3RZOH

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rzoH00
3S17H 1HZAA 3K8AA 1B8AA 2K75A 4DV7Q 1YJ9A 1Q12A 1FJGL 1GO3E 4IPGA 4DV6L 2PQAB 1NTGA 3GTLH 2I5HA 2UXDQ 1WCMH 1JE5A 2NN6G 5C4JH 4DR5L 1K8GA 1EUJA 1Y1WG 1K73C 1PH5A 4DV0Q 2E2JH 5GAHC 3M7NA 2Y0SE 3PGZA 2EIFA 3GTPH 3TS0A 1O7IA 2KCMA 3U58A 2E5LL 4JI7L 1HNWQ 4TVAB 2NVYH 4QGUA 3EIVA 3PUXA 1FVIA 1J5EL 1QVFA 3E9IA 4AYBG 3CCUA 1OXVA 3OW2A 2K52A 1BKBA 2JA5H 3H3VI 5M3FG 2R6GA 3G4SA 4PZ7A 4HJ8A 3S1NH 2VUMH 3BU2A 3PV0A 1OXSC 4C3IH 5HGQA 1WJJA 3OTOQ 1D7QA 2AWOA 2CQOA 1SN8A 1TWHH 1HZ9A 3KJPA 1SR3A 5FJ8G 2Q2TA 1S72A 4GKJL 3LGJA 4JBJA 2RCNA 1SFOH 4A3EG 2NZOA 3GO5A 1JJCB 4OO1I 1BBWA 4JC0A 4IFDG 1SRUA 1MIUA 1XMOL 3I4MH 1PH4A 1CKMA 2RHSB 3CCLA 2VNUD 2I5LX 4X66L 4X62Q 1X65A 3CMEA 3H0GH 4XTCS 4BXXH 4O0AA 4C3JH 1NJIC 4IFDJ 4X66Q 4L5TA 1YNXA 3I2ZA 2MFIA 2KCTA 1HH2P 1M1KC 1N33Q 2B29A 1LUZA 2WFWA 2RHQB 2LSSA 4NPSA 2VW9A 4ALPA 1CUKA 2ID0A 1VQ4A 5GAGC 2ZJPA 2GVAA 2ES2A 3CPWA 4KI0A 4LWCA 5HY6A 3H15A 3E9HA 4GLXA 4BA2I 2R7DA 3VDYA 4L5RC 1HZCA 4DV7L 1VQ6A 2FXQA 1YJWA 4OX9Q 1YI2A 1W3SA 2K14A 4JYAL 1IBML 4DV2L 2C35B 1TWGH 4R4QA 5FLMG 2JA5G 2OQKA 1IBMQ 2E2HH 1PYSB 3FHWA 1N34Q 3NEMA 1E1OA 3PSIA 3CCMA 1LTLA 3CCSA 1VQOA 1Q46A 2R92H 3HOXH 2E2IH 1KRSA 4JI1L 3TQYA 4HJ7A 1JB7A 1EFWA 4Y52H 1G6PA 3UDXA 3HOVG 2E5LQ 1HNWL 5K36G 3K7UC 3RLNA 1WYDA 3BJUA 4P72A 1EYGA 3AFQA 1H95A 4GNXC 4X65Q 1VQ7A 2JA8H 3KF6B 4DAYB 4QQBX 5IYDH 4LF9Q 3GTKH 1XPUA 4DR2Q 1I5FA 1LM0A 3L0OA 3CMAA 4DR4L 4A3DG 5C3EH 1XMOQ 2R7ZG 4PZ6A 3PO3H 1WFQA 3CF5A 4DUYL 1HNXL 4JI5Q 2ZM6L 1A0IA 1HR0Q 2ZJRA 1CKNB 1HNXQ 3RZOH 3MXNB 4DR1L 4P74A 2IHFA 1GVPA 2NN6I 3AQQA 2WAQE 2ZTDA 2YYZA 3KF6A 4JG2A 3RLOA 1YBYA 4DR2L 1VS0A 1QZGA 3CCRA 2Q2UA 4GN3B 4WJ4A 4L5QA 2N3SA 4JV5L 3PF5A 1IBLQ 1YZ6A 4JI3Q 5C4XH 1XMQL 3ICEA 4IOAA 1VQ9A 2Z6KA 1Q1EA 4GN4B 4A3KG 3TEHB 4NXNL 1PH7A 1J5EQ 5H1SE 4JI1Q 4NXNQ 2RF4A 4H02A 4O2DA 2AWNA 1X9NA 4JOIC 4JI6Q 2KHIA 1XMQQ 4IJHA 4DK6C 2JEBI 3HOUH 1V1QA 4JV5Q 1OTCA 4B3TQ 4UY8C 4A3FH 1YIJA 1U0LA 4R4CA 3M85A 1HR0W 2B63G 1Q82C 1XNQL 3PIPA 3DLLA 4L5SA 2HT1A 2IY5B 2D0OA 4GOPC 3S2DH 2YTVA 1IXRA 5E7NA 3WWVA 4LF6L 2JA7G 3K0XA 4A75A 4A3DH 4DUZQ 4POFA 3F2CA 4BY1G 1UE7A 2JJQA 2OQ0A 4OXPA 5DLQE 3PUWA 5M5WH 1NMGA 2D0PA 3U50C 3T1HQ 3S14H 4AH6A 3PIOA 3HOZG 2BH2A 1PA6A 2PMZE 4AYBE 1EQQA 1G51A 2CKZB 3A5ZB 4LF5L 3UE1A 5IP7G 4EQ5A 4OWXB 1QZHA 5LMUQ 2Y0SG 1YEZA 3HOYH 2WP8J 2DGYA 5IYBH 1LYLA 4UP9A 4A3LG 1A62A 3SGIA 4A3IG 4POGA 2H5XA 1PVOA 1AE2A 3AEVA 3RR5A 1GM5A 2UXBQ 3D31A 2YTYA 5C4XG 3AFPA 4GKJQ 3CQZH 1B7YB 4B3MQ 2AMCB 1NBWA 1UWVA 1L1OB 4B3RL 4OONA 3J80i 2GN5A 2MNAA 4GKKQ 2UUCQ 4A3CH 4KHZA 1Y1VG 4MTNA 4JYAQ 4GOPA 2F4VQ 2JA6G 2KBNA 1V43A 3UDFA 4YHHQ 4HIDA 4JI0Q 1HNZQ 4DV4Q 2UUBQ 4GOPB 1VQLA 4A3BG 1K8AC 4HIOA 4YCUA 1KAWA 1PYBA 1MJEA 5M3FH 3M3YH 4LFBQ 3S15H 1IBKL 4DV0L 3JC66 4YCVA 3L2PA 4JI8L 4LFBL 3PUVA 4IJLA 4APVA 4YY3Q 1I94L 3CCQA 4DV5L 3I4NG 3GDEA 4WJ3M 3J80c 2UXDL 1K3RA 1EIFA 4KHPQ 4AQYL 1FJGQ 1HNZL 3TS2A 4IPDA 4QIWE 1G291 2WB1E 2UUCL 3PF4A 1OXTA 2N8NA 2YV5A 4A3JG 1XJVA 4P75A 1E3PA 1X3GA 2A8VA 2R93H 5IYCH 2QA4A 3HKZG 2N49A 3FKIG 2UUAQ 2VL6A 3D0FA 4JBKA 5EAYA 3UE0A 3T1YQ 3HKSA 3CC7A 4LF4Q 4BXXG 3CCJA 2JEAI 3S1RH 4LF8L 2PI2A 4QY7A 1VQMA 1Q1BA 1XTDA 3NENA 2LXJA 1JJ2A 1NMFA 3CCVA 1K9MC 2GVBA 3GD7A 5JEAG 2R7FA 4DR3Q 2ZTCA 5JJIA 1VQIA 2CWAA 4AQYQ 1YITA 2E8GA 4JBMA 2MQHA 2L15A 2VS1A 3ER0A 3I7FA 2WB1G 4IOCA 1YJNA 4A76A 3F8TA 4ME3A 1B70B 1X6OA 2CCZA 1NY4A 1WCMG 3KFUA 5FLMH 1VQDA 4DR7L 3B6YA 4K0KL 5IP9H 3E0EA 4DR5Q 5IY0A 2HHHQ 3RN5A 1HJPA 5M3MH 1VQAA 1KC8C 1KIXA 4IPHA 1ASYA 1I3QH 4DK3C 4YHHL 3GTQH 2IX0A 4JI2L 1EQRA 2F3IA 3W5OA 3J81i 3PO2H 1UE1A 1YHBA 4B3TL 3A5UA 2Q2HA 2V1CC 3F2BA 4A3JH 3STBD 4DR7Q 3NELA 4DNIA 2IHEA 2VUMG 1R9TH 4GKKL 1SLJA 5IYDG 1P8LA 2K5NA 4DV3L 2EXDA 2VQEL 4A3MH 1TXYA 4LUZA 4YWLA 4GNXA 4JCVE 3RLFA 2JK8A 1XPOA 3J7A5 4BA1I 1W2BA 2PI2E 1VQ5A 1VQNA 4BY1H 1JMCA 3HKZE 1Q8KA 1SE8A 2UU9Q 5JJKA 1A8VA 1X55A 3IRBA 3S1MH 4A3GG 4A93H 5LMNW 2I5MX 4BBSH 1VCIA 1P16A 4A3EH 3BZKA 4B3SL 4BY7G 2XTIA 4LFCL 3CPFA 3T1YL 4NXML 4NB3A 3CC4A 3H0GG 5IP7H 4DR1Q 1RL2A 2WAQG 4IPCA 3RNUA 2JQOA 1UEBA 4DPGA 4HIMA 2NVXH 3S16H 4LFAQ 3I4MG 1L0WA 5BR8L 1Q81C 5LMNL 3HOWG 3ZJYC 3PUZA 2YTXA 4QJFA 4LW1A 4NXMQ 5GQOA 3M9BA 1K0RA 3TREA 4DV1L 1T9HA 2IX1A 2KHJA 1VQJA 4P73A 1IYJB 3CD6A 4JI4Q 4DV5Q 1Z47A 2OWOA 2UXCL 5GROA 1FL0A 2F52A 1PHJA 2EQSA 4A3FG 1Q7YC 1L1OC 3ULJA 5GADC 5IE8A 4MZ9A 2HIVA 4MNOA 1L1OA 1VQFA 4DV3Q 4A3BH 2QEXA 2PNHA 2R92G 4JI3L 5C0XJ 4JBWA 2NVQH 2D62A 5FLXc 1N32L 2UXCQ 3HOVH 4LNQA 3F2DA 3PUYA 3K80C 4R4IA 3A0JA 4DV1Q 3GTGH 1KHIA 4JI2Q 5IWAQ 4X64L 4IO9A 3CP0A 1NE3A 2XGTA 5C0XG 1PV4A 1N36Q 1X3EA 4B3ML 5M5XH 2JA8G 1VQ8A 2LXKA 3KDFA 3S2HH 1XNRL 4R4OA 2UXBL 4BY7H 5LMNQ 3ULPA 4LFAL 3KOJA 3S24A 2R7ZH 4K0KQ 2VQFL 3RN2A 2ALYB 4UPAA 5IYCG 1VQGA 5LMUL 2NVTH 1N33L 4DR6L 2IT1A 4LFCQ 3H3VH 1OXXK 5JJLA 4LUOA 3ULLA 1E24A 1BVSA 2AHOB 1HZBA 3M4QA 3I55A 3OYYA 2B3GA 3UDIA 4RMFA 4LF5Q 2AKWB 4X62L 3AYHB 2JE6I 1GD7A 1SROA 2PQAA 4YWKA 4YY3L 4DR3L 4RG1A 1Q86C 3T1HL 1E1TA 3UDGA 3S1QH 4A3CG 2VQFQ 2OTJA 1Y1VH 1FGUA 1E22A 2VZAA 1KRTA 1I50H 4HIKA 2ZJQA 4LF8Q 1PFSA 1RIPA 4DV4L 3CCEA 4A3KH 2HIXA 5GAEC 5ELNA 5AJ3Q 1QVGA 1PH2A 3KYHC 1CSPA 1X54A 4LF7L 3PCOB 3J81j 4LUVA 1OXUA 4DV2Q 5IP9G 3CW2C 1PH8A 4LF7Q 1YHQA 3HOUG 1E7ZA 5C44H 3RZDH 1U5KA 4A4IA 5M3MG 3JAMi 4OX9L 3I4NH 2N78A 4DKAC 5M5YH 5AJ3L 4B3RQ 1GKHA 1PH1A 2ZTEA 2A1AA 4GLVB 4OWWB 2ATWA 3PO2G 3U4VA 4JI8Q 2YU9H 1IBKQ 2B63H 4OO1G 1K83H 1V9PA 3FKIH 1VQKA 3CC2A 3M4OH 1J6QA 1M90C 1UE6A 5FJ8H 2MO0A 1VQPA 3HOXG 1WOCA 1BBUA 4DV6Q 1A63A 1N9WA 3W1BA 1VQCA 1YHAA 4A3MG 4DR6Q 2OTLA 1KXLA 4GNXB 2CFMA 4GS3A 3G6EA 4YWMA 1C7YA 3KF8B 2HQLA 3JAMc 5BR8Q 2JA9A 3Q8DA 4C2MH 3J81c 2BA1A 1PH6A 2K50A 2ASBA 1XNRQ 1CKOA 4A93G 4TQUS 4R1JA 2DUDA 4B3SQ 1VQHA 4GLAC 5IWAL 4X64Q 1N36L 1XNQQ 4LF9L 2MO1A 5IYBG 3OTOL 4X65L 1QUQB 5J3BA 3PO3G 2UU9L 4A3IH 2VY3A 5IT9c 1MKHA 4FDBA 3NBHB 4BBRG 4P71A 1N32Q 3J7ZC 3HOWH 3ERSX 2I0QA 3F1ZA 3G71A 1D8LA 4AIMA 4JI6L 4C3HH 1WI5A 2OCEA 4KHPL 3BZCA 2VQEQ 1KD1C 1I6HH 2A19A 5C44G 1JT8A 1TWCH 1JJGA 1L2FA 3CAMA 3FP9A 3TRZA 1I94Q 4JI7Q 1VQEA 4GN5A 1QVCA 3K7AH 4HJ9A 1QUQA 3STBC 2Z0SA 1EWIA 1TWAH 2JA6H 3HFZB 1S40A 1C0AA 4DUZL 4JI4L 4UP7A 1Y14B 3KLWA 5ELOA 3W1GA 4LF6Q 2UUBL 1ASZA 2Q2IA 1AH9A 4JI0L 3A74A 2K5HA 4XIGS 1VQBA 1Y1WH 2HHHL 1IL2A 2F4VL 3GTOH 1YVCA 1UE5A 2ZM6Q 1HR0L 2BH8A 1X3FA 3KDFB 1EIYB 1SMXA 4IFDI 3M4PA 2R93G 4X6AH 1XPRA 4OWTB 2K4KA 4A3GH 4DR4Q 4BBSG 4YCWA 3GTMH 3I56A 3EBEA 1PH9A 5C3EG 2JA7H 4LF4L 1AE3A 1IZ6A 3G48A 4PMWA 4HJ5A 3U4ZA 3GTJH 2BA0A 1IBLL 2CWPA 3MEFA 4BBRH 1C9OA 1PH3A 4Y7NH 1CSQA 4UP8A 3HOZH 5C0XI 2KENA 4DAMA 1Z9FA 1MJCA 4R4TA 1N8RC 4PZ8A 4EX5A 3DM3A 4QL5A 1TWFH 3L7ZC 3KJOA 4KLKA 4JOIA 1CKNA 2K5VA 3K81C 1N34L 2UUAL 4HJAA 1DGSA 1KQSA 3HOYG 3I4OA 4A3LH 1EOVA 4PG3A 4J15A 2NZHA 4JI5L 4DUYQ 1S3OA 1KL9A 2QGQA 2Z6KC 3CXCA 5JEAJ 1X56A 3EN2A
chains in the Genus database with same CATH superfamily
3S17H 1HZAA 2F0SA 4DV7Q 3K7AB 1GO3E 3GTKB 2I5HA 2UXDQ 2R93B 3R3OA 4TSSA 1DZ1A 1K8GA 1DOLA 1K73C 4DV0Q 2E2JH 2Y0SE 4G57A 3GTPH 1KABA 3K5OA 4JI7L 4RGTA 3EIVA 3PUXA 3E9IA 3OW2A 2JA5H 4HJ8A 5FO7B 3BU2A 1LTRD 1OXSC 4ILWA 1WJJA 1WVLA 2CVRA 1D7QA 1TWHH 1HZ9A 1JWMD 1U9RA 2Z6BA 3Q6SA 2TMPA 1G8ZD 1UNSA 2RCNA 4FYDA 2L11A 3T13A 5CV7A 1EOTA 2AQ3B 1K83B 2KVMA 3WOFA 3Q22A 4X62Q 4O0AA 4C3JH 4X66Q 2EJFC 4L5TA 1I4HA 2MFIA 3DMUA 1I4XA 2N88A 4JK1C 1G2SA 2WFWA 2VW9A 4ALPA 5HURA 5GAGC 3H15A 2F0OA 4RHRA 5I2XA 1EFID 2F0JA 3L9AX 1VQ6A 1UUPA 1YJWA 4QIWB 1IBML 4IQZA 3MWYW 2M9VA 2E2HH 1PYSB 1QILA 4FP5D 3UI2A 1II3A 1LTLA 1TWFB 1Q46A 1RTOA 2C5CA 4JI1L 3IL8A 2O4XA 3TQYA 1JB7A 1EFWA 5DEHA 1WTQA 4Y52H 1HNWL 2DY8A 3BJUA 3AFQA 1H95A 2JA8H 4X65Q 2MHVA 2VB3X 3GTKH 1XPUA 1SJHD 1I5FA 2K28A 2HDLA 4A3DG 1EIGA 4HMIA 5C3EH 2ICEC 4R8IA 2R7ZG 2K5WA 4PZ6A 3T51B 4KJOA 1STBA 3R8BA 3HP3A 2ZJRA 1JC7A 1A15A 1LO5D 1R4PB 1HNXQ 4CKCA 2A68D 1GVPA 2NN6I 2A5HA 3KF6A 3RLOA 2Q8RE 2Q2UA 4A3BB 1PDQA 4WJ4A 4L5QA 1QB5D 1M4VA 1NR2A 1RCVD 1W6KA 1IBLQ 4V0BA 1YZ6A 5C4XH 2Z6KA 3RMHA 3MAQA 5IGDA 1RODA 5H1SE 2RF4A 2R3ZA 4O2DA 5M5XB 1X9NA 4ZYSA 1S5ED 1MGSA 1PRTD 1QCBD 2JEBI 3HOUH 1EYAA 1NSNS 4N9TA 1V1QA 1OTCA 1PLFA 2PO4A 2Q8IB 3HOXB 2IY5B 2D0OA 4GOPC 3VR4A 1U4MA 3S2DH 2YTVA 1AZQA 2G5DA 4POFA 4BY1G 5DLQE 5C4HA 5M5WH 1NMGA 3T1HQ 4FF1A 3S14H 1EQQA 1AP0A 3A5ZB 3J80L 3VYSA 1MD2D 4QMGA 1QZHA 3HOYH 1R9TB 3T4AC 1A62A 4A3IG 5K5PA 5ELDA 1F77A 3RR5A 3D31A 3VYTA 1B9NA 1R4QB 1B7YB 1TY2A 3J7AF 4GKKQ 5C44B 1J9OA 3Q24A 4KHZA 4ZRZA 4C3HG 1EQVA 1DONA 3UDFA 4YHHQ 5I6YA 2F0NA 4LK1C 4DV4Q 4FNFA 3SXHA 1G91A 2J0TD 3S15H 1IBKL 3FPPA 3PUVA 1I94L 3I4NG 3RZOB 3JAML 2UXDL 1HTLD 1A2UA 1HNZL 4K5WA 2WB1E 2UUCL 2N8NA 2A68C 3LWUA 3GV6A 1DCZA 2TSSA 3HKZG 1IYUA 2N49A 3FKIG 2F0KA 1IW7D 2OXPA 5EPJA 4A3KB 2JEAI 3QOLA 1LTAD 4CKBA 1Q1BA 1XTDA 3NENA 2LXJA 2PW5A 4KKTA 2ZTCA 1VQIA 2CWAA 3DWPA 3SEBA 4JBMA 4EQPA 4IURA 2L15A 4UDUC 3GQBA 1HA6A 4KTAA 2NVTB 4E6IA 1EZ6A 2F0EA 3EQLC 1DOKA 2CCZA 2R7ZB 3KFUA 1VQDA 3B6YA 4JPBW 3X3NA 3BVZA 4DR5Q 5IY0A 3RN5A 1E2VA 3A7AB 1KC8C 1KIXA 1QOHA 1S5BD 3QIAA 4OEMB 1EY9A 4YHHL 3J80E 2F3IA 3J81i 1CQFA 3PO2H 1UE1A 5K36H 2K33A 2BE5D 1NR4A 4I7AA 4A3JH 2XSCA 1V1PB 3NELA 3D6CA 2VUMG 4GKKL 5CC4A 2K5NA 3E6ZX 2F0FA 1SEBD 5FO8B 1AZPA 2G9HD 5I9PA 2EXDA 2VQEL 1TXYA 4LUZA 3VR5A 4GNXA 4JCVE 3D4DA 3J7A5 3MTSA 1ICWA 3I4LA 1VQNA 3HKZE 2NTTA 2E75C 2B2UA 3IRBA 4BBSH 1C8CA 1DYQA 4BY7G 1ZYRD 3BYTB 4LFCL 3VYUA 5IP7H 2WAQG 4A3IB 1UEBA 4DPGA 1L0WA 1Q81C 5EBCA 1PTOB 3PQIA 3PUZA 3HOYB 2PNRC 3JAME 1K0RA 4DV1L 4C2MB 1T9HA 3S1MB 1VQJA 4JI4Q 5GROA 2F52A 2JXMB 2EQSA 4A3FG 3K5LA 4N8FA 1QNKA 1L1OA 1VQFA 2QEXA 2PNHA 1VF7A 3TBIB 5DM73 4JBWA 3J81L 5FLXc 1N32L 2UXCQ 5KNDA 1IW7C 3F2DA 2NVYB 3K80C 3A0JA 4X3KA 5C0XG 1PV4A 5M5XH 1VQ8A 2JSOA 3KDFA 4FXGC 4R4OA 5LMNQ 2L9HA 4LFAL 3P1HA 4UPAA 1F2YA 1VQGA 1N33L 2HCCA 2AHOB 4ZCKA 1ZKOA 2A73B 2JE6I 1KNAA 1PXUA 3AYHB 4YWKA 4DR3L 2O5IC 1X3PA 2EYHA 3T1HL 1MHWC 3OWFA 3S1RB 1QVGA 4K2LA 1X54A 3PCOB 2B8FA 3CW2C 4LF7Q 5M3MG 3JAMi 1JORA 3GP7A 4B9XA 1E2WA 2ZTEA 1SYCA 2A1AA 1EEFD 2F0VA 2YU9H 3MFGA 1TR5A 1J6QA 3I3CA 1FNUA 3NQTA 1WOCA 1BBUA 1A63A 1VQCA 1FYCA 3NWTA 1DJRD 4BY1B 3R93A 3G6EA 4YWMA 1L0XB 3JAMc 2JA9A 4RCNA 2NTSA 1KDBA 1GOZA 2B39A 4I7ZC 5ELBA 1CM9A 1VQHA 1BCPD 4GLAC 2MO1A 1TIID 4X65L 1PTOF 2EYMA 1N32Q 3HOWH 3NTKA 5E4XA 2I0QA 2EYLA 3F1ZA 2OCEA 1I6HH 1KD1C 1EU3A 5C44G 4JI7Q 1EQTA 1LABA 3GTLB 1QUQA 3STBC 5C4XB 2HUGA 3K5NA 2JA6H 1NUCA 2EXZA 1VMPA 1IL8A 1Y14B 2X69A 1TU2B 5ELOA 1ET6A 2Q2IA 1AH9A 4JI0L 3A74A 4KHVA 1D1KA 3HRZC 1O80A 1VQBA 2HHHL 5AFWA 1UE5A 2ZM6Q 1MI2A 3KDFB 2WKDA 5EBDA 4IFDI 2D2CC 3M4PA 3BVMA 4A3GH 2K4KA 4DR4Q 4YCWA 2WV6D 5C3EG 4EQNA 2H4OA 4PMWA 3GTJH 2BA0A 3GV3A 2P5ZX 4BBRH 2K5QA 5C0XI 4PZ8A 2F0MA 3L7ZC 3KJOA 3PIP3 1CKNA 1N34L 4H0LC 4GZYC 4A3LH 3DWQA 1G2TA 2NZHA 3A8IE 4JI5L 1S3OA 3J81E 3G6JB 2Z8LA 2L55A 1TWAB 4HTHA 3K8AA 1B8AA 2K75A 1FJGL 1Q12A 1JE5A 2NN6G 5D3IB 5C4JH 3D3RA 4RCOA 2KCCA 3M7NA 5GAHC 3C2PA 2FMMA 3TS0A 3U58A 1HNWQ 2G9DA 4TVAB 2NVYH 1J5EL 4FXKC 1QVFA 4AYBG 4QCLA 4I65A 5EQ0A 3H3VI 4N8X1 4DNTB 5M3FG 2EJGC 3S1NH 2LKVA 3PV0A 2E2DC 3OTOQ 3BG3A 2Q2TA 1JOKA 1WTHA 3F2UA 1YNNC 1S72A 1T5XD 4GKJL 1GHJA 4A3EG 3EFXD 2NZOA 3GO5A 4H7BA 4PMBA 4OO1I 4JC0A 3D4WA 3DM1A 1RJTA 1MIUA 2PZUA 1XMOL 3I4MH 2JA5B 1BCPF 2I5LX 1X65A 4CJ0B 4BXXH 1NJIC 2NVXB 1M1KC 2KCTA 1N33Q 3HG9A 2B29A 1I3QB 4NPSA 2ID0A 1B1ZA 2ZJPA 2GVAA 5JEAH 2ES2A 1WCMB 4L5RC 3VA5A 1SYDA 4V190 4OX9Q 4JYAL 1TWGH 3S1NB 2MP1A 4Q0FA 4J1MA 2RSOA 1N34Q 3CCMA 3CCSA 2R92H 2E2IH 2DNEA 4HJ7A 5CYUA 4HAEA 3HOVG 2E5LQ 5JJZA 2NWGA 3CKIB 4EVOA 4P72A 1EYGA 4DR2Q 1CI3M 1LM0A 3L0OA 3MZ5A 4Z9CB 1STEA 2SNMA 5EKIA 4F8MA 1WFQA 1SXTA 4RGOS 3BDCA 1JB3A 3V05A 1CKNB 2NZ1D 3IFTA 2IHFA 3S1QB 4KK7A 1GXDC 2YYZA 5CV5A 2B2WA 4KY7A 1YBYA 5T1GA 4DR2L 1HTPA 1BXTA 4J8QA 1B2TA 2F0WA 2N3SA 4JV5L 1RTNA 3NWSA 1CK1A 1Q1EA 1MBYA 4GN4B 4IUTA 2HDMA 5DM63 1J5EQ 5BN5A 1HRJA 3A55A 3A7LA 2KHIA 5ELCA 5EPKA 4R8NA 1QNUA 3QB3A 1MSGA 2A69D 1U0LA 3SVMA 3CRKC 4R4CA 4MIUA 2BOSA 4ZUIA 1Q82C 1LT4D 4L5SA 1HA5A 3SK8A 2XVSA 3K0XA 4O1NA 3H3VC 1YNJC 5JVH3 4A75A 3F2CA 4J6HA 4TRDA 2OQ0A 4OXPA 4DAVA 5CORA 1XWEA 3PIOA 3OMCA 3HOZG 1Q8IA 2PMZE 4JVZA 3PIO3 1SNQA 3KBXA 2LFNA 5IP7G 2H1EA 2PYKA 1LYLA 5NUCA 2L5TA 3EJIA 3SGIA 1AE2A 1RF2D 2GA4B 4IUNA 1KTKA 4GKJQ 3CQZH 4B3MQ 1WTWA 2AMCB 1L1OB 4B3RL 4OONA 2GN5A 2MNAA 4DXFA 4KN4C 4A3CH 5C3WA 4KD4A 1BNZA 2PPBC 1V43A 1BBXC 4HIDA 4QB4A 4JI0Q 1HNZQ 4CGYB 5J1ZA 1LTSD 1K8AC 4YCUA 1KAWA 3E0JA 3S2DB 3JC66 4YCVA 4JI8L 2RKSA 4IJLA 4CDCC 4DV5L 4WJ3M 2CHBD 3GDEA 1K3RA 1PZKD 4AQYL 3GTQB 1IHZA 3NUCA 1O7ZA 3CRLC 3EVQA 4QIWE 3RZDB 3PF4A 4DXGA 1XJVA 2A6ED 1E3PA 1X3GA 2F4IA 2R93H 4CHTB 2VL6A 2RSNA 3KBGA 4KY5A 3D0FA 1STNA 3HKSA 1VMCA 4C3JG 3CCJA 1XYIA 2F3WA 4LF8L 3ERQA 3S9WA 3SK6A 1K9MC 1D5ZC 2GVBA 1A2TA 4AQYQ 2QILA 3MXNA 3E5SA 1F9PA 4KJNA 1YJNA 3K5MA 4A76A 3F8TA 4XT1B 1X6OA 4DR7L 1EY7A 3BVGA 2OF1A 3E0EA 4BY7B 2FHTA 3A54A 2HHHQ 5M3MH 3HS0C 4B08A 1VQAA 2EY6A 3MHBA 3GTQH 2IX0A 4JI2L 4XDXA 1ICFB 2B2VA 3HOWB 1XX8A 3OMGA 3I91A 4K5VA 1TQOA 4B3TL 3F2BA 4DR7Q 1J8IA 2FFKB 4DNIA 5I9OA 5IGGA 1R9TH 1SLJA 5IGEA 1P8LA 4DF7A 4DV3L 2JYOA 1K28A 2EY1A 1XPOA 2D9UA 4BA1I 5CMDA 4RH6A 2PI2E 1JMCA 1FD7D 5EKLA 5F2DA 5JJKA 1F2ZA 4K2KA 5KNCA 3NPPA 3S1MH 2F0QA 2XIWA 1SJED 4IUVA 3Q23A 3CPFA 4NXML 3RNUA 4DR1Q 4IPCA 2JQOA 3S16H 4HIMA 3HOWG 1WTVA 3ZJYC 2YTXA 4QJFA 5GQOA 2JP1A 3C46A 2E2JB 3TREA 2F0LA 4P73A 4DV5Q 4HR7B 2OWOA 4C1NK 1EWHA 1TWHB 3NBIA 1Q7YC 2PCFB 4C3IB 5IE8A 5GADC 2Z4IA 4MNOA 4A3BH 2A6HD 2XWBB 3V2TA 4ZLTF 4RKBA 2WIIB 4L63B 2PW7A 5C0XJ 4A3JB 4S3SA 2ZXRA 3PUYA 2CQAA 2DJGC 3GTGH 1KHIA 1S5CD 2KECA 1CHQD 4LF4L 1DXMA 3CP0A 3VA7A 2JA8G 1SDFA 2LXKA 3E3XA 2F0UA 3KOJA 2R7ZH 3RN2A 1S4ZA 2ALYB 5IYCG 5JJLA 2K05A 5LMUL 4LFCQ 3U9OA 1HZBA 5M9OA 4H44C 4LF5Q 2B3GA 1LTID 4HN7A 4RMFA 3UDIA 4X62L 2WB1B 1GD7A 1SROA 1Y1WB 3S1QH 4RG1A 3SDZA 4H13C 5T1IA 1FGUA 3M3YB 2VZAA 1I50H 2I07B 1EZ8A 3MXUA 1PFSA 4DV4L 3CCEA 5AJ3Q 1VDZA 1EWCA 4F7XA 3C1FA 4QF4A 5C5LA 3TP7A 3OWEB 3J81j 4LUVA 3MFYA 1NCVA 4DV2Q 1SE3A 5JPNC 2NUCA 3HOUG 3I8ZA 1XTCD 4OX9L 3I4NH 1U5KA 1PYWD 1BO0A 5AJ3L 3T56B 3OIQA 4NMZA 4ODGA 3Q0AA 2IWHA 4HEDA 4GLVB 2B63H 4CDDC 4OO1G 3K58A 1DOMA 1GUSA 1V9PA 3FKIH 1VQKA 3TMEA 4EQOA 2MO0A 1VQPA 3HOXG 3DXJC 4RAUC 4A3MG 4DR6Q 2CFMA 4ZKBB 2WINB 3KF8B 1C7YA 4CBVA 5EGTA 2OEOA 2BA1A 4PNYA 5E1FA 2Z1CA 2DUDA 3W2DA 4B9WA 4LF9L 2K01A 5IYBG 1SMYC 3PO3G 2VY3A 3FMCA 5IT9c 1MKHA 4FDBA 2K1BA 3G71A 4JI6L 2F0GA 4AIMA 3I4NB 4OL7A 4C3HH 3BZCA 2VQEQ 1JT8A 1WD1A 2RDHA 3TRZA 1JJGA 1I94Q 1SNCA 2ZXOA 3N6RA 1QVCA 3K7AH 2AUKA 5M5WB 1EWIA 1S40A 1C0AA 4DUZL 2SOBA 5BN4A 1ASZA 5D65A 3LNNA 2EJMA 1IL2A 1SYBA 1ZYRC 2CW0D 1EIYB 1SMXA 5LHY1 3PO3B 4X6AH 3SR1A 1XPRA 4BBSG 3GTMH 3I56A 2JA7H 2EDGA 3CU7A 1ILQA 1I4RA 3U4ZA 2XNAC 1K3BC 1SNOA 4Y7NH 1Z9FA 1N8RC 2R92B 5FO9B 4KLKA 2K5VA 3S15B 1QE6A 1KQSA 3QOJA 1CA6A 2DNCA 4PG3A 1A3UA 4DUYQ 1KL9A 2Z6KC 4RKLA 5C3EB 4YWLA 4O42A 2F0TA 5EJWA 1WCMH 2KEEA 3HZXA 1EUJA 1Y1WG 1PH5A 3PGZA 2KCMA 2E5LL 2HQEA 4P2CB 1ILPA 4QGUA 1L0YB 1LTBD 2WACA 3CCUA 1OXVA 1EY5A 3S16B 1ML0D 4FXDA 1U4LA 3G4SA 1CTMA 4C3IH 1H9SB 5HGQA 5KIXA 1H9JA 1SR3A 5FJ8G 2ICIA 3LGJA 4JBJA 1JJCB 1JOOA 4IFDG 3M4OB 1SRUA 2CH4A 2IW3A 3M4YA 4LMQD 4AYBB 3CQZB 2RHSB 3CCLA 3CMEA 3H0GH 4XTCS 4IFDJ 3MC0B 2RDFA 4OIKA 2F0PA 1YNXA 1HH2P 3MVVA 1OO9B 3FPUB 5G3LD 1Z6HA 1T5EA 4IUUA 3URYA 2RHQB 2WAQB 2F0DA 1CUKA 3O13A 1VQ4A 5A2QL 2A74C 1B3AA 2KEDA 3CPWA 5C4JB 4LWCA 5HY6A 4IUPA 4GLXA 4RWSC 2R7DA 2RCFA 4YIJA 2K6AA 3J7AV 1TS4A 4DV7L 1D5MC 1PFNA 2B8GA 4C1NI 1W3SA 2K14A 4U673 2KUMA 3QR8A 5FLMG 2JA5G 1IBMQ 1I50B 2RA4A 1SNDA 2K7VA 1AW7A 2EVBA 4DGZA 2VXWA 4CDEC 1KRSA 5FKAC 3UDXA 3RLNA 1WYDA 3CHBD 1D1IA 1SE4A 5IYDH 2D5DA 2QF7A 2CH4W 1JR0D 3CMAA 1HFGA 4A3GB 4DAYA 1GUWA 5I4DA 1HNXL 3CF5A 4JI5Q 4XQQA 3TP6A 2B2UC 2J7ZA 1HR0Q 1A0IA 4DR1L 4P74A 1AFPA 4JW0A 2KA7A 4NP5A 2WAQE 1HUMA 3NP8A 1A3TA 1VS0A 1QZGA 4Y7NB 3CCRA 1ENCA 3D8GA 2BE5C 3AMUA 3PF5A 1SBBB 3PMFA 2JA6B 4IOAA 3VR6A 1DD2A 1LT3D 2M00A 3VR3A 4A3KG 1VQ9A 3TEHB 4NXNL 3IKJA 4JI1Q 3S2HB 2AWNA 2SNSA 4X3SA 4JI6Q 5C6AA 1XMQQ 4IJHA 4FF4A 2E76C 4JV5Q 4B3TQ 1YIJA 4C3JB 3I90A 1KAAA 1XNQL 5E4WC 5E7NA 3WWVA 5C3XA 1GHKA 4A3DH 3TZDA 1IKMA 4RHSA 3PUWA 4AH6A 1PA6A 4AYBE 2DJFC 2CKZB 2PZTA 3UE1A 5FLXL 4KN7C 4EQ5A 1YEZA 2WP8J 5EPLA 1D6EC 4UP9A 4A3LG 4POGA 1PTOH 2H5XA 1PVOA 3KUPA 1CZGA 3BZDB 5C4XG 1TS5A 1GJXA 4LJZC 1UWVA 3GTPB 5ISRA 2L4NA 1FNWA 2K32A 1Y1VG 4HSVA 4JYAQ 2JA6G 1Q90A 1SNMA 1K8MA 1UEAB 2UUBQ 4GOPB 1VQLA 4A3BG 2BDNA 4XQNA 2VUMB 4DFAA 5M3FH 4LFBQ 2CW0C 3NXWA 4DV0L 1IYVA 3L2PA 2F03A 2IL8A 3FEWX 4APVA 5CV6A 2EYJA 2K5DA 4N9PA 5M5YB 1O7YA 1SSOA 4ZKCB 1OXTA 2YV5A 4A3JG 5ELFA 4OHJA 1EU4A 1Y69U 3P75A 5IYCH 4JBKA 1STHA 5EAYA 4ZQ3A 4LF4Q 4ID6A 4G7ZC 4BXXG 4X3TA 4QY7A 4WJWA 1VQMA 1JJ2A 5J22A 1NMFA 4ZAIA 3GD7A 5JEAG 2BCOA 2R7FA 4DR3Q 5JJIA 3OW7A 4ME5A 3ONAB 1STAA 3OSOA 2VS1A 4IOCA 1TWGB 2F0HA 2WB1G 4HCEA 3QWNA 1B70B 1NY4A 3ITPA 3W3AA 2NB0A 1YNND 1W6JA 3V96A 2N55A 1HCZA 4NW2A 1EY6A 1I3QH 4MN3A 3W5OA 2LY7A 1YHBA 3RUZA 2O5JC 3A5UA 2Q2HA 2NVQB 4MTKA 1GUOA 3STBD 2IHEA 1KLGD 4HSPA 1QJOA 1B50A 4A3MH 3RLFA 2JK8A 1W2BA 1SFOB 3TDQA 4CJ1B 4DN4M 5IGBA 2HD3A 5IGFA 2NYZD 1Q8KA 3BDOA 2I5MX 1VCIA 2MPMA 3BZKA 3H94A 4NB3A 1SNPA 3CC4A 1RL2A 5CR3A 1EL0A 4EGVA 2PMZB 2NVXH 4ZUJA 5BR8L 4IUQA 2F0IA 1HUNA 1PFMA 3M9BA 1BOSA 2ZXPA 3EN2A 4L8JA 2I46A 1IYJB 2F1MA 3MXPA 3C1EA 4WORA 5IT9E 2PQEA 4CDFC 5CV4A 4WRDA 1EIHA 4MZ9A 2HIVA 2QCPX 5J39A 3QG1A 2R92G 1JCKB 2D62A 4TKOB 3HOVH 4LNQA 4IN3A 1PTOD 1BR9A 1X3QA 4R4IA 2B2TC 1O7LA 2ENBA 5IWAQ 4X64L 1NE3A 4DNRB 4IO9A 3OPOA 1GUGA 1RHPA 3S2HH 3LWEA 1JOQA 5IODA 2Q8TA 4BY7H 5CV8A 3ULPA 5KYIA 1HXYD 3S24A 3KLSA 3DUZA 1I4QA 4U68A 5TSSA 3FRPB 1EYDA 2IT1A 3H3VH 3LX0A 1TS3A 1E24A 3ULLA 1BVSA 3M4QA 3I55A 3OYYA 1CT1D 3TP5A 4YY3L 2BH2A 5C5MA 2MJ8A 1U4RA 1Q86C 4A3CG 2VQFQ 1ZEQX 1CZWA 2Z9HA 1LTGD 1CA5A 3A8JE 1KRTA 2ZJQA 3SK5A 4LAAA 4OIJA 5GAEC 1PH2A 3KYHC 3D6WA 4FVMA 4LF7L 2JA8B 1OXUA 2B2TA 1I6HB 5IP9G 1PH8A 1QWYA 5C44H 3RZDH 4A4IA 5CBAE 4B3RQ 2A6HC 2N78A 1C4QA 1A3VA 1PH1A 3K6OA 5C0XH 1CQVA 2ATWA 5JOBA 3U4VA 3TP8A 1IBKQ 1EY0A 4C3IG 4RGMA 3CC2A 1M90C 1UE6A 5FJ8H 1MSHA 2JN4A 4DV6Q 4G7OC 2KHSA 1YHAA 4KKUA 4GNXB 2EYFA 3HGBA 3S14B 2A6EC 1G6ZA 3K0YA 3Q8DA 4C2MH 1PH6A 2K50A 2ASBA 1JWSD 4A93G 4TQUS 4R1JA 4B3SQ 5IWAL 4X64Q 1SYFA 3SK4A 2UU9L 4A3IH 1F2LA 3MXGA 1FGBD 4BBRG 4P71A 2O2LD 3J7YW 3HOUB 3ERSX 1SYGA 1S5FD 1EEID 1WI5A 3NBHA 4RGNA 1LACA 4KHPL 2KCNA 1K8OA 1L2FA 3FP9A 2FJ2A 1VQEA 4GN5A 4HJ9A 1TWAH 3HFZB 4A3MB 3SHLA 4JI4L 2EYPA 1QG7A 3KLWA 3W1GA 2IX3A 4R9WA 2NN6H 5FOBB 2F4VL 5FK9C 4A3FB 2NBFA 2BH8A 1X3FA 4CJ2C 4BBRB 5IGCA 1JQYD 5LL6X 2R93G 2A69C 3EBEA 1PRTC 2DY7A 2F3VA 3TZUA 1UAPA 1AE3A 1IZ6A 3H09A 5LL6S 4KV6A 3R2TA 1IBLL 2CWPA 1JWUD 3MEFA 1C9OA 1PH3A 1E0BA 4UP8A 1B53A 4DAMA 4EX5A 3DM3A 4QL5A 1TWFH 2WKCA 4FF2A 2MGSA 4FO2A 4JOIA 2UUAL 3HOYG 5IT9L 3NQIA 3I4OA 4J15A 1GUTA 3RD4A 3CXCA 1X56A 3GTLH 1YJ9A 4IPGA 4DV6L 2PQAB 1NTGA 1LT5D 2MUYA 1X32A 4DR5L 4XYOA 1RKNA 1FR3A 1SE2A 1ONLA 2EIFA 1BDOA 1O7IA 3M7GA 3KLSX 1FVIA 4WFN3 2E2IB 2K52A 1BKBA 5D14A 1H9SA 5M3FB 2R6GA 4PZ7A 2VUMH 1ENFA 4KY6A 3EA6A 2AWOA 2CQOA 1SN8A 3KJPA 2QKIC 1SFOH 2BDOA 1BBWA 1SYEA 1LLRD 4NDXA 2EY2A 4PQXA 1CKMA 1PH4A 2VNUD 1ENAA 3L3OC 4X66L 1PTOC 4PMCA 4NKLA 3GTJB 3I2ZA 3PO2B 3I4MB 1NAPA 1LUZA 4K8IA 2LSSA 4KI0A 1BUVT 3E9HA 4BA2I 2XRSD 3VDYA 1HZCA 3X3MA 2FXQA 1YI2A 4IALA 4QUCA 2C35B 4DV2L 1HPCA 1F2MA 4R4QA 3FKIB 2OQKA 3ND9A 3FHWA 2B63B 2PZWA 3NEMA 1E1OA 3PSIA 1VQOA 1B4OA 4FF3A 2IJ0A 3HOXH 1EYCA 1G6PA 5G3LF 5K36G 1STGA 3K7UC 2SEBD 1KLUD 2XRQD 4DK1A 5E3FA 4GNXC 4QQBX 3T53B 1VQ7A 3KF6B 4DAYB 4LF9Q 3TN2A 4DR4L 1XMOQ 3PO3H 4DUYL 5IOCA 2ZM6L 1AEXA 3RZOH 3MXNB 3WOEA 3NK9A 3AQQA 2ZTDA 4JG2A 2DN8A 2C9OA 1FNVA 1XXGA 1TY0A 4GN3B 2L12A 3ZYYX 2XN9C 3OOCA 4JI3Q 1XMQL 3ICEA 5KNBA 4KMUC 3D4RA 1PH7A 1DM0B 4H02A 4NXNQ 4DU9A 5C4ZA 2M2LA 4JOIC 1F9RA 4DK6C 3GTGB 1TKWB 2RBMA 1YNJD 5FLXE 4UY8C 4A3FH 2EE1A 3C3LA 2OT2A 3M85A 1HR0W 2B63G 3PIPA 3DLLA 2HT1A 5EKKA 2LMCB 1IXRA 3HKZB 4LF6L 2JA7G 3NTHA 4MHEA 4DUZQ 1UE7A 1EY8A 2JJQA 2D0PA 2KOLA 3I72A 3U50C 4DAPA 1G51A 4LF5L 1H9MA 4ULLA 4OWXB 5LMUQ 2Y0SG 1B3QA 2DGYA 5IYBH 3BDLA 4K8JA 3H0GB 3AEVA 1GM5A 2UXBQ 2L0CA 2YTYA 2EOTA 3AB9A 3AFPA 1NNXA 3FDTA 1NBWA 3G7LA 3J80i 3P20A 4PV1C 1BF4A 2QEJC 4MTNA 1H9RA 4GOPA 2F4VQ 2KBNA 1HQMC 4XYQA 5A35A 3K57A 4HIOA 4K6DA 1PYBA 3IAYA 1ESFA 1MJEA 3M3YH 2K03A 4HMJA 1PFBA 3FVQA 4LFBL 1ESRA 1EY4A 4YY3Q 5BN3A 3CCQA 1I4GA 3MA2B 3J80c 1EIFA 4KHPQ 1FJGQ 4C56C 4IPDA 3QO2A 1G291 2R61A 1B44D 2QDBA 3DEPA 4P75A 4UHVA 1WD0A 2A8VA 2QA4A 1BQQT 4Q5VA 2UUAQ 5I2YA 1TVXA 1U4PA 3UE0A 3T1YQ 3CC7A 5DAUA 5DNFA 3S1RH 2PI2A 4HCSA 5I6WA 5JVG3 2AQ2B 3CCVA 2AQ1B 1YITA 2E8GA 2MQHA 2E2HB 3ER0A 3I7FA 3H91A 4ME3A 4L6TB 3VR2A 1WCMG 5FLMH 4K0KL 5KGUA 1V1PA 5IP9H 1KDCA 1ET9A 1Y8PB 3GTMB 1HJPA 3I70A 1VF5C 4IPHA 3BS1A 1ASYA 4DK3C 2J4XA 1EQRA 4OGQC 4G4KA 2V1CC 2FINB 3OIPA 3H6MA 1TS2A 5IYDG 4OELB 4A3EB 1A6XA 4A93B 3DEOA 2RVLA 4ZK9B 3KF8A 5D3DA 1VQ5A 2HCIA 4BY1H 5KEEA 1D2BA 4K5XA 1SE8A 2UU9Q 1A8VA 1X55A 4A3GG 4XXEA 4BWGB 2EY5A 5LMNW 4A93H 1P16A 4A3EH 4B3SL 2XTIA 3T1YL 3H0GG 1PRTF 2QW7A 2IPKD 2YU9B 2B2WC 1C48A 4LFAQ 4DK0A 3I4MG 4F87A 3VYRA 5LMNL 1F9QA 3WDNA 4LW1A 4NXMQ 1B9MA 1V1OA 2LS01 3T16A 4BBSB 1IKLA 2IX1A 2KHJA 3OHXC 5M3MB 1M8AA 3CD6A 1Z47A 1CFMA 1WTXA 1SAPA 2UXCL 1PHJA 1FL0A 2SDFA 1D5XC 3S17B 1L1OC 1Z7TA 3ULJA 2X6LA 4DV3Q 2E74C 4JI3L 2NVQH 2X6GA 1I6VC 3BYYB 4DV1Q 4JI2Q 1N36Q 2XGTA 1X3EA 4B3ML 3N52A 1LV9A 5JAVA 1XNRL 2V4DA 5HGTA 2UXBL 1LTTD 3DWAA 3NTIA 2Z4HA 4K0KQ 2VQFL 5COYA 2VB2X 1RDPD 2NVTH 4DR6L 1OXXK 1HFNA 4LUOA 3TS2A 3NE5B 3NHHA 2RQXA 2AKWB 3TSSA 2PQAA 3HOVB 1PZID 2OTJA 3NSWA 1E1TA 3UDGA 4RFBA 1Y1VH 2EPBA 5A2QE 2L1BA 1E22A 5KRUA 4HIKA 4LF8Q 1RIPA 4A3KH 2HIXA 3U9SA 1I4PA 5ELNA 4DA2A 2RDGA 1CSPA 3EROA 2JA7B 4XT3B 2QDLA 1TWCB 1WTOA 4RA8A 1ZXTA 1YHQA 5L37A 3R2IA 1H9KA 1E7ZA 4G7HC 2KQ3A 4DKAC 5M5YH 1GKHA 4X3UA 1E2ZA 4M8AA 4OWWB 3PO2G 2Y0SB 4JI8Q 5CGKA 3K59A 3A56A 2EZVA 2XWJB 1K83H 1JE4A 5ELEA 3M4OH 3ND8A 3HEJA 1LT6D 2KJXA 1O78A 1N9WA 3W1BA 3AU7A 2OTLA 1KXLA 3QJYA 4GS3A 1SMYD 3KLRA 2HQLA 1S5DD 5BR8Q 4C3HB 1HHVA 1BCPC 3J81c 1XNRQ 1WTPA 1CKOA 1PZJD 1RD9D 3MEHA 1N36L 2FMCA 1KDAA 1PRTB 1XNQQ 5JPMC 3OTOL 1QUQB 5J3BA 3NBHB 4XQJA 3J7ZC 2AUJD 2EYOA 1D8LA 2B2YC 4QUFA 2A19A 1AN8A 1TWCH 3CAMA 1V8QA 4K14A 4K6LA 1Y8OB 2Z0SA 1PMRA 1Y8NB 4KKSA 4A3DB 3DHQA 3KK7A 4UP7A 4OO1H 4LF6Q 2UUBL 3IFDA 1STYA 1Y1VB 3SE0A 2K5HA 4IZ8A 4XIGS 1Y1WH 4M1UB 3GTOH 1YVCA 1HR0L 3HOZB 2K04A 4F88A 1Q3LA 4KD3A 4ABNA 4OWTB 1K0SA 1WTRA 4UAIA 5KYLA 1PH9A 3G48A 3A8KE 1HQRD 4HJ5A 2B2YA 5IIFA 1JICA 1BCPB 3P7JA 1CSQA 3HOZH 2KENA 3GTOB 4R4TA 1MJCA 1CHPD 2ZT9C 4IFDH 5CV9A 3K81C 4HJAA 1DGSA 1TT2A 4BS9A 2B2VC 1EOVA 1KNEA 5CBEE 1F9SA 2QGQA 4CKEA 5JEAJ 2UUCQ 3I73A 1GUNA
chains in the Genus database with same CATH topology
3S17H 1HZAA 3K8AA 1B8AA 2K75A 4DV7Q 1YJ9A 1Q12A 1FJGL 1GO3E 4IPGA 4DV6L 2PQAB 1NTGA 3GTLH 2I5HA 2UXDQ 1WCMH 1JE5A 2NN6G 5C4JH 4DR5L 1K8GA 1EUJA 1Y1WG 1K73C 1PH5A 4DV0Q 2E2JH 5GAHC 3M7NA 2Y0SE 3PGZA 2EIFA 3GTPH 3TS0A 1O7IA 2KCMA 3U58A 2E5LL 4JI7L 1HNWQ 4TVAB 2NVYH 4QGUA 3EIVA 3PUXA 1FVIA 1J5EL 1QVFA 3E9IA 4AYBG 3CCUA 1OXVA 3OW2A 2K52A 1BKBA 2JA5H 3H3VI 5M3FG 2R6GA 3G4SA 4PZ7A 4HJ8A 3S1NH 2VUMH 3BU2A 3PV0A 1OXSC 4C3IH 5HGQA 1WJJA 3OTOQ 1D7QA 2AWOA 2CQOA 1SN8A 1TWHH 1HZ9A 3KJPA 1SR3A 5FJ8G 2Q2TA 1S72A 4GKJL 3LGJA 4JBJA 2RCNA 1SFOH 4A3EG 2NZOA 3GO5A 1JJCB 4OO1I 1BBWA 4JC0A 4IFDG 1SRUA 1MIUA 1XMOL 3I4MH 1PH4A 1CKMA 2RHSB 3CCLA 2VNUD 2I5LX 4X66L 4X62Q 1X65A 3CMEA 3H0GH 4XTCS 4BXXH 4O0AA 4C3JH 1NJIC 4IFDJ 4X66Q 4L5TA 1YNXA 3I2ZA 2MFIA 2KCTA 1HH2P 1M1KC 1N33Q 2B29A 1LUZA 2WFWA 2RHQB 2LSSA 4NPSA 2VW9A 4ALPA 1CUKA 2ID0A 1VQ4A 5GAGC 2ZJPA 2GVAA 2ES2A 3CPWA 4KI0A 4LWCA 5HY6A 3H15A 3E9HA 4GLXA 4BA2I 2R7DA 3VDYA 4L5RC 1HZCA 4DV7L 1VQ6A 2FXQA 1YJWA 4OX9Q 1YI2A 1W3SA 2K14A 4JYAL 1IBML 4DV2L 2C35B 1TWGH 4R4QA 5FLMG 2JA5G 2OQKA 1IBMQ 2E2HH 1PYSB 3FHWA 1N34Q 3NEMA 1E1OA 3PSIA 3CCMA 1LTLA 3CCSA 1VQOA 1Q46A 2R92H 3HOXH 2E2IH 1KRSA 4JI1L 3TQYA 4HJ7A 1JB7A 1EFWA 4Y52H 1G6PA 3UDXA 3HOVG 2E5LQ 1HNWL 5K36G 3K7UC 3RLNA 1WYDA 3BJUA 4P72A 1EYGA 3AFQA 1H95A 4GNXC 4X65Q 1VQ7A 2JA8H 3KF6B 4DAYB 4QQBX 5IYDH 4LF9Q 3GTKH 1XPUA 4DR2Q 1I5FA 1LM0A 3L0OA 3CMAA 4DR4L 4A3DG 5C3EH 1XMOQ 2R7ZG 4PZ6A 3PO3H 1WFQA 3CF5A 4DUYL 1HNXL 4JI5Q 2ZM6L 1A0IA 1HR0Q 2ZJRA 1CKNB 1HNXQ 3RZOH 3MXNB 4DR1L 4P74A 2IHFA 1GVPA 2NN6I 3AQQA 2WAQE 2ZTDA 2YYZA 3KF6A 4JG2A 3RLOA 1YBYA 4DR2L 1VS0A 1QZGA 3CCRA 2Q2UA 4GN3B 4WJ4A 4L5QA 2N3SA 4JV5L 3PF5A 1IBLQ 1YZ6A 4JI3Q 5C4XH 1XMQL 3ICEA 4IOAA 1VQ9A 2Z6KA 1Q1EA 4GN4B 4A3KG 3TEHB 4NXNL 1PH7A 1J5EQ 5H1SE 4JI1Q 4NXNQ 2RF4A 4H02A 4O2DA 2AWNA 1X9NA 4JOIC 4JI6Q 2KHIA 1XMQQ 4IJHA 4DK6C 2JEBI 3HOUH 1V1QA 4JV5Q 1OTCA 4B3TQ 4UY8C 4A3FH 1YIJA 1U0LA 4R4CA 3M85A 1HR0W 2B63G 1Q82C 1XNQL 3PIPA 3DLLA 4L5SA 2HT1A 2IY5B 2D0OA 4GOPC 3S2DH 2YTVA 1IXRA 5E7NA 3WWVA 4LF6L 2JA7G 3K0XA 4A75A 4A3DH 4DUZQ 4POFA 3F2CA 4BY1G 1UE7A 2JJQA 2OQ0A 4OXPA 5DLQE 3PUWA 5M5WH 1NMGA 2D0PA 3U50C 3T1HQ 3S14H 4AH6A 3PIOA 3HOZG 2BH2A 1PA6A 2PMZE 4AYBE 1EQQA 1G51A 2CKZB 3A5ZB 4LF5L 3UE1A 5IP7G 4EQ5A 4OWXB 1QZHA 5LMUQ 2Y0SG 1YEZA 3HOYH 2WP8J 2DGYA 5IYBH 1LYLA 4UP9A 4A3LG 1A62A 3SGIA 4A3IG 4POGA 2H5XA 1PVOA 1AE2A 3AEVA 3RR5A 1GM5A 2UXBQ 3D31A 2YTYA 5C4XG 3AFPA 4GKJQ 3CQZH 1B7YB 4B3MQ 2AMCB 1NBWA 1UWVA 1L1OB 4B3RL 4OONA 3J80i 2GN5A 2MNAA 4GKKQ 2UUCQ 4A3CH 4KHZA 1Y1VG 4MTNA 4JYAQ 4GOPA 2F4VQ 2JA6G 2KBNA 1V43A 3UDFA 4YHHQ 4HIDA 4JI0Q 1HNZQ 4DV4Q 2UUBQ 4GOPB 1VQLA 4A3BG 1K8AC 4HIOA 4YCUA 1KAWA 1PYBA 1MJEA 5M3FH 3M3YH 4LFBQ 3S15H 1IBKL 4DV0L 3JC66 4YCVA 3L2PA 4JI8L 4LFBL 3PUVA 4IJLA 4APVA 4YY3Q 1I94L 3CCQA 4DV5L 3I4NG 3GDEA 4WJ3M 3J80c 2UXDL 1K3RA 1EIFA 4KHPQ 4AQYL 1FJGQ 1HNZL 3TS2A 4IPDA 4QIWE 1G291 2WB1E 2UUCL 3PF4A 1OXTA 2N8NA 2YV5A 4A3JG 1XJVA 4P75A 1E3PA 1X3GA 2A8VA 2R93H 5IYCH 2QA4A 3HKZG 2N49A 3FKIG 2UUAQ 2VL6A 3D0FA 4JBKA 5EAYA 3UE0A 3T1YQ 3HKSA 3CC7A 4LF4Q 4BXXG 3CCJA 2JEAI 3S1RH 4LF8L 2PI2A 4QY7A 1VQMA 1Q1BA 1XTDA 3NENA 2LXJA 1JJ2A 1NMFA 3CCVA 1K9MC 2GVBA 3GD7A 5JEAG 2R7FA 4DR3Q 2ZTCA 5JJIA 1VQIA 2CWAA 4AQYQ 1YITA 2E8GA 4JBMA 2MQHA 2L15A 2VS1A 3ER0A 3I7FA 2WB1G 4IOCA 1YJNA 4A76A 3F8TA 4ME3A 1B70B 1X6OA 2CCZA 1NY4A 1WCMG 3KFUA 5FLMH 1VQDA 4DR7L 3B6YA 4K0KL 5IP9H 3E0EA 4DR5Q 5IY0A 2HHHQ 3RN5A 1HJPA 5M3MH 1VQAA 1KC8C 1KIXA 4IPHA 1ASYA 1I3QH 4DK3C 4YHHL 3GTQH 2IX0A 4JI2L 1EQRA 2F3IA 3W5OA 3J81i 3PO2H 1UE1A 1YHBA 4B3TL 3A5UA 2Q2HA 2V1CC 3F2BA 4A3JH 3STBD 4DR7Q 3NELA 4DNIA 2IHEA 2VUMG 1R9TH 4GKKL 1SLJA 5IYDG 1P8LA 2K5NA 4DV3L 2EXDA 2VQEL 4A3MH 1TXYA 4LUZA 4YWLA 4GNXA 4JCVE 3RLFA 2JK8A 1XPOA 3J7A5 4BA1I 1W2BA 2PI2E 1VQ5A 1VQNA 4BY1H 1JMCA 3HKZE 1Q8KA 1SE8A 2UU9Q 5JJKA 1A8VA 1X55A 3IRBA 3S1MH 4A3GG 4A93H 5LMNW 2I5MX 4BBSH 1VCIA 1P16A 4A3EH 3BZKA 4B3SL 4BY7G 2XTIA 4LFCL 3CPFA 3T1YL 4NXML 4NB3A 3CC4A 3H0GG 5IP7H 4DR1Q 1RL2A 2WAQG 4IPCA 3RNUA 2JQOA 1UEBA 4DPGA 4HIMA 2NVXH 3S16H 4LFAQ 3I4MG 1L0WA 5BR8L 1Q81C 5LMNL 3HOWG 3ZJYC 3PUZA 2YTXA 4QJFA 4LW1A 4NXMQ 5GQOA 3M9BA 1K0RA 3TREA 4DV1L 1T9HA 2IX1A 2KHJA 1VQJA 4P73A 1IYJB 3CD6A 4JI4Q 4DV5Q 1Z47A 2OWOA 2UXCL 5GROA 1FL0A 2F52A 1PHJA 2EQSA 4A3FG 1Q7YC 1L1OC 3ULJA 5GADC 5IE8A 4MZ9A 2HIVA 4MNOA 1L1OA 1VQFA 4DV3Q 4A3BH 2QEXA 2PNHA 2R92G 4JI3L 5C0XJ 4JBWA 2NVQH 2D62A 5FLXc 1N32L 2UXCQ 3HOVH 4LNQA 3F2DA 3PUYA 3K80C 4R4IA 3A0JA 4DV1Q 3GTGH 1KHIA 4JI2Q 5IWAQ 4X64L 4IO9A 3CP0A 1NE3A 2XGTA 5C0XG 1PV4A 1N36Q 1X3EA 4B3ML 5M5XH 2JA8G 1VQ8A 2LXKA 3KDFA 3S2HH 1XNRL 4R4OA 2UXBL 4BY7H 5LMNQ 3ULPA 4LFAL 3KOJA 3S24A 2R7ZH 4K0KQ 2VQFL 3RN2A 2ALYB 4UPAA 5IYCG 1VQGA 5LMUL 2NVTH 1N33L 4DR6L 2IT1A 4LFCQ 3H3VH 1OXXK 5JJLA 4LUOA 3ULLA 1E24A 1BVSA 2AHOB 1HZBA 3M4QA 3I55A 3OYYA 2B3GA 3UDIA 4RMFA 4LF5Q 2AKWB 4X62L 3AYHB 2JE6I 1GD7A 1SROA 2PQAA 4YWKA 4YY3L 4DR3L 4RG1A 1Q86C 3T1HL 1E1TA 3UDGA 3S1QH 4A3CG 2VQFQ 2OTJA 1Y1VH 1FGUA 1E22A 2VZAA 1KRTA 1I50H 4HIKA 2ZJQA 4LF8Q 1PFSA 1RIPA 4DV4L 3CCEA 4A3KH 2HIXA 5GAEC 5ELNA 5AJ3Q 1QVGA 1PH2A 3KYHC 1CSPA 1X54A 4LF7L 3PCOB 3J81j 4LUVA 1OXUA 4DV2Q 5IP9G 3CW2C 1PH8A 4LF7Q 1YHQA 3HOUG 1E7ZA 5C44H 3RZDH 1U5KA 4A4IA 5M3MG 3JAMi 4OX9L 3I4NH 2N78A 4DKAC 5M5YH 5AJ3L 4B3RQ 1GKHA 1PH1A 2ZTEA 2A1AA 4GLVB 4OWWB 2ATWA 3PO2G 3U4VA 4JI8Q 2YU9H 1IBKQ 2B63H 4OO1G 1K83H 1V9PA 3FKIH 1VQKA 3CC2A 3M4OH 1J6QA 1M90C 1UE6A 5FJ8H 2MO0A 1VQPA 3HOXG 1WOCA 1BBUA 4DV6Q 1A63A 1N9WA 3W1BA 1VQCA 1YHAA 4A3MG 4DR6Q 2OTLA 1KXLA 4GNXB 2CFMA 4GS3A 3G6EA 4YWMA 1C7YA 3KF8B 2HQLA 3JAMc 5BR8Q 2JA9A 3Q8DA 4C2MH 3J81c 2BA1A 1PH6A 2K50A 2ASBA 1XNRQ 1CKOA 4A93G 4TQUS 4R1JA 2DUDA 4B3SQ 1VQHA 4GLAC 5IWAL 4X64Q 1N36L 1XNQQ 4LF9L 2MO1A 5IYBG 3OTOL 4X65L 1QUQB 5J3BA 3PO3G 2UU9L 4A3IH 2VY3A 5IT9c 1MKHA 4FDBA 3NBHB 4BBRG 4P71A 1N32Q 3J7ZC 3HOWH 3ERSX 2I0QA 3F1ZA 3G71A 1D8LA 4AIMA 4JI6L 4C3HH 1WI5A 2OCEA 4KHPL 3BZCA 2VQEQ 1KD1C 1I6HH 2A19A 5C44G 1JT8A 1TWCH 1JJGA 1L2FA 3CAMA 3FP9A 3TRZA 1I94Q 4JI7Q 1VQEA 4GN5A 1QVCA 3K7AH 4HJ9A 1QUQA 3STBC 2Z0SA 1EWIA 1TWAH 2JA6H 3HFZB 1S40A 1C0AA 4DUZL 4JI4L 4UP7A 1Y14B 3KLWA 5ELOA 3W1GA 4LF6Q 2UUBL 1ASZA 2Q2IA 1AH9A 4JI0L 3A74A 2K5HA 4XIGS 1VQBA 1Y1WH 2HHHL 1IL2A 2F4VL 3GTOH 1YVCA 1UE5A 2ZM6Q 1HR0L 2BH8A 1X3FA 3KDFB 1EIYB 1SMXA 4IFDI 3M4PA 2R93G 4X6AH 1XPRA 4OWTB 2K4KA 4A3GH 4DR4Q 4BBSG 4YCWA 3GTMH 3I56A 3EBEA 1PH9A 5C3EG 2JA7H 4LF4L 1AE3A 1IZ6A 3G48A 4PMWA 4HJ5A 3U4ZA 3GTJH 2BA0A 1IBLL 2CWPA 3MEFA 4BBRH 1C9OA 1PH3A 4Y7NH 1CSQA 4UP8A 3HOZH 5C0XI 2KENA 4DAMA 1Z9FA 1MJCA 4R4TA 1N8RC 4PZ8A 4EX5A 3DM3A 4QL5A 1TWFH 3L7ZC 3KJOA 4KLKA 4JOIA 1CKNA 2K5VA 3K81C 1N34L 2UUAL 4HJAA 1DGSA 1KQSA 3HOYG 3I4OA 4A3LH 1EOVA 4PG3A 4J15A 2NZHA 4JI5L 4DUYQ 1S3OA 1KL9A 2QGQA 2Z6KC 3CXCA 5JEAJ 1X56A 3EN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S17 H;  1HZA A;  3K8A A;  1B8A A;  2K75 A;  4DV7 Q;  1YJ9 A;  1Q12 A;  1FJG L;  1GO3 E;  4IPG A;  4DV6 L;  2PQA B;  1NTG A;  3GTL H;  2I5H A;  2UXD Q;  1WCM H;  1JE5 A;  2NN6 G;  5C4J H;  4DR5 L;  1K8G A;  1EUJ A;  1Y1W G;  1K73 C;  1PH5 A;  4DV0 Q;  2E2J H;  5GAH C;  3M7N A;  2Y0S E;  3PGZ A;  2EIF A;  3GTP H;  3TS0 A;  1O7I A;  2KCM A;  3U58 A;  2E5L L;  4JI7 L;  1HNW Q;  4TVA B;  2NVY H;  4QGU A;  3EIV A;  3PUX A;  1FVI A;  1J5E L;  1QVF A;  3E9I A;  4AYB G;  3CCU A;  1OXV A;  3OW2 A;  2K52 A;  1BKB A;  2JA5 H;  3H3V I;  5M3F G;  2R6G A;  3G4S A;  4PZ7 A;  4HJ8 A;  3S1N H;  2VUM H;  3BU2 A;  3PV0 A;  1OXS C;  4C3I H;  5HGQ A;  1WJJ A;  3OTO Q;  1D7Q A;  2AWO A;  2CQO A;  1SN8 A;  1TWH H;  1HZ9 A;  3KJP A;  1SR3 A;  5FJ8 G;  2Q2T A;  1S72 A;  4GKJ L;  3LGJ A;  4JBJ A;  2RCN A;  1SFO H;  4A3E G;  2NZO A;  3GO5 A;  1JJC B;  4OO1 I;  1BBW A;  4JC0 A;  4IFD G;  1SRU A;  1MIU A;  1XMO L;  3I4M H;  1PH4 A;  1CKM A;  2RHS B;  3CCL A;  2VNU D;  2I5L X;  4X66 L;  4X62 Q;  1X65 A;  3CME A;  3H0G H;  4XTC S;  4BXX H;  4O0A A;  4C3J H;  1NJI C;  4IFD J;  4X66 Q;  4L5T A;  1YNX A;  3I2Z A;  2MFI A;  2KCT A;  1HH2 P;  1M1K C;  1N33 Q;  2B29 A;  1LUZ A;  2WFW A;  2RHQ B;  2LSS A;  4NPS A;  2VW9 A;  4ALP A;  1CUK A;  2ID0 A;  1VQ4 A;  5GAG C;  2ZJP A;  2GVA A;  2ES2 A;  3CPW A;  4KI0 A;  4LWC A;  5HY6 A;  3H15 A;  3E9H A;  4GLX A;  4BA2 I;  2R7D A;  3VDY A;  4L5R C;  1HZC A;  4DV7 L;  1VQ6 A;  2FXQ A;  1YJW A;  4OX9 Q;  1YI2 A;  1W3S A;  2K14 A;  4JYA L;  1IBM L;  4DV2 L;  2C35 B;  1TWG H;  4R4Q A;  5FLM G;  2JA5 G;  2OQK A;  1IBM Q;  2E2H H;  1PYS B;  3FHW A;  1N34 Q;  3NEM A;  1E1O A;  3PSI A;  3CCM A;  1LTL A;  3CCS A;  1VQO A;  1Q46 A;  2R92 H;  3HOX H;  2E2I H;  1KRS A;  4JI1 L;  3TQY A;  4HJ7 A;  1JB7 A;  1EFW A;  4Y52 H;  1G6P A;  3UDX A;  3HOV G;  2E5L Q;  1HNW L;  5K36 G;  3K7U C;  3RLN A;  1WYD A;  3BJU A;  4P72 A;  1EYG A;  3AFQ A;  1H95 A;  4GNX C;  4X65 Q;  1VQ7 A;  2JA8 H;  3KF6 B;  4DAY B;  4QQB X;  5IYD H;  4LF9 Q;  3GTK H;  1XPU A;  4DR2 Q;  1I5F A;  1LM0 A;  3L0O A;  3CMA A;  4DR4 L;  4A3D G;  5C3E H;  1XMO Q;  2R7Z G;  4PZ6 A;  3PO3 H;  1WFQ A;  3CF5 A;  4DUY L;  1HNX L;  4JI5 Q;  2ZM6 L;  1A0I A;  1HR0 Q;  2ZJR A;  1CKN B;  1HNX Q;  3RZO H;  3MXN B;  4DR1 L;  4P74 A;  2IHF A;  1GVP A;  2NN6 I;  3AQQ A;  2WAQ E;  2ZTD A;  2YYZ A;  3KF6 A;  4JG2 A;  3RLO A;  1YBY A;  4DR2 L;  1VS0 A;  1QZG A;  3CCR A;  2Q2U A;  4GN3 B;  4WJ4 A;  4L5Q A;  2N3S A;  4JV5 L;  3PF5 A;  1IBL Q;  1YZ6 A;  4JI3 Q;  5C4X H;  1XMQ L;  3ICE A;  4IOA A;  1VQ9 A;  2Z6K A;  1Q1E A;  4GN4 B;  4A3K G;  3TEH B;  4NXN L;  1PH7 A;  1J5E Q;  5H1S E;  4JI1 Q;  4NXN Q;  2RF4 A;  4H02 A;  4O2D A;  2AWN A;  1X9N A;  4JOI C;  4JI6 Q;  2KHI A;  1XMQ Q;  4IJH A;  4DK6 C;  2JEB I;  3HOU H;  1V1Q A;  4JV5 Q;  1OTC A;  4B3T Q;  4UY8 C;  4A3F H;  1YIJ A;  1U0L A;  4R4C A;  3M85 A;  1HR0 W;  2B63 G;  1Q82 C;  1XNQ L;  3PIP A;  3DLL A;  4L5S A;  2HT1 A;  2IY5 B;  2D0O A;  4GOP C;  3S2D H;  2YTV A;  1IXR A;  5E7N A;  3WWV A;  4LF6 L;  2JA7 G;  3K0X A;  4A75 A;  4A3D H;  4DUZ Q;  4POF A;  3F2C A;  4BY1 G;  1UE7 A;  2JJQ A;  2OQ0 A;  4OXP A;  5DLQ E;  3PUW A;  5M5W H;  1NMG A;  2D0P A;  3U50 C;  3T1H Q;  3S14 H;  4AH6 A;  3PIO A;  3HOZ G;  2BH2 A;  1PA6 A;  2PMZ E;  4AYB E;  1EQQ A;  1G51 A;  2CKZ B;  3A5Z B;  4LF5 L;  3UE1 A;  5IP7 G;  4EQ5 A;  4OWX B;  1QZH A;  5LMU Q;  2Y0S G;  1YEZ A;  3HOY H;  2WP8 J;  2DGY A;  5IYB H;  1LYL A;  4UP9 A;  4A3L G;  1A62 A;  3SGI A;  4A3I G;  4POG A;  2H5X A;  1PVO A;  1AE2 A;  3AEV A;  3RR5 A;  1GM5 A;  2UXB Q;  3D31 A;  2YTY A;  5C4X G;  3AFP A;  4GKJ Q;  3CQZ H;  1B7Y B;  4B3M Q;  2AMC B;  1NBW A;  1UWV A;  1L1O B;  4B3R L;  4OON A;  3J80 i;  2GN5 A;  2MNA A;  4GKK Q;  2UUC Q;  4A3C H;  4KHZ A;  1Y1V G;  4MTN A;  4JYA Q;  4GOP A;  2F4V Q;  2JA6 G;  2KBN A;  1V43 A;  3UDF A;  4YHH Q;  4HID A;  4JI0 Q;  1HNZ Q;  4DV4 Q;  2UUB Q;  4GOP B;  1VQL A;  4A3B G;  1K8A C;  4HIO A;  4YCU A;  1KAW A;  1PYB A;  1MJE A;  5M3F H;  3M3Y H;  4LFB Q;  3S15 H;  1IBK L;  4DV0 L;  3JC6 6;  4YCV A;  3L2P A;  4JI8 L;  4LFB L;  3PUV A;  4IJL A;  4APV A;  4YY3 Q;  1I94 L;  3CCQ A;  4DV5 L;  3I4N G;  3GDE A;  4WJ3 M;  3J80 c;  2UXD L;  1K3R A;  1EIF A;  4KHP Q;  4AQY L;  1FJG Q;  1HNZ L;  3TS2 A;  4IPD A;  4QIW E;  1G29 1;  2WB1 E;  2UUC L;  3PF4 A;  1OXT A;  2N8N A;  2YV5 A;  4A3J G;  1XJV A;  4P75 A;  1E3P A;  1X3G A;  2A8V A;  2R93 H;  5IYC H;  2QA4 A;  3HKZ G;  2N49 A;  3FKI G;  2UUA Q;  2VL6 A;  3D0F A;  4JBK A;  5EAY A;  3UE0 A;  3T1Y Q;  3HKS A;  3CC7 A;  4LF4 Q;  4BXX G;  3CCJ A;  2JEA I;  3S1R H;  4LF8 L;  2PI2 A;  4QY7 A;  1VQM A;  1Q1B A;  1XTD A;  3NEN A;  2LXJ A;  1JJ2 A;  1NMF A;  3CCV A;  1K9M C;  2GVB A;  3GD7 A;  5JEA G;  2R7F A;  4DR3 Q;  2ZTC A;  5JJI A;  1VQI A;  2CWA A;  4AQY Q;  1YIT A;  2E8G A;  4JBM A;  2MQH A;  2L15 A;  2VS1 A;  3ER0 A;  3I7F A;  2WB1 G;  4IOC A;  1YJN A;  4A76 A;  3F8T A;  4ME3 A;  1B70 B;  1X6O A;  2CCZ A;  1NY4 A;  1WCM G;  3KFU A;  5FLM H;  1VQD A;  4DR7 L;  3B6Y A;  4K0K L;  5IP9 H;  3E0E A;  4DR5 Q;  5IY0 A;  2HHH Q;  3RN5 A;  1HJP A;  5M3M H;  1VQA A;  1KC8 C;  1KIX A;  4IPH A;  1ASY A;  1I3Q H;  4DK3 C;  4YHH L;  3GTQ H;  2IX0 A;  4JI2 L;  1EQR A;  2F3I A;  3W5O A;  3J81 i;  3PO2 H;  1UE1 A;  1YHB A;  4B3T L;  3A5U A;  2Q2H A;  2V1C C;  3F2B A;  4A3J H;  3STB D;  4DR7 Q;  3NEL A;  4DNI A;  2IHE A;  2VUM G;  1R9T H;  4GKK L;  1SLJ A;  5IYD G;  1P8L A;  2K5N A;  4DV3 L;  2EXD A;  2VQE L;  4A3M H;  1TXY A;  4LUZ A;  4YWL A;  4GNX A;  4JCV E;  3RLF A;  2JK8 A;  1XPO A;  3J7A 5;  4BA1 I;  1W2B A;  2PI2 E;  1VQ5 A;  1VQN A;  4BY1 H;  1JMC A;  3HKZ E;  1Q8K A;  1SE8 A;  2UU9 Q;  5JJK A;  1A8V A;  1X55 A;  3IRB A;  3S1M H;  4A3G G;  4A93 H;  5LMN W;  2I5M X;  4BBS H;  1VCI A;  1P16 A;  4A3E H;  3BZK A;  4B3S L;  4BY7 G;  2XTI A;  4LFC L;  3CPF A;  3T1Y L;  4NXM L;  4NB3 A;  3CC4 A;  3H0G G;  5IP7 H;  4DR1 Q;  1RL2 A;  2WAQ G;  4IPC A;  3RNU A;  2JQO A;  1UEB A;  4DPG A;  4HIM A;  2NVX H;  3S16 H;  4LFA Q;  3I4M G;  1L0W A;  5BR8 L;  1Q81 C;  5LMN L;  3HOW G;  3ZJY C;  3PUZ A;  2YTX A;  4QJF A;  4LW1 A;  4NXM Q;  5GQO A;  3M9B A;  1K0R A;  3TRE A;  4DV1 L;  1T9H A;  2IX1 A;  2KHJ A;  1VQJ A;  4P73 A;  1IYJ B;  3CD6 A;  4JI4 Q;  4DV5 Q;  1Z47 A;  2OWO A;  2UXC L;  5GRO A;  1FL0 A;  2F52 A;  1PHJ A;  2EQS A;  4A3F G;  1Q7Y C;  1L1O C;  3ULJ A;  5GAD C;  5IE8 A;  4MZ9 A;  2HIV A;  4MNO A;  1L1O A;  1VQF A;  4DV3 Q;  4A3B H;  2QEX A;  2PNH A;  2R92 G;  4JI3 L;  5C0X J;  4JBW A;  2NVQ H;  2D62 A;  5FLX c;  1N32 L;  2UXC Q;  3HOV H;  4LNQ A;  3F2D A;  3PUY A;  3K80 C;  4R4I A;  3A0J A;  4DV1 Q;  3GTG H;  1KHI A;  4JI2 Q;  5IWA Q;  4X64 L;  4IO9 A;  3CP0 A;  1NE3 A;  2XGT A;  5C0X G;  1PV4 A;  1N36 Q;  1X3E A;  4B3M L;  5M5X H;  2JA8 G;  1VQ8 A;  2LXK A;  3KDF A;  3S2H H;  1XNR L;  4R4O A;  2UXB L;  4BY7 H;  5LMN Q;  3ULP A;  4LFA L;  3KOJ A;  3S24 A;  2R7Z H;  4K0K Q;  2VQF L;  3RN2 A;  2ALY B;  4UPA A;  5IYC G;  1VQG A;  5LMU L;  2NVT H;  1N33 L;  4DR6 L;  2IT1 A;  4LFC Q;  3H3V H;  1OXX K;  5JJL A;  4LUO A;  3ULL A;  1E24 A;  1BVS A;  2AHO B;  1HZB A;  3M4Q A;  3I55 A;  3OYY A;  2B3G A;  3UDI A;  4RMF A;  4LF5 Q;  2AKW B;  4X62 L;  3AYH B;  2JE6 I;  1GD7 A;  1SRO A;  2PQA A;  4YWK A;  4YY3 L;  4DR3 L;  4RG1 A;  1Q86 C;  3T1H L;  1E1T A;  3UDG A;  3S1Q H;  4A3C G;  2VQF Q;  2OTJ A;  1Y1V H;  1FGU A;  1E22 A;  2VZA A;  1KRT A;  1I50 H;  4HIK A;  2ZJQ A;  4LF8 Q;  1PFS A;  1RIP A;  4DV4 L;  3CCE A;  4A3K H;  2HIX A;  5GAE C;  5ELN A;  5AJ3 Q;  1QVG A;  1PH2 A;  3KYH C;  1CSP A;  1X54 A;  4LF7 L;  3PCO B;  3J81 j;  4LUV A;  1OXU A;  4DV2 Q;  5IP9 G;  3CW2 C;  1PH8 A;  4LF7 Q;  1YHQ A;  3HOU G;  1E7Z A;  5C44 H;  3RZD H;  1U5K A;  4A4I A;  5M3M G;  3JAM i;  4OX9 L;  3I4N H;  2N78 A;  4DKA C;  5M5Y H;  5AJ3 L;  4B3R Q;  1GKH A;  1PH1 A;  2ZTE A;  2A1A A;  4GLV B;  4OWW B;  2ATW A;  3PO2 G;  3U4V A;  4JI8 Q;  2YU9 H;  1IBK Q;  2B63 H;  4OO1 G;  1K83 H;  1V9P A;  3FKI H;  1VQK A;  3CC2 A;  3M4O H;  1J6Q A;  1M90 C;  1UE6 A;  5FJ8 H;  2MO0 A;  1VQP A;  3HOX G;  1WOC A;  1BBU A;  4DV6 Q;  1A63 A;  1N9W A;  3W1B A;  1VQC A;  1YHA A;  4A3M G;  4DR6 Q;  2OTL A;  1KXL A;  4GNX B;  2CFM A;  4GS3 A;  3G6E A;  4YWM A;  1C7Y A;  3KF8 B;  2HQL A;  3JAM c;  5BR8 Q;  2JA9 A;  3Q8D A;  4C2M H;  3J81 c;  2BA1 A;  1PH6 A;  2K50 A;  2ASB A;  1XNR Q;  1CKO A;  4A93 G;  4TQU S;  4R1J A;  2DUD A;  4B3S Q;  1VQH A;  4GLA C;  5IWA L;  4X64 Q;  1N36 L;  1XNQ Q;  4LF9 L;  2MO1 A;  5IYB G;  3OTO L;  4X65 L;  1QUQ B;  5J3B A;  3PO3 G;  2UU9 L;  4A3I H;  2VY3 A;  5IT9 c;  1MKH A;  4FDB A;  3NBH B;  4BBR G;  4P71 A;  1N32 Q;  3J7Z C;  3HOW H;  3ERS X;  2I0Q A;  3F1Z A;  3G71 A;  1D8L A;  4AIM A;  4JI6 L;  4C3H H;  1WI5 A;  2OCE A;  4KHP L;  3BZC A;  2VQE Q;  1KD1 C;  1I6H H;  2A19 A;  5C44 G;  1JT8 A;  1TWC H;  1JJG A;  1L2F A;  3CAM A;  3FP9 A;  3TRZ A;  1I94 Q;  4JI7 Q;  1VQE A;  4GN5 A;  1QVC A;  3K7A H;  4HJ9 A;  1QUQ A;  3STB C;  2Z0S A;  1EWI A;  1TWA H;  2JA6 H;  3HFZ B;  1S40 A;  1C0A A;  4DUZ L;  4JI4 L;  4UP7 A;  1Y14 B;  3KLW A;  5ELO A;  3W1G A;  4LF6 Q;  2UUB L;  1ASZ A;  2Q2I A;  1AH9 A;  4JI0 L;  3A74 A;  2K5H A;  4XIG S;  1VQB A;  1Y1W H;  2HHH L;  1IL2 A;  2F4V L;  3GTO H;  1YVC A;  1UE5 A;  2ZM6 Q;  1HR0 L;  2BH8 A;  1X3F A;  3KDF B;  1EIY B;  1SMX A;  4IFD I;  3M4P A;  2R93 G;  4X6A H;  1XPR A;  4OWT B;  2K4K A;  4A3G H;  4DR4 Q;  4BBS G;  4YCW A;  3GTM H;  3I56 A;  3EBE A;  1PH9 A;  5C3E G;  2JA7 H;  4LF4 L;  1AE3 A;  1IZ6 A;  3G48 A;  4PMW A;  4HJ5 A;  3U4Z A;  3GTJ H;  2BA0 A;  1IBL L;  2CWP A;  3MEF A;  4BBR H;  1C9O A;  1PH3 A;  4Y7N H;  1CSQ A;  4UP8 A;  3HOZ H;  5C0X I;  2KEN A;  4DAM A;  1Z9F A;  1MJC A;  4R4T A;  1N8R C;  4PZ8 A;  4EX5 A;  3DM3 A;  4QL5 A;  1TWF H;  3L7Z C;  3KJO A;  4KLK A;  4JOI A;  1CKN A;  2K5V A;  3K81 C;  1N34 L;  2UUA L;  4HJA A;  1DGS A;  1KQS A;  3HOY G;  3I4O A;  4A3L H;  1EOV A;  4PG3 A;  4J15 A;  2NZH A;  4JI5 L;  4DUY Q;  1S3O A;  1KL9 A;  2QGQ A;  2Z6K C;  3CXC A;  5JEA J;  1X56 A;  3EN2 A; 
#chains in the Genus database with same CATH topology
 3S17 H;  1HZA A;  2F0S A;  4DV7 Q;  3K7A B;  1GO3 E;  3GTK B;  2I5H A;  2UXD Q;  2R93 B;  3R3O A;  4TSS A;  1DZ1 A;  1K8G A;  1DOL A;  1K73 C;  4DV0 Q;  2E2J H;  2Y0S E;  4G57 A;  3GTP H;  1KAB A;  3K5O A;  4JI7 L;  4RGT A;  3EIV A;  3PUX A;  3E9I A;  3OW2 A;  2JA5 H;  4HJ8 A;  5FO7 B;  3BU2 A;  1LTR D;  1OXS C;  4ILW A;  1WJJ A;  1WVL A;  2CVR A;  1D7Q A;  1TWH H;  1HZ9 A;  1JWM D;  1U9R A;  2Z6B A;  3Q6S A;  2TMP A;  1G8Z D;  1UNS A;  2RCN A;  4FYD A;  2L11 A;  3T13 A;  5CV7 A;  1EOT A;  2AQ3 B;  1K83 B;  2KVM A;  3WOF A;  3Q22 A;  4X62 Q;  4O0A A;  4C3J H;  4X66 Q;  2EJF C;  4L5T A;  1I4H A;  2MFI A;  3DMU A;  1I4X A;  2N88 A;  4JK1 C;  1G2S A;  2WFW A;  2VW9 A;  4ALP A;  5HUR A;  5GAG C;  3H15 A;  2F0O A;  4RHR A;  5I2X A;  1EFI D;  2F0J A;  3L9A X;  1VQ6 A;  1UUP A;  1YJW A;  4QIW B;  1IBM L;  4IQZ A;  3MWY W;  2M9V A;  2E2H H;  1PYS B;  1QIL A;  4FP5 D;  3UI2 A;  1II3 A;  1LTL A;  1TWF B;  1Q46 A;  1RTO A;  2C5C A;  4JI1 L;  3IL8 A;  2O4X A;  3TQY A;  1JB7 A;  1EFW A;  5DEH A;  1WTQ A;  4Y52 H;  1HNW L;  2DY8 A;  3BJU A;  3AFQ A;  1H95 A;  2JA8 H;  4X65 Q;  2MHV A;  2VB3 X;  3GTK H;  1XPU A;  1SJH D;  1I5F A;  2K28 A;  2HDL A;  4A3D G;  1EIG A;  4HMI A;  5C3E H;  2ICE C;  4R8I A;  2R7Z G;  2K5W A;  4PZ6 A;  3T51 B;  4KJO A;  1STB A;  3R8B A;  3HP3 A;  2ZJR A;  1JC7 A;  1A15 A;  1LO5 D;  1R4P B;  1HNX Q;  4CKC A;  2A68 D;  1GVP A;  2NN6 I;  2A5H A;  3KF6 A;  3RLO A;  2Q8R E;  2Q2U A;  4A3B B;  1PDQ A;  4WJ4 A;  4L5Q A;  1QB5 D;  1M4V A;  1NR2 A;  1RCV D;  1W6K A;  1IBL Q;  4V0B A;  1YZ6 A;  5C4X H;  2Z6K A;  3RMH A;  3MAQ A;  5IGD A;  1ROD A;  5H1S E;  2RF4 A;  2R3Z A;  4O2D A;  5M5X B;  1X9N A;  4ZYS A;  1S5E D;  1MGS A;  1PRT D;  1QCB D;  2JEB I;  3HOU H;  1EYA A;  1NSN S;  4N9T A;  1V1Q A;  1OTC A;  1PLF A;  2PO4 A;  2Q8I B;  3HOX B;  2IY5 B;  2D0O A;  4GOP C;  3VR4 A;  1U4M A;  3S2D H;  2YTV A;  1AZQ A;  2G5D A;  4POF A;  4BY1 G;  5DLQ E;  5C4H A;  5M5W H;  1NMG A;  3T1H Q;  4FF1 A;  3S14 H;  1EQQ A;  1AP0 A;  3A5Z B;  3J80 L;  3VYS A;  1MD2 D;  4QMG A;  1QZH A;  3HOY H;  1R9T B;  3T4A C;  1A62 A;  4A3I G;  5K5P A;  5ELD A;  1F77 A;  3RR5 A;  3D31 A;  3VYT A;  1B9N A;  1R4Q B;  1B7Y B;  1TY2 A;  3J7A F;  4GKK Q;  5C44 B;  1J9O A;  3Q24 A;  4KHZ A;  4ZRZ A;  4C3H G;  1EQV A;  1DON A;  3UDF A;  4YHH Q;  5I6Y A;  2F0N A;  4LK1 C;  4DV4 Q;  4FNF A;  3SXH A;  1G91 A;  2J0T D;  3S15 H;  1IBK L;  3FPP A;  3PUV A;  1I94 L;  3I4N G;  3RZO B;  3JAM L;  2UXD L;  1HTL D;  1A2U A;  1HNZ L;  4K5W A;  2WB1 E;  2UUC L;  2N8N A;  2A68 C;  3LWU A;  3GV6 A;  1DCZ A;  2TSS A;  3HKZ G;  1IYU A;  2N49 A;  3FKI G;  2F0K A;  1IW7 D;  2OXP A;  5EPJ A;  4A3K B;  2JEA I;  3QOL A;  1LTA D;  4CKB A;  1Q1B A;  1XTD A;  3NEN A;  2LXJ A;  2PW5 A;  4KKT A;  2ZTC A;  1VQI A;  2CWA A;  3DWP A;  3SEB A;  4JBM A;  4EQP A;  4IUR A;  2L15 A;  4UDU C;  3GQB A;  1HA6 A;  4KTA A;  2NVT B;  4E6I A;  1EZ6 A;  2F0E A;  3EQL C;  1DOK A;  2CCZ A;  2R7Z B;  3KFU A;  1VQD A;  3B6Y A;  4JPB W;  3X3N A;  3BVZ A;  4DR5 Q;  5IY0 A;  3RN5 A;  1E2V A;  3A7A B;  1KC8 C;  1KIX A;  1QOH A;  1S5B D;  3QIA A;  4OEM B;  1EY9 A;  4YHH L;  3J80 E;  2F3I A;  3J81 i;  1CQF A;  3PO2 H;  1UE1 A;  5K36 H;  2K33 A;  2BE5 D;  1NR4 A;  4I7A A;  4A3J H;  2XSC A;  1V1P B;  3NEL A;  3D6C A;  2VUM G;  4GKK L;  5CC4 A;  2K5N A;  3E6Z X;  2F0F A;  1SEB D;  5FO8 B;  1AZP A;  2G9H D;  5I9P A;  2EXD A;  2VQE L;  1TXY A;  4LUZ A;  3VR5 A;  4GNX A;  4JCV E;  3D4D A;  3J7A 5;  3MTS A;  1ICW A;  3I4L A;  1VQN A;  3HKZ E;  2NTT A;  2E75 C;  2B2U A;  3IRB A;  4BBS H;  1C8C A;  1DYQ A;  4BY7 G;  1ZYR D;  3BYT B;  4LFC L;  3VYU A;  5IP7 H;  2WAQ G;  4A3I B;  1UEB A;  4DPG A;  1L0W A;  1Q81 C;  5EBC A;  1PTO B;  3PQI A;  3PUZ A;  3HOY B;  2PNR C;  3JAM E;  1K0R A;  4DV1 L;  4C2M B;  1T9H A;  3S1M B;  1VQJ A;  4JI4 Q;  5GRO A;  2F52 A;  2JXM B;  2EQS A;  4A3F G;  3K5L A;  4N8F A;  1QNK A;  1L1O A;  1VQF A;  2QEX A;  2PNH A;  1VF7 A;  3TBI B;  5DM7 3;  4JBW A;  3J81 L;  5FLX c;  1N32 L;  2UXC Q;  5KND A;  1IW7 C;  3F2D A;  2NVY B;  3K80 C;  3A0J A;  4X3K A;  5C0X G;  1PV4 A;  5M5X H;  1VQ8 A;  2JSO A;  3KDF A;  4FXG C;  4R4O A;  5LMN Q;  2L9H A;  4LFA L;  3P1H A;  4UPA A;  1F2Y A;  1VQG A;  1N33 L;  2HCC A;  2AHO B;  4ZCK A;  1ZKO A;  2A73 B;  2JE6 I;  1KNA A;  1PXU A;  3AYH B;  4YWK A;  4DR3 L;  2O5I C;  1X3P A;  2EYH A;  3T1H L;  1MHW C;  3OWF A;  3S1R B;  1QVG A;  4K2L A;  1X54 A;  3PCO B;  2B8F A;  3CW2 C;  4LF7 Q;  5M3M G;  3JAM i;  1JOR A;  3GP7 A;  4B9X A;  1E2W A;  2ZTE A;  1SYC A;  2A1A A;  1EEF D;  2F0V A;  2YU9 H;  3MFG A;  1TR5 A;  1J6Q A;  3I3C A;  1FNU A;  3NQT A;  1WOC A;  1BBU A;  1A63 A;  1VQC A;  1FYC A;  3NWT A;  1DJR D;  4BY1 B;  3R93 A;  3G6E A;  4YWM A;  1L0X B;  3JAM c;  2JA9 A;  4RCN A;  2NTS A;  1KDB A;  1GOZ A;  2B39 A;  4I7Z C;  5ELB A;  1CM9 A;  1VQH A;  1BCP D;  4GLA C;  2MO1 A;  1TII D;  4X65 L;  1PTO F;  2EYM A;  1N32 Q;  3HOW H;  3NTK A;  5E4X A;  2I0Q A;  2EYL A;  3F1Z A;  2OCE A;  1I6H H;  1KD1 C;  1EU3 A;  5C44 G;  4JI7 Q;  1EQT A;  1LAB A;  3GTL B;  1QUQ A;  3STB C;  5C4X B;  2HUG A;  3K5N A;  2JA6 H;  1NUC A;  2EXZ A;  1VMP A;  1IL8 A;  1Y14 B;  2X69 A;  1TU2 B;  5ELO A;  1ET6 A;  2Q2I A;  1AH9 A;  4JI0 L;  3A74 A;  4KHV A;  1D1K A;  3HRZ C;  1O80 A;  1VQB A;  2HHH L;  5AFW A;  1UE5 A;  2ZM6 Q;  1MI2 A;  3KDF B;  2WKD A;  5EBD A;  4IFD I;  2D2C C;  3M4P A;  3BVM A;  4A3G H;  2K4K A;  4DR4 Q;  4YCW A;  2WV6 D;  5C3E G;  4EQN A;  2H4O A;  4PMW A;  3GTJ H;  2BA0 A;  3GV3 A;  2P5Z X;  4BBR H;  2K5Q A;  5C0X I;  4PZ8 A;  2F0M A;  3L7Z C;  3KJO A;  3PIP 3;  1CKN A;  1N34 L;  4H0L C;  4GZY C;  4A3L H;  3DWQ A;  1G2T A;  2NZH A;  3A8I E;  4JI5 L;  1S3O A;  3J81 E;  3G6J B;  2Z8L A;  2L55 A;  1TWA B;  4HTH A;  3K8A A;  1B8A A;  2K75 A;  1FJG L;  1Q12 A;  1JE5 A;  2NN6 G;  5D3I B;  5C4J H;  3D3R A;  4RCO A;  2KCC A;  3M7N A;  5GAH C;  3C2P A;  2FMM A;  3TS0 A;  3U58 A;  1HNW Q;  2G9D A;  4TVA B;  2NVY H;  1J5E L;  4FXK C;  1QVF A;  4AYB G;  4QCL A;  4I65 A;  5EQ0 A;  3H3V I;  4N8X 1;  4DNT B;  5M3F G;  2EJG C;  3S1N H;  2LKV A;  3PV0 A;  2E2D C;  3OTO Q;  3BG3 A;  2Q2T A;  1JOK A;  1WTH A;  3F2U A;  1YNN C;  1S72 A;  1T5X D;  4GKJ L;  1GHJ A;  4A3E G;  3EFX D;  2NZO A;  3GO5 A;  4H7B A;  4PMB A;  4OO1 I;  4JC0 A;  3D4W A;  3DM1 A;  1RJT A;  1MIU A;  2PZU A;  1XMO L;  3I4M H;  2JA5 B;  1BCP F;  2I5L X;  1X65 A;  4CJ0 B;  4BXX H;  1NJI C;  2NVX B;  1M1K C;  2KCT A;  1N33 Q;  3HG9 A;  2B29 A;  1I3Q B;  4NPS A;  2ID0 A;  1B1Z A;  2ZJP A;  2GVA A;  5JEA H;  2ES2 A;  1WCM B;  4L5R C;  3VA5 A;  1SYD A;  4V19 0;  4OX9 Q;  4JYA L;  1TWG H;  3S1N B;  2MP1 A;  4Q0F A;  4J1M A;  2RSO A;  1N34 Q;  3CCM A;  3CCS A;  2R92 H;  2E2I H;  2DNE A;  4HJ7 A;  5CYU A;  4HAE A;  3HOV G;  2E5L Q;  5JJZ A;  2NWG A;  3CKI B;  4EVO A;  4P72 A;  1EYG A;  4DR2 Q;  1CI3 M;  1LM0 A;  3L0O A;  3MZ5 A;  4Z9C B;  1STE A;  2SNM A;  5EKI A;  4F8M A;  1WFQ A;  1SXT A;  4RGO S;  3BDC A;  1JB3 A;  3V05 A;  1CKN B;  2NZ1 D;  3IFT A;  2IHF A;  3S1Q B;  4KK7 A;  1GXD C;  2YYZ A;  5CV5 A;  2B2W A;  4KY7 A;  1YBY A;  5T1G A;  4DR2 L;  1HTP A;  1BXT A;  4J8Q A;  1B2T A;  2F0W A;  2N3S A;  4JV5 L;  1RTN A;  3NWS A;  1CK1 A;  1Q1E A;  1MBY A;  4GN4 B;  4IUT A;  2HDM A;  5DM6 3;  1J5E Q;  5BN5 A;  1HRJ A;  3A55 A;  3A7L A;  2KHI A;  5ELC A;  5EPK A;  4R8N A;  1QNU A;  3QB3 A;  1MSG A;  2A69 D;  1U0L A;  3SVM A;  3CRK C;  4R4C A;  4MIU A;  2BOS A;  4ZUI A;  1Q82 C;  1LT4 D;  4L5S A;  1HA5 A;  3SK8 A;  2XVS A;  3K0X A;  4O1N A;  3H3V C;  1YNJ C;  5JVH 3;  4A75 A;  3F2C A;  4J6H A;  4TRD A;  2OQ0 A;  4OXP A;  4DAV A;  5COR A;  1XWE A;  3PIO A;  3OMC A;  3HOZ G;  1Q8I A;  2PMZ E;  4JVZ A;  3PIO 3;  1SNQ A;  3KBX A;  2LFN A;  5IP7 G;  2H1E A;  2PYK A;  1LYL A;  5NUC A;  2L5T A;  3EJI A;  3SGI A;  1AE2 A;  1RF2 D;  2GA4 B;  4IUN A;  1KTK A;  4GKJ Q;  3CQZ H;  4B3M Q;  1WTW A;  2AMC B;  1L1O B;  4B3R L;  4OON A;  2GN5 A;  2MNA A;  4DXF A;  4KN4 C;  4A3C H;  5C3W A;  4KD4 A;  1BNZ A;  2PPB C;  1V43 A;  1BBX C;  4HID A;  4QB4 A;  4JI0 Q;  1HNZ Q;  4CGY B;  5J1Z A;  1LTS D;  1K8A C;  4YCU A;  1KAW A;  3E0J A;  3S2D B;  3JC6 6;  4YCV A;  4JI8 L;  2RKS A;  4IJL A;  4CDC C;  4DV5 L;  4WJ3 M;  2CHB D;  3GDE A;  1K3R A;  1PZK D;  4AQY L;  3GTQ B;  1IHZ A;  3NUC A;  1O7Z A;  3CRL C;  3EVQ A;  4QIW E;  3RZD B;  3PF4 A;  4DXG A;  1XJV A;  2A6E D;  1E3P A;  1X3G A;  2F4I A;  2R93 H;  4CHT B;  2VL6 A;  2RSN A;  3KBG A;  4KY5 A;  3D0F A;  1STN A;  3HKS A;  1VMC A;  4C3J G;  3CCJ A;  1XYI A;  2F3W A;  4LF8 L;  3ERQ A;  3S9W A;  3SK6 A;  1K9M C;  1D5Z C;  2GVB A;  1A2T A;  4AQY Q;  2QIL A;  3MXN A;  3E5S A;  1F9P A;  4KJN A;  1YJN A;  3K5M A;  4A76 A;  3F8T A;  4XT1 B;  1X6O A;  4DR7 L;  1EY7 A;  3BVG A;  2OF1 A;  3E0E A;  4BY7 B;  2FHT A;  3A54 A;  2HHH Q;  5M3M H;  3HS0 C;  4B08 A;  1VQA A;  2EY6 A;  3MHB A;  3GTQ H;  2IX0 A;  4JI2 L;  4XDX A;  1ICF B;  2B2V A;  3HOW B;  1XX8 A;  3OMG A;  3I91 A;  4K5V A;  1TQO A;  4B3T L;  3F2B A;  4DR7 Q;  1J8I A;  2FFK B;  4DNI A;  5I9O A;  5IGG A;  1R9T H;  1SLJ A;  5IGE A;  1P8L A;  4DF7 A;  4DV3 L;  2JYO A;  1K28 A;  2EY1 A;  1XPO A;  2D9U A;  4BA1 I;  5CMD A;  4RH6 A;  2PI2 E;  1JMC A;  1FD7 D;  5EKL A;  5F2D A;  5JJK A;  1F2Z A;  4K2K A;  5KNC A;  3NPP A;  3S1M H;  2F0Q A;  2XIW A;  1SJE D;  4IUV A;  3Q23 A;  3CPF A;  4NXM L;  3RNU A;  4DR1 Q;  4IPC A;  2JQO A;  3S16 H;  4HIM A;  3HOW G;  1WTV A;  3ZJY C;  2YTX A;  4QJF A;  5GQO A;  2JP1 A;  3C46 A;  2E2J B;  3TRE A;  2F0L A;  4P73 A;  4DV5 Q;  4HR7 B;  2OWO A;  4C1N K;  1EWH A;  1TWH B;  3NBI A;  1Q7Y C;  2PCF B;  4C3I B;  5IE8 A;  5GAD C;  2Z4I A;  4MNO A;  4A3B H;  2A6H D;  2XWB B;  3V2T A;  4ZLT F;  4RKB A;  2WII B;  4L63 B;  2PW7 A;  5C0X J;  4A3J B;  4S3S A;  2ZXR A;  3PUY A;  2CQA A;  2DJG C;  3GTG H;  1KHI A;  1S5C D;  2KEC A;  1CHQ D;  4LF4 L;  1DXM A;  3CP0 A;  3VA7 A;  2JA8 G;  1SDF A;  2LXK A;  3E3X A;  2F0U A;  3KOJ A;  2R7Z H;  3RN2 A;  1S4Z A;  2ALY B;  5IYC G;  5JJL A;  2K05 A;  5LMU L;  4LFC Q;  3U9O A;  1HZB A;  5M9O A;  4H44 C;  4LF5 Q;  2B3G A;  1LTI D;  4HN7 A;  4RMF A;  3UDI A;  4X62 L;  2WB1 B;  1GD7 A;  1SRO A;  1Y1W B;  3S1Q H;  4RG1 A;  3SDZ A;  4H13 C;  5T1I A;  1FGU A;  3M3Y B;  2VZA A;  1I50 H;  2I07 B;  1EZ8 A;  3MXU A;  1PFS A;  4DV4 L;  3CCE A;  5AJ3 Q;  1VDZ A;  1EWC A;  4F7X A;  3C1F A;  4QF4 A;  5C5L A;  3TP7 A;  3OWE B;  3J81 j;  4LUV A;  3MFY A;  1NCV A;  4DV2 Q;  1SE3 A;  5JPN C;  2NUC A;  3HOU G;  3I8Z A;  1XTC D;  4OX9 L;  3I4N H;  1U5K A;  1PYW D;  1BO0 A;  5AJ3 L;  3T56 B;  3OIQ A;  4NMZ A;  4ODG A;  3Q0A A;  2IWH A;  4HED A;  4GLV B;  2B63 H;  4CDD C;  4OO1 G;  3K58 A;  1DOM A;  1GUS A;  1V9P A;  3FKI H;  1VQK A;  3TME A;  4EQO A;  2MO0 A;  1VQP A;  3HOX G;  3DXJ C;  4RAU C;  4A3M G;  4DR6 Q;  2CFM A;  4ZKB B;  2WIN B;  3KF8 B;  1C7Y A;  4CBV A;  5EGT A;  2OEO A;  2BA1 A;  4PNY A;  5E1F A;  2Z1C A;  2DUD A;  3W2D A;  4B9W A;  4LF9 L;  2K01 A;  5IYB G;  1SMY C;  3PO3 G;  2VY3 A;  3FMC A;  5IT9 c;  1MKH A;  4FDB A;  2K1B A;  3G71 A;  4JI6 L;  2F0G A;  4AIM A;  3I4N B;  4OL7 A;  4C3H H;  3BZC A;  2VQE Q;  1JT8 A;  1WD1 A;  2RDH A;  3TRZ A;  1JJG A;  1I94 Q;  1SNC A;  2ZXO A;  3N6R A;  1QVC A;  3K7A H;  2AUK A;  5M5W B;  1EWI A;  1S40 A;  1C0A A;  4DUZ L;  2SOB A;  5BN4 A;  1ASZ A;  5D65 A;  3LNN A;  2EJM A;  1IL2 A;  1SYB A;  1ZYR C;  2CW0 D;  1EIY B;  1SMX A;  5LHY 1;  3PO3 B;  4X6A H;  3SR1 A;  1XPR A;  4BBS G;  3GTM H;  3I56 A;  2JA7 H;  2EDG A;  3CU7 A;  1ILQ A;  1I4R A;  3U4Z A;  2XNA C;  1K3B C;  1SNO A;  4Y7N H;  1Z9F A;  1N8R C;  2R92 B;  5FO9 B;  4KLK A;  2K5V A;  3S15 B;  1QE6 A;  1KQS A;  3QOJ A;  1CA6 A;  2DNC A;  4PG3 A;  1A3U A;  4DUY Q;  1KL9 A;  2Z6K C;  4RKL A;  5C3E B;  4YWL A;  4O42 A;  2F0T A;  5EJW A;  1WCM H;  2KEE A;  3HZX A;  1EUJ A;  1Y1W G;  1PH5 A;  3PGZ A;  2KCM A;  2E5L L;  2HQE A;  4P2C B;  1ILP A;  4QGU A;  1L0Y B;  1LTB D;  2WAC A;  3CCU A;  1OXV A;  1EY5 A;  3S16 B;  1ML0 D;  4FXD A;  1U4L A;  3G4S A;  1CTM A;  4C3I H;  1H9S B;  5HGQ A;  5KIX A;  1H9J A;  1SR3 A;  5FJ8 G;  2ICI A;  3LGJ A;  4JBJ A;  1JJC B;  1JOO A;  4IFD G;  3M4O B;  1SRU A;  2CH4 A;  2IW3 A;  3M4Y A;  4LMQ D;  4AYB B;  3CQZ B;  2RHS B;  3CCL A;  3CME A;  3H0G H;  4XTC S;  4IFD J;  3MC0 B;  2RDF A;  4OIK A;  2F0P A;  1YNX A;  1HH2 P;  3MVV A;  1OO9 B;  3FPU B;  5G3L D;  1Z6H A;  1T5E A;  4IUU A;  3URY A;  2RHQ B;  2WAQ B;  2F0D A;  1CUK A;  3O13 A;  1VQ4 A;  5A2Q L;  2A74 C;  1B3A A;  2KED A;  3CPW A;  5C4J B;  4LWC A;  5HY6 A;  4IUP A;  4GLX A;  4RWS C;  2R7D A;  2RCF A;  4YIJ A;  2K6A A;  3J7A V;  1TS4 A;  4DV7 L;  1D5M C;  1PFN A;  2B8G A;  4C1N I;  1W3S A;  2K14 A;  4U67 3;  2KUM A;  3QR8 A;  5FLM G;  2JA5 G;  1IBM Q;  1I50 B;  2RA4 A;  1SND A;  2K7V A;  1AW7 A;  2EVB A;  4DGZ A;  2VXW A;  4CDE C;  1KRS A;  5FKA C;  3UDX A;  3RLN A;  1WYD A;  3CHB D;  1D1I A;  1SE4 A;  5IYD H;  2D5D A;  2QF7 A;  2CH4 W;  1JR0 D;  3CMA A;  1HFG A;  4A3G B;  4DAY A;  1GUW A;  5I4D A;  1HNX L;  3CF5 A;  4JI5 Q;  4XQQ A;  3TP6 A;  2B2U C;  2J7Z A;  1HR0 Q;  1A0I A;  4DR1 L;  4P74 A;  1AFP A;  4JW0 A;  2KA7 A;  4NP5 A;  2WAQ E;  1HUM A;  3NP8 A;  1A3T A;  1VS0 A;  1QZG A;  4Y7N B;  3CCR A;  1ENC A;  3D8G A;  2BE5 C;  3AMU A;  3PF5 A;  1SBB B;  3PMF A;  2JA6 B;  4IOA A;  3VR6 A;  1DD2 A;  1LT3 D;  2M00 A;  3VR3 A;  4A3K G;  1VQ9 A;  3TEH B;  4NXN L;  3IKJ A;  4JI1 Q;  3S2H B;  2AWN A;  2SNS A;  4X3S A;  4JI6 Q;  5C6A A;  1XMQ Q;  4IJH A;  4FF4 A;  2E76 C;  4JV5 Q;  4B3T Q;  1YIJ A;  4C3J B;  3I90 A;  1KAA A;  1XNQ L;  5E4W C;  5E7N A;  3WWV A;  5C3X A;  1GHK A;  4A3D H;  3TZD A;  1IKM A;  4RHS A;  3PUW A;  4AH6 A;  1PA6 A;  4AYB E;  2DJF C;  2CKZ B;  2PZT A;  3UE1 A;  5FLX L;  4KN7 C;  4EQ5 A;  1YEZ A;  2WP8 J;  5EPL A;  1D6E C;  4UP9 A;  4A3L G;  4POG A;  1PTO H;  2H5X A;  1PVO A;  3KUP A;  1CZG A;  3BZD B;  5C4X G;  1TS5 A;  1GJX A;  4LJZ C;  1UWV A;  3GTP B;  5ISR A;  2L4N A;  1FNW A;  2K32 A;  1Y1V G;  4HSV A;  4JYA Q;  2JA6 G;  1Q90 A;  1SNM A;  1K8M A;  1UEA B;  2UUB Q;  4GOP B;  1VQL A;  4A3B G;  2BDN A;  4XQN A;  2VUM B;  4DFA A;  5M3F H;  4LFB Q;  2CW0 C;  3NXW A;  4DV0 L;  1IYV A;  3L2P A;  2F03 A;  2IL8 A;  3FEW X;  4APV A;  5CV6 A;  2EYJ A;  2K5D A;  4N9P A;  5M5Y B;  1O7Y A;  1SSO A;  4ZKC B;  1OXT A;  2YV5 A;  4A3J G;  5ELF A;  4OHJ A;  1EU4 A;  1Y69 U;  3P75 A;  5IYC H;  4JBK A;  1STH A;  5EAY A;  4ZQ3 A;  4LF4 Q;  4ID6 A;  4G7Z C;  4BXX G;  4X3T A;  4QY7 A;  4WJW A;  1VQM A;  1JJ2 A;  5J22 A;  1NMF A;  4ZAI A;  3GD7 A;  5JEA G;  2BCO A;  2R7F A;  4DR3 Q;  5JJI A;  3OW7 A;  4ME5 A;  3ONA B;  1STA A;  3OSO A;  2VS1 A;  4IOC A;  1TWG B;  2F0H A;  2WB1 G;  4HCE A;  3QWN A;  1B70 B;  1NY4 A;  3ITP A;  3W3A A;  2NB0 A;  1YNN D;  1W6J A;  3V96 A;  2N55 A;  1HCZ A;  4NW2 A;  1EY6 A;  1I3Q H;  4MN3 A;  3W5O A;  2LY7 A;  1YHB A;  3RUZ A;  2O5J C;  3A5U A;  2Q2H A;  2NVQ B;  4MTK A;  1GUO A;  3STB D;  2IHE A;  1KLG D;  4HSP A;  1QJO A;  1B50 A;  4A3M H;  3RLF A;  2JK8 A;  1W2B A;  1SFO B;  3TDQ A;  4CJ1 B;  4DN4 M;  5IGB A;  2HD3 A;  5IGF A;  2NYZ D;  1Q8K A;  3BDO A;  2I5M X;  1VCI A;  2MPM A;  3BZK A;  3H94 A;  4NB3 A;  1SNP A;  3CC4 A;  1RL2 A;  5CR3 A;  1EL0 A;  4EGV A;  2PMZ B;  2NVX H;  4ZUJ A;  5BR8 L;  4IUQ A;  2F0I A;  1HUN A;  1PFM A;  3M9B A;  1BOS A;  2ZXP A;  3EN2 A;  4L8J A;  2I46 A;  1IYJ B;  2F1M A;  3MXP A;  3C1E A;  4WOR A;  5IT9 E;  2PQE A;  4CDF C;  5CV4 A;  4WRD A;  1EIH A;  4MZ9 A;  2HIV A;  2QCP X;  5J39 A;  3QG1 A;  2R92 G;  1JCK B;  2D62 A;  4TKO B;  3HOV H;  4LNQ A;  4IN3 A;  1PTO D;  1BR9 A;  1X3Q A;  4R4I A;  2B2T C;  1O7L A;  2ENB A;  5IWA Q;  4X64 L;  1NE3 A;  4DNR B;  4IO9 A;  3OPO A;  1GUG A;  1RHP A;  3S2H H;  3LWE A;  1JOQ A;  5IOD A;  2Q8T A;  4BY7 H;  5CV8 A;  3ULP A;  5KYI A;  1HXY D;  3S24 A;  3KLS A;  3DUZ A;  1I4Q A;  4U68 A;  5TSS A;  3FRP B;  1EYD A;  2IT1 A;  3H3V H;  3LX0 A;  1TS3 A;  1E24 A;  3ULL A;  1BVS A;  3M4Q A;  3I55 A;  3OYY A;  1CT1 D;  3TP5 A;  4YY3 L;  2BH2 A;  5C5M A;  2MJ8 A;  1U4R A;  1Q86 C;  4A3C G;  2VQF Q;  1ZEQ X;  1CZW A;  2Z9H A;  1LTG D;  1CA5 A;  3A8J E;  1KRT A;  2ZJQ A;  3SK5 A;  4LAA A;  4OIJ A;  5GAE C;  1PH2 A;  3KYH C;  3D6W A;  4FVM A;  4LF7 L;  2JA8 B;  1OXU A;  2B2T A;  1I6H B;  5IP9 G;  1PH8 A;  1QWY A;  5C44 H;  3RZD H;  4A4I A;  5CBA E;  4B3R Q;  2A6H C;  2N78 A;  1C4Q A;  1A3V A;  1PH1 A;  3K6O A;  5C0X H;  1CQV A;  2ATW A;  5JOB A;  3U4V A;  3TP8 A;  1IBK Q;  1EY0 A;  4C3I G;  4RGM A;  3CC2 A;  1M90 C;  1UE6 A;  5FJ8 H;  1MSH A;  2JN4 A;  4DV6 Q;  4G7O C;  2KHS A;  1YHA A;  4KKU A;  4GNX B;  2EYF A;  3HGB A;  3S14 B;  2A6E C;  1G6Z A;  3K0Y A;  3Q8D A;  4C2M H;  1PH6 A;  2K50 A;  2ASB A;  1JWS D;  4A93 G;  4TQU S;  4R1J A;  4B3S Q;  5IWA L;  4X64 Q;  1SYF A;  3SK4 A;  2UU9 L;  4A3I H;  1F2L A;  3MXG A;  1FGB D;  4BBR G;  4P71 A;  2O2L D;  3J7Y W;  3HOU B;  3ERS X;  1SYG A;  1S5F D;  1EEI D;  1WI5 A;  3NBH A;  4RGN A;  1LAC A;  4KHP L;  2KCN A;  1K8O A;  1L2F A;  3FP9 A;  2FJ2 A;  1VQE A;  4GN5 A;  4HJ9 A;  1TWA H;  3HFZ B;  4A3M B;  3SHL A;  4JI4 L;  2EYP A;  1QG7 A;  3KLW A;  3W1G A;  2IX3 A;  4R9W A;  2NN6 H;  5FOB B;  2F4V L;  5FK9 C;  4A3F B;  2NBF A;  2BH8 A;  1X3F A;  4CJ2 C;  4BBR B;  5IGC A;  1JQY D;  5LL6 X;  2R93 G;  2A69 C;  3EBE A;  1PRT C;  2DY7 A;  2F3V A;  3TZU A;  1UAP A;  1AE3 A;  1IZ6 A;  3H09 A;  5LL6 S;  4KV6 A;  3R2T A;  1IBL L;  2CWP A;  1JWU D;  3MEF A;  1C9O A;  1PH3 A;  1E0B A;  4UP8 A;  1B53 A;  4DAM A;  4EX5 A;  3DM3 A;  4QL5 A;  1TWF H;  2WKC A;  4FF2 A;  2MGS A;  4FO2 A;  4JOI A;  2UUA L;  3HOY G;  5IT9 L;  3NQI A;  3I4O A;  4J15 A;  1GUT A;  3RD4 A;  3CXC A;  1X56 A;  3GTL H;  1YJ9 A;  4IPG A;  4DV6 L;  2PQA B;  1NTG A;  1LT5 D;  2MUY A;  1X32 A;  4DR5 L;  4XYO A;  1RKN A;  1FR3 A;  1SE2 A;  1ONL A;  2EIF A;  1BDO A;  1O7I A;  3M7G A;  3KLS X;  1FVI A;  4WFN 3;  2E2I B;  2K52 A;  1BKB A;  5D14 A;  1H9S A;  5M3F B;  2R6G A;  4PZ7 A;  2VUM H;  1ENF A;  4KY6 A;  3EA6 A;  2AWO A;  2CQO A;  1SN8 A;  3KJP A;  2QKI C;  1SFO H;  2BDO A;  1BBW A;  1SYE A;  1LLR D;  4NDX A;  2EY2 A;  4PQX A;  1CKM A;  1PH4 A;  2VNU D;  1ENA A;  3L3O C;  4X66 L;  1PTO C;  4PMC A;  4NKL A;  3GTJ B;  3I2Z A;  3PO2 B;  3I4M B;  1NAP A;  1LUZ A;  4K8I A;  2LSS A;  4KI0 A;  1BUV T;  3E9H A;  4BA2 I;  2XRS D;  3VDY A;  1HZC A;  3X3M A;  2FXQ A;  1YI2 A;  4IAL A;  4QUC A;  2C35 B;  4DV2 L;  1HPC A;  1F2M A;  4R4Q A;  3FKI B;  2OQK A;  3ND9 A;  3FHW A;  2B63 B;  2PZW A;  3NEM A;  1E1O A;  3PSI A;  1VQO A;  1B4O A;  4FF3 A;  2IJ0 A;  3HOX H;  1EYC A;  1G6P A;  5G3L F;  5K36 G;  1STG A;  3K7U C;  2SEB D;  1KLU D;  2XRQ D;  4DK1 A;  5E3F A;  4GNX C;  4QQB X;  3T53 B;  1VQ7 A;  3KF6 B;  4DAY B;  4LF9 Q;  3TN2 A;  4DR4 L;  1XMO Q;  3PO3 H;  4DUY L;  5IOC A;  2ZM6 L;  1AEX A;  3RZO H;  3MXN B;  3WOE A;  3NK9 A;  3AQQ A;  2ZTD A;  4JG2 A;  2DN8 A;  2C9O A;  1FNV A;  1XXG A;  1TY0 A;  4GN3 B;  2L12 A;  3ZYY X;  2XN9 C;  3OOC A;  4JI3 Q;  1XMQ L;  3ICE A;  5KNB A;  4KMU C;  3D4R A;  1PH7 A;  1DM0 B;  4H02 A;  4NXN Q;  4DU9 A;  5C4Z A;  2M2L A;  4JOI C;  1F9R A;  4DK6 C;  3GTG B;  1TKW B;  2RBM A;  1YNJ D;  5FLX E;  4UY8 C;  4A3F H;  2EE1 A;  3C3L A;  2OT2 A;  3M85 A;  1HR0 W;  2B63 G;  3PIP A;  3DLL A;  2HT1 A;  5EKK A;  2LMC B;  1IXR A;  3HKZ B;  4LF6 L;  2JA7 G;  3NTH A;  4MHE A;  4DUZ Q;  1UE7 A;  1EY8 A;  2JJQ A;  2D0P A;  2KOL A;  3I72 A;  3U50 C;  4DAP A;  1G51 A;  4LF5 L;  1H9M A;  4ULL A;  4OWX B;  5LMU Q;  2Y0S G;  1B3Q A;  2DGY A;  5IYB H;  3BDL A;  4K8J A;  3H0G B;  3AEV A;  1GM5 A;  2UXB Q;  2L0C A;  2YTY A;  2EOT A;  3AB9 A;  3AFP A;  1NNX A;  3FDT A;  1NBW A;  3G7L A;  3J80 i;  3P20 A;  4PV1 C;  1BF4 A;  2QEJ C;  4MTN A;  1H9R A;  4GOP A;  2F4V Q;  2KBN A;  1HQM C;  4XYQ A;  5A35 A;  3K57 A;  4HIO A;  4K6D A;  1PYB A;  3IAY A;  1ESF A;  1MJE A;  3M3Y H;  2K03 A;  4HMJ A;  1PFB A;  3FVQ A;  4LFB L;  1ESR A;  1EY4 A;  4YY3 Q;  5BN3 A;  3CCQ A;  1I4G A;  3MA2 B;  3J80 c;  1EIF A;  4KHP Q;  1FJG Q;  4C56 C;  4IPD A;  3QO2 A;  1G29 1;  2R61 A;  1B44 D;  2QDB A;  3DEP A;  4P75 A;  4UHV A;  1WD0 A;  2A8V A;  2QA4 A;  1BQQ T;  4Q5V A;  2UUA Q;  5I2Y A;  1TVX A;  1U4P A;  3UE0 A;  3T1Y Q;  3CC7 A;  5DAU A;  5DNF A;  3S1R H;  2PI2 A;  4HCS A;  5I6W A;  5JVG 3;  2AQ2 B;  3CCV A;  2AQ1 B;  1YIT A;  2E8G A;  2MQH A;  2E2H B;  3ER0 A;  3I7F A;  3H91 A;  4ME3 A;  4L6T B;  3VR2 A;  1WCM G;  5FLM H;  4K0K L;  5KGU A;  1V1P A;  5IP9 H;  1KDC A;  1ET9 A;  1Y8P B;  3GTM B;  1HJP A;  3I70 A;  1VF5 C;  4IPH A;  3BS1 A;  1ASY A;  4DK3 C;  2J4X A;  1EQR A;  4OGQ C;  4G4K A;  2V1C C;  2FIN B;  3OIP A;  3H6M A;  1TS2 A;  5IYD G;  4OEL B;  4A3E B;  1A6X A;  4A93 B;  3DEO A;  2RVL A;  4ZK9 B;  3KF8 A;  5D3D A;  1VQ5 A;  2HCI A;  4BY1 H;  5KEE A;  1D2B A;  4K5X A;  1SE8 A;  2UU9 Q;  1A8V A;  1X55 A;  4A3G G;  4XXE A;  4BWG B;  2EY5 A;  5LMN W;  4A93 H;  1P16 A;  4A3E H;  4B3S L;  2XTI A;  3T1Y L;  3H0G G;  1PRT F;  2QW7 A;  2IPK D;  2YU9 B;  2B2W C;  1C48 A;  4LFA Q;  4DK0 A;  3I4M G;  4F87 A;  3VYR A;  5LMN L;  1F9Q A;  3WDN A;  4LW1 A;  4NXM Q;  1B9M A;  1V1O A;  2LS0 1;  3T16 A;  4BBS B;  1IKL A;  2IX1 A;  2KHJ A;  3OHX C;  5M3M B;  1M8A A;  3CD6 A;  1Z47 A;  1CFM A;  1WTX A;  1SAP A;  2UXC L;  1PHJ A;  1FL0 A;  2SDF A;  1D5X C;  3S17 B;  1L1O C;  1Z7T A;  3ULJ A;  2X6L A;  4DV3 Q;  2E74 C;  4JI3 L;  2NVQ H;  2X6G A;  1I6V C;  3BYY B;  4DV1 Q;  4JI2 Q;  1N36 Q;  2XGT A;  1X3E A;  4B3M L;  3N52 A;  1LV9 A;  5JAV A;  1XNR L;  2V4D A;  5HGT A;  2UXB L;  1LTT D;  3DWA A;  3NTI A;  2Z4H A;  4K0K Q;  2VQF L;  5COY A;  2VB2 X;  1RDP D;  2NVT H;  4DR6 L;  1OXX K;  1HFN A;  4LUO A;  3TS2 A;  3NE5 B;  3NHH A;  2RQX A;  2AKW B;  3TSS A;  2PQA A;  3HOV B;  1PZI D;  2OTJ A;  3NSW A;  1E1T A;  3UDG A;  4RFB A;  1Y1V H;  2EPB A;  5A2Q E;  2L1B A;  1E22 A;  5KRU A;  4HIK A;  4LF8 Q;  1RIP A;  4A3K H;  2HIX A;  3U9S A;  1I4P A;  5ELN A;  4DA2 A;  2RDG A;  1CSP A;  3ERO A;  2JA7 B;  4XT3 B;  2QDL A;  1TWC B;  1WTO A;  4RA8 A;  1ZXT A;  1YHQ A;  5L37 A;  3R2I A;  1H9K A;  1E7Z A;  4G7H C;  2KQ3 A;  4DKA C;  5M5Y H;  1GKH A;  4X3U A;  1E2Z A;  4M8A A;  4OWW B;  3PO2 G;  2Y0S B;  4JI8 Q;  5CGK A;  3K59 A;  3A56 A;  2EZV A;  2XWJ B;  1K83 H;  1JE4 A;  5ELE A;  3M4O H;  3ND8 A;  3HEJ A;  1LT6 D;  2KJX A;  1O78 A;  1N9W A;  3W1B A;  3AU7 A;  2OTL A;  1KXL A;  3QJY A;  4GS3 A;  1SMY D;  3KLR A;  2HQL A;  1S5D D;  5BR8 Q;  4C3H B;  1HHV A;  1BCP C;  3J81 c;  1XNR Q;  1WTP A;  1CKO A;  1PZJ D;  1RD9 D;  3MEH A;  1N36 L;  2FMC A;  1KDA A;  1PRT B;  1XNQ Q;  5JPM C;  3OTO L;  1QUQ B;  5J3B A;  3NBH B;  4XQJ A;  3J7Z C;  2AUJ D;  2EYO A;  1D8L A;  2B2Y C;  4QUF A;  2A19 A;  1AN8 A;  1TWC H;  3CAM A;  1V8Q A;  4K14 A;  4K6L A;  1Y8O B;  2Z0S A;  1PMR A;  1Y8N B;  4KKS A;  4A3D B;  3DHQ A;  3KK7 A;  4UP7 A;  4OO1 H;  4LF6 Q;  2UUB L;  3IFD A;  1STY A;  1Y1V B;  3SE0 A;  2K5H A;  4IZ8 A;  4XIG S;  1Y1W H;  4M1U B;  3GTO H;  1YVC A;  1HR0 L;  3HOZ B;  2K04 A;  4F88 A;  1Q3L A;  4KD3 A;  4ABN A;  4OWT B;  1K0S A;  1WTR A;  4UAI A;  5KYL A;  1PH9 A;  3G48 A;  3A8K E;  1HQR D;  4HJ5 A;  2B2Y A;  5IIF A;  1JIC A;  1BCP B;  3P7J A;  1CSQ A;  3HOZ H;  2KEN A;  3GTO B;  4R4T A;  1MJC A;  1CHP D;  2ZT9 C;  4IFD H;  5CV9 A;  3K81 C;  4HJA A;  1DGS A;  1TT2 A;  4BS9 A;  2B2V C;  1EOV A;  1KNE A;  5CBE E;  1F9S A;  2QGQ A;  4CKE A;  5JEA J;  2UUC Q;  3I73 A;  1GUN A; 
#chains in the Genus database with same CATH homology
 3S17 H;  1HZA A;  3K8A A;  1B8A A;  2K75 A;  4DV7 Q;  1YJ9 A;  1Q12 A;  1FJG L;  1GO3 E;  4IPG A;  4DV6 L;  2PQA B;  1NTG A;  3GTL H;  2I5H A;  2UXD Q;  1WCM H;  1JE5 A;  2NN6 G;  5C4J H;  4DR5 L;  1K8G A;  1EUJ A;  1Y1W G;  1K73 C;  1PH5 A;  4DV0 Q;  2E2J H;  5GAH C;  3M7N A;  2Y0S E;  3PGZ A;  2EIF A;  3GTP H;  3TS0 A;  1O7I A;  2KCM A;  3U58 A;  2E5L L;  4JI7 L;  1HNW Q;  4TVA B;  2NVY H;  4QGU A;  3EIV A;  3PUX A;  1FVI A;  1J5E L;  1QVF A;  3E9I A;  4AYB G;  3CCU A;  1OXV A;  3OW2 A;  2K52 A;  1BKB A;  2JA5 H;  3H3V I;  5M3F G;  2R6G A;  3G4S A;  4PZ7 A;  4HJ8 A;  3S1N H;  2VUM H;  3BU2 A;  3PV0 A;  1OXS C;  4C3I H;  5HGQ A;  1WJJ A;  3OTO Q;  1D7Q A;  2AWO A;  2CQO A;  1SN8 A;  1TWH H;  1HZ9 A;  3KJP A;  1SR3 A;  5FJ8 G;  2Q2T A;  1S72 A;  4GKJ L;  3LGJ A;  4JBJ A;  2RCN A;  1SFO H;  4A3E G;  2NZO A;  3GO5 A;  1JJC B;  4OO1 I;  1BBW A;  4JC0 A;  4IFD G;  1SRU A;  1MIU A;  1XMO L;  3I4M H;  1PH4 A;  1CKM A;  2RHS B;  3CCL A;  2VNU D;  2I5L X;  4X66 L;  4X62 Q;  1X65 A;  3CME A;  3H0G H;  4XTC S;  4BXX H;  4O0A A;  4C3J H;  1NJI C;  4IFD J;  4X66 Q;  4L5T A;  1YNX A;  3I2Z A;  2MFI A;  2KCT A;  1HH2 P;  1M1K C;  1N33 Q;  2B29 A;  1LUZ A;  2WFW A;  2RHQ B;  2LSS A;  4NPS A;  2VW9 A;  4ALP A;  1CUK A;  2ID0 A;  1VQ4 A;  5GAG C;  2ZJP A;  2GVA A;  2ES2 A;  3CPW A;  4KI0 A;  4LWC A;  5HY6 A;  3H15 A;  3E9H A;  4GLX A;  4BA2 I;  2R7D A;  3VDY A;  4L5R C;  1HZC A;  4DV7 L;  1VQ6 A;  2FXQ A;  1YJW A;  4OX9 Q;  1YI2 A;  1W3S A;  2K14 A;  4JYA L;  1IBM L;  4DV2 L;  2C35 B;  1TWG H;  4R4Q A;  5FLM G;  2JA5 G;  2OQK A;  1IBM Q;  2E2H H;  1PYS B;  3FHW A;  1N34 Q;  3NEM A;  1E1O A;  3PSI A;  3CCM A;  1LTL A;  3CCS A;  1VQO A;  1Q46 A;  2R92 H;  3HOX H;  2E2I H;  1KRS A;  4JI1 L;  3TQY A;  4HJ7 A;  1JB7 A;  1EFW A;  4Y52 H;  1G6P A;  3UDX A;  3HOV G;  2E5L Q;  1HNW L;  5K36 G;  3K7U C;  3RLN A;  1WYD A;  3BJU A;  4P72 A;  1EYG A;  3AFQ A;  1H95 A;  4GNX C;  4X65 Q;  1VQ7 A;  2JA8 H;  3KF6 B;  4DAY B;  4QQB X;  5IYD H;  4LF9 Q;  3GTK H;  1XPU A;  4DR2 Q;  1I5F A;  1LM0 A;  3L0O A;  3CMA A;  4DR4 L;  4A3D G;  5C3E H;  1XMO Q;  2R7Z G;  4PZ6 A;  3PO3 H;  1WFQ A;  3CF5 A;  4DUY L;  1HNX L;  4JI5 Q;  2ZM6 L;  1A0I A;  1HR0 Q;  2ZJR A;  1CKN B;  1HNX Q;  3RZO H;  3MXN B;  4DR1 L;  4P74 A;  2IHF A;  1GVP A;  2NN6 I;  3AQQ A;  2WAQ E;  2ZTD A;  2YYZ A;  3KF6 A;  4JG2 A;  3RLO A;  1YBY A;  4DR2 L;  1VS0 A;  1QZG A;  3CCR A;  2Q2U A;  4GN3 B;  4WJ4 A;  4L5Q A;  2N3S A;  4JV5 L;  3PF5 A;  1IBL Q;  1YZ6 A;  4JI3 Q;  5C4X H;  1XMQ L;  3ICE A;  4IOA A;  1VQ9 A;  2Z6K A;  1Q1E A;  4GN4 B;  4A3K G;  3TEH B;  4NXN L;  1PH7 A;  1J5E Q;  5H1S E;  4JI1 Q;  4NXN Q;  2RF4 A;  4H02 A;  4O2D A;  2AWN A;  1X9N A;  4JOI C;  4JI6 Q;  2KHI A;  1XMQ Q;  4IJH A;  4DK6 C;  2JEB I;  3HOU H;  1V1Q A;  4JV5 Q;  1OTC A;  4B3T Q;  4UY8 C;  4A3F H;  1YIJ A;  1U0L A;  4R4C A;  3M85 A;  1HR0 W;  2B63 G;  1Q82 C;  1XNQ L;  3PIP A;  3DLL A;  4L5S A;  2HT1 A;  2IY5 B;  2D0O A;  4GOP C;  3S2D H;  2YTV A;  1IXR A;  5E7N A;  3WWV A;  4LF6 L;  2JA7 G;  3K0X A;  4A75 A;  4A3D H;  4DUZ Q;  4POF A;  3F2C A;  4BY1 G;  1UE7 A;  2JJQ A;  2OQ0 A;  4OXP A;  5DLQ E;  3PUW A;  5M5W H;  1NMG A;  2D0P A;  3U50 C;  3T1H Q;  3S14 H;  4AH6 A;  3PIO A;  3HOZ G;  2BH2 A;  1PA6 A;  2PMZ E;  4AYB E;  1EQQ A;  1G51 A;  2CKZ B;  3A5Z B;  4LF5 L;  3UE1 A;  5IP7 G;  4EQ5 A;  4OWX B;  1QZH A;  5LMU Q;  2Y0S G;  1YEZ A;  3HOY H;  2WP8 J;  2DGY A;  5IYB H;  1LYL A;  4UP9 A;  4A3L G;  1A62 A;  3SGI A;  4A3I G;  4POG A;  2H5X A;  1PVO A;  1AE2 A;  3AEV A;  3RR5 A;  1GM5 A;  2UXB Q;  3D31 A;  2YTY A;  5C4X G;  3AFP A;  4GKJ Q;  3CQZ H;  1B7Y B;  4B3M Q;  2AMC B;  1NBW A;  1UWV A;  1L1O B;  4B3R L;  4OON A;  3J80 i;  2GN5 A;  2MNA A;  4GKK Q;  2UUC Q;  4A3C H;  4KHZ A;  1Y1V G;  4MTN A;  4JYA Q;  4GOP A;  2F4V Q;  2JA6 G;  2KBN A;  1V43 A;  3UDF A;  4YHH Q;  4HID A;  4JI0 Q;  1HNZ Q;  4DV4 Q;  2UUB Q;  4GOP B;  1VQL A;  4A3B G;  1K8A C;  4HIO A;  4YCU A;  1KAW A;  1PYB A;  1MJE A;  5M3F H;  3M3Y H;  4LFB Q;  3S15 H;  1IBK L;  4DV0 L;  3JC6 6;  4YCV A;  3L2P A;  4JI8 L;  4LFB L;  3PUV A;  4IJL A;  4APV A;  4YY3 Q;  1I94 L;  3CCQ A;  4DV5 L;  3I4N G;  3GDE A;  4WJ3 M;  3J80 c;  2UXD L;  1K3R A;  1EIF A;  4KHP Q;  4AQY L;  1FJG Q;  1HNZ L;  3TS2 A;  4IPD A;  4QIW E;  1G29 1;  2WB1 E;  2UUC L;  3PF4 A;  1OXT A;  2N8N A;  2YV5 A;  4A3J G;  1XJV A;  4P75 A;  1E3P A;  1X3G A;  2A8V A;  2R93 H;  5IYC H;  2QA4 A;  3HKZ G;  2N49 A;  3FKI G;  2UUA Q;  2VL6 A;  3D0F A;  4JBK A;  5EAY A;  3UE0 A;  3T1Y Q;  3HKS A;  3CC7 A;  4LF4 Q;  4BXX G;  3CCJ A;  2JEA I;  3S1R H;  4LF8 L;  2PI2 A;  4QY7 A;  1VQM A;  1Q1B A;  1XTD A;  3NEN A;  2LXJ A;  1JJ2 A;  1NMF A;  3CCV A;  1K9M C;  2GVB A;  3GD7 A;  5JEA G;  2R7F A;  4DR3 Q;  2ZTC A;  5JJI A;  1VQI A;  2CWA A;  4AQY Q;  1YIT A;  2E8G A;  4JBM A;  2MQH A;  2L15 A;  2VS1 A;  3ER0 A;  3I7F A;  2WB1 G;  4IOC A;  1YJN A;  4A76 A;  3F8T A;  4ME3 A;  1B70 B;  1X6O A;  2CCZ A;  1NY4 A;  1WCM G;  3KFU A;  5FLM H;  1VQD A;  4DR7 L;  3B6Y A;  4K0K L;  5IP9 H;  3E0E A;  4DR5 Q;  5IY0 A;  2HHH Q;  3RN5 A;  1HJP A;  5M3M H;  1VQA A;  1KC8 C;  1KIX A;  4IPH A;  1ASY A;  1I3Q H;  4DK3 C;  4YHH L;  3GTQ H;  2IX0 A;  4JI2 L;  1EQR A;  2F3I A;  3W5O A;  3J81 i;  3PO2 H;  1UE1 A;  1YHB A;  4B3T L;  3A5U A;  2Q2H A;  2V1C C;  3F2B A;  4A3J H;  3STB D;  4DR7 Q;  3NEL A;  4DNI A;  2IHE A;  2VUM G;  1R9T H;  4GKK L;  1SLJ A;  5IYD G;  1P8L A;  2K5N A;  4DV3 L;  2EXD A;  2VQE L;  4A3M H;  1TXY A;  4LUZ A;  4YWL A;  4GNX A;  4JCV E;  3RLF A;  2JK8 A;  1XPO A;  3J7A 5;  4BA1 I;  1W2B A;  2PI2 E;  1VQ5 A;  1VQN A;  4BY1 H;  1JMC A;  3HKZ E;  1Q8K A;  1SE8 A;  2UU9 Q;  5JJK A;  1A8V A;  1X55 A;  3IRB A;  3S1M H;  4A3G G;  4A93 H;  5LMN W;  2I5M X;  4BBS H;  1VCI A;  1P16 A;  4A3E H;  3BZK A;  4B3S L;  4BY7 G;  2XTI A;  4LFC L;  3CPF A;  3T1Y L;  4NXM L;  4NB3 A;  3CC4 A;  3H0G G;  5IP7 H;  4DR1 Q;  1RL2 A;  2WAQ G;  4IPC A;  3RNU A;  2JQO A;  1UEB A;  4DPG A;  4HIM A;  2NVX H;  3S16 H;  4LFA Q;  3I4M G;  1L0W A;  5BR8 L;  1Q81 C;  5LMN L;  3HOW G;  3ZJY C;  3PUZ A;  2YTX A;  4QJF A;  4LW1 A;  4NXM Q;  5GQO A;  3M9B A;  1K0R A;  3TRE A;  4DV1 L;  1T9H A;  2IX1 A;  2KHJ A;  1VQJ A;  4P73 A;  1IYJ B;  3CD6 A;  4JI4 Q;  4DV5 Q;  1Z47 A;  2OWO A;  2UXC L;  5GRO A;  1FL0 A;  2F52 A;  1PHJ A;  2EQS A;  4A3F G;  1Q7Y C;  1L1O C;  3ULJ A;  5GAD C;  5IE8 A;  4MZ9 A;  2HIV A;  4MNO A;  1L1O A;  1VQF A;  4DV3 Q;  4A3B H;  2QEX A;  2PNH A;  2R92 G;  4JI3 L;  5C0X J;  4JBW A;  2NVQ H;  2D62 A;  5FLX c;  1N32 L;  2UXC Q;  3HOV H;  4LNQ A;  3F2D A;  3PUY A;  3K80 C;  4R4I A;  3A0J A;  4DV1 Q;  3GTG H;  1KHI A;  4JI2 Q;  5IWA Q;  4X64 L;  4IO9 A;  3CP0 A;  1NE3 A;  2XGT A;  5C0X G;  1PV4 A;  1N36 Q;  1X3E A;  4B3M L;  5M5X H;  2JA8 G;  1VQ8 A;  2LXK A;  3KDF A;  3S2H H;  1XNR L;  4R4O A;  2UXB L;  4BY7 H;  5LMN Q;  3ULP A;  4LFA L;  3KOJ A;  3S24 A;  2R7Z H;  4K0K Q;  2VQF L;  3RN2 A;  2ALY B;  4UPA A;  5IYC G;  1VQG A;  5LMU L;  2NVT H;  1N33 L;  4DR6 L;  2IT1 A;  4LFC Q;  3H3V H;  1OXX K;  5JJL A;  4LUO A;  3ULL A;  1E24 A;  1BVS A;  2AHO B;  1HZB A;  3M4Q A;  3I55 A;  3OYY A;  2B3G A;  3UDI A;  4RMF A;  4LF5 Q;  2AKW B;  4X62 L;  3AYH B;  2JE6 I;  1GD7 A;  1SRO A;  2PQA A;  4YWK A;  4YY3 L;  4DR3 L;  4RG1 A;  1Q86 C;  3T1H L;  1E1T A;  3UDG A;  3S1Q H;  4A3C G;  2VQF Q;  2OTJ A;  1Y1V H;  1FGU A;  1E22 A;  2VZA A;  1KRT A;  1I50 H;  4HIK A;  2ZJQ A;  4LF8 Q;  1PFS A;  1RIP A;  4DV4 L;  3CCE A;  4A3K H;  2HIX A;  5GAE C;  5ELN A;  5AJ3 Q;  1QVG A;  1PH2 A;  3KYH C;  1CSP A;  1X54 A;  4LF7 L;  3PCO B;  3J81 j;  4LUV A;  1OXU A;  4DV2 Q;  5IP9 G;  3CW2 C;  1PH8 A;  4LF7 Q;  1YHQ A;  3HOU G;  1E7Z A;  5C44 H;  3RZD H;  1U5K A;  4A4I A;  5M3M G;  3JAM i;  4OX9 L;  3I4N H;  2N78 A;  4DKA C;  5M5Y H;  5AJ3 L;  4B3R Q;  1GKH A;  1PH1 A;  2ZTE A;  2A1A A;  4GLV B;  4OWW B;  2ATW A;  3PO2 G;  3U4V A;  4JI8 Q;  2YU9 H;  1IBK Q;  2B63 H;  4OO1 G;  1K83 H;  1V9P A;  3FKI H;  1VQK A;  3CC2 A;  3M4O H;  1J6Q A;  1M90 C;  1UE6 A;  5FJ8 H;  2MO0 A;  1VQP A;  3HOX G;  1WOC A;  1BBU A;  4DV6 Q;  1A63 A;  1N9W A;  3W1B A;  1VQC A;  1YHA A;  4A3M G;  4DR6 Q;  2OTL A;  1KXL A;  4GNX B;  2CFM A;  4GS3 A;  3G6E A;  4YWM A;  1C7Y A;  3KF8 B;  2HQL A;  3JAM c;  5BR8 Q;  2JA9 A;  3Q8D A;  4C2M H;  3J81 c;  2BA1 A;  1PH6 A;  2K50 A;  2ASB A;  1XNR Q;  1CKO A;  4A93 G;  4TQU S;  4R1J A;  2DUD A;  4B3S Q;  1VQH A;  4GLA C;  5IWA L;  4X64 Q;  1N36 L;  1XNQ Q;  4LF9 L;  2MO1 A;  5IYB G;  3OTO L;  4X65 L;  1QUQ B;  5J3B A;  3PO3 G;  2UU9 L;  4A3I H;  2VY3 A;  5IT9 c;  1MKH A;  4FDB A;  3NBH B;  4BBR G;  4P71 A;  1N32 Q;  3J7Z C;  3HOW H;  3ERS X;  2I0Q A;  3F1Z A;  3G71 A;  1D8L A;  4AIM A;  4JI6 L;  4C3H H;  1WI5 A;  2OCE A;  4KHP L;  3BZC A;  2VQE Q;  1KD1 C;  1I6H H;  2A19 A;  5C44 G;  1JT8 A;  1TWC H;  1JJG A;  1L2F A;  3CAM A;  3FP9 A;  3TRZ A;  1I94 Q;  4JI7 Q;  1VQE A;  4GN5 A;  1QVC A;  3K7A H;  4HJ9 A;  1QUQ A;  3STB C;  2Z0S A;  1EWI A;  1TWA H;  2JA6 H;  3HFZ B;  1S40 A;  1C0A A;  4DUZ L;  4JI4 L;  4UP7 A;  1Y14 B;  3KLW A;  5ELO A;  3W1G A;  4LF6 Q;  2UUB L;  1ASZ A;  2Q2I A;  1AH9 A;  4JI0 L;  3A74 A;  2K5H A;  4XIG S;  1VQB A;  1Y1W H;  2HHH L;  1IL2 A;  2F4V L;  3GTO H;  1YVC A;  1UE5 A;  2ZM6 Q;  1HR0 L;  2BH8 A;  1X3F A;  3KDF B;  1EIY B;  1SMX A;  4IFD I;  3M4P A;  2R93 G;  4X6A H;  1XPR A;  4OWT B;  2K4K A;  4A3G H;  4DR4 Q;  4BBS G;  4YCW A;  3GTM H;  3I56 A;  3EBE A;  1PH9 A;  5C3E G;  2JA7 H;  4LF4 L;  1AE3 A;  1IZ6 A;  3G48 A;  4PMW A;  4HJ5 A;  3U4Z A;  3GTJ H;  2BA0 A;  1IBL L;  2CWP A;  3MEF A;  4BBR H;  1C9O A;  1PH3 A;  4Y7N H;  1CSQ A;  4UP8 A;  3HOZ H;  5C0X I;  2KEN A;  4DAM A;  1Z9F A;  1MJC A;  4R4T A;  1N8R C;  4PZ8 A;  4EX5 A;  3DM3 A;  4QL5 A;  1TWF H;  3L7Z C;  3KJO A;  4KLK A;  4JOI A;  1CKN A;  2K5V A;  3K81 C;  1N34 L;  2UUA L;  4HJA A;  1DGS A;  1KQS A;  3HOY G;  3I4O A;  4A3L H;  1EOV A;  4PG3 A;  4J15 A;  2NZH A;  4JI5 L;  4DUY Q;  1S3O A;  1KL9 A;  2QGQ A;  2Z6K C;  3CXC A;  5JEA J;  1X56 A;  3EN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...