1X3FA

Crystal structure of the single-stranded dna-binding protein from mycobacterium smegmatis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
107
Chain Sequence
GDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVEVDEIGPSLRYATAKVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Structure of Mycobacterium smegmatis single-stranded DNA-binding protein and a comparative study involving homologus SSBs: biological implications of structural plasticity and variability in quaternary association.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Dna binding protein
total genus 17
structure length 107
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x3fA00
2IHEA 4X64L 4ALPA 4TQUS 1HR0Q 2AMCB 1PH4A 1EIFA 1MIUA 2I5MX 4XIGS 2VZAA 3KFUA 4DK3C 1VQFA 4WJ3M 1JJGA 1B7YB 3J81c 2UUAQ 4P71A 4X62Q 2MO1A 2YYZA 1VQ9A 2UU9Q 1XNQL 3STBD 2R7FA 4YWLA 2N49A 1VQEA 2BA0A 4HJ9A 3GTJH 1CKMA 2KCMA 3BZKA 4BBRH 2JEAI 1FJGL 3BJUA 1KAWA 4YY3L 1E24A 4DV3L 4JI3Q 4A3GH 2I5LX 2VUMG 1Z47A 2DGYA 5IY0A 3RLFA 4C3JH 2VY3A 4UP9A 4A3KG 4LWCA 4GLXA 4A3MG 3TRZA 4YWMA 3GTMH 3I55A 3CXCA 3S14H 3I4NH 3IRBA 1S40A 3S1QH 4P75A 1GKHA 3AFPA 2C35B 1IYJB 5IYDG 5AJ3L 4DV2Q 4GOPB 1JJ2A 4LF9L 3T1HQ 2B63G 2EXDA 3B6YA 1E22A 3F8TA 2GVAA 2E2HH 3CAMA 4OONA 2AWNA 2WB1E 1B70B 4R4QA 4X64Q 1GO3E 3HKZE 1X55A 4JV5Q 1Y1VG 4A3LG 4Y7NH 1IBMQ 1CKNA 3I4OA 3S24A 3TREA 3OTOL 2VQFL 2JA8H 2YV5A 3BU2A 4A3BG 4DR2L 2A1AA 2F4VQ 2LXKA 3CPWA 3W5OA 4DUZQ 1HH2P 3G71A 2HIXA 1N8RC 5M3FH 4IOAA 1QVCA 4B3SL 1EQRA 1TWHH 3PGZA 1FJGQ 4YY3Q 2OQ0A 4DV0L 2RHQB 1U0LA 1XNRL 1DGSA 2JA7G 1UE7A 4KI0A 2RCNA 2UXCQ 3K80C 3CQZH 4JI1Q 4GKKQ 3CP0A 2VW9A 2KBNA 2JJQA 1WCMH 3T1YQ 2JK8A 5C0XI 4HIMA 2I0QA 2HIVA 4QIWE 3WWVA 1N33L 3H0GG 3ICEA 2OTLA 1PH6A 4QY7A 4NPSA 4A3JH 3TS2A 2F52A 4R1JA 2ZTCA 4A4IA 5C3EG 2QEXA 4DV1L 1C7YA 3S1MH 1Q7YC 4OO1I 1I94L 1AE2A 2WP8J 1EFWA 5JJKA 1GM5A 1X9NA 2JE6I 1KC8C 2L15A 1G6PA 3PO3G 3OYYA 1VCIA 1M1KC 4DR5Q 1MJCA 2RF4A 5C4XH 5C44H 1XPRA 4O2DA 2K5NA 2VQFQ 2PQAB 3CCJA 1EIYB 2K4KA 5IWAL 4GN5A 1KRTA 3CCLA 1QUQA 1K0RA 1E1TA 3JC66 4HIDA 5LMNL 1YEZA 3JAMi 5C0XG 3F1ZA 2PI2A 2PNHA 5IYCH 3KJOA 2NVXH 1LTLA 2I5HA 4DR1Q 4B3SQ 3CCQA 1HNWL 2D0PA 1W3SA 3CF5A 4OO1G 3U4VA 1YI2A 5FLMH 1XNRQ 1QZGA 4JG2A 3PIOA 2UUBL 4P73A 2BA1A 3GD7A 2Y0SE 3HOXH 3KDFB 1J5EL 1G291 4JI4L 1N36Q 4LF8L 3AYHB 3HOUG 4ME3A 2KHIA 1J6QA 4BY1H 3HOWG 3S16H 4BBSG 1NTGA 1XPUA 2VNUD 4JI6L 5M5XH 5M3MG 3KF8B 4X65Q 4GNXC 1JMCA 4LF5L 1VQ5A 3HOYH 3RZOH 4UP7A 2UUAL 4X62L 1JB7A 4BY7G 4HJ5A 1CSQA 4DV1Q 2KENA 4IPCA 1XMQL 2UU9L 4A3CH 1I94Q 1HZ9A 1L0WA 4DUYL 1V43A 1SE8A 1PVOA 1NMGA 1C9OA 4GKJQ 3RLOA 3M7NA 2N78A 3S17H 4LNQA 1UEBA 3FKIH 2CFMA 5IP7G 5ELOA 3TQYA 4JBWA 4RG1A 3A5UA 3A5ZB 2CQOA 1QUQB 4L5QA 4C3HH 5BR8L 5LMNQ 3CC2A 2VUMH 4GLVB 3S2DH 1X3GA 1IXRA 1WYDA 4JOIC 4NB3A 1EUJA 5IP9H 2Q2TA 2JA5G 3PSIA 2UXDQ 4QL5A 1E1OA 1GD7A 2Z0SA 4GS3A 4KHZA 3HOVG 1TWFH 3ERSX 1VQHA 2N3SA 2BH8A 4JV5L 2Q2UA 2FXQA 3KJPA 4JI6Q 1IBML 4LF5Q 3EBEA 3J80c 3J81i 4JC0A 4JBJA 4IFDJ 1SFOH 4YHHL 1VQGA 1XMQQ 2F4VL 4A3LH 2K50A 3PO2H 4YCUA 4DUZL 1IBKQ 3L0OA 4DUYQ 4A3BH 3NEMA 1SLJA 1Q81C 2OTJA 3CCRA 1XJVA 3ULLA 3I56A 1KIXA 4HIOA 2E5LQ 1NMFA 1Q12A 4JBMA 1Q8KA 1P16A 1OXTA 3PV0A 1JE5A 1H95A 3I4MH 2UXCL 3H3VH 3CW2C 4IO9A 5JEAJ 4JI1L 4GKKL 1LM0A 4LUVA 3T1YL 2JA7H 5BR8Q 1TXYA 4J15A 4B3RQ 3HFZB 5JJIA 4DV6Q 3K8AA 3RN5A 4GNXA 2QGQA 1D7QA 4POGA 4A3IH 1E3PA 4IPDA 4AYBG 1CSPA 4OWTB 3GTKH 5IYBH 3KF6A 4IJLA 3H0GH 1NE3A 4OX9L 1BBUA 2NVQH 1VS0A 5C3EH 1SR3A 2JA6H 1KRSA 3EN2A 4DAYB 4DR5L 3L7ZC 2MNAA 1QVGA 1SROA 3BZCA 2D0OA 1U5KA 1X65A 1MKHA 3L2PA 1X54A 2CCZA 2EIFA 1VQPA 4AH6A 3G4SA 4YHHQ 1KL9A 3EIVA 4PZ8A 1GVPA 2YTXA 4DNIA 3F2BA 3M4OH 2JA9A 2ID0A 2D62A 1OTCA 4R4TA 4A3EH 1A0IA 4XTCS 4DR1L 1VQLA 5FJ8G 3PF4A 5H1SE 4MZ9A 4O0AA 4A93G 4JOIA 3GO5A 1K73C 1Y1WH 2ES2A 4A3FH 3CCUA 4K0KQ 4QJFA 4DV4L 1N36L 2R7ZG 1YHBA 3AQQA 2R93H 1Z9FA 2E2JH 4C2MH 2MO0A 1SN8A 2CWAA 4RMFA 1PV4A 4PMWA 1PH2A 3U58A 4X65L 1KQSA 4OXPA 3CPFA 2F3IA 2K75A 2ZTEA 3M9BA 4LF4Q 4LFAQ 1VQAA 1YIJA 3I7FA 2R92H 1EOVA 3CCVA 4DAMA 3A74A 4OX9Q 3ER0A 3NELA 4GLAC 3KOJA 4BBRG 4HJAA 2HT1A 3ZJYC 2IHFA 4GKJL 1TWGH 1K3RA 1VQ6A 5FLXc 1BVSA 1VQ8A 1KHIA 3A0JA 4UY8C 4A3GG 2ZM6L 3PIPA 5GADC 3KLWA 3PUWA 1X56A 1CKNB 2JEBI 1VQJA 2E8GA 1PH5A 1X3EA 5IP7H 3HOZH 4DR4Q 1KD1C 3MXNB 3I4NG 5JJLA 5ELNA 1Q1EA 1K8GA 1PA6A 3AEVA 4QQBX 4FDBA 1JJCB 3W1GA 1SMXA 2OCEA 4GOPC 2PI2E 2Q2HA 1IBLL 1XPOA 3D31A 4AQYQ 4P74A 3AFQA 2UUCQ 2WAQG 3RLNA 3STBC 1VQDA 5HGQA 2LXJA 3RR5A 2UXDL 1OXSC 1UWVA 2KCTA 4DV4Q 4A3DG 3FP9A 2JA8G 1HZAA 2GVBA 4JI8L 3CMEA 4JI0Q 4H02A 2OWOA 1VQ7A 1L2FA 3HOVH 3CMAA 1PYBA 2CKZB 2IX0A 5DLQE 1PH9A 1TWCH 5M3FG 1ASYA 1JT8A 2B29A 4DKAC 1BBWA 3CC4A 3NENA 1IBKL 1FL0A 3S1NH 4YWKA 1VQKA 3J7ZC 4POFA 4EQ5A 1HNXQ 1CKOA 3M4PA 4UP8A 1A62A 2E5LL 2ATWA 4IFDI 4JCVE 5C0XJ 2IY5B 1PH3A 2XTIA 2VQEQ 2ZM6Q 5GROA 4NXMQ 1IL2A 1WCMG 5IE8A 4JYAQ 3LGJA 4B3RL 1VQIA 2LSSA 2ZTDA 4DV6L 1I6HH 4A75A 1HZBA 3M4QA 4APVA 2E2IH 1BKBA 1B8AA 1WJJA 2K5HA 2MFIA 4A3KH 1PH8A 1IBLQ 3K7AH 2R7DA 1I50H 4A3MH 1XMOQ 4LW1A 1N9WA 3RNUA 2BH2A 5C4XG 3GDEA 5IYDH 1L1OC 2VL6A 1QVFA 3W1BA 1SRUA 2B63H 4JI8Q 1Q1BA 4IFDG 1A63A 3UE1A 1PYSB 1NBWA 1S3OA 1YHAA 4GN3B 4P72A 4R4CA 3UDIA 5GAGC 4LF7L 4NXNQ 3PUYA 5LMNW 4JI2L 3J80i 4HIKA 1N34L 5IYCG 3RN2A 1Y1VH 2N8NA 4YCVA 3GTLH 3S15H 1S72A 3M85A 5HY6A 4JI5Q 1N32Q 2Z6KC 1YHQA 5M5YH 5GAHC 5FLMG 4DR3Q 4GOPA 2K52A 5LMUL 5JEAG 1RIPA 1HR0W 5FJ8H 1AE3A 4B3TL 4LF6Q 3D0FA 3SGIA 4K0KL 4LFBQ 2UXBQ 1O7IA 2AWOA 2NN6I 3UE0A 3ULPA 3HOYG 1OXXK 3S1RH 2DUDA 4B3ML 2R7ZH 2WB1G 4A3CG 1TWAH 1Q46A 4LF4L 4PZ7A 3HKZG 4LFAL 4BXXG 3CCEA 1YVCA 3OW2A 1I3QH 1K83H 1FGUA 1WFQA 5IT9c 5J3BA 1LUZA 4HJ7A 1X3FA 3PUXA 2V1CC 3FKIG 1YJNA 4DR7Q 1PH7A 1X6OA 4X66Q 4LFCL 4HJ8A 3PO3H 4LF7Q 4JI2Q 3NBHB 4DV7L 3H3VI 1YITA 1N34Q 2NN6G 3F2CA 4DPGA 4DR4L 4IOCA 2OQKA 4WJ4A 1VQNA 4IPGA 1IZ6A 2ZJRA 2KHJA 4OWWB 5IP9G 1RL2A 3M3YH 2CWPA 1D8LA 3E0EA 3K7UC 5GAEC 3K0XA 5LMUQ 4AQYL 2UUCL 2ZJQA 1K9MC 3GTOH 3GTGH 4DV5Q 4B3TQ 1LYLA 4KHPL 4MTNA 4DV7Q 4JBKA 1A8VA 1L1OA 3J81j 4AYBE 4IJHA 1Q82C 4OWXB 2H5XA 4JI0L 3GTPH 2PQAA 4B3MQ 3HOUH 4A3DH 3PO2G 2A8VA 3HOWH 4GNXB 4BBSH 2ALYB 1OXUA 2NVYH 2B3GA 2R6GA 5M3MH 2ZJPA 1XNQQ 1HJPA 2IX1A 1VQ4A 3KF6B 3H15A 3DM3A 4AIMA 4LUZA 4IPHA 2Z6KA 2QA4A 3GTQH 4BY7H 1MJEA 2YTYA 1HNXL 3I4MG 1I5FA 3Q8DA 4LFCQ 2HHHL 2VQEL 4DR6L 3CC7A 3KDFA 4PZ6A 1OXVA 4NXML 1UE5A 3ULJA 3G6EA 4DV3Q 3UDGA 4JYAL 1UE6A 3HKSA 1CUKA 4L5TA 5E7NA 4A3IG 3RZDH 1EYGA 1EQQA 5IYBG 1FVIA 3PUZA 3UDFA 4TVAB 2Y0SG 1G51A 2MQHA 1HZCA 4KLKA 5K36G 1AH9A 4X6AH 1HNZL 5AJ3Q 3VDYA 4LF9Q 2JA6G 1XMOL 1K8AC 3S2HH 2IT1A 1M90C 2EQSA 1PHJA 2XGTA 4DK6C 2NZHA 1VQMA 4JI7L 4KHPQ 1C0AA 2K14A 3DLLA 3FHWA 3TS0A 1ASZA 2YU9H 1L1OB 1PFSA 2JA5H 4GN4B 4NXNL 1NY4A 1V1QA 3OTOQ 1R9TH 4DR2Q 3J7A5 4L5RC 3CCMA 1P8LA 4A3EG 1WI5A 1WOCA 1VQCA 4BA2I 4QGUA 3K81C 3U50C 3JAMc 4JI5L 1N32L 1Y1WG 4DR3L 2YTVA 4A3FG 2JQOA 4BA1I 1E7ZA 4UPAA 3KYHC 3E9IA 2R93G 2VS1A 4DV0Q 2HHHQ 1V9PA 4DR6Q 3F2DA 1VQBA 4LF6L 4LFBL 1QZHA 2UXBL 3TEHB 1KXLA 4EX5A 1HR0L 2K5VA 2Q2IA 4A3JG 1N33Q 2R92G 2A19A 2WAQE 1YNXA 2HQLA 5C4JH 2AKWB 1HNZQ 3PCOB 5GQOA 1Q86C 2ASBA 1EWIA 4BXXH 3PUVA 1PH1A 4JI7Q 5C44G 3CD6A 4DR7L 4YCWA 2AHOB 2GN5A 4R4IA 3UDXA 4X66L 5M5WH 3PF5A 1Y14B 4LUOA 1VQOA 1XTDA 4A76A 4C3IH 1YJ9A 3G48A 3CCSA 3HOZG 1W2BA 4PG3A 5IWAQ 4JI3L 3I2ZA 4MNOA 1NJIC 1YBYA 3U4ZA 1T9HA 2NZOA 2NVTH 1UE1A 2WFWA 4R4OA 3HOXG 1HNWQ 4DV2L 2PMZE 1YJWA 4Y52H 3T1HL 1YZ6A 4BY1G 2UUBQ 4DV5L 3MEFA 5EAYA 1J5EQ 2RHSB 4LF8Q 4A93H 4JI4Q 3E9HA 4L5SA
chains in the Genus database with same CATH superfamily
2IHEA 4X64L 4TQUS 2EY6A 4PV1C 2VZAA 3I8ZA 2ZXPA 1B7YB 4P71A 4RKLA 2YYZA 3STBD 2R7FA 4YWLA 2N49A 5CV4A 3GTJH 1CKMA 2KCMA 1RD9D 4DFAA 3K5LA 1HXYD 3DEPA 1IKLA 4HMIA 1Z47A 3RLFA 1STYA 4H13C 4C3JH 3CQZB 4UP9A 3RZDB 4A3MG 1BCPF 2KJXA 3S1QH 4U68A 5BN3A 3H3VI 1HHVA 5IYDG 2E76C 4GOPB 4DV2Q 3T1HQ 3OIQA 1Y8PB 2G9DA 1SJED 4KKTA 2WB1E 4X64Q 1LTID 3K57A 2LFNA 1IBMQ 4B08A 3MXNA 2A1AA 3CPWA 1BCPB 2FMMA 5CBEE 4HSVA 5E4WC 2HIXA 5M3FH 4IOAA 3H91A 3OIPA 1S5DD 3GV6A 2JA7G 3JAME 3K80C 2KBNA 2JJQA 1N33L 2I46A 2RKSA 1XXGA 1PH6A 3E5SA 4QY7A 3TS2A 2QEXA 4A4IA 3HOYB 5JJKA 3S1MH 1Q7YC 1EFWA 5CV7A 1X9NA 2JE6I 1GM5A 1G6PA 1PFBA 2WB1B 1JE4A 5CORA 1VDZA 2Z4IA 3MXPA 1WTWA 1XPRA 4O2DA 3S17B 2F0HA 4HIDA 3MHBA 2PI2A 2RBMA 1Y8NB 2I5HA 3D6CA 4C3HB 1JQYD 1HRJA 4K14A 3Q23A 2VUMB 4CDDC 1W3SA 2RSOA 3CF5A 3S2DB 1QZGA 1LTGD 3F2UA 3HOXH 5JEAH 1G291 1PZID 2RQXA 2KECA 3T56B 1LT4D 4ZKCB 5M3MG 3KF8B 1TT2A 4HMJA 2IX3A 4CBVA 1HTPA 4HJ5A 2UU9L 2RDHA 4IPCA 1Q3LA 1L0WA 4RCNA 4DAVA 3PO2B 2WV6D 4A3BB 2K6AA 3MTSA 1IYUA 5KRUA 3K59A 2MJ8A 5IP7G 1SYEA 1QNKA 3A5UA 3I4MB 2P5ZX 2CQOA 1STEA 1QUQB 4L5QA 2PCFB 4FF2A 1X3GA 2XNAC 5C3WA 3DWPA 1EY5A 2UXDQ 4QL5A 1AEXA 1E1OA 3HOVG 5LL6X 1OO9B 2N3SA 2BH8A 4JV5L 2Q2UA 4NDXA 3EBEA 4G7HC 4JBJA 4IFDJ 1LABA 1VQGA 2F4VL 1F9QA 3L0OA 4S3SA 1CQVA 3CCRA 2OTJA 3I56A 1KIXA 4FXGC 1KLGD 1JCKB 4A3EB 1BCPD 4N9TA 1E2WA 3SE0A 1AZQA 3CW2C 2NZ1D 1LM0A 2WIIB 3T1YL 4I65A 4MTKA 3K8AA 5EKIA 4C2MB 2O5IC 4OWTB 1LACA 4UHVA 4A3JB 2F0KA 3DHQA 4G7OC 5K36H 1L0YB 3R3OA 4C3IG 5C3EH 1SR3A 2JA6H 4DAYB 4K2KA 1QVGA 1ICWA 4IUNA 1SROA 5KNDA 2D0OA 1U5KA 2HCIA 1D2BA 2A6ED 2CHBD 2YTXA 3F2BA 4R4TA 1VQLA 4XTCS 3A7AB 1F9RA 1K28A 4A93G 4JOIA 1BNZA 1KNEA 2FMCA 4N9PA 1WTOA 4A3FH 4K0KQ 3D4DA 3GP7A 5FO8B 1CTMA 4R9WA 4OO1H 3AQQA 2F0OA 2MO0A 4RMFA 3A7LA 3QOLA 1KQSA 5BN4A 1JWUD 5KYLA 2F0FA 2F3IA 3M9BA 2TMPA 4LF4Q 1EOVA 4DAMA 3ER0A 1LTSD 2PPBC 2IHFA 1CZGA 5CGKA 4TKOB 1VQ8A 1KHIA 3OMGA 4UY8C 3PUWA 1HA6A 1X56A 1CKNB 2JEBI 2E8GA 3HOZH 4ZCKA 3SK8A 3I4NG 4PQXA 5A2QL 1PTOC 3N52A 1PA6A 4GOPC 4CDFC 3HS0C 5DNFA 1S5CD 5CV5A 1XPOA 2R3ZA 2UUCQ 4P74A 3RLNA 1SE2A 4A3MB 4J6HA 1OXSC 4A3DG 2JA8G 3IFDA 3OW7A 1A3UA 1U4PA 4GZYC 1L2FA 1GUNA 2IX0A 5DLQE 4ZQ3A 1TWCH 1ASYA 1JT8A 3CC4A 5E3FA 1IBKL 2OEOA 5DEHA 2XN9C 2E5LL 1JR0D 3S9WA 5C0XJ 1O78A 2D2CC 4RAUC 1WCMG 1ZYRC 4B3RL 1KABA 2LSSA 1I6HH 3D8GA 1CA6A 1BKBA 2R7ZB 4A3KH 1TWAB 3MFYA 2L4NA 1I50H 4LW1A 5C4XG 3BVGA 3GDEA 5L37A 3MXGA 2B63H 1QVFA 1Q1BA 4IFDG 5JAVA 2BE5C 1S3OA 4LF7L 5LMNW 4JI2L 1SDFA 3J80i 3E6ZX 4ODGA 1Y1VH 2N8NA 3FVQA 3M85A 3AMUA 1N32Q 1YHQA 1RJTA 4DR3Q 3FPUB 1RIPA 1LTBD 2L0CA 1YNJD 1MHWC 4LF6Q 1VF5C 2A6HC 4FO2A 4UDUC 4B3ML 2E2JB 1Q46A 1B3AA 3CCEA 3OW2A 1I3QH 1FGUA 3ONAB 5J3BA 2KCCA 5COYA 3PUXA 5M3MB 4K8JA 1X6OA 3GTQB 4LFCL 1CK1A 4FP5D 3HP3A 4EQOA 1D5XC 4LF7Q 3DXJC 4JI2Q 3BG3A 1ET6A 2L1BA 2NN6G 1SEBD 2SNSA 4DPGA 3HEJA 4IOCA 2KHJA 4LMQD 3TDQA 1D8LA 3K7UC 4DNTB 3VR5A 3K0XA 1EU4A 1HPCA 4DV5Q 3J81j 4OHJA 4KN4C 3GV3A 4B3MQ 3HOUH 3K58A 2X6LA 2A8VA 2EE1A 4GNXB 4BBSH 1WTRA 3HOVB 3H15A 3DM3A 2Z6KA 2QA4A 4XT1B 4IURA 1HNXL 2Z4HA 1BXTA 4LFCQ 4X3KA 2HHHL 4DR6L 3ULJA 1WD1A 2KVMA 4EGVA 5E7NA 3HKSA 4L5TA 3RZDH 4R8IA 1PTOH 5KYIA 1G51A 4HAEA 2MQHA 1HZCA 1PZJD 1HNZL 3EA6A 5D65A 5G3LF 1XMOL 2F03A 1M90C 4FVMA 1VQMA 1C0AA 3KBGA 2B2YC 2K14A 3DLLA 3TS0A 1ASZA 1L1OB 4L6TB 4GN4B 5M5WB 1WTPA 1V1QA 4C3IB 2SDFA 3J7A5 1SMYD 1WVLA 1F9SA 1GUOA 1WI5A 2A69C 1XYIA 2NWGA 3U50C 5KNBA 3FEWX 2CW0D 4ZLTF 3WOFA 1EZ6A 4UPAA 2J4XA 2R93G 2HHHQ 4DR6Q 1V9PA 4DXFA 2KQ3A 1VQBA 3L9AX 1ENCA 2FHTA 3BVZA 4HTHA 5D3DA 4EX5A 3ZYYX 4A93B 2EDGA 5HGTA 3OOCA 2HQLA 3H09A 5C4JH 1ICFB 1HNZQ 2K33A 1Q86C 1QG7A 5TSSA 3PUVA 1JICA 1PH1A 3CD6A 2N55A 1G8ZD 3J7AV 1EQTA 2GN5A 1PYWD 2EOTA 2B2UC 2PZUA 1Y14B 1EY8A 5IT9E 2F0PA 2B2TA 2NTTA 3CCSA 1RTOA 5CV8A 5IWAQ 3I2ZA 5CYUA 1T9HA 2NZOA 1F2MA 3JAML 2ZXOA 1Z7TA 3NE5B 3A8JE 2HDMA 2PMZE 5EKKA 4Y52H 3I4NB 4BY1G 2Z8LA 3MEFA 1J5EQ 5A2QE 3M7NA 4JI4Q 2AMCB 1EIFA 1MIUA 2KHSA 5FO7B 3KFUA 4WJ3M 1JJGA 3J81c 5CR3A 4Y7NB 2UUAQ 4A3DB 3KLSX 2M2LA 1XNQL 2JA8B 4K5VA 2DY7A 4RHRA 4HJ9A 2K05A 3BZKA 4BBRH 4OELB 2JEAI 4X3UA 3BJUA 1KAWA 2QW7A 2BDNA 4KHVA 3D3RA 5EJWA 2K04A 2VUMG 5IY0A 1H9SB 2X6GA 4GLXA 1B3QA 1Q8IA 1WCMB 3GTMH 3I55A 3PIO3 3S14H 3IRBA 4P75A 3I3CA 3AEVA 1IYJB 1ZEQX 2K01A 5IGDA 1SMYC 2RA4A 4LF9L 3B6YA 2E2HH 3CAMA 2MUYA 3OMCA 2AWNA 1B70B 1LT5D 2EY1A 2A68C 2CW0C 1FNVA 4R4QA 1X55A 1PFNA 5C4XB 5C44B 1TS2A 3BU2A 1B9NA 4DR2L 4A3BG 4WRDA 4MN3A 5EBDA 4RH6A 1R9TB 2RCFA 3HGBA 4DUZQ 1HH2P 5IGCA 1N8RC 2NVXB 1KDBA 2OQ0A 2RHQB 4N8FA 2PZTA 2QF7A 3K5OA 4GKKQ 5G3LD 5C0XI 1QOHA 5IGEA 3H0GG 3S16B 5M5XB 4A3JH 4R1JA 2HQEA 1C7YA 1AFPA 1I94L 3QIAA 4IN3A 5T1GA 3PO3G 1I6VC 1ML0D 1VCIA 4DR5Q 1MJCA 1FNUA 2RF4A 3CRKC 2F0JA 1EIYB 3CCLA 5LMNL 3KJOA 2PNHA 4PMBA 1EYAA 4DR1Q 2O2LD 3CCQA 2EY5A 4JG2A 3PIOA 3SHLA 2C9OA 1U4MA 1J6QA 4DK0A 1XPUA 4WORA 1Q90A 4X65Q 1TWFB 4GNXC 4LF5L 3RZOH 3QB3A 1JB7A 2KENA 1SNCA 1I94Q 1HZ9A 1SFOB 1V43A 4ME5A 5DM73 5IOCA 4GKJQ 2N78A 1UEBA 3FKIH 1KDAA 2E2DC 4IZ8A 5ELOA 5ELCA 2F0SA 3VYTA 1EY6A 1DJRD 5BR8L 2K5QA 5LMNQ 2F3WA 4X3TA 3WOEA 4CKEA 1HTLD 5FK9C 1EUJA 3W2DA 1V8QA 1A6XA 1T5EA 1JWMD 4FF4A 4GS3A 2Z0SA 4G7ZC 2NVQB 2BCOA 4IALA 1LTRD 3UI2A 4F87A 1H9RA 5KNCA 1IBML 4LF5Q 2K50A 5DM63 1SLJA 1FYCA 4G57A 1GUGA 1Z6HA 1Q12A 1P16A 4B9XA 2N88A 1OXTA 1QNUA 1TWHB 2EXZA 4FF3A 2WKDA 4OEMB 4RHSA 5JEAJ 4XXEA 5JVG3 2QDBA 3BZDB 4KJNA 4J15A 5BR8Q 2JA7H 2R93B 5CV9A 4DV6Q 3RN5A 1D7QA 2QGQA 1ENAA 4ILWA 4A3IH 1CSPA 3CRLC 2KOLA 5IYBH 3GTKH 1W6JA 4KD4A 4CGYB 4BS9A 1KRSA 1D5MC 1TWGB 2MNAA 3BZCA 2EIFA 3NBIA 4AH6A 1CZWA 1E2VA 3M4OH 1OTCA 2EJMA 3NQIA 3V05A 1NR2A 4MZ9A 1Y1WH 2K1BA 1L0XB 3KLSA 1TU2B 4DV4L 2R7ZG 2RVLA 3SVMA 2E2JH 4KD3A 3NHHA 4PMWA 3U58A 4BY1B 1LT6D 1EIHA 3IL8A 2R92H 1JWSD 1F77A 4LFAQ 3I7FA 1G6ZA 3CCVA 5IGBA 1A2TA 4FF1A 3ZJYC 3Q0AA 3RD4A 2ZM6L 4H0LC 4C3JG 1PDQA 2GA4B 3EVQA 1PH5A 1X3EA 5IP7H 4DR4Q 1KD1C 5JJLA 4ZRZA 4QQBX 1JJCB 1M4VA 1EL0A 2Q2HA 3D31A 2WAQG 3STBC 3RR5A 3K7AB 4ZKBB 2UXDL 2KCTA 4DV4Q 3I91A 3SK5A 4JI8L 4DF7A 4H02A 2EYMA 3FMCA 1VQ7A 3HOVH 3KBXA 3AB9A 1H9JA 1EY4A 1WTQA 5M3FG 1DOLA 1EWCA 1FL0A 4LAAA 2FFKB 3MA2B 3S1NH 3J7ZC 3T13A 4POFA 4EQ5A 2KEEA 3J80E 2E75C 2ATWA 2XTIA 4IUUA 2ZM6Q 4NXMQ 3R2TA 4JYAQ 1SAPA 5F2DA 4PMCA 2NTSA 3LGJA 1EY7A 2ZTDA 5EPKA 1SYGA 1HZBA 3M4QA 2E2IH 2RDFA 4CJ2C 1EZ8A 5JJZA 2HCCA 2K5HA 1SSOA 1NCVA 1N9WA 2BH2A 3H0GB 4JPBW 3W1BA 3NPPA 4JI8Q 1YHAA 3NBHA 4GN3B 1BR9A 4O42A 5C3XA 2IJ0A 4HIKA 3PO3B 4RGMA 3RN2A 3GTLH 3S15H 4K6LA 3OSOA 1BBXC 1SNQA 5HY6A 4X3SA 5M5YH 4GOPA 2K52A 1EIGA 4QB4A 4JW0A 5JEAG 4P2CB 4ID6A 4K0KL 3GTOB 3QR8A 2UXBQ 1MSHA 3ULPA 3M4YA 1BDOA 2XWJB 3S1RH 1GUTA 2KA7A 4RGNA 4LF4L 1K83H 3TSSA 4HJ7A 1X3FA 4DR7Q 1VMCA 4X66Q 4CKBA 3SDZA 4DV7L 3A8KE 5FLXE 3F2CA 1MD2D 2OQKA 3QG1A 1VQNA 4RWSC 5KEEA 2ZJRA 5DAUA 2G5DA 2EJGC 2UUCL 1CQFA 3HRZC 3GTGH 3GQBA 1LT3D 3RUZA 1CHQD 1KNAA 3HZXA 4IJHA 3V2TA 4C56C 2YU9B 3DMUA 4A3DH 1EY9A 1SNDA 3HOWH 3D4WA 2NVYH 2B3GA 2ZJPA 1DCZA 5IT9L 2IX1A 3KF6B 4BY7H 4WJWA 4BWGB 1I5FA 2XWBB 5ELFA 2JXMB 4PZ6A 1OXVA 1UE5A 3G6EA 4DV3Q 3UDGA 1UE6A 2JN4A 1CUKA 4YIJA 3BDLA 3TP7A 1FVIA 4NW2A 5K36G 5EKLA 5AJ3Q 2JA6G 3S2HH 4DGZA 4DNRB 1PHJA 2NZHA 4E6IA 2LS01 3X3NA 1EQVA 2JA5H 1NUCA 3OTOQ 1B1ZA 1R9TH 1O7YA 1BCPC 4L5RC 1WOCA 4ZAIA 3VR3A 1S5BD 4BA2I 3JAMc 1N32L 4DR3L 4JVZA 4A3FG 4BA1I 3CHBD 4DV0Q 4LF6L 1WD0A 3TEHB 1HR0L 2Q2IA 4QIWB 1AN8A 2WAQE 3K5MA 4HN7A 4FXDA 2A6EC 3PCOB 1BOSA 4HCSA 1PFMA 4KK7A 5C44G 2AHOB 3TZUA 3PF5A 2KEDA 4LUOA 2Z1CA 3GTJB 3G48A 3HOZG 3MZ5A 5JPNC 4JI3L 1NJIC 4MNOA 1GJXA 4I7ZC 2CVRA 2NVTH 4C3JB 2NN6H 2B2VC 4KKUA 2WFWA 3A54A 4R4OA 1K8MA 3VA5A 1HNWQ 1YJWA 2DNEA 1YZ6A 3EFXD 3TMEA 3S1QB 2UUBQ 4IUPA 4DV5L 2B2YA 4LF8Q 4XQNA 1GHKA 2ASBA 1IHZA 1HR0Q 1PH4A 5I2YA 2WAQB 4L63B 4DK3C 3GTPB 5CMDA 2CH4W 4X62Q 2BA0A 4LJZC 4RA8A 2Q8RE 4DA2A 2RDGA 5M3FB 5LHY1 1FJGL 4YY3L 1E24A 1I4HA 4OIJA 4JI3Q 4A3GH 2I5LX 3H3VC 2DGYA 4CJ0B 2VY3A 4A3KG 3TRZA 4XT3B 3CXCA 3AFPA 1IW7D 2B63G 1Y69U 3BS1A 2F3VA 3F8TA 2A5HA 3S1MB 5J39A 2B2UA 2HD3A 4TSSA 3D4RA 1Y1VG 4IUTA 4A3LG 2BOSA 1CKNA 3K6OA 3S24A 1SE4A 2F0MA 2YV5A 2D9UA 2LXKA 1QJOA 3G71A 1XX8A 1GOZA 1QVCA 2WACA 1RF2D 1TWHH 1FJGQ 1UAPA 4YY3Q 1U0LA 2K5WA 1UE7A 4KI0A 2UXCQ 1MSGA 3CQZH 4JI1Q 1LLRD 3CP0A 3HOXB 2L5TA 2I0QA 2HIVA 3WWVA 3PMFA 5C4ZA 3ICEA 4M1UB 4ZYSA 4NPSA 1WTHA 4OO1I 2AQ3B 4F7XA 1AE2A 3OYYA 1M1KC 2PW5A 4V190 1GUSA 1ENFA 2PQAB 1YNJC 1LO5D 1PRTF 5IWAL 4GN5A 3CCJA 4DAPA 1K0RA 1E1TA 3JC66 4HR7B 5C0XG 2EYFA 3F1ZA 5IYCH 3CU7A 1LTLA 3NP8A 1JOKA 2D0PA 4NP5A 4XQQA 3U4VA 5FLMH 1AZPA 1KLUD 4P73A 1J5EL 3KDFB 3I72A 4JI4L 1N36Q 3HOUG 3NQTA 4ME3A 2KHIA 4CJ1B 1TY2A 4BY1H 4BBSG 2VNUD 1PRTB 2MPMA 1QCBD 1JMCA 1DXMA 3OPOA 4F88A 3NXWA 4K2LA 3HOYH 2UUAL 1AP0A 5I9OA 2X69A 1CSQA 3MAQA 1XMQL 4A3CH 4DUYL 1SE8A 1D5ZC 2HDLA 3S17H 1PLFA 1X3QA 2WKCA 4LNQA 3P75A 3SR1A 1XWEA 3TQYA 1CHPD 3A5ZB 5I9PA 4C3HH 3CC2A 4Q0FA 2VUMH 4GLVB 3MEHA 3S2DH 3FPPA 4DU9A 5IP9H 3DEOA 2EYHA 1TQOA 3NUCA 2F0EA 2O4XA 1GD7A 5C3EB 3ERSX 2JA6B 3KJPA 1SYDA 3KLRA 3J81i 1EU3A 2NB0A 4YHHL 1HQRD 1XMQQ 2QDLA 3PO2H 4YCUA 4DUZL 2F0DA 4DUYQ 4A3BH 3NEMA 5E4XA 2L11A 1CM9A 4ZUIA 4JBMA 1Q8KA 3PV0A 1H95A 5LL6S 5T1IA 3I4MH 1JORA 3H3VH 4K5WA 4A3FB 4GKKL 3VR4A 3HFZB 4F8MA 3O13A 3T16A 1F2YA 4ULLA 4GNXA 4IPDA 4AYBG 1STNA 4IJLA 3H0GH 4OX9L 3VYRA 2ICIA 1BBUA 4J1MA 4DR5L 3L7ZC 1AW7A 1DONA 3P1HA 1X65A 1MKHA 4HCEA 3L2PA 3J80L 2CCZA 2EYLA 1HQMC 1VMPA 4YHHQ 1KL9A 3K0YA 5I6WA 1GVPA 1DM0B 4DNIA 3HOZB 4A3EH 4DR1L 3RMHA 3SEBA 5FJ8G 1G2TA 5H1SE 1V1OA 4O0AA 2O5JC 1QWYA 1PZKD 5ELBA 3CCUA 4G4KA 1B4OA 3DUZA 4C2MH 1SN8A 2CWAA 1PH2A 3E0JA 4X65L 2XRSD 3CPFA 2K75A 2ZTEA 1VQAA 1YNND 1MBYA 3VYUA 4OX9Q 3NTHA 3NELA 4BBRG 1TWCB 2F0TA 1I4RA 4GKJL 1PRTD 1ILQA 1K3RA 1BVSA 3A0JA 1STAA 3KLWA 4M8AA 3EQLC 1VQJA 4FYDA 1G91A 2L55A 3MXNB 5CBAE 4XQJA 3R2IA 5ELNA 5CC4A 2PI2E 1UEAB 1I6HB 1C4QA 1IBLL 4AQYQ 3AFQA 4A3KB 1VQDA 2LXJA 1I50B 2NBFA 2OXPA 1EFID 4QUFA 1HZAA 2GVBA 3CMEA 4JI0Q 2OWOA 2B63B 1UUPA 3CMAA 1DZ1A 1PYBA 2CKZB 3VR2A 1G2SA 2B29A 3URYA 4DKAC 3NENA 1Y1VB 3T53B 1VQKA 1I4PA 2EVBA 5FLXL 3M4PA 2IY5B 3IAYA 1TIID 1PH3A 2VQEQ 1IL2A 5IE8A 4KKSA 2G9HD 1KTKA 1SYFA 3A8IE 2NYZD 1V1PA 1JOQA 4DV6L 2ZXRA 4APVA 2MFIA 1PH8A 1IBLQ 4A3MH 2R7DA 3IKJA 1I3QB 2IL8A 5IYDH 1L1OC 2VL6A 2ENBA 3UE1A 4QUCA 5GAGC 3UDIA 4NXNQ 3PUYA 1BUVT 1N34L 3MVVA 4YCVA 1TS5A 3VYSA 1S72A 2I07B 3N6RA 4JI5Q 5GAHC 3QWNA 1HR0W 3H94A 4CHTB 1ESRA 4Z9CB 2F0NA 1EEFD 4B3TL 3SGIA 1J9OA 4LFBQ 1O7IA 3UE0A 1O80A 1SNMA 1PRTC 1OXXK 2DUDA 2R7ZH 5JPMC 3OWEB 1TWAH 4BXXG 3HKZG 4J8QA 4LFAL 2MHVA 3ND9A 3HOUB 2SOBA 5IT9c 1PTOF 4BBSB 4N8X1 2F4IA 3FKIG 1YJNA 1PH7A 4KTAA 1K0SA 3QO2A 2B8FA 2D5DA 1F9PA 3K5NA 1KDCA 1STGA 3MXUA 3NBHB 1MGSA 1F2LA 1YITA 1N34Q 3FRPB 4DR4L 5C4HA 3P20A 4IPGA 1IZ6A 2DJGC 1RL2A 1PTOB 4U673 1S5ED 2CWPA 4RFBA 1K9MC 3QOJA 2R61A 4B3TQ 1LYLA 3T51B 4DV7Q 4JBKA 1A8VA 4UAIA 4AYBE 1Q82C 5KGUA 3GTPH 2H5XA 3HG9A 2JYOA 1QILA 4JK1C 3U9OA 2K5DA 4CDCC 3J81L 1A3TA 1U4LA 1OXUA 2R6GA 4C1NK 5M3MH 1VQ4A 2F0IA 5ISRA 4AIMA 4IPHA 3SK6A 5I6YA 3J7YW 3GTQH 2E74C 2WINB 3Q8DA 4DK1A 3CC7A 4NXML 2B2WC 5D14A 2F0WA 4JYAL 1E0BA 1EYGA 4A3IG 1EQQA 5IYBG 4TVAB 2Y0SG 5ELEA 4X6AH 1U4RA 4MIUA 5C4JB 2XGTA 4EVOA 4JI7L 4AYBB 3FHWA 4ZK9B 2L12A 1NY4A 3EROA 2F0UA 2VXWA 1VQCA 3EJIA 4RCOA 3K81C 2DNCA 1Y1WG 2YTVA 2JQOA 2LY7A 1E7ZA 3E9IA 2VS1A 3NWTA 5ELDA 2SNMA 3F2DA 1VF7A 5IODA 1ONLA 1QZHA 2UXBL 3OWFA 1KXLA 1C48A 2L9HA 1FR3A 1N33Q 2R92G 1IYVA 5D3IB 2Z6BA 2AKWB 3Q24A 2ZT9C 1SYBA 1EWIA 4JI7Q 4DR7L 1EYDA 2J7ZA 2V4DA 4K8IA 1RHPA 4R4IA 4X66L 5M5WH 1KAAA 1HFGA 4C3IH 4BBRB 1W2BA 5C6AA 3U4ZA 1HFNA 3R8BA 2H4OA 1B53A 3HOXG 3GTMB 3S14B 1STHA 1I4XA 5EPLA 3M3YB 4RGOS 4H44C 5EAYA 3A56A 4A93H 1JOOA 4NKLA 3E9HA 4ALPA 2E2HB 2I5MX 1PTOD 4XIGS 1A2UA 2JSOA 1VQFA 3I73A 4WFN3 2MO1A 1VQ9A 2UU9Q 1II3A 3W3AA 1VQEA 3KUPA 3VA7A 2RSNA 1D1IA 4DV3L 1LTAD 1EEID 2K32A 4LWCA 4YWMA 3KK7A 2CQAA 5NUCA 3I4NH 1SJHD 1S40A 1GKHA 5AJ3L 2C35B 1JJ2A 3G7LA 4R8NA 5C5MA 1ZYRD 2EXDA 1E22A 5EQ0A 2GVAA 4ZUJA 2A74C 4OONA 1LV9A 1GO3E 3HKZE 3J7AF 4IUQA 4JV5Q 4Y7NH 3OTOL 3I4OA 3TREA 2JA8H 2VQFL 1H9KA 4KV6A 2F4VQ 3W5OA 5IIFA 2DY8A 4B9WA 4KY6A 5I4DA 2B2VA 4RKBA 4B3SL 2BE5D 1EQRA 3I4LA 3PGZA 4DV0L 3ND8A 1XNRL 1DGSA 2RCNA 1U9RA 2VW9A 3T1YQ 1F2ZA 1WCMH 2JK8A 3KF8A 4HIMA 4QIWE 1K8OA 1O7LA 2TSSA 2OTLA 1Y8OB 2F52A 2ZTCA 5C3EG 4DV1L 1RTNA 3RZOB 1SBBB 2WP8J 1KC8C 2L15A 3LWEA 2A6HD 3HKZB 1FD7D 2EZVA 5C4XH 5C44H 1HCZA 1HUNA 1B2TA 2K5NA 3FKIB 2VQFQ 2K4KA 4IFDH 1KRTA 4I7AA 1QUQA 3C1FA 4Q5VA 1YEZA 2IWHA 3JAMi 2NVXH 4KJOA 4PNYA 4B3SQ 2IPKD 1HNWL 4OO1G 1CT1D 1YI2A 4HEDA 4QF4A 1XNRQ 2UUBL 2BA1A 3GD7A 1H9MA 2Y0SE 4LF8L 4FNFA 3AYHB 1B50A 3MC0B 3HOWG 2AUKA 3S16H 1TS4A 1NTGA 1B44D 1SNPA 4JI6L 2FINB 5M5XH 1VQ5A 4UP7A 3TZDA 4X62L 4BY7G 4DV1Q 1CA5A 1PVOA 2EPBA 1NMGA 1C9OA 1ZKOA 3RLOA 3J81E 5J1ZA 2CFMA 4XYOA 1BQQT 1DOKA 1EY0A 1JB3A 2MP1A 4JBWA 4RG1A 4XDXA 2H1EA 1S4ZA 2JA7B 3ITPA 3M7GA 1IXRA 2OT2A 2NUCA 4A3IB 2EYOA 1WYDA 3NWSA 4JOIC 4NB3A 3GTKB 1STBA 2Y0SB 2Q2TA 2JA5G 1GXDC 3PSIA 2Q8TA 4DAYA 3C46A 1XTCD 2QILA 4KHZA 1TWFH 1VQHA 1WTXA 2FXQA 2DJFC 4LK1C 4JI6Q 2M9VA 3DM1A 3J80c 4JC0A 2XVSA 1UNSA 1SFOH 4A3LH 4QMGA 1IBKQ 1Q81C 3ERQA 4KY7A 1XJVA 3ULLA 2F1MA 3PIP3 3M4OB 1RODA 5CV6A 3P7JA 4HIOA 2E5LQ 5IGGA 1NMFA 1JE5A 4FXKC 2UXCL 1Y1WB 2F0VA 4OGQC 4IO9A 2A69D 4JI1L 4LUVA 4B3RQ 1TXYA 2EY2A 5JJIA 2XRQD 1A3VA 5HURA 1C8CA 4POGA 1I4QA 2XIWA 1E3PA 4MHEA 4CKCA 3KF6A 4NMZA 1NE3A 1SYCA 3T4AC 2R92B 2AQ2B 3IFTA 2NVQH 1VS0A 3NTIA 3C2PA 3EN2A 4KY5A 5JOBA 1RKNA 1GHJA 2CH4A 1X54A 3BVMA 1VQPA 3G4SA 3EIVA 4KMUC 3Q6SA 4IQZA 4PZ8A 1JC7A 1DOMA 2ID0A 2D62A 2JA9A 2AQ1B 2B39A 4C1NI 1R4PB 2IW3A 1A0IA 5JVH3 3PF4A 1PMRA 5C0XH 4KN7C 2XSCA 3GO5A 3PQIA 3TP5A 1K73C 4CDEC 2ES2A 3U9SA 4QJFA 1N36L 1YHBA 2R93H 1Z9FA 1IKMA 1PV4A 1WTVA 3BYYB 5FO9B 4OXPA 1DD2A 1YIJA 2PW7A 3A74A 4GLAC 3KOJA 2HT1A 4HJAA 1HA5A 1TWGH 1VQ6A 5FLXc 3S1NB 3LWUA 1W6KA 2HUGA 4A3GG 1GUWA 3PIPA 5GADC 2K7VA 2MGSA 2F0QA 2A73B 3BYTB 2FJ2A 2M00A 1Q1EA 1K8GA 4FDBA 3W1GA 3X3MA 1SMXA 2OCEA 2Z9HA 2VB2X 1RCVD 2E2IB 3I70A 5HGQA 2QKIC 1UWVA 3D6WA 3I90A 5EPJA 2Q8IB 1HUMA 2K28A 3FP9A 3TBIB 3C3LA 5IGFA 4K6DA 1D1KA 1PH9A 2PO4A 1BBWA 1J8IA 1K3BC 4YWKA 3GTLB 2A68D 1T5XD 5J22A 1HNXQ 3S15B 1CKOA 3WDNA 4IFDI 4UP8A 1A62A 5M5YB 1X32A 4JCVE 1MI2A 5GROA 2PYKA 1IW7C 2QEJC 3C1EA 1BO0A 1SNOA 1RDPD 1S5FD 1VQIA 1QB5D 3OHXC 5FOBB 4A75A 2QCPX 1ILPA 1WJJA 1B8AA 2OF1A 3S1RB 3LNNA 3K7AH 1XMOQ 4K5XA 3RNUA 3FDTA 1K83B 4H7BA 5AFWA 3Q22A 1SRUA 1A63A 1PYSB 1NBWA 1SXTA 4P72A 4R4CA 4QCLA 4TRDA 1SE3A 2PNRC 5IYCG 3TN2A 1TKWB 2K03A 2Z6KC 5FLMG 3DWQA 2J0TD 5LMUL 1EYCA 2B8GA 2EYJA 5FJ8H 1AE3A 5C5LA 4EQNA 3D0FA 2EYPA 3GTGB 2AWOA 2KUMA 2NN6I 3HOYG 5K5PA 1LTTD 4HSPA 1I4GA 1V1PB 2WB1G 4A3CG 4OIKA 4PZ7A 3MFGA 1YVCA 1WFQA 1TY0A 3HOWB 1LUZA 2NVYB 2V1CC 4BY7B 1PXUA 1ZXTA 4HJ8A 3PO3H 3SK4A 4C3HG 2AUJD 3CKIB 1E2ZA 1TVXA 3NSWA 4WJ4A 5EGTA 1CFMA 3LX0A 4ABNA 1NR4A 5IP9G 4OWWB 4XYQA 3M3YH 2PMZB 5GAEC 3E0EA 5LMUQ 2PZWA 1TS3A 4AQYL 2ZJQA 3GTOH 4OL7A 4KHPL 3VR6A 4MTNA 1FNWA 4DXGA 3S2HB 5KIXA 1L1OA 4DN4M 4OWXB 4JI0L 2BDOA 2PQAA 2JP1A 3QJYA 1NNXA 2EJFC 3PO2G 2JA5B 1EWHA 2ALYB 4IUVA 1XNQQ 2PQEA 1HJPA 4LUZA 2LKVA 1MJEA 2YTYA 3R93A 3NK9A 5E1FA 1CI3M 3I4MG 1X3PA 1FGBD 5M9OA 5FKAC 2VQEL 2B2TC 3KDFA 1NAPA 1QE6A 3TP8A 3BDCA 2SEBD 3UDFA 3PUZA 4KLKA 1AH9A 1ESFA 3VDYA 4LF9Q 3TP6A 1K8AC 2IT1A 2EQSA 4DK6C 4KHPQ 3A55A 2YU9H 1DYQA 3E3XA 1PFSA 1EOTA 4NXNL 1M8AA 3DWAA 3SXHA 1IL8A 5BN5A 4DR2Q 4EQPA 3CCMA 1P8LA 4A3EG 5EBCA 4QGUA 4JI5L 2NVTB 2DN8A 3KYHC 1ET9A 3NTKA 4LFBL 2KCNA 2K5VA 4A3JG 3BDOA 2A19A 1BF4A 1YNXA 3L3OC 1NSNS 3V96A 5GQOA 1B9MA 4BXXH 1R4QB 1D6EC 4YCWA 5I2XA 3UDXA 1VQOA 1TR5A 1XTDA 4A76A 1YJ9A 2B2WA 4O1NA 2ICEC 3AU7A 4PG3A 2VB3X 1H9SA 1YBYA 4A3GB 2LMCB 1UE1A 3G6JB 4RGTA 3H6MA 5A35A 2F0LA 1O7ZA 4V0BA 4DV2L 3MWYW 1A15A 3T1HL 1YNNC 2C5CA 4L8JA 2RHSB 2F0GA 4L5SA
chains in the Genus database with same CATH topology
2IHEA 4X64L 4ALPA 4TQUS 1HR0Q 2AMCB 1PH4A 1EIFA 1MIUA 2I5MX 4XIGS 2VZAA 3KFUA 4DK3C 1VQFA 4WJ3M 1JJGA 1B7YB 3J81c 2UUAQ 4P71A 4X62Q 2MO1A 2YYZA 1VQ9A 2UU9Q 1XNQL 3STBD 2R7FA 4YWLA 2N49A 1VQEA 2BA0A 4HJ9A 3GTJH 1CKMA 2KCMA 3BZKA 4BBRH 2JEAI 1FJGL 3BJUA 1KAWA 4YY3L 1E24A 4DV3L 4JI3Q 4A3GH 2I5LX 2VUMG 1Z47A 2DGYA 5IY0A 3RLFA 4C3JH 2VY3A 4UP9A 4A3KG 4LWCA 4GLXA 4A3MG 3TRZA 4YWMA 3GTMH 3I55A 3CXCA 3S14H 3I4NH 3IRBA 1S40A 3S1QH 4P75A 1GKHA 3AFPA 2C35B 1IYJB 5IYDG 5AJ3L 4DV2Q 4GOPB 1JJ2A 4LF9L 3T1HQ 2B63G 2EXDA 3B6YA 1E22A 3F8TA 2GVAA 2E2HH 3CAMA 4OONA 2AWNA 2WB1E 1B70B 4R4QA 4X64Q 1GO3E 3HKZE 1X55A 4JV5Q 1Y1VG 4A3LG 4Y7NH 1IBMQ 1CKNA 3I4OA 3S24A 3TREA 3OTOL 2VQFL 2JA8H 2YV5A 3BU2A 4A3BG 4DR2L 2A1AA 2F4VQ 2LXKA 3CPWA 3W5OA 4DUZQ 1HH2P 3G71A 2HIXA 1N8RC 5M3FH 4IOAA 1QVCA 4B3SL 1EQRA 1TWHH 3PGZA 1FJGQ 4YY3Q 2OQ0A 4DV0L 2RHQB 1U0LA 1XNRL 1DGSA 2JA7G 1UE7A 4KI0A 2RCNA 2UXCQ 3K80C 3CQZH 4JI1Q 4GKKQ 3CP0A 2VW9A 2KBNA 2JJQA 1WCMH 3T1YQ 2JK8A 5C0XI 4HIMA 2I0QA 2HIVA 4QIWE 3WWVA 1N33L 3H0GG 3ICEA 2OTLA 1PH6A 4QY7A 4NPSA 4A3JH 3TS2A 2F52A 4R1JA 2ZTCA 4A4IA 5C3EG 2QEXA 4DV1L 1C7YA 3S1MH 1Q7YC 4OO1I 1I94L 1AE2A 2WP8J 1EFWA 5JJKA 1GM5A 1X9NA 2JE6I 1KC8C 2L15A 1G6PA 3PO3G 3OYYA 1VCIA 1M1KC 4DR5Q 1MJCA 2RF4A 5C4XH 5C44H 1XPRA 4O2DA 2K5NA 2VQFQ 2PQAB 3CCJA 1EIYB 2K4KA 5IWAL 4GN5A 1KRTA 3CCLA 1QUQA 1K0RA 1E1TA 3JC66 4HIDA 5LMNL 1YEZA 3JAMi 5C0XG 3F1ZA 2PI2A 2PNHA 5IYCH 3KJOA 2NVXH 1LTLA 2I5HA 4DR1Q 4B3SQ 3CCQA 1HNWL 2D0PA 1W3SA 3CF5A 4OO1G 3U4VA 1YI2A 5FLMH 1XNRQ 1QZGA 4JG2A 3PIOA 2UUBL 4P73A 2BA1A 3GD7A 2Y0SE 3HOXH 3KDFB 1J5EL 1G291 4JI4L 1N36Q 4LF8L 3AYHB 3HOUG 4ME3A 2KHIA 1J6QA 4BY1H 3HOWG 3S16H 4BBSG 1NTGA 1XPUA 2VNUD 4JI6L 5M5XH 5M3MG 3KF8B 4X65Q 4GNXC 1JMCA 4LF5L 1VQ5A 3HOYH 3RZOH 4UP7A 2UUAL 4X62L 1JB7A 4BY7G 4HJ5A 1CSQA 4DV1Q 2KENA 4IPCA 1XMQL 2UU9L 4A3CH 1I94Q 1HZ9A 1L0WA 4DUYL 1V43A 1SE8A 1PVOA 1NMGA 1C9OA 4GKJQ 3RLOA 3M7NA 2N78A 3S17H 4LNQA 1UEBA 3FKIH 2CFMA 5IP7G 5ELOA 3TQYA 4JBWA 4RG1A 3A5UA 3A5ZB 2CQOA 1QUQB 4L5QA 4C3HH 5BR8L 5LMNQ 3CC2A 2VUMH 4GLVB 3S2DH 1X3GA 1IXRA 1WYDA 4JOIC 4NB3A 1EUJA 5IP9H 2Q2TA 2JA5G 3PSIA 2UXDQ 4QL5A 1E1OA 1GD7A 2Z0SA 4GS3A 4KHZA 3HOVG 1TWFH 3ERSX 1VQHA 2N3SA 2BH8A 4JV5L 2Q2UA 2FXQA 3KJPA 4JI6Q 1IBML 4LF5Q 3EBEA 3J80c 3J81i 4JC0A 4JBJA 4IFDJ 1SFOH 4YHHL 1VQGA 1XMQQ 2F4VL 4A3LH 2K50A 3PO2H 4YCUA 4DUZL 1IBKQ 3L0OA 4DUYQ 4A3BH 3NEMA 1SLJA 1Q81C 2OTJA 3CCRA 1XJVA 3ULLA 3I56A 1KIXA 4HIOA 2E5LQ 1NMFA 1Q12A 4JBMA 1Q8KA 1P16A 1OXTA 3PV0A 1JE5A 1H95A 3I4MH 2UXCL 3H3VH 3CW2C 4IO9A 5JEAJ 4JI1L 4GKKL 1LM0A 4LUVA 3T1YL 2JA7H 5BR8Q 1TXYA 4J15A 4B3RQ 3HFZB 5JJIA 4DV6Q 3K8AA 3RN5A 4GNXA 2QGQA 1D7QA 4POGA 4A3IH 1E3PA 4IPDA 4AYBG 1CSPA 4OWTB 3GTKH 5IYBH 3KF6A 4IJLA 3H0GH 1NE3A 4OX9L 1BBUA 2NVQH 1VS0A 5C3EH 1SR3A 2JA6H 1KRSA 3EN2A 4DAYB 4DR5L 3L7ZC 2MNAA 1QVGA 1SROA 3BZCA 2D0OA 1U5KA 1X65A 1MKHA 3L2PA 1X54A 2CCZA 2EIFA 1VQPA 4AH6A 3G4SA 4YHHQ 1KL9A 3EIVA 4PZ8A 1GVPA 2YTXA 4DNIA 3F2BA 3M4OH 2JA9A 2ID0A 2D62A 1OTCA 4R4TA 4A3EH 1A0IA 4XTCS 4DR1L 1VQLA 5FJ8G 3PF4A 5H1SE 4MZ9A 4O0AA 4A93G 4JOIA 3GO5A 1K73C 1Y1WH 2ES2A 4A3FH 3CCUA 4K0KQ 4QJFA 4DV4L 1N36L 2R7ZG 1YHBA 3AQQA 2R93H 1Z9FA 2E2JH 4C2MH 2MO0A 1SN8A 2CWAA 4RMFA 1PV4A 4PMWA 1PH2A 3U58A 4X65L 1KQSA 4OXPA 3CPFA 2F3IA 2K75A 2ZTEA 3M9BA 4LF4Q 4LFAQ 1VQAA 1YIJA 3I7FA 2R92H 1EOVA 3CCVA 4DAMA 3A74A 4OX9Q 3ER0A 3NELA 4GLAC 3KOJA 4BBRG 4HJAA 2HT1A 3ZJYC 2IHFA 4GKJL 1TWGH 1K3RA 1VQ6A 5FLXc 1BVSA 1VQ8A 1KHIA 3A0JA 4UY8C 4A3GG 2ZM6L 3PIPA 5GADC 3KLWA 3PUWA 1X56A 1CKNB 2JEBI 1VQJA 2E8GA 1PH5A 1X3EA 5IP7H 3HOZH 4DR4Q 1KD1C 3MXNB 3I4NG 5JJLA 5ELNA 1Q1EA 1K8GA 1PA6A 3AEVA 4QQBX 4FDBA 1JJCB 3W1GA 1SMXA 2OCEA 4GOPC 2PI2E 2Q2HA 1IBLL 1XPOA 3D31A 4AQYQ 4P74A 3AFQA 2UUCQ 2WAQG 3RLNA 3STBC 1VQDA 5HGQA 2LXJA 3RR5A 2UXDL 1OXSC 1UWVA 2KCTA 4DV4Q 4A3DG 3FP9A 2JA8G 1HZAA 2GVBA 4JI8L 3CMEA 4JI0Q 4H02A 2OWOA 1VQ7A 1L2FA 3HOVH 3CMAA 1PYBA 2CKZB 2IX0A 5DLQE 1PH9A 1TWCH 5M3FG 1ASYA 1JT8A 2B29A 4DKAC 1BBWA 3CC4A 3NENA 1IBKL 1FL0A 3S1NH 4YWKA 1VQKA 3J7ZC 4POFA 4EQ5A 1HNXQ 1CKOA 3M4PA 4UP8A 1A62A 2E5LL 2ATWA 4IFDI 4JCVE 5C0XJ 2IY5B 1PH3A 2XTIA 2VQEQ 2ZM6Q 5GROA 4NXMQ 1IL2A 1WCMG 5IE8A 4JYAQ 3LGJA 4B3RL 1VQIA 2LSSA 2ZTDA 4DV6L 1I6HH 4A75A 1HZBA 3M4QA 4APVA 2E2IH 1BKBA 1B8AA 1WJJA 2K5HA 2MFIA 4A3KH 1PH8A 1IBLQ 3K7AH 2R7DA 1I50H 4A3MH 1XMOQ 4LW1A 1N9WA 3RNUA 2BH2A 5C4XG 3GDEA 5IYDH 1L1OC 2VL6A 1QVFA 3W1BA 1SRUA 2B63H 4JI8Q 1Q1BA 4IFDG 1A63A 3UE1A 1PYSB 1NBWA 1S3OA 1YHAA 4GN3B 4P72A 4R4CA 3UDIA 5GAGC 4LF7L 4NXNQ 3PUYA 5LMNW 4JI2L 3J80i 4HIKA 1N34L 5IYCG 3RN2A 1Y1VH 2N8NA 4YCVA 3GTLH 3S15H 1S72A 3M85A 5HY6A 4JI5Q 1N32Q 2Z6KC 1YHQA 5M5YH 5GAHC 5FLMG 4DR3Q 4GOPA 2K52A 5LMUL 5JEAG 1RIPA 1HR0W 5FJ8H 1AE3A 4B3TL 4LF6Q 3D0FA 3SGIA 4K0KL 4LFBQ 2UXBQ 1O7IA 2AWOA 2NN6I 3UE0A 3ULPA 3HOYG 1OXXK 3S1RH 2DUDA 4B3ML 2R7ZH 2WB1G 4A3CG 1TWAH 1Q46A 4LF4L 4PZ7A 3HKZG 4LFAL 4BXXG 3CCEA 1YVCA 3OW2A 1I3QH 1K83H 1FGUA 1WFQA 5IT9c 5J3BA 1LUZA 4HJ7A 1X3FA 3PUXA 2V1CC 3FKIG 1YJNA 4DR7Q 1PH7A 1X6OA 4X66Q 4LFCL 4HJ8A 3PO3H 4LF7Q 4JI2Q 3NBHB 4DV7L 3H3VI 1YITA 1N34Q 2NN6G 3F2CA 4DPGA 4DR4L 4IOCA 2OQKA 4WJ4A 1VQNA 4IPGA 1IZ6A 2ZJRA 2KHJA 4OWWB 5IP9G 1RL2A 3M3YH 2CWPA 1D8LA 3E0EA 3K7UC 5GAEC 3K0XA 5LMUQ 4AQYL 2UUCL 2ZJQA 1K9MC 3GTOH 3GTGH 4DV5Q 4B3TQ 1LYLA 4KHPL 4MTNA 4DV7Q 4JBKA 1A8VA 1L1OA 3J81j 4AYBE 4IJHA 1Q82C 4OWXB 2H5XA 4JI0L 3GTPH 2PQAA 4B3MQ 3HOUH 4A3DH 3PO2G 2A8VA 3HOWH 4GNXB 4BBSH 2ALYB 1OXUA 2NVYH 2B3GA 2R6GA 5M3MH 2ZJPA 1XNQQ 1HJPA 2IX1A 1VQ4A 3KF6B 3H15A 3DM3A 4AIMA 4LUZA 4IPHA 2Z6KA 2QA4A 3GTQH 4BY7H 1MJEA 2YTYA 1HNXL 3I4MG 1I5FA 3Q8DA 4LFCQ 2HHHL 2VQEL 4DR6L 3CC7A 3KDFA 4PZ6A 1OXVA 4NXML 1UE5A 3ULJA 3G6EA 4DV3Q 3UDGA 4JYAL 1UE6A 3HKSA 1CUKA 4L5TA 5E7NA 4A3IG 3RZDH 1EYGA 1EQQA 5IYBG 1FVIA 3PUZA 3UDFA 4TVAB 2Y0SG 1G51A 2MQHA 1HZCA 4KLKA 5K36G 1AH9A 4X6AH 1HNZL 5AJ3Q 3VDYA 4LF9Q 2JA6G 1XMOL 1K8AC 3S2HH 2IT1A 1M90C 2EQSA 1PHJA 2XGTA 4DK6C 2NZHA 1VQMA 4JI7L 4KHPQ 1C0AA 2K14A 3DLLA 3FHWA 3TS0A 1ASZA 2YU9H 1L1OB 1PFSA 2JA5H 4GN4B 4NXNL 1NY4A 1V1QA 3OTOQ 1R9TH 4DR2Q 3J7A5 4L5RC 3CCMA 1P8LA 4A3EG 1WI5A 1WOCA 1VQCA 4BA2I 4QGUA 3K81C 3U50C 3JAMc 4JI5L 1N32L 1Y1WG 4DR3L 2YTVA 4A3FG 2JQOA 4BA1I 1E7ZA 4UPAA 3KYHC 3E9IA 2R93G 2VS1A 4DV0Q 2HHHQ 1V9PA 4DR6Q 3F2DA 1VQBA 4LF6L 4LFBL 1QZHA 2UXBL 3TEHB 1KXLA 4EX5A 1HR0L 2K5VA 2Q2IA 4A3JG 1N33Q 2R92G 2A19A 2WAQE 1YNXA 2HQLA 5C4JH 2AKWB 1HNZQ 3PCOB 5GQOA 1Q86C 2ASBA 1EWIA 4BXXH 3PUVA 1PH1A 4JI7Q 5C44G 3CD6A 4DR7L 4YCWA 2AHOB 2GN5A 4R4IA 3UDXA 4X66L 5M5WH 3PF5A 1Y14B 4LUOA 1VQOA 1XTDA 4A76A 4C3IH 1YJ9A 3G48A 3CCSA 3HOZG 1W2BA 4PG3A 5IWAQ 4JI3L 3I2ZA 4MNOA 1NJIC 1YBYA 3U4ZA 1T9HA 2NZOA 2NVTH 1UE1A 2WFWA 4R4OA 3HOXG 1HNWQ 4DV2L 2PMZE 1YJWA 4Y52H 3T1HL 1YZ6A 4BY1G 2UUBQ 4DV5L 3MEFA 5EAYA 1J5EQ 2RHSB 4LF8Q 4A93H 4JI4Q 3E9HA 4L5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHE A;  4X64 L;  4ALP A;  4TQU S;  1HR0 Q;  2AMC B;  1PH4 A;  1EIF A;  1MIU A;  2I5M X;  4XIG S;  2VZA A;  3KFU A;  4DK3 C;  1VQF A;  4WJ3 M;  1JJG A;  1B7Y B;  3J81 c;  2UUA Q;  4P71 A;  4X62 Q;  2MO1 A;  2YYZ A;  1VQ9 A;  2UU9 Q;  1XNQ L;  3STB D;  2R7F A;  4YWL A;  2N49 A;  1VQE A;  2BA0 A;  4HJ9 A;  3GTJ H;  1CKM A;  2KCM A;  3BZK A;  4BBR H;  2JEA I;  1FJG L;  3BJU A;  1KAW A;  4YY3 L;  1E24 A;  4DV3 L;  4JI3 Q;  4A3G H;  2I5L X;  2VUM G;  1Z47 A;  2DGY A;  5IY0 A;  3RLF A;  4C3J H;  2VY3 A;  4UP9 A;  4A3K G;  4LWC A;  4GLX A;  4A3M G;  3TRZ A;  4YWM A;  3GTM H;  3I55 A;  3CXC A;  3S14 H;  3I4N H;  3IRB A;  1S40 A;  3S1Q H;  4P75 A;  1GKH A;  3AFP A;  2C35 B;  1IYJ B;  5IYD G;  5AJ3 L;  4DV2 Q;  4GOP B;  1JJ2 A;  4LF9 L;  3T1H Q;  2B63 G;  2EXD A;  3B6Y A;  1E22 A;  3F8T A;  2GVA A;  2E2H H;  3CAM A;  4OON A;  2AWN A;  2WB1 E;  1B70 B;  4R4Q A;  4X64 Q;  1GO3 E;  3HKZ E;  1X55 A;  4JV5 Q;  1Y1V G;  4A3L G;  4Y7N H;  1IBM Q;  1CKN A;  3I4O A;  3S24 A;  3TRE A;  3OTO L;  2VQF L;  2JA8 H;  2YV5 A;  3BU2 A;  4A3B G;  4DR2 L;  2A1A A;  2F4V Q;  2LXK A;  3CPW A;  3W5O A;  4DUZ Q;  1HH2 P;  3G71 A;  2HIX A;  1N8R C;  5M3F H;  4IOA A;  1QVC A;  4B3S L;  1EQR A;  1TWH H;  3PGZ A;  1FJG Q;  4YY3 Q;  2OQ0 A;  4DV0 L;  2RHQ B;  1U0L A;  1XNR L;  1DGS A;  2JA7 G;  1UE7 A;  4KI0 A;  2RCN A;  2UXC Q;  3K80 C;  3CQZ H;  4JI1 Q;  4GKK Q;  3CP0 A;  2VW9 A;  2KBN A;  2JJQ A;  1WCM H;  3T1Y Q;  2JK8 A;  5C0X I;  4HIM A;  2I0Q A;  2HIV A;  4QIW E;  3WWV A;  1N33 L;  3H0G G;  3ICE A;  2OTL A;  1PH6 A;  4QY7 A;  4NPS A;  4A3J H;  3TS2 A;  2F52 A;  4R1J A;  2ZTC A;  4A4I A;  5C3E G;  2QEX A;  4DV1 L;  1C7Y A;  3S1M H;  1Q7Y C;  4OO1 I;  1I94 L;  1AE2 A;  2WP8 J;  1EFW A;  5JJK A;  1GM5 A;  1X9N A;  2JE6 I;  1KC8 C;  2L15 A;  1G6P A;  3PO3 G;  3OYY A;  1VCI A;  1M1K C;  4DR5 Q;  1MJC A;  2RF4 A;  5C4X H;  5C44 H;  1XPR A;  4O2D A;  2K5N A;  2VQF Q;  2PQA B;  3CCJ A;  1EIY B;  2K4K A;  5IWA L;  4GN5 A;  1KRT A;  3CCL A;  1QUQ A;  1K0R A;  1E1T A;  3JC6 6;  4HID A;  5LMN L;  1YEZ A;  3JAM i;  5C0X G;  3F1Z A;  2PI2 A;  2PNH A;  5IYC H;  3KJO A;  2NVX H;  1LTL A;  2I5H A;  4DR1 Q;  4B3S Q;  3CCQ A;  1HNW L;  2D0P A;  1W3S A;  3CF5 A;  4OO1 G;  3U4V A;  1YI2 A;  5FLM H;  1XNR Q;  1QZG A;  4JG2 A;  3PIO A;  2UUB L;  4P73 A;  2BA1 A;  3GD7 A;  2Y0S E;  3HOX H;  3KDF B;  1J5E L;  1G29 1;  4JI4 L;  1N36 Q;  4LF8 L;  3AYH B;  3HOU G;  4ME3 A;  2KHI A;  1J6Q A;  4BY1 H;  3HOW G;  3S16 H;  4BBS G;  1NTG A;  1XPU A;  2VNU D;  4JI6 L;  5M5X H;  5M3M G;  3KF8 B;  4X65 Q;  4GNX C;  1JMC A;  4LF5 L;  1VQ5 A;  3HOY H;  3RZO H;  4UP7 A;  2UUA L;  4X62 L;  1JB7 A;  4BY7 G;  4HJ5 A;  1CSQ A;  4DV1 Q;  2KEN A;  4IPC A;  1XMQ L;  2UU9 L;  4A3C H;  1I94 Q;  1HZ9 A;  1L0W A;  4DUY L;  1V43 A;  1SE8 A;  1PVO A;  1NMG A;  1C9O A;  4GKJ Q;  3RLO A;  3M7N A;  2N78 A;  3S17 H;  4LNQ A;  1UEB A;  3FKI H;  2CFM A;  5IP7 G;  5ELO A;  3TQY A;  4JBW A;  4RG1 A;  3A5U A;  3A5Z B;  2CQO A;  1QUQ B;  4L5Q A;  4C3H H;  5BR8 L;  5LMN Q;  3CC2 A;  2VUM H;  4GLV B;  3S2D H;  1X3G A;  1IXR A;  1WYD A;  4JOI C;  4NB3 A;  1EUJ A;  5IP9 H;  2Q2T A;  2JA5 G;  3PSI A;  2UXD Q;  4QL5 A;  1E1O A;  1GD7 A;  2Z0S A;  4GS3 A;  4KHZ A;  3HOV G;  1TWF H;  3ERS X;  1VQH A;  2N3S A;  2BH8 A;  4JV5 L;  2Q2U A;  2FXQ A;  3KJP A;  4JI6 Q;  1IBM L;  4LF5 Q;  3EBE A;  3J80 c;  3J81 i;  4JC0 A;  4JBJ A;  4IFD J;  1SFO H;  4YHH L;  1VQG A;  1XMQ Q;  2F4V L;  4A3L H;  2K50 A;  3PO2 H;  4YCU A;  4DUZ L;  1IBK Q;  3L0O A;  4DUY Q;  4A3B H;  3NEM A;  1SLJ A;  1Q81 C;  2OTJ A;  3CCR A;  1XJV A;  3ULL A;  3I56 A;  1KIX A;  4HIO A;  2E5L Q;  1NMF A;  1Q12 A;  4JBM A;  1Q8K A;  1P16 A;  1OXT A;  3PV0 A;  1JE5 A;  1H95 A;  3I4M H;  2UXC L;  3H3V H;  3CW2 C;  4IO9 A;  5JEA J;  4JI1 L;  4GKK L;  1LM0 A;  4LUV A;  3T1Y L;  2JA7 H;  5BR8 Q;  1TXY A;  4J15 A;  4B3R Q;  3HFZ B;  5JJI A;  4DV6 Q;  3K8A A;  3RN5 A;  4GNX A;  2QGQ A;  1D7Q A;  4POG A;  4A3I H;  1E3P A;  4IPD A;  4AYB G;  1CSP A;  4OWT B;  3GTK H;  5IYB H;  3KF6 A;  4IJL A;  3H0G H;  1NE3 A;  4OX9 L;  1BBU A;  2NVQ H;  1VS0 A;  5C3E H;  1SR3 A;  2JA6 H;  1KRS A;  3EN2 A;  4DAY B;  4DR5 L;  3L7Z C;  2MNA A;  1QVG A;  1SRO A;  3BZC A;  2D0O A;  1U5K A;  1X65 A;  1MKH A;  3L2P A;  1X54 A;  2CCZ A;  2EIF A;  1VQP A;  4AH6 A;  3G4S A;  4YHH Q;  1KL9 A;  3EIV A;  4PZ8 A;  1GVP A;  2YTX A;  4DNI A;  3F2B A;  3M4O H;  2JA9 A;  2ID0 A;  2D62 A;  1OTC A;  4R4T A;  4A3E H;  1A0I A;  4XTC S;  4DR1 L;  1VQL A;  5FJ8 G;  3PF4 A;  5H1S E;  4MZ9 A;  4O0A A;  4A93 G;  4JOI A;  3GO5 A;  1K73 C;  1Y1W H;  2ES2 A;  4A3F H;  3CCU A;  4K0K Q;  4QJF A;  4DV4 L;  1N36 L;  2R7Z G;  1YHB A;  3AQQ A;  2R93 H;  1Z9F A;  2E2J H;  4C2M H;  2MO0 A;  1SN8 A;  2CWA A;  4RMF A;  1PV4 A;  4PMW A;  1PH2 A;  3U58 A;  4X65 L;  1KQS A;  4OXP A;  3CPF A;  2F3I A;  2K75 A;  2ZTE A;  3M9B A;  4LF4 Q;  4LFA Q;  1VQA A;  1YIJ A;  3I7F A;  2R92 H;  1EOV A;  3CCV A;  4DAM A;  3A74 A;  4OX9 Q;  3ER0 A;  3NEL A;  4GLA C;  3KOJ A;  4BBR G;  4HJA A;  2HT1 A;  3ZJY C;  2IHF A;  4GKJ L;  1TWG H;  1K3R A;  1VQ6 A;  5FLX c;  1BVS A;  1VQ8 A;  1KHI A;  3A0J A;  4UY8 C;  4A3G G;  2ZM6 L;  3PIP A;  5GAD C;  3KLW A;  3PUW A;  1X56 A;  1CKN B;  2JEB I;  1VQJ A;  2E8G A;  1PH5 A;  1X3E A;  5IP7 H;  3HOZ H;  4DR4 Q;  1KD1 C;  3MXN B;  3I4N G;  5JJL A;  5ELN A;  1Q1E A;  1K8G A;  1PA6 A;  3AEV A;  4QQB X;  4FDB A;  1JJC B;  3W1G A;  1SMX A;  2OCE A;  4GOP C;  2PI2 E;  2Q2H A;  1IBL L;  1XPO A;  3D31 A;  4AQY Q;  4P74 A;  3AFQ A;  2UUC Q;  2WAQ G;  3RLN A;  3STB C;  1VQD A;  5HGQ A;  2LXJ A;  3RR5 A;  2UXD L;  1OXS C;  1UWV A;  2KCT A;  4DV4 Q;  4A3D G;  3FP9 A;  2JA8 G;  1HZA A;  2GVB A;  4JI8 L;  3CME A;  4JI0 Q;  4H02 A;  2OWO A;  1VQ7 A;  1L2F A;  3HOV H;  3CMA A;  1PYB A;  2CKZ B;  2IX0 A;  5DLQ E;  1PH9 A;  1TWC H;  5M3F G;  1ASY A;  1JT8 A;  2B29 A;  4DKA C;  1BBW A;  3CC4 A;  3NEN A;  1IBK L;  1FL0 A;  3S1N H;  4YWK A;  1VQK A;  3J7Z C;  4POF A;  4EQ5 A;  1HNX Q;  1CKO A;  3M4P A;  4UP8 A;  1A62 A;  2E5L L;  2ATW A;  4IFD I;  4JCV E;  5C0X J;  2IY5 B;  1PH3 A;  2XTI A;  2VQE Q;  2ZM6 Q;  5GRO A;  4NXM Q;  1IL2 A;  1WCM G;  5IE8 A;  4JYA Q;  3LGJ A;  4B3R L;  1VQI A;  2LSS A;  2ZTD A;  4DV6 L;  1I6H H;  4A75 A;  1HZB A;  3M4Q A;  4APV A;  2E2I H;  1BKB A;  1B8A A;  1WJJ A;  2K5H A;  2MFI A;  4A3K H;  1PH8 A;  1IBL Q;  3K7A H;  2R7D A;  1I50 H;  4A3M H;  1XMO Q;  4LW1 A;  1N9W A;  3RNU A;  2BH2 A;  5C4X G;  3GDE A;  5IYD H;  1L1O C;  2VL6 A;  1QVF A;  3W1B A;  1SRU A;  2B63 H;  4JI8 Q;  1Q1B A;  4IFD G;  1A63 A;  3UE1 A;  1PYS B;  1NBW A;  1S3O A;  1YHA A;  4GN3 B;  4P72 A;  4R4C A;  3UDI A;  5GAG C;  4LF7 L;  4NXN Q;  3PUY A;  5LMN W;  4JI2 L;  3J80 i;  4HIK A;  1N34 L;  5IYC G;  3RN2 A;  1Y1V H;  2N8N A;  4YCV A;  3GTL H;  3S15 H;  1S72 A;  3M85 A;  5HY6 A;  4JI5 Q;  1N32 Q;  2Z6K C;  1YHQ A;  5M5Y H;  5GAH C;  5FLM G;  4DR3 Q;  4GOP A;  2K52 A;  5LMU L;  5JEA G;  1RIP A;  1HR0 W;  5FJ8 H;  1AE3 A;  4B3T L;  4LF6 Q;  3D0F A;  3SGI A;  4K0K L;  4LFB Q;  2UXB Q;  1O7I A;  2AWO A;  2NN6 I;  3UE0 A;  3ULP A;  3HOY G;  1OXX K;  3S1R H;  2DUD A;  4B3M L;  2R7Z H;  2WB1 G;  4A3C G;  1TWA H;  1Q46 A;  4LF4 L;  4PZ7 A;  3HKZ G;  4LFA L;  4BXX G;  3CCE A;  1YVC A;  3OW2 A;  1I3Q H;  1K83 H;  1FGU A;  1WFQ A;  5IT9 c;  5J3B A;  1LUZ A;  4HJ7 A;  1X3F A;  3PUX A;  2V1C C;  3FKI G;  1YJN A;  4DR7 Q;  1PH7 A;  1X6O A;  4X66 Q;  4LFC L;  4HJ8 A;  3PO3 H;  4LF7 Q;  4JI2 Q;  3NBH B;  4DV7 L;  3H3V I;  1YIT A;  1N34 Q;  2NN6 G;  3F2C A;  4DPG A;  4DR4 L;  4IOC A;  2OQK A;  4WJ4 A;  1VQN A;  4IPG A;  1IZ6 A;  2ZJR A;  2KHJ A;  4OWW B;  5IP9 G;  1RL2 A;  3M3Y H;  2CWP A;  1D8L A;  3E0E A;  3K7U C;  5GAE C;  3K0X A;  5LMU Q;  4AQY L;  2UUC L;  2ZJQ A;  1K9M C;  3GTO H;  3GTG H;  4DV5 Q;  4B3T Q;  1LYL A;  4KHP L;  4MTN A;  4DV7 Q;  4JBK A;  1A8V A;  1L1O A;  3J81 j;  4AYB E;  4IJH A;  1Q82 C;  4OWX B;  2H5X A;  4JI0 L;  3GTP H;  2PQA A;  4B3M Q;  3HOU H;  4A3D H;  3PO2 G;  2A8V A;  3HOW H;  4GNX B;  4BBS H;  2ALY B;  1OXU A;  2NVY H;  2B3G A;  2R6G A;  5M3M H;  2ZJP A;  1XNQ Q;  1HJP A;  2IX1 A;  1VQ4 A;  3KF6 B;  3H15 A;  3DM3 A;  4AIM A;  4LUZ A;  4IPH A;  2Z6K A;  2QA4 A;  3GTQ H;  4BY7 H;  1MJE A;  2YTY A;  1HNX L;  3I4M G;  1I5F A;  3Q8D A;  4LFC Q;  2HHH L;  2VQE L;  4DR6 L;  3CC7 A;  3KDF A;  4PZ6 A;  1OXV A;  4NXM L;  1UE5 A;  3ULJ A;  3G6E A;  4DV3 Q;  3UDG A;  4JYA L;  1UE6 A;  3HKS A;  1CUK A;  4L5T A;  5E7N A;  4A3I G;  3RZD H;  1EYG A;  1EQQ A;  5IYB G;  1FVI A;  3PUZ A;  3UDF A;  4TVA B;  2Y0S G;  1G51 A;  2MQH A;  1HZC A;  4KLK A;  5K36 G;  1AH9 A;  4X6A H;  1HNZ L;  5AJ3 Q;  3VDY A;  4LF9 Q;  2JA6 G;  1XMO L;  1K8A C;  3S2H H;  2IT1 A;  1M90 C;  2EQS A;  1PHJ A;  2XGT A;  4DK6 C;  2NZH A;  1VQM A;  4JI7 L;  4KHP Q;  1C0A A;  2K14 A;  3DLL A;  3FHW A;  3TS0 A;  1ASZ A;  2YU9 H;  1L1O B;  1PFS A;  2JA5 H;  4GN4 B;  4NXN L;  1NY4 A;  1V1Q A;  3OTO Q;  1R9T H;  4DR2 Q;  3J7A 5;  4L5R C;  3CCM A;  1P8L A;  4A3E G;  1WI5 A;  1WOC A;  1VQC A;  4BA2 I;  4QGU A;  3K81 C;  3U50 C;  3JAM c;  4JI5 L;  1N32 L;  1Y1W G;  4DR3 L;  2YTV A;  4A3F G;  2JQO A;  4BA1 I;  1E7Z A;  4UPA A;  3KYH C;  3E9I A;  2R93 G;  2VS1 A;  4DV0 Q;  2HHH Q;  1V9P A;  4DR6 Q;  3F2D A;  1VQB A;  4LF6 L;  4LFB L;  1QZH A;  2UXB L;  3TEH B;  1KXL A;  4EX5 A;  1HR0 L;  2K5V A;  2Q2I A;  4A3J G;  1N33 Q;  2R92 G;  2A19 A;  2WAQ E;  1YNX A;  2HQL A;  5C4J H;  2AKW B;  1HNZ Q;  3PCO B;  5GQO A;  1Q86 C;  2ASB A;  1EWI A;  4BXX H;  3PUV A;  1PH1 A;  4JI7 Q;  5C44 G;  3CD6 A;  4DR7 L;  4YCW A;  2AHO B;  2GN5 A;  4R4I A;  3UDX A;  4X66 L;  5M5W H;  3PF5 A;  1Y14 B;  4LUO A;  1VQO A;  1XTD A;  4A76 A;  4C3I H;  1YJ9 A;  3G48 A;  3CCS A;  3HOZ G;  1W2B A;  4PG3 A;  5IWA Q;  4JI3 L;  3I2Z A;  4MNO A;  1NJI C;  1YBY A;  3U4Z A;  1T9H A;  2NZO A;  2NVT H;  1UE1 A;  2WFW A;  4R4O A;  3HOX G;  1HNW Q;  4DV2 L;  2PMZ E;  1YJW A;  4Y52 H;  3T1H L;  1YZ6 A;  4BY1 G;  2UUB Q;  4DV5 L;  3MEF A;  5EAY A;  1J5E Q;  2RHS B;  4LF8 Q;  4A93 H;  4JI4 Q;  3E9H A;  4L5S A; 
#chains in the Genus database with same CATH topology
 2IHE A;  4X64 L;  4TQU S;  2EY6 A;  4PV1 C;  2VZA A;  3I8Z A;  2ZXP A;  1B7Y B;  4P71 A;  4RKL A;  2YYZ A;  3STB D;  2R7F A;  4YWL A;  2N49 A;  5CV4 A;  3GTJ H;  1CKM A;  2KCM A;  1RD9 D;  4DFA A;  3K5L A;  1HXY D;  3DEP A;  1IKL A;  4HMI A;  1Z47 A;  3RLF A;  1STY A;  4H13 C;  4C3J H;  3CQZ B;  4UP9 A;  3RZD B;  4A3M G;  1BCP F;  2KJX A;  3S1Q H;  4U68 A;  5BN3 A;  3H3V I;  1HHV A;  5IYD G;  2E76 C;  4GOP B;  4DV2 Q;  3T1H Q;  3OIQ A;  1Y8P B;  2G9D A;  1SJE D;  4KKT A;  2WB1 E;  4X64 Q;  1LTI D;  3K57 A;  2LFN A;  1IBM Q;  4B08 A;  3MXN A;  2A1A A;  3CPW A;  1BCP B;  2FMM A;  5CBE E;  4HSV A;  5E4W C;  2HIX A;  5M3F H;  4IOA A;  3H91 A;  3OIP A;  1S5D D;  3GV6 A;  2JA7 G;  3JAM E;  3K80 C;  2KBN A;  2JJQ A;  1N33 L;  2I46 A;  2RKS A;  1XXG A;  1PH6 A;  3E5S A;  4QY7 A;  3TS2 A;  2QEX A;  4A4I A;  3HOY B;  5JJK A;  3S1M H;  1Q7Y C;  1EFW A;  5CV7 A;  1X9N A;  2JE6 I;  1GM5 A;  1G6P A;  1PFB A;  2WB1 B;  1JE4 A;  5COR A;  1VDZ A;  2Z4I A;  3MXP A;  1WTW A;  1XPR A;  4O2D A;  3S17 B;  2F0H A;  4HID A;  3MHB A;  2PI2 A;  2RBM A;  1Y8N B;  2I5H A;  3D6C A;  4C3H B;  1JQY D;  1HRJ A;  4K14 A;  3Q23 A;  2VUM B;  4CDD C;  1W3S A;  2RSO A;  3CF5 A;  3S2D B;  1QZG A;  1LTG D;  3F2U A;  3HOX H;  5JEA H;  1G29 1;  1PZI D;  2RQX A;  2KEC A;  3T56 B;  1LT4 D;  4ZKC B;  5M3M G;  3KF8 B;  1TT2 A;  4HMJ A;  2IX3 A;  4CBV A;  1HTP A;  4HJ5 A;  2UU9 L;  2RDH A;  4IPC A;  1Q3L A;  1L0W A;  4RCN A;  4DAV A;  3PO2 B;  2WV6 D;  4A3B B;  2K6A A;  3MTS A;  1IYU A;  5KRU A;  3K59 A;  2MJ8 A;  5IP7 G;  1SYE A;  1QNK A;  3A5U A;  3I4M B;  2P5Z X;  2CQO A;  1STE A;  1QUQ B;  4L5Q A;  2PCF B;  4FF2 A;  1X3G A;  2XNA C;  5C3W A;  3DWP A;  1EY5 A;  2UXD Q;  4QL5 A;  1AEX A;  1E1O A;  3HOV G;  5LL6 X;  1OO9 B;  2N3S A;  2BH8 A;  4JV5 L;  2Q2U A;  4NDX A;  3EBE A;  4G7H C;  4JBJ A;  4IFD J;  1LAB A;  1VQG A;  2F4V L;  1F9Q A;  3L0O A;  4S3S A;  1CQV A;  3CCR A;  2OTJ A;  3I56 A;  1KIX A;  4FXG C;  1KLG D;  1JCK B;  4A3E B;  1BCP D;  4N9T A;  1E2W A;  3SE0 A;  1AZQ A;  3CW2 C;  2NZ1 D;  1LM0 A;  2WII B;  3T1Y L;  4I65 A;  4MTK A;  3K8A A;  5EKI A;  4C2M B;  2O5I C;  4OWT B;  1LAC A;  4UHV A;  4A3J B;  2F0K A;  3DHQ A;  4G7O C;  5K36 H;  1L0Y B;  3R3O A;  4C3I G;  5C3E H;  1SR3 A;  2JA6 H;  4DAY B;  4K2K A;  1QVG A;  1ICW A;  4IUN A;  1SRO A;  5KND A;  2D0O A;  1U5K A;  2HCI A;  1D2B A;  2A6E D;  2CHB D;  2YTX A;  3F2B A;  4R4T A;  1VQL A;  4XTC S;  3A7A B;  1F9R A;  1K28 A;  4A93 G;  4JOI A;  1BNZ A;  1KNE A;  2FMC A;  4N9P A;  1WTO A;  4A3F H;  4K0K Q;  3D4D A;  3GP7 A;  5FO8 B;  1CTM A;  4R9W A;  4OO1 H;  3AQQ A;  2F0O A;  2MO0 A;  4RMF A;  3A7L A;  3QOL A;  1KQS A;  5BN4 A;  1JWU D;  5KYL A;  2F0F A;  2F3I A;  3M9B A;  2TMP A;  4LF4 Q;  1EOV A;  4DAM A;  3ER0 A;  1LTS D;  2PPB C;  2IHF A;  1CZG A;  5CGK A;  4TKO B;  1VQ8 A;  1KHI A;  3OMG A;  4UY8 C;  3PUW A;  1HA6 A;  1X56 A;  1CKN B;  2JEB I;  2E8G A;  3HOZ H;  4ZCK A;  3SK8 A;  3I4N G;  4PQX A;  5A2Q L;  1PTO C;  3N52 A;  1PA6 A;  4GOP C;  4CDF C;  3HS0 C;  5DNF A;  1S5C D;  5CV5 A;  1XPO A;  2R3Z A;  2UUC Q;  4P74 A;  3RLN A;  1SE2 A;  4A3M B;  4J6H A;  1OXS C;  4A3D G;  2JA8 G;  3IFD A;  3OW7 A;  1A3U A;  1U4P A;  4GZY C;  1L2F A;  1GUN A;  2IX0 A;  5DLQ E;  4ZQ3 A;  1TWC H;  1ASY A;  1JT8 A;  3CC4 A;  5E3F A;  1IBK L;  2OEO A;  5DEH A;  2XN9 C;  2E5L L;  1JR0 D;  3S9W A;  5C0X J;  1O78 A;  2D2C C;  4RAU C;  1WCM G;  1ZYR C;  4B3R L;  1KAB A;  2LSS A;  1I6H H;  3D8G A;  1CA6 A;  1BKB A;  2R7Z B;  4A3K H;  1TWA B;  3MFY A;  2L4N A;  1I50 H;  4LW1 A;  5C4X G;  3BVG A;  3GDE A;  5L37 A;  3MXG A;  2B63 H;  1QVF A;  1Q1B A;  4IFD G;  5JAV A;  2BE5 C;  1S3O A;  4LF7 L;  5LMN W;  4JI2 L;  1SDF A;  3J80 i;  3E6Z X;  4ODG A;  1Y1V H;  2N8N A;  3FVQ A;  3M85 A;  3AMU A;  1N32 Q;  1YHQ A;  1RJT A;  4DR3 Q;  3FPU B;  1RIP A;  1LTB D;  2L0C A;  1YNJ D;  1MHW C;  4LF6 Q;  1VF5 C;  2A6H C;  4FO2 A;  4UDU C;  4B3M L;  2E2J B;  1Q46 A;  1B3A A;  3CCE A;  3OW2 A;  1I3Q H;  1FGU A;  3ONA B;  5J3B A;  2KCC A;  5COY A;  3PUX A;  5M3M B;  4K8J A;  1X6O A;  3GTQ B;  4LFC L;  1CK1 A;  4FP5 D;  3HP3 A;  4EQO A;  1D5X C;  4LF7 Q;  3DXJ C;  4JI2 Q;  3BG3 A;  1ET6 A;  2L1B A;  2NN6 G;  1SEB D;  2SNS A;  4DPG A;  3HEJ A;  4IOC A;  2KHJ A;  4LMQ D;  3TDQ A;  1D8L A;  3K7U C;  4DNT B;  3VR5 A;  3K0X A;  1EU4 A;  1HPC A;  4DV5 Q;  3J81 j;  4OHJ A;  4KN4 C;  3GV3 A;  4B3M Q;  3HOU H;  3K58 A;  2X6L A;  2A8V A;  2EE1 A;  4GNX B;  4BBS H;  1WTR A;  3HOV B;  3H15 A;  3DM3 A;  2Z6K A;  2QA4 A;  4XT1 B;  4IUR A;  1HNX L;  2Z4H A;  1BXT A;  4LFC Q;  4X3K A;  2HHH L;  4DR6 L;  3ULJ A;  1WD1 A;  2KVM A;  4EGV A;  5E7N A;  3HKS A;  4L5T A;  3RZD H;  4R8I A;  1PTO H;  5KYI A;  1G51 A;  4HAE A;  2MQH A;  1HZC A;  1PZJ D;  1HNZ L;  3EA6 A;  5D65 A;  5G3L F;  1XMO L;  2F03 A;  1M90 C;  4FVM A;  1VQM A;  1C0A A;  3KBG A;  2B2Y C;  2K14 A;  3DLL A;  3TS0 A;  1ASZ A;  1L1O B;  4L6T B;  4GN4 B;  5M5W B;  1WTP A;  1V1Q A;  4C3I B;  2SDF A;  3J7A 5;  1SMY D;  1WVL A;  1F9S A;  1GUO A;  1WI5 A;  2A69 C;  1XYI A;  2NWG A;  3U50 C;  5KNB A;  3FEW X;  2CW0 D;  4ZLT F;  3WOF A;  1EZ6 A;  4UPA A;  2J4X A;  2R93 G;  2HHH Q;  4DR6 Q;  1V9P A;  4DXF A;  2KQ3 A;  1VQB A;  3L9A X;  1ENC A;  2FHT A;  3BVZ A;  4HTH A;  5D3D A;  4EX5 A;  3ZYY X;  4A93 B;  2EDG A;  5HGT A;  3OOC A;  2HQL A;  3H09 A;  5C4J H;  1ICF B;  1HNZ Q;  2K33 A;  1Q86 C;  1QG7 A;  5TSS A;  3PUV A;  1JIC A;  1PH1 A;  3CD6 A;  2N55 A;  1G8Z D;  3J7A V;  1EQT A;  2GN5 A;  1PYW D;  2EOT A;  2B2U C;  2PZU A;  1Y14 B;  1EY8 A;  5IT9 E;  2F0P A;  2B2T A;  2NTT A;  3CCS A;  1RTO A;  5CV8 A;  5IWA Q;  3I2Z A;  5CYU A;  1T9H A;  2NZO A;  1F2M A;  3JAM L;  2ZXO A;  1Z7T A;  3NE5 B;  3A8J E;  2HDM A;  2PMZ E;  5EKK A;  4Y52 H;  3I4N B;  4BY1 G;  2Z8L A;  3MEF A;  1J5E Q;  5A2Q E;  3M7N A;  4JI4 Q;  2AMC B;  1EIF A;  1MIU A;  2KHS A;  5FO7 B;  3KFU A;  4WJ3 M;  1JJG A;  3J81 c;  5CR3 A;  4Y7N B;  2UUA Q;  4A3D B;  3KLS X;  2M2L A;  1XNQ L;  2JA8 B;  4K5V A;  2DY7 A;  4RHR A;  4HJ9 A;  2K05 A;  3BZK A;  4BBR H;  4OEL B;  2JEA I;  4X3U A;  3BJU A;  1KAW A;  2QW7 A;  2BDN A;  4KHV A;  3D3R A;  5EJW A;  2K04 A;  2VUM G;  5IY0 A;  1H9S B;  2X6G A;  4GLX A;  1B3Q A;  1Q8I A;  1WCM B;  3GTM H;  3I55 A;  3PIO 3;  3S14 H;  3IRB A;  4P75 A;  3I3C A;  3AEV A;  1IYJ B;  1ZEQ X;  2K01 A;  5IGD A;  1SMY C;  2RA4 A;  4LF9 L;  3B6Y A;  2E2H H;  3CAM A;  2MUY A;  3OMC A;  2AWN A;  1B70 B;  1LT5 D;  2EY1 A;  2A68 C;  2CW0 C;  1FNV A;  4R4Q A;  1X55 A;  1PFN A;  5C4X B;  5C44 B;  1TS2 A;  3BU2 A;  1B9N A;  4DR2 L;  4A3B G;  4WRD A;  4MN3 A;  5EBD A;  4RH6 A;  1R9T B;  2RCF A;  3HGB A;  4DUZ Q;  1HH2 P;  5IGC A;  1N8R C;  2NVX B;  1KDB A;  2OQ0 A;  2RHQ B;  4N8F A;  2PZT A;  2QF7 A;  3K5O A;  4GKK Q;  5G3L D;  5C0X I;  1QOH A;  5IGE A;  3H0G G;  3S16 B;  5M5X B;  4A3J H;  4R1J A;  2HQE A;  1C7Y A;  1AFP A;  1I94 L;  3QIA A;  4IN3 A;  5T1G A;  3PO3 G;  1I6V C;  1ML0 D;  1VCI A;  4DR5 Q;  1MJC A;  1FNU A;  2RF4 A;  3CRK C;  2F0J A;  1EIY B;  3CCL A;  5LMN L;  3KJO A;  2PNH A;  4PMB A;  1EYA A;  4DR1 Q;  2O2L D;  3CCQ A;  2EY5 A;  4JG2 A;  3PIO A;  3SHL A;  2C9O A;  1U4M A;  1J6Q A;  4DK0 A;  1XPU A;  4WOR A;  1Q90 A;  4X65 Q;  1TWF B;  4GNX C;  4LF5 L;  3RZO H;  3QB3 A;  1JB7 A;  2KEN A;  1SNC A;  1I94 Q;  1HZ9 A;  1SFO B;  1V43 A;  4ME5 A;  5DM7 3;  5IOC A;  4GKJ Q;  2N78 A;  1UEB A;  3FKI H;  1KDA A;  2E2D C;  4IZ8 A;  5ELO A;  5ELC A;  2F0S A;  3VYT A;  1EY6 A;  1DJR D;  5BR8 L;  2K5Q A;  5LMN Q;  2F3W A;  4X3T A;  3WOE A;  4CKE A;  1HTL D;  5FK9 C;  1EUJ A;  3W2D A;  1V8Q A;  1A6X A;  1T5E A;  1JWM D;  4FF4 A;  4GS3 A;  2Z0S A;  4G7Z C;  2NVQ B;  2BCO A;  4IAL A;  1LTR D;  3UI2 A;  4F87 A;  1H9R A;  5KNC A;  1IBM L;  4LF5 Q;  2K50 A;  5DM6 3;  1SLJ A;  1FYC A;  4G57 A;  1GUG A;  1Z6H A;  1Q12 A;  1P16 A;  4B9X A;  2N88 A;  1OXT A;  1QNU A;  1TWH B;  2EXZ A;  4FF3 A;  2WKD A;  4OEM B;  4RHS A;  5JEA J;  4XXE A;  5JVG 3;  2QDB A;  3BZD B;  4KJN A;  4J15 A;  5BR8 Q;  2JA7 H;  2R93 B;  5CV9 A;  4DV6 Q;  3RN5 A;  1D7Q A;  2QGQ A;  1ENA A;  4ILW A;  4A3I H;  1CSP A;  3CRL C;  2KOL A;  5IYB H;  3GTK H;  1W6J A;  4KD4 A;  4CGY B;  4BS9 A;  1KRS A;  1D5M C;  1TWG B;  2MNA A;  3BZC A;  2EIF A;  3NBI A;  4AH6 A;  1CZW A;  1E2V A;  3M4O H;  1OTC A;  2EJM A;  3NQI A;  3V05 A;  1NR2 A;  4MZ9 A;  1Y1W H;  2K1B A;  1L0X B;  3KLS A;  1TU2 B;  4DV4 L;  2R7Z G;  2RVL A;  3SVM A;  2E2J H;  4KD3 A;  3NHH A;  4PMW A;  3U58 A;  4BY1 B;  1LT6 D;  1EIH A;  3IL8 A;  2R92 H;  1JWS D;  1F77 A;  4LFA Q;  3I7F A;  1G6Z A;  3CCV A;  5IGB A;  1A2T A;  4FF1 A;  3ZJY C;  3Q0A A;  3RD4 A;  2ZM6 L;  4H0L C;  4C3J G;  1PDQ A;  2GA4 B;  3EVQ A;  1PH5 A;  1X3E A;  5IP7 H;  4DR4 Q;  1KD1 C;  5JJL A;  4ZRZ A;  4QQB X;  1JJC B;  1M4V A;  1EL0 A;  2Q2H A;  3D31 A;  2WAQ G;  3STB C;  3RR5 A;  3K7A B;  4ZKB B;  2UXD L;  2KCT A;  4DV4 Q;  3I91 A;  3SK5 A;  4JI8 L;  4DF7 A;  4H02 A;  2EYM A;  3FMC A;  1VQ7 A;  3HOV H;  3KBX A;  3AB9 A;  1H9J A;  1EY4 A;  1WTQ A;  5M3F G;  1DOL A;  1EWC A;  1FL0 A;  4LAA A;  2FFK B;  3MA2 B;  3S1N H;  3J7Z C;  3T13 A;  4POF A;  4EQ5 A;  2KEE A;  3J80 E;  2E75 C;  2ATW A;  2XTI A;  4IUU A;  2ZM6 Q;  4NXM Q;  3R2T A;  4JYA Q;  1SAP A;  5F2D A;  4PMC A;  2NTS A;  3LGJ A;  1EY7 A;  2ZTD A;  5EPK A;  1SYG A;  1HZB A;  3M4Q A;  2E2I H;  2RDF A;  4CJ2 C;  1EZ8 A;  5JJZ A;  2HCC A;  2K5H A;  1SSO A;  1NCV A;  1N9W A;  2BH2 A;  3H0G B;  4JPB W;  3W1B A;  3NPP A;  4JI8 Q;  1YHA A;  3NBH A;  4GN3 B;  1BR9 A;  4O42 A;  5C3X A;  2IJ0 A;  4HIK A;  3PO3 B;  4RGM A;  3RN2 A;  3GTL H;  3S15 H;  4K6L A;  3OSO A;  1BBX C;  1SNQ A;  5HY6 A;  4X3S A;  5M5Y H;  4GOP A;  2K52 A;  1EIG A;  4QB4 A;  4JW0 A;  5JEA G;  4P2C B;  4ID6 A;  4K0K L;  3GTO B;  3QR8 A;  2UXB Q;  1MSH A;  3ULP A;  3M4Y A;  1BDO A;  2XWJ B;  3S1R H;  1GUT A;  2KA7 A;  4RGN A;  4LF4 L;  1K83 H;  3TSS A;  4HJ7 A;  1X3F A;  4DR7 Q;  1VMC A;  4X66 Q;  4CKB A;  3SDZ A;  4DV7 L;  3A8K E;  5FLX E;  3F2C A;  1MD2 D;  2OQK A;  3QG1 A;  1VQN A;  4RWS C;  5KEE A;  2ZJR A;  5DAU A;  2G5D A;  2EJG C;  2UUC L;  1CQF A;  3HRZ C;  3GTG H;  3GQB A;  1LT3 D;  3RUZ A;  1CHQ D;  1KNA A;  3HZX A;  4IJH A;  3V2T A;  4C56 C;  2YU9 B;  3DMU A;  4A3D H;  1EY9 A;  1SND A;  3HOW H;  3D4W A;  2NVY H;  2B3G A;  2ZJP A;  1DCZ A;  5IT9 L;  2IX1 A;  3KF6 B;  4BY7 H;  4WJW A;  4BWG B;  1I5F A;  2XWB B;  5ELF A;  2JXM B;  4PZ6 A;  1OXV A;  1UE5 A;  3G6E A;  4DV3 Q;  3UDG A;  1UE6 A;  2JN4 A;  1CUK A;  4YIJ A;  3BDL A;  3TP7 A;  1FVI A;  4NW2 A;  5K36 G;  5EKL A;  5AJ3 Q;  2JA6 G;  3S2H H;  4DGZ A;  4DNR B;  1PHJ A;  2NZH A;  4E6I A;  2LS0 1;  3X3N A;  1EQV A;  2JA5 H;  1NUC A;  3OTO Q;  1B1Z A;  1R9T H;  1O7Y A;  1BCP C;  4L5R C;  1WOC A;  4ZAI A;  3VR3 A;  1S5B D;  4BA2 I;  3JAM c;  1N32 L;  4DR3 L;  4JVZ A;  4A3F G;  4BA1 I;  3CHB D;  4DV0 Q;  4LF6 L;  1WD0 A;  3TEH B;  1HR0 L;  2Q2I A;  4QIW B;  1AN8 A;  2WAQ E;  3K5M A;  4HN7 A;  4FXD A;  2A6E C;  3PCO B;  1BOS A;  4HCS A;  1PFM A;  4KK7 A;  5C44 G;  2AHO B;  3TZU A;  3PF5 A;  2KED A;  4LUO A;  2Z1C A;  3GTJ B;  3G48 A;  3HOZ G;  3MZ5 A;  5JPN C;  4JI3 L;  1NJI C;  4MNO A;  1GJX A;  4I7Z C;  2CVR A;  2NVT H;  4C3J B;  2NN6 H;  2B2V C;  4KKU A;  2WFW A;  3A54 A;  4R4O A;  1K8M A;  3VA5 A;  1HNW Q;  1YJW A;  2DNE A;  1YZ6 A;  3EFX D;  3TME A;  3S1Q B;  2UUB Q;  4IUP A;  4DV5 L;  2B2Y A;  4LF8 Q;  4XQN A;  1GHK A;  2ASB A;  1IHZ A;  1HR0 Q;  1PH4 A;  5I2Y A;  2WAQ B;  4L63 B;  4DK3 C;  3GTP B;  5CMD A;  2CH4 W;  4X62 Q;  2BA0 A;  4LJZ C;  4RA8 A;  2Q8R E;  4DA2 A;  2RDG A;  5M3F B;  5LHY 1;  1FJG L;  4YY3 L;  1E24 A;  1I4H A;  4OIJ A;  4JI3 Q;  4A3G H;  2I5L X;  3H3V C;  2DGY A;  4CJ0 B;  2VY3 A;  4A3K G;  3TRZ A;  4XT3 B;  3CXC A;  3AFP A;  1IW7 D;  2B63 G;  1Y69 U;  3BS1 A;  2F3V A;  3F8T A;  2A5H A;  3S1M B;  5J39 A;  2B2U A;  2HD3 A;  4TSS A;  3D4R A;  1Y1V G;  4IUT A;  4A3L G;  2BOS A;  1CKN A;  3K6O A;  3S24 A;  1SE4 A;  2F0M A;  2YV5 A;  2D9U A;  2LXK A;  1QJO A;  3G71 A;  1XX8 A;  1GOZ A;  1QVC A;  2WAC A;  1RF2 D;  1TWH H;  1FJG Q;  1UAP A;  4YY3 Q;  1U0L A;  2K5W A;  1UE7 A;  4KI0 A;  2UXC Q;  1MSG A;  3CQZ H;  4JI1 Q;  1LLR D;  3CP0 A;  3HOX B;  2L5T A;  2I0Q A;  2HIV A;  3WWV A;  3PMF A;  5C4Z A;  3ICE A;  4M1U B;  4ZYS A;  4NPS A;  1WTH A;  4OO1 I;  2AQ3 B;  4F7X A;  1AE2 A;  3OYY A;  1M1K C;  2PW5 A;  4V19 0;  1GUS A;  1ENF A;  2PQA B;  1YNJ C;  1LO5 D;  1PRT F;  5IWA L;  4GN5 A;  3CCJ A;  4DAP A;  1K0R A;  1E1T A;  3JC6 6;  4HR7 B;  5C0X G;  2EYF A;  3F1Z A;  5IYC H;  3CU7 A;  1LTL A;  3NP8 A;  1JOK A;  2D0P A;  4NP5 A;  4XQQ A;  3U4V A;  5FLM H;  1AZP A;  1KLU D;  4P73 A;  1J5E L;  3KDF B;  3I72 A;  4JI4 L;  1N36 Q;  3HOU G;  3NQT A;  4ME3 A;  2KHI A;  4CJ1 B;  1TY2 A;  4BY1 H;  4BBS G;  2VNU D;  1PRT B;  2MPM A;  1QCB D;  1JMC A;  1DXM A;  3OPO A;  4F88 A;  3NXW A;  4K2L A;  3HOY H;  2UUA L;  1AP0 A;  5I9O A;  2X69 A;  1CSQ A;  3MAQ A;  1XMQ L;  4A3C H;  4DUY L;  1SE8 A;  1D5Z C;  2HDL A;  3S17 H;  1PLF A;  1X3Q A;  2WKC A;  4LNQ A;  3P75 A;  3SR1 A;  1XWE A;  3TQY A;  1CHP D;  3A5Z B;  5I9P A;  4C3H H;  3CC2 A;  4Q0F A;  2VUM H;  4GLV B;  3MEH A;  3S2D H;  3FPP A;  4DU9 A;  5IP9 H;  3DEO A;  2EYH A;  1TQO A;  3NUC A;  2F0E A;  2O4X A;  1GD7 A;  5C3E B;  3ERS X;  2JA6 B;  3KJP A;  1SYD A;  3KLR A;  3J81 i;  1EU3 A;  2NB0 A;  4YHH L;  1HQR D;  1XMQ Q;  2QDL A;  3PO2 H;  4YCU A;  4DUZ L;  2F0D A;  4DUY Q;  4A3B H;  3NEM A;  5E4X A;  2L11 A;  1CM9 A;  4ZUI A;  4JBM A;  1Q8K A;  3PV0 A;  1H95 A;  5LL6 S;  5T1I A;  3I4M H;  1JOR A;  3H3V H;  4K5W A;  4A3F B;  4GKK L;  3VR4 A;  3HFZ B;  4F8M A;  3O13 A;  3T16 A;  1F2Y A;  4ULL A;  4GNX A;  4IPD A;  4AYB G;  1STN A;  4IJL A;  3H0G H;  4OX9 L;  3VYR A;  2ICI A;  1BBU A;  4J1M A;  4DR5 L;  3L7Z C;  1AW7 A;  1DON A;  3P1H A;  1X65 A;  1MKH A;  4HCE A;  3L2P A;  3J80 L;  2CCZ A;  2EYL A;  1HQM C;  1VMP A;  4YHH Q;  1KL9 A;  3K0Y A;  5I6W A;  1GVP A;  1DM0 B;  4DNI A;  3HOZ B;  4A3E H;  4DR1 L;  3RMH A;  3SEB A;  5FJ8 G;  1G2T A;  5H1S E;  1V1O A;  4O0A A;  2O5J C;  1QWY A;  1PZK D;  5ELB A;  3CCU A;  4G4K A;  1B4O A;  3DUZ A;  4C2M H;  1SN8 A;  2CWA A;  1PH2 A;  3E0J A;  4X65 L;  2XRS D;  3CPF A;  2K75 A;  2ZTE A;  1VQA A;  1YNN D;  1MBY A;  3VYU A;  4OX9 Q;  3NTH A;  3NEL A;  4BBR G;  1TWC B;  2F0T A;  1I4R A;  4GKJ L;  1PRT D;  1ILQ A;  1K3R A;  1BVS A;  3A0J A;  1STA A;  3KLW A;  4M8A A;  3EQL C;  1VQJ A;  4FYD A;  1G91 A;  2L55 A;  3MXN B;  5CBA E;  4XQJ A;  3R2I A;  5ELN A;  5CC4 A;  2PI2 E;  1UEA B;  1I6H B;  1C4Q A;  1IBL L;  4AQY Q;  3AFQ A;  4A3K B;  1VQD A;  2LXJ A;  1I50 B;  2NBF A;  2OXP A;  1EFI D;  4QUF A;  1HZA A;  2GVB A;  3CME A;  4JI0 Q;  2OWO A;  2B63 B;  1UUP A;  3CMA A;  1DZ1 A;  1PYB A;  2CKZ B;  3VR2 A;  1G2S A;  2B29 A;  3URY A;  4DKA C;  3NEN A;  1Y1V B;  3T53 B;  1VQK A;  1I4P A;  2EVB A;  5FLX L;  3M4P A;  2IY5 B;  3IAY A;  1TII D;  1PH3 A;  2VQE Q;  1IL2 A;  5IE8 A;  4KKS A;  2G9H D;  1KTK A;  1SYF A;  3A8I E;  2NYZ D;  1V1P A;  1JOQ A;  4DV6 L;  2ZXR A;  4APV A;  2MFI A;  1PH8 A;  1IBL Q;  4A3M H;  2R7D A;  3IKJ A;  1I3Q B;  2IL8 A;  5IYD H;  1L1O C;  2VL6 A;  2ENB A;  3UE1 A;  4QUC A;  5GAG C;  3UDI A;  4NXN Q;  3PUY A;  1BUV T;  1N34 L;  3MVV A;  4YCV A;  1TS5 A;  3VYS A;  1S72 A;  2I07 B;  3N6R A;  4JI5 Q;  5GAH C;  3QWN A;  1HR0 W;  3H94 A;  4CHT B;  1ESR A;  4Z9C B;  2F0N A;  1EEF D;  4B3T L;  3SGI A;  1J9O A;  4LFB Q;  1O7I A;  3UE0 A;  1O80 A;  1SNM A;  1PRT C;  1OXX K;  2DUD A;  2R7Z H;  5JPM C;  3OWE B;  1TWA H;  4BXX G;  3HKZ G;  4J8Q A;  4LFA L;  2MHV A;  3ND9 A;  3HOU B;  2SOB A;  5IT9 c;  1PTO F;  4BBS B;  4N8X 1;  2F4I A;  3FKI G;  1YJN A;  1PH7 A;  4KTA A;  1K0S A;  3QO2 A;  2B8F A;  2D5D A;  1F9P A;  3K5N A;  1KDC A;  1STG A;  3MXU A;  3NBH B;  1MGS A;  1F2L A;  1YIT A;  1N34 Q;  3FRP B;  4DR4 L;  5C4H A;  3P20 A;  4IPG A;  1IZ6 A;  2DJG C;  1RL2 A;  1PTO B;  4U67 3;  1S5E D;  2CWP A;  4RFB A;  1K9M C;  3QOJ A;  2R61 A;  4B3T Q;  1LYL A;  3T51 B;  4DV7 Q;  4JBK A;  1A8V A;  4UAI A;  4AYB E;  1Q82 C;  5KGU A;  3GTP H;  2H5X A;  3HG9 A;  2JYO A;  1QIL A;  4JK1 C;  3U9O A;  2K5D A;  4CDC C;  3J81 L;  1A3T A;  1U4L A;  1OXU A;  2R6G A;  4C1N K;  5M3M H;  1VQ4 A;  2F0I A;  5ISR A;  4AIM A;  4IPH A;  3SK6 A;  5I6Y A;  3J7Y W;  3GTQ H;  2E74 C;  2WIN B;  3Q8D A;  4DK1 A;  3CC7 A;  4NXM L;  2B2W C;  5D14 A;  2F0W A;  4JYA L;  1E0B A;  1EYG A;  4A3I G;  1EQQ A;  5IYB G;  4TVA B;  2Y0S G;  5ELE A;  4X6A H;  1U4R A;  4MIU A;  5C4J B;  2XGT A;  4EVO A;  4JI7 L;  4AYB B;  3FHW A;  4ZK9 B;  2L12 A;  1NY4 A;  3ERO A;  2F0U A;  2VXW A;  1VQC A;  3EJI A;  4RCO A;  3K81 C;  2DNC A;  1Y1W G;  2YTV A;  2JQO A;  2LY7 A;  1E7Z A;  3E9I A;  2VS1 A;  3NWT A;  5ELD A;  2SNM A;  3F2D A;  1VF7 A;  5IOD A;  1ONL A;  1QZH A;  2UXB L;  3OWF A;  1KXL A;  1C48 A;  2L9H A;  1FR3 A;  1N33 Q;  2R92 G;  1IYV A;  5D3I B;  2Z6B A;  2AKW B;  3Q24 A;  2ZT9 C;  1SYB A;  1EWI A;  4JI7 Q;  4DR7 L;  1EYD A;  2J7Z A;  2V4D A;  4K8I A;  1RHP A;  4R4I A;  4X66 L;  5M5W H;  1KAA A;  1HFG A;  4C3I H;  4BBR B;  1W2B A;  5C6A A;  3U4Z A;  1HFN A;  3R8B A;  2H4O A;  1B53 A;  3HOX G;  3GTM B;  3S14 B;  1STH A;  1I4X A;  5EPL A;  3M3Y B;  4RGO S;  4H44 C;  5EAY A;  3A56 A;  4A93 H;  1JOO A;  4NKL A;  3E9H A;  4ALP A;  2E2H B;  2I5M X;  1PTO D;  4XIG S;  1A2U A;  2JSO A;  1VQF A;  3I73 A;  4WFN 3;  2MO1 A;  1VQ9 A;  2UU9 Q;  1II3 A;  3W3A A;  1VQE A;  3KUP A;  3VA7 A;  2RSN A;  1D1I A;  4DV3 L;  1LTA D;  1EEI D;  2K32 A;  4LWC A;  4YWM A;  3KK7 A;  2CQA A;  5NUC A;  3I4N H;  1SJH D;  1S40 A;  1GKH A;  5AJ3 L;  2C35 B;  1JJ2 A;  3G7L A;  4R8N A;  5C5M A;  1ZYR D;  2EXD A;  1E22 A;  5EQ0 A;  2GVA A;  4ZUJ A;  2A74 C;  4OON A;  1LV9 A;  1GO3 E;  3HKZ E;  3J7A F;  4IUQ A;  4JV5 Q;  4Y7N H;  3OTO L;  3I4O A;  3TRE A;  2JA8 H;  2VQF L;  1H9K A;  4KV6 A;  2F4V Q;  3W5O A;  5IIF A;  2DY8 A;  4B9W A;  4KY6 A;  5I4D A;  2B2V A;  4RKB A;  4B3S L;  2BE5 D;  1EQR A;  3I4L A;  3PGZ A;  4DV0 L;  3ND8 A;  1XNR L;  1DGS A;  2RCN A;  1U9R A;  2VW9 A;  3T1Y Q;  1F2Z A;  1WCM H;  2JK8 A;  3KF8 A;  4HIM A;  4QIW E;  1K8O A;  1O7L A;  2TSS A;  2OTL A;  1Y8O B;  2F52 A;  2ZTC A;  5C3E G;  4DV1 L;  1RTN A;  3RZO B;  1SBB B;  2WP8 J;  1KC8 C;  2L15 A;  3LWE A;  2A6H D;  3HKZ B;  1FD7 D;  2EZV A;  5C4X H;  5C44 H;  1HCZ A;  1HUN A;  1B2T A;  2K5N A;  3FKI B;  2VQF Q;  2K4K A;  4IFD H;  1KRT A;  4I7A A;  1QUQ A;  3C1F A;  4Q5V A;  1YEZ A;  2IWH A;  3JAM i;  2NVX H;  4KJO A;  4PNY A;  4B3S Q;  2IPK D;  1HNW L;  4OO1 G;  1CT1 D;  1YI2 A;  4HED A;  4QF4 A;  1XNR Q;  2UUB L;  2BA1 A;  3GD7 A;  1H9M A;  2Y0S E;  4LF8 L;  4FNF A;  3AYH B;  1B50 A;  3MC0 B;  3HOW G;  2AUK A;  3S16 H;  1TS4 A;  1NTG A;  1B44 D;  1SNP A;  4JI6 L;  2FIN B;  5M5X H;  1VQ5 A;  4UP7 A;  3TZD A;  4X62 L;  4BY7 G;  4DV1 Q;  1CA5 A;  1PVO A;  2EPB A;  1NMG A;  1C9O A;  1ZKO A;  3RLO A;  3J81 E;  5J1Z A;  2CFM A;  4XYO A;  1BQQ T;  1DOK A;  1EY0 A;  1JB3 A;  2MP1 A;  4JBW A;  4RG1 A;  4XDX A;  2H1E A;  1S4Z A;  2JA7 B;  3ITP A;  3M7G A;  1IXR A;  2OT2 A;  2NUC A;  4A3I B;  2EYO A;  1WYD A;  3NWS A;  4JOI C;  4NB3 A;  3GTK B;  1STB A;  2Y0S B;  2Q2T A;  2JA5 G;  1GXD C;  3PSI A;  2Q8T A;  4DAY A;  3C46 A;  1XTC D;  2QIL A;  4KHZ A;  1TWF H;  1VQH A;  1WTX A;  2FXQ A;  2DJF C;  4LK1 C;  4JI6 Q;  2M9V A;  3DM1 A;  3J80 c;  4JC0 A;  2XVS A;  1UNS A;  1SFO H;  4A3L H;  4QMG A;  1IBK Q;  1Q81 C;  3ERQ A;  4KY7 A;  1XJV A;  3ULL A;  2F1M A;  3PIP 3;  3M4O B;  1ROD A;  5CV6 A;  3P7J A;  4HIO A;  2E5L Q;  5IGG A;  1NMF A;  1JE5 A;  4FXK C;  2UXC L;  1Y1W B;  2F0V A;  4OGQ C;  4IO9 A;  2A69 D;  4JI1 L;  4LUV A;  4B3R Q;  1TXY A;  2EY2 A;  5JJI A;  2XRQ D;  1A3V A;  5HUR A;  1C8C A;  4POG A;  1I4Q A;  2XIW A;  1E3P A;  4MHE A;  4CKC A;  3KF6 A;  4NMZ A;  1NE3 A;  1SYC A;  3T4A C;  2R92 B;  2AQ2 B;  3IFT A;  2NVQ H;  1VS0 A;  3NTI A;  3C2P A;  3EN2 A;  4KY5 A;  5JOB A;  1RKN A;  1GHJ A;  2CH4 A;  1X54 A;  3BVM A;  1VQP A;  3G4S A;  3EIV A;  4KMU C;  3Q6S A;  4IQZ A;  4PZ8 A;  1JC7 A;  1DOM A;  2ID0 A;  2D62 A;  2JA9 A;  2AQ1 B;  2B39 A;  4C1N I;  1R4P B;  2IW3 A;  1A0I A;  5JVH 3;  3PF4 A;  1PMR A;  5C0X H;  4KN7 C;  2XSC A;  3GO5 A;  3PQI A;  3TP5 A;  1K73 C;  4CDE C;  2ES2 A;  3U9S A;  4QJF A;  1N36 L;  1YHB A;  2R93 H;  1Z9F A;  1IKM A;  1PV4 A;  1WTV A;  3BYY B;  5FO9 B;  4OXP A;  1DD2 A;  1YIJ A;  2PW7 A;  3A74 A;  4GLA C;  3KOJ A;  2HT1 A;  4HJA A;  1HA5 A;  1TWG H;  1VQ6 A;  5FLX c;  3S1N B;  3LWU A;  1W6K A;  2HUG A;  4A3G G;  1GUW A;  3PIP A;  5GAD C;  2K7V A;  2MGS A;  2F0Q A;  2A73 B;  3BYT B;  2FJ2 A;  2M00 A;  1Q1E A;  1K8G A;  4FDB A;  3W1G A;  3X3M A;  1SMX A;  2OCE A;  2Z9H A;  2VB2 X;  1RCV D;  2E2I B;  3I70 A;  5HGQ A;  2QKI C;  1UWV A;  3D6W A;  3I90 A;  5EPJ A;  2Q8I B;  1HUM A;  2K28 A;  3FP9 A;  3TBI B;  3C3L A;  5IGF A;  4K6D A;  1D1K A;  1PH9 A;  2PO4 A;  1BBW A;  1J8I A;  1K3B C;  4YWK A;  3GTL B;  2A68 D;  1T5X D;  5J22 A;  1HNX Q;  3S15 B;  1CKO A;  3WDN A;  4IFD I;  4UP8 A;  1A62 A;  5M5Y B;  1X32 A;  4JCV E;  1MI2 A;  5GRO A;  2PYK A;  1IW7 C;  2QEJ C;  3C1E A;  1BO0 A;  1SNO A;  1RDP D;  1S5F D;  1VQI A;  1QB5 D;  3OHX C;  5FOB B;  4A75 A;  2QCP X;  1ILP A;  1WJJ A;  1B8A A;  2OF1 A;  3S1R B;  3LNN A;  3K7A H;  1XMO Q;  4K5X A;  3RNU A;  3FDT A;  1K83 B;  4H7B A;  5AFW A;  3Q22 A;  1SRU A;  1A63 A;  1PYS B;  1NBW A;  1SXT A;  4P72 A;  4R4C A;  4QCL A;  4TRD A;  1SE3 A;  2PNR C;  5IYC G;  3TN2 A;  1TKW B;  2K03 A;  2Z6K C;  5FLM G;  3DWQ A;  2J0T D;  5LMU L;  1EYC A;  2B8G A;  2EYJ A;  5FJ8 H;  1AE3 A;  5C5L A;  4EQN A;  3D0F A;  2EYP A;  3GTG B;  2AWO A;  2KUM A;  2NN6 I;  3HOY G;  5K5P A;  1LTT D;  4HSP A;  1I4G A;  1V1P B;  2WB1 G;  4A3C G;  4OIK A;  4PZ7 A;  3MFG A;  1YVC A;  1WFQ A;  1TY0 A;  3HOW B;  1LUZ A;  2NVY B;  2V1C C;  4BY7 B;  1PXU A;  1ZXT A;  4HJ8 A;  3PO3 H;  3SK4 A;  4C3H G;  2AUJ D;  3CKI B;  1E2Z A;  1TVX A;  3NSW A;  4WJ4 A;  5EGT A;  1CFM A;  3LX0 A;  4ABN A;  1NR4 A;  5IP9 G;  4OWW B;  4XYQ A;  3M3Y H;  2PMZ B;  5GAE C;  3E0E A;  5LMU Q;  2PZW A;  1TS3 A;  4AQY L;  2ZJQ A;  3GTO H;  4OL7 A;  4KHP L;  3VR6 A;  4MTN A;  1FNW A;  4DXG A;  3S2H B;  5KIX A;  1L1O A;  4DN4 M;  4OWX B;  4JI0 L;  2BDO A;  2PQA A;  2JP1 A;  3QJY A;  1NNX A;  2EJF C;  3PO2 G;  2JA5 B;  1EWH A;  2ALY B;  4IUV A;  1XNQ Q;  2PQE A;  1HJP A;  4LUZ A;  2LKV A;  1MJE A;  2YTY A;  3R93 A;  3NK9 A;  5E1F A;  1CI3 M;  3I4M G;  1X3P A;  1FGB D;  5M9O A;  5FKA C;  2VQE L;  2B2T C;  3KDF A;  1NAP A;  1QE6 A;  3TP8 A;  3BDC A;  2SEB D;  3UDF A;  3PUZ A;  4KLK A;  1AH9 A;  1ESF A;  3VDY A;  4LF9 Q;  3TP6 A;  1K8A C;  2IT1 A;  2EQS A;  4DK6 C;  4KHP Q;  3A55 A;  2YU9 H;  1DYQ A;  3E3X A;  1PFS A;  1EOT A;  4NXN L;  1M8A A;  3DWA A;  3SXH A;  1IL8 A;  5BN5 A;  4DR2 Q;  4EQP A;  3CCM A;  1P8L A;  4A3E G;  5EBC A;  4QGU A;  4JI5 L;  2NVT B;  2DN8 A;  3KYH C;  1ET9 A;  3NTK A;  4LFB L;  2KCN A;  2K5V A;  4A3J G;  3BDO A;  2A19 A;  1BF4 A;  1YNX A;  3L3O C;  1NSN S;  3V96 A;  5GQO A;  1B9M A;  4BXX H;  1R4Q B;  1D6E C;  4YCW A;  5I2X A;  3UDX A;  1VQO A;  1TR5 A;  1XTD A;  4A76 A;  1YJ9 A;  2B2W A;  4O1N A;  2ICE C;  3AU7 A;  4PG3 A;  2VB3 X;  1H9S A;  1YBY A;  4A3G B;  2LMC B;  1UE1 A;  3G6J B;  4RGT A;  3H6M A;  5A35 A;  2F0L A;  1O7Z A;  4V0B A;  4DV2 L;  3MWY W;  1A15 A;  3T1H L;  1YNN C;  2C5C A;  4L8J A;  2RHS B;  2F0G A;  4L5S A; 
#chains in the Genus database with same CATH homology
 2IHE A;  4X64 L;  4ALP A;  4TQU S;  1HR0 Q;  2AMC B;  1PH4 A;  1EIF A;  1MIU A;  2I5M X;  4XIG S;  2VZA A;  3KFU A;  4DK3 C;  1VQF A;  4WJ3 M;  1JJG A;  1B7Y B;  3J81 c;  2UUA Q;  4P71 A;  4X62 Q;  2MO1 A;  2YYZ A;  1VQ9 A;  2UU9 Q;  1XNQ L;  3STB D;  2R7F A;  4YWL A;  2N49 A;  1VQE A;  2BA0 A;  4HJ9 A;  3GTJ H;  1CKM A;  2KCM A;  3BZK A;  4BBR H;  2JEA I;  1FJG L;  3BJU A;  1KAW A;  4YY3 L;  1E24 A;  4DV3 L;  4JI3 Q;  4A3G H;  2I5L X;  2VUM G;  1Z47 A;  2DGY A;  5IY0 A;  3RLF A;  4C3J H;  2VY3 A;  4UP9 A;  4A3K G;  4LWC A;  4GLX A;  4A3M G;  3TRZ A;  4YWM A;  3GTM H;  3I55 A;  3CXC A;  3S14 H;  3I4N H;  3IRB A;  1S40 A;  3S1Q H;  4P75 A;  1GKH A;  3AFP A;  2C35 B;  1IYJ B;  5IYD G;  5AJ3 L;  4DV2 Q;  4GOP B;  1JJ2 A;  4LF9 L;  3T1H Q;  2B63 G;  2EXD A;  3B6Y A;  1E22 A;  3F8T A;  2GVA A;  2E2H H;  3CAM A;  4OON A;  2AWN A;  2WB1 E;  1B70 B;  4R4Q A;  4X64 Q;  1GO3 E;  3HKZ E;  1X55 A;  4JV5 Q;  1Y1V G;  4A3L G;  4Y7N H;  1IBM Q;  1CKN A;  3I4O A;  3S24 A;  3TRE A;  3OTO L;  2VQF L;  2JA8 H;  2YV5 A;  3BU2 A;  4A3B G;  4DR2 L;  2A1A A;  2F4V Q;  2LXK A;  3CPW A;  3W5O A;  4DUZ Q;  1HH2 P;  3G71 A;  2HIX A;  1N8R C;  5M3F H;  4IOA A;  1QVC A;  4B3S L;  1EQR A;  1TWH H;  3PGZ A;  1FJG Q;  4YY3 Q;  2OQ0 A;  4DV0 L;  2RHQ B;  1U0L A;  1XNR L;  1DGS A;  2JA7 G;  1UE7 A;  4KI0 A;  2RCN A;  2UXC Q;  3K80 C;  3CQZ H;  4JI1 Q;  4GKK Q;  3CP0 A;  2VW9 A;  2KBN A;  2JJQ A;  1WCM H;  3T1Y Q;  2JK8 A;  5C0X I;  4HIM A;  2I0Q A;  2HIV A;  4QIW E;  3WWV A;  1N33 L;  3H0G G;  3ICE A;  2OTL A;  1PH6 A;  4QY7 A;  4NPS A;  4A3J H;  3TS2 A;  2F52 A;  4R1J A;  2ZTC A;  4A4I A;  5C3E G;  2QEX A;  4DV1 L;  1C7Y A;  3S1M H;  1Q7Y C;  4OO1 I;  1I94 L;  1AE2 A;  2WP8 J;  1EFW A;  5JJK A;  1GM5 A;  1X9N A;  2JE6 I;  1KC8 C;  2L15 A;  1G6P A;  3PO3 G;  3OYY A;  1VCI A;  1M1K C;  4DR5 Q;  1MJC A;  2RF4 A;  5C4X H;  5C44 H;  1XPR A;  4O2D A;  2K5N A;  2VQF Q;  2PQA B;  3CCJ A;  1EIY B;  2K4K A;  5IWA L;  4GN5 A;  1KRT A;  3CCL A;  1QUQ A;  1K0R A;  1E1T A;  3JC6 6;  4HID A;  5LMN L;  1YEZ A;  3JAM i;  5C0X G;  3F1Z A;  2PI2 A;  2PNH A;  5IYC H;  3KJO A;  2NVX H;  1LTL A;  2I5H A;  4DR1 Q;  4B3S Q;  3CCQ A;  1HNW L;  2D0P A;  1W3S A;  3CF5 A;  4OO1 G;  3U4V A;  1YI2 A;  5FLM H;  1XNR Q;  1QZG A;  4JG2 A;  3PIO A;  2UUB L;  4P73 A;  2BA1 A;  3GD7 A;  2Y0S E;  3HOX H;  3KDF B;  1J5E L;  1G29 1;  4JI4 L;  1N36 Q;  4LF8 L;  3AYH B;  3HOU G;  4ME3 A;  2KHI A;  1J6Q A;  4BY1 H;  3HOW G;  3S16 H;  4BBS G;  1NTG A;  1XPU A;  2VNU D;  4JI6 L;  5M5X H;  5M3M G;  3KF8 B;  4X65 Q;  4GNX C;  1JMC A;  4LF5 L;  1VQ5 A;  3HOY H;  3RZO H;  4UP7 A;  2UUA L;  4X62 L;  1JB7 A;  4BY7 G;  4HJ5 A;  1CSQ A;  4DV1 Q;  2KEN A;  4IPC A;  1XMQ L;  2UU9 L;  4A3C H;  1I94 Q;  1HZ9 A;  1L0W A;  4DUY L;  1V43 A;  1SE8 A;  1PVO A;  1NMG A;  1C9O A;  4GKJ Q;  3RLO A;  3M7N A;  2N78 A;  3S17 H;  4LNQ A;  1UEB A;  3FKI H;  2CFM A;  5IP7 G;  5ELO A;  3TQY A;  4JBW A;  4RG1 A;  3A5U A;  3A5Z B;  2CQO A;  1QUQ B;  4L5Q A;  4C3H H;  5BR8 L;  5LMN Q;  3CC2 A;  2VUM H;  4GLV B;  3S2D H;  1X3G A;  1IXR A;  1WYD A;  4JOI C;  4NB3 A;  1EUJ A;  5IP9 H;  2Q2T A;  2JA5 G;  3PSI A;  2UXD Q;  4QL5 A;  1E1O A;  1GD7 A;  2Z0S A;  4GS3 A;  4KHZ A;  3HOV G;  1TWF H;  3ERS X;  1VQH A;  2N3S A;  2BH8 A;  4JV5 L;  2Q2U A;  2FXQ A;  3KJP A;  4JI6 Q;  1IBM L;  4LF5 Q;  3EBE A;  3J80 c;  3J81 i;  4JC0 A;  4JBJ A;  4IFD J;  1SFO H;  4YHH L;  1VQG A;  1XMQ Q;  2F4V L;  4A3L H;  2K50 A;  3PO2 H;  4YCU A;  4DUZ L;  1IBK Q;  3L0O A;  4DUY Q;  4A3B H;  3NEM A;  1SLJ A;  1Q81 C;  2OTJ A;  3CCR A;  1XJV A;  3ULL A;  3I56 A;  1KIX A;  4HIO A;  2E5L Q;  1NMF A;  1Q12 A;  4JBM A;  1Q8K A;  1P16 A;  1OXT A;  3PV0 A;  1JE5 A;  1H95 A;  3I4M H;  2UXC L;  3H3V H;  3CW2 C;  4IO9 A;  5JEA J;  4JI1 L;  4GKK L;  1LM0 A;  4LUV A;  3T1Y L;  2JA7 H;  5BR8 Q;  1TXY A;  4J15 A;  4B3R Q;  3HFZ B;  5JJI A;  4DV6 Q;  3K8A A;  3RN5 A;  4GNX A;  2QGQ A;  1D7Q A;  4POG A;  4A3I H;  1E3P A;  4IPD A;  4AYB G;  1CSP A;  4OWT B;  3GTK H;  5IYB H;  3KF6 A;  4IJL A;  3H0G H;  1NE3 A;  4OX9 L;  1BBU A;  2NVQ H;  1VS0 A;  5C3E H;  1SR3 A;  2JA6 H;  1KRS A;  3EN2 A;  4DAY B;  4DR5 L;  3L7Z C;  2MNA A;  1QVG A;  1SRO A;  3BZC A;  2D0O A;  1U5K A;  1X65 A;  1MKH A;  3L2P A;  1X54 A;  2CCZ A;  2EIF A;  1VQP A;  4AH6 A;  3G4S A;  4YHH Q;  1KL9 A;  3EIV A;  4PZ8 A;  1GVP A;  2YTX A;  4DNI A;  3F2B A;  3M4O H;  2JA9 A;  2ID0 A;  2D62 A;  1OTC A;  4R4T A;  4A3E H;  1A0I A;  4XTC S;  4DR1 L;  1VQL A;  5FJ8 G;  3PF4 A;  5H1S E;  4MZ9 A;  4O0A A;  4A93 G;  4JOI A;  3GO5 A;  1K73 C;  1Y1W H;  2ES2 A;  4A3F H;  3CCU A;  4K0K Q;  4QJF A;  4DV4 L;  1N36 L;  2R7Z G;  1YHB A;  3AQQ A;  2R93 H;  1Z9F A;  2E2J H;  4C2M H;  2MO0 A;  1SN8 A;  2CWA A;  4RMF A;  1PV4 A;  4PMW A;  1PH2 A;  3U58 A;  4X65 L;  1KQS A;  4OXP A;  3CPF A;  2F3I A;  2K75 A;  2ZTE A;  3M9B A;  4LF4 Q;  4LFA Q;  1VQA A;  1YIJ A;  3I7F A;  2R92 H;  1EOV A;  3CCV A;  4DAM A;  3A74 A;  4OX9 Q;  3ER0 A;  3NEL A;  4GLA C;  3KOJ A;  4BBR G;  4HJA A;  2HT1 A;  3ZJY C;  2IHF A;  4GKJ L;  1TWG H;  1K3R A;  1VQ6 A;  5FLX c;  1BVS A;  1VQ8 A;  1KHI A;  3A0J A;  4UY8 C;  4A3G G;  2ZM6 L;  3PIP A;  5GAD C;  3KLW A;  3PUW A;  1X56 A;  1CKN B;  2JEB I;  1VQJ A;  2E8G A;  1PH5 A;  1X3E A;  5IP7 H;  3HOZ H;  4DR4 Q;  1KD1 C;  3MXN B;  3I4N G;  5JJL A;  5ELN A;  1Q1E A;  1K8G A;  1PA6 A;  3AEV A;  4QQB X;  4FDB A;  1JJC B;  3W1G A;  1SMX A;  2OCE A;  4GOP C;  2PI2 E;  2Q2H A;  1IBL L;  1XPO A;  3D31 A;  4AQY Q;  4P74 A;  3AFQ A;  2UUC Q;  2WAQ G;  3RLN A;  3STB C;  1VQD A;  5HGQ A;  2LXJ A;  3RR5 A;  2UXD L;  1OXS C;  1UWV A;  2KCT A;  4DV4 Q;  4A3D G;  3FP9 A;  2JA8 G;  1HZA A;  2GVB A;  4JI8 L;  3CME A;  4JI0 Q;  4H02 A;  2OWO A;  1VQ7 A;  1L2F A;  3HOV H;  3CMA A;  1PYB A;  2CKZ B;  2IX0 A;  5DLQ E;  1PH9 A;  1TWC H;  5M3F G;  1ASY A;  1JT8 A;  2B29 A;  4DKA C;  1BBW A;  3CC4 A;  3NEN A;  1IBK L;  1FL0 A;  3S1N H;  4YWK A;  1VQK A;  3J7Z C;  4POF A;  4EQ5 A;  1HNX Q;  1CKO A;  3M4P A;  4UP8 A;  1A62 A;  2E5L L;  2ATW A;  4IFD I;  4JCV E;  5C0X J;  2IY5 B;  1PH3 A;  2XTI A;  2VQE Q;  2ZM6 Q;  5GRO A;  4NXM Q;  1IL2 A;  1WCM G;  5IE8 A;  4JYA Q;  3LGJ A;  4B3R L;  1VQI A;  2LSS A;  2ZTD A;  4DV6 L;  1I6H H;  4A75 A;  1HZB A;  3M4Q A;  4APV A;  2E2I H;  1BKB A;  1B8A A;  1WJJ A;  2K5H A;  2MFI A;  4A3K H;  1PH8 A;  1IBL Q;  3K7A H;  2R7D A;  1I50 H;  4A3M H;  1XMO Q;  4LW1 A;  1N9W A;  3RNU A;  2BH2 A;  5C4X G;  3GDE A;  5IYD H;  1L1O C;  2VL6 A;  1QVF A;  3W1B A;  1SRU A;  2B63 H;  4JI8 Q;  1Q1B A;  4IFD G;  1A63 A;  3UE1 A;  1PYS B;  1NBW A;  1S3O A;  1YHA A;  4GN3 B;  4P72 A;  4R4C A;  3UDI A;  5GAG C;  4LF7 L;  4NXN Q;  3PUY A;  5LMN W;  4JI2 L;  3J80 i;  4HIK A;  1N34 L;  5IYC G;  3RN2 A;  1Y1V H;  2N8N A;  4YCV A;  3GTL H;  3S15 H;  1S72 A;  3M85 A;  5HY6 A;  4JI5 Q;  1N32 Q;  2Z6K C;  1YHQ A;  5M5Y H;  5GAH C;  5FLM G;  4DR3 Q;  4GOP A;  2K52 A;  5LMU L;  5JEA G;  1RIP A;  1HR0 W;  5FJ8 H;  1AE3 A;  4B3T L;  4LF6 Q;  3D0F A;  3SGI A;  4K0K L;  4LFB Q;  2UXB Q;  1O7I A;  2AWO A;  2NN6 I;  3UE0 A;  3ULP A;  3HOY G;  1OXX K;  3S1R H;  2DUD A;  4B3M L;  2R7Z H;  2WB1 G;  4A3C G;  1TWA H;  1Q46 A;  4LF4 L;  4PZ7 A;  3HKZ G;  4LFA L;  4BXX G;  3CCE A;  1YVC A;  3OW2 A;  1I3Q H;  1K83 H;  1FGU A;  1WFQ A;  5IT9 c;  5J3B A;  1LUZ A;  4HJ7 A;  1X3F A;  3PUX A;  2V1C C;  3FKI G;  1YJN A;  4DR7 Q;  1PH7 A;  1X6O A;  4X66 Q;  4LFC L;  4HJ8 A;  3PO3 H;  4LF7 Q;  4JI2 Q;  3NBH B;  4DV7 L;  3H3V I;  1YIT A;  1N34 Q;  2NN6 G;  3F2C A;  4DPG A;  4DR4 L;  4IOC A;  2OQK A;  4WJ4 A;  1VQN A;  4IPG A;  1IZ6 A;  2ZJR A;  2KHJ A;  4OWW B;  5IP9 G;  1RL2 A;  3M3Y H;  2CWP A;  1D8L A;  3E0E A;  3K7U C;  5GAE C;  3K0X A;  5LMU Q;  4AQY L;  2UUC L;  2ZJQ A;  1K9M C;  3GTO H;  3GTG H;  4DV5 Q;  4B3T Q;  1LYL A;  4KHP L;  4MTN A;  4DV7 Q;  4JBK A;  1A8V A;  1L1O A;  3J81 j;  4AYB E;  4IJH A;  1Q82 C;  4OWX B;  2H5X A;  4JI0 L;  3GTP H;  2PQA A;  4B3M Q;  3HOU H;  4A3D H;  3PO2 G;  2A8V A;  3HOW H;  4GNX B;  4BBS H;  2ALY B;  1OXU A;  2NVY H;  2B3G A;  2R6G A;  5M3M H;  2ZJP A;  1XNQ Q;  1HJP A;  2IX1 A;  1VQ4 A;  3KF6 B;  3H15 A;  3DM3 A;  4AIM A;  4LUZ A;  4IPH A;  2Z6K A;  2QA4 A;  3GTQ H;  4BY7 H;  1MJE A;  2YTY A;  1HNX L;  3I4M G;  1I5F A;  3Q8D A;  4LFC Q;  2HHH L;  2VQE L;  4DR6 L;  3CC7 A;  3KDF A;  4PZ6 A;  1OXV A;  4NXM L;  1UE5 A;  3ULJ A;  3G6E A;  4DV3 Q;  3UDG A;  4JYA L;  1UE6 A;  3HKS A;  1CUK A;  4L5T A;  5E7N A;  4A3I G;  3RZD H;  1EYG A;  1EQQ A;  5IYB G;  1FVI A;  3PUZ A;  3UDF A;  4TVA B;  2Y0S G;  1G51 A;  2MQH A;  1HZC A;  4KLK A;  5K36 G;  1AH9 A;  4X6A H;  1HNZ L;  5AJ3 Q;  3VDY A;  4LF9 Q;  2JA6 G;  1XMO L;  1K8A C;  3S2H H;  2IT1 A;  1M90 C;  2EQS A;  1PHJ A;  2XGT A;  4DK6 C;  2NZH A;  1VQM A;  4JI7 L;  4KHP Q;  1C0A A;  2K14 A;  3DLL A;  3FHW A;  3TS0 A;  1ASZ A;  2YU9 H;  1L1O B;  1PFS A;  2JA5 H;  4GN4 B;  4NXN L;  1NY4 A;  1V1Q A;  3OTO Q;  1R9T H;  4DR2 Q;  3J7A 5;  4L5R C;  3CCM A;  1P8L A;  4A3E G;  1WI5 A;  1WOC A;  1VQC A;  4BA2 I;  4QGU A;  3K81 C;  3U50 C;  3JAM c;  4JI5 L;  1N32 L;  1Y1W G;  4DR3 L;  2YTV A;  4A3F G;  2JQO A;  4BA1 I;  1E7Z A;  4UPA A;  3KYH C;  3E9I A;  2R93 G;  2VS1 A;  4DV0 Q;  2HHH Q;  1V9P A;  4DR6 Q;  3F2D A;  1VQB A;  4LF6 L;  4LFB L;  1QZH A;  2UXB L;  3TEH B;  1KXL A;  4EX5 A;  1HR0 L;  2K5V A;  2Q2I A;  4A3J G;  1N33 Q;  2R92 G;  2A19 A;  2WAQ E;  1YNX A;  2HQL A;  5C4J H;  2AKW B;  1HNZ Q;  3PCO B;  5GQO A;  1Q86 C;  2ASB A;  1EWI A;  4BXX H;  3PUV A;  1PH1 A;  4JI7 Q;  5C44 G;  3CD6 A;  4DR7 L;  4YCW A;  2AHO B;  2GN5 A;  4R4I A;  3UDX A;  4X66 L;  5M5W H;  3PF5 A;  1Y14 B;  4LUO A;  1VQO A;  1XTD A;  4A76 A;  4C3I H;  1YJ9 A;  3G48 A;  3CCS A;  3HOZ G;  1W2B A;  4PG3 A;  5IWA Q;  4JI3 L;  3I2Z A;  4MNO A;  1NJI C;  1YBY A;  3U4Z A;  1T9H A;  2NZO A;  2NVT H;  1UE1 A;  2WFW A;  4R4O A;  3HOX G;  1HNW Q;  4DV2 L;  2PMZ E;  1YJW A;  4Y52 H;  3T1H L;  1YZ6 A;  4BY1 G;  2UUB Q;  4DV5 L;  3MEF A;  5EAY A;  1J5E Q;  2RHS B;  4LF8 Q;  4A93 H;  4JI4 Q;  3E9H A;  4L5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...