3FVQA

Crystal structure of the nucleotide binding domain fbpc complexed with atp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
348
structure length
343
Chain Sequence
b'TAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLGRLPVQSGAPAGTRGTLLIRPEQYSLHPHSAPAASIHAVVLKTTPKARHTEISLRAGQTVLTLNLLSDGISAVLHLDGPALFFPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fe(3+) ions import ATP-binding protein fbpC
publication title Insights into how nucleotide-binding domains power ABC transport.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Hydrolase
total genus 87
structure length 343
sequence length 348
chains with identical sequence B
ec nomenclature ec 7.2.2.7: ABC-type Fe(3+) transporter.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17845 FbpC_C_terminal FbpC C-terminal regulatory nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.450 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fvqA02
2.40.50.470 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fvqA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fvqA01
5J4VA 1T5LA 2BBTA 1RVDA 2HJVA 1QHIA 3QF4B 1NLFA 2IXEA 3I61A 3KXKA 4LJ4A 1OH8A 2X8AA 3WYFA 2IL1A 3SHWA 4JYBA 4PO9A 1AGRA 1WF3A 4OK6A 3P1JA 4R71A 1Z0JA 1OH6A 3EIHA 4WXRA 4D0NA 1RE0A 5C18A 2HYIC 3SJAA 1NMZA 2WWGA 3X1YA 1RW4A 2FJUA 2F1JA 1T8TA 2BBWA 2BV3A 3QF4A 1AZSC 3RRMA 1ZNXA 3OAAA 4M1WA 4RVCA 4F4JA 3PFIA 3KQUA 1TX4B 3I32A 1EX7A 4A82A 4L9SA 1N6PA 1AZTA 1E1RA 2B92A 2HXYA 3GFTA 2D62A 1F60A 5J5CA 3BJIC 3ZD7A 1XZPA 3PEWA 5KDOA 4BLOA 2D7DA 1E2KA 1E1QD 1SZPA 2BWJA 2Q21A 1SHZA 4OQLA 2AXNA 3GLHE 4JSTA 4AIIA 4PPFA 3U5ZB 1KI9A 4YXWD 4A0HA 3KQHA 2QL6A 3TBKA 1KKMA 8OHMA 3P4XA 1YE8A 2N1BA 3U6BA 1E2PA 4Q66C 3I5XA 4KFTA 1CR4A 4NONA 3A1VA 2G83A 3IEUA 1DAFA 2WHXA 2ZRIA 3KKNA 1E9CA 2AD5A 3OHMA 1IN8A 3B85A 3GJ6A 1US8B 2OCYC 2OCAA 3B1ZA 4BLPA 1KZGB 1A82A 2A30A 4NYIQ 2FMXA 4GOKA 4XVQA 4BRWA 3VNUA 2ANBA 1FP6A 1A2BA 3MCAA 1CKEA 3SU8A 2ZRCA 3GLHB 4Q03A 3W6OA 3R9IA 4CT5A 2R6AA 4A6XA 4IDHA 4MRSA 2OCPA 2FF7A 1UFQA 4I1SA 4C0KA 4IRUB 4ZDJA 2HJGA 3F0TA 5FBRB 3TH5A 3EARA 4H1UA 3R8CA 1SGWA 1US8A 1E0JA 5DHAA 2XZLA 2AD1A 1JALA 3CRQA 4AKIA 5FTLA 4HLQB 1Z0DA 1NVWQ 2GZDA 3IGFA 2YWGA 2D2FA 3TAHA 4O3MA 5J4KA 4LPSA 1S9DA 3GLHA 5GJCA 4XH9B 3ZQJA 1FZQA 2DWOA 4A8JB 5L8VA 2WTUA 5FPSA 1LVGA 3VR5A 3OESA 4RD1A 4H1VA 2VTKA 4FMDB 3QKSB 3CIOA 1CLUA 2OT3B 3X2SA 1KK2A 3D7MA 4OI1A 2GJ9A 1U9IC 2WJVA 4ZCIA 3KQKA 2ZXUA 5FOSA 3PXGA 4A15A 4EKDA 4HZIA 1N25A 4PAMA 3W8RA 2J7KA 3TRFA 2J59A 2BCGY 2NO7A 5FL7A 4OHZA 1E1QA 1SVWA 3SOPA 4LBWA 5IF9A 3ND9A 1JJ7A 4M21A 1L8QA 4A0GA 2J0SA 3BB3A 3C4JA 3CWZA 3FMIA 2F9LA 1IONA 3FYHA 3QKSA 2N46A 1N2CE 3QVVA 1NVUQ 4W5JA 4YXWA 4BEBA 5KPDA 4KHZA 4YMSA 1CJMA 2C95A 3AUXA 5C46F 1S3SA 4HAVA 2IT1A 3AP1A 4JMPA 2QGZA 2Z43A 3L0IB 2OAP1 2VA8A 1XTQA 2LKCA 3BBPA 4EPYA 5AWFC 4EJSA 1HYQA 2XB2A 2CEAA 2Z4RA 3K0EA 4HYYA 5TMPA 2Q9CA 4M1KA 2V3CC 4NE2A 2OXCA 4TL6A 1ZD9A 5AUNB 4OHWA 1UPTA 2IUTA 4QXAA 2EFGA 1IM2A 5DSZA 5L3RA 1G7SA 3RRZA 1UKYA 5B64A 3B8HA 4PTLA 1FFHA 1H65A 1Q21A 1G16A 4DDWA 1VCIA 1Z63A 2C98A 4BEJA 1T0HB 1FUUA 4A8JC 3CX6A 1T3HA 3QKRB 4EAQA 4C7OB 2ZM5A 5G53C 4PX9A 3SR0A 5G3YA 4DRZA 1VECA 3I72A 4G5SA 1XD8A 2AHOA 1YR9A 4JLJA 3QXSA 3VTKA 3K70C 4XD7A 1KKLA 1AN0A 2ATXA 3WMEA 5BW8A 1OF1A 4MKHA 4LJ5A 3JZAA 2P6NA 1D2MA 2VP2A 2FSFA 3GJXC 1R10A 3MLEA 1TQ4A 4C0AC 3OIVA 2QMHA 4DLZA 3QKRA 1NP6A 3KKPA 4DHEA 3E5HA 4MKIA 5CDFE 2IYVA 4Q1FA 1XJQA 1ZUHA 2CHVA 4II7A 4DDTA 1VKJA 5JI3E 3THYA 5EZ5A 4ZI2A 4CEIB 4MITA 4KCGA 1GIAA 4MGYR 1V43A 1XU4A 2I1QA 4JLVA 2GRJA 1DTSA 1W2GA 4C0JA 2ZJOA 4AURA 2V8OA 4PPGA 4YLGA 1UF9A 3WXMA 5KTYA 1PLKA 4NYMR 1FNMA 4DCTA 1OT3A 2NPFA 3ZJYA 2CBZA 5LD2B 4IHQA 4OQXA 1QG4A 1XMVA 2NG1A 3TQCA 1FTNA 3AF2A 3B78A 5E7MA 4B35A 4CEIA 1CR1A 2CMKA 1DPFA 1Q57A 4KFRA 5HE9A 3SYKA 1NJGA 2PBRA 4JKIA 1TADA 3P20A 5DN6D 1XD9A 4O0MA 1IN7A 2ZRLA 5G41A 1S1CA 3MJRA 1AQUA 1GUAA 2WKQA 1XWIA 2ZRBA 5FPTA 2ZSFA 5F2EA 721PA 2IYXA 2YOGA 5KHOC 1N6HA 4ZDIA 1TF5A 2G3YA 1KO8A 2OCBA 4B76A 1RPZA 3WP0A 3ND8A 3PEUA 4HATA 2H57A 1E2MA 2WWHA 4BLTA 1HE1C 2EYUA 4OK3A 3PUXA 1UEJA 1YRAA 4OHVA 2Q3MA 1Q3HA 2BM1A 4HSEA 3SBEA 3TLXA 2ZU0C 2KE5A 4A1FA 4B32A 3U44B 3EC1A 3MAAC 3O8CA 1ZM9A 2GHIA 4WZBE 4KVGA 2W6ID 3ZIAD 4YMUA 1GAJA 4QM7A 1BYUA 2NTYC 4LGMA 4IEIA 4PR0A 4RD2A 5DYIA 2PL3A 3HU3A 4UJ5A 4M9ZA 2XAUA 2F3RA 4YMWA 3CF0A 3U44A 1E9RA 2BEKA 3A37A 4AKHA 1WXQA 2CCKA 3TVDA 2ZITA 3SEAA 4RZ3A 3OIYA 4D25A 1MT0A 2XITA 3M0EA 4DEXA 4EFLA 1DAHA 1DVRA 4B2LA 1PLLA 3FE2A 1KO7A 3N5CA 4M22A 3C5CA 1DE0A 3SYNA 4A0FA 3EASA 2OFWA 2O8CB 3LDAA 1EFRD 5DLQC 4TLBA 4XSGA 2JLZA 1AS0A 1E2EA 2OBNA 2WJGA 3NBYC 1OKKD 5DN6A 4A9AA 5GVSA 2ODNA 2NMVA 3I73A 4DLRA 1U8ZA 4BWYA 4D4LA 1KSHA 4DLWA 1TTTA 4AG5A 4PQYA 4DLTA 1G18A 3TSOA 3DKPA 2Z83A 4CRWB 1NG1A 3NC1C 1RRFA 1XD2B 4JL8A 2O8CA 2ZE6A 2GXSA 1CU1A 2ANCA 2OE2A 2QQEA 2VHUA 4Q5IA 3IO5A 3QBVA 5FTMA 5JS8A 3T06B 5DI9A 1WBBA 2Z5FA 2XGJA 1VCMA 2BMEA 3O47A 2WAXA 4NYJQ 4TLCA 3SN6A 2ZRAA 2W0SA 4PSKA 4BRUA 5EXPA 2IYWA 2EFHB 3C41J 4HDQB 4FW9A 1YU9A 2HF8A 3P27A 2VF7A 4TTPA 4A6PA 2CXXA 3SQWA 1DS6A 2W6IA 3BE4A 1RIFA 3ZIAA 1S96A 4AKEA 2RHDA 1GG2A 2C04A 2QMEA 5DIFA 3GLGE 2FU5C 1Z8FA 1QHNA 2CLSA 3CF6R 4IOLA 5D3QA 3CB4A 5L3SB 1AKYA 4NCJA 1EFTA 2NPIA 4NZYA 5IK2D 3PUZA 3QBTA 3PG5A 4ZCLA 1L7VC 4AYWA 3CF2A 4D4KA 3SZRA 1I4TD 1X86B 3LA6A 2JLWA 2DFNA 5CB8A 5FPKA 3KJHA 5BN4A 3RRYA 4QJ4A 2BEJA 1T3SA 3G5UA 3WYAA 1P2SA 2ZI9A 2FZLA 3WP1B 4TWZA 2PCLA 4ZI3A 2A2ZA 2IW3A 2XJ4A 5L3SA 4GT1A 1E94E 3HU2A 1HA3A 1Z0KA 1EFRA 4HLCA 2WICA 4CF7A 3RRNA 2Q9AA 1OKKA 1XJCA 4KYUA 3I62A 2P3SA 3MD0A 3EA0A 5HTKA 2IK8A 2D74A 4P4TA 1GL7A 2WSSD 4HAZA 4IEEA 5KSZA 3L43A 3UG6A 5DNYB 1N0UA 2VYFA 4Q7LA 2AXPA 4TMVA 1IXZA 1MH1A 3GJ0A 5EP3A 5EE9A 3GLGA 2F7SA 2Z6VA 2LCFA 1IJEA 4XTCS 1JXOA 4OBEA 4H9GA 1G64A 5CYPA 3KXIA 4F7WA 2IEZA 4U5XA 1FQKA 3C15C 5JZVA 1B23P 3A6PC 2QZ4A 2GZAA 1QHHB 4B2PA 5EE3A 4BFWA 1OIXA 3K0CC 4ILEA 2EWVA 2ZRGA 3ZVRA 5G3ZA 1CP2A 1JECA 2P67A 2L0XA 4Q47A 4QBGB 3LX5A 3CX7A 1W48A 2AFHE 4LHZA 1A4RA 4L8GA 2FSHA 2VSXA 4GZLA 4QHSA 1IY0A 1E2IA 3EAQA 3QIAA 3HP1A 4Q1AA 1JB1A 1BIFA 4GOJA 2J0VA 5IK2A 3ZZUA 4P33A 2J3EA 2PJRA 4LJAA 4OK5A 2AFIE 4UXIA 1WA5A 4Q4HB 2WKRA 1R6BX 1G4UR 2Y8EA 5JJIA 2DYKA 4TN1A 2ODEA 3E1SA 3MRSA 4LZZA 2BBOA 4A2QA 3JVVA 1Z08A 4BFUA 1OH5A 1KI2A 3WNCA 2AL7A 2VL7A 2F1HA 3IQXA 3O8RA 2I1VB 4MYTA 4Q01A 3FHCB 2XTMA 3QKUA 3TUJC 1MR3F 2DFKB 4U02A 4OKSA 1A1VA 2RGNA 2R6CA 2C96A 1QHSA 2WV9A 4JVSB 4LK2A 4R2IA 3SJBA 3AEZA 2C9OA 5AUOB 4JT2A 3LLMA 4Q4HA 3WMGA 3QF7A 3VAAA 1CEEA 4E07A 4WZ6A 1NLZA 2ZVQX 1W7AA 1ODFA 2CHGA 1LS6A 1SXJB 4IJMA 3S1AA 4P3YA 1KDTA 1LS1A 5IDVA 1BMFD 5TXGA 1DARA 1E4YA 1VG8A 2O8EA 3KJIA 4XVRA 5FUWA 3AUYA 1II0A 3FDIA 2GJ8A 2YZ2A 3A1UA 4WAUA 3Q7QA 2ONJA 3SDZA 3ZVLA 4ABYA 4B43A 4U7DA 4DB4A 2RCNA 3EPJA 4LJYA 2B21A 2DPXA 4Q1CA 1X8JA 1XMIA 4E5UA 1E0AA 2BC9A 1G9XA 5JEEA 1ZUNB 4WOPA 4Z8YA 3LAWA 1OXVA 3NKVA 4UNQA 4QM6A 2IYZA 3UXMA 2GK7A 4TZ6A 1Z3IX 2V55B 3AB3A 2ERXA 2OBLA 4RD0A 3UATA 4TQUS 3TAUA 4V0NA 1VCNA 2D2EA 4YDHB 1ZM4A 1XEFA 2A5DA 4Q9HA 1Q1ZA 2YV5A 4LRWA 821PA 4NCKA 1GKYA 2AK3A 2QSZA 4TLDA 3SFZA 2GXAA 3ADCA 1TEXA 5K8LA 4QNMA 4A2WA 2H1LA 1SVLA 5ANRB 1JJVA 3KXLA 3VR6A 4Q9JA 2PMDA 1ZM2A 3KB2A 2ZRPA 3R9WA 4GMDA 4MQBA 3IIJA 1P9WA 2PLFA 4B73A 2EFDB 2OO7A 2BKEA 2QE7A 4G01B 2E1RA 2P2LA 2EW1A 3SNHA 4F4CA 1II9A 1NIPA 1XNJA 3RWOA 3NTUA 1Z22A 3RC8A 4WA7A 4PHGA 3L82B 3M4YA 4P4SB 1YKSA 4DLXA 1UBGA 1LF0A 1KK3A 1SXJC 2X2EA 1YZLA 3TK1A 2DWPA 2A5YB 2HUPA 3RS4A 1W36D 4TTRA 1C1YA 3W34A 1GOTA 3LQQA 1AA9A 4POAA 3I8SA 4JLOA 4TL7A 5CJ2A 4XWKA 3GLIE 2C5LA 2JLVA 1OXUA 2AK2A 4DZZA 5HZKA 2ZSEA 5AJYA 1F2UA 2FFBA 3SBDA 2ZRJA 1T8UA 1QHGA 2NGRA 1BMFA 3TIFA 4URXR 3DZ8A 4JIMA 1D5CA 2QMUA 3OE7D 2MMCA 1XPRA 3O8DA 2MSEB 4B47A 1SULA 2H18A 4QGHA 4PAQA 4HB4A 3U7GA 2OG2A 3T34A 5EP2A 2D06A 2VP6A 5JSZB 4PSAA 3GLFE 1NN1A 5FTKA 1DG3A 3KB1A 1NI3A 4TYQA 1JEEA 2EU8A 2ZPTX 3ZGXA 5C4MA 5CK5A 3GLIB 4R98A 621PA 1D9ZA 2IC5A 1W4RA 4NYMQ 2GESA 2ZSBA 1XEWX 4QC2A 2WJJA 4OI2A 4WBSA 3PUYA 3PENA 3QXHA 4KV9A 3L0OA 5EXTA 3PEVA 2KBEA 2C77A 2CL6X 1I2DA 2XB4A 4LHXA 1ZD8A 3BORA 3FTQA 2CVHA 5JSZA 4LSGA 4UNRA 4K81B 5JHHB 4KLNA 1GTVA 4UNSA 5DE3A 1TF2A 3LVQE 1R8SA 1G5PA 2IYTA 3GLIA 4TZ0A 4RY2A 4QBFA 1XZQA 4KSBA 4ZKEA 2CJWB 4CEJA 1Z0AA 3O8BA 1TMKA 4Q9LA 1HT1E 1TQ6A 3NBXX 4I4LA 1YZTA 3ZS9A 2ZYUX 1NMXA 1MKYA 4LHWA 3X1DA 1PVOA 4LHVA 4BLRA 1D2EA 3T12A 1F2TB 3ZS8A 1W1WA 1M2OB 2HDNB 2MMGA 3K9GA 3Q3JB 1KK0A 2WIAA 5SZHB 2NO1A 3VR1A 3U4QB 1XXHE 3PR1A 1I4LD 5AJXA 5HE8A 1JNYA 2CJWA 1TL7C 3IQWA 4BZXA 4KAXA 1KO5A 1MRNA 1SVKA 2WPDD 3I4LA 4M4SA 1XTSA 1RRGA 5FOTA 1IBRA 4NKRA 1EFUA 4RCYA 4C30A 2GEVA 4PC3A 1HH4A 2R65A 4BLQA 1XEWY 3QXJA 1U99A 2ZE7A 1G8FA 3SE0A 4LOAA 1FTSA 3OE7A 3IBGA 4ZIRB 3AH8A 4DSOA 1F2TA 5DGXA 3HYTA 3F3YA 2W2TA 1NSTA 1MO6A 4MDEA 3U4QA 3VQTA 2QSYA 1Z0FA 4C2UA 3SJZA 3A8TA 1PV4A 1N6IA 2ZI5A 1W5TA 4JYCA 1MO5A 2C2HA 3MG9A 3W5IA 421PA 4C0BA 1U90A 1S9HA 5CYOA 1T5IA 1XXHB 2GVDC 2OV2A 3JZMA 3CLVA 3PV0A 4HAUA 4LUCA 3H86A 5L3QA 3AVVA 1VCOA 4KFUA 4LYHA 1HV8A 2WWFA 1WRBA 1EXMA 1W49A 2WWWA 3L0SA 3OIWA 4F4IA 4K8OA 2IYLD 5DO9A 1EWRA 3ADDA 1KY2A 3K70D 1ZRHA 4ZIRA 1GILA 1G17A 4IOJA 3EZFA 2IYRA 3FKQA 2PJZA 3WNDA 3LBIA 3GEIA 5JRJA 4YMVA 3EZ2A 2ASEA 3REGA 4TYWA 1MO3A 2V6IA 3BH7A 1TU3A 1ONBA 2YKGA 1XXHA 3W6NA 4PZLA 1MO4A 4DSUA 5KPJA 1WBDA 2QAGA 1CJUC 2K5UA 3IPXA 1TF7A 3AGQA 3QE0A 4Z1MD 4LC0A 3KUDA 2C03A 4FINA 4GP6A 2ODWA 1KZ7B 4M1YA 5JLJA 4JLNA 2ORVA 1HUQA 3B1VA 4GFDA 4GDFA 3T5DA 1TUEA 1S4QA 1ZCAA 3CM0A 2ZAOA 2FFAA 4IFEA 2QENA 2AKAB 2UKDA 2WKPA 3GFPA 3QJYA 4MH0R 5FOVA 3NH9A 2WOOA 1NJFA 3KX2A 3GJ3A 3QI2A 3ETLA 4GSYA 2KB0A 3CZQA 1FPMA 1O87A 4BFXA 4EJSB 5JHGB 2RH5A 4Q1BA 5CITA 4ZV4A 3KJGA 4PC1A 2GA8A 5CLLA 1KDPA 4AY2A 5H70A 4EPXA 2XOKD 4C9BA 1NLYA 2WPDA 4NCIA 2J46A 1U0HC 3LH5A 1ZC3A 3B6EA 1ZM7A 2ZI7A 1OXSC 3KKQA 4HZUA 4W9MC 1WE2A 2OBMA 4X8HA 2IYSA 4BFTA 2BJVA 1A7JA 1VTKA 1N5KA 5EZ6B 1Z6TA 2FDCA 4IOMA 2GJAA 2RGGA 1AJEA 2ORWA 1G41A 2J1LA 2GWHA 4YMTA 4FWTA 2FGKA 5CJPA 5KSOA 1RC8A 5BQ5A 4QGAA 1D2NA 1IY1A 1T6NA 1ZCBA 5FOWA 3AP2A 4R2HA 5FUXA 3CNLA 3PIRA 4Z51A 1OE0A 1Q44A 4EPVA 1OYYA 2R8RA 1EESA 1T9HA 2GDJA 3NC0C 1G8PA 1G7CA 2ZJ5A 3PCRB 4PAOA 4D0LB 3EXAA 1W47A 4MYUA 3R8FA 3DVLA 4OJKA 3TW4A 3B5JA 3EZ6A 1U98A 2QNRA 2ZRKA 1OSNA 5IT5A 1J70A 5EUQB 1XCGB 1EWQA 4MUBA 2N42A 1Z6AA 3VX4A 1XCPA 2H92A 1P6XA 2FOLA 1J7KA 1Q1EA 2VH5R 4MA4A 3G0HA 1JR3D 5FBWB 3T5GA 5FI0B 1CIPA 1HT2E 1OLOA 4Z1MA 3U7HB 3THYB 1FX0B 3KFXA 2QT0A 4HUQA 1M34E 3TR0A 3AVXA 2YVUA 3T35A 2J0UB 3NBZC 5CIQA 2QMOA 4DLSA 1EGAA 4KITB 4R9UC 2ZYTX 4EJSC 3B1YA 4ZDKA 3DOFA 4M9QA 3ASYA 2BMDA 3BC1A 2R62A 1KSJA 1IN6A 5AJWA 3EZ9A 1ZW6A 2BKUA 1G6HA 5JS7A 4NDZA 1L4YA 1FX0A 1JR3E 2QPOA 3PVSA 3K0AB 5LPNA 2J0UA 1N6OA 1UDWA 2ZRFA 2O5VA 4B6FA 1IJFA 1QVRA 3TW8B 1D6JA 4B33A 4BQSA 4Q7KA 1Z2AA 4UNNA 3UPUA 1T0JB 2ERYA 1E6CA 4ARZA 3TUZC 1G291 4DLVA 1NY5A 3SJCA 5FBVB 1N5LA 3N2EA 4PHHA 3NDPA 1TPZA 2GILA 3Q5DA 3A36A 4UQOA 2A5GA 2H7VA 5FTNA 2BIFA 1E2FA 3K0AA 1UBEA 1P60A 4BFZA 2C9CA 1EX6A 2CE2X 4KU4A 3AVQA 4MRPA 4WW0A 5FL3A 1QZXA 4RZUA 1E0KA 2FPMA 4Q1DA 5CM9C 1UAAA 3T15A 4NPHA 1ZNYA 3EWAA 3BS4A 2QT1A 5EP1A 1Q22A 2PH1A 2PEYA 2D7CA 1QDEA 2J9RA 3T1TA 5H8WA 2O52A 4AG6A 1JPNA 2QA5A 5CDFA 4NL4H 1K8RA 4KXFB 1G8GA 3GJ8A 1KY3A 1LY1A 2GNOA 5DISB 1SHKA 3FMOB 4LV8B 3NXSA 4PPQA 2F3TA 4US0R 1X3SA 2IXGA 4DCVA 3A1WA 1Q1BA 2YWHA 2J5XA 5SZIA 2MSDB 1O3YA 1UEIA 2NZ8A 2ZSAA 1TEVA 1M7BA 3AVPA 4IOKA 4ASUD 2R9VA 4D6PA 2VP5A 2PLRA 3TKLA 1Q1QA 4RZXA 1KAOA 3RWMB 2JAQA 3UIEA 2WM9B 3GJ5A 3AVOA 4LBYA 1AGPA 2A78A 4JLPA 1LTQA 2Z4SA 2CNWD 3T1QA 1UJ2A 1P7CA 5LD2C 3DKVA 2GXQA 3U2QA 3IEVA 4O2LA 4ESHA 3CRVA 4RD4A 2IS6A 2DY1A 4C0SA 1UKVY 3I1FA 4B3DA 5JEDA 2CL0X 2VP9A 4UKDA 3RDPA 1WQ1R 1LFDB 1LV7A 4PZYA 2RGEA 1NKSA 2ZSDA 3A4NA 5F3WB 1FL9A 2EVWX 4N0DA 4JBWA 5JWHA 2YOHA 4DIEA 6Q21A 3CONA 1E2DA 3AF1A 4RCZA 3W8NA 5EP4A 3REFA 1DADA 1E2GA 2GZHA 4NYIR 4O25A 4S35A 5EE1A 4QG7A 3SI7A 4HDCA 2ZVPX 2PX3A 3BAFA 4JL5A 4XTRA 5KO2A 2FFHA 2CCGA 2YYZA 3U61B 4NMMA 3ZZ0A 5JCPA 3B1WA 1J2JA 1FMLA 5CB6A 2FPLA 4B44A 4TL9A 4UNPA 2FV8A 4YONB 2REOA 3G82C 3X1ZA 1W0KD 2G0TA 1GNRA 5FPYA 5FBQB 3LD9A 2IX3A 1XMJA 2QUZA 2VIIA 2PEZA 3B7GA 3BFXA 4U00A 1ZNZA 3UG7A 3FWYA 4ZDWA 5JJLA 1D9XA 3C5HA 2R6FA 1U0JA 3W6PA 2O8FB 3V4FA 2QP4A 2ZR7A 4LY6A 5EUMA 1PLJA 3CR7A 4G5RA 4Q19A 2WJIA 2VHTA 5LBIA 5GJWC 1M1YE 3ADBA 4Q48A 1GL9B 4TTQA 3LW7A 4G5GA 2F1IA 4A92A 2YINC 4QGGA 2ZI4A 4EQ6B 2FZ4A 3TE6A 1H8HD 1JBKA 2BHRA 3DM9B 1GDDA 2QTFA 2IWHA 4Y0VA 1P61B 3EWSA 3FMFA 2G77B 3OFND 1EFHA 1AS2A 1N0VC 4Q4JB 4OHXA 2O8FA 1Z06A 4OHYA 4TLEA 3B1XA 4KO8A 2R2AA 1IXSB 2ZAMA 3CPEA 4X8OA 1U8AA 1X1SA 3UMRA 3UK6A 2H8KA 5AUPB 2E87A 2OFOA 1C9KA 3GJ4A 4Z54A 2AWNA 5LDDC 1YZKA 4E09A 2ZUBA 2SHKA 4EQ6A 4MRRA 3MWLA 5KNBA 3FOZA 1P5ZB 4HLDA 1VHTA 3BXZA 4KFSA 3GCGA 4M0LA 3ZDQA 2H5EA 2VO1A 4WZAE 3V00A 1N0WA 1DAMA 2BOVA 4Q4JA 4W5WA 1ZUIA 1N5JA 2ODBA 1YZUA 1W46A 4RJLA 4DSTA 5B30A 2GJKA 5FPHA 3TVTA 4MGZR 1Y3AA 4TT3D 2GF9A 3HWSA 2XXAA 1ZJ6A 4JLKA 5KNCA 221PA 3GLGB 3LY5A 3AF0A 2O8DA 4XSHA 4OI0A 2R6GA 1BKDR 4E03A 3A1TA 1OPXA 3T1VA 3CRMA 4NH0A 4QL3A 3LRPA 1QHXA 1E9EA 4KYIB 3FFBA 5E95A 4HAYA 1KJWA 2WZQA 2OM2A 4GP7A 3EIQA 1W0KA 3BB4A 4LI0A 1Z6YA 4ZO4A 3AP3A 1IXRC 4URWR 4ACAA 2BJWA 2IF2A 1G8HA 3OIUA 1N3BA 4I1VA 2O0KA 3WRYC 4M9SA 2UZIR 1P2UA 1TU4A 2B6HA 2ZE8A 1QF9A 5KSPA 2I3BA 3IIMA 3I5YA 1YZQA 1N6KA 4GRAA 3NH6A 5FOUA 4DB2A 2IHBA 1Z83A 3CR8A 1E99A 4D4JA 5A5GA 4Q9IA 1J99A 1I2MA 2LKDA 4V03A 4LJ8A 1Z0IA 1H8HA 3HPRA 3I3SR 3CO5A 4FXPA 4O2RA 2XSZD 1OH7A 4JLAA 4Q02A 3W9YA 3OFNA 3CUEF 5C2JB 1PZNA 2OEPA 2GEDA 5EJEA 4NTZA 4HI0E 1G7TA 1XEXA 2WIBA 4IDNA 5TV2A 1GFIA 2DR3A 2FG5A 3CX8A 4NHOA 4KJZA 3VMFA 4B3CA 2PZGA 2XNDD 3F5FA 1E32A 2FE4A 3Q9LA 2WAYA 4US2R 2PT7A 4GNKA 3AF3A 2HLDD 4V0LA 1KSGA 3VHLB 4QBHA 1YZGA 5EXSA 3DEFA 4UJ3A 2X2FA 4JVNA 3DOEA 2OILA 4N1AA 5FH9A 4Q1EA 3GEHA 1KI6A 2AKYA 3S1AB 1NKTA 2NO6A 4PPNA 1WP9A 2O8EB 4XIGS 1ESMA 2QTVB 4A4DA 4Q7MB 3BFKA 4LYFA 3NHAA 4MKGA 3Q5EA 1K6MA 1NY6A 3PUVA 4RFVA 2G88A 2X77A 3PUWA 4G3XA 2ZE5A 4DUGD 2BDTA 1GSIA 1P9RA 2KJQA 3QQ5A 3CPJB 1R0WA 1R7RA 3IILA 1P75A 3GQBA 3LLUA 1EK0A 1VG0B 3PEYA 4BGDA 5HKKD 2WSSA 4I99A 2ZJYA 4Q9KA 3IO3A 2JDID 2P0EA 5JI2E 4A2PA 1GWNA 4AI6A 2VSOA 2VLIA 1QHYA 4P0TA 4ESVA 4FN5A 1TUIA 4TMWA 2HCJB 4P4UA 3EW9A 3V9PA 1Z28A 3OF5A 3EPHA 1QRAA 521PA 4CDGA 5E7IA 4DDVA 3H2YA 4BPBA 2CK3D 2QROA 5DYGA 3VR4A 3AQ4A 5ELXA 4PQFA 1XPOA 3V4RA 2OLKA 5JWRA 4OI4A 2GBLA 3KQLA 4ITRC 3THXA 3RSLA 2OXRA 1ESNA 3E70C 4P31A 4TMKA 1E79D 4B75A 1ETUA 1KO1A 2B7CA 2IUSA 5A4JA 5B2ZA 2RGNC 1ZAKA 4C0HA 1NBMD 2AN9A 1G20E 1DELA 2ZRHA 5AJVB 5JRZA 2XX3A 1HQYE 2ZQ5A 2XNDA 4GMXA 4DCUA 1HE8B 4G0NA 1JI0A 5K8IA 1Z07A 2XTNA 1ZVQA 2HLDA 2GEUA 2V54A 1GVNB 3M6AA 3QVUA 2YOFA 4EFNA 4FWIB 3GPLA 3MSXA 4Q7JB 1OHHD 2KWIA 3B82A 2O0JA 5KDDA 1GRNA 2OESA 4Q00A 3Q85A 3NWJA 4LV5B 2CLDX 1FMJA 1R5OA 4BUJA 1F2UB 2ZTSA 4QHTA 3RS7A 5FR1A 3CZPA 3AV0B 1ZMXA 3DDCA 1XTJA 3KUCA 2KBFA 4JJZA 1JQLB 2Q3HA 3DMDA 3WMFA 5C4GB 4BFSA 4LX0A 3NVAA 1E9AA 3EC2A 2EFEB 4EUNA 1YQTA 2G0NA 3OAAD 2FWRA 2P5TB 5HKKA 3K0SA 5JMTA 2LWIA 4JLBA 4CT4B 2JDIA 1Z2CA 1NRJB 5D3MB 5GJVC 2IXFA 1JEDA 1E1RD 2WMOB 1KYIA 3L2OB 3RNLA 4CZ2A 3DZDA 4CYMA 4DXAA 2DCUA 3FMPB 4D4MA 4C2TA 3FKSD 2A3RA 4OL0A 1LNZA 2QP9X 3VKWA 4LV6A 1GNPA 2QPAA 1TQDA 1XDBA 1X1RA 2W58A 4NYJR 3ZVMA 1IAQA 3QXCA 2NO0A 2JA1A 3HDTA 3P26A 2NO9A 1NN3A 3GFOA 3CNOA 5D3MA 2ZU6A 4LCBA 2PMKA 3AKCA 1E79A 1KNQA 3DHWC 4CEJB 1YZNA 3QKTA 3WNBA 2ZS9A 3BIFA 2WOJA 4WXPA 2GXUA 4L15A 4D80A 1FUKA 3AM1A 4FCWA 1XB2A 1NSFA 1LW7A 2ZUDA 3ADKA 2JATA 5CLQA 4I81A 1IN5A 5KNDA 3U6KA 2P6UA 2XNSA 3GEEA 4DCSA 5P21A 1N6NA 1XTIA 4FMCF 3M1IA 4DCNA 3GLFB 4W7SA 2Q6TA 4YC7A 1OHHA 3AGPA 1VHLA 3CRRA 1W36B 1RYFA 1KNXA 3QXXA 4CEHB 1GITA 4F91B 3KQNA 1R8QA 2YNMA 4J0QA 4PHFA 2RKOA 4TMTA 1OB2A 2DBYA 4B3XA 1CR2A 1AM4D 5HZHA 4RD3A 2VP0A 4W5HA 5TY0A 4Q4AB 2VP4A 3EA5A 2JLRA 3VKHA 4IW3B 1DO2A 2ZREA 4Q4LA 4P4SA 1X8LA 1P2VA 4M8NE 4Q18A 1XFAA 2ZR0A 3GLFA 2E9SA 4JBYA 1NN0A 4IXMA 1R0XA 4CEHA 4OQNA 4URUR 2Q3FA 4RKEA 1G3RA 3ZZTA 1GKUB 1OFUX 5L3QB 5F9FA 5HCNA 4BFYA 1DG1G 1DOAA 2WBLC 3I92A 5EE0A 2GCNA 4JJKA 1X6VA 1SKQA 3N70A 4Q4AA 3FKSA 2X1VA 3TQFA 1BH2A 4TMXA 1UBCA 2IF0A 1LB1B 1J90A 1ZP6A 2UVQA 3OEHD 3QG5A 4GPTA 4KLZA 4QOSA 5FL7D 3SFVA 4QJ5A 3U3RA 4BLSA 5TDHA 3BFVA 4FMBB 3AKDA 1GZSA 2IYYA 2EYQA 3HR7A 1YHNA 2QAGB 2G1KA 1WDTA 5KSYA 3GP8A 5BYKA 2RB4A 1OIWA 3KZ1E 4IVRA 1M74A 1Z6GA 1XTKA 4V0OA 4URZR 5JECA 3LWNA 1ZNWA 1CRQA 2FX3A 2ONKA 2QP3A 4M1MA 1TAGA 1VYUA 2V1XA 2F6RA 1IN4A 1CJVC 3L8ZA 1VIAA 1U2RA 4FI3C 3DL0A 3IPYA 2RGCA 3WBKA 1E2QA 3B13B 3TSZA 4ON9A 2V4ZA 3DM5A 5FTJA 4FD2A 1W36C 2ZJ8A 1U9IA 4UXHA 2ZEJA 3A1SA 5LB2A 2P5SA 2Q9BA 2Z0MA 1Z5ZA 2F9MA 3FGNA 4B71A 3IHWA 5CM8B 3SHFA 1KDRA 2FSGA 2FPKA 2OHFA 2JJ8A 3VR3A 1ZIOA 1CULC 2OAQ1 5HR5A 3RS2A 4TMZA 1V5WA 3AVWA 4HZUB 1E2JA 1K5GA 3ONWA 3BB1A 1G3MA 3D31A 1KMQA 4EFMA 2JLXA 2XZOA 3RC3A 4YQFA 2IS1A 5JFGA 1ZINA 3TSWA 2ZR9A 3MWYW 1OXXK 2ZI3A 2JEOA 3RYTC 1E9DA 4L5BA 1UM8A 5JWOA 3DO6A 1GRQA 1MOZA 4C4PA 1T3LA 2O0HA 2VHCA 2CVFA 2TMKA 4JSYA 3CBQA 4JLDA 4X8LA 3L8YA 4XD7D 1DAEA 4EPWA 1Y63A 3VKGA 4A0RA 4IDPA 1KTVA 2IS2A 1HTWA 2FA9A 3K9LA 1RRPA 3AKEA 1U8YA 2WJHA 4RD6A 3K70B 3CH4B 1KI4A 3LO5A 2WSMA 4LJ9A 1E0SA 1YR8A 2QAGC 3LVRE 1KI3A 4NCHA 3OEHA 5J47A 2J45A 2PZFA 3QUSA 4A8JA 2ZRDA 1DO0A 4QBIA 5GJBA 4LYJA 5C1BA 1G3IA 4LHYA 4OQMA 1G8YA 3MFYA 1B0UA 2GAOA 1G7RA 2GETA 4LYAA 4V02A 3RVBA 4BZPA 5F9HA 4HUQB 3W90A 3MMPA 3THOA 4GBMA 1KJZA 1MABB 1R0ZA 3WYGA 1FNNA 4IDOA 4QJ3A 4BZQA 4L9WA 2IYUA 1G4AE 1ZD1A 3K0FB 1SVSA 4FMCB 4C0LA 2WJYA 4FCVA 1XF9A 4PHTA 4DT1B 2REBA 2D4HA 1ZM3A 2JJ1D 1PUIA 1NVVR 4JKYA 3H1TA 3KJEA 5M04A 1H8ED 3I8XA 1R0YA 3Q72A 3KKMA 1VG9B 2FGJA 5F98A 4D82A 1G5TA 4FIDA 4HB2A 4XWOA 1R2QA 5J4HA 1MABA 4PC2A 4PFSA 1OFHA 2B8WA 4QKQA 2D3WA 5JBQA 2W0MA 2OLJA 1KOFA 3K0FA 4TYNA 2A7QA 4DBLC 1YJ5A 2XZPA 121PA 2GCPA 1S1MA 3E2IA 4D81A 4ARZB 3LFUA 3ZVNA 4B6EA 3QSYA 4MYHA 4BFVA 2HXSA 4DT1A 2ATVA 3QG1A 3HPQA 2IYQA 3CKLA 3B2EA 1BYIA 4TYYA 2VPPA 1XRJA 5FBLB 2VQSA 3H84A 4KI0A 2F1RA 4LWZA 3K09A 4TL8A 2FH5B 2XOKA 2O8BB 3Q8XB 2QG6A 4HDOB 3NEYA 2ZS8A 4N3NA 3SQXA 2KSQA 4MRVA 1E2NA 2ZYWX 1TQ2A 1ZIPA 4AYXA 2HT1A 4JLMA 2CE7A 1E98A 5AUQA 1XPUA 3AVTA 4C7OA 1ELOA 2IBMA 3QPVA 1J8MF 2QAJA 3HR8A 5J4LA 2BCJQ 2WMNB 1II8B 4JBXA 1CTQA 1VIYA 3RSOA 2W83A 2ZYVX 1ZU5A 4LBZA 5JJKA 1JPJA 2ZUCA 4MGIR 1UDXA 1A5TA 1BS1A 4TLAA 2O8BA 3LXXA 4B74A 3EPKA 5FUVA 3ZD6A 4LBVA 1OFTA 5DI3B 2XTZA 4AWXA 4MKFA 4WVFA 2QPTA 5FUYA 1U0LA 2FEMA 4OYHA 4GL2A 2J87A 2RMKA 3HU1A 2ZRNA 4AKGA 2P6RA 1II8A 1DAIA 1CR0A 2GTPA 1ZU4A 2RGDA 2REXB 3RS5A 3K09C 3VX3A 2QEQA 1E2LA 1OJLA 3L0PA 2HF9A 1JR3A 4NP6A 1S3GA 1SVIA 1U94A 1IQPA 2JJ1A 2JLUA 1OFIA 1RZ3A 3LQRA 5DI3A 1H8EA 3WY9A 3T61A 2PT5A 3W3AA 4JS0A 5K8TA 2RGBA 2P65A 4M2LA 3QY0A 1HQCA 1JR6A 3QOFA 2QI9C 1W44A 3BH6A 4B48A 4CGZA 4UXJA 5FR2A 1W5SA 1M7GA 2C99A 2JIZD 2QY9A 3CPHA 1FP7A 3LNCA 4G5QA 4ACBA 4LDJA 2NOAA 2WWIA 3U3OA 2CL7X 1FOEB 4JT4A 4TYPA 1GL6A 3X1WA 3C8UA 3UMFA 4M1SA 4HUTA 5GADl 3GMTA 1FW6A 1Q0UA 3EG5A 4DDUA 1J8YF 1SVMA 4XOIA 2B8TA 2QRNA 3RS3A 2JJ2D 5CK4A 3UMSA 4D0GA 1NVXQ 3OEED 2FN4A 4RFSB 1TNDA 5H68A 1Q20A 3A4MA 4QNRA 1K5DA 4P32A 4KBFA 1KGDA 3QPUA 2YJTD 2YHSA 1XTRA 2YWEA 4RKFA 2KI5A 3FHTA 1Z47A 4HAXA 3K9HA 3U3KA 3LXRA 4AD8A 1EFCA 4IVPA 4PSVA 2VRWA 3VFDA 5KOYA 1CJTC 3EZ7A 1Z29A 3MGCA 1Q3TA 1W4BA 2X19A 4MUAA 4DC9A 2HT6A 3H0KA 2ZIAA 1JAIA 1OIVA 3U60B 3RABA 4RFSA 5KUTA 1E69A 2R6DA 2ECKA 4N0EA 1NIJA 4B34A 1ZC4A 3IUYA 1YRBA 1NG9A 2W2XA 4QFMA 2GAAA 1ANKA 4V0KA 2HCBA 4HB3A 1CS4C 1XBTA 2A5JA 2QU8A 4F92B 4D26A 2J7PD 1R5NA 2DHRA 5CIWA 1S0UA 3F8TA 2OFXA 2MSCB 1CF4A 3TUIC 2ZJZA 4LPKA 2W2VA 4XVUA 2ZANA 4M1TA 2RAPA 1E2HA 1GM5A 1LF5A 4JVLA 2QTHA 4QGFA 3ICQB 1MRSA 1AIPA 4L4UA 2A9KA 5JCZA 1P62B 4KSCA 3KTAB 1EG7A 1DEKA 1I4DD 2W6JD 1UKZA 2GCOB 4JL6A 2YC2C 2OUKA 3W3ZB 2F43B 2IHYA 3BWDD 1KI7A 4WIAA 3WRXC 1F6BA 1VYTA 5E7JA 3NDBB 5J4YA 4QHYA 3NHBA 4DSNA 1KK1A 2FSIA 2RGAA 3H4MA 3TGPA 3BOSA 4ZKDA 2JIZA 1T91A 4ASUA 1NNEA 3MJHA 1G5RA 4Z8XA 4TSFD 2YC4C 1F3OA 4LJ6A 4IVQA 1XCMA 5HPYB 3LV8A 5BWMA 2PCJA 3KTAA 2XXAB 3W5JA 5FOXA 2GCOA 2JJ2A 5K8UA 1GKIA 2XJ9A 3OEEA 2O8DB 1ZBDA 2VHQA 2F43A 4I1OA 4PXAA 2CNWA 2QORA 1N6LA 3RS0A 2PX0A 4C3ZA 1M8PA 3KDSE 2ZJ2A 3KL4A 5AK0A 3RAPR 1HURA 4OQFA 1G19A 2CCJA 1XD2A 2V9PA 2WWXA 3IDQA 1KJYA 3BK7A 2IUUA 3RHFA 2QQ0A 1UKEA 4B3BA 4ZCMA 3NBFA 1AK2A 3BGWA 4Y0AA 1T4GA 3TJZA 4DEYA 3UWOA 1P9NA 2BVNA 4DIDA 1MV5A 1G6OA 4JVMA 1WB9A 3SC3A 2V1UA 1E9FA 2JLYA 1RYHA 2NQ2C 2ZRMA 3HJNA 1HEIA 1KHTA 3IKJA 2G1JA 3BERA 4NBSA 2I4IA 3QENA 3TNFA 2ZJBA 3ZQ6A 2QM7A 3DMNA 4Q21A 4HB0A 5TARA 2J7PA 1DBSA 4RZ2A 1RFLA 3K0CA 3U3MA 4DLYA 1W2HA 5KDLA 3R9XA 3IBYA 3LBNA 1OB5A 3D3QA 3MWJA 1P3JA 4JZKA 1P73A 5LB4A 2YWFA 5TVKA 2VBCA 3FPAA 1OXTA 1JAHA 1E96A 3VNVA 3UWKA 2DFLA 5SZJA 1XEXB 1GNQA 2GK6A 1W0JD 2W00A 3B9QA 3UANA 4CIDA 1A2KC 4CVNA 3VU9B 1KO4A 2GJSA 2QM8A 2W6JA 4HLUA 4LC1A 2GKSA 4AYTA 1KAGA 2RHMA 3NIBA 3ZH9B 1AQYA 3B60A 5EE5B 2HEIA 4PC6A 1IOZA 4M1OA 1NF3A 4F38A 2ZS7A 2CDNA 1YR7A 4TQAA 5GVRA 2C78A 2V7QD 2VHJA 4TQ9A 4XWAA 1G3UA 1QVAA 3P4YA 4TSFA 1KI6B 4BASA 5AR1A 1KSFX 1BOFA 2H17A 4I1UA 4PANA 4KBGA 1VPLA 1KI1A 3VU9A 4D2IA 2AX4A 4ZPXA 1COWD 2EQBA 3GD7A 2ZI6A 2VSFA 1L4UA 3R20A 3ZLJA 3FVQA 1SXJD 5B57C 1NL3A 3QNUA 1N5IA 3SYLA 3K1JA 4DWJA 2EWWA 3MUFA 4MDFA 1OYWA 5FI1B 4IFBA 3LBHA 4NCNA 3DPUA 3CH5A 2JLQA 4DLUA 1R4AA 3CNNA 4GI7A 5BN5A 3OZXA 5A0FA 3C14C 2DFTA 2FFQA 1KIMA 1OV4A 4PZZA 3D8BA 4TT3A 2JCSA 4B3GA 4HLUC 3KKOA 1RRCA 3A58B 3AVUA 1CBUA 3AF4A 1YVDA 5E4FA 1QHHA 1W4AA 4X8MA 3TMKA 1AS3A 4M9XA 1CXZA 1D8TA 2BM0A 4XJXA 4YDSA 3T1OA 4EPRA 2FNAA 5IHPA 1SXJE 2C8VA 1JQJC 1GRRA 3ASZA 4NU0A 5B58C 3HYRA 4B3FX 1PJRA 1WCV1 2QE7D 2G6BA 2DWQA 5IRCD 5TB5A 3C16C 3WHKA 3THXB 1Z6XA 2AWOA 3QPWA 5H1YA 2NZJA 3U7EB 3WHLA 3CW2A 4KODA 1S8FA 5BYJA 1XX6A 3R7WB 2OZEA 1DAKA 1NMYA 3B9PA 1Q12A 2HV8A 1AKEA 3J81k 1SVOA 4QRHA 1KI8A 2BMJA 3RANA 1W0JA 3BRWD 1SKYE 3EPLA 4MRNA 3CWQA 3PITA 4MGKR 3EX7C 5DHFA 5BN3A 4IKEA 4AC9A 2G9NA 1UBFA 1JXMA 4F93B 2Q0HA 1ZYUA 3KFVA 4URVR 1W4CA 4GOXA 2UZ3A 2B7BA 2JLSA 3A4LA 5FFMA 4EPTA 3ICEA 2OSBA 4EDHA 1KDOA 2XSZA 2V7QA 3FB4A 4AK9A 2IEYA 3R7WA 4PQRA 3QEOA 5EQTA 1PUJA 3BH0A 2C9YA 2ZROA 1VDZA 3CRW1 1L2TA 2FEOA 3D6TB 3N2IA 4HAWA 4PO8A 5KYKA 2DB3A 1M6NA 1F5NA 3JVUA 1COWA 1KMHB 2PZEA 1N6RA 3PQCA 3Q7PA 1FQJA 1SKYB 4EIWA 3GJ7A 3U3JA 1XJ0A 1SXJA 2ZJAA 5E3HA 1S2MA 4FCTA 3FHOA 5SZKB 1G3QA 4G5OA 4US1R 3U7FB 3NEJA 3PJRA 1P72A 2HYDA 2NIPA 3IIKA 5DH9A 4URYR 1RJ9B 3TR5A 2R44A 3EIEA 1E9SA 4ERNA 1F48A 3C7KA 4C0QC 2BBSA 2VF8A 1KMHA 2XEXA 3THWB 5J40A 4PC7A 5AJZA 4V0ME 1NBME 2IWRA 2QGNA 1VYVA 2ORIA 5EXXA 3P32A 2WWYA 2IS4A 1X8KA 1NVVQ 1SQ5A 4RSGA 1QG2A 2GBLC 4DUGA 3VR2A 4K46A 1VG1A 5KU1A 1WMSA 2JGNA 5UKDA 1QBKC 1E4VA 3LW8A 1P4SA 1GP2A 1HY3A 4G1UC 1IHUA 2RGXA 1RJ9A 2VEDA 1UADA 3FFAA 5BXQC 4IXNA 1NN5A 4IDQA 1CRPA 3AKYA 4LJ7A 3THWA 2QBYB 4M53A 2CLCX 4FMDF 3AVYA 4KVAA 1RKBA 3K53A 4DVGA 4HEJA 2BMFA 1OW3B 4PO1A 4CW7A 2CHQA 1VMAA 3VHXA 5G40A 5HCIA 2H16A 3LX8A 4BE7B 1XP8A 1YR6A 3NG1A 3RLFA 4B2IA 2CK3A 3BD9A 3X1XA 1M7HA 1IY2A 1E9BA 1DAGA 2J0QA 2V6JA 4MYCA 2QN6A 4OJQA 1E3MA 3K8YA 2AR7A 3UKDA 1G21E 4DJTA 2QBYA 2J41A 2GVZC 1C4OA 3QEJA 4A36A 3ECCA 1R5BA 3ZYCA 2JASA 3K9NA 4V0MA 1NBMA 3IHLA 1XMSA 1P2TA 1G1MA 2F55A 1U81A 4R7ZA 3WBJA 4E22A 2WVJA 5L3VA 2IA5A 2GF0A 1BO6A 4GZMA 4BECA 4DKXA 2EFCB 3SS8A 2ZETA 3MWKA 4S2EA 4L16A 2A5FA 2QRZA 1CJKC
chains in the Genus database with same CATH superfamily
1T5LA 3COPA 3K7AB 3I90A 1C0LA 2ONZA 2ZG6A 3TB6A 1E0BA 2BL4A 3I61A 1QORA 1G21B 3RUFA 4PYJA 2FLKA 4RWEA 2WHEA 1T8TA 1JQAA 4F4JA 1Y0BA 3V6MA 4G7ZC 3DYBA 4HVLA 2B92A 5J5CA 4WCFC 3O8NA 4CKWB 2VNKA 4KQXA 3VO2A 3EE6A 3I9MA 4EMBA 2QYHA 1F2VA 4YJ2A 4D41A 1JFVA 3TEFA 3ZI7A 3DKRA 5IU6A 1YO6A 1E2PA 4LJRA 5IWAL 3IEUA 2WHXA 2R7ZG 5ILOA 2JSOA 3GV3A 4GOKA 4KYTA 3D6FA 1TWAH 3QMWA 2OCGA 2QJOA 4F8EA 2Z0SA 2HJGA 1H2HA 4Q82A 1ZH4A 4H1UA 3D6VA 2CJFA 3RS9A 1OLSA 4AKIA 2AVDA 3HCBA 2Y0EA 1QRDA 4BDTA 2QTGA 5L8VA 1U2GA 3RM3A 2H00A 4DMFA 2D5DA 3KUUA 3DVQX 1QP4A 3KLSA 4OI1A 4JIGA 1ONLA 1ZS9A 4EKDA 1MKHA 4CFSA 2J59A 5FL7A 4GKAA 1X2BA 1AK9A 3EGVA 3U1BA 1IONA 1NVUQ 2A8VA 4OUKX 1KDBA 1Y3BE 4NX2A 2QGZA 4RDCA 4RHSA 3ZD8A 4D8WA 1GAEO 3EIWA 4QD3A 1J0EA 4J1SA 4JI1B 4OFZA 4YUYA 2ODTX 2A9RA 2EFGA 5L3RA 3BZBA 2EDAA 3B8HA 2JJMA 3DE1X 5TMDA 5IVKA 2OXFA 1FUUA 1U4NA 1C9OA 4K2KA 1SR8A 3LTNC 4DN6A 1N2CA 1S8OA 1KKLA 1WCIB 1SC4A 2WTEA 4M60A 3OOJA 4HWSA 4KD4A 5FA8A 4BQEA 4YCDA 2JHCA 2IYVA 1ZUHA 3PGZA 1I4RA 1VKJA 4KCGA 3DMUA 1HR0B 4LUVA 5AQ1A 3K92A 5DLQE 4YLGA 1UF9A 5KTYA 1TWFB 2CXRA 2Z4HA 3EC7A 3ZI0A 4DCTA 1FFXA 3NPPA 1NTRA 3IJRA 3ONNA 1UANA 4YP6A 3IESA 4EO9A 4XX0A 4I1RA 2ATEA 4OWXB 1NJGA 3ZLTA 5DN6D 3SEZA 2XCOA 3MJRA 3P4UA 1N8TA 4KQHA 1C7QA 4X62B 1B9MA 2XWJB 3A10A 3WP0A 4EK9A 3OEWA 3CEHA 3PJGA 3AKZA 2BLNA 4RETA 3PUXA 2X9QA 1BXKA 4XQEA 3HKZG 5EWJA 3U3DA 4LQ4A 2VQ6A 3EZLA 4R0MA 1XIVA 2V7EA 4D9FA 2JAPA 1QQ5A 3PXCX 3USES 2CMDA 4CF3A 3OJCA 1W4LA 3BYTB 3B9RA 1DVRA 1RBZA 4WZBB 3FE2A 1JS1X 5HUQA 1O8CA 1G98A 2JK1A 4FF3A 4FGWA 4XSGA 4NDXA 1EWHA 4LTDA 5JPMC 1U5AA 4HGNA 4PQYA 4O5OA 1GUTA 1NG1A 4R9RA 3HWX1 5K0EA 3LKBA 4Q5IA 1R27A 1OZFA 1C14A 1VCMA 3O47A 1UE7A 4WNCA 3Q5GA 2WAXA 3BD6A 3F2UA 3P27A 3USCS 2CXXA 3SQWA 5KJ1A 2H85A 2GFHA 1V1JA 3DDNA 1Z8FA 1VQLA 2CLSA 3GNSA 3KWMA 2ZCUA 3WRYA 3DLBA 5ESDA 1EFTA 4PINA 3PUZA 4RKYA 3NRBA 4NJMB 4BIIA 1J0CA 1T3SA 2GUGA 2V4DA 4HGPA 1X7XB 1QLHA 3HU2A 4EKNB 1DIOB 4A5OA 3MD0A 2MCFA 4MHTA 2D74A 4P4TA 1ISJA 2FW0A 4D56A 3I4NB 4IEEA 1P44A 4LE0A 2FMMA 3PIP3 4TMVA 1WVMA 3SWWA 3AYHB 1IJEA 3KD3A 1ECJA 5AW7A 4JI2Q 3R76A 1I50H 4Q16A 4RTSA 4QOIA 1MPTA 3WDMA 3HOYG 4GN4B 2PMCA 5F77A 4RAQA 4JEHA 3GU3A 5DBHX 1JQDA 2NT4A 1TC1A 1Y6JA 2NVTB 3NIGB 2WG1A 3IT1A 1GZ7A 3ABIA 1CI3M 2QMYA 2CV2A 1G2TA 2P9QA 4N3GA 2WKRA 1J9ZA 4FYVA 5L53A 3VM6A 2CUKA 2HLNA 2XTMA 3IUSA 3FI0A 3AEZA 2VWGA 1R4NB 2A69D 1WU7A 4K6DA 3BWYA 4CT0A 3QOWA 3ZVLA 4U7DA 1SBQA 3LO8A 2BE9A 1XMIA 3DLIA 3OTOB 2QKYA 4RIGA 4HAEA 4JXZA 3L7LA 2CJXA 1TQHA 4TQUS 3GK3A 2IOYA 1D03A 2YV5A 5JEAJ 2BRUC 821PA 1ZUNA 3NZEA 2OORA 2DAPA 3ON5A 4NV3A 1RWVA 2ZRPA 1JWUD 2ID0A 5EL0A 2LBPA 3V3KA 5BMVB 4F1JA 3RC8A 4MULA 1YKSA 4DLXA 3VZCA 2R48A 1LT4D 4K0KQ 2OGUA 5HWSA 2ZWMA 1W36D 4IICA 5A06A 2GN5A 4LUZA 2SECE 3AI1A 4TL7A 1Y8PB 2OHXA 3LKVA 4OIJA 1YAHA 4IIJB 2TMGA 3G0GA 3I4CA 4EI2A 1RJTA 3U7RA 1ZK1A 1SULA 1B26A 1UDRA 1ABEA 3GLFE 5C4JH 1NN1A 1SC3A 4E70A 2DTXA 4O4HB 2QL9A 3GTKB 4HR7B 2E2HB 2QG4A 1G5FA 3NTXA 4M8AA 2JI8A 2A5LA 1K68A 2Y1DA 3BF8A 4I0WB 4ZN6A 1ZQ9A 4FYPA 2QX9A 1BMQA 2FUCA 4CL8A 3LT4A 1F7UA 3H7IA 1M1ZA 2BE7A 4LHWA 2G1UA 2YZMA 1W1WA 5JNUA 3PRKE 1KK0A 3A5UA 2RSLA 4NK5A 5ALEA 1QZZA 4MQ4A 4QGBA 4XWYA 2MO1A 1IBRA 5K20A 2QGQA 3UFBA 4PC3A 2R65A 2O4UX 4DSOA 4AZ3A 3I1JA 1EIZA 5GQOA 3WK9A 3U4QA 4WY2A 1PV4A 2C2HA 1DP4A 2JA5G 2PGOA 2BYTA 1IUNA 4B7ZA 3BJUA 4Z5XA 2IYLD 3OZ7A 3ZWDA 2NWQA 3NONA 4YMVA 1E6LA 1WBDA 1E7MA 2D2IA 2ODWA 1NVEA 1QPBA 3L4SO 4GDFA 1HUQA 4IV8A 2UKDA 4OGWA 3ETLA 2KHIA 1X77A 3ZXIA 3HCPA 2OBYA 1R15A 1U0SY 2BGNA 4W9MC 1EB9A 4HEA1 5EZ6B 3F74A 4DUZL 2C5FA 4AIRA 1Q0RA 3DWFA 2CCZA 2FGKA 3D5TA 4W9RA 3AP2A 3PF4A 1OE0A 3IAM6 3KLRA 1GN8A 4KUGA 4XGQA 4YT2A 1NOJA 4OAQA 5E4JA 3EH2A 1YHQA 1R00A 1WD0A 3ZI4A 1EWQA 5LBUA 3VX4A 2FOLA 2B1QA 1PTOD 1Y69U 3T5GA 3OPOA 5CV8A 1H93A 4A3FB 3KFXA 2YVAA 1ECFA 3T9AA 3SHLA 4HIMA 3B1YA 1D1QA 2ZRQA 2ASBA 4GZ5A 1Q0QA 5EN4A 4F12A 3R2IA 5M3MG 2B94A 4X64B 2R5WA 2XRSD 3OM0A 1QVRA 4TWBA 1VMPA 2K03A 1TFRA 3V8RA 5FBVB 3N2EA 3I1IA 4UM5A 1LT6D 1E2FA 1Q74A 2R1VB 1EJ6A 2CMGA 3T1YL 4B6GA 2GN8A 3ZHSA 1D6NA 1EHIA 1BF4A 3PTAA 3D7RA 3GJ8A 1HMYA 1YONA 3CX3A 3QGMA 3QK7A 5HF8A 5JU6A 3A1WA 5JVDF 1GQ2A 2O3TA 1QP0A 4IOKA 4MS4A 4A3JH 1BWRA 3IJ5A 2Y1EA 1SUBA 4P3KA 3UIEA 2CYCA 3O5AA 2GXQA 4JOQA 2C2WA 1UE1A 3AINA 4HH0A 3A9VA 1M6WA 2GDZA 3QW2A 5JEDA 2FJ2A 2QD4A 4IQGA 2JEZA 2YOHA 4DIEA 1E2DA 4DJEC 1L1QA 4LY0A 2JI9A 1DXQA 1Y9ZA 5JCPA 1J2JA 1AF4A 2FPLA 4UNPA 2HFKA 4BEWA 3UXHA 4BMZA 4UUPA 2IX3A 3DONA 3K8OE 4J3FA 1OBHA 4ZV7A 3C5HA 4DJDC 1JLMA 4YP9A 2JA7H 3R3WA 4X6AH 2BDOA 2HFJA 1T3ZA 1Q77A 3FMFA 1N0VC 4YAFA 2O8FA 1XDGA 2ZAMA 3PGA1 1U8AA 3DG9A 2E87A 4EQ6A 5KNBA 3UCFA 4QUJA 4BCDA 1HEUA 1TD9A 1YQEA 3LP6A 4BX3A 1XYYA 1DAMA 2AEFA 1Y3AA 1P7YA 1ZJ6A 1IFXA 4S1WA 2PL9A 3WYBA 2J0TD 1NP7A 1WSBA 3X3HA 3AMVA 5CEFA 1GTRA 5EQFA 4DGSA 1K28A 3HXTA 2RHRA 2QSUA 3RVJA 4FSHA 1SCNE 2IF2A 1NTOA 3BL5A 4KOEC 2APJA 3NGXA 4YH1A 5E3JA 1D5WA 3E22B 3NH6A 4KAAA 4LJ8A 1FXUA 2P68A 1Y4SA 3FZEA 4H7IA 1A96A 4GQAA 2PKQO 4KJZA 2PKEA 5D8DA 4GNKA 4C6HA 3I2YX 1MQSA 5EXSA 2X40A 4KXQA 4N1AA 3GEHA 2NUAA 1SIUA 4XIGS 1DC4A 5KEIA 5IC6A 4ZU1X 5C5EA 3A26A 4DMUB 2PQ0A 4A2PA 3CU7A 4AI6A 1QHYA 1EEXB 2EJGC 4CIBA 2V5UA 1WM1A 3MUEA 2HCJB 1LC0A 3HM2A 1OZGA 2GBCA 3QOXA 1PFGA 4EUSA 2PN1A 3OPYB 1FP1D 4EA9A 4FLEA 3RSLA 1ESNA 1BXZA 3GOHA 3M9LA 3MOGA 1NBMD 1HFEL 1M2JA 2C7VA 3HUTA 3GLRA 1GG5A 4I55A 2LMCB 1SELA 3MSXA 4FUTA 1OHHD 2EZ9A 1F2UB 1X7WA 3RS7A 3BDOA 1GR0A 4WFQA 1JJIA 1U0RA 2J9YB 2GHQA 3IODA 3UY4A 1MAVA 5E8JA 1IOWA 1NRJB 2WMOB 4MYSA 4DXAA 2WNHA 4CYMA 4D0RA 4D4MA 1VE1A 4C2TA 4G0YA 4P83A 5LQSA 3L93A 1Z4IA 2AYXA 5KEEA 9MHTA 1N1GA 1XDBA 3ZVMA 1O57A 2YIMA 1DHTA 1D2AA 4B3SB 3PUJA 3G2NA 4GKKQ 3FM9A 1U0OC 2PPVA 2CVRA 4L15A 4YROA 5JDCA 3RU7A 4IUQA 5C80A 5P21A 2UZ4A 5I47A 8MHTA 3OQIB 9ATCA 3FJ1A 4G8BA 2MNAA 3DSRA 3V8QA 4RD3A 4Q4AB 2PZUA 4ZOCA 1J0XO 1PRTC 1D2GA 1TO1E 4ZQBA 2MYUA 2AKWB 2ZBEA 1R0XA 4RZIA 4FYMA 4RW0A 1OFUX 3S0JA 4JMLA 2YZNA 3AU8A 2B29A 2QR3A 4ZVSA 4DXHA 1Q1GA 4P82A 3HKZE 5KSYA 3A06A 3QE4A 4FFNA 4X7PA 3KPUA 2HDWA 3BSYA 3ZWQA 2CV1A 1Q7RA 4H0FA 3K05A 5CGZA 5EIBD 1MX3A 1JKIA 3TSZA 4WWHA 2P9HA 2V4ZA 2JAOA 2P75A 1K0RA 3U4VA 4NHEA 2PUTA 2W4QA 4YTEA 5FWYA 4CI0B 3EGCA 4C0XA 4GW3A 1I33A 3TLAA 1IBMB 3AVWA 3TZKA 3VKVA 1KMQA 3QEKA 4CG1A 5K4GA 3VOSA 3EXFB 4A3MH 2Y0BA 4ID6A 3LRXA 2KYRA 3GV0A 1YKFA 2OT2A 5IJ0A 4A0RA 4CMIA 2YTZA 1HTWA 2GD1O 4W7HA 2WJHA 2XUDA 3LO5A 5EGSA 5F7JA 4BE9A 2Y1WA 5AIAA 4BVLA 4LYJA 1XZEA 3R6WA 3DWQA 4LHYA 3K59A 3SBOA 1B0UA 1EFDN 5BR8B 1JFFB 2HGZA 2BH8A 3WKBA 2MR6A 4EVOA 3GROA 3HWRA 1IYZA 5C34B 5K0BA 1QR6A 1GGNA 3DFFA 1PUIA 4A3EB 3KJEA 4GSLA 3HLYA 3K0FA 1RABA 121PA 5FX2A 1EXWA 3ZDZB 3AJ8A 4YCMA 1UZUA 1NNI1 5FBLB 3QEAZ 2YUTA 1I7NA 4Z4IA 1A5ZA 2ZATA 3E35A 4XWGA 2OZVA 3F6BX 5HKAA 4EGQA 4GUAA 2RONA 2PRIA 2AB0A 1QIDA 2NAPA 5CV7A 2F3WA 2XECA 1G2IA 1JPJA 3R74A 4XUGB 3RSZA 3IVCA 1H85A 3ACBA 1LGYA 6CHYA 4NZOA 5EIXA 2FMFA 2PX6A 3K2EA 4EEZA 1SG0A 3E0QA 3IDFA 4BBJA 3NGMA 1P7ZA 1O9GA 2DF8A 4CGZA 1Y8CA 2JIZD 4K0KL 1TB4A 1DKRA 4EM6A 2Z1CA 3UMFA 4M1SA 2REQA 2FW9A 4DK6C 5FLKA 3PSIA 3UMSA 1M0SA 4NG4A 5CA0F 3E84A 1QVVA 2YXLA 4TV8F 4L6AA 1Z29A 1OASA 2OCDA 3A7LA 4LE1A 4RFSA 1BHQ1 2Z5LA 3IXQA 5IY0A 1V71A 1H2XA 2BFBB 3P9ZA 2IZ6A 3R2TA 1Q0ZA 5GIPE 5HW0A 2OFXA 1J21A 2PV7A 4NF2A 3PDWA 1FVXA 3KEQA 3A8IE 4MPDA 4FLFA 4FNGA 2I6QA 3FNBA 2GCOB 1U8TA 3K9WA 3JAME 1Y8ZA 3WRXC 3HOZG 2W8ZA 1WPGA 4PY2A 4DN4M 1CYDA 1PEDA 1NNEA 3LV8A 3WNVA 3H9QA 2XJ9A 2O8DB 3CVYA 3WLLA 4RGOS 4JBHA 3BMOB 1HYHA 3H19A 2CCJA 5L4SA 1UKEA 3V7YA 4UP9A 2V0CA 2BVNA 4F3KA 1EFVA 3K8QA 2RKSA 4ZVPA 4X6LA 4ILKA 1BSVA 3IHTA 2J7PA 1NW8A 1RFLA 2O5RA 3SZGA 1X70A 5TVKA 1D2CA 3G2HA 3KLWA 5THQA 4LDRA 1D6MA 3QKIA 2GJSA 1ES9A 3EAGA 3BWCA 4N8X1 1J4AA 1KSFX 3L8HA 2IOHA 3OPQA 5CVJA 3DMFA 2BUCA 3SYLA 2HHHQ 5FBZA 3OZXA 4MROA 4E6IA 1Q6ZA 3BYYB 3GLVA 2E2DC 4KMUC 4P0QB 4P1ZA 3CY6A 2YIDA 1CXZA 4H0LC 5EC8A 4F5ZA 1EQTA 4U39A 5FLXc 3WHKA 3HUEA 4R2WA 2L11A 2NZJA 1PTKA 2WZBA 2CGEA 3B9PA 2W6ZA 1O77A 4RPLA 1FXWF 1QYIA 1JB9A 4KPUA 3F4LA 1PEKE 5J2UB 2V7QA 4RLQA 3FVVA 2YVLA 3GTLH 2FEWB 3ASUA 7GPBA 1ONPA 2DB3A 4FF4A 1QUFA 3Q7PA 2A8YA 1UKAA 1XNRQ 4FCTA 2JA6G 1P72A 4AJ2A 1U5KA 3B3QA 1YJXA 4WKGA 1TTHA 2K4MA 1G20B 1NYTA 2V8BA 1RQPA 4BBRG 5KU1A 1WMSA 4F1KA 3QO2A 3LW8A 4Y18A 2EKZA 1VDMA 2B2TA 3ZDRA 1IHUA 2VEDA 3F8SA 3LZDA 4UUNA 1CQIA 1K9VF 2JHAA 5LL6X 2V4UA 5CT4A 2H16A 3LC2O 2PGLA 3PNSA 3NG1A 1YBMA 2ENWA 3K8YA 2J41A 2GVZC 3PMFA 1NU6A 1TIID 4DMRA 4R7ZA 5F78A 2DWCA 2A5FA 3HBJA 2BBTA 2BSXA 5CCDA 3GVPA 4TKMA 1UC5B 4AJ9A 1IYJB 3ANYB 4GYJA 1YVEI 1PGNA 2OO5C 2AN4A 4NFSA 2R92G 4Q3BA 2PKCA 4OU4A 4DQUA 2BV3A 2P9CA 3NVKI 2QJWA 3PFIA 3S1MH 1UPCA 2GQ0A 4K9KA 1I1HA 2QVZX 3EJIA 1F60A 4A93H 1RQ7A 1YZ3A 4FIZA 1QQAA 1E1QD 2XUGA 1SBNE 1QWYA 1BDJA 3ZK7A 2XAAA 4ZO8A 2OPHA 3F4BA 2I7XA 1YE8A 4DV1B 1TU2B 3CW9A 4KFTA 3MZ5A 5A9SA 1C9MA 3D4NA 1KZYC 5EPJA 3KEOA 4WOCA 1TKRA 1A82A 3VPDA 1ZITA 5L45A 4KMRA 3ADPA 4H44C 4B4WA 5FRDA 4JJ6A 4KYVA 1MEOA 1YJBA 2X86A 1BXGA 1US8A 4EB0A 3HP4A 2ZBFA 5FPSA 1LVGA 4RTMA 4ERXA 1PYWD 1LDYA 5L95A 3KYDB 2ZXUA 3V4LA 1F9RA 3BCSA 1V8FA 3ZGOA 2BCGY 2XRQD 1JJ7A 3G0DA 4A0GA 4BO3A 3QKSA 3FYHA 2UVDA 3S8EA 5D14A 2C95A 1QYXA 4J94A 1RQRA 4OATA 4QGUA 4E5PA 4MR8A 3INRA 2LKCA 3BBPA 2WNSA 4DR3B 3ILHA 3GRVA 1RHUA 4KPFC 2OV4A 1W30A 4DDWA 3EGXB 3KJXA 3QKRB 1DC3A 2YH2A 1M76A 2IXTA 1HM5A 5JLAA 5AVZA 4N6NA 4FO2A 4XD7A 4XIIA 4MYRA 3QOJA 1RWOA 2KBNA 3MT0A 3LVBA 5LP1A 1OI2A 1ICIA 3OZGA 1CUKA 2XSCA 4ZEMA 4MVJM 3KS9A 1V2HE 1Y1SA 3GMSA 2RK3A 1G2OA 4NYMR 1HSZA 2Q0QA 2CBZA 2RHGB 5DX8A 2NG1A 3HB5X 1XVTA 1FTNA 5LR6A 1JBQA 3GAMA 1K63A 4JYAB 2JJQA 4K9NA 1FX1A 5H3LA 4PLPA 4F2GA 2ZRBA 1PZXA 2YOGA 1JORA 5A6VA 2CY0A 2QN1A 3K1YA 4BY1H 1FLDA 2JFBA 1E2MA 1RLIA 2IE0A 2FSVA 2XIQA 4P71A 1Z7EA 4HSEA 2W6NA 4LXUA 1LTRD 3EXG2 3INYA 3NV9A 2QDXA 5EXEA 2GHIA 4Z4GA 1PT6A 4IEIA 2FZVA 2SBTA 4AJEA 4Q9AA 3ZY6A 2F3RA 4GMGA 1XQWA 1VGQA 1O2DA 4GKKL 4WBXC 2ZIXA 1MB4A 5E4XA 1VLHA 1DE0A 2DH6A 4V0QA 1WMFA 1JLLB 2FWIA 3UYLA 1OKKD 3E5RA 4LFCL 5DHSA 1K8ZB 3ESDA 3T7DA 1PQPA 3RYHA 3ZK8A 1Z38A 4F21A 1BTOA 5JS8A 1DJMA 4A3DG 3KUKA 4KH0A 2EKBA 4CJXA 2VXOA 4BMXA 5EI5A 1YU9A 4TTPA 4IHJF 5IYBG 3GZJA 4Q6BA 4ALKA 1GEEA 2Z6AA 1PMRA 2JHGA 3EZXA 2C9MA 4KGVA 2D0PB 4P73A 4PGGA 1P8LA 2C07A 5JW6A 1I4TD 4Z9BA 2B0JA 2ZULA 5B3KA 1Y1QA 1R9NA 1N0IA 4DZRA 2RSNA 2JCBA 4CF7A 2FMHA 1BRTA 2JBAB 1ZXXA 1YI0A 4CV2A 1FD7D 2ZYHA 4LN1A 3ERQA 4Q7LA 1WY5A 4F3TA 1A9QA 4EGAA 4AJNA 3L5KA 2GERA 5FWXB 4RA9B 2MOKA 4H1TA 4X7MA 2ZRGA 1KJ9A 5IFLA 1ZYRD 2E76C 1CSEE 1SFOB 2MSKA 1JECA 3MWEB 1E2IA 2WJ4A 1C3OB 3BS1A 4GLVB 3GY0A 3SP1A 3UUEA 1YZYA 4QZVA 3TUJC 3BIWA 2RJNA 4R2IA 1CUJA 4S1NA 2ZLBA 3DHYA 1RM0A 3RB8A 5BNZA 1T6XA 4NRDA 1TM1E 3OMXA 5KINB 3V2TA 2EF1A 3N8GA 1XZMA 4NY1A 3IE0A 3V7UA 4WAUA 4NWIA 4DB4A 2QAIA 5BV8A 3EMVA 3M2PA 4WOPA 1ISGA 4U2CA 4YCAA 1ZISA 2EWMA 1I1QB 1UEXC 3KDFA 2D00A 3UH0A 2A5HA 3I23A 3TI9A 3W5SA 3E0EA 4EHHA 2SNSA 4O4JF 1ZM4A 2O7NA 4UZSA 3N0XA 2E4YA 4YRRA 3KBOA 4FYHA 3SS7X 5C3EH 2DGDA 4MNOA 1JJVA 4PICA 2VZEA 3HYNA 3KT0A 4NXNQ 5GM1A 3IBCA 1Z5OA 5M9OA 2QYTA 3QR8A 3UDFA 1KDZA 4P4NA 4KW7A 4HDSB 1MEJA 4HH4A 3A56A 3HCAA 1X1QA 5BVHA 2AZMA 4LRTB 4BKPA 2IHZA 4QGHA 4MUEA 3MMNA 3GC6A 4IJ6A 3A9UA 2O2IA 4R98A 4KWHA 2EYOA 1BXRA 1G42A 5ADWA 3JPYA 1DV2A 4KV9A 4KXMA 2O3QA 5GM2A 2IRWA 4UNRA 3BK2A 3N2ZB 1TCCA 1Z7GA 3C1OA 3ONDA 1QS0A 2CNKA 4HGZA 4KJXA 1MKYA 4YP1A 2YIVX 3JWGA 4BXOA 2EX4A 4XDYA 3GRPA 5SZHB 2Z6BA 2RHBA 3JTEA 4EYGA 1TQ8A 1JWMD 3D43A 3E7DA 3DLHA 1NTGA 2VATA 3Q3IA 4RPKA 3D8TA 3IBGA 4D8YA 4L85A 2E5LQ 2UYCA 4Q05A 1DXHA 3AILA 4C0BA 3P8ZA 1QVFA 4J6HA 2Q7OE 3OIWA 3HJRA 5HILA 1EWRA 1KY2A 4QU8A 1ONNA 4ND7A 5JRJA 4MWDA 4PYOA 1U7UA 1TU3A 2HA3A 3E03A 4BAZA 1ZPDA 4PZLA 3I12A 1U2ZA 3KUDA 2PO7A 3SYMA 2ZJPA 3HGBA 4BGEA 4HS4A 2JA8G 2Q99A 2P11A 2J07A 2XY4A 2KB0A 3WMXA 4J15A 2DTDA 2XOKD 1B4DA 3HYCA 1U0HC 3CEPB 4FGKA 2V96A 5A0TA 3PDCA 1A7JA 2RGGA 2I7VA 5FADA 4XYOA 2H1EA 1NFQA 3H5AA 2HHHL 5JALA 2I5LX 5DLYA 3ND7A 4AJ1A 2XWBB 3RT7A 1Y9JA 3TW4A 5HS4A 1JIJA 4MUBA 1YF3A 1XHLA 3HA2A 5AIBA 1RXCA 2NU7B 3AVXA 4JI4L 2YVUA 4IYJA 5LKRA 2C8LA 2ZYTX 1H6DA 4AJKA 1K7EB 1G6KA 3ZLBA 1UBHS 2BKAA 1S2OA 2BKUA 3AW8A 3BDAA 4IH4A 3G9QA 4LZLA 3BJZA 5CDYA 4NXMB 3FTFA 1N6OA 5TF4A 2JH3A 1RLUA 4D3YA 3TUZC 4RSMA 1EU1A 3A36A 3TD2A 1SK8A 1QB5D 1MX5A 1HRDA 4KC0A 1XNQQ 2PM8A 4HDNA 1Z88A 4WK4B 3M5DA 1THMA 1QDEA 1M8KA 1V11B 4GP9A 1NR7A 1LY1A 2IZ5A 1PRYA 4YYEA 3ZJYC 1SQ6A 1IBLL 1N1MA 3E9ZA 3VOTA 1X0XA 1DM0B 4CETA 5IYCG 2QXYA 4EB3A 2XQGA 3HA5A 3QWAA 3IRBA 2WM9B 5C53B 3KDPA 3IEVA 1X74A 2FKAA 2GKOA 3A14A 4JBWA 3GEMA 3I7FA 3BFPA 4RCZA 3QFRA 3F5QA 1E2GA 2HADA 2IQIA 4L7VA 3R8BA 3QYAA 1Y3CE 3FDJA 4C3IG 2WA2A 2A67A 1YAJA 3EVDA 4WMLA 1KAWA 2QUZA 3B7GA 1NCVA 2H4OA 3FWYA 4ZDWA 2R6FA 4YA6A 1T35A 1WMEA 4X54A 4QDZA 4DK1A 5C35A 4WJ4A 3N2GA 3QJGA 4PRLA 1UR5A 1AS2A 2P2NA 1A5SB 2AWNA 3EUAA 1M6HA 1QG6A 4MRRA 4JCCA 2R8ZA 3NQ41 3LA8A 3R93A 4KFSA 3V00A 2D59A 1ESCA 1U3VA 1T2DA 3DD1A 1Q92A 2OQKA 1BN6A 3DEZA 1H5QA 2I0QA 2F0HA 3BILA 1QHXA 2HA6A 4HEQA 2O3RA 3ZZNA 4MQ5A 3ESZA 1LBTA 2OQ2A 4LF4Q 4IRXA 1NOKA 10MHA 1I5EA 5AW8A 1Q0TA 2B2VC 5L7YA 3HCEA 3R7FA 4R1UA 1NM5C 1CV2A 2M9MA 3SC6A 4JLAA 1EVLA 4IILA 3HOVG 1M0TA 4O4IB 1SE2A 4BY7H 3T99A 3RODA 3A6FA 5LMCA 2BEVB 5BT9A 5CBEE 3C3JA 3BFKA 5TSDA 2IPNA 2WYOA 2H2IA 1NAHA 5HKKD 4I99A 1VHJA 4ME3A 1RXYA 5CLGA 5ERXA 3G7UA 4ESVA 3EW9A 1CSPA 4D4HA 3R0ZA 2I22A 3WIUA 4MUIA 5DXFA 2J08A 3KR9A 2DMRA 3LUPA 3UHOA 8ATCA 1ARZA 2RGNC 3CRKC 4I66A 2V0GA 4XR9A 1Y1WB 2ZQ5A 2IU3A 4ZTBA 4LXGA 1P0CA 4YEDA 3WNZA 4MZ9A 4FWIB 1NURA 3MGAA 4LV5B 4DUYB 3VR0A 3CE9A 1YA8A 3T1YQ 5CB4F 3TS0A 4W9NC 3C5EA 3UAGA 2OCKA 3RJ9A 5I7SA 3HHPA 5HF5A 3S17B 2FWRA 1R0KA 4CT4B 5DEIA 3CZRA 3O9MA 2I4MA 4B85A 2Q0SA 4AMZA 2J3QA 4KFCA 1IJBA 3LPDA 1EDEA 4WA8A 1STAA 1FY2A 1IAQA 3I39X 3H83A 3R75A 3N7AA 3O13A 1YZNA 5AI4A 5K0LA 4A3GH 4GE0A 3WNBA 3LI2A 5BVGB 3WA6A 4ZEXA 4B3RQ 1XMOB 1K97A 3FNIA 1N6NA 2GCGA 1CTMA 3ND6A 3DHNA 1KNXA 3NAGA 3RUAA 1CRZA 3MTJA 4KOAA 4B3XA 4LF6Q 3CH6A 3W9BA 2B61A 4P4SA 2VXYA 4EG4A 4OEHA 1WNFA 1JEYA 1NN0A 1X3GA 4NP5A 4RKEA 3ZZTA 3IP7A 4YUZA 3I92A 3AZQA 2BFPA 1FJGB 4JJKA 4ZHQA 3KQWA 4G07A 1P4AA 1CY1A 3B7WA 1U9YA 4GPTA 5K3FB 3AKDA 3WZLA 3L1HA 3UH1A 3BQ9A 2VC2B 1ONSA 4QX6A 5EMJA 1N8SA 3HB1A 3HCDA 1CQVA 1CJVC 3P0IA 4COKA 3UWSA 5IT4A 4GZ6A 2PYZA 3EXIA 2YXPX 4TKZA 4ENTA 1SC9A 1U7WA 4TMZA 1SAYA 5EIEA 1X56A 4F60A 2XCIA 2JPDA 3LMKA 2XCRB 2VJQA 2SKDA 5LXTB 4IUYA 2JFPA 2CW0C 1MJHA 3FX2A 4BUCA 1IEWA 3A4VA 1VL2A 3A32A 4TZTA 1I3KA 1E2BA 1KC1A 1ZJJA 2XVSA 1S5BD 3FOBA 3I3CA 4AECA 1IZ0A 1WV1A 5ALIA 1ASYA 3BUSA 1A97A 4PZ6A 4IIYA 4PZCA 1P3DA 4O42A 4FMCB 1PX2A 3N59A 5BV0A 1ZSYA 3VGPA 5M04A 2VTBA 4RTJA 1YU6A 4EI9A 1R2QA 3GCWA 4OHUA 4ZAZA 3MTIA 4TYNA 3I3OA 4X85A 5HKBA 3QELB 4KDFA 2MUYA 3MCUA 4DT1A 3QG1A 2DX7A 3HY3A 2IYQA 1AKWA 1NA5A 1FL0A 1BYIA 2VZAA 3EXEA 3O2NA 4AICA 4GH5A 4HDOB 4N3NA 3ESCA 1E2NA 3UAWA 2ZYWX 2HT1A 5ENVA 2YY7A 3E1KA 5CR9A 3ZY4A 3UGKA 2JAWA 2C29D 4D92A 3RJ5A 1TWGB 2W83A 2H2AA 2YRXA 5ELDA 4LF8B 4Z6KA 1QGAA 4CMHA 2LIVA 3VKUA 4Z3KA 5DI3B 1YDHA 2FEMA 3FH0A 5DGHA 1SCDA 4IIGA 3W2TA 1VF5C 4QXMA 1QR2A 1DRVA 5HM6A 1V47A 4X1OA 2QEQA 3K80C 1UOPA 4NP6A 4NXNL 1OFIA 4KXNA 3NT5A 1W44A 4ETWA 3P9IA 1B8OA 4JN6B 2Q2TA 1CUBA 2NOAA 1HGXA 1WULS 4FF1A 4F5DA 3PSAA 3RHTA 1KORA 2B8TA 3HXPA 1DTEA 1AXEA 1NUQA 3A4MA 1ENZA 2EW8A 1HZ9A 4C87A 1EY7A 2FQWA 2Q0XA 4RKFA 3J7AV 1SU7A 5KOHA 5IAJA 2WMDA 3MGCA 2BUAA 4G25A 2A6HD 4XKJA 4BVFA 2PCFB 3CVOA 2CLOB 2W2XA 4QFMA 1R12A 4TM8A 2P8JA 2TECE 4XDGA 2PU5A 1TYDE 4WASA 1L5MA 2OKCA 3U62A 2EZVA 5JCJA 1RXIA 3H4MA 2ADMA 5C81A 4Z9AA 3LU1A 2XGSA 4ASUA 3L01A 4B45A 1PHJA 1KEUA 3OEEA 3NUGA 2E5LL 2ZJ2A 1G19A 4GYYA 1FYFA 3M3YB 4YHHB 2XRFA 1GPWB 3JD3A 3S29A 4MVYA 1ENAA 1RYHA 2PSEA 4KQGA 2G5CA 4HB0A 3U3MA 1N5OX 3IBYA 5IAOA 3MWJA 2R8YA 3S3TA 2H9AA 2GK6A 1HKHA 3IQEA 1B00A 2W6JA 3CQZH 2VHZA 3MZ0A 1J8VA 1HBJA 1SA0A 4J43A 1T2AA 2V7GA 3DVAA 1GV1A 1QVAA 3KQQA 2H1IA 4C1NI 5AR1A 3ROKA 4N0PA 4CQMA 3KDAA 4B6RA 1M6YA 4IJVA 3RT9A 4N01A 5G0SA 1UQRA 1QCYA 1TKAA 5B2FA 3GFBA 2XUIA 1HFNA 3RTBA 2JCSA 5C5IA 5I4IA 3V2HA 2A59A 1UXOA 5A3QA 4INJA 3JAWB 1QHHA 1W4AA 1T5BA 1W75A 4BWFB 3PJEA 4P80A 5K3DA 2E21A 4A6EA 4JR2A 1C5KA 2TYSB 2EJTA 2FWMX 3B53X 4WXEA 3QPWA 3WHLA 4KODA 1S8FA 1E3PA 3S2EA 2WK1A 4QRHA 3LPLA 2P79A 4I5IA 3EPLA 2QLTA 2J30A 1PFYA 4M55A 2UZ3A 1ZD2P 3IOMA 4AK9A 4A3BG 2IEYA 3PC3A 3ORRA 5LQMA 4DCGA 1CIVA 1KDAA 1F4PA 2YWCA 4R3UC 1S2MA 3KQYA 3DXYA 3E15A 2ZWOA 2HDOA 3RNUA 3U37A 4C0QC 1XNQL 3EAFA 4OXQA 1VYVA 4OO1G 2EY1A 1V8BA 2B98A 5AOVA 2BJHA 4Z4FA 3NHUA 1K1EA 2VF5X 1X1BA 4LJ7A 2EKLA 1E1CB 4CW7A 3RF6A 1OWOA 3BICA 3PT9A 2K7FA 2XQJA 5KNLA 4QFDA 3H5RA 3I2IA 5U1PA 3OTHA 3WDSA 1R5BA 2FFRA 4G5FA 1G1MA 3PC2A 4E22A 2Z2KA 2R6JA 1NBOA 4OP1A 1N4DA 4S2EA 2QRZA 5J4VA 1YDWA 4ZAGA 1DI0A 5TVGA 2G71A 4FU0A 1MC8A 3HOWG 2ZTHA 3VU1A 2I8AA 2BH2A 3JAML 4IFTA 1Z0JA 5FNVA 2TMPA 4EP1A 5C18A 4INPA 4OO1I 1ZNXA 4RVCA 4FHEA 3EVFA 2OP1A 1I4HA 1Y6ZA 3TTUA 3MXNB 1IIRA 3ZJUA 4N03A 3M1YA 3LIPA 2PR7A 1QV6A 4XCQA 1KI9A 4X0EA 2P7IA 3IDAA 4WK2B 5JE8A 3RJTA 4IOCA 4M6WA 1QWOA 3SU8A 3EVBA 3GLHB 3LZ6A 2C4TA 4MJ7A 5DLPA 4LC9A 2A74C 3WGUA 1L9XA 5DFAA 2NU6A 5DHAA 4G0OA 3INNA 3TAHA 2XMCA 3GP3A 4XH9B 3OESA 2XHEA 4C22A 2X0IA 3R0IA 4LF4L 4L5RC 4RK4A 2H52A 1VE9A 2H5LA 1K3UB 3WRVA 2EC5A 2ZT6A 2QILA 3W8RA 5D7BA 4HOYA 2NO7A 3X43A 3OCJA 3QOYA 5B36A 5EIAA 1XN1A 4HX2A 9LDTA 1O94A 1LI4A 3GA5A 4DZTA 2X0EA 1O95C 4WXYB 3PEFA 5KKNB 4NBUA 3LUGA 2CFOA 4LX8A 4JP2A 4PYRA 2HDMA 2HOQA 4HYYA 3MXOA 2M00A 3NWTA 4OHWA 3RFFA 5DSZA 4HXEB 2BMWA 1HNZB 2ZAIA 3TJMA 1G16A 5MN6A 2ATWA 1XZIA 1S4MA 3EJWA 2QLBA 2WUFA 1H23A 4H4CA 4ZJZA 3ZDXB 4L2IA 2EXDA 3WS7A 4G5SA 3BXXA 5BWBA 2PS9A 1YR9A 3HBNA 4AB1A