1X3FA

Crystal structure of the single-stranded dna-binding protein from mycobacterium smegmatis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
107
Chain Sequence
GDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVEVDEIGPSLRYATAKVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Structure of Mycobacterium smegmatis single-stranded DNA-binding protein and a comparative study involving homologus SSBs: biological implications of structural plasticity and variability in quaternary association.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
total genus 17
structure length 107
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x3fA00
4A4IA 2HIVA 2KHIA 2PQAA 4NB3A 2ZJPA 1G51A 1Q12A 5IYDH 2E8GA 4DAYB 2VUMG 3U58A 1NMFA 2MO1A 4BBRG 3CCUA 4RG1A 4R4OA 2VY3A 1EFWA 5GADC 1VQ5A 1C7YA 1S72A 4X64L 1I94Q 2YU9H 4LF9Q 4EQ5A 3F8TA 4GLVB 1VQCA 4UP8A 1I5FA 3CCQA 4A3JG 3D0FA 4DUZL 1JB7A 5C3EH 2UUCL 4DR4L 2K4KA 4GN5A 2K5NA 4DR2L 5M3FG 2UXCL 3HOUH 2EXDA 4X64Q 3W1BA 5C44G 4LF6L 3PO2G 4C2MH 3PO3G 3F2CA 3T1HQ 4X6AH 3I2ZA 2ZM6Q 5FLMH 1IBKL 3FKIH 1PH3A 4NXML 4DR4Q 4DR2Q 2OTLA 1L1OA 2UXCQ 1N34L 1X6OA 1VQBA 1LTLA 4JI3L 2WP8J 4BY1H 1AE3A 3CCMA 4HIKA 3KDFA 3MEFA 1IBKQ 4NXMQ 3AYHB 1PH5A 4OONA 4Y7NH 1LM0A 3ER0A 2KHJA 1N34Q 3HOZG 1RL2A 4DV3Q 4PZ6A 3ZJYC 3T1YL 1X9NA 4JI3Q 3L2PA 3PUYA 2CWAA 2NZHA 2UUAL 4Y52H 2JA5G 4RMFA 4UY8C 1IXRA 1VQEA 4JI1L 4UPAA 4P72A 1UEBA 3NBHB 4P73A 1YIJA 1SE8A 4YWKA 3HOVH 1TWHH 2E5LL 3W1GA 4JC0A 2UXDL 1AH9A 3CAMA 4LWCA 4JI1Q 4C3JH 4X65L 3CF5A 4A3MG 4LW1A 1YHAA 3OYYA 3HKZE 2BA1A 4BXXH 4A3FH 5LMNL 2E5LQ 3L7ZC 2UXDQ 4AQYQ 3CW2C 1XNQL 1QZHA 3S1MH 2N3SA 2YTVA 3EN2A 3I56A 4EX5A 3OTOL 1YNXA 4IJHA 3CD6A 1Y14B 3RZOH 1L1OC 3K8AA 1HR0L 1E1OA 2C35B 3LGJA 4KI0A 4O0AA 5FLXc 5C0XJ 3CCSA 2Q2HA 4LF4L 4YY3L 1JJGA 5C4XH 2Z0SA 3UDXA 3IRBA 1XNQQ 2BH8A 1Y1VG 1V43A 4GLAC 1IBML 1BKBA 1QUQA 3OTOQ 4A3KG 3RLFA 3STBD 1HNXL 2XTIA 4LF5L 4GS3A 1HR0Q 1E24A 4IPCA 1KRSA 4LF4Q 5M3MH 2MQHA 3J80i 3J81i 3DM3A 1SRUA 3KF6B 1IBMQ 4ME3A 5GAEC 1VQKA 1GVPA 4LFCL 1DGSA 3SGIA 1ASYA 4LF5Q 2QEXA 3KOJA 3GD7A 2ZTEA 1Z9FA 1QZGA 2DUDA 1VQOA 4OWWB 1PH4A 1YJ9A 3H3VI 4DR3L 1FVIA 1K0RA 4DUYL 1N8RC 2UUBQ 3E9IA 4L5RC 3PUVA 3F1ZA 2I0QA 3I4NG 4IFDJ 2NN6G 1NY4A 1QVCA 2IHEA 3TREA 4LFCQ 2VUMH 1OXVA 3ERSX 3FP9A 1TXYA 3CMAA 4JI2L 4HJ9A 3GTQH 4DR6L 1K8AC 4JI7L 1E1TA 4A3DH 4DR3Q 1HJPA 4WJ4A 4A3JH 3PIOA 4JI6L 2JA7G 4JG2A 2MNAA 2NN6I 4OO1G 2AKWB 4A75A 2A19A 1AE2A 4JI2Q 3A5UA 5M3FH 4YHHQ 2Q2IA 4JI7Q 1VQDA 2KCMA 5C44H 1VQAA 2PNHA 3PO2H 1GM5A 4JYAL 3PO3H 4LFBL 1IZ6A 1VQHA 5ELNA 4JI6Q 2R93G 2I5MX 4GKJL 4QY7A 1HZAA 5IYCG 3JAMi 3S14H 3K7AH 4OO1I 4DR5Q 3CP0A 3J7ZC 4XTCS 4IOAA 3F2DA 5IP7G 1P8LA 3WWVA 1PH2A 4DR1L 4JYAQ 4LFBQ 4GKJQ 1V9PA 2VS1A 3UDFA 4A3GG 3GTOH 1WFQA 4LF9L 2KENA 3HOZH 2JJQA 4POGA 1Q1EA 1EQRA 4MTNA 4DR1Q 2ALYB 1P16A 2ZTDA 4IPDA 1IBLQ 1XPRA 2ID0A 2JA5H 1QVFA 4GNXA 1MJEA 1MIUA 2IX0A 4LFAQ 1TWGH 1E3PA 3ULJA 3HOXG 3HOWG 4L5SA 3T1HL 2MFIA 1UE7A 2ZM6L 3HOYH 1PFSA 3F2BA 1XPOA 1CKNA 3S24A 1A63A 4JI4Q 2I5LX 4DV6L 1TWCH 1VQ6A 2PQAB 3UDIA 3M4OH 1EUJA 4P74A 4BA1I 1VQGA 1U5KA 1Z47A 1SROA 4PG3A 4A3MH 3S1NH 4J15A 4IJLA 1CSPA 3ICEA 1G291 2R7DA 5C4JH 4DV6Q 3K81C 5GROA 2ZJRA 3K0XA 5GAGC 4JBMA 4DV3L 5M5YH 4TQUS 3CCJA 2JA8H 1EWIA 1IYJB 1SFOH 1NJIC 3PUWA 1FJGL 3CMEA 2R92G 1LUZA 2NVTH 4C3IH 1QVGA 2K5VA 1BVSA 2FXQA 3L0OA 2CWPA 2R7FA 1SN8A 3PF5A 5LMNW 1VQ4A 1Y1VH 4P75A 1YJWA 4JI0L 3E9HA 4QIWE 4A3KH 1PH6A 1FJGQ 4BBSG 1EIFA 1U0LA 2HIXA 1CSQA 3NEMA 4R4QA 3DLLA 4GOPC 1L1OB 3GTLH 3H3VH 4MNOA 1HR0W 4FDBA 4IPGA 1R9TH 4DKAC 2D0PA 1B7YB 1X3FA 2I5HA 4GNXC 2E2HH 2LSSA 2JEBI 4YCVA 4DPGA 4A3EG 4JI0Q 2BH2A 3KDFB 4A3CG 4WJ3M 3CPFA 1BBWA 3EIVA 3PSIA 3CCRA 2GVBA 2R7ZG 4AQYL 3EBEA 1Q46A 3H15A 2OQ0A 2Q2TA 1K73C 4H02A 4YCUA 1W3SA 4AYBE 3I4NH 2JA6G 5JEAJ 5DLQE 4LF8L 4OXPA 2WB1E 5IYBG 5IWAL 2VQFL 2QA4A 3M9BA 2MO0A 2K75A 2NVQH 3I4MG 4A93G 1KL9A 1KQSA 4HJ5A 3CXCA 2JA7H 3S1QH 1VQ7A 3U4VA 3KJOA 4KHPL 2N8NA 1TWAH 1HZCA 4AYBG 2CFMA 5IWAQ 2PI2E 3HKZG 2VQFQ 4DV1L 3S1RH 2ES2A 1WI5A 3W5OA 1YHQA 5K36G 3OW2A 4HJ7A 4A3LG 1KAWA 2KBNA 3Q8DA 2R93H 2R6GA 1VQLA 2GN5A 3RR5A 2KCTA 4HJAA 1JJCB 4O2DA 5IYCH 4KHPQ 5FLMG 3GTPH 4OX9Q 2IT1A 1TWFH 4DV1Q 1M90C 3S17H 2VL6A 1EOVA 3BJUA 5IP7H 2E2JH 2A1AA 2UUBL 2B63G 3GO5A 2RHQB 2YV5A 1HH2P 3S2HH 2ASBA 1SMXA 1MJCA 4HIOA 4B3TL 1KIXA 4YWLA 1PV4A 5IY0A 4JI5L 1C0AA 1FGUA 1O7IA 1XNRQ 1HNWQ 1LYLA 1QUQB 1EYGA 3M4PA 3MXNB 2AHOB 2IX1A 5GQOA 3NENA 4L5QA 4BBRH 3B6YA 3GTJH 1W2BA 4DV2Q 4B3TQ 3S2DH 2E2IH 4JI5Q 4YHHL 3CCVA 3PUZA 4UP7A 3HOXH 2WAQE 3RN5A 1A62A 1PYSB 2A8VA 4L5TA 1YJNA 1N32L 2RF4A 3RNUA 1KXLA 1OXSC 3FHWA 1Q8KA 1I3QH 4APVA 3J81j 2N78A 2RCNA 4DR5L 3ULPA 1K9MC 2YTYA 1L2FA 5FJ8G 3CPWA 1OXUA 2B29A 2B3GA 3PF4A 1Q81C 4R1JA 5HGQA 1N32Q 3E0EA 5LMUL 1N33Q 3M3YH 1X65A 4QJFA 4A3FG 3TS0A 3GTKH 1WJJA 1VQIA 4DNIA 2XGTA 2NVXH 2D0OA 1IBLL 3H0GG 3KFUA 1Q1BA 2R92H 2JK8A 3G4SA 4JBWA 3CCEA 2VQEQ 5LMUQ 4DV5Q 4B3SQ 4LFAL 2ATWA 1EIYB 2V1CC 4BY7G 4LUVA 5IP9G 4GOPA 4GKKQ 3HFZB 2Y0SE 1HZ9A 4BBSH 1UWVA 4QQBX 4IOCA 4B3RL 1K83H 4YCWA 4IO9A 1XMOL 4JI4L 2F4VL 1VQPA 5JJKA 2JE6I 1I94L 2EIFA 3PIPA 1Y1WG 1OTCA 4IPHA 4A3EH 5JJLA 4TVAB 4DV7L 4HJ8A 4DR7L 1S3OA 4A3CH 3JAMc 1VQNA 4B3RQ 1XMOQ 2F4VQ 1PVOA 2R7ZH 3KF8B 2AWOA 4JI8L 2Y0SG 3CC7A 1Q7YC 4DV0L 2OWOA 5IE8A 1KRTA 2VW9A 1NE3A 4PZ7A 5IT9c 1WCMG 4QGUA 4GOPB 1J5EL 3AEVA 1C9OA 1VQMA 1YVCA 1I50H 4DV7Q 1PH1A 2JA6H 4DR7Q 4GNXB 4R4CA 4ALPA 3M7NA 3G48A 3A5ZB 1PYBA 4JI8Q 3CQZH 1VCIA 4LUZA 2Z6KA 5IYBH 5C0XG 4DV0Q 4A3IG 2IY5B 2UXBL 3UE1A 2D62A 3PUXA 1J5EQ 3GTGH 3I4MH 4A93H 4JV5L 4B3ML 4A3DG 1JT8A 5AJ3L 4DAMA 1CKNB 2LXKA 4JOIA 1N9WA 1PA6A 1CKOA 5GAHC 3NELA 3PGZA 4LF7L 2DGYA 5C0XI 3RLNA 3D31A 4JCVE 2UXBQ 5EAYA 4JV5Q 1NMGA 2F3IA 4B3MQ 2L15A 4A3LH 5AJ3Q 3GDEA 3TQYA 1HZBA 4PMWA 2OTJA 3AQQA 3ULLA 4DUZQ 1S40A 2UUCQ 1KD1C 4LF7Q 3A0JA 4NXNL 2RHSB 3BZCA 3KLWA 1JJ2A 2JEAI 1HNZL 4LF8Q 1UE1A 4A3BG 1I6HH 1XPUA 1VS0A 1VQ8A 2B63H 2PMZE 4LF6Q 1MKHA 2CKZB 4IFDG 1M1KC 2GVAA 4QL5A 2K50A 2JA9A 1NTGA 4DV4L 4NXNQ 2AMCB 1HNZQ 3RN2A 4LUOA 1L0WA 2YYZA 2VZAA 4XIGS 3G71A 4UP9A 4HIDA 2OCEA 1VQ9A 5IYDG 3G6EA 4IFDI 5JJIA 1PH9A 1FL0A 4R4IA 3AFQA 1PH7A 1J6QA 4X66L 4DK3C 4DV4Q 3S16H 5J3BA 5ELOA 4YWMA 3PCOB 4GN3B 4GLXA 1PHJA 2NZOA 2Z6KC 3T1YQ 1GO3E 3PV0A 1XMQL 2UUAQ 5C3EG 4A76A 3HOYG 4OX9L 3TRZA 4X66Q 5FJ8H 3U4ZA 1ASZA 1WOCA 4JOIC 3HOUG 2WB1G 3U50C 2YTXA 4GN4B 1PH8A 3VDYA 3TS2A 1YZ6A 3RLOA 3M4QA 2K52A 4JBJA 1XMQQ 1H95A 1UE6A 2HHHL 4AIMA 3FKIG 2QGQA 1K8GA 1XNRL 1NBWA 3CCLA 1X54A 1EQQA 5M5XH 4P71A 2ZJQA 3H0GH 4X65Q 1UE5A 2IHFA 1X56A 1XJVA 2JA8G 2VNUD 2JQOA 4BY1G 3KF6A 4DV2L 1X55A 4A3GH 1BBUA 3CC4A 2HHHQ 5LMNQ 1SLJA 1RIPA 4BY7H 3UE0A 4OWTB 5IP9H 3I7FA 2PI2A 1WYDA 1JE5A 1D8LA 3K80C 3RZDH 2CQOA 3HKSA 1YHBA 1HNWL 2F52A 1Y1WH 2K14A 2ZTCA 3STBC 4X62L 4C3HH 4YY3Q 5E7NA 1Q86C 2HQLA 3GTMH 3AFPA 3HOWH 1YITA 2Q2UA 1GD7A 1N33L 3KYHC 1X3GA 5H1SE 1HNXQ 3HOVG 1V1QA 4BA2I 3J80c 3J81c 1VQJA 1D7QA 1T9HA 3BU2A 4NPSA 5BR8L 1WCMH 4X62Q 5HY6A 1GKHA 4LNQA 1KHIA 1X3EA 3TEHB 2WAQG 2VQEL 4PZ8A 4DV5L 4BXXG 1KC8C 4B3SL 1VQFA 2N49A 1A8VA 4AH6A 5M5WH 5BR8Q 4DK6C 2EQSA 3KJPA 4A3IH 4GKKL 1A0IA 2WFWA 1CKMA 1CUKA 2UU9L 1G6PA 4DUYQ 1IL2A 4OWXB 3BZKA 3JC66 3UDGA 1E22A 1XTDA 1OXXK 2CCZA 1OXTA 1B8AA 1E7ZA 5C4XG 4DR6Q 2BA0A 2NVYH 4MZ9A 1N36L 4KLKA 1JMCA 4HIMA 1B70B 2UU9Q 1SR3A 3A74A 3M85A 1Q82C 4K0KL 2HT1A 3I4OA 4JBKA 4R4TA 3J7A5 4POFA 4A3BH 5M3MG 1YBYA 1YI2A 1K3RA 1N36Q 2H5XA 4KHZA 2AWNA 2K5HA 5JEAG 3CC2A 3S15H 4K0KQ 2LXJA 2OQKA 3K7UC 1YEZA 3I55A
chains in the Genus database with same CATH superfamily
4IZ8A 3HZXA 3MC0B 3NBIA 1Q12A 4BWGB 4HCEA 3RZOB 4DAYB 3FVQA 2KCCA 4RG1A 4R4OA 2VY3A 1WD0A 5GADC 1EFWA 4R8IA 4J8QA 1C7YA 2F0TA 1LTBD 5IT9L 4LF9Q 1I4GA 1FNWA 1JICA 1SSOA 1VQCA 3D8GA 4A3JG 2UUCL 3L9AX 1Y1WB 2K4KA 4DR4L 3H94A 5M3MB 1G2SA 2UXCL 4X64Q 4LF6L 4C2MH 3PO3G 1EWCA 5FLMH 1PH3A 3I90A 1WCMB 2B2VC 5E4WC 1JCKB 2LS01 3NTIA 4JK1C 1C48A 2WP8J 2V4DA 1AE3A 1M4VA 3QR8A 4C56C 4HIKA 1IBKQ 2PO4A 1JWUD 1FNUA 4FXKC 3ER0A 2KHJA 1N34Q 1RL2A 3ZJYC 1X9NA 3ZYYX 2UUAL 2CQAA 1IXRA 1VQEA 4XT3B 5C44B 4JI1L 3A56A 3H09A 1UEBA 3S14B 2VB2X 3W1GA 4JC0A 5I6WA 3BYYB 1AH9A 1AW7A 3CAMA 5CR3A 5FKAC 1EY8A 4X65L 3CF5A 1RD9D 3OYYA 2BA1A 2SDFA 2L5TA 3GTOB 4DXGA 1DM0B 2ICIA 3L7ZC 1XNQL 2EE1A 3I56A 5EKKA 4IJHA 3KBXA 2EOTA 4O0AA 4C3IG 5FLXc 3BS1A 4LF8Q 1JJGA 4LF4L 4YY3L 5C4XH 1U4RA 2PZWA 2QDLA 1B2TA 1V43A 4GLAC 2O5JC 4A3KG 3STBD 1HNXL 2FMMA 3MXNA 1HR0Q 3H6MA 1T5EA 1TWCB 5KIXA 2WB1B 1SYGA 3J80i 1D1IA 1U9RA 1SRUA 3R3OA 3T16A 1U4LA 5ELCA 2O2LD 1IBMQ 1GVPA 4LFCL 1ASYA 1F2YA 2B39A 3A8IE 3FRPB 5CMDA 3H3VI 2KA7A 1FVIA 1K0RA 5L37A 4IUTA 3I4NG 4JW0A 3PUVA 1U4MA 4KY5A 2NN6G 1QVCA 5EPLA 3TREA 5C3WA 5LL6X 1O7YA 3J80L 4HJ9A 4DR6L 3KK7A 1HA5A 4A3DH 1ESRA 4A3JH 2JA7G 4JG2A 1DYQA 2MNAA 5JVH3 1SNOA 4OO1G 1MD2D 1Y8OB 4A75A 4CJ2C 2DN8A 5BN5A 2KCMA 5IGGA 1VQAA 2PNHA 3PO3H 4LFBL 5ELNA 2I5MX 1RF2D 1SNMA 1STEA 3GQBA 4EQPA 3CP0A 3F2DA 4OHJA 3Q0AA 1RJTA 3NTHA 4Q0FA 5ELBA 3OWFA 1V9PA 4EVOA 3M4YA 4A3GG 2NVQB 4LF9L 1LTRD 1EQRA 3S1QB 2EDGA 2ZTDA 3QG1A 1TIID 3JAME 1MJEA 4LAAA 5C4XB 1EEFD 4LFAQ 1TWGH 1E3PA 2RSNA 2R93B 4L5SA 2DY7A 4CBVA 3E0JA 1CKNA 3S24A 3MAQA 2PQAB 1PTOH 4BA1I 4L8JA 1SROA 1CSPA 2R7DA 1WTOA 4PMCA 4TSSA 5C4JH 4DV6Q 2K28A 4JBMA 5GAGC 1JE4A 2JA8H 1IYJB 4ZYSA 1NJIC 3CMEA 2R92G 2F1MA 2B2YA 4C3IH 2NVTH 4KY7A 2CWPA 1D2BA 1H9JA 2EJGC 4A3JB 1YJWA 3I8ZA 3E9HA 5CV5A 4A3KH 1NNXA 1PH6A 1FJGQ 4CHTB 1STBA 1EIFA 1U0LA 2RKSA 1B3QA 1PZKD 3G7LA 2TMPA 3TMEA 1JR0D 4DKAC 3PO3B 1I6VC 3CHBD 2LSSA 4A3EG 4JI0Q 4DPGA 5G3LD 3Q24A 2MGSA 3EIVA 3EJIA 1EFID 4TKOB 2GVBA 1CFMA 1VF5C 3MEHA 2R7ZG 2OQ0A 2Q2TA 3QOLA 5J22A 4NKLA 1I4RA 3UI2A 3I4NH 2JA6G 1B50A 2NN6H 2PZUA 4LF8L 5K36G 4OXPA 5IWAL 2VQFL 3M9BA 3E5SA 3I4MG 1KL9A 4HJ5A 5KYLA 2JA7H 1VQ7A 2N8NA 1TWAH 1A3TA 2F0QA 2ES2A 1TWGB 1T5XD 3S1RH 2N88A 2QEJC 1BCPD 3MXUA 3ERQA 1JJCB 5J39A 5FLXL 1TWFH 4DV1Q 1HNWL 5I9PA 1D6EC 2YV5A 5IGDA 2R61A 3U9SA 4B3TL 5IY0A 4JI5L 1C0AA 3MFGA 3OMGA 4N9PA 1O7IA 4A93B 2QW7A 1GUOA 3M4PA 2BCOA 1W2BA 1BBXC 4OIKA 4FF3A 3D4RA 3PUZA 3A7LA 1EY0A 2D5DA 1A62A 2A6ED 4L5TA 1N32L 1MGSA 4CGYB 1Q8KA 2AQ2B 3EQLC 3ULPA 2YTYA 1WVLA 3SK4A 5LMUL 1N33Q 2AQ3B 3BYTB 3GTKH 1JC7A 4DNIA 3I4NB 2D0OA 4HR7B 2XRQD 3NHHA 2R92H 1QB5D 2JK8A 4JBWA 4UHVA 2K04A 4B3SQ 4LFAL 2ATWA 3KF8A 3SK5A 2X6LA 1EIYB 4EGVA 5IP9G 1UWVA 1B4OA 4IOCA 5A2QL 1KAAA 3CRKC 1VQPA 3S1RB 3LWUA 1FD7D 5M9OA 3PIPA 1B44D 4C3HG 3O13A 1K28A 1BOSA 3MXGA 4A3EH 4TVAB 4DV7L 4HJ8A 1S3OA 3IAYA 4I65A 2B2TC 1QOHA 1XMOQ 2F4VQ 2R7ZH 4JI8L 1PRTD 1TWFB 4XT1B 1STNA 5IE8A 1AFPA 1NE3A 3HP3A 4QCLA 4OL7A 1O80A 1VQMA 1I50H 1PH1A 2JA6H 3MTSA 4KTAA 4A3GB 3G48A 1PYBA 1VCIA 4DFAA 5C0XG 1ZXTA 2UXBL 3I4MH 4RHRA 1FGBD 5AJ3L 1PA6A 3PGZA 4LF7L 4F7XA 1IKLA 4JCVE 3GTMB 1JOKA 5EPJA 2L15A 1WTXA 4DUZQ 1IL8A 4X3UA 4DXFA 4NXNL 2RHSB 1JJ2A 2L0CA 1DXMA 2PMZE 3MVVA 1A2UA 3P75A 2CKZB 2PPBC 3NSWA 2BDNA 3K57A 1VQ9A 2Z8LA 2KVMA 3G71A 4HIDA 2R92B 2OCEA 5IYDG 1HTPA 4IFDI 5JJIA 4R4IA 3AFQA 1PH7A 2NUCA 5ELEA 5ELOA 3PCOB 5C5MA 2Z6KC 2K1BA 2K5QA 3HG9A 4A3EB 3WDNA 1Q90A 3NWSA 1PH8A 2R7ZB 4JBJA 1H95A 1LTSD 2HHHL 4AIMA 1CM9A 2JSOA 3CCLA 1EEID 3J7AF 1I50B 1TY0A 2JA6B 1SDFA 3KF6A 1DD2A 2ZXRA 3CC4A 2IJ0A 1HA6A 2YU9B 3UE0A 5IP9H 2RDGA 3I7FA 2PI2A 4ZKCB 3Q22A 3CU7A 2K14A 3STBC 2PQEA 2HUGA 4C3HH 1H9KA 5F2DA 1YITA 1E0BA 4X3SA 4HN7A 1GD7A 1N33L 4CKBA 1M8AA 5JVG3 1EYDA 1GKHA 1NUCA 4BY1B 3F2UA 4LK1C 2A6HD 4BXXG 4B3SL 1H9MA 5C0XH 4AH6A 5M5WH 3J81L 1Y8NB 2EQSA 1QNUA 1A0IA 1CUKA 1QCBD 2M2LA 1GOZA 2EZVA 1PTOD 4DUYQ 1IL2A 1G6PA 1WD1A 4HSVA 1EWHA 3UDGA 3R2IA 1E22A 1EY9A 2DJFC 4KKUA 1E7ZA 1W6KA 2NVYH 1Q8IA 1JMCA 1N36L 4X3KA 3C2PA 1B70B 1VF7A 3I91A 4DNTB 1SR3A 3A74A 2F0WA 1V1OA 3I4OA 4JBKA 5M3MG 4XYOA 2H5XA 4KHZA 1ZEQX 2K5HA 2EY6A 5JEAG 1KDCA 1DZ1A 3OIPA 2WACA 5E1FA 2G5DA 1I94L 4K14A 4NB3A 2ZJPA 1G51A 2EYJA 1CT1D 5IYDH 2E8GA 3H3VC 2AQ1B 3U58A 4BBRG 4OELB 2E74C 1ET6A 1S72A 5CYUA 5IT9E 2B2WC 2L12A 4GLVB 2F0GA 4UP8A 1I5FA 1RKNA 3CCQA 3D0FA 3TSSA 4DUZL 1GUSA 2IWHA 1ENFA 2K5NA 2EYMA 2XSCA 3VR6A 2EXDA 1GHKA 5CBAE 2RBMA 3W1BA 5C44G 2LMCB 4BS9A 5J1ZA 3F2CA 1KTKA 4X6AH 3GV3A 4G4KA 4NXML 4DR4Q 1HUMA 5AFWA 3Q6SA 1L1OA 2UXCQ 1LTGD 1X6OA 1VQBA 2P5ZX 4JI3L 2WKDA 4DGZA 1R4QB 3BVMA 3NBHA 3MEFA 4KN4C 1F9QA 2L4NA 3AYHB 4IQZA 1PH5A 1WTRA 3BG3A 4DV3Q 2XNAC 4N8X1 3L2PA 2NZHA 4Y52H 4RMFA 5M3FB 5CGKA 1WTWA 3DEOA 3PO2B 1FYCA 4Q5VA 1YIJA 2HDMA 1TWHH 1TY2A 2E5LL 1ICWA 3ND8A 2UXDL 1B9MA 3OW7A 3QJYA 4LWCA 4JI1Q 4A3MG 4LW1A 4J6HA 3HKZE 4QIWB 4BXXH 3TP6A 1UEAB 4A3FH 3CW2C 1GHJA 1QZHA 3S1MH 1XYIA 3EN2A 1NAPA 2PMZB 1Y14B 3RZOH 2JA5B 3K8AA 4MTKA 1E1OA 1XXGA 1Y8PB 3LGJA 5FO7B 1MSHA 2HD3A 1XNQQ 4RWSC 3VYSA 5CV7A 3RLFA 2XTIA 4LF5L 3OPOA 1E24A 3VYTA 4LF4Q 5M3MH 2MQHA 1II3A 3S1NB 5ELFA 5JEAH 3NQTA 3VR2A 1DGSA 2RVLA 1E2VA 2QEXA 3KOJA 3GD7A 2ZTEA 1HUNA 2DUDA 1VQOA 5FO9B 1JB3A 5LL6S 4DR3L 3SK8A 1PLFA 3GV6A 4DUYL 2UUBQ 2K5DA 2BE5D 3DUZA 3F1ZA 2I0QA 4IFDJ 2IHEA 4LFCQ 1OXVA 3ERSX 4JI2L 3J80E 1HQMC 5I6YA 1MBYA 3PIOA 2AKWB 1D5ZC 3QWNA 1AE2A 1V1PA 3A5UA 3IKJA 4CJ1B 1VQDA 3A7AB 5C44H 3T4AC 2LKVA 2E2HB 2R93G 4MN3A 3S14H 1RODA 3RMHA 2A69D 2CH4W 1ZYRD 1P8LA 3WWVA 1CQFA 4DR1L 4OEMB 1UUPA 4LFBQ 4CKEA 2VS1A 1HPCA 1W6JA 3GTOH 3S1MB 3TN2A 2K6AA 3I4LA 2JJQA 4POGA 1Q1EA 1P16A 4IPDA 1IYVA 2D9UA 4KKTA 4RHSA 1MI2A 4RKLA 5C5LA 3ULJA 3HOWG 2VXWA 5CORA 2MFIA 1UE7A 1PFSA 1GUGA 2F0LA 3GTPB 3S17B 2FINB 1TWCH 2E76C 2EY2A 3SHLA 3M4OH 5G3LF 4A3MH 1U5KA 4P2CB 4PG3A 1IYUA 2KQ3A 4G7HC 5EBCA 4QB4A 5GROA 4DV3L 2CW0C 4TQUS 3CCJA 2XRSD 1EWIA 4BBRB 1DOKA 2E2IB 1LT5D 1A6XA 1BVSA 4XDXA 1PFMA 3SDZA 5LMNW 4FF1A 1X3QA 2HIXA 5IGBA 3NEMA 3DLLA 2F0SA 4HMJA 1BCPF 3VR5A 1HR0W 4FDBA 4IPGA 4GNXC 1AN8A 4A3CG 3P1HA 3KDFB 5JAVA 1BBWA 3PSIA 5JPMC 2EYLA 3CCRA 3H15A 3HS0C 4H02A 4YCUA 1W3SA 1QG7A 1RCVD 5IYBG 1YNJD 2MPMA 2LY7A 5IGFA 2NVQH 4A93G 3D4WA 1EYAA 2A68C 3S1QH 4N8FA 3T51B 5IIFA 3U4VA 5HURA 1HZCA 2Q8RE 2CFMA 5IWAQ 2PI2E 1SE2A 3M7GA 2VQFQ 3BDLA 1SJED 3W5OA 5LHY1 1Z7TA 4HJ7A 4A3LG 4KKSA 2R93H 4QUCA 2KCTA 4HJAA 4O2DA 2WKCA 4B08A 3OMCA 3M4OB 4FVMA 3LX0A 2RQXA 1M90C 4A3MB 4J1MA 3SK6A 4B9XA 5FLXE 5KYIA 2A1AA 1QILA 2UUBL 2B63G 1B53A 1VMPA 2QF7A 4HIOA 3CQZB 1FGUA 4U673 1HNWQ 1E2WA 1QUQB 2K5WA 1EYGA 4KD4A 1NR2A 5IGEA 2OXPA 3V2TA 4F88A 2QCPX 3GTJH 1JWMD 3B6YA 4B3TQ 3S2DH 4JI5Q 5EGTA 1EIHA 4UP7A 3K0YA 2WAQE 1PYSB 3MXPA 2EYPA 3RNUA 3FHWA 4IUVA 3D4DA 2Z4IA 1SYDA 3W3AA 2B29A 4C3JG 1Q81C 3LWEA 4R1JA 1PRTF 1N32Q 1SBBB 2SNMA 3M3YH 1X65A 4QJFA 1G91A 2VB3X 2A6HC 4JVZA 3NPPA 2NVXH 1D5XC 1CA5A 5TSSA 5LMUQ 5IODA 4ID6A 4BY7G 4GOPA 4GKKQ 4B3RL 2F0HA 3L3OC 4DAYA 2EIFA 1KABA 5E4XA 1TU2B 1O7ZA 1AZPA 4A3CH 4G7OC 4ZQ3A 3JAMc 2E2DC 1WTPA 3KF8B 3DM1A 3CC7A 5JJZA 4DV0L 1KRTA 3RUZA 4DV7Q 1IW7C 4GNXB 4R4CA 3M7NA 2F0DA 4JI8Q 5IYBH 4LUZA 4A3IG 4C1NK 4A93H 3OOCA 2KEEA 4JV5L 3TZDA 1TKWB 4JOIA 3GTJB 3S2DB 3RLNA 2UXBQ 4KY6A 5EAYA 2F0NA 3HOWB 1JWSD 2F3IA 4A3LH 5AJ3Q 2K33A 2RCFA 4K6LA 3ULLA 5KNCA 4LF7Q 3AU7A 1HTLD 3KLWA 1HNZL 1SEBD 2B63H 1SMYD 1MKHA 3M3YB 1M1KC 2JA9A 3NE5B 4DV4L 3W2DA 4NXNQ 2Z6BA 3K5MA 2NVXB 3FPPA 4LUOA 2YYZA 3BDOA 4UP9A 4WRDA 2J4XA 3E6ZX 1LT4D 1H9SB 5E3FA 2ZT9C 3HGBA 4DK3C 4X66L 1CZGA 4YWMA 4K5WA 4CDFC 1QJOA 4IN3A 3T1YQ 4OO1H 1GO3E 1XMQL 2DNEA 5C3EG 4A76A 3HOYG 2B2UC 1SNDA 1F2ZA 3RLOA 4ZUIA 3M4QA 2K05A 1C4QA 3FKIG 1NBWA 1X54A 1I4PA 1X56A 5I9OA 5FOBB 2JQOA 4BY1G 4DA2A 1G8ZD 4A3GH 1BBUA 2HHHQ 2SNSA 1NSNS 4DU9A 4ZUJA 2O4XA 4BY7H 1PTOF 4OWTB 5DNFA 4HMIA 2Q8IB 3RZDH 1SXTA 5C4ZA 1L0YB 2X69A 4HEDA 1YHBA 3QOJA 1C8CA 5E7NA 2HQLA 3GTMH 3AFPA 5DEHA 5H1SE 1X3GA 2L55A 4BA2I 3HRZC 1ILPA 3J81c 1VQJA 3OIQA 1T9HA 4NPSA 4S3SA 1YNND 2B63B 4LNQA 3TP7A 1X3EA 1VMCA 4EQNA 4PZ8A 2N49A 4A3IH 4ODGA 3KJPA 4GKKL 2WFWA 2HCIA 2FFKB 4MHEA 3JC66 1RHPA 1XTDA 4FNFA 4GZYC 5C3XA 3C1EA 2BA0A 4MZ9A 4HAEA 2B2VA 3HEJA 1Q82C 3J7AV 2HT1A 3CKIB 1S5CD 1HHVA 3VYRA 4C3JB 1K3RA 2OF1A 1N36Q 2OT2A 3X3MA 2WAQB 4WFN3 5D3DA 3PIP3 3CC2A 3S15H 2B8FA 2LXJA 1STHA 1EU3A 3K7UC 1YEZA 2VW9A 1ML0D 2PQAA 4F87A 3JAML 3J7YW 2VUMG 1NMFA 4BY7B 1AEXA 1VQ5A 5EQ0A 3FMCA 1I94Q 2YU9H 1X32A 3RZDB 4NW2A 5C3EH 4GN5A 4DR2L 5M3FG 5EPKA 3PO2G 1A3UA 4FXDA 3I2ZA 4HCSA 3FEWX 3FKIH 1S4ZA 1HRJA 2RDFA 4K5VA 5EKIA 5I2XA 4BY1H 4RGTA 2L1BA 4A3IB 4NXMQ 1CZWA 2K01A 1HXYD 2EYOA 2G9HD 3T1YL 4JI3Q 2CWAA 2L9HA 2HCCA 2JA5G 1KLGD 4UY8C 4CJ0B 4PV1C 4Z9CB 1CHQD 4P72A 1D5MC 3NBHB 4P73A 4LMQD 1SE8A 1B9NA 3SE0A 3G6JB 5CBEE 2NTSA 2HDLA 2F0IA 3S15B 3SVMA 3X3NA 2E5LQ 2UXDQ 4AQYQ 1CHPD 4DAPA 1F2LA 1F9SA 3A55A 2N3SA 2YTVA 1PFBA 4EX5A 1PYWD 3OTOL 1DONA 1RTOA 3T56B 2Q2HA 1DCZA 2BH8A 1TS2A 1PDQA 5T1IA 5C3EB 1BKBA 1BF4A 3HOYB 3OSOA 3NK9A 2QKIC 1B1ZA 1S5BD 1KRSA 5COYA 3J81i 4ME3A 1V8QA 3FKIB 4LF5Q 1BR9A 1LTID 1YJ9A 2XN9C 3K5LA 2Z1CA 3PMFA 4RKBA 2NTTA 1N8RC 1SFOB 3E9IA 2PNRC 1LTTD 2VUMH 4DF7A 1K8AC 4JI7L 4DR3Q 4JPBW 1ZKOA 4JI6L 4K2KA 2NN6I 2A19A 4KMUC 4JI2Q 5M3FH 4YHHQ 3PO2H 2KECA 1GM5A 4JYAL 4GKJL 4QY7A 1HZAA 4OO1I 1EOTA 1MSGA 4DR5Q 3J7ZC 4XTCS 1A2TA 1PH2A 1HQRD 1E2ZA 1MHWC 1ENAA 4QMGA 1WFQA 2DJGC 4DR1Q 3D6WA 1BUVT 1QNKA 3R93A 2JA5H 1QVFA 1AZQA 1MIUA 2IX0A 5CC4A 4L6TB 3EFXD 3DWAA 1TQOA 3F2BA 1XPOA 4XQJA 2L11A 3S9WA 1VQ6A 1K3BC 2C5CA 3UDIA 2XWBB 3S1NH 5HGTA 4IJLA 2EY1A 3ICEA 1G2TA 1G291 2EPBA 2KOLA 3K81C 1GUTA 2ZJRA 3K0XA 1LACA 3KLRA 4CDEC 2VUMB 3NQIA 1LUZA 4IALA 2K5VA 2FXQA 3L0OA 5ELDA 2R7FA 1SN8A 4H13C 3R2TA 4IUNA 2MJ8A 4R4QA 1SYEA 4GOPC 3H3VH 4MNOA 1R9TH 1B7YB 1X3FA 3GTQH 1S5DD 2E2HH 1I6HH 2JEBI 1EZ8A 1LLRD 2PW5A 2PCFB 4AQYL 1Q46A 3I73A 2XWJB 2A74C 5KEEA 1EY7A 3A8JE 3TZUA 5DLQE 4RGOS 1HFNA 2QA4A 2WB1E 1RTNA 4IUUA 2K75A 1KQSA 4KN7C 3SR1A 4BBSB 3CXCA 4KHPL 3KJOA 5JOBA 4K8IA 3TBIB 4TRDA 1IHZA 5KNBA 3HKZG 4ABNA 1YHQA 3IFDA 1WTVA 1B3AA 1S5FD 2B2YC 2IPKD 3C1FA 2NB0A 1KAWA 2KBNA 3TDQA 3OW2A 2R6GA 2GN5A 3RR5A 1BCPC 3DHQA 2F3VA 4V0BA 5FLMG 3GTPH 4OX9Q 4WJWA 3S17H 1EQTA 1EOVA 3BJUA 3D3RA 4NP5A 3S2HH 3GO5A 2RHQB 1HH2P 1PFNA 4G57A 1GUNA 2ASBA 1MJCA 3WOFA 1KIXA 4YWLA 3QO2A 2I07B 1XNRQ 1TS3A 2A5HA 1KNAA 2N55A 2FHTA 3H91A 3MXNB 2AHOB 2IX1A 4XYQA 5GQOA 3NENA 4L5QA 4BBRH 2E2IH 3BDCA 1XWEA 4YHHL 1FR3A 2B2TA 4NDXA 1TVXA 2J7ZA 3RN5A 4DK0A 2F0MA 2RF4A 4APVA 2N78A 2A6EC 2RCNA 4DR5L 1K9MC 1R9TB 1UAPA 3PIO3 2XIWA 3GTQB 1I6HB 4ME5A 3PF4A 2SEBD 5HGQA 2HQEA 1YNNC 3E0EA 1WJJA 2ZXPA 2JN4A 1VQIA 1TS4A 5A35A 1HCZA 4KJNA 3CCEA 2J0TD 2V1CC 1FNVA 2Y0SE 1HZ9A 4ZKBB 4QQBX 1K83H 1STGA 4YCWA 4IO9A 5JJKA 5DAUA 1O7LA 3V96A 1OTCA 4IPHA 5CV4A 5JJLA 2G9DA 2ICEC 4DR7L 4ZRZA 4B3RQ 1PVOA 1Q7YC 2GA4B 2Y0SG 2KJXA 5JPNC 2OWOA 1HFGA 1D1KA 4PZ7A 4GOPB 1J5EL 1PRTC 3AEVA 3S2HB 2JYOA 4ALPA 3A5ZB 4WJ3M 3CQZH 4DK1A 2Z6KA 4DV0Q 3UE1A 2D62A 3GTGH 1JT8A 4B3ML 4A3DG 4DAMA 4C1NI 1CKNB 5GAHC 3NELA 4DN4M 5C0XI 3D31A 3P7JA 1BXTA 4JV5Q 5K36H 3GDEA 3TQYA 1HZBA 1F9PA 4PMWA 2OTJA 3AQQA 4K2LA 1S40A 2AUJD 2JEAI 4A3BG 1UE1A 2F3WA 1EY6A 1EY5A 4QUFA 1X3PA 3VA7A 1XPUA 4OGQC 4CDCC 1NR4A 4IFDG 3MA2B 4QL5A 1EYCA 4ZCKA 1BCPB 3K5OA 2F0FA 1HNZQ 3BVGA 3NP8A 5I4DA 1Q3LA 2VZAA 4XIGS 5FO8B 2X6GA 3G6EA 1PH9A 3FPUB 1J6QA 4DV4Q 4KD3A 1CTMA 4PNYA 4GLXA 1K83B 2NZOA 1PHJA 2PW7A 3PV0A 2D2CC 3SEBA 4OX9L 1LV9A 3TRZA 4X66Q 5BN3A 3U4ZA 1ASZA 5DM73 3DEPA 2PYKA 3HOUG 2NZ1D 4OIJA 3U50C 3EA6A 3VYUA 3TS2A 3VDYA 2K52A 1XMQQ 2M9VA 2QGQA 1K8GA 1XNRL 5DM63 5M5XH 2ZJQA 1UE5A 2IHFA 1XJVA 5CV6A 2KUMA 3KLSA 2EYHA 2C9OA 3NTKA 2JA8G 2VNUD 5LMNQ 1SLJA 3GTGB 3DMUA 1RIPA 1BDOA 1WYDA 1D8LA 3HKZB 2CQOA 3HKSA 4X62L 1I4HA 3HOWH 4C2MB 1SNCA 2Q2UA 3KYHC 4PQXA 3HOVG 1D7QA 2CHBD 5BR8L 5HY6A 1QWYA 1KHIA 3TEHB 2WAQG 1KC8C 2LFNA 4YIJA 2B2WA 1VQFA 3IL8A 1SNPA 3ONAB 1A8VA 1TR5A 2B8GA 3C46A 2A73B 2UU9L 1PRTB 3KUPA 2F4IA 4HTHA 3BZKA 3I3CA 1PTOC 1OXXK 1XTCD 1OXTA 1B8AA 4K6DA 2EJFC 2KCNA 1GUWA 4KLKA 4KV6A 2EY5A 3IFTA 1PZJD 2RSOA 4HSPA 1K0SA 4K0KL 5A2QE 1LABA 4A3BH 5CV8A 3EROA 1YI2A 2MHVA 1KLUD 1U4PA 1H9RA 2AWNA 4X3TA 1VDZA 1ONLA 4IFDH 4U68A 2F0JA 2OQKA 5M5XB 4ZAIA 3I55A 5C6AA 4A4IA 2HIVA 2KHIA 3TP5A 5EKLA 4IUQA 2MO1A 3CCUA 4H0LC 3I72A 3QB3A 2NYZD 3URYA 4PMBA 4X64L 4EQ5A 3VR3A 3F8TA 1LTAD 2QDBA 1JB7A 1BNZA 1ILQA 2NWGA 2DNCA 2H1EA 3HOUH 3FDTA 3T1HQ 2Y0SB 4RH6A 2ZM6Q 2JP1A 1IBKL 4WORA 4DR2Q 2OTLA 1N34L 3C3LA 1LTLA 1J9OA 3CCMA 3WOEA 4FF4A 3KDFA 1KDAA 4XQQA 2CVRA 3DWQA 4A3DB 4OONA 4Y7NH 1LM0A 3HOZG 4R8NA 1OO9B 1SJHD 4PZ6A 1WTQA 3PUYA 4RGMA 2MUYA 1IKMA 4RCOA 1F2MA 5ISRA 4L63B 4UPAA 3TP8A 4YWKA 3HOVH 1KDBA 4CDDC 4A3BB 1SNQA 1A15A 2F0PA 1I4QA 5IGCA 3DWPA 4C3JH 1YHAA 5NUCA 3DXJC 5LMNL 1SAPA 3V05A 1LT6D 2Z9HA 1YNXA 3CD6A 1L1OC 3D6CA 1HR0L 3ITPA 2C35B 4FYDA 4KI0A 1STAA 5C0XJ 3CCSA 4FO2A 4CKCA 2Z0SA 3UDXA 3IRBA 1Y1VG 1IBML 1QUQA 3OTOQ 4NMZA 3T53B 4GS3A 1PZID 4IPCA 3HOUB 4O42A 1JOOA 1PTOB 4KK7A 1SYCA 3DM3A 3KF6B 5GAEC 1VQKA 3SGIA 4I7AA 3NWTA 1QZGA 5C4JB 1Z9FA 2ENBA 4OWWB 1PH4A 2F0VA 1KNEA 1A3VA 2JA8B 2EXZA 4L5RC 2R3ZA 2DY8A 1NY4A 2NVTB 4C3IB 3FP9A 2BE5C 1TXYA 3CMAA 4Y7NB 3AB9A 4I7ZC 3RD4A 1E1TA 3J81E 4WJ4A 1HJPA 4A3KB 2K7VA 1G6ZA 2IL8A 3K59A 3QIAA 2Q2IA 2KEDA 3K58A 4JI7Q 5IOCA 4KJOA 1IZ6A 1VQHA 4JI6Q 3R8BA 3HOVB 4XXEA 5IYCG 3JAMi 3K7AH 3VA5A 3ND9A 4IOAA 5IP7G 3OWEB 2A69C 4JYAQ 1ZYRC 4RFBA 4GKJQ 4FXGC 3UDFA 2KENA 5C4HA 3HOZH 2K32A 4MTNA 2JA7B 2ALYB 1STYA 1IBLQ 4MIUA 1XPRA 1TWAB 2ID0A 4GNXA 1EL0A 1F9RA 3EVQA 1LT3D 1ICFB 3BZDB 3HOXG 4RGNA 2BOSA 3T1HL 2EJMA 3GP7A 1BQQT 4K5XA 2ZM6L 3HOYH 3MZ5A 2O5IC 1A63A 4ULLA 2EYFA 4JI4Q 2I5LX 4DV6L 4LJZC 1EUJA 4P74A 1VQGA 1Z47A 4J15A 5K5PA 3MFYA 2CW0D 5M5YH 1SFOH 1FJGL 3PUWA 1GJXA 4DAVA 3MHBA 1QVGA 2AUKA 2Z4HA 3PF5A 1DOMA 2CH4A 1VQ4A 1Y1VH 4P75A 4JI0L 4QIWE 4BBSG 4V190 5D14A 4ILWA 1EU4A 1CSQA 3GTLH 1L1OB 1H9SA 4IUPA 2IW3A 2D0PA 2I5HA 4RCNA 4YCVA 2BH2A 2WINB 3CPFA 3K7AB 3E3XA 3GTKB 3EBEA 1K73C 4AYBE 5JEAJ 3MWYW 3VR4A 2RDHA 3HOZB 2A68D 2MO0A 1DOLA 1YNJC 3T13A 5I2YA 2NBFA 4AYBG 2M00A 4DV1L 1WI5A 3Q8DA 1VQLA 4KHPQ 5CV9A 4RAUC 5IYCH 1DJRD 5KRUA 2IT1A 4H7BA 4G7ZC 2VL6A 5IP7H 2E2JH 1SMXA 2I46A 4XQNA 4DNRB 1PV4A 3I4MB 5M5YB 4KHVA 2H4OA 1LYLA 1TT2A 4ZLTF 3P20A 3BVZA 3KBGA 4DV2Q 5FK9C 3CCVA 1Y1VB 1SE3A 3HOXH 2A8VA 5D3IB 1SYBA 1YJNA 1ESFA 3GTLB 1J8IA 1OXSC 1KXLA 1RDPD 1I3QH 3J81j 1L2FA 5FJ8G 3CPWA 1OXUA 2B3GA 2K03A 2WV6D 4A3FG 1EQVA 4R9WA 3TS0A 3NXWA 2FMCA 4N9TA 1K8OA 2XGTA 1IBLL 3H0GG 3KFUA 1Q1BA 3G4SA 4H44C 1V1PB 2VQEQ 4DV5Q 2EVBA 3U9OA 4B9WA 3N6RA 4LUVA 3HFZB 4M8AA 4BBSH 1XMOL 2F4VL 4JI4L 1NCVA 2JE6I 4FP5D 1Y1WG 1UNSA 5EBDA 1VQNA 1Y69U 2AWOA 3Q23A 2E2JB 1IW7D 5IT9c 1WCMG 4QGUA 1C9OA 1JQYD 1YVCA 4DR7Q 3N52A 1EZ6A 2IY5B 2F0UA 3PUXA 1J5EQ 2LXKA 2B2UA 1N9WA 1CKOA 1ENCA 5KNDA 2DGYA 2XVSA 2BDOA 3HOXB 4C3HB 2JXMB 5BN4A 1NMGA 1I4XA 4B3MQ 1CQVA 1I3QB 5T1GA 3I70A 2UUCQ 1KD1C 3A0JA 3BZCA 1F77A 1VS0A 1VQ8A 4E6IA 4LF6Q 2F0EA 2GVAA 2E75C 2K50A 1SMYC 1JOQA 5M5WB 1NTGA 2AMCB 3RN2A 4IURA 3NUCA 1L0WA 1XX8A 5EJWA 3OHXC 1FL0A 1Z6HA 3S16H 3A8KE 1EY4A 5J3BA 2NVYB 1K8MA 4GN3B 3PQIA 3SXHA 1ET9A 1LO5D 2UUAQ 1WTHA 1L0XB 1SE4A 5FJ8H 4F8MA 3K5NA 1O78A 1WOCA 2OEOA 4JOIC 4K8JA 2WB1G 2YTXA 4GN4B 1YZ6A 1UE6A 2IX3A 1SYFA 2F03A 3KLSX 1EQQA 4P71A 2RA4A 2WIIB 3H0GH 4X65Q 2QILA 4DV2L 1X55A 2FJ2A 4UDUC 1PXUA 1JE5A 5KGUA 2SOBA 3K80C 4UAIA 3K6OA 4AYBB 4ZK9B 4RA8A 4EQOA 2F0OA 1AP0A 1CI3M 2F52A 2F0KA 2ZTCA 2KHSA 1Y1WH 4YY3Q 1Q86C 5D65A 1CK1A 1PMRA 3A54A 2Q8TA 2TSSA 1HNXQ 1V1QA 3J80c 3BU2A 1WCMH 4X62Q 4FF2A 2PZTA 3AMUA 3LNNA 2VQEL 4DV5L 4O1NA 5BR8Q 4DK6C 2MP1A 1EIGA 1CKMA 4M1UB 4OWXB 3S16B 2CCZA 3CRLC 5C4XG 4DR6Q 4HIMA 2UU9Q 3M85A 1TWHB 1CA6A 4R4TA 3J7A5 1R4PB 1JORA 4POFA 1YBYA 1GXDC 4QF4A 1QE6A 2ZXOA 1S5ED 4A3FB 1BO0A 4K0KQ 1TS5A 3H0GB
chains in the Genus database with same CATH topology
4A4IA 2HIVA 2KHIA 2PQAA 4NB3A 2ZJPA 1G51A 1Q12A 5IYDH 2E8GA 4DAYB 2VUMG 3U58A 1NMFA 2MO1A 4BBRG 3CCUA 4RG1A 4R4OA 2VY3A 1EFWA 5GADC 1VQ5A 1C7YA 1S72A 4X64L 1I94Q 2YU9H 4LF9Q 4EQ5A 3F8TA 4GLVB 1VQCA 4UP8A 1I5FA 3CCQA 4A3JG 3D0FA 4DUZL 1JB7A 5C3EH 2UUCL 4DR4L 2K4KA 4GN5A 2K5NA 4DR2L 5M3FG 2UXCL 3HOUH 2EXDA 4X64Q 3W1BA 5C44G 4LF6L 3PO2G 4C2MH 3PO3G 3F2CA 3T1HQ 4X6AH 3I2ZA 2ZM6Q 5FLMH 1IBKL 3FKIH 1PH3A 4NXML 4DR4Q 4DR2Q 2OTLA 1L1OA 2UXCQ 1N34L 1X6OA 1VQBA 1LTLA 4JI3L 2WP8J 4BY1H 1AE3A 3CCMA 4HIKA 3KDFA 3MEFA 1IBKQ 4NXMQ 3AYHB 1PH5A 4OONA 4Y7NH 1LM0A 3ER0A 2KHJA 1N34Q 3HOZG 1RL2A 4DV3Q 4PZ6A 3ZJYC 3T1YL 1X9NA 4JI3Q 3L2PA 3PUYA 2CWAA 2NZHA 2UUAL 4Y52H 2JA5G 4RMFA 4UY8C 1IXRA 1VQEA 4JI1L 4UPAA 4P72A 1UEBA 3NBHB 4P73A 1YIJA 1SE8A 4YWKA 3HOVH 1TWHH 2E5LL 3W1GA 4JC0A 2UXDL 1AH9A 3CAMA 4LWCA 4JI1Q 4C3JH 4X65L 3CF5A 4A3MG 4LW1A 1YHAA 3OYYA 3HKZE 2BA1A 4BXXH 4A3FH 5LMNL 2E5LQ 3L7ZC 2UXDQ 4AQYQ 3CW2C 1XNQL 1QZHA 3S1MH 2N3SA 2YTVA 3EN2A 3I56A 4EX5A 3OTOL 1YNXA 4IJHA 3CD6A 1Y14B 3RZOH 1L1OC 3K8AA 1HR0L 1E1OA 2C35B 3LGJA 4KI0A 4O0AA 5FLXc 5C0XJ 3CCSA 2Q2HA 4LF4L 4YY3L 1JJGA 5C4XH 2Z0SA 3UDXA 3IRBA 1XNQQ 2BH8A 1Y1VG 1V43A 4GLAC 1IBML 1BKBA 1QUQA 3OTOQ 4A3KG 3RLFA 3STBD 1HNXL 2XTIA 4LF5L 4GS3A 1HR0Q 1E24A 4IPCA 1KRSA 4LF4Q 5M3MH 2MQHA 3J80i 3J81i 3DM3A 1SRUA 3KF6B 1IBMQ 4ME3A 5GAEC 1VQKA 1GVPA 4LFCL 1DGSA 3SGIA 1ASYA 4LF5Q 2QEXA 3KOJA 3GD7A 2ZTEA 1Z9FA 1QZGA 2DUDA 1VQOA 4OWWB 1PH4A 1YJ9A 3H3VI 4DR3L 1FVIA 1K0RA 4DUYL 1N8RC 2UUBQ 3E9IA 4L5RC 3PUVA 3F1ZA 2I0QA 3I4NG 4IFDJ 2NN6G 1NY4A 1QVCA 2IHEA 3TREA 4LFCQ 2VUMH 1OXVA 3ERSX 3FP9A 1TXYA 3CMAA 4JI2L 4HJ9A 3GTQH 4DR6L 1K8AC 4JI7L 1E1TA 4A3DH 4DR3Q 1HJPA 4WJ4A 4A3JH 3PIOA 4JI6L 2JA7G 4JG2A 2MNAA 2NN6I 4OO1G 2AKWB 4A75A 2A19A 1AE2A 4JI2Q 3A5UA 5M3FH 4YHHQ 2Q2IA 4JI7Q 1VQDA 2KCMA 5C44H 1VQAA 2PNHA 3PO2H 1GM5A 4JYAL 3PO3H 4LFBL 1IZ6A 1VQHA 5ELNA 4JI6Q 2R93G 2I5MX 4GKJL 4QY7A 1HZAA 5IYCG 3JAMi 3S14H 3K7AH 4OO1I 4DR5Q 3CP0A 3J7ZC 4XTCS 4IOAA 3F2DA 5IP7G 1P8LA 3WWVA 1PH2A 4DR1L 4JYAQ 4LFBQ 4GKJQ 1V9PA 2VS1A 3UDFA 4A3GG 3GTOH 1WFQA 4LF9L 2KENA 3HOZH 2JJQA 4POGA 1Q1EA 1EQRA 4MTNA 4DR1Q 2ALYB 1P16A 2ZTDA 4IPDA 1IBLQ 1XPRA 2ID0A 2JA5H 1QVFA 4GNXA 1MJEA 1MIUA 2IX0A 4LFAQ 1TWGH 1E3PA 3ULJA 3HOXG 3HOWG 4L5SA 3T1HL 2MFIA 1UE7A 2ZM6L 3HOYH 1PFSA 3F2BA 1XPOA 1CKNA 3S24A 1A63A 4JI4Q 2I5LX 4DV6L 1TWCH 1VQ6A 2PQAB 3UDIA 3M4OH 1EUJA 4P74A 4BA1I 1VQGA 1U5KA 1Z47A 1SROA 4PG3A 4A3MH 3S1NH 4J15A 4IJLA 1CSPA 3ICEA 1G291 2R7DA 5C4JH 4DV6Q 3K81C 5GROA 2ZJRA 3K0XA 5GAGC 4JBMA 4DV3L 5M5YH 4TQUS 3CCJA 2JA8H 1EWIA 1IYJB 1SFOH 1NJIC 3PUWA 1FJGL 3CMEA 2R92G 1LUZA 2NVTH 4C3IH 1QVGA 2K5VA 1BVSA 2FXQA 3L0OA 2CWPA 2R7FA 1SN8A 3PF5A 5LMNW 1VQ4A 1Y1VH 4P75A 1YJWA 4JI0L 3E9HA 4QIWE 4A3KH 1PH6A 1FJGQ 4BBSG 1EIFA 1U0LA 2HIXA 1CSQA 3NEMA 4R4QA 3DLLA 4GOPC 1L1OB 3GTLH 3H3VH 4MNOA 1HR0W 4FDBA 4IPGA 1R9TH 4DKAC 2D0PA 1B7YB 1X3FA 2I5HA 4GNXC 2E2HH 2LSSA 2JEBI 4YCVA 4DPGA 4A3EG 4JI0Q 2BH2A 3KDFB 4A3CG 4WJ3M 3CPFA 1BBWA 3EIVA 3PSIA 3CCRA 2GVBA 2R7ZG 4AQYL 3EBEA 1Q46A 3H15A 2OQ0A 2Q2TA 1K73C 4H02A 4YCUA 1W3SA 4AYBE 3I4NH 2JA6G 5JEAJ 5DLQE 4LF8L 4OXPA 2WB1E 5IYBG 5IWAL 2VQFL 2QA4A 3M9BA 2MO0A 2K75A 2NVQH 3I4MG 4A93G 1KL9A 1KQSA 4HJ5A 3CXCA 2JA7H 3S1QH 1VQ7A 3U4VA 3KJOA 4KHPL 2N8NA 1TWAH 1HZCA 4AYBG 2CFMA 5IWAQ 2PI2E 3HKZG 2VQFQ 4DV1L 3S1RH 2ES2A 1WI5A 3W5OA 1YHQA 5K36G 3OW2A 4HJ7A 4A3LG 1KAWA 2KBNA 3Q8DA 2R93H 2R6GA 1VQLA 2GN5A 3RR5A 2KCTA 4HJAA 1JJCB 4O2DA 5IYCH 4KHPQ 5FLMG 3GTPH 4OX9Q 2IT1A 1TWFH 4DV1Q 1M90C 3S17H 2VL6A 1EOVA 3BJUA 5IP7H 2E2JH 2A1AA 2UUBL 2B63G 3GO5A 2RHQB 2YV5A 1HH2P 3S2HH 2ASBA 1SMXA 1MJCA 4HIOA 4B3TL 1KIXA 4YWLA 1PV4A 5IY0A 4JI5L 1C0AA 1FGUA 1O7IA 1XNRQ 1HNWQ 1LYLA 1QUQB 1EYGA 3M4PA 3MXNB 2AHOB 2IX1A 5GQOA 3NENA 4L5QA 4BBRH 3B6YA 3GTJH 1W2BA 4DV2Q 4B3TQ 3S2DH 2E2IH 4JI5Q 4YHHL 3CCVA 3PUZA 4UP7A 3HOXH 2WAQE 3RN5A 1A62A 1PYSB 2A8VA 4L5TA 1YJNA 1N32L 2RF4A 3RNUA 1KXLA 1OXSC 3FHWA 1Q8KA 1I3QH 4APVA 3J81j 2N78A 2RCNA 4DR5L 3ULPA 1K9MC 2YTYA 1L2FA 5FJ8G 3CPWA 1OXUA 2B29A 2B3GA 3PF4A 1Q81C 4R1JA 5HGQA 1N32Q 3E0EA 5LMUL 1N33Q 3M3YH 1X65A 4QJFA 4A3FG 3TS0A 3GTKH 1WJJA 1VQIA 4DNIA 2XGTA 2NVXH 2D0OA 1IBLL 3H0GG 3KFUA 1Q1BA 2R92H 2JK8A 3G4SA 4JBWA 3CCEA 2VQEQ 5LMUQ 4DV5Q 4B3SQ 4LFAL 2ATWA 1EIYB 2V1CC 4BY7G 4LUVA 5IP9G 4GOPA 4GKKQ 3HFZB 2Y0SE 1HZ9A 4BBSH 1UWVA 4QQBX 4IOCA 4B3RL 1K83H 4YCWA 4IO9A 1XMOL 4JI4L 2F4VL 1VQPA 5JJKA 2JE6I 1I94L 2EIFA 3PIPA 1Y1WG 1OTCA 4IPHA 4A3EH 5JJLA 4TVAB 4DV7L 4HJ8A 4DR7L 1S3OA 4A3CH 3JAMc 1VQNA 4B3RQ 1XMOQ 2F4VQ 1PVOA 2R7ZH 3KF8B 2AWOA 4JI8L 2Y0SG 3CC7A 1Q7YC 4DV0L 2OWOA 5IE8A 1KRTA 2VW9A 1NE3A 4PZ7A 5IT9c 1WCMG 4QGUA 4GOPB 1J5EL 3AEVA 1C9OA 1VQMA 1YVCA 1I50H 4DV7Q 1PH1A 2JA6H 4DR7Q 4GNXB 4R4CA 4ALPA 3M7NA 3G48A 3A5ZB 1PYBA 4JI8Q 3CQZH 1VCIA 4LUZA 2Z6KA 5IYBH 5C0XG 4DV0Q 4A3IG 2IY5B 2UXBL 3UE1A 2D62A 3PUXA 1J5EQ 3GTGH 3I4MH 4A93H 4JV5L 4B3ML 4A3DG 1JT8A 5AJ3L 4DAMA 1CKNB 2LXKA 4JOIA 1N9WA 1PA6A 1CKOA 5GAHC 3NELA 3PGZA 4LF7L 2DGYA 5C0XI 3RLNA 3D31A 4JCVE 2UXBQ 5EAYA 4JV5Q 1NMGA 2F3IA 4B3MQ 2L15A 4A3LH 5AJ3Q 3GDEA 3TQYA 1HZBA 4PMWA 2OTJA 3AQQA 3ULLA 4DUZQ 1S40A 2UUCQ 1KD1C 4LF7Q 3A0JA 4NXNL 2RHSB 3BZCA 3KLWA 1JJ2A 2JEAI 1HNZL 4LF8Q 1UE1A 4A3BG 1I6HH 1XPUA 1VS0A 1VQ8A 2B63H 2PMZE 4LF6Q 1MKHA 2CKZB 4IFDG 1M1KC 2GVAA 4QL5A 2K50A 2JA9A 1NTGA 4DV4L 4NXNQ 2AMCB 1HNZQ 3RN2A 4LUOA 1L0WA 2YYZA 2VZAA 4XIGS 3G71A 4UP9A 4HIDA 2OCEA 1VQ9A 5IYDG 3G6EA 4IFDI 5JJIA 1PH9A 1FL0A 4R4IA 3AFQA 1PH7A 1J6QA 4X66L 4DK3C 4DV4Q 3S16H 5J3BA 5ELOA 4YWMA 3PCOB 4GN3B 4GLXA 1PHJA 2NZOA 2Z6KC 3T1YQ 1GO3E 3PV0A 1XMQL 2UUAQ 5C3EG 4A76A 3HOYG 4OX9L 3TRZA 4X66Q 5FJ8H 3U4ZA 1ASZA 1WOCA 4JOIC 3HOUG 2WB1G 3U50C 2YTXA 4GN4B 1PH8A 3VDYA 3TS2A 1YZ6A 3RLOA 3M4QA 2K52A 4JBJA 1XMQQ 1H95A 1UE6A 2HHHL 4AIMA 3FKIG 2QGQA 1K8GA 1XNRL 1NBWA 3CCLA 1X54A 1EQQA 5M5XH 4P71A 2ZJQA 3H0GH 4X65Q 1UE5A 2IHFA 1X56A 1XJVA 2JA8G 2VNUD 2JQOA 4BY1G 3KF6A 4DV2L 1X55A 4A3GH 1BBUA 3CC4A 2HHHQ 5LMNQ 1SLJA 1RIPA 4BY7H 3UE0A 4OWTB 5IP9H 3I7FA 2PI2A 1WYDA 1JE5A 1D8LA 3K80C 3RZDH 2CQOA 3HKSA 1YHBA 1HNWL 2F52A 1Y1WH 2K14A 2ZTCA 3STBC 4X62L 4C3HH 4YY3Q 5E7NA 1Q86C 2HQLA 3GTMH 3AFPA 3HOWH 1YITA 2Q2UA 1GD7A 1N33L 3KYHC 1X3GA 5H1SE 1HNXQ 3HOVG 1V1QA 4BA2I 3J80c 3J81c 1VQJA 1D7QA 1T9HA 3BU2A 4NPSA 5BR8L 1WCMH 4X62Q 5HY6A 1GKHA 4LNQA 1KHIA 1X3EA 3TEHB 2WAQG 2VQEL 4PZ8A 4DV5L 4BXXG 1KC8C 4B3SL 1VQFA 2N49A 1A8VA 4AH6A 5M5WH 5BR8Q 4DK6C 2EQSA 3KJPA 4A3IH 4GKKL 1A0IA 2WFWA 1CKMA 1CUKA 2UU9L 1G6PA 4DUYQ 1IL2A 4OWXB 3BZKA 3JC66 3UDGA 1E22A 1XTDA 1OXXK 2CCZA 1OXTA 1B8AA 1E7ZA 5C4XG 4DR6Q 2BA0A 2NVYH 4MZ9A 1N36L 4KLKA 1JMCA 4HIMA 1B70B 2UU9Q 1SR3A 3A74A 3M85A 1Q82C 4K0KL 2HT1A 3I4OA 4JBKA 4R4TA 3J7A5 4POFA 4A3BH 5M3MG 1YBYA 1YI2A 1K3RA 1N36Q 2H5XA 4KHZA 2AWNA 2K5HA 5JEAG 3CC2A 3S15H 4K0KQ 2LXJA 2OQKA 3K7UC 1YEZA 3I55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4I A;  2HIV A;  2KHI A;  2PQA A;  4NB3 A;  2ZJP A;  1G51 A;  1Q12 A;  5IYD H;  2E8G A;  4DAY B;  2VUM G;  3U58 A;  1NMF A;  2MO1 A;  4BBR G;  3CCU A;  4RG1 A;  4R4O A;  2VY3 A;  1EFW A;  5GAD C;  1VQ5 A;  1C7Y A;  1S72 A;  4X64 L;  1I94 Q;  2YU9 H;  4LF9 Q;  4EQ5 A;  3F8T A;  4GLV B;  1VQC A;  4UP8 A;  1I5F A;  3CCQ A;  4A3J G;  3D0F A;  4DUZ L;  1JB7 A;  5C3E H;  2UUC L;  4DR4 L;  2K4K A;  4GN5 A;  2K5N A;  4DR2 L;  5M3F G;  2UXC L;  3HOU H;  2EXD A;  4X64 Q;  3W1B A;  5C44 G;  4LF6 L;  3PO2 G;  4C2M H;  3PO3 G;  3F2C A;  3T1H Q;  4X6A H;  3I2Z A;  2ZM6 Q;  5FLM H;  1IBK L;  3FKI H;  1PH3 A;  4NXM L;  4DR4 Q;  4DR2 Q;  2OTL A;  1L1O A;  2UXC Q;  1N34 L;  1X6O A;  1VQB A;  1LTL A;  4JI3 L;  2WP8 J;  4BY1 H;  1AE3 A;  3CCM A;  4HIK A;  3KDF A;  3MEF A;  1IBK Q;  4NXM Q;  3AYH B;  1PH5 A;  4OON A;  4Y7N H;  1LM0 A;  3ER0 A;  2KHJ A;  1N34 Q;  3HOZ G;  1RL2 A;  4DV3 Q;  4PZ6 A;  3ZJY C;  3T1Y L;  1X9N A;  4JI3 Q;  3L2P A;  3PUY A;  2CWA A;  2NZH A;  2UUA L;  4Y52 H;  2JA5 G;  4RMF A;  4UY8 C;  1IXR A;  1VQE A;  4JI1 L;  4UPA A;  4P72 A;  1UEB A;  3NBH B;  4P73 A;  1YIJ A;  1SE8 A;  4YWK A;  3HOV H;  1TWH H;  2E5L L;  3W1G A;  4JC0 A;  2UXD L;  1AH9 A;  3CAM A;  4LWC A;  4JI1 Q;  4C3J H;  4X65 L;  3CF5 A;  4A3M G;  4LW1 A;  1YHA A;  3OYY A;  3HKZ E;  2BA1 A;  4BXX H;  4A3F H;  5LMN L;  2E5L Q;  3L7Z C;  2UXD Q;  4AQY Q;  3CW2 C;  1XNQ L;  1QZH A;  3S1M H;  2N3S A;  2YTV A;  3EN2 A;  3I56 A;  4EX5 A;  3OTO L;  1YNX A;  4IJH A;  3CD6 A;  1Y14 B;  3RZO H;  1L1O C;  3K8A A;  1HR0 L;  1E1O A;  2C35 B;  3LGJ A;  4KI0 A;  4O0A A;  5FLX c;  5C0X J;  3CCS A;  2Q2H A;  4LF4 L;  4YY3 L;  1JJG A;  5C4X H;  2Z0S A;  3UDX A;  3IRB A;  1XNQ Q;  2BH8 A;  1Y1V G;  1V43 A;  4GLA C;  1IBM L;  1BKB A;  1QUQ A;  3OTO Q;  4A3K G;  3RLF A;  3STB D;  1HNX L;  2XTI A;  4LF5 L;  4GS3 A;  1HR0 Q;  1E24 A;  4IPC A;  1KRS A;  4LF4 Q;  5M3M H;  2MQH A;  3J80 i;  3J81 i;  3DM3 A;  1SRU A;  3KF6 B;  1IBM Q;  4ME3 A;  5GAE C;  1VQK A;  1GVP A;  4LFC L;  1DGS A;  3SGI A;  1ASY A;  4LF5 Q;  2QEX A;  3KOJ A;  3GD7 A;  2ZTE A;  1Z9F A;  1QZG A;  2DUD A;  1VQO A;  4OWW B;  1PH4 A;  1YJ9 A;  3H3V I;  4DR3 L;  1FVI A;  1K0R A;  4DUY L;  1N8R C;  2UUB Q;  3E9I A;  4L5R C;  3PUV A;  3F1Z A;  2I0Q A;  3I4N G;  4IFD J;  2NN6 G;  1NY4 A;  1QVC A;  2IHE A;  3TRE A;  4LFC Q;  2VUM H;  1OXV A;  3ERS X;  3FP9 A;  1TXY A;  3CMA A;  4JI2 L;  4HJ9 A;  3GTQ H;  4DR6 L;  1K8A C;  4JI7 L;  1E1T A;  4A3D H;  4DR3 Q;  1HJP A;  4WJ4 A;  4A3J H;  3PIO A;  4JI6 L;  2JA7 G;  4JG2 A;  2MNA A;  2NN6 I;  4OO1 G;  2AKW B;  4A75 A;  2A19 A;  1AE2 A;  4JI2 Q;  3A5U A;  5M3F H;  4YHH Q;  2Q2I A;  4JI7 Q;  1VQD A;  2KCM A;  5C44 H;  1VQA A;  2PNH A;  3PO2 H;  1GM5 A;  4JYA L;  3PO3 H;  4LFB L;  1IZ6 A;  1VQH A;  5ELN A;  4JI6 Q;  2R93 G;  2I5M X;  4GKJ L;  4QY7 A;  1HZA A;  5IYC G;  3JAM i;  3S14 H;  3K7A H;  4OO1 I;  4DR5 Q;  3CP0 A;  3J7Z C;  4XTC S;  4IOA A;  3F2D A;  5IP7 G;  1P8L A;  3WWV A;  1PH2 A;  4DR1 L;  4JYA Q;  4LFB Q;  4GKJ Q;  1V9P A;  2VS1 A;  3UDF A;  4A3G G;  3GTO H;  1WFQ A;  4LF9 L;  2KEN A;  3HOZ H;  2JJQ A;  4POG A;  1Q1E A;  1EQR A;  4MTN A;  4DR1 Q;  2ALY B;  1P16 A;  2ZTD A;  4IPD A;  1IBL Q;  1XPR A;  2ID0 A;  2JA5 H;  1QVF A;  4GNX A;  1MJE A;  1MIU A;  2IX0 A;  4LFA Q;  1TWG H;  1E3P A;  3ULJ A;  3HOX G;  3HOW G;  4L5S A;  3T1H L;  2MFI A;  1UE7 A;  2ZM6 L;  3HOY H;  1PFS A;  3F2B A;  1XPO A;  1CKN A;  3S24 A;  1A63 A;  4JI4 Q;  2I5L X;  4DV6 L;  1TWC H;  1VQ6 A;  2PQA B;  3UDI A;  3M4O H;  1EUJ A;  4P74 A;  4BA1 I;  1VQG A;  1U5K A;  1Z47 A;  1SRO A;  4PG3 A;  4A3M H;  3S1N H;  4J15 A;  4IJL A;  1CSP A;  3ICE A;  1G29 1;  2R7D A;  5C4J H;  4DV6 Q;  3K81 C;  5GRO A;  2ZJR A;  3K0X A;  5GAG C;  4JBM A;  4DV3 L;  5M5Y H;  4TQU S;  3CCJ A;  2JA8 H;  1EWI A;  1IYJ B;  1SFO H;  1NJI C;  3PUW A;  1FJG L;  3CME A;  2R92 G;  1LUZ A;  2NVT H;  4C3I H;  1QVG A;  2K5V A;  1BVS A;  2FXQ A;  3L0O A;  2CWP A;  2R7F A;  1SN8 A;  3PF5 A;  5LMN W;  1VQ4 A;  1Y1V H;  4P75 A;  1YJW A;  4JI0 L;  3E9H A;  4QIW E;  4A3K H;  1PH6 A;  1FJG Q;  4BBS G;  1EIF A;  1U0L A;  2HIX A;  1CSQ A;  3NEM A;  4R4Q A;  3DLL A;  4GOP C;  1L1O B;  3GTL H;  3H3V H;  4MNO A;  1HR0 W;  4FDB A;  4IPG A;  1R9T H;  4DKA C;  2D0P A;  1B7Y B;  1X3F A;  2I5H A;  4GNX C;  2E2H H;  2LSS A;  2JEB I;  4YCV A;  4DPG A;  4A3E G;  4JI0 Q;  2BH2 A;  3KDF B;  4A3C G;  4WJ3 M;  3CPF A;  1BBW A;  3EIV A;  3PSI A;  3CCR A;  2GVB A;  2R7Z G;  4AQY L;  3EBE A;  1Q46 A;  3H15 A;  2OQ0 A;  2Q2T A;  1K73 C;  4H02 A;  4YCU A;  1W3S A;  4AYB E;  3I4N H;  2JA6 G;  5JEA J;  5DLQ E;  4LF8 L;  4OXP A;  2WB1 E;  5IYB G;  5IWA L;  2VQF L;  2QA4 A;  3M9B A;  2MO0 A;  2K75 A;  2NVQ H;  3I4M G;  4A93 G;  1KL9 A;  1KQS A;  4HJ5 A;  3CXC A;  2JA7 H;  3S1Q H;  1VQ7 A;  3U4V A;  3KJO A;  4KHP L;  2N8N A;  1TWA H;  1HZC A;  4AYB G;  2CFM A;  5IWA Q;  2PI2 E;  3HKZ G;  2VQF Q;  4DV1 L;  3S1R H;  2ES2 A;  1WI5 A;  3W5O A;  1YHQ A;  5K36 G;  3OW2 A;  4HJ7 A;  4A3L G;  1KAW A;  2KBN A;  3Q8D A;  2R93 H;  2R6G A;  1VQL A;  2GN5 A;  3RR5 A;  2KCT A;  4HJA A;  1JJC B;  4O2D A;  5IYC H;  4KHP Q;  5FLM G;  3GTP H;  4OX9 Q;  2IT1 A;  1TWF H;  4DV1 Q;  1M90 C;  3S17 H;  2VL6 A;  1EOV A;  3BJU A;  5IP7 H;  2E2J H;  2A1A A;  2UUB L;  2B63 G;  3GO5 A;  2RHQ B;  2YV5 A;  1HH2 P;  3S2H H;  2ASB A;  1SMX A;  1MJC A;  4HIO A;  4B3T L;  1KIX A;  4YWL A;  1PV4 A;  5IY0 A;  4JI5 L;  1C0A A;  1FGU A;  1O7I A;  1XNR Q;  1HNW Q;  1LYL A;  1QUQ B;  1EYG A;  3M4P A;  3MXN B;  2AHO B;  2IX1 A;  5GQO A;  3NEN A;  4L5Q A;  4BBR H;  3B6Y A;  3GTJ H;  1W2B A;  4DV2 Q;  4B3T Q;  3S2D H;  2E2I H;  4JI5 Q;  4YHH L;  3CCV A;  3PUZ A;  4UP7 A;  3HOX H;  2WAQ E;  3RN5 A;  1A62 A;  1PYS B;  2A8V A;  4L5T A;  1YJN A;  1N32 L;  2RF4 A;  3RNU A;  1KXL A;  1OXS C;  3FHW A;  1Q8K A;  1I3Q H;  4APV A;  3J81 j;  2N78 A;  2RCN A;  4DR5 L;  3ULP A;  1K9M C;  2YTY A;  1L2F A;  5FJ8 G;  3CPW A;  1OXU A;  2B29 A;  2B3G A;  3PF4 A;  1Q81 C;  4R1J A;  5HGQ A;  1N32 Q;  3E0E A;  5LMU L;  1N33 Q;  3M3Y H;  1X65 A;  4QJF A;  4A3F G;  3TS0 A;  3GTK H;  1WJJ A;  1VQI A;  4DNI A;  2XGT A;  2NVX H;  2D0O A;  1IBL L;  3H0G G;  3KFU A;  1Q1B A;  2R92 H;  2JK8 A;  3G4S A;  4JBW A;  3CCE A;  2VQE Q;  5LMU Q;  4DV5 Q;  4B3S Q;  4LFA L;  2ATW A;  1EIY B;  2V1C C;  4BY7 G;  4LUV A;  5IP9 G;  4GOP A;  4GKK Q;  3HFZ B;  2Y0S E;  1HZ9 A;  4BBS H;  1UWV A;  4QQB X;  4IOC A;  4B3R L;  1K83 H;  4YCW A;  4IO9 A;  1XMO L;  4JI4 L;  2F4V L;  1VQP A;  5JJK A;  2JE6 I;  1I94 L;  2EIF A;  3PIP A;  1Y1W G;  1OTC A;  4IPH A;  4A3E H;  5JJL A;  4TVA B;  4DV7 L;  4HJ8 A;  4DR7 L;  1S3O A;  4A3C H;  3JAM c;  1VQN A;  4B3R Q;  1XMO Q;  2F4V Q;  1PVO A;  2R7Z H;  3KF8 B;  2AWO A;  4JI8 L;  2Y0S G;  3CC7 A;  1Q7Y C;  4DV0 L;  2OWO A;  5IE8 A;  1KRT A;  2VW9 A;  1NE3 A;  4PZ7 A;  5IT9 c;  1WCM G;  4QGU A;  4GOP B;  1J5E L;  3AEV A;  1C9O A;  1VQM A;  1YVC A;  1I50 H;  4DV7 Q;  1PH1 A;  2JA6 H;  4DR7 Q;  4GNX B;  4R4C A;  4ALP A;  3M7N A;  3G48 A;  3A5Z B;  1PYB A;  4JI8 Q;  3CQZ H;  1VCI A;  4LUZ A;  2Z6K A;  5IYB H;  5C0X G;  4DV0 Q;  4A3I G;  2IY5 B;  2UXB L;  3UE1 A;  2D62 A;  3PUX A;  1J5E Q;  3GTG H;  3I4M H;  4A93 H;  4JV5 L;  4B3M L;  4A3D G;  1JT8 A;  5AJ3 L;  4DAM A;  1CKN B;  2LXK A;  4JOI A;  1N9W A;  1PA6 A;  1CKO A;  5GAH C;  3NEL A;  3PGZ A;  4LF7 L;  2DGY A;  5C0X I;  3RLN A;  3D31 A;  4JCV E;  2UXB Q;  5EAY A;  4JV5 Q;  1NMG A;  2F3I A;  4B3M Q;  2L15 A;  4A3L H;  5AJ3 Q;  3GDE A;  3TQY A;  1HZB A;  4PMW A;  2OTJ A;  3AQQ A;  3ULL A;  4DUZ Q;  1S40 A;  2UUC Q;  1KD1 C;  4LF7 Q;  3A0J A;  4NXN L;  2RHS B;  3BZC A;  3KLW A;  1JJ2 A;  2JEA I;  1HNZ L;  4LF8 Q;  1UE1 A;  4A3B G;  1I6H H;  1XPU A;  1VS0 A;  1VQ8 A;  2B63 H;  2PMZ E;  4LF6 Q;  1MKH A;  2CKZ B;  4IFD G;  1M1K C;  2GVA A;  4QL5 A;  2K50 A;  2JA9 A;  1NTG A;  4DV4 L;  4NXN Q;  2AMC B;  1HNZ Q;  3RN2 A;  4LUO A;  1L0W A;  2YYZ A;  2VZA A;  4XIG S;  3G71 A;  4UP9 A;  4HID A;  2OCE A;  1VQ9 A;  5IYD G;  3G6E A;  4IFD I;  5JJI A;  1PH9 A;  1FL0 A;  4R4I A;  3AFQ A;  1PH7 A;  1J6Q A;  4X66 L;  4DK3 C;  4DV4 Q;  3S16 H;  5J3B A;  5ELO A;  4YWM A;  3PCO B;  4GN3 B;  4GLX A;  1PHJ A;  2NZO A;  2Z6K C;  3T1Y Q;  1GO3 E;  3PV0 A;  1XMQ L;  2UUA Q;  5C3E G;  4A76 A;  3HOY G;  4OX9 L;  3TRZ A;  4X66 Q;  5FJ8 H;  3U4Z A;  1ASZ A;  1WOC A;  4JOI C;  3HOU G;  2WB1 G;  3U50 C;  2YTX A;  4GN4 B;  1PH8 A;  3VDY A;  3TS2 A;  1YZ6 A;  3RLO A;  3M4Q A;  2K52 A;  4JBJ A;  1XMQ Q;  1H95 A;  1UE6 A;  2HHH L;  4AIM A;  3FKI G;  2QGQ A;  1K8G A;  1XNR L;  1NBW A;  3CCL A;  1X54 A;  1EQQ A;  5M5X H;  4P71 A;  2ZJQ A;  3H0G H;  4X65 Q;  1UE5 A;  2IHF A;  1X56 A;  1XJV A;  2JA8 G;  2VNU D;  2JQO A;  4BY1 G;  3KF6 A;  4DV2 L;  1X55 A;  4A3G H;  1BBU A;  3CC4 A;  2HHH Q;  5LMN Q;  1SLJ A;  1RIP A;  4BY7 H;  3UE0 A;  4OWT B;  5IP9 H;  3I7F A;  2PI2 A;  1WYD A;  1JE5 A;  1D8L A;  3K80 C;  3RZD H;  2CQO A;  3HKS A;  1YHB A;  1HNW L;  2F52 A;  1Y1W H;  2K14 A;  2ZTC A;  3STB C;  4X62 L;  4C3H H;  4YY3 Q;  5E7N A;  1Q86 C;  2HQL A;  3GTM H;  3AFP A;  3HOW H;  1YIT A;  2Q2U A;  1GD7 A;  1N33 L;  3KYH C;  1X3G A;  5H1S E;  1HNX Q;  3HOV G;  1V1Q A;  4BA2 I;  3J80 c;  3J81 c;  1VQJ A;  1D7Q A;  1T9H A;  3BU2 A;  4NPS A;  5BR8 L;  1WCM H;  4X62 Q;  5HY6 A;  1GKH A;  4LNQ A;  1KHI A;  1X3E A;  3TEH B;  2WAQ G;  2VQE L;  4PZ8 A;  4DV5 L;  4BXX G;  1KC8 C;  4B3S L;  1VQF A;  2N49 A;  1A8V A;  4AH6 A;  5M5W H;  5BR8 Q;  4DK6 C;  2EQS A;  3KJP A;  4A3I H;  4GKK L;  1A0I A;  2WFW A;  1CKM A;  1CUK A;  2UU9 L;  1G6P A;  4DUY Q;  1IL2 A;  4OWX B;  3BZK A;  3JC6 6;  3UDG A;  1E22 A;  1XTD A;  1OXX K;  2CCZ A;  1OXT A;  1B8A A;  1E7Z A;  5C4X G;  4DR6 Q;  2BA0 A;  2NVY H;  4MZ9 A;  1N36 L;  4KLK A;  1JMC A;  4HIM A;  1B70 B;  2UU9 Q;  1SR3 A;  3A74 A;  3M85 A;  1Q82 C;  4K0K L;  2HT1 A;  3I4O A;  4JBK A;  4R4T A;  3J7A 5;  4POF A;  4A3B H;  5M3M G;  1YBY A;  1YI2 A;  1K3R A;  1N36 Q;  2H5X A;  4KHZ A;  2AWN A;  2K5H A;  5JEA G;  3CC2 A;  3S15 H;  4K0K Q;  2LXJ A;  2OQK A;  3K7U C;  1YEZ A;  3I55 A; 
#chains in the Genus database with same CATH topology
 4IZ8 A;  3HZX A;  3MC0 B;  3NBI A;  1Q12 A;  4BWG B;  4HCE A;  3RZO B;  4DAY B;  3FVQ A;  2KCC A;  4RG1 A;  4R4O A;  2VY3 A;  1WD0 A;  5GAD C;  1EFW A;  4R8I A;  4J8Q A;  1C7Y A;  2F0T A;  1LTB D;  5IT9 L;  4LF9 Q;  1I4G A;  1FNW A;  1JIC A;  1SSO A;  1VQC A;  3D8G A;  4A3J G;  2UUC L;  3L9A X;  1Y1W B;  2K4K A;  4DR4 L;  3H94 A;  5M3M B;  1G2S A;  2UXC L;  4X64 Q;  4LF6 L;  4C2M H;  3PO3 G;  1EWC A;  5FLM H;  1PH3 A;  3I90 A;  1WCM B;  2B2V C;  5E4W C;  1JCK B;  2LS0 1;  3NTI A;  4JK1 C;  1C48 A;  2WP8 J;  2V4D A;  1AE3 A;  1M4V A;  3QR8 A;  4C56 C;  4HIK A;  1IBK Q;  2PO4 A;  1JWU D;  1FNU A;  4FXK C;  3ER0 A;  2KHJ A;  1N34 Q;  1RL2 A;  3ZJY C;  1X9N A;  3ZYY X;  2UUA L;  2CQA A;  1IXR A;  1VQE A;  4XT3 B;  5C44 B;  4JI1 L;  3A56 A;  3H09 A;  1UEB A;  3S14 B;  2VB2 X;  3W1G A;  4JC0 A;  5I6W A;  3BYY B;  1AH9 A;  1AW7 A;  3CAM A;  5CR3 A;  5FKA C;  1EY8 A;  4X65 L;  3CF5 A;  1RD9 D;  3OYY A;  2BA1 A;  2SDF A;  2L5T A;  3GTO B;  4DXG A;  1DM0 B;  2ICI A;  3L7Z C;  1XNQ L;  2EE1 A;  3I56 A;  5EKK A;  4IJH A;  3KBX A;  2EOT A;  4O0A A;  4C3I G;  5FLX c;  3BS1 A;  4LF8 Q;  1JJG A;  4LF4 L;  4YY3 L;  5C4X H;  1U4R A;  2PZW A;  2QDL A;  1B2T A;  1V43 A;  4GLA C;  2O5J C;  4A3K G;  3STB D;  1HNX L;  2FMM A;  3MXN A;  1HR0 Q;  3H6M A;  1T5E A;  1TWC B;  5KIX A;  2WB1 B;  1SYG A;  3J80 i;  1D1I A;  1U9R A;  1SRU A;  3R3O A;  3T16 A;  1U4L A;  5ELC A;  2O2L D;  1IBM Q;  1GVP A;  4LFC L;  1ASY A;  1F2Y A;  2B39 A;  3A8I E;  3FRP B;  5CMD A;  3H3V I;  2KA7 A;  1FVI A;  1K0R A;  5L37 A;  4IUT A;  3I4N G;  4JW0 A;  3PUV A;  1U4M A;  4KY5 A;  2NN6 G;  1QVC A;  5EPL A;  3TRE A;  5C3W A;  5LL6 X;  1O7Y A;  3J80 L;  4HJ9 A;  4DR6 L;  3KK7 A;  1HA5 A;  4A3D H;  1ESR A;  4A3J H;  2JA7 G;  4JG2 A;  1DYQ A;  2MNA A;  5JVH 3;  1SNO A;  4OO1 G;  1MD2 D;  1Y8O B;  4A75 A;  4CJ2 C;  2DN8 A;  5BN5 A;  2KCM A;  5IGG A;  1VQA A;  2PNH A;  3PO3 H;  4LFB L;  5ELN A;  2I5M X;  1RF2 D;  1SNM A;  1STE A;  3GQB A;  4EQP A;  3CP0 A;  3F2D A;  4OHJ A;  3Q0A A;  1RJT A;  3NTH A;  4Q0F A;  5ELB A;  3OWF A;  1V9P A;  4EVO A;  3M4Y A;  4A3G G;  2NVQ B;  4LF9 L;  1LTR D;  1EQR A;  3S1Q B;  2EDG A;  2ZTD A;  3QG1 A;  1TII D;  3JAM E;  1MJE A;  4LAA A;  5C4X B;  1EEF D;  4LFA Q;  1TWG H;  1E3P A;  2RSN A;  2R93 B;  4L5S A;  2DY7 A;  4CBV A;  3E0J A;  1CKN A;  3S24 A;  3MAQ A;  2PQA B;  1PTO H;  4BA1 I;  4L8J A;  1SRO A;  1CSP A;  2R7D A;  1WTO A;  4PMC A;  4TSS A;  5C4J H;  4DV6 Q;  2K28 A;  4JBM A;  5GAG C;  1JE4 A;  2JA8 H;  1IYJ B;  4ZYS A;  1NJI C;  3CME A;  2R92 G;  2F1M A;  2B2Y A;  4C3I H;  2NVT H;  4KY7 A;  2CWP A;  1D2B A;  1H9J A;  2EJG C;  4A3J B;  1YJW A;  3I8Z A;  3E9H A;  5CV5 A;  4A3K H;  1NNX A;  1PH6 A;  1FJG Q;  4CHT B;  1STB A;  1EIF A;  1U0L A;  2RKS A;  1B3Q A;  1PZK D;  3G7L A;  2TMP A;  3TME A;  1JR0 D;  4DKA C;  3PO3 B;  1I6V C;  3CHB D;  2LSS A;  4A3E G;  4JI0 Q;  4DPG A;  5G3L D;  3Q24 A;  2MGS A;  3EIV A;  3EJI A;  1EFI D;  4TKO B;  2GVB A;  1CFM A;  1VF5 C;  3MEH A;  2R7Z G;  2OQ0 A;  2Q2T A;  3QOL A;  5J22 A;  4NKL A;  1I4R A;  3UI2 A;  3I4N H;  2JA6 G;  1B50 A;  2NN6 H;  2PZU A;  4LF8 L;  5K36 G;  4OXP A;  5IWA L;  2VQF L;  3M9B A;  3E5S A;  3I4M G;  1KL9 A;  4HJ5 A;  5KYL A;  2JA7 H;  1VQ7 A;  2N8N A;  1TWA H;  1A3T A;  2F0Q A;  2ES2 A;  1TWG B;  1T5X D;  3S1R H;  2N88 A;  2QEJ C;  1BCP D;  3MXU A;  3ERQ A;  1JJC B;  5J39 A;  5FLX L;  1TWF H;  4DV1 Q;  1HNW L;  5I9P A;  1D6E C;  2YV5 A;  5IGD A;  2R61 A;  3U9S A;  4B3T L;  5IY0 A;  4JI5 L;  1C0A A;  3MFG A;  3OMG A;  4N9P A;  1O7I A;  4A93 B;  2QW7 A;  1GUO A;  3M4P A;  2BCO A;  1W2B A;  1BBX C;  4OIK A;  4FF3 A;  3D4R A;  3PUZ A;  3A7L A;  1EY0 A;  2D5D A;  1A62 A;  2A6E D;  4L5T A;  1N32 L;  1MGS A;  4CGY B;  1Q8K A;  2AQ2 B;  3EQL C;  3ULP A;  2YTY A;  1WVL A;  3SK4 A;  5LMU L;  1N33 Q;  2AQ3 B;  3BYT B;  3GTK H;  1JC7 A;  4DNI A;  3I4N B;  2D0O A;  4HR7 B;  2XRQ D;  3NHH A;  2R92 H;  1QB5 D;  2JK8 A;  4JBW A;  4UHV A;  2K04 A;  4B3S Q;  4LFA L;  2ATW A;  3KF8 A;  3SK5 A;  2X6L A;  1EIY B;  4EGV A;  5IP9 G;  1UWV A;  1B4O A;  4IOC A;  5A2Q L;  1KAA A;  3CRK C;  1VQP A;  3S1R B;  3LWU A;  1FD7 D;  5M9O A;  3PIP A;  1B44 D;  4C3H G;  3O13 A;  1K28 A;  1BOS A;  3MXG A;  4A3E H;  4TVA B;  4DV7 L;  4HJ8 A;  1S3O A;  3IAY A;  4I65 A;  2B2T C;  1QOH A;  1XMO Q;  2F4V Q;  2R7Z H;  4JI8 L;  1PRT D;  1TWF B;  4XT1 B;  1STN A;  5IE8 A;  1AFP A;  1NE3 A;  3HP3 A;  4QCL A;  4OL7 A;  1O80 A;  1VQM A;  1I50 H;  1PH1 A;  2JA6 H;  3MTS A;  4KTA A;  4A3G B;  3G48 A;  1PYB A;  1VCI A;  4DFA A;  5C0X G;  1ZXT A;  2UXB L;  3I4M H;  4RHR A;  1FGB D;  5AJ3 L;  1PA6 A;  3PGZ A;  4LF7 L;  4F7X A;  1IKL A;  4JCV E;  3GTM B;  1JOK A;  5EPJ A;  2L15 A;  1WTX A;  4DUZ Q;  1IL8 A;  4X3U A;  4DXF A;  4NXN L;  2RHS B;  1JJ2 A;  2L0C A;  1DXM A;  2PMZ E;  3MVV A;  1A2U A;  3P75 A;  2CKZ B;  2PPB C;  3NSW A;  2BDN A;  3K57 A;  1VQ9 A;  2Z8L A;  2KVM A;  3G71 A;  4HID A;  2R92 B;  2OCE A;  5IYD G;  1HTP A;  4IFD I;  5JJI A;  4R4I A;  3AFQ A;  1PH7 A;  2NUC A;  5ELE A;  5ELO A;  3PCO B;  5C5M A;  2Z6K C;  2K1B A;  2K5Q A;  3HG9 A;  4A3E B;  3WDN A;  1Q90 A;  3NWS A;  1PH8 A;  2R7Z B;  4JBJ A;  1H95 A;  1LTS D;  2HHH L;  4AIM A;  1CM9 A;  2JSO A;  3CCL A;  1EEI D;  3J7A F;  1I50 B;  1TY0 A;  2JA6 B;  1SDF A;  3KF6 A;  1DD2 A;  2ZXR A;  3CC4 A;  2IJ0 A;  1HA6 A;  2YU9 B;  3UE0 A;  5IP9 H;  2RDG A;  3I7F A;  2PI2 A;  4ZKC B;  3Q22 A;  3CU7 A;  2K14 A;  3STB C;  2PQE A;  2HUG A;  4C3H H;  1H9K A;  5F2D A;  1YIT A;  1E0B A;  4X3S A;  4HN7 A;  1GD7 A;  1N33 L;  4CKB A;  1M8A A;  5JVG 3;  1EYD A;  1GKH A;  1NUC A;  4BY1 B;  3F2U A;  4LK1 C;  2A6H D;  4BXX G;  4B3S L;  1H9M A;  5C0X H;  4AH6 A;  5M5W H;  3J81 L;  1Y8N B;  2EQS A;  1QNU A;  1A0I A;  1CUK A;  1QCB D;  2M2L A;  1GOZ A;  2EZV A;  1PTO D;  4DUY Q;  1IL2 A;  1G6P A;  1WD1 A;  4HSV A;  1EWH A;  3UDG A;  3R2I A;  1E22 A;  1EY9 A;  2DJF C;  4KKU A;  1E7Z A;  1W6K A;  2NVY H;  1Q8I A;  1JMC A;  1N36 L;  4X3K A;  3C2P A;  1B70 B;  1VF7 A;  3I91 A;  4DNT B;  1SR3 A;  3A74 A;  2F0W A;  1V1O A;  3I4O A;  4JBK A;  5M3M G;  4XYO A;  2H5X A;  4KHZ A;  1ZEQ X;  2K5H A;  2EY6 A;  5JEA G;  1KDC A;  1DZ1 A;  3OIP A;  2WAC A;  5E1F A;  2G5D A;  1I94 L;  4K14 A;  4NB3 A;  2ZJP A;  1G51 A;  2EYJ A;  1CT1 D;  5IYD H;  2E8G A;  3H3V C;  2AQ1 B;  3U58 A;  4BBR G;  4OEL B;  2E74 C;  1ET6 A;  1S72 A;  5CYU A;  5IT9 E;  2B2W C;  2L12 A;  4GLV B;  2F0G A;  4UP8 A;  1I5F A;  1RKN A;  3CCQ A;  3D0F A;  3TSS A;  4DUZ L;  1GUS A;  2IWH A;  1ENF A;  2K5N A;  2EYM A;  2XSC A;  3VR6 A;  2EXD A;  1GHK A;  5CBA E;  2RBM A;  3W1B A;  5C44 G;  2LMC B;  4BS9 A;  5J1Z A;  3F2C A;  1KTK A;  4X6A H;  3GV3 A;  4G4K A;  4NXM L;  4DR4 Q;  1HUM A;  5AFW A;  3Q6S A;  1L1O A;  2UXC Q;  1LTG D;  1X6O A;  1VQB A;  2P5Z X;  4JI3 L;  2WKD A;  4DGZ A;  1R4Q B;  3BVM A;  3NBH A;  3MEF A;  4KN4 C;  1F9Q A;  2L4N A;  3AYH B;  4IQZ A;  1PH5 A;  1WTR A;  3BG3 A;  4DV3 Q;  2XNA C;  4N8X 1;  3L2P A;  2NZH A;  4Y52 H;  4RMF A;  5M3F B;  5CGK A;  1WTW A;  3DEO A;  3PO2 B;  1FYC A;  4Q5V A;  1YIJ A;  2HDM A;  1TWH H;  1TY2 A;  2E5L L;  1ICW A;  3ND8 A;  2UXD L;  1B9M A;  3OW7 A;  3QJY A;  4LWC A;  4JI1 Q;  4A3M G;  4LW1 A;  4J6H A;  3HKZ E;  4QIW B;  4BXX H;  3TP6 A;  1UEA B;  4A3F H;  3CW2 C;  1GHJ A;  1QZH A;  3S1M H;  1XYI A;  3EN2 A;  1NAP A;  2PMZ B;  1Y14 B;  3RZO H;  2JA5 B;  3K8A A;  4MTK A;  1E1O A;  1XXG A;  1Y8P B;  3LGJ A;  5FO7 B;  1MSH A;  2HD3 A;  1XNQ Q;  4RWS C;  3VYS A;  5CV7 A;  3RLF A;  2XTI A;  4LF5 L;  3OPO A;  1E24 A;  3VYT A;  4LF4 Q;  5M3M H;  2MQH A;  1II3 A;  3S1N B;  5ELF A;  5JEA H;  3NQT A;  3VR2 A;  1DGS A;  2RVL A;  1E2V A;  2QEX A;  3KOJ A;  3GD7 A;  2ZTE A;  1HUN A;  2DUD A;  1VQO A;  5FO9 B;  1JB3 A;  5LL6 S;  4DR3 L;  3SK8 A;  1PLF A;  3GV6 A;  4DUY L;  2UUB Q;  2K5D A;  2BE5 D;  3DUZ A;  3F1Z A;  2I0Q A;  4IFD J;  2IHE A;  4LFC Q;  1OXV A;  3ERS X;  4JI2 L;  3J80 E;  1HQM C;  5I6Y A;  1MBY A;  3PIO A;  2AKW B;  1D5Z C;  3QWN A;  1AE2 A;  1V1P A;  3A5U A;  3IKJ A;  4CJ1 B;  1VQD A;  3A7A B;  5C44 H;  3T4A C;  2LKV A;  2E2H B;  2R93 G;  4MN3 A;  3S14 H;  1ROD A;  3RMH A;  2A69 D;  2CH4 W;  1ZYR D;  1P8L A;  3WWV A;  1CQF A;  4DR1 L;  4OEM B;  1UUP A;  4LFB Q;  4CKE A;  2VS1 A;  1HPC A;  1W6J A;  3GTO H;  3S1M B;  3TN2 A;  2K6A A;  3I4L A;  2JJQ A;  4POG A;  1Q1E A;  1P16 A;  4IPD A;  1IYV A;  2D9U A;  4KKT A;  4RHS A;  1MI2 A;  4RKL A;  5C5L A;  3ULJ A;  3HOW G;  2VXW A;  5COR A;  2MFI A;  1UE7 A;  1PFS A;  1GUG A;  2F0L A;  3GTP B;  3S17 B;  2FIN B;  1TWC H;  2E76 C;  2EY2 A;  3SHL A;  3M4O H;  5G3L F;  4A3M H;  1U5K A;  4P2C B;  4PG3 A;  1IYU A;  2KQ3 A;  4G7H C;  5EBC A;  4QB4 A;  5GRO A;  4DV3 L;  2CW0 C;  4TQU S;  3CCJ A;  2XRS D;  1EWI A;  4BBR B;  1DOK A;  2E2I B;  1LT5 D;  1A6X A;  1BVS A;  4XDX A;  1PFM A;  3SDZ A;  5LMN W;  4FF1 A;  1X3Q A;  2HIX A;  5IGB A;  3NEM A;  3DLL A;  2F0S A;  4HMJ A;  1BCP F;  3VR5 A;  1HR0 W;  4FDB A;  4IPG A;  4GNX C;  1AN8 A;  4A3C G;  3P1H A;  3KDF B;  5JAV A;  1BBW A;  3PSI A;  5JPM C;  2EYL A;  3CCR A;  3H15 A;  3HS0 C;  4H02 A;  4YCU A;  1W3S A;  1QG7 A;  1RCV D;  5IYB G;  1YNJ D;  2MPM A;  2LY7 A;  5IGF A;  2NVQ H;  4A93 G;  3D4W A;  1EYA A;  2A68 C;  3S1Q H;  4N8F A;  3T51 B;  5IIF A;  3U4V A;  5HUR A;  1HZC A;  2Q8R E;  2CFM A;  5IWA Q;  2PI2 E;  1SE2 A;  3M7G A;  2VQF Q;  3BDL A;  1SJE D;  3W5O A;  5LHY 1;  1Z7T A;  4HJ7 A;  4A3L G;  4KKS A;  2R93 H;  4QUC A;  2KCT A;  4HJA A;  4O2D A;  2WKC A;  4B08 A;  3OMC A;  3M4O B;  4FVM A;  3LX0 A;  2RQX A;  1M90 C;  4A3M B;  4J1M A;  3SK6 A;  4B9X A;  5FLX E;  5KYI A;  2A1A A;  1QIL A;  2UUB L;  2B63 G;  1B53 A;  1VMP A;  2QF7 A;  4HIO A;  3CQZ B;  1FGU A;  4U67 3;  1HNW Q;  1E2W A;  1QUQ B;  2K5W A;  1EYG A;  4KD4 A;  1NR2 A;  5IGE A;  2OXP A;  3V2T A;  4F88 A;  2QCP X;  3GTJ H;  1JWM D;  3B6Y A;  4B3T Q;  3S2D H;  4JI5 Q;  5EGT A;  1EIH A;  4UP7 A;  3K0Y A;  2WAQ E;  1PYS B;  3MXP A;  2EYP A;  3RNU A;  3FHW A;  4IUV A;  3D4D A;  2Z4I A;  1SYD A;  3W3A A;  2B29 A;  4C3J G;  1Q81 C;  3LWE A;  4R1J A;  1PRT F;  1N32 Q;  1SBB B;  2SNM A;  3M3Y H;  1X65 A;  4QJF A;  1G91 A;  2VB3 X;  2A6H C;  4JVZ A;  3NPP A;  2NVX H;  1D5X C;  1CA5 A;  5TSS A;  5LMU Q;  5IOD A;  4ID6 A;  4BY7 G;  4GOP A;  4GKK Q;  4B3R L;  2F0H A;  3L3O C;  4DAY A;  2EIF A;  1KAB A;  5E4X A;  1TU2 B;  1O7Z A;  1AZP A;  4A3C H;  4G7O C;  4ZQ3 A;  3JAM c;  2E2D C;  1WTP A;  3KF8 B;  3DM1 A;  3CC7 A;  5JJZ A;  4DV0 L;  1KRT A;  3RUZ A;  4DV7 Q;  1IW7 C;  4GNX B;  4R4C A;  3M7N A;  2F0D A;  4JI8 Q;  5IYB H;  4LUZ A;  4A3I G;  4C1N K;  4A93 H;  3OOC A;  2KEE A;  4JV5 L;  3TZD A;  1TKW B;  4JOI A;  3GTJ B;  3S2D B;  3RLN A;  2UXB Q;  4KY6 A;  5EAY A;  2F0N A;  3HOW B;  1JWS D;  2F3I A;  4A3L H;  5AJ3 Q;  2K33 A;  2RCF A;  4K6L A;  3ULL A;  5KNC A;  4LF7 Q;  3AU7 A;  1HTL D;  3KLW A;  1HNZ L;  1SEB D;  2B63 H;  1SMY D;  1MKH A;  3M3Y B;  1M1K C;  2JA9 A;  3NE5 B;  4DV4 L;  3W2D A;  4NXN Q;  2Z6B A;  3K5M A;  2NVX B;  3FPP A;  4LUO A;  2YYZ A;  3BDO A;  4UP9 A;  4WRD A;  2J4X A;  3E6Z X;  1LT4 D;  1H9S B;  5E3F A;  2ZT9 C;  3HGB A;  4DK3 C;  4X66 L;  1CZG A;  4YWM A;  4K5W A;  4CDF C;  1QJO A;  4IN3 A;  3T1Y Q;  4OO1 H;  1GO3 E;  1XMQ L;  2DNE A;  5C3E G;  4A76 A;  3HOY G;  2B2U C;  1SND A;  1F2Z A;  3RLO A;  4ZUI A;  3M4Q A;  2K05 A;  1C4Q A;  3FKI G;  1NBW A;  1X54 A;  1I4P A;  1X56 A;  5I9O A;  5FOB B;  2JQO A;  4BY1 G;  4DA2 A;  1G8Z D;  4A3G H;  1BBU A;  2HHH Q;  2SNS A;  1NSN S;  4DU9 A;  4ZUJ A;  2O4X A;  4BY7 H;  1PTO F;  4OWT B;  5DNF A;  4HMI A;  2Q8I B;  3RZD H;  1SXT A;  5C4Z A;  1L0Y B;  2X69 A;  4HED A;  1YHB A;  3QOJ A;  1C8C A;  5E7N A;  2HQL A;  3GTM H;  3AFP A;  5DEH A;  5H1S E;  1X3G A;  2L55 A;  4BA2 I;  3HRZ C;  1ILP A;  3J81 c;  1VQJ A;  3OIQ A;  1T9H A;  4NPS A;  4S3S A;  1YNN D;  2B63 B;  4LNQ A;  3TP7 A;  1X3E A;  1VMC A;  4EQN A;  4PZ8 A;  2N49 A;  4A3I H;  4ODG A;  3KJP A;  4GKK L;  2WFW A;  2HCI A;  2FFK B;  4MHE A;  3JC6 6;  1RHP A;  1XTD A;  4FNF A;  4GZY C;  5C3X A;  3C1E A;  2BA0 A;  4MZ9 A;  4HAE A;  2B2V A;  3HEJ A;  1Q82 C;  3J7A V;  2HT1 A;  3CKI B;  1S5C D;  1HHV A;  3VYR A;  4C3J B;  1K3R A;  2OF1 A;  1N36 Q;  2OT2 A;  3X3M A;  2WAQ B;  4WFN 3;  5D3D A;  3PIP 3;  3CC2 A;  3S15 H;  2B8F A;  2LXJ A;  1STH A;  1EU3 A;  3K7U C;  1YEZ A;  2VW9 A;  1ML0 D;  2PQA A;  4F87 A;  3JAM L;  3J7Y W;  2VUM G;  1NMF A;  4BY7 B;  1AEX A;  1VQ5 A;  5EQ0 A;  3FMC A;  1I94 Q;  2YU9 H;  1X32 A;  3RZD B;  4NW2 A;  5C3E H;  4GN5 A;  4DR2 L;  5M3F G;  5EPK A;  3PO2 G;  1A3U A;  4FXD A;  3I2Z A;  4HCS A;  3FEW X;  3FKI H;  1S4Z A;  1HRJ A;  2RDF A;  4K5V A;  5EKI A;  5I2X A;  4BY1 H;  4RGT A;  2L1B A;  4A3I B;  4NXM Q;  1CZW A;  2K01 A;  1HXY D;  2EYO A;  2G9H D;  3T1Y L;  4JI3 Q;  2CWA A;  2L9H A;  2HCC A;  2JA5 G;  1KLG D;  4UY8 C;  4CJ0 B;  4PV1 C;  4Z9C B;  1CHQ D;  4P72 A;  1D5M C;  3NBH B;  4P73 A;  4LMQ D;  1SE8 A;  1B9N A;  3SE0 A;  3G6J B;  5CBE E;  2NTS A;  2HDL A;  2F0I A;  3S15 B;  3SVM A;  3X3N A;  2E5L Q;  2UXD Q;  4AQY Q;  1CHP D;  4DAP A;  1F2L A;  1F9S A;  3A55 A;  2N3S A;  2YTV A;  1PFB A;  4EX5 A;  1PYW D;  3OTO L;  1DON A;  1RTO A;  3T56 B;  2Q2H A;  1DCZ A;  2BH8 A;  1TS2 A;  1PDQ A;  5T1I A;  5C3E B;  1BKB A;  1BF4 A;  3HOY B;  3OSO A;  3NK9 A;  2QKI C;  1B1Z A;  1S5B D;  1KRS A;  5COY A;  3J81 i;  4ME3 A;  1V8Q A;  3FKI B;  4LF5 Q;  1BR9 A;  1LTI D;  1YJ9 A;  2XN9 C;  3K5L A;  2Z1C A;  3PMF A;  4RKB A;  2NTT A;  1N8R C;  1SFO B;  3E9I A;  2PNR C;  1LTT D;  2VUM H;  4DF7 A;  1K8A C;  4JI7 L;  4DR3 Q;  4JPB W;  1ZKO A;  4JI6 L;  4K2K A;  2NN6 I;  2A19 A;  4KMU C;  4JI2 Q;  5M3F H;  4YHH Q;  3PO2 H;  2KEC A;  1GM5 A;  4JYA L;  4GKJ L;  4QY7 A;  1HZA A;  4OO1 I;  1EOT A;  1MSG A;  4DR5 Q;  3J7Z C;  4XTC S;  1A2T A;  1PH2 A;  1HQR D;  1E2Z A;  1MHW C;  1ENA A;  4QMG A;  1WFQ A;  2DJG C;  4DR1 Q;  3D6W A;  1BUV T;  1QNK A;  3R93 A;  2JA5 H;  1QVF A;  1AZQ A;  1MIU A;  2IX0 A;  5CC4 A;  4L6T B;  3EFX D;  3DWA A;  1TQO A;  3F2B A;  1XPO A;  4XQJ A;  2L11 A;  3S9W A;  1VQ6 A;  1K3B C;  2C5C A;  3UDI A;  2XWB B;  3S1N H;  5HGT A;  4IJL A;  2EY1 A;  3ICE A;  1G2T A;  1G29 1;  2EPB A;  2KOL A;  3K81 C;  1GUT A;  2ZJR A;  3K0X A;  1LAC A;  3KLR A;  4CDE C;  2VUM B;  3NQI A;  1LUZ A;  4IAL A;  2K5V A;  2FXQ A;  3L0O A;  5ELD A;  2R7F A;  1SN8 A;  4H13 C;  3R2T A;  4IUN A;  2MJ8 A;  4R4Q A;  1SYE A;  4GOP C;  3H3V H;  4MNO A;  1R9T H;  1B7Y B;  1X3F A;  3GTQ H;  1S5D D;  2E2H H;  1I6H H;  2JEB I;  1EZ8 A;  1LLR D;  2PW5 A;  2PCF B;  4AQY L;  1Q46 A;  3I73 A;  2XWJ B;  2A74 C;  5KEE A;  1EY7 A;  3A8J E;  3TZU A;  5DLQ E;  4RGO S;  1HFN A;  2QA4 A;  2WB1 E;  1RTN A;  4IUU A;  2K75 A;  1KQS A;  4KN7 C;  3SR1 A;  4BBS B;  3CXC A;  4KHP L;  3KJO A;  5JOB A;  4K8I A;  3TBI B;  4TRD A;  1IHZ A;  5KNB A;  3HKZ G;  4ABN A;  1YHQ A;  3IFD A;  1WTV A;  1B3A A;  1S5F D;  2B2Y C;  2IPK D;  3C1F A;  2NB0 A;  1KAW A;  2KBN A;  3TDQ A;  3OW2 A;  2R6G A;  2GN5 A;  3RR5 A;  1BCP C;  3DHQ A;  2F3V A;  4V0B A;  5FLM G;  3GTP H;  4OX9 Q;  4WJW A;  3S17 H;  1EQT A;  1EOV A;  3BJU A;  3D3R A;  4NP5 A;  3S2H H;  3GO5 A;  2RHQ B;  1HH2 P;  1PFN A;  4G57 A;  1GUN A;  2ASB A;  1MJC A;  3WOF A;  1KIX A;  4YWL A;  3QO2 A;  2I07 B;  1XNR Q;  1TS3 A;  2A5H A;  1KNA A;  2N55 A;  2FHT A;  3H91 A;  3MXN B;  2AHO B;  2IX1 A;  4XYQ A;  5GQO A;  3NEN A;  4L5Q A;  4BBR H;  2E2I H;  3BDC A;  1XWE A;  4YHH L;  1FR3 A;  2B2T A;  4NDX A;  1TVX A;  2J7Z A;  3RN5 A;  4DK0 A;  2F0M A;  2RF4 A;  4APV A;  2N78 A;  2A6E C;  2RCN A;  4DR5 L;  1K9M C;  1R9T B;  1UAP A;  3PIO 3;  2XIW A;  3GTQ B;  1I6H B;  4ME5 A;  3PF4 A;  2SEB D;  5HGQ A;  2HQE A;  1YNN C;  3E0E A;  1WJJ A;  2ZXP A;  2JN4 A;  1VQI A;  1TS4 A;  5A35 A;  1HCZ A;  4KJN A;  3CCE A;  2J0T D;  2V1C C;  1FNV A;  2Y0S E;  1HZ9 A;  4ZKB B;  4QQB X;  1K83 H;  1STG A;  4YCW A;  4IO9 A;  5JJK A;  5DAU A;  1O7L A;  3V96 A;  1OTC A;  4IPH A;  5CV4 A;  5JJL A;  2G9D A;  2ICE C;  4DR7 L;  4ZRZ A;  4B3R Q;  1PVO A;  1Q7Y C;  2GA4 B;  2Y0S G;  2KJX A;  5JPN C;  2OWO A;  1HFG A;  1D1K A;  4PZ7 A;  4GOP B;  1J5E L;  1PRT C;  3AEV A;  3S2H B;  2JYO A;  4ALP A;  3A5Z B;  4WJ3 M;  3CQZ H;  4DK1 A;  2Z6K A;  4DV0 Q;  3UE1 A;  2D62 A;  3GTG H;  1JT8 A;  4B3M L;  4A3D G;  4DAM A;  4C1N I;  1CKN B;  5GAH C;  3NEL A;  4DN4 M;  5C0X I;  3D31 A;  3P7J A;  1BXT A;  4JV5 Q;  5K36 H;  3GDE A;  3TQY A;  1HZB A;  1F9P A;  4PMW A;  2OTJ A;  3AQQ A;  4K2L A;  1S40 A;  2AUJ D;  2JEA I;  4A3B G;  1UE1 A;  2F3W A;  1EY6 A;  1EY5 A;  4QUF A;  1X3P A;  3VA7 A;  1XPU A;  4OGQ C;  4CDC C;  1NR4 A;  4IFD G;  3MA2 B;  4QL5 A;  1EYC A;  4ZCK A;  1BCP B;  3K5O A;  2F0F A;  1HNZ Q;  3BVG A;  3NP8 A;  5I4D A;  1Q3L A;  2VZA A;  4XIG S;  5FO8 B;  2X6G A;  3G6E A;  1PH9 A;  3FPU B;  1J6Q A;  4DV4 Q;  4KD3 A;  1CTM A;  4PNY A;  4GLX A;  1K83 B;  2NZO A;  1PHJ A;  2PW7 A;  3PV0 A;  2D2C C;  3SEB A;  4OX9 L;  1LV9 A;  3TRZ A;  4X66 Q;  5BN3 A;  3U4Z A;  1ASZ A;  5DM7 3;  3DEP A;  2PYK A;  3HOU G;  2NZ1 D;  4OIJ A;  3U50 C;  3EA6 A;  3VYU A;  3TS2 A;  3VDY A;  2K52 A;  1XMQ Q;  2M9V A;  2QGQ A;  1K8G A;  1XNR L;  5DM6 3;  5M5X H;  2ZJQ A;  1UE5 A;  2IHF A;  1XJV A;  5CV6 A;  2KUM A;  3KLS A;  2EYH A;  2C9O A;  3NTK A;  2JA8 G;  2VNU D;  5LMN Q;  1SLJ A;  3GTG B;  3DMU A;  1RIP A;  1BDO A;  1WYD A;  1D8L A;  3HKZ B;  2CQO A;  3HKS A;  4X62 L;  1I4H A;  3HOW H;  4C2M B;  1SNC A;  2Q2U A;  3KYH C;  4PQX A;  3HOV G;  1D7Q A;  2CHB D;  5BR8 L;  5HY6 A;  1QWY A;  1KHI A;  3TEH B;  2WAQ G;  1KC8 C;  2LFN A;  4YIJ A;  2B2W A;  1VQF A;  3IL8 A;  1SNP A;  3ONA B;  1A8V A;  1TR5 A;  2B8G A;  3C46 A;  2A73 B;  2UU9 L;  1PRT B;  3KUP A;  2F4I A;  4HTH A;  3BZK A;  3I3C A;  1PTO C;  1OXX K;  1XTC D;  1OXT A;  1B8A A;  4K6D A;  2EJF C;  2KCN A;  1GUW A;  4KLK A;  4KV6 A;  2EY5 A;  3IFT A;  1PZJ D;  2RSO A;  4HSP A;  1K0S A;  4K0K L;  5A2Q E;  1LAB A;  4A3B H;  5CV8 A;  3ERO A;  1YI2 A;  2MHV A;  1KLU D;  1U4P A;  1H9R A;  2AWN A;  4X3T A;  1VDZ A;  1ONL A;  4IFD H;  4U68 A;  2F0J A;  2OQK A;  5M5X B;  4ZAI A;  3I55 A;  5C6A A;  4A4I A;  2HIV A;  2KHI A;  3TP5 A;  5EKL A;  4IUQ A;  2MO1 A;  3CCU A;  4H0L C;  3I72 A;  3QB3 A;  2NYZ D;  3URY A;  4PMB A;  4X64 L;  4EQ5 A;  3VR3 A;  3F8T A;  1LTA D;  2QDB A;  1JB7 A;  1BNZ A;  1ILQ A;  2NWG A;  2DNC A;  2H1E A;  3HOU H;  3FDT A;  3T1H Q;  2Y0S B;  4RH6 A;  2ZM6 Q;  2JP1 A;  1IBK L;  4WOR A;  4DR2 Q;  2OTL A;  1N34 L;  3C3L A;  1LTL A;  1J9O A;  3CCM A;  3WOE A;  4FF4 A;  3KDF A;  1KDA A;  4XQQ A;  2CVR A;  3DWQ A;  4A3D B;  4OON A;  4Y7N H;  1LM0 A;  3HOZ G;  4R8N A;  1OO9 B;  1SJH D;  4PZ6 A;  1WTQ A;  3PUY A;  4RGM A;  2MUY A;  1IKM A;  4RCO A;  1F2M A;  5ISR A;  4L63 B;  4UPA A;  3TP8 A;  4YWK A;  3HOV H;  1KDB A;  4CDD C;  4A3B B;  1SNQ A;  1A15 A;  2F0P A;  1I4Q A;  5IGC A;  3DWP A;  4C3J H;  1YHA A;  5NUC A;  3DXJ C;  5LMN L;  1SAP A;  3V05 A;  1LT6 D;  2Z9H A;  1YNX A;  3CD6 A;  1L1O C;  3D6C A;  1HR0 L;  3ITP A;  2C35 B;  4FYD A;  4KI0 A;  1STA A;  5C0X J;  3CCS A;  4FO2 A;  4CKC A;  2Z0S A;  3UDX A;  3IRB A;  1Y1V G;  1IBM L;  1QUQ A;  3OTO Q;  4NMZ A;  3T53 B;  4GS3 A;  1PZI D;  4IPC A;  3HOU B;  4O42 A;  1JOO A;  1PTO B;  4KK7 A;  1SYC A;  3DM3 A;  3KF6 B;  5GAE C;  1VQK A;  3SGI A;  4I7A A;  3NWT A;  1QZG A;  5C4J B;  1Z9F A;  2ENB A;  4OWW B;  1PH4 A;  2F0V A;  1KNE A;  1A3V A;  2JA8 B;  2EXZ A;  4L5R C;  2R3Z A;  2DY8 A;  1NY4 A;  2NVT B;  4C3I B;  3FP9 A;  2BE5 C;  1TXY A;  3CMA A;  4Y7N B;  3AB9 A;  4I7Z C;  3RD4 A;  1E1T A;  3J81 E;  4WJ4 A;  1HJP A;  4A3K B;  2K7V A;  1G6Z A;  2IL8 A;  3K59 A;  3QIA A;  2Q2I A;  2KED A;  3K58 A;  4JI7 Q;  5IOC A;  4KJO A;  1IZ6 A;  1VQH A;  4JI6 Q;  3R8B A;  3HOV B;  4XXE A;  5IYC G;  3JAM i;  3K7A H;  3VA5 A;  3ND9 A;  4IOA A;  5IP7 G;  3OWE B;  2A69 C;  4JYA Q;  1ZYR C;  4RFB A;  4GKJ Q;  4FXG C;  3UDF A;  2KEN A;  5C4H A;  3HOZ H;  2K32 A;  4MTN A;  2JA7 B;  2ALY B;  1STY A;  1IBL Q;  4MIU A;  1XPR A;  1TWA B;  2ID0 A;  4GNX A;  1EL0 A;  1F9R A;  3EVQ A;  1LT3 D;  1ICF B;  3BZD B;  3HOX G;  4RGN A;  2BOS A;  3T1H L;  2EJM A;  3GP7 A;  1BQQ T;  4K5X A;  2ZM6 L;  3HOY H;  3MZ5 A;  2O5I C;  1A63 A;  4ULL A;  2EYF A;  4JI4 Q;  2I5L X;  4DV6 L;  4LJZ C;  1EUJ A;  4P74 A;  1VQG A;  1Z47 A;  4J15 A;  5K5P A;  3MFY A;  2CW0 D;  5M5Y H;  1SFO H;  1FJG L;  3PUW A;  1GJX A;  4DAV A;  3MHB A;  1QVG A;  2AUK A;  2Z4H A;  3PF5 A;  1DOM A;  2CH4 A;  1VQ4 A;  1Y1V H;  4P75 A;  4JI0 L;  4QIW E;  4BBS G;  4V19 0;  5D14 A;  4ILW A;  1EU4 A;  1CSQ A;  3GTL H;  1L1O B;  1H9S A;  4IUP A;  2IW3 A;  2D0P A;  2I5H A;  4RCN A;  4YCV A;  2BH2 A;  2WIN B;  3CPF A;  3K7A B;  3E3X A;  3GTK B;  3EBE A;  1K73 C;  4AYB E;  5JEA J;  3MWY W;  3VR4 A;  2RDH A;  3HOZ B;  2A68 D;  2MO0 A;  1DOL A;  1YNJ C;  3T13 A;  5I2Y A;  2NBF A;  4AYB G;  2M00 A;  4DV1 L;  1WI5 A;  3Q8D A;  1VQL A;  4KHP Q;  5CV9 A;  4RAU C;  5IYC H;  1DJR D;  5KRU A;  2IT1 A;  4H7B A;  4G7Z C;  2VL6 A;  5IP7 H;  2E2J H;  1SMX A;  2I46 A;  4XQN A;  4DNR B;  1PV4 A;  3I4M B;  5M5Y B;  4KHV A;  2H4O A;  1LYL A;  1TT2 A;  4ZLT F;  3P20 A;  3BVZ A;  3KBG A;  4DV2 Q;  5FK9 C;  3CCV A;  1Y1V B;  1SE3 A;  3HOX H;  2A8V A;  5D3I B;  1SYB A;  1YJN A;  1ESF A;  3GTL B;  1J8I A;  1OXS C;  1KXL A;  1RDP D;  1I3Q H;  3J81 j;  1L2F A;  5FJ8 G;  3CPW A;  1OXU A;  2B3G A;  2K03 A;  2WV6 D;  4A3F G;  1EQV A;  4R9W A;  3TS0 A;  3NXW A;  2FMC A;  4N9T A;  1K8O A;  2XGT A;  1IBL L;  3H0G G;  3KFU A;  1Q1B A;  3G4S A;  4H44 C;  1V1P B;  2VQE Q;  4DV5 Q;  2EVB A;  3U9O A;  4B9W A;  3N6R A;  4LUV A;  3HFZ B;  4M8A A;  4BBS H;  1XMO L;  2F4V L;  4JI4 L;  1NCV A;  2JE6 I;  4FP5 D;  1Y1W G;  1UNS A;  5EBD A;  1VQN A;  1Y69 U;  2AWO A;  3Q23 A;  2E2J B;  1IW7 D;  5IT9 c;  1WCM G;  4QGU A;  1C9O A;  1JQY D;  1YVC A;  4DR7 Q;  3N52 A;  1EZ6 A;  2IY5 B;  2F0U A;  3PUX A;  1J5E Q;  2LXK A;  2B2U A;  1N9W A;  1CKO A;  1ENC A;  5KND A;  2DGY A;  2XVS A;  2BDO A;  3HOX B;  4C3H B;  2JXM B;  5BN4 A;  1NMG A;  1I4X A;  4B3M Q;  1CQV A;  1I3Q B;  5T1G A;  3I70 A;  2UUC Q;  1KD1 C;  3A0J A;  3BZC A;  1F77 A;  1VS0 A;  1VQ8 A;  4E6I A;  4LF6 Q;  2F0E A;  2GVA A;  2E75 C;  2K50 A;  1SMY C;  1JOQ A;  5M5W B;  1NTG A;  2AMC B;  3RN2 A;  4IUR A;  3NUC A;  1L0W A;  1XX8 A;  5EJW A;  3OHX C;  1FL0 A;  1Z6H A;  3S16 H;  3A8K E;  1EY4 A;  5J3B A;  2NVY B;  1K8M A;  4GN3 B;  3PQI A;  3SXH A;  1ET9 A;  1LO5 D;  2UUA Q;  1WTH A;  1L0X B;  1SE4 A;  5FJ8 H;  4F8M A;  3K5N A;  1O78 A;  1WOC A;  2OEO A;  4JOI C;  4K8J A;  2WB1 G;  2YTX A;  4GN4 B;  1YZ6 A;  1UE6 A;  2IX3 A;  1SYF A;  2F03 A;  3KLS X;  1EQQ A;  4P71 A;  2RA4 A;  2WII B;  3H0G H;  4X65 Q;  2QIL A;  4DV2 L;  1X55 A;  2FJ2 A;  4UDU C;  1PXU A;  1JE5 A;  5KGU A;  2SOB A;  3K80 C;  4UAI A;  3K6O A;  4AYB B;  4ZK9 B;  4RA8 A;  4EQO A;  2F0O A;  1AP0 A;  1CI3 M;  2F52 A;  2F0K A;  2ZTC A;  2KHS A;  1Y1W H;  4YY3 Q;  1Q86 C;  5D65 A;  1CK1 A;  1PMR A;  3A54 A;  2Q8T A;  2TSS A;  1HNX Q;  1V1Q A;  3J80 c;  3BU2 A;  1WCM H;  4X62 Q;  4FF2 A;  2PZT A;  3AMU A;  3LNN A;  2VQE L;  4DV5 L;  4O1N A;  5BR8 Q;  4DK6 C;  2MP1 A;  1EIG A;  1CKM A;  4M1U B;  4OWX B;  3S16 B;  2CCZ A;  3CRL C;  5C4X G;  4DR6 Q;  4HIM A;  2UU9 Q;  3M85 A;  1TWH B;  1CA6 A;  4R4T A;  3J7A 5;  1R4P B;  1JOR A;  4POF A;  1YBY A;  1GXD C;  4QF4 A;  1QE6 A;  2ZXO A;  1S5E D;  4A3F B;  1BO0 A;  4K0K Q;  1TS5 A;  3H0G B; 
#chains in the Genus database with same CATH homology
 4A4I A;  2HIV A;  2KHI A;  2PQA A;  4NB3 A;  2ZJP A;  1G51 A;  1Q12 A;  5IYD H;  2E8G A;  4DAY B;  2VUM G;  3U58 A;  1NMF A;  2MO1 A;  4BBR G;  3CCU A;  4RG1 A;  4R4O A;  2VY3 A;  1EFW A;  5GAD C;  1VQ5 A;  1C7Y A;  1S72 A;  4X64 L;  1I94 Q;  2YU9 H;  4LF9 Q;  4EQ5 A;  3F8T A;  4GLV B;  1VQC A;  4UP8 A;  1I5F A;  3CCQ A;  4A3J G;  3D0F A;  4DUZ L;  1JB7 A;  5C3E H;  2UUC L;  4DR4 L;  2K4K A;  4GN5 A;  2K5N A;  4DR2 L;  5M3F G;  2UXC L;  3HOU H;  2EXD A;  4X64 Q;  3W1B A;  5C44 G;  4LF6 L;  3PO2 G;  4C2M H;  3PO3 G;  3F2C A;  3T1H Q;  4X6A H;  3I2Z A;  2ZM6 Q;  5FLM H;  1IBK L;  3FKI H;  1PH3 A;  4NXM L;  4DR4 Q;  4DR2 Q;  2OTL A;  1L1O A;  2UXC Q;  1N34 L;  1X6O A;  1VQB A;  1LTL A;  4JI3 L;  2WP8 J;  4BY1 H;  1AE3 A;  3CCM A;  4HIK A;  3KDF A;  3MEF A;  1IBK Q;  4NXM Q;  3AYH B;  1PH5 A;  4OON A;  4Y7N H;  1LM0 A;  3ER0 A;  2KHJ A;  1N34 Q;  3HOZ G;  1RL2 A;  4DV3 Q;  4PZ6 A;  3ZJY C;  3T1Y L;  1X9N A;  4JI3 Q;  3L2P A;  3PUY A;  2CWA A;  2NZH A;  2UUA L;  4Y52 H;  2JA5 G;  4RMF A;  4UY8 C;  1IXR A;  1VQE A;  4JI1 L;  4UPA A;  4P72 A;  1UEB A;  3NBH B;  4P73 A;  1YIJ A;  1SE8 A;  4YWK A;  3HOV H;  1TWH H;  2E5L L;  3W1G A;  4JC0 A;  2UXD L;  1AH9 A;  3CAM A;  4LWC A;  4JI1 Q;  4C3J H;  4X65 L;  3CF5 A;  4A3M G;  4LW1 A;  1YHA A;  3OYY A;  3HKZ E;  2BA1 A;  4BXX H;  4A3F H;  5LMN L;  2E5L Q;  3L7Z C;  2UXD Q;  4AQY Q;  3CW2 C;  1XNQ L;  1QZH A;  3S1M H;  2N3S A;  2YTV A;  3EN2 A;  3I56 A;  4EX5 A;  3OTO L;  1YNX A;  4IJH A;  3CD6 A;  1Y14 B;  3RZO H;  1L1O C;  3K8A A;  1HR0 L;  1E1O A;  2C35 B;  3LGJ A;  4KI0 A;  4O0A A;  5FLX c;  5C0X J;  3CCS A;  2Q2H A;  4LF4 L;  4YY3 L;  1JJG A;  5C4X H;  2Z0S A;  3UDX A;  3IRB A;  1XNQ Q;  2BH8 A;  1Y1V G;  1V43 A;  4GLA C;  1IBM L;  1BKB A;  1QUQ A;  3OTO Q;  4A3K G;  3RLF A;  3STB D;  1HNX L;  2XTI A;  4LF5 L;  4GS3 A;  1HR0 Q;  1E24 A;  4IPC A;  1KRS A;  4LF4 Q;  5M3M H;  2MQH A;  3J80 i;  3J81 i;  3DM3 A;  1SRU A;  3KF6 B;  1IBM Q;  4ME3 A;  5GAE C;  1VQK A;  1GVP A;  4LFC L;  1DGS A;  3SGI A;  1ASY A;  4LF5 Q;  2QEX A;  3KOJ A;  3GD7 A;  2ZTE A;  1Z9F A;  1QZG A;  2DUD A;  1VQO A;  4OWW B;  1PH4 A;  1YJ9 A;  3H3V I;  4DR3 L;  1FVI A;  1K0R A;  4DUY L;  1N8R C;  2UUB Q;  3E9I A;  4L5R C;  3PUV A;  3F1Z A;  2I0Q A;  3I4N G;  4IFD J;  2NN6 G;  1NY4 A;  1QVC A;  2IHE A;  3TRE A;  4LFC Q;  2VUM H;  1OXV A;  3ERS X;  3FP9 A;  1TXY A;  3CMA A;  4JI2 L;  4HJ9 A;  3GTQ H;  4DR6 L;  1K8A C;  4JI7 L;  1E1T A;  4A3D H;  4DR3 Q;  1HJP A;  4WJ4 A;  4A3J H;  3PIO A;  4JI6 L;  2JA7 G;  4JG2 A;  2MNA A;  2NN6 I;  4OO1 G;  2AKW B;  4A75 A;  2A19 A;  1AE2 A;  4JI2 Q;  3A5U A;  5M3F H;  4YHH Q;  2Q2I A;  4JI7 Q;  1VQD A;  2KCM A;  5C44 H;  1VQA A;  2PNH A;  3PO2 H;  1GM5 A;  4JYA L;  3PO3 H;  4LFB L;  1IZ6 A;  1VQH A;  5ELN A;  4JI6 Q;  2R93 G;  2I5M X;  4GKJ L;  4QY7 A;  1HZA A;  5IYC G;  3JAM i;  3S14 H;  3K7A H;  4OO1 I;  4DR5 Q;  3CP0 A;  3J7Z C;  4XTC S;  4IOA A;  3F2D A;  5IP7 G;  1P8L A;  3WWV A;  1PH2 A;  4DR1 L;  4JYA Q;  4LFB Q;  4GKJ Q;  1V9P A;  2VS1 A;  3UDF A;  4A3G G;  3GTO H;  1WFQ A;  4LF9 L;  2KEN A;  3HOZ H;  2JJQ A;  4POG A;  1Q1E A;  1EQR A;  4MTN A;  4DR1 Q;  2ALY B;  1P16 A;  2ZTD A;  4IPD A;  1IBL Q;  1XPR A;  2ID0 A;  2JA5 H;  1QVF A;  4GNX A;  1MJE A;  1MIU A;  2IX0 A;  4LFA Q;  1TWG H;  1E3P A;  3ULJ A;  3HOX G;  3HOW G;  4L5S A;  3T1H L;  2MFI A;  1UE7 A;  2ZM6 L;  3HOY H;  1PFS A;  3F2B A;  1XPO A;  1CKN A;  3S24 A;  1A63 A;  4JI4 Q;  2I5L X;  4DV6 L;  1TWC H;  1VQ6 A;  2PQA B;  3UDI A;  3M4O H;  1EUJ A;  4P74 A;  4BA1 I;  1VQG A;  1U5K A;  1Z47 A;  1SRO A;  4PG3 A;  4A3M H;  3S1N H;  4J15 A;  4IJL A;  1CSP A;  3ICE A;  1G29 1;  2R7D A;  5C4J H;  4DV6 Q;  3K81 C;  5GRO A;  2ZJR A;  3K0X A;  5GAG C;  4JBM A;  4DV3 L;  5M5Y H;  4TQU S;  3CCJ A;  2JA8 H;  1EWI A;  1IYJ B;  1SFO H;  1NJI C;  3PUW A;  1FJG L;  3CME A;  2R92 G;  1LUZ A;  2NVT H;  4C3I H;  1QVG A;  2K5V A;  1BVS A;  2FXQ A;  3L0O A;  2CWP A;  2R7F A;  1SN8 A;  3PF5 A;  5LMN W;  1VQ4 A;  1Y1V H;  4P75 A;  1YJW A;  4JI0 L;  3E9H A;  4QIW E;  4A3K H;  1PH6 A;  1FJG Q;  4BBS G;  1EIF A;  1U0L A;  2HIX A;  1CSQ A;  3NEM A;  4R4Q A;  3DLL A;  4GOP C;  1L1O B;  3GTL H;  3H3V H;  4MNO A;  1HR0 W;  4FDB A;  4IPG A;  1R9T H;  4DKA C;  2D0P A;  1B7Y B;  1X3F A;  2I5H A;  4GNX C;  2E2H H;  2LSS A;  2JEB I;  4YCV A;  4DPG A;  4A3E G;  4JI0 Q;  2BH2 A;  3KDF B;  4A3C G;  4WJ3 M;  3CPF A;  1BBW A;  3EIV A;  3PSI A;  3CCR A;  2GVB A;  2R7Z G;  4AQY L;  3EBE A;  1Q46 A;  3H15 A;  2OQ0 A;  2Q2T A;  1K73 C;  4H02 A;  4YCU A;  1W3S A;  4AYB E;  3I4N H;  2JA6 G;  5JEA J;  5DLQ E;  4LF8 L;  4OXP A;  2WB1 E;  5IYB G;  5IWA L;  2VQF L;  2QA4 A;  3M9B A;  2MO0 A;  2K75 A;  2NVQ H;  3I4M G;  4A93 G;  1KL9 A;  1KQS A;  4HJ5 A;  3CXC A;  2JA7 H;  3S1Q H;  1VQ7 A;  3U4V A;  3KJO A;  4KHP L;  2N8N A;  1TWA H;  1HZC A;  4AYB G;  2CFM A;  5IWA Q;  2PI2 E;  3HKZ G;  2VQF Q;  4DV1 L;  3S1R H;  2ES2 A;  1WI5 A;  3W5O A;  1YHQ A;  5K36 G;  3OW2 A;  4HJ7 A;  4A3L G;  1KAW A;  2KBN A;  3Q8D A;  2R93 H;  2R6G A;  1VQL A;  2GN5 A;  3RR5 A;  2KCT A;  4HJA A;  1JJC B;  4O2D A;  5IYC H;  4KHP Q;  5FLM G;  3GTP H;  4OX9 Q;  2IT1 A;  1TWF H;  4DV1 Q;  1M90 C;  3S17 H;  2VL6 A;  1EOV A;  3BJU A;  5IP7 H;  2E2J H;  2A1A A;  2UUB L;  2B63 G;  3GO5 A;  2RHQ B;  2YV5 A;  1HH2 P;  3S2H H;  2ASB A;  1SMX A;  1MJC A;  4HIO A;  4B3T L;  1KIX A;  4YWL A;  1PV4 A;  5IY0 A;  4JI5 L;  1C0A A;  1FGU A;  1O7I A;  1XNR Q;  1HNW Q;  1LYL A;  1QUQ B;  1EYG A;  3M4P A;  3MXN B;  2AHO B;  2IX1 A;  5GQO A;  3NEN A;  4L5Q A;  4BBR H;  3B6Y A;  3GTJ H;  1W2B A;  4DV2 Q;  4B3T Q;  3S2D H;  2E2I H;  4JI5 Q;  4YHH L;  3CCV A;  3PUZ A;  4UP7 A;  3HOX H;  2WAQ E;  3RN5 A;  1A62 A;  1PYS B;  2A8V A;  4L5T A;  1YJN A;  1N32 L;  2RF4 A;  3RNU A;  1KXL A;  1OXS C;  3FHW A;  1Q8K A;  1I3Q H;  4APV A;  3J81 j;  2N78 A;  2RCN A;  4DR5 L;  3ULP A;  1K9M C;  2YTY A;  1L2F A;  5FJ8 G;  3CPW A;  1OXU A;  2B29 A;  2B3G A;  3PF4 A;  1Q81 C;  4R1J A;  5HGQ A;  1N32 Q;  3E0E A;  5LMU L;  1N33 Q;  3M3Y H;  1X65 A;  4QJF A;  4A3F G;  3TS0 A;  3GTK H;  1WJJ A;  1VQI A;  4DNI A;  2XGT A;  2NVX H;  2D0O A;  1IBL L;  3H0G G;  3KFU A;  1Q1B A;  2R92 H;  2JK8 A;  3G4S A;  4JBW A;  3CCE A;  2VQE Q;  5LMU Q;  4DV5 Q;  4B3S Q;  4LFA L;  2ATW A;  1EIY B;  2V1C C;  4BY7 G;  4LUV A;  5IP9 G;  4GOP A;  4GKK Q;  3HFZ B;  2Y0S E;  1HZ9 A;  4BBS H;  1UWV A;  4QQB X;  4IOC A;  4B3R L;  1K83 H;  4YCW A;  4IO9 A;  1XMO L;  4JI4 L;  2F4V L;  1VQP A;  5JJK A;  2JE6 I;  1I94 L;  2EIF A;  3PIP A;  1Y1W G;  1OTC A;  4IPH A;  4A3E H;  5JJL A;  4TVA B;  4DV7 L;  4HJ8 A;  4DR7 L;  1S3O A;  4A3C H;  3JAM c;  1VQN A;  4B3R Q;  1XMO Q;  2F4V Q;  1PVO A;  2R7Z H;  3KF8 B;  2AWO A;  4JI8 L;  2Y0S G;  3CC7 A;  1Q7Y C;  4DV0 L;  2OWO A;  5IE8 A;  1KRT A;  2VW9 A;  1NE3 A;  4PZ7 A;  5IT9 c;  1WCM G;  4QGU A;  4GOP B;  1J5E L;  3AEV A;  1C9O A;  1VQM A;  1YVC A;  1I50 H;  4DV7 Q;  1PH1 A;  2JA6 H;  4DR7 Q;  4GNX B;  4R4C A;  4ALP A;  3M7N A;  3G48 A;  3A5Z B;  1PYB A;  4JI8 Q;  3CQZ H;  1VCI A;  4LUZ A;  2Z6K A;  5IYB H;  5C0X G;  4DV0 Q;  4A3I G;  2IY5 B;  2UXB L;  3UE1 A;  2D62 A;  3PUX A;  1J5E Q;  3GTG H;  3I4M H;  4A93 H;  4JV5 L;  4B3M L;  4A3D G;  1JT8 A;  5AJ3 L;  4DAM A;  1CKN B;  2LXK A;  4JOI A;  1N9W A;  1PA6 A;  1CKO A;  5GAH C;  3NEL A;  3PGZ A;  4LF7 L;  2DGY A;  5C0X I;  3RLN A;  3D31 A;  4JCV E;  2UXB Q;  5EAY A;  4JV5 Q;  1NMG A;  2F3I A;  4B3M Q;  2L15 A;  4A3L H;  5AJ3 Q;  3GDE A;  3TQY A;  1HZB A;  4PMW A;  2OTJ A;  3AQQ A;  3ULL A;  4DUZ Q;  1S40 A;  2UUC Q;  1KD1 C;  4LF7 Q;  3A0J A;  4NXN L;  2RHS B;  3BZC A;  3KLW A;  1JJ2 A;  2JEA I;  1HNZ L;  4LF8 Q;  1UE1 A;  4A3B G;  1I6H H;  1XPU A;  1VS0 A;  1VQ8 A;  2B63 H;  2PMZ E;  4LF6 Q;  1MKH A;  2CKZ B;  4IFD G;  1M1K C;  2GVA A;  4QL5 A;  2K50 A;  2JA9 A;  1NTG A;  4DV4 L;  4NXN Q;  2AMC B;  1HNZ Q;  3RN2 A;  4LUO A;  1L0W A;  2YYZ A;  2VZA A;  4XIG S;  3G71 A;  4UP9 A;  4HID A;  2OCE A;  1VQ9 A;  5IYD G;  3G6E A;  4IFD I;  5JJI A;  1PH9 A;  1FL0 A;  4R4I A;  3AFQ A;  1PH7 A;  1J6Q A;  4X66 L;  4DK3 C;  4DV4 Q;  3S16 H;  5J3B A;  5ELO A;  4YWM A;  3PCO B;  4GN3 B;  4GLX A;  1PHJ A;  2NZO A;  2Z6K C;  3T1Y Q;  1GO3 E;  3PV0 A;  1XMQ L;  2UUA Q;  5C3E G;  4A76 A;  3HOY G;  4OX9 L;  3TRZ A;  4X66 Q;  5FJ8 H;  3U4Z A;  1ASZ A;  1WOC A;  4JOI C;  3HOU G;  2WB1 G;  3U50 C;  2YTX A;  4GN4 B;  1PH8 A;  3VDY A;  3TS2 A;  1YZ6 A;  3RLO A;  3M4Q A;  2K52 A;  4JBJ A;  1XMQ Q;  1H95 A;  1UE6 A;  2HHH L;  4AIM A;  3FKI G;  2QGQ A;  1K8G A;  1XNR L;  1NBW A;  3CCL A;  1X54 A;  1EQQ A;  5M5X H;  4P71 A;  2ZJQ A;  3H0G H;  4X65 Q;  1UE5 A;  2IHF A;  1X56 A;  1XJV A;  2JA8 G;  2VNU D;  2JQO A;  4BY1 G;  3KF6 A;  4DV2 L;  1X55 A;  4A3G H;  1BBU A;  3CC4 A;  2HHH Q;  5LMN Q;  1SLJ A;  1RIP A;  4BY7 H;  3UE0 A;  4OWT B;  5IP9 H;  3I7F A;  2PI2 A;  1WYD A;  1JE5 A;  1D8L A;  3K80 C;  3RZD H;  2CQO A;  3HKS A;  1YHB A;  1HNW L;  2F52 A;  1Y1W H;  2K14 A;  2ZTC A;  3STB C;  4X62 L;  4C3H H;  4YY3 Q;  5E7N A;  1Q86 C;  2HQL A;  3GTM H;  3AFP A;  3HOW H;  1YIT A;  2Q2U A;  1GD7 A;  1N33 L;  3KYH C;  1X3G A;  5H1S E;  1HNX Q;  3HOV G;  1V1Q A;  4BA2 I;  3J80 c;  3J81 c;  1VQJ A;  1D7Q A;  1T9H A;  3BU2 A;  4NPS A;  5BR8 L;  1WCM H;  4X62 Q;  5HY6 A;  1GKH A;  4LNQ A;  1KHI A;  1X3E A;  3TEH B;  2WAQ G;  2VQE L;  4PZ8 A;  4DV5 L;  4BXX G;  1KC8 C;  4B3S L;  1VQF A;  2N49 A;  1A8V A;  4AH6 A;  5M5W H;  5BR8 Q;  4DK6 C;  2EQS A;  3KJP A;  4A3I H;  4GKK L;  1A0I A;  2WFW A;  1CKM A;  1CUK A;  2UU9 L;  1G6P A;  4DUY Q;  1IL2 A;  4OWX B;  3BZK A;  3JC6 6;  3UDG A;  1E22 A;  1XTD A;  1OXX K;  2CCZ A;  1OXT A;  1B8A A;  1E7Z A;  5C4X G;  4DR6 Q;  2BA0 A;  2NVY H;  4MZ9 A;  1N36 L;  4KLK A;  1JMC A;  4HIM A;  1B70 B;  2UU9 Q;  1SR3 A;  3A74 A;  3M85 A;  1Q82 C;  4K0K L;  2HT1 A;  3I4O A;  4JBK A;  4R4T A;  3J7A 5;  4POF A;  4A3B H;  5M3M G;  1YBY A;  1YI2 A;  1K3R A;  1N36 Q;  2H5X A;  4KHZ A;  2AWN A;  2K5H A;  5JEA G;  3CC2 A;  3S15 H;  4K0K Q;  2LXJ A;  2OQK A;  3K7U C;  1YEZ A;  3I55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...