2WKCA

Crystal structure from a single-stranded dna binding protein from the lactococcal phage p2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
90
Chain Sequence
GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEKGSNVKVAYGSAFLPDFIQLGDTVTVSGRVQAKESGEYVNYNFVFPTVEKVFIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ORF34P2
publication title Structure and Function of Phage P2 Orf34(P2), a New Type of Single-Stranded DNA Binding Protein.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Dna binding protein
total genus 11
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16773 Phage_SSB Lactococcus phage single-stranded DNA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.400 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2wkcA00
2WKDA 2WKCA
chains in the Genus database with same CATH superfamily
1KDBA 3HOZG 3TRZA 5I9OA 1YZ6A 5IP7H 1VMPA 5GADC 1IBLQ 2XGTA 4RA8A 2FINB 2EYJA 1YNXA 1KLUD 5BR8Q 2K32A 2A6HD 1KXLA 3R2TA 4GKJQ 5GAHC 2OTJA 4UP8A 3SHLA 1IHZA 3T1YQ 3KYHC 1SNCA 2RKSA 1XPUA 1AE2A 2V4DA 4MIUA 4DR3Q 2QA4A 4A3BH 2IJ0A 2VS1A 5KNDA 1AE3A 4H02A 2JA7H 2PMZB 2JK8A 4DUYL 2CQOA 1NTGA 1XTDA 5M5WH 4DR2Q 3NHHA 1BCPB 3TP7A 4G4KA 2FJ2A 4LFBL 1AW7A 4B3SL 2JQOA 4HAEA 1NJIC 5C3XA 3FHWA 4KKUA 4DV5Q 2RCFA 1TWGB 2LMCB 3P75A 1J9OA 5IT9c 2HHHQ 3I4NH 1F9SA 4F88A 1KIXA 1WTPA 4OIKA 2WAQB 1MJCA 4DR4Q 1Y8PB 1XMQL 4RG1A 3HOWH 2R7ZG 3KJOA 4POFA 2PNRC 4C3JG 3M9BA 4DV4L 1WCMH 4EX5A 1XXGA 2Q8RE 4GN3B 1HA6A 4R4QA 2R7FA 4MTNA 1EIFA 2DY7A 4KI0A 1H9KA 1BQQT 1M1KC 3CC4A 1TQOA 1Q86C 1GUWA 4IPHA 5JVH3 3RZDB 4E6IA 3G71A 1I4PA 1CZGA 1QOHA 1SJHD 5CORA 1A6XA 4NXNL 2Y0SB 2PQAA 3D8GA 2Q2IA 3SGIA 1L0XB 5G3LF 1D1IA 2RSNA 2F0IA 4RCNA 2IT1A 1ZXTA 4ZLTF 3TZUA 5T1IA 1D6EC 2DGYA 2EYOA 2KJXA 2C5CA 3EJIA 4IN3A 1UNSA 5C3EG 1O80A 1K9MC 2F0KA 2CW0D 4B3TQ 3HS0C 3D4WA 3GTLB 1I4HA 1HJPA 3A0JA 4OHJA 1D5ZC 1KQSA 1KDAA 1S5ED 5IYBG 3S24A 4BS9A 5M5XH 5IYCG 4X66Q 3OW2A 5J3BA 1AN8A 5FLXL 2A5HA 1ET9A 3S9WA 4RCOA 2F0MA 4JW0A 4N9PA 1JORA 2YTXA 1QZGA 1IBLL 1V8QA 5JVG3 2GVAA 4HJ5A 1BBXC 2AQ2B 5BR8L 1GO3E 2MP1A 3NPPA 4QUFA 2M9VA 4GKJL 1QVGA 3CC7A 5M3MH 3BG3A 3NSWA 1K8OA 3T1YL 3PO3G 1LV9A 4FNFA 4Q5VA 1B1ZA 5C4ZA 4DR3L 1PVOA 2NTTA 2KECA 4GN4B 1B44D 3I2ZA 3E0JA 3K8AA 4MZ9A 3S1MB 4OIJA 3F8TA 3IFDA 4DR2L 1VQJA 4YY3Q 3ERSX 3CMEA 3MFYA 2E5LQ 3MVVA 2WAQG 1F9PA 3SXHA 1TS4A 3IRBA 1IBMQ 3K0YA 1YJ9A 1A3UA 1PH3A 4DV5L 5M3FB 1CQVA 1G2TA 2EXZA 2R93H 2FXQA 2HHHL 3W2DA 2SOBA 3DM1A 2O5IC 4C3HB 1IBKL 3H3VI 4LAAA 2F0TA 4A93B 5GAEC 2F0FA 4DGZA 4IUUA 5IGFA 2JEAI 1M8AA 1MSGA 2D0PA 2Y0SG 4JI3Q 2XNAC 1SEBD 2KCMA 3D0FA 1SE8A 1EWCA 1AZPA 1RCVD 4R9WA 1EY9A 3BU2A 1SFOB 3CW2C 5AFWA 4B3RQ 2B63H 3MWYW 3W1GA 5ELEA 2LS01 3M4OB 2QF7A 1VQPA 3HKSA 1JT8A 4POGA 4BXXG 5JJLA 3U4ZA 3S17B 3UDFA 2OTLA 1WTHA 5COYA 1BDOA 3MXGA 5E7NA 1DCZA 1XNQQ 3WWVA 2CHBD 1FVIA 1UE1A 1ZYRC 1XX8A 3HG9A 2K5NA 1BCPF 4NKLA 2SNMA 5I2YA 4JBMA 4IFDI 3P7JA 1SBBB 2RDGA 5J39A 1YJNA 1ONLA 3MTSA 3TSSA 1OXSC 4X66L 4GNXB 1R4QB 1KTKA 1NUCA 1KDCA 2N55A 5AJ3Q 1U4LA 2XRQD 4DR1Q 1B70B 3F2UA 3J81L 3V2TA 4RWSC 2JE6I 4C2MH 2BE5D 3KLWA 4RKBA 4GKKQ 4WJ3M 2ZJQA 1B8AA 4HR7B 2NVQH 1S5BD 1YNNC 2Q2TA 3GTKB 4OWWB 1GUGA 2N78A 1JWSD 3BYYB 2R7ZH 3VA5A 4YY3L 3GDEA 1EQQA 3S14B 4IUQA 1PZID 1LLRD 2CH4W 4C3HG 5A35A 5ELFA 4RGOS 4DUZL 1HNWQ 2ENBA 1XPOA 1IBML 2LFNA 4U673 3Q22A 4A93G 1X9NA 3CKIB 4P75A 2VQEQ 4JI6Q 3T4AC 1MKHA 2PZTA 3N6RA 1BO0A 4PZ7A 4A3FB 4WRDA 3QIAA 5IODA 2HQEA 3GTJH 5JJKA 3TP5A 1MGSA 4QY7A 2A69C 1VF7A 2E76C 1SMXA 1SROA 2AQ3B 4RGNA 4TSSA 4JI3L 3LGJA 2ZTCA 3MZ5A 5C3EH 1FYCA 4A3BB 2DNEA 2F0WA 1JOOA 4IUTA 4B3RL 2ZJRA 1KABA 2JA7B 1NCVA 4HIDA 4LF7Q 5LMNW 5M5WB 5IYBH 2EIFA 5C44H 5CYUA 2B2YA 1X3FA 5IYCH 4GLVB 1YIJA 4DR7Q 2HDMA 4LF8Q 4A3IH 3EQLC 4ZRZA 1A2TA 4A75A 3SE0A 3KJPA 1E2VA 1HUMA 2E2IH 4YCWA 2JA9A 1XNQL 3I4NB 3FKIH 1EFID 1QILA 3NBHB 1LT5D 1GUTA 1SMYC 1OXXK 1TY2A 1LT4D 5KGUA 4BY7G 3HOWB 4KMUC 3PO3H 3MA2B 3V05A 2QDBA 3EBEA 1WCMB 4HIMA 4LF6Q 4A3KH 1PTOC 4PMWA 3CCJA 1MI2A 4N8FA 2UUCQ 5AJ3L 4RH6A 2JSOA 1PTOH 4DR1L 2KBNA 5IT9L 4LW1A 4A3CG 3U9SA 1STYA 2EOTA 1LYLA 4IURA 1TS5A 4G57A 1JCKB 4BY1H 4EQOA 4GKKL 1N33Q 2IX1A 5E4WC 4OX9L 2A73B 1SNQA 1G8ZD 1S3OA 2K5WA 1MIUA 1RHPA 2PNHA 1JQYD 1ILQA 3T53B 3RLOA 3PO2H 1F2MA 3R3OA 4JI7Q 3DWQA 5IP7G 1A3VA 2EDGA 4A3FG 2VNUD 1PFNA 1EYCA 3KLRA 3E6ZX 1HNWL 1HZBA 3GTPH 5M5XB 2F0UA 2B2YC 2PW5A 2JYOA 2ES2A 1GUSA 2VQEL 4UY8C 1B2TA 3I4MH 3L9AX 2EXDA 1BVSA 3HFZB 1SYCA 1J5EQ 4A3BG 1RD9D 4X3KA 1N36Q 3PUWA 1YHBA 1KC8C 4HCEA 2NN6I 3IL8A 2JA7G 1DYQA 1HZ9A 3NTKA 2YTYA 5M3MB 2YU9H 1OXUA 4FDBA 3I91A 2K5QA 2B8FA 1EY0A 2O4XA 2X6GA 1GJXA 2CH4A 2ZXOA 3DEOA 2E2HH 4LF7L 4ABNA 1CK1A 4LUZA 1JICA 4L5RC 3I4NG 1B9NA 1EU4A 4FYDA 3I8ZA 4DR7L 2OQKA 4LF8L 1VQGA 3SK4A 1JOQA 2F0LA 5EJWA 4P2CB 3HOWG 2MJ8A 4R4CA 2XTIA 3PGZA 1PA6A 2HD3A 2R93B 1LTSD 2KCTA 2PQAB 1NE3A 5IE8A 1C9OA 3G4SA 4AQYQ 1PH2A 3CPWA 2F0JA 1Z47A 2ZXPA 2D2CC 1JOKA 2Z1CA 3FMCA 2X69A 2F3IA 1YHAA 2PCFB 2OWOA 4XT3B 1CKOA 2GN5A 3VR2A 4LF6L 2CWPA 1IXRA 2K04A 2PI2A 2DY8A 4O0AA 3GO5A 3G6EA 1HFGA 2EJGC 4LFCQ 4L5SA 2PZUA 3LWUA 1EQVA 4HTHA 3OW7A 2B63B 4IPCA 1Q1BA 4UP9A 4NXMQ 2OF1A 1A15A 3EIVA 2WIIB 5CV6A 3HZXA 3PQIA 1JE4A 3CRLC 1U5KA 4ZAIA 1GD7A 5C4JH 1EZ6A 1B50A 2RA4A 4JI2Q 4OL7A 4WFN3 2EJMA 5IGBA 5JAVA 3KLSA 2IHEA 1WTQA 1L0YB 2KA7A 1K28A 2M00A 4NP5A 3RZOH 4K6DA 3K5MA 4QMGA 4CDCC 3VYTA 4X65Q 1I4RA 3J7YW 3M4QA 4JI7L 2Q8TA 3CCSA 1Y1WH 5LMUQ 1EZ8A 2BH8A 5A2QE 3T13A 3S17H 1SMYD 1BCPD 4EVOA 2K01A 3AFQA 3E3XA 4P73A 3MXUA 4LUVA 1Q8KA 5DAUA 5ELNA 2UUAQ 5DM73 5I4DA 1PTOD 2RF4A 1J5EL 3X3NA 4C2MB 2X6LA 1ENFA 1AZQA 4CKCA 1EIYB 4P71A 2HIVA 3HOUH 4J8QA 4JBWA 4DR5Q 2K5HA 2NVQB 4BY7H 5IY0A 1B9MA 3S15H 1BR9A 1DOMA 1YBYA 1PRTC 2R93G 1H9JA 2F0QA 3HOVB 4K8JA 3I73A 4TVAB 3CRKC 1ZKOA 4J15A 4K5VA 4DNRB 2WFWA 3A74A 4YHHQ 1PYWD 4A3CH 1VCIA 4HEDA 4MHEA 1PH5A 4UAIA 4AQYL 3H3VC 5EKKA 1SYBA 1TY0A 3IFTA 3URYA 4AIMA 3KBGA 1UEBA 2FMCA 1EEFD 4PZ8A 1S5DD 2K5VA 2EYLA 3HEJA 3Q6SA 4QQBX 1G51A 2B63G 1WTVA 4K0KQ 2QGQA 3STBC 4JCVE 1HZAA 4RFBA 4CDFC 3D6WA 1I94Q 5CV4A 5EAYA 3OIPA 1CHPD 3FVQA 4I7AA 5CV7A 1IKMA 4LFCL 4WORA 1CA6A 2JA8G 3J7AF 5FLMG 1T5EA 1X3QA 3Q24A 4A3FH 3PUVA 4KV6A 1HNXQ 4JOIA 5C44B 4LWCA 2UXBQ 4IUVA 3JAMi 4I65A 4H0LC 1F2YA 2IX3A 4A3IB 1U4MA 2ZM6L 2R61A 5LMNQ 1WTXA 1H9SB 4A3JH 3CMAA 1VQCA 3W1BA 2PPBC 2E2IB 1X3PA 3QB3A 3UI2A 4DK1A 3FKIB 2PZWA 1ENAA 2A68D 1B4OA 4APVA 1LT3D 4IQZA 4C1NK 4X65L 4PMBA 2SNSA 3PO3B 4IFDH 4KY7A 4QUCA 5LMUL 1HA5A 1OXVA 3LWEA 2NZHA 5EBDA 4A3KB 2JJQA 3QR8A 2RDFA 1PTOB 4HJ9A 1DZ1A 3U58A 2UUAL 4O2DA 5DEHA 1HNZQ 5D65A 5C5MA 3I55A 2B2WA 4HSVA 1TWHH 5NUCA 3GD7A 4BY1B 5TSSA 2HT1A 3GTGH 1K0SA 3HOVG 2E2JH 2VUMB 4DR5L 5E3FA 1C7YA 1W3SA 4IFDJ 3X3MA 1TWCH 2Z6KA 3NUCA 3J81j 1S40A 2BA1A 2Z8LA 3PO2B 5CBAE 1EYGA 3C1FA 1JJGA 1DJRD 1Q7YC 4LK1C 2VB3X 4DV2Q 1C0AA 2WB1G 3J80c 1S72A 3GTPB 3CAMA 1TU2B 4JOIC 5DNFA 4YHHL 1VQ6A 2DUDA 1EIGA 4XQQA 2IHFA 2K50A 4ZK9B 1C8CA 4EQPA 4LMQD 1JMCA 2H1EA 1FD7D 5CMDA 2H5XA 5EPLA 1STHA 2QEJC 1OTCA 3I4MB 4IPDA 1VQFA 5C0XJ 5FJ8H 3WOEA 1IW7C 1E2WA 2CQAA 4A3MG 4NPSA 4K0KL 1Q81C 2K1BA 3DXJC 2YU9B 4HCSA 5C44G 5BN5A 1H9MA 1I94L 2G5DA 5K36H 5KEEA 4A3IG 5FKAC 1A3TA 4XQJA 2B8GA 2E2HB 1SJED 5C4XH 2A6EC 3NXWA 1HNXL 5BN3A 3GQBA 2CVRA 3FKIG 2EYFA 1SSOA 2TMPA 3A7LA 3A8JE 5M9OA 3SVMA 5FLXE 4OWXB 4JI5Q 1Y8NB 1DXMA 2B2WC 1VQNA 2EPBA 4DAPA 5LMNL 4NMZA 1GOZA 4O1NA 2R3ZA 4L8JA 3FDTA 1MBYA 3OMGA 4A3KG 1SE3A 4R8NA 4IJHA 1L2FA 1T5XD 2PI2E 3ITPA 4X3TA 3G7LA 2ASBA 4H13C 2Z6KC 3IKJA 3KFUA 3J7ZC 3VR3A 3M4PA 2QEXA 1P8LA 4BY1G 3A5ZB 3PSIA 2WKDA 2F0HA 3TREA 1YJWA 3A7AB 4NB3A 3OTOQ 3KUPA 3STBD 1X32A 1HNZL 2VUMG 1SE2A 3VDYA 1ICWA 4X62Q 1BBWA 4DR4L 3K7AH 3K0XA 5C4HA 4G7HC 1VDZA 1XNRQ 1L1OA 4A4IA 3A8IE 3PIO3 3PO2G 5C4JB 2F03A 4XYQA 1CZWA 4AYBE 1Y14B 1RODA 1FNVA 2I46A 1E1OA 4DV6Q 3HOXH 3E5SA 4JV5Q 2DJGC 4KN4C 5IP9H 1PH7A 2D0OA 3CP0A 3U4VA 3ZJYC 4L6TB 1VQ5A 3MXNA 3RZOB 2F0GA 3M7GA 4KY6A 4FF3A 4ILWA 1AH9A 1A0IA 3FP9A 3K58A 4DV2L 3I4MG 2B2TA 1Y1WB 4IOAA 3L7ZC 5D3DA 2UUBQ 2PQEA 1EU3A 3R93A 3J7AV 2JA8H 2YYZA 2O2LD 1IKLA 5FLMH 3WOFA 3S1QH 3Q0AA 1D7QA 3CU7A 2D5DA 4P72A 4ULLA 4DK3C 1K3BC 1U0LA 1LACA 1OXTA 2K52A 2XWJB 1FNUA 4B3TL 1CA5A 3H6MA 3CXCA 3KF8A 1L0WA 4BBRB 2KHJA 3NQIA 4DXGA 3ER0A 1EY7A 2NN6H 1GXDC 1X55A 3HOUB 1PH4A 1PTOF 1LTAD 3TP6A 2MFIA 4LF5Q 1QNKA 5CV8A 4BY7B 1PXUA 4UHVA 3S15B 1E3PA 4RMFA 3AQQA 3U9OA 3TS2A 1VF5C 1U9RA 4IPGA 4LNQA 1PRTB 4JI5L 3ULLA 5EGTA 5C0XI 4N9TA 1FL0A 3J81E 1L1OC 3TP8A 5LL6X 2OEOA 1EQRA 3W3AA 2RBMA 2VZAA 3CCRA 3TBIB 3T1HQ 1BNZA 4H44C 2N88A 3BVMA 4JI0Q 1G6ZA 2OXPA 1F9RA 1YVCA 2JA5H 3K7UC 2R7DA 3HOVH 3K5OA 3RMHA 3K57A 2E5LL 2C35B 2KENA 2QDLA 3HGBA 5DM63 3I4LA 1VQ8A 1ICFB 2VY3A 4KK7A 1HHVA 1XPRA 4AYBB 1BOSA 1D5XC 1ZEQX 2B2TC 2LY7A 1VQ7A 1WOCA 3VR6A 1IYJB 2DJFC 2HUGA 4DNTB 2BCOA 1OO9B 1KL9A 4K8IA 3GTQH 4R4TA 4GZYC 3K59A 1N32Q 4X62L 2QCPX 1PMRA 2VQFQ 2NTSA 2RHQB 5EBCA 3JAMc 3A55A 1HFNA 1XNRL 3FEWX 5HGTA 5JEAJ 3SK8A 3E9HA 2RVLA 1TWFH 2NYZD 2AUJD 3KDFA 3A8KE 4YCUA 1WTWA 4DV6L 4A3JB 1Y1WG 5D3IB 4JV5L 4NDXA 2AWNA 5EQ0A 4DK6C 2K6AA 5CR3A 1V1QA 3DHQA 5I9PA 1SYEA 1NR4A 5F2DA 4A3MH 3CCMA 3HOYH 3R2IA 1CKNB 1K8AC 1Q3LA 5JPNC 2UUBL 4QJFA 1CUKA 2EY1A 1VQBA 1VQKA 4RAUC 2NVXH 4G7OC 1PHJA 1W6KA 4BBRG 2B39A 5KYIA 5FO8B 4DV3Q 3HOUG 5FO9B 2NZOA 1HRJA 3NQTA 1TWHB 3D31A 2AUKA 4HJ8A 3NTHA 2E74C 1QUQA 3TS0A 2G9HD 3GTGB 2E2JB 1PLFA 1G6PA 3LNNA 4KHVA 1SAPA 1XMOQ 2CWAA 2K5DA 3ERQA 4FF2A 2ICIA 1TWCB 4LF5L 1STAA 3D4DA 1J6QA 3K5NA 3RR5A 2JA6H 3E9IA 2H4OA 3P20A 5KYLA 3TEHB 5JOBA 4RKLA 1U4PA 4IUPA 4RHRA 1IYUA 2XVSA 1I50H 5IT9E 3DMUA 3CF5A 2UXDQ 2VUMH 1GVPA 2OT2A 4HN7A 4GOPA 1T9HA 4AYBG 3S1NH 3CD6A 3T1HL 4JI0L 5EKLA 1VS0A 2Z4IA 1C4QA 1I5FA 4S3SA 3SDZA 1Z9FA 3J80L 2SDFA 2VL6A 1I4GA 5L37A 1EY6A 3J80i 1N9WA 3DEPA 3GP7A 3TDQA 1SDFA 1ZYRD 4K5XA 2XSCA 4JI6L 4OO1I 1CI3M 3BS1A 1EIHA 1QB5D 1I4XA 4A3JG 1N32L 5C4XB 4CJ2C 3HKZE 1HR0W 1BBUA 3OOCA 2VQFL 4K6LA 4OONA 1B3QA 2M2LA 5CGKA 3I72A 1PZKD 1MHWC 4DR6Q 3TMEA 2F0DA 1TWAH 1CFMA 3R8BA 4UPAA 4IFDG 1HUNA 3D4RA 2DNCA 2F0NA 2Z4HA 4JPBW 1QE6A 1AEXA 4UDUC 1EY8A 4OEMB 4B3MQ 2K75A 2IY5B 3RLFA 1RIPA 2R6GA 1X65A 4M1UB 1YNND 2QILA 1PRTF 1JE5A 5ELOA 2CFMA 2PO4A 3CCQA 1EWHA 1WFQA 1FGBD 4IO9A 1UAPA 3L2PA 4FF1A 5C5LA 1STNA 1QZHA 1RKNA 4DV3L 2K28A 3GTMB 3NWSA 4ME5A 3CCEA 1UEAB 1VQAA 3KF6A 5I6WA 2PW7A 4CGYB 1QCBD 2KHSA 5CV9A 3K7AB 4XQNA 4GOPC 2EYMA 2I07B 3UE0A 3EVQA 1VQ4A 1JR0D 4WJ4A 1SR3A 2E75C 3EN2A 1CM9A 1XMOL 2UUCL 4B9WA 3HOXB 2A69D 2KEEA 3DM3A 1MJEA 4L5TA 1I6HH 3PIP3 1R9TH 4O42A 1E0BA 2WB1E 3A5UA 2L1BA 1LUZA 5K5PA 1B7YB 5GQOA 2N8NA 2KCNA 3NELA 1N33L 5FJ8G 2KUMA 4MNOA 2NVYB 2JA8B 2UXDL 3KLSX 3S1QB 3G6JB 3DWAA 3OHXC 1HXYD 1O7IA 3MEHA 5K36G 3T51B 2XRSD 4ZKCB 1DGSA 3HKZB 4RHSA 1PYBA 2QW7A 3SEBA 4LF4Q 4X64Q 2WKCA 3A54A 5C4XG 1SYFA 3SK6A 3IAYA 1PFBA 4CDEC 1TIID 1NR2A 1A8VA 4PNYA 4PZ6A 5IYDH 3OPOA 4BA1I 2RHSB 1KNEA 1Z6HA 1SRUA 5IGDA 4BBSB 3GTOH 3EFXD 1CTMA 5M5YH 5BN4A 3AYHB 4ODGA 2A1AA 1E1TA 1Q1EA 1N36L 2I5MX 4KHZA 1E2ZA 4KJOA 4BBRH 1VQEA 4B08A 2KCCA 3PUZA 1WVLA 3OMCA 4B3SQ 1HPCA 1TXYA 2KHIA 1UE5A 4YIJA 1EY4A 2MUYA 2CW0C 1A62A 1LO5D 5C6AA 1L1OB 1HQMC 1VQOA 4B3ML 3VA7A 3VYRA 1KRSA 2NVTH 1EWIA 1NY4A 4A3LH 3RLNA 3FRPB 4QL5A 2JA5B 4L5QA 1XMQQ 1SNMA 1LT6D 2ZXRA 2G9DA 3MXNB 3OIQA 2YV5A 2DN8A 2ICEC 4RGTA 2Q8IB 4IZ8A 3VYUA 2OCEA 5CC4A 1SNPA 3I56A 3PUYA 2EY6A 4LJZC 4YWLA 3GTQB 4PQXA 3S1RH 4DAVA 4A3DH 1DONA 2BA0A 2WB1B 3PCOB 1WTRA 3HOXG 1X3EA 5IP9G 2EVBA 5DLQE 5EPJA 4IOCA 4MN3A 3H3VH 3UDXA 1TWFB 4NXNQ 4CHTB 3CHBD 2WACA 1PH6A 1Y1VH 4ME3A 3U50C 2FHTA 4A3GH 2AWOA 1VQMA 1TKWB 3KF8B 4DFAA 4DN4M 1Q46A 4A3MB 4QGUA 1ESRA 3HOYB 4K2LA 4NXML 3QOJA 1VQDA 3JAML 4KKSA 1V1PA 1NMFA 4HMJA 5KRUA 2EYPA 1DOKA 2BDOA 2LKVA 3HKZG 2N49A 3AFPA 3DWPA 2F3VA 2NVXB 2EY2A 2MO0A 4JI2L 2YTVA 1F77A 2NZ1D 2NN6G 3C1EA 3K6OA 4CBVA 4XIGS 2ZTDA 1KD1C 2K7VA 4JI1Q 4ZUJA 1EYDA 2NUCA 3RUZA 2K03A 3C2PA 2L12A 4LF4L 4X64L 3MAQA 3PIOA 3RN2A 4BBSG 1K83H 4WJWA 3Q23A 1DOLA 1W2BA 1PH1A 1GKHA 3PMFA 2V1CC 3C3LA 1KNAA 1CT1D 1EQTA 1O78A 4CKBA 2JA6B 3CC2A 5JEAG 5I6YA 4KD3A 3UDIA 1WD1A 2L11A 4HIOA 4PV1C 3N52A 3P1HA 1PH9A 3S2HH 1G291 1I50B 4B9XA 2JA5G 4DAMA 1VMCA 5HURA 1G2SA 2IPKD 5C0XH 2HCCA 5KNBA 1PFSA 5ELCA 1BUVT 1LTTD 1GHKA 1HTLD 3S1NB 4A76A 2B2VA 4FO2A 1HQRD 3KDFB 1QNUA 3LX0A 2RSOA 1IBKQ 4DA2A 4C1NI 2JP1A 4QB4A 1F9QA 1TS3A 2D9UA 3QG1A 1QWYA 5IGCA 2VW9A 3F2BA 4DPGA 2HQLA 4V190 1H95A 4X6AH 1LTRD 4KTAA 4CKEA 2BE5C 3NWTA 3AMUA 2J0TD 3MFGA 5HY6A 1WI5A 1N34Q 2UU9Q 3HOYG 3RNUA 3CCVA 4JI8Q 1TWAB 3H0GG 1HR0Q 1WJJA 1D5MC 1J8IA 2XWBB 3NBIA 1MD2D 3EROA 1JC7A 1BKBA 2JN4A 1TT2A 1QUQB 1K8MA 1F2LA 3EA6A 1A2UA 1KAWA 2L5TA 4CJ0B 2UXBL 1II3A 1WTOA 2Z6BA 4GN5A 1C48A 1XTCD 3SR1A 1JJ2A 2Q2UA 1KHIA 3GV6A 3K80C 1PRTD 1V43A 1VQLA 3I70A 2JXMB 3CQZH 2L0CA 3OWEB 4JI1L 5C3WA 1ML0D 4X3UA 1CHQD 4TQUS 2RCNA 2HDLA 1IZ6A 1D1KA 1GUOA 4EQ5A 1CSQA 1Q90A 4QF4A 3MXPA 3KBXA 4A3EH 2IL8A 2B2VC 2JA6G 4CJ1B 4GOPB 1JB7A 4GLXA 2MGSA 4JG2A 4G7ZC 4TRDA 3UDGA 1XWEA 5EPKA 1I6HB 1R9TB 1GM5A 4K14A 3QOLA 2AQ1B 5I2XA 3GTMH 3QO2A 3Q8DA 2EY5A 1EEID 1Y8OB 1QG7A 2ZT9C 2K05A 1I3QH 3V96A 2F3WA 1NBWA 2FFKB 4DUZQ 1JWMD 2AHOB 4GLAC 4JK1C 4U68A 2KVMA 2A74C 2I5LX 3CCLA 4DU9A 4DAYA 1HTPA 3S2DH 3VYSA 1QVFA 3E0EA 2EQSA 2F0SA 2BH2A 1LM0A 4V0BA 2WP8J 1GHJA 4FXGC 1LTLA 1E22A 2EE1A 2NVYH 2HIXA 2IW3A 1P16A 1QVCA 2D62A 5T1GA 5E1FA 1PYSB 3BDOA 3GTOB 4OO1H 1NNXA 3ND8A 5M5YB 3BDLA 4KN7C 4AH6A 2I0QA 4ZCKA 2CKZB 2R92H 2UU9L 3I90A 1N34L 3ZYYX 3DLLA 2L4NA 3BDCA 5IGGA 2SEBD 4JI8L 4Y7NB 3FPUB 1HR0L 1STGA 3KF6B 2F0PA 3HOZH 1TVXA 1R4PB 3ULJA 4BBSH 3TN2A 2NVTB 1SLJA 3I7FA 3NP8A 2IWHA 1PZJD 2ZTEA 1I6VC 1LTID 3M7NA 1UUPA 3TQYA 2RDHA 4LF9Q 3M3YH 3GV3A 1KLGD 4BA2I 4QCLA 2MPMA 4HMIA 1I4QA 2RQXA 2B2UA 5JEAH 3S1RB 1YI2A 2CCZA 4A3DB 1STBA 2E2DC 2XIWA 4I7ZC 1H9SA 2KOLA 1B53A 3CCUA 1AFPA 3J81i 1CSPA 4IJLA 4C3IB 1Y1VB 4OX9Q 1IW7D 2C9OA 2K33A 2F4VQ 2I5HA 4A3GB 1QJOA 3S16B 3HRZC 1O7LA 3OTOL 5FK9C 3MC0B 1EY5A 2J7ZA 1LABA 5J1ZA 1GUNA 2ALYB 5M3FG 3RN5A 2FMMA 5ELBA 2MNAA 4C3JH 2K4KA 1JB3A 4KHPQ 4R8IA 3M4YA 5LHY1 4PMCA 2N3SA 4JBKA 2A6ED 3D3RA 5LL6S 5JPMC 2F52A 5HGQA 2L15A 3TZDA 5IYDG 1M90C 3OWFA 2NBFA 4KY5A 3BVGA 4KD4A 4XTCS 2Z0SA 1ASYA 3H0GH 1K83B 2KQ3A 5IOCA 1O7ZA 3BZKA 4DV7Q 1YNJC 4HSPA 4JYAQ 2OQ0A 3ND9A 2MO1A 3PIPA 1EOTA 4HJAA 2JEBI 1RJTA 1U4RA 3HP3A 3KOJA 5D14A 4DV1Q 2PYKA 1XYIA 5KIXA 1WD0A 2Z9HA 1FGUA 2LSSA 1TS2A 4ZYSA 2B2UC 1A63A 2L9HA 1CQFA 5GROA 1CKMA 1D2BA 3S2HB 3H15A 3NE5B 4FP5D 1N8RC 4A3LG 5JJZA 4MTKA 3NEMA 4TKOB 4JBJA 1X54A 3O13A 2P5ZX 1SN8A 2XN9C 3CPFA 3KK7A 1IL2A 1FJGQ 2O5JC 1IYVA 2ATWA 3RD4A 2EJFC 1BCPC 1S5FD 4A3DG 1TR5A 4DF7A 3I3CA 4LF9L 1DD2A 3NK9A 2F0VA 1B3AA 3NTIA 2F0EA 4YWMA 1V1PB 4C3IG 3ULPA 2A8VA 2L55A 5JJIA 2LXKA 2WINB 4YCVA 1TWGH 1Y1VG 4JI4Q 4A3GG 4KLKA 3M85A 3VR4A 2UXCQ 1FR3A 1YEZA 1VQ9A 3VR5A 3D6CA 1YHQA 2F4VL 4ZQ3A 1PH8A 4R4OA 3F2CA 4LFAQ 1ET6A 1Z7TA 3T56B 5G3LD 3PUXA 3J80E 2B3GA 3BJUA 1XJVA 4EQNA 3L3OC 1S5CD 5GAGC 3RZDH 4DV0Q 1H9RA 3UE1A 4KHPL 5ELDA 3AB9A 2AKWB 1JWUD 4DKAC 3B6YA 1BXTA 5E4XA 3BVZA 2B29A 4F87A 3CQZB 4QIWE 5FLXc 3H09A 1Y69U 4L63B 3L0OA 2F4IA 1ILPA 2NWGA 4R4IA 1EUJA 1D8LA 3GTLH 1RDPD 4BXXH 4A3EB 1VQIA 4XYOA 1DM0B 2BDNA 4DV7L 4XXEA 4JYAL 2TSSA 3MEFA 1E7ZA 4C56C 1JJCB 4GS3A 3BZDB 4J1MA 2VXWA 3F2DA 1Q12A 1K73C 5C0XG 4DV1L 5IGEA 2ID0A 2F0OA 2A6HC 1HZCA 3G48A 3ONAB 4IUNA 1EOVA 1V9PA 4F8MA 2GA4B 3PF5A 3F1ZA 1I3QB 2LXJA 1X56A 2A68C 1RTOA 4IALA 1FNWA 1ASZA 1ESFA 5ISRA 1Q8IA 1WCMG 4YWKA 1SYGA 1FJGL 4OGQC 1G91A 3PV0A 1PFMA 2BOSA 3S2DB 4NW2A 1F2ZA 1HCZA 1WYDA 4GNXA 3S1MH 5IWAQ 5CV5A 4ZUIA 1EL0A 4UP7A 4XDXA 4H7BA 1SE4A 3WDNA 3W5OA 1UWVA 4ALPA 1RF2D 1NMGA 2KEDA 4FF4A 2J4XA 1PDQA 5M3FH 1KRTA 1V1OA 4JI4L 3QJYA 1YNJD 4HIKA 4Q0FA 5H1SE 3DUZA 4JVZA 3PF4A 2UXCL 4KJNA 4FXDA 5J22A 4C3HH 2R92B 3MHBA 4X3SA 1X6OA 2Q2HA 3C46A 3K81C 4A93H 3T16A 3OSOA 5IIFA 2ZM6Q 1UE7A 1SYDA 2VB2X 3AEVA 3HOZB 4LFAL 1EYAA 4QIWB 5A2QL 1STEA 4FVMA 3J7A5 2IX0A 4DNIA 1SFOH 1SXTA 4J6HA 4DV0L 3NENA 4DUYQ 3M4OH 2MHVA 4Y52H 4DR6L 3H91A 1BF4A 4XT1B 4Y7NH 1O7YA 2NB0A 4LFBQ 3M3YB 2A19A 1LTBD 5KNCA 4A3EG 4DXFA 3OYYA 2EZVA 4OXPA 4KKTA 5M3MG 1NSNS 4RGMA 2PMZE 3J81c 2MQHA 1EFWA 3BZCA 4PG3A 4R1JA 2QKIC 4DK0A 1NAPA 4N8X1 2E8GA 1VQHA 4GNXC 4BWGB 3A56A 4DV4Q 4DAYB 2GVBA 2HCIA 4Z9CB 1CKNA 5CBEE 1RL2A 1W6JA 1LTGD 3FPPA 1K0RA 1M4VA 3BYTB 4LUOA 1SNDA 3QWNA 1MSHA 3JC66 4K2KA 4OWTB 1YITA 3SK5A 2WAQE 2R7ZB 4K5WA 4C3JB 2AMCB 4FXKC 4JC0A 1S4ZA 1E24A 3K5LA 3NBHA 4C3IH 4ID6A 1AP0A 2F1MA 1RTNA 1K8GA 3I4OA 4ZKBB 1ENCA 4HJ7A 3S16H 1HH2P 4EGVA 1Q82C 2EYHA 1KAAA 3GTKH 4OELB 4OO1G 5IWAL 3GTJB 4M8AA 3H0GB 1K3RA 2Y0SE 3S14H 2K14A 2ZJPA 5EKIA 2R92G 3H94A 3ICEA 4P74A 1IL8A 5FO7B 4CDDC 1SNOA 2WV6D 1PV4A 4F7XA 1X3GA 1UE6A 5C3EB 3AU7A 3JAME 5FOBB
chains in the Genus database with same CATH topology
1KDBA 5I9OA 1VMPA 4RA8A 2FINB 2EYJA 1KLUD 2K32A 2A6HD 3R2TA 3SHLA 1IHZA 1SNCA 2RKSA 2V4DA 4MIUA 2IJ0A 5KNDA 2PMZB 3NHHA 1BCPB 3TP7A 4G4KA 2FJ2A 1AW7A 4HAEA 5C3XA 4KKUA 1TWGB 2LMCB 3P75A 1J9OA 1F9SA 4F88A 1WTPA 4OIKA 2WAQB 1Y8PB 2PNRC 4C3JG 1XXGA 2Q8RE 1HA6A 2DY7A 4KI0A 1H9KA 1BQQT 1TQOA 1GUWA 5JVH3 3RZDB 4E6IA 1QOHA 1CZGA 1I4PA 1SJHD 5CORA 1A6XA 2Y0SB 3D8GA 1L0XB 5G3LF 1D1IA 2RSNA 2F0IA 4RCNA 2IT1A 1ZXTA 4ZLTF 3TZUA 5T1IA 1D6EC 2EYOA 2KJXA 2C5CA 3EJIA 4IN3A 1UNSA 1O80A 2F0KA 2CW0D 3GTLB 3HS0C 3D4WA 1I4HA 4OHJA 1D5ZC 1KDAA 1S5ED 4BS9A 1AN8A 5FLXL 2A5HA 1ET9A 3S9WA 4RCOA 2F0MA 4N9PA 1JORA 1V8QA 5JVG3 1BBXC 2AQ2B 2MP1A 3NPPA 4QUFA 2M9VA 3BG3A 3NSWA 1K8OA 1LV9A 4FNFA 4Q5VA 1B1ZA 5C4ZA 2NTTA 2KECA 1B44D 3E0JA 3S1MB 4OIJA 3IFDA 3MFYA 3MVVA 1F9PA 3SXHA 1TS4A 3K0YA 1A3UA 5M3FB 1CQVA 1G2TA 2EXZA 3W2DA 2SOBA 3DM1A 2O5IC 4C3HB 4LAAA 2F0TA 4A93B 2F0FA 4DGZA 4IUUA 5IGFA 2JEAI 1M8AA 1MSGA 2XNAC 1SEBD 1EWCA 1AZPA 1RCVD 4R9WA 1EY9A 1SFOB 5AFWA 3MWYW 5ELEA 2LS01 3M4OB 2QF7A 3S17B 5COYA 1BDOA 3MXGA 1DCZA 2CHBD 1ZYRC 1XX8A 3HG9A 4NKLA 1BCPF 5I2YA 2SNMA 4IFDI 3P7JA 1SBBB 2RDGA 5J39A 1ONLA 3MTSA 3TSSA 1OXSC 1R4QB 1KTKA 1NUCA 1KDCA 2N55A 1U4LA 2XRQD 3F2UA 3J81L 3V2TA 4RWSC 2JE6I 2BE5D 4RKBA 4HR7B 1S5BD 1YNNC 3GTKB 1GUGA 1JWSD 3BYYB 3VA5A 3S14B 4IUQA 1PZID 1LLRD 4C3HG 5A35A 5ELFA 4RGOS 2ENBA 2LFNA 4U673 3Q22A 3CKIB 3T4AC 2PZTA 3N6RA 1BO0A 4A3FB 4WRDA 3QIAA 5IODA 2HQEA 3TP5A 1MGSA 2A69C 1VF7A 2E76C 2AQ3B 4RGNA 4TSSA 3MZ5A 1FYCA 4A3BB 2DNEA 2F0WA 1JOOA 4IUTA 1KABA 2JA7B 1NCVA 5M5WB 5CYUA 2B2YA 2HDMA 3EQLC 4ZRZA 1A2TA 3SE0A 1E2VA 1HUMA 3I4NB 1EFID 1QILA 1LT5D 1GUTA 1SMYC 1OXXK 1TY2A 1LT4D 5KGUA 3HOWB 4KMUC 3MA2B 3V05A 2QDBA 1WCMB 1PTOC 4PMWA 1MI2A 4RH6A 2JSOA 1PTOH 5IT9L 3U9SA 1STYA 2EOTA 4IURA 1TS5A 4G57A 1JCKB 4EQOA 2IX1A 5E4WC 2A73B 1SNQA 1G8ZD 2K5WA 1RHPA 1JQYD 1ILQA 3T53B 1F2MA 3R3OA 3DWQA 1A3VA 2EDGA 2VNUD 1PFNA 1EYCA 3KLRA 3E6ZX 5M5XB 2F0UA 2B2YC 2PW5A 2JYOA 1GUSA 1B2TA 3L9AX 1SYCA 1RD9D 4X3KA 3PUWA 4HCEA 2NN6I 3IL8A 1DYQA 3NTKA 5M3MB 1OXUA 2K5QA 3I91A 2B8FA 1EY0A 2O4XA 2X6GA 1GJXA 2ZXOA 3DEOA 4ABNA 1CK1A 1JICA 1B9NA 1EU4A 4FYDA 3I8ZA 3SK4A 1JOQA 2F0LA 5EJWA 4P2CB 2MJ8A 2R93B 1LTSD 2F0JA 1Z47A 2ZXPA 2D2CC 1JOKA 2Z1CA 3FMCA 2X69A 2PCFB 4XT3B 3VR2A 2K04A 2DY8A 3GO5A 1HFGA 2EJGC 2PZUA 3LWUA 1EQVA 4HTHA 3OW7A 2B63B 1Q1BA 2OF1A 1A15A 2WIIB 5CV6A 3HZXA 1JE4A 3CRLC 4ZAIA 1EZ6A 1B50A 2RA4A 4OL7A 4WFN3 2EJMA 5IGBA 5JAVA 3KLSA 1WTQA 1L0YB 2KA7A 2M00A 4NP5A 4K6DA 3K5MA 4QMGA 3VYTA 1I4RA 3J7YW 2Q8TA 1EZ8A 5A2QE 3T13A 1SMYD 1BCPD 4EVOA 2K01A 3MXUA 5DAUA 5DM73 5I4DA 1PTOD 3X3NA 4C2MB 2X6LA 1ENFA 1AZQA 4CKCA 4J8QA 4JBWA 2NVQB 1B9MA 1BR9A 1DOMA 1PRTC 1H9JA 2F0QA 3HOVB 4K8JA 3I73A 3CRKC 1ZKOA 4K5VA 4DNRB 1PYWD 1VCIA 4HEDA 4MHEA 4UAIA 3H3VC 5EKKA 1SYBA 1TY0A 3IFTA 3URYA 3KBGA 2FMCA 1EEFD 1S5DD 3HEJA 2EYLA 3Q6SA 1WTVA 4RFBA 3D6WA 5CV4A 3OIPA 1CHPD 3FVQA 5CV7A 1IKMA 4WORA 1CA6A 3J7AF 1T5EA 1X3QA 3Q24A 3PUVA 4KV6A 5C44B 4IUVA 4I65A 4H0LC 1F2YA 2IX3A 4A3IB 1U4MA 2R61A 1WTXA 1H9SB 2PPBC 2E2IB 1X3PA 3QB3A 3UI2A 4DK1A 3FKIB 2PZWA 1ENAA 2A68D 1B4OA 1LT3D 4IQZA 4C1NK 4PMBA 2SNSA 3PO3B 4IFDH 4KY7A 4QUCA 1HA5A 1OXVA 3LWEA 5EBDA 4A3KB 2RDFA 1PTOB 1DZ1A 5DEHA 5D65A 5C5MA 2B2WA 4HSVA 5NUCA 3GD7A 4BY1B 5TSSA 2VUMB 5E3FA 4IFDJ 3X3MA 3NUCA 2BA1A 2Z8LA 3PO2B 5CBAE 3C1FA 1DJRD 4LK1C 2VB3X 3GTPB 1TU2B 5DNFA 1EIGA 4XQQA 4ZK9B 1C8CA 4EQPA 4LMQD 2H1EA 1FD7D 5CMDA 5EPLA 1STHA 2QEJC 3I4MB 5C0XJ 3WOEA 1IW7C 1E2WA 2CQAA 2K1BA 3DXJC 2YU9B 4HCSA 5BN5A 1H9MA 5K36H 5KEEA 5FKAC 1A3TA 4XQJA 2B8GA 2E2HB 1SJED 2A6EC 3NXWA 5BN3A 3GQBA 2CVRA 2EYFA 1SSOA 2TMPA 3A7LA 3A8JE 5M9OA 3SVMA 5FLXE 1Y8NB 1DXMA 2B2WC 2EPBA 4DAPA 4NMZA 1GOZA 4O1NA 2R3ZA 4L8JA 3FDTA 1MBYA 3OMGA 1SE3A 4R8NA 1T5XD 3ITPA 4X3TA 3G7LA 4H13C 3IKJA 3VR3A 2WKDA 2F0HA 3A7AB 3KUPA 1X32A 1SE2A 1ICWA 5C4HA 4G7HC 1VDZA 3A8IE 3PIO3 5C4JB 2F03A 4XYQA 1CZWA 1RODA 1FNVA 2I46A 3E5SA 4KN4C 4L6TB 3MXNA 3RZOB 2F0GA 3M7GA 4KY6A 4FF3A 4ILWA 3K58A 2B2TA 1Y1WB 3L7ZC 5D3DA 2PQEA 1EU3A 3R93A 3J7AV 2YYZA 2O2LD 1IKLA 3WOFA 3Q0AA 3CU7A 2D5DA 4ULLA 1LACA 1OXTA 2XWJB 1FNUA 1CA5A 3H6MA 3KF8A 4BBRB 3NQIA 4DXGA 1EY7A 2NN6H 1GXDC 3HOUB 1PTOF 1LTAD 3TP6A 1QNKA 5CV8A 4BY7B 1PXUA 3S15B 3U9OA 1VF5C 1U9RA 1PRTB 5EGTA 5C0XI 4N9TA 3J81E 3TP8A 5LL6X 2OEOA 3W3AA 2RBMA 3TBIB 1BNZA 4H44C 2N88A 3BVMA 1G6ZA 2OXPA 1F9RA 3K5OA 3RMHA 3K57A 3HGBA 5DM63 3I4LA 1HHVA 4KK7A 4AYBB 1BOSA 1D5XC 1ZEQX 2B2TC 2LY7A 3VR6A 2HUGA 4DNTB 2BCOA 1OO9B 4K8IA 4GZYC 3K59A 2QCPX 1PMRA 2NTSA 5EBCA 3A55A 1HFNA 3FEWX 5HGTA 5JEAJ 3SK8A 2RVLA 2NYZD 2AUJD 3A8KE 1WTWA 4A3JB 5D3IB 4NDXA 2AWNA 5EQ0A 2K6AA 5CR3A 5I9PA 3DHQA 1SYEA 1NR4A 5F2DA 3R2IA 1Q3LA 5JPNC 2EY1A 4RAUC 4G7OC 1W6KA 2B39A 5KYIA 5FO8B 5FO9B 1HRJA 3NQTA 1TWHB 3D31A 2AUKA 3NTHA 2E74C 2G9HD 3GTGB 2E2JB 1PLFA 3LNNA 4KHVA 1SAPA 2K5DA 3ERQA 4FF2A 2ICIA 1TWCB 1STAA 3D4DA 3K5NA 2H4OA 3P20A 5KYLA 5JOBA 4RKLA 1U4PA 4IUPA 4RHRA 1IYUA 2XVSA 5IT9E 3DMUA 2OT2A 4HN7A 5EKLA 2Z4IA 1C4QA 4S3SA 3SDZA 3J80L 2SDFA 1I4GA 1EY6A 3DEPA 3GP7A 3TDQA 1SDFA 1ZYRD 4K5XA 2XSCA 4OO1I 1CI3M 3BS1A 1EIHA 1QB5D 1I4XA 5C4XB 4CJ2C 3OOCA 4K6LA 2M2LA 5CGKA 3I72A 1PZKD 3TMEA 2F0DA 1CFMA 3R8BA 4IFDG 1HUNA 3D4RA 2DNCA 2F0NA 2Z4HA 1QE6A 1AEXA 4UDUC 1EY8A 3RLFA 2R6GA 4M1UB 1YNND 2QILA 1PRTF 2PO4A 1EWHA 1FGBD 1UAPA 4FF1A 5C5LA 1STNA 1RKNA 2K28A 3GTMB 3NWSA 4ME5A 1UEAB 5I6WA 2PW7A 4CGYB 1QCBD 2KHSA 5CV9A 3K7AB 4XQNA 2EYMA 2I07B 3EVQA 1JR0D 2E75C 1CM9A 4B9WA 3HOXB 2A69D 2KEEA 3PIP3 4O42A 1E0BA 2L1BA 5K5PA 2KCNA 2KUMA 2NVYB 2JA8B 3KLSX 3S1QB 3G6JB 3DWAA 3OHXC 1HXYD 3MEHA 5K36G 3T51B 2XRSD 4ZKCB 3HKZB 4RHSA 3SEBA 2WKCA 3A54A 1SYFA 3SK6A 3IAYA 1PFBA 1TIID 1NR2A 4PNYA 3OPOA 4BA1I 1KNEA 1Z6HA 5IGDA 4BBSB 3EFXD 1CTMA 5BN4A 4ODGA 1Q1EA 4KHZA 1E2ZA 4KJOA 4B08A 2KCCA 3PUZA 1WVLA 3OMCA 1HPCA 4YIJA 1EY4A 2MUYA 2CW0C 1LO5D 5C6AA 1HQMC 3VA7A 3VYRA 2JA5B 3FRPB 1SNMA 1LT6D 2ZXRA 2G9DA 3OIQA 2DN8A 2ICEC 4RGTA 2Q8IB 4IZ8A 3VYUA 5CC4A 1SNPA 3PUYA 2EY6A 4LJZC 3GTQB 4PQXA 4DAVA 1DONA 2BA0A 2WB1B 1WTRA 2EVBA 5EPJA 4MN3A 1TWFB 4CHTB 3CHBD 2WACA 2FHTA 2AWOA 1TKWB 4DFAA 4DN4M 4A3MB 1ESRA 3HOYB 4K2LA 3QOJA 3JAML 4KKSA 1V1PA 4HMJA 5KRUA 2EYPA 1DOKA 2BDOA 2LKVA 3DWPA 2NVXB 2F3VA 2EY2A 1F77A 2NZ1D 2NN6G 3C1EA 3K6OA 4CBVA 4XIGS 2K7VA 4ZUJA 1EYDA 2NUCA 3RUZA 2K03A 3C2PA 2L12A 3MAQA 4WJWA 3Q23A 1DOLA 3PMFA 3C3LA 1KNAA 1CT1D 1EQTA 1O78A 4CKBA 2JA6B 5JEAG 5I6YA 4KD3A 1WD1A 2L11A 4PV1C 3N52A 3P1HA 1G291 1I50B 4B9XA 1VMCA 5HURA 1G2SA 2IPKD 5C0XH 2HCCA 5KNBA 5ELCA 1BUVT 1LTTD 1GHKA 1HTLD 3S1NB 2B2VA 4FO2A 1HQRD 1QNUA 3LX0A 2RSOA 4DA2A 4C1NI 2JP1A 4QB4A 1F9QA 1TS3A 2D9UA 3QG1A 1QWYA 5IGCA 4V190 1LTRD 4KTAA 4CKEA 2BE5C 3NWTA 3AMUA 2J0TD 3MFGA 1TWAB 1D5MC 1J8IA 2XWBB 1MD2D 3NBIA 3EROA 1JC7A 1TT2A 1K8MA 1F2LA 3EA6A 1A2UA 2L5TA 4CJ0B 1II3A 1WTOA 1C48A 1XTCD 3SR1A 3GV6A 1PRTD 1V43A 3I70A 2JXMB 2L0CA 3OWEB 5C3WA 1ML0D 4X3UA 1CHQD 4TQUS 2HDLA 1D1KA 1GUOA 1Q90A 4QF4A 3MXPA 3KBXA 2IL8A 2B2VC 4CJ1B 2MGSA 4G7ZC 4TRDA 1XWEA 5EPKA 1I6HB 1R9TB 4K14A 3QOLA 2AQ1B 5I2XA 3QO2A 2EY5A 1EEID 1Y8OB 1QG7A 2ZT9C 2K05A 3V96A 2F3WA 2FFKB 1JWMD 4JK1C 4U68A 2KVMA 2A74C 4DU9A 4DAYA 1HTPA 3VYSA 2F0SA 4V0BA 2WP8J 1GHJA 4FXGC 2EE1A 2IW3A 2D62A 5T1GA 5E1FA 4OO1H 3BDOA 3GTOB 3ND8A 5M5YB 3BDLA 4KN7C 3I90A 3ZYYX 2L4NA 3BDCA 5IGGA 2SEBD 4Y7NB 3FPUB 1STGA 2F0PA 1TVXA 1R4PB 3TN2A 2NVTB 3NP8A 2IWHA 1PZJD 1I6VC 1LTID 3M7NA 1UUPA 2RDHA 3GV3A 1KLGD 4BA2I 4QCLA 2MPMA 4HMIA 1I4QA 2RQXA 2B2UA 5JEAH 3S1RB 4A3DB 1STBA 2E2DC 2XIWA 4I7ZC 1H9SA 2KOLA 1B53A 1AFPA 4C3IB 1Y1VB 1IW7D 2C9OA 2K33A 4A3GB 1QJOA 3S16B 3HRZC 1O7LA 5FK9C 3MC0B 1EY5A 2J7ZA 1LABA 5J1ZA 1GUNA 2FMMA 5ELBA 1JB3A 4R8IA 3M4YA 5LHY1 4PMCA 2A6ED 3D3RA 5LL6S 5JPMC 3TZDA 3OWFA 2NBFA 4KY5A 3BVGA 4KD4A 4XTCS 1K83B 2KQ3A 5IOCA 1O7ZA 1YNJC 4HSPA 3ND9A 1EOTA 2JEBI 1RJTA 1U4RA 3HP3A 5D14A 1WD0A 2PYKA 1XYIA 5KIXA 1TS2A 4ZYSA 2B2UC 2L9HA 1CQFA 1D2BA 3S2HB 3NE5B 4FP5D 5JJZA 4TKOB 3O13A 2XN9C 3KK7A 2O5JC 1IYVA 3RD4A 2EJFC 1BCPC 1S5FD 1TR5A 4DF7A 3I3CA 1DD2A 3NK9A 2F0VA 1B3AA 3NTIA 2F0EA 1V1PB 4C3IG 2L55A 2WINB 3M85A 3VR4A 1FR3A 3VR5A 3D6CA 4ZQ3A 1ET6A 1Z7TA 3T56B 5G3LD 3PUXA 3J80E 4EQNA 3L3OC 1S5CD 1H9RA 5ELDA 3AB9A 1JWUD 1BXTA 5E4XA 3BVZA 4F87A 3CQZB 3H09A 1Y69U 4L63B 2F4IA 1ILPA 2NWGA 1RDPD 4A3EB 4XYOA 1DM0B 2BDNA 4XXEA 2TSSA 4C56C 3BZDB 4J1MA 2VXWA 1Q12A 5C0XG 5IGEA 2ID0A 2F0OA 2A6HC 3ONAB 4IUNA 4F8MA 2GA4B 1I3QB 2A68C 1RTOA 4IALA 1FNWA 1ESFA 5ISRA 1Q8IA 1SYGA 4OGQC 1G91A 1PFMA 3PV0A 2BOSA 3S2DB 4NW2A 1F2ZA 1HCZA 5CV5A 4ZUIA 1EL0A 4XDXA 4H7BA 1SE4A 3WDNA 1RF2D 4FF4A 2KEDA 2J4XA 1PDQA 1V1OA 3QJYA 1YNJD 4Q0FA 3DUZA 4KJNA 4FXDA 5J22A 2R92B 3MHBA 4X3SA 3C46A 3T16A 5IIFA 3OSOA 1SYDA 2VB2X 3HOZB 1EYAA 4QIWB 5A2QL 1STEA 4FVMA 2IX0A 1SXTA 4J6HA 2MHVA 3H91A 1BF4A 4XT1B 3M3YB 1O7YA 2NB0A 1LTBD 5KNCA 4DXFA 2EZVA 4KKTA 1NSNS 4RGMA 2QKIC 4DK0A 1NAPA 4BWGB 3A56A 2HCIA 4Z9CB 5CBEE 1W6JA 1LTGD 3FPPA 1M4VA 3BYTB 1SNDA 3QWNA 1MSHA 4K2KA 3SK5A 2R7ZB 4K5WA 4C3JB 4FXKC 1S4ZA 3K5LA 3NBHA 1AP0A 4ID6A 2F1MA 1RTNA 4ZKBB 1ENCA 4EGVA 2EYHA 1KAAA 4OO1G 3GTJB 4M8AA 3H0GB 5EKIA 3H94A 1IL8A 5FO7B 1SNOA 2WV6D 4F7XA 5C3EB 3AU7A 3JAME 5FOBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKD A;  2WKC A; 
#chains in the Genus database with same CATH topology
 1KDB A;  3HOZ G;  3TRZ A;  5I9O A;  1YZ6 A;  5IP7 H;  1VMP A;  5GAD C;  1IBL Q;  2XGT A;  4RA8 A;  2FIN B;  2EYJ A;  1YNX A;  1KLU D;  5BR8 Q;  2K32 A;  2A6H D;  1KXL A;  3R2T A;  4GKJ Q;  5GAH C;  2OTJ A;  4UP8 A;  3SHL A;  1IHZ A;  3T1Y Q;  3KYH C;  1SNC A;  2RKS A;  1XPU A;  1AE2 A;  2V4D A;  4MIU A;  4DR3 Q;  2QA4 A;  4A3B H;  2IJ0 A;  2VS1 A;  5KND A;  1AE3 A;  4H02 A;  2JA7 H;  2PMZ B;  2JK8 A;  4DUY L;  2CQO A;  1NTG A;  1XTD A;  5M5W H;  4DR2 Q;  3NHH A;  1BCP B;  3TP7 A;  4G4K A;  2FJ2 A;  4LFB L;  1AW7 A;  4B3S L;  2JQO A;  4HAE A;  1NJI C;  5C3X A;  3FHW A;  4KKU A;  4DV5 Q;  2RCF A;  1TWG B;  2LMC B;  3P75 A;  1J9O A;  5IT9 c;  2HHH Q;  3I4N H;  1F9S A;  4F88 A;  1KIX A;  1WTP A;  4OIK A;  2WAQ B;  1MJC A;  4DR4 Q;  1Y8P B;  1XMQ L;  4RG1 A;  3HOW H;  2R7Z G;  3KJO A;  4POF A;  2PNR C;  4C3J G;  3M9B A;  4DV4 L;  1WCM H;  4EX5 A;  1XXG A;  2Q8R E;  4GN3 B;  1HA6 A;  4R4Q A;  2R7F A;  4MTN A;  1EIF A;  2DY7 A;  4KI0 A;  1H9K A;  1BQQ T;  1M1K C;  3CC4 A;  1TQO A;  1Q86 C;  1GUW A;  4IPH A;  5JVH 3;  3RZD B;  4E6I A;  3G71 A;  1I4P A;  1CZG A;  1QOH A;  1SJH D;  5COR A;  1A6X A;  4NXN L;  2Y0S B;  2PQA A;  3D8G A;  2Q2I A;  3SGI A;  1L0X B;  5G3L F;  1D1I A;  2RSN A;  2F0I A;  4RCN A;  2IT1 A;  1ZXT A;  4ZLT F;  3TZU A;  5T1I A;  1D6E C;  2DGY A;  2EYO A;  2KJX A;  2C5C A;  3EJI A;  4IN3 A;  1UNS A;  5C3E G;  1O80 A;  1K9M C;  2F0K A;  2CW0 D;  4B3T Q;  3HS0 C;  3D4W A;  3GTL B;  1I4H A;  1HJP A;  3A0J A;  4OHJ A;  1D5Z C;  1KQS A;  1KDA A;  1S5E D;  5IYB G;  3S24 A;  4BS9 A;  5M5X H;  5IYC G;  4X66 Q;  3OW2 A;  5J3B A;  1AN8 A;  5FLX L;  2A5H A;  1ET9 A;  3S9W A;  4RCO A;  2F0M A;  4JW0 A;  4N9P A;  1JOR A;  2YTX A;  1QZG A;  1IBL L;  1V8Q A;  5JVG 3;  2GVA A;  4HJ5 A;  1BBX C;  2AQ2 B;  5BR8 L;  1GO3 E;  2MP1 A;  3NPP A;  4QUF A;  2M9V A;  4GKJ L;  1QVG A;  3CC7 A;  5M3M H;  3BG3 A;  3NSW A;  1K8O A;  3T1Y L;  3PO3 G;  1LV9 A;  4FNF A;  4Q5V A;  1B1Z A;  5C4Z A;  4DR3 L;  1PVO A;  2NTT A;  2KEC A;  4GN4 B;  1B44 D;  3I2Z A;  3E0J A;  3K8A A;  4MZ9 A;  3S1M B;  4OIJ A;  3F8T A;  3IFD A;  4DR2 L;  1VQJ A;  4YY3 Q;  3ERS X;  3CME A;  3MFY A;  2E5L Q;  3MVV A;  2WAQ G;  1F9P A;  3SXH A;  1TS4 A;  3IRB A;  1IBM Q;  3K0Y A;  1YJ9 A;  1A3U A;  1PH3 A;  4DV5 L;  5M3F B;  1CQV A;  1G2T A;  2EXZ A;  2R93 H;  2FXQ A;  2HHH L;  3W2D A;  2SOB A;  3DM1 A;  2O5I C;  4C3H B;  1IBK L;  3H3V I;  4LAA A;  2F0T A;  4A93 B;  5GAE C;  2F0F A;  4DGZ A;  4IUU A;  5IGF A;  2JEA I;  1M8A A;  1MSG A;  2D0P A;  2Y0S G;  4JI3 Q;  2XNA C;  1SEB D;  2KCM A;  3D0F A;  1SE8 A;  1EWC A;  1AZP A;  1RCV D;  4R9W A;  1EY9 A;  3BU2 A;  1SFO B;  3CW2 C;  5AFW A;  4B3R Q;  2B63 H;  3MWY W;  3W1G A;  5ELE A;  2LS0 1;  3M4O B;  2QF7 A;  1VQP A;  3HKS A;  1JT8 A;  4POG A;  4BXX G;  5JJL A;  3U4Z A;  3S17 B;  3UDF A;  2OTL A;  1WTH A;  5COY A;  1BDO A;  3MXG A;  5E7N A;  1DCZ A;  1XNQ Q;  3WWV A;  2CHB D;  1FVI A;  1UE1 A;  1ZYR C;  1XX8 A;  3HG9 A;  2K5N A;  1BCP F;  4NKL A;  2SNM A;  5I2Y A;  4JBM A;  4IFD I;  3P7J A;  1SBB B;  2RDG A;  5J39 A;  1YJN A;  1ONL A;  3MTS A;  3TSS A;  1OXS C;  4X66 L;  4GNX B;  1R4Q B;  1KTK A;  1NUC A;  1KDC A;  2N55 A;  5AJ3 Q;  1U4L A;  2XRQ D;  4DR1 Q;  1B70 B;  3F2U A;  3J81 L;  3V2T A;  4RWS C;  2JE6 I;  4C2M H;  2BE5 D;  3KLW A;  4RKB A;  4GKK Q;  4WJ3 M;  2ZJQ A;  1B8A A;  4HR7 B;  2NVQ H;  1S5B D;  1YNN C;  2Q2T A;  3GTK B;  4OWW B;  1GUG A;  2N78 A;  1JWS D;  3BYY B;  2R7Z H;  3VA5 A;  4YY3 L;  3GDE A;  1EQQ A;  3S14 B;  4IUQ A;  1PZI D;  1LLR D;  2CH4 W;  4C3H G;  5A35 A;  5ELF A;  4RGO S;  4DUZ L;  1HNW Q;  2ENB A;  1XPO A;  1IBM L;  2LFN A;  4U67 3;  3Q22 A;  4A93 G;  1X9N A;  3CKI B;  4P75 A;  2VQE Q;  4JI6 Q;  3T4A C;  1MKH A;  2PZT A;  3N6R A;  1BO0 A;  4PZ7 A;  4A3F B;  4WRD A;  3QIA A;  5IOD A;  2HQE A;  3GTJ H;  5JJK A;  3TP5 A;  1MGS A;  4QY7 A;  2A69 C;  1VF7 A;  2E76 C;  1SMX A;  1SRO A;  2AQ3 B;  4RGN A;  4TSS A;  4JI3 L;  3LGJ A;  2ZTC A;  3MZ5 A;  5C3E H;  1FYC A;  4A3B B;  2DNE A;  2F0W A;  1JOO A;  4IUT A;  4B3R L;  2ZJR A;  1KAB A;  2JA7 B;  1NCV A;  4HID A;  4LF7 Q;  5LMN W;  5M5W B;  5IYB H;  2EIF A;  5C44 H;  5CYU A;  2B2Y A;  1X3F A;  5IYC H;  4GLV B;  1YIJ A;  4DR7 Q;  2HDM A;  4LF8 Q;  4A3I H;  3EQL C;  4ZRZ A;  1A2T A;  4A75 A;  3SE0 A;  3KJP A;  1E2V A;  1HUM A;  2E2I H;  4YCW A;  2JA9 A;  1XNQ L;  3I4N B;  3FKI H;  1EFI D;  1QIL A;  3NBH B;  1LT5 D;  1GUT A;  1SMY C;  1OXX K;  1TY2 A;  1LT4 D;  5KGU A;  4BY7 G;  3HOW B;  4KMU C;  3PO3 H;  3MA2 B;  3V05 A;  2QDB A;  3EBE A;  1WCM B;  4HIM A;  4LF6 Q;  4A3K H;  1PTO C;  4PMW A;  3CCJ A;  1MI2 A;  4N8F A;  2UUC Q;  5AJ3 L;  4RH6 A;  2JSO A;  1PTO H;  4DR1 L;  2KBN A;  5IT9 L;  4LW1 A;  4A3C G;  3U9S A;  1STY A;  2EOT A;  1LYL A;  4IUR A;  1TS5 A;  4G57 A;  1JCK B;  4BY1 H;  4EQO A;  4GKK L;  1N33 Q;  2IX1 A;  5E4W C;  4OX9 L;  2A73 B;  1SNQ A;  1G8Z D;  1S3O A;  2K5W A;  1MIU A;  1RHP A;  2PNH A;  1JQY D;  1ILQ A;  3T53 B;  3RLO A;  3PO2 H;  1F2M A;  3R3O A;  4JI7 Q;  3DWQ A;  5IP7 G;  1A3V A;  2EDG A;  4A3F G;  2VNU D;  1PFN A;  1EYC A;  3KLR A;  3E6Z X;  1HNW L;  1HZB A;  3GTP H;  5M5X B;  2F0U A;  2B2Y C;  2PW5 A;  2JYO A;  2ES2 A;  1GUS A;  2VQE L;  4UY8 C;  1B2T A;  3I4M H;  3L9A X;  2EXD A;  1BVS A;  3HFZ B;  1SYC A;  1J5E Q;  4A3B G;  1RD9 D;  4X3K A;  1N36 Q;  3PUW A;  1YHB A;  1KC8 C;  4HCE A;  2NN6 I;  3IL8 A;  2JA7 G;  1DYQ A;  1HZ9 A;  3NTK A;  2YTY A;  5M3M B;  2YU9 H;  1OXU A;  4FDB A;  3I91 A;  2K5Q A;  2B8F A;  1EY0 A;  2O4X A;  2X6G A;  1GJX A;  2CH4 A;  2ZXO A;  3DEO A;  2E2H H;  4LF7 L;  4ABN A;  1CK1 A;  4LUZ A;  1JIC A;  4L5R C;  3I4N G;  1B9N A;  1EU4 A;  4FYD A;  3I8Z A;  4DR7 L;  2OQK A;  4LF8 L;  1VQG A;  3SK4 A;  1JOQ A;  2F0L A;  5EJW A;  4P2C B;  3HOW G;  2MJ8 A;  4R4C A;  2XTI A;  3PGZ A;  1PA6 A;  2HD3 A;  2R93 B;  1LTS D;  2KCT A;  2PQA B;  1NE3 A;  5IE8 A;  1C9O A;  3G4S A;  4AQY Q;  1PH2 A;  3CPW A;  2F0J A;  1Z47 A;  2ZXP A;  2D2C C;  1JOK A;  2Z1C A;  3FMC A;  2X69 A;  2F3I A;  1YHA A;  2PCF B;  2OWO A;  4XT3 B;  1CKO A;  2GN5 A;  3VR2 A;  4LF6 L;  2CWP A;  1IXR A;  2K04 A;  2PI2 A;  2DY8 A;  4O0A A;  3GO5 A;  3G6E A;  1HFG A;  2EJG C;  4LFC Q;  4L5S A;  2PZU A;  3LWU A;  1EQV A;  4HTH A;  3OW7 A;  2B63 B;  4IPC A;  1Q1B A;  4UP9 A;  4NXM Q;  2OF1 A;  1A15 A;  3EIV A;  2WII B;  5CV6 A;  3HZX A;  3PQI A;  1JE4 A;  3CRL C;  1U5K A;  4ZAI A;  1GD7 A;  5C4J H;  1EZ6 A;  1B50 A;  2RA4 A;  4JI2 Q;  4OL7 A;  4WFN 3;  2EJM A;  5IGB A;  5JAV A;  3KLS A;  2IHE A;  1WTQ A;  1L0Y B;  2KA7 A;  1K28 A;  2M00 A;  4NP5 A;  3RZO H;  4K6D A;  3K5M A;  4QMG A;  4CDC C;  3VYT A;  4X65 Q;  1I4R A;  3J7Y W;  3M4Q A;  4JI7 L;  2Q8T A;  3CCS A;  1Y1W H;  5LMU Q;  1EZ8 A;  2BH8 A;  5A2Q E;  3T13 A;  3S17 H;  1SMY D;  1BCP D;  4EVO A;  2K01 A;  3AFQ A;  3E3X A;  4P73 A;  3MXU A;  4LUV A;  1Q8K A;  5DAU A;  5ELN A;  2UUA Q;  5DM7 3;  5I4D A;  1PTO D;  2RF4 A;  1J5E L;  3X3N A;  4C2M B;  2X6L A;  1ENF A;  1AZQ A;  4CKC A;  1EIY B;  4P71 A;  2HIV A;  3HOU H;  4J8Q A;  4JBW A;  4DR5 Q;  2K5H A;  2NVQ B;  4BY7 H;  5IY0 A;  1B9M A;  3S15 H;  1BR9 A;  1DOM A;  1YBY A;  1PRT C;  2R93 G;  1H9J A;  2F0Q A;  3HOV B;  4K8J A;  3I73 A;  4TVA B;  3CRK C;  1ZKO A;  4J15 A;  4K5V A;  4DNR B;  2WFW A;  3A74 A;  4YHH Q;  1PYW D;  4A3C H;  1VCI A;  4HED A;  4MHE A;  1PH5 A;  4UAI A;  4AQY L;  3H3V C;  5EKK A;  1SYB A;  1TY0 A;  3IFT A;  3URY A;  4AIM A;  3KBG A;  1UEB A;  2FMC A;  1EEF D;  4PZ8 A;  1S5D D;  2K5V A;  2EYL A;  3HEJ A;  3Q6S A;  4QQB X;  1G51 A;  2B63 G;  1WTV A;  4K0K Q;  2QGQ A;  3STB C;  4JCV E;  1HZA A;  4RFB A;  4CDF C;  3D6W A;  1I94 Q;  5CV4 A;  5EAY A;  3OIP A;  1CHP D;  3FVQ A;  4I7A A;  5CV7 A;  1IKM A;  4LFC L;  4WOR A;  1CA6 A;  2JA8 G;  3J7A F;  5FLM G;  1T5E A;  1X3Q A;  3Q24 A;  4A3F H;  3PUV A;  4KV6 A;  1HNX Q;  4JOI A;  5C44 B;  4LWC A;  2UXB Q;  4IUV A;  3JAM i;  4I65 A;  4H0L C;  1F2Y A;  2IX3 A;  4A3I B;  1U4M A;  2ZM6 L;  2R61 A;  5LMN Q;  1WTX A;  1H9S B;  4A3J H;  3CMA A;  1VQC A;  3W1B A;  2PPB C;  2E2I B;  1X3P A;  3QB3 A;  3UI2 A;  4DK1 A;  3FKI B;  2PZW A;  1ENA A;  2A68 D;  1B4O A;  4APV A;  1LT3 D;  4IQZ A;  4C1N K;  4X65 L;  4PMB A;  2SNS A;  3PO3 B;  4IFD H;  4KY7 A;  4QUC A;  5LMU L;  1HA5 A;  1OXV A;  3LWE A;  2NZH A;  5EBD A;  4A3K B;  2JJQ A;  3QR8 A;  2RDF A;  1PTO B;  4HJ9 A;  1DZ1 A;  3U58 A;  2UUA L;  4O2D A;  5DEH A;  1HNZ Q;  5D65 A;  5C5M A;  3I55 A;  2B2W A;  4HSV A;  1TWH H;  5NUC A;  3GD7 A;  4BY1 B;  5TSS A;  2HT1 A;  3GTG H;  1K0S A;  3HOV G;  2E2J H;  2VUM B;  4DR5 L;  5E3F A;  1C7Y A;  1W3S A;  4IFD J;  3X3M A;  1TWC H;  2Z6K A;  3NUC A;  3J81 j;  1S40 A;  2BA1 A;  2Z8L A;  3PO2 B;  5CBA E;  1EYG A;  3C1F A;  1JJG A;  1DJR D;  1Q7Y C;  4LK1 C;  2VB3 X;  4DV2 Q;  1C0A A;  2WB1 G;  3J80 c;  1S72 A;  3GTP B;  3CAM A;  1TU2 B;  4JOI C;  5DNF A;  4YHH L;  1VQ6 A;  2DUD A;  1EIG A;  4XQQ A;  2IHF A;  2K50 A;  4ZK9 B;  1C8C A;  4EQP A;  4LMQ D;  1JMC A;  2H1E A;  1FD7 D;  5CMD A;  2H5X A;  5EPL A;  1STH A;  2QEJ C;  1OTC A;  3I4M B;  4IPD A;  1VQF A;  5C0X J;  5FJ8 H;  3WOE A;  1IW7 C;  1E2W A;  2CQA A;  4A3M G;  4NPS A;  4K0K L;  1Q81 C;  2K1B A;  3DXJ C;  2YU9 B;  4HCS A;  5C44 G;  5BN5 A;  1H9M A;  1I94 L;  2G5D A;  5K36 H;  5KEE A;  4A3I G;  5FKA C;  1A3T A;  4XQJ A;  2B8G A;  2E2H B;  1SJE D;  5C4X H;  2A6E C;  3NXW A;  1HNX L;  5BN3 A;  3GQB A;  2CVR A;  3FKI G;  2EYF A;  1SSO A;  2TMP A;  3A7L A;  3A8J E;  5M9O A;  3SVM A;  5FLX E;  4OWX B;  4JI5 Q;  1Y8N B;  1DXM A;  2B2W C;  1VQN A;  2EPB A;  4DAP A;  5LMN L;  4NMZ A;  1GOZ A;  4O1N A;  2R3Z A;  4L8J A;  3FDT A;  1MBY A;  3OMG A;  4A3K G;  1SE3 A;  4R8N A;  4IJH A;  1L2F A;  1T5X D;  2PI2 E;  3ITP A;  4X3T A;  3G7L A;  2ASB A;  4H13 C;  2Z6K C;  3IKJ A;  3KFU A;  3J7Z C;  3VR3 A;  3M4P A;  2QEX A;  1P8L A;  4BY1 G;  3A5Z B;  3PSI A;  2WKD A;  2F0H A;  3TRE A;  1YJW A;  3A7A B;  4NB3 A;  3OTO Q;  3KUP A;  3STB D;  1X32 A;  1HNZ L;  2VUM G;  1SE2 A;  3VDY A;  1ICW A;  4X62 Q;  1BBW A;  4DR4 L;  3K7A H;  3K0X A;  5C4H A;  4G7H C;  1VDZ A;  1XNR Q;  1L1O A;  4A4I A;  3A8I E;  3PIO 3;  3PO2 G;  5C4J B;  2F03 A;  4XYQ A;  1CZW A;  4AYB E;  1Y14 B;  1ROD A;  1FNV A;  2I46 A;  1E1O A;  4DV6 Q;  3HOX H;  3E5S A;  4JV5 Q;  2DJG C;  4KN4 C;  5IP9 H;  1PH7 A;  2D0O A;  3CP0 A;  3U4V A;  3ZJY C;  4L6T B;  1VQ5 A;  3MXN A;  3RZO B;  2F0G A;  3M7G A;  4KY6 A;  4FF3 A;  4ILW A;  1AH9 A;  1A0I A;  3FP9 A;  3K58 A;  4DV2 L;  3I4M G;  2B2T A;  1Y1W B;  4IOA A;  3L7Z C;  5D3D A;  2UUB Q;  2PQE A;  1EU3 A;  3R93 A;  3J7A V;  2JA8 H;  2YYZ A;  2O2L D;  1IKL A;  5FLM H;  3WOF A;  3S1Q H;  3Q0A A;  1D7Q A;  3CU7 A;  2D5D A;  4P72 A;  4ULL A;  4DK3 C;  1K3B C;  1U0L A;  1LAC A;  1OXT A;  2K52 A;  2XWJ B;  1FNU A;  4B3T L;  1CA5 A;  3H6M A;  3CXC A;  3KF8 A;  1L0W A;  4BBR B;  2KHJ A;  3NQI A;  4DXG A;  3ER0 A;  1EY7 A;  2NN6 H;  1GXD C;  1X55 A;  3HOU B;  1PH4 A;  1PTO F;  1LTA D;  3TP6 A;  2MFI A;  4LF5 Q;  1QNK A;  5CV8 A;  4BY7 B;  1PXU A;  4UHV A;  3S15 B;  1E3P A;  4RMF A;  3AQQ A;  3U9O A;  3TS2 A;  1VF5 C;  1U9R A;  4IPG A;  4LNQ A;  1PRT B;  4JI5 L;  3ULL A;  5EGT A;  5C0X I;  4N9T A;  1FL0 A;  3J81 E;  1L1O C;  3TP8 A;  5LL6 X;  2OEO A;  1EQR A;  3W3A A;  2RBM A;  2VZA A;  3CCR A;  3TBI B;  3T1H Q;  1BNZ A;  4H44 C;  2N88 A;  3BVM A;  4JI0 Q;  1G6Z A;  2OXP A;  1F9R A;  1YVC A;  2JA5 H;  3K7U C;  2R7D A;  3HOV H;  3K5O A;  3RMH A;  3K57 A;  2E5L L;  2C35 B;  2KEN A;  2QDL A;  3HGB A;  5DM6 3;  3I4L A;  1VQ8 A;  1ICF B;  2VY3 A;  4KK7 A;  1HHV A;  1XPR A;  4AYB B;  1BOS A;  1D5X C;  1ZEQ X;  2B2T C;  2LY7 A;  1VQ7 A;  1WOC A;  3VR6 A;  1IYJ B;  2DJF C;  2HUG A;  4DNT B;  2BCO A;  1OO9 B;  1KL9 A;  4K8I A;  3GTQ H;  4R4T A;  4GZY C;  3K59 A;  1N32 Q;  4X62 L;  2QCP X;  1PMR A;  2VQF Q;  2NTS A;  2RHQ B;  5EBC A;  3JAM c;  3A55 A;  1HFN A;  1XNR L;  3FEW X;  5HGT A;  5JEA J;  3SK8 A;  3E9H A;  2RVL A;  1TWF H;  2NYZ D;  2AUJ D;  3KDF A;  3A8K E;  4YCU A;  1WTW A;  4DV6 L;  4A3J B;  1Y1W G;  5D3I B;  4JV5 L;  4NDX A;  2AWN A;  5EQ0 A;  4DK6 C;  2K6A A;  5CR3 A;  1V1Q A;  3DHQ A;  5I9P A;  1SYE A;  1NR4 A;  5F2D A;  4A3M H;  3CCM A;  3HOY H;  3R2I A;  1CKN B;  1K8A C;  1Q3L A;  5JPN C;  2UUB L;  4QJF A;  1CUK A;  2EY1 A;  1VQB A;  1VQK A;  4RAU C;  2NVX H;  4G7O C;  1PHJ A;  1W6K A;  4BBR G;  2B39 A;  5KYI A;  5FO8 B;  4DV3 Q;  3HOU G;  5FO9 B;  2NZO A;  1HRJ A;  3NQT A;  1TWH B;  3D31 A;  2AUK A;  4HJ8 A;  3NTH A;  2E74 C;  1QUQ A;  3TS0 A;  2G9H D;  3GTG B;  2E2J B;  1PLF A;  1G6P A;  3LNN A;  4KHV A;  1SAP A;  1XMO Q;  2CWA A;  2K5D A;  3ERQ A;  4FF2 A;  2ICI A;  1TWC B;  4LF5 L;  1STA A;  3D4D A;  1J6Q A;  3K5N A;  3RR5 A;  2JA6 H;  3E9I A;  2H4O A;  3P20 A;  5KYL A;  3TEH B;  5JOB A;  4RKL A;  1U4P A;  4IUP A;  4RHR A;  1IYU A;  2XVS A;  1I50 H;  5IT9 E;  3DMU A;  3CF5 A;  2UXD Q;  2VUM H;  1GVP A;  2OT2 A;  4HN7 A;  4GOP A;  1T9H A;  4AYB G;  3S1N H;  3CD6 A;  3T1H L;  4JI0 L;  5EKL A;  1VS0 A;  2Z4I A;  1C4Q A;  1I5F A;  4S3S A;  3SDZ A;  1Z9F A;  3J80 L;  2SDF A;  2VL6 A;  1I4G A;  5L37 A;  1EY6 A;  3J80 i;  1N9W A;  3DEP A;  3GP7 A;  3TDQ A;  1SDF A;  1ZYR D;  4K5X A;  2XSC A;  4JI6 L;  4OO1 I;  1CI3 M;  3BS1 A;  1EIH A;  1QB5 D;  1I4X A;  4A3J G;  1N32 L;  5C4X B;  4CJ2 C;  3HKZ E;  1HR0 W;  1BBU A;  3OOC A;  2VQF L;  4K6L A;  4OON A;  1B3Q A;  2M2L A;  5CGK A;  3I72 A;  1PZK D;  1MHW C;  4DR6 Q;  3TME A;  2F0D A;  1TWA H;  1CFM A;  3R8B A;  4UPA A;  4IFD G;  1HUN A;  3D4R A;  2DNC A;  2F0N A;  2Z4H A;  4JPB W;  1QE6 A;  1AEX A;  4UDU C;  1EY8 A;  4OEM B;  4B3M Q;  2K75 A;  2IY5 B;  3RLF A;  1RIP A;  2R6G A;  1X65 A;  4M1U B;  1YNN D;  2QIL A;  1PRT F;  1JE5 A;  5ELO A;  2CFM A;  2PO4 A;  3CCQ A;  1EWH A;  1WFQ A;  1FGB D;  4IO9 A;  1UAP A;  3L2P A;  4FF1 A;  5C5L A;  1STN A;  1QZH A;  1RKN A;  4DV3 L;  2K28 A;  3GTM B;  3NWS A;  4ME5 A;  3CCE A;  1UEA B;  1VQA A;  3KF6 A;  5I6W A;  2PW7 A;  4CGY B;  1QCB D;  2KHS A;  5CV9 A;  3K7A B;  4XQN A;  4GOP C;  2EYM A;  2I07 B;  3UE0 A;  3EVQ A;  1VQ4 A;  1JR0 D;  4WJ4 A;  1SR3 A;  2E75 C;  3EN2 A;  1CM9 A;  1XMO L;  2UUC L;  4B9W A;  3HOX B;  2A69 D;  2KEE A;  3DM3 A;  1MJE A;  4L5T A;  1I6H H;  3PIP 3;  1R9T H;  4O42 A;  1E0B A;  2WB1 E;  3A5U A;  2L1B A;  1LUZ A;  5K5P A;  1B7Y B;  5GQO A;  2N8N A;  2KCN A;  3NEL A;  1N33 L;  5FJ8 G;  2KUM A;  4MNO A;  2NVY B;  2JA8 B;  2UXD L;  3KLS X;  3S1Q B;  3G6J B;  3DWA A;  3OHX C;  1HXY D;  1O7I A;  3MEH A;  5K36 G;  3T51 B;  2XRS D;  4ZKC B;  1DGS A;  3HKZ B;  4RHS A;  1PYB A;  2QW7 A;  3SEB A;  4LF4 Q;  4X64 Q;  2WKC A;  3A54 A;  5C4X G;  1SYF A;  3SK6 A;  3IAY A;  1PFB A;  4CDE C;  1TII D;  1NR2 A;  1A8V A;  4PNY A;  4PZ6 A;  5IYD H;  3OPO A;  4BA1 I;  2RHS B;  1KNE A;  1Z6H A;  1SRU A;  5IGD A;  4BBS B;  3GTO H;  3EFX D;  1CTM A;  5M5Y H;  5BN4 A;  3AYH B;  4ODG A;  2A1A A;  1E1T A;  1Q1E A;  1N36 L;  2I5M X;  4KHZ A;  1E2Z A;  4KJO A;  4BBR H;  1VQE A;  4B08 A;  2KCC A;  3PUZ A;  1WVL A;  3OMC A;  4B3S Q;  1HPC A;  1TXY A;  2KHI A;  1UE5 A;  4YIJ A;  1EY4 A;  2MUY A;  2CW0 C;  1A62 A;  1LO5 D;  5C6A A;  1L1O B;  1HQM C;  1VQO A;  4B3M L;  3VA7 A;  3VYR A;  1KRS A;  2NVT H;  1EWI A;  1NY4 A;  4A3L H;  3RLN A;  3FRP B;  4QL5 A;  2JA5 B;  4L5Q A;  1XMQ Q;  1SNM A;  1LT6 D;  2ZXR A;  2G9D A;  3MXN B;  3OIQ A;  2YV5 A;  2DN8 A;  2ICE C;  4RGT A;  2Q8I B;  4IZ8 A;  3VYU A;  2OCE A;  5CC4 A;  1SNP A;  3I56 A;  3PUY A;  2EY6 A;  4LJZ C;  4YWL A;  3GTQ B;  4PQX A;  3S1R H;  4DAV A;  4A3D H;  1DON A;  2BA0 A;  2WB1 B;  3PCO B;  1WTR A;  3HOX G;  1X3E A;  5IP9 G;  2EVB A;  5DLQ E;  5EPJ A;  4IOC A;  4MN3 A;  3H3V H;  3UDX A;  1TWF B;  4NXN Q;  4CHT B;  3CHB D;  2WAC A;  1PH6 A;  1Y1V H;  4ME3 A;  3U50 C;  2FHT A;  4A3G H;  2AWO A;  1VQM A;  1TKW B;  3KF8 B;  4DFA A;  4DN4 M;  1Q46 A;  4A3M B;  4QGU A;  1ESR A;  3HOY B;  4K2L A;  4NXM L;  3QOJ A;  1VQD A;  3JAM L;  4KKS A;  1V1P A;  1NMF A;  4HMJ A;  5KRU A;  2EYP A;  1DOK A;  2BDO A;  2LKV A;  3HKZ G;  2N49 A;  3AFP A;  3DWP A;  2F3V A;  2NVX B;  2EY2 A;  2MO0 A;  4JI2 L;  2YTV A;  1F77 A;  2NZ1 D;  2NN6 G;  3C1E A;  3K6O A;  4CBV A;  4XIG S;  2ZTD A;  1KD1 C;  2K7V A;  4JI1 Q;  4ZUJ A;  1EYD A;  2NUC A;  3RUZ A;  2K03 A;  3C2P A;  2L12 A;  4LF4 L;  4X64 L;  3MAQ A;  3PIO A;  3RN2 A;  4BBS G;  1K83 H;  4WJW A;  3Q23 A;  1DOL A;  1W2B A;  1PH1 A;  1GKH A;  3PMF A;  2V1C C;  3C3L A;  1KNA A;  1CT1 D;  1EQT A;  1O78 A;  4CKB A;  2JA6 B;  3CC2 A;  5JEA G;  5I6Y A;  4KD3 A;  3UDI A;  1WD1 A;  2L11 A;  4HIO A;  4PV1 C;  3N52 A;  3P1H A;  1PH9 A;  3S2H H;  1G29 1;  1I50 B;  4B9X A;  2JA5 G;  4DAM A;  1VMC A;  5HUR A;  1G2S A;  2IPK D;  5C0X H;  2HCC A;  5KNB A;  1PFS A;  5ELC A;  1BUV T;  1LTT D;  1GHK A;  1HTL D;  3S1N B;  4A76 A;  2B2V A;  4FO2 A;  1HQR D;  3KDF B;  1QNU A;  3LX0 A;  2RSO A;  1IBK Q;  4DA2 A;  4C1N I;  2JP1 A;  4QB4 A;  1F9Q A;  1TS3 A;  2D9U A;  3QG1 A;  1QWY A;  5IGC A;  2VW9 A;  3F2B A;  4DPG A;  2HQL A;  4V19 0;  1H95 A;  4X6A H;  1LTR D;  4KTA A;  4CKE A;  2BE5 C;  3NWT A;  3AMU A;  2J0T D;  3MFG A;  5HY6 A;  1WI5 A;  1N34 Q;  2UU9 Q;  3HOY G;  3RNU A;  3CCV A;  4JI8 Q;  1TWA B;  3H0G G;  1HR0 Q;  1WJJ A;  1D5M C;  1J8I A;  2XWB B;  3NBI A;  1MD2 D;  3ERO A;  1JC7 A;  1BKB A;  2JN4 A;  1TT2 A;  1QUQ B;  1K8M A;  1F2L A;  3EA6 A;  1A2U A;  1KAW A;  2L5T A;  4CJ0 B;  2UXB L;  1II3 A;  1WTO A;  2Z6B A;  4GN5 A;  1C48 A;  1XTC D;  3SR1 A;  1JJ2 A;  2Q2U A;  1KHI A;  3GV6 A;  3K80 C;  1PRT D;  1V43 A;  1VQL A;  3I70 A;  2JXM B;  3CQZ H;  2L0C A;  3OWE B;  4JI1 L;  5C3W A;  1ML0 D;  4X3U A;  1CHQ D;  4TQU S;  2RCN A;  2HDL A;  1IZ6 A;  1D1K A;  1GUO A;  4EQ5 A;  1CSQ A;  1Q90 A;  4QF4 A;  3MXP A;  3KBX A;  4A3E H;  2IL8 A;  2B2V C;  2JA6 G;  4CJ1 B;  4GOP B;  1JB7 A;  4GLX A;  2MGS A;  4JG2 A;  4G7Z C;  4TRD A;  3UDG A;  1XWE A;  5EPK A;  1I6H B;  1R9T B;  1GM5 A;  4K14 A;  3QOL A;  2AQ1 B;  5I2X A;  3GTM H;  3QO2 A;  3Q8D A;  2EY5 A;  1EEI D;  1Y8O B;  1QG7 A;  2ZT9 C;  2K05 A;  1I3Q H;  3V96 A;  2F3W A;  1NBW A;  2FFK B;  4DUZ Q;  1JWM D;  2AHO B;  4GLA C;  4JK1 C;  4U68 A;  2KVM A;  2A74 C;  2I5L X;  3CCL A;  4DU9 A;  4DAY A;  1HTP A;  3S2D H;  3VYS A;  1QVF A;  3E0E A;  2EQS A;  2F0S A;  2BH2 A;  1LM0 A;  4V0B A;  2WP8 J;  1GHJ A;  4FXG C;  1LTL A;  1E22 A;  2EE1 A;  2NVY H;  2HIX A;  2IW3 A;  1P16 A;  1QVC A;  2D62 A;  5T1G A;  5E1F A;  1PYS B;  3BDO A;  3GTO B;  4OO1 H;  1NNX A;  3ND8 A;  5M5Y B;  3BDL A;  4KN7 C;  4AH6 A;  2I0Q A;  4ZCK A;  2CKZ B;  2R92 H;  2UU9 L;  3I90 A;  1N34 L;  3ZYY X;  3DLL A;  2L4N A;  3BDC A;  5IGG A;  2SEB D;  4JI8 L;  4Y7N B;  3FPU B;  1HR0 L;  1STG A;  3KF6 B;  2F0P A;  3HOZ H;  1TVX A;  1R4P B;  3ULJ A;  4BBS H;  3TN2 A;  2NVT B;  1SLJ A;  3I7F A;  3NP8 A;  2IWH A;  1PZJ D;  2ZTE A;  1I6V C;  1LTI D;  3M7N A;  1UUP A;  3TQY A;  2RDH A;  4LF9 Q;  3M3Y H;  3GV3 A;  1KLG D;  4BA2 I;  4QCL A;  2MPM A;  4HMI A;  1I4Q A;  2RQX A;  2B2U A;  5JEA H;  3S1R B;  1YI2 A;  2CCZ A;  4A3D B;  1STB A;  2E2D C;  2XIW A;  4I7Z C;  1H9S A;  2KOL A;  1B53 A;  3CCU A;  1AFP A;  3J81 i;  1CSP A;  4IJL A;  4C3I B;  1Y1V B;  4OX9 Q;  1IW7 D;  2C9O A;  2K33 A;  2F4V Q;  2I5H A;  4A3G B;  1QJO A;  3S16 B;  3HRZ C;  1O7L A;  3OTO L;  5FK9 C;  3MC0 B;  1EY5 A;  2J7Z A;  1LAB A;  5J1Z A;  1GUN A;  2ALY B;  5M3F G;  3RN5 A;  2FMM A;  5ELB A;  2MNA A;  4C3J H;  2K4K A;  1JB3 A;  4KHP Q;  4R8I A;  3M4Y A;  5LHY 1;  4PMC A;  2N3S A;  4JBK A;  2A6E D;  3D3R A;  5LL6 S;  5JPM C;  2F52 A;  5HGQ A;  2L15 A;  3TZD A;  5IYD G;  1M90 C;  3OWF A;  2NBF A;  4KY5 A;  3BVG A;  4KD4 A;  4XTC S;  2Z0S A;  1ASY A;  3H0G H;  1K83 B;  2KQ3 A;  5IOC A;  1O7Z A;  3BZK A;  4DV7 Q;  1YNJ C;  4HSP A;  4JYA Q;  2OQ0 A;  3ND9 A;  2MO1 A;  3PIP A;  1EOT A;  4HJA A;  2JEB I;  1RJT A;  1U4R A;  3HP3 A;  3KOJ A;  5D14 A;  4DV1 Q;  2PYK A;  1XYI A;  5KIX A;  1WD0 A;  2Z9H A;  1FGU A;  2LSS A;  1TS2 A;  4ZYS A;  2B2U C;  1A63 A;  2L9H A;  1CQF A;  5GRO A;  1CKM A;  1D2B A;  3S2H B;  3H15 A;  3NE5 B;  4FP5 D;  1N8R C;  4A3L G;  5JJZ A;  4MTK A;  3NEM A;  4TKO B;  4JBJ A;  1X54 A;  3O13 A;  2P5Z X;  1SN8 A;  2XN9 C;  3CPF A;  3KK7 A;  1IL2 A;  1FJG Q;  2O5J C;  1IYV A;  2ATW A;  3RD4 A;  2EJF C;  1BCP C;  1S5F D;  4A3D G;  1TR5 A;  4DF7 A;  3I3C A;  4LF9 L;  1DD2 A;  3NK9 A;  2F0V A;  1B3A A;  3NTI A;  2F0E A;  4YWM A;  1V1P B;  4C3I G;  3ULP A;  2A8V A;  2L55 A;  5JJI A;  2LXK A;  2WIN B;  4YCV A;  1TWG H;  1Y1V G;  4JI4 Q;  4A3G G;  4KLK A;  3M85 A;  3VR4 A;  2UXC Q;  1FR3 A;  1YEZ A;  1VQ9 A;  3VR5 A;  3D6C A;  1YHQ A;  2F4V L;  4ZQ3 A;  1PH8 A;  4R4O A;  3F2C A;  4LFA Q;  1ET6 A;  1Z7T A;  3T56 B;  5G3L D;  3PUX A;  3J80 E;  2B3G A;  3BJU A;  1XJV A;  4EQN A;  3L3O C;  1S5C D;  5GAG C;  3RZD H;  4DV0 Q;  1H9R A;  3UE1 A;  4KHP L;  5ELD A;  3AB9 A;  2AKW B;  1JWU D;  4DKA C;  3B6Y A;  1BXT A;  5E4X A;  3BVZ A;  2B29 A;  4F87 A;  3CQZ B;  4QIW E;  5FLX c;  3H09 A;  1Y69 U;  4L63 B;  3L0O A;  2F4I A;  1ILP A;  2NWG A;  4R4I A;  1EUJ A;  1D8L A;  3GTL H;  1RDP D;  4BXX H;  4A3E B;  1VQI A;  4XYO A;  1DM0 B;  2BDN A;  4DV7 L;  4XXE A;  4JYA L;  2TSS A;  3MEF A;  1E7Z A;  4C56 C;  1JJC B;  4GS3 A;  3BZD B;  4J1M A;  2VXW A;  3F2D A;  1Q12 A;  1K73 C;  5C0X G;  4DV1 L;  5IGE A;  2ID0 A;  2F0O A;  2A6H C;  1HZC A;  3G48 A;  3ONA B;  4IUN A;  1EOV A;  1V9P A;  4F8M A;  2GA4 B;  3PF5 A;  3F1Z A;  1I3Q B;  2LXJ A;  1X56 A;  2A68 C;  1RTO A;  4IAL A;  1FNW A;  1ASZ A;  1ESF A;  5ISR A;  1Q8I A;  1WCM G;  4YWK A;  1SYG A;  1FJG L;  4OGQ C;  1G91 A;  3PV0 A;  1PFM A;  2BOS A;  3S2D B;  4NW2 A;  1F2Z A;  1HCZ A;  1WYD A;  4GNX A;  3S1M H;  5IWA Q;  5CV5 A;  4ZUI A;  1EL0 A;  4UP7 A;  4XDX A;  4H7B A;  1SE4 A;  3WDN A;  3W5O A;  1UWV A;  4ALP A;  1RF2 D;  1NMG A;  2KED A;  4FF4 A;  2J4X A;  1PDQ A;  5M3F H;  1KRT A;  1V1O A;  4JI4 L;  3QJY A;  1YNJ D;  4HIK A;  4Q0F A;  5H1S E;  3DUZ A;  4JVZ A;  3PF4 A;  2UXC L;  4KJN A;  4FXD A;  5J22 A;  4C3H H;  2R92 B;  3MHB A;  4X3S A;  1X6O A;  2Q2H A;  3C46 A;  3K81 C;  4A93 H;  3T16 A;  3OSO A;  5IIF A;  2ZM6 Q;  1UE7 A;  1SYD A;  2VB2 X;  3AEV A;  3HOZ B;  4LFA L;  1EYA A;  4QIW B;  5A2Q L;  1STE A;  4FVM A;  3J7A 5;  2IX0 A;  4DNI A;  1SFO H;  1SXT A;  4J6H A;  4DV0 L;  3NEN A;  4DUY Q;  3M4O H;  2MHV A;  4Y52 H;  4DR6 L;  3H91 A;  1BF4 A;  4XT1 B;  4Y7N H;  1O7Y A;  2NB0 A;  4LFB Q;  3M3Y B;  2A19 A;  1LTB D;  5KNC A;  4A3E G;  4DXF A;  3OYY A;  2EZV A;  4OXP A;  4KKT A;  5M3M G;  1NSN S;  4RGM A;  2PMZ E;  3J81 c;  2MQH A;  1EFW A;  3BZC A;  4PG3 A;  4R1J A;  2QKI C;  4DK0 A;  1NAP A;  4N8X 1;  2E8G A;  1VQH A;  4GNX C;  4BWG B;  3A56 A;  4DV4 Q;  4DAY B;  2GVB A;  2HCI A;  4Z9C B;  1CKN A;  5CBE E;  1RL2 A;  1W6J A;  1LTG D;  3FPP A;  1K0R A;  1M4V A;  3BYT B;  4LUO A;  1SND A;  3QWN A;  1MSH A;  3JC6 6;  4K2K A;  4OWT B;  1YIT A;  3SK5 A;  2WAQ E;  2R7Z B;  4K5W A;  4C3J B;  2AMC B;  4FXK C;  4JC0 A;  1S4Z A;  1E24 A;  3K5L A;  3NBH A;  4C3I H;  4ID6 A;  1AP0 A;  2F1M A;  1RTN A;  1K8G A;  3I4O A;  4ZKB B;  1ENC A;  4HJ7 A;  3S16 H;  1HH2 P;  4EGV A;  1Q82 C;  2EYH A;  1KAA A;  3GTK H;  4OEL B;  4OO1 G;  5IWA L;  3GTJ B;  4M8A A;  3H0G B;  1K3R A;  2Y0S E;  3S14 H;  2K14 A;  2ZJP A;  5EKI A;  2R92 G;  3H94 A;  3ICE A;  4P74 A;  1IL8 A;  5FO7 B;  4CDD C;  1SNO A;  2WV6 D;  1PV4 A;  4F7X A;  1X3G A;  1UE6 A;  5C3E B;  3AU7 A;  3JAM E;  5FOB B; 
#chains in the Genus database with same CATH homology
 1KDB A;  5I9O A;  1VMP A;  4RA8 A;  2FIN B;  2EYJ A;  1KLU D;  2K32 A;  2A6H D;  3R2T A;  3SHL A;  1IHZ A;  1SNC A;  2RKS A;  2V4D A;  4MIU A;  2IJ0 A;  5KND A;  2PMZ B;  3NHH A;  1BCP B;  3TP7 A;  4G4K A;  2FJ2 A;  1AW7 A;  4HAE A;  5C3X A;  4KKU A;  1TWG B;  2LMC B;  3P75 A;  1J9O A;  1F9S A;  4F88 A;  1WTP A;  4OIK A;  2WAQ B;  1Y8P B;  2PNR C;  4C3J G;  1XXG A;  2Q8R E;  1HA6 A;  2DY7 A;  4KI0 A;  1H9K A;  1BQQ T;  1TQO A;  1GUW A;  5JVH 3;  3RZD B;  4E6I A;  1QOH A;  1CZG A;  1I4P A;  1SJH D;  5COR A;  1A6X A;  2Y0S B;  3D8G A;  1L0X B;  5G3L F;  1D1I A;  2RSN A;  2F0I A;  4RCN A;  2IT1 A;  1ZXT A;  4ZLT F;  3TZU A;  5T1I A;  1D6E C;  2EYO A;  2KJX A;  2C5C A;  3EJI A;  4IN3 A;  1UNS A;  1O80 A;  2F0K A;  2CW0 D;  3GTL B;  3HS0 C;  3D4W A;  1I4H A;  4OHJ A;  1D5Z C;  1KDA A;  1S5E D;  4BS9 A;  1AN8 A;  5FLX L;  2A5H A;  1ET9 A;  3S9W A;  4RCO A;  2F0M A;  4N9P A;  1JOR A;  1V8Q A;  5JVG 3;  1BBX C;  2AQ2 B;  2MP1 A;  3NPP A;  4QUF A;  2M9V A;  3BG3 A;  3NSW A;  1K8O A;  1LV9 A;  4FNF A;  4Q5V A;  1B1Z A;  5C4Z A;  2NTT A;  2KEC A;  1B44 D;  3E0J A;  3S1M B;  4OIJ A;  3IFD A;  3MFY A;  3MVV A;  1F9P A;  3SXH A;  1TS4 A;  3K0Y A;  1A3U A;  5M3F B;  1CQV A;  1G2T A;  2EXZ A;  3W2D A;  2SOB A;  3DM1 A;  2O5I C;  4C3H B;  4LAA A;  2F0T A;  4A93 B;  2F0F A;  4DGZ A;  4IUU A;  5IGF A;  2JEA I;  1M8A A;  1MSG A;  2XNA C;  1SEB D;  1EWC A;  1AZP A;  1RCV D;  4R9W A;  1EY9 A;  1SFO B;  5AFW A;  3MWY W;  5ELE A;  2LS0 1;  3M4O B;  2QF7 A;  3S17 B;  5COY A;  1BDO A;  3MXG A;  1DCZ A;  2CHB D;  1ZYR C;  1XX8 A;  3HG9 A;  4NKL A;  1BCP F;  5I2Y A;  2SNM A;  4IFD I;  3P7J A;  1SBB B;  2RDG A;  5J39 A;  1ONL A;  3MTS A;  3TSS A;  1OXS C;  1R4Q B;  1KTK A;  1NUC A;  1KDC A;  2N55 A;  1U4L A;  2XRQ D;  3F2U A;  3J81 L;  3V2T A;  4RWS C;  2JE6 I;  2BE5 D;  4RKB A;  4HR7 B;  1S5B D;  1YNN C;  3GTK B;  1GUG A;  1JWS D;  3BYY B;  3VA5 A;  3S14 B;  4IUQ A;  1PZI D;  1LLR D;  4C3H G;  5A35 A;  5ELF A;  4RGO S;  2ENB A;  2LFN A;  4U67 3;  3Q22 A;  3CKI B;  3T4A C;  2PZT A;  3N6R A;  1BO0 A;  4A3F B;  4WRD A;  3QIA A;  5IOD A;  2HQE A;  3TP5 A;  1MGS A;  2A69 C;  1VF7 A;  2E76 C;  2AQ3 B;  4RGN A;  4TSS A;  3MZ5 A;  1FYC A;  4A3B B;  2DNE A;  2F0W A;  1JOO A;  4IUT A;  1KAB A;  2JA7 B;  1NCV A;  5M5W B;  5CYU A;  2B2Y A;  2HDM A;  3EQL C;  4ZRZ A;  1A2T A;  3SE0 A;  1E2V A;  1HUM A;  3I4N B;  1EFI D;  1QIL A;  1LT5 D;  1GUT A;  1SMY C;  1OXX K;  1TY2 A;  1LT4 D;  5KGU A;  3HOW B;  4KMU C;  3MA2 B;  3V05 A;  2QDB A;  1WCM B;  1PTO C;  4PMW A;  1MI2 A;  4RH6 A;  2JSO A;  1PTO H;  5IT9 L;  3U9S A;  1STY A;  2EOT A;  4IUR A;  1TS5 A;  4G57 A;  1JCK B;  4EQO A;  2IX1 A;  5E4W C;  2A73 B;  1SNQ A;  1G8Z D;  2K5W A;  1RHP A;  1JQY D;  1ILQ A;  3T53 B;  1F2M A;  3R3O A;  3DWQ A;  1A3V A;  2EDG A;  2VNU D;  1PFN A;  1EYC A;  3KLR A;  3E6Z X;  5M5X B;  2F0U A;  2B2Y C;  2PW5 A;  2JYO A;  1GUS A;  1B2T A;  3L9A X;  1SYC A;  1RD9 D;  4X3K A;  3PUW A;  4HCE A;  2NN6 I;  3IL8 A;  1DYQ A;  3NTK A;  5M3M B;  1OXU A;  2K5Q A;  3I91 A;  2B8F A;  1EY0 A;  2O4X A;  2X6G A;  1GJX A;  2ZXO A;  3DEO A;  4ABN A;  1CK1 A;  1JIC A;  1B9N A;  1EU4 A;  4FYD A;  3I8Z A;  3SK4 A;  1JOQ A;  2F0L A;  5EJW A;  4P2C B;  2MJ8 A;  2R93 B;  1LTS D;  2F0J A;  1Z47 A;  2ZXP A;  2D2C C;  1JOK A;  2Z1C A;  3FMC A;  2X69 A;  2PCF B;  4XT3 B;  3VR2 A;  2K04 A;  2DY8 A;  3GO5 A;  1HFG A;  2EJG C;  2PZU A;  3LWU A;  1EQV A;  4HTH A;  3OW7 A;  2B63 B;  1Q1B A;  2OF1 A;  1A15 A;  2WII B;  5CV6 A;  3HZX A;  1JE4 A;  3CRL C;  4ZAI A;  1EZ6 A;  1B50 A;  2RA4 A;  4OL7 A;  4WFN 3;  2EJM A;  5IGB A;  5JAV A;  3KLS A;  1WTQ A;  1L0Y B;  2KA7 A;  2M00 A;  4NP5 A;  4K6D A;  3K5M A;  4QMG A;  3VYT A;  1I4R A;  3J7Y W;  2Q8T A;  1EZ8 A;  5A2Q E;  3T13 A;  1SMY D;  1BCP D;  4EVO A;  2K01 A;  3MXU A;  5DAU A;  5DM7 3;  5I4D A;  1PTO D;  3X3N A;  4C2M B;  2X6L A;  1ENF A;  1AZQ A;  4CKC A;  4J8Q A;  4JBW A;  2NVQ B;  1B9M A;  1BR9 A;  1DOM A;  1PRT C;  1H9J A;  2F0Q A;  3HOV B;  4K8J A;  3I73 A;  3CRK C;  1ZKO A;  4K5V A;  4DNR B;  1PYW D;  1VCI A;  4HED A;  4MHE A;  4UAI A;  3H3V C;  5EKK A;  1SYB A;  1TY0 A;  3IFT A;  3URY A;  3KBG A;  2FMC A;  1EEF D;  1S5D D;  3HEJ A;  2EYL A;  3Q6S A;  1WTV A;  4RFB A;  3D6W A;  5CV4 A;  3OIP A;  1CHP D;  3FVQ A;  5CV7 A;  1IKM A;  4WOR A;  1CA6 A;  3J7A F;  1T5E A;  1X3Q A;  3Q24 A;  3PUV A;  4KV6 A;  5C44 B;  4IUV A;  4I65 A;  4H0L C;  1F2Y A;  2IX3 A;  4A3I B;  1U4M A;  2R61 A;  1WTX A;  1H9S B;  2PPB C;  2E2I B;  1X3P A;  3QB3 A;  3UI2 A;  4DK1 A;  3FKI B;  2PZW A;  1ENA A;  2A68 D;  1B4O A;  1LT3 D;  4IQZ A;  4C1N K;  4PMB A;  2SNS A;  3PO3 B;  4IFD H;  4KY7 A;  4QUC A;  1HA5 A;  1OXV A;  3LWE A;  5EBD A;  4A3K B;  2RDF A;  1PTO B;  1DZ1 A;  5DEH A;  5D65 A;  5C5M A;  2B2W A;  4HSV A;  5NUC A;  3GD7 A;  4BY1 B;  5TSS A;  2VUM B;  5E3F A;  4IFD J;  3X3M A;  3NUC A;  2BA1 A;  2Z8L A;  3PO2 B;  5CBA E;  3C1F A;  1DJR D;  4LK1 C;  2VB3 X;  3GTP B;  1TU2 B;  5DNF A;  1EIG A;  4XQQ A;  4ZK9 B;  1C8C A;  4EQP A;  4LMQ D;  2H1E A;  1FD7 D;  5CMD A;  5EPL A;  1STH A;  2QEJ C;  3I4M B;  5C0X J;  3WOE A;  1IW7 C;  1E2W A;  2CQA A;  2K1B A;  3DXJ C;  2YU9 B;  4HCS A;  5BN5 A;  1H9M A;  5K36 H;  5KEE A;  5FKA C;  1A3T A;  4XQJ A;  2B8G A;  2E2H B;  1SJE D;  2A6E C;  3NXW A;  5BN3 A;  3GQB A;  2CVR A;  2EYF A;  1SSO A;  2TMP A;  3A7L A;  3A8J E;  5M9O A;  3SVM A;  5FLX E;  1Y8N B;  1DXM A;  2B2W C;  2EPB A;  4DAP A;  4NMZ A;  1GOZ A;  4O1N A;  2R3Z A;  4L8J A;  3FDT A;  1MBY A;  3OMG A;  1SE3 A;  4R8N A;  1T5X D;  3ITP A;  4X3T A;  3G7L A;  4H13 C;  3IKJ A;  3VR3 A;  2WKD A;  2F0H A;  3A7A B;  3KUP A;  1X32 A;  1SE2 A;  1ICW A;  5C4H A;  4G7H C;  1VDZ A;  3A8I E;  3PIO 3;  5C4J B;  2F03 A;  4XYQ A;  1CZW A;  1ROD A;  1FNV A;  2I46 A;  3E5S A;  4KN4 C;  4L6T B;  3MXN A;  3RZO B;  2F0G A;  3M7G A;  4KY6 A;  4FF3 A;  4ILW A;  3K58 A;  2B2T A;  1Y1W B;  3L7Z C;  5D3D A;  2PQE A;  1EU3 A;  3R93 A;  3J7A V;  2YYZ A;  2O2L D;  1IKL A;  3WOF A;  3Q0A A;  3CU7 A;  2D5D A;  4ULL A;  1LAC A;  1OXT A;  2XWJ B;  1FNU A;  1CA5 A;  3H6M A;  3KF8 A;  4BBR B;  3NQI A;  4DXG A;  1EY7 A;  2NN6 H;  1GXD C;  3HOU B;  1PTO F;  1LTA D;  3TP6 A;  1QNK A;  5CV8 A;  4BY7 B;  1PXU A;  3S15 B;  3U9O A;  1VF5 C;  1U9R A;  1PRT B;  5EGT A;  5C0X I;  4N9T A;  3J81 E;  3TP8 A;  5LL6 X;  2OEO A;  3W3A A;  2RBM A;  3TBI B;  1BNZ A;  4H44 C;  2N88 A;  3BVM A;  1G6Z A;  2OXP A;  1F9R A;  3K5O A;  3RMH A;  3K57 A;  3HGB A;  5DM6 3;  3I4L A;  1HHV A;  4KK7 A;  4AYB B;  1BOS A;  1D5X C;  1ZEQ X;  2B2T C;  2LY7 A;  3VR6 A;  2HUG A;  4DNT B;  2BCO A;  1OO9 B;  4K8I A;  4GZY C;  3K59 A;  2QCP X;  1PMR A;  2NTS A;  5EBC A;  3A55 A;  1HFN A;  3FEW X;  5HGT A;  5JEA J;  3SK8 A;  2RVL A;  2NYZ D;  2AUJ D;  3A8K E;  1WTW A;  4A3J B;  5D3I B;  4NDX A;  2AWN A;  5EQ0 A;  2K6A A;  5CR3 A;  5I9P A;  3DHQ A;  1SYE A;  1NR4 A;  5F2D A;  3R2I A;  1Q3L A;  5JPN C;  2EY1 A;  4RAU C;  4G7O C;  1W6K A;  2B39 A;  5KYI A;  5FO8 B;  5FO9 B;  1HRJ A;  3NQT A;  1TWH B;  3D31 A;  2AUK A;  3NTH A;  2E74 C;  2G9H D;  3GTG B;  2E2J B;  1PLF A;  3LNN A;  4KHV A;  1SAP A;  2K5D A;  3ERQ A;  4FF2 A;  2ICI A;  1TWC B;  1STA A;  3D4D A;  3K5N A;  2H4O A;  3P20 A;  5KYL A;  5JOB A;  4RKL A;  1U4P A;  4IUP A;  4RHR A;  1IYU A;  2XVS A;  5IT9 E;  3DMU A;  2OT2 A;  4HN7 A;  5EKL A;  2Z4I A;  1C4Q A;  4S3S A;  3SDZ A;  3J80 L;  2SDF A;  1I4G A;  1EY6 A;  3DEP A;  3GP7 A;  3TDQ A;  1SDF A;  1ZYR D;  4K5X A;  2XSC A;  4OO1 I;  1CI3 M;  3BS1 A;  1EIH A;  1QB5 D;  1I4X A;  5C4X B;  4CJ2 C;  3OOC A;  4K6L A;  2M2L A;  5CGK A;  3I72 A;  1PZK D;  3TME A;  2F0D A;  1CFM A;  3R8B A;  4IFD G;  1HUN A;  3D4R A;  2DNC A;  2F0N A;  2Z4H A;  1QE6 A;  1AEX A;  4UDU C;  1EY8 A;  3RLF A;  2R6G A;  4M1U B;  1YNN D;  2QIL A;  1PRT F;  2PO4 A;  1EWH A;  1FGB D;  1UAP A;  4FF1 A;  5C5L A;  1STN A;  1RKN A;  2K28 A;  3GTM B;  3NWS A;  4ME5 A;  1UEA B;  5I6W A;  2PW7 A;  4CGY B;  1QCB D;  2KHS A;  5CV9 A;  3K7A B;  4XQN A;  2EYM A;  2I07 B;  3EVQ A;  1JR0 D;  2E75 C;  1CM9 A;  4B9W A;  3HOX B;  2A69 D;  2KEE A;  3PIP 3;  4O42 A;  1E0B A;  2L1B A;  5K5P A;  2KCN A;  2KUM A;  2NVY B;  2JA8 B;  3KLS X;  3S1Q B;  3G6J B;  3DWA A;  3OHX C;  1HXY D;  3MEH A;  5K36 G;  3T51 B;  2XRS D;  4ZKC B;  3HKZ B;  4RHS A;  3SEB A;  2WKC A;  3A54 A;  1SYF A;  3SK6 A;  3IAY A;  1PFB A;  1TII D;  1NR2 A;  4PNY A;  3OPO A;  4BA1 I;  1KNE A;  1Z6H A;  5IGD A;  4BBS B;  3EFX D;  1CTM A;  5BN4 A;  4ODG A;  1Q1E A;  4KHZ A;  1E2Z A;  4KJO A;  4B08 A;  2KCC A;  3PUZ A;  1WVL A;  3OMC A;  1HPC A;  4YIJ A;  1EY4 A;  2MUY A;  2CW0 C;  1LO5 D;  5C6A A;  1HQM C;  3VA7 A;  3VYR A;  2JA5 B;  3FRP B;  1SNM A;  1LT6 D;  2ZXR A;  2G9D A;  3OIQ A;  2DN8 A;  2ICE C;  4RGT A;  2Q8I B;  4IZ8 A;  3VYU A;  5CC4 A;  1SNP A;  3PUY A;  2EY6 A;  4LJZ C;  3GTQ B;  4PQX A;  4DAV A;  1DON A;  2BA0 A;  2WB1 B;  1WTR A;  2EVB A;  5EPJ A;  4MN3 A;  1TWF B;  4CHT B;  3CHB D;  2WAC A;  2FHT A;  2AWO A;  1TKW B;  4DFA A;  4DN4 M;  4A3M B;  1ESR A;  3HOY B;  4K2L A;  3QOJ A;  3JAM L;  4KKS A;  1V1P A;  4HMJ A;  5KRU A;  2EYP A;  1DOK A;  2BDO A;  2LKV A;  3DWP A;  2NVX B;  2F3V A;  2EY2 A;  1F77 A;  2NZ1 D;  2NN6 G;  3C1E A;  3K6O A;  4CBV A;  4XIG S;  2K7V A;  4ZUJ A;  1EYD A;  2NUC A;  3RUZ A;  2K03 A;  3C2P A;  2L12 A;  3MAQ A;  4WJW A;  3Q23 A;  1DOL A;  3PMF A;  3C3L A;  1KNA A;  1CT1 D;  1EQT A;  1O78 A;  4CKB A;  2JA6 B;  5JEA G;  5I6Y A;  4KD3 A;  1WD1 A;  2L11 A;  4PV1 C;  3N52 A;  3P1H A;  1G29 1;  1I50 B;  4B9X A;  1VMC A;  5HUR A;  1G2S A;  2IPK D;  5C0X H;  2HCC A;  5KNB A;  5ELC A;  1BUV T;  1LTT D;  1GHK A;  1HTL D;  3S1N B;  2B2V A;  4FO2 A;  1HQR D;  1QNU A;  3LX0 A;  2RSO A;  4DA2 A;  4C1N I;  2JP1 A;  4QB4 A;  1F9Q A;  1TS3 A;  2D9U A;  3QG1 A;  1QWY A;  5IGC A;  4V19 0;  1LTR D;  4KTA A;  4CKE A;  2BE5 C;  3NWT A;  3AMU A;  2J0T D;  3MFG A;  1TWA B;  1D5M C;  1J8I A;  2XWB B;  1MD2 D;  3NBI A;  3ERO A;  1JC7 A;  1TT2 A;  1K8M A;  1F2L A;  3EA6 A;  1A2U A;  2L5T A;  4CJ0 B;  1II3 A;  1WTO A;  1C48 A;  1XTC D;  3SR1 A;  3GV6 A;  1PRT D;  1V43 A;  3I70 A;  2JXM B;  2L0C A;  3OWE B;  5C3W A;  1ML0 D;  4X3U A;  1CHQ D;  4TQU S;  2HDL A;  1D1K A;  1GUO A;  1Q90 A;  4QF4 A;  3MXP A;  3KBX A;  2IL8 A;  2B2V C;  4CJ1 B;  2MGS A;  4G7Z C;  4TRD A;  1XWE A;  5EPK A;  1I6H B;  1R9T B;  4K14 A;  3QOL A;  2AQ1 B;  5I2X A;  3QO2 A;  2EY5 A;  1EEI D;  1Y8O B;  1QG7 A;  2ZT9 C;  2K05 A;  3V96 A;  2F3W A;  2FFK B;  1JWM D;  4JK1 C;  4U68 A;  2KVM A;  2A74 C;  4DU9 A;  4DAY A;  1HTP A;  3VYS A;  2F0S A;  4V0B A;  2WP8 J;  1GHJ A;  4FXG C;  2EE1 A;  2IW3 A;  2D62 A;  5T1G A;  5E1F A;  4OO1 H;  3BDO A;  3GTO B;  3ND8 A;  5M5Y B;  3BDL A;  4KN7 C;  3I90 A;  3ZYY X;  2L4N A;  3BDC A;  5IGG A;  2SEB D;  4Y7N B;  3FPU B;  1STG A;  2F0P A;  1TVX A;  1R4P B;  3TN2 A;  2NVT B;  3NP8 A;  2IWH A;  1PZJ D;  1I6V C;  1LTI D;  3M7N A;  1UUP A;  2RDH A;  3GV3 A;  1KLG D;  4BA2 I;  4QCL A;  2MPM A;  4HMI A;  1I4Q A;  2RQX A;  2B2U A;  5JEA H;  3S1R B;  4A3D B;  1STB A;  2E2D C;  2XIW A;  4I7Z C;  1H9S A;  2KOL A;  1B53 A;  1AFP A;  4C3I B;  1Y1V B;  1IW7 D;  2C9O A;  2K33 A;  4A3G B;  1QJO A;  3S16 B;  3HRZ C;  1O7L A;  5FK9 C;  3MC0 B;  1EY5 A;  2J7Z A;  1LAB A;  5J1Z A;  1GUN A;  2FMM A;  5ELB A;  1JB3 A;  4R8I A;  3M4Y A;  5LHY 1;  4PMC A;  2A6E D;  3D3R A;  5LL6 S;  5JPM C;  3TZD A;  3OWF A;  2NBF A;  4KY5 A;  3BVG A;  4KD4 A;  4XTC S;  1K83 B;  2KQ3 A;  5IOC A;  1O7Z A;  1YNJ C;  4HSP A;  3ND9 A;  1EOT A;  2JEB I;  1RJT A;  1U4R A;  3HP3 A;  5D14 A;  1WD0 A;  2PYK A;  1XYI A;  5KIX A;  1TS2 A;  4ZYS A;  2B2U C;  2L9H A;  1CQF A;  1D2B A;  3S2H B;  3NE5 B;  4FP5 D;  5JJZ A;  4TKO B;  3O13 A;  2XN9 C;  3KK7 A;  2O5J C;  1IYV A;  3RD4 A;  2EJF C;  1BCP C;  1S5F D;  1TR5 A;  4DF7 A;  3I3C A;  1DD2 A;  3NK9 A;  2F0V A;  1B3A A;  3NTI A;  2F0E A;  1V1P B;  4C3I G;  2L55 A;  2WIN B;  3M85 A;  3VR4 A;  1FR3 A;  3VR5 A;  3D6C A;  4ZQ3 A;  1ET6 A;  1Z7T A;  3T56 B;  5G3L D;  3PUX A;  3J80 E;  4EQN A;  3L3O C;  1S5C D;  1H9R A;  5ELD A;  3AB9 A;  1JWU D;  1BXT A;  5E4X A;  3BVZ A;  4F87 A;  3CQZ B;  3H09 A;  1Y69 U;  4L63 B;  2F4I A;  1ILP A;  2NWG A;  1RDP D;  4A3E B;  4XYO A;  1DM0 B;  2BDN A;  4XXE A;  2TSS A;  4C56 C;  3BZD B;  4J1M A;  2VXW A;  1Q12 A;  5C0X G;  5IGE A;  2ID0 A;  2F0O A;  2A6H C;  3ONA B;  4IUN A;  4F8M A;  2GA4 B;  1I3Q B;  2A68 C;  1RTO A;  4IAL A;  1FNW A;  1ESF A;  5ISR A;  1Q8I A;  1SYG A;  4OGQ C;  1G91 A;  1PFM A;  3PV0 A;  2BOS A;  3S2D B;  4NW2 A;  1F2Z A;  1HCZ A;  5CV5 A;  4ZUI A;  1EL0 A;  4XDX A;  4H7B A;  1SE4 A;  3WDN A;  1RF2 D;  4FF4 A;  2KED A;  2J4X A;  1PDQ A;  1V1O A;  3QJY A;  1YNJ D;  4Q0F A;  3DUZ A;  4KJN A;  4FXD A;  5J22 A;  2R92 B;  3MHB A;  4X3S A;  3C46 A;  3T16 A;  5IIF A;  3OSO A;  1SYD A;  2VB2 X;  3HOZ B;  1EYA A;  4QIW B;  5A2Q L;  1STE A;  4FVM A;  2IX0 A;  1SXT A;  4J6H A;  2MHV A;  3H91 A;  1BF4 A;  4XT1 B;  3M3Y B;  1O7Y A;  2NB0 A;  1LTB D;  5KNC A;  4DXF A;  2EZV A;  4KKT A;  1NSN S;  4RGM A;  2QKI C;  4DK0 A;  1NAP A;  4BWG B;  3A56 A;  2HCI A;  4Z9C B;  5CBE E;  1W6J A;  1LTG D;  3FPP A;  1M4V A;  3BYT B;  1SND A;  3QWN A;  1MSH A;  4K2K A;  3SK5 A;  2R7Z B;  4K5W A;  4C3J B;  4FXK C;  1S4Z A;  3K5L A;  3NBH A;  1AP0 A;  4ID6 A;  2F1M A;  1RTN A;  4ZKB B;  1ENC A;  4EGV A;  2EYH A;  1KAA A;  4OO1 G;  3GTJ B;  4M8A A;  3H0G B;  5EKI A;  3H94 A;  1IL8 A;  5FO7 B;  1SNO A;  2WV6 D;  4F7X A;  5C3E B;  3AU7 A;  3JAM E;  5FOB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...