1YNXA

Solution structure of dna binding domain a (dbd-a) of s.cerevisiae replication protein a (rpa)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
TRPIFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRGDGKLFNVNFLDTSGEIRATAFNDFATKFNEILQEGKVYYVSKAKLQPAKPQFTNLTHPYELNLDRDTVIEECFDESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the DNA-binding domain of RPA from Saccharomyces cerevisiae and its interaction with single-stranded DNA and SV40 T antigen
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Replication factor-A protein 1
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ynxA01
1AE2A 1UE7A 2RHQB 2OQ0A 3G48A 3J81c 1OXXK 2PQAB 3RNUA 4EQ5A 1TWAH 3OTOQ 3GTKH 3HOZH 4DV1L 4A3CH 1WCMH 2R92G 2WFWA 5M5YH 1IBLQ 2E2JH 1CKOA 3HOVG 4GKKQ 4DV4L 2HIXA 4IJHA 1NBWA 1EUJA 4C3HH 2IX1A 4UP8A 5AJ3L 1IZ6A 2EXDA 4PMWA 3PF5A 1I3QH 4KLKA 1EOVA 4YY3Q 3PUZA 4DV0L 2PI2A 1XMOL 5GADC 2NZHA 4DR1L 1TWHH 4HJAA 3CF5A 4LF9Q 4LFBQ 3J7A5 3RN5A 2GVAA 3M4PA 3UDFA 4EX5A 2A19A 1KXLA 3S24A 1N32L 5HGQA 4QIWE 2E2HH 5M3MG 1CUKA 4HJ7A 4DV6L 4XTCS 5C4JH 4DR6Q 2YV5A 2BA0A 4HIMA 1MIUA 4LFCL 3UE0A 2B63H 4A3DG 2R7FA 2Z0SA 2E5LL 5FLXc 1X9NA 4DNIA 4O0AA 3NELA 1YI2A 3I2ZA 1JJGA 4BXXH 2LXKA 4GKKL 4GNXA 3HKZG 4AQYL 3T1HL 4OONA 1N36Q 2F4VL 2VUMG 2ZM6L 4A3EH 3BU2A 4JI4Q 1IL2A 3CCSA 1A8VA 3HFZB 3K7AH 2ZTEA 5M5XH 3HOXG 4DK6C 4DV3Q 3G4SA 4JYAL 4IPCA 3S1RH 4R4QA 4O2DA 4JI8L 2MQHA 4DR4L 4GN3B 3STBC 2KHIA 2ZJRA 1YVCA 3K81C 4L5RC 2ZJQA 1JJ2A 3NEMA 3RLNA 1E24A 2IX0A 5GROA 3J81i 2ZTDA 1KC8C 4LF6L 3M7NA 4OO1G 1HNXQ 1UE6A 2JA7H 3AEVA 1D8LA 1E1TA 3NBHB 1V43A 4X64Q 4A76A 4JI6L 5JJKA 3GTOH 1R9TH 3J7ZC 4IO9A 4DR5Q 2UXDL 1N36L 2QGQA 2F4VQ 2N3SA 2K52A 2CFMA 2KCMA 4X66Q 5C44G 1BVSA 3CCRA 2KHJA 1IBMQ 1BBUA 1VQ7A 5GAHC 1X6OA 3CC7A 1LM0A 1XPOA 4A93H 4DUYL 3AQQA 1PHJA 1E3PA 1BBWA 4LUVA 4JI7L 3GTLH 3H15A 4GNXB 1E1OA 3BZKA 3CC2A 1K8GA 1I6HH 4JI4L 4DR7Q 1L0WA 5IP7H 4WJ3M 1TWCH 2JA9A 1YHQA 1DGSA 2FXQA 4TVAB 5DLQE 1PH5A 1P16A 2PMZE 1N33L 1FVIA 3CXCA 3GDEA 4HIDA 3B6YA 4GOPA 3ICEA 3AFQA 2F52A 2UUBQ 5IYBH 4P73A 3I4MG 1L2FA 2WAQE 1V1QA 2F3IA 4ALPA 1HR0W 3U4VA 3L7ZC 2YU9H 1K73C 4DR6L 3S1QH 1GM5A 2CWAA 5IY0A 3GO5A 4GN4B 1CSQA 1HNZL 2UUCQ 4JBMA 1XNRQ 4B3RL 4GKJL 1MKHA 3OYYA 1PH3A 2Y0SG 3CD6A 2CWPA 1PV4A 3AYHB 2KENA 1SLJA 3GTMH 2R93H 1I50H 4DR1Q 3I4MH 4IOCA 5FLMG 1VQDA 4DR5L 3PF4A 3TREA 5C0XI 5JEAJ 2Q2HA 3PGZA 4A3KH 3I7FA 5C44H 3CAMA 2MNAA 1XNQL 2K14A 2NVYH 4NB3A 4HJ5A 4A4IA 3E9IA 3IRBA 3GTPH 3CPFA 1YJWA 4WJ4A 4A3GG 2NZOA 1JMCA 1Q81C 1HNZQ 1X3EA 3RLFA 4JBKA 2JA7G 1Q1BA 2E5LQ 4R4IA 1AE3A 2I0QA 2BH2A 4IPGA 2YTVA 2JJQA 3PO2G 1PH6A 4OXPA 3CC4A 1RL2A 1YZ6A 1VQMA 1Q46A 1L1OC 3HOXH 2UUAQ 4AQYQ 1A0IA 3J80i 4IFDJ 5JJLA 1WFQA 1YNXA 1X54A 1XNQQ 1VQCA 2VL6A 4JG2A 1PYBA 2DGYA 2JE6I 3CW2C 5HY6A 4HIKA 4BA1I 5IP7G 5C0XG 4IFDI 4LUOA 3W5OA 1XMQQ 1I94Q 2PQAA 2WB1E 2CQOA 3PUXA 1QVCA 5ELOA 1ASYA 3KJPA 4A3BG 2YTYA 3H3VI 1A63A 2PI2E 4LFBL 2XGTA 2XTIA 1PH1A 1UE5A 3GTJH 3CCEA 1VQLA 4BY7G 3HOUG 3PIPA 4POGA 2A8VA 1IXRA 1SRUA 2BH8A 4QJFA 4YY3L 3CCQA 2B63G 4A3DH 1PYSB 1PFSA 1OXVA 2GN5A 2OTJA 1QVFA 3HOWH 4J15A 2UUAL 1TXYA 4A93G 3EBEA 4A3IH 3GD7A 1VQFA 5LMUQ 4YHHQ 2C35B 1WJJA 1UWVA 4PG3A 2RCNA 4DK3C 2AMCB 1G6PA 1EQRA 4BBRH 4JI7Q 4HJ9A 4GLAC 1NJIC 3RN2A 5IYDG 5JEAG 2A1AA 3JAMi 1U5KA 4JBJA 5C3EG 1Q8KA 5LMUL 2JA5H 4A3FG 4LNQA 3S16H 4NXNL 2Z6KA 4LF8Q 4IPHA 4LF4L 2K75A 3F2DA 1T9HA 5LMNQ 2KCTA 1EYGA 3CCLA 1PVOA 1YJ9A 4X6AH 4FDBA 1MJEA 1S40A 2BA1A 2VZAA 4H02A 4C2MH 2K5VA 2VQEQ 3PO2H 1C7YA 1HZAA 4YCWA 4AYBE 3GTGH 1VQ9A 2B3GA 3T1YL 3TRZA 4QGUA 5IYDH 3KF6A 5FJ8H 1IBLL 3RR5A 4MNOA 1N9WA 1S72A 3K7UC 4BXXG 4DV7Q 2K50A 4DV2L 5IP9G 3SGIA 2LSSA 1PH9A 2MO1A 4QY7A 4LF8L 1KRSA 5GAGC 3HOYH 1KL9A 2ZJPA 4OWXB 2ID0A 3K80C 4A3MG 5C4XH 3MEFA 4JI5Q 1LYLA 2D62A 2Q2TA 1Q7YC 3FKIG 4ME3A 1XNRL 1V9PA 4R4OA 1HZ9A 4YWLA 5BR8Q 5M3FH 4QQBX 3A0JA 4P75A 2RF4A 5IWAQ 1Z47A 2N78A 4BY7H 1MJCA 4UP9A 4BBRG 2D0PA 3J81j 4B3ML 4PZ6A 2N8NA 3KOJA 1Y1WG 1AH9A 3NENA 3BZCA 3FHWA 4PZ7A 4Y52H 1GO3E 3HOWG 1M1KC 3CCJA 2R93G 4BBSG 2AWNA 5M5WH 3FP9A 4JI1L 4GNXC 2E8GA 2VW9A 5M3FG 3W1BA 2HQLA 2I5MX 2UXDQ 3CCVA 1OXSC 4HIOA 1VQKA 2UXCQ 3ULJA 1FGUA 2JA6H 1CKNB 2EQSA 2GVBA 2L15A 3G71A 1N34Q 1XPRA 1VQ5A 4GN5A 4GLVB 4L5QA 1W3SA 3PIOA 2YTXA 3CPWA 4A3BH 4JV5L 2I5HA 3H0GG 1VQBA 4IFDG 4B3RQ 4GKJQ 2VUMH 4B3TL 5K36G 1GVPA 5FLMH 4DR7L 5IYCH 1TWFH 4IJLA 1CKNA 4LF7L 3EIVA 2WP8J 4KHZA 2ES2A 3ER0A 1WOCA 1KQSA 4X65Q 1NTGA 1HZBA 1Y14B 3KJOA 3FKIH 3ULLA 3I4NH 3KF8B 2UXCL 3PUVA 4DV1Q 3H0GH 3UDIA 4R4TA 4DV3L 3VDYA 1GKHA 5C4XG 4L5SA 2CKZB 2HIVA 3JC66 4DR3Q 1OXUA 1CKMA 5ELNA 1YIJA 1IBKQ 1HNXL 1VQGA 2JA5G 2IY5B 1PH4A 4DUYQ 1HR0Q 3KDFB 4LF9L 5C0XJ 4DAYB 2QEXA 1Z9FA 1Q86C 2PNHA 5J3BA 4A3KG 1W2BA 4DKAC 1WI5A 2B29A 2WB1G 4JI3Q 2NVQH 1E7ZA 1X55A 2IHEA 3HOVH 1KAWA 3PUYA 2VNUD 1UEBA 4A3LG 3L2PA 2OTLA 5LMNW 1HH2P 1XMQL 1I94L 1VS0A 4APVA 4X66L 4JI3L 2Q2IA 1CSPA 2IHFA 3TS0A 1IBML 4K0KQ 2JEAI 2R6GA 2K5NA 3HOUH 2VQFL 2JQOA 4R4CA 3M4OH 3TS2A 4UPAA 1B8AA 1QVGA 4DV7L 4A3MH 2HHHQ 3M3YH 2JA6G 4DR4Q 1FL0A 1SROA 1JJCB 4DR3L 1SN8A 4JYAQ 4PZ8A 3G6EA 5JJIA 1JT8A 5E7NA 1A62A 4JI5L 1JB7A 3TQYA 3J80c 3F1ZA 5IYCG 4OWTB 2ZM6Q 1C0AA 3E0EA 1VQJA 4P71A 4NXNQ 4JOIA 2ATWA 3OW2A 3CQZH 1SMXA 4UY8C 2AKWB 3RZDH 3W1GA 4LFAL 4BBSH 1FJGQ 4UP7A 3DLLA 1YBYA 3KYHC 4Y7NH 2QA4A 4DR2Q 2UUCL 3I4NG 3CP0A 3S2DH 4POFA 2OQKA 4AYBG 4GOPB 3PO3G 1L1OB 3I56A 4JI1Q 1TWGH 1D7QA 4NXMQ 3U4ZA 5IYBG 1S3OA 1K0RA 1VQHA 4DV0Q 5IP9H 3PUWA 4JCVE 1QZHA 1XTDA 3RLOA 4DV6Q 4YWMA 5M3MH 4AIMA 5LMNL 1Q82C 1EIYB 3E9HA 2AWOA 3UE1A 4LWCA 1LTLA 4L5TA 4DV5L 3UDXA 3HKZE 1VCIA 3UDGA 1ASZA 4OX9L 1EFWA 2ZTCA 3KFUA 3S14H 1Y1VG 3D31A 1OXTA 2KBNA 4R1JA 3I55A 1N34L 4A3LH 3U58A 3CMEA 1YHBA 3L0OA 4YCVA 3T1HQ 3JAMc 1KIXA 4OWWB 4A3EG 1XJVA 2UUBL 1L1OA 3CCUA 4JI2Q 1KD1C 4B3SQ 1KHIA 3ERSX 4B3TQ 1NE3A 4GLXA 1N32Q 2UXBL 1VQPA 1HR0L 1WCMG 4LW1A 4C3JH 4A3CG 4BY1H 2DUDA 4LFCQ 1HNWQ 1K9MC 2R7DA 4IPDA 1X56A 2UU9L 2NN6G 4A75A 1B70B 2IT1A 3A74A 3ZJYC 1H95A 1X3FA 4KHPQ 5GAEC 1NMGA 2ASBA 2AHOB 3ULPA 2WAQG 1HNWL 4JI8Q 4NPSA 1EIFA 3S1MH 4B3SL 3Q8DA 2Z6KC 4RG1A 3OTOL 1XMOQ 2I5LX 3KLWA 3PSIA 1BKBA 3CMAA 1Q1EA 4JBWA 4LF7Q 3RZOH 4KHPL 4BA2I 5EAYA 1VQNA 2K5HA 1VQ6A 5AJ3Q 1VQ4A 1U0LA 1VQOA 1PH2A 4DV5Q 1Q12A 1WYDA 2V1CC 3D0FA 3MXNB 3PV0A 4JOIC 4OX9Q 4GS3A 3GTQH 1X3GA 4OO1I 3S2HH 1EWIA 4JV5Q 1EQQA 3S17H 1PH8A 3KDFA 4P74A 2JEBI 1N8RC 1PH7A 2CCZA 2MO0A 2VQEL 4HJ8A 2R7ZH 5GQOA 3I4OA 4YHHL 2JA8H 1IYJB 4JI0L 1G51A 4LF4Q 2MFIA 1J5EQ 4MTNA 4YWKA 4TQUS 5FJ8G 3M85A 1N33Q 3CCMA 3WWVA 4LF5Q 4NXML 1LUZA 4DPGA 4X62L 5H1SE 1QUQA 4A3IG 2Y0SE 2VY3A 1G291 4AH6A 1QZGA 3HKSA 5IWAL 4X64L 4JI6Q 4LFAQ 2EIFA 2K4KA 2JA8G 4DUZL 3M9BA 4DR2L 5IT9c 4A3FH 4X62Q 5C3EH 2OWOA 1RIPA 2OCEA 3H3VH 4JI0Q 5IE8A 1SR3A 3A5ZB 4P72A 1J5EL 1X65A 4LUZA 4B3MQ 1B7YB 4A3JH 2YYZA 1M90C 4YCUA 3S1NH 1OTCA 1Y1WH 4K0KL 1VQIA 4IOAA 3AFPA 5BR8L 3F2BA 4XIGS 3TEHB 1YHAA 1NY4A 2LXJA 1Y1VH 4A3GH 4DUZQ 2JK8A 2HHHL 1SE8A 3BJUA 3K0XA 3PCOB 3STBD 2H5XA 4RMFA 2HT1A 1XPUA 2R7ZG 1K3RA 1VQAA 3M4QA 1VQEA 1P8LA 1YJNA 4A3JG 1PA6A 2D0OA 2N49A 1HZCA 3HOYG 1O7IA 1YEZA 3A5UA 4DV4Q 1K8AC 3U50C 4DAMA 3HOZG 4LF5L 4C3IH 4X65L 2R92H 3DM3A 3LGJA 1QUQB 2Q2UA 4LF6Q 1VQ8A 4BY1G 3K8AA 1I5FA 2VS1A 3F8TA 4JI2L 1E22A 1GD7A 2RHSB 1UE1A 4MZ9A 3S15H 2VQFQ 1J6QA 3F2CA 2NN6I 2ALYB 3KF6B 1FJGL 1C9OA 3PO3H 4DV2Q 1SFOH 3EN2A 4JC0A 4QL5A 2NVXH 2UU9Q 1KRTA 2E2IH 4KI0A 1IBKL 1JE5A 1HJPA 1YITA 3T1YQ 2UXBQ 1K83H 1NMFA 4GOPC 2NVTH
chains in the Genus database with same CATH superfamily
1AE2A 2OQ0A 2E75C 4KMUC 2PQAB 3TDQA 1CM9A 1LT3D 4LAAA 3EJIA 4GKKQ 1IBLQ 4IJHA 1D5ZC 1EUJA 4PMWA 1EOVA 5ISRA 2PI2A 1STAA 5GADC 2NZHA 5ELDA 1PLFA 3CF5A 2NVQB 3J7A5 3LX0A 2GVAA 3M4PA 3PIP3 2K5WA 3BS1A 2KOLA 4BBRB 4RKLA 4DV6L 4XT1B 5C4JH 4DR6Q 1HRJA 4OIJA 2Q8TA 4I65A 5IGEA 1PMRA 1CA5A 3NELA 1WTVA 4FNFA 4CJ1B 2K05A 3MHBA 3HKZG 1M4VA 1CQVA 2VUMG 1DOMA 3BU2A 4JI4Q 2KVMA 1E2WA 3CCSA 1A8VA 4UHVA 2F0GA 2ZTEA 4DV3Q 1H9SA 2OXPA 2LY7A 3S1RH 4FO2A 4DR4L 5IGCA 4DAVA 4WRDA 3W2DA 1H9JA 3MXUA 4PV1C 2EVBA 1JJ2A 2IX0A 4MTKA 1KC8C 2ZTDA 4BY7B 3AEVA 2JA7H 4A76A 5J22A 4BS9A 4IO9A 4DR5Q 2UXDL 2N3SA 3CCRA 4CKEA 1LTSD 2R61A 3KLSX 5CR3A 3CC7A 2P5ZX 1LM0A 3OOCA 1PHJA 4JI7L 1B44D 1W6JA 3H15A 1IW7C 5IP7H 4WJ3M 1TWCH 2FXQA 4TVAB 4TRDA 3T13A 3NTIA 1FVIA 4OO1H 3WOFA 2F52A 5DNFA 2WAQE 1V1QA 2F3IA 3P1HA 4ALPA 1HR0W 3E6ZX 3S1QH 3D6CA 1HNZL 2IWHA 3N52A 3NXWA 2CWPA 1SLJA 4KK7A 1D2BA 2PZTA 2K1BA 5C44H 4NB3A 1A3UA 3IRBA 1ICFB 2L11A 4PMCA 1TT2A 2IJ0A 3GTPH 1C48A 2FMCA 2MUYA 1AE3A 3D4WA 2YTVA 1LO5D 1HTLD 2WACA 2M9VA 1EYDA 1GJXA 5C3XA 1XWEA 4IFDJ 1YNXA 2DN8A 1X54A 2K7VA 1VQCA 2VL6A 3DMUA 5HY6A 3VYSA 4R9WA 1DZ1A 2FJ2A 2CQOA 2D2CC 1QVCA 1I6VC 4JW0A 1PTOH 3HOZB 4LFBL 2XGTA 5F2DA 1H9MA 3HOUG 2MHVA 4I7AA 1UNSA 4FF4A 3IKJA 4K8IA 2A68C 2RCFA 4YY3L 3R3OA 1HA6A 1PYSB 1OXVA 4ILWA 1X3QA 2UUAL 1Y8NB 2GA4B 1JC7A 2XNAC 2XIWA 2C35B 5D14A 4PG3A 1HFGA 4DK3C 1G6PA 3FMCA 4KN7C 4BBRH 4JI7Q 1A2UA 5IYDG 1STGA 2A1AA 4ZAIA 4ABNA 1TWFB 2EE1A 2Z6KA 4LF8Q 3TP8A 1TVXA 4OELB 4OGQC 1EYGA 3CCLA 2F0PA 2JP1A 4KY7A 3KBXA 3S14B 2VZAA 1E2VA 4DK1A 2MPMA 1C8CA 4YCWA 3TRZA 4N9PA 3FDTA 3KF6A 2F0JA 1IBLL 1S72A 1A3TA 1JWSD 3VR5A 3V2TA 4DV2L 3SGIA 4CDDC 2B63B 1EL0A 1PH9A 3OWFA 3ZYYX 2MO1A 2ZJPA 2ID0A 3K80C 4UDUC 3MEFA 5C4XH 4DNTB 4BWGB 3FKIG 1EWHA 3S17B 4P75A 2RF4A 1Z47A 2N78A 3DWAA 1BXTA 4UP9A 3J81j 2CH4W 4B3ML 4PZ6A 2IPKD 1AH9A 2AWNA 5DAUA 5M3FG 3HP3A 4HIOA 3HKZB 4XQQA 4B9WA 4ZLTF 2GVBA 1XPRA 4GLVB 3BVMA 4L5QA 1TS5A 4ULLA 5M9OA 3PIOA 3VR6A 3CPWA 1WTXA 1NSNS 4HMJA 1TWCB 3NK9A 1XYIA 1SSOA 1GVPA 1DOKA 5FLMH 5IYCH 1TWFH 4IJLA 4DN4M 1CKNA 3EIVA 1S5CD 2EYFA 1WOCA 3EFXD 5KYLA 1JWUD 1GXDC 3UDIA 5JJZA 3IFTA 3NQTA 1WCMB 1A6XA 4DR3Q 1HNXL 2JA5G 1PH4A 3FRPB 5C0XJ 1ZEQX 1Z9FA 1Q86C 1RHPA 4RWSC 2B29A 2WB1G 4JI3Q 4XXEA 1KAWA 5L37A 1C4QA 3VA7A 3K0YA 2NVXB 2RVLA 1I94L 1TU2B 4K0KQ 2IHFA 3NHHA 1B9NA 1K83B 1D5XC 2R6GA 2VQFL 2JQOA 4R4CA 2R92B 3M4OH 4UPAA 1B8AA 1EQTA 4FXGC 5FO8B 1G6ZA 2XVSA 1S5ED 4AYBB 1HQMC 4ZYSA 1F77A 1VF7A 3F1ZA 4OWTB 1SNMA 1C0AA 3E0EA 4ID6A 3JAML 4JOIA 3RUZA 4DK0A 4KKSA 4UY8C 2AKWB 3I4NG 1YNND 2QA4A 2UUCL 4RGOS 4AYBG 3D3RA 1DONA 2G9HD 1D7QA 3U4ZA 1VQHA 4G7OC 4IUPA 3ONAB 5IGFA 1QZHA 1XTDA 5IOCA 2CW0C 3UE1A 4L5TA 3H94A 4NMZA 2WB1B 1WTHA 3CMEA 3T1HQ 1KIXA 2JSOA 3IL8A 5C3EB 1XJVA 4B3SQ 1N32Q 1RD9D 1ML0D 5JPMC 1WCMG 3M4OB 1GHKA 3MXGA 1IW7D 1TS3A 4BY1H 1HNWQ 3S1NB 5M5XB 4A75A 1B70B 1EQVA 1PTOB 1H95A 3PIO3 2SDFA 2H1EA 3PQIA 4FF2A 5GAEC 3NWTA 2B8GA 4JI8Q 4QIWB 3S1MH 2DJGC 1V1PA 2Z6KC 3OTOL 1XMOQ 4JBWA 2FINB 1PTOF 1VQ6A 1MGSA 3TZDA 3KLRA 1PH2A 1JWMD 1Q12A 1BCPC 2V1CC 1GUSA 1SNOA 1X3GA 4JV5Q 2JEBI 1HQRD 1FR3A 4X3TA 4A3BB 4YHHL 3OMGA 2WV6D 3N6RA 4LF4Q 1YNJD 1U4RA 1L0XB 4TQUS 5FJ8G 4ODGA 3M85A 3PO2B 2B2VC 3TMEA 5H1SE 4A3IG 1LT4D 2CQAA 1GHJA 1F2YA 5M5YB 3FKIB 4LMQD 4JI6Q 1BCPD 1GUNA 1O7LA 3LWUA 5I2XA 3D4RA 1RIPA 3GTJB 3H3VH 1HA5A 3GP7A 4IUQA 4LUZA 1YNJC 4HN7A 1KTKA 1B7YB 4A3JH 1G2TA 3S1NH 1OTCA 3PMFA 2IX3A 2PQEA 4IOAA 4K5WA 4XYOA 2NUCA 1QWYA 3TEHB 1AW7A 2HCCA 4A3GH 4J6HA 2JK8A 3BJUA 2R7ZG 3S1MB 5A2QL 4A3JG 5C4ZA 2VB2X 1Y69U 4K2LA 3G6JB 4C3IH 4X65L 4LF5L 3LGJA 2Q2UA 5KNBA 1KNEA 1QNKA 4DXGA 1E22A 2VQFQ 2ALYB 2WKDA 1GUTA 4DV2Q 4U68A 5ELCA 4JC0A 4KY6A 1KRTA 2RDHA 1YITA 1NMFA 5FO9B 2NVTH 4DAPA 1UE7A 1TQOA 2PO4A 1BCPB 2OF1A 4NKLA 1EY0A 1D5MC 4DV1L 3I91A 2F0SA 3HOVG 1CKOA 4I7ZC 1NBWA 4UP8A 3G7LA 3PF5A 1EYCA 3I73A 3VR4A 3VYRA 4DR1L 1TWHH 4LF9Q 3GTLB 1R4QB 2WKCA 1S4ZA 3RN5A 1STBA 2A19A 4L8JA 5FLXL 4FXDA 2F0IA 1KXLA 3S24A 1F2LA 5HGQA 2E2HH 5M3MG 3DWQA 4HIMA 1MIUA 1WD0A 4S3SA 2B63H 4DNRB 2R7FA 2Z0SA 2E5LL 1B3QA 4NW2A 3QB3A 3I3CA 4O0AA 3FVQA 1YI2A 4ZKCB 5C4XB 4GKKL 1WTPA 4FVMA 4GNXA 4V0BA 1RCVD 3T1HL 3BG3A 2ZM6L 4JK1C 4G57A 3A55A 3K5LA 3AMUA 3OWEB 5LL6X 1QG7A 2NZ1D 3QOJA 4O2DA 2EDGA 1SXTA 4FF1A 1MSHA 3K81C 4L5RC 1G91A 2X6LA 3RLNA 2KUMA 1E24A 2NVTB 4JVZA 1LACA 3A8KE 5K5PA 4OO1G 4IALA 1UE6A 1ZKOA 3NBHB 4JI6L 2OT2A 2C5CA 2F0FA 5JVG3 4XQNA 3FEWX 1QJOA 2QGQA 3TBIB 5M5WB 2KHJA 1BBUA 1VQ7A 2F0EA 1XPOA 3AQQA 1E3PA 2F0WA 4LUVA 1PZKD 3TN2A 5KYIA 3HZXA 2O2LD 4QMGA 3K59A 1E1OA 3BZKA 3CC2A 4JI4L 1PRTB 1YHQA 5DLQE 4OIKA 3I70A 2PMZE 1N33L 2A69D 3CXCA 3GDEA 4GOPA 5IYBH 3C3LA 4P73A 2M2LA 4KKTA 4ZKBB 5D3IB 2YU9H 4DR6L 2B39A 5IY0A 2UUCQ 1O7YA 1Q3LA 3RZDB 4GKJL 1MKHA 1PH3A 3CD6A 2KENA 2NYZD 1Y1WB 3I4MH 4IOCA 5FLMG 4DR5L 1KDBA 5E1FA 3TREA 3PGZA 3CAMA 1XNQL 2NVYH 3E9IA 5KNDA 3CPFA 1YJWA 4F87A 1X3EA 4L63B 4K5VA 2G9DA 4JBKA 1Q1BA 1LTRD 1V1OA 2BH2A 4C3IB 3PO2G 1CZGA 2RQXA 3CC4A 1CTMA 1H9RA 1L1OC 3URYA 1PZJD 1WFQA 2N88A 5IT9L 4HIKA 5IP7G 1U9RA 4IFDI 1DOLA 3S9WA 1XMQQ 4CJ2C 3PUXA 1HCZA 3E3XA 5ELOA 3S15B 3KJPA 4HCEA 2EY2A 2PI2E 1MBYA 1ESRA 3T51B 4BY7G 3GTJH 2D9UA 4POGA 2A8VA 1I4GA 1SRUA 1ESFA 2BH8A 3D4DA 3CCQA 4A3DH 4IUUA 3HOWH 4J15A 4OEMB 2JN4A 2HUGA 4RCOA 5DEHA 1MD2D 1RTOA 1WJJA 2DNEA 2RCNA 4KKUA 2E2DC 4A3GB 2NB0A 1EQRA 2EYOA 4HJ9A 1NJIC 5CV9A 3RN2A 3JAMi 3ERQA 5JEAG 5C3EG 3V05A 5C4HA 3I8ZA 2NVYB 4IPHA 4LF4L 5LMNQ 1PVOA 3L9AX 2QDLA 1S40A 1LT6D 2BA1A 5I4DA 4C2MH 1HZAA 3QWNA 3J81L 1ICWA 2B3GA 4H44C 3T1YL 4QGUA 4A3EB 5FJ8H 1N9WA 3A7LA 3CRLC 3MZ5A 1I4PA 2EY6A 2HQEA 4A3FB 1KRSA 4EQNA 1D1KA 3HOYH 1KL9A 4ZUIA 4A3MG 4KJOA 1CI3M 1LYLA 1O7ZA 4ME3A 1S5BD 1XNRL 1V9PA 4M8AA 1HZ9A 3BYTB 4YWLA 5M3FH 5IIFA 2R3ZA 2N55A 4BBRG 5IGGA 1I3QB 1JOKA 2N8NA 3BZCA 3DUZA 4PZ7A 1MSGA 1GO3E 2R93G 5M5WH 3TP6A 4JI1L 4GNXC 5KNCA 2HQLA 1WTRA 2UXDQ 3CCVA 5C5LA 2H4OA 1S5DD 3DXJC 3ULJA 2PZUA 2JA6H 2EQSA 1VQ5A 2JA7B 3G71A 3VYUA 2DY8A 1R9TB 2WIIB 4IFDG 4B3RQ 1CA6A 4G7HC 1ILQA 1SNDA 1A3VA 4LF7L 2WP8J 2ES2A 3F2UA 3ER0A 4X65Q 1NTGA 1Y14B 1JQYD 1OO9B 4X3SA 3ULLA 2UXCL 4DV1Q 5D65A 3H0GH 3OPOA 5EKLA 3R93A 2HIVA 1BQQT 4Z9CB 2MJ8A 2IL8A 2RKSA 1YIJA 1X3PA 1HR0Q 1ENFA 3KDFB 4LF9L 4HR7B 3S1QB 4KN4C 4A3KG 1W2BA 1WI5A 3GTOB 1X55A 3MWYW 3NPPA 2XSCA 2KHSA 2K6AA 5LMNW 4HSVA 1HH2P 1BOSA 3GQBA 4APVA 4X66L 4JI3L 3A56A 3TS0A 3BDLA 5C44B 1EFID 2L12A 3TS2A 1SEBD 1EZ8A 4A3MH 2X6GA 2HHHQ 1SROA 4DR3L 2B2VA 5J1ZA 1B9MA 4NP5A 1JB7A 2PW5A 3CU7A 3GV6A 4P71A 2YU9B 3RZOB 1STNA 4LFAL 1FJGQ 4DR2Q 1AZPA 2OEOA 3S2DH 4POFA 2EYLA 3GTMB 1RODA 3J7AV 3PO3G 1TWGH 1SJED 1NCVA 1DYQA 1S3OA 2BOSA 2B2YC 1SYCA 2EPBA 1TR5A 4R8IA 4XQJA 4YWMA 4MN3A 1LTLA 3P20A 1A2TA 2LS01 4OX9L 3UDXA 3HKZE 3KFUA 4A3CH 2ZTCA 4A3LH 2KBNA 1N34L 1HPCA 3VR3A 1B4OA 1SNQA 4XYQA 3L0OA 4YCVA 4A3EG 1LABA 4B9XA 5EPKA 1NUCA 3CCUA 4B3TQ 4IUVA 5IGBA 4GLXA 1CZWA 2O5JC 4LW1A 4A3CG 1BDOA 5CORA 2DUDA 4A3MB 1YNNC 1K9MC 2R7DA 4H7BA 1X56A 3HOYB 2NN6G 3A74A 1EY5A 5JAVA 2BDOA 1B3AA 5M3FB 1NMGA 2ASBA 1HNWL 4IZ8A 3RZOH 5KRUA 1Q1EA 5E4XA 4LF7Q 1SYBA 5EAYA 1VQNA 1DJRD 2K5HA 3GTPB 5C6AA 1VQ4A 2FFKB 2F0MA 2E76C 4JOIC 2F4IA 3PV0A 2ZXPA 1R4PB 3S17H 2RSNA 1N8RC 2CCZA 1TY2A 3D6WA 4PNYA 5I6YA 1IYJB 2MFIA 1LT5D 4MTNA 3WWVA 4EQPA 3FPUB 4X62L 1QUQA 3CRKC 1G291 3SK4A 2SNMA 4AH6A 4XT3B 4X64L 1EIHA 3J81E 2EJMA 1TS4A 1RKNA 5IT9c 4QB4A 5FOBB 2OWOA 3QG1A 1SYFA 4C3IG 3RD4A 4Q0FA 4JI0Q 3SVMA 2PYKA 3MXPA 4IQZA 2B2WA 4K6DA 4B3MQ 4EGVA 4YCUA 1EYAA 1VQIA 3K6OA 5BR8L 4XIGS 1YHAA 3NTHA 5A35A 1STHA 3NBIA 3VR2A 4DUZQ 3BVZA 5EPLA 3PCOB 1EIGA 4RMFA 2HT1A 1VQEA 1P8LA 1YJNA 1PA6A 1RDPD 2D0OA 1FNUA 1O7IA 4DV4Q 3A5UA 1K8AC 2PPBC 3U50C 3HOZG 4OHJA 2EJGC 1QUQB 3P75A 1I5FA 2VS1A 5G3LD 2RHSB 1G2SA 1UE1A 2G5DA 2SEBD 2XWJB 2NN6I 5ELEA 1T5XD 3EN2A 2NVXH 1FYCA 2EZVA 1F2MA 4KI0A 1HJPA 1K83H 4GOPC 5G3LF 1AEXA 1O80A 1MI2A 1VF5C 2RHQB 1WVLA 3G48A 1F9SA 2A69C 2J4XA 3NTKA 3H0GB 5EPJA 1TWAH 1SJHD 3OTOQ 3HOZH 1SE2A 2WFWA 2E2JH 1E2ZA 4DV4L 4KD3A 4P2CB 1IZ6A 2ICIA 4KLKA 2K5DA 4YY3Q 3PUZA 3RMHA 5T1IA 3J7YW 4LFBQ 4EX5A 2Z8LA 4IUNA 3C1FA 1N32L 1PFNA 4LJZC 4QIWE 4HJ7A 4N9TA 2YV5A 4LFCL 3UE0A 1X9NA 2O4XA 1EY7A 3H6MA 3I2ZA 4RFBA 1JJGA 2K5QA 4BXXH 2LXKA 1FNVA 1JOOA 2F4VL 2Y0SB 2RDFA 3C1EA 3T56B 1IL2A 4JYAL 4DK6C 2DJFC 3G4SA 2V4DA 1EU4A 4R4QA 3K57A 3HG9A 3X3NA 1RF2D 2MQHA 1FGBD 5LL6S 2IW3A 3I90A 1V1PB 2Z4IA 3D8GA 1SE3A 2ZJRA 4R8NA 1NR2A 2I46A 1PRTF 2EYPA 5GROA 3J81i 2FHTA 3M7NA 2L5TA 4H13C 1TWGB 3M7GA 5JJKA 1V43A 1QCBD 4X64Q 3QR8A 4DFAA 3SDZA 1R9TH 4WORA 3J7ZC 1SMYD 3HOVB 1Y8PB 2F4VQ 2XN9C 2KCMA 4X66Q 5C44G 2AQ2B 1KDAA 4PMBA 5GAHC 1X6OA 2QF7A 1JB3A 1BBWA 5NUCA 4DR7Q 1PYWD 4JPBW 2JA9A 1PFMA 1PH5A 3IAYA 4RH6A 1UAPA 5FLXE 3BDOA 2A6HD 3I4MG 4KJNA 2CWAA 3I4LA 4KY5A 1CSQA 1K3BC 4BBSB 4E6IA 3OYYA 1PV4A 3KBGA 1SAPA 3AYHB 4O1NA 1JORA 4DR1Q 2VB3X 2Q8IB 1BUVT 4J8QA 2Q2HA 1E0BA 2MNAA 1SNPA 3CKIB 2K14A 4HJ5A 4WJ4A 4PQXA 4F7XA 4A3GG 4CHTB 4F88A 1HNZQ 3RLFA 2HDLA 2ICEC 2JA7G 2E5LQ 1HHVA 4A3JB 2JJQA 1PH6A 5CV4A 3TP5A 1VMPA 3DHQA 3QJYA 3BVGA 5JJLA 1Z7TA 1TKWB 1SFOB 4JG2A 1EZ6A 2SOBA 3EVQA 5C0XG 4KV6A 3S2DB 1I94Q 4HAEA 2PQAA 1JICA 2VXWA 3OSOA 2F0VA 2HD3A 2CW0D 5CV7A 4BY1B 4A3BG 2YTYA 3H3VI 1A63A 2FMMA 2XTIA 3BDCA 3CCEA 2M00A 3MXNA 4TSSA 3PIPA 4ZUJA 2WAQB 2E2IB 5I9OA 1IXRA 4QJFA 1PFSA 2GN5A 2RA4A 3TP7A 1QVFA 4A93G 1CHPD 3EBEA 1TIID 3A8JE 4DGZA 3FPPA 1UWVA 1B53A 1B1ZA 5CV5A 2F1MA 1CT1D 2A5HA 2ZXOA 4JBJA 5C4JB 3O13A 4LNQA 4A3FG 2L0CA 2J0TD 2K75A 1DCZA 2QKIC 3F2DA 2KCTA 2AQ1B 1IYVA 4FDBA 2I07B 2XRQD 4H02A 2AQ3B 2K5VA 2VQEQ 3PO2H 2K03A 1C7YA 3C2PA 3GTGH 1VQ9A 1ENAA 1BO0A 5E4WC 4MNOA 2RBMA 4RKBA 2LKVA 3HRZC 2L9HA 3KK7A 4JI5Q 4OWXB 3R2TA 3MFYA 1SMYC 3Q22A 2Q2TA 1Q7YC 3I72A 5I9PA 4R4OA 5BR8Q 1KABA 3A0JA 4BY7H 1CHQD 2D0PA 2EYMA 1IKMA 3KOJA 4CDCC 1HUMA 4Y52H 2F3VA 2F0OA 3CCJA 4RCNA 4BBSG 3FP9A 3SHLA 2ZT9C 2E8GA 2VW9A 2I5MX 2PNRC 1OXSC 4EQOA 1CKNB 1N34Q 4JV5L 4CBVA 1W3SA 4A3BH 2YTXA 1U4LA 2I5HA 5CGKA 3NE5B 3SXHA 5K36G 2NN6H 1PZID 4ME5A 2LMCB 2QCPX 4KHZA 5HGTA 1KAAA 3E0JA 1KQSA 3KJOA 3FKIH 3S1RB 3KF8B 2A6HC 1I4QA 3GTGB 5CBEE 4L5SA 4CDEC 1OXUA 1CKMA 1VMCA 5ELNA 1F9RA 5M3MB 4ZRZA 5JVH3 4WJWA 1BR9A 2QEXA 4B08A 2PNHA 2K33A 4OL7A 5J3BA 1K8OA 2IHEA 3HOVH 3PUYA 4DU9A 1UEBA 5EBCA 1IL8A 4EVOA 1PXUA 1VS0A 4KD4A 1IBML 2Q2IA 1CSPA 2A6ED 2K5NA 1LTID 3K58A 2EXZA 4FXKC 2JA6G 4DR4Q 5AFWA 1JJCB 4JYAQ 5J39A 5JJIA 3P7JA 5E7NA 4JI5L 1PTOD 1ZXTA 3M4YA 2HDMA 2NTTA 5IYCG 1CK1A 3CQZH 1SMXA 4RHRA 4BBSH 1EEID 4Y7NH 2AUKA 3CP0A 2OQKA 4CJ0B 4GOPB 1EY6A 4JI1Q 2R7ZB 4NXMQ 1PTOC 2DY7A 1HTPA 5IP9H 4JCVE 1BCPF 5M3MH 4AIMA 1GOZA 4LWCA 2KCNA 3SK5A 4DV5L 1ASZA 3S14H 1VCIA 2KJXA 4C3JG 3K5NA 1EFWA 1Y1VG 2QILA 3D31A 5EJWA 2NBFA 3OMCA 3U58A 4OWWB 2UUBL 3ERSX 5CMDA 3J80L 1NE3A 3NQIA 1VQPA 1TS2A 4N8X1 1CQFA 4C3JH 2F0NA 3WOEA 2UU9L 5DM63 3OIPA 2IT1A 3SE0A 1LV9A 3ZJYC 1X3FA 1Y1VB 3U9OA 2AHOB 3KLSA 4NPSA 5FO7B 3Q8DA 5JOBA 4RG1A 2A74C 1QVGA 3KLWA 3PSIA 2L55A 1D6EC 3CQZB 5AJ3Q 1GUGA 3U9SA 1U0LA 4Y7NB 2PW7A 1VQOA 1JR0D 1F2ZA 4OX9Q 4V190 1QB5D 3SK6A 4RAUC 3S2HH 1EQQA 4HEDA 4P74A 1PH7A 2MO0A 4HJ8A 2R7ZH 5GQOA 3I4OA 4JI0L 1G51A 5FK9C 4HMIA 2JYOA 1F9QA 1LTBD 2Y0SE 2VY3A 2QDBA 1SE4A 1II3A 5C0XH 1BF4A 5CYUA 4LFAQ 2EIFA 2K4KA 4RA8A 4DUZL 2JA8G 3M9BA 4DR2L 4X62Q 2CH4A 2A6EC 1Q90A 5JEAH 5C3EH 1K28A 3L3OC 3J7AF 1F9PA 5IE8A 3OIQA 4P72A 1J5EL 3HEJA 2PZWA 2K01A 1ET6A 4K0KL 1Y1WH 2MP1A 3AFPA 5CV6A 4A3IB 3H91A 3X3MA 2Q8RE 1NY4A 5KIXA 1Y1VH 3MA2B 4U673 2HHHL 3STBD 1VQAA 1H9SB 5C3WA 1HZCA 4IUTA 1ENCA 3HOYG 4DAMA 2R92H 3DM3A 1KLUD 3K8AA 3K7AB 5EGTA 1JOQA 3OHXC 3F2CA 5T1GA 3SR1A 1SDFA 1ONLA 2E2IH 1IBKL 1JE5A 2UXBQ 3DEPA 1G8ZD 5IT9E 3LWEA 5CBAE 3J81c 1OXXK 3Q6SA 3RNUA 4EQ5A 3GTKH 1WCMH 2B2UA 2R92G 5M5YH 2HIXA 2F3WA 1IHZA 4K5XA 4C3HH 2IX1A 5AJ3L 2B2YA 4A3DB 2D5DA 2EXDA 1I3QH 4MIUA 4DV0L 1XMOL 2NWGA 4X3UA 5I2YA 4HJAA 3UDFA 2F0HA 2EY5A 1AN8A 1CUKA 2B2WC 4XTCS 2JA5B 2BA0A 5I6WA 1STEA 1PRTD 4A3DG 5FLXc 4RHSA 4DNIA 3E5SA 4ZK9B 2K28A 1GUOA 1RTNA 4FP5D 2VUMB 4AQYL 5BN4A 1CFMA 5KEEA 4OONA 1N36Q 1TY0A 4DF7A 5JPNC 4A3EH 5FKAC 3MTSA 3MVVA 2CVRA 3HFZB 3K7AH 5M5XH 3HOXG 2R93B 2QW7A 4IPCA 3T4AC 3I4NB 1NAPA 4C1NK 4JI8L 2BDNA 4GN3B 3EA6A 5K36H 3STBC 2KHIA 3TSSA 4QUFA 4G7ZC 1YVCA 4RGNA 2ZJQA 3NUCA 3NEMA 1DD2A 2KEDA 4LF6L 2B2TC 1HNXQ 3MAQA 3DEOA 1D8LA 1E1TA 1X32A 1KLGD 3GTOH 1JCKB 4QF4A 2F0TA 4L6TB 2BE5D 1N36L 2K52A 2CFMA 3A8IE 3ITPA 1IBMQ 1BVSA 4DXFA 4A93H 4DUYL 2Z6BA 1SYEA 2Z4HA 5IODA 1WTOA 3GTLH 2KA7A 4GNXB 4RGTA 1K8GA 1I6HH 1L0WA 3M3YB 1QOHA 1DGSA 1P16A 3GV3A 3W3AA 4M1UB 4CKCA 4HIDA 3B6YA 4CGYB 3ICEA 3AFQA 2UUBQ 1L2FA 3U4VA 3L7ZC 5A2QE 1K73C 1GM5A 4JBMA 3GO5A 4GN4B 1XNRQ 4B3RL 2Y0SG 3GTMH 2R93H 3K5OA 1I50H 3NBHA 3HGBA 3PF4A 1VQDA 5BN5A 5C0XI 1BNZA 5EQ0A 1SYDA 5JEAJ 4A3KH 3I7FA 5DM73 2A68D 4A4IA 1D1IA 3BYYB 2J7ZA 1KNAA 2NZOA 1JMCA 1Q81C 2DNCA 4R4IA 1LTTD 2I0QA 4IPGA 4IURA 3MFGA 4OXPA 1Z6HA 1RL2A 1YZ6A 3LNNA 1Q46A 1VQMA 3HOXH 2UUAQ 4AQYQ 1A0IA 3J80i 2BE5C 3HOUB 1XNQQ 4MHEA 1PYBA 2DGYA 2JE6I 3CW2C 4BA1I 4A93B 5TSSA 1RJTA 4UAIA 4LUOA 3W5OA 3H09A 2WB1E 1EY8A 4GZYC 3A7AB 1ASYA 5IGDA 1XXGA 1PH1A 1UE5A 2B8FA 1VQLA 2B63G 2F0LA 2AUJD 2OTJA 2NTSA 1PFBA 3QOLA 1U4PA 1TXYA 4A3IH 2BCOA 3GD7A 4XDXA 1VQFA 4X3KA 5LMUQ 4YHHQ 2AMCB 1BBXC 1HFNA 3NP8A 4GLAC 1I50B 5ELBA 5LMUL 1U5KA 1Q8KA 2JA5H 1EY4A 3VYTA 3S16H 1V8QA 4NXNL 4IFDH 4FF3A 1T9HA 4X6AH 2JA8B 4C3JB 1YJ9A 1SNCA 1MJEA 2EYHA 3QIAA 4HCSA 5CC4A 3IFDA 4DA2A 4AYBE 5IYDH 2B2UC 3MC0B 4K14A 3RR5A 5BN3A 4BXXG 3K7UC 4DV7Q 2K50A 5EKIA 1GUWA 5EKKA 5IP9G 2C9OA 2LSSA 1J9OA 2X69A 4QY7A 5C5MA 2Z9HA 4LF8L 5GAGC 2WINB 1K8MA 2D62A 1NR4A 2F0KA 3GTKB 4DAYA 3EQLC 1AP0A 3V96A 1U4MA 4QQBX 3S2HB 4NDXA 5IWAQ 2PCFB 1MJCA 1XX8A 3Q24A 3NWSA 1Y1WG 3QO2A 4TKOB 3NENA 1O78A 3FHWA 1QILA 3HOWG 1M1KC 4HSPA 5CV8A 5HURA 3W1BA 5LHY1 3R2IA 1VQKA 3OW7A 2UXCQ 1WTQA 1FGUA 3SEBA 5C4XG 2L15A 3VA5A 4GN5A 1I6HB 2PMZB 1H9KA 3H0GG 1VQBA 4GKJQ 2VUMH 4B3TL 4DR7L 1EOTA 3J80E 3HS0C 2KEEA 4K6LA 1HZBA 2B2TA 3I4NH 3PUVA 4DV3L 4R4TA 3VDYA 1GKHA 3T16A 2L1BA 2CKZB 2K04A 3JC66 3A54A 1IBKQ 1Q8IA 1VQGA 3TZUA 2IY5B 4DUYQ 4K8JA 1K0SA 2XWBB 4DAYB 4DKAC 2NVQH 3EROA 1E7ZA 1DXMA 1I4XA 1ET9A 1T5EA 3UI2A 2F0QA 2VNUD 4A3LG 1EU3A 3L2PA 2OTLA 2JXMB 2KECA 4F8MA 1XMQL 3KF8A 1HXYD 1ZYRC 1Y8OB 1WD1A 2JEAI 4QCLA 4O42A 3HOUH 1J8IA 4CKBA 1STYA 3R8BA 3JAME 2RSOA 4DV7L 1B2TA 3M3YH 4ZQ3A 1FL0A 4HTHA 3H3VC 3T53B 1SN8A 4CDFC 4PZ8A 3G6EA 2JA6B 1JT8A 1WTWA 1A62A 4C3HB 3TQYA 1S5FD 3J80c 1LLRD 2ZM6Q 4KTAA 1VQJA 3WDNA 4NXNQ 2ATWA 4QUCA 3OW2A 1UEAB 1TWHB 3RZDH 3W1GA 4K2KA 4UP7A 3DLLA 1I4RA 1YBYA 3KYHC 3HOWB 1IYUA 1KDCA 2E2JB 2E2HB 1L1OB 3I56A 2A73B 4ZCKA 1AFPA 5IYBG 1K0RA 2XRSD 2EY1A 4DV0Q 4FYDA 3PUWA 1UUPA 3RLOA 4DV6Q 5LMNL 1SYGA 4G4KA 1Q82C 1EIYB 1EY9A 2TSSA 3E9HA 2AWOA 1ILPA 4KHVA 3BZDB 3UDGA 4J1MA 1OXTA 4R1JA 3I55A 2EYJA 1YHBA 3K5MA 1DM0B 2TMPA 4IN3A 3JAMc 1JE4A 1L1OA 4JI2Q 1KD1C 2UXBL 1KHIA 1HR0L 2L4NA 3AU7A 4LFCQ 4IPDA 4C1NI 1M8AA 1VDZA 3DWPA 3ND9A 4KHPQ 5E3FA 2SNSA 4LK1C 1PRTC 3ULPA 2WAQG 1EIFA 1FNWA 4B3SL 3C46A 2I5LX 4KHPL 1BKBA 3CMAA 1LTGD 4BA2I 1AZQA 2LFNA 3KUPA 3CHBD 1WYDA 5COYA 3MXNB 3D0FA 3Q23A 4DV5Q 1W6KA 4GS3A 3GTQH 4OO1I 2K32A 1EWIA 1PH8A 3KDFA 3PO3B 1L0YB 3ND8A 3S16B 2VQEL 1FD7D 2JA8H 1J5EQ 4C2MB 4YWKA 2Z1CA 1EWCA 2KQ3A 1N33Q 3CCMA 4LF5Q 4NXML 1LUZA 2F0DA 4RGMA 4DPGA 3Q0AA 1B50A 1TWAB 2EJFC 1EEFD 1QZGA 3HKSA 5IWAL 3I4MB 1MHWC 4Q5VA 5ELFA 4C56C 4A3KB 4A3FH 1NNXA 1QNUA 1SBBB 2F0UA 2O5IC 2OCEA 2ZXRA 5KGUA 1SR3A 3A5ZB 1A15A 1LTAD 1X65A 2HCIA 5D3DA 3NSWA 2YYZA 1M90C 3SK8A 3F2BA 2RDGA 3HOXB 5EBDA 1QE6A 2LXJA 4YIJA 2E74C 1SE8A 3AB9A 3DM1A 3K0XA 2H5XA 2EOTA 1XPUA 4WFN3 1HUNA 1K3RA 3M4QA 4H0LC 1PDQA 2N49A 2F03A 2QEJC 1YEZA 2ENBA 4LF6Q 1VQ8A 4BY1G 3F8TA 4JI2L 3S15H 1GD7A 4MZ9A 3MEHA 1J6QA 2CHBD 3GTQB 3KF6B 1FJGL 1C9OA 2KCCA 3PO3H 1XTCD 1SFOH 4QL5A 2UU9Q 1I4HA 4N8FA 4C3HG 3T1YQ 1IKLA 1ZYRD 2MGSA
chains in the Genus database with same CATH topology
1AE2A 1UE7A 2RHQB 2OQ0A 3G48A 3J81c 1OXXK 2PQAB 3RNUA 4EQ5A 1TWAH 3OTOQ 3GTKH 3HOZH 4DV1L 4A3CH 1WCMH 2R92G 2WFWA 5M5YH 1IBLQ 2E2JH 1CKOA 3HOVG 4GKKQ 4DV4L 2HIXA 4IJHA 1NBWA 1EUJA 4C3HH 2IX1A 4UP8A 5AJ3L 1IZ6A 2EXDA 4PMWA 3PF5A 1I3QH 4KLKA 1EOVA 4YY3Q 3PUZA 4DV0L 2PI2A 1XMOL 5GADC 2NZHA 4DR1L 1TWHH 4HJAA 3CF5A 4LF9Q 4LFBQ 3J7A5 3RN5A 2GVAA 3M4PA 3UDFA 4EX5A 2A19A 1KXLA 3S24A 1N32L 5HGQA 4QIWE 2E2HH 5M3MG 1CUKA 4HJ7A 4DV6L 4XTCS 5C4JH 4DR6Q 2YV5A 2BA0A 4HIMA 1MIUA 4LFCL 3UE0A 2B63H 4A3DG 2R7FA 2Z0SA 2E5LL 5FLXc 1X9NA 4DNIA 4O0AA 3NELA 1YI2A 3I2ZA 1JJGA 4BXXH 2LXKA 4GKKL 4GNXA 3HKZG 4AQYL 3T1HL 4OONA 1N36Q 2F4VL 2VUMG 2ZM6L 4A3EH 3BU2A 4JI4Q 1IL2A 3CCSA 1A8VA 3HFZB 3K7AH 2ZTEA 5M5XH 3HOXG 4DK6C 4DV3Q 3G4SA 4JYAL 4IPCA 3S1RH 4R4QA 4O2DA 4JI8L 2MQHA 4DR4L 4GN3B 3STBC 2KHIA 2ZJRA 1YVCA 3K81C 4L5RC 2ZJQA 1JJ2A 3NEMA 3RLNA 1E24A 2IX0A 5GROA 3J81i 2ZTDA 1KC8C 4LF6L 3M7NA 4OO1G 1HNXQ 1UE6A 2JA7H 3AEVA 1D8LA 1E1TA 3NBHB 1V43A 4X64Q 4A76A 4JI6L 5JJKA 3GTOH 1R9TH 3J7ZC 4IO9A 4DR5Q 2UXDL 1N36L 2QGQA 2F4VQ 2N3SA 2K52A 2CFMA 2KCMA 4X66Q 5C44G 1BVSA 3CCRA 2KHJA 1IBMQ 1BBUA 1VQ7A 5GAHC 1X6OA 3CC7A 1LM0A 1XPOA 4A93H 4DUYL 3AQQA 1PHJA 1E3PA 1BBWA 4LUVA 4JI7L 3GTLH 3H15A 4GNXB 1E1OA 3BZKA 3CC2A 1K8GA 1I6HH 4JI4L 4DR7Q 1L0WA 5IP7H 4WJ3M 1TWCH 2JA9A 1YHQA 1DGSA 2FXQA 4TVAB 5DLQE 1PH5A 1P16A 2PMZE 1N33L 1FVIA 3CXCA 3GDEA 4HIDA 3B6YA 4GOPA 3ICEA 3AFQA 2F52A 2UUBQ 5IYBH 4P73A 3I4MG 1L2FA 2WAQE 1V1QA 2F3IA 4ALPA 1HR0W 3U4VA 3L7ZC 2YU9H 1K73C 4DR6L 3S1QH 1GM5A 2CWAA 5IY0A 3GO5A 4GN4B 1CSQA 1HNZL 2UUCQ 4JBMA 1XNRQ 4B3RL 4GKJL 1MKHA 3OYYA 1PH3A 2Y0SG 3CD6A 2CWPA 1PV4A 3AYHB 2KENA 1SLJA 3GTMH 2R93H 1I50H 4DR1Q 3I4MH 4IOCA 5FLMG 1VQDA 4DR5L 3PF4A 3TREA 5C0XI 5JEAJ 2Q2HA 3PGZA 4A3KH 3I7FA 5C44H 3CAMA 2MNAA 1XNQL 2K14A 2NVYH 4NB3A 4HJ5A 4A4IA 3E9IA 3IRBA 3GTPH 3CPFA 1YJWA 4WJ4A 4A3GG 2NZOA 1JMCA 1Q81C 1HNZQ 1X3EA 3RLFA 4JBKA 2JA7G 1Q1BA 2E5LQ 4R4IA 1AE3A 2I0QA 2BH2A 4IPGA 2YTVA 2JJQA 3PO2G 1PH6A 4OXPA 3CC4A 1RL2A 1YZ6A 1VQMA 1Q46A 1L1OC 3HOXH 2UUAQ 4AQYQ 1A0IA 3J80i 4IFDJ 5JJLA 1WFQA 1YNXA 1X54A 1XNQQ 1VQCA 2VL6A 4JG2A 1PYBA 2DGYA 2JE6I 3CW2C 5HY6A 4HIKA 4BA1I 5IP7G 5C0XG 4IFDI 4LUOA 3W5OA 1XMQQ 1I94Q 2PQAA 2WB1E 2CQOA 3PUXA 1QVCA 5ELOA 1ASYA 3KJPA 4A3BG 2YTYA 3H3VI 1A63A 2PI2E 4LFBL 2XGTA 2XTIA 1PH1A 1UE5A 3GTJH 3CCEA 1VQLA 4BY7G 3HOUG 3PIPA 4POGA 2A8VA 1IXRA 1SRUA 2BH8A 4QJFA 4YY3L 3CCQA 2B63G 4A3DH 1PYSB 1PFSA 1OXVA 2GN5A 2OTJA 1QVFA 3HOWH 4J15A 2UUAL 1TXYA 4A93G 3EBEA 4A3IH 3GD7A 1VQFA 5LMUQ 4YHHQ 2C35B 1WJJA 1UWVA 4PG3A 2RCNA 4DK3C 2AMCB 1G6PA 1EQRA 4BBRH 4JI7Q 4HJ9A 4GLAC 1NJIC 3RN2A 5IYDG 5JEAG 2A1AA 3JAMi 1U5KA 4JBJA 5C3EG 1Q8KA 5LMUL 2JA5H 4A3FG 4LNQA 3S16H 4NXNL 2Z6KA 4LF8Q 4IPHA 4LF4L 2K75A 3F2DA 1T9HA 5LMNQ 2KCTA 1EYGA 3CCLA 1PVOA 1YJ9A 4X6AH 4FDBA 1MJEA 1S40A 2BA1A 2VZAA 4H02A 4C2MH 2K5VA 2VQEQ 3PO2H 1C7YA 1HZAA 4YCWA 4AYBE 3GTGH 1VQ9A 2B3GA 3T1YL 3TRZA 4QGUA 5IYDH 3KF6A 5FJ8H 1IBLL 3RR5A 4MNOA 1N9WA 1S72A 3K7UC 4BXXG 4DV7Q 2K50A 4DV2L 5IP9G 3SGIA 2LSSA 1PH9A 2MO1A 4QY7A 4LF8L 1KRSA 5GAGC 3HOYH 1KL9A 2ZJPA 4OWXB 2ID0A 3K80C 4A3MG 5C4XH 3MEFA 4JI5Q 1LYLA 2D62A 2Q2TA 1Q7YC 3FKIG 4ME3A 1XNRL 1V9PA 4R4OA 1HZ9A 4YWLA 5BR8Q 5M3FH 4QQBX 3A0JA 4P75A 2RF4A 5IWAQ 1Z47A 2N78A 4BY7H 1MJCA 4UP9A 4BBRG 2D0PA 3J81j 4B3ML 4PZ6A 2N8NA 3KOJA 1Y1WG 1AH9A 3NENA 3BZCA 3FHWA 4PZ7A 4Y52H 1GO3E 3HOWG 1M1KC 3CCJA 2R93G 4BBSG 2AWNA 5M5WH 3FP9A 4JI1L 4GNXC 2E8GA 2VW9A 5M3FG 3W1BA 2HQLA 2I5MX 2UXDQ 3CCVA 1OXSC 4HIOA 1VQKA 2UXCQ 3ULJA 1FGUA 2JA6H 1CKNB 2EQSA 2GVBA 2L15A 3G71A 1N34Q 1XPRA 1VQ5A 4GN5A 4GLVB 4L5QA 1W3SA 3PIOA 2YTXA 3CPWA 4A3BH 4JV5L 2I5HA 3H0GG 1VQBA 4IFDG 4B3RQ 4GKJQ 2VUMH 4B3TL 5K36G 1GVPA 5FLMH 4DR7L 5IYCH 1TWFH 4IJLA 1CKNA 4LF7L 3EIVA 2WP8J 4KHZA 2ES2A 3ER0A 1WOCA 1KQSA 4X65Q 1NTGA 1HZBA 1Y14B 3KJOA 3FKIH 3ULLA 3I4NH 3KF8B 2UXCL 3PUVA 4DV1Q 3H0GH 3UDIA 4R4TA 4DV3L 3VDYA 1GKHA 5C4XG 4L5SA 2CKZB 2HIVA 3JC66 4DR3Q 1OXUA 1CKMA 5ELNA 1YIJA 1IBKQ 1HNXL 1VQGA 2JA5G 2IY5B 1PH4A 4DUYQ 1HR0Q 3KDFB 4LF9L 5C0XJ 4DAYB 2QEXA 1Z9FA 1Q86C 2PNHA 5J3BA 4A3KG 1W2BA 4DKAC 1WI5A 2B29A 2WB1G 4JI3Q 2NVQH 1E7ZA 1X55A 2IHEA 3HOVH 1KAWA 3PUYA 2VNUD 1UEBA 4A3LG 3L2PA 2OTLA 5LMNW 1HH2P 1XMQL 1I94L 1VS0A 4APVA 4X66L 4JI3L 2Q2IA 1CSPA 2IHFA 3TS0A 1IBML 4K0KQ 2JEAI 2R6GA 2K5NA 3HOUH 2VQFL 2JQOA 4R4CA 3M4OH 3TS2A 4UPAA 1B8AA 1QVGA 4DV7L 4A3MH 2HHHQ 3M3YH 2JA6G 4DR4Q 1FL0A 1SROA 1JJCB 4DR3L 1SN8A 4JYAQ 4PZ8A 3G6EA 5JJIA 1JT8A 5E7NA 1A62A 4JI5L 1JB7A 3TQYA 3J80c 3F1ZA 5IYCG 4OWTB 2ZM6Q 1C0AA 3E0EA 1VQJA 4P71A 4NXNQ 4JOIA 2ATWA 3OW2A 3CQZH 1SMXA 4UY8C 2AKWB 3RZDH 3W1GA 4LFAL 4BBSH 1FJGQ 4UP7A 3DLLA 1YBYA 3KYHC 4Y7NH 2QA4A 4DR2Q 2UUCL 3I4NG 3CP0A 3S2DH 4POFA 2OQKA 4AYBG 4GOPB 3PO3G 1L1OB 3I56A 4JI1Q 1TWGH 1D7QA 4NXMQ 3U4ZA 5IYBG 1S3OA 1K0RA 1VQHA 4DV0Q 5IP9H 3PUWA 4JCVE 1QZHA 1XTDA 3RLOA 4DV6Q 4YWMA 5M3MH 4AIMA 5LMNL 1Q82C 1EIYB 3E9HA 2AWOA 3UE1A 4LWCA 1LTLA 4L5TA 4DV5L 3UDXA 3HKZE 1VCIA 3UDGA 1ASZA 4OX9L 1EFWA 2ZTCA 3KFUA 3S14H 1Y1VG 3D31A 1OXTA 2KBNA 4R1JA 3I55A 1N34L 4A3LH 3U58A 3CMEA 1YHBA 3L0OA 4YCVA 3T1HQ 3JAMc 1KIXA 4OWWB 4A3EG 1XJVA 2UUBL 1L1OA 3CCUA 4JI2Q 1KD1C 4B3SQ 1KHIA 3ERSX 4B3TQ 1NE3A 4GLXA 1N32Q 2UXBL 1VQPA 1HR0L 1WCMG 4LW1A 4C3JH 4A3CG 4BY1H 2DUDA 4LFCQ 1HNWQ 1K9MC 2R7DA 4IPDA 1X56A 2UU9L 2NN6G 4A75A 1B70B 2IT1A 3A74A 3ZJYC 1H95A 1X3FA 4KHPQ 5GAEC 1NMGA 2ASBA 2AHOB 3ULPA 2WAQG 1HNWL 4JI8Q 4NPSA 1EIFA 3S1MH 4B3SL 3Q8DA 2Z6KC 4RG1A 3OTOL 1XMOQ 2I5LX 3KLWA 3PSIA 1BKBA 3CMAA 1Q1EA 4JBWA 4LF7Q 3RZOH 4KHPL 4BA2I 5EAYA 1VQNA 2K5HA 1VQ6A 5AJ3Q 1VQ4A 1U0LA 1VQOA 1PH2A 4DV5Q 1Q12A 1WYDA 2V1CC 3D0FA 3MXNB 3PV0A 4JOIC 4OX9Q 4GS3A 3GTQH 1X3GA 4OO1I 3S2HH 1EWIA 4JV5Q 1EQQA 3S17H 1PH8A 3KDFA 4P74A 2JEBI 1N8RC 1PH7A 2CCZA 2MO0A 2VQEL 4HJ8A 2R7ZH 5GQOA 3I4OA 4YHHL 2JA8H 1IYJB 4JI0L 1G51A 4LF4Q 2MFIA 1J5EQ 4MTNA 4YWKA 4TQUS 5FJ8G 3M85A 1N33Q 3CCMA 3WWVA 4LF5Q 4NXML 1LUZA 4DPGA 4X62L 5H1SE 1QUQA 4A3IG 2Y0SE 2VY3A 1G291 4AH6A 1QZGA 3HKSA 5IWAL 4X64L 4JI6Q 4LFAQ 2EIFA 2K4KA 2JA8G 4DUZL 3M9BA 4DR2L 5IT9c 4A3FH 4X62Q 5C3EH 2OWOA 1RIPA 2OCEA 3H3VH 4JI0Q 5IE8A 1SR3A 3A5ZB 4P72A 1J5EL 1X65A 4LUZA 4B3MQ 1B7YB 4A3JH 2YYZA 1M90C 4YCUA 3S1NH 1OTCA 1Y1WH 4K0KL 1VQIA 4IOAA 3AFPA 5BR8L 3F2BA 4XIGS 3TEHB 1YHAA 1NY4A 2LXJA 1Y1VH 4A3GH 4DUZQ 2JK8A 2HHHL 1SE8A 3BJUA 3K0XA 3PCOB 3STBD 2H5XA 4RMFA 2HT1A 1XPUA 2R7ZG 1K3RA 1VQAA 3M4QA 1VQEA 1P8LA 1YJNA 4A3JG 1PA6A 2D0OA 2N49A 1HZCA 3HOYG 1O7IA 1YEZA 3A5UA 4DV4Q 1K8AC 3U50C 4DAMA 3HOZG 4LF5L 4C3IH 4X65L 2R92H 3DM3A 3LGJA 1QUQB 2Q2UA 4LF6Q 1VQ8A 4BY1G 3K8AA 1I5FA 2VS1A 3F8TA 4JI2L 1E22A 1GD7A 2RHSB 1UE1A 4MZ9A 3S15H 2VQFQ 1J6QA 3F2CA 2NN6I 2ALYB 3KF6B 1FJGL 1C9OA 3PO3H 4DV2Q 1SFOH 3EN2A 4JC0A 4QL5A 2NVXH 2UU9Q 1KRTA 2E2IH 4KI0A 1IBKL 1JE5A 1HJPA 1YITA 3T1YQ 2UXBQ 1K83H 1NMFA 4GOPC 2NVTH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AE2 A;  1UE7 A;  2RHQ B;  2OQ0 A;  3G48 A;  3J81 c;  1OXX K;  2PQA B;  3RNU A;  4EQ5 A;  1TWA H;  3OTO Q;  3GTK H;  3HOZ H;  4DV1 L;  4A3C H;  1WCM H;  2R92 G;  2WFW A;  5M5Y H;  1IBL Q;  2E2J H;  1CKO A;  3HOV G;  4GKK Q;  4DV4 L;  2HIX A;  4IJH A;  1NBW A;  1EUJ A;  4C3H H;  2IX1 A;  4UP8 A;  5AJ3 L;  1IZ6 A;  2EXD A;  4PMW A;  3PF5 A;  1I3Q H;  4KLK A;  1EOV A;  4YY3 Q;  3PUZ A;  4DV0 L;  2PI2 A;  1XMO L;  5GAD C;  2NZH A;  4DR1 L;  1TWH H;  4HJA A;  3CF5 A;  4LF9 Q;  4LFB Q;  3J7A 5;  3RN5 A;  2GVA A;  3M4P A;  3UDF A;  4EX5 A;  2A19 A;  1KXL A;  3S24 A;  1N32 L;  5HGQ A;  4QIW E;  2E2H H;  5M3M G;  1CUK A;  4HJ7 A;  4DV6 L;  4XTC S;  5C4J H;  4DR6 Q;  2YV5 A;  2BA0 A;  4HIM A;  1MIU A;  4LFC L;  3UE0 A;  2B63 H;  4A3D G;  2R7F A;  2Z0S A;  2E5L L;  5FLX c;  1X9N A;  4DNI A;  4O0A A;  3NEL A;  1YI2 A;  3I2Z A;  1JJG A;  4BXX H;  2LXK A;  4GKK L;  4GNX A;  3HKZ G;  4AQY L;  3T1H L;  4OON A;  1N36 Q;  2F4V L;  2VUM G;  2ZM6 L;  4A3E H;  3BU2 A;  4JI4 Q;  1IL2 A;  3CCS A;  1A8V A;  3HFZ B;  3K7A H;  2ZTE A;  5M5X H;  3HOX G;  4DK6 C;  4DV3 Q;  3G4S A;  4JYA L;  4IPC A;  3S1R H;  4R4Q A;  4O2D A;  4JI8 L;  2MQH A;  4DR4 L;  4GN3 B;  3STB C;  2KHI A;  2ZJR A;  1YVC A;  3K81 C;  4L5R C;  2ZJQ A;  1JJ2 A;  3NEM A;  3RLN A;  1E24 A;  2IX0 A;  5GRO A;  3J81 i;  2ZTD A;  1KC8 C;  4LF6 L;  3M7N A;  4OO1 G;  1HNX Q;  1UE6 A;  2JA7 H;  3AEV A;  1D8L A;  1E1T A;  3NBH B;  1V43 A;  4X64 Q;  4A76 A;  4JI6 L;  5JJK A;  3GTO H;  1R9T H;  3J7Z C;  4IO9 A;  4DR5 Q;  2UXD L;  1N36 L;  2QGQ A;  2F4V Q;  2N3S A;  2K52 A;  2CFM A;  2KCM A;  4X66 Q;  5C44 G;  1BVS A;  3CCR A;  2KHJ A;  1IBM Q;  1BBU A;  1VQ7 A;  5GAH C;  1X6O A;  3CC7 A;  1LM0 A;  1XPO A;  4A93 H;  4DUY L;  3AQQ A;  1PHJ A;  1E3P A;  1BBW A;  4LUV A;  4JI7 L;  3GTL H;  3H15 A;  4GNX B;  1E1O A;  3BZK A;  3CC2 A;  1K8G A;  1I6H H;  4JI4 L;  4DR7 Q;  1L0W A;  5IP7 H;  4WJ3 M;  1TWC H;  2JA9 A;  1YHQ A;  1DGS A;  2FXQ A;  4TVA B;  5DLQ E;  1PH5 A;  1P16 A;  2PMZ E;  1N33 L;  1FVI A;  3CXC A;  3GDE A;  4HID A;  3B6Y A;  4GOP A;  3ICE A;  3AFQ A;  2F52 A;  2UUB Q;  5IYB H;  4P73 A;  3I4M G;  1L2F A;  2WAQ E;  1V1Q A;  2F3I A;  4ALP A;  1HR0 W;  3U4V A;  3L7Z C;  2YU9 H;  1K73 C;  4DR6 L;  3S1Q H;  1GM5 A;  2CWA A;  5IY0 A;  3GO5 A;  4GN4 B;  1CSQ A;  1HNZ L;  2UUC Q;  4JBM A;  1XNR Q;  4B3R L;  4GKJ L;  1MKH A;  3OYY A;  1PH3 A;  2Y0S G;  3CD6 A;  2CWP A;  1PV4 A;  3AYH B;  2KEN A;  1SLJ A;  3GTM H;  2R93 H;  1I50 H;  4DR1 Q;  3I4M H;  4IOC A;  5FLM G;  1VQD A;  4DR5 L;  3PF4 A;  3TRE A;  5C0X I;  5JEA J;  2Q2H A;  3PGZ A;  4A3K H;  3I7F A;  5C44 H;  3CAM A;  2MNA A;  1XNQ L;  2K14 A;  2NVY H;  4NB3 A;  4HJ5 A;  4A4I A;  3E9I A;  3IRB A;  3GTP H;  3CPF A;  1YJW A;  4WJ4 A;  4A3G G;  2NZO A;  1JMC A;  1Q81 C;  1HNZ Q;  1X3E A;  3RLF A;  4JBK A;  2JA7 G;  1Q1B A;  2E5L Q;  4R4I A;  1AE3 A;  2I0Q A;  2BH2 A;  4IPG A;  2YTV A;  2JJQ A;  3PO2 G;  1PH6 A;  4OXP A;  3CC4 A;  1RL2 A;  1YZ6 A;  1VQM A;  1Q46 A;  1L1O C;  3HOX H;  2UUA Q;  4AQY Q;  1A0I A;  3J80 i;  4IFD J;  5JJL A;  1WFQ A;  1YNX A;  1X54 A;  1XNQ Q;  1VQC A;  2VL6 A;  4JG2 A;  1PYB A;  2DGY A;  2JE6 I;  3CW2 C;  5HY6 A;  4HIK A;  4BA1 I;  5IP7 G;  5C0X G;  4IFD I;  4LUO A;  3W5O A;  1XMQ Q;  1I94 Q;  2PQA A;  2WB1 E;  2CQO A;  3PUX A;  1QVC A;  5ELO A;  1ASY A;  3KJP A;  4A3B G;  2YTY A;  3H3V I;  1A63 A;  2PI2 E;  4LFB L;  2XGT A;  2XTI A;  1PH1 A;  1UE5 A;  3GTJ H;  3CCE A;  1VQL A;  4BY7 G;  3HOU G;  3PIP A;  4POG A;  2A8V A;  1IXR A;  1SRU A;  2BH8 A;  4QJF A;  4YY3 L;  3CCQ A;  2B63 G;  4A3D H;  1PYS B;  1PFS A;  1OXV A;  2GN5 A;  2OTJ A;  1QVF A;  3HOW H;  4J15 A;  2UUA L;  1TXY A;  4A93 G;  3EBE A;  4A3I H;  3GD7 A;  1VQF A;  5LMU Q;  4YHH Q;  2C35 B;  1WJJ A;  1UWV A;  4PG3 A;  2RCN A;  4DK3 C;  2AMC B;  1G6P A;  1EQR A;  4BBR H;  4JI7 Q;  4HJ9 A;  4GLA C;  1NJI C;  3RN2 A;  5IYD G;  5JEA G;  2A1A A;  3JAM i;  1U5K A;  4JBJ A;  5C3E G;  1Q8K A;  5LMU L;  2JA5 H;  4A3F G;  4LNQ A;  3S16 H;  4NXN L;  2Z6K A;  4LF8 Q;  4IPH A;  4LF4 L;  2K75 A;  3F2D A;  1T9H A;  5LMN Q;  2KCT A;  1EYG A;  3CCL A;  1PVO A;  1YJ9 A;  4X6A H;  4FDB A;  1MJE A;  1S40 A;  2BA1 A;  2VZA A;  4H02 A;  4C2M H;  2K5V A;  2VQE Q;  3PO2 H;  1C7Y A;  1HZA A;  4YCW A;  4AYB E;  3GTG H;  1VQ9 A;  2B3G A;  3T1Y L;  3TRZ A;  4QGU A;  5IYD H;  3KF6 A;  5FJ8 H;  1IBL L;  3RR5 A;  4MNO A;  1N9W A;  1S72 A;  3K7U C;  4BXX G;  4DV7 Q;  2K50 A;  4DV2 L;  5IP9 G;  3SGI A;  2LSS A;  1PH9 A;  2MO1 A;  4QY7 A;  4LF8 L;  1KRS A;  5GAG C;  3HOY H;  1KL9 A;  2ZJP A;  4OWX B;  2ID0 A;  3K80 C;  4A3M G;  5C4X H;  3MEF A;  4JI5 Q;  1LYL A;  2D62 A;  2Q2T A;  1Q7Y C;  3FKI G;  4ME3 A;  1XNR L;  1V9P A;  4R4O A;  1HZ9 A;  4YWL A;  5BR8 Q;  5M3F H;  4QQB X;  3A0J A;  4P75 A;  2RF4 A;  5IWA Q;  1Z47 A;  2N78 A;  4BY7 H;  1MJC A;  4UP9 A;  4BBR G;  2D0P A;  3J81 j;  4B3M L;  4PZ6 A;  2N8N A;  3KOJ A;  1Y1W G;  1AH9 A;  3NEN A;  3BZC A;  3FHW A;  4PZ7 A;  4Y52 H;  1GO3 E;  3HOW G;  1M1K C;  3CCJ A;  2R93 G;  4BBS G;  2AWN A;  5M5W H;  3FP9 A;  4JI1 L;  4GNX C;  2E8G A;  2VW9 A;  5M3F G;  3W1B A;  2HQL A;  2I5M X;  2UXD Q;  3CCV A;  1OXS C;  4HIO A;  1VQK A;  2UXC Q;  3ULJ A;  1FGU A;  2JA6 H;  1CKN B;  2EQS A;  2GVB A;  2L15 A;  3G71 A;  1N34 Q;  1XPR A;  1VQ5 A;  4GN5 A;  4GLV B;  4L5Q A;  1W3S A;  3PIO A;  2YTX A;  3CPW A;  4A3B H;  4JV5 L;  2I5H A;  3H0G G;  1VQB A;  4IFD G;  4B3R Q;  4GKJ Q;  2VUM H;  4B3T L;  5K36 G;  1GVP A;  5FLM H;  4DR7 L;  5IYC H;  1TWF H;  4IJL A;  1CKN A;  4LF7 L;  3EIV A;  2WP8 J;  4KHZ A;  2ES2 A;  3ER0 A;  1WOC A;  1KQS A;  4X65 Q;  1NTG A;  1HZB A;  1Y14 B;  3KJO A;  3FKI H;  3ULL A;  3I4N H;  3KF8 B;  2UXC L;  3PUV A;  4DV1 Q;  3H0G H;  3UDI A;  4R4T A;  4DV3 L;  3VDY A;  1GKH A;  5C4X G;  4L5S A;  2CKZ B;  2HIV A;  3JC6 6;  4DR3 Q;  1OXU A;  1CKM A;  5ELN A;  1YIJ A;  1IBK Q;  1HNX L;  1VQG A;  2JA5 G;  2IY5 B;  1PH4 A;  4DUY Q;  1HR0 Q;  3KDF B;  4LF9 L;  5C0X J;  4DAY B;  2QEX A;  1Z9F A;  1Q86 C;  2PNH A;  5J3B A;  4A3K G;  1W2B A;  4DKA C;  1WI5 A;  2B29 A;  2WB1 G;  4JI3 Q;  2NVQ H;  1E7Z A;  1X55 A;  2IHE A;  3HOV H;  1KAW A;  3PUY A;  2VNU D;  1UEB A;  4A3L G;  3L2P A;  2OTL A;  5LMN W;  1HH2 P;  1XMQ L;  1I94 L;  1VS0 A;  4APV A;  4X66 L;  4JI3 L;  2Q2I A;  1CSP A;  2IHF A;  3TS0 A;  1IBM L;  4K0K Q;  2JEA I;  2R6G A;  2K5N A;  3HOU H;  2VQF L;  2JQO A;  4R4C A;  3M4O H;  3TS2 A;  4UPA A;  1B8A A;  1QVG A;  4DV7 L;  4A3M H;  2HHH Q;  3M3Y H;  2JA6 G;  4DR4 Q;  1FL0 A;  1SRO A;  1JJC B;  4DR3 L;  1SN8 A;  4JYA Q;  4PZ8 A;  3G6E A;  5JJI A;  1JT8 A;  5E7N A;  1A62 A;  4JI5 L;  1JB7 A;  3TQY A;  3J80 c;  3F1Z A;  5IYC G;  4OWT B;  2ZM6 Q;  1C0A A;  3E0E A;  1VQJ A;  4P71 A;  4NXN Q;  4JOI A;  2ATW A;  3OW2 A;  3CQZ H;  1SMX A;  4UY8 C;  2AKW B;  3RZD H;  3W1G A;  4LFA L;  4BBS H;  1FJG Q;  4UP7 A;  3DLL A;  1YBY A;  3KYH C;  4Y7N H;  2QA4 A;  4DR2 Q;  2UUC L;  3I4N G;  3CP0 A;  3S2D H;  4POF A;  2OQK A;  4AYB G;  4GOP B;  3PO3 G;  1L1O B;  3I56 A;  4JI1 Q;  1TWG H;  1D7Q A;  4NXM Q;  3U4Z A;  5IYB G;  1S3O A;  1K0R A;  1VQH A;  4DV0 Q;  5IP9 H;  3PUW A;  4JCV E;  1QZH A;  1XTD A;  3RLO A;  4DV6 Q;  4YWM A;  5M3M H;  4AIM A;  5LMN L;  1Q82 C;  1EIY B;  3E9H A;  2AWO A;  3UE1 A;  4LWC A;  1LTL A;  4L5T A;  4DV5 L;  3UDX A;  3HKZ E;  1VCI A;  3UDG A;  1ASZ A;  4OX9 L;  1EFW A;  2ZTC A;  3KFU A;  3S14 H;  1Y1V G;  3D31 A;  1OXT A;  2KBN A;  4R1J A;  3I55 A;  1N34 L;  4A3L H;  3U58 A;  3CME A;  1YHB A;  3L0O A;  4YCV A;  3T1H Q;  3JAM c;  1KIX A;  4OWW B;  4A3E G;  1XJV A;  2UUB L;  1L1O A;  3CCU A;  4JI2 Q;  1KD1 C;  4B3S Q;  1KHI A;  3ERS X;  4B3T Q;  1NE3 A;  4GLX A;  1N32 Q;  2UXB L;  1VQP A;  1HR0 L;  1WCM G;  4LW1 A;  4C3J H;  4A3C G;  4BY1 H;  2DUD A;  4LFC Q;  1HNW Q;  1K9M C;  2R7D A;  4IPD A;  1X56 A;  2UU9 L;  2NN6 G;  4A75 A;  1B70 B;  2IT1 A;  3A74 A;  3ZJY C;  1H95 A;  1X3F A;  4KHP Q;  5GAE C;  1NMG A;  2ASB A;  2AHO B;  3ULP A;  2WAQ G;  1HNW L;  4JI8 Q;  4NPS A;  1EIF A;  3S1M H;  4B3S L;  3Q8D A;  2Z6K C;  4RG1 A;  3OTO L;  1XMO Q;  2I5L X;  3KLW A;  3PSI A;  1BKB A;  3CMA A;  1Q1E A;  4JBW A;  4LF7 Q;  3RZO H;  4KHP L;  4BA2 I;  5EAY A;  1VQN A;  2K5H A;  1VQ6 A;  5AJ3 Q;  1VQ4 A;  1U0L A;  1VQO A;  1PH2 A;  4DV5 Q;  1Q12 A;  1WYD A;  2V1C C;  3D0F A;  3MXN B;  3PV0 A;  4JOI C;  4OX9 Q;  4GS3 A;  3GTQ H;  1X3G A;  4OO1 I;  3S2H H;  1EWI A;  4JV5 Q;  1EQQ A;  3S17 H;  1PH8 A;  3KDF A;  4P74 A;  2JEB I;  1N8R C;  1PH7 A;  2CCZ A;  2MO0 A;  2VQE L;  4HJ8 A;  2R7Z H;  5GQO A;  3I4O A;  4YHH L;  2JA8 H;  1IYJ B;  4JI0 L;  1G51 A;  4LF4 Q;  2MFI A;  1J5E Q;  4MTN A;  4YWK A;  4TQU S;  5FJ8 G;  3M85 A;  1N33 Q;  3CCM A;  3WWV A;  4LF5 Q;  4NXM L;  1LUZ A;  4DPG A;  4X62 L;  5H1S E;  1QUQ A;  4A3I G;  2Y0S E;  2VY3 A;  1G29 1;  4AH6 A;  1QZG A;  3HKS A;  5IWA L;  4X64 L;  4JI6 Q;  4LFA Q;  2EIF A;  2K4K A;  2JA8 G;  4DUZ L;  3M9B A;  4DR2 L;  5IT9 c;  4A3F H;  4X62 Q;  5C3E H;  2OWO A;  1RIP A;  2OCE A;  3H3V H;  4JI0 Q;  5IE8 A;  1SR3 A;  3A5Z B;  4P72 A;  1J5E L;  1X65 A;  4LUZ A;  4B3M Q;  1B7Y B;  4A3J H;  2YYZ A;  1M90 C;  4YCU A;  3S1N H;  1OTC A;  1Y1W H;  4K0K L;  1VQI A;  4IOA A;  3AFP A;  5BR8 L;  3F2B A;  4XIG S;  3TEH B;  1YHA A;  1NY4 A;  2LXJ A;  1Y1V H;  4A3G H;  4DUZ Q;  2JK8 A;  2HHH L;  1SE8 A;  3BJU A;  3K0X A;  3PCO B;  3STB D;  2H5X A;  4RMF A;  2HT1 A;  1XPU A;  2R7Z G;  1K3R A;  1VQA A;  3M4Q A;  1VQE A;  1P8L A;  1YJN A;  4A3J G;  1PA6 A;  2D0O A;  2N49 A;  1HZC A;  3HOY G;  1O7I A;  1YEZ A;  3A5U A;  4DV4 Q;  1K8A C;  3U50 C;  4DAM A;  3HOZ G;  4LF5 L;  4C3I H;  4X65 L;  2R92 H;  3DM3 A;  3LGJ A;  1QUQ B;  2Q2U A;  4LF6 Q;  1VQ8 A;  4BY1 G;  3K8A A;  1I5F A;  2VS1 A;  3F8T A;  4JI2 L;  1E22 A;  1GD7 A;  2RHS B;  1UE1 A;  4MZ9 A;  3S15 H;  2VQF Q;  1J6Q A;  3F2C A;  2NN6 I;  2ALY B;  3KF6 B;  1FJG L;  1C9O A;  3PO3 H;  4DV2 Q;  1SFO H;  3EN2 A;  4JC0 A;  4QL5 A;  2NVX H;  2UU9 Q;  1KRT A;  2E2I H;  4KI0 A;  1IBK L;  1JE5 A;  1HJP A;  1YIT A;  3T1Y Q;  2UXB Q;  1K83 H;  1NMF A;  4GOP C;  2NVT H; 
#chains in the Genus database with same CATH topology
 1AE2 A;  2OQ0 A;  2E75 C;  4KMU C;  2PQA B;  3TDQ A;  1CM9 A;  1LT3 D;  4LAA A;  3EJI A;  4GKK Q;  1IBL Q;  4IJH A;  1D5Z C;  1EUJ A;  4PMW A;  1EOV A;  5ISR A;  2PI2 A;  1STA A;  5GAD C;  2NZH A;  5ELD A;  1PLF A;  3CF5 A;  2NVQ B;  3J7A 5;  3LX0 A;  2GVA A;  3M4P A;  3PIP 3;  2K5W A;  3BS1 A;  2KOL A;  4BBR B;  4RKL A;  4DV6 L;  4XT1 B;  5C4J H;  4DR6 Q;  1HRJ A;  4OIJ A;  2Q8T A;  4I65 A;  5IGE A;  1PMR A;  1CA5 A;  3NEL A;  1WTV A;  4FNF A;  4CJ1 B;  2K05 A;  3MHB A;  3HKZ G;  1M4V A;  1CQV A;  2VUM G;  1DOM A;  3BU2 A;  4JI4 Q;  2KVM A;  1E2W A;  3CCS A;  1A8V A;  4UHV A;  2F0G A;  2ZTE A;  4DV3 Q;  1H9S A;  2OXP A;  2LY7 A;  3S1R H;  4FO2 A;  4DR4 L;  5IGC A;  4DAV A;  4WRD A;  3W2D A;  1H9J A;  3MXU A;  4PV1 C;  2EVB A;  1JJ2 A;  2IX0 A;  4MTK A;  1KC8 C;  2ZTD A;  4BY7 B;  3AEV A;  2JA7 H;  4A76 A;  5J22 A;  4BS9 A;  4IO9 A;  4DR5 Q;  2UXD L;  2N3S A;  3CCR A;  4CKE A;  1LTS D;  2R61 A;  3KLS X;  5CR3 A;  3CC7 A;  2P5Z X;  1LM0 A;  3OOC A;  1PHJ A;  4JI7 L;  1B44 D;  1W6J A;  3H15 A;  1IW7 C;  5IP7 H;  4WJ3 M;  1TWC H;  2FXQ A;  4TVA B;  4TRD A;  3T13 A;  3NTI A;  1FVI A;  4OO1 H;  3WOF A;  2F52 A;  5DNF A;  2WAQ E;  1V1Q A;  2F3I A;  3P1H A;  4ALP A;  1HR0 W;  3E6Z X;  3S1Q H;  3D6C A;  1HNZ L;  2IWH A;  3N52 A;  3NXW A;  2CWP A;  1SLJ A;  4KK7 A;  1D2B A;  2PZT A;  2K1B A;  5C44 H;  4NB3 A;  1A3U A;  3IRB A;  1ICF B;  2L11 A;  4PMC A;  1TT2 A;  2IJ0 A;  3GTP H;  1C48 A;  2FMC A;  2MUY A;  1AE3 A;  3D4W A;  2YTV A;  1LO5 D;  1HTL D;  2WAC A;  2M9V A;  1EYD A;  1GJX A;  5C3X A;  1XWE A;  4IFD J;  1YNX A;  2DN8 A;  1X54 A;  2K7V A;  1VQC A;  2VL6 A;  3DMU A;  5HY6 A;  3VYS A;  4R9W A;  1DZ1 A;  2FJ2 A;  2CQO A;  2D2C C;  1QVC A;  1I6V C;  4JW0 A;  1PTO H;  3HOZ B;  4LFB L;  2XGT A;  5F2D A;  1H9M A;  3HOU G;  2MHV A;  4I7A A;  1UNS A;  4FF4 A;  3IKJ A;  4K8I A;  2A68 C;  2RCF A;  4YY3 L;  3R3O A;  1HA6 A;  1PYS B;  1OXV A;  4ILW A;  1X3Q A;  2UUA L;  1Y8N B;  2GA4 B;  1JC7 A;  2XNA C;  2XIW A;  2C35 B;  5D14 A;  4PG3 A;  1HFG A;  4DK3 C;  1G6P A;  3FMC A;  4KN7 C;  4BBR H;  4JI7 Q;  1A2U A;  5IYD G;  1STG A;  2A1A A;  4ZAI A;  4ABN A;  1TWF B;  2EE1 A;  2Z6K A;  4LF8 Q;  3TP8 A;  1TVX A;  4OEL B;  4OGQ C;  1EYG A;  3CCL A;  2F0P A;  2JP1 A;  4KY7 A;  3KBX A;  3S14 B;  2VZA A;  1E2V A;  4DK1 A;  2MPM A;  1C8C A;  4YCW A;  3TRZ A;  4N9P A;  3FDT A;  3KF6 A;  2F0J A;  1IBL L;  1S72 A;  1A3T A;  1JWS D;  3VR5 A;  3V2T A;  4DV2 L;  3SGI A;  4CDD C;  2B63 B;  1EL0 A;  1PH9 A;  3OWF A;  3ZYY X;  2MO1 A;  2ZJP A;  2ID0 A;  3K80 C;  4UDU C;  3MEF A;  5C4X H;  4DNT B;  4BWG B;  3FKI G;  1EWH A;  3S17 B;  4P75 A;  2RF4 A;  1Z47 A;  2N78 A;  3DWA A;  1BXT A;  4UP9 A;  3J81 j;  2CH4 W;  4B3M L;  4PZ6 A;  2IPK D;  1AH9 A;  2AWN A;  5DAU A;  5M3F G;  3HP3 A;  4HIO A;  3HKZ B;  4XQQ A;  4B9W A;  4ZLT F;  2GVB A;  1XPR A;  4GLV B;  3BVM A;  4L5Q A;  1TS5 A;  4ULL A;  5M9O A;  3PIO A;  3VR6 A;  3CPW A;  1WTX A;  1NSN S;  4HMJ A;  1TWC B;  3NK9 A;  1XYI A;  1SSO A;  1GVP A;  1DOK A;  5FLM H;  5IYC H;  1TWF H;  4IJL A;  4DN4 M;  1CKN A;  3EIV A;  1S5C D;  2EYF A;  1WOC A;  3EFX D;  5KYL A;  1JWU D;  1GXD C;  3UDI A;  5JJZ A;  3IFT A;  3NQT A;  1WCM B;  1A6X A;  4DR3 Q;  1HNX L;  2JA5 G;  1PH4 A;  3FRP B;  5C0X J;  1ZEQ X;  1Z9F A;  1Q86 C;  1RHP A;  4RWS C;  2B29 A;  2WB1 G;  4JI3 Q;  4XXE A;  1KAW A;  5L37 A;  1C4Q A;  3VA7 A;  3K0Y A;  2NVX B;  2RVL A;  1I94 L;  1TU2 B;  4K0K Q;  2IHF A;  3NHH A;  1B9N A;  1K83 B;  1D5X C;  2R6G A;  2VQF L;  2JQO A;  4R4C A;  2R92 B;  3M4O H;  4UPA A;  1B8A A;  1EQT A;  4FXG C;  5FO8 B;  1G6Z A;  2XVS A;  1S5E D;  4AYB B;  1HQM C;  4ZYS A;  1F77 A;  1VF7 A;  3F1Z A;  4OWT B;  1SNM A;  1C0A A;  3E0E A;  4ID6 A;  3JAM L;  4JOI A;  3RUZ A;  4DK0 A;  4KKS A;  4UY8 C;  2AKW B;  3I4N G;  1YNN D;  2QA4 A;  2UUC L;  4RGO S;  4AYB G;  3D3R A;  1DON A;  2G9H D;  1D7Q A;  3U4Z A;  1VQH A;  4G7O C;  4IUP A;  3ONA B;  5IGF A;  1QZH A;  1XTD A;  5IOC A;  2CW0 C;  3UE1 A;  4L5T A;  3H94 A;  4NMZ A;  2WB1 B;  1WTH A;  3CME A;  3T1H Q;  1KIX A;  2JSO A;  3IL8 A;  5C3E B;  1XJV A;  4B3S Q;  1N32 Q;  1RD9 D;  1ML0 D;  5JPM C;  1WCM G;  3M4O B;  1GHK A;  3MXG A;  1IW7 D;  1TS3 A;  4BY1 H;  1HNW Q;  3S1N B;  5M5X B;  4A75 A;  1B70 B;  1EQV A;  1PTO B;  1H95 A;  3PIO 3;  2SDF A;  2H1E A;  3PQI A;  4FF2 A;  5GAE C;  3NWT A;  2B8G A;  4JI8 Q;  4QIW B;  3S1M H;  2DJG C;  1V1P A;  2Z6K C;  3OTO L;  1XMO Q;  4JBW A;  2FIN B;  1PTO F;  1VQ6 A;  1MGS A;  3TZD A;  3KLR A;  1PH2 A;  1JWM D;  1Q12 A;  1BCP C;  2V1C C;  1GUS A;  1SNO A;  1X3G A;  4JV5 Q;  2JEB I;  1HQR D;  1FR3 A;  4X3T A;  4A3B B;  4YHH L;  3OMG A;  2WV6 D;  3N6R A;  4LF4 Q;  1YNJ D;  1U4R A;  1L0X B;  4TQU S;  5FJ8 G;  4ODG A;  3M85 A;  3PO2 B;  2B2V C;  3TME A;  5H1S E;  4A3I G;  1LT4 D;  2CQA A;  1GHJ A;  1F2Y A;  5M5Y B;  3FKI B;  4LMQ D;  4JI6 Q;  1BCP D;  1GUN A;  1O7L A;  3LWU A;  5I2X A;  3D4R A;  1RIP A;  3GTJ B;  3H3V H;  1HA5 A;  3GP7 A;  4IUQ A;  4LUZ A;  1YNJ C;  4HN7 A;  1KTK A;  1B7Y B;  4A3J H;  1G2T A;  3S1N H;  1OTC A;  3PMF A;  2IX3 A;  2PQE A;  4IOA A;  4K5W A;  4XYO A;  2NUC A;  1QWY A;  3TEH B;  1AW7 A;  2HCC A;  4A3G H;  4J6H A;  2JK8 A;  3BJU A;  2R7Z G;  3S1M B;  5A2Q L;  4A3J G;  5C4Z A;  2VB2 X;  1Y69 U;  4K2L A;  3G6J B;  4C3I H;  4X65 L;  4LF5 L;  3LGJ A;  2Q2U A;  5KNB A;  1KNE A;  1QNK A;  4DXG A;  1E22 A;  2VQF Q;  2ALY B;  2WKD A;  1GUT A;  4DV2 Q;  4U68 A;  5ELC A;  4JC0 A;  4KY6 A;  1KRT A;  2RDH A;  1YIT A;  1NMF A;  5FO9 B;  2NVT H;  4DAP A;  1UE7 A;  1TQO A;  2PO4 A;  1BCP B;  2OF1 A;  4NKL A;  1EY0 A;  1D5M C;  4DV1 L;  3I91 A;  2F0S A;  3HOV G;  1CKO A;  4I7Z C;  1NBW A;  4UP8 A;  3G7L A;  3PF5 A;  1EYC A;  3I73 A;  3VR4 A;  3VYR A;  4DR1 L;  1TWH H;  4LF9 Q;  3GTL B;  1R4Q B;  2WKC A;  1S4Z A;  3RN5 A;  1STB A;  2A19 A;  4L8J A;  5FLX L;  4FXD A;  2F0I A;  1KXL A;  3S24 A;  1F2L A;  5HGQ A;  2E2H H;  5M3M G;  3DWQ A;  4HIM A;  1MIU A;  1WD0 A;  4S3S A;  2B63 H;  4DNR B;  2R7F A;  2Z0S A;  2E5L L;  1B3Q A;  4NW2 A;  3QB3 A;  3I3C A;  4O0A A;  3FVQ A;  1YI2 A;  4ZKC B;  5C4X B;  4GKK L;  1WTP A;  4FVM A;  4GNX A;  4V0B A;  1RCV D;  3T1H L;  3BG3 A;  2ZM6 L;  4JK1 C;  4G57 A;  3A55 A;  3K5L A;  3AMU A;  3OWE B;  5LL6 X;  1QG7 A;  2NZ1 D;  3QOJ A;  4O2D A;  2EDG A;  1SXT A;  4FF1 A;  1MSH A;  3K81 C;  4L5R C;  1G91 A;  2X6L A;  3RLN A;  2KUM A;  1E24 A;  2NVT B;  4JVZ A;  1LAC A;  3A8K E;  5K5P A;  4OO1 G;  4IAL A;  1UE6 A;  1ZKO A;  3NBH B;  4JI6 L;  2OT2 A;  2C5C A;  2F0F A;  5JVG 3;  4XQN A;  3FEW X;  1QJO A;  2QGQ A;  3TBI B;  5M5W B;  2KHJ A;  1BBU A;  1VQ7 A;  2F0E A;  1XPO A;  3AQQ A;  1E3P A;  2F0W A;  4LUV A;  1PZK D;  3TN2 A;  5KYI A;  3HZX A;  2O2L D;  4QMG A;  3K59 A;  1E1O A;  3BZK A;  3CC2 A;  4JI4 L;  1PRT B;  1YHQ A;  5DLQ E;  4OIK A;  3I70 A;  2PMZ E;  1N33 L;  2A69 D;  3CXC A;  3GDE A;  4GOP A;  5IYB H;  3C3L A;  4P73 A;  2M2L A;  4KKT A;  4ZKB B;  5D3I B;  2YU9 H;  4DR6 L;  2B39 A;  5IY0 A;  2UUC Q;  1O7Y A;  1Q3L A;  3RZD B;  4GKJ L;  1MKH A;  1PH3 A;  3CD6 A;  2KEN A;  2NYZ D;  1Y1W B;  3I4M H;  4IOC A;  5FLM G;  4DR5 L;  1KDB A;  5E1F A;  3TRE A;  3PGZ A;  3CAM A;  1XNQ L;  2NVY H;  3E9I A;  5KND A;  3CPF A;  1YJW A;  4F87 A;  1X3E A;  4L63 B;  4K5V A;  2G9D A;  4JBK A;  1Q1B A;  1LTR D;  1V1O A;  2BH2 A;  4C3I B;  3PO2 G;  1CZG A;  2RQX A;  3CC4 A;  1CTM A;  1H9R A;  1L1O C;  3URY A;  1PZJ D;  1WFQ A;  2N88 A;  5IT9 L;  4HIK A;  5IP7 G;  1U9R A;  4IFD I;  1DOL A;  3S9W A;  1XMQ Q;  4CJ2 C;  3PUX A;  1HCZ A;  3E3X A;  5ELO A;  3S15 B;  3KJP A;  4HCE A;  2EY2 A;  2PI2 E;  1MBY A;  1ESR A;  3T51 B;  4BY7 G;  3GTJ H;  2D9U A;  4POG A;  2A8V A;  1I4G A;  1SRU A;  1ESF A;  2BH8 A;  3D4D A;  3CCQ A;  4A3D H;  4IUU A;  3HOW H;  4J15 A;  4OEM B;  2JN4 A;  2HUG A;  4RCO A;  5DEH A;  1MD2 D;  1RTO A;  1WJJ A;  2DNE A;  2RCN A;  4KKU A;  2E2D C;  4A3G B;  2NB0 A;  1EQR A;  2EYO A;  4HJ9 A;  1NJI C;  5CV9 A;  3RN2 A;  3JAM i;  3ERQ A;  5JEA G;  5C3E G;  3V05 A;  5C4H A;  3I8Z A;  2NVY B;  4IPH A;  4LF4 L;  5LMN Q;  1PVO A;  3L9A X;  2QDL A;  1S40 A;  1LT6 D;  2BA1 A;  5I4D A;  4C2M H;  1HZA A;  3QWN A;  3J81 L;  1ICW A;  2B3G A;  4H44 C;  3T1Y L;  4QGU A;  4A3E B;  5FJ8 H;  1N9W A;  3A7L A;  3CRL C;  3MZ5 A;  1I4P A;  2EY6 A;  2HQE A;  4A3F B;  1KRS A;  4EQN A;  1D1K A;  3HOY H;  1KL9 A;  4ZUI A;  4A3M G;  4KJO A;  1CI3 M;  1LYL A;  1O7Z A;  4ME3 A;  1S5B D;  1XNR L;  1V9P A;  4M8A A;  1HZ9 A;  3BYT B;  4YWL A;  5M3F H;  5IIF A;  2R3Z A;  2N55 A;  4BBR G;  5IGG A;  1I3Q B;  1JOK A;  2N8N A;  3BZC A;  3DUZ A;  4PZ7 A;  1MSG A;  1GO3 E;  2R93 G;  5M5W H;  3TP6 A;  4JI1 L;  4GNX C;  5KNC A;  2HQL A;  1WTR A;  2UXD Q;  3CCV A;  5C5L A;  2H4O A;  1S5D D;  3DXJ C;  3ULJ A;  2PZU A;  2JA6 H;  2EQS A;  1VQ5 A;  2JA7 B;  3G71 A;  3VYU A;  2DY8 A;  1R9T B;  2WII B;  4IFD G;  4B3R Q;  1CA6 A;  4G7H C;  1ILQ A;  1SND A;  1A3V A;  4LF7 L;  2WP8 J;  2ES2 A;  3F2U A;  3ER0 A;  4X65 Q;  1NTG A;  1Y14 B;  1JQY D;  1OO9 B;  4X3S A;  3ULL A;  2UXC L;  4DV1 Q;  5D65 A;  3H0G H;  3OPO A;  5EKL A;  3R93 A;  2HIV A;  1BQQ T;  4Z9C B;  2MJ8 A;  2IL8 A;  2RKS A;  1YIJ A;  1X3P A;  1HR0 Q;  1ENF A;  3KDF B;  4LF9 L;  4HR7 B;  3S1Q B;  4KN4 C;  4A3K G;  1W2B A;  1WI5 A;  3GTO B;  1X55 A;  3MWY W;  3NPP A;  2XSC A;  2KHS A;  2K6A A;  5LMN W;  4HSV A;  1HH2 P;  1BOS A;  3GQB A;  4APV A;  4X66 L;  4JI3 L;  3A56 A;  3TS0 A;  3BDL A;  5C44 B;  1EFI D;  2L12 A;  3TS2 A;  1SEB D;  1EZ8 A;  4A3M H;  2X6G A;  2HHH Q;  1SRO A;  4DR3 L;  2B2V A;  5J1Z A;  1B9M A;  4NP5 A;  1JB7 A;  2PW5 A;  3CU7 A;  3GV6 A;  4P71 A;  2YU9 B;  3RZO B;  1STN A;  4LFA L;  1FJG Q;  4DR2 Q;  1AZP A;  2OEO A;  3S2D H;  4POF A;  2EYL A;  3GTM B;  1ROD A;  3J7A V;  3PO3 G;  1TWG H;  1SJE D;  1NCV A;  1DYQ A;  1S3O A;  2BOS A;  2B2Y C;  1SYC A;  2EPB A;  1TR5 A;  4R8I A;  4XQJ A;  4YWM A;  4MN3 A;  1LTL A;  3P20 A;  1A2T A;  2LS0 1;  4OX9 L;  3UDX A;  3HKZ E;  3KFU A;  4A3C H;  2ZTC A;  4A3L H;  2KBN A;  1N34 L;  1HPC A;  3VR3 A;  1B4O A;  1SNQ A;  4XYQ A;  3L0O A;  4YCV A;  4A3E G;  1LAB A;  4B9X A;  5EPK A;  1NUC A;  3CCU A;  4B3T Q;  4IUV A;  5IGB A;  4GLX A;  1CZW A;  2O5J C;  4LW1 A;  4A3C G;  1BDO A;  5COR A;  2DUD A;  4A3M B;  1YNN C;  1K9M C;  2R7D A;  4H7B A;  1X56 A;  3HOY B;  2NN6 G;  3A74 A;  1EY5 A;  5JAV A;  2BDO A;  1B3A A;  5M3F B;  1NMG A;  2ASB A;  1HNW L;  4IZ8 A;  3RZO H;  5KRU A;  1Q1E A;  5E4X A;  4LF7 Q;  1SYB A;  5EAY A;  1VQN A;  1DJR D;  2K5H A;  3GTP B;  5C6A A;  1VQ4 A;  2FFK B;  2F0M A;  2E76 C;  4JOI C;  2F4I A;  3PV0 A;  2ZXP A;  1R4P B;  3S17 H;  2RSN A;  1N8R C;  2CCZ A;  1TY2 A;  3D6W A;  4PNY A;  5I6Y A;  1IYJ B;  2MFI A;  1LT5 D;  4MTN A;  3WWV A;  4EQP A;  3FPU B;  4X62 L;  1QUQ A;  3CRK C;  1G29 1;  3SK4 A;  2SNM A;  4AH6 A;  4XT3 B;  4X64 L;  1EIH A;  3J81 E;  2EJM A;  1TS4 A;  1RKN A;  5IT9 c;  4QB4 A;  5FOB B;  2OWO A;  3QG1 A;  1SYF A;  4C3I G;  3RD4 A;  4Q0F A;  4JI0 Q;  3SVM A;  2PYK A;  3MXP A;  4IQZ A;  2B2W A;  4K6D A;  4B3M Q;  4EGV A;  4YCU A;  1EYA A;  1VQI A;  3K6O A;  5BR8 L;  4XIG S;  1YHA A;  3NTH A;  5A35 A;  1STH A;  3NBI A;  3VR2 A;  4DUZ Q;  3BVZ A;  5EPL A;  3PCO B;  1EIG A;  4RMF A;  2HT1 A;  1VQE A;  1P8L A;  1YJN A;  1PA6 A;  1RDP D;  2D0O A;  1FNU A;  1O7I A;  4DV4 Q;  3A5U A;  1K8A C;  2PPB C;  3U50 C;  3HOZ G;  4OHJ A;  2EJG C;  1QUQ B;  3P75 A;  1I5F A;  2VS1 A;  5G3L D;  2RHS B;  1G2S A;  1UE1 A;  2G5D A;  2SEB D;  2XWJ B;  2NN6 I;  5ELE A;  1T5X D;  3EN2 A;  2NVX H;  1FYC A;  2EZV A;  1F2M A;  4KI0 A;  1HJP A;  1K83 H;  4GOP C;  5G3L F;  1AEX A;  1O80 A;  1MI2 A;  1VF5 C;  2RHQ B;  1WVL A;  3G48 A;  1F9S A;  2A69 C;  2J4X A;  3NTK A;  3H0G B;  5EPJ A;  1TWA H;  1SJH D;  3OTO Q;  3HOZ H;  1SE2 A;  2WFW A;  2E2J H;  1E2Z A;  4DV4 L;  4KD3 A;  4P2C B;  1IZ6 A;  2ICI A;  4KLK A;  2K5D A;  4YY3 Q;  3PUZ A;  3RMH A;  5T1I A;  3J7Y W;  4LFB Q;  4EX5 A;  2Z8L A;  4IUN A;  3C1F A;  1N32 L;  1PFN A;  4LJZ C;  4QIW E;  4HJ7 A;  4N9T A;  2YV5 A;  4LFC L;  3UE0 A;  1X9N A;  2O4X A;  1EY7 A;  3H6M A;  3I2Z A;  4RFB A;  1JJG A;  2K5Q A;  4BXX H;  2LXK A;  1FNV A;  1JOO A;  2F4V L;  2Y0S B;  2RDF A;  3C1E A;  3T56 B;  1IL2 A;  4JYA L;  4DK6 C;  2DJF C;  3G4S A;  2V4D A;  1EU4 A;  4R4Q A;  3K57 A;  3HG9 A;  3X3N A;  1RF2 D;  2MQH A;  1FGB D;  5LL6 S;  2IW3 A;  3I90 A;  1V1P B;  2Z4I A;  3D8G A;  1SE3 A;  2ZJR A;  4R8N A;  1NR2 A;  2I46 A;  1PRT F;  2EYP A;  5GRO A;  3J81 i;  2FHT A;  3M7N A;  2L5T A;  4H13 C;  1TWG B;  3M7G A;  5JJK A;  1V43 A;  1QCB D;  4X64 Q;  3QR8 A;  4DFA A;  3SDZ A;  1R9T H;  4WOR A;  3J7Z C;  1SMY D;  3HOV B;  1Y8P B;  2F4V Q;  2XN9 C;  2KCM A;  4X66 Q;  5C44 G;  2AQ2 B;  1KDA A;  4PMB A;  5GAH C;  1X6O A;  2QF7 A;  1JB3 A;  1BBW A;  5NUC A;  4DR7 Q;  1PYW D;  4JPB W;  2JA9 A;  1PFM A;  1PH5 A;  3IAY A;  4RH6 A;  1UAP A;  5FLX E;  3BDO A;  2A6H D;  3I4M G;  4KJN A;  2CWA A;  3I4L A;  4KY5 A;  1CSQ A;  1K3B C;  4BBS B;  4E6I A;  3OYY A;  1PV4 A;  3KBG A;  1SAP A;  3AYH B;  4O1N A;  1JOR A;  4DR1 Q;  2VB3 X;  2Q8I B;  1BUV T;  4J8Q A;  2Q2H A;  1E0B A;  2MNA A;  1SNP A;  3CKI B;  2K14 A;  4HJ5 A;  4WJ4 A;  4PQX A;  4F7X A;  4A3G G;  4CHT B;  4F88 A;  1HNZ Q;  3RLF A;  2HDL A;  2ICE C;  2JA7 G;  2E5L Q;  1HHV A;  4A3J B;  2JJQ A;  1PH6 A;  5CV4 A;  3TP5 A;  1VMP A;  3DHQ A;  3QJY A;  3BVG A;  5JJL A;  1Z7T A;  1TKW B;  1SFO B;  4JG2 A;  1EZ6 A;  2SOB A;  3EVQ A;  5C0X G;  4KV6 A;  3S2D B;  1I94 Q;  4HAE A;  2PQA A;  1JIC A;  2VXW A;  3OSO A;  2F0V A;  2HD3 A;  2CW0 D;  5CV7 A;  4BY1 B;  4A3B G;  2YTY A;  3H3V I;  1A63 A;  2FMM A;  2XTI A;  3BDC A;  3CCE A;  2M00 A;  3MXN A;  4TSS A;  3PIP A;  4ZUJ A;  2WAQ B;  2E2I B;  5I9O A;  1IXR A;  4QJF A;  1PFS A;  2GN5 A;  2RA4 A;  3TP7 A;  1QVF A;  4A93 G;  1CHP D;  3EBE A;  1TII D;  3A8J E;  4DGZ A;  3FPP A;  1UWV A;  1B53 A;  1B1Z A;  5CV5 A;  2F1M A;  1CT1 D;  2A5H A;  2ZXO A;  4JBJ A;  5C4J B;  3O13 A;  4LNQ A;  4A3F G;  2L0C A;  2J0T D;  2K75 A;  1DCZ A;  2QKI C;  3F2D A;  2KCT A;  2AQ1 B;  1IYV A;  4FDB A;  2I07 B;  2XRQ D;  4H02 A;  2AQ3 B;  2K5V A;  2VQE Q;  3PO2 H;  2K03 A;  1C7Y A;  3C2P A;  3GTG H;  1VQ9 A;  1ENA A;  1BO0 A;  5E4W C;  4MNO A;  2RBM A;  4RKB A;  2LKV A;  3HRZ C;  2L9H A;  3KK7 A;  4JI5 Q;  4OWX B;  3R2T A;  3MFY A;  1SMY C;  3Q22 A;  2Q2T A;  1Q7Y C;  3I72 A;  5I9P A;  4R4O A;  5BR8 Q;  1KAB A;  3A0J A;  4BY7 H;  1CHQ D;  2D0P A;  2EYM A;  1IKM A;  3KOJ A;  4CDC C;  1HUM A;  4Y52 H;  2F3V A;  2F0O A;  3CCJ A;  4RCN A;  4BBS G;  3FP9 A;  3SHL A;  2ZT9 C;  2E8G A;  2VW9 A;  2I5M X;  2PNR C;  1OXS C;  4EQO A;  1CKN B;  1N34 Q;  4JV5 L;  4CBV A;  1W3S A;  4A3B H;  2YTX A;  1U4L A;  2I5H A;  5CGK A;  3NE5 B;  3SXH A;  5K36 G;  2NN6 H;  1PZI D;  4ME5 A;  2LMC B;  2QCP X;  4KHZ A;  5HGT A;  1KAA A;  3E0J A;  1KQS A;  3KJO A;  3FKI H;  3S1R B;  3KF8 B;  2A6H C;  1I4Q A;  3GTG B;  5CBE E;  4L5S A;  4CDE C;  1OXU A;  1CKM A;  1VMC A;  5ELN A;  1F9R A;  5M3M B;  4ZRZ A;  5JVH 3;  4WJW A;  1BR9 A;  2QEX A;  4B08 A;  2PNH A;  2K33 A;  4OL7 A;  5J3B A;  1K8O A;  2IHE A;  3HOV H;  3PUY A;  4DU9 A;  1UEB A;  5EBC A;  1IL8 A;  4EVO A;  1PXU A;  1VS0 A;  4KD4 A;  1IBM L;  2Q2I A;  1CSP A;  2A6E D;  2K5N A;  1LTI D;  3K58 A;  2EXZ A;  4FXK C;  2JA6 G;  4DR4 Q;  5AFW A;  1JJC B;  4JYA Q;  5J39 A;  5JJI A;  3P7J A;  5E7N A;  4JI5 L;  1PTO D;  1ZXT A;  3M4Y A;  2HDM A;  2NTT A;  5IYC G;  1CK1 A;  3CQZ H;  1SMX A;  4RHR A;  4BBS H;  1EEI D;  4Y7N H;  2AUK A;  3CP0 A;  2OQK A;  4CJ0 B;  4GOP B;  1EY6 A;  4JI1 Q;  2R7Z B;  4NXM Q;  1PTO C;  2DY7 A;  1HTP A;  5IP9 H;  4JCV E;  1BCP F;  5M3M H;  4AIM A;  1GOZ A;  4LWC A;  2KCN A;  3SK5 A;  4DV5 L;  1ASZ A;  3S14 H;  1VCI A;  2KJX A;  4C3J G;  3K5N A;  1EFW A;  1Y1V G;  2QIL A;  3D31 A;  5EJW A;  2NBF A;  3OMC A;  3U58 A;  4OWW B;  2UUB L;  3ERS X;  5CMD A;  3J80 L;  1NE3 A;  3NQI A;  1VQP A;  1TS2 A;  4N8X 1;  1CQF A;  4C3J H;  2F0N A;  3WOE A;  2UU9 L;  5DM6 3;  3OIP A;  2IT1 A;  3SE0 A;  1LV9 A;  3ZJY C;  1X3F A;  1Y1V B;  3U9O A;  2AHO B;  3KLS A;  4NPS A;  5FO7 B;  3Q8D A;  5JOB A;  4RG1 A;  2A74 C;  1QVG A;  3KLW A;  3PSI A;  2L55 A;  1D6E C;  3CQZ B;  5AJ3 Q;  1GUG A;  3U9S A;  1U0L A;  4Y7N B;  2PW7 A;  1VQO A;  1JR0 D;  1F2Z A;  4OX9 Q;  4V19 0;  1QB5 D;  3SK6 A;  4RAU C;  3S2H H;  1EQQ A;  4HED A;  4P74 A;  1PH7 A;  2MO0 A;  4HJ8 A;  2R7Z H;  5GQO A;  3I4O A;  4JI0 L;  1G51 A;  5FK9 C;  4HMI A;  2JYO A;  1F9Q A;  1LTB D;  2Y0S E;  2VY3 A;  2QDB A;  1SE4 A;  1II3 A;  5C0X H;  1BF4 A;  5CYU A;  4LFA Q;  2EIF A;  2K4K A;  4RA8 A;  4DUZ L;  2JA8 G;  3M9B A;  4DR2 L;  4X62 Q;  2CH4 A;  2A6E C;  1Q90 A;  5JEA H;  5C3E H;  1K28 A;  3L3O C;  3J7A F;  1F9P A;  5IE8 A;  3OIQ A;  4P72 A;  1J5E L;  3HEJ A;  2PZW A;  2K01 A;  1ET6 A;  4K0K L;  1Y1W H;  2MP1 A;  3AFP A;  5CV6 A;  4A3I B;  3H91 A;  3X3M A;  2Q8R E;  1NY4 A;  5KIX A;  1Y1V H;  3MA2 B;  4U67 3;  2HHH L;  3STB D;  1VQA A;  1H9S B;  5C3W A;  1HZC A;  4IUT A;  1ENC A;  3HOY G;  4DAM A;  2R92 H;  3DM3 A;  1KLU D;  3K8A A;  3K7A B;  5EGT A;  1JOQ A;  3OHX C;  3F2C A;  5T1G A;  3SR1 A;  1SDF A;  1ONL A;  2E2I H;  1IBK L;  1JE5 A;  2UXB Q;  3DEP A;  1G8Z D;  5IT9 E;  3LWE A;  5CBA E;  3J81 c;  1OXX K;  3Q6S A;  3RNU A;  4EQ5 A;  3GTK H;  1WCM H;  2B2U A;  2R92 G;  5M5Y H;  2HIX A;  2F3W A;  1IHZ A;  4K5X A;  4C3H H;  2IX1 A;  5AJ3 L;  2B2Y A;  4A3D B;  2D5D A;  2EXD A;  1I3Q H;  4MIU A;  4DV0 L;  1XMO L;  2NWG A;  4X3U A;  5I2Y A;  4HJA A;  3UDF A;  2F0H A;  2EY5 A;  1AN8 A;  1CUK A;  2B2W C;  4XTC S;  2JA5 B;  2BA0 A;  5I6W A;  1STE A;  1PRT D;  4A3D G;  5FLX c;  4RHS A;  4DNI A;  3E5S A;  4ZK9 B;  2K28 A;  1GUO A;  1RTN A;  4FP5 D;  2VUM B;  4AQY L;  5BN4 A;  1CFM A;  5KEE A;  4OON A;  1N36 Q;  1TY0 A;  4DF7 A;  5JPN C;  4A3E H;  5FKA C;  3MTS A;  3MVV A;  2CVR A;  3HFZ B;  3K7A H;  5M5X H;  3HOX G;  2R93 B;  2QW7 A;  4IPC A;  3T4A C;  3I4N B;  1NAP A;  4C1N K;  4JI8 L;  2BDN A;  4GN3 B;  3EA6 A;  5K36 H;  3STB C;  2KHI A;  3TSS A;  4QUF A;  4G7Z C;  1YVC A;  4RGN A;  2ZJQ A;  3NUC A;  3NEM A;  1DD2 A;  2KED A;  4LF6 L;  2B2T C;  1HNX Q;  3MAQ A;  3DEO A;  1D8L A;  1E1T A;  1X32 A;  1KLG D;  3GTO H;  1JCK B;  4QF4 A;  2F0T A;  4L6T B;  2BE5 D;  1N36 L;  2K52 A;  2CFM A;  3A8I E;  3ITP A;  1IBM Q;  1BVS A;  4DXF A;  4A93 H;  4DUY L;  2Z6B A;  1SYE A;  2Z4H A;  5IOD A;  1WTO A;  3GTL H;  2KA7 A;  4GNX B;  4RGT A;  1K8G A;  1I6H H;  1L0W A;  3M3Y B;  1QOH A;  1DGS A;  1P16 A;  3GV3 A;  3W3A A;  4M1U B;  4CKC A;  4HID A;  3B6Y A;  4CGY B;  3ICE A;  3AFQ A;  2UUB Q;  1L2F A;  3U4V A;  3L7Z C;  5A2Q E;  1K73 C;  1GM5 A;  4JBM A;  3GO5 A;  4GN4 B;  1XNR Q;  4B3R L;  2Y0S G;  3GTM H;  2R93 H;  3K5O A;  1I50 H;  3NBH A;  3HGB A;  3PF4 A;  1VQD A;  5BN5 A;  5C0X I;  1BNZ A;  5EQ0 A;  1SYD A;  5JEA J;  4A3K H;  3I7F A;  5DM7 3;  2A68 D;  4A4I A;  1D1I A;  3BYY B;  2J7Z A;  1KNA A;  2NZO A;  1JMC A;  1Q81 C;  2DNC A;  4R4I A;  1LTT D;  2I0Q A;  4IPG A;  4IUR A;  3MFG A;  4OXP A;  1Z6H A;  1RL2 A;  1YZ6 A;  3LNN A;  1Q46 A;  1VQM A;  3HOX H;  2UUA Q;  4AQY Q;  1A0I A;  3J80 i;  2BE5 C;  3HOU B;  1XNQ Q;  4MHE A;  1PYB A;  2DGY A;  2JE6 I;  3CW2 C;  4BA1 I;  4A93 B;  5TSS A;  1RJT A;  4UAI A;  4LUO A;  3W5O A;  3H09 A;  2WB1 E;  1EY8 A;  4GZY C;  3A7A B;  1ASY A;  5IGD A;  1XXG A;  1PH1 A;  1UE5 A;  2B8F A;  1VQL A;  2B63 G;  2F0L A;  2AUJ D;  2OTJ A;  2NTS A;  1PFB A;  3QOL A;  1U4P A;  1TXY A;  4A3I H;  2BCO A;  3GD7 A;  4XDX A;  1VQF A;  4X3K A;  5LMU Q;  4YHH Q;  2AMC B;  1BBX C;  1HFN A;  3NP8 A;  4GLA C;  1I50 B;  5ELB A;  5LMU L;  1U5K A;  1Q8K A;  2JA5 H;  1EY4 A;  3VYT A;  3S16 H;  1V8Q A;  4NXN L;  4IFD H;  4FF3 A;  1T9H A;  4X6A H;  2JA8 B;  4C3J B;  1YJ9 A;  1SNC A;  1MJE A;  2EYH A;  3QIA A;  4HCS A;  5CC4 A;  3IFD A;  4DA2 A;  4AYB E;  5IYD H;  2B2U C;  3MC0 B;  4K14 A;  3RR5 A;  5BN3 A;  4BXX G;  3K7U C;  4DV7 Q;  2K50 A;  5EKI A;  1GUW A;  5EKK A;  5IP9 G;  2C9O A;  2LSS A;  1J9O A;  2X69 A;  4QY7 A;  5C5M A;  2Z9H A;  4LF8 L;  5GAG C;  2WIN B;  1K8M A;  2D62 A;  1NR4 A;  2F0K A;  3GTK B;  4DAY A;  3EQL C;  1AP0 A;  3V96 A;  1U4M A;  4QQB X;  3S2H B;  4NDX A;  5IWA Q;  2PCF B;  1MJC A;  1XX8 A;  3Q24 A;  3NWS A;  1Y1W G;  3QO2 A;  4TKO B;  3NEN A;  1O78 A;  3FHW A;  1QIL A;  3HOW G;  1M1K C;  4HSP A;  5CV8 A;  5HUR A;  3W1B A;  5LHY 1;  3R2I A;  1VQK A;  3OW7 A;  2UXC Q;  1WTQ A;  1FGU A;  3SEB A;  5C4X G;  2L15 A;  3VA5 A;  4GN5 A;  1I6H B;  2PMZ B;  1H9K A;  3H0G G;  1VQB A;  4GKJ Q;  2VUM H;  4B3T L;  4DR7 L;  1EOT A;  3J80 E;  3HS0 C;  2KEE A;  4K6L A;  1HZB A;  2B2T A;  3I4N H;  3PUV A;  4DV3 L;  4R4T A;  3VDY A;  1GKH A;  3T16 A;  2L1B A;  2CKZ B;  2K04 A;  3JC6 6;  3A54 A;  1IBK Q;  1Q8I A;  1VQG A;  3TZU A;  2IY5 B;  4DUY Q;  4K8J A;  1K0S A;  2XWB B;  4DAY B;  4DKA C;  2NVQ H;  3ERO A;  1E7Z A;  1DXM A;  1I4X A;  1ET9 A;  1T5E A;  3UI2 A;  2F0Q A;  2VNU D;  4A3L G;  1EU3 A;  3L2P A;  2OTL A;  2JXM B;  2KEC A;  4F8M A;  1XMQ L;  3KF8 A;  1HXY D;  1ZYR C;  1Y8O B;  1WD1 A;  2JEA I;  4QCL A;  4O42 A;  3HOU H;  1J8I A;  4CKB A;  1STY A;  3R8B A;  3JAM E;  2RSO A;  4DV7 L;  1B2T A;  3M3Y H;  4ZQ3 A;  1FL0 A;  4HTH A;  3H3V C;  3T53 B;  1SN8 A;  4CDF C;  4PZ8 A;  3G6E A;  2JA6 B;  1JT8 A;  1WTW A;  1A62 A;  4C3H B;  3TQY A;  1S5F D;  3J80 c;  1LLR D;  2ZM6 Q;  4KTA A;  1VQJ A;  3WDN A;  4NXN Q;  2ATW A;  4QUC A;  3OW2 A;  1UEA B;  1TWH B;  3RZD H;  3W1G A;  4K2K A;  4UP7 A;  3DLL A;  1I4R A;  1YBY A;  3KYH C;  3HOW B;  1IYU A;  1KDC A;  2E2J B;  2E2H B;  1L1O B;  3I56 A;  2A73 B;  4ZCK A;  1AFP A;  5IYB G;  1K0R A;  2XRS D;  2EY1 A;  4DV0 Q;  4FYD A;  3PUW A;  1UUP A;  3RLO A;  4DV6 Q;  5LMN L;  1SYG A;  4G4K A;  1Q82 C;  1EIY B;  1EY9 A;  2TSS A;  3E9H A;  2AWO A;  1ILP A;  4KHV A;  3BZD B;  3UDG A;  4J1M A;  1OXT A;  4R1J A;  3I55 A;  2EYJ A;  1YHB A;  3K5M A;  1DM0 B;  2TMP A;  4IN3 A;  3JAM c;  1JE4 A;  1L1O A;  4JI2 Q;  1KD1 C;  2UXB L;  1KHI A;  1HR0 L;  2L4N A;  3AU7 A;  4LFC Q;  4IPD A;  4C1N I;  1M8A A;  1VDZ A;  3DWP A;  3ND9 A;  4KHP Q;  5E3F A;  2SNS A;  4LK1 C;  1PRT C;  3ULP A;  2WAQ G;  1EIF A;  1FNW A;  4B3S L;  3C46 A;  2I5L X;  4KHP L;  1BKB A;  3CMA A;  1LTG D;  4BA2 I;  1AZQ A;  2LFN A;  3KUP A;  3CHB D;  1WYD A;  5COY A;  3MXN B;  3D0F A;  3Q23 A;  4DV5 Q;  1W6K A;  4GS3 A;  3GTQ H;  4OO1 I;  2K32 A;  1EWI A;  1PH8 A;  3KDF A;  3PO3 B;  1L0Y B;  3ND8 A;  3S16 B;  2VQE L;  1FD7 D;  2JA8 H;  1J5E Q;  4C2M B;  4YWK A;  2Z1C A;  1EWC A;  2KQ3 A;  1N33 Q;  3CCM A;  4LF5 Q;  4NXM L;  1LUZ A;  2F0D A;  4RGM A;  4DPG A;  3Q0A A;  1B50 A;  1TWA B;  2EJF C;  1EEF D;  1QZG A;  3HKS A;  5IWA L;  3I4M B;  1MHW C;  4Q5V A;  5ELF A;  4C56 C;  4A3K B;  4A3F H;  1NNX A;  1QNU A;  1SBB B;  2F0U A;  2O5I C;  2OCE A;  2ZXR A;  5KGU A;  1SR3 A;  3A5Z B;  1A15 A;  1LTA D;  1X65 A;  2HCI A;  5D3D A;  3NSW A;  2YYZ A;  1M90 C;  3SK8 A;  3F2B A;  2RDG A;  3HOX B;  5EBD A;  1QE6 A;  2LXJ A;  4YIJ A;  2E74 C;  1SE8 A;  3AB9 A;  3DM1 A;  3K0X A;  2H5X A;  2EOT A;  1XPU A;  4WFN 3;  1HUN A;  1K3R A;  3M4Q A;  4H0L C;  1PDQ A;  2N49 A;  2F03 A;  2QEJ C;  1YEZ A;  2ENB A;  4LF6 Q;  1VQ8 A;  4BY1 G;  3F8T A;  4JI2 L;  3S15 H;  1GD7 A;  4MZ9 A;  3MEH A;  1J6Q A;  2CHB D;  3GTQ B;  3KF6 B;  1FJG L;  1C9O A;  2KCC A;  3PO3 H;  1XTC D;  1SFO H;  4QL5 A;  2UU9 Q;  1I4H A;  4N8F A;  4C3H G;  3T1Y Q;  1IKL A;  1ZYR D;  2MGS A; 
#chains in the Genus database with same CATH homology
 1AE2 A;  1UE7 A;  2RHQ B;  2OQ0 A;  3G48 A;  3J81 c;  1OXX K;  2PQA B;  3RNU A;  4EQ5 A;  1TWA H;  3OTO Q;  3GTK H;  3HOZ H;  4DV1 L;  4A3C H;  1WCM H;  2R92 G;  2WFW A;  5M5Y H;  1IBL Q;  2E2J H;  1CKO A;  3HOV G;  4GKK Q;  4DV4 L;  2HIX A;  4IJH A;  1NBW A;  1EUJ A;  4C3H H;  2IX1 A;  4UP8 A;  5AJ3 L;  1IZ6 A;  2EXD A;  4PMW A;  3PF5 A;  1I3Q H;  4KLK A;  1EOV A;  4YY3 Q;  3PUZ A;  4DV0 L;  2PI2 A;  1XMO L;  5GAD C;  2NZH A;  4DR1 L;  1TWH H;  4HJA A;  3CF5 A;  4LF9 Q;  4LFB Q;  3J7A 5;  3RN5 A;  2GVA A;  3M4P A;  3UDF A;  4EX5 A;  2A19 A;  1KXL A;  3S24 A;  1N32 L;  5HGQ A;  4QIW E;  2E2H H;  5M3M G;  1CUK A;  4HJ7 A;  4DV6 L;  4XTC S;  5C4J H;  4DR6 Q;  2YV5 A;  2BA0 A;  4HIM A;  1MIU A;  4LFC L;  3UE0 A;  2B63 H;  4A3D G;  2R7F A;  2Z0S A;  2E5L L;  5FLX c;  1X9N A;  4DNI A;  4O0A A;  3NEL A;  1YI2 A;  3I2Z A;  1JJG A;  4BXX H;  2LXK A;  4GKK L;  4GNX A;  3HKZ G;  4AQY L;  3T1H L;  4OON A;  1N36 Q;  2F4V L;  2VUM G;  2ZM6 L;  4A3E H;  3BU2 A;  4JI4 Q;  1IL2 A;  3CCS A;  1A8V A;  3HFZ B;  3K7A H;  2ZTE A;  5M5X H;  3HOX G;  4DK6 C;  4DV3 Q;  3G4S A;  4JYA L;  4IPC A;  3S1R H;  4R4Q A;  4O2D A;  4JI8 L;  2MQH A;  4DR4 L;  4GN3 B;  3STB C;  2KHI A;  2ZJR A;  1YVC A;  3K81 C;  4L5R C;  2ZJQ A;  1JJ2 A;  3NEM A;  3RLN A;  1E24 A;  2IX0 A;  5GRO A;  3J81 i;  2ZTD A;  1KC8 C;  4LF6 L;  3M7N A;  4OO1 G;  1HNX Q;  1UE6 A;  2JA7 H;  3AEV A;  1D8L A;  1E1T A;  3NBH B;  1V43 A;  4X64 Q;  4A76 A;  4JI6 L;  5JJK A;  3GTO H;  1R9T H;  3J7Z C;  4IO9 A;  4DR5 Q;  2UXD L;  1N36 L;  2QGQ A;  2F4V Q;  2N3S A;  2K52 A;  2CFM A;  2KCM A;  4X66 Q;  5C44 G;  1BVS A;  3CCR A;  2KHJ A;  1IBM Q;  1BBU A;  1VQ7 A;  5GAH C;  1X6O A;  3CC7 A;  1LM0 A;  1XPO A;  4A93 H;  4DUY L;  3AQQ A;  1PHJ A;  1E3P A;  1BBW A;  4LUV A;  4JI7 L;  3GTL H;  3H15 A;  4GNX B;  1E1O A;  3BZK A;  3CC2 A;  1K8G A;  1I6H H;  4JI4 L;  4DR7 Q;  1L0W A;  5IP7 H;  4WJ3 M;  1TWC H;  2JA9 A;  1YHQ A;  1DGS A;  2FXQ A;  4TVA B;  5DLQ E;  1PH5 A;  1P16 A;  2PMZ E;  1N33 L;  1FVI A;  3CXC A;  3GDE A;  4HID A;  3B6Y A;  4GOP A;  3ICE A;  3AFQ A;  2F52 A;  2UUB Q;  5IYB H;  4P73 A;  3I4M G;  1L2F A;  2WAQ E;  1V1Q A;  2F3I A;  4ALP A;  1HR0 W;  3U4V A;  3L7Z C;  2YU9 H;  1K73 C;  4DR6 L;  3S1Q H;  1GM5 A;  2CWA A;  5IY0 A;  3GO5 A;  4GN4 B;  1CSQ A;  1HNZ L;  2UUC Q;  4JBM A;  1XNR Q;  4B3R L;  4GKJ L;  1MKH A;  3OYY A;  1PH3 A;  2Y0S G;  3CD6 A;  2CWP A;  1PV4 A;  3AYH B;  2KEN A;  1SLJ A;  3GTM H;  2R93 H;  1I50 H;  4DR1 Q;  3I4M H;  4IOC A;  5FLM G;  1VQD A;  4DR5 L;  3PF4 A;  3TRE A;  5C0X I;  5JEA J;  2Q2H A;  3PGZ A;  4A3K H;  3I7F A;  5C44 H;  3CAM A;  2MNA A;  1XNQ L;  2K14 A;  2NVY H;  4NB3 A;  4HJ5 A;  4A4I A;  3E9I A;  3IRB A;  3GTP H;  3CPF A;  1YJW A;  4WJ4 A;  4A3G G;  2NZO A;  1JMC A;  1Q81 C;  1HNZ Q;  1X3E A;  3RLF A;  4JBK A;  2JA7 G;  1Q1B A;  2E5L Q;  4R4I A;  1AE3 A;  2I0Q A;  2BH2 A;  4IPG A;  2YTV A;  2JJQ A;  3PO2 G;  1PH6 A;  4OXP A;  3CC4 A;  1RL2 A;  1YZ6 A;  1VQM A;  1Q46 A;  1L1O C;  3HOX H;  2UUA Q;  4AQY Q;  1A0I A;  3J80 i;  4IFD J;  5JJL A;  1WFQ A;  1YNX A;  1X54 A;  1XNQ Q;  1VQC A;  2VL6 A;  4JG2 A;  1PYB A;  2DGY A;  2JE6 I;  3CW2 C;  5HY6 A;  4HIK A;  4BA1 I;  5IP7 G;  5C0X G;  4IFD I;  4LUO A;  3W5O A;  1XMQ Q;  1I94 Q;  2PQA A;  2WB1 E;  2CQO A;  3PUX A;  1QVC A;  5ELO A;  1ASY A;  3KJP A;  4A3B G;  2YTY A;  3H3V I;  1A63 A;  2PI2 E;  4LFB L;  2XGT A;  2XTI A;  1PH1 A;  1UE5 A;  3GTJ H;  3CCE A;  1VQL A;  4BY7 G;  3HOU G;  3PIP A;  4POG A;  2A8V A;  1IXR A;  1SRU A;  2BH8 A;  4QJF A;  4YY3 L;  3CCQ A;  2B63 G;  4A3D H;  1PYS B;  1PFS A;  1OXV A;  2GN5 A;  2OTJ A;  1QVF A;  3HOW H;  4J15 A;  2UUA L;  1TXY A;  4A93 G;  3EBE A;  4A3I H;  3GD7 A;  1VQF A;  5LMU Q;  4YHH Q;  2C35 B;  1WJJ A;  1UWV A;  4PG3 A;  2RCN A;  4DK3 C;  2AMC B;  1G6P A;  1EQR A;  4BBR H;  4JI7 Q;  4HJ9 A;  4GLA C;  1NJI C;  3RN2 A;  5IYD G;  5JEA G;  2A1A A;  3JAM i;  1U5K A;  4JBJ A;  5C3E G;  1Q8K A;  5LMU L;  2JA5 H;  4A3F G;  4LNQ A;  3S16 H;  4NXN L;  2Z6K A;  4LF8 Q;  4IPH A;  4LF4 L;  2K75 A;  3F2D A;  1T9H A;  5LMN Q;  2KCT A;  1EYG A;  3CCL A;  1PVO A;  1YJ9 A;  4X6A H;  4FDB A;  1MJE A;  1S40 A;  2BA1 A;  2VZA A;  4H02 A;  4C2M H;  2K5V A;  2VQE Q;  3PO2 H;  1C7Y A;  1HZA A;  4YCW A;  4AYB E;  3GTG H;  1VQ9 A;  2B3G A;  3T1Y L;  3TRZ A;  4QGU A;  5IYD H;  3KF6 A;  5FJ8 H;  1IBL L;  3RR5 A;  4MNO A;  1N9W A;  1S72 A;  3K7U C;  4BXX G;  4DV7 Q;  2K50 A;  4DV2 L;  5IP9 G;  3SGI A;  2LSS A;  1PH9 A;  2MO1 A;  4QY7 A;  4LF8 L;  1KRS A;  5GAG C;  3HOY H;  1KL9 A;  2ZJP A;  4OWX B;  2ID0 A;  3K80 C;  4A3M G;  5C4X H;  3MEF A;  4JI5 Q;  1LYL A;  2D62 A;  2Q2T A;  1Q7Y C;  3FKI G;  4ME3 A;  1XNR L;  1V9P A;  4R4O A;  1HZ9 A;  4YWL A;  5BR8 Q;  5M3F H;  4QQB X;  3A0J A;  4P75 A;  2RF4 A;  5IWA Q;  1Z47 A;  2N78 A;  4BY7 H;  1MJC A;  4UP9 A;  4BBR G;  2D0P A;  3J81 j;  4B3M L;  4PZ6 A;  2N8N A;  3KOJ A;  1Y1W G;  1AH9 A;  3NEN A;  3BZC A;  3FHW A;  4PZ7 A;  4Y52 H;  1GO3 E;  3HOW G;  1M1K C;  3CCJ A;  2R93 G;  4BBS G;  2AWN A;  5M5W H;  3FP9 A;  4JI1 L;  4GNX C;  2E8G A;  2VW9 A;  5M3F G;  3W1B A;  2HQL A;  2I5M X;  2UXD Q;  3CCV A;  1OXS C;  4HIO A;  1VQK A;  2UXC Q;  3ULJ A;  1FGU A;  2JA6 H;  1CKN B;  2EQS A;  2GVB A;  2L15 A;  3G71 A;  1N34 Q;  1XPR A;  1VQ5 A;  4GN5 A;  4GLV B;  4L5Q A;  1W3S A;  3PIO A;  2YTX A;  3CPW A;  4A3B H;  4JV5 L;  2I5H A;  3H0G G;  1VQB A;  4IFD G;  4B3R Q;  4GKJ Q;  2VUM H;  4B3T L;  5K36 G;  1GVP A;  5FLM H;  4DR7 L;  5IYC H;  1TWF H;  4IJL A;  1CKN A;  4LF7 L;  3EIV A;  2WP8 J;  4KHZ A;  2ES2 A;  3ER0 A;  1WOC A;  1KQS A;  4X65 Q;  1NTG A;  1HZB A;  1Y14 B;  3KJO A;  3FKI H;  3ULL A;  3I4N H;  3KF8 B;  2UXC L;  3PUV A;  4DV1 Q;  3H0G H;  3UDI A;  4R4T A;  4DV3 L;  3VDY A;  1GKH A;  5C4X G;  4L5S A;  2CKZ B;  2HIV A;  3JC6 6;  4DR3 Q;  1OXU A;  1CKM A;  5ELN A;  1YIJ A;  1IBK Q;  1HNX L;  1VQG A;  2JA5 G;  2IY5 B;  1PH4 A;  4DUY Q;  1HR0 Q;  3KDF B;  4LF9 L;  5C0X J;  4DAY B;  2QEX A;  1Z9F A;  1Q86 C;  2PNH A;  5J3B A;  4A3K G;  1W2B A;  4DKA C;  1WI5 A;  2B29 A;  2WB1 G;  4JI3 Q;  2NVQ H;  1E7Z A;  1X55 A;  2IHE A;  3HOV H;  1KAW A;  3PUY A;  2VNU D;  1UEB A;  4A3L G;  3L2P A;  2OTL A;  5LMN W;  1HH2 P;  1XMQ L;  1I94 L;  1VS0 A;  4APV A;  4X66 L;  4JI3 L;  2Q2I A;  1CSP A;  2IHF A;  3TS0 A;  1IBM L;  4K0K Q;  2JEA I;  2R6G A;  2K5N A;  3HOU H;  2VQF L;  2JQO A;  4R4C A;  3M4O H;  3TS2 A;  4UPA A;  1B8A A;  1QVG A;  4DV7 L;  4A3M H;  2HHH Q;  3M3Y H;  2JA6 G;  4DR4 Q;  1FL0 A;  1SRO A;  1JJC B;  4DR3 L;  1SN8 A;  4JYA Q;  4PZ8 A;  3G6E A;  5JJI A;  1JT8 A;  5E7N A;  1A62 A;  4JI5 L;  1JB7 A;  3TQY A;  3J80 c;  3F1Z A;  5IYC G;  4OWT B;  2ZM6 Q;  1C0A A;  3E0E A;  1VQJ A;  4P71 A;  4NXN Q;  4JOI A;  2ATW A;  3OW2 A;  3CQZ H;  1SMX A;  4UY8 C;  2AKW B;  3RZD H;  3W1G A;  4LFA L;  4BBS H;  1FJG Q;  4UP7 A;  3DLL A;  1YBY A;  3KYH C;  4Y7N H;  2QA4 A;  4DR2 Q;  2UUC L;  3I4N G;  3CP0 A;  3S2D H;  4POF A;  2OQK A;  4AYB G;  4GOP B;  3PO3 G;  1L1O B;  3I56 A;  4JI1 Q;  1TWG H;  1D7Q A;  4NXM Q;  3U4Z A;  5IYB G;  1S3O A;  1K0R A;  1VQH A;  4DV0 Q;  5IP9 H;  3PUW A;  4JCV E;  1QZH A;  1XTD A;  3RLO A;  4DV6 Q;  4YWM A;  5M3M H;  4AIM A;  5LMN L;  1Q82 C;  1EIY B;  3E9H A;  2AWO A;  3UE1 A;  4LWC A;  1LTL A;  4L5T A;  4DV5 L;  3UDX A;  3HKZ E;  1VCI A;  3UDG A;  1ASZ A;  4OX9 L;  1EFW A;  2ZTC A;  3KFU A;  3S14 H;  1Y1V G;  3D31 A;  1OXT A;  2KBN A;  4R1J A;  3I55 A;  1N34 L;  4A3L H;  3U58 A;  3CME A;  1YHB A;  3L0O A;  4YCV A;  3T1H Q;  3JAM c;  1KIX A;  4OWW B;  4A3E G;  1XJV A;  2UUB L;  1L1O A;  3CCU A;  4JI2 Q;  1KD1 C;  4B3S Q;  1KHI A;  3ERS X;  4B3T Q;  1NE3 A;  4GLX A;  1N32 Q;  2UXB L;  1VQP A;  1HR0 L;  1WCM G;  4LW1 A;  4C3J H;  4A3C G;  4BY1 H;  2DUD A;  4LFC Q;  1HNW Q;  1K9M C;  2R7D A;  4IPD A;  1X56 A;  2UU9 L;  2NN6 G;  4A75 A;  1B70 B;  2IT1 A;  3A74 A;  3ZJY C;  1H95 A;  1X3F A;  4KHP Q;  5GAE C;  1NMG A;  2ASB A;  2AHO B;  3ULP A;  2WAQ G;  1HNW L;  4JI8 Q;  4NPS A;  1EIF A;  3S1M H;  4B3S L;  3Q8D A;  2Z6K C;  4RG1 A;  3OTO L;  1XMO Q;  2I5L X;  3KLW A;  3PSI A;  1BKB A;  3CMA A;  1Q1E A;  4JBW A;  4LF7 Q;  3RZO H;  4KHP L;  4BA2 I;  5EAY A;  1VQN A;  2K5H A;  1VQ6 A;  5AJ3 Q;  1VQ4 A;  1U0L A;  1VQO A;  1PH2 A;  4DV5 Q;  1Q12 A;  1WYD A;  2V1C C;  3D0F A;  3MXN B;  3PV0 A;  4JOI C;  4OX9 Q;  4GS3 A;  3GTQ H;  1X3G A;  4OO1 I;  3S2H H;  1EWI A;  4JV5 Q;  1EQQ A;  3S17 H;  1PH8 A;  3KDF A;  4P74 A;  2JEB I;  1N8R C;  1PH7 A;  2CCZ A;  2MO0 A;  2VQE L;  4HJ8 A;  2R7Z H;  5GQO A;  3I4O A;  4YHH L;  2JA8 H;  1IYJ B;  4JI0 L;  1G51 A;  4LF4 Q;  2MFI A;  1J5E Q;  4MTN A;  4YWK A;  4TQU S;  5FJ8 G;  3M85 A;  1N33 Q;  3CCM A;  3WWV A;  4LF5 Q;  4NXM L;  1LUZ A;  4DPG A;  4X62 L;  5H1S E;  1QUQ A;  4A3I G;  2Y0S E;  2VY3 A;  1G29 1;  4AH6 A;  1QZG A;  3HKS A;  5IWA L;  4X64 L;  4JI6 Q;  4LFA Q;  2EIF A;  2K4K A;  2JA8 G;  4DUZ L;  3M9B A;  4DR2 L;  5IT9 c;  4A3F H;  4X62 Q;  5C3E H;  2OWO A;  1RIP A;  2OCE A;  3H3V H;  4JI0 Q;  5IE8 A;  1SR3 A;  3A5Z B;  4P72 A;  1J5E L;  1X65 A;  4LUZ A;  4B3M Q;  1B7Y B;  4A3J H;  2YYZ A;  1M90 C;  4YCU A;  3S1N H;  1OTC A;  1Y1W H;  4K0K L;  1VQI A;  4IOA A;  3AFP A;  5BR8 L;  3F2B A;  4XIG S;  3TEH B;  1YHA A;  1NY4 A;  2LXJ A;  1Y1V H;  4A3G H;  4DUZ Q;  2JK8 A;  2HHH L;  1SE8 A;  3BJU A;  3K0X A;  3PCO B;  3STB D;  2H5X A;  4RMF A;  2HT1 A;  1XPU A;  2R7Z G;  1K3R A;  1VQA A;  3M4Q A;  1VQE A;  1P8L A;  1YJN A;  4A3J G;  1PA6 A;  2D0O A;  2N49 A;  1HZC A;  3HOY G;  1O7I A;  1YEZ A;  3A5U A;  4DV4 Q;  1K8A C;  3U50 C;  4DAM A;  3HOZ G;  4LF5 L;  4C3I H;  4X65 L;  2R92 H;  3DM3 A;  3LGJ A;  1QUQ B;  2Q2U A;  4LF6 Q;  1VQ8 A;  4BY1 G;  3K8A A;  1I5F A;  2VS1 A;  3F8T A;  4JI2 L;  1E22 A;  1GD7 A;  2RHS B;  1UE1 A;  4MZ9 A;  3S15 H;  2VQF Q;  1J6Q A;  3F2C A;  2NN6 I;  2ALY B;  3KF6 B;  1FJG L;  1C9O A;  3PO3 H;  4DV2 Q;  1SFO H;  3EN2 A;  4JC0 A;  4QL5 A;  2NVX H;  2UU9 Q;  1KRT A;  2E2I H;  4KI0 A;  1IBK L;  1JE5 A;  1HJP A;  1YIT A;  3T1Y Q;  2UXB Q;  1K83 H;  1NMF A;  4GOP C;  2NVT H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...