1VQBA

Gene v protein (single-stranded dna binding protein)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
86
structure length
86
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEYPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENE V PROTEIN
publication title Structure of the gene V protein of bacteriophage f1 determined by multiwavelength x-ray diffraction on the selenomethionyl protein.
pubmed doi rcsb
source organism Enterobacteria phage f1
total genus 10
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 1996-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vqbA00
1I5FA 1VQ4A 2NZOA 3HOYH 1S3OA 3JC66 2MO1A 2JA5H 3TS0A 4TQUS 1U0LA 5IP7H 4A93H 2NVTH 2DGYA 1JMCA 3M4QA 2IHFA 2I5HA 3I4NG 3UDIA 3NELA 4NPSA 1VQNA 3PUXA 2WB1E 4DUZL 3PIOA 2UU9Q 3KF8B 4DV7L 3UDGA 2EIFA 1LYLA 4A3CH 1GD7A 4PZ8A 1VQAA 1WJJA 3AFQA 3HKZG 4GS3A 1V9PA 1WI5A 3K7UC 4OO1G 3GTJH 4MNOA 1JJGA 1VQ5A 1HNXL 1AE3A 5ELOA 1HJPA 1D8LA 4YHHQ 4GLXA 3G71A 1EIFA 4IFDG 3TRZA 1I94Q 2R92G 3I4MH 2Y0SG 2JQOA 4R1JA 1Y1VG 2CQOA 5M5WH 4DV7Q 3D31A 4GN4B 4R4QA 4DR1L 1PH5A 1N34L 5LMNL 2I5LX 3KLWA 4GNXA 3I4NH 2F4VQ 4UPAA 3M9BA 4P75A 3HOXG 1XJVA 1KQSA 4LNQA 2ID0A 2KHIA 1PA6A 2FXQA 1HNXQ 2K5NA 4QIWE 2AWNA 5J3BA 4BBSH 1G51A 2HIVA 3BZCA 2E8GA 2E5LL 1JJCB 4J15A 4R4IA 5C3EG 4HJ7A 4DR1Q 1N34Q 1E7ZA 1O7IA 1L1OB 1SRUA 5LMNQ 4LW1A 1VQ8A 4P71A 2Z0SA 4X62L 2OTLA 3OW2A 5C44H 2KENA 2R92H 3BZKA 1MKHA 3HKSA 2VW9A 1Y1VH 3CCMA 1PH9A 1QZGA 4JV5L 5JEAG 3NBHB 3PSIA 4PZ7A 4LFBQ 2WFWA 4GKKQ 1CUKA 4GLVB 3OTOQ 1HR0L 1GO3E 3W1BA 3S2HH 2VQEL 1NMGA 2E5LQ 1HNWQ 3J80i 3HOZH 2LXKA 5IT9c 3JAMc 4DAYB 1XPRA 2OQKA 2QGQA 1WCMH 2JE6I 2YU9H 1UE1A 1Z9FA 1S40A 4JI6Q 3J81i 1L1OC 3STBC 1AH9A 4JI4Q 1VQ6A 4B3SL 1VQJA 3K7AH 2ZJQA 1X3EA 1TXYA 5JJKA 2OWOA 2AKWB 2UXBQ 1VQLA 2UUCL 3S17H 4R4OA 1VQGA 4BBRH 3S14H 4DV1Q 3RN2A 1S72A 5GAHC 1PH4A 1SROA 2C35B 4P74A 1Y1WG 4JYAL 1SLJA 1SN8A 2PQAB 3J80c 1EIYB 5FJ8G 1T9HA 4L5QA 1BKBA 4NXML 1OXUA 4POGA 4LF9L 4KI0A 4B3SQ 1X3FA 2RCNA 3PUVA 1SFOH 4JI2L 5IYBG 1HNZL 3GTOH 2MQHA 1H95A 2DUDA 4A3KG 3PUWA 3STBD 1PH1A 4LF5Q 4WJ3M 3CW2C 3CC4A 4XTCS 3KYHC 2V1CC 5IE8A 1EOVA 2B3GA 4JYAQ 4LWCA 1X9NA 1JT8A 1X3GA 5M3MG 2NVYH 4DR7L 4YCUA 4NXMQ 1PH7A 3CQZH 1OXTA 3G48A 1E1TA 4LUVA 3A0JA 4PG3A 4DV5L 1Q46A 2UUAQ 4B3ML 3I56A 3HOYG 3CCUA 1FJGL 3GTPH 1I50H 4GN3B 4GN5A 1PFSA 1Y1WH 4Y52H 4OWXB 1NTGA 4XIGS 5FJ8H 5IP7G 5GQOA 4LF4L 1RL2A 3RLOA 5AJ3L 4OX9L 3KFUA 4A93G 1N36Q 3HOVG 1X6OA 1MJCA 1LM0A 3FKIG 1XPUA 5IYBH 2VNUD 4BA2I 1A8VA 1GVPA 2K52A 3DLLA 1OTCA 4IJLA 1BBUA 2A1AA 2HHHQ 4OWWB 1K9MC 3PF4A 4DR7Q 4K0KQ 4A3KH 1L1OA 2R7ZG 4DV5Q 4QY7A 3RNUA 1PVOA 1UE7A 3G6EA 4JI3L 1XTDA 1IXRA 3WWVA 4OX9Q 3CP0A 1HR0W 2IT1A 4X64L 1Q8KA 3GDEA 2VUMH 4DNIA 4RMFA 2WB1G 3I4MG 3DM3A 4R4TA 2A19A 2YYZA 2OQ0A 3E9HA 4OXPA 3U4ZA 1UE5A 2R93H 2VY3A 3HOVH 4YHHL 4JI3Q 3M4OH 3FKIH 3PGZA 1HZ9A 2B29A 2BA1A 1NMFA 1I94L 3F1ZA 4LFAQ 4QGUA 3S1NH 3RLNA 2R7ZH 2L15A 1EQRA 4X64Q 1VQBA 2F4VL 4HIKA 3GTGH 4BBSG 1XNQL 4H02A 4X66Q 1D7QA 3PUYA 1HNWL 3M3YH 1IL2A 3EIVA 1K3RA 5HY6A 3ULJA 3CPWA 1HH2P 1JE5A 2K4KA 4C3HH 1YI2A 4HJAA 4A3LG 2JEAI 3CCJA 1XMOL 2PQAA 5C44G 2LSSA 1Y14B 4A3GG 5K36G 5M5XH 4A75A 1ASZA 2ZJRA 4HIMA 1TWHH 1XMQQ 4L5SA 2UXCQ 4ME3A 4JC0A 1IBLL 2ZTDA 3L2PA 4JCVE 1XNRL 1PH8A 1VQ7A 3G4SA 1VQ9A 3ICEA 1K0RA 4AYBG 1XNQQ 3K80C 5C4JH 3KJPA 2UXDL 5JJIA 3IRBA 3OYYA 1K8AC 3PV0A 4HIOA 1OXSC 3K81C 3HOZG 3FHWA 4DV6L 1IYJB 4UP7A 4LFBL 5M3FG 1WCMG 3M4PA 1XMOQ 3HOUH 4GKKL 4AYBE 3JAMi 3OTOL 2WAQG 3UE1A 4DK3C 3AEVA 4A3JH 3L7ZC 3W5OA 1G291 2ZJPA 1N8RC 1IBLQ 1YHAA 2E2JH 1XNRQ 4A3LH 1VCIA 4JI8L 3F8TA 1OXXK 2N3SA 5DLQE 4JI6L 2PMZE 4A3GH 4JI7L 2UXDQ 4BBRG 1VS0A 1WYDA 3KJOA 1TWGH 2WAQE 4JI4L 4DPGA 2RHQB 2Z6KC 4TVAB 2B63H 2K5VA 2F3IA 4LF6L 2ALYB 4AIMA 4DV6Q 4JBKA 1K73C 3CCVA 4POFA 2UXBL 1E1OA 2ATWA 2RHSB 3EN2A 4DV1L 3KDFB 1PV4A 3GTQH 2NN6I 2OCEA 1EQQA 4JI8Q 5M3FH 1PH2A 4JI7Q 3D0FA 1EYGA 4DUYL 4DAMA 3I55A 2I5MX 1Q82C 4LF6Q 2NZHA 2JA7H 1JJ2A 5FLMH 5IWAQ 3T1YL 5IYDG 3AYHB 2R6GA 2EQSA 3PCOB 4O2DA 4OWTB 3J81j 1IBMQ 4LF5L 2KHJA 4HIDA 4X65Q 4GKJL 1P16A 3RN5A 1X54A 2Q2TA 4YCVA 4LFCL 4DUYQ 4AQYL 2VQFL 4JG2A 3ER0A 2UUAL 4A3DH 1FVIA 1C7YA 4DR4L 1MJEA 3MEFA 3T1YQ 1A63A 1UEBA 4DR6L 3E0EA 3KF6B 2E2IH 2HT1A 4KHPL 1N36L 1YHBA 1MIUA 4IPDA 5IP9H 2XGTA 4A4IA 3W1GA 3ZJYC 5IYDH 1LUZA 1CKNB 4YY3L 5LMNW 2HHHL 4LFCQ 5C0XJ 1OXVA 2F52A 1HZAA 1KRSA 1YVCA 3S24A 4C2MH 2VQFQ 4AQYQ 1Q86C 1QVGA 1PYSB 2D0PA 4DKAC 2Z6KA 2VUMG 1VQMA 4DR4Q 1FGUA 2KCMA 5IY0A 1YJWA 3CC2A 4DR6Q 5HGQA 4BY7H 2R93G 3K0XA 4KHPQ 1QUQA 4DR2L 3CC7A 2CWPA 2YTVA 3TQYA 1NBWA 2N49A 3S1RH 3A74A 4KLKA 3E9IA 1N32Q 3S15H 1E22A 1YBYA 3U4VA 4YY3Q 4JI5Q 3RLFA 2LXJA 5M5YH 2NN6G 2GVAA 2R7DA 4B3TL 3CXCA 1GKHA 4IPGA 1J5EL 2IY5B 2JK8A 4IPHA 4FDBA 5C0XI 4LFAL 1WFQA 1YEZA 1UE6A 4DR2Q 3S1QH 1V43A 4EX5A 2YTXA 3CMEA 5BR8L 5FLXc 1EFWA 5JJLA 2KBNA 3PO2H 4X66L 1Q12A 4JOIA 1A0IA 4OONA 4P73A 5GAEC 4A3BH 1CSQA 3GTMH 3GTLH 3H3VH 5C4XG 4B3TQ 2K14A 3U58A 3KDFA 1M1KC 1K8GA 3PO3H 3CCRA 1J5EQ 3L0OA 4MTNA 1ASYA 1G6PA 3K8AA 2JEBI 1V1QA 4BY1G 1TWCH 1X65A 4YWMA 1XMQL 1QVFA 2UXCL 2CWAA 4WJ4A 1YJNA 1UWVA 3HOUG 1LTLA 2RF4A 1TWFH 4RG1A 5BR8Q 2MFIA 4JI0L 4A76A 1X56A 4BXXG 3HOWH 1YITA 2AHOB 2PI2A 3F2BA 4A3JG 1KAWA 4A3MG 1KXLA 2JA8H 4B3RL 4KHZA 2UUBL 2IX0A 1HZCA 3GD7A 2VS1A 2H5XA 4R4CA 2B63G 5C4XH 3B6YA 4YWLA 4X6AH 2MO0A 1Q1BA 1C0AA 1A62A 2KCTA 1SR3A 4A3FH 1KD1C 1BBWA 2CKZB 5ELNA 4JI0Q 3RZDH 1N33L 3J7A5 3KF6A 4BY1H 4L5TA 4B3RQ 2I0QA 3F2CA 1QUQB 4DV0L 2IHEA 2UUBQ 5EAYA 1TWAH 1YZ6A 1CKNA 3EBEA 5E7NA 5IYCG 1BVSA 4BXXH 1X55A 3CF5A 2AWOA 2K75A 1L0WA 1K83H 4DR3L 2Q2IA 4DV2L 4A3MH 3CMAA 1VQKA 2NVXH 2JA7G 3PF5A 3HKZE 1VQFA 5FLMG 5C0XG 4DUZQ 2GN5A 2JA6G 4JBWA 1N33Q 4EQ5A 1XPOA 4HJ8A 1HZBA 1NE3A 2JA9A 3CCEA 1E3PA 2ASBA 4DV0Q 1NY4A 3H3VI 2Y0SE 4JI1L 4DK6C 4APVA 4DV3L 5IWAL 1IBKL 3FP9A 1IZ6A 1B70B 3NEMA 4NXNL 1IBML 4DR3Q 4GOPB 2E2HH 4LF7L 1WOCA 4DV2Q 4A3DG 5GAGC 3TEHB 4X65L 3VDYA 3M7NA 2AMCB 2QA4A 3S2DH 1P8LA 5IYCH 2NVQH 3Q8DA 1EUJA 1C9OA 2A8VA 1U5KA 2ZM6L 3CD6A 3CCSA 1L2FA 1DGSA 4IOAA 4HJ9A 4DV3Q 4JI1Q 5IP9G 1IBKQ 2JA6H 2PNHA 2D0OA 4BA1I 4NXNQ 1CKMA 5GROA 4LF7Q 1B7YB 1JB7A 1J6QA 2ZTEA 4A3EG 4IPCA 3HOXH 4JOIC 3KOJA 4GOPC 1NJIC 3I7FA 4DR5L 1KRTA 3J7ZC 1RIPA 1VQCA 3H0GG 3I4OA 1Q1EA 2YTYA 2WP8J 4PZ6A 2Q2UA 1PHJA 4BY7G 4X62Q 4ALPA 2ZM6Q 3A5ZB 1Q7YC 1I6HH 2PI2E 5GADC 1PH3A 1N9WA 3S1MH 1FL0A 1QVCA 2CCZA 2D62A 3S16H 5C3EH 2QEXA 4JV5Q 3GO5A 1EWIA 3ERSX 3U50C 2GVBA 1VQHA 1YNXA 2ZTCA 3UDFA 3PIPA 1HR0Q 2JJQA 1B8AA 2HIXA 2VQEQ 4DR5Q 2BH2A 3PUZA 3A5UA 4JI5L 4A3IG 1PH6A 4JBJA 4IFDJ 3RR5A 4LF8L 4JBMA 1QZHA 3ULPA 4IFDI 1AE2A 4YCWA 4A3EH 1YIJA 1CKOA 1E24A 1VQIA 3PO2G 1W2BA 3NENA 5LMUL 2BH8A 3H0GH 4IO9A 4A3BG 2VZAA 1VQOA 3J81c 2CFMA 3TREA 3SGIA 1M90C 1KIXA 4GNXB 1VQDA 3PO3G 2YV5A 2UUCQ 1VQPA 2R7FA 4GLAC 3H15A 3TS2A 1R9TH 3F2DA 3BJUA 4P72A 1Q81C 4K0KL 1YJ9A 3AFPA 3RZOH 2IX1A 3BU2A 4OO1I 2EXDA 1N32L 4C3JH 2BA0A 1SMXA 2HQLA 4PMWA 4IOCA 3T1HL 1Z47A 4QL5A 4HJ5A 1KC8C 4YWKA 1PYBA 2XTIA 2ES2A 2MNAA 5LMUQ 4DV4L 4MZ9A 4A3IH 4LF9Q 3HOWG 4QQBX 3UE0A 4UP9A 4LUOA 4JI2Q 5H1SE 3M85A 1HNZQ 2JA8G 5JEAJ 2JA5G 4UY8C 2N78A 3CCQA 4NB3A 1W3SA 2OTJA 4GNXC 2K5HA 2K50A 1KL9A 3AQQA 1SE8A 3CPFA 4AH6A 4GOPA 1I3QH 2VL6A 2Q2HA 4C3IH 4Y7NH 3CAMA 4A3FG 3ULLA 4LUZA 3T1HQ 1KHIA 1VQEA 4LF8Q 4GKJQ 4DV4Q 4B3MQ 4O0AA 3HFZB 3CCLA 4A3CG 3UDXA 1FJGQ 1GM5A 4IJHA 3GTKH 3MXNB 5M3MH 4LF4Q 3I2ZA 2UU9L 4QJFA 3LGJA 5AJ3Q 4UP8A 1CSPA 4L5RC 1YHQA 2N8NA
chains in the Genus database with same CATH superfamily
1NNXA 1HUNA 1B9MA 3I4MB 1R4QB 2JA5H 1U0LA 1ILPA 2DGYA 1JMCA 4V190 3I4NG 4NPSA 5C4JB 2DJFC 5IT9L 3KF8B 1LTSD 1IYUA 1EQVA 4PZ8A 2BE5C 5ELDA 5IGGA 1SSOA 3HKZG 4OO1G 3GTJH 1HUMA 1D8LA 3BYTB 5C44B 3W2DA 1H9RA 2WINB 2CQOA 3D31A 4GN4B 4R4QA 3SK6A 2I5LX 1MSHA 4K14A 3I4NH 4B08A 2KHIA 3ND8A 2FXQA 5DM73 2K5NA 4QIWE 1H9JA 2F1MA 4BBSH 4OGQC 3A7LA 4CKBA 1L0XB 1SRUA 4LW1A 4P71A 4X62L 3OW2A 2KENA 1EY6A 1XTCD 4Q0FA 1QZGA 1SE4A 1QB5D 1SNQA 2WFWA 3OTOQ 1GO3E 1A2UA 2F0GA 3W1BA 5NUCA 1NMGA 2LXKA 2EYOA 1CM9A 2F0VA 1PLFA 3STBC 4JI4Q 3HS0C 1HQRD 2J7ZA 5EGTA 2ZJQA 2VXWA 3TP7A 4I7AA 3S17H 4C2MB 1VQGA 3S14H 4HCSA 4DV1Q 3I4LA 3RN2A 1SROA 4JYAL 1KDAA 1SN8A 4BY7B 5FJ8G 1T9HA 1R4PB 4L5QA 3PMFA 4KI0A 3T51B 1LTRD 1HPCA 5IYBG 3GTOH 4RA8A 1VDZA 2L0CA 2DUDA 1JICA 3CC4A 1F9RA 3DWQA 5IE8A 2B3GA 2AQ1B 5JAVA 4JYAQ 1X9NA 5CV5A 2EYPA 3ZYYX 4YCUA 1PH7A 3S1QB 4LUVA 1OXTA 4PG3A 1E1TA 4WRDA 3A0JA 4GKJL 4B3ML 4FXGC 3F2UA 4Y52H 3MHBA 5FJ8H 4LF4L 4A93G 5AJ3L 3URYA 1PYWD 3OSOA 4H13C 5IYBH 4BA2I 2B2UA 3DLLA 4IJLA 1BBUA 1SNDA 4OWWB 1K9MC 1K8OA 2R7ZG 1LLRD 4G7HC 2P5ZX 1IXRA 3MC0B 4ZQ3A 3NBHA 4HSPA 3DM1A 3X3MA 4ZKBB 4J1MA 2B2VA 2IPKD 3DM3A 4R4TA 1CI3M 2YYZA 4OXPA 4PMBA 1UE5A 5KYLA 2VY3A 1LT3D 1II3A 2B2YC 2B29A 4BY1B 1NMFA 1UAPA 1PFBA 1RODA 4LFAQ 2R7ZH 1SNMA 1BCPF 1U4LA 2F4VL 4RKBA 3U9OA 2HUGA 4X66Q 3PUYA 4A3JB 4A3MB 1D7QA 1G6ZA 2GA4B 3V2TA 3CPWA 2BCOA 1HH2P 2F0JA 4HJAA 1XMOL 5K36G 2KEDA 5M5XH 4A75A 1ASZA 1D6EC 2RDFA 1XMQQ 1Y8NB 2PNRC 3BS1A 3S9WA 4H0LC 1DD2A 1K0RA 3FMCA 5JJIA 3O13A 4UHVA 1K8AC 3HOZG 2OXPA 3KBGA 1GUSA 4UP7A 3HOUH 1WCMG 3M4PA 1XMOQ 3MFYA 2NVQB 3JAMi 4M1UB 3W5OA 1G291 5I9PA 2JA6B 1VCIA 4L63B 5K36H 5TSSA 4JI7L 4BBRG 2Z8LA 1GXDC 1TWGH 2WAQE 2B63H 3MAQA 3J7YW 2K5VA 5EKKA 4KJNA 2K01A 4A3DB 1D5ZC 4PV1C 1PV4A 3GTQH 2AUKA 4JI7Q 1EYGA 3I55A 2I5MX 4HN7A 2D2CC 4XYQA 3J80E 1JJ2A 4RCNA 3T1YL 3W3AA 4KY7A 2EQSA 4O2DA 2JXMB 4LF5L 1SE2A 1HHVA 4X65Q 4PMCA 3U9SA 2NZ1D 2PYKA 1SJHD 5KNBA 4LFCL 1B4OA 4TKOB 5C3WA 2VQFL 2F0QA 1V1PA 4K2KA 3QO2A 4DR4L 3Q24A 1A6XA 3T1YQ 2QW7A 3T56B 3E0EA 4DNTB 2L9HA 1H9SA 2E2IH 1N36L 4HTHA 1DOMA 2XGTA 3X3NA 4LFCQ 1QVGA 1HZAA 2VQFQ 4K5VA 3RUZA 1HQMC 4B9WA 3EFXD 2D0PA 3K5NA 1HCZA 2VUMG 1E2ZA 4DR4Q 2KCMA 3SXHA 5KEEA 3FRPB 1S5ED 3PO3B 5HGQA 2R93G 1NBWA 1QILA 3A74A 4IUTA 4ZCKA 1N32Q 1TWCB 1E22A 2KECA 5M5YH 4KTAA 3L9AX 2GVAA 3GTKB 4KKTA 2HDMA 3EROA 4IPGA 5KNDA 4N9PA 3QG1A 4KY5A 5M9OA 1ZEQX 1WFQA 2JA5B 1UE6A 5T1IA 4EX5A 5BR8L 5JJLA 4ZAIA 2KBNA 2EVBA 3VA5A 4JOIA 1A0IA 2DNEA 2NWGA 5IOCA 4A3BH 1CSQA 3H3VH 2RA4A 1D5XC 3KDFA 1EL0A 4A3FB 1KNEA 3CCRA 1FNUA 1MHWC 1ASYA 3K8AA 1STYA 2UXCL 1K0SA 2F4IA 1YJNA 1NSNS 2SNMA 1TWFH 5BR8Q 2MUYA 4A76A 1X56A 1Y8PB 1YITA 1WTWA 2XIWA 4H7BA 2WB1B 5CV8A 2Z6BA 4EVOA 2H5XA 4R4CA 1IL8A 2EJFC 3A8JE 3SK5A 3I4NB 1KNAA 2B2WC 4YWLA 3QOLA 5A2QE 2MO0A 1CHQD 1IKLA 1A62A 1E0BA 1SR3A 2KCTA 1QNKA 3GQBA 3BZDB 5CBAE 5ELNA 4DK1A 1I4RA 2E2HB 4CDEC 1LT5D 4YIJA 4XDXA 1CT1D 5D65A 2NB0A 3VR5A 5T1GA 1TWAH 4XT1B 3EBEA 5E7NA 1BVSA 3D6WA 1K83H 4ID6A 2PQEA 2NVXH 4RWSC 4FXDA 2SEBD 4DUZQ 2A69C 3J80L 2ASBA 5C5MA 3NSWA 2RSNA 1NY4A 1DYQA 4IURA 3ONAB 4APVA 1DZ1A 3NEMA 3T4AC 2EY5A 3T13A 3PIO3 3IFDA 2D9UA 3S16B 2DY7A 3M7NA 2F3VA 2QA4A 4QB4A 3HP3A 3J7AF 4HSVA 3S17B 2ZM6L 3T53B 3CD6A 1DGSA 2EYHA 4JPBW 5IP9G 2PNHA 1CKMA 4KMUC 1LT6D 3C46A 1JWSD 1WTVA 3HOXH 1RCVD 3I3CA 1EWHA 4BS9A 3I7FA 3D3RA 3M7GA 1KRTA 3J7ZC 5CV4A 1Q1EA 3GTOB 2WP8J 4BY7G 1PHJA 2ZM6Q 2N88A 1PH3A 1FL0A 2CCZA 4QUCA 5C3EH 1F9QA 1Y8OB 1VQHA 1HR0Q 4LK1C 4RHSA 2HIXA 2VQEQ 3PUZA 4CBVA 1PH6A 1GUTA 1YNJC 3ULPA 4KV6A 2TMPA 1AE2A 3G6JB 4KD4A 3KF8A 1VQIA 3PO2G 5LMUL 4IO9A 1JOOA 4O1NA 3TREA 1KIXA 4GNXB 4C3IG 1HRJA 3NK9A 3I72A 2YV5A 1EYDA 3H15A 2H4OA 1R9TH 3BJUA 4KJOA 2QILA 4P72A 2LKVA 1BOSA 1HA6A 4FYDA 1SMXA 1ICFB 2F0FA 4QL5A 2KUMA 4DN4M 2MNAA 5LMUQ 1TKWB 1ET6A 4MZ9A 4DV4L 3HOWG 1HNZQ 3OIPA 5JEAJ 2N78A 4A93B 2NVTB 5G3LD 4GNXC 2K50A 3AQQA 1QJOA 1TU2B 3EJIA 2Q2HA 4C3IH 4IALA 2K7VA 3KUPA 2R7ZB 5A2QL 1PRTB 5JJZA 4NP5A 4UDUC 4DV4Q 4O0AA 4A3CG 5M3MH 2CQAA 4NKLA 3LGJA 4L5RC 2G5DA 1WTHA 3HOYH 5M5XB 3JC66 4OEMB 2F0MA 2EYMA 1DONA 3DHQA 3AMUA 2I5HA 1PRTC 3PUXA 1EEID 3PIOA 3UDGA 2NUCA 3HOUB 4A3CH 1GD7A 2FJ2A 2EYLA 1I6VC 1WJJA 3AFQA 1JJGA 1VQ5A 1HNXL 1F77A 1TWGB 1B3QA 1HXYD 4DAPA 1I94Q 2B63B 2Y0SG 4NMZA 4DR1L 1N34L 5LMNL 4P75A 1KQSA 4LNQA 4CGYB 1HNXQ 5IGCA 1JWMD 3OHXC 1G51A 3BYYB 2HIVA 4J15A 2M00A 1HFGA 5I6WA 4HJ7A 4DR1Q 1N34Q 1O7IA 1L1OB 5LMNQ 1VQ8A 1QCBD 3OW7A 2Z0SA 1EY4A 4RKLA 4BBRB 2KEEA 2ICIA 2L55A 3BZKA 3TZDA 3CCMA 3DEPA 1E2VA 3OOCA 4LFBQ 4GKKQ 1CUKA 1A2TA 4ZLTF 2DJGC 2F0DA 3RMHA 3S2HH 1EY0A 3PQIA 5IT9c 1YNNC 3SK4A 5J39A 1XPRA 3MXNA 3J81i 1L1OC 2E2IB 4CKCA 2SDFA 1VQJA 3K7AH 4KD3A 3A56A 2OWOA 2AKWB 2UXBQ 3CQZB 3BG3A 1S72A 3I70A 4F87A 1CK1A 4DK0A 1PH4A 1SE3A 5CV9A 2PQAB 2A6HC 1BKBA 4POGA 1OXUA 4LF9L 3I8ZA 1X3FA 1SFOH 4EGVA 5M5YB 2ENBA 1B50A 4P2CB 3KYHC 4RAUC 2X6GA 4XTCS 2L11A 4LWCA 1RF2D 1FGBD 2R61A 1GUWA 3TN2A 1JT8A 1X3GA 5C5LA 1KDCA 1W6KA 3G48A 2VUMB 2UUAQ 2B8GA 1FJGL 3GTPH 4K5WA 4X3UA 4A3BB 1NTGA 2R93B 4OX9L 3KFUA 3RLOA 2RDHA 2B2TC 1BNZA 3HOVG 1X6OA 2PCFB 1A8VA 2EYFA 3K5LA 2FHTA 3HG9A 1OTCA 3QIAA 3PF4A 1WTOA 2TSSA 3N6RA 1TWFB 3H91A 4WFN3 3G6EA 4JI3L 2CHBD 4OX9Q 1STHA 5ELEA 2F0UA 5ELBA 2IT1A 4X64L 1Q8KA 3GDEA 4DNIA 1EZ6A 2WB1G 4JK1C 3HOVH 4JI3Q 4FF2A 3M4OH 5G3LF 2O5JC 4K6LA 2E74C 1S5FD 4QGUA 3RLNA 3C1EA 2L15A 3ERQA 1EQRA 3QB3A 1STGA 3FVQA 1VQBA 4X64Q 1K8MA 4BBSG 1Q90A 4H02A 3EIVA 1U4PA 2K4KA 1B2TA 1Y14B 3HRZC 4HIMA 4ME3A 4JC0A 2ZTDA 1PH8A 2QCPX 1ZYRC 3OYYA 1PTOH 4HIOA 1IYJB 2PO4A 4AYBE 3OTOL 2EXZA 4B9XA 1A15A 1Y69U 2WAQG 4DK3C 1LTBD 3AEVA 1TVXA 1SMYC 4ZK9B 3L7ZC 1SNPA 5LL6X 4IUUA 1CZGA 2E2JH 2FINB 3F8TA 1TS3A 2PMZE 2F0SA 5CR3A 3KJOA 1QOHA 1WYDA 2O4XA 4JI4L 2RHQB 4TVAB 3HOXB 4DXFA 4WJWA 2F3IA 2ALYB 3WDNA 1PTOD 5DEHA 1V1OA 2RHSB 4DV1L 1UEAB 1EQQA 1X32A 2OCEA 5EQ0A 4CJ2C 1PH2A 2F3WA 2JA7H 4J6HA 1G2TA 5C0XH 5FLMH 5J22A 1IBMQ 5FLXL 1B9NA 3LWUA 4FVMA 1P16A 3RN5A 4JG2A 1BO0A 1FVIA 1R9TB 1MJEA 3MEFA 5EPLA 1A63A 4S3SA 1A3TA 1BDOA 2RQXA 3EA6A 2HT1A 4CKEA 3ZJYC 5C0XJ 1OXVA 2F52A 2ZXPA 2Z6KA 1VQMA 1FGUA 3TP8A 1LACA 3PO2B 3MXPA 5IY0A 1E2WA 3GTMB 1BXTA 5C4HA 1AP0A 4C3IB 1F2YA 4DR2L 3CC7A 2CWPA 3S1RH 3TQYA 4KLKA 3E9IA 3S15H 2HCCA 3U4VA 4JI5Q 1ILQA 2G9HD 4GZYC 3K58A 1J8IA 3PIP3 2IY5B 3HOWB 3SR1A 4IPHA 3HOYB 3CRLC 4LFAL 1YEZA 4DR2Q 1V43A 2OF1A 3CMEA 3KK7A 2V4DA 4X66L 1Q12A 4P73A 3R8BA 2F03A 2PW7A 2K14A 3U58A 2CW0C 1K8GA 2HDLA 4XT3B 4YWMA 5K5PA 4FF3A 1XMQL 1QVFA 4OELB 3HOUG 4K6DA 3GP7A 3TZUA 2KOLA 4RH6A 1JWUD 1KAWA 5C6AA 4KHZA 4ULLA 3VYSA 2DN8A 2B63G 3B6YA 5LHY1 3TP5A 3A8KE 4KY6A 3J7A5 3KF6A 5EKLA 1O7YA 2KA7A 2E75C 3S2DB 1QUQB 4DV0L 2IHEA 4KN7C 5LL6S 1YZ6A 3OMGA 1F2ZA 1CKNA 1T5EA 1X55A 3CF5A 1JCKB 3L3OC 1H9MA 3TBIB 4DV2L 3CMAA 4K8IA 2Y0SB 3HKZE 2A68C 5IGFA 4JBWA 4QIWB 3MZ5A 3JAME 5CV6A 1NE3A 4FP5D 2Q8TA 4DV0Q 3H3VI 4DV3L 1IBKL 1B70B 2F0TA 4GOPB 3V96A 4LF7L 1WOCA 4DV2Q 3S1MB 5GAGC 4ME5A 5EPKA 4X65L 2AMCB 1O80A 3K7AB 1P8LA 1FD7D 1C9OA 1U5KA 2EY6A 4IFDH 4DV3Q 1TIID 3HGBA 1IBKQ 3P20A 2D0OA 4BA1I 5L37A 5GROA 1W6JA 4LF7Q 4A3EG 3P75A 4GOPC 1NJIC 4DR5L 1IW7D 3SHLA 1SFOB 4FXKC 2YTYA 4PZ6A 3VR3A 3FDTA 3C3LA 1PTOF 2ICEC 3A5ZB 1I6HH 5GADC 3Q0AA 1BCPB 2QEXA 3FEWX 1MD2D 4JV5Q 3U50C 2KJXA 5KGUA 2ZTCA 3MTSA 4DF7A 3PIPA 4C3JG 3RD4A 4BWGB 1B8AA 2EOTA 1N32L 4DR5Q 4IFDJ 3KBXA 4A3IG 3BDCA 2XWJB 1ESRA 1TY0A 4A3EH 3NENA 4EQNA 5HURA 4A3BG 2FMCA 2VZAA 2CFMA 1BCPC 4HEDA 2UUCQ 2R7FA 1U4RA 2KCNA 3TS2A 3AFPA 3RZOH 3BU2A 1S5DD 1SYDA 1I4XA 4C3JH 1PFMA 2HQLA 2EY2A 1LTAD 4HJ5A 3D4RA 4YWKA 4A3IH 5H1SE 2B8FA 4JI2Q 2LFNA 5KRUA 2D5DA 5COYA 1SAPA 1ET9A 4NB3A 3D4WA 3HOVB 1WD0A 3GV6A 1QG7A 3BVMA 1RKNA 2NTSA 4Y7NH 3ULLA 4LUZA 1KHIA 1VQEA 3DWAA 4TRDA 2M9VA 5JPNC 3H94A 3CCLA 1GM5A 1EY9A 1PDQA 3GTJB 2UU9L 2F0PA 1Z6HA 1CSPA 1JB3A 1YHQA 1I5FA 2NZOA 1S3OA 2MO1A 3TS0A 3LNNA 4TQUS 5IP7H 4XQJA 4DNRB 2QKIC 2XSCA 4M8AA 3M4QA 3VR2A 2IHFA 3BVZA 1VQNA 1M4VA 2F0NA 3ND9A 3JAML 4DUZL 1A3VA 2UU9Q 2EIFA 3MWYW 1LYLA 4BBSB 4QF4A 4GS3A 1V9PA 1WI5A 4MNOA 5I2YA 2E2JB 5ELOA 1HJPA 4YHHQ 4GLXA 2LY7A 3G71A 3TRZA 2WKDA 2MPMA 4IZ8A 3VR4A 3I4MH 1O7LA 4U68A 1Z7TA 1VMPA 1F9PA 4UPAA 1XJVA 4LJZC 3HOXG 1PZKD 4RGMA 3OMCA 1KAAA 1PA6A 1DOLA 3Q6SA 1GOZA 2WAQB 2BE5D 2EYJA 5BN4A 2E5LL 1JJCB 4R4IA 5C3EG 2JA7B 3E3XA 1TS4A 1FNVA 5C44H 1CA5A 3S14B 1MKHA 2VW9A 2JYOA 1PH9A 4MIUA 3NBHB 5JEAG 3HZXA 3PSIA 1QNUA 1HR0L 1DCZA 2VQEL 2E5LQ 1G91A 2F0KA 4ZRZA 4KK7A 2K5WA 2B2UC 4DAYB 2OQKA 2QGQA 4JI6Q 2JE6I 3KLSX 1Z9FA 1F2LA 1S40A 1JQYD 1AH9A 2A74C 1VQ6A 4B3SL 2PZWA 1SYBA 2BDOA 2FMMA 2O2LD 5JJKA 1VQLA 5FOBB 5ISRA 1EYCA 1PZJD 5JEAH 3NBIA 3CU7A 5GAHC 3MFGA 4P74A 3MVVA 3R2IA 1Y1WG 1EIYB 4NXML 1DOKA 4DGZA 3VYRA 3S1RB 4B3SQ 4C1NK 3OIQA 1HNZL 3S15B 2MQHA 1H95A 2CH4W 4A3KG 3PUWA 2KVMA 3STBD 1PH1A 2EJMA 3CW2C 3V05A 1EZ8A 2V1CC 2WACA 1EOVA 2LMCB 5M3MG 4DR7L 4NXMQ 3E5SA 4K2LA 5I4DA 3CCUA 2J4XA 3HOYG 1I50H 4GN3B 1Y1WH 4KKUA 3SVMA 4OWXB 4XIGS 2KCCA 1MJCA 1STBA 1GVPA 2K52A 1QWYA 2HHHQ 4DR7Q 1KLUD 4A3KH 1JR0D 3RNUA 3ITPA 1PVOA 1XTDA 3WWVA 1EY5A 3CP0A 2IJ0A 4C3HG 2XN9C 3TMEA 2KHSA 4FF1A 2EJGC 3E9HA 3NTIA 3U4ZA 2JP1A 2BA1A 1S5BD 1I94L 5KYIA 3F1ZA 2NN6H 3S1NH 4ZUJA 1SNOA 1V1PB 3GTGH 2F0WA 2HQEA 3ULJA 2AQ3B 4QUFA 4C3HH 1H9SB 1XWEA 2K03A 5ELFA 3CCJA 2HCIA 2JEAI 4QMGA 1JE4A 4A3GG 4MTKA 2K28A 2ZJRA 1TWHH 2SNSA 5CC4A 3L2PA 1IBLL 4JCVE 2AUJD 1VQ7A 3G4SA 1VQ9A 3ICEA 4AYBG 2UXDL 1IKMA 3K80C 3KJPA 3A54A 3IRBA 4R8NA 3K81C 3GTQB 3VYUA 3FHWA 4LFBL 2L1BA 5M3FG 4GKKL 2ZXOA 3DWPA 3NE5B 4ABNA 1NCVA 4A3JH 1NAPA 1EWCA 2ZJPA 1N8RC 1IBLQ 1YHAA 1HTLD 1G2SA 1OXXK 4JI8L 5DLQE 2UXDQ 4A3GH 4N8X1 1FR3A 2EE1A 5D3IB 4DA2A 4LF6L 1K73C 3CCVA 4POFA 2UXBL 1E1OA 2B2YA 1BUVT 2C9OA 5A35A 1I6HB 3D4DA 3R93A 1CTMA 3KDFB 2EPBA 1JOKA 4JI8Q 5M3FH 3WOEA 3N52A 2K6AA 4DUYL 2NTTA 1Q82C 4LF6Q 5EBCA 2VB2X 2NZHA 5IWAQ 5IYDG 1B1ZA 2Z4HA 3J81j 4OWTB 4A3EB 3J81E 1G8ZD 2KHJA 4HIDA 1NUCA 5AFWA 4YCVA 3DXJC 3NQIA 1I4QA 2F0LA 4DUYQ 1EOTA 1K28A 2UUAL 4A3DH 1C7YA 2BDNA 1RTNA 3RZOB 4DR6L 4C3JB 1X3QA 4KHPL 1MIUA 4IPDA 1PZID 1EU4A 1EFID 4A3IB 1U4MA 3NTHA 5IYDH 1LUZA 1Q86C 3TSSA 1AZPA 1LTTD 1YVCA 4G4KA 1PYSB 4DKAC 5C3XA 1IHZA 1L0YB 1TR5A 2K5DA 2A5HA 4DR6Q 3K0XA 4KHPQ 1QUQA 2L4NA 2WKCA 2YTVA 1SYEA 2Z1CA 4Q5VA 3CXCA 2JN4A 1GKHA 4NDXA 1J5EL 5I2XA 3WOFA 4FDBA 5C0XI 3CHBD 3H3VC 2YTXA 5FLXc 4QCLA 4I7ZC 4K0KQ 2PZUA 5GAEC 3D8GA 3GTLH 5C4XG 4OIKA 3PO3H 1M1KC 1J5EQ 5CV7A 3L0OA 4MTNA 2JEBI 1V1QA 5KIXA 1TWCH 1X65A 5ELCA 3A8IE 1TWAB 1MGSA 1LTLA 1ZKOA 4N9TA 4X3SA 1K83B 3MEHA 3F2BA 2NVXB 1SEBD 2JA8H 4KKSA 5DNFA 1K3BC 1GHKA 4JVZA 2IX0A 1HZCA 1DXMA 2VS1A 2JSOA 4R9WA 4RCOA 1EQTA 3K5MA 5C4XH 1RDPD 4X6AH 1MBYA 4OIJA 4DXGA 1Q1BA 3K5OA 1C0AA 4A3FH 2MJ8A 4L6TB 2CKZB 3RZDH 2K33A 2XRSD 2WIIB 5E1FA 2I0QA 3IAYA 2I07B 5IYCG 1GJXA 2PZTA 1L0WA 4E6IA 1ML0D 3OWEB 2Q2IA 1NR4A 1SYFA 2JA7G 3PF5A 2QDLA 5C0XG 3R2TA 5FLMG 1STAA 4ZUIA 4HMIA 5I6YA 2RBMA 1HZBA 2JA9A 2QEJC 2SOBA 2Y0SE 4JI1L 3J81L 2M2LA 1U9RA 4KHVA 1IBML 1SYCA 4HMJA 2E2HH 1HTPA 3Q23A 2FFKB 5C3EB 5JOBA 4OO1H 5IYCH 3Q8DA 2A6EC 1B44D 4IOAA 4HJ9A 1VF7A 4JI1Q 2A69D 1J6QA 1PXUA 4IPCA 2B2WA 2HD3A 3KOJA 5CMDA 3H0GG 1RIPA 1I4PA 3EVQA 2Z4IA 4X62Q 1Q7YC 4C1NI 1N9WA 3S16H 2OT2A 1EWIA 1AZQA 4V0BA 2GVBA 1YNXA 2JJQA 1I4HA 1AW7A 2BH2A 4JI5L 3BDLA 4JBJA 2XRQD 3OPOA 1I50B 2NYZD 1Y1WB 4JBMA 1BQQT 5FO9B 1CKOA 3TDQA 1W2BA 1J9OA 3H0GH 1VQOA 3SGIA 4I65A 1VQDA 4A3KB 1EU3A 4L8JA 1YJ9A 1WTXA 4NW2A 2IX1A 5M3MB 2VB3X 2BA0A 3T1HL 1KC8C 3CKIB 1Z47A 2ES2A 4LF8L 2O5IC 4IFDI 3UE0A 4LUOA 3C2PA 1YNJD 5DM63 2DY8A 4UY8C 3J7AV 1Q8IA 2OTJA 1KL9A 1SE8A 3CPFA 4AH6A 3P7JA 1I3QH 3EQLC 1X3PA 3S1NB 3T1HQ 4LF8Q 2XNAC 5DAUA 4GKJQ 1CZWA 4B3MQ 3GTGB 3HFZB 3UDXA 4IUNA 1T5XD 3MXNB 1C8CA 1D5MC 4LF4Q 3I2ZA 4C3HB 5AJ3Q 4UP8A 1LTID 2N8NA 2L12A 3I90A 1VQ4A 2AQ2B 1BBXC 5FK9C 1TWHB 4X3KA 1D1KA 4A93H 4K8JA 2NVTH 4DAYA 3UDIA 3NELA 5IGDA 1LV9A 1Q3LA 2WB1E 4IUPA 1D2BA 1VF5C 2X6LA 4DV7L 2E2DC 5EJWA 1EYAA 2IX3A 4F88A 1GUGA 1VQAA 2Q8RE 1AFPA 1FNWA 3K7UC 5F2DA 1AE3A 1TS5A 1B3AA 3QJYA 4A3GB 1EIFA 4IFDG 2F0IA 2G9DA 2KQ3A 1SBBB 3K59A 2RCFA 2J0TD 2R92G 1A3UA 2JQOA 4R1JA 1Y1VG 3KLRA 5M5WH 4DV7Q 1GUNA 1PH5A 3KLWA 4GNXA 4AYBB 2F4VQ 1DJRD 3M9BA 3SE0A 3S2HB 2IWHA 1PRTD 2ID0A 3R3OA 1KDBA 5M3FB 3NXWA 2AWNA 2PMZB 5J3BA 3H6MA 2WV6D 2PPBC 3BZCA 2E8GA 1HNWL 2R3ZA 1E7ZA 4CHTB 2OTLA 2EZVA 2R92H 3AB9A 3HKSA 1Y1VH 4JV5L 4PZ7A 1EIGA 4GLVB 2CVRA 1JORA 1WTPA 1HNWQ 3I91A 3J80i 5FO7B 3HOZH 3JAMc 4PQXA 4IUVA 1WCMH 2YU9H 1UE1A 3CRKC 4IN3A 3C1FA 1F2MA 3LX0A 4FNFA 1X3EA 1XX8A 1TXYA 3LWEA 2A73B 2UUCL 4TSSA 2C5CA 4R4OA 4BBRH 5FO8B 1JOQA 1LABA 1O78A 3Q22A 3GTPB 5D14A 1M8AA 1I4GA 2C35B 2K05A 1SLJA 2NBFA 3J80c 1MI2A 3VYTA 2RCNA 1AN8A 3IKJA 3PUVA 4JI2L 1YNND 3KLSA 4DFAA 5KNCA 4LF5Q 4R8IA 4WJ3M 1XYIA 4G7OC 4HAEA 1KLGD 2EY1A 3P1HA 2NVYH 3M4YA 4XQQA 3CQZH 4JW0A 4DV5L 1Q46A 3I56A 2K32A 4GN5A 1NR2A 1PFSA 4FO2A 4U673 3GTLB 4H44C 5IP7G 1CQFA 5GQOA 1RL2A 1CQVA 2A6HD 3DEOA 3M4OB 3SK8A 1N36Q 1XPUA 1LM0A 3FKIG 2VNUD 4RHRA 2A1AA 5EPJA 3QWNA 1L1OA 4OHJA 4DV5Q 4QY7A 1UE7A 5CBEE 2Z9HA 3QOJA 2JA8B 1BF4A 1HR0W 2CH4A 2VUMH 4RMFA 4F7XA 1WTQA 2F0EA 4CDDC 1CA6A 3I4MG 5C4XB 2A19A 2OQ0A 2R93H 4YHHL 3FKIH 3RZDB 3OWFA 3PGZA 4G57A 5IIFA 3NUCA 1HZ9A 4RFBA 1PTOB 1ZXTA 1SJED 4CDFC 4HIKA 3QR8A 1DM0B 2QF7A 1XNQL 3M3YH 1IL2A 1K3RA 5HY6A 4HR7B 1JC7A 3G7LA 1JE5A 1KTKA 1YI2A 4A3LG 3K0YA 2XVSA 2PQAA 5C44G 2LSSA 5FKAC 1UNSA 2E76C 3D6CA 1TY2A 1RD9D 1EEFD 4L5SA 2UXCQ 1PTOC 3A55A 1XNRL 2B2TA 1UUPA 4DAVA 1XNQQ 5C4JH 5I9OA 1STNA 3NTKA 3PV0A 4EQOA 1ENFA 2X69A 1OXSC 1RHPA 3HKZB 3NWSA 4DV6L 4LAAA 5EBDA 1S5CD 3UE1A 4A3LH 1XNRQ 4IUQA 2RSOA 4JI6L 2N3SA 1XXGA 3NQTA 2BOSA 1VS0A 4XXEA 4DU9A 4DPGA 2Z6KC 5BN3A 4RGNA 4AIMA 4DV6Q 4JBKA 1EY8A 5HGTA 2Q8IB 1ZYRD 1TT2A 3E0JA 2ATWA 3EN2A 2N55A 3NHHA 1PRTF 1RJTA 2NN6I 3D0FA 3T16A 4DAMA 2XWBB 1C4QA 2RVLA 1SMYD 1KABA 2QDBA 4MN3A 2RKSA 2B39A 4UAIA 1ENCA 2R6GA 3AYHB 3PCOB 4RGOS 1AEXA 2B2VC 2K1BA 1X54A 4J8QA 3H0GB 2Q2TA 5JVG3 2LS01 4F8MA 4C56C 4AQYL 3ER0A 5JVH3 3DMUA 2MP1A 1EIHA 1SNCA 4LMQD 3H09A 5CORA 1D1IA 1UEBA 4WORA 2IW3A 3KF6B 2A6ED 1H9KA 1YHBA 3FPPA 5IP9H 1ENAA 3W1GA 4A4IA 1CKNB 2F0OA 4RGTA 3SDZA 4YY3L 5LMNW 2HHHL 3S24A 1KRSA 4C2MH 4ZYSA 4AQYQ 4N8FA 1STEA 1V8QA 1YJWA 3CC2A 1I3QB 4BY7H 3TP6A 2N49A 1RTOA 3E6ZX 1QE6A 2L5TA 1YBYA 4YY3Q 3RLFA 2LXJA 2NN6G 3HEJA 2R7DA 4K5XA 4B3TL 2JK8A 2ZT9C 2ZXRA 5E4XA 2OEOA 3S1QH 1WD1A 1EFWA 3PO2H 4X3TA 5IGBA 4OONA 3GTMH 5JPMC 4B3TQ 1GHJA 1VMCA 3IFTA 1ICWA 1TS2A 1G6PA 5IODA 3VR6A 1SDFA 4BY1G 3GV3A 4ZKCB 4WJ4A 2CWAA 1UWVA 3BVGA 2RF4A 4RG1A 3A7AB 2MFIA 4JI0L 4BXXG 3HOWH 2AHOB 2PI2A 3MXUA 4A3JG 4A3MG 1KXLA 1PFNA 2MHVA 4B3RL 5BN5A 3VA7A 5IGEA 5M5WB 4ILWA 2UUBL 2IL8A 3GD7A 4HCEA 5C4ZA 3NWTA 1S4ZA 1HA5A 4MHEA 1KD1C 2CW0D 1BBWA 4JI0Q 1N33L 2K5QA 1PMRA 4BY1H 4L5TA 4B3RQ 3F2CA 2UUBQ 5EAYA 1WTRA 2DNCA 1B53A 4BXXH 2AWOA 2K75A 4DR3L 4A3MH 1VQKA 1HFNA 2R92B 2H1EA 5E3FA 1Y1VB 3I73A 1VQFA 3K57A 4PNYA 2GN5A 3MA2B 4ODGA 5J1ZA 2JA6G 1ESFA 1N33Q 4XQNA 4EQ5A 1XPOA 5IT9E 4HJ8A 3CCEA 1OO9B 1E3PA 4KN4C 1IW7C 4DK6C 1BR9A 4CJ0B 3FP9A 1FYCA 5IWAL 1IZ6A 4NXNL 3HOZB 1WCMB 2YU9B 4DR3Q 4OL7A 1LO5D 4A3DG 3TEHB 3VDYA 4G7ZC 3S2DH 2NVQH 1EUJA 3FPUB 4CDCC 2A8VA 1F9SA 3CCSA 1L2FA 1CFMA 2JA6H 2A68D 1CHPD 4NXNQ 1B7YB 1TQOA 1JB7A 2ZTEA 1SXTA 3MXGA 4JOIC 4EQPA 1VQCA 3DUZA 3I4OA 2Q2UA 4ALPA 1GUOA 2PI2E 3S1MH 4FF4A 1QVCA 2D62A 1SYGA 3AU7A 3GO5A 3ERSX 2EDGA 3UDFA 1IYVA 2NVYB 2K04A 5E4WC 1C48A 3A5UA 1LTGD 3IL8A 3RR5A 1QZHA 2MGSA 4YCWA 1YIJA 1ONLA 5D3DA 2F0HA 1E24A 5CGKA 2BH8A 4IQZA 5EKIA 3J81c 4Y7NB 1M90C 3PO3G 1VQPA 1EY7A 4GLAC 1MSGA 3F2DA 1Q81C 4K0KL 1WVLA 2I46A 3SEBA 2EXDA 3BDOA 5FLXE 1O7ZA 4OO1I 4CJ1B 4PMWA 4IOCA 1LT4D 4XYOA 4LF9Q 1PYBA 2XTIA 4QQBX 4UP9A 3M85A 2JA8G 2JA5G 3CCQA 5CYUA 1W3SA 2K5HA 3K6OA 3FKIB 4GOPA 2RDGA 3NP8A 4Z9CB 2VL6A 1BCPD 3CAMA 4A3FG 3UI2A 4O42A 1FJGQ 3M3YB 4IJHA 3GTKH 2PW5A 4QJFA 3NPPA
chains in the Genus database with same CATH topology
1I5FA 1VQ4A 2NZOA 3HOYH 1S3OA 3JC66 2MO1A 2JA5H 3TS0A 4TQUS 1U0LA 5IP7H 4A93H 2NVTH 2DGYA 1JMCA 3M4QA 2IHFA 2I5HA 3I4NG 3UDIA 3NELA 4NPSA 1VQNA 3PUXA 2WB1E 4DUZL 3PIOA 2UU9Q 3KF8B 4DV7L 3UDGA 2EIFA 1LYLA 4A3CH 1GD7A 4PZ8A 1VQAA 1WJJA 3AFQA 3HKZG 4GS3A 1V9PA 1WI5A 3K7UC 4OO1G 3GTJH 4MNOA 1JJGA 1VQ5A 1HNXL 1AE3A 5ELOA 1HJPA 1D8LA 4YHHQ 4GLXA 3G71A 1EIFA 4IFDG 3TRZA 1I94Q 2R92G 3I4MH 2Y0SG 2JQOA 4R1JA 1Y1VG 2CQOA 5M5WH 4DV7Q 3D31A 4GN4B 4R4QA 4DR1L 1PH5A 1N34L 5LMNL 2I5LX 3KLWA 4GNXA 3I4NH 2F4VQ 4UPAA 3M9BA 4P75A 3HOXG 1XJVA 1KQSA 4LNQA 2ID0A 2KHIA 1PA6A 2FXQA 1HNXQ 2K5NA 4QIWE 2AWNA 5J3BA 4BBSH 1G51A 2HIVA 3BZCA 2E8GA 2E5LL 1JJCB 4J15A 4R4IA 5C3EG 4HJ7A 4DR1Q 1N34Q 1E7ZA 1O7IA 1L1OB 1SRUA 5LMNQ 4LW1A 1VQ8A 4P71A 2Z0SA 4X62L 2OTLA 3OW2A 5C44H 2KENA 2R92H 3BZKA 1MKHA 3HKSA 2VW9A 1Y1VH 3CCMA 1PH9A 1QZGA 4JV5L 5JEAG 3NBHB 3PSIA 4PZ7A 4LFBQ 2WFWA 4GKKQ 1CUKA 4GLVB 3OTOQ 1HR0L 1GO3E 3W1BA 3S2HH 2VQEL 1NMGA 2E5LQ 1HNWQ 3J80i 3HOZH 2LXKA 5IT9c 3JAMc 4DAYB 1XPRA 2OQKA 2QGQA 1WCMH 2JE6I 2YU9H 1UE1A 1Z9FA 1S40A 4JI6Q 3J81i 1L1OC 3STBC 1AH9A 4JI4Q 1VQ6A 4B3SL 1VQJA 3K7AH 2ZJQA 1X3EA 1TXYA 5JJKA 2OWOA 2AKWB 2UXBQ 1VQLA 2UUCL 3S17H 4R4OA 1VQGA 4BBRH 3S14H 4DV1Q 3RN2A 1S72A 5GAHC 1PH4A 1SROA 2C35B 4P74A 1Y1WG 4JYAL 1SLJA 1SN8A 2PQAB 3J80c 1EIYB 5FJ8G 1T9HA 4L5QA 1BKBA 4NXML 1OXUA 4POGA 4LF9L 4KI0A 4B3SQ 1X3FA 2RCNA 3PUVA 1SFOH 4JI2L 5IYBG 1HNZL 3GTOH 2MQHA 1H95A 2DUDA 4A3KG 3PUWA 3STBD 1PH1A 4LF5Q 4WJ3M 3CW2C 3CC4A 4XTCS 3KYHC 2V1CC 5IE8A 1EOVA 2B3GA 4JYAQ 4LWCA 1X9NA 1JT8A 1X3GA 5M3MG 2NVYH 4DR7L 4YCUA 4NXMQ 1PH7A 3CQZH 1OXTA 3G48A 1E1TA 4LUVA 3A0JA 4PG3A 4DV5L 1Q46A 2UUAQ 4B3ML 3I56A 3HOYG 3CCUA 1FJGL 3GTPH 1I50H 4GN3B 4GN5A 1PFSA 1Y1WH 4Y52H 4OWXB 1NTGA 4XIGS 5FJ8H 5IP7G 5GQOA 4LF4L 1RL2A 3RLOA 5AJ3L 4OX9L 3KFUA 4A93G 1N36Q 3HOVG 1X6OA 1MJCA 1LM0A 3FKIG 1XPUA 5IYBH 2VNUD 4BA2I 1A8VA 1GVPA 2K52A 3DLLA 1OTCA 4IJLA 1BBUA 2A1AA 2HHHQ 4OWWB 1K9MC 3PF4A 4DR7Q 4K0KQ 4A3KH 1L1OA 2R7ZG 4DV5Q 4QY7A 3RNUA 1PVOA 1UE7A 3G6EA 4JI3L 1XTDA 1IXRA 3WWVA 4OX9Q 3CP0A 1HR0W 2IT1A 4X64L 1Q8KA 3GDEA 2VUMH 4DNIA 4RMFA 2WB1G 3I4MG 3DM3A 4R4TA 2A19A 2YYZA 2OQ0A 3E9HA 4OXPA 3U4ZA 1UE5A 2R93H 2VY3A 3HOVH 4YHHL 4JI3Q 3M4OH 3FKIH 3PGZA 1HZ9A 2B29A 2BA1A 1NMFA 1I94L 3F1ZA 4LFAQ 4QGUA 3S1NH 3RLNA 2R7ZH 2L15A 1EQRA 4X64Q 1VQBA 2F4VL 4HIKA 3GTGH 4BBSG 1XNQL 4H02A 4X66Q 1D7QA 3PUYA 1HNWL 3M3YH 1IL2A 3EIVA 1K3RA 5HY6A 3ULJA 3CPWA 1HH2P 1JE5A 2K4KA 4C3HH 1YI2A 4HJAA 4A3LG 2JEAI 3CCJA 1XMOL 2PQAA 5C44G 2LSSA 1Y14B 4A3GG 5K36G 5M5XH 4A75A 1ASZA 2ZJRA 4HIMA 1TWHH 1XMQQ 4L5SA 2UXCQ 4ME3A 4JC0A 1IBLL 2ZTDA 3L2PA 4JCVE 1XNRL 1PH8A 1VQ7A 3G4SA 1VQ9A 3ICEA 1K0RA 4AYBG 1XNQQ 3K80C 5C4JH 3KJPA 2UXDL 5JJIA 3IRBA 3OYYA 1K8AC 3PV0A 4HIOA 1OXSC 3K81C 3HOZG 3FHWA 4DV6L 1IYJB 4UP7A 4LFBL 5M3FG 1WCMG 3M4PA 1XMOQ 3HOUH 4GKKL 4AYBE 3JAMi 3OTOL 2WAQG 3UE1A 4DK3C 3AEVA 4A3JH 3L7ZC 3W5OA 1G291 2ZJPA 1N8RC 1IBLQ 1YHAA 2E2JH 1XNRQ 4A3LH 1VCIA 4JI8L 3F8TA 1OXXK 2N3SA 5DLQE 4JI6L 2PMZE 4A3GH 4JI7L 2UXDQ 4BBRG 1VS0A 1WYDA 3KJOA 1TWGH 2WAQE 4JI4L 4DPGA 2RHQB 2Z6KC 4TVAB 2B63H 2K5VA 2F3IA 4LF6L 2ALYB 4AIMA 4DV6Q 4JBKA 1K73C 3CCVA 4POFA 2UXBL 1E1OA 2ATWA 2RHSB 3EN2A 4DV1L 3KDFB 1PV4A 3GTQH 2NN6I 2OCEA 1EQQA 4JI8Q 5M3FH 1PH2A 4JI7Q 3D0FA 1EYGA 4DUYL 4DAMA 3I55A 2I5MX 1Q82C 4LF6Q 2NZHA 2JA7H 1JJ2A 5FLMH 5IWAQ 3T1YL 5IYDG 3AYHB 2R6GA 2EQSA 3PCOB 4O2DA 4OWTB 3J81j 1IBMQ 4LF5L 2KHJA 4HIDA 4X65Q 4GKJL 1P16A 3RN5A 1X54A 2Q2TA 4YCVA 4LFCL 4DUYQ 4AQYL 2VQFL 4JG2A 3ER0A 2UUAL 4A3DH 1FVIA 1C7YA 4DR4L 1MJEA 3MEFA 3T1YQ 1A63A 1UEBA 4DR6L 3E0EA 3KF6B 2E2IH 2HT1A 4KHPL 1N36L 1YHBA 1MIUA 4IPDA 5IP9H 2XGTA 4A4IA 3W1GA 3ZJYC 5IYDH 1LUZA 1CKNB 4YY3L 5LMNW 2HHHL 4LFCQ 5C0XJ 1OXVA 2F52A 1HZAA 1KRSA 1YVCA 3S24A 4C2MH 2VQFQ 4AQYQ 1Q86C 1QVGA 1PYSB 2D0PA 4DKAC 2Z6KA 2VUMG 1VQMA 4DR4Q 1FGUA 2KCMA 5IY0A 1YJWA 3CC2A 4DR6Q 5HGQA 4BY7H 2R93G 3K0XA 4KHPQ 1QUQA 4DR2L 3CC7A 2CWPA 2YTVA 3TQYA 1NBWA 2N49A 3S1RH 3A74A 4KLKA 3E9IA 1N32Q 3S15H 1E22A 1YBYA 3U4VA 4YY3Q 4JI5Q 3RLFA 2LXJA 5M5YH 2NN6G 2GVAA 2R7DA 4B3TL 3CXCA 1GKHA 4IPGA 1J5EL 2IY5B 2JK8A 4IPHA 4FDBA 5C0XI 4LFAL 1WFQA 1YEZA 1UE6A 4DR2Q 3S1QH 1V43A 4EX5A 2YTXA 3CMEA 5BR8L 5FLXc 1EFWA 5JJLA 2KBNA 3PO2H 4X66L 1Q12A 4JOIA 1A0IA 4OONA 4P73A 5GAEC 4A3BH 1CSQA 3GTMH 3GTLH 3H3VH 5C4XG 4B3TQ 2K14A 3U58A 3KDFA 1M1KC 1K8GA 3PO3H 3CCRA 1J5EQ 3L0OA 4MTNA 1ASYA 1G6PA 3K8AA 2JEBI 1V1QA 4BY1G 1TWCH 1X65A 4YWMA 1XMQL 1QVFA 2UXCL 2CWAA 4WJ4A 1YJNA 1UWVA 3HOUG 1LTLA 2RF4A 1TWFH 4RG1A 5BR8Q 2MFIA 4JI0L 4A76A 1X56A 4BXXG 3HOWH 1YITA 2AHOB 2PI2A 3F2BA 4A3JG 1KAWA 4A3MG 1KXLA 2JA8H 4B3RL 4KHZA 2UUBL 2IX0A 1HZCA 3GD7A 2VS1A 2H5XA 4R4CA 2B63G 5C4XH 3B6YA 4YWLA 4X6AH 2MO0A 1Q1BA 1C0AA 1A62A 2KCTA 1SR3A 4A3FH 1KD1C 1BBWA 2CKZB 5ELNA 4JI0Q 3RZDH 1N33L 3J7A5 3KF6A 4BY1H 4L5TA 4B3RQ 2I0QA 3F2CA 1QUQB 4DV0L 2IHEA 2UUBQ 5EAYA 1TWAH 1YZ6A 1CKNA 3EBEA 5E7NA 5IYCG 1BVSA 4BXXH 1X55A 3CF5A 2AWOA 2K75A 1L0WA 1K83H 4DR3L 2Q2IA 4DV2L 4A3MH 3CMAA 1VQKA 2NVXH 2JA7G 3PF5A 3HKZE 1VQFA 5FLMG 5C0XG 4DUZQ 2GN5A 2JA6G 4JBWA 1N33Q 4EQ5A 1XPOA 4HJ8A 1HZBA 1NE3A 2JA9A 3CCEA 1E3PA 2ASBA 4DV0Q 1NY4A 3H3VI 2Y0SE 4JI1L 4DK6C 4APVA 4DV3L 5IWAL 1IBKL 3FP9A 1IZ6A 1B70B 3NEMA 4NXNL 1IBML 4DR3Q 4GOPB 2E2HH 4LF7L 1WOCA 4DV2Q 4A3DG 5GAGC 3TEHB 4X65L 3VDYA 3M7NA 2AMCB 2QA4A 3S2DH 1P8LA 5IYCH 2NVQH 3Q8DA 1EUJA 1C9OA 2A8VA 1U5KA 2ZM6L 3CD6A 3CCSA 1L2FA 1DGSA 4IOAA 4HJ9A 4DV3Q 4JI1Q 5IP9G 1IBKQ 2JA6H 2PNHA 2D0OA 4BA1I 4NXNQ 1CKMA 5GROA 4LF7Q 1B7YB 1JB7A 1J6QA 2ZTEA 4A3EG 4IPCA 3HOXH 4JOIC 3KOJA 4GOPC 1NJIC 3I7FA 4DR5L 1KRTA 3J7ZC 1RIPA 1VQCA 3H0GG 3I4OA 1Q1EA 2YTYA 2WP8J 4PZ6A 2Q2UA 1PHJA 4BY7G 4X62Q 4ALPA 2ZM6Q 3A5ZB 1Q7YC 1I6HH 2PI2E 5GADC 1PH3A 1N9WA 3S1MH 1FL0A 1QVCA 2CCZA 2D62A 3S16H 5C3EH 2QEXA 4JV5Q 3GO5A 1EWIA 3ERSX 3U50C 2GVBA 1VQHA 1YNXA 2ZTCA 3UDFA 3PIPA 1HR0Q 2JJQA 1B8AA 2HIXA 2VQEQ 4DR5Q 2BH2A 3PUZA 3A5UA 4JI5L 4A3IG 1PH6A 4JBJA 4IFDJ 3RR5A 4LF8L 4JBMA 1QZHA 3ULPA 4IFDI 1AE2A 4YCWA 4A3EH 1YIJA 1CKOA 1E24A 1VQIA 3PO2G 1W2BA 3NENA 5LMUL 2BH8A 3H0GH 4IO9A 4A3BG 2VZAA 1VQOA 3J81c 2CFMA 3TREA 3SGIA 1M90C 1KIXA 4GNXB 1VQDA 3PO3G 2YV5A 2UUCQ 1VQPA 2R7FA 4GLAC 3H15A 3TS2A 1R9TH 3F2DA 3BJUA 4P72A 1Q81C 4K0KL 1YJ9A 3AFPA 3RZOH 2IX1A 3BU2A 4OO1I 2EXDA 1N32L 4C3JH 2BA0A 1SMXA 2HQLA 4PMWA 4IOCA 3T1HL 1Z47A 4QL5A 4HJ5A 1KC8C 4YWKA 1PYBA 2XTIA 2ES2A 2MNAA 5LMUQ 4DV4L 4MZ9A 4A3IH 4LF9Q 3HOWG 4QQBX 3UE0A 4UP9A 4LUOA 4JI2Q 5H1SE 3M85A 1HNZQ 2JA8G 5JEAJ 2JA5G 4UY8C 2N78A 3CCQA 4NB3A 1W3SA 2OTJA 4GNXC 2K5HA 2K50A 1KL9A 3AQQA 1SE8A 3CPFA 4AH6A 4GOPA 1I3QH 2VL6A 2Q2HA 4C3IH 4Y7NH 3CAMA 4A3FG 3ULLA 4LUZA 3T1HQ 1KHIA 1VQEA 4LF8Q 4GKJQ 4DV4Q 4B3MQ 4O0AA 3HFZB 3CCLA 4A3CG 3UDXA 1FJGQ 1GM5A 4IJHA 3GTKH 3MXNB 5M3MH 4LF4Q 3I2ZA 2UU9L 4QJFA 3LGJA 5AJ3Q 4UP8A 1CSPA 4L5RC 1YHQA 2N8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5F A;  1VQ4 A;  2NZO A;  3HOY H;  1S3O A;  3JC6 6;  2MO1 A;  2JA5 H;  3TS0 A;  4TQU S;  1U0L A;  5IP7 H;  4A93 H;  2NVT H;  2DGY A;  1JMC A;  3M4Q A;  2IHF A;  2I5H A;  3I4N G;  3UDI A;  3NEL A;  4NPS A;  1VQN A;  3PUX A;  2WB1 E;  4DUZ L;  3PIO A;  2UU9 Q;  3KF8 B;  4DV7 L;  3UDG A;  2EIF A;  1LYL A;  4A3C H;  1GD7 A;  4PZ8 A;  1VQA A;  1WJJ A;  3AFQ A;  3HKZ G;  4GS3 A;  1V9P A;  1WI5 A;  3K7U C;  4OO1 G;  3GTJ H;  4MNO A;  1JJG A;  1VQ5 A;  1HNX L;  1AE3 A;  5ELO A;  1HJP A;  1D8L A;  4YHH Q;  4GLX A;  3G71 A;  1EIF A;  4IFD G;  3TRZ A;  1I94 Q;  2R92 G;  3I4M H;  2Y0S G;  2JQO A;  4R1J A;  1Y1V G;  2CQO A;  5M5W H;  4DV7 Q;  3D31 A;  4GN4 B;  4R4Q A;  4DR1 L;  1PH5 A;  1N34 L;  5LMN L;  2I5L X;  3KLW A;  4GNX A;  3I4N H;  2F4V Q;  4UPA A;  3M9B A;  4P75 A;  3HOX G;  1XJV A;  1KQS A;  4LNQ A;  2ID0 A;  2KHI A;  1PA6 A;  2FXQ A;  1HNX Q;  2K5N A;  4QIW E;  2AWN A;  5J3B A;  4BBS H;  1G51 A;  2HIV A;  3BZC A;  2E8G A;  2E5L L;  1JJC B;  4J15 A;  4R4I A;  5C3E G;  4HJ7 A;  4DR1 Q;  1N34 Q;  1E7Z A;  1O7I A;  1L1O B;  1SRU A;  5LMN Q;  4LW1 A;  1VQ8 A;  4P71 A;  2Z0S A;  4X62 L;  2OTL A;  3OW2 A;  5C44 H;  2KEN A;  2R92 H;  3BZK A;  1MKH A;  3HKS A;  2VW9 A;  1Y1V H;  3CCM A;  1PH9 A;  1QZG A;  4JV5 L;  5JEA G;  3NBH B;  3PSI A;  4PZ7 A;  4LFB Q;  2WFW A;  4GKK Q;  1CUK A;  4GLV B;  3OTO Q;  1HR0 L;  1GO3 E;  3W1B A;  3S2H H;  2VQE L;  1NMG A;  2E5L Q;  1HNW Q;  3J80 i;  3HOZ H;  2LXK A;  5IT9 c;  3JAM c;  4DAY B;  1XPR A;  2OQK A;  2QGQ A;  1WCM H;  2JE6 I;  2YU9 H;  1UE1 A;  1Z9F A;  1S40 A;  4JI6 Q;  3J81 i;  1L1O C;  3STB C;  1AH9 A;  4JI4 Q;  1VQ6 A;  4B3S L;  1VQJ A;  3K7A H;  2ZJQ A;  1X3E A;  1TXY A;  5JJK A;  2OWO A;  2AKW B;  2UXB Q;  1VQL A;  2UUC L;  3S17 H;  4R4O A;  1VQG A;  4BBR H;  3S14 H;  4DV1 Q;  3RN2 A;  1S72 A;  5GAH C;  1PH4 A;  1SRO A;  2C35 B;  4P74 A;  1Y1W G;  4JYA L;  1SLJ A;  1SN8 A;  2PQA B;  3J80 c;  1EIY B;  5FJ8 G;  1T9H A;  4L5Q A;  1BKB A;  4NXM L;  1OXU A;  4POG A;  4LF9 L;  4KI0 A;  4B3S Q;  1X3F A;  2RCN A;  3PUV A;  1SFO H;  4JI2 L;  5IYB G;  1HNZ L;  3GTO H;  2MQH A;  1H95 A;  2DUD A;  4A3K G;  3PUW A;  3STB D;  1PH1 A;  4LF5 Q;  4WJ3 M;  3CW2 C;  3CC4 A;  4XTC S;  3KYH C;  2V1C C;  5IE8 A;  1EOV A;  2B3G A;  4JYA Q;  4LWC A;  1X9N A;  1JT8 A;  1X3G A;  5M3M G;  2NVY H;  4DR7 L;  4YCU A;  4NXM Q;  1PH7 A;  3CQZ H;  1OXT A;  3G48 A;  1E1T A;  4LUV A;  3A0J A;  4PG3 A;  4DV5 L;  1Q46 A;  2UUA Q;  4B3M L;  3I56 A;  3HOY G;  3CCU A;  1FJG L;  3GTP H;  1I50 H;  4GN3 B;  4GN5 A;  1PFS A;  1Y1W H;  4Y52 H;  4OWX B;  1NTG A;  4XIG S;  5FJ8 H;  5IP7 G;  5GQO A;  4LF4 L;  1RL2 A;  3RLO A;  5AJ3 L;  4OX9 L;  3KFU A;  4A93 G;  1N36 Q;  3HOV G;  1X6O A;  1MJC A;  1LM0 A;  3FKI G;  1XPU A;  5IYB H;  2VNU D;  4BA2 I;  1A8V A;  1GVP A;  2K52 A;  3DLL A;  1OTC A;  4IJL A;  1BBU A;  2A1A A;  2HHH Q;  4OWW B;  1K9M C;  3PF4 A;  4DR7 Q;  4K0K Q;  4A3K H;  1L1O A;  2R7Z G;  4DV5 Q;  4QY7 A;  3RNU A;  1PVO A;  1UE7 A;  3G6E A;  4JI3 L;  1XTD A;  1IXR A;  3WWV A;  4OX9 Q;  3CP0 A;  1HR0 W;  2IT1 A;  4X64 L;  1Q8K A;  3GDE A;  2VUM H;  4DNI A;  4RMF A;  2WB1 G;  3I4M G;  3DM3 A;  4R4T A;  2A19 A;  2YYZ A;  2OQ0 A;  3E9H A;  4OXP A;  3U4Z A;  1UE5 A;  2R93 H;  2VY3 A;  3HOV H;  4YHH L;  4JI3 Q;  3M4O H;  3FKI H;  3PGZ A;  1HZ9 A;  2B29 A;  2BA1 A;  1NMF A;  1I94 L;  3F1Z A;  4LFA Q;  4QGU A;  3S1N H;  3RLN A;  2R7Z H;  2L15 A;  1EQR A;  4X64 Q;  1VQB A;  2F4V L;  4HIK A;  3GTG H;  4BBS G;  1XNQ L;  4H02 A;  4X66 Q;  1D7Q A;  3PUY A;  1HNW L;  3M3Y H;  1IL2 A;  3EIV A;  1K3R A;  5HY6 A;  3ULJ A;  3CPW A;  1HH2 P;  1JE5 A;  2K4K A;  4C3H H;  1YI2 A;  4HJA A;  4A3L G;  2JEA I;  3CCJ A;  1XMO L;  2PQA A;  5C44 G;  2LSS A;  1Y14 B;  4A3G G;  5K36 G;  5M5X H;  4A75 A;  1ASZ A;  2ZJR A;  4HIM A;  1TWH H;  1XMQ Q;  4L5S A;  2UXC Q;  4ME3 A;  4JC0 A;  1IBL L;  2ZTD A;  3L2P A;  4JCV E;  1XNR L;  1PH8 A;  1VQ7 A;  3G4S A;  1VQ9 A;  3ICE A;  1K0R A;  4AYB G;  1XNQ Q;  3K80 C;  5C4J H;  3KJP A;  2UXD L;  5JJI A;  3IRB A;  3OYY A;  1K8A C;  3PV0 A;  4HIO A;  1OXS C;  3K81 C;  3HOZ G;  3FHW A;  4DV6 L;  1IYJ B;  4UP7 A;  4LFB L;  5M3F G;  1WCM G;  3M4P A;  1XMO Q;  3HOU H;  4GKK L;  4AYB E;  3JAM i;  3OTO L;  2WAQ G;  3UE1 A;  4DK3 C;  3AEV A;  4A3J H;  3L7Z C;  3W5O A;  1G29 1;  2ZJP A;  1N8R C;  1IBL Q;  1YHA A;  2E2J H;  1XNR Q;  4A3L H;  1VCI A;  4JI8 L;  3F8T A;  1OXX K;  2N3S A;  5DLQ E;  4JI6 L;  2PMZ E;  4A3G H;  4JI7 L;  2UXD Q;  4BBR G;  1VS0 A;  1WYD A;  3KJO A;  1TWG H;  2WAQ E;  4JI4 L;  4DPG A;  2RHQ B;  2Z6K C;  4TVA B;  2B63 H;  2K5V A;  2F3I A;  4LF6 L;  2ALY B;  4AIM A;  4DV6 Q;  4JBK A;  1K73 C;  3CCV A;  4POF A;  2UXB L;  1E1O A;  2ATW A;  2RHS B;  3EN2 A;  4DV1 L;  3KDF B;  1PV4 A;  3GTQ H;  2NN6 I;  2OCE A;  1EQQ A;  4JI8 Q;  5M3F H;  1PH2 A;  4JI7 Q;  3D0F A;  1EYG A;  4DUY L;  4DAM A;  3I55 A;  2I5M X;  1Q82 C;  4LF6 Q;  2NZH A;  2JA7 H;  1JJ2 A;  5FLM H;  5IWA Q;  3T1Y L;  5IYD G;  3AYH B;  2R6G A;  2EQS A;  3PCO B;  4O2D A;  4OWT B;  3J81 j;  1IBM Q;  4LF5 L;  2KHJ A;  4HID A;  4X65 Q;  4GKJ L;  1P16 A;  3RN5 A;  1X54 A;  2Q2T A;  4YCV A;  4LFC L;  4DUY Q;  4AQY L;  2VQF L;  4JG2 A;  3ER0 A;  2UUA L;  4A3D H;  1FVI A;  1C7Y A;  4DR4 L;  1MJE A;  3MEF A;  3T1Y Q;  1A63 A;  1UEB A;  4DR6 L;  3E0E A;  3KF6 B;  2E2I H;  2HT1 A;  4KHP L;  1N36 L;  1YHB A;  1MIU A;  4IPD A;  5IP9 H;  2XGT A;  4A4I A;  3W1G A;  3ZJY C;  5IYD H;  1LUZ A;  1CKN B;  4YY3 L;  5LMN W;  2HHH L;  4LFC Q;  5C0X J;  1OXV A;  2F52 A;  1HZA A;  1KRS A;  1YVC A;  3S24 A;  4C2M H;  2VQF Q;  4AQY Q;  1Q86 C;  1QVG A;  1PYS B;  2D0P A;  4DKA C;  2Z6K A;  2VUM G;  1VQM A;  4DR4 Q;  1FGU A;  2KCM A;  5IY0 A;  1YJW A;  3CC2 A;  4DR6 Q;  5HGQ A;  4BY7 H;  2R93 G;  3K0X A;  4KHP Q;  1QUQ A;  4DR2 L;  3CC7 A;  2CWP A;  2YTV A;  3TQY A;  1NBW A;  2N49 A;  3S1R H;  3A74 A;  4KLK A;  3E9I A;  1N32 Q;  3S15 H;  1E22 A;  1YBY A;  3U4V A;  4YY3 Q;  4JI5 Q;  3RLF A;  2LXJ A;  5M5Y H;  2NN6 G;  2GVA A;  2R7D A;  4B3T L;  3CXC A;  1GKH A;  4IPG A;  1J5E L;  2IY5 B;  2JK8 A;  4IPH A;  4FDB A;  5C0X I;  4LFA L;  1WFQ A;  1YEZ A;  1UE6 A;  4DR2 Q;  3S1Q H;  1V43 A;  4EX5 A;  2YTX A;  3CME A;  5BR8 L;  5FLX c;  1EFW A;  5JJL A;  2KBN A;  3PO2 H;  4X66 L;  1Q12 A;  4JOI A;  1A0I A;  4OON A;  4P73 A;  5GAE C;  4A3B H;  1CSQ A;  3GTM H;  3GTL H;  3H3V H;  5C4X G;  4B3T Q;  2K14 A;  3U58 A;  3KDF A;  1M1K C;  1K8G A;  3PO3 H;  3CCR A;  1J5E Q;  3L0O A;  4MTN A;  1ASY A;  1G6P A;  3K8A A;  2JEB I;  1V1Q A;  4BY1 G;  1TWC H;  1X65 A;  4YWM A;  1XMQ L;  1QVF A;  2UXC L;  2CWA A;  4WJ4 A;  1YJN A;  1UWV A;  3HOU G;  1LTL A;  2RF4 A;  1TWF H;  4RG1 A;  5BR8 Q;  2MFI A;  4JI0 L;  4A76 A;  1X56 A;  4BXX G;  3HOW H;  1YIT A;  2AHO B;  2PI2 A;  3F2B A;  4A3J G;  1KAW A;  4A3M G;  1KXL A;  2JA8 H;  4B3R L;  4KHZ A;  2UUB L;  2IX0 A;  1HZC A;  3GD7 A;  2VS1 A;  2H5X A;  4R4C A;  2B63 G;  5C4X H;  3B6Y A;  4YWL A;  4X6A H;  2MO0 A;  1Q1B A;  1C0A A;  1A62 A;  2KCT A;  1SR3 A;  4A3F H;  1KD1 C;  1BBW A;  2CKZ B;  5ELN A;  4JI0 Q;  3RZD H;  1N33 L;  3J7A 5;  3KF6 A;  4BY1 H;  4L5T A;  4B3R Q;  2I0Q A;  3F2C A;  1QUQ B;  4DV0 L;  2IHE A;  2UUB Q;  5EAY A;  1TWA H;  1YZ6 A;  1CKN A;  3EBE A;  5E7N A;  5IYC G;  1BVS A;  4BXX H;  1X55 A;  3CF5 A;  2AWO A;  2K75 A;  1L0W A;  1K83 H;  4DR3 L;  2Q2I A;  4DV2 L;  4A3M H;  3CMA A;  1VQK A;  2NVX H;  2JA7 G;  3PF5 A;  3HKZ E;  1VQF A;  5FLM G;  5C0X G;  4DUZ Q;  2GN5 A;  2JA6 G;  4JBW A;  1N33 Q;  4EQ5 A;  1XPO A;  4HJ8 A;  1HZB A;  1NE3 A;  2JA9 A;  3CCE A;  1E3P A;  2ASB A;  4DV0 Q;  1NY4 A;  3H3V I;  2Y0S E;  4JI1 L;  4DK6 C;  4APV A;  4DV3 L;  5IWA L;  1IBK L;  3FP9 A;  1IZ6 A;  1B70 B;  3NEM A;  4NXN L;  1IBM L;  4DR3 Q;  4GOP B;  2E2H H;  4LF7 L;  1WOC A;  4DV2 Q;  4A3D G;  5GAG C;  3TEH B;  4X65 L;  3VDY A;  3M7N A;  2AMC B;  2QA4 A;  3S2D H;  1P8L A;  5IYC H;  2NVQ H;  3Q8D A;  1EUJ A;  1C9O A;  2A8V A;  1U5K A;  2ZM6 L;  3CD6 A;  3CCS A;  1L2F A;  1DGS A;  4IOA A;  4HJ9 A;  4DV3 Q;  4JI1 Q;  5IP9 G;  1IBK Q;  2JA6 H;  2PNH A;  2D0O A;  4BA1 I;  4NXN Q;  1CKM A;  5GRO A;  4LF7 Q;  1B7Y B;  1JB7 A;  1J6Q A;  2ZTE A;  4A3E G;  4IPC A;  3HOX H;  4JOI C;  3KOJ A;  4GOP C;  1NJI C;  3I7F A;  4DR5 L;  1KRT A;  3J7Z C;  1RIP A;  1VQC A;  3H0G G;  3I4O A;  1Q1E A;  2YTY A;  2WP8 J;  4PZ6 A;  2Q2U A;  1PHJ A;  4BY7 G;  4X62 Q;  4ALP A;  2ZM6 Q;  3A5Z B;  1Q7Y C;  1I6H H;  2PI2 E;  5GAD C;  1PH3 A;  1N9W A;  3S1M H;  1FL0 A;  1QVC A;  2CCZ A;  2D62 A;  3S16 H;  5C3E H;  2QEX A;  4JV5 Q;  3GO5 A;  1EWI A;  3ERS X;  3U50 C;  2GVB A;  1VQH A;  1YNX A;  2ZTC A;  3UDF A;  3PIP A;  1HR0 Q;  2JJQ A;  1B8A A;  2HIX A;  2VQE Q;  4DR5 Q;  2BH2 A;  3PUZ A;  3A5U A;  4JI5 L;  4A3I G;  1PH6 A;  4JBJ A;  4IFD J;  3RR5 A;  4LF8 L;  4JBM A;  1QZH A;  3ULP A;  4IFD I;  1AE2 A;  4YCW A;  4A3E H;  1YIJ A;  1CKO A;  1E24 A;  1VQI A;  3PO2 G;  1W2B A;  3NEN A;  5LMU L;  2BH8 A;  3H0G H;  4IO9 A;  4A3B G;  2VZA A;  1VQO A;  3J81 c;  2CFM A;  3TRE A;  3SGI A;  1M90 C;  1KIX A;  4GNX B;  1VQD A;  3PO3 G;  2YV5 A;  2UUC Q;  1VQP A;  2R7F A;  4GLA C;  3H15 A;  3TS2 A;  1R9T H;  3F2D A;  3BJU A;  4P72 A;  1Q81 C;  4K0K L;  1YJ9 A;  3AFP A;  3RZO H;  2IX1 A;  3BU2 A;  4OO1 I;  2EXD A;  1N32 L;  4C3J H;  2BA0 A;  1SMX A;  2HQL A;  4PMW A;  4IOC A;  3T1H L;  1Z47 A;  4QL5 A;  4HJ5 A;  1KC8 C;  4YWK A;  1PYB A;  2XTI A;  2ES2 A;  2MNA A;  5LMU Q;  4DV4 L;  4MZ9 A;  4A3I H;  4LF9 Q;  3HOW G;  4QQB X;  3UE0 A;  4UP9 A;  4LUO A;  4JI2 Q;  5H1S E;  3M85 A;  1HNZ Q;  2JA8 G;  5JEA J;  2JA5 G;  4UY8 C;  2N78 A;  3CCQ A;  4NB3 A;  1W3S A;  2OTJ A;  4GNX C;  2K5H A;  2K50 A;  1KL9 A;  3AQQ A;  1SE8 A;  3CPF A;  4AH6 A;  4GOP A;  1I3Q H;  2VL6 A;  2Q2H A;  4C3I H;  4Y7N H;  3CAM A;  4A3F G;  3ULL A;  4LUZ A;  3T1H Q;  1KHI A;  1VQE A;  4LF8 Q;  4GKJ Q;  4DV4 Q;  4B3M Q;  4O0A A;  3HFZ B;  3CCL A;  4A3C G;  3UDX A;  1FJG Q;  1GM5 A;  4IJH A;  3GTK H;  3MXN B;  5M3M H;  4LF4 Q;  3I2Z A;  2UU9 L;  4QJF A;  3LGJ A;  5AJ3 Q;  4UP8 A;  1CSP A;  4L5R C;  1YHQ A;  2N8N A; 
#chains in the Genus database with same CATH topology
 1NNX A;  1HUN A;  1B9M A;  3I4M B;  1R4Q B;  2JA5 H;  1U0L A;  1ILP A;  2DGY A;  1JMC A;  4V19 0;  3I4N G;  4NPS A;  5C4J B;  2DJF C;  5IT9 L;  3KF8 B;  1LTS D;  1IYU A;  1EQV A;  4PZ8 A;  2BE5 C;  5ELD A;  5IGG A;  1SSO A;  3HKZ G;  4OO1 G;  3GTJ H;  1HUM A;  1D8L A;  3BYT B;  5C44 B;  3W2D A;  1H9R A;  2WIN B;  2CQO A;  3D31 A;  4GN4 B;  4R4Q A;  3SK6 A;  2I5L X;  1MSH A;  4K14 A;  3I4N H;  4B08 A;  2KHI A;  3ND8 A;  2FXQ A;  5DM7 3;  2K5N A;  4QIW E;  1H9J A;  2F1M A;  4BBS H;  4OGQ C;  3A7L A;  4CKB A;  1L0X B;  1SRU A;  4LW1 A;  4P71 A;  4X62 L;  3OW2 A;  2KEN A;  1EY6 A;  1XTC D;  4Q0F A;  1QZG A;  1SE4 A;  1QB5 D;  1SNQ A;  2WFW A;  3OTO Q;  1GO3 E;  1A2U A;  2F0G A;  3W1B A;  5NUC A;  1NMG A;  2LXK A;  2EYO A;  1CM9 A;  2F0V A;  1PLF A;  3STB C;  4JI4 Q;  3HS0 C;  1HQR D;  2J7Z A;  5EGT A;  2ZJQ A;  2VXW A;  3TP7 A;  4I7A A;  3S17 H;  4C2M B;  1VQG A;  3S14 H;  4HCS A;  4DV1 Q;  3I4L A;  3RN2 A;  1SRO A;  4JYA L;  1KDA A;  1SN8 A;  4BY7 B;  5FJ8 G;  1T9H A;  1R4P B;  4L5Q A;  3PMF A;  4KI0 A;  3T51 B;  1LTR D;  1HPC A;  5IYB G;  3GTO H;  4RA8 A;  1VDZ A;  2L0C A;  2DUD A;  1JIC A;  3CC4 A;  1F9R A;  3DWQ A;  5IE8 A;  2B3G A;  2AQ1 B;  5JAV A;  4JYA Q;  1X9N A;  5CV5 A;  2EYP A;  3ZYY X;  4YCU A;  1PH7 A;  3S1Q B;  4LUV A;  1OXT A;  4PG3 A;  1E1T A;  4WRD A;  3A0J A;  4GKJ L;  4B3M L;  4FXG C;  3F2U A;  4Y52 H;  3MHB A;  5FJ8 H;  4LF4 L;  4A93 G;  5AJ3 L;  3URY A;  1PYW D;  3OSO A;  4H13 C;  5IYB H;  4BA2 I;  2B2U A;  3DLL A;  4IJL A;  1BBU A;  1SND A;  4OWW B;  1K9M C;  1K8O A;  2R7Z G;  1LLR D;  4G7H C;  2P5Z X;  1IXR A;  3MC0 B;  4ZQ3 A;  3NBH A;  4HSP A;  3DM1 A;  3X3M A;  4ZKB B;  4J1M A;  2B2V A;  2IPK D;  3DM3 A;  4R4T A;  1CI3 M;  2YYZ A;  4OXP A;  4PMB A;  1UE5 A;  5KYL A;  2VY3 A;  1LT3 D;  1II3 A;  2B2Y C;  2B29 A;  4BY1 B;  1NMF A;  1UAP A;  1PFB A;  1ROD A;  4LFA Q;  2R7Z H;  1SNM A;  1BCP F;  1U4L A;  2F4V L;  4RKB A;  3U9O A;  2HUG A;  4X66 Q;  3PUY A;  4A3J B;  4A3M B;  1D7Q A;  1G6Z A;  2GA4 B;  3V2T A;  3CPW A;  2BCO A;  1HH2 P;  2F0J A;  4HJA A;  1XMO L;  5K36 G;  2KED A;  5M5X H;  4A75 A;  1ASZ A;  1D6E C;  2RDF A;  1XMQ Q;  1Y8N B;  2PNR C;  3BS1 A;  3S9W A;  4H0L C;  1DD2 A;  1K0R A;  3FMC A;  5JJI A;  3O13 A;  4UHV A;  1K8A C;  3HOZ G;  2OXP A;  3KBG A;  1GUS A;  4UP7 A;  3HOU H;  1WCM G;  3M4P A;  1XMO Q;  3MFY A;  2NVQ B;  3JAM i;  4M1U B;  3W5O A;  1G29 1;  5I9P A;  2JA6 B;  1VCI A;  4L63 B;  5K36 H;  5TSS A;  4JI7 L;  4BBR G;  2Z8L A;  1GXD C;  1TWG H;  2WAQ E;  2B63 H;  3MAQ A;  3J7Y W;  2K5V A;  5EKK A;  4KJN A;  2K01 A;  4A3D B;  1D5Z C;  4PV1 C;  1PV4 A;  3GTQ H;  2AUK A;  4JI7 Q;  1EYG A;  3I55 A;  2I5M X;  4HN7 A;  2D2C C;  4XYQ A;  3J80 E;  1JJ2 A;  4RCN A;  3T1Y L;  3W3A A;  4KY7 A;  2EQS A;  4O2D A;  2JXM B;  4LF5 L;  1SE2 A;  1HHV A;  4X65 Q;  4PMC A;  3U9S A;  2NZ1 D;  2PYK A;  1SJH D;  5KNB A;  4LFC L;  1B4O A;  4TKO B;  5C3W A;  2VQF L;  2F0Q A;  1V1P A;  4K2K A;  3QO2 A;  4DR4 L;  3Q24 A;  1A6X A;  3T1Y Q;  2QW7 A;  3T56 B;  3E0E A;  4DNT B;  2L9H A;  1H9S A;  2E2I H;  1N36 L;  4HTH A;  1DOM A;  2XGT A;  3X3N A;  4LFC Q;  1QVG A;  1HZA A;  2VQF Q;  4K5V A;  3RUZ A;  1HQM C;  4B9W A;  3EFX D;  2D0P A;  3K5N A;  1HCZ A;  2VUM G;  1E2Z A;  4DR4 Q;  2KCM A;  3SXH A;  5KEE A;  3FRP B;  1S5E D;  3PO3 B;  5HGQ A;  2R93 G;  1NBW A;  1QIL A;  3A74 A;  4IUT A;  4ZCK A;  1N32 Q;  1TWC B;  1E22 A;  2KEC A;  5M5Y H;  4KTA A;  3L9A X;  2GVA A;  3GTK B;  4KKT A;  2HDM A;  3ERO A;  4IPG A;  5KND A;  4N9P A;  3QG1 A;  4KY5 A;  5M9O A;  1ZEQ X;  1WFQ A;  2JA5 B;  1UE6 A;  5T1I A;  4EX5 A;  5BR8 L;  5JJL A;  4ZAI A;  2KBN A;  2EVB A;  3VA5 A;  4JOI A;  1A0I A;  2DNE A;  2NWG A;  5IOC A;  4A3B H;  1CSQ A;  3H3V H;  2RA4 A;  1D5X C;  3KDF A;  1EL0 A;  4A3F B;  1KNE A;  3CCR A;  1FNU A;  1MHW C;  1ASY A;  3K8A A;  1STY A;  2UXC L;  1K0S A;  2F4I A;  1YJN A;  1NSN S;  2SNM A;  1TWF H;  5BR8 Q;  2MUY A;  4A76 A;  1X56 A;  1Y8P B;  1YIT A;  1WTW A;  2XIW A;  4H7B A;  2WB1 B;  5CV8 A;  2Z6B A;  4EVO A;  2H5X A;  4R4C A;  1IL8 A;  2EJF C;  3A8J E;  3SK5 A;  3I4N B;  1KNA A;  2B2W C;  4YWL A;  3QOL A;  5A2Q E;  2MO0 A;  1CHQ D;  1IKL A;  1A62 A;  1E0B A;  1SR3 A;  2KCT A;  1QNK A;  3GQB A;  3BZD B;  5CBA E;  5ELN A;  4DK1 A;  1I4R A;  2E2H B;  4CDE C;  1LT5 D;  4YIJ A;  4XDX A;  1CT1 D;  5D65 A;  2NB0 A;  3VR5 A;  5T1G A;  1TWA H;  4XT1 B;  3EBE A;  5E7N A;  1BVS A;  3D6W A;  1K83 H;  4ID6 A;  2PQE A;  2NVX H;  4RWS C;  4FXD A;  2SEB D;  4DUZ Q;  2A69 C;  3J80 L;  2ASB A;  5C5M A;  3NSW A;  2RSN A;  1NY4 A;  1DYQ A;  4IUR A;  3ONA B;  4APV A;  1DZ1 A;  3NEM A;  3T4A C;  2EY5 A;  3T13 A;  3PIO 3;  3IFD A;  2D9U A;  3S16 B;  2DY7 A;  3M7N A;  2F3V A;  2QA4 A;  4QB4 A;  3HP3 A;  3J7A F;  4HSV A;  3S17 B;  2ZM6 L;  3T53 B;  3CD6 A;  1DGS A;  2EYH A;  4JPB W;  5IP9 G;  2PNH A;  1CKM A;  4KMU C;  1LT6 D;  3C46 A;  1JWS D;  1WTV A;  3HOX H;  1RCV D;  3I3C A;  1EWH A;  4BS9 A;  3I7F A;  3D3R A;  3M7G A;  1KRT A;  3J7Z C;  5CV4 A;  1Q1E A;  3GTO B;  2WP8 J;  4BY7 G;  1PHJ A;  2ZM6 Q;  2N88 A;  1PH3 A;  1FL0 A;  2CCZ A;  4QUC A;  5C3E H;  1F9Q A;  1Y8O B;  1VQH A;  1HR0 Q;  4LK1 C;  4RHS A;  2HIX A;  2VQE Q;  3PUZ A;  4CBV A;  1PH6 A;  1GUT A;  1YNJ C;  3ULP A;  4KV6 A;  2TMP A;  1AE2 A;  3G6J B;  4KD4 A;  3KF8 A;  1VQI A;  3PO2 G;  5LMU L;  4IO9 A;  1JOO A;  4O1N A;  3TRE A;  1KIX A;  4GNX B;  4C3I G;  1HRJ A;  3NK9 A;  3I72 A;  2YV5 A;  1EYD A;  3H15 A;  2H4O A;  1R9T H;  3BJU A;  4KJO A;  2QIL A;  4P72 A;  2LKV A;  1BOS A;  1HA6 A;  4FYD A;  1SMX A;  1ICF B;  2F0F A;  4QL5 A;  2KUM A;  4DN4 M;  2MNA A;  5LMU Q;  1TKW B;  1ET6 A;  4MZ9 A;  4DV4 L;  3HOW G;  1HNZ Q;  3OIP A;  5JEA J;  2N78 A;  4A93 B;  2NVT B;  5G3L D;  4GNX C;  2K50 A;  3AQQ A;  1QJO A;  1TU2 B;  3EJI A;  2Q2H A;  4C3I H;  4IAL A;  2K7V A;  3KUP A;  2R7Z B;  5A2Q L;  1PRT B;  5JJZ A;  4NP5 A;  4UDU C;  4DV4 Q;  4O0A A;  4A3C G;  5M3M H;  2CQA A;  4NKL A;  3LGJ A;  4L5R C;  2G5D A;  1WTH A;  3HOY H;  5M5X B;  3JC6 6;  4OEM B;  2F0M A;  2EYM A;  1DON A;  3DHQ A;  3AMU A;  2I5H A;  1PRT C;  3PUX A;  1EEI D;  3PIO A;  3UDG A;  2NUC A;  3HOU B;  4A3C H;  1GD7 A;  2FJ2 A;  2EYL A;  1I6V C;  1WJJ A;  3AFQ A;  1JJG A;  1VQ5 A;  1HNX L;  1F77 A;  1TWG B;  1B3Q A;  1HXY D;  4DAP A;  1I94 Q;  2B63 B;  2Y0S G;  4NMZ A;  4DR1 L;  1N34 L;  5LMN L;  4P75 A;  1KQS A;  4LNQ A;  4CGY B;  1HNX Q;  5IGC A;  1JWM D;  3OHX C;  1G51 A;  3BYY B;  2HIV A;  4J15 A;  2M00 A;  1HFG A;  5I6W A;  4HJ7 A;  4DR1 Q;  1N34 Q;  1O7I A;  1L1O B;  5LMN Q;  1VQ8 A;  1QCB D;  3OW7 A;  2Z0S A;  1EY4 A;  4RKL A;  4BBR B;  2KEE A;  2ICI A;  2L55 A;  3BZK A;  3TZD A;  3CCM A;  3DEP A;  1E2V A;  3OOC A;  4LFB Q;  4GKK Q;  1CUK A;  1A2T A;  4ZLT F;  2DJG C;  2F0D A;  3RMH A;  3S2H H;  1EY0 A;  3PQI A;  5IT9 c;  1YNN C;  3SK4 A;  5J39 A;  1XPR A;  3MXN A;  3J81 i;  1L1O C;  2E2I B;  4CKC A;  2SDF A;  1VQJ A;  3K7A H;  4KD3 A;  3A56 A;  2OWO A;  2AKW B;  2UXB Q;  3CQZ B;  3BG3 A;  1S72 A;  3I70 A;  4F87 A;  1CK1 A;  4DK0 A;  1PH4 A;  1SE3 A;  5CV9 A;  2PQA B;  2A6H C;  1BKB A;  4POG A;  1OXU A;  4LF9 L;  3I8Z A;  1X3F A;  1SFO H;  4EGV A;  5M5Y B;  2ENB A;  1B50 A;  4P2C B;  3KYH C;  4RAU C;  2X6G A;  4XTC S;  2L11 A;  4LWC A;  1RF2 D;  1FGB D;  2R61 A;  1GUW A;  3TN2 A;  1JT8 A;  1X3G A;  5C5L A;  1KDC A;  1W6K A;  3G48 A;  2VUM B;  2UUA Q;  2B8G A;  1FJG L;  3GTP H;  4K5W A;  4X3U A;  4A3B B;  1NTG A;  2R93 B;  4OX9 L;  3KFU A;  3RLO A;  2RDH A;  2B2T C;  1BNZ A;  3HOV G;  1X6O A;  2PCF B;  1A8V A;  2EYF A;  3K5L A;  2FHT A;  3HG9 A;  1OTC A;  3QIA A;  3PF4 A;  1WTO A;  2TSS A;  3N6R A;  1TWF B;  3H91 A;  4WFN 3;  3G6E A;  4JI3 L;  2CHB D;  4OX9 Q;  1STH A;  5ELE A;  2F0U A;  5ELB A;  2IT1 A;  4X64 L;  1Q8K A;  3GDE A;  4DNI A;  1EZ6 A;  2WB1 G;  4JK1 C;  3HOV H;  4JI3 Q;  4FF2 A;  3M4O H;  5G3L F;  2O5J C;  4K6L A;  2E74 C;  1S5F D;  4QGU A;  3RLN A;  3C1E A;  2L15 A;  3ERQ A;  1EQR A;  3QB3 A;  1STG A;  3FVQ A;  1VQB A;  4X64 Q;  1K8M A;  4BBS G;  1Q90 A;  4H02 A;  3EIV A;  1U4P A;  2K4K A;  1B2T A;  1Y14 B;  3HRZ C;  4HIM A;  4ME3 A;  4JC0 A;  2ZTD A;  1PH8 A;  2QCP X;  1ZYR C;  3OYY A;  1PTO H;  4HIO A;  1IYJ B;  2PO4 A;  4AYB E;  3OTO L;  2EXZ A;  4B9X A;  1A15 A;  1Y69 U;  2WAQ G;  4DK3 C;  1LTB D;  3AEV A;  1TVX A;  1SMY C;  4ZK9 B;  3L7Z C;  1SNP A;  5LL6 X;  4IUU A;  1CZG A;  2E2J H;  2FIN B;  3F8T A;  1TS3 A;  2PMZ E;  2F0S A;  5CR3 A;  3KJO A;  1QOH A;  1WYD A;  2O4X A;  4JI4 L;  2RHQ B;  4TVA B;  3HOX B;  4DXF A;  4WJW A;  2F3I A;  2ALY B;  3WDN A;  1PTO D;  5DEH A;  1V1O A;  2RHS B;  4DV1 L;  1UEA B;  1EQQ A;  1X32 A;  2OCE A;  5EQ0 A;  4CJ2 C;  1PH2 A;  2F3W A;  2JA7 H;  4J6H A;  1G2T A;  5C0X H;  5FLM H;  5J22 A;  1IBM Q;  5FLX L;  1B9N A;  3LWU A;  4FVM A;  1P16 A;  3RN5 A;  4JG2 A;  1BO0 A;  1FVI A;  1R9T B;  1MJE A;  3MEF A;  5EPL A;  1A63 A;  4S3S A;  1A3T A;  1BDO A;  2RQX A;  3EA6 A;  2HT1 A;  4CKE A;  3ZJY C;  5C0X J;  1OXV A;  2F52 A;  2ZXP A;  2Z6K A;  1VQM A;  1FGU A;  3TP8 A;  1LAC A;  3PO2 B;  3MXP A;  5IY0 A;  1E2W A;  3GTM B;  1BXT A;  5C4H A;  1AP0 A;  4C3I B;  1F2Y A;  4DR2 L;  3CC7 A;  2CWP A;  3S1R H;  3TQY A;  4KLK A;  3E9I A;  3S15 H;  2HCC A;  3U4V A;  4JI5 Q;  1ILQ A;  2G9H D;  4GZY C;  3K58 A;  1J8I A;  3PIP 3;  2IY5 B;  3HOW B;  3SR1 A;  4IPH A;  3HOY B;  3CRL C;  4LFA L;  1YEZ A;  4DR2 Q;  1V43 A;  2OF1 A;  3CME A;  3KK7 A;  2V4D A;  4X66 L;  1Q12 A;  4P73 A;  3R8B A;  2F03 A;  2PW7 A;  2K14 A;  3U58 A;  2CW0 C;  1K8G A;  2HDL A;  4XT3 B;  4YWM A;  5K5P A;  4FF3 A;  1XMQ L;  1QVF A;  4OEL B;  3HOU G;  4K6D A;  3GP7 A;  3TZU A;  2KOL A;  4RH6 A;  1JWU D;  1KAW A;  5C6A A;  4KHZ A;  4ULL A;  3VYS A;  2DN8 A;  2B63 G;  3B6Y A;  5LHY 1;  3TP5 A;  3A8K E;  4KY6 A;  3J7A 5;  3KF6 A;  5EKL A;  1O7Y A;  2KA7 A;  2E75 C;  3S2D B;  1QUQ B;  4DV0 L;  2IHE A;  4KN7 C;  5LL6 S;  1YZ6 A;  3OMG A;  1F2Z A;  1CKN A;  1T5E A;  1X55 A;  3CF5 A;  1JCK B;  3L3O C;  1H9M A;  3TBI B;  4DV2 L;  3CMA A;  4K8I A;  2Y0S B;  3HKZ E;  2A68 C;  5IGF A;  4JBW A;  4QIW B;  3MZ5 A;  3JAM E;  5CV6 A;  1NE3 A;  4FP5 D;  2Q8T A;  4DV0 Q;  3H3V I;  4DV3 L;  1IBK L;  1B70 B;  2F0T A;  4GOP B;  3V96 A;  4LF7 L;  1WOC A;  4DV2 Q;  3S1M B;  5GAG C;  4ME5 A;  5EPK A;  4X65 L;  2AMC B;  1O80 A;  3K7A B;  1P8L A;  1FD7 D;  1C9O A;  1U5K A;  2EY6 A;  4IFD H;  4DV3 Q;  1TII D;  3HGB A;  1IBK Q;  3P20 A;  2D0O A;  4BA1 I;  5L37 A;  5GRO A;  1W6J A;  4LF7 Q;  4A3E G;  3P75 A;  4GOP C;  1NJI C;  4DR5 L;  1IW7 D;  3SHL A;  1SFO B;  4FXK C;  2YTY A;  4PZ6 A;  3VR3 A;  3FDT A;  3C3L A;  1PTO F;  2ICE C;  3A5Z B;  1I6H H;  5GAD C;  3Q0A A;  1BCP B;  2QEX A;  3FEW X;  1MD2 D;  4JV5 Q;  3U50 C;  2KJX A;  5KGU A;  2ZTC A;  3MTS A;  4DF7 A;  3PIP A;  4C3J G;  3RD4 A;  4BWG B;  1B8A A;  2EOT A;  1N32 L;  4DR5 Q;  4IFD J;  3KBX A;  4A3I G;  3BDC A;  2XWJ B;  1ESR A;  1TY0 A;  4A3E H;  3NEN A;  4EQN A;  5HUR A;  4A3B G;  2FMC A;  2VZA A;  2CFM A;  1BCP C;  4HED A;  2UUC Q;  2R7F A;  1U4R A;  2KCN A;  3TS2 A;  3AFP A;  3RZO H;  3BU2 A;  1S5D D;  1SYD A;  1I4X A;  4C3J H;  1PFM A;  2HQL A;  2EY2 A;  1LTA D;  4HJ5 A;  3D4R A;  4YWK A;  4A3I H;  5H1S E;  2B8F A;  4JI2 Q;  2LFN A;  5KRU A;  2D5D A;  5COY A;  1SAP A;  1ET9 A;  4NB3 A;  3D4W A;  3HOV B;  1WD0 A;  3GV6 A;  1QG7 A;  3BVM A;  1RKN A;  2NTS A;  4Y7N H;  3ULL A;  4LUZ A;  1KHI A;  1VQE A;  3DWA A;  4TRD A;  2M9V A;  5JPN C;  3H94 A;  3CCL A;  1GM5 A;  1EY9 A;  1PDQ A;  3GTJ B;  2UU9 L;  2F0P A;  1Z6H A;  1CSP A;  1JB3 A;  1YHQ A;  1I5F A;  2NZO A;  1S3O A;  2MO1 A;  3TS0 A;  3LNN A;  4TQU S;  5IP7 H;  4XQJ A;  4DNR B;  2QKI C;  2XSC A;  4M8A A;  3M4Q A;  3VR2 A;  2IHF A;  3BVZ A;  1VQN A;  1M4V A;  2F0N A;  3ND9 A;  3JAM L;  4DUZ L;  1A3V A;  2UU9 Q;  2EIF A;  3MWY W;  1LYL A;  4BBS B;  4QF4 A;  4GS3 A;  1V9P A;  1WI5 A;  4MNO A;  5I2Y A;  2E2J B;  5ELO A;  1HJP A;  4YHH Q;  4GLX A;  2LY7 A;  3G71 A;  3TRZ A;  2WKD A;  2MPM A;  4IZ8 A;  3VR4 A;  3I4M H;  1O7L A;  4U68 A;  1Z7T A;  1VMP A;  1F9P A;  4UPA A;  1XJV A;  4LJZ C;  3HOX G;  1PZK D;  4RGM A;  3OMC A;  1KAA A;  1PA6 A;  1DOL A;  3Q6S A;  1GOZ A;  2WAQ B;  2BE5 D;  2EYJ A;  5BN4 A;  2E5L L;  1JJC B;  4R4I A;  5C3E G;  2JA7 B;  3E3X A;  1TS4 A;  1FNV A;  5C44 H;  1CA5 A;  3S14 B;  1MKH A;  2VW9 A;  2JYO A;  1PH9 A;  4MIU A;  3NBH B;  5JEA G;  3HZX A;  3PSI A;  1QNU A;  1HR0 L;  1DCZ A;  2VQE L;  2E5L Q;  1G91 A;  2F0K A;  4ZRZ A;  4KK7 A;  2K5W A;  2B2U C;  4DAY B;  2OQK A;  2QGQ A;  4JI6 Q;  2JE6 I;  3KLS X;  1Z9F A;  1F2L A;  1S40 A;  1JQY D;  1AH9 A;  2A74 C;  1VQ6 A;  4B3S L;  2PZW A;  1SYB A;  2BDO A;  2FMM A;  2O2L D;  5JJK A;  1VQL A;  5FOB B;  5ISR A;  1EYC A;  1PZJ D;  5JEA H;  3NBI A;  3CU7 A;  5GAH C;  3MFG A;  4P74 A;  3MVV A;  3R2I A;  1Y1W G;  1EIY B;  4NXM L;  1DOK A;  4DGZ A;  3VYR A;  3S1R B;  4B3S Q;  4C1N K;  3OIQ A;  1HNZ L;  3S15 B;  2MQH A;  1H95 A;  2CH4 W;  4A3K G;  3PUW A;  2KVM A;  3STB D;  1PH1 A;  2EJM A;  3CW2 C;  3V05 A;  1EZ8 A;  2V1C C;  2WAC A;  1EOV A;  2LMC B;  5M3M G;  4DR7 L;  4NXM Q;  3E5S A;  4K2L A;  5I4D A;  3CCU A;  2J4X A;  3HOY G;  1I50 H;  4GN3 B;  1Y1W H;  4KKU A;  3SVM A;  4OWX B;  4XIG S;  2KCC A;  1MJC A;  1STB A;  1GVP A;  2K52 A;  1QWY A;  2HHH Q;  4DR7 Q;  1KLU D;  4A3K H;  1JR0 D;  3RNU A;  3ITP A;  1PVO A;  1XTD A;  3WWV A;  1EY5 A;  3CP0 A;  2IJ0 A;  4C3H G;  2XN9 C;  3TME A;  2KHS A;  4FF1 A;  2EJG C;  3E9H A;  3NTI A;  3U4Z A;  2JP1 A;  2BA1 A;  1S5B D;  1I94 L;  5KYI A;  3F1Z A;  2NN6 H;  3S1N H;  4ZUJ A;  1SNO A;  1V1P B;  3GTG H;  2F0W A;  2HQE A;  3ULJ A;  2AQ3 B;  4QUF A;  4C3H H;  1H9S B;  1XWE A;  2K03 A;  5ELF A;  3CCJ A;  2HCI A;  2JEA I;  4QMG A;  1JE4 A;  4A3G G;  4MTK A;  2K28 A;  2ZJR A;  1TWH H;  2SNS A;  5CC4 A;  3L2P A;  1IBL L;  4JCV E;  2AUJ D;  1VQ7 A;  3G4S A;  1VQ9 A;  3ICE A;  4AYB G;  2UXD L;  1IKM A;  3K80 C;  3KJP A;  3A54 A;  3IRB A;  4R8N A;  3K81 C;  3GTQ B;  3VYU A;  3FHW A;  4LFB L;  2L1B A;  5M3F G;  4GKK L;  2ZXO A;  3DWP A;  3NE5 B;  4ABN A;  1NCV A;  4A3J H;  1NAP A;  1EWC A;  2ZJP A;  1N8R C;  1IBL Q;  1YHA A;  1HTL D;  1G2S A;  1OXX K;  4JI8 L;  5DLQ E;  2UXD Q;  4A3G H;  4N8X 1;  1FR3 A;  2EE1 A;  5D3I B;  4DA2 A;  4LF6 L;  1K73 C;  3CCV A;  4POF A;  2UXB L;  1E1O A;  2B2Y A;  1BUV T;  2C9O A;  5A35 A;  1I6H B;  3D4D A;  3R93 A;  1CTM A;  3KDF B;  2EPB A;  1JOK A;  4JI8 Q;  5M3F H;  3WOE A;  3N52 A;  2K6A A;  4DUY L;  2NTT A;  1Q82 C;  4LF6 Q;  5EBC A;  2VB2 X;  2NZH A;  5IWA Q;  5IYD G;  1B1Z A;  2Z4H A;  3J81 j;  4OWT B;  4A3E B;  3J81 E;  1G8Z D;  2KHJ A;  4HID A;  1NUC A;  5AFW A;  4YCV A;  3DXJ C;  3NQI A;  1I4Q A;  2F0L A;  4DUY Q;  1EOT A;  1K28 A;  2UUA L;  4A3D H;  1C7Y A;  2BDN A;  1RTN A;  3RZO B;  4DR6 L;  4C3J B;  1X3Q A;  4KHP L;  1MIU A;  4IPD A;  1PZI D;  1EU4 A;  1EFI D;  4A3I B;  1U4M A;  3NTH A;  5IYD H;  1LUZ A;  1Q86 C;  3TSS A;  1AZP A;  1LTT D;  1YVC A;  4G4K A;  1PYS B;  4DKA C;  5C3X A;  1IHZ A;  1L0Y B;  1TR5 A;  2K5D A;  2A5H A;  4DR6 Q;  3K0X A;  4KHP Q;  1QUQ A;  2L4N A;  2WKC A;  2YTV A;  1SYE A;  2Z1C A;  4Q5V A;  3CXC A;  2JN4 A;  1GKH A;  4NDX A;  1J5E L;  5I2X A;  3WOF A;  4FDB A;  5C0X I;  3CHB D;  3H3V C;  2YTX A;  5FLX c;  4QCL A;  4I7Z C;  4K0K Q;  2PZU A;  5GAE C;  3D8G A;  3GTL H;  5C4X G;  4OIK A;  3PO3 H;  1M1K C;  1J5E Q;  5CV7 A;  3L0O A;  4MTN A;  2JEB I;  1V1Q A;  5KIX A;  1TWC H;  1X65 A;  5ELC A;  3A8I E;  1TWA B;  1MGS A;  1LTL A;  1ZKO A;  4N9T A;  4X3S A;  1K83 B;  3MEH A;  3F2B A;  2NVX B;  1SEB D;  2JA8 H;  4KKS A;  5DNF A;  1K3B C;  1GHK A;  4JVZ A;  2IX0 A;  1HZC A;  1DXM A;  2VS1 A;  2JSO A;  4R9W A;  4RCO A;  1EQT A;  3K5M A;  5C4X H;  1RDP D;  4X6A H;  1MBY A;  4OIJ A;  4DXG A;  1Q1B A;  3K5O A;  1C0A A;  4A3F H;  2MJ8 A;  4L6T B;  2CKZ B;  3RZD H;  2K33 A;  2XRS D;  2WII B;  5E1F A;  2I0Q A;  3IAY A;  2I07 B;  5IYC G;  1GJX A;  2PZT A;  1L0W A;  4E6I A;  1ML0 D;  3OWE B;  2Q2I A;  1NR4 A;  1SYF A;  2JA7 G;  3PF5 A;  2QDL A;  5C0X G;  3R2T A;  5FLM G;  1STA A;  4ZUI A;  4HMI A;  5I6Y A;  2RBM A;  1HZB A;  2JA9 A;  2QEJ C;  2SOB A;  2Y0S E;  4JI1 L;  3J81 L;  2M2L A;  1U9R A;  4KHV A;  1IBM L;  1SYC A;  4HMJ A;  2E2H H;  1HTP A;  3Q23 A;  2FFK B;  5C3E B;  5JOB A;  4OO1 H;  5IYC H;  3Q8D A;  2A6E C;  1B44 D;  4IOA A;  4HJ9 A;  1VF7 A;  4JI1 Q;  2A69 D;  1J6Q A;  1PXU A;  4IPC A;  2B2W A;  2HD3 A;  3KOJ A;  5CMD A;  3H0G G;  1RIP A;  1I4P A;  3EVQ A;  2Z4I A;  4X62 Q;  1Q7Y C;  4C1N I;  1N9W A;  3S16 H;  2OT2 A;  1EWI A;  1AZQ A;  4V0B A;  2GVB A;  1YNX A;  2JJQ A;  1I4H A;  1AW7 A;  2BH2 A;  4JI5 L;  3BDL A;  4JBJ A;  2XRQ D;  3OPO A;  1I50 B;  2NYZ D;  1Y1W B;  4JBM A;  1BQQ T;  5FO9 B;  1CKO A;  3TDQ A;  1W2B A;  1J9O A;  3H0G H;  1VQO A;  3SGI A;  4I65 A;  1VQD A;  4A3K B;  1EU3 A;  4L8J A;  1YJ9 A;  1WTX A;  4NW2 A;  2IX1 A;  5M3M B;  2VB3 X;  2BA0 A;  3T1H L;  1KC8 C;  3CKI B;  1Z47 A;  2ES2 A;  4LF8 L;  2O5I C;  4IFD I;  3UE0 A;  4LUO A;  3C2P A;  1YNJ D;  5DM6 3;  2DY8 A;  4UY8 C;  3J7A V;  1Q8I A;  2OTJ A;  1KL9 A;  1SE8 A;  3CPF A;  4AH6 A;  3P7J A;  1I3Q H;  3EQL C;  1X3P A;  3S1N B;  3T1H Q;  4LF8 Q;  2XNA C;  5DAU A;  4GKJ Q;  1CZW A;  4B3M Q;  3GTG B;  3HFZ B;  3UDX A;  4IUN A;  1T5X D;  3MXN B;  1C8C A;  1D5M C;  4LF4 Q;  3I2Z A;  4C3H B;  5AJ3 Q;  4UP8 A;  1LTI D;  2N8N A;  2L12 A;  3I90 A;  1VQ4 A;  2AQ2 B;  1BBX C;  5FK9 C;  1TWH B;  4X3K A;  1D1K A;  4A93 H;  4K8J A;  2NVT H;  4DAY A;  3UDI A;  3NEL A;  5IGD A;  1LV9 A;  1Q3L A;  2WB1 E;  4IUP A;  1D2B A;  1VF5 C;  2X6L A;  4DV7 L;  2E2D C;  5EJW A;  1EYA A;  2IX3 A;  4F88 A;  1GUG A;  1VQA A;  2Q8R E;  1AFP A;  1FNW A;  3K7U C;  5F2D A;  1AE3 A;  1TS5 A;  1B3A A;  3QJY A;  4A3G B;  1EIF A;  4IFD G;  2F0I A;  2G9D A;  2KQ3 A;  1SBB B;  3K59 A;  2RCF A;  2J0T D;  2R92 G;  1A3U A;  2JQO A;  4R1J A;  1Y1V G;  3KLR A;  5M5W H;  4DV7 Q;  1GUN A;  1PH5 A;  3KLW A;  4GNX A;  4AYB B;  2F4V Q;  1DJR D;  3M9B A;  3SE0 A;  3S2H B;  2IWH A;  1PRT D;  2ID0 A;  3R3O A;  1KDB A;  5M3F B;  3NXW A;  2AWN A;  2PMZ B;  5J3B A;  3H6M A;  2WV6 D;  2PPB C;  3BZC A;  2E8G A;  1HNW L;  2R3Z A;  1E7Z A;  4CHT B;  2OTL A;  2EZV A;  2R92 H;  3AB9 A;  3HKS A;  1Y1V H;  4JV5 L;  4PZ7 A;  1EIG A;  4GLV B;  2CVR A;  1JOR A;  1WTP A;  1HNW Q;  3I91 A;  3J80 i;  5FO7 B;  3HOZ H;  3JAM c;  4PQX A;  4IUV A;  1WCM H;  2YU9 H;  1UE1 A;  3CRK C;  4IN3 A;  3C1F A;  1F2M A;  3LX0 A;  4FNF A;  1X3E A;  1XX8 A;  1TXY A;  3LWE A;  2A73 B;  2UUC L;  4TSS A;  2C5C A;  4R4O A;  4BBR H;  5FO8 B;  1JOQ A;  1LAB A;  1O78 A;  3Q22 A;  3GTP B;  5D14 A;  1M8A A;  1I4G A;  2C35 B;  2K05 A;  1SLJ A;  2NBF A;  3J80 c;  1MI2 A;  3VYT A;  2RCN A;  1AN8 A;  3IKJ A;  3PUV A;  4JI2 L;  1YNN D;  3KLS A;  4DFA A;  5KNC A;  4LF5 Q;  4R8I A;  4WJ3 M;  1XYI A;  4G7O C;  4HAE A;  1KLG D;  2EY1 A;  3P1H A;  2NVY H;  3M4Y A;  4XQQ A;  3CQZ H;  4JW0 A;  4DV5 L;  1Q46 A;  3I56 A;  2K32 A;  4GN5 A;  1NR2 A;  1PFS A;  4FO2 A;  4U67 3;  3GTL B;  4H44 C;  5IP7 G;  1CQF A;  5GQO A;  1RL2 A;  1CQV A;  2A6H D;  3DEO A;  3M4O B;  3SK8 A;  1N36 Q;  1XPU A;  1LM0 A;  3FKI G;  2VNU D;  4RHR A;  2A1A A;  5EPJ A;  3QWN A;  1L1O A;  4OHJ A;  4DV5 Q;  4QY7 A;  1UE7 A;  5CBE E;  2Z9H A;  3QOJ A;  2JA8 B;  1BF4 A;  1HR0 W;  2CH4 A;  2VUM H;  4RMF A;  4F7X A;  1WTQ A;  2F0E A;  4CDD C;  1CA6 A;  3I4M G;  5C4X B;  2A19 A;  2OQ0 A;  2R93 H;  4YHH L;  3FKI H;  3RZD B;  3OWF A;  3PGZ A;  4G57 A;  5IIF A;  3NUC A;  1HZ9 A;  4RFB A;  1PTO B;  1ZXT A;  1SJE D;  4CDF C;  4HIK A;  3QR8 A;  1DM0 B;  2QF7 A;  1XNQ L;  3M3Y H;  1IL2 A;  1K3R A;  5HY6 A;  4HR7 B;  1JC7 A;  3G7L A;  1JE5 A;  1KTK A;  1YI2 A;  4A3L G;  3K0Y A;  2XVS A;  2PQA A;  5C44 G;  2LSS A;  5FKA C;  1UNS A;  2E76 C;  3D6C A;  1TY2 A;  1RD9 D;  1EEF D;  4L5S A;  2UXC Q;  1PTO C;  3A55 A;  1XNR L;  2B2T A;  1UUP A;  4DAV A;  1XNQ Q;  5C4J H;  5I9O A;  1STN A;  3NTK A;  3PV0 A;  4EQO A;  1ENF A;  2X69 A;  1OXS C;  1RHP A;  3HKZ B;  3NWS A;  4DV6 L;  4LAA A;  5EBD A;  1S5C D;  3UE1 A;  4A3L H;  1XNR Q;  4IUQ A;  2RSO A;  4JI6 L;  2N3S A;  1XXG A;  3NQT A;  2BOS A;  1VS0 A;  4XXE A;  4DU9 A;  4DPG A;  2Z6K C;  5BN3 A;  4RGN A;  4AIM A;  4DV6 Q;  4JBK A;  1EY8 A;  5HGT A;  2Q8I B;  1ZYR D;  1TT2 A;  3E0J A;  2ATW A;  3EN2 A;  2N55 A;  3NHH A;  1PRT F;  1RJT A;  2NN6 I;  3D0F A;  3T16 A;  4DAM A;  2XWB B;  1C4Q A;  2RVL A;  1SMY D;  1KAB A;  2QDB A;  4MN3 A;  2RKS A;  2B39 A;  4UAI A;  1ENC A;  2R6G A;  3AYH B;  3PCO B;  4RGO S;  1AEX A;  2B2V C;  2K1B A;  1X54 A;  4J8Q A;  3H0G B;  2Q2T A;  5JVG 3;  2LS0 1;  4F8M A;  4C56 C;  4AQY L;  3ER0 A;  5JVH 3;  3DMU A;  2MP1 A;  1EIH A;  1SNC A;  4LMQ D;  3H09 A;  5COR A;  1D1I A;  1UEB A;  4WOR A;  2IW3 A;  3KF6 B;  2A6E D;  1H9K A;  1YHB A;  3FPP A;  5IP9 H;  1ENA A;  3W1G A;  4A4I A;  1CKN B;  2F0O A;  4RGT A;  3SDZ A;  4YY3 L;  5LMN W;  2HHH L;  3S24 A;  1KRS A;  4C2M H;  4ZYS A;  4AQY Q;  4N8F A;  1STE A;  1V8Q A;  1YJW A;  3CC2 A;  1I3Q B;  4BY7 H;  3TP6 A;  2N49 A;  1RTO A;  3E6Z X;  1QE6 A;  2L5T A;  1YBY A;  4YY3 Q;  3RLF A;  2LXJ A;  2NN6 G;  3HEJ A;  2R7D A;  4K5X A;  4B3T L;  2JK8 A;  2ZT9 C;  2ZXR A;  5E4X A;  2OEO A;  3S1Q H;  1WD1 A;  1EFW A;  3PO2 H;  4X3T A;  5IGB A;  4OON A;  3GTM H;  5JPM C;  4B3T Q;  1GHJ A;  1VMC A;  3IFT A;  1ICW A;  1TS2 A;  1G6P A;  5IOD A;  3VR6 A;  1SDF A;  4BY1 G;  3GV3 A;  4ZKC B;  4WJ4 A;  2CWA A;  1UWV A;  3BVG A;  2RF4 A;  4RG1 A;  3A7A B;  2MFI A;  4JI0 L;  4BXX G;  3HOW H;  2AHO B;  2PI2 A;  3MXU A;  4A3J G;  4A3M G;  1KXL A;  1PFN A;  2MHV A;  4B3R L;  5BN5 A;  3VA7 A;  5IGE A;  5M5W B;  4ILW A;  2UUB L;  2IL8 A;  3GD7 A;  4HCE A;  5C4Z A;  3NWT A;  1S4Z A;  1HA5 A;  4MHE A;  1KD1 C;  2CW0 D;  1BBW A;  4JI0 Q;  1N33 L;  2K5Q A;  1PMR A;  4BY1 H;  4L5T A;  4B3R Q;  3F2C A;  2UUB Q;  5EAY A;  1WTR A;  2DNC A;  1B53 A;  4BXX H;  2AWO A;  2K75 A;  4DR3 L;  4A3M H;  1VQK A;  1HFN A;  2R92 B;  2H1E A;  5E3F A;  1Y1V B;  3I73 A;  1VQF A;  3K57 A;  4PNY A;  2GN5 A;  3MA2 B;  4ODG A;  5J1Z A;  2JA6 G;  1ESF A;  1N33 Q;  4XQN A;  4EQ5 A;  1XPO A;  5IT9 E;  4HJ8 A;  3CCE A;  1OO9 B;  1E3P A;  4KN4 C;  1IW7 C;  4DK6 C;  1BR9 A;  4CJ0 B;  3FP9 A;  1FYC A;  5IWA L;  1IZ6 A;  4NXN L;  3HOZ B;  1WCM B;  2YU9 B;  4DR3 Q;  4OL7 A;  1LO5 D;  4A3D G;  3TEH B;  3VDY A;  4G7Z C;  3S2D H;  2NVQ H;  1EUJ A;  3FPU B;  4CDC C;  2A8V A;  1F9S A;  3CCS A;  1L2F A;  1CFM A;  2JA6 H;  2A68 D;  1CHP D;  4NXN Q;  1B7Y B;  1TQO A;  1JB7 A;  2ZTE A;  1SXT A;  3MXG A;  4JOI C;  4EQP A;  1VQC A;  3DUZ A;  3I4O A;  2Q2U A;  4ALP A;  1GUO A;  2PI2 E;  3S1M H;  4FF4 A;  1QVC A;  2D62 A;  1SYG A;  3AU7 A;  3GO5 A;  3ERS X;  2EDG A;  3UDF A;  1IYV A;  2NVY B;  2K04 A;  5E4W C;  1C48 A;  3A5U A;  1LTG D;  3IL8 A;  3RR5 A;  1QZH A;  2MGS A;  4YCW A;  1YIJ A;  1ONL A;  5D3D A;  2F0H A;  1E24 A;  5CGK A;  2BH8 A;  4IQZ A;  5EKI A;  3J81 c;  4Y7N B;  1M90 C;  3PO3 G;  1VQP A;  1EY7 A;  4GLA C;  1MSG A;  3F2D A;  1Q81 C;  4K0K L;  1WVL A;  2I46 A;  3SEB A;  2EXD A;  3BDO A;  5FLX E;  1O7Z A;  4OO1 I;  4CJ1 B;  4PMW A;  4IOC A;  1LT4 D;  4XYO A;  4LF9 Q;  1PYB A;  2XTI A;  4QQB X;  4UP9 A;  3M85 A;  2JA8 G;  2JA5 G;  3CCQ A;  5CYU A;  1W3S A;  2K5H A;  3K6O A;  3FKI B;  4GOP A;  2RDG A;  3NP8 A;  4Z9C B;  2VL6 A;  1BCP D;  3CAM A;  4A3F G;  3UI2 A;  4O42 A;  1FJG Q;  3M3Y B;  4IJH A;  3GTK H;  2PW5 A;  4QJF A;  3NPP A; 
#chains in the Genus database with same CATH homology
 1I5F A;  1VQ4 A;  2NZO A;  3HOY H;  1S3O A;  3JC6 6;  2MO1 A;  2JA5 H;  3TS0 A;  4TQU S;  1U0L A;  5IP7 H;  4A93 H;  2NVT H;  2DGY A;  1JMC A;  3M4Q A;  2IHF A;  2I5H A;  3I4N G;  3UDI A;  3NEL A;  4NPS A;  1VQN A;  3PUX A;  2WB1 E;  4DUZ L;  3PIO A;  2UU9 Q;  3KF8 B;  4DV7 L;  3UDG A;  2EIF A;  1LYL A;  4A3C H;  1GD7 A;  4PZ8 A;  1VQA A;  1WJJ A;  3AFQ A;  3HKZ G;  4GS3 A;  1V9P A;  1WI5 A;  3K7U C;  4OO1 G;  3GTJ H;  4MNO A;  1JJG A;  1VQ5 A;  1HNX L;  1AE3 A;  5ELO A;  1HJP A;  1D8L A;  4YHH Q;  4GLX A;  3G71 A;  1EIF A;  4IFD G;  3TRZ A;  1I94 Q;  2R92 G;  3I4M H;  2Y0S G;  2JQO A;  4R1J A;  1Y1V G;  2CQO A;  5M5W H;  4DV7 Q;  3D31 A;  4GN4 B;  4R4Q A;  4DR1 L;  1PH5 A;  1N34 L;  5LMN L;  2I5L X;  3KLW A;  4GNX A;  3I4N H;  2F4V Q;  4UPA A;  3M9B A;  4P75 A;  3HOX G;  1XJV A;  1KQS A;  4LNQ A;  2ID0 A;  2KHI A;  1PA6 A;  2FXQ A;  1HNX Q;  2K5N A;  4QIW E;  2AWN A;  5J3B A;  4BBS H;  1G51 A;  2HIV A;  3BZC A;  2E8G A;  2E5L L;  1JJC B;  4J15 A;  4R4I A;  5C3E G;  4HJ7 A;  4DR1 Q;  1N34 Q;  1E7Z A;  1O7I A;  1L1O B;  1SRU A;  5LMN Q;  4LW1 A;  1VQ8 A;  4P71 A;  2Z0S A;  4X62 L;  2OTL A;  3OW2 A;  5C44 H;  2KEN A;  2R92 H;  3BZK A;  1MKH A;  3HKS A;  2VW9 A;  1Y1V H;  3CCM A;  1PH9 A;  1QZG A;  4JV5 L;  5JEA G;  3NBH B;  3PSI A;  4PZ7 A;  4LFB Q;  2WFW A;  4GKK Q;  1CUK A;  4GLV B;  3OTO Q;  1HR0 L;  1GO3 E;  3W1B A;  3S2H H;  2VQE L;  1NMG A;  2E5L Q;  1HNW Q;  3J80 i;  3HOZ H;  2LXK A;  5IT9 c;  3JAM c;  4DAY B;  1XPR A;  2OQK A;  2QGQ A;  1WCM H;  2JE6 I;  2YU9 H;  1UE1 A;  1Z9F A;  1S40 A;  4JI6 Q;  3J81 i;  1L1O C;  3STB C;  1AH9 A;  4JI4 Q;  1VQ6 A;  4B3S L;  1VQJ A;  3K7A H;  2ZJQ A;  1X3E A;  1TXY A;  5JJK A;  2OWO A;  2AKW B;  2UXB Q;  1VQL A;  2UUC L;  3S17 H;  4R4O A;  1VQG A;  4BBR H;  3S14 H;  4DV1 Q;  3RN2 A;  1S72 A;  5GAH C;  1PH4 A;  1SRO A;  2C35 B;  4P74 A;  1Y1W G;  4JYA L;  1SLJ A;  1SN8 A;  2PQA B;  3J80 c;  1EIY B;  5FJ8 G;  1T9H A;  4L5Q A;  1BKB A;  4NXM L;  1OXU A;  4POG A;  4LF9 L;  4KI0 A;  4B3S Q;  1X3F A;  2RCN A;  3PUV A;  1SFO H;  4JI2 L;  5IYB G;  1HNZ L;  3GTO H;  2MQH A;  1H95 A;  2DUD A;  4A3K G;  3PUW A;  3STB D;  1PH1 A;  4LF5 Q;  4WJ3 M;  3CW2 C;  3CC4 A;  4XTC S;  3KYH C;  2V1C C;  5IE8 A;  1EOV A;  2B3G A;  4JYA Q;  4LWC A;  1X9N A;  1JT8 A;  1X3G A;  5M3M G;  2NVY H;  4DR7 L;  4YCU A;  4NXM Q;  1PH7 A;  3CQZ H;  1OXT A;  3G48 A;  1E1T A;  4LUV A;  3A0J A;  4PG3 A;  4DV5 L;  1Q46 A;  2UUA Q;  4B3M L;  3I56 A;  3HOY G;  3CCU A;  1FJG L;  3GTP H;  1I50 H;  4GN3 B;  4GN5 A;  1PFS A;  1Y1W H;  4Y52 H;  4OWX B;  1NTG A;  4XIG S;  5FJ8 H;  5IP7 G;  5GQO A;  4LF4 L;  1RL2 A;  3RLO A;  5AJ3 L;  4OX9 L;  3KFU A;  4A93 G;  1N36 Q;  3HOV G;  1X6O A;  1MJC A;  1LM0 A;  3FKI G;  1XPU A;  5IYB H;  2VNU D;  4BA2 I;  1A8V A;  1GVP A;  2K52 A;  3DLL A;  1OTC A;  4IJL A;  1BBU A;  2A1A A;  2HHH Q;  4OWW B;  1K9M C;  3PF4 A;  4DR7 Q;  4K0K Q;  4A3K H;  1L1O A;  2R7Z G;  4DV5 Q;  4QY7 A;  3RNU A;  1PVO A;  1UE7 A;  3G6E A;  4JI3 L;  1XTD A;  1IXR A;  3WWV A;  4OX9 Q;  3CP0 A;  1HR0 W;  2IT1 A;  4X64 L;  1Q8K A;  3GDE A;  2VUM H;  4DNI A;  4RMF A;  2WB1 G;  3I4M G;  3DM3 A;  4R4T A;  2A19 A;  2YYZ A;  2OQ0 A;  3E9H A;  4OXP A;  3U4Z A;  1UE5 A;  2R93 H;  2VY3 A;  3HOV H;  4YHH L;  4JI3 Q;  3M4O H;  3FKI H;  3PGZ A;  1HZ9 A;  2B29 A;  2BA1 A;  1NMF A;  1I94 L;  3F1Z A;  4LFA Q;  4QGU A;  3S1N H;  3RLN A;  2R7Z H;  2L15 A;  1EQR A;  4X64 Q;  1VQB A;  2F4V L;  4HIK A;  3GTG H;  4BBS G;  1XNQ L;  4H02 A;  4X66 Q;  1D7Q A;  3PUY A;  1HNW L;  3M3Y H;  1IL2 A;  3EIV A;  1K3R A;  5HY6 A;  3ULJ A;  3CPW A;  1HH2 P;  1JE5 A;  2K4K A;  4C3H H;  1YI2 A;  4HJA A;  4A3L G;  2JEA I;  3CCJ A;  1XMO L;  2PQA A;  5C44 G;  2LSS A;  1Y14 B;  4A3G G;  5K36 G;  5M5X H;  4A75 A;  1ASZ A;  2ZJR A;  4HIM A;  1TWH H;  1XMQ Q;  4L5S A;  2UXC Q;  4ME3 A;  4JC0 A;  1IBL L;  2ZTD A;  3L2P A;  4JCV E;  1XNR L;  1PH8 A;  1VQ7 A;  3G4S A;  1VQ9 A;  3ICE A;  1K0R A;  4AYB G;  1XNQ Q;  3K80 C;  5C4J H;  3KJP A;  2UXD L;  5JJI A;  3IRB A;  3OYY A;  1K8A C;  3PV0 A;  4HIO A;  1OXS C;  3K81 C;  3HOZ G;  3FHW A;  4DV6 L;  1IYJ B;  4UP7 A;  4LFB L;  5M3F G;  1WCM G;  3M4P A;  1XMO Q;  3HOU H;  4GKK L;  4AYB E;  3JAM i;  3OTO L;  2WAQ G;  3UE1 A;  4DK3 C;  3AEV A;  4A3J H;  3L7Z C;  3W5O A;  1G29 1;  2ZJP A;  1N8R C;  1IBL Q;  1YHA A;  2E2J H;  1XNR Q;  4A3L H;  1VCI A;  4JI8 L;  3F8T A;  1OXX K;  2N3S A;  5DLQ E;  4JI6 L;  2PMZ E;  4A3G H;  4JI7 L;  2UXD Q;  4BBR G;  1VS0 A;  1WYD A;  3KJO A;  1TWG H;  2WAQ E;  4JI4 L;  4DPG A;  2RHQ B;  2Z6K C;  4TVA B;  2B63 H;  2K5V A;  2F3I A;  4LF6 L;  2ALY B;  4AIM A;  4DV6 Q;  4JBK A;  1K73 C;  3CCV A;  4POF A;  2UXB L;  1E1O A;  2ATW A;  2RHS B;  3EN2 A;  4DV1 L;  3KDF B;  1PV4 A;  3GTQ H;  2NN6 I;  2OCE A;  1EQQ A;  4JI8 Q;  5M3F H;  1PH2 A;  4JI7 Q;  3D0F A;  1EYG A;  4DUY L;  4DAM A;  3I55 A;  2I5M X;  1Q82 C;  4LF6 Q;  2NZH A;  2JA7 H;  1JJ2 A;  5FLM H;  5IWA Q;  3T1Y L;  5IYD G;  3AYH B;  2R6G A;  2EQS A;  3PCO B;  4O2D A;  4OWT B;  3J81 j;  1IBM Q;  4LF5 L;  2KHJ A;  4HID A;  4X65 Q;  4GKJ L;  1P16 A;  3RN5 A;  1X54 A;  2Q2T A;  4YCV A;  4LFC L;  4DUY Q;  4AQY L;  2VQF L;  4JG2 A;  3ER0 A;  2UUA L;  4A3D H;  1FVI A;  1C7Y A;  4DR4 L;  1MJE A;  3MEF A;  3T1Y Q;  1A63 A;  1UEB A;  4DR6 L;  3E0E A;  3KF6 B;  2E2I H;  2HT1 A;  4KHP L;  1N36 L;  1YHB A;  1MIU A;  4IPD A;  5IP9 H;  2XGT A;  4A4I A;  3W1G A;  3ZJY C;  5IYD H;  1LUZ A;  1CKN B;  4YY3 L;  5LMN W;  2HHH L;  4LFC Q;  5C0X J;  1OXV A;  2F52 A;  1HZA A;  1KRS A;  1YVC A;  3S24 A;  4C2M H;  2VQF Q;  4AQY Q;  1Q86 C;  1QVG A;  1PYS B;  2D0P A;  4DKA C;  2Z6K A;  2VUM G;  1VQM A;  4DR4 Q;  1FGU A;  2KCM A;  5IY0 A;  1YJW A;  3CC2 A;  4DR6 Q;  5HGQ A;  4BY7 H;  2R93 G;  3K0X A;  4KHP Q;  1QUQ A;  4DR2 L;  3CC7 A;  2CWP A;  2YTV A;  3TQY A;  1NBW A;  2N49 A;  3S1R H;  3A74 A;  4KLK A;  3E9I A;  1N32 Q;  3S15 H;  1E22 A;  1YBY A;  3U4V A;  4YY3 Q;  4JI5 Q;  3RLF A;  2LXJ A;  5M5Y H;  2NN6 G;  2GVA A;  2R7D A;  4B3T L;  3CXC A;  1GKH A;  4IPG A;  1J5E L;  2IY5 B;  2JK8 A;  4IPH A;  4FDB A;  5C0X I;  4LFA L;  1WFQ A;  1YEZ A;  1UE6 A;  4DR2 Q;  3S1Q H;  1V43 A;  4EX5 A;  2YTX A;  3CME A;  5BR8 L;  5FLX c;  1EFW A;  5JJL A;  2KBN A;  3PO2 H;  4X66 L;  1Q12 A;  4JOI A;  1A0I A;  4OON A;  4P73 A;  5GAE C;  4A3B H;  1CSQ A;  3GTM H;  3GTL H;  3H3V H;  5C4X G;  4B3T Q;  2K14 A;  3U58 A;  3KDF A;  1M1K C;  1K8G A;  3PO3 H;  3CCR A;  1J5E Q;  3L0O A;  4MTN A;  1ASY A;  1G6P A;  3K8A A;  2JEB I;  1V1Q A;  4BY1 G;  1TWC H;  1X65 A;  4YWM A;  1XMQ L;  1QVF A;  2UXC L;  2CWA A;  4WJ4 A;  1YJN A;  1UWV A;  3HOU G;  1LTL A;  2RF4 A;  1TWF H;  4RG1 A;  5BR8 Q;  2MFI A;  4JI0 L;  4A76 A;  1X56 A;  4BXX G;  3HOW H;  1YIT A;  2AHO B;  2PI2 A;  3F2B A;  4A3J G;  1KAW A;  4A3M G;  1KXL A;  2JA8 H;  4B3R L;  4KHZ A;  2UUB L;  2IX0 A;  1HZC A;  3GD7 A;  2VS1 A;  2H5X A;  4R4C A;  2B63 G;  5C4X H;  3B6Y A;  4YWL A;  4X6A H;  2MO0 A;  1Q1B A;  1C0A A;  1A62 A;  2KCT A;  1SR3 A;  4A3F H;  1KD1 C;  1BBW A;  2CKZ B;  5ELN A;  4JI0 Q;  3RZD H;  1N33 L;  3J7A 5;  3KF6 A;  4BY1 H;  4L5T A;  4B3R Q;  2I0Q A;  3F2C A;  1QUQ B;  4DV0 L;  2IHE A;  2UUB Q;  5EAY A;  1TWA H;  1YZ6 A;  1CKN A;  3EBE A;  5E7N A;  5IYC G;  1BVS A;  4BXX H;  1X55 A;  3CF5 A;  2AWO A;  2K75 A;  1L0W A;  1K83 H;  4DR3 L;  2Q2I A;  4DV2 L;  4A3M H;  3CMA A;  1VQK A;  2NVX H;  2JA7 G;  3PF5 A;  3HKZ E;  1VQF A;  5FLM G;  5C0X G;  4DUZ Q;  2GN5 A;  2JA6 G;  4JBW A;  1N33 Q;  4EQ5 A;  1XPO A;  4HJ8 A;  1HZB A;  1NE3 A;  2JA9 A;  3CCE A;  1E3P A;  2ASB A;  4DV0 Q;  1NY4 A;  3H3V I;  2Y0S E;  4JI1 L;  4DK6 C;  4APV A;  4DV3 L;  5IWA L;  1IBK L;  3FP9 A;  1IZ6 A;  1B70 B;  3NEM A;  4NXN L;  1IBM L;  4DR3 Q;  4GOP B;  2E2H H;  4LF7 L;  1WOC A;  4DV2 Q;  4A3D G;  5GAG C;  3TEH B;  4X65 L;  3VDY A;  3M7N A;  2AMC B;  2QA4 A;  3S2D H;  1P8L A;  5IYC H;  2NVQ H;  3Q8D A;  1EUJ A;  1C9O A;  2A8V A;  1U5K A;  2ZM6 L;  3CD6 A;  3CCS A;  1L2F A;  1DGS A;  4IOA A;  4HJ9 A;  4DV3 Q;  4JI1 Q;  5IP9 G;  1IBK Q;  2JA6 H;  2PNH A;  2D0O A;  4BA1 I;  4NXN Q;  1CKM A;  5GRO A;  4LF7 Q;  1B7Y B;  1JB7 A;  1J6Q A;  2ZTE A;  4A3E G;  4IPC A;  3HOX H;  4JOI C;  3KOJ A;  4GOP C;  1NJI C;  3I7F A;  4DR5 L;  1KRT A;  3J7Z C;  1RIP A;  1VQC A;  3H0G G;  3I4O A;  1Q1E A;  2YTY A;  2WP8 J;  4PZ6 A;  2Q2U A;  1PHJ A;  4BY7 G;  4X62 Q;  4ALP A;  2ZM6 Q;  3A5Z B;  1Q7Y C;  1I6H H;  2PI2 E;  5GAD C;  1PH3 A;  1N9W A;  3S1M H;  1FL0 A;  1QVC A;  2CCZ A;  2D62 A;  3S16 H;  5C3E H;  2QEX A;  4JV5 Q;  3GO5 A;  1EWI A;  3ERS X;  3U50 C;  2GVB A;  1VQH A;  1YNX A;  2ZTC A;  3UDF A;  3PIP A;  1HR0 Q;  2JJQ A;  1B8A A;  2HIX A;  2VQE Q;  4DR5 Q;  2BH2 A;  3PUZ A;  3A5U A;  4JI5 L;  4A3I G;  1PH6 A;  4JBJ A;  4IFD J;  3RR5 A;  4LF8 L;  4JBM A;  1QZH A;  3ULP A;  4IFD I;  1AE2 A;  4YCW A;  4A3E H;  1YIJ A;  1CKO A;  1E24 A;  1VQI A;  3PO2 G;  1W2B A;  3NEN A;  5LMU L;  2BH8 A;  3H0G H;  4IO9 A;  4A3B G;  2VZA A;  1VQO A;  3J81 c;  2CFM A;  3TRE A;  3SGI A;  1M90 C;  1KIX A;  4GNX B;  1VQD A;  3PO3 G;  2YV5 A;  2UUC Q;  1VQP A;  2R7F A;  4GLA C;  3H15 A;  3TS2 A;  1R9T H;  3F2D A;  3BJU A;  4P72 A;  1Q81 C;  4K0K L;  1YJ9 A;  3AFP A;  3RZO H;  2IX1 A;  3BU2 A;  4OO1 I;  2EXD A;  1N32 L;  4C3J H;  2BA0 A;  1SMX A;  2HQL A;  4PMW A;  4IOC A;  3T1H L;  1Z47 A;  4QL5 A;  4HJ5 A;  1KC8 C;  4YWK A;  1PYB A;  2XTI A;  2ES2 A;  2MNA A;  5LMU Q;  4DV4 L;  4MZ9 A;  4A3I H;  4LF9 Q;  3HOW G;  4QQB X;  3UE0 A;  4UP9 A;  4LUO A;  4JI2 Q;  5H1S E;  3M85 A;  1HNZ Q;  2JA8 G;  5JEA J;  2JA5 G;  4UY8 C;  2N78 A;  3CCQ A;  4NB3 A;  1W3S A;  2OTJ A;  4GNX C;  2K5H A;  2K50 A;  1KL9 A;  3AQQ A;  1SE8 A;  3CPF A;  4AH6 A;  4GOP A;  1I3Q H;  2VL6 A;  2Q2H A;  4C3I H;  4Y7N H;  3CAM A;  4A3F G;  3ULL A;  4LUZ A;  3T1H Q;  1KHI A;  1VQE A;  4LF8 Q;  4GKJ Q;  4DV4 Q;  4B3M Q;  4O0A A;  3HFZ B;  3CCL A;  4A3C G;  3UDX A;  1FJG Q;  1GM5 A;  4IJH A;  3GTK H;  3MXN B;  5M3M H;  4LF4 Q;  3I2Z A;  2UU9 L;  4QJF A;  3LGJ A;  5AJ3 Q;  4UP8 A;  1CSP A;  4L5R C;  1YHQ A;  2N8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...