2L15A

Solution structure of cold shock protein cspa using combined nmr and cs-rosetta method
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock protein CspA
publication title Fully automated high-quality NMR structure determination of small (2)H-enriched proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2l15A00
1I94Q 3J7A5 4DAMA 2EIFA 2GVAA 1K8GA 2FXQA 4JI6L 4JI1Q 1I5FA 3AFPA 4YY3Q 4DUYL 1IBLQ 3HOYG 1KQSA 5DLQE 3CC2A 2JE6I 1B7YB 1KHIA 3HOXH 5IP9G 4A3JH 2QGQA 3I4NH 5C0XG 1PH9A 5J3BA 1XNRL 2VQFL 2NVQH 4GKJL 2WAQE 5GAGC 3ERSX 3M4QA 3K81C 4X65Q 4LUOA 1EQQA 2IHFA 1GVPA 2AWOA 4OWWB 3S2HH 4KHPL 4O0AA 4A3BH 2JA8G 2RF4A 1VQCA 1N34Q 2JA5G 4TQUS 4A3FH 1VQ9A 4HIKA 1I50H 4J15A 3G4SA 4X6AH 1V9PA 4HJAA 2PI2A 4IFDI 4PZ8A 3W1GA 2UUAL 5K36G 2HIVA 1XMOL 3PUVA 2N3SA 2ZTCA 3UDFA 2H5XA 2ID0A 1NBWA 3H15A 4GNXB 3I55A 1YHBA 1T9HA 1Y1VG 3K0XA 3CCRA 2A1AA 4GLXA 2VS1A 2LSSA 1BBUA 4C3IH 4DR6L 2IX0A 3L7ZC 4A3CH 5JEAG 4GS3A 4DR5Q 1XNRQ 3F2CA 2UXDL 1TWHH 2R6GA 3F2DA 1HR0L 1Y14B 2Z6KC 4A3EH 2JA7H 3CQZH 3HKZG 4NB3A 2VQEL 3HOUG 4DR3Q 3KJPA 3S1QH 1UEBA 4KHPQ 2JA6H 2E5LQ 4DAYB 3SGIA 1X3GA 1YNXA 3F2BA 4LUVA 2K5NA 3J81j 2NVXH 4YWMA 3U4ZA 2E2JH 2E8GA 1E7ZA 3F1ZA 2E2HH 3HOWH 1L1OC 1KC8C 4C3HH 1X6OA 3S1NH 4R4OA 4R1JA 4A3IG 2UUAQ 2I5MX 2HQLA 5IY0A 4BXXH 4P72A 2UUBL 1JT8A 1RL2A 4L5TA 1NY4A 1SR3A 5IE8A 2R7ZH 4B3RL 4JV5L 5AJ3L 1KXLA 2L15A 1NMGA 3CCVA 4JI0Q 1EIFA 2YTYA 1XNQQ 1LYLA 4DR4L 1E24A 1PH8A 2MO1A 4TVAB 1JMCA 4DR6Q 5IWAL 1HNXL 1XTDA 4K0KL 1EUJA 1HZBA 1VQEA 3D31A 1A0IA 4OX9L 1QUQB 1XPUA 3E9IA 4QJFA 2ZTEA 4A3JG 3H0GH 3HOXG 1HR0Q 4UY8C 3I4NG 2VQEQ 3ICEA 3M4PA 4MZ9A 4AIMA 2K5VA 4C2MH 1N32L 1QVCA 4JI4Q 2ZJRA 4JI8L 2AHOB 4P74A 4A3BG 2R7DA 4YCVA 3M85A 1D7QA 1S3OA 4JI2Q 4A93H 4A3FG 1UE5A 1VQNA 1B8AA 4DV5L 3CCMA 1OXUA 1FGUA 2MO0A 2UUBQ 1SLJA 4NXMQ 1BKBA 4BY1H 4L5SA 4B3TL 3MXNB 2K14A 4JC0A 3HKSA 3PIOA 2B29A 2BA1A 4IPDA 3CD6A 1HNWQ 4YCUA 3KF6B 3TEHB 3JAMc 5IWAQ 2WB1G 1WOCA 4GNXC 4K0KQ 2CCZA 4JI5L 4AYBG 4LF9L 1CKOA 4A3CG 5GQOA 4PZ7A 1SRUA 1EOVA 1P16A 1Q46A 3I4MH 4IPCA 4A3EG 2JA7G 5GAHC 2Y0SE 2JA6G 4JBKA 3EIVA 2OCEA 4FDBA 2QA4A 1JJGA 1K3RA 4DR2Q 3PO2H 3HOWG 4DV5Q 4GN4B 3KFUA 4QQBX 1KRTA 1WJJA 3KYHC 3KDFA 1Q8KA 3K7AH 4IPHA 4DK6C 3WWVA 2MFIA 5IYCH 4QY7A 2UU9L 1OXXK 4JI1L 3JAMi 2R7ZG 2ZTDA 1S40A 3A0JA 3S24A 2B3GA 3I2ZA 1C7YA 2YTXA 1WCMH 2IT1A 4LF9Q 4X65L 1Q1BA 3RLFA 2RCNA 1WYDA 3M4OH 3F8TA 4PG3A 4MNOA 5FJ8H 2BA0A 2N49A 1N34L 4JI7Q 3H0GG 1K9MC 1IBKQ 4BXXG 1CKNB 2YV5A 4QIWE 1MJCA 1KAWA 1VQ7A 2HHHL 3S14H 5LMUQ 4B3MQ 1PA6A 4POFA 3RN5A 3FKIG 4A93G 3OYYA 2KHJA 4DR4Q 4JBWA 2XGTA 4DR1Q 2UU9Q 2NVYH 2PMZE 4BY1G 2PQAB 2ZJPA 2VZAA 2Q2TA 5GROA 1VQBA 3CAMA 1GKHA 4DR5L 1K73C 5IYDH 2WAQG 1MKHA 5HGQA 5BR8L 4LNQA 2A8VA 2CQOA 4O2DA 4A3KH 3PIPA 3S15H 4DR3L 3GD7A 3CF5A 4AQYL 4P71A 4R4QA 3FP9A 2E5LL 3PUYA 3CXCA 2B63H 2LXKA 3NBHB 3UDXA 2F52A 3B6YA 3PV0A 3J81c 1X55A 2CWAA 3I4MG 2EXDA 5M3FH 2KBNA 4GOPB 5M5YH 4BBSH 2HHHQ 3J7ZC 2JQOA 4MTNA 3PF4A 1JE5A 2MNAA 4EQ5A 1XNQL 4JI0L 4Y7NH 1GM5A 3PO2G 1YJNA 4YWKA 3DLLA 5FLMH 4H02A 5IYCG 2Z6KA 4HIOA 3I7FA 1IL2A 1Y1WH 4R4IA 3CPFA 4DV6L 5BR8Q 1X56A 1YJ9A 2D0OA 1XMQQ 1VQ5A 1V43A 2OWOA 4R4CA 1NJIC 3GTMH 3KOJA 1WCMG 4ME3A 3CCQA 4AQYQ 1L1OA 1VQLA 3J81i 4JI4L 1XPOA 1IZ6A 3TS0A 4GLVB 1SFOH 5FJ8G 1OXTA 4LF6L 4JI2L 1BBWA 4X64Q 2I0QA 4NXML 1G6PA 1EWIA 3ER0A 4IFDJ 2EQSA 4PZ6A 1PH4A 1QZGA 4BA2I 4DV7Q 3I4OA 4P75A 1DGSA 3CMAA 5M5XH 1HZCA 1HNWL 5EAYA 2Z0SA 1KD1C 3RN2A 1IBMQ 1Q86C 1U0LA 1VQ4A 4WJ3M 4YHHL 3AEVA 5GADC 1HNZQ 3K80C 2F4VQ 2UXCQ 3VDYA 3S1RH 3NEMA 4DV6Q 1D8LA 1PH3A 2GVBA 3I56A 3BZCA 4C3JH 5IYDG 4DV3L 1H95A 3H3VH 5C0XI 3CP0A 1X3EA 5C4JH 2NN6G 4A3KG 3STBD 3PGZA 3GTLH 3GTPH 2IHEA 2AMCB 2AWNA 4LF6Q 2B63G 3T1YQ 1LTLA 1YITA 1Z47A 3FKIH 1YHQA 3RR5A 3E9HA 4OWTB 2MQHA 2CWPA 2K50A 4X66Q 4DR2L 1EYGA 3KLWA 3DM3A 5M3FG 3OW2A 1C0AA 3AFQA 2R93H 4BBSG 3JC66 1W3SA 3A5UA 1N8RC 1PH1A 2N78A 4GNXA 4JYAL 4GOPC 1N33L 2NZHA 4UPAA 2VL6A 4JOIC 2V1CC 1X9NA 4B3SL 1IXRA 4YHHQ 2JJQA 3LGJA 1VQIA 5JJIA 3CW2C 3U4VA 5FLMG 4HJ8A 2ZM6Q 1FJGQ 3K8AA 1PYBA 1Y1WG 4A3LH 1UE7A 3L0OA 4DV3Q 3PUZA 4A3MH 4JI7L 5IYBH 2Y0SG 4APVA 4A4IA 1IBKL 2BH2A 5JJLA 3STBC 5C0XJ 3L2PA 1CUKA 4YWLA 1OTCA 2PI2E 3GTKH 1QVGA 4WJ4A 3CCLA 2Q2HA 1PH7A 3ULJA 1UWVA 5LMUL 4DV1Q 1EFWA 4B3ML 3HFZB 1K8AC 3CCJA 3K7UC 1WI5A 4GN3B 2RHSB 3U58A 4DR1L 1VQJA 1X65A 3GO5A 3RZOH 4JYAQ 2JK8A 2JEAI 1YIJA 1N33Q 3S2DH 4L5RC 1N36Q 2HIXA 4B3SQ 4XTCS 1PH5A 3EN2A 4DV0Q 1J5EL 3RLNA 4DKAC 1Q81C 2OQ0A 5C3EH 2UUCQ 4LF7Q 4DNIA 2R92H 1I3QH 1QUQA 2DUDA 1NE3A 4BA1I 3BU2A 1Q7YC 3HOVH 1P8LA 3TS2A 3FHWA 3G71A 4IOAA 1L0WA 4BBRH 5GAEC 3ULPA 1TWGH 2BH8A 5LMNW 1VQAA 5JEAJ 2AKWB 2HT1A 2K4KA 4JBJA 3CPWA 4A76A 4JI3Q 2ASBA 4LF8L 2NN6I 1RIPA 1CKMA 3OTOQ 3AYHB 1YBYA 1VQMA 1PYSB 4LFCQ 2KENA 2GN5A 2LXJA 2R93G 4JCVE 4A75A 3ZJYC 4GKKL 2KHIA 3G6EA 4YCWA 5M3MH 1J6QA 4GN5A 3KF6A 3D0FA 2YTVA 1XMQL 1J5EQ 1EQRA 3NENA 2Q2IA 4LUZA 1VQGA 3S16H 3CCEA 1QZHA 4JG2A 4LFBL 1IYJB 1HH2P 1NMFA 3GTJH 3BJUA 1YI2A 2D62A 4A3LG 2KCTA 1SROA 4LFAQ 4L5QA 5C44H 4LF5Q 4A3MG 1GD7A 5IYBG 4DV2Q 4A3DH 1E1OA 4IJHA 5C4XH 4X64L 4A3GH 3PO3H 4LF8Q 2C35B 4LW1A 4DV7L 2YU9H 1YVCA 3A5ZB 2E2IH 1TXYA 1A63A 2NVTH 1M90C 1OXSC 2NZOA 1IBML 2VUMH 1UE6A 3TRZA 1HR0W 4GKKQ 3GTOH 3S1MH 1HZAA 1K83H 1VQFA 4NPSA 3Q8DA 1HNZL 2F4VL 2UXCL 1JJ2A 1G51A 1HZ9A 3W5OA 4OO1G 4XIGS 4LFBQ 5IT9c 5C3EG 1C9OA 2R92G 1TWFH 1KIXA 3HOZH 3GTQH 3HOVG 2OTLA 5LMNQ 4OXPA 4DV4Q 3T1YL 1CKNA 4BBRG 1X3FA 4OWXB 5H1SE 1OXVA 2F3IA 4X66L 1MIUA 1E3PA 1SMXA 1ASZA 2KCMA 1U5KA 4LF4L 3TQYA 3PUXA 4JI6Q 1VQ6A 4DUYQ 1Q12A 3H3VI 1W2BA 2K75A 2VNUD 4HJ7A 1K0RA 3U50C 2JEBI 2VQFQ 4HJ5A 1AE3A 4GKJQ 2ES2A 2PQAA 1LUZA 4NXNL 1JJCB 3HKZE 3W1BA 1G291 3J80c 4OONA 4BY7H 2ZM6L 1FJGL 1PVOA 2OQKA 5M3MG 3IRBA 1PH2A 1PFSA 4QL5A 3M7NA 1QVFA 2XTIA 1N9WA 2Q2UA 1JB7A 1XMOQ 1VQKA 4UP8A 3KDFB 1R9TH 3UE1A 3UE0A 1WFQA 5IP7H 1SN8A 1PH6A 3EBEA 5C44G 4DV1L 1TWAH 4GOPA 4A3DG 4AH6A 3NELA 4LF4Q 5C4XG 4JOIA 4A3GG 4EX5A 4DPGA 3PO3G 2IY5B 1E22A 4X62L 4GLAC 4HIMA 1YJWA 1VQPA 4JBMA 2CKZB 4PMWA 1A8VA 2K5HA 2OTJA 2UXDQ 1N36L 3J80i 1AH9A 3PCOB 3M9BA 2VUMG 4DV0L 2ATWA 2RHQB 4NXNQ 2UUCL 4LF7L 2WP8J 2I5LX 2VW9A 1KL9A 5M5WH 3PUWA 3MEFA 4HIDA 1ASYA 1B70B 3ULLA 1Q82C 1S72A 1I6HH 1Q1EA 5FLXc 4Y52H 3CC4A 4JI3L 4OO1I 3HOZG 2A19A 1NTGA 3GDEA 3HOYH 4B3RQ 4JV5Q 2UXBL 5AJ3Q 1Z9FA 3PSIA 3OTOL 5IP9H 4UP7A 3CCUA 1XPRA 5JJKA 3PF5A 1YHAA 4LFCL 4X62Q 1CSPA 1HNXQ 1VQDA 1CSQA 1YEZA 2WB1E 4ALPA 4OX9Q 3UDIA 3KF8B 3TREA 4AYBE 1XJVA 2JA8H 2JA5H 4QGUA 4KI0A 1X54A 1L2FA 1BVSA 2R7FA 4HJ9A 1EIYB 3M3YH 4IFDG 1UE1A 1M1KC 1N32Q 5ELOA 3T1HL 5E7NA 4KLKA 4DK3C 4JI8Q 5ELNA 4IPGA 4KHZA 4P73A 4DUZL 4BY7G 1VCIA 1PHJA 4RG1A 3E0EA 3UDGA 1LM0A 4IO9A 4LFAL 1VQOA 4LF5L 3CMEA 1O7IA 1Y1VH 2WFWA 4IJLA 3RLOA 4DV2L 3RNUA 4DR7L 1FVIA 2K52A 1I94L 1SE8A 2ZJQA 4R4TA 2UXBQ 2JA9A 1GO3E 1VQHA 4B3TQ 4YY3L 5IP7G 1IBLL 2I5HA 1FL0A 1MJEA 2DGYA 1V1QA 5HY6A 1AE2A 2CFMA 1TWCH 3HOUH 2N8NA 4LWCA 3CC7A 4JI5Q 2ALYB 2D0PA 1VS0A 1L1OB 4UP9A 1HJPA 4RMFA 4IOCA 1YZ6A 1A62A 1KRSA 3A74A 2QEXA 3T1HQ 2PNHA 3AQQA 2YYZA 4A3IH 3G48A 2VY3A 3CCSA 4DUZQ 1PV4A 3RZDH 3KJOA 1E1TA 5LMNL 4DV4L 4POGA 2IX1A 3S17H 4DR7Q 1VQ8A 3BZKA 3GTGH
chains in the Genus database with same CATH superfamily
3J7A5 2TMPA 4I7AA 5CORA 1K8GA 3AFPA 4YY3Q 1SNPA 1KQSA 3KBXA 2JE6I 1B7YB 1KHIA 4B9WA 2VQFL 2NVQH 3M4QA 2OF1A 2IHFA 1GVPA 2AWOA 5IGCA 4G4KA 4KHPL 4LJZC 2JA8G 1QCBD 1N34Q 2E74C 1EY7A 4HIKA 1I50H 3SXHA 1V9PA 4RHSA 4A93B 1LACA 3OWFA 3MHBA 5CMDA 1TIID 3H15A 3NWSA 3I55A 3SHLA 3K0XA 4FF1A 5EGTA 2VS1A 2WAQB 1BBUA 2KECA 2KEDA 3HP3A 4DR6L 3L7ZC 2B8GA 2K5QA 4GS3A 2K05A 3F2DA 2KCCA 3VYUA 3HOUG 4KHPQ 2JA6H 5I6YA 4DAYB 1SNQA 3J81j 1SYBA 4YWMA 3U4ZA 1B44D 2XSCA 2XWBB 4L8JA 1KC8C 4GZYC 4P72A 2UUBL 3OMGA 2ICIA 4NP5A 3CCVA 1XNQQ 2CHBD 3TN2A 1LYLA 3MA2B 1NAPA 2MO1A 4TVAB 4DR6Q 1HNXL 4CKCA 1HZBA 1FNWA 2QDLA 1QUQB 1EYCA 2ZTEA 4A3JG 4AIMA 1N32L 1QVCA 4JI4Q 5FK9C 4JI8L 4CHTB 2A68D 2L1BA 4OIJA 4P74A 3TP8A 1SNMA 4OEMB 4KY6A 4YCVA 1D7QA 3EROA 4RGOS 1V1PB 1KDAA 3CCMA 4KMUC 2UUBQ 2MO0A 1B9MA 2VB3X 4B9XA 2KA7A 2NVYB 3MEHA 3J81L 3CD6A 4EQPA 5JPNC 3KF6B 3TEHB 4A3JB 3FEWX 4CJ1B 3VYRA 1P16A 5EKKA 5IGGA 3I4MH 4A3EG 2Y0SE 2EYLA 2A68C 1BO0A 2OCEA 5M5YB 2QA4A 3VR5A 1K3RA 2IJ0A 4DR2Q 3TBIB 5I9PA 5IYCH 4BXXG 1RF2D 2R7ZG 2ZTDA 3BYYB 3I2ZA 1HFNA 3Q23A 2H4OA 1WCMH 4A3EB 1G2TA 4X65L 1Q1BA 2RCNA 1WYDA 1EFID 3M4OH 5FJ8H 2G9DA 1H9SB 3H0GG 1IBKQ 2B8FA 2E2HB 3DEOA 4DNTB 4QUCA 4ID6A 2HHHL 4L63B 3VR2A 3ZYYX 3OYYA 1F2MA 5M5XB 1B9NA 1YNNC 4BY1G 2Q2TA 1IKMA 4ME5A 4DR5L 5C4HA 1QWYA 2RKSA 3S15H 4DR3L 1B50A 3CF5A 2E5LL 1GJXA 3CXCA 2B63H 2BCOA 5EQ0A 1KLUD 3B6YA 3J81c 1TVXA 1X55A 2CWAA 4ZLTF 2KBNA 2XRQD 2MPMA 4F88A 2HHHQ 4HR7B 4CDEC 4IALA 3PF4A 1MGSA 1TT2A 2X6GA 2MNAA 4EQ5A 1A15A 1GM5A 1ET6A 1YJNA 1DOKA 2Z6KA 4Q5VA 2K6AA 4R4IA 4DV6L 1X56A 1YJ9A 5FKAC 1VQ5A 1SYEA 1PMRA 3GTMH 3CCQA 1STAA 1PRTD 3D3RA 1VQLA 3J81i 1XPOA 2EDGA 2HCCA 4GLVB 1SFOH 1XWEA 1JE4A 2FJ2A 3GTKB 2RBMA 3P20A 3A54A 3ER0A 1BUVT 1HNWL 1BCPB 3RN2A 1QOHA 1Q86C 1K8OA 4HMJA 1BQQT 3BDOA 2A73B 3NEMA 4DV6Q 1D8LA 4DV3L 4C3JH 2FMCA 1PRTC 5C0XI 3CP0A 5C4ZA 2IL8A 1KDCA 4RGTA 4FYDA 4N8X1 4C1NI 5CGKA 1Z47A 1HXYD 1EIGA 5G3LF 2MQHA 2K50A 3AFQA 4BBSG 3A5UA 1PYWD 5FO9B 4GNXA 5E4WC 3MFYA 4R9WA 5HGTA 1X9NA 4B3SL 1IXRA 2CW0C 3LGJA 5FLMG 1FJGQ 3DWAA 3T56B 1UE7A 4DV3Q 4F7XA 2Z6BA 4JI7L 4APVA 2RDFA 1JICA 2A69D 3T13A 1VDZA 1CT1D 1LTSD 1SDFA 1LTID 3PO3B 1UWVA 4DV1Q 3CCJA 4Y7NB 3RUZA 1WTXA 2VUMB 2JK8A 3DWPA 4ZRZA 4B3SQ 3EN2A 1J5EL 2UUCQ 1LLRD 2RCFA 3BU2A 1Q7YC 3Q6SA 3FHWA 4IOAA 3ULPA 4BBRH 1QNUA 1BR9A 2BH8A 5JEAJ 2HT1A 3K5MA 2A69C 4JBJA 3CPWA 4A76A 5ELFA 2ASBA 4LF8L 3OTOQ 1CKMA 3FDTA 3EA6A 1PYSB 3GP7A 4LFCQ 3BDLA 2F0UA 1D1IA 2GN5A 3I8ZA 2R93G 2KOLA 2KHIA 2O2LD 3ND8A 4KKSA 3D0FA 1J5EQ 2Q2IA 4QIWB 4LUZA 3S16H 3ONAB 1QZHA 4LFBL 3A8IE 1IYJB 1HH2P 2KCTA 3FRPB 4LF5Q 4A3MG 2WKDA 1E1OA 5C4XH 4LF8Q 2R93B 2YU9H 3I70A 1EY5A 4DK0A 1TXYA 4KN4C 1LT5D 1M90C 1HZAA 1K83H 4PV1C 3Q8DA 1HNZL 2F4VL 1JJ2A 4IURA 3V05A 2Z9HA 1LTGD 5EJWA 2QILA 3MVVA 4TRDA 4LFBQ 5C3EG 3VA5A 2R92G 3OWEB 1KAAA 4RGNA 3C1EA 3T1YL 4HCSA 2DJFC 4X66L 1G91A 2KCMA 3TQYA 4OHJA 5BN5A 4XYQA 1L0YB 4GKJQ 2ES2A 3M3YB 2DN8A 1LUZA 1JJCB 4H0LC 3W1BA 2ZM6L 5M3MG 1PH2A 1PFSA 5FOBB 2XTIA 2EZVA 2Q2UA 1CI3M 2KEEA 4DN4M 1R9TH 3NBHA 3UE0A 3UE1A 1SN8A 3EBEA 4PMBA 5IGBA 1TWAH 4A3DG 3MC0B 3NELA 1WTRA 4JOIA 4A3GG 3QO2A 4X62L 2EJFC 4HIMA 1X32A 5C6AA 1A8VA 2K5HA 2UXDQ 1N36L 5EPLA 1F2LA 2ATWA 4LF7L 3D4RA 3RZDB 1Q1EA 3IFTA 5EPJA 4A3DB 4A3GB 3HOZG 2A19A 4B3RQ 3HOYH 4JV5Q 1LT6D 3H94A 1Z9FA 4K8IA 2O4XA 1YNJD 2O5IC 4XXEA 5JJKA 2KJXA 2NVTB 2F0GA 4RGMA 5CV5A 4X62Q 4DAVA 1CSPA 3KBGA 2V4DA 1BXTA 2LY7A 4C56C 3GTOB 4OX9Q 2A6ED 1X54A 3DXJC 4G7HC 1EIYB 4L6TB 2PYKA 5K36H 4DUZL 3E0EA 1STBA 4LFAL 2RDGA 1O7IA 2NTTA 4IJLA 3RLOA 4K2KA 1TS2A 1GO3E 1VQHA 2X6LA 4DNRB 2HQEA 5JEAH 1FL0A 4LK1C 2DGYA 1EWHA 4X3KA 1AE2A 2CFMA 2HUGA 4JK1C 2LFNA 4HCEA 2R3ZA 2RQXA 1RODA 2ALYB 2A6EC 1VS0A 3KK7A 4FP5D 2JA6B 5E4XA 1YZ6A 1A62A 1SJHD 1SNCA 2YYZA 4A3IH 2VY3A 1W6JA 4XQJA 4DUZQ 2EPBA 3OIQA 2FMMA 4POGA 3S17H 1VQ8A 3MFGA 5CC4A 4K2LA 1CFMA 1PFNA 4DAMA 4RAUC 2EIFA 4LMQD 5ELEA 4JI6L 1PXUA 4DUYL 1LTTD 3BVGA 3CC2A 3LWUA 1BOSA 3HOXH 3I4NH 3EFXD 5C0XG 1PH9A 5J3BA 1C8CA 4ZUIA 5GAGC 3K81C 4LUOA 5ELDA 4R8IA 4O0AA 2JYOA 3VYTA 4A3BH 2DY7A 1VQCA 2CH4A 1T5EA 4A3FH 2MUYA 4X6AH 4V0BA 1I6HB 1I6VC 4PZ8A 1HRJA 3OSOA 4IUQA 5K5PA 3PUVA 2N3SA 2ZTCA 3UDFA 2H5XA 4KV6A 1YHBA 1Y1VG 2EJMA 2F0EA 1Z6HA 2LSSA 1EWCA 2M2LA 4IQZA 1C48A 4IUTA 4A3CH 4KTAA 1D2BA 5IODA 1HR0L 3ERQA 2G9HD 3HKZG 2JA7H 3I4MB 1UEBA 1GHJA 1X3GA 1YNXA 3CRLC 3F2BA 2NVXH 2IW3A 3OOCA 1ICWA 2E2JH 2JXMB 4CJ2C 3HOWH 1L1OC 2I5MX 1HHVA 5IY0A 4H44C 1CA6A 5IE8A 5AJ3L 3SK5A 4ABNA 1CTMA 1EUJA 1WCMB 1EU4A 1VQEA 1HPCA 3E9IA 1HR0Q 4UY8C 3ICEA 2XVSA 2ZJRA 1H9MA 2AHOB 3M85A 1S3OA 4JI2Q 3QB3A 1SYCA 3VR6A 3HZXA 3GV6A 3NTIA 3SEBA 3GTGB 1V8QA 2EYHA 1BKBA 3MXNB 1CK1A 4JC0A 3PIOA 2B29A 3TZDA 4YCUA 1SE2A 3I73A 2WB1G 4C3IG 3OW7A 4JI5L 2J0TD 4AYBG 5IOCA 4X3TA 4ZAIA 5FO7B 4LF9L 3S15B 1H9RA 4PZ7A 1EL0A 1EOVA 1SMYC 1NR4A 3TMEA 2B63B 2KCNA 4IPCA 4K5VA 4ILWA 1DONA 4H13C 4C3HG 1WJJA 1Q8KA 2UU9L 3A8JE 4AYBB 3A0JA 2B3GA 3DHQA 2KQ3A 4HSVA 4LF9Q 3GTMB 2BA0A 1SFOB 2N49A 1N34L 3DMUA 2F0HA 1CKNB 4QIWE 1U4MA 2WKCA 1MJCA 2F0VA 1KAWA 3EJIA 1FNUA 1EEID 3SK8A 5CV4A 4PNYA 3S14H 5LMUQ 4A93G 4POFA 1EIHA 5NUCA 1O80A 4JBWA 2XGTA 2UU9Q 3SVMA 1LV9A 2VZAA 1PRTB 5J22A 5GROA 2B2TA 2B2UA 5IYDH 2WAQG 1MKHA 2L4NA 2A8VA 4O2DA 2NB0A 4C3JB 2NN6H 1QB5D 3PIPA 1CHPD 1AP0A 2E2DC 2F52A 2F0LA 1XYIA 5M3FH 2B2VA 2BDNA 3SK6A 2PMZB 3CU7A 2EYOA 1FGBD 3J7ZC 1HCZA 1I4HA 1XNQL 3PO2G 1D6EC 2EY2A 1WTQA 2JP1A 4N9PA 4K8JA 4YWKA 4H02A 3E6ZX 4HIOA 5IIFA 3CPFA 2PW7A 2AQ2B 2K1BA 2D0OA 2OWOA 1KLGD 3KOJA 4ME3A 5JJZA 4JI4L 2D2CC 1WTHA 3GV3A 5KRUA 1OXTA 3Q24A 4LF6L 4XQQA 5EKLA 4X64Q 3PO2B 3VR4A 4YIJA 4IFDJ 4HSPA 2EQSA 4DV7Q 1IHZA 5ISRA 3I4OA 1DGSA 3CKIB 3LWEA 1A3TA 1HZCA 5EAYA 1Q90A 3QIAA 1IBMQ 1U0LA 1TS3A 1SNDA 4YHHL 3AEVA 5AFWA 2BDOA 3FPPA 3K80C 2UXCQ 1IW7D 3HEJA 3S1RH 2AQ1B 3T53B 3I56A 2EYFA 3H3VH 4BBRB 1X3EA 5C4JH 4A3KG 1GUTA 3GTPH 3L9AX 4UDUC 4WRDA 2K5WA 4LF6Q 1S4ZA 3H3VC 3FKIH 3NP8A 4DR2L 2CWPA 1EYGA 5KGUA 2XWJB 4KKTA 4FF3A 4JYAL 4GOPC 1N33L 2NZHA 1F2ZA 2XN9C 3ITPA 2V1CC 1AFPA 2EVBA 1EEFD 4YHHQ 5JJIA 2JJQA 3S16B 1IW7C 3MAQA 4A3KB 1PYBA 1Y1WG 4A3LH 3L0OA 1LO5D 5IYBH 1IBKL 1I4RA 5JJLA 4FXGC 1D1KA 3Q22A 5EPKA 2LMCB 2I07B 4YWLA 1OTCA 4XYOA 1S5DD 1SE4A 3MXPA 3CCLA 5CV8A 3ULJA 4CGYB 4S3SA 1U4RA 2YU9B 4QUFA 4GN3B 2F0MA 3GO5A 3RZOH 4JYAQ 1YIJA 1N33Q 3S2DH 1K83B 4L5RC 3R2TA 1Y1WB 1PFBA 2HIXA 1JB3A 3TZUA 4DV0Q 4DKAC 4OO1H 1CQFA 4U68A 1QUQA 1B53A 1NE3A 5D3DA 3HOVH 1P8LA 1STNA 4EQOA 4Z9CB 1TWGH 3K57A 5LMNW 2AKWB 1WTVA 4JI3Q 5CR3A 4CKEA 2NN6I 1V1PA 4DF7A 1VQMA 4IZ8A 5G3LD 2LXJA 1O7LA 3E0JA 3ZJYC 4UHVA 1F9SA 4GN5A 3KF6A 2Z8LA 5JVG3 4HN7A 3NENA 1VQGA 5CBAE 2H1EA 4DXFA 1NMFA 2L55A 1SYDA 3BJUA 1YI2A 1SROA 5C44H 1R9TB 4P2CB 1GXDC 4DV2Q 1TWAB 1AN8A 2HCIA 3J7AF 5C3WA 1YVCA 3A5ZB 2E2IH 1SYFA 2NZ1D 3J7AV 4NMZA 1CHQD 2B2TC 2X69A 1RD9D 4XIGS 2RDHA 3QOJA 5CV6A 5LMNQ 3HOYB 4OWXB 3DEPA 1OXVA 4DXGA 3H09A 1E3PA 1SMXA 1ASZA 1T5XD 5DEHA 3H3VI 1W2BA 3NXWA 4B08A 1I4GA 2RSOA 4IFDH 4RKBA 4IUVA 1IKLA 2JEBI 3QR8A 4KD4A 3HKZE 4BY7H 4OONA 1FJGL 4TKOB 3IRBA 4QL5A 3A7LA 3QJYA 1NCVA 1N9WA 4R8NA 1O7YA 1JB7A 1XMOQ 1VQKA 3KDFB 5IP7H 2L9HA 2EJGC 2ZXOA 5JOBA 1Z7TA 4DV1L 3NQIA 1ENCA 4AH6A 5KYLA 3PO3G 2GA4B 2EOTA 1STEA 1YJWA 1VQPA 4JBMA 5KEEA 2EYPA 4RCOA 4K5WA 2VUMG 2RHQB 1AZPA 2Z4IA 2UUCL 4A3IB 5M5WH 1STGA 4HIDA 4NW2A 1EZ6A 3K0YA 1Q82C 1FD7D 4O42A 2L5TA 3S17B 2F0KA 3R2IA 2XRSD 5T1IA 1SSOA 1MBYA 1I4XA 4OO1I 1PFMA 1NTGA 3GDEA 3PSIA 3OTOL 1KTKA 1XPRA 4IUNA 4FO2A 4LFCL 3HOXB 3W2DA 3I4NB 1BNZA 2WB1E 1YEZA 4ALPA 1PTOF 2PZWA 5D14A 3KF8B 1U4PA 4AYBE 5FLXE 2JA8H 4QGUA 1L2FA 1BVSA 1UE1A 3LX0A 5E7NA 4DK3C 3G6JB 4A3FB 1D5XC 3EVQA 1TWFB 1B2TA 2F0SA 3UDGA 1LM0A 4IO9A 1VQOA 4LF5L 3CMEA 2WFWA 3P1HA 4DR7L 1FVIA 1I94L 4R4TA 2JA9A 4B3TQ 1IBLL 1Y8OB 4BS9A 5HY6A 1PRTF 3HOUH 2N8NA 1W6KA 1HUNA 1L1OB 4IOCA 2NVXB 1KRSA 3HRZC 3A74A 2JSOA 2E2JB 4X3UA 5D3IB 3HOWB 3H91A 4DR7Q 1I94Q 2R61A 2GVAA 4FNFA 2FXQA 4JI1Q 1I5FA 1IBLQ 2F03A 1HTLD 1TY0A 4A3JH 4WORA 5IP9G 2TSSA 1XNRL 4RKLA 1A2TA 2WAQE 4GKJL 2ZXRA 4OWWB 1X3QA 4CDDC 1D5ZC 2JA5G 3BDCA 4J15A 3G4SA 4IFDI 3W1GA 2SEBD 2HIVA 1WVLA 3K59A 2ID0A 1VMPA 1SBBB 2F0IA 3A7AB 2Q8RE 3R3OA 2A1AA 1WTPA 3NUCA 2IX0A 2Z4HA 5ELBA 3C2PA 1XNRQ 2UXDL 1TWHH 2R6GA 2JA5B 1Y14B 2Z6KC 4A3EH 3CQZH 2K01A 3I4LA 1S5FD 2NYZD 1LTAD 1Q3LA 2EE1A 4PQXA 2E8GA 1E7ZA 4UAIA 2E2HH 2K28A 5EBCA 1MSGA 1X6OA 3C46A 4R4OA 4R1JA 2HQLA 4BXXH 1A6XA 4L5TA 2R7ZH 4B3RL 4JV5L 1KXLA 1A2UA 1NMGA 4JI0Q 2YTYA 1HTPA 1CZWA 3BS1A 1TWCB 1XTDA 4K0KL 5DNFA 5LHY1 3EQLC 1A0IA 4OX9L 2PZTA 1XPUA 2QDBA 4QJFA 3H0GH 3MXUA 4I7ZC 3M4PA 4MZ9A 2K5VA 4C2MH 4RH6A 1J9OA 3N52A 2WIIB 5CV9A 4MIUA 1D5MC 1VF7A 1UE5A 4RFBA 3MZ5A 1B8AA 3S14B 1LTRD 5J1ZA 4CDCC 1ET9A 1NNXA 1EU3A 1SLJA 1HA6A 4BY1H 3URYA 3HKSA 4IPDA 5IGEA 1WTWA 1WOCA 4GNXC 4K0KQ 2SNSA 2NVQB 5D65A 3NTKA 2ICEC 4KD3A 5GQOA 3NQTA 4G7ZC 5I6WA 1I50B 3HS0C 1F9RA 5M3FB 2JA6G 1O7ZA 1GUOA 1JJGA 1EY0A 3JAME 3FMCA 3KFUA 4O1NA 5EBDA 3KYHC 4LAAA 3FPUB 3K7AH 3WWVA 2MFIA 1JORA 4QY7A 4E6IA 1YNJC 3UI2A 3NK9A 2XIWA 2QF7A 1S40A 3S24A 4XT1B 1BDOA 3NPPA 3OHXC 3K5LA 3IFDA 1B3AA 2YTXA 3RLFA 1O78A 4ULLA 4MNOA 3D6WA 2M9VA 3TP7A 1FYCA 2E76C 1K8MA 2YV5A 1ILQA 2XNAC 4B3MQ 3RN5A 3FKIG 4DR1Q 1ONLA 2PQAB 2ZJPA 4OGQC 3KLSX 3S1RB 4LNQA 5HGQA 1NSNS 3A8KE 2C9OA 3GD7A 4P71A 5C4JB 3GTPB 3UDXA 5ELCA 4FXKC 3PV0A 3I4MG 2EXDA 3FKIB 1X3PA 2PO4A 5I2XA 4GOPB 4BBSH 1KDBA 4KY5A 2JQOA 4Y7NH 4RWSC 1BCPF 5FLMH 5IYCG 3DLLA 2AUKA 1JWMD 4OELB 4IUPA 1CZGA 2HDLA 2SOBA 1XMQQ 3H6MA 1V43A 1S5ED 1SAPA 1WCMG 1GUWA 1UAPA 5FJ8G 1PZKD 2J4XA 4JI2L 3R8BA 1BBWA 4NXML 1EWIA 4HMIA 5FO8B 1UNSA 4PZ6A 2QCPX 4P75A 3CMAA 3RZOB 2F0TA 1ZKOA 2EYMA 4C1NK 4EVOA 1JOOA 5LL6X 1B3QA 5GADC 2KUMA 3M4OB 3HOVB 2OEOA 3BZCA 2LS01 1G6ZA 1TWGB 3STBD 3PGZA 3GTLH 2AWNA 2IPKD 2B63G 1YITA 1LTLA 3RR5A 1K28A 4OWTB 4NXMQ 2VXWA 3DM3A 1C0AA 3OW2A 2R93H 2FINB 1PH1A 2N78A 1ILPA 4CBVA 2J7ZA 5E3FA 4JOIC 4ZK9B 4RCNA 1VQIA 3CW2C 3U4VA 4I65A 4HJ8A 3BG3A 1LT3D 2G5DA 4M1UB 4WFN3 3OIPA 4A3MH 2I46A 4FF2A 2BH2A 3STBC 5C0XJ 5C5LA 1CUKA 1QVGA 4WJ4A 1EFWA 4NDXA 5LMUL 2E2IB 3HFZB 2CVRA 2RHSB 3SK4A 1VQJA 1X65A 1IYUA 1TKWB 2SNMA 1HUMA 4DA2A 4KK7A 1S5BD 1PH5A 1E0BA 3RLNA 2OQ0A 3E3XA 1TS4A 5C3EH 1CA5A 4G7OC 2R92H 1I3QH 4BA1I 2DUDA 4ZYSA 4KY7A 1L0WA 3HGBA 2EY6A 4C3JG 2K33A 1VQAA 4XQNA 1QJOA 5JVH3 4U673 2K03A 1RIPA 3AYHB 3CHBD 1YBYA 3NBIA 1TU2B 4JCVE 5KNCA 4A75A 4GKKL 4YCWA 5M3MH 1J6QA 2DY8A 2YTVA 1EQRA 1F2YA 3P7JA 3ND9A 1KNEA 3CCEA 5TSSA 1ENAA 5E1FA 3GTJH 2D62A 4F8MA 1JWSD 1GD7A 1AZQA 4A3DH 4IJHA 3R93A 4X64L 4A3GH 1KNAA 2C35B 1NR2A 4LW1A 4DV7L 2OXPA 5FLXL 1RDPD 2NVTH 2NZOA 1IBML 1UE6A 4GKKQ 3GTOH 3S1MH 3C3LA 1VQFA 1K0SA 2UXCL 2Q8TA 1HQRD 3S9WA 1G51A 5M5WB 3W5OA 1C9OA 1LTBD 1KIXA 3HOZH 3GTQH 2OTLA 1AEXA 4OXPA 3BZKA 4DV4Q 2NUCA 1CKNA 4K6DA 4BBRG 2DJGC 4LF4L 3KLSA 1Q12A 3IL8A 2VNUD 3O13A 4HJ7A 3KLRA 5IT9E 2JA8B 4HJ5A 5I9OA 2VQFQ 5KNDA 1G291 3BVMA 1G8ZD 1PVOA 2OQKA 3I90A 3V96A 2KVMA 3M7NA 5CYUA 1BF4A 4PMCA 4J1MA 3QG1A 5CBEE 1QE6A 4LF4Q 5C4XG 3J80E 4EX5A 4DPGA 1E22A 3HOUB 1M4VA 4PMWA 2IWHA 2OTJA 3K6OA 1RKNA 2EYJA 3OMCA 3SDZA 4DV0L 2KHSA 1KL9A 3PUWA 3MEFA 5BN4A 1ASYA 1B70B 1JR0D 1OO9B 2EXZA 4NKLA 3PIO3 1I6HH 5FLXc 4DAYA 4Y52H 5C4XB 1B1ZA 4JI3L 4N9TA 2B2YA 2MJ8A 3W3AA 1RJTA 3K58A 4UP7A 1KABA 5C0XH 1YHAA 2F0PA 2NTSA 1HNXQ 1VQDA 3QOLA 5JAVA 3UDIA 2F4IA 3TREA 1JCKB 1XJVA 4KI0A 1EYAA 2F0DA 4HJ9A 2P5ZX 3N6RA 4JVZA 1M1KC 1N32Q 3T1HL 2RVLA 2O5JC 4KLKA 1EOTA 4JI8Q 1I4QA 4IPGA 2AQ3B 4P73A 1ZEQX 2MGSA 4RG1A 2ZXPA 4TSSA 4ZUJA 1FR3A 1Y1VH 3RNUA 4DV2L 2N88A 1SE8A 1HQMC 2ZJQA 3AMUA 1YNND 1H9JA 3LNNA 2I5HA 4XDXA 1V1QA 5KIXA 1GUSA 1TWHB 4LWCA 3CC7A 1RCVD 3Q0AA 5DM73 2D0PA 3CQZB 4UP9A 1HJPA 4RMFA 5KNBA 1ESFA 4IUUA 3T1HQ 2PNHA 3AQQA 1DZ1A 4WJWA 1PV4A 1PZID 2MHVA 3KJOA 1EY4A 2K32A 4QMGA 3TSSA 3VYSA 5LMNL 5A2QE 5CV7A 2R7ZB 3GTGH 1V1OA 1A3VA 3MTSA 4X3SA 1R4QB 3PIP3 3HOYG 5DLQE 2QGQA 3DM1A 3WOFA 4CKBA 3H0GB 3ERSX 3S2HH 4K14A 1A3UA 4X65Q 1EQQA 4QCLA 4C2MB 2A6HD 2B2UC 3D4DA 1EQVA 2RF4A 1PTOD 3JAML 4TQUS 1VQ9A 3G7LA 4HJAA 3K5NA 2PI2A 5K36G 1JC7A 2BOSA 2UUAL 1H9SA 2WV6D 4OIKA 1XMOL 3BYTB 1IL8A 1NBWA 1TY2A 4BWGB 5BN3A 4BY1B 4GNXB 2B2VC 2AUJD 2M00A 1T9HA 3CCRA 2RSNA 4GLXA 4C3IH 2F0OA 1GHKA 2DNCA 2F0JA 5JEAG 4F87A 4DR5Q 1QILA 3F2CA 1PTOH 1XX8A 1DOMA 4NB3A 2VQEL 5C3XA 3S1QH 2QKIC 3KJPA 4DR3Q 2A6HC 2E5LQ 1ESRA 3SGIA 4LUVA 2K5NA 2K7VA 1PTOC 4RA8A 5T1GA 3IAYA 3F1ZA 5COYA 1L0XB 4C3HH 3S1NH 4KJNA 4A3IG 2UUAQ 1M8AA 4EGVA 1JT8A 1RL2A 1NY4A 1SR3A 3K7AB 2L15A 2D5DA 1EIFA 1E24A 5M9OA 1CM9A 3I3CA 1WTOA 3L3OC 3TDQA 1PH8A 1JMCA 1PZJD 5IWAL 2CW0D 3D31A 1F9QA 3HOXG 1F9PA 3I4NG 3X3NA 2VQEQ 2CQAA 1I4PA 4A3BG 2K5DA 2R7DA 1DM0B 3V2TA 4A93H 4A3FG 1VQNA 3BVZA 4DV5L 1OXUA 1FGUA 4L5SA 2SDFA 3E5SA 4B3TL 2K14A 1SE3A 3NWTA 2BA1A 1HNWQ 3U9SA 3JAMc 5IWAQ 1E2ZA 2JN4A 2CCZA 1SJED 1UUPA 2MP1A 1STYA 1CKOA 4A3CG 2A74C 4A3BB 1SRUA 1Q46A 2JA7G 4M8AA 5GAHC 1UEAB 1WD1A 4KJOA 5IGDA 4JBKA 3EIVA 4BBSB 1GOZA 3PO2H 3HOWG 4DV5Q 4GN4B 4QQBX 2HD3A 1KRTA 2LKVA 4K6LA 3KDFA 4IPHA 2B2WA 4DK6C 4DR4L 1G2SA 2B2YC 3OPOA 1FNVA 1OXXK 1ZYRD 4IN3A 4JI1L 5HURA 3JAMi 1C7YA 3AU7A 5EKIA 5I2YA 2IT1A 2JA7B 3HG9A 3F8TA 4PG3A 4KN7C 4JI7Q 1K9MC 2D9UA 1VQ7A 2PQEA 1PA6A 2L12A 3IKJA 2KHJA 4DR4Q 3TP6A 2NVYH 1ZYRC 4QF4A 2DNEA 2PMZE 5DM63 4FXDA 4KKUA 2Q8IB 1VQBA 3CAMA 1GKHA 3DWQA 1K73C 5BR8L 3TP5A 2CQOA 4A3KH 4AQYL 3KF8A 4R4QA 3FP9A 3PUYA 4J6HA 4KHVA 3GTLB 2LXKA 3M4YA 3NBHB 1U9RA 1STHA 1LABA 5M5YH 2FHTA 1NUCA 2F0NA 4MTNA 4Q0FA 1JE5A 1SXTA 4JI0L 1JOKA 2QW7A 4N8FA 4EQNA 3NTHA 3WDNA 3I7FA 1IL2A 1R4PB 3J81E 1Y1WH 5BR8Q 1ICFB 4R4CA 1NJIC 1SYGA 4A3MB 4AQYQ 1TR5A 1L1OA 3AB9A 1IZ6A 3TS0A 1C4QA 5IGFA 2ZT9C 5C5MA 2I0QA 1G6PA 2PPBC 4V190 1PH4A 1QZGA 4BA2I 4DGZA 1TQOA 4CDFC 5M5XH 1KD1C 2Z0SA 1PLFA 3BZDB 1VQ4A 1ENFA 1RTOA 2NWGA 4WJ3M 1J8IA 1HNZQ 2F4VQ 5C3EB 2WACA 3VDYA 2R92B 1I3QB 1S5CD 1PH3A 2GVBA 4MHEA 5IYDG 1H95A 1MSHA 3J7YW 2Z1CA 2NN6G 2IHEA 2AMCB 1VF5C 3T1YQ 2RA4A 1YHQA 3E9HA 4X66Q 3D8GA 3KLWA 5M3FG 3JC66 1W3SA 1N8RC 4UPAA 2VL6A 5M3MB 5L37A 1II3A 4JW0A 1BCPD 2ZM6Q 3K8AA 2OT2A 5LL6S 3FVQA 5A35A 3GTJB 3PUZA 2Y0SG 4A4IA 2PW5A 3F2UA 4G57A 3L2PA 2PI2E 3GTKH 1CQVA 2Q2HA 1HA5A 1PH7A 4B3ML 1K8AC 3K7UC 1WI5A 5IT9L 3U58A 4HTHA 4DR1L 2JEAI 3S1MB 4ZKCB 1N36Q 3D6CA 4XTCS 1Q81C 2Y0SB 3A55A 4LF7Q 4DNIA 5KYIA 1BCPC 1EQTA 4ZKBB 3TS2A 4H7BA 3G71A 3HOZB 5GAEC 3GTQB 2K4KA 3J80L 1SNOA 2NBFA 2F3WA 3NHHA 2B2WC 1LT4D 2KENA 3P75A 2F0WA 2N55A 3G6EA 2CH4W 3C1FA 4XT3B 1XMQL 4CJ0B 1GUNA 2F0FA 3D4WA 4QB4A 4JG2A 3VA7A 3MXGA 4A3LG 4LFAQ 4L5QA 3PMFA 4OL7A 5IYBG 1XTCD 3T16A 4FVMA 3PO3H 3KUPA 1EYDA 1VMCA 2EY5A 2L0CA 3A56A 1XXGA 1A63A 1Q8IA 1MD2D 1OXSC 1WD0A 2VUMH 3DUZA 3TRZA 2BE5D 1HR0W 3X3MA 4NPSA 1MHWC 2WINB 4JPBW 1HZ9A 3VR3A 1EY6A 3K5OA 1EZ8A 2K04A 4OO1G 5IT9c 1SEBD 1TWFH 4DFAA 3HOVG 1ML0D 1IYVA 3QWNA 1X3FA 3NE5B 3WOEA 2PNRC 5H1SE 2F3IA 4DAPA 1MIUA 3T4AC 1U5KA 1ZXTA 3PUXA 4JI6Q 1VQ6A 4DUYQ 2FFKB 2K75A 3S2DB 3NSWA 1K0RA 5DAUA 3U50C 2BE5C 1AE3A 1PDQA 2PQAA 4NXNL 3J80c 1QNKA 5F2DA 4RHRA 2F3VA 5A2QL 4MN3A 4DU9A 1QVFA 1Y1VB 2ENBA 4UP8A 2PCFB 2IX3A 1PH6A 1WFQA 5C44G 4MTKA 4GOPA 4K5XA 2IY5B 3HKZB 4GLAC 2CKZB 1RHPA 2EY1A 3PQIA 2L11A 3J80i 1AH9A 3PCOB 2A5HA 3M9BA 5JPMC 2HDMA 1SMYD 4HEDA 4NXNQ 1Y8PB 2WP8J 1JWUD 1K3BC 1MI2A 2B39A 2I5LX 3MWYW 4HAEA 2VW9A 5I4DA 3ULLA 1S72A 3SR1A 4ZCKA 5C44B 3I72A 1DYQA 5J39A 2F1MA 2VB2X 3CC4A 2QEJC 4ZQ3A 2UXBL 1DXMA 4FF4A 5AJ3Q 5IP9H 3CCUA 3PF5A 1GUGA 1CSQA 1DD2A 1DJRD 4J8QA 3U9OA 3S2HB 1EY9A 1H9KA 2JA5H 2R7FA 4DK1A 3M3YH 4IFDG 5ELOA 1B4OA 3CRKC 5ELNA 4ODGA 4KHZA 4BY7G 1U4LA 1RTNA 1JQYD 1VCIA 2E75C 1PHJA 3GQBA 1QG7A 1E2WA 1EY8A 2K52A 3M7GA 2PZUA 2UXBQ 2WB1B 2C5CA 1DCZA 4C3IB 4YY3L 5IP7G 1MJEA 1F77A 3RMHA 3I91A 1E2VA 1DOLA 1TWCH 1Y69U 3MXNA 1PTOB 4JI5Q 3S1QB 1JOQA 4BY7B 1BBXC 3SE0A 3RD4A 1Y8NB 2QEXA 3G48A 1AW7A 3CCSA 4C3HB 3S1NB 3RZDH 1HFGA 3T51B 2F0QA 1E1TA 1TS5A 4DV4L 2IX1A 4FDBA
chains in the Genus database with same CATH topology
1I94Q 3J7A5 4DAMA 2EIFA 2GVAA 1K8GA 2FXQA 4JI6L 4JI1Q 1I5FA 3AFPA 4YY3Q 4DUYL 1IBLQ 3HOYG 1KQSA 5DLQE 3CC2A 2JE6I 1B7YB 1KHIA 3HOXH 5IP9G 4A3JH 2QGQA 3I4NH 5C0XG 1PH9A 5J3BA 1XNRL 2VQFL 2NVQH 4GKJL 2WAQE 5GAGC 3ERSX 3M4QA 3K81C 4X65Q 4LUOA 1EQQA 2IHFA 1GVPA 2AWOA 4OWWB 3S2HH 4KHPL 4O0AA 4A3BH 2JA8G 2RF4A 1VQCA 1N34Q 2JA5G 4TQUS 4A3FH 1VQ9A 4HIKA 1I50H 4J15A 3G4SA 4X6AH 1V9PA 4HJAA 2PI2A 4IFDI 4PZ8A 3W1GA 2UUAL 5K36G 2HIVA 1XMOL 3PUVA 2N3SA 2ZTCA 3UDFA 2H5XA 2ID0A 1NBWA 3H15A 4GNXB 3I55A 1YHBA 1T9HA 1Y1VG 3K0XA 3CCRA 2A1AA 4GLXA 2VS1A 2LSSA 1BBUA 4C3IH 4DR6L 2IX0A 3L7ZC 4A3CH 5JEAG 4GS3A 4DR5Q 1XNRQ 3F2CA 2UXDL 1TWHH 2R6GA 3F2DA 1HR0L 1Y14B 2Z6KC 4A3EH 2JA7H 3CQZH 3HKZG 4NB3A 2VQEL 3HOUG 4DR3Q 3KJPA 3S1QH 1UEBA 4KHPQ 2JA6H 2E5LQ 4DAYB 3SGIA 1X3GA 1YNXA 3F2BA 4LUVA 2K5NA 3J81j 2NVXH 4YWMA 3U4ZA 2E2JH 2E8GA 1E7ZA 3F1ZA 2E2HH 3HOWH 1L1OC 1KC8C 4C3HH 1X6OA 3S1NH 4R4OA 4R1JA 4A3IG 2UUAQ 2I5MX 2HQLA 5IY0A 4BXXH 4P72A 2UUBL 1JT8A 1RL2A 4L5TA 1NY4A 1SR3A 5IE8A 2R7ZH 4B3RL 4JV5L 5AJ3L 1KXLA 2L15A 1NMGA 3CCVA 4JI0Q 1EIFA 2YTYA 1XNQQ 1LYLA 4DR4L 1E24A 1PH8A 2MO1A 4TVAB 1JMCA 4DR6Q 5IWAL 1HNXL 1XTDA 4K0KL 1EUJA 1HZBA 1VQEA 3D31A 1A0IA 4OX9L 1QUQB 1XPUA 3E9IA 4QJFA 2ZTEA 4A3JG 3H0GH 3HOXG 1HR0Q 4UY8C 3I4NG 2VQEQ 3ICEA 3M4PA 4MZ9A 4AIMA 2K5VA 4C2MH 1N32L 1QVCA 4JI4Q 2ZJRA 4JI8L 2AHOB 4P74A 4A3BG 2R7DA 4YCVA 3M85A 1D7QA 1S3OA 4JI2Q 4A93H 4A3FG 1UE5A 1VQNA 1B8AA 4DV5L 3CCMA 1OXUA 1FGUA 2MO0A 2UUBQ 1SLJA 4NXMQ 1BKBA 4BY1H 4L5SA 4B3TL 3MXNB 2K14A 4JC0A 3HKSA 3PIOA 2B29A 2BA1A 4IPDA 3CD6A 1HNWQ 4YCUA 3KF6B 3TEHB 3JAMc 5IWAQ 2WB1G 1WOCA 4GNXC 4K0KQ 2CCZA 4JI5L 4AYBG 4LF9L 1CKOA 4A3CG 5GQOA 4PZ7A 1SRUA 1EOVA 1P16A 1Q46A 3I4MH 4IPCA 4A3EG 2JA7G 5GAHC 2Y0SE 2JA6G 4JBKA 3EIVA 2OCEA 4FDBA 2QA4A 1JJGA 1K3RA 4DR2Q 3PO2H 3HOWG 4DV5Q 4GN4B 3KFUA 4QQBX 1KRTA 1WJJA 3KYHC 3KDFA 1Q8KA 3K7AH 4IPHA 4DK6C 3WWVA 2MFIA 5IYCH 4QY7A 2UU9L 1OXXK 4JI1L 3JAMi 2R7ZG 2ZTDA 1S40A 3A0JA 3S24A 2B3GA 3I2ZA 1C7YA 2YTXA 1WCMH 2IT1A 4LF9Q 4X65L 1Q1BA 3RLFA 2RCNA 1WYDA 3M4OH 3F8TA 4PG3A 4MNOA 5FJ8H 2BA0A 2N49A 1N34L 4JI7Q 3H0GG 1K9MC 1IBKQ 4BXXG 1CKNB 2YV5A 4QIWE 1MJCA 1KAWA 1VQ7A 2HHHL 3S14H 5LMUQ 4B3MQ 1PA6A 4POFA 3RN5A 3FKIG 4A93G 3OYYA 2KHJA 4DR4Q 4JBWA 2XGTA 4DR1Q 2UU9Q 2NVYH 2PMZE 4BY1G 2PQAB 2ZJPA 2VZAA 2Q2TA 5GROA 1VQBA 3CAMA 1GKHA 4DR5L 1K73C 5IYDH 2WAQG 1MKHA 5HGQA 5BR8L 4LNQA 2A8VA 2CQOA 4O2DA 4A3KH 3PIPA 3S15H 4DR3L 3GD7A 3CF5A 4AQYL 4P71A 4R4QA 3FP9A 2E5LL 3PUYA 3CXCA 2B63H 2LXKA 3NBHB 3UDXA 2F52A 3B6YA 3PV0A 3J81c 1X55A 2CWAA 3I4MG 2EXDA 5M3FH 2KBNA 4GOPB 5M5YH 4BBSH 2HHHQ 3J7ZC 2JQOA 4MTNA 3PF4A 1JE5A 2MNAA 4EQ5A 1XNQL 4JI0L 4Y7NH 1GM5A 3PO2G 1YJNA 4YWKA 3DLLA 5FLMH 4H02A 5IYCG 2Z6KA 4HIOA 3I7FA 1IL2A 1Y1WH 4R4IA 3CPFA 4DV6L 5BR8Q 1X56A 1YJ9A 2D0OA 1XMQQ 1VQ5A 1V43A 2OWOA 4R4CA 1NJIC 3GTMH 3KOJA 1WCMG 4ME3A 3CCQA 4AQYQ 1L1OA 1VQLA 3J81i 4JI4L 1XPOA 1IZ6A 3TS0A 4GLVB 1SFOH 5FJ8G 1OXTA 4LF6L 4JI2L 1BBWA 4X64Q 2I0QA 4NXML 1G6PA 1EWIA 3ER0A 4IFDJ 2EQSA 4PZ6A 1PH4A 1QZGA 4BA2I 4DV7Q 3I4OA 4P75A 1DGSA 3CMAA 5M5XH 1HZCA 1HNWL 5EAYA 2Z0SA 1KD1C 3RN2A 1IBMQ 1Q86C 1U0LA 1VQ4A 4WJ3M 4YHHL 3AEVA 5GADC 1HNZQ 3K80C 2F4VQ 2UXCQ 3VDYA 3S1RH 3NEMA 4DV6Q 1D8LA 1PH3A 2GVBA 3I56A 3BZCA 4C3JH 5IYDG 4DV3L 1H95A 3H3VH 5C0XI 3CP0A 1X3EA 5C4JH 2NN6G 4A3KG 3STBD 3PGZA 3GTLH 3GTPH 2IHEA 2AMCB 2AWNA 4LF6Q 2B63G 3T1YQ 1LTLA 1YITA 1Z47A 3FKIH 1YHQA 3RR5A 3E9HA 4OWTB 2MQHA 2CWPA 2K50A 4X66Q 4DR2L 1EYGA 3KLWA 3DM3A 5M3FG 3OW2A 1C0AA 3AFQA 2R93H 4BBSG 3JC66 1W3SA 3A5UA 1N8RC 1PH1A 2N78A 4GNXA 4JYAL 4GOPC 1N33L 2NZHA 4UPAA 2VL6A 4JOIC 2V1CC 1X9NA 4B3SL 1IXRA 4YHHQ 2JJQA 3LGJA 1VQIA 5JJIA 3CW2C 3U4VA 5FLMG 4HJ8A 2ZM6Q 1FJGQ 3K8AA 1PYBA 1Y1WG 4A3LH 1UE7A 3L0OA 4DV3Q 3PUZA 4A3MH 4JI7L 5IYBH 2Y0SG 4APVA 4A4IA 1IBKL 2BH2A 5JJLA 3STBC 5C0XJ 3L2PA 1CUKA 4YWLA 1OTCA 2PI2E 3GTKH 1QVGA 4WJ4A 3CCLA 2Q2HA 1PH7A 3ULJA 1UWVA 5LMUL 4DV1Q 1EFWA 4B3ML 3HFZB 1K8AC 3CCJA 3K7UC 1WI5A 4GN3B 2RHSB 3U58A 4DR1L 1VQJA 1X65A 3GO5A 3RZOH 4JYAQ 2JK8A 2JEAI 1YIJA 1N33Q 3S2DH 4L5RC 1N36Q 2HIXA 4B3SQ 4XTCS 1PH5A 3EN2A 4DV0Q 1J5EL 3RLNA 4DKAC 1Q81C 2OQ0A 5C3EH 2UUCQ 4LF7Q 4DNIA 2R92H 1I3QH 1QUQA 2DUDA 1NE3A 4BA1I 3BU2A 1Q7YC 3HOVH 1P8LA 3TS2A 3FHWA 3G71A 4IOAA 1L0WA 4BBRH 5GAEC 3ULPA 1TWGH 2BH8A 5LMNW 1VQAA 5JEAJ 2AKWB 2HT1A 2K4KA 4JBJA 3CPWA 4A76A 4JI3Q 2ASBA 4LF8L 2NN6I 1RIPA 1CKMA 3OTOQ 3AYHB 1YBYA 1VQMA 1PYSB 4LFCQ 2KENA 2GN5A 2LXJA 2R93G 4JCVE 4A75A 3ZJYC 4GKKL 2KHIA 3G6EA 4YCWA 5M3MH 1J6QA 4GN5A 3KF6A 3D0FA 2YTVA 1XMQL 1J5EQ 1EQRA 3NENA 2Q2IA 4LUZA 1VQGA 3S16H 3CCEA 1QZHA 4JG2A 4LFBL 1IYJB 1HH2P 1NMFA 3GTJH 3BJUA 1YI2A 2D62A 4A3LG 2KCTA 1SROA 4LFAQ 4L5QA 5C44H 4LF5Q 4A3MG 1GD7A 5IYBG 4DV2Q 4A3DH 1E1OA 4IJHA 5C4XH 4X64L 4A3GH 3PO3H 4LF8Q 2C35B 4LW1A 4DV7L 2YU9H 1YVCA 3A5ZB 2E2IH 1TXYA 1A63A 2NVTH 1M90C 1OXSC 2NZOA 1IBML 2VUMH 1UE6A 3TRZA 1HR0W 4GKKQ 3GTOH 3S1MH 1HZAA 1K83H 1VQFA 4NPSA 3Q8DA 1HNZL 2F4VL 2UXCL 1JJ2A 1G51A 1HZ9A 3W5OA 4OO1G 4XIGS 4LFBQ 5IT9c 5C3EG 1C9OA 2R92G 1TWFH 1KIXA 3HOZH 3GTQH 3HOVG 2OTLA 5LMNQ 4OXPA 4DV4Q 3T1YL 1CKNA 4BBRG 1X3FA 4OWXB 5H1SE 1OXVA 2F3IA 4X66L 1MIUA 1E3PA 1SMXA 1ASZA 2KCMA 1U5KA 4LF4L 3TQYA 3PUXA 4JI6Q 1VQ6A 4DUYQ 1Q12A 3H3VI 1W2BA 2K75A 2VNUD 4HJ7A 1K0RA 3U50C 2JEBI 2VQFQ 4HJ5A 1AE3A 4GKJQ 2ES2A 2PQAA 1LUZA 4NXNL 1JJCB 3HKZE 3W1BA 1G291 3J80c 4OONA 4BY7H 2ZM6L 1FJGL 1PVOA 2OQKA 5M3MG 3IRBA 1PH2A 1PFSA 4QL5A 3M7NA 1QVFA 2XTIA 1N9WA 2Q2UA 1JB7A 1XMOQ 1VQKA 4UP8A 3KDFB 1R9TH 3UE1A 3UE0A 1WFQA 5IP7H 1SN8A 1PH6A 3EBEA 5C44G 4DV1L 1TWAH 4GOPA 4A3DG 4AH6A 3NELA 4LF4Q 5C4XG 4JOIA 4A3GG 4EX5A 4DPGA 3PO3G 2IY5B 1E22A 4X62L 4GLAC 4HIMA 1YJWA 1VQPA 4JBMA 2CKZB 4PMWA 1A8VA 2K5HA 2OTJA 2UXDQ 1N36L 3J80i 1AH9A 3PCOB 3M9BA 2VUMG 4DV0L 2ATWA 2RHQB 4NXNQ 2UUCL 4LF7L 2WP8J 2I5LX 2VW9A 1KL9A 5M5WH 3PUWA 3MEFA 4HIDA 1ASYA 1B70B 3ULLA 1Q82C 1S72A 1I6HH 1Q1EA 5FLXc 4Y52H 3CC4A 4JI3L 4OO1I 3HOZG 2A19A 1NTGA 3GDEA 3HOYH 4B3RQ 4JV5Q 2UXBL 5AJ3Q 1Z9FA 3PSIA 3OTOL 5IP9H 4UP7A 3CCUA 1XPRA 5JJKA 3PF5A 1YHAA 4LFCL 4X62Q 1CSPA 1HNXQ 1VQDA 1CSQA 1YEZA 2WB1E 4ALPA 4OX9Q 3UDIA 3KF8B 3TREA 4AYBE 1XJVA 2JA8H 2JA5H 4QGUA 4KI0A 1X54A 1L2FA 1BVSA 2R7FA 4HJ9A 1EIYB 3M3YH 4IFDG 1UE1A 1M1KC 1N32Q 5ELOA 3T1HL 5E7NA 4KLKA 4DK3C 4JI8Q 5ELNA 4IPGA 4KHZA 4P73A 4DUZL 4BY7G 1VCIA 1PHJA 4RG1A 3E0EA 3UDGA 1LM0A 4IO9A 4LFAL 1VQOA 4LF5L 3CMEA 1O7IA 1Y1VH 2WFWA 4IJLA 3RLOA 4DV2L 3RNUA 4DR7L 1FVIA 2K52A 1I94L 1SE8A 2ZJQA 4R4TA 2UXBQ 2JA9A 1GO3E 1VQHA 4B3TQ 4YY3L 5IP7G 1IBLL 2I5HA 1FL0A 1MJEA 2DGYA 1V1QA 5HY6A 1AE2A 2CFMA 1TWCH 3HOUH 2N8NA 4LWCA 3CC7A 4JI5Q 2ALYB 2D0PA 1VS0A 1L1OB 4UP9A 1HJPA 4RMFA 4IOCA 1YZ6A 1A62A 1KRSA 3A74A 2QEXA 3T1HQ 2PNHA 3AQQA 2YYZA 4A3IH 3G48A 2VY3A 3CCSA 4DUZQ 1PV4A 3RZDH 3KJOA 1E1TA 5LMNL 4DV4L 4POGA 2IX1A 3S17H 4DR7Q 1VQ8A 3BZKA 3GTGH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 Q;  3J7A 5;  4DAM A;  2EIF A;  2GVA A;  1K8G A;  2FXQ A;  4JI6 L;  4JI1 Q;  1I5F A;  3AFP A;  4YY3 Q;  4DUY L;  1IBL Q;  3HOY G;  1KQS A;  5DLQ E;  3CC2 A;  2JE6 I;  1B7Y B;  1KHI A;  3HOX H;  5IP9 G;  4A3J H;  2QGQ A;  3I4N H;  5C0X G;  1PH9 A;  5J3B A;  1XNR L;  2VQF L;  2NVQ H;  4GKJ L;  2WAQ E;  5GAG C;  3ERS X;  3M4Q A;  3K81 C;  4X65 Q;  4LUO A;  1EQQ A;  2IHF A;  1GVP A;  2AWO A;  4OWW B;  3S2H H;  4KHP L;  4O0A A;  4A3B H;  2JA8 G;  2RF4 A;  1VQC A;  1N34 Q;  2JA5 G;  4TQU S;  4A3F H;  1VQ9 A;  4HIK A;  1I50 H;  4J15 A;  3G4S A;  4X6A H;  1V9P A;  4HJA A;  2PI2 A;  4IFD I;  4PZ8 A;  3W1G A;  2UUA L;  5K36 G;  2HIV A;  1XMO L;  3PUV A;  2N3S A;  2ZTC A;  3UDF A;  2H5X A;  2ID0 A;  1NBW A;  3H15 A;  4GNX B;  3I55 A;  1YHB A;  1T9H A;  1Y1V G;  3K0X A;  3CCR A;  2A1A A;  4GLX A;  2VS1 A;  2LSS A;  1BBU A;  4C3I H;  4DR6 L;  2IX0 A;  3L7Z C;  4A3C H;  5JEA G;  4GS3 A;  4DR5 Q;  1XNR Q;  3F2C A;  2UXD L;  1TWH H;  2R6G A;  3F2D A;  1HR0 L;  1Y14 B;  2Z6K C;  4A3E H;  2JA7 H;  3CQZ H;  3HKZ G;  4NB3 A;  2VQE L;  3HOU G;  4DR3 Q;  3KJP A;  3S1Q H;  1UEB A;  4KHP Q;  2JA6 H;  2E5L Q;  4DAY B;  3SGI A;  1X3G A;  1YNX A;  3F2B A;  4LUV A;  2K5N A;  3J81 j;  2NVX H;  4YWM A;  3U4Z A;  2E2J H;  2E8G A;  1E7Z A;  3F1Z A;  2E2H H;  3HOW H;  1L1O C;  1KC8 C;  4C3H H;  1X6O A;  3S1N H;  4R4O A;  4R1J A;  4A3I G;  2UUA Q;  2I5M X;  2HQL A;  5IY0 A;  4BXX H;  4P72 A;  2UUB L;  1JT8 A;  1RL2 A;  4L5T A;  1NY4 A;  1SR3 A;  5IE8 A;  2R7Z H;  4B3R L;  4JV5 L;  5AJ3 L;  1KXL A;  2L15 A;  1NMG A;  3CCV A;  4JI0 Q;  1EIF A;  2YTY A;  1XNQ Q;  1LYL A;  4DR4 L;  1E24 A;  1PH8 A;  2MO1 A;  4TVA B;  1JMC A;  4DR6 Q;  5IWA L;  1HNX L;  1XTD A;  4K0K L;  1EUJ A;  1HZB A;  1VQE A;  3D31 A;  1A0I A;  4OX9 L;  1QUQ B;  1XPU A;  3E9I A;  4QJF A;  2ZTE A;  4A3J G;  3H0G H;  3HOX G;  1HR0 Q;  4UY8 C;  3I4N G;  2VQE Q;  3ICE A;  3M4P A;  4MZ9 A;  4AIM A;  2K5V A;  4C2M H;  1N32 L;  1QVC A;  4JI4 Q;  2ZJR A;  4JI8 L;  2AHO B;  4P74 A;  4A3B G;  2R7D A;  4YCV A;  3M85 A;  1D7Q A;  1S3O A;  4JI2 Q;  4A93 H;  4A3F G;  1UE5 A;  1VQN A;  1B8A A;  4DV5 L;  3CCM A;  1OXU A;  1FGU A;  2MO0 A;  2UUB Q;  1SLJ A;  4NXM Q;  1BKB A;  4BY1 H;  4L5S A;  4B3T L;  3MXN B;  2K14 A;  4JC0 A;  3HKS A;  3PIO A;  2B29 A;  2BA1 A;  4IPD A;  3CD6 A;  1HNW Q;  4YCU A;  3KF6 B;  3TEH B;  3JAM c;  5IWA Q;  2WB1 G;  1WOC A;  4GNX C;  4K0K Q;  2CCZ A;  4JI5 L;  4AYB G;  4LF9 L;  1CKO A;  4A3C G;  5GQO A;  4PZ7 A;  1SRU A;  1EOV A;  1P16 A;  1Q46 A;  3I4M H;  4IPC A;  4A3E G;  2JA7 G;  5GAH C;  2Y0S E;  2JA6 G;  4JBK A;  3EIV A;  2OCE A;  4FDB A;  2QA4 A;  1JJG A;  1K3R A;  4DR2 Q;  3PO2 H;  3HOW G;  4DV5 Q;  4GN4 B;  3KFU A;  4QQB X;  1KRT A;  1WJJ A;  3KYH C;  3KDF A;  1Q8K A;  3K7A H;  4IPH A;  4DK6 C;  3WWV A;  2MFI A;  5IYC H;  4QY7 A;  2UU9 L;  1OXX K;  4JI1 L;  3JAM i;  2R7Z G;  2ZTD A;  1S40 A;  3A0J A;  3S24 A;  2B3G A;  3I2Z A;  1C7Y A;  2YTX A;  1WCM H;  2IT1 A;  4LF9 Q;  4X65 L;  1Q1B A;  3RLF A;  2RCN A;  1WYD A;  3M4O H;  3F8T A;  4PG3 A;  4MNO A;  5FJ8 H;  2BA0 A;  2N49 A;  1N34 L;  4JI7 Q;  3H0G G;  1K9M C;  1IBK Q;  4BXX G;  1CKN B;  2YV5 A;  4QIW E;  1MJC A;  1KAW A;  1VQ7 A;  2HHH L;  3S14 H;  5LMU Q;  4B3M Q;  1PA6 A;  4POF A;  3RN5 A;  3FKI G;  4A93 G;  3OYY A;  2KHJ A;  4DR4 Q;  4JBW A;  2XGT A;  4DR1 Q;  2UU9 Q;  2NVY H;  2PMZ E;  4BY1 G;  2PQA B;  2ZJP A;  2VZA A;  2Q2T A;  5GRO A;  1VQB A;  3CAM A;  1GKH A;  4DR5 L;  1K73 C;  5IYD H;  2WAQ G;  1MKH A;  5HGQ A;  5BR8 L;  4LNQ A;  2A8V A;  2CQO A;  4O2D A;  4A3K H;  3PIP A;  3S15 H;  4DR3 L;  3GD7 A;  3CF5 A;  4AQY L;  4P71 A;  4R4Q A;  3FP9 A;  2E5L L;  3PUY A;  3CXC A;  2B63 H;  2LXK A;  3NBH B;  3UDX A;  2F52 A;  3B6Y A;  3PV0 A;  3J81 c;  1X55 A;  2CWA A;  3I4M G;  2EXD A;  5M3F H;  2KBN A;  4GOP B;  5M5Y H;  4BBS H;  2HHH Q;  3J7Z C;  2JQO A;  4MTN A;  3PF4 A;  1JE5 A;  2MNA A;  4EQ5 A;  1XNQ L;  4JI0 L;  4Y7N H;  1GM5 A;  3PO2 G;  1YJN A;  4YWK A;  3DLL A;  5FLM H;  4H02 A;  5IYC G;  2Z6K A;  4HIO A;  3I7F A;  1IL2 A;  1Y1W H;  4R4I A;  3CPF A;  4DV6 L;  5BR8 Q;  1X56 A;  1YJ9 A;  2D0O A;  1XMQ Q;  1VQ5 A;  1V43 A;  2OWO A;  4R4C A;  1NJI C;  3GTM H;  3KOJ A;  1WCM G;  4ME3 A;  3CCQ A;  4AQY Q;  1L1O A;  1VQL A;  3J81 i;  4JI4 L;  1XPO A;  1IZ6 A;  3TS0 A;  4GLV B;  1SFO H;  5FJ8 G;  1OXT A;  4LF6 L;  4JI2 L;  1BBW A;  4X64 Q;  2I0Q A;  4NXM L;  1G6P A;  1EWI A;  3ER0 A;  4IFD J;  2EQS A;  4PZ6 A;  1PH4 A;  1QZG A;  4BA2 I;  4DV7 Q;  3I4O A;  4P75 A;  1DGS A;  3CMA A;  5M5X H;  1HZC A;  1HNW L;  5EAY A;  2Z0S A;  1KD1 C;  3RN2 A;  1IBM Q;  1Q86 C;  1U0L A;  1VQ4 A;  4WJ3 M;  4YHH L;  3AEV A;  5GAD C;  1HNZ Q;  3K80 C;  2F4V Q;  2UXC Q;  3VDY A;  3S1R H;  3NEM A;  4DV6 Q;  1D8L A;  1PH3 A;  2GVB A;  3I56 A;  3BZC A;  4C3J H;  5IYD G;  4DV3 L;  1H95 A;  3H3V H;  5C0X I;  3CP0 A;  1X3E A;  5C4J H;  2NN6 G;  4A3K G;  3STB D;  3PGZ A;  3GTL H;  3GTP H;  2IHE A;  2AMC B;  2AWN A;  4LF6 Q;  2B63 G;  3T1Y Q;  1LTL A;  1YIT A;  1Z47 A;  3FKI H;  1YHQ A;  3RR5 A;  3E9H A;  4OWT B;  2MQH A;  2CWP A;  2K50 A;  4X66 Q;  4DR2 L;  1EYG A;  3KLW A;  3DM3 A;  5M3F G;  3OW2 A;  1C0A A;  3AFQ A;  2R93 H;  4BBS G;  3JC6 6;  1W3S A;  3A5U A;  1N8R C;  1PH1 A;  2N78 A;  4GNX A;  4JYA L;  4GOP C;  1N33 L;  2NZH A;  4UPA A;  2VL6 A;  4JOI C;  2V1C C;  1X9N A;  4B3S L;  1IXR A;  4YHH Q;  2JJQ A;  3LGJ A;  1VQI A;  5JJI A;  3CW2 C;  3U4V A;  5FLM G;  4HJ8 A;  2ZM6 Q;  1FJG Q;  3K8A A;  1PYB A;  1Y1W G;  4A3L H;  1UE7 A;  3L0O A;  4DV3 Q;  3PUZ A;  4A3M H;  4JI7 L;  5IYB H;  2Y0S G;  4APV A;  4A4I A;  1IBK L;  2BH2 A;  5JJL A;  3STB C;  5C0X J;  3L2P A;  1CUK A;  4YWL A;  1OTC A;  2PI2 E;  3GTK H;  1QVG A;  4WJ4 A;  3CCL A;  2Q2H A;  1PH7 A;  3ULJ A;  1UWV A;  5LMU L;  4DV1 Q;  1EFW A;  4B3M L;  3HFZ B;  1K8A C;  3CCJ A;  3K7U C;  1WI5 A;  4GN3 B;  2RHS B;  3U58 A;  4DR1 L;  1VQJ A;  1X65 A;  3GO5 A;  3RZO H;  4JYA Q;  2JK8 A;  2JEA I;  1YIJ A;  1N33 Q;  3S2D H;  4L5R C;  1N36 Q;  2HIX A;  4B3S Q;  4XTC S;  1PH5 A;  3EN2 A;  4DV0 Q;  1J5E L;  3RLN A;  4DKA C;  1Q81 C;  2OQ0 A;  5C3E H;  2UUC Q;  4LF7 Q;  4DNI A;  2R92 H;  1I3Q H;  1QUQ A;  2DUD A;  1NE3 A;  4BA1 I;  3BU2 A;  1Q7Y C;  3HOV H;  1P8L A;  3TS2 A;  3FHW A;  3G71 A;  4IOA A;  1L0W A;  4BBR H;  5GAE C;  3ULP A;  1TWG H;  2BH8 A;  5LMN W;  1VQA A;  5JEA J;  2AKW B;  2HT1 A;  2K4K A;  4JBJ A;  3CPW A;  4A76 A;  4JI3 Q;  2ASB A;  4LF8 L;  2NN6 I;  1RIP A;  1CKM A;  3OTO Q;  3AYH B;  1YBY A;  1VQM A;  1PYS B;  4LFC Q;  2KEN A;  2GN5 A;  2LXJ A;  2R93 G;  4JCV E;  4A75 A;  3ZJY C;  4GKK L;  2KHI A;  3G6E A;  4YCW A;  5M3M H;  1J6Q A;  4GN5 A;  3KF6 A;  3D0F A;  2YTV A;  1XMQ L;  1J5E Q;  1EQR A;  3NEN A;  2Q2I A;  4LUZ A;  1VQG A;  3S16 H;  3CCE A;  1QZH A;  4JG2 A;  4LFB L;  1IYJ B;  1HH2 P;  1NMF A;  3GTJ H;  3BJU A;  1YI2 A;  2D62 A;  4A3L G;  2KCT A;  1SRO A;  4LFA Q;  4L5Q A;  5C44 H;  4LF5 Q;  4A3M G;  1GD7 A;  5IYB G;  4DV2 Q;  4A3D H;  1E1O A;  4IJH A;  5C4X H;  4X64 L;  4A3G H;  3PO3 H;  4LF8 Q;  2C35 B;  4LW1 A;  4DV7 L;  2YU9 H;  1YVC A;  3A5Z B;  2E2I H;  1TXY A;  1A63 A;  2NVT H;  1M90 C;  1OXS C;  2NZO A;  1IBM L;  2VUM H;  1UE6 A;  3TRZ A;  1HR0 W;  4GKK Q;  3GTO H;  3S1M H;  1HZA A;  1K83 H;  1VQF A;  4NPS A;  3Q8D A;  1HNZ L;  2F4V L;  2UXC L;  1JJ2 A;  1G51 A;  1HZ9 A;  3W5O A;  4OO1 G;  4XIG S;  4LFB Q;  5IT9 c;  5C3E G;  1C9O A;  2R92 G;  1TWF H;  1KIX A;  3HOZ H;  3GTQ H;  3HOV G;  2OTL A;  5LMN Q;  4OXP A;  4DV4 Q;  3T1Y L;  1CKN A;  4BBR G;  1X3F A;  4OWX B;  5H1S E;  1OXV A;  2F3I A;  4X66 L;  1MIU A;  1E3P A;  1SMX A;  1ASZ A;  2KCM A;  1U5K A;  4LF4 L;  3TQY A;  3PUX A;  4JI6 Q;  1VQ6 A;  4DUY Q;  1Q12 A;  3H3V I;  1W2B A;  2K75 A;  2VNU D;  4HJ7 A;  1K0R A;  3U50 C;  2JEB I;  2VQF Q;  4HJ5 A;  1AE3 A;  4GKJ Q;  2ES2 A;  2PQA A;  1LUZ A;  4NXN L;  1JJC B;  3HKZ E;  3W1B A;  1G29 1;  3J80 c;  4OON A;  4BY7 H;  2ZM6 L;  1FJG L;  1PVO A;  2OQK A;  5M3M G;  3IRB A;  1PH2 A;  1PFS A;  4QL5 A;  3M7N A;  1QVF A;  2XTI A;  1N9W A;  2Q2U A;  1JB7 A;  1XMO Q;  1VQK A;  4UP8 A;  3KDF B;  1R9T H;  3UE1 A;  3UE0 A;  1WFQ A;  5IP7 H;  1SN8 A;  1PH6 A;  3EBE A;  5C44 G;  4DV1 L;  1TWA H;  4GOP A;  4A3D G;  4AH6 A;  3NEL A;  4LF4 Q;  5C4X G;  4JOI A;  4A3G G;  4EX5 A;  4DPG A;  3PO3 G;  2IY5 B;  1E22 A;  4X62 L;  4GLA C;  4HIM A;  1YJW A;  1VQP A;  4JBM A;  2CKZ B;  4PMW A;  1A8V A;  2K5H A;  2OTJ A;  2UXD Q;  1N36 L;  3J80 i;  1AH9 A;  3PCO B;  3M9B A;  2VUM G;  4DV0 L;  2ATW A;  2RHQ B;  4NXN Q;  2UUC L;  4LF7 L;  2WP8 J;  2I5L X;  2VW9 A;  1KL9 A;  5M5W H;  3PUW A;  3MEF A;  4HID A;  1ASY A;  1B70 B;  3ULL A;  1Q82 C;  1S72 A;  1I6H H;  1Q1E A;  5FLX c;  4Y52 H;  3CC4 A;  4JI3 L;  4OO1 I;  3HOZ G;  2A19 A;  1NTG A;  3GDE A;  3HOY H;  4B3R Q;  4JV5 Q;  2UXB L;  5AJ3 Q;  1Z9F A;  3PSI A;  3OTO L;  5IP9 H;  4UP7 A;  3CCU A;  1XPR A;  5JJK A;  3PF5 A;  1YHA A;  4LFC L;  4X62 Q;  1CSP A;  1HNX Q;  1VQD A;  1CSQ A;  1YEZ A;  2WB1 E;  4ALP A;  4OX9 Q;  3UDI A;  3KF8 B;  3TRE A;  4AYB E;  1XJV A;  2JA8 H;  2JA5 H;  4QGU A;  4KI0 A;  1X54 A;  1L2F A;  1BVS A;  2R7F A;  4HJ9 A;  1EIY B;  3M3Y H;  4IFD G;  1UE1 A;  1M1K C;  1N32 Q;  5ELO A;  3T1H L;  5E7N A;  4KLK A;  4DK3 C;  4JI8 Q;  5ELN A;  4IPG A;  4KHZ A;  4P73 A;  4DUZ L;  4BY7 G;  1VCI A;  1PHJ A;  4RG1 A;  3E0E A;  3UDG A;  1LM0 A;  4IO9 A;  4LFA L;  1VQO A;  4LF5 L;  3CME A;  1O7I A;  1Y1V H;  2WFW A;  4IJL A;  3RLO A;  4DV2 L;  3RNU A;  4DR7 L;  1FVI A;  2K52 A;  1I94 L;  1SE8 A;  2ZJQ A;  4R4T A;  2UXB Q;  2JA9 A;  1GO3 E;  1VQH A;  4B3T Q;  4YY3 L;  5IP7 G;  1IBL L;  2I5H A;  1FL0 A;  1MJE A;  2DGY A;  1V1Q A;  5HY6 A;  1AE2 A;  2CFM A;  1TWC H;  3HOU H;  2N8N A;  4LWC A;  3CC7 A;  4JI5 Q;  2ALY B;  2D0P A;  1VS0 A;  1L1O B;  4UP9 A;  1HJP A;  4RMF A;  4IOC A;  1YZ6 A;  1A62 A;  1KRS A;  3A74 A;  2QEX A;  3T1H Q;  2PNH A;  3AQQ A;  2YYZ A;  4A3I H;  3G48 A;  2VY3 A;  3CCS A;  4DUZ Q;  1PV4 A;  3RZD H;  3KJO A;  1E1T A;  5LMN L;  4DV4 L;  4POG A;  2IX1 A;  3S17 H;  4DR7 Q;  1VQ8 A;  3BZK A;  3GTG H; 
#chains in the Genus database with same CATH topology
 3J7A 5;  2TMP A;  4I7A A;  5COR A;  1K8G A;  3AFP A;  4YY3 Q;  1SNP A;  1KQS A;  3KBX A;  2JE6 I;  1B7Y B;  1KHI A;  4B9W A;  2VQF L;  2NVQ H;  3M4Q A;  2OF1 A;  2IHF A;  1GVP A;  2AWO A;  5IGC A;  4G4K A;  4KHP L;  4LJZ C;  2JA8 G;  1QCB D;  1N34 Q;  2E74 C;  1EY7 A;  4HIK A;  1I50 H;  3SXH A;  1V9P A;  4RHS A;  4A93 B;  1LAC A;  3OWF A;  3MHB A;  5CMD A;  1TII D;  3H15 A;  3NWS A;  3I55 A;  3SHL A;  3K0X A;  4FF1 A;  5EGT A;  2VS1 A;  2WAQ B;  1BBU A;  2KEC A;  2KED A;  3HP3 A;  4DR6 L;  3L7Z C;  2B8G A;  2K5Q A;  4GS3 A;  2K05 A;  3F2D A;  2KCC A;  3VYU A;  3HOU G;  4KHP Q;  2JA6 H;  5I6Y A;  4DAY B;  1SNQ A;  3J81 j;  1SYB A;  4YWM A;  3U4Z A;  1B44 D;  2XSC A;  2XWB B;  4L8J A;  1KC8 C;  4GZY C;  4P72 A;  2UUB L;  3OMG A;  2ICI A;  4NP5 A;  3CCV A;  1XNQ Q;  2CHB D;  3TN2 A;  1LYL A;  3MA2 B;  1NAP A;  2MO1 A;  4TVA B;  4DR6 Q;  1HNX L;  4CKC A;  1HZB A;  1FNW A;  2QDL A;  1QUQ B;  1EYC A;  2ZTE A;  4A3J G;  4AIM A;  1N32 L;  1QVC A;  4JI4 Q;  5FK9 C;  4JI8 L;  4CHT B;  2A68 D;  2L1B A;  4OIJ A;  4P74 A;  3TP8 A;  1SNM A;  4OEM B;  4KY6 A;  4YCV A;  1D7Q A;  3ERO A;  4RGO S;  1V1P B;  1KDA A;  3CCM A;  4KMU C;  2UUB Q;  2MO0 A;  1B9M A;  2VB3 X;  4B9X A;  2KA7 A;  2NVY B;  3MEH A;  3J81 L;  3CD6 A;  4EQP A;  5JPN C;  3KF6 B;  3TEH B;  4A3J B;  3FEW X;  4CJ1 B;  3VYR A;  1P16 A;  5EKK A;  5IGG A;  3I4M H;  4A3E G;  2Y0S E;  2EYL A;  2A68 C;  1BO0 A;  2OCE A;  5M5Y B;  2QA4 A;  3VR5 A;  1K3R A;  2IJ0 A;  4DR2 Q;  3TBI B;  5I9P A;  5IYC H;  4BXX G;  1RF2 D;  2R7Z G;  2ZTD A;  3BYY B;  3I2Z A;  1HFN A;  3Q23 A;  2H4O A;  1WCM H;  4A3E B;  1G2T A;  4X65 L;  1Q1B A;  2RCN A;  1WYD A;  1EFI D;  3M4O H;  5FJ8 H;  2G9D A;  1H9S B;  3H0G G;  1IBK Q;  2B8F A;  2E2H B;  3DEO A;  4DNT B;  4QUC A;  4ID6 A;  2HHH L;  4L63 B;  3VR2 A;  3ZYY X;  3OYY A;  1F2M A;  5M5X B;  1B9N A;  1YNN C;  4BY1 G;  2Q2T A;  1IKM A;  4ME5 A;  4DR5 L;  5C4H A;  1QWY A;  2RKS A;  3S15 H;  4DR3 L;  1B50 A;  3CF5 A;  2E5L L;  1GJX A;  3CXC A;  2B63 H;  2BCO A;  5EQ0 A;  1KLU D;  3B6Y A;  3J81 c;  1TVX A;  1X55 A;  2CWA A;  4ZLT F;  2KBN A;  2XRQ D;  2MPM A;  4F88 A;  2HHH Q;  4HR7 B;  4CDE C;  4IAL A;  3PF4 A;  1MGS A;  1TT2 A;  2X6G A;  2MNA A;  4EQ5 A;  1A15 A;  1GM5 A;  1ET6 A;  1YJN A;  1DOK A;  2Z6K A;  4Q5V A;  2K6A A;  4R4I A;  4DV6 L;  1X56 A;  1YJ9 A;  5FKA C;  1VQ5 A;  1SYE A;  1PMR A;  3GTM H;  3CCQ A;  1STA A;  1PRT D;  3D3R A;  1VQL A;  3J81 i;  1XPO A;  2EDG A;  2HCC A;  4GLV B;  1SFO H;  1XWE A;  1JE4 A;  2FJ2 A;  3GTK B;  2RBM A;  3P20 A;  3A54 A;  3ER0 A;  1BUV T;  1HNW L;  1BCP B;  3RN2 A;  1QOH A;  1Q86 C;  1K8O A;  4HMJ A;  1BQQ T;  3BDO A;  2A73 B;  3NEM A;  4DV6 Q;  1D8L A;  4DV3 L;  4C3J H;  2FMC A;  1PRT C;  5C0X I;  3CP0 A;  5C4Z A;  2IL8 A;  1KDC A;  4RGT A;  4FYD A;  4N8X 1;  4C1N I;  5CGK A;  1Z47 A;  1HXY D;  1EIG A;  5G3L F;  2MQH A;  2K50 A;  3AFQ A;  4BBS G;  3A5U A;  1PYW D;  5FO9 B;  4GNX A;  5E4W C;  3MFY A;  4R9W A;  5HGT A;  1X9N A;  4B3S L;  1IXR A;  2CW0 C;  3LGJ A;  5FLM G;  1FJG Q;  3DWA A;  3T56 B;  1UE7 A;  4DV3 Q;  4F7X A;  2Z6B A;  4JI7 L;  4APV A;  2RDF A;  1JIC A;  2A69 D;  3T13 A;  1VDZ A;  1CT1 D;  1LTS D;  1SDF A;  1LTI D;  3PO3 B;  1UWV A;  4DV1 Q;  3CCJ A;  4Y7N B;  3RUZ A;  1WTX A;  2VUM B;  2JK8 A;  3DWP A;  4ZRZ A;  4B3S Q;  3EN2 A;  1J5E L;  2UUC Q;  1LLR D;  2RCF A;  3BU2 A;  1Q7Y C;  3Q6S A;  3FHW A;  4IOA A;  3ULP A;  4BBR H;  1QNU A;  1BR9 A;  2BH8 A;  5JEA J;  2HT1 A;  3K5M A;  2A69 C;  4JBJ A;  3CPW A;  4A76 A;  5ELF A;  2ASB A;  4LF8 L;  3OTO Q;  1CKM A;  3FDT A;  3EA6 A;  1PYS B;  3GP7 A;  4LFC Q;  3BDL A;  2F0U A;  1D1I A;  2GN5 A;  3I8Z A;  2R93 G;  2KOL A;  2KHI A;  2O2L D;  3ND8 A;  4KKS A;  3D0F A;  1J5E Q;  2Q2I A;  4QIW B;  4LUZ A;  3S16 H;  3ONA B;  1QZH A;  4LFB L;  3A8I E;  1IYJ B;  1HH2 P;  2KCT A;  3FRP B;  4LF5 Q;  4A3M G;  2WKD A;  1E1O A;  5C4X H;  4LF8 Q;  2R93 B;  2YU9 H;  3I70 A;  1EY5 A;  4DK0 A;  1TXY A;  4KN4 C;  1LT5 D;  1M90 C;  1HZA A;  1K83 H;  4PV1 C;  3Q8D A;  1HNZ L;  2F4V L;  1JJ2 A;  4IUR A;  3V05 A;  2Z9H A;  1LTG D;  5EJW A;  2QIL A;  3MVV A;  4TRD A;  4LFB Q;  5C3E G;  3VA5 A;  2R92 G;  3OWE B;  1KAA A;  4RGN A;  3C1E A;  3T1Y L;  4HCS A;  2DJF C;  4X66 L;  1G91 A;  2KCM A;  3TQY A;  4OHJ A;  5BN5 A;  4XYQ A;  1L0Y B;  4GKJ Q;  2ES2 A;  3M3Y B;  2DN8 A;  1LUZ A;  1JJC B;  4H0L C;  3W1B A;  2ZM6 L;  5M3M G;  1PH2 A;  1PFS A;  5FOB B;  2XTI A;  2EZV A;  2Q2U A;  1CI3 M;  2KEE A;  4DN4 M;  1R9T H;  3NBH A;  3UE0 A;  3UE1 A;  1SN8 A;  3EBE A;  4PMB A;  5IGB A;  1TWA H;  4A3D G;  3MC0 B;  3NEL A;  1WTR A;  4JOI A;  4A3G G;  3QO2 A;  4X62 L;  2EJF C;  4HIM A;  1X32 A;  5C6A A;  1A8V A;  2K5H A;  2UXD Q;  1N36 L;  5EPL A;  1F2L A;  2ATW A;  4LF7 L;  3D4R A;  3RZD B;  1Q1E A;  3IFT A;  5EPJ A;  4A3D B;  4A3G B;  3HOZ G;  2A19 A;  4B3R Q;  3HOY H;  4JV5 Q;  1LT6 D;  3H94 A;  1Z9F A;  4K8I A;  2O4X A;  1YNJ D;  2O5I C;  4XXE A;  5JJK A;  2KJX A;  2NVT B;  2F0G A;  4RGM A;  5CV5 A;  4X62 Q;  4DAV A;  1CSP A;  3KBG A;  2V4D A;  1BXT A;  2LY7 A;  4C56 C;  3GTO B;  4OX9 Q;  2A6E D;  1X54 A;  3DXJ C;  4G7H C;  1EIY B;  4L6T B;  2PYK A;  5K36 H;  4DUZ L;  3E0E A;  1STB A;  4LFA L;  2RDG A;  1O7I A;  2NTT A;  4IJL A;  3RLO A;  4K2K A;  1TS2 A;  1GO3 E;  1VQH A;  2X6L A;  4DNR B;  2HQE A;  5JEA H;  1FL0 A;  4LK1 C;  2DGY A;  1EWH A;  4X3K A;  1AE2 A;  2CFM A;  2HUG A;  4JK1 C;  2LFN A;  4HCE A;  2R3Z A;  2RQX A;  1ROD A;  2ALY B;  2A6E C;  1VS0 A;  3KK7 A;  4FP5 D;  2JA6 B;  5E4X A;  1YZ6 A;  1A62 A;  1SJH D;  1SNC A;  2YYZ A;  4A3I H;  2VY3 A;  1W6J A;  4XQJ A;  4DUZ Q;  2EPB A;  3OIQ A;  2FMM A;  4POG A;  3S17 H;  1VQ8 A;  3MFG A;  5CC4 A;  4K2L A;  1CFM A;  1PFN A;  4DAM A;  4RAU C;  2EIF A;  4LMQ D;  5ELE A;  4JI6 L;  1PXU A;  4DUY L;  1LTT D;  3BVG A;  3CC2 A;  3LWU A;  1BOS A;  3HOX H;  3I4N H;  3EFX D;  5C0X G;  1PH9 A;  5J3B A;  1C8C A;  4ZUI A;  5GAG C;  3K81 C;  4LUO A;  5ELD A;  4R8I A;  4O0A A;  2JYO A;  3VYT A;  4A3B H;  2DY7 A;  1VQC A;  2CH4 A;  1T5E A;  4A3F H;  2MUY A;  4X6A H;  4V0B A;  1I6H B;  1I6V C;  4PZ8 A;  1HRJ A;  3OSO A;  4IUQ A;  5K5P A;  3PUV A;  2N3S A;  2ZTC A;  3UDF A;  2H5X A;  4KV6 A;  1YHB A;  1Y1V G;  2EJM A;  2F0E A;  1Z6H A;  2LSS A;  1EWC A;  2M2L A;  4IQZ A;  1C48 A;  4IUT A;  4A3C H;  4KTA A;  1D2B A;  5IOD A;  1HR0 L;  3ERQ A;  2G9H D;  3HKZ G;  2JA7 H;  3I4M B;  1UEB A;  1GHJ A;  1X3G A;  1YNX A;  3CRL C;  3F2B A;  2NVX H;  2IW3 A;  3OOC A;  1ICW A;  2E2J H;  2JXM B;  4CJ2 C;  3HOW H;  1L1O C;  2I5M X;  1HHV A;  5IY0 A;  4H44 C;  1CA6 A;  5IE8 A;  5AJ3 L;  3SK5 A;  4ABN A;  1CTM A;  1EUJ A;  1WCM B;  1EU4 A;  1VQE A;  1HPC A;  3E9I A;  1HR0 Q;  4UY8 C;  3ICE A;  2XVS A;  2ZJR A;  1H9M A;  2AHO B;  3M85 A;  1S3O A;  4JI2 Q;  3QB3 A;  1SYC A;  3VR6 A;  3HZX A;  3GV6 A;  3NTI A;  3SEB A;  3GTG B;  1V8Q A;  2EYH A;  1BKB A;  3MXN B;  1CK1 A;  4JC0 A;  3PIO A;  2B29 A;  3TZD A;  4YCU A;  1SE2 A;  3I73 A;  2WB1 G;  4C3I G;  3OW7 A;  4JI5 L;  2J0T D;  4AYB G;  5IOC A;  4X3T A;  4ZAI A;  5FO7 B;  4LF9 L;  3S15 B;  1H9R A;  4PZ7 A;  1EL0 A;  1EOV A;  1SMY C;  1NR4 A;  3TME A;  2B63 B;  2KCN A;  4IPC A;  4K5V A;  4ILW A;  1DON A;  4H13 C;  4C3H G;  1WJJ A;  1Q8K A;  2UU9 L;  3A8J E;  4AYB B;  3A0J A;  2B3G A;  3DHQ A;  2KQ3 A;  4HSV A;  4LF9 Q;  3GTM B;  2BA0 A;  1SFO B;  2N49 A;  1N34 L;  3DMU A;  2F0H A;  1CKN B;  4QIW E;  1U4M A;  2WKC A;  1MJC A;  2F0V A;  1KAW A;  3EJI A;  1FNU A;  1EEI D;  3SK8 A;  5CV4 A;  4PNY A;  3S14 H;  5LMU Q;  4A93 G;  4POF A;  1EIH A;  5NUC A;  1O80 A;  4JBW A;  2XGT A;  2UU9 Q;  3SVM A;  1LV9 A;  2VZA A;  1PRT B;  5J22 A;  5GRO A;  2B2T A;  2B2U A;  5IYD H;  2WAQ G;  1MKH A;  2L4N A;  2A8V A;  4O2D A;  2NB0 A;  4C3J B;  2NN6 H;  1QB5 D;  3PIP A;  1CHP D;  1AP0 A;  2E2D C;  2F52 A;  2F0L A;  1XYI A;  5M3F H;  2B2V A;  2BDN A;  3SK6 A;  2PMZ B;  3CU7 A;  2EYO A;  1FGB D;  3J7Z C;  1HCZ A;  1I4H A;  1XNQ L;  3PO2 G;  1D6E C;  2EY2 A;  1WTQ A;  2JP1 A;  4N9P A;  4K8J A;  4YWK A;  4H02 A;  3E6Z X;  4HIO A;  5IIF A;  3CPF A;  2PW7 A;  2AQ2 B;  2K1B A;  2D0O A;  2OWO A;  1KLG D;  3KOJ A;  4ME3 A;  5JJZ A;  4JI4 L;  2D2C C;  1WTH A;  3GV3 A;  5KRU A;  1OXT A;  3Q24 A;  4LF6 L;  4XQQ A;  5EKL A;  4X64 Q;  3PO2 B;  3VR4 A;  4YIJ A;  4IFD J;  4HSP A;  2EQS A;  4DV7 Q;  1IHZ A;  5ISR A;  3I4O A;  1DGS A;  3CKI B;  3LWE A;  1A3T A;  1HZC A;  5EAY A;  1Q90 A;  3QIA A;  1IBM Q;  1U0L A;  1TS3 A;  1SND A;  4YHH L;  3AEV A;  5AFW A;  2BDO A;  3FPP A;  3K80 C;  2UXC Q;  1IW7 D;  3HEJ A;  3S1R H;  2AQ1 B;  3T53 B;  3I56 A;  2EYF A;  3H3V H;  4BBR B;  1X3E A;  5C4J H;  4A3K G;  1GUT A;  3GTP H;  3L9A X;  4UDU C;  4WRD A;  2K5W A;  4LF6 Q;  1S4Z A;  3H3V C;  3FKI H;  3NP8 A;  4DR2 L;  2CWP A;  1EYG A;  5KGU A;  2XWJ B;  4KKT A;  4FF3 A;  4JYA L;  4GOP C;  1N33 L;  2NZH A;  1F2Z A;  2XN9 C;  3ITP A;  2V1C C;  1AFP A;  2EVB A;  1EEF D;  4YHH Q;  5JJI A;  2JJQ A;  3S16 B;  1IW7 C;  3MAQ A;  4A3K B;  1PYB A;  1Y1W G;  4A3L H;  3L0O A;  1LO5 D;  5IYB H;  1IBK L;  1I4R A;  5JJL A;  4FXG C;  1D1K A;  3Q22 A;  5EPK A;  2LMC B;  2I07 B;  4YWL A;  1OTC A;  4XYO A;  1S5D D;  1SE4 A;  3MXP A;  3CCL A;  5CV8 A;  3ULJ A;  4CGY B;  4S3S A;  1U4R A;  2YU9 B;  4QUF A;  4GN3 B;  2F0M A;  3GO5 A;  3RZO H;  4JYA Q;  1YIJ A;  1N33 Q;  3S2D H;  1K83 B;  4L5R C;  3R2T A;  1Y1W B;  1PFB A;  2HIX A;  1JB3 A;  3TZU A;  4DV0 Q;  4DKA C;  4OO1 H;  1CQF A;  4U68 A;  1QUQ A;  1B53 A;  1NE3 A;  5D3D A;  3HOV H;  1P8L A;  1STN A;  4EQO A;  4Z9C B;  1TWG H;  3K57 A;  5LMN W;  2AKW B;  1WTV A;  4JI3 Q;  5CR3 A;  4CKE A;  2NN6 I;  1V1P A;  4DF7 A;  1VQM A;  4IZ8 A;  5G3L D;  2LXJ A;  1O7L A;  3E0J A;  3ZJY C;  4UHV A;  1F9S A;  4GN5 A;  3KF6 A;  2Z8L A;  5JVG 3;  4HN7 A;  3NEN A;  1VQG A;  5CBA E;  2H1E A;  4DXF A;  1NMF A;  2L55 A;  1SYD A;  3BJU A;  1YI2 A;  1SRO A;  5C44 H;  1R9T B;  4P2C B;  1GXD C;  4DV2 Q;  1TWA B;  1AN8 A;  2HCI A;  3J7A F;  5C3W A;  1YVC A;  3A5Z B;  2E2I H;  1SYF A;  2NZ1 D;  3J7A V;  4NMZ A;  1CHQ D;  2B2T C;  2X69 A;  1RD9 D;  4XIG S;  2RDH A;  3QOJ A;  5CV6 A;  5LMN Q;  3HOY B;  4OWX B;  3DEP A;  1OXV A;  4DXG A;  3H09 A;  1E3P A;  1SMX A;  1ASZ A;  1T5X D;  5DEH A;  3H3V I;  1W2B A;  3NXW A;  4B08 A;  1I4G A;  2RSO A;  4IFD H;  4RKB A;  4IUV A;  1IKL A;  2JEB I;  3QR8 A;  4KD4 A;  3HKZ E;  4BY7 H;  4OON A;  1FJG L;  4TKO B;  3IRB A;  4QL5 A;  3A7L A;  3QJY A;  1NCV A;  1N9W A;  4R8N A;  1O7Y A;  1JB7 A;  1XMO Q;  1VQK A;  3KDF B;  5IP7 H;  2L9H A;  2EJG C;  2ZXO A;  5JOB A;  1Z7T A;  4DV1 L;  3NQI A;  1ENC A;  4AH6 A;  5KYL A;  3PO3 G;  2GA4 B;  2EOT A;  1STE A;  1YJW A;  1VQP A;  4JBM A;  5KEE A;  2EYP A;  4RCO A;  4K5W A;  2VUM G;  2RHQ B;  1AZP A;  2Z4I A;  2UUC L;  4A3I B;  5M5W H;  1STG A;  4HID A;  4NW2 A;  1EZ6 A;  3K0Y A;  1Q82 C;  1FD7 D;  4O42 A;  2L5T A;  3S17 B;  2F0K A;  3R2I A;  2XRS D;  5T1I A;  1SSO A;  1MBY A;  1I4X A;  4OO1 I;  1PFM A;  1NTG A;  3GDE A;  3PSI A;  3OTO L;  1KTK A;  1XPR A;  4IUN A;  4FO2 A;  4LFC L;  3HOX B;  3W2D A;  3I4N B;  1BNZ A;  2WB1 E;  1YEZ A;  4ALP A;  1PTO F;  2PZW A;  5D14 A;  3KF8 B;  1U4P A;  4AYB E;  5FLX E;  2JA8 H;  4QGU A;  1L2F A;  1BVS A;  1UE1 A;  3LX0 A;  5E7N A;  4DK3 C;  3G6J B;  4A3F B;  1D5X C;  3EVQ A;  1TWF B;  1B2T A;  2F0S A;  3UDG A;  1LM0 A;  4IO9 A;  1VQO A;  4LF5 L;  3CME A;  2WFW A;  3P1H A;  4DR7 L;  1FVI A;  1I94 L;  4R4T A;  2JA9 A;  4B3T Q;  1IBL L;  1Y8O B;  4BS9 A;  5HY6 A;  1PRT F;  3HOU H;  2N8N A;  1W6K A;  1HUN A;  1L1O B;  4IOC A;  2NVX B;  1KRS A;  3HRZ C;  3A74 A;  2JSO A;  2E2J B;  4X3U A;  5D3I B;  3HOW B;  3H91 A;  4DR7 Q;  1I94 Q;  2R61 A;  2GVA A;  4FNF A;  2FXQ A;  4JI1 Q;  1I5F A;  1IBL Q;  2F03 A;  1HTL D;  1TY0 A;  4A3J H;  4WOR A;  5IP9 G;  2TSS A;  1XNR L;  4RKL A;  1A2T A;  2WAQ E;  4GKJ L;  2ZXR A;  4OWW B;  1X3Q A;  4CDD C;  1D5Z C;  2JA5 G;  3BDC A;  4J15 A;  3G4S A;  4IFD I;  3W1G A;  2SEB D;  2HIV A;  1WVL A;  3K59 A;  2ID0 A;  1VMP A;  1SBB B;  2F0I A;  3A7A B;  2Q8R E;  3R3O A;  2A1A A;  1WTP A;  3NUC A;  2IX0 A;  2Z4H A;  5ELB A;  3C2P A;  1XNR Q;  2UXD L;  1TWH H;  2R6G A;  2JA5 B;  1Y14 B;  2Z6K C;  4A3E H;  3CQZ H;  2K01 A;  3I4L A;  1S5F D;  2NYZ D;  1LTA D;  1Q3L A;  2EE1 A;  4PQX A;  2E8G A;  1E7Z A;  4UAI A;  2E2H H;  2K28 A;  5EBC A;  1MSG A;  1X6O A;  3C46 A;  4R4O A;  4R1J A;  2HQL A;  4BXX H;  1A6X A;  4L5T A;  2R7Z H;  4B3R L;  4JV5 L;  1KXL A;  1A2U A;  1NMG A;  4JI0 Q;  2YTY A;  1HTP A;  1CZW A;  3BS1 A;  1TWC B;  1XTD A;  4K0K L;  5DNF A;  5LHY 1;  3EQL C;  1A0I A;  4OX9 L;  2PZT A;  1XPU A;  2QDB A;  4QJF A;  3H0G H;  3MXU A;  4I7Z C;  3M4P A;  4MZ9 A;  2K5V A;  4C2M H;  4RH6 A;  1J9O A;  3N52 A;  2WII B;  5CV9 A;  4MIU A;  1D5M C;  1VF7 A;  1UE5 A;  4RFB A;  3MZ5 A;  1B8A A;  3S14 B;  1LTR D;  5J1Z A;  4CDC C;  1ET9 A;  1NNX A;  1EU3 A;  1SLJ A;  1HA6 A;  4BY1 H;  3URY A;  3HKS A;  4IPD A;  5IGE A;  1WTW A;  1WOC A;  4GNX C;  4K0K Q;  2SNS A;  2NVQ B;  5D65 A;  3NTK A;  2ICE C;  4KD3 A;  5GQO A;  3NQT A;  4G7Z C;  5I6W A;  1I50 B;  3HS0 C;  1F9R A;  5M3F B;  2JA6 G;  1O7Z A;  1GUO A;  1JJG A;  1EY0 A;  3JAM E;  3FMC A;  3KFU A;  4O1N A;  5EBD A;  3KYH C;  4LAA A;  3FPU B;  3K7A H;  3WWV A;  2MFI A;  1JOR A;  4QY7 A;  4E6I A;  1YNJ C;  3UI2 A;  3NK9 A;  2XIW A;  2QF7 A;  1S40 A;  3S24 A;  4XT1 B;  1BDO A;  3NPP A;  3OHX C;  3K5L A;  3IFD A;  1B3A A;  2YTX A;  3RLF A;  1O78 A;  4ULL A;  4MNO A;  3D6W A;  2M9V A;  3TP7 A;  1FYC A;  2E76 C;  1K8M A;  2YV5 A;  1ILQ A;  2XNA C;  4B3M Q;  3RN5 A;  3FKI G;  4DR1 Q;  1ONL A;  2PQA B;  2ZJP A;  4OGQ C;  3KLS X;  3S1R B;  4LNQ A;  5HGQ A;  1NSN S;  3A8K E;  2C9O A;  3GD7 A;  4P71 A;  5C4J B;  3GTP B;  3UDX A;  5ELC A;  4FXK C;  3PV0 A;  3I4M G;  2EXD A;  3FKI B;  1X3P A;  2PO4 A;  5I2X A;  4GOP B;  4BBS H;  1KDB A;  4KY5 A;  2JQO A;  4Y7N H;  4RWS C;  1BCP F;  5FLM H;  5IYC G;  3DLL A;  2AUK A;  1JWM D;  4OEL B;  4IUP A;  1CZG A;  2HDL A;  2SOB A;  1XMQ Q;  3H6M A;  1V43 A;  1S5E D;  1SAP A;  1WCM G;  1GUW A;  1UAP A;  5FJ8 G;  1PZK D;  2J4X A;  4JI2 L;  3R8B A;  1BBW A;  4NXM L;  1EWI A;  4HMI A;  5FO8 B;  1UNS A;  4PZ6 A;  2QCP X;  4P75 A;  3CMA A;  3RZO B;  2F0T A;  1ZKO A;  2EYM A;  4C1N K;  4EVO A;  1JOO A;  5LL6 X;  1B3Q A;  5GAD C;  2KUM A;  3M4O B;  3HOV B;  2OEO A;  3BZC A;  2LS0 1;  1G6Z A;  1TWG B;  3STB D;  3PGZ A;  3GTL H;  2AWN A;  2IPK D;  2B63 G;  1YIT A;  1LTL A;  3RR5 A;  1K28 A;  4OWT B;  4NXM Q;  2VXW A;  3DM3 A;  1C0A A;  3OW2 A;  2R93 H;  2FIN B;  1PH1 A;  2N78 A;  1ILP A;  4CBV A;  2J7Z A;  5E3F A;  4JOI C;  4ZK9 B;  4RCN A;  1VQI A;  3CW2 C;  3U4V A;  4I65 A;  4HJ8 A;  3BG3 A;  1LT3 D;  2G5D A;  4M1U B;  4WFN 3;  3OIP A;  4A3M H;  2I46 A;  4FF2 A;  2BH2 A;  3STB C;  5C0X J;  5C5L A;  1CUK A;  1QVG A;  4WJ4 A;  1EFW A;  4NDX A;  5LMU L;  2E2I B;  3HFZ B;  2CVR A;  2RHS B;  3SK4 A;  1VQJ A;  1X65 A;  1IYU A;  1TKW B;  2SNM A;  1HUM A;  4DA2 A;  4KK7 A;  1S5B D;  1PH5 A;  1E0B A;  3RLN A;  2OQ0 A;  3E3X A;  1TS4 A;  5C3E H;  1CA5 A;  4G7O C;  2R92 H;  1I3Q H;  4BA1 I;  2DUD A;  4ZYS A;  4KY7 A;  1L0W A;  3HGB A;  2EY6 A;  4C3J G;  2K33 A;  1VQA A;  4XQN A;  1QJO A;  5JVH 3;  4U67 3;  2K03 A;  1RIP A;  3AYH B;  3CHB D;  1YBY A;  3NBI A;  1TU2 B;  4JCV E;  5KNC A;  4A75 A;  4GKK L;  4YCW A;  5M3M H;  1J6Q A;  2DY8 A;  2YTV A;  1EQR A;  1F2Y A;  3P7J A;  3ND9 A;  1KNE A;  3CCE A;  5TSS A;  1ENA A;  5E1F A;  3GTJ H;  2D62 A;  4F8M A;  1JWS D;  1GD7 A;  1AZQ A;  4A3D H;  4IJH A;  3R93 A;  4X64 L;  4A3G H;  1KNA A;  2C35 B;  1NR2 A;  4LW1 A;  4DV7 L;  2OXP A;  5FLX L;  1RDP D;  2NVT H;  2NZO A;  1IBM L;  1UE6 A;  4GKK Q;  3GTO H;  3S1M H;  3C3L A;  1VQF A;  1K0S A;  2UXC L;  2Q8T A;  1HQR D;  3S9W A;  1G51 A;  5M5W B;  3W5O A;  1C9O A;  1LTB D;  1KIX A;  3HOZ H;  3GTQ H;  2OTL A;  1AEX A;  4OXP A;  3BZK A;  4DV4 Q;  2NUC A;  1CKN A;  4K6D A;  4BBR G;  2DJG C;  4LF4 L;  3KLS A;  1Q12 A;  3IL8 A;  2VNU D;  3O13 A;  4HJ7 A;  3KLR A;  5IT9 E;  2JA8 B;  4HJ5 A;  5I9O A;  2VQF Q;  5KND A;  1G29 1;  3BVM A;  1G8Z D;  1PVO A;  2OQK A;  3I90 A;  3V96 A;  2KVM A;  3M7N A;  5CYU A;  1BF4 A;  4PMC A;  4J1M A;  3QG1 A;  5CBE E;  1QE6 A;  4LF4 Q;  5C4X G;  3J80 E;  4EX5 A;  4DPG A;  1E22 A;  3HOU B;  1M4V A;  4PMW A;  2IWH A;  2OTJ A;  3K6O A;  1RKN A;  2EYJ A;  3OMC A;  3SDZ A;  4DV0 L;  2KHS A;  1KL9 A;  3PUW A;  3MEF A;  5BN4 A;  1ASY A;  1B70 B;  1JR0 D;  1OO9 B;  2EXZ A;  4NKL A;  3PIO 3;  1I6H H;  5FLX c;  4DAY A;  4Y52 H;  5C4X B;  1B1Z A;  4JI3 L;  4N9T A;  2B2Y A;  2MJ8 A;  3W3A A;  1RJT A;  3K58 A;  4UP7 A;  1KAB A;  5C0X H;  1YHA A;  2F0P A;  2NTS A;  1HNX Q;  1VQD A;  3QOL A;  5JAV A;  3UDI A;  2F4I A;  3TRE A;  1JCK B;  1XJV A;  4KI0 A;  1EYA A;  2F0D A;  4HJ9 A;  2P5Z X;  3N6R A;  4JVZ A;  1M1K C;  1N32 Q;  3T1H L;  2RVL A;  2O5J C;  4KLK A;  1EOT A;  4JI8 Q;  1I4Q A;  4IPG A;  2AQ3 B;  4P73 A;  1ZEQ X;  2MGS A;  4RG1 A;  2ZXP A;  4TSS A;  4ZUJ A;  1FR3 A;  1Y1V H;  3RNU A;  4DV2 L;  2N88 A;  1SE8 A;  1HQM C;  2ZJQ A;  3AMU A;  1YNN D;  1H9J A;  3LNN A;  2I5H A;  4XDX A;  1V1Q A;  5KIX A;  1GUS A;  1TWH B;  4LWC A;  3CC7 A;  1RCV D;  3Q0A A;  5DM7 3;  2D0P A;  3CQZ B;  4UP9 A;  1HJP A;  4RMF A;  5KNB A;  1ESF A;  4IUU A;  3T1H Q;  2PNH A;  3AQQ A;  1DZ1 A;  4WJW A;  1PV4 A;  1PZI D;  2MHV A;  3KJO A;  1EY4 A;  2K32 A;  4QMG A;  3TSS A;  3VYS A;  5LMN L;  5A2Q E;  5CV7 A;  2R7Z B;  3GTG H;  1V1O A;  1A3V A;  3MTS A;  4X3S A;  1R4Q B;  3PIP 3;  3HOY G;  5DLQ E;  2QGQ A;  3DM1 A;  3WOF A;  4CKB A;  3H0G B;  3ERS X;  3S2H H;  4K14 A;  1A3U A;  4X65 Q;  1EQQ A;  4QCL A;  4C2M B;  2A6H D;  2B2U C;  3D4D A;  1EQV A;  2RF4 A;  1PTO D;  3JAM L;  4TQU S;  1VQ9 A;  3G7L A;  4HJA A;  3K5N A;  2PI2 A;  5K36 G;  1JC7 A;  2BOS A;  2UUA L;  1H9S A;  2WV6 D;  4OIK A;  1XMO L;  3BYT B;  1IL8 A;  1NBW A;  1TY2 A;  4BWG B;  5BN3 A;  4BY1 B;  4GNX B;  2B2V C;  2AUJ D;  2M00 A;  1T9H A;  3CCR A;  2RSN A;  4GLX A;  4C3I H;  2F0O A;  1GHK A;  2DNC A;  2F0J A;  5JEA G;  4F87 A;  4DR5 Q;  1QIL A;  3F2C A;  1PTO H;  1XX8 A;  1DOM A;  4NB3 A;  2VQE L;  5C3X A;  3S1Q H;  2QKI C;  3KJP A;  4DR3 Q;  2A6H C;  2E5L Q;  1ESR A;  3SGI A;  4LUV A;  2K5N A;  2K7V A;  1PTO C;  4RA8 A;  5T1G A;  3IAY A;  3F1Z A;  5COY A;  1L0X B;  4C3H H;  3S1N H;  4KJN A;  4A3I G;  2UUA Q;  1M8A A;  4EGV A;  1JT8 A;  1RL2 A;  1NY4 A;  1SR3 A;  3K7A B;  2L15 A;  2D5D A;  1EIF A;  1E24 A;  5M9O A;  1CM9 A;  3I3C A;  1WTO A;  3L3O C;  3TDQ A;  1PH8 A;  1JMC A;  1PZJ D;  5IWA L;  2CW0 D;  3D31 A;  1F9Q A;  3HOX G;  1F9P A;  3I4N G;  3X3N A;  2VQE Q;  2CQA A;  1I4P A;  4A3B G;  2K5D A;  2R7D A;  1DM0 B;  3V2T A;  4A93 H;  4A3F G;  1VQN A;  3BVZ A;  4DV5 L;  1OXU A;  1FGU A;  4L5S A;  2SDF A;  3E5S A;  4B3T L;  2K14 A;  1SE3 A;  3NWT A;  2BA1 A;  1HNW Q;  3U9S A;  3JAM c;  5IWA Q;  1E2Z A;  2JN4 A;  2CCZ A;  1SJE D;  1UUP A;  2MP1 A;  1STY A;  1CKO A;  4A3C G;  2A74 C;  4A3B B;  1SRU A;  1Q46 A;  2JA7 G;  4M8A A;  5GAH C;  1UEA B;  1WD1 A;  4KJO A;  5IGD A;  4JBK A;  3EIV A;  4BBS B;  1GOZ A;  3PO2 H;  3HOW G;  4DV5 Q;  4GN4 B;  4QQB X;  2HD3 A;  1KRT A;  2LKV A;  4K6L A;  3KDF A;  4IPH A;  2B2W A;  4DK6 C;  4DR4 L;  1G2S A;  2B2Y C;  3OPO A;  1FNV A;  1OXX K;  1ZYR D;  4IN3 A;  4JI1 L;  5HUR A;  3JAM i;  1C7Y A;  3AU7 A;  5EKI A;  5I2Y A;  2IT1 A;  2JA7 B;  3HG9 A;  3F8T A;  4PG3 A;  4KN7 C;  4JI7 Q;  1K9M C;  2D9U A;  1VQ7 A;  2PQE A;  1PA6 A;  2L12 A;  3IKJ A;  2KHJ A;  4DR4 Q;  3TP6 A;  2NVY H;  1ZYR C;  4QF4 A;  2DNE A;  2PMZ E;  5DM6 3;  4FXD A;  4KKU A;  2Q8I B;  1VQB A;  3CAM A;  1GKH A;  3DWQ A;  1K73 C;  5BR8 L;  3TP5 A;  2CQO A;  4A3K H;  4AQY L;  3KF8 A;  4R4Q A;  3FP9 A;  3PUY A;  4J6H A;  4KHV A;  3GTL B;  2LXK A;  3M4Y A;  3NBH B;  1U9R A;  1STH A;  1LAB A;  5M5Y H;  2FHT A;  1NUC A;  2F0N A;  4MTN A;  4Q0F A;  1JE5 A;  1SXT A;  4JI0 L;  1JOK A;  2QW7 A;  4N8F A;  4EQN A;  3NTH A;  3WDN A;  3I7F A;  1IL2 A;  1R4P B;  3J81 E;  1Y1W H;  5BR8 Q;  1ICF B;  4R4C A;  1NJI C;  1SYG A;  4A3M B;  4AQY Q;  1TR5 A;  1L1O A;  3AB9 A;  1IZ6 A;  3TS0 A;  1C4Q A;  5IGF A;  2ZT9 C;  5C5M A;  2I0Q A;  1G6P A;  2PPB C;  4V19 0;  1PH4 A;  1QZG A;  4BA2 I;  4DGZ A;  1TQO A;  4CDF C;  5M5X H;  1KD1 C;  2Z0S A;  1PLF A;  3BZD B;  1VQ4 A;  1ENF A;  1RTO A;  2NWG A;  4WJ3 M;  1J8I A;  1HNZ Q;  2F4V Q;  5C3E B;  2WAC A;  3VDY A;  2R92 B;  1I3Q B;  1S5C D;  1PH3 A;  2GVB A;  4MHE A;  5IYD G;  1H95 A;  1MSH A;  3J7Y W;  2Z1C A;  2NN6 G;  2IHE A;  2AMC B;  1VF5 C;  3T1Y Q;  2RA4 A;  1YHQ A;  3E9H A;  4X66 Q;  3D8G A;  3KLW A;  5M3F G;  3JC6 6;  1W3S A;  1N8R C;  4UPA A;  2VL6 A;  5M3M B;  5L37 A;  1II3 A;  4JW0 A;  1BCP D;  2ZM6 Q;  3K8A A;  2OT2 A;  5LL6 S;  3FVQ A;  5A35 A;  3GTJ B;  3PUZ A;  2Y0S G;  4A4I A;  2PW5 A;  3F2U A;  4G57 A;  3L2P A;  2PI2 E;  3GTK H;  1CQV A;  2Q2H A;  1HA5 A;  1PH7 A;  4B3M L;  1K8A C;  3K7U C;  1WI5 A;  5IT9 L;  3U58 A;  4HTH A;  4DR1 L;  2JEA I;  3S1M B;  4ZKC B;  1N36 Q;  3D6C A;  4XTC S;  1Q81 C;  2Y0S B;  3A55 A;  4LF7 Q;  4DNI A;  5KYI A;  1BCP C;  1EQT A;  4ZKB B;  3TS2 A;  4H7B A;  3G71 A;  3HOZ B;  5GAE C;  3GTQ B;  2K4K A;  3J80 L;  1SNO A;  2NBF A;  2F3W A;  3NHH A;  2B2W C;  1LT4 D;  2KEN A;  3P75 A;  2F0W A;  2N55 A;  3G6E A;  2CH4 W;  3C1F A;  4XT3 B;  1XMQ L;  4CJ0 B;  1GUN A;  2F0F A;  3D4W A;  4QB4 A;  4JG2 A;  3VA7 A;  3MXG A;  4A3L G;  4LFA Q;  4L5Q A;  3PMF A;  4OL7 A;  5IYB G;  1XTC D;  3T16 A;  4FVM A;  3PO3 H;  3KUP A;  1EYD A;  1VMC A;  2EY5 A;  2L0C A;  3A56 A;  1XXG A;  1A63 A;  1Q8I A;  1MD2 D;  1OXS C;  1WD0 A;  2VUM H;  3DUZ A;  3TRZ A;  2BE5 D;  1HR0 W;  3X3M A;  4NPS A;  1MHW C;  2WIN B;  4JPB W;  1HZ9 A;  3VR3 A;  1EY6 A;  3K5O A;  1EZ8 A;  2K04 A;  4OO1 G;  5IT9 c;  1SEB D;  1TWF H;  4DFA A;  3HOV G;  1ML0 D;  1IYV A;  3QWN A;  1X3F A;  3NE5 B;  3WOE A;  2PNR C;  5H1S E;  2F3I A;  4DAP A;  1MIU A;  3T4A C;  1U5K A;  1ZXT A;  3PUX A;  4JI6 Q;  1VQ6 A;  4DUY Q;  2FFK B;  2K75 A;  3S2D B;  3NSW A;  1K0R A;  5DAU A;  3U50 C;  2BE5 C;  1AE3 A;  1PDQ A;  2PQA A;  4NXN L;  3J80 c;  1QNK A;  5F2D A;  4RHR A;  2F3V A;  5A2Q L;  4MN3 A;  4DU9 A;  1QVF A;  1Y1V B;  2ENB A;  4UP8 A;  2PCF B;  2IX3 A;  1PH6 A;  1WFQ A;  5C44 G;  4MTK A;  4GOP A;  4K5X A;  2IY5 B;  3HKZ B;  4GLA C;  2CKZ B;  1RHP A;  2EY1 A;  3PQI A;  2L11 A;  3J80 i;  1AH9 A;  3PCO B;  2A5H A;  3M9B A;  5JPM C;  2HDM A;  1SMY D;  4HED A;  4NXN Q;  1Y8P B;  2WP8 J;  1JWU D;  1K3B C;  1MI2 A;  2B39 A;  2I5L X;  3MWY W;  4HAE A;  2VW9 A;  5I4D A;  3ULL A;  1S72 A;  3SR1 A;  4ZCK A;  5C44 B;  3I72 A;  1DYQ A;  5J39 A;  2F1M A;  2VB2 X;  3CC4 A;  2QEJ C;  4ZQ3 A;  2UXB L;  1DXM A;  4FF4 A;  5AJ3 Q;  5IP9 H;  3CCU A;  3PF5 A;  1GUG A;  1CSQ A;  1DD2 A;  1DJR D;  4J8Q A;  3U9O A;  3S2H B;  1EY9 A;  1H9K A;  2JA5 H;  2R7F A;  4DK1 A;  3M3Y H;  4IFD G;  5ELO A;  1B4O A;  3CRK C;  5ELN A;  4ODG A;  4KHZ A;  4BY7 G;  1U4L A;  1RTN A;  1JQY D;  1VCI A;  2E75 C;  1PHJ A;  3GQB A;  1QG7 A;  1E2W A;  1EY8 A;  2K52 A;  3M7G A;  2PZU A;  2UXB Q;  2WB1 B;  2C5C A;  1DCZ A;  4C3I B;  4YY3 L;  5IP7 G;  1MJE A;  1F77 A;  3RMH A;  3I91 A;  1E2V A;  1DOL A;  1TWC H;  1Y69 U;  3MXN A;  1PTO B;  4JI5 Q;  3S1Q B;  1JOQ A;  4BY7 B;  1BBX C;  3SE0 A;  3RD4 A;  1Y8N B;  2QEX A;  3G48 A;  1AW7 A;  3CCS A;  4C3H B;  3S1N B;  3RZD H;  1HFG A;  3T51 B;  2F0Q A;  1E1T A;  1TS5 A;  4DV4 L;  2IX1 A;  4FDB A; 
#chains in the Genus database with same CATH homology
 1I94 Q;  3J7A 5;  4DAM A;  2EIF A;  2GVA A;  1K8G A;  2FXQ A;  4JI6 L;  4JI1 Q;  1I5F A;  3AFP A;  4YY3 Q;  4DUY L;  1IBL Q;  3HOY G;  1KQS A;  5DLQ E;  3CC2 A;  2JE6 I;  1B7Y B;  1KHI A;  3HOX H;  5IP9 G;  4A3J H;  2QGQ A;  3I4N H;  5C0X G;  1PH9 A;  5J3B A;  1XNR L;  2VQF L;  2NVQ H;  4GKJ L;  2WAQ E;  5GAG C;  3ERS X;  3M4Q A;  3K81 C;  4X65 Q;  4LUO A;  1EQQ A;  2IHF A;  1GVP A;  2AWO A;  4OWW B;  3S2H H;  4KHP L;  4O0A A;  4A3B H;  2JA8 G;  2RF4 A;  1VQC A;  1N34 Q;  2JA5 G;  4TQU S;  4A3F H;  1VQ9 A;  4HIK A;  1I50 H;  4J15 A;  3G4S A;  4X6A H;  1V9P A;  4HJA A;  2PI2 A;  4IFD I;  4PZ8 A;  3W1G A;  2UUA L;  5K36 G;  2HIV A;  1XMO L;  3PUV A;  2N3S A;  2ZTC A;  3UDF A;  2H5X A;  2ID0 A;  1NBW A;  3H15 A;  4GNX B;  3I55 A;  1YHB A;  1T9H A;  1Y1V G;  3K0X A;  3CCR A;  2A1A A;  4GLX A;  2VS1 A;  2LSS A;  1BBU A;  4C3I H;  4DR6 L;  2IX0 A;  3L7Z C;  4A3C H;  5JEA G;  4GS3 A;  4DR5 Q;  1XNR Q;  3F2C A;  2UXD L;  1TWH H;  2R6G A;  3F2D A;  1HR0 L;  1Y14 B;  2Z6K C;  4A3E H;  2JA7 H;  3CQZ H;  3HKZ G;  4NB3 A;  2VQE L;  3HOU G;  4DR3 Q;  3KJP A;  3S1Q H;  1UEB A;  4KHP Q;  2JA6 H;  2E5L Q;  4DAY B;  3SGI A;  1X3G A;  1YNX A;  3F2B A;  4LUV A;  2K5N A;  3J81 j;  2NVX H;  4YWM A;  3U4Z A;  2E2J H;  2E8G A;  1E7Z A;  3F1Z A;  2E2H H;  3HOW H;  1L1O C;  1KC8 C;  4C3H H;  1X6O A;  3S1N H;  4R4O A;  4R1J A;  4A3I G;  2UUA Q;  2I5M X;  2HQL A;  5IY0 A;  4BXX H;  4P72 A;  2UUB L;  1JT8 A;  1RL2 A;  4L5T A;  1NY4 A;  1SR3 A;  5IE8 A;  2R7Z H;  4B3R L;  4JV5 L;  5AJ3 L;  1KXL A;  2L15 A;  1NMG A;  3CCV A;  4JI0 Q;  1EIF A;  2YTY A;  1XNQ Q;  1LYL A;  4DR4 L;  1E24 A;  1PH8 A;  2MO1 A;  4TVA B;  1JMC A;  4DR6 Q;  5IWA L;  1HNX L;  1XTD A;  4K0K L;  1EUJ A;  1HZB A;  1VQE A;  3D31 A;  1A0I A;  4OX9 L;  1QUQ B;  1XPU A;  3E9I A;  4QJF A;  2ZTE A;  4A3J G;  3H0G H;  3HOX G;  1HR0 Q;  4UY8 C;  3I4N G;  2VQE Q;  3ICE A;  3M4P A;  4MZ9 A;  4AIM A;  2K5V A;  4C2M H;  1N32 L;  1QVC A;  4JI4 Q;  2ZJR A;  4JI8 L;  2AHO B;  4P74 A;  4A3B G;  2R7D A;  4YCV A;  3M85 A;  1D7Q A;  1S3O A;  4JI2 Q;  4A93 H;  4A3F G;  1UE5 A;  1VQN A;  1B8A A;  4DV5 L;  3CCM A;  1OXU A;  1FGU A;  2MO0 A;  2UUB Q;  1SLJ A;  4NXM Q;  1BKB A;  4BY1 H;  4L5S A;  4B3T L;  3MXN B;  2K14 A;  4JC0 A;  3HKS A;  3PIO A;  2B29 A;  2BA1 A;  4IPD A;  3CD6 A;  1HNW Q;  4YCU A;  3KF6 B;  3TEH B;  3JAM c;  5IWA Q;  2WB1 G;  1WOC A;  4GNX C;  4K0K Q;  2CCZ A;  4JI5 L;  4AYB G;  4LF9 L;  1CKO A;  4A3C G;  5GQO A;  4PZ7 A;  1SRU A;  1EOV A;  1P16 A;  1Q46 A;  3I4M H;  4IPC A;  4A3E G;  2JA7 G;  5GAH C;  2Y0S E;  2JA6 G;  4JBK A;  3EIV A;  2OCE A;  4FDB A;  2QA4 A;  1JJG A;  1K3R A;  4DR2 Q;  3PO2 H;  3HOW G;  4DV5 Q;  4GN4 B;  3KFU A;  4QQB X;  1KRT A;  1WJJ A;  3KYH C;  3KDF A;  1Q8K A;  3K7A H;  4IPH A;  4DK6 C;  3WWV A;  2MFI A;  5IYC H;  4QY7 A;  2UU9 L;  1OXX K;  4JI1 L;  3JAM i;  2R7Z G;  2ZTD A;  1S40 A;  3A0J A;  3S24 A;  2B3G A;  3I2Z A;  1C7Y A;  2YTX A;  1WCM H;  2IT1 A;  4LF9 Q;  4X65 L;  1Q1B A;  3RLF A;  2RCN A;  1WYD A;  3M4O H;  3F8T A;  4PG3 A;  4MNO A;  5FJ8 H;  2BA0 A;  2N49 A;  1N34 L;  4JI7 Q;  3H0G G;  1K9M C;  1IBK Q;  4BXX G;  1CKN B;  2YV5 A;  4QIW E;  1MJC A;  1KAW A;  1VQ7 A;  2HHH L;  3S14 H;  5LMU Q;  4B3M Q;  1PA6 A;  4POF A;  3RN5 A;  3FKI G;  4A93 G;  3OYY A;  2KHJ A;  4DR4 Q;  4JBW A;  2XGT A;  4DR1 Q;  2UU9 Q;  2NVY H;  2PMZ E;  4BY1 G;  2PQA B;  2ZJP A;  2VZA A;  2Q2T A;  5GRO A;  1VQB A;  3CAM A;  1GKH A;  4DR5 L;  1K73 C;  5IYD H;  2WAQ G;  1MKH A;  5HGQ A;  5BR8 L;  4LNQ A;  2A8V A;  2CQO A;  4O2D A;  4A3K H;  3PIP A;  3S15 H;  4DR3 L;  3GD7 A;  3CF5 A;  4AQY L;  4P71 A;  4R4Q A;  3FP9 A;  2E5L L;  3PUY A;  3CXC A;  2B63 H;  2LXK A;  3NBH B;  3UDX A;  2F52 A;  3B6Y A;  3PV0 A;  3J81 c;  1X55 A;  2CWA A;  3I4M G;  2EXD A;  5M3F H;  2KBN A;  4GOP B;  5M5Y H;  4BBS H;  2HHH Q;  3J7Z C;  2JQO A;  4MTN A;  3PF4 A;  1JE5 A;  2MNA A;  4EQ5 A;  1XNQ L;  4JI0 L;  4Y7N H;  1GM5 A;  3PO2 G;  1YJN A;  4YWK A;  3DLL A;  5FLM H;  4H02 A;  5IYC G;  2Z6K A;  4HIO A;  3I7F A;  1IL2 A;  1Y1W H;  4R4I A;  3CPF A;  4DV6 L;  5BR8 Q;  1X56 A;  1YJ9 A;  2D0O A;  1XMQ Q;  1VQ5 A;  1V43 A;  2OWO A;  4R4C A;  1NJI C;  3GTM H;  3KOJ A;  1WCM G;  4ME3 A;  3CCQ A;  4AQY Q;  1L1O A;  1VQL A;  3J81 i;  4JI4 L;  1XPO A;  1IZ6 A;  3TS0 A;  4GLV B;  1SFO H;  5FJ8 G;  1OXT A;  4LF6 L;  4JI2 L;  1BBW A;  4X64 Q;  2I0Q A;  4NXM L;  1G6P A;  1EWI A;  3ER0 A;  4IFD J;  2EQS A;  4PZ6 A;  1PH4 A;  1QZG A;  4BA2 I;  4DV7 Q;  3I4O A;  4P75 A;  1DGS A;  3CMA A;  5M5X H;  1HZC A;  1HNW L;  5EAY A;  2Z0S A;  1KD1 C;  3RN2 A;  1IBM Q;  1Q86 C;  1U0L A;  1VQ4 A;  4WJ3 M;  4YHH L;  3AEV A;  5GAD C;  1HNZ Q;  3K80 C;  2F4V Q;  2UXC Q;  3VDY A;  3S1R H;  3NEM A;  4DV6 Q;  1D8L A;  1PH3 A;  2GVB A;  3I56 A;  3BZC A;  4C3J H;  5IYD G;  4DV3 L;  1H95 A;  3H3V H;  5C0X I;  3CP0 A;  1X3E A;  5C4J H;  2NN6 G;  4A3K G;  3STB D;  3PGZ A;  3GTL H;  3GTP H;  2IHE A;  2AMC B;  2AWN A;  4LF6 Q;  2B63 G;  3T1Y Q;  1LTL A;  1YIT A;  1Z47 A;  3FKI H;  1YHQ A;  3RR5 A;  3E9H A;  4OWT B;  2MQH A;  2CWP A;  2K50 A;  4X66 Q;  4DR2 L;  1EYG A;  3KLW A;  3DM3 A;  5M3F G;  3OW2 A;  1C0A A;  3AFQ A;  2R93 H;  4BBS G;  3JC6 6;  1W3S A;  3A5U A;  1N8R C;  1PH1 A;  2N78 A;  4GNX A;  4JYA L;  4GOP C;  1N33 L;  2NZH A;  4UPA A;  2VL6 A;  4JOI C;  2V1C C;  1X9N A;  4B3S L;  1IXR A;  4YHH Q;  2JJQ A;  3LGJ A;  1VQI A;  5JJI A;  3CW2 C;  3U4V A;  5FLM G;  4HJ8 A;  2ZM6 Q;  1FJG Q;  3K8A A;  1PYB A;  1Y1W G;  4A3L H;  1UE7 A;  3L0O A;  4DV3 Q;  3PUZ A;  4A3M H;  4JI7 L;  5IYB H;  2Y0S G;  4APV A;  4A4I A;  1IBK L;  2BH2 A;  5JJL A;  3STB C;  5C0X J;  3L2P A;  1CUK A;  4YWL A;  1OTC A;  2PI2 E;  3GTK H;  1QVG A;  4WJ4 A;  3CCL A;  2Q2H A;  1PH7 A;  3ULJ A;  1UWV A;  5LMU L;  4DV1 Q;  1EFW A;  4B3M L;  3HFZ B;  1K8A C;  3CCJ A;  3K7U C;  1WI5 A;  4GN3 B;  2RHS B;  3U58 A;  4DR1 L;  1VQJ A;  1X65 A;  3GO5 A;  3RZO H;  4JYA Q;  2JK8 A;  2JEA I;  1YIJ A;  1N33 Q;  3S2D H;  4L5R C;  1N36 Q;  2HIX A;  4B3S Q;  4XTC S;  1PH5 A;  3EN2 A;  4DV0 Q;  1J5E L;  3RLN A;  4DKA C;  1Q81 C;  2OQ0 A;  5C3E H;  2UUC Q;  4LF7 Q;  4DNI A;  2R92 H;  1I3Q H;  1QUQ A;  2DUD A;  1NE3 A;  4BA1 I;  3BU2 A;  1Q7Y C;  3HOV H;  1P8L A;  3TS2 A;  3FHW A;  3G71 A;  4IOA A;  1L0W A;  4BBR H;  5GAE C;  3ULP A;  1TWG H;  2BH8 A;  5LMN W;  1VQA A;  5JEA J;  2AKW B;  2HT1 A;  2K4K A;  4JBJ A;  3CPW A;  4A76 A;  4JI3 Q;  2ASB A;  4LF8 L;  2NN6 I;  1RIP A;  1CKM A;  3OTO Q;  3AYH B;  1YBY A;  1VQM A;  1PYS B;  4LFC Q;  2KEN A;  2GN5 A;  2LXJ A;  2R93 G;  4JCV E;  4A75 A;  3ZJY C;  4GKK L;  2KHI A;  3G6E A;  4YCW A;  5M3M H;  1J6Q A;  4GN5 A;  3KF6 A;  3D0F A;  2YTV A;  1XMQ L;  1J5E Q;  1EQR A;  3NEN A;  2Q2I A;  4LUZ A;  1VQG A;  3S16 H;  3CCE A;  1QZH A;  4JG2 A;  4LFB L;  1IYJ B;  1HH2 P;  1NMF A;  3GTJ H;  3BJU A;  1YI2 A;  2D62 A;  4A3L G;  2KCT A;  1SRO A;  4LFA Q;  4L5Q A;  5C44 H;  4LF5 Q;  4A3M G;  1GD7 A;  5IYB G;  4DV2 Q;  4A3D H;  1E1O A;  4IJH A;  5C4X H;  4X64 L;  4A3G H;  3PO3 H;  4LF8 Q;  2C35 B;  4LW1 A;  4DV7 L;  2YU9 H;  1YVC A;  3A5Z B;  2E2I H;  1TXY A;  1A63 A;  2NVT H;  1M90 C;  1OXS C;  2NZO A;  1IBM L;  2VUM H;  1UE6 A;  3TRZ A;  1HR0 W;  4GKK Q;  3GTO H;  3S1M H;  1HZA A;  1K83 H;  1VQF A;  4NPS A;  3Q8D A;  1HNZ L;  2F4V L;  2UXC L;  1JJ2 A;  1G51 A;  1HZ9 A;  3W5O A;  4OO1 G;  4XIG S;  4LFB Q;  5IT9 c;  5C3E G;  1C9O A;  2R92 G;  1TWF H;  1KIX A;  3HOZ H;  3GTQ H;  3HOV G;  2OTL A;  5LMN Q;  4OXP A;  4DV4 Q;  3T1Y L;  1CKN A;  4BBR G;  1X3F A;  4OWX B;  5H1S E;  1OXV A;  2F3I A;  4X66 L;  1MIU A;  1E3P A;  1SMX A;  1ASZ A;  2KCM A;  1U5K A;  4LF4 L;  3TQY A;  3PUX A;  4JI6 Q;  1VQ6 A;  4DUY Q;  1Q12 A;  3H3V I;  1W2B A;  2K75 A;  2VNU D;  4HJ7 A;  1K0R A;  3U50 C;  2JEB I;  2VQF Q;  4HJ5 A;  1AE3 A;  4GKJ Q;  2ES2 A;  2PQA A;  1LUZ A;  4NXN L;  1JJC B;  3HKZ E;  3W1B A;  1G29 1;  3J80 c;  4OON A;  4BY7 H;  2ZM6 L;  1FJG L;  1PVO A;  2OQK A;  5M3M G;  3IRB A;  1PH2 A;  1PFS A;  4QL5 A;  3M7N A;  1QVF A;  2XTI A;  1N9W A;  2Q2U A;  1JB7 A;  1XMO Q;  1VQK A;  4UP8 A;  3KDF B;  1R9T H;  3UE1 A;  3UE0 A;  1WFQ A;  5IP7 H;  1SN8 A;  1PH6 A;  3EBE A;  5C44 G;  4DV1 L;  1TWA H;  4GOP A;  4A3D G;  4AH6 A;  3NEL A;  4LF4 Q;  5C4X G;  4JOI A;  4A3G G;  4EX5 A;  4DPG A;  3PO3 G;  2IY5 B;  1E22 A;  4X62 L;  4GLA C;  4HIM A;  1YJW A;  1VQP A;  4JBM A;  2CKZ B;  4PMW A;  1A8V A;  2K5H A;  2OTJ A;  2UXD Q;  1N36 L;  3J80 i;  1AH9 A;  3PCO B;  3M9B A;  2VUM G;  4DV0 L;  2ATW A;  2RHQ B;  4NXN Q;  2UUC L;  4LF7 L;  2WP8 J;  2I5L X;  2VW9 A;  1KL9 A;  5M5W H;  3PUW A;  3MEF A;  4HID A;  1ASY A;  1B70 B;  3ULL A;  1Q82 C;  1S72 A;  1I6H H;  1Q1E A;  5FLX c;  4Y52 H;  3CC4 A;  4JI3 L;  4OO1 I;  3HOZ G;  2A19 A;  1NTG A;  3GDE A;  3HOY H;  4B3R Q;  4JV5 Q;  2UXB L;  5AJ3 Q;  1Z9F A;  3PSI A;  3OTO L;  5IP9 H;  4UP7 A;  3CCU A;  1XPR A;  5JJK A;  3PF5 A;  1YHA A;  4LFC L;  4X62 Q;  1CSP A;  1HNX Q;  1VQD A;  1CSQ A;  1YEZ A;  2WB1 E;  4ALP A;  4OX9 Q;  3UDI A;  3KF8 B;  3TRE A;  4AYB E;  1XJV A;  2JA8 H;  2JA5 H;  4QGU A;  4KI0 A;  1X54 A;  1L2F A;  1BVS A;  2R7F A;  4HJ9 A;  1EIY B;  3M3Y H;  4IFD G;  1UE1 A;  1M1K C;  1N32 Q;  5ELO A;  3T1H L;  5E7N A;  4KLK A;  4DK3 C;  4JI8 Q;  5ELN A;  4IPG A;  4KHZ A;  4P73 A;  4DUZ L;  4BY7 G;  1VCI A;  1PHJ A;  4RG1 A;  3E0E A;  3UDG A;  1LM0 A;  4IO9 A;  4LFA L;  1VQO A;  4LF5 L;  3CME A;  1O7I A;  1Y1V H;  2WFW A;  4IJL A;  3RLO A;  4DV2 L;  3RNU A;  4DR7 L;  1FVI A;  2K52 A;  1I94 L;  1SE8 A;  2ZJQ A;  4R4T A;  2UXB Q;  2JA9 A;  1GO3 E;  1VQH A;  4B3T Q;  4YY3 L;  5IP7 G;  1IBL L;  2I5H A;  1FL0 A;  1MJE A;  2DGY A;  1V1Q A;  5HY6 A;  1AE2 A;  2CFM A;  1TWC H;  3HOU H;  2N8N A;  4LWC A;  3CC7 A;  4JI5 Q;  2ALY B;  2D0P A;  1VS0 A;  1L1O B;  4UP9 A;  1HJP A;  4RMF A;  4IOC A;  1YZ6 A;  1A62 A;  1KRS A;  3A74 A;  2QEX A;  3T1H Q;  2PNH A;  3AQQ A;  2YYZ A;  4A3I H;  3G48 A;  2VY3 A;  3CCS A;  4DUZ Q;  1PV4 A;  3RZD H;  3KJO A;  1E1T A;  5LMN L;  4DV4 L;  4POG A;  2IX1 A;  3S17 H;  4DR7 Q;  1VQ8 A;  3BZK A;  3GTG H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...