;  1OXV A;  4QL5 A;  3TP5 A;  2HCC A;  1O78 A;  2V1C C;  2B2V A;  1EIH A;  1TU2 B;  3ERO A;  2PW5 A;  1E3P A;  2N55 A;  1LTL A;  4CJ0 B;  3J7A F;  1I3Q H;  2PYK A;  3D0F A;  2F0Q A;  2VS1 A;  3E6Z X;  4JI1 Q;  5CBE E;  1WJJ A;  1VQG A;  2QDL A;  3R8B A;  4EQ5 A;  2ALY B;  2RDG A;  2A1A A;  1MHW C;  1TS2 A;  4QUC A;  1KAB A;  4UP7 A;  4X3K A;  1SEB D;  4KY5 A;  3S1Q H;  1Q46 A;  1VQP A;  4A3C H;  4JV5 L;  1YEZ A;  3FP9 A;  3SVM A;  5IOD A;  2XWJ B;  1KXL A;  4R4C A;  4R8I A;  3UI2 A;  3ULL A;  1J5E L;  4ILW A;  1BBW A;  2K7V A;  1BCP F;  3HKS A;  4NPS A;  2YYZ A;  4YWK A;  3TZU A;  3CME A;  3RZD B;  1HCZ A;  2I5H A;  1HZA A;  2SNM A;  3BVM A;  3HOW G;  3PUX A;  3LX0 A;  3CCS A;  1Y1V B;  4KTA A;  2R3Z A;  2MJ8 A;  3CP0 A;  1BR9 A;  2B2T A;  1SYG A;  1STY A;  1HH2 P;  3KUP A;  5C4Z A;  3TZD A;  1MD2 D;  1KRS A;  3LWE A;  3H15 A;  4HIK A;  1EWH A;  1PTO H;  3M4Q A;  3KFU A;  1CQF A;  3I4M H;  3KF6 A;  1O7Y A;  2B63 B;  5GRO A;  2Z4I A;  1VQK A;  1UUP A;  3K5N A;  2AKW B;  1QG7 A;  1AE3 A;  4CDE C;  3KLR A;  1WVL A;  1EIY B;  2OEO A;  1NBW A;  1SYE A;  1LTB D;  2AHO B;  3M4O B;  5CBA E;  3GTO B;  2F0O A;  4GNX B;  3HOY B;  4DR6 L;  3P75 A;  1TT2 A;  4C3J H;  5D3I B;  4KHP L;  2Q8T A;  4JI2 Q;  4EVO A;  1HQR D;  2K14 A;  4A3C G;  1U0L A;  1I6H H;  4M1U B;  5JOB A;  3KJO A;  4DUY Q;  4LF6 L;  4UHV A;  2A68 D;  4A3K G;  4O0A A;  4DK1 A;  3D3R A;  2CQA A;  4BBR B;  4XT1 B;  2Z4H A;  1V9P A;  3TP8 A;  1IBK Q;  3H0G B;  3IFT A;  1XNR L;  1RD9 D;  2YTV A;  2KVM A;  4CDD C;  4IPG A;  5AJ3 Q;  2EYL A;  1H9R A;  3URY A;  4DK0 A;  4LUV A;  3TRE A;  4DF7 A;  1K8A C;  2WII B;  2JA6 G;  5J22 A;  2K5V A;  4LF7 Q;  1WTV A;  1C9O A;  1WTQ A;  2D5D A;  1EIG A;  2NYZ D;  1FYC A;  2Q8I B;  3CC2 A;  4UY8 C;  3S2H B;  2NVY B;  3J7A 5;  1GUN A;  4ZKB B;  1SDF A;  5CMD A;  4IUN A;  5M5Y B;  1VDZ A;  5CV6 A;  3D6W A;  1JIC A;  2HIX A;  4LW1 A;  1SLJ A;  1TWH H;  1UE1 A;  4JK1 C;  2M00 A;  1CI3 M;  1YHA A;  3D4D A;  5FLM G;  1MI2 A;  1TWF H;  1NMF A;  1GM5 A;  4RA8 A;  2R93 B;  1N32 L;  4EQO A;  2EYM A;  1CQV A;  1Q7Y C;  1JCK B;  3AYH B;  4CJ2 C;  2LFN A;  4K8I A;  3CPW A;  2KOL A;  4FDB A;  3FPP A;  3ER0 A;  5HGQ A;  1EY4 A;  4RKB A;  2NUC A;  1EQQ A;  1JMC A;  3CCM A;  2CH4 W;  1EZ6 A;  1SNM A;  4JI4 Q;  3LGJ A;  5C44 G;  1PYB A;  3M4Y A;  5IT9 E;  4KK7 A;  1LAB A;  5IE8 A;  5C6A A;  1BCP D;  1J6Q A;  1XPO A;  1PV4 A;  3MVV A;  1YBY A;  3A8J E;  1K3R A;  4IOC A;  2L1B A;  5EPL A;  4A3F B;  1BVS A;  2NZH A;  4X66 L;  5EQ0 A;  1P8L A;  4A4I A;  3SK6 A;  3PO2 H;  4WFN 3;  5NUC A;  2D2C C;  1HUN A;  2XRQ D;  4GKJ L;  2R7F A;  2ZXP A;  3TRZ A;  3G7L A;  2RSN A;  2K5W A;  3PIO A;  4BBR H;  1ENC A;  1GUS A;  3RD4 A;  2OT2 A;  1EQV A;  1S5F D;  3BYT B;  2VB2 X;  3Q8D A;  4IUV A;  2K01 A;  2XSC A;  3QIA A;  1H9M A;  2NZ1 D;  4FNF A;  1TWC B;  3HOX G;  4HJ7 A;  4OHJ A;  2BE5 C;  2NVX B;  4JI4 L;  4QCL A;  1FNW A;  2JXM B;  4LF8 Q;  4DV0 Q;  1HZB A;  3C1E A;  4LF5 L;  1YJN A;  4G7H C;  2EYH A;  4JI0 L;  5IYB G;  1HNX Q;  4OON A;  4K2K A;  4BBS H;  2B39 A;  3TP7 A;  1ICF B;  2VY3 A;  3HZX A;  3CQZ H;  1W6K A;  1WTR A;  1X3E A;  3H09 A;  4C3J B;  3RLN A;  4DUZ Q;  1QB5 D;  2EXZ A;  4LJZ C;  4AYB E;  4X62 L;  1BDO A;  4A93 B;  1NR2 A;  4IUQ A;  4LFB Q;  3A8K E;  3OHX C;  2PQE A;  3BZK A;  1I3Q B;  1NMG A;  2NVQ H;  1XPU A;  1G29 1;  1RJT A;  2K32 A;  4RWS C;  4LF7 L;  2A5H A;  5GQO A;  1EYA A;  5F2D A;  1LT3 D;  3BVG A;  5E7N A;  3TDQ A;  3NXW A;  3SGI A;  2L4N A;  1PXU A;  2E2J B;  1Y1V G;  2F0N A;  1HXY D;  1CTM A;  1AW7 A;  3PO2 B;  2CVR A;  5FOB B;  3I56 A;  1C8C A;  4H0L C;  1QNU A;  1YIJ A;  1WTX A;  1G91 A;  1F2Z A;  3NTH A;  2K50 A;  2RHS B;  4BS9 A;  4DV6 L;  4I7Z C;  2OCE A;  4NXN L;  4H13 C;  5AFW A;  4IUU A;  4BY1 H;  2DJG C;  1A62 A;  1KLU D;  1TWA B;  1NAP A;  5IYB H;  5A2Q L;  4MNO A;  2NN6 H;  4LFC L;  4K0K Q;  3H91 A;  3I73 A;  4DR7 L;  3IFD A;  1PRT B;  4B9X A;  1SND A;  1YNJ D;  1CUK A;  1KAW A;  1V1P B;  4LWC A;  4B3R Q;  1ICW A;  1EYG A;  3M9B A;  3MXP A;  1SE2 A;  4U68 A;  2AWN A;  4M8A A;  2UUA Q;  1XTD A;  4R4O A;  3V05 A;  4XQN A;  2Q2T A;  4AYB B;  5HGT A;  4JBM A;  2VNU D;  4ABN A;  2WV6 D;  2YTY A;  5ELO A;  4H02 A;  3RZD H;  1WD0 A;  2L5T A;  2C5C A;  3PF5 A;  1EY8 A;  2MGS A;  5C0X I;  1E1O A;  3F2C A;  5JJK A;  3C46 A;  4BY7 B;  3CCL A;  1LTA D;  4Q0F A;  4A3D G;  3NTI A;  3ERS X;  2A8V A;  1AEX A;  4K0K L;  1HA5 A;  3I4M B;  5EPJ A;  3Q0A A;  4KKU A;  4YWL A;  2E2J H;  2K75 A;  1VCI A;  4X66 Q;  3DLL A;  3PO3 B;  1E0B A;  4QB4 A;  2QIL A;  5JJZ A;  2YU9 H;  5EKK A;  4YWM A;  1CKN B;  4G7Z C;  4JI7 L;  3GTM H;  4TKO B;  1GUG A;  2R6G A;  4YCV A;  1JOR A;  4DAM A;  1KRT A;  2IW3 A;  2OTJ A;  1H95 A;  1R9T B;  4DAV A;  2DUD A;  1YZ6 A;  4G7O C;  2HDL A;  5D3D A;  3S1R H;  2R7D A;  5ELB A;  3NHH A;  5LHY 1;  4BY1 B;  2RQX A;  2O5J C;  5C44 B;  2EXD A;  1IBM Q;  1LTS D;  5L37 A;  3MWY W;  1S3O A;  4RH6 A;  2Z6K A;  1II3 A;  3KBG A;  1ASZ A;  1BQQ T;  1JOO A;  3WWV A;  3HOU H;  1ENF A;  1QUQ A;  2A68 C;  3PUV A;  1PLF A;  2Z8L A;  4B3M L;  2PI2 A;  2GA4 B;  2BCO A;  1UEA B;  3GTG B;  3DM1 A;  2B2T C;  5EKL A;  2K4K A;  1K73 C;  2R7Z G;  4RGO S;  1Z7T A;  4R4T A;  3HRZ C;  4Y7N B;  3J7A V;  2EOT A;  1Q1B A;  3UE1 A;  1TWG B;  4DV4 L;  3S17 B;  4CKC A;  3HEJ A;  1U9R A;  3W3A A;  4QF4 A;  3MC0 B;  1B53 A;  2QEX A;  5IWA Q;  2KEC A;  4YCU A;  1JWS D;  2PZT A;  3ITP A;  2CW0 C;  2SNS A;  2VQF Q;  2EY5 A;  4ID6 A;  4JV5 Q;  2VUM B;  1Z6H A;  4EQP A;  4NXN Q;  4RMF A;  4C3I G;  4QUF A;  5M3F H;  1WTO A;  4FXG C;  2F0T A;  1TR5 A;  3NSW A;  1ZXT A;  4RAU C;  2OWO A;  4CBV A;  4V19 0;  2H1E A;  5M5X B;  5IGE A;  4GNX A;  3T1Y L;  1LTR D;  3S14 H;  4KY6 A;  1KHI A;  1CM9 A;  1I4P A;  1LTG D;  2NN6 G;  2CCZ A;  1VMP A;  3BDC A;  2JA7 H;  3M7G A;  1SSO A;  1HA6 A;  2WIN B;  2VUM H;  3EJI A;  5AJ3 L;  1S5D D;  1STG A;  4V0B A;  4OIK A;  1AN8 A;  2JJQ A;  2RA4 A;  3BJU A;  3RN2 A;  1HR0 W;  4C2M B;  5C3E B;  3N52 A;  2NVX H;  1YNN C;  3K0X A;  4UP8 A;  5CV9 A;  4P75 A;  3S17 H;  4WJ3 M;  2F3V A;  5C5L A;  1TQO A;  3HOZ B;  5LMU L;  5BN5 A;  2MQH A;  2B63 H;  4OGQ C;  1ML0 D;  5EBC A;  3VR5 A;  1K3B C;  3NQT A;  2VQE L;  1BXT A;  2AQ3 B;  1SNQ A;  2B8F A;  4X65 Q;  2UXC Q;  3FKI H;  4QY7 A;  4HJA A;  1VQA A;  3MTS A;  4FXK C;  3E5S A;  3SDZ A;  4GKK Q;  4TSS A;  4A3I H;  4JI3 L;  1PH7 A;  3GTO H;  1UAP A;  2JA6 H;  3KLS X;  3G48 A;  5J39 A;  3SHL A;  2OQ0 A;  4ZQ3 A;  3PUZ A;  2I46 A;  2JN4 A;  2NBF A;  3A55 A;  3OMC A;  3T4A C;  1F9P A;  1X55 A;  5C4J H;  1SYD A;  1TS4 A;  2QF7 A;  5E4X A;  1VQ9 A;  4FP5 D;  2XNA C;  4OEM B;  5IGC A;  3VR4 A;  5FLX L;  2FFK B;  3F2B A;  3D31 A;  2HHH L;  3HOU G;  3SR1 A;  1JJC B;  3FRP B;  1W3S A;  2F0L A;  1GO3 E;  2GN5 A;  2EJG C;  1DJR D;  2R92 G;  1LTI D;  3S24 A;  3CCV A;  1STE A;  3UE0 A;  1OXX K;  3NEM A;  1QWY A;  2B2V C;  4P71 A;  4MIU A;  5HUR A;  4A3L H;  2M9V A;  4JI5 Q;  3T56 B;  4EGV A;  4TRD A;  1W2B A;  3RZO H;  1EFI D;  2X69 A;  3HGB A;  4LF4 L;  3OOC A;  1HQM C;  4NB3 A;  4JI6 Q;  3C3L A;  3GTL B;  3KLW A;  4GLA C;  3V2T A;  3K7A B;  4A3J G;  4KMU C;  4JCV E;  4A3M G;  3DMU A;  4KD3 A;  2R93 H;  5E1F A;  5IGF A;  1NR4 A;  4LFA Q;  4A3E B;  3IRB A;  3MAQ A;  4C3I H;  2F0M A;  2F0P A;  2PZW A;  3IKJ A;  1PRT C;  1E22 A;  1HRJ A;  3OMG A;  3P1H A;  5FO8 B;  2JSO A;  4DV5 Q;  4K8J A;  4HR7 B;  1PH3 A;  3GTM B;  1AH9 A;  3EA6 A;  1N8R C;  2FHT A;  2B2U A;  3LWU A;  2FJ2 A;  1OXS C;  3TME A;  2F0H A;  1A3T A;  2PQA A;  1K9M C;  1SRU A;  1YNN D;  4DV7 Q;  4XYQ A;  4GLX A;  1D8L A;  3QB3 A;  2PW7 A;  1XX8 A;  1WCM G;  4J6H A;  4HSV A;  1MSG A;  1D7Q A;  1GVP A;  1U4L A;  4KHV A;  3S1N H;  2VQE Q;  2N78 A;  4AIM A;  4QGU A;  4LUO A;  2PQA B;  4AYB G;  1VQF A;  4PMB A;  3ICE A;  1HUM A;  4RKL A;  4NXM Q;  3I4L A;  4PMW A;  1GKH A;  1PFN A;  1EQT A;  4YCW A;  1H9K A;  2IT1 A;  1U4M A;  3I4N H;  2VUM G;  4XQJ A;  1LYL A;  5M5W H;  1KAA A;  4JVZ A;  4PNY A;  4YHH L;  4GS3 A;  1VQ6 A;  1A3U A;  4GOP B;  1KL9 A;  5KIX A;  1KLG D;  4F87 A;  3GTJ H;  1I6H B;  2PMZ E;  3V96 A;  4J8Q A;  4KJO A;  4WRD A;  5CC4 A;  2HQE A;  4RG1 A;  2R92 B;  3OWF A;  2JYO A;  2ZJQ A;  2XIW A;  5DLQ E;  5C0X G;  1SE4 A;  3H6M A;  1U5K A;  1DXM A;  1YNJ C;  1B50 A;  1E24 A;  2D62 A;  2DJF C;  1B70 B;  1DYQ A;  1QE6 A;  3HOW B;  4JOI C;  5C4X B;  3I4N B;  3U4V A;  2XGT A;  1PH6 A;  1PVO A;  4DV2 L;  2DY7 A;  4DXF A;  2K33 A;  1SN8 A;  3QOL A;  1VMC A;  2QW7 A;  3S1Q B;  4OO1 I;  5JPM C;  1VQ7 A;  3K80 C;  2QCP X;  1SBB B;  2ZJR A;  4HCE A;  3OTO Q;  1BOS A;  2NTS A;  2N49 A;  5IP9 H;  4HN7 A;  1B1Z A;  4JYA Q;  4CHT B;  1WI5 A;  2ZJP A;  2GVB A;  5DNF A;  3F1Z A;  3HKZ B;  2H5X A;  1MJC A;  2MO1 A;  3CCJ A;  1EY9 A;  1IBL L;  2AMC B;  3PO3 H;  1PFS A;  1I4X A;  3HKZ E;  5M3M G;  5IYD H;  4DAY B;  3AQQ A;  1VQE A;  1D2B A;  1PA6 A;  4A3G B;  1PTO B;  1MJE A;  4N8F A;  3T1H L;  4OIJ A;  5LMU Q;  1LLR D;  2F4V Q;  4C3I B;  4OO1 H;  4LF4 Q;  3F8T A;  4A93 G;  3A8I E;  4N9P A;  1L1O A;  4A3J B;  4BXX G;  1JT8 A;  3R2I A;  1MKH A;  3T16 A;  3EVQ A;  4DAY A;  4DR1 L;  4CDC C;  2K52 A;  2B63 G;  1G8Z D;  1NTG A;  3KBX A;  1I50 H;  3KOJ A;  1YI2 A;  1YJ9 A;  2AQ1 B;  5GAD C;  3W1B A;  1S72 A;  2BE5 D;  4DKA C;  2NTT A;  2F0G A;  1XPR A;  1L1O B;  3HOW H;  1IHZ A;  1ILQ A;  2ICE C;  2M2L A;  4R4I A;  2L11 A;  5ELE A;  2PMZ B;  1T9H A;  2VW9 A;  1SR3 A;  1KNE A;  2F4I A;  4O42 A;  4Z9C B;  4BWG B;  4XDX A;  5T1G A;  3NQI A;  3ZYY X;  1IYJ B;  1K83 H;  1QVC A;  1EQR A;  5A2Q E;  4P72 A;  4HED A;  1R4Q B;  4UDU C;  1XMQ L;  3A7L A;  3T51 B;  1JB7 A;  3RZO B;  2E2D C;  1TY0 A;  5FO9 B;  3G71 A;  3GTP H;  2RF4 A;  4IJH A;  2G5D A;  1V43 A;  3MXN B;  1WTP A;  1E2V A;  4RFB A;  4L5Q A;  3U58 A;  1Q1E A;  4X6A H;  2MHV A;  3RR5 A;  2HQL A;  1WTH A;  2IHF A;  4Y52 H;  2IHE A;  1STA A;  2EY6 A;  3J80 L;  4Q5V A;  4DK6 C;  1VQH A;  3UDF A;  3Q6S A;  2ZT9 C;  2L9H A;  3VYU A;  5LMN Q;  2B29 A;  2C9O A;  4K6D A;  1K83 B;  3ZJY C;  1YJW A;  2A6E C;  4ME5 A;  2JP1 A;  4XXE A;  4GLV B;  1X54 A;  3CAM A;  1UEB A;  5KNB A;  2D0P A;  1QVG A;  1HZC A;  1I94 Q;  4DR7 Q;  4G57 A;  3OWE B;  4PZ7 A;  2IY5 B;  2E76 C;  2HIV A;  3RMH A;  5JEA H;  3K7U C;  3NEN A;  5JVH 3;  1EUJ A;  1PHJ A;  1QIL A;  3BZC A;  1EOT A;  1KQS A;  2UUA L;  4F7X A;  1EYD A;  3MEF A;  3FDT A;  3PV0 A;  4DR2 Q;  1VQ4 A;  2IJ0 A;  5EJW A;  3J81 j;  2B2U C;  3KYH C;  4K6L A;  5M3M H;  3N6R A;  5IYD G;  4C3J G;  3KF8 B;  3TP6 A;  2KUM A;  1K8G A;  1EFW A;  1GUO A;  1V1Q A;  1YHQ A;  1IYU A;  1V1P A;  5C3W A;  1TS3 A;  1EY0 A;  1SNC A;  1EZ8 A;  3DWQ A;  4JI5 L;  4F8M A;  3M7N A;  4JI2 L;  5CV8 A;  2EYJ A;  1DOM A;  1EU3 A;  2HUG A;  2KEN A;  2EDG A;  1SYB A;  3FMC A;  3GV3 A;  1Q81 C;  1PH8 A;  4WJ4 A;  1A63 A;  3HG9 A;  2ASB A;  2K05 A;  1HFN A;  3W5O A;  4PZ6 A;  1N33 Q;  2JE6 I;  3HFZ B;  1XJV A;  4DV3 L;  4K2L A;  1Z9F A;  3HOV H;  1O7I A;  4KD4 A;  5I6W A;  2L12 A;  3EFX D;  4R1J A;  3RN5 A;  4JI0 Q;  2RSO A;  4A93 H;  5DEH A;  2PZU A;  2JEA I;  2LMC B;  4A3K H;  2A69 C;  3HP3 A;  2WB1 G;  4K5X A;  4X3T A;  5DM6 3;  3EBE A;  2RHQ B;  3VA5 A;  4XTC S;  2XRS D;  3VYS A;  3RNU A;  3S1M B;  1JR0 D;  5CR3 A;  5M5Y H;  3JAM c;  1I4H A;  1ASY A;  4ODG A;  2VQF L;  4LFC Q;  5H1S E;  3I55 A;  4R8N A;  3K57 A;  5K36 H;  2F03 A;  3S9W A;  3A74 A;  3K5O A;  3E0E A;  4B3R L;  5ELF A;  1N32 Q;  4POF A;  4E6I A;  4QQB X;  1VQ8 A;  5FLM H;  1SAP A;  1JE4 A;  1CKO A;  5FLX c;  2EYF A;  4PMC A;  2FIN B;  2K5H A;  4K5W A;  5CV5 A;  3SXH A;  5LMN L;  2NB0 A;  4PV1 C;  2LXK A;  4H44 C;  4AQY Q;  3L7Z C;  3CHB D;  5CYU A;  2OTL A;  2L0C A;  4OX9 L;  4JW0 A;  1PDQ A;  3R93 A;  3CF5 A;  2Q8R E;  3PIO 3;  4L5T A;  4FO2 A;  2N8N A;  1I6V C;  1XMO Q;  2MUY A;  1X9N A;  4R4Q A;  3A56 A;  4ZRZ A;  5FO7 B;  1GXD C;  3NBH A;  1JB3 A;  4IFD I;  1S40 A;  2A6E D;  2EVB A;  3QG1 A;  4IFD J;  1NUC A;  5G3L F;  1U4P A;  4OEL B;  2NN6 I;  4IZ8 A;  4GNX C;  1L0W A;  3CW2 C;  1L0X B;  4BY1 G;  4KJN A;  1X3Q A;  4DNR B;  5K36 G;  3NWS A;  4DXG A;  3K58 A;  2D9U A;  4DV1 Q;  4LFB L;  1OXT A;  1DM0 B;  3GV6 A;  2WAC A;  2I0Q A;  3HOX H;  3FEW X;  3S15 B;  2RKS A;  3AFP A;  1B2T A;  3DWA A;  4TVA B;  3G4S A;  1EU4 A;  3VA7 A;  1NJI C;  3KF6 B;  1SFO H;  5FK9 C;  2O5I C;  2E74 C;  2KHJ A;  3I4O A;  1DD2 A;  1PH4 A;  3CC7 A;  2MFI A;  4JI7 Q;  1RTO A;  4JI1 L;  1BCP B;  2F0K A;  5HY6 A;  2I07 B;  4X62 Q;  4IUP A;  1F77 A;  3U50 C;  4FF3 A;  4H7B A;  4CKB A;  2A74 C;  3HOV B;  4A76 A;  4HCS A;  3PO2 G;  2VB3 X;  3I72 A;  1STN A;  3KK7 A;  4KV6 A;  5KGU A;  1TY2 A;  3H0G G;  2ZTC A;  3K81 C;  2WKD A;  4JBJ A;  1IBK L;  1SFO B;  2CQO A;  3ERQ A;  5IYC H;  4G4K A;  3HOY H; 
#chains in the Genus database with same CATH homology
 3J7Z C;  3HKS A;  3RZO H;  2JK8 A;  3S1M H;  2FXQ A;  4NPS A;  2YYZ A;  3S2H H;  2JA5 H;  4YWK A;  4X64 L;  3CME A;  2Y0S E;  2I5H A;  1HZA A;  1HNW L;  4LF4 L;  2HHH Q;  3HOW G;  4LF9 L;  3PUX A;  3CCS A;  4OWX B;  4NB3 A;  3VDY A;  1WOC A;  2OQK A;  1J5E Q;  4DV2 Q;  4JI6 Q;  3HOZ G;  3CP0 A;  3KLW A;  4GLA C;  1SE8 A;  4BY7 H;  2BA1 A;  5C3E H;  3CCE A;  4A3J G;  3BU2 A;  1HH2 P;  4GOP A;  2PI2 E;  3H15 A;  1KRS A;  4JCV E;  2YV5 A;  4HIK A;  4A3M G;  1EWI A;  2JA8 H;  3M4Q A;  2R93 H;  3KFU A;  4LFA Q;  4JI6 L;  3I4M H;  3KF6 A;  2MO0 A;  3IRB A;  3PCO B;  4C3I H;  5JJI A;  4HID A;  5GRO A;  1E22 A;  1VQK A;  4DV5 Q;  1AH9 A;  2AKW B;  1PH3 A;  1AE3 A;  1N8R C;  1UE6 A;  1EIY B;  2ZTD A;  1OXS C;  2BH2 A;  1PH2 A;  5C4X H;  1NBW A;  1XNQ Q;  2AHO B;  2PQA A;  1K9M C;  5JJL A;  1SRU A;  2UU9 Q;  4GNX B;  4DV7 Q;  4DR6 L;  4C3J H;  1K0R A;  4GLX A;  4KHP L;  3GTK H;  1D8L A;  4HIM A;  2E8G A;  3CXC A;  1G51 A;  1DGS A;  1WCM G;  4JI2 Q;  2K14 A;  4A3C G;  1U0L A;  1I6H H;  4A3B G;  1I5F A;  1Y1V H;  1JJ2 A;  3KJO A;  1RL2 A;  1GVP A;  4DUY Q;  2E5L L;  4LF6 L;  1D7Q A;  4A3K G;  4O0A A;  3I4N G;  3S1N H;  2VQE Q;  2N78 A;  4AIM A;  4QGU A;  1NY4 A;  1YIT A;  4LUO A;  4XIG S;  2PQA B;  4A3F G;  4AYB G;  1VQF A;  1V9P A;  1IBK Q;  1XNR L;  3ICE A;  1OXU A;  2YTV A;  4NXM Q;  4IPG A;  5AJ3 Q;  1WFQ A;  4PMW A;  5C0X I;  4DR5 Q;  1GKH A;  1Y1W H;  3GO5 A;  3PUW A;  4LUV A;  3TRE A;  5IP9 G;  4YCW A;  1K8A C;  4YHH Q;  5JEA G;  2JA6 G;  2IT1 A;  1VQO A;  2ZTE A;  4DR1 Q;  3J81 i;  2EQS A;  2K5V A;  3I4N H;  4LF7 Q;  1VQN A;  1C0A A;  1R9T H;  1C9O A;  2VUM G;  4A3G H;  4YY3 Q;  1VQD A;  4IOA A;  3CC2 A;  2VL6 A;  1LYL A;  5M5W H;  2ZM6 Q;  4YHH L;  4J15 A;  4GS3 A;  4UY8 C;  1VQ6 A;  1PYS B;  4GOP B;  3STB C;  3A5Z B;  1N36 Q;  2JA8 G;  3J7A 5;  1KL9 A;  2IX0 A;  4DR7 Q;  2Z6K C;  3GTJ H;  3T1H Q;  3GTL H;  1SRO A;  2HIX A;  4LW1 A;  1SLJ A;  2PMZ E;  1TWH H;  1CKM A;  1UE1 A;  1YHA A;  5IT9 c;  5FLM G;  1TWF H;  3PIP A;  1G6P A;  1RIP A;  3CC4 A;  1NMF A;  4RG1 A;  1GM5 A;  4PG3 A;  2CKZ B;  1N32 L;  2CFM A;  2ZJQ A;  1IBL Q;  4OX9 Q;  5DLQ E;  5C0X G;  1Q7Y C;  1VQJ A;  3AYH B;  4OXP A;  1U5K A;  3RLO A;  2QA4 A;  1E24 A;  3CPW A;  4FDB A;  2D62 A;  3ER0 A;  1B70 B;  2Q2I A;  4NXM L;  5HGQ A;  1EQQ A;  1JMC A;  3H3V H;  4DK3 C;  1FL0 A;  4JYA L;  2XTI A;  3CCM A;  4JI4 Q;  2D0O A;  3LGJ A;  4JOI C;  1PYB A;  5C44 G;  3U4V A;  2XGT A;  1PH6 A;  4B3S L;  3ULJ A;  1PVO A;  2PNH A;  1X56 A;  4DV2 L;  5IE8 A;  1J6Q A;  1XPO A;  1SN8 A;  1PV4 A;  1YBY A;  4IOC A;  1K3R A;  3M4P A;  4QIW E;  1IXR A;  4TQU S;  4POG A;  3W1G A;  4X64 Q;  4OO1 I;  1IZ6 A;  1VQ7 A;  2I5L X;  3K80 C;  5ELN A;  1BVS A;  2NZH A;  4X66 L;  1P8L A;  3PSI A;  4JOI A;  4A4I A;  2F4V L;  2ZJR A;  1N34 Q;  4B3T L;  3PO2 H;  3OTO Q;  3T1Y Q;  5IP9 H;  2N49 A;  4GKJ L;  4A3L G;  5JJK A;  2R7F A;  3TRZ A;  3I2Z A;  3PIO A;  4BBR H;  3J80 i;  4JYA Q;  1WI5 A;  4O2D A;  5EAY A;  2ZJP A;  2GVB A;  4OWW B;  3F1Z A;  1KD1 C;  1X3G A;  2H5X A;  1MJC A;  4OO1 G;  2MO1 A;  1UE7 A;  3CCJ A;  2ATW A;  1IBL L;  2AMC B;  1VQB A;  1PFS A;  2A19 A;  3Q8D A;  4DV4 Q;  3PO3 H;  4ALP A;  3HKZ E;  4KLK A;  5M3M G;  4DAY B;  5IYD H;  3AQQ A;  3FHW A;  4BY7 G;  1VQE A;  1HR0 L;  3HOX G;  1PA6 A;  5IP7 H;  5FJ8 G;  3TS2 A;  4HJ7 A;  4JI4 L;  4IPH A;  1MJE A;  3T1H L;  2JA5 G;  1VQI A;  1Y14 B;  4HIO A;  4LF8 Q;  4GKJ Q;  2L15 A;  5LMU Q;  1HZB A;  4DV0 Q;  2F4V Q;  4LF5 L;  1XNR Q;  1Q82 C;  4LF4 Q;  5BR8 Q;  1YJN A;  3F8T A;  2JA7 G;  4A93 G;  4JI0 L;  3PO3 G;  3AFQ A;  5IYB G;  1UE5 A;  4OON A;  1HNX Q;  3S15 H;  1L1O A;  3UDG A;  2F3I A;  4BXX G;  1JT8 A;  2RCN A;  1MKH A;  4BBS H;  1M90 C;  2VY3 A;  3CQZ H;  4DR1 L;  1CSQ A;  3M4O H;  2K52 A;  1X3E A;  2B63 G;  3PUY A;  5IY0 A;  1NTG A;  3RLN A;  4DUZ Q;  4X62 L;  1I50 H;  4AYB E;  3KOJ A;  3M85 A;  4DR2 L;  1YI2 A;  1YJ9 A;  1B8A A;  3W1B A;  5GAD C;  3TEH B;  1S72 A;  4DKA C;  4DUZ L;  4LFB Q;  3BZK A;  4GN4 B;  1XPR A;  4GKK L;  1NMG A;  1L1O B;  3HOW H;  1XMQ Q;  2NVQ H;  1XPU A;  4KHP Q;  1N9W A;  5JEA J;  4BA1 I;  1G29 1;  1QZG A;  3CPF A;  4R4I A;  1EIF A;  1Q12 A;  3TS0 A;  4LF7 L;  5GQO A;  2F52 A;  4EX5 A;  1FVI A;  1T9H A;  2VW9 A;  5E7N A;  1SR3 A;  4IPC A;  3SGI A;  1TXY A;  1Y1V G;  4DR5 L;  2AWO A;  1HNZ Q;  1BBW A;  2JA9 A;  3I56 A;  1YVC A;  2UXD L;  1YIJ A;  1IYJ B;  3F2D A;  3OW2 A;  3OYY A;  1K83 H;  2KBN A;  2E2H H;  1QVC A;  1EQR A;  2NVT H;  4P72 A;  3K8A A;  1JJG A;  2K50 A;  2RHS B;  1CKN A;  4DV6 L;  1XMQ L;  1JB7 A;  2IX1 A;  5C4X G;  3S16 H;  2OCE A;  4NXN L;  3G71 A;  5IYC G;  2JEB I;  3KJP A;  3GTP H;  2RF4 A;  4L5S A;  1CSP A;  4IJH A;  3L2P A;  4BY1 H;  4DR3 Q;  1A62 A;  1KC8 C;  4DV7 L;  3PF4 A;  4DR6 Q;  1V43 A;  3MXN B;  3G6E A;  4IO9 A;  5IYB H;  3ULP A;  4L5Q A;  4MNO A;  4LFC L;  3U58 A;  1Q1E A;  4L5R C;  4K0K Q;  4DR3 L;  3RLF A;  3M3Y H;  2UUC L;  1HR0 Q;  4X6A H;  3H3V I;  3RR5 A;  3GDE A;  4LF9 Q;  1MIU A;  2HQL A;  4DR7 L;  4OWT B;  1CUK A;  1KAW A;  2IHF A;  2IHE A;  4JBK A;  2DGY A;  4LWC A;  4Y52 H;  4B3R Q;  1NE3 A;  4BBR G;  1EYG A;  3M9B A;  5LMN W;  3DM3 A;  1L2F A;  4LF5 Q;  4KHZ A;  2LXJ A;  2AWN A;  4DK6 C;  1VQH A;  3UDF A;  2UUA Q;  4B3S Q;  3GTG H;  1UWV A;  4KI0 A;  2K5N A;  4UPA A;  1XTD A;  5LMN Q;  2B29 A;  4R4O A;  2Q2T A;  2KCT A;  3CCQ A;  3L0O A;  3NBH B;  4JBM A;  2VNU D;  2YTY A;  5ELO A;  4H02 A;  3ZJY C;  3RZD H;  4A3F H;  1YJW A;  4JI8 L;  3I7F A;  3PF5 A;  4JC0 A;  4GLV B;  1X54 A;  1FGU A;  1UEB A;  1E1O A;  2D0P A;  3CAM A;  1HZC A;  3EN2 A;  4YY3 L;  3TQY A;  3F2C A;  1QVG A;  1I94 Q;  5C0X J;  3CCL A;  4PZ7 A;  4DNI A;  2IY5 B;  1VQC A;  2HIV A;  4C2M H;  4A3D G;  4AQY L;  5C44 H;  3K7U C;  3NEN A;  2UUB L;  3ERS X;  2KCM A;  3UDI A;  1EUJ A;  2E2I H;  2VZA A;  1QVF A;  1PHJ A;  2A8V A;  2MNA A;  4K0K L;  3BZC A;  1KQS A;  2UUA L;  1N34 L;  4B3T Q;  4YWL A;  2E2J H;  2K75 A;  3MEF A;  3PV0 A;  1VCI A;  4DR2 Q;  1VQ4 A;  4X66 Q;  1PH5 A;  1HZ9 A;  3J81 j;  3DLL A;  3HOZ H;  3GTM H;  2YU9 H;  4JI3 Q;  4JI7 L;  4YWM A;  1CKN B;  4JBW A;  3KYH C;  5M3M H;  5IYD G;  3KF8 B;  1K8G A;  2R6G A;  1EFW A;  4Y7N H;  1V1Q A;  4YCV A;  1L1O C;  1YHQ A;  4DAM A;  1KRT A;  3GTQ H;  3I4M G;  2OTJ A;  1H95 A;  1WCM H;  2DUD A;  5M5X H;  4JI5 L;  3M7N A;  1YZ6 A;  4JI2 L;  3S1R H;  2R7D A;  2KEN A;  1PH8 A;  1PH9 A;  1A63 A;  4WJ4 A;  1Q81 C;  2LSS A;  2NVY H;  4IJL A;  4ME3 A;  4HJ8 A;  2UU9 L;  2ASB A;  3W5O A;  3CD6 A;  4A3J H;  4PZ6 A;  3KDF B;  1N33 Q;  2EXD A;  1XMO L;  2JE6 I;  3HFZ B;  2ZM6 L;  1IBM Q;  1XJV A;  2R7Z H;  1S3O A;  4DV3 L;  4A3E G;  1A8V A;  2Z6K A;  1Z9F A;  3HOV H;  4DR4 Q;  1O7I A;  1YHB A;  1ASZ A;  1HJP A;  4DUY L;  1X6O A;  1YNX A;  4DV5 L;  3PGZ A;  3WWV A;  3HOU H;  4A75 A;  5J3B A;  4R1J A;  3RN5 A;  4JI0 Q;  4GN5 A;  1X3F A;  1QUQ A;  3PUV A;  4A93 H;  1VS0 A;  4B3M L;  4BXX H;  2JEA I;  2PI2 A;  4A3K H;  1AE2 A;  4B3M Q;  3A5U A;  1B7Y B;  2R7Z G;  2K4K A;  3KDF A;  1K73 C;  4LNQ A;  2Q2H A;  4R4T A;  4C3H H;  2WB1 G;  1Q1B A;  3UE1 A;  1EOV A;  3B6Y A;  3U4Z A;  4HJ9 A;  1I94 L;  4LF6 Q;  3EBE A;  4DV4 L;  2E5L Q;  2EIF A;  2RHQ B;  3JAM i;  4XTC S;  4AH6 A;  5GAG C;  3RNU A;  1N33 L;  4JI8 Q;  4PZ8 A;  2R93 G;  2QEX A;  5M5Y H;  5IWA Q;  3JAM c;  2C35 B;  4YCU A;  5M3F G;  3NEL A;  1ASY A;  4UP9 A;  1QZH A;  2VQF L;  2HT1 A;  4LFC Q;  5H1S E;  3I55 A;  5C3E G;  1X65 A;  3J81 c;  4APV A;  2UUB Q;  2VQF Q;  2R92 H;  3A74 A;  2N3S A;  1WYD A;  4JV5 Q;  1A0I A;  3E0E A;  4NXN Q;  2B3G A;  3UDX A;  5GAH C;  4B3R L;  4RMF A;  1N32 Q;  4P73 A;  4POF A;  5M3F H;  4QQB X;  1VQ8 A;  3HOY G;  5FLM H;  2KHI A;  1FJG Q;  3JC6 6;  4GOP C;  4MZ9 A;  2OWO A;  1CKO A;  3FKI G;  1E1T A;  4LF8 L;  2BH8 A;  5FLX c;  3J80 c;  2JQO A;  2K5H A;  1SMX A;  5LMN L;  2GVA A;  4BBS G;  4GNX A;  2LXK A;  4AQY Q;  1C7Y A;  1IL2 A;  3OTO L;  3T1Y L;  5IWA L;  3L7Z C;  3S14 H;  1Q86 C;  3CMA A;  1HNW Q;  1KHI A;  4IPD A;  2WP8 J;  4GN3 B;  2OTL A;  2I5M X;  4A3M H;  2NZO A;  3HKZ G;  1VQ5 A;  4OX9 L;  2NN6 G;  1QUQ B;  4X65 L;  2CCZ A;  2UXC L;  4A3B H;  2UXB L;  3CF5 A;  4P74 A;  4L5T A;  3S2D H;  2N8N A;  1XMO Q;  1IBM L;  1X9N A;  2JA7 H;  1Z47 A;  4R4Q A;  2CWA A;  2Y0S G;  4QJF A;  1P16 A;  1HNZ L;  2VUM H;  4A3G G;  4IFD I;  1S40 A;  5AJ3 L;  2Q2U A;  3H0G H;  4IFD J;  2Z0S A;  2CWP A;  3E9H A;  3EIV A;  2NN6 I;  4GNX C;  4JG2 A;  1L0W A;  3CW2 C;  2JJQ A;  3BJU A;  3RN2 A;  1HR0 W;  1TWC H;  3GD7 A;  1E7Z A;  4BY1 G;  3K7A H;  4DR4 L;  1PH1 A;  2NVX H;  2BA0 A;  4DV3 Q;  4HJ5 A;  2UUC Q;  1HNX L;  3K0X A;  4UP8 A;  3CCU A;  1TWG H;  5K36 G;  1LM0 A;  4P75 A;  5BR8 L;  3S17 H;  4DV1 Q;  4A3I G;  4IFD G;  4LFB L;  2UXD Q;  4WJ3 M;  1OXT A;  4A3E H;  3HOV G;  2QGQ A;  2WB1 E;  2WFW A;  5LMU L;  4DV0 L;  3STB D;  2MQH A;  1N36 L;  2I0Q A;  2B63 H;  3HOX H;  1VQM A;  4A3D H;  3AFP A;  4BA2 I;  3AEV A;  1KIX A;  4TVA B;  1LUZ A;  3G4S A;  1BKB A;  4DV6 Q;  3KF6 B;  2VQE L;  1SFO H;  1NJI C;  1BBU A;  3CCR A;  1Y1W G;  2UXB Q;  2WAQ E;  1JE5 A;  4X65 Q;  4LUZ A;  2UXC Q;  1OXV A;  3FKI H;  4QL5 A;  2KHJ A;  3I4O A;  4QY7 A;  4HJA A;  1VQA A;  4GKK Q;  1PH4 A;  2V1C C;  2MFI A;  4JI3 L;  3CC7 A;  4A3I H;  4JI1 L;  1PH7 A;  4JI7 Q;  1OTC A;  3G48 A;  2JA6 H;  3GTO H;  1E3P A;  2OQ0 A;  3PUZ A;  1LTL A;  5HY6 A;  1X55 A;  5C4J H;  4X62 Q;  1I3Q H;  3D0F A;  5FJ8 H;  3U50 C;  4DPG A;  5IP7 G;  2VS1 A;  4DV1 L;  1VQ9 A;  4JI1 Q;  1TWA H;  3E9I A;  1M1K C;  1WJJ A;  1VQG A;  3F2B A;  4EQ5 A;  4MTN A;  2ALY B;  4A76 A;  1FJG L;  3PO2 G;  2ID0 A;  1VQL A;  5GAE C;  3D31 A;  2HHH L;  2A1A A;  3HOU G;  3A0J A;  1JJC B;  4UP7 A;  1GD7 A;  2ES2 A;  1W3S A;  3S1Q H;  1Q46 A;  1GO3 E;  2GN5 A;  1VQP A;  4A3C H;  2R92 G;  4JV5 L;  1YEZ A;  3FP9 A;  3H0G G;  4LFA L;  3S24 A;  2ZTC A;  3CCV A;  3K81 C;  3UE0 A;  1OXX K;  3NEM A;  1Q8K A;  4JBJ A;  4P71 A;  1KXL A;  1IBK L;  1XNQ L;  4R4C A;  4A3L H;  4JI5 Q;  2CQO A;  1W2B A;  5IYC H;  2YTX A;  3ULL A;  3HOY H;  1J5E L;  2WAQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...