2WKCA

Crystal structure from a single-stranded dna binding protein from the lactococcal phage p2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
90
Chain Sequence
GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEKGSNVKVAYGSAFLPDFIQLGDTVTVSGRVQAKESGEYVNYNFVFPTVEKVFIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ORF34P2
publication title Structure and Function of Phage P2 Orf34(P2), a New Type of Single-Stranded DNA Binding Protein.
pubmed doi rcsb
source organism Lactococcus phage p2
total genus 11
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16773 Phage_SSB Lactococcus phage single-stranded DNA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.400 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2wkcA00
2WKDA 2WKCA
chains in the Genus database with same CATH superfamily
2GVAA 3A54A 4HJ8A 1F9SA 1PLFA 1STHA 3KJOA 1KDBA 3MTSA 3R93A 2KOLA 3P7JA 4IN3A 2Q2IA 5C3EH 3DUZA 4NPSA 4YCUA 2VQFL 2YTXA 3EQLC 2B2VA 1KTKA 3GQBA 3T13A 4QIWE 2B2UA 3MFGA 1DD2A 2FXQA 4BY7H 1O7IA 1I4XA 1WFQA 4DR3Q 2Z6KA 1PFNA 1LTSD 4DA2A 4EQOA 3EA6A 1KD1C 5EKIA 1ESRA 3BZKA 4LF6L 1I6HH 2YTYA 5IT9c 2K04A 4HIOA 2Y0SB 5CGKA 3X3MA 1QUQA 2L9HA 4C3IH 1EWHA 1E2ZA 2Q2UA 4DNTB 5DEHA 4KKTA 5KIXA 1N8RC 4QY7A 4DUZL 2OF1A 2K03A 2R92G 5JPMC 4CKCA 5M5YH 3BZDB 2MP1A 1MJCA 1TVXA 1F9QA 2NZHA 3J7AF 4V0BA 3TP6A 2EYOA 4O1NA 3JAME 4Y7NH 1KL9A 2EVBA 2PI2E 1Z47A 4M8AA 1CFMA 3H3VI 2ZJQA 3K81C 3UE1A 4JK1C 4N9PA 1E24A 4EQ5A 3FHWA 4R4TA 1E2VA 5DLQE 1QNUA 1H9RA 1MIUA 4JI3Q 3OMGA 3CD6A 3JAML 4DKAC 2ZT9C 3GDEA 3NBHB 4C3JH 1S5BD 1ZEQX 1VQGA 2IJ0A 2KBNA 2I5LX 1KIXA 2Z4IA 5HGTA 1F2MA 1HUNA 5E4XA 1TWCH 2EYLA 4XQNA 5DM63 4AYBG 3I4MB 3ONAB 2Y0SE 4P2CB 4DGZA 3OMCA 2BOSA 3HOWG 1YI2A 5LMNL 4FF2A 1A3TA 1PYWD 3S1RH 1NR2A 2CH4A 3I2ZA 3CU7A 2Z6BA 2K5DA 3HOZH 2D9UA 3Q6SA 4KKUA 3CCRA 1ET9A 1QCBD 1D7QA 4BY1B 3CCVA 1HR0L 1VQLA 1GHKA 2CH4W 1ICWA 3HKSA 3KBXA 1D5ZC 1TS5A 3T1HL 4RHSA 3J81c 5C0XG 3MXNA 3CAMA 3S16H 2L11A 3GTMH 3AFPA 4DR6Q 1HPCA 2F52A 5E3FA 1F77A 4OHJA 5M5WB 2DY7A 4RGTA 1LYLA 2B2VC 2PI2A 1A63A 1R4PB 1S5FD 1IBML 4JYAL 4A93B 2HQEA 2J0TD 4IFDH 2E2HH 1EIGA 4A3GG 2X69A 1QILA 3IRBA 4U68A 3L0OA 3OHXC 2NVYH 4B9WA 5JVH3 1NAPA 2XNAC 3TMEA 1X54A 1UE7A 3HOUG 4OL7A 5ELFA 4HJ7A 1HNXL 2J4XA 1A15A 2D2CC 4R4IA 1I4HA 5CV5A 1G2SA 4DAVA 4CJ1B 2QKIC 1VQ8A 4DR1L 1B7YB 1CSPA 1LT4D 4CJ0B 4H7BA 3DXJC 1VQBA 1UE6A 3HKZB 1MD2D 3RR5A 4A3DH 3K7AB 3ICEA 2MJ8A 1S4ZA 1C0AA 1Q46A 4GLAC 3I70A 2F0PA 2UU9L 1N32Q 1PH1A 1NUCA 4GOPB 1RHPA 3EJIA 3B6YA 2K5QA 1JOQA 3FPUB 4J8QA 4DK1A 4V190 1RD9D 2KCCA 2L15A 1DZ1A 3RD4A 4YY3Q 1XPOA 1D2BA 4FF4A 3CCLA 2IHFA 4OIJA 1VMCA 4KTAA 1IYJB 4QB4A 4A3IG 3PSIA 2VUMH 1W6KA 4OEMB 3BDLA 5FLXE 4R4CA 1NCVA 2ZJRA 3NBHA 5DAUA 2OT2A 1BF4A 3P75A 2F0QA 1EFID 1JE4A 5JEAJ 4A3LG 4BBRB 1IKMA 4DR4Q 1NBWA 3KLRA 4XT3B 2ZJPA 3HKZE 3U4VA 1RIPA 2QCPX 4HEDA 4UPAA 1T5EA 3KOJA 2R7DA 1W6JA 3VR3A 4LF5L 3FRPB 3T53B 3BG3A 1EYCA 5I6YA 1ILQA 3D4RA 4PQXA 3S14B 5FKAC 2R6GA 1C48A 2BH2A 1G6ZA 3PO3H 4KHPL 4KHZA 5BR8L 4ZRZA 5I2YA 4OELB 2IY5B 4B3SQ 3HRZC 3CKIB 2K28A 1PH6A 4C1NI 5IY0A 4WORA 4NXMQ 2LSSA 1F9PA 2ATWA 3H0GB 3I4NG 4RGOS 3UDFA 5M3MB 3K0YA 4HJAA 1XWEA 4DU9A 1S5CD 3NQIA 2NYZD 3W3AA 1TWFB 1SNMA 1UNSA 2P5ZX 2RCFA 1B3AA 3GTGB 4IPCA 2PPBC 2F0UA 5GROA 4QUCA 2B8FA 1V1PB 4JBWA 5KRUA 2B2TA 4A3GB 2EQSA 2PQAA 2K5HA 1IYVA 4LUOA 3MXUA 4CKBA 3RN2A 4BWGB 1JMCA 2LY7A 1SROA 2H1EA 2WAQB 1XX8A 3CC7A 1BCPB 4GZYC 3R2TA 1DOLA 4CKEA 3BVZA 3VYUA 4HR7B 1KLGD 2JA8H 4JI6L 1WYDA 1TWAB 4J15A 1PXUA 5LL6X 1EZ6A 1GO3E 1KNAA 4GKJL 4IFDI 5KEEA 3GTLH 5ISRA 3I55A 4YHHQ 1ZYRD 2RSNA 4A3MB 3HGBA 4OONA 3J81j 5I6WA 1U9RA 3BDOA 3A7LA 5C4XB 4BS9A 4DV5Q 1WOCA 2QDBA 1L2FA 4P74A 3NTIA 4HMJA 3MVVA 1YJNA 2DJFC 3KLSX 1PZJD 1D5MC 4AIMA 1N34Q 4GOPA 3CC2A 3M4YA 4GN3B 1U4LA 3PUYA 1I4PA 1SYEA 5FJ8G 1Q3LA 2ZTEA 5HY6A 3J80c 1Q8KA 2B63B 4B3ML 2Q8IB 1TT2A 4FO2A 2XTIA 1FVIA 4G4KA 1YHAA 4B3TQ 1QJOA 2LXJA 3V05A 4RGMA 1N9WA 2WAQE 1O7YA 4BXXG 4TKOB 4A3FH 5CC4A 2VB2X 2JA6B 2R93G 2N55A 4FF3A 2CWAA 1HNWL 1NNXA 4RG1A 3STBD 1VF5C 1RF2D 4RCOA 2EYJA 2N88A 1J5EL 3A0JA 2ZXPA 2L12A 3U9SA 3AB9A 2MUYA 1LTBD 1YNND 1N33L 1G2TA 1DOKA 1J6QA 1I50B 4A3EH 4UP7A 3WDNA 2JA7B 1KNEA 2F4VL 3A5UA 3PO2H 3R3OA 5K36H 1O7ZA 1Y1VG 2XN9C 1SNCA 3BU2A 1X9NA 3FEWX 3OW7A 3GTQB 3HOVH 2F0JA 1EQTA 4FXKC 2D5DA 4IUNA 1EOTA 5GAGC 4ID6A 1STBA 4C3HH 3CQZH 1RKNA 5JEAG 2UUCL 5LL6S 1EEID 2F0VA 2I0QA 1STAA 4LF7L 1EYGA 3MWYW 1HA6A 2B29A 4HAEA 4A3BH 2KA7A 3S24A 1I4RA 4HTHA 2YU9H 1HUMA 3NP8A 2O5JC 2K52A 1Y1WG 4POGA 2L5TA 5L37A 4BA2I 4C2MB 1HZCA 4DF7A 2VQFQ 3HOYH 3S2DB 1E3PA 3HOXB 2NZOA 3E6ZX 1V1PA 2F0NA 2GN5A 1WCMH 1RJTA 4BY7G 5G3LF 2Z4HA 2HD3A 3D3RA 2KCTA 2QW7A 2O5IC 1KRTA 4DAYB 4C56C 4J1MA 1HZBA 1STYA 4JI4L 1B1ZA 3CPFA 3HEJA 4I7ZC 4LF6Q 3QIAA 4A3CH 1AP0A 3SR1A 4DR2L 5I9PA 1SMXA 3RZDH 2O2LD 4NXNL 4LFAL 3S1MB 1BDOA 3NQTA 4APVA 1EWCA 2V4DA 5I9OA 1EIHA 4DUZQ 1EQVA 5M3FB 5EQ0A 1MSHA 2ZTCA 2FMMA 1F9RA 1CZGA 4DXFA 3D4WA 3BDCA 2AWNA 1SJED 2HQLA 1MJEA 1S40A 2C35B 2VXWA 2OWOA 1JWSD 4OO1G 1QUQB 2AMCB 3NHHA 3H3VH 4ZLTF 2Y0SG 1VQJA 2MQHA 3F2DA 1IHZA 2EYFA 4UHVA 5D65A 3PF4A 3GTPH 1SXTA 4ZYSA 4QF4A 1FD7D 1DOMA 4K5WA 1TS3A 3GTOB 3IFDA 2K75A 1MSGA 1EWIA 4LF4L 3GTKH 2SOBA 4LMQD 4FXDA 1UEBA 3GTJH 1V8QA 1WJJA 2CW0C 1HTLD 1SNOA 5EBCA 2E8GA 1AE2A 2NN6H 4IPDA 1K8MA 3DWAA 4DNIA 1KDCA 3I4OA 2R3ZA 1DJRD 1VQ7A 3HZXA 1OXTA 1ET6A 2JJQA 5LMNQ 4RFBA 1EEFD 1AW7A 4YCWA 2E2IB 4MHEA 1GVPA 4HCSA 1QZHA 5FLMH 2PYKA 3L3OC 1JOOA 1PH8A 5A2QL 2HIVA 3E9IA 2D62A 4KJOA 3M3YH 3G71A 1K28A 4MNOA 1A3UA 4GNXB 2F0WA 3AEVA 2A8VA 3AFQA 3ERQA 3TQYA 1HR0Q 2HIXA 5C5LA 1SE4A 1ENCA 1SSOA 2UXBL 1CTMA 1L0XB 3T1HQ 4ZK9B 1B50A 2FFKB 3H15A 2YYZA 5C3EB 1CZWA 4JI7L 3DLLA 1DGSA 2PMZB 4DNRB 3PUVA 3HG9A 4Z9CB 1NSNS 4KKSA 1ASZA 1NMFA 1SRUA 4IZ8A 1D6EC 1B9NA 1IBMQ 4JYAQ 4KY6A 4GS3A 2E5LL 3QJYA 4CBVA 3TZUA 4BY7B 4BY1G 4LFCL 2ZTDA 1VQAA 3KLSA 1Y8PB 2XWBB 2A6EC 4HIDA 1SE8A 3GO5A 3H09A 4DV4L 1WTXA 1F2ZA 4KJNA 1Q12A 3CF5A 1BCPC 2F3IA 1C4QA 2VY3A 2UUAL 5JJLA 3RNUA 2KHJA 4DR7L 1I6HB 3KYHC 3U9OA 1HNXQ 3VR2A 4RCNA 1S5DD 5CORA 2JA9A 1FJGL 4DAYA 1EY5A 4C3IB 2VW9A 4NDXA 4DR1Q 4OXPA 4XXEA 2AQ2B 3UI2A 2G9HD 3ULLA 1QVFA 2A68C 4A93G 5EPJA 5M5YB 1ONLA 3WOFA 1AEXA 3K59A 1GUNA 1CSQA 2PQEA 1A62A 2A74C 4Y7NB 1SE2A 1X32A 4NP5A 2UU9Q 3GD7A 1F2LA 4IOAA 2SDFA 1GJXA 5FOBB 3A8JE 5C3WA 5ELEA 2PMZE 2EJGC 3E5SA 2TMPA 2CCZA 3MHBA 4HCEA 4A3JH 3DEOA 2N78A 1YZ6A 4K2KA 5KYLA 3CMEA 1FGBD 4RH6A 2BCOA 4RGNA 4JI1L 3HKZG 2ICIA 1XMQQ 1KABA 1EU4A 5CMDA 1X65A 1YEZA 4C3JB 2K01A 2VUMG 4ME3A 4U673 3K7UC 4UY8C 4PZ8A 1WTQA 1TWCB 5KNCA 1CA5A 3V2TA 3CRKC 2L4NA 1BVSA 4K14A 1BR9A 4NKLA 1G8ZD 5T1GA 4X62L 3P1HA 4XTCS 1EYAA 4IUUA 3TS0A 2KVMA 3S1RB 1STNA 4UAIA 1R9TH 1JWUD 1Q82C 3SK8A 5IGGA 4DAPA 3HOZB 4LF5Q 4IPGA 3Q22A 1P8LA 2JQOA 2VS1A 1BKBA 1VQNA 1H9MA 2B2YA 1PTOC 3UE0A 2E2JH 1D8LA 1NY4A 1UWVA 3M4PA 1B8AA 1CT1D 2A19A 4UDUC 3VDYA 3SHLA 4KHPQ 3C46A 5BR8Q 1H9KA 2NN6I 1WD1A 4GNXA 4KD3A 2F0FA 2NVQH 4BBRG 4LWCA 3CCSA 4DV0L 1C9OA 3TP5A 1VQ6A 3KF6B 3GTMB 1IBLL 3S16B 1S5ED 1TWHH 3OIPA 2MO1A 2IHEA 3MAQA 1JJ2A 4PMCA 4LF9L 3FKIH 3TZDA 2ASBA 5IWAL 1I3QH 4DAMA 3S17H 1IW7C 5CV7A 1XPUA 5ELOA 2NVTH 3UDXA 1PH4A 2E2HB 4DFAA 4FF1A 1GUTA 5KYIA 1SN8A 3K8AA 1O78A 4Y52H 1PFSA 1UE5A 3OIQA 5IODA 2ZM6L 1ESFA 2NVYB 4WFN3 1QZGA 3QWNA 1LLRD 3S1QH 1R4QB 1BNZA 2MNAA 2KHSA 5F2DA 3M7NA 3H0GG 3RLOA 5M3MG 2PNHA 2EXDA 3FDTA 2JP1A 2AKWB 2NZ1D 1ILPA 3KDFB 1X3QA 4JI6Q 4A3DB 1SYCA 2PQAB 2B3GA 2OCEA 4GKJQ 2B2UC 3VYRA 1JICA 2EDGA 2R7FA 3SE0A 1E7ZA 5LMUL 2JN4A 2EJFC 2Z6KC 1SMYC 5IYDG 1KRSA 1D1IA 3VR4A 2F3WA 2ALYB 1FR3A 5C44H 1JB7A 4BBSH 2B2WA 4ODGA 1GUWA 2WAQG 1HZ9A 1Q7YC 5E7NA 3OTOL 4KY7A 1TS2A 2A6HC 4QCLA 2K6AA 1AE3A 2K5WA 3G6EA 3DMUA 3PUWA 3GP7A 1FL0A 4F87A 1QG7A 1A6XA 4B3MQ 3ND9A 2VUMB 2X6LA 2NTTA 4A3MG 2DY8A 3DWQA 1HHVA 3I73A 4B08A 2KJXA 5C4XG 4A3FG 3FVQA 4X66L 1XNRL 3IAYA 5ELBA 1PH3A 4JG2A 4YIJA 4HJ9A 3K5NA 2HT1A 3OWFA 1HNWQ 3SEBA 1H95A 2EYPA 2Z0SA 1VQDA 4MTKA 1J5EQ 2PZTA 1JORA 5KGUA 3OW2A 2B63G 1VQFA 1AZPA 1N33Q 4FXGC 1DYQA 2OXPA 1SBBB 3T4AC 3AU7A 4DV7L 4DV3L 2JA5H 3PO3B 1U4MA 2K5NA 4FDBA 5IIFA 1VQ9A 2F4VQ 1YITA 3MFYA 4GNXC 4EGVA 2C5CA 1K9MC 3I91A 2JA6G 2OQKA 4R1JA 3CP0A 5JJIA 4R4OA 2PW7A 3HOVG 2PCFB 2L1BA 2QEXA 2NTSA 1HCZA 2SNSA 4RWSC 3M85A 1MBYA 2QF7A 4X3UA 4K5VA 2F0DA 4DK6C 5IYBG 1HNZL 3R8BA 2GVBA 5FLXL 1IBKL 1RL2A 3LNNA 1PMRA 3KF6A 3IL8A 2G5DA 2UUBL 2JA7G 3RZOH 2R92H 2IL8A 1FNWA 2UUCQ 2X6GA 1QOHA 2WIIB 3URYA 2V1CC 4LF7Q 4PV1C 1U4PA 4DR5L 5IP7G 1WCMG 2KUMA 1TY2A 3H6MA 1ENAA 2EXZA 5IGFA 3Q0AA 5IGCA 3NXWA 2VNUD 3DHQA 3EIVA 1PYBA 4TQUS 3SVMA 1G51A 5IOCA 1GXDC 3MEFA 4CDEC 2JA8B 1OXSC 5TSSA 4JI4Q 3GTLB 1PRTF 1JT8A 3Q8DA 3KDFA 1H9SB 3I3CA 4DR2Q 1Q90A 1XNQL 2B2WC 1SNDA 3HOXG 4LFAQ 4NXNQ 3BYYB 1I6VC 3H94A 3LWEA 4RKLA 5COYA 3HOWH 2PW5A 2F0EA 2IT1A 4K8IA 4CGYB 1KDAA 3EBEA 3QG1A 4L5TA 1X55A 2KCMA 4JOIA 1YBYA 3V96A 4A4IA 4HIKA 4OWWB 1ENFA 3NTKA 5E4WC 4HSVA 4X6AH 1E1OA 3M9BA 4JI2Q 3K0XA 5JPNC 1CI3M 1OXUA 1JB3A 1O80A 3CCEA 4AQYL 1SEBD 4B9XA 4P75A 4A3FB 2F03A 1BOSA 3JAMc 2EYMA 5EAYA 3S2HH 2WFWA 5M3FG 5C0XH 2F0GA 1UUPA 3NELA 3K5MA 3TP7A 1EY9A 3M4OH 5CBAE 4TRDA 4LF4Q 1SAPA 5IYCG 3N6RA 5ELDA 2CW0D 1L1OB 1Z7TA 4XYQA 4A3EB 4DV2L 3M4QA 4JI8L 1U0LA 1K73C 1DXMA 3PO2B 3NBIA 2M00A 4JCVE 3CPWA 3TN2A 1SNQA 4X3SA 3VR6A 1KC8C 3RLFA 3HOUH 4OIKA 3T1YL 1YVCA 5D3IB 1K8GA 4X64L 3K57A 1WTHA 3HOVB 3NUCA 2RQXA 5C4JH 3QB3A 1II3A 3O13A 3F2CA 5IT9E 2SEBD 4C3HB 3A5ZB 1CQFA 2JYOA 3CQZB 2UXBQ 1PVOA 5EGTA 4IUPA 4IFDJ 4O42A 1SJHD 4A75A 4A3BB 4R8NA 3VYSA 1Q1BA 2YU9B 4JI7Q 3AYHB 3A8IE 2IX1A 1K83H 4JBMA 5J1ZA 3HOYB 4DUYL 1XTCD 1P16A 1Y8NB 2MGSA 4H0LC 1X3GA 4ALPA 4S3SA 1WCMB 2R7ZH 1SE3A 1I4GA 1W3SA 4ZKCB 1CK1A 4PMWA 1B3QA 1VQ5A 2YTVA 2DNEA 3L7ZC 1NMGA 5CV8A 2E5LQ 4LFCQ 1HZAA 4LFBL 2A6ED 3D6CA 4JI5L 4DV4Q 1KAWA 2QGQA 1A0IA 1BCPD 1LTGD 2UUAQ 4PZ7A 4DN4M 2OTJA 2BE5C 5C3EG 4A3IH 4DR7Q 1LT3D 1LM0A 4R8IA 2M2LA 3L9AX 1STGA 4ILWA 2B2TC 4DK0A 1FJGQ 3ITPA 3RZDB 4CDDC 4X65L 5IP9H 4JV5L 5E1FA 1XPRA 4IALA 4O0AA 4MIUA 2FHTA 2K7VA 3ERSX 4JVZA 3MXPA 1H9SA 2A68D 3S15H 4IUTA 2A1AA 3VA7A 2A69C 3HS0C 1IYUA 3E3XA 4GN4B 1LT5D 1AN8A 4TSSA 3C1EA 3A55A 1FGUA 3NPPA 1Q1EA 2CKZB 2Z9HA 3K5OA 3I7FA 2KEEA 2KEDA 1DONA 1VCIA 4KHVA 4LW1A 1HRJA 3BYTB 4C3IG 5M5XH 5EBDA 1PTOH 4LK1C 1X3EA 3GTPB 4JI1Q 2HDMA 4KD4A 1EL0A 3OOCA 1C7YA 1PRTB 1XTDA 3J7AV 3I4NH 4KN4C 1VQPA 2ZXRA 1EFWA 3J81E 1CA6A 4G7ZC 3A56A 3ZYYX 4GOPC 1QWYA 1X6OA 1FNVA 1EY4A 1Q8IA 3GTJB 3K6OA 3GTKB 3TSSA 2RA4A 1HJPA 5CV9A 4K0KL 3W2DA 3EFXD 4X62Q 1LO5D 1BUVT 1AFPA 1WI5A 5D3DA 3UDGA 1WTVA 4UP9A 2FMCA 1PH9A 1L1OA 1MI2A 1TWGH 5C5MA 3J81L 4GLVB 1SYGA 4ZCKA 4C3JG 5FLXc 3M3YB 1SLJA 5C0XI 1YHQA 1EU3A 2WKCA 3F2UA 1QB5D 1RTNA 3F8TA 3BVGA 1PTOD 3LWUA 1CHPD 1PH7A 4EQPA 1JQYD 2I5MX 4H13C 1YHBA 4KMUC 3JAMi 3X3NA 4FNFA 2DGYA 4DV0Q 1K3BC 2IPKD 3GV6A 1RODA 1SFOH 1IBLQ 1KXLA 1HXYD 3A74A 2CQOA 2KECA 4LF9Q 1EZ8A 3MEHA 5BN5A 5IWAQ 3HOZG 2Q2TA 3D31A 1IW7D 4K5XA 1TXYA 2N49A 3MXGA 1A2UA 3W5OA 1HFGA 1KAAA 4MTNA 2NUCA 2PZUA 4A3KH 4DV6L 3BVMA 1TY0A 2ZM6Q 1XMOL 1TKWB 5FJ8H 1EOVA 4KV6A 4N8X1 5FK9C 4R4QA 2WKDA 4I65A 2Z8LA 3WOEA 1LT6D 5GADC 3HFZB 2HCIA 2IX0A 4BXXH 5C3XA 2R93H 2XGTA 1WTOA 4KN7C 2E74C 4IFDG 1GUSA 1HTPA 4DK3C 4JBKA 1D5XC 3M7GA 2I46A 2F0KA 1PYSB 5LMUQ 2K4KA 1M8AA 1QE6A 3PV0A 1G6PA 1BQQT 1SMYD 2A5HA 1GHJA 1GUOA 1E0BA 3Q23A 3I8ZA 4A3JB 1RCVD 2QEJC 1TU2B 1I94L 4KI0A 1ICFB 3OTOQ 5HGQA 1VDZA 3E0JA 1SYDA 2EY1A 2EY6A 2EY5A 2A6HD 1PFMA 1V43A 4NW2A 1Y1VH 3CC4A 4A3DG 1EUJA 4ZUJA 3TRZA 1JC7A 3UDIA 1VQMA 2F0OA 1M4VA 4ZQ3A 2QDLA 1JJCB 5IGEA 4IUQA 2K05A 4QGUA 2RSOA 2TSSA 5KNBA 3MZ5A 1SDFA 4X66Q 5GAEC 1XNRQ 1VQHA 5JEAH 1EIYB 3IFTA 5J3BA 4P72A 4WRDA 2XRSD 2BDNA 2ZXOA 3DEPA 1WTRA 2HHHL 1L1OC 1R9TB 3HP3A 4GKKL 3CXCA 1VF7A 2N3SA 1Y1WH 1LTTD 2A73B 2RHSB 5C4HA 4LNQA 1XXGA 4XT1B 2MO0A 3ZJYC 2JA5G 1JWMD 3QOJA 2E2JB 4JBJA 2JXMB 1PZID 5M9OA 1Q86C 2NVXH 1YNJC 2F0SA 4DV3Q 4DV7Q 3EROA 4LUZA 4OWTB 3S1NH 2L0CA 3NEMA 1ZXTA 2RF4A 4H44C 2VQEL 1CQVA 2WB1B 4IUVA 2NVQB 4LF8L 1N36L 5H1SE 4OX9L 1PFBA 1SYFA 1TWHB 4B3RL 1NE3A 4GLXA 3TS2A 5BN3A 4FYDA 2I07B 3FKIB 4K6DA 3PGZA 3P20A 1IXRA 1I3QB 2JSOA 1HNZQ 3S17B 1A3VA 1Y8OB 2RKSA 2KQ3A 4EX5A 1IBKQ 2EIFA 1SYBA 2NVTB 3ER0A 2UUBQ 2L55A 3A7AB 3PO3G 4QQBX 5CR3A 3JC66 5BN4A 5C4ZA 2KENA 1PZKD 3S1QB 5LHY1 4DR5Q 4OO1H 1NR4A 4YWLA 5GAHC 2DJGC 1PDQA 3PUXA 1BBWA 3J80E 4Q0FA 4JI0L 4NB3A 1S72A 1VS0A 3CCMA 3VA5A 2BH8A 4LAAA 1W2BA 1HQMC 1HH2P 2ICEC 1FYCA 5AJ3L 4WJ4A 5JJZA 1JCKB 2F0HA 2QA4A 3E9HA 1LACA 4K6LA 3ULJA 2WB1E 4IPHA 1LV9A 2UXCL 1AH9A 3F2BA 2RDGA 3J80L 1KHIA 2XIWA 4J6HA 1YJ9A 4P71A 3N52A 5T1IA 2PZWA 5C44B 1XNQQ 2E2DC 1B53A 1RTOA 2RBMA 4L5QA 3AMUA 4BBSB 3TDQA 4F8MA 3FMCA 2O4XA 1KQSA 4YCVA 1B4OA 1OXVA 2JA8G 3H3VC 1V1OA 5G3LD 4A76A 1BCPF 2RHQB 3QO2A 1Y14B 1E2WA 3S9WA 2M9VA 2CFMA 1SNPA 2R61A 1ASYA 2PO4A 1F2YA 3EVQA 4IJHA 4XYOA 4G7HC 3NTHA 3I4MH 1PRTC 4AQYQ 5J39A 3PIP3 3R2IA 3U4ZA 4L8JA 1XYIA 3PUZA 1G91A 2Z1CA 4M1UB 5J22A 3J7ZC 3C1FA 5K5PA 1UAPA 1QNKA 2Q2HA 2UXDL 4RHRA 5JJKA 4H02A 4DV1L 2G9DA 4DV2Q 1EQQA 1WTPA 4QL5A 1LTAD 3BZCA 4JI8Q 1K3RA 4BY1H 2JA5B 2J7ZA 5DM73 1B2TA 1JE5A 4Q5VA 1KLUD 2K33A 4X3TA 3T1YQ 1SR3A 1WVLA 4X64Q 4HMIA 4C1NK 2JEAI 1T5XD 3NWSA 2FJ2A 5HURA 4KLKA 3CCUA 5M5WH 1CKOA 3U58A 5AFWA 5IGBA 1H9JA 4IOCA 4ZAIA 4P73A 4A3EG 3T51B 4XIGS 4A93H 5LMNW 1K8AC 3RZOB 3D0FA 2R92B 2LFNA 1EY8A 5EJWA 4DR3L 2B2YC 3K80C 4WJWA 3AQQA 3G4SA 1J8IA 3PO2G 5K36G 1X56A 1S3OA 3CMAA 4F88A 1V9PA 2XWJB 4OGQC 2R7ZG 2H4OA 4DUYQ 1B44D 2WINB 2D0OA 4JW0A 2DUDA 3MC0B 1BBXC 1HR0W 2K50A 1XMQL 2H5XA 3E0EA 5JVG3 1PTOF 4I7AA 1OO9B 2KCNA 2FINB 4R9WA 4C3HG 4XDXA 4LFBQ 4JI5Q 3K7AH 4N8FA 3MA2B 3DM1A 4HN7A 1MKHA 2KHIA 1UEAB 3PIO3 2OEOA 4A3BG 2BE5D 4DXGA 3I72A 5IP9G 1K0SA 4ZKBB 4KY5A 4BA1I 4AYBB 3D4DA 4X65Q 3T56B 4DPGA 4JV5Q 4OO1I 3HOYG 2E76C 3SGIA 3L2PA 3J7A5 2AUKA 5NUCA 4JC0A 4IQZA 3HOWB 1CM9A 2EJMA 1PH5A 4JI3L 4G7OC 1LTLA 1OXXK 3CW2C 5ELNA 2A69D 5IE8A 4POFA 4QJFA 4PMBA 2K32A 3A8KE 3G6JB 1EY7A 2K14A 1LUZA 4A3CG 4HSPA 1EYDA 3PCOB 1MHWC 2Q8TA 1A8VA 1CHQD 3CHBD 3KF8B 1M90C 1VQEA 2CHBD 2NB0A 3T16A 4BBRH 3S2HB 1HQRD 2JEBI 2MFIA 1GD7A 3M4OB 2DN8A 3I90A 5JAVA 3SDZA 3TBIB 4QUFA 4MZ9A 4RAUC 1TIID 1X3PA 2F4IA 2N8NA 2Q8RE 3LX0A 4ME5A 5DNFA 3RLNA 3NK9A 1PHJA 1IL2A 3Q24A 3S14H 4G57A 4K0KQ 5C6AA 1E1TA 4NMZA 4AYBE 4XQJA 2LKVA 3PQIA 2E75C 3OYYA 3OSOA 3J7YW 4L6TB 3HOUB 2EPBA 1NJIC 1UE1A 3SK6A 3H0GH 4DR6L 2VL6A 4E6IA 5M3MH 2AHOB 5C4JB 3I4LA 3W1GA 3J81i 3CCQA 2AUJD 1TWFH 2NN6G 2RDFA 1U4RA 3GTGH 3F1ZA 3ULPA 5EKKA 3K5LA 2D0PA 5A35A 4A3GH 1BO0A 2BA1A 5FLMG 5IYDH 1V1QA 1K83B 3LGJA 4N9TA 4ZUIA 1LTRD 2R7ZB 4CJ2C 4KK7A 3FP9A 4A3KG 2ENBA 5FO9B 4ULLA 4LJZC 2YV5A 2F1MA 2BDOA 2RDHA 3I56A 4DV6Q 1MGSA 1CKNB 5KNDA 1TWAH 5D14A 4EVOA 1XMOQ 4TVAB 5FO8B 4IO9A 2F0MA 1BXTA 2EZVA 1HFNA 1RDPD 1PV4A 4A3IB 4JPBW 4RA8A 4EQNA 4A3MH 3C2PA 2XVSA 1N32L 3KK7A 5C4XH 2EY2A 3H91A 5CYUA 3RUZA 2WP8J 1PA6A 5ELCA 1YJWA 3DM3A 3CCJA 1IL8A 1DM0B 4IJLA 4AH6A 5IT9L 3S15B 3NE5B 4YWMA 4PG3A 2WV6D 4CHTB 4K8JA 2MHVA 4YY3L 3SK5A 1WTWA 3EN2A 4ABNA 3OPOA 5GQOA 4L63B 1FNUA 2B63H 2LS01 1GM5A 1B70B 1Z6HA 3KJPA 1VMPA 1Z9FA 5M5XB 1PTOB 3OWEB 1I94Q 4O2DA 2CQAA 3G7LA 4XQQA 5FO7B 1D1KA 4L5RC 2JA6H 2GA4B 2JE6I 4RMFA 1JJGA 1I4QA 4DR4L 1GKHA 4MN3A 2DNCA 4A3LH 1QVGA 3I4NB 2HDLA 3KF8A 3FPPA 1YIJA 2WACA 3D6WA 5IYBH 4JOIC 2NBFA 3TEHB 3RN5A 3GV3A 1I50H 1JOKA 2JA7H 1GOZA 4GN5A 1GUGA 1TS4A 4A3JG 2HHHQ 2HCCA 1X3FA 1TWGB 4GKKQ 3SK4A 1C8CA 4B3SL 5IP7H 2IX3A 5IGDA 1YNXA 2AWOA 3C3LA 4NXML 3K58A 3NWTA 3GTQH 2B8GA 4UP8A 1G291 2NWGA 1B9MA 1VQIA 4PZ6A 1YNJD 2IWHA 1O7LA 1HA5A 4X3KA 4HJ5A 4L5SA 2VQEQ 3PIPA 2RCNA 4LF8Q 1N36Q 4OX9Q 5JOBA 3KLWA 1EY6A 3KUPA 1SFOB 4IURA 2HUGA 2LXKA 2RVLA 4B3RQ 1QVCA 3U50C 3KFUA 2AQ1B 4C2MH 4F7XA 3PMFA 3S2DH 3TREA 2C9OA 3HOXH 2SNMA 5I2XA 2OTLA 1K0RA 2VZAA 5EKLA 1VQCA 3QOLA 2K1BA 1BBUA 4LUVA 4A3KB 4YWKA 1IZ6A 2IW3A 1LTID 1ZKOA 2WB1G 2QILA 4JI2L 3G48A 5EPLA 2LMCB 1EY0A 1ZYRC 3KBGA 4YHHL 1EIFA 1U5KA 2F0LA 2ES2A 1L0WA 4WJ3M 3BS1A 1LABA 1CKNA 3CRLC 1L0YB 1T9HA 4JI0Q 1NTGA 4DV5L 3FKIG 2XRQD 1J9OA 5I4DA 3S1MH 4CDFC 1VQ4A 2R93B 3WWVA 1DCZA 2EOTA 3IKJA 1A2TA 5CV4A 5AJ3Q 4K2LA 3ND8A 5M3FH 1K8OA 1N34L 3RMHA 5A2QE 1E22A 5CBEE 1CUKA 1IKLA 2UXCQ 1VQOA 2AQ3B 5IYCH 2XSCA 2K5VA 3NSWA 3D8GA 1TR5A 2F0IA 4HIMA 4B3TL 2PNRC 5CV6A 3J80i 4FP5D 1VQKA 1EQRA 1Y1VB 2CWPA 3STBC 4PNYA 2I5HA 5C0XJ 3PIOA 3GTOH 2B39A 4QIWB 3I4MG 2EYHA 1WD0A 1I5FA 4QMGA 4FVMA 1XJVA 3W1BA 1YNNC 3BJUA 4CDCC 3VYTA 5C44G 1PRTD 4BBSG 1M1KC 3TP8A 2EE1A 2ID0A 1CKMA 4OWXB 2E2IH 1JR0D 2F0TA 2JK8A 3PF5A 1Y1WB 2MPMA 2F3VA 3DWPA 1Q81C 3NENA 3QR8A 3VR5A 2UXDQ 2CVRA 1TQOA 2VB3X 4DV1Q 5EPKA 1ML0D 2BA0A 1AZQA 1PH2A 1OTCA 2NVXB 3MXNB 1STEA 4RKBA 3SXHA 1Y69U 3S1NB 2OQ0A
chains in the Genus database with same CATH topology
3A54A 1F9SA 1PLFA 1STHA 1KDBA 3MTSA 3R93A 2KOLA 3P7JA 4IN3A 3DUZA 3EQLC 2B2VA 1KTKA 3GQBA 3T13A 2B2UA 3MFGA 1DD2A 1I4XA 1PFNA 1LTSD 4DA2A 4EQOA 3EA6A 5EKIA 1ESRA 2K04A 2Y0SB 5CGKA 3X3MA 2L9HA 1EWHA 1E2ZA 4DNTB 5DEHA 4KKTA 5KIXA 2OF1A 2K03A 5JPMC 4CKCA 3BZDB 2MP1A 1TVXA 1F9QA 3J7AF 4V0BA 3TP6A 2EYOA 4O1NA 3JAME 2EVBA 1Z47A 4M8AA 1CFMA 4JK1C 4N9PA 1E2VA 1QNUA 1H9RA 3OMGA 3JAML 2ZT9C 1S5BD 1ZEQX 2IJ0A 2Z4IA 5HGTA 1F2MA 1HUNA 5E4XA 2EYLA 4XQNA 5DM63 3I4MB 3ONAB 4P2CB 4DGZA 3OMCA 2BOSA 4FF2A 1A3TA 1PYWD 1NR2A 3CU7A 2K5DA 2D9UA 3Q6SA 4KKUA 1ET9A 1QCBD 4BY1B 1GHKA 1ICWA 3KBXA 1D5ZC 1TS5A 4RHSA 5C0XG 3MXNA 2L11A 1HPCA 5E3FA 1F77A 4OHJA 5M5WB 2DY7A 4RGTA 2B2VC 1R4PB 1S5FD 4A93B 2HQEA 2J0TD 4IFDH 1EIGA 2X69A 1QILA 4U68A 3OHXC 5JVH3 4B9WA 1NAPA 2XNAC 3TMEA 4OL7A 5ELFA 2J4XA 1A15A 2D2CC 1I4HA 5CV5A 1G2SA 4DAVA 4CJ1B 2QKIC 1LT4D 4CJ0B 4H7BA 3DXJC 3HKZB 1MD2D 3K7AB 2MJ8A 1S4ZA 3I70A 2F0PA 1NUCA 1RHPA 3EJIA 2K5QA 1JOQA 3FPUB 4J8QA 4DK1A 4V190 1RD9D 2KCCA 1DZ1A 3RD4A 1D2BA 4FF4A 4OIJA 1VMCA 4KTAA 4QB4A 1W6KA 3BDLA 5FLXE 1NCVA 3NBHA 5DAUA 2OT2A 1BF4A 3P75A 2F0QA 1EFID 5JEAJ 1JE4A 4BBRB 1IKMA 3KLRA 4XT3B 2QCPX 4HEDA 1T5EA 1W6JA 3VR3A 3FRPB 3T53B 3BG3A 1EYCA 5I6YA 1ILQA 3D4RA 4PQXA 3S14B 5FKAC 2R6GA 1C48A 1G6ZA 4KHZA 4ZRZA 5I2YA 3HRZC 3CKIB 2K28A 4C1NI 4WORA 1F9PA 3H0GB 4RGOS 5M3MB 3K0YA 1XWEA 4DU9A 1S5CD 3NQIA 2NYZD 3W3AA 1TWFB 1SNMA 1UNSA 1B3AA 3GTGB 2PPBC 2F0UA 4QUCA 2B8FA 1V1PB 4JBWA 5KRUA 2B2TA 4A3GB 1IYVA 3MXUA 4CKBA 4BWGB 2LY7A 2H1EA 2WAQB 1XX8A 1BCPB 4GZYC 3R2TA 1DOLA 4CKEA 3BVZA 3VYUA 4HR7B 1KLGD 1TWAB 1PXUA 5LL6X 1EZ6A 1KNAA 4IFDI 5KEEA 5ISRA 1ZYRD 2RSNA 4A3MB 3HGBA 5I6WA 1U9RA 3BDOA 3A7LA 5C4XB 4BS9A 2QDBA 3NTIA 4HMJA 3MVVA 3KLSX 1PZJD 1D5MC 3M4YA 1U4LA 3PUYA 1I4PA 1SYEA 1Q3LA 2B63B 2Q8IB 1TT2A 4FO2A 4G4KA 1QJOA 3V05A 4RGMA 1O7YA 4TKOB 5CC4A 2VB2X 2JA6B 2N55A 4FF3A 1VF5C 1RF2D 4RCOA 2EYJA 2N88A 2ZXPA 2L12A 3U9SA 3AB9A 2MUYA 1LTBD 1YNND 1G2TA 1DOKA 1I50B 3WDNA 2JA7B 1KNEA 3R3OA 5K36H 1O7ZA 2XN9C 1SNCA 3FEWX 3OW7A 3GTQB 2F0JA 1EQTA 4FXKC 2D5DA 4IUNA 1EOTA 4ID6A 1STBA 1RKNA 5JEAG 5LL6S 1EEID 2F0VA 1STAA 3MWYW 1HA6A 4HAEA 2KA7A 1I4RA 4HTHA 1HUMA 3NP8A 2O5JC 2L5TA 4BA2I 4C2MB 4DF7A 3S2DB 3HOXB 3E6ZX 1V1PA 2F0NA 1RJTA 5G3LF 2Z4HA 3D3RA 2O5IC 4C56C 4J1MA 1STYA 1B1ZA 3HEJA 4I7ZC 3QIAA 1AP0A 3SR1A 5I9PA 2O2LD 3S1MB 1BDOA 3NQTA 1EWCA 2V4DA 5I9OA 1EIHA 1EQVA 5M3FB 5EQ0A 1MSHA 2FMMA 1F9RA 1CZGA 4DXFA 3D4WA 3BDCA 2AWNA 1SJED 2VXWA 1JWSD 4OO1G 3NHHA 4ZLTF 1IHZA 2EYFA 5D65A 1SXTA 4ZYSA 4QF4A 1FD7D 1DOMA 4K5WA 1TS3A 3GTOB 3IFDA 1MSGA 2SOBA 4LMQD 4FXDA 1V8QA 2CW0C 1HTLD 1SNOA 5EBCA 2NN6H 1K8MA 3DWAA 1KDCA 2R3ZA 1DJRD 3HZXA 1OXTA 1ET6A 4RFBA 1EEFD 1AW7A 2E2IB 4MHEA 4HCSA 2PYKA 3L3OC 1JOOA 5A2QL 2D62A 4KJOA 1A3UA 2F0WA 3ERQA 5C5LA 1SSOA 1SE4A 1ENCA 1CTMA 1L0XB 4ZK9B 1B50A 2FFKB 2YYZA 5C3EB 1CZWA 2PMZB 4DNRB 3PUVA 3HG9A 4Z9CB 1NSNS 4KKSA 4IZ8A 1D6EC 1B9NA 4KY6A 3QJYA 4CBVA 3TZUA 4BY7B 3KLSA 1Y8PB 2XWBB 2A6EC 3GO5A 3H09A 1WTXA 1F2ZA 4KJNA 1Q12A 1BCPC 1C4QA 1I6HB 3U9OA 3VR2A 4RCNA 1S5DD 5CORA 4DAYA 1EY5A 4C3IB 4NDXA 4XXEA 2AQ2B 3UI2A 2G9HD 2A68C 5EPJA 5M5YB 1ONLA 3WOFA 1AEXA 3K59A 1GUNA 2PQEA 2A74C 4Y7NB 1SE2A 1X32A 4NP5A 3GD7A 1F2LA 2SDFA 1GJXA 5FOBB 3A8JE 5C3WA 5ELEA 3E5SA 2EJGC 2TMPA 3MHBA 4HCEA 3DEOA 4K2KA 5KYLA 1FGBD 4RH6A 2BCOA 4RGNA 2ICIA 1KABA 1EU4A 5CMDA 4C3JB 2K01A 4U673 1WTQA 1TWCB 5KNCA 1CA5A 3V2TA 3CRKC 2L4NA 4K14A 1BR9A 4NKLA 1G8ZD 5T1GA 3P1HA 4XTCS 1EYAA 4IUUA 2KVMA 3S1RB 1STNA 4UAIA 1JWUD 3SK8A 5IGGA 4DAPA 3HOZB 3Q22A 1H9MA 2B2YA 1PTOC 1CT1D 4UDUC 3SHLA 3C46A 1H9KA 2NN6I 1WD1A 4KD3A 2F0FA 3TP5A 3S16B 3GTMB 1S5ED 3OIPA 3MAQA 4PMCA 3TZDA 1IW7C 5CV7A 2E2HB 4DFAA 4FF1A 1GUTA 5KYIA 1O78A 3OIQA 5IODA 1ESFA 2NVYB 4WFN3 3QWNA 1LLRD 1R4QB 1BNZA 2KHSA 5F2DA 3M7NA 3FDTA 2JP1A 2NZ1D 1ILPA 1X3QA 4A3DB 1SYCA 2B2UC 3VYRA 1JICA 2EDGA 3SE0A 2EJFC 1SMYC 1D1IA 3VR4A 2F3WA 1FR3A 2B2WA 4ODGA 1GUWA 4KY7A 1TS2A 2A6HC 4QCLA 2K6AA 2K5WA 3DMUA 3PUWA 3GP7A 4F87A 1QG7A 1A6XA 3ND9A 2VUMB 2X6LA 2NTTA 2DY8A 3DWQA 1HHVA 3I73A 4B08A 2KJXA 3FVQA 3IAYA 5ELBA 4YIJA 3K5NA 3OWFA 3SEBA 2EYPA 2PZTA 1JORA 5KGUA 1AZPA 4FXGC 1DYQA 2OXPA 1SBBB 3T4AC 3AU7A 3PO3B 1U4MA 5IIFA 3MFYA 4EGVA 2C5CA 3I91A 2PW7A 2PCFB 2L1BA 2NTSA 1HCZA 2SNSA 4RWSC 3M85A 1MBYA 2QF7A 4X3UA 4K5VA 2F0DA 3R8BA 5FLXL 3LNNA 1PMRA 3IL8A 2IL8A 1FNWA 2X6GA 1QOHA 2WIIB 3URYA 4PV1C 1U4PA 2KUMA 1TY2A 3H6MA 1ENAA 2EXZA 5IGFA 3Q0AA 5IGCA 3NXWA 2VNUD 3DHQA 4TQUS 3SVMA 5IOCA 1GXDC 2JA8B 1OXSC 5TSSA 3GTLB 1PRTF 1H9SB 3I3CA 1Q90A 2B2WC 1SNDA 3BYYB 1I6VC 3H94A 3LWEA 4RKLA 5COYA 2PW5A 2F0EA 2IT1A 4K8IA 4CGYB 1KDAA 3QG1A 3V96A 1ENFA 3NTKA 5E4WC 4HSVA 5JPNC 1CI3M 1OXUA 1JB3A 1O80A 1SEBD 4B9XA 4A3FB 2F03A 1BOSA 2EYMA 5C0XH 2F0GA 1UUPA 3K5MA 3TP7A 1EY9A 5CBAE 4TRDA 1SAPA 3N6RA 5ELDA 2CW0D 1Z7TA 4XYQA 4A3EB 1DXMA 3PO2B 3NBIA 2M00A 3TN2A 1SNQA 4X3SA 3VR6A 3RLFA 4OIKA 5D3IB 3K57A 3HOVB 3NUCA 2RQXA 3QB3A 1II3A 3O13A 5IT9E 2SEBD 4C3HB 1CQFA 2JYOA 3CQZB 5EGTA 4IUPA 4IFDJ 4O42A 1SJHD 4A3BB 4R8NA 3VYSA 1Q1BA 2YU9B 3A8IE 2IX1A 5J1ZA 3HOYB 1XTCD 1Y8NB 2MGSA 4H0LC 4S3SA 1WCMB 1SE3A 1I4GA 4ZKCB 1CK1A 4PMWA 2DNEA 3L7ZC 5CV8A 2A6ED 3D6CA 1BCPD 1LTGD 4DN4M 2BE5C 1LT3D 4R8IA 2M2LA 3L9AX 1STGA 4DK0A 4ILWA 2B2TC 3ITPA 3RZDB 5E1FA 4IALA 4MIUA 2FHTA 2K7VA 3MXPA 1H9SA 2A68D 4IUTA 3VA7A 2A69C 3HS0C 1IYUA 1LT5D 1AN8A 4TSSA 3C1EA 3A55A 3NPPA 1Q1EA 3K5OA 2KEEA 2KEDA 1DONA 1VCIA 4KHVA 1HRJA 3BYTB 4C3IG 5EBDA 1PTOH 4LK1C 3GTPB 2HDMA 4KD4A 1EL0A 3OOCA 1PRTB 3J7AV 4KN4C 2ZXRA 3J81E 1CA6A 4G7ZC 3A56A 3ZYYX 1QWYA 3GTKB 1FNVA 1EY4A 1Q8IA 3GTJB 3K6OA 3TSSA 2RA4A 5CV9A 3W2DA 3EFXD 1LO5D 1BUVT 1AFPA 5D3DA 1WTVA 2FMCA 3J81L 1MI2A 5C5MA 1SYGA 4C3JG 3M3YB 5C0XI 1EU3A 2WKCA 3F2UA 1QB5D 1RTNA 3BVGA 1PTOD 3LWUA 1CHPD 4EQPA 1JQYD 4H13C 4KMUC 3X3NA 4FNFA 2IPKD 3GV6A 1RODA 1HXYD 2KECA 1EZ8A 3MEHA 5BN5A 3D31A 1IW7D 4K5XA 3MXGA 1A2UA 1HFGA 1KAAA 2NUCA 2PZUA 3BVMA 1TY0A 1TKWB 4KV6A 5FK9C 2WKDA 4I65A 2Z8LA 3WOEA 1LT6D 2HCIA 2IX0A 5C3XA 1WTOA 4KN7C 2E74C 4IFDG 1GUSA 1HTPA 1D5XC 3M7GA 2I46A 2F0KA 1M8AA 1QE6A 3PV0A 1BQQT 1SMYD 2A5HA 1GHJA 1GUOA 1E0BA 3Q23A 3I8ZA 4A3JB 1RCVD 2QEJC 1TU2B 4KI0A 1VDZA 3E0JA 1SYDA 2EY1A 2EY6A 2EY5A 2A6HD 1PFMA 1V43A 4NW2A 4ZUJA 1JC7A 2F0OA 1M4VA 4ZQ3A 5IGEA 4IUQA 2K05A 2RSOA 2TSSA 5KNBA 3MZ5A 1SDFA 5JEAH 3IFTA 4WRDA 2XRSD 2BDNA 2ZXOA 3DEPA 1WTRA 1R9TB 3HP3A 1VF7A 1LTTD 2A73B 5C4HA 1XXGA 4XT1B 1JWMD 3QOJA 2E2JB 2JXMB 1PZID 5M9OA 1YNJC 2F0SA 3EROA 2L0CA 1ZXTA 4H44C 1CQVA 2WB1B 4IUVA 2NVQB 1PFBA 1SYFA 1TWHB 4FYDA 5BN3A 2I07B 3FKIB 4K6DA 3P20A 1I3QB 2JSOA 3S17B 1A3VA 1Y8OB 2RKSA 2KQ3A 1SYBA 2NVTB 2L55A 3A7AB 5CR3A 5BN4A 5C4ZA 1PZKD 3S1QB 5LHY1 4OO1H 1NR4A 1PDQA 3PUXA 3J80E 4Q0FA 3VA5A 4LAAA 1HQMC 2ICEC 1FYCA 5JJZA 1JCKB 2F0HA 1LACA 4K6LA 1LV9A 2RDGA 3J80L 2XIWA 4J6HA 3N52A 5T1IA 2PZWA 5C44B 2E2DC 1B53A 1RTOA 2RBMA 3AMUA 4BBSB 3TDQA 4F8MA 3FMCA 2O4XA 1B4OA 1OXVA 3H3VC 1V1OA 5G3LD 1BCPF 3QO2A 1E2WA 3S9WA 2M9VA 1SNPA 2R61A 2PO4A 1F2YA 3EVQA 4XYOA 4G7HC 3NTHA 1PRTC 5J39A 3PIP3 3R2IA 4L8JA 1XYIA 3PUZA 1G91A 2Z1CA 4M1UB 5J22A 3C1FA 5K5PA 1UAPA 1QNKA 4RHRA 2G9DA 1WTPA 1LTAD 2JA5B 2J7ZA 5DM73 1B2TA 4Q5VA 1KLUD 2K33A 4X3TA 1WVLA 4HMIA 4C1NK 2JEAI 1T5XD 3NWSA 2FJ2A 5HURA 5AFWA 5IGBA 1H9JA 4ZAIA 3T51B 4XIGS 3RZOB 2R92B 2LFNA 1EY8A 5EJWA 2B2YC 4WJWA 1J8IA 5K36G 4F88A 2XWJB 4OGQC 2H4OA 1B44D 2WINB 3MC0B 1BBXC 5JVG3 1PTOF 1OO9B 2KCNA 2FINB 4R9WA 4C3HG 4XDXA 3MA2B 3DM1A 4HN7A 1UEAB 3PIO3 2OEOA 2BE5D 4DXGA 3I72A 4ZKBB 4KY5A 4BA1I 4AYBB 3D4DA 3T56B 4OO1I 2E76C 2AUKA 5NUCA 4IQZA 3HOWB 1CM9A 2EJMA 4G7OC 1OXXK 2A69D 4PMBA 2K32A 3A8KE 3G6JB 1EY7A 4HSPA 1EYDA 2Q8TA 1CHQD 3CHBD 2CHBD 2NB0A 3T16A 3S2HB 1HQRD 2JEBI 3M4OB 2DN8A 3I90A 5JAVA 3SDZA 3TBIB 4QUFA 4RAUC 1TIID 1X3PA 2F4IA 3LX0A 2Q8RE 5DNFA 4ME5A 3NK9A 3Q24A 4G57A 5C6AA 4NMZA 4XQJA 2LKVA 2E75C 3OSOA 3J7YW 4L6TB 3HOUB 2EPBA 3SK6A 4E6IA 5C4JB 3I4LA 2AUJD 2NN6G 2RDFA 1U4RA 5EKKA 3K5LA 5A35A 1BO0A 2BA1A 1K83B 4N9TA 4ZUIA 1LTRD 2R7ZB 4CJ2C 4KK7A 2ENBA 5FO9B 4ULLA 4LJZC 2F1MA 2BDOA 2RDHA 1MGSA 5KNDA 5D14A 4EVOA 5FO8B 2EZVA 2F0MA 1BXTA 1HFNA 1RDPD 4A3IB 4RA8A 4EQNA 3C2PA 2XVSA 3KK7A 2EY2A 3H91A 5CYUA 3RUZA 2WP8J 5ELCA 1IL8A 1DM0B 5IT9L 3S15B 3NE5B 4CHTB 2WV6D 4K8JA 2MHVA 3SK5A 1WTWA 4ABNA 3OPOA 4L63B 1FNUA 2LS01 1Z6HA 1VMPA 5M5XB 1PTOB 3OWEB 2CQAA 3G7LA 4XQQA 5FO7B 1D1KA 2GA4B 2JE6I 1I4QA 4MN3A 2DNCA 3I4NB 2HDLA 3KF8A 3FPPA 2WACA 3D6WA 2NBFA 3GV3A 1JOKA 1GOZA 1GUGA 1TS4A 2HCCA 1TWGB 3SK4A 1C8CA 2IX3A 5IGDA 2AWOA 3C3LA 3K58A 3NWTA 2B8GA 1G291 2NWGA 1B9MA 1YNJD 2IWHA 1O7LA 1HA5A 4X3KA 5JOBA 1EY6A 3KUPA 1SFOB 4IURA 2HUGA 2RVLA 2AQ1B 4F7XA 3PMFA 2C9OA 2SNMA 5I2XA 5EKLA 3QOLA 2K1BA 4A3KB 2IW3A 1LTID 1ZKOA 2QILA 5EPLA 2LMCB 1EY0A 1ZYRC 3KBGA 2F0LA 3BS1A 1LABA 3CRLC 1L0YB 2XRQD 1J9OA 5I4DA 2R93B 1DCZA 2EOTA 3IKJA 1A2TA 5CV4A 4K2LA 3ND8A 1K8OA 3RMHA 5A2QE 5CBEE 1IKLA 2AQ3B 2XSCA 3NSWA 3D8GA 1TR5A 2F0IA 2PNRC 5CV6A 4FP5D 1Y1VB 4PNYA 5C0XJ 2B39A 4QIWB 2EYHA 1WD0A 4QMGA 4FVMA 1YNNC 3VYTA 1PRTD 3TP8A 2EE1A 2ID0A 1JR0D 2F0TA 1Y1WB 2MPMA 2F3VA 3DWPA 3VR5A 2CVRA 1TQOA 2VB3X 5EPKA 1ML0D 2BA0A 1AZQA 2NVXB 1STEA 4RKBA 3SXHA 1Y69U 3S1NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKD A;  2WKC A; 
#chains in the Genus database with same CATH topology
 2GVA A;  3A54 A;  4HJ8 A;  1F9S A;  1PLF A;  1STH A;  3KJO A;  1KDB A;  3MTS A;  3R93 A;  2KOL A;  3P7J A;  4IN3 A;  2Q2I A;  5C3E H;  3DUZ A;  4NPS A;  4YCU A;  2VQF L;  2YTX A;  3EQL C;  2B2V A;  1KTK A;  3GQB A;  3T13 A;  4QIW E;  2B2U A;  3MFG A;  1DD2 A;  2FXQ A;  4BY7 H;  1O7I A;  1I4X A;  1WFQ A;  4DR3 Q;  2Z6K A;  1PFN A;  1LTS D;  4DA2 A;  4EQO A;  3EA6 A;  1KD1 C;  5EKI A;  1ESR A;  3BZK A;  4LF6 L;  1I6H H;  2YTY A;  5IT9 c;  2K04 A;  4HIO A;  2Y0S B;  5CGK A;  3X3M A;  1QUQ A;  2L9H A;  4C3I H;  1EWH A;  1E2Z A;  2Q2U A;  4DNT B;  5DEH A;  4KKT A;  5KIX A;  1N8R C;  4QY7 A;  4DUZ L;  2OF1 A;  2K03 A;  2R92 G;  5JPM C;  4CKC A;  5M5Y H;  3BZD B;  2MP1 A;  1MJC A;  1TVX A;  1F9Q A;  2NZH A;  3J7A F;  4V0B A;  3TP6 A;  2EYO A;  4O1N A;  3JAM E;  4Y7N H;  1KL9 A;  2EVB A;  2PI2 E;  1Z47 A;  4M8A A;  1CFM A;  3H3V I;  2ZJQ A;  3K81 C;  3UE1 A;  4JK1 C;  4N9P A;  1E24 A;  4EQ5 A;  3FHW A;  4R4T A;  1E2V A;  5DLQ E;  1QNU A;  1H9R A;  1MIU A;  4JI3 Q;  3OMG A;  3CD6 A;  3JAM L;  4DKA C;  2ZT9 C;  3GDE A;  3NBH B;  4C3J H;  1S5B D;  1ZEQ X;  1VQG A;  2IJ0 A;  2KBN A;  2I5L X;  1KIX A;  2Z4I A;  5HGT A;  1F2M A;  1HUN A;  5E4X A;  1TWC H;  2EYL A;  4XQN A;  5DM6 3;  4AYB G;  3I4M B;  3ONA B;  2Y0S E;  4P2C B;  4DGZ A;  3OMC A;  2BOS A;  3HOW G;  1YI2 A;  5LMN L;  4FF2 A;  1A3T A;  1PYW D;  3S1R H;  1NR2 A;  2CH4 A;  3I2Z A;  3CU7 A;  2Z6B A;  2K5D A;  3HOZ H;  2D9U A;  3Q6S A;  4KKU A;  3CCR A;  1ET9 A;  1QCB D;  1D7Q A;  4BY1 B;  3CCV A;  1HR0 L;  1VQL A;  1GHK A;  2CH4 W;  1ICW A;  3HKS A;  3KBX A;  1D5Z C;  1TS5 A;  3T1H L;  4RHS A;  3J81 c;  5C0X G;  3MXN A;  3CAM A;  3S16 H;  2L11 A;  3GTM H;  3AFP A;  4DR6 Q;  1HPC A;  2F52 A;  5E3F A;  1F77 A;  4OHJ A;  5M5W B;  2DY7 A;  4RGT A;  1LYL A;  2B2V C;  2PI2 A;  1A63 A;  1R4P B;  1S5F D;  1IBM L;  4JYA L;  4A93 B;  2HQE A;  2J0T D;  4IFD H;  2E2H H;  1EIG A;  4A3G G;  2X69 A;  1QIL A;  3IRB A;  4U68 A;  3L0O A;  3OHX C;  2NVY H;  4B9W A;  5JVH 3;  1NAP A;  2XNA C;  3TME A;  1X54 A;  1UE7 A;  3HOU G;  4OL7 A;  5ELF A;  4HJ7 A;  1HNX L;  2J4X A;  1A15 A;  2D2C C;  4R4I A;  1I4H A;  5CV5 A;  1G2S A;  4DAV A;  4CJ1 B;  2QKI C;  1VQ8 A;  4DR1 L;  1B7Y B;  1CSP A;  1LT4 D;  4CJ0 B;  4H7B A;  3DXJ C;  1VQB A;  1UE6 A;  3HKZ B;  1MD2 D;  3RR5 A;  4A3D H;  3K7A B;  3ICE A;  2MJ8 A;  1S4Z A;  1C0A A;  1Q46 A;  4GLA C;  3I70 A;  2F0P A;  2UU9 L;  1N32 Q;  1PH1 A;  1NUC A;  4GOP B;  1RHP A;  3EJI A;  3B6Y A;  2K5Q A;  1JOQ A;  3FPU B;  4J8Q A;  4DK1 A;  4V19 0;  1RD9 D;  2KCC A;  2L15 A;  1DZ1 A;  3RD4 A;  4YY3 Q;  1XPO A;  1D2B A;  4FF4 A;  3CCL A;  2IHF A;  4OIJ A;  1VMC A;  4KTA A;  1IYJ B;  4QB4 A;  4A3I G;  3PSI A;  2VUM H;  1W6K A;  4OEM B;  3BDL A;  5FLX E;  4R4C A;  1NCV A;  2ZJR A;  3NBH A;  5DAU A;  2OT2 A;  1BF4 A;  3P75 A;  2F0Q A;  1EFI D;  1JE4 A;  5JEA J;  4A3L G;  4BBR B;  1IKM A;  4DR4 Q;  1NBW A;  3KLR A;  4XT3 B;  2ZJP A;  3HKZ E;  3U4V A;  1RIP A;  2QCP X;  4HED A;  4UPA A;  1T5E A;  3KOJ A;  2R7D A;  1W6J A;  3VR3 A;  4LF5 L;  3FRP B;  3T53 B;  3BG3 A;  1EYC A;  5I6Y A;  1ILQ A;  3D4R A;  4PQX A;  3S14 B;  5FKA C;  2R6G A;  1C48 A;  2BH2 A;  1G6Z A;  3PO3 H;  4KHP L;  4KHZ A;  5BR8 L;  4ZRZ A;  5I2Y A;  4OEL B;  2IY5 B;  4B3S Q;  3HRZ C;  3CKI B;  2K28 A;  1PH6 A;  4C1N I;  5IY0 A;  4WOR A;  4NXM Q;  2LSS A;  1F9P A;  2ATW A;  3H0G B;  3I4N G;  4RGO S;  3UDF A;  5M3M B;  3K0Y A;  4HJA A;  1XWE A;  4DU9 A;  1S5C D;  3NQI A;  2NYZ D;  3W3A A;  1TWF B;  1SNM A;  1UNS A;  2P5Z X;  2RCF A;  1B3A A;  3GTG B;  4IPC A;  2PPB C;  2F0U A;  5GRO A;  4QUC A;  2B8F A;  1V1P B;  4JBW A;  5KRU A;  2B2T A;  4A3G B;  2EQS A;  2PQA A;  2K5H A;  1IYV A;  4LUO A;  3MXU A;  4CKB A;  3RN2 A;  4BWG B;  1JMC A;  2LY7 A;  1SRO A;  2H1E A;  2WAQ B;  1XX8 A;  3CC7 A;  1BCP B;  4GZY C;  3R2T A;  1DOL A;  4CKE A;  3BVZ A;  3VYU A;  4HR7 B;  1KLG D;  2JA8 H;  4JI6 L;  1WYD A;  1TWA B;  4J15 A;  1PXU A;  5LL6 X;  1EZ6 A;  1GO3 E;  1KNA A;  4GKJ L;  4IFD I;  5KEE A;  3GTL H;  5ISR A;  3I55 A;  4YHH Q;  1ZYR D;  2RSN A;  4A3M B;  3HGB A;  4OON A;  3J81 j;  5I6W A;  1U9R A;  3BDO A;  3A7L A;  5C4X B;  4BS9 A;  4DV5 Q;  1WOC A;  2QDB A;  1L2F A;  4P74 A;  3NTI A;  4HMJ A;  3MVV A;  1YJN A;  2DJF C;  3KLS X;  1PZJ D;  1D5M C;  4AIM A;  1N34 Q;  4GOP A;  3CC2 A;  3M4Y A;  4GN3 B;  1U4L A;  3PUY A;  1I4P A;  1SYE A;  5FJ8 G;  1Q3L A;  2ZTE A;  5HY6 A;  3J80 c;  1Q8K A;  2B63 B;  4B3M L;  2Q8I B;  1TT2 A;  4FO2 A;  2XTI A;  1FVI A;  4G4K A;  1YHA A;  4B3T Q;  1QJO A;  2LXJ A;  3V05 A;  4RGM A;  1N9W A;  2WAQ E;  1O7Y A;  4BXX G;  4TKO B;  4A3F H;  5CC4 A;  2VB2 X;  2JA6 B;  2R93 G;  2N55 A;  4FF3 A;  2CWA A;  1HNW L;  1NNX A;  4RG1 A;  3STB D;  1VF5 C;  1RF2 D;  4RCO A;  2EYJ A;  2N88 A;  1J5E L;  3A0J A;  2ZXP A;  2L12 A;  3U9S A;  3AB9 A;  2MUY A;  1LTB D;  1YNN D;  1N33 L;  1G2T A;  1DOK A;  1J6Q A;  1I50 B;  4A3E H;  4UP7 A;  3WDN A;  2JA7 B;  1KNE A;  2F4V L;  3A5U A;  3PO2 H;  3R3O A;  5K36 H;  1O7Z A;  1Y1V G;  2XN9 C;  1SNC A;  3BU2 A;  1X9N A;  3FEW X;  3OW7 A;  3GTQ B;  3HOV H;  2F0J A;  1EQT A;  4FXK C;  2D5D A;  4IUN A;  1EOT A;  5GAG C;  4ID6 A;  1STB A;  4C3H H;  3CQZ H;  1RKN A;  5JEA G;  2UUC L;  5LL6 S;  1EEI D;  2F0V A;  2I0Q A;  1STA A;  4LF7 L;  1EYG A;  3MWY W;  1HA6 A;  2B29 A;  4HAE A;  4A3B H;  2KA7 A;  3S24 A;  1I4R A;  4HTH A;  2YU9 H;  1HUM A;  3NP8 A;  2O5J C;  2K52 A;  1Y1W G;  4POG A;  2L5T A;  5L37 A;  4BA2 I;  4C2M B;  1HZC A;  4DF7 A;  2VQF Q;  3HOY H;  3S2D B;  1E3P A;  3HOX B;  2NZO A;  3E6Z X;  1V1P A;  2F0N A;  2GN5 A;  1WCM H;  1RJT A;  4BY7 G;  5G3L F;  2Z4H A;  2HD3 A;  3D3R A;  2KCT A;  2QW7 A;  2O5I C;  1KRT A;  4DAY B;  4C56 C;  4J1M A;  1HZB A;  1STY A;  4JI4 L;  1B1Z A;  3CPF A;  3HEJ A;  4I7Z C;  4LF6 Q;  3QIA A;  4A3C H;  1AP0 A;  3SR1 A;  4DR2 L;  5I9P A;  1SMX A;  3RZD H;  2O2L D;  4NXN L;  4LFA L;  3S1M B;  1BDO A;  3NQT A;  4APV A;  1EWC A;  2V4D A;  5I9O A;  1EIH A;  4DUZ Q;  1EQV A;  5M3F B;  5EQ0 A;  1MSH A;  2ZTC A;  2FMM A;  1F9R A;  1CZG A;  4DXF A;  3D4W A;  3BDC A;  2AWN A;  1SJE D;  2HQL A;  1MJE A;  1S40 A;  2C35 B;  2VXW A;  2OWO A;  1JWS D;  4OO1 G;  1QUQ B;  2AMC B;  3NHH A;  3H3V H;  4ZLT F;  2Y0S G;  1VQJ A;  2MQH A;  3F2D A;  1IHZ A;  2EYF A;  4UHV A;  5D65 A;  3PF4 A;  3GTP H;  1SXT A;  4ZYS A;  4QF4 A;  1FD7 D;  1DOM A;  4K5W A;  1TS3 A;  3GTO B;  3IFD A;  2K75 A;  1MSG A;  1EWI A;  4LF4 L;  3GTK H;  2SOB A;  4LMQ D;  4FXD A;  1UEB A;  3GTJ H;  1V8Q A;  1WJJ A;  2CW0 C;  1HTL D;  1SNO A;  5EBC A;  2E8G A;  1AE2 A;  2NN6 H;  4IPD A;  1K8M A;  3DWA A;  4DNI A;  1KDC A;  3I4O A;  2R3Z A;  1DJR D;  1VQ7 A;  3HZX A;  1OXT A;  1ET6 A;  2JJQ A;  5LMN Q;  4RFB A;  1EEF D;  1AW7 A;  4YCW A;  2E2I B;  4MHE A;  1GVP A;  4HCS A;  1QZH A;  5FLM H;  2PYK A;  3L3O C;  1JOO A;  1PH8 A;  5A2Q L;  2HIV A;  3E9I A;  2D62 A;  4KJO A;  3M3Y H;  3G71 A;  1K28 A;  4MNO A;  1A3U A;  4GNX B;  2F0W A;  3AEV A;  2A8V A;  3AFQ A;  3ERQ A;  3TQY A;  1HR0 Q;  2HIX A;  5C5L A;  1SE4 A;  1ENC A;  1SSO A;  2UXB L;  1CTM A;  1L0X B;  3T1H Q;  4ZK9 B;  1B50 A;  2FFK B;  3H15 A;  2YYZ A;  5C3E B;  1CZW A;  4JI7 L;  3DLL A;  1DGS A;  2PMZ B;  4DNR B;  3PUV A;  3HG9 A;  4Z9C B;  1NSN S;  4KKS A;  1ASZ A;  1NMF A;  1SRU A;  4IZ8 A;  1D6E C;  1B9N A;  1IBM Q;  4JYA Q;  4KY6 A;  4GS3 A;  2E5L L;  3QJY A;  4CBV A;  3TZU A;  4BY7 B;  4BY1 G;  4LFC L;  2ZTD A;  1VQA A;  3KLS A;  1Y8P B;  2XWB B;  2A6E C;  4HID A;  1SE8 A;  3GO5 A;  3H09 A;  4DV4 L;  1WTX A;  1F2Z A;  4KJN A;  1Q12 A;  3CF5 A;  1BCP C;  2F3I A;  1C4Q A;  2VY3 A;  2UUA L;  5JJL A;  3RNU A;  2KHJ A;  4DR7 L;  1I6H B;  3KYH C;  3U9O A;  1HNX Q;  3VR2 A;  4RCN A;  1S5D D;  5COR A;  2JA9 A;  1FJG L;  4DAY A;  1EY5 A;  4C3I B;  2VW9 A;  4NDX A;  4DR1 Q;  4OXP A;  4XXE A;  2AQ2 B;  3UI2 A;  2G9H D;  3ULL A;  1QVF A;  2A68 C;  4A93 G;  5EPJ A;  5M5Y B;  1ONL A;  3WOF A;  1AEX A;  3K59 A;  1GUN A;  1CSQ A;  2PQE A;  1A62 A;  2A74 C;  4Y7N B;  1SE2 A;  1X32 A;  4NP5 A;  2UU9 Q;  3GD7 A;  1F2L A;  4IOA A;  2SDF A;  1GJX A;  5FOB B;  3A8J E;  5C3W A;  5ELE A;  2PMZ E;  2EJG C;  3E5S A;  2TMP A;  2CCZ A;  3MHB A;  4HCE A;  4A3J H;  3DEO A;  2N78 A;  1YZ6 A;  4K2K A;  5KYL A;  3CME A;  1FGB D;  4RH6 A;  2BCO A;  4RGN A;  4JI1 L;  3HKZ G;  2ICI A;  1XMQ Q;  1KAB A;  1EU4 A;  5CMD A;  1X65 A;  1YEZ A;  4C3J B;  2K01 A;  2VUM G;  4ME3 A;  4U67 3;  3K7U C;  4UY8 C;  4PZ8 A;  1WTQ A;  1TWC B;  5KNC A;  1CA5 A;  3V2T A;  3CRK C;  2L4N A;  1BVS A;  4K14 A;  1BR9 A;  4NKL A;  1G8Z D;  5T1G A;  4X62 L;  3P1H A;  4XTC S;  1EYA A;  4IUU A;  3TS0 A;  2KVM A;  3S1R B;  1STN A;  4UAI A;  1R9T H;  1JWU D;  1Q82 C;  3SK8 A;  5IGG A;  4DAP A;  3HOZ B;  4LF5 Q;  4IPG A;  3Q22 A;  1P8L A;  2JQO A;  2VS1 A;  1BKB A;  1VQN A;  1H9M A;  2B2Y A;  1PTO C;  3UE0 A;  2E2J H;  1D8L A;  1NY4 A;  1UWV A;  3M4P A;  1B8A A;  1CT1 D;  2A19 A;  4UDU C;  3VDY A;  3SHL A;  4KHP Q;  3C46 A;  5BR8 Q;  1H9K A;  2NN6 I;  1WD1 A;  4GNX A;  4KD3 A;  2F0F A;  2NVQ H;  4BBR G;  4LWC A;  3CCS A;  4DV0 L;  1C9O A;  3TP5 A;  1VQ6 A;  3KF6 B;  3GTM B;  1IBL L;  3S16 B;  1S5E D;  1TWH H;  3OIP A;  2MO1 A;  2IHE A;  3MAQ A;  1JJ2 A;  4PMC A;  4LF9 L;  3FKI H;  3TZD A;  2ASB A;  5IWA L;  1I3Q H;  4DAM A;  3S17 H;  1IW7 C;  5CV7 A;  1XPU A;  5ELO A;  2NVT H;  3UDX A;  1PH4 A;  2E2H B;  4DFA A;  4FF1 A;  1GUT A;  5KYI A;  1SN8 A;  3K8A A;  1O78 A;  4Y52 H;  1PFS A;  1UE5 A;  3OIQ A;  5IOD A;  2ZM6 L;  1ESF A;  2NVY B;  4WFN 3;  1QZG A;  3QWN A;  1LLR D;  3S1Q H;  1R4Q B;  1BNZ A;  2MNA A;  2KHS A;  5F2D A;  3M7N A;  3H0G G;  3RLO A;  5M3M G;  2PNH A;  2EXD A;  3FDT A;  2JP1 A;  2AKW B;  2NZ1 D;  1ILP A;  3KDF B;  1X3Q A;  4JI6 Q;  4A3D B;  1SYC A;  2PQA B;  2B3G A;  2OCE A;  4GKJ Q;  2B2U C;  3VYR A;  1JIC A;  2EDG A;  2R7F A;  3SE0 A;  1E7Z A;  5LMU L;  2JN4 A;  2EJF C;  2Z6K C;  1SMY C;  5IYD G;  1KRS A;  1D1I A;  3VR4 A;  2F3W A;  2ALY B;  1FR3 A;  5C44 H;  1JB7 A;  4BBS H;  2B2W A;  4ODG A;  1GUW A;  2WAQ G;  1HZ9 A;  1Q7Y C;  5E7N A;  3OTO L;  4KY7 A;  1TS2 A;  2A6H C;  4QCL A;  2K6A A;  1AE3 A;  2K5W A;  3G6E A;  3DMU A;  3PUW A;  3GP7 A;  1FL0 A;  4F87 A;  1QG7 A;  1A6X A;  4B3M Q;  3ND9 A;  2VUM B;  2X6L A;  2NTT A;  4A3M G;  2DY8 A;  3DWQ A;  1HHV A;  3I73 A;  4B08 A;  2KJX A;  5C4X G;  4A3F G;  3FVQ A;  4X66 L;  1XNR L;  3IAY A;  5ELB A;  1PH3 A;  4JG2 A;  4YIJ A;  4HJ9 A;  3K5N A;  2HT1 A;  3OWF A;  1HNW Q;  3SEB A;  1H95 A;  2EYP A;  2Z0S A;  1VQD A;  4MTK A;  1J5E Q;  2PZT A;  1JOR A;  5KGU A;  3OW2 A;  2B63 G;  1VQF A;  1AZP A;  1N33 Q;  4FXG C;  1DYQ A;  2OXP A;  1SBB B;  3T4A C;  3AU7 A;  4DV7 L;  4DV3 L;  2JA5 H;  3PO3 B;  1U4M A;  2K5N A;  4FDB A;  5IIF A;  1VQ9 A;  2F4V Q;  1YIT A;  3MFY A;  4GNX C;  4EGV A;  2C5C A;  1K9M C;  3I91 A;  2JA6 G;  2OQK A;  4R1J A;  3CP0 A;  5JJI A;  4R4O A;  2PW7 A;  3HOV G;  2PCF B;  2L1B A;  2QEX A;  2NTS A;  1HCZ A;  2SNS A;  4RWS C;  3M85 A;  1MBY A;  2QF7 A;  4X3U A;  4K5V A;  2F0D A;  4DK6 C;  5IYB G;  1HNZ L;  3R8B A;  2GVB A;  5FLX L;  1IBK L;  1RL2 A;  3LNN A;  1PMR A;  3KF6 A;  3IL8 A;  2G5D A;  2UUB L;  2JA7 G;  3RZO H;  2R92 H;  2IL8 A;  1FNW A;  2UUC Q;  2X6G A;  1QOH A;  2WII B;  3URY A;  2V1C C;  4LF7 Q;  4PV1 C;  1U4P A;  4DR5 L;  5IP7 G;  1WCM G;  2KUM A;  1TY2 A;  3H6M A;  1ENA A;  2EXZ A;  5IGF A;  3Q0A A;  5IGC A;  3NXW A;  2VNU D;  3DHQ A;  3EIV A;  1PYB A;  4TQU S;  3SVM A;  1G51 A;  5IOC A;  1GXD C;  3MEF A;  4CDE C;  2JA8 B;  1OXS C;  5TSS A;  4JI4 Q;  3GTL B;  1PRT F;  1JT8 A;  3Q8D A;  3KDF A;  1H9S B;  3I3C A;  4DR2 Q;  1Q90 A;  1XNQ L;  2B2W C;  1SND A;  3HOX G;  4LFA Q;  4NXN Q;  3BYY B;  1I6V C;  3H94 A;  3LWE A;  4RKL A;  5COY A;  3HOW H;  2PW5 A;  2F0E A;  2IT1 A;  4K8I A;  4CGY B;  1KDA A;  3EBE A;  3QG1 A;  4L5T A;  1X55 A;  2KCM A;  4JOI A;  1YBY A;  3V96 A;  4A4I A;  4HIK A;  4OWW B;  1ENF A;  3NTK A;  5E4W C;  4HSV A;  4X6A H;  1E1O A;  3M9B A;  4JI2 Q;  3K0X A;  5JPN C;  1CI3 M;  1OXU A;  1JB3 A;  1O80 A;  3CCE A;  4AQY L;  1SEB D;  4B9X A;  4P75 A;  4A3F B;  2F03 A;  1BOS A;  3JAM c;  2EYM A;  5EAY A;  3S2H H;  2WFW A;  5M3F G;  5C0X H;  2F0G A;  1UUP A;  3NEL A;  3K5M A;  3TP7 A;  1EY9 A;  3M4O H;  5CBA E;  4TRD A;  4LF4 Q;  1SAP A;  5IYC G;  3N6R A;  5ELD A;  2CW0 D;  1L1O B;  1Z7T A;  4XYQ A;  4A3E B;  4DV2 L;  3M4Q A;  4JI8 L;  1U0L A;  1K73 C;  1DXM A;  3PO2 B;  3NBI A;  2M00 A;  4JCV E;  3CPW A;  3TN2 A;  1SNQ A;  4X3S A;  3VR6 A;  1KC8 C;  3RLF A;  3HOU H;  4OIK A;  3T1Y L;  1YVC A;  5D3I B;  1K8G A;  4X64 L;  3K57 A;  1WTH A;  3HOV B;  3NUC A;  2RQX A;  5C4J H;  3QB3 A;  1II3 A;  3O13 A;  3F2C A;  5IT9 E;  2SEB D;  4C3H B;  3A5Z B;  1CQF A;  2JYO A;  3CQZ B;  2UXB Q;  1PVO A;  5EGT A;  4IUP A;  4IFD J;  4O42 A;  1SJH D;  4A75 A;  4A3B B;  4R8N A;  3VYS A;  1Q1B A;  2YU9 B;  4JI7 Q;  3AYH B;  3A8I E;  2IX1 A;  1K83 H;  4JBM A;  5J1Z A;  3HOY B;  4DUY L;  1XTC D;  1P16 A;  1Y8N B;  2MGS A;  4H0L C;  1X3G A;  4ALP A;  4S3S A;  1WCM B;  2R7Z H;  1SE3 A;  1I4G A;  1W3S A;  4ZKC B;  1CK1 A;  4PMW A;  1B3Q A;  1VQ5 A;  2YTV A;  2DNE A;  3L7Z C;  1NMG A;  5CV8 A;  2E5L Q;  4LFC Q;  1HZA A;  4LFB L;  2A6E D;  3D6C A;  4JI5 L;  4DV4 Q;  1KAW A;  2QGQ A;  1A0I A;  1BCP D;  1LTG D;  2UUA Q;  4PZ7 A;  4DN4 M;  2OTJ A;  2BE5 C;  5C3E G;  4A3I H;  4DR7 Q;  1LT3 D;  1LM0 A;  4R8I A;  2M2L A;  3L9A X;  1STG A;  4ILW A;  2B2T C;  4DK0 A;  1FJG Q;  3ITP A;  3RZD B;  4CDD C;  4X65 L;  5IP9 H;  4JV5 L;  5E1F A;  1XPR A;  4IAL A;  4O0A A;  4MIU A;  2FHT A;  2K7V A;  3ERS X;  4JVZ A;  3MXP A;  1H9S A;  2A68 D;  3S15 H;  4IUT A;  2A1A A;  3VA7 A;  2A69 C;  3HS0 C;  1IYU A;  3E3X A;  4GN4 B;  1LT5 D;  1AN8 A;  4TSS A;  3C1E A;  3A55 A;  1FGU A;  3NPP A;  1Q1E A;  2CKZ B;  2Z9H A;  3K5O A;  3I7F A;  2KEE A;  2KED A;  1DON A;  1VCI A;  4KHV A;  4LW1 A;  1HRJ A;  3BYT B;  4C3I G;  5M5X H;  5EBD A;  1PTO H;  4LK1 C;  1X3E A;  3GTP B;  4JI1 Q;  2HDM A;  4KD4 A;  1EL0 A;  3OOC A;  1C7Y A;  1PRT B;  1XTD A;  3J7A V;  3I4N H;  4KN4 C;  1VQP A;  2ZXR A;  1EFW A;  3J81 E;  1CA6 A;  4G7Z C;  3A56 A;  3ZYY X;  4GOP C;  1QWY A;  1X6O A;  1FNV A;  1EY4 A;  1Q8I A;  3GTJ B;  3K6O A;  3GTK B;  3TSS A;  2RA4 A;  1HJP A;  5CV9 A;  4K0K L;  3W2D A;  3EFX D;  4X62 Q;  1LO5 D;  1BUV T;  1AFP A;  1WI5 A;  5D3D A;  3UDG A;  1WTV A;  4UP9 A;  2FMC A;  1PH9 A;  1L1O A;  1MI2 A;  1TWG H;  5C5M A;  3J81 L;  4GLV B;  1SYG A;  4ZCK A;  4C3J G;  5FLX c;  3M3Y B;  1SLJ A;  5C0X I;  1YHQ A;  1EU3 A;  2WKC A;  3F2U A;  1QB5 D;  1RTN A;  3F8T A;  3BVG A;  1PTO D;  3LWU A;  1CHP D;  1PH7 A;  4EQP A;  1JQY D;  2I5M X;  4H13 C;  1YHB A;  4KMU C;  3JAM i;  3X3N A;  4FNF A;  2DGY A;  4DV0 Q;  1K3B C;  2IPK D;  3GV6 A;  1ROD A;  1SFO H;  1IBL Q;  1KXL A;  1HXY D;  3A74 A;  2CQO A;  2KEC A;  4LF9 Q;  1EZ8 A;  3MEH A;  5BN5 A;  5IWA Q;  3HOZ G;  2Q2T A;  3D31 A;  1IW7 D;  4K5X A;  1TXY A;  2N49 A;  3MXG A;  1A2U A;  3W5O A;  1HFG A;  1KAA A;  4MTN A;  2NUC A;  2PZU A;  4A3K H;  4DV6 L;  3BVM A;  1TY0 A;  2ZM6 Q;  1XMO L;  1TKW B;  5FJ8 H;  1EOV A;  4KV6 A;  4N8X 1;  5FK9 C;  4R4Q A;  2WKD A;  4I65 A;  2Z8L A;  3WOE A;  1LT6 D;  5GAD C;  3HFZ B;  2HCI A;  2IX0 A;  4BXX H;  5C3X A;  2R93 H;  2XGT A;  1WTO A;  4KN7 C;  2E74 C;  4IFD G;  1GUS A;  1HTP A;  4DK3 C;  4JBK A;  1D5X C;  3M7G A;  2I46 A;  2F0K A;  1PYS B;  5LMU Q;  2K4K A;  1M8A A;  1QE6 A;  3PV0 A;  1G6P A;  1BQQ T;  1SMY D;  2A5H A;  1GHJ A;  1GUO A;  1E0B A;  3Q23 A;  3I8Z A;  4A3J B;  1RCV D;  2QEJ C;  1TU2 B;  1I94 L;  4KI0 A;  1ICF B;  3OTO Q;  5HGQ A;  1VDZ A;  3E0J A;  1SYD A;  2EY1 A;  2EY6 A;  2EY5 A;  2A6H D;  1PFM A;  1V43 A;  4NW2 A;  1Y1V H;  3CC4 A;  4A3D G;  1EUJ A;  4ZUJ A;  3TRZ A;  1JC7 A;  3UDI A;  1VQM A;  2F0O A;  1M4V A;  4ZQ3 A;  2QDL A;  1JJC B;  5IGE A;  4IUQ A;  2K05 A;  4QGU A;  2RSO A;  2TSS A;  5KNB A;  3MZ5 A;  1SDF A;  4X66 Q;  5GAE C;  1XNR Q;  1VQH A;  5JEA H;  1EIY B;  3IFT A;  5J3B A;  4P72 A;  4WRD A;  2XRS D;  2BDN A;  2ZXO A;  3DEP A;  1WTR A;  2HHH L;  1L1O C;  1R9T B;  3HP3 A;  4GKK L;  3CXC A;  1VF7 A;  2N3S A;  1Y1W H;  1LTT D;  2A73 B;  2RHS B;  5C4H A;  4LNQ A;  1XXG A;  4XT1 B;  2MO0 A;  3ZJY C;  2JA5 G;  1JWM D;  3QOJ A;  2E2J B;  4JBJ A;  2JXM B;  1PZI D;  5M9O A;  1Q86 C;  2NVX H;  1YNJ C;  2F0S A;  4DV3 Q;  4DV7 Q;  3ERO A;  4LUZ A;  4OWT B;  3S1N H;  2L0C A;  3NEM A;  1ZXT A;  2RF4 A;  4H44 C;  2VQE L;  1CQV A;  2WB1 B;  4IUV A;  2NVQ B;  4LF8 L;  1N36 L;  5H1S E;  4OX9 L;  1PFB A;  1SYF A;  1TWH B;  4B3R L;  1NE3 A;  4GLX A;  3TS2 A;  5BN3 A;  4FYD A;  2I07 B;  3FKI B;  4K6D A;  3PGZ A;  3P20 A;  1IXR A;  1I3Q B;  2JSO A;  1HNZ Q;  3S17 B;  1A3V A;  1Y8O B;  2RKS A;  2KQ3 A;  4EX5 A;  1IBK Q;  2EIF A;  1SYB A;  2NVT B;  3ER0 A;  2UUB Q;  2L55 A;  3A7A B;  3PO3 G;  4QQB X;  5CR3 A;  3JC6 6;  5BN4 A;  5C4Z A;  2KEN A;  1PZK D;  3S1Q B;  5LHY 1;  4DR5 Q;  4OO1 H;  1NR4 A;  4YWL A;  5GAH C;  2DJG C;  1PDQ A;  3PUX A;  1BBW A;  3J80 E;  4Q0F A;  4JI0 L;  4NB3 A;  1S72 A;  1VS0 A;  3CCM A;  3VA5 A;  2BH8 A;  4LAA A;  1W2B A;  1HQM C;  1HH2 P;  2ICE C;  1FYC A;  5AJ3 L;  4WJ4 A;  5JJZ A;  1JCK B;  2F0H A;  2QA4 A;  3E9H A;  1LAC A;  4K6L A;  3ULJ A;  2WB1 E;  4IPH A;  1LV9 A;  2UXC L;  1AH9 A;  3F2B A;  2RDG A;  3J80 L;  1KHI A;  2XIW A;  4J6H A;  1YJ9 A;  4P71 A;  3N52 A;  5T1I A;  2PZW A;  5C44 B;  1XNQ Q;  2E2D C;  1B53 A;  1RTO A;  2RBM A;  4L5Q A;  3AMU A;  4BBS B;  3TDQ A;  4F8M A;  3FMC A;  2O4X A;  1KQS A;  4YCV A;  1B4O A;  1OXV A;  2JA8 G;  3H3V C;  1V1O A;  5G3L D;  4A76 A;  1BCP F;  2RHQ B;  3QO2 A;  1Y14 B;  1E2W A;  3S9W A;  2M9V A;  2CFM A;  1SNP A;  2R61 A;  1ASY A;  2PO4 A;  1F2Y A;  3EVQ A;  4IJH A;  4XYO A;  4G7H C;  3NTH A;  3I4M H;  1PRT C;  4AQY Q;  5J39 A;  3PIP 3;  3R2I A;  3U4Z A;  4L8J A;  1XYI A;  3PUZ A;  1G91 A;  2Z1C A;  4M1U B;  5J22 A;  3J7Z C;  3C1F A;  5K5P A;  1UAP A;  1QNK A;  2Q2H A;  2UXD L;  4RHR A;  5JJK A;  4H02 A;  4DV1 L;  2G9D A;  4DV2 Q;  1EQQ A;  1WTP A;  4QL5 A;  1LTA D;  3BZC A;  4JI8 Q;  1K3R A;  4BY1 H;  2JA5 B;  2J7Z A;  5DM7 3;  1B2T A;  1JE5 A;  4Q5V A;  1KLU D;  2K33 A;  4X3T A;  3T1Y Q;  1SR3 A;  1WVL A;  4X64 Q;  4HMI A;  4C1N K;  2JEA I;  1T5X D;  3NWS A;  2FJ2 A;  5HUR A;  4KLK A;  3CCU A;  5M5W H;  1CKO A;  3U58 A;  5AFW A;  5IGB A;  1H9J A;  4IOC A;  4ZAI A;  4P73 A;  4A3E G;  3T51 B;  4XIG S;  4A93 H;  5LMN W;  1K8A C;  3RZO B;  3D0F A;  2R92 B;  2LFN A;  1EY8 A;  5EJW A;  4DR3 L;  2B2Y C;  3K80 C;  4WJW A;  3AQQ A;  3G4S A;  1J8I A;  3PO2 G;  5K36 G;  1X56 A;  1S3O A;  3CMA A;  4F88 A;  1V9P A;  2XWJ B;  4OGQ C;  2R7Z G;  2H4O A;  4DUY Q;  1B44 D;  2WIN B;  2D0O A;  4JW0 A;  2DUD A;  3MC0 B;  1BBX C;  1HR0 W;  2K50 A;  1XMQ L;  2H5X A;  3E0E A;  5JVG 3;  1PTO F;  4I7A A;  1OO9 B;  2KCN A;  2FIN B;  4R9W A;  4C3H G;  4XDX A;  4LFB Q;  4JI5 Q;  3K7A H;  4N8F A;  3MA2 B;  3DM1 A;  4HN7 A;  1MKH A;  2KHI A;  1UEA B;  3PIO 3;  2OEO A;  4A3B G;  2BE5 D;  4DXG A;  3I72 A;  5IP9 G;  1K0S A;  4ZKB B;  4KY5 A;  4BA1 I;  4AYB B;  3D4D A;  4X65 Q;  3T56 B;  4DPG A;  4JV5 Q;  4OO1 I;  3HOY G;  2E76 C;  3SGI A;  3L2P A;  3J7A 5;  2AUK A;  5NUC A;  4JC0 A;  4IQZ A;  3HOW B;  1CM9 A;  2EJM A;  1PH5 A;  4JI3 L;  4G7O C;  1LTL A;  1OXX K;  3CW2 C;  5ELN A;  2A69 D;  5IE8 A;  4POF A;  4QJF A;  4PMB A;  2K32 A;  3A8K E;  3G6J B;  1EY7 A;  2K14 A;  1LUZ A;  4A3C G;  4HSP A;  1EYD A;  3PCO B;  1MHW C;  2Q8T A;  1A8V A;  1CHQ D;  3CHB D;  3KF8 B;  1M90 C;  1VQE A;  2CHB D;  2NB0 A;  3T16 A;  4BBR H;  3S2H B;  1HQR D;  2JEB I;  2MFI A;  1GD7 A;  3M4O B;  2DN8 A;  3I90 A;  5JAV A;  3SDZ A;  3TBI B;  4QUF A;  4MZ9 A;  4RAU C;  1TII D;  1X3P A;  2F4I A;  2N8N A;  2Q8R E;  3LX0 A;  4ME5 A;  5DNF A;  3RLN A;  3NK9 A;  1PHJ A;  1IL2 A;  3Q24 A;  3S14 H;  4G57 A;  4K0K Q;  5C6A A;  1E1T A;  4NMZ A;  4AYB E;  4XQJ A;  2LKV A;  3PQI A;  2E75 C;  3OYY A;  3OSO A;  3J7Y W;  4L6T B;  3HOU B;  2EPB A;  1NJI C;  1UE1 A;  3SK6 A;  3H0G H;  4DR6 L;  2VL6 A;  4E6I A;  5M3M H;  2AHO B;  5C4J B;  3I4L A;  3W1G A;  3J81 i;  3CCQ A;  2AUJ D;  1TWF H;  2NN6 G;  2RDF A;  1U4R A;  3GTG H;  3F1Z A;  3ULP A;  5EKK A;  3K5L A;  2D0P A;  5A35 A;  4A3G H;  1BO0 A;  2BA1 A;  5FLM G;  5IYD H;  1V1Q A;  1K83 B;  3LGJ A;  4N9T A;  4ZUI A;  1LTR D;  2R7Z B;  4CJ2 C;  4KK7 A;  3FP9 A;  4A3K G;  2ENB A;  5FO9 B;  4ULL A;  4LJZ C;  2YV5 A;  2F1M A;  2BDO A;  2RDH A;  3I56 A;  4DV6 Q;  1MGS A;  1CKN B;  5KND A;  1TWA H;  5D14 A;  4EVO A;  1XMO Q;  4TVA B;  5FO8 B;  4IO9 A;  2F0M A;  1BXT A;  2EZV A;  1HFN A;  1RDP D;  1PV4 A;  4A3I B;  4JPB W;  4RA8 A;  4EQN A;  4A3M H;  3C2P A;  2XVS A;  1N32 L;  3KK7 A;  5C4X H;  2EY2 A;  3H91 A;  5CYU A;  3RUZ A;  2WP8 J;  1PA6 A;  5ELC A;  1YJW A;  3DM3 A;  3CCJ A;  1IL8 A;  1DM0 B;  4IJL A;  4AH6 A;  5IT9 L;  3S15 B;  3NE5 B;  4YWM A;  4PG3 A;  2WV6 D;  4CHT B;  4K8J A;  2MHV A;  4YY3 L;  3SK5 A;  1WTW A;  3EN2 A;  4ABN A;  3OPO A;  5GQO A;  4L63 B;  1FNU A;  2B63 H;  2LS0 1;  1GM5 A;  1B70 B;  1Z6H A;  3KJP A;  1VMP A;  1Z9F A;  5M5X B;  1PTO B;  3OWE B;  1I94 Q;  4O2D A;  2CQA A;  3G7L A;  4XQQ A;  5FO7 B;  1D1K A;  4L5R C;  2JA6 H;  2GA4 B;  2JE6 I;  4RMF A;  1JJG A;  1I4Q A;  4DR4 L;  1GKH A;  4MN3 A;  2DNC A;  4A3L H;  1QVG A;  3I4N B;  2HDL A;  3KF8 A;  3FPP A;  1YIJ A;  2WAC A;  3D6W A;  5IYB H;  4JOI C;  2NBF A;  3TEH B;  3RN5 A;  3GV3 A;  1I50 H;  1JOK A;  2JA7 H;  1GOZ A;  4GN5 A;  1GUG A;  1TS4 A;  4A3J G;  2HHH Q;  2HCC A;  1X3F A;  1TWG B;  4GKK Q;  3SK4 A;  1C8C A;  4B3S L;  5IP7 H;  2IX3 A;  5IGD A;  1YNX A;  2AWO A;  3C3L A;  4NXM L;  3K58 A;  3NWT A;  3GTQ H;  2B8G A;  4UP8 A;  1G29 1;  2NWG A;  1B9M A;  1VQI A;  4PZ6 A;  1YNJ D;  2IWH A;  1O7L A;  1HA5 A;  4X3K A;  4HJ5 A;  4L5S A;  2VQE Q;  3PIP A;  2RCN A;  4LF8 Q;  1N36 Q;  4OX9 Q;  5JOB A;  3KLW A;  1EY6 A;  3KUP A;  1SFO B;  4IUR A;  2HUG A;  2LXK A;  2RVL A;  4B3R Q;  1QVC A;  3U50 C;  3KFU A;  2AQ1 B;  4C2M H;  4F7X A;  3PMF A;  3S2D H;  3TRE A;  2C9O A;  3HOX H;  2SNM A;  5I2X A;  2OTL A;  1K0R A;  2VZA A;  5EKL A;  1VQC A;  3QOL A;  2K1B A;  1BBU A;  4LUV A;  4A3K B;  4YWK A;  1IZ6 A;  2IW3 A;  1LTI D;  1ZKO A;  2WB1 G;  2QIL A;  4JI2 L;  3G48 A;  5EPL A;  2LMC B;  1EY0 A;  1ZYR C;  3KBG A;  4YHH L;  1EIF A;  1U5K A;  2F0L A;  2ES2 A;  1L0W A;  4WJ3 M;  3BS1 A;  1LAB A;  1CKN A;  3CRL C;  1L0Y B;  1T9H A;  4JI0 Q;  1NTG A;  4DV5 L;  3FKI G;  2XRQ D;  1J9O A;  5I4D A;  3S1M H;  4CDF C;  1VQ4 A;  2R93 B;  3WWV A;  1DCZ A;  2EOT A;  3IKJ A;  1A2T A;  5CV4 A;  5AJ3 Q;  4K2L A;  3ND8 A;  5M3F H;  1K8O A;  1N34 L;  3RMH A;  5A2Q E;  1E22 A;  5CBE E;  1CUK A;  1IKL A;  2UXC Q;  1VQO A;  2AQ3 B;  5IYC H;  2XSC A;  2K5V A;  3NSW A;  3D8G A;  1TR5 A;  2F0I A;  4HIM A;  4B3T L;  2PNR C;  5CV6 A;  3J80 i;  4FP5 D;  1VQK A;  1EQR A;  1Y1V B;  2CWP A;  3STB C;  4PNY A;  2I5H A;  5C0X J;  3PIO A;  3GTO H;  2B39 A;  4QIW B;  3I4M G;  2EYH A;  1WD0 A;  1I5F A;  4QMG A;  4FVM A;  1XJV A;  3W1B A;  1YNN C;  3BJU A;  4CDC C;  3VYT A;  5C44 G;  1PRT D;  4BBS G;  1M1K C;  3TP8 A;  2EE1 A;  2ID0 A;  1CKM A;  4OWX B;  2E2I H;  1JR0 D;  2F0T A;  2JK8 A;  3PF5 A;  1Y1W B;  2MPM A;  2F3V A;  3DWP A;  1Q81 C;  3NEN A;  3QR8 A;  3VR5 A;  2UXD Q;  2CVR A;  1TQO A;  2VB3 X;  4DV1 Q;  5EPK A;  1ML0 D;  2BA0 A;  1AZQ A;  1PH2 A;  1OTC A;  2NVX B;  3MXN B;  1STE A;  4RKB A;  3SXH A;  1Y69 U;  3S1N B;  2OQ0 A; 
#chains in the Genus database with same CATH homology
 3A54 A;  1F9S A;  1PLF A;  1STH A;  1KDB A;  3MTS A;  3R93 A;  2KOL A;  3P7J A;  4IN3 A;  3DUZ A;  3EQL C;  2B2V A;  1KTK A;  3GQB A;  3T13 A;  2B2U A;  3MFG A;  1DD2 A;  1I4X A;  1PFN A;  1LTS D;  4DA2 A;  4EQO A;  3EA6 A;  5EKI A;  1ESR A;  2K04 A;  2Y0S B;  5CGK A;  3X3M A;  2L9H A;  1EWH A;  1E2Z A;  4DNT B;  5DEH A;  4KKT A;  5KIX A;  2OF1 A;  2K03 A;  5JPM C;  4CKC A;  3BZD B;  2MP1 A;  1TVX A;  1F9Q A;  3J7A F;  4V0B A;  3TP6 A;  2EYO A;  4O1N A;  3JAM E;  2EVB A;  1Z47 A;  4M8A A;  1CFM A;  4JK1 C;  4N9P A;  1E2V A;  1QNU A;  1H9R A;  3OMG A;  3JAM L;  2ZT9 C;  1S5B D;  1ZEQ X;  2IJ0 A;  2Z4I A;  5HGT A;  1F2M A;  1HUN A;  5E4X A;  2EYL A;  4XQN A;  5DM6 3;  3I4M B;  3ONA B;  4P2C B;  4DGZ A;  3OMC A;  2BOS A;  4FF2 A;  1A3T A;  1PYW D;  1NR2 A;  3CU7 A;  2K5D A;  2D9U A;  3Q6S A;  4KKU A;  1ET9 A;  1QCB D;  4BY1 B;  1GHK A;  1ICW A;  3KBX A;  1D5Z C;  1TS5 A;  4RHS A;  5C0X G;  3MXN A;  2L11 A;  1HPC A;  5E3F A;  1F77 A;  4OHJ A;  5M5W B;  2DY7 A;  4RGT A;  2B2V C;  1R4P B;  1S5F D;  4A93 B;  2HQE A;  2J0T D;  4IFD H;  1EIG A;  2X69 A;  1QIL A;  4U68 A;  3OHX C;  5JVH 3;  4B9W A;  1NAP A;  2XNA C;  3TME A;  4OL7 A;  5ELF A;  2J4X A;  1A15 A;  2D2C C;  1I4H A;  5CV5 A;  1G2S A;  4DAV A;  4CJ1 B;  2QKI C;  1LT4 D;  4CJ0 B;  4H7B A;  3DXJ C;  3HKZ B;  1MD2 D;  3K7A B;  2MJ8 A;  1S4Z A;  3I70 A;  2F0P A;  1NUC A;  1RHP A;  3EJI A;  2K5Q A;  1JOQ A;  3FPU B;  4J8Q A;  4DK1 A;  4V19 0;  1RD9 D;  2KCC A;  1DZ1 A;  3RD4 A;  1D2B A;  4FF4 A;  4OIJ A;  1VMC A;  4KTA A;  4QB4 A;  1W6K A;  3BDL A;  5FLX E;  1NCV A;  3NBH A;  5DAU A;  2OT2 A;  1BF4 A;  3P75 A;  2F0Q A;  1EFI D;  5JEA J;  1JE4 A;  4BBR B;  1IKM A;  3KLR A;  4XT3 B;  2QCP X;  4HED A;  1T5E A;  1W6J A;  3VR3 A;  3FRP B;  3T53 B;  3BG3 A;  1EYC A;  5I6Y A;  1ILQ A;  3D4R A;  4PQX A;  3S14 B;  5FKA C;  2R6G A;  1C48 A;  1G6Z A;  4KHZ A;  4ZRZ A;  5I2Y A;  3HRZ C;  3CKI B;  2K28 A;  4C1N I;  4WOR A;  1F9P A;  3H0G B;  4RGO S;  5M3M B;  3K0Y A;  1XWE A;  4DU9 A;  1S5C D;  3NQI A;  2NYZ D;  3W3A A;  1TWF B;  1SNM A;  1UNS A;  1B3A A;  3GTG B;  2PPB C;  2F0U A;  4QUC A;  2B8F A;  1V1P B;  4JBW A;  5KRU A;  2B2T A;  4A3G B;  1IYV A;  3MXU A;  4CKB A;  4BWG B;  2LY7 A;  2H1E A;  2WAQ B;  1XX8 A;  1BCP B;  4GZY C;  3R2T A;  1DOL A;  4CKE A;  3BVZ A;  3VYU A;  4HR7 B;  1KLG D;  1TWA B;  1PXU A;  5LL6 X;  1EZ6 A;  1KNA A;  4IFD I;  5KEE A;  5ISR A;  1ZYR D;  2RSN A;  4A3M B;  3HGB A;  5I6W A;  1U9R A;  3BDO A;  3A7L A;  5C4X B;  4BS9 A;  2QDB A;  3NTI A;  4HMJ A;  3MVV A;  3KLS X;  1PZJ D;  1D5M C;  3M4Y A;  1U4L A;  3PUY A;  1I4P A;  1SYE A;  1Q3L A;  2B63 B;  2Q8I B;  1TT2 A;  4FO2 A;  4G4K A;  1QJO A;  3V05 A;  4RGM A;  1O7Y A;  4TKO B;  5CC4 A;  2VB2 X;  2JA6 B;  2N55 A;  4FF3 A;  1VF5 C;  1RF2 D;  4RCO A;  2EYJ A;  2N88 A;  2ZXP A;  2L12 A;  3U9S A;  3AB9 A;  2MUY A;  1LTB D;  1YNN D;  1G2T A;  1DOK A;  1I50 B;  3WDN A;  2JA7 B;  1KNE A;  3R3O A;  5K36 H;  1O7Z A;  2XN9 C;  1SNC A;  3FEW X;  3OW7 A;  3GTQ B;  2F0J A;  1EQT A;  4FXK C;  2D5D A;  4IUN A;  1EOT A;  4ID6 A;  1STB A;  1RKN A;  5JEA G;  5LL6 S;  1EEI D;  2F0V A;  1STA A;  3MWY W;  1HA6 A;  4HAE A;  2KA7 A;  1I4R A;  4HTH A;  1HUM A;  3NP8 A;  2O5J C;  2L5T A;  4BA2 I;  4C2M B;  4DF7 A;  3S2D B;  3HOX B;  3E6Z X;  1V1P A;  2F0N A;  1RJT A;  5G3L F;  2Z4H A;  3D3R A;  2O5I C;  4C56 C;  4J1M A;  1STY A;  1B1Z A;  3HEJ A;  4I7Z C;  3QIA A;  1AP0 A;  3SR1 A;  5I9P A;  2O2L D;  3S1M B;  1BDO A;  3NQT A;  1EWC A;  2V4D A;  5I9O A;  1EIH A;  1EQV A;  5M3F B;  5EQ0 A;  1MSH A;  2FMM A;  1F9R A;  1CZG A;  4DXF A;  3D4W A;  3BDC A;  2AWN A;  1SJE D;  2VXW A;  1JWS D;  4OO1 G;  3NHH A;  4ZLT F;  1IHZ A;  2EYF A;  5D65 A;  1SXT A;  4ZYS A;  4QF4 A;  1FD7 D;  1DOM A;  4K5W A;  1TS3 A;  3GTO B;  3IFD A;  1MSG A;  2SOB A;  4LMQ D;  4FXD A;  1V8Q A;  2CW0 C;  1HTL D;  1SNO A;  5EBC A;  2NN6 H;  1K8M A;  3DWA A;  1KDC A;  2R3Z A;  1DJR D;  3HZX A;  1OXT A;  1ET6 A;  4RFB A;  1EEF D;  1AW7 A;  2E2I B;  4MHE A;  4HCS A;  2PYK A;  3L3O C;  1JOO A;  5A2Q L;  2D62 A;  4KJO A;  1A3U A;  2F0W A;  3ERQ A;  5C5L A;  1SSO A;  1SE4 A;  1ENC A;  1CTM A;  1L0X B;  4ZK9 B;  1B50 A;  2FFK B;  2YYZ A;  5C3E B;  1CZW A;  2PMZ B;  4DNR B;  3PUV A;  3HG9 A;  4Z9C B;  1NSN S;  4KKS A;  4IZ8 A;  1D6E C;  1B9N A;  4KY6 A;  3QJY A;  4CBV A;  3TZU A;  4BY7 B;  3KLS A;  1Y8P B;  2XWB B;  2A6E C;  3GO5 A;  3H09 A;  1WTX A;  1F2Z A;  4KJN A;  1Q12 A;  1BCP C;  1C4Q A;  1I6H B;  3U9O A;  3VR2 A;  4RCN A;  1S5D D;  5COR A;  4DAY A;  1EY5 A;  4C3I B;  4NDX A;  4XXE A;  2AQ2 B;  3UI2 A;  2G9H D;  2A68 C;  5EPJ A;  5M5Y B;  1ONL A;  3WOF A;  1AEX A;  3K59 A;  1GUN A;  2PQE A;  2A74 C;  4Y7N B;  1SE2 A;  1X32 A;  4NP5 A;  3GD7 A;  1F2L A;  2SDF A;  1GJX A;  5FOB B;  3A8J E;  5C3W A;  5ELE A;  3E5S A;  2EJG C;  2TMP A;  3MHB A;  4HCE A;  3DEO A;  4K2K A;  5KYL A;  1FGB D;  4RH6 A;  2BCO A;  4RGN A;  2ICI A;  1KAB A;  1EU4 A;  5CMD A;  4C3J B;  2K01 A;  4U67 3;  1WTQ A;  1TWC B;  5KNC A;  1CA5 A;  3V2T A;  3CRK C;  2L4N A;  4K14 A;  1BR9 A;  4NKL A;  1G8Z D;  5T1G A;  3P1H A;  4XTC S;  1EYA A;  4IUU A;  2KVM A;  3S1R B;  1STN A;  4UAI A;  1JWU D;  3SK8 A;  5IGG A;  4DAP A;  3HOZ B;  3Q22 A;  1H9M A;  2B2Y A;  1PTO C;  1CT1 D;  4UDU C;  3SHL A;  3C46 A;  1H9K A;  2NN6 I;  1WD1 A;  4KD3 A;  2F0F A;  3TP5 A;  3S16 B;  3GTM B;  1S5E D;  3OIP A;  3MAQ A;  4PMC A;  3TZD A;  1IW7 C;  5CV7 A;  2E2H B;  4DFA A;  4FF1 A;  1GUT A;  5KYI A;  1O78 A;  3OIQ A;  5IOD A;  1ESF A;  2NVY B;  4WFN 3;  3QWN A;  1LLR D;  1R4Q B;  1BNZ A;  2KHS A;  5F2D A;  3M7N A;  3FDT A;  2JP1 A;  2NZ1 D;  1ILP A;  1X3Q A;  4A3D B;  1SYC A;  2B2U C;  3VYR A;  1JIC A;  2EDG A;  3SE0 A;  2EJF C;  1SMY C;  1D1I A;  3VR4 A;  2F3W A;  1FR3 A;  2B2W A;  4ODG A;  1GUW A;  4KY7 A;  1TS2 A;  2A6H C;  4QCL A;  2K6A A;  2K5W A;  3DMU A;  3PUW A;  3GP7 A;  4F87 A;  1QG7 A;  1A6X A;  3ND9 A;  2VUM B;  2X6L A;  2NTT A;  2DY8 A;  3DWQ A;  1HHV A;  3I73 A;  4B08 A;  2KJX A;  3FVQ A;  3IAY A;  5ELB A;  4YIJ A;  3K5N A;  3OWF A;  3SEB A;  2EYP A;  2PZT A;  1JOR A;  5KGU A;  1AZP A;  4FXG C;  1DYQ A;  2OXP A;  1SBB B;  3T4A C;  3AU7 A;  3PO3 B;  1U4M A;  5IIF A;  3MFY A;  4EGV A;  2C5C A;  3I91 A;  2PW7 A;  2PCF B;  2L1B A;  2NTS A;  1HCZ A;  2SNS A;  4RWS C;  3M85 A;  1MBY A;  2QF7 A;  4X3U A;  4K5V A;  2F0D A;  3R8B A;  5FLX L;  3LNN A;  1PMR A;  3IL8 A;  2IL8 A;  1FNW A;  2X6G A;  1QOH A;  2WII B;  3URY A;  4PV1 C;  1U4P A;  2KUM A;  1TY2 A;  3H6M A;  1ENA A;  2EXZ A;  5IGF A;  3Q0A A;  5IGC A;  3NXW A;  2VNU D;  3DHQ A;  4TQU S;  3SVM A;  5IOC A;  1GXD C;  2JA8 B;  1OXS C;  5TSS A;  3GTL B;  1PRT F;  1H9S B;  3I3C A;  1Q90 A;  2B2W C;  1SND A;  3BYY B;  1I6V C;  3H94 A;  3LWE A;  4RKL A;  5COY A;  2PW5 A;  2F0E A;  2IT1 A;  4K8I A;  4CGY B;  1KDA A;  3QG1 A;  3V96 A;  1ENF A;  3NTK A;  5E4W C;  4HSV A;  5JPN C;  1CI3 M;  1OXU A;  1JB3 A;  1O80 A;  1SEB D;  4B9X A;  4A3F B;  2F03 A;  1BOS A;  2EYM A;  5C0X H;  2F0G A;  1UUP A;  3K5M A;  3TP7 A;  1EY9 A;  5CBA E;  4TRD A;  1SAP A;  3N6R A;  5ELD A;  2CW0 D;  1Z7T A;  4XYQ A;  4A3E B;  1DXM A;  3PO2 B;  3NBI A;  2M00 A;  3TN2 A;  1SNQ A;  4X3S A;  3VR6 A;  3RLF A;  4OIK A;  5D3I B;  3K57 A;  3HOV B;  3NUC A;  2RQX A;  3QB3 A;  1II3 A;  3O13 A;  5IT9 E;  2SEB D;  4C3H B;  1CQF A;  2JYO A;  3CQZ B;  5EGT A;  4IUP A;  4IFD J;  4O42 A;  1SJH D;  4A3B B;  4R8N A;  3VYS A;  1Q1B A;  2YU9 B;  3A8I E;  2IX1 A;  5J1Z A;  3HOY B;  1XTC D;  1Y8N B;  2MGS A;  4H0L C;  4S3S A;  1WCM B;  1SE3 A;  1I4G A;  4ZKC B;  1CK1 A;  4PMW A;  2DNE A;  3L7Z C;  5CV8 A;  2A6E D;  3D6C A;  1BCP D;  1LTG D;  4DN4 M;  2BE5 C;  1LT3 D;  4R8I A;  2M2L A;  3L9A X;  1STG A;  4DK0 A;  4ILW A;  2B2T C;  3ITP A;  3RZD B;  5E1F A;  4IAL A;  4MIU A;  2FHT A;  2K7V A;  3MXP A;  1H9S A;  2A68 D;  4IUT A;  3VA7 A;  2A69 C;  3HS0 C;  1IYU A;  1LT5 D;  1AN8 A;  4TSS A;  3C1E A;  3A55 A;  3NPP A;  1Q1E A;  3K5O A;  2KEE A;  2KED A;  1DON A;  1VCI A;  4KHV A;  1HRJ A;  3BYT B;  4C3I G;  5EBD A;  1PTO H;  4LK1 C;  3GTP B;  2HDM A;  4KD4 A;  1EL0 A;  3OOC A;  1PRT B;  3J7A V;  4KN4 C;  2ZXR A;  3J81 E;  1CA6 A;  4G7Z C;  3A56 A;  3ZYY X;  1QWY A;  3GTK B;  1FNV A;  1EY4 A;  1Q8I A;  3GTJ B;  3K6O A;  3TSS A;  2RA4 A;  5CV9 A;  3W2D A;  3EFX D;  1LO5 D;  1BUV T;  1AFP A;  5D3D A;  1WTV A;  2FMC A;  3J81 L;  1MI2 A;  5C5M A;  1SYG A;  4C3J G;  3M3Y B;  5C0X I;  1EU3 A;  2WKC A;  3F2U A;  1QB5 D;  1RTN A;  3BVG A;  1PTO D;  3LWU A;  1CHP D;  4EQP A;  1JQY D;  4H13 C;  4KMU C;  3X3N A;  4FNF A;  2IPK D;  3GV6 A;  1ROD A;  1HXY D;  2KEC A;  1EZ8 A;  3MEH A;  5BN5 A;  3D31 A;  1IW7 D;  4K5X A;  3MXG A;  1A2U A;  1HFG A;  1KAA A;  2NUC A;  2PZU A;  3BVM A;  1TY0 A;  1TKW B;  4KV6 A;  5FK9 C;  2WKD A;  4I65 A;  2Z8L A;  3WOE A;  1LT6 D;  2HCI A;  2IX0 A;  5C3X A;  1WTO A;  4KN7 C;  2E74 C;  4IFD G;  1GUS A;  1HTP A;  1D5X C;  3M7G A;  2I46 A;  2F0K A;  1M8A A;  1QE6 A;  3PV0 A;  1BQQ T;  1SMY D;  2A5H A;  1GHJ A;  1GUO A;  1E0B A;  3Q23 A;  3I8Z A;  4A3J B;  1RCV D;  2QEJ C;  1TU2 B;  4KI0 A;  1VDZ A;  3E0J A;  1SYD A;  2EY1 A;  2EY6 A;  2EY5 A;  2A6H D;  1PFM A;  1V43 A;  4NW2 A;  4ZUJ A;  1JC7 A;  2F0O A;  1M4V A;  4ZQ3 A;  5IGE A;  4IUQ A;  2K05 A;  2RSO A;  2TSS A;  5KNB A;  3MZ5 A;  1SDF A;  5JEA H;  3IFT A;  4WRD A;  2XRS D;  2BDN A;  2ZXO A;  3DEP A;  1WTR A;  1R9T B;  3HP3 A;  1VF7 A;  1LTT D;  2A73 B;  5C4H A;  1XXG A;  4XT1 B;  1JWM D;  3QOJ A;  2E2J B;  2JXM B;  1PZI D;  5M9O A;  1YNJ C;  2F0S A;  3ERO A;  2L0C A;  1ZXT A;  4H44 C;  1CQV A;  2WB1 B;  4IUV A;  2NVQ B;  1PFB A;  1SYF A;  1TWH B;  4FYD A;  5BN3 A;  2I07 B;  3FKI B;  4K6D A;  3P20 A;  1I3Q B;  2JSO A;  3S17 B;  1A3V A;  1Y8O B;  2RKS A;  2KQ3 A;  1SYB A;  2NVT B;  2L55 A;  3A7A B;  5CR3 A;  5BN4 A;  5C4Z A;  1PZK D;  3S1Q B;  5LHY 1;  4OO1 H;  1NR4 A;  1PDQ A;  3PUX A;  3J80 E;  4Q0F A;  3VA5 A;  4LAA A;  1HQM C;  2ICE C;  1FYC A;  5JJZ A;  1JCK B;  2F0H A;  1LAC A;  4K6L A;  1LV9 A;  2RDG A;  3J80 L;  2XIW A;  4J6H A;  3N52 A;  5T1I A;  2PZW A;  5C44 B;  2E2D C;  1B53 A;  1RTO A;  2RBM A;  3AMU A;  4BBS B;  3TDQ A;  4F8M A;  3FMC A;  2O4X A;  1B4O A;  1OXV A;  3H3V C;  1V1O A;  5G3L D;  1BCP F;  3QO2 A;  1E2W A;  3S9W A;  2M9V A;  1SNP A;  2R61 A;  2PO4 A;  1F2Y A;  3EVQ A;  4XYO A;  4G7H C;  3NTH A;  1PRT C;  5J39 A;  3PIP 3;  3R2I A;  4L8J A;  1XYI A;  3PUZ A;  1G91 A;  2Z1C A;  4M1U B;  5J22 A;  3C1F A;  5K5P A;  1UAP A;  1QNK A;  4RHR A;  2G9D A;  1WTP A;  1LTA D;  2JA5 B;  2J7Z A;  5DM7 3;  1B2T A;  4Q5V A;  1KLU D;  2K33 A;  4X3T A;  1WVL A;  4HMI A;  4C1N K;  2JEA I;  1T5X D;  3NWS A;  2FJ2 A;  5HUR A;  5AFW A;  5IGB A;  1H9J A;  4ZAI A;  3T51 B;  4XIG S;  3RZO B;  2R92 B;  2LFN A;  1EY8 A;  5EJW A;  2B2Y C;  4WJW A;  1J8I A;  5K36 G;  4F88 A;  2XWJ B;  4OGQ C;  2H4O A;  1B44 D;  2WIN B;  3MC0 B;  1BBX C;  5JVG 3;  1PTO F;  1OO9 B;  2KCN A;  2FIN B;  4R9W A;  4C3H G;  4XDX A;  3MA2 B;  3DM1 A;  4HN7 A;  1UEA B;  3PIO 3;  2OEO A;  2BE5 D;  4DXG A;  3I72 A;  4ZKB B;  4KY5 A;  4BA1 I;  4AYB B;  3D4D A;  3T56 B;  4OO1 I;  2E76 C;  2AUK A;  5NUC A;  4IQZ A;  3HOW B;  1CM9 A;  2EJM A;  4G7O C;  1OXX K;  2A69 D;  4PMB A;  2K32 A;  3A8K E;  3G6J B;  1EY7 A;  4HSP A;  1EYD A;  2Q8T A;  1CHQ D;  3CHB D;  2CHB D;  2NB0 A;  3T16 A;  3S2H B;  1HQR D;  2JEB I;  3M4O B;  2DN8 A;  3I90 A;  5JAV A;  3SDZ A;  3TBI B;  4QUF A;  4RAU C;  1TII D;  1X3P A;  2F4I A;  3LX0 A;  2Q8R E;  5DNF A;  4ME5 A;  3NK9 A;  3Q24 A;  4G57 A;  5C6A A;  4NMZ A;  4XQJ A;  2LKV A;  2E75 C;  3OSO A;  3J7Y W;  4L6T B;  3HOU B;  2EPB A;  3SK6 A;  4E6I A;  5C4J B;  3I4L A;  2AUJ D;  2NN6 G;  2RDF A;  1U4R A;  5EKK A;  3K5L A;  5A35 A;  1BO0 A;  2BA1 A;  1K83 B;  4N9T A;  4ZUI A;  1LTR D;  2R7Z B;  4CJ2 C;  4KK7 A;  2ENB A;  5FO9 B;  4ULL A;  4LJZ C;  2F1M A;  2BDO A;  2RDH A;  1MGS A;  5KND A;  5D14 A;  4EVO A;  5FO8 B;  2EZV A;  2F0M A;  1BXT A;  1HFN A;  1RDP D;  4A3I B;  4RA8 A;  4EQN A;  3C2P A;  2XVS A;  3KK7 A;  2EY2 A;  3H91 A;  5CYU A;  3RUZ A;  2WP8 J;  5ELC A;  1IL8 A;  1DM0 B;  5IT9 L;  3S15 B;  3NE5 B;  4CHT B;  2WV6 D;  4K8J A;  2MHV A;  3SK5 A;  1WTW A;  4ABN A;  3OPO A;  4L63 B;  1FNU A;  2LS0 1;  1Z6H A;  1VMP A;  5M5X B;  1PTO B;  3OWE B;  2CQA A;  3G7L A;  4XQQ A;  5FO7 B;  1D1K A;  2GA4 B;  2JE6 I;  1I4Q A;  4MN3 A;  2DNC A;  3I4N B;  2HDL A;  3KF8 A;  3FPP A;  2WAC A;  3D6W A;  2NBF A;  3GV3 A;  1JOK A;  1GOZ A;  1GUG A;  1TS4 A;  2HCC A;  1TWG B;  3SK4 A;  1C8C A;  2IX3 A;  5IGD A;  2AWO A;  3C3L A;  3K58 A;  3NWT A;  2B8G A;  1G29 1;  2NWG A;  1B9M A;  1YNJ D;  2IWH A;  1O7L A;  1HA5 A;  4X3K A;  5JOB A;  1EY6 A;  3KUP A;  1SFO B;  4IUR A;  2HUG A;  2RVL A;  2AQ1 B;  4F7X A;  3PMF A;  2C9O A;  2SNM A;  5I2X A;  5EKL A;  3QOL A;  2K1B A;  4A3K B;  2IW3 A;  1LTI D;  1ZKO A;  2QIL A;  5EPL A;  2LMC B;  1EY0 A;  1ZYR C;  3KBG A;  2F0L A;  3BS1 A;  1LAB A;  3CRL C;  1L0Y B;  2XRQ D;  1J9O A;  5I4D A;  2R93 B;  1DCZ A;  2EOT A;  3IKJ A;  1A2T A;  5CV4 A;  4K2L A;  3ND8 A;  1K8O A;  3RMH A;  5A2Q E;  5CBE E;  1IKL A;  2AQ3 B;  2XSC A;  3NSW A;  3D8G A;  1TR5 A;  2F0I A;  2PNR C;  5CV6 A;  4FP5 D;  1Y1V B;  4PNY A;  5C0X J;  2B39 A;  4QIW B;  2EYH A;  1WD0 A;  4QMG A;  4FVM A;  1YNN C;  3VYT A;  1PRT D;  3TP8 A;  2EE1 A;  2ID0 A;  1JR0 D;  2F0T A;  1Y1W B;  2MPM A;  2F3V A;  3DWP A;  3VR5 A;  2CVR A;  1TQO A;  2VB3 X;  5EPK A;  1ML0 D;  2BA0 A;  1AZQ A;  2NVX B;  1STE A;  4RKB A;  3SXH A;  1Y69 U;  3S1N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...