1YNXA

Solution structure of dna binding domain a (dbd-a) of s.cerevisiae replication protein a (rpa)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
114
structure length
114
Chain Sequence
TRPIFAIEQLSPYQNVWTIKARVSYKGEIKTWHNQRGDGKLFNVNFLDTSGEIRATAFNDFATKFNEILQEGKVYYVSKAKLQPAKPQFTNLTHPYELNLDRDTVIEECFDESN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the DNA-binding domain of RPA from Saccharomyces cerevisiae and its interaction with single-stranded DNA and SV40 T antigen
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords Replication factor-A protein 1
total genus 11
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2005-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ynxA01
5JEAJ 1PHJA 1NMGA 1PH2A 1CUKA 4A3BH 1PYSB 2DUDA 3K7AH 4IPDA 1K8AC 1IBKL 1XNRL 1IBKQ 4LF6L 1XNRQ 4DR7L 2VS1A 3U58A 3G4SA 4GKKQ 3EBEA 3ERSX 3KDFA 4GOPA 2R93G 1IBLQ 3J81j 1A0IA 1FGUA 2JA5G 2N78A 1PH5A 4POGA 2HIVA 4APVA 3U50C 3CD6A 1J6QA 2OQ0A 4L5TA 2E5LL 1SRUA 1IZ6A 1LTLA 2WB1E 3D0FA 1OXXK 1P16A 5IE8A 4DV5L 2IY5B 3HOWG 4R4OA 2IT1A 1SR3A 3K80C 4IO9A 2UUBL 4LF7L 4DV6L 4NXNQ 3J7A5 1HNWQ 2UUBQ 4LF7Q 1HNWL 4DUYQ 1E1OA 3RN2A 2R7ZG 1XJVA 3PUYA 3S1QH 5M3FH 5GAHC 3RLOA 4GNXA 2PQAA 1W3SA 2JK8A 2EIFA 5GAEC 2YTXA 3VDYA 1S40A 1QVGA 1PH4A 3F1ZA 2Z6KC 1N36Q 2UXBL 1XTDA 1TWGH 4JOIA 1N36L 4JI2L 1EQRA 3CCSA 4BY1H 3NEMA 5J3BA 1Q46A 1HZCA 2IX0A 2YV5A 1L2FA 2AKWB 3E9IA 5FLMG 3H3VH 2GN5A 4DV4Q 4DUZQ 5FJ8H 2UU9L 5IWAQ 4BBSH 3RN5A 4A3JG 2UU9Q 3HKSA 2ZM6L 4HJ9A 4HJ7A 2E2JH 4YCVA 3I56A 5LMNQ 4YY3L 1YHAA 3L0OA 1KC8C 3RR5A 2YU9H 1PA6A 3I4MG 5FLMH 1TXYA 2N3SA 1N34L 4IJHA 1JJCB 1IYJB 1H95A 5BR8L 3TREA 5FJ8G 2EQSA 3UDGA 4BBSG 2HT1A 2K5HA 1OXTA 4BA1I 1K3RA 1L1OA 4B3TQ 3TS2A 4PZ6A 3CXCA 5IYCG 1OXSC 5JJIA 4DV7Q 2ALYB 4C3IH 1A63A 3W5OA 1HR0Q 2A1AA 4JBWA 5C3EG 4X64L 3ULPA 2JA7H 4DR4Q 1JJ2A 4ME3A 4DR7Q 2N49A 1GM5A 1VQPA 2JJQA 1XMOQ 2XGTA 2D0OA 4IJLA 1VQ8A 2OQKA 1G6PA 3S24A 3I4NH 2Q2TA 1SFOH 5LMUQ 1PH1A 1Z9FA 4TQUS 5LMUL 4GOPB 4JI4Q 4RG1A 1IBML 1PV4A 3J7ZC 4A3BG 4AH6A 5IYBH 1Q82C 4A3GH 4XTCS 3CAMA 1B70B 3I4OA 1HZBA 1I50H 3S1MH 3HOZH 4A75A 1N8RC 5IP7G 3U4VA 1NJIC 3J80i 5DLQE 4NXNL 4HIKA 1TWAH 4DR3L 1CSQA 3CCLA 3DLLA 3G48A 5M5YH 2ZJPA 1V9PA 3G71A 2Q2HA 1EFWA 4LF8L 4A3GG 3GTOH 2OCEA 1AE3A 1MIUA 3CC2A 2UXBQ 4A93G 4DKAC 3I7FA 4DV2Q 2F4VL 4IFDI 3UE0A 5IYDG 4H02A 4DV2L 2OTLA 4GNXB 2UUCQ 1WFQA 2F4VQ 3KF6A 3HOZG 3M3YH 3U4ZA 3BJUA 1I5FA 1SN8A 3M9BA 4DR1Q 4A3KH 3I4MH 3T1HL 3CMAA 5M3FG 2VZAA 2NN6I 1EOVA 3NENA 5IP9H 4GKJL 2C35B 2I5MX 4YHHL 4LF4Q 5IWAL 4JCVE 4DV4L 4HJ8A 4HIMA 3PO2G 1L0WA 3KF8B 2E2HH 1G291 4DV1Q 4DPGA 4JI1L 5IYCH 3J81c 4HJAA 4A3KG 4A76A 1C9OA 4A3DG 2KHJA 1VQKA 5EAYA 2QGQA 4B3MQ 4PZ7A 1VQOA 4IPGA 4B3RL 1VQDA 2I5LX 4KHZA 1X3GA 1WJJA 1VQIA 4QIWE 4A3CH 4QQBX 1FL0A 5M5WH 1JJGA 2B29A 1TWCH 3GTMH 4MNOA 4O0AA 3NBHB 1DGSA 5C44G 3G6EA 3JAMc 2JA9A 2Q2IA 3CCJA 3AQQA 3CQZH 1PH7A 1L1OB 1UWVA 4PMWA 1ASYA 3CCVA 1EUJA 2AWNA 3Q8DA 4L5QA 1Q81C 3STBD 1VQAA 3PGZA 1QVCA 1XMOL 2IX1A 4A3CG 1KRTA 4AIMA 1X55A 1OTCA 4JI7Q 4A3FG 2RF4A 4TVAB 3BZCA 1I3QH 1JMCA 2HHHL 2K5NA 2ZJQA 1WYDA 1GKHA 1MKHA 4EX5A 2MO0A 5C3EH 4X62Q 3H3VI 1SROA 3PO3G 2I5HA 2JQOA 2MFIA 5IY0A 1UEBA 3A5UA 4LFAQ 3CMEA 4HIOA 1N33Q 2MQHA 4DV5Q 2KHIA 3EN2A 2K50A 2L15A 1N32Q 2JA8H 4DR6Q 1VQGA 4JOIC 1HR0W 4Y52H 4BY7H 5M5XH 2ES2A 3HKZG 3UE1A 3PF4A 1UE7A 4DV0L 3TEHB 4DR2Q 2R92H 3TRZA 5GAGC 5IP9G 4DV3L 1O7IA 4JI3L 5AJ3L 3S14H 3TS0A 4B3TL 4NXMQ 3DM3A 2HIXA 2YTYA 1X3FA 1GVPA 3L7ZC 1HNZL 1N9WA 1V1QA 2F52A 2WB1G 4A3IG 1R9TH 4LUVA 5IP7H 3HOVH 1KHIA 1U0LA 1P8LA 3A74A 3E9HA 1X65A 4R4IA 1UE1A 5IT9c 3RLNA 3F8TA 3CCMA 4DR1L 3T1HQ 4L5RC 2NVTH 2LXKA 4GKJQ 3ICEA 4IFDJ 1AH9A 2VL6A 4DK6C 3K7UC 4UPAA 4DR5L 1HZ9A 4A3LG 1VQCA 1X3EA 1UE6A 2CWAA 2ZTDA 3FKIG 5JEAG 1EIYB 1K9MC 1FJGQ 3HOVG 2KBNA 3K0XA 3E0EA 4FDBA 5C44H 1IBMQ 2I0QA 3ULJA 3PUXA 3M85A 5H1SE 1JT8A 3KDFB 4R4CA 2CCZA 2K14A 4P74A 4A3LH 4X66L 2VUMG 3OTOQ 3KFUA 4KHPQ 4OO1G 1VQ9A 4JI8Q 3OTOL 1GD7A 4KHPL 1EQQA 4IFDG 4K0KQ 4QL5A 3A5ZB 4K0KL 1YJ9A 3TQYA 1EWIA 4LF8Q 2K75A 1HR0L 3GDEA 3L2PA 3PCOB 1K8GA 3GTGH 3AFQA 3FHWA 1NBWA 5IYBG 3KJPA 2VY3A 4LF6Q 4OO1I 2IHFA 2VUMH 2D0PA 4QJFA 1BBWA 4HJ5A 2OWOA 2JA8G 4A3DH 1PH3A 1PH8A 3PF5A 1XNQQ 3CW2C 4BY7G 1T9HA 4LUOA 4R4QA 1Y14B 2HHHQ 4X62L 2EXDA 1YJNA 1X6OA 2XTIA 4A3MH 5HGQA 3OW2A 2BH2A 1CKNB 1AE2A 5JJKA 1E7ZA 3AFPA 1KL9A 4LF9L 1XMQQ 3PUWA 2K52A 1YVCA 1HJPA 2NZOA 2NZHA 2V1CC 4JYAL 1VQMA 4DV0Q 2PI2E 2LXJA 4GN3B 1KIXA 2H5XA 2WAQG 3GTKH 1KD1C 4OX9L 3EIVA 4A3MG 3MXNB 2QEXA 4JI2Q 1X9NA 4YWKA 3FKIH 3ZJYC 1S3OA 3CCRA 4IOCA 3S1RH 1VQNA 4LFBL 4LFBQ 2UUCL 2R7DA 1HNZQ 1Y1VG 4DNIA 2OTJA 3W1BA 1LM0A 4OWTB 3J80c 2JE6I 4X64Q 3CPWA 3RNUA 3GTJH 2R92G 2QA4A 3CP0A 3PSIA 4OWXB 2A19A 1M90C 2Q2UA 4JV5L 2PI2A 2ZM6Q 1V43A 4JBJA 4C3JH 1ASZA 4JI7L 1GO3E 3S2HH 4DV1L 2HQLA 1NMFA 1VQEA 3M4OH 4A3IH 1TWHH 2Y0SE 4AYBG 3HOXG 4JI4L 1B7YB 2E5LQ 3JC66 3S16H 4P71A 1YHQA 4X65Q 1A62A 2FXQA 4GLAC 1Q8KA 1HH2P 4YCUA 2BA0A 2CQOA 4LW1A 4P72A 2JEAI 4UP9A 4UP7A 4RMFA 5ELNA 1J5EL 4LF5L 1JE5A 2JA6G 4JI5L 1C0AA 2ASBA 2VQEL 1NE3A 2IHEA 4R1JA 4KI0A 3J81i 4Y7NH 4A3FH 4JI6L 2BH8A 4DV3Q 4B3SL 3HOUH 4ALPA 1QZGA 3PO3H 3I2ZA 2YYZA 4GKKL 4LWCA 1BVSA 1SE8A 4A4IA 3LGJA 1W2BA 1XNQL 4GLVB 1QZHA 3GO5A 1X54A 2ZJRA 3GTPH 4OXPA 3JAMi 4YCWA 2AHOB 1CKNA 1VQBA 1D7QA 1QUQA 4LNQA 1OXUA 1Q1BA 3STBC 4JI1Q 1IXRA 3PIOA 3CCEA 4JBKA 1Q7YC 1BKBA 1IL2A 1C7YA 2VQFL 1N32L 2Z0SA 1HNXQ 4J15A 1N34Q 2WAQE 2NVXH 2GVAA 1G51A 3KOJA 3PUZA 4DR2L 4B3RQ 4OX9Q 4P75A 3CCQA 5AJ3Q 2E8GA 1QVFA 2YTVA 3ULLA 2AMCB 3RZDH 5ELOA 1Z47A 3PIPA 4AYBE 3NELA 3M7NA 1E3PA 1PYBA 1PH9A 5C0XI 1A8VA 3HOXH 3K8AA 3H0GH 1NY4A 1L1OC 4POFA 4O2DA 4DR5Q 4C2MH 1E24A 4AQYQ 2UUAQ 4OWWB 1K73C 4GS3A 5LMNW 1LUZA 4DAYB 4GLXA 3AEVA 5M3MG 2CKZB 1Q86C 1FJGL 1PVOA 3PUVA 3F2DA 3M4PA 5GADC 1QUQB 1VQ7A 2Y0SG 5C4XG 3CPFA 3BZKA 3M4QA 4LFAL 2BA1A 4YWMA 4OONA 4UY8C 2ZTEA 3UDIA 4DR6L 1VQJA 5FLXc 4DV6Q 1KQSA 4WJ3M 5M3MH 4JI5Q 3ER0A 4JI8L 1SMXA 1J5EQ 1FVIA 3UDXA 1YIJA 1MJCA 3H15A 4HIDA 2NVQH 2WP8J 5C4XH 4JI3Q 2KENA 4QGUA 1WOCA 3D31A 1VQ5A 4DR4L 4WJ4A 4MTNA 2NN6G 2R7FA 1EYGA 1E22A 1YNXA 1PH6A 1IBLL 4A3EH 1Y1WG 1XPUA 4IPCA 2JA6H 2KCTA 1WCMG 2MNAA 3HKZE 3PV0A 2KCMA 2CWPA 3T1YL 2MO1A 2NVYH 3S15H 1N33L 4LFCL 1MJEA 4JC0A 3S17H 4PZ8A 1YEZA 3MEFA 5LMNL 4LFCQ 2UXCL 2AWOA 4R4TA 3HOYG 2Z6KA 2VQFQ 1VCIA 4JYAQ 1E1TA 1Y1VH 1OXVA 2VNUD 2UXDL 5HY6A 3GTQH 4B3ML 1U5KA 1EIFA 3BU2A 4A3JH 4GOPC 4X66Q 4MZ9A 4IOAA 2R93H 4JI0Q 4YWLA 2DGYA 3W1GA 2ATWA 3GTLH 4GN4B 3F2BA 4JI0L 3S1NH 1I6HH 3B6YA 3AYHB 4JBMA 3HOYH 4IPHA 4B3SQ 1YHBA 4X6AH 2PNHA 4GNXC 2RHQB 1RL2A 1B8AA 2A8VA 2B63H 4BXXH 4DAMA 2CFMA 3F2CA 3CC7A 3K81C 4BBRH 3CF5A 4AQYL 3KJOA 2UUAL 4LF4L 3HOWH 4JV5Q 1KXLA 1VQ6A 1D8LA 1NTGA 1XPOA 4JG2A 2R7ZH 1YZ6A 2LSSA 3WWVA 5C4JH 2JEBI 3PO2H 1K83H 2E2IH 3H0GG 4BXXG 5JJLA 3HOUG 1RIPA 4KLKA 1XMQL 4X65L 1VQFA 2K5VA 1TWFH 3OYYA 4GN5A 4DUYL 2B3GA 3KF6B 4PG3A 1CSPA 4DR3Q 2PMZE 3SGIA 2VQEQ 3CC4A 1WCMH 2ID0A 4JI6Q 3GD7A 4LF5Q 5E7NA 3HFZB 4QY7A 1VQHA 3KLWA 4L5SA 4NXML 4EQ5A 1CKMA 2ZTCA 3KYHC 3UDFA 4C3HH 1LYLA 1PFSA 1CKOA 1Q12A 3IRBA 5C0XJ 1Q1EA 3CCUA 1XPRA 1M1KC 4BA2I 2R6GA 1VS0A 2D62A 3RLFA 1VQLA 2GVBA 1X56A 3FP9A 3T1YQ 4YHHQ 1YJWA 4A93H 4NB3A 4DUZL 4DK3C 5IYDH 2F3IA 4BY1G 1BBUA 4LF9Q 2VW9A 1YI2A 4YY3Q 2RCNA 1VQ4A 2UXCQ 5K36G 1HZAA 4P73A 5GQOA 4A3EG 1SLJA 1Y1WH 3S2DH 1KAWA 4NPSA 1HNXL 1I94Q 2B63G 5BR8Q 2WFWA 3A0JA 2JA7G 3I55A 5C0XG 1I94L 1UE5A 4LUZA 5GROA 2RHSB 4XIGS 2UXDQ 2PQAB 3RZOH 4BBRG 4UP8A 1JB7A 1KRSA 2JA5H 1WI5A 3I4NG 1YITA 1S72A 2N8NA 4DV7L 2K4KA 1K0RA 1YBYA
chains in the Genus database with same CATH superfamily
1PHJA 1GUTA 3K7AH 1IBKL 1IYVA 1IBKQ 4LF6L 5CV5A 3U58A 1CA5A 3D4RA 1B9NA 5CV8A 1A0IA 1FGUA 2N78A 1PH5A 4APVA 2MP1A 2XSCA 1PTOB 1M4VA 3QR8A 2E5LL 3A8JE 4RCNA 5FLXL 3HOWG 4HR7B 3K80C 1SJED 4LF7L 1HNWQ 4NXNQ 3J7A5 2UUBQ 3I73A 5EBCA 4K5VA 4GNXA 4KKTA 1S40A 3VDYA 5IGBA 1YNJC 1STNA 1QVGA 4LK1C 4C56C 1TWGH 1N36L 3N6RA 3CCSA 3D6WA 2RA4A 3NEMA 2B2UA 1Q46A 2L4NA 1HPCA 3H6MA 2DY7A 4CJ0B 5JVG3 2O4XA 4C1NK 2DJGC 2UU9L 2UU9Q 3HKSA 2E2JH 4HJ9A 2QF7A 4YCVA 1KDAA 1LT5D 2MGSA 1YHAA 4J6HA 4RHRA 5C3XA 5J22A 3I4MG 3RZDB 4IJHA 1IYJB 1H95A 5BR8L 3S2DB 4H0LC 1H9SA 4BA1I 2Z6BA 2A6HD 4PZ6A 3QG1A 1OXSC 1T5EA 2ALYB 2K03A 3DWQA 2K1BA 1HXYD 3ULPA 2JA7H 4DR4Q 2FMCA 1XMOQ 1VQ8A 2D0OA 3J80E 2Q2TA 4TRDA 4JI4Q 1U4RA 1DCZA 1I4XA 4A3IB 4A3BG 3VA7A 2K04A 4ZKCB 4XTCS 1WTVA 2IJ0A 1B70B 1I50H 3NHHA 3HOZH 5IGEA 5IP7G 3U4VA 3DHQA 2F0VA 1HQMC 5M5YH 2F0JA 1V9PA 5I9OA 2Q2HA 3G71A 1EFWA 3CC2A 2UXBQ 4A93G 3I7FA 2F4VL 3S15B 3VR4A 4IFDI 3CRKC 3T16A 1ILPA 2K5QA 3U4ZA 2QW7A 4WJWA 1NR2A 4A3KH 3I4MH 2F0WA 3T1HL 4DK0A 3CMAA 5FK9C 1SMYD 4HIMA 1G2SA 2MPMA 3I4MB 1G291 2F0UA 4DV1Q 2DNEA 3J81c 1LTGD 1VQKA 1LACA 4B3MQ 2CH4A 4IPGA 2DNCA 5FOBB 1X3GA 5IOCA 5C3WA 1EZ8A 2B29A 1DGSA 5C44G 3G6EA 2JA9A 3TP7A 3J81E 4N8X1 3U9SA 1JOKA 1SFOB 1ASYA 4FF4A 1ESFA 1K83B 2AWNA 1TWCB 2IX1A 3PGZA 3KLRA 2HUGA 2QDBA 5HGTA 1X55A 5I9PA 2ICIA 4JI7Q 1F77A 2RF4A 4BBSB 1HA6A 1BO0A 1I3QH 3BZCA 2K5NA 1WYDA 4B08A 5C3EH 3H3VI 1ZEQX 4HIOA 4LFAQ 3AB9A 2MQHA 4DV5Q 2L15A 3NSWA 1U4PA 1NAPA 1HR0W 4Y52H 3KBXA 3HKZG 4CBVA 3A54A 5DEHA 4DV0L 4DR2Q 4DV3L 1A3UA 1O7IA 4JI3L 5AJ3L 1A6XA 4G7HC 2ICEC 4B3TL 2EYFA 1EYDA 2JP1A 2HIXA 2FHTA 1X3FA 1GVPA 3L7ZC 2Y0SB 4ME5A 1N9WA 1V1QA 2F52A 4TSSA 4HCSA 5CV6A 3HOVH 3S17B 4C2MB 5ELBA 3T1HQ 1UE1A 2EXZA 4L5RC 2ZXRA 1B53A 1ONLA 4DR1L 3TP8A 4GKJQ 2LXKA 2VL6A 2C9OA 4DK6C 2CWAA 2SEBD 3K0XA 1D1IA 3TSSA 5C44H 1IBMQ 1SYBA 1JICA 3PUXA 1JWUD 1C4QA 1JT8A 3KDFB 4R4CA 3G7LA 1BUVT 1GD7A 1EQQA 4QL5A 1FNVA 4LF8Q 5KNDA 3PCOB 3GTGH 2F0SA 1PZJD 3AFQA 3NQTA 1RTNA 3FHWA 4RAUC 5E4WC 5IYBG 5ELDA 2VUMH 4QJFA 1JR0D 2BDNA 4KKUA 1BBWA 4HJ5A 1PH3A 2ZXOA 3CW2C 3D8GA 2EXDA 4XQQA 5M5XB 2XTIA 4A3MH 2NN6H 3OW2A 2BH2A 1AE2A 1Z6HA 4LF9L 4CHTB 3K59A 1ZYRC 1SMYC 2EYMA 2SOBA 2WKDA 2V1CC 1VQMA 1DJRD 4F87A 4GN3B 2PQEA 3GTKH 2WAQG 4OX9L 3GTMB 1K8MA 2F0DA 1MBYA 1VQNA 1EL0A 4DNIA 2OTJA 4FXKC 4ZUIA 4DN4M 4OWTB 2JE6I 1ET9A 2XRSD 3RNUA 4QB4A 2R92G 1F9SA 3PSIA 4OWXB 5JAVA 2PI2A 4KMUC 4JBJA 4C3JH 1ASZA 4AYBG 4JI4L 3A7LA 1ICFB 3JC66 1PZKD 1A62A 4YCUA 2BA0A 4UP7A 1UUPA 1G6ZA 2HDMA 4KI0A 4Y7NH 3A8IE 4K5XA 2JYOA 1QZGA 3I4LA 3R2IA 3PO3H 1SE8A 2RSNA 4A4IA 4GLVB 1LTTD 1X54A 4OXPA 5FKAC 3QWNA 4HCEA 1D7QA 4HEDA 1QUQA 4QUFA 4IUTA 4LNQA 1ZXTA 4ID6A 4R8NA 4FF2A 1Q7YC 2D5DA 2VQFL 4J15A 2NVXH 2GVAA 3PUZA 3GV3A 3CCQA 2E8GA 1LTID 2ZXPA 3I8ZA 2WV6D 3VR2A 5JEAH 3AMUA 1PRTC 2E2JB 3PIPA 3KBGA 1PYWD 3TZUA 1NY4A 4POFA 3NTHA 1H9MA 3P1HA 1PMRA 3Q0AA 3BYTB 5JPMC 4DAYB 2SNSA 1EWCA 3BVZA 2EZVA 3S2HB 1QUQB 1EY6A 1KABA 1TS5A 4LFAL 4RGTA 4YWMA 4UY8C 1HTPA 2RBMA 2ZTEA 3K57A 2AUJD 5FLXc 4ULLA 4WJ3M 1TT2A 1GJXA 3L3OC 1MJCA 3H15A 4XQJA 4JI3Q 5FO8B 4DR4L 1VQ5A 3G6JB 4WJ4A 4HMIA 1YNXA 1IBLL 3OMCA 3S1MB 2F3VA 5IGCA 1FGBD 3PV0A 3T1YL 1LT3D 3OIQA 1DOLA 4N9TA 1N33L 1Q90A 2UXCL 1YEZA 5LMNL 3MFYA 2Z6KA 2IPKD 2VQFQ 2EYHA 2LFNA 3HOVB 2VNUD 3I90A 5EBDA 4B3ML 3QB3A 1EIFA 5L37A 1XYIA 4IOAA 1BR9A 3GTLH 4KN7C 3H94A 3AYHB 2EYPA 4B3SQ 1YHBA 2A8VA 4GNXC 1SE3A 3FVQA 2CFMA 1EFID 3K81C 3CF5A 5NUCA 4AQYL 3P7JA 1VQ6A 1D8LA 4JG2A 1XTCD 3QO2A 4IUPA 3J7AV 4BXXG 3T53B 2YU9B 1EY5A 3OYYA 2PZTA 3SGIA 3HZXA 4LF5Q 4U68A 4A3EB 2KCNA 5E7NA 1EU4A 1VQHA 3KLWA 2NVYB 4BWGB 3ONAB 4EQ5A 1O7LA 2ZTCA 3EA6A 3DEPA 1PFSA 5D3DA 4BA2I 1Q1EA 3CCUA 1M1KC 1VS0A 2KVMA 4K8JA 5EQ0A 2GVBA 1DYQA 1HTLD 4YHHQ 5KEEA 2EY2A 4K6DA 4DUZL 4ZCKA 5IYDH 2R92B 2B2WA 2F3IA 4B9XA 2VW9A 3BVMA 1VQ4A 4DXGA 2NB0A 4A3EG 1Y1WH 1C8CA 2EJFC 4NPSA 3HKZB 5C0XG 2UXDQ 2RHSB 2J0TD 2PQAB 1RTOA 3C3LA 1WI5A 1H9SB 1S72A 1HA5A 3JAML 1XXGA 1K0RA 4CKEA 2WINB 5EKIA 4K6LA 3RZOB 3M7GA 1PH2A 2DUDA 1K8AC 2GA4B 3IFTA 4DR7L 2VS1A 3BVGA 4GOPA 2F1MA 4POGA 3K5OA 2HIVA 2K01A 2L9HA 1I6VC 3BDOA 1CZWA 1SRUA 2A74C 2WB1E 3D0FA 1OXXK 1P16A 5IE8A 5LL6X 1B3AA 2A73B 3DM1A 2IY5B 4R4OA 4FF1A 1PRTD 3R3OA 1S5DD 3Q23A 4LF7Q 1HNWL 5A2QE 1E1OA 4DUYQ 3RN2A 1XJVA 5D3IB 3S1QH 5M3FH 1YNJD 1EZ6A 1W3SA 3W2DA 2M2LA 3S1NB 1TY0A 1XTDA 4JI2L 4KJOA 5FLMG 1U9RA 5C5MA 5E1FA 4DUZQ 5IWAQ 3RN5A 4A3JG 3SK5A 4HJ7A 1AFPA 1EY4A 3OWEB 3L0OA 2YU9H 1PA6A 3NK9A 2N3SA 3VYSA 1BCPB 1NUCA 1JJCB 1QWYA 4M1UB 4X3UA 3TZDA 2P5ZX 3TS2A 1TS2A 5IYCG 3BDLA 3VR6A 4C3IH 1A63A 1EQTA 1BNZA 4J8QA 4CDFC 1HR0Q 1SNOA 3M4YA 4X64L 5BN4A 3ND8A 4IUNA 4DR7Q 5I6YA 2CVRA 2JJQA 1VQPA 2BE5C 1G6PA 2OQKA 2SDFA 1WTPA 2NUCA 3HOWB 3EFXD 5CGKA 1IW7C 1STAA 1IBML 1PV4A 4A3GH 4AH6A 1PLFA 3J7YW 4RH6A 5M5YB 3GTOB 1CHPD 2M9VA 3J80i 4HIKA 2OXPA 1S5ED 4X3TA 3URYA 3CCLA 5J1ZA 4LF8L 2OCEA 1I4RA 1IHZA 3R93A 2NBFA 1CA6A 2OTLA 1S5BD 2UUCQ 4K2LA 5F2DA 2F4VQ 3HOZG 3KF6A 1V1PA 1SN8A 2K28A 2NN6I 5IP9H 1PFMA 4X3SA 4HJ8A 1L0WA 3KF8B 4PV1C 5IYCH 3JAME 4A3KG 4C3IG 4A3DG 2QGQA 4PZ7A 4B3RL 1VQDA 3V05A 1WJJA 1VQIA 4QIWE 1PFBA 4EQOA 4A3CH 4QQBX 2QKIC 1FL0A 4NMZA 3TDQA 4F8MA 3GTMH 1WTXA 1TVXA 5CYUA 1NCVA 3AQQA 1L1OB 1WTHA 1UWVA 2C5CA 1EUJA 1A3TA 1Q81C 2EPBA 1XMOL 1ZKOA 2I07B 3MZ5A 1OTCA 2IW3A 4A3FG 4H7BA 1HRJA 1JMCA 1GHKA 1MKHA 2MO0A 1JE4A 4PMBA 4FO2A 5D65A 1SROA 4X62Q 2JQOA 1JCKB 2G9DA 3A7AB 2K6AA 4NP5A 1BCPF 4DR6Q 4BY7H 2ES2A 3PF4A 4CDEC 5GAGC 5IP9G 2YTYA 2NTSA 3VR5A 1IL8A 4A3IG 4IN3A 1R9TH 4O1NA 1X65A 4PMCA 3F8TA 1JC7A 2A5HA 2HQEA 3TP5A 3ICEA 4IFDJ 3K7UC 2O5IC 4A3LG 1LTBD 1OO9B 4HSVA 1K9MC 5DM73 1H9RA 1FJGQ 3HOVG 2KBNA 2F4IA 1RDPD 4FDBA 3TMEA 1I4QA 2V4DA 1Y8OB 3NPPA 2FINB 1ML0D 1QNUA 3HEJA 3BG3A 3VA5A 4X66L 1VDZA 4OO1G 4K8IA 3RMHA 1EWIA 2PZUA 1JB3A 2E74C 1UNSA 2HD3A 4WRDA 3CRLC 3H3VC 3KJPA 2VY3A 1YNNC 2D0PA 1RJTA 1QILA 1WCMB 4BBRB 1PH8A 3PF5A 5C4ZA 1Y8NB 2RQXA 4BY7G 1T9HA 3F2UA 2HHHQ 1YJNA 1X6OA 5JJKA 4KD3A 1E7ZA 1EY9A 3HG9A 2F0KA 1AZPA 1YVCA 3S1RB 4JYAL 4B9WA 3KLSA 4N8FA 4DV0Q 1KIXA 2H5XA 3SEBA 4A3MG 2NVTB 2QEXA 1LO5D 4EVOA 1F9RA 4YWKA 3ZJYC 3S1RH 1H9JA 3NWTA 1HNZQ 1Y1VG 2VB2X 3W1BA 4HAEA 4X64Q 3GTJH 2QA4A 1STEA 3S16B 4F88A 2Q2UA 4KN4C 4JV5L 2ZM6Q 4OHJA 3S2HH 4MHEA 4P2CB 4DV1L 3M4OH 1NMFA 1NNXA 5E4XA 4RGOS 1B7YB 2E5LQ 1YHQA 1EU3A 4GLAC 1V1PB 2CQOA 4K14A 4ZYSA 4RMFA 5ELNA 1J5EL 4JI5L 1C0AA 2VQEL 2IHEA 4R1JA 4JI6L 1O78A 3HOZB 3I2ZA 4A3GB 4DNRB 4IZ8A 1BVSA 1SYDA 3CQZB 1W2BA 1EYAA 1SNDA 4ABNA 3GO5A 2ZJRA 4KK7A 2L55A 3OSOA 3JAMi 2N55A 5M3FB 3L9AX 1TWGB 4R9WA 3STBC 1DXMA 1IXRA 5M9OA 3PIOA 1IL2A 3S9WA 3I3CA 1C7YA 2QCPX 2Z0SA 3SK6A 1HNXQ 2WAQE 2KHSA 1ENCA 2JXMB 4DR2L 4B3RQ 4OX9Q 5AJ3Q 3MC0B 3FPUB 4MN3A 3ULLA 4AYBE 1O7YA 5C0XI 3K8AA 1B2TA 4O2DA 2RDFA 4DR5Q 2R7ZB 1E24A 4GS3A 3SK4A 5LMNW 2RDGA 5M3MG 5M5WB 2CKZB 2EY5A 1DOKA 3EVQA 4C3JB 5GADC 2Y0SG 3BZKA 3M4QA 1TWHB 2BA1A 4OONA 1SYFA 4DNTB 4NKLA 3UDIA 5EKLA 1VQJA 5K5PA 4DR6L 3RUZA 1MGSA 4JI5Q 3ER0A 4CKCA 4HIDA 2EJGC 2F0HA 2NVQH 5EPLA 2Z9HA 2NN6G 4IUQA 1EYGA 1TWAB 1XPUA 2JA6H 2KCTA 3WOFA 2VUMB 2KCMA 2MO1A 1WTQA 3S15H 4G7OC 2TSSA 3ZYYX 2Z4HA 1MJEA 3S17H 4PZ8A 1U4MA 2AWOA 4R4TA 3PQIA 1I50B 2D2CC 5COYA 3IKJA 5EGTA 3GTQH 1U5KA 3H09A 5G3LF 3LWEA 2K5WA 4X66Q 2BOSA 4A3DB 3MFGA 4MZ9A 1BXTA 4DU9A 2X6GA 4GN4B 3S1NH 4M8AA 4JBMA 4JK1C 3DXJC 3LX0A 1ZYRD 4CKBA 3F2CA 4BBRH 3HOWH 3K0YA 5AFWA 3VYUA 4ZAIA 2R3ZA 5G3LD 3WWVA 3EJIA 1EIGA 1K83H 4O42A 3H0GG 4KKSA 2KJXA 4KLKA 2PCFB 4X65L 2K5VA 1TWFH 1CSPA 5CBEE 1D5MC 5I6WA 3ITPA 1JQYD 4L5SA 1CKMA 3KYHC 1UEAB 4C3HH 1Q12A 1CKOA 1XPRA 4YIJA 1AEXA 2HCCA 4XXEA 2D62A 3SE0A 1Y1WB 3DWPA 2CW0D 3T1YQ 4NB3A 2F0MA 1J9OA 4BY1G 1I4GA 4OGQC 4YY3Q 2RCNA 2UXCQ 1DZ1A 5K36G 4P73A 1KAWA 2JA8B 3KLSX 2JA7G 1UE5A 4XIGS 4BY7B 1K3BC 2X6LA 1EY7A 4BBRG 1JB7A 1KRSA 2JA5H 3HOUB 4K2KA 5EKKA 4DV7L 1BF4A 1PDQA 1YBYA 1V1OA 5ELEA 5I4DA 5JEAJ 1NMGA 2Z8LA 1CUKA 3A8KE 1PYSB 1XNRL 4A3BH 4X6AH 3I72A 1XNRQ 4GKKQ 2B2YC 2R93G 2PYKA 4RCOA 1CK1A 2OQ0A 5EPJA 4DV5L 1D5XC 2Z1CA 3MAQA 4IO9A 4DV6L 2R7ZG 4EQNA 4C3HB 5GAHC 2JK8A 2PQAA 1PH4A 5GAEC 3PO2G 2YTXA 1B4OA 1V8QA 2Z6KC 3E3XA 2ENBA 4OELB 2KCCA 2F0TA 1RF2D 4BY1H 1QB5D 2O2LD 3X3MA 1IKMA 4RGMA 1AP0A 1B1ZA 2PMZB 3H3VH 2KQ3A 5TSSA 4DV4Q 5FJ8H 4BBSH 2ZM6L 3IFDA 3I56A 4YY3L 3T13A 5FLMH 1TXYA 1N34L 3C1EA 1WVLA 4BBSG 2EQSA 1W6KA 2K5HA 2JA7B 1K3RA 4KJNA 1L1OA 4B3TQ 3CXCA 5JJIA 4KY5A 1IKLA 2I46A 3W5OA 2B8GA 5C3EG 3MEHA 1X3QA 4ME3A 1JJ2A 2B39A 1GM5A 2A69C 4IJLA 1QJOA 3S24A 2A6ED 3I4NH 1AW7A 1SFOH 5LMUQ 2Q8TA 2XVSA 5DM63 5LMUL 3OHXC 4GOPB 1SNCA 4RG1A 1SNMA 3CAMA 2F0OA 2EYJA 2KOLA 5DLQE 4NXNL 1TWAH 2EE1A 4DR3L 3DLLA 3G48A 2F0LA 4H13C 4A3GG 1MIUA 4OL7A 4KD4A 4DV2Q 4RKLA 5IYDG 4H02A 3M3YH 2WACA 3BJUA 3PO3B 1I5FA 3M9BA 5C5LA 4DR1Q 1JORA 1UAPA 2C35B 5KYIA 1JWMD 5IWAL 4JCVE 2WIIB 2B63B 4DPGA 5DAUA 4JI1L 4HJAA 4A93B 1FNUA 1G91A 1RHPA 3NBIA 5EAYA 1VQOA 2J7ZA 2I5LX 1JJGA 4IURA 4MNOA 4O0AA 2L11A 1T5XD 2Q2IA 1XX8A 1LTAD 1HUNA 1PH7A 3CQZH 4PMWA 2EVBA 3DMUA 4CDDC 3STBD 4A3CG 1QVCA 5I2XA 1KRTA 4LJZC 1TWFB 3V96A 1TQOA 2F0PA 2AQ2B 3J81L 1Y69U 2I5HA 2MFIA 2PW7A 3A5UA 1UEBA 1N33Q 3HP3A 3N52A 1A2TA 2RDHA 2KHIA 5FO7B 4G57A 2PPBC 3MVVA 2JA8H 1VQGA 1MHWC 5M5XH 5T1IA 2LMCB 2R92H 4DK1A 3DM3A 4C3JG 4LUVA 5IP7H 5C4HA 1P8LA 5CORA 1EQVA 1TS3A 3NWSA 4QUCA 2B2TC 1AH9A 4UPAA 1HZ9A 1D5ZC 1X3EA 2NWGA 1UE6A 2OT2A 2ZTDA 3FKIG 1EIYB 4I7ZC 2TMPA 4R8IA 3FRPB 3M85A 4RWSC 4UDUC 2K14A 4P74A 4A3LH 3KFUA 3OTOQ 4KHPQ 1VQ9A 2Z4IA 3MTSA 4IFDG 4ODGA 4CDCC 1R4QB 1PTOF 3SDZA 3TQYA 5IODA 5CV9A 4CJ1B 4V0BA 3GDEA 1HR0L 1R4PB 1KNEA 1NBWA 4A3KB 1GUSA 1H9KA 2F0EA 4Y7NB 1KAAA 2JA8G 2H1EA 4A3DH 1I4HA 4I65A 1Y14B 3PIO3 4X62L 2MHVA 1F2LA 3FMCA 1CKNB 1KL9A 3AFPA 3AU7A 1ENFA 2K05A 4DFAA 2HCIA 1CQVA 3NP8A 2K52A 2OEOA 1HJPA 2KEEA 2NZHA 2EY6A 3EIVA 1S5CD 1X9NA 3FKIH 4LFBL 1S3OA 4FNFA 2XWBB 3ERQA 2LS01 5CC4A 3CPWA 3CP0A 2Q8IB 3LWUA 2A19A 1M90C 3P20A 4C3IB 4JI7L 2HQLA 5C3EB 4Q5VA 1TWHH 2Y0SE 4DAYA 2A6EC 3S16H 2WKCA 1KLUD 2BDOA 3NE5B 2K32A 4P71A 2G5DA 2IL8A 1Q8KA 1HH2P 1PRTF 2X69A 3MWYW 4LW1A 2JEAI 4UP9A 4GZYC 4UHVA 1STHA 4LF5L 1B3QA 1JE5A 4G4KA 2ASBA 1NE3A 3D4DA 3J81i 4A3FH 2E2DC 2SNMA 2XN9C 3K58A 4DV3Q 1A15A 4B3SL 3HOUH 3M3YB 1SNPA 2YYZA 3SHLA 4GKKL 5KRUA 2MJ8A 3VYRA 1SSOA 4BS9A 1QZHA 1PTOD 4L6TB 3GTPH 5I2YA 3C1FA 3BZDB 2AHOB 2B2UC 2B2TA 1AN8A 1X32A 1BCPD 1I4PA 3HS0C 1OXUA 1Q1BA 4JI1Q 2NYZD 3CCEA 4ZKBB 4DA2A 1BKBA 3CU7A 4A3JB 4BY1B 1N32L 1N34Q 1YNND 1WTOA 3KOJA 2PNRC 4P75A 5IT9E 1QVFA 3RD4A 3GTGB 1HCZA 3RZDH 5ELOA 4PNYA 4DAVA 3M7NA 1E3PA 1LABA 4C2MH 2UUAQ 3WOEA 3E5SA 1I3QB 4JW0A 4OO1H 2XWJB 3AEVA 5ELFA 1PVOA 3PUVA 3F2DA 1E0BA 2CHBD 3M4PA 1VQ7A 1PTOC 5C4XG 1QOHA 1TIID 3D3RA 5FO9B 2K5DA 1DM0B 5JOBA 2CQAA 3OOCA 1KQSA 2FFKB 5M3MH 3MHBA 4JI8L 1FVIA 1K8OA 4FXDA 3K5NA 1MD2D 1FNWA 3OMGA 2R7FA 1GXDC 5IGFA 3FPPA 4Z9CB 4RHSA 3GTJB 4A3EH 1Y1WG 4IPCA 2NVQB 3HKZE 4RGNA 2NVYH 2E75C 2BCOA 2N88A 4LFCL 2E76C 4JC0A 5C44B 1CZGA 3MEFA 3FEWX 1BDOA 4LFCQ 3NTKA 1WD1A 3HOYG 1SAPA 1CM9A 1VCIA 4JYAQ 1DONA 1Y1VH 3OW7A 2UXDL 5HY6A 1PRTB 2KECA 4C1NI 3Q6SA 3BU2A 4GOPC 1ET6A 2DN8A 1SE4A 4JI0Q 2PO4A 3W1GA 5CBAE 2ATWA 4CGYB 4JI0L 2DY8A 1B44D 1B8AA 4DAMA 3FKIB 3I4NB 3CC7A 3GTLB 3KJOA 2F03A 4LAAA 2VXWA 1KXLA 3V2TA 1D2BA 1BOSA 3MXGA 1JWSD 5A35A 2LSSA 3NUCA 5C4JH 5JJLA 2E2IH 3UI2A 1RIPA 1XMQL 4GN5A 5ISRA 2B3GA 4PG3A 4DR3Q 5KYLA 4JI6Q 3GD7A 1Q3LA 2XRQD 1SE2A 3FDTA 3IL8A 1O7ZA 4QY7A 1HFGA 4A3MB 3TBIB 3UDFA 2F0FA 4IUVA 4G7ZC 1LT6D 3RLFA 5CMDA 4HTHA 2RVLA 2RSOA 1FR3A 4A93H 4ILWA 4LF9Q 2A69D 4TKOB 5EPKA 3OWFA 5GQOA 1Q8IA 1SLJA 3S2DH 1TKWB 1HNXL 2BE5D 1I94Q 5KNBA 5BR8Q 4L8JA 2RKSA 3A0JA 3VR3A 3RZOH 2FMMA 2OF1A 2EY1A 5K36H 1ESRA 1YITA 2K4KA 3T51B 1HZAA 1NR4A 1RD9D 3QJYA 4IPDA 4ZRZA 2JA6B 3R2TA 3G4SA 3EBEA 3ERSX 3KDFA 5JVH3 1IBLQ 1VF5C 3J81j 2JA5G 4A3FB 1CT1D 4PQXA 3U50C 5J39A 3A55A 3CD6A 1J6QA 1G2TA 4WFN3 4L5TA 2E2HB 3HGBA 1IZ6A 1LTLA 2H4OA 3K5MA 4WORA 5LL6S 1CHQD 2IT1A 1SR3A 1FYCA 2F0GA 2UUBL 2L12A 1PTOH 2LY7A 4KHVA 3VYTA 3PUYA 3K5LA 4HN7A 3RLOA 2EIFA 2DJFC 4FYDA 2CH4W 2UXBL 3F1ZA 3NTIA 1N36Q 4JOIA 3A56A 1EQRA 1M8AA 5J3BA 1HZCA 2IX0A 1IYUA 3CKIB 2YV5A 1L2FA 2AKWB 3E9IA 3GTKB 2GN5A 2JN4A 2D9UA 3BYYB 3DEOA 2MUYA 3D4WA 5LMNQ 1KC8C 1QG7A 3RR5A 3C46A 5CV7A 3SVMA 3Q24A 2L0CA 2A68D 1GUGA 5FJ8G 1ICWA 3TREA 3QOJA 5KIXA 4UAIA 1D1KA 2IX3A 3UDGA 1WTRA 1OXTA 2HT1A 5IGDA 2ZT9C 3K7AB 4XYQA 1O80A 3J7AF 5C4XB 4DV7Q 4XQNA 1XWEA 4JVZA 2A1AA 1QCBD 2EDGA 4JBWA 4LMQD 4HSPA 5DNFA 3P75A 2N49A 4XYOA 2RCFA 2XGTA 4OIKA 1PH1A 1RCVD 4L63B 4XT1B 1Z9FA 4TQUS 4FVMA 3J7ZC 5IYBH 2Q8RE 1Q82C 1SEBD 1K0SA 3GQBA 3I4OA 3PO2B 1HZBA 3S1MH 4A75A 1N8RC 4FXGC 4C3HG 1NJIC 1CSQA 2R93B 2ZJPA 2JA5B 3GTOH 2PW5A 1AE3A 1SYEA 3MXPA 2WB1B 4DKAC 2A68C 3UE0A 4DV2L 4GNXB 1WFQA 4ZLTF 3EROA 1JOQA 5M3FG 2VZAA 4GKJL 1EOVA 3NENA 2I5MX 2R61A 2QILA 4YHHL 4LF4Q 4XT3B 4DV4L 1NSNS 5ELCA 2E2HH 4KY7A 3MA2B 1FD7D 4A76A 1C9OA 2KHJA 2KEDA 2B8FA 4KTAA 4FP5D 4KHZA 2NVXB 1VMPA 5M5WH 1TWCH 3NBHB 5KGUA 1SXTA 1TU2B 3JAMc 3CCJA 1L0XB 1HQRD 3CCVA 1SYCA 2E2IB 3Q8DA 4L5QA 3T56B 1ILQA 1VQAA 1S4ZA 3CHBD 1LLRD 4AIMA 1LTSD 5D14A 4TVAB 2HHHL 1EYCA 2ZJQA 1GKHA 2QEJC 4EX5A 3PO3G 3KF8A 2F0QA 4X3KA 5IY0A 3CMEA 2PZWA 3SXHA 3KUPA 3EN2A 2K50A 1N32Q 1CQFA 2G9HD 4JOIC 1SNQA 3UE1A 1W6JA 1UE7A 1U4LA 4H44C 4QMGA 3TEHB 3TRZA 3S14H 3DWAA 3TP6A 2HDLA 4NDXA 1G8ZD 3X3NA 3TS0A 4NXMQ 2B2VC 3NBHA 1TS4A 5JJZA 1HNZL 1A2UA 1QNKA 2WB1G 1KHIA 1U0LA 1QE6A 3A74A 3GTQB 3E9HA 5IT9c 4R4IA 1B50A 3RLNA 3CCMA 1WTWA 3C2PA 2NVTH 4HMJA 4DR5L 1VQCA 2XIWA 5JEAG 1SDFA 4CJ2C 1D6EC 3E0EA 5BN3A 5A2QL 2I0QA 3ULJA 3E6ZX 5H1SE 2O5JC 1S5FD 2CCZA 3OPOA 2VUMG 2AQ3B 1PFNA 3MXUA 4JI8Q 3OTOL 4KHPL 4K0KQ 3A5ZB 4K0KL 4XDXA 1YJ9A 2K75A 3L2PA 1CFMA 3PIP3 1K8GA 5CV4A 5IT9L 4LF6Q 4OO1I 2IHFA 2F3WA 4QIWB 4IFDH 3GV6A 2OWOA 1F2YA 3GP7A 1GUOA 2WAQB 1XNQQ 4QF4A 4LUOA 4R4QA 4V190 3TN2A 1CI3M 2AQ1B 5HGQA 1SBBB 4J1MA 1A3VA 1XMQQ 3PUWA 4JPBW 2M00A 2NZOA 1KTKA 3U9OA 4OEMB 1MSHA 2PI2E 2LXJA 2IWHA 1KD1C 3MXNB 4JI2Q 3HOXB 4DXFA 4QCLA 2KUMA 3CCRA 1F9PA 4IOCA 3S14B 4LFBQ 2UUCL 2R7DA 1LM0A 3J80c 4RFBA 1CTMA 1V43A 2XNAC 5JPNC 1GO3E 4DAPA 1VQEA 4IUUA 4S3SA 4A3IH 2LKVA 3HOXG 4A3BB 1AZQA 4OIJA 3LNNA 4X65Q 2FXQA 3H91A 1L0YB 4P72A 2JA6G 1STGA 4Q0FA 1HUMA 2J4XA 2BH8A 2AUKA 4ALPA 4EGVA 1VMCA 3KK7A 3OIPA 4LWCA 3LGJA 1F2ZA 1XNQL 2KA7A 5LHY1 1KNAA 4K5WA 4YCWA 1CKNA 1IW7D 1JOOA 2B2YA 1VQBA 5E3FA 5C4JB 2JSOA 1EIHA 3GTPB 1B9MA 1Z7TA 4JBKA 1EOTA 2EYOA 2K7VA 1J8IA 4KY6A 4IQZA 1HFNA 1G51A 1X3PA 1EY0A 3MXNA 1I6HB 1GUNA 3HOYB 3ND9A 3S1QB 1GHJA 1VF7A 1BQQT 2YTVA 1E2WA 2AMCB 5BN5A 4ZK9B 1Z47A 2B2VA 3J80L 3NELA 1DOMA 1PYBA 1PH9A 1A8VA 1PZID 3HOXH 3H0GH 3O13A 2F0IA 1L1OC 5IIFA 3D6CA 1BCPC 3WDNA 2EYLA 4AQYQ 4OWWB 1EEID 1K73C 4RKBA 1LUZA 3T4AC 4GLXA 3H0GB 1Q86C 1PXUA 3W3AA 1FJGL 1E2VA 3CPFA 2NTTA 4MTKA 4DV6Q 2EJMA 3BDCA 1SMXA 1J5EQ 1SJHD 3I91A 3UDXA 1YIJA 2L1BA 2WP8J 5C4XH 2KENA 1BBXC 4QGUA 1WOCA 3D31A 4MTNA 4RA8A 4DF7A 5C6AA 1E22A 1PH6A 4DGZA 1EY8A 2QDLA 1WCMG 1SYGA 2F0NA 2MNAA 4IALA 2CWPA 1TR5A 2CW0C 1LTRD 1Y1VB 1F9QA 3I70A 3QOLA 1GUWA 1LT4D 3EQLC 4F7XA 1K28A 4MIUA 1TY2A 1E1TA 5CR3A 1R9TB 1OXVA 3E0JA 1DD2A 1C48A 5FLXE 4A3JH 1ENAA 2R93H 2A6HC 4YWLA 2DGYA 1KDBA 3F2BA 5IGGA 3Q22A 1I6HH 3B6YA 4ZQ3A 3HOYH 5T1GA 4IPHA 2PNHA 2RHQB 1RL2A 2B63H 4BXXH 3IAYA 2VB3X 2UUAL 4LF4L 4JV5Q 3QIAA 1NTGA 2NZ1D 4NW2A 2EOTA 1XPOA 1WD0A 2R7ZH 5HURA 1YZ6A 1EWHA 4AYBB 2JEBI 4FF3A 3PO2H 5M3MB 1RODA 1II3A 1KDCA 3M4OB 3HOUG 3BS1A 3SR1A 1Y8PB 1MI2A 1VQFA 2FJ2A 4KV6A 3SK8A 1STYA 3R8BA 4DUYL 3KF6B 2PMZE 2L5TA 2VQEQ 3CC4A 1WCMH 2ID0A 4U673 1RKNA 5EJWA 3HFZB 3DUZA 4NXML 1LYLA 3IRBA 5C0XJ 3K6OA 1EEFD 2R6GA 3HRZC 1MSGA 1HHVA 1VQLA 1X56A 3FP9A 5C0XH 1YJWA 3NQIA 4DK3C 4E6IA 4N9PA 1BBUA 1LV9A 2B2WC 3PMFA 1YI2A 4ZUJA 3NXWA 5KNCA 1KLGD 2B63G 2WFWA 3I55A 1GOZA 1I94L 2K33A 4LUZA 5GROA 1E2ZA 1F2MA 4UP8A 4EQPA 3I4NG 4I7AA 1STBA 2N8NA
chains in the Genus database with same CATH topology
5JEAJ 1PHJA 1NMGA 1PH2A 1CUKA 4A3BH 1PYSB 2DUDA 3K7AH 4IPDA 1K8AC 1IBKL 1XNRL 1IBKQ 4LF6L 1XNRQ 4DR7L 2VS1A 3U58A 3G4SA 4GKKQ 3EBEA 3ERSX 3KDFA 4GOPA 2R93G 1IBLQ 3J81j 1A0IA 1FGUA 2JA5G 2N78A 1PH5A 4POGA 2HIVA 4APVA 3U50C 3CD6A 1J6QA 2OQ0A 4L5TA 2E5LL 1SRUA 1IZ6A 1LTLA 2WB1E 3D0FA 1OXXK 1P16A 5IE8A 4DV5L 2IY5B 3HOWG 4R4OA 2IT1A 1SR3A 3K80C 4IO9A 2UUBL 4LF7L 4DV6L 4NXNQ 3J7A5 1HNWQ 2UUBQ 4LF7Q 1HNWL 4DUYQ 1E1OA 3RN2A 2R7ZG 1XJVA 3PUYA 3S1QH 5M3FH 5GAHC 3RLOA 4GNXA 2PQAA 1W3SA 2JK8A 2EIFA 5GAEC 2YTXA 3VDYA 1S40A 1QVGA 1PH4A 3F1ZA 2Z6KC 1N36Q 2UXBL 1XTDA 1TWGH 4JOIA 1N36L 4JI2L 1EQRA 3CCSA 4BY1H 3NEMA 5J3BA 1Q46A 1HZCA 2IX0A 2YV5A 1L2FA 2AKWB 3E9IA 5FLMG 3H3VH 2GN5A 4DV4Q 4DUZQ 5FJ8H 2UU9L 5IWAQ 4BBSH 3RN5A 4A3JG 2UU9Q 3HKSA 2ZM6L 4HJ9A 4HJ7A 2E2JH 4YCVA 3I56A 5LMNQ 4YY3L 1YHAA 3L0OA 1KC8C 3RR5A 2YU9H 1PA6A 3I4MG 5FLMH 1TXYA 2N3SA 1N34L 4IJHA 1JJCB 1IYJB 1H95A 5BR8L 3TREA 5FJ8G 2EQSA 3UDGA 4BBSG 2HT1A 2K5HA 1OXTA 4BA1I 1K3RA 1L1OA 4B3TQ 3TS2A 4PZ6A 3CXCA 5IYCG 1OXSC 5JJIA 4DV7Q 2ALYB 4C3IH 1A63A 3W5OA 1HR0Q 2A1AA 4JBWA 5C3EG 4X64L 3ULPA 2JA7H 4DR4Q 1JJ2A 4ME3A 4DR7Q 2N49A 1GM5A 1VQPA 2JJQA 1XMOQ 2XGTA 2D0OA 4IJLA 1VQ8A 2OQKA 1G6PA 3S24A 3I4NH 2Q2TA 1SFOH 5LMUQ 1PH1A 1Z9FA 4TQUS 5LMUL 4GOPB 4JI4Q 4RG1A 1IBML 1PV4A 3J7ZC 4A3BG 4AH6A 5IYBH 1Q82C 4A3GH 4XTCS 3CAMA 1B70B 3I4OA 1HZBA 1I50H 3S1MH 3HOZH 4A75A 1N8RC 5IP7G 3U4VA 1NJIC 3J80i 5DLQE 4NXNL 4HIKA 1TWAH 4DR3L 1CSQA 3CCLA 3DLLA 3G48A 5M5YH 2ZJPA 1V9PA 3G71A 2Q2HA 1EFWA 4LF8L 4A3GG 3GTOH 2OCEA 1AE3A 1MIUA 3CC2A 2UXBQ 4A93G 4DKAC 3I7FA 4DV2Q 2F4VL 4IFDI 3UE0A 5IYDG 4H02A 4DV2L 2OTLA 4GNXB 2UUCQ 1WFQA 2F4VQ 3KF6A 3HOZG 3M3YH 3U4ZA 3BJUA 1I5FA 1SN8A 3M9BA 4DR1Q 4A3KH 3I4MH 3T1HL 3CMAA 5M3FG 2VZAA 2NN6I 1EOVA 3NENA 5IP9H 4GKJL 2C35B 2I5MX 4YHHL 4LF4Q 5IWAL 4JCVE 4DV4L 4HJ8A 4HIMA 3PO2G 1L0WA 3KF8B 2E2HH 1G291 4DV1Q 4DPGA 4JI1L 5IYCH 3J81c 4HJAA 4A3KG 4A76A 1C9OA 4A3DG 2KHJA 1VQKA 5EAYA 2QGQA 4B3MQ 4PZ7A 1VQOA 4IPGA 4B3RL 1VQDA 2I5LX 4KHZA 1X3GA 1WJJA 1VQIA 4QIWE 4A3CH 4QQBX 1FL0A 5M5WH 1JJGA 2B29A 1TWCH 3GTMH 4MNOA 4O0AA 3NBHB 1DGSA 5C44G 3G6EA 3JAMc 2JA9A 2Q2IA 3CCJA 3AQQA 3CQZH 1PH7A 1L1OB 1UWVA 4PMWA 1ASYA 3CCVA 1EUJA 2AWNA 3Q8DA 4L5QA 1Q81C 3STBD 1VQAA 3PGZA 1QVCA 1XMOL 2IX1A 4A3CG 1KRTA 4AIMA 1X55A 1OTCA 4JI7Q 4A3FG 2RF4A 4TVAB 3BZCA 1I3QH 1JMCA 2HHHL 2K5NA 2ZJQA 1WYDA 1GKHA 1MKHA 4EX5A 2MO0A 5C3EH 4X62Q 3H3VI 1SROA 3PO3G 2I5HA 2JQOA 2MFIA 5IY0A 1UEBA 3A5UA 4LFAQ 3CMEA 4HIOA 1N33Q 2MQHA 4DV5Q 2KHIA 3EN2A 2K50A 2L15A 1N32Q 2JA8H 4DR6Q 1VQGA 4JOIC 1HR0W 4Y52H 4BY7H 5M5XH 2ES2A 3HKZG 3UE1A 3PF4A 1UE7A 4DV0L 3TEHB 4DR2Q 2R92H 3TRZA 5GAGC 5IP9G 4DV3L 1O7IA 4JI3L 5AJ3L 3S14H 3TS0A 4B3TL 4NXMQ 3DM3A 2HIXA 2YTYA 1X3FA 1GVPA 3L7ZC 1HNZL 1N9WA 1V1QA 2F52A 2WB1G 4A3IG 1R9TH 4LUVA 5IP7H 3HOVH 1KHIA 1U0LA 1P8LA 3A74A 3E9HA 1X65A 4R4IA 1UE1A 5IT9c 3RLNA 3F8TA 3CCMA 4DR1L 3T1HQ 4L5RC 2NVTH 2LXKA 4GKJQ 3ICEA 4IFDJ 1AH9A 2VL6A 4DK6C 3K7UC 4UPAA 4DR5L 1HZ9A 4A3LG 1VQCA 1X3EA 1UE6A 2CWAA 2ZTDA 3FKIG 5JEAG 1EIYB 1K9MC 1FJGQ 3HOVG 2KBNA 3K0XA 3E0EA 4FDBA 5C44H 1IBMQ 2I0QA 3ULJA 3PUXA 3M85A 5H1SE 1JT8A 3KDFB 4R4CA 2CCZA 2K14A 4P74A 4A3LH 4X66L 2VUMG 3OTOQ 3KFUA 4KHPQ 4OO1G 1VQ9A 4JI8Q 3OTOL 1GD7A 4KHPL 1EQQA 4IFDG 4K0KQ 4QL5A 3A5ZB 4K0KL 1YJ9A 3TQYA 1EWIA 4LF8Q 2K75A 1HR0L 3GDEA 3L2PA 3PCOB 1K8GA 3GTGH 3AFQA 3FHWA 1NBWA 5IYBG 3KJPA 2VY3A 4LF6Q 4OO1I 2IHFA 2VUMH 2D0PA 4QJFA 1BBWA 4HJ5A 2OWOA 2JA8G 4A3DH 1PH3A 1PH8A 3PF5A 1XNQQ 3CW2C 4BY7G 1T9HA 4LUOA 4R4QA 1Y14B 2HHHQ 4X62L 2EXDA 1YJNA 1X6OA 2XTIA 4A3MH 5HGQA 3OW2A 2BH2A 1CKNB 1AE2A 5JJKA 1E7ZA 3AFPA 1KL9A 4LF9L 1XMQQ 3PUWA 2K52A 1YVCA 1HJPA 2NZOA 2NZHA 2V1CC 4JYAL 1VQMA 4DV0Q 2PI2E 2LXJA 4GN3B 1KIXA 2H5XA 2WAQG 3GTKH 1KD1C 4OX9L 3EIVA 4A3MG 3MXNB 2QEXA 4JI2Q 1X9NA 4YWKA 3FKIH 3ZJYC 1S3OA 3CCRA 4IOCA 3S1RH 1VQNA 4LFBL 4LFBQ 2UUCL 2R7DA 1HNZQ 1Y1VG 4DNIA 2OTJA 3W1BA 1LM0A 4OWTB 3J80c 2JE6I 4X64Q 3CPWA 3RNUA 3GTJH 2R92G 2QA4A 3CP0A 3PSIA 4OWXB 2A19A 1M90C 2Q2UA 4JV5L 2PI2A 2ZM6Q 1V43A 4JBJA 4C3JH 1ASZA 4JI7L 1GO3E 3S2HH 4DV1L 2HQLA 1NMFA 1VQEA 3M4OH 4A3IH 1TWHH 2Y0SE 4AYBG 3HOXG 4JI4L 1B7YB 2E5LQ 3JC66 3S16H 4P71A 1YHQA 4X65Q 1A62A 2FXQA 4GLAC 1Q8KA 1HH2P 4YCUA 2BA0A 2CQOA 4LW1A 4P72A 2JEAI 4UP9A 4UP7A 4RMFA 5ELNA 1J5EL 4LF5L 1JE5A 2JA6G 4JI5L 1C0AA 2ASBA 2VQEL 1NE3A 2IHEA 4R1JA 4KI0A 3J81i 4Y7NH 4A3FH 4JI6L 2BH8A 4DV3Q 4B3SL 3HOUH 4ALPA 1QZGA 3PO3H 3I2ZA 2YYZA 4GKKL 4LWCA 1BVSA 1SE8A 4A4IA 3LGJA 1W2BA 1XNQL 4GLVB 1QZHA 3GO5A 1X54A 2ZJRA 3GTPH 4OXPA 3JAMi 4YCWA 2AHOB 1CKNA 1VQBA 1D7QA 1QUQA 4LNQA 1OXUA 1Q1BA 3STBC 4JI1Q 1IXRA 3PIOA 3CCEA 4JBKA 1Q7YC 1BKBA 1IL2A 1C7YA 2VQFL 1N32L 2Z0SA 1HNXQ 4J15A 1N34Q 2WAQE 2NVXH 2GVAA 1G51A 3KOJA 3PUZA 4DR2L 4B3RQ 4OX9Q 4P75A 3CCQA 5AJ3Q 2E8GA 1QVFA 2YTVA 3ULLA 2AMCB 3RZDH 5ELOA 1Z47A 3PIPA 4AYBE 3NELA 3M7NA 1E3PA 1PYBA 1PH9A 5C0XI 1A8VA 3HOXH 3K8AA 3H0GH 1NY4A 1L1OC 4POFA 4O2DA 4DR5Q 4C2MH 1E24A 4AQYQ 2UUAQ 4OWWB 1K73C 4GS3A 5LMNW 1LUZA 4DAYB 4GLXA 3AEVA 5M3MG 2CKZB 1Q86C 1FJGL 1PVOA 3PUVA 3F2DA 3M4PA 5GADC 1QUQB 1VQ7A 2Y0SG 5C4XG 3CPFA 3BZKA 3M4QA 4LFAL 2BA1A 4YWMA 4OONA 4UY8C 2ZTEA 3UDIA 4DR6L 1VQJA 5FLXc 4DV6Q 1KQSA 4WJ3M 5M3MH 4JI5Q 3ER0A 4JI8L 1SMXA 1J5EQ 1FVIA 3UDXA 1YIJA 1MJCA 3H15A 4HIDA 2NVQH 2WP8J 5C4XH 4JI3Q 2KENA 4QGUA 1WOCA 3D31A 1VQ5A 4DR4L 4WJ4A 4MTNA 2NN6G 2R7FA 1EYGA 1E22A 1YNXA 1PH6A 1IBLL 4A3EH 1Y1WG 1XPUA 4IPCA 2JA6H 2KCTA 1WCMG 2MNAA 3HKZE 3PV0A 2KCMA 2CWPA 3T1YL 2MO1A 2NVYH 3S15H 1N33L 4LFCL 1MJEA 4JC0A 3S17H 4PZ8A 1YEZA 3MEFA 5LMNL 4LFCQ 2UXCL 2AWOA 4R4TA 3HOYG 2Z6KA 2VQFQ 1VCIA 4JYAQ 1E1TA 1Y1VH 1OXVA 2VNUD 2UXDL 5HY6A 3GTQH 4B3ML 1U5KA 1EIFA 3BU2A 4A3JH 4GOPC 4X66Q 4MZ9A 4IOAA 2R93H 4JI0Q 4YWLA 2DGYA 3W1GA 2ATWA 3GTLH 4GN4B 3F2BA 4JI0L 3S1NH 1I6HH 3B6YA 3AYHB 4JBMA 3HOYH 4IPHA 4B3SQ 1YHBA 4X6AH 2PNHA 4GNXC 2RHQB 1RL2A 1B8AA 2A8VA 2B63H 4BXXH 4DAMA 2CFMA 3F2CA 3CC7A 3K81C 4BBRH 3CF5A 4AQYL 3KJOA 2UUAL 4LF4L 3HOWH 4JV5Q 1KXLA 1VQ6A 1D8LA 1NTGA 1XPOA 4JG2A 2R7ZH 1YZ6A 2LSSA 3WWVA 5C4JH 2JEBI 3PO2H 1K83H 2E2IH 3H0GG 4BXXG 5JJLA 3HOUG 1RIPA 4KLKA 1XMQL 4X65L 1VQFA 2K5VA 1TWFH 3OYYA 4GN5A 4DUYL 2B3GA 3KF6B 4PG3A 1CSPA 4DR3Q 2PMZE 3SGIA 2VQEQ 3CC4A 1WCMH 2ID0A 4JI6Q 3GD7A 4LF5Q 5E7NA 3HFZB 4QY7A 1VQHA 3KLWA 4L5SA 4NXML 4EQ5A 1CKMA 2ZTCA 3KYHC 3UDFA 4C3HH 1LYLA 1PFSA 1CKOA 1Q12A 3IRBA 5C0XJ 1Q1EA 3CCUA 1XPRA 1M1KC 4BA2I 2R6GA 1VS0A 2D62A 3RLFA 1VQLA 2GVBA 1X56A 3FP9A 3T1YQ 4YHHQ 1YJWA 4A93H 4NB3A 4DUZL 4DK3C 5IYDH 2F3IA 4BY1G 1BBUA 4LF9Q 2VW9A 1YI2A 4YY3Q 2RCNA 1VQ4A 2UXCQ 5K36G 1HZAA 4P73A 5GQOA 4A3EG 1SLJA 1Y1WH 3S2DH 1KAWA 4NPSA 1HNXL 1I94Q 2B63G 5BR8Q 2WFWA 3A0JA 2JA7G 3I55A 5C0XG 1I94L 1UE5A 4LUZA 5GROA 2RHSB 4XIGS 2UXDQ 2PQAB 3RZOH 4BBRG 4UP8A 1JB7A 1KRSA 2JA5H 1WI5A 3I4NG 1YITA 1S72A 2N8NA 4DV7L 2K4KA 1K0RA 1YBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA J;  1PHJ A;  1NMG A;  1PH2 A;  1CUK A;  4A3B H;  1PYS B;  2DUD A;  3K7A H;  4IPD A;  1K8A C;  1IBK L;  1XNR L;  1IBK Q;  4LF6 L;  1XNR Q;  4DR7 L;  2VS1 A;  3U58 A;  3G4S A;  4GKK Q;  3EBE A;  3ERS X;  3KDF A;  4GOP A;  2R93 G;  1IBL Q;  3J81 j;  1A0I A;  1FGU A;  2JA5 G;  2N78 A;  1PH5 A;  4POG A;  2HIV A;  4APV A;  3U50 C;  3CD6 A;  1J6Q A;  2OQ0 A;  4L5T A;  2E5L L;  1SRU A;  1IZ6 A;  1LTL A;  2WB1 E;  3D0F A;  1OXX K;  1P16 A;  5IE8 A;  4DV5 L;  2IY5 B;  3HOW G;  4R4O A;  2IT1 A;  1SR3 A;  3K80 C;  4IO9 A;  2UUB L;  4LF7 L;  4DV6 L;  4NXN Q;  3J7A 5;  1HNW Q;  2UUB Q;  4LF7 Q;  1HNW L;  4DUY Q;  1E1O A;  3RN2 A;  2R7Z G;  1XJV A;  3PUY A;  3S1Q H;  5M3F H;  5GAH C;  3RLO A;  4GNX A;  2PQA A;  1W3S A;  2JK8 A;  2EIF A;  5GAE C;  2YTX A;  3VDY A;  1S40 A;  1QVG A;  1PH4 A;  3F1Z A;  2Z6K C;  1N36 Q;  2UXB L;  1XTD A;  1TWG H;  4JOI A;  1N36 L;  4JI2 L;  1EQR A;  3CCS A;  4BY1 H;  3NEM A;  5J3B A;  1Q46 A;  1HZC A;  2IX0 A;  2YV5 A;  1L2F A;  2AKW B;  3E9I A;  5FLM G;  3H3V H;  2GN5 A;  4DV4 Q;  4DUZ Q;  5FJ8 H;  2UU9 L;  5IWA Q;  4BBS H;  3RN5 A;  4A3J G;  2UU9 Q;  3HKS A;  2ZM6 L;  4HJ9 A;  4HJ7 A;  2E2J H;  4YCV A;  3I56 A;  5LMN Q;  4YY3 L;  1YHA A;  3L0O A;  1KC8 C;  3RR5 A;  2YU9 H;  1PA6 A;  3I4M G;  5FLM H;  1TXY A;  2N3S A;  1N34 L;  4IJH A;  1JJC B;  1IYJ B;  1H95 A;  5BR8 L;  3TRE A;  5FJ8 G;  2EQS A;  3UDG A;  4BBS G;  2HT1 A;  2K5H A;  1OXT A;  4BA1 I;  1K3R A;  1L1O A;  4B3T Q;  3TS2 A;  4PZ6 A;  3CXC A;  5IYC G;  1OXS C;  5JJI A;  4DV7 Q;  2ALY B;  4C3I H;  1A63 A;  3W5O A;  1HR0 Q;  2A1A A;  4JBW A;  5C3E G;  4X64 L;  3ULP A;  2JA7 H;  4DR4 Q;  1JJ2 A;  4ME3 A;  4DR7 Q;  2N49 A;  1GM5 A;  1VQP A;  2JJQ A;  1XMO Q;  2XGT A;  2D0O A;  4IJL A;  1VQ8 A;  2OQK A;  1G6P A;  3S24 A;  3I4N H;  2Q2T A;  1SFO H;  5LMU Q;  1PH1 A;  1Z9F A;  4TQU S;  5LMU L;  4GOP B;  4JI4 Q;  4RG1 A;  1IBM L;  1PV4 A;  3J7Z C;  4A3B G;  4AH6 A;  5IYB H;  1Q82 C;  4A3G H;  4XTC S;  3CAM A;  1B70 B;  3I4O A;  1HZB A;  1I50 H;  3S1M H;  3HOZ H;  4A75 A;  1N8R C;  5IP7 G;  3U4V A;  1NJI C;  3J80 i;  5DLQ E;  4NXN L;  4HIK A;  1TWA H;  4DR3 L;  1CSQ A;  3CCL A;  3DLL A;  3G48 A;  5M5Y H;  2ZJP A;  1V9P A;  3G71 A;  2Q2H A;  1EFW A;  4LF8 L;  4A3G G;  3GTO H;  2OCE A;  1AE3 A;  1MIU A;  3CC2 A;  2UXB Q;  4A93 G;  4DKA C;  3I7F A;  4DV2 Q;  2F4V L;  4IFD I;  3UE0 A;  5IYD G;  4H02 A;  4DV2 L;  2OTL A;  4GNX B;  2UUC Q;  1WFQ A;  2F4V Q;  3KF6 A;  3HOZ G;  3M3Y H;  3U4Z A;  3BJU A;  1I5F A;  1SN8 A;  3M9B A;  4DR1 Q;  4A3K H;  3I4M H;  3T1H L;  3CMA A;  5M3F G;  2VZA A;  2NN6 I;  1EOV A;  3NEN A;  5IP9 H;  4GKJ L;  2C35 B;  2I5M X;  4YHH L;  4LF4 Q;  5IWA L;  4JCV E;  4DV4 L;  4HJ8 A;  4HIM A;  3PO2 G;  1L0W A;  3KF8 B;  2E2H H;  1G29 1;  4DV1 Q;  4DPG A;  4JI1 L;  5IYC H;  3J81 c;  4HJA A;  4A3K G;  4A76 A;  1C9O A;  4A3D G;  2KHJ A;  1VQK A;  5EAY A;  2QGQ A;  4B3M Q;  4PZ7 A;  1VQO A;  4IPG A;  4B3R L;  1VQD A;  2I5L X;  4KHZ A;  1X3G A;  1WJJ A;  1VQI A;  4QIW E;  4A3C H;  4QQB X;  1FL0 A;  5M5W H;  1JJG A;  2B29 A;  1TWC H;  3GTM H;  4MNO A;  4O0A A;  3NBH B;  1DGS A;  5C44 G;  3G6E A;  3JAM c;  2JA9 A;  2Q2I A;  3CCJ A;  3AQQ A;  3CQZ H;  1PH7 A;  1L1O B;  1UWV A;  4PMW A;  1ASY A;  3CCV A;  1EUJ A;  2AWN A;  3Q8D A;  4L5Q A;  1Q81 C;  3STB D;  1VQA A;  3PGZ A;  1QVC A;  1XMO L;  2IX1 A;  4A3C G;  1KRT A;  4AIM A;  1X55 A;  1OTC A;  4JI7 Q;  4A3F G;  2RF4 A;  4TVA B;  3BZC A;  1I3Q H;  1JMC A;  2HHH L;  2K5N A;  2ZJQ A;  1WYD A;  1GKH A;  1MKH A;  4EX5 A;  2MO0 A;  5C3E H;  4X62 Q;  3H3V I;  1SRO A;  3PO3 G;  2I5H A;  2JQO A;  2MFI A;  5IY0 A;  1UEB A;  3A5U A;  4LFA Q;  3CME A;  4HIO A;  1N33 Q;  2MQH A;  4DV5 Q;  2KHI A;  3EN2 A;  2K50 A;  2L15 A;  1N32 Q;  2JA8 H;  4DR6 Q;  1VQG A;  4JOI C;  1HR0 W;  4Y52 H;  4BY7 H;  5M5X H;  2ES2 A;  3HKZ G;  3UE1 A;  3PF4 A;  1UE7 A;  4DV0 L;  3TEH B;  4DR2 Q;  2R92 H;  3TRZ A;  5GAG C;  5IP9 G;  4DV3 L;  1O7I A;  4JI3 L;  5AJ3 L;  3S14 H;  3TS0 A;  4B3T L;  4NXM Q;  3DM3 A;  2HIX A;  2YTY A;  1X3F A;  1GVP A;  3L7Z C;  1HNZ L;  1N9W A;  1V1Q A;  2F52 A;  2WB1 G;  4A3I G;  1R9T H;  4LUV A;  5IP7 H;  3HOV H;  1KHI A;  1U0L A;  1P8L A;  3A74 A;  3E9H A;  1X65 A;  4R4I A;  1UE1 A;  5IT9 c;  3RLN A;  3F8T A;  3CCM A;  4DR1 L;  3T1H Q;  4L5R C;  2NVT H;  2LXK A;  4GKJ Q;  3ICE A;  4IFD J;  1AH9 A;  2VL6 A;  4DK6 C;  3K7U C;  4UPA A;  4DR5 L;  1HZ9 A;  4A3L G;  1VQC A;  1X3E A;  1UE6 A;  2CWA A;  2ZTD A;  3FKI G;  5JEA G;  1EIY B;  1K9M C;  1FJG Q;  3HOV G;  2KBN A;  3K0X A;  3E0E A;  4FDB A;  5C44 H;  1IBM Q;  2I0Q A;  3ULJ A;  3PUX A;  3M85 A;  5H1S E;  1JT8 A;  3KDF B;  4R4C A;  2CCZ A;  2K14 A;  4P74 A;  4A3L H;  4X66 L;  2VUM G;  3OTO Q;  3KFU A;  4KHP Q;  4OO1 G;  1VQ9 A;  4JI8 Q;  3OTO L;  1GD7 A;  4KHP L;  1EQQ A;  4IFD G;  4K0K Q;  4QL5 A;  3A5Z B;  4K0K L;  1YJ9 A;  3TQY A;  1EWI A;  4LF8 Q;  2K75 A;  1HR0 L;  3GDE A;  3L2P A;  3PCO B;  1K8G A;  3GTG H;  3AFQ A;  3FHW A;  1NBW A;  5IYB G;  3KJP A;  2VY3 A;  4LF6 Q;  4OO1 I;  2IHF A;  2VUM H;  2D0P A;  4QJF A;  1BBW A;  4HJ5 A;  2OWO A;  2JA8 G;  4A3D H;  1PH3 A;  1PH8 A;  3PF5 A;  1XNQ Q;  3CW2 C;  4BY7 G;  1T9H A;  4LUO A;  4R4Q A;  1Y14 B;  2HHH Q;  4X62 L;  2EXD A;  1YJN A;  1X6O A;  2XTI A;  4A3M H;  5HGQ A;  3OW2 A;  2BH2 A;  1CKN B;  1AE2 A;  5JJK A;  1E7Z A;  3AFP A;  1KL9 A;  4LF9 L;  1XMQ Q;  3PUW A;  2K52 A;  1YVC A;  1HJP A;  2NZO A;  2NZH A;  2V1C C;  4JYA L;  1VQM A;  4DV0 Q;  2PI2 E;  2LXJ A;  4GN3 B;  1KIX A;  2H5X A;  2WAQ G;  3GTK H;  1KD1 C;  4OX9 L;  3EIV A;  4A3M G;  3MXN B;  2QEX A;  4JI2 Q;  1X9N A;  4YWK A;  3FKI H;  3ZJY C;  1S3O A;  3CCR A;  4IOC A;  3S1R H;  1VQN A;  4LFB L;  4LFB Q;  2UUC L;  2R7D A;  1HNZ Q;  1Y1V G;  4DNI A;  2OTJ A;  3W1B A;  1LM0 A;  4OWT B;  3J80 c;  2JE6 I;  4X64 Q;  3CPW A;  3RNU A;  3GTJ H;  2R92 G;  2QA4 A;  3CP0 A;  3PSI A;  4OWX B;  2A19 A;  1M90 C;  2Q2U A;  4JV5 L;  2PI2 A;  2ZM6 Q;  1V43 A;  4JBJ A;  4C3J H;  1ASZ A;  4JI7 L;  1GO3 E;  3S2H H;  4DV1 L;  2HQL A;  1NMF A;  1VQE A;  3M4O H;  4A3I H;  1TWH H;  2Y0S E;  4AYB G;  3HOX G;  4JI4 L;  1B7Y B;  2E5L Q;  3JC6 6;  3S16 H;  4P71 A;  1YHQ A;  4X65 Q;  1A62 A;  2FXQ A;  4GLA C;  1Q8K A;  1HH2 P;  4YCU A;  2BA0 A;  2CQO A;  4LW1 A;  4P72 A;  2JEA I;  4UP9 A;  4UP7 A;  4RMF A;  5ELN A;  1J5E L;  4LF5 L;  1JE5 A;  2JA6 G;  4JI5 L;  1C0A A;  2ASB A;  2VQE L;  1NE3 A;  2IHE A;  4R1J A;  4KI0 A;  3J81 i;  4Y7N H;  4A3F H;  4JI6 L;  2BH8 A;  4DV3 Q;  4B3S L;  3HOU H;  4ALP A;  1QZG A;  3PO3 H;  3I2Z A;  2YYZ A;  4GKK L;  4LWC A;  1BVS A;  1SE8 A;  4A4I A;  3LGJ A;  1W2B A;  1XNQ L;  4GLV B;  1QZH A;  3GO5 A;  1X54 A;  2ZJR A;  3GTP H;  4OXP A;  3JAM i;  4YCW A;  2AHO B;  1CKN A;  1VQB A;  1D7Q A;  1QUQ A;  4LNQ A;  1OXU A;  1Q1B A;  3STB C;  4JI1 Q;  1IXR A;  3PIO A;  3CCE A;  4JBK A;  1Q7Y C;  1BKB A;  1IL2 A;  1C7Y A;  2VQF L;  1N32 L;  2Z0S A;  1HNX Q;  4J15 A;  1N34 Q;  2WAQ E;  2NVX H;  2GVA A;  1G51 A;  3KOJ A;  3PUZ A;  4DR2 L;  4B3R Q;  4OX9 Q;  4P75 A;  3CCQ A;  5AJ3 Q;  2E8G A;  1QVF A;  2YTV A;  3ULL A;  2AMC B;  3RZD H;  5ELO A;  1Z47 A;  3PIP A;  4AYB E;  3NEL A;  3M7N A;  1E3P A;  1PYB A;  1PH9 A;  5C0X I;  1A8V A;  3HOX H;  3K8A A;  3H0G H;  1NY4 A;  1L1O C;  4POF A;  4O2D A;  4DR5 Q;  4C2M H;  1E24 A;  4AQY Q;  2UUA Q;  4OWW B;  1K73 C;  4GS3 A;  5LMN W;  1LUZ A;  4DAY B;  4GLX A;  3AEV A;  5M3M G;  2CKZ B;  1Q86 C;  1FJG L;  1PVO A;  3PUV A;  3F2D A;  3M4P A;  5GAD C;  1QUQ B;  1VQ7 A;  2Y0S G;  5C4X G;  3CPF A;  3BZK A;  3M4Q A;  4LFA L;  2BA1 A;  4YWM A;  4OON A;  4UY8 C;  2ZTE A;  3UDI A;  4DR6 L;  1VQJ A;  5FLX c;  4DV6 Q;  1KQS A;  4WJ3 M;  5M3M H;  4JI5 Q;  3ER0 A;  4JI8 L;  1SMX A;  1J5E Q;  1FVI A;  3UDX A;  1YIJ A;  1MJC A;  3H15 A;  4HID A;  2NVQ H;  2WP8 J;  5C4X H;  4JI3 Q;  2KEN A;  4QGU A;  1WOC A;  3D31 A;  1VQ5 A;  4DR4 L;  4WJ4 A;  4MTN A;  2NN6 G;  2R7F A;  1EYG A;  1E22 A;  1YNX A;  1PH6 A;  1IBL L;  4A3E H;  1Y1W G;  1XPU A;  4IPC A;  2JA6 H;  2KCT A;  1WCM G;  2MNA A;  3HKZ E;  3PV0 A;  2KCM A;  2CWP A;  3T1Y L;  2MO1 A;  2NVY H;  3S15 H;  1N33 L;  4LFC L;  1MJE A;  4JC0 A;  3S17 H;  4PZ8 A;  1YEZ A;  3MEF A;  5LMN L;  4LFC Q;  2UXC L;  2AWO A;  4R4T A;  3HOY G;  2Z6K A;  2VQF Q;  1VCI A;  4JYA Q;  1E1T A;  1Y1V H;  1OXV A;  2VNU D;  2UXD L;  5HY6 A;  3GTQ H;  4B3M L;  1U5K A;  1EIF A;  3BU2 A;  4A3J H;  4GOP C;  4X66 Q;  4MZ9 A;  4IOA A;  2R93 H;  4JI0 Q;  4YWL A;  2DGY A;  3W1G A;  2ATW A;  3GTL H;  4GN4 B;  3F2B A;  4JI0 L;  3S1N H;  1I6H H;  3B6Y A;  3AYH B;  4JBM A;  3HOY H;  4IPH A;  4B3S Q;  1YHB A;  4X6A H;  2PNH A;  4GNX C;  2RHQ B;  1RL2 A;  1B8A A;  2A8V A;  2B63 H;  4BXX H;  4DAM A;  2CFM A;  3F2C A;  3CC7 A;  3K81 C;  4BBR H;  3CF5 A;  4AQY L;  3KJO A;  2UUA L;  4LF4 L;  3HOW H;  4JV5 Q;  1KXL A;  1VQ6 A;  1D8L A;  1NTG A;  1XPO A;  4JG2 A;  2R7Z H;  1YZ6 A;  2LSS A;  3WWV A;  5C4J H;  2JEB I;  3PO2 H;  1K83 H;  2E2I H;  3H0G G;  4BXX G;  5JJL A;  3HOU G;  1RIP A;  4KLK A;  1XMQ L;  4X65 L;  1VQF A;  2K5V A;  1TWF H;  3OYY A;  4GN5 A;  4DUY L;  2B3G A;  3KF6 B;  4PG3 A;  1CSP A;  4DR3 Q;  2PMZ E;  3SGI A;  2VQE Q;  3CC4 A;  1WCM H;  2ID0 A;  4JI6 Q;  3GD7 A;  4LF5 Q;  5E7N A;  3HFZ B;  4QY7 A;  1VQH A;  3KLW A;  4L5S A;  4NXM L;  4EQ5 A;  1CKM A;  2ZTC A;  3KYH C;  3UDF A;  4C3H H;  1LYL A;  1PFS A;  1CKO A;  1Q12 A;  3IRB A;  5C0X J;  1Q1E A;  3CCU A;  1XPR A;  1M1K C;  4BA2 I;  2R6G A;  1VS0 A;  2D62 A;  3RLF A;  1VQL A;  2GVB A;  1X56 A;  3FP9 A;  3T1Y Q;  4YHH Q;  1YJW A;  4A93 H;  4NB3 A;  4DUZ L;  4DK3 C;  5IYD H;  2F3I A;  4BY1 G;  1BBU A;  4LF9 Q;  2VW9 A;  1YI2 A;  4YY3 Q;  2RCN A;  1VQ4 A;  2UXC Q;  5K36 G;  1HZA A;  4P73 A;  5GQO A;  4A3E G;  1SLJ A;  1Y1W H;  3S2D H;  1KAW A;  4NPS A;  1HNX L;  1I94 Q;  2B63 G;  5BR8 Q;  2WFW A;  3A0J A;  2JA7 G;  3I55 A;  5C0X G;  1I94 L;  1UE5 A;  4LUZ A;  5GRO A;  2RHS B;  4XIG S;  2UXD Q;  2PQA B;  3RZO H;  4BBR G;  4UP8 A;  1JB7 A;  1KRS A;  2JA5 H;  1WI5 A;  3I4N G;  1YIT A;  1S72 A;  2N8N A;  4DV7 L;  2K4K A;  1K0R A;  1YBY A; 
#chains in the Genus database with same CATH topology
 1PHJ A;  1GUT A;  3K7A H;  1IBK L;  1IYV A;  1IBK Q;  4LF6 L;  5CV5 A;  3U58 A;  1CA5 A;  3D4R A;  1B9N A;  5CV8 A;  1A0I A;  1FGU A;  2N78 A;  1PH5 A;  4APV A;  2MP1 A;  2XSC A;  1PTO B;  1M4V A;  3QR8 A;  2E5L L;  3A8J E;  4RCN A;  5FLX L;  3HOW G;  4HR7 B;  3K80 C;  1SJE D;  4LF7 L;  1HNW Q;  4NXN Q;  3J7A 5;  2UUB Q;  3I73 A;  5EBC A;  4K5V A;  4GNX A;  4KKT A;  1S40 A;  3VDY A;  5IGB A;  1YNJ C;  1STN A;  1QVG A;  4LK1 C;  4C56 C;  1TWG H;  1N36 L;  3N6R A;  3CCS A;  3D6W A;  2RA4 A;  3NEM A;  2B2U A;  1Q46 A;  2L4N A;  1HPC A;  3H6M A;  2DY7 A;  4CJ0 B;  5JVG 3;  2O4X A;  4C1N K;  2DJG C;  2UU9 L;  2UU9 Q;  3HKS A;  2E2J H;  4HJ9 A;  2QF7 A;  4YCV A;  1KDA A;  1LT5 D;  2MGS A;  1YHA A;  4J6H A;  4RHR A;  5C3X A;  5J22 A;  3I4M G;  3RZD B;  4IJH A;  1IYJ B;  1H95 A;  5BR8 L;  3S2D B;  4H0L C;  1H9S A;  4BA1 I;  2Z6B A;  2A6H D;  4PZ6 A;  3QG1 A;  1OXS C;  1T5E A;  2ALY B;  2K03 A;  3DWQ A;  2K1B A;  1HXY D;  3ULP A;  2JA7 H;  4DR4 Q;  2FMC A;  1XMO Q;  1VQ8 A;  2D0O A;  3J80 E;  2Q2T A;  4TRD A;  4JI4 Q;  1U4R A;  1DCZ A;  1I4X A;  4A3I B;  4A3B G;  3VA7 A;  2K04 A;  4ZKC B;  4XTC S;  1WTV A;  2IJ0 A;  1B70 B;  1I50 H;  3NHH A;  3HOZ H;  5IGE A;  5IP7 G;  3U4V A;  3DHQ A;  2F0V A;  1HQM C;  5M5Y H;  2F0J A;  1V9P A;  5I9O A;  2Q2H A;  3G71 A;  1EFW A;  3CC2 A;  2UXB Q;  4A93 G;  3I7F A;  2F4V L;  3S15 B;  3VR4 A;  4IFD I;  3CRK C;  3T16 A;  1ILP A;  2K5Q A;  3U4Z A;  2QW7 A;  4WJW A;  1NR2 A;  4A3K H;  3I4M H;  2F0W A;  3T1H L;  4DK0 A;  3CMA A;  5FK9 C;  1SMY D;  4HIM A;  1G2S A;  2MPM A;  3I4M B;  1G29 1;  2F0U A;  4DV1 Q;  2DNE A;  3J81 c;  1LTG D;  1VQK A;  1LAC A;  4B3M Q;  2CH4 A;  4IPG A;  2DNC A;  5FOB B;  1X3G A;  5IOC A;  5C3W A;  1EZ8 A;  2B29 A;  1DGS A;  5C44 G;  3G6E A;  2JA9 A;  3TP7 A;  3J81 E;  4N8X 1;  3U9S A;  1JOK A;  1SFO B;  1ASY A;  4FF4 A;  1ESF A;  1K83 B;  2AWN A;  1TWC B;  2IX1 A;  3PGZ A;  3KLR A;  2HUG A;  2QDB A;  5HGT A;  1X55 A;  5I9P A;  2ICI A;  4JI7 Q;  1F77 A;  2RF4 A;  4BBS B;  1HA6 A;  1BO0 A;  1I3Q H;  3BZC A;  2K5N A;  1WYD A;  4B08 A;  5C3E H;  3H3V I;  1ZEQ X;  4HIO A;  4LFA Q;  3AB9 A;  2MQH A;  4DV5 Q;  2L15 A;  3NSW A;  1U4P A;  1NAP A;  1HR0 W;  4Y52 H;  3KBX A;  3HKZ G;  4CBV A;  3A54 A;  5DEH A;  4DV0 L;  4DR2 Q;  4DV3 L;  1A3U A;  1O7I A;  4JI3 L;  5AJ3 L;  1A6X A;  4G7H C;  2ICE C;  4B3T L;  2EYF A;  1EYD A;  2JP1 A;  2HIX A;  2FHT A;  1X3F A;  1GVP A;  3L7Z C;  2Y0S B;  4ME5 A;  1N9W A;  1V1Q A;  2F52 A;  4TSS A;  4HCS A;  5CV6 A;  3HOV H;  3S17 B;  4C2M B;  5ELB A;  3T1H Q;  1UE1 A;  2EXZ A;  4L5R C;  2ZXR A;  1B53 A;  1ONL A;  4DR1 L;  3TP8 A;  4GKJ Q;  2LXK A;  2VL6 A;  2C9O A;  4DK6 C;  2CWA A;  2SEB D;  3K0X A;  1D1I A;  3TSS A;  5C44 H;  1IBM Q;  1SYB A;  1JIC A;  3PUX A;  1JWU D;  1C4Q A;  1JT8 A;  3KDF B;  4R4C A;  3G7L A;  1BUV T;  1GD7 A;  1EQQ A;  4QL5 A;  1FNV A;  4LF8 Q;  5KND A;  3PCO B;  3GTG H;  2F0S A;  1PZJ D;  3AFQ A;  3NQT A;  1RTN A;  3FHW A;  4RAU C;  5E4W C;  5IYB G;  5ELD A;  2VUM H;  4QJF A;  1JR0 D;  2BDN A;  4KKU A;  1BBW A;  4HJ5 A;  1PH3 A;  2ZXO A;  3CW2 C;  3D8G A;  2EXD A;  4XQQ A;  5M5X B;  2XTI A;  4A3M H;  2NN6 H;  3OW2 A;  2BH2 A;  1AE2 A;  1Z6H A;  4LF9 L;  4CHT B;  3K59 A;  1ZYR C;  1SMY C;  2EYM A;  2SOB A;  2WKD A;  2V1C C;  1VQM A;  1DJR D;  4F87 A;  4GN3 B;  2PQE A;  3GTK H;  2WAQ G;  4OX9 L;  3GTM B;  1K8M A;  2F0D A;  1MBY A;  1VQN A;  1EL0 A;  4DNI A;  2OTJ A;  4FXK C;  4ZUI A;  4DN4 M;  4OWT B;  2JE6 I;  1ET9 A;  2XRS D;  3RNU A;  4QB4 A;  2R92 G;  1F9S A;  3PSI A;  4OWX B;  5JAV A;  2PI2 A;  4KMU C;  4JBJ A;  4C3J H;  1ASZ A;  4AYB G;  4JI4 L;  3A7L A;  1ICF B;  3JC6 6;  1PZK D;  1A62 A;  4YCU A;  2BA0 A;  4UP7 A;  1UUP A;  1G6Z A;  2HDM A;  4KI0 A;  4Y7N H;  3A8I E;  4K5X A;  2JYO A;  1QZG A;  3I4L A;  3R2I A;  3PO3 H;  1SE8 A;  2RSN A;  4A4I A;  4GLV B;  1LTT D;  1X54 A;  4OXP A;  5FKA C;  3QWN A;  4HCE A;  1D7Q A;  4HED A;  1QUQ A;  4QUF A;  4IUT A;  4LNQ A;  1ZXT A;  4ID6 A;  4R8N A;  4FF2 A;  1Q7Y C;  2D5D A;  2VQF L;  4J15 A;  2NVX H;  2GVA A;  3PUZ A;  3GV3 A;  3CCQ A;  2E8G A;  1LTI D;  2ZXP A;  3I8Z A;  2WV6 D;  3VR2 A;  5JEA H;  3AMU A;  1PRT C;  2E2J B;  3PIP A;  3KBG A;  1PYW D;  3TZU A;  1NY4 A;  4POF A;  3NTH A;  1H9M A;  3P1H A;  1PMR A;  3Q0A A;  3BYT B;  5JPM C;  4DAY B;  2SNS A;  1EWC A;  3BVZ A;  2EZV A;  3S2H B;  1QUQ B;  1EY6 A;  1KAB A;  1TS5 A;  4LFA L;  4RGT A;  4YWM A;  4UY8 C;  1HTP A;  2RBM A;  2ZTE A;  3K57 A;  2AUJ D;  5FLX c;  4ULL A;  4WJ3 M;  1TT2 A;  1GJX A;  3L3O C;  1MJC A;  3H15 A;  4XQJ A;  4JI3 Q;  5FO8 B;  4DR4 L;  1VQ5 A;  3G6J B;  4WJ4 A;  4HMI A;  1YNX A;  1IBL L;  3OMC A;  3S1M B;  2F3V A;  5IGC A;  1FGB D;  3PV0 A;  3T1Y L;  1LT3 D;  3OIQ A;  1DOL A;  4N9T A;  1N33 L;  1Q90 A;  2UXC L;  1YEZ A;  5LMN L;  3MFY A;  2Z6K A;  2IPK D;  2VQF Q;  2EYH A;  2LFN A;  3HOV B;  2VNU D;  3I90 A;  5EBD A;  4B3M L;  3QB3 A;  1EIF A;  5L37 A;  1XYI A;  4IOA A;  1BR9 A;  3GTL H;  4KN7 C;  3H94 A;  3AYH B;  2EYP A;  4B3S Q;  1YHB A;  2A8V A;  4GNX C;  1SE3 A;  3FVQ A;  2CFM A;  1EFI D;  3K81 C;  3CF5 A;  5NUC A;  4AQY L;  3P7J A;  1VQ6 A;  1D8L A;  4JG2 A;  1XTC D;  3QO2 A;  4IUP A;  3J7A V;  4BXX G;  3T53 B;  2YU9 B;  1EY5 A;  3OYY A;  2PZT A;  3SGI A;  3HZX A;  4LF5 Q;  4U68 A;  4A3E B;  2KCN A;  5E7N A;  1EU4 A;  1VQH A;  3KLW A;  2NVY B;  4BWG B;  3ONA B;  4EQ5 A;  1O7L A;  2ZTC A;  3EA6 A;  3DEP A;  1PFS A;  5D3D A;  4BA2 I;  1Q1E A;  3CCU A;  1M1K C;  1VS0 A;  2KVM A;  4K8J A;  5EQ0 A;  2GVB A;  1DYQ A;  1HTL D;  4YHH Q;  5KEE A;  2EY2 A;  4K6D A;  4DUZ L;  4ZCK A;  5IYD H;  2R92 B;  2B2W A;  2F3I A;  4B9X A;  2VW9 A;  3BVM A;  1VQ4 A;  4DXG A;  2NB0 A;  4A3E G;  1Y1W H;  1C8C A;  2EJF C;  4NPS A;  3HKZ B;  5C0X G;  2UXD Q;  2RHS B;  2J0T D;  2PQA B;  1RTO A;  3C3L A;  1WI5 A;  1H9S B;  1S72 A;  1HA5 A;  3JAM L;  1XXG A;  1K0R A;  4CKE A;  2WIN B;  5EKI A;  4K6L A;  3RZO B;  3M7G A;  1PH2 A;  2DUD A;  1K8A C;  2GA4 B;  3IFT A;  4DR7 L;  2VS1 A;  3BVG A;  4GOP A;  2F1M A;  4POG A;  3K5O A;  2HIV A;  2K01 A;  2L9H A;  1I6V C;  3BDO A;  1CZW A;  1SRU A;  2A74 C;  2WB1 E;  3D0F A;  1OXX K;  1P16 A;  5IE8 A;  5LL6 X;  1B3A A;  2A73 B;  3DM1 A;  2IY5 B;  4R4O A;  4FF1 A;  1PRT D;  3R3O A;  1S5D D;  3Q23 A;  4LF7 Q;  1HNW L;  5A2Q E;  1E1O A;  4DUY Q;  3RN2 A;  1XJV A;  5D3I B;  3S1Q H;  5M3F H;  1YNJ D;  1EZ6 A;  1W3S A;  3W2D A;  2M2L A;  3S1N B;  1TY0 A;  1XTD A;  4JI2 L;  4KJO A;  5FLM G;  1U9R A;  5C5M A;  5E1F A;  4DUZ Q;  5IWA Q;  3RN5 A;  4A3J G;  3SK5 A;  4HJ7 A;  1AFP A;  1EY4 A;  3OWE B;  3L0O A;  2YU9 H;  1PA6 A;  3NK9 A;  2N3S A;  3VYS A;  1BCP B;  1NUC A;  1JJC B;  1QWY A;  4M1U B;  4X3U A;  3TZD A;  2P5Z X;  3TS2 A;  1TS2 A;  5IYC G;  3BDL A;  3VR6 A;  4C3I H;  1A63 A;  1EQT A;  1BNZ A;  4J8Q A;  4CDF C;  1HR0 Q;  1SNO A;  3M4Y A;  4X64 L;  5BN4 A;  3ND8 A;  4IUN A;  4DR7 Q;  5I6Y A;  2CVR A;  2JJQ A;  1VQP A;  2BE5 C;  1G6P A;  2OQK A;  2SDF A;  1WTP A;  2NUC A;  3HOW B;  3EFX D;  5CGK A;  1IW7 C;  1STA A;  1IBM L;  1PV4 A;  4A3G H;  4AH6 A;  1PLF A;  3J7Y W;  4RH6 A;  5M5Y B;  3GTO B;  1CHP D;  2M9V A;  3J80 i;  4HIK A;  2OXP A;  1S5E D;  4X3T A;  3URY A;  3CCL A;  5J1Z A;  4LF8 L;  2OCE A;  1I4R A;  1IHZ A;  3R93 A;  2NBF A;  1CA6 A;  2OTL A;  1S5B D;  2UUC Q;  4K2L A;  5F2D A;  2F4V Q;  3HOZ G;  3KF6 A;  1V1P A;  1SN8 A;  2K28 A;  2NN6 I;  5IP9 H;  1PFM A;  4X3S A;  4HJ8 A;  1L0W A;  3KF8 B;  4PV1 C;  5IYC H;  3JAM E;  4A3K G;  4C3I G;  4A3D G;  2QGQ A;  4PZ7 A;  4B3R L;  1VQD A;  3V05 A;  1WJJ A;  1VQI A;  4QIW E;  1PFB A;  4EQO A;  4A3C H;  4QQB X;  2QKI C;  1FL0 A;  4NMZ A;  3TDQ A;  4F8M A;  3GTM H;  1WTX A;  1TVX A;  5CYU A;  1NCV A;  3AQQ A;  1L1O B;  1WTH A;  1UWV A;  2C5C A;  1EUJ A;  1A3T A;  1Q81 C;  2EPB A;  1XMO L;  1ZKO A;  2I07 B;  3MZ5 A;  1OTC A;  2IW3 A;  4A3F G;  4H7B A;  1HRJ A;  1JMC A;  1GHK A;  1MKH A;  2MO0 A;  1JE4 A;  4PMB A;  4FO2 A;  5D65 A;  1SRO A;  4X62 Q;  2JQO A;  1JCK B;  2G9D A;  3A7A B;  2K6A A;  4NP5 A;  1BCP F;  4DR6 Q;  4BY7 H;  2ES2 A;  3PF4 A;  4CDE C;  5GAG C;  5IP9 G;  2YTY A;  2NTS A;  3VR5 A;  1IL8 A;  4A3I G;  4IN3 A;  1R9T H;  4O1N A;  1X65 A;  4PMC A;  3F8T A;  1JC7 A;  2A5H A;  2HQE A;  3TP5 A;  3ICE A;  4IFD J;  3K7U C;  2O5I C;  4A3L G;  1LTB D;  1OO9 B;  4HSV A;  1K9M C;  5DM7 3;  1H9R A;  1FJG Q;  3HOV G;  2KBN A;  2F4I A;  1RDP D;  4FDB A;  3TME A;  1I4Q A;  2V4D A;  1Y8O B;  3NPP A;  2FIN B;  1ML0 D;  1QNU A;  3HEJ A;  3BG3 A;  3VA5 A;  4X66 L;  1VDZ A;  4OO1 G;  4K8I A;  3RMH A;  1EWI A;  2PZU A;  1JB3 A;  2E74 C;  1UNS A;  2HD3 A;  4WRD A;  3CRL C;  3H3V C;  3KJP A;  2VY3 A;  1YNN C;  2D0P A;  1RJT A;  1QIL A;  1WCM B;  4BBR B;  1PH8 A;  3PF5 A;  5C4Z A;  1Y8N B;  2RQX A;  4BY7 G;  1T9H A;  3F2U A;  2HHH Q;  1YJN A;  1X6O A;  5JJK A;  4KD3 A;  1E7Z A;  1EY9 A;  3HG9 A;  2F0K A;  1AZP A;  1YVC A;  3S1R B;  4JYA L;  4B9W A;  3KLS A;  4N8F A;  4DV0 Q;  1KIX A;  2H5X A;  3SEB A;  4A3M G;  2NVT B;  2QEX A;  1LO5 D;  4EVO A;  1F9R A;  4YWK A;  3ZJY C;  3S1R H;  1H9J A;  3NWT A;  1HNZ Q;  1Y1V G;  2VB2 X;  3W1B A;  4HAE A;  4X64 Q;  3GTJ H;  2QA4 A;  1STE A;  3S16 B;  4F88 A;  2Q2U A;  4KN4 C;  4JV5 L;  2ZM6 Q;  4OHJ A;  3S2H H;  4MHE A;  4P2C B;  4DV1 L;  3M4O H;  1NMF A;  1NNX A;  5E4X A;  4RGO S;  1B7Y B;  2E5L Q;  1YHQ A;  1EU3 A;  4GLA C;  1V1P B;  2CQO A;  4K14 A;  4ZYS A;  4RMF A;  5ELN A;  1J5E L;  4JI5 L;  1C0A A;  2VQE L;  2IHE A;  4R1J A;  4JI6 L;  1O78 A;  3HOZ B;  3I2Z A;  4A3G B;  4DNR B;  4IZ8 A;  1BVS A;  1SYD A;  3CQZ B;  1W2B A;  1EYA A;  1SND A;  4ABN A;  3GO5 A;  2ZJR A;  4KK7 A;  2L55 A;  3OSO A;  3JAM i;  2N55 A;  5M3F B;  3L9A X;  1TWG B;  4R9W A;  3STB C;  1DXM A;  1IXR A;  5M9O A;  3PIO A;  1IL2 A;  3S9W A;  3I3C A;  1C7Y A;  2QCP X;  2Z0S A;  3SK6 A;  1HNX Q;  2WAQ E;  2KHS A;  1ENC A;  2JXM B;  4DR2 L;  4B3R Q;  4OX9 Q;  5AJ3 Q;  3MC0 B;  3FPU B;  4MN3 A;  3ULL A;  4AYB E;  1O7Y A;  5C0X I;  3K8A A;  1B2T A;  4O2D A;  2RDF A;  4DR5 Q;  2R7Z B;  1E24 A;  4GS3 A;  3SK4 A;  5LMN W;  2RDG A;  5M3M G;  5M5W B;  2CKZ B;  2EY5 A;  1DOK A;  3EVQ A;  4C3J B;  5GAD C;  2Y0S G;  3BZK A;  3M4Q A;  1TWH B;  2BA1 A;  4OON A;  1SYF A;  4DNT B;  4NKL A;  3UDI A;  5EKL A;  1VQJ A;  5K5P A;  4DR6 L;  3RUZ A;  1MGS A;  4JI5 Q;  3ER0 A;  4CKC A;  4HID A;  2EJG C;  2F0H A;  2NVQ H;  5EPL A;  2Z9H A;  2NN6 G;  4IUQ A;  1EYG A;  1TWA B;  1XPU A;  2JA6 H;  2KCT A;  3WOF A;  2VUM B;  2KCM A;  2MO1 A;  1WTQ A;  3S15 H;  4G7O C;  2TSS A;  3ZYY X;  2Z4H A;  1MJE A;  3S17 H;  4PZ8 A;  1U4M A;  2AWO A;  4R4T A;  3PQI A;  1I50 B;  2D2C C;  5COY A;  3IKJ A;  5EGT A;  3GTQ H;  1U5K A;  3H09 A;  5G3L F;  3LWE A;  2K5W A;  4X66 Q;  2BOS A;  4A3D B;  3MFG A;  4MZ9 A;  1BXT A;  4DU9 A;  2X6G A;  4GN4 B;  3S1N H;  4M8A A;  4JBM A;  4JK1 C;  3DXJ C;  3LX0 A;  1ZYR D;  4CKB A;  3F2C A;  4BBR H;  3HOW H;  3K0Y A;  5AFW A;  3VYU A;  4ZAI A;  2R3Z A;  5G3L D;  3WWV A;  3EJI A;  1EIG A;  1K83 H;  4O42 A;  3H0G G;  4KKS A;  2KJX A;  4KLK A;  2PCF B;  4X65 L;  2K5V A;  1TWF H;  1CSP A;  5CBE E;  1D5M C;  5I6W A;  3ITP A;  1JQY D;  4L5S A;  1CKM A;  3KYH C;  1UEA B;  4C3H H;  1Q12 A;  1CKO A;  1XPR A;  4YIJ A;  1AEX A;  2HCC A;  4XXE A;  2D62 A;  3SE0 A;  1Y1W B;  3DWP A;  2CW0 D;  3T1Y Q;  4NB3 A;  2F0M A;  1J9O A;  4BY1 G;  1I4G A;  4OGQ C;  4YY3 Q;  2RCN A;  2UXC Q;  1DZ1 A;  5K36 G;  4P73 A;  1KAW A;  2JA8 B;  3KLS X;  2JA7 G;  1UE5 A;  4XIG S;  4BY7 B;  1K3B C;  2X6L A;  1EY7 A;  4BBR G;  1JB7 A;  1KRS A;  2JA5 H;  3HOU B;  4K2K A;  5EKK A;  4DV7 L;  1BF4 A;  1PDQ A;  1YBY A;  1V1O A;  5ELE A;  5I4D A;  5JEA J;  1NMG A;  2Z8L A;  1CUK A;  3A8K E;  1PYS B;  1XNR L;  4A3B H;  4X6A H;  3I72 A;  1XNR Q;  4GKK Q;  2B2Y C;  2R93 G;  2PYK A;  4RCO A;  1CK1 A;  2OQ0 A;  5EPJ A;  4DV5 L;  1D5X C;  2Z1C A;  3MAQ A;  4IO9 A;  4DV6 L;  2R7Z G;  4EQN A;  4C3H B;  5GAH C;  2JK8 A;  2PQA A;  1PH4 A;  5GAE C;  3PO2 G;  2YTX A;  1B4O A;  1V8Q A;  2Z6K C;  3E3X A;  2ENB A;  4OEL B;  2KCC A;  2F0T A;  1RF2 D;  4BY1 H;  1QB5 D;  2O2L D;  3X3M A;  1IKM A;  4RGM A;  1AP0 A;  1B1Z A;  2PMZ B;  3H3V H;  2KQ3 A;  5TSS A;  4DV4 Q;  5FJ8 H;  4BBS H;  2ZM6 L;  3IFD A;  3I56 A;  4YY3 L;  3T13 A;  5FLM H;  1TXY A;  1N34 L;  3C1E A;  1WVL A;  4BBS G;  2EQS A;  1W6K A;  2K5H A;  2JA7 B;  1K3R A;  4KJN A;  1L1O A;  4B3T Q;  3CXC A;  5JJI A;  4KY5 A;  1IKL A;  2I46 A;  3W5O A;  2B8G A;  5C3E G;  3MEH A;  1X3Q A;  4ME3 A;  1JJ2 A;  2B39 A;  1GM5 A;  2A69 C;  4IJL A;  1QJO A;  3S24 A;  2A6E D;  3I4N H;  1AW7 A;  1SFO H;  5LMU Q;  2Q8T A;  2XVS A;  5DM6 3;  5LMU L;  3OHX C;  4GOP B;  1SNC A;  4RG1 A;  1SNM A;  3CAM A;  2F0O A;  2EYJ A;  2KOL A;  5DLQ E;  4NXN L;  1TWA H;  2EE1 A;  4DR3 L;  3DLL A;  3G48 A;  2F0L A;  4H13 C;  4A3G G;  1MIU A;  4OL7 A;  4KD4 A;  4DV2 Q;  4RKL A;  5IYD G;  4H02 A;  3M3Y H;  2WAC A;  3BJU A;  3PO3 B;  1I5F A;  3M9B A;  5C5L A;  4DR1 Q;  1JOR A;  1UAP A;  2C35 B;  5KYI A;  1JWM D;  5IWA L;  4JCV E;  2WII B;  2B63 B;  4DPG A;  5DAU A;  4JI1 L;  4HJA A;  4A93 B;  1FNU A;  1G91 A;  1RHP A;  3NBI A;  5EAY A;  1VQO A;  2J7Z A;  2I5L X;  1JJG A;  4IUR A;  4MNO A;  4O0A A;  2L11 A;  1T5X D;  2Q2I A;  1XX8 A;  1LTA D;  1HUN A;  1PH7 A;  3CQZ H;  4PMW A;  2EVB A;  3DMU A;  4CDD C;  3STB D;  4A3C G;  1QVC A;  5I2X A;  1KRT A;  4LJZ C;  1TWF B;  3V96 A;  1TQO A;  2F0P A;  2AQ2 B;  3J81 L;  1Y69 U;  2I5H A;  2MFI A;  2PW7 A;  3A5U A;  1UEB A;  1N33 Q;  3HP3 A;  3N52 A;  1A2T A;  2RDH A;  2KHI A;  5FO7 B;  4G57 A;  2PPB C;  3MVV A;  2JA8 H;  1VQG A;  1MHW C;  5M5X H;  5T1I A;  2LMC B;  2R92 H;  4DK1 A;  3DM3 A;  4C3J G;  4LUV A;  5IP7 H;  5C4H A;  1P8L A;  5COR A;  1EQV A;  1TS3 A;  3NWS A;  4QUC A;  2B2T C;  1AH9 A;  4UPA A;  1HZ9 A;  1D5Z C;  1X3E A;  2NWG A;  1UE6 A;  2OT2 A;  2ZTD A;  3FKI G;  1EIY B;  4I7Z C;  2TMP A;  4R8I A;  3FRP B;  3M85 A;  4RWS C;  4UDU C;  2K14 A;  4P74 A;  4A3L H;  3KFU A;  3OTO Q;  4KHP Q;  1VQ9 A;  2Z4I A;  3MTS A;  4IFD G;  4ODG A;  4CDC C;  1R4Q B;  1PTO F;  3SDZ A;  3TQY A;  5IOD A;  5CV9 A;  4CJ1 B;  4V0B A;  3GDE A;  1HR0 L;  1R4P B;  1KNE A;  1NBW A;  4A3K B;  1GUS A;  1H9K A;  2F0E A;  4Y7N B;  1KAA A;  2JA8 G;  2H1E A;  4A3D H;  1I4H A;  4I65 A;  1Y14 B;  3PIO 3;  4X62 L;  2MHV A;  1F2L A;  3FMC A;  1CKN B;  1KL9 A;  3AFP A;  3AU7 A;  1ENF A;  2K05 A;  4DFA A;  2HCI A;  1CQV A;  3NP8 A;  2K52 A;  2OEO A;  1HJP A;  2KEE A;  2NZH A;  2EY6 A;  3EIV A;  1S5C D;  1X9N A;  3FKI H;  4LFB L;  1S3O A;  4FNF A;  2XWB B;  3ERQ A;  2LS0 1;  5CC4 A;  3CPW A;  3CP0 A;  2Q8I B;  3LWU A;  2A19 A;  1M90 C;  3P20 A;  4C3I B;  4JI7 L;  2HQL A;  5C3E B;  4Q5V A;  1TWH H;  2Y0S E;  4DAY A;  2A6E C;  3S16 H;  2WKC A;  1KLU D;  2BDO A;  3NE5 B;  2K32 A;  4P71 A;  2G5D A;  2IL8 A;  1Q8K A;  1HH2 P;  1PRT F;  2X69 A;  3MWY W;  4LW1 A;  2JEA I;  4UP9 A;  4GZY C;  4UHV A;  1STH A;  4LF5 L;  1B3Q A;  1JE5 A;  4G4K A;  2ASB A;  1NE3 A;  3D4D A;  3J81 i;  4A3F H;  2E2D C;  2SNM A;  2XN9 C;  3K58 A;  4DV3 Q;  1A15 A;  4B3S L;  3HOU H;  3M3Y B;  1SNP A;  2YYZ A;  3SHL A;  4GKK L;  5KRU A;  2MJ8 A;  3VYR A;  1SSO A;  4BS9 A;  1QZH A;  1PTO D;  4L6T B;  3GTP H;  5I2Y A;  3C1F A;  3BZD B;  2AHO B;  2B2U C;  2B2T A;  1AN8 A;  1X32 A;  1BCP D;  1I4P A;  3HS0 C;  1OXU A;  1Q1B A;  4JI1 Q;  2NYZ D;  3CCE A;  4ZKB B;  4DA2 A;  1BKB A;  3CU7 A;  4A3J B;  4BY1 B;  1N32 L;  1N34 Q;  1YNN D;  1WTO A;  3KOJ A;  2PNR C;  4P75 A;  5IT9 E;  1QVF A;  3RD4 A;  3GTG B;  1HCZ A;  3RZD H;  5ELO A;  4PNY A;  4DAV A;  3M7N A;  1E3P A;  1LAB A;  4C2M H;  2UUA Q;  3WOE A;  3E5S A;  1I3Q B;  4JW0 A;  4OO1 H;  2XWJ B;  3AEV A;  5ELF A;  1PVO A;  3PUV A;  3F2D A;  1E0B A;  2CHB D;  3M4P A;  1VQ7 A;  1PTO C;  5C4X G;  1QOH A;  1TII D;  3D3R A;  5FO9 B;  2K5D A;  1DM0 B;  5JOB A;  2CQA A;  3OOC A;  1KQS A;  2FFK B;  5M3M H;  3MHB A;  4JI8 L;  1FVI A;  1K8O A;  4FXD A;  3K5N A;  1MD2 D;  1FNW A;  3OMG A;  2R7F A;  1GXD C;  5IGF A;  3FPP A;  4Z9C B;  4RHS A;  3GTJ B;  4A3E H;  1Y1W G;  4IPC A;  2NVQ B;  3HKZ E;  4RGN A;  2NVY H;  2E75 C;  2BCO A;  2N88 A;  4LFC L;  2E76 C;  4JC0 A;  5C44 B;  1CZG A;  3MEF A;  3FEW X;  1BDO A;  4LFC Q;  3NTK A;  1WD1 A;  3HOY G;  1SAP A;  1CM9 A;  1VCI A;  4JYA Q;  1DON A;  1Y1V H;  3OW7 A;  2UXD L;  5HY6 A;  1PRT B;  2KEC A;  4C1N I;  3Q6S A;  3BU2 A;  4GOP C;  1ET6 A;  2DN8 A;  1SE4 A;  4JI0 Q;  2PO4 A;  3W1G A;  5CBA E;  2ATW A;  4CGY B;  4JI0 L;  2DY8 A;  1B44 D;  1B8A A;  4DAM A;  3FKI B;  3I4N B;  3CC7 A;  3GTL B;  3KJO A;  2F03 A;  4LAA A;  2VXW A;  1KXL A;  3V2T A;  1D2B A;  1BOS A;  3MXG A;  1JWS D;  5A35 A;  2LSS A;  3NUC A;  5C4J H;  5JJL A;  2E2I H;  3UI2 A;  1RIP A;  1XMQ L;  4GN5 A;  5ISR A;  2B3G A;  4PG3 A;  4DR3 Q;  5KYL A;  4JI6 Q;  3GD7 A;  1Q3L A;  2XRQ D;  1SE2 A;  3FDT A;  3IL8 A;  1O7Z A;  4QY7 A;  1HFG A;  4A3M B;  3TBI B;  3UDF A;  2F0F A;  4IUV A;  4G7Z C;  1LT6 D;  3RLF A;  5CMD A;  4HTH A;  2RVL A;  2RSO A;  1FR3 A;  4A93 H;  4ILW A;  4LF9 Q;  2A69 D;  4TKO B;  5EPK A;  3OWF A;  5GQO A;  1Q8I A;  1SLJ A;  3S2D H;  1TKW B;  1HNX L;  2BE5 D;  1I94 Q;  5KNB A;  5BR8 Q;  4L8J A;  2RKS A;  3A0J A;  3VR3 A;  3RZO H;  2FMM A;  2OF1 A;  2EY1 A;  5K36 H;  1ESR A;  1YIT A;  2K4K A;  3T51 B;  1HZA A;  1NR4 A;  1RD9 D;  3QJY A;  4IPD A;  4ZRZ A;  2JA6 B;  3R2T A;  3G4S A;  3EBE A;  3ERS X;  3KDF A;  5JVH 3;  1IBL Q;  1VF5 C;  3J81 j;  2JA5 G;  4A3F B;  1CT1 D;  4PQX A;  3U50 C;  5J39 A;  3A55 A;  3CD6 A;  1J6Q A;  1G2T A;  4WFN 3;  4L5T A;  2E2H B;  3HGB A;  1IZ6 A;  1LTL A;  2H4O A;  3K5M A;  4WOR A;  5LL6 S;  1CHQ D;  2IT1 A;  1SR3 A;  1FYC A;  2F0G A;  2UUB L;  2L12 A;  1PTO H;  2LY7 A;  4KHV A;  3VYT A;  3PUY A;  3K5L A;  4HN7 A;  3RLO A;  2EIF A;  2DJF C;  4FYD A;  2CH4 W;  2UXB L;  3F1Z A;  3NTI A;  1N36 Q;  4JOI A;  3A56 A;  1EQR A;  1M8A A;  5J3B A;  1HZC A;  2IX0 A;  1IYU A;  3CKI B;  2YV5 A;  1L2F A;  2AKW B;  3E9I A;  3GTK B;  2GN5 A;  2JN4 A;  2D9U A;  3BYY B;  3DEO A;  2MUY A;  3D4W A;  5LMN Q;  1KC8 C;  1QG7 A;  3RR5 A;  3C46 A;  5CV7 A;  3SVM A;  3Q24 A;  2L0C A;  2A68 D;  1GUG A;  5FJ8 G;  1ICW A;  3TRE A;  3QOJ A;  5KIX A;  4UAI A;  1D1K A;  2IX3 A;  3UDG A;  1WTR A;  1OXT A;  2HT1 A;  5IGD A;  2ZT9 C;  3K7A B;  4XYQ A;  1O80 A;  3J7A F;  5C4X B;  4DV7 Q;  4XQN A;  1XWE A;  4JVZ A;  2A1A A;  1QCB D;  2EDG A;  4JBW A;  4LMQ D;  4HSP A;  5DNF A;  3P75 A;  2N49 A;  4XYO A;  2RCF A;  2XGT A;  4OIK A;  1PH1 A;  1RCV D;  4L63 B;  4XT1 B;  1Z9F A;  4TQU S;  4FVM A;  3J7Z C;  5IYB H;  2Q8R E;  1Q82 C;  1SEB D;  1K0S A;  3GQB A;  3I4O A;  3PO2 B;  1HZB A;  3S1M H;  4A75 A;  1N8R C;  4FXG C;  4C3H G;  1NJI C;  1CSQ A;  2R93 B;  2ZJP A;  2JA5 B;  3GTO H;  2PW5 A;  1AE3 A;  1SYE A;  3MXP A;  2WB1 B;  4DKA C;  2A68 C;  3UE0 A;  4DV2 L;  4GNX B;  1WFQ A;  4ZLT F;  3ERO A;  1JOQ A;  5M3F G;  2VZA A;  4GKJ L;  1EOV A;  3NEN A;  2I5M X;  2R61 A;  2QIL A;  4YHH L;  4LF4 Q;  4XT3 B;  4DV4 L;  1NSN S;  5ELC A;  2E2H H;  4KY7 A;  3MA2 B;  1FD7 D;  4A76 A;  1C9O A;  2KHJ A;  2KED A;  2B8F A;  4KTA A;  4FP5 D;  4KHZ A;  2NVX B;  1VMP A;  5M5W H;  1TWC H;  3NBH B;  5KGU A;  1SXT A;  1TU2 B;  3JAM c;  3CCJ A;  1L0X B;  1HQR D;  3CCV A;  1SYC A;  2E2I B;  3Q8D A;  4L5Q A;  3T56 B;  1ILQ A;  1VQA A;  1S4Z A;  3CHB D;  1LLR D;  4AIM A;  1LTS D;  5D14 A;  4TVA B;  2HHH L;  1EYC A;  2ZJQ A;  1GKH A;  2QEJ C;  4EX5 A;  3PO3 G;  3KF8 A;  2F0Q A;  4X3K A;  5IY0 A;  3CME A;  2PZW A;  3SXH A;  3KUP A;  3EN2 A;  2K50 A;  1N32 Q;  1CQF A;  2G9H D;  4JOI C;  1SNQ A;  3UE1 A;  1W6J A;  1UE7 A;  1U4L A;  4H44 C;  4QMG A;  3TEH B;  3TRZ A;  3S14 H;  3DWA A;  3TP6 A;  2HDL A;  4NDX A;  1G8Z D;  3X3N A;  3TS0 A;  4NXM Q;  2B2V C;  3NBH A;  1TS4 A;  5JJZ A;  1HNZ L;  1A2U A;  1QNK A;  2WB1 G;  1KHI A;  1U0L A;  1QE6 A;  3A74 A;  3GTQ B;  3E9H A;  5IT9 c;  4R4I A;  1B50 A;  3RLN A;  3CCM A;  1WTW A;  3C2P A;  2NVT H;  4HMJ A;  4DR5 L;  1VQC A;  2XIW A;  5JEA G;  1SDF A;  4CJ2 C;  1D6E C;  3E0E A;  5BN3 A;  5A2Q L;  2I0Q A;  3ULJ A;  3E6Z X;  5H1S E;  2O5J C;  1S5F D;  2CCZ A;  3OPO A;  2VUM G;  2AQ3 B;  1PFN A;  3MXU A;  4JI8 Q;  3OTO L;  4KHP L;  4K0K Q;  3A5Z B;  4K0K L;  4XDX A;  1YJ9 A;  2K75 A;  3L2P A;  1CFM A;  3PIP 3;  1K8G A;  5CV4 A;  5IT9 L;  4LF6 Q;  4OO1 I;  2IHF A;  2F3W A;  4QIW B;  4IFD H;  3GV6 A;  2OWO A;  1F2Y A;  3GP7 A;  1GUO A;  2WAQ B;  1XNQ Q;  4QF4 A;  4LUO A;  4R4Q A;  4V19 0;  3TN2 A;  1CI3 M;  2AQ1 B;  5HGQ A;  1SBB B;  4J1M A;  1A3V A;  1XMQ Q;  3PUW A;  4JPB W;  2M00 A;  2NZO A;  1KTK A;  3U9O A;  4OEM B;  1MSH A;  2PI2 E;  2LXJ A;  2IWH A;  1KD1 C;  3MXN B;  4JI2 Q;  3HOX B;  4DXF A;  4QCL A;  2KUM A;  3CCR A;  1F9P A;  4IOC A;  3S14 B;  4LFB Q;  2UUC L;  2R7D A;  1LM0 A;  3J80 c;  4RFB A;  1CTM A;  1V43 A;  2XNA C;  5JPN C;  1GO3 E;  4DAP A;  1VQE A;  4IUU A;  4S3S A;  4A3I H;  2LKV A;  3HOX G;  4A3B B;  1AZQ A;  4OIJ A;  3LNN A;  4X65 Q;  2FXQ A;  3H91 A;  1L0Y B;  4P72 A;  2JA6 G;  1STG A;  4Q0F A;  1HUM A;  2J4X A;  2BH8 A;  2AUK A;  4ALP A;  4EGV A;  1VMC A;  3KK7 A;  3OIP A;  4LWC A;  3LGJ A;  1F2Z A;  1XNQ L;  2KA7 A;  5LHY 1;  1KNA A;  4K5W A;  4YCW A;  1CKN A;  1IW7 D;  1JOO A;  2B2Y A;  1VQB A;  5E3F A;  5C4J B;  2JSO A;  1EIH A;  3GTP B;  1B9M A;  1Z7T A;  4JBK A;  1EOT A;  2EYO A;  2K7V A;  1J8I A;  4KY6 A;  4IQZ A;  1HFN A;  1G51 A;  1X3P A;  1EY0 A;  3MXN A;  1I6H B;  1GUN A;  3HOY B;  3ND9 A;  3S1Q B;  1GHJ A;  1VF7 A;  1BQQ T;  2YTV A;  1E2W A;  2AMC B;  5BN5 A;  4ZK9 B;  1Z47 A;  2B2V A;  3J80 L;  3NEL A;  1DOM A;  1PYB A;  1PH9 A;  1A8V A;  1PZI D;  3HOX H;  3H0G H;  3O13 A;  2F0I A;  1L1O C;  5IIF A;  3D6C A;  1BCP C;  3WDN A;  2EYL A;  4AQY Q;  4OWW B;  1EEI D;  1K73 C;  4RKB A;  1LUZ A;  3T4A C;  4GLX A;  3H0G B;  1Q86 C;  1PXU A;  3W3A A;  1FJG L;  1E2V A;  3CPF A;  2NTT A;  4MTK A;  4DV6 Q;  2EJM A;  3BDC A;  1SMX A;  1J5E Q;  1SJH D;  3I91 A;  3UDX A;  1YIJ A;  2L1B A;  2WP8 J;  5C4X H;  2KEN A;  1BBX C;  4QGU A;  1WOC A;  3D31 A;  4MTN A;  4RA8 A;  4DF7 A;  5C6A A;  1E22 A;  1PH6 A;  4DGZ A;  1EY8 A;  2QDL A;  1WCM G;  1SYG A;  2F0N A;  2MNA A;  4IAL A;  2CWP A;  1TR5 A;  2CW0 C;  1LTR D;  1Y1V B;  1F9Q A;  3I70 A;  3QOL A;  1GUW A;  1LT4 D;  3EQL C;  4F7X A;  1K28 A;  4MIU A;  1TY2 A;  1E1T A;  5CR3 A;  1R9T B;  1OXV A;  3E0J A;  1DD2 A;  1C48 A;  5FLX E;  4A3J H;  1ENA A;  2R93 H;  2A6H C;  4YWL A;  2DGY A;  1KDB A;  3F2B A;  5IGG A;  3Q22 A;  1I6H H;  3B6Y A;  4ZQ3 A;  3HOY H;  5T1G A;  4IPH A;  2PNH A;  2RHQ B;  1RL2 A;  2B63 H;  4BXX H;  3IAY A;  2VB3 X;  2UUA L;  4LF4 L;  4JV5 Q;  3QIA A;  1NTG A;  2NZ1 D;  4NW2 A;  2EOT A;  1XPO A;  1WD0 A;  2R7Z H;  5HUR A;  1YZ6 A;  1EWH A;  4AYB B;  2JEB I;  4FF3 A;  3PO2 H;  5M3M B;  1ROD A;  1II3 A;  1KDC A;  3M4O B;  3HOU G;  3BS1 A;  3SR1 A;  1Y8P B;  1MI2 A;  1VQF A;  2FJ2 A;  4KV6 A;  3SK8 A;  1STY A;  3R8B A;  4DUY L;  3KF6 B;  2PMZ E;  2L5T A;  2VQE Q;  3CC4 A;  1WCM H;  2ID0 A;  4U67 3;  1RKN A;  5EJW A;  3HFZ B;  3DUZ A;  4NXM L;  1LYL A;  3IRB A;  5C0X J;  3K6O A;  1EEF D;  2R6G A;  3HRZ C;  1MSG A;  1HHV A;  1VQL A;  1X56 A;  3FP9 A;  5C0X H;  1YJW A;  3NQI A;  4DK3 C;  4E6I A;  4N9P A;  1BBU A;  1LV9 A;  2B2W C;  3PMF A;  1YI2 A;  4ZUJ A;  3NXW A;  5KNC A;  1KLG D;  2B63 G;  2WFW A;  3I55 A;  1GOZ A;  1I94 L;  2K33 A;  4LUZ A;  5GRO A;  1E2Z A;  1F2M A;  4UP8 A;  4EQP A;  3I4N G;  4I7A A;  1STB A;  2N8N A; 
#chains in the Genus database with same CATH homology
 5JEA J;  1PHJ A;  1NMG A;  1PH2 A;  1CUK A;  4A3B H;  1PYS B;  2DUD A;  3K7A H;  4IPD A;  1K8A C;  1IBK L;  1XNR L;  1IBK Q;  4LF6 L;  1XNR Q;  4DR7 L;  2VS1 A;  3U58 A;  3G4S A;  4GKK Q;  3EBE A;  3ERS X;  3KDF A;  4GOP A;  2R93 G;  1IBL Q;  3J81 j;  1A0I A;  1FGU A;  2JA5 G;  2N78 A;  1PH5 A;  4POG A;  2HIV A;  4APV A;  3U50 C;  3CD6 A;  1J6Q A;  2OQ0 A;  4L5T A;  2E5L L;  1SRU A;  1IZ6 A;  1LTL A;  2WB1 E;  3D0F A;  1OXX K;  1P16 A;  5IE8 A;  4DV5 L;  2IY5 B;  3HOW G;  4R4O A;  2IT1 A;  1SR3 A;  3K80 C;  4IO9 A;  2UUB L;  4LF7 L;  4DV6 L;  4NXN Q;  3J7A 5;  1HNW Q;  2UUB Q;  4LF7 Q;  1HNW L;  4DUY Q;  1E1O A;  3RN2 A;  2R7Z G;  1XJV A;  3PUY A;  3S1Q H;  5M3F H;  5GAH C;  3RLO A;  4GNX A;  2PQA A;  1W3S A;  2JK8 A;  2EIF A;  5GAE C;  2YTX A;  3VDY A;  1S40 A;  1QVG A;  1PH4 A;  3F1Z A;  2Z6K C;  1N36 Q;  2UXB L;  1XTD A;  1TWG H;  4JOI A;  1N36 L;  4JI2 L;  1EQR A;  3CCS A;  4BY1 H;  3NEM A;  5J3B A;  1Q46 A;  1HZC A;  2IX0 A;  2YV5 A;  1L2F A;  2AKW B;  3E9I A;  5FLM G;  3H3V H;  2GN5 A;  4DV4 Q;  4DUZ Q;  5FJ8 H;  2UU9 L;  5IWA Q;  4BBS H;  3RN5 A;  4A3J G;  2UU9 Q;  3HKS A;  2ZM6 L;  4HJ9 A;  4HJ7 A;  2E2J H;  4YCV A;  3I56 A;  5LMN Q;  4YY3 L;  1YHA A;  3L0O A;  1KC8 C;  3RR5 A;  2YU9 H;  1PA6 A;  3I4M G;  5FLM H;  1TXY A;  2N3S A;  1N34 L;  4IJH A;  1JJC B;  1IYJ B;  1H95 A;  5BR8 L;  3TRE A;  5FJ8 G;  2EQS A;  3UDG A;  4BBS G;  2HT1 A;  2K5H A;  1OXT A;  4BA1 I;  1K3R A;  1L1O A;  4B3T Q;  3TS2 A;  4PZ6 A;  3CXC A;  5IYC G;  1OXS C;  5JJI A;  4DV7 Q;  2ALY B;  4C3I H;  1A63 A;  3W5O A;  1HR0 Q;  2A1A A;  4JBW A;  5C3E G;  4X64 L;  3ULP A;  2JA7 H;  4DR4 Q;  1JJ2 A;  4ME3 A;  4DR7 Q;  2N49 A;  1GM5 A;  1VQP A;  2JJQ A;  1XMO Q;  2XGT A;  2D0O A;  4IJL A;  1VQ8 A;  2OQK A;  1G6P A;  3S24 A;  3I4N H;  2Q2T A;  1SFO H;  5LMU Q;  1PH1 A;  1Z9F A;  4TQU S;  5LMU L;  4GOP B;  4JI4 Q;  4RG1 A;  1IBM L;  1PV4 A;  3J7Z C;  4A3B G;  4AH6 A;  5IYB H;  1Q82 C;  4A3G H;  4XTC S;  3CAM A;  1B70 B;  3I4O A;  1HZB A;  1I50 H;  3S1M H;  3HOZ H;  4A75 A;  1N8R C;  5IP7 G;  3U4V A;  1NJI C;  3J80 i;  5DLQ E;  4NXN L;  4HIK A;  1TWA H;  4DR3 L;  1CSQ A;  3CCL A;  3DLL A;  3G48 A;  5M5Y H;  2ZJP A;  1V9P A;  3G71 A;  2Q2H A;  1EFW A;  4LF8 L;  4A3G G;  3GTO H;  2OCE A;  1AE3 A;  1MIU A;  3CC2 A;  2UXB Q;  4A93 G;  4DKA C;  3I7F A;  4DV2 Q;  2F4V L;  4IFD I;  3UE0 A;  5IYD G;  4H02 A;  4DV2 L;  2OTL A;  4GNX B;  2UUC Q;  1WFQ A;  2F4V Q;  3KF6 A;  3HOZ G;  3M3Y H;  3U4Z A;  3BJU A;  1I5F A;  1SN8 A;  3M9B A;  4DR1 Q;  4A3K H;  3I4M H;  3T1H L;  3CMA A;  5M3F G;  2VZA A;  2NN6 I;  1EOV A;  3NEN A;  5IP9 H;  4GKJ L;  2C35 B;  2I5M X;  4YHH L;  4LF4 Q;  5IWA L;  4JCV E;  4DV4 L;  4HJ8 A;  4HIM A;  3PO2 G;  1L0W A;  3KF8 B;  2E2H H;  1G29 1;  4DV1 Q;  4DPG A;  4JI1 L;  5IYC H;  3J81 c;  4HJA A;  4A3K G;  4A76 A;  1C9O A;  4A3D G;  2KHJ A;  1VQK A;  5EAY A;  2QGQ A;  4B3M Q;  4PZ7 A;  1VQO A;  4IPG A;  4B3R L;  1VQD A;  2I5L X;  4KHZ A;  1X3G A;  1WJJ A;  1VQI A;  4QIW E;  4A3C H;  4QQB X;  1FL0 A;  5M5W H;  1JJG A;  2B29 A;  1TWC H;  3GTM H;  4MNO A;  4O0A A;  3NBH B;  1DGS A;  5C44 G;  3G6E A;  3JAM c;  2JA9 A;  2Q2I A;  3CCJ A;  3AQQ A;  3CQZ H;  1PH7 A;  1L1O B;  1UWV A;  4PMW A;  1ASY A;  3CCV A;  1EUJ A;  2AWN A;  3Q8D A;  4L5Q A;  1Q81 C;  3STB D;  1VQA A;  3PGZ A;  1QVC A;  1XMO L;  2IX1 A;  4A3C G;  1KRT A;  4AIM A;  1X55 A;  1OTC A;  4JI7 Q;  4A3F G;  2RF4 A;  4TVA B;  3BZC A;  1I3Q H;  1JMC A;  2HHH L;  2K5N A;  2ZJQ A;  1WYD A;  1GKH A;  1MKH A;  4EX5 A;  2MO0 A;  5C3E H;  4X62 Q;  3H3V I;  1SRO A;  3PO3 G;  2I5H A;  2JQO A;  2MFI A;  5IY0 A;  1UEB A;  3A5U A;  4LFA Q;  3CME A;  4HIO A;  1N33 Q;  2MQH A;  4DV5 Q;  2KHI A;  3EN2 A;  2K50 A;  2L15 A;  1N32 Q;  2JA8 H;  4DR6 Q;  1VQG A;  4JOI C;  1HR0 W;  4Y52 H;  4BY7 H;  5M5X H;  2ES2 A;  3HKZ G;  3UE1 A;  3PF4 A;  1UE7 A;  4DV0 L;  3TEH B;  4DR2 Q;  2R92 H;  3TRZ A;  5GAG C;  5IP9 G;  4DV3 L;  1O7I A;  4JI3 L;  5AJ3 L;  3S14 H;  3TS0 A;  4B3T L;  4NXM Q;  3DM3 A;  2HIX A;  2YTY A;  1X3F A;  1GVP A;  3L7Z C;  1HNZ L;  1N9W A;  1V1Q A;  2F52 A;  2WB1 G;  4A3I G;  1R9T H;  4LUV A;  5IP7 H;  3HOV H;  1KHI A;  1U0L A;  1P8L A;  3A74 A;  3E9H A;  1X65 A;  4R4I A;  1UE1 A;  5IT9 c;  3RLN A;  3F8T A;  3CCM A;  4DR1 L;  3T1H Q;  4L5R C;  2NVT H;  2LXK A;  4GKJ Q;  3ICE A;  4IFD J;  1AH9 A;  2VL6 A;  4DK6 C;  3K7U C;  4UPA A;  4DR5 L;  1HZ9 A;  4A3L G;  1VQC A;  1X3E A;  1UE6 A;  2CWA A;  2ZTD A;  3FKI G;  5JEA G;  1EIY B;  1K9M C;  1FJG Q;  3HOV G;  2KBN A;  3K0X A;  3E0E A;  4FDB A;  5C44 H;  1IBM Q;  2I0Q A;  3ULJ A;  3PUX A;  3M85 A;  5H1S E;  1JT8 A;  3KDF B;  4R4C A;  2CCZ A;  2K14 A;  4P74 A;  4A3L H;  4X66 L;  2VUM G;  3OTO Q;  3KFU A;  4KHP Q;  4OO1 G;  1VQ9 A;  4JI8 Q;  3OTO L;  1GD7 A;  4KHP L;  1EQQ A;  4IFD G;  4K0K Q;  4QL5 A;  3A5Z B;  4K0K L;  1YJ9 A;  3TQY A;  1EWI A;  4LF8 Q;  2K75 A;  1HR0 L;  3GDE A;  3L2P A;  3PCO B;  1K8G A;  3GTG H;  3AFQ A;  3FHW A;  1NBW A;  5IYB G;  3KJP A;  2VY3 A;  4LF6 Q;  4OO1 I;  2IHF A;  2VUM H;  2D0P A;  4QJF A;  1BBW A;  4HJ5 A;  2OWO A;  2JA8 G;  4A3D H;  1PH3 A;  1PH8 A;  3PF5 A;  1XNQ Q;  3CW2 C;  4BY7 G;  1T9H A;  4LUO A;  4R4Q A;  1Y14 B;  2HHH Q;  4X62 L;  2EXD A;  1YJN A;  1X6O A;  2XTI A;  4A3M H;  5HGQ A;  3OW2 A;  2BH2 A;  1CKN B;  1AE2 A;  5JJK A;  1E7Z A;  3AFP A;  1KL9 A;  4LF9 L;  1XMQ Q;  3PUW A;  2K52 A;  1YVC A;  1HJP A;  2NZO A;  2NZH A;  2V1C C;  4JYA L;  1VQM A;  4DV0 Q;  2PI2 E;  2LXJ A;  4GN3 B;  1KIX A;  2H5X A;  2WAQ G;  3GTK H;  1KD1 C;  4OX9 L;  3EIV A;  4A3M G;  3MXN B;  2QEX A;  4JI2 Q;  1X9N A;  4YWK A;  3FKI H;  3ZJY C;  1S3O A;  3CCR A;  4IOC A;  3S1R H;  1VQN A;  4LFB L;  4LFB Q;  2UUC L;  2R7D A;  1HNZ Q;  1Y1V G;  4DNI A;  2OTJ A;  3W1B A;  1LM0 A;  4OWT B;  3J80 c;  2JE6 I;  4X64 Q;  3CPW A;  3RNU A;  3GTJ H;  2R92 G;  2QA4 A;  3CP0 A;  3PSI A;  4OWX B;  2A19 A;  1M90 C;  2Q2U A;  4JV5 L;  2PI2 A;  2ZM6 Q;  1V43 A;  4JBJ A;  4C3J H;  1ASZ A;  4JI7 L;  1GO3 E;  3S2H H;  4DV1 L;  2HQL A;  1NMF A;  1VQE A;  3M4O H;  4A3I H;  1TWH H;  2Y0S E;  4AYB G;  3HOX G;  4JI4 L;  1B7Y B;  2E5L Q;  3JC6 6;  3S16 H;  4P71 A;  1YHQ A;  4X65 Q;  1A62 A;  2FXQ A;  4GLA C;  1Q8K A;  1HH2 P;  4YCU A;  2BA0 A;  2CQO A;  4LW1 A;  4P72 A;  2JEA I;  4UP9 A;  4UP7 A;  4RMF A;  5ELN A;  1J5E L;  4LF5 L;  1JE5 A;  2JA6 G;  4JI5 L;  1C0A A;  2ASB A;  2VQE L;  1NE3 A;  2IHE A;  4R1J A;  4KI0 A;  3J81 i;  4Y7N H;  4A3F H;  4JI6 L;  2BH8 A;  4DV3 Q;  4B3S L;  3HOU H;  4ALP A;  1QZG A;  3PO3 H;  3I2Z A;  2YYZ A;  4GKK L;  4LWC A;  1BVS A;  1SE8 A;  4A4I A;  3LGJ A;  1W2B A;  1XNQ L;  4GLV B;  1QZH A;  3GO5 A;  1X54 A;  2ZJR A;  3GTP H;  4OXP A;  3JAM i;  4YCW A;  2AHO B;  1CKN A;  1VQB A;  1D7Q A;  1QUQ A;  4LNQ A;  1OXU A;  1Q1B A;  3STB C;  4JI1 Q;  1IXR A;  3PIO A;  3CCE A;  4JBK A;  1Q7Y C;  1BKB A;  1IL2 A;  1C7Y A;  2VQF L;  1N32 L;  2Z0S A;  1HNX Q;  4J15 A;  1N34 Q;  2WAQ E;  2NVX H;  2GVA A;  1G51 A;  3KOJ A;  3PUZ A;  4DR2 L;  4B3R Q;  4OX9 Q;  4P75 A;  3CCQ A;  5AJ3 Q;  2E8G A;  1QVF A;  2YTV A;  3ULL A;  2AMC B;  3RZD H;  5ELO A;  1Z47 A;  3PIP A;  4AYB E;  3NEL A;  3M7N A;  1E3P A;  1PYB A;  1PH9 A;  5C0X I;  1A8V A;  3HOX H;  3K8A A;  3H0G H;  1NY4 A;  1L1O C;  4POF A;  4O2D A;  4DR5 Q;  4C2M H;  1E24 A;  4AQY Q;  2UUA Q;  4OWW B;  1K73 C;  4GS3 A;  5LMN W;  1LUZ A;  4DAY B;  4GLX A;  3AEV A;  5M3M G;  2CKZ B;  1Q86 C;  1FJG L;  1PVO A;  3PUV A;  3F2D A;  3M4P A;  5GAD C;  1QUQ B;  1VQ7 A;  2Y0S G;  5C4X G;  3CPF A;  3BZK A;  3M4Q A;  4LFA L;  2BA1 A;  4YWM A;  4OON A;  4UY8 C;  2ZTE A;  3UDI A;  4DR6 L;  1VQJ A;  5FLX c;  4DV6 Q;  1KQS A;  4WJ3 M;  5M3M H;  4JI5 Q;  3ER0 A;  4JI8 L;  1SMX A;  1J5E Q;  1FVI A;  3UDX A;  1YIJ A;  1MJC A;  3H15 A;  4HID A;  2NVQ H;  2WP8 J;  5C4X H;  4JI3 Q;  2KEN A;  4QGU A;  1WOC A;  3D31 A;  1VQ5 A;  4DR4 L;  4WJ4 A;  4MTN A;  2NN6 G;  2R7F A;  1EYG A;  1E22 A;  1YNX A;  1PH6 A;  1IBL L;  4A3E H;  1Y1W G;  1XPU A;  4IPC A;  2JA6 H;  2KCT A;  1WCM G;  2MNA A;  3HKZ E;  3PV0 A;  2KCM A;  2CWP A;  3T1Y L;  2MO1 A;  2NVY H;  3S15 H;  1N33 L;  4LFC L;  1MJE A;  4JC0 A;  3S17 H;  4PZ8 A;  1YEZ A;  3MEF A;  5LMN L;  4LFC Q;  2UXC L;  2AWO A;  4R4T A;  3HOY G;  2Z6K A;  2VQF Q;  1VCI A;  4JYA Q;  1E1T A;  1Y1V H;  1OXV A;  2VNU D;  2UXD L;  5HY6 A;  3GTQ H;  4B3M L;  1U5K A;  1EIF A;  3BU2 A;  4A3J H;  4GOP C;  4X66 Q;  4MZ9 A;  4IOA A;  2R93 H;  4JI0 Q;  4YWL A;  2DGY A;  3W1G A;  2ATW A;  3GTL H;  4GN4 B;  3F2B A;  4JI0 L;  3S1N H;  1I6H H;  3B6Y A;  3AYH B;  4JBM A;  3HOY H;  4IPH A;  4B3S Q;  1YHB A;  4X6A H;  2PNH A;  4GNX C;  2RHQ B;  1RL2 A;  1B8A A;  2A8V A;  2B63 H;  4BXX H;  4DAM A;  2CFM A;  3F2C A;  3CC7 A;  3K81 C;  4BBR H;  3CF5 A;  4AQY L;  3KJO A;  2UUA L;  4LF4 L;  3HOW H;  4JV5 Q;  1KXL A;  1VQ6 A;  1D8L A;  1NTG A;  1XPO A;  4JG2 A;  2R7Z H;  1YZ6 A;  2LSS A;  3WWV A;  5C4J H;  2JEB I;  3PO2 H;  1K83 H;  2E2I H;  3H0G G;  4BXX G;  5JJL A;  3HOU G;  1RIP A;  4KLK A;  1XMQ L;  4X65 L;  1VQF A;  2K5V A;  1TWF H;  3OYY A;  4GN5 A;  4DUY L;  2B3G A;  3KF6 B;  4PG3 A;  1CSP A;  4DR3 Q;  2PMZ E;  3SGI A;  2VQE Q;  3CC4 A;  1WCM H;  2ID0 A;  4JI6 Q;  3GD7 A;  4LF5 Q;  5E7N A;  3HFZ B;  4QY7 A;  1VQH A;  3KLW A;  4L5S A;  4NXM L;  4EQ5 A;  1CKM A;  2ZTC A;  3KYH C;  3UDF A;  4C3H H;  1LYL A;  1PFS A;  1CKO A;  1Q12 A;  3IRB A;  5C0X J;  1Q1E A;  3CCU A;  1XPR A;  1M1K C;  4BA2 I;  2R6G A;  1VS0 A;  2D62 A;  3RLF A;  1VQL A;  2GVB A;  1X56 A;  3FP9 A;  3T1Y Q;  4YHH Q;  1YJW A;  4A93 H;  4NB3 A;  4DUZ L;  4DK3 C;  5IYD H;  2F3I A;  4BY1 G;  1BBU A;  4LF9 Q;  2VW9 A;  1YI2 A;  4YY3 Q;  2RCN A;  1VQ4 A;  2UXC Q;  5K36 G;  1HZA A;  4P73 A;  5GQO A;  4A3E G;  1SLJ A;  1Y1W H;  3S2D H;  1KAW A;  4NPS A;  1HNX L;  1I94 Q;  2B63 G;  5BR8 Q;  2WFW A;  3A0J A;  2JA7 G;  3I55 A;  5C0X G;  1I94 L;  1UE5 A;  4LUZ A;  5GRO A;  2RHS B;  4XIG S;  2UXD Q;  2PQA B;  3RZO H;  4BBR G;  4UP8 A;  1JB7 A;  1KRS A;  2JA5 H;  1WI5 A;  3I4N G;  1YIT A;  1S72 A;  2N8N A;  4DV7 L;  2K4K A;  1K0R A;  1YBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...