3RZOH

Rna polymerase ii initiation complex with a 4-nt rna
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 22
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3rzoH00
2CCZA 1YZ6A 1XPRA 2XTIA 1U5KA 1AE3A 3KDFB 3LGJA 4YCVA 2BH2A 4XIGS 4A76A 2V1CC 3GD7A 3EIVA 2VW9A 3PCOB 4AQYL 1UE7A 1FJGL 3I55A 3K8AA 5DLQE 3J81i 1EFWA 4JI8L 4A3EH 2QGQA 4LWCA 3TREA 4DR1L 1J5EQ 4JI4L 2I5LX 1NMFA 1QVCA 2WP8J 4QL5A 4UP9A 2VQFL 3CCMA 4DV4Q 3PO2G 1PH9A 1RIPA 2UU9L 1L1OC 3Q8DA 2AHOB 2VY3A 4AH6A 1C7YA 1ASYA 4C3JH 1IBLQ 2YU9H 1CKNB 4BY7G 4P71A 3A0JA 4R1JA 4GOPA 4A75A 4A3CG 2R93H 3AYHB 4JBKA 2R7DA 1PHJA 2K5HA 1N36Q 4A3IH 5HY6A 4OX9Q 4DR4Q 3CCVA 3TRZA 4DUZQ 4LF6Q 4K0KL 1YEZA 3UDXA 2YV5A 5IP9G 5LMNQ 1IYJB 4BBRG 1K73C 3RZOH 4A3BH 4DR7L 5FLMH 4RG1A 1D7QA 4A93G 5JEAJ 4X62Q 3ER0A 5C44H 1SROA 1I5FA 3E0EA 1UE5A 1KD1C 2FXQA 4POFA 1YVCA 4LUOA 1I94L 2UUAL 2UUBQ 1NBWA 3FKIG 1XNQQ 2CWPA 3SGIA 5IYBH 4JYAQ 3RN2A 1VQCA 4YCWA 4JI2Q 4DUYL 4WJ3M 1SN8A 3HOXH 1HH2P 4GLVB 4OXPA 3KLWA 2A19A 4DV3Q 1OXXK 4HJAA 4GOPC 3W1BA 2HHHQ 3HOYH 5JEAG 3H3VI 4B3RL 1G6PA 4WJ4A 5C4JH 3UDFA 4GLXA 1BBWA 1XPUA 3S2HH 1EWIA 4JBWA 4BXXG 1HNWL 1WJJA 2K75A 1E7ZA 3HKSA 2K4KA 4YY3L 4YCUA 3U58A 4LFAL 3CF5A 4BA2I 3HKZE 3L0OA 4HJ8A 2Z6KA 3KFUA 1VQNA 2OCEA 4MNOA 3S2DH 1XMOL 1PYSB 4GLAC 4GN4B 4XTCS 4DV6L 1IBKL 2RHQB 2JQOA 4KHPQ 4A3EG 1HNXL 4JCVE 2R7ZH 3A5UA 4DV5L 1R9TH 4P73A 4P75A 1CSQA 3AFQA 1PVOA 2F4VL 1KQSA 1HR0Q 1SLJA 4GOPB 2MFIA 4DV0L 3PV0A 1M90C 3PSIA 2NN6I 2R6GA 1N33Q 2JE6I 1E1OA 2ALYB 3PO3H 2R93G 4C2MH 4LFBQ 2OQKA 2IY5B 4IJLA 4MTNA 2ZTCA 2PI2A 4A3IG 4JI0Q 4OWXB 3CCSA 2B29A 1GM5A 2DGYA 2JEAI 5GQOA 4IPGA 3KJOA 4DAYB 4GKJL 1YHAA 2D62A 4YHHQ 5ELNA 2Z6KC 4A3BG 4X65L 1J6QA 5FLMG 4Y7NH 1YHBA 3CMEA 2AWNA 3S1MH 2WAQG 5C44G 1VQ5A 2IHEA 2KHIA 4APVA 1B70B 2QA4A 3KDFA 5AJ3L 4B3MQ 5J3BA 5IYBG 1NY4A 1VQAA 2UXCQ 3J81c 3CQZH 2HQLA 2ZTDA 3I56A 1VQEA 3HOXG 1A8VA 3M4QA 4JI7L 1EQQA 3HOUH 1C9OA 3HOYG 3M3YH 3UE1A 1VQ9A 4DV7Q 2WB1G 4QGUA 4HIKA 4A3FH 2ATWA 3KF6B 1BKBA 3RNUA 2JA7H 1CKNA 1CKMA 3AQQA 3KYHC 1X3FA 1Q1BA 1PH5A 4BBSH 1NE3A 2B63G 2NN6G 3ERSX 5LMUQ 1VQ7A 3D0FA 3OW2A 3NBHB 5IYCH 3S1QH 4AIMA 2D0OA 2E2JH 2OWOA 4IPCA 2JA5H 4JI1L 1X56A 2HT1A 2R7ZG 4L5TA 1N34L 4LF8Q 1PH8A 3T1YL 4A3DH 1TXYA 1E3PA 4O0AA 3S1NH 2H5XA 4A3LH 1VQIA 1EYGA 1L1OA 3T1HL 2IT1A 3PO3G 3PUWA 2Q2HA 2E8GA 3ULLA 2ZM6Q 4HIOA 1WI5A 2Y0SG 2L15A 1Q46A 1I6HH 1QZGA 2VZAA 3E9IA 3CP0A 2NVTH 3TS0A 4KLKA 2HIVA 2VQEL 2D0PA 1FL0A 4LF7L 1JB7A 2VS1A 1EIYB 4B3SQ 1QVFA 2DUDA 3TS2A 4DR5Q 5C3EH 5IY0A 2MNAA 4DR2Q 4OONA 4KHZA 4IO9A 1JMCA 2JA6H 1FVIA 5K36G 1JJCB 1YJNA 2WFWA 3HOZH 1J5EL 1P16A 2MQHA 3A74A 2C35B 4OO1I 2YTVA 3EBEA 3PUZA 3UDGA 1YJWA 4DV4L 2NVQH 3HOUG 1AH9A 4NXML 4A3JH 1LYLA 4AYBE 1PA6A 4DR6Q 1IBLL 3GTKH 1S72A 1PH6A 1WFQA 1X54A 4A3FG 2JJQA 3UDIA 2JA7G 4JI5Q 3K7AH 4DK6C 3MEFA 2KENA 4HJ9A 2I5HA 1N36L 1OXTA 1BBUA 5IP7H 4OX9L 4BBSG 1Q8KA 1SE8A 4DR4L 1NJIC 1GVPA 2E5LQ 4LF6L 1K8GA 4FDBA 5IYCG 5LMNL 1GKHA 3F2DA 3S14H 2Q2UA 2NZOA 1Q86C 5M3MH 4X62L 1YHQA 1SR3A 1HZAA 4X66Q 1E22A 2JA5G 5JJLA 2UUBL 1L1OB 2HIXA 5IWAQ 2IX1A 4A3DG 1Z47A 1XNQL 1HZ9A 1LTLA 1OXVA 2F3IA 1LM0A 4A3LG 1SMXA 4JYAL 2CFMA 4LUVA 2B3GA 3GTMH 3J7ZC 3PIOA 4JI2L 4PG3A 4YWLA 5E7NA 5GADC 4J15A 4K0KQ 5EAYA 1I3QH 3DLLA 1EIFA 1V9PA 2EIFA 4DV3L 5GAEC 2HHHL 4IOCA 4NXNQ 4DR7Q 1QUQB 1X6OA 3K81C 1MKHA 4UPAA 4OO1G 3CPWA 3ZJYC 5M5WH 4JV5Q 3KF6A 2IHFA 3G6EA 2UUCQ 1U0LA 2LSSA 3I4NH 5JJKA 4L5RC 1V43A 2KCTA 1V1QA 2KCMA 3GO5A 5C3EG 3M85A 3ULJA 4DV2Q 2GN5A 1HZBA 5BR8Q 1K8AC 3CCJA 4GN3B 2JA6G 2ID0A 3M9BA 1L2FA 5H1SE 1JE5A 4KHPL 1G291 1UE1A 3JAMi 3KF8B 2QEXA 2RF4A 2UXDQ 4B3TQ 2JA9A 1HR0L 4PMWA 4X64Q 4A3JG 4A3KH 1K3RA 4DR3Q 1XMQQ 1PV4A 2ES2A 4LFAQ 2I0QA 1N33L 4R4QA 4NB3A 1N9WA 3B6YA 1OXUA 4LFBL 3F2CA 4LF5L 4QY7A 4YWKA 5IP7G 4JI0L 3DM3A 5M5YH 3S1RH 1Z9FA 3F2BA 3BZCA 4GS3A 2MO0A 4YHHL 1VQPA 4OWWB 1HNZQ 2F4VQ 4TQUS 5M3MG 4DV0Q 4HIMA 4JI6Q 4QQBX 1N32Q 1T9HA 3HOVH 4DKAC 4QIWE 2EQSA 4B3ML 2BH8A 1VS0A 3STBD 4DV1Q 1PH7A 2UXCL 2ZJQA 3AFPA 4BY1H 2NVYH 2OTJA 2VUMH 3I4MH 3G4SA 1VQBA 3HOWH 1H95A 2K50A 5C0XI 3CW2C 1FGUA 1XJVA 5M5XH 1YNXA 2VNUD 4DV7L 3UE0A 2OTLA 4QJFA 3CC4A 1K0RA 3CC2A 4LFCQ 4O2DA 3STBC 3M4OH 2YYZA 4JI3Q 3I4NG 3TQYA 4LF9Q 1C0AA 4LF4Q 2UXBQ 2AWOA 5LMUL 5M3FH 4GNXA 4DAMA 2R7FA 1VQDA 4ALPA 1JJ2A 1SRUA 4BA1I 1E24A 1P8LA 4C3IH 2CKZB 2ZJRA 5GROA 1K9MC 2LXKA 4LW1A 3HKZG 2N3SA 1XNRQ 3CC7A 4R4OA 1TWGH 1PH2A 4LF8L 3I4OA 4HJ5A 1WCMH 4UP8A 3J80i 4A3KG 1IBMQ 5C0XJ 4JBMA 2N78A 2RCNA 5FJ8H 2Z0SA 4P72A 3OTOQ 3PF4A 3PIPA 2ZM6L 4JOIA 3RLFA 1A0IA 3BU2A 2RHSB 3NENA 2K5VA 4A3MH 2XGTA 4JI1Q 1VQJA 4JBJA 4GN5A 1QUQA 3J81j 3CMAA 1X55A 1Q12A 4GNXC 1M1KC 1HZCA 1E1TA 3CAMA 5C0XG 4B3SL 3GTQH 4DR5L 1Q7YC 2AMCB 3HOVG 1W2BA 1VQ6A 5IYDH 3T1HQ 4DR2L 4GKKQ 1W3SA 1Y1VH 4ME3A 4L5SA 1YBYA 3S24A 4BY1G 2VUMG 1G51A 2Q2TA 2PQAA 3I4MG 3HOWG 1JJGA 3CPFA 1TWCH 1VQGA 3JAMc 1VQ4A 2GVAA 4YWMA 2R92H 3S17H 4JOIC 1B8AA 1YJ9A 4DR6L 3G71A 3KOJA 4IFDI 1O7IA 2PNHA 4R4IA 1FJGQ 4AQYQ 2IX0A 2A8VA 3PUYA 3I7FA 4GNXB 3PUVA 4JI5L 2CQOA 3GTJH 1KIXA 3PUXA 2N49A 1Q1EA 4JI8Q 4DUZL 4DR1Q 2NZHA 2NVXH 4JI4Q 4LF7Q 2ZJPA 2VQFQ 1VCIA 5M3FG 2E5LL 3GDEA 1YIJA 3FHWA 4JG2A 2UU9Q 3WWVA 1X3GA 3G48A 3CCQA 2I5MX 4NXMQ 3RLOA 2E2IH 4X66L 3NEMA 1PH1A 4C3HH 4NPSA 4LUZA 1KHIA 2JK8A 2N8NA 3U50C 1HJPA 5IWAL 4HJ7A 2MO1A 1TWFH 2WAQE 1WCMG 3CD6A 3ICEA 3CCRA 4A3GH 1VQLA 5FJ8G 4L5QA 2JA8H 4JC0A 4IFDJ 4HIDA 2LXJA 3VDYA 3GTOH 1S3OA 4NXNL 3RLNA 2UUAQ 1Q81C 3I2ZA 4A3MG 1I94Q 3H3VH 2KBNA 3GTGH 1SFOH 4JV5L 1NMGA 2WB1E 2UUCL 3H15A 1UE6A 4DUYQ 1XPOA 1X9NA 5JJIA 1JT8A 2EXDA 4IFDG 1KRSA 2VL6A 5IYDG 3J7A5 2GVBA 1EQRA 1KAWA 4TVAB 1IXRA 2PQAB 3U4VA 5BR8L 1Y1VG 4DV2L 3TEHB 4UY8C 4B3RQ 1WYDA 1Y1WH 1S40A 3MXNB 1N8RC 1HNWQ 3EN2A 3K0XA 1PH4A 1Y14B 5GAHC 1ASZA 2UXDL 2AKWB 4IPDA 2R92G 3JC66 4B3TL 5HGQA 1EUJA 4YY3Q 4X64L 3BJUA 3J80c 4DR3L 1XMQL 1DGSA 4X6AH 4PZ8A 1I50H 1CKOA 3PGZA 1RL2A 3W5OA 2KHJA 1VQOA 1XMOQ 4DV6Q 1IBKQ 1HNXQ 1A62A 1MJCA 1D8LA 5FLXc 1VQHA 5LMNW 4AYBG 4DV5Q 2YTYA 4H02A 1KC8C 4IJHA 3H0GH 2Y0SE 3W1GA 1A63A 1PFSA 4RMFA 1AE2A 1HNZL 1IL2A 1BVSA 1MJEA 4JI6L 3AEVA 1N32L 2ASBA 3PF5A 2F52A 1X65A 3CCUA 3A5ZB 1L0WA 1Q82C 3F8TA 3HFZB 1PYBA 2ZTEA 4DV1L 1CUKA 4DK3C 4LF5Q 3GTLH 3F1ZA 1IZ6A 5C4XH 5IT9c 4A3GG 4GKJQ 1OXSC 2JA8G 4X65Q 3ULPA 4Y52H 4A4IA 2K52A 3IRBA 4DNIA 3RZDH 1K83H 1LUZA 3S15H 1PH3A 1CSPA 3D31A 5AJ3Q 1NTGA 3KJPA 1TWAH 4LFCL 5ELOA 3NELA 4JI3L 3CCEA 2JEBI 4PZ7A 1VQKA 4LF9L 2B63H 4LF4L 2UXBL 2Q2IA 4EQ5A 3PO2H 4JI7Q 2K14A 2K5NA 1TWHH 5IE8A 1YITA 1KL9A 2CWAA 1VQMA 2PI2E 1Y1WG 4BY7H 1HR0W 3CXCA 4A3CH 2OQ0A 4IOAA 1GD7A 1WOCA 4DPGA 1XNRL 4UP7A 4KI0A 1GO3E 1IBML 3U4ZA 5IP9H 1B7YB 4BBRH 1UEBA 3OTOL 1X3EA 3K80C 4POGA 2YTXA 1XTDA 4A93H 4P74A 1N34Q 3BZKA 1MIUA 3E9HA 3K7UC 2A1AA 3H0GG 3FKIH 3OYYA 1KRTA 3RN5A 3T1YQ 2E2HH 3GTPH 1EOVA 4R4CA 3M7NA 1KXLA 5GAGC 3L2PA 1VQFA 1QVGA 2BA0A 4IPHA 4GKKL 4MZ9A 3S16H 4OWTB 3HOZG 3FP9A 1YI2A 4LNQA 5C4XG 3M4PA 4EX5A 1VQ8A 4PZ6A 2BA1A 1OTCA 1UWVA 2VQEQ 4BXXH 3CCLA 3RR5A 3L7ZC 4R4TA 2PMZE 1QZHA
chains in the Genus database with same CATH superfamily
5EKIA 1YZ6A 1XPRA 3NWTA 2EYJA 3QJYA 1CZGA 4A76A 4AQYL 3PCOB 4QMGA 1UE7A 1J5EQ 2QGQA 1QVCA 2D2CC 3CCMA 4DV4Q 3PO2G 1GHKA 3TP6A 2ZXPA 3Q8DA 5C6AA 2K33A 5JJZA 1CKNB 1W6KA 4GOPA 4R1JA 2FFKB 3NK9A 3AYHB 2F0IA 1JQYD 2K5HA 4A3IH 1SMYD 4A3EB 4L8JA 2CVRA 1BO0A 3TRZA 5DM63 3UDXA 1VMPA 1K73C 4I7AA 4A3BH 1QNKA 1U4PA 2B2VA 3GQBA 4A93G 5C44H 1I5FA 2UUAL 1UE5A 3FKIG 4M1UB 2WIIB 3P7JA 2K5WA 1I4PA 3X3NA 1BUVT 3KLWA 4DV3Q 4GOPC 4HJAA 4CKCA 3W1BA 2EYMA 4B3RL 5KNBA 1ZYRC 4C1NI 1XPUA 1R4PB 5I4DA 1EIGA 1WJJA 1GXDC 2ICIA 3VR3A 2K4KA 1BBXC 1PYWD 4LFAL 3CF5A 3HOXB 3HKZE 1VF7A 1VQNA 5LL6X 3SVMA 3OMGA 2N55A 4CJ0B 1IBKL 1X3QA 5C4JB 1SBBB 4WORA 1LTAD 3H6MA 1U9RA 1ZXTA 2R7ZH 4P73A 1HR0Q 4ZCKA 4GOPB 2MFIA 2CW0D 4C3JG 5HURA 3PSIA 2NN6I 2R6GA 3V96A 1MHWC 1WD0A 3CRKC 2ALYB 3N6RA 4C2MH 2X69A 2OQKA 3VA7A 1JE4A 2B29A 1GM5A 2DGYA 3CRLC 2JEAI 4IPGA 4ZKBB 2MHVA 2D62A 4YHHQ 1DZ1A 4CGYB 1EZ8A 2HUGA 4Y7NH 1SNOA 2AWNA 2KHIA 4IUNA 2QA4A 5AJ3L 4J1MA 1S5DD 3K6OA 4Q0FA 5JVH3 2KQ3A 1A8VA 3O13A 3M4YA 3M3YH 3HOYG 3OW7A 2NBFA 1EY5A 4NKLA 3OHXC 1FD7D 4DV7Q 2WB1G 3QB3A 1JORA 2JA7H 3AQQA 2O5IC 4ULLA 3KYHC 5IODA 4RGNA 4BBSH 1NE3A 3OWFA 5LMUQ 2LY7A 3KLRA 4J6HA 2FHTA 4A3FB 1B3AA 2PQEA 3S1NH 4MIUA 1F2MA 1EYAA 5EBCA 4NDXA 2IT1A 3PO3G 3S1QB 4K2LA 3VYSA 2E8GA 3Q24A 3MEHA 5KNDA 1KDCA 4KY6A 2VZAA 4QF4A 5EGTA 2EY6A 1WTOA 1JB7A 3MFYA 2F03A 4B3SQ 1K3BC 3NPPA 4DR2Q 4KHZA 2F0PA 1PMRA 4C1NK 5K36G 1YJNA 3J80E 3A74A 4OO1I 1YJWA 3UDGA 3HOUG 4U673 3A8JE 3IFDA 4NXML 4AYBE 2IW3A 1S72A 1X54A 2AQ1B 1QG7A 1HFNA 3MEFA 3R2TA 2KENA 3C1FA 3VR4A 1OXTA 4OX9L 2DNCA 1NJIC 1AFPA 2NVQB 1LT3D 2HQEA 3F2DA 2Q2UA 3K57A 1WTWA 1Q86C 5M3MH 1YHQA 1G8ZD 3MXGA 2JA5G 5JJLA 4CJ2C 2OF1A 1PRTD 4A3DG 1XNQL 1LTLA 1OXVA 3T51B 1LM0A 1SMXA 4LUVA 3PIOA 2IPKD 4PG3A 5E7NA 5GADC 1EIFA 2EIFA 5KNCA 4IOCA 1STHA 4UPAA 3ZJYC 3KF6A 4L5RC 1V43A 5L37A 2KCTA 4G7HC 1Y8OB 2KCMA 3KLSX 1ML0D 5BR8Q 4IQZA 4DNTB 2ID0A 5M5WB 4V0BA 4IUPA 1WTHA 4B3TQ 4PMWA 4X64Q 1K3RA 2I0QA 1N33L 4NB3A 1PLFA 1OXUA 1AEXA 1QE6A 3DM3A 1BF4A 3S1RH 1Z9FA 1VQPA 4A3KB 1GUNA 4TQUS 4QQBX 1U4RA 4JI6Q 3T4AC 2L5TA 3JAME 2AUJD 4B3ML 1IHZA 2KCNA 3I4MH 1VQBA 5FO9B 3HOWH 2JN4A 4HMJA 2F0WA 3CW2C 1CI3M 2B2UA 1YNXA 2OTLA 3CC4A 1C4QA 2B8GA 4O42A 4LFCQ 4K5VA 2VUMB 4DAMA 1YNJD 1VQDA 5CYUA 4ALPA 4BA1I 5M5XB 1E24A 2LFNA 3D4WA 3MXUA 3VR2A 4DN4M 4LW1A 3M4OB 3HKZG 3DWQA 4FP5D 3CC7A 1I4HA 4R4OA 5EKKA 2JXMB 5C0XJ 4JBMA 2Z0SA 4RFBA 3PIPA 4JOIA 5J1ZA 1F9RA 4C3IB 1LTID 4A3MH 4ID6A 1SNQA 1TWGB 3SK4A 1ESRA 3CAMA 5C0XG 2X6LA 3U9OA 1D2BA 1VQ6A 5IYDH 2GA4B 1SJED 4ME3A 1J9OA 2MGSA 4BY1G 1EU3A 4HTHA 2F0MA 1JJGA 1TWCH 2Q8IB 1CA5A 2DJGC 1HUMA 1E2WA 3KF8A 3MXNA 4JOIC 3BDCA 4DR6L 4LAAA 1FJGQ 2IX0A 2CQOA 4K2KA 4Z9CB 3PUXA 1D5XC 4JI4Q 2IX3A 4FNFA 1JWSD 3RMHA 5M3FG 2E5LL 1YIJA 3X3MA 1X3GA 1LLRD 1HFGA 4KD3A 1S5BD 3BDOA 4C3HH 1PTOC 2RDHA 3SK8A 3U50C 2WAQE 2FINB 1WCMG 3H3VC 3CCRA 1JOOA 5FJ8G 4JC0A 1B1ZA 5I6YA 4HIDA 3VDYA 1DD2A 3GTOH 1S3OA 2EZVA 3RLNA 2CH4W 1O7LA 3IKJA 4K6DA 1I94Q 1CFMA 1TWFB 4JV5L 2B2YC 1DOLA 4RHRA 2UUCL 1UE6A 5JJIA 1PTOB 1KAWA 1TKWB 1AZPA 1Y1VG 4UY8C 2BCOA 1DM0B 1Y1WH 3MXNB 3QOJA 1HNWQ 2SDFA 4HSPA 3K0XA 2AKWB 4YY3Q 5TSSA 4DR3L 2KHJA 4K8IA 5BN4A 4DV6Q 1HNXQ 4K8JA 2L0CA 1D8LA 5FLXc 3ND9A 4AYBG 2YTYA 3A7LA 4IJHA 3D6CA 2Y0SE 1Y8NB 1STYA 1OO9B 1I50B 1N32L 3PMFA 4QCLA 2ENBA 2A5HA 4LF5Q 1CUKA 1XX8A 2RDGA 4A3GG 3F1ZA 4GKJQ 5JOBA 1A3TA 2FJ2A 4A4IA 2K52A 3TN2A 3RZDH 1K83H 3I4LA 2A69D 5JVG3 1SYGA 2XSCA 3HOZB 3GTLB 3NELA 4Q5VA 5J39A 5M9OA 5HGTA 1VQKA 1JWUD 4LF9L 4EQ5A 2K14A 1TWHH 4F8MA 1KL9A 2CWAA 3S15B 2QILA 1HR0W 1GUOA 4A3CH 4IOAA 1XNRL 4DPGA 2MP1A 4KI0A 4OIKA 3PO2B 1PFNA 3NTHA 5DEHA 3SEBA 3OTOL 1X3EA 5C4ZA 1QB5D 1STEA 1N34Q 3OMCA 2E2HH 3H0GG 1TT2A 3M7GA 1EOVA 1EWCA 4QUFA 2EYLA 4M8AA 4PQXA 3IL8A 4WFN3 4GKKL 4A93B 4EQNA 5C4XG 3M4PA 4EX5A 3FKIB 3GTPB 4RGOS 4BXXH 1RD9D 1SYBA 1CK1A 2M9VA 1MD2D 3KDFB 3SR1A 2BH2A 1RDPD 2V1CC 3S16B 4UAIA 3I55A 3K8AA 1EFWA 4JI8L 2E74C 4DR1L 4A3EH 2B63G 1B9NA 2WP8J 2VQFL 2QEJC 1L1OC 4XQQA 4BY7G 2VB2X 4DGZA 3A0JA 2M00A 4F87A 2WINB 1PHJA 1N36Q 5CBEE 5HY6A 4DR4Q 3CCVA 4DUZQ 4LF6Q 4KKUA 2YV5A 5IP9G 2A73B 3J81E 4C3JB 1CZWA 1I6VC 4X62Q 3ER0A 1SROA 3EA6A 4ABNA 4LUOA 1NBWA 2CWPA 2PNRC 5A35A 4JYAQ 2DN8A 4R8IA 4DUYL 1DOKA 4ZRZA 1TS2A 1SN8A 3HOXH 1A3VA 1HH2P 3RZOB 2FMMA 2A19A 2F3WA 2HHHQ 1TQOA 2EJFC 5C4JH 1KDBA 1LV9A 4DK0A 1E7ZA 3FPUB 3FPPA 4EQOA 4BA2I 1SSOA 3E5SA 2XWJB 3L0OA 2NN6H 2Z6KA 2RQXA 4MNOA 3HOYB 1XMOL 1GUGA 4GLAC 4GN4B 5IGDA 5G3LF 2JQOA 2F0HA 2WB1B 4CHTB 4DNRB 3S2HB 2IWHA 1SYFA 2X6GA 4P75A 2QDBA 3AFQA 1GOZA 3E3XA 1M90C 1UUPA 2JE6I 1JICA 1RCVD 3S2DB 1IW7C 1E1OA 2EY1A 2R93G 4JI0Q 4OWXB 2EJMA 3EFXD 3KJOA 2E2DC 2Z6KC 1C8CA 4X65L 5FLMG 3CMEA 2KHSA 2WAQG 4IUUA 1VQ5A 3C2PA 3PO3B 3CU7A 2L55A 5J3BA 4KN7C 5IYBG 1NY4A 4U68A 2HQLA 2ZTDA 4CDEC 3ND8A 1STBA 3HRZC 5J22A 1C9OA 1Z7TA 5F2DA 2BE5C 2A6EC 3H94A 1HTPA 3R93A 1STAA 2ATWA 4A3FH 3W3AA 1S5FD 3RNUA 1CKNA 1CKMA 3CQZB 1BOSA 3ERSX 1VQ7A 3HOUB 3OW2A 5IYCH 3S1QH 4DU9A 2M2LA 2D0OA 4IPCA 5A2QL 1DJRD 2HT1A 4ME5A 4LF8Q 1PH8A 3T1YL 3AMUA 4ZYSA 4O0AA 4A3LH 1MGSA 4EGVA 3BYYB 4L6TB 3ULLA 2E2JB 1H9MA 2Y0SG 2JA5B 1TS3A 1QZGA 4OO1H 3TS0A 5E1FA 1D5ZC 4KLKA 3J7YW 4A3DB 1VDZA 2VS1A 2EPBA 1QVFA 4XXEA 3TS2A 3EROA 2RA4A 5FKAC 2K04A 5IY0A 4OONA 5ELCA 1I6HB 2WFWA 1J5EL 2NVTB 2MQHA 1KTKA 3EBEA 2NVQH 1LT4D 4DV4L 3N52A 1MBYA 1EIHA 5EQ0A 1O7YA 3D4DA 2PO4A 5IGBA 4FXDA 1K28A 2SOBA 1PH6A 4JI5Q 4DK6C 4HJ9A 5IP7H 4B08A 1PTOD 1EY0A 1BCPC 2PCFB 3DM1A 1K8GA 1ICWA 1GKHA 4KN4C 2NZOA 4DA2A 1A3UA 3AB9A 2N88A 5IWAQ 2IX1A 1Z47A 1HZ9A 4KD4A 4NW2A 2VXWA 2CFMA 4PMBA 3J7ZC 4FXKC 4J15A 1V9PA 4DV3L 1EL0A 4NXNQ 3K81C 4DAPA 4JPBW 1BCPB 4IURA 3CPWA 1G2TA 5M5WH 1WTPA 3HEJA 4HN7A 2LSSA 3GTMB 5NUCA 1V1QA 5C3EG 3M85A 1I3QB 2EYFA 3ULJA 5KYIA 2GN5A 1O7ZA 2JA6G 1ICFB 1WTXA 4RWSC 3V2TA 2UXDQ 2QEXA 2RF4A 2PPBC 5COYA 5CV4A 1HR0L 1J8IA 4A3JG 1B2TA 4A3KH 1XMQQ 1YNNC 4LFAQ 3H09A 4QY7A 1IYUA 1RTOA 3OIQA 3HKZB 4IUQA 2B39A 1HCZA 4YHHL 2BOSA 3LWUA 3OPOA 4CKBA 1HNZQ 2O2LD 4HCSA 4QIWE 1VS0A 3AFPA 2OTJA 2VUMH 1H95A 3CHBD 4XDXA 5C0XI 1SNMA 4BWGB 5M5XH 4KKSA 4DV7L 3UE0A 3C1EA 3KBGA 3STBC 3M4OH 3VYTA 4JI3Q 4BY1B 3I4NG 2XN9C 2NVYB 3TQYA 4G7ZC 2Q8TA 4LF4Q 2UXBQ 5LMUL 4K5XA 4FF3A 4C3IH 2CKZB 2D9UA 2ZJRA 2LKVA 4RA8A 2N3SA 3NP8A 1TWGH 3I4OA 3NTKA 4HJ5A 2KUMA 5KRUA 1IBMQ 5M3FB 1X32A 3PF4A 3RLFA 3QG1A 4B9XA 1IKMA 2CHBD 2RHSB 1I4GA 2XGTA 1PFBA 3J81j 3CMAA 2C9OA 1X55A 1DOMA 1WCMB 2EVBA 5JPMC 1E1TA 4B3SL 4TRDA 5EPJA 1Q7YC 3HOVG 1W2BA 1HQMC 3DHQA 4DR2L 1JCKB 1YBYA 3BDLA 1G51A 2HCCA 2Q2TA 3KK7A 4K5WA 4IUTA 3JAMc 1ET9A 1LABA 4XYOA 1MSHA 2HD3A 4JW0A 1Y1VB 3PUYA 5D65A 1LTBD 4LF7Q 1EQVA 2NZHA 3R2IA 2QF7A 4CDFC 1NAPA 1A6XA 1GHJA 4JG2A 2UU9Q 4ZK9B 1D6EC 2L9HA 1F2YA 2NB0A 1V8QA 4NXMQ 3RLOA 2BDOA 1Y69U 3BS1A 3RUZA 3GTJB 1HJPA 1TWFH 2NVXB 3CD6A 4AYBB 4RKBA 4L5QA 4IFDJ 2LXJA 1PTOH 1DYQA 3H3VH 1NUCA 1H9JA 2F0DA 2E2IB 1NMGA 4A3GB 1X9NA 3I73A 2A68D 1E0BA 2EXDA 4IFDG 2F0EA 5BR8L 1A2TA 3GTGB 3EN2A 4OEMB 1PH4A 1Y14B 1HUNA 1SDFA 4IPDA 2R92G 3JC66 4B3TL 1EUJA 4X64L 1NNXA 4NMZA 3GV6A 1DGSA 3PQIA 4X6AH 4PZ8A 1EQTA 1I50H 3PGZA 1RL2A 3SHLA 1BNZA 2BDNA 1DONA 1A62A 2DY8A 3PIO3 4DV5Q 2AQ3B 5EKLA 1VF5C 5D3IB 2RSNA 1PRTF 1CQVA 3K5MA 2XRSD 4JI6L 3VYRA 1BXTA 3MHBA 1X65A 4KMUC 3A5ZB 1JC7A 1Q82C 1ESFA 3F8TA 3HFZB 2ZTEA 3HOZH 3GTLH 3KUPA 5IT9c 3H0GB 2JA8G 1LO5D 2L11A 4Y52H 4IZ8A 3IRBA 3K0YA 4LMQD 1LUZA 1X3PA 3S15H 2WKDA 3P20A 2RVLA 2PW5A 1PZID 3MTSA 3KJPA 4LFCL 3D3RA 1G6ZA 2XRQD 4R9WA 5C4XB 3DWAA 2OXPA 2JEBI 4PZ7A 3PO2H 4HR7B 4JI7Q 2K5NA 4TKOB 5JAVA 3HP3A 1YITA 2PI2E 1F9QA 5E4WC 1CQFA 1PXUA 3R8BA 2RCFA 1EEID 3CXCA 1TWAB 1WOCA 2K03A 2K32A 4UP7A 2B63B 1GO3E 4OGQC 3U4ZA 1B7YB 2KOLA 1UEBA 1WTQA 4POGA 4ILWA 1XTDA 4A93H 4BY7B 1JB3A 1F9SA 2JSOA 3DUZA 1MIUA 3K7UC 3FKIH 3RN5A 3GTPH 5IOCA 1KXLA 5GAGC 2EY5A 5C5MA 1B3QA 2B2TC 3FRPB 3MA2B 1Q8IA 2PZWA 4IPHA 3S16H 4OWTB 2PZTA 1C48A 5LL6S 2EJGC 2BA1A 2VQEQ 3CCLA 1HA6A 3L7ZC 4R4TA 2PMZE 1QZHA 2CCZA 2A6HC 2PYKA 2Z9HA 2XTIA 1U5KA 1EYCA 3MC0B 1SNPA 4XIGS 4OELB 5FK9C 1HTLD 3GD7A 2VW9A 3FVQA 1FJGL 1H9KA 4H44C 5DLQE 3GV3A 3NQIA 3MVVA 3FDTA 3TREA 3MFGA 4JI4L 4QL5A 1NMFA 2E75C 2B2YA 4X3TA 1PH9A 2OT2A 4JK1C 3PIP3 2AHOB 2VY3A 1BCPD 4AH6A 3SK6A 4C3JH 1IBLQ 4P71A 4O1NA 1SYEA 4JBKA 3MWYW 3E0JA 4DK1A 1O78A 4K0KL 5LMNQ 4BBRG 3RZOH 2YU9B 4DR7L 1EY9A 1D7QA 5BN5A 5JEAJ 3E0EA 2R93B 4KJOA 1ZYRD 1YVCA 4POFA 1I94L 2UUBQ 2F0GA 5E4XA 3SGIA 4G57A 1T5XD 3SXHA 4YCWA 4JI2Q 4WJ3M 1G91A 4OXPA 1LTTD 1H9RA 1OXXK 2JP1A 3HOYH 5JEAG 5IGFA 3H3VI 2WAQB 4XT1B 3UDFA 1BBWA 4GLXA 3S2HH 1HQRD 3VYUA 1HNWL 2K75A 3HKSA 1SE3A 4H13C 3NWSA 2F0OA 4YCUA 4DXFA 4YY3L 3U58A 4HJ8A 1ET6A 3KFUA 1K0SA 2OCEA 3S2DH 5I9OA 1HRJA 4DV6L 4XTCS 3BVZA 4QUCA 4DXGA 2RHQB 4KHPQ 2CQAA 1HNXL 1KDAA 2ZT9C 3A5UA 3NBHA 4BS9A 1CSQA 1GJXA 1PVOA 1V1PA 2F4VL 1SLJA 3OSOA 1TS4A 4DV0L 1WVLA 1SE2A 4KY7A 3PO3H 4LFBQ 1SNDA 2EXZA 4IJLA 4MTNA 1IKLA 4A3IG 3K59A 3QWNA 3TBIB 4ZAIA 1R9TB 4B9WA 4GKJL 2CW0C 5ELNA 5KEEA 2ICEC 4A3BG 2LS01 2JYOA 4X3SA 5C44G 2IHEA 4APVA 1B70B 2L1BA 3C3LA 3KDFA 2Y0SB 2F0KA 2EY2A 1VQAA 2UXCQ 5K36H 3J81c 3CQZH 3I56A 3NXWA 3HOUH 4F7XA 3S1MB 1VQ9A 4QGUA 2K7VA 3OWEB 5ELEA 4HIKA 1NCVA 4E6IA 1PZKD 1BKBA 3QOLA 2KECA 3SE0A 1X3FA 1KAAA 1PH5A 5CV5A 3NBHB 1V1PB 2E2JH 4HEDA 1ENAA 2JA5H 4JI1L 3NE5B 2R7ZG 1N34L 2RSOA 4A3DH 1TXYA 1IL8A 2H5XA 1VQIA 4KY5A 1EYGA 1L1OA 3NSWA 2DY7A 3T1HL 1QNUA 2Q2HA 1A15A 4C56C 3P75A 2IL8A 3VA5A 2ZM6Q 2L15A 1Q46A 3G6JB 1I6HH 2NVTH 2F0NA 3Q0AA 2D0PA 1FL0A 1CTMA 3EQLC 1EIYB 4DR5Q 1S5CD 1HPCA 3DWPA 4J8QA 5T1GA 5FLXL 2MNAA 1GUSA 1U4MA 4IO9A 1JMCA 1T5EA 3A7AB 2YTVA 3PUZA 4ZKCB 1RODA 1SXTA 1AH9A 5I2YA 3UI2A 1LYLA 2G5DA 3V05A 5C3EB 4I65A 1WFQA 3ERQA 3C46A 3Q23A 2JJQA 2QW7A 2JA7G 2JA6B 2NWGA 3HGBA 2I5HA 1N36L 2TSSA 4BBSG 1Q8KA 1TY2A 1NSNS 4DR4L 4FVMA 4LF6L 3OIPA 4FDBA 4A3JB 3MAQA 3GTKB 4X62L 1SR3A 4X66Q 1E22A 3K7AB 1L1OB 4RHSA 2MPMA 4JYAL 5ELBA 3GTMH 5I2XA 5EAYA 3P1HA 1I3QH 3DLLA 3S14B 2HHHL 3EVQA 1QUQB 4LK1C 4OHJA 1MKHA 1PRTC 2IHFA 1U0LA 4RKLA 2KJXA 3TZUA 1NR2A 1SE4A 2C5CA 4DV2Q 3CCJA 4FYDA 4GN3B 1B50A 2K5QA 3M9BA 5H1SE 1JE5A 4WRDA 1UE1A 2Z6BA 3JAMi 2F0QA 5IIFA 3DEPA 4RGTA 3I4NB 1U4LA 2ES2A 1STNA 2E76C 4R4QA 1PRTB 1N9WA 3B6YA 3A56A 4G7OC 4YWKA 4JI0L 1D5MC 1SAPA 4GS3A 4H0LC 4IUVA 2VB3X 4OWWB 4KV6A 5C0XH 5M3MG 2F0VA 1QJOA 5M5YB 4DV1Q 2ZJQA 4BY1H 2NVYH 2F0SA 3WOEA 2NZ1D 5D14A 2K50A 1XJVA 1BDOA 3HOVB 2VNUD 4QJFA 3DMUA 1K0RA 5ELFA 4O2DA 2YYZA 1C0AA 5E3FA 5M3FH 2R7FA 1SRUA 1P8LA 1K9MC 2LXKA 2PW7A 4LF8L 1PH2A 1RF2D 1WCMH 4UP8A 1PFMA 1QOHA 5FJ8H 5JPNC 2F4IA 1FGBD 2ZXRA 4P72A 5A2QE 4OIJA 1A0IA 2XWBB 2HCIA 3BU2A 3NENA 1VQJA 4JBJA 4PNYA 5DM73 1HZCA 3D4RA 2AMCB 1FNVA 2A6HD 1TIID 1Y1VH 2K5DA 1LTRD 4MHEA 1XYIA 1TS5A 2NYZD 3I4MG 2PQAA 3HOWG 2L12A 5D3DA 3CPFA 1VQGA 2GVAA 3GTQB 2PZUA 1QCBD 4IFDI 3G71A 3KOJA 2PNHA 2B2WA 4AQYQ 3F2UA 1TVXA 3PUVA 4JI5L 3GTJH 2QKIC 1KIXA 3ITPA 2N49A 1Q1EA 1CM9A 5C3WA 2NVXH 2XIWA 1HXYD 1AP0A 1ZKOA 3GDEA 2R92B 1EU4A 3S17B 3L3OC 3WWVA 4N8FA 1ZEQX 3NEMA 4ODGA 3K5LA 5I9PA 1KHIA 2E2IH 5IWAL 2OEOA 5CMDA 1GUWA 3ICEA 4A3GH 1VQLA 2DJFC 4FO2A 3AU7A 2B2WC 1JWMD 2O4XA 4NXNL 2UUAQ 1STGA 1Q81C 3I2ZA 5KYLA 4A3MG 1ILPA 1K8MA 4DFAA 3GTGH 4X3KA 1XPOA 1EY6A 3WDNA 2JA8B 3J7A5 2F0JA 5IYDG 3BYTB 4TVAB 2PQAB 4B3RQ 2F1MA 4HMIA 2G9HD 1S40A 1N8RC 2KEEA 1SFOB 4KKTA 4QB4A 2UXDL 5HGQA 1EY4A 3BJUA 3HS0C 3LNNA 4G4KA 3G7LA 3QIAA 3J80c 1XMQL 1PTOF 1GUTA 2B2VC 1CKOA 4H7BA 1VQOA 2SEBD 4LJZC 1IBKQ 5EJWA 4KHVA 3L9AX 1VQHA 5LMNW 1KC8C 3H0GH 3W1GA 1PFSA 3Q22A 1HNZL 3D8GA 1IL2A 1BVSA 1IYVA 3AEVA 3TP5A 4C3HG 2ASBA 3KLSA 1TY0A 5IGCA 2I07B 4DK3C 3MZ5A 1IZ6A 3I72A 1LTSD 5C4XH 1OXSC 3TMEA 2IJ0A 5ELDA 5KGUA 3KBXA 1PH3A 1CSPA 1B44D 5AJ3Q 1SYCA 3VR6A 1TWAH 4JI3L 3CCEA 2B63H 1RKNA 1CHQD 1W6JA 4LF4L 2Q2IA 2UXBL 4QIWB 5IE8A 2MUYA 1VQMA 2A69C 2H4OA 1Y1WG 4BY7H 5IGGA 1GD7A 1IBML 4IALA 1ENCA 5IP9H 2YTXA 3TSSA 4P74A 5CV8A 1WD1A 3BZKA 1LACA 1KRTA 2A1AA 2G9DA 1S4ZA 4R4CA 3L2PA 4BBRB 4EQPA 4FF4A 3W2DA 5FO7B 3FP9A 1YI2A 4LNQA 4KK7A 1VQ8A 4HSVA 1UWVA 3NTIA 3VR5A 4XQNA 2R61A 5ISRA 3J80L 2QDLA 1AE3A 3LGJA 4YCVA 1D1IA 1FR3A 3EIVA 4YIJA 3J81i 3A55A 1MI2A 4LF7L 4LWCA 2I5LX 4UP9A 1M8AA 3H91A 1ENFA 1RIPA 2UU9L 1ASYA 1C7YA 2YU9H 1NR4A 3A8IE 1CHPD 2R93H 4A75A 4A3CG 1CA6A 2R7DA 2Z4IA 4OX9Q 3GP7A 2NUCA 1YEZA 1IYJB 5FLMH 4RG1A 4DAYA 1KD1C 4ZUIA 2FXQA 2H1EA 4A3IB 1XNQQ 5IYBH 2NTSA 3RN2A 1HA5A 1VQCA 2EYOA 4GLVB 4A3BB 1G6PA 5C44B 1EZ6A 4WJ4A 2EE1A 2P5ZX 1EWIA 4JBWA 4BXXG 1EFID 1ONLA 1RTNA 2EYHA 4CDCC 4XYQA 1IW7D 1G2SA 1PYSB 3T56B 4A3EG 3I70A 4JCVE 4DF7A 2J4XA 4DV5L 1R9TH 1KQSA 3QO2A 1KLGD 3PV0A 1N33Q 1H9SA 1E2VA 2IY5B 3T13A 4TSSA 2J0TD 2ZTCA 2PI2A 3CCSA 3JAML 2R7ZB 5FO8B 4S3SA 5GQOA 4DAYB 1YHAA 1PZJD 1WTVA 1QWYA 4XQJA 1J6QA 1YHBA 1F2ZA 3S1MH 2BE5D 2A6ED 4KTAA 1B9MA 4C2MB 3BVMA 5IGEA 2RDFA 4B3MQ 3NBIA 3E6ZX 2B8FA 3TP7A 1VQEA 3HOXG 3M4QA 1XWEA 4Y7NB 1EQQA 4JI7L 2B2TA 3UE1A 1FNWA 3KF6B 1Q90A 4L63B 4RH6A 1Q1BA 5CV6A 4CKEA 2NN6G 5K5PA 3D0FA 3M3YB 3J7AF 4AIMA 2EOTA 2OWOA 1X56A 4N9TA 1SYDA 3J7AV 2JA7B 4L5TA 4WJWA 1AZQA 1H9SB 1SJHD 4BBSB 1E3PA 4PV1C 5AFWA 2K01A 3R3OA 3QR8A 1KLUD 3PUWA 1RHPA 2B2UC 4HIOA 1WI5A 3TZDA 4UDUC 1K8OA 2SNMA 1FYCA 1I4XA 3E9IA 1XTCD 3CP0A 2HIVA 3SK5A 2VQEL 4X3UA 3S1NB 2DUDA 5C3EH 4CDDC 2K6AA 2JA6H 1FVIA 2I46A 1JJCB 2KEDA 1P16A 2C35B 2V4DA 4A3JH 1PA6A 4DR6Q 4DAVA 1IBLL 3GTKH 3FEWX 5T1IA 4FXGC 4A3FG 4ZLTF 3UDIA 5IT9L 3K7AH 1F77A 4JVZA 1BBUA 2PMZB 1SE8A 1Y8PB 1GVPA 5EPKA 3MXPA 2E5LQ 1BQQT 1VMCA 5LMNL 5IYCG 4GZYC 2NTTA 3S14H 2HDMA 2KCCA 3LWEA 1UNSA 3D6WA 1HZAA 5IT9E 1SMYC 2UUBL 2HIXA 1UAPA 2F3IA 1L0YB 4K6LA 4N8X1 4A3LG 4RCOA 2B3GA 4JI2L 1ILQA 4YWLA 4K0KQ 1B4OA 3DXJC 5M3MB 5GAEC 4DR7Q 1LTGD 1X6OA 4OO1G 1E2ZA 4JV5Q 4HAEA 3G6EA 2UUCQ 3EJIA 3I4NH 5JJKA 3CKIB 3GO5A 1YNND 1II3A 1HZBA 3I90A 1K8AC 1EY8A 1KABA 2F0TA 1L2FA 1BCPF 4KHPL 1G291 1O80A 4IN3A 3KF8B 4UHVA 2JA9A 2EYPA 1PV4A 4DR3Q 4MN3A 5C4HA 4LFBL 3F2CA 4LF5L 1A2UA 3RD4A 4EVOA 5IP7G 2K05A 5M5YH 3I8ZA 3F2BA 3BZCA 3K5OA 1S5ED 2MO0A 2FMCA 5CV9A 2F4VQ 3BZDB 4DV0Q 5EPLA 4HIMA 1N32Q 2WKCA 1T9HA 3HOVH 1EWHA 4DKAC 2EQSA 2BH8A 3STBD 3S1RB 1PH7A 1EY7A 2UXCL 4PMCA 3G4SA 5BN3A 3TDQA 3Q6SA 5KIXA 3WOFA 1FGUA 1SNCA 1I4RA 1Z6HA 1FNUA 3CC2A 3NQTA 3BG3A 1F2LA 4LF9Q 3A54A 3I4MB 2KA7A 2AWOA 3HOWB 4GNXA 1JJ2A 3A8KE 1JR0D 2J7ZA 5GROA 1D1KA 2Q8RE 5EBDA 1JOKA 4CJ1B 1TR5A 4FF2A 1XNRQ 3J80i 4A3KG 2N78A 2RCNA 5CC4A 3OTOQ 4F88A 1EYDA 3S9WA 2ZM6L 4CBVA 2K5VA 4N9PA 2F0FA 4JI1Q 4GN5A 1QUQA 1Q12A 4GNXC 1M1KC 5FOBB 2DNEA 3GTQH 1RJTA 4DR5L 4IFDH 3K58A 3T1HQ 4GKKQ 1W3SA 4L5SA 5DAUA 3S24A 4A3MB 2VUMG 1VQ4A 4YWMA 5FLXE 2R92H 3S17H 2O5JC 4V190 1B8AA 1YJ9A 1O7IA 1I4QA 3ZYYX 4R4IA 2A8VA 2XVSA 3I7FA 4GNXB 1AW7A 4JI8Q 2RBMA 4DUZL 4DR1Q 2ZJPA 2VQFQ 1TWCB 1VCIA 3FHWA 5G3LD 3URYA 4ZQ3A 3G48A 3T53B 3CCQA 2I5MX 2Z1CA 3FMCA 4I7ZC 3T16A 4C3IG 4X66L 2D5DA 1PH1A 4NPSA 3J81L 4KJNA 2WACA 4LUZA 2N8NA 2JK8A 4HJ7A 2MO1A 3K5NA 3NUCA 5CBAE 2JA8H 2XNAC 5LHY1 1SEBD 1DCZA 1TU2B 3IFTA 1CT1D 5CORA 4C3HB 2QCPX 2KBNA 4RAUC 1KNAA 1R4QB 1SFOH 2WB1E 3OOCA 4NP5A 3H15A 4DUYQ 1JT8A 1XXGA 1KRSA 2VL6A 2GVBA 3GTOB 1EQRA 1EOTA 1IXRA 3U4VA 4DV2L 2AQ2B 3TEHB 1WYDA 4RCNA 1M4VA 2WV6D 5I6WA 5GAHC 1ASZA 2A68C 2L4NA 1AN8A 2K28A 1XMOQ 3W5OA 1DXMA 2K1BA 1WTRA 1MJCA 1Y1WB 2Z8LA 4H02A 2EDGA 1A63A 4RMFA 1AE2A 3ONAB 1JOQA 1MJEA 4ZUJA 4K14A 2A74C 3PF5A 2F52A 3CCUA 1L0WA 1LT5D 3BVGA 2F3VA 1PYBA 4DV1L 3DEOA 5CV7A 1KNEA 1L0XB 1PDQA 2AUKA 2SNSA 4RGMA 5CGKA 4X65Q 5DNFA 3ULPA 5CR3A 4DNIA 3D31A 4MTKA 1NTGA 2LMCB 3HZXA 4FF1A 5ELOA 2Z4HA 4R8NA 5C3XA 2MJ8A 3IAYA 2TMPA 3RZDB 1K83B 1F9PA 4OL7A 1Q3LA 2HDLA 2F0LA 2RKSA 2OQ0A 2CH4A 2KVMA 3HG9A 1YNJC 1TWHB 1B53A 4BBRH 3K80C 1QILA 1EEFD 2ZXOA 1MSGA 1V1OA 3U9SA 3I3CA 4HCEA 5C5LA 3E9HA 3NHHA 3OYYA 3T1YQ 1HHVA 1UEAB 3M7NA 3LX0A 3TP8A 1VQFA 2R3ZA 1QVGA 2BA0A 4MZ9A 5JEAH 3HOZG 4P2CB 3I91A 2E2HB 4PZ6A 1OTCA 2F0UA 4XT3B 3SDZA 3RR5A 1BR9A 1LT6D
chains in the Genus database with same CATH topology
2CCZA 1YZ6A 1XPRA 2XTIA 1U5KA 1AE3A 3KDFB 3LGJA 4YCVA 2BH2A 4XIGS 4A76A 2V1CC 3GD7A 3EIVA 2VW9A 3PCOB 4AQYL 1UE7A 1FJGL 3I55A 3K8AA 5DLQE 3J81i 1EFWA 4JI8L 4A3EH 2QGQA 4LWCA 3TREA 4DR1L 1J5EQ 4JI4L 2I5LX 1NMFA 1QVCA 2WP8J 4QL5A 4UP9A 2VQFL 3CCMA 4DV4Q 3PO2G 1PH9A 1RIPA 2UU9L 1L1OC 3Q8DA 2AHOB 2VY3A 4AH6A 1C7YA 1ASYA 4C3JH 1IBLQ 2YU9H 1CKNB 4BY7G 4P71A 3A0JA 4R1JA 4GOPA 4A75A 4A3CG 2R93H 3AYHB 4JBKA 2R7DA 1PHJA 2K5HA 1N36Q 4A3IH 5HY6A 4OX9Q 4DR4Q 3CCVA 3TRZA 4DUZQ 4LF6Q 4K0KL 1YEZA 3UDXA 2YV5A 5IP9G 5LMNQ 1IYJB 4BBRG 1K73C 3RZOH 4A3BH 4DR7L 5FLMH 4RG1A 1D7QA 4A93G 5JEAJ 4X62Q 3ER0A 5C44H 1SROA 1I5FA 3E0EA 1UE5A 1KD1C 2FXQA 4POFA 1YVCA 4LUOA 1I94L 2UUAL 2UUBQ 1NBWA 3FKIG 1XNQQ 2CWPA 3SGIA 5IYBH 4JYAQ 3RN2A 1VQCA 4YCWA 4JI2Q 4DUYL 4WJ3M 1SN8A 3HOXH 1HH2P 4GLVB 4OXPA 3KLWA 2A19A 4DV3Q 1OXXK 4HJAA 4GOPC 3W1BA 2HHHQ 3HOYH 5JEAG 3H3VI 4B3RL 1G6PA 4WJ4A 5C4JH 3UDFA 4GLXA 1BBWA 1XPUA 3S2HH 1EWIA 4JBWA 4BXXG 1HNWL 1WJJA 2K75A 1E7ZA 3HKSA 2K4KA 4YY3L 4YCUA 3U58A 4LFAL 3CF5A 4BA2I 3HKZE 3L0OA 4HJ8A 2Z6KA 3KFUA 1VQNA 2OCEA 4MNOA 3S2DH 1XMOL 1PYSB 4GLAC 4GN4B 4XTCS 4DV6L 1IBKL 2RHQB 2JQOA 4KHPQ 4A3EG 1HNXL 4JCVE 2R7ZH 3A5UA 4DV5L 1R9TH 4P73A 4P75A 1CSQA 3AFQA 1PVOA 2F4VL 1KQSA 1HR0Q 1SLJA 4GOPB 2MFIA 4DV0L 3PV0A 1M90C 3PSIA 2NN6I 2R6GA 1N33Q 2JE6I 1E1OA 2ALYB 3PO3H 2R93G 4C2MH 4LFBQ 2OQKA 2IY5B 4IJLA 4MTNA 2ZTCA 2PI2A 4A3IG 4JI0Q 4OWXB 3CCSA 2B29A 1GM5A 2DGYA 2JEAI 5GQOA 4IPGA 3KJOA 4DAYB 4GKJL 1YHAA 2D62A 4YHHQ 5ELNA 2Z6KC 4A3BG 4X65L 1J6QA 5FLMG 4Y7NH 1YHBA 3CMEA 2AWNA 3S1MH 2WAQG 5C44G 1VQ5A 2IHEA 2KHIA 4APVA 1B70B 2QA4A 3KDFA 5AJ3L 4B3MQ 5J3BA 5IYBG 1NY4A 1VQAA 2UXCQ 3J81c 3CQZH 2HQLA 2ZTDA 3I56A 1VQEA 3HOXG 1A8VA 3M4QA 4JI7L 1EQQA 3HOUH 1C9OA 3HOYG 3M3YH 3UE1A 1VQ9A 4DV7Q 2WB1G 4QGUA 4HIKA 4A3FH 2ATWA 3KF6B 1BKBA 3RNUA 2JA7H 1CKNA 1CKMA 3AQQA 3KYHC 1X3FA 1Q1BA 1PH5A 4BBSH 1NE3A 2B63G 2NN6G 3ERSX 5LMUQ 1VQ7A 3D0FA 3OW2A 3NBHB 5IYCH 3S1QH 4AIMA 2D0OA 2E2JH 2OWOA 4IPCA 2JA5H 4JI1L 1X56A 2HT1A 2R7ZG 4L5TA 1N34L 4LF8Q 1PH8A 3T1YL 4A3DH 1TXYA 1E3PA 4O0AA 3S1NH 2H5XA 4A3LH 1VQIA 1EYGA 1L1OA 3T1HL 2IT1A 3PO3G 3PUWA 2Q2HA 2E8GA 3ULLA 2ZM6Q 4HIOA 1WI5A 2Y0SG 2L15A 1Q46A 1I6HH 1QZGA 2VZAA 3E9IA 3CP0A 2NVTH 3TS0A 4KLKA 2HIVA 2VQEL 2D0PA 1FL0A 4LF7L 1JB7A 2VS1A 1EIYB 4B3SQ 1QVFA 2DUDA 3TS2A 4DR5Q 5C3EH 5IY0A 2MNAA 4DR2Q 4OONA 4KHZA 4IO9A 1JMCA 2JA6H 1FVIA 5K36G 1JJCB 1YJNA 2WFWA 3HOZH 1J5EL 1P16A 2MQHA 3A74A 2C35B 4OO1I 2YTVA 3EBEA 3PUZA 3UDGA 1YJWA 4DV4L 2NVQH 3HOUG 1AH9A 4NXML 4A3JH 1LYLA 4AYBE 1PA6A 4DR6Q 1IBLL 3GTKH 1S72A 1PH6A 1WFQA 1X54A 4A3FG 2JJQA 3UDIA 2JA7G 4JI5Q 3K7AH 4DK6C 3MEFA 2KENA 4HJ9A 2I5HA 1N36L 1OXTA 1BBUA 5IP7H 4OX9L 4BBSG 1Q8KA 1SE8A 4DR4L 1NJIC 1GVPA 2E5LQ 4LF6L 1K8GA 4FDBA 5IYCG 5LMNL 1GKHA 3F2DA 3S14H 2Q2UA 2NZOA 1Q86C 5M3MH 4X62L 1YHQA 1SR3A 1HZAA 4X66Q 1E22A 2JA5G 5JJLA 2UUBL 1L1OB 2HIXA 5IWAQ 2IX1A 4A3DG 1Z47A 1XNQL 1HZ9A 1LTLA 1OXVA 2F3IA 1LM0A 4A3LG 1SMXA 4JYAL 2CFMA 4LUVA 2B3GA 3GTMH 3J7ZC 3PIOA 4JI2L 4PG3A 4YWLA 5E7NA 5GADC 4J15A 4K0KQ 5EAYA 1I3QH 3DLLA 1EIFA 1V9PA 2EIFA 4DV3L 5GAEC 2HHHL 4IOCA 4NXNQ 4DR7Q 1QUQB 1X6OA 3K81C 1MKHA 4UPAA 4OO1G 3CPWA 3ZJYC 5M5WH 4JV5Q 3KF6A 2IHFA 3G6EA 2UUCQ 1U0LA 2LSSA 3I4NH 5JJKA 4L5RC 1V43A 2KCTA 1V1QA 2KCMA 3GO5A 5C3EG 3M85A 3ULJA 4DV2Q 2GN5A 1HZBA 5BR8Q 1K8AC 3CCJA 4GN3B 2JA6G 2ID0A 3M9BA 1L2FA 5H1SE 1JE5A 4KHPL 1G291 1UE1A 3JAMi 3KF8B 2QEXA 2RF4A 2UXDQ 4B3TQ 2JA9A 1HR0L 4PMWA 4X64Q 4A3JG 4A3KH 1K3RA 4DR3Q 1XMQQ 1PV4A 2ES2A 4LFAQ 2I0QA 1N33L 4R4QA 4NB3A 1N9WA 3B6YA 1OXUA 4LFBL 3F2CA 4LF5L 4QY7A 4YWKA 5IP7G 4JI0L 3DM3A 5M5YH 3S1RH 1Z9FA 3F2BA 3BZCA 4GS3A 2MO0A 4YHHL 1VQPA 4OWWB 1HNZQ 2F4VQ 4TQUS 5M3MG 4DV0Q 4HIMA 4JI6Q 4QQBX 1N32Q 1T9HA 3HOVH 4DKAC 4QIWE 2EQSA 4B3ML 2BH8A 1VS0A 3STBD 4DV1Q 1PH7A 2UXCL 2ZJQA 3AFPA 4BY1H 2NVYH 2OTJA 2VUMH 3I4MH 3G4SA 1VQBA 3HOWH 1H95A 2K50A 5C0XI 3CW2C 1FGUA 1XJVA 5M5XH 1YNXA 2VNUD 4DV7L 3UE0A 2OTLA 4QJFA 3CC4A 1K0RA 3CC2A 4LFCQ 4O2DA 3STBC 3M4OH 2YYZA 4JI3Q 3I4NG 3TQYA 4LF9Q 1C0AA 4LF4Q 2UXBQ 2AWOA 5LMUL 5M3FH 4GNXA 4DAMA 2R7FA 1VQDA 4ALPA 1JJ2A 1SRUA 4BA1I 1E24A 1P8LA 4C3IH 2CKZB 2ZJRA 5GROA 1K9MC 2LXKA 4LW1A 3HKZG 2N3SA 1XNRQ 3CC7A 4R4OA 1TWGH 1PH2A 4LF8L 3I4OA 4HJ5A 1WCMH 4UP8A 3J80i 4A3KG 1IBMQ 5C0XJ 4JBMA 2N78A 2RCNA 5FJ8H 2Z0SA 4P72A 3OTOQ 3PF4A 3PIPA 2ZM6L 4JOIA 3RLFA 1A0IA 3BU2A 2RHSB 3NENA 2K5VA 4A3MH 2XGTA 4JI1Q 1VQJA 4JBJA 4GN5A 1QUQA 3J81j 3CMAA 1X55A 1Q12A 4GNXC 1M1KC 1HZCA 1E1TA 3CAMA 5C0XG 4B3SL 3GTQH 4DR5L 1Q7YC 2AMCB 3HOVG 1W2BA 1VQ6A 5IYDH 3T1HQ 4DR2L 4GKKQ 1W3SA 1Y1VH 4ME3A 4L5SA 1YBYA 3S24A 4BY1G 2VUMG 1G51A 2Q2TA 2PQAA 3I4MG 3HOWG 1JJGA 3CPFA 1TWCH 1VQGA 3JAMc 1VQ4A 2GVAA 4YWMA 2R92H 3S17H 4JOIC 1B8AA 1YJ9A 4DR6L 3G71A 3KOJA 4IFDI 1O7IA 2PNHA 4R4IA 1FJGQ 4AQYQ 2IX0A 2A8VA 3PUYA 3I7FA 4GNXB 3PUVA 4JI5L 2CQOA 3GTJH 1KIXA 3PUXA 2N49A 1Q1EA 4JI8Q 4DUZL 4DR1Q 2NZHA 2NVXH 4JI4Q 4LF7Q 2ZJPA 2VQFQ 1VCIA 5M3FG 2E5LL 3GDEA 1YIJA 3FHWA 4JG2A 2UU9Q 3WWVA 1X3GA 3G48A 3CCQA 2I5MX 4NXMQ 3RLOA 2E2IH 4X66L 3NEMA 1PH1A 4C3HH 4NPSA 4LUZA 1KHIA 2JK8A 2N8NA 3U50C 1HJPA 5IWAL 4HJ7A 2MO1A 1TWFH 2WAQE 1WCMG 3CD6A 3ICEA 3CCRA 4A3GH 1VQLA 5FJ8G 4L5QA 2JA8H 4JC0A 4IFDJ 4HIDA 2LXJA 3VDYA 3GTOH 1S3OA 4NXNL 3RLNA 2UUAQ 1Q81C 3I2ZA 4A3MG 1I94Q 3H3VH 2KBNA 3GTGH 1SFOH 4JV5L 1NMGA 2WB1E 2UUCL 3H15A 1UE6A 4DUYQ 1XPOA 1X9NA 5JJIA 1JT8A 2EXDA 4IFDG 1KRSA 2VL6A 5IYDG 3J7A5 2GVBA 1EQRA 1KAWA 4TVAB 1IXRA 2PQAB 3U4VA 5BR8L 1Y1VG 4DV2L 3TEHB 4UY8C 4B3RQ 1WYDA 1Y1WH 1S40A 3MXNB 1N8RC 1HNWQ 3EN2A 3K0XA 1PH4A 1Y14B 5GAHC 1ASZA 2UXDL 2AKWB 4IPDA 2R92G 3JC66 4B3TL 5HGQA 1EUJA 4YY3Q 4X64L 3BJUA 3J80c 4DR3L 1XMQL 1DGSA 4X6AH 4PZ8A 1I50H 1CKOA 3PGZA 1RL2A 3W5OA 2KHJA 1VQOA 1XMOQ 4DV6Q 1IBKQ 1HNXQ 1A62A 1MJCA 1D8LA 5FLXc 1VQHA 5LMNW 4AYBG 4DV5Q 2YTYA 4H02A 1KC8C 4IJHA 3H0GH 2Y0SE 3W1GA 1A63A 1PFSA 4RMFA 1AE2A 1HNZL 1IL2A 1BVSA 1MJEA 4JI6L 3AEVA 1N32L 2ASBA 3PF5A 2F52A 1X65A 3CCUA 3A5ZB 1L0WA 1Q82C 3F8TA 3HFZB 1PYBA 2ZTEA 4DV1L 1CUKA 4DK3C 4LF5Q 3GTLH 3F1ZA 1IZ6A 5C4XH 5IT9c 4A3GG 4GKJQ 1OXSC 2JA8G 4X65Q 3ULPA 4Y52H 4A4IA 2K52A 3IRBA 4DNIA 3RZDH 1K83H 1LUZA 3S15H 1PH3A 1CSPA 3D31A 5AJ3Q 1NTGA 3KJPA 1TWAH 4LFCL 5ELOA 3NELA 4JI3L 3CCEA 2JEBI 4PZ7A 1VQKA 4LF9L 2B63H 4LF4L 2UXBL 2Q2IA 4EQ5A 3PO2H 4JI7Q 2K14A 2K5NA 1TWHH 5IE8A 1YITA 1KL9A 2CWAA 1VQMA 2PI2E 1Y1WG 4BY7H 1HR0W 3CXCA 4A3CH 2OQ0A 4IOAA 1GD7A 1WOCA 4DPGA 1XNRL 4UP7A 4KI0A 1GO3E 1IBML 3U4ZA 5IP9H 1B7YB 4BBRH 1UEBA 3OTOL 1X3EA 3K80C 4POGA 2YTXA 1XTDA 4A93H 4P74A 1N34Q 3BZKA 1MIUA 3E9HA 3K7UC 2A1AA 3H0GG 3FKIH 3OYYA 1KRTA 3RN5A 3T1YQ 2E2HH 3GTPH 1EOVA 4R4CA 3M7NA 1KXLA 5GAGC 3L2PA 1VQFA 1QVGA 2BA0A 4IPHA 4GKKL 4MZ9A 3S16H 4OWTB 3HOZG 3FP9A 1YI2A 4LNQA 5C4XG 3M4PA 4EX5A 1VQ8A 4PZ6A 2BA1A 1OTCA 1UWVA 2VQEQ 4BXXH 3CCLA 3RR5A 3L7ZC 4R4TA 2PMZE 1QZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CCZ A;  1YZ6 A;  1XPR A;  2XTI A;  1U5K A;  1AE3 A;  3KDF B;  3LGJ A;  4YCV A;  2BH2 A;  4XIG S;  4A76 A;  2V1C C;  3GD7 A;  3EIV A;  2VW9 A;  3PCO B;  4AQY L;  1UE7 A;  1FJG L;  3I55 A;  3K8A A;  5DLQ E;  3J81 i;  1EFW A;  4JI8 L;  4A3E H;  2QGQ A;  4LWC A;  3TRE A;  4DR1 L;  1J5E Q;  4JI4 L;  2I5L X;  1NMF A;  1QVC A;  2WP8 J;  4QL5 A;  4UP9 A;  2VQF L;  3CCM A;  4DV4 Q;  3PO2 G;  1PH9 A;  1RIP A;  2UU9 L;  1L1O C;  3Q8D A;  2AHO B;  2VY3 A;  4AH6 A;  1C7Y A;  1ASY A;  4C3J H;  1IBL Q;  2YU9 H;  1CKN B;  4BY7 G;  4P71 A;  3A0J A;  4R1J A;  4GOP A;  4A75 A;  4A3C G;  2R93 H;  3AYH B;  4JBK A;  2R7D A;  1PHJ A;  2K5H A;  1N36 Q;  4A3I H;  5HY6 A;  4OX9 Q;  4DR4 Q;  3CCV A;  3TRZ A;  4DUZ Q;  4LF6 Q;  4K0K L;  1YEZ A;  3UDX A;  2YV5 A;  5IP9 G;  5LMN Q;  1IYJ B;  4BBR G;  1K73 C;  3RZO H;  4A3B H;  4DR7 L;  5FLM H;  4RG1 A;  1D7Q A;  4A93 G;  5JEA J;  4X62 Q;  3ER0 A;  5C44 H;  1SRO A;  1I5F A;  3E0E A;  1UE5 A;  1KD1 C;  2FXQ A;  4POF A;  1YVC A;  4LUO A;  1I94 L;  2UUA L;  2UUB Q;  1NBW A;  3FKI G;  1XNQ Q;  2CWP A;  3SGI A;  5IYB H;  4JYA Q;  3RN2 A;  1VQC A;  4YCW A;  4JI2 Q;  4DUY L;  4WJ3 M;  1SN8 A;  3HOX H;  1HH2 P;  4GLV B;  4OXP A;  3KLW A;  2A19 A;  4DV3 Q;  1OXX K;  4HJA A;  4GOP C;  3W1B A;  2HHH Q;  3HOY H;  5JEA G;  3H3V I;  4B3R L;  1G6P A;  4WJ4 A;  5C4J H;  3UDF A;  4GLX A;  1BBW A;  1XPU A;  3S2H H;  1EWI A;  4JBW A;  4BXX G;  1HNW L;  1WJJ A;  2K75 A;  1E7Z A;  3HKS A;  2K4K A;  4YY3 L;  4YCU A;  3U58 A;  4LFA L;  3CF5 A;  4BA2 I;  3HKZ E;  3L0O A;  4HJ8 A;  2Z6K A;  3KFU A;  1VQN A;  2OCE A;  4MNO A;  3S2D H;  1XMO L;  1PYS B;  4GLA C;  4GN4 B;  4XTC S;  4DV6 L;  1IBK L;  2RHQ B;  2JQO A;  4KHP Q;  4A3E G;  1HNX L;  4JCV E;  2R7Z H;  3A5U A;  4DV5 L;  1R9T H;  4P73 A;  4P75 A;  1CSQ A;  3AFQ A;  1PVO A;  2F4V L;  1KQS A;  1HR0 Q;  1SLJ A;  4GOP B;  2MFI A;  4DV0 L;  3PV0 A;  1M90 C;  3PSI A;  2NN6 I;  2R6G A;  1N33 Q;  2JE6 I;  1E1O A;  2ALY B;  3PO3 H;  2R93 G;  4C2M H;  4LFB Q;  2OQK A;  2IY5 B;  4IJL A;  4MTN A;  2ZTC A;  2PI2 A;  4A3I G;  4JI0 Q;  4OWX B;  3CCS A;  2B29 A;  1GM5 A;  2DGY A;  2JEA I;  5GQO A;  4IPG A;  3KJO A;  4DAY B;  4GKJ L;  1YHA A;  2D62 A;  4YHH Q;  5ELN A;  2Z6K C;  4A3B G;  4X65 L;  1J6Q A;  5FLM G;  4Y7N H;  1YHB A;  3CME A;  2AWN A;  3S1M H;  2WAQ G;  5C44 G;  1VQ5 A;  2IHE A;  2KHI A;  4APV A;  1B70 B;  2QA4 A;  3KDF A;  5AJ3 L;  4B3M Q;  5J3B A;  5IYB G;  1NY4 A;  1VQA A;  2UXC Q;  3J81 c;  3CQZ H;  2HQL A;  2ZTD A;  3I56 A;  1VQE A;  3HOX G;  1A8V A;  3M4Q A;  4JI7 L;  1EQQ A;  3HOU H;  1C9O A;  3HOY G;  3M3Y H;  3UE1 A;  1VQ9 A;  4DV7 Q;  2WB1 G;  4QGU A;  4HIK A;  4A3F H;  2ATW A;  3KF6 B;  1BKB A;  3RNU A;  2JA7 H;  1CKN A;  1CKM A;  3AQQ A;  3KYH C;  1X3F A;  1Q1B A;  1PH5 A;  4BBS H;  1NE3 A;  2B63 G;  2NN6 G;  3ERS X;  5LMU Q;  1VQ7 A;  3D0F A;  3OW2 A;  3NBH B;  5IYC H;  3S1Q H;  4AIM A;  2D0O A;  2E2J H;  2OWO A;  4IPC A;  2JA5 H;  4JI1 L;  1X56 A;  2HT1 A;  2R7Z G;  4L5T A;  1N34 L;  4LF8 Q;  1PH8 A;  3T1Y L;  4A3D H;  1TXY A;  1E3P A;  4O0A A;  3S1N H;  2H5X A;  4A3L H;  1VQI A;  1EYG A;  1L1O A;  3T1H L;  2IT1 A;  3PO3 G;  3PUW A;  2Q2H A;  2E8G A;  3ULL A;  2ZM6 Q;  4HIO A;  1WI5 A;  2Y0S G;  2L15 A;  1Q46 A;  1I6H H;  1QZG A;  2VZA A;  3E9I A;  3CP0 A;  2NVT H;  3TS0 A;  4KLK A;  2HIV A;  2VQE L;  2D0P A;  1FL0 A;  4LF7 L;  1JB7 A;  2VS1 A;  1EIY B;  4B3S Q;  1QVF A;  2DUD A;  3TS2 A;  4DR5 Q;  5C3E H;  5IY0 A;  2MNA A;  4DR2 Q;  4OON A;  4KHZ A;  4IO9 A;  1JMC A;  2JA6 H;  1FVI A;  5K36 G;  1JJC B;  1YJN A;  2WFW A;  3HOZ H;  1J5E L;  1P16 A;  2MQH A;  3A74 A;  2C35 B;  4OO1 I;  2YTV A;  3EBE A;  3PUZ A;  3UDG A;  1YJW A;  4DV4 L;  2NVQ H;  3HOU G;  1AH9 A;  4NXM L;  4A3J H;  1LYL A;  4AYB E;  1PA6 A;  4DR6 Q;  1IBL L;  3GTK H;  1S72 A;  1PH6 A;  1WFQ A;  1X54 A;  4A3F G;  2JJQ A;  3UDI A;  2JA7 G;  4JI5 Q;  3K7A H;  4DK6 C;  3MEF A;  2KEN A;  4HJ9 A;  2I5H A;  1N36 L;  1OXT A;  1BBU A;  5IP7 H;  4OX9 L;  4BBS G;  1Q8K A;  1SE8 A;  4DR4 L;  1NJI C;  1GVP A;  2E5L Q;  4LF6 L;  1K8G A;  4FDB A;  5IYC G;  5LMN L;  1GKH A;  3F2D A;  3S14 H;  2Q2U A;  2NZO A;  1Q86 C;  5M3M H;  4X62 L;  1YHQ A;  1SR3 A;  1HZA A;  4X66 Q;  1E22 A;  2JA5 G;  5JJL A;  2UUB L;  1L1O B;  2HIX A;  5IWA Q;  2IX1 A;  4A3D G;  1Z47 A;  1XNQ L;  1HZ9 A;  1LTL A;  1OXV A;  2F3I A;  1LM0 A;  4A3L G;  1SMX A;  4JYA L;  2CFM A;  4LUV A;  2B3G A;  3GTM H;  3J7Z C;  3PIO A;  4JI2 L;  4PG3 A;  4YWL A;  5E7N A;  5GAD C;  4J15 A;  4K0K Q;  5EAY A;  1I3Q H;  3DLL A;  1EIF A;  1V9P A;  2EIF A;  4DV3 L;  5GAE C;  2HHH L;  4IOC A;  4NXN Q;  4DR7 Q;  1QUQ B;  1X6O A;  3K81 C;  1MKH A;  4UPA A;  4OO1 G;  3CPW A;  3ZJY C;  5M5W H;  4JV5 Q;  3KF6 A;  2IHF A;  3G6E A;  2UUC Q;  1U0L A;  2LSS A;  3I4N H;  5JJK A;  4L5R C;  1V43 A;  2KCT A;  1V1Q A;  2KCM A;  3GO5 A;  5C3E G;  3M85 A;  3ULJ A;  4DV2 Q;  2GN5 A;  1HZB A;  5BR8 Q;  1K8A C;  3CCJ A;  4GN3 B;  2JA6 G;  2ID0 A;  3M9B A;  1L2F A;  5H1S E;  1JE5 A;  4KHP L;  1G29 1;  1UE1 A;  3JAM i;  3KF8 B;  2QEX A;  2RF4 A;  2UXD Q;  4B3T Q;  2JA9 A;  1HR0 L;  4PMW A;  4X64 Q;  4A3J G;  4A3K H;  1K3R A;  4DR3 Q;  1XMQ Q;  1PV4 A;  2ES2 A;  4LFA Q;  2I0Q A;  1N33 L;  4R4Q A;  4NB3 A;  1N9W A;  3B6Y A;  1OXU A;  4LFB L;  3F2C A;  4LF5 L;  4QY7 A;  4YWK A;  5IP7 G;  4JI0 L;  3DM3 A;  5M5Y H;  3S1R H;  1Z9F A;  3F2B A;  3BZC A;  4GS3 A;  2MO0 A;  4YHH L;  1VQP A;  4OWW B;  1HNZ Q;  2F4V Q;  4TQU S;  5M3M G;  4DV0 Q;  4HIM A;  4JI6 Q;  4QQB X;  1N32 Q;  1T9H A;  3HOV H;  4DKA C;  4QIW E;  2EQS A;  4B3M L;  2BH8 A;  1VS0 A;  3STB D;  4DV1 Q;  1PH7 A;  2UXC L;  2ZJQ A;  3AFP A;  4BY1 H;  2NVY H;  2OTJ A;  2VUM H;  3I4M H;  3G4S A;  1VQB A;  3HOW H;  1H95 A;  2K50 A;  5C0X I;  3CW2 C;  1FGU A;  1XJV A;  5M5X H;  1YNX A;  2VNU D;  4DV7 L;  3UE0 A;  2OTL A;  4QJF A;  3CC4 A;  1K0R A;  3CC2 A;  4LFC Q;  4O2D A;  3STB C;  3M4O H;  2YYZ A;  4JI3 Q;  3I4N G;  3TQY A;  4LF9 Q;  1C0A A;  4LF4 Q;  2UXB Q;  2AWO A;  5LMU L;  5M3F H;  4GNX A;  4DAM A;  2R7F A;  1VQD A;  4ALP A;  1JJ2 A;  1SRU A;  4BA1 I;  1E24 A;  1P8L A;  4C3I H;  2CKZ B;  2ZJR A;  5GRO A;  1K9M C;  2LXK A;  4LW1 A;  3HKZ G;  2N3S A;  1XNR Q;  3CC7 A;  4R4O A;  1TWG H;  1PH2 A;  4LF8 L;  3I4O A;  4HJ5 A;  1WCM H;  4UP8 A;  3J80 i;  4A3K G;  1IBM Q;  5C0X J;  4JBM A;  2N78 A;  2RCN A;  5FJ8 H;  2Z0S A;  4P72 A;  3OTO Q;  3PF4 A;  3PIP A;  2ZM6 L;  4JOI A;  3RLF A;  1A0I A;  3BU2 A;  2RHS B;  3NEN A;  2K5V A;  4A3M H;  2XGT A;  4JI1 Q;  1VQJ A;  4JBJ A;  4GN5 A;  1QUQ A;  3J81 j;  3CMA A;  1X55 A;  1Q12 A;  4GNX C;  1M1K C;  1HZC A;  1E1T A;  3CAM A;  5C0X G;  4B3S L;  3GTQ H;  4DR5 L;  1Q7Y C;  2AMC B;  3HOV G;  1W2B A;  1VQ6 A;  5IYD H;  3T1H Q;  4DR2 L;  4GKK Q;  1W3S A;  1Y1V H;  4ME3 A;  4L5S A;  1YBY A;  3S24 A;  4BY1 G;  2VUM G;  1G51 A;  2Q2T A;  2PQA A;  3I4M G;  3HOW G;  1JJG A;  3CPF A;  1TWC H;  1VQG A;  3JAM c;  1VQ4 A;  2GVA A;  4YWM A;  2R92 H;  3S17 H;  4JOI C;  1B8A A;  1YJ9 A;  4DR6 L;  3G71 A;  3KOJ A;  4IFD I;  1O7I A;  2PNH A;  4R4I A;  1FJG Q;  4AQY Q;  2IX0 A;  2A8V A;  3PUY A;  3I7F A;  4GNX B;  3PUV A;  4JI5 L;  2CQO A;  3GTJ H;  1KIX A;  3PUX A;  2N49 A;  1Q1E A;  4JI8 Q;  4DUZ L;  4DR1 Q;  2NZH A;  2NVX H;  4JI4 Q;  4LF7 Q;  2ZJP A;  2VQF Q;  1VCI A;  5M3F G;  2E5L L;  3GDE A;  1YIJ A;  3FHW A;  4JG2 A;  2UU9 Q;  3WWV A;  1X3G A;  3G48 A;  3CCQ A;  2I5M X;  4NXM Q;  3RLO A;  2E2I H;  4X66 L;  3NEM A;  1PH1 A;  4C3H H;  4NPS A;  4LUZ A;  1KHI A;  2JK8 A;  2N8N A;  3U50 C;  1HJP A;  5IWA L;  4HJ7 A;  2MO1 A;  1TWF H;  2WAQ E;  1WCM G;  3CD6 A;  3ICE A;  3CCR A;  4A3G H;  1VQL A;  5FJ8 G;  4L5Q A;  2JA8 H;  4JC0 A;  4IFD J;  4HID A;  2LXJ A;  3VDY A;  3GTO H;  1S3O A;  4NXN L;  3RLN A;  2UUA Q;  1Q81 C;  3I2Z A;  4A3M G;  1I94 Q;  3H3V H;  2KBN A;  3GTG H;  1SFO H;  4JV5 L;  1NMG A;  2WB1 E;  2UUC L;  3H15 A;  1UE6 A;  4DUY Q;  1XPO A;  1X9N A;  5JJI A;  1JT8 A;  2EXD A;  4IFD G;  1KRS A;  2VL6 A;  5IYD G;  3J7A 5;  2GVB A;  1EQR A;  1KAW A;  4TVA B;  1IXR A;  2PQA B;  3U4V A;  5BR8 L;  1Y1V G;  4DV2 L;  3TEH B;  4UY8 C;  4B3R Q;  1WYD A;  1Y1W H;  1S40 A;  3MXN B;  1N8R C;  1HNW Q;  3EN2 A;  3K0X A;  1PH4 A;  1Y14 B;  5GAH C;  1ASZ A;  2UXD L;  2AKW B;  4IPD A;  2R92 G;  3JC6 6;  4B3T L;  5HGQ A;  1EUJ A;  4YY3 Q;  4X64 L;  3BJU A;  3J80 c;  4DR3 L;  1XMQ L;  1DGS A;  4X6A H;  4PZ8 A;  1I50 H;  1CKO A;  3PGZ A;  1RL2 A;  3W5O A;  2KHJ A;  1VQO A;  1XMO Q;  4DV6 Q;  1IBK Q;  1HNX Q;  1A62 A;  1MJC A;  1D8L A;  5FLX c;  1VQH A;  5LMN W;  4AYB G;  4DV5 Q;  2YTY A;  4H02 A;  1KC8 C;  4IJH A;  3H0G H;  2Y0S E;  3W1G A;  1A63 A;  1PFS A;  4RMF A;  1AE2 A;  1HNZ L;  1IL2 A;  1BVS A;  1MJE A;  4JI6 L;  3AEV A;  1N32 L;  2ASB A;  3PF5 A;  2F52 A;  1X65 A;  3CCU A;  3A5Z B;  1L0W A;  1Q82 C;  3F8T A;  3HFZ B;  1PYB A;  2ZTE A;  4DV1 L;  1CUK A;  4DK3 C;  4LF5 Q;  3GTL H;  3F1Z A;  1IZ6 A;  5C4X H;  5IT9 c;  4A3G G;  4GKJ Q;  1OXS C;  2JA8 G;  4X65 Q;  3ULP A;  4Y52 H;  4A4I A;  2K52 A;  3IRB A;  4DNI A;  3RZD H;  1K83 H;  1LUZ A;  3S15 H;  1PH3 A;  1CSP A;  3D31 A;  5AJ3 Q;  1NTG A;  3KJP A;  1TWA H;  4LFC L;  5ELO A;  3NEL A;  4JI3 L;  3CCE A;  2JEB I;  4PZ7 A;  1VQK A;  4LF9 L;  2B63 H;  4LF4 L;  2UXB L;  2Q2I A;  4EQ5 A;  3PO2 H;  4JI7 Q;  2K14 A;  2K5N A;  1TWH H;  5IE8 A;  1YIT A;  1KL9 A;  2CWA A;  1VQM A;  2PI2 E;  1Y1W G;  4BY7 H;  1HR0 W;  3CXC A;  4A3C H;  2OQ0 A;  4IOA A;  1GD7 A;  1WOC A;  4DPG A;  1XNR L;  4UP7 A;  4KI0 A;  1GO3 E;  1IBM L;  3U4Z A;  5IP9 H;  1B7Y B;  4BBR H;  1UEB A;  3OTO L;  1X3E A;  3K80 C;  4POG A;  2YTX A;  1XTD A;  4A93 H;  4P74 A;  1N34 Q;  3BZK A;  1MIU A;  3E9H A;  3K7U C;  2A1A A;  3H0G G;  3FKI H;  3OYY A;  1KRT A;  3RN5 A;  3T1Y Q;  2E2H H;  3GTP H;  1EOV A;  4R4C A;  3M7N A;  1KXL A;  5GAG C;  3L2P A;  1VQF A;  1QVG A;  2BA0 A;  4IPH A;  4GKK L;  4MZ9 A;  3S16 H;  4OWT B;  3HOZ G;  3FP9 A;  1YI2 A;  4LNQ A;  5C4X G;  3M4P A;  4EX5 A;  1VQ8 A;  4PZ6 A;  2BA1 A;  1OTC A;  1UWV A;  2VQE Q;  4BXX H;  3CCL A;  3RR5 A;  3L7Z C;  4R4T A;  2PMZ E;  1QZH A; 
#chains in the Genus database with same CATH topology
 5EKI A;  1YZ6 A;  1XPR A;  3NWT A;  2EYJ A;  3QJY A;  1CZG A;  4A76 A;  4AQY L;  3PCO B;  4QMG A;  1UE7 A;  1J5E Q;  2QGQ A;  1QVC A;  2D2C C;  3CCM A;  4DV4 Q;  3PO2 G;  1GHK A;  3TP6 A;  2ZXP A;  3Q8D A;  5C6A A;  2K33 A;  5JJZ A;  1CKN B;  1W6K A;  4GOP A;  4R1J A;  2FFK B;  3NK9 A;  3AYH B;  2F0I A;  1JQY D;  2K5H A;  4A3I H;  1SMY D;  4A3E B;  4L8J A;  2CVR A;  1BO0 A;  3TRZ A;  5DM6 3;  3UDX A;  1VMP A;  1K73 C;  4I7A A;  4A3B H;  1QNK A;  1U4P A;  2B2V A;  3GQB A;  4A93 G;  5C44 H;  1I5F A;  2UUA L;  1UE5 A;  3FKI G;  4M1U B;  2WII B;  3P7J A;  2K5W A;  1I4P A;  3X3N A;  1BUV T;  3KLW A;  4DV3 Q;  4GOP C;  4HJA A;  4CKC A;  3W1B A;  2EYM A;  4B3R L;  5KNB A;  1ZYR C;  4C1N I;  1XPU A;  1R4P B;  5I4D A;  1EIG A;  1WJJ A;  1GXD C;  2ICI A;  3VR3 A;  2K4K A;  1BBX C;  1PYW D;  4LFA L;  3CF5 A;  3HOX B;  3HKZ E;  1VF7 A;  1VQN A;  5LL6 X;  3SVM A;  3OMG A;  2N55 A;  4CJ0 B;  1IBK L;  1X3Q A;  5C4J B;  1SBB B;  4WOR A;  1LTA D;  3H6M A;  1U9R A;  1ZXT A;  2R7Z H;  4P73 A;  1HR0 Q;  4ZCK A;  4GOP B;  2MFI A;  2CW0 D;  4C3J G;  5HUR A;  3PSI A;  2NN6 I;  2R6G A;  3V96 A;  1MHW C;  1WD0 A;  3CRK C;  2ALY B;  3N6R A;  4C2M H;  2X69 A;  2OQK A;  3VA7 A;  1JE4 A;  2B29 A;  1GM5 A;  2DGY A;  3CRL C;  2JEA I;  4IPG A;  4ZKB B;  2MHV A;  2D62 A;  4YHH Q;  1DZ1 A;  4CGY B;  1EZ8 A;  2HUG A;  4Y7N H;  1SNO A;  2AWN A;  2KHI A;  4IUN A;  2QA4 A;  5AJ3 L;  4J1M A;  1S5D D;  3K6O A;  4Q0F A;  5JVH 3;  2KQ3 A;  1A8V A;  3O13 A;  3M4Y A;  3M3Y H;  3HOY G;  3OW7 A;  2NBF A;  1EY5 A;  4NKL A;  3OHX C;  1FD7 D;  4DV7 Q;  2WB1 G;  3QB3 A;  1JOR A;  2JA7 H;  3AQQ A;  2O5I C;  4ULL A;  3KYH C;  5IOD A;  4RGN A;  4BBS H;  1NE3 A;  3OWF A;  5LMU Q;  2LY7 A;  3KLR A;  4J6H A;  2FHT A;  4A3F B;  1B3A A;  2PQE A;  3S1N H;  4MIU A;  1F2M A;  1EYA A;  5EBC A;  4NDX A;  2IT1 A;  3PO3 G;  3S1Q B;  4K2L A;  3VYS A;  2E8G A;  3Q24 A;  3MEH A;  5KND A;  1KDC A;  4KY6 A;  2VZA A;  4QF4 A;  5EGT A;  2EY6 A;  1WTO A;  1JB7 A;  3MFY A;  2F03 A;  4B3S Q;  1K3B C;  3NPP A;  4DR2 Q;  4KHZ A;  2F0P A;  1PMR A;  4C1N K;  5K36 G;  1YJN A;  3J80 E;  3A74 A;  4OO1 I;  1YJW A;  3UDG A;  3HOU G;  4U67 3;  3A8J E;  3IFD A;  4NXM L;  4AYB E;  2IW3 A;  1S72 A;  1X54 A;  2AQ1 B;  1QG7 A;  1HFN A;  3MEF A;  3R2T A;  2KEN A;  3C1F A;  3VR4 A;  1OXT A;  4OX9 L;  2DNC A;  1NJI C;  1AFP A;  2NVQ B;  1LT3 D;  2HQE A;  3F2D A;  2Q2U A;  3K57 A;  1WTW A;  1Q86 C;  5M3M H;  1YHQ A;  1G8Z D;  3MXG A;  2JA5 G;  5JJL A;  4CJ2 C;  2OF1 A;  1PRT D;  4A3D G;  1XNQ L;  1LTL A;  1OXV A;  3T51 B;  1LM0 A;  1SMX A;  4LUV A;  3PIO A;  2IPK D;  4PG3 A;  5E7N A;  5GAD C;  1EIF A;  2EIF A;  5KNC A;  4IOC A;  1STH A;  4UPA A;  3ZJY C;  3KF6 A;  4L5R C;  1V43 A;  5L37 A;  2KCT A;  4G7H C;  1Y8O B;  2KCM A;  3KLS X;  1ML0 D;  5BR8 Q;  4IQZ A;  4DNT B;  2ID0 A;  5M5W B;  4V0B A;  4IUP A;  1WTH A;  4B3T Q;  4PMW A;  4X64 Q;  1K3R A;  2I0Q A;  1N33 L;  4NB3 A;  1PLF A;  1OXU A;  1AEX A;  1QE6 A;  3DM3 A;  1BF4 A;  3S1R H;  1Z9F A;  1VQP A;  4A3K B;  1GUN A;  4TQU S;  4QQB X;  1U4R A;  4JI6 Q;  3T4A C;  2L5T A;  3JAM E;  2AUJ D;  4B3M L;  1IHZ A;  2KCN A;  3I4M H;  1VQB A;  5FO9 B;  3HOW H;  2JN4 A;  4HMJ A;  2F0W A;  3CW2 C;  1CI3 M;  2B2U A;  1YNX A;  2OTL A;  3CC4 A;  1C4Q A;  2B8G A;  4O42 A;  4LFC Q;  4K5V A;  2VUM B;  4DAM A;  1YNJ D;  1VQD A;  5CYU A;  4ALP A;  4BA1 I;  5M5X B;  1E24 A;  2LFN A;  3D4W A;  3MXU A;  3VR2 A;  4DN4 M;  4LW1 A;  3M4O B;  3HKZ G;  3DWQ A;  4FP5 D;  3CC7 A;  1I4H A;  4R4O A;  5EKK A;  2JXM B;  5C0X J;  4JBM A;  2Z0S A;  4RFB A;  3PIP A;  4JOI A;  5J1Z A;  1F9R A;  4C3I B;  1LTI D;  4A3M H;  4ID6 A;  1SNQ A;  1TWG B;  3SK4 A;  1ESR A;  3CAM A;  5C0X G;  2X6L A;  3U9O A;  1D2B A;  1VQ6 A;  5IYD H;  2GA4 B;  1SJE D;  4ME3 A;  1J9O A;  2MGS A;  4BY1 G;  1EU3 A;  4HTH A;  2F0M A;  1JJG A;  1TWC H;  2Q8I B;  1CA5 A;  2DJG C;  1HUM A;  1E2W A;  3KF8 A;  3MXN A;  4JOI C;  3BDC A;  4DR6 L;  4LAA A;  1FJG Q;  2IX0 A;  2CQO A;  4K2K A;  4Z9C B;  3PUX A;  1D5X C;  4JI4 Q;  2IX3 A;  4FNF A;  1JWS D;  3RMH A;  5M3F G;  2E5L L;  1YIJ A;  3X3M A;  1X3G A;  1LLR D;  1HFG A;  4KD3 A;  1S5B D;  3BDO A;  4C3H H;  1PTO C;  2RDH A;  3SK8 A;  3U50 C;  2WAQ E;  2FIN B;  1WCM G;  3H3V C;  3CCR A;  1JOO A;  5FJ8 G;  4JC0 A;  1B1Z A;  5I6Y A;  4HID A;  3VDY A;  1DD2 A;  3GTO H;  1S3O A;  2EZV A;  3RLN A;  2CH4 W;  1O7L A;  3IKJ A;  4K6D A;  1I94 Q;  1CFM A;  1TWF B;  4JV5 L;  2B2Y C;  1DOL A;  4RHR A;  2UUC L;  1UE6 A;  5JJI A;  1PTO B;  1KAW A;  1TKW B;  1AZP A;  1Y1V G;  4UY8 C;  2BCO A;  1DM0 B;  1Y1W H;  3MXN B;  3QOJ A;  1HNW Q;  2SDF A;  4HSP A;  3K0X A;  2AKW B;  4YY3 Q;  5TSS A;  4DR3 L;  2KHJ A;  4K8I A;  5BN4 A;  4DV6 Q;  1HNX Q;  4K8J A;  2L0C A;  1D8L A;  5FLX c;  3ND9 A;  4AYB G;  2YTY A;  3A7L A;  4IJH A;  3D6C A;  2Y0S E;  1Y8N B;  1STY A;  1OO9 B;  1I50 B;  1N32 L;  3PMF A;  4QCL A;  2ENB A;  2A5H A;  4LF5 Q;  1CUK A;  1XX8 A;  2RDG A;  4A3G G;  3F1Z A;  4GKJ Q;  5JOB A;  1A3T A;  2FJ2 A;  4A4I A;  2K52 A;  3TN2 A;  3RZD H;  1K83 H;  3I4L A;  2A69 D;  5JVG 3;  1SYG A;  2XSC A;  3HOZ B;  3GTL B;  3NEL A;  4Q5V A;  5J39 A;  5M9O A;  5HGT A;  1VQK A;  1JWU D;  4LF9 L;  4EQ5 A;  2K14 A;  1TWH H;  4F8M A;  1KL9 A;  2CWA A;  3S15 B;  2QIL A;  1HR0 W;  1GUO A;  4A3C H;  4IOA A;  1XNR L;  4DPG A;  2MP1 A;  4KI0 A;  4OIK A;  3PO2 B;  1PFN A;  3NTH A;  5DEH A;  3SEB A;  3OTO L;  1X3E A;  5C4Z A;  1QB5 D;  1STE A;  1N34 Q;  3OMC A;  2E2H H;  3H0G G;  1TT2 A;  3M7G A;  1EOV A;  1EWC A;  4QUF A;  2EYL A;  4M8A A;  4PQX A;  3IL8 A;  4WFN 3;  4GKK L;  4A93 B;  4EQN A;  5C4X G;  3M4P A;  4EX5 A;  3FKI B;  3GTP B;  4RGO S;  4BXX H;  1RD9 D;  1SYB A;  1CK1 A;  2M9V A;  1MD2 D;  3KDF B;  3SR1 A;  2BH2 A;  1RDP D;  2V1C C;  3S16 B;  4UAI A;  3I55 A;  3K8A A;  1EFW A;  4JI8 L;  2E74 C;  4DR1 L;  4A3E H;  2B63 G;  1B9N A;  2WP8 J;  2VQF L;  2QEJ C;  1L1O C;  4XQQ A;  4BY7 G;  2VB2 X;  4DGZ A;  3A0J A;  2M00 A;  4F87 A;  2WIN B;  1PHJ A;  1N36 Q;  5CBE E;  5HY6 A;  4DR4 Q;  3CCV A;  4DUZ Q;  4LF6 Q;  4KKU A;  2YV5 A;  5IP9 G;  2A73 B;  3J81 E;  4C3J B;  1CZW A;  1I6V C;  4X62 Q;  3ER0 A;  1SRO A;  3EA6 A;  4ABN A;  4LUO A;  1NBW A;  2CWP A;  2PNR C;  5A35 A;  4JYA Q;  2DN8 A;  4R8I A;  4DUY L;  1DOK A;  4ZRZ A;  1TS2 A;  1SN8 A;  3HOX H;  1A3V A;  1HH2 P;  3RZO B;  2FMM A;  2A19 A;  2F3W A;  2HHH Q;  1TQO A;  2EJF C;  5C4J H;  1KDB A;  1LV9 A;  4DK0 A;  1E7Z A;  3FPU B;  3FPP A;  4EQO A;  4BA2 I;  1SSO A;  3E5S A;  2XWJ B;  3L0O A;  2NN6 H;  2Z6K A;  2RQX A;  4MNO A;  3HOY B;  1XMO L;  1GUG A;  4GLA C;  4GN4 B;  5IGD A;  5G3L F;  2JQO A;  2F0H A;  2WB1 B;  4CHT B;  4DNR B;  3S2H B;  2IWH A;  1SYF A;  2X6G A;  4P75 A;  2QDB A;  3AFQ A;  1GOZ A;  3E3X A;  1M90 C;  1UUP A;  2JE6 I;  1JIC A;  1RCV D;  3S2D B;  1IW7 C;  1E1O A;  2EY1 A;  2R93 G;  4JI0 Q;  4OWX B;  2EJM A;  3EFX D;  3KJO A;  2E2D C;  2Z6K C;  1C8C A;  4X65 L;  5FLM G;  3CME A;  2KHS A;  2WAQ G;  4IUU A;  1VQ5 A;  3C2P A;  3PO3 B;  3CU7 A;  2L55 A;  5J3B A;  4KN7 C;  5IYB G;  1NY4 A;  4U68 A;  2HQL A;  2ZTD A;  4CDE C;  3ND8 A;  1STB A;  3HRZ C;  5J22 A;  1C9O A;  1Z7T A;  5F2D A;  2BE5 C;  2A6E C;  3H94 A;  1HTP A;  3R93 A;  1STA A;  2ATW A;  4A3F H;  3W3A A;  1S5F D;  3RNU A;  1CKN A;  1CKM A;  3CQZ B;  1BOS A;  3ERS X;  1VQ7 A;  3HOU B;  3OW2 A;  5IYC H;  3S1Q H;  4DU9 A;  2M2L A;  2D0O A;  4IPC A;  5A2Q L;  1DJR D;  2HT1 A;  4ME5 A;  4LF8 Q;  1PH8 A;  3T1Y L;  3AMU A;  4ZYS A;  4O0A A;  4A3L H;  1MGS A;  4EGV A;  3BYY B;  4L6T B;  3ULL A;  2E2J B;  1H9M A;  2Y0S G;  2JA5 B;  1TS3 A;  1QZG A;  4OO1 H;  3TS0 A;  5E1F A;  1D5Z C;  4KLK A;  3J7Y W;  4A3D B;  1VDZ A;  2VS1 A;  2EPB A;  1QVF A;  4XXE A;  3TS2 A;  3ERO A;  2RA4 A;  5FKA C;  2K04 A;  5IY0 A;  4OON A;  5ELC A;  1I6H B;  2WFW A;  1J5E L;  2NVT B;  2MQH A;  1KTK A;  3EBE A;  2NVQ H;  1LT4 D;  4DV4 L;  3N52 A;  1MBY A;  1EIH A;  5EQ0 A;  1O7Y A;  3D4D A;  2PO4 A;  5IGB A;  4FXD A;  1K28 A;  2SOB A;  1PH6 A;  4JI5 Q;  4DK6 C;  4HJ9 A;  5IP7 H;  4B08 A;  1PTO D;  1EY0 A;  1BCP C;  2PCF B;  3DM1 A;  1K8G A;  1ICW A;  1GKH A;  4KN4 C;  2NZO A;  4DA2 A;  1A3U A;  3AB9 A;  2N88 A;  5IWA Q;  2IX1 A;  1Z47 A;  1HZ9 A;  4KD4 A;  4NW2 A;  2VXW A;  2CFM A;  4PMB A;  3J7Z C;  4FXK C;  4J15 A;  1V9P A;  4DV3 L;  1EL0 A;  4NXN Q;  3K81 C;  4DAP A;  4JPB W;  1BCP B;  4IUR A;  3CPW A;  1G2T A;  5M5W H;  1WTP A;  3HEJ A;  4HN7 A;  2LSS A;  3GTM B;  5NUC A;  1V1Q A;  5C3E G;  3M85 A;  1I3Q B;  2EYF A;  3ULJ A;  5KYI A;  2GN5 A;  1O7Z A;  2JA6 G;  1ICF B;  1WTX A;  4RWS C;  3V2T A;  2UXD Q;  2QEX A;  2RF4 A;  2PPB C;  5COY A;  5CV4 A;  1HR0 L;  1J8I A;  4A3J G;  1B2T A;  4A3K H;  1XMQ Q;  1YNN C;  4LFA Q;  3H09 A;  4QY7 A;  1IYU A;  1RTO A;  3OIQ A;  3HKZ B;  4IUQ A;  2B39 A;  1HCZ A;  4YHH L;  2BOS A;  3LWU A;  3OPO A;  4CKB A;  1HNZ Q;  2O2L D;  4HCS A;  4QIW E;  1VS0 A;  3AFP A;  2OTJ A;  2VUM H;  1H95 A;  3CHB D;  4XDX A;  5C0X I;  1SNM A;  4BWG B;  5M5X H;  4KKS A;  4DV7 L;  3UE0 A;  3C1E A;  3KBG A;  3STB C;  3M4O H;  3VYT A;  4JI3 Q;  4BY1 B;  3I4N G;  2XN9 C;  2NVY B;  3TQY A;  4G7Z C;  2Q8T A;  4LF4 Q;  2UXB Q;  5LMU L;  4K5X A;  4FF3 A;  4C3I H;  2CKZ B;  2D9U A;  2ZJR A;  2LKV A;  4RA8 A;  2N3S A;  3NP8 A;  1TWG H;  3I4O A;  3NTK A;  4HJ5 A;  2KUM A;  5KRU A;  1IBM Q;  5M3F B;  1X32 A;  3PF4 A;  3RLF A;  3QG1 A;  4B9X A;  1IKM A;  2CHB D;  2RHS B;  1I4G A;  2XGT A;  1PFB A;  3J81 j;  3CMA A;  2C9O A;  1X55 A;  1DOM A;  1WCM B;  2EVB A;  5JPM C;  1E1T A;  4B3S L;  4TRD A;  5EPJ A;  1Q7Y C;  3HOV G;  1W2B A;  1HQM C;  3DHQ A;  4DR2 L;  1JCK B;  1YBY A;  3BDL A;  1G51 A;  2HCC A;  2Q2T A;  3KK7 A;  4K5W A;  4IUT A;  3JAM c;  1ET9 A;  1LAB A;  4XYO A;  1MSH A;  2HD3 A;  4JW0 A;  1Y1V B;  3PUY A;  5D65 A;  1LTB D;  4LF7 Q;  1EQV A;  2NZH A;  3R2I A;  2QF7 A;  4CDF C;  1NAP A;  1A6X A;  1GHJ A;  4JG2 A;  2UU9 Q;  4ZK9 B;  1D6E C;  2L9H A;  1F2Y A;  2NB0 A;  1V8Q A;  4NXM Q;  3RLO A;  2BDO A;  1Y69 U;  3BS1 A;  3RUZ A;  3GTJ B;  1HJP A;  1TWF H;  2NVX B;  3CD6 A;  4AYB B;  4RKB A;  4L5Q A;  4IFD J;  2LXJ A;  1PTO H;  1DYQ A;  3H3V H;  1NUC A;  1H9J A;  2F0D A;  2E2I B;  1NMG A;  4A3G B;  1X9N A;  3I73 A;  2A68 D;  1E0B A;  2EXD A;  4IFD G;  2F0E A;  5BR8 L;  1A2T A;  3GTG B;  3EN2 A;  4OEM B;  1PH4 A;  1Y14 B;  1HUN A;  1SDF A;  4IPD A;  2R92 G;  3JC6 6;  4B3T L;  1EUJ A;  4X64 L;  1NNX A;  4NMZ A;  3GV6 A;  1DGS A;  3PQI A;  4X6A H;  4PZ8 A;  1EQT A;  1I50 H;  3PGZ A;  1RL2 A;  3SHL A;  1BNZ A;  2BDN A;  1DON A;  1A62 A;  2DY8 A;  3PIO 3;  4DV5 Q;  2AQ3 B;  5EKL A;  1VF5 C;  5D3I B;  2RSN A;  1PRT F;  1CQV A;  3K5M A;  2XRS D;  4JI6 L;  3VYR A;  1BXT A;  3MHB A;  1X65 A;  4KMU C;  3A5Z B;  1JC7 A;  1Q82 C;  1ESF A;  3F8T A;  3HFZ B;  2ZTE A;  3HOZ H;  3GTL H;  3KUP A;  5IT9 c;  3H0G B;  2JA8 G;  1LO5 D;  2L11 A;  4Y52 H;  4IZ8 A;  3IRB A;  3K0Y A;  4LMQ D;  1LUZ A;  1X3P A;  3S15 H;  2WKD A;  3P20 A;  2RVL A;  2PW5 A;  1PZI D;  3MTS A;  3KJP A;  4LFC L;  3D3R A;  1G6Z A;  2XRQ D;  4R9W A;  5C4X B;  3DWA A;  2OXP A;  2JEB I;  4PZ7 A;  3PO2 H;  4HR7 B;  4JI7 Q;  2K5N A;  4TKO B;  5JAV A;  3HP3 A;  1YIT A;  2PI2 E;  1F9Q A;  5E4W C;  1CQF A;  1PXU A;  3R8B A;  2RCF A;  1EEI D;  3CXC A;  1TWA B;  1WOC A;  2K03 A;  2K32 A;  4UP7 A;  2B63 B;  1GO3 E;  4OGQ C;  3U4Z A;  1B7Y B;  2KOL A;  1UEB A;  1WTQ A;  4POG A;  4ILW A;  1XTD A;  4A93 H;  4BY7 B;  1JB3 A;  1F9S A;  2JSO A;  3DUZ A;  1MIU A;  3K7U C;  3FKI H;  3RN5 A;  3GTP H;  5IOC A;  1KXL A;  5GAG C;  2EY5 A;  5C5M A;  1B3Q A;  2B2T C;  3FRP B;  3MA2 B;  1Q8I A;  2PZW A;  4IPH A;  3S16 H;  4OWT B;  2PZT A;  1C48 A;  5LL6 S;  2EJG C;  2BA1 A;  2VQE Q;  3CCL A;  1HA6 A;  3L7Z C;  4R4T A;  2PMZ E;  1QZH A;  2CCZ A;  2A6H C;  2PYK A;  2Z9H A;  2XTI A;  1U5K A;  1EYC A;  3MC0 B;  1SNP A;  4XIG S;  4OEL B;  5FK9 C;  1HTL D;  3GD7 A;  2VW9 A;  3FVQ A;  1FJG L;  1H9K A;  4H44 C;  5DLQ E;  3GV3 A;  3NQI A;  3MVV A;  3FDT A;  3TRE A;  3MFG A;  4JI4 L;  4QL5 A;  1NMF A;  2E75 C;  2B2Y A;  4X3T A;  1PH9 A;  2OT2 A;  4JK1 C;  3PIP 3;  2AHO B;  2VY3 A;  1BCP D;  4AH6 A;  3SK6 A;  4C3J H;  1IBL Q;  4P71 A;  4O1N A;  1SYE A;  4JBK A;  3MWY W;  3E0J A;  4DK1 A;  1O78 A;  4K0K L;  5LMN Q;  4BBR G;  3RZO H;  2YU9 B;  4DR7 L;  1EY9 A;  1D7Q A;  5BN5 A;  5JEA J;  3E0E A;  2R93 B;  4KJO A;  1ZYR D;  1YVC A;  4POF A;  1I94 L;  2UUB Q;  2F0G A;  5E4X A;  3SGI A;  4G57 A;  1T5X D;  3SXH A;  4YCW A;  4JI2 Q;  4WJ3 M;  1G91 A;  4OXP A;  1LTT D;  1H9R A;  1OXX K;  2JP1 A;  3HOY H;  5JEA G;  5IGF A;  3H3V I;  2WAQ B;  4XT1 B;  3UDF A;  1BBW A;  4GLX A;  3S2H H;  1HQR D;  3VYU A;  1HNW L;  2K75 A;  3HKS A;  1SE3 A;  4H13 C;  3NWS A;  2F0O A;  4YCU A;  4DXF A;  4YY3 L;  3U58 A;  4HJ8 A;  1ET6 A;  3KFU A;  1K0S A;  2OCE A;  3S2D H;  5I9O A;  1HRJ A;  4DV6 L;  4XTC S;  3BVZ A;  4QUC A;  4DXG A;  2RHQ B;  4KHP Q;  2CQA A;  1HNX L;  1KDA A;  2ZT9 C;  3A5U A;  3NBH A;  4BS9 A;  1CSQ A;  1GJX A;  1PVO A;  1V1P A;  2F4V L;  1SLJ A;  3OSO A;  1TS4 A;  4DV0 L;  1WVL A;  1SE2 A;  4KY7 A;  3PO3 H;  4LFB Q;  1SND A;  2EXZ A;  4IJL A;  4MTN A;  1IKL A;  4A3I G;  3K59 A;  3QWN A;  3TBI B;  4ZAI A;  1R9T B;  4B9W A;  4GKJ L;  2CW0 C;  5ELN A;  5KEE A;  2ICE C;  4A3B G;  2LS0 1;  2JYO A;  4X3S A;  5C44 G;  2IHE A;  4APV A;  1B70 B;  2L1B A;  3C3L A;  3KDF A;  2Y0S B;  2F0K A;  2EY2 A;  1VQA A;  2UXC Q;  5K36 H;  3J81 c;  3CQZ H;  3I56 A;  3NXW A;  3HOU H;  4F7X A;  3S1M B;  1VQ9 A;  4QGU A;  2K7V A;  3OWE B;  5ELE A;  4HIK A;  1NCV A;  4E6I A;  1PZK D;  1BKB A;  3QOL A;  2KEC A;  3SE0 A;  1X3F A;  1KAA A;  1PH5 A;  5CV5 A;  3NBH B;  1V1P B;  2E2J H;  4HED A;  1ENA A;  2JA5 H;  4JI1 L;  3NE5 B;  2R7Z G;  1N34 L;  2RSO A;  4A3D H;  1TXY A;  1IL8 A;  2H5X A;  1VQI A;  4KY5 A;  1EYG A;  1L1O A;  3NSW A;  2DY7 A;  3T1H L;  1QNU A;  2Q2H A;  1A15 A;  4C56 C;  3P75 A;  2IL8 A;  3VA5 A;  2ZM6 Q;  2L15 A;  1Q46 A;  3G6J B;  1I6H H;  2NVT H;  2F0N A;  3Q0A A;  2D0P A;  1FL0 A;  1CTM A;  3EQL C;  1EIY B;  4DR5 Q;  1S5C D;  1HPC A;  3DWP A;  4J8Q A;  5T1G A;  5FLX L;  2MNA A;  1GUS A;  1U4M A;  4IO9 A;  1JMC A;  1T5E A;  3A7A B;  2YTV A;  3PUZ A;  4ZKC B;  1ROD A;  1SXT A;  1AH9 A;  5I2Y A;  3UI2 A;  1LYL A;  2G5D A;  3V05 A;  5C3E B;  4I65 A;  1WFQ A;  3ERQ A;  3C46 A;  3Q23 A;  2JJQ A;  2QW7 A;  2JA7 G;  2JA6 B;  2NWG A;  3HGB A;  2I5H A;  1N36 L;  2TSS A;  4BBS G;  1Q8K A;  1TY2 A;  1NSN S;  4DR4 L;  4FVM A;  4LF6 L;  3OIP A;  4FDB A;  4A3J B;  3MAQ A;  3GTK B;  4X62 L;  1SR3 A;  4X66 Q;  1E22 A;  3K7A B;  1L1O B;  4RHS A;  2MPM A;  4JYA L;  5ELB A;  3GTM H;  5I2X A;  5EAY A;  3P1H A;  1I3Q H;  3DLL A;  3S14 B;  2HHH L;  3EVQ A;  1QUQ B;  4LK1 C;  4OHJ A;  1MKH A;  1PRT C;  2IHF A;  1U0L A;  4RKL A;  2KJX A;  3TZU A;  1NR2 A;  1SE4 A;  2C5C A;  4DV2 Q;  3CCJ A;  4FYD A;  4GN3 B;  1B50 A;  2K5Q A;  3M9B A;  5H1S E;  1JE5 A;  4WRD A;  1UE1 A;  2Z6B A;  3JAM i;  2F0Q A;  5IIF A;  3DEP A;  4RGT A;  3I4N B;  1U4L A;  2ES2 A;  1STN A;  2E76 C;  4R4Q A;  1PRT B;  1N9W A;  3B6Y A;  3A56 A;  4G7O C;  4YWK A;  4JI0 L;  1D5M C;  1SAP A;  4GS3 A;  4H0L C;  4IUV A;  2VB3 X;  4OWW B;  4KV6 A;  5C0X H;  5M3M G;  2F0V A;  1QJO A;  5M5Y B;  4DV1 Q;  2ZJQ A;  4BY1 H;  2NVY H;  2F0S A;  3WOE A;  2NZ1 D;  5D14 A;  2K50 A;  1XJV A;  1BDO A;  3HOV B;  2VNU D;  4QJF A;  3DMU A;  1K0R A;  5ELF A;  4O2D A;  2YYZ A;  1C0A A;  5E3F A;  5M3F H;  2R7F A;  1SRU A;  1P8L A;  1K9M C;  2LXK A;  2PW7 A;  4LF8 L;  1PH2 A;  1RF2 D;  1WCM H;  4UP8 A;  1PFM A;  1QOH A;  5FJ8 H;  5JPN C;  2F4I A;  1FGB D;  2ZXR A;  4P72 A;  5A2Q E;  4OIJ A;  1A0I A;  2XWB B;  2HCI A;  3BU2 A;  3NEN A;  1VQJ A;  4JBJ A;  4PNY A;  5DM7 3;  1HZC A;  3D4R A;  2AMC B;  1FNV A;  2A6H D;  1TII D;  1Y1V H;  2K5D A;  1LTR D;  4MHE A;  1XYI A;  1TS5 A;  2NYZ D;  3I4M G;  2PQA A;  3HOW G;  2L12 A;  5D3D A;  3CPF A;  1VQG A;  2GVA A;  3GTQ B;  2PZU A;  1QCB D;  4IFD I;  3G71 A;  3KOJ A;  2PNH A;  2B2W A;  4AQY Q;  3F2U A;  1TVX A;  3PUV A;  4JI5 L;  3GTJ H;  2QKI C;  1KIX A;  3ITP A;  2N49 A;  1Q1E A;  1CM9 A;  5C3W A;  2NVX H;  2XIW A;  1HXY D;  1AP0 A;  1ZKO A;  3GDE A;  2R92 B;  1EU4 A;  3S17 B;  3L3O C;  3WWV A;  4N8F A;  1ZEQ X;  3NEM A;  4ODG A;  3K5L A;  5I9P A;  1KHI A;  2E2I H;  5IWA L;  2OEO A;  5CMD A;  1GUW A;  3ICE A;  4A3G H;  1VQL A;  2DJF C;  4FO2 A;  3AU7 A;  2B2W C;  1JWM D;  2O4X A;  4NXN L;  2UUA Q;  1STG A;  1Q81 C;  3I2Z A;  5KYL A;  4A3M G;  1ILP A;  1K8M A;  4DFA A;  3GTG H;  4X3K A;  1XPO A;  1EY6 A;  3WDN A;  2JA8 B;  3J7A 5;  2F0J A;  5IYD G;  3BYT B;  4TVA B;  2PQA B;  4B3R Q;  2F1M A;  4HMI A;  2G9H D;  1S40 A;  1N8R C;  2KEE A;  1SFO B;  4KKT A;  4QB4 A;  2UXD L;  5HGQ A;  1EY4 A;  3BJU A;  3HS0 C;  3LNN A;  4G4K A;  3G7L A;  3QIA A;  3J80 c;  1XMQ L;  1PTO F;  1GUT A;  2B2V C;  1CKO A;  4H7B A;  1VQO A;  2SEB D;  4LJZ C;  1IBK Q;  5EJW A;  4KHV A;  3L9A X;  1VQH A;  5LMN W;  1KC8 C;  3H0G H;  3W1G A;  1PFS A;  3Q22 A;  1HNZ L;  3D8G A;  1IL2 A;  1BVS A;  1IYV A;  3AEV A;  3TP5 A;  4C3H G;  2ASB A;  3KLS A;  1TY0 A;  5IGC A;  2I07 B;  4DK3 C;  3MZ5 A;  1IZ6 A;  3I72 A;  1LTS D;  5C4X H;  1OXS C;  3TME A;  2IJ0 A;  5ELD A;  5KGU A;  3KBX A;  1PH3 A;  1CSP A;  1B44 D;  5AJ3 Q;  1SYC A;  3VR6 A;  1TWA H;  4JI3 L;  3CCE A;  2B63 H;  1RKN A;  1CHQ D;  1W6J A;  4LF4 L;  2Q2I A;  2UXB L;  4QIW B;  5IE8 A;  2MUY A;  1VQM A;  2A69 C;  2H4O A;  1Y1W G;  4BY7 H;  5IGG A;  1GD7 A;  1IBM L;  4IAL A;  1ENC A;  5IP9 H;  2YTX A;  3TSS A;  4P74 A;  5CV8 A;  1WD1 A;  3BZK A;  1LAC A;  1KRT A;  2A1A A;  2G9D A;  1S4Z A;  4R4C A;  3L2P A;  4BBR B;  4EQP A;  4FF4 A;  3W2D A;  5FO7 B;  3FP9 A;  1YI2 A;  4LNQ A;  4KK7 A;  1VQ8 A;  4HSV A;  1UWV A;  3NTI A;  3VR5 A;  4XQN A;  2R61 A;  5ISR A;  3J80 L;  2QDL A;  1AE3 A;  3LGJ A;  4YCV A;  1D1I A;  1FR3 A;  3EIV A;  4YIJ A;  3J81 i;  3A55 A;  1MI2 A;  4LF7 L;  4LWC A;  2I5L X;  4UP9 A;  1M8A A;  3H91 A;  1ENF A;  1RIP A;  2UU9 L;  1ASY A;  1C7Y A;  2YU9 H;  1NR4 A;  3A8I E;  1CHP D;  2R93 H;  4A75 A;  4A3C G;  1CA6 A;  2R7D A;  2Z4I A;  4OX9 Q;  3GP7 A;  2NUC A;  1YEZ A;  1IYJ B;  5FLM H;  4RG1 A;  4DAY A;  1KD1 C;  4ZUI A;  2FXQ A;  2H1E A;  4A3I B;  1XNQ Q;  5IYB H;  2NTS A;  3RN2 A;  1HA5 A;  1VQC A;  2EYO A;  4GLV B;  4A3B B;  1G6P A;  5C44 B;  1EZ6 A;  4WJ4 A;  2EE1 A;  2P5Z X;  1EWI A;  4JBW A;  4BXX G;  1EFI D;  1ONL A;  1RTN A;  2EYH A;  4CDC C;  4XYQ A;  1IW7 D;  1G2S A;  1PYS B;  3T56 B;  4A3E G;  3I70 A;  4JCV E;  4DF7 A;  2J4X A;  4DV5 L;  1R9T H;  1KQS A;  3QO2 A;  1KLG D;  3PV0 A;  1N33 Q;  1H9S A;  1E2V A;  2IY5 B;  3T13 A;  4TSS A;  2J0T D;  2ZTC A;  2PI2 A;  3CCS A;  3JAM L;  2R7Z B;  5FO8 B;  4S3S A;  5GQO A;  4DAY B;  1YHA A;  1PZJ D;  1WTV A;  1QWY A;  4XQJ A;  1J6Q A;  1YHB A;  1F2Z A;  3S1M H;  2BE5 D;  2A6E D;  4KTA A;  1B9M A;  4C2M B;  3BVM A;  5IGE A;  2RDF A;  4B3M Q;  3NBI A;  3E6Z X;  2B8F A;  3TP7 A;  1VQE A;  3HOX G;  3M4Q A;  1XWE A;  4Y7N B;  1EQQ A;  4JI7 L;  2B2T A;  3UE1 A;  1FNW A;  3KF6 B;  1Q90 A;  4L63 B;  4RH6 A;  1Q1B A;  5CV6 A;  4CKE A;  2NN6 G;  5K5P A;  3D0F A;  3M3Y B;  3J7A F;  4AIM A;  2EOT A;  2OWO A;  1X56 A;  4N9T A;  1SYD A;  3J7A V;  2JA7 B;  4L5T A;  4WJW A;  1AZQ A;  1H9S B;  1SJH D;  4BBS B;  1E3P A;  4PV1 C;  5AFW A;  2K01 A;  3R3O A;  3QR8 A;  1KLU D;  3PUW A;  1RHP A;  2B2U C;  4HIO A;  1WI5 A;  3TZD A;  4UDU C;  1K8O A;  2SNM A;  1FYC A;  1I4X A;  3E9I A;  1XTC D;  3CP0 A;  2HIV A;  3SK5 A;  2VQE L;  4X3U A;  3S1N B;  2DUD A;  5C3E H;  4CDD C;  2K6A A;  2JA6 H;  1FVI A;  2I46 A;  1JJC B;  2KED A;  1P16 A;  2C35 B;  2V4D A;  4A3J H;  1PA6 A;  4DR6 Q;  4DAV A;  1IBL L;  3GTK H;  3FEW X;  5T1I A;  4FXG C;  4A3F G;  4ZLT F;  3UDI A;  5IT9 L;  3K7A H;  1F77 A;  4JVZ A;  1BBU A;  2PMZ B;  1SE8 A;  1Y8P B;  1GVP A;  5EPK A;  3MXP A;  2E5L Q;  1BQQ T;  1VMC A;  5LMN L;  5IYC G;  4GZY C;  2NTT A;  3S14 H;  2HDM A;  2KCC A;  3LWE A;  1UNS A;  3D6W A;  1HZA A;  5IT9 E;  1SMY C;  2UUB L;  2HIX A;  1UAP A;  2F3I A;  1L0Y B;  4K6L A;  4N8X 1;  4A3L G;  4RCO A;  2B3G A;  4JI2 L;  1ILQ A;  4YWL A;  4K0K Q;  1B4O A;  3DXJ C;  5M3M B;  5GAE C;  4DR7 Q;  1LTG D;  1X6O A;  4OO1 G;  1E2Z A;  4JV5 Q;  4HAE A;  3G6E A;  2UUC Q;  3EJI A;  3I4N H;  5JJK A;  3CKI B;  3GO5 A;  1YNN D;  1II3 A;  1HZB A;  3I90 A;  1K8A C;  1EY8 A;  1KAB A;  2F0T A;  1L2F A;  1BCP F;  4KHP L;  1G29 1;  1O80 A;  4IN3 A;  3KF8 B;  4UHV A;  2JA9 A;  2EYP A;  1PV4 A;  4DR3 Q;  4MN3 A;  5C4H A;  4LFB L;  3F2C A;  4LF5 L;  1A2U A;  3RD4 A;  4EVO A;  5IP7 G;  2K05 A;  5M5Y H;  3I8Z A;  3F2B A;  3BZC A;  3K5O A;  1S5E D;  2MO0 A;  2FMC A;  5CV9 A;  2F4V Q;  3BZD B;  4DV0 Q;  5EPL A;  4HIM A;  1N32 Q;  2WKC A;  1T9H A;  3HOV H;  1EWH A;  4DKA C;  2EQS A;  2BH8 A;  3STB D;  3S1R B;  1PH7 A;  1EY7 A;  2UXC L;  4PMC A;  3G4S A;  5BN3 A;  3TDQ A;  3Q6S A;  5KIX A;  3WOF A;  1FGU A;  1SNC A;  1I4R A;  1Z6H A;  1FNU A;  3CC2 A;  3NQT A;  3BG3 A;  1F2L A;  4LF9 Q;  3A54 A;  3I4M B;  2KA7 A;  2AWO A;  3HOW B;  4GNX A;  1JJ2 A;  3A8K E;  1JR0 D;  2J7Z A;  5GRO A;  1D1K A;  2Q8R E;  5EBD A;  1JOK A;  4CJ1 B;  1TR5 A;  4FF2 A;  1XNR Q;  3J80 i;  4A3K G;  2N78 A;  2RCN A;  5CC4 A;  3OTO Q;  4F88 A;  1EYD A;  3S9W A;  2ZM6 L;  4CBV A;  2K5V A;  4N9P A;  2F0F A;  4JI1 Q;  4GN5 A;  1QUQ A;  1Q12 A;  4GNX C;  1M1K C;  5FOB B;  2DNE A;  3GTQ H;  1RJT A;  4DR5 L;  4IFD H;  3K58 A;  3T1H Q;  4GKK Q;  1W3S A;  4L5S A;  5DAU A;  3S24 A;  4A3M B;  2VUM G;  1VQ4 A;  4YWM A;  5FLX E;  2R92 H;  3S17 H;  2O5J C;  4V19 0;  1B8A A;  1YJ9 A;  1O7I A;  1I4Q A;  3ZYY X;  4R4I A;  2A8V A;  2XVS A;  3I7F A;  4GNX B;  1AW7 A;  4JI8 Q;  2RBM A;  4DUZ L;  4DR1 Q;  2ZJP A;  2VQF Q;  1TWC B;  1VCI A;  3FHW A;  5G3L D;  3URY A;  4ZQ3 A;  3G48 A;  3T53 B;  3CCQ A;  2I5M X;  2Z1C A;  3FMC A;  4I7Z C;  3T16 A;  4C3I G;  4X66 L;  2D5D A;  1PH1 A;  4NPS A;  3J81 L;  4KJN A;  2WAC A;  4LUZ A;  2N8N A;  2JK8 A;  4HJ7 A;  2MO1 A;  3K5N A;  3NUC A;  5CBA E;  2JA8 H;  2XNA C;  5LHY 1;  1SEB D;  1DCZ A;  1TU2 B;  3IFT A;  1CT1 D;  5COR A;  4C3H B;  2QCP X;  2KBN A;  4RAU C;  1KNA A;  1R4Q B;  1SFO H;  2WB1 E;  3OOC A;  4NP5 A;  3H15 A;  4DUY Q;  1JT8 A;  1XXG A;  1KRS A;  2VL6 A;  2GVB A;  3GTO B;  1EQR A;  1EOT A;  1IXR A;  3U4V A;  4DV2 L;  2AQ2 B;  3TEH B;  1WYD A;  4RCN A;  1M4V A;  2WV6 D;  5I6W A;  5GAH C;  1ASZ A;  2A68 C;  2L4N A;  1AN8 A;  2K28 A;  1XMO Q;  3W5O A;  1DXM A;  2K1B A;  1WTR A;  1MJC A;  1Y1W B;  2Z8L A;  4H02 A;  2EDG A;  1A63 A;  4RMF A;  1AE2 A;  3ONA B;  1JOQ A;  1MJE A;  4ZUJ A;  4K14 A;  2A74 C;  3PF5 A;  2F52 A;  3CCU A;  1L0W A;  1LT5 D;  3BVG A;  2F3V A;  1PYB A;  4DV1 L;  3DEO A;  5CV7 A;  1KNE A;  1L0X B;  1PDQ A;  2AUK A;  2SNS A;  4RGM A;  5CGK A;  4X65 Q;  5DNF A;  3ULP A;  5CR3 A;  4DNI A;  3D31 A;  4MTK A;  1NTG A;  2LMC B;  3HZX A;  4FF1 A;  5ELO A;  2Z4H A;  4R8N A;  5C3X A;  2MJ8 A;  3IAY A;  2TMP A;  3RZD B;  1K83 B;  1F9P A;  4OL7 A;  1Q3L A;  2HDL A;  2F0L A;  2RKS A;  2OQ0 A;  2CH4 A;  2KVM A;  3HG9 A;  1YNJ C;  1TWH B;  1B53 A;  4BBR H;  3K80 C;  1QIL A;  1EEF D;  2ZXO A;  1MSG A;  1V1O A;  3U9S A;  3I3C A;  4HCE A;  5C5L A;  3E9H A;  3NHH A;  3OYY A;  3T1Y Q;  1HHV A;  1UEA B;  3M7N A;  3LX0 A;  3TP8 A;  1VQF A;  2R3Z A;  1QVG A;  2BA0 A;  4MZ9 A;  5JEA H;  3HOZ G;  4P2C B;  3I91 A;  2E2H B;  4PZ6 A;  1OTC A;  2F0U A;  4XT3 B;  3SDZ A;  3RR5 A;  1BR9 A;  1LT6 D; 
#chains in the Genus database with same CATH homology
 2CCZ A;  1YZ6 A;  1XPR A;  2XTI A;  1U5K A;  1AE3 A;  3KDF B;  3LGJ A;  4YCV A;  2BH2 A;  4XIG S;  4A76 A;  2V1C C;  3GD7 A;  3EIV A;  2VW9 A;  3PCO B;  4AQY L;  1UE7 A;  1FJG L;  3I55 A;  3K8A A;  5DLQ E;  3J81 i;  1EFW A;  4JI8 L;  4A3E H;  2QGQ A;  4LWC A;  3TRE A;  4DR1 L;  1J5E Q;  4JI4 L;  2I5L X;  1NMF A;  1QVC A;  2WP8 J;  4QL5 A;  4UP9 A;  2VQF L;  3CCM A;  4DV4 Q;  3PO2 G;  1PH9 A;  1RIP A;  2UU9 L;  1L1O C;  3Q8D A;  2AHO B;  2VY3 A;  4AH6 A;  1C7Y A;  1ASY A;  4C3J H;  1IBL Q;  2YU9 H;  1CKN B;  4BY7 G;  4P71 A;  3A0J A;  4R1J A;  4GOP A;  4A75 A;  4A3C G;  2R93 H;  3AYH B;  4JBK A;  2R7D A;  1PHJ A;  2K5H A;  1N36 Q;  4A3I H;  5HY6 A;  4OX9 Q;  4DR4 Q;  3CCV A;  3TRZ A;  4DUZ Q;  4LF6 Q;  4K0K L;  1YEZ A;  3UDX A;  2YV5 A;  5IP9 G;  5LMN Q;  1IYJ B;  4BBR G;  1K73 C;  3RZO H;  4A3B H;  4DR7 L;  5FLM H;  4RG1 A;  1D7Q A;  4A93 G;  5JEA J;  4X62 Q;  3ER0 A;  5C44 H;  1SRO A;  1I5F A;  3E0E A;  1UE5 A;  1KD1 C;  2FXQ A;  4POF A;  1YVC A;  4LUO A;  1I94 L;  2UUA L;  2UUB Q;  1NBW A;  3FKI G;  1XNQ Q;  2CWP A;  3SGI A;  5IYB H;  4JYA Q;  3RN2 A;  1VQC A;  4YCW A;  4JI2 Q;  4DUY L;  4WJ3 M;  1SN8 A;  3HOX H;  1HH2 P;  4GLV B;  4OXP A;  3KLW A;  2A19 A;  4DV3 Q;  1OXX K;  4HJA A;  4GOP C;  3W1B A;  2HHH Q;  3HOY H;  5JEA G;  3H3V I;  4B3R L;  1G6P A;  4WJ4 A;  5C4J H;  3UDF A;  4GLX A;  1BBW A;  1XPU A;  3S2H H;  1EWI A;  4JBW A;  4BXX G;  1HNW L;  1WJJ A;  2K75 A;  1E7Z A;  3HKS A;  2K4K A;  4YY3 L;  4YCU A;  3U58 A;  4LFA L;  3CF5 A;  4BA2 I;  3HKZ E;  3L0O A;  4HJ8 A;  2Z6K A;  3KFU A;  1VQN A;  2OCE A;  4MNO A;  3S2D H;  1XMO L;  1PYS B;  4GLA C;  4GN4 B;  4XTC S;  4DV6 L;  1IBK L;  2RHQ B;  2JQO A;  4KHP Q;  4A3E G;  1HNX L;  4JCV E;  2R7Z H;  3A5U A;  4DV5 L;  1R9T H;  4P73 A;  4P75 A;  1CSQ A;  3AFQ A;  1PVO A;  2F4V L;  1KQS A;  1HR0 Q;  1SLJ A;  4GOP B;  2MFI A;  4DV0 L;  3PV0 A;  1M90 C;  3PSI A;  2NN6 I;  2R6G A;  1N33 Q;  2JE6 I;  1E1O A;  2ALY B;  3PO3 H;  2R93 G;  4C2M H;  4LFB Q;  2OQK A;  2IY5 B;  4IJL A;  4MTN A;  2ZTC A;  2PI2 A;  4A3I G;  4JI0 Q;  4OWX B;  3CCS A;  2B29 A;  1GM5 A;  2DGY A;  2JEA I;  5GQO A;  4IPG A;  3KJO A;  4DAY B;  4GKJ L;  1YHA A;  2D62 A;  4YHH Q;  5ELN A;  2Z6K C;  4A3B G;  4X65 L;  1J6Q A;  5FLM G;  4Y7N H;  1YHB A;  3CME A;  2AWN A;  3S1M H;  2WAQ G;  5C44 G;  1VQ5 A;  2IHE A;  2KHI A;  4APV A;  1B70 B;  2QA4 A;  3KDF A;  5AJ3 L;  4B3M Q;  5J3B A;  5IYB G;  1NY4 A;  1VQA A;  2UXC Q;  3J81 c;  3CQZ H;  2HQL A;  2ZTD A;  3I56 A;  1VQE A;  3HOX G;  1A8V A;  3M4Q A;  4JI7 L;  1EQQ A;  3HOU H;  1C9O A;  3HOY G;  3M3Y H;  3UE1 A;  1VQ9 A;  4DV7 Q;  2WB1 G;  4QGU A;  4HIK A;  4A3F H;  2ATW A;  3KF6 B;  1BKB A;  3RNU A;  2JA7 H;  1CKN A;  1CKM A;  3AQQ A;  3KYH C;  1X3F A;  1Q1B A;  1PH5 A;  4BBS H;  1NE3 A;  2B63 G;  2NN6 G;  3ERS X;  5LMU Q;  1VQ7 A;  3D0F A;  3OW2 A;  3NBH B;  5IYC H;  3S1Q H;  4AIM A;  2D0O A;  2E2J H;  2OWO A;  4IPC A;  2JA5 H;  4JI1 L;  1X56 A;  2HT1 A;  2R7Z G;  4L5T A;  1N34 L;  4LF8 Q;  1PH8 A;  3T1Y L;  4A3D H;  1TXY A;  1E3P A;  4O0A A;  3S1N H;  2H5X A;  4A3L H;  1VQI A;  1EYG A;  1L1O A;  3T1H L;  2IT1 A;  3PO3 G;  3PUW A;  2Q2H A;  2E8G A;  3ULL A;  2ZM6 Q;  4HIO A;  1WI5 A;  2Y0S G;  2L15 A;  1Q46 A;  1I6H H;  1QZG A;  2VZA A;  3E9I A;  3CP0 A;  2NVT H;  3TS0 A;  4KLK A;  2HIV A;  2VQE L;  2D0P A;  1FL0 A;  4LF7 L;  1JB7 A;  2VS1 A;  1EIY B;  4B3S Q;  1QVF A;  2DUD A;  3TS2 A;  4DR5 Q;  5C3E H;  5IY0 A;  2MNA A;  4DR2 Q;  4OON A;  4KHZ A;  4IO9 A;  1JMC A;  2JA6 H;  1FVI A;  5K36 G;  1JJC B;  1YJN A;  2WFW A;  3HOZ H;  1J5E L;  1P16 A;  2MQH A;  3A74 A;  2C35 B;  4OO1 I;  2YTV A;  3EBE A;  3PUZ A;  3UDG A;  1YJW A;  4DV4 L;  2NVQ H;  3HOU G;  1AH9 A;  4NXM L;  4A3J H;  1LYL A;  4AYB E;  1PA6 A;  4DR6 Q;  1IBL L;  3GTK H;  1S72 A;  1PH6 A;  1WFQ A;  1X54 A;  4A3F G;  2JJQ A;  3UDI A;  2JA7 G;  4JI5 Q;  3K7A H;  4DK6 C;  3MEF A;  2KEN A;  4HJ9 A;  2I5H A;  1N36 L;  1OXT A;  1BBU A;  5IP7 H;  4OX9 L;  4BBS G;  1Q8K A;  1SE8 A;  4DR4 L;  1NJI C;  1GVP A;  2E5L Q;  4LF6 L;  1K8G A;  4FDB A;  5IYC G;  5LMN L;  1GKH A;  3F2D A;  3S14 H;  2Q2U A;  2NZO A;  1Q86 C;  5M3M H;  4X62 L;  1YHQ A;  1SR3 A;  1HZA A;  4X66 Q;  1E22 A;  2JA5 G;  5JJL A;  2UUB L;  1L1O B;  2HIX A;  5IWA Q;  2IX1 A;  4A3D G;  1Z47 A;  1XNQ L;  1HZ9 A;  1LTL A;  1OXV A;  2F3I A;  1LM0 A;  4A3L G;  1SMX A;  4JYA L;  2CFM A;  4LUV A;  2B3G A;  3GTM H;  3J7Z C;  3PIO A;  4JI2 L;  4PG3 A;  4YWL A;  5E7N A;  5GAD C;  4J15 A;  4K0K Q;  5EAY A;  1I3Q H;  3DLL A;  1EIF A;  1V9P A;  2EIF A;  4DV3 L;  5GAE C;  2HHH L;  4IOC A;  4NXN Q;  4DR7 Q;  1QUQ B;  1X6O A;  3K81 C;  1MKH A;  4UPA A;  4OO1 G;  3CPW A;  3ZJY C;  5M5W H;  4JV5 Q;  3KF6 A;  2IHF A;  3G6E A;  2UUC Q;  1U0L A;  2LSS A;  3I4N H;  5JJK A;  4L5R C;  1V43 A;  2KCT A;  1V1Q A;  2KCM A;  3GO5 A;  5C3E G;  3M85 A;  3ULJ A;  4DV2 Q;  2GN5 A;  1HZB A;  5BR8 Q;  1K8A C;  3CCJ A;  4GN3 B;  2JA6 G;  2ID0 A;  3M9B A;  1L2F A;  5H1S E;  1JE5 A;  4KHP L;  1G29 1;  1UE1 A;  3JAM i;  3KF8 B;  2QEX A;  2RF4 A;  2UXD Q;  4B3T Q;  2JA9 A;  1HR0 L;  4PMW A;  4X64 Q;  4A3J G;  4A3K H;  1K3R A;  4DR3 Q;  1XMQ Q;  1PV4 A;  2ES2 A;  4LFA Q;  2I0Q A;  1N33 L;  4R4Q A;  4NB3 A;  1N9W A;  3B6Y A;  1OXU A;  4LFB L;  3F2C A;  4LF5 L;  4QY7 A;  4YWK A;  5IP7 G;  4JI0 L;  3DM3 A;  5M5Y H;  3S1R H;  1Z9F A;  3F2B A;  3BZC A;  4GS3 A;  2MO0 A;  4YHH L;  1VQP A;  4OWW B;  1HNZ Q;  2F4V Q;  4TQU S;  5M3M G;  4DV0 Q;  4HIM A;  4JI6 Q;  4QQB X;  1N32 Q;  1T9H A;  3HOV H;  4DKA C;  4QIW E;  2EQS A;  4B3M L;  2BH8 A;  1VS0 A;  3STB D;  4DV1 Q;  1PH7 A;  2UXC L;  2ZJQ A;  3AFP A;  4BY1 H;  2NVY H;  2OTJ A;  2VUM H;  3I4M H;  3G4S A;  1VQB A;  3HOW H;  1H95 A;  2K50 A;  5C0X I;  3CW2 C;  1FGU A;  1XJV A;  5M5X H;  1YNX A;  2VNU D;  4DV7 L;  3UE0 A;  2OTL A;  4QJF A;  3CC4 A;  1K0R A;  3CC2 A;  4LFC Q;  4O2D A;  3STB C;  3M4O H;  2YYZ A;  4JI3 Q;  3I4N G;  3TQY A;  4LF9 Q;  1C0A A;  4LF4 Q;  2UXB Q;  2AWO A;  5LMU L;  5M3F H;  4GNX A;  4DAM A;  2R7F A;  1VQD A;  4ALP A;  1JJ2 A;  1SRU A;  4BA1 I;  1E24 A;  1P8L A;  4C3I H;  2CKZ B;  2ZJR A;  5GRO A;  1K9M C;  2LXK A;  4LW1 A;  3HKZ G;  2N3S A;  1XNR Q;  3CC7 A;  4R4O A;  1TWG H;  1PH2 A;  4LF8 L;  3I4O A;  4HJ5 A;  1WCM H;  4UP8 A;  3J80 i;  4A3K G;  1IBM Q;  5C0X J;  4JBM A;  2N78 A;  2RCN A;  5FJ8 H;  2Z0S A;  4P72 A;  3OTO Q;  3PF4 A;  3PIP A;  2ZM6 L;  4JOI A;  3RLF A;  1A0I A;  3BU2 A;  2RHS B;  3NEN A;  2K5V A;  4A3M H;  2XGT A;  4JI1 Q;  1VQJ A;  4JBJ A;  4GN5 A;  1QUQ A;  3J81 j;  3CMA A;  1X55 A;  1Q12 A;  4GNX C;  1M1K C;  1HZC A;  1E1T A;  3CAM A;  5C0X G;  4B3S L;  3GTQ H;  4DR5 L;  1Q7Y C;  2AMC B;  3HOV G;  1W2B A;  1VQ6 A;  5IYD H;  3T1H Q;  4DR2 L;  4GKK Q;  1W3S A;  1Y1V H;  4ME3 A;  4L5S A;  1YBY A;  3S24 A;  4BY1 G;  2VUM G;  1G51 A;  2Q2T A;  2PQA A;  3I4M G;  3HOW G;  1JJG A;  3CPF A;  1TWC H;  1VQG A;  3JAM c;  1VQ4 A;  2GVA A;  4YWM A;  2R92 H;  3S17 H;  4JOI C;  1B8A A;  1YJ9 A;  4DR6 L;  3G71 A;  3KOJ A;  4IFD I;  1O7I A;  2PNH A;  4R4I A;  1FJG Q;  4AQY Q;  2IX0 A;  2A8V A;  3PUY A;  3I7F A;  4GNX B;  3PUV A;  4JI5 L;  2CQO A;  3GTJ H;  1KIX A;  3PUX A;  2N49 A;  1Q1E A;  4JI8 Q;  4DUZ L;  4DR1 Q;  2NZH A;  2NVX H;  4JI4 Q;  4LF7 Q;  2ZJP A;  2VQF Q;  1VCI A;  5M3F G;  2E5L L;  3GDE A;  1YIJ A;  3FHW A;  4JG2 A;  2UU9 Q;  3WWV A;  1X3G A;  3G48 A;  3CCQ A;  2I5M X;  4NXM Q;  3RLO A;  2E2I H;  4X66 L;  3NEM A;  1PH1 A;  4C3H H;  4NPS A;  4LUZ A;  1KHI A;  2JK8 A;  2N8N A;  3U50 C;  1HJP A;  5IWA L;  4HJ7 A;  2MO1 A;  1TWF H;  2WAQ E;  1WCM G;  3CD6 A;  3ICE A;  3CCR A;  4A3G H;  1VQL A;  5FJ8 G;  4L5Q A;  2JA8 H;  4JC0 A;  4IFD J;  4HID A;  2LXJ A;  3VDY A;  3GTO H;  1S3O A;  4NXN L;  3RLN A;  2UUA Q;  1Q81 C;  3I2Z A;  4A3M G;  1I94 Q;  3H3V H;  2KBN A;  3GTG H;  1SFO H;  4JV5 L;  1NMG A;  2WB1 E;  2UUC L;  3H15 A;  1UE6 A;  4DUY Q;  1XPO A;  1X9N A;  5JJI A;  1JT8 A;  2EXD A;  4IFD G;  1KRS A;  2VL6 A;  5IYD G;  3J7A 5;  2GVB A;  1EQR A;  1KAW A;  4TVA B;  1IXR A;  2PQA B;  3U4V A;  5BR8 L;  1Y1V G;  4DV2 L;  3TEH B;  4UY8 C;  4B3R Q;  1WYD A;  1Y1W H;  1S40 A;  3MXN B;  1N8R C;  1HNW Q;  3EN2 A;  3K0X A;  1PH4 A;  1Y14 B;  5GAH C;  1ASZ A;  2UXD L;  2AKW B;  4IPD A;  2R92 G;  3JC6 6;  4B3T L;  5HGQ A;  1EUJ A;  4YY3 Q;  4X64 L;  3BJU A;  3J80 c;  4DR3 L;  1XMQ L;  1DGS A;  4X6A H;  4PZ8 A;  1I50 H;  1CKO A;  3PGZ A;  1RL2 A;  3W5O A;  2KHJ A;  1VQO A;  1XMO Q;  4DV6 Q;  1IBK Q;  1HNX Q;  1A62 A;  1MJC A;  1D8L A;  5FLX c;  1VQH A;  5LMN W;  4AYB G;  4DV5 Q;  2YTY A;  4H02 A;  1KC8 C;  4IJH A;  3H0G H;  2Y0S E;  3W1G A;  1A63 A;  1PFS A;  4RMF A;  1AE2 A;  1HNZ L;  1IL2 A;  1BVS A;  1MJE A;  4JI6 L;  3AEV A;  1N32 L;  2ASB A;  3PF5 A;  2F52 A;  1X65 A;  3CCU A;  3A5Z B;  1L0W A;  1Q82 C;  3F8T A;  3HFZ B;  1PYB A;  2ZTE A;  4DV1 L;  1CUK A;  4DK3 C;  4LF5 Q;  3GTL H;  3F1Z A;  1IZ6 A;  5C4X H;  5IT9 c;  4A3G G;  4GKJ Q;  1OXS C;  2JA8 G;  4X65 Q;  3ULP A;  4Y52 H;  4A4I A;  2K52 A;  3IRB A;  4DNI A;  3RZD H;  1K83 H;  1LUZ A;  3S15 H;  1PH3 A;  1CSP A;  3D31 A;  5AJ3 Q;  1NTG A;  3KJP A;  1TWA H;  4LFC L;  5ELO A;  3NEL A;  4JI3 L;  3CCE A;  2JEB I;  4PZ7 A;  1VQK A;  4LF9 L;  2B63 H;  4LF4 L;  2UXB L;  2Q2I A;  4EQ5 A;  3PO2 H;  4JI7 Q;  2K14 A;  2K5N A;  1TWH H;  5IE8 A;  1YIT A;  1KL9 A;  2CWA A;  1VQM A;  2PI2 E;  1Y1W G;  4BY7 H;  1HR0 W;  3CXC A;  4A3C H;  2OQ0 A;  4IOA A;  1GD7 A;  1WOC A;  4DPG A;  1XNR L;  4UP7 A;  4KI0 A;  1GO3 E;  1IBM L;  3U4Z A;  5IP9 H;  1B7Y B;  4BBR H;  1UEB A;  3OTO L;  1X3E A;  3K80 C;  4POG A;  2YTX A;  1XTD A;  4A93 H;  4P74 A;  1N34 Q;  3BZK A;  1MIU A;  3E9H A;  3K7U C;  2A1A A;  3H0G G;  3FKI H;  3OYY A;  1KRT A;  3RN5 A;  3T1Y Q;  2E2H H;  3GTP H;  1EOV A;  4R4C A;  3M7N A;  1KXL A;  5GAG C;  3L2P A;  1VQF A;  1QVG A;  2BA0 A;  4IPH A;  4GKK L;  4MZ9 A;  3S16 H;  4OWT B;  3HOZ G;  3FP9 A;  1YI2 A;  4LNQ A;  5C4X G;  3M4P A;  4EX5 A;  1VQ8 A;  4PZ6 A;  2BA1 A;  1OTC A;  1UWV A;  2VQE Q;  4BXX H;  3CCL A;  3RR5 A;  3L7Z C;  4R4T A;  2PMZ E;  1QZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...