2L15A

Solution structure of cold shock protein cspa using combined nmr and cs-rosetta method
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cold shock protein CspA
publication title Fully automated high-quality NMR structure determination of small (2)H-enriched proteins.
pubmed doi rcsb
source organism Escherichia coli
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2l15A00
3UE1A 4X66L 4B3TQ 2N3SA 3JAMc 2Z0SA 5GROA 2KCMA 1C7YA 1IBMQ 2E5LL 2D0OA 1E3PA 1Z9FA 4NPSA 1S40A 3S24A 3T1HL 5IYDH 4QY7A 3GO5A 2Q2HA 4PZ7A 3K8AA 4A3MH 3TEHB 4NXNQ 4DR7L 3S2HH 1VQJA 3CQZH 3J80i 4YWLA 1IL2A 4DR3L 5DLQE 1J5EQ 2MO1A 4A3EG 1B70B 3H0GH 4BA1I 3TRZA 2ZTDA 2E2IH 5M5YH 4OX9Q 1X56A 4DR1Q 4IPGA 3UDXA 1CSQA 4GOPB 1HR0L 4JOIC 4LF9Q 4IOCA 3F8TA 1PV4A 1EIYB 3M85A 4A3MG 4HIOA 1PHJA 1KL9A 2AWNA 3A5ZB 3I4NG 1J6QA 2HIVA 1UE6A 3CCVA 1AH9A 3DM3A 2VQFQ 3CCUA 2IX1A 4A3CH 2R7DA 1VQLA 1BVSA 4JI8L 4X65Q 3CCSA 4BA2I 4A3LH 1U5KA 1X55A 3GTKH 1G6PA 1VQ4A 4DV1L 5LMUL 3RR5A 3L2PA 3AQQA 4RG1A 4H02A 3F2DA 1MJEA 3HKSA 1IBKL 5JEAG 1NY4A 2NVYH 1XPUA 5C0XG 2IY5B 1Y1VG 1WOCA 1SN8A 2VZAA 5IWAQ 3PO2G 1ASYA 5IYCH 3A74A 1ASZA 5GADC 4A3LG 4C3IH 4JI1Q 3M9BA 4XIGS 1K9MC 1YHAA 1Q1BA 4LFAL 1L1OB 2NN6G 2OTLA 3ER0A 3OTOL 1VQDA 2D0PA 4LF6L 1NE3A 4HJ9A 1XNQQ 2UXDL 1VQFA 5GAGC 1B8AA 4DV4L 1V43A 1PH5A 1HNZQ 3K81C 1Y14B 3GTOH 3M4OH 2N49A 1HNXL 2ES2A 1LUZA 4IJHA 2CWPA 2IHFA 3AFPA 2B29A 4GN4B 4P73A 4IPCA 5FLMG 5M3FH 4HJ5A 1IYJB 3EIVA 2VL6A 2JA6H 2UXCL 2VUMH 4IJLA 2PNHA 2PMZE 2R92H 1HNWL 1V1QA 1XTDA 3PSIA 2NVQH 3RLOA 5IP9H 1S3OA 2DUDA 3GTQH 1A8VA 1YHBA 4L5TA 2Y0SE 2MFIA 1NJIC 5C44H 3PUYA 1VQ5A 3PF4A 2LSSA 4GKKL 4LUOA 2ATWA 4GOPA 3HOZG 4BY7G 1VQ8A 3M7NA 1N32L 1EWIA 5LMNW 2L15A 4WJ3M 1QZHA 4P75A 2UUCQ 1SLJA 4QL5A 4TVAB 4GNXB 1XMOL 2JA6G 3CC7A 3CMAA 2R92G 2IHEA 5AJ3Q 4EX5A 1Q82C 4B3MQ 3CPWA 4JI0Q 3S15H 2BA1A 4A3JG 4JV5Q 3PO3H 3PV0A 1XPOA 5M5XH 2E2JH 3CD6A 2CFMA 4UY8C 5C44G 3HOUG 1I6HH 4JI7Q 1GD7A 2BH8A 2XGTA 5GAHC 3I55A 1KHIA 3W1BA 3J81c 4DV3Q 1XPRA 1VQ9A 3HOYH 4GKJL 1PVOA 4BXXG 1H95A 1WI5A 4DV5Q 2WP8J 5HGQA 1HZ9A 1LTLA 4DV7Q 1X54A 4LFCL 1EQQA 3E9IA 4GLXA 1SFOH 4BBRG 5C0XI 2JA7H 2K5VA 3I4OA 2R7ZH 1Q81C 5ELNA 3PUZA 5IT9c 1X3FA 4P72A 2VNUD 4A3GG 1MKHA 4DR5Q 4PZ6A 4B3TL 2JA9A 1X9NA 5M3MG 3U58A 1G51A 1I94Q 4JI4Q 1X3GA 3MXNB 1AE2A 1IBML 2HHHQ 4A3FH 4A93G 1LM0A 2GN5A 1Q12A 1YBYA 4AIMA 3S1NH 1HR0W 2AMCB 5K36G 2UUAQ 3F2BA 3CP0A 4IFDI 4NXNL 1YEZA 5IP7H 2CQOA 2RF4A 3G48A 4APVA 4C3JH 3NENA 1VQAA 5C0XJ 4LF8Q 4DR6Q 2JA8G 2MQHA 4YWKA 1BKBA 4DAMA 1FL0A 1J5EL 1KIXA 4K0KL 1N36Q 4OO1G 4WJ4A 4A3FG 4GNXA 1I5FA 2QGQA 5JJLA 4OX9L 4Y7NH 2B3GA 4DR1L 2I5LX 3SGIA 4JYAL 3T1YQ 4LF9L 2ALYB 2E8GA 4LFBQ 1JJCB 2NZOA 2LXJA 3S1MH 3Q8DA 2N8NA 1CUKA 2VQFL 5C4XH 3HOVH 3TS0A 4JI2Q 2PI2A 1D7QA 1A63A 4X65L 4X62Q 3I2ZA 4IO9A 2YU9H 1C9OA 1IZ6A 1VS0A 2AHOB 5E7NA 4IFDJ 3LGJA 1I50H 3TREA 4C3HH 2VQEQ 1VQGA 1Y1WH 1OTCA 3KFUA 2K75A 3H15A 3FHWA 4JBMA 5IYDG 2Z6KC 1U0LA 2F3IA 1Q8KA 3BZCA 3W1GA 1XJVA 4OWTB 3KJPA 1PH6A 1PH3A 3PCOB 5IE8A 3K7UC 3F2CA 5IWAL 3PUVA 3W5OA 1M90C 1P16A 4JI1L 1QUQA 3TQYA 4PMWA 3RZOH 4MZ9A 1CKNA 3CAMA 1YJ9A 5IY0A 3KDFB 1PH8A 3D0FA 1EUJA 4QJFA 3H0GG 3UDGA 2UU9Q 1HNZL 4O2DA 4LF5Q 4DV2Q 1EIFA 1OXSC 1CKOA 5FJ8H 4DUZQ 3S1QH 1BBWA 3JC66 2JEBI 4BBSH 3GDEA 2F52A 1FVIA 4RMFA 2UUBQ 4R4IA 1T9HA 4L5QA 4HIDA 2ZM6Q 4GOPC 3ERSX 2K14A 3E9HA 4A3CG 2LXKA 4DV6Q 3UE0A 4R4TA 3UDIA 1N34Q 2JA5H 3HKZE 3MEFA 1GM5A 4OO1I 2KBNA 1HH2P 1HZBA 1KQSA 2R93H 1VCIA 2ZJQA 1UEBA 4NXMQ 4BY1H 1K8AC 3JAMi 4DR7Q 3HOWH 1TXYA 3S1RH 1K73C 4AYBG 2UUCL 4GS3A 4R4CA 3S2DH 4JYAQ 4LW1A 3GTGH 3RLNA 3S16H 4C2MH 5AJ3L 1PH9A 4B3ML 3A0JA 2EQSA 2A1AA 4JI0L 4QQBX 2RCNA 4JV5L 5IYCG 4DR2Q 1K83H 1X65A 1YZ6A 2R6GA 2ASBA 3G71A 4KHPQ 4R4OA 4IFDG 2QA4A 1QVGA 4B3SQ 2UXBQ 1RL2A 4JI7L 1I3QH 3CPFA 4DUYQ 4A3BH 3CCMA 1A0IA 1MJCA 4DV3L 1XMQQ 2ZJPA 2A19A 4YY3Q 2BH2A 3BZKA 4JOIA 4DV5L 5M5WH 1WYDA 1IXRA 3CCLA 1K8GA 3GTPH 4DV7L 1L1OC 2KHJA 4A4IA 2KHIA 5JJKA 5M3FG 5JJIA 3IRBA 1EYGA 1Q1EA 1SE8A 1YNXA 4B3RQ 2VUMG 4LNQA 4KLKA 4J15A 1AE3A 5IP9G 3HOXH 2JJQA 2HIXA 3KDFA 1PH4A 3ICEA 4A76A 4DR5L 3CW2C 4JCVE 1Q86C 1PA6A 1M1KC 2PI2E 1MIUA 1W3SA 4LF4L 1WCMH 2IX0A 1JT8A 2R7FA 3GTMH 3HKZG 1I94L 3K80C 4JI4L 1NTGA 3AFQA 1E24A 2CKZB 4P74A 4ALPA 4AQYQ 2HHHL 3K7AH 4UP8A 4YCVA 2B63H 2VW9A 2K52A 3G6EA 4DNIA 4JI5Q 4HJ7A 3PO3G 2NZHA 2D62A 1YIJA 1TWCH 4GNXC 1WCMG 4LF7Q 4LF8L 4DR6L 1O7IA 5IYBH 2AKWB 2VS1A 3I56A 1OXUA 4YCUA 3HOYG 1KRTA 1KRSA 3U4VA 3UDFA 1W2BA 3TS2A 1QUQB 3M3YH 3I7FA 1CKNB 3J80c 3FKIH 3E0EA 3T1YL 4LFBL 2JA7G 3NELA 2R7ZG 4JI6Q 1HZCA 4A3KH 1VQEA 2FXQA 2VY3A 3BU2A 1GKHA 2NVTH 3L7ZC 1XNRQ 1S72A 4JI2L 4MNOA 1IBLQ 1SRUA 1G291 4X62L 3CC2A 1KC8C 1N8RC 1YJWA 1VQ6A 2JK8A 3EBEA 4UP9A 1VQNA 2K4KA 2VQEL 2F4VQ 3CMEA 4A3IH 3CCEA 3S14H 1K3RA 1Q7YC 4PZ8A 4X64Q 5C3EH 2AWOA 5H1SE 3OW2A 2Q2IA 4GLAC 4KI0A 4HIMA 2ZTEA 1QVCA 1UE7A 2YTXA 3NEMA 1FJGQ 1TWFH 5IP7G 3KJOA 3KLWA 1UWVA 3CCQA 2NVXH 1E1TA 4UPAA 1WFQA 2YYZA 1HJPA 2WB1G 4GN5A 4LWCA 1V9PA 3J81i 3PIOA 5BR8Q 3A5UA 2ID0A 4LF5L 2PQAB 5C3EG 4DV0Q 4DV2L 1VQIA 4DUZL 4AYBE 1KXLA 3L0OA 4KHZA 3G4SA 3STBC 3RNUA 2UUBL 1QZGA 1CKMA 3RN5A 3B6YA 4JG2A 4A3EH 2ZM6L 4DR4Q 5C4XG 3HOVG 4JBWA 1L0WA 5LMNQ 4DV6L 1N34L 2WAQG 1KD1C 1N33Q 3GD7A 1OXVA 1YVCA 2JE6I 4YHHQ 3RZDH 3AEVA 2RHSB 3KOJA 3I4NH 1Y1WG 4NXML 2I0QA 4JI3Q 1UE1A 1VQMA 4AH6A 1P8LA 2I5MX 2ZJRA 4HJAA 4JC0A 4X66Q 3DLLA 4Y52H 3CCRA 2K50A 4K0KQ 4A75A 2GVBA 1XNQL 3WWVA 1NMFA 4P71A 4EQ5A 3CC4A 1JE5A 1EQRA 1X6OA 4YWMA 1UE5A 4DR2L 1EFWA 3J7ZC 3FP9A 4KHPL 2E5LQ 3CXCA 4R1JA 3PF5A 4B3SL 2UXBL 2HT1A 3T1HQ 1E22A 3M4PA 1TWGH 4DUYL 1JB7A 1FGUA 2MO0A 2YTVA 4FDBA 1XMQL 2OTJA 4DK6C 1LYLA 4YCWA 2MNAA 4YY3L 1Z47A 1VQOA 1DGSA 1Y1VH 3BJUA 5FJ8G 3PO2H 1L2FA 1GVPA 4IPDA 2WFWA 1HZAA 1VQPA 1QVFA 4BBSG 3ULPA 2C35B 1B7YB 3OYYA 5C4JH 3D31A 4DR3Q 1K0RA 4O0AA 2OCEA 2E2HH 4HIKA 4IOAA 3CF5A 2YTYA 2GVAA 3GTJH 3S17H 4B3RL 3HFZB 3H3VH 3F1ZA 4MTNA 2JA5G 3PGZA 2V1CC 1HR0Q 2N78A 2PQAA 3KF6B 5HY6A 2R93G 3U50C 3RN2A 5FLMH 5GAEC 4ME3A 4BY1G 1VQBA 2A8VA 3HOWG 1C0AA 1E1OA 1N9WA 2Z6KA 4AQYL 4IPHA 3ZJYC 4JI8Q 4OONA 2KENA 3EN2A 5ELOA 4JI5L 4A3DH 3I4MH 4X6AH 1SROA 4DPGA 3HOZH 3PIPA 1PYBA 5LMUQ 4DV1Q 3VDYA 4POFA 4BY7H 4JBKA 3U4ZA 4LF7L 1YHQA 2OWOA 4A3BG 5EAYA 1IBKQ 4QGUA 1PH7A 3K0XA 4LUVA 1OXTA 3J81j 4A3JH 4DAYB 2YV5A 1R9TH 1PH1A 3M4QA 2EIFA 1BBUA 1NMGA 3STBD 2CCZA 1A62A 3GTLH 3HOUH 4A3DG 3NBHB 2JEAI 3I4MG 4LFAQ 2K5HA 1D8LA 4JI6L 2UUAL 2ZTCA 1VQCA 4XTCS 3OTOQ 4DK3C 4LF6Q 3HOXG 4BXXH 3ULLA 1XNRL 2UXDQ 4PG3A 4DV4Q 1PYSB 1IBLL 1OXXK 3PUXA 4NB3A 2DGYA 1HNXQ 2WB1E 1WJJA 4BBRH 2XTIA 4OWWB 4L5RC 2F4VL 5GQOA 4GLVB 5J3BA 1JJ2A 2UXCQ 1N36L 2I5HA 1NBWA 1HNWQ 3KF8B 2RHQB 2OQ0A 2B63G 4X64L 4A3GH 1PFSA 1RIPA 3CCJA 5M3MH 4GKKQ 1FJGL 1YITA 2HQLA 3ULJA 1SMXA 3KF6A 1SR3A 1N32Q 4QIWE 2WAQE 5IYBG 4A93H 1PH2A 1XMOQ 4HJ8A 3PUWA 2KCTA 1VQHA 2H5XA 5BR8L 1L1OA 4OXPA 4DV0L 4L5SA 2EXDA 1VQKA 3FKIG 4LF4Q 1JJGA 2NN6I 2Q2TA 5FLXc 4POGA 2Y0SG 1VQ7A 1TWAH 2JQOA 3KYHC 3RLFA 2JA8H 4A3KG 3H3VI 1TWHH 4GN3B 4GKJQ 4OWXB 4LUZA 1EOVA 1KAWA 2Q2UA 3J7A5 4DR4L 2QEXA 1GO3E 2K5NA 1X3EA 1JMCA 5LMNL 1YJNA 1CSPA 4R4QA 1N33L 2IT1A 4TQUS 1Q46A 4LFCQ 1YI2A 4YHHL 2OQKA 5JEAJ 1E7ZA 4JI3L 4A3IG 4JBJA 4DKAC 2BA0A 4UP7A 2UU9L 3AYHB 2CWAA
chains in the Genus database with same CATH superfamily
1WTOA 5D65A 5EBCA 3R93A 2I46A 5IIFA 3JAMc 4BBSB 5GROA 1STGA 2PCFB 2KCMA 1C7YA 1IBMQ 2E5LL 2TMPA 3T1HL 5IYDH 1TWGB 4PZ7A 3FDTA 4FNFA 3SDZA 4YWLA 1IL2A 1JOOA 5ELEA 4DR3L 1J5EQ 2QF7A 5C4JB 5KEEA 1B70B 5FO9B 4BA1I 3S17B 2ZTDA 2E2IH 1S4ZA 1CSQA 4JYAQ 1PV4A 4A3MG 4HIOA 2AWNA 4EGVA 3I4NG 1UE6A 3CCVA 2IL8A 1VQLA 2EY6A 4BA2I 4X65Q 4A3LH 1U5KA 2DN8A 4XQNA 5E1FA 3GTKH 1ESFA 4C1NI 4DV1L 3K57A 3R2TA 2A68D 3AQQA 3G6JB 1ICFB 3K5NA 5C0XG 5IGBA 1GHKA 2IY5B 2VZAA 1SN8A 5IWAQ 3A7AB 1F77A 3A74A 4J8QA 5IYCH 1ASZA 3M9BA 1W6KA 2HD3A 4LFAL 2B2VA 4HCEA 1VQDA 2KEDA 4HJ9A 1XNQQ 3VYRA 5GAGC 4FXGC 1Y14B 1WTRA 1F2ZA 1EEID 4IJHA 4GN4B 2B29A 2JA6H 2VUMH 4IJLA 3SK4A 2R92H 1HPCA 1TIID 3E6ZX 3H91A 1A8VA 3KLSA 4RA8A 4B08A 1C8CA 2Y0SE 1VQ5A 5KNDA 3PF4A 2EJMA 5IGCA 2LSSA 4GKKL 4LUOA 1HFGA 3M7NA 4NDXA 4RGNA 4IALA 1N32L 1SYBA 4QL5A 4TVAB 3CC7A 1E2WA 1G6ZA 3S15H 4Q0FA 3CPWA 3CD6A 4UY8C 4Q5VA 4KN7C 1I6HH 1GD7A 2BE5D 4DNTB 3I55A 3J81c 4DV3Q 1STYA 3HOYH 1TWHB 4DV5Q 1VMCA 1IKMA 1LTLA 1EQQA 1SFOH 5C0XI 1MD2D 5G3LD 2R7ZH 1H9SB 4PNYA 3DXJC 4QF4A 3TBIB 4ILWA 4P72A 1MKHA 5EKIA 2JA9A 2CVRA 3U58A 1D2BA 1G51A 1EY5A 2A5HA 3DUZA 1LM0A 1AN8A 1HR0W 2AMCB 4YIJA 4IFDI 1UUPA 5JPMC 3RUZA 2EYHA 2CQOA 3T4AC 4APVA 1M4VA 3S2HB 3NENA 4V0BA 5C5MA 1EL0A 2JA8G 2MQHA 4A3FG 4S3SA 4RCNA 4DR1L 2E8GA 5M5YB 2PO4A 1JJCB 4X3UA 2LXJA 3D3RA 2N8NA 1CUKA 5F2DA 2VQFL 1EY4A 1FNUA 1B2TA 2PI2A 2F0JA 2OT2A 4IO9A 1YNND 1U4LA 5JPNC 1I50H 2VB2X 1ESRA 1IW7D 5EBDA 3KFUA 2TSSA 2Q8TA 2LMCB 5IYDG 1PH3A 2HCCA 1RJTA 1M90C 2F0LA 3W5OA 4QUFA 3A55A 1QUQA 3TQYA 1RHPA 4C3IB 3CAMA 2C9OA 3KLRA 3D0FA 4QJFA 4PMCA 2KOLA 3UDGA 1XTCD 4O2DA 4IUQA 1OXSC 2HUGA 4CGYB 3KK7A 4FF3A 4F8MA 1D5MC 1KTKA 1F2LA 1LLRD 3FPPA 4ULLA 5M3FB 4GOPC 2K14A 2F0IA 1Q8IA 3MC0B 4ZAIA 3UDIA 2NVQB 3JAML 2KBNA 1KQSA 5C44B 1SNOA 4KHVA 2L5TA 3JAMi 3HOWH 1TXYA 4NW2A 1J9OA 1EIGA 4GS3A 5CGKA 4B3ML 1WTWA 3E0JA 1D5ZC 4QQBX 4JV5L 5IYCG 4DR2Q 2K32A 4ABNA 2UXBQ 1RL2A 4JI7L 1MJCA 5BN4A 3CRLC 2RVLA 4YY3Q 3BZKA 4JOIA 1DD2A 1CT1D 2JYOA 3OPOA 4DV7L 2KHJA 4A4IA 2L11A 2RBMA 1L0YB 1AW7A 2VUMG 2EYFA 1PTOC 3CW2C 4LF4L 1VMPA 3D4WA 1W3SA 2IX0A 3FEWX 5ELBA 1I94L 1ENAA 3AFQA 4P74A 1X3QA 4YCVA 5DNFA 2VW9A 1EY8A 3G6EA 4RH6A 2KEEA 2NBFA 4CDFC 5I2XA 1TWCH 3MTSA 1WCMG 4LF7Q 3I90A 5IYBH 2AKWB 2A6HC 3CRKC 4YCUA 4C3JB 3T13A 3HOYG 3QJYA 1KRTA 1W6JA 3UDFA 1W2BA 2WV6D 3J80c 2EY2A 3T1YL 5FK9C 3HGBA 2R7ZG 4JI6Q 2NB0A 1HZCA 3T56B 4A3KH 2MP1A 2NVTH 3L7ZC 3V2TA 2A68C 2F4IA 4JI2L 4IUPA 4DA2A 3CC2A 1N8RC 2I07B 1YJWA 1DOKA 2JK8A 2EYMA 3CCEA 3S14H 5G3LF 2IW3A 4C3HB 1Y1WB 4PZ8A 2RDHA 4HIMA 2ZTEA 2CQAA 2G9DA 2MUYA 1TWFH 2QEJC 3KJOA 3L9AX 3KLWA 4RGOS 3J81L 2NYZD 1WFQA 1B3AA 1QG7A 3HRZC 2HDLA 1BCPC 4LAAA 4LWCA 3J81i 2F1MA 3A5UA 4DV0Q 3X3NA 1MBYA 1S5ED 1KXLA 2J0TD 3RNUA 1KDBA 2EYLA 1AFPA 3B6YA 1A3UA 4CDDC 2ZM6L 2NVYB 2O5IC 1LT4D 4DV6L 2WAQG 3DMUA 2E74C 1OXVA 3EJIA 4RGMA 2JE6I 2JA5B 1J8IA 3RZDH 3AEVA 5E4WC 2R93B 3LNNA 4JI3Q 1KNAA 1QILA 1UE1A 4AH6A 5EKKA 2ZJRA 3AU7A 1K0SA 3S2DB 2BE5C 4RHSA 3GV3A 4YWMA 4C2MB 3FP9A 5J22A 3I73A 5JEAH 4FDBA 1V1PB 2DNCA 1XMQL 4DK6C 2F3VA 1VQOA 5FO8B 3PO2H 3H6MA 1GVPA 1IKLA 3GTPB 4IOAA 3I91A 5CV5A 4NP5A 3WOEA 1BNZA 1HA5A 1HR0Q 3PO3B 2N78A 2PQAA 5M5XB 4ME3A 1VQBA 3DWQA 4CDEC 3HOWG 2EY1A 3HZXA 4IPHA 2AQ2B 5FLXE 3EN2A 3BVMA 4JI5L 4A3DH 3BS1A 4DPGA 3HOZH 4POFA 1BBXC 4JBKA 2K6AA 2LY7A 5EGTA 1T5EA 5HGTA 2QDLA 1LABA 5EAYA 1CZWA 3ND8A 2AQ1B 4LUVA 3J81j 4A3JH 4DAYB 2YV5A 3NK9A 4N9PA 1A62A 1WTVA 2PMZB 1JORA 2UUAL 2ZTCA 1VQCA 3KLSX 4DK3C 1KNEA 2KCCA 1IW7C 1I4RA 3ULLA 2UXDQ 4PG3A 4DV4Q 1XYIA 1OXXK 2F0PA 5C3WA 1GUGA 4BBRH 5A2QL 5M9OA 5J3BA 1JJ2A 4B9WA 1NBWA 3KF8B 3H09A 1PFSA 1GOZA 1HUMA 5CC4A 5C3EB 3PIO3 3CCJA 2CW0D 2PPBC 1YITA 2K28A 3ULJA 4KK7A 1SR3A 4QIWE 5IYBG 1PH2A 3FVQA 2L4NA 3NBIA 4N8X1 4QIWB 3HS0C 3QR8A 1JJGA 2Q2TA 4DXFA 1CK1A 3RD4A 1TWAH 2JQOA 3RLFA 4R8IA 4A3KG 2OXPA 4LUZA 1GO3E 5LMNL 1YJNA 2LKVA 4R4QA 1N33L 4LFCQ 2O4XA 4YHHL 1BF4A 1LV9A 3FMCA 3I4NB 3MXUA 2UU9L 2CWAA 4B3TQ 2N3SA 1RKNA 1S40A 1II3A 1SYEA 4A3MH 4NXNQ 1WD0A 4DR7L 3J80i 1E2ZA 5EKLA 4HCSA 2EJGC 4HMJA 3J7AV 1HFNA 5CMDA 1RTOA 2E2HB 3A7LA 3GTJB 1O78A 2B2UA 3UDXA 1ICWA 4JOIC 3SR1A 1D1IA 2G9HD 3BG3A 3A5ZB 1PHJA 1J6QA 2B39A 5C0XH 3DM3A 2VB3X 4JI8L 4IUUA 2X6GA 5M5WB 1O7LA 1ONLA 5LMUL 3RR5A 3I4MB 3FRPB 2OEOA 2XWBB 5JEAG 1ILPA 4UDUC 1A6XA 3PO2G 1PZJD 3PQIA 1RDPD 5IT9E 4IFDH 4XIGS 1K9MC 1YHAA 5FKAC 1Q1BA 3TN2A 2ZXPA 1A3VA 1V1OA 2B63B 4RHRA 2D0PA 4CKCA 1VQFA 1HNZQ 3TMEA 2K1BA 3E5SA 4HSVA 3GTOH 3M4OH 1HNXL 1M8AA 2XRSD 2CWPA 3BYTB 3TP7A 1BQQT 4IPCA 3VR4A 4HJ5A 2UXCL 1QE6A 2L1BA 2B8FA 3GP7A 4L5TA 2MFIA 1NJIC 3K6OA 4GOPA 3HOZG 2IPKD 2L15A 4P75A 1SLJA 5JVG3 4UHVA 4GNXB 1CHQD 1QCBD 1PRTC 1ZXTA 3HP3A 5A35A 5AJ3Q 2A74C 1Q82C 4JI0Q 4A3JG 4OELB 4ZKBB 2E2JH 4I7ZC 5JAVA 3BDOA 5KYLA 2BH8A 1VQ9A 2EXZA 1KHIA 1PVOA 1WTPA 1H95A 1EY9A 1HZ9A 3E9IA 1PZKD 4LMQD 4BBRG 4RAUC 3KBXA 5NUCA 3PUZA 1FNVA 3CU7A 3O13A 4IUNA 2VNUD 1DYQA 2JN4A 4FO2A 1SYFA 5EPLA 4JI4Q 1IBML 3G7LA 2HHHQ 4A3FH 4OGQC 1Q12A 4AIMA 3F2BA 2FFKB 5IGFA 2F0NA 5C4ZA 1EWHA 1HCZA 1U4MA 4LF8Q 3H94A 3MEHA 3EQLC 1S5CD 1FNWA 1BKBA 1J5EL 1FL0A 3R3OA 4DF7A 1N36Q 2PZWA 4WJ4A 4XQQA 3KUPA 3SK5A 5COYA 1I5FA 5JJLA 2B3GA 3SGIA 4JYAL 1U9RA 2E2IB 2ALYB 2NZOA 3MXGA 2F0DA 5C6AA 4CDCC 1GUWA 3HOVH 3A56A 4LJZC 3TS0A 4K6DA 4U673 4X65L 1HA6A 2YU9H 2DNEA 1GUNA 5E7NA 1I4XA 4QCLA 3SHLA 3TREA 3GTKB 2VQEQ 1D5XC 4KY7A 1I4PA 4KJNA 3H15A 4WRDA 3FHWA 3K7UC 4HEDA 5IWAL 2K05A 3PUVA 3F2CA 3A8KE 5EPKA 3U9SA 1V8QA 4XYQA 4MZ9A 1B9MA 3MXNA 1YJ9A 3RMHA 5IY0A 3KDFB 1AP0A 1PH8A 1XNQL 4LF5Q 1CKOA 4DUZQ 1TY2A 3EFXD 1PFMA 4BBSH 2F52A 1FVIA 1AEXA 1FD7D 4R4IA 4HIDA 2JA6B 1TVXA 2R92B 3UE0A 4R4TA 2RDFA 3MEFA 1GM5A 1A3TA 1HH2P 5ELFA 4X3KA 1VCIA 2ZJQA 4BY1H 1X32A 1WTQA 3S1RH 4K5VA 4AYBG 4X3TA 4P2CB 1S5DD 3RLNA 1CA5A 5FO7B 1PH9A 5IGEA 3A0JA 2A1AA 4K5XA 2SEBD 1K83H 1YZ6A 2R6GA 2FJ2A 1F9PA 3G71A 4IFDG 2WKDA 4A3BH 3CCMA 1I6HB 4DV3L 5T1GA 2ZJPA 4A3GB 2A19A 1IL8A 2F0FA 4RKBA 4DV5L 1T5XD 1IXRA 3CCLA 2K04A 5JJIA 3IRBA 2EPBA 1SFOB 1EYGA 4B3RQ 2C5CA 2R7ZB 1AE3A 2JJQA 2FINB 3VR3A 3BVGA 5HURA 1MIUA 1TT2A 1WCMH 1JT8A 1QNKA 4FXDA 3GTMH 4KN4C 1STEA 1E24A 1RTNA 5KRUA 2BDOA 2K52A 1K8OA 3K0YA 1GUSA 4HJ7A 1V1PA 3C1FA 2KQ3A 3I56A 1LTID 2SNSA 1EFID 4DFAA 1HTLD 1KRSA 2JP1A 2DJFC 3QB3A 3E0EA 4K5WA 3NELA 2PW7A 1VQEA 2FXQA 3HG9A 1XNRQ 2P5ZX 3URYA 1S72A 4MNOA 2EZVA 4I7AA 1KC8C 2B2WA 2AUJD 2B2UC 3CQZB 4KY6A 1VQ6A 3EBEA 1VQNA 2F4VQ 1JCKB 3CMEA 1I50B 4A3IH 5J1ZA 1SYCA 2Q2IA 4GLAC 2XWJB 4J6HA 1FJGQ 1NAPA 3CCQA 4G57A 4UPAA 2NVXH 1HJPA 1BDOA 4GN5A 3PIOA 2ID0A 1U4PA 4ODGA 3DEOA 5I9OA 4KHZA 2K01A 1QZGA 2R3ZA 5EQ0A 1SJED 3BDCA 4JG2A 4A3EH 4KV6A 4DR4Q 3HOVG 1G91A 4TKOB 1L0WA 1JE4A 1ZYRD 1HQMC 3KF8A 3GD7A 3P7JA 2CHBD 5KGUA 1WTXA 2X6LA 1EOTA 1JC7A 1TR5A 1SE2A 3HOWB 4X66Q 2F0QA 2K50A 2GVBA 3A8IE 1JE5A 3LWEA 2Z4IA 4DR2L 4WJWA 4R1JA 1F9SA 2PNRC 2UXBL 3ND9A 2NTTA 1FGUA 2MO0A 4XQJA 2AUKA 1SXTA 2MNAA 4YY3L 1SMYD 1Z47A 1DGSA 1Y1VH 4N9TA 4BBSG 2B2TC 1K0RA 4M8AA 4O0AA 3M7GA 2V4DA 1QWYA 5D3IB 4CJ1B 3DHQA 5FLMH 3QO2A 1C48A 5GAEC 4BY1G 4MN3A 1C0AA 2F03A 3ZJYC 3TZDA 5CV6A 1SROA 3K58A 4Y52H 4BY7H 4LF7L 1TWCB 1YHQA 4A3BG 1IBKQ 2Z9HA 2F0MA 2J4XA 1OXTA 3OW7A 1SNDA 1R9TH 2EIFA 3STBD 2CCZA 3GTLH 3HOUH 2MJ8A 3NBHB 2JEAI 4JI6L 3DWAA 1DOMA 3S1NB 4XTCS 3OTOQ 4KKSA 5CBAE 4K8IA 4LF6Q 4A3KB 3JAME 1TS4A 1PYSB 2NVTB 1PTOH 4NB3A 2WB1E 1CHPD 1Q3LA 5E4XA 4OWWB 1B3QA 4GLVB 2B8GA 1HNWQ 3OSOA 2NZ1D 2F0UA 2RHQB 2WB1B 5FOBB 3S14B 2MGSA 2ICIA 5M3MH 1SMXA 3KF6A 3R2IA 1TWFB 4ME5A 4A93H 5K36H 4L6TB 4IN3A 1XMOQ 2KCTA 3K5OA 2Q8RE 4DV0L 4L5SA 2EXDA 2KCNA 4IQZA 4LF4Q 2NN6I 4POGA 1SSOA 1XXGA 2X69A 2A6ED 2Y0SG 4U68A 4GKJQ 4GN3B 1Y69U 2L12A 5T1IA 2Q2UA 1TS3A 2IT1A 4KTAA 4RWSC 4TQUS 1BCPB 4DK1A 5JEAJ 1E7ZA 4JI3L 4A3IG 4JBJA 4DKAC 2BA0A 5I2YA 4UP7A 3MA2B 2MPMA 3UE1A 5CV4A 4DGZA 1H9MA 3VR5A 2EDGA 4FP5D 3S24A 1EY0A 2SNMA 1Y8OB 1VQJA 1GHJA 2QCPX 3K59A 1Y8NB 2ZT9C 4ZUIA 2K5DA 4KY5A 5DLQE 4F7XA 4A3EG 1G8ZD 2LFNA 4IURA 4HN7A 3H0GH 3TRZA 4OX9Q 4E6IA 1EQTA 1HR0L 4LF9Q 4IOCA 3F8TA 1EIYB 1I4HA 2N88A 2JSOA 3CCUA 2IX1A 1LTBD 2R7DA 1BVSA 3CCSA 1X55A 3C3LA 3EVQA 3CHBD 2RSNA 4B9XA 3J81E 3K5LA 4KD3A 4XT1B 4A3DB 3FPUB 1G2TA 3L2PA 3HOZB 4H02A 1STAA 3F2DA 1MJEA 2NVYH 1XPUA 2K5QA 1Y1VG 5C4HA 1ASYA 1SNQA 5GADC 4A3JB 4JI1Q 1KLGD 1STBA 3I72A 3VYSA 1KAAA 1L1OB 3ER0A 5LL6X 1NE3A 2UXDL 3V05A 1B8AA 1QOHA 1V43A 2XSCA 4DV4L 1PH5A 3K81C 2ES2A 5KNCA 1LUZA 2IHFA 3AFPA 1EZ6A 1RD9D 4P73A 4ZKCB 5FLMG 1IYJB 3EIVA 2VL6A 1MHWC 2PMZE 1V1QA 1B53A 3PSIA 3GTQH 3RLOA 1S3OA 2DUDA 1YHBA 1ENFA 1KLUD 3L3OC 1YNNC 2B2WC 4BY7G 2BCOA 2XRQD 2FHTA 2UUCQ 1H9RA 3PO3H 4WFN3 3PV0A 1XPOA 5M5XH 1WD1A 3DEPA 5C44G 4TRDA 3HOUG 3CKIB 3BYYB 2XGTA 5GAHC 3W1BA 3TSSA 1TWAB 3DM1A 4ZYSA 2F0GA 1X54A 4LFCL 1LT5D 2JA7H 2K5VA 3I4OA 1NSNS 5ELNA 1MSGA 1X3FA 3W2DA 3OWEB 4DR5Q 3WOFA 2RKSA 2EVBA 4B3TL 4ZRZA 1X9NA 5M3MG 3DWPA 1H9JA 3K5MA 4DK0A 1AE2A 4A93G 2RDGA 2GN5A 5K36G 2NUCA 2UUAQ 1E0BA 5CYUA 5IGGA 3CP0A 1LT6D 1JOQA 2F0EA 4NXNL 1YEZA 4A3MB 1JR0D 5C0XJ 1WVLA 4DR6Q 1VQAA 4K0KL 5DM63 1JQYD 3J7YW 1ZEQX 2QGQA 1HRJA 4Y7NH 3VA7A 1ML0D 5A2QE 4LFBQ 3SE0A 4ZK9B 1EYDA 3S1MH 4O42A 3J80L 4K2KA 5C4XH 1ENCA 1D7QA 4X62Q 3I2ZA 4IFDJ 1C9OA 3LGJA 1TS5A 1VQGA 1EIHA 1EY6A 1QJOA 4PV1C 4JBMA 1H9SA 1U0LA 2F3IA 3BZCA 3W1GA 3AMUA 3KJPA 3PCOB 5IE8A 1CA6A 1P16A 3RZOH 1EUJA 3H0GG 3NTKA 2UU9Q 1HNZL 3S1QH 4DV2Q 5FJ8H 2PZTA 3JC66 2JEBI 1SJHD 3GDEA 3M4OB 3D8GA 4RMFA 2UUBQ 5EJWA 1T9HA 3OOCA 3H3VC 3ERSX 1DZ1A 1N34Q 3NTHA 1KDCA 1HZBA 5JOBA 4IUVA 4CKBA 1UEBA 4NXMQ 4DR7Q 1NCVA 4DNRB 4LW1A 3GTGH 3NXWA 3S16H 2A6EC 1FR3A 5AJ3L 4JI0L 2RCNA 5IOCA 4KHPQ 1X65A 4KJOA 2ASBA 1IYUA 4R4OA 4B3SQ 2E2JB 1I3QH 3CPFA 4DUYQ 1A0IA 3T16A 2BH2A 2SOBA 4L8JA 5M5WH 3N52A 3R8BA 1K8GA 3NTIA 3I8ZA 1QB5D 3IL8A 3VA5A 4HAEA 1Q1EA 1SE8A 1YNXA 2D5DA 3NP8A 2QW7A 4CJ2C 3BZDB 3UI2A 4J15A 5L37A 3HOXH 2EOTA 2B2TA 1HXYD 4A76A 1Q86C 1PA6A 4C1NK 5CV9A 4I65A 4QUCA 2R7FA 2RCFA 3HKZG 4G7OC 4JI4L 1NTGA 2KHSA 3NSWA 2CKZB 2HHHL 2JA8B 4ALPA 4AQYQ 3K7AH 4ZCKA 4UP8A 1RODA 4A3FB 2B63H 3I3CA 4ZQ3A 4DNIA 2KUMA 3PO3G 2D62A 3VYTA 1RCVD 4GNXC 4LF8L 2RQXA 1U4RA 2VS1A 2L55A 3TS2A 2Z4HA 3M3YH 2O5JC 3I7FA 1CKNB 3FKIH 4ZUJA 2WINB 3PMFA 3MXPA 2JA7G 4FVMA 4EVOA 3ONAB 1IBLQ 4HR7B 1NUCA 3HOVB 2ZXOA 2B2YC 2YU9B 2KVMA 2CH4W 2K4KA 2VQEL 4L63B 3S9WA 1K3RA 1Q7YC 4X64Q 2AWOA 5H1SE 5I6WA 4KI0A 1L0XB 1QVCA 1UE7A 3NEMA 3NWTA 1UWVA 2CH4A 2F0SA 1E1TA 3QG1A 2YYZA 5D14A 5BR8Q 4LF5L 2PQAB 5C3EG 1VQIA 4DUZL 3L0OA 2GA4B 3SK8A 3G4SA 2KECA 1CKMA 3RN5A 1PTOD 5C4XG 4JBWA 1KD1C 4RFBA 3C2PA 1OO9B 2BOSA 3KOJA 2I0QA 2XN9C 1VQMA 1P8LA 3D6CA 4HJAA 4BY1B 4QB4A 4JC0A 1EZ8A 3S1RB 4A75A 5KYIA 1NNXA 1DJRD 1X6OA 1BOSA 3VR6A 2CW0C 3T51B 1Y8PB 2E5LQ 2A6HD 3CXCA 1B1ZA 1K83B 2VUMB 3Q22A 3T1HQ 1TWGH 1JB7A 2YTVA 3LWUA 4A3BB 4YCWA 1KABA 3I70A 2D9UA 2K5WA 5FJ8G 4X3SA 1A2UA 4FF4A 1K28A 1L2FA 1EU3A 4IPDA 1HHVA 1HZAA 1ET9A 2C35B 1B7YB 3OYYA 5C4JH 3D31A 4DR3Q 2OCEA 2NN6H 4HIKA 4B3RL 2O2LD 3CF5A 2GVAA 3S17H 2HQEA 4MHEA 3F1ZA 4MTNA 5EPJA 3S15B 4NKLA 2ENBA 2V1CC 5HY6A 3RN2A 1WCMB 1SBBB 3GTMB 2Z6KA 1SE4A 3HOYB 4OONA 2KENA 3NPPA 2NWGA 5ELOA 5C5LA 4X6AH 4DV1Q 1PYBA 1SEBD 1BCPD 2EYJA 3K0XA 1TS2A 1JWMD 3AB9A 3P75A 1O7YA 1PH1A 2JXMB 2EE1A 1E2VA 3I4MG 4LFAQ 2K5HA 1D8LA 3KBGA 4BS9A 2Y0SB 5CV7A 3HOXG 2F3WA 1XNRL 4BXXH 2SDFA 1SYGA 2EYOA 3BDLA 1D6EC 1STNA 4QMGA 2DGYA 3J7AF 1PFBA 1I4QA 1WJJA 2XTIA 4L5RC 2FMCA 2VXWA 2F4VL 5GQOA 1SNMA 2I5HA 2LS01 1X3PA 2OQ0A 2B63G 4A3IB 5C3XA 1NR2A 4A3GH 1RIPA 2RSOA 2PQEA 4GKKQ 1K8MA 1FJGL 4H7BA 1NR4A 3A54A 1N32Q 2WAQE 2XNAC 3E3XA 3OMCA 3BVZA 4HJ8A 1EYAA 3PUWA 2NVXB 4UAIA 3NUCA 1VQHA 2H5XA 4H0LC 2WAQB 1L1OA 4OXPA 3OWFA 3V96A 5I4DA 1B44D 1VQKA 3FKIG 4XXEA 5FLXc 2PW5A 1VQ7A 3KYHC 3H3VI 2H1EA 1TWHH 4OO1H 3QIAA 1EOVA 4DR4L 3P1HA 2K5NA 4A3EB 1CSPA 4GZYC 1S5BD 1EYCA 1LTTD 4DAYA 4C56C 1YI2A 5JVH3 1DXMA 2F0TA 4HMIA 4N8FA 4CJ0B 4MIUA 1JOKA 2QILA 5CV8A 4X66L 2L0CA 1CTMA 1EEFD 3TZUA 3MWYW 1Z7TA 3N6RA 2Z0SA 2D0OA 1E3PA 1Z9FA 4NPSA 1HTPA 2K33A 3Q23A 5DM73 4QY7A 3GO5A 2Q2HA 1GJXA 3K8AA 4HSPA 3EROA 3TEHB 1GXDC 3S2HH 1Y1VB 1PLFA 1XX8A 3CQZH 4RCOA 1YNJD 2MO1A 1PMRA 3C46A 1LTGD 3EA6A 2KA7A 1X56A 3ZYYX 3OIQA 4IPGA 5M5YH 4DR1Q 4GOPB 3M85A 1KL9A 3PIP3 2HIVA 4H44C 1AH9A 2VQFQ 4A3CH 1PTOF 4DU9A 1KDAA 2G5DA 1CFMA 1A2TA 1G6PA 4MTKA 1VQ4A 1DM0B 4RG1A 4EQNA 4BY7B 3NWSA 4G7ZC 3HKSA 1IBKL 1NY4A 2A69D 1PYWD 2M2LA 4J1MA 3TP8A 1WOCA 4WORA 1VF7A 1LT3D 4A3LG 4C3IH 1DONA 1R9TB 1LO5D 3GTLB 3HOUB 1VF5C 2NN6G 2OTLA 1B4OA 3OTOL 3SVMA 4LF6L 1HUNA 2F0WA 1LTAD 1LACA 1B50A 4CKEA 2N49A 1PTOB 3MFYA 5M3FH 5DEHA 1DOLA 2PNHA 1HNWL 1XTDA 5J39A 2NVQH 5IP9H 4IZ8A 2F0HA 5C44H 3NQTA 3PUYA 1TKWB 2ATWA 1I4GA 1MSHA 1VQ8A 5M3MB 1EWIA 5LMNW 4WJ3M 1QZHA 4BWGB 4DAPA 4KKTA 1XMOL 2JA6G 4A93B 3CMAA 2R92G 1JB3A 2IHEA 2NTSA 3VR2A 4EX5A 4B3MQ 1R4PB 2BA1A 4JV5Q 2CFMA 2IWHA 1CZGA 4JI7Q 1XPRA 1BCPF 4GKJL 2E76C 4BXXG 1HQRD 1BO0A 1WI5A 5E3FA 2WP8J 5HGQA 3U9OA 4DV7Q 4GLXA 3LX0A 4TSSA 3TP5A 1Q81C 5IT9c 4ID6A 2D2CC 4A3GG 4PZ6A 5KIXA 4R8NA 5IODA 3NQIA 4LK1C 1I94Q 3W3AA 1X3GA 3MXNB 1JWSD 1YBYA 3IFTA 3S1NH 4HTHA 4DN4M 1FGBD 1D1KA 4K6LA 1SDFA 1MGSA 3C1EA 5IP7H 3RZDB 2RF4A 3G48A 4C3JH 5BN5A 2QKIC 4YWKA 4DAMA 1KIXA 4OO1G 2A73B 4XDXA 4GNXA 1Q90A 1EQVA 1K3BC 4OX9L 3H0GB 2I5LX 3T1YQ 4LF9L 4JVZA 1SNCA 2XIWA 1LTSD 3Q8DA 3VYUA 3D4RA 4JI2Q 1A63A 3PO2B 5CORA 1VS0A 1IZ6A 2AHOB 5TSSA 1VDZA 2IX3A 3QOLA 1F9QA 4C3HH 1Y1WH 1OTCA 2L9HA 2K75A 3NHHA 1PRTD 2HDMA 2B2YA 2Z6KC 1XJVA 5ELCA 1Q8KA 3T53B 4OWTB 1PH6A 3SEBA 1SE3A 2B2VC 3MZ5A 5FLXL 2MHVA 2F0OA 4JI1L 1B9NA 3QWNA 4PMWA 3Q24A 1CKNA 3ITPA 1EIFA 2Z8LA 1AZPA 4EQPA 1BBWA 1PDQA 1WTHA 2M00A 3Q0AA 4L5QA 2ZM6Q 1TU2B 3E9HA 4A3CG 2LXKA 4DV6Q 2JA5H 3GTQB 4G4KA 3F2UA 3HKZE 1BUVT 4OO1I 2R93H 1CI3M 1F9RA 2IJ0A 1K8AC 3HKZB 1TQOA 2EY5A 4OEMB 1RF2D 1K73C 2UUCL 4R4CA 1QNUA 3S2DH 5K5PA 4C2MH 2EQSA 3I4LA 3IAYA 2K03A 1EY7A 2QDBA 4K2LA 4C3IG 4BBRB 2QA4A 1QVGA 4FXKC 1BR9A 4XT3B 3TDQA 1XMQQ 1UNSA 4F87A 3GQBA 2RA4A 1WYDA 3GTPH 1L1OC 4Z9CB 4F88A 1JICA 2KHIA 5JJKA 5M3FG 4FYDA 2JA7B 4LNQA 2DY7A 3SXHA 4KLKA 3MHBA 5IP9G 3KDFA 2HIXA 1PH4A 3ICEA 4NMZA 4DR5L 4JCVE 2N55A 1M1KC 2PI2E 5CR3A 4PQXA 1ZYRC 1CQVA 5BN3A 3K80C 5DAUA 3OHXC 1G2SA 1UEAB 4KD4A 4FF1A 1F2YA 5JJZA 2HCIA 4JI5Q 1YNJC 2NZHA 1YIJA 1FYCA 3P20A 4DR6L 1O7IA 1XWEA 1OXUA 4CBVA 3U4VA 2EYPA 1QUQB 5D3DA 1IYVA 1SMYC 4Y7NB 4LFBL 3MVVA 4KKUA 1A15A 2ZXRA 2VY3A 3BU2A 1GKHA 3S1MB 2Z1CA 1LTRD 4JK1C 1SRUA 1G291 4X62L 5C4XB 2ICEC 2A69C 4UP9A 1O7ZA 1F2MA 1CQFA 2PYKA 5C3EH 1AZQA 3OW2A 3MAQA 4M1UB 2YTXA 1DCZA 2AQ3B 5IP7G 4EQOA 1ILQA 4C3JG 4PMBA 5LHY1 3OMGA 2WB1G 3RZOB 4JW0A 1V9PA 1ET6A 2KJXA 2PZUA 1PZID 4DV2L 3QOJA 4AYBE 3S1QB 1EWCA 3STBC 5IT9L 5CBEE 2UUBL 4AYBB 1C4QA 2F0KA 1EU4A 1O80A 2H4OA 5LMNQ 1N34L 1N33Q 5KNBA 1YVCA 4YHHQ 3WDNA 2RHSB 3I4NH 4C3HG 1Y1WG 4NXML 5LL6S 2I5MX 1SYDA 3DLLA 4KMUC 3CCRA 4K0KQ 1JWUD 1NMFA 4P71A 3WWVA 4EQ5A 3CC4A 1EQRA 3GTGB 3GTOB 1UE5A 1BXTA 3S16B 1EFWA 2XVSA 3J7ZC 4KHPL 3TP6A 1H9KA 4B3SL 1Z6HA 3PF5A 4FF2A 2HT1A 1TY0A 2J7ZA 1E22A 3M4PA 3X3MA 4DUYL 1PRTF 1I3QB 4K8JA 2OTJA 1LYLA 1CM9A 3BJUA 4IUTA 2WFWA 3A8JE 1VQPA 1QVFA 3ULPA 4V190 3J80E 4K14A 3NE5B 2E2HH 2M9VA 2YTYA 3GTJH 3HFZB 3H3VH 1PXUA 1ZKOA 1SAPA 2JA5G 1S5FD 3HOXB 3PGZA 2R93G 3KF6B 3U50C 2BDNA 2WACA 2A8VA 3IFDA 3ERQA 1E1OA 1N9WA 5AFWA 4AQYL 4JI8Q 2DJGC 4RKLA 4CHTB 3K7AB 3HEJA 4OIKA 2EJFC 1UAPA 3I4MH 1PRTB 3PIPA 5LMUQ 4OL7A 3VDYA 3U4ZA 3OIPA 1I6VC 4H13C 2E2DC 2OWOA 4QGUA 1PH7A 2WIIB 2K7VA 3GV6A 3M4QA 4OIJA 1BBUA 1NMGA 1PFNA 3M3YB 5I6YA 4A3DG 3FKIB 4R9WA 3SK6A 3MFGA 2FMMA 4O1NA 4G7HC 1IBLL 2WKCA 3PUXA 1HNXQ 3M4YA 1GUOA 5ISRA 2UXCQ 4JPBW 5IGDA 1N36L 3D4DA 1GUTA 4X64L 2HQLA 4ZLTF 1R4QB 3Q6SA 1MI2A 5BR8L 3IKJA 2Q8IB 3D6WA 4DXGA 2OF1A 4DAVA 2JA8H 5ELDA 1IHZA 4RGTA 4OWXB 1KAWA 3J7A5 2QEXA 1JMCA 1X3EA 2Z6BA 1SNPA 2R61A 1Q46A 2DY8A 2F0VA 2OQKA 5I9PA 2E75C 4OHJA 4XYOA 1STHA 3NBHA 3AYHB
chains in the Genus database with same CATH topology
3UE1A 4X66L 4B3TQ 2N3SA 3JAMc 2Z0SA 5GROA 2KCMA 1C7YA 1IBMQ 2E5LL 2D0OA 1E3PA 1Z9FA 4NPSA 1S40A 3S24A 3T1HL 5IYDH 4QY7A 3GO5A 2Q2HA 4PZ7A 3K8AA 4A3MH 3TEHB 4NXNQ 4DR7L 3S2HH 1VQJA 3CQZH 3J80i 4YWLA 1IL2A 4DR3L 5DLQE 1J5EQ 2MO1A 4A3EG 1B70B 3H0GH 4BA1I 3TRZA 2ZTDA 2E2IH 5M5YH 4OX9Q 1X56A 4DR1Q 4IPGA 3UDXA 1CSQA 4GOPB 1HR0L 4JOIC 4LF9Q 4IOCA 3F8TA 1PV4A 1EIYB 3M85A 4A3MG 4HIOA 1PHJA 1KL9A 2AWNA 3A5ZB 3I4NG 1J6QA 2HIVA 1UE6A 3CCVA 1AH9A 3DM3A 2VQFQ 3CCUA 2IX1A 4A3CH 2R7DA 1VQLA 1BVSA 4JI8L 4X65Q 3CCSA 4BA2I 4A3LH 1U5KA 1X55A 3GTKH 1G6PA 1VQ4A 4DV1L 5LMUL 3RR5A 3L2PA 3AQQA 4RG1A 4H02A 3F2DA 1MJEA 3HKSA 1IBKL 5JEAG 1NY4A 2NVYH 1XPUA 5C0XG 2IY5B 1Y1VG 1WOCA 1SN8A 2VZAA 5IWAQ 3PO2G 1ASYA 5IYCH 3A74A 1ASZA 5GADC 4A3LG 4C3IH 4JI1Q 3M9BA 4XIGS 1K9MC 1YHAA 1Q1BA 4LFAL 1L1OB 2NN6G 2OTLA 3ER0A 3OTOL 1VQDA 2D0PA 4LF6L 1NE3A 4HJ9A 1XNQQ 2UXDL 1VQFA 5GAGC 1B8AA 4DV4L 1V43A 1PH5A 1HNZQ 3K81C 1Y14B 3GTOH 3M4OH 2N49A 1HNXL 2ES2A 1LUZA 4IJHA 2CWPA 2IHFA 3AFPA 2B29A 4GN4B 4P73A 4IPCA 5FLMG 5M3FH 4HJ5A 1IYJB 3EIVA 2VL6A 2JA6H 2UXCL 2VUMH 4IJLA 2PNHA 2PMZE 2R92H 1HNWL 1V1QA 1XTDA 3PSIA 2NVQH 3RLOA 5IP9H 1S3OA 2DUDA 3GTQH 1A8VA 1YHBA 4L5TA 2Y0SE 2MFIA 1NJIC 5C44H 3PUYA 1VQ5A 3PF4A 2LSSA 4GKKL 4LUOA 2ATWA 4GOPA 3HOZG 4BY7G 1VQ8A 3M7NA 1N32L 1EWIA 5LMNW 2L15A 4WJ3M 1QZHA 4P75A 2UUCQ 1SLJA 4QL5A 4TVAB 4GNXB 1XMOL 2JA6G 3CC7A 3CMAA 2R92G 2IHEA 5AJ3Q 4EX5A 1Q82C 4B3MQ 3CPWA 4JI0Q 3S15H 2BA1A 4A3JG 4JV5Q 3PO3H 3PV0A 1XPOA 5M5XH 2E2JH 3CD6A 2CFMA 4UY8C 5C44G 3HOUG 1I6HH 4JI7Q 1GD7A 2BH8A 2XGTA 5GAHC 3I55A 1KHIA 3W1BA 3J81c 4DV3Q 1XPRA 1VQ9A 3HOYH 4GKJL 1PVOA 4BXXG 1H95A 1WI5A 4DV5Q 2WP8J 5HGQA 1HZ9A 1LTLA 4DV7Q 1X54A 4LFCL 1EQQA 3E9IA 4GLXA 1SFOH 4BBRG 5C0XI 2JA7H 2K5VA 3I4OA 2R7ZH 1Q81C 5ELNA 3PUZA 5IT9c 1X3FA 4P72A 2VNUD 4A3GG 1MKHA 4DR5Q 4PZ6A 4B3TL 2JA9A 1X9NA 5M3MG 3U58A 1G51A 1I94Q 4JI4Q 1X3GA 3MXNB 1AE2A 1IBML 2HHHQ 4A3FH 4A93G 1LM0A 2GN5A 1Q12A 1YBYA 4AIMA 3S1NH 1HR0W 2AMCB 5K36G 2UUAQ 3F2BA 3CP0A 4IFDI 4NXNL 1YEZA 5IP7H 2CQOA 2RF4A 3G48A 4APVA 4C3JH 3NENA 1VQAA 5C0XJ 4LF8Q 4DR6Q 2JA8G 2MQHA 4YWKA 1BKBA 4DAMA 1FL0A 1J5EL 1KIXA 4K0KL 1N36Q 4OO1G 4WJ4A 4A3FG 4GNXA 1I5FA 2QGQA 5JJLA 4OX9L 4Y7NH 2B3GA 4DR1L 2I5LX 3SGIA 4JYAL 3T1YQ 4LF9L 2ALYB 2E8GA 4LFBQ 1JJCB 2NZOA 2LXJA 3S1MH 3Q8DA 2N8NA 1CUKA 2VQFL 5C4XH 3HOVH 3TS0A 4JI2Q 2PI2A 1D7QA 1A63A 4X65L 4X62Q 3I2ZA 4IO9A 2YU9H 1C9OA 1IZ6A 1VS0A 2AHOB 5E7NA 4IFDJ 3LGJA 1I50H 3TREA 4C3HH 2VQEQ 1VQGA 1Y1WH 1OTCA 3KFUA 2K75A 3H15A 3FHWA 4JBMA 5IYDG 2Z6KC 1U0LA 2F3IA 1Q8KA 3BZCA 3W1GA 1XJVA 4OWTB 3KJPA 1PH6A 1PH3A 3PCOB 5IE8A 3K7UC 3F2CA 5IWAL 3PUVA 3W5OA 1M90C 1P16A 4JI1L 1QUQA 3TQYA 4PMWA 3RZOH 4MZ9A 1CKNA 3CAMA 1YJ9A 5IY0A 3KDFB 1PH8A 3D0FA 1EUJA 4QJFA 3H0GG 3UDGA 2UU9Q 1HNZL 4O2DA 4LF5Q 4DV2Q 1EIFA 1OXSC 1CKOA 5FJ8H 4DUZQ 3S1QH 1BBWA 3JC66 2JEBI 4BBSH 3GDEA 2F52A 1FVIA 4RMFA 2UUBQ 4R4IA 1T9HA 4L5QA 4HIDA 2ZM6Q 4GOPC 3ERSX 2K14A 3E9HA 4A3CG 2LXKA 4DV6Q 3UE0A 4R4TA 3UDIA 1N34Q 2JA5H 3HKZE 3MEFA 1GM5A 4OO1I 2KBNA 1HH2P 1HZBA 1KQSA 2R93H 1VCIA 2ZJQA 1UEBA 4NXMQ 4BY1H 1K8AC 3JAMi 4DR7Q 3HOWH 1TXYA 3S1RH 1K73C 4AYBG 2UUCL 4GS3A 4R4CA 3S2DH 4JYAQ 4LW1A 3GTGH 3RLNA 3S16H 4C2MH 5AJ3L 1PH9A 4B3ML 3A0JA 2EQSA 2A1AA 4JI0L 4QQBX 2RCNA 4JV5L 5IYCG 4DR2Q 1K83H 1X65A 1YZ6A 2R6GA 2ASBA 3G71A 4KHPQ 4R4OA 4IFDG 2QA4A 1QVGA 4B3SQ 2UXBQ 1RL2A 4JI7L 1I3QH 3CPFA 4DUYQ 4A3BH 3CCMA 1A0IA 1MJCA 4DV3L 1XMQQ 2ZJPA 2A19A 4YY3Q 2BH2A 3BZKA 4JOIA 4DV5L 5M5WH 1WYDA 1IXRA 3CCLA 1K8GA 3GTPH 4DV7L 1L1OC 2KHJA 4A4IA 2KHIA 5JJKA 5M3FG 5JJIA 3IRBA 1EYGA 1Q1EA 1SE8A 1YNXA 4B3RQ 2VUMG 4LNQA 4KLKA 4J15A 1AE3A 5IP9G 3HOXH 2JJQA 2HIXA 3KDFA 1PH4A 3ICEA 4A76A 4DR5L 3CW2C 4JCVE 1Q86C 1PA6A 1M1KC 2PI2E 1MIUA 1W3SA 4LF4L 1WCMH 2IX0A 1JT8A 2R7FA 3GTMH 3HKZG 1I94L 3K80C 4JI4L 1NTGA 3AFQA 1E24A 2CKZB 4P74A 4ALPA 4AQYQ 2HHHL 3K7AH 4UP8A 4YCVA 2B63H 2VW9A 2K52A 3G6EA 4DNIA 4JI5Q 4HJ7A 3PO3G 2NZHA 2D62A 1YIJA 1TWCH 4GNXC 1WCMG 4LF7Q 4LF8L 4DR6L 1O7IA 5IYBH 2AKWB 2VS1A 3I56A 1OXUA 4YCUA 3HOYG 1KRTA 1KRSA 3U4VA 3UDFA 1W2BA 3TS2A 1QUQB 3M3YH 3I7FA 1CKNB 3J80c 3FKIH 3E0EA 3T1YL 4LFBL 2JA7G 3NELA 2R7ZG 4JI6Q 1HZCA 4A3KH 1VQEA 2FXQA 2VY3A 3BU2A 1GKHA 2NVTH 3L7ZC 1XNRQ 1S72A 4JI2L 4MNOA 1IBLQ 1SRUA 1G291 4X62L 3CC2A 1KC8C 1N8RC 1YJWA 1VQ6A 2JK8A 3EBEA 4UP9A 1VQNA 2K4KA 2VQEL 2F4VQ 3CMEA 4A3IH 3CCEA 3S14H 1K3RA 1Q7YC 4PZ8A 4X64Q 5C3EH 2AWOA 5H1SE 3OW2A 2Q2IA 4GLAC 4KI0A 4HIMA 2ZTEA 1QVCA 1UE7A 2YTXA 3NEMA 1FJGQ 1TWFH 5IP7G 3KJOA 3KLWA 1UWVA 3CCQA 2NVXH 1E1TA 4UPAA 1WFQA 2YYZA 1HJPA 2WB1G 4GN5A 4LWCA 1V9PA 3J81i 3PIOA 5BR8Q 3A5UA 2ID0A 4LF5L 2PQAB 5C3EG 4DV0Q 4DV2L 1VQIA 4DUZL 4AYBE 1KXLA 3L0OA 4KHZA 3G4SA 3STBC 3RNUA 2UUBL 1QZGA 1CKMA 3RN5A 3B6YA 4JG2A 4A3EH 2ZM6L 4DR4Q 5C4XG 3HOVG 4JBWA 1L0WA 5LMNQ 4DV6L 1N34L 2WAQG 1KD1C 1N33Q 3GD7A 1OXVA 1YVCA 2JE6I 4YHHQ 3RZDH 3AEVA 2RHSB 3KOJA 3I4NH 1Y1WG 4NXML 2I0QA 4JI3Q 1UE1A 1VQMA 4AH6A 1P8LA 2I5MX 2ZJRA 4HJAA 4JC0A 4X66Q 3DLLA 4Y52H 3CCRA 2K50A 4K0KQ 4A75A 2GVBA 1XNQL 3WWVA 1NMFA 4P71A 4EQ5A 3CC4A 1JE5A 1EQRA 1X6OA 4YWMA 1UE5A 4DR2L 1EFWA 3J7ZC 3FP9A 4KHPL 2E5LQ 3CXCA 4R1JA 3PF5A 4B3SL 2UXBL 2HT1A 3T1HQ 1E22A 3M4PA 1TWGH 4DUYL 1JB7A 1FGUA 2MO0A 2YTVA 4FDBA 1XMQL 2OTJA 4DK6C 1LYLA 4YCWA 2MNAA 4YY3L 1Z47A 1VQOA 1DGSA 1Y1VH 3BJUA 5FJ8G 3PO2H 1L2FA 1GVPA 4IPDA 2WFWA 1HZAA 1VQPA 1QVFA 4BBSG 3ULPA 2C35B 1B7YB 3OYYA 5C4JH 3D31A 4DR3Q 1K0RA 4O0AA 2OCEA 2E2HH 4HIKA 4IOAA 3CF5A 2YTYA 2GVAA 3GTJH 3S17H 4B3RL 3HFZB 3H3VH 3F1ZA 4MTNA 2JA5G 3PGZA 2V1CC 1HR0Q 2N78A 2PQAA 3KF6B 5HY6A 2R93G 3U50C 3RN2A 5FLMH 5GAEC 4ME3A 4BY1G 1VQBA 2A8VA 3HOWG 1C0AA 1E1OA 1N9WA 2Z6KA 4AQYL 4IPHA 3ZJYC 4JI8Q 4OONA 2KENA 3EN2A 5ELOA 4JI5L 4A3DH 3I4MH 4X6AH 1SROA 4DPGA 3HOZH 3PIPA 1PYBA 5LMUQ 4DV1Q 3VDYA 4POFA 4BY7H 4JBKA 3U4ZA 4LF7L 1YHQA 2OWOA 4A3BG 5EAYA 1IBKQ 4QGUA 1PH7A 3K0XA 4LUVA 1OXTA 3J81j 4A3JH 4DAYB 2YV5A 1R9TH 1PH1A 3M4QA 2EIFA 1BBUA 1NMGA 3STBD 2CCZA 1A62A 3GTLH 3HOUH 4A3DG 3NBHB 2JEAI 3I4MG 4LFAQ 2K5HA 1D8LA 4JI6L 2UUAL 2ZTCA 1VQCA 4XTCS 3OTOQ 4DK3C 4LF6Q 3HOXG 4BXXH 3ULLA 1XNRL 2UXDQ 4PG3A 4DV4Q 1PYSB 1IBLL 1OXXK 3PUXA 4NB3A 2DGYA 1HNXQ 2WB1E 1WJJA 4BBRH 2XTIA 4OWWB 4L5RC 2F4VL 5GQOA 4GLVB 5J3BA 1JJ2A 2UXCQ 1N36L 2I5HA 1NBWA 1HNWQ 3KF8B 2RHQB 2OQ0A 2B63G 4X64L 4A3GH 1PFSA 1RIPA 3CCJA 5M3MH 4GKKQ 1FJGL 1YITA 2HQLA 3ULJA 1SMXA 3KF6A 1SR3A 1N32Q 4QIWE 2WAQE 5IYBG 4A93H 1PH2A 1XMOQ 4HJ8A 3PUWA 2KCTA 1VQHA 2H5XA 5BR8L 1L1OA 4OXPA 4DV0L 4L5SA 2EXDA 1VQKA 3FKIG 4LF4Q 1JJGA 2NN6I 2Q2TA 5FLXc 4POGA 2Y0SG 1VQ7A 1TWAH 2JQOA 3KYHC 3RLFA 2JA8H 4A3KG 3H3VI 1TWHH 4GN3B 4GKJQ 4OWXB 4LUZA 1EOVA 1KAWA 2Q2UA 3J7A5 4DR4L 2QEXA 1GO3E 2K5NA 1X3EA 1JMCA 5LMNL 1YJNA 1CSPA 4R4QA 1N33L 2IT1A 4TQUS 1Q46A 4LFCQ 1YI2A 4YHHL 2OQKA 5JEAJ 1E7ZA 4JI3L 4A3IG 4JBJA 4DKAC 2BA0A 4UP7A 2UU9L 3AYHB 2CWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UE1 A;  4X66 L;  4B3T Q;  2N3S A;  3JAM c;  2Z0S A;  5GRO A;  2KCM A;  1C7Y A;  1IBM Q;  2E5L L;  2D0O A;  1E3P A;  1Z9F A;  4NPS A;  1S40 A;  3S24 A;  3T1H L;  5IYD H;  4QY7 A;  3GO5 A;  2Q2H A;  4PZ7 A;  3K8A A;  4A3M H;  3TEH B;  4NXN Q;  4DR7 L;  3S2H H;  1VQJ A;  3CQZ H;  3J80 i;  4YWL A;  1IL2 A;  4DR3 L;  5DLQ E;  1J5E Q;  2MO1 A;  4A3E G;  1B70 B;  3H0G H;  4BA1 I;  3TRZ A;  2ZTD A;  2E2I H;  5M5Y H;  4OX9 Q;  1X56 A;  4DR1 Q;  4IPG A;  3UDX A;  1CSQ A;  4GOP B;  1HR0 L;  4JOI C;  4LF9 Q;  4IOC A;  3F8T A;  1PV4 A;  1EIY B;  3M85 A;  4A3M G;  4HIO A;  1PHJ A;  1KL9 A;  2AWN A;  3A5Z B;  3I4N G;  1J6Q A;  2HIV A;  1UE6 A;  3CCV A;  1AH9 A;  3DM3 A;  2VQF Q;  3CCU A;  2IX1 A;  4A3C H;  2R7D A;  1VQL A;  1BVS A;  4JI8 L;  4X65 Q;  3CCS A;  4BA2 I;  4A3L H;  1U5K A;  1X55 A;  3GTK H;  1G6P A;  1VQ4 A;  4DV1 L;  5LMU L;  3RR5 A;  3L2P A;  3AQQ A;  4RG1 A;  4H02 A;  3F2D A;  1MJE A;  3HKS A;  1IBK L;  5JEA G;  1NY4 A;  2NVY H;  1XPU A;  5C0X G;  2IY5 B;  1Y1V G;  1WOC A;  1SN8 A;  2VZA A;  5IWA Q;  3PO2 G;  1ASY A;  5IYC H;  3A74 A;  1ASZ A;  5GAD C;  4A3L G;  4C3I H;  4JI1 Q;  3M9B A;  4XIG S;  1K9M C;  1YHA A;  1Q1B A;  4LFA L;  1L1O B;  2NN6 G;  2OTL A;  3ER0 A;  3OTO L;  1VQD A;  2D0P A;  4LF6 L;  1NE3 A;  4HJ9 A;  1XNQ Q;  2UXD L;  1VQF A;  5GAG C;  1B8A A;  4DV4 L;  1V43 A;  1PH5 A;  1HNZ Q;  3K81 C;  1Y14 B;  3GTO H;  3M4O H;  2N49 A;  1HNX L;  2ES2 A;  1LUZ A;  4IJH A;  2CWP A;  2IHF A;  3AFP A;  2B29 A;  4GN4 B;  4P73 A;  4IPC A;  5FLM G;  5M3F H;  4HJ5 A;  1IYJ B;  3EIV A;  2VL6 A;  2JA6 H;  2UXC L;  2VUM H;  4IJL A;  2PNH A;  2PMZ E;  2R92 H;  1HNW L;  1V1Q A;  1XTD A;  3PSI A;  2NVQ H;  3RLO A;  5IP9 H;  1S3O A;  2DUD A;  3GTQ H;  1A8V A;  1YHB A;  4L5T A;  2Y0S E;  2MFI A;  1NJI C;  5C44 H;  3PUY A;  1VQ5 A;  3PF4 A;  2LSS A;  4GKK L;  4LUO A;  2ATW A;  4GOP A;  3HOZ G;  4BY7 G;  1VQ8 A;  3M7N A;  1N32 L;  1EWI A;  5LMN W;  2L15 A;  4WJ3 M;  1QZH A;  4P75 A;  2UUC Q;  1SLJ A;  4QL5 A;  4TVA B;  4GNX B;  1XMO L;  2JA6 G;  3CC7 A;  3CMA A;  2R92 G;  2IHE A;  5AJ3 Q;  4EX5 A;  1Q82 C;  4B3M Q;  3CPW A;  4JI0 Q;  3S15 H;  2BA1 A;  4A3J G;  4JV5 Q;  3PO3 H;  3PV0 A;  1XPO A;  5M5X H;  2E2J H;  3CD6 A;  2CFM A;  4UY8 C;  5C44 G;  3HOU G;  1I6H H;  4JI7 Q;  1GD7 A;  2BH8 A;  2XGT A;  5GAH C;  3I55 A;  1KHI A;  3W1B A;  3J81 c;  4DV3 Q;  1XPR A;  1VQ9 A;  3HOY H;  4GKJ L;  1PVO A;  4BXX G;  1H95 A;  1WI5 A;  4DV5 Q;  2WP8 J;  5HGQ A;  1HZ9 A;  1LTL A;  4DV7 Q;  1X54 A;  4LFC L;  1EQQ A;  3E9I A;  4GLX A;  1SFO H;  4BBR G;  5C0X I;  2JA7 H;  2K5V A;  3I4O A;  2R7Z H;  1Q81 C;  5ELN A;  3PUZ A;  5IT9 c;  1X3F A;  4P72 A;  2VNU D;  4A3G G;  1MKH A;  4DR5 Q;  4PZ6 A;  4B3T L;  2JA9 A;  1X9N A;  5M3M G;  3U58 A;  1G51 A;  1I94 Q;  4JI4 Q;  1X3G A;  3MXN B;  1AE2 A;  1IBM L;  2HHH Q;  4A3F H;  4A93 G;  1LM0 A;  2GN5 A;  1Q12 A;  1YBY A;  4AIM A;  3S1N H;  1HR0 W;  2AMC B;  5K36 G;  2UUA Q;  3F2B A;  3CP0 A;  4IFD I;  4NXN L;  1YEZ A;  5IP7 H;  2CQO A;  2RF4 A;  3G48 A;  4APV A;  4C3J H;  3NEN A;  1VQA A;  5C0X J;  4LF8 Q;  4DR6 Q;  2JA8 G;  2MQH A;  4YWK A;  1BKB A;  4DAM A;  1FL0 A;  1J5E L;  1KIX A;  4K0K L;  1N36 Q;  4OO1 G;  4WJ4 A;  4A3F G;  4GNX A;  1I5F A;  2QGQ A;  5JJL A;  4OX9 L;  4Y7N H;  2B3G A;  4DR1 L;  2I5L X;  3SGI A;  4JYA L;  3T1Y Q;  4LF9 L;  2ALY B;  2E8G A;  4LFB Q;  1JJC B;  2NZO A;  2LXJ A;  3S1M H;  3Q8D A;  2N8N A;  1CUK A;  2VQF L;  5C4X H;  3HOV H;  3TS0 A;  4JI2 Q;  2PI2 A;  1D7Q A;  1A63 A;  4X65 L;  4X62 Q;  3I2Z A;  4IO9 A;  2YU9 H;  1C9O A;  1IZ6 A;  1VS0 A;  2AHO B;  5E7N A;  4IFD J;  3LGJ A;  1I50 H;  3TRE A;  4C3H H;  2VQE Q;  1VQG A;  1Y1W H;  1OTC A;  3KFU A;  2K75 A;  3H15 A;  3FHW A;  4JBM A;  5IYD G;  2Z6K C;  1U0L A;  2F3I A;  1Q8K A;  3BZC A;  3W1G A;  1XJV A;  4OWT B;  3KJP A;  1PH6 A;  1PH3 A;  3PCO B;  5IE8 A;  3K7U C;  3F2C A;  5IWA L;  3PUV A;  3W5O A;  1M90 C;  1P16 A;  4JI1 L;  1QUQ A;  3TQY A;  4PMW A;  3RZO H;  4MZ9 A;  1CKN A;  3CAM A;  1YJ9 A;  5IY0 A;  3KDF B;  1PH8 A;  3D0F A;  1EUJ A;  4QJF A;  3H0G G;  3UDG A;  2UU9 Q;  1HNZ L;  4O2D A;  4LF5 Q;  4DV2 Q;  1EIF A;  1OXS C;  1CKO A;  5FJ8 H;  4DUZ Q;  3S1Q H;  1BBW A;  3JC6 6;  2JEB I;  4BBS H;  3GDE A;  2F52 A;  1FVI A;  4RMF A;  2UUB Q;  4R4I A;  1T9H A;  4L5Q A;  4HID A;  2ZM6 Q;  4GOP C;  3ERS X;  2K14 A;  3E9H A;  4A3C G;  2LXK A;  4DV6 Q;  3UE0 A;  4R4T A;  3UDI A;  1N34 Q;  2JA5 H;  3HKZ E;  3MEF A;  1GM5 A;  4OO1 I;  2KBN A;  1HH2 P;  1HZB A;  1KQS A;  2R93 H;  1VCI A;  2ZJQ A;  1UEB A;  4NXM Q;  4BY1 H;  1K8A C;  3JAM i;  4DR7 Q;  3HOW H;  1TXY A;  3S1R H;  1K73 C;  4AYB G;  2UUC L;  4GS3 A;  4R4C A;  3S2D H;  4JYA Q;  4LW1 A;  3GTG H;  3RLN A;  3S16 H;  4C2M H;  5AJ3 L;  1PH9 A;  4B3M L;  3A0J A;  2EQS A;  2A1A A;  4JI0 L;  4QQB X;  2RCN A;  4JV5 L;  5IYC G;  4DR2 Q;  1K83 H;  1X65 A;  1YZ6 A;  2R6G A;  2ASB A;  3G71 A;  4KHP Q;  4R4O A;  4IFD G;  2QA4 A;  1QVG A;  4B3S Q;  2UXB Q;  1RL2 A;  4JI7 L;  1I3Q H;  3CPF A;  4DUY Q;  4A3B H;  3CCM A;  1A0I A;  1MJC A;  4DV3 L;  1XMQ Q;  2ZJP A;  2A19 A;  4YY3 Q;  2BH2 A;  3BZK A;  4JOI A;  4DV5 L;  5M5W H;  1WYD A;  1IXR A;  3CCL A;  1K8G A;  3GTP H;  4DV7 L;  1L1O C;  2KHJ A;  4A4I A;  2KHI A;  5JJK A;  5M3F G;  5JJI A;  3IRB A;  1EYG A;  1Q1E A;  1SE8 A;  1YNX A;  4B3R Q;  2VUM G;  4LNQ A;  4KLK A;  4J15 A;  1AE3 A;  5IP9 G;  3HOX H;  2JJQ A;  2HIX A;  3KDF A;  1PH4 A;  3ICE A;  4A76 A;  4DR5 L;  3CW2 C;  4JCV E;  1Q86 C;  1PA6 A;  1M1K C;  2PI2 E;  1MIU A;  1W3S A;  4LF4 L;  1WCM H;  2IX0 A;  1JT8 A;  2R7F A;  3GTM H;  3HKZ G;  1I94 L;  3K80 C;  4JI4 L;  1NTG A;  3AFQ A;  1E24 A;  2CKZ B;  4P74 A;  4ALP A;  4AQY Q;  2HHH L;  3K7A H;  4UP8 A;  4YCV A;  2B63 H;  2VW9 A;  2K52 A;  3G6E A;  4DNI A;  4JI5 Q;  4HJ7 A;  3PO3 G;  2NZH A;  2D62 A;  1YIJ A;  1TWC H;  4GNX C;  1WCM G;  4LF7 Q;  4LF8 L;  4DR6 L;  1O7I A;  5IYB H;  2AKW B;  2VS1 A;  3I56 A;  1OXU A;  4YCU A;  3HOY G;  1KRT A;  1KRS A;  3U4V A;  3UDF A;  1W2B A;  3TS2 A;  1QUQ B;  3M3Y H;  3I7F A;  1CKN B;  3J80 c;  3FKI H;  3E0E A;  3T1Y L;  4LFB L;  2JA7 G;  3NEL A;  2R7Z G;  4JI6 Q;  1HZC A;  4A3K H;  1VQE A;  2FXQ A;  2VY3 A;  3BU2 A;  1GKH A;  2NVT H;  3L7Z C;  1XNR Q;  1S72 A;  4JI2 L;  4MNO A;  1IBL Q;  1SRU A;  1G29 1;  4X62 L;  3CC2 A;  1KC8 C;  1N8R C;  1YJW A;  1VQ6 A;  2JK8 A;  3EBE A;  4UP9 A;  1VQN A;  2K4K A;  2VQE L;  2F4V Q;  3CME A;  4A3I H;  3CCE A;  3S14 H;  1K3R A;  1Q7Y C;  4PZ8 A;  4X64 Q;  5C3E H;  2AWO A;  5H1S E;  3OW2 A;  2Q2I A;  4GLA C;  4KI0 A;  4HIM A;  2ZTE A;  1QVC A;  1UE7 A;  2YTX A;  3NEM A;  1FJG Q;  1TWF H;  5IP7 G;  3KJO A;  3KLW A;  1UWV A;  3CCQ A;  2NVX H;  1E1T A;  4UPA A;  1WFQ A;  2YYZ A;  1HJP A;  2WB1 G;  4GN5 A;  4LWC A;  1V9P A;  3J81 i;  3PIO A;  5BR8 Q;  3A5U A;  2ID0 A;  4LF5 L;  2PQA B;  5C3E G;  4DV0 Q;  4DV2 L;  1VQI A;  4DUZ L;  4AYB E;  1KXL A;  3L0O A;  4KHZ A;  3G4S A;  3STB C;  3RNU A;  2UUB L;  1QZG A;  1CKM A;  3RN5 A;  3B6Y A;  4JG2 A;  4A3E H;  2ZM6 L;  4DR4 Q;  5C4X G;  3HOV G;  4JBW A;  1L0W A;  5LMN Q;  4DV6 L;  1N34 L;  2WAQ G;  1KD1 C;  1N33 Q;  3GD7 A;  1OXV A;  1YVC A;  2JE6 I;  4YHH Q;  3RZD H;  3AEV A;  2RHS B;  3KOJ A;  3I4N H;  1Y1W G;  4NXM L;  2I0Q A;  4JI3 Q;  1UE1 A;  1VQM A;  4AH6 A;  1P8L A;  2I5M X;  2ZJR A;  4HJA A;  4JC0 A;  4X66 Q;  3DLL A;  4Y52 H;  3CCR A;  2K50 A;  4K0K Q;  4A75 A;  2GVB A;  1XNQ L;  3WWV A;  1NMF A;  4P71 A;  4EQ5 A;  3CC4 A;  1JE5 A;  1EQR A;  1X6O A;  4YWM A;  1UE5 A;  4DR2 L;  1EFW A;  3J7Z C;  3FP9 A;  4KHP L;  2E5L Q;  3CXC A;  4R1J A;  3PF5 A;  4B3S L;  2UXB L;  2HT1 A;  3T1H Q;  1E22 A;  3M4P A;  1TWG H;  4DUY L;  1JB7 A;  1FGU A;  2MO0 A;  2YTV A;  4FDB A;  1XMQ L;  2OTJ A;  4DK6 C;  1LYL A;  4YCW A;  2MNA A;  4YY3 L;  1Z47 A;  1VQO A;  1DGS A;  1Y1V H;  3BJU A;  5FJ8 G;  3PO2 H;  1L2F A;  1GVP A;  4IPD A;  2WFW A;  1HZA A;  1VQP A;  1QVF A;  4BBS G;  3ULP A;  2C35 B;  1B7Y B;  3OYY A;  5C4J H;  3D31 A;  4DR3 Q;  1K0R A;  4O0A A;  2OCE A;  2E2H H;  4HIK A;  4IOA A;  3CF5 A;  2YTY A;  2GVA A;  3GTJ H;  3S17 H;  4B3R L;  3HFZ B;  3H3V H;  3F1Z A;  4MTN A;  2JA5 G;  3PGZ A;  2V1C C;  1HR0 Q;  2N78 A;  2PQA A;  3KF6 B;  5HY6 A;  2R93 G;  3U50 C;  3RN2 A;  5FLM H;  5GAE C;  4ME3 A;  4BY1 G;  1VQB A;  2A8V A;  3HOW G;  1C0A A;  1E1O A;  1N9W A;  2Z6K A;  4AQY L;  4IPH A;  3ZJY C;  4JI8 Q;  4OON A;  2KEN A;  3EN2 A;  5ELO A;  4JI5 L;  4A3D H;  3I4M H;  4X6A H;  1SRO A;  4DPG A;  3HOZ H;  3PIP A;  1PYB A;  5LMU Q;  4DV1 Q;  3VDY A;  4POF A;  4BY7 H;  4JBK A;  3U4Z A;  4LF7 L;  1YHQ A;  2OWO A;  4A3B G;  5EAY A;  1IBK Q;  4QGU A;  1PH7 A;  3K0X A;  4LUV A;  1OXT A;  3J81 j;  4A3J H;  4DAY B;  2YV5 A;  1R9T H;  1PH1 A;  3M4Q A;  2EIF A;  1BBU A;  1NMG A;  3STB D;  2CCZ A;  1A62 A;  3GTL H;  3HOU H;  4A3D G;  3NBH B;  2JEA I;  3I4M G;  4LFA Q;  2K5H A;  1D8L A;  4JI6 L;  2UUA L;  2ZTC A;  1VQC A;  4XTC S;  3OTO Q;  4DK3 C;  4LF6 Q;  3HOX G;  4BXX H;  3ULL A;  1XNR L;  2UXD Q;  4PG3 A;  4DV4 Q;  1PYS B;  1IBL L;  1OXX K;  3PUX A;  4NB3 A;  2DGY A;  1HNX Q;  2WB1 E;  1WJJ A;  4BBR H;  2XTI A;  4OWW B;  4L5R C;  2F4V L;  5GQO A;  4GLV B;  5J3B A;  1JJ2 A;  2UXC Q;  1N36 L;  2I5H A;  1NBW A;  1HNW Q;  3KF8 B;  2RHQ B;  2OQ0 A;  2B63 G;  4X64 L;  4A3G H;  1PFS A;  1RIP A;  3CCJ A;  5M3M H;  4GKK Q;  1FJG L;  1YIT A;  2HQL A;  3ULJ A;  1SMX A;  3KF6 A;  1SR3 A;  1N32 Q;  4QIW E;  2WAQ E;  5IYB G;  4A93 H;  1PH2 A;  1XMO Q;  4HJ8 A;  3PUW A;  2KCT A;  1VQH A;  2H5X A;  5BR8 L;  1L1O A;  4OXP A;  4DV0 L;  4L5S A;  2EXD A;  1VQK A;  3FKI G;  4LF4 Q;  1JJG A;  2NN6 I;  2Q2T A;  5FLX c;  4POG A;  2Y0S G;  1VQ7 A;  1TWA H;  2JQO A;  3KYH C;  3RLF A;  2JA8 H;  4A3K G;  3H3V I;  1TWH H;  4GN3 B;  4GKJ Q;  4OWX B;  4LUZ A;  1EOV A;  1KAW A;  2Q2U A;  3J7A 5;  4DR4 L;  2QEX A;  1GO3 E;  2K5N A;  1X3E A;  1JMC A;  5LMN L;  1YJN A;  1CSP A;  4R4Q A;  1N33 L;  2IT1 A;  4TQU S;  1Q46 A;  4LFC Q;  1YI2 A;  4YHH L;  2OQK A;  5JEA J;  1E7Z A;  4JI3 L;  4A3I G;  4JBJ A;  4DKA C;  2BA0 A;  4UP7 A;  2UU9 L;  3AYH B;  2CWA A; 
#chains in the Genus database with same CATH topology
 1WTO A;  5D65 A;  5EBC A;  3R93 A;  2I46 A;  5IIF A;  3JAM c;  4BBS B;  5GRO A;  1STG A;  2PCF B;  2KCM A;  1C7Y A;  1IBM Q;  2E5L L;  2TMP A;  3T1H L;  5IYD H;  1TWG B;  4PZ7 A;  3FDT A;  4FNF A;  3SDZ A;  4YWL A;  1IL2 A;  1JOO A;  5ELE A;  4DR3 L;  1J5E Q;  2QF7 A;  5C4J B;  5KEE A;  1B70 B;  5FO9 B;  4BA1 I;  3S17 B;  2ZTD A;  2E2I H;  1S4Z A;  1CSQ A;  4JYA Q;  1PV4 A;  4A3M G;  4HIO A;  2AWN A;  4EGV A;  3I4N G;  1UE6 A;  3CCV A;  2IL8 A;  1VQL A;  2EY6 A;  4BA2 I;  4X65 Q;  4A3L H;  1U5K A;  2DN8 A;  4XQN A;  5E1F A;  3GTK H;  1ESF A;  4C1N I;  4DV1 L;  3K57 A;  3R2T A;  2A68 D;  3AQQ A;  3G6J B;  1ICF B;  3K5N A;  5C0X G;  5IGB A;  1GHK A;  2IY5 B;  2VZA A;  1SN8 A;  5IWA Q;  3A7A B;  1F77 A;  3A74 A;  4J8Q A;  5IYC H;  1ASZ A;  3M9B A;  1W6K A;  2HD3 A;  4LFA L;  2B2V A;  4HCE A;  1VQD A;  2KED A;  4HJ9 A;  1XNQ Q;  3VYR A;  5GAG C;  4FXG C;  1Y14 B;  1WTR A;  1F2Z A;  1EEI D;  4IJH A;  4GN4 B;  2B29 A;  2JA6 H;  2VUM H;  4IJL A;  3SK4 A;  2R92 H;  1HPC A;  1TII D;  3E6Z X;  3H91 A;  1A8V A;  3KLS A;  4RA8 A;  4B08 A;  1C8C A;  2Y0S E;  1VQ5 A;  5KND A;  3PF4 A;  2EJM A;  5IGC A;  2LSS A;  4GKK L;  4LUO A;  1HFG A;  3M7N A;  4NDX A;  4RGN A;  4IAL A;  1N32 L;  1SYB A;  4QL5 A;  4TVA B;  3CC7 A;  1E2W A;  1G6Z A;  3S15 H;  4Q0F A;  3CPW A;  3CD6 A;  4UY8 C;  4Q5V A;  4KN7 C;  1I6H H;  1GD7 A;  2BE5 D;  4DNT B;  3I55 A;  3J81 c;  4DV3 Q;  1STY A;  3HOY H;  1TWH B;  4DV5 Q;  1VMC A;  1IKM A;  1LTL A;  1EQQ A;  1SFO H;  5C0X I;  1MD2 D;  5G3L D;  2R7Z H;  1H9S B;  4PNY A;  3DXJ C;  4QF4 A;  3TBI B;  4ILW A;  4P72 A;  1MKH A;  5EKI A;  2JA9 A;  2CVR A;  3U58 A;  1D2B A;  1G51 A;  1EY5 A;  2A5H A;  3DUZ A;  1LM0 A;  1AN8 A;  1HR0 W;  2AMC B;  4YIJ A;  4IFD I;  1UUP A;  5JPM C;  3RUZ A;  2EYH A;  2CQO A;  3T4A C;  4APV A;  1M4V A;  3S2H B;  3NEN A;  4V0B A;  5C5M A;  1EL0 A;  2JA8 G;  2MQH A;  4A3F G;  4S3S A;  4RCN A;  4DR1 L;  2E8G A;  5M5Y B;  2PO4 A;  1JJC B;  4X3U A;  2LXJ A;  3D3R A;  2N8N A;  1CUK A;  5F2D A;  2VQF L;  1EY4 A;  1FNU A;  1B2T A;  2PI2 A;  2F0J A;  2OT2 A;  4IO9 A;  1YNN D;  1U4L A;  5JPN C;  1I50 H;  2VB2 X;  1ESR A;  1IW7 D;  5EBD A;  3KFU A;  2TSS A;  2Q8T A;  2LMC B;  5IYD G;  1PH3 A;  2HCC A;  1RJT A;  1M90 C;  2F0L A;  3W5O A;  4QUF A;  3A55 A;  1QUQ A;  3TQY A;  1RHP A;  4C3I B;  3CAM A;  2C9O A;  3KLR A;  3D0F A;  4QJF A;  4PMC A;  2KOL A;  3UDG A;  1XTC D;  4O2D A;  4IUQ A;  1OXS C;  2HUG A;  4CGY B;  3KK7 A;  4FF3 A;  4F8M A;  1D5M C;  1KTK A;  1F2L A;  1LLR D;  3FPP A;  4ULL A;  5M3F B;  4GOP C;  2K14 A;  2F0I A;  1Q8I A;  3MC0 B;  4ZAI A;  3UDI A;  2NVQ B;  3JAM L;  2KBN A;  1KQS A;  5C44 B;  1SNO A;  4KHV A;  2L5T A;  3JAM i;  3HOW H;  1TXY A;  4NW2 A;  1J9O A;  1EIG A;  4GS3 A;  5CGK A;  4B3M L;  1WTW A;  3E0J A;  1D5Z C;  4QQB X;  4JV5 L;  5IYC G;  4DR2 Q;  2K32 A;  4ABN A;  2UXB Q;  1RL2 A;  4JI7 L;  1MJC A;  5BN4 A;  3CRL C;  2RVL A;  4YY3 Q;  3BZK A;  4JOI A;  1DD2 A;  1CT1 D;  2JYO A;  3OPO A;  4DV7 L;  2KHJ A;  4A4I A;  2L11 A;  2RBM A;  1L0Y B;  1AW7 A;  2VUM G;  2EYF A;  1PTO C;  3CW2 C;  4LF4 L;  1VMP A;  3D4W A;  1W3S A;  2IX0 A;  3FEW X;  5ELB A;  1I94 L;  1ENA A;  3AFQ A;  4P74 A;  1X3Q A;  4YCV A;  5DNF A;  2VW9 A;  1EY8 A;  3G6E A;  4RH6 A;  2KEE A;  2NBF A;  4CDF C;  5I2X A;  1TWC H;  3MTS A;  1WCM G;  4LF7 Q;  3I90 A;  5IYB H;  2AKW B;  2A6H C;  3CRK C;  4YCU A;  4C3J B;  3T13 A;  3HOY G;  3QJY A;  1KRT A;  1W6J A;  3UDF A;  1W2B A;  2WV6 D;  3J80 c;  2EY2 A;  3T1Y L;  5FK9 C;  3HGB A;  2R7Z G;  4JI6 Q;  2NB0 A;  1HZC A;  3T56 B;  4A3K H;  2MP1 A;  2NVT H;  3L7Z C;  3V2T A;  2A68 C;  2F4I A;  4JI2 L;  4IUP A;  4DA2 A;  3CC2 A;  1N8R C;  2I07 B;  1YJW A;  1DOK A;  2JK8 A;  2EYM A;  3CCE A;  3S14 H;  5G3L F;  2IW3 A;  4C3H B;  1Y1W B;  4PZ8 A;  2RDH A;  4HIM A;  2ZTE A;  2CQA A;  2G9D A;  2MUY A;  1TWF H;  2QEJ C;  3KJO A;  3L9A X;  3KLW A;  4RGO S;  3J81 L;  2NYZ D;  1WFQ A;  1B3A A;  1QG7 A;  3HRZ C;  2HDL A;  1BCP C;  4LAA A;  4LWC A;  3J81 i;  2F1M A;  3A5U A;  4DV0 Q;  3X3N A;  1MBY A;  1S5E D;  1KXL A;  2J0T D;  3RNU A;  1KDB A;  2EYL A;  1AFP A;  3B6Y A;  1A3U A;  4CDD C;  2ZM6 L;  2NVY B;  2O5I C;  1LT4 D;  4DV6 L;  2WAQ G;  3DMU A;  2E74 C;  1OXV A;  3EJI A;  4RGM A;  2JE6 I;  2JA5 B;  1J8I A;  3RZD H;  3AEV A;  5E4W C;  2R93 B;  3LNN A;  4JI3 Q;  1KNA A;  1QIL A;  1UE1 A;  4AH6 A;  5EKK A;  2ZJR A;  3AU7 A;  1K0S A;  3S2D B;  2BE5 C;  4RHS A;  3GV3 A;  4YWM A;  4C2M B;  3FP9 A;  5J22 A;  3I73 A;  5JEA H;  4FDB A;  1V1P B;  2DNC A;  1XMQ L;  4DK6 C;  2F3V A;  1VQO A;  5FO8 B;  3PO2 H;  3H6M A;  1GVP A;  1IKL A;  3GTP B;  4IOA A;  3I91 A;  5CV5 A;  4NP5 A;  3WOE A;  1BNZ A;  1HA5 A;  1HR0 Q;  3PO3 B;  2N78 A;  2PQA A;  5M5X B;  4ME3 A;  1VQB A;  3DWQ A;  4CDE C;  3HOW G;  2EY1 A;  3HZX A;  4IPH A;  2AQ2 B;  5FLX E;  3EN2 A;  3BVM A;  4JI5 L;  4A3D H;  3BS1 A;  4DPG A;  3HOZ H;  4POF A;  1BBX C;  4JBK A;  2K6A A;  2LY7 A;  5EGT A;  1T5E A;  5HGT A;  2QDL A;  1LAB A;  5EAY A;  1CZW A;  3ND8 A;  2AQ1 B;  4LUV A;  3J81 j;  4A3J H;  4DAY B;  2YV5 A;  3NK9 A;  4N9P A;  1A62 A;  1WTV A;  2PMZ B;  1JOR A;  2UUA L;  2ZTC A;  1VQC A;  3KLS X;  4DK3 C;  1KNE A;  2KCC A;  1IW7 C;  1I4R A;  3ULL A;  2UXD Q;  4PG3 A;  4DV4 Q;  1XYI A;  1OXX K;  2F0P A;  5C3W A;  1GUG A;  4BBR H;  5A2Q L;  5M9O A;  5J3B A;  1JJ2 A;  4B9W A;  1NBW A;  3KF8 B;  3H09 A;  1PFS A;  1GOZ A;  1HUM A;  5CC4 A;  5C3E B;  3PIO 3;  3CCJ A;  2CW0 D;  2PPB C;  1YIT A;  2K28 A;  3ULJ A;  4KK7 A;  1SR3 A;  4QIW E;  5IYB G;  1PH2 A;  3FVQ A;  2L4N A;  3NBI A;  4N8X 1;  4QIW B;  3HS0 C;  3QR8 A;  1JJG A;  2Q2T A;  4DXF A;  1CK1 A;  3RD4 A;  1TWA H;  2JQO A;  3RLF A;  4R8I A;  4A3K G;  2OXP A;  4LUZ A;  1GO3 E;  5LMN L;  1YJN A;  2LKV A;  4R4Q A;  1N33 L;  4LFC Q;  2O4X A;  4YHH L;  1BF4 A;  1LV9 A;  3FMC A;  3I4N B;  3MXU A;  2UU9 L;  2CWA A;  4B3T Q;  2N3S A;  1RKN A;  1S40 A;  1II3 A;  1SYE A;  4A3M H;  4NXN Q;  1WD0 A;  4DR7 L;  3J80 i;  1E2Z A;  5EKL A;  4HCS A;  2EJG C;  4HMJ A;  3J7A V;  1HFN A;  5CMD A;  1RTO A;  2E2H B;  3A7L A;  3GTJ B;  1O78 A;  2B2U A;  3UDX A;  1ICW A;  4JOI C;  3SR1 A;  1D1I A;  2G9H D;  3BG3 A;  3A5Z B;  1PHJ A;  1J6Q A;  2B39 A;  5C0X H;  3DM3 A;  2VB3 X;  4JI8 L;  4IUU A;  2X6G A;  5M5W B;  1O7L A;  1ONL A;  5LMU L;  3RR5 A;  3I4M B;  3FRP B;  2OEO A;  2XWB B;  5JEA G;  1ILP A;  4UDU C;  1A6X A;  3PO2 G;  1PZJ D;  3PQI A;  1RDP D;  5IT9 E;  4IFD H;  4XIG S;  1K9M C;  1YHA A;  5FKA C;  1Q1B A;  3TN2 A;  2ZXP A;  1A3V A;  1V1O A;  2B63 B;  4RHR A;  2D0P A;  4CKC A;  1VQF A;  1HNZ Q;  3TME A;  2K1B A;  3E5S A;  4HSV A;  3GTO H;  3M4O H;  1HNX L;  1M8A A;  2XRS D;  2CWP A;  3BYT B;  3TP7 A;  1BQQ T;  4IPC A;  3VR4 A;  4HJ5 A;  2UXC L;  1QE6 A;  2L1B A;  2B8F A;  3GP7 A;  4L5T A;  2MFI A;  1NJI C;  3K6O A;  4GOP A;  3HOZ G;  2IPK D;  2L15 A;  4P75 A;  1SLJ A;  5JVG 3;  4UHV A;  4GNX B;  1CHQ D;  1QCB D;  1PRT C;  1ZXT A;  3HP3 A;  5A35 A;  5AJ3 Q;  2A74 C;  1Q82 C;  4JI0 Q;  4A3J G;  4OEL B;  4ZKB B;  2E2J H;  4I7Z C;  5JAV A;  3BDO A;  5KYL A;  2BH8 A;  1VQ9 A;  2EXZ A;  1KHI A;  1PVO A;  1WTP A;  1H95 A;  1EY9 A;  1HZ9 A;  3E9I A;  1PZK D;  4LMQ D;  4BBR G;  4RAU C;  3KBX A;  5NUC A;  3PUZ A;  1FNV A;  3CU7 A;  3O13 A;  4IUN A;  2VNU D;  1DYQ A;  2JN4 A;  4FO2 A;  1SYF A;  5EPL A;  4JI4 Q;  1IBM L;  3G7L A;  2HHH Q;  4A3F H;  4OGQ C;  1Q12 A;  4AIM A;  3F2B A;  2FFK B;  5IGF A;  2F0N A;  5C4Z A;  1EWH A;  1HCZ A;  1U4M A;  4LF8 Q;  3H94 A;  3MEH A;  3EQL C;  1S5C D;  1FNW A;  1BKB A;  1J5E L;  1FL0 A;  3R3O A;  4DF7 A;  1N36 Q;  2PZW A;  4WJ4 A;  4XQQ A;  3KUP A;  3SK5 A;  5COY A;  1I5F A;  5JJL A;  2B3G A;  3SGI A;  4JYA L;  1U9R A;  2E2I B;  2ALY B;  2NZO A;  3MXG A;  2F0D A;  5C6A A;  4CDC C;  1GUW A;  3HOV H;  3A56 A;  4LJZ C;  3TS0 A;  4K6D A;  4U67 3;  4X65 L;  1HA6 A;  2YU9 H;  2DNE A;  1GUN A;  5E7N A;  1I4X A;  4QCL A;  3SHL A;  3TRE A;  3GTK B;  2VQE Q;  1D5X C;  4KY7 A;  1I4P A;  4KJN A;  3H15 A;  4WRD A;  3FHW A;  3K7U C;  4HED A;  5IWA L;  2K05 A;  3PUV A;  3F2C A;  3A8K E;  5EPK A;  3U9S A;  1V8Q A;  4XYQ A;  4MZ9 A;  1B9M A;  3MXN A;  1YJ9 A;  3RMH A;  5IY0 A;  3KDF B;  1AP0 A;  1PH8 A;  1XNQ L;  4LF5 Q;  1CKO A;  4DUZ Q;  1TY2 A;  3EFX D;  1PFM A;  4BBS H;  2F52 A;  1FVI A;  1AEX A;  1FD7 D;  4R4I A;  4HID A;  2JA6 B;  1TVX A;  2R92 B;  3UE0 A;  4R4T A;  2RDF A;  3MEF A;  1GM5 A;  1A3T A;  1HH2 P;  5ELF A;  4X3K A;  1VCI A;  2ZJQ A;  4BY1 H;  1X32 A;  1WTQ A;  3S1R H;  4K5V A;  4AYB G;  4X3T A;  4P2C B;  1S5D D;  3RLN A;  1CA5 A;  5FO7 B;  1PH9 A;  5IGE A;  3A0J A;  2A1A A;  4K5X A;  2SEB D;  1K83 H;  1YZ6 A;  2R6G A;  2FJ2 A;  1F9P A;  3G71 A;  4IFD G;  2WKD A;  4A3B H;  3CCM A;  1I6H B;  4DV3 L;  5T1G A;  2ZJP A;  4A3G B;  2A19 A;  1IL8 A;  2F0F A;  4RKB A;  4DV5 L;  1T5X D;  1IXR A;  3CCL A;  2K04 A;  5JJI A;  3IRB A;  2EPB A;  1SFO B;  1EYG A;  4B3R Q;  2C5C A;  2R7Z B;  1AE3 A;  2JJQ A;  2FIN B;  3VR3 A;  3BVG A;  5HUR A;  1MIU A;  1TT2 A;  1WCM H;  1JT8 A;  1QNK A;  4FXD A;  3GTM H;  4KN4 C;  1STE A;  1E24 A;  1RTN A;  5KRU A;  2BDO A;  2K52 A;  1K8O A;  3K0Y A;  1GUS A;  4HJ7 A;  1V1P A;  3C1F A;  2KQ3 A;  3I56 A;  1LTI D;  2SNS A;  1EFI D;  4DFA A;  1HTL D;  1KRS A;  2JP1 A;  2DJF C;  3QB3 A;  3E0E A;  4K5W A;  3NEL A;  2PW7 A;  1VQE A;  2FXQ A;  3HG9 A;  1XNR Q;  2P5Z X;  3URY A;  1S72 A;  4MNO A;  2EZV A;  4I7A A;  1KC8 C;  2B2W A;  2AUJ D;  2B2U C;  3CQZ B;  4KY6 A;  1VQ6 A;  3EBE A;  1VQN A;  2F4V Q;  1JCK B;  3CME A;  1I50 B;  4A3I H;  5J1Z A;  1SYC A;  2Q2I A;  4GLA C;  2XWJ B;  4J6H A;  1FJG Q;  1NAP A;  3CCQ A;  4G57 A;  4UPA A;  2NVX H;  1HJP A;  1BDO A;  4GN5 A;  3PIO A;  2ID0 A;  1U4P A;  4ODG A;  3DEO A;  5I9O A;  4KHZ A;  2K01 A;  1QZG A;  2R3Z A;  5EQ0 A;  1SJE D;  3BDC A;  4JG2 A;  4A3E H;  4KV6 A;  4DR4 Q;  3HOV G;  1G91 A;  4TKO B;  1L0W A;  1JE4 A;  1ZYR D;  1HQM C;  3KF8 A;  3GD7 A;  3P7J A;  2CHB D;  5KGU A;  1WTX A;  2X6L A;  1EOT A;  1JC7 A;  1TR5 A;  1SE2 A;  3HOW B;  4X66 Q;  2F0Q A;  2K50 A;  2GVB A;  3A8I E;  1JE5 A;  3LWE A;  2Z4I A;  4DR2 L;  4WJW A;  4R1J A;  1F9S A;  2PNR C;  2UXB L;  3ND9 A;  2NTT A;  1FGU A;  2MO0 A;  4XQJ A;  2AUK A;  1SXT A;  2MNA A;  4YY3 L;  1SMY D;  1Z47 A;  1DGS A;  1Y1V H;  4N9T A;  4BBS G;  2B2T C;  1K0R A;  4M8A A;  4O0A A;  3M7G A;  2V4D A;  1QWY A;  5D3I B;  4CJ1 B;  3DHQ A;  5FLM H;  3QO2 A;  1C48 A;  5GAE C;  4BY1 G;  4MN3 A;  1C0A A;  2F03 A;  3ZJY C;  3TZD A;  5CV6 A;  1SRO A;  3K58 A;  4Y52 H;  4BY7 H;  4LF7 L;  1TWC B;  1YHQ A;  4A3B G;  1IBK Q;  2Z9H A;  2F0M A;  2J4X A;  1OXT A;  3OW7 A;  1SND A;  1R9T H;  2EIF A;  3STB D;  2CCZ A;  3GTL H;  3HOU H;  2MJ8 A;  3NBH B;  2JEA I;  4JI6 L;  3DWA A;  1DOM A;  3S1N B;  4XTC S;  3OTO Q;  4KKS A;  5CBA E;  4K8I A;  4LF6 Q;  4A3K B;  3JAM E;  1TS4 A;  1PYS B;  2NVT B;  1PTO H;  4NB3 A;  2WB1 E;  1CHP D;  1Q3L A;  5E4X A;  4OWW B;  1B3Q A;  4GLV B;  2B8G A;  1HNW Q;  3OSO A;  2NZ1 D;  2F0U A;  2RHQ B;  2WB1 B;  5FOB B;  3S14 B;  2MGS A;  2ICI A;  5M3M H;  1SMX A;  3KF6 A;  3R2I A;  1TWF B;  4ME5 A;  4A93 H;  5K36 H;  4L6T B;  4IN3 A;  1XMO Q;  2KCT A;  3K5O A;  2Q8R E;  4DV0 L;  4L5S A;  2EXD A;  2KCN A;  4IQZ A;  4LF4 Q;  2NN6 I;  4POG A;  1SSO A;  1XXG A;  2X69 A;  2A6E D;  2Y0S G;  4U68 A;  4GKJ Q;  4GN3 B;  1Y69 U;  2L12 A;  5T1I A;  2Q2U A;  1TS3 A;  2IT1 A;  4KTA A;  4RWS C;  4TQU S;  1BCP B;  4DK1 A;  5JEA J;  1E7Z A;  4JI3 L;  4A3I G;  4JBJ A;  4DKA C;  2BA0 A;  5I2Y A;  4UP7 A;  3MA2 B;  2MPM A;  3UE1 A;  5CV4 A;  4DGZ A;  1H9M A;  3VR5 A;  2EDG A;  4FP5 D;  3S24 A;  1EY0 A;  2SNM A;  1Y8O B;  1VQJ A;  1GHJ A;  2QCP X;  3K59 A;  1Y8N B;  2ZT9 C;  4ZUI A;  2K5D A;  4KY5 A;  5DLQ E;  4F7X A;  4A3E G;  1G8Z D;  2LFN A;  4IUR A;  4HN7 A;  3H0G H;  3TRZ A;  4OX9 Q;  4E6I A;  1EQT A;  1HR0 L;  4LF9 Q;  4IOC A;  3F8T A;  1EIY B;  1I4H A;  2N88 A;  2JSO A;  3CCU A;  2IX1 A;  1LTB D;  2R7D A;  1BVS A;  3CCS A;  1X55 A;  3C3L A;  3EVQ A;  3CHB D;  2RSN A;  4B9X A;  3J81 E;  3K5L A;  4KD3 A;  4XT1 B;  4A3D B;  3FPU B;  1G2T A;  3L2P A;  3HOZ B;  4H02 A;  1STA A;  3F2D A;  1MJE A;  2NVY H;  1XPU A;  2K5Q A;  1Y1V G;  5C4H A;  1ASY A;  1SNQ A;  5GAD C;  4A3J B;  4JI1 Q;  1KLG D;  1STB A;  3I72 A;  3VYS A;  1KAA A;  1L1O B;  3ER0 A;  5LL6 X;  1NE3 A;  2UXD L;  3V05 A;  1B8A A;  1QOH A;  1V43 A;  2XSC A;  4DV4 L;  1PH5 A;  3K81 C;  2ES2 A;  5KNC A;  1LUZ A;  2IHF A;  3AFP A;  1EZ6 A;  1RD9 D;  4P73 A;  4ZKC B;  5FLM G;  1IYJ B;  3EIV A;  2VL6 A;  1MHW C;  2PMZ E;  1V1Q A;  1B53 A;  3PSI A;  3GTQ H;  3RLO A;  1S3O A;  2DUD A;  1YHB A;  1ENF A;  1KLU D;  3L3O C;  1YNN C;  2B2W C;  4BY7 G;  2BCO A;  2XRQ D;  2FHT A;  2UUC Q;  1H9R A;  3PO3 H;  4WFN 3;  3PV0 A;  1XPO A;  5M5X H;  1WD1 A;  3DEP A;  5C44 G;  4TRD A;  3HOU G;  3CKI B;  3BYY B;  2XGT A;  5GAH C;  3W1B A;  3TSS A;  1TWA B;  3DM1 A;  4ZYS A;  2F0G A;  1X54 A;  4LFC L;  1LT5 D;  2JA7 H;  2K5V A;  3I4O A;  1NSN S;  5ELN A;  1MSG A;  1X3F A;  3W2D A;  3OWE B;  4DR5 Q;  3WOF A;  2RKS A;  2EVB A;  4B3T L;  4ZRZ A;  1X9N A;  5M3M G;  3DWP A;  1H9J A;  3K5M A;  4DK0 A;  1AE2 A;  4A93 G;  2RDG A;  2GN5 A;  5K36 G;  2NUC A;  2UUA Q;  1E0B A;  5CYU A;  5IGG A;  3CP0 A;  1LT6 D;  1JOQ A;  2F0E A;  4NXN L;  1YEZ A;  4A3M B;  1JR0 D;  5C0X J;  1WVL A;  4DR6 Q;  1VQA A;  4K0K L;  5DM6 3;  1JQY D;  3J7Y W;  1ZEQ X;  2QGQ A;  1HRJ A;  4Y7N H;  3VA7 A;  1ML0 D;  5A2Q E;  4LFB Q;  3SE0 A;  4ZK9 B;  1EYD A;  3S1M H;  4O42 A;  3J80 L;  4K2K A;  5C4X H;  1ENC A;  1D7Q A;  4X62 Q;  3I2Z A;  4IFD J;  1C9O A;  3LGJ A;  1TS5 A;  1VQG A;  1EIH A;  1EY6 A;  1QJO A;  4PV1 C;  4JBM A;  1H9S A;  1U0L A;  2F3I A;  3BZC A;  3W1G A;  3AMU A;  3KJP A;  3PCO B;  5IE8 A;  1CA6 A;  1P16 A;  3RZO H;  1EUJ A;  3H0G G;  3NTK A;  2UU9 Q;  1HNZ L;  3S1Q H;  4DV2 Q;  5FJ8 H;  2PZT A;  3JC6 6;  2JEB I;  1SJH D;  3GDE A;  3M4O B;  3D8G A;  4RMF A;  2UUB Q;  5EJW A;  1T9H A;  3OOC A;  3H3V C;  3ERS X;  1DZ1 A;  1N34 Q;  3NTH A;  1KDC A;  1HZB A;  5JOB A;  4IUV A;  4CKB A;  1UEB A;  4NXM Q;  4DR7 Q;  1NCV A;  4DNR B;  4LW1 A;  3GTG H;  3NXW A;  3S16 H;  2A6E C;  1FR3 A;  5AJ3 L;  4JI0 L;  2RCN A;  5IOC A;  4KHP Q;  1X65 A;  4KJO A;  2ASB A;  1IYU A;  4R4O A;  4B3S Q;  2E2J B;  1I3Q H;  3CPF A;  4DUY Q;  1A0I A;  3T16 A;  2BH2 A;  2SOB A;  4L8J A;  5M5W H;  3N52 A;  3R8B A;  1K8G A;  3NTI A;  3I8Z A;  1QB5 D;  3IL8 A;  3VA5 A;  4HAE A;  1Q1E A;  1SE8 A;  1YNX A;  2D5D A;  3NP8 A;  2QW7 A;  4CJ2 C;  3BZD B;  3UI2 A;  4J15 A;  5L37 A;  3HOX H;  2EOT A;  2B2T A;  1HXY D;  4A76 A;  1Q86 C;  1PA6 A;  4C1N K;  5CV9 A;  4I65 A;  4QUC A;  2R7F A;  2RCF A;  3HKZ G;  4G7O C;  4JI4 L;  1NTG A;  2KHS A;  3NSW A;  2CKZ B;  2HHH L;  2JA8 B;  4ALP A;  4AQY Q;  3K7A H;  4ZCK A;  4UP8 A;  1ROD A;  4A3F B;  2B63 H;  3I3C A;  4ZQ3 A;  4DNI A;  2KUM A;  3PO3 G;  2D62 A;  3VYT A;  1RCV D;  4GNX C;  4LF8 L;  2RQX A;  1U4R A;  2VS1 A;  2L55 A;  3TS2 A;  2Z4H A;  3M3Y H;  2O5J C;  3I7F A;  1CKN B;  3FKI H;  4ZUJ A;  2WIN B;  3PMF A;  3MXP A;  2JA7 G;  4FVM A;  4EVO A;  3ONA B;  1IBL Q;  4HR7 B;  1NUC A;  3HOV B;  2ZXO A;  2B2Y C;  2YU9 B;  2KVM A;  2CH4 W;  2K4K A;  2VQE L;  4L63 B;  3S9W A;  1K3R A;  1Q7Y C;  4X64 Q;  2AWO A;  5H1S E;  5I6W A;  4KI0 A;  1L0X B;  1QVC A;  1UE7 A;  3NEM A;  3NWT A;  1UWV A;  2CH4 A;  2F0S A;  1E1T A;  3QG1 A;  2YYZ A;  5D14 A;  5BR8 Q;  4LF5 L;  2PQA B;  5C3E G;  1VQI A;  4DUZ L;  3L0O A;  2GA4 B;  3SK8 A;  3G4S A;  2KEC A;  1CKM A;  3RN5 A;  1PTO D;  5C4X G;  4JBW A;  1KD1 C;  4RFB A;  3C2P A;  1OO9 B;  2BOS A;  3KOJ A;  2I0Q A;  2XN9 C;  1VQM A;  1P8L A;  3D6C A;  4HJA A;  4BY1 B;  4QB4 A;  4JC0 A;  1EZ8 A;  3S1R B;  4A75 A;  5KYI A;  1NNX A;  1DJR D;  1X6O A;  1BOS A;  3VR6 A;  2CW0 C;  3T51 B;  1Y8P B;  2E5L Q;  2A6H D;  3CXC A;  1B1Z A;  1K83 B;  2VUM B;  3Q22 A;  3T1H Q;  1TWG H;  1JB7 A;  2YTV A;  3LWU A;  4A3B B;  4YCW A;  1KAB A;  3I70 A;  2D9U A;  2K5W A;  5FJ8 G;  4X3S A;  1A2U A;  4FF4 A;  1K28 A;  1L2F A;  1EU3 A;  4IPD A;  1HHV A;  1HZA A;  1ET9 A;  2C35 B;  1B7Y B;  3OYY A;  5C4J H;  3D31 A;  4DR3 Q;  2OCE A;  2NN6 H;  4HIK A;  4B3R L;  2O2L D;  3CF5 A;  2GVA A;  3S17 H;  2HQE A;  4MHE A;  3F1Z A;  4MTN A;  5EPJ A;  3S15 B;  4NKL A;  2ENB A;  2V1C C;  5HY6 A;  3RN2 A;  1WCM B;  1SBB B;  3GTM B;  2Z6K A;  1SE4 A;  3HOY B;  4OON A;  2KEN A;  3NPP A;  2NWG A;  5ELO A;  5C5L A;  4X6A H;  4DV1 Q;  1PYB A;  1SEB D;  1BCP D;  2EYJ A;  3K0X A;  1TS2 A;  1JWM D;  3AB9 A;  3P75 A;  1O7Y A;  1PH1 A;  2JXM B;  2EE1 A;  1E2V A;  3I4M G;  4LFA Q;  2K5H A;  1D8L A;  3KBG A;  4BS9 A;  2Y0S B;  5CV7 A;  3HOX G;  2F3W A;  1XNR L;  4BXX H;  2SDF A;  1SYG A;  2EYO A;  3BDL A;  1D6E C;  1STN A;  4QMG A;  2DGY A;  3J7A F;  1PFB A;  1I4Q A;  1WJJ A;  2XTI A;  4L5R C;  2FMC A;  2VXW A;  2F4V L;  5GQO A;  1SNM A;  2I5H A;  2LS0 1;  1X3P A;  2OQ0 A;  2B63 G;  4A3I B;  5C3X A;  1NR2 A;  4A3G H;  1RIP A;  2RSO A;  2PQE A;  4GKK Q;  1K8M A;  1FJG L;  4H7B A;  1NR4 A;  3A54 A;  1N32 Q;  2WAQ E;  2XNA C;  3E3X A;  3OMC A;  3BVZ A;  4HJ8 A;  1EYA A;  3PUW A;  2NVX B;  4UAI A;  3NUC A;  1VQH A;  2H5X A;  4H0L C;  2WAQ B;  1L1O A;  4OXP A;  3OWF A;  3V96 A;  5I4D A;  1B44 D;  1VQK A;  3FKI G;  4XXE A;  5FLX c;  2PW5 A;  1VQ7 A;  3KYH C;  3H3V I;  2H1E A;  1TWH H;  4OO1 H;  3QIA A;  1EOV A;  4DR4 L;  3P1H A;  2K5N A;  4A3E B;  1CSP A;  4GZY C;  1S5B D;  1EYC A;  1LTT D;  4DAY A;  4C56 C;  1YI2 A;  5JVH 3;  1DXM A;  2F0T A;  4HMI A;  4N8F A;  4CJ0 B;  4MIU A;  1JOK A;  2QIL A;  5CV8 A;  4X66 L;  2L0C A;  1CTM A;  1EEF D;  3TZU A;  3MWY W;  1Z7T A;  3N6R A;  2Z0S A;  2D0O A;  1E3P A;  1Z9F A;  4NPS A;  1HTP A;  2K33 A;  3Q23 A;  5DM7 3;  4QY7 A;  3GO5 A;  2Q2H A;  1GJX A;  3K8A A;  4HSP A;  3ERO A;  3TEH B;  1GXD C;  3S2H H;  1Y1V B;  1PLF A;  1XX8 A;  3CQZ H;  4RCO A;  1YNJ D;  2MO1 A;  1PMR A;  3C46 A;  1LTG D;  3EA6 A;  2KA7 A;  1X56 A;  3ZYY X;  3OIQ A;  4IPG A;  5M5Y H;  4DR1 Q;  4GOP B;  3M85 A;  1KL9 A;  3PIP 3;  2HIV A;  4H44 C;  1AH9 A;  2VQF Q;  4A3C H;  1PTO F;  4DU9 A;  1KDA A;  2G5D A;  1CFM A;  1A2T A;  1G6P A;  4MTK A;  1VQ4 A;  1DM0 B;  4RG1 A;  4EQN A;  4BY7 B;  3NWS A;  4G7Z C;  3HKS A;  1IBK L;  1NY4 A;  2A69 D;  1PYW D;  2M2L A;  4J1M A;  3TP8 A;  1WOC A;  4WOR A;  1VF7 A;  1LT3 D;  4A3L G;  4C3I H;  1DON A;  1R9T B;  1LO5 D;  3GTL B;  3HOU B;  1VF5 C;  2NN6 G;  2OTL A;  1B4O A;  3OTO L;  3SVM A;  4LF6 L;  1HUN A;  2F0W A;  1LTA D;  1LAC A;  1B50 A;  4CKE A;  2N49 A;  1PTO B;  3MFY A;  5M3F H;  5DEH A;  1DOL A;  2PNH A;  1HNW L;  1XTD A;  5J39 A;  2NVQ H;  5IP9 H;  4IZ8 A;  2F0H A;  5C44 H;  3NQT A;  3PUY A;  1TKW B;  2ATW A;  1I4G A;  1MSH A;  1VQ8 A;  5M3M B;  1EWI A;  5LMN W;  4WJ3 M;  1QZH A;  4BWG B;  4DAP A;  4KKT A;  1XMO L;  2JA6 G;  4A93 B;  3CMA A;  2R92 G;  1JB3 A;  2IHE A;  2NTS A;  3VR2 A;  4EX5 A;  4B3M Q;  1R4P B;  2BA1 A;  4JV5 Q;  2CFM A;  2IWH A;  1CZG A;  4JI7 Q;  1XPR A;  1BCP F;  4GKJ L;  2E76 C;  4BXX G;  1HQR D;  1BO0 A;  1WI5 A;  5E3F A;  2WP8 J;  5HGQ A;  3U9O A;  4DV7 Q;  4GLX A;  3LX0 A;  4TSS A;  3TP5 A;  1Q81 C;  5IT9 c;  4ID6 A;  2D2C C;  4A3G G;  4PZ6 A;  5KIX A;  4R8N A;  5IOD A;  3NQI A;  4LK1 C;  1I94 Q;  3W3A A;  1X3G A;  3MXN B;  1JWS D;  1YBY A;  3IFT A;  3S1N H;  4HTH A;  4DN4 M;  1FGB D;  1D1K A;  4K6L A;  1SDF A;  1MGS A;  3C1E A;  5IP7 H;  3RZD B;  2RF4 A;  3G48 A;  4C3J H;  5BN5 A;  2QKI C;  4YWK A;  4DAM A;  1KIX A;  4OO1 G;  2A73 B;  4XDX A;  4GNX A;  1Q90 A;  1EQV A;  1K3B C;  4OX9 L;  3H0G B;  2I5L X;  3T1Y Q;  4LF9 L;  4JVZ A;  1SNC A;  2XIW A;  1LTS D;  3Q8D A;  3VYU A;  3D4R A;  4JI2 Q;  1A63 A;  3PO2 B;  5COR A;  1VS0 A;  1IZ6 A;  2AHO B;  5TSS A;  1VDZ A;  2IX3 A;  3QOL A;  1F9Q A;  4C3H H;  1Y1W H;  1OTC A;  2L9H A;  2K75 A;  3NHH A;  1PRT D;  2HDM A;  2B2Y A;  2Z6K C;  1XJV A;  5ELC A;  1Q8K A;  3T53 B;  4OWT B;  1PH6 A;  3SEB A;  1SE3 A;  2B2V C;  3MZ5 A;  5FLX L;  2MHV A;  2F0O A;  4JI1 L;  1B9N A;  3QWN A;  4PMW A;  3Q24 A;  1CKN A;  3ITP A;  1EIF A;  2Z8L A;  1AZP A;  4EQP A;  1BBW A;  1PDQ A;  1WTH A;  2M00 A;  3Q0A A;  4L5Q A;  2ZM6 Q;  1TU2 B;  3E9H A;  4A3C G;  2LXK A;  4DV6 Q;  2JA5 H;  3GTQ B;  4G4K A;  3F2U A;  3HKZ E;  1BUV T;  4OO1 I;  2R93 H;  1CI3 M;  1F9R A;  2IJ0 A;  1K8A C;  3HKZ B;  1TQO A;  2EY5 A;  4OEM B;  1RF2 D;  1K73 C;  2UUC L;  4R4C A;  1QNU A;  3S2D H;  5K5P A;  4C2M H;  2EQS A;  3I4L A;  3IAY A;  2K03 A;  1EY7 A;  2QDB A;  4K2L A;  4C3I G;  4BBR B;  2QA4 A;  1QVG A;  4FXK C;  1BR9 A;  4XT3 B;  3TDQ A;  1XMQ Q;  1UNS A;  4F87 A;  3GQB A;  2RA4 A;  1WYD A;  3GTP H;  1L1O C;  4Z9C B;  4F88 A;  1JIC A;  2KHI A;  5JJK A;  5M3F G;  4FYD A;  2JA7 B;  4LNQ A;  2DY7 A;  3SXH A;  4KLK A;  3MHB A;  5IP9 G;  3KDF A;  2HIX A;  1PH4 A;  3ICE A;  4NMZ A;  4DR5 L;  4JCV E;  2N55 A;  1M1K C;  2PI2 E;  5CR3 A;  4PQX A;  1ZYR C;  1CQV A;  5BN3 A;  3K80 C;  5DAU A;  3OHX C;  1G2S A;  1UEA B;  4KD4 A;  4FF1 A;  1F2Y A;  5JJZ A;  2HCI A;  4JI5 Q;  1YNJ C;  2NZH A;  1YIJ A;  1FYC A;  3P20 A;  4DR6 L;  1O7I A;  1XWE A;  1OXU A;  4CBV A;  3U4V A;  2EYP A;  1QUQ B;  5D3D A;  1IYV A;  1SMY C;  4Y7N B;  4LFB L;  3MVV A;  4KKU A;  1A15 A;  2ZXR A;  2VY3 A;  3BU2 A;  1GKH A;  3S1M B;  2Z1C A;  1LTR D;  4JK1 C;  1SRU A;  1G29 1;  4X62 L;  5C4X B;  2ICE C;  2A69 C;  4UP9 A;  1O7Z A;  1F2M A;  1CQF A;  2PYK A;  5C3E H;  1AZQ A;  3OW2 A;  3MAQ A;  4M1U B;  2YTX A;  1DCZ A;  2AQ3 B;  5IP7 G;  4EQO A;  1ILQ A;  4C3J G;  4PMB A;  5LHY 1;  3OMG A;  2WB1 G;  3RZO B;  4JW0 A;  1V9P A;  1ET6 A;  2KJX A;  2PZU A;  1PZI D;  4DV2 L;  3QOJ A;  4AYB E;  3S1Q B;  1EWC A;  3STB C;  5IT9 L;  5CBE E;  2UUB L;  4AYB B;  1C4Q A;  2F0K A;  1EU4 A;  1O80 A;  2H4O A;  5LMN Q;  1N34 L;  1N33 Q;  5KNB A;  1YVC A;  4YHH Q;  3WDN A;  2RHS B;  3I4N H;  4C3H G;  1Y1W G;  4NXM L;  5LL6 S;  2I5M X;  1SYD A;  3DLL A;  4KMU C;  3CCR A;  4K0K Q;  1JWU D;  1NMF A;  4P71 A;  3WWV A;  4EQ5 A;  3CC4 A;  1EQR A;  3GTG B;  3GTO B;  1UE5 A;  1BXT A;  3S16 B;  1EFW A;  2XVS A;  3J7Z C;  4KHP L;  3TP6 A;  1H9K A;  4B3S L;  1Z6H A;  3PF5 A;  4FF2 A;  2HT1 A;  1TY0 A;  2J7Z A;  1E22 A;  3M4P A;  3X3M A;  4DUY L;  1PRT F;  1I3Q B;  4K8J A;  2OTJ A;  1LYL A;  1CM9 A;  3BJU A;  4IUT A;  2WFW A;  3A8J E;  1VQP A;  1QVF A;  3ULP A;  4V19 0;  3J80 E;  4K14 A;  3NE5 B;  2E2H H;  2M9V A;  2YTY A;  3GTJ H;  3HFZ B;  3H3V H;  1PXU A;  1ZKO A;  1SAP A;  2JA5 G;  1S5F D;  3HOX B;  3PGZ A;  2R93 G;  3KF6 B;  3U50 C;  2BDN A;  2WAC A;  2A8V A;  3IFD A;  3ERQ A;  1E1O A;  1N9W A;  5AFW A;  4AQY L;  4JI8 Q;  2DJG C;  4RKL A;  4CHT B;  3K7A B;  3HEJ A;  4OIK A;  2EJF C;  1UAP A;  3I4M H;  1PRT B;  3PIP A;  5LMU Q;  4OL7 A;  3VDY A;  3U4Z A;  3OIP A;  1I6V C;  4H13 C;  2E2D C;  2OWO A;  4QGU A;  1PH7 A;  2WII B;  2K7V A;  3GV6 A;  3M4Q A;  4OIJ A;  1BBU A;  1NMG A;  1PFN A;  3M3Y B;  5I6Y A;  4A3D G;  3FKI B;  4R9W A;  3SK6 A;  3MFG A;  2FMM A;  4O1N A;  4G7H C;  1IBL L;  2WKC A;  3PUX A;  1HNX Q;  3M4Y A;  1GUO A;  5ISR A;  2UXC Q;  4JPB W;  5IGD A;  1N36 L;  3D4D A;  1GUT A;  4X64 L;  2HQL A;  4ZLT F;  1R4Q B;  3Q6S A;  1MI2 A;  5BR8 L;  3IKJ A;  2Q8I B;  3D6W A;  4DXG A;  2OF1 A;  4DAV A;  2JA8 H;  5ELD A;  1IHZ A;  4RGT A;  4OWX B;  1KAW A;  3J7A 5;  2QEX A;  1JMC A;  1X3E A;  2Z6B A;  1SNP A;  2R61 A;  1Q46 A;  2DY8 A;  2F0V A;  2OQK A;  5I9P A;  2E75 C;  4OHJ A;  4XYO A;  1STH A;  3NBH A;  3AYH B; 
#chains in the Genus database with same CATH homology
 3UE1 A;  4X66 L;  4B3T Q;  2N3S A;  3JAM c;  2Z0S A;  5GRO A;  2KCM A;  1C7Y A;  1IBM Q;  2E5L L;  2D0O A;  1E3P A;  1Z9F A;  4NPS A;  1S40 A;  3S24 A;  3T1H L;  5IYD H;  4QY7 A;  3GO5 A;  2Q2H A;  4PZ7 A;  3K8A A;  4A3M H;  3TEH B;  4NXN Q;  4DR7 L;  3S2H H;  1VQJ A;  3CQZ H;  3J80 i;  4YWL A;  1IL2 A;  4DR3 L;  5DLQ E;  1J5E Q;  2MO1 A;  4A3E G;  1B70 B;  3H0G H;  4BA1 I;  3TRZ A;  2ZTD A;  2E2I H;  5M5Y H;  4OX9 Q;  1X56 A;  4DR1 Q;  4IPG A;  3UDX A;  1CSQ A;  4GOP B;  1HR0 L;  4JOI C;  4LF9 Q;  4IOC A;  3F8T A;  1PV4 A;  1EIY B;  3M85 A;  4A3M G;  4HIO A;  1PHJ A;  1KL9 A;  2AWN A;  3A5Z B;  3I4N G;  1J6Q A;  2HIV A;  1UE6 A;  3CCV A;  1AH9 A;  3DM3 A;  2VQF Q;  3CCU A;  2IX1 A;  4A3C H;  2R7D A;  1VQL A;  1BVS A;  4JI8 L;  4X65 Q;  3CCS A;  4BA2 I;  4A3L H;  1U5K A;  1X55 A;  3GTK H;  1G6P A;  1VQ4 A;  4DV1 L;  5LMU L;  3RR5 A;  3L2P A;  3AQQ A;  4RG1 A;  4H02 A;  3F2D A;  1MJE A;  3HKS A;  1IBK L;  5JEA G;  1NY4 A;  2NVY H;  1XPU A;  5C0X G;  2IY5 B;  1Y1V G;  1WOC A;  1SN8 A;  2VZA A;  5IWA Q;  3PO2 G;  1ASY A;  5IYC H;  3A74 A;  1ASZ A;  5GAD C;  4A3L G;  4C3I H;  4JI1 Q;  3M9B A;  4XIG S;  1K9M C;  1YHA A;  1Q1B A;  4LFA L;  1L1O B;  2NN6 G;  2OTL A;  3ER0 A;  3OTO L;  1VQD A;  2D0P A;  4LF6 L;  1NE3 A;  4HJ9 A;  1XNQ Q;  2UXD L;  1VQF A;  5GAG C;  1B8A A;  4DV4 L;  1V43 A;  1PH5 A;  1HNZ Q;  3K81 C;  1Y14 B;  3GTO H;  3M4O H;  2N49 A;  1HNX L;  2ES2 A;  1LUZ A;  4IJH A;  2CWP A;  2IHF A;  3AFP A;  2B29 A;  4GN4 B;  4P73 A;  4IPC A;  5FLM G;  5M3F H;  4HJ5 A;  1IYJ B;  3EIV A;  2VL6 A;  2JA6 H;  2UXC L;  2VUM H;  4IJL A;  2PNH A;  2PMZ E;  2R92 H;  1HNW L;  1V1Q A;  1XTD A;  3PSI A;  2NVQ H;  3RLO A;  5IP9 H;  1S3O A;  2DUD A;  3GTQ H;  1A8V A;  1YHB A;  4L5T A;  2Y0S E;  2MFI A;  1NJI C;  5C44 H;  3PUY A;  1VQ5 A;  3PF4 A;  2LSS A;  4GKK L;  4LUO A;  2ATW A;  4GOP A;  3HOZ G;  4BY7 G;  1VQ8 A;  3M7N A;  1N32 L;  1EWI A;  5LMN W;  2L15 A;  4WJ3 M;  1QZH A;  4P75 A;  2UUC Q;  1SLJ A;  4QL5 A;  4TVA B;  4GNX B;  1XMO L;  2JA6 G;  3CC7 A;  3CMA A;  2R92 G;  2IHE A;  5AJ3 Q;  4EX5 A;  1Q82 C;  4B3M Q;  3CPW A;  4JI0 Q;  3S15 H;  2BA1 A;  4A3J G;  4JV5 Q;  3PO3 H;  3PV0 A;  1XPO A;  5M5X H;  2E2J H;  3CD6 A;  2CFM A;  4UY8 C;  5C44 G;  3HOU G;  1I6H H;  4JI7 Q;  1GD7 A;  2BH8 A;  2XGT A;  5GAH C;  3I55 A;  1KHI A;  3W1B A;  3J81 c;  4DV3 Q;  1XPR A;  1VQ9 A;  3HOY H;  4GKJ L;  1PVO A;  4BXX G;  1H95 A;  1WI5 A;  4DV5 Q;  2WP8 J;  5HGQ A;  1HZ9 A;  1LTL A;  4DV7 Q;  1X54 A;  4LFC L;  1EQQ A;  3E9I A;  4GLX A;  1SFO H;  4BBR G;  5C0X I;  2JA7 H;  2K5V A;  3I4O A;  2R7Z H;  1Q81 C;  5ELN A;  3PUZ A;  5IT9 c;  1X3F A;  4P72 A;  2VNU D;  4A3G G;  1MKH A;  4DR5 Q;  4PZ6 A;  4B3T L;  2JA9 A;  1X9N A;  5M3M G;  3U58 A;  1G51 A;  1I94 Q;  4JI4 Q;  1X3G A;  3MXN B;  1AE2 A;  1IBM L;  2HHH Q;  4A3F H;  4A93 G;  1LM0 A;  2GN5 A;  1Q12 A;  1YBY A;  4AIM A;  3S1N H;  1HR0 W;  2AMC B;  5K36 G;  2UUA Q;  3F2B A;  3CP0 A;  4IFD I;  4NXN L;  1YEZ A;  5IP7 H;  2CQO A;  2RF4 A;  3G48 A;  4APV A;  4C3J H;  3NEN A;  1VQA A;  5C0X J;  4LF8 Q;  4DR6 Q;  2JA8 G;  2MQH A;  4YWK A;  1BKB A;  4DAM A;  1FL0 A;  1J5E L;  1KIX A;  4K0K L;  1N36 Q;  4OO1 G;  4WJ4 A;  4A3F G;  4GNX A;  1I5F A;  2QGQ A;  5JJL A;  4OX9 L;  4Y7N H;  2B3G A;  4DR1 L;  2I5L X;  3SGI A;  4JYA L;  3T1Y Q;  4LF9 L;  2ALY B;  2E8G A;  4LFB Q;  1JJC B;  2NZO A;  2LXJ A;  3S1M H;  3Q8D A;  2N8N A;  1CUK A;  2VQF L;  5C4X H;  3HOV H;  3TS0 A;  4JI2 Q;  2PI2 A;  1D7Q A;  1A63 A;  4X65 L;  4X62 Q;  3I2Z A;  4IO9 A;  2YU9 H;  1C9O A;  1IZ6 A;  1VS0 A;  2AHO B;  5E7N A;  4IFD J;  3LGJ A;  1I50 H;  3TRE A;  4C3H H;  2VQE Q;  1VQG A;  1Y1W H;  1OTC A;  3KFU A;  2K75 A;  3H15 A;  3FHW A;  4JBM A;  5IYD G;  2Z6K C;  1U0L A;  2F3I A;  1Q8K A;  3BZC A;  3W1G A;  1XJV A;  4OWT B;  3KJP A;  1PH6 A;  1PH3 A;  3PCO B;  5IE8 A;  3K7U C;  3F2C A;  5IWA L;  3PUV A;  3W5O A;  1M90 C;  1P16 A;  4JI1 L;  1QUQ A;  3TQY A;  4PMW A;  3RZO H;  4MZ9 A;  1CKN A;  3CAM A;  1YJ9 A;  5IY0 A;  3KDF B;  1PH8 A;  3D0F A;  1EUJ A;  4QJF A;  3H0G G;  3UDG A;  2UU9 Q;  1HNZ L;  4O2D A;  4LF5 Q;  4DV2 Q;  1EIF A;  1OXS C;  1CKO A;  5FJ8 H;  4DUZ Q;  3S1Q H;  1BBW A;  3JC6 6;  2JEB I;  4BBS H;  3GDE A;  2F52 A;  1FVI A;  4RMF A;  2UUB Q;  4R4I A;  1T9H A;  4L5Q A;  4HID A;  2ZM6 Q;  4GOP C;  3ERS X;  2K14 A;  3E9H A;  4A3C G;  2LXK A;  4DV6 Q;  3UE0 A;  4R4T A;  3UDI A;  1N34 Q;  2JA5 H;  3HKZ E;  3MEF A;  1GM5 A;  4OO1 I;  2KBN A;  1HH2 P;  1HZB A;  1KQS A;  2R93 H;  1VCI A;  2ZJQ A;  1UEB A;  4NXM Q;  4BY1 H;  1K8A C;  3JAM i;  4DR7 Q;  3HOW H;  1TXY A;  3S1R H;  1K73 C;  4AYB G;  2UUC L;  4GS3 A;  4R4C A;  3S2D H;  4JYA Q;  4LW1 A;  3GTG H;  3RLN A;  3S16 H;  4C2M H;  5AJ3 L;  1PH9 A;  4B3M L;  3A0J A;  2EQS A;  2A1A A;  4JI0 L;  4QQB X;  2RCN A;  4JV5 L;  5IYC G;  4DR2 Q;  1K83 H;  1X65 A;  1YZ6 A;  2R6G A;  2ASB A;  3G71 A;  4KHP Q;  4R4O A;  4IFD G;  2QA4 A;  1QVG A;  4B3S Q;  2UXB Q;  1RL2 A;  4JI7 L;  1I3Q H;  3CPF A;  4DUY Q;  4A3B H;  3CCM A;  1A0I A;  1MJC A;  4DV3 L;  1XMQ Q;  2ZJP A;  2A19 A;  4YY3 Q;  2BH2 A;  3BZK A;  4JOI A;  4DV5 L;  5M5W H;  1WYD A;  1IXR A;  3CCL A;  1K8G A;  3GTP H;  4DV7 L;  1L1O C;  2KHJ A;  4A4I A;  2KHI A;  5JJK A;  5M3F G;  5JJI A;  3IRB A;  1EYG A;  1Q1E A;  1SE8 A;  1YNX A;  4B3R Q;  2VUM G;  4LNQ A;  4KLK A;  4J15 A;  1AE3 A;  5IP9 G;  3HOX H;  2JJQ A;  2HIX A;  3KDF A;  1PH4 A;  3ICE A;  4A76 A;  4DR5 L;  3CW2 C;  4JCV E;  1Q86 C;  1PA6 A;  1M1K C;  2PI2 E;  1MIU A;  1W3S A;  4LF4 L;  1WCM H;  2IX0 A;  1JT8 A;  2R7F A;  3GTM H;  3HKZ G;  1I94 L;  3K80 C;  4JI4 L;  1NTG A;  3AFQ A;  1E24 A;  2CKZ B;  4P74 A;  4ALP A;  4AQY Q;  2HHH L;  3K7A H;  4UP8 A;  4YCV A;  2B63 H;  2VW9 A;  2K52 A;  3G6E A;  4DNI A;  4JI5 Q;  4HJ7 A;  3PO3 G;  2NZH A;  2D62 A;  1YIJ A;  1TWC H;  4GNX C;  1WCM G;  4LF7 Q;  4LF8 L;  4DR6 L;  1O7I A;  5IYB H;  2AKW B;  2VS1 A;  3I56 A;  1OXU A;  4YCU A;  3HOY G;  1KRT A;  1KRS A;  3U4V A;  3UDF A;  1W2B A;  3TS2 A;  1QUQ B;  3M3Y H;  3I7F A;  1CKN B;  3J80 c;  3FKI H;  3E0E A;  3T1Y L;  4LFB L;  2JA7 G;  3NEL A;  2R7Z G;  4JI6 Q;  1HZC A;  4A3K H;  1VQE A;  2FXQ A;  2VY3 A;  3BU2 A;  1GKH A;  2NVT H;  3L7Z C;  1XNR Q;  1S72 A;  4JI2 L;  4MNO A;  1IBL Q;  1SRU A;  1G29 1;  4X62 L;  3CC2 A;  1KC8 C;  1N8R C;  1YJW A;  1VQ6 A;  2JK8 A;  3EBE A;  4UP9 A;  1VQN A;  2K4K A;  2VQE L;  2F4V Q;  3CME A;  4A3I H;  3CCE A;  3S14 H;  1K3R A;  1Q7Y C;  4PZ8 A;  4X64 Q;  5C3E H;  2AWO A;  5H1S E;  3OW2 A;  2Q2I A;  4GLA C;  4KI0 A;  4HIM A;  2ZTE A;  1QVC A;  1UE7 A;  2YTX A;  3NEM A;  1FJG Q;  1TWF H;  5IP7 G;  3KJO A;  3KLW A;  1UWV A;  3CCQ A;  2NVX H;  1E1T A;  4UPA A;  1WFQ A;  2YYZ A;  1HJP A;  2WB1 G;  4GN5 A;  4LWC A;  1V9P A;  3J81 i;  3PIO A;  5BR8 Q;  3A5U A;  2ID0 A;  4LF5 L;  2PQA B;  5C3E G;  4DV0 Q;  4DV2 L;  1VQI A;  4DUZ L;  4AYB E;  1KXL A;  3L0O A;  4KHZ A;  3G4S A;  3STB C;  3RNU A;  2UUB L;  1QZG A;  1CKM A;  3RN5 A;  3B6Y A;  4JG2 A;  4A3E H;  2ZM6 L;  4DR4 Q;  5C4X G;  3HOV G;  4JBW A;  1L0W A;  5LMN Q;  4DV6 L;  1N34 L;  2WAQ G;  1KD1 C;  1N33 Q;  3GD7 A;  1OXV A;  1YVC A;  2JE6 I;  4YHH Q;  3RZD H;  3AEV A;  2RHS B;  3KOJ A;  3I4N H;  1Y1W G;  4NXM L;  2I0Q A;  4JI3 Q;  1UE1 A;  1VQM A;  4AH6 A;  1P8L A;  2I5M X;  2ZJR A;  4HJA A;  4JC0 A;  4X66 Q;  3DLL A;  4Y52 H;  3CCR A;  2K50 A;  4K0K Q;  4A75 A;  2GVB A;  1XNQ L;  3WWV A;  1NMF A;  4P71 A;  4EQ5 A;  3CC4 A;  1JE5 A;  1EQR A;  1X6O A;  4YWM A;  1UE5 A;  4DR2 L;  1EFW A;  3J7Z C;  3FP9 A;  4KHP L;  2E5L Q;  3CXC A;  4R1J A;  3PF5 A;  4B3S L;  2UXB L;  2HT1 A;  3T1H Q;  1E22 A;  3M4P A;  1TWG H;  4DUY L;  1JB7 A;  1FGU A;  2MO0 A;  2YTV A;  4FDB A;  1XMQ L;  2OTJ A;  4DK6 C;  1LYL A;  4YCW A;  2MNA A;  4YY3 L;  1Z47 A;  1VQO A;  1DGS A;  1Y1V H;  3BJU A;  5FJ8 G;  3PO2 H;  1L2F A;  1GVP A;  4IPD A;  2WFW A;  1HZA A;  1VQP A;  1QVF A;  4BBS G;  3ULP A;  2C35 B;  1B7Y B;  3OYY A;  5C4J H;  3D31 A;  4DR3 Q;  1K0R A;  4O0A A;  2OCE A;  2E2H H;  4HIK A;  4IOA A;  3CF5 A;  2YTY A;  2GVA A;  3GTJ H;  3S17 H;  4B3R L;  3HFZ B;  3H3V H;  3F1Z A;  4MTN A;  2JA5 G;  3PGZ A;  2V1C C;  1HR0 Q;  2N78 A;  2PQA A;  3KF6 B;  5HY6 A;  2R93 G;  3U50 C;  3RN2 A;  5FLM H;  5GAE C;  4ME3 A;  4BY1 G;  1VQB A;  2A8V A;  3HOW G;  1C0A A;  1E1O A;  1N9W A;  2Z6K A;  4AQY L;  4IPH A;  3ZJY C;  4JI8 Q;  4OON A;  2KEN A;  3EN2 A;  5ELO A;  4JI5 L;  4A3D H;  3I4M H;  4X6A H;  1SRO A;  4DPG A;  3HOZ H;  3PIP A;  1PYB A;  5LMU Q;  4DV1 Q;  3VDY A;  4POF A;  4BY7 H;  4JBK A;  3U4Z A;  4LF7 L;  1YHQ A;  2OWO A;  4A3B G;  5EAY A;  1IBK Q;  4QGU A;  1PH7 A;  3K0X A;  4LUV A;  1OXT A;  3J81 j;  4A3J H;  4DAY B;  2YV5 A;  1R9T H;  1PH1 A;  3M4Q A;  2EIF A;  1BBU A;  1NMG A;  3STB D;  2CCZ A;  1A62 A;  3GTL H;  3HOU H;  4A3D G;  3NBH B;  2JEA I;  3I4M G;  4LFA Q;  2K5H A;  1D8L A;  4JI6 L;  2UUA L;  2ZTC A;  1VQC A;  4XTC S;  3OTO Q;  4DK3 C;  4LF6 Q;  3HOX G;  4BXX H;  3ULL A;  1XNR L;  2UXD Q;  4PG3 A;  4DV4 Q;  1PYS B;  1IBL L;  1OXX K;  3PUX A;  4NB3 A;  2DGY A;  1HNX Q;  2WB1 E;  1WJJ A;  4BBR H;  2XTI A;  4OWW B;  4L5R C;  2F4V L;  5GQO A;  4GLV B;  5J3B A;  1JJ2 A;  2UXC Q;  1N36 L;  2I5H A;  1NBW A;  1HNW Q;  3KF8 B;  2RHQ B;  2OQ0 A;  2B63 G;  4X64 L;  4A3G H;  1PFS A;  1RIP A;  3CCJ A;  5M3M H;  4GKK Q;  1FJG L;  1YIT A;  2HQL A;  3ULJ A;  1SMX A;  3KF6 A;  1SR3 A;  1N32 Q;  4QIW E;  2WAQ E;  5IYB G;  4A93 H;  1PH2 A;  1XMO Q;  4HJ8 A;  3PUW A;  2KCT A;  1VQH A;  2H5X A;  5BR8 L;  1L1O A;  4OXP A;  4DV0 L;  4L5S A;  2EXD A;  1VQK A;  3FKI G;  4LF4 Q;  1JJG A;  2NN6 I;  2Q2T A;  5FLX c;  4POG A;  2Y0S G;  1VQ7 A;  1TWA H;  2JQO A;  3KYH C;  3RLF A;  2JA8 H;  4A3K G;  3H3V I;  1TWH H;  4GN3 B;  4GKJ Q;  4OWX B;  4LUZ A;  1EOV A;  1KAW A;  2Q2U A;  3J7A 5;  4DR4 L;  2QEX A;  1GO3 E;  2K5N A;  1X3E A;  1JMC A;  5LMN L;  1YJN A;  1CSP A;  4R4Q A;  1N33 L;  2IT1 A;  4TQU S;  1Q46 A;  4LFC Q;  1YI2 A;  4YHH L;  2OQK A;  5JEA J;  1E7Z A;  4JI3 L;  4A3I G;  4JBJ A;  4DKA C;  2BA0 A;  4UP7 A;  2UU9 L;  3AYH B;  2CWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...