3RZOH

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rzoH00
4A3BH 4GKJQ 3PUYA 3K7AH 4HIDA 1UEBA 1IBMQ 1Q1EA 1QVFA 3I4MH 1X3EA 1EQRA 5E7NA 3CCSA 1YVCA 1HR0W 4A76A 1JT8A 1ASZA 4A3CG 5GADC 2I5MX 2Y0SG 1HJPA 2NN6G 3GDEA 4DR2Q 3NEMA 3PF5A 4X66Q 4POFA 1VQ7A 2RHSB 1OXVA 1Q8KA 1UE5A 4KI0A 5IP9G 5M3FG 1Y1WH 2ID0A 1Z9FA 1VQKA 2UXBL 5AJ3L 4A3IG 2E2IH 1PYSB 1W3SA 3PCOB 3CCLA 1OXSC 1I50H 2UUBL 2F52A 5IP9H 3KDFB 4A3MG 2B63G 3S14H 2NVYH 5BR8L 2KCTA 3KYHC 1HNZQ 3CXCA 4A3IH 4LFBL 2AWOA 3OTOQ 4OO1I 1K83H 2JEAI 4DUYL 2NN6I 2R7ZH 4IFDG 3KF6A 4BA2I 4YWKA 3J80i 3SGIA 3GTOH 4A3GG 4GOPC 3UE1A 4JI4Q 4GKKL 2KENA 4K0KL 1B8AA 1VQPA 2HQLA 1AH9A 1OXXK 1Q46A 4JI1L 5IE8A 4DR3L 1S3OA 4GOPA 2ZJQA 1PH7A 2KHJA 4YCUA 1PH6A 4LF8Q 1JB7A 1OXUA 2NZHA 3AEVA 2R92H 2VZAA 4B3SL 4LF5L 3M3YH 4IFDI 2UUCQ 4DV2Q 4HJ9A 4DV0Q 3RZOH 3D0FA 3G4SA 4JV5Q 2PMZE 1X3FA 4DR5Q 1KC8C 3LGJA 3PO3G 2N78A 3H15A 4H02A 4C3IH 3ERSX 3UDIA 1TWHH 1VQJA 2CFMA 3J7A5 3EN2A 2WFWA 2JK8A 2K52A 5LMNQ 3T1YQ 4MNOA 4NXML 2HHHQ 1NTGA 4QGUA 3JAMi 4DUZQ 4A3FG 4BBRH 4OONA 4P72A 1N34L 4R4CA 2VQFL 2HT1A 3K7UC 3BZCA 4A3KH 3UDGA 1I94L 1HR0Q 4X65L 3HOWH 2JA8H 5HY6A 3F1ZA 1SR3A 1EIYB 2Q2UA 2IY5B 5ELNA 4JI0L 4DAYB 4LFCQ 1YJNA 1FVIA 3E0EA 3PUVA 1ASYA 4R4IA 2UUAQ 3OW2A 2CKZB 5C3EG 1WOCA 2K5NA 1HZCA 1G291 2LSSA 1KRTA 5HGQA 3HOVG 4GKJL 4JI3Q 1QZHA 2EXDA 2XTIA 2ZJPA 1IBML 1X6OA 2N3SA 2MNAA 3CCEA 3H3VI 2IX1A 4LF6L 4JI8Q 3MEFA 4DR2L 1J5EQ 4KHPQ 2IHEA 4B3RL 4X66L 2B29A 4X62Q 3TEHB 5IWAQ 1VQBA 1YJWA 4MTNA 4FDBA 3UE0A 4IJLA 4JI7Q 4A93H 1E22A 1OXTA 4DK6C 2Z6KC 2DGYA 1A63A 1LUZA 4GN5A 3HOYG 3RNUA 5JJLA 3S2DH 2CWAA 4BY1G 2A1AA 1HNZL 5K36G 3OTOL 1CUKA 2Z6KA 3J7ZC 2QA4A 4DV3L 3ZJYC 1UE7A 4DNIA 3H0GG 1WFQA 3KJOA 5LMUL 3HOYH 4IPCA 3BZKA 1MIUA 1GKHA 3S16H 4BBSG 2NZOA 4DV5L 3H0GH 1B70B 3FHWA 4TQUS 4DV7Q 1XPRA 1K9MC 2R6GA 4UPAA 1K73C 4KLKA 3CCVA 1PHJA 4ALPA 3JAMc 4BBSH 2NVTH 3CW2C 4BY7H 4LF8L 1XNQQ 2N49A 4GS3A 2N8NA 1KXLA 1FL0A 2UUCL 5JEAJ 1MJEA 1E3PA 4OO1G 1Y1VG 3G48A 4DV2L 4DR7L 4DV0L 2AHOB 1Y14B 4JOIA 3RN5A 3M85A 4LNQA 3HOUG 4JV5L 5FLMG 1A62A 4L5QA 2JQOA 1HNWL 4YWMA 3STBD 3FKIH 3T1HQ 5IYCG 1Q86C 2JA7H 3CCQA 1BBUA 1UE6A 3U4VA 5FLMH 5C0XJ 4DUZL 2EQSA 4NPSA 2LXKA 2BH8A 3K80C 4A75A 1VQEA 2R93H 4YY3Q 2IT1A 1H95A 3G71A 2UXDQ 1BVSA 3DM3A 2QGQA 1N8RC 4UY8C 2D0PA 4A3EH 3I55A 1Q7YC 2JA6G 1N33Q 1IBKQ 2YTYA 1EWIA 3HOXG 4NXNL 3I4OA 3M4PA 4IPHA 2UUAL 3J81c 3Q8DA 3TRZA 1CSPA 1S72A 1CSQA 4LFAQ 3RLFA 4JI3L 1CKOA 1V1QA 3FP9A 4C3JH 3HOXH 1XJVA 3RN2A 1HNXL 1IBLL 2NVXH 1XNRL 3GTQH 3GTPH 3PO2G 4BXXG 2A8VA 2KHIA 4C3HH 1D7QA 1C9OA 4A3CH 4GLXA 4QIWE 1V9PA 3KLWA 1AE2A 4JI2Q 4JI8L 1J5EL 5M3MG 4KHPL 4OWWB 4X64Q 5M3FH 1LYLA 3HKZE 1E7ZA 4X62L 1VQ8A 2GVAA 2ES2A 4GN4B 4LUVA 3S15H 1G51A 4MZ9A 2CWPA 5J3BA 1N32Q 2VNUD 4A3MH 3WWVA 2B63H 1IZ6A 2ATWA 1PH9A 1TXYA 3M9BA 4QJFA 4DR4Q 4JYAQ 1KAWA 5M5XH 3PIPA 3OYYA 3CCRA 4JI6Q 1CKNB 3A5ZB 2R7FA 4A4IA 4JI5Q 4A3GH 4UP8A 2R92G 1MJCA 3KDFA 4AQYL 1PH3A 2YU9H 1AE3A 3ULLA 1JE5A 3NELA 3J81j 1XMOQ 1VQNA 4LW1A 4OWXB 2ZTEA 4RMFA 4GOPB 2QEXA 2VQEQ 4QQBX 3CPWA 1YITA 1KL9A 1HZ9A 4AH6A 4OWTB 4DV4Q 3M7NA 4O2DA 4HJAA 3S2HH 1FGUA 3RLNA 3RZDH 4DV6Q 1XNQL 3S1QH 3A74A 3U50C 5GAHC 2WAQE 3W5OA 1M1KC 3PO3H 2ZJRA 1HZBA 1QVGA 1Q1BA 2OWOA 1XPUA 4IPDA 3W1GA 4LF9L 4A3JG 4YHHQ 2CCZA 2I0QA 3ICEA 3STBC 4A3FH 4DR1L 3EIVA 1QUQA 2GVBA 4DR6Q 4P73A 3F2BA 4IJHA 3AYHB 1I5FA 1KHIA 4YY3L 2UXCQ 1W2BA 1EUJA 2DUDA 2UXDL 4YCVA 2Y0SE 3L2PA 1YNXA 3H3VH 4JBKA 2HIVA 1IBKL 3MXNB 1EIFA 2ZM6Q 4HIKA 1PH4A 3CC4A 1FJGQ 1NY4A 4PZ6A 2PQAB 2WB1G 1PVOA 3KFUA 3M4OH 4UP9A 1I3QH 1TWCH 5C3EH 4APVA 1YHQA 3HOVH 1SE8A 1V43A 2H5XA 3A0JA 4YCWA 1QZGA 3I2ZA 4NB3A 4AYBG 1GD7A 2KCMA 1VQGA 1LTLA 1VQFA 2MO1A 1IL2A 3PUZA 1JMCA 2C35B 4A3DG 3W1BA 3J81i 1L1OC 2XGTA 2E5LQ 4JI2L 2OQKA 1Q81C 3CQZH 1UE1A 4X64L 4IOCA 4LWCA 3F2DA 1L1OA 1QVCA 4ME3A 4A3DH 1XMQQ 4A3LG 3CPFA 5IP7G 3B6YA 1DGSA 1P8LA 1YHBA 1N32L 2K4KA 1E1OA 3I7FA 4GNXA 5AJ3Q 4BY1H 1VQMA 1U5KA 4JI4L 3TQYA 2IHFA 4GLVB 3HFZB 3CCJA 1X54A 2D0OA 5C44G 4IO9A 2LXJA 4JI5L 3PIOA 4LFBQ 3CCMA 4X6AH 1C0AA 1VQAA 3PV0A 3K81C 4L5RC 4DUYQ 4L5SA 5M5WH 5JEAG 3GTKH 3BU2A 3PF4A 4P74A 2JA5G 4WJ4A 4JOIC 1U0LA 3IRBA 2E2HH 1NBWA 4HIMA 4GKKQ 1KRSA 4XTCS 3TS2A 2ALYB 3F8TA 2VL6A 2RF4A 4P71A 2CQOA 1YHAA 2IX0A 3E9HA 4DR5L 2JA5H 4LF7Q 3S24A 4DR3Q 2OTJA 1NJIC 1Q12A 5C0XG 4JBWA 1Y1VH 4LF4Q 5LMNL 3T1YL 2BH2A 2RHQB 3GO5A 3HOUH 3HKSA 3F2CA 2HHHL 2KBNA 4B3SQ 1K3RA 2D62A 3UDFA 3AFPA 5IYDG 2FXQA 5IYCH 1A0IA 1YEZA 4YHHL 3I4NG 2YYZA 2B3GA 5M5YH 1HR0L 1UWVA 4PMWA 2I5HA 5IYBG 2L15A 3NBHB 2GN5A 4LFCL 2PI2A 2HIXA 4IPGA 3CMEA 4QL5A 5C0XI 3CC2A 3I4NH 4NXMQ 4KHZA 2JEBI 1K8AC 1GO3E 3KJPA 1N34Q 4R4TA 2JA6H 5IYBH 2VQFQ 1IYJB 3BJUA 2UU9Q 1YBYA 2ZM6L 2K75A 1XTDA 3HOZG 1E1TA 1TWGH 1CKMA 1TWFH 5FJ8G 5FLXc 2VW9A 3ULPA 4IOAA 1BKBA 4WJ3M 4A3BG 1X56A 4JI0Q 2JA9A 3RR5A 3I4MG 3HOZH 3ULJA 3PO2H 3EBEA 1PH2A 4BXXH 5IWAL 3GTGH 5JJIA 4JI7L 2F3IA 1YIJA 4RG1A 1WCMG 2E5LL 5M3MH 1OTCA 2AMCB 4B3MQ 5GAGC 1Y1WG 1HH2P 2ASBA 2Q2IA 4LF6Q 3CF5A 1XMQL 3NENA 3G6EA 1WCMH 4B3RQ 3KF6B 1YI2A 5C4XG 1SMXA 4JG2A 5H1SE 1JJ2A 1WYDA 4OX9Q 2YTXA 2R7ZG 4GN3B 4B3TQ 4EQ5A 5C4XH 1VQCA 4AIMA 4DV7L 2MO0A 1SROA 4XIGS 2I5LX 2VY3A 4HJ5A 4BA1I 1EFWA 4DV3Q 1SFOH 3VDYA 5LMUQ 1CKNA 3S1MH 1PH8A 4IFDJ 4L5TA 1Q82C 2EIFA 4DV5Q 4LF7L 2Q2HA 5DLQE 3GTJH 1PYBA 4YWLA 1EQQA 1YJ9A 1YZ6A 2OCEA 2Z0SA 2V1CC 2AWNA 3GTMH 2RCNA 1KIXA 3M4QA 3T1HL 3PUXA 4LF4L 4Y7NH 3CP0A 4R4QA 3JC66 4Y52H 2NVQH 1NMFA 1EOVA 1PH1A 4POGA 2K5HA 4LUZA 3KOJA 4A3JH 4DR7Q 1RIPA 1VQIA 1P16A 4JBJA 1M90C 2MFIA 1GM5A 1VQDA 1I6HH 1QUQB 4BBRG 1N33L 5ELOA 3S1NH 4HJ8A 1HNWQ 3K0XA 3PGZA 1IXRA 4A3KG 3AFQA 1N36Q 4DK3C 5GAEC 1GVPA 2F4VQ 3HOWG 1EYGA 2JA8G 1WI5A 2WP8J 3K8AA 1PA6A 1VQHA 1VQ5A 1VQ9A 1SN8A 1BBWA 1VCIA 2UU9L 2Q2TA 4LFAL 4C2MH 1SLJA 4PZ8A 4DV1Q 1TWAH 1SRUA 5GROA 4DAMA 3GTLH 1K8GA 1N9WA 4HIOA 1VQ4A 4NXNQ 2ZTDA 2PQAA 3ER0A 4TVAB 4GNXC 1VQOA 1J6QA 1Z47A 2ZTCA 4UP7A 2OTLA 1K0RA 1IBLQ 1HZAA 1HNXQ 1XNRQ 2UXBQ 2OQ0A 1O7IA 4B3ML 1L1OB 1E24A 4A93G 3CC7A 3KF8B 4DR4L 4JYAL 3PUWA 5IT9c 4LUOA 3J80c 1XPOA 5IP7H 3U4ZA 4A3LH 2UUBQ 4JI6L 3U58A 1X55A 4GNXB 3S1RH 2YV5A 1PFSA 1D8LA 5BR8Q 2YTVA 4OX9L 3RLOA 3A5UA 1G6PA 1XMOL 2MQHA 4DPGA 1X65A 5C44H 5IY0A 1PV4A 1PH5A 1R9TH 1C7YA 4B3TL 3I56A 2VQEL 4PG3A 3DLLA 3HKZG 2VUMG 4DV4L 1KQSA 4K0KQ 2E8GA 3E9IA 1B7YB 1VQ6A 1VS0A 5EAYA 1L0WA 4JI1Q 3CMAA 1JJGA 4P75A 4DKAC 4DV6L 4AQYQ 4R1JA 2VUMH 2K50A 1X3GA 3D31A 2JJQA 4OXPA 4BY7G 1NMGA 4LF5Q 5JJKA 2PI2E 2A19A 3TREA 3PSIA 1JJCB 2VS1A 3S17H 3L7ZC 4EX5A 4HJ7A 4JCVE 4QY7A 2K14A 2WB1E 2AKWB 1S40A 3CD6A 4DR6L 5IYDH 3FKIG 2JA7G 2UXCL 3CAMA 1X9NA 2BA0A 1MKHA 1RL2A 4O0AA 1VQLA 4J15A 4JC0A 2BA1A 4PZ7A 3AQQA 5GQOA 4AYBE 2E2JH 4JBMA 4LF9Q 2R93G 1T9HA 4R4OA 1FJGL 1I94Q 1N36L 1LM0A 4X65Q 2F4VL 3TS0A 4A3EG 1L2FA 4DR1Q 2JE6I 2WAQG 5C4JH 1WJJA 2R7DA 3L0OA 3UDXA 1NE3A 2K5VA 2PNHA 3CCUA 4GLAC 3GD7A 4DV1L 5FJ8H 5LMNW 1A8VA 1KD1C
chains in the Genus database with same CATH superfamily
1SYFA 2L4NA 3K7AH 4HIDA 4C3JG 2E76C 1CQFA 5E7NA 3G7LA 1V1PB 1DONA 2JN4A 3MVVA 5GADC 2Y0SG 3GDEA 3J80L 1WTOA 2RBMA 5DEHA 3J7AV 4BY1B 1Y1WH 5AJ3L 4JVZA 4IUPA 2E2IH 1JOKA 2UUBL 1PTOH 2F52A 1E0BA 3KDFB 2NVYH 5BR8L 2AWOA 2L9HA 3OTOQ 1K83H 1F2ZA 1MSHA 2E2HB 4A3GG 2DJGC 2F0JA 4GKKL 3LWEA 4L6TB 2KENA 2JA5B 4RKLA 2F0UA 4NP5A 2WV6D 1AH9A 1KLUD 2RDGA 4RH6A 2ZJQA 1PZKD 1S3OA 4DAPA 3JAML 1PH6A 1D5ZC 4DF7A 5HURA 1OXUA 4LF5L 3M3YH 1EY8A 4XT1B 4DV2Q 3T4AC 5M5YB 4DR5Q 1S5FD 1KC8C 3LGJA 1EEID 4H02A 4WFN3 1WVLA 3UDIA 3I4NB 1X3QA 3EN2A 2DN8A 5LMNQ 1A15A 2JA6B 2HHHQ 1NTGA 4P72A 1N34L 1DOMA 2VQFL 3K7UC 2ICIA 1PXUA 3F1ZA 1EIYB 2Q2UA 2IY5B 4DAYB 5ISRA 2F0DA 4R4IA 5K5PA 2LY7A 5KNCA 1LTID 4NW2A 2LSSA 1KRTA 4ABNA 4GKJL 1G2TA 2XTIA 2ZJPA 2N3SA 3KBGA 1KABA 3H3VI 5IGGA 4JI8Q 4DR2L 1Y1WB 4X3UA 2B29A 2E2IB 4F88A 1RODA 4DK6C 1PTOB 5IGDA 2Z6KC 2DGYA 5JJLA 4BY1G 2A1AA 4BS9A 2XWBB 1CUKA 2Z6KA 4DV3L 3A7AB 3KJOA 1LT6D 2DY8A 5K36H 1H9JA 2ZXPA 3H91A 1Y8OB 1B70B 3FHWA 4TQUS 3GTMB 4DK0A 1Y69U 4BBSH 3OHXC 1K8MA 3M3YB 4LF8L 3BDCA 1MJEA 1UUPA 2RCFA 4DR7L 3VA7A 2MGSA 2AHOB 1Y14B 2K33A 4HCSA 4JOIA 2IWHA 3M85A 3S1NB 2MP1A 4L5QA 1WTPA 2JQOA 1Q86C 3IAYA 1LO5D 1BBUA 1UE6A 4XXEA 3U4VA 4C2MB 2LXKA 2BH8A 1QCBD 2RSNA 4HEDA 1H9MA 3DM3A 3CHBD 1N8RC 2D0PA 3MHBA 4A3EH 2JA6G 3L9AX 1SYGA 4G7HC 3M4PA 4IPHA 3J81c 3T51B 3EROA 1YNJD 3K0YA 1S72A 3RLFA 3IL8A 1EL0A 3BG3A 4CDEC 2JXMB 5D3DA 4XYQA 4U673 4A3CH 3KLWA 1EZ6A 3S1RB 4KHPL 4K8JA 5M3FH 1LYLA 2B2TC 1V1PA 2GVAA 3K58A 5C44B 1STNA 2B2TA 2KEEA 3QB3A 2CWPA 4A3MH 2EYOA 4DR4Q 4JYAQ 1KAWA 3PIPA 4QIWB 3CCRA 4IFDH 4JI5Q 5C5LA 1MJCA 3KDFA 4AQYL 3J81j 4KTAA 3HS0C 1TS5A 4LW1A 4OWXB 4RMFA 1F2LA 3CPWA 3D8GA 4DV4Q 1STEA 1KTKA 4O2DA 4HJAA 3S1QH 4TKOB 1Y8NB 3A74A 5GAHC 1AN8A 3VYSA 4ZKBB 3DHQA 1M1KC 4V0BA 1B2TA 2ZJRA 3TZDA 3R3OA 1XPUA 4LF9L 2Z1CA 3ICEA 1O7ZA 4DR1L 4DR6Q 4P73A 3F2BA 1I5FA 1W2BA 4A3EB 2UXDL 2O5JC 2DY7A 2Y0SE 4RCOA 1YNXA 4RHSA 1R4PB 2HIVA 2ZM6Q 5JVH3 3I4MB 1GUGA 2L11A 3CC4A 3ITPA 1NY4A 4PZ6A 2A6EC 2PQAB 5EBDA 4ZKCB 2NYZD 3KFUA 4CDCC 5EKIA 2B8FA 5C3EH 4YCWA 4QCLA 4AYBG 4DAYA 1GHKA 1RDPD 1YNJC 1LTLA 3URYA 3PUZA 1JMCA 4A3DG 3W1BA 1HUMA 2XGTA 2E5LQ 4JI2L 2Z4IA 4CJ2C 1ICFB 1MSGA 1HUNA 1RTNA 1XWEA 1STBA 4A3IB 1MHWC 4ME3A 1XMQQ 3CPFA 5IP7G 2NTTA 3B6YA 5DAUA 4JI4L 2CH4W 2IHFA 4GLVB 3HFZB 5C44G 2D0OA 5D65A 4IO9A 3D4RA 4DAVA 4RWSC 5KIXA 5M5WH 3MA2B 3ZYYX 2E74C 1KDBA 3IRBA 4ZCKA 1NBWA 3ND8A 2FMMA 4P71A 4ZLTF 2CQOA 5JEAH 1YHAA 4DR3Q 2OTJA 1TWHB 2PYKA 5ELDA 2RHQB 2KBNA 4RGTA 3C1EA 1X3PA 3HOWB 5IYCH 2RQXA 4YHHL 2YYZA 1UWVA 2CVRA 2AUKA 3CMEA 2HIXA 4IPGA 2ZXRA 2FMCA 1K8AC 1GO3E 3KJPA 4C1NI 1R4QB 5IYBH 3F2UA 1A3VA 1YBYA 3TP8A 1J9OA 3HOZG 1TWGH 3BVZA 1CKMA 5FJ8G 2GA4B 2DNEA 4A3BG 4JI0Q 1I4GA 3I4MG 3GP7A 3PO2H 3DEOA 5KEEA 4KKTA 2ICEC 4RG1A 1LTSD 1OTCA 3S2DB 2NUCA 3QOJA 5CV5A 3BYTB 2J0TD 4LF6Q 5I2YA 1WCMH 4CDDC 4B3RQ 1JWMD 1YI2A 3HOYB 5C4XG 2RSOA 4JG2A 1JJ2A 3AU7A 5CGKA 2R7ZG 4B3TQ 4JW0A 2F0KA 4HCEA 1SROA 5G3LF 2K05A 4CBVA 2I5LX 2VY3A 2C9OA 1I4PA 3NXWA 5LMUQ 5C5MA 3S1MH 2CW0D 1PTOF 2AQ3B 2XN9C 4IFDJ 5KRUA 3GTJH 4JBMA 1PYBA 1ILPA 1KIXA 3PUXA 4LF4L 3CP0A 2A69D 3NE5B 3CRKC 4FYDA 1L0XB 2R93B 3WOFA 3KOJA 4A3JH 1LTGD 2D2CC 2XNAC 1GM5A 2MUYA 1VQDA 1W6KA 1QUQB 4KD3A 4JPBW 5ELOA 4HJ8A 3K0XA 4A3KG 3AFQA 3HOWG 1EYGA 1WI5A 4I7AA 1SN8A 2HDLA 3GTQB 2UU9L 1PZID 3NWSA 1SLJA 4PZ8A 3GTLH 4FP5D 4O1NA 4HIOA 2B2UA 3SK5A 3H94A 5IOCA 2ZTDA 1XX8A 4EQNA 2PQAA 3ER0A 1J6QA 4UP7A 2OTLA 2B63B 2UXBQ 3U9OA 2OQ0A 5DM63 2F0QA 3KF8B 1AZPA 4A3LH 5IT9c 4LUOA 3J80c 4JI6L 4NDXA 2YV5A 1D8LA 4WRDA 2RA4A 4OX9L 4DXGA 1G6PA 1EY9A 4IQZA 4DPGA 4IUNA 1H9KA 1PV4A 5ELFA 1PH5A 3TP5A 3SVMA 1C7YA 3NK9A 2VQEL 4IUUA 1JQYD 3Q23A 2K7VA 3HKZG 2VUMG 2OXPA 4K0KQ 3E9IA 5CV4A 1VS0A 1UAPA 2E2DC 4JI1Q 1JJGA 5EBCA 4P75A 3J81E 4DV6L 2K50A 1X3GA 1AW7A 3DWQA 3PO3B 3D31A 2CW0C 2E75C 4OXPA 2VS1A 2EYFA 4EX5A 4XQNA 3CKIB 2K14A 2AKWB 3NQIA 1S40A 2A69C 3CAMA 4CDFC 1RL2A 2PO4A 4JC0A 4AYBE 5BN3A 4PZ7A 3AQQA 1EOTA 2R93G 2D5DA 4R4OA 3M4OB 4X65Q 1C48A 1DCZA 2F03A 3HOVB 2JE6I 2WAQG 2HUGA 2PZWA 3UDXA 3HGBA 3GD7A 1BCPB 1A8VA 3KLRA 2O4XA 3CQZB 3DMUA 1A3TA 5D3IB 1F9PA 1H9SB 4K8IA 1C8CA 1YVCA 4F8MA 2I5MX 1WTVA 2R61A 3ND9A 4X66Q 1SNQA 4POFA 1Q8KA 5IP9G 3CU7A 2ZT9C 4DNTB 3O13A 3CCLA 4OEMB 1EY0A 2B63G 5EPLA 1ESFA 3VR5A 3M4YA 1DOLA 4DUYL 2JEAI 3K57A 4BA2I 4YWKA 1JORA 3QWNA 5FKAC 4GOPC 4P2CB 1PRTB 5EPJA 3K5NA 2F0NA 2DJFC 3I3CA 1OXXK 1Q46A 5IE8A 4GOPA 2HCCA 2KHJA 3HOUB 1SYEA 3A8KE 2Z6BA 3DXJC 3AEVA 2R92H 4IFDI 3HEJA 3VR3A 4C3IG 4MN3A 3NWTA 4HJ9A 4DV0Q 3RZOH 4JV5Q 2NBFA 1BOSA 3PO3G 2EVBA 1LV9A 2SOBA 4XDXA 5TSSA 1RD9D 3T1YQ 4NXML 4QGUA 4DUZQ 4A3FG 2QKIC 4R4CA 2HT1A 3HG9A 1I94L 4IUVA 5A2QE 1FVIA 1RHPA 1HHVA 3OW2A 4IURA 1FGBD 5HGQA 1GOZA 3HOVG 1EIHA 4JI3Q 1B50A 1X6OA 4PNYA 4H13C 4HTHA 1VF7A 2QILA 3I8ZA 1J5EQ 3MEFA 1KLGD 2IHEA 5LL6X 4X62Q 1YJWA 1VQBA 1G91A 4JI7Q 4V190 4A93H 2M2LA 1E22A 1IW7D 1OXTA 1GJXA 2MJ8A 3RNUA 1TY0A 1HQRD 5T1IA 2CWAA 2A68D 4KY5A 1MD2D 3KF8A 3OTOL 5CORA 2F0MA 3J7ZC 4DNIA 3H0GG 5I9OA 1BDOA 4HSPA 4KK7A 3IFTA 1BQQT 4DV5L 4DV7Q 1RCVD 1HCZA 1K73C 5CMDA 4Y7NB 3MXPA 2NVQB 2NVTH 2KA7A 2SEBD 3CW2C 1TU2B 3FMCA 4BY7H 2BOSA 4K14A 1FL0A 4KV6A 1E3PA 4OO1G 1Y1VG 3G48A 4DXFA 4DV2L 4LNQA 3HOUG 1DD2A 5DM73 1A62A 3FKIH 3UI2A 3W3AA 3CCQA 1ZEQX 4NPSA 4A75A 3J7AF 1VQEA 1TWAB 2WB1B 4YY3Q 5EGTA 3G71A 3C3LA 1BVSA 3LX0A 2CH4A 3OMGA 1Q7YC 3I55A 4X3SA 1RJTA 1IBKQ 3HOXG 4C3HG 1CSQA 4LFAQ 1D5XC 3A8JE 2KVMA 3FP9A 1XJVA 1HNXL 1I4XA 4BXXG 3GTPH 1QG7A 2KHIA 1D7QA 1A2UA 3SDZA 4GLXA 2NN6H 1V9PA 1AE2A 4JI8L 1LT5D 3NTIA 1SAPA 1H9SA 2JP1A 3HKZE 4A93B 2ES2A 4FF4A 4GN4B 4DNRB 1G2SA 3S15H 4KKUA 1E2ZA 1N32Q 1IW7C 1TQOA 1IZ6A 1STHA 1TXYA 2WACA 5JAVA 2F0HA 2A68C 2R7FA 4A4IA 2AQ1B 4UP8A 2K5WA 2NWGA 1HXYD 1X32A 2PCFB 1NAPA 1AE3A 5JVG3 3NELA 1CZGA 4R8NA 3PMFA 3GV6A 1RKNA 2L55A 1HZ9A 1Q8IA 4LJZC 2QW7A 4AH6A 5NUCA 3M7NA 4BY7B 3RLNA 1BO0A 1ZXTA 1PDQA 2WAQE 4LMQD 3M7GA 1QVGA 3OIQA 3A7LA 3LNNA 2A73B 4IPDA 3A55A 3W1GA 1D5MC 2CCZA 3C2PA 3NQTA 5IT9E 3J80E 2PMZB 2BDNA 4CKBA 1SSOA 2EJMA 1KHIA 4B9WA 1WTHA 2UXCQ 1CTMA 1U4LA 4YCVA 3L2PA 4JBKA 3K7AB 3MXNB 4QUFA 3BVGA 1FJGQ 3WDNA 3MFGA 2WB1G 3X3NA 2B8GA 3IKJA 1ML0D 1TWCH 2TSSA 1SE8A 1STAA 2H5XA 4CKCA 4NB3A 2PPBC 3GTPB 2KCMA 1JOOA 1VQFA 2MO1A 5EQ0A 1SNCA 1VF5C 2C35B 4HMJA 2OQKA 2OEOA 2NVYB 3OSOA 4IOCA 4LWCA 3F2DA 1K83B 4A3DH 1B9NA 1PYWD 3PQIA 1BCPF 2KUMA 4G57A 4K6LA 4GNXA 1TS4A 5AJ3Q 1VQMA 3EJIA 2X6LA 1QE6A 3CCJA 1LT3D 1HFGA 2LXJA 4JI5L 4KY7A 4PV1C 3K81C 4L5RC 4L5SA 3GTKH 2Q8RE 3PF4A 5ELCA 2JA5G 4DN4M 4WJ4A 4JOIC 4GKKQ 4B9XA 2ALYB 3F8TA 1EU4A 4LF7Q 1STGA 3R93A 4JBWA 1M4VA 2BH2A 1O7YA 3UDFA 3R2TA 5IYDG 1LABA 1T5XD 3I4NG 3KUPA 2B3GA 1HR0L 5AFWA 2L15A 3NBHB 2H1EA 2GN5A 4LFCL 4QL5A 1TS3A 4XYOA 2JEBI 1N34Q 4R4TA 2VQFQ 3BJUA 3OPOA 2ZM6L 2O5IC 1DZ1A 4H7BA 5FLXc 4WJ3M 3E0JA 4U68A 5G3LD 4ZUJA 5CC4A 3HOZH 1SE4A 3ULJA 1PH2A 5IWAL 1GUTA 3GTGH 1Z7TA 4RAUC 1PTOD 3RUZA 5M3MH 2E5LL 5I9PA 2AUJD 4B3MQ 5GAGC 4HN7A 1Y1WG 2WIIB 1F77A 1XMQL 3NENA 1SDFA 3G6EA 5CV9A 1SMXA 4QF4A 5H1SE 2L5TA 4GN3B 4XQQA 5ELEA 3NHHA 5C4XH 2G5DA 1GUWA 1FNVA 3PIO3 2MO0A 2B2YA 4BBSB 1IL8A 4DV3Q 1SFOH 1B9MA 3VR4A 4EVOA 2RVLA 1SMYD 2XWJB 2EIFA 3VYUA 2RCNA 3MXUA 3R8BA 3T1HL 4DGZA 4Y52H 2EOTA 3JC66 1EOVA 4POGA 1ZKOA 4DR7Q 1WD0A 5CV7A 1VQIA 1P16A 2MFIA 3GQBA 1VDZA 2RDHA 1MGSA 1AEXA 1N33L 4UDUC 4LK1C 3PGZA 1DJRD 1GVPA 3SR1A 2WP8J 1VQ5A 1NR2A 4Z9CB 2Q2TA 2N55A 1SRUA 5GROA 1ONLA 1K8GA 1N9WA 2EY5A 3SHLA 2F0WA 3FDTA 3HRZC 5JJZA 1G6ZA 1VQ4A 1HPCA 3MXNA 5M3FB 4J1MA 1K0RA 1SYBA 1HZAA 5KNDA 3DEPA 4A3MB 1PTOC 3FPUB 4QUCA 1L1OB 4N9PA 1PZJD 2HD3A 1X55A 4ILWA 1PFSA 3G6JB 1ENAA 1FR3A 3RLOA 5C6AA 1K0SA 1XMOL 2MQHA 5IY0A 4B3TL 1QB5D 4N8FA 4KMUC 1M8AA 4KD4A 1KQSA 2F0OA 3D4DA 2E8GA 1WTWA 3S1QB 1BBXC 1W6JA 4DKAC 1I4HA 1V8QA 3BZDB 4AQYQ 4R1JA 2VUMH 3FEWX 4QB4A 4TSSA 4K5WA 3MTSA 1SMYC 5JJKA 2A19A 3TREA 5C0XH 3PSIA 3S17H 1PLFA 2P5ZX 4M8AA 2WB1E 1XYIA 2AQ2B 2BA0A 1MKHA 4O0AA 2E2JH 2BA1A 4LF9Q 1HQMC 4UAIA 4OIJA 5EKKA 1LM0A 5C3EB 3C46A 3BVMA 3NP8A 3TS0A 4A3EG 1SEBD 4DR1Q 5DNFA 5C4JH 1WJJA 3NBHA 2KQ3A 2R7DA 3V96A 5F2DA 2QF7A 4RGNA 1UEBA 1IBMQ 4IUTA 1QVFA 5C4HA 5CBEE 3HZXA 1HR0W 2K04A 3VYTA 2J4XA 1ASZA 4A3CG 1HJPA 4I7ZC 3NEMA 3PF5A 4K6DA 2RHSB 4KI0A 1UE5A 5M3FG 2UXBL 1Z9FA 4A3IG 4FF1A 3IFDA 1JOQA 1W3SA 3I72A 3PCOB 2LMCB 1OXSC 1S5BD 3TP7A 3E5SA 2PZTA 5IP9H 2EYPA 3S14H 4A3MG 3U9SA 1S4ZA 3KYHC 3QG1A 5M5WB 1HNZQ 3T56B 1EY7A 4LFBL 2KCCA 1CZWA 2NN6I 5I2XA 4IFDG 2EJFC 2BCOA 3SGIA 1KAAA 3ERQA 3GTOH 1DYQA 3UE1A 4JI4Q 5JOBA 4K0KL 1VQPA 4JI1L 2LS01 2B2VC 1LTTD 4YIJA 4YCUA 4HSVA 4KHVA 3K59A 4DU9A 1JB7A 2B2VA 2NZHA 2VZAA 1K28A 1EY5A 4B3SL 2UUCQ 3S17B 3D0FA 2Q8IB 3G4SA 2PMZE 2TMPA 2K32A 2N78A 3V05A 3H15A 4C3IH 3NTHA 1VQJA 2EE1A 2JK8A 2K52A 3SK8A 4MNOA 2E2JB 3QJYA 4BBRH 4OONA 1CHPD 2XSCA 4WJWA 3BZCA 1TWGB 2B2UC 5FOBB 3UDGA 4X65L 2JA8H 1SR3A 4G7OC 5ELNA 4ZAIA 3E0EA 3PO2B 2Z9HA 2UUAQ 2KJXA 2CKZB 4RGMA 5C3EG 2K5NA 1HZCA 1QZHA 2MNAA 5J1ZA 2SNMA 1WCMB 4X66L 3TEHB 3D6CA 4MTNA 4FDBA 1OO9B 2OF1A 3OW7A 3HOYG 2Q8TA 2XIWA 1CT1D 3S1MB 1UE7A 3GTOB 1WFQA 3MFYA 4FXKC 3S16H 1QOHA 4XQJA 3GTJB 1D6EC 2K5DA 3H0GH 1XPRA 1K9MC 1EQVA 3NSWA 5FLXE 2R6GA 4UPAA 3L3OC 3T53B 3JAMc 1ET6A 1BR9A 1XNQQ 5E4WC 4A3JB 5FK9C 1WTRA 5JEAJ 3NPPA 4DV0L 4JV5L 3RN5A 5FLMG 2EY6A 1HNWL 1I4RA 5IGCA 3STBD 4OO1H 3A54A 2JA7H 5IYCG 3FPPA 4CHTB 3NTKA 4DFAA 1I4QA 1F9RA 5C0XJ 4DUZL 2IT1A 1QJOA 3GTLB 5T1GA 4UY8C 4RFBA 2YTYA 1EWIA 3MWYW 4F7XA 4NXNL 1DXMA 2A6HD 3ONAB 3TRZA 1CSPA 3TN2A 1PFBA 4JI3L 4C3JH 3HOXH 1IBLL 1JCKB 2NVXH 1XNRL 1IHZA 3PO2G 3AMUA 4C3HH 1C9OA 1SXTA 4QIWE 1J5EL 4X64Q 1MBYA 1E7ZA 4X62L 1SYDA 2K5QA 4LUVA 1G51A 5J3BA 3MXGA 5I6WA 3NUCA 3WWVA 2ATWA 3M9BA 4QJFA 1JR0D 3OYYA 4JI6Q 3A5ZB 1EU3A 4L63B 4A3GH 2EY1A 3E6ZX 1PH3A 2YU9H 3ULLA 5CBAE 1VQNA 1NUCA 2ZTEA 2QEXA 2VQEQ 4QQBX 3QOLA 1YITA 2PQEA 1CM9A 1KL9A 4CJ0B 2QEJC 4FO2A 3S2HH 3TMEA 3RZDH 1F9SA 4DV6Q 1S5DD 2MHVA 3U50C 1IYVA 3W5OA 1CHQD 3TSSA 3EFXD 4A3JG 2EYJA 1SNOA 5A35A 2I0QA 5I4DA 5EJWA 3STBC 3EIVA 1QUQA 2GVBA 4ULLA 3W2DA 4IJHA 2HCIA 4YY3L 1BCPD 1EUJA 2DUDA 4FF3A 1TS2A 2F4IA 1IBKL 1EIFA 1SE3A 2KOLA 1NCVA 2NTSA 4CKEA 1I3QH 3K5MA 1YHQA 2A6HC 3A0JA 2NVXB 4KJOA 1IL2A 2Y0SB 2VB3X 3J81i 4RCNA 2SDFA 4JK1C 1Q81C 1UE1A 1LTRD 4O42A 1QVCA 1U4RA 4A3LG 3VR2A 4H0LC 1DGSA 4ZRZA 1N32L 3A8IE 3I7FA 1A6XA 1PRTD 2NB0A 2WINB 3SXHA 1U5KA 4BY1H 1Y8PB 1B4OA 2HDMA 1X54A 3NBIA 4OIKA 1B1ZA 2IL8A 3PIOA 1O78A 3CCMA 2G9HD 1C0AA 1VQAA 3PV0A 3TDQA 4DUYQ 1ILQA 1CK1A 2R92B 3EQLC 2EXZA 1U0LA 2E2HH 4HIMA 3RZOB 4XTCS 3D4WA 2VL6A 2RF4A 2CHBD 2Z8LA 4DR5L 1PFMA 4QMGA 2JA5H 3S24A 1HTPA 3BDLA 3H6MA 1HA6A 2PW7A 1A2TA 5LMNL 3GO5A 1C4QA 1F2MA 2F0EA 3HKSA 5KNBA 5M9OA 1DOKA 4CGYB 4K2LA 3F2CA 2PNRC 3H3VC 2EYMA 2PZUA 1A0IA 5M5YH 4PMWA 4LAAA 2K6AA 3CC2A 5C0XI 3I4NH 4NXMQ 4KHZA 4FVMA 2JA6H 1BCPC 1IYJB 1GXDC 2F0SA 2K75A 5E4XA 1AP0A 1E2WA 1E1TA 1I3QB 1QILA 1TWFH 3ULPA 3MEHA 2VW9A 4IOAA 1BKBA 5J39A 5C3WA 2J7ZA 4I65A 2G9DA 2F3IA 4N9TA 4B08A 3E3XA 2R3ZA 1HH2P 5IT9L 3CF5A 3KF6B 1WYDA 1DM0B 3TZUA 5FO9B 3R2IA 4R8IA 2YTXA 1PRTC 3X3MA 4EQ5A 4AIMA 4K2KA 2K28A 5KGUA 4HJ5A 2NVTB 2F0IA 4KKSA 1EFWA 1ET9A 1JICA 1EWHA 1EY4A 4L5TA 1T5EA 4DV5Q 3DM1A 4LF7L 2R92G 4YWLA 1YJ9A 2OCEA 2Z0SA 2V1CC 2AWNA 2H4OA 3FKIB 3GTMH 4R4QA 1NMFA 1S5ED 3SK4A 2K5HA 1RIPA 4JBJA 1ZYRD 3P75A 2X69A 3S1NH 4UHVA 3Q24A 1N36Q 4DK3C 2F4VQ 3K8AA 1VQ9A 1VQHA 2I46A 1BBWA 1JE4A 3QIAA 4MTKA 4C2MH 4DV1Q 1TWFB 4DAMA 2EPBA 1HRJA 3V2TA 4RKBA 5L37A 3JAME 2K1BA 1CQVA 4TVAB 1BNZA 2V4DA 4GNXC 3S15B 2ZTCA 2D9UA 3BDOA 3I70A 1HNXQ 1EZ8A 3D6WA 1O7IA 4B3ML 3FRPB 4A93G 3CC7A 2KECA 4DR4L 4JYAL 4EQOA 3U4ZA 5IP7H 4PMBA 2UUBQ 1Z6HA 3S1RH 2A74C 5BR8Q 2HQEA 4XT3B 4R9WA 3A5UA 1X65A 5C44H 4J6HA 2L1BA 1R9TH 5JPNC 4PG3A 3DLLA 4DV4L 3QO2A 1B7YB 1GUOA 2EYLA 5EAYA 3D3RA 1EYDA 3DWPA 4BY7G 4LF5Q 1PRTF 1JJCB 5LHY1 2K03A 5ELBA 1XTCD 3CD6A 4DR6L 2EJGC 2QDLA 3FKIG 1VMPA 4NKLA 1X9NA 5FO8B 1EEFD 1WTQA 4J15A 3KBXA 3S9WA 1KDCA 1T9HA 1ZYRC 4NMZA 1TWCB 1KDAA 4CJ1B 3L0OA 2BDOA 1NE3A 4IN3A 4OO1I 5FJ8H 5LMNW 1KD1C 2A6ED 4KJNA 3N6RA 4A3BH 4GKJQ 4AYBB 2XVSA 3PUYA 1Q1EA 3DUZA 4K5XA 1EQTA 3I4MH 1X3EA 1EQRA 3CCSA 4A3DB 4A76A 1JT8A 2NN6G 3SK6A 4DR2Q 1VQ7A 1LACA 1OXVA 1VQKA 1I6VC 2ID0A 2B2YC 1PYSB 1FD7D 1I50H 2KCTA 3GTKB 3CXCA 4A3IH 4IZ8A 2R7ZH 1SBBB 1R9TB 2F0TA 3KF6A 3J80i 2ENBA 1D1IA 1SYCA 1B8AA 4GZYC 2HQLA 4DR3L 1LLRD 4X3KA 1PH7A 2Z4HA 5CV8A 4LF8Q 1EYCA 1D2BA 1K3BC 3MZ5A 1X3FA 1TVXA 1TR5A 3ERSX 1TT2A 1TWHH 2CFMA 3J7A5 2WFWA 1WTXA 1KNEA 2BE5D 3JAMi 3EA6A 4EGVA 3K5OA 5CYUA 4A3KH 1HR0Q 3HOWH 5HY6A 2HHHL 4JI0L 2DNCA 1YNND 1YJNA 3KLSA 3VR6A 4LFCQ 5I6YA 3N52A 3PUVA 3HOZB 1ASYA 1CFMA 1LT4D 3GTGB 1B44D 4A3BB 1WOCA 3BYYB 1G291 5M3MB 5EPKA 1WD1A 2EXDA 5E1FA 1IBML 4HMIA 1UNSA 3CCEA 2IX1A 4LF6L 3SEBA 2OT2A 2SNSA 4KHPQ 4B3RL 5JPMC 5IWAQ 1S5CD 1STYA 2IW3A 3UE0A 4IJLA 1VMCA 4M1UB 1I50B 5C4XB 4X3TA 4F87A 1A63A 1LUZA 4GN5A 3I73A 3S2DH 3FVQA 1SFOB 2R7ZB 1HNZL 5K36G 2QA4A 3OMCA 3ZJYC 5LMUL 1II3A 2LFNA 2F0PA 4IPCA 3HOYH 1K8OA 3BZKA 4MHEA 2F0VA 1MIUA 1GKHA 1G8ZD 4BBSG 2VB2X 3KLSX 2NZOA 1F9QA 1QWYA 4KLKA 3CCVA 1PHJA 4ALPA 1O7LA 2N49A 1SNMA 4GS3A 2N8NA 1KXLA 2UUCL 4FF2A 1Q3LA 1V1OA 3I4LA 1U4PA 4FXGC 4YWMA 1KNAA 1GUSA 3T1HQ 2N88A 3I90A 1IYUA 1AFPA 4ZYSA 1QNUA 5FLMH 4FXDA 2EQSA 4A3KB 3K80C 2R93H 2BE5C 1H95A 2UXDQ 1SJHD 2QGQA 5HGTA 1N33Q 2M9VA 2FHTA 1L0YB 3I4OA 2UUAL 3Q8DA 1YNNC 2IPKD 2F3WA 1U9RA 3K5LA 1CKOA 1V1QA 2M00A 3GTQH 3RN2A 2A8VA 3HP3A 5FO7B 4JI2Q 5M3MG 2EDGA 4OWWB 3A56A 2RDFA 3AB9A 1GUNA 1VQ8A 2QDBA 1CI3M 2EY2A 4MZ9A 2VNUD 3VA5A 5KYLA 2B63H 1PH9A 5M5XH 1CKNB 3HKZB 2VUMB 1ENCA 2C5CA 1JE5A 1XMOQ 4KY6A 4GOPB 4E6IA 2FFKB 1H9RA 4OWTB 1FGUA 3MAQA 1XNQL 2F3VA 4EQPA 1AZQA 3PO3H 2FJ2A 1HZBA 2OWOA 1Q1BA 1E2VA 4YHHQ 3WOEA 5C4JB 2KEDA 4A3FH 3EVQA 1HA5A 4PMCA 1IKLA 3AYHB 4ZK9B 3TBIB 3J81L 2WAQB 1FYCA 3H3VH 1LTBD 5C3XA 1IKMA 1SNDA 1ESRA 4HIKA 1PH4A 2XRQD 1PVOA 5FLXL 1F2YA 1LTAD 4UP9A 3M4OH 2B2WC 4APVA 3KK7A 1V43A 2F0GA 5E3FA 1QZGA 3HOVH 3I2ZA 1O80A 1BUVT 1GD7A 1VQGA 2B2WA 3Q0AA 1L1OC 1FNUA 1D1KA 1JWSD 3CQZH 3S14B 2L12A 3LWUA 4X64L 1CA5A 5IGEA 3C1FA 1L1OA 4ID6A 4Q5VA 4KN4C 3MC0B 4C1NK 1P8LA 1YHBA 2K4KA 1E1OA 3OWFA 5M5XB 3TQYA 1A3UA 3PIP3 2MPMA 5BN5A 2RKSA 5IIFA 4ME5A 4LFBQ 3Q22A 4X6AH 3Q6SA 4OL7A 5JEAG 3BU2A 4P74A 3TP6A 1PMRA 1U4MA 4WORA 4HAEA 3T16A 1KRSA 1EWCA 3J7YW 3TS2A 3P1HA 4DA2A 4HR7B 2IX0A 2I07B 1XXGA 3E9HA 4C3IB 4PQXA 1NJIC 1Q12A 4Q0FA 5C0XG 1Y1VH 4LF4Q 2F1MA 3DWAA 2WKDA 3T1YL 4BBRB 3HOUH 4B3SQ 1K3RA 2D62A 3AFPA 5IGBA 2FXQA 5IGFA 2JA8B 1YEZA 4FNFA 4A3FB 3QR8A 2I5HA 1Q90A 2IJ0A 5IYBG 2PI2A 4RA8A 1NSNS 5C4ZA 4OHJA 2UU9Q 3OIPA 5J22A 1B3QA 1XTDA 4S3SA 1X56A 2JYOA 2JA9A 3RR5A 4ODGA 4BXXH 3EBEA 3GV3A 5JJIA 4JI7L 1YIJA 1WCMG 3OOCA 2AMCB 1HFNA 1TY2A 5KYIA 2ASBA 2Q2IA 3VYRA 1MI2A 2XRSD 1SNPA 4N8X1 5A2QL 3S16B 3BS1A 4OX9Q 1JWUD 3H0GB 1TKWB 1VQCA 4DV7L 2CQAA 2A5HA 1QNKA 2NZ1D 2PW5A 4XIGS 4BA1I 1NNXA 5CR3A 3VDYA 4RHRA 1CKNA 1SE2A 4IALA 1PH8A 2K01A 1Q82C 2Q2HA 5DLQE 1EQQA 2L0CA 5CV6A 1YZ6A 4DK1A 1Y1VB 1EYAA 1BF4A 2JA7B 5COYA 3M4QA 2EZVA 4Y7NH 1EY6A 2NVQH 1ICWA 1B53A 3SE0A 1HTLD 4L8JA 1PH1A 4LUZA 1JC7A 4OGQC 1M90C 3RD4A 2KCNA 2F0LA 1I6HH 4BBRG 2ZXOA 1HNWQ 1IXRA 1ENFA 5GAEC 2FINB 4G4KA 2JA8G 1TIID 1PA6A 1RTOA 2F0FA 5D14A 4C3JB 3HOXB 1VCIA 4LFAL 1EIGA 1TWAH 3T13A 4C3HB 4NXNQ 3K6OA 1VQOA 1Z47A 2VXWA 1IBLQ 1XNRQ 1JB3A 4IUQA 2JSOA 3RMHA 1E24A 4H44C 2KHSA 2O2LD 3PUWA 1BXTA 1XPOA 4A3GB 3U58A 4GNXB 2YU9B 1B3AA 2YTVA 4C56C 4J8QA 1J8IA 4OELB 3P7JA 3I56A 4BWGB 4TRDA 3S2HB 3RZDB 2B39A 1VQ6A 1PFNA 1L0WA 3CMAA 1SJED 3OWEB 2JJQA 1NMGA 2PI2E 1RF2D 3L7ZC 4HJ7A 2EYHA 2LKVA 4JCVE 1NR4A 3P20A 1GHJA 3H09A 4QY7A 5EKLA 4KN7C 5IYDH 2JA7G 2UXCL 2IX3A 1CA6A 5IODA 4G7ZC 1I6HB 1VQLA 2X6GA 2QCPX 2WKCA 5GQOA 5BN4A 4MIUA 4RGOS 1FJGL 1I94Q 1N36L 1FNWA 2F4VL 4ZQ3A 1L2FA 3CRLC 4ZUIA 1EFID 3I91A 1UEAB 4DV1L 2PNHA 2K5VA 3CCUA 4GLAC 5LL6S 4K5VA
chains in the Genus database with same CATH topology
4A3BH 4GKJQ 3PUYA 3K7AH 4HIDA 1UEBA 1IBMQ 1Q1EA 1QVFA 3I4MH 1X3EA 1EQRA 5E7NA 3CCSA 1YVCA 1HR0W 4A76A 1JT8A 1ASZA 4A3CG 5GADC 2I5MX 2Y0SG 1HJPA 2NN6G 3GDEA 4DR2Q 3NEMA 3PF5A 4X66Q 4POFA 1VQ7A 2RHSB 1OXVA 1Q8KA 1UE5A 4KI0A 5IP9G 5M3FG 1Y1WH 2ID0A 1Z9FA 1VQKA 2UXBL 5AJ3L 4A3IG 2E2IH 1PYSB 1W3SA 3PCOB 3CCLA 1OXSC 1I50H 2UUBL 2F52A 5IP9H 3KDFB 4A3MG 2B63G 3S14H 2NVYH 5BR8L 2KCTA 3KYHC 1HNZQ 3CXCA 4A3IH 4LFBL 2AWOA 3OTOQ 4OO1I 1K83H 2JEAI 4DUYL 2NN6I 2R7ZH 4IFDG 3KF6A 4BA2I 4YWKA 3J80i 3SGIA 3GTOH 4A3GG 4GOPC 3UE1A 4JI4Q 4GKKL 2KENA 4K0KL 1B8AA 1VQPA 2HQLA 1AH9A 1OXXK 1Q46A 4JI1L 5IE8A 4DR3L 1S3OA 4GOPA 2ZJQA 1PH7A 2KHJA 4YCUA 1PH6A 4LF8Q 1JB7A 1OXUA 2NZHA 3AEVA 2R92H 2VZAA 4B3SL 4LF5L 3M3YH 4IFDI 2UUCQ 4DV2Q 4HJ9A 4DV0Q 3RZOH 3D0FA 3G4SA 4JV5Q 2PMZE 1X3FA 4DR5Q 1KC8C 3LGJA 3PO3G 2N78A 3H15A 4H02A 4C3IH 3ERSX 3UDIA 1TWHH 1VQJA 2CFMA 3J7A5 3EN2A 2WFWA 2JK8A 2K52A 5LMNQ 3T1YQ 4MNOA 4NXML 2HHHQ 1NTGA 4QGUA 3JAMi 4DUZQ 4A3FG 4BBRH 4OONA 4P72A 1N34L 4R4CA 2VQFL 2HT1A 3K7UC 3BZCA 4A3KH 3UDGA 1I94L 1HR0Q 4X65L 3HOWH 2JA8H 5HY6A 3F1ZA 1SR3A 1EIYB 2Q2UA 2IY5B 5ELNA 4JI0L 4DAYB 4LFCQ 1YJNA 1FVIA 3E0EA 3PUVA 1ASYA 4R4IA 2UUAQ 3OW2A 2CKZB 5C3EG 1WOCA 2K5NA 1HZCA 1G291 2LSSA 1KRTA 5HGQA 3HOVG 4GKJL 4JI3Q 1QZHA 2EXDA 2XTIA 2ZJPA 1IBML 1X6OA 2N3SA 2MNAA 3CCEA 3H3VI 2IX1A 4LF6L 4JI8Q 3MEFA 4DR2L 1J5EQ 4KHPQ 2IHEA 4B3RL 4X66L 2B29A 4X62Q 3TEHB 5IWAQ 1VQBA 1YJWA 4MTNA 4FDBA 3UE0A 4IJLA 4JI7Q 4A93H 1E22A 1OXTA 4DK6C 2Z6KC 2DGYA 1A63A 1LUZA 4GN5A 3HOYG 3RNUA 5JJLA 3S2DH 2CWAA 4BY1G 2A1AA 1HNZL 5K36G 3OTOL 1CUKA 2Z6KA 3J7ZC 2QA4A 4DV3L 3ZJYC 1UE7A 4DNIA 3H0GG 1WFQA 3KJOA 5LMUL 3HOYH 4IPCA 3BZKA 1MIUA 1GKHA 3S16H 4BBSG 2NZOA 4DV5L 3H0GH 1B70B 3FHWA 4TQUS 4DV7Q 1XPRA 1K9MC 2R6GA 4UPAA 1K73C 4KLKA 3CCVA 1PHJA 4ALPA 3JAMc 4BBSH 2NVTH 3CW2C 4BY7H 4LF8L 1XNQQ 2N49A 4GS3A 2N8NA 1KXLA 1FL0A 2UUCL 5JEAJ 1MJEA 1E3PA 4OO1G 1Y1VG 3G48A 4DV2L 4DR7L 4DV0L 2AHOB 1Y14B 4JOIA 3RN5A 3M85A 4LNQA 3HOUG 4JV5L 5FLMG 1A62A 4L5QA 2JQOA 1HNWL 4YWMA 3STBD 3FKIH 3T1HQ 5IYCG 1Q86C 2JA7H 3CCQA 1BBUA 1UE6A 3U4VA 5FLMH 5C0XJ 4DUZL 2EQSA 4NPSA 2LXKA 2BH8A 3K80C 4A75A 1VQEA 2R93H 4YY3Q 2IT1A 1H95A 3G71A 2UXDQ 1BVSA 3DM3A 2QGQA 1N8RC 4UY8C 2D0PA 4A3EH 3I55A 1Q7YC 2JA6G 1N33Q 1IBKQ 2YTYA 1EWIA 3HOXG 4NXNL 3I4OA 3M4PA 4IPHA 2UUAL 3J81c 3Q8DA 3TRZA 1CSPA 1S72A 1CSQA 4LFAQ 3RLFA 4JI3L 1CKOA 1V1QA 3FP9A 4C3JH 3HOXH 1XJVA 3RN2A 1HNXL 1IBLL 2NVXH 1XNRL 3GTQH 3GTPH 3PO2G 4BXXG 2A8VA 2KHIA 4C3HH 1D7QA 1C9OA 4A3CH 4GLXA 4QIWE 1V9PA 3KLWA 1AE2A 4JI2Q 4JI8L 1J5EL 5M3MG 4KHPL 4OWWB 4X64Q 5M3FH 1LYLA 3HKZE 1E7ZA 4X62L 1VQ8A 2GVAA 2ES2A 4GN4B 4LUVA 3S15H 1G51A 4MZ9A 2CWPA 5J3BA 1N32Q 2VNUD 4A3MH 3WWVA 2B63H 1IZ6A 2ATWA 1PH9A 1TXYA 3M9BA 4QJFA 4DR4Q 4JYAQ 1KAWA 5M5XH 3PIPA 3OYYA 3CCRA 4JI6Q 1CKNB 3A5ZB 2R7FA 4A4IA 4JI5Q 4A3GH 4UP8A 2R92G 1MJCA 3KDFA 4AQYL 1PH3A 2YU9H 1AE3A 3ULLA 1JE5A 3NELA 3J81j 1XMOQ 1VQNA 4LW1A 4OWXB 2ZTEA 4RMFA 4GOPB 2QEXA 2VQEQ 4QQBX 3CPWA 1YITA 1KL9A 1HZ9A 4AH6A 4OWTB 4DV4Q 3M7NA 4O2DA 4HJAA 3S2HH 1FGUA 3RLNA 3RZDH 4DV6Q 1XNQL 3S1QH 3A74A 3U50C 5GAHC 2WAQE 3W5OA 1M1KC 3PO3H 2ZJRA 1HZBA 1QVGA 1Q1BA 2OWOA 1XPUA 4IPDA 3W1GA 4LF9L 4A3JG 4YHHQ 2CCZA 2I0QA 3ICEA 3STBC 4A3FH 4DR1L 3EIVA 1QUQA 2GVBA 4DR6Q 4P73A 3F2BA 4IJHA 3AYHB 1I5FA 1KHIA 4YY3L 2UXCQ 1W2BA 1EUJA 2DUDA 2UXDL 4YCVA 2Y0SE 3L2PA 1YNXA 3H3VH 4JBKA 2HIVA 1IBKL 3MXNB 1EIFA 2ZM6Q 4HIKA 1PH4A 3CC4A 1FJGQ 1NY4A 4PZ6A 2PQAB 2WB1G 1PVOA 3KFUA 3M4OH 4UP9A 1I3QH 1TWCH 5C3EH 4APVA 1YHQA 3HOVH 1SE8A 1V43A 2H5XA 3A0JA 4YCWA 1QZGA 3I2ZA 4NB3A 4AYBG 1GD7A 2KCMA 1VQGA 1LTLA 1VQFA 2MO1A 1IL2A 3PUZA 1JMCA 2C35B 4A3DG 3W1BA 3J81i 1L1OC 2XGTA 2E5LQ 4JI2L 2OQKA 1Q81C 3CQZH 1UE1A 4X64L 4IOCA 4LWCA 3F2DA 1L1OA 1QVCA 4ME3A 4A3DH 1XMQQ 4A3LG 3CPFA 5IP7G 3B6YA 1DGSA 1P8LA 1YHBA 1N32L 2K4KA 1E1OA 3I7FA 4GNXA 5AJ3Q 4BY1H 1VQMA 1U5KA 4JI4L 3TQYA 2IHFA 4GLVB 3HFZB 3CCJA 1X54A 2D0OA 5C44G 4IO9A 2LXJA 4JI5L 3PIOA 4LFBQ 3CCMA 4X6AH 1C0AA 1VQAA 3PV0A 3K81C 4L5RC 4DUYQ 4L5SA 5M5WH 5JEAG 3GTKH 3BU2A 3PF4A 4P74A 2JA5G 4WJ4A 4JOIC 1U0LA 3IRBA 2E2HH 1NBWA 4HIMA 4GKKQ 1KRSA 4XTCS 3TS2A 2ALYB 3F8TA 2VL6A 2RF4A 4P71A 2CQOA 1YHAA 2IX0A 3E9HA 4DR5L 2JA5H 4LF7Q 3S24A 4DR3Q 2OTJA 1NJIC 1Q12A 5C0XG 4JBWA 1Y1VH 4LF4Q 5LMNL 3T1YL 2BH2A 2RHQB 3GO5A 3HOUH 3HKSA 3F2CA 2HHHL 2KBNA 4B3SQ 1K3RA 2D62A 3UDFA 3AFPA 5IYDG 2FXQA 5IYCH 1A0IA 1YEZA 4YHHL 3I4NG 2YYZA 2B3GA 5M5YH 1HR0L 1UWVA 4PMWA 2I5HA 5IYBG 2L15A 3NBHB 2GN5A 4LFCL 2PI2A 2HIXA 4IPGA 3CMEA 4QL5A 5C0XI 3CC2A 3I4NH 4NXMQ 4KHZA 2JEBI 1K8AC 1GO3E 3KJPA 1N34Q 4R4TA 2JA6H 5IYBH 2VQFQ 1IYJB 3BJUA 2UU9Q 1YBYA 2ZM6L 2K75A 1XTDA 3HOZG 1E1TA 1TWGH 1CKMA 1TWFH 5FJ8G 5FLXc 2VW9A 3ULPA 4IOAA 1BKBA 4WJ3M 4A3BG 1X56A 4JI0Q 2JA9A 3RR5A 3I4MG 3HOZH 3ULJA 3PO2H 3EBEA 1PH2A 4BXXH 5IWAL 3GTGH 5JJIA 4JI7L 2F3IA 1YIJA 4RG1A 1WCMG 2E5LL 5M3MH 1OTCA 2AMCB 4B3MQ 5GAGC 1Y1WG 1HH2P 2ASBA 2Q2IA 4LF6Q 3CF5A 1XMQL 3NENA 3G6EA 1WCMH 4B3RQ 3KF6B 1YI2A 5C4XG 1SMXA 4JG2A 5H1SE 1JJ2A 1WYDA 4OX9Q 2YTXA 2R7ZG 4GN3B 4B3TQ 4EQ5A 5C4XH 1VQCA 4AIMA 4DV7L 2MO0A 1SROA 4XIGS 2I5LX 2VY3A 4HJ5A 4BA1I 1EFWA 4DV3Q 1SFOH 3VDYA 5LMUQ 1CKNA 3S1MH 1PH8A 4IFDJ 4L5TA 1Q82C 2EIFA 4DV5Q 4LF7L 2Q2HA 5DLQE 3GTJH 1PYBA 4YWLA 1EQQA 1YJ9A 1YZ6A 2OCEA 2Z0SA 2V1CC 2AWNA 3GTMH 2RCNA 1KIXA 3M4QA 3T1HL 3PUXA 4LF4L 4Y7NH 3CP0A 4R4QA 3JC66 4Y52H 2NVQH 1NMFA 1EOVA 1PH1A 4POGA 2K5HA 4LUZA 3KOJA 4A3JH 4DR7Q 1RIPA 1VQIA 1P16A 4JBJA 1M90C 2MFIA 1GM5A 1VQDA 1I6HH 1QUQB 4BBRG 1N33L 5ELOA 3S1NH 4HJ8A 1HNWQ 3K0XA 3PGZA 1IXRA 4A3KG 3AFQA 1N36Q 4DK3C 5GAEC 1GVPA 2F4VQ 3HOWG 1EYGA 2JA8G 1WI5A 2WP8J 3K8AA 1PA6A 1VQHA 1VQ5A 1VQ9A 1SN8A 1BBWA 1VCIA 2UU9L 2Q2TA 4LFAL 4C2MH 1SLJA 4PZ8A 4DV1Q 1TWAH 1SRUA 5GROA 4DAMA 3GTLH 1K8GA 1N9WA 4HIOA 1VQ4A 4NXNQ 2ZTDA 2PQAA 3ER0A 4TVAB 4GNXC 1VQOA 1J6QA 1Z47A 2ZTCA 4UP7A 2OTLA 1K0RA 1IBLQ 1HZAA 1HNXQ 1XNRQ 2UXBQ 2OQ0A 1O7IA 4B3ML 1L1OB 1E24A 4A93G 3CC7A 3KF8B 4DR4L 4JYAL 3PUWA 5IT9c 4LUOA 3J80c 1XPOA 5IP7H 3U4ZA 4A3LH 2UUBQ 4JI6L 3U58A 1X55A 4GNXB 3S1RH 2YV5A 1PFSA 1D8LA 5BR8Q 2YTVA 4OX9L 3RLOA 3A5UA 1G6PA 1XMOL 2MQHA 4DPGA 1X65A 5C44H 5IY0A 1PV4A 1PH5A 1R9TH 1C7YA 4B3TL 3I56A 2VQEL 4PG3A 3DLLA 3HKZG 2VUMG 4DV4L 1KQSA 4K0KQ 2E8GA 3E9IA 1B7YB 1VQ6A 1VS0A 5EAYA 1L0WA 4JI1Q 3CMAA 1JJGA 4P75A 4DKAC 4DV6L 4AQYQ 4R1JA 2VUMH 2K50A 1X3GA 3D31A 2JJQA 4OXPA 4BY7G 1NMGA 4LF5Q 5JJKA 2PI2E 2A19A 3TREA 3PSIA 1JJCB 2VS1A 3S17H 3L7ZC 4EX5A 4HJ7A 4JCVE 4QY7A 2K14A 2WB1E 2AKWB 1S40A 3CD6A 4DR6L 5IYDH 3FKIG 2JA7G 2UXCL 3CAMA 1X9NA 2BA0A 1MKHA 1RL2A 4O0AA 1VQLA 4J15A 4JC0A 2BA1A 4PZ7A 3AQQA 5GQOA 4AYBE 2E2JH 4JBMA 4LF9Q 2R93G 1T9HA 4R4OA 1FJGL 1I94Q 1N36L 1LM0A 4X65Q 2F4VL 3TS0A 4A3EG 1L2FA 4DR1Q 2JE6I 2WAQG 5C4JH 1WJJA 2R7DA 3L0OA 3UDXA 1NE3A 2K5VA 2PNHA 3CCUA 4GLAC 3GD7A 4DV1L 5FJ8H 5LMNW 1A8VA 1KD1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B H;  4GKJ Q;  3PUY A;  3K7A H;  4HID A;  1UEB A;  1IBM Q;  1Q1E A;  1QVF A;  3I4M H;  1X3E A;  1EQR A;  5E7N A;  3CCS A;  1YVC A;  1HR0 W;  4A76 A;  1JT8 A;  1ASZ A;  4A3C G;  5GAD C;  2I5M X;  2Y0S G;  1HJP A;  2NN6 G;  3GDE A;  4DR2 Q;  3NEM A;  3PF5 A;  4X66 Q;  4POF A;  1VQ7 A;  2RHS B;  1OXV A;  1Q8K A;  1UE5 A;  4KI0 A;  5IP9 G;  5M3F G;  1Y1W H;  2ID0 A;  1Z9F A;  1VQK A;  2UXB L;  5AJ3 L;  4A3I G;  2E2I H;  1PYS B;  1W3S A;  3PCO B;  3CCL A;  1OXS C;  1I50 H;  2UUB L;  2F52 A;  5IP9 H;  3KDF B;  4A3M G;  2B63 G;  3S14 H;  2NVY H;  5BR8 L;  2KCT A;  3KYH C;  1HNZ Q;  3CXC A;  4A3I H;  4LFB L;  2AWO A;  3OTO Q;  4OO1 I;  1K83 H;  2JEA I;  4DUY L;  2NN6 I;  2R7Z H;  4IFD G;  3KF6 A;  4BA2 I;  4YWK A;  3J80 i;  3SGI A;  3GTO H;  4A3G G;  4GOP C;  3UE1 A;  4JI4 Q;  4GKK L;  2KEN A;  4K0K L;  1B8A A;  1VQP A;  2HQL A;  1AH9 A;  1OXX K;  1Q46 A;  4JI1 L;  5IE8 A;  4DR3 L;  1S3O A;  4GOP A;  2ZJQ A;  1PH7 A;  2KHJ A;  4YCU A;  1PH6 A;  4LF8 Q;  1JB7 A;  1OXU A;  2NZH A;  3AEV A;  2R92 H;  2VZA A;  4B3S L;  4LF5 L;  3M3Y H;  4IFD I;  2UUC Q;  4DV2 Q;  4HJ9 A;  4DV0 Q;  3RZO H;  3D0F A;  3G4S A;  4JV5 Q;  2PMZ E;  1X3F A;  4DR5 Q;  1KC8 C;  3LGJ A;  3PO3 G;  2N78 A;  3H15 A;  4H02 A;  4C3I H;  3ERS X;  3UDI A;  1TWH H;  1VQJ A;  2CFM A;  3J7A 5;  3EN2 A;  2WFW A;  2JK8 A;  2K52 A;  5LMN Q;  3T1Y Q;  4MNO A;  4NXM L;  2HHH Q;  1NTG A;  4QGU A;  3JAM i;  4DUZ Q;  4A3F G;  4BBR H;  4OON A;  4P72 A;  1N34 L;  4R4C A;  2VQF L;  2HT1 A;  3K7U C;  3BZC A;  4A3K H;  3UDG A;  1I94 L;  1HR0 Q;  4X65 L;  3HOW H;  2JA8 H;  5HY6 A;  3F1Z A;  1SR3 A;  1EIY B;  2Q2U A;  2IY5 B;  5ELN A;  4JI0 L;  4DAY B;  4LFC Q;  1YJN A;  1FVI A;  3E0E A;  3PUV A;  1ASY A;  4R4I A;  2UUA Q;  3OW2 A;  2CKZ B;  5C3E G;  1WOC A;  2K5N A;  1HZC A;  1G29 1;  2LSS A;  1KRT A;  5HGQ A;  3HOV G;  4GKJ L;  4JI3 Q;  1QZH A;  2EXD A;  2XTI A;  2ZJP A;  1IBM L;  1X6O A;  2N3S A;  2MNA A;  3CCE A;  3H3V I;  2IX1 A;  4LF6 L;  4JI8 Q;  3MEF A;  4DR2 L;  1J5E Q;  4KHP Q;  2IHE A;  4B3R L;  4X66 L;  2B29 A;  4X62 Q;  3TEH B;  5IWA Q;  1VQB A;  1YJW A;  4MTN A;  4FDB A;  3UE0 A;  4IJL A;  4JI7 Q;  4A93 H;  1E22 A;  1OXT A;  4DK6 C;  2Z6K C;  2DGY A;  1A63 A;  1LUZ A;  4GN5 A;  3HOY G;  3RNU A;  5JJL A;  3S2D H;  2CWA A;  4BY1 G;  2A1A A;  1HNZ L;  5K36 G;  3OTO L;  1CUK A;  2Z6K A;  3J7Z C;  2QA4 A;  4DV3 L;  3ZJY C;  1UE7 A;  4DNI A;  3H0G G;  1WFQ A;  3KJO A;  5LMU L;  3HOY H;  4IPC A;  3BZK A;  1MIU A;  1GKH A;  3S16 H;  4BBS G;  2NZO A;  4DV5 L;  3H0G H;  1B70 B;  3FHW A;  4TQU S;  4DV7 Q;  1XPR A;  1K9M C;  2R6G A;  4UPA A;  1K73 C;  4KLK A;  3CCV A;  1PHJ A;  4ALP A;  3JAM c;  4BBS H;  2NVT H;  3CW2 C;  4BY7 H;  4LF8 L;  1XNQ Q;  2N49 A;  4GS3 A;  2N8N A;  1KXL A;  1FL0 A;  2UUC L;  5JEA J;  1MJE A;  1E3P A;  4OO1 G;  1Y1V G;  3G48 A;  4DV2 L;  4DR7 L;  4DV0 L;  2AHO B;  1Y14 B;  4JOI A;  3RN5 A;  3M85 A;  4LNQ A;  3HOU G;  4JV5 L;  5FLM G;  1A62 A;  4L5Q A;  2JQO A;  1HNW L;  4YWM A;  3STB D;  3FKI H;  3T1H Q;  5IYC G;  1Q86 C;  2JA7 H;  3CCQ A;  1BBU A;  1UE6 A;  3U4V A;  5FLM H;  5C0X J;  4DUZ L;  2EQS A;  4NPS A;  2LXK A;  2BH8 A;  3K80 C;  4A75 A;  1VQE A;  2R93 H;  4YY3 Q;  2IT1 A;  1H95 A;  3G71 A;  2UXD Q;  1BVS A;  3DM3 A;  2QGQ A;  1N8R C;  4UY8 C;  2D0P A;  4A3E H;  3I55 A;  1Q7Y C;  2JA6 G;  1N33 Q;  1IBK Q;  2YTY A;  1EWI A;  3HOX G;  4NXN L;  3I4O A;  3M4P A;  4IPH A;  2UUA L;  3J81 c;  3Q8D A;  3TRZ A;  1CSP A;  1S72 A;  1CSQ A;  4LFA Q;  3RLF A;  4JI3 L;  1CKO A;  1V1Q A;  3FP9 A;  4C3J H;  3HOX H;  1XJV A;  3RN2 A;  1HNX L;  1IBL L;  2NVX H;  1XNR L;  3GTQ H;  3GTP H;  3PO2 G;  4BXX G;  2A8V A;  2KHI A;  4C3H H;  1D7Q A;  1C9O A;  4A3C H;  4GLX A;  4QIW E;  1V9P A;  3KLW A;  1AE2 A;  4JI2 Q;  4JI8 L;  1J5E L;  5M3M G;  4KHP L;  4OWW B;  4X64 Q;  5M3F H;  1LYL A;  3HKZ E;  1E7Z A;  4X62 L;  1VQ8 A;  2GVA A;  2ES2 A;  4GN4 B;  4LUV A;  3S15 H;  1G51 A;  4MZ9 A;  2CWP A;  5J3B A;  1N32 Q;  2VNU D;  4A3M H;  3WWV A;  2B63 H;  1IZ6 A;  2ATW A;  1PH9 A;  1TXY A;  3M9B A;  4QJF A;  4DR4 Q;  4JYA Q;  1KAW A;  5M5X H;  3PIP A;  3OYY A;  3CCR A;  4JI6 Q;  1CKN B;  3A5Z B;  2R7F A;  4A4I A;  4JI5 Q;  4A3G H;  4UP8 A;  2R92 G;  1MJC A;  3KDF A;  4AQY L;  1PH3 A;  2YU9 H;  1AE3 A;  3ULL A;  1JE5 A;  3NEL A;  3J81 j;  1XMO Q;  1VQN A;  4LW1 A;  4OWX B;  2ZTE A;  4RMF A;  4GOP B;  2QEX A;  2VQE Q;  4QQB X;  3CPW A;  1YIT A;  1KL9 A;  1HZ9 A;  4AH6 A;  4OWT B;  4DV4 Q;  3M7N A;  4O2D A;  4HJA A;  3S2H H;  1FGU A;  3RLN A;  3RZD H;  4DV6 Q;  1XNQ L;  3S1Q H;  3A74 A;  3U50 C;  5GAH C;  2WAQ E;  3W5O A;  1M1K C;  3PO3 H;  2ZJR A;  1HZB A;  1QVG A;  1Q1B A;  2OWO A;  1XPU A;  4IPD A;  3W1G A;  4LF9 L;  4A3J G;  4YHH Q;  2CCZ A;  2I0Q A;  3ICE A;  3STB C;  4A3F H;  4DR1 L;  3EIV A;  1QUQ A;  2GVB A;  4DR6 Q;  4P73 A;  3F2B A;  4IJH A;  3AYH B;  1I5F A;  1KHI A;  4YY3 L;  2UXC Q;  1W2B A;  1EUJ A;  2DUD A;  2UXD L;  4YCV A;  2Y0S E;  3L2P A;  1YNX A;  3H3V H;  4JBK A;  2HIV A;  1IBK L;  3MXN B;  1EIF A;  2ZM6 Q;  4HIK A;  1PH4 A;  3CC4 A;  1FJG Q;  1NY4 A;  4PZ6 A;  2PQA B;  2WB1 G;  1PVO A;  3KFU A;  3M4O H;  4UP9 A;  1I3Q H;  1TWC H;  5C3E H;  4APV A;  1YHQ A;  3HOV H;  1SE8 A;  1V43 A;  2H5X A;  3A0J A;  4YCW A;  1QZG A;  3I2Z A;  4NB3 A;  4AYB G;  1GD7 A;  2KCM A;  1VQG A;  1LTL A;  1VQF A;  2MO1 A;  1IL2 A;  3PUZ A;  1JMC A;  2C35 B;  4A3D G;  3W1B A;  3J81 i;  1L1O C;  2XGT A;  2E5L Q;  4JI2 L;  2OQK A;  1Q81 C;  3CQZ H;  1UE1 A;  4X64 L;  4IOC A;  4LWC A;  3F2D A;  1L1O A;  1QVC A;  4ME3 A;  4A3D H;  1XMQ Q;  4A3L G;  3CPF A;  5IP7 G;  3B6Y A;  1DGS A;  1P8L A;  1YHB A;  1N32 L;  2K4K A;  1E1O A;  3I7F A;  4GNX A;  5AJ3 Q;  4BY1 H;  1VQM A;  1U5K A;  4JI4 L;  3TQY A;  2IHF A;  4GLV B;  3HFZ B;  3CCJ A;  1X54 A;  2D0O A;  5C44 G;  4IO9 A;  2LXJ A;  4JI5 L;  3PIO A;  4LFB Q;  3CCM A;  4X6A H;  1C0A A;  1VQA A;  3PV0 A;  3K81 C;  4L5R C;  4DUY Q;  4L5S A;  5M5W H;  5JEA G;  3GTK H;  3BU2 A;  3PF4 A;  4P74 A;  2JA5 G;  4WJ4 A;  4JOI C;  1U0L A;  3IRB A;  2E2H H;  1NBW A;  4HIM A;  4GKK Q;  1KRS A;  4XTC S;  3TS2 A;  2ALY B;  3F8T A;  2VL6 A;  2RF4 A;  4P71 A;  2CQO A;  1YHA A;  2IX0 A;  3E9H A;  4DR5 L;  2JA5 H;  4LF7 Q;  3S24 A;  4DR3 Q;  2OTJ A;  1NJI C;  1Q12 A;  5C0X G;  4JBW A;  1Y1V H;  4LF4 Q;  5LMN L;  3T1Y L;  2BH2 A;  2RHQ B;  3GO5 A;  3HOU H;  3HKS A;  3F2C A;  2HHH L;  2KBN A;  4B3S Q;  1K3R A;  2D62 A;  3UDF A;  3AFP A;  5IYD G;  2FXQ A;  5IYC H;  1A0I A;  1YEZ A;  4YHH L;  3I4N G;  2YYZ A;  2B3G A;  5M5Y H;  1HR0 L;  1UWV A;  4PMW A;  2I5H A;  5IYB G;  2L15 A;  3NBH B;  2GN5 A;  4LFC L;  2PI2 A;  2HIX A;  4IPG A;  3CME A;  4QL5 A;  5C0X I;  3CC2 A;  3I4N H;  4NXM Q;  4KHZ A;  2JEB I;  1K8A C;  1GO3 E;  3KJP A;  1N34 Q;  4R4T A;  2JA6 H;  5IYB H;  2VQF Q;  1IYJ B;  3BJU A;  2UU9 Q;  1YBY A;  2ZM6 L;  2K75 A;  1XTD A;  3HOZ G;  1E1T A;  1TWG H;  1CKM A;  1TWF H;  5FJ8 G;  5FLX c;  2VW9 A;  3ULP A;  4IOA A;  1BKB A;  4WJ3 M;  4A3B G;  1X56 A;  4JI0 Q;  2JA9 A;  3RR5 A;  3I4M G;  3HOZ H;  3ULJ A;  3PO2 H;  3EBE A;  1PH2 A;  4BXX H;  5IWA L;  3GTG H;  5JJI A;  4JI7 L;  2F3I A;  1YIJ A;  4RG1 A;  1WCM G;  2E5L L;  5M3M H;  1OTC A;  2AMC B;  4B3M Q;  5GAG C;  1Y1W G;  1HH2 P;  2ASB A;  2Q2I A;  4LF6 Q;  3CF5 A;  1XMQ L;  3NEN A;  3G6E A;  1WCM H;  4B3R Q;  3KF6 B;  1YI2 A;  5C4X G;  1SMX A;  4JG2 A;  5H1S E;  1JJ2 A;  1WYD A;  4OX9 Q;  2YTX A;  2R7Z G;  4GN3 B;  4B3T Q;  4EQ5 A;  5C4X H;  1VQC A;  4AIM A;  4DV7 L;  2MO0 A;  1SRO A;  4XIG S;  2I5L X;  2VY3 A;  4HJ5 A;  4BA1 I;  1EFW A;  4DV3 Q;  1SFO H;  3VDY A;  5LMU Q;  1CKN A;  3S1M H;  1PH8 A;  4IFD J;  4L5T A;  1Q82 C;  2EIF A;  4DV5 Q;  4LF7 L;  2Q2H A;  5DLQ E;  3GTJ H;  1PYB A;  4YWL A;  1EQQ A;  1YJ9 A;  1YZ6 A;  2OCE A;  2Z0S A;  2V1C C;  2AWN A;  3GTM H;  2RCN A;  1KIX A;  3M4Q A;  3T1H L;  3PUX A;  4LF4 L;  4Y7N H;  3CP0 A;  4R4Q A;  3JC6 6;  4Y52 H;  2NVQ H;  1NMF A;  1EOV A;  1PH1 A;  4POG A;  2K5H A;  4LUZ A;  3KOJ A;  4A3J H;  4DR7 Q;  1RIP A;  1VQI A;  1P16 A;  4JBJ A;  1M90 C;  2MFI A;  1GM5 A;  1VQD A;  1I6H H;  1QUQ B;  4BBR G;  1N33 L;  5ELO A;  3S1N H;  4HJ8 A;  1HNW Q;  3K0X A;  3PGZ A;  1IXR A;  4A3K G;  3AFQ A;  1N36 Q;  4DK3 C;  5GAE C;  1GVP A;  2F4V Q;  3HOW G;  1EYG A;  2JA8 G;  1WI5 A;  2WP8 J;  3K8A A;  1PA6 A;  1VQH A;  1VQ5 A;  1VQ9 A;  1SN8 A;  1BBW A;  1VCI A;  2UU9 L;  2Q2T A;  4LFA L;  4C2M H;  1SLJ A;  4PZ8 A;  4DV1 Q;  1TWA H;  1SRU A;  5GRO A;  4DAM A;  3GTL H;  1K8G A;  1N9W A;  4HIO A;  1VQ4 A;  4NXN Q;  2ZTD A;  2PQA A;  3ER0 A;  4TVA B;  4GNX C;  1VQO A;  1J6Q A;  1Z47 A;  2ZTC A;  4UP7 A;  2OTL A;  1K0R A;  1IBL Q;  1HZA A;  1HNX Q;  1XNR Q;  2UXB Q;  2OQ0 A;  1O7I A;  4B3M L;  1L1O B;  1E24 A;  4A93 G;  3CC7 A;  3KF8 B;  4DR4 L;  4JYA L;  3PUW A;  5IT9 c;  4LUO A;  3J80 c;  1XPO A;  5IP7 H;  3U4Z A;  4A3L H;  2UUB Q;  4JI6 L;  3U58 A;  1X55 A;  4GNX B;  3S1R H;  2YV5 A;  1PFS A;  1D8L A;  5BR8 Q;  2YTV A;  4OX9 L;  3RLO A;  3A5U A;  1G6P A;  1XMO L;  2MQH A;  4DPG A;  1X65 A;  5C44 H;  5IY0 A;  1PV4 A;  1PH5 A;  1R9T H;  1C7Y A;  4B3T L;  3I56 A;  2VQE L;  4PG3 A;  3DLL A;  3HKZ G;  2VUM G;  4DV4 L;  1KQS A;  4K0K Q;  2E8G A;  3E9I A;  1B7Y B;  1VQ6 A;  1VS0 A;  5EAY A;  1L0W A;  4JI1 Q;  3CMA A;  1JJG A;  4P75 A;  4DKA C;  4DV6 L;  4AQY Q;  4R1J A;  2VUM H;  2K50 A;  1X3G A;  3D31 A;  2JJQ A;  4OXP A;  4BY7 G;  1NMG A;  4LF5 Q;  5JJK A;  2PI2 E;  2A19 A;  3TRE A;  3PSI A;  1JJC B;  2VS1 A;  3S17 H;  3L7Z C;  4EX5 A;  4HJ7 A;  4JCV E;  4QY7 A;  2K14 A;  2WB1 E;  2AKW B;  1S40 A;  3CD6 A;  4DR6 L;  5IYD H;  3FKI G;  2JA7 G;  2UXC L;  3CAM A;  1X9N A;  2BA0 A;  1MKH A;  1RL2 A;  4O0A A;  1VQL A;  4J15 A;  4JC0 A;  2BA1 A;  4PZ7 A;  3AQQ A;  5GQO A;  4AYB E;  2E2J H;  4JBM A;  4LF9 Q;  2R93 G;  1T9H A;  4R4O A;  1FJG L;  1I94 Q;  1N36 L;  1LM0 A;  4X65 Q;  2F4V L;  3TS0 A;  4A3E G;  1L2F A;  4DR1 Q;  2JE6 I;  2WAQ G;  5C4J H;  1WJJ A;  2R7D A;  3L0O A;  3UDX A;  1NE3 A;  2K5V A;  2PNH A;  3CCU A;  4GLA C;  3GD7 A;  4DV1 L;  5FJ8 H;  5LMN W;  1A8V A;  1KD1 C; 
#chains in the Genus database with same CATH topology
 1SYF A;  2L4N A;  3K7A H;  4HID A;  4C3J G;  2E76 C;  1CQF A;  5E7N A;  3G7L A;  1V1P B;  1DON A;  2JN4 A;  3MVV A;  5GAD C;  2Y0S G;  3GDE A;  3J80 L;  1WTO A;  2RBM A;  5DEH A;  3J7A V;  4BY1 B;  1Y1W H;  5AJ3 L;  4JVZ A;  4IUP A;  2E2I H;  1JOK A;  2UUB L;  1PTO H;  2F52 A;  1E0B A;  3KDF B;  2NVY H;  5BR8 L;  2AWO A;  2L9H A;  3OTO Q;  1K83 H;  1F2Z A;  1MSH A;  2E2H B;  4A3G G;  2DJG C;  2F0J A;  4GKK L;  3LWE A;  4L6T B;  2KEN A;  2JA5 B;  4RKL A;  2F0U A;  4NP5 A;  2WV6 D;  1AH9 A;  1KLU D;  2RDG A;  4RH6 A;  2ZJQ A;  1PZK D;  1S3O A;  4DAP A;  3JAM L;  1PH6 A;  1D5Z C;  4DF7 A;  5HUR A;  1OXU A;  4LF5 L;  3M3Y H;  1EY8 A;  4XT1 B;  4DV2 Q;  3T4A C;  5M5Y B;  4DR5 Q;  1S5F D;  1KC8 C;  3LGJ A;  1EEI D;  4H02 A;  4WFN 3;  1WVL A;  3UDI A;  3I4N B;  1X3Q A;  3EN2 A;  2DN8 A;  5LMN Q;  1A15 A;  2JA6 B;  2HHH Q;  1NTG A;  4P72 A;  1N34 L;  1DOM A;  2VQF L;  3K7U C;  2ICI A;  1PXU A;  3F1Z A;  1EIY B;  2Q2U A;  2IY5 B;  4DAY B;  5ISR A;  2F0D A;  4R4I A;  5K5P A;  2LY7 A;  5KNC A;  1LTI D;  4NW2 A;  2LSS A;  1KRT A;  4ABN A;  4GKJ L;  1G2T A;  2XTI A;  2ZJP A;  2N3S A;  3KBG A;  1KAB A;  3H3V I;  5IGG A;  4JI8 Q;  4DR2 L;  1Y1W B;  4X3U A;  2B29 A;  2E2I B;  4F88 A;  1ROD A;  4DK6 C;  1PTO B;  5IGD A;  2Z6K C;  2DGY A;  5JJL A;  4BY1 G;  2A1A A;  4BS9 A;  2XWB B;  1CUK A;  2Z6K A;  4DV3 L;  3A7A B;  3KJO A;  1LT6 D;  2DY8 A;  5K36 H;  1H9J A;  2ZXP A;  3H91 A;  1Y8O B;  1B70 B;  3FHW A;  4TQU S;  3GTM B;  4DK0 A;  1Y69 U;  4BBS H;  3OHX C;  1K8M A;  3M3Y B;  4LF8 L;  3BDC A;  1MJE A;  1UUP A;  2RCF A;  4DR7 L;  3VA7 A;  2MGS A;  2AHO B;  1Y14 B;  2K33 A;  4HCS A;  4JOI A;  2IWH A;  3M85 A;  3S1N B;  2MP1 A;  4L5Q A;  1WTP A;  2JQO A;  1Q86 C;  3IAY A;  1LO5 D;  1BBU A;  1UE6 A;  4XXE A;  3U4V A;  4C2M B;  2LXK A;  2BH8 A;  1QCB D;  2RSN A;  4HED A;  1H9M A;  3DM3 A;  3CHB D;  1N8R C;  2D0P A;  3MHB A;  4A3E H;  2JA6 G;  3L9A X;  1SYG A;  4G7H C;  3M4P A;  4IPH A;  3J81 c;  3T51 B;  3ERO A;  1YNJ D;  3K0Y A;  1S72 A;  3RLF A;  3IL8 A;  1EL0 A;  3BG3 A;  4CDE C;  2JXM B;  5D3D A;  4XYQ A;  4U67 3;  4A3C H;  3KLW A;  1EZ6 A;  3S1R B;  4KHP L;  4K8J A;  5M3F H;  1LYL A;  2B2T C;  1V1P A;  2GVA A;  3K58 A;  5C44 B;  1STN A;  2B2T A;  2KEE A;  3QB3 A;  2CWP A;  4A3M H;  2EYO A;  4DR4 Q;  4JYA Q;  1KAW A;  3PIP A;  4QIW B;  3CCR A;  4IFD H;  4JI5 Q;  5C5L A;  1MJC A;  3KDF A;  4AQY L;  3J81 j;  4KTA A;  3HS0 C;  1TS5 A;  4LW1 A;  4OWX B;  4RMF A;  1F2L A;  3CPW A;  3D8G A;  4DV4 Q;  1STE A;  1KTK A;  4O2D A;  4HJA A;  3S1Q H;  4TKO B;  1Y8N B;  3A74 A;  5GAH C;  1AN8 A;  3VYS A;  4ZKB B;  3DHQ A;  1M1K C;  4V0B A;  1B2T A;  2ZJR A;  3TZD A;  3R3O A;  1XPU A;  4LF9 L;  2Z1C A;  3ICE A;  1O7Z A;  4DR1 L;  4DR6 Q;  4P73 A;  3F2B A;  1I5F A;  1W2B A;  4A3E B;  2UXD L;  2O5J C;  2DY7 A;  2Y0S E;  4RCO A;  1YNX A;  4RHS A;  1R4P B;  2HIV A;  2ZM6 Q;  5JVH 3;  3I4M B;  1GUG A;  2L11 A;  3CC4 A;  3ITP A;  1NY4 A;  4PZ6 A;  2A6E C;  2PQA B;  5EBD A;  4ZKC B;  2NYZ D;  3KFU A;  4CDC C;  5EKI A;  2B8F A;  5C3E H;  4YCW A;  4QCL A;  4AYB G;  4DAY A;  1GHK A;  1RDP D;  1YNJ C;  1LTL A;  3URY A;  3PUZ A;  1JMC A;  4A3D G;  3W1B A;  1HUM A;  2XGT A;  2E5L Q;  4JI2 L;  2Z4I A;  4CJ2 C;  1ICF B;  1MSG A;  1HUN A;  1RTN A;  1XWE A;  1STB A;  4A3I B;  1MHW C;  4ME3 A;  1XMQ Q;  3CPF A;  5IP7 G;  2NTT A;  3B6Y A;  5DAU A;  4JI4 L;  2CH4 W;  2IHF A;  4GLV B;  3HFZ B;  5C44 G;  2D0O A;  5D65 A;  4IO9 A;  3D4R A;  4DAV A;  4RWS C;  5KIX A;  5M5W H;  3MA2 B;  3ZYY X;  2E74 C;  1KDB A;  3IRB A;  4ZCK A;  1NBW A;  3ND8 A;  2FMM A;  4P71 A;  4ZLT F;  2CQO A;  5JEA H;  1YHA A;  4DR3 Q;  2OTJ A;  1TWH B;  2PYK A;  5ELD A;  2RHQ B;  2KBN A;  4RGT A;  3C1E A;  1X3P A;  3HOW B;  5IYC H;  2RQX A;  4YHH L;  2YYZ A;  1UWV A;  2CVR A;  2AUK A;  3CME A;  2HIX A;  4IPG A;  2ZXR A;  2FMC A;  1K8A C;  1GO3 E;  3KJP A;  4C1N I;  1R4Q B;  5IYB H;  3F2U A;  1A3V A;  1YBY A;  3TP8 A;  1J9O A;  3HOZ G;  1TWG H;  3BVZ A;  1CKM A;  5FJ8 G;  2GA4 B;  2DNE A;  4A3B G;  4JI0 Q;  1I4G A;  3I4M G;  3GP7 A;  3PO2 H;  3DEO A;  5KEE A;  4KKT A;  2ICE C;  4RG1 A;  1LTS D;  1OTC A;  3S2D B;  2NUC A;  3QOJ A;  5CV5 A;  3BYT B;  2J0T D;  4LF6 Q;  5I2Y A;  1WCM H;  4CDD C;  4B3R Q;  1JWM D;  1YI2 A;  3HOY B;  5C4X G;  2RSO A;  4JG2 A;  1JJ2 A;  3AU7 A;  5CGK A;  2R7Z G;  4B3T Q;  4JW0 A;  2F0K A;  4HCE A;  1SRO A;  5G3L F;  2K05 A;  4CBV A;  2I5L X;  2VY3 A;  2C9O A;  1I4P A;  3NXW A;  5LMU Q;  5C5M A;  3S1M H;  2CW0 D;  1PTO F;  2AQ3 B;  2XN9 C;  4IFD J;  5KRU A;  3GTJ H;  4JBM A;  1PYB A;  1ILP A;  1KIX A;  3PUX A;  4LF4 L;  3CP0 A;  2A69 D;  3NE5 B;  3CRK C;  4FYD A;  1L0X B;  2R93 B;  3WOF A;  3KOJ A;  4A3J H;  1LTG D;  2D2C C;  2XNA C;  1GM5 A;  2MUY A;  1VQD A;  1W6K A;  1QUQ B;  4KD3 A;  4JPB W;  5ELO A;  4HJ8 A;  3K0X A;  4A3K G;  3AFQ A;  3HOW G;  1EYG A;  1WI5 A;  4I7A A;  1SN8 A;  2HDL A;  3GTQ B;  2UU9 L;  1PZI D;  3NWS A;  1SLJ A;  4PZ8 A;  3GTL H;  4FP5 D;  4O1N A;  4HIO A;  2B2U A;  3SK5 A;  3H94 A;  5IOC A;  2ZTD A;  1XX8 A;  4EQN A;  2PQA A;  3ER0 A;  1J6Q A;  4UP7 A;  2OTL A;  2B63 B;  2UXB Q;  3U9O A;  2OQ0 A;  5DM6 3;  2F0Q A;  3KF8 B;  1AZP A;  4A3L H;  5IT9 c;  4LUO A;  3J80 c;  4JI6 L;  4NDX A;  2YV5 A;  1D8L A;  4WRD A;  2RA4 A;  4OX9 L;  4DXG A;  1G6P A;  1EY9 A;  4IQZ A;  4DPG A;  4IUN A;  1H9K A;  1PV4 A;  5ELF A;  1PH5 A;  3TP5 A;  3SVM A;  1C7Y A;  3NK9 A;  2VQE L;  4IUU A;  1JQY D;  3Q23 A;  2K7V A;  3HKZ G;  2VUM G;  2OXP A;  4K0K Q;  3E9I A;  5CV4 A;  1VS0 A;  1UAP A;  2E2D C;  4JI1 Q;  1JJG A;  5EBC A;  4P75 A;  3J81 E;  4DV6 L;  2K50 A;  1X3G A;  1AW7 A;  3DWQ A;  3PO3 B;  3D31 A;  2CW0 C;  2E75 C;  4OXP A;  2VS1 A;  2EYF A;  4EX5 A;  4XQN A;  3CKI B;  2K14 A;  2AKW B;  3NQI A;  1S40 A;  2A69 C;  3CAM A;  4CDF C;  1RL2 A;  2PO4 A;  4JC0 A;  4AYB E;  5BN3 A;  4PZ7 A;  3AQQ A;  1EOT A;  2R93 G;  2D5D A;  4R4O A;  3M4O B;  4X65 Q;  1C48 A;  1DCZ A;  2F03 A;  3HOV B;  2JE6 I;  2WAQ G;  2HUG A;  2PZW A;  3UDX A;  3HGB A;  3GD7 A;  1BCP B;  1A8V A;  3KLR A;  2O4X A;  3CQZ B;  3DMU A;  1A3T A;  5D3I B;  1F9P A;  1H9S B;  4K8I A;  1C8C A;  1YVC A;  4F8M A;  2I5M X;  1WTV A;  2R61 A;  3ND9 A;  4X66 Q;  1SNQ A;  4POF A;  1Q8K A;  5IP9 G;  3CU7 A;  2ZT9 C;  4DNT B;  3O13 A;  3CCL A;  4OEM B;  1EY0 A;  2B63 G;  5EPL A;  1ESF A;  3VR5 A;  3M4Y A;  1DOL A;  4DUY L;  2JEA I;  3K57 A;  4BA2 I;  4YWK A;  1JOR A;  3QWN A;  5FKA C;  4GOP C;  4P2C B;  1PRT B;  5EPJ A;  3K5N A;  2F0N A;  2DJF C;  3I3C A;  1OXX K;  1Q46 A;  5IE8 A;  4GOP A;  2HCC A;  2KHJ A;  3HOU B;  1SYE A;  3A8K E;  2Z6B A;  3DXJ C;  3AEV A;  2R92 H;  4IFD I;  3HEJ A;  3VR3 A;  4C3I G;  4MN3 A;  3NWT A;  4HJ9 A;  4DV0 Q;  3RZO H;  4JV5 Q;  2NBF A;  1BOS A;  3PO3 G;  2EVB A;  1LV9 A;  2SOB A;  4XDX A;  5TSS A;  1RD9 D;  3T1Y Q;  4NXM L;  4QGU A;  4DUZ Q;  4A3F G;  2QKI C;  4R4C A;  2HT1 A;  3HG9 A;  1I94 L;  4IUV A;  5A2Q E;  1FVI A;  1RHP A;  1HHV A;  3OW2 A;  4IUR A;  1FGB D;  5HGQ A;  1GOZ A;  3HOV G;  1EIH A;  4JI3 Q;  1B50 A;  1X6O A;  4PNY A;  4H13 C;  4HTH A;  1VF7 A;  2QIL A;  3I8Z A;  1J5E Q;  3MEF A;  1KLG D;  2IHE A;  5LL6 X;  4X62 Q;  1YJW A;  1VQB A;  1G91 A;  4JI7 Q;  4V19 0;  4A93 H;  2M2L A;  1E22 A;  1IW7 D;  1OXT A;  1GJX A;  2MJ8 A;  3RNU A;  1TY0 A;  1HQR D;  5T1I A;  2CWA A;  2A68 D;  4KY5 A;  1MD2 D;  3KF8 A;  3OTO L;  5COR A;  2F0M A;  3J7Z C;  4DNI A;  3H0G G;  5I9O A;  1BDO A;  4HSP A;  4KK7 A;  3IFT A;  1BQQ T;  4DV5 L;  4DV7 Q;  1RCV D;  1HCZ A;  1K73 C;  5CMD A;  4Y7N B;  3MXP A;  2NVQ B;  2NVT H;  2KA7 A;  2SEB D;  3CW2 C;  1TU2 B;  3FMC A;  4BY7 H;  2BOS A;  4K14 A;  1FL0 A;  4KV6 A;  1E3P A;  4OO1 G;  1Y1V G;  3G48 A;  4DXF A;  4DV2 L;  4LNQ A;  3HOU G;  1DD2 A;  5DM7 3;  1A62 A;  3FKI H;  3UI2 A;  3W3A A;  3CCQ A;  1ZEQ X;  4NPS A;  4A75 A;  3J7A F;  1VQE A;  1TWA B;  2WB1 B;  4YY3 Q;  5EGT A;  3G71 A;  3C3L A;  1BVS A;  3LX0 A;  2CH4 A;  3OMG A;  1Q7Y C;  3I55 A;  4X3S A;  1RJT A;  1IBK Q;  3HOX G;  4C3H G;  1CSQ A;  4LFA Q;  1D5X C;  3A8J E;  2KVM A;  3FP9 A;  1XJV A;  1HNX L;  1I4X A;  4BXX G;  3GTP H;  1QG7 A;  2KHI A;  1D7Q A;  1A2U A;  3SDZ A;  4GLX A;  2NN6 H;  1V9P A;  1AE2 A;  4JI8 L;  1LT5 D;  3NTI A;  1SAP A;  1H9S A;  2JP1 A;  3HKZ E;  4A93 B;  2ES2 A;  4FF4 A;  4GN4 B;  4DNR B;  1G2S A;  3S15 H;  4KKU A;  1E2Z A;  1N32 Q;  1IW7 C;  1TQO A;  1IZ6 A;  1STH A;  1TXY A;  2WAC A;  5JAV A;  2F0H A;  2A68 C;  2R7F A;  4A4I A;  2AQ1 B;  4UP8 A;  2K5W A;  2NWG A;  1HXY D;  1X32 A;  2PCF B;  1NAP A;  1AE3 A;  5JVG 3;  3NEL A;  1CZG A;  4R8N A;  3PMF A;  3GV6 A;  1RKN A;  2L55 A;  1HZ9 A;  1Q8I A;  4LJZ C;  2QW7 A;  4AH6 A;  5NUC A;  3M7N A;  4BY7 B;  3RLN A;  1BO0 A;  1ZXT A;  1PDQ A;  2WAQ E;  4LMQ D;  3M7G A;  1QVG A;  3OIQ A;  3A7L A;  3LNN A;  2A73 B;  4IPD A;  3A55 A;  3W1G A;  1D5M C;  2CCZ A;  3C2P A;  3NQT A;  5IT9 E;  3J80 E;  2PMZ B;  2BDN A;  4CKB A;  1SSO A;  2EJM A;  1KHI A;  4B9W A;  1WTH A;  2UXC Q;  1CTM A;  1U4L A;  4YCV A;  3L2P A;  4JBK A;  3K7A B;  3MXN B;  4QUF A;  3BVG A;  1FJG Q;  3WDN A;  3MFG A;  2WB1 G;  3X3N A;  2B8G A;  3IKJ A;  1ML0 D;  1TWC H;  2TSS A;  1SE8 A;  1STA A;  2H5X A;  4CKC A;  4NB3 A;  2PPB C;  3GTP B;  2KCM A;  1JOO A;  1VQF A;  2MO1 A;  5EQ0 A;  1SNC A;  1VF5 C;  2C35 B;  4HMJ A;  2OQK A;  2OEO A;  2NVY B;  3OSO A;  4IOC A;  4LWC A;  3F2D A;  1K83 B;  4A3D H;  1B9N A;  1PYW D;  3PQI A;  1BCP F;  2KUM A;  4G57 A;  4K6L A;  4GNX A;  1TS4 A;  5AJ3 Q;  1VQM A;  3EJI A;  2X6L A;  1QE6 A;  3CCJ A;  1LT3 D;  1HFG A;  2LXJ A;  4JI5 L;  4KY7 A;  4PV1 C;  3K81 C;  4L5R C;  4L5S A;  3GTK H;  2Q8R E;  3PF4 A;  5ELC A;  2JA5 G;  4DN4 M;  4WJ4 A;  4JOI C;  4GKK Q;  4B9X A;  2ALY B;  3F8T A;  1EU4 A;  4LF7 Q;  1STG A;  3R93 A;  4JBW A;  1M4V A;  2BH2 A;  1O7Y A;  3UDF A;  3R2T A;  5IYD G;  1LAB A;  1T5X D;  3I4N G;  3KUP A;  2B3G A;  1HR0 L;  5AFW A;  2L15 A;  3NBH B;  2H1E A;  2GN5 A;  4LFC L;  4QL5 A;  1TS3 A;  4XYO A;  2JEB I;  1N34 Q;  4R4T A;  2VQF Q;  3BJU A;  3OPO A;  2ZM6 L;  2O5I C;  1DZ1 A;  4H7B A;  5FLX c;  4WJ3 M;  3E0J A;  4U68 A;  5G3L D;  4ZUJ A;  5CC4 A;  3HOZ H;  1SE4 A;  3ULJ A;  1PH2 A;  5IWA L;  1GUT A;  3GTG H;  1Z7T A;  4RAU C;  1PTO D;  3RUZ A;  5M3M H;  2E5L L;  5I9P A;  2AUJ D;  4B3M Q;  5GAG C;  4HN7 A;  1Y1W G;  2WII B;  1F77 A;  1XMQ L;  3NEN A;  1SDF A;  3G6E A;  5CV9 A;  1SMX A;  4QF4 A;  5H1S E;  2L5T A;  4GN3 B;  4XQQ A;  5ELE A;  3NHH A;  5C4X H;  2G5D A;  1GUW A;  1FNV A;  3PIO 3;  2MO0 A;  2B2Y A;  4BBS B;  1IL8 A;  4DV3 Q;  1SFO H;  1B9M A;  3VR4 A;  4EVO A;  2RVL A;  1SMY D;  2XWJ B;  2EIF A;  3VYU A;  2RCN A;  3MXU A;  3R8B A;  3T1H L;  4DGZ A;  4Y52 H;  2EOT A;  3JC6 6;  1EOV A;  4POG A;  1ZKO A;  4DR7 Q;  1WD0 A;  5CV7 A;  1VQI A;  1P16 A;  2MFI A;  3GQB A;  1VDZ A;  2RDH A;  1MGS A;  1AEX A;  1N33 L;  4UDU C;  4LK1 C;  3PGZ A;  1DJR D;  1GVP A;  3SR1 A;  2WP8 J;  1VQ5 A;  1NR2 A;  4Z9C B;  2Q2T A;  2N55 A;  1SRU A;  5GRO A;  1ONL A;  1K8G A;  1N9W A;  2EY5 A;  3SHL A;  2F0W A;  3FDT A;  3HRZ C;  5JJZ A;  1G6Z A;  1VQ4 A;  1HPC A;  3MXN A;  5M3F B;  4J1M A;  1K0R A;  1SYB A;  1HZA A;  5KND A;  3DEP A;  4A3M B;  1PTO C;  3FPU B;  4QUC A;  1L1O B;  4N9P A;  1PZJ D;  2HD3 A;  1X55 A;  4ILW A;  1PFS A;  3G6J B;  1ENA A;  1FR3 A;  3RLO A;  5C6A A;  1K0S A;  1XMO L;  2MQH A;  5IY0 A;  4B3T L;  1QB5 D;  4N8F A;  4KMU C;  1M8A A;  4KD4 A;  1KQS A;  2F0O A;  3D4D A;  2E8G A;  1WTW A;  3S1Q B;  1BBX C;  1W6J A;  4DKA C;  1I4H A;  1V8Q A;  3BZD B;  4AQY Q;  4R1J A;  2VUM H;  3FEW X;  4QB4 A;  4TSS A;  4K5W A;  3MTS A;  1SMY C;  5JJK A;  2A19 A;  3TRE A;  5C0X H;  3PSI A;  3S17 H;  1PLF A;  2P5Z X;  4M8A A;  2WB1 E;  1XYI A;  2AQ2 B;  2BA0 A;  1MKH A;  4O0A A;  2E2J H;  2BA1 A;  4LF9 Q;  1HQM C;  4UAI A;  4OIJ A;  5EKK A;  1LM0 A;  5C3E B;  3C46 A;  3BVM A;  3NP8 A;  3TS0 A;  4A3E G;  1SEB D;  4DR1 Q;  5DNF A;  5C4J H;  1WJJ A;  3NBH A;  2KQ3 A;  2R7D A;  3V96 A;  5F2D A;  2QF7 A;  4RGN A;  1UEB A;  1IBM Q;  4IUT A;  1QVF A;  5C4H A;  5CBE E;  3HZX A;  1HR0 W;  2K04 A;  3VYT A;  2J4X A;  1ASZ A;  4A3C G;  1HJP A;  4I7Z C;  3NEM A;  3PF5 A;  4K6D A;  2RHS B;  4KI0 A;  1UE5 A;  5M3F G;  2UXB L;  1Z9F A;  4A3I G;  4FF1 A;  3IFD A;  1JOQ A;  1W3S A;  3I72 A;  3PCO B;  2LMC B;  1OXS C;  1S5B D;  3TP7 A;  3E5S A;  2PZT A;  5IP9 H;  2EYP A;  3S14 H;  4A3M G;  3U9S A;  1S4Z A;  3KYH C;  3QG1 A;  5M5W B;  1HNZ Q;  3T56 B;  1EY7 A;  4LFB L;  2KCC A;  1CZW A;  2NN6 I;  5I2X A;  4IFD G;  2EJF C;  2BCO A;  3SGI A;  1KAA A;  3ERQ A;  3GTO H;  1DYQ A;  3UE1 A;  4JI4 Q;  5JOB A;  4K0K L;  1VQP A;  4JI1 L;  2LS0 1;  2B2V C;  1LTT D;  4YIJ A;  4YCU A;  4HSV A;  4KHV A;  3K59 A;  4DU9 A;  1JB7 A;  2B2V A;  2NZH A;  2VZA A;  1K28 A;  1EY5 A;  4B3S L;  2UUC Q;  3S17 B;  3D0F A;  2Q8I B;  3G4S A;  2PMZ E;  2TMP A;  2K32 A;  2N78 A;  3V05 A;  3H15 A;  4C3I H;  3NTH A;  1VQJ A;  2EE1 A;  2JK8 A;  2K52 A;  3SK8 A;  4MNO A;  2E2J B;  3QJY A;  4BBR H;  4OON A;  1CHP D;  2XSC A;  4WJW A;  3BZC A;  1TWG B;  2B2U C;  5FOB B;  3UDG A;  4X65 L;  2JA8 H;  1SR3 A;  4G7O C;  5ELN A;  4ZAI A;  3E0E A;  3PO2 B;  2Z9H A;  2UUA Q;  2KJX A;  2CKZ B;  4RGM A;  5C3E G;  2K5N A;  1HZC A;  1QZH A;  2MNA A;  5J1Z A;  2SNM A;  1WCM B;  4X66 L;  3TEH B;  3D6C A;  4MTN A;  4FDB A;  1OO9 B;  2OF1 A;  3OW7 A;  3HOY G;  2Q8T A;  2XIW A;  1CT1 D;  3S1M B;  1UE7 A;  3GTO B;  1WFQ A;  3MFY A;  4FXK C;  3S16 H;  1QOH A;  4XQJ A;  3GTJ B;  1D6E C;  2K5D A;  3H0G H;  1XPR A;  1K9M C;  1EQV A;  3NSW A;  5FLX E;  2R6G A;  4UPA A;  3L3O C;  3T53 B;  3JAM c;  1ET6 A;  1BR9 A;  1XNQ Q;  5E4W C;  4A3J B;  5FK9 C;  1WTR A;  5JEA J;  3NPP A;  4DV0 L;  4JV5 L;  3RN5 A;  5FLM G;  2EY6 A;  1HNW L;  1I4R A;  5IGC A;  3STB D;  4OO1 H;  3A54 A;  2JA7 H;  5IYC G;  3FPP A;  4CHT B;  3NTK A;  4DFA A;  1I4Q A;  1F9R A;  5C0X J;  4DUZ L;  2IT1 A;  1QJO A;  3GTL B;  5T1G A;  4UY8 C;  4RFB A;  2YTY A;  1EWI A;  3MWY W;  4F7X A;  4NXN L;  1DXM A;  2A6H D;  3ONA B;  3TRZ A;  1CSP A;  3TN2 A;  1PFB A;  4JI3 L;  4C3J H;  3HOX H;  1IBL L;  1JCK B;  2NVX H;  1XNR L;  1IHZ A;  3PO2 G;  3AMU A;  4C3H H;  1C9O A;  1SXT A;  4QIW E;  1J5E L;  4X64 Q;  1MBY A;  1E7Z A;  4X62 L;  1SYD A;  2K5Q A;  4LUV A;  1G51 A;  5J3B A;  3MXG A;  5I6W A;  3NUC A;  3WWV A;  2ATW A;  3M9B A;  4QJF A;  1JR0 D;  3OYY A;  4JI6 Q;  3A5Z B;  1EU3 A;  4L63 B;  4A3G H;  2EY1 A;  3E6Z X;  1PH3 A;  2YU9 H;  3ULL A;  5CBA E;  1VQN A;  1NUC A;  2ZTE A;  2QEX A;  2VQE Q;  4QQB X;  3QOL A;  1YIT A;  2PQE A;  1CM9 A;  1KL9 A;  4CJ0 B;  2QEJ C;  4FO2 A;  3S2H H;  3TME A;  3RZD H;  1F9S A;  4DV6 Q;  1S5D D;  2MHV A;  3U50 C;  1IYV A;  3W5O A;  1CHQ D;  3TSS A;  3EFX D;  4A3J G;  2EYJ A;  1SNO A;  5A35 A;  2I0Q A;  5I4D A;  5EJW A;  3STB C;  3EIV A;  1QUQ A;  2GVB A;  4ULL A;  3W2D A;  4IJH A;  2HCI A;  4YY3 L;  1BCP D;  1EUJ A;  2DUD A;  4FF3 A;  1TS2 A;  2F4I A;  1IBK L;  1EIF A;  1SE3 A;  2KOL A;  1NCV A;  2NTS A;  4CKE A;  1I3Q H;  3K5M A;  1YHQ A;  2A6H C;  3A0J A;  2NVX B;  4KJO A;  1IL2 A;  2Y0S B;  2VB3 X;  3J81 i;  4RCN A;  2SDF A;  4JK1 C;  1Q81 C;  1UE1 A;  1LTR D;  4O42 A;  1QVC A;  1U4R A;  4A3L G;  3VR2 A;  4H0L C;  1DGS A;  4ZRZ A;  1N32 L;  3A8I E;  3I7F A;  1A6X A;  1PRT D;  2NB0 A;  2WIN B;  3SXH A;  1U5K A;  4BY1 H;  1Y8P B;  1B4O A;  2HDM A;  1X54 A;  3NBI A;  4OIK A;  1B1Z A;  2IL8 A;  3PIO A;  1O78 A;  3CCM A;  2G9H D;  1C0A A;  1VQA A;  3PV0 A;  3TDQ A;  4DUY Q;  1ILQ A;  1CK1 A;  2R92 B;  3EQL C;  2EXZ A;  1U0L A;  2E2H H;  4HIM A;  3RZO B;  4XTC S;  3D4W A;  2VL6 A;  2RF4 A;  2CHB D;  2Z8L A;  4DR5 L;  1PFM A;  4QMG A;  2JA5 H;  3S24 A;  1HTP A;  3BDL A;  3H6M A;  1HA6 A;  2PW7 A;  1A2T A;  5LMN L;  3GO5 A;  1C4Q A;  1F2M A;  2F0E A;  3HKS A;  5KNB A;  5M9O A;  1DOK A;  4CGY B;  4K2L A;  3F2C A;  2PNR C;  3H3V C;  2EYM A;  2PZU A;  1A0I A;  5M5Y H;  4PMW A;  4LAA A;  2K6A A;  3CC2 A;  5C0X I;  3I4N H;  4NXM Q;  4KHZ A;  4FVM A;  2JA6 H;  1BCP C;  1IYJ B;  1GXD C;  2F0S A;  2K75 A;  5E4X A;  1AP0 A;  1E2W A;  1E1T A;  1I3Q B;  1QIL A;  1TWF H;  3ULP A;  3MEH A;  2VW9 A;  4IOA A;  1BKB A;  5J39 A;  5C3W A;  2J7Z A;  4I65 A;  2G9D A;  2F3I A;  4N9T A;  4B08 A;  3E3X A;  2R3Z A;  1HH2 P;  5IT9 L;  3CF5 A;  3KF6 B;  1WYD A;  1DM0 B;  3TZU A;  5FO9 B;  3R2I A;  4R8I A;  2YTX A;  1PRT C;  3X3M A;  4EQ5 A;  4AIM A;  4K2K A;  2K28 A;  5KGU A;  4HJ5 A;  2NVT B;  2F0I A;  4KKS A;  1EFW A;  1ET9 A;  1JIC A;  1EWH A;  1EY4 A;  4L5T A;  1T5E A;  4DV5 Q;  3DM1 A;  4LF7 L;  2R92 G;  4YWL A;  1YJ9 A;  2OCE A;  2Z0S A;  2V1C C;  2AWN A;  2H4O A;  3FKI B;  3GTM H;  4R4Q A;  1NMF A;  1S5E D;  3SK4 A;  2K5H A;  1RIP A;  4JBJ A;  1ZYR D;  3P75 A;  2X69 A;  3S1N H;  4UHV A;  3Q24 A;  1N36 Q;  4DK3 C;  2F4V Q;  3K8A A;  1VQ9 A;  1VQH A;  2I46 A;  1BBW A;  1JE4 A;  3QIA A;  4MTK A;  4C2M H;  4DV1 Q;  1TWF B;  4DAM A;  2EPB A;  1HRJ A;  3V2T A;  4RKB A;  5L37 A;  3JAM E;  2K1B A;  1CQV A;  4TVA B;  1BNZ A;  2V4D A;  4GNX C;  3S15 B;  2ZTC A;  2D9U A;  3BDO A;  3I70 A;  1HNX Q;  1EZ8 A;  3D6W A;  1O7I A;  4B3M L;  3FRP B;  4A93 G;  3CC7 A;  2KEC A;  4DR4 L;  4JYA L;  4EQO A;  3U4Z A;  5IP7 H;  4PMB A;  2UUB Q;  1Z6H A;  3S1R H;  2A74 C;  5BR8 Q;  2HQE A;  4XT3 B;  4R9W A;  3A5U A;  1X65 A;  5C44 H;  4J6H A;  2L1B A;  1R9T H;  5JPN C;  4PG3 A;  3DLL A;  4DV4 L;  3QO2 A;  1B7Y B;  1GUO A;  2EYL A;  5EAY A;  3D3R A;  1EYD A;  3DWP A;  4BY7 G;  4LF5 Q;  1PRT F;  1JJC B;  5LHY 1;  2K03 A;  5ELB A;  1XTC D;  3CD6 A;  4DR6 L;  2EJG C;  2QDL A;  3FKI G;  1VMP A;  4NKL A;  1X9N A;  5FO8 B;  1EEF D;  1WTQ A;  4J15 A;  3KBX A;  3S9W A;  1KDC A;  1T9H A;  1ZYR C;  4NMZ A;  1TWC B;  1KDA A;  4CJ1 B;  3L0O A;  2BDO A;  1NE3 A;  4IN3 A;  4OO1 I;  5FJ8 H;  5LMN W;  1KD1 C;  2A6E D;  4KJN A;  3N6R A;  4A3B H;  4GKJ Q;  4AYB B;  2XVS A;  3PUY A;  1Q1E A;  3DUZ A;  4K5X A;  1EQT A;  3I4M H;  1X3E A;  1EQR A;  3CCS A;  4A3D B;  4A76 A;  1JT8 A;  2NN6 G;  3SK6 A;  4DR2 Q;  1VQ7 A;  1LAC A;  1OXV A;  1VQK A;  1I6V C;  2ID0 A;  2B2Y C;  1PYS B;  1FD7 D;  1I50 H;  2KCT A;  3GTK B;  3CXC A;  4A3I H;  4IZ8 A;  2R7Z H;  1SBB B;  1R9T B;  2F0T A;  3KF6 A;  3J80 i;  2ENB A;  1D1I A;  1SYC A;  1B8A A;  4GZY C;  2HQL A;  4DR3 L;  1LLR D;  4X3K A;  1PH7 A;  2Z4H A;  5CV8 A;  4LF8 Q;  1EYC A;  1D2B A;  1K3B C;  3MZ5 A;  1X3F A;  1TVX A;  1TR5 A;  3ERS X;  1TT2 A;  1TWH H;  2CFM A;  3J7A 5;  2WFW A;  1WTX A;  1KNE A;  2BE5 D;  3JAM i;  3EA6 A;  4EGV A;  3K5O A;  5CYU A;  4A3K H;  1HR0 Q;  3HOW H;  5HY6 A;  2HHH L;  4JI0 L;  2DNC A;  1YNN D;  1YJN A;  3KLS A;  3VR6 A;  4LFC Q;  5I6Y A;  3N52 A;  3PUV A;  3HOZ B;  1ASY A;  1CFM A;  1LT4 D;  3GTG B;  1B44 D;  4A3B B;  1WOC A;  3BYY B;  1G29 1;  5M3M B;  5EPK A;  1WD1 A;  2EXD A;  5E1F A;  1IBM L;  4HMI A;  1UNS A;  3CCE A;  2IX1 A;  4LF6 L;  3SEB A;  2OT2 A;  2SNS A;  4KHP Q;  4B3R L;  5JPM C;  5IWA Q;  1S5C D;  1STY A;  2IW3 A;  3UE0 A;  4IJL A;  1VMC A;  4M1U B;  1I50 B;  5C4X B;  4X3T A;  4F87 A;  1A63 A;  1LUZ A;  4GN5 A;  3I73 A;  3S2D H;  3FVQ A;  1SFO B;  2R7Z B;  1HNZ L;  5K36 G;  2QA4 A;  3OMC A;  3ZJY C;  5LMU L;  1II3 A;  2LFN A;  2F0P A;  4IPC A;  3HOY H;  1K8O A;  3BZK A;  4MHE A;  2F0V A;  1MIU A;  1GKH A;  1G8Z D;  4BBS G;  2VB2 X;  3KLS X;  2NZO A;  1F9Q A;  1QWY A;  4KLK A;  3CCV A;  1PHJ A;  4ALP A;  1O7L A;  2N49 A;  1SNM A;  4GS3 A;  2N8N A;  1KXL A;  2UUC L;  4FF2 A;  1Q3L A;  1V1O A;  3I4L A;  1U4P A;  4FXG C;  4YWM A;  1KNA A;  1GUS A;  3T1H Q;  2N88 A;  3I90 A;  1IYU A;  1AFP A;  4ZYS A;  1QNU A;  5FLM H;  4FXD A;  2EQS A;  4A3K B;  3K80 C;  2R93 H;  2BE5 C;  1H95 A;  2UXD Q;  1SJH D;  2QGQ A;  5HGT A;  1N33 Q;  2M9V A;  2FHT A;  1L0Y B;  3I4O A;  2UUA L;  3Q8D A;  1YNN C;  2IPK D;  2F3W A;  1U9R A;  3K5L A;  1CKO A;  1V1Q A;  2M00 A;  3GTQ H;  3RN2 A;  2A8V A;  3HP3 A;  5FO7 B;  4JI2 Q;  5M3M G;  2EDG A;  4OWW B;  3A56 A;  2RDF A;  3AB9 A;  1GUN A;  1VQ8 A;  2QDB A;  1CI3 M;  2EY2 A;  4MZ9 A;  2VNU D;  3VA5 A;  5KYL A;  2B63 H;  1PH9 A;  5M5X H;  1CKN B;  3HKZ B;  2VUM B;  1ENC A;  2C5C A;  1JE5 A;  1XMO Q;  4KY6 A;  4GOP B;  4E6I A;  2FFK B;  1H9R A;  4OWT B;  1FGU A;  3MAQ A;  1XNQ L;  2F3V A;  4EQP A;  1AZQ A;  3PO3 H;  2FJ2 A;  1HZB A;  2OWO A;  1Q1B A;  1E2V A;  4YHH Q;  3WOE A;  5C4J B;  2KED A;  4A3F H;  3EVQ A;  1HA5 A;  4PMC A;  1IKL A;  3AYH B;  4ZK9 B;  3TBI B;  3J81 L;  2WAQ B;  1FYC A;  3H3V H;  1LTB D;  5C3X A;  1IKM A;  1SND A;  1ESR A;  4HIK A;  1PH4 A;  2XRQ D;  1PVO A;  5FLX L;  1F2Y A;  1LTA D;  4UP9 A;  3M4O H;  2B2W C;  4APV A;  3KK7 A;  1V43 A;  2F0G A;  5E3F A;  1QZG A;  3HOV H;  3I2Z A;  1O80 A;  1BUV T;  1GD7 A;  1VQG A;  2B2W A;  3Q0A A;  1L1O C;  1FNU A;  1D1K A;  1JWS D;  3CQZ H;  3S14 B;  2L12 A;  3LWU A;  4X64 L;  1CA5 A;  5IGE A;  3C1F A;  1L1O A;  4ID6 A;  4Q5V A;  4KN4 C;  3MC0 B;  4C1N K;  1P8L A;  1YHB A;  2K4K A;  1E1O A;  3OWF A;  5M5X B;  3TQY A;  1A3U A;  3PIP 3;  2MPM A;  5BN5 A;  2RKS A;  5IIF A;  4ME5 A;  4LFB Q;  3Q22 A;  4X6A H;  3Q6S A;  4OL7 A;  5JEA G;  3BU2 A;  4P74 A;  3TP6 A;  1PMR A;  1U4M A;  4WOR A;  4HAE A;  3T16 A;  1KRS A;  1EWC A;  3J7Y W;  3TS2 A;  3P1H A;  4DA2 A;  4HR7 B;  2IX0 A;  2I07 B;  1XXG A;  3E9H A;  4C3I B;  4PQX A;  1NJI C;  1Q12 A;  4Q0F A;  5C0X G;  1Y1V H;  4LF4 Q;  2F1M A;  3DWA A;  2WKD A;  3T1Y L;  4BBR B;  3HOU H;  4B3S Q;  1K3R A;  2D62 A;  3AFP A;  5IGB A;  2FXQ A;  5IGF A;  2JA8 B;  1YEZ A;  4FNF A;  4A3F B;  3QR8 A;  2I5H A;  1Q90 A;  2IJ0 A;  5IYB G;  2PI2 A;  4RA8 A;  1NSN S;  5C4Z A;  4OHJ A;  2UU9 Q;  3OIP A;  5J22 A;  1B3Q A;  1XTD A;  4S3S A;  1X56 A;  2JYO A;  2JA9 A;  3RR5 A;  4ODG A;  4BXX H;  3EBE A;  3GV3 A;  5JJI A;  4JI7 L;  1YIJ A;  1WCM G;  3OOC A;  2AMC B;  1HFN A;  1TY2 A;  5KYI A;  2ASB A;  2Q2I A;  3VYR A;  1MI2 A;  2XRS D;  1SNP A;  4N8X 1;  5A2Q L;  3S16 B;  3BS1 A;  4OX9 Q;  1JWU D;  3H0G B;  1TKW B;  1VQC A;  4DV7 L;  2CQA A;  2A5H A;  1QNK A;  2NZ1 D;  2PW5 A;  4XIG S;  4BA1 I;  1NNX A;  5CR3 A;  3VDY A;  4RHR A;  1CKN A;  1SE2 A;  4IAL A;  1PH8 A;  2K01 A;  1Q82 C;  2Q2H A;  5DLQ E;  1EQQ A;  2L0C A;  5CV6 A;  1YZ6 A;  4DK1 A;  1Y1V B;  1EYA A;  1BF4 A;  2JA7 B;  5COY A;  3M4Q A;  2EZV A;  4Y7N H;  1EY6 A;  2NVQ H;  1ICW A;  1B53 A;  3SE0 A;  1HTL D;  4L8J A;  1PH1 A;  4LUZ A;  1JC7 A;  4OGQ C;  1M90 C;  3RD4 A;  2KCN A;  2F0L A;  1I6H H;  4BBR G;  2ZXO A;  1HNW Q;  1IXR A;  1ENF A;  5GAE C;  2FIN B;  4G4K A;  2JA8 G;  1TII D;  1PA6 A;  1RTO A;  2F0F A;  5D14 A;  4C3J B;  3HOX B;  1VCI A;  4LFA L;  1EIG A;  1TWA H;  3T13 A;  4C3H B;  4NXN Q;  3K6O A;  1VQO A;  1Z47 A;  2VXW A;  1IBL Q;  1XNR Q;  1JB3 A;  4IUQ A;  2JSO A;  3RMH A;  1E24 A;  4H44 C;  2KHS A;  2O2L D;  3PUW A;  1BXT A;  1XPO A;  4A3G B;  3U58 A;  4GNX B;  2YU9 B;  1B3A A;  2YTV A;  4C56 C;  4J8Q A;  1J8I A;  4OEL B;  3P7J A;  3I56 A;  4BWG B;  4TRD A;  3S2H B;  3RZD B;  2B39 A;  1VQ6 A;  1PFN A;  1L0W A;  3CMA A;  1SJE D;  3OWE B;  2JJQ A;  1NMG A;  2PI2 E;  1RF2 D;  3L7Z C;  4HJ7 A;  2EYH A;  2LKV A;  4JCV E;  1NR4 A;  3P20 A;  1GHJ A;  3H09 A;  4QY7 A;  5EKL A;  4KN7 C;  5IYD H;  2JA7 G;  2UXC L;  2IX3 A;  1CA6 A;  5IOD A;  4G7Z C;  1I6H B;  1VQL A;  2X6G A;  2QCP X;  2WKC A;  5GQO A;  5BN4 A;  4MIU A;  4RGO S;  1FJG L;  1I94 Q;  1N36 L;  1FNW A;  2F4V L;  4ZQ3 A;  1L2F A;  3CRL C;  4ZUI A;  1EFI D;  3I91 A;  1UEA B;  4DV1 L;  2PNH A;  2K5V A;  3CCU A;  4GLA C;  5LL6 S;  4K5V A; 
#chains in the Genus database with same CATH homology
 4A3B H;  4GKJ Q;  3PUY A;  3K7A H;  4HID A;  1UEB A;  1IBM Q;  1Q1E A;  1QVF A;  3I4M H;  1X3E A;  1EQR A;  5E7N A;  3CCS A;  1YVC A;  1HR0 W;  4A76 A;  1JT8 A;  1ASZ A;  4A3C G;  5GAD C;  2I5M X;  2Y0S G;  1HJP A;  2NN6 G;  3GDE A;  4DR2 Q;  3NEM A;  3PF5 A;  4X66 Q;  4POF A;  1VQ7 A;  2RHS B;  1OXV A;  1Q8K A;  1UE5 A;  4KI0 A;  5IP9 G;  5M3F G;  1Y1W H;  2ID0 A;  1Z9F A;  1VQK A;  2UXB L;  5AJ3 L;  4A3I G;  2E2I H;  1PYS B;  1W3S A;  3PCO B;  3CCL A;  1OXS C;  1I50 H;  2UUB L;  2F52 A;  5IP9 H;  3KDF B;  4A3M G;  2B63 G;  3S14 H;  2NVY H;  5BR8 L;  2KCT A;  3KYH C;  1HNZ Q;  3CXC A;  4A3I H;  4LFB L;  2AWO A;  3OTO Q;  4OO1 I;  1K83 H;  2JEA I;  4DUY L;  2NN6 I;  2R7Z H;  4IFD G;  3KF6 A;  4BA2 I;  4YWK A;  3J80 i;  3SGI A;  3GTO H;  4A3G G;  4GOP C;  3UE1 A;  4JI4 Q;  4GKK L;  2KEN A;  4K0K L;  1B8A A;  1VQP A;  2HQL A;  1AH9 A;  1OXX K;  1Q46 A;  4JI1 L;  5IE8 A;  4DR3 L;  1S3O A;  4GOP A;  2ZJQ A;  1PH7 A;  2KHJ A;  4YCU A;  1PH6 A;  4LF8 Q;  1JB7 A;  1OXU A;  2NZH A;  3AEV A;  2R92 H;  2VZA A;  4B3S L;  4LF5 L;  3M3Y H;  4IFD I;  2UUC Q;  4DV2 Q;  4HJ9 A;  4DV0 Q;  3RZO H;  3D0F A;  3G4S A;  4JV5 Q;  2PMZ E;  1X3F A;  4DR5 Q;  1KC8 C;  3LGJ A;  3PO3 G;  2N78 A;  3H15 A;  4H02 A;  4C3I H;  3ERS X;  3UDI A;  1TWH H;  1VQJ A;  2CFM A;  3J7A 5;  3EN2 A;  2WFW A;  2JK8 A;  2K52 A;  5LMN Q;  3T1Y Q;  4MNO A;  4NXM L;  2HHH Q;  1NTG A;  4QGU A;  3JAM i;  4DUZ Q;  4A3F G;  4BBR H;  4OON A;  4P72 A;  1N34 L;  4R4C A;  2VQF L;  2HT1 A;  3K7U C;  3BZC A;  4A3K H;  3UDG A;  1I94 L;  1HR0 Q;  4X65 L;  3HOW H;  2JA8 H;  5HY6 A;  3F1Z A;  1SR3 A;  1EIY B;  2Q2U A;  2IY5 B;  5ELN A;  4JI0 L;  4DAY B;  4LFC Q;  1YJN A;  1FVI A;  3E0E A;  3PUV A;  1ASY A;  4R4I A;  2UUA Q;  3OW2 A;  2CKZ B;  5C3E G;  1WOC A;  2K5N A;  1HZC A;  1G29 1;  2LSS A;  1KRT A;  5HGQ A;  3HOV G;  4GKJ L;  4JI3 Q;  1QZH A;  2EXD A;  2XTI A;  2ZJP A;  1IBM L;  1X6O A;  2N3S A;  2MNA A;  3CCE A;  3H3V I;  2IX1 A;  4LF6 L;  4JI8 Q;  3MEF A;  4DR2 L;  1J5E Q;  4KHP Q;  2IHE A;  4B3R L;  4X66 L;  2B29 A;  4X62 Q;  3TEH B;  5IWA Q;  1VQB A;  1YJW A;  4MTN A;  4FDB A;  3UE0 A;  4IJL A;  4JI7 Q;  4A93 H;  1E22 A;  1OXT A;  4DK6 C;  2Z6K C;  2DGY A;  1A63 A;  1LUZ A;  4GN5 A;  3HOY G;  3RNU A;  5JJL A;  3S2D H;  2CWA A;  4BY1 G;  2A1A A;  1HNZ L;  5K36 G;  3OTO L;  1CUK A;  2Z6K A;  3J7Z C;  2QA4 A;  4DV3 L;  3ZJY C;  1UE7 A;  4DNI A;  3H0G G;  1WFQ A;  3KJO A;  5LMU L;  3HOY H;  4IPC A;  3BZK A;  1MIU A;  1GKH A;  3S16 H;  4BBS G;  2NZO A;  4DV5 L;  3H0G H;  1B70 B;  3FHW A;  4TQU S;  4DV7 Q;  1XPR A;  1K9M C;  2R6G A;  4UPA A;  1K73 C;  4KLK A;  3CCV A;  1PHJ A;  4ALP A;  3JAM c;  4BBS H;  2NVT H;  3CW2 C;  4BY7 H;  4LF8 L;  1XNQ Q;  2N49 A;  4GS3 A;  2N8N A;  1KXL A;  1FL0 A;  2UUC L;  5JEA J;  1MJE A;  1E3P A;  4OO1 G;  1Y1V G;  3G48 A;  4DV2 L;  4DR7 L;  4DV0 L;  2AHO B;  1Y14 B;  4JOI A;  3RN5 A;  3M85 A;  4LNQ A;  3HOU G;  4JV5 L;  5FLM G;  1A62 A;  4L5Q A;  2JQO A;  1HNW L;  4YWM A;  3STB D;  3FKI H;  3T1H Q;  5IYC G;  1Q86 C;  2JA7 H;  3CCQ A;  1BBU A;  1UE6 A;  3U4V A;  5FLM H;  5C0X J;  4DUZ L;  2EQS A;  4NPS A;  2LXK A;  2BH8 A;  3K80 C;  4A75 A;  1VQE A;  2R93 H;  4YY3 Q;  2IT1 A;  1H95 A;  3G71 A;  2UXD Q;  1BVS A;  3DM3 A;  2QGQ A;  1N8R C;  4UY8 C;  2D0P A;  4A3E H;  3I55 A;  1Q7Y C;  2JA6 G;  1N33 Q;  1IBK Q;  2YTY A;  1EWI A;  3HOX G;  4NXN L;  3I4O A;  3M4P A;  4IPH A;  2UUA L;  3J81 c;  3Q8D A;  3TRZ A;  1CSP A;  1S72 A;  1CSQ A;  4LFA Q;  3RLF A;  4JI3 L;  1CKO A;  1V1Q A;  3FP9 A;  4C3J H;  3HOX H;  1XJV A;  3RN2 A;  1HNX L;  1IBL L;  2NVX H;  1XNR L;  3GTQ H;  3GTP H;  3PO2 G;  4BXX G;  2A8V A;  2KHI A;  4C3H H;  1D7Q A;  1C9O A;  4A3C H;  4GLX A;  4QIW E;  1V9P A;  3KLW A;  1AE2 A;  4JI2 Q;  4JI8 L;  1J5E L;  5M3M G;  4KHP L;  4OWW B;  4X64 Q;  5M3F H;  1LYL A;  3HKZ E;  1E7Z A;  4X62 L;  1VQ8 A;  2GVA A;  2ES2 A;  4GN4 B;  4LUV A;  3S15 H;  1G51 A;  4MZ9 A;  2CWP A;  5J3B A;  1N32 Q;  2VNU D;  4A3M H;  3WWV A;  2B63 H;  1IZ6 A;  2ATW A;  1PH9 A;  1TXY A;  3M9B A;  4QJF A;  4DR4 Q;  4JYA Q;  1KAW A;  5M5X H;  3PIP A;  3OYY A;  3CCR A;  4JI6 Q;  1CKN B;  3A5Z B;  2R7F A;  4A4I A;  4JI5 Q;  4A3G H;  4UP8 A;  2R92 G;  1MJC A;  3KDF A;  4AQY L;  1PH3 A;  2YU9 H;  1AE3 A;  3ULL A;  1JE5 A;  3NEL A;  3J81 j;  1XMO Q;  1VQN A;  4LW1 A;  4OWX B;  2ZTE A;  4RMF A;  4GOP B;  2QEX A;  2VQE Q;  4QQB X;  3CPW A;  1YIT A;  1KL9 A;  1HZ9 A;  4AH6 A;  4OWT B;  4DV4 Q;  3M7N A;  4O2D A;  4HJA A;  3S2H H;  1FGU A;  3RLN A;  3RZD H;  4DV6 Q;  1XNQ L;  3S1Q H;  3A74 A;  3U50 C;  5GAH C;  2WAQ E;  3W5O A;  1M1K C;  3PO3 H;  2ZJR A;  1HZB A;  1QVG A;  1Q1B A;  2OWO A;  1XPU A;  4IPD A;  3W1G A;  4LF9 L;  4A3J G;  4YHH Q;  2CCZ A;  2I0Q A;  3ICE A;  3STB C;  4A3F H;  4DR1 L;  3EIV A;  1QUQ A;  2GVB A;  4DR6 Q;  4P73 A;  3F2B A;  4IJH A;  3AYH B;  1I5F A;  1KHI A;  4YY3 L;  2UXC Q;  1W2B A;  1EUJ A;  2DUD A;  2UXD L;  4YCV A;  2Y0S E;  3L2P A;  1YNX A;  3H3V H;  4JBK A;  2HIV A;  1IBK L;  3MXN B;  1EIF A;  2ZM6 Q;  4HIK A;  1PH4 A;  3CC4 A;  1FJG Q;  1NY4 A;  4PZ6 A;  2PQA B;  2WB1 G;  1PVO A;  3KFU A;  3M4O H;  4UP9 A;  1I3Q H;  1TWC H;  5C3E H;  4APV A;  1YHQ A;  3HOV H;  1SE8 A;  1V43 A;  2H5X A;  3A0J A;  4YCW A;  1QZG A;  3I2Z A;  4NB3 A;  4AYB G;  1GD7 A;  2KCM A;  1VQG A;  1LTL A;  1VQF A;  2MO1 A;  1IL2 A;  3PUZ A;  1JMC A;  2C35 B;  4A3D G;  3W1B A;  3J81 i;  1L1O C;  2XGT A;  2E5L Q;  4JI2 L;  2OQK A;  1Q81 C;  3CQZ H;  1UE1 A;  4X64 L;  4IOC A;  4LWC A;  3F2D A;  1L1O A;  1QVC A;  4ME3 A;  4A3D H;  1XMQ Q;  4A3L G;  3CPF A;  5IP7 G;  3B6Y A;  1DGS A;  1P8L A;  1YHB A;  1N32 L;  2K4K A;  1E1O A;  3I7F A;  4GNX A;  5AJ3 Q;  4BY1 H;  1VQM A;  1U5K A;  4JI4 L;  3TQY A;  2IHF A;  4GLV B;  3HFZ B;  3CCJ A;  1X54 A;  2D0O A;  5C44 G;  4IO9 A;  2LXJ A;  4JI5 L;  3PIO A;  4LFB Q;  3CCM A;  4X6A H;  1C0A A;  1VQA A;  3PV0 A;  3K81 C;  4L5R C;  4DUY Q;  4L5S A;  5M5W H;  5JEA G;  3GTK H;  3BU2 A;  3PF4 A;  4P74 A;  2JA5 G;  4WJ4 A;  4JOI C;  1U0L A;  3IRB A;  2E2H H;  1NBW A;  4HIM A;  4GKK Q;  1KRS A;  4XTC S;  3TS2 A;  2ALY B;  3F8T A;  2VL6 A;  2RF4 A;  4P71 A;  2CQO A;  1YHA A;  2IX0 A;  3E9H A;  4DR5 L;  2JA5 H;  4LF7 Q;  3S24 A;  4DR3 Q;  2OTJ A;  1NJI C;  1Q12 A;  5C0X G;  4JBW A;  1Y1V H;  4LF4 Q;  5LMN L;  3T1Y L;  2BH2 A;  2RHQ B;  3GO5 A;  3HOU H;  3HKS A;  3F2C A;  2HHH L;  2KBN A;  4B3S Q;  1K3R A;  2D62 A;  3UDF A;  3AFP A;  5IYD G;  2FXQ A;  5IYC H;  1A0I A;  1YEZ A;  4YHH L;  3I4N G;  2YYZ A;  2B3G A;  5M5Y H;  1HR0 L;  1UWV A;  4PMW A;  2I5H A;  5IYB G;  2L15 A;  3NBH B;  2GN5 A;  4LFC L;  2PI2 A;  2HIX A;  4IPG A;  3CME A;  4QL5 A;  5C0X I;  3CC2 A;  3I4N H;  4NXM Q;  4KHZ A;  2JEB I;  1K8A C;  1GO3 E;  3KJP A;  1N34 Q;  4R4T A;  2JA6 H;  5IYB H;  2VQF Q;  1IYJ B;  3BJU A;  2UU9 Q;  1YBY A;  2ZM6 L;  2K75 A;  1XTD A;  3HOZ G;  1E1T A;  1TWG H;  1CKM A;  1TWF H;  5FJ8 G;  5FLX c;  2VW9 A;  3ULP A;  4IOA A;  1BKB A;  4WJ3 M;  4A3B G;  1X56 A;  4JI0 Q;  2JA9 A;  3RR5 A;  3I4M G;  3HOZ H;  3ULJ A;  3PO2 H;  3EBE A;  1PH2 A;  4BXX H;  5IWA L;  3GTG H;  5JJI A;  4JI7 L;  2F3I A;  1YIJ A;  4RG1 A;  1WCM G;  2E5L L;  5M3M H;  1OTC A;  2AMC B;  4B3M Q;  5GAG C;  1Y1W G;  1HH2 P;  2ASB A;  2Q2I A;  4LF6 Q;  3CF5 A;  1XMQ L;  3NEN A;  3G6E A;  1WCM H;  4B3R Q;  3KF6 B;  1YI2 A;  5C4X G;  1SMX A;  4JG2 A;  5H1S E;  1JJ2 A;  1WYD A;  4OX9 Q;  2YTX A;  2R7Z G;  4GN3 B;  4B3T Q;  4EQ5 A;  5C4X H;  1VQC A;  4AIM A;  4DV7 L;  2MO0 A;  1SRO A;  4XIG S;  2I5L X;  2VY3 A;  4HJ5 A;  4BA1 I;  1EFW A;  4DV3 Q;  1SFO H;  3VDY A;  5LMU Q;  1CKN A;  3S1M H;  1PH8 A;  4IFD J;  4L5T A;  1Q82 C;  2EIF A;  4DV5 Q;  4LF7 L;  2Q2H A;  5DLQ E;  3GTJ H;  1PYB A;  4YWL A;  1EQQ A;  1YJ9 A;  1YZ6 A;  2OCE A;  2Z0S A;  2V1C C;  2AWN A;  3GTM H;  2RCN A;  1KIX A;  3M4Q A;  3T1H L;  3PUX A;  4LF4 L;  4Y7N H;  3CP0 A;  4R4Q A;  3JC6 6;  4Y52 H;  2NVQ H;  1NMF A;  1EOV A;  1PH1 A;  4POG A;  2K5H A;  4LUZ A;  3KOJ A;  4A3J H;  4DR7 Q;  1RIP A;  1VQI A;  1P16 A;  4JBJ A;  1M90 C;  2MFI A;  1GM5 A;  1VQD A;  1I6H H;  1QUQ B;  4BBR G;  1N33 L;  5ELO A;  3S1N H;  4HJ8 A;  1HNW Q;  3K0X A;  3PGZ A;  1IXR A;  4A3K G;  3AFQ A;  1N36 Q;  4DK3 C;  5GAE C;  1GVP A;  2F4V Q;  3HOW G;  1EYG A;  2JA8 G;  1WI5 A;  2WP8 J;  3K8A A;  1PA6 A;  1VQH A;  1VQ5 A;  1VQ9 A;  1SN8 A;  1BBW A;  1VCI A;  2UU9 L;  2Q2T A;  4LFA L;  4C2M H;  1SLJ A;  4PZ8 A;  4DV1 Q;  1TWA H;  1SRU A;  5GRO A;  4DAM A;  3GTL H;  1K8G A;  1N9W A;  4HIO A;  1VQ4 A;  4NXN Q;  2ZTD A;  2PQA A;  3ER0 A;  4TVA B;  4GNX C;  1VQO A;  1J6Q A;  1Z47 A;  2ZTC A;  4UP7 A;  2OTL A;  1K0R A;  1IBL Q;  1HZA A;  1HNX Q;  1XNR Q;  2UXB Q;  2OQ0 A;  1O7I A;  4B3M L;  1L1O B;  1E24 A;  4A93 G;  3CC7 A;  3KF8 B;  4DR4 L;  4JYA L;  3PUW A;  5IT9 c;  4LUO A;  3J80 c;  1XPO A;  5IP7 H;  3U4Z A;  4A3L H;  2UUB Q;  4JI6 L;  3U58 A;  1X55 A;  4GNX B;  3S1R H;  2YV5 A;  1PFS A;  1D8L A;  5BR8 Q;  2YTV A;  4OX9 L;  3RLO A;  3A5U A;  1G6P A;  1XMO L;  2MQH A;  4DPG A;  1X65 A;  5C44 H;  5IY0 A;  1PV4 A;  1PH5 A;  1R9T H;  1C7Y A;  4B3T L;  3I56 A;  2VQE L;  4PG3 A;  3DLL A;  3HKZ G;  2VUM G;  4DV4 L;  1KQS A;  4K0K Q;  2E8G A;  3E9I A;  1B7Y B;  1VQ6 A;  1VS0 A;  5EAY A;  1L0W A;  4JI1 Q;  3CMA A;  1JJG A;  4P75 A;  4DKA C;  4DV6 L;  4AQY Q;  4R1J A;  2VUM H;  2K50 A;  1X3G A;  3D31 A;  2JJQ A;  4OXP A;  4BY7 G;  1NMG A;  4LF5 Q;  5JJK A;  2PI2 E;  2A19 A;  3TRE A;  3PSI A;  1JJC B;  2VS1 A;  3S17 H;  3L7Z C;  4EX5 A;  4HJ7 A;  4JCV E;  4QY7 A;  2K14 A;  2WB1 E;  2AKW B;  1S40 A;  3CD6 A;  4DR6 L;  5IYD H;  3FKI G;  2JA7 G;  2UXC L;  3CAM A;  1X9N A;  2BA0 A;  1MKH A;  1RL2 A;  4O0A A;  1VQL A;  4J15 A;  4JC0 A;  2BA1 A;  4PZ7 A;  3AQQ A;  5GQO A;  4AYB E;  2E2J H;  4JBM A;  4LF9 Q;  2R93 G;  1T9H A;  4R4O A;  1FJG L;  1I94 Q;  1N36 L;  1LM0 A;  4X65 Q;  2F4V L;  3TS0 A;  4A3E G;  1L2F A;  4DR1 Q;  2JE6 I;  2WAQ G;  5C4J H;  1WJJ A;  2R7D A;  3L0O A;  3UDX A;  1NE3 A;  2K5V A;  2PNH A;  3CCU A;  4GLA C;  3GD7 A;  4DV1 L;  5FJ8 H;  5LMN W;  1A8V A;  1KD1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...