2L15A

Solution structure of cold shock protein cspa using combined nmr and cs-rosetta method
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
70
structure length
70
Chain Sequence
MSGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fully automated high-quality NMR structure determination of small (2)H-enriched proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Cold shock protein CspA
total genus 14
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2010-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2l15A00
2EQSA 1JB7A 1E1TA 4GKKL 4JI5L 5IP7H 4A3CG 2I5LX 1V1QA 1GM5A 3H15A 5DLQE 4L5RC 3S17H 2WP8J 1WI5A 1S3OA 1MJCA 1WCMG 1V43A 3I4OA 4JI8Q 4DV2L 4B3RL 4LF5Q 4A3IH 1PFSA 4FDBA 4KHPL 1X56A 2Q2UA 2BA1A 4YWLA 4ALPA 1LYLA 5IYDH 4R4IA 3PUXA 3NEMA 1HZ9A 3PUYA 5LMNW 2YU9H 3KDFA 2WB1G 4LF9Q 2E2IH 2LSSA 3I4NH 1Q46A 4DV5Q 3ULJA 4QJFA 4JI8L 4YCUA 3G71A 1X55A 1NMGA 1WJJA 2VQFQ 1VQEA 2I5MX 1XNQL 2DGYA 4BBSG 3ICEA 2MO1A 2ZTCA 2F3IA 3HKZE 4MTNA 1MKHA 4AH6A 1VQNA 1JT8A 4XIGS 4DV4L 4A3FH 4KLKA 2UUCQ 5LMUQ 2R92H 1CKNA 4A3LG 4DPGA 1YI2A 1PH7A 4JV5L 3AFPA 4EX5A 3BZKA 2JK8A 3TEHB 3U50C 2YTXA 3CCJA 1SR3A 1BKBA 3EBEA 3RR5A 1OXSC 4DV3L 5BR8Q 4IFDG 2UU9L 2YYZA 2WAQE 4JI3Q 2BH8A 4YY3L 4O2DA 1Q86C 1GD7A 2N3SA 3H3VH 1UE1A 4LNQA 4AYBG 2KHIA 1VQ6A 4R1JA 2D0OA 3DM3A 4JI2Q 3CD6A 4YWMA 1E24A 4KHZA 4A3DG 4A3MH 4IJLA 1X3GA 3HOZH 1G51A 2NVXH 3RN5A 2K5VA 3E9HA 1FJGL 4DR3Q 4JI7Q 3OYYA 5IY0A 1AE2A 1N34Q 3UDXA 1M1KC 4NXNQ 1VQPA 1OXTA 3UE0A 4B3MQ 1HZAA 4A76A 5IWAQ 1A0IA 2N78A 2E2HH 4JI6L 3J7A5 2KHJA 1S72A 1XNRL 1CKOA 2OCEA 3GO5A 2Z0SA 1LUZA 1JE5A 1PH6A 3CPFA 2JA6G 3L7ZC 2V1CC 4YY3Q 1K73C 4JI3L 2R92G 2R6GA 3S1MH 4DV3Q 2RHSB 3U4VA 2IX0A 5GQOA 3HOUH 4EQ5A 4A75A 3I7FA 3PO3G 3S2HH 4NPSA 2ZTDA 4TQUS 3CCSA 3ZJYC 2UXDQ 3WWVA 4RG1A 1UE7A 5LMUL 2GN5A 2UUCL 3RLFA 4TVAB 1SRUA 4GN5A 3J80i 4IJHA 2KBNA 2HIVA 5GAHC 1IZ6A 3PO2G 1N33L 3PSIA 2JE6I 1SROA 1N32Q 1J5EL 5M5XH 3JAMi 1PYSB 2IT1A 4PG3A 4DKAC 4JI4L 1XNQQ 2VQFL 4PZ6A 1MJEA 3GTPH 1VQHA 3K8AA 1PH4A 4GOPC 4A4IA 3PO3H 4QGUA 3HOUG 4DV5L 4JOIA 1TWAH 1DGSA 2K5NA 3KF6B 1L0WA 4C3IH 4A3IG 1XPOA 2VW9A 1XPUA 1EYGA 4PZ8A 4PZ7A 2CWAA 2WB1E 1TWGH 3M85A 3OTOQ 2IHFA 3W1BA 1X9NA 2OQKA 2R7ZH 1G291 4MNOA 4A3EG 2EXDA 2E8GA 3GTOH 2WFWA 4DUYL 1PH8A 1Q7YC 5FLMH 1HR0W 3AYHB 2UXBL 2UXBQ 4DV0L 2JA5G 3I2ZA 1GKHA 1YHBA 3KOJA 4PMWA 2VUMH 3GDEA 4YCVA 2A8VA 4HIMA 1LTLA 3NBHB 1PH2A 3CC4A 2VQEL 1YNXA 1SMXA 3HOZG 2KCTA 1HNZL 4OWWB 4LFCQ 1BBWA 1OXVA 4AYBE 4Y7NH 2HHHQ 1Q8KA 4R4QA 5ELOA 2BA0A 2KENA 3CCLA 3T1YQ 2F4VQ 5C44H 3CF5A 1D8LA 1E3PA 2NVYH 2VNUD 4UY8C 2WAQG 3CCRA 2PNHA 1OXXK 4MZ9A 2ZJPA 4DAYB 3D31A 1N32L 1TWCH 4JBWA 4GNXB 1N33Q 3UDIA 2PI2A 1Q12A 4AIMA 4POGA 2K5HA 1BBUA 2QGQA 4X64L 2MO0A 1Q1BA 4DR1L 3VDYA 3M4OH 1SN8A 2PI2E 3GTJH 1N36Q 2IX1A 3PV0A 4C2MH 1VQLA 2HQLA 1UEBA 5FLXc 3RLOA 2JQOA 3ULPA 2B63H 3DLLA 1QZGA 4LFAL 5JEAG 4JC0A 4X65L 4HJ7A 2OWOA 3L2PA 5IP9G 3UE1A 2HIXA 3HOVH 1KAWA 1U5KA 1I6HH 5IYCH 2NZHA 5C0XI 2OTLA 2MNAA 3CMEA 2B29A 3GTKH 4IOAA 5K36G 4O0AA 3J7ZC 3PIPA 5IYDG 1PV4A 3CAMA 4B3ML 4NXNL 3HOWH 1YIJA 1TWFH 1L1OA 2E5LQ 3UDFA 4WJ4A 4GKJQ 4QQBX 2ZTEA 1XPRA 5LMNL 1IBKQ 1HNWQ 1NTGA 3K7UC 1RL2A 3F2DA 4DUZQ 4DR3L 1FJGQ 2JA6H 4DR5Q 3ER0A 5H1SE 4HIKA 5IE8A 4DV1Q 4P74A 1A63A 3I56A 3CW2C 2QEXA 5M5WH 3OW2A 5GADC 3RLNA 4HJ8A 2VL6A 5C0XJ 1PH9A 3FKIH 4DAMA 1HR0Q 4LF6Q 5IYCG 4IPGA 1P16A 4P71A 4GNXC 2UU9Q 5JJLA 4DR2Q 1XMOL 2K50A 4DUZL 3CMAA 1WFQA 1YJNA 5LMNQ 1KC8C 2JA7G 3I4MG 4DR7L 1I50H 1ASZA 1IBLQ 4GOPA 4DR4L 4B3TL 4A3DH 2FXQA 4NXML 1XMQQ 3J80c 3PF4A 4LFBQ 1W2BA 2H5XA 1HNXQ 1I5FA 4L5TA 1C9OA 2PQAB 5JJKA 3I55A 1L2FA 4OO1G 1AH9A 3W5OA 3B6YA 4A3EH 5M3MH 4AQYL 3PUVA 3KFUA 1QUQB 1L1OB 2MQHA 1EUJA 2DUDA 4YHHL 2UUBL 5FJ8G 3F1ZA 4BY7H 1RIPA 5HGQA 4A3FG 1B7YB 1HZBA 4JBJA 4DNIA 4HJ9A 1E7ZA 3JC66 4QY7A 5IYBG 1T9HA 1IYJB 2E2JH 2Q2TA 3HKZG 2NN6G 3J81c 4X64Q 1JMCA 4B3SL 3HOXG 4GLXA 4LF5L 4KHPQ 1K3RA 3F2CA 3PO2H 1CSPA 1KHIA 4A3MG 1PVOA 1UE6A 1X65A 5M3FG 4A3JH 2K4KA 1EWIA 4QL5A 2VUMG 4GKKQ 1Y1WH 1EOVA 1X54A 3H0GH 3CC7A 1JJCB 1HZCA 1B70B 2AKWB 1S40A 3GTGH 4LF4L 3CQZH 1CKMA 1OXUA 4OXPA 2ZM6L 1HNZQ 3K0XA 2JA9A 2NN6I 2Z6KA 3PCOB 2EIFA 2CCZA 3PUZA 4A3GH 3EN2A 1PHJA 1VQ7A 4A3CH 3KLWA 1YZ6A 1HJPA 4A3KH 2F52A 2ES2A 4DUYQ 2B3GA 1VCIA 3JAMc 3STBD 1VQJA 1CKNB 1SFOH 2UXCQ 2RCNA 4B3SQ 1E1OA 1VQ5A 4X66Q 4OO1I 3HOVG 1Q1EA 5IP9H 3D0FA 3I4NG 1VQ9A 3S16H 1YHAA 2LXJA 4DV6L 2PQAA 3CCMA 1I94L 3MEFA 2B63G 1O7IA 3AQQA 5J3BA 3EIVA 4BA2I 4LF8Q 3TREA 3S24A 2JEAI 3PIOA 3J81i 1I3QH 1MIUA 1VS0A 1VQGA 2N8NA 4IPCA 4JI4Q 2IY5B 1PYBA 4DV7L 4BXXH 4P72A 3CC2A 1CUKA 1HNXL 2Y0SE 3K81C 3CP0A 3HFZB 3PUWA 1EFWA 4B3TQ 4LWCA 3GTQH 4DR4Q 4DR7Q 2VZAA 5C4XG 4BXXG 4JOIC 1H95A 2GVBA 2PMZE 5C44G 4GNXA 5AJ3L 3CCVA 4OWTB 4OX9Q 3S1NH 4A93H 4UP8A 4JYAL 2ATWA 3GTLH 1YVCA 1NBWA 1Q81C 3M9BA 3TQYA 5IT9c 4DR6Q 2D0PA 1QVCA 3TS0A 1FVIA 2VY3A 2XGTA 2JA7H 2ZJQA 4KI0A 2ALYB 1R9TH 1VQMA 4X62Q 4DV1L 1L1OC 4JI6Q 2R7FA 1K0RA 3M4PA 3FKIG 5IWAL 4UPAA 2R7DA 5C0XG 1JJ2A 5FLMG 4LF8L 4DR5L 3S14H 4GS3A 3RNUA 3RN2A 1N34L 1KXLA 1HNWL 4DV6Q 4P73A 2MFIA 1SLJA 4JI7L 3S2DH 3T1HL 3S1RH 2E5LL 2RHQB 3M4QA 1IBML 1YJWA 3FHWA 4GN3B 2CQOA 2QA4A 1ASYA 4APVA 1QVGA 4JI0Q 1OTCA 1KQSA 4A3GG 3PGZA 3NELA 5IP7G 1PH3A 3K7AH 2UUAL 3E0EA 4X6AH 4H02A 1UWVA 4R4TA 3CPWA 3KF6A 4NB3A 4JBMA 2OTJA 3AEVA 5BR8L 4IPHA 2JA8G 1VQBA 3CXCA 4GLVB 2YV5A 1PA6A 4JI1Q 4DK6C 4HJAA 2K75A 5M5YH 5M3FH 1VQ8A 2NVTH 2K14A 2N49A 4DR1Q 1QZHA 3KYHC 4LF7Q 4BY1G 3HOXH 1IXRA 2NZOA 4UP7A 4C3JH 5C3EG 4J15A 1K83H 1W3SA 3BZCA 5JJIA 3S1QH 1K8AC 4C3HH 4DK3C 4A93G 1WCMH 2YTYA 4YWKA 1FL0A 3CCUA 4HJ5A 4Y52H 5C4XH 2OQ0A 3UDGA 4LF7L 3U4ZA 3MXNB 2Q2HA 2K52A 4LF9L 4IOCA 2F4VL 3STBC 3E9IA 1K9MC 2ID0A 5GROA 4JI1L 1Z47A 2R93G 1V9PA 1J6QA 2ZJRA 3RZDH 2VQEQ 3G4SA 1VQOA 1BVSA 3S15H 4YHHQ 4DV2Q 1NMFA 2UUBQ 3HOYG 4UP9A 2I5HA 4OONA 4B3RQ 5HY6A 3G48A 4IPDA 4DV0Q 3KJOA 3A74A 1VQCA 4A3BH 3ERSX 4AQYQ 2AMCB 2UUAQ 2CKZB 4JI5Q 1NY4A 3BJUA 5EAYA 4OWXB 1YHQA 3TS2A 3I4MH 3W1GA 2IHEA 4JI0L 1YBYA 4LUZA 2Z6KC 3BU2A 1WYDA 3OTOL 2AWNA 4L5QA 4K0KQ 1Q82C 1XMQL 4NXMQ 3L0OA 2BH2A 5GAGC 1IBMQ 4LW1A 4LFBL 1C0AA 3FP9A 4YCWA 1A62A 3T1HQ 1Z9FA 1PH5A 1K8GA 2CFMA 1IBLL 2I0QA 2R7ZG 2Q2IA 2AHOB 3IRBA 3ULLA 1GO3E 4DR2L 1XMOQ 1D7QA 2VS1A 4ME3A 1GVPA 4LUOA 4IO9A 4A3KG 1TWHH 4LF6L 1HR0L 3AFQA 3GTMH 3TRZA 1X6OA 4BBRH 4A3LH 1J5EQ 5JEAJ 3F8TA 4X62L 1QVFA 5C4JH 3SGIA 2YTVA 1E22A 3A5UA 2KCMA 4DR6L 4HIOA 3K80C 5C3EH 4BBSH 1JJGA 3HOWG 1WOCA 1P8LA 4P75A 5AJ3Q 4OX9L 1AE3A 4JYAQ 2UXDL 3H0GG 1IBKL 1KRSA 3G6EA 1Y1WG 4GKJL 3J81j 4A3JG 1XJVA 1KIXA 3KDFB 4A3BG 3Q8DA 1EQRA 1CSQA 4DV7Q 2ASBA 2CWPA 4GOPB 1EIYB 4JCVE 1XNRQ 3HOYH 2JEBI 5IYBH 1VQDA 1IL2A 4L5SA 1YJ9A 2HT1A 1Y14B 3A5ZB 5E7NA 4X65Q 4LFAQ 2R93H 4XTCS 2LXKA 1U0LA 4BBRG 1NJIC 3H3VI 3F2BA 4RMFA 5FJ8H 1I94Q 3RZOH 4BY7G 1HH2P 2RF4A 1YITA 1VQKA 1VQAA 3NENA 4IFDI 1YEZA 1EQQA 1N36L 4GN4B 4R4OA 4POFA 3KJPA 4JBKA 1X3FA 3M7NA 1B8AA 1TXYA 3A0JA 4X66L 5M3MG 1N8RC 5ELNA 2XTIA 4JI2L 4WJ3M 3PF5A 3M3YH 2UXCL 1Y1VG 2D62A 1KRTA 1PH1A 1A8VA 1UE5A 1XTDA 2Y0SG 4BY1H 1G6PA 2L15A 1FGUA 3CCEA 1SE8A 1N9WA 3LGJA 4BA1I 1LM0A 1X3EA 2JJQA 1C7YA 3T1YL 1QUQA 1Y1VH 3GD7A 5GAEC 3CCQA 4JV5Q 1KD1C 4JG2A 4HIDA 2ZM6Q 3U58A 2HHHL 1EIFA 1NE3A 1VQIA 2AWOA 4GLAC 3HKSA 4LFCL 1M90C 2JA5H 4DV4Q 4LUVA 4LF4Q 2JA8H 2NVQH 4K0KL 3KF8B 4IFDJ 1KL9A 2A19A 4QIWE 4R4CA 1VQ4A 2GVAA 2C35B 2A1AA 1VQFA
chains in the Genus database with same CATH superfamily
2TSSA 3GTQB 4GKKL 5IP7H 1GHKA 5CC4A 2DJGC 5DNFA 4WRDA 4PNYA 1GM5A 1EWCA 4FNFA 2FJ2A 2R3ZA 4FDBA 2Q2UA 2BA1A 2O2LD 3PUXA 1STGA 2KEEA 3JAML 2E2IH 1LT6D 1Q46A 1G91A 4DV5Q 3ULJA 4YCUA 4HMJA 1WJJA 3SK6A 2XRQD 3J80E 1VQEA 2QF7A 3ICEA 1YNJD 3DWAA 3RZDB 1MKHA 2D9UA 2QDBA 4I7AA 1DZ1A 2TMPA 2ZXPA 2UUCQ 5LMUQ 2R92H 4A3LG 4DPGA 5LL6S 1O80A 1SNDA 5IGBA 4C1NK 4EX5A 3BZKA 3CCJA 3U50C 1OXSC 2IX3A 2UU9L 2YYZA 2WAQE 1Y8NB 4O2DA 1Q90A 3NUCA 4AYBG 2FMMA 4FF3A 2D0OA 3CU7A 2NVTB 4KHZA 1NNXA 3JAME 3TP8A 3D4WA 1A3TA 1G51A 3PIO3 3E9HA 1LABA 4JI7Q 5IY0A 1AE2A 5KYIA 2KCCA 4NXNQ 5IWAQ 2WACA 1A0IA 2RSOA 2K5DA 4BY7B 3EQLC 1WTHA 2JA6G 1NR4A 4RCNA 3T53B 5CMDA 3S1RB 2R6GA 1ICFB 3S1MH 4DV3Q 2RHSB 3U4VA 2IX0A 3DXJC 1ML0D 4A75A 3I7FA 3EJIA 2JYOA 4NPSA 3S14B 3ZJYC 2UXDQ 5HURA 2K33A 3RLFA 1HRJA 1TU2B 4IJHA 2IWHA 2JA7B 1NUCA 3PO2G 2JE6I 4RHSA 1H9MA 5M5XH 2HDLA 2IT1A 4PG3A 5J1ZA 1XNQQ 1BR9A 3BDCA 1NCVA 1CHPD 3K8AA 4GOPC 1PH4A 1EY9A 3PO3H 2Z8LA 1ICWA 1XWEA 4KHVA 1TWAH 1S5BD 1L0WA 5EBDA 3SR1A 3BYYB 3SHLA 1TWGB 5KIXA 3M85A 4KJOA 3GV6A 4L6TB 4PV1C 1X9NA 4MNOA 1EYDA 3SVMA 1WTXA 2WFWA 1PH8A 1E2VA 2A6HC 4B9WA 2JA5G 3I2ZA 1GKHA 2VUMH 4PMWA 3LWEA 1BBXC 3GDEA 2A8VA 4HIMA 3NBHB 4ZCKA 5KNBA 1HNZL 1BBWA 1OXVA 2F4VQ 1CQVA 2KENA 2PMZB 2OEOA 2XNAC 3CF5A 5ELCA 1SE3A 2VNUD 2MJ8A 3QWNA 2VXWA 3TSSA 2ZJPA 2LKVA 3M4OB 1GXDC 1UEAB 2K05A 1Q1BA 4L8JA 4K6DA 1SN8A 3HOWB 3GTJH 1ZXTA 3PV0A 1B3QA 1UEBA 3RLOA 3H94A 1STYA 4IALA 1IL8A 5FLXE 3L2PA 5IP9G 3UE1A 2HIXA 3HOVH 3K6OA 1PFNA 4F87A 5IYCH 3GTKH 3J7ZC 5ISRA 4FF2A 3E0JA 1YIJA 2E5LQ 4WJ4A 2M00A 4QQBX 2F03A 4OIKA 2HCIA 2RA4A 2E2DC 4DR3L 1FJGQ 1TWCB 5KEEA 5H1SE 4P74A 1A63A 3CW2C 3KK7A 5M5WH 3OW2A 3N6RA 5C0XJ 3OW7A 3FKIH 4DAMA 4LF6Q 4IPGA 1LTID 4P71A 2UU9Q 1MSGA 1FNUA 2JA7G 1WFQA 1KC8C 1ASZA 1IBLQ 2Z1CA 4G7HC 2YU9B 4L5TA 3DM1A 1MD2D 3W5OA 1EZ6A 4A3IB 1JICA 2CVRA 3KFUA 1QUQB 2MQHA 4CBVA 2DUDA 4KMUC 3TZDA 2B2VC 4RGMA 1RIPA 4TRDA 1HZBA 1PZJD 4DNIA 1E7ZA 3JC66 3MAQA 1GUSA 1IYJB 4C3HG 2NN6G 2QILA 1JMCA 1UAPA 1Y1VB 4KHPQ 4V0BA 3PO2H 1KHIA 4HAEA 4A3MG 1PVOA 2G9DA 1A3UA 5M3FG 4A3JH 2K4KA 4WORA 2MP1A 4GKKQ 4O42A 2NBFA 4DXGA 1WVLA 4CKBA 2WINB 5EGTA 2F0QA 1HNZQ 2NN6I 2Z6KA 5HGTA 2OXPA 4A3GH 4C3IG 1VQ7A 4A3CH 1YZ6A 1HJPA 2EPBA 3STBD 1VQJA 1SFOH 4B3SQ 2A69C 1VQ5A 4X66Q 1CK1A 4IUNA 3D0FA 1VQ9A 5D14A 2PQAA 1B53A 3MEFA 2B63G 3BS1A 4IUPA 3PIOA 1NAPA 5KNCA 1VS0A 1TS4A 1BDOA 1Z7TA 4DV7L 4P72A 4J1MA 1MI2A 5CV8A 3IAYA 2V4DA 2Y0SE 3D6CA 4B3TQ 1G2TA 4OGQC 4DR4Q 4DAYA 4DR7Q 1I4PA 2PMZE 4JYAL 4OWTB 3GTPB 3GTLH 4HMIA 1BCPC 1IHZA 5IT9c 4XQJA 5T1GA 2PYKA 5A2QE 4RKLA 4KI0A 2ALYB 4XYQA 3I4NB 3AB9A 3M4PA 1FR3A 1KDBA 5KGUA 5IIFA 5L37A 5FLMG 4CKEA 4OIJA 1KXLA 1SLJA 3D8GA 2NTSA 4EQNA 4DF7A 3I70A 2CQOA 1QVGA 4JI0Q 1OTCA 4FF4A 4A3GG 3QOLA 4KY7A 1DOMA 1PH3A 3QR8A 5JVH3 4JPBW 4R4TA 2NVQB 3K5MA 4N9PA 4GLVB 4HJAA 4DXFA 2K75A 1VQ8A 5BN3A 3OWFA 3HOXH 1B4OA 5C3EG 1W3SA 4C3HH 3OPOA 2A68C 1XYIA 4KN7C 4K8JA 3R8BA 4IOCA 1S5ED 2ICEC 1SNMA 3E9IA 4JI1L 1Z47A 5IGFA 1V9PA 1J6QA 3NSWA 1BVSA 3C46A 1U4RA 2I5HA 2M2LA 5D3IB 1A6XA 1DM0B 3ERSX 1VMPA 1YHQA 3TS2A 2M9VA 4ID6A 4LFBL 5EPJA 1IBMQ 4LW1A 4BBSB 2I0QA 4YCWA 1PH5A 1WTPA 3ULLA 2KHSA 2VS1A 1GVPA 4ZAIA 1RTNA 1X6OA 1EYAA 2K28A 3GTMB 1J5EQ 4X62L 3MXNA 4P75A 3H0GG 4FVMA 3HP3A 1IBKL 1RD9D 1DXMA 1SEBD 3NXWA 1XJVA 4H13C 1LV9A 3X3NA 4A3BG 3Q8DA 1EQRA 4XYOA 1HPCA 2CWPA 3HOYH 3O13A 1VQDA 1IL2A 1YJ9A 1K8MA 3LNNA 2HDMA 2R93H 3F2BA 4CDFC 1YITA 1CT1D 5LL6X 1EQQA 4JBKA 3VR2A 2BCOA 3A0JA 1BQQT 1N8RC 2XTIA 4WJ3M 1BCPB 3K5LA 3M3YH 2D62A 1PH1A 1NSNS 1B9NA 4BY1H 1PZID 3LGJA 4BA1I 4M1UB 2X6GA 2F0WA 1Y1VH 4JV5Q 4O1NA 1JCKB 3VR3A 2ZM6Q 4DNTB 1VQIA 1M90C 2AWOA 2JA5H 2F0SA 4DV4Q 3F2UA 3KF8B 4KJNA 4QIWE 3J7YW 2A69D 3E6ZX 1JB7A 4NP5A 4JI5L 4BBRB 4JI8Q 1EL0A 4LF5Q 4A3IH 1EY8A 4DK0A 3I73A 1LYLA 4RHRA 1D1IA 4KD3A 2D2CC 3NEMA 1HZ9A 3PUYA 2PNRC 2YU9H 4H0LC 4S3SA 1B50A 5C0XH 2LSSA 2WV6D 3PMFA 1STAA 4ZYSA 1ZYRC 3NE5B 4QJFA 2QW7A 1X55A 1SYEA 1I4HA 2I5MX 2AQ3B 1MBYA 2MO1A 2IPKD 2ZTCA 5CGKA 3HKZE 3NWTA 3GV3A 4XT1B 5I6WA 4PMBA 4XIGS 4A3FH 1CA6A 1X3PA 1YI2A 2JK8A 3KBXA 3OIPA 1XX8A 2YTXA 1RJTA 1SR3A 3RR5A 4IFDG 5BR8Q 3GQBA 1Q86C 1GD7A 1K83B 3H3VH 4KKUA 2RQXA 3AMUA 2KHIA 5EPLA 3J81L 3H0GB 1CQFA 1A15A 4YWMA 1E24A 1DOKA 1I6VC 5C5MA 4A3DG 4A3MH 1KNEA 1K3BC 1X3GA 2PQEA 3HOZH 3HOVB 2NVXH 4MTKA 3FPUB 1HCZA 2R61A 4R9WA 3UDXA 5J39A 1E2WA 4B3MQ 1HZAA 4A76A 1D5ZC 3WOEA 2E2HH 5EJWA 1WTQA 1BUVT 4CJ2C 1S72A 1XNRL 3J7A5 2OCEA 4K14A 1LUZA 1CFMA 1PH6A 3CPFA 3L7ZC 5ELFA 1GJXA 3CQZB 1K73C 4N8FA 2R92G 3PO3G 1HQRD 2LFNA 1WTOA 2ZTDA 3AU7A 4TQUS 4AYBB 3WWVA 1L0XB 4JK1C 4TVAB 2XSCA 2C9OA 1SRUA 3J80i 4CGYB 1BF4A 5FO9B 1IZ6A 1N33L 1E2ZA 4IUUA 2L9HA 1PYSB 4JI4L 3I3CA 1LTBD 4DKAC 1QCBD 4A93B 2EE1A 4Q5VA 4QGUA 3E3XA 2EYFA 4DV5L 1CTMA 4JOIA 3KF6B 1DGSA 1XPOA 1XPUA 1SYFA 2CWAA 1TWGH 3T16A 2Q8TA 1G291 1Q8IA 1TWFB 1F77A 2EJMA 1HR0W 2UXBQ 3NHHA 2UXBL 3AYHB 2GA4B 4A3DB 5M5XB 1LTLA 5ELDA 3CC4A 1F9SA 1YNXA 2HCCA 4IZ8A 5F2DA 3HOZG 1EZ8A 2EY6A 1ET9A 4AYBE 5LHY1 1B3AA 4Y7NH 1KLGD 2NN6H 1Q8KA 2BA0A 4ME5A 5A2QL 1F2YA 1LO5D 2JN4A 1OO9B 1F2MA 4DAYB 3QOJA 2O5JC 5AFWA 3N52A 3GP7A 1Q12A 1S5DD 3QIAA 4AIMA 1BBUA 2QGQA 1MSHA 2DJFC 4X64L 3VDYA 4DR1L 2K1BA 1R4QB 2IX1A 4JW0A 2EYHA 4UDUC 1Y1WB 1JWMD 4ULLA 3DLLA 1PTOH 3J81E 4LFAL 4Y7NB 4JC0A 1I6HH 1AN8A 3I4LA 3T4AC 3BVMA 1NR2A 2B29A 2K03A 3I90A 1SNPA 3PIPA 2J7ZA 3CAMA 4B3ML 5KNDA 1EIHA 1TWFH 4XQNA 4ZQ3A 5CR3A 3T51B 1V1OA 2CH4W 1XPRA 5LMNL 1NTGA 3K7UC 1RL2A 4G57A 4DUZQ 3TBIB 1WTWA 3I72A 5M3MB 5IE8A 5CV7A 1Q3LA 2EXZA 5CBEE 2ZT9C 1CM9A 2KA7A 3HKZB 4QF4A 3SDZA 2PZWA 2ZXOA 4OHJA 1B9MA 1K8OA 2PZTA 1HR0Q 5IYCG 1P16A 1I50B 4GNXC 3J7AF 5JOBA 2K50A 3I4MG 5LMNQ 4GOPA 4DR4L 4A3DH 3ND9A 1SBBB 4NXML 3BVZA 3J80c 1W2BA 2H5XA 2WAQB 1SXTA 1D5MC 3I55A 1B44D 4OO1G 2EYMA 5ELEA 1S5FD 4A3EH 5KYLA 2E76C 3PUVA 4IFDH 1QG7A 2IJ0A 1B2TA 1RF2D 5FJ8G 5HGQA 1ILQA 4A3FG 1B7YB 3DHQA 3W2DA 3NK9A 4QY7A 5IYBG 2E2JH 1MGSA 1TR5A 4PMCA 4X64Q 1TT2A 2BDNA 4LK1C 3RMHA 4GLXA 2EYPA 3HG9A 3KF8A 1UE6A 2VUMG 1EOVA 1DJRD 3H0GH 4FYDA 1I4XA 2E74C 4LMQD 1S40A 3SE0A 3FVQA 1CHQD 3CQZH 4OXPA 5FO7B 3K0XA 2HUGA 3PCOB 4OEMB 1ESRA 4R8NA 2CCZA 3SK4A 3V05A 1PHJA 1BXTA 1EWHA 3CRKC 2J0TD 2E2HB 4A3KH 4DUYQ 5E3FA 2Q8IB 2RDGA 4I7ZC 2RCNA 1E1OA 2B2UA 2NVXB 1Q1EA 4KN4C 1JWSD 4A3MB 1LTRD 3CCMA 2XWBB 4G7ZC 1CZGA 4CDEC 2CW0C 3AQQA 5E4WC 5I4DA 4BA2I 1PTOC 4LF8Q 2JEAI 3J81i 1O7LA 2N8NA 4JI4Q 5C3EB 2R7ZB 1QB5D 3CC2A 3HZXA 1CUKA 1EU4A 1KAAA 3G6JB 3D6WA 2Z9HA 3HFZB 3K81C 4C3IB 4A3FB 1EFWA 4LWCA 2KJXA 2VZAA 5C4XG 4BXXG 4JOIC 3A54A 3S1NH 1JORA 4UP8A 1PFMA 1YVCA 3X3MA 1EY0A 1TS2A 1QNUA 2ENBA 3M9BA 3TQYA 1QVCA 3TS0A 4ODGA 1A2UA 1R9TH 4X62Q 2R7FA 1K0RA 1SMYC 1U4LA 2R7DA 4LF8L 4K5WA 3S2HB 3HOUB 1HNWL 3ERQA 4P73A 3S15B 3HEJA 2E5LL 1IBML 5IODA 3IFTA 2QA4A 4APVA 3PGZA 2F0JA 2R93B 2NB0A 1UWVA 2K7VA 2RCFA 4NB3A 2JA5B 4XQQA 2OTJA 1IW7C 3VYRA 2XN9C 2JA8G 3AEVA 3IL8A 3PQIA 2A74C 3NWSA 2YV5A 1CI3M 3BVGA 4JI1Q 5M3FB 1VMCA 2NYZD 2N49A 1QZHA 1LTSD 2KEDA 1V1PA 3KYHC 1IXRA 4UP7A 5IGCA 1EQTA 5JJIA 3NTHA 3H3VC 4UHVA 3MFYA 1X3QA 4KKTA 2MPMA 4HEDA 4RA8A 2ID0A 4FXDA 3Q23A 4YHHQ 1YNNC 1NMFA 2FINB 3DWQA 3G48A 4DV0Q 3A74A 1NY4A 2H1EA 1TQOA 2MUYA 4OWXB 5I2XA 3P1HA 3W1GA 1YBYA 4LUZA 2Z6KC 3OTOL 1C0AA 1A62A 3T1HQ 1GHJA 1U4PA 4K8IA 2AHOB 4OELB 5I6YA 1GO3E 4ME3A 1SNOA 1HR0L 3AFQA 4MN3A 3GTMH 1QVFA 3F8TA 1ZEQX 2YTVA 5EBCA 2JA8B 4HIOA 3BYTB 1JJGA 4BBSH 3HOWG 1P8LA 2Y0SB 5AJ3Q 4PQXA 4OX9L 2UXDL 1KRSA 1SAPA 3G6EA 5K36H 4GKJL 3J81j 4A3JG 2A6HD 5EPKA 3ZYYX 3S16B 1RHPA 1FNWA 3TZUA 4RCOA 1VF5C 3A8JE 1PLFA 2P5ZX 3K5NA 4JCVE 2G5DA 1JR0D 3C3LA 5EQ0A 1Y14B 3A5ZB 4JVZA 4KD4A 4Z9CB 1SSOA 5E7NA 2L5TA 4LFAQ 1I94Q 5J22A 3VR5A 2A6ED 3H91A 5JPNC 4IFDI 5DM63 1TXYA 4C3HB 3FRPB 5ELNA 2AQ2B 3HOXB 1KRTA 1F9PA 4C3JG 1UE5A 1G6PA 2B8FA 2PO4A 4DFAA 1X3EA 2JJQA 1QUQA 3C1EA 4JG2A 4HIDA 3U58A 1GUWA 2I46A 1EIFA 1NE3A 2JA8H 2NVQH 3SK8A 2A19A 2B2YA 1H9SA 2OT2A 3VYUA 2I5LX 1V1QA 4DN4M 2EY2A 5DLQE 4L5RC 3R2TA 1MHWC 2WP8J 1S3OA 1MJCA 3RD4A 1PRTF 4DV2L 4B3RL 4KHPL 1PFSA 2IL8A 2ZXRA 1G2SA 1S5CD 4YWLA 5A35A 2JXMB 4NDXA 5IT9E 4KK7A 5CYUA 3KDFA 4LF9Q 1DCZA 3I4NH 2DY8A 3L9AX 3VA5A 1C8CA 5CV6A 4RH6A 3NBIA 2VQFQ 2DGYA 4BBSG 2F3IA 4DAPA 1TY2A 4X3SA 4AH6A 1JT8A 4MHEA 1FGBD 2RVLA 3DMUA 1PH7A 1YNJC 1BKBA 3EBEA 1BO0A 5IOCA 1RKNA 4JI3Q 1H9KA 2F0DA 1VQ6A 4R1JA 1RODA 4L63B 3D4RA 4A3JB 3WOFA 2QKIC 4IJLA 1EFID 3RN5A 3R93A 2K5VA 4DGZA 1FJGL 4DR3Q 1II3A 3TMEA 2B63B 1VQPA 1OXTA 3UE0A 3MC0B 2N78A 3OIQA 5IGEA 4IN3A 2KHJA 1CKOA 1M8AA 4A3GB 2Z0SA 2F0TA 4ZLTF 1JE5A 1HFGA 1T5XD 2SNMA 2V1CC 4YY3Q 2BE5D 1CZWA 1LLRD 5GQOA 2KOLA 3HOUH 4EQ5A 4DK1A 3S2HH 1T5EA 5BN5A 5FKAC 5C44B 4RG1A 1UE7A 2L1BA 2BE5C 4GN5A 3VR4A 1LTAD 5GAHC 1HA6A 1I4GA 1PRTB 1SROA 3JAMi 3WDNA 4F88A 1EEFD 4PZ6A 1FNVA 3S1NB 3BG3A 4RGTA 2G9HD 4A4IA 2K6AA 3EFXD 4C3IH 3HGBA 3OTOQ 1PRTD 1SDFA 3W3AA 4BS9A 2OQKA 4WFN3 2R7ZH 3C2PA 1HTLD 2E8GA 5G3LF 3H09A 2AUJD 1Q7YC 1EEID 4DV0L 1YHBA 3P20A 1S4ZA 2NTTA 4YCVA 3GTKB 1PH2A 2VQEL 4GZYC 1SMXA 1SYDA 3V2TA 4CJ1B 4OWWB 1ONLA 3MA2B 4R4QA 5ELOA 3CCLA 2AUKA 5M5WB 1D8LA 1E3PA 4UY8C 2WAQG 4A3KB 2PNHA 3GTJB 1OXXK 1D1KA 1ENCA 1TWCH 4GNXB 2SOBA 1LT5D 3UDIA 2LMCB 4POGA 1UUPA 2O4XA 1HFNA 1DYQA 3M4OH 2PI2E 3A8KE 2F0PA 2RDHA 1VQLA 2HQLA 3A7LA 2EYOA 4NMZA 2PCFB 5ELBA 3MXUA 4X65L 2OWOA 1KAWA 1U5KA 2OF1A 2NZHA 5C0XI 2OTLA 5K36G 4IOAA 3OSOA 3QB3A 3D4DA 4O0AA 2VUMB 1PTOD 1KNAA 3BDLA 4HCSA 5IYDG 3ND8A 1PV4A 4NXNL 3HOWH 3UDFA 1IBKQ 1HNWQ 3F2DA 4DNRB 4DR5Q 1D6EC 5JPMC 3ER0A 1EIGA 4A3EB 4HIKA 4NW2A 1F9RA 3PO3B 3NQTA 3I56A 2QEXA 5GADC 2EOTA 4J8QA 2B2TA 4DR2Q 1XMOL 3CMAA 2XVSA 2VB2X 1I50H 2QDLA 4LFBQ 3PF4A 4CDDC 2EDGA 4HSVA 1I5FA 5C5LA 3VYTA 3TN2A 2PQAB 5JJKA 1L2FA 5M9OA 2PW7A 2K04A 3P75A 3S1MB 2EYLA 4WJWA 5M3MH 1ENFA 3DEPA 3V96A 3PIP3 1O7ZA 2UUBL 3LWUA 4BY7H 2L0CA 1U4MA 2F3WA 2JSOA 2RSNA 4BWGB 1IKMA 1B1ZA 2KCNA 4IURA 5C6AA 1GUNA 3F2CA 1I6HB 4IUTA 1EWIA 1PTOB 1Y1WH 3QG1A 1RTOA 1L0YB 3CC7A 2AKWB 1EOTA 3KUPA 3GTGH 1AEXA 1HTPA 1EY6A 1C48A 2EIFA 3KLSX 1HHVA 4LJZC 3LX0A 3KLWA 1STBA 2ES2A 4RKBA 1VCIA 3JAMc 1HA5A 3MHBA 3OOCA 2BOSA 3CRLC 5COYA 1YNND 1YHAA 2LXJA 2E2IB 1I94L 4U68A 1O7IA 5J3BA 3EIVA 1MIUA 3D3RA 1VQGA 4IPCA 1Y8PB 2KECA 2IY5B 3KLRA 5CORA 5D65A 1WD0A 1HNXL 1RDPD 1X32A 2B2WA 3A8IE 2R92B 4CKCA 3CP0A 3HRZC 3GTQH 1TWHB 2WIIB 1SNCA 5DM73 2F4IA 1H95A 2K5WA 3KLSA 4GNXA 5AJ3L 3CCVA 4OX9Q 5C3XA 4A93H 1NBWA 2D0PA 1SNQA 1FVIA 2VY3A 1Y8OB 2N55A 3I4MB 3CHBD 2ZJQA 1VQMA 4DV1L 1L1OC 4IQZA 3J80L 5IWAL 5C0XG 1PXUA 1JC7A 3RN2A 4C56C 1PMRA 1ENAA 1R4PB 1AP0A 4XT3B 2QEJC 1HQMC 4JI7L 2X6LA 3S2DH 3T1HL 3M4QA 1YJWA 4QUFA 1ASYA 1ILPA 3NELA 1PTOF 3EVQA 3K7AH 3E0EA 4X6AH 4H02A 3CPWA 3G7LA 5IGGA 4IPHA 2RBMA 1AZQA 2KVMA 3I8ZA 3HOZB 5M5YB 4MIUA 5M5YH 3UI2A 4DR1Q 2NUCA 4BY1G 3CCEA 4EVOA 4FP5D 4C3JH 4J15A 1K83H 3BZCA 1KABA 1EU3A 3S1QH 3KBGA 3QJYA 4YWKA 4HJ5A 3K7AB 4LF7L 3U4ZA 3MXNB 4HTHA 4LF9L 3NPPA 4QB4A 4N8X1 1K9MC 1JQYD 2L12A 2R93G 3TDQA 3S2DB 3G4SA 2DNEA 4DV2Q 2UUBQ 3E5SA 4B3RQ 4OONA 5HY6A 4IPDA 1VQCA 2AMCB 2UUAQ 2CKZB 4M8AA 3BJUA 2MGSA 2EJFC 2B39A 3I4MH 2IHEA 3FDTA 5K5PA 4A3BB 2AWNA 4L5QA 1Q82C 3L0OA 5GAGC 3K59A 3FP9A 1K8GA 1IYUA 2MHVA 1IBLL 1AFPA 2CFMA 2R7ZG 2Q2IA 3U9SA 3IRBA 1SYCA 4DR2L 1XMOQ 4LUOA 1GUGA 1TWHH 4LF6L 3J7AV 1STHA 4BBRH 4A3LH 2B2UC 5JEAJ 2F0KA 5C4JH 5C4XB 5IGDA 4C1NI 5D3DA 1K28A 1WCMB 4FF1A 4DR6L 4CHTB 4DU9A 1WD1A 4DAVA 1DONA 2F1MA 1SE2A 3R3OA 3TP6A 1Y1WG 1XTCD 2WB1B 4K2LA 5I9OA 4BY1B 2NWGA 3FMCA 2EY1A 3S9WA 1CSQA 3M3YB 1BCPF 3OMCA 1JE4A 4QMGA 1EIYB 1XNRQ 2JEBI 1SYBA 4L5SA 4QUCA 5E1FA 4X65Q 4XTCS 2LXKA 5FK9C 1NJIC 4RMFA 4BY7G 3NQIA 1HH2P 1VQKA 1VQAA 1UNSA 1YEZA 4R4OA 1X3FA 5M3MG 3HOYB 5EKIA 1STNA 2F0IA 3GTGB 4JI2L 2UXCL 4Q0FA 1Y1VG 1BNZA 1GUOA 1XTDA 3NP8A 3SK5A 1FGUA 4EGVA 1SE8A 1N9WA 1VF7A 2N88A 4X3TA 3GD7A 2L11A 5GAEC 1KD1C 2I07B 2DY7A 2H4OA 3HKSA 4LF4Q 4LUVA 4K0KL 1KL9A 2GVAA 2C35B 1U9RA 5C3WA 2EQSA 1E1TA 4A3CG 4DA2A 3MFGA 3H15A 5EKLA 3S17H 2DN8A 3URYA 1WI5A 1WCMG 1V43A 3I4OA 2F0UA 4ZKBB 1X56A 1D2BA 4ALPA 2B2WC 3DWPA 5IYDH 4R4IA 4H44C 5LMNW 1QNKA 2WB1G 4I65A 3K58A 1V1PB 4JI8L 3G71A 1BOSA 1NMGA 1CA5A 3VA7A 1XNQL 2F0HA 3MWYW 4MTNA 1EY4A 1VQNA 4DV4L 1JOKA 4KLKA 3IFDA 1CKNA 4JV5L 3AFPA 1QJOA 3TEHB 3ITPA 4HR7B 1TY0A 4DV3L 3H6MA 2BH8A 4YY3L 1I3QB 2N3SA 1UE1A 4LNQA 1I4RA 1O7YA 4P2CB 3U9OA 3DM3A 3MXPA 4JI2Q 4X3KA 3CD6A 1F2LA 3C1FA 4TKOB 4ZUJA 4CDCC 1PRTC 2B8GA 4FXKC 2CH4A 4EQPA 3OYYA 4ZKCB 5I2YA 1EY7A 1N34Q 2O5IC 1M1KC 4ABNA 3OMGA 4JI6L 4NKLA 2PZUA 3GO5A 2CW0D 5EKKA 4LAAA 2PW5A 4JI3L 1IYVA 3HS0C 2A73B 3CCSA 2HQEA 2EZVA 5LMUL 2UUCL 2GN5A 2RDFA 3IKJA 1A2TA 1H9RA 1J9OA 2KBNA 5CV5A 2HIVA 1TS3A 3PSIA 1N32Q 1J5EL 2B2YC 5JEAH 3GTLB 2F0OA 2VQFL 3GTPH 1MJEA 1DOLA 1VQHA 3HOUG 1A3VA 2K5NA 2A68D 4A3IG 2VW9A 1EYGA 4PZ8A 4PZ7A 2WB1E 1HUNA 1FD7D 4E6IA 2IHFA 2WKDA 3W1BA 4KTAA 4A3EG 2HD3A 1KDCA 3MZ5A 2EXDA 4K5VA 3GTOH 1HXYD 2A6EC 4DUYL 5FLMH 3NTKA 3Q0AA 4FXGC 3KOJA 4B9XA 1SJHD 1ET6A 2KCTA 4B08A 4LFCQ 1SMYD 2XIWA 2HHHQ 1LT4D 1G6ZA 1SFOB 3T1YQ 5C44H 2IW3A 2NVYH 3A55A 4RAUC 4K6LA 1QWYA 3CCRA 4RGOS 2EY5A 4MZ9A 3D31A 1N32L 4JBWA 5G3LD 1N33Q 2JA6B 4K5XA 2PI2A 4XXEA 2K5HA 1ZYRD 2MO0A 3NTIA 2B2TC 1N36Q 1TKWB 5FLXL 4C2MH 4IUQA 5FLXc 2JQOA 1EY5A 3ULPA 2B63H 1QZGA 5JEAG 4HJ7A 2LS01 3PO2B 3EA6A 3BZDB 4RGNA 2MNAA 3CMEA 3MEHA 1FYCA 5CV4A 4C2MB 3NBHA 2F0EA 1JOOA 1L1OA 4GKJQ 1W6KA 2ZTEA 3A56A 1LACA 2FMCA 3SEBA 2B2VA 2JA6H 2E75C 4G4KA 1SYGA 4DV1Q 1TVXA 3K57A 2NVYB 3Q6SA 3RLNA 4HJ8A 2VL6A 3VYSA 3CKIB 1PH9A 3K0YA 1Z6HA 5JJLA 3MXGA 1WTRA 4DUZL 4K2KA 1YJNA 1D5XC 4DR7L 2L4NA 1VDZA 4QIWB 4YIJA 4B3TL 3FKIB 5T1IA 2FXQA 1XMQQ 2F3VA 1HNXQ 3GTOB 1C9OA 3Q24A 1AH9A 2EYJA 4CJ0B 3B6YA 2K5QA 4AQYL 1PZKD 4ILWA 1QE6A 1L1OB 4UAIA 1EUJA 3L3OC 4YHHL 3SXHA 3QO2A 3F1ZA 5TSSA 4JBJA 4HJ9A 1T9HA 2Q2TA 3HKZG 3J81c 4B3SL 5KRUA 3HOXG 4LF5L 2BDOA 1K3RA 4KY5A 1CSPA 2Q8RE 1X65A 2XRSD 2SNSA 4QL5A 2WKCA 1X54A 1JJCB 1HZCA 1B70B 4LF4L 4N9TA 2PPBC 1CKMA 1OXUA 5I9PA 2ZM6L 2JA9A 2F0GA 4FO2A 5BN4A 2X69A 1C4QA 3PUZA 3EN2A 2SEBD 1STEA 2F52A 2B3GA 4F7XA 2K32A 1CKNB 2UXCQ 1TIID 1GUTA 3K5OA 3TP7A 4OO1I 3HOVG 1EQVA 5IP9H 3I4NG 3S16H 2D5DA 1LTTD 4DV6L 1K0SA 2L55A 1W6JA 1F9QA 3TREA 3S24A 3FEWX 1I3QH 5C4HA 5FO8B 3FPPA 4KKSA 1PYBA 2F0MA 2KQ3A 4BXXH 2NZ1D 1F2ZA 2Z4HA 1TWAB 3PUWA 1V8QA 4HN7A 5NUCA 3TP5A 2GVBA 5C44G 2ATWA 4ZUIA 4RWSC 4G7OC 1XXGA 5IT9L 1Q81C 2AQ1B 4DR6Q 2XGTA 2JA7H 2JP1A 3RUZA 2KUMA 4HSPA 2CQAA 4JI6Q 1SJED 3FKIG 4UPAA 1JJ2A 1SE4A 3BDOA 4DR5L 4GS3A 3S14H 3RNUA 1N34L 1KDAA 4DV6Q 2Z6BA 2MFIA 3S1RH 2RHQB 3S17B 3FHWA 4GN3B 1H9SB 4ZRZA 1KQSA 5IP7G 2UUAL 4TSSA 1ESFA 3KF6A 5CBAE 4JBMA 5BR8L 3P7JA 1VQBA 3CXCA 1AW7A 1PA6A 5E4XA 4DK6C 2C5CA 5M3FH 2NVTH 1PFBA 2K14A 1H9JA 4LF7Q 2NZOA 2XWJB 1K8AC 4DK3C 2DNCA 4A93G 1LT3D 1WCMH 2RKSA 3MVVA 2YTYA 1FL0A 5C4ZA 3CCUA 4Y52H 5C4XH 2OQ0A 3UDGA 2Q2HA 2K52A 2F0LA 1JB3A 2F4VL 2EVBA 3STBC 1LTGD 1Y69U 1JOQA 2CHBD 2J4XA 5GROA 3MTSA 3DUZA 3OHXC 2ZJRA 1J8IA 3RZDH 1DD2A 2K01A 2VQEQ 1VQOA 1KTKA 3S15H 4OO1H 3HOYG 1JWUD 4UP9A 5DAUA 1O78A 3OWEB 3KJOA 2FHTA 4A3BH 4AQYQ 4JI5Q 4OL7A 2LY7A 1R9TB 4X3UA 5EAYA 4EQOA 4JI0L 3BU2A 1ZKOA 1WYDA 4K0KQ 5JAVA 1XMQL 4NXMQ 2BH2A 1TS5A 1Z9FA 3T56B 1E0BA 4HCEA 3EROA 1HUMA 3M4YA 1D7QA 5C4JB 1AZPA 4IO9A 2QCPX 4A3KG 1IW7D 1EYCA 3TRZA 2F0FA 4XDXA 5JVG3 1PDQA 2A5HA 3SGIA 2SDFA 1E22A 3A5UA 2KCMA 1M4VA 1QOHA 3K80C 5C3EH 1WOCA 4C3JB 2ICIA 4JYAQ 1AE3A 3I91A 4KV6A 1WTVA 1I4QA 1KLUD 4KY6A 3Q22A 4H7BA 4J6HA 3KDFB 1KIXA 2FFKB 1PYWD 4DV7Q 5JJZA 2ASBA 3DEOA 4GOPB 5IYBH 2HT1A 4U673 3T13A 3H3VI 4BBRG 1U0LA 3A7AB 3RZOH 5FJ8H 3RZOB 1BCPD 2RF4A 3M7GA 3NENA 3R2IA 4R8IA 1N36L 4GN4B 4POFA 4ZK9B 3KJPA 3M7NA 1B8AA 4X66L 2F0NA 3S1QB 4V190 2Z4IA 3PF5A 1GOZA 1RCVD 5DEHA 1A8VA 1G8ZD 2Y0SG 5CV9A 2VB3X 2L15A 3ONAB 1IKLA 2F0VA 1LM0A 2EJGC 1C7YA 1QILA 3T1YL 4QCLA 3CCQA 2HHHL 5FOBB 4RFBA 4GLAC 4IUVA 4LFCL 2E2JB 4F8MA 4IFDJ 3VR6A 4R4CA 1VQ4A 2A1AA 1VQFA
chains in the Genus database with same CATH topology
2EQSA 1JB7A 1E1TA 4GKKL 4JI5L 5IP7H 4A3CG 2I5LX 1V1QA 1GM5A 3H15A 5DLQE 4L5RC 3S17H 2WP8J 1WI5A 1S3OA 1MJCA 1WCMG 1V43A 3I4OA 4JI8Q 4DV2L 4B3RL 4LF5Q 4A3IH 1PFSA 4FDBA 4KHPL 1X56A 2Q2UA 2BA1A 4YWLA 4ALPA 1LYLA 5IYDH 4R4IA 3PUXA 3NEMA 1HZ9A 3PUYA 5LMNW 2YU9H 3KDFA 2WB1G 4LF9Q 2E2IH 2LSSA 3I4NH 1Q46A 4DV5Q 3ULJA 4QJFA 4JI8L 4YCUA 3G71A 1X55A 1NMGA 1WJJA 2VQFQ 1VQEA 2I5MX 1XNQL 2DGYA 4BBSG 3ICEA 2MO1A 2ZTCA 2F3IA 3HKZE 4MTNA 1MKHA 4AH6A 1VQNA 1JT8A 4XIGS 4DV4L 4A3FH 4KLKA 2UUCQ 5LMUQ 2R92H 1CKNA 4A3LG 4DPGA 1YI2A 1PH7A 4JV5L 3AFPA 4EX5A 3BZKA 2JK8A 3TEHB 3U50C 2YTXA 3CCJA 1SR3A 1BKBA 3EBEA 3RR5A 1OXSC 4DV3L 5BR8Q 4IFDG 2UU9L 2YYZA 2WAQE 4JI3Q 2BH8A 4YY3L 4O2DA 1Q86C 1GD7A 2N3SA 3H3VH 1UE1A 4LNQA 4AYBG 2KHIA 1VQ6A 4R1JA 2D0OA 3DM3A 4JI2Q 3CD6A 4YWMA 1E24A 4KHZA 4A3DG 4A3MH 4IJLA 1X3GA 3HOZH 1G51A 2NVXH 3RN5A 2K5VA 3E9HA 1FJGL 4DR3Q 4JI7Q 3OYYA 5IY0A 1AE2A 1N34Q 3UDXA 1M1KC 4NXNQ 1VQPA 1OXTA 3UE0A 4B3MQ 1HZAA 4A76A 5IWAQ 1A0IA 2N78A 2E2HH 4JI6L 3J7A5 2KHJA 1S72A 1XNRL 1CKOA 2OCEA 3GO5A 2Z0SA 1LUZA 1JE5A 1PH6A 3CPFA 2JA6G 3L7ZC 2V1CC 4YY3Q 1K73C 4JI3L 2R92G 2R6GA 3S1MH 4DV3Q 2RHSB 3U4VA 2IX0A 5GQOA 3HOUH 4EQ5A 4A75A 3I7FA 3PO3G 3S2HH 4NPSA 2ZTDA 4TQUS 3CCSA 3ZJYC 2UXDQ 3WWVA 4RG1A 1UE7A 5LMUL 2GN5A 2UUCL 3RLFA 4TVAB 1SRUA 4GN5A 3J80i 4IJHA 2KBNA 2HIVA 5GAHC 1IZ6A 3PO2G 1N33L 3PSIA 2JE6I 1SROA 1N32Q 1J5EL 5M5XH 3JAMi 1PYSB 2IT1A 4PG3A 4DKAC 4JI4L 1XNQQ 2VQFL 4PZ6A 1MJEA 3GTPH 1VQHA 3K8AA 1PH4A 4GOPC 4A4IA 3PO3H 4QGUA 3HOUG 4DV5L 4JOIA 1TWAH 1DGSA 2K5NA 3KF6B 1L0WA 4C3IH 4A3IG 1XPOA 2VW9A 1XPUA 1EYGA 4PZ8A 4PZ7A 2CWAA 2WB1E 1TWGH 3M85A 3OTOQ 2IHFA 3W1BA 1X9NA 2OQKA 2R7ZH 1G291 4MNOA 4A3EG 2EXDA 2E8GA 3GTOH 2WFWA 4DUYL 1PH8A 1Q7YC 5FLMH 1HR0W 3AYHB 2UXBL 2UXBQ 4DV0L 2JA5G 3I2ZA 1GKHA 1YHBA 3KOJA 4PMWA 2VUMH 3GDEA 4YCVA 2A8VA 4HIMA 1LTLA 3NBHB 1PH2A 3CC4A 2VQEL 1YNXA 1SMXA 3HOZG 2KCTA 1HNZL 4OWWB 4LFCQ 1BBWA 1OXVA 4AYBE 4Y7NH 2HHHQ 1Q8KA 4R4QA 5ELOA 2BA0A 2KENA 3CCLA 3T1YQ 2F4VQ 5C44H 3CF5A 1D8LA 1E3PA 2NVYH 2VNUD 4UY8C 2WAQG 3CCRA 2PNHA 1OXXK 4MZ9A 2ZJPA 4DAYB 3D31A 1N32L 1TWCH 4JBWA 4GNXB 1N33Q 3UDIA 2PI2A 1Q12A 4AIMA 4POGA 2K5HA 1BBUA 2QGQA 4X64L 2MO0A 1Q1BA 4DR1L 3VDYA 3M4OH 1SN8A 2PI2E 3GTJH 1N36Q 2IX1A 3PV0A 4C2MH 1VQLA 2HQLA 1UEBA 5FLXc 3RLOA 2JQOA 3ULPA 2B63H 3DLLA 1QZGA 4LFAL 5JEAG 4JC0A 4X65L 4HJ7A 2OWOA 3L2PA 5IP9G 3UE1A 2HIXA 3HOVH 1KAWA 1U5KA 1I6HH 5IYCH 2NZHA 5C0XI 2OTLA 2MNAA 3CMEA 2B29A 3GTKH 4IOAA 5K36G 4O0AA 3J7ZC 3PIPA 5IYDG 1PV4A 3CAMA 4B3ML 4NXNL 3HOWH 1YIJA 1TWFH 1L1OA 2E5LQ 3UDFA 4WJ4A 4GKJQ 4QQBX 2ZTEA 1XPRA 5LMNL 1IBKQ 1HNWQ 1NTGA 3K7UC 1RL2A 3F2DA 4DUZQ 4DR3L 1FJGQ 2JA6H 4DR5Q 3ER0A 5H1SE 4HIKA 5IE8A 4DV1Q 4P74A 1A63A 3I56A 3CW2C 2QEXA 5M5WH 3OW2A 5GADC 3RLNA 4HJ8A 2VL6A 5C0XJ 1PH9A 3FKIH 4DAMA 1HR0Q 4LF6Q 5IYCG 4IPGA 1P16A 4P71A 4GNXC 2UU9Q 5JJLA 4DR2Q 1XMOL 2K50A 4DUZL 3CMAA 1WFQA 1YJNA 5LMNQ 1KC8C 2JA7G 3I4MG 4DR7L 1I50H 1ASZA 1IBLQ 4GOPA 4DR4L 4B3TL 4A3DH 2FXQA 4NXML 1XMQQ 3J80c 3PF4A 4LFBQ 1W2BA 2H5XA 1HNXQ 1I5FA 4L5TA 1C9OA 2PQAB 5JJKA 3I55A 1L2FA 4OO1G 1AH9A 3W5OA 3B6YA 4A3EH 5M3MH 4AQYL 3PUVA 3KFUA 1QUQB 1L1OB 2MQHA 1EUJA 2DUDA 4YHHL 2UUBL 5FJ8G 3F1ZA 4BY7H 1RIPA 5HGQA 4A3FG 1B7YB 1HZBA 4JBJA 4DNIA 4HJ9A 1E7ZA 3JC66 4QY7A 5IYBG 1T9HA 1IYJB 2E2JH 2Q2TA 3HKZG 2NN6G 3J81c 4X64Q 1JMCA 4B3SL 3HOXG 4GLXA 4LF5L 4KHPQ 1K3RA 3F2CA 3PO2H 1CSPA 1KHIA 4A3MG 1PVOA 1UE6A 1X65A 5M3FG 4A3JH 2K4KA 1EWIA 4QL5A 2VUMG 4GKKQ 1Y1WH 1EOVA 1X54A 3H0GH 3CC7A 1JJCB 1HZCA 1B70B 2AKWB 1S40A 3GTGH 4LF4L 3CQZH 1CKMA 1OXUA 4OXPA 2ZM6L 1HNZQ 3K0XA 2JA9A 2NN6I 2Z6KA 3PCOB 2EIFA 2CCZA 3PUZA 4A3GH 3EN2A 1PHJA 1VQ7A 4A3CH 3KLWA 1YZ6A 1HJPA 4A3KH 2F52A 2ES2A 4DUYQ 2B3GA 1VCIA 3JAMc 3STBD 1VQJA 1CKNB 1SFOH 2UXCQ 2RCNA 4B3SQ 1E1OA 1VQ5A 4X66Q 4OO1I 3HOVG 1Q1EA 5IP9H 3D0FA 3I4NG 1VQ9A 3S16H 1YHAA 2LXJA 4DV6L 2PQAA 3CCMA 1I94L 3MEFA 2B63G 1O7IA 3AQQA 5J3BA 3EIVA 4BA2I 4LF8Q 3TREA 3S24A 2JEAI 3PIOA 3J81i 1I3QH 1MIUA 1VS0A 1VQGA 2N8NA 4IPCA 4JI4Q 2IY5B 1PYBA 4DV7L 4BXXH 4P72A 3CC2A 1CUKA 1HNXL 2Y0SE 3K81C 3CP0A 3HFZB 3PUWA 1EFWA 4B3TQ 4LWCA 3GTQH 4DR4Q 4DR7Q 2VZAA 5C4XG 4BXXG 4JOIC 1H95A 2GVBA 2PMZE 5C44G 4GNXA 5AJ3L 3CCVA 4OWTB 4OX9Q 3S1NH 4A93H 4UP8A 4JYAL 2ATWA 3GTLH 1YVCA 1NBWA 1Q81C 3M9BA 3TQYA 5IT9c 4DR6Q 2D0PA 1QVCA 3TS0A 1FVIA 2VY3A 2XGTA 2JA7H 2ZJQA 4KI0A 2ALYB 1R9TH 1VQMA 4X62Q 4DV1L 1L1OC 4JI6Q 2R7FA 1K0RA 3M4PA 3FKIG 5IWAL 4UPAA 2R7DA 5C0XG 1JJ2A 5FLMG 4LF8L 4DR5L 3S14H 4GS3A 3RNUA 3RN2A 1N34L 1KXLA 1HNWL 4DV6Q 4P73A 2MFIA 1SLJA 4JI7L 3S2DH 3T1HL 3S1RH 2E5LL 2RHQB 3M4QA 1IBML 1YJWA 3FHWA 4GN3B 2CQOA 2QA4A 1ASYA 4APVA 1QVGA 4JI0Q 1OTCA 1KQSA 4A3GG 3PGZA 3NELA 5IP7G 1PH3A 3K7AH 2UUAL 3E0EA 4X6AH 4H02A 1UWVA 4R4TA 3CPWA 3KF6A 4NB3A 4JBMA 2OTJA 3AEVA 5BR8L 4IPHA 2JA8G 1VQBA 3CXCA 4GLVB 2YV5A 1PA6A 4JI1Q 4DK6C 4HJAA 2K75A 5M5YH 5M3FH 1VQ8A 2NVTH 2K14A 2N49A 4DR1Q 1QZHA 3KYHC 4LF7Q 4BY1G 3HOXH 1IXRA 2NZOA 4UP7A 4C3JH 5C3EG 4J15A 1K83H 1W3SA 3BZCA 5JJIA 3S1QH 1K8AC 4C3HH 4DK3C 4A93G 1WCMH 2YTYA 4YWKA 1FL0A 3CCUA 4HJ5A 4Y52H 5C4XH 2OQ0A 3UDGA 4LF7L 3U4ZA 3MXNB 2Q2HA 2K52A 4LF9L 4IOCA 2F4VL 3STBC 3E9IA 1K9MC 2ID0A 5GROA 4JI1L 1Z47A 2R93G 1V9PA 1J6QA 2ZJRA 3RZDH 2VQEQ 3G4SA 1VQOA 1BVSA 3S15H 4YHHQ 4DV2Q 1NMFA 2UUBQ 3HOYG 4UP9A 2I5HA 4OONA 4B3RQ 5HY6A 3G48A 4IPDA 4DV0Q 3KJOA 3A74A 1VQCA 4A3BH 3ERSX 4AQYQ 2AMCB 2UUAQ 2CKZB 4JI5Q 1NY4A 3BJUA 5EAYA 4OWXB 1YHQA 3TS2A 3I4MH 3W1GA 2IHEA 4JI0L 1YBYA 4LUZA 2Z6KC 3BU2A 1WYDA 3OTOL 2AWNA 4L5QA 4K0KQ 1Q82C 1XMQL 4NXMQ 3L0OA 2BH2A 5GAGC 1IBMQ 4LW1A 4LFBL 1C0AA 3FP9A 4YCWA 1A62A 3T1HQ 1Z9FA 1PH5A 1K8GA 2CFMA 1IBLL 2I0QA 2R7ZG 2Q2IA 2AHOB 3IRBA 3ULLA 1GO3E 4DR2L 1XMOQ 1D7QA 2VS1A 4ME3A 1GVPA 4LUOA 4IO9A 4A3KG 1TWHH 4LF6L 1HR0L 3AFQA 3GTMH 3TRZA 1X6OA 4BBRH 4A3LH 1J5EQ 5JEAJ 3F8TA 4X62L 1QVFA 5C4JH 3SGIA 2YTVA 1E22A 3A5UA 2KCMA 4DR6L 4HIOA 3K80C 5C3EH 4BBSH 1JJGA 3HOWG 1WOCA 1P8LA 4P75A 5AJ3Q 4OX9L 1AE3A 4JYAQ 2UXDL 3H0GG 1IBKL 1KRSA 3G6EA 1Y1WG 4GKJL 3J81j 4A3JG 1XJVA 1KIXA 3KDFB 4A3BG 3Q8DA 1EQRA 1CSQA 4DV7Q 2ASBA 2CWPA 4GOPB 1EIYB 4JCVE 1XNRQ 3HOYH 2JEBI 5IYBH 1VQDA 1IL2A 4L5SA 1YJ9A 2HT1A 1Y14B 3A5ZB 5E7NA 4X65Q 4LFAQ 2R93H 4XTCS 2LXKA 1U0LA 4BBRG 1NJIC 3H3VI 3F2BA 4RMFA 5FJ8H 1I94Q 3RZOH 4BY7G 1HH2P 2RF4A 1YITA 1VQKA 1VQAA 3NENA 4IFDI 1YEZA 1EQQA 1N36L 4GN4B 4R4OA 4POFA 3KJPA 4JBKA 1X3FA 3M7NA 1B8AA 1TXYA 3A0JA 4X66L 5M3MG 1N8RC 5ELNA 2XTIA 4JI2L 4WJ3M 3PF5A 3M3YH 2UXCL 1Y1VG 2D62A 1KRTA 1PH1A 1A8VA 1UE5A 1XTDA 2Y0SG 4BY1H 1G6PA 2L15A 1FGUA 3CCEA 1SE8A 1N9WA 3LGJA 4BA1I 1LM0A 1X3EA 2JJQA 1C7YA 3T1YL 1QUQA 1Y1VH 3GD7A 5GAEC 3CCQA 4JV5Q 1KD1C 4JG2A 4HIDA 2ZM6Q 3U58A 2HHHL 1EIFA 1NE3A 1VQIA 2AWOA 4GLAC 3HKSA 4LFCL 1M90C 2JA5H 4DV4Q 4LUVA 4LF4Q 2JA8H 2NVQH 4K0KL 3KF8B 4IFDJ 1KL9A 2A19A 4QIWE 4R4CA 1VQ4A 2GVAA 2C35B 2A1AA 1VQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQS A;  1JB7 A;  1E1T A;  4GKK L;  4JI5 L;  5IP7 H;  4A3C G;  2I5L X;  1V1Q A;  1GM5 A;  3H15 A;  5DLQ E;  4L5R C;  3S17 H;  2WP8 J;  1WI5 A;  1S3O A;  1MJC A;  1WCM G;  1V43 A;  3I4O A;  4JI8 Q;  4DV2 L;  4B3R L;  4LF5 Q;  4A3I H;  1PFS A;  4FDB A;  4KHP L;  1X56 A;  2Q2U A;  2BA1 A;  4YWL A;  4ALP A;  1LYL A;  5IYD H;  4R4I A;  3PUX A;  3NEM A;  1HZ9 A;  3PUY A;  5LMN W;  2YU9 H;  3KDF A;  2WB1 G;  4LF9 Q;  2E2I H;  2LSS A;  3I4N H;  1Q46 A;  4DV5 Q;  3ULJ A;  4QJF A;  4JI8 L;  4YCU A;  3G71 A;  1X55 A;  1NMG A;  1WJJ A;  2VQF Q;  1VQE A;  2I5M X;  1XNQ L;  2DGY A;  4BBS G;  3ICE A;  2MO1 A;  2ZTC A;  2F3I A;  3HKZ E;  4MTN A;  1MKH A;  4AH6 A;  1VQN A;  1JT8 A;  4XIG S;  4DV4 L;  4A3F H;  4KLK A;  2UUC Q;  5LMU Q;  2R92 H;  1CKN A;  4A3L G;  4DPG A;  1YI2 A;  1PH7 A;  4JV5 L;  3AFP A;  4EX5 A;  3BZK A;  2JK8 A;  3TEH B;  3U50 C;  2YTX A;  3CCJ A;  1SR3 A;  1BKB A;  3EBE A;  3RR5 A;  1OXS C;  4DV3 L;  5BR8 Q;  4IFD G;  2UU9 L;  2YYZ A;  2WAQ E;  4JI3 Q;  2BH8 A;  4YY3 L;  4O2D A;  1Q86 C;  1GD7 A;  2N3S A;  3H3V H;  1UE1 A;  4LNQ A;  4AYB G;  2KHI A;  1VQ6 A;  4R1J A;  2D0O A;  3DM3 A;  4JI2 Q;  3CD6 A;  4YWM A;  1E24 A;  4KHZ A;  4A3D G;  4A3M H;  4IJL A;  1X3G A;  3HOZ H;  1G51 A;  2NVX H;  3RN5 A;  2K5V A;  3E9H A;  1FJG L;  4DR3 Q;  4JI7 Q;  3OYY A;  5IY0 A;  1AE2 A;  1N34 Q;  3UDX A;  1M1K C;  4NXN Q;  1VQP A;  1OXT A;  3UE0 A;  4B3M Q;  1HZA A;  4A76 A;  5IWA Q;  1A0I A;  2N78 A;  2E2H H;  4JI6 L;  3J7A 5;  2KHJ A;  1S72 A;  1XNR L;  1CKO A;  2OCE A;  3GO5 A;  2Z0S A;  1LUZ A;  1JE5 A;  1PH6 A;  3CPF A;  2JA6 G;  3L7Z C;  2V1C C;  4YY3 Q;  1K73 C;  4JI3 L;  2R92 G;  2R6G A;  3S1M H;  4DV3 Q;  2RHS B;  3U4V A;  2IX0 A;  5GQO A;  3HOU H;  4EQ5 A;  4A75 A;  3I7F A;  3PO3 G;  3S2H H;  4NPS A;  2ZTD A;  4TQU S;  3CCS A;  3ZJY C;  2UXD Q;  3WWV A;  4RG1 A;  1UE7 A;  5LMU L;  2GN5 A;  2UUC L;  3RLF A;  4TVA B;  1SRU A;  4GN5 A;  3J80 i;  4IJH A;  2KBN A;  2HIV A;  5GAH C;  1IZ6 A;  3PO2 G;  1N33 L;  3PSI A;  2JE6 I;  1SRO A;  1N32 Q;  1J5E L;  5M5X H;  3JAM i;  1PYS B;  2IT1 A;  4PG3 A;  4DKA C;  4JI4 L;  1XNQ Q;  2VQF L;  4PZ6 A;  1MJE A;  3GTP H;  1VQH A;  3K8A A;  1PH4 A;  4GOP C;  4A4I A;  3PO3 H;  4QGU A;  3HOU G;  4DV5 L;  4JOI A;  1TWA H;  1DGS A;  2K5N A;  3KF6 B;  1L0W A;  4C3I H;  4A3I G;  1XPO A;  2VW9 A;  1XPU A;  1EYG A;  4PZ8 A;  4PZ7 A;  2CWA A;  2WB1 E;  1TWG H;  3M85 A;  3OTO Q;  2IHF A;  3W1B A;  1X9N A;  2OQK A;  2R7Z H;  1G29 1;  4MNO A;  4A3E G;  2EXD A;  2E8G A;  3GTO H;  2WFW A;  4DUY L;  1PH8 A;  1Q7Y C;  5FLM H;  1HR0 W;  3AYH B;  2UXB L;  2UXB Q;  4DV0 L;  2JA5 G;  3I2Z A;  1GKH A;  1YHB A;  3KOJ A;  4PMW A;  2VUM H;  3GDE A;  4YCV A;  2A8V A;  4HIM A;  1LTL A;  3NBH B;  1PH2 A;  3CC4 A;  2VQE L;  1YNX A;  1SMX A;  3HOZ G;  2KCT A;  1HNZ L;  4OWW B;  4LFC Q;  1BBW A;  1OXV A;  4AYB E;  4Y7N H;  2HHH Q;  1Q8K A;  4R4Q A;  5ELO A;  2BA0 A;  2KEN A;  3CCL A;  3T1Y Q;  2F4V Q;  5C44 H;  3CF5 A;  1D8L A;  1E3P A;  2NVY H;  2VNU D;  4UY8 C;  2WAQ G;  3CCR A;  2PNH A;  1OXX K;  4MZ9 A;  2ZJP A;  4DAY B;  3D31 A;  1N32 L;  1TWC H;  4JBW A;  4GNX B;  1N33 Q;  3UDI A;  2PI2 A;  1Q12 A;  4AIM A;  4POG A;  2K5H A;  1BBU A;  2QGQ A;  4X64 L;  2MO0 A;  1Q1B A;  4DR1 L;  3VDY A;  3M4O H;  1SN8 A;  2PI2 E;  3GTJ H;  1N36 Q;  2IX1 A;  3PV0 A;  4C2M H;  1VQL A;  2HQL A;  1UEB A;  5FLX c;  3RLO A;  2JQO A;  3ULP A;  2B63 H;  3DLL A;  1QZG A;  4LFA L;  5JEA G;  4JC0 A;  4X65 L;  4HJ7 A;  2OWO A;  3L2P A;  5IP9 G;  3UE1 A;  2HIX A;  3HOV H;  1KAW A;  1U5K A;  1I6H H;  5IYC H;  2NZH A;  5C0X I;  2OTL A;  2MNA A;  3CME A;  2B29 A;  3GTK H;  4IOA A;  5K36 G;  4O0A A;  3J7Z C;  3PIP A;  5IYD G;  1PV4 A;  3CAM A;  4B3M L;  4NXN L;  3HOW H;  1YIJ A;  1TWF H;  1L1O A;  2E5L Q;  3UDF A;  4WJ4 A;  4GKJ Q;  4QQB X;  2ZTE A;  1XPR A;  5LMN L;  1IBK Q;  1HNW Q;  1NTG A;  3K7U C;  1RL2 A;  3F2D A;  4DUZ Q;  4DR3 L;  1FJG Q;  2JA6 H;  4DR5 Q;  3ER0 A;  5H1S E;  4HIK A;  5IE8 A;  4DV1 Q;  4P74 A;  1A63 A;  3I56 A;  3CW2 C;  2QEX A;  5M5W H;  3OW2 A;  5GAD C;  3RLN A;  4HJ8 A;  2VL6 A;  5C0X J;  1PH9 A;  3FKI H;  4DAM A;  1HR0 Q;  4LF6 Q;  5IYC G;  4IPG A;  1P16 A;  4P71 A;  4GNX C;  2UU9 Q;  5JJL A;  4DR2 Q;  1XMO L;  2K50 A;  4DUZ L;  3CMA A;  1WFQ A;  1YJN A;  5LMN Q;  1KC8 C;  2JA7 G;  3I4M G;  4DR7 L;  1I50 H;  1ASZ A;  1IBL Q;  4GOP A;  4DR4 L;  4B3T L;  4A3D H;  2FXQ A;  4NXM L;  1XMQ Q;  3J80 c;  3PF4 A;  4LFB Q;  1W2B A;  2H5X A;  1HNX Q;  1I5F A;  4L5T A;  1C9O A;  2PQA B;  5JJK A;  3I55 A;  1L2F A;  4OO1 G;  1AH9 A;  3W5O A;  3B6Y A;  4A3E H;  5M3M H;  4AQY L;  3PUV A;  3KFU A;  1QUQ B;  1L1O B;  2MQH A;  1EUJ A;  2DUD A;  4YHH L;  2UUB L;  5FJ8 G;  3F1Z A;  4BY7 H;  1RIP A;  5HGQ A;  4A3F G;  1B7Y B;  1HZB A;  4JBJ A;  4DNI A;  4HJ9 A;  1E7Z A;  3JC6 6;  4QY7 A;  5IYB G;  1T9H A;  1IYJ B;  2E2J H;  2Q2T A;  3HKZ G;  2NN6 G;  3J81 c;  4X64 Q;  1JMC A;  4B3S L;  3HOX G;  4GLX A;  4LF5 L;  4KHP Q;  1K3R A;  3F2C A;  3PO2 H;  1CSP A;  1KHI A;  4A3M G;  1PVO A;  1UE6 A;  1X65 A;  5M3F G;  4A3J H;  2K4K A;  1EWI A;  4QL5 A;  2VUM G;  4GKK Q;  1Y1W H;  1EOV A;  1X54 A;  3H0G H;  3CC7 A;  1JJC B;  1HZC A;  1B70 B;  2AKW B;  1S40 A;  3GTG H;  4LF4 L;  3CQZ H;  1CKM A;  1OXU A;  4OXP A;  2ZM6 L;  1HNZ Q;  3K0X A;  2JA9 A;  2NN6 I;  2Z6K A;  3PCO B;  2EIF A;  2CCZ A;  3PUZ A;  4A3G H;  3EN2 A;  1PHJ A;  1VQ7 A;  4A3C H;  3KLW A;  1YZ6 A;  1HJP A;  4A3K H;  2F52 A;  2ES2 A;  4DUY Q;  2B3G A;  1VCI A;  3JAM c;  3STB D;  1VQJ A;  1CKN B;  1SFO H;  2UXC Q;  2RCN A;  4B3S Q;  1E1O A;  1VQ5 A;  4X66 Q;  4OO1 I;  3HOV G;  1Q1E A;  5IP9 H;  3D0F A;  3I4N G;  1VQ9 A;  3S16 H;  1YHA A;  2LXJ A;  4DV6 L;  2PQA A;  3CCM A;  1I94 L;  3MEF A;  2B63 G;  1O7I A;  3AQQ A;  5J3B A;  3EIV A;  4BA2 I;  4LF8 Q;  3TRE A;  3S24 A;  2JEA I;  3PIO A;  3J81 i;  1I3Q H;  1MIU A;  1VS0 A;  1VQG A;  2N8N A;  4IPC A;  4JI4 Q;  2IY5 B;  1PYB A;  4DV7 L;  4BXX H;  4P72 A;  3CC2 A;  1CUK A;  1HNX L;  2Y0S E;  3K81 C;  3CP0 A;  3HFZ B;  3PUW A;  1EFW A;  4B3T Q;  4LWC A;  3GTQ H;  4DR4 Q;  4DR7 Q;  2VZA A;  5C4X G;  4BXX G;  4JOI C;  1H95 A;  2GVB A;  2PMZ E;  5C44 G;  4GNX A;  5AJ3 L;  3CCV A;  4OWT B;  4OX9 Q;  3S1N H;  4A93 H;  4UP8 A;  4JYA L;  2ATW A;  3GTL H;  1YVC A;  1NBW A;  1Q81 C;  3M9B A;  3TQY A;  5IT9 c;  4DR6 Q;  2D0P A;  1QVC A;  3TS0 A;  1FVI A;  2VY3 A;  2XGT A;  2JA7 H;  2ZJQ A;  4KI0 A;  2ALY B;  1R9T H;  1VQM A;  4X62 Q;  4DV1 L;  1L1O C;  4JI6 Q;  2R7F A;  1K0R A;  3M4P A;  3FKI G;  5IWA L;  4UPA A;  2R7D A;  5C0X G;  1JJ2 A;  5FLM G;  4LF8 L;  4DR5 L;  3S14 H;  4GS3 A;  3RNU A;  3RN2 A;  1N34 L;  1KXL A;  1HNW L;  4DV6 Q;  4P73 A;  2MFI A;  1SLJ A;  4JI7 L;  3S2D H;  3T1H L;  3S1R H;  2E5L L;  2RHQ B;  3M4Q A;  1IBM L;  1YJW A;  3FHW A;  4GN3 B;  2CQO A;  2QA4 A;  1ASY A;  4APV A;  1QVG A;  4JI0 Q;  1OTC A;  1KQS A;  4A3G G;  3PGZ A;  3NEL A;  5IP7 G;  1PH3 A;  3K7A H;  2UUA L;  3E0E A;  4X6A H;  4H02 A;  1UWV A;  4R4T A;  3CPW A;  3KF6 A;  4NB3 A;  4JBM A;  2OTJ A;  3AEV A;  5BR8 L;  4IPH A;  2JA8 G;  1VQB A;  3CXC A;  4GLV B;  2YV5 A;  1PA6 A;  4JI1 Q;  4DK6 C;  4HJA A;  2K75 A;  5M5Y H;  5M3F H;  1VQ8 A;  2NVT H;  2K14 A;  2N49 A;  4DR1 Q;  1QZH A;  3KYH C;  4LF7 Q;  4BY1 G;  3HOX H;  1IXR A;  2NZO A;  4UP7 A;  4C3J H;  5C3E G;  4J15 A;  1K83 H;  1W3S A;  3BZC A;  5JJI A;  3S1Q H;  1K8A C;  4C3H H;  4DK3 C;  4A93 G;  1WCM H;  2YTY A;  4YWK A;  1FL0 A;  3CCU A;  4HJ5 A;  4Y52 H;  5C4X H;  2OQ0 A;  3UDG A;  4LF7 L;  3U4Z A;  3MXN B;  2Q2H A;  2K52 A;  4LF9 L;  4IOC A;  2F4V L;  3STB C;  3E9I A;  1K9M C;  2ID0 A;  5GRO A;  4JI1 L;  1Z47 A;  2R93 G;  1V9P A;  1J6Q A;  2ZJR A;  3RZD H;  2VQE Q;  3G4S A;  1VQO A;  1BVS A;  3S15 H;  4YHH Q;  4DV2 Q;  1NMF A;  2UUB Q;  3HOY G;  4UP9 A;  2I5H A;  4OON A;  4B3R Q;  5HY6 A;  3G48 A;  4IPD A;  4DV0 Q;  3KJO A;  3A74 A;  1VQC A;  4A3B H;  3ERS X;  4AQY Q;  2AMC B;  2UUA Q;  2CKZ B;  4JI5 Q;  1NY4 A;  3BJU A;  5EAY A;  4OWX B;  1YHQ A;  3TS2 A;  3I4M H;  3W1G A;  2IHE A;  4JI0 L;  1YBY A;  4LUZ A;  2Z6K C;  3BU2 A;  1WYD A;  3OTO L;  2AWN A;  4L5Q A;  4K0K Q;  1Q82 C;  1XMQ L;  4NXM Q;  3L0O A;  2BH2 A;  5GAG C;  1IBM Q;  4LW1 A;  4LFB L;  1C0A A;  3FP9 A;  4YCW A;  1A62 A;  3T1H Q;  1Z9F A;  1PH5 A;  1K8G A;  2CFM A;  1IBL L;  2I0Q A;  2R7Z G;  2Q2I A;  2AHO B;  3IRB A;  3ULL A;  1GO3 E;  4DR2 L;  1XMO Q;  1D7Q A;  2VS1 A;  4ME3 A;  1GVP A;  4LUO A;  4IO9 A;  4A3K G;  1TWH H;  4LF6 L;  1HR0 L;  3AFQ A;  3GTM H;  3TRZ A;  1X6O A;  4BBR H;  4A3L H;  1J5E Q;  5JEA J;  3F8T A;  4X62 L;  1QVF A;  5C4J H;  3SGI A;  2YTV A;  1E22 A;  3A5U A;  2KCM A;  4DR6 L;  4HIO A;  3K80 C;  5C3E H;  4BBS H;  1JJG A;  3HOW G;  1WOC A;  1P8L A;  4P75 A;  5AJ3 Q;  4OX9 L;  1AE3 A;  4JYA Q;  2UXD L;  3H0G G;  1IBK L;  1KRS A;  3G6E A;  1Y1W G;  4GKJ L;  3J81 j;  4A3J G;  1XJV A;  1KIX A;  3KDF B;  4A3B G;  3Q8D A;  1EQR A;  1CSQ A;  4DV7 Q;  2ASB A;  2CWP A;  4GOP B;  1EIY B;  4JCV E;  1XNR Q;  3HOY H;  2JEB I;  5IYB H;  1VQD A;  1IL2 A;  4L5S A;  1YJ9 A;  2HT1 A;  1Y14 B;  3A5Z B;  5E7N A;  4X65 Q;  4LFA Q;  2R93 H;  4XTC S;  2LXK A;  1U0L A;  4BBR G;  1NJI C;  3H3V I;  3F2B A;  4RMF A;  5FJ8 H;  1I94 Q;  3RZO H;  4BY7 G;  1HH2 P;  2RF4 A;  1YIT A;  1VQK A;  1VQA A;  3NEN A;  4IFD I;  1YEZ A;  1EQQ A;  1N36 L;  4GN4 B;  4R4O A;  4POF A;  3KJP A;  4JBK A;  1X3F A;  3M7N A;  1B8A A;  1TXY A;  3A0J A;  4X66 L;  5M3M G;  1N8R C;  5ELN A;  2XTI A;  4JI2 L;  4WJ3 M;  3PF5 A;  3M3Y H;  2UXC L;  1Y1V G;  2D62 A;  1KRT A;  1PH1 A;  1A8V A;  1UE5 A;  1XTD A;  2Y0S G;  4BY1 H;  1G6P A;  2L15 A;  1FGU A;  3CCE A;  1SE8 A;  1N9W A;  3LGJ A;  4BA1 I;  1LM0 A;  1X3E A;  2JJQ A;  1C7Y A;  3T1Y L;  1QUQ A;  1Y1V H;  3GD7 A;  5GAE C;  3CCQ A;  4JV5 Q;  1KD1 C;  4JG2 A;  4HID A;  2ZM6 Q;  3U58 A;  2HHH L;  1EIF A;  1NE3 A;  1VQI A;  2AWO A;  4GLA C;  3HKS A;  4LFC L;  1M90 C;  2JA5 H;  4DV4 Q;  4LUV A;  4LF4 Q;  2JA8 H;  2NVQ H;  4K0K L;  3KF8 B;  4IFD J;  1KL9 A;  2A19 A;  4QIW E;  4R4C A;  1VQ4 A;  2GVA A;  2C35 B;  2A1A A;  1VQF A; 
#chains in the Genus database with same CATH topology
 2TSS A;  3GTQ B;  4GKK L;  5IP7 H;  1GHK A;  5CC4 A;  2DJG C;  5DNF A;  4WRD A;  4PNY A;  1GM5 A;  1EWC A;  4FNF A;  2FJ2 A;  2R3Z A;  4FDB A;  2Q2U A;  2BA1 A;  2O2L D;  3PUX A;  1STG A;  2KEE A;  3JAM L;  2E2I H;  1LT6 D;  1Q46 A;  1G91 A;  4DV5 Q;  3ULJ A;  4YCU A;  4HMJ A;  1WJJ A;  3SK6 A;  2XRQ D;  3J80 E;  1VQE A;  2QF7 A;  3ICE A;  1YNJ D;  3DWA A;  3RZD B;  1MKH A;  2D9U A;  2QDB A;  4I7A A;  1DZ1 A;  2TMP A;  2ZXP A;  2UUC Q;  5LMU Q;  2R92 H;  4A3L G;  4DPG A;  5LL6 S;  1O80 A;  1SND A;  5IGB A;  4C1N K;  4EX5 A;  3BZK A;  3CCJ A;  3U50 C;  1OXS C;  2IX3 A;  2UU9 L;  2YYZ A;  2WAQ E;  1Y8N B;  4O2D A;  1Q90 A;  3NUC A;  4AYB G;  2FMM A;  4FF3 A;  2D0O A;  3CU7 A;  2NVT B;  4KHZ A;  1NNX A;  3JAM E;  3TP8 A;  3D4W A;  1A3T A;  1G51 A;  3PIO 3;  3E9H A;  1LAB A;  4JI7 Q;  5IY0 A;  1AE2 A;  5KYI A;  2KCC A;  4NXN Q;  5IWA Q;  2WAC A;  1A0I A;  2RSO A;  2K5D A;  4BY7 B;  3EQL C;  1WTH A;  2JA6 G;  1NR4 A;  4RCN A;  3T53 B;  5CMD A;  3S1R B;  2R6G A;  1ICF B;  3S1M H;  4DV3 Q;  2RHS B;  3U4V A;  2IX0 A;  3DXJ C;  1ML0 D;  4A75 A;  3I7F A;  3EJI A;  2JYO A;  4NPS A;  3S14 B;  3ZJY C;  2UXD Q;  5HUR A;  2K33 A;  3RLF A;  1HRJ A;  1TU2 B;  4IJH A;  2IWH A;  2JA7 B;  1NUC A;  3PO2 G;  2JE6 I;  4RHS A;  1H9M A;  5M5X H;  2HDL A;  2IT1 A;  4PG3 A;  5J1Z A;  1XNQ Q;  1BR9 A;  3BDC A;  1NCV A;  1CHP D;  3K8A A;  4GOP C;  1PH4 A;  1EY9 A;  3PO3 H;  2Z8L A;  1ICW A;  1XWE A;  4KHV A;  1TWA H;  1S5B D;  1L0W A;  5EBD A;  3SR1 A;  3BYY B;  3SHL A;  1TWG B;  5KIX A;  3M85 A;  4KJO A;  3GV6 A;  4L6T B;  4PV1 C;  1X9N A;  4MNO A;  1EYD A;  3SVM A;  1WTX A;  2WFW A;  1PH8 A;  1E2V A;  2A6H C;  4B9W A;  2JA5 G;  3I2Z A;  1GKH A;  2VUM H;  4PMW A;  3LWE A;  1BBX C;  3GDE A;  2A8V A;  4HIM A;  3NBH B;  4ZCK A;  5KNB A;  1HNZ L;  1BBW A;  1OXV A;  2F4V Q;  1CQV A;  2KEN A;  2PMZ B;  2OEO A;  2XNA C;  3CF5 A;  5ELC A;  1SE3 A;  2VNU D;  2MJ8 A;  3QWN A;  2VXW A;  3TSS A;  2ZJP A;  2LKV A;  3M4O B;  1GXD C;  1UEA B;  2K05 A;  1Q1B A;  4L8J A;  4K6D A;  1SN8 A;  3HOW B;  3GTJ H;  1ZXT A;  3PV0 A;  1B3Q A;  1UEB A;  3RLO A;  3H94 A;  1STY A;  4IAL A;  1IL8 A;  5FLX E;  3L2P A;  5IP9 G;  3UE1 A;  2HIX A;  3HOV H;  3K6O A;  1PFN A;  4F87 A;  5IYC H;  3GTK H;  3J7Z C;  5ISR A;  4FF2 A;  3E0J A;  1YIJ A;  2E5L Q;  4WJ4 A;  2M00 A;  4QQB X;  2F03 A;  4OIK A;  2HCI A;  2RA4 A;  2E2D C;  4DR3 L;  1FJG Q;  1TWC B;  5KEE A;  5H1S E;  4P74 A;  1A63 A;  3CW2 C;  3KK7 A;  5M5W H;  3OW2 A;  3N6R A;  5C0X J;  3OW7 A;  3FKI H;  4DAM A;  4LF6 Q;  4IPG A;  1LTI D;  4P71 A;  2UU9 Q;  1MSG A;  1FNU A;  2JA7 G;  1WFQ A;  1KC8 C;  1ASZ A;  1IBL Q;  2Z1C A;  4G7H C;  2YU9 B;  4L5T A;  3DM1 A;  1MD2 D;  3W5O A;  1EZ6 A;  4A3I B;  1JIC A;  2CVR A;  3KFU A;  1QUQ B;  2MQH A;  4CBV A;  2DUD A;  4KMU C;  3TZD A;  2B2V C;  4RGM A;  1RIP A;  4TRD A;  1HZB A;  1PZJ D;  4DNI A;  1E7Z A;  3JC6 6;  3MAQ A;  1GUS A;  1IYJ B;  4C3H G;  2NN6 G;  2QIL A;  1JMC A;  1UAP A;  1Y1V B;  4KHP Q;  4V0B A;  3PO2 H;  1KHI A;  4HAE A;  4A3M G;  1PVO A;  2G9D A;  1A3U A;  5M3F G;  4A3J H;  2K4K A;  4WOR A;  2MP1 A;  4GKK Q;  4O42 A;  2NBF A;  4DXG A;  1WVL A;  4CKB A;  2WIN B;  5EGT A;  2F0Q A;  1HNZ Q;  2NN6 I;  2Z6K A;  5HGT A;  2OXP A;  4A3G H;  4C3I G;  1VQ7 A;  4A3C H;  1YZ6 A;  1HJP A;  2EPB A;  3STB D;  1VQJ A;  1SFO H;  4B3S Q;  2A69 C;  1VQ5 A;  4X66 Q;  1CK1 A;  4IUN A;  3D0F A;  1VQ9 A;  5D14 A;  2PQA A;  1B53 A;  3MEF A;  2B63 G;  3BS1 A;  4IUP A;  3PIO A;  1NAP A;  5KNC A;  1VS0 A;  1TS4 A;  1BDO A;  1Z7T A;  4DV7 L;  4P72 A;  4J1M A;  1MI2 A;  5CV8 A;  3IAY A;  2V4D A;  2Y0S E;  3D6C A;  4B3T Q;  1G2T A;  4OGQ C;  4DR4 Q;  4DAY A;  4DR7 Q;  1I4P A;  2PMZ E;  4JYA L;  4OWT B;  3GTP B;  3GTL H;  4HMI A;  1BCP C;  1IHZ A;  5IT9 c;  4XQJ A;  5T1G A;  2PYK A;  5A2Q E;  4RKL A;  4KI0 A;  2ALY B;  4XYQ A;  3I4N B;  3AB9 A;  3M4P A;  1FR3 A;  1KDB A;  5KGU A;  5IIF A;  5L37 A;  5FLM G;  4CKE A;  4OIJ A;  1KXL A;  1SLJ A;  3D8G A;  2NTS A;  4EQN A;  4DF7 A;  3I70 A;  2CQO A;  1QVG A;  4JI0 Q;  1OTC A;  4FF4 A;  4A3G G;  3QOL A;  4KY7 A;  1DOM A;  1PH3 A;  3QR8 A;  5JVH 3;  4JPB W;  4R4T A;  2NVQ B;  3K5M A;  4N9P A;  4GLV B;  4HJA A;  4DXF A;  2K75 A;  1VQ8 A;  5BN3 A;  3OWF A;  3HOX H;  1B4O A;  5C3E G;  1W3S A;  4C3H H;  3OPO A;  2A68 C;  1XYI A;  4KN7 C;  4K8J A;  3R8B A;  4IOC A;  1S5E D;  2ICE C;  1SNM A;  3E9I A;  4JI1 L;  1Z47 A;  5IGF A;  1V9P A;  1J6Q A;  3NSW A;  1BVS A;  3C46 A;  1U4R A;  2I5H A;  2M2L A;  5D3I B;  1A6X A;  1DM0 B;  3ERS X;  1VMP A;  1YHQ A;  3TS2 A;  2M9V A;  4ID6 A;  4LFB L;  5EPJ A;  1IBM Q;  4LW1 A;  4BBS B;  2I0Q A;  4YCW A;  1PH5 A;  1WTP A;  3ULL A;  2KHS A;  2VS1 A;  1GVP A;  4ZAI A;  1RTN A;  1X6O A;  1EYA A;  2K28 A;  3GTM B;  1J5E Q;  4X62 L;  3MXN A;  4P75 A;  3H0G G;  4FVM A;  3HP3 A;  1IBK L;  1RD9 D;  1DXM A;  1SEB D;  3NXW A;  1XJV A;  4H13 C;  1LV9 A;  3X3N A;  4A3B G;  3Q8D A;  1EQR A;  4XYO A;  1HPC A;  2CWP A;  3HOY H;  3O13 A;  1VQD A;  1IL2 A;  1YJ9 A;  1K8M A;  3LNN A;  2HDM A;  2R93 H;  3F2B A;  4CDF C;  1YIT A;  1CT1 D;  5LL6 X;  1EQQ A;  4JBK A;  3VR2 A;  2BCO A;  3A0J A;  1BQQ T;  1N8R C;  2XTI A;  4WJ3 M;  1BCP B;  3K5L A;  3M3Y H;  2D62 A;  1PH1 A;  1NSN S;  1B9N A;  4BY1 H;  1PZI D;  3LGJ A;  4BA1 I;  4M1U B;  2X6G A;  2F0W A;  1Y1V H;  4JV5 Q;  4O1N A;  1JCK B;  3VR3 A;  2ZM6 Q;  4DNT B;  1VQI A;  1M90 C;  2AWO A;  2JA5 H;  2F0S A;  4DV4 Q;  3F2U A;  3KF8 B;  4KJN A;  4QIW E;  3J7Y W;  2A69 D;  3E6Z X;  1JB7 A;  4NP5 A;  4JI5 L;  4BBR B;  4JI8 Q;  1EL0 A;  4LF5 Q;  4A3I H;  1EY8 A;  4DK0 A;  3I73 A;  1LYL A;  4RHR A;  1D1I A;  4KD3 A;  2D2C C;  3NEM A;  1HZ9 A;  3PUY A;  2PNR C;  2YU9 H;  4H0L C;  4S3S A;  1B50 A;  5C0X H;  2LSS A;  2WV6 D;  3PMF A;  1STA A;  4ZYS A;  1ZYR C;  3NE5 B;  4QJF A;  2QW7 A;  1X55 A;  1SYE A;  1I4H A;  2I5M X;  2AQ3 B;  1MBY A;  2MO1 A;  2IPK D;  2ZTC A;  5CGK A;  3HKZ E;  3NWT A;  3GV3 A;  4XT1 B;  5I6W A;  4PMB A;  4XIG S;  4A3F H;  1CA6 A;  1X3P A;  1YI2 A;  2JK8 A;  3KBX A;  3OIP A;  1XX8 A;  2YTX A;  1RJT A;  1SR3 A;  3RR5 A;  4IFD G;  5BR8 Q;  3GQB A;  1Q86 C;  1GD7 A;  1K83 B;  3H3V H;  4KKU A;  2RQX A;  3AMU A;  2KHI A;  5EPL A;  3J81 L;  3H0G B;  1CQF A;  1A15 A;  4YWM A;  1E24 A;  1DOK A;  1I6V C;  5C5M A;  4A3D G;  4A3M H;  1KNE A;  1K3B C;  1X3G A;  2PQE A;  3HOZ H;  3HOV B;  2NVX H;  4MTK A;  3FPU B;  1HCZ A;  2R61 A;  4R9W A;  3UDX A;  5J39 A;  1E2W A;  4B3M Q;  1HZA A;  4A76 A;  1D5Z C;  3WOE A;  2E2H H;  5EJW A;  1WTQ A;  1BUV T;  4CJ2 C;  1S72 A;  1XNR L;  3J7A 5;  2OCE A;  4K14 A;  1LUZ A;  1CFM A;  1PH6 A;  3CPF A;  3L7Z C;  5ELF A;  1GJX A;  3CQZ B;  1K73 C;  4N8F A;  2R92 G;  3PO3 G;  1HQR D;  2LFN A;  1WTO A;  2ZTD A;  3AU7 A;  4TQU S;  4AYB B;  3WWV A;  1L0X B;  4JK1 C;  4TVA B;  2XSC A;  2C9O A;  1SRU A;  3J80 i;  4CGY B;  1BF4 A;  5FO9 B;  1IZ6 A;  1N33 L;  1E2Z A;  4IUU A;  2L9H A;  1PYS B;  4JI4 L;  3I3C A;  1LTB D;  4DKA C;  1QCB D;  4A93 B;  2EE1 A;  4Q5V A;  4QGU A;  3E3X A;  2EYF A;  4DV5 L;  1CTM A;  4JOI A;  3KF6 B;  1DGS A;  1XPO A;  1XPU A;  1SYF A;  2CWA A;  1TWG H;  3T16 A;  2Q8T A;  1G29 1;  1Q8I A;  1TWF B;  1F77 A;  2EJM A;  1HR0 W;  2UXB Q;  3NHH A;  2UXB L;  3AYH B;  2GA4 B;  4A3D B;  5M5X B;  1LTL A;  5ELD A;  3CC4 A;  1F9S A;  1YNX A;  2HCC A;  4IZ8 A;  5F2D A;  3HOZ G;  1EZ8 A;  2EY6 A;  1ET9 A;  4AYB E;  5LHY 1;  1B3A A;  4Y7N H;  1KLG D;  2NN6 H;  1Q8K A;  2BA0 A;  4ME5 A;  5A2Q L;  1F2Y A;  1LO5 D;  2JN4 A;  1OO9 B;  1F2M A;  4DAY B;  3QOJ A;  2O5J C;  5AFW A;  3N52 A;  3GP7 A;  1Q12 A;  1S5D D;  3QIA A;  4AIM A;  1BBU A;  2QGQ A;  1MSH A;  2DJF C;  4X64 L;  3VDY A;  4DR1 L;  2K1B A;  1R4Q B;  2IX1 A;  4JW0 A;  2EYH A;  4UDU C;  1Y1W B;  1JWM D;  4ULL A;  3DLL A;  1PTO H;  3J81 E;  4LFA L;  4Y7N B;  4JC0 A;  1I6H H;  1AN8 A;  3I4L A;  3T4A C;  3BVM A;  1NR2 A;  2B29 A;  2K03 A;  3I90 A;  1SNP A;  3PIP A;  2J7Z A;  3CAM A;  4B3M L;  5KND A;  1EIH A;  1TWF H;  4XQN A;  4ZQ3 A;  5CR3 A;  3T51 B;  1V1O A;  2CH4 W;  1XPR A;  5LMN L;  1NTG A;  3K7U C;  1RL2 A;  4G57 A;  4DUZ Q;  3TBI B;  1WTW A;  3I72 A;  5M3M B;  5IE8 A;  5CV7 A;  1Q3L A;  2EXZ A;  5CBE E;  2ZT9 C;  1CM9 A;  2KA7 A;  3HKZ B;  4QF4 A;  3SDZ A;  2PZW A;  2ZXO A;  4OHJ A;  1B9M A;  1K8O A;  2PZT A;  1HR0 Q;  5IYC G;  1P16 A;  1I50 B;  4GNX C;  3J7A F;  5JOB A;  2K50 A;  3I4M G;  5LMN Q;  4GOP A;  4DR4 L;  4A3D H;  3ND9 A;  1SBB B;  4NXM L;  3BVZ A;  3J80 c;  1W2B A;  2H5X A;  2WAQ B;  1SXT A;  1D5M C;  3I55 A;  1B44 D;  4OO1 G;  2EYM A;  5ELE A;  1S5F D;  4A3E H;  5KYL A;  2E76 C;  3PUV A;  4IFD H;  1QG7 A;  2IJ0 A;  1B2T A;  1RF2 D;  5FJ8 G;  5HGQ A;  1ILQ A;  4A3F G;  1B7Y B;  3DHQ A;  3W2D A;  3NK9 A;  4QY7 A;  5IYB G;  2E2J H;  1MGS A;  1TR5 A;  4PMC A;  4X64 Q;  1TT2 A;  2BDN A;  4LK1 C;  3RMH A;  4GLX A;  2EYP A;  3HG9 A;  3KF8 A;  1UE6 A;  2VUM G;  1EOV A;  1DJR D;  3H0G H;  4FYD A;  1I4X A;  2E74 C;  4LMQ D;  1S40 A;  3SE0 A;  3FVQ A;  1CHQ D;  3CQZ H;  4OXP A;  5FO7 B;  3K0X A;  2HUG A;  3PCO B;  4OEM B;  1ESR A;  4R8N A;  2CCZ A;  3SK4 A;  3V05 A;  1PHJ A;  1BXT A;  1EWH A;  3CRK C;  2J0T D;  2E2H B;  4A3K H;  4DUY Q;  5E3F A;  2Q8I B;  2RDG A;  4I7Z C;  2RCN A;  1E1O A;  2B2U A;  2NVX B;  1Q1E A;  4KN4 C;  1JWS D;  4A3M B;  1LTR D;  3CCM A;  2XWB B;  4G7Z C;  1CZG A;  4CDE C;  2CW0 C;  3AQQ A;  5E4W C;  5I4D A;  4BA2 I;  1PTO C;  4LF8 Q;  2JEA I;  3J81 i;  1O7L A;  2N8N A;  4JI4 Q;  5C3E B;  2R7Z B;  1QB5 D;  3CC2 A;  3HZX A;  1CUK A;  1EU4 A;  1KAA A;  3G6J B;  3D6W A;  2Z9H A;  3HFZ B;  3K81 C;  4C3I B;  4A3F B;  1EFW A;  4LWC A;  2KJX A;  2VZA A;  5C4X G;  4BXX G;  4JOI C;  3A54 A;  3S1N H;  1JOR A;  4UP8 A;  1PFM A;  1YVC A;  3X3M A;  1EY0 A;  1TS2 A;  1QNU A;  2ENB A;  3M9B A;  3TQY A;  1QVC A;  3TS0 A;  4ODG A;  1A2U A;  1R9T H;  4X62 Q;  2R7F A;  1K0R A;  1SMY C;  1U4L A;  2R7D A;  4LF8 L;  4K5W A;  3S2H B;  3HOU B;  1HNW L;  3ERQ A;  4P73 A;  3S15 B;  3HEJ A;  2E5L L;  1IBM L;  5IOD A;  3IFT A;  2QA4 A;  4APV A;  3PGZ A;  2F0J A;  2R93 B;  2NB0 A;  1UWV A;  2K7V A;  2RCF A;  4NB3 A;  2JA5 B;  4XQQ A;  2OTJ A;  1IW7 C;  3VYR A;  2XN9 C;  2JA8 G;  3AEV A;  3IL8 A;  3PQI A;  2A74 C;  3NWS A;  2YV5 A;  1CI3 M;  3BVG A;  4JI1 Q;  5M3F B;  1VMC A;  2NYZ D;  2N49 A;  1QZH A;  1LTS D;  2KED A;  1V1P A;  3KYH C;  1IXR A;  4UP7 A;  5IGC A;  1EQT A;  5JJI A;  3NTH A;  3H3V C;  4UHV A;  3MFY A;  1X3Q A;  4KKT A;  2MPM A;  4HED A;  4RA8 A;  2ID0 A;  4FXD A;  3Q23 A;  4YHH Q;  1YNN C;  1NMF A;  2FIN B;  3DWQ A;  3G48 A;  4DV0 Q;  3A74 A;  1NY4 A;  2H1E A;  1TQO A;  2MUY A;  4OWX B;  5I2X A;  3P1H A;  3W1G A;  1YBY A;  4LUZ A;  2Z6K C;  3OTO L;  1C0A A;  1A62 A;  3T1H Q;  1GHJ A;  1U4P A;  4K8I A;  2AHO B;  4OEL B;  5I6Y A;  1GO3 E;  4ME3 A;  1SNO A;  1HR0 L;  3AFQ A;  4MN3 A;  3GTM H;  1QVF A;  3F8T A;  1ZEQ X;  2YTV A;  5EBC A;  2JA8 B;  4HIO A;  3BYT B;  1JJG A;  4BBS H;  3HOW G;  1P8L A;  2Y0S B;  5AJ3 Q;  4PQX A;  4OX9 L;  2UXD L;  1KRS A;  1SAP A;  3G6E A;  5K36 H;  4GKJ L;  3J81 j;  4A3J G;  2A6H D;  5EPK A;  3ZYY X;  3S16 B;  1RHP A;  1FNW A;  3TZU A;  4RCO A;  1VF5 C;  3A8J E;  1PLF A;  2P5Z X;  3K5N A;  4JCV E;  2G5D A;  1JR0 D;  3C3L A;  5EQ0 A;  1Y14 B;  3A5Z B;  4JVZ A;  4KD4 A;  4Z9C B;  1SSO A;  5E7N A;  2L5T A;  4LFA Q;  1I94 Q;  5J22 A;  3VR5 A;  2A6E D;  3H91 A;  5JPN C;  4IFD I;  5DM6 3;  1TXY A;  4C3H B;  3FRP B;  5ELN A;  2AQ2 B;  3HOX B;  1KRT A;  1F9P A;  4C3J G;  1UE5 A;  1G6P A;  2B8F A;  2PO4 A;  4DFA A;  1X3E A;  2JJQ A;  1QUQ A;  3C1E A;  4JG2 A;  4HID A;  3U58 A;  1GUW A;  2I46 A;  1EIF A;  1NE3 A;  2JA8 H;  2NVQ H;  3SK8 A;  2A19 A;  2B2Y A;  1H9S A;  2OT2 A;  3VYU A;  2I5L X;  1V1Q A;  4DN4 M;  2EY2 A;  5DLQ E;  4L5R C;  3R2T A;  1MHW C;  2WP8 J;  1S3O A;  1MJC A;  3RD4 A;  1PRT F;  4DV2 L;  4B3R L;  4KHP L;  1PFS A;  2IL8 A;  2ZXR A;  1G2S A;  1S5C D;  4YWL A;  5A35 A;  2JXM B;  4NDX A;  5IT9 E;  4KK7 A;  5CYU A;  3KDF A;  4LF9 Q;  1DCZ A;  3I4N H;  2DY8 A;  3L9A X;  3VA5 A;  1C8C A;  5CV6 A;  4RH6 A;  3NBI A;  2VQF Q;  2DGY A;  4BBS G;  2F3I A;  4DAP A;  1TY2 A;  4X3S A;  4AH6 A;  1JT8 A;  4MHE A;  1FGB D;  2RVL A;  3DMU A;  1PH7 A;  1YNJ C;  1BKB A;  3EBE A;  1BO0 A;  5IOC A;  1RKN A;  4JI3 Q;  1H9K A;  2F0D A;  1VQ6 A;  4R1J A;  1ROD A;  4L63 B;  3D4R A;  4A3J B;  3WOF A;  2QKI C;  4IJL A;  1EFI D;  3RN5 A;  3R93 A;  2K5V A;  4DGZ A;  1FJG L;  4DR3 Q;  1II3 A;  3TME A;  2B63 B;  1VQP A;  1OXT A;  3UE0 A;  3MC0 B;  2N78 A;  3OIQ A;  5IGE A;  4IN3 A;  2KHJ A;  1CKO A;  1M8A A;  4A3G B;  2Z0S A;  2F0T A;  4ZLT F;  1JE5 A;  1HFG A;  1T5X D;  2SNM A;  2V1C C;  4YY3 Q;  2BE5 D;  1CZW A;  1LLR D;  5GQO A;  2KOL A;  3HOU H;  4EQ5 A;  4DK1 A;  3S2H H;  1T5E A;  5BN5 A;  5FKA C;  5C44 B;  4RG1 A;  1UE7 A;  2L1B A;  2BE5 C;  4GN5 A;  3VR4 A;  1LTA D;  5GAH C;  1HA6 A;  1I4G A;  1PRT B;  1SRO A;  3JAM i;  3WDN A;  4F88 A;  1EEF D;  4PZ6 A;  1FNV A;  3S1N B;  3BG3 A;  4RGT A;  2G9H D;  4A4I A;  2K6A A;  3EFX D;  4C3I H;  3HGB A;  3OTO Q;  1PRT D;  1SDF A;  3W3A A;  4BS9 A;  2OQK A;  4WFN 3;  2R7Z H;  3C2P A;  1HTL D;  2E8G A;  5G3L F;  3H09 A;  2AUJ D;  1Q7Y C;  1EEI D;  4DV0 L;  1YHB A;  3P20 A;  1S4Z A;  2NTT A;  4YCV A;  3GTK B;  1PH2 A;  2VQE L;  4GZY C;  1SMX A;  1SYD A;  3V2T A;  4CJ1 B;  4OWW B;  1ONL A;  3MA2 B;  4R4Q A;  5ELO A;  3CCL A;  2AUK A;  5M5W B;  1D8L A;  1E3P A;  4UY8 C;  2WAQ G;  4A3K B;  2PNH A;  3GTJ B;  1OXX K;  1D1K A;  1ENC A;  1TWC H;  4GNX B;  2SOB A;  1LT5 D;  3UDI A;  2LMC B;  4POG A;  1UUP A;  2O4X A;  1HFN A;  1DYQ A;  3M4O H;  2PI2 E;  3A8K E;  2F0P A;  2RDH A;  1VQL A;  2HQL A;  3A7L A;  2EYO A;  4NMZ A;  2PCF B;  5ELB A;  3MXU A;  4X65 L;  2OWO A;  1KAW A;  1U5K A;  2OF1 A;  2NZH A;  5C0X I;  2OTL A;  5K36 G;  4IOA A;  3OSO A;  3QB3 A;  3D4D A;  4O0A A;  2VUM B;  1PTO D;  1KNA A;  3BDL A;  4HCS A;  5IYD G;  3ND8 A;  1PV4 A;  4NXN L;  3HOW H;  3UDF A;  1IBK Q;  1HNW Q;  3F2D A;  4DNR B;  4DR5 Q;  1D6E C;  5JPM C;  3ER0 A;  1EIG A;  4A3E B;  4HIK A;  4NW2 A;  1F9R A;  3PO3 B;  3NQT A;  3I56 A;  2QEX A;  5GAD C;  2EOT A;  4J8Q A;  2B2T A;  4DR2 Q;  1XMO L;  3CMA A;  2XVS A;  2VB2 X;  1I50 H;  2QDL A;  4LFB Q;  3PF4 A;  4CDD C;  2EDG A;  4HSV A;  1I5F A;  5C5L A;  3VYT A;  3TN2 A;  2PQA B;  5JJK A;  1L2F A;  5M9O A;  2PW7 A;  2K04 A;  3P75 A;  3S1M B;  2EYL A;  4WJW A;  5M3M H;  1ENF A;  3DEP A;  3V96 A;  3PIP 3;  1O7Z A;  2UUB L;  3LWU A;  4BY7 H;  2L0C A;  1U4M A;  2F3W A;  2JSO A;  2RSN A;  4BWG B;  1IKM A;  1B1Z A;  2KCN A;  4IUR A;  5C6A A;  1GUN A;  3F2C A;  1I6H B;  4IUT A;  1EWI A;  1PTO B;  1Y1W H;  3QG1 A;  1RTO A;  1L0Y B;  3CC7 A;  2AKW B;  1EOT A;  3KUP A;  3GTG H;  1AEX A;  1HTP A;  1EY6 A;  1C48 A;  2EIF A;  3KLS X;  1HHV A;  4LJZ C;  3LX0 A;  3KLW A;  1STB A;  2ES2 A;  4RKB A;  1VCI A;  3JAM c;  1HA5 A;  3MHB A;  3OOC A;  2BOS A;  3CRL C;  5COY A;  1YNN D;  1YHA A;  2LXJ A;  2E2I B;  1I94 L;  4U68 A;  1O7I A;  5J3B A;  3EIV A;  1MIU A;  3D3R A;  1VQG A;  4IPC A;  1Y8P B;  2KEC A;  2IY5 B;  3KLR A;  5COR A;  5D65 A;  1WD0 A;  1HNX L;  1RDP D;  1X32 A;  2B2W A;  3A8I E;  2R92 B;  4CKC A;  3CP0 A;  3HRZ C;  3GTQ H;  1TWH B;  2WII B;  1SNC A;  5DM7 3;  2F4I A;  1H95 A;  2K5W A;  3KLS A;  4GNX A;  5AJ3 L;  3CCV A;  4OX9 Q;  5C3X A;  4A93 H;  1NBW A;  2D0P A;  1SNQ A;  1FVI A;  2VY3 A;  1Y8O B;  2N55 A;  3I4M B;  3CHB D;  2ZJQ A;  1VQM A;  4DV1 L;  1L1O C;  4IQZ A;  3J80 L;  5IWA L;  5C0X G;  1PXU A;  1JC7 A;  3RN2 A;  4C56 C;  1PMR A;  1ENA A;  1R4P B;  1AP0 A;  4XT3 B;  2QEJ C;  1HQM C;  4JI7 L;  2X6L A;  3S2D H;  3T1H L;  3M4Q A;  1YJW A;  4QUF A;  1ASY A;  1ILP A;  3NEL A;  1PTO F;  3EVQ A;  3K7A H;  3E0E A;  4X6A H;  4H02 A;  3CPW A;  3G7L A;  5IGG A;  4IPH A;  2RBM A;  1AZQ A;  2KVM A;  3I8Z A;  3HOZ B;  5M5Y B;  4MIU A;  5M5Y H;  3UI2 A;  4DR1 Q;  2NUC A;  4BY1 G;  3CCE A;  4EVO A;  4FP5 D;  4C3J H;  4J15 A;  1K83 H;  3BZC A;  1KAB A;  1EU3 A;  3S1Q H;  3KBG A;  3QJY A;  4YWK A;  4HJ5 A;  3K7A B;  4LF7 L;  3U4Z A;  3MXN B;  4HTH A;  4LF9 L;  3NPP A;  4QB4 A;  4N8X 1;  1K9M C;  1JQY D;  2L12 A;  2R93 G;  3TDQ A;  3S2D B;  3G4S A;  2DNE A;  4DV2 Q;  2UUB Q;  3E5S A;  4B3R Q;  4OON A;  5HY6 A;  4IPD A;  1VQC A;  2AMC B;  2UUA Q;  2CKZ B;  4M8A A;  3BJU A;  2MGS A;  2EJF C;  2B39 A;  3I4M H;  2IHE A;  3FDT A;  5K5P A;  4A3B B;  2AWN A;  4L5Q A;  1Q82 C;  3L0O A;  5GAG C;  3K59 A;  3FP9 A;  1K8G A;  1IYU A;  2MHV A;  1IBL L;  1AFP A;  2CFM A;  2R7Z G;  2Q2I A;  3U9S A;  3IRB A;  1SYC A;  4DR2 L;  1XMO Q;  4LUO A;  1GUG A;  1TWH H;  4LF6 L;  3J7A V;  1STH A;  4BBR H;  4A3L H;  2B2U C;  5JEA J;  2F0K A;  5C4J H;  5C4X B;  5IGD A;  4C1N I;  5D3D A;  1K28 A;  1WCM B;  4FF1 A;  4DR6 L;  4CHT B;  4DU9 A;  1WD1 A;  4DAV A;  1DON A;  2F1M A;  1SE2 A;  3R3O A;  3TP6 A;  1Y1W G;  1XTC D;  2WB1 B;  4K2L A;  5I9O A;  4BY1 B;  2NWG A;  3FMC A;  2EY1 A;  3S9W A;  1CSQ A;  3M3Y B;  1BCP F;  3OMC A;  1JE4 A;  4QMG A;  1EIY B;  1XNR Q;  2JEB I;  1SYB A;  4L5S A;  4QUC A;  5E1F A;  4X65 Q;  4XTC S;  2LXK A;  5FK9 C;  1NJI C;  4RMF A;  4BY7 G;  3NQI A;  1HH2 P;  1VQK A;  1VQA A;  1UNS A;  1YEZ A;  4R4O A;  1X3F A;  5M3M G;  3HOY B;  5EKI A;  1STN A;  2F0I A;  3GTG B;  4JI2 L;  2UXC L;  4Q0F A;  1Y1V G;  1BNZ A;  1GUO A;  1XTD A;  3NP8 A;  3SK5 A;  1FGU A;  4EGV A;  1SE8 A;  1N9W A;  1VF7 A;  2N88 A;  4X3T A;  3GD7 A;  2L11 A;  5GAE C;  1KD1 C;  2I07 B;  2DY7 A;  2H4O A;  3HKS A;  4LF4 Q;  4LUV A;  4K0K L;  1KL9 A;  2GVA A;  2C35 B;  1U9R A;  5C3W A;  2EQS A;  1E1T A;  4A3C G;  4DA2 A;  3MFG A;  3H15 A;  5EKL A;  3S17 H;  2DN8 A;  3URY A;  1WI5 A;  1WCM G;  1V43 A;  3I4O A;  2F0U A;  4ZKB B;  1X56 A;  1D2B A;  4ALP A;  2B2W C;  3DWP A;  5IYD H;  4R4I A;  4H44 C;  5LMN W;  1QNK A;  2WB1 G;  4I65 A;  3K58 A;  1V1P B;  4JI8 L;  3G71 A;  1BOS A;  1NMG A;  1CA5 A;  3VA7 A;  1XNQ L;  2F0H A;  3MWY W;  4MTN A;  1EY4 A;  1VQN A;  4DV4 L;  1JOK A;  4KLK A;  3IFD A;  1CKN A;  4JV5 L;  3AFP A;  1QJO A;  3TEH B;  3ITP A;  4HR7 B;  1TY0 A;  4DV3 L;  3H6M A;  2BH8 A;  4YY3 L;  1I3Q B;  2N3S A;  1UE1 A;  4LNQ A;  1I4R A;  1O7Y A;  4P2C B;  3U9O A;  3DM3 A;  3MXP A;  4JI2 Q;  4X3K A;  3CD6 A;  1F2L A;  3C1F A;  4TKO B;  4ZUJ A;  4CDC C;  1PRT C;  2B8G A;  4FXK C;  2CH4 A;  4EQP A;  3OYY A;  4ZKC B;  5I2Y A;  1EY7 A;  1N34 Q;  2O5I C;  1M1K C;  4ABN A;  3OMG A;  4JI6 L;  4NKL A;  2PZU A;  3GO5 A;  2CW0 D;  5EKK A;  4LAA A;  2PW5 A;  4JI3 L;  1IYV A;  3HS0 C;  2A73 B;  3CCS A;  2HQE A;  2EZV A;  5LMU L;  2UUC L;  2GN5 A;  2RDF A;  3IKJ A;  1A2T A;  1H9R A;  1J9O A;  2KBN A;  5CV5 A;  2HIV A;  1TS3 A;  3PSI A;  1N32 Q;  1J5E L;  2B2Y C;  5JEA H;  3GTL B;  2F0O A;  2VQF L;  3GTP H;  1MJE A;  1DOL A;  1VQH A;  3HOU G;  1A3V A;  2K5N A;  2A68 D;  4A3I G;  2VW9 A;  1EYG A;  4PZ8 A;  4PZ7 A;  2WB1 E;  1HUN A;  1FD7 D;  4E6I A;  2IHF A;  2WKD A;  3W1B A;  4KTA A;  4A3E G;  2HD3 A;  1KDC A;  3MZ5 A;  2EXD A;  4K5V A;  3GTO H;  1HXY D;  2A6E C;  4DUY L;  5FLM H;  3NTK A;  3Q0A A;  4FXG C;  3KOJ A;  4B9X A;  1SJH D;  1ET6 A;  2KCT A;  4B08 A;  4LFC Q;  1SMY D;  2XIW A;  2HHH Q;  1LT4 D;  1G6Z A;  1SFO B;  3T1Y Q;  5C44 H;  2IW3 A;  2NVY H;  3A55 A;  4RAU C;  4K6L A;  1QWY A;  3CCR A;  4RGO S;  2EY5 A;  4MZ9 A;  3D31 A;  1N32 L;  4JBW A;  5G3L D;  1N33 Q;  2JA6 B;  4K5X A;  2PI2 A;  4XXE A;  2K5H A;  1ZYR D;  2MO0 A;  3NTI A;  2B2T C;  1N36 Q;  1TKW B;  5FLX L;  4C2M H;  4IUQ A;  5FLX c;  2JQO A;  1EY5 A;  3ULP A;  2B63 H;  1QZG A;  5JEA G;  4HJ7 A;  2LS0 1;  3PO2 B;  3EA6 A;  3BZD B;  4RGN A;  2MNA A;  3CME A;  3MEH A;  1FYC A;  5CV4 A;  4C2M B;  3NBH A;  2F0E A;  1JOO A;  1L1O A;  4GKJ Q;  1W6K A;  2ZTE A;  3A56 A;  1LAC A;  2FMC A;  3SEB A;  2B2V A;  2JA6 H;  2E75 C;  4G4K A;  1SYG A;  4DV1 Q;  1TVX A;  3K57 A;  2NVY B;  3Q6S A;  3RLN A;  4HJ8 A;  2VL6 A;  3VYS A;  3CKI B;  1PH9 A;  3K0Y A;  1Z6H A;  5JJL A;  3MXG A;  1WTR A;  4DUZ L;  4K2K A;  1YJN A;  1D5X C;  4DR7 L;  2L4N A;  1VDZ A;  4QIW B;  4YIJ A;  4B3T L;  3FKI B;  5T1I A;  2FXQ A;  1XMQ Q;  2F3V A;  1HNX Q;  3GTO B;  1C9O A;  3Q24 A;  1AH9 A;  2EYJ A;  4CJ0 B;  3B6Y A;  2K5Q A;  4AQY L;  1PZK D;  4ILW A;  1QE6 A;  1L1O B;  4UAI A;  1EUJ A;  3L3O C;  4YHH L;  3SXH A;  3QO2 A;  3F1Z A;  5TSS A;  4JBJ A;  4HJ9 A;  1T9H A;  2Q2T A;  3HKZ G;  3J81 c;  4B3S L;  5KRU A;  3HOX G;  4LF5 L;  2BDO A;  1K3R A;  4KY5 A;  1CSP A;  2Q8R E;  1X65 A;  2XRS D;  2SNS A;  4QL5 A;  2WKC A;  1X54 A;  1JJC B;  1HZC A;  1B70 B;  4LF4 L;  4N9T A;  2PPB C;  1CKM A;  1OXU A;  5I9P A;  2ZM6 L;  2JA9 A;  2F0G A;  4FO2 A;  5BN4 A;  2X69 A;  1C4Q A;  3PUZ A;  3EN2 A;  2SEB D;  1STE A;  2F52 A;  2B3G A;  4F7X A;  2K32 A;  1CKN B;  2UXC Q;  1TII D;  1GUT A;  3K5O A;  3TP7 A;  4OO1 I;  3HOV G;  1EQV A;  5IP9 H;  3I4N G;  3S16 H;  2D5D A;  1LTT D;  4DV6 L;  1K0S A;  2L55 A;  1W6J A;  1F9Q A;  3TRE A;  3S24 A;  3FEW X;  1I3Q H;  5C4H A;  5FO8 B;  3FPP A;  4KKS A;  1PYB A;  2F0M A;  2KQ3 A;  4BXX H;  2NZ1 D;  1F2Z A;  2Z4H A;  1TWA B;  3PUW A;  1V8Q A;  4HN7 A;  5NUC A;  3TP5 A;  2GVB A;  5C44 G;  2ATW A;  4ZUI A;  4RWS C;  4G7O C;  1XXG A;  5IT9 L;  1Q81 C;  2AQ1 B;  4DR6 Q;  2XGT A;  2JA7 H;  2JP1 A;  3RUZ A;  2KUM A;  4HSP A;  2CQA A;  4JI6 Q;  1SJE D;  3FKI G;  4UPA A;  1JJ2 A;  1SE4 A;  3BDO A;  4DR5 L;  4GS3 A;  3S14 H;  3RNU A;  1N34 L;  1KDA A;  4DV6 Q;  2Z6B A;  2MFI A;  3S1R H;  2RHQ B;  3S17 B;  3FHW A;  4GN3 B;  1H9S B;  4ZRZ A;  1KQS A;  5IP7 G;  2UUA L;  4TSS A;  1ESF A;  3KF6 A;  5CBA E;  4JBM A;  5BR8 L;  3P7J A;  1VQB A;  3CXC A;  1AW7 A;  1PA6 A;  5E4X A;  4DK6 C;  2C5C A;  5M3F H;  2NVT H;  1PFB A;  2K14 A;  1H9J A;  4LF7 Q;  2NZO A;  2XWJ B;  1K8A C;  4DK3 C;  2DNC A;  4A93 G;  1LT3 D;  1WCM H;  2RKS A;  3MVV A;  2YTY A;  1FL0 A;  5C4Z A;  3CCU A;  4Y52 H;  5C4X H;  2OQ0 A;  3UDG A;  2Q2H A;  2K52 A;  2F0L A;  1JB3 A;  2F4V L;  2EVB A;  3STB C;  1LTG D;  1Y69 U;  1JOQ A;  2CHB D;  2J4X A;  5GRO A;  3MTS A;  3DUZ A;  3OHX C;  2ZJR A;  1J8I A;  3RZD H;  1DD2 A;  2K01 A;  2VQE Q;  1VQO A;  1KTK A;  3S15 H;  4OO1 H;  3HOY G;  1JWU D;  4UP9 A;  5DAU A;  1O78 A;  3OWE B;  3KJO A;  2FHT A;  4A3B H;  4AQY Q;  4JI5 Q;  4OL7 A;  2LY7 A;  1R9T B;  4X3U A;  5EAY A;  4EQO A;  4JI0 L;  3BU2 A;  1ZKO A;  1WYD A;  4K0K Q;  5JAV A;  1XMQ L;  4NXM Q;  2BH2 A;  1TS5 A;  1Z9F A;  3T56 B;  1E0B A;  4HCE A;  3ERO A;  1HUM A;  3M4Y A;  1D7Q A;  5C4J B;  1AZP A;  4IO9 A;  2QCP X;  4A3K G;  1IW7 D;  1EYC A;  3TRZ A;  2F0F A;  4XDX A;  5JVG 3;  1PDQ A;  2A5H A;  3SGI A;  2SDF A;  1E22 A;  3A5U A;  2KCM A;  1M4V A;  1QOH A;  3K80 C;  5C3E H;  1WOC A;  4C3J B;  2ICI A;  4JYA Q;  1AE3 A;  3I91 A;  4KV6 A;  1WTV A;  1I4Q A;  1KLU D;  4KY6 A;  3Q22 A;  4H7B A;  4J6H A;  3KDF B;  1KIX A;  2FFK B;  1PYW D;  4DV7 Q;  5JJZ A;  2ASB A;  3DEO A;  4GOP B;  5IYB H;  2HT1 A;  4U67 3;  3T13 A;  3H3V I;  4BBR G;  1U0L A;  3A7A B;  3RZO H;  5FJ8 H;  3RZO B;  1BCP D;  2RF4 A;  3M7G A;  3NEN A;  3R2I A;  4R8I A;  1N36 L;  4GN4 B;  4POF A;  4ZK9 B;  3KJP A;  3M7N A;  1B8A A;  4X66 L;  2F0N A;  3S1Q B;  4V19 0;  2Z4I A;  3PF5 A;  1GOZ A;  1RCV D;  5DEH A;  1A8V A;  1G8Z D;  2Y0S G;  5CV9 A;  2VB3 X;  2L15 A;  3ONA B;  1IKL A;  2F0V A;  1LM0 A;  2EJG C;  1C7Y A;  1QIL A;  3T1Y L;  4QCL A;  3CCQ A;  2HHH L;  5FOB B;  4RFB A;  4GLA C;  4IUV A;  4LFC L;  2E2J B;  4F8M A;  4IFD J;  3VR6 A;  4R4C A;  1VQ4 A;  2A1A A;  1VQF A; 
#chains in the Genus database with same CATH homology
 2EQS A;  1JB7 A;  1E1T A;  4GKK L;  4JI5 L;  5IP7 H;  4A3C G;  2I5L X;  1V1Q A;  1GM5 A;  3H15 A;  5DLQ E;  4L5R C;  3S17 H;  2WP8 J;  1WI5 A;  1S3O A;  1MJC A;  1WCM G;  1V43 A;  3I4O A;  4JI8 Q;  4DV2 L;  4B3R L;  4LF5 Q;  4A3I H;  1PFS A;  4FDB A;  4KHP L;  1X56 A;  2Q2U A;  2BA1 A;  4YWL A;  4ALP A;  1LYL A;  5IYD H;  4R4I A;  3PUX A;  3NEM A;  1HZ9 A;  3PUY A;  5LMN W;  2YU9 H;  3KDF A;  2WB1 G;  4LF9 Q;  2E2I H;  2LSS A;  3I4N H;  1Q46 A;  4DV5 Q;  3ULJ A;  4QJF A;  4JI8 L;  4YCU A;  3G71 A;  1X55 A;  1NMG A;  1WJJ A;  2VQF Q;  1VQE A;  2I5M X;  1XNQ L;  2DGY A;  4BBS G;  3ICE A;  2MO1 A;  2ZTC A;  2F3I A;  3HKZ E;  4MTN A;  1MKH A;  4AH6 A;  1VQN A;  1JT8 A;  4XIG S;  4DV4 L;  4A3F H;  4KLK A;  2UUC Q;  5LMU Q;  2R92 H;  1CKN A;  4A3L G;  4DPG A;  1YI2 A;  1PH7 A;  4JV5 L;  3AFP A;  4EX5 A;  3BZK A;  2JK8 A;  3TEH B;  3U50 C;  2YTX A;  3CCJ A;  1SR3 A;  1BKB A;  3EBE A;  3RR5 A;  1OXS C;  4DV3 L;  5BR8 Q;  4IFD G;  2UU9 L;  2YYZ A;  2WAQ E;  4JI3 Q;  2BH8 A;  4YY3 L;  4O2D A;  1Q86 C;  1GD7 A;  2N3S A;  3H3V H;  1UE1 A;  4LNQ A;  4AYB G;  2KHI A;  1VQ6 A;  4R1J A;  2D0O A;  3DM3 A;  4JI2 Q;  3CD6 A;  4YWM A;  1E24 A;  4KHZ A;  4A3D G;  4A3M H;  4IJL A;  1X3G A;  3HOZ H;  1G51 A;  2NVX H;  3RN5 A;  2K5V A;  3E9H A;  1FJG L;  4DR3 Q;  4JI7 Q;  3OYY A;  5IY0 A;  1AE2 A;  1N34 Q;  3UDX A;  1M1K C;  4NXN Q;  1VQP A;  1OXT A;  3UE0 A;  4B3M Q;  1HZA A;  4A76 A;  5IWA Q;  1A0I A;  2N78 A;  2E2H H;  4JI6 L;  3J7A 5;  2KHJ A;  1S72 A;  1XNR L;  1CKO A;  2OCE A;  3GO5 A;  2Z0S A;  1LUZ A;  1JE5 A;  1PH6 A;  3CPF A;  2JA6 G;  3L7Z C;  2V1C C;  4YY3 Q;  1K73 C;  4JI3 L;  2R92 G;  2R6G A;  3S1M H;  4DV3 Q;  2RHS B;  3U4V A;  2IX0 A;  5GQO A;  3HOU H;  4EQ5 A;  4A75 A;  3I7F A;  3PO3 G;  3S2H H;  4NPS A;  2ZTD A;  4TQU S;  3CCS A;  3ZJY C;  2UXD Q;  3WWV A;  4RG1 A;  1UE7 A;  5LMU L;  2GN5 A;  2UUC L;  3RLF A;  4TVA B;  1SRU A;  4GN5 A;  3J80 i;  4IJH A;  2KBN A;  2HIV A;  5GAH C;  1IZ6 A;  3PO2 G;  1N33 L;  3PSI A;  2JE6 I;  1SRO A;  1N32 Q;  1J5E L;  5M5X H;  3JAM i;  1PYS B;  2IT1 A;  4PG3 A;  4DKA C;  4JI4 L;  1XNQ Q;  2VQF L;  4PZ6 A;  1MJE A;  3GTP H;  1VQH A;  3K8A A;  1PH4 A;  4GOP C;  4A4I A;  3PO3 H;  4QGU A;  3HOU G;  4DV5 L;  4JOI A;  1TWA H;  1DGS A;  2K5N A;  3KF6 B;  1L0W A;  4C3I H;  4A3I G;  1XPO A;  2VW9 A;  1XPU A;  1EYG A;  4PZ8 A;  4PZ7 A;  2CWA A;  2WB1 E;  1TWG H;  3M85 A;  3OTO Q;  2IHF A;  3W1B A;  1X9N A;  2OQK A;  2R7Z H;  1G29 1;  4MNO A;  4A3E G;  2EXD A;  2E8G A;  3GTO H;  2WFW A;  4DUY L;  1PH8 A;  1Q7Y C;  5FLM H;  1HR0 W;  3AYH B;  2UXB L;  2UXB Q;  4DV0 L;  2JA5 G;  3I2Z A;  1GKH A;  1YHB A;  3KOJ A;  4PMW A;  2VUM H;  3GDE A;  4YCV A;  2A8V A;  4HIM A;  1LTL A;  3NBH B;  1PH2 A;  3CC4 A;  2VQE L;  1YNX A;  1SMX A;  3HOZ G;  2KCT A;  1HNZ L;  4OWW B;  4LFC Q;  1BBW A;  1OXV A;  4AYB E;  4Y7N H;  2HHH Q;  1Q8K A;  4R4Q A;  5ELO A;  2BA0 A;  2KEN A;  3CCL A;  3T1Y Q;  2F4V Q;  5C44 H;  3CF5 A;  1D8L A;  1E3P A;  2NVY H;  2VNU D;  4UY8 C;  2WAQ G;  3CCR A;  2PNH A;  1OXX K;  4MZ9 A;  2ZJP A;  4DAY B;  3D31 A;  1N32 L;  1TWC H;  4JBW A;  4GNX B;  1N33 Q;  3UDI A;  2PI2 A;  1Q12 A;  4AIM A;  4POG A;  2K5H A;  1BBU A;  2QGQ A;  4X64 L;  2MO0 A;  1Q1B A;  4DR1 L;  3VDY A;  3M4O H;  1SN8 A;  2PI2 E;  3GTJ H;  1N36 Q;  2IX1 A;  3PV0 A;  4C2M H;  1VQL A;  2HQL A;  1UEB A;  5FLX c;  3RLO A;  2JQO A;  3ULP A;  2B63 H;  3DLL A;  1QZG A;  4LFA L;  5JEA G;  4JC0 A;  4X65 L;  4HJ7 A;  2OWO A;  3L2P A;  5IP9 G;  3UE1 A;  2HIX A;  3HOV H;  1KAW A;  1U5K A;  1I6H H;  5IYC H;  2NZH A;  5C0X I;  2OTL A;  2MNA A;  3CME A;  2B29 A;  3GTK H;  4IOA A;  5K36 G;  4O0A A;  3J7Z C;  3PIP A;  5IYD G;  1PV4 A;  3CAM A;  4B3M L;  4NXN L;  3HOW H;  1YIJ A;  1TWF H;  1L1O A;  2E5L Q;  3UDF A;  4WJ4 A;  4GKJ Q;  4QQB X;  2ZTE A;  1XPR A;  5LMN L;  1IBK Q;  1HNW Q;  1NTG A;  3K7U C;  1RL2 A;  3F2D A;  4DUZ Q;  4DR3 L;  1FJG Q;  2JA6 H;  4DR5 Q;  3ER0 A;  5H1S E;  4HIK A;  5IE8 A;  4DV1 Q;  4P74 A;  1A63 A;  3I56 A;  3CW2 C;  2QEX A;  5M5W H;  3OW2 A;  5GAD C;  3RLN A;  4HJ8 A;  2VL6 A;  5C0X J;  1PH9 A;  3FKI H;  4DAM A;  1HR0 Q;  4LF6 Q;  5IYC G;  4IPG A;  1P16 A;  4P71 A;  4GNX C;  2UU9 Q;  5JJL A;  4DR2 Q;  1XMO L;  2K50 A;  4DUZ L;  3CMA A;  1WFQ A;  1YJN A;  5LMN Q;  1KC8 C;  2JA7 G;  3I4M G;  4DR7 L;  1I50 H;  1ASZ A;  1IBL Q;  4GOP A;  4DR4 L;  4B3T L;  4A3D H;  2FXQ A;  4NXM L;  1XMQ Q;  3J80 c;  3PF4 A;  4LFB Q;  1W2B A;  2H5X A;  1HNX Q;  1I5F A;  4L5T A;  1C9O A;  2PQA B;  5JJK A;  3I55 A;  1L2F A;  4OO1 G;  1AH9 A;  3W5O A;  3B6Y A;  4A3E H;  5M3M H;  4AQY L;  3PUV A;  3KFU A;  1QUQ B;  1L1O B;  2MQH A;  1EUJ A;  2DUD A;  4YHH L;  2UUB L;  5FJ8 G;  3F1Z A;  4BY7 H;  1RIP A;  5HGQ A;  4A3F G;  1B7Y B;  1HZB A;  4JBJ A;  4DNI A;  4HJ9 A;  1E7Z A;  3JC6 6;  4QY7 A;  5IYB G;  1T9H A;  1IYJ B;  2E2J H;  2Q2T A;  3HKZ G;  2NN6 G;  3J81 c;  4X64 Q;  1JMC A;  4B3S L;  3HOX G;  4GLX A;  4LF5 L;  4KHP Q;  1K3R A;  3F2C A;  3PO2 H;  1CSP A;  1KHI A;  4A3M G;  1PVO A;  1UE6 A;  1X65 A;  5M3F G;  4A3J H;  2K4K A;  1EWI A;  4QL5 A;  2VUM G;  4GKK Q;  1Y1W H;  1EOV A;  1X54 A;  3H0G H;  3CC7 A;  1JJC B;  1HZC A;  1B70 B;  2AKW B;  1S40 A;  3GTG H;  4LF4 L;  3CQZ H;  1CKM A;  1OXU A;  4OXP A;  2ZM6 L;  1HNZ Q;  3K0X A;  2JA9 A;  2NN6 I;  2Z6K A;  3PCO B;  2EIF A;  2CCZ A;  3PUZ A;  4A3G H;  3EN2 A;  1PHJ A;  1VQ7 A;  4A3C H;  3KLW A;  1YZ6 A;  1HJP A;  4A3K H;  2F52 A;  2ES2 A;  4DUY Q;  2B3G A;  1VCI A;  3JAM c;  3STB D;  1VQJ A;  1CKN B;  1SFO H;  2UXC Q;  2RCN A;  4B3S Q;  1E1O A;  1VQ5 A;  4X66 Q;  4OO1 I;  3HOV G;  1Q1E A;  5IP9 H;  3D0F A;  3I4N G;  1VQ9 A;  3S16 H;  1YHA A;  2LXJ A;  4DV6 L;  2PQA A;  3CCM A;  1I94 L;  3MEF A;  2B63 G;  1O7I A;  3AQQ A;  5J3B A;  3EIV A;  4BA2 I;  4LF8 Q;  3TRE A;  3S24 A;  2JEA I;  3PIO A;  3J81 i;  1I3Q H;  1MIU A;  1VS0 A;  1VQG A;  2N8N A;  4IPC A;  4JI4 Q;  2IY5 B;  1PYB A;  4DV7 L;  4BXX H;  4P72 A;  3CC2 A;  1CUK A;  1HNX L;  2Y0S E;  3K81 C;  3CP0 A;  3HFZ B;  3PUW A;  1EFW A;  4B3T Q;  4LWC A;  3GTQ H;  4DR4 Q;  4DR7 Q;  2VZA A;  5C4X G;  4BXX G;  4JOI C;  1H95 A;  2GVB A;  2PMZ E;  5C44 G;  4GNX A;  5AJ3 L;  3CCV A;  4OWT B;  4OX9 Q;  3S1N H;  4A93 H;  4UP8 A;  4JYA L;  2ATW A;  3GTL H;  1YVC A;  1NBW A;  1Q81 C;  3M9B A;  3TQY A;  5IT9 c;  4DR6 Q;  2D0P A;  1QVC A;  3TS0 A;  1FVI A;  2VY3 A;  2XGT A;  2JA7 H;  2ZJQ A;  4KI0 A;  2ALY B;  1R9T H;  1VQM A;  4X62 Q;  4DV1 L;  1L1O C;  4JI6 Q;  2R7F A;  1K0R A;  3M4P A;  3FKI G;  5IWA L;  4UPA A;  2R7D A;  5C0X G;  1JJ2 A;  5FLM G;  4LF8 L;  4DR5 L;  3S14 H;  4GS3 A;  3RNU A;  3RN2 A;  1N34 L;  1KXL A;  1HNW L;  4DV6 Q;  4P73 A;  2MFI A;  1SLJ A;  4JI7 L;  3S2D H;  3T1H L;  3S1R H;  2E5L L;  2RHQ B;  3M4Q A;  1IBM L;  1YJW A;  3FHW A;  4GN3 B;  2CQO A;  2QA4 A;  1ASY A;  4APV A;  1QVG A;  4JI0 Q;  1OTC A;  1KQS A;  4A3G G;  3PGZ A;  3NEL A;  5IP7 G;  1PH3 A;  3K7A H;  2UUA L;  3E0E A;  4X6A H;  4H02 A;  1UWV A;  4R4T A;  3CPW A;  3KF6 A;  4NB3 A;  4JBM A;  2OTJ A;  3AEV A;  5BR8 L;  4IPH A;  2JA8 G;  1VQB A;  3CXC A;  4GLV B;  2YV5 A;  1PA6 A;  4JI1 Q;  4DK6 C;  4HJA A;  2K75 A;  5M5Y H;  5M3F H;  1VQ8 A;  2NVT H;  2K14 A;  2N49 A;  4DR1 Q;  1QZH A;  3KYH C;  4LF7 Q;  4BY1 G;  3HOX H;  1IXR A;  2NZO A;  4UP7 A;  4C3J H;  5C3E G;  4J15 A;  1K83 H;  1W3S A;  3BZC A;  5JJI A;  3S1Q H;  1K8A C;  4C3H H;  4DK3 C;  4A93 G;  1WCM H;  2YTY A;  4YWK A;  1FL0 A;  3CCU A;  4HJ5 A;  4Y52 H;  5C4X H;  2OQ0 A;  3UDG A;  4LF7 L;  3U4Z A;  3MXN B;  2Q2H A;  2K52 A;  4LF9 L;  4IOC A;  2F4V L;  3STB C;  3E9I A;  1K9M C;  2ID0 A;  5GRO A;  4JI1 L;  1Z47 A;  2R93 G;  1V9P A;  1J6Q A;  2ZJR A;  3RZD H;  2VQE Q;  3G4S A;  1VQO A;  1BVS A;  3S15 H;  4YHH Q;  4DV2 Q;  1NMF A;  2UUB Q;  3HOY G;  4UP9 A;  2I5H A;  4OON A;  4B3R Q;  5HY6 A;  3G48 A;  4IPD A;  4DV0 Q;  3KJO A;  3A74 A;  1VQC A;  4A3B H;  3ERS X;  4AQY Q;  2AMC B;  2UUA Q;  2CKZ B;  4JI5 Q;  1NY4 A;  3BJU A;  5EAY A;  4OWX B;  1YHQ A;  3TS2 A;  3I4M H;  3W1G A;  2IHE A;  4JI0 L;  1YBY A;  4LUZ A;  2Z6K C;  3BU2 A;  1WYD A;  3OTO L;  2AWN A;  4L5Q A;  4K0K Q;  1Q82 C;  1XMQ L;  4NXM Q;  3L0O A;  2BH2 A;  5GAG C;  1IBM Q;  4LW1 A;  4LFB L;  1C0A A;  3FP9 A;  4YCW A;  1A62 A;  3T1H Q;  1Z9F A;  1PH5 A;  1K8G A;  2CFM A;  1IBL L;  2I0Q A;  2R7Z G;  2Q2I A;  2AHO B;  3IRB A;  3ULL A;  1GO3 E;  4DR2 L;  1XMO Q;  1D7Q A;  2VS1 A;  4ME3 A;  1GVP A;  4LUO A;  4IO9 A;  4A3K G;  1TWH H;  4LF6 L;  1HR0 L;  3AFQ A;  3GTM H;  3TRZ A;  1X6O A;  4BBR H;  4A3L H;  1J5E Q;  5JEA J;  3F8T A;  4X62 L;  1QVF A;  5C4J H;  3SGI A;  2YTV A;  1E22 A;  3A5U A;  2KCM A;  4DR6 L;  4HIO A;  3K80 C;  5C3E H;  4BBS H;  1JJG A;  3HOW G;  1WOC A;  1P8L A;  4P75 A;  5AJ3 Q;  4OX9 L;  1AE3 A;  4JYA Q;  2UXD L;  3H0G G;  1IBK L;  1KRS A;  3G6E A;  1Y1W G;  4GKJ L;  3J81 j;  4A3J G;  1XJV A;  1KIX A;  3KDF B;  4A3B G;  3Q8D A;  1EQR A;  1CSQ A;  4DV7 Q;  2ASB A;  2CWP A;  4GOP B;  1EIY B;  4JCV E;  1XNR Q;  3HOY H;  2JEB I;  5IYB H;  1VQD A;  1IL2 A;  4L5S A;  1YJ9 A;  2HT1 A;  1Y14 B;  3A5Z B;  5E7N A;  4X65 Q;  4LFA Q;  2R93 H;  4XTC S;  2LXK A;  1U0L A;  4BBR G;  1NJI C;  3H3V I;  3F2B A;  4RMF A;  5FJ8 H;  1I94 Q;  3RZO H;  4BY7 G;  1HH2 P;  2RF4 A;  1YIT A;  1VQK A;  1VQA A;  3NEN A;  4IFD I;  1YEZ A;  1EQQ A;  1N36 L;  4GN4 B;  4R4O A;  4POF A;  3KJP A;  4JBK A;  1X3F A;  3M7N A;  1B8A A;  1TXY A;  3A0J A;  4X66 L;  5M3M G;  1N8R C;  5ELN A;  2XTI A;  4JI2 L;  4WJ3 M;  3PF5 A;  3M3Y H;  2UXC L;  1Y1V G;  2D62 A;  1KRT A;  1PH1 A;  1A8V A;  1UE5 A;  1XTD A;  2Y0S G;  4BY1 H;  1G6P A;  2L15 A;  1FGU A;  3CCE A;  1SE8 A;  1N9W A;  3LGJ A;  4BA1 I;  1LM0 A;  1X3E A;  2JJQ A;  1C7Y A;  3T1Y L;  1QUQ A;  1Y1V H;  3GD7 A;  5GAE C;  3CCQ A;  4JV5 Q;  1KD1 C;  4JG2 A;  4HID A;  2ZM6 Q;  3U58 A;  2HHH L;  1EIF A;  1NE3 A;  1VQI A;  2AWO A;  4GLA C;  3HKS A;  4LFC L;  1M90 C;  2JA5 H;  4DV4 Q;  4LUV A;  4LF4 Q;  2JA8 H;  2NVQ H;  4K0K L;  3KF8 B;  4IFD J;  1KL9 A;  2A19 A;  4QIW E;  4R4C A;  1VQ4 A;  2GVA A;  2C35 B;  2A1A A;  1VQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...