3FVQA

Crystal structure of the nucleotide binding domain fbpc complexed with atp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
348
structure length
343
Chain Sequence
TAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLGRLPVQSGAPAGTRGTLLIRPEQYSLHPHSAPAASIHAVVLKTTPKARHTEISLRAGQTVLTLNLLSDGISAVLHLDGPALFFPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Fe(3+) ions import ATP-binding protein fbpC
publication title Insights into how nucleotide-binding domains power ABC transport.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
total genus 87
structure length 343
sequence length 348
chains with identical sequence B
ec nomenclature ec 7.2.2.7: ABC-type Fe(3+) transporter.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17845 FbpC_C_terminal FbpC C-terminal regulatory nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.450 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fvqA02
2.40.50.470 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fvqA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fvqA01
1U8ZA 3JZAA 3CZPA 2F1HA 2GCPA 1W0KA 4G3XA 5EZ5A 1TEVA 2YC4C 3GJ7A 1CP2A 5AWFC 1TX4B 3AVOA 2XTMA 5CYOA 1OFUX 4RCZA 3F5FA 1Z63A 3TQFA 2IYTA 3UMFA 4GP6A 1D8TA 1W4CA 2ZRMA 2OFXA 1DBSA 1Q12A 2GBLA 3AF0A 3RS5A 3LRPA 3L0IB 4NHOA 1Z83A 3N70A 2R44A 2BDTA 2B21A 2WAXA 4HB0A 3X2SA 1N0WA 4LV6A 2EWVA 2QTFA 1E0SA 4KV9A 3TSZA 4JYCA 4LPSA 2AK2A 3GLFE 4GL2A 3FMFA 3NBZC 2ZE6A 3AVPA 3FYHA 3LVQE 3QXXA 3SBEA 3N2IA 2EFEB 2B7BA 3QXJA 1RYFA 2F1RA 4PTLA 1H65A 3DHWC 2ZRFA 3T35A 1MOZA 4EJSA 4XWKA 1FPMA 4O2RA 1QRAA 2OFOA 4KI0A 1ZNWA 3RS2A 421PA 5FTMA 3LBHA 3TAHA 2DYKA 2ZSFA 4EPTA 4Z54A 4ZPXA 2XTZA 2FSGA 5AJXA 3T1TA 1W36D 3C5CA 3MFYA 1U81A 2KE5A 4RZXA 1X8LA 4FN5A 5CB6A 1UBCA 5E4FA 2Q3MA 2ZS9A 4KO8A 4Q02A 1CJVC 2QBYA 3A1WA 4F4JA 4Q18A 5BN3A 2BVNA 3I8XA 3CNLA 1OKKD 1Q0UA 2O0KA 1GSIA 2ODNA 1NLFA 3W6PA 1ZC3A 1KI6B 1W2GA 3GEIA 3UKDA 5EJEA 4W5HA 3K0CA 2R6CA 2FF7A 1M2OB 2O5VA 3OFNA 2V4ZA 4KYIB 4FD2A 4HLUA 4Z51A 5DIFA 2WHXA 4Q9KA 1LF0A 4WXRA 3V4FA 5JWRA 3Q72A 4R9UC 2PH1A 4H1VA 4C3ZA 1CEEA 2ZAOA 2P5TB 2GBLC 2XOKA 4AKIA 4A2QA 1Z6AA 3AGQA 1UAAA 2R6DA 4QXAA 1NY5A 2O8CA 1SVKA 2JLQA 1W4RA 3KKQA 2K5UA 2OLKA 4LHVA 4BLOA 3QEOA 2P2LA 4EPXA 3GFTA 4F4IA 2F9MA 2VP6A 5KO2A 4EDHA 4M9XA 1MT0A 2WJGA 3CX7A 4ZI2A 2B92A 1FUUA 2VSFA 2OXRA 4GI7A 4EJSC 5DHFA 2JLXA 3AVUA 3P1JA 1EFRA 3A58B 3EZ7A 3VR6A 1G8HA 3BH0A 4DLTA 4TTQA 2FPKA 4FMDB 1VHLA 3QVVA 4DEYA 2ZE5A 2OBLA 3H0KA 1LB1B 2ZRHA 2DHRA 3EAQA 2WJHA 3K09A 1TQ6A 3AUYA 1NN0A 1UJ2A 1XTQA 3HPQA 5FR1A 5L3RA 3JVVA 5LDDC 3K1JA 2J0UB 1P5ZB 4JZKA 3THWA 1IN7A 2YV5A 3MG9A 3MWKA 4ASUD 3BORA 1KDPA 4BFTA 3AP2A 3QE0A 5J4VA 1QG4A 1RW4A 4BUJA 4YXWD 2IYYA 2ZYWX 5EP1A 2AL7A 2J1LA 1KO5A 2FSHA 4EQ6B 1S3GA 4Q03A 4A6PA 5HKKD 821PA 1WB9A 3LXRA 4AKGA 2A5GA 2JEOA 3K0CC 4CVNA 2ODEA 5BQ5A 4DZZA 1M7HA 1Z08A 4PX9A 1RRPA 1OXTA 5J4HA 2V8OA 4IHQA 1ZAKA 2VA8A 3I62A 5FR2A 3IQXA 4KXFB 1E1RD 1N6NA 5G40A 2C9YA 2JIZA 3LNCA 4M1OA 4Q47A 3QBVA 2I1VB 1G3MA 4C0LA 1GKIA 5FOXA 3U3KA 1GP2A 3SN6A 1Q20A 1XB2A 2OZEA 4RFSB 4X8OA 5IHPA 3I5XA 3CNNA 1T91A 3FB4A 2ZRPA 3SC3A 2OCYC 2QMUA 1C4OA 4LGMA 2FZLA 4K46A 1W5SA 2QPOA 4P3YA 3R9WA 4G5QA 1OT3A 1Y3AA 1YJ5A 2N42A 1ZNYA 3LA6A 2WKQA 4MITA 1XEXB 4MA4A 2Y8EA 4PC7A 1G4AE 1Q57A 4XOIA 1Z2CA 5JS8A 4OI0A 3QKTA 4LC1A 2WSSD 3K09C 4UXJA 1E4VA 3VQTA 1JJVA 1KHTA 3ZH9B 1XXHB 3UXMA 2ZITA 4DB4A 3VKWA 2REXB 2XAUA 4KFRA 5B57C 4Q5IA 2ONKA 1N5JA 4PHFA 1GILA 4TMZA 1T9HA 4UNRA 4QM7A 2WJYA 1G4UR 5G3ZA 1R5NA 1DAHA 3WY9A 2EFDB 3PV0A 1W48A 1US8A 2EYUA 5C2JB 2XNDA 2F9LA 2E9SA 2JJ1A 4D25A 1P2TA 2RB4A 1OH8A 3SHWA 2QI9C 3U3MA 3LBIA 4Q4JB 1E2MA 4ACBA 1DTSA 3TW8B 2DWOA 4CEIB 3AF3A 3WYGA 2EFGA 1P7CA 3FWYA 1II9A 2L0XA 2BBSA 5DI3A 4ESHA 3U4QA 3N5CA 3MWYW 3BB1A 4Q9LA 3A4NA 2XXAA 4O2LA 4MUAA 4DSOA 3LFUA 3O8DA 4Q7KA 4D26A 1DO2A 1PLLA 3ASZA 2GJ9A 3WMFA 4NMMA 1ZIOA 1CS4C 4LK2A 1MO6A 3TSOA 3GLGA 4YMTA 3TUIC 1CF4A 2E1RA 3V4RA 3SJBA 2QT0A 3ZJYA 4TYWA 2HCJB 1KK1A 1KI7A 1IHUA 4E5UA 2ZUBA 1NJFA 3KJEA 2Q21A 5FOSA 2ZUCA 3GLIB 1JECA 4AI6A 1TEXA 3LLMA 3RWMB 2ATXA 1XBTA 3QXHA 1KOFA 2QTHA 1NJGA 1IOZA 2F3RA 2X2EA 1LS1A 4WW0A 5KSZA 1KI2A 4HAZA 2OLJA 1QHSA 2IL1A 2IK8A 3T1VA 4M1KA 4Q4AB 5CIWA 2WBLC 3SYLA 1NBME 4URZR 3BBPA 1VKJA 5FH9A 1IN8A 2C2HA 2KBEA 3R9IA 4DLXA 2H7VA 4A9AA 3I92A 5E3HA 4JIMA 1M6NA 2ZRIA 4LHZA 4PSAA 3ZVLA 1X6VA 1NSFA 2J7PD 3GFOA 4LJAA 4A6XA 2F55A 3E2IA 3CKLA 2ZREA 3U2QA 2CXXA 2GJ8A 2RGDA 5CLLA 5GJVC 5KDOA 2DY1A 1Z8FA 3GFPA 1ELOA 4FW9A 2R9VA 1W1WA 2Q9AA 2VHCA 3W3AA 4YDHB 3B85A 1DS6A 2B8TA 1WBDA 2J3EA 1O87A 2EFCB 4G0NA 1ZUNB 1R0WA 2RGBA 4QBIA 1S2MA 3U61B 3GJXC 3ND8A 4POAA 2ZJZA 4PO9A 1F2UA 1FOEB 4WVFA 1W4BA 1FQKA 3PUYA 4KBFA 2ZS7A 4DLSA 1G1MA 5AUPB 1CXZA 3AVYA 4NCHA 5JBQA 4JMPA 2DFLA 4HDCA 1SQ5A 1C1YA 3R20A 2HT6A 3K70D 4L15A 5DSZA 4CW7A 1NN3A 3LLUA 2HDNB 2PEYA 2PJRA 2GKSA 4ACAA 1KI6A 5FL7D 3Q7PA 4A4DA 2GEUA 5TXGA 1KDOA 3TR0A 1IM2A 2GETA 2PT7A 5K8UA 2J0VA 2IUSA 1JAIA 2GILA 4RD4A 3K9NA 3KX2A 4XD7A 1XD2A 3VR5A 3VR2A 2FV8A 2ZI4A 4A8JB 3EPKA 3SYNA 2C98A 4Q19A 3WNCA 1AQUA 2LKDA 4NU0A 4YLGA 2REBA 3CF2A 5KOYA 5KDLA 3ZQJA 3AVWA 4KSCA 2KSQA 3WRXC 1BO6A 4IXNA 2WOJA 4S2EA 3KJGA 3KXLA 2CL0X 4D4MA 1BIFA 2BMJA 1NSTA 2H18A 4IOKA 1CR2A 1JEEA 1HEIA 2AX4A 2XZPA 1GZSA 3JZMA 5CK5A 5FBRB 3I5YA 4M1YA 3KUDA 4TTRA 2FPMA 4US1R 2YOFA 1ETUA 3AP3A 5FOWA 4DUGA 2XGJA 3GMTA 1YR6A 4HDQB 4B47A 1Y63A 2OAP1 3PEVA 4OI2A 1GTVA 1U2RA 1CR0A 4EFNA 1NN5A 1U99A 5BN4A 1VIYA 1GUAA 3GEEA 3LBNA 3IBYA 2MSDB 4LBWA 4O3MA 2H1LA 2SHKA 2ZETA 3V9PA 4BLTA 3ZQ6A 1NG1A 1A2KC 2YOGA 2PCLA 2ORWA 2QAJA 3IHLA 4GFDA 4LV5B 5EP2A 3ZIAA 1R6BX 1E4YA 1N0UA 1MKYA 1EGAA 4ZDKA 2FJUA 5EUQB 1G17A 4FMCF 5JLJA 3QKRB 4D81A 4NYMR 4EQ6A 3T1QA 1RRGA 2FOLA 4UJ5A 1WRBA 4FMDF 4JBXA 1ESNA 1F48A 4ZIRB 4UXIA 4HATA 5JSZA 2JLYA 1OB5A 1ZU4A 5IK2A 721PA 4EIWA 1T0HB 3LQQA 4NYJQ 4WXPA 4RKEA 1DARA 1EK0A 2BBTA 4B35A 3NBXX 2C96A 1EG7A 3IPXA 5J4YA 1QVRA 4TT3A 3ASYA 2AXNA 1OF1A 3AEZA 2QQEA 5JHGB 3MCAA 3HU1A 5FTLA 1L2TA 1P2SA 2Z4SA 3MWJA 3NDPA 3PITA 4RFSA 3VX4A 3B82A 3A36A 4Q1CA 2QRZA 2REOA 3CPJB 2ZYUX 1SXJE 3Q7QA 2GDJA 4DC9A 2FGKA 3I72A 3P4XA 4W9MC 3B1VA 4LHYA 4EPVA 3D6TB 2QAGB 2VHJA 2XZOA 2C9OA 3DL0A 4CZ2A 5FBVB 2CK3D 5K8TA 2ZJOA 1WMSA 4G1UC 3C5HA 1FUKA 5H1YA 4QJ3A 5BYKA 2NGRA 1XJQA 1XXHA 2RGXA 3SZRA 4I99A 5KSOA 1QZXA 3OIVA 1YHNA 1UM8A 3KDSE 3TQCA 1L4YA 4A2PA 5JEDA 4PHGA 3ICEA 2IW3A 3MD0A 2IYZA 3AQ4A 1NLZA 4Q48A 2GXUA 2QN6A 2HV8A 3RWOA 1PJRA 2BOVA 3KQNA 1Z6GA 2W6JD 4JLMA 1H8HD 3QUSA 2FSIA 2W2VA 4DCVA 2VTKA 2QGNA 1Z0IA 4JSTA 1HQCA 1HA3A 4Q4JA 4B74A 1Z6XA 4GZLA 4LYJA 4BZXA 1DG1G 3AP1A 4O0MA 4BLQA 1AK2A 3ND9A 5EP4A 2CJWA 3B1WA 2QROA 3EX7C 4ABYA 1CJMA 4II7A 2VEDA 1G8GA 4JJZA 4K81B 3VAAA 4XTCS 1FX0A 3L0PA 4B3FX 5M04A 4B3GA 3D31A 2GAOA 1V5WA 5H70A 4HAYA 3KB2A 4TN1A 3GJ0A 5F3WB 1F3OA 1W47A 3C4JA 4GP7A 1KSJA 1ODFA 1T6NA 1E96A 1ZP6A 4ZDJA 3RS3A 5JI2E 3VX3A 4ITRC 2QE7A 3B9PA 3U3JA 2OILA 4R2IA 3KFVA 3BJIC 1KDRA 4JL5A 1R5BA 4XD7D 3ECCA 4OK3A 1KI3A 1X1SA 3KUCA 4GOXA 1OYYA 1QHXA 2OAQ1 1Z0KA 5BYJA 1P4SA 1EWRA 1E1QA 3A4MA 3RLFA 1E79A 1DELA 2W6ID 3OIUA 5FUWA 4MYTA 3TJZA 3MLEA 4Q4AA 3SJCA 1ZC4A 1N2CE 4RZ2A 5F2EA 1ZM2A 3B6EA 5C4MA 1SVWA 4A1FA 2GZAA 1RKBA 1KK0A 2VF7A 2AFHE 3QSYA 3HU3A 3UG6A 1R0XA 2GF9A 2Z4RA 1W0JA 3GLIE 4LRWA 4P4SB 3DEFA 1QDEA 2BKUA 5JJKA 2ODWA 3VR1A 4QGFA 3AF4A 4Q01A 3ADKA 1SVOA 2GF0A 3PIRA 3RRMA 2RGCA 3U7HB 5J5CA 3SE0A 3GLHE 2QEQA 4C2TA 1AGPA 2A30A 1YU9A 5E7MA 2VP0A 4PZLA 2WOOA 1R5OA 2XB4A 2IYSA 3QENA 2QENA 3U7EB 4LI0A 3ZIAD 3X1YA 1E2HA 1ZYUA 2BBOA 3IGFA 3NH9A 4P33A 1DE0A 1XD8A 5AJZA 2D06A 3P4YA 1Z22A 4K8OA 3TBKA 1PZNA 4MRVA 1GAJA 5CM9C 4FWIB 5AR1A 5CJ2A 4CEHB 1OFHA 1F5NA 2WMOB 3EC1A 4P4UA 3BC1A 3VHLB 2BC9A 2VQSA 2UZ3A 1N5LA 2HYDA 3CR7A 5IK2D 4YC7A 4Q21A 1S9HA 4TLEA 1KI1A 2R65A 1YZGA 3GJ6A 1ZIPA 1KI9A 2C03A 3RC8A 3I4LA 3RYTC 4Q9IA 4IVRA 3ADCA 2ERXA 2GJKA 3W6NA 1T8TA 3O8BA 5CIQA 4AY2A 2O0JA 2QNRA 4A92A 3AKDA 5AUQA 2W83A 3CM0A 2RGAA 4JSYA 2FSFA 2Q9BA 1NIPA 2FGJA 1DO0A 3KTAA 2CE2X 3W8RA 1P2UA 1GNQA 1KZGB 3W6OA 1GL9B 3G82C 1QHHB 2J9RA 2PLRA 3K0SA 4AKHA 1JAHA 1XCPA 4NONA 2QSYA 1LY1A 4KSBA 4JT2A 2OM2A 1I2DA 4C2UA 3OHMA 5LD2C 2DFKB 3PUVA 4LYAA 4FCVA 4WIAA 4N3NA 1GIAA 3H86A 4A0RA 4NYMQ 3JVUA 4HZIA 4JLAA 2CBZA 2D2FA 1NP6A 4LHWA 4O25A 2AKAB 4ZCIA 4WOPA 3S1AA 3VKHA 4M1WA 2HEIA 4M2LA 5FBLB 4KAXA 4MDEA 5JHHB 5JI3E 1TU3A 2VP5A 3NBFA 4G5RA 4DKXA 1XMJA 1P9NA 1FP6A 4HYYA 3I1FA 1CR4A 2IHYA 2PZFA 4PO1A 3X1WA 1VYUA 1IJEA 5CLQA 1EFHA 2CHVA 1UEJA 1WE2A 2EU8A 3GJ4A 5DYIA 1NG9A 3T12A 1P73A 1QHIA 1IXZA 4LJ8A 3ZZUA 4GT1A 1R0ZA 3GLFA 4PR0A 2AWNA 3K9GA 3A37A 3L2OB 4HLDA 3DM9B 4TMTA 5P21A 5L3SA 1YZQA 2YWEA 2FFQA 4OJKA 4UXHA 4ZIRA 1XMVA 2ZVQX 4BZPA 4JLOA 1XRJA 4JLJA 2C9CA 4F93B 4PPFA 3DPUA 4XIGS 1Q44A 4W5WA 1YE8A 4OK5A 2IA5A 2AR7A 3BH6A 4LX0A 4DLVA 3U6BA 2NTYC 2NG1A 6Q21A 3A1VA 5E95A 4D0NA 5C1BA 2WPDA 4XWAA 2OSBA 1MABB 2ZI6A 4TMWA 2C8VA 2JJ2A 1WXQA 3BRWD 1YR8A 2HT1A 3WBJA 5FUVA 3WYFA 4PAQA 2O8DB 1XPRA 4QBGB 1W2HA 2H5EA 2P0EA 5LBIA 1AZSC 3FFAA 4Q00A 1G9XA 3RRZA 3SNHA 3NC1C 4TLAA 1W5TA 3P32A 1E6CA 3WHKA 1YR9A 1XCMA 3DZ8A 4XH9B 1N25A 5BW8A 4KODA 1KY3A 1NLYA 1NVXQ 1YVDA 2QAGA 1M7GA 5FTKA 3KKPA 4QJ4A 1CTQA 4V02A 3THYB 2NMVA 3PEUA 1T3SA 2P6UA 3ETLA 1E0JA 1AS2A 3LXXA 3ZLJA 5GADl 3BS4A 4PFSA 3FMIA 4EPRA 1YZLA 4V0NA 5FPYA 3U60B 2VF8A 4MGZR 4IDQA 1KI4A 4I4LA 4CT5A 3B1ZA 3TGPA 1XTIA 2ZJ5A 4ON9A 4YMWA 4KFUA 2Z0MA 3GD7A 2PL3A 3TW4A 1AKYA 3Q85A 4DT1B 1K5GA 3B2EA 4RZUA 1DG3A 1TMKA 3R7WB 4QHYA 1ZRHA 5KTYA 1MH1A 5IDVA 2AHOA 4PPGA 4B73A 3PVSA 1IAQA 4UQOA 2X2FA 4C0SA 5FOUA 3MWLA 2ZRAA 3AV0B 3QPVA 1AS3A 4NDZA 2ZAMA 3VR4A 1S8FA 1W46A 4KJZA 3TRFA 1T0JB 4P31A 3M6AA 4RFVA 4DIEA 3P27A 5G41A 1S1CA 1NMXA 3NHAA 1XMSA 3T5DA 4KU4A 2GXAA 3A6PC 4QM6A 4U5XA 1X86B 4JBYA 2F43B 1PUIA 2AD5A 1P9RA 1E2KA 2OHFA 1CU1A 4V03A 2QAGC 3LW8A 1G16A 2ZRJA 1U94A 4L4UA 1OSNA 4UNNA 2JDIA 5B2ZA 3UK6A 2AN9A 4NCNA 4B2PA 1GWNA 1QHGA 1ZD9A 4V0ME 3ZS9A 5SZJA 3I32A 1G7SA 4U02A 1G18A 1V43A 5AUNB 1BS1A 2RGEA 3QI2A 2LWIA 1OE0A 4V0KA 3NIBA 3G0HA 4MYHA 3EA0A 3NH6A 4JLNA 1UADA 4BFUA 3H4MA 1ZINA 1SXJB 4Z1MD 1UBFA 2RGGA 2JATA 5EE0A 4TYNA 2BCJQ 1HE8B 1WDTA 3BIFA 4NCJA 3AB3A 3BAFA 4QC2A 1XPOA 1FMLA 3C8UA 1M34E 1GRRA 2R6AA 1EX7A 3NBYC 1NNEA 1XCGB 4OQXA 3EIEA 3AVXA 5TY0A 1QF9A 3TVDA 3H2YA 4C7OB 3E70C 2WV9A 1KI8A 5DH9A 3EZFA 4I1UA 1Q1ZA 1ZU5A 1KO8A 5FI1B 3B1XA 4IKEA 1W0KD 4PAMA 2D3WA 4CEHA 4MDFA 4BFSA 2O8BB 1KKMA 2IYWA 2BEJA 2NO0A 5FFMA 5CJPA 3IIKA 3VFDA 4BQSA 1OHHA 1M74A 2V7QA 1RJ9B 4KHZA 1JPNA 3FKQA 5H8WA 1DVRA 3DMNA 3B1YA 3QF7A 5DN6A 121PA 4D2IA 1IN6A 1G21E 3MSXA 3TNFA 3MRSA 5F98A 3HR7A 4NYJR 5EE9A 3L0OA 5EZ6B 1BYUA 1D9XA 3OIWA 1W44A 3VTKA 3TUJC 3BFXA 5EE5B 3L82B 4QNMA 3AVQA 5DE3A 4TSFA 2ZJ2A 2WPDD 2XSZA 1NY6A 2G1KA 1YZUA 1KDTA 3OEEA 1T8UA 2AK3A 4JS0A 2CNWA 2VRWA 1J2JA 2DR3A 4PC3A 2FFAA 3PUXA 4BFWA 5TMPA 1MV5A 2WJJA 5HE9A 3UMSA 1HV8A 1ZM9A 3E1SA 3IO5A 3W34A 2KBFA 1DAFA 4Q4HB 4BASA 2ZM5A 2VYFA 4C0HA 2C04A 5JJIA 1MRNA 4OYHA 1D2NA 1WA5A 2NZ8A 4C0JA 1DPFA 2WVJA 1VCMA 2DB3A 3VU9A 2VHUA 3PFIA 1VTKA 4DCTA 3EPJA 3IDQA 2ZYTX 1E9DA 2WWXA 3GCGA 4DXAA 3UIEA 1IY0A 4CF7A 1XNJA 3NVAA 3FHTA 2YJTD 3EXAA 3KKMA 2P67A 3Q8XB 2CHQA 1DAKA 5EUMA 1X3SA 5SZKB 3U5ZB 1GL6A 2HLDA 4ZKEA 2GTPA 1OIVA 4W5JA 1G7CA 1P72A 1DAMA 2A5DA 1GKYA 1P3JA 4MGIR 3RS4A 3OFND 4OQLA 3V00A 2JLSA 2WM9B 5B30A 2JGNA 2B6HA 4JKIA 3QKUA 2O0HA 3QPUA 5KYKA 4M9SA 2VPPA 3U6KA 1JQJC 2O8FB 1ZW6A 1QG2A 3DKVA 1RVDA 2XOKD 3OEHA 2IT1A 3HPRA 3ZZTA 1N6LA 1YQTA 2XJ9A 4L8GA 5AK0A 1N5KA 1CJUC 1NVUQ 1G20E 2Z5FA 4LBVA 1KSHA 1TUEA 4D80A 3GPLA 3RAPR 1NKTA 3GLHB 4BEBA 5BN5A 1IJFA 4A0HA 5GVRA 1AJEA 2IC5A 4DLZA 3CR8A 3CONA 2ONJA 4TZ0A 3PUWA 1JEDA 4QBHA 4FI3C 2CL7X 2FWRA 2GK7A 2QM8A 4XVQA 1EFRD 1HY3A 1JALA 1S0UA 5KSPA 4BRWA 4XVUA 3THXB 4E07A 1NI3A 4DSNA 3AF1A 3BK7A 4HDOB 3KKNA 3WP1B 4A2WA 3GLGE 4URXR 1MABA 2I1QA 4Q9JA 2BIFA 3LX5A 2O8DA 2OBMA 2JDID 3I8SA 4B43A 1PLKA 1R8QA 1W36B 2WWFA 1HT1E 3IQWA 4US0R 5BWMA 2GCOB 3R8CA 3OZXA 3B78A 1OIWA 4L9SA 2Q9CA 3OIYA 4F92B 2J0SA 1ZM4A 1YR7A 4DLWA 2G0NA 2P5SA 1Q21A 3EWSA 4IDNA 4YONB 4KLZA 2KB0A 3NHBA 5JRZA 2RAPA 3EIHA 2YNMA 3OAAA 2NO6A 3WYAA 5DNYB 2QRNA 1LFDB 5C4GB 5HZKA 4PPQA 2F1IA 1HT2E 4BWYA 1PLJA 3DMDA 2A5YB 2IWHA 2ZRDA 1A2BA 4R2HA 4Z8YA 2VH5R 4QHSA 2JIZD 2QU8A 2JA1A 4PSVA 3K0FB 4AYTA 4HI0E 3NDBB 1KMQA 2CL6X 2G77B 2HXSA 3PXGA 1E69A 3ZDQA 2PLFA 3EA5A 4JT4A 1EFTA 3B13B 3EASA 4GZMA 4JVLA 2ORVA 4DT1A 4IEEA 1T4GA 2BJVA 3UWOA 1GDDA 2A9KA 4PC2A 4TQUS 1JJ7A 1XJCA 3R7WA 4HUTA 2KWIA 4P32A 1T3LA 3QVUA 2J59A 2QQ0A 5KNBA 3CWZA 4TL6A 4PZYA 3ZS8A 3KJIA 1RE0A 2OUKA 3T5GA 2V55B 3GJ3A 1ZMXA 4TLBA 1WBBA 1GOTA 4NZYA 1E9BA 1JI0A 1OB2A 2G1JA 1Z06A 3TMKA 1XDBA 1G8PA 2AWOA 3FFBA 3FMOB 1HUQA 4MKFA 1AA9A 1RZ3A 2G6BA 1XMIA 3FKSA 3LVRE 2RMKA 2WZQA 4M1TA 4MKHA 5FPTA 1NKSA 4OI4A 5L3QB 4GMXA 3U7FB 4E03A 1R7RA 2PJZA 4B3XA 2IXFA 2F43A 2IXEA 4L5BA 4F4CA 4BLSA 1Z47A 3O8CA 2XNDD 5HE8A 2JJ1D 4FIDA 1E2EA 3EIQA 2J0UA 2IYUA 4M4SA 3RRYA 4BFXA 1OW3B 4KLNA 4Q7JB 4Q1EA 1FQJA 3CUEF 2C5LA 1N6PA 621PA 2FPLA 1Q22A 2N46A 2ZU0C 4DWJA 4JLPA 4YMSA 3AUXA 3KXIA 2RHDA 2WWHA 1KJWA 2OV2A 1UF9A 3OESA 5CDFE 1VCOA 4E22A 1KY2A 3CF0A 3UPUA 2WICA 4RD6A 1Z6YA 2CLSA 4LYHA 5F9FA 1BMFA 1SXJA 1K6MA 3CZQA 3QF4B 1F2TB 1ZM3A 4IVPA 4Q7LA 2QSZA 1CIPA 4OQFA 1VYVA 1G5TA 2OCAA 5IRCD 2GWHA 3EARA 4EPYA 4IEIA 1G8YA 4ARZB 2F3TA 1ZCAA 2NPFA 3UATA 2ZPTX 3OEHD 2IEYA 5UKDA 1OIXA 5G53C 2IHBA 3RVBA 2Z43A 4GMDA 4B6EA 4LYFA 5SZHB 1KSGA 4DDWA 2O8BA 4U00A 4P0TA 3RHFA 4GPTA 1GVNB 1X1RA 1RJ9A 2ZR9A 3PG5A 4LBYA 3T1OA 3NKVA 2XTNA 3REFA 1N6KA 1EFCA 1ZD1A 5E7JA 1G19A 2B8WA 1XEWX 3A8TA 3BFKA 2JLRA 1XEXA 2W0MA 3X1DA 4ZDIA 1N6HA 1EX6A 1E2PA 2GVDC 1NF3A 2YOHA 2IUTA 3QJYA 5TB5A 4EKDA 3N2EA 1M8PA 1VHTA 1ZCBA 3LH5A 4L16A 3CRRA 3MJHA 1WF3A 1TF5A 1UEIA 5AJWA 3R9XA 1L8QA 3OF5A 4YMUA 5J47A 3FPAA 4WBSA 3UWKA 3PEYA 3E5HA 3KZ1E 1XEWY 1T3HA 4Q4HA 4XTRA 1U98A 3SBDA 3TH5A 3NEJA 3ADBA 2DPXA 2IYLD 2ZTSA 4N0DA 4DSUA 1NN1A 3ADDA 4JVMA 3MGCA 2NQ2C 2QP4A 3K9HA 4BGDA 1H8EA 4CEIA 1SXJC 1UKZA 2IS6A 1ANKA 1EESA 1P61B 3D8BA 1ZJ6A 3U44B 2LKCA 2C78A 4GNKA 2GESA 2QGZA 3CRW1 2V9PA 3F0TA 2UKDA 4OBEA 2BEKA 4HB3A 3SFVA 2J5XA 5JZVA 1G3QA 4BECA 5D3QA 1J99A 1TUIA 3GP8A 4DCSA 4DLYA 3DKPA 4B34A 4JVNA 4B44A 4LHXA 4TQ9A 3BB4A 3M4YA 5DISB 1J8MF 3KKOA 3NXSA 4QGAA 2QZ4A 3WMGA 1B23P 2FDCA 1U8YA 2Q3FA 3Q9LA 4XSGA 3GLIA 2O8FA 2O8CB 3Q5EA 4HAXA 3T34A 4KVGA 4LJ6A 4Q1AA 1SZPA 5HR5A 4PC6A 4DBLC 4WA7A 4ZV4A 3PR1A 1HURA 1G5RA 1JR3A 2HUPA 4URVR 3SS8A 4TLDA 4PHTA 3TVTA 1Z6TA 3GLHA 4ILEA 1UKYA 4B32A 4OHZA 4OK6A 3TLXA 3KQLA 3VR3A 2QY9A 1G7TA 3SDZA 2CCJA 1JQLB 2W0SA 1G7RA 4OHYA 4NL4H 1E0KA 2J46A 4RD0A 1N6RA 2CLCX 1T5IA 4RZ3A 4AG5A 1BKDR 1ONBA 5HCIA 4DJTA 4P4TA 1TF2A 4M9ZA 4DUGD 2HCBA 2EW1A 2XNSA 1UKVY 2ZI9A 3PEWA 1IONA 4TL7A 3GJ5A 3T15A 1WCV1 3C41J 1PUJA 5LB2A 3AF2A 4BZQA 4C0BA 1LVGA 1CRPA 3FTQA 5EXXA 4IFBA 1TAGA 4M8NE 1AQYA 4AURA 2O52A 2NOAA 3UG7A 4YMVA 1XFAA 5GJWC 2FX3A 3KFXA 1OXXK 2DBYA 2RKOA 2D7DA 3FOZA 2GCOA 2PT5A 3L8YA 2BBWA 1OH7A 1G5PA 2O8EB 4CEJB 4DIDA 4PQYA 2ZIAA 1E2JA 1OKKA 4U7DA 3K70B 2Q6TA 2PEZA 4KVAA 1ZUIA 3CPHA 3MAAC 3HJNA 1A7JA 2EFHB 2LCFA 2Q3HA 2WMNB 5FUYA 3D3QA 4QGHA 4CT4B 3KJHA 2VL7A 2IYQA 3KB1A 3QBTA 1CKEA 4HSEA 4AYXA 3BWDD 1TADA 1GNRA 3C15C 1COWA 4TT3D 2WIAA 1XJ0A 1IN4A 3TIFA 2QG6A 4LJ4A 2WTUA 1YRAA 2NO7A 5GVSA 1E9SA 3K0FA 3DOEA 5JCPA 5EXTA 2ZQ5A 3EZ2A 3BGWA 4JLVA 1TTTA 1UBGA 5IT5A 2I3BA 3QY0A 2BKEA 1YRBA 5FBQB 5L8VA 4R7ZA 4IDOA 4JVSB 4TLCA 2I4IA 2ZE7A 4DRZA 4BLPA 4NE2A 4ESVA 4CGZA 2X8AA 4A8JA 4MGKR 1S96A 3BB3A 2GK6A 3WNDA 1RIFA 4RVCA 1TQDA 3MUFA 2AKYA 3FMPB 5DYGA 2CVHA 4BFYA 2IX3A 2BWJA 4UNPA 5A5GA 2GXQA 2EQBA 4RD3A 1D2EA 2WSMA 4XVRA 4HAUA 2HXYA 4FXPA 2BMDA 1W7AA 2YC2C 3ZVMA 4GOKA 1R2QA 1SVIA 3M0EA 2ZI5A 4D0LB 3R8FA 4D4JA 1W36C 3ZGXA 2FZ4A 2GNOA 2OE2A 3PCRB 1E2LA 1VG0B 5L3QA 2XJ4A 3EPHA 2BMFA 3QPWA 4AYWA 1FL9A 1GRNA 5A0FA 4UNQA 2QP3A 2DFTA 3HYTA 5ELXA 3CIOA 3TUZC 3WBKA 2IWRA 3I3SR 4JL6A 4YXWA 4HB4A 3EWAA 3WMEA 1D9ZA 3PQCA 1G3UA 1K8RA 2JCSA 4GOJA 3BXZA 5HKKA 3PENA 2G88A 2FA9A 1FMJA 4ZCLA 1LV7A 4TMVA 3IIJA 5LPNA 3GQBA 2ZXUA 3QNUA 5JCZA 4IFEA 3RS0A 3FDIA 3QKRA 1MO5A 4FCWA 1P60A 3GLGB 4KFTA 2W00A 5FTNA 5EE3A 2YWGA 1L7VC 2FNAA 4BEJA 1UPTA 4IOJA 4D4KA 2OESA 1E1RA 1A82A 2H16A 3Q3JB 3DM5A 4M0LA 4TL8A 4GDFA 4LDJA 2ZYVX 4MGYR 1F2TA 2W2TA 1E2QA 2ERYA 4PC1A 1GKUB 5FBWB 5JJLA 1R4AA 1VYTA 2QE7D 4KFSA 4G5GA 3IUYA 4QGGA 2H17A 4DHEA 4E09A 4I1VA 4MRNA 4A8JC 4ARZA 4EAQA 2FEMA 5KHOC 2EYQA 2MMGA 2OXCA 1E1QD 2DWPA 3AGPA 4LCBA 1Z0AA 1E79D 1Z2AA 4EFMA 3KQKA 2CCKA 1JR3D 1IXRC 4NYIQ 5DGXA 3CX6A 4PSKA 1AIPA 1E2IA 3EPLA 4M1MA 2J0QA 4XSHA 3SYKA 5J4KA 4G5OA 5F9HA 1TPZA 2QORA 3H1TA 2ATVA 2WSSA 1KO1A 2VLIA 3SU8A 4BFVA 4IXMA 1W0JD 3IO3A 4PXAA 5EXPA 1NMYA 4H9GA 1Q3HA 3VMFA 1KK2A 3IEUA 3FVQA 3THOA 2PX3A 1KTVA 4M1SA 1S9DA 1F2UB 2GHIA 1XWIA 4AC9A 3LV8A 4QOSA 4TMXA 5TVKA 1MR3F 4R98A 3UANA 2PBRA 1F6BA 221PA 3RSLA 3GEHA 5GJBA 1P6XA 1NIJA 1QHNA 1UDWA 1E2NA 1ZVQA 1AZTA 4OHWA 4PQRA 3U44A 4A36A 2H8KA 1U0LA 3AH8A 1P75A 4D6PA 1BH2A 2CLDX 4HZUB 1COWD 1SKQA 2ZANA 5KUTA 4OI1A 3ZVRA 4B75A 4V0MA 5AJVB 4JYBA 1KZ7B 1JXOA 1QHYA 3BERA 4QHTA 1VPLA 5E7IA 1XD2B 3DZDA 3AVVA 3NEYA 2GJSA 4GBMA 4MKIA 5D3MB 2V3CC 1FZQA 3L0SA 3CLVA 1Q1QA 1RFLA 3AKEA 2DCUA 2ZU6A 4IOLA 1G41A 1IY2A 1VCNA 4TTPA 5CYPA 4HAVA 5K8IA 3X1XA 4IOMA 4C30A 5KPDA 1II8B 4UKDA 2OCPA 1UKEA 2QA5A 4MUBA 4GSYA 1IBRA 1T5LA 1KNQA 4DDUA 2A2ZA 4FMCB 2OG2A 3L8ZA 2Z6VA 3D7MA 4KYUA 3WNBA 2J7PA 1LF5A 3A4LA 4Q7MB 1KYIA 5SZIA 2XEXA 4URUR 3PJRA 4H1UA 2GXSA 1FNNA 1ESMA 3X1ZA 1IN5A 5K8LA 3AKCA 1CBUA 2GA8A 4P4SA 3RNLA 3SFZA 1YZKA 1PV4A 4LOAA 4DLRA 3TR5A 5KDDA 2R6FA 4QBFA 5FPHA 2W2XA 4DVGA 2PCJA 1U9IA 4M53A 2GCNA 2H57A 1Z29A 1S4QA 2X19A 2EWWA 3KQUA 3RABA 2A7QA 2JJ8A 3U3RA 4TZ6A 5FUXA 1N0VC 2JLUA 4Y0AA 1E98A 1SVMA 2ASEA 3CO5A 2GJAA 3M1IA 4YQFA 2J45A 3FHCB 4ZO4A 3QG5A 1XTJA 4FMBB 5JSZB 2ZI7A 2O8EA 4CEJA 4HLUC 1E94E 3LX8A 1KO4A 2FN4A 3IBGA 4TYYA 4WZ6A 2PZGA 1HTWA 4LZZA 3P20A 5CITA 5FL7A 4R71A 2ANBA 4C4PA 3B9QA 3BOSA 4BFZA 5JFGA 4M22A 2XZLA 4TQAA 1VMAA 5J40A 2X1VA 3F8TA 1SGWA 2ZI3A 1Z0FA 2D2EA 3CRQA 5JRJA 2JJ2D 2OBNA 3LD9A 1U8AA 1R0YA 4CIDA 3SQWA 2GRJA 2V1XA 3CRVA 4B2IA 1L4UA 1D6JA 2BM0A 3SHFA 4ERNA 2VP2A 2VIIA 1Z28A 5KSYA 3W5JA 3RANA 3O8RA 3VKGA 2YKGA 2GVZC 2BCGY 2ZSBA 4FCTA 3HP1A 5HTKA 1QHHA 3TSWA 2YWFA 5AUOB 4FWTA 3EW9A 1P9WA 3CH4B 1X8JA 3NTUA 4NTZA 1HH4A 2D4HA 4C0KA 1GL7A 4Q66C 1I4DD 2GAAA 1K5DA 1OH6A 3TAUA 4OHVA 2R62A 2VO1A 1NL3A 3H84A 2YWHA 4FINA 4HEJA 4LSGA 1U9IC 2Z83A 3F3YA 3CW2A 4LC0A 3T61A 1CR1A 4QKQA 5HZHA 1NVVR 4J0QA 3RC3A 4WZBE 1NBMA 1G6HA 1E32A 1I4TD 4N1AA 1KK3A 3FHOA 3TKLA 3SJAA 2BHRA 3CPEA 4JBWA 2RCNA 1RRCA 4AKEA 4LV8B 1KKLA 1ZM7A 2WIBA 2IEZA 3K70C 2FG5A 3EZ6A 4Q1BA 4JKYA 2CJWB 3ONWA 2MSEB 5J4LA 5B64A 4CYMA 1D5CA 4X8LA 2YZ2A 1FX0B 2NZJA 1E9AA 1E3MA 2F6RA 2G3YA 4WAUA 1KJYA 2RGNA 1EFUA 1SHKA 2ORIA 2AXPA 1D2MA 3DDCA 4WZAE 2DWQA 4D0GA 4MRPA 3C7KA 1N5IA 2QTVB 4PPNA 2IYRA 4B48A 5C18A 2FH5B 1EXMA 2QL6A 4F91B 2CVFA 4N0EA 1SKYE 2Q0HA 4XJXA 2QMHA 4HUQB 4QNRA 1MO4A 5L3VA 4CRWB 2XX3A 2FU5C 1G64A 2QPAA 4ZDWA 4RD2A 5FPSA 1JBKA 4MKGA 1G3RA 2IBMA 1SULA 2IF2A 1OV4A 5EP3A 3HYRA 1MO3A 1M7BA 4RSGA 2CDNA 2DFNA 2RHMA 5FI0B 2R2AA 3VNVA 1E2DA 4DDVA 2CK3A 3C14C 3LO5A 1XTRA 3MJRA 3LDAA 1UBEA 5KNDA 3THYA 5JS7A 4KCGA 5LD2B 1QVAA 3NC0C 2ZJAA 3QG1A 2P65A 4B71A 4QL3A 2ZVPX 1P2VA 3EZ9A 3LY5A 4MYUA 1OLOA 2R6GA 4YDSA 3HWSA 5TARA 2PX0A 4I1OA 3MMPA 2W6JA 1E2GA 1H8HA 1CLUA 1A4RA 1VECA 3CRMA 1OPXA 3SI7A 1KGDA 1DAGA 3IPYA 5JWHA 1W4AA 2YHSA 1KIMA 1II0A 1XU4A 2RGNC 1GITA 5FOTA 4NKRA 3TE6A 3W90A 4EUNA 4V0LA 2C77A 1SHZA 2ANCA 2FMXA 2G0TA 2ZRLA 3RDPA 1X8KA 1PVOA 2OO7A 1AGRA 1YZNA 3IILA 4M9QA 4KITB 3WHLA 4EPWA 1OHHD 2V7QD 3RRNA 1BOFA 2GEVA 2HJGA 2VP9A 2WKPA 4IDHA 5DN6D 521PA 5KU1A 3QOFA 2D7CA 3CH5A 4OHXA 3C16C 4OKSA 2WJIA 4A0GA 2VHTA 2HYIC 4MRSA 2W58A 4AWXA 2WJVA 2G83A 4HZUA 4X8MA 1KMHB 2NIPA 2FEOA 1TQ4A 3IEVA 4TSFD 4DCUA 2P6RA 2XSZD 2ODBA 4PHHA 3KTAB 2V6IA 1GM5A 5FL3A 4D82A 3OEED 1AN0A 2CNWD 2A3RA 5D3MA 2VBCA 5CDFA 4BRUA 2W6IA 3OE7A 3RS7A 4DLUA 1XF9A 2P6NA 3L43A 4NBSA 4Q1DA 4RJLA 5BXQC 2OCBA 2FE4A 2PMKA 1ZUHA 4MQBA 4OJQA 1OXVA 4DCNA 1II8A 3QKSB 1RYHA 3BD9A 2ZJBA 4B3CA 1RPZA 4ZCMA 3AVTA 3K0AB 3I73A 4DB2A 4LJYA 3DOFA 3S1AB 2HF9A 3J81k 4JLBA 2HJVA 4JL8A 2J7KA 4ZKDA 3LWNA 1E0AA 2HLDD 5HPYB 2J87A 2ZRBA 3U7GA 4AK9A 4C0QC 1NBMD 1JPJA 2CMKA 2CE7A 4W7SA 2VSOA 2V1UA 4XWOA 3REGA 3TK1A 4A0FA 2MSCB 1NMZA 3GLFB 1GG2A 4C7OA 3K0EA 1Q3TA 4B2LA 4EFLA 3AM1A 1Z5ZA 1FTNA 4TYPA 3SR0A 2VP4A 1VG9B 5L3SB 1OFIA 4AD8A 1XZQA 4BPBA 5AJYA 2XITA 1U0HC 1DOAA 5C46F 1KAGA 4MRRA 4B33A 1Z07A 1J8YF 5FTJA 5CB8A 1E2FA 1AS0A 1GRQA 3W5IA 1TQ2A 1TU4A 2ZRNA 2CCGA 4OL0A 4IW3B 4IJMA 1Z0JA 2VSXA 2PMDA 2QMOA 2ZRKA 3SOPA 1P62B 1OYWA 3HR8A 2WKRA 5FPKA 4LY6A 1RC8A 4RCYA 4I81A 4LJ9A 2BM1A 2VHQA 2ZE8A 3LAWA 1CULC 1J7KA 1S1MA 4MH0R 4NH0A 4EJSB 1HQYE 3QIAA 4HAWA 4C0AC 2YINC 3ZVNA 3U3OA 1NVVQ 4PO8A 4LPKA 1NRJB 2YVUA 4JJKA 1XPUA 2HF8A 3NG1A 2KJQA 5B58C 1KO7A 4B6FA 3CWQA 4NYIR 1OXSC 3QQ5A 1ZNZA 3I61A 3IHWA 1B0UA 5DO9A 4B3BA 4OQMA 3QEJA 3ZYCA 4X8HA 2IF0A 2ZJYA 2QBYB 2PZEA 5LB4A 4LUCA 4PQFA 2GEDA 4AG6A 2ZS8A 1G8FA 5JEEA 1VDZA 5GJCA 2GZHA 3OAAD 2YYZA 4NCKA 4BLRA 4QFMA 1YZTA 3B5JA 1JB1A 2IYXA 2J41A 3KXKA 2QPTA 1TL7C 1I4LD 4IVQA 3ZZ0A 1FTSA 3ZD7A 3LQRA 2JLVA 1HE1C 2XB2A 2ZSDA 2NPIA 1Z0DA 4PZZA 2WAYA 1E9FA 1O3YA 2NO9A 2GZDA 4Q4LA 5A4JA 4Q9HA 2V6JA 1SVSA 2X77A 1IQPA 4LJ7A 1GNPA 3ZD6A 1XXHE 1DAIA 5ANRB 2MMCA 3DVLA 1VG8A 1YKSA 1KAOA 4F38A 2FFHA 1XTKA 2ZROA 3A1UA 1KSFX 4LJ5A 1F60A 5DHAA 4QRHA 1FP7A 4TMKA 4NPHA 1XP8A 4PANA 1CJKC 1TF7A 3LW7A 3GJ8A 3BE4A 1NVWQ 1R8SA 2A78A 1RRFA 3BH7A 2V54A 1U90A 4B3DA 1OJLA 2C95A 4HLQB 1BYIA 1N3BA 2B7CA 3WXMA 3FKSD 3VNUA 2WWYA 3THXA 1ZD8A 2AD1A 2ZR7A 4HUQA 4US2R 3THWB 3OE7D 4V0OA 2ZR0A 4HLCA 1LNZA 3VHXA 3KL4A 3HU2A 2IS2A 1A1VA 1XTSA 2ZUDA 2C99A 5EE1A 1LTQA 2BV3A 3K53A 5G3YA 4D4LA 4NCIA 1AM4D 2R8RA 2ZSAA 1N6IA 3IKJA 5DI9A 2OEPA 1DADA 4RY2A 5H68A 5TDHA 1XX6A 1SVLA 3RSOA 1IXSB 4Q1FA 1E9CA 4URYR 1E9EA 1JXMA 4UNSA 2ZSEA 4RD1A 1OFTA 5HCNA 4LBZA 3QXCA 1JR3E 3B8HA 1CRQA 4Z8XA 2JASA 1CJTC 1OXUA 2CHGA 2QT1A 3P26A 4Y0VA 3QXSA 5JECA 1BMFD 1SXJD 1VG1A 2ZJ8A 4QJ5A 3A1TA 4A15A 1I2MA 3W3ZB 4LWZA 1DEKA 3SJZA 5TV2A 1FFHA 1FNMA 2QUZA 1MRSA 1IY1A 1U0JA 2WWIA 3CF6R 3AKYA 4MYCA 1XZPA 4QG7A 1KJZA 2QP9X 5IF9A 5JMTA 2AFIE 3IIMA 5EQTA 4L9WA 4S35A 3PUZA 4A82A 1UFQA 1J90A 3DO6A 5FOVA 3T06B 2RH5A 1S3SA 1GFIA 1A5TA 4CDGA 5CK4A 4BE7B 2IS1A 2QMEA 4PAOA 2ECKA 3NWJA 2JAQA 3B7GA 3W9YA 1LW7A 3SEAA 3CB4A 2OT3B 4OQNA 1JR6A 3B60A 2ZRCA 5JWOA 3K8YA 1AKEA 3FGNA 4B76A 4F7WA 3CBQA 1WP9A 3HDTA 1E9RA 4I1SA 1G6OA 3G5UA 2F1JA 3K9LA 3CX8A 1KMHA 2IUUA 4TL9A 4TWZA 1N6OA 1EWQA 4IDPA 3WRYC 3SQXA 1W49A 4JLDA 1KNXA 2UVQA 2NO1A 1US8B 5DLQC 5EXSA 1J70A 4JLKA 4M21A 1TNDA 1LS6A 2JLZA 2A5JA 2E87A 5KPJA 4G01B 3BFVA 1HYQA 1Q1EA 2UZIR 1Z3IX 4UJ3A 2G9NA 4ASUA 5KNCA 2D62A 1ZBDA 5DI3B 3VU9B 3U4QB 1G291 2N1BA 2WWWA 2KI5A 3QKSA 1G3IA 2QM7A 4DEXA 1DAEA 4URWR 1UDXA 2IYVA 2XXAB 1H8ED 1SKYB 1C9KA 2TMKA 5CM8B 2IXGA 4DDTA 2CEAA 1QBKC 3K0AA 4G5SA 3O47A 1FW6A 3ICQB 2WWGA 4DSTA 4C9BA 1WQ1R 1VCIA 3EG5A 1OH5A 3Q5DA 3CNOA 3EC2A 4RKFA 1XEFA 2F7SA 8OHMA 2OFWA 4TYQA 4GRAA 4Z1MA 3KQHA 1E99A 2ZEJA 1Q1BA 3WP0A 2IS4A 1R10A 4KBGA 1VIAA 2P3SA 4ZI3A 1XD9A 2EVWX 2ZRGA 2D74A 1JNYA 2JLWA 3QF4A 4AIIA 2H92A 3FE2A 4HB2A 2A5FA 2BMEA 2FFBA 3A1SA 4IRUB 3UMRA 3W8NA 4NP6A 1M1YE 1ZNXA 2BJWA
chains in the Genus database with same CATH superfamily
4DG5A 3NAZA 1ZJYA 1SNQA 2HU8A 3PC4A 3PQ3A 4IFIA 4K9PA 3S17H 3L0IB 4QYMA 4IQZA 4RSRA 3TSZA 2AK2A 4P9NA 5CDTA 5IX8A 3AIKA 1WOMA 5TC4A 5T4FA 2OFOA 1T9BA 4J9UE 2YY6A 421PA 4G2TA 1K28A 4XIIA 4RKRA 1RFGE 1AUOA 4RESA 2JS7A 3EEFA 3B6IA 5EBDA 1OYVA 4F4JA 4JGGA 1I51A 4IF6A 5ERGB 2IHZA 2H07A 3K0CA 3S2EA 2H4ZA 4I5EA 1QGOA 2X1MA 3LF1A 1X13A 3N86A 2ZAOA 2P5TB 4RTPA 2RHBA 4JBJA 3EXG1 4JA0A 2Q3EA 1W4RA 3KKQA 4ZI2A 4PXSA 4URFA 4EJSC 4GI7A 1POXA 4YIJA 2Q07A 3NHFA 1WPGA 1VHLA 1LB1B 1CDOA 4BP9A 5JT1A 4JZKA 1NVMB 5JCJA 3PSHA 1EUJA 1D0IA 4Y2HA 5JYEA 2G09A 4NEHB 3QZUA 5BUZA 3DONA 1DUIA 1FJGB 1U7WA 4LGYA 4KXQA 4P08A 1UP7A 3N8NA 3H3FA 1H3NA 1ZAKA 3CV3A 3E2MA 5AICA 1WZ2A 3S16B 3QBVA 2I1VB 1S5BD 5JAOA 3RM3A 3I5XA 1U1FA 4IS2A 1NULA 4KN8A 4XCXA 2ZUWA 2YN2A 4RC9A 4DV1B 4B6GA 5HZMA 1QH1B 3VC3A 1YJ5A 5AOAA 4DA9A 1VBKA 2X5NA 4CIBA 3ZH9B 4AVYA 3EH2A 3QU9A 1T9HA 4HDNB 2JFNA 1EQVA 3PNSA 1FX1A 4EJ0A 1TLFA 4GVXA 3RUAA 4EKGA 3C3CA 1N36Q 3AF3A 1A8IA 4OAQA 3SAJA 2B99A 4R0NA 4GKAA 1V8BA 2CWPA 4D26A 4OGWA 1PLLA 4RULA 2B8NA 4YMTA 1CF4A 2CV0A 3CMAA 3K7EA 2JBAB 4G8DA 5DM63 3KJEA 1WOCA 3ANXA 3DKKA 3RWMB 2HW8A 2PWZA 1KOFA 3WTBA 4HAZA 2IK8A 1K7EB 3BBPA 4HX9A 4K6KA 5EQDA 3UYKA 4YRQA 1A5AB 5K8VA 1I33A 4ZOBA 3P5SA 5K4AA 4LJAA 1CUEA 1MP0A 2RGDA 5CLLA 1VJ5A 2R9VA 3ZY3A 1WBDA 5K2OA 1JW9B 3OM8A 2C7QA 1XAIA 4O63O 4W6ZA 2O59A 1Y3BE 1UC5B 5JBQA 4U2KA 4HXYA 2H4WA 2HRZA 2PEYA 1FLVA 2DJ5A 2JFUA 3EPKA 2R87A 3EXEA 3PL1A 1DFHA 2Y71A 5T8KC 3DLAA 4LVOA 4BMSA 1FL0A 5IVPA 3T94A 3TXXA 4ZQ3A 5HZGA 1D2BA 2GPWA 4UD2A 3V42A 4LV5B 3VTZA 1DIGA 3KQVA 4YNBA 1Y8RB 3QKRB 3T1QA 4OEMB 4B31A 4PYMA 1BCSB 3EHEA 2DSTA 2VR1A 4U7PB 1Q0QA 1J8VA 2ICAA 2J07A 4NYJQ 4CODB 2Y1EA 1PAUA 1EE9A 1V16B 3QRWA 1QVRA 5DNUA 3UXYA 2VQDA 2HK7A 1YMUA 2GBGA 1DX4A 1V3UA 4PGAA 3HSYA 4GI1A 3GRRA 4PYKA 1M5TA 2ZYUX 2P6PA 2FGKA 3U39A 2QL5A 4DJDC 3STUA 3LUDA 4OBWA 1ECCA 3JARB 2B30A 1L7BA 1ULTA 1EK6A 3N6XA 4Y2UA 1YHNA 3KDSE 4GZ6A 4OO1H 2G9DA 1TWHB 4YAGA 1RAEA 4H2DA 4BAUA 1AY0A 4GZLA 4LYJA 3H09A 5GADC 4BLQA 5L53A 1XHLA 2IJGX 4LYEA 4PG4A 1QIEA 4JJZA 1AF4A 3H9QA 3KB2A 3GJ0A 5I4DA 1HT3A 1LRKA 1ZP6A 5A4DA 1KDRA 1SC1A 4FR2A 3K5NA 1E1QA 1W1UA 2DU8A 2E76C 1C9YA 4C03A 3B6EA 2E4WA 3M6UA 1Q15A 3KYBA 5I7WA 2BKUA 3HLYA 3F5SA 3U7HB 2GM9A 3G3EA 1FEZA 2IYSA 4L4RA 1ZOPA 1L7OA 3P4YA 4FWIB 5CJ2A 2WJAA 2DMRA 4UDUC 1BDOA 2VYVD 4EW1A 1S9HA 3GW8A 4LF6B 2MO1A 3CLTD 4KR0A 1T8TA 2ERCA 1WABA 4GYJA 3OTHA 2OQVA 2O0JA 1Q7YC 5AUQA 4CQMA 4YXFA 3D8GA 1NIPA 2M1XA 3IQEA 3QELB 2SDFA 1WSWA 1HZJA 1TTPB 2DFKB 3TI9A 1A15A 3H86A 1SXQA 3RD4A 4WOPA 4M2LA 5FBLB 2ZCUA 3ZE6A 4HYYA 4IILA 3HKBB 3HVHA 1OUMA 5DOVA 3X1WA 3T1YB 4S1OA 2EU8A 1WE2A 3SXHA 3Q3CA 2I1WA 3ST7A 4BEVA 1N92A 3GEBA 1QQAA 3K9GA 1V6AA 4BNYA 1GPAA 2GFIA 2HK8A 3E23A 3ZXIA 3JRWA 4UXHA 1YJ9A 3WK7A 1UWLA 4JLOA 2OHOA 4JLJA 3A6KA 1XI2A 2EEPA 4F3CA 3LSTA 2V7VA 4LOJA 4G0QA 4BRSA 1NMEA 2OSBA 4BC0A 2HT1A 1EWCA 1J1ZA 1LBSA 3S2IA 1GPYA 2P0EA 4KTAA 4M0KA 4U673 2Q4EA 2FPGB 4MS4B 1SFOH 3RR2A 4YCAA 2NN3C 1NVXQ 1YVDA 1ZZEA 3THYB 1CTQA 1E0JA 2RDGA 4RCNA 4ZVQA 4MGZR 3F7MA 1MFPA 4YMWA 2LTAA 3Q85A 5WRFA 1K5GA 2ES2A 4RZUA 1DG3A 4ZVLA 1CJCA 3R7WB 4QA9A 2WDPA 2DQKA 2FEXA 2CB9A 3HO6A 3IQGX 3RYIB 2QXTA 4UQOA 4RHTA 4B3JA 3TRFA 1IZYA 2NUPA 2B78A 4ID9A 4QLAA 6ABPA 4QUGA 2OHXA 1ZJWA 5I7VA 4RK0A 2OZLA 3DPSA 2HBQA 4C6SA 2R00A 1K5HA 4A76A 2F43B 4EGSA 1P9RA 3RJMA 2ZIEA 5CW2A 1L8OA 3DR5A 4X44A 1CUDA 1BS1A 2RGEA 4AS3A 4QUFA 1EFPA 4EYOA 1WTAA 3N76A 4JP2A 3I2IA 4MQ5A 5BURA 2EV9A 5JH7A 4F0JA 4QPNA 2F67A 5FA6A 4C7OB 4AJEA 4DS3A 1GPLA 5FAXA 4YQYA 2ACWA 1IG0A 3G2QA 3H5NA 4IKEA 3B5EA 4MDFA 2O8BB 4QU8A 3GJZA 1XYVA 1NF2A 1JG6A 1HL3A 4G6ZA 1EH5A 2HWXA 3VTKA 2QEXA 3KYJB 3L82B 5DE3A 3D1VA 4AX4A 2ZB3A 3F78A 3ZHTA 2Z2IA 4Q4HB 2HSJA 4RJ2A 4ZUIA 2IQ5A 1XQVA 1YA6A 4LF7Q 4EKEA 4QGBA 1HR0Q 3TSSA 3JWEA 5BQXA 2ZYTX 4DR5B 1C3OB 3KKMA 1N2CB 1P72A 4N47A 4I1RA 3GEPA 2F0OA 1OC2A 5U4XA 3GU3A 4DG8A 5C7IO 5HUHA 2O0HA 1KE1A 3I9JA 1ET6A 3VZPA 3Q6NA 1UDAA 4RX1A 3OTQA 5A3JA 3OEHA 3HPRA 5H82A 1Y89A 1ISFA 1N0IA 3OY2A 1Y80A 3BF8A 2X5KO 4URHA 3RBAA 4HUJA 2CLLB 1MJ5A 4C5AA 1AV7A 1FS6A 3D4OA 5EVJA 3RLIA 1MABA 2E4XA 3F7OA 2O8DA 2P8JA 2JDID 1W36B 2CFTA 1HT1E 1O5TA 2Q9CA 3OIYA 4IZIA 2C4TA 1ZM4A 1L9XA 4ZTUB 1DC8A 3GNLA 3O03A 4N3GA 4AIMA 4GNXA 4D4HA 2Y27A 5E4YA 3HOWH 2ZRDA 3E0XA 3D43A 1NOIA 1WW2A 4JEHA 3INTA 2ORVA 1YITA 3F4BA 5K1ZA 1XJCA 2H9YA 5SYAA 4J0JA 4JLWA 1JA0A 4HR7B 3OTOQ 3K81C 5EMKA 5CA0B 1TKWB 1V4NA 3PE6A 4PTZA 1GGMA 2RBKA 2G1JA 2R8YA 1A8QA 1HUQA 5BR8Q 1XPJA 3LCRA 3FKSA 2GPAA 4B3XA 1P6QA 4AROA 1IBMQ 3EIUA 5G3LD 2J4XA 1Q22A 3G5MA 2ZKLA 4WD3A 2DAPA 1PT5A 2JFGA 2OHJA 1LSUA 2C2YA 1MF7A 1KY2A 4RD6A 3P0RA 2QSZA 3OJOA 4OQFA 4GXRA 2BGJA 5IRCD 1E0BA 3DE4X 4ZZ0A 2PXCA 3OZCA 3RVBA 1NUAA 3QWAA 2EE1A 3ZQKA 4K8IA 1WL8A 2VWGA 4PQGA 3HOXB 3L9WA 3SBXA 3EN0A 1HDXA 3T5TA 2GD6A 5J59A 1HZZA 4C89A 4ZJZA 4J0HA 3K59A 5J3JA 4HH0A 1PK9A 2MR6A 4HPJB 1HEYA 3R0QA 3FPAA 3JR3A 5TEWA 4F45A 1NXVA 3GEDA 1IFXA 3OC0A 1T8PA 1SXJC 1UKZA 4N8X1 3VAYA 2QIOA 3CRNA 1R50A 3T5AA 4DV6Q 4K40A 2D2VA 4DLYA 3G7LA 1NVEA 4ZGGA 1LACA 4QGAA 2I0QA 4XSGA 3HA5A 3EBEA 1GKLA 1ZR2A 3M34A 4DV4L 2COKA 4IP0A 4HVAA 2B2UA 2QY9A 4R5MA 4DR4L 1H2XA 1L8AA 1ZH2A 2P69A 1CRPA 4HS4A 4IFBA 2IPMA 5BRAA 4UMEA 1E5DA 4HXFB 2Y0EA 2BBWA 4EBBA 5B6PA 4A3LH 5FUBA 3HKZB 1ULBA 3IFTA 4MZ9A 4RELA 4G57A 5AESA 2HCTA 3PLAE 3PRKE 3C6ZA 5IT5A 4BNDA 4N8FA 3HL4A 2V98A 2KW5A 1QKKA 4ZI7A 4CR8A 1TQDA 4ND1A 2BAGA 3EAGA 4NCAA 2WIJA 3ZC3A 2QB5A 2ZI5A 1P1IA 4YAUA 4CLXA 5L3QA 3EPHA 2PYZA 4AYWA 4A8TA 1OX4A 4XZ3A 3L0BA 3EMKA 1PU2A 1S02A 1FFGA 4HB4A 3SIRA 3A14A 2X0JA 1OAOC 5G4KA 3PENA 1EZ6A 1LV7A 3GQBA 3RS0A 2PBFA 3ZKWB 2A92A 5FTNA 5DHSA 3I12A 2F1MA 4IOJA 1MKHA 1WSBA 2DUWA 1YE3A 2WKDA 5JJBA 2C8LA 1UMCB 3EZYA 3FDZB 4YRSA 1F12A 4LCBA 5BYAA 2CCKA 3BA1A 4EHNA 3RODA 3G2JA 4P83A 3H1TA 1OA1A 3M8KA 3TVYA 4R83A 1T2NA 1I4WA 4UZEA 1HMPA 4ZU1X 3DDOA 1NW3A 2IKSA 1KEEB 2V5VA 1F2UB 3DXYA 1RCVD 4R8SA 3R0IA 4QOSA 2HLNA 2Y93A 1L5YA 4W4TA 1ZVQA 4ER0A 2C7OA 2VJBA 2X7XA 4LJSA 4FXOA 2HSGA 2EXZA 1ZRSA 4V0MA 3L8EA 3ZWPA 3IIIA 1RYMA 3QMMA 4RSMA 3SNKA 4KBYA 1S3OA 3ER9A 1E61A 4K9OA 3DOUA 4HSPA 3IV6A 1CNEA 2IPKD 3WNBA 4M49A 2HNBA 2PZUA 4CKCB 1UAGA 3U40A 5H4HA 3QJGA 4MW4A 4LJLA 4D3FA 5FV7A 1WTPA 4JUDX 3K15A 2YY5A 1Z29A 4O29A 5AJHA 3ROQA 5L9AA 1GCIA 1P8JA 5EZYF 1Q0TA 3VPFA 2R86A 2L0CA 4I5IA 4C4PA 1EP3B 4GGOA 5LOVB 1LNSA 2PGXA 3O7MA 4M22A 5FADA 4EGJA 4IGIA 3I30X 4LUZA 4ZRNA 2W90A 3JY6A 3FNHA 2ENBA 3SZLA 2V1XA 3GA7A 1AQIA 4CMEA 3C2PA 2IHTA 3W5JA 2JA6G 2I03A 2YKGA 3DA8A 4BO7A 1IWOA 3AR5A 3G2OA 4C3VA 4FWTA 4R84A 3S81A 1HH4A 1VP9A 2B5VA 2ZXFA 1K5DA 4LSGA 2MNAA 4DA4A 1NR7A 3G9ZA 1NBMA 3O4HA 1SZDA 1RM5A 3TLGB 2C5HA 3ZCUA 4X3CA 3E5NA 1Q77A 3R0JA 2IEZA 4RPKA 3T13A 3OKPA 4AZSA 3JATA 1SG9A 4OMFG 4EKYA 4UTRA 1E9AA 4WCDA 3WDLA 2JGRA 3ANNA 1J0CA 4OHFA 4CM3A 4C2MH 3RIXA 1DCKA 1KD1C 5CTAA 3ER0A 3CKMA 3K96A 1JWAB 2FP4B 1SKYE 3CXRA 2EQSA 5BW4A 5AM1A 4YAJA 1HOXA 1RLTA 1PJ8A 2W5UA 2RAUA 3HFZB 4RLSA 3TW0A 4C05A 2PZJA 1JR0D 2RHMA 2PRKA 3EH1A 1D04A 1ZG3A 3SQLA 4GR9A 3TJMA 4QIWE 3PC2A 3TRKA 3FYUB 4L22A 1YB6A 3Q0EA 3EZ9A 2II6A 2D1RA 4YDSA 1ILWA 5FNVB 2PX0A 3MMPA 1BCPF 2QW8A 5IEBA 1DAGA 1ENYA 4D8XA 2GF2A 1RTNA 4G4JA 1A97A 4CL0A 4QDKA 3Q8MA 2FRXA 1DQYA 2N49A 3I4MH 4G89A 2WJIA 2HYIC 3HCEA 7MDHA 1PFGA 1W35A 4DV7L 3O4VA 1L4BA 1GM5A 4KQHA 4GLVB 3L41A 2R8OA 3E8SA 4X7MA 4OJQA 4MR9A 4J07A 2HIMA 5IT9L 4UFNA 3RV4A 1HLFA 3L18A 1ZISA 4QXRA 4Q3BA 2EY2A 1QNKA 2X6QA 3S2HB 3R5KA 4W82A 1YJBA 1JFFB 3NXKA 4HTAA 4DIKA 4YBZA 1JQAA 3OJCA 1DTWA 1DOAA 2I62A 3F2UA 2WG0A 4GIBA 4IJMA 3JASB 1HXYD 3SOPA 1RQ7A 1Z26A 2PMFA 4AZ3A 1PH8A 1J7KA 4EENA 1NI4A 1JDSA 3LOPA 3KT8A 3REOA 1K8ZB 3BMCA 2A0XA 1XPUA 4F6LA 1QCCA 4BXXH 3KSUA 3ULKA 1TW2A 2B8JA 1AGYA 2YXNA 4PQFA 2JKVA 1G0OA 2LUOA 3PC6A 1G8FA 3STBC 3QR8A 5EJ7A 5IDXA 1JTVA 4DA2A 4DA0A 3TB6A 2Z3WA 1HE1C 4LOIA 3BZBA 2NO9A 4BMYA 1GNPA 3NEPX 4LFBB 2WT9A 1SWWA 5TJ9A 5KCMA 1WCYA 1ENCA 5LZ4A 4C1NK 4BMPB 4HN7A 1TTQB 4DYHA 1FP7A 1QCZA 4NPHA 1T5TA 2HDLA 2NYUA 1CJKC 3GJ8A 2Z5VA 3O0DA 4NS4A 3GWGA 2IV7A 2FMFA 3KOZA 2XA1A 1ZD8A 4V0OA 3SE7A 3WIOA 1U5CA 3VHXA 4BQRA 1A1VA 1U04A 1XTSA 2C99A 4QNNA 3FM9A 1CY1A 4DAOA 5FTWA 3OCUA 4BYMA 4UEQA 1Z4KA 4L9RA 1P44A 3GGGA 5LP6C 3VNAA 3KNZA 4A15A 2QUZA 2IIQA 5HF6A 2R92B 1JF8A 2RHLA 4MJ3A 3DVAB 1KJZA 2QP9X 3I23A 5JMTA 3MXNA 1J56A 3IR7A 4B7UA 1CCWA 5E2AA 4Y2GA 2IDZA 3PX7A 1FU7A 3G0IA 4OO1I 4B45A 4AFNA 1X1CA 1E5LA 1USVA 3TLAA 4DXDA 3MERA 2X5XA 3JAWA 2BGRA 4BO2A 2EYHA 1E4EA 1XA3A 3HK2A 4KXVA 3GMSA 3HDQA 3LS2A 4CLEA 1MV8A 1C9KA 3K0AA 2WWGA 1L5RA 4RJKA 2VQEB 3H0EA 2XA2A 2ZP1A 1XEFA 2WNIA 2B4RO 4NECA 5ALGA 4A3KH 3FE2A 3A1SA 2Z5GA 3WQSB 2C31A 3JZAA 3DFZA 2XMPA 4UHVA 3GJTA 1PR4A 2ZBGA 1OBVA 1L6RA 3V8QA 4AUEA 4FYKA 4X1KA 1DBSA 4ALIA 3MFQA 4NHOA 4YRFA 1ZVMA 5TNXA 4Z9XA 3NPMA 4LMQD 1QXSA 4CMKA 4PTLA 1Z5VA 3DHWC 4EJSA 2UVDA 1QRAA 4LF8Q 3Q7EA 2XGOA 5KTSA 4YT5A 3WK5A 4ZPXA 1GUOA 1PVDA 5GOTA 4WFQA 1OJ7A 4Y0NA 3ELBA 1YFJA 4XYOA 3G9XA 4DM7A 1B0AA 1YCFA 4I50F 2JGJA 5BXYA 3F6BX 2C4WA 5CT4A 1M2OB 4C7XA 3RAFC 1LF0A 5DWVA 3ABOB 2CLOB 2DJIA 3UO8B 2GBLC 3ZHVA 4COKA 3AGQA 4K5XA 2AG6A 3EUWA 4R41A 5IFLA 1CERA 2P2LA 5C5LA 4DIFA 4CFZA 4C4AA 4C5BA 2A4KA 1QAQA 1FDRA 2DHRA 5BN4B 5DOZA 5I9PA 3HM9A 2J0UB 3A27A 3ZDYB 2WHEA 4H60A 5ADVA 4LTNA 4WJWA 3IDZA 2JAOA 4ZC1A 2HHHQ 1S3GA 4EMUA 3LXRA 1EJBA 3R5HA 1PJLA 3JCZA 3T3OA 3UAXA 3KAKA 3QW4B 5C34B 3Q2IA 4KHPL 5B6IA 3T1HQ 2OZEA 3MLBA 3CNNA 5A4IS 1E7YA 2XD9A 5KKCA 2WU3A 1MU0A 4GGMX 2H2FA 4L08A 4NCBA 4BP8A 3MMNA 4BV2A 3KLPX 2DECA 3V8BA 1SVUA 4YJ2A 2R1ZA 4UNRA 4RY0A 4QVIA 1DAHA 3PDIB 2EYUA 1LO5D 3U3MA 4RDHA 4CEIB 3NAMA 1C0AA 1E3JA 4GYYA 4WOKA 4V1CB 2D1FA 1CB0A 3ZKAA 4BO0A 5JEAG 3ZHBA 3TSOA 1JHYA 3TUIC 2WTBA 2ZUBA 1NJFA 1SQ0A 2ZUCA 1JMCA 1EVZA 4CI9A 1XBTA 4DCCA 4O2AB 1IOZA 1MXHA 4MQMA 3W4KA 4EFKA 1TTHA 5FV4A 3I5AA 3CA8A 2R93B 1Y7IA 4EO9A 3CHBD 3KDFA 2BDEA 4J6FA 4K0KL 4JQSA 2J7PD 3TD2A 5AKGA 3ZCSA 2VF2A 5T8KA 2AFIB 4NS1A 3MWEA 2VHCA 1YJCA 3IESA 3GTQH 5C4XB 1DS6A 4CF6A 4LFCL 1ZUNB 4HG2A 4X1OA 4MQEB 5HDBB 1FQKA 3A7DA 5CVCA 3L6BA 4NXMB 4NAUA 1K08A 2WB4A 4HDCA 1CUSA 2KQUA 2G80A 2YJGA 2O3QA 4PNZA 1OLUB 3ZDFA 3KYDB 4HFNA 1G6PA 4OYRA 5C44H 4NQRA 1KETA 2EBFX 2CV2A 1JU9A 2XUFA 3S27A 2P9FA 2UUCQ 1IOWA 2REBA 1X7YA 4DQ0A 3LF2A 2WOJA 2AC7A 2P9HA 5M5WH 3FCAA 2WAQE 4GYWA 5TMBA 2RGUA 4D9FA 2B2CA 2B69A 1S8NA 1K3RA 9ABPA 1K06A 2MSDB 4O3MA 4UCQA 3WR5A 1HOTA 4GFDA 4R1PA 1K4MA 1UJNA 2OK8A 4UUOA 3NKFA 3UKJA 1G17A 3COVA 4OIMA 2J8ZA 3OG9A 5C7YA 1IG3A 5JSZA 5E8RA 1ZU4A 2FX2A 4DUYL 5KCZA 3JX9A 4JT8A 1DARA 1EK0A 2BFPA 3M2TA 5T57A 5KC8A 2DT8A 3GVCA 2QQEA 1E3PA 3KUUA 3ZNNA 3EPRA 3NDPA 1OWNA 4NARA 5ESDA 5E1DA 3UUEA 4UU0A 2LE0A 2A19A 2TS1A 3AT1A 1VJRA 2DQ4A 3CC2A 3TPZA 5JSUA 1QF6A 2VKQA 3I58A 2CK3D 4FUTA 4BMXA 2F0PA 5BYKA 3SZRA 5T3UA 3VKVA 2CNBA 4R1OA 2I33A 2JH3A 4OUDA 4Q48A 1C7FA 5ALXA 2QA4A 1M8FA 2BOVA 4RVFA 3GTMH 1LBHA 1KXJA 1NPDA 9GPBA 1AK2A 3GVIA 5ED0A 2NXCA 5GIOE 2VJPA 4N0PA 5M04A 5LSAA 2GAOA 1V5WA 3C3EA 3OT1B 2R7AA 5F3WB 4BVHA 1W47A 2PD3A 1RACA 5JI2E 5JQGF 1KTIA 3B9PA 3U3JA 2OILA 4GQIA 3M7IA 3C3PA 4O4IF 4AYBE 1QZHA 4W5TA 3WNZA 2XYVA 4QUBA 1XRRA 4BO4A 3PKZA 2OV8A 5KQGA 3RSCA 1XTPA 2VF7A 4NX2A 1MDFA 3PB3A 2Z4RA 4I4TF 1Q14A 1U8EA 1H0KA 4QGFA 3IHTA 2JLAA 1B8VA 5ALHA 4D8VA 5AW6A 4DLKA 4RGBA 4KK7A 2BBOA 1AKQA 3TPCA 2WD7B 1Z33A 4OP1A 2AN4A 1F5NA 3LYAA 2CGEA 2VXCA 3DP7A 1TZJA 3KLWA 2BC9A 2Z4HA 4YC7A 4L5TA 1L5FA 1UL1X 3U1TA 2QW7A 4W1PA 1J20A 4IO1A 5AIBA 3GP7A 2KMLA 3LT2A 1V6SA 2FPIB 3A05A 3DDZX 3HV0A 3GLTA 3TDQA 2AQKA 1SROA 4GKKQ 2A6ED 1LABA 3H17A 2WAQG 3CCJA 4YO8A 4QMGA 5T4EA 4ZCIA 4XM1A 1Y8AA 1LYLA 2C82A 3PFHA 4F2DA 1Y5IA 2WZCA 1JIUA 1P9NA 3F4LA 3G8YA 1CR4A 1BC5A 6CHYA 3M6VA 4LJ8A 5IBCA 4PR0A 1CJBA 3CVVA 4LTMA 4PRYA 3CMMA 2PG3A 2PFKA 2YWEA 2X0NA 4ZIRA 3D6WA 5IAGA 1LTID 2J6HA 5JS1A 3U6BA 5E7NA 3A3OA 3WGIA 3WGMA 1G60A 3DL4A 3L05A 3MB5A 1GHJA 4A3BB 1W5TA 3PBKA 3HXLA 3GFSA 3BGVA 3KO8A 4H02A 3FY4A 1RYBA 3T7AA 4CMIB 2VF8A 1S2OA 1U5BB 3RT9A 1A4UA 2WJ4A 4BY1H 3DBOB 1WCMH 4DT1B 1AKYA 4EZEA 1ZRHA 3QU2A 5IC6A 1VBFA 1TT5B 4BY9E 1ZSNA 1ZJ5A 2Y0PA 4RXUA 4JI7L 3M6AA 1FZTA 1I9GA 3KJNA 1R4PB 1WMEA 2VZ0A 2AD5A 3LJKA 1AXRA 4A91A 4WKGA 3S5UA 4IHKA 2W70A 4NE7A 5KX5B 1DONA 4I6EA 3L1IA 5BSWA 1A2TA 1X9GA 3I2GA 3S68A 1ZX1A 4NABA 5IWAQ 4ZV9A 5HA5A 2R6AA 1FUEA 1C48A 5LR6A 1QG6A 1UM9B 2X0DA 3MM4A 5FWYA 4G09A 2ECQA 3OJEA 3HGBA 4PAMA 3CW8X 2D5IA 3L7AA 5EKUA 1UKCA 3CQ9A 3PO2H 1KAEA 2WU4A 2JC3A 3B3AA 1KNAA 4HAOA 3BFPA 4QNMA 1XA0A 4ZYLA 2WPDD 1VHQA 4FLEA 2I0FA 2J9FA 4YT4A 1L1OB 3LT5A 2MU1A 1G38A 2HDOA 3LPAA 1EY4A 2ZXRA 1OV6A 3EPJA 1E9DA 1A9ZA 3NK9A 2WWXA 4NI5A 1J7JA 3UJHA 2VYND 3RRBA 3ZTWA 5SZKB 3U5ZB 4G7ZC 1SU8A 2HLDA 3UVEA 3KUPA 2FUCA 3HJUA 1VFNA 1N34B 3RYHB 4WNAA 2XMSA 2JGNA 1P0IA 2JGFA 2IBSA 1KJJA 4B3TB 1J6QA 9LDBA 1RVDA 4NHEA 1FYEA 1N5KA 3VZRA 1OWPA 2J3IA 4FFNA 1NNLA 1H2WA 1JEDA 1F1BA 4PF1A 1C80A 3DD1A 3THXB 1IMJA 2WU8A 2BUBA 5P8WA 4B81A 2CZGA 4BBRH 3I8SA 4KOAA 1GL3A 1X1DA 4UAVA 1DEAA 1B8OA 4L9SA 1K6IA 2PMBA 4PG8A 3JQFC 4OAPA 5DGDA 1L7RA 2YNMA 2NO6A 3OAAA 3TIVA 1LFDB 3AEKA 1SBIA 3RRXA 3K0FB 2BISA 3RGWS 2PLFA 3C6XA 4GZMA 3TI7A 2R8PA 5JSHA 3OM9A 4WFJA 4QPCA 1DV1A 2J59A 3F9CA 4RANA 1RE0A 5DHTA 4NNJA 2X40A 4NC9A 1KEPA 2EX1A 3E9ZA 4FHEA 4ZJUA 2PJZA 1X7XB 1JFLA 4AP5A 2P5YA 3RRYA 3E15A 1FDWA 3WL4A 1VQ1A 4OWWB 3V1UA 1WR8A 1KJWA 2Q3LA 1A3UA 1N32L 4GDMA 4K9KA 4RQTA 5EFZA 1SXJA 1S3FA 3H6HA 1ADFA 3O6VA 4R4TA 3TZKA 1NASA 4I3HA 4ARZB 4B1FA 2F3TA 3UATA 2OB1A 5IUNC 4M7OA 4GMDA 3D4LA 4XWTA 4X64L 2I91A 2NVQH 5LYJB 4P0TA 1PW5A 4R1JA 1GVNB 4KNVA 1QCDA 3NKVA 4CMAA 1PQUA 2XTNA 1ZHOA 1G19A 2QRMA 2GVDC 2DZDA 1NF3A 5TB5A 4Q4DA 3LH5A 5EXEA 3W3AD 3R9XA 2SICE 4JI5B 4ZHSA 3OF5A 4MUHA 3H1GA 2IYLD 1T8SA 1NN1A 4AUNA 4BGEA 1P61B 1ZJ6A 5CA1F 3EXHB 1P45A 3F0TA 1XX8A 3K05A 3ETJA 2P9BA 3ZK7A 4N54A 2ZYSA 1J99A 1X42A 2RKBA 2ESRA 2OBBA 3M4YA 3KU1A 2HCRA 4G4KA 4QRDA 2HRBA 3VR2D 4WA7A 4QYSA 3PIO3 1OC4A 4JP1A 1U6JA 3S14H 2I2BA 1WKVA 4BX3A 4CLHA 3CBGA 4X63A 5F2KA 1PCXA 3L1HA 1J2RA 3JQBC 2B4AA 4A93B 4B9WA 4EVQA 5EXXA 4JI4B 2XSCA 4ID6A 3ZWXA 1OXXK 3DOJA 3VJKA 1GRVA 2WM2A 2XCRB 4GKJB 4ZK2A 3X0DA 1G8KA 4WLVA 3HJNA 1A7JA 5KZMB 5DLQE 1TADA 5HIIA 4F56A 5E6UB 1DZIA 4LJ4A 1L5LA 5EXTA 4TUYF 5DSXA 5CYFA 1WVIA 3ZE2B 3H9BA 3A8JE 2YIMA 3IXMA 3ETEA 1DOLA 4GN3B 1NOJA 4R81A 3G7NA 5BSKA 3MUFA 1GVPA 2AKYA 1AUPA 3I28A 2GXQA 3R7BA 1JQYD 1ZGBA 1IPHA 1DU4A 3BJRA 3I2FA 1VG0B 3KFLA 5LZ9A 2G70A 5IKMA 2ZYGA 3EWAA 3P94A 4HYQA 3NP9A 2G88A 4KRXA 2OV1A 2X1LA 3PGKA 4PM4A 5AVKA 3SQOA 1CR6A 1EHCA 2H16A 2HZBA 4N7MA 4MGYR 4JI2Q 4NAVA 2N3ZA 4B08A 1NP3A 4CDEC 3C98A 1P1KA 4FYHA 2GUGA 3M4XA 1L7PA 3TFOA 2NUAA 1VJTA 3L4KA 1W0JD 2Q0QA 3EGOA 1GAWA 4QDJA 3KKEA 3PRYA 3RGGA 3THOA 2PX3A 4HSVA 3ZPXA 3IKMB 4TMXA 3CUYA 2I29A 4X45A 1TIKA 3IJ5A 2BGLA 2OQRA 3EMBA 4K9NA 3K1YA 4L74A 3RSSA 3RUPA 2ID9A 4HZUB 1D07A 3ZVRA 2GDZA 3S17B 3IA2A 4CCYB 3O3OB 4EW2A 3N0WA 4XPZA 2FZEA 3CLVA 4F12A 3H2HA 1VXRA 4MUBA 2V6FA 5EUBA 5MF6A 4KPFC 2AJ8A 2QVZX 2GTIA 3H0GG 2XEXA 1FNSA 3X1ZA 1VA5A 2BDNA 2JPDA 2GA8A 3RC7A 5E1MA 3KK0A 1TA0A 3LUCA 4RUKA 2HWKA 2ZTMA 4M1ZA 2X19A 2F0MA 4Y2QA 3KOXA 4YQFA 3G49A 4J7AA 4FMBB 1KFEB 3E7PA 5KRUA 3TYXA 4NG4A 3BPSA 5JPCA 3VZBA 4U6SA 1PZFA 1XSEA 2FN4A 2H5JA 4TYYA 1T9AA 2JKZA 4B8ZA 2L69A 1RJWA 4DMLA 1PS8A 3VGPA 3CEMA 4BFZA 5JJCA 4WBNA 1JLLB 4AMZA 4XOUA 3FPPA 1NDHA 1B8UA 3TCXB 3GHHA 3SHFA 4BLWA 1QRTA 5LDHA 2Q50A 3HBJA 2P4QA 3VKGA 3SLKA 3HP1A 4I65A 4FT2A 3GT0A 1R4QB 2VO1A 1FFAA 4MPDA 4C4TA 1CQXA 4OWTB 2X4DA 1E3IA 2G67A 2Q5EA 3U4VA 1GQYA 4HBZA 1TMGE 2RCNA 2Z09A 1YJAA 1KJNA 1Q0PA 1ZM7A 2GEKA 2WIBA 3PA6A 3C5EA 1DHRA 1XVUA 2FG5A 4JB0A 4RPGA 5DYNA 3H9UA 3H91A 4FGJA 3VR4D 5IP9G 1IL0A 1UZLA 3EIVA 1GUGA 4N0EA 5AKJA 4TVAB 1FRFS 5CNMA 2QMHA 1MO4A 2XX3A 1C50A 4F9FA 2PGLA 1GLNA 1SULA 3TAXA 4RSGA 1P91A 1EUZA 3E81A 4YRJA 4I08A 1EDBA 3MJRA 3IR5A 5AW7A 4KCGA 2XGTA 3PEFA 2Y1GA 3OC6A 2Q3JA 3T3DA 2CHUA 1UP6A 4FXGC 2WM8A 1YS1X 1IHZA 1NA5A 3IPYA 2B34A 1XXGA 2AKEA 1VL6A 1II0A 1XU4A 3TE6A 4KWIA 2O2EA 2IZ7A 2G0TA 2OO7A 4IXWA 4DREA 5BVGB 5KU1A 3UV7A 3LU1A 3PP8A 1VE5A 5JQWA 2ZSUA 3GVHA 2JA2A 4J1MA 2ASBA 3H5VA 5J2UA 3OEED 3AR2A 3A3KA 2NO4A 2W6IA 1FVIA 4DLUA 3C43A 1MB4A 3JAML 1OXVA 2F0VA 1RYHA 2WVAA 2DEUA 5KKNB 1ZLYA 2J4DA 1KYYA 5L7TA 1JS1X 1DGQA 6ADHA 3R3OA 1GADO 1YQUA 2J87A 2WHPB 3EDOA 1GNLA 3MAQA 2AXQA 4KAAA 2VSOA 2A86A 1A96A 1BRMA 4HP8A 4YYZA 3FXAA 5DCYA 4TYPA 4BPBA 1XZQA 3WIBA 4OUKX 3W5IA 2VSYA 3SF8A 3R6WA 1JKJA 2SBTA 3PF8A 5FPKA 1T5DX 2IU3A 4LY6A 4DMGA 1Z15A 4NH0A 1CULC 2DHQA 3QIAA 4CF4A 5KVAA 4CMBA 3NBHB 3PA8A 3AR3A 1EA7A 4MUMA 2V6MA 1KLUD 2EGUA 3A9UA 2OHGA 4LSZA 3JQGB 4OA5A 1JIJA 5JEEA 5CORA 5GJCA 1WNTA 3MILA 2HJHA 2JFZA 3ZE7A 1K1EA 4PBRA 5CNIA 1FTSA 5JUWA 2JLVA 4PZZA 1WD5A 1JYFA 4Q3OA 1N1EA 5LP6A 1K2VN 1DT5A 3A1UA 1GG8A 1QGAA 4K86A 3Q8DA 2VUMH 4PANA 1ZDMA 3UAZA 1OTYA 4HNAB 1PJQA 1J42A 5ARCA 1QZUA 2UUAQ 1RJEA 3QVJA 1EX1A 3GT3A 2DC1A 1CG6A 4KXNA 4M38A 3VUEA 3OE7D 3SZ3A 1X38A 2A6HC 4JD5A 4QYTA 4NCIA 3G89A 2NVYH 2FW7A 3JWGA 4AO7A 2AQIA 4PGMA 1QLWA 4IUPA 5SV2A 5EZQA 4LBZA 1WZCA 1MVNA 4ZAWA 5EJFA 1J8IA 4F1WA 1O96A 3WRVA 2DLCX 3D7NA 3KLOA 5GM2A 4G85A 1UCFA 2YTVA 3L06A 3WIDA 2VJKA 2GZSA 2DP4E 1F0YA 3IIMA 2C2MA 4K88A 1UFQA 1DXOA 4CMCA 2QMEA 1MAUA 4A5SA 2OT3B 3S99A 1X7DA 3R41A 4K6GA 3VOBA 4F7WA 3OQIB 1JWLA 2MSLA 1GTRA 3OA0A 4CM8B 5CV6A 3GGDA 2RSOA 1BR9A 5KPJA 2UZIR 3PIIA 3N8HA 4BC1A 3K1TA 2L12A 5FO0A 3MXUA 3FNRA 5IJXA 2VK8A 3Q5DA 4IHJB 4YRZA 4B5KA 3GTPH 4YAFA 3KZXA 1O54A 2YJ5A 2BKAA 1HK7A 2PBZA 2D74A 1T6BY 1JHVA 3O38A 1PRYA 4JI1B 1GV0A 3IUNA 1FJHA 1XUOA 2IYTA 2H2HA 1PHPA 2GBLA 1HDGO 2R44A 1J2TA 2R6R1 3CVOA 3HNPA 4CG3A 1RVV1 1N1GA 3Q41A 3LQKA 1SMYD 1ZNWA 3RS2A 1ZD3A 4JK1C 1PTOD 3TAHA 1CVRA 2BFCB 4D42A 1RBYA