3FVQA

Crystal structure of the nucleotide binding domain fbpc complexed with atp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
348
structure length
343
Chain Sequence
TAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEGIVFPAALNADGTADCRLGRLPVQSGAPAGTRGTLLIRPEQYSLHPHSAPAASIHAVVLKTTPKARHTEISLRAGQTVLTLNLLSDGISAVLHLDGPALFFPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into how nucleotide-binding domains power ABC transport.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Hydrolase
molecule keywords Fe(3+) ions import ATP-binding protein fbpC
total genus 87
structure length 343
sequence length 348
chains with identical sequence B
ec nomenclature ec 7.2.2.7: ABC-type Fe(3+) transporter.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17845 FbpC_C_terminal FbpC C-terminal regulatory nucleotide binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.450 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fvqA02
2.40.50.470 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3fvqA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fvqA01
3VMFA 1E2HA 2IYTA 3A1VA 4WOPA 2ZJYA 2R44A 3CRVA 1AKEA 4XVRA 2FWRA 1XPUA 1N25A 5FOVA 2G0NA 4LWZA 2V7QD 4LHVA 1ZRHA 3RC8A 1KOFA 2Q3FA 4HAUA 4XD7A 1IN4A 1IM2A 2QUZA 5A4JA 3HYTA 4HZUA 1OH5A 4PC1A 2GJAA 2JLRA 1IY1A 1Z22A 2OLKA 1Q1BA 2WJHA 2OXRA 4QBFA 5JS8A 1E9SA 1XX6A 4BEBA 1OT3A 2BWJA 2ZANA 5KOYA 2ZRFA 4AKEA 3BFVA 3P20A 4DLYA 1ZM7A 1KO4A 2REOA 4OQFA 1EX7A 2A5GA 3BB4A 3U4QB 5FR2A 1E0KA 1YR8A 2GDJA 2P6NA 4LDJA 4LJ6A 4AG5A 2IL1A 2EFCB 2V6IA 3KXIA 2JJ1A 3OIWA 2NG1A 4MDEA 4URXR 1FW6A 2C03A 2FV8A 5JSZB 2R6FA 4A2WA 3HP1A 3KKMA 5HCNA 3TGPA 1YZQA 3ADBA 2J87A 3IUYA 4GZMA 2MMCA 3AKDA 3RDPA 2ERYA 1JQJC 4NPHA 1ETUA 3ASYA 5BQ5A 3G82C 1LF0A 2BBSA 5P21A 1SGWA 2V54A 4M9QA 1IXSB 1DS6A 1Q1ZA 1KK2A 2IEZA 1QZXA 4LC1A 3RSOA 5HCIA 2C99A 5DI3B 1W49A 5HKKD 2ZYWX 3AVQA 2WJJA 2ZVPX 4GFDA 1U0HC 5BYKA 2PJZA 4FMCB 1VG9B 2F9LA 1FNNA 2QENA 3K9NA 1V5WA 4AK9A 2CVFA 3P27A 2N42A 2PH1A 1MRSA 1Z83A 4WXRA 3TK1A 1RW4A 2JLSA 5LBIA 1JI0A 2WSMA 1E2KA 3I8XA 1KZGB 3VKWA 2MSDB 2XGJA 2VP9A 2GAAA 4KU4A 4QGAA 1Z2CA 1FNMA 3IQWA 4DB2A 2KB0A 4LHWA 4MYUA 1SKYB 2IS6A 4MYCA 4PPNA 1XTSA 4XWKA 5FL7D 3T5DA 2ZS8A 2WMOB 3DOEA 2J7KA 4V0OA 1T0JB 3W3ZB 3NH6A 4PPGA 1P3JA 2YZ2A 3RWMB 3U61B 4B44A 2WZQA 5G40A 3FMFA 4Q9KA 1VYVA 4XSHA 4H1VA 4IJMA 5DYIA 5CIQA 1SVIA 1Q44A 3LRPA 4LOAA 4MH0R 4CIDA 4M1WA 3MAAC 2JJ2A 2ZI7A 3LO5A 4Q21A 2J7PD 3CRQA 5EZ6B 2HEIA 1A1VA 4RD2A 2BMDA 4X8MA 2NO9A 3EA5A 1CJVC 2KBFA 4JVMA 5CLLA 5FPSA 5FUYA 4BZPA 4C0JA 1H8ED 3LQRA 3IPYA 3CRRA 4US1R 5DH9A 4HZIA 5KTYA 1F60A 1ZCBA 2GKSA 3L0SA 4US0R 2QBYB 1GL6A 3ZVMA 1IQPA 4QL3A 5JRZA 3EWAA 3PVSA 5AUNB 2OCPA 4L5BA 4NU0A 1R2QA 2JCSA 4TSFD 1PJRA 1EXMA 4DDVA 1OF1A 4MKGA 4JLAA 3M6AA 2ZIAA 1G5PA 4HDOB 3R7WA 3LV8A 3LXXA 1OFHA 3C7KA 4DLVA 2X19A 1P6XA 4HZUB 4P3YA 121PA 1N6LA 4DVGA 5FTMA 3BE4A 5EE9A 2DCUA 2Z4SA 2F1IA 3SZRA 3JZAA 4PO8A 1ZC3A 2OG2A 5JJKA 4MRPA 4NP6A 1ZNWA 1RRGA 5FPYA 4RD6A 5AR1A 4P0TA 2ZRLA 3C41J 2Q3MA 4PSVA 5FPKA 5H68A 2CVHA 3FHTA 2TMKA 3GJ7A 4TZ6A 2J9RA 3BH0A 1F2UB 4C0SA 1LB1B 1E2MA 1ODFA 1X8JA 3QPUA 4G0NA 4M1YA 2ECKA 3KUCA 3LBIA 4HI0E 3EIHA 3I61A 4C0KA 1BKDR 4B2LA 1WE2A 4TQ9A 4U02A 1XD9A 2XZPA 3OEHA 1XZPA 3KTAB 4HB4A 3W6OA 1YZKA 3NDBB 4MYHA 4R98A 3CB4A 1OIVA 2BIFA 1E2DA 4PX9A 5K8LA 1EFRD 1QRAA 1N6KA 1OKKD 1G8HA 1S3GA 1HUQA 4IFEA 1ZUIA 4HLQB 3ZIAA 3D31A 4Q1CA 4ACAA 2I1QA 2F3RA 4Q9LA 4LYAA 621PA 3TW8B 2RGCA 4FI3C 2EQBA 4FMBB 3RNLA 3T1QA 2C95A 4CDGA 2FZ4A 5TMPA 4TMZA 2O0KA 2ZS7A 4UXJA 2YWFA 2O0JA 4TLDA 2FF7A 4LRWA 1RKBA 4E03A 4OYHA 2NO1A 1P72A 3IIMA 4V03A 1N0WA 2WJVA 4QG7A 3GJ0A 1P7CA 3AVYA 1OB2A 3ZD7A 4M0LA 2GCPA 3KKNA 4JLJA 1E3MA 1UPTA 2ZR7A 3AF0A 4HAXA 2PCJA 2VQSA 2YWHA 3RS2A 2YOHA 4BGDA 1RIFA 4CEIB 5CLQA 1LTQA 1YR6A 2DWOA 4YC7A 5KU1A 1NY6A 5EE1A 1D6JA 3ZH9B 4XD7D 3P26A 2XNSA 3FVQA 4A6PA 2QTFA 2XXAA 4KVAA 2H92A 5AUPB 2C8VA 4FMDB 5KPJA 1G9XA 4M2LA 2Q9BA 1IAQA 1XCPA 1E9BA 3B60A 2Q6TA 2RCNA 4FMDF 3EIEA 4NHOA 3U3RA 1KMHB 1G5TA 5EXSA 3A8TA 3B8HA 2FE4A 3VR6A 2X1VA 3REFA 4V0NA 1D8TA 1E1QA 3AEZA 2B21A 4Y0VA 1AQYA 1FUKA 3GJ5A 4MRNA 3AVVA 3K0CC 1LS1A 3CZPA 2G1KA 2ZYVX 4BLTA 1W4BA 5EXPA 1OYWA 3BXZA 1JR6A 4I1VA 4JBXA 2BKEA 4YLGA 4B76A 1MT0A 3QKRB 5A5GA 5KNCA 1ZIPA 1E2IA 2IF2A 4BECA 1BYUA 3ZIAD 1FOEB 4L9SA 2VRWA 2XEXA 4OQLA 4TLBA 2ZUBA 4XTCS 2D62A 2XTMA 1NRJB 1GILA 4KBGA 4QJ3A 2CE7A 5FBQB 2GF9A 2HXSA 4ZDIA 2H18A 4AD8A 2ZJ2A 2XZLA 4Q1FA 4E22A 5KNBA 1XRJA 1ZMXA 4IHQA 2IYRA 3L0IB 5HR5A 1I4DD 3R8CA 4A15A 3GLIB 5CJ2A 4M1TA 4LSGA 3QXHA 5KDOA 1NBMA 4QHYA 5FOUA 5DHFA 2NO7A 2V55B 2XITA 3RS3A 4PHTA 3ZQ6A 1OXTA 3HR7A 3A1TA 1KI6A 1DAKA 1MKYA 3DZDA 3HDTA 3HJNA 4P31A 5CB8A 3GD7A 3MJRA 4KITB 2DR3A 1VECA 4GI7A 2BM1A 3B1VA 1VIYA 2QPTA 3D6TB 4KAXA 2ZRIA 3THOA 1DAFA 4K8OA 5HKKA 1XD2B 1G3MA 4TLEA 3B9PA 2HYDA 1IN6A 4YXWA 1C1YA 4O3MA 2AHOA 1K5GA 1TPZA 1U8YA 2F1JA 3LFUA 1G8GA 2FSHA 2IYYA 3Q3JB 4D0NA 2ZI9A 4D6PA 3Q72A 4Q4HA 4BRWA 4DBLC 2A5DA 1NVWQ 5HZKA 1GIAA 5B30A 4Q7JB 4Z8YA 1VDZA 2K5UA 1JPNA 3ONWA 3FB4A 3UMFA 2CL6X 3D7MA 4K81B 2D4HA 4LBVA 4QHSA 4DT1B 1G3IA 1VIAA 5D3MB 2NGRA 3VU9B 4FWIB 3THXA 2VL7A 3H1TA 2WVJA 1NBME 4LHYA 2VLIA 2WJIA 5HTKA 3QG5A 4FN5A 2CJWB 2A30A 3BBPA 1TNDA 2OFOA 4PPFA 1NP6A 2REXB 3AVOA 4CEIA 2FNAA 3NH9A 5DI3A 3CR8A 4NYJR 3MCAA 1HT2E 1TF5A 1W5TA 5CIWA 4MGZR 1CR4A 1DELA 4PHGA 3SBDA 3U2QA 5J4KA 1E9AA 2A5JA 4UXHA 3TBKA 2JGNA 3KQHA 1N3BA 4QNRA 2QI9C 3HR8A 5CK5A 3TJZA 4IKEA 1UFQA 5CB6A 4YMSA 4W5JA 1UF9A 4QFMA 4RZUA 2WWGA 4BLPA 1PLJA 1SKQA 2GNOA 2GJKA 1G64A 3MD0A 2WMNB 1XWIA 1Z8FA 3KKPA 1FP6A 1S8FA 4DB4A 2YOFA 3T34A 1VCMA 5FL7A 2QG6A 4GPTA 4P4UA 1W0JA 1GVNB 1UKVY 4ABYA 2FA9A 1E0JA 5JWHA 3W8NA 2D2FA 2R6DA 2ZR0A 3WXMA 1MO4A 1YKSA 1ONBA 2QT0A 3B1XA 2BKUA 4RY2A 1R7RA 4RD1A 5DI9A 1RRPA 4S35A 3GJ6A 4BWYA 3U6KA 1ZCAA 4EIWA 5GJWC 2P2LA 1KSFX 3U60B 1NIPA 1X1SA 2R9VA 3A4NA 1TUEA 2IXGA 4RD3A 1T0HB 1U81A 2BHRA 2C9CA 2OAP1 3M0EA 1DEKA 3CNLA 4D2IA 1CR0A 1E2LA 2VHTA 2QQ0A 3AF2A 3W6NA 1B0UA 2HXYA 3OIYA 4BE7B 4ZIRB 2MSEB 1KAOA 1CULC 1AA9A 3BGWA 4Z1MA 3OF5A 2HJVA 3IIJA 1EGAA 4ZCMA 3QY0A 4IXMA 2WKRA 4DSUA 1W4CA 3W34A 3LY5A 5CITA 2SHKA 1G6OA 1QDEA 1RE0A 1KI2A 1EFHA 3VNUA 4EUNA 4V0ME 1NJGA 3QBVA 2DFTA 2ZRJA 1TADA 4KO8A 2IA5A 2WWYA 2ORVA 1U94A 3R7WB 2QZ4A 2AXPA 3Q5DA 4KVGA 3OIUA 4NL4H 4C0LA 1HT1E 1RYFA 1NNEA 1KAGA 1CIPA 3ZD6A 5KSYA 4GSYA 1QG4A 3RS0A 4KSBA 2GEVA 3K0SA 5FTJA 4BUJA 2JLVA 5C1BA 1S2MA 1KGDA 3QKUA 4YXWD 1KK1A 1W36D 1UKEA 3KL4A 1XD2A 3LLMA 4A2QA 2GXAA 3E2IA 4LCBA 1HV8A 3RRZA 4BZXA 3U7HB 5AWFC 1F2UA 1Q3HA 5IT5A 5TARA 4QGGA 1XD8A 4LHXA 1CR1A 1W36C 1JB1A 2X2FA 4FXPA 4JVNA 5CM9C 2GRJA 3WHLA 4DIEA 1M7GA 3FFBA 2IYQA 1WB9A 3DM5A 1KSHA 1ZD1A 3VNVA 1E6CA 1OSNA 2ZE8A 1GAJA 2QN6A 1PUJA 1U8AA 1YZTA 3QKSB 4EFNA 1KY3A 4CEHA 5D3MA 2WWFA 1F5NA 3THWB 3THXB 3O47A 4FINA 2W58A 4M21A 4MRRA 721PA 2BEJA 4ARZA 2N46A 3EAQA 2WKQA 4E5UA 1DAEA 3PUXA 4Q02A 3CUEF 3EZ9A 5EE3A 3X1XA 4RKEA 3B1ZA 4ON9A 5BN5A 3GLFB 1SXJE 2ZJZA 3CF6R 5B64A 5JHGB 3ZDQA 5FBLB 3K9GA 4JLNA 5IRCD 1CRQA 3GEIA 3SBEA 2GBLA 4LUCA 1Q12A 2RB4A 5SZJA 5L3QA 3U44A 4E09A 1TUIA 3WBKA 2IX3A 4D25A 1N5KA 3M1IA 4NZYA 3A36A 4HB2A 3TSZA 1ZYUA 1FUUA 1E1QD 5LB4A 3PFIA 2P6RA 1YJ5A 4LJ8A 3U6BA 4ESHA 4GL2A 1RVDA 3AH8A 4UQOA 2ZJAA 5EJEA 1T8UA 1EX6A 1ZNZA 4P4SB 2YVUA 1IOZA 1W2GA 1T5LA 5KSPA 4D81A 4D4JA 3QXJA 1II8A 2PX3A 4TMWA 2O5VA 4CRWB 4TTPA 1S9DA 1GZSA 1ZVQA 1Q1QA 4CT4B 2OLJA 1Z63A 1KNQA 2YOGA 3EIQA 5KUTA 2AK3A 1JXMA 1MABA 2OSBA 1KI9A 3NEYA 4OK5A 1ZJ6A 2W0SA 1DVRA 3G0HA 4B71A 4W5WA 2W6JA 1GFIA 1G1MA 2ZRAA 4TL6A 4EJSA 5C2JB 4D4LA 4G5SA 3RABA 3K8YA 4JKIA 5LPNA 3AB3A 1QBKC 4LBZA 2Z83A 3D3QA 1YRBA 2WWWA 4BFWA 2A9KA 4ZIRA 1KMHA 3UG6A 2WIBA 3LD9A 1IY0A 1IONA 2VYFA 3HWSA 1FMLA 2XX3A 2C9YA 3RRNA 4DEXA 4WZBE 2ZRKA 5JHHB 1G5RA 2G77B 2I3BA 2IUTA 1KI1A 3LW8A 4A8JC 5FH9A 2VBCA 1Z08A 2G88A 4ESVA 1KKMA 1KO7A 2EW1A 1OHHD 2G3YA 2VP4A 4J0QA 4PZZA 3X1ZA 3EW9A 4DDUA 3PR1A 2NZJA 3B9QA 4IVPA 3TH5A 1WBBA 1Q3TA 2QE7D 5AJZA 3ZZ0A 1RPZA 3SS8A 1OB5A 1G16A 2QMEA 3HU2A 4NCIA 3B7GA 4LC0A 3PUZA 4U7DA 4LZZA 1HTWA 2VEDA 2REBA 4DLXA 1E9FA 3SOPA 1OLOA 3AUYA 2E87A 3EWSA 3K0AB 4C3ZA 2HF9A 1MRNA 1SHZA 2DBYA 1VCOA 3L0PA 4HLDA 3K09A 1CJMA 1J2JA 2RAPA 1X86B 2PT5A 2ANCA 1XEWY 3GFTA 1KY2A 4QRHA 2UKDA 1NMYA 4B48A 2Q9AA 5IF9A 2QNRA 4D4KA 2R8RA 2VH5R 1P73A 3MFYA 5FPHA 5J4VA 5H8WA 3GLIA 4C0BA 3CZQA 3CX6A 3FHOA 3TQCA 521PA 3NHAA 1UBEA 1Q57A 2F55A 3A1SA 1R0XA 3O8RA 1ESMA 3GLGA 3DZ8A 5DNYB 3U5ZB 2ZEJA 1QHGA 2CL0X 1NVUQ 5TY0A 2IYWA 4C30A 1QHNA 2ATVA 1CBUA 5J4HA 2C98A 2QU8A 4Q1DA 3AKYA 2ZJBA 1VKJA 2XNDD 1SXJC 3ADKA 3PUVA 2HYIC 3FFAA 2OCYC 2CLDX 1EESA 2OT3B 3QUSA 2WBLC 2AKAB 1X8KA 3RS4A 3TIFA 1YZGA 5HZHA 2FSGA 1UJ2A 4OHVA 2X2EA 1COWA 1WBDA 3B5JA 3DM9B 4O2RA 1KIMA 2J0VA 3WRYC 4G5OA 3KKOA 4JLKA 1MO6A 3VFDA 4I4LA 5L3QB 3U44B 3WMEA 2O8CA 3W90A 2GILA 1E2NA 1MH1A 3GLFE 1XCMA 4GP6A 3OEHD 1E0AA 2FSIA 4KV9A 4RFSB 3TUIC 1KZ7B 4A8JB 1SVWA 1XXHE 3LDAA 3U3JA 3KB1A 1IXRC 3QXSA 3S1AB 1GNQA 4PTLA 3T1OA 2GJ8A 3NBYC 5JJLA 2FGKA 3JVVA 1T4GA 1L2TA 3OIVA 2BDTA 3TVTA 1Z0FA 2H57A 3LLUA 1Q0UA 2EYUA 4ZI2A 4HLCA 2ZI5A 3I1FA 3LBHA 4U5XA 4DIDA 4KYIB 4Z8XA 4XWAA 4IOLA 3LXRA 4LJ5A 4HDQB 3BERA 4CVNA 2JDIA 4EQ6B 5CJPA 1N6IA 3CF2A 3WBJA 2O8DB 4JLVA 2EWWA 1O87A 221PA 4OQXA 4IXNA 3CIOA 1GL9B 4HUQB 4NE2A 1K6MA 3U3OA 2F7SA 5C46F 1W7AA 1CF4A 3KXLA 2NPFA 2GCNA 2OBLA 2QROA 2R6CA 1HYQA 1HH4A 5H1YA 4EDHA 4W9MC 2QE7A 1R0WA 1SQ5A 1W0JD 4B3CA 5GJCA 1R10A 2UVQA 3EC2A 4IFBA 3BB3A 2RGDA 2WV9A 3WRXC 2ZQ5A 1IJEA 1JAIA 1T3SA 2ZSAA 1YE8A 3R8FA 4Q47A 5JI2E 2OXCA 2DWQA 1DAGA 1W1WA 4HDCA 1XMIA 1HQCA 1KDTA 1PUIA 2HDNB 3MUFA 1JPJA 3V9PA 2RGNA 4RJLA 2J7PA 5KSZA 3CW2A 1KI3A 1BS1A 5K8IA 1GG2A 1FTSA 2I4IA 1Z6YA 3ZLJA 1TQ2A 1NY5A 1NKSA 2H5EA 3VKGA 2P5SA 2LKCA 3AVWA 1XZQA 1X6VA 1N5JA 1E0SA 1S3SA 3DKPA 3E1SA 1R5OA 2OCAA 3OESA 2QEQA 1DAIA 4TTQA 4A1FA 3SYLA 4L15A 1GM5A 1AS3A 4R2HA 1P2UA 2O8FA 2QPAA 2NZ8A 1XMVA 3K9HA 4DHEA 5L3SB 3TQFA 4Q00A 4Z51A 1E1RA 3TW4A 3GLGB 2O8BA 1L4UA 3OFNA 3IQXA 3SQXA 4HATA 4NCHA 1NSFA 2BBWA 1T91A 2Z0MA 4B6EA 1S96A 1ZM4A 4XVQA 2ZUCA 2GZDA 2XNDA 4KBFA 3BH7A 2JLXA 3FPAA 3LW7A 4JS0A 4F91B 4KFUA 3KUDA 4IVQA 3I4LA 3WMGA 1WQ1R 1LV7A 3GFOA 3FGNA 3FKSA 3HPRA 1NN0A 2WOOA 1P9NA 4GT1A 3ZVLA 2J5XA 5JWOA 3T06B 4FCTA 5FOXA 5FFMA 4II7A 1E79A 5EE5B 2FPKA 1UM8A 4DC9A 2PZEA 1Z28A 4FW9A 1IN5A 1NF3A 1WF3A 2ZRDA 1N0UA 1KO5A 3SC3A 1F2TB 1SVOA 2W2TA 5BWMA 4PAMA 3VR3A 1KDOA 1RRFA 2VIIA 4CEHB 4TMXA 1E2PA 1AZTA 5A0FA 3S1AA 4QM7A 3ZVRA 1VPLA 3F3YA 4HAYA 3VAAA 5BW8A 3H4MA 4LPSA 1KI8A 3K0FB 2WJGA 2GHIA 2ONJA 1CS4C 4ARZB 2R65A 3DDCA 2XB2A 3KKQA 1EWQA 1NL3A 3ECCA 3MWYW 3HU3A 2GA8A 2Z5FA 5DIFA 4B73A 2XAUA 3PV0A 3QE0A 3GCGA 5AUQA 4PAQA 3BC1A 2B7BA 4YQFA 3EZ2A 4TMTA 2ZJ5A 3GLHB 2VP2A 2ZSDA 3FMOB 1XMSA 2BM0A 5KO2A 3A1UA 2KE5A 3MRSA 4TLCA 1EWRA 4BZQA 2OFXA 1RRCA 1X1RA 2AWOA 2QP9X 1KSGA 1W0KD 1XTKA 4JKYA 1YZLA 3MGCA 2ZRPA 3MWLA 3LVQE 1SVLA 5JCPA 3C4JA 4TYNA 3H2YA 5EP4A 1M6NA 2WAYA 1TF2A 4PO9A 3O8DA 3VR4A 1G19A 2RGAA 5JLJA 3RWOA 5D3QA 2RKOA 4CZ2A 4JJKA 3LA6A 2R2AA 3B85A 3V00A 1G7TA 1T8TA 3FHCB 5DO9A 4DDWA 2XSZA 5J4YA 3W9YA 4B33A 3RANA 2LKDA 2VTKA 4DLWA 1XTRA 5B2ZA 2V9PA 3I5YA 3EPLA 1A82A 3IEUA 4JLPA 3W6PA 4BFUA 1Z5ZA 4OQMA 1P9WA 4KODA 5C4GB 1N0VC 4RCZA 1GKIA 3HYRA 1E69A 1YR7A 4JJZA 4OI2A 1ZP6A 3T61A 1XEXB 3KJGA 4OI4A 4LY6A 5TVKA 1U90A 1ZAKA 2QMUA 2ZI6A 4TYPA 1HA3A 4BFTA 3EC1A 4Q19A 4ACBA 2IXEA 4RZXA 4BEJA 1XFAA 5TDHA 3HU1A 1RJ9A 4HYYA 2O8FB 4IEIA 1U9IC 3OFND 1I4LD 1WMSA 4XOIA 1GDDA 3OZXA 4AI6A 5JZVA 1YR9A 4LYFA 3AQ4A 4YMTA 5GVSA 4TN1A 5AJVB 1OXVA 3UG7A 1QHHB 1JNYA 3GQBA 3VX4A 2CLSA 4YONB 3U7GA 4TQUS 1D5CA 2HCBA 2GBLC 4LJ9A 2CBZA 4OI0A 4V0KA 3VTKA 2FX3A 4URYR 2OBMA 2CL7X 3AKCA 1YU9A 4OQNA 1M8PA 1R5BA 4URWR 2IBMA 3ZZUA 2F9MA 1FMJA 2IF0A 2O0HA 5LD2B 2QAGB 3FTQA 3K0EA 2ZU6A 1TQDA 1S1MA 2YC4C 5KNDA 3AGPA 2GCOB 2WWHA 2BBTA 2YJTD 1OJLA 4F38A 3QEJA 1G21E 1NI3A 2FSFA 2QPOA 2G0TA 4GOXA 2HT6A 4IW3B 5F9FA 1M7HA 3VKHA 3CWZA 4DCTA 2ZJ8A 4QGFA 4TZ0A 4OHWA 1JR3A 1KO8A 1EG7A 2H8KA 4EAQA 2R62A 2WIAA 1WCV1 3MWJA 1TX4B 3BD9A 4EPRA 5LD2C 1CEEA 4CEJA 2XB4A 1D2EA 2GESA 4C0AC 2FDCA 3B6EA 2PMKA 1E94E 4G1UC 1W47A 3DO6A 2JDID 3I32A 4M1SA 3X1DA 1UDWA 1U9IA 2ZI3A 4AURA 1VTKA 2V3CC 2NMVA 1RC8A 4LGMA 1Z06A 4MGYR 3B13B 1L4YA 3C15C 2B8WA 2WPDD 1K8RA 1ESNA 4PC7A 3UANA 3UWOA 4I1SA 4LBYA 1K5DA 4OI1A 3WNCA 2ORWA 2NO6A 4UJ5A 3RRYA 2W83A 3UWKA 2ZE5A 4XWOA 3LNCA 4PHFA 1Z6GA 5L3VA 3EPJA 3VR1A 1I4TD 2HV8A 4A8JA 4B34A 5FTLA 4GDFA 2FH5B 1XXHB 3GJXC 1TQ4A 3ZS8A 4IRUB 1VYTA 3VQTA 4A0RA 3QKRA 1M7BA 1XU4A 3R20A 2BCGY 4L9WA 4Q01A 4BFSA 3BIFA 3SI7A 2ASEA 3WP1B 3TSWA 1DADA 5IK2D 5AJWA 3DMDA 3NBFA 3OE7D 5GJVC 1IHUA 2F43A 1EFTA 4DLZA 3GLIE 2WSSD 3Q7PA 2C04A 5SZKB 2ZXUA 5E7IA 4PANA 2ATXA 3EZFA 2GXSA 3L82B 1QVAA 1LNZA 4QC2A 3IBGA 1XMJA 1TF7A 2QSYA 1X8LA 2QGNA 4F4IA 3PUYA 2CNWA 3FYHA 3DOFA 3QF7A 1ZNYA 3OHMA 4HAWA 2GJ9A 2KSQA 1XEXA 2LWIA 3CBQA 3AVXA 1DOAA 1TQ6A 1M74A 1YHNA 5DSZA 5F98A 2G9NA 2FJUA 3C16C 2OZEA 1Q20A 1E79D 4PSAA 3QIAA 3W5JA 3L8YA 4TYYA 2QTVB 1U0LA 4KSCA 4D4MA 4NYJQ 2J0UB 2XJ9A 2AKYA 2QGZA 1CP2A 4Q1EA 1NVVR 1J99A 1TEVA 4RZ3A 2DFNA 1G8FA 1N5LA 2JA1A 3TR5A 4NYMR 4EKDA 1CR2A 4V0LA 3TUJC 4ZDJA 1EFRA 1J90A 1AZSC 1OKKA 3PEVA 3UPUA 3RHFA 4C4PA 1ZU5A 2AFIE 3JZMA 4JMPA 3CLVA 1NLFA 3QVVA 5H70A 1ZD8A 3SJBA 3C5CA 1S4QA 3CH4B 4RVCA 4YMWA 3ZJYA 1AIPA 2NO0A 3U3KA 3LBNA 3M4YA 2PLFA 1YRAA 2MSCB 5DLQC 2ORIA 2UZIR 4URZR 2V7QA 3WY9A 2FZLA 3K09C 1QHSA 2Y8EA 1QG2A 4M1KA 4C7OB 1Z0KA 4HAZA 4JSYA 4GNKA 1GRNA 1VYUA 2QQEA 1TU4A 2GCOA 1VMAA 2IYXA 4Z54A 1E4YA 1AK2A 1G3QA 1CTQA 3EARA 1Z0JA 1W0KA 3GEEA 1Q21A 1P75A 4HB3A 5KSOA 2CJWA 4OHXA 4C2UA 1S1CA 1H8HD 1OFUX 2PZGA 3CONA 2O8BB 4F4JA 1EFCA 3FKQA 1ZM9A 3LX5A 1G17A 3QG1A 3I62A 1S9HA 1E2QA 2Q9CA 1E9EA 4N3NA 3NIBA 1HEIA 1KI7A 2NPIA 4PXAA 3UMSA 3ZZTA 1G3UA 4JL5A 1TTTA 2JJ8A 5FTNA 1IBRA 4AKHA 4PFSA 4M53A 1WP9A 2EWVA 4NYIR 1OPXA 1II9A 4TT3D 4Q4JA 1KK3A 2FU5C 1YZNA 4V0MA 1G7CA 1UKYA 5DN6A 3NTUA 5DGXA 1Z3IX 4DCUA 2NIPA 2IUSA 1DBSA 1N6NA 1MO3A 3RYTC 3J81k 3V4RA 4C9BA 2OE2A 4PAOA 4TL7A 4KFRA 4LI0A 2GZAA 3FOZA 1XBTA 2HT1A 4C2TA 2CHGA 4AKGA 1A2KC 3OAAA 5FI0B 4DWJA 4DLRA 4BLRA 4DRZA 2FPMA 1OFIA 2YV5A 2BOVA 4KCGA 5FBWB 4YDSA 2HLDD 4Q5IA 4MRVA 5CYOA 4HLUC 1NMZA 2DFKB 4LV6A 2IWRA 3WNBA 4IVRA 3A58B 4KXFB 3B1YA 3SYKA 4LV8B 2J45A 4W5HA 5FUWA 2QY9A 2RGEA 2XXAB 2P67A 1WXQA 2WSSA 3KJEA 1KYIA 2A2ZA 4V02A 4B75A 2F43B 5BYJA 4CT5A 1PZNA 2QMHA 4KLZA 4LV5B 4NBSA 4MDFA 3NBXX 4HB0A 4A36A 1VHTA 4MGKR 4PHHA 1OIXA 1JAHA 3SQWA 4TYWA 3QOFA 5FTKA 1ZINA 3EASA 2ODNA 5EQTA 3RVBA 1JECA 2BMJA 2IEYA 1OXSC 5JMTA 1XEWX 4G5RA 4TSFA 3ND8A 1E2JA 4JBWA 3QXCA 4EPXA 1GUAA 5EXTA 1PLLA 1X3SA 1P2VA 3E70C 3MMPA 4M9SA 2GAOA 3REGA 2ZRCA 4FMCF 3AP1A 3K0CA 2P3SA 1DTSA 1G18A 5CDFA 1CU1A 1IN8A 2BVNA 2ODEA 1YZUA 2FFBA 2ZSFA 2FMXA 4M1MA 5J47A 4QXAA 5EP2A 1XCGB 3KQKA 1BIFA 4F92B 2OAQ1 3TRFA 2A78A 3PQCA 5CM8B 2JASA 3QEOA 5F9HA 3PIRA 1Z6AA 3K53A 1L7VC 1FTNA 1AS0A 4UNSA 1JR3E 3SN6A 1U8ZA 1V43A 4NCNA 3T35A 2KWIA 3MLEA 4Q9IA 5TV2A 5FI1B 3FMIA 1W36B 4LYHA 4LPKA 3Q9LA 3I72A 3DL0A 4DZZA 1YQTA 5FPTA 3A4MA 4QKQA 4TMKA 1W2HA 1VHLA 3NKVA 3I3SR 4JZKA 3N5CA 2P5TB 2ZRHA 1G6HA 1N6PA 5DE3A 4QBIA 4MITA 2QT1A 1GL7A 421PA 5KYKA 4K46A 3CO5A 4OK3A 1H65A 3H84A 1FL9A 3PEUA 5FL3A 2AR7A 3K70B 4NDZA 4Q18A 4WIAA 2ZM5A 3TE6A 4OL0A 4D26A 3QNUA 4C0HA 3QKSA 1XTQA 2HF8A 3K9LA 4DCNA 1NLZA 3QVUA 2ONKA 2YKGA 5M04A 2GVZC 4IDHA 2RMKA 1JALA 1KJYA 2L0XA 3L8ZA 3NC0C 4YMVA 2BJVA 2V4ZA 4B3FX 2KJQA 4B3BA 4KLNA 1C4OA 2DY1A 3CX7A 5EUMA 2D7DA 1FFHA 2BC9A 3BFKA 2OBNA 4LX0A 3KXKA 2P0EA 4OJQA 2F1RA 3A1WA 2VHQA 3CNOA 5GJBA 3U3MA 5FBRB 1O3YA 2PT7A 2OV2A 1ZM2A 2LCFA 4Q4JB 2ZRBA 2FOLA 3AP3A 4MKIA 5JEEA 4D80A 2C78A 4JT4A 1ZBDA 1S0UA 2AL7A 4M1OA 2J1LA 2CK3D 2W00A 3KZ1E 4ILEA 4MUBA 1E99A 2ZROA 2WWIA 4DEYA 4DT1A 1R0YA 2J0SA 3DHWC 3SFVA 2YINC 4DSNA 1AQUA 1Z6XA 3FDIA 1G20E 4CGZA 2Q3HA 2NQ2C 4OHYA 3TVDA 1II8B 1GTVA 3MG9A 2PZFA 2AD1A 1OV4A 4LBWA 3TR0A 1XTJA 5C18A 2QRNA 3DEFA 2CMKA 4YMUA 2W6IA 2N1BA 1SVMA 2D74A 4MYTA 2BBOA 3A37A 5G41A 3MWKA 2FEOA 3CX8A 2WJYA 3O8CA 1TAGA 3BJIC 3GLHE 1KJZA 3SR0A 5ELXA 3IBYA 1U98A 1L8QA 2QAGC 5SZHB 3BB1A 2J0QA 2QP3A 1WDTA 1NG9A 4IEEA 5JI3E 2QAJA 4GBMA 1ZNXA 3QPWA 3ADDA 1KHTA 1JXOA 3CNNA 4Q9JA 2F3TA 2GETA 2UZ3A 1Z47A 4G3XA 1NVVQ 1BYIA 1FX0B 3KQNA 5JBQA 3A6PC 1R6BX 3JVUA 4PPQA 4DCVA 3R9IA 1Q1EA 2XOKD 3THYA 3FE2A 1G291 1ZUHA 1TL7C 1FZQA 3WP0A 4B35A 4POAA 5SZIA 3SHWA 4MKHA 1D2MA 3LQQA 1XXHA 2A5YB 4PQYA 3W8RA 5FBVB 1R4AA 1AJEA 1TEXA 3F8TA 4R7ZA 3TSOA 1KI6B 5FR1A 2BCJQ 4RFVA 5EZ5A 3UXMA 3GFPA 5BN4A 3UIEA 2IT1A 1QHXA 1HQYE 4XVUA 4L8GA 1COWD 4AKIA 1DG3A 1Z0DA 4DKXA 3KQLA 2I1VB 4TLAA 4EPWA 3H0KA 4URUR 1LW7A 1BH2A 1G8YA 2WM9B 2DFLA 4B3DA 2ZE6A 4JLOA 3AUXA 1U2RA 4ZKDA 1NN5A 5KPDA 1XEFA 1UAAA 4XH9B 1W48A 2V6JA 3IKJA 2CK3A 2ZRGA 3ND9A 2PEYA 4PO1A 2IS4A 2ZTSA 4N0DA 1SZPA 2PEZA 4Q4HB 4A92A 4WXPA 1D9XA 2FPLA 3EG5A 3X1WA 3NEJA 2R6GA 4DLTA 5CK4A 3MSXA 3GJ4A 4Q1BA 3T15A 3QENA 2ZSBA 5EXXA 3RAPR 1AGRA 3IIKA 4IDQA 3T12A 4Q03A 3SJAA 2CCKA 4DUGD 4I1OA 1P2SA 3VU9A 4WZAE 1Z29A 2D06A 4S2EA 3IHWA 4MQBA 1BMFD 1N6OA 1SVKA 3AF3A 3HPQA 5JFGA 1NN1A 1KO1A 3BH6A 3ZS9A 1GITA 2BEKA 4JLDA 4LJ4A 5KDLA 4CW7A 3ICQB 2B92A 5FUVA 5LB2A 4BLSA 4A82A 4LJYA 4QOSA 3IO5A 4FWTA 1N6HA 3F5FA 4I99A 2DB3A 3ETLA 2YHSA 4BFXA 2ZAMA 2ZRMA 4TYQA 1PVOA 1HE1C 4GOKA 1GOTA 2OM2A 3UATA 4YDHB 3UKDA 1BO6A 1VG1A 5E7JA 1QHYA 3SNHA 1GKUB 4UNNA 1UBFA 2KBEA 3GMTA 3KB2A 4JYBA 3VHLB 5F3WB 2OFWA 3DMNA 1NBMD 2V8OA 4C7OA 5CDFE 4WA7A 4RFSA 3BAFA 3UMRA 1CXZA 1I2MA 2ZRNA 2XJ4A 1HE8B 5F2EA 1UBCA 2AFHE 4TQAA 2Z6VA 4FD2A 1OHHA 3KFVA 4JL8A 2P6UA 2C2HA 4Q48A 3DVLA 1PV4A 2Z43A 4A0HA 5B57C 2PL3A 2QORA 3E5HA 2CDNA 1KK0A 2VPPA 4A2PA 3X2SA 2CXXA 1R8QA 2PMDA 4FCVA 1ZD9A 4NMMA 3BFXA 1P2TA 4Q7MB 4KFTA 2E9SA 3CM0A 4AC9A 5E95A 2EFEB 4UKDA 3Q5EA 2B8TA 5DYGA 1M2OB 1B23P 2AN9A 3NHBA 4XSGA 3VR5A 2WTUA 5HE9A 4JYCA 4TT3A 1XNJA 1AM4D 2W6JD 4A0FA 2GXQA 3VX3A 1OH6A 2O8DA 1VG0B 3AVPA 2H7VA 2XOKA 2DHRA 3OEED 5AK0A 1JJ7A 3L43A 4PZLA 1SULA 4EPVA 2GF0A 1G4AE 3A4LA 2CE2X 2XTZA 3IPXA 5IHPA 5JRJA 1XF9A 3AKEA 3SU8A 1DO0A 1T3HA 2H17A 4GP7A 1FX0A 4P4SA 2V1UA 2A5FA 2VP5A 1GSIA 2J41A 2HLDA 4ASUD 4RZ2A 1XPOA 5JEDA 3CPEA 2RGGA 3EZ7A 1OYYA 1T3LA 1ZM3A 1Z2AA 3QI2A 4O2LA 2VHUA 2AWNA 4QNMA 4BFVA 4GMDA 1FPMA 2G6BA 1G8PA 3KJHA 1XJCA 2ODWA 4ZDKA 3GJ3A 3RS5A 4QJ4A 3VHXA 4DLUA 3WHKA 1LS6A 2EYQA 1G3RA 2QM7A 1DO2A 3CF0A 3GEHA 2EFGA 2C9OA 3IHLA 4IDPA 2YWGA 2IS1A 2FGJA 4DCSA 2HUPA 2J59A 3I8SA 5L3RA 2JJ1D 4F7WA 2A7QA 3EPKA 3NVAA 3PCRB 5E3HA 4E07A 3ICEA 3RS7A 4KHZA 3R9WA 2CCGA 2IUUA 2GK6A 4WW0A 1P5ZB 5HPYB 1GWNA 1J8MF 1P60A 3BORA 2JIZD 1E1RD 1WRBA 4ZDWA 1NIJA 4F4CA 5G3ZA 1M34E 5G53C 5L3SA 1VG8A 3FMPB 2ZVQX 4HAVA 2D2EA 4PQFA 3RSLA 1HURA 3N2EA 1KI4A 3THWA 1XP8A 1BOFA 3PITA 3QBTA 4O0MA 4B47A 2RHDA 2ZETA 4CF7A 2J46A 2VSXA 5E7MA 1GNPA 4PSKA 3AGQA 3EZ6A 4DLSA 3GPLA 4BLQA 3PUWA 2AD5A 4ZCIA 3IDQA 3QQ5A 2FN4A 4AG6A 1Z0IA 2B7CA 2IK8A 3U7FB 2IXFA 4JL6A 2Q0HA 3WYAA 4B32A 4Z1MD 1SXJA 2GXUA 2O8EB 3P4YA 1ELOA 4JLMA 4M9ZA 3GJ8A 4JVSB 3KJIA 4B6FA 1NSTA 1UDXA 3SHFA 3ZVNA 1RFLA 2WICA 8OHMA 1MR3F 4HLUA 1VCNA 5UKDA 3IEVA 5FOTA 1IY2A 1ANKA 4XIGS 2DYKA 2GK7A 4L16A 3CWQA 1E2GA 4WBSA 5FOWA 4PC3A 3I92A 2OHFA 2D3WA 1R5NA 1DG1G 1R0ZA 2RGNC 2OESA 3RRMA 1IXZA 1R8SA 3P1JA 1G4UR 2QP4A 1ZU4A 2Z4RA 3CKLA 4G01B 4JVLA 3TKLA 4ZCLA 3AVUA 1NMXA 5EP3A 4D0GA 5J5CA 3LH5A 3DKVA 3NC1C 4NTZA 1I2DA 1US8A 4OK6A 3PJRA 1Z0AA 1KDRA 1A5TA 3Q85A 1CJUC 4NH0A 4IOJA 1EK0A 2QTHA 5L8VA 3NBZC 1UKZA 2IWHA 4QM6A 4RSGA 4QBHA 4MGIR 4A4DA 4IOKA 2ZU0C 3T5GA 4JLBA 3Q7QA 3ZGXA 3QPVA 2ODBA 5AJXA 1U99A 2HJGA 3OAAD 3GLGE 2WAXA 2F6RA 3DPUA 2R6AA 4NONA 4TTRA 2KI5A 3WYGA 2OUKA 2QM8A 1E9CA 1PLKA 4RD0A 1SKYE 2CEAA 4B3XA 6Q21A 2VSFA 1F48A 2AX4A 2YC2C 3CR7A 2IYUA 3K70C 3NDPA 2JEOA 1Q22A 2ZE7A 1NJFA 4X8OA 4BQSA 4RD4A 4B43A 3U7EB 3K0AA 5K8TA 4HUQA 1OH8A 2C77A 1N6RA 4H1UA 2YWEA 4AYXA 1SXJD 4MRSA 1W4RA 4M4SA 2JIZA 4IDOA 1IJFA 4BRUA 3O8BA 4JT2A 2FFQA 1UEJA 5EUQB 5IDVA 1E2FA 1Z07A 4URVR 1AS2A 2VHCA 2BJWA 5GVRA 2QRZA 3IO3A 1QHIA 3KX2A 2GEDA 3K70D 3KQUA 4LHZA 4GMXA 2RH5A 4CYMA 1P62B 4B2IA 4ZO4A 5JSZA 3THYB 2YYZA 2W2XA 2OILA 3IGFA 2JLQA 1T5IA 4AYTA 3VR2A 2JLZA 1AKYA 1YVDA 2IHYA 4GZLA 3SE0A 1KKLA 4G5QA 1VCIA 4RCYA 1OFTA 5DHAA 1JBKA 1J8YF 4LK2A 4P4TA 4Q9HA 1DE0A 4BASA 4JIMA 1JR3D 4WVFA 2PJRA 4D82A 5AUOB 2RHMA 4WAUA 3LX8A 3TAHA 4DJTA 1T6NA 4Q4LA 1JEDA 1P9RA 2ZS9A 1BMFA 2H1LA 4KFSA 4IDNA 4ERNA 1KTVA 3CRMA 3G5UA 4RKFA 1XPRA 3TNFA 1JQLB 1W46A 1RYHA 1E2EA 3RC3A 3CPHA 3TMKA 3AM1A 3SFZA 3AF4A 2QAGA 4Q4AB 2VSOA 2O8EA 1CKEA 4NYIQ 2MMGA 3B1WA 2FG5A 3P32A 4BFYA 3P4XA 4HEJA 3TLXA 4A9AA 1J70A 2ZPTX 4MUAA 1LY1A 2IYSA 4O25A 2NOAA 3SJCA 3AVTA 4BLOA 1P61B 2WHXA 2IS2A 1E98A 1G7SA 1ZW6A 4A0GA 3C5HA 4UJ3A 2W2VA 1LF5A 5BN3A 4NYMQ 4TMVA 4ASUA 4P32A 4B2PA 2G83A 4BFZA 1NG1A 2GTPA 3QF4B 4Q1AA 4C0QC 5JWRA 4JBYA 2QA5A 4CEJB 1FQKA 1E4VA 2GWHA 4QGHA 3CPJB 1KNXA 2OCBA 4UNQA 2EFHB 2E1RA 1E32A 2XSZD 4B74A 1E96A 3KDSE 4QHTA 1A7JA 2PLRA 3PEWA 2JLYA 3ADCA 3GLFA 3I5XA 4B3GA 2EVWX 5JECA 3W3AA 2GVDC 2WPDA 4Q66C 1US8B 2ZITA 2ZUDA 3GP8A 4OHZA 2VF7A 3SEAA 4EQ6A 2XZOA 1DARA 2C5LA 3SDZA 3PG5A 3QSYA 2CNWD 4ZKEA 4AWXA 2WKPA 4P33A 4W7SA 1CJKC 5TB5A 3EXAA 3NWJA 2IYZA 4NCJA 1F2TA 5J40A 4ZV4A 1Y3AA 1D2NA 2PCLA 3QXXA 1MV5A 4HUTA 4KYUA 2ZREA 5CYPA 5B58C 4PR0A 2VF8A 1NVXQ 2WWXA 1FP7A 3QKTA 4US2R 3L0OA 1G7RA 1OE0A 4F93B 5IK2A 2JLWA 3H86A 2RGXA 1LVGA 5DISB 5C4MA 5EE0A 3W5IA 3C14C 4I81A 1II0A 4GRAA 2CCJA 4L4UA 3LVRE 3T1VA 1MABB 4IOMA 2QL6A 1EFUA 2CLCX 3GLHA 2J3EA 3T1TA 2EU8A 4PC6A 4X8HA 4EJSB 2HCJB 4ZPXA 4D0LB 1NN3A 2ANBA 2FFHA 4H9GA 3IILA 5AJYA 3PEYA 3ZYCA 2H16A 1NKTA 3B2EA 5LDDC 1QF9A 1KSJA 5G3YA 1OXXK 2DWPA 2ZYTX 4G5GA 2QMOA 1KMQA 1DPFA 2DPXA 4TL8A 5FUXA 2O52A 3BWDD 1W44A 3PENA 4U00A 4R2IA 2F1HA 2GJSA 1Z6TA 3UK6A 2JATA 1CJTC 3AV0B 3LAWA 2NTYC 3Q8XB 1UBGA 1D9ZA 2J0UA 2W6ID 5JJIA 2PBRA 3KTAA 2VP6A 4M22A 4UNRA 1OXUA 5KDDA 4PQRA 2GZHA 4FIDA 4QJ5A 4OKSA 3EA0A 1H8HA 4Q7KA 3SYNA 2CHQA 4MKFA 2JLUA 3LWNA 1JJVA 3C8UA 3NG1A 4M8NE 3KFXA 4PZYA 1ZIOA 1OW3B 1TMKA 4LJ7A 1JEEA 4UNPA 1QVRA 3I73A 4XJXA 1A4RA 2OO7A 1GRQA 4OJKA 2QSZA 4R9UC 1M1YE 4X8LA 3U4QA 4KJZA 4WZ6A 5DN6D 2C96A 5JS7A 5KHOC 1U0JA 2WOJA 3R9XA 2YNMA 1FQJA 1CLUA 3V4FA 1A2BA 4Q4AA 5K8UA 4HSEA 2IW3A 2OEPA 4TWZA 5EP1A 2GEUA 2B6HA 4KI0A 4LYJA 4AYWA 2IHBA 1RJ9B 1ZUNB 4TL9A 3FWYA 1N5IA 1OIWA 4DSTA 5TXGA 1OH7A 2AK2A 1TU3A 3NXSA 2RGBA 4DXAA 1QHHA 1F6BA 4DUGA 1XB2A 3B82A 3N70A 3BK7A 3QF4A 3RLFA 1AGPA 2IYLD 2V1XA 4DSOA 3K0FA 1E9RA 3OE7A 4I1UA 5E4FA 1UADA 821PA 3ASZA 3QJYA 3EPHA 4AIIA 3PXGA 2IYVA 1GP2A 2ZSEA 3L2OB 3BOSA 1LFDB 4BPBA 4M9XA 2FFAA 1F3OA 1G41A 1SVSA 2X77A 4EJSC 3EX7C 4EPYA 3AP2A 1MOZA 1SXJB 4EFLA 3K1JA 4A6XA 2G1JA 4ITRC 1XTIA 4UXIA 1XDBA 2ZI4A 3B78A 3WMFA 4Y0AA 4FCWA 4OBEA 5BXQC 1GNRA 2CHVA 2BMFA 2O8CB 4LJAA 4EPTA 4R71A 1AN0A 1W4AA 1RZ3A 3WYFA 1P4SA 2A3RA 3TAUA 3X1YA 1T9HA 2VO1A 1KJWA 4QBGB 2ZAOA 3BRWD 5JCZA 4Q7LA 5ANRB 4N0EA 1E9DA 3N2IA 4AY2A 1N2CE 1MO5A 4JSTA 4GOJA 3ZQJA 5FOSA 2AXNA 1WA5A 2BMEA 2P65A 4ZI3A 3FKSD 4NKRA 3WNDA 5J4LA 3TUZC 1XJQA 1DAMA 1C9KA 1ZC4A 2IC5A 1IN7A 1UEIA 3MJHA 2FEMA 4PC2A 4XTRA 4EFMA 1GKYA 3D8BA 1KDPA 1NLYA 1SHKA 4N1AA 2ZR9A 1W5SA 2PX0A 2D7CA 2VP0A 5GADl 1Y63A 2W0MA 4NCKA 2JJ2D 2EFDB 2ERXA 2BV3A 1H8EA 2VHJA 2XTNA 2VA8A 2ZJOA 2QBYA 1DAHA 3BS4A 5HE8A 2ZYUX 4MA4A 3SJZA 1GRRA 2X8AA 3F0TA 4DDTA 3CH5A 1XJ0A 3CRW1 1J7KA 2Q21A 1CRPA 3OEEA 2JAQA 1HY3A 3AF1A
chains in the Genus database with same CATH superfamily
3KPWA 3X43A 1YA6A 4WOPA 4E14A 2ZJYA 1E6MA 3MYRA 1D0IA 1G8AA 4RPGA 3REQB 4E5KA 3CRVA 3U16A 2WDPA 4F46A 3MNFA 1XQYA 1N25A 3OA2A 4GN3B 3WYDA 4LWZA 1I2ZA 1UZLA 1JDJA 1ZRHA 3BWEA 4H1HA 1NUSA 3D8RA 3U6BA 4MQ5A 3RC8A 1P6QA 1T0UA 2GYWA 1JILA 4YAEA 4EHBA 1DQYA 5JZ9A 1QMPA 4HZUA 3HGMA 3KXDA 3DZJA 3WK8A 1IY1A 1Z22A 5AI9A 3HSSA 4EYGA 2XQIA 1R9JA 2PFKA 3Q8WA 1OFGA 4B6JA 2WJHA 9ATCA 2WF7A 1UBUS 2HA2A 2G9UA 3PS9A 4UHDA 5C5EA 1C3EA 3W2GA 4FOPA 4K1XA 1TO2E 5DNFA 3CZRA 3DONA 2UYYA 4HQLA 1FXUA 4COOA 3DOCA 4IH1A 4A3BH 1ZM7A 4FN4A 5JO0A 3HXMA 1YR3A 3SX0A 2P41A 1B8NA 2DLNA 2OR3A 2B0CA 3EGEA 2YXPX 4RY0A 3V8EA 3U4QB 4TKUB 1KZ9A 1DWQA 2JK1A 3AETB 2Z6QA 3PQ3A 3AK4A 3T38A 4JI4B 1JP7A 1LPAB 1XPJA 1BMQA 3K6JA 4LDJA 1FFBA 5LDGA 3AMVA 4WXHA 2DUUA 2V6IA 4GYKA 1TVKA 2NG1A 2PG3A 4AUNA 1VOTA 3FM9A 3RVLA 4NBRA 3TFWA 4N18A 1BS2A 1DDOA 1OBVA 2C3UA 2XCQA 4A2WA 3T13A 3QVTA 3TGPA 2IBTA 3EPRA 5DGHA 3RDPA 1EG2A 5EIOA 1JQJC 4CM4B 3BN3A 5BQ5A 3DBLB 3IVRA 2QW1A 4CL8A 1LF0A 1LNSA 3M5WA 3CF4G 2VQ3A 1E1TA 1WPQA 2QQ5A 2W2MA 3ZU4A 1ZAYA 1B76A 3EJ6A 1R18A 2WHPB 1TYEB 1WVIA 4I55A 4JP8A 1H2ZA 2ZJPA 1I80A 1P9OA 2YHBA 3AVQA 3MAQA 2ZVPX 4H6WA 2WNHA 4GFDA 4MVXA 4WFJA 4NIMA 1DONA 4FMCB 3NTKA 1C9YA 1J09A 4HFRA 1FNNA 3I4NG 3NNDA 4ZZ1A 2K33A 1EZ4A 5GWXA 1W29A 5EHQA 3P27A 2PH1A 4AK9A 3RYCA 2GEFA 1H6CA 1JHMA 1Z83A 2B9EA 2BTOA 2JIPA 2JLSA 2JFXA 1G6KA 1QH8B 3NHUA 2ID7A 4OSOA 4RF3A 2WSMA 3UK1A 1PYBA 2OQRA 4YX9A 1PO7A 1KDCA 1UBOS 3TDKA 1D2GA 4K8IA 1L7OA 3DLPX 3I8XA 4X6XA 1MLDA 4IZHA 5GQSA 4NXMQ 1KP9A 1L4EA 2MSDB 2Y3IA 4DGSA 4QGAA 2N55A 1KBOA 3CTPA 1E7RA 1RWQA 4HY3A 3AI2A 1NI5A 1YBAA 5LP6A 1TYZA 1N33Q 2WC1A 2P27A 1SKYB 2JI9A 4MYUA 3D1VA 3T5AA 1ISJA 5FL7D 4CKXA 1RL2A 1KH1A 2J7KA 2XIJA 2PQAA 3DAFA 3K96A 4V0OA 3NH6A 3QLVA 4BAGA 1Z2OX 3MUNA 5KYWB 4B44A 2I5HA 4XCQA 3G5AA 5AKHA 2IIVA 3E6AA 3O8LA 5HM8A 5ITZA 5ALQA 2FN9A 2Y1OA 1RLTA 4XSHA 2XD9A 4AUEA 4AX8A 5E8JA 3GTGB 1XLTA 3QU7A 1Z4QA 4MH0R 2OXPA 4GS5A 5EVJA 3MAAC 2IUFA 2X9NA 5I5GA 3T3DA 1BDHA 2Q2QA 4UAUA 4Q21A 3DLLA 1Q81C 4LXHA 2J7PD 3MS7A 1BQEA 3CRQA 3MIIA 4I6EA 4AYXA 2G6TA 3C45A 5IJ9B 2J4XA 4QYIB 2IDJA 1KVQA 3V2GA 1NT2A 1QKJA 2Z5LA 2K5HA 1CDDA 3U48A 2JAXA 2BAGA 3IPYA 2XUOA 4HNQA 2BR3A 2P69A 2P6PA 5DH9A 3RU2A 5BWOA 5J1SB 5KTYA 3TJMA 4IUYA 2EJVA 3L0SA 4UMDA 4LF8L 4G81A 3O38A 4HDRB 3W2HA 1L1QA 5E8RA 2EWMA 2HRDA 2NO4A 4UDOA 2JFBA 1IQPA 1RYYA 5EMJA 3RIHA 3EWAA 5JRZA 4P0QB 1YIAA 4Z86A 2OCPA 5ALJA 3Q7RA 4WKPA 3H99A 2SEBD 3JCZA 3T8YA 3OF3A 3ZJVA 2ZIAA 3IOCA 3JAML 1MX5A 3PFBA 1JXAA 3NJ4A 2EIFA 1ADFA 1V6CA 2F52A 3P2EA 1U4PA 2VK2A 3WAJA 4DLVA 4DR4B 3WZMA 2IP4A 1N1DA 2I55A 1JKFA 1Y6JA 2VG8A 4HXFB 4PLHA 5BSTA 1GTRA 3JSXA 3BE4A 2QDXA 2ZBPA 1R74A 3M2PA 1L5ZA 4OYLA 2R00C 3RBZA 5HM6A 2QJTA 4II3A 4E2ZA 1QQTA 2CNBA 3H2KA 4DV1L 1PRYA 1QO9A 4C7MA 3LUJA 5A05A 1RRGA 2OKGA 2PQ6A 5FPYA 1JFFA 3OUZA 5AR1A 5FV7A 3S29A 1XWEA 2VTBB 3H1GA 5LWHA 2Q3MA 5DB4A 1Q5PA 1GGKA 2OB2A 3A9UA 3LSTA 2JEYA 3TSSA 2CFIA 2J9RA 2TMKA 3H5OA 3IELA 4ZCRA 4FYHA 4XB2A 4B81A 2C29D 2NVQB 1E2MA 2VRCD 3QPUA 4G0NA 5A62A 2GHRA 1OXKB 4MPRA 5F4ZA 4D56A 4CMAA 4PFKA 3K4QA 3V1TC 5KQSA 3LBIA 1XZJA 3ET4A 1YJWA 4LFAQ 4E6IA 1QLJA 1JU3A 4GMFA 3L6CA 3EIHA 3IR6A 4D3ZA 3VJKA 4AJHA 5C3MA 4PRKA 4B2LA 1DEXA 5D3MB 2NUAA 4P86A 3PU6A 2W6CX 4M60A 5FQOA 5C3WA 3N6XA 4B3HA 4H4DA 3W8DA 4ENUA 3DMTC 1ORRA 1XZ8A 2Q2NA 3BCSA 3PIDA 2JI6A 4HB4A 2Z6AA 1RBMA 2INGX 2H4FA 4U3JB 1MA3A 2XT6A 3BRCA 4XZ3A 4K0RA 4Z5XA 1DGQA 4R98A 2ES2A 2UAGA 2QTMA 2YVQA 4LJZC 4W1SA 2Y27A 5IM5A 5K8LA 4ZANA 1GD7A 2G36A 1QRAA 3NHMA 1HTLD 2Z3ZA 3EQ8A 4U2CA 1YNJC 2R6R1 4IZOA 4EMBA 4UD6A 4JBMA 2Z5GA 3CNBA 1ZUIA 2V5AA 3DAYA 3D31A 2D2VA 3I2HA 3HB9A 1M34B 1KFCB 3O3OB 3PI6A 2IJ0A 4J16C 4EI2A 2APJA 2ENBA 3HEJA 4FT2A 4BNMA 3EXG1 4IWYA 4K8RB 3TW8B 3VUEA 2JN4A 4LDZA 3ISVA 3GDHA 2GLXA 2PLAA 4UZFA 2QTAA 4FMBB 5EMLA 4B08A 1W30A 2C00A 2PM8A 2C95A 2LTAA 4DFAA 1DCKA 3QNMA 4MICA 3MJTA 3TOCA 4BO6A 4CDGA 3R9XB 1BFDA 4Y6PA 2HHLA 2RHCA 5M3MB 4GUAA 1KXLA 4CODB 5BRNA 4RH0A 3NQ41 4JJEA 4V03A 1N0WA 1X1BA 3DEZA 2B1IA 4QG7A 2Q5EA 1SFOH 1ZIYA 4NBWA 4NNPA 1FW8A 1KEVA 1AKTA 3Q9UA 4G9BA 4K2KA 3LHKA 3LU1A 2J9FB 1C3VA 4M0LA 1M1KC 1BVUA 3I9V6 3INNA 3FSRA 4ZODA 5AVOA 2BGGA 2YWHA 5TEVA 3Q6SA 3U1BA 4ANFA 5GMOA 4X3UA 4FGWA 2EBHX 2G9HD 1A5ZA 4DZRA 1Q15A 1FRQA 1T6XA 1USKA 2BJHA 3PSHA 5CLQA 5ELEA 2NXJA 3C8DA 1NY6A 3CBGA 4JDUA 1WG8A 2AI2A 2Z57A 1M8AA 1U4SA 1PTOC 4ZQCB 4ZT5A 2XTIA 1A9ZA 3ZH9B 2OWEA 2XQFA 1GQRA 2H1OA 4XD7D 1ATIA 2A0XA 5J2TB 3D59A 5EKLA 2XNSA 4FR0A 4A3FB 1HR0B 3FKIH 4PNHA 2XXAA 1YI0A 4ZK9B 2B94A 3TLBA 1E3DA 1RJTA 3I6YA 1R4MB 3GLVA 3OICA 4IHJA 4YH1A 4BP8A 1G9XA 4B3SL 4M2LA 5AUPB 2Q9BA 2LFNA 1LD3A 2FWPA 3I6QA 4WZAA 5J5AA 2A92A 3QW2A 2V8BA 1FNDA 1IWPB 4BNIA 2RCNA 1C30B 2VUMH 4KY5A 4F5DA 4FBGA 2QN2A 5CH3A 4IQ8A 2IHJA 4BNTA 5F7ZA 2CNOA 3NKFA 2OOKA 1JIVA 5ECDA 1E20A 4EQOA 2X1VA 5EIWA 4KHVA 1C50A 1FUEA 2FZVA 3F49S 4J0FA 4M0EA 4NK5A 3TB4A 1IHZA 5KQMA 1UJMA 4FJ2A 3FY4A 1CS0B 1S2DA 4ROTA 4FC6A 2EHJA 3QXGA 2OEOA 2OORC 1E2VA 3FYUB 5J2UF 3OQPA 1LS1A 1C1DA 2YV4A 3LGSA 2XVAA 3T7SA 2W37A 4BLTA 2B4YA 4X20B 3TZBA 2B5WA 3VU1A 3BXZA 1EY6A 1Z8NA 1LPPA 1LFAA 4I1VA 1KBZA 4JBXA 2PUJA 2PWZA 3FCEA 4YLGA 2QJOA 5IFLA 1RI1A 1H4QA 1F6WA 2E82A 2M00A 3C1FA 2R7ZG 1QX4A 1VJ0A 3ZGYA 4WK2B 1EDBA 5LU8A 2IF2A 1BNCA 3DXYA 2C57A 4P72A 1XLTC 3LY7A 1BYUA 3ZIAD 4BECA 5IE8A 1U3VA 2E85A 3CWCA 3SQLA 3DCYA 3F2VA 2W70A 5KJ1A 4XRGA 3A4VA 3GMIA 1I1HA 2HXGA 4TLBA 3TOZA 1ACJA 4WPGA 1BCPB 4XTCS 3HJGA 4KBGA 3ITPA 1RQLA 2IYPA 2CLKB 1FYWA 4M0FA 5DNEA 3PNPA 1AZWA 4GG1A 2J32A 3DTYA 4XYGA 2C7QA 1XMOB 2CWAA 2GK3A 1EFWA 4IMPA 4Q1FA 4D9KA 3TN2A 4D96A 5TF0A 1K3UB 1N2HA 4HVLA 1YS1X 4IHQA 2VNUD 3PQ5A 1L7BA 3QBDA 4UBMA 3NT4A 2XDWA 5HR5A 1VL0A 5CJ2A 1PQUA 5EKDA 3GLIB 4M1TA 1VJDA 1M6EX 2DFPA 1NBMA 4LF8B 1YI1A 1A77A 5JU6A 2XITA 5KIAA 3RS3A 2B9VA 5JLAA 2L55A 1NC1A 1IUNA 3HJAA 3MXTA 1R0BA 4KK4A 2ZYIA 5BR8Q 1GZ4A 4Y7CA 3ZJTA 1DAKA 1ATZA 5I9OA 1PFGA 4YACA 1QUQA 4KKTA 4RM2A 4QJFA 4P71A 1QPBA 2I7CA 4YQZA 3HWX1 2EZ4A 3H3FA 1P81A 4GI7A 2V7TA 5COYA 1GN8A 2BM1A 1VIYA 2JGFA 3D6TB 4D44A 2GT1A 5CYGA 4I3FA 2ICEC 3THOA 3H5VA 4WJWA 2W22A 2WHYA 1QR6A 3GARA 1M8GA 1RIIA 4HK4A 4K8OA 2EJFC 1MU0A 1P1RA 2Q6IA 4O8CA 3I9NA 2Q8IB 3RROA 5HKKA 1GTMA 1XD2B 1LI4A 2XF2A 3A3OA 3HRIA 1O4WA 3QLJA 4K6HA 2DZDA 4NBNA 5TMEA 1WUYA 2HYDA 3RTDA 3ZQ4A 4YXWA 4BGUA 4BQPA 4O3MA 1DC4A 3Q3JB 1LEHA 4ARSA 4ARUA 3FZYA 4N8X1 1WXHA 1HLDA 5KAMA 2VOJA 2I6QA 3C8HA 4BVLA 5TC4A 3VVCA 5HZKA 3UICA 4Y6LA 1EIWA 1VDZA 1XLUA 3EVNA 5IC4A 1CVLA 1T25A 3A6EA 5KNDH 2A9JA 3OPXA 4L2IB 4MI1A 4MNTA 4KR9A 2D4HA 5KOIA 5FO9B 4QHSA 1PH5A 1V1JA 1SHJA 4OL7A 3NBMA 3RUIA 3C0KA 4KMSA 1X42A 4NLLA 4FWIB 1O97C 1S5PA 4J6EA 4NZOA 1UOPA 1JZSA 3O2NA 3CHBD 4LHYA 5DTIA 1JH9A 4CUKA 2XVXA 4I0WB 4JB0A 3QG5A 4FN5A 3MS2A 1ET9A 1IBLB 4BFLA 5EZQA 2BFNA 3M3HA 4DGZA 3ANSA 4OO1H 1CFJA 3EWIA 1LUZA 2CW0C 5HYVA 2WU4A 1O97D 2FNAA 2IZ0A 5BWCA 2F0IA 3FHTA 3R41A 3TXXA 4NYJR 4GD3Q 2J85A 1MEEA 4J6HA 5CIWA 1QLHA 3M1AA 4QOEA 3HFZB 4HDNB 1SVNA 1M2HA 2R6ZA 3CN7A 3PQ2A 5AKLA 2A5JA 3M3YH 4O4JB 2DQ4A 4DK6C 2JGNA 3EIUA 3KQHA 3KPVA 1W8DA 3SVMA 5CK5A 5NLLA 2AG1A 5CB6A 2XGSA 3C3CA 3AU9A 4W5JA 4E7OA 4UULA 3T5BA 1HYEA 4P5PA 5IZCC 1XV5A 4MUXA 4RZUA 2WWGA 4BLPA 4A3LG 4LWCA 1SKQA 2I80A 3LUAA 1G64A 2PT6A 3JYOA 4PVCA 3HJFA 3RLIA 4LHEA 2HHJA 5EPJA 1FP6A 1N36Q 1W4ZA 2Y1CA 4ZU3A 3L49A 1QK3A 1UKCA 4E70A 2JCXA 3T34A 4DB4A 1EJ2A 3WLTA 1AHIA 1N57A 4GPTA 2GPTA 4DR7Q 1W0JA 3L7AA 1UKVY 1YCFA 4UD2A 2R93G 5AHWA 1FLVA 5JWHA 3F7NA 4UUOA 1FDRA 4ABYA 1WKCA 2R6DA 3OCUA 5FBVB 2RK4A 1GSAA 3NYIA 1DYQA 1MO4A 1YKSA 2C83A 2O2EA 2QT0A 3B1XA 1DLJA 1R7RA 2A84A 4ID9A 4QT0A 4RY2A 4H3SA 4UDYX 5CX4A 1RAFA 3U6KA 2GBCA 1M73E 4YHHL 1X13A 5H1SE 3VKFA 2JKYA 2IPOA 2A88A 2P2LA 2DT8A 4OUDB 1AQIA 4N5MA 1X1SA 4ER6A 4C1NI 5K6TA 2LE0A 4OLHA 2P4SA 3VPXA 5FOBB 1AZPA 1OASA 4O4LB 2YMLA 3BWMA 2BGUA 2BHRA 1O94A 3M0EA 4B09A 1V41E 3CNLA 1L5LA 1I13A 3JS5A 1CR0A 5JXHA 4X1IA 3TM5A 4JBIA 2QQ0A 3VJMA 3W6NA 4AO7A 1MPTA 2JBHA 4U7JA 1TK3A 3QKWA 3KOWA 1ONSA 1AA9A 4YRTA 4PXSA 1RTOA 4W99A 4EUSA 1LTID 2WUGA 5JG7A 5JE8A 3LL4A 1C7RA 3QY0A 2EEZA 1XN4A 2X13A 1TKWB 4CKCA 3GZJA 1V4VA 3MTAA 4IXMA 4NXNL 4KD3A 2ASVA 5CITA 1MX3A 1UJ5A 5BR8B 2A1IA 2JFYA 1RE0A 5KKCA 2GYVA 2V74B 2Z2YA 4K9PA 1EFHA 4ZQ3A 1NUPA 4EUNA 3WTBA 4KLAA 3CQZB 3QBVA 3T3HA 3TMYA 2PLWA 4JI1L 3R75A 1RM3A 3HL4A 2WYOA 4XARA 3U7IA 2H2HA 4LY3A 5K4HA 1RIPA 4RIIA 1A88A 4G24A 5JO9A 4F88A 3Q5DA 1JE5A 2GN5A 5IYBH 1P3DA 1GUWA 2N8NA 1F9SA 4GU5A 4MEJA 1BXGA 1HT1E 3T5PA 2FPGB 1Y5MA 2BA0A 1RRKA 5C4XG 1ZOSA 3FPPA 2CXRA 4GSYA 2CLOB 1F8GA 4JQZA 1WTOA 2JLVA 4S1OA 1SY7A 1S2MA 1XLVA 5A7GA 4RTNA 3FSEA 2JCYA 2DUMA 1I6HB 3CJQA 1KK1A 3ISJA 4JLUA 3C6XA 3ENZA 4M7RA 4AJJA 4QPDA 2E4ZA 3OIFA 2ZYDA 5BNFA 4LCBA 4BZXA 3U4VA 1Q3HA 1UP7A 2IU4A 1WVLA 4QGGA 1XD8A 2AT1A 3A56A 3F8SA 2X2FA 1PH8A 3JAKB 1F1JA 2GRJA 4DR7L 1DEOA 1MEJA 2WLTA 2R4TA 3WLAA 4Y9TA 3SKXA 3FFBA 4IPTA 5G0WA 5I6DA 1WB9A 1SROA 3SXHA 1NJ5A 2XI4A 3QMPA 3MLAA 5TRTA 2BOSA 4BVGA 3MEFA 4M1UB 1HE3A 3FWHA 3MT0A 4X9XA 1M5RA 3ENQA 5CTJA 4EFNA 2VDNB 4GXRA 1OZHA 2MO0A 4XB1A 4MRAA 1A7UA 4Q3AA 5FDFA 2NZOA 3WL6A 2HD3A 4GRDA 1ISRA 2R85A 4DCOA 5KYYB 1UANA 1L5GB 2PUBA 4C78A 3CCQA 4J0IA 4MV0A 2Z2IA 4U3JA 4PY2A 4C2MB 5B1IA 1IMOA 2Q99A 3WLPA 4QJBA 2B30A 5KTRA 7MHTA 4C4OA 2XCLA 2IPXA 5CRIA 1O94D 4ZKCB 3W9BA 2CKZB 2OCEA 3EZ9A 5EJWA 3X1XA 1F9RA 2ZP1A 3K0KA 3PPVA 1TD9A 3HCEA 1AQJA 3IAEA 3CMCO 4LRUA 3PMFA 4ZGWA 1M34A 2ZJZA 3HJUA 4EVQA 5EERA 1CRWG 1ESZA 2NSLA 3HYNA 4JUBA 1Y1RA 4PTYA 4GEGA 4RGYA 5FBLB 3ZDQA 3ZDXB 5I2XA 1CRQA 3RYHB 3ZZMA 2ZSJA 2QEJC 3GFFA 1YFJA 2CY0A 3DKRA 2MIIA 1SXPA 1K83B 1RZVA 3KQTA 5DWVA 3U44A 1KMNA 4E09A 3QWBA 4WDRA 2JGKA 2NVOA 3GXBA 4PFJA 4G6ZA 3ZDYB 5LQRA 3A36A 4HB2A 4KN9S 3VNSA 1W9MA 1PJTA 1X80A 3PFIA 4R81A 3S15B 3MBKA 4QQFA 2ZYAA 5CVVA 1FNCA 1RVDA 2EBWA 2IYNA 4FF1A 4WD3A 4P4SB 1ZNZA 2J9FA 4ENWA 3NHHA 2ADFA 4HIMA 1T5LA 1U7DA 2YVAA 4I1YA 4OGFA 1OTHA 1C8KA 2RI1A 2WLSA 4C4RA 5HQTA 3TLGB 4GBED 1OCEA 4TMWA 1B8PA 2O5VA 4CRWB 5KYLA 1ZVQA 4J0EA 3O95A 1E1YA 1NRWA 1U3DA 2X9QA 4QRIA 4B9AA 3I3OA 1F17A 2AK3A 2BUCA 5IANA 3S1QH 3IJ5A 2Z6BA 2ZQYA 3VYUB 2I6GA 4BNUA 1O8BA 4AQDA 1VLQA 1ZJ6A 1FLNA 1DVRA 3VHXB 4YRAA 5ECWA 1R15A 4HMPA 3M3DA 1EM8A 2ZRAA 3KR1A 4ZEXA 4IJ6A 4LZWA 3TIXB 3I64A 4RQTA 1H22A 4D4LA 4WZAB 2EV9A 1BE0A 1AXEA 1IL8A 1UXIA 2PUWA 3A9VA 3L7IA 3P0RA 4JKIA 3I12A 3WA7A 2LV8A 1QBKC 2FPIB 4IXWA 3KLNA 4ZCTA 1KVTA 3REOA 4CF6A 3ABSB 3MEQA 3KQYA 3NYWA 3MTIA 3MTJA 4IMJB 3UG6A 2IH5A 2H4OA 1XZEA 2YZMA 5HEKA 2VYFA 3VISA 1XWFA 4RZIA 1G55A 4EJFA 1V9PA 5CCDA 4DEXA 5SV2A 1IATA 1WAMA 5JHHB 2G77B 3NUGA 2I3BA 2IUTA 5TF4A 5FH9A 2VA9A 1QNUA 1EQRA 4YIKA 4LCJA 3UC9A 5KVCA 4F9TA 2G3YA 2P2CA 2VP4A 3KKKA 3WLJA 2GM4A 3EW9A 1IBSA 3V1NA 3J7AC 2HU7A 3TH5A 4NJMA 3T7RA 2OPHA 4BTEA 4S3SA 5AJZA 4X20A 2ZW9A 3Q15C 2GLUA 3TVYA 4X63A 4QPJC 1U0RA 3PUZA 2E3JA 4IIVA 1UJBA 3JQQA 4LZZA 3N8GA 1HTWA 2V4MA 5M3MG 3WKAA 2DY7A 2ZXOA 1T0BA 4DLXA 3S1NH 1E9FA 1EAYA 2PDAA 3CXUA 3E27A 3SOPA 3K0AB 3EBEA 1HGXA 1JHYA 1PE0A 2FQYA 4PLVA 1UWVA 5A35A 2E0IA 1WSWA 1CT1D 2F3QA 4FI3F 4DA0A 1VCOA 4UCQA 3LIIA 4BX0A 4J7AA 4MS1B 1X2BA 1O5IA 2PT5A 2I3ZA 2ANCA 1C7JA 1XEWY 2NVUA 2TMPA 2EW2A 2W43A 4QRHA 5EJFA 5EAIA 3OCXA 1PTOB 1XRMA 3EDQA 4H13C 1THGA 4B48A 3DO8A 3HXPA 1TO1E 2O1XA 5EFZA 1JG1A 2RI0A 4PEVA 5ALKA 2E8GA 3IDOA 2R8RA 3MFYA 2H2IA 3ROXA 1GZ5A 3OT5A 4MN3A 4QF4A 1JW9B 1ZO8A 3TS1A 4C0BA 5J4VA 2VUMG 1KARA 1QDUA 3TQCA 4QOIA 4YVFA 3E03A 4FR5A 5EJGA 2FLVA 1RC1A 2QYOA 1UBEA 1AUOA 5LP6F 1ZKOA 1YZ6A 1YNSA 1R0XA 5AKKA 4BBAA 1ESMA 3KWMA 1RQNA 1KETA 3LNTA 3M4ZA 4FKBA 3UXHA 2DETA 2ZEJA 5ESRA 1QHGA 3EHEA 4WLUA 3IUSA 3S2IA 3U26A 1GU0A 1QUQB 1NVUQ 4B3SQ 2ZK7A 4Z4CA 2YY5A 1NMFA 4C30A 2OTLA 2CSXA 3C6MA 2ATVA 3NYRA 3CZ5A 3ON5A 3D6VA 4OBXA 1LSJA 1NVAA 2AXQA 3AKYA 1VKJA 2DAPA 1K3RA 2RFLA 4RADA 4L6AA 4WCDA 3SD7A 4BKQA 1J5EQ 2A74C 1QTNA 4IGKA 1GTSA 4KWEA 1M3SA 2OT3B 3OQVA 2AKAB 1K3BC 1X8KA 2I6XA 1TMGE 4KOEC 3UA4A 5HZHA 2MJLA 4TSSA 2EY2A 2ZM6B 1Z39A 1JKIA 4OHVA 4B82A 1COWA 1GGMA 1U4RA 3EVZA 3OTIA 4LOIA 2EARA 5AJ3Q 5DVZA 1JGTA 4KP7A 5F12A 2GAIA 2Y0SG 4HYEA 1S7CA 3QLUC 1KJ9A 4XGQA 3ZV3A 3LXMA 4JLKA 1GCOA 2LBPA 4OM7A 5CU7A 2K14A 3WMEA 2PQ0A 3IULA 3W90A 5A5FA 2BTEA 3SLGA 4BO1A 4GNXA 4N48A 4KV9A 3O9VA 3TLEA 3M4QA 1U9ZA 2X2OA 3E5NA 5E38A 5SICE 3WMXA 1H6DA 3ZXIA 1LABA 3L06A 4R1QA 3EEYA 1XXHE 3M6UA 3MEHA 3KB1A 4HQ0A 1QOZA 1U2ZA 2SCUA 4FP9A 1GNQA 4DUZQ 1M33A 3T1OA 2GJ8A 2A57A 3NBYC 4WA8A 1SUPA 5LVAA 1EEFD 2J0TD 5B3LA 4DPGA 3JQ7A 1SB8A 2XY4A 3BX1A 8MHTA 4AVYA 2OMEA 3OIVA 4ND8A 1E66A 1AX9A 5TSSA 2PJUA 1NF9A 2RIRA 5TQ2A 3UUFA 4D45A 2HHHL 1QM5A 1G2IA 5JSUA 4HLCA 1HQMC 3GO4A 3G5MA 1M5TA 5LMCA 3W79A 2NYVA 1NE3A 3V1UA 3EGOA 4BQRA 2XRZA 1OLUA 2XBLA 4U5XA 3IAFA 4HHEA 4KYIB 4XWAA 4Z8XA 4JCVE 4D6XA 2RHOA 2CEKA 4KTAA 1S2NA 3LXRA 4MB0A 3M7IA 2DN8A 4HTAA 3ESYA 5CJPA 1YJ8A 2ZTEA 3CF2A 3WBJA 4B6QA 4JLVA 2EWWA 1QQBA 1GPKA 1MJGM 1PDQA 2GAFA 5KTPA 1GL9B 1CF4A 1K6MA 2F7SA 3WZ2A 4X62B 2NPFA 2QROA 1D4OA 1OC2A 2R6CA 1VE9A 4GBGA 4MKZA 4F04A 4CDDC 2LR0A 1GPMA 2XMCA 4W9MC 4WLNA 1LBTA 1JF8A 1R0WA 1O4VA 1SQ5A 2GD0A 2QSUA 2VF5X 1ORWA 4XKJA 2Z6KA 1R10A 4B3CA 4BN5A 3MWDB 5JTTA 2BI8A 3JPYA 4GZ3A 1DCZA 2B20A 4BXXH 1QZTA 2C3OA 1IAVA 2WV9A 1FFGA 3WICA 2QR5A 3SZ3A 4EG7A 5CLIA 3J7YW 2Q50A 4MDYA 4BVFA 3K5WA 5I3ZA 4YCVA 1JQAA 4YHHB 2L9HA 2Y93A 1TCUA 3K31A 5FFFA 4WUTA 1ZIDA 5LZ4A 2OXCA 1JICA 2VR1A 3AG6A 1M66A 3F74A 1DAGA 3GVPA 3K94A 4OHCA 4ZAWA 1PFNA 3P1HA 1P4RA 3BDCA 4ZYLA 2G4VA 1T43A 3HKSA 3BZKA 3GF4A 5BMVB 3V9PA 4H6VA 5AHXA 2IV2X 1KYZA 1ZMOA 1C9JA 3IKMB 3R0VA 3UNXA 1K7XB 5CA0F 3H9EO 3KJXA 3STYA 1RQ2A 3P96A 1P0MA 5AVSA 4XR4A 1UCFA 4X1IB 5K8IA 4OHMA 4BUCA 4MPJA 6LDHA 1C29B 1CYDA 3PQ4A 2ZYGA 3AVWA 1ORTA 1XZQA 1SYBA 1DHRA 1SO8A 1Y98A 2DH6A 2FMFA 2O0LA 2OV1A 3HB1A 3VH1A 4DMLA 3E1SA 1N7IA 1H1DA 2VXYA 1W2BA 2FK8A 3TOSA 3T1YL 2HPVA 4A3LH 2A94A 2XVZA 3N0RA 1DC6A 2EATA 5F2OA 5C51B 1X3GA 4L0CA 1AZQA 4L15A 2VJDA 1B00A 1EIZA 4W9NA 3BS1A 3TOVA 1HL3A 3DV0B 3ORFA 2O8FA 3VPCA 2K28A 1Z7EA 2NTJA 3K9HA 4CQJA 2F0GA 4DV6Q 4WI1A 4EKNB 1DBIA 1NHWA 3H5AA 2KA7A 3M83A 1NPTO 4Z51A 1IBMB 1JOKA 1L4UA 4UAGA 3WKBA 3IQXA 3CZ4A 4FEYA 4NCHA 1I3KA 4PCLA 4ZT6A 4D02A 3QELA 4X3PA 3NE5B 1T0IA 3DZHA 1FVHA 1ZA1A 3J81E 1E60A 1H0HA 2Z0MA 4PCAA 5AW6A 5EWJA 3V55A 1RR6A 1T4CB 3S2SA 5CFZA 4J3NA 1TJ4A 2HRQA 1DMSA 3LW7A 4GQBA 1B41A 1VA4A 2IP1A 1MJ5A 3C4QA 4B6SA 3I4LA 5FLXE 1AK9A 4YUVA 1QH0A 1U3CA 1WQ1R 5TGTA 3PWTA 1T6BY 4G8BA 1TAHA 5KB3A 3SEFA 4WX2B 1YDHA 2F3SA 1I3LA 2EYLA 5C0XI 4H7FA 1NN0A 1WP4A 1P9NA 3E9QA 4Q3DA 3ZVLA 2CFOA 4UEWA 4LXXA 3VC3A 5T8KA 1QO7A 3H11A 5HHTA 2X0JA 3W2IA 3C5EA 3T06B 3K57A 4FCTA 5D1NA 1FZTA 4II7A 4UEOA 1X7WB 4AZ3B 4CTMA 2FMTA 1QF6A 1F2MA 4TSKA 4ZRNA 4ZT3A 1E79A 5EE5B 5CW2A 3ANLA 3KLSA 4RORA 2JA8G 1UPCA 1EIGA 2CLEB 3WLQA 4DC9A 2I99A 4ZAXA 4DA8A 5BRJA 3KKEA 1IN5A 5BQ3A 2ZRDA 1JRLA 2GN2A 1KNEA 3DD5A 3DDUA 4I9FA 1DBPA 1F2TB 2Y77A 3S1MH 5CA1F 1I4GA 4HWTA 3VR3A 1QVWA 3NQTA 3FPKA 5HILA 4DA6A 1YXMA 2B78A 2FR0A 3S1AA 5EI5A 5JD5A 1EVJA 2BEWB 2JLXA 4GEKA 1K7SN 3HA7A 4E32A 4EGFA 2Q9UA 1CUXA 1XJWA 4UOEA 2XUPA 4MQMA 3S8YA 2ONJA 4ARZB 5EIXA 2XB2A 4FKMA 3H16A 4HC4A 3V97A 2J6BA 3UGJA 3OE5A 4KJOA 1MGSA 4IIDA 1IZ8A 2FG7C 3RMHA 4PZDA 1SUDA 3FSGA 2RHRA 3PV0A 1CUWA 3LY8A 4A3KG 1P31A 5AUQA 2OQKA 1GTZA 2B7BA 4PAQA 5FLYA 3TP8A 3HOXG 1UOEA 2ZJ5A 4OHBA 3PEVA 2VP2A 2ZSDA 1B1CA 4DAVA 3IRUA 1PDOA 2AC2A 3ZWKA 4O4HB 1RADA 1N32B 3A1UA 3B52X 3FAKA 4Q37A 4LXGA 5AW8A 4TLCA 4GYJA 1I5FA 4UEKA 1ZVKA 3PF8A 4BZQA 5FYQA 5FNVF 4B6RA 1DOZA 4ER5A 3KEMA 2I5PO 5B6JA 1LT3D 1MZVA 3OM1A 4O2BF 1WMEA 3M7GA 2ZRPA 4A10A 1SKMA 3ETGA 1B43A 2I71A 2PO7A 2OLEA 3RIMA 4E46A 4HD8A 5FUWA 4FUTA 2EL9A 3CZAA 1EYDA 3KCNA 3GLKA 3DG9A 3I61A 5EZYA 4EBBA 5AM4A 3ERCA 1H2FA 4WOKA 2QQGA 5DBHX 3ITNA 3S55A 3LPAA 3U5TA 3PC4A 4JBLA 3UMCA 1HEYA 4JJKA 3I09A 1P2DA 2Z56A 4KTTE 2VJYA 4G5YA 3G8YA 3DM1A 2P9YA 4QLAA 1GAQA 5FLEX 4AT1A 3V00A 3LUFA 2I2FA 1USWA 1T8TA 3FHCB 4Y2GA 2ZJFA 5HIJA 1DG9A 4O1MA 2P8SA 1PQWA 3W9YA 5C80A 4B33A 3KT0A 4EO7A 3WGQA 3TWOA 2VTKA 4XEHA 5B2ZA 3TIIA 2KHJA 1GUOA 1U7WA 2V9PA 3EPLA 4LF9B 1H9KA 2IIBA 4LXUA 2OD9A 1LDEA 5ICFA 1EESA 2AN5A 2FLKA 2X1LA 4KODA 3TNJA 2H1HA 2IYAA 5C4GB 2Q8RE 3IQIX 1PCXA 4RCZA 1J42A 4FIZA 1BBXC 1MGPA 1E69A 4DV1B 1AP0A 4IIXA 5TPWB 4BRSA 3QTTA 5DF1A 1VQPA 5DSTA 1YUBA 5EJ8A 3IQHX 2K03A 1K5PA 4EW2A 3OIQA 2PPLA 4C5AA 1CX9B 3H8WA 4BMDA 5ICEA 4TYPA 1HA3A 2QTGA 4BFTA 2Q46A 3NOVA 4Q19A 4QA9A 3U19A 3VC7A 3BDLA 4RZXA 2GN9A 2I6UA 4BEJA 4DKJA 2QA4A 2NSJA 1SBBB 1RAGA 2ATCA 4B6GA 1NE2A 1XMPA 1XXLA 3V96A 4IEIA 1U9IC 1JE4A 3H9UA 4IICA 4NX2A 3IKTA 4YUXA 2Y6UA 1N2CA 5T1IA 2P3LA 3GLTA 3ITEA 1ODKA 3L7OA 3MCWA 4HGZA 1ISIA 3VZRA 1ZUD1 2CQOA 1QS0B 5INTA 2OCIA 2VKTA 5EHNA 5B7QA 1N36B 4TN1A 4NCAA 1OXVA 1T1EA 3DE0X 1JZTA 1AN9A 4C76A 1Q3KA 2JCBA 2WILA 3ESXA 3PT9A 5CXXA 5TS3A 3V42A 4L5QA 3VX4A 5CFMA 2B39A 1JA0A 1PEAA 4LGVA 3UQYS 4MVJE 3JVEA 4N40A 2HCBA 3UM9A 3W1VA 2G71A 3QA9A 5D85A 5GP1A 3KQQA 4OI0A 1MAAA 4V0KA 5LQNA 2FX3A 1QIKA 4URYR 4CWAA 1FNSA 1X3LA 1X3EA 2XYHA 2CL7X 3AKCA 4A23A 3ZCVA 5CAEA 1R5BA 3CUSA 3P71T 1UXJA 4URWR 3ZUPA 4B1FA 1EZ8A 1FXSA 2QG9A 3WSWA 4UMEA 4DMCA 1SCAA 2PS1A 4DR1B 2NVUB 1FMJA 4FFWA 1NF2A 2XUZA 3UOWA 4BB0A 3UMMA 5LD2B 3AHEA 4JT8A 2QAGB 2WT9A 3K0EA 3R3JA 4JI1B 3U1VA 4CM6A 1QB7A 4L27A 1KRWA 4HGRA 2C35B 3R23A 1QCYA 2TSYB 4FEGA 4RQUA 2WWHA 1WU8A 2YJTD 1OJLA 5JYDA 3QEJA 1TAUA 3I28A 1IBLQ 3ICPA 1FGBD 5DRYA 4A93H 3HSKA 2QRVA 4JOCA 4ZHQA 1QVGA 5F77A 5IEBA 2FMCA 2VDPB 4YTEA 3U40A 1YSCA 1H2XA 3CWZA 4QGFA 1WZUA 3HHPA 2AR9A 4MQLA 4X65Q 1KQSA 4IIFA 1JR3A 1KO8A 1UJNA 2H8KA 2F3VA 1XVIA 2QUJA 4OHWA 4P7JA 2X9GA 4UVIA 5M5WH 3RUHA 3BD9A 1PFUA 3UZUA 3MA2B 4EPRA 1SCUB 3FAZA 2EKBA 2V45A 4Y6GB 2XB4A 4RPLA 5L4LA </