2WKCA

Crystal structure from a single-stranded dna binding protein from the lactococcal phage p2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
90
structure length
90
Chain Sequence
GTIITVTAQANEKNTRTVSTAKGDKKIISVPLFEKEKGSNVKVAYGSAFLPDFIQLGDTVTVSGRVQAKESGEYVNYNFVFPTVEKVFIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Phage P2 Orf34(P2), a New Type of Single-Stranded DNA Binding Protein.
pubmed doi rcsb
source organism Lactococcus phage p2
molecule tags Dna binding protein
molecule keywords ORF34P2
total genus 11
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16773 Phage_SSB Lactococcus phage single-stranded DNA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.400 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2wkcA00
2WKDA 2WKCA
chains in the Genus database with same CATH superfamily
4KKUA 1A63A 2H1EA 1A2UA 4JI1L 1J5EQ 2JA7H 2KA7A 1TU2B 3N6RA 1XYIA 1U4MA 3GQBA 1HNZQ 5CGKA 2A69D 5CV4A 3Q23A 3U4ZA 4DV2Q 5HURA 1J5EL 1J9OA 4UY8C 1HZCA 4POFA 4GKKL 3PV0A 2B2VC 5IE8A 1K0RA 3GTOH 4BS9A 5IGEA 3D4DA 4DAVA 2NUCA 1OXTA 1EEFD 4K5XA 3F2BA 2JYOA 4A3GG 2NZ1D 3VA5A 1EY5A 3S14H 2PZTA 4HCEA 5BN3A 1LTID 4XDXA 1BF4A 2F0EA 3CCJA 3R8BA 1WJJA 2A19A 4A3BH 1BO0A 1X3PA 2UUCL 2D62A 2B2UA 3Q6SA 1B3AA 4BY7G 2GVAA 1DOMA 3EBEA 1PLFA 1Q86C 1QUQA 1H9JA 1TVXA 3HOUH 1B50A 2NVTB 4OO1I 5JJZA 1BR9A 2B2TC 3DWPA 2M00A 1PTOH 1I4PA 1E1OA 3O13A 4I7AA 4PNYA 2BE5C 3M9BA 3H15A 3GTPB 1LUZA 5JJIA 1VF5C 2F0DA 2R92H 1A3TA 2D9UA 1HNWL 1HXYD 1YJNA 5JEAJ 1CM9A 2HT1A 1Q1BA 1QZGA 3S24A 1TY2A 4IPHA 3SE0A 4APVA 2MJ8A 1VQJA 3OOCA 1M8AA 5C4ZA 1OTCA 2I46A 4WJ3M 1TWCB 5EKLA 3K59A 3C46A 1XNRL 1CHPD 4XT1B 4NW2A 4GZYC 2PNRC 2H5XA 1Q81C 2X6GA 5EKIA 2K52A 1IXRA 1F9PA 4GN3B 4GNXA 1GD7A 1TWFH 1PRTB 4A3DG 4RHSA 2L11A 1LTGD 4HIDA 1I50H 3TP8A 4JI0Q 1V9PA 1XXGA 2RQXA 3Q22A 3JAMc 1Z7TA 3U9OA 2DUDA 2RBMA 5ELCA 1DOKA 5KEEA 2B2YA 1EY6A 5DLQE 1SE3A 5I2XA 1KRSA 1VQ7A 5FLMH 4DR6Q 1UE7A 1N36Q 1PFSA 1NMFA 1A2TA 2JA9A 5M3MG 1B3QA 1L1OC 3W2DA 2AWOA 3F8TA 5LMNL 5FLXc 3PF5A 4MTKA 1PA6A 2OQKA 4DR1L 2OWOA 1EOTA 1HJPA 1LT6D 2A6ED 4OO1H 1YNND 4OELB 3RD4A 2LXJA 1PTOB 4N9TA 1U4LA 3TZUA 2LFNA 1KNEA 4BY7B 2BH8A 4A3JH 5M5YB 1IBLL 1EIHA 4NKLA 5G3LD 2JA5H 1G8ZD 2A6EC 4JOIA 3ERQA 3GTLH 2CWAA 1B1ZA 1YI2A 2EY6A 2LXKA 2GA4B 4C3JB 2O5IC 5IYDH 4HR7B 1IBLQ 3BYYB 1WCMH 1TT2A 3K7AB 2RCNA 2ZTDA 1HZBA 2PO4A 1STAA 3PIP3 5JEAG 4A3GH 1TWHH 4XXEA 4X3UA 1RF2D 3E3XA 4PZ6A 2MFIA 1MGSA 1O78A 1KNAA 2AQ1B 4R4CA 5EPJA 4GN5A 1OXXK 4LF8L 1EYAA 2R7ZB 4HTHA 5ELEA 4YCWA 4DV5Q 2E2IH 4A75A 1YHAA 3CD6A 1Q1EA 1UNSA 3CAMA 4GNXB 2BOSA 2UU9Q 1NJIC 4B3RQ 3F2CA 1GUSA 1VQLA 3DUZA 3FVQA 2N88A 3A7AB 1GUGA 3M7NA 2NTTA 1JOOA 5JOBA 4HJ7A 3STBC 4C56C 5I9PA 3MHBA 4O2DA 5A2QL 1YEZA 1P16A 3WDNA 3J7A5 1H9SB 3UDGA 5IYDG 1W6JA 1I6HH 2I07B 2A73B 4G4KA 2B63H 1QILA 4KHPL 5I6WA 1BCPC 5EBCA 4ZQ3A 1ILQA 4Y7NH 2OXPA 3PUWA 4C3IB 4X62Q 2VQFL 3HKZB 3J7ZC 4WFN3 1BQQT 2NVQH 2EYOA 1KIXA 1CKMA 2HCCA 4OWTB 4ZAIA 4JI8L 3GP7A 1ML0D 4X62L 3NSWA 1ONLA 1SEBD 4KHVA 5CORA 2B8FA 3SK4A 4IOCA 2F0NA 3I4MB 5FO7B 4C3JG 2ASBA 1WTWA 1GJXA 1HR0Q 1DCZA 4QIWE 4BY7H 1V1PA 4JI8Q 1UEAB 3KDFA 3R3OA 4DAYB 3HRZC 3TMEA 3HKZG 1Q90A 4A3IG 4LFAQ 1PV4A 3DM1A 2FJ2A 4KKTA 1N8RC 3J80i 1S5DD 1EU4A 5GROA 3V96A 3K57A 1I3QH 1STHA 3TN2A 2B2WA 2QDLA 3D6CA 1IW7C 1Q82C 1I3QB 3H09A 1Q46A 2X69A 2KBNA 2RA4A 1F2LA 4EQOA 1D5XC 1JQYD 1OXUA 3CP0A 3MZ5A 3M3YH 1D2BA 4BY1B 3DHQA 1Y14B 3D4RA 1FJGQ 4JI6L 1IYJB 1PTOF 3GTMB 4GKJL 2Y0SE 3K7UC 2E76C 3W1BA 5J39A 3KOJA 3S16B 2E8GA 4K5WA 3JAME 1XNQL 1SJED 4GNXC 4YWLA 1TWFB 4JI6Q 2N3SA 3PMFA 3VR4A 4LF5L 3BDLA 4RMFA 1E24A 2IY5B 2B2TA 2K5NA 4IJHA 5K36G 1AW7A 3PF4A 4V190 1X3EA 1K8AC 3H3VC 4B3TQ 1R9TB 3UDIA 3WOEA 4LF5Q 4XTCS 5EKKA 3I56A 4FF2A 3BZDB 1PH8A 1AZPA 4B3TL 4JPBW 2ZXOA 1BDOA 5H1SE 1KDCA 4CDEC 3GTOB 4QY7A 3T1YQ 4XIGS 4FNFA 2IL8A 2L0CA 4YY3L 3TREA 4A93B 2E75C 2RKSA 2KCMA 3GTPH 3QJYA 4Y7NB 4OWWB 4A3MG 4YY3Q 2SOBA 4A3BG 3J81j 1VQCA 3H0GG 1Z6HA 1HFGA 2XWBB 1VQMA 5KIXA 5GADC 1XWEA 2RSNA 4UAIA 1ENFA 4UP7A 2WINB 1Q8KA 1EWHA 3OWFA 1YNNC 2JE6I 4KJOA 4DV2L 3S2HB 1QG7A 1LABA 4QQBX 3CCMA 3PUVA 3KLSX 1NUCA 1I4GA 3G48A 2BA1A 1F2ZA 4FXDA 1XX8A 4OX9L 3NWSA 2KUMA 5IP9H 4OONA 4RH6A 4IURA 3OMGA 3KLRA 3P1HA 5EAYA 4XYOA 2EVBA 1LACA 2JA8H 1AE2A 2SNSA 1L2FA 3U9SA 1PH6A 3G71A 5LMUQ 2AQ3B 4OX9Q 1ICFB 4OEMB 2WACA 2EJMA 1WTVA 4R8NA 3K6OA 2KJXA 2C35B 2FINB 5D65A 3PO3B 2EXZA 1V1PB 1BCPF 5IYBG 2I5MX 2OQ0A 1VQHA 2K5VA 1HH2P 3NEMA 1PYWD 2WAQG 2DNEA 2CVRA 2Z9HA 1E0BA 2JA6B 4DR4L 3DEPA 2CQAA 1KC8C 1EYDA 4DV3L 2A74C 2RSOA 3RZOB 1LTAD 2WIIB 2QGQA 3I91A 2EY2A 1UWVA 2ALYB 1XPOA 2ZT9C 1SSOA 3K81C 1OO9B 2YTXA 1KDAA 1TWAB 1WI5A 2CH4W 5AFWA 2VL6A 1ZEQX 1PZJD 3NWTA 4FF3A 4BBSH 3SDZA 4DU9A 5M5YH 4A3JB 3BDOA 1QZHA 4HIOA 1JR0D 5C3EB 2ZXPA 2AMCB 2F0LA 2MO1A 3ULJA 3A54A 2PMZE 4DNTB 3BS1A 5IGGA 4E6IA 2UXDQ 2UUBL 5FO9B 3AU7A 3WWVA 4Z9CB 3I2ZA 3NUCA 4DUZL 4KHZA 1I50B 4R4IA 4WRDA 3K7AH 4JBJA 3MXGA 1XNRQ 4A3EH 1PVOA 5I9OA 1O7YA 3PO2B 2BDOA 2BH2A 2F0SA 1CKNA 3CCUA 4JOIC 2JN4A 1WFQA 1I6VC 5GAHC 1Y1VH 3AMUA 2F3VA 4NMZA 4WJWA 2K32A 5IY0A 4JI7Q 1H9KA 4F87A 4ID6A 3HG9A 3A0JA 1SDFA 5CC4A 3ER0A 3LX0A 3CF5A 1A6XA 4OL7A 4QB4A 2NN6I 2F1MA 2OEOA 3GTQB 1X54A 3UDFA 1J6QA 4JI7L 1PH1A 3L0OA 3PO2H 1ICWA 1SMYC 5E4XA 1UE5A 1TWCH 4P74A 5JAVA 4IJLA 3S1QH 1OXVA 1EFWA 3OMCA 4K8IA 1RTOA 1YNJC 1V1OA 1RDPD 2BDNA 4B9WA 2Q2UA 2KEEA 4GLXA 1KABA 3BDCA 1TWGH 1I4XA 1P8LA 4A3FH 4O0AA 4RWSC 2NVTH 3HOUG 4ME3A 1B8AA 4GLAC 1ZYRC 2PNHA 2F0HA 2KENA 5JVH3 3QOLA 5C0XH 1A3VA 4KD3A 5M3MB 3K58A 3BG3A 1KLUD 2B2UC 2D2CC 1K3BC 4DPGA 2C5CA 3KJPA 4GOPA 3H94A 1HRJA 1NNXA 1JMCA 4NPSA 1C48A 2EY1A 2RF4A 3NPPA 1K83B 1WTOA 4QCLA 2IX3A 5KGUA 1PFBA 4G7HC 2E5LL 2KHSA 2C9OA 2EYJA 4DFAA 3K0XA 4DK1A 4X64L 3MAQA 4CGYB 2AQ2B 5M5WB 2I0QA 1MSGA 3FRPB 2YU9H 3HOZH 4GN4B 2LMCB 1HHVA 4H13C 2Q8TA 4L5QA 1VQIA 4X64Q 2MO0A 4K0KL 1K83H 2NVYH 1U0LA 3SEBA 4JC0A 3QG1A 4FVMA 3TSSA 3W5OA 3G4SA 1T5EA 4DR2Q 1TS3A 4H7BA 2RDFA 3RN2A 5CBAE 1SNCA 3HOUB 1T5XD 5IT9L 1Z9FA 4A3EG 1LTBD 2YU9B 2EYLA 3KF8B 2J7ZA 1FNWA 2P5ZX 1CFMA 1YNJD 1ASZA 1X56A 5ELNA 4DR2L 4ZRZA 3G7LA 4P72A 5IT9c 5K5PA 1JJCB 2IWHA 3NQTA 4CDFC 1MKHA 2R7FA 3GO5A 5J1ZA 4J1MA 1TXYA 4UPAA 5ELBA 1PH9A 3Q0AA 3JAML 4PQXA 4DV0Q 4DN4M 2IJ0A 3HOWH 1GM5A 3TEHB 2NN6G 3K8AA 4RG1A 4LMQD 2ZTCA 3MVVA 3NBHA 1QE6A 2YTVA 3IKJA 5KNCA 4EQPA 5M5WH 5CYUA 1CA6A 4X66L 3I4NB 4A3IB 1IBKQ 1QCBD 3NTHA 1CK1A 1EQRA 4X66Q 1SFOH 1HR0L 2K01A 5ELOA 2XIWA 4DV7L 1WTPA 3FPUB 2WAQE 4GS3A 1TY0A 1I94Q 4LFAL 5K36H 4HSPA 2ID0A 1STNA 5E1FA 4F7XA 1JB3A 1TIID 2HCIA 4DXFA 2LKVA 4LJZC 3MFGA 2RCFA 3OHXC 5IT9E 2UXBQ 2R6GA 3MXNB 1L0WA 4X3TA 4IUVA 4JCVE 4DA2A 3EIVA 1SRUA 3KFUA 3VYTA 3DWAA 4ILWA 3L2PA 1HQMC 1NR2A 4AQYL 3TS2A 3GTJH 2IT1A 5IYCG 1SN8A 1WTRA 5EPLA 1N34L 1BBUA 4YCVA 4HMIA 1G291 2RHSB 3DXJC 3E0JA 2R93G 3S16H 3HZXA 3W3AA 4ABNA 1K3RA 3RZOH 1F9QA 1HPCA 1B2TA 1LTSD 4MNOA 2JEAI 3UI2A 2XRQD 4FXKC 4HMJA 4IN3A 5FO8B 2QEXA 4MHEA 1U4PA 1T9HA 2K5DA 5J22A 1B44D 3PO3H 3RN5A 5IP7H 3X3NA 3PQIA 1PRTF 3DWQA 1UEBA 2Z6BA 2R7DA 4JI1Q 1XMQQ 3C1FA 2WB1B 3U50C 1IL8A 4ME5A 4C3IH 3ZYYX 4IFDG 2JA8B 3A56A 1VS0A 4RCNA 4EGVA 4ZKCB 4CDDC 1HNXQ 4L5TA 1G2TA 1RKNA 1SMXA 1TS5A 2JSOA 1X65A 2B3GA 3BVZA 2EJFC 2WP8J 2X6LA 2PW5A 1N32Q 4FO2A 5C44G 1KLGD 3A8IE 3VR5A 4CKBA 1RCVD 2IW3A 1MBYA 5DNFA 1KAAA 4QJFA 1CKNB 3ND8A 5FJ8G 4GLVB 3D31A 2PMZB 5IODA 4TKOB 4JV5L 3BZKA 1EZ6A 1GUNA 1EFID 1K28A 5FLXL 2WV6D 2PZWA 2M9VA 1GUOA 2K28A 4JK1C 2B63B 1CQVA 3AFQA 3ICEA 4N8FA 3CMEA 5EPKA 1AE3A 3LGJA 1FR3A 2R61A 3NK9A 3Q8DA 4JV5Q 3PIPA 1HCZA 1VQPA 4IUQA 1UE1A 4J8QA 2PQEA 3IRBA 3T56B 1JICA 1FVIA 1JE5A 3KK7A 1LV9A 3NBIA 5C4HA 3OW7A 1GKHA 4A3FB 3D8GA 2B2VA 4UP9A 3HFZB 1JWSD 4JI3L 5JPNC 2EOTA 3HP3A 4KY5A 1PRTC 4XQJA 2L15A 1BCPD 1GVPA 1X9NA 3WOFA 1E1TA 2B8GA 4POGA 2KOLA 1HQRD 4A3KB 1DYQA 1CSQA 2R7ZG 1YITA 2QILA 1WTQA 3HKZE 3ND9A 5C3EG 4LF7L 4FF4A 2DN8A 2EIFA 2V1CC 2KCNA 5TSSA 1VQ9A 2F4IA 3P20A 2Q8RE 1RIPA 1L0YB 2Q8IB 4LF7Q 3KF6B 1MIUA 4A3CH 1JJ2A 2NBFA 1GO3E 4DV4Q 1EQTA 1TWHB 3OPOA 4A3FG 3KDFB 3RR5A 2Q2HA 4B9XA 4LFBL 4DUZQ 2EJGC 2N78A 4AIMA 3CPWA 4EQ5A 4RGNA 1YNXA 5M3MH 5KNBA 2B39A 4NDXA 5HGTA 3M4OH 3I72A 2F03A 1SNPA 4G7OC 5I6YA 5C44B 3DEOA 4F88A 2E2JH 2AUKA 5C3XA 2NVXB 2ZXRA 2MUYA 2VXWA 4OIJA 4C2MH 4DR5L 1N36L 1G6PA 2D5DA 3NENA 2F0QA 2HDLA 3PIO3 1IKLA 1PXUA 4JG2A 2KCTA 4LAAA 5LMNQ 3FKIH 4QUFA 3C2PA 4JVZA 3I4NH 1CUKA 3I7FA 2O4XA 4AYBE 1Y1VG 3STBD 2VQEL 1VQDA 3S17H 1G51A 1HZAA 2F3IA 1Q12A 4HIMA 1PH7A 2EY5A 4DV6L 2DNCA 2FFKB 2IX1A 2MQHA 1X6OA 3RMHA 3EQLC 4AYBB 1IW7D 2L9HA 2KHJA 1Q7YC 5JEAH 2JXMB 2FXQA 2K33A 4R9WA 4ZK9B 4HAEA 1DOLA 1WCMG 4PG3A 1WOCA 1JWUD 3BYTB 2AUJD 4C3HH 3IFDA 4RCOA 1X32A 1EOVA 5C4JH 4FXGC 3GTGH 2DY8A 4RGOS 3AQQA 2R93B 3W1GA 2R92B 4B3SQ 1BNZA 3KLSA 2F4VL 3PSIA 2MGSA 3URYA 3CCQA 1A3UA 3HOVB 1VQEA 5AJ3Q 3NXWA 3HOWB 4B3SL 1FGUA 2BCOA 1AEXA 3BU2A 3CHBD 2Z4IA 4CJ2C 3HKSA 4B3ML 1NBWA 2R3ZA 5M3FG 1EYGA 1WD0A 1HUNA 3SGIA 4DV5L 3KF6A 3L9AX 1U5KA 3KYHC 4CKCA 1EZ8A 3HOYB 4X3SA 1C7YA 4X6AH 3CC7A 3CXCA 4IUNA 4JYAL 1ZYRD 2NTSA 1VQFA 4HIKA 1S5CD 1BUVT 1ZXTA 2CKZB 3HOVG 1SNDA 1E3PA 2TSSA 5T1IA 4DUYQ 1S5BD 4ALPA 4HSVA 1YJ9A 3TP6A 2A6HD 2JA6H 4HJ5A 2JK8A 1KL9A 1LM0A 4A3IH 2NWGA 3GTLB 4DUYL 3AB9A 3GTKH 2MP1A 4KHPQ 1B70B 2K1BA 2JP1A 2YV5A 5F2DA 1NTGA 4I7ZC 4EQNA 3FEWX 1E2VA 1VQ5A 1E22A 2VY3A 4DXGA 1SAPA 4DV0L 5CV9A 5M5XH 2XSCA 1K8GA 4K8JA 4RKBA 4JI2Q 2F52A 1PZKD 5C5LA 1R4QB 4O42A 4DV1Q 3RZDH 1Y1WH 2Z6KC 2L55A 5M3FH 4BBSG 2EYMA 4RFBA 4ZLTF 1YIJA 5BR8L 4FYDA 1J8IA 5DEHA 1VQGA 4JI2L 4YHHQ 5C4XH 1G91A 1II3A 1SNOA 1YVCA 3A5UA 4UHVA 1R9TH 3NP8A 5EGTA 5ELFA 1TQOA 1IBMQ 1LTLA 1CHQD 4JI4Q 2Z8LA 3B6YA 1ESRA 1SYEA 1CA5A 2NZOA 1L1OA 1FD7D 3S17B 4KMUC 2A69C 4KY7A 3F2DA 3P75A 3GV3A 4CJ1B 2I5HA 4JI4L 2Z1CA 3PIOA 1K0SA 3CQZB 4NXNQ 3J80E 1SMYD 2Q2IA 3HOXH 4BXXG 4J6HA 3M3YB 3A74A 1XPUA 2DJGC 3I4OA 2XNAC 4KN7C 3CPFA 3TDQA 3ONAB 2JJQA 3RLOA 5G3LF 5BN5A 1IYVA 2JA6G 2O5JC 1N34Q 4AH6A 2QA4A 3HOXG 3D0FA 1XMOQ 4LNQA 4A3LH 4UP8A 4MZ9A 5DAUA 2JA7G 1G2SA 5KNDA 2K03A 5E3FA 2K6AA 1K8MA 1RTNA 3S15B 1AH9A 4L8JA 3OTOQ 2XWJB 1HA6A 1I4RA 5D3IB 3S15H 1ESFA 1GUTA 4KK7A 4JI5L 3S1QB 1CI3M 4BBRH 2NZHA 2RHQB 4LF4Q 4GOPC 2OT2A 1M1KC 5ELDA 4QGUA 3S2DB 1IHZA 4DR3Q 2F0FA 4KKSA 1O7LA 2OTJA 3MXUA 4DR7Q 4RAUC 1W2BA 4LF4L 3M4YA 1YZ6A 1S3OA 5C3WA 4AYBG 3SK6A 2EE1A 1SYFA 5KYLA 1HTPA 4CJ0B 3IAYA 1TKWB 3MFYA 3EJIA 3TRZA 3GTKB 2ES2A 4OO1G 3KJOA 2R7ZH 2L12A 1STGA 3N52A 5EQ0A 4K2LA 2YTYA 4C3HG 4A3EB 3A7LA 3CC4A 2VW9A 1EYCA 3MA2B 3K0YA 4K5VA 5JVG3 4L5SA 4GKJQ 2MNAA 4TRDA 4A3LG 3OIQA 2DGYA 4BBRG 3A5ZB 5FLMG 2KVMA 1PYSB 4TQUS 3PUXA 1BVSA 3I4LA 1EIYB 3J7YW 3OSOA 1MSHA 5HY6A 1AP0A 5M3FB 5EJWA 1LTTD 3UE0A 5I2YA 4DR4Q 3DM3A 3CW2C 4DV3Q 1JB7A 4QF4A 4GOPB 1PFNA 3I55A 4KV6A 5A35A 4R4QA 5JPMC 3L3OC 4DKAC 3E5SA 4DAMA 1GXDC 5FJ8H 3QR8A 2SDFA 2PI2A 2R92G 3DMUA 2SNMA 4A3MH 1V1QA 1VF7A 3E6ZX 4KLKA 4LUOA 2ICIA 4C3JH 2XRSD 1EEID 2K5HA 3S2DH 1FNVA 1PRTD 2L5TA 2F0UA 2E2HH 2A6HC 4OWXB 1RODA 4P73A 4Y52H 3GTJB 2XN9C 1WD1A 1SROA 4R1JA 4C3HB 2UXCQ 1A62A 1EU3A 4A4IA 1F2YA 1LO5D 4QMGA 1SBBB 4OHJA 2JA5G 2F0MA 1Y69U 3QIAA 1L1OB 1JWMD 1DXMA 5ISRA 4JI0L 3K5NA 3E9IA 5IWAQ 4BA2I 4LWCA 1PYBA 2UXCL 4LFBQ 4OGQC 1HR0W 2WAQB 3HGBA 2VUMG 1QNKA 1AFPA 2F0TA 2QF7A 3PO3G 1X3QA 3S2HH 5IWAL 5CV7A 2PZUA 3AFPA 2H4OA 1CZWA 3CKIB 2VB3X 3LWEA 1HA5A 5GAGC 4ZYSA 3FMCA 1HTLD 5LMUL 1BOSA 1YHBA 1PFMA 2GVBA 3I70A 1Y1VB 4XT3B 3OW2A 1GUWA 3X3MA 3SR1A 4MN3A 5FOBB 2F0GA 1LTRD 3A55A 3FDTA 1EQQA 2K04A 1DONA 3I4MG 1JCKB 1Y8PB 4DV6Q 4G7ZC 4PZ8A 4IPDA 3IL8A 1EY8A 1YHQA 4LF9L 4FF1A 2CH4A 4A3DB 2Y0SG 4EVOA 3ULLA 3T51B 3S1MB 3D3RA 1ILPA 3S1MH 4K6DA 2A68C 2AHOB 1HZ9A 1BBXC 1B4OA 2K75A 5E4WC 2BA0A 5C44H 1H9RA 2CHBD 1TWAH 4KJNA 4O1NA 1ZKOA 1ASYA 3CRKC 1EWCA 4JBMA 3GD7A 2VUMH 4IALA 3K5LA 2PI2E 5KYIA 1KXLA 5AJ3L 2F0WA 4NP5A 1C4QA 2EQSA 1Y8NB 4YCUA 3F1ZA 1SE4A 5C3EH 3HS0C 4YIJA 2HHHQ 2JQOA 3R2IA 4B3MQ 1DD2A 2EDGA 3P7JA 3SVMA 2EZVA 3G6JB 2B2WC 1VMPA 3NE5B 2ZM6L 4NXML 4DR6L 5FK9C 1EUJA 2ENBA 2TMPA 2O2LD 1YJWA 2XGTA 5M5XB 4H0LC 1JJGA 2EYHA 3J81i 3CCEA 1CSPA 1SYCA 3EVQA 1KD1C 1H95A 2FHTA 2YYZA 2ZM6Q 4DR1Q 3ITPA 4NXMQ 2L1BA 1SFOB 2NVYB 2KCCA 1F9RA 3I4NG 5CV6A 3H3VI 1GHJA 1E2ZA 3MXNA 2CFMA 2J4XA 5C0XJ 1SE8A 4XQQA 1N33L 3KLWA 2PPBC 2L4NA 3C3LA 3SHLA 2VNUD 1A8VA 3VDYA 1S4ZA 2HD3A 1QVCA 5I4DA 2CWPA 4JW0A 1VQKA 3BJUA 1N33Q 4OIKA 1E7ZA 3FKIG 1QNUA 4BXXH 1A0IA 4CDCC 5BN4A 3Q24A 5KRUA 3HOVH 1JT8A 1CQFA 3NTKA 4A93G 2CW0D 5NUCA 3NBHB 1NMGA 3TP7A 3EN2A 1SYDA 3J7AF 2E2HB 1TR5A 4HN7A 2V4DA 4LF6Q 1D7QA 4LF8Q 3H0GB 2A5HA 2WB1G 3EROA 4C3IG 4YHHL 1XTDA 1C0AA 4TVAB 3KUPA 4LUVA 3SXHA 1KAWA 1EY4A 4Q0FA 5IP7G 2UU9L 5C4XG 3FHWA 4B3RL 4RKLA 4BA1I 4IFDI 2E2IB 1NCVA 3BVMA 5L37A 3PCOB 3AYHB 4K0KQ 2GN5A 2VZAA 3M85A 3J81c 3NQIA 5LL6S 1Y1WG 2CCZA 1PZID 4H44C 2Z4HA 3NELA 4JBKA 1DGSA 3U58A 2BE5D 2PW7A 1NSNS 1MHWC 1N9WA 3IFTA 1QUQB 3J80c 4A3KG 4BY1G 1QVFA 1EIGA 1PH2A 2IPKD 5IGFA 2XVSA 1PHJA 1BBWA 2VQFQ 1EIFA 4IPGA 1PH3A 4IPCA 4P71A 4LUZA 4QL5A 3T1HQ 4LK1C 4HJAA 2OF1A 4RHRA 3GTGB 2VS1A 5C4JB 5FLXE 3AEVA 1XPRA 1LT5D 1CTMA 3RLNA 3I90A 2XTIA 3GTMH 1D6EC 4DK3C 4F8MA 1VQ4A 2EYPA 3GDEA 3OTOL 3T13A 1O80A 4HCSA 3T1HL 3VR2A 3J81L 3J7AV 2E2JB 3QWNA 1SXTA 3R93A 2F0PA 5JJKA 1LLRD 4JI5Q 1IBKL 2FMCA 4PZ7A 2IHEA 1WVLA 3MTSA 3CCLA 2LY7A 1PTOD 2WKDA 2Q2TA 4U68A 4A3KH 4R4TA 1HNXL 1KDBA 4NB3A 1M90C 1VCIA 1NAPA 3KBXA 3KBGA 2DJFC 2HDMA 2HUGA 2CQOA 4LFCL 1F77A 2E74C 3TS0A 3VYUA 2QW7A 3VA7A 1NE3A 3QO2A 2LS01 2F0IA 2UXBL 3CCRA 4V0BA 4RA8A 1UE6A 1JORA 4K6LA 2HQEA 2MHVA 3ERSX 1DJRD 1XNQQ 4M8AA 4A3BB 1QB5D 2RDGA 4FDBA 4AQYQ 3R2TA 4PMBA 3TQYA 5D3DA 1Z47A 4DGZA 5E7NA 3S1RB 1O7IA 1WTHA 4MIUA 4MTNA 2J0TD 1PDQA 5IYBH 1X3GA 4DK0A 3M7GA 4FP5D 3JC66 1JC7A 1V8QA 5D14A 3EA6A 2KQ3A 1YBYA 1SJHD 1HFNA 1SYBA 2RVLA 2EYFA 4M1UB 1H9SA 3CU7A 2B2YC 1FNUA 2OTLA 3H3VH 4L5RC 1UUPA 5IP9G 1GOZA 3S9WA 1B7YB 1NY4A 3HOZG 1HNZL 5C0XI 1WCMB 4S3SA 2PCFB 1AZQA 1EY0A 1PTOC 2AWNA 2UXDL 2K50A 1SYGA 4DAYA 2UUBQ 1PH4A 4CKEA 3CC2A 1KTKA 4J15A 4GKKQ 2N55A 3E0EA 2K4KA 1QVGA 3I3CA 1IYUA 1KQSA 3FPPA 3MEHA 5IOCA 2EXDA 4PMCA 4A76A 5C5MA 3DLLA 4A3CG 3S14B 1QOHA 1OXSC 2UUCQ 1IL2A 5JJLA 3A8JE 3D6WA 3MXPA 2NN6H 1VQAA 2WB1E 3RNUA 3JAMi 2DY7A 3T16A 3FKIB 3G6EA 2ATWA 4DR5Q 1B9NA 1I4HA 1XJVA 3HEJA 4ODGA 4QUCA 3VYRA 2IX0A 2EPBA 4YWKA 1TWGB 4OXPA 1STYA 2NVXH 3S1NB 4Q5VA 3UDXA 1HUMA 3PO2G 1PMRA 4IO9A 3CMAA 1BKBA 1WYDA 1HNWQ 1RD9D 1KRTA 1EQVA 2R93H 4X3KA 2OCEA 3HOYH 4EX5A 3K5MA 1FGBD 4JI3Q 4KI0A 3PUYA 1BXTA 4LF9Q 5IYCH 4R4OA 3S1NH 3MC0B 5FKAC 3LNNA 1D1IA 1PH5A 4C1NK 1I6HB 5C6AA 1ENCA 1BCPB 1X3FA 2F4VQ 4HJ9A 2PQAA 5IGCA 4DNRB 2B29A 1U9RA 3VR6A 2WKCA 4PMWA 1QWYA 2NVQB 2NB0A 2NYZD 1STEA 1VQOA 5A2QE 5LL6X 4DV4L 3F2UA 2PYKA 3TP5A 2N49A 4B08A 1EY7A 2MPMA 2Y0SB 3M4PA 3PUZA 2SEBD 4HEDA 2Z0SA 1NR4A 5GQOA 3H91A 3CQZH 2A8VA 2HQLA 1EL0A 4H02A 1D1KA 1LYLA 2I5LX 2QKIC 4KY6A 4ZKBB 5CMDA 2HHHL 1SNMA 4JYAQ 4IFDH 4DF7A 4BBSB 2UUAQ 2F0KA 1UAPA 3T53B 2K5WA 2K5QA 4KN4C 3TBIB 3V05A 2F0OA 1M4VA 2UUAL 2B63G 2ZJPA 2A68D 3D4WA 4LW1A 3CCSA 2VQEQ 3I8ZA 4X65L 3MWYW 1R4PB 1VMCA 1Y8OB 2JEBI 1MJEA 2QEJC 4L6TB 3QB3A 2KEDA 2ZJQA 1W6KA 3SK5A 5IGDA 3BVGA 4X65Q 1L0XB 1SE2A 4G57A 4A3MB 4ZUJA 1WTXA 1K73C 1GHKA 3S1RH 4KTAA 1LT3D 3C1EA 2CW0C 1C9OA 2IHFA 3GV6A 4A3GB 1DZ1A 3E9HA 1MI2A 1O7ZA 4YWMA 1D5MC 1QJOA 3HOZB 5BR8Q 4R8IA 4DV7Q 4DAPA 4IUTA 2KECA 5M9OA 1SLJA 2E5LQ 4CHTB 1I94L 1ENAA 3HOYG 2F0VA 2JA5B 5DM73 1SNQA 4LF6L 2PQAB 5GAEC 3M4QA 3L7ZC 1SR3A 1CKOA 3U4VA 1STBA 2HIXA 1IBML 2ICEC 3A8KE 2JA7B 4WORA 4RGTA 2LSSA 4PV1C 4ZUIA 1F9SA 2F3WA 2N8NA 2ZTEA 2FMMA 5EBDA 1G6ZA 4I65A 1MJCA 3KF8A 1B9MA 1F2MA 3CRLC 3PGZA 4DK6C 1V43A 2F0JA 5CBEE 5T1GA 4RGMA 4HJ8A 2K05A 4NXNL 5CV8A 5C0XG 3J81E 1Q8IA 1I5FA 1LT4D 1K8OA 2QCPX 1W3SA 1ET9A 1FL0A 4WJ4A 4K2KA 2ZJRA 2G9DA 5DM63 2VB2X 1H9MA 4IFDJ 1RJTA 4IZ8A 2KHIA 1A15A 5CR3A 4XQNA 3I73A 1U4RA 4A93H 4CBVA 1D5ZC 1AN8A 1TS4A 1CT1D 1XMOL 2QDBA 4U673 1VDZA 2A1AA 3RLFA 4TSSA 4BBRB 3CCVA 4N9PA 3ZJYC 3VYSA 2HIVA 4IUPA 5LHY1 1MD2D 2K7VA 3BZCA 3T4AC 1S40A 1FYCA 1XMQL 4C2MB 1D8LA 4DV1L 1S5ED 2WFWA 1KHIA 5IGBA 4IQZA 5IIFA 3I4MH 1TS2A 4A3DH 3NHHA 2VUMB 3V2TA 4DR3L 2M2LA 4ZCKA 2D0PA 2JA8G 1K9MC 1Q3LA 1RL2A 3K80C 4DR7L 2Z6KA 3H6MA 1X55A 4IUUA 1VQ8A 5HGQA 2G5DA 1IKMA 4N8X1 4KD4A 4IOAA 4JBWA 1N32L 3GTQH 4P75A 5LMNW 1S72A 4DNIA 3LWUA 1JOQA 1JE4A 1FJGL 2D0OA 1XTCD 2E2DC 4BWGB 4BY1H 5J3BA 1JOKA 5CV5A 3TZDA 4ULLA 4LFCQ 3VR3A 5COYA 3H0GH 2RDHA 4L63B 3M4OB 3OYYA 3OIPA 1RHPA 3NTIA 4A3JG 3RZDB 4K14A 1E2WA 4XYQA 1VQNA 1DM0B 3EFXD 3RUZA 3ULPA 1B53A 1VQ6A 3HOWG 3HOXB 1IZ6A 4QIWB 3SK8A 5C4XB 1C8CA 1EWIA 2AKWB 1EY9A 3OWEB 4P2CB 1VQBA 3J80L 1I4QA 2G9HD 2K14A 3FP9A 4C1NI 3T1YL 3K5OA 1ET6A 3QOJA 1Y1WB 3MEFA 1CZGA 4UDUC 3UE1A 1S5FD
chains in the Genus database with same CATH topology
4KKUA 2H1EA 1A2UA 2KA7A 1TU2B 3N6RA 1XYIA 1U4MA 3GQBA 5CGKA 2A69D 5CV4A 3Q23A 5HURA 1J9OA 3PV0A 2B2VC 4BS9A 5IGEA 3D4DA 4DAVA 2NUCA 1OXTA 1EEFD 4K5XA 2JYOA 2NZ1D 3VA5A 1EY5A 2PZTA 4HCEA 5BN3A 1LTID 4XDXA 1BF4A 2F0EA 3R8BA 1BO0A 1X3PA 2D62A 2B2UA 3Q6SA 1B3AA 1DOMA 1PLFA 1H9JA 1TVXA 1B50A 2NVTB 4OO1I 5JJZA 1BR9A 2B2TC 3DWPA 2M00A 1PTOH 1I4PA 3O13A 4PNYA 2BE5C 3GTPB 1VF5C 2F0DA 1A3TA 2D9UA 1HXYD 5JEAJ 1CM9A 1Q1BA 1TY2A 3SE0A 2MJ8A 3OOCA 5C4ZA 1M8AA 2I46A 1TWCB 5EKLA 3K59A 3C46A 1CHPD 4XT1B 4NW2A 4GZYC 2PNRC 2X6GA 5EKIA 1F9PA 1PRTB 4RHSA 2L11A 1LTGD 3TP8A 1XXGA 2RQXA 3Q22A 1Z7TA 3U9OA 2RBMA 5ELCA 1DOKA 5KEEA 2B2YA 1EY6A 1SE3A 5I2XA 1A2TA 3W2DA 2AWOA 1EOTA 1LT6D 2A6ED 4OO1H 1YNND 3RD4A 1PTOB 4N9TA 1U4LA 3TZUA 2LFNA 1KNEA 4BY7B 5M5YB 1EIHA 4NKLA 5G3LD 1G8ZD 2A6EC 3ERQA 1B1ZA 2EY6A 2GA4B 4C3JB 2O5IC 4HR7B 3BYYB 1TT2A 3K7AB 2PO4A 1STAA 3PIP3 5JEAG 4XXEA 4X3UA 1RF2D 1MGSA 1O78A 1KNAA 2AQ1B 5EPJA 1OXXK 1EYAA 2R7ZB 4HTHA 5ELEA 1Q1EA 1UNSA 2BOSA 1GUSA 3DUZA 3FVQA 2N88A 3A7AB 1GUGA 3M7NA 2NTTA 1JOOA 5JOBA 4C56C 5I9PA 3MHBA 5A2QL 3WDNA 1H9SB 1W6JA 2I07B 2A73B 4G4KA 1QILA 5I6WA 1BCPC 5EBCA 4ZQ3A 1ILQA 2OXPA 3PUWA 4C3IB 3HKZB 4WFN3 1BQQT 2EYOA 2HCCA 4ZAIA 3GP7A 1ML0D 3NSWA 1ONLA 1SEBD 4KHVA 5CORA 2B8FA 3SK4A 2F0NA 3I4MB 5FO7B 4C3JG 1WTWA 1GJXA 1DCZA 1V1PA 1UEAB 3R3OA 3HRZC 3TMEA 1Q90A 3DM1A 2FJ2A 4KKTA 1S5DD 1EU4A 3V96A 3K57A 1STHA 3TN2A 2B2WA 3D6CA 1IW7C 1I3QB 3H09A 2X69A 2RA4A 1F2LA 4EQOA 1D5XC 1JQYD 1OXUA 3MZ5A 1D2BA 4BY1B 3DHQA 3D4RA 1PTOF 3GTMB 2E76C 5J39A 3S16B 4K5WA 3JAME 1SJED 1TWFB 3PMFA 3VR4A 3BDLA 2B2TA 5K36G 1AW7A 4V190 3H3VC 1R9TB 3WOEA 4XTCS 5EKKA 4FF2A 3BZDB 1AZPA 2ZXOA 1BDOA 1KDCA 3GTOB 4XIGS 4FNFA 2IL8A 2L0CA 4A93B 2E75C 2RKSA 3QJYA 4Y7NB 2SOBA 1Z6HA 1HFGA 2XWBB 5KIXA 1XWEA 2RSNA 4UAIA 1ENFA 2WINB 1EWHA 3OWFA 1YNNC 2JE6I 4KJOA 3S2HB 1QG7A 1LABA 3PUVA 3KLSX 1NUCA 1I4GA 2BA1A 1F2ZA 4FXDA 1XX8A 3NWSA 2KUMA 4RH6A 4IURA 3OMGA 3KLRA 3P1HA 4XYOA 2EVBA 1LACA 2SNSA 3U9SA 2AQ3B 2WACA 2EJMA 1WTVA 4R8NA 3K6OA 2FINB 5D65A 2KJXA 3PO3B 2EXZA 1V1PB 1BCPF 1PYWD 2DNEA 2CVRA 1E0BA 2JA6B 3DEPA 2CQAA 1EYDA 2A74C 2RSOA 3RZOB 1LTAD 2WIIB 3I91A 2EY2A 2ZT9C 1SSOA 1OO9B 1KDAA 1TWAB 5AFWA 1ZEQX 1PZJD 3NWTA 4FF3A 3SDZA 4DU9A 4A3JB 3BDOA 1JR0D 5C3EB 2ZXPA 2F0LA 3A54A 4DNTB 3BS1A 5IGGA 4E6IA 5FO9B 3AU7A 4Z9CB 3NUCA 4KHZA 1I50B 4WRDA 3MXGA 5I9OA 1O7YA 3PO2B 2BDOA 2F0SA 1I6VC 3AMUA 2F3VA 4NMZA 4WJWA 2K32A 1H9KA 4F87A 4ID6A 3HG9A 1SDFA 5CC4A 1A6XA 3LX0A 4OL7A 4QB4A 2NN6I 2F1MA 2OEOA 3GTQB 1ICWA 1SMYC 5E4XA 5JAVA 1OXVA 3OMCA 4K8IA 1RTOA 1YNJC 1V1OA 1RDPD 2BDNA 4B9WA 2KEEA 1KABA 3BDCA 1I4XA 4RWSC 1ZYRC 2F0HA 5JVH3 3QOLA 5C0XH 1A3VA 4KD3A 5M3MB 3K58A 3BG3A 1KLUD 2B2UC 2D2CC 2C5CA 3H94A 1HRJA 1C48A 2EY1A 3NPPA 1K83B 1WTOA 4QCLA 2IX3A 5KGUA 1PFBA 4G7HC 2KHSA 2C9OA 2EYJA 4DFAA 4DK1A 3MAQA 4CGYB 2AQ2B 5M5WB 1MSGA 3FRPB 2LMCB 1HHVA 4H13C 2Q8TA 3SEBA 3QG1A 4FVMA 3TSSA 1T5EA 1TS3A 4H7BA 2RDFA 5CBAE 1SNCA 3HOUB 1T5XD 5IT9L 1LTBD 2YU9B 2EYLA 2J7ZA 1FNWA 1CFMA 1YNJD 4ZRZA 3G7LA 5K5PA 2IWHA 3NQTA 5J1ZA 3GO5A 4J1MA 5ELBA 3Q0AA 3JAML 4PQXA 4DN4M 2IJ0A 2NN6G 4LMQD 3MVVA 3NBHA 1QE6A 3IKJA 5KNCA 4EQPA 5CYUA 1CA6A 3I4NB 4A3IB 1QCBD 3NTHA 1CK1A 2K01A 2XIWA 1WTPA 3FPUB 1TY0A 5K36H 4HSPA 2ID0A 1STNA 5E1FA 4F7XA 1JB3A 1TIID 2HCIA 4DXFA 2LKVA 4LJZC 3MFGA 3OHXC 5IT9E 2R6GA 4X3TA 4IUVA 4DA2A 3VYTA 3DWAA 4ILWA 1HQMC 1NR2A 2IT1A 1WTRA 5EPLA 4HMIA 1G291 3DXJC 3E0JA 3HZXA 3W3AA 4ABNA 1F9QA 1HPCA 1B2TA 1LTSD 2JEAI 3UI2A 2XRQD 4FXKC 4HMJA 4IN3A 5FO8B 4MHEA 1U4PA 2K5DA 5J22A 1B44D 3X3NA 1PRTF 3DWQA 3C1FA 2WB1B 1IL8A 4ME5A 3ZYYX 4IFDG 2JA8B 3A56A 4RCNA 4EGVA 4ZKCB 1G2TA 1RKNA 1TS5A 2JSOA 3BVZA 2EJFC 2WP8J 2X6LA 2PW5A 4FO2A 1KLGD 3A8IE 3VR5A 4CKBA 1RCVD 2IW3A 1MBYA 5DNFA 1KAAA 3ND8A 3D31A 2PMZB 5IODA 4TKOB 1EZ6A 1GUNA 1EFID 5FLXL 2WV6D 2PZWA 2M9VA 1GUOA 2K28A 4JK1C 2B63B 1CQVA 5EPKA 1FR3A 2R61A 3NK9A 1HCZA 4IUQA 4J8QA 2PQEA 3T56B 1JICA 3KK7A 1LV9A 3NBIA 5C4HA 3OW7A 4A3FB 3D8GA 2B2VA 1JWSD 5JPNC 4XQJA 2EOTA 3HP3A 1PRTC 4KY5A 1BCPD 3WOFA 2B8GA 2KOLA 1HQRD 4A3KB 1DYQA 2QILA 1WTQA 3ND9A 4FF4A 2DN8A 2KCNA 5TSSA 2F4IA 3P20A 2Q8RE 1L0YB 2Q8IB 2NBFA 1EQTA 1TWHB 3OPOA 4B9XA 2EJGC 4RGNA 5KNBA 2B39A 4NDXA 5HGTA 3I72A 2F03A 1SNPA 4G7OC 5I6YA 5C44B 3DEOA 4F88A 2AUKA 5C3XA 2NVXB 2ZXRA 2MUYA 2VXWA 4OIJA 2D5DA 2F0QA 2HDLA 3PIO3 1IKLA 1PXUA 4LAAA 4QUFA 3C2PA 2O4XA 1Q12A 2EY5A 2DNCA 2FFKB 2IX1A 3RMHA 3EQLC 4AYBB 1IW7D 2L9HA 5JEAH 2JXMB 4ZK9B 2K33A 4R9WA 1DOLA 4HAEA 1JWUD 3BYTB 2AUJD 3IFDA 4RCOA 1X32A 4FXGC 2DY8A 4RGOS 2R93B 2R92B 1BNZA 3KLSA 2MGSA 3URYA 1A3UA 3HOVB 3NXWA 3HOWB 2BCOA 1AEXA 3CHBD 2Z4IA 4CJ2C 2R3ZA 1WD0A 1HUNA 3L9AX 4CKCA 3HOYB 1EZ8A 4X3SA 4IUNA 1ZYRD 2NTSA 1S5CD 1BUVT 1ZXTA 1SNDA 2TSSA 5T1IA 1S5BD 4HSVA 3TP6A 2A6HD 2NWGA 3GTLB 3AB9A 2MP1A 2K1BA 2JP1A 5F2DA 4I7ZC 4EQNA 3FEWX 1E2VA 4DXGA 1SAPA 5CV9A 2XSCA 4K8JA 4RKBA 1PZKD 5C5LA 1R4QB 4O42A 2L55A 2EYMA 4RFBA 4ZLTF 4FYDA 1J8IA 5DEHA 1G91A 1II3A 1SNOA 3NP8A 5EGTA 5ELFA 1TQOA 1CHQD 2Z8LA 1ESRA 1SYEA 1CA5A 1FD7D 3S17B 4KMUC 2A69C 4KY7A 3P75A 3GV3A 4CJ1B 2Z1CA 3CQZB 3J80E 1SMYD 4J6HA 3M3YB 2XNAC 4KN7C 3TDQA 3ONAB 5G3LF 5BN5A 1IYVA 2O5JC 5DAUA 1G2SA 5KNDA 2K03A 5E3FA 2K6AA 1K8MA 1RTNA 3S15B 4L8JA 2XWJB 1HA6A 1I4RA 5D3IB 1ESFA 1GUTA 4KK7A 3S1QB 1CI3M 2OT2A 5ELDA 3S2DB 1IHZA 2F0FA 4KKSA 1O7LA 3MXUA 4RAUC 3M4YA 5C3WA 3SK6A 2EE1A 1SYFA 5KYLA 1HTPA 4CJ0B 3IAYA 1TKWB 3MFYA 3EJIA 3GTKB 4OO1G 2L12A 1STGA 3N52A 5EQ0A 4K2LA 4C3HG 4A3EB 3A7LA 1EYCA 3MA2B 3K0YA 4K5VA 5JVG3 4TRDA 3OIQA 2KVMA 4TQUS 3PUXA 3I4LA 3J7YW 3OSOA 1MSHA 1AP0A 5M3FB 5EJWA 1LTTD 5I2YA 4QF4A 1PFNA 4KV6A 5A35A 5JPMC 3L3OC 3E5SA 1GXDC 2SDFA 3DMUA 2SNMA 1VF7A 3E6ZX 2ICIA 2XRSD 1EEID 1FNVA 1PRTD 2L5TA 2F0UA 2A6HC 1RODA 3GTJB 2XN9C 1WD1A 4C3HB 1EU3A 1F2YA 1LO5D 4QMGA 1SBBB 4OHJA 2F0MA 1Y69U 3QIAA 1JWMD 1DXMA 5ISRA 3K5NA 4BA2I 4OGQC 2WAQB 3HGBA 1QNKA 1AFPA 2F0TA 2QF7A 1X3QA 5CV7A 2PZUA 2H4OA 1CZWA 3CKIB 2VB3X 3LWEA 1HA5A 4ZYSA 3FMCA 1HTLD 1BOSA 1PFMA 3I70A 1Y1VB 4XT3B 1GUWA 3X3MA 3SR1A 4MN3A 5FOBB 2F0GA 1LTRD 3A55A 3FDTA 2K04A 1DONA 1JCKB 1Y8PB 4G7ZC 3IL8A 1EY8A 4FF1A 4A3DB 4EVOA 3T51B 3S1MB 3D3RA 1ILPA 4K6DA 2A68C 1BBXC 1B4OA 5E4WC 2BA0A 1H9RA 2CHBD 4KJNA 4O1NA 1ZKOA 3CRKC 1EWCA 3GD7A 4IALA 3K5LA 5KYIA 2F0WA 4NP5A 1C4QA 1Y8NB 1SE4A 3HS0C 4YIJA 1DD2A 3R2IA 2EDGA 3P7JA 3SVMA 2EZVA 3G6JB 2B2WC 1VMPA 3NE5B 5FK9C 2ENBA 2TMPA 2O2LD 5M5XB 4H0LC 2EYHA 1SYCA 3EVQA 2FHTA 2YYZA 3ITPA 2L1BA 1SFOB 2NVYB 2KCCA 1F9RA 5CV6A 1GHJA 1E2ZA 3MXNA 2J4XA 5C0XJ 4XQQA 2PPBC 2L4NA 3C3LA 3SHLA 2VNUD 1S4ZA 5I4DA 4OIKA 1QNUA 5BN4A 3Q24A 5KRUA 1CQFA 3NTKA 2CW0D 5NUCA 3TP7A 1SYDA 3J7AF 2E2HB 1TR5A 4HN7A 2V4DA 3H0GB 2A5HA 3EROA 4C3IG 3KUPA 3SXHA 1EY4A 4Q0FA 4RKLA 4BA1I 4IFDI 2E2IB 1NCVA 3BVMA 3M85A 3NQIA 5LL6S 1PZID 4H44C 2Z4HA 2BE5D 2PW7A 1NSNS 3IFTA 1EIGA 2IPKD 5IGFA 2XVSA 4LK1C 2OF1A 4RHRA 3GTGB 5C4JB 5FLXE 1LT5D 1CTMA 3I90A 1D6EC 4F8MA 2EYPA 3T13A 1O80A 4HCSA 3VR2A 3J81L 3J7AV 2E2JB 3QWNA 1SXTA 3R93A 2F0PA 1LLRD 2FMCA 1WVLA 3MTSA 2LY7A 1PTOD 2WKDA 4U68A 1KDBA 1VCIA 1NAPA 3KBXA 3KBGA 2HDMA 2HUGA 1F77A 2E74C 3VYUA 3VA7A 3QO2A 2LS01 2F0IA 4V0BA 4RA8A 1JORA 4K6LA 2HQEA 2MHVA 1DJRD 4M8AA 4A3BB 1QB5D 2RDGA 3R2TA 4PMBA 5D3DA 1Z47A 4DGZA 3S1RB 4MIUA 2J0TD 1PDQA 4DK0A 3M7GA 4FP5D 1JC7A 1V8QA 5D14A 3EA6A 2KQ3A 1SJHD 1HFNA 1SYBA 2RVLA 2EYFA 4M1UB 1H9SA 3CU7A 2B2YC 1FNUA 1UUPA 1GOZA 3S9WA 5C0XI 1WCMB 4S3SA 2PCFB 1AZQA 1EY0A 1PTOC 2AWNA 1SYGA 4DAYA 4CKEA 1KTKA 2N55A 3I3CA 1IYUA 3FPPA 3MEHA 5IOCA 4PMCA 5C5MA 3S14B 1QOHA 1OXSC 3A8JE 3D6WA 3MXPA 2NN6H 2DY7A 3T16A 3FKIB 1B9NA 1I4HA 3HEJA 4ODGA 4QUCA 3VYRA 2IX0A 2EPBA 1TWGB 1STYA 3S1NB 4Q5VA 1HUMA 1PMRA 1RD9D 1EQVA 4X3KA 3K5MA 1FGBD 4KI0A 3PUYA 1BXTA 3MC0B 5FKAC 3LNNA 1D1IA 4C1NK 1I6HB 5C6AA 1ENCA 1BCPB 5IGCA 4DNRB 1U9RA 3VR6A 2WKCA 4PMWA 1QWYA 2NVQB 2NB0A 2NYZD 1STEA 5A2QE 5LL6X 3F2UA 2PYKA 3TP5A 4B08A 1EY7A 2MPMA 2Y0SB 3PUZA 2SEBD 4HEDA 1NR4A 3H91A 1EL0A 4ZKBB 1D1KA 2QKIC 4KY6A 5CMDA 1SNMA 4IFDH 4DF7A 4BBSB 2F0KA 1UAPA 3T53B 2K5WA 2K5QA 4KN4C 3TBIB 3V05A 2F0OA 1M4VA 2A68D 3D4WA 3I8ZA 3MWYW 1R4PB 1VMCA 1Y8OB 2JEBI 2QEJC 3QB3A 4L6TB 2KEDA 1W6KA 3SK5A 5IGDA 3BVGA 1L0XB 1SE2A 4G57A 4A3MB 4ZUJA 1WTXA 1GHKA 4KTAA 1LT3D 3C1EA 2CW0C 3GV6A 4A3GB 1DZ1A 1MI2A 1O7ZA 1D5MC 1QJOA 3HOZB 4R8IA 4DAPA 4IUTA 2KECA 5M9OA 4CHTB 1ENAA 2F0VA 2JA5B 5DM73 1SNQA 3L7ZC 1STBA 2ICEC 3A8KE 2JA7B 4WORA 4RGTA 4PV1C 4ZUIA 1F9SA 2F3WA 2FMMA 5EBDA 1G6ZA 4I65A 3KF8A 1B9MA 1F2MA 3CRLC 1V43A 2F0JA 5CBEE 5T1GA 4RGMA 2K05A 5CV8A 5C0XG 3J81E 1Q8IA 1LT4D 1K8OA 2QCPX 1ET9A 4K2KA 2G9DA 5DM63 2VB2X 1H9MA 4IFDJ 1RJTA 4IZ8A 5CR3A 1A15A 4XQNA 3I73A 1U4RA 4CBVA 1D5ZC 1AN8A 1TS4A 1CT1D 2QDBA 4U673 1VDZA 3RLFA 4TSSA 4BBRB 4N9PA 3VYSA 4IUPA 5LHY1 1MD2D 2K7VA 3T4AC 1FYCA 4C2MB 1S5ED 5IGBA 4IQZA 5IIFA 1TS2A 3NHHA 2VUMB 3V2TA 2M2LA 1Q3LA 3H6MA 4IUUA 1IKMA 4KD4A 4JBWA 3LWUA 1JOQA 1JE4A 1XTCD 2E2DC 4BWGB 1JOKA 5CV5A 3TZDA 4ULLA 3VR3A 5COYA 2RDHA 4L63B 3M4OB 3OIPA 1RHPA 3NTIA 3RZDB 4K14A 1E2WA 4XYQA 1DM0B 3EFXD 3RUZA 1B53A 3HOXB 4QIWB 3SK8A 5C4XB 1C8CA 1EY9A 3OWEB 4P2CB 3J80L 1I4QA 2G9HD 4C1NI 3K5OA 1ET6A 3QOJA 1Y1WB 1CZGA 4UDUC 1S5FD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKD A;  2WKC A; 
#chains in the Genus database with same CATH topology
 4KKU A;  1A63 A;  2H1E A;  1A2U A;  4JI1 L;  1J5E Q;  2JA7 H;  2KA7 A;  1TU2 B;  3N6R A;  1XYI A;  1U4M A;  3GQB A;  1HNZ Q;  5CGK A;  2A69 D;  5CV4 A;  3Q23 A;  3U4Z A;  4DV2 Q;  5HUR A;  1J5E L;  1J9O A;  4UY8 C;  1HZC A;  4POF A;  4GKK L;  3PV0 A;  2B2V C;  5IE8 A;  1K0R A;  3GTO H;  4BS9 A;  5IGE A;  3D4D A;  4DAV A;  2NUC A;  1OXT A;  1EEF D;  4K5X A;  3F2B A;  2JYO A;  4A3G G;  2NZ1 D;  3VA5 A;  1EY5 A;  3S14 H;  2PZT A;  4HCE A;  5BN3 A;  1LTI D;  4XDX A;  1BF4 A;  2F0E A;  3CCJ A;  3R8B A;  1WJJ A;  2A19 A;  4A3B H;  1BO0 A;  1X3P A;  2UUC L;  2D62 A;  2B2U A;  3Q6S A;  1B3A A;  4BY7 G;  2GVA A;  1DOM A;  3EBE A;  1PLF A;  1Q86 C;  1QUQ A;  1H9J A;  1TVX A;  3HOU H;  1B50 A;  2NVT B;  4OO1 I;  5JJZ A;  1BR9 A;  2B2T C;  3DWP A;  2M00 A;  1PTO H;  1I4P A;  1E1O A;  3O13 A;  4I7A A;  4PNY A;  2BE5 C;  3M9B A;  3H15 A;  3GTP B;  1LUZ A;  5JJI A;  1VF5 C;  2F0D A;  2R92 H;  1A3T A;  2D9U A;  1HNW L;  1HXY D;  1YJN A;  5JEA J;  1CM9 A;  2HT1 A;  1Q1B A;  1QZG A;  3S24 A;  1TY2 A;  4IPH A;  3SE0 A;  4APV A;  2MJ8 A;  1VQJ A;  3OOC A;  1M8A A;  5C4Z A;  1OTC A;  2I46 A;  4WJ3 M;  1TWC B;  5EKL A;  3K59 A;  3C46 A;  1XNR L;  1CHP D;  4XT1 B;  4NW2 A;  4GZY C;  2PNR C;  2H5X A;  1Q81 C;  2X6G A;  5EKI A;  2K52 A;  1IXR A;  1F9P A;  4GN3 B;  4GNX A;  1GD7 A;  1TWF H;  1PRT B;  4A3D G;  4RHS A;  2L11 A;  1LTG D;  4HID A;  1I50 H;  3TP8 A;  4JI0 Q;  1V9P A;  1XXG A;  2RQX A;  3Q22 A;  3JAM c;  1Z7T A;  3U9O A;  2DUD A;  2RBM A;  5ELC A;  1DOK A;  5KEE A;  2B2Y A;  1EY6 A;  5DLQ E;  1SE3 A;  5I2X A;  1KRS A;  1VQ7 A;  5FLM H;  4DR6 Q;  1UE7 A;  1N36 Q;  1PFS A;  1NMF A;  1A2T A;  2JA9 A;  5M3M G;  1B3Q A;  1L1O C;  3W2D A;  2AWO A;  3F8T A;  5LMN L;  5FLX c;  3PF5 A;  4MTK A;  1PA6 A;  2OQK A;  4DR1 L;  2OWO A;  1EOT A;  1HJP A;  1LT6 D;  2A6E D;  4OO1 H;  1YNN D;  4OEL B;  3RD4 A;  2LXJ A;  1PTO B;  4N9T A;  1U4L A;  3TZU A;  2LFN A;  1KNE A;  4BY7 B;  2BH8 A;  4A3J H;  5M5Y B;  1IBL L;  1EIH A;  4NKL A;  5G3L D;  2JA5 H;  1G8Z D;  2A6E C;  4JOI A;  3ERQ A;  3GTL H;  2CWA A;  1B1Z A;  1YI2 A;  2EY6 A;  2LXK A;  2GA4 B;  4C3J B;  2O5I C;  5IYD H;  4HR7 B;  1IBL Q;  3BYY B;  1WCM H;  1TT2 A;  3K7A B;  2RCN A;  2ZTD A;  1HZB A;  2PO4 A;  1STA A;  3PIP 3;  5JEA G;  4A3G H;  1TWH H;  4XXE A;  4X3U A;  1RF2 D;  3E3X A;  4PZ6 A;  2MFI A;  1MGS A;  1O78 A;  1KNA A;  2AQ1 B;  4R4C A;  5EPJ A;  4GN5 A;  1OXX K;  4LF8 L;  1EYA A;  2R7Z B;  4HTH A;  5ELE A;  4YCW A;  4DV5 Q;  2E2I H;  4A75 A;  1YHA A;  3CD6 A;  1Q1E A;  1UNS A;  3CAM A;  4GNX B;  2BOS A;  2UU9 Q;  1NJI C;  4B3R Q;  3F2C A;  1GUS A;  1VQL A;  3DUZ A;  3FVQ A;  2N88 A;  3A7A B;  1GUG A;  3M7N A;  2NTT A;  1JOO A;  5JOB A;  4HJ7 A;  3STB C;  4C56 C;  5I9P A;  3MHB A;  4O2D A;  5A2Q L;  1YEZ A;  1P16 A;  3WDN A;  3J7A 5;  1H9S B;  3UDG A;  5IYD G;  1W6J A;  1I6H H;  2I07 B;  2A73 B;  4G4K A;  2B63 H;  1QIL A;  4KHP L;  5I6W A;  1BCP C;  5EBC A;  4ZQ3 A;  1ILQ A;  4Y7N H;  2OXP A;  3PUW A;  4C3I B;  4X62 Q;  2VQF L;  3HKZ B;  3J7Z C;  4WFN 3;  1BQQ T;  2NVQ H;  2EYO A;  1KIX A;  1CKM A;  2HCC A;  4OWT B;  4ZAI A;  4JI8 L;  3GP7 A;  1ML0 D;  4X62 L;  3NSW A;  1ONL A;  1SEB D;  4KHV A;  5COR A;  2B8F A;  3SK4 A;  4IOC A;  2F0N A;  3I4M B;  5FO7 B;  4C3J G;  2ASB A;  1WTW A;  1GJX A;  1HR0 Q;  1DCZ A;  4QIW E;  4BY7 H;  1V1P A;  4JI8 Q;  1UEA B;  3KDF A;  3R3O A;  4DAY B;  3HRZ C;  3TME A;  3HKZ G;  1Q90 A;  4A3I G;  4LFA Q;  1PV4 A;  3DM1 A;  2FJ2 A;  4KKT A;  1N8R C;  3J80 i;  1S5D D;  1EU4 A;  5GRO A;  3V96 A;  3K57 A;  1I3Q H;  1STH A;  3TN2 A;  2B2W A;  2QDL A;  3D6C A;  1IW7 C;  1Q82 C;  1I3Q B;  3H09 A;  1Q46 A;  2X69 A;  2KBN A;  2RA4 A;  1F2L A;  4EQO A;  1D5X C;  1JQY D;  1OXU A;  3CP0 A;  3MZ5 A;  3M3Y H;  1D2B A;  4BY1 B;  3DHQ A;  1Y14 B;  3D4R A;  1FJG Q;  4JI6 L;  1IYJ B;  1PTO F;  3GTM B;  4GKJ L;  2Y0S E;  3K7U C;  2E76 C;  3W1B A;  5J39 A;  3KOJ A;  3S16 B;  2E8G A;  4K5W A;  3JAM E;  1XNQ L;  1SJE D;  4GNX C;  4YWL A;  1TWF B;  4JI6 Q;  2N3S A;  3PMF A;  3VR4 A;  4LF5 L;  3BDL A;  4RMF A;  1E24 A;  2IY5 B;  2B2T A;  2K5N A;  4IJH A;  5K36 G;  1AW7 A;  3PF4 A;  4V19 0;  1X3E A;  1K8A C;  3H3V C;  4B3T Q;  1R9T B;  3UDI A;  3WOE A;  4LF5 Q;  4XTC S;  5EKK A;  3I56 A;  4FF2 A;  3BZD B;  1PH8 A;  1AZP A;  4B3T L;  4JPB W;  2ZXO A;  1BDO A;  5H1S E;  1KDC A;  4CDE C;  3GTO B;  4QY7 A;  3T1Y Q;  4XIG S;  4FNF A;  2IL8 A;  2L0C A;  4YY3 L;  3TRE A;  4A93 B;  2E75 C;  2RKS A;  2KCM A;  3GTP H;  3QJY A;  4Y7N B;  4OWW B;  4A3M G;  4YY3 Q;  2SOB A;  4A3B G;  3J81 j;  1VQC A;  3H0G G;  1Z6H A;  1HFG A;  2XWB B;  1VQM A;  5KIX A;  5GAD C;  1XWE A;  2RSN A;  4UAI A;  1ENF A;  4UP7 A;  2WIN B;  1Q8K A;  1EWH A;  3OWF A;  1YNN C;  2JE6 I;  4KJO A;  4DV2 L;  3S2H B;  1QG7 A;  1LAB A;  4QQB X;  3CCM A;  3PUV A;  3KLS X;  1NUC A;  1I4G A;  3G48 A;  2BA1 A;  1F2Z A;  4FXD A;  1XX8 A;  4OX9 L;  3NWS A;  2KUM A;  5IP9 H;  4OON A;  4RH6 A;  4IUR A;  3OMG A;  3KLR A;  3P1H A;  5EAY A;  4XYO A;  2EVB A;  1LAC A;  2JA8 H;  1AE2 A;  2SNS A;  1L2F A;  3U9S A;  1PH6 A;  3G71 A;  5LMU Q;  2AQ3 B;  4OX9 Q;  1ICF B;  4OEM B;  2WAC A;  2EJM A;  1WTV A;  4R8N A;  3K6O A;  2KJX A;  2C35 B;  2FIN B;  5D65 A;  3PO3 B;  2EXZ A;  1V1P B;  1BCP F;  5IYB G;  2I5M X;  2OQ0 A;  1VQH A;  2K5V A;  1HH2 P;  3NEM A;  1PYW D;  2WAQ G;  2DNE A;  2CVR A;  2Z9H A;  1E0B A;  2JA6 B;  4DR4 L;  3DEP A;  2CQA A;  1KC8 C;  1EYD A;  4DV3 L;  2A74 C;  2RSO A;  3RZO B;  1LTA D;  2WII B;  2QGQ A;  3I91 A;  2EY2 A;  1UWV A;  2ALY B;  1XPO A;  2ZT9 C;  1SSO A;  3K81 C;  1OO9 B;  2YTX A;  1KDA A;  1TWA B;  1WI5 A;  2CH4 W;  5AFW A;  2VL6 A;  1ZEQ X;  1PZJ D;  3NWT A;  4FF3 A;  4BBS H;  3SDZ A;  4DU9 A;  5M5Y H;  4A3J B;  3BDO A;  1QZH A;  4HIO A;  1JR0 D;  5C3E B;  2ZXP A;  2AMC B;  2F0L A;  2MO1 A;  3ULJ A;  3A54 A;  2PMZ E;  4DNT B;  3BS1 A;  5IGG A;  4E6I A;  2UXD Q;  2UUB L;  5FO9 B;  3AU7 A;  3WWV A;  4Z9C B;  3I2Z A;  3NUC A;  4DUZ L;  4KHZ A;  1I50 B;  4R4I A;  4WRD A;  3K7A H;  4JBJ A;  3MXG A;  1XNR Q;  4A3E H;  1PVO A;  5I9O A;  1O7Y A;  3PO2 B;  2BDO A;  2BH2 A;  2F0S A;  1CKN A;  3CCU A;  4JOI C;  2JN4 A;  1WFQ A;  1I6V C;  5GAH C;  1Y1V H;  3AMU A;  2F3V A;  4NMZ A;  4WJW A;  2K32 A;  5IY0 A;  4JI7 Q;  1H9K A;  4F87 A;  4ID6 A;  3HG9 A;  3A0J A;  1SDF A;  5CC4 A;  3ER0 A;  3LX0 A;  3CF5 A;  1A6X A;  4OL7 A;  4QB4 A;  2NN6 I;  2F1M A;  2OEO A;  3GTQ B;  1X54 A;  3UDF A;  1J6Q A;  4JI7 L;  1PH1 A;  3L0O A;  3PO2 H;  1ICW A;  1SMY C;  5E4X A;  1UE5 A;  1TWC H;  4P74 A;  5JAV A;  4IJL A;  3S1Q H;  1OXV A;  1EFW A;  3OMC A;  4K8I A;  1RTO A;  1YNJ C;  1V1O A;  1RDP D;  2BDN A;  4B9W A;  2Q2U A;  2KEE A;  4GLX A;  1KAB A;  3BDC A;  1TWG H;  1I4X A;  1P8L A;  4A3F H;  4O0A A;  4RWS C;  2NVT H;  3HOU G;  4ME3 A;  1B8A A;  4GLA C;  1ZYR C;  2PNH A;  2F0H A;  2KEN A;  5JVH 3;  3QOL A;  5C0X H;  1A3V A;  4KD3 A;  5M3M B;  3K58 A;  3BG3 A;  1KLU D;  2B2U C;  2D2C C;  1K3B C;  4DPG A;  2C5C A;  3KJP A;  4GOP A;  3H94 A;  1HRJ A;  1NNX A;  1JMC A;  4NPS A;  1C48 A;  2EY1 A;  2RF4 A;  3NPP A;  1K83 B;  1WTO A;  4QCL A;  2IX3 A;  5KGU A;  1PFB A;  4G7H C;  2E5L L;  2KHS A;  2C9O A;  2EYJ A;  4DFA A;  3K0X A;  4DK1 A;  4X64 L;  3MAQ A;  4CGY B;  2AQ2 B;  5M5W B;  2I0Q A;  1MSG A;  3FRP B;  2YU9 H;  3HOZ H;  4GN4 B;  2LMC B;  1HHV A;  4H13 C;  2Q8T A;  4L5Q A;  1VQI A;  4X64 Q;  2MO0 A;  4K0K L;  1K83 H;  2NVY H;  1U0L A;  3SEB A;  4JC0 A;  3QG1 A;  4FVM A;  3TSS A;  3W5O A;  3G4S A;  1T5E A;  4DR2 Q;  1TS3 A;  4H7B A;  2RDF A;  3RN2 A;  5CBA E;  1SNC A;  3HOU B;  1T5X D;  5IT9 L;  1Z9F A;  4A3E G;  1LTB D;  2YU9 B;  2EYL A;  3KF8 B;  2J7Z A;  1FNW A;  2P5Z X;  1CFM A;  1YNJ D;  1ASZ A;  1X56 A;  5ELN A;  4DR2 L;  4ZRZ A;  3G7L A;  4P72 A;  5IT9 c;  5K5P A;  1JJC B;  2IWH A;  3NQT A;  4CDF C;  1MKH A;  2R7F A;  3GO5 A;  5J1Z A;  4J1M A;  1TXY A;  4UPA A;  5ELB A;  1PH9 A;  3Q0A A;  3JAM L;  4PQX A;  4DV0 Q;  4DN4 M;  2IJ0 A;  3HOW H;  1GM5 A;  3TEH B;  2NN6 G;  3K8A A;  4RG1 A;  4LMQ D;  2ZTC A;  3MVV A;  3NBH A;  1QE6 A;  2YTV A;  3IKJ A;  5KNC A;  4EQP A;  5M5W H;  5CYU A;  1CA6 A;  4X66 L;  3I4N B;  4A3I B;  1IBK Q;  1QCB D;  3NTH A;  1CK1 A;  1EQR A;  4X66 Q;  1SFO H;  1HR0 L;  2K01 A;  5ELO A;  2XIW A;  4DV7 L;  1WTP A;  3FPU B;  2WAQ E;  4GS3 A;  1TY0 A;  1I94 Q;  4LFA L;  5K36 H;  4HSP A;  2ID0 A;  1STN A;  5E1F A;  4F7X A;  1JB3 A;  1TII D;  2HCI A;  4DXF A;  2LKV A;  4LJZ C;  3MFG A;  2RCF A;  3OHX C;  5IT9 E;  2UXB Q;  2R6G A;  3MXN B;  1L0W A;  4X3T A;  4IUV A;  4JCV E;  4DA2 A;  3EIV A;  1SRU A;  3KFU A;  3VYT A;  3DWA A;  4ILW A;  3L2P A;  1HQM C;  1NR2 A;  4AQY L;  3TS2 A;  3GTJ H;  2IT1 A;  5IYC G;  1SN8 A;  1WTR A;  5EPL A;  1N34 L;  1BBU A;  4YCV A;  4HMI A;  1G29 1;  2RHS B;  3DXJ C;  3E0J A;  2R93 G;  3S16 H;  3HZX A;  3W3A A;  4ABN A;  1K3R A;  3RZO H;  1F9Q A;  1HPC A;  1B2T A;  1LTS D;  4MNO A;  2JEA I;  3UI2 A;  2XRQ D;  4FXK C;  4HMJ A;  4IN3 A;  5FO8 B;  2QEX A;  4MHE A;  1U4P A;  1T9H A;  2K5D A;  5J22 A;  1B44 D;  3PO3 H;  3RN5 A;  5IP7 H;  3X3N A;  3PQI A;  1PRT F;  3DWQ A;  1UEB A;  2Z6B A;  2R7D A;  4JI1 Q;  1XMQ Q;  3C1F A;  2WB1 B;  3U50 C;  1IL8 A;  4ME5 A;  4C3I H;  3ZYY X;  4IFD G;  2JA8 B;  3A56 A;  1VS0 A;  4RCN A;  4EGV A;  4ZKC B;  4CDD C;  1HNX Q;  4L5T A;  1G2T A;  1RKN A;  1SMX A;  1TS5 A;  2JSO A;  1X65 A;  2B3G A;  3BVZ A;  2EJF C;  2WP8 J;  2X6L A;  2PW5 A;  1N32 Q;  4FO2 A;  5C44 G;  1KLG D;  3A8I E;  3VR5 A;  4CKB A;  1RCV D;  2IW3 A;  1MBY A;  5DNF A;  1KAA A;  4QJF A;  1CKN B;  3ND8 A;  5FJ8 G;  4GLV B;  3D31 A;  2PMZ B;  5IOD A;  4TKO B;  4JV5 L;  3BZK A;  1EZ6 A;  1GUN A;  1EFI D;  1K28 A;  5FLX L;  2WV6 D;  2PZW A;  2M9V A;  1GUO A;  2K28 A;  4JK1 C;  2B63 B;  1CQV A;  3AFQ A;  3ICE A;  4N8F A;  3CME A;  5EPK A;  1AE3 A;  3LGJ A;  1FR3 A;  2R61 A;  3NK9 A;  3Q8D A;  4JV5 Q;  3PIP A;  1HCZ A;  1VQP A;  4IUQ A;  1UE1 A;  4J8Q A;  2PQE A;  3IRB A;  3T56 B;  1JIC A;  1FVI A;  1JE5 A;  3KK7 A;  1LV9 A;  3NBI A;  5C4H A;  3OW7 A;  1GKH A;  4A3F B;  3D8G A;  2B2V A;  4UP9 A;  3HFZ B;  1JWS D;  4JI3 L;  5JPN C;  2EOT A;  3HP3 A;  4KY5 A;  1PRT C;  4XQJ A;  2L15 A;  1BCP D;  1GVP A;  1X9N A;  3WOF A;  1E1T A;  2B8G A;  4POG A;  2KOL A;  1HQR D;  4A3K B;  1DYQ A;  1CSQ A;  2R7Z G;  1YIT A;  2QIL A;  1WTQ A;  3HKZ E;  3ND9 A;  5C3E G;  4LF7 L;  4FF4 A;  2DN8 A;  2EIF A;  2V1C C;  2KCN A;  5TSS A;  1VQ9 A;  2F4I A;  3P20 A;  2Q8R E;  1RIP A;  1L0Y B;  2Q8I B;  4LF7 Q;  3KF6 B;  1MIU A;  4A3C H;  1JJ2 A;  2NBF A;  1GO3 E;  4DV4 Q;  1EQT A;  1TWH B;  3OPO A;  4A3F G;  3KDF B;  3RR5 A;  2Q2H A;  4B9X A;  4LFB L;  4DUZ Q;  2EJG C;  2N78 A;  4AIM A;  3CPW A;  4EQ5 A;  4RGN A;  1YNX A;  5M3M H;  5KNB A;  2B39 A;  4NDX A;  5HGT A;  3M4O H;  3I72 A;  2F03 A;  1SNP A;  4G7O C;  5I6Y A;  5C44 B;  3DEO A;  4F88 A;  2E2J H;  2AUK A;  5C3X A;  2NVX B;  2ZXR A;  2MUY A;  2VXW A;  4OIJ A;  4C2M H;  4DR5 L;  1N36 L;  1G6P A;  2D5D A;  3NEN A;  2F0Q A;  2HDL A;  3PIO 3;  1IKL A;  1PXU A;  4JG2 A;  2KCT A;  4LAA A;  5LMN Q;  3FKI H;  4QUF A;  3C2P A;  4JVZ A;  3I4N H;  1CUK A;  3I7F A;  2O4X A;  4AYB E;  1Y1V G;  3STB D;  2VQE L;  1VQD A;  3S17 H;  1G51 A;  1HZA A;  2F3I A;  1Q12 A;  4HIM A;  1PH7 A;  2EY5 A;  4DV6 L;  2DNC A;  2FFK B;  2IX1 A;  2MQH A;  1X6O A;  3RMH A;  3EQL C;  4AYB B;  1IW7 D;  2L9H A;  2KHJ A;  1Q7Y C;  5JEA H;  2JXM B;  2FXQ A;  2K33 A;  4R9W A;  4ZK9 B;  4HAE A;  1DOL A;  1WCM G;  4PG3 A;  1WOC A;  1JWU D;  3BYT B;  2AUJ D;  4C3H H;  3IFD A;  4RCO A;  1X32 A;  1EOV A;  5C4J H;  4FXG C;  3GTG H;  2DY8 A;  4RGO S;  3AQQ A;  2R93 B;  3W1G A;  2R92 B;  4B3S Q;  1BNZ A;  3KLS A;  2F4V L;  3PSI A;  2MGS A;  3URY A;  3CCQ A;  1A3U A;  3HOV B;  1VQE A;  5AJ3 Q;  3NXW A;  3HOW B;  4B3S L;  1FGU A;  2BCO A;  1AEX A;  3BU2 A;  3CHB D;  2Z4I A;  4CJ2 C;  3HKS A;  4B3M L;  1NBW A;  2R3Z A;  5M3F G;  1EYG A;  1WD0 A;  1HUN A;  3SGI A;  4DV5 L;  3KF6 A;  3L9A X;  1U5K A;  3KYH C;  4CKC A;  1EZ8 A;  3HOY B;  4X3S A;  1C7Y A;  4X6A H;  3CC7 A;  3CXC A;  4IUN A;  4JYA L;  1ZYR D;  2NTS A;  1VQF A;  4HIK A;  1S5C D;  1BUV T;  1ZXT A;  2CKZ B;  3HOV G;  1SND A;  1E3P A;  2TSS A;  5T1I A;  4DUY Q;  1S5B D;  4ALP A;  4HSV A;  1YJ9 A;  3TP6 A;  2A6H D;  2JA6 H;  4HJ5 A;  2JK8 A;  1KL9 A;  1LM0 A;  4A3I H;  2NWG A;  3GTL B;  4DUY L;  3AB9 A;  3GTK H;  2MP1 A;  4KHP Q;  1B70 B;  2K1B A;  2JP1 A;  2YV5 A;  5F2D A;  1NTG A;  4I7Z C;  4EQN A;  3FEW X;  1E2V A;  1VQ5 A;  1E22 A;  2VY3 A;  4DXG A;  1SAP A;  4DV0 L;  5CV9 A;  5M5X H;  2XSC A;  1K8G A;  4K8J A;  4RKB A;  4JI2 Q;  2F52 A;  1PZK D;  5C5L A;  1R4Q B;  4O42 A;  4DV1 Q;  3RZD H;  1Y1W H;  2Z6K C;  2L55 A;  5M3F H;  4BBS G;  2EYM A;  4RFB A;  4ZLT F;  1YIJ A;  5BR8 L;  4FYD A;  1J8I A;  5DEH A;  1VQG A;  4JI2 L;  4YHH Q;  5C4X H;  1G91 A;  1II3 A;  1SNO A;  1YVC A;  3A5U A;  4UHV A;  1R9T H;  3NP8 A;  5EGT A;  5ELF A;  1TQO A;  1IBM Q;  1LTL A;  1CHQ D;  4JI4 Q;  2Z8L A;  3B6Y A;  1ESR A;  1SYE A;  1CA5 A;  2NZO A;  1L1O A;  1FD7 D;  3S17 B;  4KMU C;  2A69 C;  4KY7 A;  3F2D A;  3P75 A;  3GV3 A;  4CJ1 B;  2I5H A;  4JI4 L;  2Z1C A;  3PIO A;  1K0S A;  3CQZ B;  4NXN Q;  3J80 E;  1SMY D;  2Q2I A;  3HOX H;  4BXX G;  4J6H A;  3M3Y B;  3A74 A;  1XPU A;  2DJG C;  3I4O A;  2XNA C;  4KN7 C;  3CPF A;  3TDQ A;  3ONA B;  2JJQ A;  3RLO A;  5G3L F;  5BN5 A;  1IYV A;  2JA6 G;  2O5J C;  1N34 Q;  4AH6 A;  2QA4 A;  3HOX G;  3D0F A;  1XMO Q;  4LNQ A;  4A3L H;  4UP8 A;  4MZ9 A;  5DAU A;  2JA7 G;  1G2S A;  5KND A;  2K03 A;  5E3F A;  2K6A A;  1K8M A;  1RTN A;  3S15 B;  1AH9 A;  4L8J A;  3OTO Q;  2XWJ B;  1HA6 A;  1I4R A;  5D3I B;  3S15 H;  1ESF A;  1GUT A;  4KK7 A;  4JI5 L;  3S1Q B;  1CI3 M;  4BBR H;  2NZH A;  2RHQ B;  4LF4 Q;  4GOP C;  2OT2 A;  1M1K C;  5ELD A;  4QGU A;  3S2D B;  1IHZ A;  4DR3 Q;  2F0F A;  4KKS A;  1O7L A;  2OTJ A;  3MXU A;  4DR7 Q;  4RAU C;  1W2B A;  4LF4 L;  3M4Y A;  1YZ6 A;  1S3O A;  5C3W A;  4AYB G;  3SK6 A;  2EE1 A;  1SYF A;  5KYL A;  1HTP A;  4CJ0 B;  3IAY A;  1TKW B;  3MFY A;  3EJI A;  3TRZ A;  3GTK B;  2ES2 A;  4OO1 G;  3KJO A;  2R7Z H;  2L12 A;  1STG A;  3N52 A;  5EQ0 A;  4K2L A;  2YTY A;  4C3H G;  4A3E B;  3A7L A;  3CC4 A;  2VW9 A;  1EYC A;  3MA2 B;  3K0Y A;  4K5V A;  5JVG 3;  4L5S A;  4GKJ Q;  2MNA A;  4TRD A;  4A3L G;  3OIQ A;  2DGY A;  4BBR G;  3A5Z B;  5FLM G;  2KVM A;  1PYS B;  4TQU S;  3PUX A;  1BVS A;  3I4L A;  1EIY B;  3J7Y W;  3OSO A;  1MSH A;  5HY6 A;  1AP0 A;  5M3F B;  5EJW A;  1LTT D;  3UE0 A;  5I2Y A;  4DR4 Q;  3DM3 A;  3CW2 C;  4DV3 Q;  1JB7 A;  4QF4 A;  4GOP B;  1PFN A;  3I55 A;  4KV6 A;  5A35 A;  4R4Q A;  5JPM C;  3L3O C;  4DKA C;  3E5S A;  4DAM A;  1GXD C;  5FJ8 H;  3QR8 A;  2SDF A;  2PI2 A;  2R92 G;  3DMU A;  2SNM A;  4A3M H;  1V1Q A;  1VF7 A;  3E6Z X;  4KLK A;  4LUO A;  2ICI A;  4C3J H;  2XRS D;  1EEI D;  2K5H A;  3S2D H;  1FNV A;  1PRT D;  2L5T A;  2F0U A;  2E2H H;  2A6H C;  4OWX B;  1ROD A;  4P73 A;  4Y52 H;  3GTJ B;  2XN9 C;  1WD1 A;  1SRO A;  4R1J A;  4C3H B;  2UXC Q;  1A62 A;  1EU3 A;  4A4I A;  1F2Y A;  1LO5 D;  4QMG A;  1SBB B;  4OHJ A;  2JA5 G;  2F0M A;  1Y69 U;  3QIA A;  1L1O B;  1JWM D;  1DXM A;  5ISR A;  4JI0 L;  3K5N A;  3E9I A;  5IWA Q;  4BA2 I;  4LWC A;  1PYB A;  2UXC L;  4LFB Q;  4OGQ C;  1HR0 W;  2WAQ B;  3HGB A;  2VUM G;  1QNK A;  1AFP A;  2F0T A;  2QF7 A;  3PO3 G;  1X3Q A;  3S2H H;  5IWA L;  5CV7 A;  2PZU A;  3AFP A;  2H4O A;  1CZW A;  3CKI B;  2VB3 X;  3LWE A;  1HA5 A;  5GAG C;  4ZYS A;  3FMC A;  1HTL D;  5LMU L;  1BOS A;  1YHB A;  1PFM A;  2GVB A;  3I70 A;  1Y1V B;  4XT3 B;  3OW2 A;  1GUW A;  3X3M A;  3SR1 A;  4MN3 A;  5FOB B;  2F0G A;  1LTR D;  3A55 A;  3FDT A;  1EQQ A;  2K04 A;  1DON A;  3I4M G;  1JCK B;  1Y8P B;  4DV6 Q;  4G7Z C;  4PZ8 A;  4IPD A;  3IL8 A;  1EY8 A;  1YHQ A;  4LF9 L;  4FF1 A;  2CH4 A;  4A3D B;  2Y0S G;  4EVO A;  3ULL A;  3T51 B;  3S1M B;  3D3R A;  1ILP A;  3S1M H;  4K6D A;  2A68 C;  2AHO B;  1HZ9 A;  1BBX C;  1B4O A;  2K75 A;  5E4W C;  2BA0 A;  5C44 H;  1H9R A;  2CHB D;  1TWA H;  4KJN A;  4O1N A;  1ZKO A;  1ASY A;  3CRK C;  1EWC A;  4JBM A;  3GD7 A;  2VUM H;  4IAL A;  3K5L A;  2PI2 E;  5KYI A;  1KXL A;  5AJ3 L;  2F0W A;  4NP5 A;  1C4Q A;  2EQS A;  1Y8N B;  4YCU A;  3F1Z A;  1SE4 A;  5C3E H;  3HS0 C;  4YIJ A;  2HHH Q;  2JQO A;  3R2I A;  4B3M Q;  1DD2 A;  2EDG A;  3P7J A;  3SVM A;  2EZV A;  3G6J B;  2B2W C;  1VMP A;  3NE5 B;  2ZM6 L;  4NXM L;  4DR6 L;  5FK9 C;  1EUJ A;  2ENB A;  2TMP A;  2O2L D;  1YJW A;  2XGT A;  5M5X B;  4H0L C;  1JJG A;  2EYH A;  3J81 i;  3CCE A;  1CSP A;  1SYC A;  3EVQ A;  1KD1 C;  1H95 A;  2FHT A;  2YYZ A;  2ZM6 Q;  4DR1 Q;  3ITP A;  4NXM Q;  2L1B A;  1SFO B;  2NVY B;  2KCC A;  1F9R A;  3I4N G;  5CV6 A;  3H3V I;  1GHJ A;  1E2Z A;  3MXN A;  2CFM A;  2J4X A;  5C0X J;  1SE8 A;  4XQQ A;  1N33 L;  3KLW A;  2PPB C;  2L4N A;  3C3L A;  3SHL A;  2VNU D;  1A8V A;  3VDY A;  1S4Z A;  2HD3 A;  1QVC A;  5I4D A;  2CWP A;  4JW0 A;  1VQK A;  3BJU A;  1N33 Q;  4OIK A;  1E7Z A;  3FKI G;  1QNU A;  4BXX H;  1A0I A;  4CDC C;  5BN4 A;  3Q24 A;  5KRU A;  3HOV H;  1JT8 A;  1CQF A;  3NTK A;  4A93 G;  2CW0 D;  5NUC A;  3NBH B;  1NMG A;  3TP7 A;  3EN2 A;  1SYD A;  3J7A F;  2E2H B;  1TR5 A;  4HN7 A;  2V4D A;  4LF6 Q;  1D7Q A;  4LF8 Q;  3H0G B;  2A5H A;  2WB1 G;  3ERO A;  4C3I G;  4YHH L;  1XTD A;  1C0A A;  4TVA B;  3KUP A;  4LUV A;  3SXH A;  1KAW A;  1EY4 A;  4Q0F A;  5IP7 G;  2UU9 L;  5C4X G;  3FHW A;  4B3R L;  4RKL A;  4BA1 I;  4IFD I;  2E2I B;  1NCV A;  3BVM A;  5L37 A;  3PCO B;  3AYH B;  4K0K Q;  2GN5 A;  2VZA A;  3M85 A;  3J81 c;  3NQI A;  5LL6 S;  1Y1W G;  2CCZ A;  1PZI D;  4H44 C;  2Z4H A;  3NEL A;  4JBK A;  1DGS A;  3U58 A;  2BE5 D;  2PW7 A;  1NSN S;  1MHW C;  1N9W A;  3IFT A;  1QUQ B;  3J80 c;  4A3K G;  4BY1 G;  1QVF A;  1EIG A;  1PH2 A;  2IPK D;  5IGF A;  2XVS A;  1PHJ A;  1BBW A;  2VQF Q;  1EIF A;  4IPG A;  1PH3 A;  4IPC A;  4P71 A;  4LUZ A;  4QL5 A;  3T1H Q;  4LK1 C;  4HJA A;  2OF1 A;  4RHR A;  3GTG B;  2VS1 A;  5C4J B;  5FLX E;  3AEV A;  1XPR A;  1LT5 D;  1CTM A;  3RLN A;  3I90 A;  2XTI A;  3GTM H;  1D6E C;  4DK3 C;  4F8M A;  1VQ4 A;  2EYP A;  3GDE A;  3OTO L;  3T13 A;  1O80 A;  4HCS A;  3T1H L;  3VR2 A;  3J81 L;  3J7A V;  2E2J B;  3QWN A;  1SXT A;  3R93 A;  2F0P A;  5JJK A;  1LLR D;  4JI5 Q;  1IBK L;  2FMC A;  4PZ7 A;  2IHE A;  1WVL A;  3MTS A;  3CCL A;  2LY7 A;  1PTO D;  2WKD A;  2Q2T A;  4U68 A;  4A3K H;  4R4T A;  1HNX L;  1KDB A;  4NB3 A;  1M90 C;  1VCI A;  1NAP A;  3KBX A;  3KBG A;  2DJF C;  2HDM A;  2HUG A;  2CQO A;  4LFC L;  1F77 A;  2E74 C;  3TS0 A;  3VYU A;  2QW7 A;  3VA7 A;  1NE3 A;  3QO2 A;  2LS0 1;  2F0I A;  2UXB L;  3CCR A;  4V0B A;  4RA8 A;  1UE6 A;  1JOR A;  4K6L A;  2HQE A;  2MHV A;  3ERS X;  1DJR D;  1XNQ Q;  4M8A A;  4A3B B;  1QB5 D;  2RDG A;  4FDB A;  4AQY Q;  3R2T A;  4PMB A;  3TQY A;  5D3D A;  1Z47 A;  4DGZ A;  5E7N A;  3S1R B;  1O7I A;  1WTH A;  4MIU A;  4MTN A;  2J0T D;  1PDQ A;  5IYB H;  1X3G A;  4DK0 A;  3M7G A;  4FP5 D;  3JC6 6;  1JC7 A;  1V8Q A;  5D14 A;  3EA6 A;  2KQ3 A;  1YBY A;  1SJH D;  1HFN A;  1SYB A;  2RVL A;  2EYF A;  4M1U B;  1H9S A;  3CU7 A;  2B2Y C;  1FNU A;  2OTL A;  3H3V H;  4L5R C;  1UUP A;  5IP9 G;  1GOZ A;  3S9W A;  1B7Y B;  1NY4 A;  3HOZ G;  1HNZ L;  5C0X I;  1WCM B;  4S3S A;  2PCF B;  1AZQ A;  1EY0 A;  1PTO C;  2AWN A;  2UXD L;  2K50 A;  1SYG A;  4DAY A;  2UUB Q;  1PH4 A;  4CKE A;  3CC2 A;  1KTK A;  4J15 A;  4GKK Q;  2N55 A;  3E0E A;  2K4K A;  1QVG A;  3I3C A;  1IYU A;  1KQS A;  3FPP A;  3MEH A;  5IOC A;  2EXD A;  4PMC A;  4A76 A;  5C5M A;  3DLL A;  4A3C G;  3S14 B;  1QOH A;  1OXS C;  2UUC Q;  1IL2 A;  5JJL A;  3A8J E;  3D6W A;  3MXP A;  2NN6 H;  1VQA A;  2WB1 E;  3RNU A;  3JAM i;  2DY7 A;  3T16 A;  3FKI B;  3G6E A;  2ATW A;  4DR5 Q;  1B9N A;  1I4H A;  1XJV A;  3HEJ A;  4ODG A;  4QUC A;  3VYR A;  2IX0 A;  2EPB A;  4YWK A;  1TWG B;  4OXP A;  1STY A;  2NVX H;  3S1N B;  4Q5V A;  3UDX A;  1HUM A;  3PO2 G;  1PMR A;  4IO9 A;  3CMA A;  1BKB A;  1WYD A;  1HNW Q;  1RD9 D;  1KRT A;  1EQV A;  2R93 H;  4X3K A;  2OCE A;  3HOY H;  4EX5 A;  3K5M A;  1FGB D;  4JI3 Q;  4KI0 A;  3PUY A;  1BXT A;  4LF9 Q;  5IYC H;  4R4O A;  3S1N H;  3MC0 B;  5FKA C;  3LNN A;  1D1I A;  1PH5 A;  4C1N K;  1I6H B;  5C6A A;  1ENC A;  1BCP B;  1X3F A;  2F4V Q;  4HJ9 A;  2PQA A;  5IGC A;  4DNR B;  2B29 A;  1U9R A;  3VR6 A;  2WKC A;  4PMW A;  1QWY A;  2NVQ B;  2NB0 A;  2NYZ D;  1STE A;  1VQO A;  5A2Q E;  5LL6 X;  4DV4 L;  3F2U A;  2PYK A;  3TP5 A;  2N49 A;  4B08 A;  1EY7 A;  2MPM A;  2Y0S B;  3M4P A;  3PUZ A;  2SEB D;  4HED A;  2Z0S A;  1NR4 A;  5GQO A;  3H91 A;  3CQZ H;  2A8V A;  2HQL A;  1EL0 A;  4H02 A;  1D1K A;  1LYL A;  2I5L X;  2QKI C;  4KY6 A;  4ZKB B;  5CMD A;  2HHH L;  1SNM A;  4JYA Q;  4IFD H;  4DF7 A;  4BBS B;  2UUA Q;  2F0K A;  1UAP A;  3T53 B;  2K5W A;  2K5Q A;  4KN4 C;  3TBI B;  3V05 A;  2F0O A;  1M4V A;  2UUA L;  2B63 G;  2ZJP A;  2A68 D;  3D4W A;  4LW1 A;  3CCS A;  2VQE Q;  3I8Z A;  4X65 L;  3MWY W;  1R4P B;  1VMC A;  1Y8O B;  2JEB I;  1MJE A;  2QEJ C;  4L6T B;  3QB3 A;  2KED A;  2ZJQ A;  1W6K A;  3SK5 A;  5IGD A;  3BVG A;  4X65 Q;  1L0X B;  1SE2 A;  4G57 A;  4A3M B;  4ZUJ A;  1WTX A;  1K73 C;  1GHK A;  3S1R H;  4KTA A;  1LT3 D;  3C1E A;  2CW0 C;  1C9O A;  2IHF A;  3GV6 A;  4A3G B;  1DZ1 A;  3E9H A;  1MI2 A;  1O7Z A;  4YWM A;  1D5M C;  1QJO A;  3HOZ B;  5BR8 Q;  4R8I A;  4DV7 Q;  4DAP A;  4IUT A;  2KEC A;  5M9O A;  1SLJ A;  2E5L Q;  4CHT B;  1I94 L;  1ENA A;  3HOY G;  2F0V A;  2JA5 B;  5DM7 3;  1SNQ A;  4LF6 L;  2PQA B;  5GAE C;  3M4Q A;  3L7Z C;  1SR3 A;  1CKO A;  3U4V A;  1STB A;  2HIX A;  1IBM L;  2ICE C;  3A8K E;  2JA7 B;  4WOR A;  4RGT A;  2LSS A;  4PV1 C;  4ZUI A;  1F9S A;  2F3W A;  2N8N A;  2ZTE A;  2FMM A;  5EBD A;  1G6Z A;  4I65 A;  1MJC A;  3KF8 A;  1B9M A;  1F2M A;  3CRL C;  3PGZ A;  4DK6 C;  1V43 A;  2F0J A;  5CBE E;  5T1G A;  4RGM A;  4HJ8 A;  2K05 A;  4NXN L;  5CV8 A;  5C0X G;  3J81 E;  1Q8I A;  1I5F A;  1LT4 D;  1K8O A;  2QCP X;  1W3S A;  1ET9 A;  1FL0 A;  4WJ4 A;  4K2K A;  2ZJR A;  2G9D A;  5DM6 3;  2VB2 X;  1H9M A;  4IFD J;  1RJT A;  4IZ8 A;  2KHI A;  1A15 A;  5CR3 A;  4XQN A;  3I73 A;  1U4R A;  4A93 H;  4CBV A;  1D5Z C;  1AN8 A;  1TS4 A;  1CT1 D;  1XMO L;  2QDB A;  4U67 3;  1VDZ A;  2A1A A;  3RLF A;  4TSS A;  4BBR B;  3CCV A;  4N9P A;  3ZJY C;  3VYS A;  2HIV A;  4IUP A;  5LHY 1;  1MD2 D;  2K7V A;  3BZC A;  3T4A C;  1S40 A;  1FYC A;  1XMQ L;  4C2M B;  1D8L A;  4DV1 L;  1S5E D;  2WFW A;  1KHI A;  5IGB A;  4IQZ A;  5IIF A;  3I4M H;  1TS2 A;  4A3D H;  3NHH A;  2VUM B;  3V2T A;  4DR3 L;  2M2L A;  4ZCK A;  2D0P A;  2JA8 G;  1K9M C;  1Q3L A;  1RL2 A;  3K80 C;  4DR7 L;  2Z6K A;  3H6M A;  1X55 A;  4IUU A;  1VQ8 A;  5HGQ A;  2G5D A;  1IKM A;  4N8X 1;  4KD4 A;  4IOA A;  4JBW A;  1N32 L;  3GTQ H;  4P75 A;  5LMN W;  1S72 A;  4DNI A;  3LWU A;  1JOQ A;  1JE4 A;  1FJG L;  2D0O A;  1XTC D;  2E2D C;  4BWG B;  4BY1 H;  5J3B A;  1JOK A;  5CV5 A;  3TZD A;  4ULL A;  4LFC Q;  3VR3 A;  5COY A;  3H0G H;  2RDH A;  4L63 B;  3M4O B;  3OYY A;  3OIP A;  1RHP A;  3NTI A;  4A3J G;  3RZD B;  4K14 A;  1E2W A;  4XYQ A;  1VQN A;  1DM0 B;  3EFX D;  3RUZ A;  3ULP A;  1B53 A;  1VQ6 A;  3HOW G;  3HOX B;  1IZ6 A;  4QIW B;  3SK8 A;  5C4X B;  1C8C A;  1EWI A;  2AKW B;  1EY9 A;  3OWE B;  4P2C B;  1VQB A;  3J80 L;  1I4Q A;  2G9H D;  2K14 A;  3FP9 A;  4C1N I;  3T1Y L;  3K5O A;  1ET6 A;  3QOJ A;  1Y1W B;  3MEF A;  1CZG A;  4UDU C;  3UE1 A;  1S5F D; 
#chains in the Genus database with same CATH homology
 4KKU A;  2H1E A;  1A2U A;  2KA7 A;  1TU2 B;  3N6R A;  1XYI A;  1U4M A;  3GQB A;  5CGK A;  2A69 D;  5CV4 A;  3Q23 A;  5HUR A;  1J9O A;  3PV0 A;  2B2V C;  4BS9 A;  5IGE A;  3D4D A;  4DAV A;  2NUC A;  1OXT A;  1EEF D;  4K5X A;  2JYO A;  2NZ1 D;  3VA5 A;  1EY5 A;  2PZT A;  4HCE A;  5BN3 A;  1LTI D;  4XDX A;  1BF4 A;  2F0E A;  3R8B A;  1BO0 A;  1X3P A;  2D62 A;  2B2U A;  3Q6S A;  1B3A A;  1DOM A;  1PLF A;  1H9J A;  1TVX A;  1B50 A;  2NVT B;  4OO1 I;  5JJZ A;  1BR9 A;  2B2T C;  3DWP A;  2M00 A;  1PTO H;  1I4P A;  3O13 A;  4PNY A;  2BE5 C;  3GTP B;  1VF5 C;  2F0D A;  1A3T A;  2D9U A;  1HXY D;  5JEA J;  1CM9 A;  1Q1B A;  1TY2 A;  3SE0 A;  2MJ8 A;  3OOC A;  5C4Z A;  1M8A A;  2I46 A;  1TWC B;  5EKL A;  3K59 A;  3C46 A;  1CHP D;  4XT1 B;  4NW2 A;  4GZY C;  2PNR C;  2X6G A;  5EKI A;  1F9P A;  1PRT B;  4RHS A;  2L11 A;  1LTG D;  3TP8 A;  1XXG A;  2RQX A;  3Q22 A;  1Z7T A;  3U9O A;  2RBM A;  5ELC A;  1DOK A;  5KEE A;  2B2Y A;  1EY6 A;  1SE3 A;  5I2X A;  1A2T A;  3W2D A;  2AWO A;  1EOT A;  1LT6 D;  2A6E D;  4OO1 H;  1YNN D;  3RD4 A;  1PTO B;  4N9T A;  1U4L A;  3TZU A;  2LFN A;  1KNE A;  4BY7 B;  5M5Y B;  1EIH A;  4NKL A;  5G3L D;  1G8Z D;  2A6E C;  3ERQ A;  1B1Z A;  2EY6 A;  2GA4 B;  4C3J B;  2O5I C;  4HR7 B;  3BYY B;  1TT2 A;  3K7A B;  2PO4 A;  1STA A;  3PIP 3;  5JEA G;  4XXE A;  4X3U A;  1RF2 D;  1MGS A;  1O78 A;  1KNA A;  2AQ1 B;  5EPJ A;  1OXX K;  1EYA A;  2R7Z B;  4HTH A;  5ELE A;  1Q1E A;  1UNS A;  2BOS A;  1GUS A;  3DUZ A;  3FVQ A;  2N88 A;  3A7A B;  1GUG A;  3M7N A;  2NTT A;  1JOO A;  5JOB A;  4C56 C;  5I9P A;  3MHB A;  5A2Q L;  3WDN A;  1H9S B;  1W6J A;  2I07 B;  2A73 B;  4G4K A;  1QIL A;  5I6W A;  1BCP C;  5EBC A;  4ZQ3 A;  1ILQ A;  2OXP A;  3PUW A;  4C3I B;  3HKZ B;  4WFN 3;  1BQQ T;  2EYO A;  2HCC A;  4ZAI A;  3GP7 A;  1ML0 D;  3NSW A;  1ONL A;  1SEB D;  4KHV A;  5COR A;  2B8F A;  3SK4 A;  2F0N A;  3I4M B;  5FO7 B;  4C3J G;  1WTW A;  1GJX A;  1DCZ A;  1V1P A;  1UEA B;  3R3O A;  3HRZ C;  3TME A;  1Q90 A;  3DM1 A;  2FJ2 A;  4KKT A;  1S5D D;  1EU4 A;  3V96 A;  3K57 A;  1STH A;  3TN2 A;  2B2W A;  3D6C A;  1IW7 C;  1I3Q B;  3H09 A;  2X69 A;  2RA4 A;  1F2L A;  4EQO A;  1D5X C;  1JQY D;  1OXU A;  3MZ5 A;  1D2B A;  4BY1 B;  3DHQ A;  3D4R A;  1PTO F;  3GTM B;  2E76 C;  5J39 A;  3S16 B;  4K5W A;  3JAM E;  1SJE D;  1TWF B;  3PMF A;  3VR4 A;  3BDL A;  2B2T A;  5K36 G;  1AW7 A;  4V19 0;  3H3V C;  1R9T B;  3WOE A;  4XTC S;  5EKK A;  4FF2 A;  3BZD B;  1AZP A;  2ZXO A;  1BDO A;  1KDC A;  3GTO B;  4XIG S;  4FNF A;  2IL8 A;  2L0C A;  4A93 B;  2E75 C;  2RKS A;  3QJY A;  4Y7N B;  2SOB A;  1Z6H A;  1HFG A;  2XWB B;  5KIX A;  1XWE A;  2RSN A;  4UAI A;  1ENF A;  2WIN B;  1EWH A;  3OWF A;  1YNN C;  2JE6 I;  4KJO A;  3S2H B;  1QG7 A;  1LAB A;  3PUV A;  3KLS X;  1NUC A;  1I4G A;  2BA1 A;  1F2Z A;  4FXD A;  1XX8 A;  3NWS A;  2KUM A;  4RH6 A;  4IUR A;  3OMG A;  3KLR A;  3P1H A;  4XYO A;  2EVB A;  1LAC A;  2SNS A;  3U9S A;  2AQ3 B;  2WAC A;  2EJM A;  1WTV A;  4R8N A;  3K6O A;  2FIN B;  5D65 A;  2KJX A;  3PO3 B;  2EXZ A;  1V1P B;  1BCP F;  1PYW D;  2DNE A;  2CVR A;  1E0B A;  2JA6 B;  3DEP A;  2CQA A;  1EYD A;  2A74 C;  2RSO A;  3RZO B;  1LTA D;  2WII B;  3I91 A;  2EY2 A;  2ZT9 C;  1SSO A;  1OO9 B;  1KDA A;  1TWA B;  5AFW A;  1ZEQ X;  1PZJ D;  3NWT A;  4FF3 A;  3SDZ A;  4DU9 A;  4A3J B;  3BDO A;  1JR0 D;  5C3E B;  2ZXP A;  2F0L A;  3A54 A;  4DNT B;  3BS1 A;  5IGG A;  4E6I A;  5FO9 B;  3AU7 A;  4Z9C B;  3NUC A;  4KHZ A;  1I50 B;  4WRD A;  3MXG A;  5I9O A;  1O7Y A;  3PO2 B;  2BDO A;  2F0S A;  1I6V C;  3AMU A;  2F3V A;  4NMZ A;  4WJW A;  2K32 A;  1H9K A;  4F87 A;  4ID6 A;  3HG9 A;  1SDF A;  5CC4 A;  1A6X A;  3LX0 A;  4OL7 A;  4QB4 A;  2NN6 I;  2F1M A;  2OEO A;  3GTQ B;  1ICW A;  1SMY C;  5E4X A;  5JAV A;  1OXV A;  3OMC A;  4K8I A;  1RTO A;  1YNJ C;  1V1O A;  1RDP D;  2BDN A;  4B9W A;  2KEE A;  1KAB A;  3BDC A;  1I4X A;  4RWS C;  1ZYR C;  2F0H A;  5JVH 3;  3QOL A;  5C0X H;  1A3V A;  4KD3 A;  5M3M B;  3K58 A;  3BG3 A;  1KLU D;  2B2U C;  2D2C C;  2C5C A;  3H94 A;  1HRJ A;  1C48 A;  2EY1 A;  3NPP A;  1K83 B;  1WTO A;  4QCL A;  2IX3 A;  5KGU A;  1PFB A;  4G7H C;  2KHS A;  2C9O A;  2EYJ A;  4DFA A;  4DK1 A;  3MAQ A;  4CGY B;  2AQ2 B;  5M5W B;  1MSG A;  3FRP B;  2LMC B;  1HHV A;  4H13 C;  2Q8T A;  3SEB A;  3QG1 A;  4FVM A;  3TSS A;  1T5E A;  1TS3 A;  4H7B A;  2RDF A;  5CBA E;  1SNC A;  3HOU B;  1T5X D;  5IT9 L;  1LTB D;  2YU9 B;  2EYL A;  2J7Z A;  1FNW A;  1CFM A;  1YNJ D;  4ZRZ A;  3G7L A;  5K5P A;  2IWH A;  3NQT A;  5J1Z A;  3GO5 A;  4J1M A;  5ELB A;  3Q0A A;  3JAM L;  4PQX A;  4DN4 M;  2IJ0 A;  2NN6 G;  4LMQ D;  3MVV A;  3NBH A;  1QE6 A;  3IKJ A;  5KNC A;  4EQP A;  5CYU A;  1CA6 A;  3I4N B;  4A3I B;  1QCB D;  3NTH A;  1CK1 A;  2K01 A;  2XIW A;  1WTP A;  3FPU B;  1TY0 A;  5K36 H;  4HSP A;  2ID0 A;  1STN A;  5E1F A;  4F7X A;  1JB3 A;  1TII D;  2HCI A;  4DXF A;  2LKV A;  4LJZ C;  3MFG A;  3OHX C;  5IT9 E;  2R6G A;  4X3T A;  4IUV A;  4DA2 A;  3VYT A;  3DWA A;  4ILW A;  1HQM C;  1NR2 A;  2IT1 A;  1WTR A;  5EPL A;  4HMI A;  1G29 1;  3DXJ C;  3E0J A;  3HZX A;  3W3A A;  4ABN A;  1F9Q A;  1HPC A;  1B2T A;  1LTS D;  2JEA I;  3UI2 A;  2XRQ D;  4FXK C;  4HMJ A;  4IN3 A;  5FO8 B;  4MHE A;  1U4P A;  2K5D A;  5J22 A;  1B44 D;  3X3N A;  1PRT F;  3DWQ A;  3C1F A;  2WB1 B;  1IL8 A;  4ME5 A;  3ZYY X;  4IFD G;  2JA8 B;  3A56 A;  4RCN A;  4EGV A;  4ZKC B;  1G2T A;  1RKN A;  1TS5 A;  2JSO A;  3BVZ A;  2EJF C;  2WP8 J;  2X6L A;  2PW5 A;  4FO2 A;  1KLG D;  3A8I E;  3VR5 A;  4CKB A;  1RCV D;  2IW3 A;  1MBY A;  5DNF A;  1KAA A;  3ND8 A;  3D31 A;  2PMZ B;  5IOD A;  4TKO B;  1EZ6 A;  1GUN A;  1EFI D;  5FLX L;  2WV6 D;  2PZW A;  2M9V A;  1GUO A;  2K28 A;  4JK1 C;  2B63 B;  1CQV A;  5EPK A;  1FR3 A;  2R61 A;  3NK9 A;  1HCZ A;  4IUQ A;  4J8Q A;  2PQE A;  3T56 B;  1JIC A;  3KK7 A;  1LV9 A;  3NBI A;  5C4H A;  3OW7 A;  4A3F B;  3D8G A;  2B2V A;  1JWS D;  5JPN C;  4XQJ A;  2EOT A;  3HP3 A;  1PRT C;  4KY5 A;  1BCP D;  3WOF A;  2B8G A;  2KOL A;  1HQR D;  4A3K B;  1DYQ A;  2QIL A;  1WTQ A;  3ND9 A;  4FF4 A;  2DN8 A;  2KCN A;  5TSS A;  2F4I A;  3P20 A;  2Q8R E;  1L0Y B;  2Q8I B;  2NBF A;  1EQT A;  1TWH B;  3OPO A;  4B9X A;  2EJG C;  4RGN A;  5KNB A;  2B39 A;  4NDX A;  5HGT A;  3I72 A;  2F03 A;  1SNP A;  4G7O C;  5I6Y A;  5C44 B;  3DEO A;  4F88 A;  2AUK A;  5C3X A;  2NVX B;  2ZXR A;  2MUY A;  2VXW A;  4OIJ A;  2D5D A;  2F0Q A;  2HDL A;  3PIO 3;  1IKL A;  1PXU A;  4LAA A;  4QUF A;  3C2P A;  2O4X A;  1Q12 A;  2EY5 A;  2DNC A;  2FFK B;  2IX1 A;  3RMH A;  3EQL C;  4AYB B;  1IW7 D;  2L9H A;  5JEA H;  2JXM B;  4ZK9 B;  2K33 A;  4R9W A;  1DOL A;  4HAE A;  1JWU D;  3BYT B;  2AUJ D;  3IFD A;  4RCO A;  1X32 A;  4FXG C;  2DY8 A;  4RGO S;  2R93 B;  2R92 B;  1BNZ A;  3KLS A;  2MGS A;  3URY A;  1A3U A;  3HOV B;  3NXW A;  3HOW B;  2BCO A;  1AEX A;  3CHB D;  2Z4I A;  4CJ2 C;  2R3Z A;  1WD0 A;  1HUN A;  3L9A X;  4CKC A;  3HOY B;  1EZ8 A;  4X3S A;  4IUN A;  1ZYR D;  2NTS A;  1S5C D;  1BUV T;  1ZXT A;  1SND A;  2TSS A;  5T1I A;  1S5B D;  4HSV A;  3TP6 A;  2A6H D;  2NWG A;  3GTL B;  3AB9 A;  2MP1 A;  2K1B A;  2JP1 A;  5F2D A;  4I7Z C;  4EQN A;  3FEW X;  1E2V A;  4DXG A;  1SAP A;  5CV9 A;  2XSC A;  4K8J A;  4RKB A;  1PZK D;  5C5L A;  1R4Q B;  4O42 A;  2L55 A;  2EYM A;  4RFB A;  4ZLT F;  4FYD A;  1J8I A;  5DEH A;  1G91 A;  1II3 A;  1SNO A;  3NP8 A;  5EGT A;  5ELF A;  1TQO A;  1CHQ D;  2Z8L A;  1ESR A;  1SYE A;  1CA5 A;  1FD7 D;  3S17 B;  4KMU C;  2A69 C;  4KY7 A;  3P75 A;  3GV3 A;  4CJ1 B;  2Z1C A;  3CQZ B;  3J80 E;  1SMY D;  4J6H A;  3M3Y B;  2XNA C;  4KN7 C;  3TDQ A;  3ONA B;  5G3L F;  5BN5 A;  1IYV A;  2O5J C;  5DAU A;  1G2S A;  5KND A;  2K03 A;  5E3F A;  2K6A A;  1K8M A;  1RTN A;  3S15 B;  4L8J A;  2XWJ B;  1HA6 A;  1I4R A;  5D3I B;  1ESF A;  1GUT A;  4KK7 A;  3S1Q B;  1CI3 M;  2OT2 A;  5ELD A;  3S2D B;  1IHZ A;  2F0F A;  4KKS A;  1O7L A;  3MXU A;  4RAU C;  3M4Y A;  5C3W A;  3SK6 A;  2EE1 A;  1SYF A;  5KYL A;  1HTP A;  4CJ0 B;  3IAY A;  1TKW B;  3MFY A;  3EJI A;  3GTK B;  4OO1 G;  2L12 A;  1STG A;  3N52 A;  5EQ0 A;  4K2L A;  4C3H G;  4A3E B;  3A7L A;  1EYC A;  3MA2 B;  3K0Y A;  4K5V A;  5JVG 3;  4TRD A;  3OIQ A;  2KVM A;  4TQU S;  3PUX A;  3I4L A;  3J7Y W;  3OSO A;  1MSH A;  1AP0 A;  5M3F B;  5EJW A;  1LTT D;  5I2Y A;  4QF4 A;  1PFN A;  4KV6 A;  5A35 A;  5JPM C;  3L3O C;  3E5S A;  1GXD C;  2SDF A;  3DMU A;  2SNM A;  1VF7 A;  3E6Z X;  2ICI A;  2XRS D;  1EEI D;  1FNV A;  1PRT D;  2L5T A;  2F0U A;  2A6H C;  1ROD A;  3GTJ B;  2XN9 C;  1WD1 A;  4C3H B;  1EU3 A;  1F2Y A;  1LO5 D;  4QMG A;  1SBB B;  4OHJ A;  2F0M A;  1Y69 U;  3QIA A;  1JWM D;  1DXM A;  5ISR A;  3K5N A;  4BA2 I;  4OGQ C;  2WAQ B;  3HGB A;  1QNK A;  1AFP A;  2F0T A;  2QF7 A;  1X3Q A;  5CV7 A;  2PZU A;  2H4O A;  1CZW A;  3CKI B;  2VB3 X;  3LWE A;  1HA5 A;  4ZYS A;  3FMC A;  1HTL D;  1BOS A;  1PFM A;  3I70 A;  1Y1V B;  4XT3 B;  1GUW A;  3X3M A;  3SR1 A;  4MN3 A;  5FOB B;  2F0G A;  1LTR D;  3A55 A;  3FDT A;  2K04 A;  1DON A;  1JCK B;  1Y8P B;  4G7Z C;  3IL8 A;  1EY8 A;  4FF1 A;  4A3D B;  4EVO A;  3T51 B;  3S1M B;  3D3R A;  1ILP A;  4K6D A;  2A68 C;  1BBX C;  1B4O A;  5E4W C;  2BA0 A;  1H9R A;  2CHB D;  4KJN A;  4O1N A;  1ZKO A;  3CRK C;  1EWC A;  3GD7 A;  4IAL A;  3K5L A;  5KYI A;  2F0W A;  4NP5 A;  1C4Q A;  1Y8N B;  1SE4 A;  3HS0 C;  4YIJ A;  1DD2 A;  3R2I A;  2EDG A;  3P7J A;  3SVM A;  2EZV A;  3G6J B;  2B2W C;  1VMP A;  3NE5 B;  5FK9 C;  2ENB A;  2TMP A;  2O2L D;  5M5X B;  4H0L C;  2EYH A;  1SYC A;  3EVQ A;  2FHT A;  2YYZ A;  3ITP A;  2L1B A;  1SFO B;  2NVY B;  2KCC A;  1F9R A;  5CV6 A;  1GHJ A;  1E2Z A;  3MXN A;  2J4X A;  5C0X J;  4XQQ A;  2PPB C;  2L4N A;  3C3L A;  3SHL A;  2VNU D;  1S4Z A;  5I4D A;  4OIK A;  1QNU A;  5BN4 A;  3Q24 A;  5KRU A;  1CQF A;  3NTK A;  2CW0 D;  5NUC A;  3TP7 A;  1SYD A;  3J7A F;  2E2H B;  1TR5 A;  4HN7 A;  2V4D A;  3H0G B;  2A5H A;  3ERO A;  4C3I G;  3KUP A;  3SXH A;  1EY4 A;  4Q0F A;  4RKL A;  4BA1 I;  4IFD I;  2E2I B;  1NCV A;  3BVM A;  3M85 A;  3NQI A;  5LL6 S;  1PZI D;  4H44 C;  2Z4H A;  2BE5 D;  2PW7 A;  1NSN S;  3IFT A;  1EIG A;  2IPK D;  5IGF A;  2XVS A;  4LK1 C;  2OF1 A;  4RHR A;  3GTG B;  5C4J B;  5FLX E;  1LT5 D;  1CTM A;  3I90 A;  1D6E C;  4F8M A;  2EYP A;  3T13 A;  1O80 A;  4HCS A;  3VR2 A;  3J81 L;  3J7A V;  2E2J B;  3QWN A;  1SXT A;  3R93 A;  2F0P A;  1LLR D;  2FMC A;  1WVL A;  3MTS A;  2LY7 A;  1PTO D;  2WKD A;  4U68 A;  1KDB A;  1VCI A;  1NAP A;  3KBX A;  3KBG A;  2HDM A;  2HUG A;  1F77 A;  2E74 C;  3VYU A;  3VA7 A;  3QO2 A;  2LS0 1;  2F0I A;  4V0B A;  4RA8 A;  1JOR A;  4K6L A;  2HQE A;  2MHV A;  1DJR D;  4M8A A;  4A3B B;  1QB5 D;  2RDG A;  3R2T A;  4PMB A;  5D3D A;  1Z47 A;  4DGZ A;  3S1R B;  4MIU A;  2J0T D;  1PDQ A;  4DK0 A;  3M7G A;  4FP5 D;  1JC7 A;  1V8Q A;  5D14 A;  3EA6 A;  2KQ3 A;  1SJH D;  1HFN A;  1SYB A;  2RVL A;  2EYF A;  4M1U B;  1H9S A;  3CU7 A;  2B2Y C;  1FNU A;  1UUP A;  1GOZ A;  3S9W A;  5C0X I;  1WCM B;  4S3S A;  2PCF B;  1AZQ A;  1EY0 A;  1PTO C;  2AWN A;  1SYG A;  4DAY A;  4CKE A;  1KTK A;  2N55 A;  3I3C A;  1IYU A;  3FPP A;  3MEH A;  5IOC A;  4PMC A;  5C5M A;  3S14 B;  1QOH A;  1OXS C;  3A8J E;  3D6W A;  3MXP A;  2NN6 H;  2DY7 A;  3T16 A;  3FKI B;  1B9N A;  1I4H A;  3HEJ A;  4ODG A;  4QUC A;  3VYR A;  2IX0 A;  2EPB A;  1TWG B;  1STY A;  3S1N B;  4Q5V A;  1HUM A;  1PMR A;  1RD9 D;  1EQV A;  4X3K A;  3K5M A;  1FGB D;  4KI0 A;  3PUY A;  1BXT A;  3MC0 B;  5FKA C;  3LNN A;  1D1I A;  4C1N K;  1I6H B;  5C6A A;  1ENC A;  1BCP B;  5IGC A;  4DNR B;  1U9R A;  3VR6 A;  2WKC A;  4PMW A;  1QWY A;  2NVQ B;  2NB0 A;  2NYZ D;  1STE A;  5A2Q E;  5LL6 X;  3F2U A;  2PYK A;  3TP5 A;  4B08 A;  1EY7 A;  2MPM A;  2Y0S B;  3PUZ A;  2SEB D;  4HED A;  1NR4 A;  3H91 A;  1EL0 A;  4ZKB B;  1D1K A;  2QKI C;  4KY6 A;  5CMD A;  1SNM A;  4IFD H;  4DF7 A;  4BBS B;  2F0K A;  1UAP A;  3T53 B;  2K5W A;  2K5Q A;  4KN4 C;  3TBI B;  3V05 A;  2F0O A;  1M4V A;  2A68 D;  3D4W A;  3I8Z A;  3MWY W;  1R4P B;  1VMC A;  1Y8O B;  2JEB I;  2QEJ C;  3QB3 A;  4L6T B;  2KED A;  1W6K A;  3SK5 A;  5IGD A;  3BVG A;  1L0X B;  1SE2 A;  4G57 A;  4A3M B;  4ZUJ A;  1WTX A;  1GHK A;  4KTA A;  1LT3 D;  3C1E A;  2CW0 C;  3GV6 A;  4A3G B;  1DZ1 A;  1MI2 A;  1O7Z A;  1D5M C;  1QJO A;  3HOZ B;  4R8I A;  4DAP A;  4IUT A;  2KEC A;  5M9O A;  4CHT B;  1ENA A;  2F0V A;  2JA5 B;  5DM7 3;  1SNQ A;  3L7Z C;  1STB A;  2ICE C;  3A8K E;  2JA7 B;  4WOR A;  4RGT A;  4PV1 C;  4ZUI A;  1F9S A;  2F3W A;  2FMM A;  5EBD A;  1G6Z A;  4I65 A;  3KF8 A;  1B9M A;  1F2M A;  3CRL C;  1V43 A;  2F0J A;  5CBE E;  5T1G A;  4RGM A;  2K05 A;  5CV8 A;  5C0X G;  3J81 E;  1Q8I A;  1LT4 D;  1K8O A;  2QCP X;  1ET9 A;  4K2K A;  2G9D A;  5DM6 3;  2VB2 X;  1H9M A;  4IFD J;  1RJT A;  4IZ8 A;  5CR3 A;  1A15 A;  4XQN A;  3I73 A;  1U4R A;  4CBV A;  1D5Z C;  1AN8 A;  1TS4 A;  1CT1 D;  2QDB A;  4U67 3;  1VDZ A;  3RLF A;  4TSS A;  4BBR B;  4N9P A;  3VYS A;  4IUP A;  5LHY 1;  1MD2 D;  2K7V A;  3T4A C;  1FYC A;  4C2M B;  1S5E D;  5IGB A;  4IQZ A;  5IIF A;  1TS2 A;  3NHH A;  2VUM B;  3V2T A;  2M2L A;  1Q3L A;  3H6M A;  4IUU A;  1IKM A;  4KD4 A;  4JBW A;  3LWU A;  1JOQ A;  1JE4 A;  1XTC D;  2E2D C;  4BWG B;  1JOK A;  5CV5 A;  3TZD A;  4ULL A;  3VR3 A;  5COY A;  2RDH A;  4L63 B;  3M4O B;  3OIP A;  1RHP A;  3NTI A;  3RZD B;  4K14 A;  1E2W A;  4XYQ A;  1DM0 B;  3EFX D;  3RUZ A;  1B53 A;  3HOX B;  4QIW B;  3SK8 A;  5C4X B;  1C8C A;  1EY9 A;  3OWE B;  4P2C B;  3J80 L;  1I4Q A;  2G9H D;  4C1N I;  3K5O A;  1ET6 A;  3QOJ A;  1Y1W B;  1CZG A;  4UDU C;  1S5F D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...