3FVQA

Crystal structure of the nucleotide binding domain fbpc complexed with atp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
348
structure length
343
Chain Sequence
TAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLGRLPVQSGAPAGTRGTLLIRPEQYSLHPHSAPAASIHAVVLKTTPKARHTEISLRAGQTVLTLNLLSDGISAVLHLDGPALFFPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into how nucleotide-binding domains power ABC transport.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Hydrolase
molecule keywords Fe(3+) ions import ATP-binding protein fbpC
total genus 87
structure length 343
sequence length 348
chains with identical sequence B
ec nomenclature ec 7.2.2.7: ABC-type Fe(3+) transporter.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17845 FbpC_C_terminal FbpC C-terminal regulatory nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.450 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fvqA02
2.40.50.470 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fvqA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fvqA01
5CLQA 2ZUDA 1WXQA 2BHRA 3TVTA 3LLMA 3GLFB 3T61A 1AKEA 4A0FA 4EPWA 4NONA 1TUIA 4O2LA 2GJ8A 1SVKA 4M1YA 4GL2A 2ZRDA 2ZJ2A 3KXLA 3SHWA 4MITA 1XMSA 4Q19A 5HE9A 3VU9B 3GLGA 3MWJA 1E3MA 1M8PA 3PXGA 2VHUA 3CPJB 3K09C 4FINA 3BH0A 2ZR0A 2JLQA 3BS4A 1FNNA 1G64A 3QNUA 2ZYWX 4CDGA 2RAPA 3K0AB 4CEHA 2F1JA 3BB4A 1QHSA 2BDTA 1FTSA 1GG2A 621PA 3RC8A 2Z43A 3GJXC 4DUGD 2ONJA 4BFWA 4Z8YA 1M7HA 4C0SA 3UANA 4RD3A 3R9WA 1KTVA 3CNNA 421PA 2VEDA 1OF1A 2D2EA 4IDOA 2FV8A 1NN3A 1P9RA 2BCGY 4MDFA 4B33A 3SJZA 4DJTA 1TUEA 2CJWA 2DB3A 2BMDA 4P4SA 4KFTA 2UZ3A 4K8OA 4P4SB 4TT3A 1SVMA 5EXSA 5K8TA 1YZQA 2QPAA 2F3RA 4JLJA 4LWZA 2IYWA 4JL6A 1YHNA 2GJ9A 3AVWA 3EASA 3Q7PA 1EXMA 3TK1A 1XEWX 2QY9A 4M21A 2IS4A 2VYFA 2YOGA 1XPUA 1DPFA 4Q4JA 4IEEA 4Q1CA 1Z2CA 4II7A 2FFBA 4KYUA 1T91A 2FZ4A 5FBQB 2GVZC 1IN6A 2ZANA 4G3XA 1ESMA 2HCJB 4I4LA 4JKIA 4RFSB 3T1OA 1T8TA 1G3IA 2WPDA 4MQBA 2ODNA 5JFGA 1MOZA 4PXAA 4B2PA 2CE7A 4F4CA 1BMFD 1MO3A 1N0WA 3HU2A 2W0MA 2J87A 1V43A 4KSCA 2IYUA 2DY1A 3C4JA 4KBFA 3U7GA 1G16A 2NQ2C 1U98A 4IRUB 4P4UA 1VG9B 4AKIA 3WYFA 3M1IA 3L8ZA 2KBEA 4PANA 4FMCF 1CEEA 2PT7A 2R65A 2ZYTX 3VFDA 2W2TA 4KFRA 2J0UA 3EIEA 3GLHA 4L9SA 3D8BA 1JAIA 1E1QA 3PJRA 3X1ZA 3WNDA 3TW4A 1XDBA 5BN5A 4B43A 1W5TA 1TAGA 2EWWA 1HQCA 2A5DA 2B7BA 3FTQA 4C0LA 4C9BA 4LJ5A 3I61A 3NH6A 4MRSA 4EFNA 3AVUA 1GL6A 4PX9A 1W4RA 2ANBA 2P6RA 2IYSA 4WZAE 2RGDA 3AP2A 3ZQJA 5EE3A 2J0VA 4IDNA 1T5LA 4PO1A 3BH7A 1ZYUA 1N6OA 1Z22A 1SVWA 4Z1MD 3TQCA 2J1LA 3MG9A 1OXSC 1KAGA 1T0HB 4BLQA 5DNYB 4GOKA 2Q3FA 3K0EA 4R7ZA 1XRJA 3I5XA 1KO5A 2F9LA 2QPOA 2EFHB 1E1RD 5CB6A 2FMXA 4NKRA 3EPJA 1S2MA 1JEEA 2VHQA 3QQ5A 1W4BA 1YZLA 1N25A 1Q21A 2QQ0A 4PTLA 4TMVA 1U8YA 2ZI4A 3VMFA 1X1SA 1R0XA 1D9XA 2QAGB 1QHGA 4WA7A 4HDQB 4IOMA 4ZI2A 3R9XA 3K53A 3DM5A 4IEIA 2XZPA 4PFSA 3IBYA 3TRFA 1OLOA 2A5FA 1E2DA 2HXSA 2ZQ5A 3FHTA 1R5BA 2OAP1 2QL6A 3PQCA 2WWXA 2I3BA 1NL3A 2QZ4A 4DZZA 2FEOA 2RMKA 4D0NA 3AKYA 1DOAA 5FUVA 2GNOA 4HLCA 5EE9A 4X8MA 2J0SA 5ELXA 1QG4A 2Z6VA 4A8JC 2F7SA 4Q00A 4RD6A 5H8WA 1MABB 3KKNA 1Q20A 2B8WA 4CEJB 3CF2A 3GJ7A 2WJIA 4PR0A 4G01B 4Q1FA 1IHUA 3SBEA 4NL4H 3T06B 4LJAA 2WAYA 2NMVA 4EJSC 4DEYA 5EJEA 2GF0A 2ZR7A 1QBKC 4B48A 3U6BA 5KSOA 1OXTA 3GFTA 3NDPA 3KTAA 5LPNA 4GBMA 1GM5A 1XXHA 3WNCA 5TMPA 2PZEA 4JVMA 1EFRA 1CS4C 1L4UA 1SQ5A 1US8A 2H57A 1PVOA 2W2VA 4JSTA 2D7CA 3EA0A 1ZM7A 2WJGA 3FHCB 3LNCA 1VMAA 2YJTD 4QGGA 3VAAA 2GCNA 2GILA 4G0NA 5EP2A 1QHHA 2ERXA 2PCLA 1NVVR 2PMKA 3DOEA 2JJ2D 5FH9A 4N3NA 4DCSA 2WBLC 4HUQA 3EWAA 1ZC3A 2D3WA 1S8FA 4TTPA 4O3MA 2BBTA 4HLDA 3WHKA 4BZXA 4ZCIA 2WKQA 2IEZA 4MGYR 4PAQA 1U99A 4R71A 3T1QA 1E2IA 1TF2A 1E9SA 3E70C 1ZP6A 3FOZA 2XSZD 4BEBA 4TSFA 3O8CA 5AR1A 2PMDA 1Z6AA 1EFTA 4KBGA 1P9NA 2Q0HA 2QAGC 3U44B 2XTNA 3FKSD 3B7GA 2QMOA 3GD7A 3KX2A 4QC2A 5G41A 5JWHA 3VR4A 5JHHB 5IK2A 2DR3A 2DHRA 1G1MA 2P3SA 3RANA 4M0LA 1UADA 3BAFA 4IDHA 3IEVA 2A30A 3AEZA 2OLKA 4XIGS 3A4MA 2QT1A 1NY6A 2VRWA 3P27A 3NHBA 1XD2B 2HDNB 2O52A 1VG8A 2WKPA 5DI3B 5GADl 5A5GA 5KO2A 5KSZA 2ZAMA 4IDPA 2NZ8A 3W34A 4A4DA 3G82C 2XTZA 4DB4A 4C2UA 1UDWA 1GIAA 4MYTA 4JLKA 1T3LA 5JS7A 2PEZA 4OBEA 4QJ4A 2IK8A 2QBYA 3JZMA 3DMDA 5JECA 1U8ZA 3R9IA 1V5WA 3VR1A 4XVRA 3H2YA 1XP8A 5TY0A 3CIOA 3FWYA 4US0R 5CIQA 1XXHB 2C77A 3Q3JB 5JEEA 2B7CA 3QF4B 4OK5A 1L2TA 3GLHE 2AL7A 5JJKA 2V7QD 3ZS9A 1XEWY 3CUEF 3QENA 2CLDX 4RD1A 2V6JA 4FCTA 1YU9A 4DC9A 2DFNA 4D4JA 3OEHA 1GTVA 1XMVA 1R5OA 2RB4A 4XSHA 1Q3TA 1QG2A 3N70A 1WRBA 3HU1A 2QRZA 3OIUA 1ZUHA 1L7VC 1ZNXA 4KCGA 1ZIPA 4JVLA 5JCZA 1XMJA 5EQTA 4HATA 3WNBA 4NYJQ 2OCPA 1F48A 1MRSA 5KNCA 5JRJA 2VP6A 4URWR 3DZ8A 1KI4A 2EVWX 1IBRA 3BOSA 4QBFA 2WJJA 2NGRA 4TSFD 2UZIR 3MJHA 1R0YA 4EQ6B 3EX7C 3THWA 1EESA 4B73A 1DEKA 3SEAA 3RRNA 3SN6A 1D2MA 3GLIB 4M2LA 2IYVA 5H1YA 4MH0R 4V0OA 2B6HA 1MO6A 4IVRA 3WMGA 4DIEA 1E2NA 2AKYA 2CLSA 3JVUA 4DLVA 1KKMA 1IY1A 2DFKB 1HE1C 2H92A 3BIFA 3MWLA 3EW9A 3L0OA 3KXKA 3CRQA 1JEDA 3BFVA 5KPDA 5LDDC 3S1AA 4JLVA 4JZKA 1DO2A 3T5DA 3U2QA 5FBLB 4FD2A 4TLDA 1JR3D 2VP4A 2PL3A 4FWTA 2F1HA 2IXEA 4OL0A 1Z29A 3KJGA 2ZS7A 3R7WB 3O8DA 1SKYE 4YMTA 1N2CE 2HF8A 3U7FB 4JLOA 4A0GA 2V4ZA 3SYLA 2WWGA 4DLRA 1XCGB 3SHFA 4BECA 3ECCA 1WMSA 1E4YA 2IUSA 2OILA 1OB2A 2QORA 2WICA 4G1UC 2RHDA 1G6OA 4GMXA 4MUAA 1UM8A 2ZJ8A 1KDTA 5BW8A 4Q4HB 4IXMA 1Q0UA 3IGFA 2E87A 4MKIA 1JR3A 3K1JA 5FL7D 1NLZA 4XVQA 3B6EA 1Z28A 1XTJA 4AURA 1G5TA 2NO6A 2X19A 1KJZA 4B3BA 1IJEA 5KDOA 1M74A 1UKVY 4Q02A 5F9HA 4RCYA 4DIDA 2BM0A 4M1SA 4B34A 2VIIA 1T9HA 4Q7LA 4RKEA 3C7KA 3GLIA 3AUYA 4ARZA 4BFTA 1OH5A 4IW3B 2OAQ1 5FPYA 1DAEA 4PSKA 4GOJA 4GPTA 1NMZA 2G6BA 3H1TA 1US8B 3F0TA 4O2RA 3ICEA 1N5IA 2G1JA 4LI0A 4RD4A 3KFVA 4EPYA 5E7MA 1MR3F 1KI2A 2HJVA 3ND9A 1DARA 3NHAA 3MSXA 2C98A 1SKQA 1T3HA 3IHLA 2R44A 5AJYA 3I73A 4AYWA 4M4SA 1OH6A 4LJ7A 5FBRB 4DDUA 5CITA 1I4LD 5FR2A 3W90A 2AD1A 4D82A 2BCJQ 1KJWA 4ZKEA 4CEIA 3V4FA 1NIJA 2O8DA 2XOKA 3E1SA 1R0ZA 3MLEA 3FKSA 1OIWA 1KO1A 4W5WA 3U60B 1KI8A 3EZ2A 1OW3B 3NBXX 1E0AA 3M0EA 4NCKA 1FUUA 1LF0A 2PEYA 4Q7KA 2WWYA 5EE1A 3OAAA 1E69A 1VCMA 4FN5A 5FTNA 4TYYA 4LOAA 2YWGA 3CO5A 4Z54A 3GMTA 3C15C 2REXB 5JMTA 3GJ5A 3N2IA 2IYYA 4RZUA 1SULA 2RGBA 4XOIA 5FI0B 4OYHA 1P2UA 1UEJA 3FHOA 4GZMA 2OFXA 1NG9A 5JLJA 2YKGA 4AY2A 1E2HA 1H8HA 3SBDA 3RRZA 1N6KA 1NMXA 3U6KA 3QKSA 2MSCB 4DLWA 1F2TA 1EFRD 3GEIA 1U9IA 3QKSB 1I2MA 4HDOB 2OHFA 3LW7A 4RCZA 3VNUA 1XWIA 1XCPA 4LJ6A 2ZITA 3THXB 3RNLA 1G8HA 3GJ3A 4EPXA 3OE7D 2V3CC 2GJKA 1TADA 2GXAA 1OFUX 2ZE7A 3CRRA 1LVGA 1SVLA 4U00A 2VP9A 1Q1BA 2SHKA 1YKSA 1VCIA 1NSTA 3EIHA 1MO5A 1AGPA 1NLFA 3L0PA 4N0DA 3LBHA 3PUYA 1U0LA 2ERYA 2ZE8A 4PC6A 2A3RA 1CJTC 3KB1A 2ZRPA 3CONA 4LHVA 4KU4A 4MYCA 3ZD7A 3L82B 1M7GA 3PR1A 2C99A 1YZKA 1N6RA 4G5RA 1IY0A 2HV8A 4KLNA 1W46A 5HKKA 1IN7A 3Q5EA 3EAQA 2ZRGA 1S9DA 3AVTA 2FE4A 4Q9IA 5CK5A 1UPTA 2GTPA 1XTKA 1SHKA 1N5JA 2YOFA 1YVDA 4X8LA 4X8OA 1G41A 2QN6A 5KHOC 4NHOA 4TL8A 4A2WA 1A2BA 1HH4A 2Z4SA 1GNQA 4CIDA 2ZJBA 2IWRA 4KHZA 3VKGA 1AIPA 4LJYA 5FL3A 4AYXA 2QTHA 2XB4A 4MDEA 4OI2A 1EFCA 1S3GA 2UVQA 5FUWA 4JLBA 1NG1A 3K0AA 5HZKA 3KJIA 1XU4A 5JJIA 1U0HC 1XJQA 4PSAA 5FR1A 2WJHA 3A37A 3TVDA 4DT1A 3KQKA 4PC2A 1HTWA 1D8TA 4KVAA 5FOVA 5JSZA 2DYKA 4QBGB 5C46F 1EGAA 3K70B 5K8IA 4I1SA 5AUQA 2IS1A 5L8VA 4JBYA 4Z1MA 3QBVA 5TDHA 2Q9AA 4LBYA 2BV3A 3T15A 3G5UA 3P32A 3BD9A 1E1QD 2VLIA 3OEED 1KY2A 2VHJA 2EFDB 3QPUA 4LPKA 4D81A 2EQBA 3KJEA 4GRAA 4C3ZA 2ZJZA 4G5OA 2QG6A 2R6FA 1U90A 4XWAA 5FFMA 4DCNA 2IXGA 4H1VA 1KGDA 3H4MA 2HLDA 2F55A 2GXSA 4BASA 3THXA 2YC2C 3AM1A 4TLAA 1T0JB 2MMCA 3KQNA 2FNAA 1F5NA 2CL7X 3OIVA 1NIPA 1QF9A 1Z6TA 3W8RA 5J4VA 1FUKA 2VL7A 4H9GA 3ICQB 1TU3A 3CH5A 3QXCA 3ETLA 5B57C 2I1QA 1RVDA 4I1VA 3QIAA 2WVJA 4PQFA 1JR3E 3D3QA 3RABA 1G7TA 1CJVC 1K8RA 3RS4A 4D4LA 2JCSA 3NBFA 1S9HA 4QRHA 3MWYW 2QNRA 2JLUA 2G83A 4R2IA 1D5CA 1GRRA 2ZRHA 3DL0A 3ONWA 3LDAA 1GKIA 1Z6GA 3FKQA 3ZZTA 2L0XA 3OFND 2GBLC 3F3YA 3GP8A 1U94A 2OO7A 3ADCA 2O8FA 3QG1A 2FF7A 2ANCA 2WSSD 4BLTA 4PO8A 3NXSA 2LWIA 5ANRB 2H8KA 5TXGA 4Q66C 1VYUA 2BEKA 2R9VA 2QGZA 1R5NA 4LSGA 4Q9JA 2BKEA 2VP0A 2O5VA 5SZKB 1SVSA 1EWQA 3A6PC 1ELOA 3DDCA 5AK0A 1RYFA 1FQKA 3AB3A 3KKMA 1GRNA 1P7CA 2CK3D 2CJWB 3ZH9B 3AP1A 2IS2A 3IILA 3MWKA 1ZUIA 4TZ0A 1WF3A 3AGQA 4PSVA 4ASUD 1G9XA 1ZU5A 2XTMA 2HT6A 2JGNA 4AKGA 5TV2A 4URYR 3QUSA 5LD2B 1QDEA 2ECKA 2FOLA 2NO9A 3NC0C 1DS6A 2JLYA 3P20A 1XJ0A 1SVOA 3EARA 3AF0A 4AIIA 4V0ME 4JVNA 1W4AA 2R6CA 2BEJA 1CULC 3X1XA 3IUYA 5LD2C 2BM1A 2OFWA 3DZDA 4UXHA 4BE7B 1N5LA 2F1RA 2Q9BA 4QGFA 1NNEA 4HAYA 2NIPA 3HDTA 4UXIA 3C5HA 5FTLA 1OHHD 2ZJAA 3NTUA 3FFBA 1UKYA 2GAOA 2D62A 4PQYA 3TNFA 4BFXA 1CR0A 1SKYB 4URUR 3R8CA 4LHZA 3TH5A 1MABA 3SQXA 1SXJA 3GJ8A 4YONB 4TYPA 1W1WA 2GCOB 2JJ1A 5FTJA 2ZRFA 1KJYA 2YZ2A 2VP5A 1BMFA 2G1KA 4BFSA 2CMKA 1E98A 1ZCBA 2FN4A 4TWZA 4JL8A 2CK3A 3LBIA 2IUTA 4R9UC 2XGJA 2GAAA 1N5KA 4TYWA 3Q8XB 2XXAB 1K5GA 2NTYC 2C9YA 4PC3A 4CT4B 4FIDA 1AQYA 2P6NA 4I1OA 4YMVA 5AJZA 2DWQA 4ZKDA 4M22A 3AUXA 2QAGA 2HYDA 1KI1A 4Q4AB 3TE6A 1ANKA 2ORVA 3S1AB 2B8TA 1IN4A 3UMFA 2C78A 3TUJC 1Y3AA 5IF9A 4U02A 4PZZA 2V1UA 1GKUB 2XEXA 2OCAA 4L15A 3BBPA 4PO9A 1KZGB 1BOFA 3CF6R 1D6JA 3IO5A 2GEUA 3PITA 4QJ5A 3VKWA 2CHVA 4HUTA 3I4LA 2CBZA 4V02A 1YE8A 2IBMA 2IF2A 4DVGA 1XMIA 3OIWA 1LY1A 2X2EA 3HR8A 3T34A 4TZ6A 4QM7A 1TEXA 4D4KA 1TX4B 4NU0A 1RZ3A 1Z0DA 1E99A 2J7PD 3DM9B 1R6BX 4QGAA 5EUQB 4XWOA 4D26A 4HZUB 1CR2A 2BMEA 4G5QA 2IX3A 1HA3A 4LPSA 1VG1A 2JAQA 2RGNC 1E2QA 3CWZA 4PPFA 1ZNZA 4EPRA 3FYHA 1XTRA 2XNDA 1ZUNB 2V1XA 4M9XA 4C0QC 1LF5A 2P5SA 2EU8A 4TQ9A 2GXQA 1UJ2A 1P3JA 2OSBA 2CDNA 2ZRKA 1LB1B 3L0SA 1OFIA 3O8BA 3RLFA 1G3MA 1QHYA 3A4NA 4AD8A 1Z07A 3ZDQA 2PBRA 1KDOA 3LWNA 4M1MA 3EZ6A 4TLBA 4IVQA 2PLFA 1NRJB 1F60A 4KJZA 3J81k 1A82A 2F1IA 3BK7A 1G6HA 2ZM5A 2R8RA 4DCUA 4YC7A 1Q1EA 2ZUCA 3FGNA 3QF4A 1FP7A 3UG6A 4XD7D 4QM6A 4L9WA 5DI9A 2R62A 3L0IB 1ZD8A 4C7OA 2GK6A 1SHZA 2IT1A 5CDFE 1E0JA 2W6JD 1E9DA 3DO6A 3IKJA 2OBNA 4XTRA 2IHBA 4A9AA 4TYQA 1YR9A 1W0KA 3V9PA 1GVNB 5KSPA 5IT5A 2D2FA 1FMLA 1TEVA 4N0EA 3KL4A 1E32A 3BB1A 3CZPA 4DLSA 4WVFA 4CEJA 3CBQA 3IEUA 4ACBA 2ZSAA 4HZIA 1GUAA 4A82A 4Q48A 3B9QA 3VQTA 1Z47A 2PX0A 4XWKA 2FZLA 3IBGA 4TT3D 4A15A 1II8A 3ADBA 3I5YA 2FA9A 2W6ID 4CRWB 1KSJA 4ILEA 2WWIA 4OJQA 4TMXA 1P5ZB 4ITRC 2MSEB 5JZVA 1VPLA 2QM7A 1Q3HA 1E2PA 2R6GA 1G20E 2C5LA 2O0KA 1CJMA 1KMHA 3K8YA 4Z51A 2ZI5A 5D3MA 4F91B 5K8LA 1KKLA 4BFYA 1SXJC 3SJCA 1ZM2A 3EA5A 3X1WA 3VHXA 4RFSA 4JVSB 2AK2A 5GJWC 4ESHA 2BMJA 2F6RA 2OUKA 2VF8A 1KDRA 4LGMA 3CLVA 3SDZA 4JYBA 3T35A 5IHPA 4A36A 3EZ7A 5LB4A 2VO1A 1KHTA 2V54A 2YNMA 1YR7A 3LBNA 3B78A 4DLXA 2IC5A 5HPYB 3R20A 1KNQA 2C9CA 4V03A 2GCPA 4B3XA 3RS3A 4OI4A 3QE0A 1OXXK 3I1FA 1W5SA 1U0JA 3JZAA 3THYA 4LJ8A 1FW6A 2ZI7A 2FEMA 1ZMXA 1XEXA 3LQQA 1VIYA 4FMDB 4MUBA 3K0CC 4PHFA 3RSLA 3SI7A 3C5CA 2BC9A 5AUNB 4GZLA 4ZDWA 2VP2A 4G5GA 4U7DA 3ZYCA 1DAKA 2GK7A 3K0FA 2BJWA 3V4RA 5J47A 1A5TA 4MGKR 3EXAA 1J8MF 4NDZA 4RVCA 3LX5A 3E5HA 2Q21A 1NMYA 1HQYE 3QXXA 2DCUA 3BERA 2A2ZA 1EFHA 1XEFA 3TUIC 3GLFE 2JLSA 4LJ9A 3FDIA 1A4RA 3B1XA 4CW7A 4E5UA 2HJGA 1RKBA 2B92A 3GJ4A 4M1WA 5CJ2A 1IONA 1HEIA 3MCAA 4RSGA 2NOAA 5H70A 4EPTA 1QHHB 1XCMA 3ZD6A 1DADA 1P72A 3TMKA 2YYZA 2ORWA 3UMSA 2IF0A 3CPEA 2KJQA 3TR5A 1VCOA 2ODEA 3OHMA 3A36A 3LW8A 2DFLA 1IM2A 1T5IA 3B82A 1II0A 4N1AA 1GL9B 1LW7A 2YC4C 2ZSBA 3LLUA 2XJ9A 4US2R 4TL7A 1W36C 1YRBA 2P6UA 1COWA 3FB4A 3F8TA 1O87A 3IQXA 1R8SA 8OHMA 2AN9A 2QMEA 1PJRA 4Q1DA 1QRAA 1S4QA 3GLHB 1CRQA 1R4AA 3A1SA 4QNRA 1G19A 4K46A 3OEHD 4PAMA 4CT5A 2JLXA 4B3FX 2ASEA 2QP4A 4UJ5A 3B1WA 3I62A 5KPJA 3ZS8A 1D9ZA 3W6NA 1ZU4A 2N1BA 1XTQA 3AF1A 4OQNA 4FWIB 4YDHB 4AKEA 4CVNA 1ZM3A 2YOHA 2XZOA 2AKAB 3QXSA 1CBUA 1FFHA 2J0UB 4HAWA 4Q1BA 1PUJA 2ZROA 1X1RA 4TQUS 1L4YA 4D0LB 3G0HA 4DDWA 1JR6A 3ZJYA 2H5EA 1H8EA 4QGHA 3UWKA 4WIAA 1JALA 5HZHA 5B30A 3U5ZB 2GDJA 2CHQA 2ONKA 2FPKA 4NCHA 3IO3A 1RW4A 1P9WA 1N6LA 4L16A 4GFDA 1Z0IA 5KTYA 2DWPA 2ZJ5A 1MH1A 2P5TB 2VTKA 3CKLA 4ZCLA 1EG7A 2FGKA 1XD2A 3CRVA 2H1LA 5HCIA 4RY2A 3WHLA 2OESA 1NI3A 1Z83A 4QJ3A 1XBTA 1VIAA 2AR7A 2QQEA 2RGXA 3OZXA 721PA 3ZIAD 1E1RA 2ZYUX 4JIMA 1ZW6A 2BVNA 2OCYC 3DHWC 4ZO4A 2ZETA 3QOFA 3LRPA 4PPQA 5L3RA 2XSZA 2Q3HA 3W3ZB 1J8YF 1Z0JA 5CB8A 1HURA 1GNRA 4AI6A 1I2DA 1P73A 2REBA 4W9MC 2J41A 5AJWA 1CIPA 1OE0A 2D06A 1WBDA 4JYCA 1YZTA 3VNVA 1KY3A 4OHWA 4ACAA 1NKSA 3DKPA 4EFMA 5AJVB 3Q9LA 2IW3A 1WA5A 4I99A 5DLQC 1KMQA 1OFTA 3TQFA 4AYTA 2QM8A 2XOKD 3QXJA 4JT4A 2YINC 3BJIC 1U9IC 2GA8A 4EKDA 1WBBA 2C95A 2ZRAA 4A6PA 3MMPA 3BWDD 3UXMA 4OI1A 1GZSA 3BH6A 4J0QA 4LV6A 1AS2A 5CJPA 4UKDA 1B0UA 4IXNA 4WXRA 1F6BA 2J0QA 2HUPA 2O8CA 2FGJA 5FUYA 2ZEJA 1BS1A 2ZU6A 3SNHA 1ZM4A 3CWQA 1N0UA 4F38A 4JJZA 1TL7C 3SE0A 1J70A 3KB2A 4Q01A 1YR8A 2ZR9A 1DAFA 4A0HA 1AA9A 2C2HA 3B5JA 4RKFA 4US1R 3QKRA 4UNSA 3M4YA 3SOPA 1LTQA 2CHGA 5SZHB 3VX3A 3IIJA 4CEIB 3RVBA 4IFEA 3NBZC 4JL5A 1W0JD 4HAXA 1KK2A 2CLCX 3AVYA 4LC1A 4ZDKA 5JHGB 4DSTA 5J4LA 4P32A 4B75A 3Q85A 1W36B 1NVVQ 1MRNA 1ZAKA 3NH9A 1COWD 2OBLA 4OK6A 1X8JA 2BBWA 2A78A 3HR7A 5AUOB 3RRMA 1OYYA 1G7CA 2IYRA 3C41J 3QVVA 4TYNA 1KMHB 2WKRA 1XD8A 3PUXA 1AJEA 1S0UA 4O0MA 2FFAA 4HYYA 1Z0AA 1PUIA 1ZCAA 1R0WA 1G3UA 3HWSA 4TMTA 3IPXA 2X77A 1W47A 3I8XA 2XAUA 5IK2D 1GP2A 1KK1A 4E22A 3AF3A 4BUJA 4Q4LA 1G7RA 1G8YA 2WOJA 1XTSA 2J3EA 1AKYA 3GQBA 4YXWD 3IIKA 2GBLA 2Y8EA 4DHEA 1VKJA 1YZGA 3BRWD 3AVPA 1PV4A 5A4JA 2JEOA 2HYIC 1UDXA 1G8GA 1XB2A 5IDVA 1X8KA 5FPHA 4P31A 3RAPR 3TW8B 3ADKA 5JWOA 2J5XA 2JJ8A 2JASA 2PJZA 4B47A 1XJCA 2IUUA 4TMKA 2XJ4A 3HPQA 3AQ4A 3UKDA 3B85A 1WP9A 1UKZA 2KI5A 4QBHA 1N3BA 5JCPA 5GJCA 3K0SA 2RGEA 2OE2A 2HLDD 3B1YA 1E2JA 1I4TD 1W2HA 1C1YA 3L2OB 3NBYC 4KAXA 2D4HA 2O8DB 1LFDB 1KI7A 4NBSA 1HYQA 5EZ5A 2WPDD 4NCNA 1GAJA 1F2TB 5CYOA 1E79A 3O47A 5FTMA 4MKHA 3KXIA 2AWNA 2KE5A 3CB4A 2CXXA 4A0RA 1KK0A 4P4TA 121PA 1IXRC 4Q47A 4OQLA 1GOTA 2OM2A 4B3DA 3NDBB 4YDSA 1UF9A 4FMDF 3GJ6A 1ZNWA 4BWYA 3ZVLA 4Q5IA 3X1YA 2QP3A 1ZD1A 3EPHA 2CE2X 2CNWD 5EZ6B 4B2LA 3CX8A 3GCGA 4L5BA 2P67A 2PLRA 5GVRA 4A2QA 4ZDJA 5J4KA 1G291 3K9GA 4P33A 4QBIA 2JA1A 4LBVA 1F2UA 1E2LA 2NO7A 1WB9A 2WWWA 5AWFC 1VG0B 1A2KC 2PT5A 2XNDD 3W5JA 2ZE6A 4E03A 5TVKA 5KUTA 4OHYA 2N42A 2QENA 4Q4HA 2GVDC 1TMKA 4HUQB 3PEVA 4WAUA 1ZINA 5DHFA 4ERNA 1CR1A 3MAAC 1RFLA 3OIYA 5JI2E 3KJHA 1OFHA 2BBSA 4DKXA 4TTRA 4KYIB 4LYFA 4AC9A 5C1BA 5DE3A 3TJZA 1NP6A 4F4JA 1VYVA 3VHLB 4NYMR 4BFUA 1DVRA 2X2FA 2ZVQX 3CX6A 4LUCA 4BZPA 5FOSA 4S35A 4PAOA 3FMFA 1GDDA 3UK6A 3CNOA 2PX3A 2EWVA 3H86A 2ZTSA 3WY9A 3P1JA 4PZLA 3SJBA 4UNRA 3GFPA 4JLDA 2MMGA 1YQTA 4M1TA 3QKUA 2FPMA 2CNWA 3FE2A 2IYXA 2P65A 3KUDA 2ODBA 4S2EA 3LX8A 4C0JA 1Z63A 4YQFA 1XD9A 3ADDA 4HLQB 1EWRA 2CCKA 2H7VA 1QVAA 3BGWA 4KODA 1Y63A 3DPUA 3W6OA 2FH5B 1EX6A 4ABYA 2IHYA 1Z8FA 1GSIA 1OH7A 1ODFA 1G3RA 1R10A 1X3SA 4JLMA 5HCNA 3VR3A 5GVSA 3EIQA 1MO4A 4PC1A 2JLZA 4Y0AA 1G5RA 2ZRBA 3TAUA 3AVXA 2WM9B 5J4YA 4BZQA 2NZJA 3OEEA 1X86B 1VECA 1OXVA 2CEAA 2RHMA 2WJYA 4NPHA 1JPJA 4HB3A 4IOJA 5EP1A 1H8HD 4POAA 2JLRA 3B1ZA 1IQPA 4GP6A 2XXAA 3B2EA 3ND8A 1X8LA 3WYAA 3CZQA 2AWOA 4PHHA 5BN4A 1N6IA 2O0JA 2PZFA 3RRYA 4NE2A 3U3OA 1W49A 1NF3A 5DO9A 5A0FA 5E95A 1FQJA 3R8FA 3P4YA 4F7WA 3W9YA 3WXMA 1E9RA 6Q21A 1KI9A 1WQ1R 4B71A 1HE8B 3V00A 1DO0A 3CH4B 4JSYA 3CF0A 2FX3A 5BXQC 4LYHA 4XTCS 3LA6A 4A8JB 2F43A 4B6EA 3RYTC 3AP3A 3CW2A 2WZQA 2E1RA 2WSSA 4TLCA 4QOSA 1XEXB 1E6CA 2J7KA 2VA8A 3IIMA 4KO8A 4M1OA 1R2QA 2F3TA 1DE0A 3LV8A 4W7SA 4B6FA 2J45A 4EJSB 4FXPA 2GEDA 4TL9A 1UAAA 4EDHA 2WV9A 3EZFA 1E0KA 1VYTA 2W6IA 1UKEA 4EUNA 4ZPXA 1P4SA 3U3JA 4JLNA 4MKFA 4ZV4A 1KSGA 4HZUA 1P2SA 2MSDB 3GLIE 5DI3A 1OJLA 3GJ0A 4OQFA 2ZE5A 2Z5FA 2CCJA 5KDLA 1JBKA 2JJ1D 3N2EA 2I4IA 4KI0A 5CIWA 2ZU0C 5SZJA 1NN5A 3QBTA 4E07A 2ZSFA 2FDCA 3LQRA 3NEJA 1AS0A 4EAQA 4C0BA 4DLZA 3PUWA 5JBQA 1QHNA 2K5UA 2VQSA 3QJYA 2QP9X 1OHHA 1SXJB 4EPVA 1P75A 3QSYA 1SVIA 3A8TA 2QPTA 2JIZD 1DAMA 2XITA 2QI9C 2ZSDA 5KSYA 1NN1A 1EFUA 2QU8A 2D7DA 4CGZA 2AXNA 2W6JA 1II8B 4FW9A 1HY3A 1NY5A 2AXPA 521PA 1M34E 3TSZA 2BIFA 4B76A 1BKDR 5FL7A 4XD7A 1Q57A 3PENA 4HSEA 4RFVA 2CVHA 4IVPA 2I1VB 3THYB 3QVUA 1NBMD 1AS3A 3FFAA 4RD2A 3WP0A 4JJKA 3A58B 3I8SA 2BBOA 1JAHA 2GZAA 3ZGXA 1CJKC 4ZDIA 1GWNA 4M1KA 1M6NA 3FMPB 3VR5A 4R98A 1MT0A 1QHIA 3B9PA 3E2IA 4Q21A 1XXHE 3H0KA 1UEIA 1Q1QA 2Z0MA 3OF5A 5DYIA 2AD5A 3WYGA 2QSZA 1JXMA 2FSFA 2RGNA 2OEPA 2ZRJA 2F9MA 1FL9A 2ZVPX 3RDPA 3LD9A 3T1VA 1FX0A 1OKKD 1ZD9A 4C7OB 1GL7A 4GT1A 2FFHA 3THOA 1ESNA 2FSHA 3HJNA 5FUXA 3UG7A 4CYMA 2V9PA 1VDZA 2XX3A 1UBCA 2QE7A 1E94E 1M2OB 3AVOA 2JIZA 5JS8A 3IHWA 1DTSA 1Z0FA 5DISB 2AFHE 3TLXA 3BB3A 1NLYA 2HXYA 2WIBA 4AK9A 1UFQA 1KAOA 4NH0A 3RS7A 1S3SA 1ONBA 2ATXA 4HI0E 4RD0A 2HF9A 1JECA 2Q9CA 3W5IA 2ZRCA 1NVXQ 4IKEA 3NC1C 3P26A 2HEIA 4W5JA 5E4FA 1TF7A 4AKHA 4BLPA 3Q72A 2HCBA 4AWXA 3PG5A 4HB2A 2ZRNA 4L4UA 1DAGA 1ZRHA 2H16A 2QTVB 4NYIQ 4QHSA 3RS2A 4DT1B 3GLGB 3ZVMA 4DLTA 4QXAA 2PJRA 1YR6A 3K9HA 1XPOA 1RJ9B 5DN6D 4GMDA 3EG5A 2IYQA 2RH5A 4DB2A 4LHYA 4IJMA 1RJ9A 5D3MB 3Q5DA 3HYTA 4Q9LA 1E9BA 2YWHA 4D25A 1E2GA 2IXFA 4HAVA 4RZ3A 2V8OA 1J99A 4LY6A 4LJ4A 3QXHA 1MKYA 4HEJA 4M9QA 2IS6A 2FG5A 1K5DA 2ZJOA 1OKKA 4V0LA 2ZREA 1ZC4A 3KKPA 1Q44A 2ZI3A 3QKTA 5HKKD 1XZQA 3A1UA 5C4MA 5FI1B 1OIVA 3U7EB 4A2PA 3FPAA 5EP4A 2ZSEA 2ZS9A 4EFLA 4BPBA 1OXUA 1CP2A 1NJGA 5HTKA 1H8ED 4WZ6A 4PHGA 5CDFA 1BO6A 4R2HA 1N6NA 2HT1A 4D0GA 1KIMA 2W58A 3BFXA 2EYQA 4LRWA 1O3YA 3CX7A 5GJVC 5LB2A 1WDTA 4DRZA 4JS0A 3EPLA 3RWOA 1CLUA 1NKTA 5CYPA 1NVUQ 1D2NA 4YLGA 5FOTA 4B3GA 1ZVQA 2N46A 3KQHA 1KK3A 2AX4A 2A5JA 4LV8B 3AKDA 4KITB 2ZRIA 1F3OA 4WOPA 3TAHA 4DSNA 5F98A 2JLVA 3I92A 5EUMA 3HYRA 2ZXUA 2JDID 5C18A 1E2FA 4CF7A 4F92B 4TQAA 4QHTA 1CTQA 4URVR 5AUPB 1JXOA 3PV0A 2W83A 1E9CA 1M7BA 5TARA 5G3YA 5DH9A 1OV4A 1CU1A 1FNMA 2QGNA 3LH5A 1XTIA 3EWSA 5E3HA 1ZIOA 3K09A 1KSFX 1AQUA 2GEVA 1QZXA 2IL1A 1C9KA 2TMKA 4C30A 5KNBA 1CJUC 2WTUA 1OH8A 5EE0A 3SU8A 3CM0A 2DPXA 4Q18A 3I3SR 5FPTA 4DDTA 3PIRA 5FOWA 3EPKA 4OHXA 4TTQA 4M53A 4GI7A 2IYTA 4BQSA 4GSYA 4DCTA 1TQDA 4UNPA 3U61B 2DWOA 2EFGA 4I1UA 4JBXA 4BGDA 5EXXA 1GNPA 1K6MA 2ZYVX 2FPLA 2VBCA 3FMIA 3QPWA 1KI3A 1R8QA 2GZDA 4M9ZA 3RWMB 3MD0A 5FPSA 2GCOA 2Q3MA 1E2EA 4BRWA 3KKQA 4DUGA 3ZVRA 3K70C 1TNDA 3DKVA 3FVQA 4B44A 3WBKA 3SYNA 1JJ7A 2UKDA 4TL6A 3HPRA 1TTTA 3TKLA 2GKSA 1G7SA 4QL3A 4UQOA 3AF2A 2GHIA 2IYLD 4PPNA 1RPZA 3A1WA 4GDFA 2EFEB 3SFVA 4Z8XA 1U81A 3DEFA 1RC8A 1CRPA 3CPHA 1XF9A 1RE0A 3MJRA 4NZYA 4I81A 4E09A 4DDVA 2QBYB 1MV5A 3MFYA 1DAIA 2C04A 2V55B 3WRYC 1Z08A 2VH5R 1SXJE 1VHTA 4URZR 2LKDA 3NWJA 4PC7A 4A8JA 1B23P 1A7JA 3H84A 4Q7MB 4Q4JB 1WE2A 1VCNA 1Q1ZA 2KBFA 3REFA 1HV8A 1RRGA 1LS1A 1YJ5A 2DBYA 2WJVA 3D6TB 4WZBE 5J5CA 4B3CA 2QA5A 4UNQA 2A9KA 4C0KA 1E9AA 5D3QA 2ZS8A 3X2SA 4F93B 3PFIA 1LV7A 2GJAA 3KZ1E 3OFNA 1NVWQ 5AJXA 3B1VA 1T8UA 4OK3A 3GEEA 3ZZUA 4JLAA 3CRMA 3RSOA 1Z6YA 4NYMQ 4WXPA 4QG7A 2C9OA 4XSGA 3U4QB 4CZ2A 3AV0B 2BWJA 2G0TA 2W2XA 3A1VA 5J40A 3KKOA 1PZNA 4OHZA 3RS0A 4BLSA 1W36D 2G9NA 2ZJYA 1HT2E 2LKCA 1Z5ZA 4NCIA 3C14C 3MRSA 1NBME 2RGAA 3CNLA 2RCNA 2H17A 4HLUA 4Q1EA 1TF5A 3AGPA 2QT0A 2QMUA 2IYZA 4MRPA 3AKCA 5FBWB 2WMNB 4NYIR 3KQUA 2DFTA 4TN1A 1QHXA 1IAQA 3QY0A 4LCBA 4LV5B 4H1UA 3BFKA 5EXPA 1P6XA 2NPIA 5C2JB 3DVLA 1G17A 2QE7D 3B13B 1YZNA 3VU9A 3U3KA 5J4HA 1GKYA 2OT3B 3SFZA 1A1VA 2WWHA 4LDJA 2O8EB 4FMCB 3ASYA 5FOUA 2IWHA 1DBSA 1E79D 5JWRA 3TSOA 3VX4A 3KQLA 1P2VA 5L3VA 3UWOA 2WWFA 3BC1A 5F3WB 2NO0A 2PCJA 5L3QA 1BH2A 1TU4A 4P3YA 3WP1B 5DSZA 2GETA 4LZZA 5C4GB 5F2EA 3EZ9A 4B35A 3K9LA 4Q7JB 1CR4A 4DLUA 1G8FA 1SXJD 1ETUA 2OZEA 3RS5A 4V0MA 3U4QA 1G4AE 1G5PA 3OE7A 3QEJA 4HLUC 4ZI3A 5JRZA 3SJAA 4TMZA 1DELA 2YV5A 1JB1A 1W0JA 4L8GA 1XX6A 1G21E 1IN5A 3O8RA 2ATVA 3U7HB 2XB2A 3REGA 1IXZA 3QPVA 1Q12A 4MKGA 2A5GA 5FPKA 3I32A 2FFQA 4AG5A 1BYUA 3NEYA 3D7MA 3LVRE 1AK2A 5L3SA 3EC2A 4RZXA 3TIFA 2GXUA 5JI3E 3LAWA 2O8CB 4C0HA 3BORA 2VF7A 4XJXA 3ASZA 4MRVA 1PLKA 4U5XA 5CK4A 4M8NE 2J9RA 3TR0A 4KV9A 1TPZA 4PQRA 5TB5A 2GF9A 4EQ6A 4LYAA 3THWB 3GFOA 3OAAD 3CR7A 1NN0A 1Z0KA 2Z83A 4QFMA 3PUVA 5E7IA 3U44A 4WW0A 3B8HA 3MGCA 2QMHA 3LY5A 3KUCA 1FOEB 1AZTA 2AHOA 2QEQA 3K0FB 2BOVA 1N6PA 1AM4D 1D2EA 5JEDA 3HU3A 5CLLA 3WMEA 5G53C 3L43A 3QKRB 4DBLC 3M6AA 2CCGA 3TGPA 3GLGE 4LBZA 1BIFA 5KYKA 3SC3A 1AN0A 4B2IA 1ZBDA 1JNYA 2JLWA 4KFUA 4QHYA 3IQWA 4BLRA 4NCJA 4OJKA 2EYUA 4NYJR 2ZRMA 1KSHA 2XZLA 1QVRA 2NPFA 1OIXA 1W2GA 3ZIAA 1M1YE 1CXZA 3LFUA 1DG3A 1RRPA 4CEHB 4EIWA 4LHWA 3A1TA 2WAXA 2B21A 4ESVA 3LO5A 4YMUA 2O8BB 4URXR 2QTFA 4Q03A 3U3MA 2IEYA 2OXCA 1G3QA 2QUZA 3F5FA 3QG5A 3LXRA 5F9FA 3T12A 4DWJA 2YWFA 5B58C 4KFSA 1FZQA 2EW1A 2W00A 3QF7A 2YWEA 4GNKA 3ZZ0A 2OCBA 2ZRLA 3BXZA 1LNZA 3PEWA 2KSQA 4G5SA 3W6PA 1DAHA 3VKHA 4KSBA 3HP1A 5B64A 1E9FA 2ZI6A 3NIBA 4BLOA 2CL6X 5FBVB 4JKYA 1RRCA 4MRRA 1X6VA 2P2LA 3PEUA 4DCVA 1FTNA 3UIEA 3FMOB 1E2KA 3VR6A 4A6XA 1R7RA 3D31A 3U3RA 4K81B 4Q4AA 5DIFA 1OYWA 4MYUA 2REOA 5DN6A 3K0CA 4IFBA 3WMFA 2GRJA 1UBGA 4HB0A 5EE5B 1TQ4A 2J46A 4D4MA 1JJVA 1T6NA 2AK3A 2WSMA 4Q9HA 4GOXA 3AVQA 2OV2A 1PLJA 1KOFA 1SGWA 4ZCMA 2KWIA 1IY2A 2VSOA 4OI0A 1N0VC 4OKSA 1E9EA 3Q7QA 2GESA 3ZLJA 1U8AA 5EP3A 1KNXA 4HAUA 2VSXA 1P2TA 2J7PA 4PZYA 1E96A 5H68A 3RHFA 3WRXC 1L8QA 2WIAA 5L3SB 1J90A 2ODWA 2ZIAA 3TBKA 5LBIA 1TQ2A 2BMFA 3AH8A 3NVAA 3SS8A 1W4CA 3L8YA 2PZGA 4KXFB 3KDSE 3KTAB 5G3ZA 1VHLA 2OXRA 4KVGA 1RYHA 2C96A 1IN8A 1P62B 5CM9C 1Z3IX 4PHTA 1E4VA 1Z2AA 2O0HA 5K8UA 1BYIA 2XNSA 5DHAA 3ZVNA 1JQLB 2R2AA 2VSFA 3C16C 5BYKA 2H18A 1P61B 221PA 3NG1A 1HT1E 4JLPA 3T5GA 2FWRA 1YZUA 2W0SA 4LC0A 4A92A 1XZPA 4BFVA 1IOZA 3K9NA 1KDPA 1FMJA 3ZQ6A 2BKUA 2ZUBA 2J59A 1HUQA 5G40A 5KDDA 1W44A 2A5YB 5CM8B 3MUFA 1CKEA 2GWHA 4QKQA 1P60A 3QI2A 2R6AA 2OG2A 2V7QA 4Q9KA 3W3AA 1GITA 1Q22A 4HDCA 2G0NA 4C4PA 2V6IA 1ZJ6A 3UPUA 2WHXA 4ARZB 3CRW1 1EX7A 4DXAA 3VR2A 1S96A 2WOOA 5UKDA 4D80A 2KB0A 4LK2A 3UATA 2FSIA 4YMWA 5FOXA 4YXWA 4Y0VA 1WCV1 2RKOA 1NJFA 3PUZA 3GPLA 1UBEA 4AG6A 4C0AC 4FCVA 2P0EA 4DSOA 2R6DA 5BYJA 5B2ZA 4JBWA 1CF4A 1FPMA 4DLYA 4RJLA 1OT3A 2YVUA 1ZM9A 2Z4RA 1GRQA 5KU1A 2ORIA 1EK0A 2AFIE 2QSYA 4HAZA 1IJFA 2JATA 4P0TA 4DEXA 4UNNA 3SR0A 2LCFA 1FX0B 3KFXA 5IRCD 5FTKA 5KOYA 4MRNA 5EXTA 821PA 1KI6B 3PEYA 2GJSA 2JJ2A 1U2RA 1KI6A 4M9SA 1J7KA 3N5CA 4OQMA 2RGGA 5HE8A 2QROA 2VHTA 1G18A 1KO8A 3DMNA 3PCRB 1ZNYA 2EFCB 1C4OA 3C8UA 3P4XA 2NG1A 5JJLA 2JDIA 4EJSA 1XPRA 1OSNA 2BJVA 1OPXA 4ON9A 3IPYA 4C2TA 3LVQE 1KO7A 4ZIRA 1TQ6A 5HR5A 4Q1AA 3GLFA 1OB5A 4D6PA 5GJBA 2FJUA 1W0KD 1GFIA 2FU5C 1XNJA 3IDQA 2F43B 4YMSA 3EC1A 3SQWA 4V0NA 2Q6TA 3AVVA 2CL0X 3AF4A 3RC3A 5P21A 4ASUA 2C03A 1H65A 4GP7A 2QRNA 1IXSB 2VPPA 3B60A 4RZ2A 2FSGA 5DYGA 1N6HA 1KO4A 4X8HA 1VTKA 3UMRA 3QEOA 4BRUA 3TUZC 3SYKA 1AZSC 3CR8A 4A1FA 5BN3A 2CVFA 3I72A 3DOFA 2ZI9A 2OFOA 4V0KA 1G4UR 1SZPA 4TLEA 3T1TA 2E9SA 1JI0A 5E7JA 4O25A 4MA4A 5DGXA 1AGRA 1F2UB 1RIFA 1S1CA 4UXJA 3R7WA 2O8EA 1GILA 1XFAA 3OESA 4NP6A 1I4DD 2QAJA 2ZPTX 5M04A 1W7AA 2G77B 2RGCA 2C8VA 4LHXA 4OQXA 4DSUA 2G88A 4MGZR 1JPNA 4IHQA 3W8NA 4TMWA 2OLJA 5L3QB 1YRAA 4QNMA 4MYHA 4NTZA 3JVVA 1PLLA 4MGIR 2VHCA 4NMMA 4LBWA 1II9A 1E0SA 1Z6XA 1NSFA 5BQ5A 3VTKA 3WBJA 4ZIRB 3GEHA 3AKEA 1W48A 1E2MA 4XVUA 2D74A 1J2JA 3K70D 1KYIA 1Z06A 4XH9B 1FP6A 2ZAOA 2WMOB 4FMBB 4FI3C 3TSWA 4FCWA 2O8BA 2X1VA 1DG1G 1LS6A 2NO1A 4IOKA 1RRFA 1G8PA 1UBFA 4IDQA 4IOLA 1T3SA 3A4LA 4LX0A 1JQJC 1S1MA 4BEJA 4D2IA 4W5HA 3LXXA 5BWMA 3NKVA 4F4IA 1NBMA 1T4GA 1KZ7B 3BE4A 3PVSA 5SZIA 2PH1A 2IA5A 5KNDA 4JT2A 5JSZB 4UJ3A 4BFZA 4PPGA 4WBSA 4B74A 2A7QA 2X8AA 4KLZA 2G3YA 4B32A 4JMPA 4HB4A 2OBMA 3SZRA 2YHSA 2O8FB 3X1DA 4LYJA 2GZHA 4OHVA
chains in the Genus database with same CATH superfamily
3CC8A 7GPBA 4TXLA 3E84A 3NHMA 2BHRA 3ZWOA 3D3EA 1E5LA 1N5MA 3TVTA 3GLFB 4TRRA 4UEOA 2JGIA 5CNJA 3ULPA 4JQZA 2G40A 4O2LA 2GJ8A 4X93A 4UFOA 4YCAA 5EG5A 5FA8A 4Q05A 3VU9B 5HE9A 5KJFA 4HDKA 1BBWA 3WL3A 1SNPA 2XUIA 3RUHA 1E3MA 3PXGA 3ZKWA 5MGBA 3CPJB 4AN0A 3BDVA 1ICEA 1YO6A 1DP4A 4OQZA 5CH5A 1Y3IA 4YRDA 1WNTA 4J7XA 3RAJA 2JFQA 3GOHA 2ACEA 1PTOC 1G64A 1S8OA 4GXRA 4MV0A 1PDOA 3K0AB 4FBGA 1T8PA 4LCEA 1M6WA 2C07A 5KIXA 5A2GA 2V6FA 1TWHH 1IFXA 1FTSA 1GG2A 1QMPA 2BDTA 3ABIA 3JTEA 3ROTA 5JD3A 2WJ4A 4HAEA 5DLPA 5K3FB 4TSSA 2UVPB 2M6LA 3CCQA 3C3MA 4YRRA 3T7RA 4YCMA 5DX8A 4XAQA 3F1ZA 4FFBA 3RU2A 1A50B 2G9UA 5CVTA 4J3JA 1O54A 2VEDA 1OF1A 4H2DA 2YJ4A 4ETWA 5BV1A 2KJXA 2PQMA 4P75A 1QB7A 4KV6A 2FV8A 2CN1A 4FDVA 4A3DG 4GS5A 1EU3A 1HFWA 4BX9A 2ZYRA 2KHSA 3BWXA 4FU0A 4ND2A 1NR1A 5IIFA 3FCYA 1DIOB 4CKWB 3P7JA 3NAMA 1P7YA 1S6YA 1T36B 3SZMA 4ZI7F 3S8EA 3VA7A 3PZBA 4AMBA 4KREA 2EF0A 3HNOA 5TS2A 1JQDA 4CGYB 2X9LA 2YWJA 3IEXA 3L4EA 5CFZA 4P7BA 3IH5A 2PQ6A 5EXSA 3QYAA 1JLLB 4R2MA 2VSYA 1TWCB 2G7MC 1RQ7A 2ONYA 3HDGA 3LE8A 3N39C 3PXCX 2F3RA 2VPXA 4UBLA 4JL6A 4BKQA 1VSVA 2AQ1B 2PGXA 3EASA 1EXMA 1LI5A 3KBGA 1A77A 2Q8NA 1RXEA 2VDWA 2DZDA 3JVEA 1Y6ZA 2C97A 2RE8A 1UP4A 2OD9A 1R4NA 4RVHA 4TV9F 1DPFA 3C97A 4KJXA 3L4SO 3MZ0A 1NXOA 3PHLA 3GEBA 2R4UA 4YMIA 4AF7A 1RC0A 3U9OA 3BA6A 2QUIA 1IY9A 2ZANA 5C37A 2QRKA 2QRLA 4DCMA 2FYTA 3WWCA 1ECJA 3R5KA 3RCBA 2CXPA 4G81A 3S7TA 2C3MA 1NNSA 2DPLA 4JKIA 4KSYA 3GJTA 3VR3D 2VJKA 3EPPA 1SXGA 4DKJA 1U4PA 4AMZA 5DWDA 1SE2A 1HLDA 4X84A 4WN9B 1WEKA 3OZWA 1PJ8A 1SD2A 5CGZA 1MOZA 4PXAA 5DTRA 2CE7A 3TVYA 3UT5A 2OHGA 1TM7E 1RPJA 3NM5A 1QQTA 3C4JA 2Q5JA 2NQ2C 2C4KA 4KBFA 4OXPA 3SM9A 1P3DA 1U98A 4HGYA 1VG9B 1NXTA 4S0ZA 4OQQA 1ODIA 4KGDA 2I6SA 2PTGA 1QQAA 1VHQA 1E64A 2VKQA 3L8ZA 4K0KQ 2C54A 1C1DB 1TJ4A 3HA7A 1B2LA 2BT4A 3L06A 4PANA 4WJKB 4FMCF 5FEMA 4CCYB 5K45A 1CEEA 1WDWB 4C7XA 5LFAA 3KV1A 2J3LA 3GVHA 1U2EA 3P9ZA 4HGOA 4KFRA 2HFKA 4ZAXA 3EIEA 2Q8PA 1IZ7A 3LC0A 4JJGA 4UQPA 1D5WA 3MCTA 4R41A 2ICIA 1E1QA 3X1ZA 1U2GC 1E89A 2JAPA 4RABA 3WNDA 2EATA 1I50H 5JJBA 4MCJA 3I61A 1E5DA 1GY8A 1GUGA 2PBLA 5JVH3 1JNXX 4RV9A 5EVCA 4C0LA 1JMYA 3AFQA 2JA6G 2HWYA 2IPAB 1RODA 2RAVA 3R24A 5B7PA 1Y4AE 4UDXX 3S1NH 2RGDA 2IP4A 2IODA 3ILSA 4B9EA 3OQNA 4Y30A 1E1OA 1DSSG 1EM8B 4IDNA 5ALKA 1YAJA 3I6MA 4C03A 3BH7A 5J59A 4KDCA 4Z1OA 2VDLB 2DUUA 3L6OO 1KMCA 1OBFO 3CYFA 3MG9A 1T0HB 4XRRA 2PKEA 4XX1A 3ZLVA 4BLQA 4DTCA 2Q3FA 4BWVA 3EBOA 1CZWA 3HRKA 2XKBA 3R3WA 5BURA 3I5XA 1BX3A 1TRHA 3B70A 2HMAA 4A3CG 4YAGA 1I3CA 3OU2A 5C3EH 1DKLA 1E1RD 2EFHB 2IZ0A 2QGFA 4OHUA 5G1OA 1F51E 2BKAA 2VHQA 3EPJA 1TXYA 3Q4GA 3ZDDA 5C0XH 4RDCA 3ZHBA 4TMVA 3P75A 4LFAL 2VLBA 2VL6A 2O7NA 3NEMA 3VMFA 1QHEA 3GEMA 3DYVA 1T2EA 1PR5A 1X1SA 2HDHA 2R8EA 3R4VA 1Q17A 1E3IA 1D9XA 1R0XA 2DULA 1UAYA 3GLVA 1J9ZA 3OIGA 3VSBA 1QHGA 5HKLA 5HIAA 1CT9A 1O7JA 4I5FA 3PD0A 4HRVA 4TS1A 5BVGA 1Z8HA 2HI0A 2WP0A 3MT0A 2K1BA 1XYGA 2E6UX 2O5RA 2NUCA 3RMHA 2HXSA 2CFRA 2CXHA 3H16A 1ENZA 3PS9A 2XYPA 2H52A 5BMOA 4IIEA 2FWPA 4FQ7A 2FEOA 1EY9A 2RMKA 4D0NA 2HA3A 4DZZA 1SD5A 2ZTVA 4E4RA 1F9RA 2OZKA 3AKYA 1DOAA 3NKLA 4TRJA 4ZQIA 3ZGVA 4CM6A 2QRPA 2EP5A 2J0SA 4C4XA 3ZWXA 3FTNA 5FA6A 4V0SA 2PZLA 4HEDA 2E4YA 3CBGA 4Q00A 4A8JC 1MABB 1OZHA 2QLJA 4MVJA 4X63A 1Q20A 3PR3A 5BMVF 5IEJA 4EO7A 4G01B 3SBEA 5AW7A 5T8KA 3ITDA 1FDTA 3T06B 2NW6A 1QIKA 2WV6D 3IPRA 4DEYA 3UJ3X 2GF0A 1RQ2A 2BGTA 4EGVA 2P2GA 3FOAA 3W3AH 3HVIA 5F7OA 5KSOA 1K6XA 5LPNA 1SXPA 2GLXA 1ZXLA 3BGVA 3VH3A 4DUZQ 1E18A 1CS4C 2PS3A 3I3OA 3SNKA 1H1TA 1JHPA 4ENTA 1DLIA 1EFDN 2W2VA 4R05A 5AXCA 3LLCA 1GEEA 3QKWA 3EA0A 5LDHA 3TQRA 2WJGA 3LUCA 4LDAA 1TU2B 1U28A 1VMAA 2YJTD 4KMMA 3Q3IA 5CLHA 4G0NA 5EP2A 4LFBL 1QHHA 4U39A 3DOEA 3ZBQA 1NVVR 2PO5A 2JJ2D 4IJWA 3CX3A 3JD3A 4RLSA 3C2QA 4U9UA 4HUQA 4RTQA 2X5OA 3C7DB 4NENA 2D3WA 2WU8A 4QX6A 1H69A 1ACLA 3GGDA 5JMTA 4HLDA 13PKA 1Q7EA 4XCXA 4AUKA 2IEZA 3Q1KA 5JFOA 4XEUA 4R71A 3UJ8A 3PQ7A 3T1QA 4HPJB 2W90A 5GM1A 1E9SA 2XYHA 2BDOA 3E70C 2H54A 4FS8A 3T7TA 1UPUA 2D2VA 4BEBA 2I4RA 4DLNA 3AU9A 5JZOA 3UC9A 1EWYA 1U1CA 4C56C 3JQGA 3LZDA 2C4VA 2PMDA 2WRZA 4F2WA 5JY1A 4LMRA 1EFTA 3ZVKA 4KBGA 1MIUA 1WJGA 2PWPA 1ENYA 2Q0HA 1VLMA 2QAGC 3S70A 2PRJA 2XTNA 5CG1A 3CVUA 3VR4A 4JI1Q 5I9MA 4QC2A 1Z5PA 3V3KA 1L3CA 2MGSA 1GAEO 3LYHA 2VHWA 4YBZA 1G1MA 1L5HA 4JCVE 4A3EB 3RANA 4JBJA 1UADA 7MHTA 2PUJA 1JEYB 2OLKA 3A4MA 3HCNA 2QT1A 5G1NA 1BROA 2VRWA 3GIWA 3NHBA 1XD2B 5AJTA 3ZCQA 4ZJZA 3RVQA 3EVFA 1U2SA 1THTA 5GADl 3HN7A 4OOEA 4LSZA 2H9AA 3ORSA 3U16A 1Y5RA 2XQGA 1E62A 1X56A 4FZ3A 4Q3EA 3BL6A 3ZHTA 4AN4A 3KZXA 2WMDA 1TM3E 5B1EA 2Q2UA 4ZQGA 3RVJA 1Z9BA 7AT1A 4IIJA 2R5FA 3JPWA 4MYTA 1T3LA 2Z08A 3ZW9A 2PEZA 4OBEA 3V6MA 4YASA 1Y6GA 3AINA 1HORA 4LHEA 2HN9A 3RVDA 4C20A 4BU0A 4EVQA 2KHIA 1X39A 1M6HA 3H2YA 4XVRA 1GUZA 3TGWA 3U37A 2JAHA 4US0R 4TM7A 1XXHB 2EW2A 1SDFA 1EKXA 2UUBQ 2FPPA 3KQSA 4X5OA 3C3BA 5EHQA 2WKWA 1I7QB 2OAEA 3DP9A 1Z75A 2QLTA 3GU3A 2KW5A 4P4NA 5C81A 1SXQA 3KVOA 1QWSA 2HXGA 2YZGA 1IMOA 1CX9B 4PGFA 1XEWY 1LLDA 3CUEF 1V7QA 3E4CA 3IB3A 4Y2RA 5DM0A 1NMQA 1BMQA 4EQNA 3P1HA 1JG2A 2IVZA 4APVA 2EE1A 3OA2A 3OZVA 3C6QA 3DLAA 1PZID 1C41A 4RY0A 3K9CA 4DC9A 5ES3A 1U9ZA 2V3CC 1PWXA 4D44A 4B3TQ 2C2BA 4P0QB 4GOPB 1EL0A 3RJMA 1P4RA 2E6KA 3N70A 3UHJA 5CBKA 4L85A 1YQEA 4Q7QA 4B09A 4Q9NA 3VKUA 2QRZA 3OIUA 2M2LA 1ZUHA 3K8AA 1ID1A 4KR3A 4RHXA 1PVDA 3I09A 2PGAA 4IQFA 1LQTA 1JG6A 1IUKA 4JVLA 4W7IA 5JCZA 4IGEA 3QZUA 4OEHA 3HP3A 1KP9A 4YJ3B 2FFKB 1F48A 1MRSA 1TGVA 2FSVA 2AUKA 3AV3A 2MJ8A 3UPTA 1W6RA 2HA2A 2HV9A 4URWR 3F97A 4FEEA 4I7EA 3MLAA 1V7ZA 2R7ZG 1EUZA 3UICA 1TS5A 4CHTA 2X0DA 3M33A 1UXOA 2WJJA 4EGJA 3MJHA 3QVMA 3EX7C 1EESA 1ZSNA 2NZOA 1VPEA 4B46A 3DFMA 4L5SA 5I3CA 1C0EA 4QVKA 3M2TA 4HDSB 1D2MA 2G0AA 3KTFA 4M2LA 1XXLA 2FFJA 1EDEA 4GM1A 2RG1A 3AJRA 1B9NA 4ZZIA 4MHTA 1WHSB 4MH0R 1SOAA 1MOQA 2B6HA 1TT5B 1ZW1A 4UY8C 1L1RA 4YECA 4BCCA 4NF2A 2NUTA 4MLCA 4TYMA 4P2CB 1KKMA 1MX9A 4H7JA 1HE1C 5EJIA 3E0QA 1MMFB 2BZ1A 1U2TA 3UC5A 4EH1A 1GSOA 1RAHA 1K2VN 3GRFA 3HCPA 3KXKA 2RH8A 3U50C 1JEDA 3BFVA 4OHMA 1ZGJA 3OD5A 4TKVB 3S1AA 4JB3A 4JFAA 4HJ5A 2ZBGA 3HUTA 3T5DA 2HK7A 2QVZX 3ESZA 4RWZA 3U2QA 3ZCTA 5FBLB 4FD2A 1EINA 2WD8A 4BJ1A 2PL3A 3HNRA 4OL0A 5EZQA 2V7BA 3HLKA 3CCMA 1UP6A 4RETA 5FBZA 5JI2E 4LF8Q 3R7WB 4ZYTA 1GG5A 4BS9A 4DR5Q 4O4LB 5IT0A 1GNLA 3OZFA 3NENA 2X4IA 4JLOA 4RK7A 5ICSA 1NI4B 4A0GA 5JPIA 1MB4A 3SMVA 4DLRA 3GTGB 1V71A 4BECA 4NBNA 1VQDA 3H5WA 2OILA 2WICA 4YDRA 4G1UC 2RHDA 1G6OA 4N0PA 4MUAA 3RVLA 4E15A 5L53A 3K6JA 3R5XA 5I9BA 5HIKA 5ICFA 3N2GA 1O6GA 2ZJ8A 1WUIS 2GA9A 3JARA 4A3MG 1N2OA 2JGDB 4W63A 2CB9A 5LA6F 1Q0UA 2E87A 3R5JA 4QPCA 3K1JA 4OHCA 1E2ZA 4R1PA 4XVQA 1UDCA 1Z28A 5IARA 5A5DA 1G5TA 1U0NA 2X19A 1KJZA 2XB6A 1TTQB 3F7OA 4G6ZA 1GQ2A 5F9HA 3SVZA 4O1IA 3LT4A 4M1SA 4B34A 2IHUA 2VIIA 1YTLA 4MVJM 4RKEA 4QDOA 1ONNA 3ZCXA 2ZUVA 3AUYA 1EXWA 1UR5A 4M87A 1UOEA 3X1KA 1WTQA 5DM4A 2AUJD 4Z7QB 3VC3A 3E8XA 2EJUA 2PL9A 4X1KA 1P80A 4BCDA 4TWRA 2AFIA 5LM3A 3GBPA 3MTAA 2G6BA 3H1TA 2EXXA 1UK9A 2PUEA 3ICEA 4DARA 1UFVA 2BUCA 1NOJA 3L2PA 1T1JA 1EDDA 2C35B 1VE6A 2AUNA 2YTVA 2G1JA 3DZGA 3EA4A 3JQAD 5E6SA 4GX5A 5EIBC 1N2HA 1HC7A 1TFUA 4CT0A 3DS8A 3QU5A 4HNQA 1EYAA 2EKQA 3VM6A 5J1SB 1NV8A 4J9UE 2RKBA 3FPKA 4QUBA 3H2IA 1VQ6A 3RZOH 3PX7A 1PU2A 4CKEA 4Z7NB 3TQYA 4M4SA 3RS8A 5CITA 4DDUA 3DAOA 4MWBA 4MLZA 4PU0A 1YI1A 3H1PA 4MKXA 5TQ2B 3V33A 1TYEB 3GDWA 4E4YA 2BCJQ 4YP7A 4EHKA 4CEIA 4ZZ1A 1G51A 3PSHA 4YHHQ 1VXOA 2WAAA 2WNSA 3ZNOA 5JXHA 4NCAA 1C4QA 4Y2UA 2O8DA 2GAFA 3OHXC 5AI5A 3FVTA 1QCYA 5H1SE 1A9QA 1X1DA 1A04A 3TW6A 3HXOA 5LMNW 3V4SA 2CVOA 2LVBA 3F46A 1KI8A 4RTOA 3W1EA 1E0AA 1QKJA 3KYDB 4KQXA 4MARA 1PGOA 3BVGA 4Q7KA 1I2AA 5CFPA 4KMUC 3OAAA 2EV9A 4F2PA 1TD1A 5E0OA 5JC8A 1D03A 2REQB 3VYVA 2OV6A 4XYBA 3NUQA 1XLWA 3VUFA 4EY8A 1M2NA 2YWGA 4C76A 1XAGA 4J76A 4O4LF 4DJDC 4X41A 4GX2A 2MSNA 3N2IA 2VZAA 1SULA 2D3TA 4XDZA 4PX2A 4XOIA 1IK4A 1P19A 2L69A 5FI0B 3AW9A 3FHOA 4GZMA 3KR0A 4RK6A 1JHYA 4M46A 3TLGA 1ZVVA 1IATA 2NO5A 3JZDA 1TAUA 2W6MA 1LJ8A 2H0RA 2ISCA 1NMXA 2VATA 4J1TA 4E32A 4F8YA 1K68A 3UT6A 5DNUA 1ULSA 1TTHA 2CT8A 3PO2G 1T1EA 1EWHA 5EJFA 1CFJA 5KRUA 3DHEA 3GEIA 3VGPA 3ZU6A 3CW2C 4HDOB 4HTFB 5JANA 3LW7A 3N76A 2O06A 4D4IA 1I80A 3PB3A 1XWIA 4FPXA 5JAZA 2WHQA 2ZJ7A 2BGLA 4PTZA 4II2A 4KN5A 1CSPA 3JZIA 1GZ3A 1Y89A 3P52A 3QWHA 3KLPX 4G8DA 1HDOA 1JU3A 1Z7GA 2ZE7A 1J39A 3CRRA 1CY6A 3R6DA 4KQKA 4L4SA 5LBUA 4A26A 3H2HA 1J1UA 4BQRA 3F2CA 1CQVA 1NSTA 4R8VA 4B84A 5BWOA 2G9QA 5FKAC 1T26A 3KLSA 2MT9A 1J5EL 5IVHA 2XE4A 4YP9A 1LRJA 3WQRA 3PUYA 2ZE8A 1A8IA 1UBRS 3AWIA 3C48A 1N2BA 3KB1A 5CIYA 4BNKA 3H2ZA 4R31A 5C7IO 1E77A 1Z4QA 4EB0A 4MYCA 3OLQA 3ZD7A 2WK1A 4G0YA 1M7GA 3E7DA 2DJGC 4LRQA 3VKVA 1JJAA 3OZTA 2C99A 1YZKA 2O6LA 1BE6A 4UE3S 2HV8A 3ZE2B 3I3CA 2VWHA 5BRJA 1IN7A 1O6BA 1M67A 2X1MA 1VLQA 4FFNA 3N05A 5BN3B 5JW6A 5FUBA 4MAMA 3GXBA 3ABQB 4ZQHA 5LP6F 1Y80A 3ORQA 2OO5A 5HY6A 2XT9A 1SHKA 2WFAA 3KYJB 2HPZA 3EGXB 1ZEQX 1YVDA 2NM0A 3VA5A 4YCNA 2HJSA 5CVVA 5FLXL 5KHOC 5KEEA 3BF8A 3U4AA 4LF7L 5J3BA 1SUEA 1UC8A 1A2BA 3LDGA 4YO8A 2E5FA 1HH4A 3RGGA 3K05A 2E89A 5DHSA 3V34A 4CIDA 1F7UA 2ZJBA 3VAZA 4CMIA 1M1NB 1ENOA 4C2AA 1G6ZA 1XZHA 4E5YA 3VKGA 4KBYA 3R7BA 3OLVA 4LJYA 3BCHA 4AJ4A 4YFYA 3HKBA 1VL2A 3IAM1 4S04A 4MDEA 1X9IA 1Y1WH 5A9TA 2ONJA 4CN8A 2ESRA 2MJLA 1IM5A 3WSVA 2P0AA 2O8VA 1XJQA 3O4VA 4PSAA 1FVOA 5FR1A 4QY7A 3A70A 2A35A 3NEPX 3MB5A 4EF6A 5LL6P 1WCYA 4X6XA 3KQKA 5JSZA 3V1MA 3W5VA 2R4TA 5TNXA 2GN6A 1PDWA 4HIOA 1DRUA 1W88B 4FS3A 4Q1VA 5K8IA 3EIWA 2PGNA 1O78A 1AKMA 3DOHA 4BNWA 3EQ6A 3QU2A 4QEKA 5TDHA 2Q9AA 3CLTD 3T15A 3DLBA 1ZUNA 3V4ZA 4EL5A 1G2SA 3LQYA 1QPZA 2VHJA 2EFDB 2AKEA 4QNNA 4IPTA 4DCOA 3KJEA 4ZCQA 1T1IA 1U5BB 2FB9A 4G5OA 4XWAA 5KTPA 4CLDA 2ZM6B 5CEJA 5F1YA 3CA8A 2A0KA 2O2ZA 5AVUA 2B5VA 3HCAA 1Y1PA 1YHYA 2A9PA 1LLQA 2VPIA 1MOPA 1HDIA 3H4MA 3K92A 3MUOA 2GA4B 2LIVA 3OIDA 3Q6IA 4KZPA 1EY0A 1CHPD 2F17A 3MWGA 4CKZA 5HGXA 4NOKA 2LMCB 2HK8A 3CLUD 2B4RO 2YC2C 3BAZA 3WGJA 4IPGA 3AM1A 3MXNB 4WD3A 4X3KA 1W9MA 4C1NK 1EJBA 1CDOA 1F5NA 2FNAA 3KOXA 3JD4A 1QF9A 2XDQB 4POFA 4B4WA 4UBNA 2OECA 3NS7A 3SSMA 2DTEA 1TU3A 4URFA 4KH0A 5JO9A 4CL2A 3H6HA 1U8UA 3CEPB 1WOMA 4I1VA 3QIAA 4DXDA 1JU4A 1XDDA 3FFTA 2WVJA 3NHLA 1M2JA 5CVUA 5AI4A 2BFNA 3DE3X 1JR3E 3TEJA 1B7GO 1BVUA 1UUFA 3HKSA 1RMQA 3RS4A 2JA8H 4EZIA 4DV5Q 2EYJA 2JCSA 4XPIA 1S9HA 1O94A 4QRHA 4F7DA 2VT2A 1DKOA 1E1LA 3A3YA 3OOYA 2O3TA 1EOVA 4R2IA 2ZRHA 3DL0A 3HI6A 4DNQA 4X3OA 4ZYVA 4NXMB 3VYUA 3LDAA 1YUNA 1E1CB 2CNKA 2MU1A 1N8SA 2EG9A 3OFND 1NXQA 4A3EG 1F7VA 1U94A 3HFRA 2OO7A 3ADCA 5JG7A 3QJ5A 2HSEA 1WABA 4NU5A 2ANCA 1H22A 2G5GX 4HZGA 4PLTA 5AI9A 3HXMA 1Z4LA 3NXSA 3BQNB 3R09A 4NS1A 4YUXA 3R0IA 3KV3O 3ZK9A 2LCQA 1O80A 4P3NA 1E63A 2IBTA 1FU7A 3UAYA 2Z1MA 2JEBI 1XLUA 3VZBA 1L5ZA 1ELOA 1B2TA 3DDCA 3AB9A 4HEQA 3A6PC 5K7SA 1SCKA 5I8PA 1GRNA 2O6HA 4RQUA 1YS7A 4CKWA 4TTAA 3AP1A 3OTWA 3NEAA 1C29B 2QTWB 2VQ3A 1G6Q1 3F2IA 4OUDA 3PF8A 3RKUA 4WOCA 4PSVA 5IWAB 2FMCA 1THMA 4WLVA 3F47A 2O54A 2FY8A 5CLGA 4L0DA 2G6TA 4L8YA 4K2AA 2OHOA 3QUSA 3X43A 2W2QA 2YXPX 3LX6A 4N49A 4ER6A 2ECKA 3NC0C 2C5GA 5F33A 4B3RQ 4DUPA 1DS6A 1I24A 4MV9A 3KEMA 3ZYYX 4TV8B 2F0NA 2JIOA 5ILGA 3WGZA 5PNTA 2JLYA 3A54A 2FDRA 1R6UA 2YYSA 1UDAA 3ZTWA 1FFDA 4JVNA 4BX0A 2R6CA 5ESWA 4NFYA 2OTCA 3TCNA 4CMIB 1DHRA 1KPIA 2H7XA 4U2CA 3UJAA 1KYQA 2CYCA 2HTEA 2JI7A 5T6MA 4BE7B 2PNHA 5C8ZA 1V1PB 2WR8A 3UNXA 2BTEA 3ID6C 2EP8A 3DOOA 4N01A 3PXDA 1V3QE 4CXMA 1KEZA 3MIZA 3HDTA 4XUCA 3PR2B 4R51A 4CLRB 1Y3FE 5H80A 1NE2A 3OPVA 1X0VA 1UKYA 2GAOA 2QCPX 4OXIA 3WDNA 3QU4A 4KNWA 1RRMA 4PQYA 4TN5A 1CB0A 3TNFA 1XTTA 1X9GA 2FZKA 1DJOA 3I1JA 1MABA 5G0UA 3PPXA 1RIIA 5AW4A 1W1WA 2AGVA 1SQFA 2JJ1A 3K32A 1KAWA 1GKHA 1N36Q 2I0QA 1MG5A 3LP5A 4O4HA 1KJYA 1MX5A 2FJ0A 2YZ2A 3IAAA 4KQGA 2Q46A 3CCUA 2CMKA 3VR5H 2GEFA 1JVNA 1TQHA 1Z5UA 2VXOA 2FN4A 2XA9A 3IE0A 1LACA 3QUBA 4KN9S 2Z2XA 4TWZA 5JNTA 2CK3A 2QN7A 1A2UA 5BWBA 4BY7H 2WYUA 3OZGA 3OZAA 5BVHB 5L4SA 5KNLA 1RHPA 3V7UA 2F0TA 1F8UA 1EGQA 1U02A 4CT4B 5ALLA 5HIJA 3GN2A 3HKEB 1AQYA 1L8LA 2FHPA 2G09A 3M9XA 3NAGA 5ALUA 5E6UA 3T4UA 3TI7A 5JASA 4ALJA 1KQOA 1VSTA 4M22A 3UHAA 3VOTA 3SSOA 3I01A 4IHAA 1P1FA 1HZBA 2CLIB 1E3LA 1F9PA 2B8TA 1IB6A 2KCTA 1T24A 1TD9A 1X7ZB 2FX2A 2PSHA 2R7AA 3C1FA 3E7WA 3MJDA 2P2SA 4DXHA 1CHNA 3Q0IA 4WNIA 3R9KA 2KPOA 4BBSH 4HFRA 4H0FA 3HUFA 3QVSA 3UUEA 2V1UA 1ATIA 4L5RC 1GKUB 3DL2A 4DR7B 5A4DA 3BBPA 5FPQA 1L7QA 2EJGC 4IJQA 1PFYA 1NJ1A 2B2XA 3B48A 4QJ5A 3OF3A 5GONF 4RDIA 1LTRD 1OBVA 5ER9A 5KVCA 5LU8A 4MSUA 3PXEA 5FUQA 1C2YA 4MO2A 2IF2A 1P2BA 3UE0A 3AOEA 2P5ZX 3FW1A 3T34A 5C4HA 3ND5A 1N5DA 4LY9A 4NMHA 4D4KA 4EF5A 3TZ6A 1TX4B 1G8MA 1M2OA 2W2NA 4NU0A 3H3VC 1QUFA 3AJ8A 4HS9A 3MTDA 3KZKA 1U7DA 2PHZA 1J6QA 1JIQA 4OGLA 2NT4A 5CT5A 3PFNA 1R6BX 1ZS9A 2GR9A 2A6HD 3GEPA 5CJJA 1FSZA 1ZI6A 1L1OB 3SHTA 3TBFA 4CU2A 4G5QA 4EI7A 3UBTA 1YMVA 3Q87B 4ADSG 1EP1B 1AGYA 2PE5A 2RGNC 4ZK9B 1E2QA 4PPFA 5AICA 1IG0A 3B52X 2AX3A 2ZB7A 2V1XA 3MWEA 1NHWA 4FKZA 1LF5A 2EU8A 4DR5L 3HCBA 3JQPA 3SF8A 4QWWA 1XZGA 3EBEA 1A3TA 1LB1B 4WZAB 5I7UA 3NR2A 1PTOF 3RLFA 3QA3E 5HF6A 1E1KA 1Z07A 2GAJA 2PBRA 1KDOA 4N3AA 3ZDQA 1RCFA 4BMVA 5U9CA 2L15A 3A6ZA 2J07A 4KQ6A 3RSCA 1NLMA 3DFIA 3WLHA 2P6OA 2ZUCA 3FBTA 3NASA 4XKJA 3VSCA 4EARA 3UG6A 4NIMA 1BWRA 1ULHA 2K5QA 3F7TA 4O4IA 3T41A 4EO4A 1ES9A 1ZR2A 2NU7A 1T4BA 1H9MA 3GMDA 4OXXA 5ALTA 3CEJA 4YQEA 1Y1VG 1PRTB 4GNXA 3C3LA 1C7ZA 3KQPA 3IKJA 1ZMBA 1SCQA 2WEKA 4UM5A 3PX2A 2R1TA 5I01A 1YR9A 2OP0A 2QQ5A 2Q28A 1C4KA 4PYOA 2GO1A 1L5HB 3ILYA 1ODSA 3FTPA 4YDQA 1Y6JA 2IOQA 4H3SA 3AMUA 3ANXA 2D2FA 4PYQA 2B9VA 4JBGA 5IT5A 2BFWA 1TEVA 4OQDA 1L5KA 1CZOA 1LWNA 2WT4A 3GUCA 1K5PA 1S5CD 4DLSA 1YAHA 4S1NA 2CXNA 4CEJA 3CBQA 3NUGA 3S2ZA 4CKBA 2PS1A 4HK4A 3RVRA 1HA5A 3OZCA 2OV1A 4HZIA 5AHOA 4X45A 4B3MQ 3PC6A 1BQ4A 1N2SA 1ZCJA 2YFKA 5JNVA 3B9QA 3T9CA 1Z47A 2PX0A 1WLSA 3VQTA 4K0KB 3GTPH 2CF5A 4OB7A 1ZN7A 3B1FA 3PCTA 5JYCA 4A15A 2K7FA 3GUYA 4NENB 3R0ZA 4OLJA 4JBKA 4A75A 1DQNA 4YHHL 4DMFA 3EISA 3FCXA 4AVYA 2ENBA 3D4DA 2W6ID 4J1TC 1G8ZD 3MK31 4ILEA 2WWIA 4MPJA 4BVJA 5EJGA 1P5ZB 2GNAA 4OFZA 5J2UB 2OCKA 2MSEB 1HX7A 1E2PA 2AG1A 2O0KA 3AEYA 2MR6A 3K8YA 4JJ8A 3VSDA 5ALYA 1KR2A 4Z51A 4F91B 1T5OA 2EDAA 3ZE0B 3WFZA 4A3SA 2Y0SE 1F6DA 3BYYB 3VHXA 4RFSA 1VQGA 1YR1A 1NXXA 3OCZA 4JVSB 5GJWC 3NHFA 3USZA 4EEKA 3AESA 3SDZA 1QVGA 1J8QA 1KDRA 2HSWA 3CLVA 2RKWA 4J0CA 1JUDA 1PW5A 4MROA 3PE3A 4LDZA 4MHOA 5EZYF 3RSQA 1XK7A 5IJ0A 1F2MA 4QU0A 3LTNC 2NZXA 3TTXA 2V54A 3DMTA 2FLVA 4E4TA 3LBNA 3B78A 2IC5A 3T7KA 4TKOB 3R20A 5H9VA 3ST7A 2HPHA 3TLCA 3VZDA 3J80c 4FF4A 1AK1A 1Z0ZA 4B3XA 2E21A 4LW8A 4IDDA 4AZWA 2E74C 1EE2A 1WCWA 2PH5A 4IN3A 1SXHA 2Q3DA 2YUTA 3FNIA 3HHEA 3K8OE 1XNRQ 2IOYA 2YWRA 3L49A 4U4AA 2H1SA 1QU2A 4MMZB 5D6NA 2ZDQA 1ZL0A 4ALPA 3CPSA 3N6RA 1ZMXA 4FMDB 3TM4A 3CZ9A 3C5CA 1R15A 4WKNA 3H3VH 3KALA 3CG4A 2LTAA 3E6AA 3NV7A 4X64Q 3SXJA 3W3AD 3K2BA 2KBNA 3EFHA 3WZLA 3WGNA 2QGQA 5LOVB 2R96A 2HO4A 1PEDA 5HKBA 3FETA 2I4LA 4QUKA 4X6UA 1T9KA 1AQJA 3FRJA 1HQYE 3FDJA 2QTMA 2DCUA 3G2PA 3DE6X 4K9MA 2IX0A 2E4XA 2VP3A 3GJQA 3RREA 2WB4A 1UOOA 4ETIA 2WU0A 3JQBC 1SC1A 2JJQA 1RKBA 3UVEA 3GJ4A 1JAXA 3L8FA 4ZAFA 4IFDJ 1NX9A 3FNBA 1PX2A 1QZTA 3CLHA 1HEIA 2C7QA 1EUYA 3OT1B 2VCYA 1L7BA 3KVYA 4BY1H 5H70A 5B5SA 4EPTA 1QHHB 2B2NA 1DZIA 1SQ0A 1JEOA 4RQTA 1NQOA 4HTHA 4P9NA 1TM2A 2YYZA 4A8PA 1G98A 1Y4UA 4PN3A 4D1YA 3KF6B 1PW7A 3MCWA 1VE3A 2AYYA 3OHMA 3CVVA 2N3SA 3HOUG 1K0UA 4HO1X 1SZJG 4JUBA 1AHPA 1AX9A 1NE3A 1EUDB 3MXNA 4KMRA 2XUPA 2YC4C 3EROA 4DR7Q 3FDFA 3KHSA 4TL7A 1B00A 1B8NA 3V4LA 5DM70 3FB4A 4KPUB 3E9CA 5F76A 2GT1A 3A4VA 1QDUA 1DTEA 4RBNA 3QPBA 4AZ0B 4S2UA 1SYFA 1QRAA 1G4HA 1NOKA 1S4QA 3GLHB 3HUUA 1NMFA 3NM6B 2JAOA 1R4AA 2Q5QA 4IMRA 4MYDA 4XFJA 1PYBA 2HNBA 3NHKA 3Q3EA 4H15A 4JODA 1ET6A 4K46A 3OEHD 4K6KA 4LOLA 4J7CA 2IZ5A 3AFGA 3SQLA 3UYKA 4B3FX 3A5UA 1EK1A 2ZIGA 4CKBB 3V4PB 3T8YA 1U3FA 2ZT7A 5KPJA 4QYIA 1ZU4A 1NTGA 2ZXRA 1ECGA 1V8PA 1XTQA 2VG8A 2CKZB 2VYVD 3AF1A 3TN2A 4Z9YA 3V8NA 4F4DA 4AKEA 4CVNA 1DC7A 4YJ3A 4MUXA 2OV3A 1OZGA 5AHXA 2AKAB 4GM0A 3QXSA 2OCXA 1UMBA 3JSAA 3BGIA 4HAWA 2VUMB 1TLLA 4GN3B 3NVMB 1E6KA 1CUGA 4KIFA 3H0CA 3A7LA 3OTHA 4JX8A 1QOQB 5LKRA 1U2DA 1OTHA 4FGKA 3S1RH 4DA6A 2V59A 3OBIA 1IRIA 3RYIA 2X9NA 5JMWA 1V9LA 2C5AA 4H7KA 1JALA 5HZHA 5B30A 3U5ZB 3CCEA 2GDJA 2CHQA 4L22A 3QOLA 1M5UA 3RYIB 5ICCA 5IXSA 3D8TA 3LPDA 2KCMA 4LF6L 2EJBA 2FZVA 4GFDA 5CDHA 1C9NA 4XB6B 4D3ZA 1MJEA 1GSHA 1YVPA 4HQ6A 3RC8A 4EHBA 1EIZA 2AZ4A 4A3JG 1JQYD 3L7LA 2BGNA 4ZYLA 4LOKA 1W59A 2V4MA 3HC7A 2VTVA 3HABA 5I8WA 2EKBA 4FE4A 1EZ6A 1Y6RA 3CVYA 4DV0B 4IZ8A 4DV2B 3FHWA 2H1IA 2QDKA 5D1HA 5LXTF 5IT9c 5CA1B 4JBNA 5JD5A 2OL4A 2FUCA 1GDHA 1ZJZA 2OYSA 1D7QA 1FUIA 2QQEA 3R2TA 2RGXA 2EXZA 3GX1A 3IA7A 3ZIAD 1ZW6A 1J0AA 2HQBA 5CHYA 5F9MA 1GPNA 5LQKA 1EB8A 1GD1O 3UMMA 3GF4A 5U1PA 3URMA 5ENZA 1TZJA 1AQLA 1BXRB 1YQWA 2XSZA 3N28A 5EJ6A 2Q3HA 3D6FA 3RYHB 5LP6B 1A9XB 2I5HA 1IYVA 2RSLA 2UZ1A 4GX1A 4LMAA 4OUKX 2DPYA 2VYVA 3AUSA 3LX4A 4NEGA 1Z0JA 1QF7A 4AJPA 5BOSB 4RORA 1QIHA 3IUJA 3N1UA 2B3TA 1T43A 2A58A 3TQSA 2ZJRA 4MYSA 5DNVA 3WC4A 3HEAA 3W2DA 2D2IA 1RXUA 2D06A 2OOSA 1WBDA 1SM4A 3A04A 5BR4A 4JV5B 1D2AA 1YZTA 2PSSA 2XA2A 4G4JA 4MPRA 4ALKA 3SZLA 2XSCA 3F74A 1GGFA 2QG9A 3HLYA 3TRIA 3E27A 3GCDA 4J0IA 5AJVB 1L0BA 4I99A 5CA0F 4P3PA 1C8VB 1KMQA 1OFTA 2ZTHA 3TQFA 3DXZA 2QM8A 4CM4B 3QWNA 4PZ9A 1B1ZA 1MAWA 1ZH4A 2YINC 2CQAA 1WBBA 2DHQA 2ZXPA 1XMQQ 4KPFC 4YXFA 2C95A 2ZRAA 4A6PA 1T0IA 3MMPA 4GF5A 4UCWA 4G8BA 1XJ5A 5DASA 5H3CA 3WK5A 5KNBH 1OGJA 4RAOA 3NHHA 3RTBA 2IH2A 4LXGA 5MFPA 4B3RL 4I4TA 1A88A 4OA5A 4IKPA 3VC2A 3ROZA 4O4JA 4CJ2C 2NVTH 1FFCA 3OPXA 4WACA 2ID0A 3JQQA 4KLAA 1QWYA 4EG0A 4LK1C 1DBIA 4LS3A 4ND1A 5KZMB 2O8CA 2FGJA 4COOA 1SBBB 2TMYA 5FUYA 2WWRA 4ZVUA 2SNMA 2WKSA 2HU8A 3E3MA </