2WKCA

Crystal structure from a single-stranded dna binding protein from the lactococcal phage p2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
90
Chain Sequence
b'GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEKGSNVKVAYGSAFLPDFIQLGDTVTVSGRVQAKESGEYVNYNFVFPTVEKVFIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF34P2
publication title Structure and Function of Phage P2 Orf34(P2), a New Type of Single-Stranded DNA Binding Protein.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Dna binding protein
total genus 11
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16773 Phage_SSB Lactococcus phage single-stranded DNA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.400 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2wkcA00
2WKCA 2WKDA
chains in the Genus database with same CATH superfamily
4XYOA 2AWNA 1A3VA 3A8JE 3T1HL 3HRZC 1ESFA 3M4OH 4DUYQ 1WTXA 1QNKA 3MTSA 5IWAL 5M5WH 1HA5A 3ND9A 5LMUL 3S17H 3OIQA 5IOCA 4YY3L 4LUZA 4K14A 4OO1H 2NZHA 1FJGQ 2FMCA 5E7NA 3GTMB 2HDMA 2Y0SG 5ELCA 3GTGH 1QVFA 4JI7L 1I3QH 2PZWA 3SK6A 1U4MA 4XDXA 5CBAE 2B39A 1TVXA 5ELDA 3OMCA 3GO5A 4HEDA 1O7LA 1SFOH 1G8ZD 4KKTA 4LFCL 5IYBH 1VQ8A 4ZQ3A 4J6HA 1PRTF 2CWPA 3M9BA 1MSHA 4N8X1 1L0XB 4YWKA 3S1NB 1D6EC 3Q8DA 1K8AC 3K0XA 2UXBQ 1BCPC 1C48A 2Y0SB 3R93A 5BN4A 1R4QB 5EBDA 3P1HA 2XN9C 2IJ0A 1STNA 1EY7A 2NYZD 5C6AA 2PNRC 1X6OA 2FFKB 3OMGA 4S3SA 3MZ5A 1PMRA 3C3LA 3I4NH 1IZ6A 1L1OA 1VF5C 1AP0A 1WCMG 3VA5A 1R9TH 1X54A 1BUVT 3FKIG 1LUZA 2RA4A 4DR2Q 1OXTA 1SYBA 2RDHA 2WKDA 4P72A 4A76A 2K28A 1MI2A 4DV0Q 1ENFA 1FGUA 1DCZA 5IYDG 2JA6G 4C1NI 1BCPB 4B9WA 1EYCA 4KY5A 2XVSA 4A3KH 4RA8A 5JOBA 1I4RA 4NKLA 1T5XD 1E0BA 2A1AA 4BY7G 1N33L 2N8NA 1EY8A 1WCMB 2C9OA 4DNIA 1H9KA 3PMFA 3I55A 2VUMB 2WB1E 1NSNS 2F52A 2K5DA 3HOVH 3QR8A 2AUKA 4POFA 2RCFA 4YCUA 1PYSB 4U68A 1TIID 4K0KL 3ERQA 3GV6A 3ICEA 1ICWA 2D62A 1PXUA 1FL0A 5CV7A 1Q1EA 1L0YB 4A3LG 4X64L 4FF3A 3MXNB 1I4HA 2CQOA 1MD2D 4UAIA 1H9SB 3WDNA 3FDTA 1JWMD 1CZGA 1YNNC 4I7ZC 1D1IA 4LAAA 1EY4A 4GOPA 1I4QA 2ZTCA 4IOCA 3PO3G 4RH6A 2JA7H 1CI3M 4FDBA 3OTOL 3BVZA 4C3IB 4X3KA 1MBYA 4QGUA 4OHJA 4LF4L 3TS2A 3EIVA 3ERSX 4LFBL 4HMJA 1S4ZA 5DEHA 2F0NA 3D4WA 4LF9Q 4ZRZA 1EYDA 3C1FA 3CHBD 2B8GA 4JI5Q 1B44D 2QILA 1SE4A 3Q24A 2I46A 4BXXG 3TEHB 4K5XA 4A3FH 3ZJYC 2JXMB 1PFSA 1K0SA 3X3NA 2E2IB 4KLKA 2WINB 4A93H 1X56A 2VZAA 1PA6A 4XYQA 1LT6D 4A3BB 3VR4A 3PIP3 4HJ5A 4OL7A 1ILQA 4KKUA 4LNQA 2IL8A 3NUCA 2NVTH 1BCPD 1EY6A 3MAQA 4IFDG 3H15A 1SNOA 3S2HB 1F2YA 3I70A 1A6XA 4H7BA 5C44H 3S15H 1JQYD 1D7QA 4A3CH 2ZJPA 1MSGA 5HURA 4JV5Q 3ONAB 3AEVA 3KF8B 3PO2B 2PQAB 1HNWL 4KTAA 2YTVA 3WOEA 4CDFC 1KQSA 1LTTD 3IFDA 5M3FB 2O2LD 2VB2X 3MA2B 1IBLL 1EQQA 4DR5Q 4KJNA 1FNVA 3KUPA 3CMAA 1XXGA 3J80E 2RF4A 4TSSA 1AN8A 5GAHC 2EYPA 1EOTA 1IBML 4L63B 2QKIC 1HXYD 4DV7Q 3K7UC 4WJWA 1QWYA 5KRUA 3A8IE 2EDGA 5T1IA 4PV1C 4YHHQ 1OTCA 2F0HA 3PIPA 4X3UA 3QO2A 5M5YH 3U9SA 1K83H 4HJ9A 1G2SA 5A2QL 1Q1BA 2A68C 2OCEA 3BDLA 1PH1A 2UUAL 3L0OA 1LTRD 4MN3A 1EQRA 2VUMH 3J7AF 2Q8RE 2TSSA 1D5MC 5GADC 5M3MB 1B7YB 2HCIA 1IYUA 1VQLA 1X55A 2K5HA 5COYA 1JWSD 3QOJA 2PW7A 4ZLTF 1YNND 3ULLA 4G57A 3VYUA 2OXPA 1YIJA 4FXDA 2RSOA 3HOWH 1TWCH 3D6CA 2F0IA 4ALPA 4IUVA 3BG3A 4FVMA 4R4QA 1JJCB 1SR3A 3T56B 4IUTA 3HOZB 3KBGA 4DV6Q 1N32Q 1LT4D 5IY0A 1EWHA 1IKMA 4B9XA 5HGTA 2AQ3B 5DM63 1STBA 2LS01 4LWCA 1GUTA 1A2UA 4J1MA 4CHTB 1NBWA 2WB1B 5GAEC 3K7AH 4RFBA 2JA5H 1X32A 2A6EC 1PDQA 1F9SA 2L4NA 3RZDB 1JC7A 3NK9A 3QB3A 4MIUA 2F4VQ 1D8LA 1OXXK 4IUPA 4F88A 5JPMC 4Q0FA 2F0JA 2MNAA 1VQFA 4JBJA 3HP3A 2QGQA 3KLRA 2UUBQ 1A3TA 1SRUA 1G51A 2D2CC 1OXUA 3K5OA 4DAVA 3G4SA 4DV5L 4ZAIA 1ASYA 2KUMA 2FJ2A 1WTRA 2IX3A 2NVQH 2Z4IA 5IYCH 2NVXB 4DAYB 3JAMi 4K5WA 1PFMA 4LF7Q 4BA1I 4OIKA 3SE0A 3TP7A 4DN4M 5FO9B 1BCPF 2B2YC 4LUOA 3NPPA 3H94A 2F0EA 4B3SQ 3S14H 4JOIA 4DK1A 4JI0L 3HOYB 2BOSA 4BWGB 4NXMQ 3O13A 2RVLA 1Y1VH 1II3A 3OWFA 1HZBA 3FEWX 1ILPA 1S3OA 1RCVD 5IODA 3VA7A 1CQVA 5FJ8H 2QCPX 4Z9CB 4BY1H 1FR3A 5TSSA 1V9PA 2K14A 3SHLA 3RLOA 3CCRA 3CPFA 2YTYA 4IZ8A 2R92G 4X65Q 4WJ3M 3X3MA 5C0XJ 3QWNA 1TWFB 1XNQL 3BZKA 3HOXH 1WTVA 1EYAA 2B2WC 4RMFA 1HH2P 3AFQA 4LF5Q 2A68D 3SVMA 2A6HC 4X3SA 4NXNQ 4KY7A 1YNXA 5FOBB 4A3IH 1PRTC 1ZYRC 2K4KA 4EVOA 5IT9c 1PH6A 1I50B 3LNNA 3P75A 1TS3A 3S2DH 4A75A 1VQ5A 1KRSA 1X3FA 3RNUA 3CKIB 5C0XG 2E2HH 4JI1Q 3OYYA 3S24A 1I6HH 1NAPA 3OHXC 4DV4Q 1HHVA 4R9WA 1QB5D 1G6PA 4KMUC 5FLMH 3NQTA 3DM3A 2KENA 4OX9Q 2RSNA 2ZXPA 3H0GH 2B3GA 2L55A 1NR4A 3L7ZC 2EYFA 3CCSA 3URYA 5C4ZA 5C3EH 4LF8L 4HJ8A 2WFWA 2VQEQ 3KFUA 3UDIA 1G2TA 4R8IA 1TWGB 4A3GG 1U0LA 4JCVE 5K36G 1YHAA 3CC4A 3SGIA 2F0VA 2A8VA 2A6ED 4GKKQ 1B53A 4AQYQ 3TQYA 4A3MB 1ML0D 2KCNA 4RAUC 3NEMA 4IO9A 4IFDI 4A4IA 3TS0A 1QZHA 2EJMA 2F0KA 4K8JA 4C3JG 3SXHA 2KA7A 3V05A 2OQ0A 4A3GB 1X3QA 4BS9A 1M4VA 2VS1A 4ZYSA 2PNHA 2EYLA 4CJ1B 4DR3Q 4OO1G 4WJ4A 4JI3L 4C3JB 5I4DA 2UXCQ 4DV3L 4X6AH 1G291 1Q90A 3IFTA 1GO3E 3M7GA 3JAME 3M4OB 2L0CA 4KV6A 2F0LA 2WAQE 2HT1A 3VDYA 4TVAB 2FHTA 2ZJRA 4RHRA 4R4CA 3GTJH 5JVH3 1S5DD 3MFYA 5ELNA 2MFIA 3S17B 3TMEA 4FF1A 1TS5A 5IP9G 1DJRD 1KIXA 1QG7A 2EYJA 4LJZC 5LHY1 2HIXA 1PTOH 2K5VA 4DR7Q 2DY7A 5EAYA 1M1KC 4RG1A 5IGDA 3GTGB 4UHVA 2O5JC 3VYTA 4E6IA 5EGTA 4C3HH 1OXSC 2DY8A 4JC0A 3CF5A 3AU7A 1GUOA 4OONA 1B4OA 4OELB 4HAEA 1PYWD 3I91A 2A6HD 1SFOB 3NSWA 2Z6KC 1EYGA 4OXPA 1PRTD 4DV1L 1ZYRD 2Q2IA 5FK9C 4HMIA 1V1PB 2LSSA 1DYQA 3CCEA 1KNAA 1K3RA 3CMEA 1BXTA 2LKVA 3K6OA 4LMQD 1NNXA 4EGVA 1VQCA 1W2BA 1VQJA 4EQ5A 5JAVA 4KHPL 2KJXA 3UE1A 2IPKD 1VQEA 3I4NB 2WKCA 3MC0B 2OTJA 5EKLA 5LMNW 3NTKA 1VQMA 1R9TB 2XGTA 4K6DA 2F03A 3A7LA 3E9HA 1EIFA 1VQKA 4MNOA 2JQOA 3IL8A 3W5OA 4KJOA 1FYCA 1LTAD 4DF7A 3VYRA 1J8IA 1S5FD 3AFPA 1F2LA 4O2DA 3RN5A 2RDFA 4A3KB 4FO2A 3MXNA 5IGGA 1Z9FA 3WOFA 1H9SA 3CAMA 2JSOA 1E2ZA 4O42A 4ME5A 1HPCA 3F2DA 3H09A 1QVCA 4POGA 3HOVB 3I4MH 1LTLA 2SDFA 5FLXc 4CKBA 4LK1C 2LFNA 1UEAB 1EOVA 2NN6G 4BBRH 2E5LQ 1VQ4A 2L12A 1GUGA 3A54A 1SNMA 3EN2A 2F0OA 4UP9A 2NB0A 1A3UA 3N52A 1HFNA 1EU3A 2JA7B 3CCUA 1YHQA 4KN7C 4IUQA 3T51B 5C5MA 2K04A 2F0MA 4JI2L 3T1HQ 1HTLD 4HTHA 2B2VC 1KXLA 1ENCA 3PCOB 2RCNA 1BDOA 3PSIA 5A2QE 2ZXOA 1SYFA 5IWAQ 2KCTA 1DONA 4QY7A 2B2TC 5LMUQ 4YY3Q 2BDNA 4RGTA 1WTWA 3AB9A 2L15A 1XMOL 5I9OA 2F0UA 1Q81C 4A3FB 1T5EA 1U4RA 5JEAH 3ND8A 4A93B 1EQTA 1NCVA 3BDCA 2EXDA 2GVAA 3UI2A 4JI7Q 4KN4C 5C0XI 2O4XA 3FVQA 1K28A 2N55A 3LWEA 3TDQA 1K3BC 1BOSA 3E0EA 1GM5A 4LFCQ 4ILWA 2AMCB 3SK4A 2X6GA 3BYYB 5FO7B 2NVTB 3BS1A 2R93H 2C35B 3NWTA 4DXFA 4XT3B 4DK0A 1Q8KA 1EFWA 2PMZE 3M85A 2NVYH 5C44B 3S15B 3I4OA 1C8CA 2Z4HA 4OWTB 3GV3A 1YJNA 1HZ9A 1STAA 4I65A 5AJ3L 1SEBD 3DLLA 3NTHA 3RUZA 2HUGA 1BQQT 4YCVA 1LT3D 2F0FA 5EKKA 1UUPA 1BVSA 4X62L 1LYLA 5BN3A 1HR0W 4JYAQ 4EQNA 4P75A 3KDFB 1DOMA 4GN4B 1A0IA 4A3DH 2R3ZA 2VUMG 3CCJA 2CVRA 5IT9L 1NR2A 2EPBA 3DHQA 3HKZE 2HIVA 4J8QA 4YCWA 2NUCA 1KLUD 3MXPA 3I8ZA 5DNFA 1XTDA 2P5ZX 5M5YB 1K83B 2QF7A 4L5RC 3MXUA 1PHJA 1N33Q 2K03A 2I5MX 4B3RL 4OO1I 2Q2UA 2MUYA 2CH4W 4UP8A 4IJHA 4NMZA 3G7LA 2PZUA 2K05A 1HCZA 2RKSA 3CP0A 5CV8A 1BBWA 2E74C 5A35A 4K0KQ 5LMNL 3W2DA 4GS3A 1Y14B 5M5XH 2HHHL 4NP5A 1UAPA 1WYDA 2MO0A 4C3IG 1TT2A 2AQ2B 5T1GA 4X64Q 1LACA 4GLXA 1PH3A 4PMBA 1CSPA 3HOWB 1TWCB 4FXKC 2L11A 2CW0C 2A73B 1GD7A 5JJIA 4OGQC 1B70B 1E1TA 1GHJA 3K81C 3NQIA 1CFMA 1SXTA 3OTOQ 5ELFA 5I2XA 2YTXA 4LF4Q 2XRSD 1CTMA 4LFBQ 2KVMA 3L3OC 2R61A 3SK8A 3OWEB 3E3XA 5ELEA 3H3VH 2YYZA 4A3BG 3D31A 3K7AB 1IL8A 4P71A 1IL2A 2JA5B 1L2FA 1QUQB 1LM0A 2MQHA 1YI2A 4HCSA 3V2TA 3K80C 3ZYYX 1Q46A 3GTKH 1LTBD 5G3LF 1SNQA 2SOBA 2JA8H 4OEMB 1N9WA 1KLGD 3GTQH 4PG3A 3ULJA 2HQLA 3J80c 5IIFA 5BN5A 4MTKA 4RCOA 3U4VA 1SNDA 4GNXC 2NVQB 4IPHA 1FVIA 3RD4A 1SE3A 2EJGC 2KECA 3PO2G 2DGYA 4GLAC 1YITA 5GROA 2OEOA 1QCBD 4F8MA 3DM1A 5M3FG 1KHIA 1MJCA 5EPLA 2K75A 1Z6HA 3Q22A 4XIGS 4A3JH 2RHSB 3DXJC 3S14B 3CRLC 5C4JB 2Z1CA 3RMHA 4C1NK 4RKBA 4ODGA 3D3RA 2MPMA 1CKMA 2B2YA 2FMMA 4CDEC 1N8RC 4A3EH 1S40A 1V1QA 1HNWQ 4KD3A 3LX0A 3HOXG 1CKOA 1TU2B 1Y1VB 3FPUB 2F3VA 4BY1B 4GNXB 1TWAH 1IBLQ 2YU9H 4GKJL 1PH5A 1VQAA 1HUMA 1YHBA 2A19A 1LTSD 2IWHA 1SE2A 1V1OA 2RBMA 1HA6A 4PQXA 1B50A 1BO0A 1RL2A 2NN6I 5ELOA 1IBMQ 2ICEC 4CDDC 1NMFA 3ER0A 3KLSX 3HOXB 2JA9A 3MXGA 2UU9L 5M3MG 2NWGA 1J5EL 1JOOA 2ID0A 2VW9A 1T9HA 5FLMG 4A3IB 2I07B 3D4RA 1OO9B 3PUXA 2PMZB 2B2WA 3A56A 1HNXL 1B3QA 2UUAQ 4Y52H 4B3TL 3J81L 1D2BA 1WD0A 4H13C 3S2DB 2B2UC 3HOZG 1KABA 2H4OA 1JB7A 1HR0L 1MHWC 2E2HB 3BJUA 3NBIA 2JEBI 4DV7L 1I6HB 1D5XC 3RZOH 1I4XA 2CW0D 2LMCB 3W3AA 3H0GB 3T4AC 1QE6A 2WB1G 2J4XA 1V8QA 4KY6A 3FKIH 5C3EB 2MHVA 1PH7A 3Q23A 1PFNA 3J81j 3S1QH 4PMCA 2CWAA 3PGZA 1RHPA 4JI8L 3T53B 2EE1A 3HEJA 2JA6H 5IYDH 5BR8L 5FLXL 3PV0A 1SJHD 4KD4A 5I6YA 1XX8A 1VQ9A 4QCLA 2G9HD 3CCVA 4I7AA 5FKAC 4X66L 4IURA 1W3SA 2O5IC 1NY4A 4NW2A 2ES2A 5HY6A 4ZKBB 3TZDA 3R8BA 2EY6A 1UE6A 2KQ3A 4DV5Q 1X3EA 4G7ZC 3HOYG 3PIO3 1JICA 4KHVA 3V96A 4A3LH 3GTLH 2A5HA 1PTOC 1DOKA 5EPKA 1VQGA 3DMUA 1Y8PB 1VQHA 4JG2A 4ZK9B 1WVLA 5JPNC 3EVQA 1ENAA 1FGBD 3PO3H 4QL5A 2D5DA 4RWSC 5E1FA 5NUCA 3CU7A 4JI0Q 4C3HG 2KEEA 5C4JH 2PO4A 1TY0A 2IT1A 4JK1C 3GTJB 5IGCA 4JI6L 1STEA 4RGNA 4G4KA 3TP5A 1CHQD 1WTOA 1V1PA 2H1EA 1PTOB 4BXXH 3STBC 1E24A 1Y8NB 4C3HB 4NDXA 1SLJA 4O0AA 5D14A 4OWXB 1PH9A 1E1OA 1TKWB 1XNQQ 1JE4A 4XQQA 4XXEA 1X9NA 3PIOA 1JOQA 1V43A 1H9JA 1SMYC 3I7FA 2Z6KA 4V0BA 3S1RB 1ET9A 2N49A 1GUNA 4IFDH 5EQ0A 4N9PA 5IGFA 4HIOA 1YEZA 4RHSA 4ME3A 2UXDL 4M8AA 1SBBB 5IP7H 4QJFA 4UY8C 1PLFA 2FINB 2Q8TA 4K2KA 1EY0A 4FYDA 5CV6A 4DUZL 3P7JA 1LLRD 5EJWA 2RDGA 3CQZH 1AZQA 1RF2D 3R3OA 4DR6L 1UE7A 3IRBA 4A3MG 5C4XH 2K5WA 4TKOB 2XIWA 2KHIA 2XTIA 4LF8Q 3SK5A 4HJ7A 1ET6A 2OWOA 5KNBA 1RJTA 3G48A 3W1BA 2LXJA 4LW1A 1BBXC 1TWHH 4JBKA 1UEBA 1MJEA 1YVCA 1BBUA 1AE3A 1PZID 2YV5A 3A5ZB 3HFZB 1MIUA 5IGBA 3T1YL 3I4MB 2B63B 3PQIA 1LTGD 2PZTA 3BDOA 3WWVA 1GUSA 3BYTB 1HNZL 1B3AA 2J7ZA 4IPGA 5JEAJ 2SEBD 4H44C 4CBVA 4CJ0B 4IALA 3NTIA 4AYBE 2VQEL 3Q6SA 1O7IA 3I4LA 4L6TB 3E5SA 4BBRB 2MP1A 2XSCA 1CKNB 2VY3A 4BBSH 1JCKB 1JJGA 1PTOD 4DAPA 5KEEA 3K5LA 4B3ML 1XNRL 2CFMA 2F3WA 1FNWA 3OW2A 3U50C 4HIDA 2JE6I 4JI3Q 5DAUA 1HZCA 4DV3Q 1F2MA 3FPPA 1IYJB 1WTPA 2PI2A 4K2LA 3U58A 1J9OA 3BZCA 4F87A 1FNUA 3R2TA 2DNCA 3FMCA 3M7NA 3M3YH 5CV9A 1SNPA 3VR6A 2DJFC 1MKHA 3J80L 2B2VA 4PZ7A 1VCIA 1KC8C 1RODA 2UUCQ 3OSOA 1GKHA 2Z6BA 2OTLA 1IW7C 3TP6A 3D4DA 4JI4L 1LTID 5IYBG 3J7A5 1HRJA 3VR2A 4JVZA 3STBD 2B2TA 3I3CA 1S72A 3W1GA 3HOUH 2RQXA 3VR3A 3F8TA 1F77A 5KNDA 4ULLA 2Y0SE 4DNRB 3TREA 5EBCA 2EYMA 5CGKA 1WTQA 1ONLA 2F1MA 5CV4A 1SE8A 4DV1Q 1G91A 1EU4A 1SMYD 2R93B 2CQAA 2ZTEA 3I4NG 1U4LA 1VMPA 2M2LA 2Q8IB 2PW5A 2NVYB 4GN5A 3QOLA 1Q7YC 4DA2A 3S1RH 4ZUIA 2HQEA 1XPOA 4N9TA 1F2ZA 1YZ6A 1B9NA 1LT5D 2F0DA 2QEJC 4DR4L 2B8FA 1PYBA 3FHWA 1KDAA 4DNTB 1C4QA 4UDUC 3K59A 4KHPQ 2AUJD 5H1SE 1DGSA 4K8IA 4Y7NH 4A3KG 2F4IA 4CDCC 1R4PB 2ZXRA 2EY5A 4C2MH 3J81c 1N34L 3E0JA 3DWAA 4A3DB 1CT1D 3NE5B 2VQFL 3GP7A 3HS0C 3HOVG 2R92H 2IX0A 2L5TA 1XMQL 3U4ZA 2MJ8A 5J1ZA 2ZM6L 2D0PA 1CHPD 4LF6L 1S5BD 2NZOA 1I94L 4JBWA 2L9HA 2SNMA 1AZPA 1IXRA 2Q2HA 1E22A 3NP8A 2IY5B 4PZ8A 4DXGA 4K6LA 3KLSA 4HSPA 1CA5A 4YWMA 1TY2A 4RGOS 4GZYC 1NE3A 2PYKA 2B63H 2K52A 3H3VC 1EEFD 1HTPA 2K50A 2JA7G 1N36L 2F0WA 5M5XB 1PZKD 2K1BA 1EIGA 3I56A 5AFWA 4XTCS 1AH9A 2GA4B 2N78A 2E2JH 1PTOF 2K32A 5CR3A 3AMUA 3H6MA 1KDBA 3PF4A 4QIWE 1Y1WB 1U4PA 5J39A 1DZ1A 3CCLA 3CC2A 1QNUA 3KF6B 3MEHA 2B29A 2XWBB 4JI2Q 1GVPA 4A3FG 4EX5A 2DUDA 3LWUA 1O7YA 1VQOA 4A93G 5K36H 2IHFA 5C3XA 1JORA 1IW7D 2AWOA 1A62A 2WV6D 1B8AA 4OWWB 2XWJB 1KD1C 2X69A 2BCOA 1JT8A 3GTPH 4DV2L 3OOCA 1XMOQ 3RLFA 4AYBB 3GTKB 3NBHB 2NZ1D 5G3LD 4IQZA 3S1MH 1PZJD 3C46A 1TR5A 2C5CA 1I4PA 3D8GA 1IBKL 2JA8B 2GVBA 4LFAL 3GTQB 2WAQG 2WIIB 4DR1L 4CKEA 5E3FA 5C44G 1H9MA 3KF8A 4DUYL 4A3EG 1Y69U 4A3CG 2ALYB 4HN7A 4MZ9A 2PQAA 3G6JB 1RDPD 1XWEA 2AKWB 4R1JA 4ZCKA 4GNXA 2CH4A 5FLXE 2R6GA 4A3JB 5ISRA 1KRTA 5DM73 1C7YA 1FJGL 2WAQB 1A8VA 1E3PA 3RLNA 1EZ8A 3OIPA 4A3EB 1SYGA 2JN4A 3JC66 5AJ3Q 4IJLA 2EOTA 5KYIA 5JJLA 1B1ZA 1NMGA 5M9OA 1O80A 3MWYW 3N6RA 1TWAB 2I0QA 4X62Q 2YU9B 5IP9H 4MTNA 1SYCA 3FP9A 1IYVA 2CCZA 3A8KE 3SEBA 3TN2A 4DK3C 3HGBA 4H02A 1EIYB 5E4WC 4J15A 2R7ZH 2UXBL 1QJOA 1SYEA 2TMPA 1K8GA 2OF1A 4R8NA 3F2UA 2QDBA 1B2TA 3GDEA 2G5DA 5L37A 3UE0A 3GQBA 3J80i 2EYOA 3K0YA 3F2BA 1CM9A 1RIPA 4B3RQ 4KKSA 3PUVA 4R4IA 1EY5A 3HOWG 2OQKA 2PCFB 2BA1A 4PZ6A 4JYAL 4P74A 3T16A 2D9UA 1H95A 1U9RA 1K8MA 3T13A 1C9OA 3UDFA 5CYUA 5LMNQ 4DR2L 2F0GA 2GN5A 3QIAA 5JVG3 1X65A 2HHHQ 4DV0L 4NB3A 2B2UA 4XQJA 3QG1A 3SR1A 1OXVA 3BVMA 3EBEA 3RZOB 3EJIA 4C56C 3EFXD 5KGUA 2KBNA 3KK7A 3JAML 2CHBD 2KOLA 1CQFA 3D0FA 2JA5G 3FKIB 1Y8OB 1XTCD 1VMCA 2HDLA 3U9OA 1Y1WH 3S1QB 1BKBA 2E76C 2JA6B 2ZT9C 4QF4A 4L8JA 2N88A 5KNCA 5LL6S 2EIFA 1ESRA 3IKJA 3S16H 4DPGA 1QZGA 4DAYA 1K8OA 2E2DC 4BY7B 5IYCG 4IUNA 2QDLA 4EQOA 1TS4A 1RTNA 4YIJA 1K9MC 1SYDA 5E4XA 3IAYA 1VQBA 1Q3LA 2AQ1B 1VF7A 2RHQB 1PVOA 3D6WA 2NN6H 3BZDB 1JR0D 5C4HA 1S5ED 2N3SA 4N8FA 3GTLB 1VDZA 4QIWB 1UE1A 3NXWA 2EJFC 1E7ZA 4HSVA 1HJPA 1Y1VG 4LF9L 4KHZA 4JI5L 3CRKC 5FJ8G 4IFDJ 4BY1G 3PO3B 3KOJA 4XT1B 1SJED 1LV9A 3DWPA 2F0QA 1UE5A 3GTMH 1RD9D 1HQRD 2CKZB 3M4PA 4XQNA 1QILA 3KJOA 2EXZA 2I5HA 3FRPB 2QEXA 1KDCA 1AW7A 2M00A 4GKJQ 1DD2A 2IW3A 4A3IG 3HG9A 4PNYA 3OW7A 3A5UA 3EA6A 1RKNA 3S1NH 1P8LA 5IP7G 3TBIB 5EKIA 2NTSA 2HD3A 3C2PA 2NTTA 4HCEA 1VQ7A 1QOHA 4HR7B 4IOAA 2EY1A 4X3TA 2UU9Q 1O78A 1Z7TA 1J5EQ 4V190 1WJJA 3P20A 3H3VI 2ZTDA 4JV5L 2F0TA 1L1OC 2E75C 3CD6A 4ZKCB 3NENA 1HNXQ 1XPUA 5C4XG 3H0GG 4L5TA 3S9WA 4B3TQ 3KYHC 4GLVB 3KJPA 1CZWA 2NBFA 3HKZG 5C3EG 4DR5L 4KI0A 3I90A 5FO8B 4GN3B 1HR0Q 1A2TA 4O1NA 1YNJC 4RGMA 2JP1A 3CQZB 1EFID 4YHHL 3L2PA 2M9VA 5C4XB 5IGEA 5CBEE 3DEOA 2JEAI 4AH6A 5JJZA 3A55A 1WCMH 1L1OB 3HKZB 3A0JA 2MGSA 4IN3A 5J3BA 4APVA 3LGJA 2XRQD 1NJIC 3L9AX 4JI8Q 4DFAA 1CKNA 5BR8Q 1TWHB 4CKCA 3MFGA 2Q2TA 1JOKA 4BBSG 4ABNA 2K01A 1GXDC 4UPAA 2EZVA 4LUVA 2R7DA 4CGYB 4G7HC 2KCCA 3NELA 4GOPC 1PH2A 3DUZA 4YWLA 4BY7H 4X66Q 3BU2A 1NUCA 4WRDA 2VXWA 1STYA 3I73A 1VQIA 1BF4A 3GD7A 5IE8A 4DV6L 1N32L 1F9QA 4Q5VA 4BBSB 1STGA 2R7FA 4C3IH 1CA6A 1EZ6A 1GHKA 2VNUD 1WD1A 1KNEA 3K58A 1I6VC 2BDOA 2VL6A 3F1ZA 5CMDA 1Q12A 2X6LA 4GOPB 2F4VL 3HOUG 1EL0A 1QVGA 2BE5C 5J22A 3M3YB 1W6KA 1VS0A 3K8AA 2KHJA 2V4DA 1YBYA 2E2IH 1YJ9A 2UUBL 4JI6Q 2A69C 2PPBC 1JB3A 1SDFA 2E8GA 4AIMA 4A3BH 1JJ2A 2BH2A 1F9PA 1Q82C 4DKAC 4QQBX 4LF7L 3HOUB 1GOZA 3NHHA 3TZUA 3S2HH 4FNFA 4B3SL 4JBMA 1EUJA 3CCMA 1E2VA 1GUWA 4HIKA 5KYLA 5HGQA 3CW2C 1WOCA 4NXML 3PO2H 2JJQA 1A63A 3ITPA 4ZUJA 1WFQA 2ICIA 4DGZA 3Q0AA 5M3FH 2UXDQ 4BA2I 1AEXA 2K7VA 3A7AB 1FD7D 2FXQA 3AYHB 1SN8A 4X65L 1YNJD 3MEFA 1VQNA 4Y7NB 3R2IA 4DUZQ 1MGSA 2K6AA 4C2MB 2BA0A 4DR6Q 2ATWA 4LF5L 2EQSA 1HFGA 1W6JA 4NXNL 3K5MA 1PH8A 3K5NA 3I4MG 2R92B 2B63G 1X3GA 4WORA 3J7YW 2OT2A 3CPWA 1E2WA 2F0PA 2H5XA 3HZXA 2WACA 3A74A 1U5KA 1Q8IA 5CV5A 5M3MH 4BBRG 3JAMc 5CC4A 5K5PA 3J7ZC 2JK8A 4G7OC 1ASZA 2VB3X 2F0SA 4JI1L 4DV4L 4MHEA 1CSQA 4B08A 3T1YQ 4RKLA 5C5LA 3KF6A 4OX9L 2KEDA 3GTOB 1ZXTA 1HNZQ 2L1BA 4IPDA 3DEPA 1JMCA 4FXGC 2DNEA 1BNZA 2XNAC 1PRTB 1PH4A 3HOZH 1XYIA 4KK7A 4PMWA 4B3MQ 2E2JB 3G71A 3MHBA 1XNRQ 4IUUA 1SSOA 4P2CB 3UDGA 2G9DA 4FF2A 4IPCA 1EEID 4GKKL 4AQYL 5I9PA 5IT9E 1O7ZA 2K5QA 1DOLA 3NBHA 3VR5A 1GJXA 4QMGA 1JE5A 3TSSA 2BE5D 1M8AA 3RN2A 3RZDH 3J81i 2QA4A 1EWIA 5JEAG 5C3WA 2A69D 5DLQE 1JWUD 2PI2E 1SMXA 3C1EA 1TQOA 2Z8LA 1AE2A 4QUCA 3PUWA 1VQDA 1BR9A 4JI4Q 1AFPA 3GTPB 5CORA 4HIMA 2NVXH 2D0OA 2R93G 4DR3L 5LL6X 3S1MB 4JOIC 1PFBA 2KHSA 2UXCL 1KAWA 1HUNA 2WP8J 3E9IA 4FF4A 4H0LC 1H9RA 2IX1A 2MO1A 3VYSA 3NWSA 3M4QA 2HCCA 3EQLC 3CC7A 3HOYH 4CJ2C 5M5WB 2EY2A 2UUCL 2PQEA 4FP5D 1HQMC 3EROA 1SNCA 2J0TD 4L5SA 3KDFA 1TXYA 2ENBA 2AHOB 1Z47A 4A3DG 3CCQA 1EIHA 4R4TA 2R7ZG 2I5LX 4UP7A 4DR7L 4DR4Q 1DM0B 1I3QB 3I2ZA 4U673 3TP8A 5GAGC 1KL9A 3M4YA 3CXCA 1K73C 3TRZA 4OIJA 1TWFH 4L5QA 4DK6C 1N34Q 4HJAA 5D65A 2F3IA 1I4GA 1IKLA 4ID6A 1KTKA 2VQFQ 2R7ZB 3B6YA 5KIXA 2DN8A 1YJWA 1XMQQ 1C0AA 1PV4A 1I50H 2Z0SA 1SROA 2ZM6Q 1Q86C 2BH8A 4JPBW 4DU9A 1LABA 4LF6Q 4QB4A 1STHA 5I6WA 1IHZA 1I94Q 1DXMA 1WTHA 3OPOA 1CUKA 4DAMA 5JJKA 3KLWA 1A15A 1VQPA 3PF5A 1D1KA 1ZEQX 2EYHA 2QW7A 2ASBA 5I2YA 3SDZA 4P73A 4WFN3 1CK1A 3QJYA 4M1UB 2Z9HA 1VQ6A 2K5NA 1ICFB 2IHEA 3I72A 5F2DA 1G6ZA 2LY7A 1Y1WG 2V1CC 3H91A 5ELBA 1LO5D 3GTOH 2SNSA 1N36Q 1D5ZC 1I5FA 4EQPA 4K5VA 3DWQA 3G6EA 3HKSA 1M90C 1EWCA 1F9RA 3AQQA 5EPJA 5GQOA 4QUFA 1NTGA 3J7AV 1B9MA 1TS2A 5D3IB 1TWGH 5C0XH 2ZJQA 2A74C 1RTOA 4R4OA 1UWVA 1S5CD 1HZAA 1X3PA 1QUQA 3E6ZX 3K57A 1K0RA 4A3MH 3UDXA 4JW0A 1XJVA 4TQUS 5D3DA 1XPRA 3F2CA 4AYBG 4RCNA 2LXKA 1EY9A 2K33A 3MVVA 3PUZA 2JA8G 2KCMA 4A3GH 3S16B 4F7XA 3KBXA 1ZKOA 4NPSA 2E5LL 1UNSA 1J6QA 3J81E 3PUYA 4DV2Q 1P16A 2EVBA 3RR5A 3ULPA 2JYOA 3BVGA 4TRDA 1KAAA 1EQVA 1WI5A 1IBKQ 4C3JH 4A3JG 4LFAQ 1L0WA 2DJGC 4DR1Q 1SAPA
chains in the Genus database with same CATH topology
4XYOA 2AWNA 1A3VA 3A8JE 3HRZC 1ESFA 1WTXA 1QNKA 3MTSA 1HA5A 3ND9A 3OIQA 5IOCA 4K14A 4OO1H 2FMCA 3GTMB 2HDMA 5ELCA 2PZWA 3SK6A 1U4MA 4XDXA 5CBAE 2B39A 1TVXA 5ELDA 3OMCA 3GO5A 4HEDA 1O7LA 1G8ZD 4KKTA 4ZQ3A 4J6HA 1PRTF 1MSHA 1L0XB 3S1NB 1D6EC 1BCPC 1C48A 2Y0SB 3R93A 5BN4A 1R4QB 5EBDA 3P1HA 2XN9C 2IJ0A 1STNA 1EY7A 2NYZD 5C6AA 2PNRC 2FFKB 3OMGA 4S3SA 3MZ5A 1PMRA 3C3LA 1VF5C 1AP0A 3VA5A 1BUVT 2RA4A 1OXTA 1SYBA 2RDHA 2WKDA 2K28A 1MI2A 1ENFA 1DCZA 4C1NI 1BCPB 4B9WA 1EYCA 4KY5A 2XVSA 4RA8A 5JOBA 1I4RA 4NKLA 1T5XD 1E0BA 1EY8A 1WCMB 2C9OA 1H9KA 3PMFA 2VUMB 1NSNS 2K5DA 2AUKA 4U68A 1TIID 3ERQA 3GV6A 1ICWA 2D62A 1PXUA 5CV7A 1Q1EA 1L0YB 4FF3A 1I4HA 1MD2D 4UAIA 1H9SB 3WDNA 3FDTA 1JWMD 1CZGA 1YNNC 4I7ZC 1D1IA 4LAAA 1EY4A 1I4QA 4RH6A 1CI3M 3BVZA 4C3IB 4X3KA 1MBYA 4OHJA 4HMJA 1S4ZA 5DEHA 2F0NA 3D4WA 4ZRZA 1EYDA 3C1FA 3CHBD 2B8GA 1B44D 2QILA 1SE4A 3Q24A 2I46A 4K5XA 2JXMB 3X3NA 2E2IB 2WINB 4XYQA 1LT6D 4A3BB 3VR4A 3PIP3 4OL7A 1ILQA 4KKUA 2IL8A 3NUCA 1BCPD 1EY6A 3MAQA 4IFDG 1SNOA 3S2HB 1F2YA 3I70A 1A6XA 4H7BA 1JQYD 1MSGA 5HURA 3ONAB 3PO2B 4KTAA 3WOEA 1LTTD 3IFDA 5M3FB 2O2LD 2VB2X 3MA2B 4KJNA 1FNVA 3KUPA 1XXGA 3J80E 4TSSA 1AN8A 2EYPA 1EOTA 4L63B 2QKIC 1HXYD 4WJWA 1QWYA 5KRUA 3A8IE 2EDGA 5T1IA 4PV1C 2F0HA 4X3UA 3QO2A 3U9SA 1G2SA 5A2QL 1Q1BA 2A68C 3BDLA 1LTRD 4MN3A 3J7AF 2Q8RE 2TSSA 1D5MC 5M3MB 2HCIA 1IYUA 5COYA 1JWSD 3QOJA 2PW7A 4ZLTF 1YNND 4G57A 3VYUA 2OXPA 4FXDA 2RSOA 3D6CA 2F0IA 4IUVA 3BG3A 4FVMA 3T56B 4IUTA 3HOZB 3KBGA 1LT4D 1EWHA 1IKMA 4B9XA 5HGTA 2AQ3B 5DM63 1STBA 2LS01 1GUTA 1A2UA 4J1MA 4CHTB 2WB1B 4RFBA 1X32A 2A6EC 1PDQA 1F9SA 2L4NA 3RZDB 1JC7A 3NK9A 3QB3A 4MIUA 1OXXK 4IUPA 4F88A 5JPMC 4Q0FA 2F0JA 3HP3A 3KLRA 1A3TA 2D2CC 1OXUA 3K5OA 4DAVA 4ZAIA 2KUMA 2FJ2A 1WTRA 2IX3A 2Z4IA 2NVXB 4K5WA 1PFMA 4BA1I 4OIKA 3SE0A 3TP7A 4DN4M 5FO9B 1BCPF 2B2YC 3NPPA 3H94A 2F0EA 4DK1A 3HOYB 2BOSA 4BWGB 3O13A 2RVLA 1II3A 3OWFA 3FEWX 1ILPA 1RCVD 5IODA 3VA7A 1CQVA 2QCPX 4Z9CB 1FR3A 5TSSA 3SHLA 4IZ8A 3X3MA 5C0XJ 3QWNA 1TWFB 1WTVA 1EYAA 2B2WC 2A68D 3SVMA 2A6HC 4X3SA 4KY7A 5FOBB 1PRTC 1ZYRC 4EVOA 1I50B 3LNNA 3P75A 1TS3A 3CKIB 5C0XG 1HHVA 1NAPA 3OHXC 4R9WA 1QB5D 4KMUC 3NQTA 2RSNA 2ZXPA 2L55A 1NR4A 3L7ZC 2EYFA 3URYA 5C4ZA 1G2TA 4R8IA 1TWGB 5K36G 2F0VA 2A6ED 1B53A 4A3MB 1ML0D 2KCNA 4RAUC 4IFDI 2EJMA 2F0KA 4K8JA 4C3JG 3SXHA 2KA7A 3V05A 4A3GB 1X3QA 4BS9A 1M4VA 4ZYSA 2EYLA 4CJ1B 4OO1G 5I4DA 4C3JB 1G291 1Q90A 3IFTA 3M7GA 3JAME 3M4OB 2L0CA 4KV6A 2F0LA 2FHTA 4RHRA 5JVH3 1S5DD 3MFYA 3S17B 3TMEA 4FF1A 1TS5A 1DJRD 1QG7A 2EYJA 4LJZC 5LHY1 1PTOH 2DY7A 2O5JC 5IGDA 3GTGB 3VYTA 4E6IA 5EGTA 1OXSC 2DY8A 3AU7A 1GUOA 1B4OA 4HAEA 1PYWD 3I91A 2A6HD 1SFOB 3NSWA 1PRTD 1ZYRD 5FK9C 4HMIA 1V1PB 1DYQA 1KNAA 1BXTA 2LKVA 3K6OA 4LMQD 4EGVA 5JAVA 2KJXA 2IPKD 3I4NB 2WKCA 3MC0B 5EKLA 3NTKA 1R9TB 4K6DA 2F03A 3A7LA 3IL8A 4KJOA 1FYCA 1LTAD 4DF7A 3VYRA 1J8IA 1S5FD 1F2LA 2RDFA 4A3KB 4FO2A 3MXNA 5IGGA 3WOFA 1H9SA 2JSOA 1E2ZA 4O42A 4ME5A 1HPCA 3H09A 3HOVB 2SDFA 4CKBA 4LK1C 2LFNA 1UEAB 2NN6G 2L12A 1GUGA 3A54A 1SNMA 2F0OA 2NB0A 1A3UA 3N52A 1HFNA 1EU3A 2JA7B 4KN7C 4IUQA 3T51B 5C5MA 2K04A 2F0MA 1HTLD 4HTHA 2B2VC 1ENCA 1BDOA 5A2QE 2ZXOA 1SYFA 1DONA 2B2TC 2BDNA 4RGTA 1WTWA 3AB9A 5I9OA 2F0UA 4A3FB 1T5EA 1U4RA 5JEAH 3ND8A 4A93B 1EQTA 1NCVA 3BDCA 3UI2A 4KN4C 5C0XI 2O4XA 3FVQA 2N55A 3LWEA 3TDQA 1BOSA 4ILWA 3SK4A 2X6GA 3BYYB 5FO7B 2NVTB 3BS1A 3NWTA 4DXFA 4XT3B 4DK0A 3M85A 5C44B 3S15B 1C8CA 2Z4HA 3GV3A 1STAA 4I65A 1SEBD 3NTHA 3RUZA 2HUGA 1BQQT 1LT3D 2F0FA 5EKKA 1UUPA 5BN3A 4EQNA 1DOMA 2R3ZA 2CVRA 5IT9L 1NR2A 2EPBA 3DHQA 4J8QA 2NUCA 1KLUD 3MXPA 3I8ZA 5DNFA 5M5YB 1K83B 2QF7A 3MXUA 2K03A 4OO1I 2MUYA 4NMZA 3G7LA 2PZUA 2K05A 1HCZA 2RKSA 5CV8A 2E74C 5A35A 3W2DA 4NP5A 1UAPA 4C3IG 1TT2A 2AQ2B 5T1GA 1LACA 4PMBA 3HOWB 1TWCB 4FXKC 2L11A 2CW0C 2A73B 4OGQC 1GHJA 3NQIA 1CFMA 1SXTA 5ELFA 5I2XA 2XRSD 1CTMA 2KVMA 3L3OC 2R61A 3SK8A 3OWEB 5ELEA 2YYZA 3D31A 3K7AB 1IL8A 2JA5B 4HCSA 3V2TA 3ZYYX 1LTBD 5G3LF 1SNQA 2SOBA 1KLGD 5IIFA 5BN5A 4RCOA 1SNDA 2NVQB 3RD4A 1SE3A 2EJGC 2KECA 2OEOA 1QCBD 4F8MA 3DM1A 5EPLA 3Q22A 1Z6HA 4XIGS 3DXJC 3S14B 3CRLC 5C4JB 2Z1CA 3RMHA 4C1NK 4RKBA 4ODGA 3D3RA 2MPMA 2FMMA 2B2YA 4KD3A 3LX0A 1Y1VB 1TU2B 3FPUB 2F3VA 4BY1B 1HUMA 1LTSD 2IWHA 1SE2A 1V1OA 2RBMA 1HA6A 4PQXA 1B50A 1BO0A 2NN6I 2ICEC 3KLSX 3HOXB 3MXGA 2NWGA 1JOOA 2ID0A 4A3IB 2I07B 3D4RA 1OO9B 3PUXA 2PMZB 2B2WA 3A56A 3J81L 1D2BA 1WD0A 4H13C 3S2DB 2B2UC 1KABA 2E2HB 3NBIA 2JEBI 1I6HB 1D5XC 1I4XA 2CW0D 2LMCB 3W3AA 3H0GB 3T4AC 1QE6A 2J4XA 1V8QA 4KY6A 5C3EB 2MHVA 3Q23A 1PFNA 4PMCA 1RHPA 3T53B 2EE1A 3HEJA 5FLXL 3PV0A 1SJHD 4KD4A 5I6YA 1XX8A 4QCLA 2G9HD 5FKAC 4IURA 2O5IC 4NW2A 4ZKBB 3TZDA 3R8BA 2EY6A 2KQ3A 4G7ZC 3PIO3 1JICA 4KHVA 3V96A 2A5HA 1PTOC 1DOKA 5EPKA 3DMUA 1Y8PB 4ZK9B 1WVLA 5JPNC 3EVQA 1ENAA 1FGBD 2D5DA 4RWSC 5E1FA 5NUCA 3CU7A 4C3HG 2KEEA 2PO4A 1TY0A 2IT1A 4JK1C 3GTJB 5IGCA 1STEA 4RGNA 4G4KA 3TP5A 1CHQD 1WTOA 1V1PA 2H1EA 1PTOB 1Y8NB 4C3HB 4NDXA 5D14A 1TKWB 1JE4A 4XQQA 4XXEA 1JOQA 1V43A 1H9JA 1SMYC 4V0BA 3S1RB 1ET9A 1GUNA 4IFDH 5EQ0A 4N9PA 5IGFA 4RHSA 4M8AA 1SBBB 1PLFA 2FINB 2Q8TA 4K2KA 1EY0A 4FYDA 5CV6A 3P7JA 1LLRD 5EJWA 2RDGA 1AZQA 1RF2D 3R3OA 2K5WA 4TKOB 2XIWA 3SK5A 1ET6A 5KNBA 1RJTA 1BBXC 1PZID 5IGBA 3I4MB 2B63B 1LTGD 2PZTA 3BDOA 1GUSA 3BYTB 1B3AA 2J7ZA 5JEAJ 2SEBD 4H44C 4CBVA 4CJ0B 4IALA 3NTIA 3Q6SA 3I4LA 4L6TB 3E5SA 4BBRB 2MP1A 2XSCA 1JCKB 1PTOD 4DAPA 5KEEA 3K5LA 2F3WA 1FNWA 2JE6I 5DAUA 1F2MA 3FPPA 1WTPA 4K2LA 1J9OA 4F87A 1FNUA 3R2TA 2DNCA 3FMCA 3M7NA 5CV9A 1SNPA 3VR6A 3J80L 2B2VA 1VCIA 1RODA 3OSOA 1IW7C 3TP6A 3D4DA 1HRJA 1LTID 3VR2A 2B2TA 3I3CA 2RQXA 3VR3A 1F77A 5KNDA 4ULLA 4DNRB 5EBCA 2EYMA 5CGKA 1WTQA 1ONLA 2F1MA 5CV4A 1G91A 1EU4A 1SMYD 2R93B 2CQAA 1U4LA 1VMPA 2M2LA 2Q8IB 2PW5A 2NVYB 3QOLA 4DA2A 4ZUIA 2HQEA 4N9TA 1F2ZA 1B9NA 1LT5D 2F0DA 2QEJC 2B8FA 1KDAA 4DNTB 1C4QA 4UDUC 3K59A 2AUJD 4K8IA 2F4IA 1R4PB 2ZXRA 2EY5A 3E0JA 3DWAA 4A3DB 1CT1D 3NE5B 3GP7A 3HS0C 2IX0A 2L5TA 2MJ8A 5J1ZA 1CHPD 1S5BD 4JBWA 2L9HA 2SNMA 1AZPA 3NP8A 4DXGA 4K6LA 3KLSA 4HSPA 1CA5A 1TY2A 4RGOS 4GZYC 2PYKA 3H3VC 1EEFD 1HTPA 2F0WA 5M5XB 1PZKD 2K1BA 1EIGA 5AFWA 4XTCS 2GA4B 1PTOF 2K32A 5CR3A 3AMUA 3H6MA 1KDBA 1Y1WB 1U4PA 5J39A 1DZ1A 1QNUA 3MEHA 2XWBB 3LWUA 1O7YA 5K36H 5C3XA 1JORA 1IW7D 2AWOA 2WV6D 2XWJB 2X69A 2BCOA 3OOCA 3RLFA 4AYBB 3GTKB 2NZ1D 5G3LD 4IQZA 1PZJD 3C46A 1TR5A 2C5CA 1I4PA 3D8GA 2JA8B 3GTQB 2WIIB 4CKEA 5E3FA 1H9MA 3KF8A 1Y69U 4HN7A 3G6JB 1RDPD 1XWEA 5FLXE 2R6GA 4A3JB 5ISRA 5DM73 2WAQB 1EZ8A 3OIPA 4A3EB 1SYGA 2EOTA 5KYIA 1B1ZA 5M9OA 1O80A 3MWYW 3N6RA 1TWAB 2YU9B 1SYCA 1IYVA 3A8KE 3SEBA 3TN2A 3HGBA 5E4WC 1QJOA 1SYEA 2TMPA 2OF1A 4R8NA 3F2UA 2QDBA 1B2TA 3GQBA 2EYOA 3K0YA 1CM9A 4KKSA 3PUVA 1EY5A 2PCFB 2BA1A 3T16A 2D9UA 1U9RA 1K8MA 3T13A 5CYUA 2F0GA 3QIAA 5JVG3 2B2UA 4XQJA 3QG1A 3SR1A 1OXVA 3BVMA 3RZOB 3EJIA 4C56C 3EFXD 5KGUA 3JAML 3KK7A 2CHBD 2KOLA 1CQFA 3FKIB 1Y8OB 1XTCD 1VMCA 2HDLA 3U9OA 3S1QB 2E76C 2JA6B 2ZT9C 4QF4A 4L8JA 2N88A 5KNCA 5LL6S 1ESRA 3IKJA 4DAYA 1K8OA 2E2DC 4BY7B 4IUNA 4EQOA 1TS4A 1RTNA 4YIJA 1SYDA 5E4XA 3IAYA 1Q3LA 2AQ1B 1VF7A 3D6WA 2NN6H 3BZDB 1JR0D 5C4HA 1S5ED 3GTLB 1VDZA 4QIWB 3NXWA 2EJFC 4HSVA 4KHZA 3CRKC 4IFDJ 3PO3B 4XT1B 1SJED 1LV9A 3DWPA 2F0QA 1RD9D 1HQRD 4XQNA 1QILA 2EXZA 3FRPB 1KDCA 1AW7A 2M00A 1DD2A 2IW3A 3HG9A 4PNYA 3OW7A 3EA6A 1RKNA 3TBIB 5EKIA 2NTSA 3C2PA 2NTTA 4HCEA 1QOHA 4HR7B 2EY1A 4X3TA 1O78A 1Z7TA 4V190 3P20A 2F0TA 2E75C 4ZKCB 3S9WA 1CZWA 2NBFA 4KI0A 3I90A 5FO8B 1A2TA 4O1NA 1YNJC 4RGMA 2JP1A 3CQZB 1EFID 2M9VA 5C4XB 5IGEA 5CBEE 3DEOA 2JEAI 5JJZA 3A55A 3HKZB 2MGSA 4IN3A 2XRQD 3L9AX 4DFAA 1TWHB 4CKCA 3MFGA 1JOKA 4ABNA 2K01A 1GXDC 2EZVA 4CGYB 4G7HC 2KCCA 3DUZA 1NUCA 4WRDA 2VXWA 1STYA 3I73A 1BF4A 3GD7A 1F9QA 4Q5VA 4BBSB 1STGA 1CA6A 1EZ6A 1GHKA 2VNUD 1WD1A 1KNEA 3K58A 1I6VC 2BDOA 5CMDA 1Q12A 2X6LA 1EL0A 2BE5C 5J22A 3M3YB 1W6KA 2V4DA 2A69C 2PPBC 1JB3A 1SDFA 1F9PA 3HOUB 1GOZA 3NHHA 3TZUA 4FNFA 1E2VA 1GUWA 5KYLA 3ITPA 4ZUJA 2ICIA 3Q0AA 4DGZA 4BA2I 1AEXA 2K7VA 3A7AB 1FD7D 1YNJD 4Y7NB 3R2IA 1MGSA 2K6AA 4C2MB 2BA0A 1HFGA 1W6JA 3K5MA 3K5NA 2R92B 4WORA 3J7YW 2OT2A 1E2WA 2F0PA 3HZXA 2WACA 1Q8IA 5CV5A 5CC4A 5K5PA 4G7OC 2VB3X 2F0SA 4MHEA 4B08A 4RKLA 5C5LA 2KEDA 3GTOB 1ZXTA 2L1BA 3DEPA 4FXGC 2DNEA 1BNZA 2XNAC 1PRTB 1XYIA 4KK7A 4PMWA 2E2JB 3MHBA 4IUUA 1SSOA 4P2CB 2G9DA 4FF2A 1EEID 5I9PA 5IT9E 1O7ZA 2K5QA 1DOLA 3NBHA 3VR5A 1GJXA 4QMGA 3TSSA 2BE5D 1M8AA 5JEAG 5C3WA 2A69D 1JWUD 3C1EA 1TQOA 2Z8LA 4QUCA 3PUWA 1BR9A 1AFPA 3GTPB 5CORA 5LL6X 3S1MB 1PFBA 2KHSA 1HUNA 2WP8J 4FF4A 4H0LC 1H9RA 2IX1A 3VYSA 3NWSA 2HCCA 3EQLC 4CJ2C 5M5WB 2EY2A 2PQEA 4FP5D 1HQMC 3EROA 1SNCA 2J0TD 2ENBA 1Z47A 1EIHA 1DM0B 1I3QB 4U673 3TP8A 3M4YA 4OIJA 5D65A 1I4GA 1IKLA 4ID6A 1KTKA 2R7ZB 5KIXA 2DN8A 4DU9A 1LABA 4QB4A 1STHA 5I6WA 1IHZA 1DXMA 3OPOA 1A15A 1D1KA 1ZEQX 2EYHA 5I2YA 3SDZA 4WFN3 1CK1A 3QJYA 4M1UB 3I72A 5F2DA 1G6ZA 2LY7A 3H91A 5ELBA 1LO5D 2SNSA 1D5ZC 4EQPA 4K5VA 3DWQA 1EWCA 1F9RA 3J7AV 5EPJA 4QUFA 1B9MA 1TS2A 5D3IB 5C0XH 2A74C 1RTOA 1S5CD 1X3PA 3E6ZX 3K57A 4TQUS 5D3DA 4RCNA 1EY9A 2K33A 3MVVA 3PUZA 3S16B 4F7XA 3KBXA 1ZKOA 1UNSA 3J81E 3PUYA 2EVBA 2JYOA 3BVGA 4TRDA 1KAAA 1EQVA 2H4OA 1SAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKC A;  2WKD A; 
#chains in the Genus database with same CATH topology
 4XYO A;  2AWN A;  1A3V A;  3A8J E;  3T1H L;  3HRZ C;  1ESF A;  3M4O H;  4DUY Q;  1WTX A;  1QNK A;  3MTS A;  5IWA L;  5M5W H;  1HA5 A;  3ND9 A;  5LMU L;  3S17 H;  3OIQ A;  5IOC A;  4YY3 L;  4LUZ A;  4K14 A;  4OO1 H;  2NZH A;  1FJG Q;  2FMC A;  5E7N A;  3GTM B;  2HDM A;  2Y0S G;  5ELC A;  3GTG H;  1QVF A;  4JI7 L;  1I3Q H;  2PZW A;  3SK6 A;  1U4M A;  4XDX A;  5CBA E;  2B39 A;  1TVX A;  5ELD A;  3OMC A;  3GO5 A;  4HED A;  1O7L A;  1SFO H;  1G8Z D;  4KKT A;  4LFC L;  5IYB H;  1VQ8 A;  4ZQ3 A;  4J6H A;  1PRT F;  2CWP A;  3M9B A;  1MSH A;  4N8X 1;  1L0X B;  4YWK A;  3S1N B;  1D6E C;  3Q8D A;  1K8A C;  3K0X A;  2UXB Q;  1BCP C;  1C48 A;  2Y0S B;  3R93 A;  5BN4 A;  1R4Q B;  5EBD A;  3P1H A;  2XN9 C;  2IJ0 A;  1STN A;  1EY7 A;  2NYZ D;  5C6A A;  2PNR C;  1X6O A;  2FFK B;  3OMG A;  4S3S A;  3MZ5 A;  1PMR A;  3C3L A;  3I4N H;  1IZ6 A;  1L1O A;  1VF5 C;  1AP0 A;  1WCM G;  3VA5 A;  1R9T H;  1X54 A;  1BUV T;  3FKI G;  1LUZ A;  2RA4 A;  4DR2 Q;  1OXT A;  1SYB A;  2RDH A;  2WKD A;  4P72 A;  4A76 A;  2K28 A;  1MI2 A;  4DV0 Q;  1ENF A;  1FGU A;  1DCZ A;  5IYD G;  2JA6 G;  4C1N I;  1BCP B;  4B9W A;  1EYC A;  4KY5 A;  2XVS A;  4A3K H;  4RA8 A;  5JOB A;  1I4R A;  4NKL A;  1T5X D;  1E0B A;  2A1A A;  4BY7 G;  1N33 L;  2N8N A;  1EY8 A;  1WCM B;  2C9O A;  4DNI A;  1H9K A;  3PMF A;  3I55 A;  2VUM B;  2WB1 E;  1NSN S;  2F52 A;  2K5D A;  3HOV H;  3QR8 A;  2AUK A;  4POF A;  2RCF A;  4YCU A;  1PYS B;  4U68 A;  1TII D;  4K0K L;  3ERQ A;  3GV6 A;  3ICE A;  1ICW A;  2D62 A;  1PXU A;  1FL0 A;  5CV7 A;  1Q1E A;  1L0Y B;  4A3L G;  4X64 L;  4FF3 A;  3MXN B;  1I4H A;  2CQO A;  1MD2 D;  4UAI A;  1H9S B;  3WDN A;  3FDT A;  1JWM D;  1CZG A;  1YNN C;  4I7Z C;  1D1I A;  4LAA A;  1EY4 A;  4GOP A;  1I4Q A;  2ZTC A;  4IOC A;  3PO3 G;  4RH6 A;  2JA7 H;  1CI3 M;  4FDB A;  3OTO L;  3BVZ A;  4C3I B;  4X3K A;  1MBY A;  4QGU A;  4OHJ A;  4LF4 L;  3TS2 A;  3EIV A;  3ERS X;  4LFB L;  4HMJ A;  1S4Z A;  5DEH A;  2F0N A;  3D4W A;  4LF9 Q;  4ZRZ A;  1EYD A;  3C1F A;  3CHB D;  2B8G A;  4JI5 Q;  1B44 D;  2QIL A;  1SE4 A;  3Q24 A;  2I46 A;  4BXX G;  3TEH B;  4K5X A;  4A3F H;  3ZJY C;  2JXM B;  1PFS A;  1K0S A;  3X3N A;  2E2I B;  4KLK A;  2WIN B;  4A93 H;  1X56 A;  2VZA A;  1PA6 A;  4XYQ A;  1LT6 D;  4A3B B;  3VR4 A;  3PIP 3;  4HJ5 A;  4OL7 A;  1ILQ A;  4KKU A;  4LNQ A;  2IL8 A;  3NUC A;  2NVT H;  1BCP D;  1EY6 A;  3MAQ A;  4IFD G;  3H15 A;  1SNO A;  3S2H B;  1F2Y A;  3I70 A;  1A6X A;  4H7B A;  5C44 H;  3S15 H;  1JQY D;  1D7Q A;  4A3C H;  2ZJP A;  1MSG A;  5HUR A;  4JV5 Q;  3ONA B;  3AEV A;  3KF8 B;  3PO2 B;  2PQA B;  1HNW L;  4KTA A;  2YTV A;  3WOE A;  4CDF C;  1KQS A;  1LTT D;  3IFD A;  5M3F B;  2O2L D;  2VB2 X;  3MA2 B;  1IBL L;  1EQQ A;  4DR5 Q;  4KJN A;  1FNV A;  3KUP A;  3CMA A;  1XXG A;  3J80 E;  2RF4 A;  4TSS A;  1AN8 A;  5GAH C;  2EYP A;  1EOT A;  1IBM L;  4L63 B;  2QKI C;  1HXY D;  4DV7 Q;  3K7U C;  4WJW A;  1QWY A;  5KRU A;  3A8I E;  2EDG A;  5T1I A;  4PV1 C;  4YHH Q;  1OTC A;  2F0H A;  3PIP A;  4X3U A;  3QO2 A;  5M5Y H;  3U9S A;  1K83 H;  4HJ9 A;  1G2S A;  5A2Q L;  1Q1B A;  2A68 C;  2OCE A;  3BDL A;  1PH1 A;  2UUA L;  3L0O A;  1LTR D;  4MN3 A;  1EQR A;  2VUM H;  3J7A F;  2Q8R E;  2TSS A;  1D5M C;  5GAD C;  5M3M B;  1B7Y B;  2HCI A;  1IYU A;  1VQL A;  1X55 A;  2K5H A;  5COY A;  1JWS D;  3QOJ A;  2PW7 A;  4ZLT F;  1YNN D;  3ULL A;  4G57 A;  3VYU A;  2OXP A;  1YIJ A;  4FXD A;  2RSO A;  3HOW H;  1TWC H;  3D6C A;  2F0I A;  4ALP A;  4IUV A;  3BG3 A;  4FVM A;  4R4Q A;  1JJC B;  1SR3 A;  3T56 B;  4IUT A;  3HOZ B;  3KBG A;  4DV6 Q;  1N32 Q;  1LT4 D;  5IY0 A;  1EWH A;  1IKM A;  4B9X A;  5HGT A;  2AQ3 B;  5DM6 3;  1STB A;  2LS0 1;  4LWC A;  1GUT A;  1A2U A;  4J1M A;  4CHT B;  1NBW A;  2WB1 B;  5GAE C;  3K7A H;  4RFB A;  2JA5 H;  1X32 A;  2A6E C;  1PDQ A;  1F9S A;  2L4N A;  3RZD B;  1JC7 A;  3NK9 A;  3QB3 A;  4MIU A;  2F4V Q;  1D8L A;  1OXX K;  4IUP A;  4F88 A;  5JPM C;  4Q0F A;  2F0J A;  2MNA A;  1VQF A;  4JBJ A;  3HP3 A;  2QGQ A;  3KLR A;  2UUB Q;  1A3T A;  1SRU A;  1G51 A;  2D2C C;  1OXU A;  3K5O A;  4DAV A;  3G4S A;  4DV5 L;  4ZAI A;  1ASY A;  2KUM A;  2FJ2 A;  1WTR A;  2IX3 A;  2NVQ H;  2Z4I A;  5IYC H;  2NVX B;  4DAY B;  3JAM i;  4K5W A;  1PFM A;  4LF7 Q;  4BA1 I;  4OIK A;  3SE0 A;  3TP7 A;  4DN4 M;  5FO9 B;  1BCP F;  2B2Y C;  4LUO A;  3NPP A;  3H94 A;  2F0E A;  4B3S Q;  3S14 H;  4JOI A;  4DK1 A;  4JI0 L;  3HOY B;  2BOS A;  4BWG B;  4NXM Q;  3O13 A;  2RVL A;  1Y1V H;  1II3 A;  3OWF A;  1HZB A;  3FEW X;  1ILP A;  1S3O A;  1RCV D;  5IOD A;  3VA7 A;  1CQV A;  5FJ8 H;  2QCP X;  4Z9C B;  4BY1 H;  1FR3 A;  5TSS A;  1V9P A;  2K14 A;  3SHL A;  3RLO A;  3CCR A;  3CPF A;  2YTY A;  4IZ8 A;  2R92 G;  4X65 Q;  4WJ3 M;  3X3M A;  5C0X J;  3QWN A;  1TWF B;  1XNQ L;  3BZK A;  3HOX H;  1WTV A;  1EYA A;  2B2W C;  4RMF A;  1HH2 P;  3AFQ A;  4LF5 Q;  2A68 D;  3SVM A;  2A6H C;  4X3S A;  4NXN Q;  4KY7 A;  1YNX A;  5FOB B;  4A3I H;  1PRT C;  1ZYR C;  2K4K A;  4EVO A;  5IT9 c;  1PH6 A;  1I50 B;  3LNN A;  3P75 A;  1TS3 A;  3S2D H;  4A75 A;  1VQ5 A;  1KRS A;  1X3F A;  3RNU A;  3CKI B;  5C0X G;  2E2H H;  4JI1 Q;  3OYY A;  3S24 A;  1I6H H;  1NAP A;  3OHX C;  4DV4 Q;  1HHV A;  4R9W A;  1QB5 D;  1G6P A;  4KMU C;  5FLM H;  3NQT A;  3DM3 A;  2KEN A;  4OX9 Q;  2RSN A;  2ZXP A;  3H0G H;  2B3G A;  2L55 A;  1NR4 A;  3L7Z C;  2EYF A;  3CCS A;  3URY A;  5C4Z A;  5C3E H;  4LF8 L;  4HJ8 A;  2WFW A;  2VQE Q;  3KFU A;  3UDI A;  1G2T A;  4R8I A;  1TWG B;  4A3G G;  1U0L A;  4JCV E;  5K36 G;  1YHA A;  3CC4 A;  3SGI A;  2F0V A;  2A8V A;  2A6E D;  4GKK Q;  1B53 A;  4AQY Q;  3TQY A;  4A3M B;  1ML0 D;  2KCN A;  4RAU C;  3NEM A;  4IO9 A;  4IFD I;  4A4I A;  3TS0 A;  1QZH A;  2EJM A;  2F0K A;  4K8J A;  4C3J G;  3SXH A;  2KA7 A;  3V05 A;  2OQ0 A;  4A3G B;  1X3Q A;  4BS9 A;  1M4V A;  2VS1 A;  4ZYS A;  2PNH A;  2EYL A;  4CJ1 B;  4DR3 Q;  4OO1 G;  4WJ4 A;  4JI3 L;  4C3J B;  5I4D A;  2UXC Q;  4DV3 L;  4X6A H;  1G29 1;  1Q90 A;  3IFT A;  1GO3 E;  3M7G A;  3JAM E;  3M4O B;  2L0C A;  4KV6 A;  2F0L A;  2WAQ E;  2HT1 A;  3VDY A;  4TVA B;  2FHT A;  2ZJR A;  4RHR A;  4R4C A;  3GTJ H;  5JVH 3;  1S5D D;  3MFY A;  5ELN A;  2MFI A;  3S17 B;  3TME A;  4FF1 A;  1TS5 A;  5IP9 G;  1DJR D;  1KIX A;  1QG7 A;  2EYJ A;  4LJZ C;  5LHY 1;  2HIX A;  1PTO H;  2K5V A;  4DR7 Q;  2DY7 A;  5EAY A;  1M1K C;  4RG1 A;  5IGD A;  3GTG B;  4UHV A;  2O5J C;  3VYT A;  4E6I A;  5EGT A;  4C3H H;  1OXS C;  2DY8 A;  4JC0 A;  3CF5 A;  3AU7 A;  1GUO A;  4OON A;  1B4O A;  4OEL B;  4HAE A;  1PYW D;  3I91 A;  2A6H D;  1SFO B;  3NSW A;  2Z6K C;  1EYG A;  4OXP A;  1PRT D;  4DV1 L;  1ZYR D;  2Q2I A;  5FK9 C;  4HMI A;  1V1P B;  2LSS A;  1DYQ A;  3CCE A;  1KNA A;  1K3R A;  3CME A;  1BXT A;  2LKV A;  3K6O A;  4LMQ D;  1NNX A;  4EGV A;  1VQC A;  1W2B A;  1VQJ A;  4EQ5 A;  5JAV A;  4KHP L;  2KJX A;  3UE1 A;  2IPK D;  1VQE A;  3I4N B;  2WKC A;  3MC0 B;  2OTJ A;  5EKL A;  5LMN W;  3NTK A;  1VQM A;  1R9T B;  2XGT A;  4K6D A;  2F03 A;  3A7L A;  3E9H A;  1EIF A;  1VQK A;  4MNO A;  2JQO A;  3IL8 A;  3W5O A;  4KJO A;  1FYC A;  1LTA D;  4DF7 A;  3VYR A;  1J8I A;  1S5F D;  3AFP A;  1F2L A;  4O2D A;  3RN5 A;  2RDF A;  4A3K B;  4FO2 A;  3MXN A;  5IGG A;  1Z9F A;  3WOF A;  1H9S A;  3CAM A;  2JSO A;  1E2Z A;  4O42 A;  4ME5 A;  1HPC A;  3F2D A;  3H09 A;  1QVC A;  4POG A;  3HOV B;  3I4M H;  1LTL A;  2SDF A;  5FLX c;  4CKB A;  4LK1 C;  2LFN A;  1UEA B;  1EOV A;  2NN6 G;  4BBR H;  2E5L Q;  1VQ4 A;  2L12 A;  1GUG A;  3A54 A;  1SNM A;  3EN2 A;  2F0O A;  4UP9 A;  2NB0 A;  1A3U A;  3N52 A;  1HFN A;  1EU3 A;  2JA7 B;  3CCU A;  1YHQ A;  4KN7 C;  4IUQ A;  3T51 B;  5C5M A;  2K04 A;  2F0M A;  4JI2 L;  3T1H Q;  1HTL D;  4HTH A;  2B2V C;  1KXL A;  1ENC A;  3PCO B;  2RCN A;  1BDO A;  3PSI A;  5A2Q E;  2ZXO A;  1SYF A;  5IWA Q;  2KCT A;  1DON A;  4QY7 A;  2B2T C;  5LMU Q;  4YY3 Q;  2BDN A;  4RGT A;  1WTW A;  3AB9 A;  2L15 A;  1XMO L;  5I9O A;  2F0U A;  1Q81 C;  4A3F B;  1T5E A;  1U4R A;  5JEA H;  3ND8 A;  4A93 B;  1EQT A;  1NCV A;  3BDC A;  2EXD A;  2GVA A;  3UI2 A;  4JI7 Q;  4KN4 C;  5C0X I;  2O4X A;  3FVQ A;  1K28 A;  2N55 A;  3LWE A;  3TDQ A;  1K3B C;  1BOS A;  3E0E A;  1GM5 A;  4LFC Q;  4ILW A;  2AMC B;  3SK4 A;  2X6G A;  3BYY B;  5FO7 B;  2NVT B;  3BS1 A;  2R93 H;  2C35 B;  3NWT A;  4DXF A;  4XT3 B;  4DK0 A;  1Q8K A;  1EFW A;  2PMZ E;  3M85 A;  2NVY H;  5C44 B;  3S15 B;  3I4O A;  1C8C A;  2Z4H A;  4OWT B;  3GV3 A;  1YJN A;  1HZ9 A;  1STA A;  4I65 A;  5AJ3 L;  1SEB D;  3DLL A;  3NTH A;  3RUZ A;  2HUG A;  1BQQ T;  4YCV A;  1LT3 D;  2F0F A;  5EKK A;  1UUP A;  1BVS A;  4X62 L;  1LYL A;  5BN3 A;  1HR0 W;  4JYA Q;  4EQN A;  4P75 A;  3KDF B;  1DOM A;  4GN4 B;  1A0I A;  4A3D H;  2R3Z A;  2VUM G;  3CCJ A;  2CVR A;  5IT9 L;  1NR2 A;  2EPB A;  3DHQ A;  3HKZ E;  2HIV A;  4J8Q A;  4YCW A;  2NUC A;  1KLU D;  3MXP A;  3I8Z A;  5DNF A;  1XTD A;  2P5Z X;  5M5Y B;  1K83 B;  2QF7 A;  4L5R C;  3MXU A;  1PHJ A;  1N33 Q;  2K03 A;  2I5M X;  4B3R L;  4OO1 I;  2Q2U A;  2MUY A;  2CH4 W;  4UP8 A;  4IJH A;  4NMZ A;  3G7L A;  2PZU A;  2K05 A;  1HCZ A;  2RKS A;  3CP0 A;  5CV8 A;  1BBW A;  2E74 C;  5A35 A;  4K0K Q;  5LMN L;  3W2D A;  4GS3 A;  1Y14 B;  5M5X H;  2HHH L;  4NP5 A;  1UAP A;  1WYD A;  2MO0 A;  4C3I G;  1TT2 A;  2AQ2 B;  5T1G A;  4X64 Q;  1LAC A;  4GLX A;  1PH3 A;  4PMB A;  1CSP A;  3HOW B;  1TWC B;  4FXK C;  2L11 A;  2CW0 C;  2A73 B;  1GD7 A;  5JJI A;  4OGQ C;  1B70 B;  1E1T A;  1GHJ A;  3K81 C;  3NQI A;  1CFM A;  1SXT A;  3OTO Q;  5ELF A;  5I2X A;  2YTX A;  4LF4 Q;  2XRS D;  1CTM A;  4LFB Q;  2KVM A;  3L3O C;  2R61 A;  3SK8 A;  3OWE B;  3E3X A;  5ELE A;  3H3V H;  2YYZ A;  4A3B G;  3D31 A;  3K7A B;  1IL8 A;  4P71 A;  1IL2 A;  2JA5 B;  1L2F A;  1QUQ B;  1LM0 A;  2MQH A;  1YI2 A;  4HCS A;  3V2T A;  3K80 C;  3ZYY X;  1Q46 A;  3GTK H;  1LTB D;  5G3L F;  1SNQ A;  2SOB A;  2JA8 H;  4OEM B;  1N9W A;  1KLG D;  3GTQ H;  4PG3 A;  3ULJ A;  2HQL A;  3J80 c;  5IIF A;  5BN5 A;  4MTK A;  4RCO A;  3U4V A;  1SND A;  4GNX C;  2NVQ B;  4IPH A;  1FVI A;  3RD4 A;  1SE3 A;  2EJG C;  2KEC A;  3PO2 G;  2DGY A;  4GLA C;  1YIT A;  5GRO A;  2OEO A;  1QCB D;  4F8M A;  3DM1 A;  5M3F G;  1KHI A;  1MJC A;  5EPL A;  2K75 A;  1Z6H A;  3Q22 A;  4XIG S;  4A3J H;  2RHS B;  3DXJ C;  3S14 B;  3CRL C;  5C4J B;  2Z1C A;  3RMH A;  4C1N K;  4RKB A;  4ODG A;  3D3R A;  2MPM A;  1CKM A;  2B2Y A;  2FMM A;  4CDE C;  1N8R C;  4A3E H;  1S40 A;  1V1Q A;  1HNW Q;  4KD3 A;  3LX0 A;  3HOX G;  1CKO A;  1TU2 B;  1Y1V B;  3FPU B;  2F3V A;  4BY1 B;  4GNX B;  1TWA H;  1IBL Q;  2YU9 H;  4GKJ L;  1PH5 A;  1VQA A;  1HUM A;  1YHB A;  2A19 A;  1LTS D;  2IWH A;  1SE2 A;  1V1O A;  2RBM A;  1HA6 A;  4PQX A;  1B50 A;  1BO0 A;  1RL2 A;  2NN6 I;  5ELO A;  1IBM Q;  2ICE C;  4CDD C;  1NMF A;  3ER0 A;  3KLS X;  3HOX B;  2JA9 A;  3MXG A;  2UU9 L;  5M3M G;  2NWG A;  1J5E L;  1JOO A;  2ID0 A;  2VW9 A;  1T9H A;  5FLM G;  4A3I B;  2I07 B;  3D4R A;  1OO9 B;  3PUX A;  2PMZ B;  2B2W A;  3A56 A;  1HNX L;  1B3Q A;  2UUA Q;  4Y52 H;  4B3T L;  3J81 L;  1D2B A;  1WD0 A;  4H13 C;  3S2D B;  2B2U C;  3HOZ G;  1KAB A;  2H4O A;  1JB7 A;  1HR0 L;  1MHW C;  2E2H B;  3BJU A;  3NBI A;  2JEB I;  4DV7 L;  1I6H B;  1D5X C;  3RZO H;  1I4X A;  2CW0 D;  2LMC B;  3W3A A;  3H0G B;  3T4A C;  1QE6 A;  2WB1 G;  2J4X A;  1V8Q A;  4KY6 A;  3FKI H;  5C3E B;  2MHV A;  1PH7 A;  3Q23 A;  1PFN A;  3J81 j;  3S1Q H;  4PMC A;  2CWA A;  3PGZ A;  1RHP A;  4JI8 L;  3T53 B;  2EE1 A;  3HEJ A;  2JA6 H;  5IYD H;  5BR8 L;  5FLX L;  3PV0 A;  1SJH D;  4KD4 A;  5I6Y A;  1XX8 A;  1VQ9 A;  4QCL A;  2G9H D;  3CCV A;  4I7A A;  5FKA C;  4X66 L;  4IUR A;  1W3S A;  2O5I C;  1NY4 A;  4NW2 A;  2ES2 A;  5HY6 A;  4ZKB B;  3TZD A;  3R8B A;  2EY6 A;  1UE6 A;  2KQ3 A;  4DV5 Q;  1X3E A;  4G7Z C;  3HOY G;  3PIO 3;  1JIC A;  4KHV A;  3V96 A;  4A3L H;  3GTL H;  2A5H A;  1PTO C;  1DOK A;  5EPK A;  1VQG A;  3DMU A;  1Y8P B;  1VQH A;  4JG2 A;  4ZK9 B;  1WVL A;  5JPN C;  3EVQ A;  1ENA A;  1FGB D;  3PO3 H;  4QL5 A;  2D5D A;  4RWS C;  5E1F A;  5NUC A;  3CU7 A;  4JI0 Q;  4C3H G;  2KEE A;  5C4J H;  2PO4 A;  1TY0 A;  2IT1 A;  4JK1 C;  3GTJ B;  5IGC A;  4JI6 L;  1STE A;  4RGN A;  4G4K A;  3TP5 A;  1CHQ D;  1WTO A;  1V1P A;  2H1E A;  1PTO B;  4BXX H;  3STB C;  1E24 A;  1Y8N B;  4C3H B;  4NDX A;  1SLJ A;  4O0A A;  5D14 A;  4OWX B;  1PH9 A;  1E1O A;  1TKW B;  1XNQ Q;  1JE4 A;  4XQQ A;  4XXE A;  1X9N A;  3PIO A;  1JOQ A;  1V43 A;  1H9J A;  1SMY C;  3I7F A;  2Z6K A;  4V0B A;  3S1R B;  1ET9 A;  2N49 A;  1GUN A;  4IFD H;  5EQ0 A;  4N9P A;  5IGF A;  4HIO A;  1YEZ A;  4RHS A;  4ME3 A;  2UXD L;  4M8A A;  1SBB B;  5IP7 H;  4QJF A;  4UY8 C;  1PLF A;  2FIN B;  2Q8T A;  4K2K A;  1EY0 A;  4FYD A;  5CV6 A;  4DUZ L;  3P7J A;  1LLR D;  5EJW A;  2RDG A;  3CQZ H;  1AZQ A;  1RF2 D;  3R3O A;  4DR6 L;  1UE7 A;  3IRB A;  4A3M G;  5C4X H;  2K5W A;  4TKO B;  2XIW A;  2KHI A;  2XTI A;  4LF8 Q;  3SK5 A;  4HJ7 A;  1ET6 A;  2OWO A;  5KNB A;  1RJT A;  3G48 A;  3W1B A;  2LXJ A;  4LW1 A;  1BBX C;  1TWH H;  4JBK A;  1UEB A;  1MJE A;  1YVC A;  1BBU A;  1AE3 A;  1PZI D;  2YV5 A;  3A5Z B;  3HFZ B;  1MIU A;  5IGB A;  3T1Y L;  3I4M B;  2B63 B;  3PQI A;  1LTG D;  2PZT A;  3BDO A;  3WWV A;  1GUS A;  3BYT B;  1HNZ L;  1B3A A;  2J7Z A;  4IPG A;  5JEA J;  2SEB D;  4H44 C;  4CBV A;  4CJ0 B;  4IAL A;  3NTI A;  4AYB E;  2VQE L;  3Q6S A;  1O7I A;  3I4L A;  4L6T B;  3E5S A;  4BBR B;  2MP1 A;  2XSC A;  1CKN B;  2VY3 A;  4BBS H;  1JCK B;  1JJG A;  1PTO D;  4DAP A;  5KEE A;  3K5L A;  4B3M L;  1XNR L;  2CFM A;  2F3W A;  1FNW A;  3OW2 A;  3U50 C;  4HID A;  2JE6 I;  4JI3 Q;  5DAU A;  1HZC A;  4DV3 Q;  1F2M A;  3FPP A;  1IYJ B;  1WTP A;  2PI2 A;  4K2L A;  3U58 A;  1J9O A;  3BZC A;  4F87 A;  1FNU A;  3R2T A;  2DNC A;  3FMC A;  3M7N A;  3M3Y H;  5CV9 A;  1SNP A;  3VR6 A;  2DJF C;  1MKH A;  3J80 L;  2B2V A;  4PZ7 A;  1VCI A;  1KC8 C;  1ROD A;  2UUC Q;  3OSO A;  1GKH A;  2Z6B A;  2OTL A;  1IW7 C;  3TP6 A;  3D4D A;  4JI4 L;  1LTI D;  5IYB G;  3J7A 5;  1HRJ A;  3VR2 A;  4JVZ A;  3STB D;  2B2T A;  3I3C A;  1S72 A;  3W1G A;  3HOU H;  2RQX A;  3VR3 A;  3F8T A;  1F77 A;  5KND A;  4ULL A;  2Y0S E;  4DNR B;  3TRE A;  5EBC A;  2EYM A;  5CGK A;  1WTQ A;  1ONL A;  2F1M A;  5CV4 A;  1SE8 A;  4DV1 Q;  1G91 A;  1EU4 A;  1SMY D;  2R93 B;  2CQA A;  2ZTE A;  3I4N G;  1U4L A;  1VMP A;  2M2L A;  2Q8I B;  2PW5 A;  2NVY B;  4GN5 A;  3QOL A;  1Q7Y C;  4DA2 A;  3S1R H;  4ZUI A;  2HQE A;  1XPO A;  4N9T A;  1F2Z A;  1YZ6 A;  1B9N A;  1LT5 D;  2F0D A;  2QEJ C;  4DR4 L;  2B8F A;  1PYB A;  3FHW A;  1KDA A;  4DNT B;  1C4Q A;  4UDU C;  3K59 A;  4KHP Q;  2AUJ D;  5H1S E;  1DGS A;  4K8I A;  4Y7N H;  4A3K G;  2F4I A;  4CDC C;  1R4P B;  2ZXR A;  2EY5 A;  4C2M H;  3J81 c;  1N34 L;  3E0J A;  3DWA A;  4A3D B;  1CT1 D;  3NE5 B;  2VQF L;  3GP7 A;  3HS0 C;  3HOV G;  2R92 H;  2IX0 A;  2L5T A;  1XMQ L;  3U4Z A;  2MJ8 A;  5J1Z A;  2ZM6 L;  2D0P A;  1CHP D;  4LF6 L;  1S5B D;  2NZO A;  1I94 L;  4JBW A;  2L9H A;  2SNM A;  1AZP A;  1IXR A;  2Q2H A;  1E22 A;  3NP8 A;  2IY5 B;  4PZ8 A;  4DXG A;  4K6L A;  3KLS A;  4HSP A;  1CA5 A;  4YWM A;  1TY2 A;  4RGO S;  4GZY C;  1NE3 A;  2PYK A;  2B63 H;  2K52 A;  3H3V C;  1EEF D;  1HTP A;  2K50 A;  2JA7 G;  1N36 L;  2F0W A;  5M5X B;  1PZK D;  2K1B A;  1EIG A;  3I56 A;  5AFW A;  4XTC S;  1AH9 A;  2GA4 B;  2N78 A;  2E2J H;  1PTO F;  2K32 A;  5CR3 A;  3AMU A;  3H6M A;  1KDB A;  3PF4 A;  4QIW E;  1Y1W B;  1U4P A;  5J39 A;  1DZ1 A;  3CCL A;  3CC2 A;  1QNU A;  3KF6 B;  3MEH A;  2B29 A;  2XWB B;  4JI2 Q;  1GVP A;  4A3F G;  4EX5 A;  2DUD A;  3LWU A;  1O7Y A;  1VQO A;  4A93 G;  5K36 H;  2IHF A;  5C3X A;  1JOR A;  1IW7 D;  2AWO A;  1A62 A;  2WV6 D;  1B8A A;  4OWW B;  2XWJ B;  1KD1 C;  2X69 A;  2BCO A;  1JT8 A;  3GTP H;  4DV2 L;  3OOC A;  1XMO Q;  3RLF A;  4AYB B;  3GTK B;  3NBH B;  2NZ1 D;  5G3L D;  4IQZ A;  3S1M H;  1PZJ D;  3C46 A;  1TR5 A;  2C5C A;  1I4P A;  3D8G A;  1IBK L;  2JA8 B;  2GVB A;  4LFA L;  3GTQ B;  2WAQ G;  2WII B;  4DR1 L;  4CKE A;  5E3F A;  5C44 G;  1H9M A;  3KF8 A;  4DUY L;  4A3E G;  1Y69 U;  4A3C G;  2ALY B;  4HN7 A;  4MZ9 A;  2PQA A;  3G6J B;  1RDP D;  1XWE A;  2AKW B;  4R1J A;  4ZCK A;  4GNX A;  2CH4 A;  5FLX E;  2R6G A;  4A3J B;  5ISR A;  1KRT A;  5DM7 3;  1C7Y A;  1FJG L;  2WAQ B;  1A8V A;  1E3P A;  3RLN A;  1EZ8 A;  3OIP A;  4A3E B;  1SYG A;  2JN4 A;  3JC6 6;  5AJ3 Q;  4IJL A;  2EOT A;  5KYI A;  5JJL A;  1B1Z A;  1NMG A;  5M9O A;  1O80 A;  3MWY W;  3N6R A;  1TWA B;  2I0Q A;  4X62 Q;  2YU9 B;  5IP9 H;  4MTN A;  1SYC A;  3FP9 A;  1IYV A;  2CCZ A;  3A8K E;  3SEB A;  3TN2 A;  4DK3 C;  3HGB A;  4H02 A;  1EIY B;  5E4W C;  4J15 A;  2R7Z H;  2UXB L;  1QJO A;  1SYE A;  2TMP A;  1K8G A;  2OF1 A;  4R8N A;  3F2U A;  2QDB A;  1B2T A;  3GDE A;  2G5D A;  5L37 A;  3UE0 A;  3GQB A;  3J80 i;  2EYO A;  3K0Y A;  3F2B A;  1CM9 A;  1RIP A;  4B3R Q;  4KKS A;  3PUV A;  4R4I A;  1EY5 A;  3HOW G;  2OQK A;  2PCF B;  2BA1 A;  4PZ6 A;  4JYA L;  4P74 A;  3T16 A;  2D9U A;  1H95 A;  1U9R A;  1K8M A;  3T13 A;  1C9O A;  3UDF A;  5CYU A;  5LMN Q;  4DR2 L;  2F0G A;  2GN5 A;  3QIA A;  5JVG 3;  1X65 A;  2HHH Q;  4DV0 L;  4NB3 A;  2B2U A;  4XQJ A;  3QG1 A;  3SR1 A;  1OXV A;  3BVM A;  3EBE A;  3RZO B;  3EJI A;  4C56 C;  3EFX D;  5KGU A;  2KBN A;  3KK7 A;  3JAM L;  2CHB D;  2KOL A;  1CQF A;  3D0F A;  2JA5 G;  3FKI B;  1Y8O B;  1XTC D;  1VMC A;  2HDL A;  3U9O A;  1Y1W H;  3S1Q B;  1BKB A;  2E76 C;  2JA6 B;  2ZT9 C;  4QF4 A;  4L8J A;  2N88 A;  5KNC A;  5LL6 S;  2EIF A;  1ESR A;  3IKJ A;  3S16 H;  4DPG A;  1QZG A;  4DAY A;  1K8O A;  2E2D C;  4BY7 B;  5IYC G;  4IUN A;  2QDL A;  4EQO A;  1TS4 A;  1RTN A;  4YIJ A;  1K9M C;  1SYD A;  5E4X A;  3IAY A;  1VQB A;  1Q3L A;  2AQ1 B;  1VF7 A;  2RHQ B;  1PVO A;  3D6W A;  2NN6 H;  3BZD B;  1JR0 D;  5C4H A;  1S5E D;  2N3S A;  4N8F A;  3GTL B;  1VDZ A;  4QIW B;  1UE1 A;  3NXW A;  2EJF C;  1E7Z A;  4HSV A;  1HJP A;  1Y1V G;  4LF9 L;  4KHZ A;  4JI5 L;  3CRK C;  5FJ8 G;  4IFD J;  4BY1 G;  3PO3 B;  3KOJ A;  4XT1 B;  1SJE D;  1LV9 A;  3DWP A;  2F0Q A;  1UE5 A;  3GTM H;  1RD9 D;  1HQR D;  2CKZ B;  3M4P A;  4XQN A;  1QIL A;  3KJO A;  2EXZ A;  2I5H A;  3FRP B;  2QEX A;  1KDC A;  1AW7 A;  2M00 A;  4GKJ Q;  1DD2 A;  2IW3 A;  4A3I G;  3HG9 A;  4PNY A;  3OW7 A;  3A5U A;  3EA6 A;  1RKN A;  3S1N H;  1P8L A;  5IP7 G;  3TBI B;  5EKI A;  2NTS A;  2HD3 A;  3C2P A;  2NTT A;  4HCE A;  1VQ7 A;  1QOH A;  4HR7 B;  4IOA A;  2EY1 A;  4X3T A;  2UU9 Q;  1O78 A;  1Z7T A;  1J5E Q;  4V19 0;  1WJJ A;  3P20 A;  3H3V I;  2ZTD A;  4JV5 L;  2F0T A;  1L1O C;  2E75 C;  3CD6 A;  4ZKC B;  3NEN A;  1HNX Q;  1XPU A;  5C4X G;  3H0G G;  4L5T A;  3S9W A;  4B3T Q;  3KYH C;  4GLV B;  3KJP A;  1CZW A;  2NBF A;  3HKZ G;  5C3E G;  4DR5 L;  4KI0 A;  3I90 A;  5FO8 B;  4GN3 B;  1HR0 Q;  1A2T A;  4O1N A;  1YNJ C;  4RGM A;  2JP1 A;  3CQZ B;  1EFI D;  4YHH L;  3L2P A;  2M9V A;  5C4X B;  5IGE A;  5CBE E;  3DEO A;  2JEA I;  4AH6 A;  5JJZ A;  3A55 A;  1WCM H;  1L1O B;  3HKZ B;  3A0J A;  2MGS A;  4IN3 A;  5J3B A;  4APV A;  3LGJ A;  2XRQ D;  1NJI C;  3L9A X;  4JI8 Q;  4DFA A;  1CKN A;  5BR8 Q;  1TWH B;  4CKC A;  3MFG A;  2Q2T A;  1JOK A;  4BBS G;  4ABN A;  2K01 A;  1GXD C;  4UPA A;  2EZV A;  4LUV A;  2R7D A;  4CGY B;  4G7H C;  2KCC A;  3NEL A;  4GOP C;  1PH2 A;  3DUZ A;  4YWL A;  4BY7 H;  4X66 Q;  3BU2 A;  1NUC A;  4WRD A;  2VXW A;  1STY A;  3I73 A;  1VQI A;  1BF4 A;  3GD7 A;  5IE8 A;  4DV6 L;  1N32 L;  1F9Q A;  4Q5V A;  4BBS B;  1STG A;  2R7F A;  4C3I H;  1CA6 A;  1EZ6 A;  1GHK A;  2VNU D;  1WD1 A;  1KNE A;  3K58 A;  1I6V C;  2BDO A;  2VL6 A;  3F1Z A;  5CMD A;  1Q12 A;  2X6L A;  4GOP B;  2F4V L;  3HOU G;  1EL0 A;  1QVG A;  2BE5 C;  5J22 A;  3M3Y B;  1W6K A;  1VS0 A;  3K8A A;  2KHJ A;  2V4D A;  1YBY A;  2E2I H;  1YJ9 A;  2UUB L;  4JI6 Q;  2A69 C;  2PPB C;  1JB3 A;  1SDF A;  2E8G A;  4AIM A;  4A3B H;  1JJ2 A;  2BH2 A;  1F9P A;  1Q82 C;  4DKA C;  4QQB X;  4LF7 L;  3HOU B;  1GOZ A;  3NHH A;  3TZU A;  3S2H H;  4FNF A;  4B3S L;  4JBM A;  1EUJ A;  3CCM A;  1E2V A;  1GUW A;  4HIK A;  5KYL A;  5HGQ A;  3CW2 C;  1WOC A;  4NXM L;  3PO2 H;  2JJQ A;  1A63 A;  3ITP A;  4ZUJ A;  1WFQ A;  2ICI A;  4DGZ A;  3Q0A A;  5M3F H;  2UXD Q;  4BA2 I;  1AEX A;  2K7V A;  3A7A B;  1FD7 D;  2FXQ A;  3AYH B;  1SN8 A;  4X65 L;  1YNJ D;  3MEF A;  1VQN A;  4Y7N B;  3R2I A;  4DUZ Q;  1MGS A;  2K6A A;  4C2M B;  2BA0 A;  4DR6 Q;  2ATW A;  4LF5 L;  2EQS A;  1HFG A;  1W6J A;  4NXN L;  3K5M A;  1PH8 A;  3K5N A;  3I4M G;  2R92 B;  2B63 G;  1X3G A;  4WOR A;  3J7Y W;  2OT2 A;  3CPW A;  1E2W A;  2F0P A;  2H5X A;  3HZX A;  2WAC A;  3A74 A;  1U5K A;  1Q8I A;  5CV5 A;  5M3M H;  4BBR G;  3JAM c;  5CC4 A;  5K5P A;  3J7Z C;  2JK8 A;  4G7O C;  1ASZ A;  2VB3 X;  2F0S A;  4JI1 L;  4DV4 L;  4MHE A;  1CSQ A;  4B08 A;  3T1Y Q;  4RKL A;  5C5L A;  3KF6 A;  4OX9 L;  2KED A;  3GTO B;  1ZXT A;  1HNZ Q;  2L1B A;  4IPD A;  3DEP A;  1JMC A;  4FXG C;  2DNE A;  1BNZ A;  2XNA C;  1PRT B;  1PH4 A;  3HOZ H;  1XYI A;  4KK7 A;  4PMW A;  4B3M Q;  2E2J B;  3G71 A;  3MHB A;  1XNR Q;  4IUU A;  1SSO A;  4P2C B;  3UDG A;  2G9D A;  4FF2 A;  4IPC A;  1EEI D;  4GKK L;  4AQY L;  5I9P A;  5IT9 E;  1O7Z A;  2K5Q A;  1DOL A;  3NBH A;  3VR5 A;  1GJX A;  4QMG A;  1JE5 A;  3TSS A;  2BE5 D;  1M8A A;  3RN2 A;  3RZD H;  3J81 i;  2QA4 A;  1EWI A;  5JEA G;  5C3W A;  2A69 D;  5DLQ E;  1JWU D;  2PI2 E;  1SMX A;  3C1E A;  1TQO A;  2Z8L A;  1AE2 A;  4QUC A;  3PUW A;  1VQD A;  1BR9 A;  4JI4 Q;  1AFP A;  3GTP B;  5COR A;  4HIM A;  2NVX H;  2D0O A;  2R93 G;  4DR3 L;  5LL6 X;  3S1M B;  4JOI C;  1PFB A;  2KHS A;  2UXC L;  1KAW A;  1HUN A;  2WP8 J;  3E9I A;  4FF4 A;  4H0L C;  1H9R A;  2IX1 A;  2MO1 A;  3VYS A;  3NWS A;  3M4Q A;  2HCC A;  3EQL C;  3CC7 A;  3HOY H;  4CJ2 C;  5M5W B;  2EY2 A;  2UUC L;  2PQE A;  4FP5 D;  1HQM C;  3ERO A;  1SNC A;  2J0T D;  4L5S A;  3KDF A;  1TXY A;  2ENB A;  2AHO B;  1Z47 A;  4A3D G;  3CCQ A;  1EIH A;  4R4T A;  2R7Z G;  2I5L X;  4UP7 A;  4DR7 L;  4DR4 Q;  1DM0 B;  1I3Q B;  3I2Z A;  4U67 3;  3TP8 A;  5GAG C;  1KL9 A;  3M4Y A;  3CXC A;  1K73 C;  3TRZ A;  4OIJ A;  1TWF H;  4L5Q A;  4DK6 C;  1N34 Q;  4HJA A;  5D65 A;  2F3I A;  1I4G A;  1IKL A;  4ID6 A;  1KTK A;  2VQF Q;  2R7Z B;  3B6Y A;  5KIX A;  2DN8 A;  1YJW A;  1XMQ Q;  1C0A A;  1PV4 A;  1I50 H;  2Z0S A;  1SRO A;  2ZM6 Q;  1Q86 C;  2BH8 A;  4JPB W;  4DU9 A;  1LAB A;  4LF6 Q;  4QB4 A;  1STH A;  5I6W A;  1IHZ A;  1I94 Q;  1DXM A;  1WTH A;  3OPO A;  1CUK A;  4DAM A;  5JJK A;  3KLW A;  1A15 A;  1VQP A;  3PF5 A;  1D1K A;  1ZEQ X;  2EYH A;  2QW7 A;  2ASB A;  5I2Y A;  3SDZ A;  4P73 A;  4WFN 3;  1CK1 A;  3QJY A;  4M1U B;  2Z9H A;  1VQ6 A;  2K5N A;  1ICF B;  2IHE A;  3I72 A;  5F2D A;  1G6Z A;  2LY7 A;  1Y1W G;  2V1C C;  3H91 A;  5ELB A;  1LO5 D;  3GTO H;  2SNS A;  1N36 Q;  1D5Z C;  1I5F A;  4EQP A;  4K5V A;  3DWQ A;  3G6E A;  3HKS A;  1M90 C;  1EWC A;  1F9R A;  3AQQ A;  5EPJ A;  5GQO A;  4QUF A;  1NTG A;  3J7A V;  1B9M A;  1TS2 A;  5D3I B;  1TWG H;  5C0X H;  2ZJQ A;  2A74 C;  1RTO A;  4R4O A;  1UWV A;  1S5C D;  1HZA A;  1X3P A;  1QUQ A;  3E6Z X;  3K57 A;  1K0R A;  4A3M H;  3UDX A;  4JW0 A;  1XJV A;  4TQU S;  5D3D A;  1XPR A;  3F2C A;  4AYB G;  4RCN A;  2LXK A;  1EY9 A;  2K33 A;  3MVV A;  3PUZ A;  2JA8 G;  2KCM A;  4A3G H;  3S16 B;  4F7X A;  3KBX A;  1ZKO A;  4NPS A;  2E5L L;  1UNS A;  1J6Q A;  3J81 E;  3PUY A;  4DV2 Q;  1P16 A;  2EVB A;  3RR5 A;  3ULP A;  2JYO A;  3BVG A;  4TRD A;  1KAA A;  1EQV A;  1WI5 A;  1IBK Q;  4C3J H;  4A3J G;  4LFA Q;  1L0W A;  2DJG C;  4DR1 Q;  1SAP A; 
#chains in the Genus database with same CATH homology
 4XYO A;  2AWN A;  1A3V A;  3A8J E;  3HRZ C;  1ESF A;  1WTX A;  1QNK A;  3MTS A;  1HA5 A;  3ND9 A;  3OIQ A;  5IOC A;  4K14 A;  4OO1 H;  2FMC A;  3GTM B;  2HDM A;  5ELC A;  2PZW A;  3SK6 A;  1U4M A;  4XDX A;  5CBA E;  2B39 A;  1TVX A;  5ELD A;  3OMC A;  3GO5 A;  4HED A;  1O7L A;  1G8Z D;  4KKT A;  4ZQ3 A;  4J6H A;  1PRT F;  1MSH A;  1L0X B;  3S1N B;  1D6E C;  1BCP C;  1C48 A;  2Y0S B;  3R93 A;  5BN4 A;  1R4Q B;  5EBD A;  3P1H A;  2XN9 C;  2IJ0 A;  1STN A;  1EY7 A;  2NYZ D;  5C6A A;  2PNR C;  2FFK B;  3OMG A;  4S3S A;  3MZ5 A;  1PMR A;  3C3L A;  1VF5 C;  1AP0 A;  3VA5 A;  1BUV T;  2RA4 A;  1OXT A;  1SYB A;  2RDH A;  2WKD A;  2K28 A;  1MI2 A;  1ENF A;  1DCZ A;  4C1N I;  1BCP B;  4B9W A;  1EYC A;  4KY5 A;  2XVS A;  4RA8 A;  5JOB A;  1I4R A;  4NKL A;  1T5X D;  1E0B A;  1EY8 A;  1WCM B;  2C9O A;  1H9K A;  3PMF A;  2VUM B;  1NSN S;  2K5D A;  2AUK A;  4U68 A;  1TII D;  3ERQ A;  3GV6 A;  1ICW A;  2D62 A;  1PXU A;  5CV7 A;  1Q1E A;  1L0Y B;  4FF3 A;  1I4H A;  1MD2 D;  4UAI A;  1H9S B;  3WDN A;  3FDT A;  1JWM D;  1CZG A;  1YNN C;  4I7Z C;  1D1I A;  4LAA A;  1EY4 A;  1I4Q A;  4RH6 A;  1CI3 M;  3BVZ A;  4C3I B;  4X3K A;  1MBY A;  4OHJ A;  4HMJ A;  1S4Z A;  5DEH A;  2F0N A;  3D4W A;  4ZRZ A;  1EYD A;  3C1F A;  3CHB D;  2B8G A;  1B44 D;  2QIL A;  1SE4 A;  3Q24 A;  2I46 A;  4K5X A;  2JXM B;  3X3N A;  2E2I B;  2WIN B;  4XYQ A;  1LT6 D;  4A3B B;  3VR4 A;  3PIP 3;  4OL7 A;  1ILQ A;  4KKU A;  2IL8 A;  3NUC A;  1BCP D;  1EY6 A;  3MAQ A;  4IFD G;  1SNO A;  3S2H B;  1F2Y A;  3I70 A;  1A6X A;  4H7B A;  1JQY D;  1MSG A;  5HUR A;  3ONA B;  3PO2 B;  4KTA A;  3WOE A;  1LTT D;  3IFD A;  5M3F B;  2O2L D;  2VB2 X;  3MA2 B;  4KJN A;  1FNV A;  3KUP A;  1XXG A;  3J80 E;  4TSS A;  1AN8 A;  2EYP A;  1EOT A;  4L63 B;  2QKI C;  1HXY D;  4WJW A;  1QWY A;  5KRU A;  3A8I E;  2EDG A;  5T1I A;  4PV1 C;  2F0H A;  4X3U A;  3QO2 A;  3U9S A;  1G2S A;  5A2Q L;  1Q1B A;  2A68 C;  3BDL A;  1LTR D;  4MN3 A;  3J7A F;  2Q8R E;  2TSS A;  1D5M C;  5M3M B;  2HCI A;  1IYU A;  5COY A;  1JWS D;  3QOJ A;  2PW7 A;  4ZLT F;  1YNN D;  4G57 A;  3VYU A;  2OXP A;  4FXD A;  2RSO A;  3D6C A;  2F0I A;  4IUV A;  3BG3 A;  4FVM A;  3T56 B;  4IUT A;  3HOZ B;  3KBG A;  1LT4 D;  1EWH A;  1IKM A;  4B9X A;  5HGT A;  2AQ3 B;  5DM6 3;  1STB A;  2LS0 1;  1GUT A;  1A2U A;  4J1M A;  4CHT B;  2WB1 B;  4RFB A;  1X32 A;  2A6E C;  1PDQ A;  1F9S A;  2L4N A;  3RZD B;  1JC7 A;  3NK9 A;  3QB3 A;  4MIU A;  1OXX K;  4IUP A;  4F88 A;  5JPM C;  4Q0F A;  2F0J A;  3HP3 A;  3KLR A;  1A3T A;  2D2C C;  1OXU A;  3K5O A;  4DAV A;  4ZAI A;  2KUM A;  2FJ2 A;  1WTR A;  2IX3 A;  2Z4I A;  2NVX B;  4K5W A;  1PFM A;  4BA1 I;  4OIK A;  3SE0 A;  3TP7 A;  4DN4 M;  5FO9 B;  1BCP F;  2B2Y C;  3NPP A;  3H94 A;  2F0E A;  4DK1 A;  3HOY B;  2BOS A;  4BWG B;  3O13 A;  2RVL A;  1II3 A;  3OWF A;  3FEW X;  1ILP A;  1RCV D;  5IOD A;  3VA7 A;  1CQV A;  2QCP X;  4Z9C B;  1FR3 A;  5TSS A;  3SHL A;  4IZ8 A;  3X3M A;  5C0X J;  3QWN A;  1TWF B;  1WTV A;  1EYA A;  2B2W C;  2A68 D;  3SVM A;  2A6H C;  4X3S A;  4KY7 A;  5FOB B;  1PRT C;  1ZYR C;  4EVO A;  1I50 B;  3LNN A;  3P75 A;  1TS3 A;  3CKI B;  5C0X G;  1HHV A;  1NAP A;  3OHX C;  4R9W A;  1QB5 D;  4KMU C;  3NQT A;  2RSN A;  2ZXP A;  2L55 A;  1NR4 A;  3L7Z C;  2EYF A;  3URY A;  5C4Z A;  1G2T A;  4R8I A;  1TWG B;  5K36 G;  2F0V A;  2A6E D;  1B53 A;  4A3M B;  1ML0 D;  2KCN A;  4RAU C;  4IFD I;  2EJM A;  2F0K A;  4K8J A;  4C3J G;  3SXH A;  2KA7 A;  3V05 A;  4A3G B;  1X3Q A;  4BS9 A;  1M4V A;  4ZYS A;  2EYL A;  4CJ1 B;  4OO1 G;  5I4D A;  4C3J B;  1G29 1;  1Q90 A;  3IFT A;  3M7G A;  3JAM E;  3M4O B;  2L0C A;  4KV6 A;  2F0L A;  2FHT A;  4RHR A;  5JVH 3;  1S5D D;  3MFY A;  3S17 B;  3TME A;  4FF1 A;  1TS5 A;  1DJR D;  1QG7 A;  2EYJ A;  4LJZ C;  5LHY 1;  1PTO H;  2DY7 A;  2O5J C;  5IGD A;  3GTG B;  3VYT A;  4E6I A;  5EGT A;  1OXS C;  2DY8 A;  3AU7 A;  1GUO A;  1B4O A;  4HAE A;  1PYW D;  3I91 A;  2A6H D;  1SFO B;  3NSW A;  1PRT D;  1ZYR D;  5FK9 C;  4HMI A;  1V1P B;  1DYQ A;  1KNA A;  1BXT A;  2LKV A;  3K6O A;  4LMQ D;  4EGV A;  5JAV A;  2KJX A;  2IPK D;  3I4N B;  2WKC A;  3MC0 B;  5EKL A;  3NTK A;  1R9T B;  4K6D A;  2F03 A;  3A7L A;  3IL8 A;  4KJO A;  1FYC A;  1LTA D;  4DF7 A;  3VYR A;  1J8I A;  1S5F D;  1F2L A;  2RDF A;  4A3K B;  4FO2 A;  3MXN A;  5IGG A;  3WOF A;  1H9S A;  2JSO A;  1E2Z A;  4O42 A;  4ME5 A;  1HPC A;  3H09 A;  3HOV B;  2SDF A;  4CKB A;  4LK1 C;  2LFN A;  1UEA B;  2NN6 G;  2L12 A;  1GUG A;  3A54 A;  1SNM A;  2F0O A;  2NB0 A;  1A3U A;  3N52 A;  1HFN A;  1EU3 A;  2JA7 B;  4KN7 C;  4IUQ A;  3T51 B;  5C5M A;  2K04 A;  2F0M A;  1HTL D;  4HTH A;  2B2V C;  1ENC A;  1BDO A;  5A2Q E;  2ZXO A;  1SYF A;  1DON A;  2B2T C;  2BDN A;  4RGT A;  1WTW A;  3AB9 A;  5I9O A;  2F0U A;  4A3F B;  1T5E A;  1U4R A;  5JEA H;  3ND8 A;  4A93 B;  1EQT A;  1NCV A;  3BDC A;  3UI2 A;  4KN4 C;  5C0X I;  2O4X A;  3FVQ A;  2N55 A;  3LWE A;  3TDQ A;  1BOS A;  4ILW A;  3SK4 A;  2X6G A;  3BYY B;  5FO7 B;  2NVT B;  3BS1 A;  3NWT A;  4DXF A;  4XT3 B;  4DK0 A;  3M85 A;  5C44 B;  3S15 B;  1C8C A;  2Z4H A;  3GV3 A;  1STA A;  4I65 A;  1SEB D;  3NTH A;  3RUZ A;  2HUG A;  1BQQ T;  1LT3 D;  2F0F A;  5EKK A;  1UUP A;  5BN3 A;  4EQN A;  1DOM A;  2R3Z A;  2CVR A;  5IT9 L;  1NR2 A;  2EPB A;  3DHQ A;  4J8Q A;  2NUC A;  1KLU D;  3MXP A;  3I8Z A;  5DNF A;  5M5Y B;  1K83 B;  2QF7 A;  3MXU A;  2K03 A;  4OO1 I;  2MUY A;  4NMZ A;  3G7L A;  2PZU A;  2K05 A;  1HCZ A;  2RKS A;  5CV8 A;  2E74 C;  5A35 A;  3W2D A;  4NP5 A;  1UAP A;  4C3I G;  1TT2 A;  2AQ2 B;  5T1G A;  1LAC A;  4PMB A;  3HOW B;  1TWC B;  4FXK C;  2L11 A;  2CW0 C;  2A73 B;  4OGQ C;  1GHJ A;  3NQI A;  1CFM A;  1SXT A;  5ELF A;  5I2X A;  2XRS D;  1CTM A;  2KVM A;  3L3O C;  2R61 A;  3SK8 A;  3OWE B;  5ELE A;  2YYZ A;  3D31 A;  3K7A B;  1IL8 A;  2JA5 B;  4HCS A;  3V2T A;  3ZYY X;  1LTB D;  5G3L F;  1SNQ A;  2SOB A;  1KLG D;  5IIF A;  5BN5 A;  4RCO A;  1SND A;  2NVQ B;  3RD4 A;  1SE3 A;  2EJG C;  2KEC A;  2OEO A;  1QCB D;  4F8M A;  3DM1 A;  5EPL A;  3Q22 A;  1Z6H A;  4XIG S;  3DXJ C;  3S14 B;  3CRL C;  5C4J B;  2Z1C A;  3RMH A;  4C1N K;  4RKB A;  4ODG A;  3D3R A;  2MPM A;  2FMM A;  2B2Y A;  4KD3 A;  3LX0 A;  1Y1V B;  1TU2 B;  3FPU B;  2F3V A;  4BY1 B;  1HUM A;  1LTS D;  2IWH A;  1SE2 A;  1V1O A;  2RBM A;  1HA6 A;  4PQX A;  1B50 A;  1BO0 A;  2NN6 I;  2ICE C;  3KLS X;  3HOX B;  3MXG A;  2NWG A;  1JOO A;  2ID0 A;  4A3I B;  2I07 B;  3D4R A;  1OO9 B;  3PUX A;  2PMZ B;  2B2W A;  3A56 A;  3J81 L;  1D2B A;  1WD0 A;  4H13 C;  3S2D B;  2B2U C;  1KAB A;  2E2H B;  3NBI A;  2JEB I;  1I6H B;  1D5X C;  1I4X A;  2CW0 D;  2LMC B;  3W3A A;  3H0G B;  3T4A C;  1QE6 A;  2J4X A;  1V8Q A;  4KY6 A;  5C3E B;  2MHV A;  3Q23 A;  1PFN A;  4PMC A;  1RHP A;  3T53 B;  2EE1 A;  3HEJ A;  5FLX L;  3PV0 A;  1SJH D;  4KD4 A;  5I6Y A;  1XX8 A;  4QCL A;  2G9H D;  5FKA C;  4IUR A;  2O5I C;  4NW2 A;  4ZKB B;  3TZD A;  3R8B A;  2EY6 A;  2KQ3 A;  4G7Z C;  3PIO 3;  1JIC A;  4KHV A;  3V96 A;  2A5H A;  1PTO C;  1DOK A;  5EPK A;  3DMU A;  1Y8P B;  4ZK9 B;  1WVL A;  5JPN C;  3EVQ A;  1ENA A;  1FGB D;  2D5D A;  4RWS C;  5E1F A;  5NUC A;  3CU7 A;  4C3H G;  2KEE A;  2PO4 A;  1TY0 A;  2IT1 A;  4JK1 C;  3GTJ B;  5IGC A;  1STE A;  4RGN A;  4G4K A;  3TP5 A;  1CHQ D;  1WTO A;  1V1P A;  2H1E A;  1PTO B;  1Y8N B;  4C3H B;  4NDX A;  5D14 A;  1TKW B;  1JE4 A;  4XQQ A;  4XXE A;  1JOQ A;  1V43 A;  1H9J A;  1SMY C;  4V0B A;  3S1R B;  1ET9 A;  1GUN A;  4IFD H;  5EQ0 A;  4N9P A;  5IGF A;  4RHS A;  4M8A A;  1SBB B;  1PLF A;  2FIN B;  2Q8T A;  4K2K A;  1EY0 A;  4FYD A;  5CV6 A;  3P7J A;  1LLR D;  5EJW A;  2RDG A;  1AZQ A;  1RF2 D;  3R3O A;  2K5W A;  4TKO B;  2XIW A;  3SK5 A;  1ET6 A;  5KNB A;  1RJT A;  1BBX C;  1PZI D;  5IGB A;  3I4M B;  2B63 B;  1LTG D;  2PZT A;  3BDO A;  1GUS A;  3BYT B;  1B3A A;  2J7Z A;  5JEA J;  2SEB D;  4H44 C;  4CBV A;  4CJ0 B;  4IAL A;  3NTI A;  3Q6S A;  3I4L A;  4L6T B;  3E5S A;  4BBR B;  2MP1 A;  2XSC A;  1JCK B;  1PTO D;  4DAP A;  5KEE A;  3K5L A;  2F3W A;  1FNW A;  2JE6 I;  5DAU A;  1F2M A;  3FPP A;  1WTP A;  4K2L A;  1J9O A;  4F87 A;  1FNU A;  3R2T A;  2DNC A;  3FMC A;  3M7N A;  5CV9 A;  1SNP A;  3VR6 A;  3J80 L;  2B2V A;  1VCI A;  1ROD A;  3OSO A;  1IW7 C;  3TP6 A;  3D4D A;  1HRJ A;  1LTI D;  3VR2 A;  2B2T A;  3I3C A;  2RQX A;  3VR3 A;  1F77 A;  5KND A;  4ULL A;  4DNR B;  5EBC A;  2EYM A;  5CGK A;  1WTQ A;  1ONL A;  2F1M A;  5CV4 A;  1G91 A;  1EU4 A;  1SMY D;  2R93 B;  2CQA A;  1U4L A;  1VMP A;  2M2L A;  2Q8I B;  2PW5 A;  2NVY B;  3QOL A;  4DA2 A;  4ZUI A;  2HQE A;  4N9T A;  1F2Z A;  1B9N A;  1LT5 D;  2F0D A;  2QEJ C;  2B8F A;  1KDA A;  4DNT B;  1C4Q A;  4UDU C;  3K59 A;  2AUJ D;  4K8I A;  2F4I A;  1R4P B;  2ZXR A;  2EY5 A;  3E0J A;  3DWA A;  4A3D B;  1CT1 D;  3NE5 B;  3GP7 A;  3HS0 C;  2IX0 A;  2L5T A;  2MJ8 A;  5J1Z A;  1CHP D;  1S5B D;  4JBW A;  2L9H A;  2SNM A;  1AZP A;  3NP8 A;  4DXG A;  4K6L A;  3KLS A;  4HSP A;  1CA5 A;  1TY2 A;  4RGO S;  4GZY C;  2PYK A;  3H3V C;  1EEF D;  1HTP A;  2F0W A;  5M5X B;  1PZK D;  2K1B A;  1EIG A;  5AFW A;  4XTC S;  2GA4 B;  1PTO F;  2K32 A;  5CR3 A;  3AMU A;  3H6M A;  1KDB A;  1Y1W B;  1U4P A;  5J39 A;  1DZ1 A;  1QNU A;  3MEH A;  2XWB B;  3LWU A;  1O7Y A;  5K36 H;  5C3X A;  1JOR A;  1IW7 D;  2AWO A;  2WV6 D;  2XWJ B;  2X69 A;  2BCO A;  3OOC A;  3RLF A;  4AYB B;  3GTK B;  2NZ1 D;  5G3L D;  4IQZ A;  1PZJ D;  3C46 A;  1TR5 A;  2C5C A;  1I4P A;  3D8G A;  2JA8 B;  3GTQ B;  2WII B;  4CKE A;  5E3F A;  1H9M A;  3KF8 A;  1Y69 U;  4HN7 A;  3G6J B;  1RDP D;  1XWE A;  5FLX E;  2R6G A;  4A3J B;  5ISR A;  5DM7 3;  2WAQ B;  1EZ8 A;  3OIP A;  4A3E B;  1SYG A;  2EOT A;  5KYI A;  1B1Z A;  5M9O A;  1O80 A;  3MWY W;  3N6R A;  1TWA B;  2YU9 B;  1SYC A;  1IYV A;  3A8K E;  3SEB A;  3TN2 A;  3HGB A;  5E4W C;  1QJO A;  1SYE A;  2TMP A;  2OF1 A;  4R8N A;  3F2U A;  2QDB A;  1B2T A;  3GQB A;  2EYO A;  3K0Y A;  1CM9 A;  4KKS A;  3PUV A;  1EY5 A;  2PCF B;  2BA1 A;  3T16 A;  2D9U A;  1U9R A;  1K8M A;  3T13 A;  5CYU A;  2F0G A;  3QIA A;  5JVG 3;  2B2U A;  4XQJ A;  3QG1 A;  3SR1 A;  1OXV A;  3BVM A;  3RZO B;  3EJI A;  4C56 C;  3EFX D;  5KGU A;  3JAM L;  3KK7 A;  2CHB D;  2KOL A;  1CQF A;  3FKI B;  1Y8O B;  1XTC D;  1VMC A;  2HDL A;  3U9O A;  3S1Q B;  2E76 C;  2JA6 B;  2ZT9 C;  4QF4 A;  4L8J A;  2N88 A;  5KNC A;  5LL6 S;  1ESR A;  3IKJ A;  4DAY A;  1K8O A;  2E2D C;  4BY7 B;  4IUN A;  4EQO A;  1TS4 A;  1RTN A;  4YIJ A;  1SYD A;  5E4X A;  3IAY A;  1Q3L A;  2AQ1 B;  1VF7 A;  3D6W A;  2NN6 H;  3BZD B;  1JR0 D;  5C4H A;  1S5E D;  3GTL B;  1VDZ A;  4QIW B;  3NXW A;  2EJF C;  4HSV A;  4KHZ A;  3CRK C;  4IFD J;  3PO3 B;  4XT1 B;  1SJE D;  1LV9 A;  3DWP A;  2F0Q A;  1RD9 D;  1HQR D;  4XQN A;  1QIL A;  2EXZ A;  3FRP B;  1KDC A;  1AW7 A;  2M00 A;  1DD2 A;  2IW3 A;  3HG9 A;  4PNY A;  3OW7 A;  3EA6 A;  1RKN A;  3TBI B;  5EKI A;  2NTS A;  3C2P A;  2NTT A;  4HCE A;  1QOH A;  4HR7 B;  2EY1 A;  4X3T A;  1O78 A;  1Z7T A;  4V19 0;  3P20 A;  2F0T A;  2E75 C;  4ZKC B;  3S9W A;  1CZW A;  2NBF A;  4KI0 A;  3I90 A;  5FO8 B;  1A2T A;  4O1N A;  1YNJ C;  4RGM A;  2JP1 A;  3CQZ B;  1EFI D;  2M9V A;  5C4X B;  5IGE A;  5CBE E;  3DEO A;  2JEA I;  5JJZ A;  3A55 A;  3HKZ B;  2MGS A;  4IN3 A;  2XRQ D;  3L9A X;  4DFA A;  1TWH B;  4CKC A;  3MFG A;  1JOK A;  4ABN A;  2K01 A;  1GXD C;  2EZV A;  4CGY B;  4G7H C;  2KCC A;  3DUZ A;  1NUC A;  4WRD A;  2VXW A;  1STY A;  3I73 A;  1BF4 A;  3GD7 A;  1F9Q A;  4Q5V A;  4BBS B;  1STG A;  1CA6 A;  1EZ6 A;  1GHK A;  2VNU D;  1WD1 A;  1KNE A;  3K58 A;  1I6V C;  2BDO A;  5CMD A;  1Q12 A;  2X6L A;  1EL0 A;  2BE5 C;  5J22 A;  3M3Y B;  1W6K A;  2V4D A;  2A69 C;  2PPB C;  1JB3 A;  1SDF A;  1F9P A;  3HOU B;  1GOZ A;  3NHH A;  3TZU A;  4FNF A;  1E2V A;  1GUW A;  5KYL A;  3ITP A;  4ZUJ A;  2ICI A;  3Q0A A;  4DGZ A;  4BA2 I;  1AEX A;  2K7V A;  3A7A B;  1FD7 D;  1YNJ D;  4Y7N B;  3R2I A;  1MGS A;  2K6A A;  4C2M B;  2BA0 A;  1HFG A;  1W6J A;  3K5M A;  3K5N A;  2R92 B;  4WOR A;  3J7Y W;  2OT2 A;  1E2W A;  2F0P A;  3HZX A;  2WAC A;  1Q8I A;  5CV5 A;  5CC4 A;  5K5P A;  4G7O C;  2VB3 X;  2F0S A;  4MHE A;  4B08 A;  4RKL A;  5C5L A;  2KED A;  3GTO B;  1ZXT A;  2L1B A;  3DEP A;  4FXG C;  2DNE A;  1BNZ A;  2XNA C;  1PRT B;  1XYI A;  4KK7 A;  4PMW A;  2E2J B;  3MHB A;  4IUU A;  1SSO A;  4P2C B;  2G9D A;  4FF2 A;  1EEI D;  5I9P A;  5IT9 E;  1O7Z A;  2K5Q A;  1DOL A;  3NBH A;  3VR5 A;  1GJX A;  4QMG A;  3TSS A;  2BE5 D;  1M8A A;  5JEA G;  5C3W A;  2A69 D;  1JWU D;  3C1E A;  1TQO A;  2Z8L A;  4QUC A;  3PUW A;  1BR9 A;  1AFP A;  3GTP B;  5COR A;  5LL6 X;  3S1M B;  1PFB A;  2KHS A;  1HUN A;  2WP8 J;  4FF4 A;  4H0L C;  1H9R A;  2IX1 A;  3VYS A;  3NWS A;  2HCC A;  3EQL C;  4CJ2 C;  5M5W B;  2EY2 A;  2PQE A;  4FP5 D;  1HQM C;  3ERO A;  1SNC A;  2J0T D;  2ENB A;  1Z47 A;  1EIH A;  1DM0 B;  1I3Q B;  4U67 3;  3TP8 A;  3M4Y A;  4OIJ A;  5D65 A;  1I4G A;  1IKL A;  4ID6 A;  1KTK A;  2R7Z B;  5KIX A;  2DN8 A;  4DU9 A;  1LAB A;  4QB4 A;  1STH A;  5I6W A;  1IHZ A;  1DXM A;  3OPO A;  1A15 A;  1D1K A;  1ZEQ X;  2EYH A;  5I2Y A;  3SDZ A;  4WFN 3;  1CK1 A;  3QJY A;  4M1U B;  3I72 A;  5F2D A;  1G6Z A;  2LY7 A;  3H91 A;  5ELB A;  1LO5 D;  2SNS A;  1D5Z C;  4EQP A;  4K5V A;  3DWQ A;  1EWC A;  1F9R A;  3J7A V;  5EPJ A;  4QUF A;  1B9M A;  1TS2 A;  5D3I B;  5C0X H;  2A74 C;  1RTO A;  1S5C D;  1X3P A;  3E6Z X;  3K57 A;  4TQU S;  5D3D A;  4RCN A;  1EY9 A;  2K33 A;  3MVV A;  3PUZ A;  3S16 B;  4F7X A;  3KBX A;  1ZKO A;  1UNS A;  3J81 E;  3PUY A;  2EVB A;  2JYO A;  3BVG A;  4TRD A;  1KAA A;  1EQV A;  2H4O A;  1SAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...