1YNXA

Solution structure of dna binding domain a (dbd-a) of s.cerevisiae replication protein a (rpa)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
TRPIFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRGDGKLFNVNFLDTSGEIRATAFNDFATKFNEILQEGKVYYVSKAKLQPAKPQFTNLTHPYELNLDRDTVIEECFDESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Replication factor-A protein 1
publication title Solution structure of the DNA-binding domain of RPA from Saccharomyces cerevisiae and its interaction with single-stranded DNA and SV40 T antigen
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ynxA01
1V1QA 3HOYG 4BY7H 4GS3A 2HT1A 3HOYH 5BR8L 2PQAB 1N32L 3CP0A 1KIXA 4AQYL 5M5XH 3CMAA 2ZTCA 1FVIA 4LFAQ 2RCNA 3KJPA 2UU9Q 3KFUA 1SR3A 1SLJA 5IT9c 4OXPA 2R7FA 2ID0A 3J80i 4RG1A 5IP7G 3IRBA 2UUBQ 4WJ3M 1PH4A 4OX9Q 4POFA 3S1NH 4PZ7A 4BA2I 3FP9A 3HOVG 1PH7A 1CKMA 5LMNQ 3STBC 3HOVH 2NN6G 1PVOA 3CCVA 2XTIA 4LF5Q 1VQ8A 4LF9L 3Q8DA 1KAWA 2D62A 5BR8Q 2NN6I 4HJ8A 4DV7L 3A0JA 4AQYQ 2K5NA 3JAMi 4P73A 1I3QH 1B8AA 1PA6A 1BKBA 2QGQA 4AYBG 3G4SA 2NVTH 1WJJA 2CQOA 4APVA 1S40A 1A62A 4PZ6A 3ZJYC 1ASZA 3G48A 2H5XA 1RL2A 1KL9A 3E0EA 1CKNA 3ULPA 2E2JH 2JEAI 3M3YH 1X65A 4O0AA 4GLAC 4JYAL 4KI0A 3A5ZB 2NVXH 2KCMA 2AHOB 1Z47A 3HKZG 5EAYA 4IJHA 2E8GA 2HIXA 3U4VA 4YY3Q 1M90C 4LF9Q 2F4VQ 3S1QH 1NY4A 3GTPH 1VQBA 3ER0A 1NJIC 2KENA 2WP8J 4OWXB 3PF5A 3B6YA 4IFDG 5LMUL 3PO3H 1X54A 4FDBA 1NMGA 4P71A 1YIJA 1QZGA 2ZM6Q 4POGA 3PGZA 1YHBA 2K4KA 3KF6B 4LUVA 1UWVA 1PH6A 1K8GA 3CC2A 4L5SA 1I6HH 1VQ9A 4GOPB 1KQSA 1Q1EA 4A3DH 2NZOA 1HJPA 4X65Q 3RLNA 4JYAQ 4HIOA 3JAMc 2L15A 1XPOA 1N8RC 2RF4A 3GTLH 1C7YA 1QVCA 1CSQA 2Y0SE 2Z6KC 3I2ZA 1J6QA 3W5OA 5IWAL 2VQEQ 4GN5A 1FJGL 4YWMA 2E2IH 4C3HH 2LXKA 4A3MG 4DR3L 1K3RA 3CD6A 3F2CA 5LMUQ 4A3MH 4DV0L 5M5WH 5C44G 4LF7L 3G6EA 1SN8A 2OTLA 5C44H 4DV5L 3S1MH 2UXBQ 3J81i 4C3JH 3GTMH 3PCOB 1X3GA 2VZAA 4NXNL 2F3IA 2ASBA 3CCRA 4BBSG 2V1CC 3MXNB 5E7NA 3NELA 4BBSH 1JT8A 3S14H 5IWAQ 1Q1BA 3PUYA 1BVSA 2QEXA 3ULLA 1FJGQ 3BJUA 4JOIA 1PH2A 4A4IA 4DR3Q 1WOCA 2YTXA 4DV0Q 1AH9A 4IOCA 4LF7Q 4A3JG 3DM3A 1QZHA 2RHQB 2E5LL 4DV5Q 3WWVA 1XPUA 3PIOA 1EQRA 3EN2A 4A3FG 2VUMH 4R4QA 1SROA 1A63A 1YJNA 4A3FH 2ALYB 2ZJPA 4JI8L 1PYBA 2VNUD 4NXNQ 1M1KC 1PH3A 2YYZA 3L0OA 4C2MH 2R7DA 1LM0A 1S72A 1NTGA 4LWCA 2XGTA 5M3FG 3L7ZC 3PIPA 4GNXA 4L5QA 5C0XG 5M3FH 2AKWB 3J81c 2AWNA 1IBKQ 1V9PA 2VL6A 4DR1L 3S17H 3AQQA 3PO2G 1L1OC 5M5YH 3E9HA 1EWIA 1MJCA 1VS0A 2N8NA 1CKNB 4JI2Q 4X64L 3J7ZC 1VQ5A 2E5LQ 3PF4A 3CF5A 4YCVA 1E22A 2NVQH 4JI1L 4A3CH 2BH2A 5C4JH 3GTKH 4JI8Q 1B70B 3AEVA 1FGUA 4UP9A 2JA7G 4A93G 1EIFA 4LF5L 4R4OA 1BBUA 4DR5L 2JA7H 3I4MG 4A93H 5IYCG 4PZ8A 1VCIA 4X62L 2Q2IA 5GADC 3I4MH 1HZBA 5IYCH 1IZ6A 3M9BA 3CCMA 4HJAA 1XMQL 4TVAB 4O2DA 3UDXA 3PUWA 2WAQG 1YBYA 5H1SE 5M3MG 4DV1Q 1OXVA 1AE3A 3CXCA 4R4CA 4DR1Q 5M3MH 3M85A 2JE6I 4A3BG 2JK8A 3KF8B 2JJQA 1GVPA 1VQIA 4X64Q 3CMEA 4JI7L 4A3BH 4DV3L 4JI1Q 2PI2E 1N36Q 3S2HH 4XIGS 3UDIA 5FLMG 1HNZQ 1E1OA 4BBRG 1VQ7A 4JI0Q 3M7NA 5FLMH 1SMXA 1XJVA 1V43A 4BBRH 4DR5Q 5IY0A 4YY3L 4HIMA 2F4VL 1NMFA 4X62Q 4IFDJ 3BU2A 3S15H 1Q86C 3L2PA 1T9HA 1U0LA 3CQZH 3K7UC 3GD7A 2IHFA 4DR2L 1XMQQ 2JEBI 3W1BA 4JI4Q 4YHHQ 3CPWA 3OTOL 3AFPA 4DV6L 3KYHC 2B3GA 4Y52H 5HY6A 2ZM6L 3SGIA 4HJ9A 5HGQA 2GN5A 3K8AA 3CCJA 3S24A 2KCTA 4JI7Q 2FXQA 2CCZA 2JA9A 1K0RA 3PSIA 4DV3Q 1J5EL 2JA8G 2AWOA 3NEMA 4X65L 3F8TA 3TEHB 4NB3A 5IYDG 2JA8H 4DV4Q 3CCUA 3TS0A 5IYDH 4JI6Q 1YITA 1Q46A 2VQEL 4R4IA 3M4PA 4YCUA 1VQ6A 2QA4A 5GAGC 2JA6G 3J80c 3RN2A 4DR2Q 4IPDA 3PO3G 4LFBL 1VQKA 2JA6H 1KXLA 3I7FA 1HZAA 3OTOQ 1RIPA 2PMZE 4DV6Q 1YJ9A 1N34L 4B3MQ 3T1YQ 5DLQE 3PUVA 2EIFA 4OWWB 1EFWA 2UXBL 2OQKA 1R9TH 4A3DG 2A1AA 3ICEA 1YVCA 4A3KG 1J5EQ 4AYBE 4GKKL 4OONA 1P16A 1PYSB 3OYYA 4A3KH 2YU9H 1QVFA 2PNHA 1E7ZA 4GNXB 5FJ8G 1I5FA 1HR0W 2D0PA 3HOUG 5FJ8H 1Z9FA 2JQOA 3VDYA 1HR0L 2K14A 2IY5B 2WB1G 1IBMQ 3HOUH 3HOWG 4DK3C 1HH2P 3HKZE 5FLXc 3CCEA 3HOWH 4K0KL 4IPCA 4LFBQ 5GROA 3CCSA 2AMCB 1X3EA 1N34Q 2Q2TA 3MEFA 1OXUA 5JEAJ 3U50C 1OXXK 2LSSA 5IYBG 1P8LA 1EIYB 5IYBH 1TXYA 5ELNA 4LFCL 2UUAL 1DGSA 1L0WA 3PV0A 4JI3Q 4GKKQ 3KOJA 2UUCQ 1OXSC 2WFWA 2UXDL 4R1JA 2PI2A 5C0XJ 3CPFA 4DUYL 1VQ4A 4QL5A 1YEZA 2Q2UA 1UEBA 2R6GA 1I94Q 4GOPC 1HR0Q 1NE3A 3J7A5 5K36G 2K75A 2YV5A 1LTLA 4K0KQ 4LW1A 4YWKA 1IBKL 1JB7A 2K52A 2EQSA 3EIVA 2EXDA 4HJ5A 2B29A 4DKAC 2BA1A 4JI2L 1XNQQ 4AH6A 1XNRL 4P72A 1Q8KA 3W1GA 2VUMG 1JJCB 4QIWE 4DNIA 4DUZL 1XMOQ 1JJ2A 1QUQA 1SE8A 3A74A 2UUAQ 4LFCQ 2KHIA 3UE1A 1WCMH 5J3BA 4EQ5A 4LF6L 2UXDQ 4LUOA 4JBKA 2HQLA 4IPHA 4DUYQ 2Z6KA 3H3VI 1Q12A 3FKIG 3CCQA 1KRSA 3FKIH 4P74A 2HHHL 3BZKA 3CC4A 4JI5Q 3RLOA 1PHJA 2MNAA 4DV1L 4IO9A 4OO1I 1CSPA 1UE7A 5IP9G 4BXXH 1S3OA 3H0GH 5IP9H 2ZTDA 2R92G 2DGYA 1MIUA 2F52A 4XTCS 3J81j 1VQPA 1XNRQ 2HIVA 2R92H 2ZJRA 1WI5A 1IYJB 4A3CG 4DUZQ 1N36L 2CWAA 1VQFA 1D7QA 1HNZL 3LGJA 3HFZB 4JI0L 4EX5A 3F2DA 4LF6Q 1W2BA 3F2BA 1E24A 2GVBA 1SRUA 4GN3B 2A8VA 1Y1WG 1YZ6A 4DR7L 1LUZA 4UP7A 1X6OA 2MFIA 1N9WA 1Y1WH 1HNXL 2HHHQ 4KHPQ 4JI4L 1E3PA 4YHHL 2I5LX 1JMCA 4MNOA 1GM5A 3HKSA 4A3GH 4PMWA 1VQLA 2N49A 4IPGA 3T1HL 1EYGA 4LF8L 1VQMA 3CW2C 3U58A 1QVGA 4HIKA 1IXRA 1TWAH 4J15A 4BA1I 2A19A 4ALPA 1W3SA 4DV4L 1LYLA 1D8LA 1BBWA 1VQJA 3GTQH 4MZ9A 3UDFA 1OTCA 4JBMA 4JI6L 4WJ4A 5AJ3L 1VQEA 3E9IA 4DV2Q 1Y14B 4DR7Q 1K9MC 1HNXQ 4GKJQ 4LUZA 2I0QA 1L1OA 2E2HH 4DR4L 4NXML 4UPAA 3GTGH 4GLXA 4BY7G 4B3ML 2K50A 4GN4B 3GTJH 3T1YL 1EUJA 2DUDA 1Y1VG 3FHWA 3UE0A 4LNQA 3PUXA 3T1HQ 1Y1VH 1UE5A 2OWOA 3BZCA 1TWFH 2WAQE 4LF8Q 5IP7H 4JBJA 1X56A 3I55A 4RMFA 1IBLL 1G51A 2OQ0A 1L2FA 1VQAA 4ME3A 1MJEA 4DPGA 1PH8A 5AJ3Q 3I4OA 3EBEA 4A3IG 2YTYA 4QJFA 4JV5L 4KLKA 1N32Q 1IBML 4A3IH 2OTJA 1K8AC 4H02A 3GO5A 4IJLA 1N33L 4DR4Q 4NXMQ 2RHSB 3F1ZA 1KHIA 3G71A 1Q7YC 1VQHA 3KJOA 1HZ9A 1QUQB 2BH8A 2B63G 4R4TA 5ELOA 4DAMA 4UY8C 2B63H 1YNXA 2ATWA 1Q81C 4JI3L 1PFSA 2Y0SG 1TWGH 2MQHA 1IBLQ 2UUCL 2K5HA 1KRTA 1Q82C 1H95A 3H15A 2I5MX 4TQUS 3KDFA 3AYHB 4X66L 3AFQA 2CFMA 4Y7NH 3ERSX 2YTVA 1CKOA 3KLWA 1I94L 4JV5Q 2R93G 1PH1A 1YI2A 4DV7Q 4OWTB 4JCVE 4A76A 3GDEA 4MTNA 2R93H 2PQAA 1N33Q 1C9OA 3HOXG 1X3FA 3I56A 1K83H 1TWHH 4JG2A 3HOXH 1A8VA 4DAYB 3DLLA 4JOIC 1VQOA 1K73C 3RZOH 3TS2A 1XNQL 4A3LG 4PG3A 4QGUA 4A3LH 4HIDA 1UE6A 1G291 3UDGA 3HOZG 4A3EG 4IFDI 3K7AH 1XMOL 2CKZB 2VY3A 3HOZH 4A3EH 4AIMA 3GTOH 2NVYH 1JJGA 2OCEA 2K5VA 2KHJA 4B3RL 1O7IA 4X66Q 1EQQA 2BA0A 4LF4L 1HNWL 5GQOA 1X55A 5JJIA 3RN5A 4JI5L 3U4ZA 4B3SL 3RZDH 3ULJA 1GD7A 3NENA 4IOAA 1A0IA 2MO0A 4GNXC 3CCLA 3K80C 2IX1A 4UP8A 2WB1E 2IX0A 3OW2A 1WYDA 1OXTA 4QQBX 1E1TA 1TWCH 2N78A 4JC0A 5IE8A 1X9NA 1NBWA 1I50H 1WCMG 4DR6L 1UE1A 2NZHA 1GKHA 5GAHC 1XPRA 3RLFA 3H3VH 2IT1A 2N3SA 1EOVA 4B3RQ 3RR5A 2R7ZG 1KC8C 2D0OA 4LF4Q 4OO1G 1YJWA 1L1OB 2R7ZH 1HNWQ 3PUZA 3JC66 3TREA 5JJLA 1B7YB 5C3EG 4HJ7A 4A75A 1PH5A 4GLVB 3M4OH 2MO1A 3K0XA 5C3EH 3D0FA 4KHPL 4X6AH 4B3SQ 4BXXG 1YHQA 2ZTEA 3H0GG 4DK6C 1IL2A 2IHEA 4L5TA 3S2DH 1VQCA 1PV4A 1VQDA 2Q2HA 1U5KA 4L5RC 3CAMA 2ZJQA 3RNUA 4BY1G 1VQGA 4A3JH 1C0AA 4B3TL 4BY1H 3M4QA 4QY7A 1AE2A 4YWLA 2JA5G 5JEAG 1PH9A 4DR6Q 2UXCL 3KF6A 2VQFL 2JA5H 2C35B 2VW9A 1CUKA 2CWPA 4YCWA 2VS1A 3NBHB 4GOPA 1MKHA 1VQNA 4KHZA 3S16H 4P75A 5JJKA 1YHAA 1ASYA 2KBNA 4C3IH 2LXJA 4DV2L 1KD1C 3D31A 3CC7A 4GKJL 3K81C 4LFAL 5GAEC 1JE5A 1FL0A 1SFOH 2UU9L 1WFQA 1HZCA 2Z0SA 3A5UA 3TQYA 3I4NG 4A3GG 3STBD 1G6PA 3PO2H 3I4NH 5C0XI 2GVAA 4JBWA 2UUBL 2I5HA 1XTDA 4OX9L 5C4XG 4B3TQ 1GO3E 5LMNW 3KDFB 5C4XH 5LMNL 2UXCQ 2VQFQ 3S1RH 3TRZA 4NPSA 2ES2A
chains in the Genus database with same CATH superfamily
4BY7H 4GS3A 5BR8L 4TRDA 4AQYL 3A55A 1HA6A 2Q8RE 3F2UA 2MPMA 3S16B 2RCNA 4C3IB 3KJPA 1EEFD 5IT9c 2PCFB 1G8ZD 1AZPA 2R7FA 2RBMA 3DWAA 4RG1A 5IP7G 1PH4A 4OX9Q 4FF4A 3R2IA 4POFA 4PZ7A 4BA2I 1BF4A 3HOVG 1PH7A 1D2BA 1PVOA 2XTIA 1VQ8A 2NN6H 3Q8DA 3P7JA 5KRUA 3I70A 4O1NA 1TS2A 1LABA 4DV7L 2G5DA 1KNEA 1C8CA 3LNNA 4QUFA 3I4MB 3HOYB 1B8AA 2EJGC 3G4SA 2D5DA 4PZ6A 1ASZA 2WAQB 3G48A 5NUCA 1CKNA 3ULPA 1X65A 4JYAL 3A5ZB 3K58A 2AHOB 2XN9C 3U4VA 4YY3Q 3S2HB 2F4VQ 2EYJA 1NY4A 3ONAB 3E5SA 3VR6A 2F0JA 3VYSA 3PF5A 3B6YA 3MXPA 2F0IA 4K2LA 2RDGA 1IYVA 2ZM6Q 4G4KA 3PGZA 4CDDC 4IUVA 3CC2A 1JQYD 1UWVA 1SMYD 1PLFA 2NZOA 3RLNA 2F0FA 4XT1B 1XPOA 2E2JB 3M3YB 2JA8B 1C7YA 1QVCA 2Z6KC 2NVXB 2L5TA 4HR7B 5CBAE 1FJGL 3Q6SA 4HCEA 2E2IH 1STBA 3T4AC 5G3LD 2K5WA 4J8QA 3S1MH 1NR4A 5C4HA 4C3JH 3MTSA 3PCOB 2VZAA 3BYYB 4HTHA 2F3IA 2ASBA 2EE1A 5E7NA 1SMYC 3NELA 1JT8A 1VF7A 1STNA 3ULLA 4DR3Q 4ID6A 2YTXA 3TBIB 3VA5A 3IAYA 1QE6A 2BOSA 4IALA 1SBBB 4A3MB 1B2TA 1EQRA 4R4QA 2ALYB 2DNEA 5IOCA 1PYBA 3GQBA 3L0OA 3A7AB 2R7DA 1LM0A 4O42A 1E2WA 3L7ZC 4L5QA 3HZXA 4XDXA 4ABNA 5M3FH 2F0HA 3I3CA 1IBKQ 1V9PA 2VL6A 4DR1L 1F9RA 3URYA 3S17H 4L6TB 1L1OC 1EWCA 1DOLA 1VS0A 1ICWA 2E5LQ 1JOQA 1VQ5A 1CZGA 1RODA 1B70B 4A93G 1AFPA 4R4OA 2JA7H 5IYCG 4PZ8A 2F0NA 1VF5C 5FK9C 1IKLA 5H1SE 4BWGB 1AE3A 4R4CA 5M3MH 4FYDA 3M85A 2JE6I 4A3BG 2JK8A 3SK8A 1VQIA 4DV3L 1N36Q 2PI2E 2R92B 4R8NA 1T5EA 4JI0Q 5FLMH 1SMXA 2DJGC 4BBRH 4PMBA 3SVMA 1LTRD 1ICFB 5EPLA 5JOBA 4YY3L 4DR5Q 1NMFA 2F4VL 3GTKB 4IFDJ 3X3MA 3T16A 4NP5A 1KTKA 3K7UC 1XMQQ 3GD7A 3X3NA 2F0KA 4JI4Q 3CPWA 1GUOA 4DV6L 3ND8A 2ZM6L 1GHJA 3VYUA 4HJ9A 1JOKA 3S24A 2Z1CA 1CM9A 1QWYA 2CCZA 1K0RA 3GV6A 1Y8NB 2Z4HA 3P1HA 2HDLA 2SEBD 4NB3A 5IYDG 2RDFA 1Q46A 3HRZC 1CQVA 5GAGC 3MHBA 1PTOD 3S15B 4B3MQ 1N34L 3T1YQ 4RGOS 4H44C 4IZ8A 1YVCA 4A3KG 1J5EQ 1EY8A 4OONA 5BN3A 3RUZA 5ELDA 1I5FA 1HR0W 5FJ8H 1HR0L 4ULLA 2WB1G 4RKLA 4LFBQ 4ZKCB 5C3XA 1U9RA 3OIPA 2MUYA 1X3EA 1RKNA 1PDQA 2SOBA 3MEFA 2JA6B 5IYBH 4C3JG 3LWUA 3WDNA 1DGSA 1PTOC 2UUAL 4QCLA 1D6EC 3SK5A 5I9OA 4GKKQ 1MGSA 4ZRZA 3E6ZX 4G7OC 2UXDL 3J7A5 2QDLA 4GOPC 1EZ8A 1NE3A 2F4IA 2O5JC 5K36H 1D5MC 4K0KQ 4LW1A 1IBKL 1JB7A 1SYCA 3NPPA 2BA1A 3J81E 3G6JB 4H7BA 3VR3A 2DY8A 4LF6L 1LTGD 4DUYQ 1LTSD 3C1EA 1Q12A 2A73B 3FKIG 4LK1C 1KRSA 3V2TA 3CCQA 2F0MA 3JAML 4JI5Q 3EJIA 2B2UA 5ISRA 1BCPD 2G9DA 5IP9H 2KOLA 1W6JA 1VQPA 2A74C 3W3AA 4DUZQ 1N36L 2QEJC 2EYLA 4JI0L 3F2DA 1TWCB 4K5WA 1SRUA 2J4XA 3MFGA 1Y8PB 1LUZA 5CV8A 2HHHQ 4JI4L 1SDFA 2RSNA 1J8IA 1DZ1A 1NCVA 1O80A 1SNMA 4F8MA 1EOTA 2N49A 1H9KA 1S5FD 1GUSA 2TSSA 4KY5A 3U58A 1STYA 1HXYD 4HIKA 1PRTF 4BA1I 4ALPA 2OF1A 3GTQH 1O78A 4DV2Q 5L37A 1K9MC 1HNXQ 2I0QA 4B3ML 2K1BA 4MTKA 3J80E 3T1YL 3FHWA 1I4HA 4LNQA 3OOCA 2OWOA 3T1HQ 1SFOB 3BVMA 2WIIB 2BCOA 1DOKA 3H6MA 5J22A 1TWAB 3H91A 5AJ3Q 4A3IG 3EBEA 2OTJA 4JV5L 4QJFA 4CJ0B 1PZID 2K33A 4H02A 4PQXA 1Q7YC 3TP6A 1QUQB 3KBGA 2BH8A 4DAMA 1Q8IA 1DM0B 2B63H 1YNXA 3T53B 1TWGH 2MQHA 2K5HA 3H15A 4TQUS 2EVBA 3AYHB 4X66L 4Y7NH 2NYZD 1U4RA 3KLWA 5JVG3 5HGTA 3EFXD 1BCPF 5EPJA 3HOXG 5CV6A 4QMGA 1KDBA 1TWHH 1A8VA 3A54A 4IFDH 4JOIC 4A3LH 4A3EG 3K7AH 2CKZB 2VY3A 2NUCA 1WTWA 3GTOH 2SNSA 1O7ZA 2K5VA 2IPKD 1O7IA 1EQVA 2BA0A 2DJFC 4DU9A 1EY9A 5IGBA 4JI5L 3DWPA 3RZDH 3ULJA 4C1NK 2D2CC 4IOAA 1A0IA 3CCLA 3VR4A 2IX1A 4UP8A 2FJ2A 4K8IA 1OXTA 5D3IB 3RZOB 3K57A 2E76C 2HCCA 1I50H 4DR6L 1SEBD 1GKHA 3RLFA 2N3SA 3RR5A 3HOZB 2D0OA 4OO1G 1L1OB 3JC66 5J39A 4GLVB 5AFWA 3M4OH 4N8FA 5C3EH 1TR5A 2QW7A 1STGA 1VQDA 4JPBW 1U5KA 2E2IB 4QB4A 3M7GA 2N55A 2ZJQA 3RNUA 4WJWA 4BY1G 3U9SA 4A3JH 2PW5A 4B3TL 3MWYW 1F2MA 5EJWA 2JA5G 5E1FA 1EY4A 2H4OA 2VS1A 5BN5A 1JR0D 4C3IG 1I4XA 1E2VA 4ZQ3A 3MAQA 4DV2L 1R4QB 4R8IA 1KD1C 3D31A 3HGBA 5A35A 2EZVA 2XVSA 2UU9L 1WFQA 1K0SA 3A5UA 2DY7A 3STBD 3TZDA 2JXMB 3I4NH 2GVAA 4ZKBB 4H0LC 1B3QA 3KLSX 1SE3A 1GO3E 4EQOA 3KDFB 5IGGA 1WTRA 1A2UA 4NPSA 1V1QA 3HOYG 1X3QA 3CP0A 1KIXA 2RA4A 5M5XH 4K14A 4LFAQ 1DD2A 1SR3A 3EVQA 4KD4A 1EFID 3MC0B 3TN2A 5M3FB 2UUBQ 2EYPA 3S1NH 2VXWA 1MSHA 3PO2B 3FP9A 4CJ2C 1CKMA 3VR5A 5LMNQ 2B39A 3STBC 3HOVH 3CCVA 1KAWA 3K0YA 2D62A 5BR8Q 5EQ0A 2WINB 4HJ8A 4AQYQ 3RMHA 3JAMi 3G7LA 1I3QH 2X69A 3D4WA 1BKBA 1WJJA 1S40A 2RQXA 5M3MB 4OL7A 3VA7A 4O0AA 4GLAC 2QDBA 5EAYA 2DN8A 3S1QH 3GV3A 3FVQA 3OMGA 3ER0A 1NJIC 2KENA 2AQ2B 4BBRB 1R4PB 1FGBD 2WP8J 1PTOB 4X3KA 3TDQA 4IFDG 5LMUL 3PO3H 4CKBA 3C46A 1ET6A 1NMGA 4P71A 1QZGA 4POGA 3AB9A 1YHBA 4LUVA 1TS3A 5CV9A 2NVTB 1VQ9A 4GOPB 4A3DH 4X65Q 4JYAQ 4HIOA 4NKLA 3JAMc 1N8RC 3WOEA 1JC7A 1CSQA 2Y0SE 5LHY1 5IWAL 3D4RA 3CD6A 2LXKA 5EKKA 4A3MG 3F2CA 5ELBA 1ET9A 4P2CB 5M5WH 4LF7L 3G6EA 4DV5L 4X3TA 3ITPA 3L9AX 4DF7A 3GTMH 5CV7A 2Q8TA 5DNFA 1EZ6A 4NXNL 1I6HB 4BBSG 3MXNB 5CC4A 2IJ0A 4DNTB 3S14H 1W6KA 1FJGQ 1PH2A 1WOCA 4A3JG 4C3HB 1QZHA 3MZ5A 2OEOA 1I4GA 1XPUA 3PIOA 3EN2A 4WORA 4B9WA 5C44B 4JW0A 1M1KC 2YYZA 4C2MH 1RF2D 1B9MA 3NXWA 4LWCA 2TMPA 1O7LA 2F3VA 3NBIA 1F2LA 5LL6S 2AWNA 1IW7C 3AQQA 4IUPA 5M5YH 1KDCA 1IHZA 3PF4A 2N8NA 4BS9A 4YCVA 2NVQH 4N9PA 5IT9E 4JI1L 1K28A 4L63B 4V190 3E0JA 4ME5A 2JYOA 2VUMB 2LMCB 3KLRA 4FF1A 4A93H 4A3FB 1FR3A 1VCIA 4X62L 1RJTA 3D8GA 5IYCH 2CH4W 3P20A 4KN4C 2B8GA 4TVAB 3PUWA 1YBYA 2PQEA 2X6GA 5T1IA 5IGEA 3CXCA 3HP3A 4DR1Q 4ILWA 3NE5B 2KQ3A 1JCKB 3CMEA 2JJQA 1GVPA 4A3BH 4JI7L 2FMMA 1GUWA 1HNZQ 1HFGA 1E1OA 1VQ7A 3M7NA 1MHWC 1EEID 5IY0A 4HIMA 5C4JB 2IX3A 3BDLA 3BU2A 2E2DC 3I91A 3L2PA 1KAAA 4IUNA 3CQZH 2JEBI 3W2DA 1GUNA 4YHHQ 4CKEA 5HY6A 3SGIA 3OSOA 4KKTA 2GN5A 4DV3Q 4IURA 1WD1A 4X65L 3CCUA 3TS0A 5IYDH 4FVMA 3CU7A 4R4IA 3I73A 2QA4A 2JA6G 4M1UB 4IPDA 2EJFC 1QNUA 3PO3G 1VQKA 1GUTA 4TSSA 1KXLA 1RIPA 2PMZE 4DV6Q 2RVLA 3PUVA 2EIFA 1EFWA 2OQKA 3OW7A 5IIFA 1ENCA 4A3DG 2A1AA 3ICEA 3OYYA 4A3KH 2YU9H 2PNHA 4K5XA 2NTTA 1WTQA 3HOUG 2ZXRA 2IY5B 1IBMQ 1IL8A 3HOWG 4IPCA 2AMCB 2L55A 1N34Q 2Q2TA 2LSSA 3K5NA 3M4YA 3Q24A 1ZKOA 1TXYA 3SR1A 4JI3Q 3MXUA 3I4LA 3KOJA 2UUCQ 1R9TB 4R1JA 2PI2A 3SE0A 5C0XJ 1YEZA 4K5VA 1I94Q 2Y0SB 4DGZA 1HR0Q 2F0UA 4ZYSA 4KN7C 2YV5A 1LTLA 4KY6A 2EYFA 1E0BA 2EXDA 4DKAC 4HJ5A 3J80L 4AH6A 1K8MA 2A5HA 1JJCB 3WOFA 3Q23A 1JJ2A 1II3A 1QUQA 1HCZA 1EY7A 2L12A 3A74A 3PMFA 2CQAA 2UUAQ 3BDOA 2UXDQ 4JBKA 4TKOB 2Z6KA 1PZJD 5FKAC 3R93A 2ZXPA 3Q0AA 5D65A 3FKIH 3RLOA 1PHJA 1CSPA 1UE7A 1YNJD 3D6CA 3H0GH 2ZTDA 4Z9CB 2P5ZX 2DGYA 3J81j 1IYJB 2KA7A 1VDZA 1VQFA 1D7QA 1HNZL 3BYTB 4EX5A 4LF6Q 2HQEA 3F2BA 1E24A 2O4XA 4C1NI 1LO5D 1WCMB 1EIGA 4FP5D 4DR7L 3QJYA 2HDMA 2HD3A 4YHHL 2CH4A 4CKCA 4MNOA 1GM5A 3HKSA 5DM73 2RSOA 1OO9B 4A3GH 2CW0D 1EYGA 4LF8L 1RCVD 1VQMA 1BDOA 3CW2C 2O5IC 1YNJC 3S9WA 2A19A 1W3SA 1LYLA 4MZ9A 1X32A 5CR3A 4OHJA 1OTCA 1LT6D 1WVLA 4WJ4A 4I7AA 2NB0A 3E9IA 1WTPA 1Y14B 4EQNA 1ZYRC 4GKJQ 1L1OA 2E2HH 4DR4L 4NXML 3PIO3 3GTGH 4U673 4ZK9B 5G3LF 3MXGA 4GN4B 2K50A 3A7LA 1Y1WB 4FNFA 1I4PA 2L4NA 4HEDA 3UE0A 1F9QA 1UE5A 3TMEA 3HS0C 2KHSA 2A69D 4N8X1 3FRPB 5I4DA 5JPMC 1IBLL 1L2FA 2CW0C 1F2ZA 4DK0A 1VQAA 2K7VA 4DPGA 3I4OA 1N32Q 1IBML 4A3IH 1XWEA 4DN4M 1N33L 2MGSA 3G71A 1VQHA 4RHRA 4EQPA 5C4ZA 2KVMA 2OXPA 2IWHA 4R4TA 1LT4D 1TVXA 2F0EA 5ELOA 1STEA 3GTJB 4WFN3 4JI3L 2UUCL 1Y1VB 1TWFB 1KRTA 3QIAA 4JK1C 3KDFA 3AFQA 3HOVB 2A69C 1I94L 3A8JE 4JV5Q 2R93G 1YI2A 4A76A 1H9JA 4MIUA 2Z4IA 3D4DA 2PMZB 3QG1A 3HOXH 4NMZA 4DAYB 1DYQA 1VQOA 2A6ED 3TS2A 1I3QB 1H9MA 1UE6A 3HOZG 3KUPA 2E74C 1L0YB 2XWJB 3RD4A 4A3EH 2NVYH 4B3RL 4KJNA 3HG9A 4X66Q 1HNWL 1X55A 5JJIA 1H9RA 1RD9D 2XWBB 4B3SL 2MO0A 4GNXC 1ZXTA 5EKLA 2WB1E 2IX0A 1K83B 4RFBA 5J1ZA 3LWEA 4UDUC 1LTTD 5IE8A 1UE1A 2NZHA 3H3VH 1QB5D 2A6EC 2Q8IB 2IT1A 4XQQA 1EOVA 3DMUA 2K6AA 1EY0A 1YJWA 2ZXOA 3PUZA 3TREA 4OO1H 5JJLA 4A75A 4X6AH 3GP7A 2L0CA 4DXFA 2ZTEA 3H0GG 2IHEA 3S2DH 1VQCA 3PQIA 5DM63 5FLXL 5EGTA 2XNAC 3NHHA 2RCFA 1UUPA 4BY1H 5M5WB 2FHTA 1CA5A 5JEAG 1PH9A 2K32A 4DR6Q 2VQFL 2JA5H 4G57A 2F0TA 1IKMA 2LS01 2B2TC 4YCWA 4GOPA 1MKHA 3FEWX 3S16H 1ASYA 2KBNA 2G9HD 4C3IH 4GKJL 1LTAD 1PTOF 2R7ZB 1TY2A 1JE5A 1F9SA 1HZCA 4A3GG 1G6PA 4B3TQ 1FD7D 1EU3A 2EYOA 1G2TA 2ES2A 4UAIA 2B2YC 2HT1A 3HOYH 1CHPD 1N32L 1S5CD 4J6HA 2L11A 3BDCA 3MXNA 5CORA 2K28A 4ZAIA 1TIID 4C2MB 4MN3A 1FVIA 4ZLTF 2UU9Q 3KFUA 4IUQA 1S5DD 1B50A 4ZCKA 2EOTA 2ID0A 3J80i 4WJ3M 1UNSA 5M5YB 3BZDB 2F0QA 1QJOA 2Z9HA 4KJOA 4LF9L 5C4XB 1SSOA 3S1RB 2NN6I 3DXJC 3A0JA 4M8AA 2K5NA 4A93B 4BY7B 1HTPA 1PA6A 4CHTB 4AYBG 2CQOA 4APVA 1A62A 2KUMA 5IODA 1A3UA 2H5XA 2X6LA 1KL9A 3E0EA 2JEAI 2E2JH 4A3BB 5A2QL 4LMQD 3M3YH 4KI0A 2NVXH 3DWQA 3HKZG 1Z47A 4RGTA 1M90C 2HIXA 2RDHA 3NWTA 1KLGD 1AN8A 4OWXB 5ELFA 3TZUA 1T5XD 4Q5VA 5IGDA 1SNDA 1D5XC 3C3LA 3KF6B 1SNQA 1PH6A 4L5SA 5IT9L 1KQSA 1Q1EA 4X3UA 4XYOA 2BE5D 5KNDA 3GTLH 1B4OA 1M8AA 5FO7B 2WACA 4GN5A 1AW7A 2NTSA 1K3RA 5LMUQ 4A3MH 4EVOA 4DV0L 5C44G 3O13A 2UXBQ 4QF4A 5JVH3 1LTID 1X3GA 1QOHA 3CCRA 2V1CC 1B3AA 5JAVA 2B2WC 1CFMA 4BBSH 5IWAQ 3PUYA 1V1OA 1NSNS 1B1ZA 3BJUA 4JOIA 4A4IA 2BE5C 2JP1A 2WB1B 4IOCA 4LF7Q 2RHQB 4DV5Q 4XYQA 3WWVA 1A3TA 2F0PA 4A3FG 1C48A 1SROA 1A63A 1YJNA 2ZJPA 2WV6D 4JI8L 3S1MB 2XRQD 1MSGA 4NXNQ 4C3JB 1PH3A 1UEAB 5KGUA 1S72A 1GHKA 3C1FA 2XGTA 5C0XG 1I6VC 1MD2D 2QF7A 4RAUC 4K6LA 1S5ED 1KLUD 1EWIA 1MJCA 4JI2Q 3J7ZC 4X64L 3OPOA 4G7ZC 5FO9B 2KEEA 1E22A 3KK7A 3BVZA 1FYCA 2BH2A 3GTKH 1HUNA 3NP8A 2C9OA 1EIFA 3I4MG 1BBUA 1I4QA 2EJMA 4G7HC 2Q2IA 3SK4A 1HZBA 5EBDA 2K5DA 3CCMA 4HJAA 1ENAA 4K8JA 2WAQG 1RDPD 5T1GA 3FKIB 4RH6A 1D1IA 1G6ZA 3OIQA 3DEPA 5HURA 5E4WC 1D1KA 2V4DA 4FXDA 3KF8B 3NTKA 3S17B 4JI1Q 3UI2A 5I6WA 1XJVA 2NWGA 1NUCA 4X62Q 2R61A 4KTAA 2K01A 1WTOA 3S15H 1T9HA 1U0LA 2JA7B 4DR2L 1F2YA 4KK7A 3U9OA 3W1BA 2BDOA 2QKIC 4B08A 3OTOL 5BN4A 3KYHC 3I8ZA 5CMDA 1TKWB 4UHVA 4RKBA 4JI7Q 2FXQA 4GZYC 2JA9A 2JA8G 1F9PA 2AWOA 3TEHB 4OIJA 2EY1A 4DV4Q 1YITA 3JAME 3R8BA 3M4PA 5EKIA 1PXUA 3RN2A 3T51B 2JA6H 1HQRD 1V1PB 1HZAA 2F3WA 1LV9A 5DLQE 2RKSA 2UXBL 2VB3X 4K6DA 5CGKA 1QVFA 1AZQA 1SJED 3V96A 1E7ZA 4GNXB 3CHBD 2AUKA 2D0PA 1JWUD 1Z9FA 2JQOA 3HOUH 1CHQD 1HH2P 5FLXc 3MFYA 3HOWH 4A3IB 3K5LA 2F0LA 5JEAJ 1PFNA 3R2TA 2JSOA 1GJXA 5JPNC 4LFCL 3IFTA 5I6YA 1L0WA 2R3ZA 1BNZA 2O2LD 4PMCA 1XX8A 1B44D 2WFWA 4LJZC 3CPFA 4N9TA 1VQ4A 1IW7D 4QL5A 2BDNA 2R6GA 2K75A 2XSCA 4YWKA 1CZWA 2K52A 4DNRB 1FNWA 1SNCA 2EQSA 3DM1A 3EIVA 2B29A 1HPCA 4JI2L 1XNRL 1NR2A 3W1GA 1SNPA 3HOXB 4QIWE 4DNIA 2I46A 1SE8A 4HSPA 1BOSA 3UE1A 4LUOA 4IPHA 4ODGA 1SYEA 4A3EB 4CGYB 3H3VI 3IFDA 4K2KA 1WTHA 3BZKA 3CC4A 4PNYA 2MNAA 4OO1I 4CDCC 2FINB 3BVGA 2R92G 4XTCS 1MIUA 2F52A 1WI5A 4DAYA 4LAAA 2CWAA 1JWSD 2J7ZA 1U4LA 3LGJA 1W2BA 2GVBA 5CV4A 2F0OA 4GN3B 2A8VA 4V0BA 1Y1WG 2NZ1D 4UP7A 2MFIA 1E3PA 3H09A 1JMCA 3OMCA 1A3VA 1VQLA 2DNCA 4IPGA 1L0XB 3KLSA 4HSVA 4U68A 3LX0A 1QVGA 2PNRC 4FXKC 1TWAH 3N6RA 1BQQT 1RTOA 4DV4L 1VQJA 4BY1B 1BBWA 4S3SA 4JBMA 1Z6HA 4Q0FA 3BG3A 2JA5B 3H94A 4DR7Q 4LUZA 1DCZA 2KCCA 3QOLA 1Y1VG 3PUXA 3J81L 1ILQA 4LF8Q 2FMCA 4DXGA 3L3OC 1J9OA 1X56A 4PV1C 2XIWA 4RMFA 3A56A 2OQ0A 1CT1D 1MJEA 1VMCA 4NW2A 2YTYA 4DFAA 3GTQB 4J1MA 4DR4Q 4NXMQ 1F77A 1WD0A 2WKDA 1HZ9A 2EPBA 1HRJA 4UY8C 1BXTA 5FOBB 2ATWA 1Q81C 2IL8A 5I2XA 1IBLQ 1Q82C 1H95A 2I5MX 2EY5A 1C4QA 3CRKC 2ICEC 2YTVA 1CKOA 1U4MA 1D5ZC 4JCVE 5EPKA 4MTNA 2R93H 1EYAA 2EYMA 1N33Q 1C9OA 1X3FA 2IW3A 1K73C 3DLLA 3RZOH 4PG3A 4QGUA 2F0GA 5D3DA 3UDGA 4IFDI 4RA8A 3HOZH 4AIMA 2B63B 1JJGA 1QG7A 2OCEA 3I72A 2KHJA 4LF4L 1TWGB 1O7YA 3U4ZA 4RCOA 4Y7NB 1FNUA 4L8JA 1MI2A 1GD7A 1JICA 3NENA 4FO2A 4C56C 5E3FA 4OGQC 4IUTA 1WYDA 2K05A 1DOMA 1TWHB 4QQBX 1E1TA 2N78A 4JC0A 1X9NA 4KHVA 5GAHC 1BBXC 3K7AB 3EROA 4B3RQ 1NAPA 2R7ZG 2OT2A 3GTOB 1HNWQ 2E75C 2F0WA 3QOJA 1JORA 1PH5A 2CHBD 4R9WA 2MO1A 2EYHA 3K0XA 3TP7A 4B3SQ 1YHQA 3GTLB 4DK6C 4L5TA 3TP8A 1PV4A 3T56B 3RZDB 3CAMA 3DUZA 4QIWB 4FF2A 1EY5A 3J7AV 4QY7A 1AE2A 2HUGA 4YWLA 1QNKA 2K04A 1LACA 3KF6A 2UXCL 1ZYRD 5JEAH 2VW9A 4CDFC 3NBHB 1I50B 5JJKA 1YHAA 5FO8B 4XQNA 2LXJA 2WKCA 1H9SB 3CC7A 1Q3LA 3K81C 4BBSB 2LKVA 3M4OB 5C3EB 3OWEB 3PO2H 3E3XA 4JBWA 1XTDA 4OX9L 1XXGA 5C4XG 2XRSD 3ZYYX 1S5BD 2VQFQ 4A3JB 3TRZA 4BY7G 2C5CA 3NQIA 5IGFA 2F0DA 2PQAB 1KABA 3CMAA 2ZTCA 1EIHA 2VB2X 4NDXA 3BS1A 1SLJA 4OXPA 2F0VA 3IRBA 1JWMD 3I4NB 2M00A 4HN7A 2NN6G 1CTMA 3NUCA 4LF5Q 1NNXA 4HMIA 1PTOH 4CJ1B 1ESFA 5K5PA 4P73A 5CBEE 2QGQA 3ERQA 2NVTH 1K8OA 5M5XB 3ZJYC 5COYA 1HA5A 1RL2A 4F7XA 5C3WA 2F03A 1TS5A 4OEMB 2KCMA 3S1NB 4E6IA 4IJHA 2E8GA 4LF9Q 2NBFA 2M2LA 3GTPH 1VQBA 4JVZA 1DXMA 1GXDC 3EA6A 1WTVA 1X54A 4FDBA 1YIJA 3AU7A 3NTHA 5F2DA 2K4KA 1A2TA 3K6OA 2MJ8A 1K8GA 1I6HH 1HJPA 1Y8OB 3KF8A 3C2PA 1Z7TA 4KMUC 1PRTD 1SNOA 2F1MA 1STHA 2L15A 2SNMA 2RF4A 1BO0A 2VQEQ 3D3RA 1J6QA 2ENBA 3I2ZA 1SYFA 3W5OA 3S1QB 4YWMA 1AP0A 4C3HH 4DR3L 2B2UC 1JB3A 2EY2A 1SN8A 2OTLA 5C44H 4ZUJA 1EYDA 3PO3B 3J81i 1DJRD 1SYDA 3FPUB 3SK6A 4KKUA 4DA2A 1ZEQX 4A3DB 2J0TD 1GUGA 1Q1BA 2PW7A 5ELCA 1BVSA 2QEXA 1RHPA 1ILPA 1PRTC 1TQOA 4RCNA 4FXGC 3HOUB 4DV0Q 1AH9A 3HOWB 2E5LL 3DM3A 1ENFA 1V1PA 1CQFA 1KNAA 4DAVA 1ESRA 1SYBA 2VUMH 2B8FA 4A3FH 2VNUD 5CYUA 3GTMB 1DONA 1NTGA 5M3FG 3PIPA 4GNXA 5DEHA 2AKWB 3J81c 5C0XH 3S14B 3PO2G 3E9HA 1LT3D 1CKNB 2SDFA 3CF5A 3QB3A 2AQ1B 4A3CH 1HTLD 3IL8A 5C4JH 4JI8Q 3AEVA 1FGUA 4UP9A 2JA7G 2FFKB 4LF5L 2AQ3B 4DR5L 5GADC 3I4MH 1IZ6A 3M9BA 1XMQL 1UAPA 4O2DA 4XT3B 3UDXA 3CRLC 3VYRA 4DV1Q 5M3MG 1HHVA 1OXVA 3R3OA 1I4RA 3H3VC 5KEEA 3ND9A 3TSSA 1IYUA 4X64Q 1E2ZA 1BCPC 2B2VC 2B2TA 3S2HH 4XIGS 3UDIA 5FLMG 1LLRD 3HEJA 4HAEA 3NSWA 4BBRG 2NVQB 1V43A 4X3SA 1SE4A 2M9VA 2A68D 1Q86C 2ZT9C 2IHFA 4DAPA 2KCNA 3K5MA 4B9XA 3T13A 3AFPA 4KD3A 4Y52H 2B3GA 1MBYA 5D14A 5HGQA 3K8AA 2K03A 3CCJA 2KCTA 3OHXC 1S4ZA 3PSIA 4RWSC 3Q22A 1J5EL 2B2YA 3NEMA 3F8TA 2H1EA 2JA8H 3MA2B 1QCBD 4IQZA 4KY7A 4FF3A 4JI6Q 1EL0A 2EY6A 2VQEL 1B9NA 4YCUA 1VQ6A 1STAA 3J80c 3QWNA 5C5MA 4DR2Q 4LFBL 3I7FA 3OTOQ 5KNCA 1YJ9A 3CQZB 2A68C 2B2VA 4OWWB 1CA6A 3NQTA 1R9TH 3I90A 1EYCA 1U4PA 4AYBE 4GKKL 1P16A 1PYSB 4RHSA 1PZKD 2D9UA 5FJ8G 1X3PA 4I7ZC 3VDYA 2K14A 2KJXA 4DK3C 4C3HG 3HKZE 4K0KL 3CCEA 2KECA 5GROA 3CCSA 5I2YA 5JJZA 1OXUA 3U50C 1OXXK 5IYBG 1P8LA 2A6HD 1EIYB 1HFNA 1YNND 5ELNA 3K59A 3PV0A 2KEDA 2PZWA 2GA4B 2MP1A 1OXSC 2QILA 2EXZA 1PFBA 1PYWD 4DUYL 4A3KB 2Q2UA 2YU9B 1SXTA 1UEBA 1VMPA 5K36G 3DHQA 3VYTA 2I07B 4XQJA 3NTIA 3K5OA 5E4XA 1A15A 3EQLC 2R93B 1CI3M 1GOZA 1XNQQ 4DK1A 3D6WA 4P72A 1Q8KA 2VUMG 3J7YW 4DUZL 1XMOQ 3MEHA 4LFCQ 1ONLA 3J7AF 2KHIA 1AEXA 1WCMH 5J3BA 4EQ5A 3N52A 2A6HC 2HQLA 1YNNC 4OELB 1RTNA 5KIXA 5I9PA 2HCIA 2LY7A 4P74A 2HHHL 1EQTA 1EWHA 3DEOA 5KNBA 2L1BA 4DV1L 4IO9A 5IP9G 4BXXH 1S3OA 2R92H 1HUMA 4IN3A 1XNRQ 2HIVA 1LT5D 2ZJRA 4A3CG 1V8QA 3HFZB 2B2WA 1HQMC 4H13C 3NK9A 2Z8LA 4F87A 1YZ6A 5TSSA 1XTCD 1X6OA 1HNXL 1N9WA 1Y1WH 4KHPQ 5ELEA 2I5LX 4PMWA 1TU2B 3T1HL 3H0GB 2PPBC 2ICIA 1IXRA 4J15A 4WRDA 3VR2A 1D8LA 3UDFA 4JI6L 4QUCA 5AJ3L 1TY0A 2K5QA 1VQEA 2PO4A 1KDAA 4UPAA 4YIJA 2MHVA 4GLXA 4I65A 3GTJH 1EUJA 1JOOA 2DUDA 1XYIA 4OIKA 1Y1VH 5CV5A 3BZCA 1TWFH 2WAQE 5IP7H 4JBJA 5KYLA 3SHLA 4A3GB 3I55A 2PZUA 1B53A 1G51A 3PIP3 2F0SA 4ME3A 1PH8A 1FNVA 4KLKA 3NBHA 3IKJA 3P75A 1SJHD 1K8AC 3GO5A 4IJLA 3QO2A 2RHSB 3F1ZA 5EBCA 1KHIA 3KJOA 1H9SA 2PZTA 1Q90A 5FLXE 2E2HB 2B63G 2EDGA 5C6AA 3GTGB 1G2SA 3KBXA 1TT2A 1PFSA 2Y0SG 4RGMA 4EGVA 3MVVA 2CFMA 4XXEA 3ERSX 1PH1A 4CBVA 4OWTB 4DV7Q 3GDEA 2N88A 1A6XA 2L9HA 2PQAA 4KKSA 3I56A 1K83H 4JG2A 1SAPA 5IGCA 1XNQL 4CDEC 4A3LG 5C5LA 4HCSA 4HIDA 1G291 1XMOL 4AYBB 3FPPA 1QILA 1PRTB 2AUJD 1EQQA 2LFNA 1G91A 5GQOA 1JE4A 3RN5A 1SYGA 3CKIB 3HKZB 4F88A 3GTPB 2QCPX 1PFMA 5LL6X 3K80C 1LTBD 2CVRA 3OW2A 3OWFA 1SE2A 3V05A 1TWCH 1NBWA 1WCMG 3NWSA 1XPRA 1WTXA 3A8IE 2PYKA 4ZUIA 2JN4A 1KC8C 4LF4Q 2R7ZH 1K3BC 2NVYB 3SXHA 1B7YB 5C3EG 4HJ7A 3D0FA 4KHPL 4BXXG 4HMJA 1Y69U 1IL2A 4KV6A 1EY6A 2Q2HA 4L5RC 5KYIA 3SDZA 1VQGA 1C0AA 4MHEA 1BR9A 3M4QA 5A2QE 4IUUA 2C35B 1CUKA 1BUVT 2CWPA 3TP5A 1VQNA 4KHZA 4P75A 1ML0D 3FDTA 1PMRA 1TS4A 1BCPB 4LFAL 5GAEC 1FL0A 5DAUA 1SFOH 2Z0SA 3TQYA 3I4NG 2Z6BA 3SEBA 5C0XI 2UUBL 2I5HA 1CK1A 3QR8A 4RGNA 3S2DB 3A8KE 5LMNW 5C4XH 1EU4A 3FMCA 5LMNL 2UXCQ 3S1RH 5M9OA 1M4VA 3AMUA
chains in the Genus database with same CATH topology
1V1QA 3HOYG 4BY7H 4GS3A 2HT1A 3HOYH 5BR8L 2PQAB 1N32L 3CP0A 1KIXA 4AQYL 5M5XH 3CMAA 2ZTCA 1FVIA 4LFAQ 2RCNA 3KJPA 2UU9Q 3KFUA 1SR3A 1SLJA 5IT9c 4OXPA 2R7FA 2ID0A 3J80i 4RG1A 5IP7G 3IRBA 2UUBQ 4WJ3M 1PH4A 4OX9Q 4POFA 3S1NH 4PZ7A 4BA2I 3FP9A 3HOVG 1PH7A 1CKMA 5LMNQ 3STBC 3HOVH 2NN6G 1PVOA 3CCVA 2XTIA 4LF5Q 1VQ8A 4LF9L 3Q8DA 1KAWA 2D62A 5BR8Q 2NN6I 4HJ8A 4DV7L 3A0JA 4AQYQ 2K5NA 3JAMi 4P73A 1I3QH 1B8AA 1PA6A 1BKBA 2QGQA 4AYBG 3G4SA 2NVTH 1WJJA 2CQOA 4APVA 1S40A 1A62A 4PZ6A 3ZJYC 1ASZA 3G48A 2H5XA 1RL2A 1KL9A 3E0EA 1CKNA 3ULPA 2E2JH 2JEAI 3M3YH 1X65A 4O0AA 4GLAC 4JYAL 4KI0A 3A5ZB 2NVXH 2KCMA 2AHOB 1Z47A 3HKZG 5EAYA 4IJHA 2E8GA 2HIXA 3U4VA 4YY3Q 1M90C 4LF9Q 2F4VQ 3S1QH 1NY4A 3GTPH 1VQBA 3ER0A 1NJIC 2KENA 2WP8J 4OWXB 3PF5A 3B6YA 4IFDG 5LMUL 3PO3H 1X54A 4FDBA 1NMGA 4P71A 1YIJA 1QZGA 2ZM6Q 4POGA 3PGZA 1YHBA 2K4KA 3KF6B 4LUVA 1UWVA 1PH6A 1K8GA 3CC2A 4L5SA 1I6HH 1VQ9A 4GOPB 1KQSA 1Q1EA 4A3DH 2NZOA 1HJPA 4X65Q 3RLNA 4JYAQ 4HIOA 3JAMc 2L15A 1XPOA 1N8RC 2RF4A 3GTLH 1C7YA 1QVCA 1CSQA 2Y0SE 2Z6KC 3I2ZA 1J6QA 3W5OA 5IWAL 2VQEQ 4GN5A 1FJGL 4YWMA 2E2IH 4C3HH 2LXKA 4A3MG 4DR3L 1K3RA 3CD6A 3F2CA 5LMUQ 4A3MH 4DV0L 5M5WH 5C44G 4LF7L 3G6EA 1SN8A 2OTLA 5C44H 4DV5L 3S1MH 2UXBQ 3J81i 4C3JH 3GTMH 3PCOB 1X3GA 2VZAA 4NXNL 2F3IA 2ASBA 3CCRA 4BBSG 2V1CC 3MXNB 5E7NA 3NELA 4BBSH 1JT8A 3S14H 5IWAQ 1Q1BA 3PUYA 1BVSA 2QEXA 3ULLA 1FJGQ 3BJUA 4JOIA 1PH2A 4A4IA 4DR3Q 1WOCA 2YTXA 4DV0Q 1AH9A 4IOCA 4LF7Q 4A3JG 3DM3A 1QZHA 2RHQB 2E5LL 4DV5Q 3WWVA 1XPUA 3PIOA 1EQRA 3EN2A 4A3FG 2VUMH 4R4QA 1SROA 1A63A 1YJNA 4A3FH 2ALYB 2ZJPA 4JI8L 1PYBA 2VNUD 4NXNQ 1M1KC 1PH3A 2YYZA 3L0OA 4C2MH 2R7DA 1LM0A 1S72A 1NTGA 4LWCA 2XGTA 5M3FG 3L7ZC 3PIPA 4GNXA 4L5QA 5C0XG 5M3FH 2AKWB 3J81c 2AWNA 1IBKQ 1V9PA 2VL6A 4DR1L 3S17H 3AQQA 3PO2G 1L1OC 5M5YH 3E9HA 1EWIA 1MJCA 1VS0A 2N8NA 1CKNB 4JI2Q 4X64L 3J7ZC 1VQ5A 2E5LQ 3PF4A 3CF5A 4YCVA 1E22A 2NVQH 4JI1L 4A3CH 2BH2A 5C4JH 3GTKH 4JI8Q 1B70B 3AEVA 1FGUA 4UP9A 2JA7G 4A93G 1EIFA 4LF5L 4R4OA 1BBUA 4DR5L 2JA7H 3I4MG 4A93H 5IYCG 4PZ8A 1VCIA 4X62L 2Q2IA 5GADC 3I4MH 1HZBA 5IYCH 1IZ6A 3M9BA 3CCMA 4HJAA 1XMQL 4TVAB 4O2DA 3UDXA 3PUWA 2WAQG 1YBYA 5H1SE 5M3MG 4DV1Q 1OXVA 1AE3A 3CXCA 4R4CA 4DR1Q 5M3MH 3M85A 2JE6I 4A3BG 2JK8A 3KF8B 2JJQA 1GVPA 1VQIA 4X64Q 3CMEA 4JI7L 4A3BH 4DV3L 4JI1Q 2PI2E 1N36Q 3S2HH 4XIGS 3UDIA 5FLMG 1HNZQ 1E1OA 4BBRG 1VQ7A 4JI0Q 3M7NA 5FLMH 1SMXA 1XJVA 1V43A 4BBRH 4DR5Q 5IY0A 4YY3L 4HIMA 2F4VL 1NMFA 4X62Q 4IFDJ 3BU2A 3S15H 1Q86C 3L2PA 1T9HA 1U0LA 3CQZH 3K7UC 3GD7A 2IHFA 4DR2L 1XMQQ 2JEBI 3W1BA 4JI4Q 4YHHQ 3CPWA 3OTOL 3AFPA 4DV6L 3KYHC 2B3GA 4Y52H 5HY6A 2ZM6L 3SGIA 4HJ9A 5HGQA 2GN5A 3K8AA 3CCJA 3S24A 2KCTA 4JI7Q 2FXQA 2CCZA 2JA9A 1K0RA 3PSIA 4DV3Q 1J5EL 2JA8G 2AWOA 3NEMA 4X65L 3F8TA 3TEHB 4NB3A 5IYDG 2JA8H 4DV4Q 3CCUA 3TS0A 5IYDH 4JI6Q 1YITA 1Q46A 2VQEL 4R4IA 3M4PA 4YCUA 1VQ6A 2QA4A 5GAGC 2JA6G 3J80c 3RN2A 4DR2Q 4IPDA 3PO3G 4LFBL 1VQKA 2JA6H 1KXLA 3I7FA 1HZAA 3OTOQ 1RIPA 2PMZE 4DV6Q 1YJ9A 1N34L 4B3MQ 3T1YQ 5DLQE 3PUVA 2EIFA 4OWWB 1EFWA 2UXBL 2OQKA 1R9TH 4A3DG 2A1AA 3ICEA 1YVCA 4A3KG 1J5EQ 4AYBE 4GKKL 4OONA 1P16A 1PYSB 3OYYA 4A3KH 2YU9H 1QVFA 2PNHA 1E7ZA 4GNXB 5FJ8G 1I5FA 1HR0W 2D0PA 3HOUG 5FJ8H 1Z9FA 2JQOA 3VDYA 1HR0L 2K14A 2IY5B 2WB1G 1IBMQ 3HOUH 3HOWG 4DK3C 1HH2P 3HKZE 5FLXc 3CCEA 3HOWH 4K0KL 4IPCA 4LFBQ 5GROA 3CCSA 2AMCB 1X3EA 1N34Q 2Q2TA 3MEFA 1OXUA 5JEAJ 3U50C 1OXXK 2LSSA 5IYBG 1P8LA 1EIYB 5IYBH 1TXYA 5ELNA 4LFCL 2UUAL 1DGSA 1L0WA 3PV0A 4JI3Q 4GKKQ 3KOJA 2UUCQ 1OXSC 2WFWA 2UXDL 4R1JA 2PI2A 5C0XJ 3CPFA 4DUYL 1VQ4A 4QL5A 1YEZA 2Q2UA 1UEBA 2R6GA 1I94Q 4GOPC 1HR0Q 1NE3A 3J7A5 5K36G 2K75A 2YV5A 1LTLA 4K0KQ 4LW1A 4YWKA 1IBKL 1JB7A 2K52A 2EQSA 3EIVA 2EXDA 4HJ5A 2B29A 4DKAC 2BA1A 4JI2L 1XNQQ 4AH6A 1XNRL 4P72A 1Q8KA 3W1GA 2VUMG 1JJCB 4QIWE 4DNIA 4DUZL 1XMOQ 1JJ2A 1QUQA 1SE8A 3A74A 2UUAQ 4LFCQ 2KHIA 3UE1A 1WCMH 5J3BA 4EQ5A 4LF6L 2UXDQ 4LUOA 4JBKA 2HQLA 4IPHA 4DUYQ 2Z6KA 3H3VI 1Q12A 3FKIG 3CCQA 1KRSA 3FKIH 4P74A 2HHHL 3BZKA 3CC4A 4JI5Q 3RLOA 1PHJA 2MNAA 4DV1L 4IO9A 4OO1I 1CSPA 1UE7A 5IP9G 4BXXH 1S3OA 3H0GH 5IP9H 2ZTDA 2R92G 2DGYA 1MIUA 2F52A 4XTCS 3J81j 1VQPA 1XNRQ 2HIVA 2R92H 2ZJRA 1WI5A 1IYJB 4A3CG 4DUZQ 1N36L 2CWAA 1VQFA 1D7QA 1HNZL 3LGJA 3HFZB 4JI0L 4EX5A 3F2DA 4LF6Q 1W2BA 3F2BA 1E24A 2GVBA 1SRUA 4GN3B 2A8VA 1Y1WG 1YZ6A 4DR7L 1LUZA 4UP7A 1X6OA 2MFIA 1N9WA 1Y1WH 1HNXL 2HHHQ 4KHPQ 4JI4L 1E3PA 4YHHL 2I5LX 1JMCA 4MNOA 1GM5A 3HKSA 4A3GH 4PMWA 1VQLA 2N49A 4IPGA 3T1HL 1EYGA 4LF8L 1VQMA 3CW2C 3U58A 1QVGA 4HIKA 1IXRA 1TWAH 4J15A 4BA1I 2A19A 4ALPA 1W3SA 4DV4L 1LYLA 1D8LA 1BBWA 1VQJA 3GTQH 4MZ9A 3UDFA 1OTCA 4JBMA 4JI6L 4WJ4A 5AJ3L 1VQEA 3E9IA 4DV2Q 1Y14B 4DR7Q 1K9MC 1HNXQ 4GKJQ 4LUZA 2I0QA 1L1OA 2E2HH 4DR4L 4NXML 4UPAA 3GTGH 4GLXA 4BY7G 4B3ML 2K50A 4GN4B 3GTJH 3T1YL 1EUJA 2DUDA 1Y1VG 3FHWA 3UE0A 4LNQA 3PUXA 3T1HQ 1Y1VH 1UE5A 2OWOA 3BZCA 1TWFH 2WAQE 4LF8Q 5IP7H 4JBJA 1X56A 3I55A 4RMFA 1IBLL 1G51A 2OQ0A 1L2FA 1VQAA 4ME3A 1MJEA 4DPGA 1PH8A 5AJ3Q 3I4OA 3EBEA 4A3IG 2YTYA 4QJFA 4JV5L 4KLKA 1N32Q 1IBML 4A3IH 2OTJA 1K8AC 4H02A 3GO5A 4IJLA 1N33L 4DR4Q 4NXMQ 2RHSB 3F1ZA 1KHIA 3G71A 1Q7YC 1VQHA 3KJOA 1HZ9A 1QUQB 2BH8A 2B63G 4R4TA 5ELOA 4DAMA 4UY8C 2B63H 1YNXA 2ATWA 1Q81C 4JI3L 1PFSA 2Y0SG 1TWGH 2MQHA 1IBLQ 2UUCL 2K5HA 1KRTA 1Q82C 1H95A 3H15A 2I5MX 4TQUS 3KDFA 3AYHB 4X66L 3AFQA 2CFMA 4Y7NH 3ERSX 2YTVA 1CKOA 3KLWA 1I94L 4JV5Q 2R93G 1PH1A 1YI2A 4DV7Q 4OWTB 4JCVE 4A76A 3GDEA 4MTNA 2R93H 2PQAA 1N33Q 1C9OA 3HOXG 1X3FA 3I56A 1K83H 1TWHH 4JG2A 3HOXH 1A8VA 4DAYB 3DLLA 4JOIC 1VQOA 1K73C 3RZOH 3TS2A 1XNQL 4A3LG 4PG3A 4QGUA 4A3LH 4HIDA 1UE6A 1G291 3UDGA 3HOZG 4A3EG 4IFDI 3K7AH 1XMOL 2CKZB 2VY3A 3HOZH 4A3EH 4AIMA 3GTOH 2NVYH 1JJGA 2OCEA 2K5VA 2KHJA 4B3RL 1O7IA 4X66Q 1EQQA 2BA0A 4LF4L 1HNWL 5GQOA 1X55A 5JJIA 3RN5A 4JI5L 3U4ZA 4B3SL 3RZDH 3ULJA 1GD7A 3NENA 4IOAA 1A0IA 2MO0A 4GNXC 3CCLA 3K80C 2IX1A 4UP8A 2WB1E 2IX0A 3OW2A 1WYDA 1OXTA 4QQBX 1E1TA 1TWCH 2N78A 4JC0A 5IE8A 1X9NA 1NBWA 1I50H 1WCMG 4DR6L 1UE1A 2NZHA 1GKHA 5GAHC 1XPRA 3RLFA 3H3VH 2IT1A 2N3SA 1EOVA 4B3RQ 3RR5A 2R7ZG 1KC8C 2D0OA 4LF4Q 4OO1G 1YJWA 1L1OB 2R7ZH 1HNWQ 3PUZA 3JC66 3TREA 5JJLA 1B7YB 5C3EG 4HJ7A 4A75A 1PH5A 4GLVB 3M4OH 2MO1A 3K0XA 5C3EH 3D0FA 4KHPL 4X6AH 4B3SQ 4BXXG 1YHQA 2ZTEA 3H0GG 4DK6C 1IL2A 2IHEA 4L5TA 3S2DH 1VQCA 1PV4A 1VQDA 2Q2HA 1U5KA 4L5RC 3CAMA 2ZJQA 3RNUA 4BY1G 1VQGA 4A3JH 1C0AA 4B3TL 4BY1H 3M4QA 4QY7A 1AE2A 4YWLA 2JA5G 5JEAG 1PH9A 4DR6Q 2UXCL 3KF6A 2VQFL 2JA5H 2C35B 2VW9A 1CUKA 2CWPA 4YCWA 2VS1A 3NBHB 4GOPA 1MKHA 1VQNA 4KHZA 3S16H 4P75A 5JJKA 1YHAA 1ASYA 2KBNA 4C3IH 2LXJA 4DV2L 1KD1C 3D31A 3CC7A 4GKJL 3K81C 4LFAL 5GAEC 1JE5A 1FL0A 1SFOH 2UU9L 1WFQA 1HZCA 2Z0SA 3A5UA 3TQYA 3I4NG 4A3GG 3STBD 1G6PA 3PO2H 3I4NH 5C0XI 2GVAA 4JBWA 2UUBL 2I5HA 1XTDA 4OX9L 5C4XG 4B3TQ 1GO3E 5LMNW 3KDFB 5C4XH 5LMNL 2UXCQ 2VQFQ 3S1RH 3TRZA 4NPSA 2ES2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1Q A;  3HOY G;  4BY7 H;  4GS3 A;  2HT1 A;  3HOY H;  5BR8 L;  2PQA B;  1N32 L;  3CP0 A;  1KIX A;  4AQY L;  5M5X H;  3CMA A;  2ZTC A;  1FVI A;  4LFA Q;  2RCN A;  3KJP A;  2UU9 Q;  3KFU A;  1SR3 A;  1SLJ A;  5IT9 c;  4OXP A;  2R7F A;  2ID0 A;  3J80 i;  4RG1 A;  5IP7 G;  3IRB A;  2UUB Q;  4WJ3 M;  1PH4 A;  4OX9 Q;  4POF A;  3S1N H;  4PZ7 A;  4BA2 I;  3FP9 A;  3HOV G;  1PH7 A;  1CKM A;  5LMN Q;  3STB C;  3HOV H;  2NN6 G;  1PVO A;  3CCV A;  2XTI A;  4LF5 Q;  1VQ8 A;  4LF9 L;  3Q8D A;  1KAW A;  2D62 A;  5BR8 Q;  2NN6 I;  4HJ8 A;  4DV7 L;  3A0J A;  4AQY Q;  2K5N A;  3JAM i;  4P73 A;  1I3Q H;  1B8A A;  1PA6 A;  1BKB A;  2QGQ A;  4AYB G;  3G4S A;  2NVT H;  1WJJ A;  2CQO A;  4APV A;  1S40 A;  1A62 A;  4PZ6 A;  3ZJY C;  1ASZ A;  3G48 A;  2H5X A;  1RL2 A;  1KL9 A;  3E0E A;  1CKN A;  3ULP A;  2E2J H;  2JEA I;  3M3Y H;  1X65 A;  4O0A A;  4GLA C;  4JYA L;  4KI0 A;  3A5Z B;  2NVX H;  2KCM A;  2AHO B;  1Z47 A;  3HKZ G;  5EAY A;  4IJH A;  2E8G A;  2HIX A;  3U4V A;  4YY3 Q;  1M90 C;  4LF9 Q;  2F4V Q;  3S1Q H;  1NY4 A;  3GTP H;  1VQB A;  3ER0 A;  1NJI C;  2KEN A;  2WP8 J;  4OWX B;  3PF5 A;  3B6Y A;  4IFD G;  5LMU L;  3PO3 H;  1X54 A;  4FDB A;  1NMG A;  4P71 A;  1YIJ A;  1QZG A;  2ZM6 Q;  4POG A;  3PGZ A;  1YHB A;  2K4K A;  3KF6 B;  4LUV A;  1UWV A;  1PH6 A;  1K8G A;  3CC2 A;  4L5S A;  1I6H H;  1VQ9 A;  4GOP B;  1KQS A;  1Q1E A;  4A3D H;  2NZO A;  1HJP A;  4X65 Q;  3RLN A;  4JYA Q;  4HIO A;  3JAM c;  2L15 A;  1XPO A;  1N8R C;  2RF4 A;  3GTL H;  1C7Y A;  1QVC A;  1CSQ A;  2Y0S E;  2Z6K C;  3I2Z A;  1J6Q A;  3W5O A;  5IWA L;  2VQE Q;  4GN5 A;  1FJG L;  4YWM A;  2E2I H;  4C3H H;  2LXK A;  4A3M G;  4DR3 L;  1K3R A;  3CD6 A;  3F2C A;  5LMU Q;  4A3M H;  4DV0 L;  5M5W H;  5C44 G;  4LF7 L;  3G6E A;  1SN8 A;  2OTL A;  5C44 H;  4DV5 L;  3S1M H;  2UXB Q;  3J81 i;  4C3J H;  3GTM H;  3PCO B;  1X3G A;  2VZA A;  4NXN L;  2F3I A;  2ASB A;  3CCR A;  4BBS G;  2V1C C;  3MXN B;  5E7N A;  3NEL A;  4BBS H;  1JT8 A;  3S14 H;  5IWA Q;  1Q1B A;  3PUY A;  1BVS A;  2QEX A;  3ULL A;  1FJG Q;  3BJU A;  4JOI A;  1PH2 A;  4A4I A;  4DR3 Q;  1WOC A;  2YTX A;  4DV0 Q;  1AH9 A;  4IOC A;  4LF7 Q;  4A3J G;  3DM3 A;  1QZH A;  2RHQ B;  2E5L L;  4DV5 Q;  3WWV A;  1XPU A;  3PIO A;  1EQR A;  3EN2 A;  4A3F G;  2VUM H;  4R4Q A;  1SRO A;  1A63 A;  1YJN A;  4A3F H;  2ALY B;  2ZJP A;  4JI8 L;  1PYB A;  2VNU D;  4NXN Q;  1M1K C;  1PH3 A;  2YYZ A;  3L0O A;  4C2M H;  2R7D A;  1LM0 A;  1S72 A;  1NTG A;  4LWC A;  2XGT A;  5M3F G;  3L7Z C;  3PIP A;  4GNX A;  4L5Q A;  5C0X G;  5M3F H;  2AKW B;  3J81 c;  2AWN A;  1IBK Q;  1V9P A;  2VL6 A;  4DR1 L;  3S17 H;  3AQQ A;  3PO2 G;  1L1O C;  5M5Y H;  3E9H A;  1EWI A;  1MJC A;  1VS0 A;  2N8N A;  1CKN B;  4JI2 Q;  4X64 L;  3J7Z C;  1VQ5 A;  2E5L Q;  3PF4 A;  3CF5 A;  4YCV A;  1E22 A;  2NVQ H;  4JI1 L;  4A3C H;  2BH2 A;  5C4J H;  3GTK H;  4JI8 Q;  1B70 B;  3AEV A;  1FGU A;  4UP9 A;  2JA7 G;  4A93 G;  1EIF A;  4LF5 L;  4R4O A;  1BBU A;  4DR5 L;  2JA7 H;  3I4M G;  4A93 H;  5IYC G;  4PZ8 A;  1VCI A;  4X62 L;  2Q2I A;  5GAD C;  3I4M H;  1HZB A;  5IYC H;  1IZ6 A;  3M9B A;  3CCM A;  4HJA A;  1XMQ L;  4TVA B;  4O2D A;  3UDX A;  3PUW A;  2WAQ G;  1YBY A;  5H1S E;  5M3M G;  4DV1 Q;  1OXV A;  1AE3 A;  3CXC A;  4R4C A;  4DR1 Q;  5M3M H;  3M85 A;  2JE6 I;  4A3B G;  2JK8 A;  3KF8 B;  2JJQ A;  1GVP A;  1VQI A;  4X64 Q;  3CME A;  4JI7 L;  4A3B H;  4DV3 L;  4JI1 Q;  2PI2 E;  1N36 Q;  3S2H H;  4XIG S;  3UDI A;  5FLM G;  1HNZ Q;  1E1O A;  4BBR G;  1VQ7 A;  4JI0 Q;  3M7N A;  5FLM H;  1SMX A;  1XJV A;  1V43 A;  4BBR H;  4DR5 Q;  5IY0 A;  4YY3 L;  4HIM A;  2F4V L;  1NMF A;  4X62 Q;  4IFD J;  3BU2 A;  3S15 H;  1Q86 C;  3L2P A;  1T9H A;  1U0L A;  3CQZ H;  3K7U C;  3GD7 A;  2IHF A;  4DR2 L;  1XMQ Q;  2JEB I;  3W1B A;  4JI4 Q;  4YHH Q;  3CPW A;  3OTO L;  3AFP A;  4DV6 L;  3KYH C;  2B3G A;  4Y52 H;  5HY6 A;  2ZM6 L;  3SGI A;  4HJ9 A;  5HGQ A;  2GN5 A;  3K8A A;  3CCJ A;  3S24 A;  2KCT A;  4JI7 Q;  2FXQ A;  2CCZ A;  2JA9 A;  1K0R A;  3PSI A;  4DV3 Q;  1J5E L;  2JA8 G;  2AWO A;  3NEM A;  4X65 L;  3F8T A;  3TEH B;  4NB3 A;  5IYD G;  2JA8 H;  4DV4 Q;  3CCU A;  3TS0 A;  5IYD H;  4JI6 Q;  1YIT A;  1Q46 A;  2VQE L;  4R4I A;  3M4P A;  4YCU A;  1VQ6 A;  2QA4 A;  5GAG C;  2JA6 G;  3J80 c;  3RN2 A;  4DR2 Q;  4IPD A;  3PO3 G;  4LFB L;  1VQK A;  2JA6 H;  1KXL A;  3I7F A;  1HZA A;  3OTO Q;  1RIP A;  2PMZ E;  4DV6 Q;  1YJ9 A;  1N34 L;  4B3M Q;  3T1Y Q;  5DLQ E;  3PUV A;  2EIF A;  4OWW B;  1EFW A;  2UXB L;  2OQK A;  1R9T H;  4A3D G;  2A1A A;  3ICE A;  1YVC A;  4A3K G;  1J5E Q;  4AYB E;  4GKK L;  4OON A;  1P16 A;  1PYS B;  3OYY A;  4A3K H;  2YU9 H;  1QVF A;  2PNH A;  1E7Z A;  4GNX B;  5FJ8 G;  1I5F A;  1HR0 W;  2D0P A;  3HOU G;  5FJ8 H;  1Z9F A;  2JQO A;  3VDY A;  1HR0 L;  2K14 A;  2IY5 B;  2WB1 G;  1IBM Q;  3HOU H;  3HOW G;  4DK3 C;  1HH2 P;  3HKZ E;  5FLX c;  3CCE A;  3HOW H;  4K0K L;  4IPC A;  4LFB Q;  5GRO A;  3CCS A;  2AMC B;  1X3E A;  1N34 Q;  2Q2T A;  3MEF A;  1OXU A;  5JEA J;  3U50 C;  1OXX K;  2LSS A;  5IYB G;  1P8L A;  1EIY B;  5IYB H;  1TXY A;  5ELN A;  4LFC L;  2UUA L;  1DGS A;  1L0W A;  3PV0 A;  4JI3 Q;  4GKK Q;  3KOJ A;  2UUC Q;  1OXS C;  2WFW A;  2UXD L;  4R1J A;  2PI2 A;  5C0X J;  3CPF A;  4DUY L;  1VQ4 A;  4QL5 A;  1YEZ A;  2Q2U A;  1UEB A;  2R6G A;  1I94 Q;  4GOP C;  1HR0 Q;  1NE3 A;  3J7A 5;  5K36 G;  2K75 A;  2YV5 A;  1LTL A;  4K0K Q;  4LW1 A;  4YWK A;  1IBK L;  1JB7 A;  2K52 A;  2EQS A;  3EIV A;  2EXD A;  4HJ5 A;  2B29 A;  4DKA C;  2BA1 A;  4JI2 L;  1XNQ Q;  4AH6 A;  1XNR L;  4P72 A;  1Q8K A;  3W1G A;  2VUM G;  1JJC B;  4QIW E;  4DNI A;  4DUZ L;  1XMO Q;  1JJ2 A;  1QUQ A;  1SE8 A;  3A74 A;  2UUA Q;  4LFC Q;  2KHI A;  3UE1 A;  1WCM H;  5J3B A;  4EQ5 A;  4LF6 L;  2UXD Q;  4LUO A;  4JBK A;  2HQL A;  4IPH A;  4DUY Q;  2Z6K A;  3H3V I;  1Q12 A;  3FKI G;  3CCQ A;  1KRS A;  3FKI H;  4P74 A;  2HHH L;  3BZK A;  3CC4 A;  4JI5 Q;  3RLO A;  1PHJ A;  2MNA A;  4DV1 L;  4IO9 A;  4OO1 I;  1CSP A;  1UE7 A;  5IP9 G;  4BXX H;  1S3O A;  3H0G H;  5IP9 H;  2ZTD A;  2R92 G;  2DGY A;  1MIU A;  2F52 A;  4XTC S;  3J81 j;  1VQP A;  1XNR Q;  2HIV A;  2R92 H;  2ZJR A;  1WI5 A;  1IYJ B;  4A3C G;  4DUZ Q;  1N36 L;  2CWA A;  1VQF A;  1D7Q A;  1HNZ L;  3LGJ A;  3HFZ B;  4JI0 L;  4EX5 A;  3F2D A;  4LF6 Q;  1W2B A;  3F2B A;  1E24 A;  2GVB A;  1SRU A;  4GN3 B;  2A8V A;  1Y1W G;  1YZ6 A;  4DR7 L;  1LUZ A;  4UP7 A;  1X6O A;  2MFI A;  1N9W A;  1Y1W H;  1HNX L;  2HHH Q;  4KHP Q;  4JI4 L;  1E3P A;  4YHH L;  2I5L X;  1JMC A;  4MNO A;  1GM5 A;  3HKS A;  4A3G H;  4PMW A;  1VQL A;  2N49 A;  4IPG A;  3T1H L;  1EYG A;  4LF8 L;  1VQM A;  3CW2 C;  3U58 A;  1QVG A;  4HIK A;  1IXR A;  1TWA H;  4J15 A;  4BA1 I;  2A19 A;  4ALP A;  1W3S A;  4DV4 L;  1LYL A;  1D8L A;  1BBW A;  1VQJ A;  3GTQ H;  4MZ9 A;  3UDF A;  1OTC A;  4JBM A;  4JI6 L;  4WJ4 A;  5AJ3 L;  1VQE A;  3E9I A;  4DV2 Q;  1Y14 B;  4DR7 Q;  1K9M C;  1HNX Q;  4GKJ Q;  4LUZ A;  2I0Q A;  1L1O A;  2E2H H;  4DR4 L;  4NXM L;  4UPA A;  3GTG H;  4GLX A;  4BY7 G;  4B3M L;  2K50 A;  4GN4 B;  3GTJ H;  3T1Y L;  1EUJ A;  2DUD A;  1Y1V G;  3FHW A;  3UE0 A;  4LNQ A;  3PUX A;  3T1H Q;  1Y1V H;  1UE5 A;  2OWO A;  3BZC A;  1TWF H;  2WAQ E;  4LF8 Q;  5IP7 H;  4JBJ A;  1X56 A;  3I55 A;  4RMF A;  1IBL L;  1G51 A;  2OQ0 A;  1L2F A;  1VQA A;  4ME3 A;  1MJE A;  4DPG A;  1PH8 A;  5AJ3 Q;  3I4O A;  3EBE A;  4A3I G;  2YTY A;  4QJF A;  4JV5 L;  4KLK A;  1N32 Q;  1IBM L;  4A3I H;  2OTJ A;  1K8A C;  4H02 A;  3GO5 A;  4IJL A;  1N33 L;  4DR4 Q;  4NXM Q;  2RHS B;  3F1Z A;  1KHI A;  3G71 A;  1Q7Y C;  1VQH A;  3KJO A;  1HZ9 A;  1QUQ B;  2BH8 A;  2B63 G;  4R4T A;  5ELO A;  4DAM A;  4UY8 C;  2B63 H;  1YNX A;  2ATW A;  1Q81 C;  4JI3 L;  1PFS A;  2Y0S G;  1TWG H;  2MQH A;  1IBL Q;  2UUC L;  2K5H A;  1KRT A;  1Q82 C;  1H95 A;  3H15 A;  2I5M X;  4TQU S;  3KDF A;  3AYH B;  4X66 L;  3AFQ A;  2CFM A;  4Y7N H;  3ERS X;  2YTV A;  1CKO A;  3KLW A;  1I94 L;  4JV5 Q;  2R93 G;  1PH1 A;  1YI2 A;  4DV7 Q;  4OWT B;  4JCV E;  4A76 A;  3GDE A;  4MTN A;  2R93 H;  2PQA A;  1N33 Q;  1C9O A;  3HOX G;  1X3F A;  3I56 A;  1K83 H;  1TWH H;  4JG2 A;  3HOX H;  1A8V A;  4DAY B;  3DLL A;  4JOI C;  1VQO A;  1K73 C;  3RZO H;  3TS2 A;  1XNQ L;  4A3L G;  4PG3 A;  4QGU A;  4A3L H;  4HID A;  1UE6 A;  1G29 1;  3UDG A;  3HOZ G;  4A3E G;  4IFD I;  3K7A H;  1XMO L;  2CKZ B;  2VY3 A;  3HOZ H;  4A3E H;  4AIM A;  3GTO H;  2NVY H;  1JJG A;  2OCE A;  2K5V A;  2KHJ A;  4B3R L;  1O7I A;  4X66 Q;  1EQQ A;  2BA0 A;  4LF4 L;  1HNW L;  5GQO A;  1X55 A;  5JJI A;  3RN5 A;  4JI5 L;  3U4Z A;  4B3S L;  3RZD H;  3ULJ A;  1GD7 A;  3NEN A;  4IOA A;  1A0I A;  2MO0 A;  4GNX C;  3CCL A;  3K80 C;  2IX1 A;  4UP8 A;  2WB1 E;  2IX0 A;  3OW2 A;  1WYD A;  1OXT A;  4QQB X;  1E1T A;  1TWC H;  2N78 A;  4JC0 A;  5IE8 A;  1X9N A;  1NBW A;  1I50 H;  1WCM G;  4DR6 L;  1UE1 A;  2NZH A;  1GKH A;  5GAH C;  1XPR A;  3RLF A;  3H3V H;  2IT1 A;  2N3S A;  1EOV A;  4B3R Q;  3RR5 A;  2R7Z G;  1KC8 C;  2D0O A;  4LF4 Q;  4OO1 G;  1YJW A;  1L1O B;  2R7Z H;  1HNW Q;  3PUZ A;  3JC6 6;  3TRE A;  5JJL A;  1B7Y B;  5C3E G;  4HJ7 A;  4A75 A;  1PH5 A;  4GLV B;  3M4O H;  2MO1 A;  3K0X A;  5C3E H;  3D0F A;  4KHP L;  4X6A H;  4B3S Q;  4BXX G;  1YHQ A;  2ZTE A;  3H0G G;  4DK6 C;  1IL2 A;  2IHE A;  4L5T A;  3S2D H;  1VQC A;  1PV4 A;  1VQD A;  2Q2H A;  1U5K A;  4L5R C;  3CAM A;  2ZJQ A;  3RNU A;  4BY1 G;  1VQG A;  4A3J H;  1C0A A;  4B3T L;  4BY1 H;  3M4Q A;  4QY7 A;  1AE2 A;  4YWL A;  2JA5 G;  5JEA G;  1PH9 A;  4DR6 Q;  2UXC L;  3KF6 A;  2VQF L;  2JA5 H;  2C35 B;  2VW9 A;  1CUK A;  2CWP A;  4YCW A;  2VS1 A;  3NBH B;  4GOP A;  1MKH A;  1VQN A;  4KHZ A;  3S16 H;  4P75 A;  5JJK A;  1YHA A;  1ASY A;  2KBN A;  4C3I H;  2LXJ A;  4DV2 L;  1KD1 C;  3D31 A;  3CC7 A;  4GKJ L;  3K81 C;  4LFA L;  5GAE C;  1JE5 A;  1FL0 A;  1SFO H;  2UU9 L;  1WFQ A;  1HZC A;  2Z0S A;  3A5U A;  3TQY A;  3I4N G;  4A3G G;  3STB D;  1G6P A;  3PO2 H;  3I4N H;  5C0X I;  2GVA A;  4JBW A;  2UUB L;  2I5H A;  1XTD A;  4OX9 L;  5C4X G;  4B3T Q;  1GO3 E;  5LMN W;  3KDF B;  5C4X H;  5LMN L;  2UXC Q;  2VQF Q;  3S1R H;  3TRZ A;  4NPS A;  2ES2 A; 
#chains in the Genus database with same CATH topology
 4BY7 H;  4GS3 A;  5BR8 L;  4TRD A;  4AQY L;  3A55 A;  1HA6 A;  2Q8R E;  3F2U A;  2MPM A;  3S16 B;  2RCN A;  4C3I B;  3KJP A;  1EEF D;  5IT9 c;  2PCF B;  1G8Z D;  1AZP A;  2R7F A;  2RBM A;  3DWA A;  4RG1 A;  5IP7 G;  1PH4 A;  4OX9 Q;  4FF4 A;  3R2I A;  4POF A;  4PZ7 A;  4BA2 I;  1BF4 A;  3HOV G;  1PH7 A;  1D2B A;  1PVO A;  2XTI A;  1VQ8 A;  2NN6 H;  3Q8D A;  3P7J A;  5KRU A;  3I70 A;  4O1N A;  1TS2 A;  1LAB A;  4DV7 L;  2G5D A;  1KNE A;  1C8C A;  3LNN A;  4QUF A;  3I4M B;  3HOY B;  1B8A A;  2EJG C;  3G4S A;  2D5D A;  4PZ6 A;  1ASZ A;  2WAQ B;  3G48 A;  5NUC A;  1CKN A;  3ULP A;  1X65 A;  4JYA L;  3A5Z B;  3K58 A;  2AHO B;  2XN9 C;  3U4V A;  4YY3 Q;  3S2H B;  2F4V Q;  2EYJ A;  1NY4 A;  3ONA B;  3E5S A;  3VR6 A;  2F0J A;  3VYS A;  3PF5 A;  3B6Y A;  3MXP A;  2F0I A;  4K2L A;  2RDG A;  1IYV A;  2ZM6 Q;  4G4K A;  3PGZ A;  4CDD C;  4IUV A;  3CC2 A;  1JQY D;  1UWV A;  1SMY D;  1PLF A;  2NZO A;  3RLN A;  2F0F A;  4XT1 B;  1XPO A;  2E2J B;  3M3Y B;  2JA8 B;  1C7Y A;  1QVC A;  2Z6K C;  2NVX B;  2L5T A;  4HR7 B;  5CBA E;  1FJG L;  3Q6S A;  4HCE A;  2E2I H;  1STB A;  3T4A C;  5G3L D;  2K5W A;  4J8Q A;  3S1M H;  1NR4 A;  5C4H A;  4C3J H;  3MTS A;  3PCO B;  2VZA A;  3BYY B;  4HTH A;  2F3I A;  2ASB A;  2EE1 A;  5E7N A;  1SMY C;  3NEL A;  1JT8 A;  1VF7 A;  1STN A;  3ULL A;  4DR3 Q;  4ID6 A;  2YTX A;  3TBI B;  3VA5 A;  3IAY A;  1QE6 A;  2BOS A;  4IAL A;  1SBB B;  4A3M B;  1B2T A;  1EQR A;  4R4Q A;  2ALY B;  2DNE A;  5IOC A;  1PYB A;  3GQB A;  3L0O A;  3A7A B;  2R7D A;  1LM0 A;  4O42 A;  1E2W A;  3L7Z C;  4L5Q A;  3HZX A;  4XDX A;  4ABN A;  5M3F H;  2F0H A;  3I3C A;  1IBK Q;  1V9P A;  2VL6 A;  4DR1 L;  1F9R A;  3URY A;  3S17 H;  4L6T B;  1L1O C;  1EWC A;  1DOL A;  1VS0 A;  1ICW A;  2E5L Q;  1JOQ A;  1VQ5 A;  1CZG A;  1ROD A;  1B70 B;  4A93 G;  1AFP A;  4R4O A;  2JA7 H;  5IYC G;  4PZ8 A;  2F0N A;  1VF5 C;  5FK9 C;  1IKL A;  5H1S E;  4BWG B;  1AE3 A;  4R4C A;  5M3M H;  4FYD A;  3M85 A;  2JE6 I;  4A3B G;  2JK8 A;  3SK8 A;  1VQI A;  4DV3 L;  1N36 Q;  2PI2 E;  2R92 B;  4R8N A;  1T5E A;  4JI0 Q;  5FLM H;  1SMX A;  2DJG C;  4BBR H;  4PMB A;  3SVM A;  1LTR D;  1ICF B;  5EPL A;  5JOB A;  4YY3 L;  4DR5 Q;  1NMF A;  2F4V L;  3GTK B;  4IFD J;  3X3M A;  3T16 A;  4NP5 A;  1KTK A;  3K7U C;  1XMQ Q;  3GD7 A;  3X3N A;  2F0K A;  4JI4 Q;  3CPW A;  1GUO A;  4DV6 L;  3ND8 A;  2ZM6 L;  1GHJ A;  3VYU A;  4HJ9 A;  1JOK A;  3S24 A;  2Z1C A;  1CM9 A;  1QWY A;  2CCZ A;  1K0R A;  3GV6 A;  1Y8N B;  2Z4H A;  3P1H A;  2HDL A;  2SEB D;  4NB3 A;  5IYD G;  2RDF A;  1Q46 A;  3HRZ C;  1CQV A;  5GAG C;  3MHB A;  1PTO D;  3S15 B;  4B3M Q;  1N34 L;  3T1Y Q;  4RGO S;  4H44 C;  4IZ8 A;  1YVC A;  4A3K G;  1J5E Q;  1EY8 A;  4OON A;  5BN3 A;  3RUZ A;  5ELD A;  1I5F A;  1HR0 W;  5FJ8 H;  1HR0 L;  4ULL A;  2WB1 G;  4RKL A;  4LFB Q;  4ZKC B;  5C3X A;  1U9R A;  3OIP A;  2MUY A;  1X3E A;  1RKN A;  1PDQ A;  2SOB A;  3MEF A;  2JA6 B;  5IYB H;  4C3J G;  3LWU A;  3WDN A;  1DGS A;  1PTO C;  2UUA L;  4QCL A;  1D6E C;  3SK5 A;  5I9O A;  4GKK Q;  1MGS A;  4ZRZ A;  3E6Z X;  4G7O C;  2UXD L;  3J7A 5;  2QDL A;  4GOP C;  1EZ8 A;  1NE3 A;  2F4I A;  2O5J C;  5K36 H;  1D5M C;  4K0K Q;  4LW1 A;  1IBK L;  1JB7 A;  1SYC A;  3NPP A;  2BA1 A;  3J81 E;  3G6J B;  4H7B A;  3VR3 A;  2DY8 A;  4LF6 L;  1LTG D;  4DUY Q;  1LTS D;  3C1E A;  1Q12 A;  2A73 B;  3FKI G;  4LK1 C;  1KRS A;  3V2T A;  3CCQ A;  2F0M A;  3JAM L;  4JI5 Q;  3EJI A;  2B2U A;  5ISR A;  1BCP D;  2G9D A;  5IP9 H;  2KOL A;  1W6J A;  1VQP A;  2A74 C;  3W3A A;  4DUZ Q;  1N36 L;  2QEJ C;  2EYL A;  4JI0 L;  3F2D A;  1TWC B;  4K5W A;  1SRU A;  2J4X A;  3MFG A;  1Y8P B;  1LUZ A;  5CV8 A;  2HHH Q;  4JI4 L;  1SDF A;  2RSN A;  1J8I A;  1DZ1 A;  1NCV A;  1O80 A;  1SNM A;  4F8M A;  1EOT A;  2N49 A;  1H9K A;  1S5F D;  1GUS A;  2TSS A;  4KY5 A;  3U58 A;  1STY A;  1HXY D;  4HIK A;  1PRT F;  4BA1 I;  4ALP A;  2OF1 A;  3GTQ H;  1O78 A;  4DV2 Q;  5L37 A;  1K9M C;  1HNX Q;  2I0Q A;  4B3M L;  2K1B A;  4MTK A;  3J80 E;  3T1Y L;  3FHW A;  1I4H A;  4LNQ A;  3OOC A;  2OWO A;  3T1H Q;  1SFO B;  3BVM A;  2WII B;  2BCO A;  1DOK A;  3H6M A;  5J22 A;  1TWA B;  3H91 A;  5AJ3 Q;  4A3I G;  3EBE A;  2OTJ A;  4JV5 L;  4QJF A;  4CJ0 B;  1PZI D;  2K33 A;  4H02 A;  4PQX A;  1Q7Y C;  3TP6 A;  1QUQ B;  3KBG A;  2BH8 A;  4DAM A;  1Q8I A;  1DM0 B;  2B63 H;  1YNX A;  3T53 B;  1TWG H;  2MQH A;  2K5H A;  3H15 A;  4TQU S;  2EVB A;  3AYH B;  4X66 L;  4Y7N H;  2NYZ D;  1U4R A;  3KLW A;  5JVG 3;  5HGT A;  3EFX D;  1BCP F;  5EPJ A;  3HOX G;  5CV6 A;  4QMG A;  1KDB A;  1TWH H;  1A8V A;  3A54 A;  4IFD H;  4JOI C;  4A3L H;  4A3E G;  3K7A H;  2CKZ B;  2VY3 A;  2NUC A;  1WTW A;  3GTO H;  2SNS A;  1O7Z A;  2K5V A;  2IPK D;  1O7I A;  1EQV A;  2BA0 A;  2DJF C;  4DU9 A;  1EY9 A;  5IGB A;  4JI5 L;  3DWP A;  3RZD H;  3ULJ A;  4C1N K;  2D2C C;  4IOA A;  1A0I A;  3CCL A;  3VR4 A;  2IX1 A;  4UP8 A;  2FJ2 A;  4K8I A;  1OXT A;  5D3I B;  3RZO B;  3K57 A;  2E76 C;  2HCC A;  1I50 H;  4DR6 L;  1SEB D;  1GKH A;  3RLF A;  2N3S A;  3RR5 A;  3HOZ B;  2D0O A;  4OO1 G;  1L1O B;  3JC6 6;  5J39 A;  4GLV B;  5AFW A;  3M4O H;  4N8F A;  5C3E H;  1TR5 A;  2QW7 A;  1STG A;  1VQD A;  4JPB W;  1U5K A;  2E2I B;  4QB4 A;  3M7G A;  2N55 A;  2ZJQ A;  3RNU A;  4WJW A;  4BY1 G;  3U9S A;  4A3J H;  2PW5 A;  4B3T L;  3MWY W;  1F2M A;  5EJW A;  2JA5 G;  5E1F A;  1EY4 A;  2H4O A;  2VS1 A;  5BN5 A;  1JR0 D;  4C3I G;  1I4X A;  1E2V A;  4ZQ3 A;  3MAQ A;  4DV2 L;  1R4Q B;  4R8I A;  1KD1 C;  3D31 A;  3HGB A;  5A35 A;  2EZV A;  2XVS A;  2UU9 L;  1WFQ A;  1K0S A;  3A5U A;  2DY7 A;  3STB D;  3TZD A;  2JXM B;  3I4N H;  2GVA A;  4ZKB B;  4H0L C;  1B3Q A;  3KLS X;  1SE3 A;  1GO3 E;  4EQO A;  3KDF B;  5IGG A;  1WTR A;  1A2U A;  4NPS A;  1V1Q A;  3HOY G;  1X3Q A;  3CP0 A;  1KIX A;  2RA4 A;  5M5X H;  4K14 A;  4LFA Q;  1DD2 A;  1SR3 A;  3EVQ A;  4KD4 A;  1EFI D;  3MC0 B;  3TN2 A;  5M3F B;  2UUB Q;  2EYP A;  3S1N H;  2VXW A;  1MSH A;  3PO2 B;  3FP9 A;  4CJ2 C;  1CKM A;  3VR5 A;  5LMN Q;  2B39 A;  3STB C;  3HOV H;  3CCV A;  1KAW A;  3K0Y A;  2D62 A;  5BR8 Q;  5EQ0 A;  2WIN B;  4HJ8 A;  4AQY Q;  3RMH A;  3JAM i;  3G7L A;  1I3Q H;  2X69 A;  3D4W A;  1BKB A;  1WJJ A;  1S40 A;  2RQX A;  5M3M B;  4OL7 A;  3VA7 A;  4O0A A;  4GLA C;  2QDB A;  5EAY A;  2DN8 A;  3S1Q H;  3GV3 A;  3FVQ A;  3OMG A;  3ER0 A;  1NJI C;  2KEN A;  2AQ2 B;  4BBR B;  1R4P B;  1FGB D;  2WP8 J;  1PTO B;  4X3K A;  3TDQ A;  4IFD G;  5LMU L;  3PO3 H;  4CKB A;  3C46 A;  1ET6 A;  1NMG A;  4P71 A;  1QZG A;  4POG A;  3AB9 A;  1YHB A;  4LUV A;  1TS3 A;  5CV9 A;  2NVT B;  1VQ9 A;  4GOP B;  4A3D H;  4X65 Q;  4JYA Q;  4HIO A;  4NKL A;  3JAM c;  1N8R C;  3WOE A;  1JC7 A;  1CSQ A;  2Y0S E;  5LHY 1;  5IWA L;  3D4R A;  3CD6 A;  2LXK A;  5EKK A;  4A3M G;  3F2C A;  5ELB A;  1ET9 A;  4P2C B;  5M5W H;  4LF7 L;  3G6E A;  4DV5 L;  4X3T A;  3ITP A;  3L9A X;  4DF7 A;  3GTM H;  5CV7 A;  2Q8T A;  5DNF A;  1EZ6 A;  4NXN L;  1I6H B;  4BBS G;  3MXN B;  5CC4 A;  2IJ0 A;  4DNT B;  3S14 H;  1W6K A;  1FJG Q;  1PH2 A;  1WOC A;  4A3J G;  4C3H B;  1QZH A;  3MZ5 A;  2OEO A;  1I4G A;  1XPU A;  3PIO A;  3EN2 A;  4WOR A;  4B9W A;  5C44 B;  4JW0 A;  1M1K C;  2YYZ A;  4C2M H;  1RF2 D;  1B9M A;  3NXW A;  4LWC A;  2TMP A;  1O7L A;  2F3V A;  3NBI A;  1F2L A;  5LL6 S;  2AWN A;  1IW7 C;  3AQQ A;  4IUP A;  5M5Y H;  1KDC A;  1IHZ A;  3PF4 A;  2N8N A;  4BS9 A;  4YCV A;  2NVQ H;  4N9P A;  5IT9 E;  4JI1 L;  1K28 A;  4L63 B;  4V19 0;  3E0J A;  4ME5 A;  2JYO A;  2VUM B;  2LMC B;  3KLR A;  4FF1 A;  4A93 H;  4A3F B;  1FR3 A;  1VCI A;  4X62 L;  1RJT A;  3D8G A;  5IYC H;  2CH4 W;  3P20 A;  4KN4 C;  2B8G A;  4TVA B;  3PUW A;  1YBY A;  2PQE A;  2X6G A;  5T1I A;  5IGE A;  3CXC A;  3HP3 A;  4DR1 Q;  4ILW A;  3NE5 B;  2KQ3 A;  1JCK B;  3CME A;  2JJQ A;  1GVP A;  4A3B H;  4JI7 L;  2FMM A;  1GUW A;  1HNZ Q;  1HFG A;  1E1O A;  1VQ7 A;  3M7N A;  1MHW C;  1EEI D;  5IY0 A;  4HIM A;  5C4J B;  2IX3 A;  3BDL A;  3BU2 A;  2E2D C;  3I91 A;  3L2P A;  1KAA A;  4IUN A;  3CQZ H;  2JEB I;  3W2D A;  1GUN A;  4YHH Q;  4CKE A;  5HY6 A;  3SGI A;  3OSO A;  4KKT A;  2GN5 A;  4DV3 Q;  4IUR A;  1WD1 A;  4X65 L;  3CCU A;  3TS0 A;  5IYD H;  4FVM A;  3CU7 A;  4R4I A;  3I73 A;  2QA4 A;  2JA6 G;  4M1U B;  4IPD A;  2EJF C;  1QNU A;  3PO3 G;  1VQK A;  1GUT A;  4TSS A;  1KXL A;  1RIP A;  2PMZ E;  4DV6 Q;  2RVL A;  3PUV A;  2EIF A;  1EFW A;  2OQK A;  3OW7 A;  5IIF A;  1ENC A;  4A3D G;  2A1A A;  3ICE A;  3OYY A;  4A3K H;  2YU9 H;  2PNH A;  4K5X A;  2NTT A;  1WTQ A;  3HOU G;  2ZXR A;  2IY5 B;  1IBM Q;  1IL8 A;  3HOW G;  4IPC A;  2AMC B;  2L55 A;  1N34 Q;  2Q2T A;  2LSS A;  3K5N A;  3M4Y A;  3Q24 A;  1ZKO A;  1TXY A;  3SR1 A;  4JI3 Q;  3MXU A;  3I4L A;  3KOJ A;  2UUC Q;  1R9T B;  4R1J A;  2PI2 A;  3SE0 A;  5C0X J;  1YEZ A;  4K5V A;  1I94 Q;  2Y0S B;  4DGZ A;  1HR0 Q;  2F0U A;  4ZYS A;  4KN7 C;  2YV5 A;  1LTL A;  4KY6 A;  2EYF A;  1E0B A;  2EXD A;  4DKA C;  4HJ5 A;  3J80 L;  4AH6 A;  1K8M A;  2A5H A;  1JJC B;  3WOF A;  3Q23 A;  1JJ2 A;  1II3 A;  1QUQ A;  1HCZ A;  1EY7 A;  2L12 A;  3A74 A;  3PMF A;  2CQA A;  2UUA Q;  3BDO A;  2UXD Q;  4JBK A;  4TKO B;  2Z6K A;  1PZJ D;  5FKA C;  3R93 A;  2ZXP A;  3Q0A A;  5D65 A;  3FKI H;  3RLO A;  1PHJ A;  1CSP A;  1UE7 A;  1YNJ D;  3D6C A;  3H0G H;  2ZTD A;  4Z9C B;  2P5Z X;  2DGY A;  3J81 j;  1IYJ B;  2KA7 A;  1VDZ A;  1VQF A;  1D7Q A;  1HNZ L;  3BYT B;  4EX5 A;  4LF6 Q;  2HQE A;  3F2B A;  1E24 A;  2O4X A;  4C1N I;  1LO5 D;  1WCM B;  1EIG A;  4FP5 D;  4DR7 L;  3QJY A;  2HDM A;  2HD3 A;  4YHH L;  2CH4 A;  4CKC A;  4MNO A;  1GM5 A;  3HKS A;  5DM7 3;  2RSO A;  1OO9 B;  4A3G H;  2CW0 D;  1EYG A;  4LF8 L;  1RCV D;  1VQM A;  1BDO A;  3CW2 C;  2O5I C;  1YNJ C;  3S9W A;  2A19 A;  1W3S A;  1LYL A;  4MZ9 A;  1X32 A;  5CR3 A;  4OHJ A;  1OTC A;  1LT6 D;  1WVL A;  4WJ4 A;  4I7A A;  2NB0 A;  3E9I A;  1WTP A;  1Y14 B;  4EQN A;  1ZYR C;  4GKJ Q;  1L1O A;  2E2H H;  4DR4 L;  4NXM L;  3PIO 3;  3GTG H;  4U67 3;  4ZK9 B;  5G3L F;  3MXG A;  4GN4 B;  2K50 A;  3A7L A;  1Y1W B;  4FNF A;  1I4P A;  2L4N A;  4HED A;  3UE0 A;  1F9Q A;  1UE5 A;  3TME A;  3HS0 C;  2KHS A;  2A69 D;  4N8X 1;  3FRP B;  5I4D A;  5JPM C;  1IBL L;  1L2F A;  2CW0 C;  1F2Z A;  4DK0 A;  1VQA A;  2K7V A;  4DPG A;  3I4O A;  1N32 Q;  1IBM L;  4A3I H;  1XWE A;  4DN4 M;  1N33 L;  2MGS A;  3G71 A;  1VQH A;  4RHR A;  4EQP A;  5C4Z A;  2KVM A;  2OXP A;  2IWH A;  4R4T A;  1LT4 D;  1TVX A;  2F0E A;  5ELO A;  1STE A;  3GTJ B;  4WFN 3;  4JI3 L;  2UUC L;  1Y1V B;  1TWF B;  1KRT A;  3QIA A;  4JK1 C;  3KDF A;  3AFQ A;  3HOV B;  2A69 C;  1I94 L;  3A8J E;  4JV5 Q;  2R93 G;  1YI2 A;  4A76 A;  1H9J A;  4MIU A;  2Z4I A;  3D4D A;  2PMZ B;  3QG1 A;  3HOX H;  4NMZ A;  4DAY B;  1DYQ A;  1VQO A;  2A6E D;  3TS2 A;  1I3Q B;  1H9M A;  1UE6 A;  3HOZ G;  3KUP A;  2E74 C;  1L0Y B;  2XWJ B;  3RD4 A;  4A3E H;  2NVY H;  4B3R L;  4KJN A;  3HG9 A;  4X66 Q;  1HNW L;  1X55 A;  5JJI A;  1H9R A;  1RD9 D;  2XWB B;  4B3S L;  2MO0 A;  4GNX C;  1ZXT A;  5EKL A;  2WB1 E;  2IX0 A;  1K83 B;  4RFB A;  5J1Z A;  3LWE A;  4UDU C;  1LTT D;  5IE8 A;  1UE1 A;  2NZH A;  3H3V H;  1QB5 D;  2A6E C;  2Q8I B;  2IT1 A;  4XQQ A;  1EOV A;  3DMU A;  2K6A A;  1EY0 A;  1YJW A;  2ZXO A;  3PUZ A;  3TRE A;  4OO1 H;  5JJL A;  4A75 A;  4X6A H;  3GP7 A;  2L0C A;  4DXF A;  2ZTE A;  3H0G G;  2IHE A;  3S2D H;  1VQC A;  3PQI A;  5DM6 3;  5FLX L;  5EGT A;  2XNA C;  3NHH A;  2RCF A;  1UUP A;  4BY1 H;  5M5W B;  2FHT A;  1CA5 A;  5JEA G;  1PH9 A;  2K32 A;  4DR6 Q;  2VQF L;  2JA5 H;  4G57 A;  2F0T A;  1IKM A;  2LS0 1;  2B2T C;  4YCW A;  4GOP A;  1MKH A;  3FEW X;  3S16 H;  1ASY A;  2KBN A;  2G9H D;  4C3I H;  4GKJ L;  1LTA D;  1PTO F;  2R7Z B;  1TY2 A;  1JE5 A;  1F9S A;  1HZC A;  4A3G G;  1G6P A;  4B3T Q;  1FD7 D;  1EU3 A;  2EYO A;  1G2T A;  2ES2 A;  4UAI A;  2B2Y C;  2HT1 A;  3HOY H;  1CHP D;  1N32 L;  1S5C D;  4J6H A;  2L11 A;  3BDC A;  3MXN A;  5COR A;  2K28 A;  4ZAI A;  1TII D;  4C2M B;  4MN3 A;  1FVI A;  4ZLT F;  2UU9 Q;  3KFU A;  4IUQ A;  1S5D D;  1B50 A;  4ZCK A;  2EOT A;  2ID0 A;  3J80 i;  4WJ3 M;  1UNS A;  5M5Y B;  3BZD B;  2F0Q A;  1QJO A;  2Z9H A;  4KJO A;  4LF9 L;  5C4X B;  1SSO A;  3S1R B;  2NN6 I;  3DXJ C;  3A0J A;  4M8A A;  2K5N A;  4A93 B;  4BY7 B;  1HTP A;  1PA6 A;  4CHT B;  4AYB G;  2CQO A;  4APV A;  1A62 A;  2KUM A;  5IOD A;  1A3U A;  2H5X A;  2X6L A;  1KL9 A;  3E0E A;  2JEA I;  2E2J H;  4A3B B;  5A2Q L;  4LMQ D;  3M3Y H;  4KI0 A;  2NVX H;  3DWQ A;  3HKZ G;  1Z47 A;  4RGT A;  1M90 C;  2HIX A;  2RDH A;  3NWT A;  1KLG D;  1AN8 A;  4OWX B;  5ELF A;  3TZU A;  1T5X D;  4Q5V A;  5IGD A;  1SND A;  1D5X C;  3C3L A;  3KF6 B;  1SNQ A;  1PH6 A;  4L5S A;  5IT9 L;  1KQS A;  1Q1E A;  4X3U A;  4XYO A;  2BE5 D;  5KND A;  3GTL H;  1B4O A;  1M8A A;  5FO7 B;  2WAC A;  4GN5 A;  1AW7 A;  2NTS A;  1K3R A;  5LMU Q;  4A3M H;  4EVO A;  4DV0 L;  5C44 G;  3O13 A;  2UXB Q;  4QF4 A;  5JVH 3;  1LTI D;  1X3G A;  1QOH A;  3CCR A;  2V1C C;  1B3A A;  5JAV A;  2B2W C;  1CFM A;  4BBS H;  5IWA Q;  3PUY A;  1V1O A;  1NSN S;  1B1Z A;  3BJU A;  4JOI A;  4A4I A;  2BE5 C;  2JP1 A;  2WB1 B;  4IOC A;  4LF7 Q;  2RHQ B;  4DV5 Q;  4XYQ A;  3WWV A;  1A3T A;  2F0P A;  4A3F G;  1C48 A;  1SRO A;  1A63 A;  1YJN A;  2ZJP A;  2WV6 D;  4JI8 L;  3S1M B;  2XRQ D;  1MSG A;  4NXN Q;  4C3J B;  1PH3 A;  1UEA B;  5KGU A;  1S72 A;  1GHK A;  3C1F A;  2XGT A;  5C0X G;  1I6V C;  1MD2 D;  2QF7 A;  4RAU C;  4K6L A;  1S5E D;  1KLU D;  1EWI A;  1MJC A;  4JI2 Q;  3J7Z C;  4X64 L;  3OPO A;  4G7Z C;  5FO9 B;  2KEE A;  1E22 A;  3KK7 A;  3BVZ A;  1FYC A;  2BH2 A;  3GTK H;  1HUN A;  3NP8 A;  2C9O A;  1EIF A;  3I4M G;  1BBU A;  1I4Q A;  2EJM A;  4G7H C;  2Q2I A;  3SK4 A;  1HZB A;  5EBD A;  2K5D A;  3CCM A;  4HJA A;  1ENA A;  4K8J A;  2WAQ G;  1RDP D;  5T1G A;  3FKI B;  4RH6 A;  1D1I A;  1G6Z A;  3OIQ A;  3DEP A;  5HUR A;  5E4W C;  1D1K A;  2V4D A;  4FXD A;  3KF8 B;  3NTK A;  3S17 B;  4JI1 Q;  3UI2 A;  5I6W A;  1XJV A;  2NWG A;  1NUC A;  4X62 Q;  2R61 A;  4KTA A;  2K01 A;  1WTO A;  3S15 H;  1T9H A;  1U0L A;  2JA7 B;  4DR2 L;  1F2Y A;  4KK7 A;  3U9O A;  3W1B A;  2BDO A;  2QKI C;  4B08 A;  3OTO L;  5BN4 A;  3KYH C;  3I8Z A;  5CMD A;  1TKW B;  4UHV A;  4RKB A;  4JI7 Q;  2FXQ A;  4GZY C;  2JA9 A;  2JA8 G;  1F9P A;  2AWO A;  3TEH B;  4OIJ A;  2EY1 A;  4DV4 Q;  1YIT A;  3JAM E;  3R8B A;  3M4P A;  5EKI A;  1PXU A;  3RN2 A;  3T51 B;  2JA6 H;  1HQR D;  1V1P B;  1HZA A;  2F3W A;  1LV9 A;  5DLQ E;  2RKS A;  2UXB L;  2VB3 X;  4K6D A;  5CGK A;  1QVF A;  1AZQ A;  1SJE D;  3V96 A;  1E7Z A;  4GNX B;  3CHB D;  2AUK A;  2D0P A;  1JWU D;  1Z9F A;  2JQO A;  3HOU H;  1CHQ D;  1HH2 P;  5FLX c;  3MFY A;  3HOW H;  4A3I B;  3K5L A;  2F0L A;  5JEA J;  1PFN A;  3R2T A;  2JSO A;  1GJX A;  5JPN C;  4LFC L;  3IFT A;  5I6Y A;  1L0W A;  2R3Z A;  1BNZ A;  2O2L D;  4PMC A;  1XX8 A;  1B44 D;  2WFW A;  4LJZ C;  3CPF A;  4N9T A;  1VQ4 A;  1IW7 D;  4QL5 A;  2BDN A;  2R6G A;  2K75 A;  2XSC A;  4YWK A;  1CZW A;  2K52 A;  4DNR B;  1FNW A;  1SNC A;  2EQS A;  3DM1 A;  3EIV A;  2B29 A;  1HPC A;  4JI2 L;  1XNR L;  1NR2 A;  3W1G A;  1SNP A;  3HOX B;  4QIW E;  4DNI A;  2I46 A;  1SE8 A;  4HSP A;  1BOS A;  3UE1 A;  4LUO A;  4IPH A;  4ODG A;  1SYE A;  4A3E B;  4CGY B;  3H3V I;  3IFD A;  4K2K A;  1WTH A;  3BZK A;  3CC4 A;  4PNY A;  2MNA A;  4OO1 I;  4CDC C;  2FIN B;  3BVG A;  2R92 G;  4XTC S;  1MIU A;  2F52 A;  1WI5 A;  4DAY A;  4LAA A;  2CWA A;  1JWS D;  2J7Z A;  1U4L A;  3LGJ A;  1W2B A;  2GVB A;  5CV4 A;  2F0O A;  4GN3 B;  2A8V A;  4V0B A;  1Y1W G;  2NZ1 D;  4UP7 A;  2MFI A;  1E3P A;  3H09 A;  1JMC A;  3OMC A;  1A3V A;  1VQL A;  2DNC A;  4IPG A;  1L0X B;  3KLS A;  4HSV A;  4U68 A;  3LX0 A;  1QVG A;  2PNR C;  4FXK C;  1TWA H;  3N6R A;  1BQQ T;  1RTO A;  4DV4 L;  1VQJ A;  4BY1 B;  1BBW A;  4S3S A;  4JBM A;  1Z6H A;  4Q0F A;  3BG3 A;  2JA5 B;  3H94 A;  4DR7 Q;  4LUZ A;  1DCZ A;  2KCC A;  3QOL A;  1Y1V G;  3PUX A;  3J81 L;  1ILQ A;  4LF8 Q;  2FMC A;  4DXG A;  3L3O C;  1J9O A;  1X56 A;  4PV1 C;  2XIW A;  4RMF A;  3A56 A;  2OQ0 A;  1CT1 D;  1MJE A;  1VMC A;  4NW2 A;  2YTY A;  4DFA A;  3GTQ B;  4J1M A;  4DR4 Q;  4NXM Q;  1F77 A;  1WD0 A;  2WKD A;  1HZ9 A;  2EPB A;  1HRJ A;  4UY8 C;  1BXT A;  5FOB B;  2ATW A;  1Q81 C;  2IL8 A;  5I2X A;  1IBL Q;  1Q82 C;  1H95 A;  2I5M X;  2EY5 A;  1C4Q A;  3CRK C;  2ICE C;  2YTV A;  1CKO A;  1U4M A;  1D5Z C;  4JCV E;  5EPK A;  4MTN A;  2R93 H;  1EYA A;  2EYM A;  1N33 Q;  1C9O A;  1X3F A;  2IW3 A;  1K73 C;  3DLL A;  3RZO H;  4PG3 A;  4QGU A;  2F0G A;  5D3D A;  3UDG A;  4IFD I;  4RA8 A;  3HOZ H;  4AIM A;  2B63 B;  1JJG A;  1QG7 A;  2OCE A;  3I72 A;  2KHJ A;  4LF4 L;  1TWG B;  1O7Y A;  3U4Z A;  4RCO A;  4Y7N B;  1FNU A;  4L8J A;  1MI2 A;  1GD7 A;  1JIC A;  3NEN A;  4FO2 A;  4C56 C;  5E3F A;  4OGQ C;  4IUT A;  1WYD A;  2K05 A;  1DOM A;  1TWH B;  4QQB X;  1E1T A;  2N78 A;  4JC0 A;  1X9N A;  4KHV A;  5GAH C;  1BBX C;  3K7A B;  3ERO A;  4B3R Q;  1NAP A;  2R7Z G;  2OT2 A;  3GTO B;  1HNW Q;  2E75 C;  2F0W A;  3QOJ A;  1JOR A;  1PH5 A;  2CHB D;  4R9W A;  2MO1 A;  2EYH A;  3K0X A;  3TP7 A;  4B3S Q;  1YHQ A;  3GTL B;  4DK6 C;  4L5T A;  3TP8 A;  1PV4 A;  3T56 B;  3RZD B;  3CAM A;  3DUZ A;  4QIW B;  4FF2 A;  1EY5 A;  3J7A V;  4QY7 A;  1AE2 A;  2HUG A;  4YWL A;  1QNK A;  2K04 A;  1LAC A;  3KF6 A;  2UXC L;  1ZYR D;  5JEA H;  2VW9 A;  4CDF C;  3NBH B;  1I50 B;  5JJK A;  1YHA A;  5FO8 B;  4XQN A;  2LXJ A;  2WKC A;  1H9S B;  3CC7 A;  1Q3L A;  3K81 C;  4BBS B;  2LKV A;  3M4O B;  5C3E B;  3OWE B;  3PO2 H;  3E3X A;  4JBW A;  1XTD A;  4OX9 L;  1XXG A;  5C4X G;  2XRS D;  3ZYY X;  1S5B D;  2VQF Q;  4A3J B;  3TRZ A;  4BY7 G;  2C5C A;  3NQI A;  5IGF A;  2F0D A;  2PQA B;  1KAB A;  3CMA A;  2ZTC A;  1EIH A;  2VB2 X;  4NDX A;  3BS1 A;  1SLJ A;  4OXP A;  2F0V A;  3IRB A;  1JWM D;  3I4N B;  2M00 A;  4HN7 A;  2NN6 G;  1CTM A;  3NUC A;  4LF5 Q;  1NNX A;  4HMI A;  1PTO H;  4CJ1 B;  1ESF A;  5K5P A;  4P73 A;  5CBE E;  2QGQ A;  3ERQ A;  2NVT H;  1K8O A;  5M5X B;  3ZJY C;  5COY A;  1HA5 A;  1RL2 A;  4F7X A;  5C3W A;  2F03 A;  1TS5 A;  4OEM B;  2KCM A;  3S1N B;  4E6I A;  4IJH A;  2E8G A;  4LF9 Q;  2NBF A;  2M2L A;  3GTP H;  1VQB A;  4JVZ A;  1DXM A;  1GXD C;  3EA6 A;  1WTV A;  1X54 A;  4FDB A;  1YIJ A;  3AU7 A;  3NTH A;  5F2D A;  2K4K A;  1A2T A;  3K6O A;  2MJ8 A;  1K8G A;  1I6H H;  1HJP A;  1Y8O B;  3KF8 A;  3C2P A;  1Z7T A;  4KMU C;  1PRT D;  1SNO A;  2F1M A;  1STH A;  2L15 A;  2SNM A;  2RF4 A;  1BO0 A;  2VQE Q;  3D3R A;  1J6Q A;  2ENB A;  3I2Z A;  1SYF A;  3W5O A;  3S1Q B;  4YWM A;  1AP0 A;  4C3H H;  4DR3 L;  2B2U C;  1JB3 A;  2EY2 A;  1SN8 A;  2OTL A;  5C44 H;  4ZUJ A;  1EYD A;  3PO3 B;  3J81 i;  1DJR D;  1SYD A;  3FPU B;  3SK6 A;  4KKU A;  4DA2 A;  1ZEQ X;  4A3D B;  2J0T D;  1GUG A;  1Q1B A;  2PW7 A;  5ELC A;  1BVS A;  2QEX A;  1RHP A;  1ILP A;  1PRT C;  1TQO A;  4RCN A;  4FXG C;  3HOU B;  4DV0 Q;  1AH9 A;  3HOW B;  2E5L L;  3DM3 A;  1ENF A;  1V1P A;  1CQF A;  1KNA A;  4DAV A;  1ESR A;  1SYB A;  2VUM H;  2B8F A;  4A3F H;  2VNU D;  5CYU A;  3GTM B;  1DON A;  1NTG A;  5M3F G;  3PIP A;  4GNX A;  5DEH A;  2AKW B;  3J81 c;  5C0X H;  3S14 B;  3PO2 G;  3E9H A;  1LT3 D;  1CKN B;  2SDF A;  3CF5 A;  3QB3 A;  2AQ1 B;  4A3C H;  1HTL D;  3IL8 A;  5C4J H;  4JI8 Q;  3AEV A;  1FGU A;  4UP9 A;  2JA7 G;  2FFK B;  4LF5 L;  2AQ3 B;  4DR5 L;  5GAD C;  3I4M H;  1IZ6 A;  3M9B A;  1XMQ L;  1UAP A;  4O2D A;  4XT3 B;  3UDX A;  3CRL C;  3VYR A;  4DV1 Q;  5M3M G;  1HHV A;  1OXV A;  3R3O A;  1I4R A;  3H3V C;  5KEE A;  3ND9 A;  3TSS A;  1IYU A;  4X64 Q;  1E2Z A;  1BCP C;  2B2V C;  2B2T A;  3S2H H;  4XIG S;  3UDI A;  5FLM G;  1LLR D;  3HEJ A;  4HAE A;  3NSW A;  4BBR G;  2NVQ B;  1V43 A;  4X3S A;  1SE4 A;  2M9V A;  2A68 D;  1Q86 C;  2ZT9 C;  2IHF A;  4DAP A;  2KCN A;  3K5M A;  4B9X A;  3T13 A;  3AFP A;  4KD3 A;  4Y52 H;  2B3G A;  1MBY A;  5D14 A;  5HGQ A;  3K8A A;  2K03 A;  3CCJ A;  2KCT A;  3OHX C;  1S4Z A;  3PSI A;  4RWS C;  3Q22 A;  1J5E L;  2B2Y A;  3NEM A;  3F8T A;  2H1E A;  2JA8 H;  3MA2 B;  1QCB D;  4IQZ A;  4KY7 A;  4FF3 A;  4JI6 Q;  1EL0 A;  2EY6 A;  2VQE L;  1B9N A;  4YCU A;  1VQ6 A;  1STA A;  3J80 c;  3QWN A;  5C5M A;  4DR2 Q;  4LFB L;  3I7F A;  3OTO Q;  5KNC A;  1YJ9 A;  3CQZ B;  2A68 C;  2B2V A;  4OWW B;  1CA6 A;  3NQT A;  1R9T H;  3I90 A;  1EYC A;  1U4P A;  4AYB E;  4GKK L;  1P16 A;  1PYS B;  4RHS A;  1PZK D;  2D9U A;  5FJ8 G;  1X3P A;  4I7Z C;  3VDY A;  2K14 A;  2KJX A;  4DK3 C;  4C3H G;  3HKZ E;  4K0K L;  3CCE A;  2KEC A;  5GRO A;  3CCS A;  5I2Y A;  5JJZ A;  1OXU A;  3U50 C;  1OXX K;  5IYB G;  1P8L A;  2A6H D;  1EIY B;  1HFN A;  1YNN D;  5ELN A;  3K59 A;  3PV0 A;  2KED A;  2PZW A;  2GA4 B;  2MP1 A;  1OXS C;  2QIL A;  2EXZ A;  1PFB A;  1PYW D;  4DUY L;  4A3K B;  2Q2U A;  2YU9 B;  1SXT A;  1UEB A;  1VMP A;  5K36 G;  3DHQ A;  3VYT A;  2I07 B;  4XQJ A;  3NTI A;  3K5O A;  5E4X A;  1A15 A;  3EQL C;  2R93 B;  1CI3 M;  1GOZ A;  1XNQ Q;  4DK1 A;  3D6W A;  4P72 A;  1Q8K A;  2VUM G;  3J7Y W;  4DUZ L;  1XMO Q;  3MEH A;  4LFC Q;  1ONL A;  3J7A F;  2KHI A;  1AEX A;  1WCM H;  5J3B A;  4EQ5 A;  3N52 A;  2A6H C;  2HQL A;  1YNN C;  4OEL B;  1RTN A;  5KIX A;  5I9P A;  2HCI A;  2LY7 A;  4P74 A;  2HHH L;  1EQT A;  1EWH A;  3DEO A;  5KNB A;  2L1B A;  4DV1 L;  4IO9 A;  5IP9 G;  4BXX H;  1S3O A;  2R92 H;  1HUM A;  4IN3 A;  1XNR Q;  2HIV A;  1LT5 D;  2ZJR A;  4A3C G;  1V8Q A;  3HFZ B;  2B2W A;  1HQM C;  4H13 C;  3NK9 A;  2Z8L A;  4F87 A;  1YZ6 A;  5TSS A;  1XTC D;  1X6O A;  1HNX L;  1N9W A;  1Y1W H;  4KHP Q;  5ELE A;  2I5L X;  4PMW A;  1TU2 B;  3T1H L;  3H0G B;  2PPB C;  2ICI A;  1IXR A;  4J15 A;  4WRD A;  3VR2 A;  1D8L A;  3UDF A;  4JI6 L;  4QUC A;  5AJ3 L;  1TY0 A;  2K5Q A;  1VQE A;  2PO4 A;  1KDA A;  4UPA A;  4YIJ A;  2MHV A;  4GLX A;  4I65 A;  3GTJ H;  1EUJ A;  1JOO A;  2DUD A;  1XYI A;  4OIK A;  1Y1V H;  5CV5 A;  3BZC A;  1TWF H;  2WAQ E;  5IP7 H;  4JBJ A;  5KYL A;  3SHL A;  4A3G B;  3I55 A;  2PZU A;  1B53 A;  1G51 A;  3PIP 3;  2F0S A;  4ME3 A;  1PH8 A;  1FNV A;  4KLK A;  3NBH A;  3IKJ A;  3P75 A;  1SJH D;  1K8A C;  3GO5 A;  4IJL A;  3QO2 A;  2RHS B;  3F1Z A;  5EBC A;  1KHI A;  3KJO A;  1H9S A;  2PZT A;  1Q90 A;  5FLX E;  2E2H B;  2B63 G;  2EDG A;  5C6A A;  3GTG B;  1G2S A;  3KBX A;  1TT2 A;  1PFS A;  2Y0S G;  4RGM A;  4EGV A;  3MVV A;  2CFM A;  4XXE A;  3ERS X;  1PH1 A;  4CBV A;  4OWT B;  4DV7 Q;  3GDE A;  2N88 A;  1A6X A;  2L9H A;  2PQA A;  4KKS A;  3I56 A;  1K83 H;  4JG2 A;  1SAP A;  5IGC A;  1XNQ L;  4CDE C;  4A3L G;  5C5L A;  4HCS A;  4HID A;  1G29 1;  1XMO L;  4AYB B;  3FPP A;  1QIL A;  1PRT B;  2AUJ D;  1EQQ A;  2LFN A;  1G91 A;  5GQO A;  1JE4 A;  3RN5 A;  1SYG A;  3CKI B;  3HKZ B;  4F88 A;  3GTP B;  2QCP X;  1PFM A;  5LL6 X;  3K80 C;  1LTB D;  2CVR A;  3OW2 A;  3OWF A;  1SE2 A;  3V05 A;  1TWC H;  1NBW A;  1WCM G;  3NWS A;  1XPR A;  1WTX A;  3A8I E;  2PYK A;  4ZUI A;  2JN4 A;  1KC8 C;  4LF4 Q;  2R7Z H;  1K3B C;  2NVY B;  3SXH A;  1B7Y B;  5C3E G;  4HJ7 A;  3D0F A;  4KHP L;  4BXX G;  4HMJ A;  1Y69 U;  1IL2 A;  4KV6 A;  1EY6 A;  2Q2H A;  4L5R C;  5KYI A;  3SDZ A;  1VQG A;  1C0A A;  4MHE A;  1BR9 A;  3M4Q A;  5A2Q E;  4IUU A;  2C35 B;  1CUK A;  1BUV T;  2CWP A;  3TP5 A;  1VQN A;  4KHZ A;  4P75 A;  1ML0 D;  3FDT A;  1PMR A;  1TS4 A;  1BCP B;  4LFA L;  5GAE C;  1FL0 A;  5DAU A;  1SFO H;  2Z0S A;  3TQY A;  3I4N G;  2Z6B A;  3SEB A;  5C0X I;  2UUB L;  2I5H A;  1CK1 A;  3QR8 A;  4RGN A;  3S2D B;  3A8K E;  5LMN W;  5C4X H;  1EU4 A;  3FMC A;  5LMN L;  2UXC Q;  3S1R H;  5M9O A;  1M4V A;  3AMU A; 
#chains in the Genus database with same CATH homology
 1V1Q A;  3HOY G;  4BY7 H;  4GS3 A;  2HT1 A;  3HOY H;  5BR8 L;  2PQA B;  1N32 L;  3CP0 A;  1KIX A;  4AQY L;  5M5X H;  3CMA A;  2ZTC A;  1FVI A;  4LFA Q;  2RCN A;  3KJP A;  2UU9 Q;  3KFU A;  1SR3 A;  1SLJ A;  5IT9 c;  4OXP A;  2R7F A;  2ID0 A;  3J80 i;  4RG1 A;  5IP7 G;  3IRB A;  2UUB Q;  4WJ3 M;  1PH4 A;  4OX9 Q;  4POF A;  3S1N H;  4PZ7 A;  4BA2 I;  3FP9 A;  3HOV G;  1PH7 A;  1CKM A;  5LMN Q;  3STB C;  3HOV H;  2NN6 G;  1PVO A;  3CCV A;  2XTI A;  4LF5 Q;  1VQ8 A;  4LF9 L;  3Q8D A;  1KAW A;  2D62 A;  5BR8 Q;  2NN6 I;  4HJ8 A;  4DV7 L;  3A0J A;  4AQY Q;  2K5N A;  3JAM i;  4P73 A;  1I3Q H;  1B8A A;  1PA6 A;  1BKB A;  2QGQ A;  4AYB G;  3G4S A;  2NVT H;  1WJJ A;  2CQO A;  4APV A;  1S40 A;  1A62 A;  4PZ6 A;  3ZJY C;  1ASZ A;  3G48 A;  2H5X A;  1RL2 A;  1KL9 A;  3E0E A;  1CKN A;  3ULP A;  2E2J H;  2JEA I;  3M3Y H;  1X65 A;  4O0A A;  4GLA C;  4JYA L;  4KI0 A;  3A5Z B;  2NVX H;  2KCM A;  2AHO B;  1Z47 A;  3HKZ G;  5EAY A;  4IJH A;  2E8G A;  2HIX A;  3U4V A;  4YY3 Q;  1M90 C;  4LF9 Q;  2F4V Q;  3S1Q H;  1NY4 A;  3GTP H;  1VQB A;  3ER0 A;  1NJI C;  2KEN A;  2WP8 J;  4OWX B;  3PF5 A;  3B6Y A;  4IFD G;  5LMU L;  3PO3 H;  1X54 A;  4FDB A;  1NMG A;  4P71 A;  1YIJ A;  1QZG A;  2ZM6 Q;  4POG A;  3PGZ A;  1YHB A;  2K4K A;  3KF6 B;  4LUV A;  1UWV A;  1PH6 A;  1K8G A;  3CC2 A;  4L5S A;  1I6H H;  1VQ9 A;  4GOP B;  1KQS A;  1Q1E A;  4A3D H;  2NZO A;  1HJP A;  4X65 Q;  3RLN A;  4JYA Q;  4HIO A;  3JAM c;  2L15 A;  1XPO A;  1N8R C;  2RF4 A;  3GTL H;  1C7Y A;  1QVC A;  1CSQ A;  2Y0S E;  2Z6K C;  3I2Z A;  1J6Q A;  3W5O A;  5IWA L;  2VQE Q;  4GN5 A;  1FJG L;  4YWM A;  2E2I H;  4C3H H;  2LXK A;  4A3M G;  4DR3 L;  1K3R A;  3CD6 A;  3F2C A;  5LMU Q;  4A3M H;  4DV0 L;  5M5W H;  5C44 G;  4LF7 L;  3G6E A;  1SN8 A;  2OTL A;  5C44 H;  4DV5 L;  3S1M H;  2UXB Q;  3J81 i;  4C3J H;  3GTM H;  3PCO B;  1X3G A;  2VZA A;  4NXN L;  2F3I A;  2ASB A;  3CCR A;  4BBS G;  2V1C C;  3MXN B;  5E7N A;  3NEL A;  4BBS H;  1JT8 A;  3S14 H;  5IWA Q;  1Q1B A;  3PUY A;  1BVS A;  2QEX A;  3ULL A;  1FJG Q;  3BJU A;  4JOI A;  1PH2 A;  4A4I A;  4DR3 Q;  1WOC A;  2YTX A;  4DV0 Q;  1AH9 A;  4IOC A;  4LF7 Q;  4A3J G;  3DM3 A;  1QZH A;  2RHQ B;  2E5L L;  4DV5 Q;  3WWV A;  1XPU A;  3PIO A;  1EQR A;  3EN2 A;  4A3F G;  2VUM H;  4R4Q A;  1SRO A;  1A63 A;  1YJN A;  4A3F H;  2ALY B;  2ZJP A;  4JI8 L;  1PYB A;  2VNU D;  4NXN Q;  1M1K C;  1PH3 A;  2YYZ A;  3L0O A;  4C2M H;  2R7D A;  1LM0 A;  1S72 A;  1NTG A;  4LWC A;  2XGT A;  5M3F G;  3L7Z C;  3PIP A;  4GNX A;  4L5Q A;  5C0X G;  5M3F H;  2AKW B;  3J81 c;  2AWN A;  1IBK Q;  1V9P A;  2VL6 A;  4DR1 L;  3S17 H;  3AQQ A;  3PO2 G;  1L1O C;  5M5Y H;  3E9H A;  1EWI A;  1MJC A;  1VS0 A;  2N8N A;  1CKN B;  4JI2 Q;  4X64 L;  3J7Z C;  1VQ5 A;  2E5L Q;  3PF4 A;  3CF5 A;  4YCV A;  1E22 A;  2NVQ H;  4JI1 L;  4A3C H;  2BH2 A;  5C4J H;  3GTK H;  4JI8 Q;  1B70 B;  3AEV A;  1FGU A;  4UP9 A;  2JA7 G;  4A93 G;  1EIF A;  4LF5 L;  4R4O A;  1BBU A;  4DR5 L;  2JA7 H;  3I4M G;  4A93 H;  5IYC G;  4PZ8 A;  1VCI A;  4X62 L;  2Q2I A;  5GAD C;  3I4M H;  1HZB A;  5IYC H;  1IZ6 A;  3M9B A;  3CCM A;  4HJA A;  1XMQ L;  4TVA B;  4O2D A;  3UDX A;  3PUW A;  2WAQ G;  1YBY A;  5H1S E;  5M3M G;  4DV1 Q;  1OXV A;  1AE3 A;  3CXC A;  4R4C A;  4DR1 Q;  5M3M H;  3M85 A;  2JE6 I;  4A3B G;  2JK8 A;  3KF8 B;  2JJQ A;  1GVP A;  1VQI A;  4X64 Q;  3CME A;  4JI7 L;  4A3B H;  4DV3 L;  4JI1 Q;  2PI2 E;  1N36 Q;  3S2H H;  4XIG S;  3UDI A;  5FLM G;  1HNZ Q;  1E1O A;  4BBR G;  1VQ7 A;  4JI0 Q;  3M7N A;  5FLM H;  1SMX A;  1XJV A;  1V43 A;  4BBR H;  4DR5 Q;  5IY0 A;  4YY3 L;  4HIM A;  2F4V L;  1NMF A;  4X62 Q;  4IFD J;  3BU2 A;  3S15 H;  1Q86 C;  3L2P A;  1T9H A;  1U0L A;  3CQZ H;  3K7U C;  3GD7 A;  2IHF A;  4DR2 L;  1XMQ Q;  2JEB I;  3W1B A;  4JI4 Q;  4YHH Q;  3CPW A;  3OTO L;  3AFP A;  4DV6 L;  3KYH C;  2B3G A;  4Y52 H;  5HY6 A;  2ZM6 L;  3SGI A;  4HJ9 A;  5HGQ A;  2GN5 A;  3K8A A;  3CCJ A;  3S24 A;  2KCT A;  4JI7 Q;  2FXQ A;  2CCZ A;  2JA9 A;  1K0R A;  3PSI A;  4DV3 Q;  1J5E L;  2JA8 G;  2AWO A;  3NEM A;  4X65 L;  3F8T A;  3TEH B;  4NB3 A;  5IYD G;  2JA8 H;  4DV4 Q;  3CCU A;  3TS0 A;  5IYD H;  4JI6 Q;  1YIT A;  1Q46 A;  2VQE L;  4R4I A;  3M4P A;  4YCU A;  1VQ6 A;  2QA4 A;  5GAG C;  2JA6 G;  3J80 c;  3RN2 A;  4DR2 Q;  4IPD A;  3PO3 G;  4LFB L;  1VQK A;  2JA6 H;  1KXL A;  3I7F A;  1HZA A;  3OTO Q;  1RIP A;  2PMZ E;  4DV6 Q;  1YJ9 A;  1N34 L;  4B3M Q;  3T1Y Q;  5DLQ E;  3PUV A;  2EIF A;  4OWW B;  1EFW A;  2UXB L;  2OQK A;  1R9T H;  4A3D G;  2A1A A;  3ICE A;  1YVC A;  4A3K G;  1J5E Q;  4AYB E;  4GKK L;  4OON A;  1P16 A;  1PYS B;  3OYY A;  4A3K H;  2YU9 H;  1QVF A;  2PNH A;  1E7Z A;  4GNX B;  5FJ8 G;  1I5F A;  1HR0 W;  2D0P A;  3HOU G;  5FJ8 H;  1Z9F A;  2JQO A;  3VDY A;  1HR0 L;  2K14 A;  2IY5 B;  2WB1 G;  1IBM Q;  3HOU H;  3HOW G;  4DK3 C;  1HH2 P;  3HKZ E;  5FLX c;  3CCE A;  3HOW H;  4K0K L;  4IPC A;  4LFB Q;  5GRO A;  3CCS A;  2AMC B;  1X3E A;  1N34 Q;  2Q2T A;  3MEF A;  1OXU A;  5JEA J;  3U50 C;  1OXX K;  2LSS A;  5IYB G;  1P8L A;  1EIY B;  5IYB H;  1TXY A;  5ELN A;  4LFC L;  2UUA L;  1DGS A;  1L0W A;  3PV0 A;  4JI3 Q;  4GKK Q;  3KOJ A;  2UUC Q;  1OXS C;  2WFW A;  2UXD L;  4R1J A;  2PI2 A;  5C0X J;  3CPF A;  4DUY L;  1VQ4 A;  4QL5 A;  1YEZ A;  2Q2U A;  1UEB A;  2R6G A;  1I94 Q;  4GOP C;  1HR0 Q;  1NE3 A;  3J7A 5;  5K36 G;  2K75 A;  2YV5 A;  1LTL A;  4K0K Q;  4LW1 A;  4YWK A;  1IBK L;  1JB7 A;  2K52 A;  2EQS A;  3EIV A;  2EXD A;  4HJ5 A;  2B29 A;  4DKA C;  2BA1 A;  4JI2 L;  1XNQ Q;  4AH6 A;  1XNR L;  4P72 A;  1Q8K A;  3W1G A;  2VUM G;  1JJC B;  4QIW E;  4DNI A;  4DUZ L;  1XMO Q;  1JJ2 A;  1QUQ A;  1SE8 A;  3A74 A;  2UUA Q;  4LFC Q;  2KHI A;  3UE1 A;  1WCM H;  5J3B A;  4EQ5 A;  4LF6 L;  2UXD Q;  4LUO A;  4JBK A;  2HQL A;  4IPH A;  4DUY Q;  2Z6K A;  3H3V I;  1Q12 A;  3FKI G;  3CCQ A;  1KRS A;  3FKI H;  4P74 A;  2HHH L;  3BZK A;  3CC4 A;  4JI5 Q;  3RLO A;  1PHJ A;  2MNA A;  4DV1 L;  4IO9 A;  4OO1 I;  1CSP A;  1UE7 A;  5IP9 G;  4BXX H;  1S3O A;  3H0G H;  5IP9 H;  2ZTD A;  2R92 G;  2DGY A;  1MIU A;  2F52 A;  4XTC S;  3J81 j;  1VQP A;  1XNR Q;  2HIV A;  2R92 H;  2ZJR A;  1WI5 A;  1IYJ B;  4A3C G;  4DUZ Q;  1N36 L;  2CWA A;  1VQF A;  1D7Q A;  1HNZ L;  3LGJ A;  3HFZ B;  4JI0 L;  4EX5 A;  3F2D A;  4LF6 Q;  1W2B A;  3F2B A;  1E24 A;  2GVB A;  1SRU A;  4GN3 B;  2A8V A;  1Y1W G;  1YZ6 A;  4DR7 L;  1LUZ A;  4UP7 A;  1X6O A;  2MFI A;  1N9W A;  1Y1W H;  1HNX L;  2HHH Q;  4KHP Q;  4JI4 L;  1E3P A;  4YHH L;  2I5L X;  1JMC A;  4MNO A;  1GM5 A;  3HKS A;  4A3G H;  4PMW A;  1VQL A;  2N49 A;  4IPG A;  3T1H L;  1EYG A;  4LF8 L;  1VQM A;  3CW2 C;  3U58 A;  1QVG A;  4HIK A;  1IXR A;  1TWA H;  4J15 A;  4BA1 I;  2A19 A;  4ALP A;  1W3S A;  4DV4 L;  1LYL A;  1D8L A;  1BBW A;  1VQJ A;  3GTQ H;  4MZ9 A;  3UDF A;  1OTC A;  4JBM A;  4JI6 L;  4WJ4 A;  5AJ3 L;  1VQE A;  3E9I A;  4DV2 Q;  1Y14 B;  4DR7 Q;  1K9M C;  1HNX Q;  4GKJ Q;  4LUZ A;  2I0Q A;  1L1O A;  2E2H H;  4DR4 L;  4NXM L;  4UPA A;  3GTG H;  4GLX A;  4BY7 G;  4B3M L;  2K50 A;  4GN4 B;  3GTJ H;  3T1Y L;  1EUJ A;  2DUD A;  1Y1V G;  3FHW A;  3UE0 A;  4LNQ A;  3PUX A;  3T1H Q;  1Y1V H;  1UE5 A;  2OWO A;  3BZC A;  1TWF H;  2WAQ E;  4LF8 Q;  5IP7 H;  4JBJ A;  1X56 A;  3I55 A;  4RMF A;  1IBL L;  1G51 A;  2OQ0 A;  1L2F A;  1VQA A;  4ME3 A;  1MJE A;  4DPG A;  1PH8 A;  5AJ3 Q;  3I4O A;  3EBE A;  4A3I G;  2YTY A;  4QJF A;  4JV5 L;  4KLK A;  1N32 Q;  1IBM L;  4A3I H;  2OTJ A;  1K8A C;  4H02 A;  3GO5 A;  4IJL A;  1N33 L;  4DR4 Q;  4NXM Q;  2RHS B;  3F1Z A;  1KHI A;  3G71 A;  1Q7Y C;  1VQH A;  3KJO A;  1HZ9 A;  1QUQ B;  2BH8 A;  2B63 G;  4R4T A;  5ELO A;  4DAM A;  4UY8 C;  2B63 H;  1YNX A;  2ATW A;  1Q81 C;  4JI3 L;  1PFS A;  2Y0S G;  1TWG H;  2MQH A;  1IBL Q;  2UUC L;  2K5H A;  1KRT A;  1Q82 C;  1H95 A;  3H15 A;  2I5M X;  4TQU S;  3KDF A;  3AYH B;  4X66 L;  3AFQ A;  2CFM A;  4Y7N H;  3ERS X;  2YTV A;  1CKO A;  3KLW A;  1I94 L;  4JV5 Q;  2R93 G;  1PH1 A;  1YI2 A;  4DV7 Q;  4OWT B;  4JCV E;  4A76 A;  3GDE A;  4MTN A;  2R93 H;  2PQA A;  1N33 Q;  1C9O A;  3HOX G;  1X3F A;  3I56 A;  1K83 H;  1TWH H;  4JG2 A;  3HOX H;  1A8V A;  4DAY B;  3DLL A;  4JOI C;  1VQO A;  1K73 C;  3RZO H;  3TS2 A;  1XNQ L;  4A3L G;  4PG3 A;  4QGU A;  4A3L H;  4HID A;  1UE6 A;  1G29 1;  3UDG A;  3HOZ G;  4A3E G;  4IFD I;  3K7A H;  1XMO L;  2CKZ B;  2VY3 A;  3HOZ H;  4A3E H;  4AIM A;  3GTO H;  2NVY H;  1JJG A;  2OCE A;  2K5V A;  2KHJ A;  4B3R L;  1O7I A;  4X66 Q;  1EQQ A;  2BA0 A;  4LF4 L;  1HNW L;  5GQO A;  1X55 A;  5JJI A;  3RN5 A;  4JI5 L;  3U4Z A;  4B3S L;  3RZD H;  3ULJ A;  1GD7 A;  3NEN A;  4IOA A;  1A0I A;  2MO0 A;  4GNX C;  3CCL A;  3K80 C;  2IX1 A;  4UP8 A;  2WB1 E;  2IX0 A;  3OW2 A;  1WYD A;  1OXT A;  4QQB X;  1E1T A;  1TWC H;  2N78 A;  4JC0 A;  5IE8 A;  1X9N A;  1NBW A;  1I50 H;  1WCM G;  4DR6 L;  1UE1 A;  2NZH A;  1GKH A;  5GAH C;  1XPR A;  3RLF A;  3H3V H;  2IT1 A;  2N3S A;  1EOV A;  4B3R Q;  3RR5 A;  2R7Z G;  1KC8 C;  2D0O A;  4LF4 Q;  4OO1 G;  1YJW A;  1L1O B;  2R7Z H;  1HNW Q;  3PUZ A;  3JC6 6;  3TRE A;  5JJL A;  1B7Y B;  5C3E G;  4HJ7 A;  4A75 A;  1PH5 A;  4GLV B;  3M4O H;  2MO1 A;  3K0X A;  5C3E H;  3D0F A;  4KHP L;  4X6A H;  4B3S Q;  4BXX G;  1YHQ A;  2ZTE A;  3H0G G;  4DK6 C;  1IL2 A;  2IHE A;  4L5T A;  3S2D H;  1VQC A;  1PV4 A;  1VQD A;  2Q2H A;  1U5K A;  4L5R C;  3CAM A;  2ZJQ A;  3RNU A;  4BY1 G;  1VQG A;  4A3J H;  1C0A A;  4B3T L;  4BY1 H;  3M4Q A;  4QY7 A;  1AE2 A;  4YWL A;  2JA5 G;  5JEA G;  1PH9 A;  4DR6 Q;  2UXC L;  3KF6 A;  2VQF L;  2JA5 H;  2C35 B;  2VW9 A;  1CUK A;  2CWP A;  4YCW A;  2VS1 A;  3NBH B;  4GOP A;  1MKH A;  1VQN A;  4KHZ A;  3S16 H;  4P75 A;  5JJK A;  1YHA A;  1ASY A;  2KBN A;  4C3I H;  2LXJ A;  4DV2 L;  1KD1 C;  3D31 A;  3CC7 A;  4GKJ L;  3K81 C;  4LFA L;  5GAE C;  1JE5 A;  1FL0 A;  1SFO H;  2UU9 L;  1WFQ A;  1HZC A;  2Z0S A;  3A5U A;  3TQY A;  3I4N G;  4A3G G;  3STB D;  1G6P A;  3PO2 H;  3I4N H;  5C0X I;  2GVA A;  4JBW A;  2UUB L;  2I5H A;  1XTD A;  4OX9 L;  5C4X G;  4B3T Q;  1GO3 E;  5LMN W;  3KDF B;  5C4X H;  5LMN L;  2UXC Q;  2VQF Q;  3S1R H;  3TRZ A;  4NPS A;  2ES2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...