1X3FA

Crystal structure of the single-stranded dna-binding protein from mycobacterium smegmatis
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
118
structure length
107
Chain Sequence
GDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRGEALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVEVEVDEIGPSLRYATAKVNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-strand binding protein
publication title Structure of Mycobacterium smegmatis single-stranded DNA-binding protein and a comparative study involving homologus SSBs: biological implications of structural plasticity and variability in quaternary association.
pubmed doi rcsb
source organism Mycobacterium smegmatis
total genus 17
structure length 107
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1x3fA00
3BU2A 1KXLA 3CAMA 4C3IH 4DV2L 1Y1VH 2PMZE 1IXRA 2ZJQA 4X64Q 1Q1EA 4JI4L 2GVAA 4H02A 4KHPL 2Q2HA 4AH6A 3AYHB 3TEHB 2VY3A 3S2HH 4HJAA 4A3IG 1IBKQ 4UY8C 2QA4A 1YI2A 4BBSG 5IP7H 4YWKA 4LFCQ 3M85A 2BA1A 1Q46A 1E24A 1YIJA 1J6QA 3H3VI 4GLVB 1PH4A 2K5NA 3S16H 1I94L 2GN5A 4QIWE 4C3HH 1XPOA 1N9WA 2Z6KC 3HKSA 4Y52H 3W1GA 1XJVA 1MIUA 4DR6Q 4R4CA 1X65A 2F4VL 3GTKH 4RMFA 1FJGL 1KC8C 5LMNW 1S40A 5IYBH 1FL0A 2LXKA 3UDXA 1VQ6A 4DKAC 1AE3A 1VQDA 1YZ6A 2D62A 3MEFA 3PV0A 4A3FG 1NMFA 2OQ0A 1PH8A 1JMCA 4GLXA 3KJPA 2E8GA 3J81i 2E2JH 1VQHA 2N49A 1N33Q 2E2HH 4JCVE 4B3TQ 4BY7G 3CCQA 1VS0A 4B3RL 4YY3L 1X3EA 4WJ4A 1EQRA 2IHFA 4A3KH 1VQEA 4LFBQ 3G71A 4PMWA 3CMAA 3M4QA 5IWAQ 4KHZA 1VQMA 1QZHA 1TWHH 3J7A5 4JV5Q 4GOPC 5DLQE 4APVA 4GOPB 1B70B 1QVGA 4LF6L 1B7YB 4JG2A 3S2DH 3T1HL 1YJWA 4OO1G 3JC66 1X6OA 1V43A 3TRZA 3U4VA 3J80c 1JJ2A 1VQFA 4LFAQ 1QUQB 4PG3A 5FLMG 4BY1H 2VZAA 2UXCQ 2UUBQ 4DUZQ 3H0GH 1AE2A 3H15A 3HOZH 2UXBQ 1E22A 2F52A 3CCEA 1VCIA 4DAYB 4LF4L 1HH2P 2PI2A 1Y1WH 1EFWA 2ZJPA 1Q12A 1PV4A 1OXUA 1PFSA 4X65Q 3KF6B 2JK8A 3FKIG 4JI1L 2JA6G 4GKKQ 4LF7L 3PO2G 4GKJQ 3HOXG 4DR3L 3M4OH 1PYBA 1K8AC 1S3OA 3CCMA 5M3FG 5E7NA 2ALYB 3ZJYC 4NXNL 1Z9FA 2WP8J 4WJ3M 1KRSA 1A0IA 3BJUA 1XNQQ 2BH2A 4JI2L 1XTDA 2MO1A 4NPSA 1N8RC 2JEAI 2PQAA 4IPHA 3TS0A 2HIVA 3NELA 1IZ6A 4A3BG 1KRTA 3E0EA 3S1QH 3DLLA 1IBLL 4JI6Q 1QVCA 4DR7Q 3CC7A 3FKIH 3PO2H 4PZ6A 1I5FA 2WFWA 1YJ9A 1PYSB 5HY6A 1OXSC 2Z6KA 2OTLA 4JI7Q 5C44G 3OTOQ 1BBWA 4A3MH 1VQKA 1LTLA 3CCVA 4DV2Q 2ZTEA 3HOWG 3CCJA 1XNRL 2K52A 4LW1A 3CF5A 1AH9A 2IT1A 1V9PA 2AWNA 3KOJA 4P72A 2ZM6Q 4JI4Q 4KHPQ 4UP8A 2RF4A 3EBEA 2VQFL 3KJOA 3HKZE 4DV5Q 2VQEQ 3CP0A 4A3BH 4JI3L 4HJ8A 4DPGA 4IPDA 3NENA 3ULLA 2OCEA 3HFZB 1K83H 1YJNA 2VL6A 2BH8A 3BZCA 1OXVA 2MO0A 3F8TA 5BR8L 3GTPH 3HKZG 1UWVA 1XMQQ 1I94Q 1FGUA 1K8GA 4A3LG 4DR5L 4HIMA 2DUDA 4DR1L 1VQNA 3ER0A 1Q82C 4LUVA 3CC2A 1HNZQ 1B8AA 2D0PA 2KHJA 1G291 3S17H 1K9MC 3T1YL 1KQSA 2CWAA 2EIFA 1VQ5A 1J5EL 1VQJA 2E5LQ 1LUZA 1VQBA 4NXML 3NEMA 4BA1I 4GOPA 4NB3A 2F4VQ 3I2ZA 5EAYA 4BBRG 1FJGQ 3F2DA 2A8VA 1W2BA 1UEBA 3A5ZB 2I5HA 5ELOA 4HIKA 4DK6C 1KL9A 4QL5A 3Q8DA 4YHHL 1YVCA 4HJ9A 3KYHC 2MNAA 4JI5L 3A0JA 2PI2E 1QUQA 1U0LA 5LMNL 1HR0L 2N3SA 1X54A 1G51A 3GDEA 1JE5A 2B63H 5C3EG 1WI5A 1VQ9A 4YY3Q 5M5YH 2I0QA 4A75A 2UU9Q 2YTXA 2PQAB 2NVQH 3KF6A 1BKBA 1NMGA 1Y14B 1YEZA 1XMOL 3L2PA 3I4MH 3G48A 3GO5A 2ID0A 1EUJA 1VQCA 5GAEC 1I6HH 1K0RA 4LF6Q 2VNUD 2JA7G 2BA0A 2R7FA 4DUYL 3T1HQ 3GTJH 3J81c 3ICEA 3H3VH 2F3IA 2Q2IA 3I55A 5J3BA 1XPUA 3KDFA 4DR4Q 1E7ZA 1SMXA 4UP9A 2OQKA 2K5VA 5C3EH 2AMCB 4A3IH 1EOVA 4IPGA 1SROA 1JB7A 3UE0A 4BBSH 1MJEA 1HR0W 2V1CC 3RNUA 4JBJA 3RZDH 4LF8L 4JI1Q 2MQHA 3L7ZC 2Y0SG 3CCLA 4LF7Q 1BVSA 2R6GA 2ZTCA 4A3JG 1IBML 3CW2C 5AJ3L 4KLKA 4DV6L 1EQQA 1M1KC 3GTGH 3M7NA 4QY7A 2JA7H 2QEXA 1IL2A 1NY4A 4DV0L 1KD1C 4EQ5A 4JBKA 2R93G 2AHOB 4C2MH 4YWMA 1SFOH 1R9TH 5LMUQ 1N36L 3M3YH 2VUMG 4ALPA 2KHIA 4GN5A 1X3GA 1WCMG 4GNXC 4IOCA 2IX0A 4GNXB 1IBLQ 4A3FH 2YU9H 1HZBA 4DV3Q 1OTCA 1SN8A 1YBYA 5C4XG 4OWXB 3D0FA 4YCVA 2WB1E 2IX1A 4A93G 1Z47A 3WWVA 3STBC 4P75A 3JAMc 4BY7H 2VW9A 1QZGA 3PUXA 3K0XA 2CCZA 4TVAB 3TREA 3U50C 1P8LA 4POFA 4LUZA 4OWTB 4DNIA 4DV1L 2WB1G 2IHEA 1X9NA 2VQFQ 4DV4L 4LFCL 1WOCA 4DV7L 1Q8KA 2ASBA 2K50A 5GAGC 2HHHL 2RHQB 4KI0A 1WCMH 4QJFA 4JI8L 1UE1A 2GVBA 5BR8Q 1WFQA 3TS2A 2OTJA 4JC0A 4X62Q 1N34Q 3CMEA 1NJIC 1H95A 2JA8G 4J15A 2ZJRA 4AYBG 1PH3A 4XIGS 2R7ZG 3MXNB 4AIMA 5FLMH 4K0KL 4DR6L 3UDFA 3KDFB 2CKZB 4AQYL 1J5EQ 3K8AA 3S1NH 3I56A 3K81C 3EIVA 3F2CA 2FXQA 1VQPA 4NXMQ 2Q2TA 1X3FA 1VQLA 4JI0L 2XGTA 4LWCA 3K80C 2JA6H 4OONA 2UUAL 1I3QH 3HOXH 2UUCQ 2YTYA 1WJJA 3RN5A 2XTIA 1CSQA 5M3FH 1A62A 1EWIA 4DR2L 4JI5Q 5LMNQ 1HJPA 1LYLA 4FDBA 2I5MX 2ATWA 2KBNA 3ULJA 5M3MG 1KHIA 5M5WH 1YITA 2CQOA 4PZ8A 4TQUS 4L5RC 3PUVA 4YCUA 2R7ZH 2R7DA 1G6PA 3GD7A 4L5TA 3RLOA 4LNQA 3M4PA 2KCMA 5IWAL 4IO9A 4LF9L 1O7IA 1XMOQ 4JV5L 3PGZA 2AWOA 4PZ7A 1YNXA 2N8NA 5IP9G 3A5UA 3A74A 3PIOA 1Q7YC 5C44H 1VQAA 3PIPA 3ULPA 4O2DA 3HOWH 1HZAA 4JYAL 4R1JA 1EIYB 1LM0A 1GVPA 2UUBL 4JOIC 5M3MH 4A3GG 2UXBL 4B3SL 1TXYA 3D31A 4IJHA 5GAHC 3S24A 1PH7A 4A3CG 5JEAG 4Y7NH 4GNXA 2NVTH 4IFDI 1D7QA 2EQSA 2JA5G 4GKKL 4X65L 3S15H 4P73A 5IYCG 1SRUA 2AKWB 3HOYG 1P16A 2WAQE 5JEAJ 3U4ZA 4R4OA 3NBHB 2UXDL 1IBMQ 1VQ7A 1Y1VG 3CXCA 2IY5B 1XNQL 3STBD 1GD7A 5IE8A 1N32L 1NTGA 1Q86C 4A3LH 3S1RH 1HZ9A 4DV0Q 3PSIA 3RR5A 2WAQG 3VDYA 1ASYA 3DM3A 4B3RQ 2RCNA 1N36Q 1W3SA 1C0AA 4OX9L 3E9HA 4GN4B 4GS3A 4YWLA 1HZCA 2A1AA 4R4IA 4BBRH 3AFPA 4IJLA 1QVFA 3W1BA 1GM5A 2CFMA 2HQLA 1TWGH 4QQBX 3HOUG 3PUYA 3IRBA 3PCOB 5FLXc 2YYZA 1TWAH 3S14H 1E3PA 2PNHA 4BA2I 4O0AA 5C0XI 2JEBI 2ZM6L 3U58A 3M9BA 1PH2A 1HNWL 4POGA 2Y0SE 3UDGA 3FHWA 1HNXL 4DV1Q 2VQEL 4DV5L 1ASZA 5IYBG 4LF4Q 2R92G 4DV4Q 1PH5A 2K14A 1UE6A 3K7UC 4DV7Q 3ERSX 1M90C 2HHHQ 1NE3A 2YV5A 4JI8Q 4DR3Q 4L5SA 4C3JH 1XMQL 4DAMA 3BZKA 3HOUH 3GTOH 4NXNQ 5C4JH 3UDIA 4X66L 1UE5A 4JI2Q 3KF8B 1HNZL 4UP7A 4A3KG 1CSPA 3RZOH 4MZ9A 1JJGA 3PUWA 4LF5L 4K0KQ 1Q1BA 2E5LL 4BXXG 2K75A 5IY0A 4AQYQ 2KENA 2I5LX 3OYYA 2NVXH 4B3ML 1PH9A 2R92H 4GN3B 2DGYA 2ES2A 4JI0Q 1PVOA 4P71A 4A3JH 1C7YA 2UUAQ 1JT8A 3CD6A 5IT9c 4ME3A 4MTNA 4X64L 4JBMA 5GQOA 4JOIA 4DR2Q 1L1OC 1S72A 3CPFA 4BY1G 1XNRQ 1L1OB 2R93H 2NN6G 1CKMA 4A76A 3H0GG 1IBKL 2UU9L 3HOZG 4IOAA 3I7FA 1C9OA 2ZTDA 1L0WA 3PF4A 3S1MH 1DGSA 1BBUA 5FJ8G 1VQ8A 1Y1WG 2VUMH 4X6AH 4BXXH 1WYDA 2OWOA 4LF9Q 4JI3Q 1XPRA 4AYBE 1VQ4A 1OXTA 1T9HA 3G4SA 1CKNB 3L0OA 3TQYA 2KCTA 2D0OA 3GTLH 1PH1A 4HJ5A 1YHBA 5C4XH 2NN6I 1GO3E 1PA6A 1U5KA 3K7AH 4A93H 2QGQA 1A8VA 4DR5Q 4DR1Q 1SR3A 4JBWA 3CCUA 3PF5A 1I50H 4DR4L 4JYAQ 1SLJA 2MFIA 1PHJA 3T1YQ 2HIXA 2NZHA 3F2BA 4B3SQ 2Q2UA 1TWFH 5FJ8H 1SE8A 2H5XA 4P74A 3G6EA 4OO1I 1E1TA 2K4KA 4YCWA 5GADC 3PUZA 2K5HA 4YHHQ 2JJQA 4QGUA 4A3MG 2B29A 1K3RA 2UXDQ 1N33L 3J80i 2VS1A 3JAMi 1HR0Q 4B3TL 3PO3G 4L5QA 1FVIA 4DK3C 1N32Q 1RL2A 3CCRA 3EN2A 5LMUL 2JA8H 1V1QA 4LFBL 4OXPA 1CKOA 3J7ZC 3HOVG 1YHQA 3F1ZA 4EX5A 2RHSB 1D8LA 5K36G 1JJCB 1K73C 1KAWA 1CUKA 3AFQA 4MNOA 5GROA 5IYDG 4OX9Q 2HT1A 5HGQA 1MKHA 4IFDG 1Q81C 5JJIA 4GLAC 5JJLA 1GKHA 3CC4A 4DV3L 2L15A 4A3DG 4A3EG 3I4OA 1X56A 1EIFA 4UPAA 4DUYQ 2LXJA 5H1SE 4IFDJ 3J81j 4LFAL 3AEVA 5ELNA 3I4NG 3GTQH 2UXCL 3PO3H 3LGJA 2NVYH 1L2FA 3FP9A 1YHAA 4DUZL 2CWPA 3KFUA 3RLFA 1HNWQ 2JE6I 3HOVH 3SGIA 5M5XH 3AQQA 1HNXQ 4HJ7A 2JQOA 3UE1A 4GKJL 3RLNA 1A63A 1EYGA 2E2IH 5IYDH 2B3GA 4LF8Q 2Z0SA 3CCSA 3RN2A 1NBWA 4LUOA 1IYJB 3CQZH 1VQGA 1X55A 4RG1A 4A4IA 5IP9H 4OWWB 5AJ3Q 4DV6Q 3B6YA 3E9IA 4A3DH 1L1OA 4A3EH 3GTMH 4X62L 1N34L 1MJCA 1VQIA 2JA9A 4X66Q 2B63G 4HIOA 1VQOA 3I4NH 3KLWA 5C0XG 4A3GH 1TWCH 2N78A 5IP7G 2A19A 2YTVA 4IPCA 1RIPA 4LF5Q 3I4MG 4A3CH 1E1OA 3W5OA 3OW2A 4JI6L 1CKNA 3CPWA 4XTCS 4HIDA 4R4QA 4R4TA 2JA5H 4DR7L 2LSSA 1PH6A 1KIXA 5C0XJ 5IYCH 4B3MQ 5JJKA 2NZOA 2UUCL 1OXXK 2C35B 1UE7A 3HOYH 4JI7L 3OTOL 2EXDA
chains in the Genus database with same CATH superfamily
3BU2A 4C3IH 5IGDA 1FNUA 4JI4L 2F0UA 4AH6A 3TEHB 1JWMD 1PFBA 1Z6HA 4KN7C 4XT3B 1YI2A 2BA1A 1YIJA 1J6QA 1KAAA 5IOCA 1XPOA 4A3FB 2K28A 1B3AA 3HKSA 2EYLA 5JVH3 4R4CA 2R3ZA 2F0NA 5E4XA 5IYBH 3UDXA 4PQXA 2JP1A 4DKAC 4IALA 1YZ6A 2A74C 1HQRD 1JMCA 2E8GA 2E2JH 4MIUA 1VQHA 2RVLA 1KLUD 1N33Q 1B44D 4B3TQ 3CCQA 4B3RL 1CFMA 4WJ4A 1EQRA 1LTRD 1VQEA 2B2WC 3G71A 4KHZA 3QG1A 2EOTA 5DLQE 1WTQA 5I2YA 4JG2A 4OO1G 1YJWA 3SK5A 2FINB 5J39A 1JJ2A 5E4WC 3MXGA 5M3FB 4PG3A 5FLMG 4BY1H 2UXCQ 2NN6H 4CDCC 5CORA 5KGUA 4ZRZA 5FK9C 1VCIA 5M5WB 3OWEB 2JA8B 1HH2P 2PI2A 1Y1WH 1LV9A 2ZJPA 1PV4A 4GKKQ 1OXUA 1S5CD 4X65Q 4JI1L 4KKSA 1LTID 1K8AC 4FVMA 3CKIB 5E7NA 2WP8J 3VR3A 1V1OA 4WJ3M 1A0IA 1KRSA 3BJUA 1A15A 4KY6A 1UNSA 4IPHA 3Q23A 1V8QA 2L4NA 1ZEQX 3GTQB 2BE5D 3LWUA 2NVYB 1JORA 1TR5A 3E0EA 1NR2A 3N6RA 3FKIH 3S15B 3PO2H 4PZ6A 1I5FA 2WFWA 2PYKA 1PYSB 1OXSC 2Z6KA 5C44G 1BBWA 4KY7A 3CQZB 3CF5A 2J0TD 2IT1A 1V9PA 4KHPQ 2E2DC 1M4VA 1JB3A 4EGVA 3I70A 4DV5Q 1S5DD 2QILA 3CP0A 4L6TB 3H91A 4HJ8A 4DPGA 5CV7A 4HR7B 1K83H 1YJNA 2VL6A 2BH8A 1OXVA 4X3KA 1QOHA 1FGUA 1K8GA 1STAA 1U4RA 2DUDA 1VQNA 3Q22A 1PTOB 3S17H 4C3IB 3S14B 1K9MC 3T1YL 1B53A 1FYCA 1O7YA 1VQ5A 1LUZA 1VQBA 2B2YA 4NB3A 2WAQB 3F2DA 1UEBA 3FEWX 4HIKA 3CU7A 1B9MA 4YHHL 3WOEA 4TKOB 2PI2E 1HR0L 2AUJD 2SOBA 1X54A 1RTOA 2H1EA 2KOLA 4PNYA 1G51A 1AP0A 1JE5A 2MGSA 4YY3Q 4XT1B 2YTXA 3I90A 2NVQH 1NMGA 1XMOL 3RZOB 5C5LA 1Q8IA 4FXDA 2ID0A 4DFAA 4U68A 1RCVD 1LTBD 4DK0A 3J81c 1KTKA 1L0YB 4ZKCB 3I55A 3I73A 5J3BA 2E2JB 2AMCB 1JB7A 1IKMA 1SROA 1B4OA 3A8IE 1MJEA 1HR0W 3AU7A 1VF7A 1K28A 2FFKB 1LTTD 3NWSA 4ZYSA 1IBML 3GTGH 3CW2C 3M7NA 3D3RA 1QILA 1WTRA 1OO9B 3GTLB 1XXGA 5G3LF 2QEXA 1IL2A 4P2CB 4EQ5A 1D5MC 4C2MH 5C4XB 4YWMA 3DEPA 3VA7A 4Q5VA 1F9QA 3M3YH 1TKWB 2DNEA 2EYOA 4GN5A 1W6JA 4TSSA 1JWUD 2OEOA 4GNXC 2IX0A 5FOBB 1Y1WB 2YU9H 1OTCA 1XWEA 5EGTA 3Q0AA 3JAMc 3STBC 4BY7H 5I6YA 2CCZA 2Q8IB 4POFA 5FLXL 3J81L 2HD3A 2VQFQ 1SNDA 4DV4L 4DV7L 2ASBA 5GAGC 2HHHL 1D1KA 5EJWA 4IUNA 2Z8LA 4K2LA 4HCEA 3TS2A 1JOQA 1WTVA 1Y8NB 3CMEA 1H95A 2JA8G 1PH3A 2L11A 4K0KL 2XSCA 3F2CA 3EIVA 2Q2TA 3TBIB 2WKCA 2XGTA 4I7AA 1NNXA 1WJJA 1NUCA 5D3IB 3G6JB 1CSQA 1A62A 5D65A 1K83B 2K5QA 4JI5Q 5LMNQ 4FDBA 1D1IA 1LYLA 2EPBA 3ULJA 4A3EB 1KHIA 1MD2D 3PUVA 4BS9A 1DOMA 2Q8RE 1CHQD 5I2XA 3I4NB 1BQQT 1TWCB 1NCVA 2AWOA 2A6ED 4PZ7A 2JA5B 5IP9G 2X69A 1GUSA 3PIOA 3ULPA 3P75A 3PIPA 3J81E 3IAYA 3HOYB 1EIYB 2SNSA 2E75C 4A3GG 1PH7A 2HUGA 4Y7NH 2EQSA 4GKKL 4X65L 2NB0A 5IYCG 2NVQB 4V0BA 4G7OC 4XQNA 2WAQE 2XRQD 4C3IG 2IY5B 3CRKC 1NTGA 4R8NA 3FPPA 5EPKA 2WAQG 2A68D 2A5HA 3DM3A 1N36Q 1ENCA 2TSSA 3E9HA 4GN4B 1A2UA 4GS3A 4R4IA 3DWQA 1PDQA 1FR3A 1GUOA 1MI2A 4RFBA 1J9OA 1TWAH 2XWBB 3GTGB 4O0AA 1YNND 2E2HB 4ZCKA 1HNXL 3OW7A 4DV5L 5IYBG 2BE5C 3DUZA 1UE6A 1X3QA 2OF1A 2YV5A 3HS0C 2I46A 2EYHA 4DAMA 3BZKA 1H9JA 4ME5A 4NXNQ 2YU9B 4X66L 1UE5A 4JI2Q 4FYDA 3OHXC 1F9SA 3MEHA 4MZ9A 1AEXA 3SK6A 1KNEA 2ZT9C 1RD9D 4Q0FA 1HTPA 2K75A 3L9AX 5CYUA 4BY7B 3OYYA 2NVXH 1EWHA 4DA2A 4B3ML 5JVG3 1A2TA 2R92H 4RCNA 2DGYA 4JI0Q 1LT4D 2PO4A 4F87A 2E74C 2B2UC 5IT9c 4ME3A 5GQOA 4JOIA 4M1UB 1S72A 4BY1G 2NN6G 1SNCA 3PF4A 1BBUA 1VQ8A 1Y1WG 2VUMH 1WYDA 1B3QA 4JI3Q 4LF9Q 1HFGA 3S1QB 3BVZA 1U4LA 3TQYA 2KCTA 2D0OA 1AFPA 2A69C 1NAPA 1F2MA 1B1ZA 5DNFA 4HJ5A 4RAUC 2NN6I 4K6LA 4A93H 4JBWA 3CCUA 1I50H 4JYAQ 1SLJA 2Q8TA 1PHJA 1U9RA 4WJWA 2Q2UA 3K57A 5FJ8H 5KEEA 3G6EA 1JICA 4YCWA 4A3BB 2PQEA 2EE1A 2K5HA 2VS1A 1CZGA 1N32Q 1DCZA 2O4XA 3BS1A 3SEBA 4EX5A 1K73C 2OT2A 1KAWA 3Q6SA 4MNOA 1GKHA 3CC4A 4A3EG 1EIFA 2LXJA 5H1SE 1QNUA 3I4NG 3PO3H 4JPBW 3LGJA 2CWPA 3NQTA 1EEFD 2EY2A 1HNWQ 3V96A 3UE1A 3J80L 2CH4W 1EYGA 2E2IH 5IYDH 3I4MB 2Z0SA 3RN2A 4LUOA 1VQGA 3WDNA 1I6HB 5AJ3Q 2IX3A 1BUVT 4OEMB 2AQ2B 2R61A 1I4QA 4CJ0B 2PZWA 1EFID 2JA9A 3GTJB 1ESFA 3KLWA 2PZTA 5CV6A 1S5FD 1STYA 2A19A 2YTVA 4IPCA 4LF5Q 4FNFA 3OW2A 1EY7A 2D2CC 4XTCS 2K6AA 1LACA 3SDZA 4ZKBB 1UE7A 3OTOL 3RZDB 3EQLC 4DV2L 2ZXPA 4X64Q 3LX0A 2K5WA 1UUPA 2GVAA 4KJNA 3VR4A 3S2HH 4DAYA 2X6GA 1SFOB 1SJED 5C0XH 5I6WA 5IP7H 2F0KA 2F1MA 5CV5A 4ZK9B 4GLVB 3H6MA 1N9WA 4RHRA 2F0JA 1DOLA 2CHBD 3J80E 3W1GA 3SK8A 1XJVA 1MIUA 1T5EA 2F4VL 1ZYRC 1FJGL 5LMNW 1WTOA 3MAQA 2RSOA 1BCPD 1BO0A 4FF2A 3PV0A 1EL0A 2A6EC 1Y8PB 1PH8A 3J81i 3NXWA 2WACA 2F0SA 4JCVE 2F0IA 4BY7G 4A3KH 4A93B 3X3MA 3M4QA 5DEHA 1STGA 4GOPC 1B70B 2LS01 1B7YB 1QNKA 4LMQD 3VYUA 1CA5A 1X6OA 3TRZA 1I3QB 3EVQA 1LABA 1VQFA 4LFAQ 2P5ZX 2PW5A 4DUZQ 3H0GH 1AE2A 2UUBQ 3H15A 3HOZH 1E22A 2PPBC 1I4XA 1PFSA 3KF6B 2JK8A 4LF7L 1GHKA 3M4OH 1PYBA 3NTHA 1TS2A 3CCMA 4NXNL 1R4PB 4C1NK 4TRDA 4JI2L 4NPSA 1A6XA 1YNNC 2L55A 1E0BA 3TS0A 2M9VA 1D6EC 3NELA 2X6LA 4IN3A 4A3BG 1KRTA 3DLLA 1QVCA 4DR7Q 1SYGA 1YJ9A 3BVGA 2E2IB 4JI7Q 1LTLA 5L37A 2ZTEA 2Z4IA 1AZPA 4P72A 4UP8A 2QKIC 4GZYC 4WORA 1EIGA 2VQEQ 1A3TA 4JI3L 4ZQ3A 1DJRD 3NENA 3ULLA 4V190 1STBA 5BR8L 1EOTA 5LL6S 5CBAE 1I94Q 1RTNA 3E5SA 3TP6A 3ER0A 2B2WA 1HNZQ 5G3LD 4ABNA 2EIFA 1JWSD 3NEMA 5E1FA 5EAYA 3A5ZB 3FRPB 3Q8DA 3DHQA 1RODA 3A0JA 3BG3A 1U0LA 4C3JB 3W3AA 2HQEA 2DN8A 3HOUB 1SMYD 5DM73 2B63H 4X3SA 1WI5A 1VQ9A 1E2VA 4DXFA 5M5YH 2UU9Q 2AUKA 3KF6A 1Y14B 1V1PB 4QUCA 3L2PA 3G48A 3GO5A 2PCFB 1EUJA 1VQCA 5GAEC 1K0RA 2QCPX 4LF6Q 1IHZA 4NP5A 3T1HQ 3ICEA 4HTHA 4F88A 1SNOA 3EFXD 3KDFA 2EZVA 5C3EH 5JOBA 1EOVA 2HDMA 1WVLA 4BBSH 2V1CC 3S1MB 1E2ZA 2PW7A 2MQHA 3CCLA 2Y0SG 1WD1A 1E2WA 4MTKA 2ZTCA 5AJ3L 2NWGA 2WV6D 2JA7H 3DXJC 3C46A 4DV0L 1HXYD 5LL6X 1O7LA 2F0QA 3SHLA 2MUYA 5LMUQ 1R9TH 5NUCA 1CQVA 2PNRC 4XQQA 1LTGD 5J22A 4N9PA 2VUMG 2CVRA 4ALPA 2K1BA 3HOZB 4HN7A 4K8IA 5JJZA 4GNXB 5M9OA 1IBLQ 1TWFB 4MHEA 1QG7A 4HCSA 4DV3Q 1SN8A 1C4QA 4CJ2C 1GHJA 3NP8A 3DMUA 4A93G 1W6KA 1PTOD 3MHBA 1TS4A 2O2LD 1QZGA 4CKCA 3K0XA 4TVAB 3TREA 1P8LA 4DNIA 4DV1L 4KY5A 2IHEA 3URYA 1WOCA 3O13A 4OL7A 2EYFA 1K0SA 1MBYA 1GUWA 2JYOA 1WCMH 3NBHA 1T5XD 2V4DA 1EU4A 1WFQA 1NJIC 1D5XC 4DK1A 1V1PA 1BDOA 1S5ED 4J1MA 1BCPF 2CKZB 1IYVA 5LHY1 1J5EQ 1BBXC 3K8AA 4QCLA 4NXMQ 3HOVB 1X3FA 5EBDA 3GV3A 1VQLA 2JA6H 1X32A 1ICFB 3RN5A 1G91A 1SYEA 1EWIA 4DR2L 1HJPA 2ATWA 2L5TA 2F0WA 4PZ8A 4TQUS 3I72A 2R7ZH 1G6PA 2EY6A 4DF7A 3M4PA 2KCMA 1O7IA 4A3GB 2F4IA 3PGZA 4CHTB 3C1EA 3BZDB 3A5UA 3A74A 3P1HA 1SYBA 3CHBD 4J6HA 4N8FA 4OHJA 1HZAA 3HOWH 4R1JA 3GP7A 1ONLA 1LM0A 2UUBL 5M3MH 2Z6BA 2SDFA 4B3SL 3D31A 1D2BA 3S24A 4ID6A 5JEAG 4GNXA 2NVTH 4IFDI 1HRJA 3K6OA 5M5YB 2HCIA 4P73A 1CT1D 1JQYD 1P16A 1EEID 2F03A 4FF4A 5JAVA 4F7XA 3I3CA 3S1RH 1HZ9A 4QB4A 3PSIA 3RR5A 3VDYA 3H3VC 5C4ZA 2RCNA 1LT6D 2KJXA 4OX9L 1TQOA 2A1AA 4BBRH 4BBSB 4C3JG 1RKNA 2CFMA 3HOUG 3PUYA 4RH6A 5FLXc 2YYZA 4R8IA 5HGTA 5C0XI 2JEBI 3M9BA 4POGA 2RQXA 1YNJC 2VQEL 3NHHA 2XNAC 1II3A 1PH5A 1BOSA 3C3LA 2K14A 2F0OA 3K7UC 5IIFA 4QIWB 1RJTA 3NE5B 3R2IA 4JI8Q 4L5SA 1ZXTA 4JK1C 1F2ZA 5TSSA 5C4JH 3QR8A 3TN2A 1HNZL 4A3KG 1EY0A 3PUWA 4BXXG 4BY1B 3ITPA 2TMPA 4AQYQ 2KENA 4KK7A 1LLRD 4XXEA 1PH9A 1DONA 3ZYYX 2BOSA 1U4PA 1QCBD 4A3JH 1C7YA 2A6HD 2UUAQ 3CD6A 2SNMA 3TSSA 4JBMA 2R93H 2RDFA 4M8AA 3H0GG 4A76A 2UU9L 3HOZG 1C9OA 1DGSA 2OWOA 1IKLA 1KLGD 3EJIA 2WINB 4CGYB 1CKNB 3L0OA 1GUGA 1LTSD 1YHBA 2JA6B 1ESRA 2H4OA 3FKIB 1GO3E 1PA6A 3OMCA 3PO2B 2QGQA 4DR5Q 4DR1Q 3SE0A 4ULLA 1GUNA 2K01A 2MFIA 4LK1C 2CW0D 5I4DA 3F2BA 3VR2A 1SE8A 2KA7A 1E1TA 3PMFA 1GJXA 5DAUA 4IUTA 5FKAC 1ICWA 3MC0B 2JJQA 1CTMA 4QGUA 3A8KE 2UXDQ 1N33L 4B3TL 4G57A 4L5QA 1FVIA 5LMUL 1V1QA 4OXPA 3HOVG 1HUMA 5K36G 2RHSB 1EQVA 3S17B 1JJCB 4N8X1 1J8IA 2HT1A 5GROA 2QW7A 4IUUA 4PMCA 4L63B 1MKHA 4RWSC 1Q81C 1PTOF 2NVTB 4DV3L 2L15A 1KDCA 5FLXE 4DUYQ 3J81j 3AEVA 2RDHA 1S5BD 2UXCL 3HKZB 4YIJA 2ZXOA 1YHAA 5K5PA 3KFUA 2JE6I 5M5XH 1BR9A 4HJ7A 2EY1A 3RLNA 4RKLA 4LF8Q 2B2UA 1X55A 2K05A 3H09A 4OWWB 4A3DH 4EVOA 3GTMH 1VQIA 5E3FA 1PTOC 2B63G 1F9PA 2OXPA 1QE6A 3M7GA 3OOCA 1JCKB 2N78A 5JPNC 4A3CH 1CKNA 3CPWA 4R4TA 3QOLA 1KIXA 2NZOA 2CQAA 2C35B 1SSOA 3T4AC 5IODA 3CAMA 3NQIA 1Y1VH 4KD3A 1IXRA 1CHPD 3FPUB 3K5OA 4KHPL 2Q2HA 5C4JB 1FNWA 5KNCA 4C2MB 4HJAA 1IBKQ 2QA4A 4UY8C 1UEAB 4BBSG 4YWKA 3ERQA 2MP1A 3M85A 4H13C 4LFCQ 1HQMC 1Q46A 3M3YB 1E24A 3HGBA 2M2LA 3S16H 2K5NA 4QIWE 4IZ8A 4H0LC 1PRTB 4Y52H 4A3JB 1EZ6A 4CDEC 4DR6Q 1X65A 3GTKH 2R93B 1KDBA 1KC8C 1O80A 1S40A 2LXKA 1PFNA 5KNDA 1VQDA 2OQ0A 4IURA 4JVZA 3KJPA 2A73B 5ELFA 4E6IA 4YY3L 1X3EA 5IGEA 4LFBQ 1HHVA 4PMWA 2BCOA 4DNTB 1VQMA 1QZHA 1TWHH 2B39A 3J7A5 4JV5Q 2BDNA 4GOPB 1QVGA 2WB1B 3P20A 3S2DH 3JC66 3U4VA 3J80c 2CH4A 4S3SA 4IUQA 3FMCA 5IGFA 1LT3D 1SXTA 1A3VA 4DAYB 1C8CA 1BF4A 5KIXA 1Q12A 5T1IA 3HZXA 3CRLC 2JA6G 3FKIG 1GXDC 4GKJQ 3PO2G 3HP3A 2IPKD 1S4ZA 2PZUA 2SEBD 1S3OA 2QDBA 3ZJYC 4OO1H 3D4DA 1XNQQ 2BH2A 2MO1A 3NUCA 2PQAA 1M8AA 1F2YA 3KLSA 2MJ8A 3R2TA 2EJMA 4JI6Q 3FVQA 4Y7NB 1G8ZD 3CC7A 5C4HA 4KKUA 5HY6A 2KUMA 2O5IC 2OTLA 4OELB 1VQKA 3HOWG 1WD0A 3VYSA 3MA2B 2K52A 4LW1A 5JPMC 1AH9A 2AWNA 4JI4Q 2ZM6Q 1PZJD 2RF4A 1SAPA 2VQFL 3HKZE 5A2QL 3AB9A 5IGBA 4IPDA 3HFZB 4IFDH 3GTPH 3K5MA 2MO0A 3HKZG 1UWVA 4RHSA 1O78A 2A6HC 3D4RA 4DR5L 4HIMA 4DR1L 1B8AA 2KHJA 1G291 1JOOA 1TWAB 2VB2X 4UAIA 2CWAA 2E5LQ 4GOPA 4BA1I 3Q24A 4BBRG 1W2BA 4DK6C 1KL9A 2I07B 4KV6A 1YVCA 2RSNA 3KYHC 2MNAA 4JI5L 3C1FA 3D6WA 1STNA 5LMNL 2XWJB 4MN3A 1X3PA 4LJZC 5BN4A 2I0QA 4A75A 1SE4A 1BKBA 1YEZA 2CW0C 2L9HA 4X3UA 2XRSD 3MWYW 2NVXB 5I9OA 3MXPA 4UDUC 2VNUD 2R92B 1KABA 1EY4A 2R7FA 4DUYL 3NTIA 3RMHA 2G9DA 2Y0SB 3H3VH 1RF2D 3K58A 5A2QE 1B2TA 1K3BC 1SMXA 2WKDA 2K5VA 4ZAIA 4A3IH 1ZKOA 5COYA 4LAAA 2F0PA 4LF8L 1Y69U 2EYPA 1LO5D 2VUMB 2O5JC 4JI1Q 3L7ZC 2R6GA 4A3JG 5CGKA 3MFYA 2M00A 4NKLA 1M1KC 1NY4A 4JBKA 2R93G 2MHVA 1N36L 1Q90A 1I4PA 5C5MA 1I50B 2NTSA 2KHIA 1WTWA 1X3GA 2GA4B 1ML0D 4IOCA 1JOKA 3IFTA 3DWPA 4A3FH 1HZBA 1CA6A 1H9RA 1YBYA 4OWXB 1L0XB 2WB1E 1TIID 4RKBA 1Z47A 1CM9A 2XN9C 3PUXA 3U50C 4HMIA 2A68C 4H7BA 4LUZA 4OWTB 5FO9B 5D3DA 2WB1G 2XIWA 2RA4A 4LFCL 4WFN3 3D4WA 2VXWA 2RHQB 4KI0A 1U4MA 2EJFC 1UE1A 1DOKA 1CQFA 3IL8A 1SYFA 2GVBA 1JC7A 2QDLA 1HA5A 2FMMA 5CBEE 4X62Q 4J15A 3R8BA 4AYBG 2ZJRA 4XIGS 3MXNB 4DR6L 3UDFA 1AZQA 5EPLA 3A8JE 3KDFB 5C6AA 3PO3B 3NBIA 1VQPA 4ZLTF 3NTKA 4JI0L 1HTLD 2EYMA 2QEJC 3HOXH 2UUCQ 2YTYA 3I91A 2LMCB 2XTIA 5M3FH 3GTPB 4FF3A 3QOJA 2I5MX 2KBNA 5CMDA 1YITA 3I8ZA 5M5WH 4L5RC 2RKSA 4YCUA 3GD7A 5EBCA 3K59A 3RLOA 4LNQA 3E3XA 4IO9A 1EYAA 4LF9L 1XMOQ 4JV5L 1SE2A 1ET9A 2C9OA 3QB3A 1YNXA 5KYLA 3A7AB 4EQNA 2KQ3A 1VQAA 4O2DA 4H44C 4JYAL 3SXHA 1TXYA 5EKIA 4A3CG 3S2HB 3N52A 3S15H 1TS5A 1XTCD 3EA6A 5JEAJ 3NBHB 2RBMA 1IBMQ 1Y1VG 1XNQL 1TVXA 1GD7A 2ZXRA 3STBD 5IE8A 1N32L 4A3LH 1TS3A 1EU3A 1HUNA 2KCNA 3A56A 3VA5A 2G9HD 1HZCA 4A3IB 4DGZA 1QVFA 4IJLA 3W1BA 1GM5A 1XX8A 3BVMA 1TWGH 2C5CA 4QQBX 3IRBA 3PCOB 4X3TA 4G7ZC 1PTOH 2EVBA 3MXNA 2NZ1D 3S14H 1QWYA 1G6ZA 3MZ5A 2ZM6L 1H9KA 2WIIB 1HNWL 1PYWD 2Y0SE 5CV9A 3KLSX 3UDGA 3FHWA 2E76C 1ASZA 3GQBA 4A3KB 5BN5A 4LF4Q 2R92G 4DV4Q 5FO7B 1I6VC 4DV7Q 1M90C 2HHHQ 1NE3A 2QF7A 1K8MA 4DR3Q 5EQ0A 3MXUA 3GTOH 5T1GA 3UDIA 3KF8B 4XQJA 3ND9A 4UP7A 3RZOH 3BDLA 4CBVA 1LTAD 4LF5L 4CKEA 4K0KQ 1Q1BA 2E5LL 2K33A 1DM0B 2ICEC 3H0GB 1ENAA 4GN3B 2B2TC 2ES2A 2F0LA 3KUPA 1MSHA 4P71A 1CI3M 1VMCA 5DM63 5HURA 3L3OC 4X64L 3M4OB 1EYDA 4N9TA 1FGBD 1L1OC 1PZID 3CPFA 1XNRQ 1CKMA 3IFDA 1Z7TA 1SNMA 4IOAA 2ZTDA 1I4RA 5FJ8G 1JR0D 2B2VC 4X6AH 3V05A 2F0EA 1IW7D 1XPRA 1VQ4A 1T9HA 3G4SA 4BWGB 3GTLH 2JXMB 3A55A 3R3OA 5C4XH 3K7AH 3HOXB 3PF5A 1HA6A 2DY7A 4IUVA 3TP8A 2IW3A 2EYJA 2HIXA 2NZHA 2ICIA 4ODGA 1B9NA 3LWEA 3VYRA 1HPCA 3MFGA 4OO1I 3U9SA 4QUFA 3PUZA 1ILQA 2B29A 2EJGC 3J80i 3PO3G 4DK3C 1RL2A 3OMGA 1CKOA 1VDZA 2LKVA 1YHQA 1DYQA 3M4YA 3AFQA 1CUKA 5IYDG 4HEDA 5HGQA 1G2SA 4IFDG 1EZ8A 1BCPC 1PLFA 3I4OA 1X56A 5IGCA 2F0HA 3KF8A 4QMGA 4KTAA 4RGOS 4LFAL 4R9WA 4KMUC 4IQZA 5EPJA 4DUZL 3FP9A 1SDFA 3RLFA 3T51B 2B63B 3AQQA 1HNXQ 2JQOA 2ENBA 4K2KA 3TMEA 4C1NI 3UI2A 2B3GA 3X3NA 3QO2A 1QJOA 4RG1A 4A4IA 3BYYB 4DV6Q 3B6YA 3E9IA 5CV4A 4A3EH 4X62L 1TWGB 4X66Q 1HCZA 4HIOA 3I4NH 4KHVA 5C0XG 5CR3A 1TWCH 1UAPA 5IP7G 3KK7A 1E1OA 2B8FA 3W5OA 3T53B 5C3EB 2JA5H 4DR7L 4B3MQ 3TP5A 2F0MA 2A69D 2UUCL 3HOYH 4JI7L 2EXDA 2L12A 2L0CA 4OIKA 1CZWA 1KXLA 4UHVA 2PMZE 2ZJQA 1Q1EA 4H02A 2JA7B 1AW7A 3GTOB 3AYHB 3GV6A 2VY3A 4A3IG 1R9TB 1ENFA 1H9SB 2D9UA 3KBGA 1LT5D 2F0DA 1SE3A 3H3VI 1PH4A 1MHWC 2GN5A 1SBBB 1I94L 4C3HH 2LFNA 2N55A 1BNZA 2Z6KC 1K8OA 2IWHA 4QF4A 4DU9A 2RCFA 4RMFA 1VQ6A 1FL0A 1AE3A 4A3FG 2D62A 3MEFA 3BYTB 1NMFA 3G7LA 5CC4A 3OIQA 1WCMB 4GLXA 1MSGA 2N49A 5D14A 2E2HH 1VS0A 2IHFA 2JSOA 3K7AB 5EKLA 3CMAA 2N88A 5KYIA 4DN4M 5IWAQ 1ET6A 3R93A 2FMCA 4HMJA 3P7JA 2B2YC 1I4HA 4APVA 4FO2A 4B08A 4LF6L 1XYIA 3T1HL 3QIAA 1V43A 4CKBA 1QUQB 1PFMA 4G4KA 1SMYC 2VZAA 2UXBQ 2F52A 3CCEA 2F0GA 4LF4L 2R7ZB 1SNQA 1EFWA 2KEEA 3RD4A 1EY8A 2KEDA 3HOXG 2VB3X 4DR3L 5M3FG 4O42A 5I9PA 2ALYB 1QB5D 1Z9FA 3KBXA 1XTDA 2DY8A 1N8RC 2JEAI 1H9SA 3HOWB 2HIVA 1IZ6A 3SK4A 4HAEA 5M3MB 3S1QH 1IBLL 4NW2A 3SVMA 5IGGA 2J4XA 3TP7A 4XYOA 1PRTD 3OTOQ 4A3MH 4G7HC 5KRUA 3CCVA 3VR6A 4DV2Q 3CCJA 1XNRL 3KOJA 3S1RB 3EBEA 5ELBA 3KJOA 1ZYRD 2AQ3B 3JAML 3H94A 1SYDA 4NMZA 4A3BH 3NWTA 2OCEA 3A7LA 3BZCA 4FP5D 3F8TA 4I7ZC 4XDXA 1H9MA 4BBRB 1XMQQ 2D5DA 3K0YA 4DNRB 4CDDC 4A3LG 1EIHA 1Q82C 5F2DA 4LUVA 3CC2A 2D0PA 2KCCA 3A54A 1KQSA 1J5EL 1VQJA 4OGQC 4PMBA 2F4VQ 4NXML 1TY0A 5J1ZA 3I2ZA 1KNAA 1FJGQ 2A8VA 2HCCA 5ELOA 2I5HA 1IW7C 4QL5A 4HJ9A 1QUQA 3NSWA 1F77A 2N3SA 4C3HB 2HDLA 3GDEA 5C3EG 4KJOA 3QWNA 1Q3LA 2PQAB 3S9WA 2Z9HA 3I4MH 4FXGC 3E0JA 3NK9A 1TY2A 4K14A 5A35A 1I6HH 1NR4A 2JA7G 2EXZA 2BA0A 4NDXA 2LY7A 3GTJH 2K03A 2F3IA 2Q2IA 2F0TA 3JAME 1XPUA 1RDPD 4DR4Q 1E7ZA 4UP9A 2OQKA 3MTSA 1Y8OB 4IPGA 3UE0A 4DAPA 3NPPA 3U9OA 3RNUA 4JBJA 3RZDH 4PV1C 4F8MA 1EY9A 4LF7Q 1BVSA 1EQQA 4KLKA 4DV6L 1STHA 3OPOA 2F3WA 4QY7A 1BXTA 1KD1C 3ONAB 1PXUA 2EDGA 2AHOB 1SFOH 4JW0A 4U673 1WCMG 3DWAA 5C4XG 3TZDA 3D0FA 4YCVA 2IX1A 4K8JA 3WWVA 4P75A 3T16A 1EYCA 2VW9A 1RHPA 4RGMA 1A3UA 1X9NA 4AYBB 3OIPA 1DD2A 3HRZC 1Q8KA 2IJ0A 2K50A 2F3VA 3TDQA 4QJFA 3HEJA 4JI8L 5BR8Q 2DJFC 2G5DA 2OTJA 4JC0A 1N34Q 3WOFA 2KECA 5ELEA 5BN3A 2R7ZG 2FHTA 4A3MB 4AIMA 5FLMH 1PMRA 4AQYL 4B9XA 4RA8A 3T56B 3V2TA 1EY5A 3S1NH 4FXKC 3K81C 3I56A 2FXQA 5M5XB 4LWCA 3K80C 4OONA 1SEBD 1I3QH 3EROA 2UUAL 1F9RA 1GUTA 4A3DB 5M3MG 4K5WA 3GTMB 2CQOA 2R7DA 4ZUIA 4L5TA 5IT9L 1SJHD 5IWAL 3VYTA 1IYUA 1FD7D 2N8NA 1I4GA 1MGSA 1DZ1A 2FJ2A 1Q7YC 5C44H 2KHSA 3T13A 4WRDA 3E6ZX 1Y1VB 1GVPA 4JOIC 2UXBL 4IJHA 5GAHC 3QJYA 1D7QA 3AMUA 2B8GA 3K5LA 2JA5G 3PIO3 5C3XA 1SRUA 2AKWB 3DEOA 3PIP3 3HOYG 4RCOA 3U4ZA 4EQPA 4R4OA 5FO8B 1GOZA 2UXDL 1VQ7A 3CXCA 3S16B 1SYCA 4I65A 1Q86C 5AFWA 4DV0Q 4HSPA 1ASYA 4B3RQ 3KLRA 1TT2A 1W3SA 1C0AA 4B9WA 2KVMA 1R4QB 5JEAH 1PRTF 3LNNA 4FF1A 2K32A 3GTKB 4YWLA 3AFPA 3MVVA 2HQLA 5ELDA 1O7ZA 4C3HG 1STEA 4HSVA 4K5XA 5IT9E 1E3PA 2PNHA 4BA2I 5ISRA 3U58A 1PH2A 2Z1CA 4DV1Q 4K5VA 3ERSX 2K04A 1KDAA 3K5NA 1TWHB 4C56C 4C3JH 1XMQL 1G2TA 1VMPA 3HOUH 1D5ZC 1CK1A 2IL8A 1PRTC 3S2DB 2JN4A 1CSPA 5EKKA 1JJGA 3BDCA 4EQOA 5C3WA 5IY0A 5KNBA 4O1NA 2I5LX 1B50A 4ILWA 1PVOA 2K7VA 1JT8A 4KN4C 4MTNA 4DR2Q 1L1OB 2EY5A 1HFNA 1IBKL 3DM1A 3I7FA 4J8QA 1L0WA 3J7AF 3S1MH 3J7YW 1TU2B 2AQ1B 4BXXH 3W2DA 2NTTA 3IKJA 2MPMA 4AYBE 1OXTA 3S1NB 3D8GA 3PQIA 1ILPA 1PH1A 4KKTA 4RGNA 3OSOA 1U5KA 1A8VA 3ND8A 2F0VA 4IUPA 1SR3A 4DR4L 3T1YQ 4B3SQ 1EY6A 3D6CA 1EQTA 1PZKD 1TWFH 2XVSA 2L1BA 4P74A 2H5XA 3C2PA 4L8JA 4CDFC 2J7ZA 2K4KA 5ELCA 2RDGA 5GADC 4OIJA 4DXGA 4YHHQ 4CJ1B 4A3MG 1K3RA 2F0FA 3JAMi 1F2LA 1HR0Q 3F2UA 3CCRA 1C48A 3EN2A 2JA8H 1YNJD 4LFBL 5C44B 3J7ZC 2NBFA 3F1ZA 1D8LA 1IL8A 5JJIA 4OX9Q 3RUZA 3HG9A 4GLAC 5JJLA 3OWFA 2NYZD 1BCPB 4A3DG 1NSNS 1DXMA 4UPAA 2DNCA 2K5DA 4IFDJ 2Z4HA 3BDOA 5ELNA 3GTQH 2NVYH 1L2FA 2BDOA 4DAVA 1WTPA 4RGTA 3HOVH 3SGIA 1JE4A 1A63A 5K36H 2B2TA 4GKJL 1WTHA 2DJGC 4ZUJA 3I4LA 5CV8A 1VF5C 3CCSA 1NBWA 4XYQA 1IYJB 3CQZH 5IP9H 1FNVA 3J7AV 1L1OA 1N34L 4Z9CB 1MJCA 1VQOA 3VR5A 1WTXA 2B2VA 4KD4A 4A3GH 1AN8A 1RIPA 3I4MG 4JI6L 4HIDA 2NUCA 4R4QA 1SNPA 2LSSA 3SR1A 2PMZB 5C0XJ 5IYCH 1PH6A 5JJKA 1OXXK 4K6DA 3FDTA 3TZUA 1EWCA
chains in the Genus database with same CATH topology
3BU2A 1KXLA 3CAMA 4C3IH 4DV2L 1Y1VH 2PMZE 1IXRA 2ZJQA 4X64Q 1Q1EA 4JI4L 2GVAA 4H02A 4KHPL 2Q2HA 4AH6A 3AYHB 3TEHB 2VY3A 3S2HH 4HJAA 4A3IG 1IBKQ 4UY8C 2QA4A 1YI2A 4BBSG 5IP7H 4YWKA 4LFCQ 3M85A 2BA1A 1Q46A 1E24A 1YIJA 1J6QA 3H3VI 4GLVB 1PH4A 2K5NA 3S16H 1I94L 2GN5A 4QIWE 4C3HH 1XPOA 1N9WA 2Z6KC 3HKSA 4Y52H 3W1GA 1XJVA 1MIUA 4DR6Q 4R4CA 1X65A 2F4VL 3GTKH 4RMFA 1FJGL 1KC8C 5LMNW 1S40A 5IYBH 1FL0A 2LXKA 3UDXA 1VQ6A 4DKAC 1AE3A 1VQDA 1YZ6A 2D62A 3MEFA 3PV0A 4A3FG 1NMFA 2OQ0A 1PH8A 1JMCA 4GLXA 3KJPA 2E8GA 3J81i 2E2JH 1VQHA 2N49A 1N33Q 2E2HH 4JCVE 4B3TQ 4BY7G 3CCQA 1VS0A 4B3RL 4YY3L 1X3EA 4WJ4A 1EQRA 2IHFA 4A3KH 1VQEA 4LFBQ 3G71A 4PMWA 3CMAA 3M4QA 5IWAQ 4KHZA 1VQMA 1QZHA 1TWHH 3J7A5 4JV5Q 4GOPC 5DLQE 4APVA 4GOPB 1B70B 1QVGA 4LF6L 1B7YB 4JG2A 3S2DH 3T1HL 1YJWA 4OO1G 3JC66 1X6OA 1V43A 3TRZA 3U4VA 3J80c 1JJ2A 1VQFA 4LFAQ 1QUQB 4PG3A 5FLMG 4BY1H 2VZAA 2UXCQ 2UUBQ 4DUZQ 3H0GH 1AE2A 3H15A 3HOZH 2UXBQ 1E22A 2F52A 3CCEA 1VCIA 4DAYB 4LF4L 1HH2P 2PI2A 1Y1WH 1EFWA 2ZJPA 1Q12A 1PV4A 1OXUA 1PFSA 4X65Q 3KF6B 2JK8A 3FKIG 4JI1L 2JA6G 4GKKQ 4LF7L 3PO2G 4GKJQ 3HOXG 4DR3L 3M4OH 1PYBA 1K8AC 1S3OA 3CCMA 5M3FG 5E7NA 2ALYB 3ZJYC 4NXNL 1Z9FA 2WP8J 4WJ3M 1KRSA 1A0IA 3BJUA 1XNQQ 2BH2A 4JI2L 1XTDA 2MO1A 4NPSA 1N8RC 2JEAI 2PQAA 4IPHA 3TS0A 2HIVA 3NELA 1IZ6A 4A3BG 1KRTA 3E0EA 3S1QH 3DLLA 1IBLL 4JI6Q 1QVCA 4DR7Q 3CC7A 3FKIH 3PO2H 4PZ6A 1I5FA 2WFWA 1YJ9A 1PYSB 5HY6A 1OXSC 2Z6KA 2OTLA 4JI7Q 5C44G 3OTOQ 1BBWA 4A3MH 1VQKA 1LTLA 3CCVA 4DV2Q 2ZTEA 3HOWG 3CCJA 1XNRL 2K52A 4LW1A 3CF5A 1AH9A 2IT1A 1V9PA 2AWNA 3KOJA 4P72A 2ZM6Q 4JI4Q 4KHPQ 4UP8A 2RF4A 3EBEA 2VQFL 3KJOA 3HKZE 4DV5Q 2VQEQ 3CP0A 4A3BH 4JI3L 4HJ8A 4DPGA 4IPDA 3NENA 3ULLA 2OCEA 3HFZB 1K83H 1YJNA 2VL6A 2BH8A 3BZCA 1OXVA 2MO0A 3F8TA 5BR8L 3GTPH 3HKZG 1UWVA 1XMQQ 1I94Q 1FGUA 1K8GA 4A3LG 4DR5L 4HIMA 2DUDA 4DR1L 1VQNA 3ER0A 1Q82C 4LUVA 3CC2A 1HNZQ 1B8AA 2D0PA 2KHJA 1G291 3S17H 1K9MC 3T1YL 1KQSA 2CWAA 2EIFA 1VQ5A 1J5EL 1VQJA 2E5LQ 1LUZA 1VQBA 4NXML 3NEMA 4BA1I 4GOPA 4NB3A 2F4VQ 3I2ZA 5EAYA 4BBRG 1FJGQ 3F2DA 2A8VA 1W2BA 1UEBA 3A5ZB 2I5HA 5ELOA 4HIKA 4DK6C 1KL9A 4QL5A 3Q8DA 4YHHL 1YVCA 4HJ9A 3KYHC 2MNAA 4JI5L 3A0JA 2PI2E 1QUQA 1U0LA 5LMNL 1HR0L 2N3SA 1X54A 1G51A 3GDEA 1JE5A 2B63H 5C3EG 1WI5A 1VQ9A 4YY3Q 5M5YH 2I0QA 4A75A 2UU9Q 2YTXA 2PQAB 2NVQH 3KF6A 1BKBA 1NMGA 1Y14B 1YEZA 1XMOL 3L2PA 3I4MH 3G48A 3GO5A 2ID0A 1EUJA 1VQCA 5GAEC 1I6HH 1K0RA 4LF6Q 2VNUD 2JA7G 2BA0A 2R7FA 4DUYL 3T1HQ 3GTJH 3J81c 3ICEA 3H3VH 2F3IA 2Q2IA 3I55A 5J3BA 1XPUA 3KDFA 4DR4Q 1E7ZA 1SMXA 4UP9A 2OQKA 2K5VA 5C3EH 2AMCB 4A3IH 1EOVA 4IPGA 1SROA 1JB7A 3UE0A 4BBSH 1MJEA 1HR0W 2V1CC 3RNUA 4JBJA 3RZDH 4LF8L 4JI1Q 2MQHA 3L7ZC 2Y0SG 3CCLA 4LF7Q 1BVSA 2R6GA 2ZTCA 4A3JG 1IBML 3CW2C 5AJ3L 4KLKA 4DV6L 1EQQA 1M1KC 3GTGH 3M7NA 4QY7A 2JA7H 2QEXA 1IL2A 1NY4A 4DV0L 1KD1C 4EQ5A 4JBKA 2R93G 2AHOB 4C2MH 4YWMA 1SFOH 1R9TH 5LMUQ 1N36L 3M3YH 2VUMG 4ALPA 2KHIA 4GN5A 1X3GA 1WCMG 4GNXC 4IOCA 2IX0A 4GNXB 1IBLQ 4A3FH 2YU9H 1HZBA 4DV3Q 1OTCA 1SN8A 1YBYA 5C4XG 4OWXB 3D0FA 4YCVA 2WB1E 2IX1A 4A93G 1Z47A 3WWVA 3STBC 4P75A 3JAMc 4BY7H 2VW9A 1QZGA 3PUXA 3K0XA 2CCZA 4TVAB 3TREA 3U50C 1P8LA 4POFA 4LUZA 4OWTB 4DNIA 4DV1L 2WB1G 2IHEA 1X9NA 2VQFQ 4DV4L 4LFCL 1WOCA 4DV7L 1Q8KA 2ASBA 2K50A 5GAGC 2HHHL 2RHQB 4KI0A 1WCMH 4QJFA 4JI8L 1UE1A 2GVBA 5BR8Q 1WFQA 3TS2A 2OTJA 4JC0A 4X62Q 1N34Q 3CMEA 1NJIC 1H95A 2JA8G 4J15A 2ZJRA 4AYBG 1PH3A 4XIGS 2R7ZG 3MXNB 4AIMA 5FLMH 4K0KL 4DR6L 3UDFA 3KDFB 2CKZB 4AQYL 1J5EQ 3K8AA 3S1NH 3I56A 3K81C 3EIVA 3F2CA 2FXQA 1VQPA 4NXMQ 2Q2TA 1X3FA 1VQLA 4JI0L 2XGTA 4LWCA 3K80C 2JA6H 4OONA 2UUAL 1I3QH 3HOXH 2UUCQ 2YTYA 1WJJA 3RN5A 2XTIA 1CSQA 5M3FH 1A62A 1EWIA 4DR2L 4JI5Q 5LMNQ 1HJPA 1LYLA 4FDBA 2I5MX 2ATWA 2KBNA 3ULJA 5M3MG 1KHIA 5M5WH 1YITA 2CQOA 4PZ8A 4TQUS 4L5RC 3PUVA 4YCUA 2R7ZH 2R7DA 1G6PA 3GD7A 4L5TA 3RLOA 4LNQA 3M4PA 2KCMA 5IWAL 4IO9A 4LF9L 1O7IA 1XMOQ 4JV5L 3PGZA 2AWOA 4PZ7A 1YNXA 2N8NA 5IP9G 3A5UA 3A74A 3PIOA 1Q7YC 5C44H 1VQAA 3PIPA 3ULPA 4O2DA 3HOWH 1HZAA 4JYAL 4R1JA 1EIYB 1LM0A 1GVPA 2UUBL 4JOIC 5M3MH 4A3GG 2UXBL 4B3SL 1TXYA 3D31A 4IJHA 5GAHC 3S24A 1PH7A 4A3CG 5JEAG 4Y7NH 4GNXA 2NVTH 4IFDI 1D7QA 2EQSA 2JA5G 4GKKL 4X65L 3S15H 4P73A 5IYCG 1SRUA 2AKWB 3HOYG 1P16A 2WAQE 5JEAJ 3U4ZA 4R4OA 3NBHB 2UXDL 1IBMQ 1VQ7A 1Y1VG 3CXCA 2IY5B 1XNQL 3STBD 1GD7A 5IE8A 1N32L 1NTGA 1Q86C 4A3LH 3S1RH 1HZ9A 4DV0Q 3PSIA 3RR5A 2WAQG 3VDYA 1ASYA 3DM3A 4B3RQ 2RCNA 1N36Q 1W3SA 1C0AA 4OX9L 3E9HA 4GN4B 4GS3A 4YWLA 1HZCA 2A1AA 4R4IA 4BBRH 3AFPA 4IJLA 1QVFA 3W1BA 1GM5A 2CFMA 2HQLA 1TWGH 4QQBX 3HOUG 3PUYA 3IRBA 3PCOB 5FLXc 2YYZA 1TWAH 3S14H 1E3PA 2PNHA 4BA2I 4O0AA 5C0XI 2JEBI 2ZM6L 3U58A 3M9BA 1PH2A 1HNWL 4POGA 2Y0SE 3UDGA 3FHWA 1HNXL 4DV1Q 2VQEL 4DV5L 1ASZA 5IYBG 4LF4Q 2R92G 4DV4Q 1PH5A 2K14A 1UE6A 3K7UC 4DV7Q 3ERSX 1M90C 2HHHQ 1NE3A 2YV5A 4JI8Q 4DR3Q 4L5SA 4C3JH 1XMQL 4DAMA 3BZKA 3HOUH 3GTOH 4NXNQ 5C4JH 3UDIA 4X66L 1UE5A 4JI2Q 3KF8B 1HNZL 4UP7A 4A3KG 1CSPA 3RZOH 4MZ9A 1JJGA 3PUWA 4LF5L 4K0KQ 1Q1BA 2E5LL 4BXXG 2K75A 5IY0A 4AQYQ 2KENA 2I5LX 3OYYA 2NVXH 4B3ML 1PH9A 2R92H 4GN3B 2DGYA 2ES2A 4JI0Q 1PVOA 4P71A 4A3JH 1C7YA 2UUAQ 1JT8A 3CD6A 5IT9c 4ME3A 4MTNA 4X64L 4JBMA 5GQOA 4JOIA 4DR2Q 1L1OC 1S72A 3CPFA 4BY1G 1XNRQ 1L1OB 2R93H 2NN6G 1CKMA 4A76A 3H0GG 1IBKL 2UU9L 3HOZG 4IOAA 3I7FA 1C9OA 2ZTDA 1L0WA 3PF4A 3S1MH 1DGSA 1BBUA 5FJ8G 1VQ8A 1Y1WG 2VUMH 4X6AH 4BXXH 1WYDA 2OWOA 4LF9Q 4JI3Q 1XPRA 4AYBE 1VQ4A 1OXTA 1T9HA 3G4SA 1CKNB 3L0OA 3TQYA 2KCTA 2D0OA 3GTLH 1PH1A 4HJ5A 1YHBA 5C4XH 2NN6I 1GO3E 1PA6A 1U5KA 3K7AH 4A93H 2QGQA 1A8VA 4DR5Q 4DR1Q 1SR3A 4JBWA 3CCUA 3PF5A 1I50H 4DR4L 4JYAQ 1SLJA 2MFIA 1PHJA 3T1YQ 2HIXA 2NZHA 3F2BA 4B3SQ 2Q2UA 1TWFH 5FJ8H 1SE8A 2H5XA 4P74A 3G6EA 4OO1I 1E1TA 2K4KA 4YCWA 5GADC 3PUZA 2K5HA 4YHHQ 2JJQA 4QGUA 4A3MG 2B29A 1K3RA 2UXDQ 1N33L 3J80i 2VS1A 3JAMi 1HR0Q 4B3TL 3PO3G 4L5QA 1FVIA 4DK3C 1N32Q 1RL2A 3CCRA 3EN2A 5LMUL 2JA8H 1V1QA 4LFBL 4OXPA 1CKOA 3J7ZC 3HOVG 1YHQA 3F1ZA 4EX5A 2RHSB 1D8LA 5K36G 1JJCB 1K73C 1KAWA 1CUKA 3AFQA 4MNOA 5GROA 5IYDG 4OX9Q 2HT1A 5HGQA 1MKHA 4IFDG 1Q81C 5JJIA 4GLAC 5JJLA 1GKHA 3CC4A 4DV3L 2L15A 4A3DG 4A3EG 3I4OA 1X56A 1EIFA 4UPAA 4DUYQ 2LXJA 5H1SE 4IFDJ 3J81j 4LFAL 3AEVA 5ELNA 3I4NG 3GTQH 2UXCL 3PO3H 3LGJA 2NVYH 1L2FA 3FP9A 1YHAA 4DUZL 2CWPA 3KFUA 3RLFA 1HNWQ 2JE6I 3HOVH 3SGIA 5M5XH 3AQQA 1HNXQ 4HJ7A 2JQOA 3UE1A 4GKJL 3RLNA 1A63A 1EYGA 2E2IH 5IYDH 2B3GA 4LF8Q 2Z0SA 3CCSA 3RN2A 1NBWA 4LUOA 1IYJB 3CQZH 1VQGA 1X55A 4RG1A 4A4IA 5IP9H 4OWWB 5AJ3Q 4DV6Q 3B6YA 3E9IA 4A3DH 1L1OA 4A3EH 3GTMH 4X62L 1N34L 1MJCA 1VQIA 2JA9A 4X66Q 2B63G 4HIOA 1VQOA 3I4NH 3KLWA 5C0XG 4A3GH 1TWCH 2N78A 5IP7G 2A19A 2YTVA 4IPCA 1RIPA 4LF5Q 3I4MG 4A3CH 1E1OA 3W5OA 3OW2A 4JI6L 1CKNA 3CPWA 4XTCS 4HIDA 4R4QA 4R4TA 2JA5H 4DR7L 2LSSA 1PH6A 1KIXA 5C0XJ 5IYCH 4B3MQ 5JJKA 2NZOA 2UUCL 1OXXK 2C35B 1UE7A 3HOYH 4JI7L 3OTOL 2EXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BU2 A;  1KXL A;  3CAM A;  4C3I H;  4DV2 L;  1Y1V H;  2PMZ E;  1IXR A;  2ZJQ A;  4X64 Q;  1Q1E A;  4JI4 L;  2GVA A;  4H02 A;  4KHP L;  2Q2H A;  4AH6 A;  3AYH B;  3TEH B;  2VY3 A;  3S2H H;  4HJA A;  4A3I G;  1IBK Q;  4UY8 C;  2QA4 A;  1YI2 A;  4BBS G;  5IP7 H;  4YWK A;  4LFC Q;  3M85 A;  2BA1 A;  1Q46 A;  1E24 A;  1YIJ A;  1J6Q A;  3H3V I;  4GLV B;  1PH4 A;  2K5N A;  3S16 H;  1I94 L;  2GN5 A;  4QIW E;  4C3H H;  1XPO A;  1N9W A;  2Z6K C;  3HKS A;  4Y52 H;  3W1G A;  1XJV A;  1MIU A;  4DR6 Q;  4R4C A;  1X65 A;  2F4V L;  3GTK H;  4RMF A;  1FJG L;  1KC8 C;  5LMN W;  1S40 A;  5IYB H;  1FL0 A;  2LXK A;  3UDX A;  1VQ6 A;  4DKA C;  1AE3 A;  1VQD A;  1YZ6 A;  2D62 A;  3MEF A;  3PV0 A;  4A3F G;  1NMF A;  2OQ0 A;  1PH8 A;  1JMC A;  4GLX A;  3KJP A;  2E8G A;  3J81 i;  2E2J H;  1VQH A;  2N49 A;  1N33 Q;  2E2H H;  4JCV E;  4B3T Q;  4BY7 G;  3CCQ A;  1VS0 A;  4B3R L;  4YY3 L;  1X3E A;  4WJ4 A;  1EQR A;  2IHF A;  4A3K H;  1VQE A;  4LFB Q;  3G71 A;  4PMW A;  3CMA A;  3M4Q A;  5IWA Q;  4KHZ A;  1VQM A;  1QZH A;  1TWH H;  3J7A 5;  4JV5 Q;  4GOP C;  5DLQ E;  4APV A;  4GOP B;  1B70 B;  1QVG A;  4LF6 L;  1B7Y B;  4JG2 A;  3S2D H;  3T1H L;  1YJW A;  4OO1 G;  3JC6 6;  1X6O A;  1V43 A;  3TRZ A;  3U4V A;  3J80 c;  1JJ2 A;  1VQF A;  4LFA Q;  1QUQ B;  4PG3 A;  5FLM G;  4BY1 H;  2VZA A;  2UXC Q;  2UUB Q;  4DUZ Q;  3H0G H;  1AE2 A;  3H15 A;  3HOZ H;  2UXB Q;  1E22 A;  2F52 A;  3CCE A;  1VCI A;  4DAY B;  4LF4 L;  1HH2 P;  2PI2 A;  1Y1W H;  1EFW A;  2ZJP A;  1Q12 A;  1PV4 A;  1OXU A;  1PFS A;  4X65 Q;  3KF6 B;  2JK8 A;  3FKI G;  4JI1 L;  2JA6 G;  4GKK Q;  4LF7 L;  3PO2 G;  4GKJ Q;  3HOX G;  4DR3 L;  3M4O H;  1PYB A;  1K8A C;  1S3O A;  3CCM A;  5M3F G;  5E7N A;  2ALY B;  3ZJY C;  4NXN L;  1Z9F A;  2WP8 J;  4WJ3 M;  1KRS A;  1A0I A;  3BJU A;  1XNQ Q;  2BH2 A;  4JI2 L;  1XTD A;  2MO1 A;  4NPS A;  1N8R C;  2JEA I;  2PQA A;  4IPH A;  3TS0 A;  2HIV A;  3NEL A;  1IZ6 A;  4A3B G;  1KRT A;  3E0E A;  3S1Q H;  3DLL A;  1IBL L;  4JI6 Q;  1QVC A;  4DR7 Q;  3CC7 A;  3FKI H;  3PO2 H;  4PZ6 A;  1I5F A;  2WFW A;  1YJ9 A;  1PYS B;  5HY6 A;  1OXS C;  2Z6K A;  2OTL A;  4JI7 Q;  5C44 G;  3OTO Q;  1BBW A;  4A3M H;  1VQK A;  1LTL A;  3CCV A;  4DV2 Q;  2ZTE A;  3HOW G;  3CCJ A;  1XNR L;  2K52 A;  4LW1 A;  3CF5 A;  1AH9 A;  2IT1 A;  1V9P A;  2AWN A;  3KOJ A;  4P72 A;  2ZM6 Q;  4JI4 Q;  4KHP Q;  4UP8 A;  2RF4 A;  3EBE A;  2VQF L;  3KJO A;  3HKZ E;  4DV5 Q;  2VQE Q;  3CP0 A;  4A3B H;  4JI3 L;  4HJ8 A;  4DPG A;  4IPD A;  3NEN A;  3ULL A;  2OCE A;  3HFZ B;  1K83 H;  1YJN A;  2VL6 A;  2BH8 A;  3BZC A;  1OXV A;  2MO0 A;  3F8T A;  5BR8 L;  3GTP H;  3HKZ G;  1UWV A;  1XMQ Q;  1I94 Q;  1FGU A;  1K8G A;  4A3L G;  4DR5 L;  4HIM A;  2DUD A;  4DR1 L;  1VQN A;  3ER0 A;  1Q82 C;  4LUV A;  3CC2 A;  1HNZ Q;  1B8A A;  2D0P A;  2KHJ A;  1G29 1;  3S17 H;  1K9M C;  3T1Y L;  1KQS A;  2CWA A;  2EIF A;  1VQ5 A;  1J5E L;  1VQJ A;  2E5L Q;  1LUZ A;  1VQB A;  4NXM L;  3NEM A;  4BA1 I;  4GOP A;  4NB3 A;  2F4V Q;  3I2Z A;  5EAY A;  4BBR G;  1FJG Q;  3F2D A;  2A8V A;  1W2B A;  1UEB A;  3A5Z B;  2I5H A;  5ELO A;  4HIK A;  4DK6 C;  1KL9 A;  4QL5 A;  3Q8D A;  4YHH L;  1YVC A;  4HJ9 A;  3KYH C;  2MNA A;  4JI5 L;  3A0J A;  2PI2 E;  1QUQ A;  1U0L A;  5LMN L;  1HR0 L;  2N3S A;  1X54 A;  1G51 A;  3GDE A;  1JE5 A;  2B63 H;  5C3E G;  1WI5 A;  1VQ9 A;  4YY3 Q;  5M5Y H;  2I0Q A;  4A75 A;  2UU9 Q;  2YTX A;  2PQA B;  2NVQ H;  3KF6 A;  1BKB A;  1NMG A;  1Y14 B;  1YEZ A;  1XMO L;  3L2P A;  3I4M H;  3G48 A;  3GO5 A;  2ID0 A;  1EUJ A;  1VQC A;  5GAE C;  1I6H H;  1K0R A;  4LF6 Q;  2VNU D;  2JA7 G;  2BA0 A;  2R7F A;  4DUY L;  3T1H Q;  3GTJ H;  3J81 c;  3ICE A;  3H3V H;  2F3I A;  2Q2I A;  3I55 A;  5J3B A;  1XPU A;  3KDF A;  4DR4 Q;  1E7Z A;  1SMX A;  4UP9 A;  2OQK A;  2K5V A;  5C3E H;  2AMC B;  4A3I H;  1EOV A;  4IPG A;  1SRO A;  1JB7 A;  3UE0 A;  4BBS H;  1MJE A;  1HR0 W;  2V1C C;  3RNU A;  4JBJ A;  3RZD H;  4LF8 L;  4JI1 Q;  2MQH A;  3L7Z C;  2Y0S G;  3CCL A;  4LF7 Q;  1BVS A;  2R6G A;  2ZTC A;  4A3J G;  1IBM L;  3CW2 C;  5AJ3 L;  4KLK A;  4DV6 L;  1EQQ A;  1M1K C;  3GTG H;  3M7N A;  4QY7 A;  2JA7 H;  2QEX A;  1IL2 A;  1NY4 A;  4DV0 L;  1KD1 C;  4EQ5 A;  4JBK A;  2R93 G;  2AHO B;  4C2M H;  4YWM A;  1SFO H;  1R9T H;  5LMU Q;  1N36 L;  3M3Y H;  2VUM G;  4ALP A;  2KHI A;  4GN5 A;  1X3G A;  1WCM G;  4GNX C;  4IOC A;  2IX0 A;  4GNX B;  1IBL Q;  4A3F H;  2YU9 H;  1HZB A;  4DV3 Q;  1OTC A;  1SN8 A;  1YBY A;  5C4X G;  4OWX B;  3D0F A;  4YCV A;  2WB1 E;  2IX1 A;  4A93 G;  1Z47 A;  3WWV A;  3STB C;  4P75 A;  3JAM c;  4BY7 H;  2VW9 A;  1QZG A;  3PUX A;  3K0X A;  2CCZ A;  4TVA B;  3TRE A;  3U50 C;  1P8L A;  4POF A;  4LUZ A;  4OWT B;  4DNI A;  4DV1 L;  2WB1 G;  2IHE A;  1X9N A;  2VQF Q;  4DV4 L;  4LFC L;  1WOC A;  4DV7 L;  1Q8K A;  2ASB A;  2K50 A;  5GAG C;  2HHH L;  2RHQ B;  4KI0 A;  1WCM H;  4QJF A;  4JI8 L;  1UE1 A;  2GVB A;  5BR8 Q;  1WFQ A;  3TS2 A;  2OTJ A;  4JC0 A;  4X62 Q;  1N34 Q;  3CME A;  1NJI C;  1H95 A;  2JA8 G;  4J15 A;  2ZJR A;  4AYB G;  1PH3 A;  4XIG S;  2R7Z G;  3MXN B;  4AIM A;  5FLM H;  4K0K L;  4DR6 L;  3UDF A;  3KDF B;  2CKZ B;  4AQY L;  1J5E Q;  3K8A A;  3S1N H;  3I56 A;  3K81 C;  3EIV A;  3F2C A;  2FXQ A;  1VQP A;  4NXM Q;  2Q2T A;  1X3F A;  1VQL A;  4JI0 L;  2XGT A;  4LWC A;  3K80 C;  2JA6 H;  4OON A;  2UUA L;  1I3Q H;  3HOX H;  2UUC Q;  2YTY A;  1WJJ A;  3RN5 A;  2XTI A;  1CSQ A;  5M3F H;  1A62 A;  1EWI A;  4DR2 L;  4JI5 Q;  5LMN Q;  1HJP A;  1LYL A;  4FDB A;  2I5M X;  2ATW A;  2KBN A;  3ULJ A;  5M3M G;  1KHI A;  5M5W H;  1YIT A;  2CQO A;  4PZ8 A;  4TQU S;  4L5R C;  3PUV A;  4YCU A;  2R7Z H;  2R7D A;  1G6P A;  3GD7 A;  4L5T A;  3RLO A;  4LNQ A;  3M4P A;  2KCM A;  5IWA L;  4IO9 A;  4LF9 L;  1O7I A;  1XMO Q;  4JV5 L;  3PGZ A;  2AWO A;  4PZ7 A;  1YNX A;  2N8N A;  5IP9 G;  3A5U A;  3A74 A;  3PIO A;  1Q7Y C;  5C44 H;  1VQA A;  3PIP A;  3ULP A;  4O2D A;  3HOW H;  1HZA A;  4JYA L;  4R1J A;  1EIY B;  1LM0 A;  1GVP A;  2UUB L;  4JOI C;  5M3M H;  4A3G G;  2UXB L;  4B3S L;  1TXY A;  3D31 A;  4IJH A;  5GAH C;  3S24 A;  1PH7 A;  4A3C G;  5JEA G;  4Y7N H;  4GNX A;  2NVT H;  4IFD I;  1D7Q A;  2EQS A;  2JA5 G;  4GKK L;  4X65 L;  3S15 H;  4P73 A;  5IYC G;  1SRU A;  2AKW B;  3HOY G;  1P16 A;  2WAQ E;  5JEA J;  3U4Z A;  4R4O A;  3NBH B;  2UXD L;  1IBM Q;  1VQ7 A;  1Y1V G;  3CXC A;  2IY5 B;  1XNQ L;  3STB D;  1GD7 A;  5IE8 A;  1N32 L;  1NTG A;  1Q86 C;  4A3L H;  3S1R H;  1HZ9 A;  4DV0 Q;  3PSI A;  3RR5 A;  2WAQ G;  3VDY A;  1ASY A;  3DM3 A;  4B3R Q;  2RCN A;  1N36 Q;  1W3S A;  1C0A A;  4OX9 L;  3E9H A;  4GN4 B;  4GS3 A;  4YWL A;  1HZC A;  2A1A A;  4R4I A;  4BBR H;  3AFP A;  4IJL A;  1QVF A;  3W1B A;  1GM5 A;  2CFM A;  2HQL A;  1TWG H;  4QQB X;  3HOU G;  3PUY A;  3IRB A;  3PCO B;  5FLX c;  2YYZ A;  1TWA H;  3S14 H;  1E3P A;  2PNH A;  4BA2 I;  4O0A A;  5C0X I;  2JEB I;  2ZM6 L;  3U58 A;  3M9B A;  1PH2 A;  1HNW L;  4POG A;  2Y0S E;  3UDG A;  3FHW A;  1HNX L;  4DV1 Q;  2VQE L;  4DV5 L;  1ASZ A;  5IYB G;  4LF4 Q;  2R92 G;  4DV4 Q;  1PH5 A;  2K14 A;  1UE6 A;  3K7U C;  4DV7 Q;  3ERS X;  1M90 C;  2HHH Q;  1NE3 A;  2YV5 A;  4JI8 Q;  4DR3 Q;  4L5S A;  4C3J H;  1XMQ L;  4DAM A;  3BZK A;  3HOU H;  3GTO H;  4NXN Q;  5C4J H;  3UDI A;  4X66 L;  1UE5 A;  4JI2 Q;  3KF8 B;  1HNZ L;  4UP7 A;  4A3K G;  1CSP A;  3RZO H;  4MZ9 A;  1JJG A;  3PUW A;  4LF5 L;  4K0K Q;  1Q1B A;  2E5L L;  4BXX G;  2K75 A;  5IY0 A;  4AQY Q;  2KEN A;  2I5L X;  3OYY A;  2NVX H;  4B3M L;  1PH9 A;  2R92 H;  4GN3 B;  2DGY A;  2ES2 A;  4JI0 Q;  1PVO A;  4P71 A;  4A3J H;  1C7Y A;  2UUA Q;  1JT8 A;  3CD6 A;  5IT9 c;  4ME3 A;  4MTN A;  4X64 L;  4JBM A;  5GQO A;  4JOI A;  4DR2 Q;  1L1O C;  1S72 A;  3CPF A;  4BY1 G;  1XNR Q;  1L1O B;  2R93 H;  2NN6 G;  1CKM A;  4A76 A;  3H0G G;  1IBK L;  2UU9 L;  3HOZ G;  4IOA A;  3I7F A;  1C9O A;  2ZTD A;  1L0W A;  3PF4 A;  3S1M H;  1DGS A;  1BBU A;  5FJ8 G;  1VQ8 A;  1Y1W G;  2VUM H;  4X6A H;  4BXX H;  1WYD A;  2OWO A;  4LF9 Q;  4JI3 Q;  1XPR A;  4AYB E;  1VQ4 A;  1OXT A;  1T9H A;  3G4S A;  1CKN B;  3L0O A;  3TQY A;  2KCT A;  2D0O A;  3GTL H;  1PH1 A;  4HJ5 A;  1YHB A;  5C4X H;  2NN6 I;  1GO3 E;  1PA6 A;  1U5K A;  3K7A H;  4A93 H;  2QGQ A;  1A8V A;  4DR5 Q;  4DR1 Q;  1SR3 A;  4JBW A;  3CCU A;  3PF5 A;  1I50 H;  4DR4 L;  4JYA Q;  1SLJ A;  2MFI A;  1PHJ A;  3T1Y Q;  2HIX A;  2NZH A;  3F2B A;  4B3S Q;  2Q2U A;  1TWF H;  5FJ8 H;  1SE8 A;  2H5X A;  4P74 A;  3G6E A;  4OO1 I;  1E1T A;  2K4K A;  4YCW A;  5GAD C;  3PUZ A;  2K5H A;  4YHH Q;  2JJQ A;  4QGU A;  4A3M G;  2B29 A;  1K3R A;  2UXD Q;  1N33 L;  3J80 i;  2VS1 A;  3JAM i;  1HR0 Q;  4B3T L;  3PO3 G;  4L5Q A;  1FVI A;  4DK3 C;  1N32 Q;  1RL2 A;  3CCR A;  3EN2 A;  5LMU L;  2JA8 H;  1V1Q A;  4LFB L;  4OXP A;  1CKO A;  3J7Z C;  3HOV G;  1YHQ A;  3F1Z A;  4EX5 A;  2RHS B;  1D8L A;  5K36 G;  1JJC B;  1K73 C;  1KAW A;  1CUK A;  3AFQ A;  4MNO A;  5GRO A;  5IYD G;  4OX9 Q;  2HT1 A;  5HGQ A;  1MKH A;  4IFD G;  1Q81 C;  5JJI A;  4GLA C;  5JJL A;  1GKH A;  3CC4 A;  4DV3 L;  2L15 A;  4A3D G;  4A3E G;  3I4O A;  1X56 A;  1EIF A;  4UPA A;  4DUY Q;  2LXJ A;  5H1S E;  4IFD J;  3J81 j;  4LFA L;  3AEV A;  5ELN A;  3I4N G;  3GTQ H;  2UXC L;  3PO3 H;  3LGJ A;  2NVY H;  1L2F A;  3FP9 A;  1YHA A;  4DUZ L;  2CWP A;  3KFU A;  3RLF A;  1HNW Q;  2JE6 I;  3HOV H;  3SGI A;  5M5X H;  3AQQ A;  1HNX Q;  4HJ7 A;  2JQO A;  3UE1 A;  4GKJ L;  3RLN A;  1A63 A;  1EYG A;  2E2I H;  5IYD H;  2B3G A;  4LF8 Q;  2Z0S A;  3CCS A;  3RN2 A;  1NBW A;  4LUO A;  1IYJ B;  3CQZ H;  1VQG A;  1X55 A;  4RG1 A;  4A4I A;  5IP9 H;  4OWW B;  5AJ3 Q;  4DV6 Q;  3B6Y A;  3E9I A;  4A3D H;  1L1O A;  4A3E H;  3GTM H;  4X62 L;  1N34 L;  1MJC A;  1VQI A;  2JA9 A;  4X66 Q;  2B63 G;  4HIO A;  1VQO A;  3I4N H;  3KLW A;  5C0X G;  4A3G H;  1TWC H;  2N78 A;  5IP7 G;  2A19 A;  2YTV A;  4IPC A;  1RIP A;  4LF5 Q;  3I4M G;  4A3C H;  1E1O A;  3W5O A;  3OW2 A;  4JI6 L;  1CKN A;  3CPW A;  4XTC S;  4HID A;  4R4Q A;  4R4T A;  2JA5 H;  4DR7 L;  2LSS A;  1PH6 A;  1KIX A;  5C0X J;  5IYC H;  4B3M Q;  5JJK A;  2NZO A;  2UUC L;  1OXX K;  2C35 B;  1UE7 A;  3HOY H;  4JI7 L;  3OTO L;  2EXD A; 
#chains in the Genus database with same CATH topology
 3BU2 A;  4C3I H;  5IGD A;  1FNU A;  4JI4 L;  2F0U A;  4AH6 A;  3TEH B;  1JWM D;  1PFB A;  1Z6H A;  4KN7 C;  4XT3 B;  1YI2 A;  2BA1 A;  1YIJ A;  1J6Q A;  1KAA A;  5IOC A;  1XPO A;  4A3F B;  2K28 A;  1B3A A;  3HKS A;  2EYL A;  5JVH 3;  4R4C A;  2R3Z A;  2F0N A;  5E4X A;  5IYB H;  3UDX A;  4PQX A;  2JP1 A;  4DKA C;  4IAL A;  1YZ6 A;  2A74 C;  1HQR D;  1JMC A;  2E8G A;  2E2J H;  4MIU A;  1VQH A;  2RVL A;  1KLU D;  1N33 Q;  1B44 D;  4B3T Q;  3CCQ A;  4B3R L;  1CFM A;  4WJ4 A;  1EQR A;  1LTR D;  1VQE A;  2B2W C;  3G71 A;  4KHZ A;  3QG1 A;  2EOT A;  5DLQ E;  1WTQ A;  5I2Y A;  4JG2 A;  4OO1 G;  1YJW A;  3SK5 A;  2FIN B;  5J39 A;  1JJ2 A;  5E4W C;  3MXG A;  5M3F B;  4PG3 A;  5FLM G;  4BY1 H;  2UXC Q;  2NN6 H;  4CDC C;  5COR A;  5KGU A;  4ZRZ A;  5FK9 C;  1VCI A;  5M5W B;  3OWE B;  2JA8 B;  1HH2 P;  2PI2 A;  1Y1W H;  1LV9 A;  2ZJP A;  1PV4 A;  4GKK Q;  1OXU A;  1S5C D;  4X65 Q;  4JI1 L;  4KKS A;  1LTI D;  1K8A C;  4FVM A;  3CKI B;  5E7N A;  2WP8 J;  3VR3 A;  1V1O A;  4WJ3 M;  1A0I A;  1KRS A;  3BJU A;  1A15 A;  4KY6 A;  1UNS A;  4IPH A;  3Q23 A;  1V8Q A;  2L4N A;  1ZEQ X;  3GTQ B;  2BE5 D;  3LWU A;  2NVY B;  1JOR A;  1TR5 A;  3E0E A;  1NR2 A;  3N6R A;  3FKI H;  3S15 B;  3PO2 H;  4PZ6 A;  1I5F A;  2WFW A;  2PYK A;  1PYS B;  1OXS C;  2Z6K A;  5C44 G;  1BBW A;  4KY7 A;  3CQZ B;  3CF5 A;  2J0T D;  2IT1 A;  1V9P A;  4KHP Q;  2E2D C;  1M4V A;  1JB3 A;  4EGV A;  3I70 A;  4DV5 Q;  1S5D D;  2QIL A;  3CP0 A;  4L6T B;  3H91 A;  4HJ8 A;  4DPG A;  5CV7 A;  4HR7 B;  1K83 H;  1YJN A;  2VL6 A;  2BH8 A;  1OXV A;  4X3K A;  1QOH A;  1FGU A;  1K8G A;  1STA A;  1U4R A;  2DUD A;  1VQN A;  3Q22 A;  1PTO B;  3S17 H;  4C3I B;  3S14 B;  1K9M C;  3T1Y L;  1B53 A;  1FYC A;  1O7Y A;  1VQ5 A;  1LUZ A;  1VQB A;  2B2Y A;  4NB3 A;  2WAQ B;  3F2D A;  1UEB A;  3FEW X;  4HIK A;  3CU7 A;  1B9M A;  4YHH L;  3WOE A;  4TKO B;  2PI2 E;  1HR0 L;  2AUJ D;  2SOB A;  1X54 A;  1RTO A;  2H1E A;  2KOL A;  4PNY A;  1G51 A;  1AP0 A;  1JE5 A;  2MGS A;  4YY3 Q;  4XT1 B;  2YTX A;  3I90 A;  2NVQ H;  1NMG A;  1XMO L;  3RZO B;  5C5L A;  1Q8I A;  4FXD A;  2ID0 A;  4DFA A;  4U68 A;  1RCV D;  1LTB D;  4DK0 A;  3J81 c;  1KTK A;  1L0Y B;  4ZKC B;  3I55 A;  3I73 A;  5J3B A;  2E2J B;  2AMC B;  1JB7 A;  1IKM A;  1SRO A;  1B4O A;  3A8I E;  1MJE A;  1HR0 W;  3AU7 A;  1VF7 A;  1K28 A;  2FFK B;  1LTT D;  3NWS A;  4ZYS A;  1IBM L;  3GTG H;  3CW2 C;  3M7N A;  3D3R A;  1QIL A;  1WTR A;  1OO9 B;  3GTL B;  1XXG A;  5G3L F;  2QEX A;  1IL2 A;  4P2C B;  4EQ5 A;  1D5M C;  4C2M H;  5C4X B;  4YWM A;  3DEP A;  3VA7 A;  4Q5V A;  1F9Q A;  3M3Y H;  1TKW B;  2DNE A;  2EYO A;  4GN5 A;  1W6J A;  4TSS A;  1JWU D;  2OEO A;  4GNX C;  2IX0 A;  5FOB B;  1Y1W B;  2YU9 H;  1OTC A;  1XWE A;  5EGT A;  3Q0A A;  3JAM c;  3STB C;  4BY7 H;  5I6Y A;  2CCZ A;  2Q8I B;  4POF A;  5FLX L;  3J81 L;  2HD3 A;  2VQF Q;  1SND A;  4DV4 L;  4DV7 L;  2ASB A;  5GAG C;  2HHH L;  1D1K A;  5EJW A;  4IUN A;  2Z8L A;  4K2L A;  4HCE A;  3TS2 A;  1JOQ A;  1WTV A;  1Y8N B;  3CME A;  1H95 A;  2JA8 G;  1PH3 A;  2L11 A;  4K0K L;  2XSC A;  3F2C A;  3EIV A;  2Q2T A;  3TBI B;  2WKC A;  2XGT A;  4I7A A;  1NNX A;  1WJJ A;  1NUC A;  5D3I B;  3G6J B;  1CSQ A;  1A62 A;  5D65 A;  1K83 B;  2K5Q A;  4JI5 Q;  5LMN Q;  4FDB A;  1D1I A;  1LYL A;  2EPB A;  3ULJ A;  4A3E B;  1KHI A;  1MD2 D;  3PUV A;  4BS9 A;  1DOM A;  2Q8R E;  1CHQ D;  5I2X A;  3I4N B;  1BQQ T;  1TWC B;  1NCV A;  2AWO A;  2A6E D;  4PZ7 A;  2JA5 B;  5IP9 G;  2X69 A;  1GUS A;  3PIO A;  3ULP A;  3P75 A;  3PIP A;  3J81 E;  3IAY A;  3HOY B;  1EIY B;  2SNS A;  2E75 C;  4A3G G;  1PH7 A;  2HUG A;  4Y7N H;  2EQS A;  4GKK L;  4X65 L;  2NB0 A;  5IYC G;  2NVQ B;  4V0B A;  4G7O C;  4XQN A;  2WAQ E;  2XRQ D;  4C3I G;  2IY5 B;  3CRK C;  1NTG A;  4R8N A;  3FPP A;  5EPK A;  2WAQ G;  2A68 D;  2A5H A;  3DM3 A;  1N36 Q;  1ENC A;  2TSS A;  3E9H A;  4GN4 B;  1A2U A;  4GS3 A;  4R4I A;  3DWQ A;  1PDQ A;  1FR3 A;  1GUO A;  1MI2 A;  4RFB A;  1J9O A;  1TWA H;  2XWB B;  3GTG B;  4O0A A;  1YNN D;  2E2H B;  4ZCK A;  1HNX L;  3OW7 A;  4DV5 L;  5IYB G;  2BE5 C;  3DUZ A;  1UE6 A;  1X3Q A;  2OF1 A;  2YV5 A;  3HS0 C;  2I46 A;  2EYH A;  4DAM A;  3BZK A;  1H9J A;  4ME5 A;  4NXN Q;  2YU9 B;  4X66 L;  1UE5 A;  4JI2 Q;  4FYD A;  3OHX C;  1F9S A;  3MEH A;  4MZ9 A;  1AEX A;  3SK6 A;  1KNE A;  2ZT9 C;  1RD9 D;  4Q0F A;  1HTP A;  2K75 A;  3L9A X;  5CYU A;  4BY7 B;  3OYY A;  2NVX H;  1EWH A;  4DA2 A;  4B3M L;  5JVG 3;  1A2T A;  2R92 H;  4RCN A;  2DGY A;  4JI0 Q;  1LT4 D;  2PO4 A;  4F87 A;  2E74 C;  2B2U C;  5IT9 c;  4ME3 A;  5GQO A;  4JOI A;  4M1U B;  1S72 A;  4BY1 G;  2NN6 G;  1SNC A;  3PF4 A;  1BBU A;  1VQ8 A;  1Y1W G;  2VUM H;  1WYD A;  1B3Q A;  4JI3 Q;  4LF9 Q;  1HFG A;  3S1Q B;  3BVZ A;  1U4L A;  3TQY A;  2KCT A;  2D0O A;  1AFP A;  2A69 C;  1NAP A;  1F2M A;  1B1Z A;  5DNF A;  4HJ5 A;  4RAU C;  2NN6 I;  4K6L A;  4A93 H;  4JBW A;  3CCU A;  1I50 H;  4JYA Q;  1SLJ A;  2Q8T A;  1PHJ A;  1U9R A;  4WJW A;  2Q2U A;  3K57 A;  5FJ8 H;  5KEE A;  3G6E A;  1JIC A;  4YCW A;  4A3B B;  2PQE A;  2EE1 A;  2K5H A;  2VS1 A;  1CZG A;  1N32 Q;  1DCZ A;  2O4X A;  3BS1 A;  3SEB A;  4EX5 A;  1K73 C;  2OT2 A;  1KAW A;  3Q6S A;  4MNO A;  1GKH A;  3CC4 A;  4A3E G;  1EIF A;  2LXJ A;  5H1S E;  1QNU A;  3I4N G;  3PO3 H;  4JPB W;  3LGJ A;  2CWP A;  3NQT A;  1EEF D;  2EY2 A;  1HNW Q;  3V96 A;  3UE1 A;  3J80 L;  2CH4 W;  1EYG A;  2E2I H;  5IYD H;  3I4M B;  2Z0S A;  3RN2 A;  4LUO A;  1VQG A;  3WDN A;  1I6H B;  5AJ3 Q;  2IX3 A;  1BUV T;  4OEM B;  2AQ2 B;  2R61 A;  1I4Q A;  4CJ0 B;  2PZW A;  1EFI D;  2JA9 A;  3GTJ B;  1ESF A;  3KLW A;  2PZT A;  5CV6 A;  1S5F D;  1STY A;  2A19 A;  2YTV A;  4IPC A;  4LF5 Q;  4FNF A;  3OW2 A;  1EY7 A;  2D2C C;  4XTC S;  2K6A A;  1LAC A;  3SDZ A;  4ZKB B;  1UE7 A;  3OTO L;  3RZD B;  3EQL C;  4DV2 L;  2ZXP A;  4X64 Q;  3LX0 A;  2K5W A;  1UUP A;  2GVA A;  4KJN A;  3VR4 A;  3S2H H;  4DAY A;  2X6G A;  1SFO B;  1SJE D;  5C0X H;  5I6W A;  5IP7 H;  2F0K A;  2F1M A;  5CV5 A;  4ZK9 B;  4GLV B;  3H6M A;  1N9W A;  4RHR A;  2F0J A;  1DOL A;  2CHB D;  3J80 E;  3W1G A;  3SK8 A;  1XJV A;  1MIU A;  1T5E A;  2F4V L;  1ZYR C;  1FJG L;  5LMN W;  1WTO A;  3MAQ A;  2RSO A;  1BCP D;  1BO0 A;  4FF2 A;  3PV0 A;  1EL0 A;  2A6E C;  1Y8P B;  1PH8 A;  3J81 i;  3NXW A;  2WAC A;  2F0S A;  4JCV E;  2F0I A;  4BY7 G;  4A3K H;  4A93 B;  3X3M A;  3M4Q A;  5DEH A;  1STG A;  4GOP C;  1B70 B;  2LS0 1;  1B7Y B;  1QNK A;  4LMQ D;  3VYU A;  1CA5 A;  1X6O A;  3TRZ A;  1I3Q B;  3EVQ A;  1LAB A;  1VQF A;  4LFA Q;  2P5Z X;  2PW5 A;  4DUZ Q;  3H0G H;  1AE2 A;  2UUB Q;  3H15 A;  3HOZ H;  1E22 A;  2PPB C;  1I4X A;  1PFS A;  3KF6 B;  2JK8 A;  4LF7 L;  1GHK A;  3M4O H;  1PYB A;  3NTH A;  1TS2 A;  3CCM A;  4NXN L;  1R4P B;  4C1N K;  4TRD A;  4JI2 L;  4NPS A;  1A6X A;  1YNN C;  2L55 A;  1E0B A;  3TS0 A;  2M9V A;  1D6E C;  3NEL A;  2X6L A;  4IN3 A;  4A3B G;  1KRT A;  3DLL A;  1QVC A;  4DR7 Q;  1SYG A;  1YJ9 A;  3BVG A;  2E2I B;  4JI7 Q;  1LTL A;  5L37 A;  2ZTE A;  2Z4I A;  1AZP A;  4P72 A;  4UP8 A;  2QKI C;  4GZY C;  4WOR A;  1EIG A;  2VQE Q;  1A3T A;  4JI3 L;  4ZQ3 A;  1DJR D;  3NEN A;  3ULL A;  4V19 0;  1STB A;  5BR8 L;  1EOT A;  5LL6 S;  5CBA E;  1I94 Q;  1RTN A;  3E5S A;  3TP6 A;  3ER0 A;  2B2W A;  1HNZ Q;  5G3L D;  4ABN A;  2EIF A;  1JWS D;  3NEM A;  5E1F A;  5EAY A;  3A5Z B;  3FRP B;  3Q8D A;  3DHQ A;  1ROD A;  3A0J A;  3BG3 A;  1U0L A;  4C3J B;  3W3A A;  2HQE A;  2DN8 A;  3HOU B;  1SMY D;  5DM7 3;  2B63 H;  4X3S A;  1WI5 A;  1VQ9 A;  1E2V A;  4DXF A;  5M5Y H;  2UU9 Q;  2AUK A;  3KF6 A;  1Y14 B;  1V1P B;  4QUC A;  3L2P A;  3G48 A;  3GO5 A;  2PCF B;  1EUJ A;  1VQC A;  5GAE C;  1K0R A;  2QCP X;  4LF6 Q;  1IHZ A;  4NP5 A;  3T1H Q;  3ICE A;  4HTH A;  4F88 A;  1SNO A;  3EFX D;  3KDF A;  2EZV A;  5C3E H;  5JOB A;  1EOV A;  2HDM A;  1WVL A;  4BBS H;  2V1C C;  3S1M B;  1E2Z A;  2PW7 A;  2MQH A;  3CCL A;  2Y0S G;  1WD1 A;  1E2W A;  4MTK A;  2ZTC A;  5AJ3 L;  2NWG A;  2WV6 D;  2JA7 H;  3DXJ C;  3C46 A;  4DV0 L;  1HXY D;  5LL6 X;  1O7L A;  2F0Q A;  3SHL A;  2MUY A;  5LMU Q;  1R9T H;  5NUC A;  1CQV A;  2PNR C;  4XQQ A;  1LTG D;  5J22 A;  4N9P A;  2VUM G;  2CVR A;  4ALP A;  2K1B A;  3HOZ B;  4HN7 A;  4K8I A;  5JJZ A;  4GNX B;  5M9O A;  1IBL Q;  1TWF B;  4MHE A;  1QG7 A;  4HCS A;  4DV3 Q;  1SN8 A;  1C4Q A;  4CJ2 C;  1GHJ A;  3NP8 A;  3DMU A;  4A93 G;  1W6K A;  1PTO D;  3MHB A;  1TS4 A;  2O2L D;  1QZG A;  4CKC A;  3K0X A;  4TVA B;  3TRE A;  1P8L A;  4DNI A;  4DV1 L;  4KY5 A;  2IHE A;  3URY A;  1WOC A;  3O13 A;  4OL7 A;  2EYF A;  1K0S A;  1MBY A;  1GUW A;  2JYO A;  1WCM H;  3NBH A;  1T5X D;  2V4D A;  1EU4 A;  1WFQ A;  1NJI C;  1D5X C;  4DK1 A;  1V1P A;  1BDO A;  1S5E D;  4J1M A;  1BCP F;  2CKZ B;  1IYV A;  5LHY 1;  1J5E Q;  1BBX C;  3K8A A;  4QCL A;  4NXM Q;  3HOV B;  1X3F A;  5EBD A;  3GV3 A;  1VQL A;  2JA6 H;  1X32 A;  1ICF B;  3RN5 A;  1G91 A;  1SYE A;  1EWI A;  4DR2 L;  1HJP A;  2ATW A;  2L5T A;  2F0W A;  4PZ8 A;  4TQU S;  3I72 A;  2R7Z H;  1G6P A;  2EY6 A;  4DF7 A;  3M4P A;  2KCM A;  1O7I A;  4A3G B;  2F4I A;  3PGZ A;  4CHT B;  3C1E A;  3BZD B;  3A5U A;  3A74 A;  3P1H A;  1SYB A;  3CHB D;  4J6H A;  4N8F A;  4OHJ A;  1HZA A;  3HOW H;  4R1J A;  3GP7 A;  1ONL A;  1LM0 A;  2UUB L;  5M3M H;  2Z6B A;  2SDF A;  4B3S L;  3D31 A;  1D2B A;  3S24 A;  4ID6 A;  5JEA G;  4GNX A;  2NVT H;  4IFD I;  1HRJ A;  3K6O A;  5M5Y B;  2HCI A;  4P73 A;  1CT1 D;  1JQY D;  1P16 A;  1EEI D;  2F03 A;  4FF4 A;  5JAV A;  4F7X A;  3I3C A;  3S1R H;  1HZ9 A;  4QB4 A;  3PSI A;  3RR5 A;  3VDY A;  3H3V C;  5C4Z A;  2RCN A;  1LT6 D;  2KJX A;  4OX9 L;  1TQO A;  2A1A A;  4BBR H;  4BBS B;  4C3J G;  1RKN A;  2CFM A;  3HOU G;  3PUY A;  4RH6 A;  5FLX c;  2YYZ A;  4R8I A;  5HGT A;  5C0X I;  2JEB I;  3M9B A;  4POG A;  2RQX A;  1YNJ C;  2VQE L;  3NHH A;  2XNA C;  1II3 A;  1PH5 A;  1BOS A;  3C3L A;  2K14 A;  2F0O A;  3K7U C;  5IIF A;  4QIW B;  1RJT A;  3NE5 B;  3R2I A;  4JI8 Q;  4L5S A;  1ZXT A;  4JK1 C;  1F2Z A;  5TSS A;  5C4J H;  3QR8 A;  3TN2 A;  1HNZ L;  4A3K G;  1EY0 A;  3PUW A;  4BXX G;  4BY1 B;  3ITP A;  2TMP A;  4AQY Q;  2KEN A;  4KK7 A;  1LLR D;  4XXE A;  1PH9 A;  1DON A;  3ZYY X;  2BOS A;  1U4P A;  1QCB D;  4A3J H;  1C7Y A;  2A6H D;  2UUA Q;  3CD6 A;  2SNM A;  3TSS A;  4JBM A;  2R93 H;  2RDF A;  4M8A A;  3H0G G;  4A76 A;  2UU9 L;  3HOZ G;  1C9O A;  1DGS A;  2OWO A;  1IKL A;  1KLG D;  3EJI A;  2WIN B;  4CGY B;  1CKN B;  3L0O A;  1GUG A;  1LTS D;  1YHB A;  2JA6 B;  1ESR A;  2H4O A;  3FKI B;  1GO3 E;  1PA6 A;  3OMC A;  3PO2 B;  2QGQ A;  4DR5 Q;  4DR1 Q;  3SE0 A;  4ULL A;  1GUN A;  2K01 A;  2MFI A;  4LK1 C;  2CW0 D;  5I4D A;  3F2B A;  3VR2 A;  1SE8 A;  2KA7 A;  1E1T A;  3PMF A;  1GJX A;  5DAU A;  4IUT A;  5FKA C;  1ICW A;  3MC0 B;  2JJQ A;  1CTM A;  4QGU A;  3A8K E;  2UXD Q;  1N33 L;  4B3T L;  4G57 A;  4L5Q A;  1FVI A;  5LMU L;  1V1Q A;  4OXP A;  3HOV G;  1HUM A;  5K36 G;  2RHS B;  1EQV A;  3S17 B;  1JJC B;  4N8X 1;  1J8I A;  2HT1 A;  5GRO A;  2QW7 A;  4IUU A;  4PMC A;  4L63 B;  1MKH A;  4RWS C;  1Q81 C;  1PTO F;  2NVT B;  4DV3 L;  2L15 A;  1KDC A;  5FLX E;  4DUY Q;  3J81 j;  3AEV A;  2RDH A;  1S5B D;  2UXC L;  3HKZ B;  4YIJ A;  2ZXO A;  1YHA A;  5K5P A;  3KFU A;  2JE6 I;  5M5X H;  1BR9 A;  4HJ7 A;  2EY1 A;  3RLN A;  4RKL A;  4LF8 Q;  2B2U A;  1X55 A;  2K05 A;  3H09 A;  4OWW B;  4A3D H;  4EVO A;  3GTM H;  1VQI A;  5E3F A;  1PTO C;  2B63 G;  1F9P A;  2OXP A;  1QE6 A;  3M7G A;  3OOC A;  1JCK B;  2N78 A;  5JPN C;  4A3C H;  1CKN A;  3CPW A;  4R4T A;  3QOL A;  1KIX A;  2NZO A;  2CQA A;  2C35 B;  1SSO A;  3T4A C;  5IOD A;  3CAM A;  3NQI A;  1Y1V H;  4KD3 A;  1IXR A;  1CHP D;  3FPU B;  3K5O A;  4KHP L;  2Q2H A;  5C4J B;  1FNW A;  5KNC A;  4C2M B;  4HJA A;  1IBK Q;  2QA4 A;  4UY8 C;  1UEA B;  4BBS G;  4YWK A;  3ERQ A;  2MP1 A;  3M85 A;  4H13 C;  4LFC Q;  1HQM C;  1Q46 A;  3M3Y B;  1E24 A;  3HGB A;  2M2L A;  3S16 H;  2K5N A;  4QIW E;  4IZ8 A;  4H0L C;  1PRT B;  4Y52 H;  4A3J B;  1EZ6 A;  4CDE C;  4DR6 Q;  1X65 A;  3GTK H;  2R93 B;  1KDB A;  1KC8 C;  1O80 A;  1S40 A;  2LXK A;  1PFN A;  5KND A;  1VQD A;  2OQ0 A;  4IUR A;  4JVZ A;  3KJP A;  2A73 B;  5ELF A;  4E6I A;  4YY3 L;  1X3E A;  5IGE A;  4LFB Q;  1HHV A;  4PMW A;  2BCO A;  4DNT B;  1VQM A;  1QZH A;  1TWH H;  2B39 A;  3J7A 5;  4JV5 Q;  2BDN A;  4GOP B;  1QVG A;  2WB1 B;  3P20 A;  3S2D H;  3JC6 6;  3U4V A;  3J80 c;  2CH4 A;  4S3S A;  4IUQ A;  3FMC A;  5IGF A;  1LT3 D;  1SXT A;  1A3V A;  4DAY B;  1C8C A;  1BF4 A;  5KIX A;  1Q12 A;  5T1I A;  3HZX A;  3CRL C;  2JA6 G;  3FKI G;  1GXD C;  4GKJ Q;  3PO2 G;  3HP3 A;  2IPK D;  1S4Z A;  2PZU A;  2SEB D;  1S3O A;  2QDB A;  3ZJY C;  4OO1 H;  3D4D A;  1XNQ Q;  2BH2 A;  2MO1 A;  3NUC A;  2PQA A;  1M8A A;  1F2Y A;  3KLS A;  2MJ8 A;  3R2T A;  2EJM A;  4JI6 Q;  3FVQ A;  4Y7N B;  1G8Z D;  3CC7 A;  5C4H A;  4KKU A;  5HY6 A;  2KUM A;  2O5I C;  2OTL A;  4OEL B;  1VQK A;  3HOW G;  1WD0 A;  3VYS A;  3MA2 B;  2K52 A;  4LW1 A;  5JPM C;  1AH9 A;  2AWN A;  4JI4 Q;  2ZM6 Q;  1PZJ D;  2RF4 A;  1SAP A;  2VQF L;  3HKZ E;  5A2Q L;  3AB9 A;  5IGB A;  4IPD A;  3HFZ B;  4IFD H;  3GTP H;  3K5M A;  2MO0 A;  3HKZ G;  1UWV A;  4RHS A;  1O78 A;  2A6H C;  3D4R A;  4DR5 L;  4HIM A;  4DR1 L;  1B8A A;  2KHJ A;  1G29 1;  1JOO A;  1TWA B;  2VB2 X;  4UAI A;  2CWA A;  2E5L Q;  4GOP A;  4BA1 I;  3Q24 A;  4BBR G;  1W2B A;  4DK6 C;  1KL9 A;  2I07 B;  4KV6 A;  1YVC A;  2RSN A;  3KYH C;  2MNA A;  4JI5 L;  3C1F A;  3D6W A;  1STN A;  5LMN L;  2XWJ B;  4MN3 A;  1X3P A;  4LJZ C;  5BN4 A;  2I0Q A;  4A75 A;  1SE4 A;  1BKB A;  1YEZ A;  2CW0 C;  2L9H A;  4X3U A;  2XRS D;  3MWY W;  2NVX B;  5I9O A;  3MXP A;  4UDU C;  2VNU D;  2R92 B;  1KAB A;  1EY4 A;  2R7F A;  4DUY L;  3NTI A;  3RMH A;  2G9D A;  2Y0S B;  3H3V H;  1RF2 D;  3K58 A;  5A2Q E;  1B2T A;  1K3B C;  1SMX A;  2WKD A;  2K5V A;  4ZAI A;  4A3I H;  1ZKO A;  5COY A;  4LAA A;  2F0P A;  4LF8 L;  1Y69 U;  2EYP A;  1LO5 D;  2VUM B;  2O5J C;  4JI1 Q;  3L7Z C;  2R6G A;  4A3J G;  5CGK A;  3MFY A;  2M00 A;  4NKL A;  1M1K C;  1NY4 A;  4JBK A;  2R93 G;  2MHV A;  1N36 L;  1Q90 A;  1I4P A;  5C5M A;  1I50 B;  2NTS A;  2KHI A;  1WTW A;  1X3G A;  2GA4 B;  1ML0 D;  4IOC A;  1JOK A;  3IFT A;  3DWP A;  4A3F H;  1HZB A;  1CA6 A;  1H9R A;  1YBY A;  4OWX B;  1L0X B;  2WB1 E;  1TII D;  4RKB A;  1Z47 A;  1CM9 A;  2XN9 C;  3PUX A;  3U50 C;  4HMI A;  2A68 C;  4H7B A;  4LUZ A;  4OWT B;  5FO9 B;  5D3D A;  2WB1 G;  2XIW A;  2RA4 A;  4LFC L;  4WFN 3;  3D4W A;  2VXW A;  2RHQ B;  4KI0 A;  1U4M A;  2EJF C;  1UE1 A;  1DOK A;  1CQF A;  3IL8 A;  1SYF A;  2GVB A;  1JC7 A;  2QDL A;  1HA5 A;  2FMM A;  5CBE E;  4X62 Q;  4J15 A;  3R8B A;  4AYB G;  2ZJR A;  4XIG S;  3MXN B;  4DR6 L;  3UDF A;  1AZQ A;  5EPL A;  3A8J E;  3KDF B;  5C6A A;  3PO3 B;  3NBI A;  1VQP A;  4ZLT F;  3NTK A;  4JI0 L;  1HTL D;  2EYM A;  2QEJ C;  3HOX H;  2UUC Q;  2YTY A;  3I91 A;  2LMC B;  2XTI A;  5M3F H;  3GTP B;  4FF3 A;  3QOJ A;  2I5M X;  2KBN A;  5CMD A;  1YIT A;  3I8Z A;  5M5W H;  4L5R C;  2RKS A;  4YCU A;  3GD7 A;  5EBC A;  3K59 A;  3RLO A;  4LNQ A;  3E3X A;  4IO9 A;  1EYA A;  4LF9 L;  1XMO Q;  4JV5 L;  1SE2 A;  1ET9 A;  2C9O A;  3QB3 A;  1YNX A;  5KYL A;  3A7A B;  4EQN A;  2KQ3 A;  1VQA A;  4O2D A;  4H44 C;  4JYA L;  3SXH A;  1TXY A;  5EKI A;  4A3C G;  3S2H B;  3N52 A;  3S15 H;  1TS5 A;  1XTC D;  3EA6 A;  5JEA J;  3NBH B;  2RBM A;  1IBM Q;  1Y1V G;  1XNQ L;  1TVX A;  1GD7 A;  2ZXR A;  3STB D;  5IE8 A;  1N32 L;  4A3L H;  1TS3 A;  1EU3 A;  1HUN A;  2KCN A;  3A56 A;  3VA5 A;  2G9H D;  1HZC A;  4A3I B;  4DGZ A;  1QVF A;  4IJL A;  3W1B A;  1GM5 A;  1XX8 A;  3BVM A;  1TWG H;  2C5C A;  4QQB X;  3IRB A;  3PCO B;  4X3T A;  4G7Z C;  1PTO H;  2EVB A;  3MXN A;  2NZ1 D;  3S14 H;  1QWY A;  1G6Z A;  3MZ5 A;  2ZM6 L;  1H9K A;  2WII B;  1HNW L;  1PYW D;  2Y0S E;  5CV9 A;  3KLS X;  3UDG A;  3FHW A;  2E76 C;  1ASZ A;  3GQB A;  4A3K B;  5BN5 A;  4LF4 Q;  2R92 G;  4DV4 Q;  5FO7 B;  1I6V C;  4DV7 Q;  1M90 C;  2HHH Q;  1NE3 A;  2QF7 A;  1K8M A;  4DR3 Q;  5EQ0 A;  3MXU A;  3GTO H;  5T1G A;  3UDI A;  3KF8 B;  4XQJ A;  3ND9 A;  4UP7 A;  3RZO H;  3BDL A;  4CBV A;  1LTA D;  4LF5 L;  4CKE A;  4K0K Q;  1Q1B A;  2E5L L;  2K33 A;  1DM0 B;  2ICE C;  3H0G B;  1ENA A;  4GN3 B;  2B2T C;  2ES2 A;  2F0L A;  3KUP A;  1MSH A;  4P71 A;  1CI3 M;  1VMC A;  5DM6 3;  5HUR A;  3L3O C;  4X64 L;  3M4O B;  1EYD A;  4N9T A;  1FGB D;  1L1O C;  1PZI D;  3CPF A;  1XNR Q;  1CKM A;  3IFD A;  1Z7T A;  1SNM A;  4IOA A;  2ZTD A;  1I4R A;  5FJ8 G;  1JR0 D;  2B2V C;  4X6A H;  3V05 A;  2F0E A;  1IW7 D;  1XPR A;  1VQ4 A;  1T9H A;  3G4S A;  4BWG B;  3GTL H;  2JXM B;  3A55 A;  3R3O A;  5C4X H;  3K7A H;  3HOX B;  3PF5 A;  1HA6 A;  2DY7 A;  4IUV A;  3TP8 A;  2IW3 A;  2EYJ A;  2HIX A;  2NZH A;  2ICI A;  4ODG A;  1B9N A;  3LWE A;  3VYR A;  1HPC A;  3MFG A;  4OO1 I;  3U9S A;  4QUF A;  3PUZ A;  1ILQ A;  2B29 A;  2EJG C;  3J80 i;  3PO3 G;  4DK3 C;  1RL2 A;  3OMG A;  1CKO A;  1VDZ A;  2LKV A;  1YHQ A;  1DYQ A;  3M4Y A;  3AFQ A;  1CUK A;  5IYD G;  4HED A;  5HGQ A;  1G2S A;  4IFD G;  1EZ8 A;  1BCP C;  1PLF A;  3I4O A;  1X56 A;  5IGC A;  2F0H A;  3KF8 A;  4QMG A;  4KTA A;  4RGO S;  4LFA L;  4R9W A;  4KMU C;  4IQZ A;  5EPJ A;  4DUZ L;  3FP9 A;  1SDF A;  3RLF A;  3T51 B;  2B63 B;  3AQQ A;  1HNX Q;  2JQO A;  2ENB A;  4K2K A;  3TME A;  4C1N I;  3UI2 A;  2B3G A;  3X3N A;  3QO2 A;  1QJO A;  4RG1 A;  4A4I A;  3BYY B;  4DV6 Q;  3B6Y A;  3E9I A;  5CV4 A;  4A3E H;  4X62 L;  1TWG B;  4X66 Q;  1HCZ A;  4HIO A;  3I4N H;  4KHV A;  5C0X G;  5CR3 A;  1TWC H;  1UAP A;  5IP7 G;  3KK7 A;  1E1O A;  2B8F A;  3W5O A;  3T53 B;  5C3E B;  2JA5 H;  4DR7 L;  4B3M Q;  3TP5 A;  2F0M A;  2A69 D;  2UUC L;  3HOY H;  4JI7 L;  2EXD A;  2L12 A;  2L0C A;  4OIK A;  1CZW A;  1KXL A;  4UHV A;  2PMZ E;  2ZJQ A;  1Q1E A;  4H02 A;  2JA7 B;  1AW7 A;  3GTO B;  3AYH B;  3GV6 A;  2VY3 A;  4A3I G;  1R9T B;  1ENF A;  1H9S B;  2D9U A;  3KBG A;  1LT5 D;  2F0D A;  1SE3 A;  3H3V I;  1PH4 A;  1MHW C;  2GN5 A;  1SBB B;  1I94 L;  4C3H H;  2LFN A;  2N55 A;  1BNZ A;  2Z6K C;  1K8O A;  2IWH A;  4QF4 A;  4DU9 A;  2RCF A;  4RMF A;  1VQ6 A;  1FL0 A;  1AE3 A;  4A3F G;  2D62 A;  3MEF A;  3BYT B;  1NMF A;  3G7L A;  5CC4 A;  3OIQ A;  1WCM B;  4GLX A;  1MSG A;  2N49 A;  5D14 A;  2E2H H;  1VS0 A;  2IHF A;  2JSO A;  3K7A B;  5EKL A;  3CMA A;  2N88 A;  5KYI A;  4DN4 M;  5IWA Q;  1ET6 A;  3R93 A;  2FMC A;  4HMJ A;  3P7J A;  2B2Y C;  1I4H A;  4APV A;  4FO2 A;  4B08 A;  4LF6 L;  1XYI A;  3T1H L;  3QIA A;  1V43 A;  4CKB A;  1QUQ B;  1PFM A;  4G4K A;  1SMY C;  2VZA A;  2UXB Q;  2F52 A;  3CCE A;  2F0G A;  4LF4 L;  2R7Z B;  1SNQ A;  1EFW A;  2KEE A;  3RD4 A;  1EY8 A;  2KED A;  3HOX G;  2VB3 X;  4DR3 L;  5M3F G;  4O42 A;  5I9P A;  2ALY B;  1QB5 D;  1Z9F A;  3KBX A;  1XTD A;  2DY8 A;  1N8R C;  2JEA I;  1H9S A;  3HOW B;  2HIV A;  1IZ6 A;  3SK4 A;  4HAE A;  5M3M B;  3S1Q H;  1IBL L;  4NW2 A;  3SVM A;  5IGG A;  2J4X A;  3TP7 A;  4XYO A;  1PRT D;  3OTO Q;  4A3M H;  4G7H C;  5KRU A;  3CCV A;  3VR6 A;  4DV2 Q;  3CCJ A;  1XNR L;  3KOJ A;  3S1R B;  3EBE A;  5ELB A;  3KJO A;  1ZYR D;  2AQ3 B;  3JAM L;  3H94 A;  1SYD A;  4NMZ A;  4A3B H;  3NWT A;  2OCE A;  3A7L A;  3BZC A;  4FP5 D;  3F8T A;  4I7Z C;  4XDX A;  1H9M A;  4BBR B;  1XMQ Q;  2D5D A;  3K0Y A;  4DNR B;  4CDD C;  4A3L G;  1EIH A;  1Q82 C;  5F2D A;  4LUV A;  3CC2 A;  2D0P A;  2KCC A;  3A54 A;  1KQS A;  1J5E L;  1VQJ A;  4OGQ C;  4PMB A;  2F4V Q;  4NXM L;  1TY0 A;  5J1Z A;  3I2Z A;  1KNA A;  1FJG Q;  2A8V A;  2HCC A;  5ELO A;  2I5H A;  1IW7 C;  4QL5 A;  4HJ9 A;  1QUQ A;  3NSW A;  1F77 A;  2N3S A;  4C3H B;  2HDL A;  3GDE A;  5C3E G;  4KJO A;  3QWN A;  1Q3L A;  2PQA B;  3S9W A;  2Z9H A;  3I4M H;  4FXG C;  3E0J A;  3NK9 A;  1TY2 A;  4K14 A;  5A35 A;  1I6H H;  1NR4 A;  2JA7 G;  2EXZ A;  2BA0 A;  4NDX A;  2LY7 A;  3GTJ H;  2K03 A;  2F3I A;  2Q2I A;  2F0T A;  3JAM E;  1XPU A;  1RDP D;  4DR4 Q;  1E7Z A;  4UP9 A;  2OQK A;  3MTS A;  1Y8O B;  4IPG A;  3UE0 A;  4DAP A;  3NPP A;  3U9O A;  3RNU A;  4JBJ A;  3RZD H;  4PV1 C;  4F8M A;  1EY9 A;  4LF7 Q;  1BVS A;  1EQQ A;  4KLK A;  4DV6 L;  1STH A;  3OPO A;  2F3W A;  4QY7 A;  1BXT A;  1KD1 C;  3ONA B;  1PXU A;  2EDG A;  2AHO B;  1SFO H;  4JW0 A;  4U67 3;  1WCM G;  3DWA A;  5C4X G;  3TZD A;  3D0F A;  4YCV A;  2IX1 A;  4K8J A;  3WWV A;  4P75 A;  3T16 A;  1EYC A;  2VW9 A;  1RHP A;  4RGM A;  1A3U A;  1X9N A;  4AYB B;  3OIP A;  1DD2 A;  3HRZ C;  1Q8K A;  2IJ0 A;  2K50 A;  2F3V A;  3TDQ A;  4QJF A;  3HEJ A;  4JI8 L;  5BR8 Q;  2DJF C;  2G5D A;  2OTJ A;  4JC0 A;  1N34 Q;  3WOF A;  2KEC A;  5ELE A;  5BN3 A;  2R7Z G;  2FHT A;  4A3M B;  4AIM A;  5FLM H;  1PMR A;  4AQY L;  4B9X A;  4RA8 A;  3T56 B;  3V2T A;  1EY5 A;  3S1N H;  4FXK C;  3K81 C;  3I56 A;  2FXQ A;  5M5X B;  4LWC A;  3K80 C;  4OON A;  1SEB D;  1I3Q H;  3ERO A;  2UUA L;  1F9R A;  1GUT A;  4A3D B;  5M3M G;  4K5W A;  3GTM B;  2CQO A;  2R7D A;  4ZUI A;  4L5T A;  5IT9 L;  1SJH D;  5IWA L;  3VYT A;  1IYU A;  1FD7 D;  2N8N A;  1I4G A;  1MGS A;  1DZ1 A;  2FJ2 A;  1Q7Y C;  5C44 H;  2KHS A;  3T13 A;  4WRD A;  3E6Z X;  1Y1V B;  1GVP A;  4JOI C;  2UXB L;  4IJH A;  5GAH C;  3QJY A;  1D7Q A;  3AMU A;  2B8G A;  3K5L A;  2JA5 G;  3PIO 3;  5C3X A;  1SRU A;  2AKW B;  3DEO A;  3PIP 3;  3HOY G;  4RCO A;  3U4Z A;  4EQP A;  4R4O A;  5FO8 B;  1GOZ A;  2UXD L;  1VQ7 A;  3CXC A;  3S16 B;  1SYC A;  4I65 A;  1Q86 C;  5AFW A;  4DV0 Q;  4HSP A;  1ASY A;  4B3R Q;  3KLR A;  1TT2 A;  1W3S A;  1C0A A;  4B9W A;  2KVM A;  1R4Q B;  5JEA H;  1PRT F;  3LNN A;  4FF1 A;  2K32 A;  3GTK B;  4YWL A;  3AFP A;  3MVV A;  2HQL A;  5ELD A;  1O7Z A;  4C3H G;  1STE A;  4HSV A;  4K5X A;  5IT9 E;  1E3P A;  2PNH A;  4BA2 I;  5ISR A;  3U58 A;  1PH2 A;  2Z1C A;  4DV1 Q;  4K5V A;  3ERS X;  2K04 A;  1KDA A;  3K5N A;  1TWH B;  4C56 C;  4C3J H;  1XMQ L;  1G2T A;  1VMP A;  3HOU H;  1D5Z C;  1CK1 A;  2IL8 A;  1PRT C;  3S2D B;  2JN4 A;  1CSP A;  5EKK A;  1JJG A;  3BDC A;  4EQO A;  5C3W A;  5IY0 A;  5KNB A;  4O1N A;  2I5L X;  1B50 A;  4ILW A;  1PVO A;  2K7V A;  1JT8 A;  4KN4 C;  4MTN A;  4DR2 Q;  1L1O B;  2EY5 A;  1HFN A;  1IBK L;  3DM1 A;  3I7F A;  4J8Q A;  1L0W A;  3J7A F;  3S1M H;  3J7Y W;  1TU2 B;  2AQ1 B;  4BXX H;  3W2D A;  2NTT A;  3IKJ A;  2MPM A;  4AYB E;  1OXT A;  3S1N B;  3D8G A;  3PQI A;  1ILP A;  1PH1 A;  4KKT A;  4RGN A;  3OSO A;  1U5K A;  1A8V A;  3ND8 A;  2F0V A;  4IUP A;  1SR3 A;  4DR4 L;  3T1Y Q;  4B3S Q;  1EY6 A;  3D6C A;  1EQT A;  1PZK D;  1TWF H;  2XVS A;  2L1B A;  4P74 A;  2H5X A;  3C2P A;  4L8J A;  4CDF C;  2J7Z A;  2K4K A;  5ELC A;  2RDG A;  5GAD C;  4OIJ A;  4DXG A;  4YHH Q;  4CJ1 B;  4A3M G;  1K3R A;  2F0F A;  3JAM i;  1F2L A;  1HR0 Q;  3F2U A;  3CCR A;  1C48 A;  3EN2 A;  2JA8 H;  1YNJ D;  4LFB L;  5C44 B;  3J7Z C;  2NBF A;  3F1Z A;  1D8L A;  1IL8 A;  5JJI A;  4OX9 Q;  3RUZ A;  3HG9 A;  4GLA C;  5JJL A;  3OWF A;  2NYZ D;  1BCP B;  4A3D G;  1NSN S;  1DXM A;  4UPA A;  2DNC A;  2K5D A;  4IFD J;  2Z4H A;  3BDO A;  5ELN A;  3GTQ H;  2NVY H;  1L2F A;  2BDO A;  4DAV A;  1WTP A;  4RGT A;  3HOV H;  3SGI A;  1JE4 A;  1A63 A;  5K36 H;  2B2T A;  4GKJ L;  1WTH A;  2DJG C;  4ZUJ A;  3I4L A;  5CV8 A;  1VF5 C;  3CCS A;  1NBW A;  4XYQ A;  1IYJ B;  3CQZ H;  5IP9 H;  1FNV A;  3J7A V;  1L1O A;  1N34 L;  4Z9C B;  1MJC A;  1VQO A;  3VR5 A;  1WTX A;  2B2V A;  4KD4 A;  4A3G H;  1AN8 A;  1RIP A;  3I4M G;  4JI6 L;  4HID A;  2NUC A;  4R4Q A;  1SNP A;  2LSS A;  3SR1 A;  2PMZ B;  5C0X J;  5IYC H;  1PH6 A;  5JJK A;  1OXX K;  4K6D A;  3FDT A;  3TZU A;  1EWC A; 
#chains in the Genus database with same CATH homology
 3BU2 A;  1KXL A;  3CAM A;  4C3I H;  4DV2 L;  1Y1V H;  2PMZ E;  1IXR A;  2ZJQ A;  4X64 Q;  1Q1E A;  4JI4 L;  2GVA A;  4H02 A;  4KHP L;  2Q2H A;  4AH6 A;  3AYH B;  3TEH B;  2VY3 A;  3S2H H;  4HJA A;  4A3I G;  1IBK Q;  4UY8 C;  2QA4 A;  1YI2 A;  4BBS G;  5IP7 H;  4YWK A;  4LFC Q;  3M85 A;  2BA1 A;  1Q46 A;  1E24 A;  1YIJ A;  1J6Q A;  3H3V I;  4GLV B;  1PH4 A;  2K5N A;  3S16 H;  1I94 L;  2GN5 A;  4QIW E;  4C3H H;  1XPO A;  1N9W A;  2Z6K C;  3HKS A;  4Y52 H;  3W1G A;  1XJV A;  1MIU A;  4DR6 Q;  4R4C A;  1X65 A;  2F4V L;  3GTK H;  4RMF A;  1FJG L;  1KC8 C;  5LMN W;  1S40 A;  5IYB H;  1FL0 A;  2LXK A;  3UDX A;  1VQ6 A;  4DKA C;  1AE3 A;  1VQD A;  1YZ6 A;  2D62 A;  3MEF A;  3PV0 A;  4A3F G;  1NMF A;  2OQ0 A;  1PH8 A;  1JMC A;  4GLX A;  3KJP A;  2E8G A;  3J81 i;  2E2J H;  1VQH A;  2N49 A;  1N33 Q;  2E2H H;  4JCV E;  4B3T Q;  4BY7 G;  3CCQ A;  1VS0 A;  4B3R L;  4YY3 L;  1X3E A;  4WJ4 A;  1EQR A;  2IHF A;  4A3K H;  1VQE A;  4LFB Q;  3G71 A;  4PMW A;  3CMA A;  3M4Q A;  5IWA Q;  4KHZ A;  1VQM A;  1QZH A;  1TWH H;  3J7A 5;  4JV5 Q;  4GOP C;  5DLQ E;  4APV A;  4GOP B;  1B70 B;  1QVG A;  4LF6 L;  1B7Y B;  4JG2 A;  3S2D H;  3T1H L;  1YJW A;  4OO1 G;  3JC6 6;  1X6O A;  1V43 A;  3TRZ A;  3U4V A;  3J80 c;  1JJ2 A;  1VQF A;  4LFA Q;  1QUQ B;  4PG3 A;  5FLM G;  4BY1 H;  2VZA A;  2UXC Q;  2UUB Q;  4DUZ Q;  3H0G H;  1AE2 A;  3H15 A;  3HOZ H;  2UXB Q;  1E22 A;  2F52 A;  3CCE A;  1VCI A;  4DAY B;  4LF4 L;  1HH2 P;  2PI2 A;  1Y1W H;  1EFW A;  2ZJP A;  1Q12 A;  1PV4 A;  1OXU A;  1PFS A;  4X65 Q;  3KF6 B;  2JK8 A;  3FKI G;  4JI1 L;  2JA6 G;  4GKK Q;  4LF7 L;  3PO2 G;  4GKJ Q;  3HOX G;  4DR3 L;  3M4O H;  1PYB A;  1K8A C;  1S3O A;  3CCM A;  5M3F G;  5E7N A;  2ALY B;  3ZJY C;  4NXN L;  1Z9F A;  2WP8 J;  4WJ3 M;  1KRS A;  1A0I A;  3BJU A;  1XNQ Q;  2BH2 A;  4JI2 L;  1XTD A;  2MO1 A;  4NPS A;  1N8R C;  2JEA I;  2PQA A;  4IPH A;  3TS0 A;  2HIV A;  3NEL A;  1IZ6 A;  4A3B G;  1KRT A;  3E0E A;  3S1Q H;  3DLL A;  1IBL L;  4JI6 Q;  1QVC A;  4DR7 Q;  3CC7 A;  3FKI H;  3PO2 H;  4PZ6 A;  1I5F A;  2WFW A;  1YJ9 A;  1PYS B;  5HY6 A;  1OXS C;  2Z6K A;  2OTL A;  4JI7 Q;  5C44 G;  3OTO Q;  1BBW A;  4A3M H;  1VQK A;  1LTL A;  3CCV A;  4DV2 Q;  2ZTE A;  3HOW G;  3CCJ A;  1XNR L;  2K52 A;  4LW1 A;  3CF5 A;  1AH9 A;  2IT1 A;  1V9P A;  2AWN A;  3KOJ A;  4P72 A;  2ZM6 Q;  4JI4 Q;  4KHP Q;  4UP8 A;  2RF4 A;  3EBE A;  2VQF L;  3KJO A;  3HKZ E;  4DV5 Q;  2VQE Q;  3CP0 A;  4A3B H;  4JI3 L;  4HJ8 A;  4DPG A;  4IPD A;  3NEN A;  3ULL A;  2OCE A;  3HFZ B;  1K83 H;  1YJN A;  2VL6 A;  2BH8 A;  3BZC A;  1OXV A;  2MO0 A;  3F8T A;  5BR8 L;  3GTP H;  3HKZ G;  1UWV A;  1XMQ Q;  1I94 Q;  1FGU A;  1K8G A;  4A3L G;  4DR5 L;  4HIM A;  2DUD A;  4DR1 L;  1VQN A;  3ER0 A;  1Q82 C;  4LUV A;  3CC2 A;  1HNZ Q;  1B8A A;  2D0P A;  2KHJ A;  1G29 1;  3S17 H;  1K9M C;  3T1Y L;  1KQS A;  2CWA A;  2EIF A;  1VQ5 A;  1J5E L;  1VQJ A;  2E5L Q;  1LUZ A;  1VQB A;  4NXM L;  3NEM A;  4BA1 I;  4GOP A;  4NB3 A;  2F4V Q;  3I2Z A;  5EAY A;  4BBR G;  1FJG Q;  3F2D A;  2A8V A;  1W2B A;  1UEB A;  3A5Z B;  2I5H A;  5ELO A;  4HIK A;  4DK6 C;  1KL9 A;  4QL5 A;  3Q8D A;  4YHH L;  1YVC A;  4HJ9 A;  3KYH C;  2MNA A;  4JI5 L;  3A0J A;  2PI2 E;  1QUQ A;  1U0L A;  5LMN L;  1HR0 L;  2N3S A;  1X54 A;  1G51 A;  3GDE A;  1JE5 A;  2B63 H;  5C3E G;  1WI5 A;  1VQ9 A;  4YY3 Q;  5M5Y H;  2I0Q A;  4A75 A;  2UU9 Q;  2YTX A;  2PQA B;  2NVQ H;  3KF6 A;  1BKB A;  1NMG A;  1Y14 B;  1YEZ A;  1XMO L;  3L2P A;  3I4M H;  3G48 A;  3GO5 A;  2ID0 A;  1EUJ A;  1VQC A;  5GAE C;  1I6H H;  1K0R A;  4LF6 Q;  2VNU D;  2JA7 G;  2BA0 A;  2R7F A;  4DUY L;  3T1H Q;  3GTJ H;  3J81 c;  3ICE A;  3H3V H;  2F3I A;  2Q2I A;  3I55 A;  5J3B A;  1XPU A;  3KDF A;  4DR4 Q;  1E7Z A;  1SMX A;  4UP9 A;  2OQK A;  2K5V A;  5C3E H;  2AMC B;  4A3I H;  1EOV A;  4IPG A;  1SRO A;  1JB7 A;  3UE0 A;  4BBS H;  1MJE A;  1HR0 W;  2V1C C;  3RNU A;  4JBJ A;  3RZD H;  4LF8 L;  4JI1 Q;  2MQH A;  3L7Z C;  2Y0S G;  3CCL A;  4LF7 Q;  1BVS A;  2R6G A;  2ZTC A;  4A3J G;  1IBM L;  3CW2 C;  5AJ3 L;  4KLK A;  4DV6 L;  1EQQ A;  1M1K C;  3GTG H;  3M7N A;  4QY7 A;  2JA7 H;  2QEX A;  1IL2 A;  1NY4 A;  4DV0 L;  1KD1 C;  4EQ5 A;  4JBK A;  2R93 G;  2AHO B;  4C2M H;  4YWM A;  1SFO H;  1R9T H;  5LMU Q;  1N36 L;  3M3Y H;  2VUM G;  4ALP A;  2KHI A;  4GN5 A;  1X3G A;  1WCM G;  4GNX C;  4IOC A;  2IX0 A;  4GNX B;  1IBL Q;  4A3F H;  2YU9 H;  1HZB A;  4DV3 Q;  1OTC A;  1SN8 A;  1YBY A;  5C4X G;  4OWX B;  3D0F A;  4YCV A;  2WB1 E;  2IX1 A;  4A93 G;  1Z47 A;  3WWV A;  3STB C;  4P75 A;  3JAM c;  4BY7 H;  2VW9 A;  1QZG A;  3PUX A;  3K0X A;  2CCZ A;  4TVA B;  3TRE A;  3U50 C;  1P8L A;  4POF A;  4LUZ A;  4OWT B;  4DNI A;  4DV1 L;  2WB1 G;  2IHE A;  1X9N A;  2VQF Q;  4DV4 L;  4LFC L;  1WOC A;  4DV7 L;  1Q8K A;  2ASB A;  2K50 A;  5GAG C;  2HHH L;  2RHQ B;  4KI0 A;  1WCM H;  4QJF A;  4JI8 L;  1UE1 A;  2GVB A;  5BR8 Q;  1WFQ A;  3TS2 A;  2OTJ A;  4JC0 A;  4X62 Q;  1N34 Q;  3CME A;  1NJI C;  1H95 A;  2JA8 G;  4J15 A;  2ZJR A;  4AYB G;  1PH3 A;  4XIG S;  2R7Z G;  3MXN B;  4AIM A;  5FLM H;  4K0K L;  4DR6 L;  3UDF A;  3KDF B;  2CKZ B;  4AQY L;  1J5E Q;  3K8A A;  3S1N H;  3I56 A;  3K81 C;  3EIV A;  3F2C A;  2FXQ A;  1VQP A;  4NXM Q;  2Q2T A;  1X3F A;  1VQL A;  4JI0 L;  2XGT A;  4LWC A;  3K80 C;  2JA6 H;  4OON A;  2UUA L;  1I3Q H;  3HOX H;  2UUC Q;  2YTY A;  1WJJ A;  3RN5 A;  2XTI A;  1CSQ A;  5M3F H;  1A62 A;  1EWI A;  4DR2 L;  4JI5 Q;  5LMN Q;  1HJP A;  1LYL A;  4FDB A;  2I5M X;  2ATW A;  2KBN A;  3ULJ A;  5M3M G;  1KHI A;  5M5W H;  1YIT A;  2CQO A;  4PZ8 A;  4TQU S;  4L5R C;  3PUV A;  4YCU A;  2R7Z H;  2R7D A;  1G6P A;  3GD7 A;  4L5T A;  3RLO A;  4LNQ A;  3M4P A;  2KCM A;  5IWA L;  4IO9 A;  4LF9 L;  1O7I A;  1XMO Q;  4JV5 L;  3PGZ A;  2AWO A;  4PZ7 A;  1YNX A;  2N8N A;  5IP9 G;  3A5U A;  3A74 A;  3PIO A;  1Q7Y C;  5C44 H;  1VQA A;  3PIP A;  3ULP A;  4O2D A;  3HOW H;  1HZA A;  4JYA L;  4R1J A;  1EIY B;  1LM0 A;  1GVP A;  2UUB L;  4JOI C;  5M3M H;  4A3G G;  2UXB L;  4B3S L;  1TXY A;  3D31 A;  4IJH A;  5GAH C;  3S24 A;  1PH7 A;  4A3C G;  5JEA G;  4Y7N H;  4GNX A;  2NVT H;  4IFD I;  1D7Q A;  2EQS A;  2JA5 G;  4GKK L;  4X65 L;  3S15 H;  4P73 A;  5IYC G;  1SRU A;  2AKW B;  3HOY G;  1P16 A;  2WAQ E;  5JEA J;  3U4Z A;  4R4O A;  3NBH B;  2UXD L;  1IBM Q;  1VQ7 A;  1Y1V G;  3CXC A;  2IY5 B;  1XNQ L;  3STB D;  1GD7 A;  5IE8 A;  1N32 L;  1NTG A;  1Q86 C;  4A3L H;  3S1R H;  1HZ9 A;  4DV0 Q;  3PSI A;  3RR5 A;  2WAQ G;  3VDY A;  1ASY A;  3DM3 A;  4B3R Q;  2RCN A;  1N36 Q;  1W3S A;  1C0A A;  4OX9 L;  3E9H A;  4GN4 B;  4GS3 A;  4YWL A;  1HZC A;  2A1A A;  4R4I A;  4BBR H;  3AFP A;  4IJL A;  1QVF A;  3W1B A;  1GM5 A;  2CFM A;  2HQL A;  1TWG H;  4QQB X;  3HOU G;  3PUY A;  3IRB A;  3PCO B;  5FLX c;  2YYZ A;  1TWA H;  3S14 H;  1E3P A;  2PNH A;  4BA2 I;  4O0A A;  5C0X I;  2JEB I;  2ZM6 L;  3U58 A;  3M9B A;  1PH2 A;  1HNW L;  4POG A;  2Y0S E;  3UDG A;  3FHW A;  1HNX L;  4DV1 Q;  2VQE L;  4DV5 L;  1ASZ A;  5IYB G;  4LF4 Q;  2R92 G;  4DV4 Q;  1PH5 A;  2K14 A;  1UE6 A;  3K7U C;  4DV7 Q;  3ERS X;  1M90 C;  2HHH Q;  1NE3 A;  2YV5 A;  4JI8 Q;  4DR3 Q;  4L5S A;  4C3J H;  1XMQ L;  4DAM A;  3BZK A;  3HOU H;  3GTO H;  4NXN Q;  5C4J H;  3UDI A;  4X66 L;  1UE5 A;  4JI2 Q;  3KF8 B;  1HNZ L;  4UP7 A;  4A3K G;  1CSP A;  3RZO H;  4MZ9 A;  1JJG A;  3PUW A;  4LF5 L;  4K0K Q;  1Q1B A;  2E5L L;  4BXX G;  2K75 A;  5IY0 A;  4AQY Q;  2KEN A;  2I5L X;  3OYY A;  2NVX H;  4B3M L;  1PH9 A;  2R92 H;  4GN3 B;  2DGY A;  2ES2 A;  4JI0 Q;  1PVO A;  4P71 A;  4A3J H;  1C7Y A;  2UUA Q;  1JT8 A;  3CD6 A;  5IT9 c;  4ME3 A;  4MTN A;  4X64 L;  4JBM A;  5GQO A;  4JOI A;  4DR2 Q;  1L1O C;  1S72 A;  3CPF A;  4BY1 G;  1XNR Q;  1L1O B;  2R93 H;  2NN6 G;  1CKM A;  4A76 A;  3H0G G;  1IBK L;  2UU9 L;  3HOZ G;  4IOA A;  3I7F A;  1C9O A;  2ZTD A;  1L0W A;  3PF4 A;  3S1M H;  1DGS A;  1BBU A;  5FJ8 G;  1VQ8 A;  1Y1W G;  2VUM H;  4X6A H;  4BXX H;  1WYD A;  2OWO A;  4LF9 Q;  4JI3 Q;  1XPR A;  4AYB E;  1VQ4 A;  1OXT A;  1T9H A;  3G4S A;  1CKN B;  3L0O A;  3TQY A;  2KCT A;  2D0O A;  3GTL H;  1PH1 A;  4HJ5 A;  1YHB A;  5C4X H;  2NN6 I;  1GO3 E;  1PA6 A;  1U5K A;  3K7A H;  4A93 H;  2QGQ A;  1A8V A;  4DR5 Q;  4DR1 Q;  1SR3 A;  4JBW A;  3CCU A;  3PF5 A;  1I50 H;  4DR4 L;  4JYA Q;  1SLJ A;  2MFI A;  1PHJ A;  3T1Y Q;  2HIX A;  2NZH A;  3F2B A;  4B3S Q;  2Q2U A;  1TWF H;  5FJ8 H;  1SE8 A;  2H5X A;  4P74 A;  3G6E A;  4OO1 I;  1E1T A;  2K4K A;  4YCW A;  5GAD C;  3PUZ A;  2K5H A;  4YHH Q;  2JJQ A;  4QGU A;  4A3M G;  2B29 A;  1K3R A;  2UXD Q;  1N33 L;  3J80 i;  2VS1 A;  3JAM i;  1HR0 Q;  4B3T L;  3PO3 G;  4L5Q A;  1FVI A;  4DK3 C;  1N32 Q;  1RL2 A;  3CCR A;  3EN2 A;  5LMU L;  2JA8 H;  1V1Q A;  4LFB L;  4OXP A;  1CKO A;  3J7Z C;  3HOV G;  1YHQ A;  3F1Z A;  4EX5 A;  2RHS B;  1D8L A;  5K36 G;  1JJC B;  1K73 C;  1KAW A;  1CUK A;  3AFQ A;  4MNO A;  5GRO A;  5IYD G;  4OX9 Q;  2HT1 A;  5HGQ A;  1MKH A;  4IFD G;  1Q81 C;  5JJI A;  4GLA C;  5JJL A;  1GKH A;  3CC4 A;  4DV3 L;  2L15 A;  4A3D G;  4A3E G;  3I4O A;  1X56 A;  1EIF A;  4UPA A;  4DUY Q;  2LXJ A;  5H1S E;  4IFD J;  3J81 j;  4LFA L;  3AEV A;  5ELN A;  3I4N G;  3GTQ H;  2UXC L;  3PO3 H;  3LGJ A;  2NVY H;  1L2F A;  3FP9 A;  1YHA A;  4DUZ L;  2CWP A;  3KFU A;  3RLF A;  1HNW Q;  2JE6 I;  3HOV H;  3SGI A;  5M5X H;  3AQQ A;  1HNX Q;  4HJ7 A;  2JQO A;  3UE1 A;  4GKJ L;  3RLN A;  1A63 A;  1EYG A;  2E2I H;  5IYD H;  2B3G A;  4LF8 Q;  2Z0S A;  3CCS A;  3RN2 A;  1NBW A;  4LUO A;  1IYJ B;  3CQZ H;  1VQG A;  1X55 A;  4RG1 A;  4A4I A;  5IP9 H;  4OWW B;  5AJ3 Q;  4DV6 Q;  3B6Y A;  3E9I A;  4A3D H;  1L1O A;  4A3E H;  3GTM H;  4X62 L;  1N34 L;  1MJC A;  1VQI A;  2JA9 A;  4X66 Q;  2B63 G;  4HIO A;  1VQO A;  3I4N H;  3KLW A;  5C0X G;  4A3G H;  1TWC H;  2N78 A;  5IP7 G;  2A19 A;  2YTV A;  4IPC A;  1RIP A;  4LF5 Q;  3I4M G;  4A3C H;  1E1O A;  3W5O A;  3OW2 A;  4JI6 L;  1CKN A;  3CPW A;  4XTC S;  4HID A;  4R4Q A;  4R4T A;  2JA5 H;  4DR7 L;  2LSS A;  1PH6 A;  1KIX A;  5C0X J;  5IYC H;  4B3M Q;  5JJK A;  2NZO A;  2UUC L;  1OXX K;  2C35 B;  1UE7 A;  3HOY H;  4JI7 L;  3OTO L;  2EXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...