1YNXA

Solution structure of dna binding domain a (dbd-a) of s.cerevisiae replication protein a (rpa)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
TRPIFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRGDGKLFNVNFLDTSGEIRATAFNDFATKFNEILQEGKVYYVSKAKLQPAKPQFTNLTHPYELNLDRDTVIEECFDESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Replication factor-A protein 1
publication title Solution structure of the DNA-binding domain of RPA from Saccharomyces cerevisiae and its interaction with single-stranded DNA and SV40 T antigen
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ynxA01
4C3IH 5LMNL 4QIWE 3KDFA 3S1RH 1PV4A 4R4CA 1VQKA 3S1QH 3TEHB 4UP7A 1E3PA 1PYSB 2ZM6Q 4JI7L 1H95A 1Y1VG 4JI6Q 1IXRA 1XNRL 1EWIA 1PH5A 1CSPA 2QGQA 4QL5A 1E7ZA 5E7NA 3ULJA 3HOXH 4B3SL 4A3LG 3PUWA 1CKMA 4QGUA 2Q2HA 3AQQA 4OX9Q 5IP9G 3HOVH 1OXUA 1WI5A 2NZOA 1EUJA 4H02A 3G4SA 2OTJA 1G6PA 3J81i 1OTCA 4DR4Q 4P72A 3M7NA 4GLXA 2V1CC 5IWAL 4JG2A 3S16H 1VQHA 2E5LL 3TS2A 1DGSA 4GKKQ 5H1SE 1XMQQ 4HIMA 1KXLA 2JJQA 1J5EQ 1IBLQ 4NB3A 2D62A 3HOXG 1QUQA 4MTNA 2UUBQ 1WFQA 1E1OA 2WAQE 5BR8L 3HOVG 1A63A 1XPOA 2CWPA 1N9WA 2OQ0A 1B70B 2NVTH 3DM3A 4QJFA 2MO1A 1YI2A 1FL0A 3JAMc 4GLVB 3HOZG 4HJAA 4A3EH 3I4MG 3CF5A 4UPAA 1G291 1LTLA 4LF9Q 1XNQQ 1GO3E 3FHWA 4OONA 1PA6A 1RIPA 2F52A 2K50A 1FJGL 2BA0A 4Y7NH 3S14H 5IYDH 1GVPA 4A3JG 4LW1A 3AFPA 3TRZA 3I56A 3H0GH 1S40A 2ZTCA 3UDFA 1C9OA 1VQIA 5JEAJ 2DUDA 3HOYH 4JI5L 5LMNQ 4DR5L 1V1QA 4C2MH 1PH3A 1EFWA 4B3TQ 4YY3Q 4DV1L 2UXDL 3M4OH 4LF6L 3ERSX 2YYZA 4GNXB 2OTLA 4OO1I 4WJ4A 3T1HL 3M3YH 3CCRA 3A0JA 1SLJA 2VUMH 1MJEA 4LNQA 1N34L 3RLNA 3UE0A 2GVAA 1VS0A 3S15H 1CKNA 4XIGS 2ZJQA 3FKIG 5IP7H 3KF6B 1XTDA 4HIOA 2HHHQ 3HOYG 3LGJA 4LFCL 4JBKA 1L1OA 2ID0A 4A4IA 2I5LX 1PYBA 4JCVE 4LF8Q 5IYBG 3S1MH 4DV7Q 4BXXH 4KHZA 4EX5A 4GNXA 4PZ8A 1VQDA 2UUCQ 4DNIA 2MQHA 5BR8Q 5M3FH 3PUYA 4DR1L 1PHJA 3GDEA 3BZKA 4X62L 1QVGA 2E2HH 2VNUD 1TWGH 3JC66 1VQCA 1QZHA 2ZTEA 1VQLA 1NE3A 2EIFA 1A8VA 4K0KL 3CCSA 2KHIA 3SGIA 4BXXG 1Z47A 3S2HH 1NBWA 2CFMA 4OWXB 2JEBI 2WAQG 3K7AH 1P16A 1QVFA 1QZGA 3UE1A 1Y1WG 2R92H 3F8TA 4LFBL 2CWAA 4DV4Q 1PH2A 4POFA 4JOIA 5M3FG 1N32Q 3CAMA 2CCZA 4LF5L 3GD7A 1VQGA 3OTOQ 2UXCQ 2JK8A 4DV1Q 2VQEQ 1NY4A 4AYBG 4PG3A 4LF6Q 2IY5B 2H5XA 2HIVA 2RCNA 2N78A 4AIMA 3KJPA 4A3MH 1HNZL 1Q1EA 4A93H 4B3RL 4DR2L 4P71A 1Q82C 1YIJA 3H15A 4IPDA 3OYYA 3PIOA 1N34Q 3J80c 2R92G 2LXKA 2I0QA 4BY1H 4JI3Q 2K4KA 1HR0L 1I6HH 4DKAC 2BA1A 5HGQA 2JQOA 4YCVA 4LFCQ 3GTKH 3KF8B 1JE5A 1YJ9A 3U4ZA 4JI8L 3S17H 3F2DA 4O2DA 4R4IA 4NXNQ 4JI1Q 1Y14B 5C4XH 4YHHQ 4JBWA 2JA6G 3KDFB 1A0IA 1L1OC 1N33L 2Z6KA 1I5FA 4IFDJ 2RHQB 2JA5H 1VQAA 1YEZA 4DV0L 4X6AH 1Y1VH 1E24A 4BY1G 4ME3A 4C3JH 4DAYB 1VQNA 2RHSB 1U5KA 4X62Q 2JE6I 2A19A 5GROA 3J81c 3CC7A 1IBMQ 4GOPA 2IT1A 3PO3H 4BBRH 1HH2P 1B8AA 1SE8A 1X3FA 1TWFH 1YHBA 4L5SA 2UU9Q 2YU9H 2Y0SG 1C0AA 5C4XG 1J6QA 3PIPA 4QY7A 2L15A 3NBHB 3NELA 3D0FA 5GQOA 1EYGA 2JA5G 1PH8A 3T1YL 1MJCA 1SR3A 1TWCH 2Q2IA 3FP9A 2UUAL 4LF7L 1QUQB 4IJLA 4AQYL 2GVBA 4OO1G 4WJ3M 4JBMA 2B3GA 3PO3G 4BBRG 1X56A 4L5QA 4OXPA 4JOIC 3W1GA 3W5OA 1S72A 1N8RC 1IBKQ 2WP8J 1X65A 2ZTDA 4X64L 5GAEC 4QQBX 4KHPL 1D7QA 4LFAQ 5GADC 1I3QH 4LUZA 2HQLA 4YCWA 5M3MH 1PH6A 3HOZH 2ALYB 3L0OA 1CKOA 3I4MH 3I7FA 5IY0A 2IX0A 3EBEA 4DUZQ 1VQ9A 2AWNA 3K80C 2E8GA 3F2CA 2F3IA 1Q86C 4A3JH 4DV3Q 2XTIA 3ULPA 1WYDA 1KRSA 4DR6Q 2IHEA 4A75A 4IPCA 4DV6Q 4JV5Q 4UP9A 5AJ3L 3CPWA 1SMXA 3KYHC 4JI4Q 4JI0Q 1BBWA 4L5RC 1N33Q 1LYLA 4DV2L 3PF5A 2K75A 5M3MG 3CCMA 3CD6A 1G51A 1KAWA 3E9IA 1AH9A 3U50C 5LMUQ 2E2JH 4AYBE 3OW2A 2AWOA 1K3RA 2Z6KC 1YHQA 1K8GA 1KD1C 5GAHC 1CKNB 1HNXQ 4IPHA 1XPUA 3RN5A 3FKIH 2LSSA 1XMOL 4LWCA 4JYAQ 5EAYA 3GTOH 4GOPC 1N36Q 1L1OB 4JI2L 4A3FH 1MIUA 5IT9c 1VQEA 5IYBH 4JC0A 3CCQA 4JI7Q 1XNRQ 3KOJA 4GKJL 3CCVA 1B7YB 2C35B 4KLKA 1VQ7A 4B3SQ 4OWWB 2ZJRA 5JJLA 3ULLA 4KI0A 4B3ML 2PMZE 4HIKA 1OXXK 3A5ZB 1VCIA 3KLWA 3J81j 1YZ6A 3S24A 1V43A 4X64Q 4DUYL 4P74A 5FLXc 5IWAQ 4A3FG 2E5LQ 1JJGA 2NZHA 1OXTA 4BA2I 2HIXA 2R7FA 4YWLA 1IYJB 1XJVA 1PVOA 2VS1A 2Y0SE 4HIDA 1Y1WH 3BJUA 4EQ5A 1EIFA 1X6OA 1V9PA 1VQMA 3RNUA 2KCMA 2CKZB 3JAMi 3GTQH 1YVCA 4PZ7A 3G71A 2K14A 3K81C 1E1TA 4DV2Q 1PH7A 1WJJA 4R4OA 2OCEA 2Z0SA 3PSIA 5C3EG 4X66L 1D8LA 2MNAA 2YV5A 1PFSA 4R4QA 3U4VA 5C0XI 1JMCA 1FJGQ 2F4VQ 2JA8G 4DR3L 2Q2UA 4LF4L 1Q8KA 4HJ5A 2DGYA 1VQPA 1R9TH 2E2IH 2GN5A 1GD7A 3CCUA 1Q81C 2UXBL 4JI5Q 1IL2A 4A3BG 4DR5Q 2UXDQ 2I5HA 2AKWB 3S1NH 4AH6A 1OXSC 4O0AA 2JA6H 4A76A 1SFOH 3T1HQ 1X3EA 3D31A 3I4OA 5LMNW 4FDBA 1M90C 4RMFA 4X65L 1I94L 4B3MQ 1X3GA 3HFZB 1WOCA 5DLQE 1NTGA 5M5WH 2OQKA 2R93H 3AYHB 4GLAC 1RL2A 3DLLA 3K7UC 4GOPB 1GKHA 2ZM6L 2ZJPA 4JI6L 4RG1A 4P75A 1SROA 3CXCA 3G6EA 1YNXA 3GTMH 2N8NA 3RZOH 1UWVA 1HZCA 1X54A 4UY8C 4OX9L 3M4QA 1M1KC 1L0WA 1BBUA 4DR4L 3ICEA 1MKHA 1KQSA 3HOWG 4DR1Q 1VQ6A 2R93G 5GAGC 4IO9A 3F2BA 2NN6G 3KJOA 4A3IH 4GKKL 3PF4A 1XMQL 3VDYA 4DK3C 4K0KQ 1J5EL 1I50H 1IBLL 2N49A 3MEFA 1U0LA 1TXYA 3M4PA 4DK6C 3ZJYC 2RF4A 4A3DH 1HJPA 1VQBA 2ATWA 4MZ9A 2EXDA 4LFBQ 2ASBA 3HKSA 3CPFA 1PH1A 3A5UA 4UP8A 2KHJA 4DV5L 4OWTB 1WCMG 1Z9FA 4POGA 4BBSH 5JJKA 4DAMA 4LF5Q 4A3IG 2BH8A 1YHAA 3WWVA 3MXNB 1XNQL 3TS0A 3STBD 1FVIA 5IYCH 1Q7YC 1HNZQ 4B3RQ 4DR2Q 4A3DG 5HY6A 1I94Q 2Q2TA 1BKBA 5JJIA 1VQJA 1YJWA 4B3TL 1HR0Q 2K5NA 1UE7A 1NMGA 4YCUA 4YY3L 1K0RA 3K0XA 4L5TA 1PH4A 4BBSG 1K83H 1VQ4A 4ALPA 1EQQA 1KC8C 1HZBA 4JI8Q 1GM5A 1Q12A 5IYCG 2VY3A 1K8AC 2R7ZH 1JB7A 3HKZG 4DV0Q 2CQOA 2K52A 1AE3A 1SN8A 2NN6I 3AEVA 2D0PA 4HJ7A 2HHHL 3S2DH 3CC4A 1ASZA 1SRUA 2IHFA 1EQRA 2K5HA 4LF8L 1W2BA 5ELNA 3PGZA 3PUXA 4PZ6A 3CMAA 4DV7L 1KIXA 1BVSA 1W3SA 5C0XG 1EOVA 1S3OA 2YTXA 3RN2A 2UUCL 3B6YA 2PQAB 4GN4B 3TREA 3UDIA 4BA1I 1EIYB 3E9HA 2VQFL 2PI2E 2R7ZG 4IFDG 3T1YQ 4J15A 2A1AA 2KCTA 4DV5Q 4YWMA 2UUAQ 4LF7Q 1UE5A 3W1BA 1LM0A 4XTCS 3H3VI 4AQYQ 1K9MC 1VQ5A 3PO2H 1HZ9A 3GTJH 2WB1G 2QA4A 3RR5A 4Y52H 2K5VA 5C44H 3GTLH 1JT8A 1UEBA 2PQAA 3I2ZA 4R1JA 4DV4L 4KHPQ 2PNHA 1TWHH 1KHIA 1JJCB 2FXQA 4GN5A 4IPGA 3I4NH 4A3GH 5FJ8H 2NVYH 5C3EH 1N32L 1NMFA 3PUZA 3CCJA 1CSQA 3UDXA 3OTOL 3UDGA 2UXCL 1YBYA 2JA8H 3PO2G 2VQEL 2MO0A 3E0EA 1AE2A 3KFUA 4A3EG 2MFIA 2JA7H 2F4VL 3GO5A 3L7ZC 2YTVA 1UE1A 5FLMH 5C44G 1QVCA 5AJ3Q 5IYDG 3CMEA 1YJNA 4HJ9A 4IOCA 1HR0W 2B63H 4A3BH 4IOAA 1HNWL 1VQFA 1ASYA 4A3GG 3H0GG 1UE6A 4JI3L 3I4NG 1NJIC 5FJ8G 1XPRA 1TWAH 5M5YH 1A62A 1Q46A 2JEAI 4YWKA 3PCOB 2A8VA 4NXNL 4JI1L 4YHHL 2JA7G 3IRBA 1XMOQ 3CCLA 3G48A 5FLMG 3HOUH 4IFDI 2VUMG 2B63G 4JI2Q 4A3KH 1LUZA 2N3SA 2WFWA 3K8AA 4PMWA 1X9NA 3M85A 2VQFQ 3CW2C 4LUOA 4HJ8A 2OWOA 1X55A 5IP7G 4GKJQ 4GN3B 1IBML 4C3HH 3KF6A 1VQOA 1Q1BA 2NVQH 4A3CH 2EQSA 4NXML 3EN2A 1KRTA 4IJHA 3AFQA 2LXJA 3J7ZC 3L2PA 4DR7L 2UU9L 2PI2A 4DR6L 2QEXA 3GTGH 3HOWH 3A74A 3RLOA 3HKZE 4APVA 3RZDH 3HOUG 4DUYQ 2R7DA 1VQ8A 1E22A 5JEAG 3PUVA 2AHOB 4GS3A 4A3KG 3F1ZA 4BY7H 3CQZH 3PV0A 3TQYA 2KBNA 3CCEA 2XGTA 3NEMA 4A3CG 2BH2A 4MNOA 4P73A 1IBKL 3ER0A 3J7A5 3EIVA 2ES2A 2IX1A 3STBC 1WCMH 2VL6A 4LUVA 5IE8A 4LFAL 2R6GA 1HNWQ 1O7IA 3H3VH 4BY7G 3M9BA 3NENA 2B29A 4TVAB 1YITA 2NVXH 4DUZL 2WB1E 2UUBL 1CUKA 3CP0A 4X66Q 1L2FA 3U58A 4DV3L 5C0XJ 5K36G 1OXVA 5J3BA 1KL9A 3RLFA 1JJ2A 2KENA 4DR3Q 3GTPH 4JV5L 4LF4Q 4DV6L 4JI4L 4R4TA 4NPSA 4A3MG 3CC2A 4JBJA 4JI0L 4A93G 2VZAA 2D0OA 5M5XH 2UXBQ 4TQUS 1K73C 2VW9A 5ELOA 1HZAA 1FGUA 3Q8DA 4DPGA 3I55A 5LMUL 4GNXC 4LF9L 1T9HA 3J80i 4A3LH 3BU2A 2AMCB 5IP9H 5C4JH 1C7YA 1IZ6A 1HNXL 4NXMQ 2YTYA 2JA9A 3BZCA 4X65Q 4DR7Q 2HT1A 2I5MX 4JYAL 1PH9A 1P8LA 1N36L
chains in the Genus database with same CATH superfamily
1O7ZA 4QIWE 1VQKA 1QJOA 3S1QH 2ZM6Q 3EA6A 1PH5A 2QGQA 4QL5A 1E7ZA 3HOXH 1SE2A 1CKMA 3PUWA 3AQQA 1AP0A 1WTOA 1OXUA 2NZOA 1EUJA 1JWUD 4GLXA 4JG2A 2Q8IB 1TS3A 1BR9A 1RHPA 4KKUA 5D14A 2PPBC 3AB9A 1UNSA 3SE0A 4QJFA 4G4KA 2J4XA 5KYLA 4HJAA 4IUPA 1XNQQ 2RVLA 1GO3E 3DWAA 2BA0A 3DWPA 4LW1A 3AFPA 3TRZA 3MWYW 1S40A 2ZTCA 1C9OA 1Y1WB 1VQIA 5JEAJ 2K5QA 3HOYH 2CH4A 1V1QA 4DV1L 3M4OH 2YYZA 4KV6A 1PRTC 3I90A 5EKIA 3M3YH 3EFXD 1SLJA 2VUMH 4LNQA 1N34L 5D3IB 5M5YB 1BXTA 2FMCA 3C46A 1XTDA 2C9OA 2L0CA 1ESRA 4HIOA 1K8OA 1L1OA 1PYBA 4JCVE 1R9TB 2E2IB 1FNUA 1SNMA 5IYBG 4DV7Q 2EYHA 4B08A 4IALA 4EX5A 3PIP3 4PZ8A 1VMCA 3OIQA 4K5WA 1SFOB 1TU2B 1HTPA 3NSWA 1PHJA 1PFMA 1S5ED 4X62L 1QVGA 3K59A 3GV3A 2RQXA 2EYOA 1E2WA 1YNNC 4HCSA 3LNNA 4HTHA 2MP1A 2KHIA 1CA6A 1STYA 2CFMA 5C4HA 2JEBI 2WAQG 1HA5A 1SYCA 4JK1C 3UE1A 2R92H 3GTMB 4LFBL 4PMCA 4POFA 1DOLA 1N32Q 2X6GA 3TZUA 2B2UC 2UXCQ 4CKEA 3NTIA 2H4OA 1WCMB 1NY4A 4AYBG 4PG3A 2IY5B 1GUTA 1SYBA 1Q82C 5EPJA 3H15A 1I50B 3PIOA 2WACA 1BCPF 3J80c 2LXKA 2L11A 4ZCKA 1GXDC 1WTXA 3GTKH 2EJFC 4JI8L 4O2DA 1PRTB 4YHHQ 1JOOA 3KDFB 2QILA 2NYZD 1I5FA 4ID6A 1QNUA 1JE4A 5KEEA 2EYJA 3VYUA 4DAYB 2QW7A 3I8ZA 3VYRA 3R2IA 1KLGD 4HN7A 1U5KA 3QR8A 5DM63 3ONAB 2IT1A 4GOPA 4OO1H 4XT3B 5J22A 3PO3H 3CHBD 1HH2P 3QIAA 3DWQA 1TWFH 1C0AA 5C4XG 1K83B 1ZEQX 1J6QA 2M2LA 1PXUA 1QE6A 3NBHB 3NELA 4OHJA 1SR3A 4J1MA 3BG3A 2R7ZB 4JBMA 4L5QA 3JAML 4OXPA 5IIFA 1N8RC 5GAEC 1D7QA 1I3QH 3NTKA 2FJ2A 3I72A 2IX0A 3EBEA 1VQ9A 3NTHA 3K80C 3F2CA 1RF2D 1KRSA 3PO2B 2PO4A 1HPCA 5AJ3L 1EY4A 3KYHC 4JI0Q 1BBWA 2K04A 4DV2L 1WTWA 3D6CA 1AH9A 5LMUQ 3OMGA 1TWHB 1TS4A 4A3GB 3I4NB 3H3VC 2Z6KC 2HDLA 5D3DA 4DU9A 1HNXQ 5DM73 1XPUA 3RN5A 2JA8B 5DNFA 3QOJA 1N36Q 1XX8A 1SE3A 5IYBH 5IT9c 3BDCA 4JC0A 4A3BB 1A6XA 1DOKA 2C35B 2ZJRA 5IGBA 1TWAB 4HIKA 1SAPA 1VCIA 3N6RA 2B2WA 3J81j 1WD1A 5FLXc 5IWAQ 1FNVA 1OXTA 4BA2I 2HIXA 4A3KB 4YWLA 1IYJB 1XJVA 2XNAC 2VS1A 5IOCA 1EIFA 4CGYB 2L4NA 4PZ7A 1D5MC 2KCNA 3P1HA 3A56A 2E76C 1E1TA 1V1OA 3PSIA 2MNAA 4X66L 1JMCA 3CQZB 1FJGQ 3UI2A 4DR3L 3IL8A 1B1ZA 2DGYA 2L55A 4RWSC 2HUGA 1BCPC 4R9WA 2UXBL 1KLUD 4R8NA 2CQAA 2K5WA 2AKWB 1OXSC 2IL8A 4A76A 3D31A 1SBBB 1YNJC 5LMNW 4FDBA 3X3MA 4GLAC 2ZM6L 2ZJPA 3VYSA 3CXCA 3KLSA 5M5XB 1HZCA 4KD4A 4UY8C 2EJMA 1JB3A 1L0WA 1R4QB 3HZXA 1MKHA 3ICEA 3A7LA 3HP3A 1KQSA 3HOWG 1DCZA 4HMIA 1DXMA 3MHBA 4K0KQ 2Z4HA 3QB3A 3R2TA 4JVZA 3S1QB 3MEFA 1U0LA 1TWCB 2ATWA 3O13A 3HOXB 2EXDA 2AUJD 3TMEA 3A5UA 1LTGD 4C1NK 1WCMG 4BBSH 4OIJA 5I2YA 2BH8A 1YHAA 2EY6A 4DNTB 3MXNB 3ND9A 3PQIA 1XNQL 5IYCH 1Q7YC 4B3RQ 3V2TA 1H9SB 4XYOA 1TS5A 2Q2TA 4U673 1BKBA 2DN8A 1UUPA 4CDEC 1BCPB 1JC7A 5CYUA 2K5NA 4YCUA 4CKBA 1HCZA 1VQ4A 1KC8C 1EQQA 5IGEA 1DONA 1HHVA 1GM5A 1EY9A 1WTQA 3NWSA 3U9SA 5EBDA 1K8AC 2FMMA 1RKNA 2IW3A 1PTOD 5C6AA 1SRUA 1W2BA 1TS2A 4DV7L 3HOYB 1W3SA 1EOVA 5E4WC 3M4OB 1O7YA 4GN4B 1HQMC 4BA1I 4BWGB 3M3YB 2R7ZG 2VQFL 2PI2E 2F0JA 1GOZA 5A2QL 2VUMB 2DNEA 3T1YQ 5TSSA 2KCTA 2UUAQ 1UE5A 1CQFA 4AQYQ 1K9MC 1VQ5A 3TP7A 2WB1G 3H6MA 1RCVD 2K5VA 4I7AA 4FP5D 5I6WA 3GTLH 1UEBA 4KHPQ 3D4RA 2EJGC 3LX0A 1KHIA 4GN5A 2FXQA 2FFKB 1N32L 3PUZA 1CSQA 2UXCL 1CA5A 4NW2A 2O4XA 3PO2G 3SK8A 2MFIA 1BQQT 1HR0W 3NBIA 4IOAA 1XWEA 2VXWA 3J80L 4A3GG 1PTOH 5AFWA 3I4NG 4G7HC 2R92B 1A2UA 1B2TA 5M5YH 4ZUIA 2JEAI 3PCOB 1KTKA 3NUCA 4YHHL 5C3XA 1X3QA 3IRBA 4ZKBB 4MN3A 5JEAH 3TP8A 1PRTD 1QB5D 1X55A 4GN3B 2NTSA 4EQNA 1WTVA 3TP6A 1A2TA 2L12A 3MEHA 1QG7A 3IFTA 3GTGH 3HOWH 3A74A 3RLOA 3VA7A 1IYUA 3GTKB 4APVA 3HRZC 3RZDH 5HGTA 4WFN3 4A3KG 1LO5D 1AEXA 4MIUA 3TQYA 3IFDA 3J81E 3BYYB 3PO3B 3EIVA 1C8CA 4EGVA 1WCMH 2VL6A 3I70A 1YNND 4QMGA 3MFYA 3VR2A 1EYDA 2PNRC 1TY0A 2B29A 1SYEA 2NVXH 4RAUC 2UUBL 4ZLTF 1CUKA 1L2FA 5CV7A 5EKLA 3U58A 1C48A 1RJTA 4CKCA 1JCKB 4A3MG 4JI0L 1CHPD 3MXPA 4FXGC 4L8JA 3BZDB 2VW9A 2DY8A 4DGZA 1FGUA 5LMUL 1I3QB 2F0VA 1EWCA 4HEDA 3BVZA 1IZ6A 1HNXL 2E74C 3BZCA 2KJXA 2I07B 4DR6Q 1N36L 1H9RA 2AQ2B 2NB0A 1PYSB 1Y1VG 5EPLA 5IT9L 1CSPA 2OXPA 2K7VA 4A3LG 2MPMA 5IP9G 4H02A 3E0JA 3TZDA 5EJWA 2B2TA 3M7NA 1CHQD 5IWAL 3S16H 2K33A 1VQHA 5FLXL 3TS2A 4ODGA 1DGSA 1KDAA 3MAQA 4UHVA 4HIMA 1KXLA 1J5EQ 2SDFA 4NB3A 3HOXG 5E1FA 1NSNS 1E1OA 2WAQE 5BR8L 3URYA 1A63A 5ELCA 4WRDA 2CWPA 3W3AA 1B70B 4U68A 4FO2A 2MO1A 4N9TA 1YI2A 3MA2B 3JAMc 2F0WA 4GLVB 3OWEB 1PFBA 4WJWA 1E2ZA 4LF9Q 3PIO3 1FJGL 1RIPA 1LTSD 5C3EB 3S14H 4A3JG 2F0SA 5ELFA 3UDFA 1UAPA 2F0DA 3QOLA 5LMNQ 1PH3A 4LF6L 2OTLA 4XXEA 2A6EC 2XWJB 4AYBB 3CCRA 5I2XA 4DXGA 1MJEA 1PZKD 3RLNA 3UE0A 1B3QA 2WINB 2BDOA 3FKIG 3KF6B 1ZXTA 2HHHQ 2AQ3B 3HOYG 4FVMA 2B8GA 4JBKA 2I5LX 2RCFA 3S1MH 2N88A 4BXXH 4RKBA 3H91A 2UUCQ 4DNIA 5M3FH 1I4QA 3BZKA 3KBGA 4IUVA 2ENBA 2EYLA 1QZHA 2ZTEA 1NE3A 4K0KL 4DK0A 4N8X1 1Z47A 3N52A 5D65A 4NKLA 3K7AH 1P16A 2F0MA 3F8TA 1M4VA 1Y8OB 2CWAA 1AFPA 5CMDA 1PH2A 1CI3M 4JOIA 2KEDA 5CBAE 3SR1A 3U9OA 3OTOQ 1SYGA 3P20A 4FXKC 5I9OA 1MI2A 4A3MH 4B3RL 1Q1EA 5FKAC 2R92G 4BY1H 1STBA 3Q6SA 1JORA 1LTID 5CGKA 4IQZA 4YCVA 4LFCQ 3KF8B 2B2WC 4Z9CB 3F2DA 4BBSB 4NXNQ 3A8IE 1LABA 1BCPD 4JBWA 1A0IA 1QWYA 2JA5H 1MHWC 1K8MA 4X6AH 1Y1VH 1E24A 4ME3A 2RHSB 1V1PA 1YNJD 3OOCA 1B8AA 1SE8A 1X3FA 1YHBA 5BN3A 3CKIB 4WORA 4QY7A 2L15A 1EYGA 1PH8A 3T1YL 1RODA 4V0BA 1TWCH 2Q2IA 3FP9A 2UUAL 1QUQB 4IJLA 5NUCA 4AQYL 2GVBA 5A35A 4OO1G 3PO3G 3OIPA 3BDLA 3G6JB 3HEJA 2KOLA 3W5OA 4B9XA 2RDHA 2M9VA 4QQBX 4KHPL 4KTAA 5GADC 4FYDA 1PH6A 5C5LA 3L0OA 1TIID 2PZWA 1CZWA 3K5MA 1TT2A 5IY0A 4I7ZC 2E8GA 2F3VA 5K5PA 2QDBA 4A3JH 2DJGC 2F0NA 1B9MA 3JAME 2PZTA 4JPBW 5JPMC 3ULPA 1WYDA 4IPCA 4UP9A 4NDXA 1N33Q 3K58A 3HGBA 5JPNC 2K75A 3PF5A 3GTLB 1WD0A 1G51A 1KAWA 1DYQA 3U50C 1LTAD 3OW2A 1G91A 1JWSD 1K3RA 1YHQA 4QIWB 1KD1C 1CKNB 3FKIH 1D1KA 3GTOH 4Q5VA 3CRLC 4A3FH 1SYFA 1MIUA 3CCQA 3KOJA 2V4DA 3CCVA 4B3SQ 1PTOB 4H7BA 3ULLA 1NAPA 3SEBA 1JOKA 4B3ML 4OGQC 4K8JA 3C1FA 1YZ6A 1AZQA 2ZXPA 4X64Q 5E4XA 2E5LQ 3RMHA 2D9UA 3ND8A 2K28A 2Y0SE 4HIDA 4HAEA 4HMJA 1X6OA 2EE1A 2DY7A 3GTQH 4FF3A 2CH4W 3GTGB 3V96A 3HOWB 3RZDB 1Y69U 5C3EG 1D8LA 3ITPA 5FO9B 5C0XI 1BUVT 1F9SA 2AUKA 1Q8KA 4HJ5A 4F87A 1GD7A 1Q81C 1AN8A 4JI5Q 1IL2A 2UXDQ 4J6HA 3S1NH 1Q8IA 4O0AA 1ET6A 5FOBB 5T1IA 4V190 2NVXB 1M90C 4RMFA 1I94L 3CU7A 3HFZB 4CJ1B 5M5WH 1O80A 3Q23A 4P75A 1SROA 1NUCA 3GP7A 1UWVA 4ZUJA 4G7OC 3M4QA 4KY5A 2Z9HA 4K6DA 4A3IH 1STAA 3NPPA 3VDYA 2XSCA 1J5EL 3K5LA 2N49A 1TXYA 5EQ0A 5C4ZA 2RF4A 1HJPA 1VQBA 4MHEA 5IGDA 4DV5L 1GJXA 4POGA 4E6IA 4X3UA 2LY7A 3E5SA 1I4PA 3S16B 1FVIA 2OF1A 1HNZQ 2WB1B 4DR2Q 1T5EA 1EWHA 2B2YA 1D1IA 2FINB 5ELDA 4HR7B 1VQJA 1GUWA 5LHY1 1UE7A 4BBSG 1K0RA 4TKOB 5DEHA 1JICA 4RGNA 5J1ZA 1Q12A 2RA4A 5IYCG 4ZQ3A 1SJED 2EYPA 1XTCD 3L9AX 4RFBA 3HKZG 4DV0Q 3M7GA 3S14B 2HHHL 5C5MA 3VR6A 3CC4A 4C3IG 2DJFC 1EQRA 5CR3A 3CMAA 3FDTA 5KNDA 4CDFC 1FR3A 3OWFA 2UUCL 3KBXA 1H9MA 1DJRD 3E9HA 1PMRA 2SNMA 4J15A 1LACA 1T5XD 4LF7Q 1S5DD 1HZ9A 4G57A 1JT8A 3S1MB 3SXHA 3I2ZA 4NP5A 5A2QE 2NVYH 5C3EH 1FGBD 1NMFA 3CCJA 3E3XA 4CDDC 3UDXA 3OTOL 2VB3X 1YBYA 3K0YA 5M3FB 3E0EA 2F1MA 4DXFA 2JP1A 2JA7H 5ELEA 3T53B 2YTVA 1NCVA 3QWNA 5FLMH 1QVCA 2B63H 1SDFA 2J0TD 3CMEA 2L9HA 1HNWL 1ET9A 1EY7A 1VQFA 3DEPA 3EJIA 4MTKA 3H0GG 1UE6A 3K7AB 3I73A 4N8FA 1GUNA 4H13C 4CDCC 2F0TA 1A62A 1Q46A 1H9JA 4NXNL 2B2TC 4IFDI 3HOUH 1I4HA 1EQVA 4PMWA 2WFWA 3K8AA 3J80E 1JQYD 4A3MB 1B4OA 3M85A 1X9NA 1TQOA 2A6ED 4HJ8A 5IP7G 4GKJQ 4BY1B 4C3HH 1SNPA 2NVQH 4NXML 1KRTA 4X3TA 2LXJA 2QEXA 1TVXA 2SOBA 2VB2X 1SNQA 4DA2A 2EPBA 1VQ8A 1IKMA 3P75A 5JEAG 2AHOB 2XN9C 4KY7A 2JA5B 1Y1VB 1BF4A 1ILQA 2RSOA 4IUNA 2D2CC 1G8ZD 3J7A5 5LL6S 2ES2A 2IX1A 3STBC 4K6LA 4LUVA 1Q90A 3R3OA 1F77A 2X69A 1SMYC 1C4QA 1JOQA 3NENA 3FEWX 3M9BA 2ICEC 1I6VC 2K03A 4ABNA 3CP0A 1BO0A 5C0XJ 5J3BA 1KL9A 2JYOA 3RLFA 4LF4Q 4KKTA 1W6JA 1K0SA 2L1BA 3OHXC 3VR5A 4TQUS 1K73C 3P7JA 5ELOA 3BU2A 2AMCB 2YTYA 4PMBA 4N9PA 4DR7Q 4A3JB 4C3IH 3KDFA 3S1RH 2BE5C 2Q8RE 3TEHB 1E3PA 1K3BC 1IXRA 2EXZA 4DAYA 5E7NA 2XRQD 4B3SL 5COYA 1QCBD 2Q2HA 4OX9Q 4OL7A 3HOVH 2OTJA 1OTCA 2SEBD 4P72A 3X3NA 5T1GA 3OSOA 2OEOA 3FKIB 2E5LL 4RHRA 3NBHA 3GTOB 4GKKQ 5IT9E 1XMQQ 2JJQA 4A3FB 2EY1A 4QCLA 4MTNA 1WFQA 2HCCA 1XPOA 1EY8A 1N9WA 1F9RA 2NVTH 1CQVA 4QB4A 5FLXE 1FL0A 3HOZG 3TP5A 3D3RA 4JW0A 3CF5A 4UPAA 4G7ZC 3FHWA 4OONA 1PA6A 2F52A 2K50A 4Y7NH 1GVPA 2B2UA 4F7XA 3I56A 3H0GH 1KABA 4DN4M 1KNEA 2DUDA 4JI5L 2UXDL 4C2MH 1EFWA 1D2BA 4DAPA 3GTQB 2PCFB 4WJ4A 1II3A 2XVSA 3RUZA 1H9KA 2GVAA 2JSOA 1VS0A 3S15H 2F3WA 1L0XB 1EL0A 4K5VA 2Q8TA 5IP7H 5IGFA 2ID0A 2CHBD 3D8GA 4GNXA 1VQDA 3S1NB 1U4PA 3K57A 2PMZB 3GDEA 1PYWD 1B50A 2E2HH 2VNUD 1TWGH 3JC66 1VQCA 5M5WB 4CJ2C 1VQLA 2EIFA 5EKKA 3SGIA 4BXXG 1NBWA 4OWXB 3EROA 1G2TA 2B2VA 2G9HD 4RHSA 2EOTA 1XXGA 5M3FG 3NQIA 1EY6A 3CAMA 3GD7A 2JK8A 2E75C 4DV1Q 3TDQA 2ZXOA 1S5FD 1TR5A 2N78A 4AIMA 3KJPA 4A3IB 1HNZL 4DR2L 1YIJA 3LWUA 1SE4A 3SVMA 5IGGA 1N34Q 2A68D 1LTTD 2RSNA 4DKAC 2BA1A 1I6HH 2NTTA 2JQOA 4O42A 4RCOA 3U4ZA 3D4WA 1YJ9A 3S17H 4R4IA 4XYQA 4JI1Q 2NBFA 2JA6G 3E6ZX 1KAAA 4EQOA 3KLRA 1L1OC 4IFDJ 3K6OA 2Z6KA 2K01A 4DV0L 1OO9B 2BOSA 4BY1G 2LKVA 1RD9D 4X62Q 3CC7A 1DD2A 4BBRH 2SNSA 3BVMA 2QKIC 4ULLA 3K5OA 3D0FA 2F0UA 2JA5G 5I9PA 1GHKA 1MJCA 2KEEA 4LF7L 5CV6A 4WJ3M 2B3GA 3GQBA 5CBEE 1L0YB 5FK9C 3C2PA 4LFAQ 4OELB 2HQLA 5M3MH 1ENAA 3HOZH 2ALYB 1CKOA 5M9OA 4KJNA 3I7FA 4DUZQ 1IHZA 1NR2A 2F3IA 2KHSA 4ZKCB 2CW0D 1W6KA 1H95A 4DV6Q 1I4GA 4JI4Q 1A3VA 4CHTB 1A3UA 1H9SA 1LYLA 1S5BD 3CCMA 3CD6A 2RBMA 2E2JH 4AYBE 3OMCA 5FO7B 1K8GA 2QDLA 2KA7A 2NVYB 5GAHC 2F0PA 4LMQD 2BDNA 3TN2A 4JYAQ 4GOPC 1L1OB 2JA7B 4KMUC 3FVQA 1ENFA 4DFAA 4JI7Q 1EEID 1XNRQ 2B63B 4GKJL 4IUQA 4ZYSA 4OIKA 4OWWB 4KI0A 3KLWA 2WV6D 5KNCA 4A3FG 4M1UB 2WKDA 4X3SA 2NZHA 3HOUB 4ME5A 2HD3A 2LMCB 1AZPA 3T16A 3BJUA 1PDQA 4C3HB 2F4IA 1VQMA 1J9OA 2NVQB 4ILWA 2CKZB 2KCMA 1SEBD 1XYIA 1YVCA 2J7ZA 1ESFA 2K14A 4ZK9B 1QOHA 4DV2Q 2D5DA 3TBIB 3U4VA 1G6ZA 2P5ZX 1HFGA 2F4VQ 1D6EC 2Q2UA 1J8IA 4LF4L 1VQPA 1IKLA 3MC0B 1Y8NB 1KDBA 1QILA 4L6TB 4DR5Q 4A93B 2E2DC 3DUZA 3I91A 2R3ZA 4BS9A 2JA6H 3K5NA 3T1HQ 1LT6D 1X3EA 1E2VA 5DLQE 2OQKA 5EBCA 3AYHB 2R93H 1RL2A 4GOPB 4RGOS 4DF7A 2C5CA 4I65A 4RG1A 3G6EA 3QG1A 3RZOH 1X54A 1EZ6A 4OX9L 1VF5C 4DR1Q 1VQ6A 5GAGC 3HKZB 4IO9A 2IJ0A 5KGUA 4GKKL 4FF1A 1XMQL 4C3IB 5J39A 3S1RB 3NWTA 1F2ZA 3SK6A 3M4YA 1MBYA 3ZJYC 4A3DH 3GV6A 2G5DA 4FXDA 4F8MA 4MZ9A 3A8JE 3HKSA 3CPFA 1SNDA 2KHJA 3HOVB 4LJZC 4OWTB 1F2YA 1S4ZA 1GHJA 1Z9FA 4DAMA 4LF5Q 4A3IG 3STBD 1SMYD 3I4MB 4RCNA 5HY6A 3LWEA 1GUOA 2KVMA 5JJIA 1STEA 2KCCA 2ZT9C 1YJWA 1HR0Q 4KN7C 4XT1B 1PH4A 1EZ8A 4L5TA 4ALPA 5C0XH 1HZBA 2NVTB 4P2CB 2KUMA 5FO8B 3NXWA 1VMPA 2MUYA 1JB7A 2CQOA 2K52A 3S2DH 2NN6I 4QUFA 1EOTA 4Y7NB 4HJ7A 1MGSA 1ASZA 1KNAA 2H1EA 3CRKC 3H0GB 2F0QA 3NK9A 5IODA 3PGZA 1BVSA 4C2MB 1S3OA 3ERQA 2YTXA 1ZYRC 4R8IA 1HRJA 3B6YA 2BE5D 4EQPA 5BN4A 2DNCA 1EYAA 2RDGA 1EIYB 2MHVA 4IFDG 3I4LA 2A1AA 5JVH3 3S15B 3W1BA 1LM0A 3H3VI 3GTJH 1DM0B 3RR5A 3SK5A 4Y52H 5C44H 3Q24A 2PQAA 4XQJA 2F0LA 4HCEA 2QCPX 5FJ8H 1U4RA 2EVBA 2PW7A 2E2HB 1TWGB 4A3EG 5G3LF 2IPKD 3NHHA 5CV8A 1U4LA 5IYDG 4HJ9A 5KIXA 4IOCA 4XDXA 1NR4A 1NJIC 2K32A 2A73B 2A68C 2WIIB 4KD3A 4YWKA 2A8VA 2JXMB 4JI1L 2QF7A 1LT5D 2JA7G 1Z7TA 1XMOQ 3G48A 5FLMG 4C1NI 3J7YW 2B63G 4JI2Q 2VQFQ 4H44C 2Z6BA 2A6HC 4LUOA 1WVLA 3KF6A 4PQXA 1Q1BA 1VQOA 4A3CH 3T51B 3AFQA 1I6HB 3L2PA 1STHA 4DR6L 1ENCA 1LLRD 3S17B 3HOUG 4DUYQ 2Y0SB 1E22A 4GS3A 4K2KA 4BY7H 3PV0A 2KBNA 1B53A 2HCIA 3HS0C 4C3HG 3CCEA 2XGTA 1SYDA 2ZXRA 3NEMA 5K36H 1DZ1A 4MNOA 4RKLA 5DAUA 3ER0A 1CZGA 4BBRB 4LFAL 1RTOA 3IAYA 2F0KA 1PZJD 3SHLA 2NWGA 4DUZL 2WB1E 3DEOA 2EYFA 1TKWB 2NZ1D 1OXVA 2MGSA 2F0GA 3VYTA 2CW0C 4DV6L 4JI4L 4R4TA 4NPSA 4A93G 4JBJA 2XIWA 1KDCA 1R4PB 5CC4A 4C56C 3I55A 1HZAA 3Q8DA 4GNXC 4LF9L 3BVGA 5M3MB 1T9HA 1VDZA 3HOZB 2EYMA 5C4JH 5F2DA 3KF8A 3MXGA 4X65Q 4KHVA 4JYAL 4DK1A 1PH9A 1P8LA 4K5XA 5LMNL 1PV4A 4R4CA 4UP7A 1LTRD 4JI7L 1LT3D 4JI6Q 4C3JG 1XNRL 3A55A 1EWIA 1O7LA 3ULJA 2B2VC 4QGUA 2E2JB 3G4SA 1WI5A 4IFDH 1G6PA 3J81i 4DR4Q 2V1CC 3Q0AA 2F03A 3KK7A 1DOMA 2F0OA 4RA8A 1Z6HA 5JVG3 5H1SE 4PNYA 3FPPA 1IBLQ 2A74C 5JAVA 2D62A 3AMUA 1QUQA 2UUBQ 1EYCA 1F2MA 1CFMA 5E3FA 3HOVG 2OQ0A 3DM3A 1I4RA 4A3EH 3I4MG 1G291 1LTLA 3T13A 2F4VL 5IYDH 4KKSA 5EPKA 2NUCA 4GZYC 2OT2A 3MZ5A 5JJZA 1U4MA 2JN4A 3D6WA 4DR5L 4UAIA 4B3TQ 4YY3Q 1CM9A 3NE5B 3ERSX 4GNXB 1RTNA 4OO1I 3T1HL 1QNKA 1I4XA 3A0JA 3EQLC 4M8AA 2F0HA 1CKNA 4IUUA 4XIGS 2ZJQA 3WOEA 2PQEA 4KK7A 2Z8LA 4XQQA 3DMUA 2XRSD 1EEFD 3LGJA 4LFCL 4A4IA 1BBXC 4LF8Q 4KHZA 1O78A 4TSSA 2A69C 2JA6B 2MQHA 5BR8Q 1ASYA 3J7AV 1IW7C 3PUYA 4DR1L 1FYCA 1WTRA 5I4DA 3KUPA 2R93B 2ICIA 1A8VA 3CCSA 3ZYYX 4UDUC 3S2HH 2PYKA 3R93A 2HQEA 3C3LA 4NMZA 3VA5A 1QVFA 1QZGA 1Y1WG 3RZOB 4IURA 4DV4Q 2F0IA 2CCZA 4LF5L 1AW7A 1VQGA 2BCOA 2VQEQ 4LF6Q 2K05A 2H5XA 2HIVA 2RCNA 3EVQA 1IYVA 4A93H 2EZVA 4P71A 4IPDA 3OYYA 1D5XC 5ISRA 2I0QA 4LAAA 4A3DB 4JI3Q 2K4KA 1HR0L 2Z4IA 1IL8A 4KJOA 5HGQA 3GTPB 1JE5A 5C4XH 1Y14B 2L5TA 1N33L 2RHQB 3DHQA 2IWHA 1VQAA 1YEZA 4X3KA 2O5JC 4C3JH 5CV5A 1VQNA 2RKSA 3L3OC 5IGCA 1MD2D 2A19A 2JE6I 3PMFA 4K14A 5GROA 3J81c 4K2LA 1IBMQ 1MSGA 3I3CA 3T4AC 4L5SA 2UU9Q 2YU9H 2Y0SG 4L63B 3PIPA 5GQOA 1ONLA 2KECA 3S2DB 4BBRG 1X56A 4JOIC 3W1GA 1S72A 1IBKQ 2WP8J 1X65A 2ZTDA 4X64L 4ZRZA 1ML0D 4LUZA 4YCWA 2R61A 3T56B 2O5IC 3I4MH 1B9NA 1EIGA 2AWNA 1Q86C 4DV3Q 2XTIA 4HSVA 2MJ8A 1JR0D 2IHEA 4A75A 3GTJB 4JV5Q 3H94A 3CPWA 1SMXA 4HSPA 4L5RC 3BYTB 5M3MG 5C44B 3MXUA 3E9IA 1V8QA 2AWOA 3HG9A 2TMPA 1LT4D 4IPHA 5ELBA 2M00A 2LSSA 1XMOL 4LWCA 2K5DA 5EAYA 1Y8PB 4JI2L 3OW7A 2CVRA 4FNFA 1SJHD 3A54A 1B44D 1VQEA 4YIJA 4ZAIA 1B7YB 5HURA 4KLKA 1VQ7A 5JJLA 1F2LA 1HUMA 2PMZE 1OXXK 3A5ZB 3BDOA 2WKCA 1BDOA 3FRPB 3S24A 4TRDA 3A7AB 1V43A 4DUYL 4P74A 3QJYA 1U9RA 3NP8A 1GUGA 3W2DA 1JJGA 1ZYRD 1HTLD 1M8AA 2R7FA 4RH6A 1A3TA 1PZID 3FMCA 1PVOA 1Y1WH 4EQ5A 1ZKOA 1V9PA 3RNUA 4O1NA 3JAMi 5BN5A 3G71A 3K81C 1SSOA 3F2UA 1PH7A 1WJJA 4R4OA 2OCEA 2Z0SA 2YV5A 1PFSA 4R4QA 4BY7B 2JA8G 1NNXA 1BNZA 4XQNA 1UEAB 2F0EA 1R9TH 2E2IH 2GN5A 3CCUA 4A3BG 2I5HA 1CT1D 1BOSA 4AH6A 3DM1A 1SFOH 3I4OA 4KN4C 1PFNA 4X65L 1S5CD 4B3MQ 1X3GA 1F9PA 5KRUA 1V1PB 1WOCA 4F88A 1NTGA 3DLLA 3K7UC 3A8KE 1GKHA 3MTSA 5KNBA 4JI6L 4B9WA 2O2LD 1EFID 3VR4A 4CBVA 2QEJC 4EVOA 1YNXA 3J7AF 2AQ1B 3GTMH 2N8NA 1LTBD 1M1KC 1BBUA 4DR4L 1CK1A 2A6HD 2EY2A 1B3AA 5C4JB 1X3PA 2R93G 1TWFB 2I46A 3F2BA 2PW5A 2NN6G 3KJOA 4S3SA 3PF4A 4DK3C 1SXTA 1I50H 3S9WA 1IBLL 1HQRD 3M4PA 4IUTA 1ICFB 4DK6C 4LFBQ 2ASBA 1PH1A 4UP8A 1GUSA 5JJKA 3SK4A 1Q3LA 3WWVA 3TS0A 2X6LA 4A3DG 1I94Q 3H09A 1D5ZC 4RGMA 1JWMD 4B3TL 5I6YA 4YY3L 1NMGA 3K0XA 1PTOF 1K83H 4JI8Q 5KYIA 1EQTA 4IZ8A 3Q22A 3C1EA 3MXNA 4KY6A 4A3EB 2VY3A 2IX3A 1STGA 2R7ZH 3AEVA 3QO2A 1AE3A 1SN8A 1EIHA 2D0PA 1HUNA 2IHFA 2K5HA 4LF8L 5CV4A 5ELNA 3PUXA 4PZ6A 5L37A 1KIXA 2GA4B 5C0XG 4DAVA 1F9QA 3RN2A 4DNRB 2PQAB 3TREA 3UDIA 3TSSA 2KQ3A 1CTMA 3IKJA 2LFNA 4QUCA 4DV5Q 1FD7D 4YWMA 4XTCS 2B8FA 3PO2H 1FNWA 1RDPD 2QA4A 2LS01 1K28A 3FPUB 4R1JA 4DV4L 2PNHA 2WAQB 1TWHH 1JJCB 1ICWA 4IPGA 4J8QA 3I4NH 5JOBA 2N55A 3NQTA 4A3GH 2PZUA 2F0FA 3UDGA 2B2YC 2JA8H 2VQEL 2MO0A 3WDNA 1AE2A 3KFUA 4Q0FA 3GO5A 2B39A 3L7ZC 1HXYD 1UE1A 2TSSA 1SNOA 5C44G 5AJ3Q 1YJNA 3RD4A 3S2HB 4A3BH 1EY5A 3BS1A 3MVVA 1E0BA 4JI3L 5FJ8G 1XPRA 1TWAH 5LL6X 1PRTF 2Z1CA 3R8BA 2FHTA 5G3LD 3VR3A 2EDGA 3DXJC 1TY2A 2HDMA 3CCLA 2VUMG 4A3KH 1LUZA 1MSHA 2N3SA 4IN3A 1VF7A 3CW2C 1SNCA 2OWOA 1IBML 1LV9A 3J81L 2EQSA 3EN2A 4IJHA 3J7ZC 4DR7L 2UU9L 2PI2A 1PLFA 5CORA 1STNA 3HKZE 4RGTA 3MFGA 3OPOA 2NN6H 4LK1C 2R7DA 5C4XB 1X32A 3PUVA 3F1ZA 3CQZH 5CV9A 4OEMB 4FF2A 2A69D 1WTPA 4C3JB 4K8IA 4A3CG 2BH2A 1IW7D 4P73A 1IBKL 1WTHA 3G7LA 4CJ0B 5C3WA 5EGTA 1HFNA 5IE8A 1A15A 3V05A 2R6GA 1HNWQ 2YU9B 1O7IA 3H3VH 4BY7G 4TVAB 3SDZA 1YITA 1ILPA 4X66Q 2XWBB 2EY5A 4DV3L 4H0LC 5K36G 1JJ2A 2KENA 3KLSX 4DR3Q 3GTPH 4JV5L 3WOFA 4PV1C 3CC2A 2VZAA 1G2SA 2K6AA 1EU3A 2D0OA 3AU7A 5M5XH 2UXBQ 1EU4A 2RDFA 1HA6A 4DPGA 4FF4A 4QF4A 3J80i 4A3LH 1PTOC 3D4DA 2A5HA 2K1BA 2G9DA 5IP9H 1C7YA 4NXMQ 1EY0A 2JA9A 2HT1A 2I5MX
chains in the Genus database with same CATH topology
4C3IH 5LMNL 4QIWE 3KDFA 3S1RH 1PV4A 4R4CA 1VQKA 3S1QH 3TEHB 4UP7A 1E3PA 1PYSB 2ZM6Q 4JI7L 1H95A 1Y1VG 4JI6Q 1IXRA 1XNRL 1EWIA 1PH5A 1CSPA 2QGQA 4QL5A 1E7ZA 5E7NA 3ULJA 3HOXH 4B3SL 4A3LG 3PUWA 1CKMA 4QGUA 2Q2HA 3AQQA 4OX9Q 5IP9G 3HOVH 1OXUA 1WI5A 2NZOA 1EUJA 4H02A 3G4SA 2OTJA 1G6PA 3J81i 1OTCA 4DR4Q 4P72A 3M7NA 4GLXA 2V1CC 5IWAL 4JG2A 3S16H 1VQHA 2E5LL 3TS2A 1DGSA 4GKKQ 5H1SE 1XMQQ 4HIMA 1KXLA 2JJQA 1J5EQ 1IBLQ 4NB3A 2D62A 3HOXG 1QUQA 4MTNA 2UUBQ 1WFQA 1E1OA 2WAQE 5BR8L 3HOVG 1A63A 1XPOA 2CWPA 1N9WA 2OQ0A 1B70B 2NVTH 3DM3A 4QJFA 2MO1A 1YI2A 1FL0A 3JAMc 4GLVB 3HOZG 4HJAA 4A3EH 3I4MG 3CF5A 4UPAA 1G291 1LTLA 4LF9Q 1XNQQ 1GO3E 3FHWA 4OONA 1PA6A 1RIPA 2F52A 2K50A 1FJGL 2BA0A 4Y7NH 3S14H 5IYDH 1GVPA 4A3JG 4LW1A 3AFPA 3TRZA 3I56A 3H0GH 1S40A 2ZTCA 3UDFA 1C9OA 1VQIA 5JEAJ 2DUDA 3HOYH 4JI5L 5LMNQ 4DR5L 1V1QA 4C2MH 1PH3A 1EFWA 4B3TQ 4YY3Q 4DV1L 2UXDL 3M4OH 4LF6L 3ERSX 2YYZA 4GNXB 2OTLA 4OO1I 4WJ4A 3T1HL 3M3YH 3CCRA 3A0JA 1SLJA 2VUMH 1MJEA 4LNQA 1N34L 3RLNA 3UE0A 2GVAA 1VS0A 3S15H 1CKNA 4XIGS 2ZJQA 3FKIG 5IP7H 3KF6B 1XTDA 4HIOA 2HHHQ 3HOYG 3LGJA 4LFCL 4JBKA 1L1OA 2ID0A 4A4IA 2I5LX 1PYBA 4JCVE 4LF8Q 5IYBG 3S1MH 4DV7Q 4BXXH 4KHZA 4EX5A 4GNXA 4PZ8A 1VQDA 2UUCQ 4DNIA 2MQHA 5BR8Q 5M3FH 3PUYA 4DR1L 1PHJA 3GDEA 3BZKA 4X62L 1QVGA 2E2HH 2VNUD 1TWGH 3JC66 1VQCA 1QZHA 2ZTEA 1VQLA 1NE3A 2EIFA 1A8VA 4K0KL 3CCSA 2KHIA 3SGIA 4BXXG 1Z47A 3S2HH 1NBWA 2CFMA 4OWXB 2JEBI 2WAQG 3K7AH 1P16A 1QVFA 1QZGA 3UE1A 1Y1WG 2R92H 3F8TA 4LFBL 2CWAA 4DV4Q 1PH2A 4POFA 4JOIA 5M3FG 1N32Q 3CAMA 2CCZA 4LF5L 3GD7A 1VQGA 3OTOQ 2UXCQ 2JK8A 4DV1Q 2VQEQ 1NY4A 4AYBG 4PG3A 4LF6Q 2IY5B 2H5XA 2HIVA 2RCNA 2N78A 4AIMA 3KJPA 4A3MH 1HNZL 1Q1EA 4A93H 4B3RL 4DR2L 4P71A 1Q82C 1YIJA 3H15A 4IPDA 3OYYA 3PIOA 1N34Q 3J80c 2R92G 2LXKA 2I0QA 4BY1H 4JI3Q 2K4KA 1HR0L 1I6HH 4DKAC 2BA1A 5HGQA 2JQOA 4YCVA 4LFCQ 3GTKH 3KF8B 1JE5A 1YJ9A 3U4ZA 4JI8L 3S17H 3F2DA 4O2DA 4R4IA 4NXNQ 4JI1Q 1Y14B 5C4XH 4YHHQ 4JBWA 2JA6G 3KDFB 1A0IA 1L1OC 1N33L 2Z6KA 1I5FA 4IFDJ 2RHQB 2JA5H 1VQAA 1YEZA 4DV0L 4X6AH 1Y1VH 1E24A 4BY1G 4ME3A 4C3JH 4DAYB 1VQNA 2RHSB 1U5KA 4X62Q 2JE6I 2A19A 5GROA 3J81c 3CC7A 1IBMQ 4GOPA 2IT1A 3PO3H 4BBRH 1HH2P 1B8AA 1SE8A 1X3FA 1TWFH 1YHBA 4L5SA 2UU9Q 2YU9H 2Y0SG 1C0AA 5C4XG 1J6QA 3PIPA 4QY7A 2L15A 3NBHB 3NELA 3D0FA 5GQOA 1EYGA 2JA5G 1PH8A 3T1YL 1MJCA 1SR3A 1TWCH 2Q2IA 3FP9A 2UUAL 4LF7L 1QUQB 4IJLA 4AQYL 2GVBA 4OO1G 4WJ3M 4JBMA 2B3GA 3PO3G 4BBRG 1X56A 4L5QA 4OXPA 4JOIC 3W1GA 3W5OA 1S72A 1N8RC 1IBKQ 2WP8J 1X65A 2ZTDA 4X64L 5GAEC 4QQBX 4KHPL 1D7QA 4LFAQ 5GADC 1I3QH 4LUZA 2HQLA 4YCWA 5M3MH 1PH6A 3HOZH 2ALYB 3L0OA 1CKOA 3I4MH 3I7FA 5IY0A 2IX0A 3EBEA 4DUZQ 1VQ9A 2AWNA 3K80C 2E8GA 3F2CA 2F3IA 1Q86C 4A3JH 4DV3Q 2XTIA 3ULPA 1WYDA 1KRSA 4DR6Q 2IHEA 4A75A 4IPCA 4DV6Q 4JV5Q 4UP9A 5AJ3L 3CPWA 1SMXA 3KYHC 4JI4Q 4JI0Q 1BBWA 4L5RC 1N33Q 1LYLA 4DV2L 3PF5A 2K75A 5M3MG 3CCMA 3CD6A 1G51A 1KAWA 3E9IA 1AH9A 3U50C 5LMUQ 2E2JH 4AYBE 3OW2A 2AWOA 1K3RA 2Z6KC 1YHQA 1K8GA 1KD1C 5GAHC 1CKNB 1HNXQ 4IPHA 1XPUA 3RN5A 3FKIH 2LSSA 1XMOL 4LWCA 4JYAQ 5EAYA 3GTOH 4GOPC 1N36Q 1L1OB 4JI2L 4A3FH 1MIUA 5IT9c 1VQEA 5IYBH 4JC0A 3CCQA 4JI7Q 1XNRQ 3KOJA 4GKJL 3CCVA 1B7YB 2C35B 4KLKA 1VQ7A 4B3SQ 4OWWB 2ZJRA 5JJLA 3ULLA 4KI0A 4B3ML 2PMZE 4HIKA 1OXXK 3A5ZB 1VCIA 3KLWA 3J81j 1YZ6A 3S24A 1V43A 4X64Q 4DUYL 4P74A 5FLXc 5IWAQ 4A3FG 2E5LQ 1JJGA 2NZHA 1OXTA 4BA2I 2HIXA 2R7FA 4YWLA 1IYJB 1XJVA 1PVOA 2VS1A 2Y0SE 4HIDA 1Y1WH 3BJUA 4EQ5A 1EIFA 1X6OA 1V9PA 1VQMA 3RNUA 2KCMA 2CKZB 3JAMi 3GTQH 1YVCA 4PZ7A 3G71A 2K14A 3K81C 1E1TA 4DV2Q 1PH7A 1WJJA 4R4OA 2OCEA 2Z0SA 3PSIA 5C3EG 4X66L 1D8LA 2MNAA 2YV5A 1PFSA 4R4QA 3U4VA 5C0XI 1JMCA 1FJGQ 2F4VQ 2JA8G 4DR3L 2Q2UA 4LF4L 1Q8KA 4HJ5A 2DGYA 1VQPA 1R9TH 2E2IH 2GN5A 1GD7A 3CCUA 1Q81C 2UXBL 4JI5Q 1IL2A 4A3BG 4DR5Q 2UXDQ 2I5HA 2AKWB 3S1NH 4AH6A 1OXSC 4O0AA 2JA6H 4A76A 1SFOH 3T1HQ 1X3EA 3D31A 3I4OA 5LMNW 4FDBA 1M90C 4RMFA 4X65L 1I94L 4B3MQ 1X3GA 3HFZB 1WOCA 5DLQE 1NTGA 5M5WH 2OQKA 2R93H 3AYHB 4GLAC 1RL2A 3DLLA 3K7UC 4GOPB 1GKHA 2ZM6L 2ZJPA 4JI6L 4RG1A 4P75A 1SROA 3CXCA 3G6EA 1YNXA 3GTMH 2N8NA 3RZOH 1UWVA 1HZCA 1X54A 4UY8C 4OX9L 3M4QA 1M1KC 1L0WA 1BBUA 4DR4L 3ICEA 1MKHA 1KQSA 3HOWG 4DR1Q 1VQ6A 2R93G 5GAGC 4IO9A 3F2BA 2NN6G 3KJOA 4A3IH 4GKKL 3PF4A 1XMQL 3VDYA 4DK3C 4K0KQ 1J5EL 1I50H 1IBLL 2N49A 3MEFA 1U0LA 1TXYA 3M4PA 4DK6C 3ZJYC 2RF4A 4A3DH 1HJPA 1VQBA 2ATWA 4MZ9A 2EXDA 4LFBQ 2ASBA 3HKSA 3CPFA 1PH1A 3A5UA 4UP8A 2KHJA 4DV5L 4OWTB 1WCMG 1Z9FA 4POGA 4BBSH 5JJKA 4DAMA 4LF5Q 4A3IG 2BH8A 1YHAA 3WWVA 3MXNB 1XNQL 3TS0A 3STBD 1FVIA 5IYCH 1Q7YC 1HNZQ 4B3RQ 4DR2Q 4A3DG 5HY6A 1I94Q 2Q2TA 1BKBA 5JJIA 1VQJA 1YJWA 4B3TL 1HR0Q 2K5NA 1UE7A 1NMGA 4YCUA 4YY3L 1K0RA 3K0XA 4L5TA 1PH4A 4BBSG 1K83H 1VQ4A 4ALPA 1EQQA 1KC8C 1HZBA 4JI8Q 1GM5A 1Q12A 5IYCG 2VY3A 1K8AC 2R7ZH 1JB7A 3HKZG 4DV0Q 2CQOA 2K52A 1AE3A 1SN8A 2NN6I 3AEVA 2D0PA 4HJ7A 2HHHL 3S2DH 3CC4A 1ASZA 1SRUA 2IHFA 1EQRA 2K5HA 4LF8L 1W2BA 5ELNA 3PGZA 3PUXA 4PZ6A 3CMAA 4DV7L 1KIXA 1BVSA 1W3SA 5C0XG 1EOVA 1S3OA 2YTXA 3RN2A 2UUCL 3B6YA 2PQAB 4GN4B 3TREA 3UDIA 4BA1I 1EIYB 3E9HA 2VQFL 2PI2E 2R7ZG 4IFDG 3T1YQ 4J15A 2A1AA 2KCTA 4DV5Q 4YWMA 2UUAQ 4LF7Q 1UE5A 3W1BA 1LM0A 4XTCS 3H3VI 4AQYQ 1K9MC 1VQ5A 3PO2H 1HZ9A 3GTJH 2WB1G 2QA4A 3RR5A 4Y52H 2K5VA 5C44H 3GTLH 1JT8A 1UEBA 2PQAA 3I2ZA 4R1JA 4DV4L 4KHPQ 2PNHA 1TWHH 1KHIA 1JJCB 2FXQA 4GN5A 4IPGA 3I4NH 4A3GH 5FJ8H 2NVYH 5C3EH 1N32L 1NMFA 3PUZA 3CCJA 1CSQA 3UDXA 3OTOL 3UDGA 2UXCL 1YBYA 2JA8H 3PO2G 2VQEL 2MO0A 3E0EA 1AE2A 3KFUA 4A3EG 2MFIA 2JA7H 2F4VL 3GO5A 3L7ZC 2YTVA 1UE1A 5FLMH 5C44G 1QVCA 5AJ3Q 5IYDG 3CMEA 1YJNA 4HJ9A 4IOCA 1HR0W 2B63H 4A3BH 4IOAA 1HNWL 1VQFA 1ASYA 4A3GG 3H0GG 1UE6A 4JI3L 3I4NG 1NJIC 5FJ8G 1XPRA 1TWAH 5M5YH 1A62A 1Q46A 2JEAI 4YWKA 3PCOB 2A8VA 4NXNL 4JI1L 4YHHL 2JA7G 3IRBA 1XMOQ 3CCLA 3G48A 5FLMG 3HOUH 4IFDI 2VUMG 2B63G 4JI2Q 4A3KH 1LUZA 2N3SA 2WFWA 3K8AA 4PMWA 1X9NA 3M85A 2VQFQ 3CW2C 4LUOA 4HJ8A 2OWOA 1X55A 5IP7G 4GKJQ 4GN3B 1IBML 4C3HH 3KF6A 1VQOA 1Q1BA 2NVQH 4A3CH 2EQSA 4NXML 3EN2A 1KRTA 4IJHA 3AFQA 2LXJA 3J7ZC 3L2PA 4DR7L 2UU9L 2PI2A 4DR6L 2QEXA 3GTGH 3HOWH 3A74A 3RLOA 3HKZE 4APVA 3RZDH 3HOUG 4DUYQ 2R7DA 1VQ8A 1E22A 5JEAG 3PUVA 2AHOB 4GS3A 4A3KG 3F1ZA 4BY7H 3CQZH 3PV0A 3TQYA 2KBNA 3CCEA 2XGTA 3NEMA 4A3CG 2BH2A 4MNOA 4P73A 1IBKL 3ER0A 3J7A5 3EIVA 2ES2A 2IX1A 3STBC 1WCMH 2VL6A 4LUVA 5IE8A 4LFAL 2R6GA 1HNWQ 1O7IA 3H3VH 4BY7G 3M9BA 3NENA 2B29A 4TVAB 1YITA 2NVXH 4DUZL 2WB1E 2UUBL 1CUKA 3CP0A 4X66Q 1L2FA 3U58A 4DV3L 5C0XJ 5K36G 1OXVA 5J3BA 1KL9A 3RLFA 1JJ2A 2KENA 4DR3Q 3GTPH 4JV5L 4LF4Q 4DV6L 4JI4L 4R4TA 4NPSA 4A3MG 3CC2A 4JBJA 4JI0L 4A93G 2VZAA 2D0OA 5M5XH 2UXBQ 4TQUS 1K73C 2VW9A 5ELOA 1HZAA 1FGUA 3Q8DA 4DPGA 3I55A 5LMUL 4GNXC 4LF9L 1T9HA 3J80i 4A3LH 3BU2A 2AMCB 5IP9H 5C4JH 1C7YA 1IZ6A 1HNXL 4NXMQ 2YTYA 2JA9A 3BZCA 4X65Q 4DR7Q 2HT1A 2I5MX 4JYAL 1PH9A 1P8LA 1N36L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I H;  5LMN L;  4QIW E;  3KDF A;  3S1R H;  1PV4 A;  4R4C A;  1VQK A;  3S1Q H;  3TEH B;  4UP7 A;  1E3P A;  1PYS B;  2ZM6 Q;  4JI7 L;  1H95 A;  1Y1V G;  4JI6 Q;  1IXR A;  1XNR L;  1EWI A;  1PH5 A;  1CSP A;  2QGQ A;  4QL5 A;  1E7Z A;  5E7N A;  3ULJ A;  3HOX H;  4B3S L;  4A3L G;  3PUW A;  1CKM A;  4QGU A;  2Q2H A;  3AQQ A;  4OX9 Q;  5IP9 G;  3HOV H;  1OXU A;  1WI5 A;  2NZO A;  1EUJ A;  4H02 A;  3G4S A;  2OTJ A;  1G6P A;  3J81 i;  1OTC A;  4DR4 Q;  4P72 A;  3M7N A;  4GLX A;  2V1C C;  5IWA L;  4JG2 A;  3S16 H;  1VQH A;  2E5L L;  3TS2 A;  1DGS A;  4GKK Q;  5H1S E;  1XMQ Q;  4HIM A;  1KXL A;  2JJQ A;  1J5E Q;  1IBL Q;  4NB3 A;  2D62 A;  3HOX G;  1QUQ A;  4MTN A;  2UUB Q;  1WFQ A;  1E1O A;  2WAQ E;  5BR8 L;  3HOV G;  1A63 A;  1XPO A;  2CWP A;  1N9W A;  2OQ0 A;  1B70 B;  2NVT H;  3DM3 A;  4QJF A;  2MO1 A;  1YI2 A;  1FL0 A;  3JAM c;  4GLV B;  3HOZ G;  4HJA A;  4A3E H;  3I4M G;  3CF5 A;  4UPA A;  1G29 1;  1LTL A;  4LF9 Q;  1XNQ Q;  1GO3 E;  3FHW A;  4OON A;  1PA6 A;  1RIP A;  2F52 A;  2K50 A;  1FJG L;  2BA0 A;  4Y7N H;  3S14 H;  5IYD H;  1GVP A;  4A3J G;  4LW1 A;  3AFP A;  3TRZ A;  3I56 A;  3H0G H;  1S40 A;  2ZTC A;  3UDF A;  1C9O A;  1VQI A;  5JEA J;  2DUD A;  3HOY H;  4JI5 L;  5LMN Q;  4DR5 L;  1V1Q A;  4C2M H;  1PH3 A;  1EFW A;  4B3T Q;  4YY3 Q;  4DV1 L;  2UXD L;  3M4O H;  4LF6 L;  3ERS X;  2YYZ A;  4GNX B;  2OTL A;  4OO1 I;  4WJ4 A;  3T1H L;  3M3Y H;  3CCR A;  3A0J A;  1SLJ A;  2VUM H;  1MJE A;  4LNQ A;  1N34 L;  3RLN A;  3UE0 A;  2GVA A;  1VS0 A;  3S15 H;  1CKN A;  4XIG S;  2ZJQ A;  3FKI G;  5IP7 H;  3KF6 B;  1XTD A;  4HIO A;  2HHH Q;  3HOY G;  3LGJ A;  4LFC L;  4JBK A;  1L1O A;  2ID0 A;  4A4I A;  2I5L X;  1PYB A;  4JCV E;  4LF8 Q;  5IYB G;  3S1M H;  4DV7 Q;  4BXX H;  4KHZ A;  4EX5 A;  4GNX A;  4PZ8 A;  1VQD A;  2UUC Q;  4DNI A;  2MQH A;  5BR8 Q;  5M3F H;  3PUY A;  4DR1 L;  1PHJ A;  3GDE A;  3BZK A;  4X62 L;  1QVG A;  2E2H H;  2VNU D;  1TWG H;  3JC6 6;  1VQC A;  1QZH A;  2ZTE A;  1VQL A;  1NE3 A;  2EIF A;  1A8V A;  4K0K L;  3CCS A;  2KHI A;  3SGI A;  4BXX G;  1Z47 A;  3S2H H;  1NBW A;  2CFM A;  4OWX B;  2JEB I;  2WAQ G;  3K7A H;  1P16 A;  1QVF A;  1QZG A;  3UE1 A;  1Y1W G;  2R92 H;  3F8T A;  4LFB L;  2CWA A;  4DV4 Q;  1PH2 A;  4POF A;  4JOI A;  5M3F G;  1N32 Q;  3CAM A;  2CCZ A;  4LF5 L;  3GD7 A;  1VQG A;  3OTO Q;  2UXC Q;  2JK8 A;  4DV1 Q;  2VQE Q;  1NY4 A;  4AYB G;  4PG3 A;  4LF6 Q;  2IY5 B;  2H5X A;  2HIV A;  2RCN A;  2N78 A;  4AIM A;  3KJP A;  4A3M H;  1HNZ L;  1Q1E A;  4A93 H;  4B3R L;  4DR2 L;  4P71 A;  1Q82 C;  1YIJ A;  3H15 A;  4IPD A;  3OYY A;  3PIO A;  1N34 Q;  3J80 c;  2R92 G;  2LXK A;  2I0Q A;  4BY1 H;  4JI3 Q;  2K4K A;  1HR0 L;  1I6H H;  4DKA C;  2BA1 A;  5HGQ A;  2JQO A;  4YCV A;  4LFC Q;  3GTK H;  3KF8 B;  1JE5 A;  1YJ9 A;  3U4Z A;  4JI8 L;  3S17 H;  3F2D A;  4O2D A;  4R4I A;  4NXN Q;  4JI1 Q;  1Y14 B;  5C4X H;  4YHH Q;  4JBW A;  2JA6 G;  3KDF B;  1A0I A;  1L1O C;  1N33 L;  2Z6K A;  1I5F A;  4IFD J;  2RHQ B;  2JA5 H;  1VQA A;  1YEZ A;  4DV0 L;  4X6A H;  1Y1V H;  1E24 A;  4BY1 G;  4ME3 A;  4C3J H;  4DAY B;  1VQN A;  2RHS B;  1U5K A;  4X62 Q;  2JE6 I;  2A19 A;  5GRO A;  3J81 c;  3CC7 A;  1IBM Q;  4GOP A;  2IT1 A;  3PO3 H;  4BBR H;  1HH2 P;  1B8A A;  1SE8 A;  1X3F A;  1TWF H;  1YHB A;  4L5S A;  2UU9 Q;  2YU9 H;  2Y0S G;  1C0A A;  5C4X G;  1J6Q A;  3PIP A;  4QY7 A;  2L15 A;  3NBH B;  3NEL A;  3D0F A;  5GQO A;  1EYG A;  2JA5 G;  1PH8 A;  3T1Y L;  1MJC A;  1SR3 A;  1TWC H;  2Q2I A;  3FP9 A;  2UUA L;  4LF7 L;  1QUQ B;  4IJL A;  4AQY L;  2GVB A;  4OO1 G;  4WJ3 M;  4JBM A;  2B3G A;  3PO3 G;  4BBR G;  1X56 A;  4L5Q A;  4OXP A;  4JOI C;  3W1G A;  3W5O A;  1S72 A;  1N8R C;  1IBK Q;  2WP8 J;  1X65 A;  2ZTD A;  4X64 L;  5GAE C;  4QQB X;  4KHP L;  1D7Q A;  4LFA Q;  5GAD C;  1I3Q H;  4LUZ A;  2HQL A;  4YCW A;  5M3M H;  1PH6 A;  3HOZ H;  2ALY B;  3L0O A;  1CKO A;  3I4M H;  3I7F A;  5IY0 A;  2IX0 A;  3EBE A;  4DUZ Q;  1VQ9 A;  2AWN A;  3K80 C;  2E8G A;  3F2C A;  2F3I A;  1Q86 C;  4A3J H;  4DV3 Q;  2XTI A;  3ULP A;  1WYD A;  1KRS A;  4DR6 Q;  2IHE A;  4A75 A;  4IPC A;  4DV6 Q;  4JV5 Q;  4UP9 A;  5AJ3 L;  3CPW A;  1SMX A;  3KYH C;  4JI4 Q;  4JI0 Q;  1BBW A;  4L5R C;  1N33 Q;  1LYL A;  4DV2 L;  3PF5 A;  2K75 A;  5M3M G;  3CCM A;  3CD6 A;  1G51 A;  1KAW A;  3E9I A;  1AH9 A;  3U50 C;  5LMU Q;  2E2J H;  4AYB E;  3OW2 A;  2AWO A;  1K3R A;  2Z6K C;  1YHQ A;  1K8G A;  1KD1 C;  5GAH C;  1CKN B;  1HNX Q;  4IPH A;  1XPU A;  3RN5 A;  3FKI H;  2LSS A;  1XMO L;  4LWC A;  4JYA Q;  5EAY A;  3GTO H;  4GOP C;  1N36 Q;  1L1O B;  4JI2 L;  4A3F H;  1MIU A;  5IT9 c;  1VQE A;  5IYB H;  4JC0 A;  3CCQ A;  4JI7 Q;  1XNR Q;  3KOJ A;  4GKJ L;  3CCV A;  1B7Y B;  2C35 B;  4KLK A;  1VQ7 A;  4B3S Q;  4OWW B;  2ZJR A;  5JJL A;  3ULL A;  4KI0 A;  4B3M L;  2PMZ E;  4HIK A;  1OXX K;  3A5Z B;  1VCI A;  3KLW A;  3J81 j;  1YZ6 A;  3S24 A;  1V43 A;  4X64 Q;  4DUY L;  4P74 A;  5FLX c;  5IWA Q;  4A3F G;  2E5L Q;  1JJG A;  2NZH A;  1OXT A;  4BA2 I;  2HIX A;  2R7F A;  4YWL A;  1IYJ B;  1XJV A;  1PVO A;  2VS1 A;  2Y0S E;  4HID A;  1Y1W H;  3BJU A;  4EQ5 A;  1EIF A;  1X6O A;  1V9P A;  1VQM A;  3RNU A;  2KCM A;  2CKZ B;  3JAM i;  3GTQ H;  1YVC A;  4PZ7 A;  3G71 A;  2K14 A;  3K81 C;  1E1T A;  4DV2 Q;  1PH7 A;  1WJJ A;  4R4O A;  2OCE A;  2Z0S A;  3PSI A;  5C3E G;  4X66 L;  1D8L A;  2MNA A;  2YV5 A;  1PFS A;  4R4Q A;  3U4V A;  5C0X I;  1JMC A;  1FJG Q;  2F4V Q;  2JA8 G;  4DR3 L;  2Q2U A;  4LF4 L;  1Q8K A;  4HJ5 A;  2DGY A;  1VQP A;  1R9T H;  2E2I H;  2GN5 A;  1GD7 A;  3CCU A;  1Q81 C;  2UXB L;  4JI5 Q;  1IL2 A;  4A3B G;  4DR5 Q;  2UXD Q;  2I5H A;  2AKW B;  3S1N H;  4AH6 A;  1OXS C;  4O0A A;  2JA6 H;  4A76 A;  1SFO H;  3T1H Q;  1X3E A;  3D31 A;  3I4O A;  5LMN W;  4FDB A;  1M90 C;  4RMF A;  4X65 L;  1I94 L;  4B3M Q;  1X3G A;  3HFZ B;  1WOC A;  5DLQ E;  1NTG A;  5M5W H;  2OQK A;  2R93 H;  3AYH B;  4GLA C;  1RL2 A;  3DLL A;  3K7U C;  4GOP B;  1GKH A;  2ZM6 L;  2ZJP A;  4JI6 L;  4RG1 A;  4P75 A;  1SRO A;  3CXC A;  3G6E A;  1YNX A;  3GTM H;  2N8N A;  3RZO H;  1UWV A;  1HZC A;  1X54 A;  4UY8 C;  4OX9 L;  3M4Q A;  1M1K C;  1L0W A;  1BBU A;  4DR4 L;  3ICE A;  1MKH A;  1KQS A;  3HOW G;  4DR1 Q;  1VQ6 A;  2R93 G;  5GAG C;  4IO9 A;  3F2B A;  2NN6 G;  3KJO A;  4A3I H;  4GKK L;  3PF4 A;  1XMQ L;  3VDY A;  4DK3 C;  4K0K Q;  1J5E L;  1I50 H;  1IBL L;  2N49 A;  3MEF A;  1U0L A;  1TXY A;  3M4P A;  4DK6 C;  3ZJY C;  2RF4 A;  4A3D H;  1HJP A;  1VQB A;  2ATW A;  4MZ9 A;  2EXD A;  4LFB Q;  2ASB A;  3HKS A;  3CPF A;  1PH1 A;  3A5U A;  4UP8 A;  2KHJ A;  4DV5 L;  4OWT B;  1WCM G;  1Z9F A;  4POG A;  4BBS H;  5JJK A;  4DAM A;  4LF5 Q;  4A3I G;  2BH8 A;  1YHA A;  3WWV A;  3MXN B;  1XNQ L;  3TS0 A;  3STB D;  1FVI A;  5IYC H;  1Q7Y C;  1HNZ Q;  4B3R Q;  4DR2 Q;  4A3D G;  5HY6 A;  1I94 Q;  2Q2T A;  1BKB A;  5JJI A;  1VQJ A;  1YJW A;  4B3T L;  1HR0 Q;  2K5N A;  1UE7 A;  1NMG A;  4YCU A;  4YY3 L;  1K0R A;  3K0X A;  4L5T A;  1PH4 A;  4BBS G;  1K83 H;  1VQ4 A;  4ALP A;  1EQQ A;  1KC8 C;  1HZB A;  4JI8 Q;  1GM5 A;  1Q12 A;  5IYC G;  2VY3 A;  1K8A C;  2R7Z H;  1JB7 A;  3HKZ G;  4DV0 Q;  2CQO A;  2K52 A;  1AE3 A;  1SN8 A;  2NN6 I;  3AEV A;  2D0P A;  4HJ7 A;  2HHH L;  3S2D H;  3CC4 A;  1ASZ A;  1SRU A;  2IHF A;  1EQR A;  2K5H A;  4LF8 L;  1W2B A;  5ELN A;  3PGZ A;  3PUX A;  4PZ6 A;  3CMA A;  4DV7 L;  1KIX A;  1BVS A;  1W3S A;  5C0X G;  1EOV A;  1S3O A;  2YTX A;  3RN2 A;  2UUC L;  3B6Y A;  2PQA B;  4GN4 B;  3TRE A;  3UDI A;  4BA1 I;  1EIY B;  3E9H A;  2VQF L;  2PI2 E;  2R7Z G;  4IFD G;  3T1Y Q;  4J15 A;  2A1A A;  2KCT A;  4DV5 Q;  4YWM A;  2UUA Q;  4LF7 Q;  1UE5 A;  3W1B A;  1LM0 A;  4XTC S;  3H3V I;  4AQY Q;  1K9M C;  1VQ5 A;  3PO2 H;  1HZ9 A;  3GTJ H;  2WB1 G;  2QA4 A;  3RR5 A;  4Y52 H;  2K5V A;  5C44 H;  3GTL H;  1JT8 A;  1UEB A;  2PQA A;  3I2Z A;  4R1J A;  4DV4 L;  4KHP Q;  2PNH A;  1TWH H;  1KHI A;  1JJC B;  2FXQ A;  4GN5 A;  4IPG A;  3I4N H;  4A3G H;  5FJ8 H;  2NVY H;  5C3E H;  1N32 L;  1NMF A;  3PUZ A;  3CCJ A;  1CSQ A;  3UDX A;  3OTO L;  3UDG A;  2UXC L;  1YBY A;  2JA8 H;  3PO2 G;  2VQE L;  2MO0 A;  3E0E A;  1AE2 A;  3KFU A;  4A3E G;  2MFI A;  2JA7 H;  2F4V L;  3GO5 A;  3L7Z C;  2YTV A;  1UE1 A;  5FLM H;  5C44 G;  1QVC A;  5AJ3 Q;  5IYD G;  3CME A;  1YJN A;  4HJ9 A;  4IOC A;  1HR0 W;  2B63 H;  4A3B H;  4IOA A;  1HNW L;  1VQF A;  1ASY A;  4A3G G;  3H0G G;  1UE6 A;  4JI3 L;  3I4N G;  1NJI C;  5FJ8 G;  1XPR A;  1TWA H;  5M5Y H;  1A62 A;  1Q46 A;  2JEA I;  4YWK A;  3PCO B;  2A8V A;  4NXN L;  4JI1 L;  4YHH L;  2JA7 G;  3IRB A;  1XMO Q;  3CCL A;  3G48 A;  5FLM G;  3HOU H;  4IFD I;  2VUM G;  2B63 G;  4JI2 Q;  4A3K H;  1LUZ A;  2N3S A;  2WFW A;  3K8A A;  4PMW A;  1X9N A;  3M85 A;  2VQF Q;  3CW2 C;  4LUO A;  4HJ8 A;  2OWO A;  1X55 A;  5IP7 G;  4GKJ Q;  4GN3 B;  1IBM L;  4C3H H;  3KF6 A;  1VQO A;  1Q1B A;  2NVQ H;  4A3C H;  2EQS A;  4NXM L;  3EN2 A;  1KRT A;  4IJH A;  3AFQ A;  2LXJ A;  3J7Z C;  3L2P A;  4DR7 L;  2UU9 L;  2PI2 A;  4DR6 L;  2QEX A;  3GTG H;  3HOW H;  3A74 A;  3RLO A;  3HKZ E;  4APV A;  3RZD H;  3HOU G;  4DUY Q;  2R7D A;  1VQ8 A;  1E22 A;  5JEA G;  3PUV A;  2AHO B;  4GS3 A;  4A3K G;  3F1Z A;  4BY7 H;  3CQZ H;  3PV0 A;  3TQY A;  2KBN A;  3CCE A;  2XGT A;  3NEM A;  4A3C G;  2BH2 A;  4MNO A;  4P73 A;  1IBK L;  3ER0 A;  3J7A 5;  3EIV A;  2ES2 A;  2IX1 A;  3STB C;  1WCM H;  2VL6 A;  4LUV A;  5IE8 A;  4LFA L;  2R6G A;  1HNW Q;  1O7I A;  3H3V H;  4BY7 G;  3M9B A;  3NEN A;  2B29 A;  4TVA B;  1YIT A;  2NVX H;  4DUZ L;  2WB1 E;  2UUB L;  1CUK A;  3CP0 A;  4X66 Q;  1L2F A;  3U58 A;  4DV3 L;  5C0X J;  5K36 G;  1OXV A;  5J3B A;  1KL9 A;  3RLF A;  1JJ2 A;  2KEN A;  4DR3 Q;  3GTP H;  4JV5 L;  4LF4 Q;  4DV6 L;  4JI4 L;  4R4T A;  4NPS A;  4A3M G;  3CC2 A;  4JBJ A;  4JI0 L;  4A93 G;  2VZA A;  2D0O A;  5M5X H;  2UXB Q;  4TQU S;  1K73 C;  2VW9 A;  5ELO A;  1HZA A;  1FGU A;  3Q8D A;  4DPG A;  3I55 A;  5LMU L;  4GNX C;  4LF9 L;  1T9H A;  3J80 i;  4A3L H;  3BU2 A;  2AMC B;  5IP9 H;  5C4J H;  1C7Y A;  1IZ6 A;  1HNX L;  4NXM Q;  2YTY A;  2JA9 A;  3BZC A;  4X65 Q;  4DR7 Q;  2HT1 A;  2I5M X;  4JYA L;  1PH9 A;  1P8L A;  1N36 L; 
#chains in the Genus database with same CATH topology
 1O7Z A;  4QIW E;  1VQK A;  1QJO A;  3S1Q H;  2ZM6 Q;  3EA6 A;  1PH5 A;  2QGQ A;  4QL5 A;  1E7Z A;  3HOX H;  1SE2 A;  1CKM A;  3PUW A;  3AQQ A;  1AP0 A;  1WTO A;  1OXU A;  2NZO A;  1EUJ A;  1JWU D;  4GLX A;  4JG2 A;  2Q8I B;  1TS3 A;  1BR9 A;  1RHP A;  4KKU A;  5D14 A;  2PPB C;  3AB9 A;  1UNS A;  3SE0 A;  4QJF A;  4G4K A;  2J4X A;  5KYL A;  4HJA A;  4IUP A;  1XNQ Q;  2RVL A;  1GO3 E;  3DWA A;  2BA0 A;  3DWP A;  4LW1 A;  3AFP A;  3TRZ A;  3MWY W;  1S40 A;  2ZTC A;  1C9O A;  1Y1W B;  1VQI A;  5JEA J;  2K5Q A;  3HOY H;  2CH4 A;  1V1Q A;  4DV1 L;  3M4O H;  2YYZ A;  4KV6 A;  1PRT C;  3I90 A;  5EKI A;  3M3Y H;  3EFX D;  1SLJ A;  2VUM H;  4LNQ A;  1N34 L;  5D3I B;  5M5Y B;  1BXT A;  2FMC A;  3C46 A;  1XTD A;  2C9O A;  2L0C A;  1ESR A;  4HIO A;  1K8O A;  1L1O A;  1PYB A;  4JCV E;  1R9T B;  2E2I B;  1FNU A;  1SNM A;  5IYB G;  4DV7 Q;  2EYH A;  4B08 A;  4IAL A;  4EX5 A;  3PIP 3;  4PZ8 A;  1VMC A;  3OIQ A;  4K5W A;  1SFO B;  1TU2 B;  1HTP A;  3NSW A;  1PHJ A;  1PFM A;  1S5E D;  4X62 L;  1QVG A;  3K59 A;  3GV3 A;  2RQX A;  2EYO A;  1E2W A;  1YNN C;  4HCS A;  3LNN A;  4HTH A;  2MP1 A;  2KHI A;  1CA6 A;  1STY A;  2CFM A;  5C4H A;  2JEB I;  2WAQ G;  1HA5 A;  1SYC A;  4JK1 C;  3UE1 A;  2R92 H;  3GTM B;  4LFB L;  4PMC A;  4POF A;  1DOL A;  1N32 Q;  2X6G A;  3TZU A;  2B2U C;  2UXC Q;  4CKE A;  3NTI A;  2H4O A;  1WCM B;  1NY4 A;  4AYB G;  4PG3 A;  2IY5 B;  1GUT A;  1SYB A;  1Q82 C;  5EPJ A;  3H15 A;  1I50 B;  3PIO A;  2WAC A;  1BCP F;  3J80 c;  2LXK A;  2L11 A;  4ZCK A;  1GXD C;  1WTX A;  3GTK H;  2EJF C;  4JI8 L;  4O2D A;  1PRT B;  4YHH Q;  1JOO A;  3KDF B;  2QIL A;  2NYZ D;  1I5F A;  4ID6 A;  1QNU A;  1JE4 A;  5KEE A;  2EYJ A;  3VYU A;  4DAY B;  2QW7 A;  3I8Z A;  3VYR A;  3R2I A;  1KLG D;  4HN7 A;  1U5K A;  3QR8 A;  5DM6 3;  3ONA B;  2IT1 A;  4GOP A;  4OO1 H;  4XT3 B;  5J22 A;  3PO3 H;  3CHB D;  1HH2 P;  3QIA A;  3DWQ A;  1TWF H;  1C0A A;  5C4X G;  1K83 B;  1ZEQ X;  1J6Q A;  2M2L A;  1PXU A;  1QE6 A;  3NBH B;  3NEL A;  4OHJ A;  1SR3 A;  4J1M A;  3BG3 A;  2R7Z B;  4JBM A;  4L5Q A;  3JAM L;  4OXP A;  5IIF A;  1N8R C;  5GAE C;  1D7Q A;  1I3Q H;  3NTK A;  2FJ2 A;  3I72 A;  2IX0 A;  3EBE A;  1VQ9 A;  3NTH A;  3K80 C;  3F2C A;  1RF2 D;  1KRS A;  3PO2 B;  2PO4 A;  1HPC A;  5AJ3 L;  1EY4 A;  3KYH C;  4JI0 Q;  1BBW A;  2K04 A;  4DV2 L;  1WTW A;  3D6C A;  1AH9 A;  5LMU Q;  3OMG A;  1TWH B;  1TS4 A;  4A3G B;  3I4N B;  3H3V C;  2Z6K C;  2HDL A;  5D3D A;  4DU9 A;  1HNX Q;  5DM7 3;  1XPU A;  3RN5 A;  2JA8 B;  5DNF A;  3QOJ A;  1N36 Q;  1XX8 A;  1SE3 A;  5IYB H;  5IT9 c;  3BDC A;  4JC0 A;  4A3B B;  1A6X A;  1DOK A;  2C35 B;  2ZJR A;  5IGB A;  1TWA B;  4HIK A;  1SAP A;  1VCI A;  3N6R A;  2B2W A;  3J81 j;  1WD1 A;  5FLX c;  5IWA Q;  1FNV A;  1OXT A;  4BA2 I;  2HIX A;  4A3K B;  4YWL A;  1IYJ B;  1XJV A;  2XNA C;  2VS1 A;  5IOC A;  1EIF A;  4CGY B;  2L4N A;  4PZ7 A;  1D5M C;  2KCN A;  3P1H A;  3A56 A;  2E76 C;  1E1T A;  1V1O A;  3PSI A;  2MNA A;  4X66 L;  1JMC A;  3CQZ B;  1FJG Q;  3UI2 A;  4DR3 L;  3IL8 A;  1B1Z A;  2DGY A;  2L55 A;  4RWS C;  2HUG A;  1BCP C;  4R9W A;  2UXB L;  1KLU D;  4R8N A;  2CQA A;  2K5W A;  2AKW B;  1OXS C;  2IL8 A;  4A76 A;  3D31 A;  1SBB B;  1YNJ C;  5LMN W;  4FDB A;  3X3M A;  4GLA C;  2ZM6 L;  2ZJP A;  3VYS A;  3CXC A;  3KLS A;  5M5X B;  1HZC A;  4KD4 A;  4UY8 C;  2EJM A;  1JB3 A;  1L0W A;  1R4Q B;  3HZX A;  1MKH A;  3ICE A;  3A7L A;  3HP3 A;  1KQS A;  3HOW G;  1DCZ A;  4HMI A;  1DXM A;  3MHB A;  4K0K Q;  2Z4H A;  3QB3 A;  3R2T A;  4JVZ A;  3S1Q B;  3MEF A;  1U0L A;  1TWC B;  2ATW A;  3O13 A;  3HOX B;  2EXD A;  2AUJ D;  3TME A;  3A5U A;  1LTG D;  4C1N K;  1WCM G;  4BBS H;  4OIJ A;  5I2Y A;  2BH8 A;  1YHA A;  2EY6 A;  4DNT B;  3MXN B;  3ND9 A;  3PQI A;  1XNQ L;  5IYC H;  1Q7Y C;  4B3R Q;  3V2T A;  1H9S B;  4XYO A;  1TS5 A;  2Q2T A;  4U67 3;  1BKB A;  2DN8 A;  1UUP A;  4CDE C;  1BCP B;  1JC7 A;  5CYU A;  2K5N A;  4YCU A;  4CKB A;  1HCZ A;  1VQ4 A;  1KC8 C;  1EQQ A;  5IGE A;  1DON A;  1HHV A;  1GM5 A;  1EY9 A;  1WTQ A;  3NWS A;  3U9S A;  5EBD A;  1K8A C;  2FMM A;  1RKN A;  2IW3 A;  1PTO D;  5C6A A;  1SRU A;  1W2B A;  1TS2 A;  4DV7 L;  3HOY B;  1W3S A;  1EOV A;  5E4W C;  3M4O B;  1O7Y A;  4GN4 B;  1HQM C;  4BA1 I;  4BWG B;  3M3Y B;  2R7Z G;  2VQF L;  2PI2 E;  2F0J A;  1GOZ A;  5A2Q L;  2VUM B;  2DNE A;  3T1Y Q;  5TSS A;  2KCT A;  2UUA Q;  1UE5 A;  1CQF A;  4AQY Q;  1K9M C;  1VQ5 A;  3TP7 A;  2WB1 G;  3H6M A;  1RCV D;  2K5V A;  4I7A A;  4FP5 D;  5I6W A;  3GTL H;  1UEB A;  4KHP Q;  3D4R A;  2EJG C;  3LX0 A;  1KHI A;  4GN5 A;  2FXQ A;  2FFK B;  1N32 L;  3PUZ A;  1CSQ A;  2UXC L;  1CA5 A;  4NW2 A;  2O4X A;  3PO2 G;  3SK8 A;  2MFI A;  1BQQ T;  1HR0 W;  3NBI A;  4IOA A;  1XWE A;  2VXW A;  3J80 L;  4A3G G;  1PTO H;  5AFW A;  3I4N G;  4G7H C;  2R92 B;  1A2U A;  1B2T A;  5M5Y H;  4ZUI A;  2JEA I;  3PCO B;  1KTK A;  3NUC A;  4YHH L;  5C3X A;  1X3Q A;  3IRB A;  4ZKB B;  4MN3 A;  5JEA H;  3TP8 A;  1PRT D;  1QB5 D;  1X55 A;  4GN3 B;  2NTS A;  4EQN A;  1WTV A;  3TP6 A;  1A2T A;  2L12 A;  3MEH A;  1QG7 A;  3IFT A;  3GTG H;  3HOW H;  3A74 A;  3RLO A;  3VA7 A;  1IYU A;  3GTK B;  4APV A;  3HRZ C;  3RZD H;  5HGT A;  4WFN 3;  4A3K G;  1LO5 D;  1AEX A;  4MIU A;  3TQY A;  3IFD A;  3J81 E;  3BYY B;  3PO3 B;  3EIV A;  1C8C A;  4EGV A;  1WCM H;  2VL6 A;  3I70 A;  1YNN D;  4QMG A;  3MFY A;  3VR2 A;  1EYD A;  2PNR C;  1TY0 A;  2B29 A;  1SYE A;  2NVX H;  4RAU C;  2UUB L;  4ZLT F;  1CUK A;  1L2F A;  5CV7 A;  5EKL A;  3U58 A;  1C48 A;  1RJT A;  4CKC A;  1JCK B;  4A3M G;  4JI0 L;  1CHP D;  3MXP A;  4FXG C;  4L8J A;  3BZD B;  2VW9 A;  2DY8 A;  4DGZ A;  1FGU A;  5LMU L;  1I3Q B;  2F0V A;  1EWC A;  4HED A;  3BVZ A;  1IZ6 A;  1HNX L;  2E74 C;  3BZC A;  2KJX A;  2I07 B;  4DR6 Q;  1N36 L;  1H9R A;  2AQ2 B;  2NB0 A;  1PYS B;  1Y1V G;  5EPL A;  5IT9 L;  1CSP A;  2OXP A;  2K7V A;  4A3L G;  2MPM A;  5IP9 G;  4H02 A;  3E0J A;  3TZD A;  5EJW A;  2B2T A;  3M7N A;  1CHQ D;  5IWA L;  3S16 H;  2K33 A;  1VQH A;  5FLX L;  3TS2 A;  4ODG A;  1DGS A;  1KDA A;  3MAQ A;  4UHV A;  4HIM A;  1KXL A;  1J5E Q;  2SDF A;  4NB3 A;  3HOX G;  5E1F A;  1NSN S;  1E1O A;  2WAQ E;  5BR8 L;  3URY A;  1A63 A;  5ELC A;  4WRD A;  2CWP A;  3W3A A;  1B70 B;  4U68 A;  4FO2 A;  2MO1 A;  4N9T A;  1YI2 A;  3MA2 B;  3JAM c;  2F0W A;  4GLV B;  3OWE B;  1PFB A;  4WJW A;  1E2Z A;  4LF9 Q;  3PIO 3;  1FJG L;  1RIP A;  1LTS D;  5C3E B;  3S14 H;  4A3J G;  2F0S A;  5ELF A;  3UDF A;  1UAP A;  2F0D A;  3QOL A;  5LMN Q;  1PH3 A;  4LF6 L;  2OTL A;  4XXE A;  2A6E C;  2XWJ B;  4AYB B;  3CCR A;  5I2X A;  4DXG A;  1MJE A;  1PZK D;  3RLN A;  3UE0 A;  1B3Q A;  2WIN B;  2BDO A;  3FKI G;  3KF6 B;  1ZXT A;  2HHH Q;  2AQ3 B;  3HOY G;  4FVM A;  2B8G A;  4JBK A;  2I5L X;  2RCF A;  3S1M H;  2N88 A;  4BXX H;  4RKB A;  3H91 A;  2UUC Q;  4DNI A;  5M3F H;  1I4Q A;  3BZK A;  3KBG A;  4IUV A;  2ENB A;  2EYL A;  1QZH A;  2ZTE A;  1NE3 A;  4K0K L;  4DK0 A;  4N8X 1;  1Z47 A;  3N52 A;  5D65 A;  4NKL A;  3K7A H;  1P16 A;  2F0M A;  3F8T A;  1M4V A;  1Y8O B;  2CWA A;  1AFP A;  5CMD A;  1PH2 A;  1CI3 M;  4JOI A;  2KED A;  5CBA E;  3SR1 A;  3U9O A;  3OTO Q;  1SYG A;  3P20 A;  4FXK C;  5I9O A;  1MI2 A;  4A3M H;  4B3R L;  1Q1E A;  5FKA C;  2R92 G;  4BY1 H;  1STB A;  3Q6S A;  1JOR A;  1LTI D;  5CGK A;  4IQZ A;  4YCV A;  4LFC Q;  3KF8 B;  2B2W C;  4Z9C B;  3F2D A;  4BBS B;  4NXN Q;  3A8I E;  1LAB A;  1BCP D;  4JBW A;  1A0I A;  1QWY A;  2JA5 H;  1MHW C;  1K8M A;  4X6A H;  1Y1V H;  1E24 A;  4ME3 A;  2RHS B;  1V1P A;  1YNJ D;  3OOC A;  1B8A A;  1SE8 A;  1X3F A;  1YHB A;  5BN3 A;  3CKI B;  4WOR A;  4QY7 A;  2L15 A;  1EYG A;  1PH8 A;  3T1Y L;  1ROD A;  4V0B A;  1TWC H;  2Q2I A;  3FP9 A;  2UUA L;  1QUQ B;  4IJL A;  5NUC A;  4AQY L;  2GVB A;  5A35 A;  4OO1 G;  3PO3 G;  3OIP A;  3BDL A;  3G6J B;  3HEJ A;  2KOL A;  3W5O A;  4B9X A;  2RDH A;  2M9V A;  4QQB X;  4KHP L;  4KTA A;  5GAD C;  4FYD A;  1PH6 A;  5C5L A;  3L0O A;  1TII D;  2PZW A;  1CZW A;  3K5M A;  1TT2 A;  5IY0 A;  4I7Z C;  2E8G A;  2F3V A;  5K5P A;  2QDB A;  4A3J H;  2DJG C;  2F0N A;  1B9M A;  3JAM E;  2PZT A;  4JPB W;  5JPM C;  3ULP A;  1WYD A;  4IPC A;  4UP9 A;  4NDX A;  1N33 Q;  3K58 A;  3HGB A;  5JPN C;  2K75 A;  3PF5 A;  3GTL B;  1WD0 A;  1G51 A;  1KAW A;  1DYQ A;  3U50 C;  1LTA D;  3OW2 A;  1G91 A;  1JWS D;  1K3R A;  1YHQ A;  4QIW B;  1KD1 C;  1CKN B;  3FKI H;  1D1K A;  3GTO H;  4Q5V A;  3CRL C;  4A3F H;  1SYF A;  1MIU A;  3CCQ A;  3KOJ A;  2V4D A;  3CCV A;  4B3S Q;  1PTO B;  4H7B A;  3ULL A;  1NAP A;  3SEB A;  1JOK A;  4B3M L;  4OGQ C;  4K8J A;  3C1F A;  1YZ6 A;  1AZQ A;  2ZXP A;  4X64 Q;  5E4X A;  2E5L Q;  3RMH A;  2D9U A;  3ND8 A;  2K28 A;  2Y0S E;  4HID A;  4HAE A;  4HMJ A;  1X6O A;  2EE1 A;  2DY7 A;  3GTQ H;  4FF3 A;  2CH4 W;  3GTG B;  3V96 A;  3HOW B;  3RZD B;  1Y69 U;  5C3E G;  1D8L A;  3ITP A;  5FO9 B;  5C0X I;  1BUV T;  1F9S A;  2AUK A;  1Q8K A;  4HJ5 A;  4F87 A;  1GD7 A;  1Q81 C;  1AN8 A;  4JI5 Q;  1IL2 A;  2UXD Q;  4J6H A;  3S1N H;  1Q8I A;  4O0A A;  1ET6 A;  5FOB B;  5T1I A;  4V19 0;  2NVX B;  1M90 C;  4RMF A;  1I94 L;  3CU7 A;  3HFZ B;  4CJ1 B;  5M5W H;  1O80 A;  3Q23 A;  4P75 A;  1SRO A;  1NUC A;  3GP7 A;  1UWV A;  4ZUJ A;  4G7O C;  3M4Q A;  4KY5 A;  2Z9H A;  4K6D A;  4A3I H;  1STA A;  3NPP A;  3VDY A;  2XSC A;  1J5E L;  3K5L A;  2N49 A;  1TXY A;  5EQ0 A;  5C4Z A;  2RF4 A;  1HJP A;  1VQB A;  4MHE A;  5IGD A;  4DV5 L;  1GJX A;  4POG A;  4E6I A;  4X3U A;  2LY7 A;  3E5S A;  1I4P A;  3S16 B;  1FVI A;  2OF1 A;  1HNZ Q;  2WB1 B;  4DR2 Q;  1T5E A;  1EWH A;  2B2Y A;  1D1I A;  2FIN B;  5ELD A;  4HR7 B;  1VQJ A;  1GUW A;  5LHY 1;  1UE7 A;  4BBS G;  1K0R A;  4TKO B;  5DEH A;  1JIC A;  4RGN A;  5J1Z A;  1Q12 A;  2RA4 A;  5IYC G;  4ZQ3 A;  1SJE D;  2EYP A;  1XTC D;  3L9A X;  4RFB A;  3HKZ G;  4DV0 Q;  3M7G A;  3S14 B;  2HHH L;  5C5M A;  3VR6 A;  3CC4 A;  4C3I G;  2DJF C;  1EQR A;  5CR3 A;  3CMA A;  3FDT A;  5KND A;  4CDF C;  1FR3 A;  3OWF A;  2UUC L;  3KBX A;  1H9M A;  1DJR D;  3E9H A;  1PMR A;  2SNM A;  4J15 A;  1LAC A;  1T5X D;  4LF7 Q;  1S5D D;  1HZ9 A;  4G57 A;  1JT8 A;  3S1M B;  3SXH A;  3I2Z A;  4NP5 A;  5A2Q E;  2NVY H;  5C3E H;  1FGB D;  1NMF A;  3CCJ A;  3E3X A;  4CDD C;  3UDX A;  3OTO L;  2VB3 X;  1YBY A;  3K0Y A;  5M3F B;  3E0E A;  2F1M A;  4DXF A;  2JP1 A;  2JA7 H;  5ELE A;  3T53 B;  2YTV A;  1NCV A;  3QWN A;  5FLM H;  1QVC A;  2B63 H;  1SDF A;  2J0T D;  3CME A;  2L9H A;  1HNW L;  1ET9 A;  1EY7 A;  1VQF A;  3DEP A;  3EJI A;  4MTK A;  3H0G G;  1UE6 A;  3K7A B;  3I73 A;  4N8F A;  1GUN A;  4H13 C;  4CDC C;  2F0T A;  1A62 A;  1Q46 A;  1H9J A;  4NXN L;  2B2T C;  4IFD I;  3HOU H;  1I4H A;  1EQV A;  4PMW A;  2WFW A;  3K8A A;  3J80 E;  1JQY D;  4A3M B;  1B4O A;  3M85 A;  1X9N A;  1TQO A;  2A6E D;  4HJ8 A;  5IP7 G;  4GKJ Q;  4BY1 B;  4C3H H;  1SNP A;  2NVQ H;  4NXM L;  1KRT A;  4X3T A;  2LXJ A;  2QEX A;  1TVX A;  2SOB A;  2VB2 X;  1SNQ A;  4DA2 A;  2EPB A;  1VQ8 A;  1IKM A;  3P75 A;  5JEA G;  2AHO B;  2XN9 C;  4KY7 A;  2JA5 B;  1Y1V B;  1BF4 A;  1ILQ A;  2RSO A;  4IUN A;  2D2C C;  1G8Z D;  3J7A 5;  5LL6 S;  2ES2 A;  2IX1 A;  3STB C;  4K6L A;  4LUV A;  1Q90 A;  3R3O A;  1F77 A;  2X69 A;  1SMY C;  1C4Q A;  1JOQ A;  3NEN A;  3FEW X;  3M9B A;  2ICE C;  1I6V C;  2K03 A;  4ABN A;  3CP0 A;  1BO0 A;  5C0X J;  5J3B A;  1KL9 A;  2JYO A;  3RLF A;  4LF4 Q;  4KKT A;  1W6J A;  1K0S A;  2L1B A;  3OHX C;  3VR5 A;  4TQU S;  1K73 C;  3P7J A;  5ELO A;  3BU2 A;  2AMC B;  2YTY A;  4PMB A;  4N9P A;  4DR7 Q;  4A3J B;  4C3I H;  3KDF A;  3S1R H;  2BE5 C;  2Q8R E;  3TEH B;  1E3P A;  1K3B C;  1IXR A;  2EXZ A;  4DAY A;  5E7N A;  2XRQ D;  4B3S L;  5COY A;  1QCB D;  2Q2H A;  4OX9 Q;  4OL7 A;  3HOV H;  2OTJ A;  1OTC A;  2SEB D;  4P72 A;  3X3N A;  5T1G A;  3OSO A;  2OEO A;  3FKI B;  2E5L L;  4RHR A;  3NBH A;  3GTO B;  4GKK Q;  5IT9 E;  1XMQ Q;  2JJQ A;  4A3F B;  2EY1 A;  4QCL A;  4MTN A;  1WFQ A;  2HCC A;  1XPO A;  1EY8 A;  1N9W A;  1F9R A;  2NVT H;  1CQV A;  4QB4 A;  5FLX E;  1FL0 A;  3HOZ G;  3TP5 A;  3D3R A;  4JW0 A;  3CF5 A;  4UPA A;  4G7Z C;  3FHW A;  4OON A;  1PA6 A;  2F52 A;  2K50 A;  4Y7N H;  1GVP A;  2B2U A;  4F7X A;  3I56 A;  3H0G H;  1KAB A;  4DN4 M;  1KNE A;  2DUD A;  4JI5 L;  2UXD L;  4C2M H;  1EFW A;  1D2B A;  4DAP A;  3GTQ B;  2PCF B;  4WJ4 A;  1II3 A;  2XVS A;  3RUZ A;  1H9K A;  2GVA A;  2JSO A;  1VS0 A;  3S15 H;  2F3W A;  1L0X B;  1EL0 A;  4K5V A;  2Q8T A;  5IP7 H;  5IGF A;  2ID0 A;  2CHB D;  3D8G A;  4GNX A;  1VQD A;  3S1N B;  1U4P A;  3K57 A;  2PMZ B;  3GDE A;  1PYW D;  1B50 A;  2E2H H;  2VNU D;  1TWG H;  3JC6 6;  1VQC A;  5M5W B;  4CJ2 C;  1VQL A;  2EIF A;  5EKK A;  3SGI A;  4BXX G;  1NBW A;  4OWX B;  3ERO A;  1G2T A;  2B2V A;  2G9H D;  4RHS A;  2EOT A;  1XXG A;  5M3F G;  3NQI A;  1EY6 A;  3CAM A;  3GD7 A;  2JK8 A;  2E75 C;  4DV1 Q;  3TDQ A;  2ZXO A;  1S5F D;  1TR5 A;  2N78 A;  4AIM A;  3KJP A;  4A3I B;  1HNZ L;  4DR2 L;  1YIJ A;  3LWU A;  1SE4 A;  3SVM A;  5IGG A;  1N34 Q;  2A68 D;  1LTT D;  2RSN A;  4DKA C;  2BA1 A;  1I6H H;  2NTT A;  2JQO A;  4O42 A;  4RCO A;  3U4Z A;  3D4W A;  1YJ9 A;  3S17 H;  4R4I A;  4XYQ A;  4JI1 Q;  2NBF A;  2JA6 G;  3E6Z X;  1KAA A;  4EQO A;  3KLR A;  1L1O C;  4IFD J;  3K6O A;  2Z6K A;  2K01 A;  4DV0 L;  1OO9 B;  2BOS A;  4BY1 G;  2LKV A;  1RD9 D;  4X62 Q;  3CC7 A;  1DD2 A;  4BBR H;  2SNS A;  3BVM A;  2QKI C;  4ULL A;  3K5O A;  3D0F A;  2F0U A;  2JA5 G;  5I9P A;  1GHK A;  1MJC A;  2KEE A;  4LF7 L;  5CV6 A;  4WJ3 M;  2B3G A;  3GQB A;  5CBE E;  1L0Y B;  5FK9 C;  3C2P A;  4LFA Q;  4OEL B;  2HQL A;  5M3M H;  1ENA A;  3HOZ H;  2ALY B;  1CKO A;  5M9O A;  4KJN A;  3I7F A;  4DUZ Q;  1IHZ A;  1NR2 A;  2F3I A;  2KHS A;  4ZKC B;  2CW0 D;  1W6K A;  1H95 A;  4DV6 Q;  1I4G A;  4JI4 Q;  1A3V A;  4CHT B;  1A3U A;  1H9S A;  1LYL A;  1S5B D;  3CCM A;  3CD6 A;  2RBM A;  2E2J H;  4AYB E;  3OMC A;  5FO7 B;  1K8G A;  2QDL A;  2KA7 A;  2NVY B;  5GAH C;  2F0P A;  4LMQ D;  2BDN A;  3TN2 A;  4JYA Q;  4GOP C;  1L1O B;  2JA7 B;  4KMU C;  3FVQ A;  1ENF A;  4DFA A;  4JI7 Q;  1EEI D;  1XNR Q;  2B63 B;  4GKJ L;  4IUQ A;  4ZYS A;  4OIK A;  4OWW B;  4KI0 A;  3KLW A;  2WV6 D;  5KNC A;  4A3F G;  4M1U B;  2WKD A;  4X3S A;  2NZH A;  3HOU B;  4ME5 A;  2HD3 A;  2LMC B;  1AZP A;  3T16 A;  3BJU A;  1PDQ A;  4C3H B;  2F4I A;  1VQM A;  1J9O A;  2NVQ B;  4ILW A;  2CKZ B;  2KCM A;  1SEB D;  1XYI A;  1YVC A;  2J7Z A;  1ESF A;  2K14 A;  4ZK9 B;  1QOH A;  4DV2 Q;  2D5D A;  3TBI B;  3U4V A;  1G6Z A;  2P5Z X;  1HFG A;  2F4V Q;  1D6E C;  2Q2U A;  1J8I A;  4LF4 L;  1VQP A;  1IKL A;  3MC0 B;  1Y8N B;  1KDB A;  1QIL A;  4L6T B;  4DR5 Q;  4A93 B;  2E2D C;  3DUZ A;  3I91 A;  2R3Z A;  4BS9 A;  2JA6 H;  3K5N A;  3T1H Q;  1LT6 D;  1X3E A;  1E2V A;  5DLQ E;  2OQK A;  5EBC A;  3AYH B;  2R93 H;  1RL2 A;  4GOP B;  4RGO S;  4DF7 A;  2C5C A;  4I65 A;  4RG1 A;  3G6E A;  3QG1 A;  3RZO H;  1X54 A;  1EZ6 A;  4OX9 L;  1VF5 C;  4DR1 Q;  1VQ6 A;  5GAG C;  3HKZ B;  4IO9 A;  2IJ0 A;  5KGU A;  4GKK L;  4FF1 A;  1XMQ L;  4C3I B;  5J39 A;  3S1R B;  3NWT A;  1F2Z A;  3SK6 A;  3M4Y A;  1MBY A;  3ZJY C;  4A3D H;  3GV6 A;  2G5D A;  4FXD A;  4F8M A;  4MZ9 A;  3A8J E;  3HKS A;  3CPF A;  1SND A;  2KHJ A;  3HOV B;  4LJZ C;  4OWT B;  1F2Y A;  1S4Z A;  1GHJ A;  1Z9F A;  4DAM A;  4LF5 Q;  4A3I G;  3STB D;  1SMY D;  3I4M B;  4RCN A;  5HY6 A;  3LWE A;  1GUO A;  2KVM A;  5JJI A;  1STE A;  2KCC A;  2ZT9 C;  1YJW A;  1HR0 Q;  4KN7 C;  4XT1 B;  1PH4 A;  1EZ8 A;  4L5T A;  4ALP A;  5C0X H;  1HZB A;  2NVT B;  4P2C B;  2KUM A;  5FO8 B;  3NXW A;  1VMP A;  2MUY A;  1JB7 A;  2CQO A;  2K52 A;  3S2D H;  2NN6 I;  4QUF A;  1EOT A;  4Y7N B;  4HJ7 A;  1MGS A;  1ASZ A;  1KNA A;  2H1E A;  3CRK C;  3H0G B;  2F0Q A;  3NK9 A;  5IOD A;  3PGZ A;  1BVS A;  4C2M B;  1S3O A;  3ERQ A;  2YTX A;  1ZYR C;  4R8I A;  1HRJ A;  3B6Y A;  2BE5 D;  4EQP A;  5BN4 A;  2DNC A;  1EYA A;  2RDG A;  1EIY B;  2MHV A;  4IFD G;  3I4L A;  2A1A A;  5JVH 3;  3S15 B;  3W1B A;  1LM0 A;  3H3V I;  3GTJ H;  1DM0 B;  3RR5 A;  3SK5 A;  4Y52 H;  5C44 H;  3Q24 A;  2PQA A;  4XQJ A;  2F0L A;  4HCE A;  2QCP X;  5FJ8 H;  1U4R A;  2EVB A;  2PW7 A;  2E2H B;  1TWG B;  4A3E G;  5G3L F;  2IPK D;  3NHH A;  5CV8 A;  1U4L A;  5IYD G;  4HJ9 A;  5KIX A;  4IOC A;  4XDX A;  1NR4 A;  1NJI C;  2K32 A;  2A73 B;  2A68 C;  2WII B;  4KD3 A;  4YWK A;  2A8V A;  2JXM B;  4JI1 L;  2QF7 A;  1LT5 D;  2JA7 G;  1Z7T A;  1XMO Q;  3G48 A;  5FLM G;  4C1N I;  3J7Y W;  2B63 G;  4JI2 Q;  2VQF Q;  4H44 C;  2Z6B A;  2A6H C;  4LUO A;  1WVL A;  3KF6 A;  4PQX A;  1Q1B A;  1VQO A;  4A3C H;  3T51 B;  3AFQ A;  1I6H B;  3L2P A;  1STH A;  4DR6 L;  1ENC A;  1LLR D;  3S17 B;  3HOU G;  4DUY Q;  2Y0S B;  1E22 A;  4GS3 A;  4K2K A;  4BY7 H;  3PV0 A;  2KBN A;  1B53 A;  2HCI A;  3HS0 C;  4C3H G;  3CCE A;  2XGT A;  1SYD A;  2ZXR A;  3NEM A;  5K36 H;  1DZ1 A;  4MNO A;  4RKL A;  5DAU A;  3ER0 A;  1CZG A;  4BBR B;  4LFA L;  1RTO A;  3IAY A;  2F0K A;  1PZJ D;  3SHL A;  2NWG A;  4DUZ L;  2WB1 E;  3DEO A;  2EYF A;  1TKW B;  2NZ1 D;  1OXV A;  2MGS A;  2F0G A;  3VYT A;  2CW0 C;  4DV6 L;  4JI4 L;  4R4T A;  4NPS A;  4A93 G;  4JBJ A;  2XIW A;  1KDC A;  1R4P B;  5CC4 A;  4C56 C;  3I55 A;  1HZA A;  3Q8D A;  4GNX C;  4LF9 L;  3BVG A;  5M3M B;  1T9H A;  1VDZ A;  3HOZ B;  2EYM A;  5C4J H;  5F2D A;  3KF8 A;  3MXG A;  4X65 Q;  4KHV A;  4JYA L;  4DK1 A;  1PH9 A;  1P8L A;  4K5X A;  5LMN L;  1PV4 A;  4R4C A;  4UP7 A;  1LTR D;  4JI7 L;  1LT3 D;  4JI6 Q;  4C3J G;  1XNR L;  3A55 A;  1EWI A;  1O7L A;  3ULJ A;  2B2V C;  4QGU A;  2E2J B;  3G4S A;  1WI5 A;  4IFD H;  1G6P A;  3J81 i;  4DR4 Q;  2V1C C;  3Q0A A;  2F03 A;  3KK7 A;  1DOM A;  2F0O A;  4RA8 A;  1Z6H A;  5JVG 3;  5H1S E;  4PNY A;  3FPP A;  1IBL Q;  2A74 C;  5JAV A;  2D62 A;  3AMU A;  1QUQ A;  2UUB Q;  1EYC A;  1F2M A;  1CFM A;  5E3F A;  3HOV G;  2OQ0 A;  3DM3 A;  1I4R A;  4A3E H;  3I4M G;  1G29 1;  1LTL A;  3T13 A;  2F4V L;  5IYD H;  4KKS A;  5EPK A;  2NUC A;  4GZY C;  2OT2 A;  3MZ5 A;  5JJZ A;  1U4M A;  2JN4 A;  3D6W A;  4DR5 L;  4UAI A;  4B3T Q;  4YY3 Q;  1CM9 A;  3NE5 B;  3ERS X;  4GNX B;  1RTN A;  4OO1 I;  3T1H L;  1QNK A;  1I4X A;  3A0J A;  3EQL C;  4M8A A;  2F0H A;  1CKN A;  4IUU A;  4XIG S;  2ZJQ A;  3WOE A;  2PQE A;  4KK7 A;  2Z8L A;  4XQQ A;  3DMU A;  2XRS D;  1EEF D;  3LGJ A;  4LFC L;  4A4I A;  1BBX C;  4LF8 Q;  4KHZ A;  1O78 A;  4TSS A;  2A69 C;  2JA6 B;  2MQH A;  5BR8 Q;  1ASY A;  3J7A V;  1IW7 C;  3PUY A;  4DR1 L;  1FYC A;  1WTR A;  5I4D A;  3KUP A;  2R93 B;  2ICI A;  1A8V A;  3CCS A;  3ZYY X;  4UDU C;  3S2H H;  2PYK A;  3R93 A;  2HQE A;  3C3L A;  4NMZ A;  3VA5 A;  1QVF A;  1QZG A;  1Y1W G;  3RZO B;  4IUR A;  4DV4 Q;  2F0I A;  2CCZ A;  4LF5 L;  1AW7 A;  1VQG A;  2BCO A;  2VQE Q;  4LF6 Q;  2K05 A;  2H5X A;  2HIV A;  2RCN A;  3EVQ A;  1IYV A;  4A93 H;  2EZV A;  4P71 A;  4IPD A;  3OYY A;  1D5X C;  5ISR A;  2I0Q A;  4LAA A;  4A3D B;  4JI3 Q;  2K4K A;  1HR0 L;  2Z4I A;  1IL8 A;  4KJO A;  5HGQ A;  3GTP B;  1JE5 A;  5C4X H;  1Y14 B;  2L5T A;  1N33 L;  2RHQ B;  3DHQ A;  2IWH A;  1VQA A;  1YEZ A;  4X3K A;  2O5J C;  4C3J H;  5CV5 A;  1VQN A;  2RKS A;  3L3O C;  5IGC A;  1MD2 D;  2A19 A;  2JE6 I;  3PMF A;  4K14 A;  5GRO A;  3J81 c;  4K2L A;  1IBM Q;  1MSG A;  3I3C A;  3T4A C;  4L5S A;  2UU9 Q;  2YU9 H;  2Y0S G;  4L63 B;  3PIP A;  5GQO A;  1ONL A;  2KEC A;  3S2D B;  4BBR G;  1X56 A;  4JOI C;  3W1G A;  1S72 A;  1IBK Q;  2WP8 J;  1X65 A;  2ZTD A;  4X64 L;  4ZRZ A;  1ML0 D;  4LUZ A;  4YCW A;  2R61 A;  3T56 B;  2O5I C;  3I4M H;  1B9N A;  1EIG A;  2AWN A;  1Q86 C;  4DV3 Q;  2XTI A;  4HSV A;  2MJ8 A;  1JR0 D;  2IHE A;  4A75 A;  3GTJ B;  4JV5 Q;  3H94 A;  3CPW A;  1SMX A;  4HSP A;  4L5R C;  3BYT B;  5M3M G;  5C44 B;  3MXU A;  3E9I A;  1V8Q A;  2AWO A;  3HG9 A;  2TMP A;  1LT4 D;  4IPH A;  5ELB A;  2M00 A;  2LSS A;  1XMO L;  4LWC A;  2K5D A;  5EAY A;  1Y8P B;  4JI2 L;  3OW7 A;  2CVR A;  4FNF A;  1SJH D;  3A54 A;  1B44 D;  1VQE A;  4YIJ A;  4ZAI A;  1B7Y B;  5HUR A;  4KLK A;  1VQ7 A;  5JJL A;  1F2L A;  1HUM A;  2PMZ E;  1OXX K;  3A5Z B;  3BDO A;  2WKC A;  1BDO A;  3FRP B;  3S24 A;  4TRD A;  3A7A B;  1V43 A;  4DUY L;  4P74 A;  3QJY A;  1U9R A;  3NP8 A;  1GUG A;  3W2D A;  1JJG A;  1ZYR D;  1HTL D;  1M8A A;  2R7F A;  4RH6 A;  1A3T A;  1PZI D;  3FMC A;  1PVO A;  1Y1W H;  4EQ5 A;  1ZKO A;  1V9P A;  3RNU A;  4O1N A;  3JAM i;  5BN5 A;  3G71 A;  3K81 C;  1SSO A;  3F2U A;  1PH7 A;  1WJJ A;  4R4O A;  2OCE A;  2Z0S A;  2YV5 A;  1PFS A;  4R4Q A;  4BY7 B;  2JA8 G;  1NNX A;  1BNZ A;  4XQN A;  1UEA B;  2F0E A;  1R9T H;  2E2I H;  2GN5 A;  3CCU A;  4A3B G;  2I5H A;  1CT1 D;  1BOS A;  4AH6 A;  3DM1 A;  1SFO H;  3I4O A;  4KN4 C;  1PFN A;  4X65 L;  1S5C D;  4B3M Q;  1X3G A;  1F9P A;  5KRU A;  1V1P B;  1WOC A;  4F88 A;  1NTG A;  3DLL A;  3K7U C;  3A8K E;  1GKH A;  3MTS A;  5KNB A;  4JI6 L;  4B9W A;  2O2L D;  1EFI D;  3VR4 A;  4CBV A;  2QEJ C;  4EVO A;  1YNX A;  3J7A F;  2AQ1 B;  3GTM H;  2N8N A;  1LTB D;  1M1K C;  1BBU A;  4DR4 L;  1CK1 A;  2A6H D;  2EY2 A;  1B3A A;  5C4J B;  1X3P A;  2R93 G;  1TWF B;  2I46 A;  3F2B A;  2PW5 A;  2NN6 G;  3KJO A;  4S3S A;  3PF4 A;  4DK3 C;  1SXT A;  1I50 H;  3S9W A;  1IBL L;  1HQR D;  3M4P A;  4IUT A;  1ICF B;  4DK6 C;  4LFB Q;  2ASB A;  1PH1 A;  4UP8 A;  1GUS A;  5JJK A;  3SK4 A;  1Q3L A;  3WWV A;  3TS0 A;  2X6L A;  4A3D G;  1I94 Q;  3H09 A;  1D5Z C;  4RGM A;  1JWM D;  4B3T L;  5I6Y A;  4YY3 L;  1NMG A;  3K0X A;  1PTO F;  1K83 H;  4JI8 Q;  5KYI A;  1EQT A;  4IZ8 A;  3Q22 A;  3C1E A;  3MXN A;  4KY6 A;  4A3E B;  2VY3 A;  2IX3 A;  1STG A;  2R7Z H;  3AEV A;  3QO2 A;  1AE3 A;  1SN8 A;  1EIH A;  2D0P A;  1HUN A;  2IHF A;  2K5H A;  4LF8 L;  5CV4 A;  5ELN A;  3PUX A;  4PZ6 A;  5L37 A;  1KIX A;  2GA4 B;  5C0X G;  4DAV A;  1F9Q A;  3RN2 A;  4DNR B;  2PQA B;  3TRE A;  3UDI A;  3TSS A;  2KQ3 A;  1CTM A;  3IKJ A;  2LFN A;  4QUC A;  4DV5 Q;  1FD7 D;  4YWM A;  4XTC S;  2B8F A;  3PO2 H;  1FNW A;  1RDP D;  2QA4 A;  2LS0 1;  1K28 A;  3FPU B;  4R1J A;  4DV4 L;  2PNH A;  2WAQ B;  1TWH H;  1JJC B;  1ICW A;  4IPG A;  4J8Q A;  3I4N H;  5JOB A;  2N55 A;  3NQT A;  4A3G H;  2PZU A;  2F0F A;  3UDG A;  2B2Y C;  2JA8 H;  2VQE L;  2MO0 A;  3WDN A;  1AE2 A;  3KFU A;  4Q0F A;  3GO5 A;  2B39 A;  3L7Z C;  1HXY D;  1UE1 A;  2TSS A;  1SNO A;  5C44 G;  5AJ3 Q;  1YJN A;  3RD4 A;  3S2H B;  4A3B H;  1EY5 A;  3BS1 A;  3MVV A;  1E0B A;  4JI3 L;  5FJ8 G;  1XPR A;  1TWA H;  5LL6 X;  1PRT F;  2Z1C A;  3R8B A;  2FHT A;  5G3L D;  3VR3 A;  2EDG A;  3DXJ C;  1TY2 A;  2HDM A;  3CCL A;  2VUM G;  4A3K H;  1LUZ A;  1MSH A;  2N3S A;  4IN3 A;  1VF7 A;  3CW2 C;  1SNC A;  2OWO A;  1IBM L;  1LV9 A;  3J81 L;  2EQS A;  3EN2 A;  4IJH A;  3J7Z C;  4DR7 L;  2UU9 L;  2PI2 A;  1PLF A;  5COR A;  1STN A;  3HKZ E;  4RGT A;  3MFG A;  3OPO A;  2NN6 H;  4LK1 C;  2R7D A;  5C4X B;  1X32 A;  3PUV A;  3F1Z A;  3CQZ H;  5CV9 A;  4OEM B;  4FF2 A;  2A69 D;  1WTP A;  4C3J B;  4K8I A;  4A3C G;  2BH2 A;  1IW7 D;  4P73 A;  1IBK L;  1WTH A;  3G7L A;  4CJ0 B;  5C3W A;  5EGT A;  1HFN A;  5IE8 A;  1A15 A;  3V05 A;  2R6G A;  1HNW Q;  2YU9 B;  1O7I A;  3H3V H;  4BY7 G;  4TVA B;  3SDZ A;  1YIT A;  1ILP A;  4X66 Q;  2XWB B;  2EY5 A;  4DV3 L;  4H0L C;  5K36 G;  1JJ2 A;  2KEN A;  3KLS X;  4DR3 Q;  3GTP H;  4JV5 L;  3WOF A;  4PV1 C;  3CC2 A;  2VZA A;  1G2S A;  2K6A A;  1EU3 A;  2D0O A;  3AU7 A;  5M5X H;  2UXB Q;  1EU4 A;  2RDF A;  1HA6 A;  4DPG A;  4FF4 A;  4QF4 A;  3J80 i;  4A3L H;  1PTO C;  3D4D A;  2A5H A;  2K1B A;  2G9D A;  5IP9 H;  1C7Y A;  4NXM Q;  1EY0 A;  2JA9 A;  2HT1 A;  2I5M X; 
#chains in the Genus database with same CATH homology
 4C3I H;  5LMN L;  4QIW E;  3KDF A;  3S1R H;  1PV4 A;  4R4C A;  1VQK A;  3S1Q H;  3TEH B;  4UP7 A;  1E3P A;  1PYS B;  2ZM6 Q;  4JI7 L;  1H95 A;  1Y1V G;  4JI6 Q;  1IXR A;  1XNR L;  1EWI A;  1PH5 A;  1CSP A;  2QGQ A;  4QL5 A;  1E7Z A;  5E7N A;  3ULJ A;  3HOX H;  4B3S L;  4A3L G;  3PUW A;  1CKM A;  4QGU A;  2Q2H A;  3AQQ A;  4OX9 Q;  5IP9 G;  3HOV H;  1OXU A;  1WI5 A;  2NZO A;  1EUJ A;  4H02 A;  3G4S A;  2OTJ A;  1G6P A;  3J81 i;  1OTC A;  4DR4 Q;  4P72 A;  3M7N A;  4GLX A;  2V1C C;  5IWA L;  4JG2 A;  3S16 H;  1VQH A;  2E5L L;  3TS2 A;  1DGS A;  4GKK Q;  5H1S E;  1XMQ Q;  4HIM A;  1KXL A;  2JJQ A;  1J5E Q;  1IBL Q;  4NB3 A;  2D62 A;  3HOX G;  1QUQ A;  4MTN A;  2UUB Q;  1WFQ A;  1E1O A;  2WAQ E;  5BR8 L;  3HOV G;  1A63 A;  1XPO A;  2CWP A;  1N9W A;  2OQ0 A;  1B70 B;  2NVT H;  3DM3 A;  4QJF A;  2MO1 A;  1YI2 A;  1FL0 A;  3JAM c;  4GLV B;  3HOZ G;  4HJA A;  4A3E H;  3I4M G;  3CF5 A;  4UPA A;  1G29 1;  1LTL A;  4LF9 Q;  1XNQ Q;  1GO3 E;  3FHW A;  4OON A;  1PA6 A;  1RIP A;  2F52 A;  2K50 A;  1FJG L;  2BA0 A;  4Y7N H;  3S14 H;  5IYD H;  1GVP A;  4A3J G;  4LW1 A;  3AFP A;  3TRZ A;  3I56 A;  3H0G H;  1S40 A;  2ZTC A;  3UDF A;  1C9O A;  1VQI A;  5JEA J;  2DUD A;  3HOY H;  4JI5 L;  5LMN Q;  4DR5 L;  1V1Q A;  4C2M H;  1PH3 A;  1EFW A;  4B3T Q;  4YY3 Q;  4DV1 L;  2UXD L;  3M4O H;  4LF6 L;  3ERS X;  2YYZ A;  4GNX B;  2OTL A;  4OO1 I;  4WJ4 A;  3T1H L;  3M3Y H;  3CCR A;  3A0J A;  1SLJ A;  2VUM H;  1MJE A;  4LNQ A;  1N34 L;  3RLN A;  3UE0 A;  2GVA A;  1VS0 A;  3S15 H;  1CKN A;  4XIG S;  2ZJQ A;  3FKI G;  5IP7 H;  3KF6 B;  1XTD A;  4HIO A;  2HHH Q;  3HOY G;  3LGJ A;  4LFC L;  4JBK A;  1L1O A;  2ID0 A;  4A4I A;  2I5L X;  1PYB A;  4JCV E;  4LF8 Q;  5IYB G;  3S1M H;  4DV7 Q;  4BXX H;  4KHZ A;  4EX5 A;  4GNX A;  4PZ8 A;  1VQD A;  2UUC Q;  4DNI A;  2MQH A;  5BR8 Q;  5M3F H;  3PUY A;  4DR1 L;  1PHJ A;  3GDE A;  3BZK A;  4X62 L;  1QVG A;  2E2H H;  2VNU D;  1TWG H;  3JC6 6;  1VQC A;  1QZH A;  2ZTE A;  1VQL A;  1NE3 A;  2EIF A;  1A8V A;  4K0K L;  3CCS A;  2KHI A;  3SGI A;  4BXX G;  1Z47 A;  3S2H H;  1NBW A;  2CFM A;  4OWX B;  2JEB I;  2WAQ G;  3K7A H;  1P16 A;  1QVF A;  1QZG A;  3UE1 A;  1Y1W G;  2R92 H;  3F8T A;  4LFB L;  2CWA A;  4DV4 Q;  1PH2 A;  4POF A;  4JOI A;  5M3F G;  1N32 Q;  3CAM A;  2CCZ A;  4LF5 L;  3GD7 A;  1VQG A;  3OTO Q;  2UXC Q;  2JK8 A;  4DV1 Q;  2VQE Q;  1NY4 A;  4AYB G;  4PG3 A;  4LF6 Q;  2IY5 B;  2H5X A;  2HIV A;  2RCN A;  2N78 A;  4AIM A;  3KJP A;  4A3M H;  1HNZ L;  1Q1E A;  4A93 H;  4B3R L;  4DR2 L;  4P71 A;  1Q82 C;  1YIJ A;  3H15 A;  4IPD A;  3OYY A;  3PIO A;  1N34 Q;  3J80 c;  2R92 G;  2LXK A;  2I0Q A;  4BY1 H;  4JI3 Q;  2K4K A;  1HR0 L;  1I6H H;  4DKA C;  2BA1 A;  5HGQ A;  2JQO A;  4YCV A;  4LFC Q;  3GTK H;  3KF8 B;  1JE5 A;  1YJ9 A;  3U4Z A;  4JI8 L;  3S17 H;  3F2D A;  4O2D A;  4R4I A;  4NXN Q;  4JI1 Q;  1Y14 B;  5C4X H;  4YHH Q;  4JBW A;  2JA6 G;  3KDF B;  1A0I A;  1L1O C;  1N33 L;  2Z6K A;  1I5F A;  4IFD J;  2RHQ B;  2JA5 H;  1VQA A;  1YEZ A;  4DV0 L;  4X6A H;  1Y1V H;  1E24 A;  4BY1 G;  4ME3 A;  4C3J H;  4DAY B;  1VQN A;  2RHS B;  1U5K A;  4X62 Q;  2JE6 I;  2A19 A;  5GRO A;  3J81 c;  3CC7 A;  1IBM Q;  4GOP A;  2IT1 A;  3PO3 H;  4BBR H;  1HH2 P;  1B8A A;  1SE8 A;  1X3F A;  1TWF H;  1YHB A;  4L5S A;  2UU9 Q;  2YU9 H;  2Y0S G;  1C0A A;  5C4X G;  1J6Q A;  3PIP A;  4QY7 A;  2L15 A;  3NBH B;  3NEL A;  3D0F A;  5GQO A;  1EYG A;  2JA5 G;  1PH8 A;  3T1Y L;  1MJC A;  1SR3 A;  1TWC H;  2Q2I A;  3FP9 A;  2UUA L;  4LF7 L;  1QUQ B;  4IJL A;  4AQY L;  2GVB A;  4OO1 G;  4WJ3 M;  4JBM A;  2B3G A;  3PO3 G;  4BBR G;  1X56 A;  4L5Q A;  4OXP A;  4JOI C;  3W1G A;  3W5O A;  1S72 A;  1N8R C;  1IBK Q;  2WP8 J;  1X65 A;  2ZTD A;  4X64 L;  5GAE C;  4QQB X;  4KHP L;  1D7Q A;  4LFA Q;  5GAD C;  1I3Q H;  4LUZ A;  2HQL A;  4YCW A;  5M3M H;  1PH6 A;  3HOZ H;  2ALY B;  3L0O A;  1CKO A;  3I4M H;  3I7F A;  5IY0 A;  2IX0 A;  3EBE A;  4DUZ Q;  1VQ9 A;  2AWN A;  3K80 C;  2E8G A;  3F2C A;  2F3I A;  1Q86 C;  4A3J H;  4DV3 Q;  2XTI A;  3ULP A;  1WYD A;  1KRS A;  4DR6 Q;  2IHE A;  4A75 A;  4IPC A;  4DV6 Q;  4JV5 Q;  4UP9 A;  5AJ3 L;  3CPW A;  1SMX A;  3KYH C;  4JI4 Q;  4JI0 Q;  1BBW A;  4L5R C;  1N33 Q;  1LYL A;  4DV2 L;  3PF5 A;  2K75 A;  5M3M G;  3CCM A;  3CD6 A;  1G51 A;  1KAW A;  3E9I A;  1AH9 A;  3U50 C;  5LMU Q;  2E2J H;  4AYB E;  3OW2 A;  2AWO A;  1K3R A;  2Z6K C;  1YHQ A;  1K8G A;  1KD1 C;  5GAH C;  1CKN B;  1HNX Q;  4IPH A;  1XPU A;  3RN5 A;  3FKI H;  2LSS A;  1XMO L;  4LWC A;  4JYA Q;  5EAY A;  3GTO H;  4GOP C;  1N36 Q;  1L1O B;  4JI2 L;  4A3F H;  1MIU A;  5IT9 c;  1VQE A;  5IYB H;  4JC0 A;  3CCQ A;  4JI7 Q;  1XNR Q;  3KOJ A;  4GKJ L;  3CCV A;  1B7Y B;  2C35 B;  4KLK A;  1VQ7 A;  4B3S Q;  4OWW B;  2ZJR A;  5JJL A;  3ULL A;  4KI0 A;  4B3M L;  2PMZ E;  4HIK A;  1OXX K;  3A5Z B;  1VCI A;  3KLW A;  3J81 j;  1YZ6 A;  3S24 A;  1V43 A;  4X64 Q;  4DUY L;  4P74 A;  5FLX c;  5IWA Q;  4A3F G;  2E5L Q;  1JJG A;  2NZH A;  1OXT A;  4BA2 I;  2HIX A;  2R7F A;  4YWL A;  1IYJ B;  1XJV A;  1PVO A;  2VS1 A;  2Y0S E;  4HID A;  1Y1W H;  3BJU A;  4EQ5 A;  1EIF A;  1X6O A;  1V9P A;  1VQM A;  3RNU A;  2KCM A;  2CKZ B;  3JAM i;  3GTQ H;  1YVC A;  4PZ7 A;  3G71 A;  2K14 A;  3K81 C;  1E1T A;  4DV2 Q;  1PH7 A;  1WJJ A;  4R4O A;  2OCE A;  2Z0S A;  3PSI A;  5C3E G;  4X66 L;  1D8L A;  2MNA A;  2YV5 A;  1PFS A;  4R4Q A;  3U4V A;  5C0X I;  1JMC A;  1FJG Q;  2F4V Q;  2JA8 G;  4DR3 L;  2Q2U A;  4LF4 L;  1Q8K A;  4HJ5 A;  2DGY A;  1VQP A;  1R9T H;  2E2I H;  2GN5 A;  1GD7 A;  3CCU A;  1Q81 C;  2UXB L;  4JI5 Q;  1IL2 A;  4A3B G;  4DR5 Q;  2UXD Q;  2I5H A;  2AKW B;  3S1N H;  4AH6 A;  1OXS C;  4O0A A;  2JA6 H;  4A76 A;  1SFO H;  3T1H Q;  1X3E A;  3D31 A;  3I4O A;  5LMN W;  4FDB A;  1M90 C;  4RMF A;  4X65 L;  1I94 L;  4B3M Q;  1X3G A;  3HFZ B;  1WOC A;  5DLQ E;  1NTG A;  5M5W H;  2OQK A;  2R93 H;  3AYH B;  4GLA C;  1RL2 A;  3DLL A;  3K7U C;  4GOP B;  1GKH A;  2ZM6 L;  2ZJP A;  4JI6 L;  4RG1 A;  4P75 A;  1SRO A;  3CXC A;  3G6E A;  1YNX A;  3GTM H;  2N8N A;  3RZO H;  1UWV A;  1HZC A;  1X54 A;  4UY8 C;  4OX9 L;  3M4Q A;  1M1K C;  1L0W A;  1BBU A;  4DR4 L;  3ICE A;  1MKH A;  1KQS A;  3HOW G;  4DR1 Q;  1VQ6 A;  2R93 G;  5GAG C;  4IO9 A;  3F2B A;  2NN6 G;  3KJO A;  4A3I H;  4GKK L;  3PF4 A;  1XMQ L;  3VDY A;  4DK3 C;  4K0K Q;  1J5E L;  1I50 H;  1IBL L;  2N49 A;  3MEF A;  1U0L A;  1TXY A;  3M4P A;  4DK6 C;  3ZJY C;  2RF4 A;  4A3D H;  1HJP A;  1VQB A;  2ATW A;  4MZ9 A;  2EXD A;  4LFB Q;  2ASB A;  3HKS A;  3CPF A;  1PH1 A;  3A5U A;  4UP8 A;  2KHJ A;  4DV5 L;  4OWT B;  1WCM G;  1Z9F A;  4POG A;  4BBS H;  5JJK A;  4DAM A;  4LF5 Q;  4A3I G;  2BH8 A;  1YHA A;  3WWV A;  3MXN B;  1XNQ L;  3TS0 A;  3STB D;  1FVI A;  5IYC H;  1Q7Y C;  1HNZ Q;  4B3R Q;  4DR2 Q;  4A3D G;  5HY6 A;  1I94 Q;  2Q2T A;  1BKB A;  5JJI A;  1VQJ A;  1YJW A;  4B3T L;  1HR0 Q;  2K5N A;  1UE7 A;  1NMG A;  4YCU A;  4YY3 L;  1K0R A;  3K0X A;  4L5T A;  1PH4 A;  4BBS G;  1K83 H;  1VQ4 A;  4ALP A;  1EQQ A;  1KC8 C;  1HZB A;  4JI8 Q;  1GM5 A;  1Q12 A;  5IYC G;  2VY3 A;  1K8A C;  2R7Z H;  1JB7 A;  3HKZ G;  4DV0 Q;  2CQO A;  2K52 A;  1AE3 A;  1SN8 A;  2NN6 I;  3AEV A;  2D0P A;  4HJ7 A;  2HHH L;  3S2D H;  3CC4 A;  1ASZ A;  1SRU A;  2IHF A;  1EQR A;  2K5H A;  4LF8 L;  1W2B A;  5ELN A;  3PGZ A;  3PUX A;  4PZ6 A;  3CMA A;  4DV7 L;  1KIX A;  1BVS A;  1W3S A;  5C0X G;  1EOV A;  1S3O A;  2YTX A;  3RN2 A;  2UUC L;  3B6Y A;  2PQA B;  4GN4 B;  3TRE A;  3UDI A;  4BA1 I;  1EIY B;  3E9H A;  2VQF L;  2PI2 E;  2R7Z G;  4IFD G;  3T1Y Q;  4J15 A;  2A1A A;  2KCT A;  4DV5 Q;  4YWM A;  2UUA Q;  4LF7 Q;  1UE5 A;  3W1B A;  1LM0 A;  4XTC S;  3H3V I;  4AQY Q;  1K9M C;  1VQ5 A;  3PO2 H;  1HZ9 A;  3GTJ H;  2WB1 G;  2QA4 A;  3RR5 A;  4Y52 H;  2K5V A;  5C44 H;  3GTL H;  1JT8 A;  1UEB A;  2PQA A;  3I2Z A;  4R1J A;  4DV4 L;  4KHP Q;  2PNH A;  1TWH H;  1KHI A;  1JJC B;  2FXQ A;  4GN5 A;  4IPG A;  3I4N H;  4A3G H;  5FJ8 H;  2NVY H;  5C3E H;  1N32 L;  1NMF A;  3PUZ A;  3CCJ A;  1CSQ A;  3UDX A;  3OTO L;  3UDG A;  2UXC L;  1YBY A;  2JA8 H;  3PO2 G;  2VQE L;  2MO0 A;  3E0E A;  1AE2 A;  3KFU A;  4A3E G;  2MFI A;  2JA7 H;  2F4V L;  3GO5 A;  3L7Z C;  2YTV A;  1UE1 A;  5FLM H;  5C44 G;  1QVC A;  5AJ3 Q;  5IYD G;  3CME A;  1YJN A;  4HJ9 A;  4IOC A;  1HR0 W;  2B63 H;  4A3B H;  4IOA A;  1HNW L;  1VQF A;  1ASY A;  4A3G G;  3H0G G;  1UE6 A;  4JI3 L;  3I4N G;  1NJI C;  5FJ8 G;  1XPR A;  1TWA H;  5M5Y H;  1A62 A;  1Q46 A;  2JEA I;  4YWK A;  3PCO B;  2A8V A;  4NXN L;  4JI1 L;  4YHH L;  2JA7 G;  3IRB A;  1XMO Q;  3CCL A;  3G48 A;  5FLM G;  3HOU H;  4IFD I;  2VUM G;  2B63 G;  4JI2 Q;  4A3K H;  1LUZ A;  2N3S A;  2WFW A;  3K8A A;  4PMW A;  1X9N A;  3M85 A;  2VQF Q;  3CW2 C;  4LUO A;  4HJ8 A;  2OWO A;  1X55 A;  5IP7 G;  4GKJ Q;  4GN3 B;  1IBM L;  4C3H H;  3KF6 A;  1VQO A;  1Q1B A;  2NVQ H;  4A3C H;  2EQS A;  4NXM L;  3EN2 A;  1KRT A;  4IJH A;  3AFQ A;  2LXJ A;  3J7Z C;  3L2P A;  4DR7 L;  2UU9 L;  2PI2 A;  4DR6 L;  2QEX A;  3GTG H;  3HOW H;  3A74 A;  3RLO A;  3HKZ E;  4APV A;  3RZD H;  3HOU G;  4DUY Q;  2R7D A;  1VQ8 A;  1E22 A;  5JEA G;  3PUV A;  2AHO B;  4GS3 A;  4A3K G;  3F1Z A;  4BY7 H;  3CQZ H;  3PV0 A;  3TQY A;  2KBN A;  3CCE A;  2XGT A;  3NEM A;  4A3C G;  2BH2 A;  4MNO A;  4P73 A;  1IBK L;  3ER0 A;  3J7A 5;  3EIV A;  2ES2 A;  2IX1 A;  3STB C;  1WCM H;  2VL6 A;  4LUV A;  5IE8 A;  4LFA L;  2R6G A;  1HNW Q;  1O7I A;  3H3V H;  4BY7 G;  3M9B A;  3NEN A;  2B29 A;  4TVA B;  1YIT A;  2NVX H;  4DUZ L;  2WB1 E;  2UUB L;  1CUK A;  3CP0 A;  4X66 Q;  1L2F A;  3U58 A;  4DV3 L;  5C0X J;  5K36 G;  1OXV A;  5J3B A;  1KL9 A;  3RLF A;  1JJ2 A;  2KEN A;  4DR3 Q;  3GTP H;  4JV5 L;  4LF4 Q;  4DV6 L;  4JI4 L;  4R4T A;  4NPS A;  4A3M G;  3CC2 A;  4JBJ A;  4JI0 L;  4A93 G;  2VZA A;  2D0O A;  5M5X H;  2UXB Q;  4TQU S;  1K73 C;  2VW9 A;  5ELO A;  1HZA A;  1FGU A;  3Q8D A;  4DPG A;  3I55 A;  5LMU L;  4GNX C;  4LF9 L;  1T9H A;  3J80 i;  4A3L H;  3BU2 A;  2AMC B;  5IP9 H;  5C4J H;  1C7Y A;  1IZ6 A;  1HNX L;  4NXM Q;  2YTY A;  2JA9 A;  3BZC A;  4X65 Q;  4DR7 Q;  2HT1 A;  2I5M X;  4JYA L;  1PH9 A;  1P8L A;  1N36 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...