3FVQA

Crystal structure of the nucleotide binding domain fbpc complexed with atp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
348
structure length
343
Chain Sequence
TAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLGRLPVQSGAPAGTRGTLLIRPEQYSLHPHSAPAASIHAVVLKTTPKARHTEISLRAGQTVLTLNLLSDGISAVLHLDGPALFFPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fe(3+) ions import ATP-binding protein fbpC
publication title Insights into how nucleotide-binding domains power ABC transport.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Hydrolase
total genus 87
structure length 343
sequence length 348
chains with identical sequence B
ec nomenclature ec 7.2.2.7: ABC-type Fe(3+) transporter.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17845 FbpC_C_terminal FbpC C-terminal regulatory nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.450 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fvqA02
2.40.50.470 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fvqA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fvqA01
1OV4A 4DDUA 3AKEA 3BC1A 2C95A 5D3MA 1VTKA 3LBNA 4EAQA 1SHKA 1IXZA 1HH4A 3EA0A 1G8FA 3LW8A 4EDHA 4GZLA 2R2AA 3BAFA 1OH6A 1OIXA 2EQBA 1G8GA 1YQTA 5K8TA 3KQNA 4RD2A 3Q8XB 1TU4A 1R5BA 5L3RA 1TQDA 3ZGXA 4A1FA 2O8FB 1WQ1R 5JLJA 2ZJZA 2QAGB 1XXHB 3PFIA 1QHSA 3BS4A 4NCNA 2HCBA 2V1UA 2D2EA 5FR2A 2WJHA 1I4DD 3H1TA 3BFVA 2OT3B 2ZSAA 2C9OA 4Q9HA 1CS4C 1Q21A 3M6AA 4HB0A 5CYOA 2O8FA 5JJKA 5EE0A 2OO7A 2OCYC 2QN6A 3CH5A 2QAGA 1XXHA 1EX6A 5DN6D 1ZNZA 3NBYC 3PG5A 1W47A 5DI3B 3U6BA 2GJ8A 3TUIC 1D8TA 3KTAB 3QKUA 3GQBA 4W9MC 4E03A 1E2EA 2JEOA 2ATXA 2GWHA 3VKHA 4DIDA 1X3SA 3ASZA 1VMAA 2F9LA 3ZVLA 4PTLA 5AUNB 4XVRA 2OCPA 1G7TA 2NZ8A 4BLSA 3VX4A 4YQFA 4HB4A 2OAQ1 1YJ5A 2JJ2A 4DEYA 4OK3A 4E09A 1HYQA 2X1VA 3THOA 3FDIA 4A92A 4DLYA 1HQCA 3ZZTA 2VL7A 1AQYA 4N0DA 5JJLA 3ZH9B 4Q48A 4B3CA 2GA8A 3AH8A 2YINC 3LQQA 4HDQB 4DBLC 2QZ4A 4EJSB 4XWOA 3EIHA 2WPDD 4RKFA 2FPKA 1E3MA 5DHFA 5JWRA 4DLRA 1Z29A 1G41A 2FA9A 1GKIA 4FMCF 3R8CA 1A1VA 1W4BA 1FW6A 3B1XA 4XWKA 1R6BX 1NBME 4OI4A 4A9AA 4HDCA 1VCNA 2W6ID 3KJIA 1R8QA 2Q9CA 2VPPA 5A4JA 1HE8B 4AY2A 4LJYA 3AVVA 1VPLA 4MQBA 3MWYW 2ODEA 3O47A 1P4SA 3AP3A 1GVNB 3CR7A 4CYMA 2RGNA 1KY2A 1OKKD 2QY9A 5TV2A 1TPZA 2C9CA 1KTVA 2Q9AA 3F8TA 3Q5EA 4FXPA 1GUAA 2EFDB 4QGHA 1IM2A 2Q3HA 2V4ZA 4RZ2A 2QSZA 4S2EA 1YVDA 4B74A 1IXRC 1QHNA 2PT5A 3NEYA 1LF5A 3SC3A 4KLZA 1UKVY 1EK0A 2WKRA 1E2KA 5EE1A 1CJKC 5EXXA 1VYUA 5CB6A 721PA 2HYIC 3EZ7A 4POAA 4K8OA 4B32A 1G6OA 2WJVA 1MR3F 1RIFA 2ZI7A 3NVAA 5CLLA 3W8NA 1UKEA 1SVWA 1JNYA 4HLQB 2GXUA 2G1JA 3DMNA 4IOLA 2REBA 1KNQA 3EPHA 3ICQB 2ZUDA 5H8WA 2CNWA 2YVUA 4RD4A 3VNUA 4LJ9A 2ZYVX 2IYSA 5KNDA 1XPOA 4CT4B 2OFXA 2ODNA 3J81k 1NSTA 1FP7A 1SXJC 2IYYA 2QPAA 2VHUA 5EP1A 3ZZ0A 1W0JA 1NMXA 1G1MA 1XPRA 2JJ1D 4LWZA 4Q9KA 2ZJYA 4AKEA 3RABA 3RANA 4B47A 1TQ2A 2A78A 4BLPA 2OM2A 3QVVA 2PH1A 1ZJ6A 4TT3D 5BQ5A 2O8EB 1V43A 3FMPB 2AXPA 4UNQA 4HLCA 1Q1BA 2W2VA 1NVXQ 4B48A 1L4UA 3ZZUA 2ZJOA 5FTLA 3HU1A 1GRRA 4LHZA 1XMSA 1QG2A 2OBLA 2XOKD 2NG1A 3W5JA 1E9BA 4MKIA 3QPWA 3WP0A 3TGPA 3CB4A 621PA 1TNDA 3PJRA 4JYBA 1DAGA 2ZXUA 3D7MA 3AKYA 3K09C 1D5CA 3L0PA 3QXSA 1R2QA 2Q6TA 3ZLJA 5B57C 2JLWA 5GVSA 1XZPA 2TMKA 2WWYA 1PLJA 1VG1A 1K5DA 4AG6A 4B75A 4EQ6A 4XOIA 2OLJA 1KZ7B 2WJYA 5KHOC 4Q03A 3QUSA 2ZE6A 2EVWX 4G01B 1W36B 2DFNA 5FL7D 3GFTA 4NH0A 2H1LA 4F4IA 4CVNA 2O52A 5J4KA 2VP5A 3TVDA 3SI7A 4B6FA 2BMFA 4BZQA 5FUXA 3MWKA 4BGDA 4JSYA 4QBFA 3RRMA 2OV2A 1ZCBA 4BLTA 2GAAA 5M04A 2BJWA 2BKUA 2QMUA 4ZCMA 1QVAA 1N6KA 3FKSD 1L7VC 2ZRNA 1ZW6A 2ANBA 3LVQE 2W0MA 2QGZA 4XD7A 2DR3A 4Z8YA 1RFLA 2ZI9A 2J0SA 3AVXA 3A1UA 2IA5A 1LB1B 4P4SA 3QXJA 3K70D 3I61A 3G5UA 3QIAA 2QTFA 3ASYA 3LX5A 4TLCA 5FPTA 1RRCA 5FTMA 2HF9A 2X77A 4MUAA 3I1FA 1XTKA 5FL3A 1PZNA 3Q3JB 1IN5A 2FN4A 5FI1B 1NIPA 3RC8A 5GVRA 2DYKA 3UKDA 2XEXA 4WZAE 1OFUX 1Z6AA 5FOSA 3VHLB 2RAPA 3DM9B 4D4MA 2O0JA 1KOFA 1E0AA 2ZRLA 5BN5A 1G3MA 2GXSA 4HAUA 2IYRA 3TH5A 4X8OA 2ZJBA 2REXB 3H0KA 3F0TA 2HYDA 1JXOA 5AUPB 4QJ3A 1HY3A 3ADDA 1W0KD 2FFBA 3B6EA 4DVGA 4O0MA 1E4VA 2WWXA 3NHBA 1N5LA 2ORIA 3KJGA 2D7DA 5E3HA 3K0EA 3CM0A 3DDCA 5AUOB 2D3WA 1W4CA 1Q3HA 4L4UA 1IY2A 4ZDKA 1P73A 4MGYR 3LD9A 4LJ4A 4OKSA 2ZRMA 1CJTC 1U81A 3DKPA 1CJUC 4I1SA 4D4LA 4JYCA 3GJ6A 1E9DA 4BFXA 2DFKB 3TQFA 2BEKA 2B21A 4MGKR 3BIFA 4OHWA 2GETA 4TQAA 3B7GA 2C04A 4CIDA 1W2GA 2Z4SA 3KQUA 3GJ4A 2BMEA 4LJ8A 2J3EA 1HT2E 1Q44A 3DOEA 3H84A 3AEZA 1U98A 3BRWD 2Z4RA 5G40A 1XEWY 2JJ8A 2J9RA 1EGAA 4DC9A 1N5JA 1XMJA 4BFZA 1RYHA 2OFOA 1QF9A 2YWFA 3WHKA 1U0JA 4RZXA 2JIZD 2OEPA 3QOFA 3TIFA 3KQLA 2BBSA 4BRWA 1BYIA 5KOYA 1T8UA 3Q7QA 1HUQA 5J4YA 3TSOA 4QHYA 2ZTSA 2ZETA 4PSKA 2OXCA 2F43A 3U2QA 2OHFA 2GRJA 3L8ZA 1LNZA 2PMDA 2ZEJA 3CNLA 3U7HB 1SXJB 1VG0B 5BXQC 1A5TA 5TB5A 4G5SA 3A4NA 4V0MA 3C8UA 4DB2A 1YRAA 1XB2A 3THXB 5ELXA 4M1YA 1X8KA 2RGCA 4JLBA 2WMNB 1SXJA 4UXJA 2FZ4A 3I8SA 1QG4A 1JXMA 3TNFA 4WVFA 5EP4A 4JLVA 4HAXA 3P32A 3THXA 5JJIA 2IUUA 2GNOA 2PEZA 4BFYA 4KI0A 2QPTA 5AWFC 4E07A 2WAXA 4DLZA 2QT1A 1XJQA 2OCBA 1G3IA 2NPIA 4X8LA 2ZJ5A 3B5JA 2CLSA 2DFLA 2RH5A 4QXAA 2PJRA 3T5DA 4Q1BA 1E2NA 4YMVA 1QHIA 3CX7A 3FKQA 1T3HA 4HATA 5DISB 2PJZA 3OEED 3B9PA 1G19A 3FFBA 3DZDA 2R65A 4HLDA 2O0HA 1FMJA 1P7CA 4XIGS 4QOSA 1IY0A 3U7FB 4A6XA 2ZE5A 1DOAA 1WBBA 3K09A 1X6VA 1Z22A 2ZYTX 3BFXA 4HLUC 3DL0A 1JR6A 2ZANA 1ZINA 1E2LA 4NCHA 2GJ9A 2ZRGA 5EQTA 5FOVA 2HJGA 3N2EA 5FBWB 1OIVA 3KZ1E 1AA9A 4FCVA 1D6JA 4RCYA 1LS1A 2JLQA 1XTJA 2A5GA 1FX0B 5CITA 4CEHA 2PEYA 4JJKA 3TW4A 1ZCAA 2WWFA 3PUXA 2P6UA 1M2OB 3REGA 1KK2A 1U9IA 4ZKDA 2F3RA 3I8XA 3LVRE 3PR1A 4BEJA 1E2PA 2PBRA 2BHRA 4C0HA 4QM6A 3IQXA 3MGCA 3LBIA 5F98A 1E2JA 1KDTA 1XP8A 2XJ4A 4RD0A 4JT2A 2OZEA 4QNMA 1NP6A 4MH0R 5F9HA 3BBPA 4LHYA 3KFVA 3FMFA 3SEAA 4XSHA 5J4LA 1KSGA 2JLVA 1N25A 4GRAA 1IN7A 1Z47A 2LWIA 4KODA 1FTNA 4PO8A 3HU2A 2IXGA 5JMTA 4KHZA 2WWHA 2HXYA 1LTQA 4KCGA 2UZ3A 3ZQJA 1JI0A 3N2IA 4MYUA 1U8ZA 4IHQA 4KSCA 2JJ1A 5BN4A 3HPQA 5JI2E 3AF0A 2OILA 1ZC4A 4JLKA 1M7BA 2ZR0A 3OEHA 4I1VA 2WSMA 1ZC3A 4OBEA 4EPTA 4FMDF 4MGIR 4C7OA 2PX3A 4C0KA 1FQJA 2W2TA 4PXAA 1RZ3A 1TUEA 4O2RA 1EFUA 4PPGA 4M9ZA 2JDIA 3AF4A 5KDDA 1OT3A 4ASUA 1HE1C 2GDJA 3U7EB 1TL7C 2GZHA 2AWOA 3PV0A 4NP6A 3GLFE 1KI7A 3L82B 1E2DA 1DAIA 2D2FA 4ZV4A 1ZUNB 4D25A 1G64A 2WVJA 3O8CA 1UF9A 1P2VA 3HWSA 1KJZA 2XZOA 2QORA 2C2HA 1H8HA 4EPRA 1NL3A 4BEBA 3WBKA 3K9GA 2E1RA 2EFEB 4NKRA 2QAGC 1E79D 4D26A 1CLUA 4WAUA 4KBGA 4DUGD 2ZAOA 5LD2B 4OI1A 2AFHE 1RVDA 3DO6A 1H65A 1B0UA 2WBLC 4PPFA 2QAJA 1FMLA 2BV3A 4DKXA 4FMBB 3EZ2A 1BKDR 1HURA 2H5EA 1GRQA 1HT1E 2VF7A 3CX8A 4LHWA 1E2HA 5J47A 1IJFA 1DELA 1SVMA 3C41J 4XWAA 3M4YA 3AVPA 4PC2A 3K0AA 4J0QA 5JBQA 5IRCD 1DAKA 4OHYA 4IRUB 4IOMA 3PEYA 4AK9A 1KI8A 4TWZA 1OH7A 1ZUHA 4DCUA 2EFGA 4C2UA 1NVWQ 2ZSDA 1E9FA 4RSGA 1J8MF 3K0FB 4Q9IA 4IKEA 4KBFA 2ZITA 5FI0B 2BWJA 5D3QA 2PMKA 2F55A 4FMCB 4PR0A 3CIOA 3ADKA 1G6HA 4QHTA 5CJ2A 3V4FA 1XTRA 2J45A 4I4LA 4OYHA 2P2LA 3L0OA 4Q7MB 3RNLA 4OK5A 4EJSC 4R71A 3K0FA 4URWR 3SS8A 3W6NA 3OHMA 3ZIAA 1CU1A 4F4JA 5DE3A 2NMVA 4DLVA 5GADl 1ZNYA 2FEMA 1Z2CA 4DZZA 4B73A 1S4QA 1AKEA 3ADBA 1TTTA 4A0FA 1JQJC 4IDNA 3A1TA 3WNDA 2XB4A 1IN4A 5FBLB 4BLOA 3KKPA 5J40A 2A7QA 4KV9A 5EXPA 5FTNA 2B7BA 2FSGA 2RGNC 2QTHA 1G16A 1SQ5A 3ZVRA 3PEWA 3U7GA 4LK2A 3F3YA 3P4XA 1NSFA 4TSFA 1M1YE 1O87A 2OXRA 3T1OA 1WBDA 1P2UA 2ZRAA 1A2KC 1YKSA 2XX3A 4V03A 2Q0HA 3AUXA 3FMIA 3Q72A 2R6FA 4Q19A 5EP2A 2AL7A 1OPXA 3QEJA 1KNXA 1XCGB 3W5IA 4KSBA 1II8B 3IIKA 4Q1DA 3Q9LA 4Q1EA 2BKEA 3K0CA 4PSAA 3BXZA 3I72A 2WSSA 1OXVA 4DXAA 3OIVA 2EYUA 3CWZA 3L2OB 1AZTA 2WIAA 2JLYA 2HCJB 5KSZA 1G5PA 4L9WA 1DPFA 4M8NE 3SJAA 1KI1A 2D4HA 3SE0A 3FTQA 2QG6A 1Z63A 2Q21A 2ZPTX 1W46A 4Z8XA 3HP1A 1H8ED 4HLUA 1KK1A 3AVOA 2VLIA 4TMVA 2BVNA 1XRJA 5AJYA 1G4AE 2IF2A 3LV8A 2MSDB 2PLRA 3MRSA 1NLFA 4ARZB 2H18A 1NG9A 1UFQA 4Q4JB 4ABYA 2FNAA 1UM8A 5ANRB 4BASA 3FE2A 1NG1A 1LS6A 3DM5A 3C16C 4NMMA 2XAUA 1G7RA 2FPMA 1E2FA 3QKRA 5BN3A 3CKLA 1F2UB 4US2R 1E1QD 4KFRA 5FPKA 5SZIA 3S1AB 4LBVA 2WZQA 521PA 4GSYA 4ARZA 4ZDJA 1NJFA 4Q4JA 2O0KA 5AJXA 2VIIA 2DBYA 2FF7A 2W6JA 3QI2A 3SNHA 4KJZA 1Q57A 1Z8FA 2W0SA 3FYHA 1F2UA 1Q22A 3AF3A 1AIPA 1VYVA 4MDEA 2X2EA 3S1AA 2FDCA 2ATVA 1BO6A 4KO8A 5IK2A 821PA 1Q1QA 2CJWB 4EPWA 4JLMA 3AVTA 2QE7D 1VIAA 3R20A 3LX8A 1ZM2A 4NCIA 2BC9A 4LC0A 1PUJA 4A0HA 2F7SA 2IL1A 3TQCA 3GLGB 1N6OA 3HJNA 4DLWA 1GNQA 1Z0FA 3CLVA 2GF9A 2CCKA 2AD5A 3RAPR 1SKYB 4Q9JA 4HAZA 3L43A 4FW9A 3KL4A 5GJBA 1W44A 2GK7A 3QG1A 3CRQA 3KKNA 3GLGA 1RYFA 2YOHA 3OZXA 5JRJA 1F60A 4RD6A 1W36C 2WOJA 3JVVA 3BE4A 1W48A 1WE2A 1K5GA 2YWEA 3EARA 4WZBE 5HR5A 3FGNA 2CE7A 4G5OA 3FHTA 1GITA 4ZDWA 4JT4A 1JEEA 1T0HB 5A5GA 1JJ7A 2AFIE 1TU3A 3W6OA 1AZSC 1CTQA 2OAP1 1KDRA 2J7PD 3BK7A 4IVRA 1E32A 5K8UA 1PVOA 5FBRB 2JLZA 2XGJA 4G3XA 5J4VA 1T4GA 1A4RA 1VDZA 4Z54A 2CVHA 2QM7A 2NO9A 2GILA 2RGDA 4G5RA 4A0RA 4C0LA 4P31A 4TLBA 2IS1A 1G20E 4CT5A 5DGXA 5KTYA 1U90A 3PCRB 2QBYB 2GZAA 3D31A 4HUTA 3KB2A 2J1LA 3LLMA 4M4SA 5DI3A 5LBIA 2V7QD 3EC1A 3NC0C 4PC3A 2KBEA 4R2IA 3KTAA 4OQFA 3SHWA 3TSWA 1DBSA 2FU5C 4NYJR 2HXSA 3LWNA 3NDBB 2QBYA 4C3ZA 2DPXA 1KKMA 3N70A 4F93B 3NBFA 2QROA 3WYFA 4C0AC 4M1TA 3PXGA 4B33A 2WJIA 1FPMA 1PLKA 1NN5A 3VX3A 1JJVA 2HDNB 3KFXA 4XSGA 4AC9A 4Z1MD 4P4UA 3SBDA 3P4YA 1NMYA 3W3AA 4YDSA 4CEIB 1ZAKA 3QG5A 3Q5DA 2KI5A 4YMUA 4GMDA 4HUQB 4JLNA 4OI0A 4FINA 2YJTD 3I5XA 4R7ZA 1E0SA 1E96A 4CEIA 2XTNA 2GJKA 4EJSA 2QRNA 1KZGB 3B1ZA 2RGGA 3HR7A 1KO4A 4HUQA 3REFA 1OXSC 3L0SA 1ZMXA 3P26A 4WZ6A 5EZ6B 4M9XA 1US8B 4YDHB 3B13B 2C8VA 3FMOB 4IDHA 4EPXA 4ZCLA 2BM0A 2JAQA 1NF3A 3EW9A 2ZSFA 3RRYA 1G17A 2PL3A 1UADA 2B8TA 1US8A 1E2GA 2YWGA 1E0KA 3C14C 3G0HA 2A5YB 3WNCA 2UVQA 4KITB 4LHXA 4B2LA 2DHRA 1ZBDA 2KSQA 4JL8A 4N1AA 1OIWA 1C4OA 3A8TA 1J8YF 5FUYA 4CF7A 2GJAA 2EW1A 5HCNA 1QBKC 3JVUA 5GJWC 4DDTA 2O8CB 2R6AA 3IQWA 5CDFA 1XTIA 5DI9A 3ND9A 4LUCA 1GM5A 1JALA 1NNEA 4DLXA 1QHHB 1M7HA 2DWOA 2R44A 5F3WB 3W90A 121PA 4A15A 4GOXA 1EWQA 1N5IA 2EFCB 3GLFB 2IYLD 5JHHB 3SR0A 4MYHA 2O8CA 1L8QA 3VKWA 1CF4A 3MSXA 5G41A 6Q21A 1NKSA 1FP6A 1NBMD 1HA3A 3B9QA 4LHVA 3B1WA 1OLOA 4C30A 4NYIR 4EPYA 4D0NA 1MRNA 2Q3MA 2P5SA 5GJCA 4D0GA 3GEEA 2FH5B 3V4RA 3GJXC 4NTZA 4NYMR 5FPHA 3X1YA 5FBQB 2BDTA 5JSZB 3U5ZB 3CO5A 1XJ0A 2ZSBA 1CR0A 4YXWA 3SJZA 1OXUA 2D7CA 3K9HA 3U60B 2I1QA 3A1VA 2FFHA 4B35A 4EIWA 1KI4A 3A36A 1MH1A 2IS4A 1ZU4A 2XNDD 4TMZA 3TLXA 5JSZA 4UKDA 1JR3A 4OJQA 3LLUA 1RE0A 1YR9A 3AB3A 3GJ0A 4DSTA 5HKKA 3CR8A 4XVUA 2H57A 2IEZA 4PPQA 3PVSA 4DCNA 2O8EA 1E2QA 1UDWA 2BOVA 4M1KA 5B64A 3EASA 3GJ5A 1Q12A 2O8BB 5L8VA 1YZUA 3IIMA 2Z6VA 2ZRCA 3QXXA 5CK4A 3LQRA 1KO7A 2CCJA 1KK0A 2ZYWX 1UAAA 3PUZA 4XJXA 4BFSA 2ZJAA 4KYUA 4JMPA 3BWDD 2O8BA 3SU8A 4M1WA 4F38A 1VCIA 2WJGA 5FUVA 4C0JA 1TUIA 4TL7A 2IHBA 3QXCA 1E94E 4AIIA 1II9A 1T3LA 2ZE7A 2FPLA 4CEJB 3IPYA 1IHUA 4C4PA 3B85A 3O8RA 1U9IC 2V6JA 3OAAA 4LCBA 1KIMA 5E7JA 1EFHA 1P6XA 4JBXA 1FL9A 1FTSA 4HYYA 3C7KA 2XZLA 1NRJB 4RZUA 5EXSA 3WYGA 2GZDA 3X1XA 1OXXK 1GL6A 2OE2A 1W7AA 3RS4A 3KXLA 1GP2A 3VR2A 2FZLA 5FOWA 1KI2A 3EXAA 3OE7D 1K8RA 5L3QB 3EX7C 1T5LA 4UXHA 2F1JA 3BB3A 5KU1A 1QZXA 4OI2A 2QQ0A 3O8DA 1D2EA 1ESMA 1CJVC 2NZJA 2XXAB 5FR1A 2G77B 3ZJYA 3LH5A 4NE2A 1TAGA 1B23P 1N6HA 4FMDB 1OH8A 3R8FA 2ZS9A 4JL5A 2IYXA 4ILEA 4NL4H 2ERXA 3A6PC 2ONJA 1M8PA 4MDFA 4TYQA 1S8FA 2D62A 2QT0A 3BGWA 4ACAA 2QI9C 4TZ6A 1COWD 1VIYA 2CK3A 1OHHD 1IOZA 2GVZC 2A9KA 3GLIE 2BCGY 1D2NA 2IYVA 2G1KA 2IWHA 4PO1A 1OFTA 3K0SA 1NVVR 1XU4A 2BM1A 3I4LA 2VH5R 3LY5A 3ZS9A 3VR1A 3IO5A 2NO1A 4NCKA 2WIBA 2H8KA 2FOLA 1S3SA 5JEDA 2YHSA 3AKCA 1SGWA 3UMFA 1DAFA 2NTYC 5A0FA 3WYAA 5JWOA 5TARA 1E9EA 3B78A 2WJJA 5C46F 1GSIA 1GKYA 3U4QB 3GEHA 4MRNA 2PCJA 4UJ3A 1ZNWA 4B44A 4F7WA 2GCNA 4PC7A 4TTQA 5LD2C 3LXRA 3VNVA 4KFTA 2CLCX 3QQ5A 5HE9A 4DCTA 2RB4A 3Q7PA 2YOGA 4R2HA 2V3CC 3AV0B 1ZP6A 5JCPA 4LC1A 2XITA 2ODWA 1I4LD 1MO3A 2IYZA 2G83A 1S1CA 421PA 5CJPA 2IUTA 2CLDX 4L5BA 5KUTA 2HLDD 1UBGA 2WM9B 1P2SA 1UBFA 5E7MA 1Z6GA 1ZM7A 1WA5A 2NIPA 2ZRPA 2OBNA 3SFZA 1XMIA 2MSEB 2A5DA 1EFTA 4RVCA 4DLTA 4P0TA 1ONBA 3GLHE 1DG1G 5DN6A 3K70C 4US1R 1KDPA 2WV9A 4U02A 4DEXA 3HR8A 4HDOB 2QEQA 1FQKA 1YU9A 5DSZA 1RRPA 2E87A 2PX0A 3PUVA 3LBHA 4I1UA 4LZZA 1J7KA 1FOEB 1WMSA 1ZD9A 3EZ9A 1DO0A 4IJMA 2GCOB 2ZM5A 3QKTA 3CF6R 2V55B 2YZ2A 2VEDA 2GXQA 1T0JB 3OESA 4MRSA 3I73A 5AJVB 3T34A 2GEUA 5DHAA 1BIFA 3CRMA 4O2LA 2I3BA 2VSOA 1JPNA 4LV6A 1U2RA 4JZKA 3CUEF 2E9SA 3NBXX 5CIWA 4Z1MA 2FX3A 1IQPA 1YZLA 2R6GA 3EIEA 3EC2A 2WPDA 4L9SA 4TQ9A 4U00A 1GNRA 1SVLA 2VP2A 2PZGA 2VHCA 2J7KA 2DY1A 1BOFA 2FSIA 2GTPA 3RWOA 2PT7A 4KU4A 3PITA 3MLEA 4P4TA 3TAHA 3K0CC 1XXHE 1QHXA 2J0UB 1KI9A 2QPOA 4KFSA 4CDGA 1GNPA 2W6IA 1G8HA 4O3MA 4AI6A 3C15C 2VQSA 3MWLA 2ZVPX 3SFVA 2OFWA 2R6CA 4BZPA 1OB2A 2HF8A 2XB2A 2ZI4A 2ZROA 3IPXA 1FZQA 5B30A 4M53A 1BH2A 5CB8A 2J0UA 2FEOA 4JVSB 1OKKA 2HT6A 3I3SR 4Q4AB 4BFWA 1OW3B 2IW3A 3TMKA 4UNRA 2BMJA 3TAUA 4A4DA 1UKZA 4QC2A 1WB9A 1W5TA 2CL7X 2FSFA 2ECKA 4QM7A 1A7JA 3E5HA 4Q02A 5G3ZA 2J0QA 5IDVA 1VYTA 1II0A 2OBMA 4JIMA 3X2SA 3ZVMA 5FPYA 3RHFA 1N0VC 1ZD1A 4M0LA 1X1RA 2GF0A 5JS7A 3SQWA 4B3BA 3LRPA 2H7VA 4JLOA 2REOA 2YC4C 4UXIA 1FX0A 3AVYA 3IO3A 1E9CA 1MV5A 3I32A 1T6NA 3NG1A 1NBMA 1UJ2A 1Z5ZA 3CBQA 4OL0A 4PZLA 3B8HA 2ZYUX 4PHFA 3UMRA 1TF7A 1NJGA 3K9NA 2X2FA 4MUBA 3K53A 4PAMA 4Q1AA 4YMWA 5IF9A 3IHWA 5J4HA 5L3SB 3PENA 1AGRA 2IUSA 4A36A 2N42A 2Q9BA 1C9KA 2YOFA 1DTSA 4X8MA 1AKYA 3D3QA 1SVSA 2QP9X 3DPUA 3FWYA 4JVNA 4OK6A 4NYJQ 4PANA 1UPTA 2A30A 1DVRA 4RFSB 4TT3A 5L3SA 5BW8A 2JJ2D 1AS3A 3MG9A 1U0HC 4E22A 2YV5A 4TL6A 3KB1A 2MMGA 1XD2B 2HV8A 4RFVA 2B7CA 1CJMA 3SBEA 1R0YA 1N2CE 5DYIA 3VR6A 2ZSEA 5CLQA 2VP6A 1FNNA 4URUR 1IBRA 4RD1A 4RFSA 1YR7A 2XOKA 5KSPA 5HPYB 4Q21A 3QEOA 4IDQA 4F91B 2R6DA 4BECA 1XD2A 2XNSA 3MJHA 1XDBA 2BBWA 2IF0A 4OHZA 1YZGA 4AWXA 5C1BA 2RGAA 4D80A 4UNSA 3SDZA 1M34E 1SKQA 1F5NA 4EFMA 4L8GA 1P72A 2ONKA 2FSHA 2XJ9A 3FHOA 3GEIA 1GIAA 1L4YA 4IOKA 5LB4A 4EPVA 1XZQA 4FWTA 3C4JA 2OLKA 5LDDC 4YMTA 4Q5IA 1DAMA 2ASEA 5TXGA 5K8IA 5FL7A 3O8BA 3A1SA 3PUYA 2VP0A 4A2WA 5HCIA 2FFQA 4DLUA 1Z6TA 1D2MA 1UEIA 3RC3A 1JECA 5H70A 4FWIB 3KX2A 2WHXA 2D74A 3SJCA 4M9SA 4TLDA 1R5NA 2P6RA 3GJ3A 4JS0A 5G53C 3LO5A 1KKLA 3B60A 3FKSA 1KJYA 1NY6A 4DSNA 2UZIR 4GFDA 3K70B 4TMXA 1NLZA 3B1VA 2P67A 2NO7A 1LV7A 4WIAA 3KUCA 4LY6A 4Q66C 5E7IA 4EFNA 2G3YA 1WDTA 2N1BA 3IHLA 2G88A 1R8SA 4I81A 5EE9A 3PEUA 4FN5A 1G3QA 1RJ9B 2JATA 5B58C 3C5HA 1ZM9A 4GPTA 1TEXA 1MABB 1OE0A 2CNWD 5DH9A 4B34A 4TMKA 4NYIQ 4OQXA 2C98A 1V5WA 4GOJA 1OB5A 2G9NA 2MMCA 2ZS8A 5JRZA 2RGBA 1RJ9A 3QKSB 4D2IA 1OFHA 1RC8A 1MABA 2XTMA 2CCGA 4NYMQ 2FE4A 1W0JD 1PJRA 5KDLA 1GWNA 3ZD6A 1IY1A 4PZZA 1EESA 4KXFB 3UXMA 3MUFA 5H1YA 5JZVA 4V0OA 2ERYA 2ZS7A 3KJHA 3QKSA 3T35A 1E98A 2PCLA 4H9GA 1W0KA 3UATA 1YZTA 2A5FA 1VKJA 4MRPA 4HSEA 5KSOA 1YR8A 4B2IA 2LCFA 5J5CA 1KGDA 2DCUA 3UIEA 4OQNA 5JWHA 3BOSA 3DEFA 5BYJA 4XTRA 2J59A 5L3VA 3QF4B 1Z6XA 2ANCA 1JEDA 1N6NA 1QHGA 2LKCA 3W3ZB 4TMTA 1IONA 1YE8A 5C18A 4PSVA 1ODFA 3RDPA 3KKOA 5KYKA 4BLRA 5EJEA 3V00A 1IN8A 3QSYA 3KKQA 3ZQ6A 3IEVA 4ZPXA 3MFYA 1QDEA 2F1RA 4L16A 4UNNA 5DNYB 5C4MA 2IXFA 2WMOB 1II8A 4R9UC 1ZD8A 2JLRA 5BYKA 1ANKA 3FOZA 1GTVA 2HLDA 4MA4A 2VO1A 2CBZA 3RS7A 2FG5A 5KNCA 3N5CA 1M7GA 3BB4A 4DSOA 1EWRA 2JIZA 1NIJA 4NONA 4NHOA 1XTSA 1N3BA 1IN6A 4IXNA 5EXTA 5DO9A 3BH0A 4GI7A 4GBMA 2WKPA 2ZI6A 4LRWA 4WOPA 2QUZA 1GL9B 4CZ2A 4ZO4A 4A82A 1XCPA 3MCAA 1MO5A 3IKJA 1A2BA 4MITA 4R98A 2WTUA 2AR7A 4XD7D 2DB3A 1JAIA 2YWHA 1I2DA 3DVLA 1ESNA 2FFAA 3EAQA 4MRRA 1Q1ZA 2A3RA 4V0NA 1DEKA 4Y0AA 3I92A 1XTQA 3OFND 2AX4A 1KSFX 5FOUA 3TKLA 2IHYA 3X1WA 3LW7A 4Y0VA 4MGZR 1VG8A 1W49A 3QBTA 4LDJA 1ZUIA 2ZU6A 1R0WA 4DT1B 2ZRDA 2AKAB 4PZYA 1AGPA 4C0BA 1KY3A 2HJVA 1KI6B 1AM4D 3B1YA 1KAOA 4EFLA 4Q00A 4FCWA 1E1RD 2YNMA 3ADCA 1LVGA 1OYWA 4QGGA 2CJWA 2CDNA 2AHOA 2QNRA 1NVVQ 1EFRD 1OF1A 3UK6A 3W8RA 3GFPA 1QVRA 3MJRA 1WP9A 4URZR 4TLAA 1KI6A 1U8AA 1XEXB 3QENA 5C4GB 5EUMA 2GJSA 4TL9A 5SZJA 3OEEA 3QBVA 3SN6A 1KDOA 3IBGA 3NC1C 1P5ZB 3W9YA 4GNKA 1ZIOA 3VHXA 4QBGB 1J70A 2Y8EA 2OG2A 2V54A 4BPBA 1XPUA 4G5GA 1XEXA 4C0SA 4P3YA 4C9BA 4DJTA 5K8LA 4HZIA 5F2EA 4YC7A 3OF5A 1Q1EA 5FTKA 1XX6A 4LGMA 2R62A 3CNNA 3F5FA 3ICEA 3IUYA 2W83A 3T06B 3EG5A 1UKYA 4LYJA 1W1WA 4V0ME 1YZNA 3ONWA 4V02A 1YRBA 3ECCA 4AG5A 3PIRA 3M0EA 4JLJA 4L15A 5TDHA 2O5VA 1SXJE 2BBOA 5CM8B 1O3YA 1PUIA 3TRFA 4DCSA 4DSUA 3Q85A 1F3OA 3DMDA 1Q20A 4TYYA 1TF2A 1S1MA 1N6IA 1VCOA 2KJQA 3OIWA 1Z0IA 4QJ5A 1R4AA 2C9YA 2QGNA 2RCNA 2QP3A 5AJWA 1T3SA 3VFDA 1FNMA 1Z28A 2WOOA 3CWQA 3HYTA 2IEYA 2GEDA 2NQ2C 3TR5A 1KJWA 3IIJA 3KXIA 4I1OA 4HB2A 4OJKA 4DLSA 4AYXA 4PQYA 2ZI3A 2K5UA 4AURA 3THWB 1XEFA 2J87A 2YC2C 1W5SA 2P6NA 2G0NA 1R7RA 3QJYA 3RLFA 4RKEA 1E2MA 2AK3A 3QPUA 4IEIA 1CP2A 1G3UA 4OHXA 2GXAA 2FGJA 1U8YA 4PQFA 3THWA 2BIFA 1NN1A 4QL3A 3P27A 4D6PA 4LSGA 2CMKA 1VHTA 2IS6A 1XD9A 2IYUA 2ZUCA 3P20A 3QY0A 3VR5A 4EKDA 1LFDB 1YZKA 3P1JA 3IDQA 3KDSE 5CYPA 4NU0A 5KSYA 3FB4A 1MO6A 4JVMA 3I5YA 1SXJD 5FOTA 5SZHB 2JLUA 1U99A 2VA8A 4LJ6A 4GDFA 3CONA 1DS6A 3U3MA 1GDDA 2DFTA 5AUQA 4RCZA 1CBUA 2P65A 4LBYA 1QHYA 2F3TA 2F1IA 2NO0A 2EFHB 1T5IA 4D0LB 2CVFA 221PA 2AK2A 5LB2A 4XTCS 1E79A 4N3NA 2XZPA 1T91A 1AK2A 4DUGA 4AYWA 5EZ5A 4G5QA 1AJEA 1DO2A 4KLNA 4S35A 4A0GA 2ZI5A 4AKIA 2V8OA 2YKGA 2BEJA 2SHKA 3UANA 2R9VA 3G82C 4TMWA 1BMFD 1ZIPA 4BZXA 1CRPA 2RGEA 1G291 2JLSA 2ZREA 1TMKA 4PPNA 3WRXC 4NPHA 3AF2A 3T1QA 5BWMA 4WXRA 1KSJA 4M1MA 5DLQC 3SOPA 1G8YA 2C78A 1QHHA 2QMEA 1Z0KA 2XSZD 3TUJC 3GP8A 1AQUA 4ZI2A 2J5XA 4M9QA 5GJVC 3GLFA 2WWWA 1R0XA 2JGNA 3LFUA 5B2ZA 4X8HA 4QG7A 2ZRHA 3T12A 3W6PA 5C2JB 1F48A 2OSBA 3U6KA 1P60A 3CZPA 1Z0JA 4B71A 3ZD7A 3PUWA 3AUYA 2BMDA 4B2PA 3MD0A 4JLDA 4JVLA 1KMQA 1VG9B 4RD3A 1Z2AA 5JS8A 4JSTA 4M21A 2QL6A 2C5LA 2RGXA 4FI3C 5JHGB 2QRZA 4QFMA 1G5RA 3HU3A 1J90A 1JAHA 2IS2A 1Y63A 1XJCA 1EFCA 1SVKA 3GPLA 2VP9A 3AP1A 1KO5A 4N0EA 1X8LA 1GG2A 5IT5A 1TF5A 2WKQA 2J46A 1UBEA 1DG3A 4KVGA 3QNUA 1SVOA 5EE5B 4OQLA 3OEHD 4AKGA 3FPAA 1KAGA 2I1VB 3K1JA 4D4JA 4QGFA 4F4CA 1XD8A 4BLQA 3RSOA 3R7WB 4GP7A 3EPLA 4Q4HB 1G3RA 3T1TA 2C77A 3IGFA 1U94A 2JDID 1FUUA 3AGQA 4B3DA 4ASUD 2N46A 2WAYA 3OIUA 4JKIA 1SVIA 5FUWA 3U3OA 1P9RA 4LYHA 1P9WA 4Q7LA 3R7WA 3KUDA 1IXSB 4Q4HA 4DB4A 4AKHA 2EYQA 4EQ6B 2A2ZA 3C5CA 1NN3A 2W2XA 4NBSA 1N6LA 1H8HD 5FBVB 2IXEA 1E2IA 3MWJA 1N6RA 4W5HA 3ND8A 4CEJA 3RRNA 1VECA 3WY9A 3IBYA 4JLAA 4Z51A 4W5JA 2L0XA 2AD1A 2F9MA 4MKHA 3K9LA 1G4UR 4Q01A 4KYIB 5SZKB 3CPHA 2B6HA 2I4IA 5JECA 1XWIA 4LV5B 4NZYA 1H8EA 3GFOA 2KBFA 5JEEA 2ZR9A 2O8DB 5KNBA 1I2MA 1IAQA 1OYYA 2C96A 5L3QA 4IDOA 4JLPA 4YMSA 3BORA 1PV4A 1ETUA 1M74A 1RW4A 3SZRA 3BFKA 5DYGA 2O8DA 1S96A 2F1HA 5CK5A 2XXAA 2IYWA 2ZE8A 4MKGA 1X8JA 4P4SB 1KK3A 2GKSA 4HAWA 4H1VA 2ZUBA 4PAQA 4TTRA 3TW8B 2H92A 3HPRA 3RS5A 1E1QA 4B43A 3UPUA 1ZNXA 3AP2A 5AR1A 1R5OA 1E9SA 2DWQA 3TBKA 2J41A 4QJ4A 1ZRHA 1Q3TA 1Z07A 2ZRKA 3SYNA 3DOFA 3LAWA 3OFNA 1BYUA 3CRW1 4W5WA 1F2TB 4BRUA 1DARA 3MAAC 5JCZA 1DAEA 1UDXA 3LDAA 3RS2A 1N6PA 2QE7A 1F6BA 3ZIAD 1F2TA 2J0VA 2GBLC 2FV8A 1XF9A 3CZQA 1RRFA 1E1RA 1G7SA 1HEIA 4Q9LA 1HTWA 3AKDA 3BD9A 3SQXA 1OSNA 3KJEA 1Z08A 3EZ6A 3RSLA 2VSXA 4DWJA 4LYFA 1EFRA 1X86B 2OCAA 4IVQA 4MRVA 1EXMA 2Z5FA 5TMPA 2EWVA 4TZ0A 2JCSA 3EZFA 1W4AA 4F92B 2GCPA 2Q3FA 4GZMA 3PEVA 4D81A 3KXKA 3R9WA 1P75A 1P2TA 1UBCA 2PZFA 3NH9A 1MT0A 3U4QA 1Z0AA 2HEIA 1E6CA 1WXQA 3D6TB 4IXMA 4TSFD 1EG7A 5UKDA 1S9HA 1BS1A 3E1SA 4TQUS 1RPZA 4DCVA 3NEJA 2AXNA 3IILA 1JQLB 4MYTA 4QNRA 4HAYA 3HDTA 1VHLA 1AS0A 3CF2A 4QHSA 5HTKA 4D82A 1XEWX 4V0KA 1T9HA 3TVTA 1NN0A 3FFAA 2J7PA 3TE6A 4RJLA 2XTZA 3TUZC 1KHTA 3VAAA 1OFIA 4HEJA 1DE0A 2X8AA 2JA1A 2OESA 3WRYC 3EWSA 3ZYCA 2QMOA 4QRHA 2WSSD 3ETLA 4PC6A 5KPJA 4ZIRB 1Q0UA 1GAJA 2VF8A 4MKFA 3SYKA 4IFEA 4ON9A 2KWIA 3W34A 2QMHA 4ZDIA 2HT1A 5EE3A 4ERNA 1XCMA 3CH4B 2X19A 4DDVA 3NWJA 2CXXA 4C2TA 3I62A 2PZEA 4ACBA 3LNCA 2V7QA 4ZIRA 4US0R 1T8TA 3ZDQA 3WMGA 4ZCIA 2ZQ5A 1G5TA 4JL6A 3U3RA 1GRNA 3WMFA 4Q47A 2GESA 2Z83A 4Q1CA 1P62B 4ZKEA 4LYAA 1W2HA 1WRBA 2GCOA 2WICA 3GJ8A 3JZAA 4PHTA 3VMFA 1S2MA 2F43B 4A8JC 4ESHA 4IOJA 3CNOA 3GLGE 4XH9B 2FMXA 4JKYA 2ZJ8A 5FOXA 1Z6YA 2BBTA 4AYTA 1S3GA 4LV8B 3AQ4A 1SKYE 1P61B 4GL2A 1K6MA 1KSHA 4ZI3A 1JBKA 2C03A 2VRWA 4MYCA 3VR4A 1CEEA 2IWRA 2CHVA 1N5KA 2W6JD 3X1DA 4LBZA 4GT1A 4YLGA 3R9IA 3NH6A 3AVQA 4TYNA 4PO9A 3NHAA 3CW2A 2LKDA 2QSYA 2OUKA 2CEAA 5IK2D 1CKEA 3A37A 1SZPA 1WF3A 1Z0DA 4U5XA 2IBMA 3TR0A 1CR4A 4RY2A 3ZS8A 4Q1FA 4G1UC 3NXSA 4OHVA 1NVUQ 4U7DA 4JBYA 1G9XA 3NTUA 1Z83A 3BERA 4UNPA 1OJLA 4A2PA 4M1SA 4PFSA 1WCV1 2AN9A 3TJZA 1E0JA 3H2YA 4URYR 3U3JA 2NOAA 1XFAA 3OIYA 3EPJA 3EWAA 4FD2A 2VYFA 3U3KA 1TQ4A 2QP4A 3UWOA 2Z0MA 2VTKA 4QBHA 1KI3A 1R10A 3E2IA 1VCMA 1CR2A 2UKDA 1P3JA 3DKVA 4Q4AA 3GCGA 5TVKA 3RVBA 3EIQA 2RHMA 1QRAA 1MKYA 1NY5A 1G18A 1XMVA 2ORVA 1FFHA 3UG7A 4C0QC 3E70C 4LOAA 3K8YA 1BMFA 1KYIA 4FIDA 2EU8A 3KKMA 4V0LA 1GZSA 2RKOA 3PQCA 5HZKA 4CEHB 4B6EA 1SULA 2ZRJA 4BUJA 3KQHA 2GEVA 1E69A 2GAOA 2QQEA 2G6BA 2XSZA 3IEUA 4LJ7A 1XBTA 4LJAA 1UEJA 4UJ5A 2C99A 1LW7A 1N0UA 4FCTA 1NLYA 4M22A 2IYQA 4NDZA 5AJZA 5KDOA 1TEVA 3BH7A 4ITRC 1GL7A 2GK6A 1C1YA 1P9NA 3HYRA 5FFMA 8OHMA 1HV8A 1J99A 3BJIC 5AK0A 2QU8A 3RS0A 1GFIA 3CPEA 3LA6A 4Q7KA 2W58A 4LI0A 3FHCB 4XVQA 1YHNA 2FGKA 2XNDA 3VKGA 2KE5A 2QTVB 1JB1A 1M6NA 1TQ6A 2ZAMA 3QXHA 4IDPA 5E95A 1X1SA 4PHHA 2IT1A 4WA7A 4WBSA 4G0NA 3T61A 2NPFA 3U44B 4C7OB 5P21A 2ZRIA 2ZU0C 3UG6A 2CL0X 2R8RA 3QVUA 2V6IA 2AWNA 3A1WA 4B3FX 5CDFE 4TYWA 4B3XA 2ZIAA 2QA5A 3U44A 4IVPA 1Y3AA 1YR6A 4TL8A 4M2LA 3EPKA 1R0ZA 1G8PA 4LPSA 1JPJA 2F6RA 2ZJ2A 4TLEA 2FWRA 4B76A 2GBLA 1DADA 3R9XA 3CRVA 1NKTA 1CR1A 2QM8A 1W4RA 3V9PA 1A82A 5G3YA 4B3GA 3NKVA 1MO4A 4GMXA 3WNBA 1S0UA 2AKYA 3RYTC 4ESVA 2VHTA 3JZMA 3SYLA 2IC5A 4UQOA 3CF0A 2RMKA 3EA5A 2QENA 1DAHA 4GP6A 2CE2X 1ZM4A 2B92A 2H16A 2IK8A 4OQMA 1S9DA 5EP3A 4DHEA 4AD8A 3OE7A 3QF7A 1JR3E 1LY1A 5H68A 2WWIA 1KO8A 5JFGA 2MSCB 3AM1A 3FVQA 3L0IB 2GVDC 4Q4LA 2RHDA 1E9AA 3K0AB 4PHGA 4PX9A 3H86A 3UMSA 3WMEA 4PQRA 3M1IA 2NGRA 4E5UA 2G0TA 1RRGA 3A58B 3UWKA 3NDPA 3THYB 2CHQA 2H17A 3AGPA 2PLFA 3CRRA 1ELOA 2VHJA 3MMPA 1OH5A 4KFUA 3RRZA 3RWMB 1AS2A 4A8JB 1U0LA 1COWA 1OHHA 1YZQA 2V1XA 3D8BA 1CIPA 4II7A 3T5GA 4NCJA 4BE7B 2P3SA 3THYA 4QGAA 2Z43A 4LX0A 2YYZA 5TY0A 1TADA 2JLXA 4YXWD 4Q18A 1D9ZA 4LPKA 1Z06A 4A8JA 1J2JA 2W00A 1ZM3A 1IJEA 5FTJA 4K46A 4CRWB 1G7CA 4URXR 4QBIA 1ZU5A 1JR3D 4DIEA 2ZVQX 5HKKD 3QE0A 2HUPA 2BJVA 2WWGA 3A4LA 3GJ7A 1NI3A 4KVAA 3U61B 2NO6A 4IW3B 4BFVA 4CW7A 1MRSA 2ZR7A 2IYTA 3B82A 3DHWC 3KQKA 4BWYA 1MOZA 2ZRBA 3CPJB 4M1OA 1RKBA 3VU9B 3GLIB 3QF4A 1PLLA 4QKQA 2VP4A 2IX3A 3A4MA 1D9XA 1LF0A 5CM9C 2ZRFA 5KPDA 4LJ5A 4HAVA 1KMHB 2ODBA 2JASA 3QPVA 4LBWA 3VU9A 4IEEA 4IFBA 3GLIA 2VBCA 3L8YA 1E99A 5EUQB 1OXTA 2P0EA 4GOKA 4A6PA 4YONB 4URVR 5F9FA 2B8WA 3WBJA 4A2QA 5LPNA 3ZVNA 3OAAD 3WHLA 1ZVQA 4I99A 4H1UA 4BQSA 1KMHA 1TX4B 1NMZA 2VSFA 2ORWA 2EWWA 4D4KA 4P33A 5FPSA 1W36D 3AF1A 1GOTA 4RZ3A 1GKUB 3VQTA 2KB0A 1CULC 5E4FA 4W7SA 2CHGA 2CL6X 2V9PA 4DRZA 4EUNA 2BCJQ 3BH6A 3TSZA 2VHQA 4O25A 1EX7A 4HZUB 5JI3E 1CRQA 1Z3IX 1KO1A 3WP1B 2P5TB 1G21E 3LXXA 3RS3A 1CXZA 3CX6A 4HB3A 1AN0A 3WXMA 1I4TD 3B2EA 3T1VA 3QKRB 1N0WA 4BFTA 2GHIA 3VTKA 4HZUA 4DDWA 5KO2A 5FH9A 3T15A 3SHFA 1E9RA 2DWPA 3VR3A 4WXPA 4Q7JB 4JJZA 1XNJA 3GLHB 4TN1A 1SHZA 5CIQA 3TK1A 3AVUA 4KAXA 2FJUA 4PC1A 2A5JA 2CK3D 4JBWA 4P32A 5DIFA 2D06A 4CGZA 3X1ZA 1GILA 3GMTA 4DT1A 3GLHA 1HQYE 4K81B 5IHPA 3BB1A 3NBZC 4BFUA 3H4MA 1L2TA 4TYPA 1ZYUA 3GD7A 1FUKA 5D3MB 3SJBA 1E4YA 3AVWA 5HZHA 4PAOA 4WW0A 4HI0E 3DZ8A 3NIBA 4TTPA 5HE8A
chains in the Genus database with same CATH superfamily
1V1MA 4KC0A 1G0OA 1HH4A 3M3YB 3KQNA 5REQA 1Y6ZA 3AK4A 1TU4A 3W4IA 2VYND 1NW8A 4L7VA 2P9ZA 4HN2A 2F4VB 4BN5A 1E8DA 4FMPA 1T2UA 3H1TA 2OT3B 4FJ0A 1QGED 1Q21A 4ZK2A 3HGMA 5CYOA 5JASA 5CC4A 3P0EA 5DI3B 4QF4A 1NT2A 5KTPA 4L72A 3FYCA 1X2BA 1L9XA 4C7KA 1Q7YC 3VX4A 4A3EG 4HB4A 3P9NA 1V8FA 3JS5A 3CB2A 4OK3A 1GYPA 2VJYA 2VL7A 5CT4A 2Q0SA 1C3LA 2QZ4A 3GRRA 4IRXA 5C81A 4XGQA 1G41A 4IPDA 4MKZA 1NW7A 4FMCF 2CDBA 3B1XA 4YUXA 2PKCA 2CF6A 4D99A 3IIEA 5LM3A 1Y42X 1R8QA 1KH2A 2G67A 4BY1B 1J0DA 1VMEA 1S3OA 5IT9A 2C9CA 3I2GA 3Q5EA 3U4AA 3KQPA 2RJOA 4O5AA 1LF5A 3LT0A 3QFFA 3SC3A 3U5TA 4X7BA 1EK0A 5EPJA 1ZIDA 2I03A 2WIKA 3CHBD 3M89A 2AQHA 3HKCA 3DMNA 5KOIA 1C8VB 5H8WA 5ELFA 3A04A 2IYSA 4J94A 2YZMA 4E30A 1EU3A 4JASB 3NDJA 3QVVA 1JL3A 1GZ3A 3I76A 3SR1A 4PCVA 2DBZA 2I6SA 3D1JA 2ZJOA 3FMCA 2NG1A 2TMDA 1O94D 4BJ3A 4P36A 2JZCA 3I83A 3JD1A 1Y14B 5B57C 4I5IA 5ELEA 1WYDA 3BWBA 3KEOA 1QGUB 1QG0A 2ACEA 2VP5A 4WWHA 4PZ6A 1EBFA 3CP0A 1SVNA 4L5JA 3KVYA 5CPFA 1JIVA 4ZCMA 1N6KA 2EYMA 3WV4A 3FKSD 2ANBA 2OD7A 3DZBA 1SDFA 3OCZA 1W34A 1COZA 1JR2A 3JWPA 4P4SA 3R3OA 3CCBA 3CUYA 1RRCA 2BA1A 3GH3A 1J2YA 5BN5B 4UP7A 3IOMA 1NIPA 4A7PA 2PD3A 3FDXA 3R5KA 3GYBA 4D4MA 5M3FB 3CZ5A 4PR3A 1HDRA 2REXB 2JP1A 3R7DA 2G76A 1N5LA 2XE4A 1UEXC 4XT1B 2HU2A 1ESDA 2NTNA 1ZOOA 2E4VA 4ZLTF 3PWZA 1R27A 1ZH6A 3VM6A 3STXA 3VV3A 4R7TA 5BRAA 2B35A 4MQEB 3IOBA 3SHQA 2UXBL 3NYQA 3TF5A 5KC8A 4Q9NA 5KOHA 1S8NA 4PIVA 4RMJA 4PBSA 4NDNE 2ZTSA 4PSKA 3B6IA 4KTAA 3RUIA 5I8PA 2GRJA 1MEOA 1ODJA 4J1QA 4IZ8A 1TYDE 2NVUA 2CXQA 5G1PA 1QO7A 5THXA 2AVNA 3THXB 4DLPA 1S5BD 3I8SA 2XGGA 3SK0A 1IQRA 3CCUA 2MYNA 3RU2A 4ND5A 4JLVA 5HQJA 4GQIA 4E07A 5C5LA 3R24A 2JK1A 3PEEA 1I2ZA 5FQOA 1UWVA 3FFBA 4PZUA 4NU5A 3R6GA 3W8FA 1BGVA 3P2YA 1QFMA 4S0ZA 2E4ZA 2VT6A 1ZINA 3DEYX 4P35A 1KLUD 2C7PA 5CITA 4JJKA 1R4ZA 2WT8A 2BDOA 3A4YA 5HIKA 1U9IA 3IFDA 1CZKA 3EB9A 5GAJA 4FDLA 2PL9A 5F9HA 4DXGA 4XQNA 1Z47A 2ZM6L 4RANA 4ZODA 3N2IA 3W2IA 3SZ3A 3AF0A 3K6JA 4JQCA 4OBEA 4C21A 1YQXA 4J0FA 5A4KA 2J5KA 3SHVA 3A6ZA 2WG0A 4ICIA 3C3MA 2D2FA 1ZUNB 4JOQA 2WVJA 1KJZA 2XZOA 2C2HA 3CMEA 1XDZA 2W93A 4XVCA 1RJGA 3GTPH 3L6DA 3I6MA 1S5FD 4DAYA 4GC5A 2AFHE 1H65A 1L5SA 4PONA 4REQB 3R7SA 4PC2A 3FUWA 4EA8A 1BFDA 4ZHQF 3KUKA 4AK9A 1VS0A 4LX8A 1U9JA 4IUCS 2CT8A 1KE2A 2XD9A 2GASA 5CHYA 1B9MA 4EJSC 1RWOA 4PX5A 2CLMB 1WG8A 1Z2CA 4G8JA 3I9JA 2QDXA 2AYZA 1DRJA 2ET6A 5F33A 3WNDA 3UEOA 5JDCA 4TRMA 3BCHA 4M1ZA 1PSWA 3ZVRA 2K5QA 2XT0A 1SUWA 1M1YE 1ENPA 1UZLA 2XX3A 2COKA 2UXCL 4FFSA 4PVCA 2AN1A 5BV7A 1PFQA 1PZHA 3BXZA 2W2PA 2YVKA 3DMGA 1KQNA 1XKXA 2HMSA 1SHJA 2QZPA 4J3FA 1J9EA 4L9WA 5CW1A 2X7XA 1U3FA 4WNCA 3GFQA 3VH3A 4DV1B 4NOJA 3WGUA 1KK1A 2WI8A 5A2QL 3GYGA 3DM5A 1LS6A 3U3ZA 5TQ2B 2M6LA 5CA1A 3FPKA 5EZYA 4G07A 4HWGA 2W0SA 4UDYX 1VYVA 3NI2A 5DT9A 3S1AA 3KPUA 4RA6A 2ZYAA 2DN8A 3PPYA 4RFLA 2IL1A 2CD7A 3PQ8A 4F86A 1IBSA 2R3ZA 2CXHA 4K1XA 3DFZA 2GK7A 1YDHA 5TJ9A 2K05A 1RYFA 2YOHA 5DM4A 1F60A 3DXXA 1NVAA 1MD2D 3L6BA 1DJNA 5CP8A 1JJ7A 4NOLA 3G68A 4UU0A 4M6WA 3KJXA 1JMYA 5FQNA 1LTGD 4LA4A 4JI7L 3A54A 1JF8A 1IATA 3C3JA 2QBYB 3UB3A 2G1PA 2R00A 3NAQA 3NC0C 1PTJC 4R2IA 2G28A 3WWEA 1MXFA 1EUDB 1PR5A 3MHPA 4MNOA 5F52A 1R6DA 4ZWNA 1YVPA 2XWQA 1NMYA 1CR6A 2FRDC 1B53A 2UVPB 4HGOA 2IY8A 4UVGA 1X7XA 1SOWA 4K9QA 1JJCB 1RIPA 4BVEA 3ZHBA 3IAS1 4AJIA 2HIMA 2QLFA 1A8VA 1KZGB 4YJGA 3L0SA 4YDHB 5CB0A 5SYNA 1RABA 3EDQA 1K8OA 3NHKA 2VDVE 3B7PA 5DWVA 4HDKB 4XWTA 4LHSA 3DWEX 3L1JA 3P19A 5HCNA 3KT0A 3LPAA 4INAA 4MQUA 3S7ZA 3SEFA 4NSNA 3IHTA 1QHHB 2DWOA 1I8TA 4MYHA 5F23A 1L8QA 3VKWA 4HNHA 1IUKA 1NBMD 2JGJA 3U9OA 2PYZA 5GOZA 4C7JA 2B2WC 2AOTB 2C2MA 3K5NA 1EDZA 2H2DA 3N52A 5AKLA 3CO5A 1JIKA 2WF5A 4BNWA 4MV9A 1UK9A 2NVQH 4F72A 1ZU4A 2QUKA 1ONPA 1HDCA 1RE0A 2ZSKA 4E2YA 4JI6L 3IB6A 4MZXA 1KDYA 4HFJA 3S2FA 3GJ5A 3GLQA 1A62A 4WXEA 5L6MB 4K5VA 3P9KA 5E9WA 3QHAA 2Q1SA 3GPCA 3MJEA 4R6XA 1GPKA 2RDGA 5JNWA 2IHBA 1NPYA 1AF7A 4RCOA 3RV4A 1RKVA 4P4NA 4LCBA 2IX0A 3M6WA 3ZE6A 4JBXA 2K2QB 2XZLA 4G0QA 2OE2A 4I1IA 5JXHA 1AKNA 1T5LA 1I7PA 4MB2A 1U0RA 1PH2A 4E51A 4WFIA 3TOVA 3RHZA 4PYLA 5I7WA 3OLQA 1IOZA 2QD5A 2GVZC 2A9KA 3L8DA 3NE5B 5C4XH 2BM1A 5JVG3 2HCCA 4NCKA 2ICIA 3LX4A 1FS5A 4B4DA 4HIOA 1E63A 1G1AA 4ND6A 1GKYA 1IBKQ 1CFZA 3PYXA 4HTAA 1I4RA 3OUUA 1ZP6A 1MO3A 1CUJA 2IYZA 3D43A 2P40A 2CLDX 5E7MA 4HFMA 1GA1A 4Y98A 3ANLA 2VZ9A 4W8OA 3AFIA 4A8HA 4NW2A 1EDOA 1XWFA 2KQUA 2OO5A 2WFLA 4YALA 4UC0A 2R8XA 4K0KL 3L6UA 4L8WB 5KYYA 1IJBA 3F6YA 3CRMA 4ZT4A 4GMHA 2C82A 2JPDA 1QH8A 2E9SA 2HSDA 3NBXX 1JDBB 1A0IA 5EEGA 3TZEA 2Q5OA 4G1VA 3ZUPA 4PLGA 3OKFA 3NWPA 4U00A 1SVLA 1J06A 3G8AA 4JPBW 4YH1A 1KI9A 1J0CA 1G8HA 4O3MA 3KDFB 4EGFA 3BM5A 3M5WA 3T3OA 2XB8A 4NZMA 1BH2A 2VXOA 3LKZA 4BFWA 1FDVA 2EL9A 3OQPA 1OJ7A 4RAUC 4FQ7A 5F2NA 2VWHA 5IDVA 1L6IA 3OEWA 1H1DA 5CDYA 3DBVO 4RHSA 1B93A 1KERA 4DF7A 1FX0A 3G2NA 2HSGA 2VKTA 2I7TA 1YZFA 1CUBA 4DTIA 1Z0SA 1E3DA 1ZL2A 3FSRA 3A31A 1C9KA 1TJ3A 4X8MA 1EAYA 1AKYA 2JFQA 3RROA 3ZPXA 3R7AA 5TPWA 3BRCA 1PW7A 4YI3A 4OJNA 1A69A 5DYIA 3B52X 4LY9A 2GAFA 5KSPA 4EW6A 5AKHA 2B2VA 5M3MH 2VLBA 3H2BA 5ER9A 3SE7A 2B4YA 3FHOA 4W63A 2XYQA 1F9PA 1GGKA 2C4UA 3HRKA 8ADHA 2FFQA 5EESA 5H70A 1FDTA 3SEBA 2OPHA 3HADA 5IJ0B 3GJ3A 3Q1LA 4KJXA 3K70B 2FEPA 1ZRMA 2P67A 2GKOA 1LT4D 2HMTA 4WIAA 1ZJ5A 4QVGA 1E1CA 3S44A 4Q66C 4TXHA 2G09A 1JWSD 3PEUA 5A02A 2HMAA 1ZM9A 3MLAA 3S1RB 4Z4GA 4IUYA 1V5WA 5CIYA 5JRZA 3QKSB 3VZBA 1IG3A 4R1SA 4D6XA 2A1IA 3KJHA 1C7EA 5IAEA 3OO0A 1YTUA 1N34Q 2GEJA 3KHSA 2I3AA 4DA7A 3GNLA 3IKLA 1QHGA 1YE8A 1Q92A 3HEJA 1SCAA 4ZOBA 1A04A 2ODAA 4KV6A 5FA5A 2G4LA 2FZGA 5AO9A 2O7RA 1CKNA 1XTUA 2JLRA 3SKXA 2QM3A 4N5LA 4HSGA 2ZPUA 1J56A 1S2GA 3AEKB 2VRNA 6AT1A 1JHZA 2I7CA 4EFDA 1A2BA 1RTKA 5B3JA 2ZIVB 1W2BA 3VZDA 2ZCJA 2QUIA 1YRYE 5EKSA 2GARA 4NU6A 4AJKA 1SWVA 5COQA 1UAPA 4MGZR 4WXYB 3L6RA 1AA6A 3T3EA 1L5HB 1YZYA 4NEHB 3QSGA 2FI1A 5CD1A 3ZI4A 3PFHA 3E9MA 2HL6A 4QFCA 4UARA 4KPYA 1AM4D 4IR7A 2R11A 4KYVA 4UVIA 1XX8A 2P4HX 4G56A 4ME3A 1MJFA 1JEAA 1ML3A 4RTJA 3SN6A 4RHRA 2Y1XA 4WY8A 1TVKA 4DJTA 2D5DA 1M10A 2ZVDA 1Z0UA 3IUYA 4FFPA 2W83A 2OBYA 2D1QA 2BCOA 3FTDA 4DGSA 3K71B 4L9AA 4AG5A 3PMFA 5KMGB 3Q85A 1Z0IA 4QJ5A 2QGNA 2RCNA 3GFSA 2IYAA 1VQJA 3GRPA 3D6VA 4I6EA 3QLTA 4C0WA 2I67A 2J87A 2D0DA 2Q07A 1JR4A 1I30A 1HNNA 3DCIA 3THWA 2BIFA 4CMCA 4PVDA 3R7BA 1K9SA 2BEVB 3VR5A 4JI1B 1YZKA 2E4XA 5KSYA 3JQBC 4JI8L 5FOTA 2VA8A 1JVNA 5JAMA 4IIDA 3JYQA 1PX0A 1RIIA 3HBLA 4LISA 2DPLA 3GPDG 221PA 1MNQA 3OZ7A 1A88A 3IT3A 5LP1A 1YK0A 1VQ9A 1AJEA 2UXBQ 3T52A 3UB4A 5C3EG 1M1KC 2C78A 2X2PA 4R1LA 4QG7A 2EJVA 1W3SA 1F48A 2DE0X 3VXKA 1Q16A 4WKPA 5LXTB 3RBVA 3O8OA 4PMCA 3BXFA 3OP1A 2RGXA 1G5RA 1OI3A 2W4QA 4F97A 3I8ZA 2VWGA 9GPBA 5IT5A 1A2TA 5IC4A 3R7FA 1ZWKA 3WDNA 4GN5A 5CA1F 5EZYF 1G3RA 1JSCA 2WAYA 2RK3A 2BUAA 5KWJA 4Q37A 4TGLA 2W2XA 1N6LA 3AWDA 1C9OA 4CEJA 4JLAA 1VB5A 1QKJA 2FDRA 2AD1A 4YRPA 1S01A 1G4UR 1ZH8A 1G6Q1 1LJLA 4JX8A 3R3HA 3WQRA 1H8EA 1NNI1 2EV9A 4NJEA 2ZTHA 1LTHR 2ZM6Q 5AKKA 1XNGA 5KYTA 1IAQA 2WQ6A 2C4WA 2I5PO 1FZTA 3KBGA 1PAUA 4QSHA 2C58A 3RS5A 3SGLA 4YROA 3WA6A 2HHJA 3TP8A 2TSYB 5DV9A 4JBJA 1TKBA 3URYA 1A7KA 1YMQA 2Q3JA 1I50H 3S2ZA 5JNRA 1CUZA 1Z2EA 1IZ6A 3WX0A 3QFTA 2Z8XA 1TU0A 1I3QB 2VSXA 1PZMA 1N8SA 2I8AA 4X44A 3F6SA 2P75A 5AW0A 2EWVA 4RIIA 3BXXA 4TSFD 3RTGA 1JQLB 3HDTA 3CF2A 1KFJB 2IUFA 3GT0A 1E77A 4B82A 2QYHA 3TUZC 3J81c 4FT4A 4X9XA 3RIHA 4R9WA 1H0HA 4DA4A 4ON9A 3ZDFA 3PPIA 4L5QA 1U1IA 4L0CA 4C2TA 4DSAA 4FVTA 4ZCIA 4LWPA 3HN2A 3VYSB 1BX3A 4HTFB 1EIGA 3UQZA 3CWCA 3DVAA 4OL9A 1Z6YA 4PLYA 1S3GA 4LV8B 1P0MA 3J81j 3CC7A 1JTFA 1EGHA 2A59A 1JBKA 3W9UA 3SX2A 4FJ2A 4ZVTA 3N75A 2FRVA 1ICWA 4O4HF 4QUDA 4J7XA 2C29D 4ZOCA 1CKEA 3TSYA 3RYCB 3MTBA 1PQWA 2C94A 5H80A 4PGFA 2GM4A 1TZ2A 1GPNA 5EPUA 1E0JA 4U3JA 4RULA 1LPOA 4YRRA 2XCQA 2ST1A 5KNLA 1CLEA 1FFHA 1D5XC 2F62A 3FEWX 1STYA 3WJ1A 3EUWA 1TCCA 3OU2A 3BGOS 4V0LA 5BT8A 1YTLA 1WW8A 2XKKA 4GPD1 3NHUA 4HN4B 7ADHA 2GH1A 4DLLA 1JQBA 4PG7A 1NJ2A 3KWFA 1TEVA 2GK6A 4FHGA 3IAUA 2Y66A 1I7LA 3W5HA 3THRA 3N8GA 5A2GA 2GD6A 3WB0A 1GTL1 4GKKL 1FK8A 1K8MA 2YL2A 1YCHA 2GOYA 4L8YA 2UZ1A 3UBTA 4FNGA 2ZIAA 1N1GA 1MC8A 5AW8A 4BHTA 4P5EA 2XUQA 4TLEA 2WF6A 2ZBGA 4R3UC 3ILHA 1Y8QB 4JI7Q 5G3YA 4O4IA 3HOWB 1CDOA 3DXYA 4UQOA 1DAHA 5BOVA 2BRUC 1SOMA 2IK8A 4OU4A 1S9DA 5AKYA 3OE7A 4INOA 4UHJA 1P3Y1 4DY6A 3RF6A 1EIHA 4YMLA 1AKWA 2H4YA 1CUDA 4H7KA 4K6DA 2P2GA 1OHHA 1CIPA 2BFNA 2P3SA 3THYA 1PBNA 3FJ1A 1NNSA 2M1XA 2D8AA 1D9ZA 4LPKA 2YW2A 3P9ZA 4FHZA 4YJ2B 3HBJA 3HXTA 1UUFA 1WWKA 3U61B 4CODB 1MRSA 3QV1A 4CR7A 3R0QA 3T7AA 3GNQA 1PLLA 1Z5GA 5A4DA 1LF0A 3KBXA 2PGLA 4F04A 4IFBA 2NVYB 4YONB 5F9FA 2E2IB 3WBJA 3QWHA 3FF1A 1GG8A 3JQPA 1TX4B 2EWWA 2KB0A 2CHGA 4DRZA 1BDJA 1Y1RA 1NR1A 1KO1A 3WMXA 1CXZA 2ZBQA 1I4TD 4LF4B 3DMUA 2PO5A 3SHFA 2Z8LA 3ZU5A 5CIQA 4KWHA 2Y0BA 4KAXA 4P3OA 2FJUA 3U62A 2ZBFA 2RHQB 3NVKI 1DC5A 4R83A 4JV5B 4B3ML 5B7QA 1HQYE 4KXQA 4P84A 1EX9A 4ZI7B 1GGHA 3WYDA 5EAIA 1TU2B 4IF4A 2R2AA 1OH6A 1RLOA 1F6DA 3RFXA 2AT1A 1OX6A 2ZJZA 4HWRA 4JYAL 4JUDX 3II6X 1H85A 3PD7A 2D2EA 3IUSA 3RUAA 5JJKA 4GBED 3V4VB 3QITA 4LVOA 1GEGA 2C4HA 3MIIA 1UBRS 3WJ7A 3KOZA 1X3SA 1A77A 4PTLA 2OCPA 4FFBA 4KVFA 1GKLA 1J1ZA 4LXYA 1AQYA 1EUCA 3PFBA 5FHRA 3KWJA 5AVZA 5IBQA 2PUCA 1IG0A 1E3MA 4A1OA 1X42A 3ILVA 2FA9A 3NIDB 2NSHA 4UHHA 3R8CA 2DETA 3CT4A 4A73A 1YNJD 3WGVA 3UUWA 3CN7A 1HE8B 3B3FA 4ZAFA 2QY9A 2XXBA 4K0KQ 2IZ1A 3KB8A 2Q3HA 1I6HB 1VLZA 3QB3A 4HRXA 4JWKA 3JQFC 5IUKC 1BCRA 2OB2A 4OM7A 1QGOA 4HLQB 5JXGA 4IOLA 1SR8A 2VF2A 4PYKA 4RD4A 4XIIA 1FSSA 3IQDB 3U56A 1KFEB 1I2BA 3SNKA 1X3QA 5HGQA 3S15B 3PFNA 1MORA 4F9FA 2NVWA 4I7ZC 4DUYL 4WY2A 4MKIA 1AF4A 3CB4A 3MWDA 1DAGA 3TRKA 4U9UA 4D0SA 5GVSA 1K5DA 3JQQA 5FOQA 4LEIA 4QDXA 5M29A 1QXSA 4MO9A 3ROFA 2OV2A 3ZXXA 1QPGA 2BL4A 2BJWA 3D0RA 4QQBX 2LSSA 2VT7A 1A9TA 2JEAI 4Y9SA 4ZV7A 5FLMH 2IA5A 4D43A 2W6ZA 3ZG6A 4HJXA 5I6YA 3L4JA 4HOYA 4FVMA 1YBMA 1ISIA 4P58A 5H0IA 3RARA 4INZA 3HFZB 1YCDA 4X8OA 5HKLA 1DFHA 3M7IA 5AUPB 4EELA 3KJGA 1KY4A 2D7DA 2K5DA 5AUOB 1WMFA 1W4CA 4MGYR 4KNVA 3LD9A 3OTGA 3I9MA 1W5BA 5KQRA 1CJUC 3TMAA 1UPUA 3KD3A 2VATA 2PZBA 2HPZA 1E9VA 1DRVA 3C7AA 1YOVB 3D02A 4LNUB 3FZQA 3AEZA 3CSSA 4NF2A 2A9OA 4BFZA 3KPJA 1BX0A 1F2LA 4CLOB 1PCXA 2NZ1D 2EDAA 5D01A 1LNZA 2C9MA 5HFAA 2NXCA 3ZV3A 3KCQA 4HGQA 1E3SA 3PXCX 5JQGA 3KDPA 4ZD6A 3ZIDA 5ENZA 1WTXA 1DUSA 2VHVA 5EP4A 4KI0A 3LYUA 4BJ6A 1XJQA 2DFLA 1Z2PX 1LPMA 1OX4A 1IBML 4WTOA 1UOQA 1T0IA 4OAOA 4MQ6A 3S70A 3LT2A 4CKEA 1HE2A 1YFKA 3NV7A 1E2LA 4QTYA 5C52B 4OATA 1JILA 4MDHA 3OTOB 2JK8A 2QUJA 5HS6A 4GEGA 5CDSA 2GM9A 3MHTA 3DWAA 2RDHA 2CH4W 1E1LA 2GWRA 4WRRA 1SCUB 4KSCA 5BN4A 1NC1A 1V7PC 1PNRA 3PD1A 1M7BA 2C8LA 3EF1A 4I1VA 3MBKA 2PX3A 2I34A 4QXPA 3R5TA 3RLOA 5FK9C 3GP7A 4RCVA 4PPGA 2I6FA 2YXDA 1EJ0A 3H8WA 1QRRA 3NEMA 3SICE 5BRJA 2FW0A 4RV9A 5IODA 5E1FA 2YWBA 1NL3A 3IDZA 4HDMA 2UYOA 4C89A 1GQOA 4D26A 2FSPA 5CR3A 3O31A 4KBGA 2ZAOA 4K6HA 3ZV4A 3I6QA 1FYVA 3G9XA 3HBMA 4A3DH 3EQ6A 1FMLA 5E6SA 1P29A 3U7IA 1E2HA 2WF9A 3AVPA 4RJ2A 3MRVA 1MPXA 3Q15C 5CNIA 3WGYA 5BO5A 4OHYA 4IRUB 3MZ0A 1D0VA 4OKNA 4CM9D 2EIXA 4CM5A 2QJTA 1LA2A 4WBXC 4MHTA 5BRNA 4URWR 1H94A 4ZAIA 4A0FA 3A1TA 3VNAA 5FBLB 3MMXA 3RD4A 2A7QA 2B7BA 4EYQA 5JZMA 2LCQA 5EPLA 3F3YA 1P2UA 3WHIA 3NPPA 1U8FO 3OM1A 4I50B 3F4KA 3WVNA 4LF7L 3ORHA 2QUBA 4K9DA 2BKEA 3U9TA 4DXAA 3EUAA 4ENSA 2HQ1A 1DPFA 5GQOA 2FP4A 2VBIA 1FJ2A 3A70A 3V8QA 2ZPTX 3RO7A 2ATIA 2VLIA 3I90A 5KTTA 3D2AA 1UFQA 1KQFA 2OPBA 3TIVA 3VUFA 4KN5A 4KFRA 3IFSA 5SZIA 1Z8FA 1B7YB 4DAVA 4IWXA 3ESBA 5JAPA 1Z13A 2GF9A 4WKGA 3BTSA 2CCKA 3NHWA 1T0PA 1NV8A 2JFBA 1JKIA 4Q9JA 5GJBA 3EVGA 4C05A 3RKSA 4MCIA 1WE2A 1K5GA 1Q84A 5I48A 4IDAA 3H2GA 1E58A 4Z54A 1A4RA 3SBOA 3PO2B 3DV0B 1EM6A 4O4IF 2RGDA 2XQVA 3LPMA 2NU9B 3RWBA 3PCRB 3FPHA 3FUXA 5BSWA 3L0CA 4M4SA 4QYIB 5DEIA 1Y5LA 3DULA 4A3BH 4AQDA 3N70A 5CG2A 1NMGA 5A0VA 2WU3A 4I55A 4YPFA 1ZAKA 1WCIA 4GMDA 2YJTD 4ZU6X 2J8ZA 4LKRA 4G1MB 4ZEXA 3QELB 1QFJA 3COWA 3IVMA 5I6DA 5DSXA 5FLXc 1E2BA 5T1GA 4CN8A 4NPAA 2IZOA 2OBBA 4CPDA 4TXJA 1RADA 4ZYZA 1UMDA 1GFSA 4KK3A 4MV1A 3A6FA 3KD2A 1N8RC 2WJ6A 4UVDA 1WKBA 2RKWA 5DI9A 3ND9A 5FA6A 3RHSA 1Q91A 2LY7A 3W90A 1EWQA 1N5IA 4D57A 1UOOA 2XNCA 3BXOA 3UUEA 5G41A 6Q21A 4GD3Q 2L19A 5CJJA 5CFZA 3O2QB 2JZNA 2AIRA 4ZGBA 1T3ZA 3PQDA 1B8OA 4XYBA 1U2SA 3ESZA 4GPBA 3A1VA 5TMEA 4JR1A 2OEOA 5T1IA 5JNUA 2QWXA 5A9RA 3LLUA 4TXNA 3NTIA 1SCIA 2FUG1 5JO0A 4UOEA 3ENZA 5KTMA 2MUYA 5I7HA 4OQEA 2PKQP 4PZDA 2HK9A 2ZJAA 2QZSA 3KYCB 2O8BA 4M1WA 3IIIA 4EJ0A 4Y6LA 5K36H 4QVIA 2GZ3A 3FX2A 2Q6KA 3IR6A 4S05A 1C1HA 2V45A 2Q2VA 1GL6A 3RS4A 3WKEA 2FZLA 5L3QB 1VL0A 4UXHA 2XUOA 1PFWA 1F38A 4CCSA 1KDCA 4K5QA 4GKKQ 4C20A 1B23P 2XKJE 4DN6A 1LI4A 1DWPA 3R8FA 1WPGA 2JBWA 3MF4A 1XVTA 2X6LA 1JDTA 3JQGA 5ARCA 2DJFC 4TRDA 3BMOB 2QMYA 3ACCA 2X76A 1D2NA 1ENFA 3AUSA 2F8MA 3KF8A 4NCBA 2ZSJA 4EGVA 4MVWA 4KIJA 4U7TB 1K3RA 1UBUS 3RC1A 2NBFA 3N8HA 1O96B 1GLNA 4N54A 4X61A 4FYXA 3LGJA 4DCTA 1CZUA 1VBFA 2EX1A 2F4IA 3U37A 2JLCA 2CYCA 1WMAA 4UCWA 3ZY5A 5GONB 2OYCA 5IUNC 2R8ZA 1KBZA 1QYDA 1KAQA 3EEBA 2Z6KC 2JC3A 3RFUA 3EZ9A 1VE1A 4P53A 1OI2A 4QPNA 3QNMA 4JUFA 4OB7A 2Z4HA 2OENG 4RTNA 3C8MA 2P9HA 5DX1A 2OVBA 5A04A 1T34A 3EC2A 1LU9A 4TQ9A 3FPGA 3SOZA 2ZDGA 1NM5A 2FWPA 2FSIA 2GTPA 3PITA 1VA5A 4YA6A 4DV7B 3T7RA 4MUJA 1XQYA 4C3HH 3PVZA 4IMJB 4UZSA 4JUAA 2R6CA 4QU9A 4BZPA 4J7CA 4YP9A 4ERXA 3I9FA 4YRNA 1UKZA 2R97A 5SV2A 4OQPA 2NSYA 1JKJB 4QDZA 3W7AA 4U2EA 5EQFA 3RHFA 4CTOA 1NQXA 1T9DA 3NG1A 3JR3A 1HR0B 4XGRA 4B3MQ 1NAHA 5IF9A 1WCMG 2ID4A 3I01M 2Y93A 1Q95A 1U8CB 5KYXA 4E88A 3H3VH 4P5DA 2OV4A 3HOVH 2VP6A 1FNNA 2AE2A 3IQFA 3UV6A 3H9JA 4OHZA 2YMLA 4GRDA 4JYAQ 5CA0B 2F0EA 4L8GA 1R4NB 4WINA 1SNDA 3ZR4B 5EIAA 3FRJA 4UPVA 1V1QA 5HCIA 3AUAA 5BOSB 2F0GA 2Q3BA 1Q5PA 4ZRNA 3GLRA 5GY7A 4DIMA 2UZIR 4GFDA 1IBKL 2X9GA 4AVYA 1T36B 1BQQT 1LV7A 4LY6A 4QQFA 2TS1A 4NBUA 4EFNA 5JC1A 1UKBA 2AF4C 3BRSA 3GCZA 4FN5A 1G3QA 2QR3A 2CNWD 3QFCA 3K6OA 4AS1A 2EY5A 1W0JD 1PJRA 4KYTA 4DG8A 1W2WB 4JYMA 4BMDA 1W0KA 3BVPA 3AFHA 4B2IA 4M8SA 5I9IA 1LLDA 3GRZA 3TW6A 4EKEA 3CTPA 3EXFB 4OVKA 3KKQA 2KHJA 4NNPA 4JEMA 2Q4EA 1SC4A 4MDYA 1UL1X 2EKPA 1M7GA 3JQRA 4GM4A 3T5BA 1N3BA 1X9GA 4GI7A 3OTWA 2YXLA 2WKPA 1GL9B 3LVBA 3FETA 3EEQA 2R92G 3G6WA 3OECA 4AY4A 2WABA 4BUZA 3X1KA 1SJHD 4RK4A 4AZTA 1V5GA 4YQYA 2FR0A 2V8BA 1HFGA 4EG8A 1BX1A 1W49A 3ZCTA 1AGPA 1K3BC 3HR4A 5JMWA 4ND7A 1N9KA 4QUFA 3KBBA 3QBJA 5LQRA 1WP9A 3O8QA 3ILSA 3OEEA 4IF6A 3NC1C 4R8KA 3PJDA 4GNKA 5HIAA 4QBGB 3RYFA 1QIEA 4C9BA 5FTKA 1BD4A 1XX6A 3QWBA 4TPKA 3DH0A 1V7CA 4GGPA 4YHHL 2MHVA 4V0ME 2OA0A 3HXLA 4V02A 3VR5H 1AHHA 3GZ4A 1O3YA 4CI0B 1F17A 1IH8A 4OHFA 3VJRA 1I51A 4XRGA 1F4PA 4M7PA 2MSNA 4RGVA 2NQ2C 4NMZA 3HUDA 3IIJA 4DLSA 4P3KA 2ZI3A 2K5UA 2X0FA 4NIMA 5ALWA 5TJHA 2G40A 2C0PA 1P16A 3GNTA 4N9TA 2J3QA 5IJWA 4QO7A 1SXJD 1Z9FA 5L4SA 1PV1A 3E5MA 4XTCS 2H07A 1EI9A 1MJGM 4KLKA 1MAHA 5GTDA 5BR4A 4L5IA 3ZJ4A 2IRWA 1YFLA 4KLNA 2ZI5A 2SHKA 1RSZA 1HZAA 4GLAC 1N34L 2X6GA 4NR0A 4WXRA 5DLQC 1GRVA 4TKLA 1Z0KA 2WT4A 4HN7A 3HLYA 3U09A 4RE5A 1BO0A 3CZPA 1SXIA 3I2YX 3H8SA 3E1KA 2NUTB 1NVTA 1V6CA 3M3PA 1JAHA 1EY8A 1CZHA 5DBFA 1I4GA 4LGCA 2WKQA 1ZOLA 1IBMQ 2Q2NA 3ZHTA 3L18A 2Y0SB 5DCWA 5EE5B 3I5AA 4RGYA 4F4CA 1KBOA 4QGFA 2HNAA 4OIFA 1DHRA 4Q4HB 3I9V1 3BQMB 2JDID 4B3DA 5LP6A 5HOEA 1XU9A 3CF4A 1J8VA 5I9MA 2QG9A 3KUDA 3ENKA 4TWAA 3RD5A 1JG6A 3L6EA 5FBVB 3MTIA 4W5HA 4JHXA 3TEHB 3VU1A 4Z51A 3WLFA 2YXBA 3EVZA 1HG1A 5JECA 5HX7A 3JQAB 3R3JA 2NVXB 1IE3A 5EMJA 5A5DA 4G4SP 1SE4A 3AETA 5AK6A 5AVVA 1KK3A 3AQIA 3ROEA 1E9SA 4IUNA 1ZRHA 1Z07A 3GLTA 4BWGA 1EY7A 2YTZA 4A3JH 1DKNA 1Y6RA 5ALVA 3CKKA 1F6BA 3ZIAD 1EFWA 1CC1S 5MN4A 4PNHA 1GGMA 1GPBA 1Z08A 4I55F 1FJHA 2ZIZA 1VJ0A 4MRVA 4R7GA 2JCSA 4YRQA 3U4QA 3W2FA 1E6CA 1SAYA 1P9LA 1IQ0A 4G0XA 4HAYA 4ZVSA 4RVFA 1VHLA 4D82A 1KRHA 1SZJG 4QRHA 3M70A 2OP1A 2WG2A 2ILTA 1JSRA 1GRNA 5HMLA 2IIVA 1ZXTA 1KYVA 1WRBA 3JV7A 4A8JC 2XB6A 2BBTA 2JGIA 1N2XA 4YCLA 1HXHA 3OCXA 2CWPA 3GIWA 4MYCA 3C6ZA 2W6JD 1TT5B 3OWXA 3GJYA 2YWXA 1G55A 5E6RA 4LF7Q 3ANYB 1JFFA 3A37A 3LCJA 2WUWE 2HQRA 4OHVA 4PBRA 4KN6A 2X2OA 4RX1A 2NOAA 1JEOA 4EA6A 1LK7A 3UWOA 4KY7A 4DLBA 3DKVA 1KORA 1U9ZA 1D2CA 3C43A 1G18A 2X0JA 4IZIA 3K8YA 1YKGA 3KKMA 1AFPA 1H5UA 2YZNA 1E69A 5CBPB 4AIMA 2PDAA 3HB4X 1EWCA 1GL7A 4D3ZA 2XGOA 4AXBA 2YNMC 3KJOA 2FUCA 1JB1A 2F17A 3DXZA 4H2DA 1T2AA 1LLCA 3S99A 5DGTA 4AWAA 5K20A 5K5PA 4NENB 4LPSA 3Q8KA 5D5HA 4UE2A 3C98A 3IP3A 3CRVA 4PSUA 3KR0A 2CE2X 1T4BA 4FE7A 2RQXA 4A3LG 4DRXB 5BWBA 2J07A 2RHDA 3BG3A 4QJFA 4WA8A 1XMOB 1N5DA 4R1NA 3A8IE 4QGAA 4QYWA 2B1QA 3MYYA 1DWQA 1D1SA 1HI9A 9MHTA 3RUZA 1REQB 4NABA 1SJED 2BJVA 5ULLA 5JXIA 4FLFA 2NUAA 3LO8A 3P71T 4CGYA 4O8ZA 2IYTA 2B3DA 3KQKA 1MOZA 3PE6A 1PJ4A 2G8LA 1RKBA 1Y3DE 2H1WA 4QYTA 3A4MA 2NU6A 2OYSA 4X6YA 3S28A 3GXOA 4BDTA 5T4FA 3UJPA 4X1KA 1WXWA 1ZG3A 2GEFA 4AMUA 3WWPA 3HCEA 3FF4A 4RXTA 1IEVA 4N12A 4QICA 2K28A 3SQMA 2FPOA 3SK5A 5JMOA 2WPNA 1EDDA 1NDQA 1G21E 4UM9B 2J9GA 4RHUA 2L82A 2GHIA 1HTTA 3K15A 1FLNA 4WXPA 3ZJTA 1XNJA 4MVJI 1VLMA 4IJWA 3IP9A 4L28A 1YQGA 2XW6A 3JZFA 1RWQA 1HM5A 3GMTA 4K81B 3KXPA 4NFHA 3H65A 2BTQA 1L2TA 1U9CA 4QRDA 2BEUA 1VMKA 4XFJA 5HE8A 1OV4A 1VTKA 2KCNA 4KGDA 1ZUWA 3P0HA 2I87A 2JH3A 4Z0PA 2C9ZA 1YQTA 2O7QA 2Z2YA 2F0TA 3M7GA 5KC9A 1D4AA 4P4LA 3VH2A 4EX6A 5A2QA 1TQDA 5TSSA 3QEMB 3HVIA 2EEZA 3TNDA 4MI3A 2WJHA 1JKFA 4GH5A 1RWXA 1AW7A 1VA4A 3QKUA 1EY5A 1X3PA 4F2HA 4WK4B 4BLSA 1JIUA 3E0QA 4MEAA 5DXJA 2DWCA 1POXA 1I4WA 5JJLA 3H3XA 1VSVA 3AH8A 3EIOA 4DCGA 4NE9A 3UJBA 3NDRA 3RC2A 2HN9A 3B5EA 3DT8A 5KEEA 2W6ID 3DMTC 5IFLA 4ENTA 4LJYA 4MQBA 4WBNB 1GO2A 4QT0A 2UV8A 1IM2A 1C7YA 3HYLA 4FDVA 2WKRA 3REQB 2AJTA 3EZ7A 3PYMA 2W8BB 1K06A 2Q28A 4IV8A 1W9HA 4WN3A 5JVH3 4LJ9A 4DZRA 4UATA 1FP7A 3G3EA 4O4HA 2EOTA 3VVBA 4LWZA 5DOZA 3RABA 5L9AA 4X92A 4DR5Q 3OE5A