2IL8A

Three-dimensional structure of interleukin 8 in solution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of interleukin 8 in solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords INTERLEUKIN-8
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2il8A00
3MTSA 4UAIA 3IL8A 1M8AA 1X32A 1ILPA 1VMPA 2KEDA 3DEOA 5JJZA 2H1EA 2EE1A 1JICA 2JYOA 2FMMA 2B2UC 1NAPA 2CVRA 4OIKA 5COYA 5EJWA 1CM9A 2B2TC 4IUPA 1WTPA 1B53A 1VMCA 1WTVA 3D6WA 2K01A 3QO2A 4MHEA 1U4PA 1QG7A 2JP1A 2L11A 2HCCA 1MI2A 1HUNA 3I91A 1AZPA 4IUTA 4XDXA 1HFGA 3H91A 1NR4A 4RA8A 1NCVA 1IKLA 1SAPA 5DNFA 3FDTA 4NW2A 3MWYW 2EOTA 1QNKA 1NR2A 1WTRA 1XYIA 4HCSA 4ZKCB 4R9WA 3DM1A 1PLFA 3G7LA 3UI2A 1CA5A 1U4MA 1EQTA 2B2YC 2N55A 1WVLA 1G91A 2Q8RE 1RODA 5CBEE 1BBXC 2EPBA 2K1BA 2K05A 1RTOA 5EKIA 1CA6A 2FJ2A 1DOLA 1XX8A 2RSNA 2KOLA 2SDFA 2RA4A 3LWEA 3Q6SA 3N52A 1G6ZA 1PFBA 1EOTA 3IFDA 5EPKA 3TZDA 1EIHA 2FFKB 1F9SA 4QUCA 1SDFA 3R93A 1C8CA 2X69A 1WTXA 5CORA 2DY7A 2B2VA 2X6GA 2MPMA 5T1IA 4HAEA 2FINB 2IL8A 5CBAE 1E0BA 1F9PA 2B2WA 2FHTA 2HUGA 3I8ZA 1TVXA 2HDMA 4XT3B 1IL8A 3KBXA 3I3CA 4RWSC 2B2TA 1RTNA 2KECA 1F9QA 4ZLTF 2L1BA 2MGSA 4CJ2C 1BF4A 1WD0A 4IUQA 1ML0D 2B2VC 1DOKA 3DEPA 4CJ1B 1PFMA 2L9HA 1IKMA 2B2YA 1U4LA 2XIWA 4X3TA 1WTQA 2VXWA 2X6LA 3GV6A 1EIGA 4MN3A 1WTOA 2MP1A 1QE6A 2R3ZA 4U68A 1X3PA 2HCIA 4DN4M 4R8IA 4ZKBB 3F2UA 1RHPA 1ICWA 3HP3A 1G2TA 1HFNA 5EPJA 2NZ1D 5D14A 1BNZA 1MSHA 2NWGA 1F2LA 1Q3LA 1BO0A 2KEEA 2L12A 1RJTA 1DZ1A 4HEDA 1MGSA 1HHVA 4IUVA 3I90A 2B2WC 1LV9A 1B2TA 2K03A 5EQ0A 5D65A 4RAUC 2RVLA 4X3KA 2DY8A 2Q8TA 4ZK9B 2L4NA 2B2UA 1B3AA 1O7ZA 4XT1B 2M2LA 1WD1A 1SSOA 1PDQA 4O42A 2KVMA 1ZXTA 2NYZD 5CMDA 1O7YA 5E4XA 4OIJA 5AFWA 1J8IA 1GUWA 1B50A 3FPUB 4HSVA 1O80A 2MJ8A 1MSGA 1G2SA 2BDNA 1PFNA 2K28A 3GV3A 1ILQA 1B4OA 3SVMA 1KNAA 4ZAIA 4X3UA 1HA6A 1AZQA 2D9UA 1DOMA 5EPLA 1A15A 1JE4A 1ESRA 2HDLA 4IURA 3ONAB 2KUMA 1S4ZA 4LMQD 1KNEA 1HUMA 1AP0A 5E4WC 1U4RA 4QUFA 2RSOA 3P7JA 5T1GA 1HRJA 4X3SA 4IUUA 3TN2A 3KUPA 2J7ZA 1J9OA 1F9RA 2K04A 1DONA 1WTWA 1EL0A 4CJ0B 1X3QA 2N88A
chains in the Genus database with same CATH superfamily
1VMPA 3L9AX 2BA1A 1CSPA 3OYYA 3GTPH 1C9OA 1QG7A 1R4PB 3GP7A 1KAWA 1HTPA 4OGQC 1XMQQ 3GTMB 1JE5A 1LTRD 3HOUG 2JN4A 2JEBI 4NW2A 5LMNQ 4JC0A 1HZ9A 1QCBD 4ME5A 1PA6A 4KMUC 4DV2Q 3H0GB 1A63A 1KQSA 1PFBA 3OTOQ 3GTLB 1SYFA 2DNEA 1TY0A 4A3LH 3GTKH 1IBMQ 4LF7Q 3PO3G 1LTTD 3EBEA 4XYOA 1N34L 1QB5D 2ID0A 4C3IB 1K8OA 4UP8A 1UEAB 4A3FH 2WP8J 1GHJA 3CCUA 4FYDA 1H9SA 3MXPA 4JBKA 2YV5A 4A3KH 1D5XC 2AHOB 2B2YA 3M9BA 5FJ8G 4B3SL 3GTMH 1LACA 4DXFA 4K8IA 2E75C 5EPJA 4DGZA 5LMNL 5D14A 4S3SA 3K0XA 2NZHA 1A62A 1L2FA 5IP9H 2XWBB 1UE7A 1WCMH 1K3BC 1EYDA 1XMQL 1XMOL 3S15H 4IUVA 4QGUA 1LV9A 2Z6KC 1DYQA 1FGUA 4POGA 4TSSA 2YU9H 1N9WA 2UUAL 4IFDI 3FKIG 1I5FA 2VQEQ 1MJEA 2K52A 3QJYA 1EY8A 1YJ9A 1TWGB 1Q12A 1D7QA 1G291 4KK7A 4ZAIA 3KLSA 3BVMA 2XN9C 1EU4A 1STBA 1JE4A 4MNOA 4IURA 2OTLA 4QQBX 5IP9G 2F0MA 1OXXK 3I73A 2A8VA 3P7JA 2VS1A 4RHSA 1TQOA 3EQLC 5FLMG 2OTJA 4KN4C 5FKAC 3KOJA 5HGQA 4MZ9A 2R7ZB 4A3DG 2EE1A 2ALYB 1Z47A 2NN6H 2E74C 4YY3Q 3H6MA 1HA5A 4LUVA 2K5QA 3VR3A 4XIGS 2JQOA 2B29A 1BCPD 2B8FA 5JPNC 2VUMB 2IJ0A 3RNUA 3EA6A 3HG9A 2R7ZG 1NR2A 1SFOH 1QWYA 4JI6L 2Z6KA 3JC66 4BBRG 4WJ4A 3PO2H 4G7HC 2UUAQ 4UY8C 2ASBA 5EKIA 2RSNA 5EAYA 3D3RA 1EEFD 1F9SA 3R93A 2X69A 3NELA 4LF9L 1SRUA 1D1IA 2OXPA 1F9PA 2B2WA 4DV3Q 2O4XA 4RWSC 2KCTA 4DXGA 1RTNA 4JI4L 1L0XB 3T13A 1C4QA 1NSNS 4K0KL 1TWFB 3HOVB 2DUDA 1WTQA 2PI2A 1GUSA 4RFBA 3NBHB 1GO3E 3F2UA 1ICWA 1X55A 3RN5A 1Y1WH 4UP7A 1Q3LA 1M4VA 3B6YA 1BO0A 3FMCA 2R92G 1H9JA 2RQXA 2JEAI 3HOVG 4TQUS 3G4SA 1KDBA 3F2BA 1LTBD 2Z4HA 2A6ED 3CCJA 3KF8A 1EYCA 3HOWB 4AQYL 5E4XA 3NWTA 2JA6G 3D0FA 3SVMA 4GOPA 3PO3B 1Q8IA 4GOPB 2D62A 1DXMA 4JI4Q 2UUBL 4OX9Q 1MJCA 1I4XA 2ZJRA 3OPOA 2K50A 2PZUA 2VL6A 4A3IH 4ZUJA 1HRJA 3WDNA 2OQKA 2XTIA 2PZWA 4QF4A 1PFSA 3J81j 5I6WA 3PF5A 3OIQA 3M4OB 1B9MA 3W1GA 2K6AA 3DWQA 2PMZB 1HTLD 2WB1B 3HKZE 5C4HA 1PH4A 4HJ9A 2AQ3B 1I4RA 1QZHA 3HOUB 4EVOA 4A3MB 1H9KA 1V9PA 2C9OA 3H94A 4HMJA 1KDCA 2LXJA 3U4ZA 3QO2A 2JE6I 1VQLA 4ODGA 1PYWD 3CP0A 3TEHB 1N8RC 1VQ6A 3I91A 3BZKA 1YHBA 2KCNA 1NCVA 2OQ0A 1SLJA 2CW0C 1LM0A 2EOTA 1TWGH 4KHPL 1XYIA 1IW7C 1L1OB 4HCSA 4A4IA 1Y1VG 3R2IA 1LLRD 1A0IA 3J7AV 5FJ8H 3S17H 2CQOA 5CV4A 1QOHA 4A3IB 1G6ZA 1JWMD 4YWKA 3CAMA 1EIHA 1BQQT 1NTGA 1SYGA 5HURA 3NP8A 2IL8A 3E0EA 1EIYB 2RDHA 1FGBD 1MBYA 1D2BA 3FKIB 2V1CC 3FVQA 1HR0Q 2IWHA 1NUCA 3WOEA 2F0JA 2QW7A 1HNZQ 4DKAC 1BR9A 4HIKA 2CCZA 1A3UA 3BDCA 5DLQE 5FLXL 4FNFA 4HCEA 3NBHA 2X6LA 4DK3C 1UE1A 2C5CA 4HMIA 4C56C 1BCPF 1ASYA 1HFNA 2SOBA 1SNCA 5C3EH 3NHHA 4A3MG 2VW9A 5EBCA 3M7GA 5C3EG 1XXGA 4V190 5C4XB 4A3CH 3VR5A 4V0BA 3T56B 3HOZB 2ZTCA 4C3IH 2RVLA 1EQVA 2I5HA 4N9PA 4QMGA 2QA4A 5KYLA 2NVXH 3NK9A 4C3IG 2UUBQ 3HOXG 1KDAA 4OX9L 1E3PA 1N32L 5CYUA 5BR8L 1GUWA 3S2DH 3GTOB 2RDFA 1FVIA 1SMXA 3AEVA 2NN6G 5JJKA 1ET9A 3IFTA 2HQLA 1A15A 1TWFH 1FJGQ 2VZAA 3SEBA 1ENAA 1SBBB 1N36Q 2IW3A 4MTNA 2CW0D 4JI0L 3TDQA 4OWTB 4BBRH 1I4GA 3GQBA 3KUPA 2RDGA 4I7AA 3TMEA 3A0JA 5M5WH 3A74A 5C3EB 5JVH3 3BG3A 1BBUA 3CXCA 2EZVA 3EN2A 5M9OA 2H1EA 1KRSA 3FPPA 1CTMA 3OMGA 3ULLA 4DUYQ 1JOQA 1BXTA 4OO1I 3T4AC 1CKNA 1Q8KA 3K81C 3CCLA 2HCCA 2ZXRA 4DV0L 3E9HA 3NPPA 5NUCA 4IOCA 4KTAA 5BN5A 4JBMA 3C46A 1YNNC 4OXPA 1LUZA 4N9TA 3WWVA 3CCQA 4Y7NB 1U4MA 2LXKA 5M3FG 1D1KA 4K6LA 4WRDA 3M3YH 5GROA 3S16B 1FJGL 5K36G 2XVSA 2Z0SA 1G51A 1TXYA 5EPKA 3QOJA 2JA6H 2ZJPA 2NBFA 1PH8A 3A8KE 2FHTA 3HOVH 5ELFA 3R8BA 1PZID 3HOUH 1HJPA 4A3BG 4R1JA 2B2VC 1IBML 1HZBA 3HRZC 2VXWA 5KNBA 3S14H 3MC0B 5ELDA 1TS2A 4IPDA 1V43A 3QOLA 2F3WA 4QB4A 4G7OC 3KF8B 5C0XJ 3VA5A 2NZ1D 1IBLL 3I2ZA 2KEEA 4JBJA 4HEDA 2N78A 1JCKB 5M5YH 1OXSC 5IYBH 4DR4Q 3NBIA 5EKKA 1F2YA 2PQEA 2K03A 3DWAA 4A3BB 5KRUA 1PHJA 2DY8A 4DR3L 1OXUA 4CBVA 5J22A 1H9RA 2KVMA 4A3KB 4GN5A 1XNRL 1KC8C 2F0NA 4JI2L 3C1EA 1M90C 4X64Q 4FF3A 1O78A 3KFUA 1ILQA 1SNDA 1ONLA 3BYTB 4JI3L 1PRTF 1YNJC 3GD7A 1V1PB 2D9UA 3A55A 3SXHA 1Y1WB 3HOWG 4TVAB 3EVQA 2CH4A 2D0OA 4B3RL 2D5DA 2VQEL 1TS3A 4LJZC 2MQHA 4QUFA 5FO9B 2EDGA 3NXWA 2NVYB 2AMCB 2E76C 2K5HA 2R92B 4ZYSA 4JVZA 5GQOA 4PNYA 4RGMA 1SROA 1X3GA 1S5DD 5EKLA 4KD4A 1M8AA 3URYA 4DU9A 1O7IA 4DNRB 1VQJA 2FMCA 2BOSA 2NVXB 2L55A 1TY2A 3D6WA 5I4DA 4JOIC 3CCRA 1U4PA 4I7ZC 1MI2A 3H91A 1NR4A 1IBKQ 4JI7Q 2EXZA 3CRKC 3RZDB 3RLFA 3STBD 5C3XA 4Z9CB 4ZKCB 4WFN3 2A5HA 4DR3Q 1PLFA 1VDZA 5M5XH 2B2YC 4DR6Q 3M4OH 1UAPA 3W2DA 3N52A 1PMRA 3KDFB 1EOTA 5DEHA 3PIPA 3G6EA 1XNQL 2UXCQ 3U58A 5C44G 2B2VA 4HJ8A 1HR0L 5LMUL 4XT3B 3H0GG 3OOCA 2PNHA 1VQ5A 4ILWA 2KECA 4ZLTF 5GAGC 1RIPA 4DV1L 1WD0A 1I6HH 5KIXA 2VUMG 1AN8A 2JA7H 4QL5A 4GKKQ 3HOZH 3IAYA 1SNMA 4A3DB 1G2TA 2L5TA 1VQ4A 3KLSX 1MSHA 4K2LA 2RCFA 1VQMA 3VYUA 1XNRQ 4F88A 1E7ZA 2NTTA 3H0GH 1Q7YC 4LF5Q 1B3QA 1NNXA 4EQPA 1H95A 2F4VL 3UDFA 1TS4A 3KJOA 1EYAA 1XNQQ 2NYZD 1O7YA 4A3EB 1SN8A 4XQNA 3OW2A 5ELCA 4ME3A 3EIVA 2ZJQA 1K8AC 3QIAA 1N32Q 2IY5B 2XRSD 3MXNA 3SHLA 1BKBA 1Y14B 1VQKA 1EFID 3MXUA 3ONAB 3RD4A 4AYBG 1SNOA 1S5FD 3CC2A 4LFBL 5IYDH 5C44H 5BN4A 1Y1VB 1GD7A 3RZDH 4C1NK 2F0TA 1Z9FA 1PTOD 3K57A 1WFQA 1Q82C 1LT4D 1BCPB 2XNAC 5AJ3Q 3WOFA 2A19A 1CQVA 1QNUA 2RHQB 1OO9B 3RUZA 1CM9A 4ZRZA 1WTPA 1GXDC 4RMFA 3D6CA 2WB1G 4IFDJ 2KA7A 1KLUD 5A2QL 1TT2A 1Q86C 4IZ8A 2VNUD 1EZ6A 2NVQH 4G4KA 3SDZA 5L37A 1XTCD 2O5JC 1RF2D 1UUPA 3IKJA 4NXML 1CA6A 2I0QA 3Q6SA 1KRTA 1K0SA 1FL0A 2EJFC 2N8NA 1K8GA 1PZJD 2X6GA 1CSQA 3CKIB 5CBAE 1E0BA 3CC4A 2R93G 5M5YB 1NMFA 2E5LQ 3T1YQ 4KN7C 2B2TA 3EROA 3BS1A 2G9HD 3G71A 3DLLA 3DEPA 3NSWA 1PH3A 1YNXA 2UXDL 4K8JA 1CQFA 2CHBD 3KDFA 4FXGC 4QIWB 3S17B 2ZTEA 4MN3A 4N8FA 3NQIA 1UE5A 4LUZA 4UPAA 2Y0SB 5M5XB 2OT2A 2F4IA 5ELNA 1LT6D 3UDGA 4PZ8A 1XWEA 3FHWA 4XYQA 1LTSD 1PH6A 5C3WA 1B2TA 2UXBQ 4A3GB 2B63B 2WINB 1Z6HA 1Q1BA 4DV7L 1O7ZA 3TZUA 3S1MH 2OF1A 4AH6A 4DUZQ 2HT1A 1QUQA 1VQGA 4RG1A 3CW2C 4ABNA 3RLNA 4DFAA 4F8MA 3X3MA 3HOYB 1HA6A 2EYJA 4XQJA 1YZ6A 2HDLA 3GTKB 1VQBA 4RGOS 4AIMA 3HKZG 3OTOL 1CI3M 1YHAA 4Q5VA 1ENCA 3S1QB 1YBYA 1BVSA 4X3SA 3SK6A 4IPCA 1WTWA 5LMUQ 2KBNA 1PVOA 2JA8B 1YNND 3J81E 3V2TA 2OCEA 1QJOA 3MTSA 3S15B 2K4KA 1AFPA 3QG1A 4CKCA 3G48A 4FXDA 3NE5B 2ENBA 4OIKA 2HQEA 2N49A 3ICEA 2JP1A 2L11A 2HHHL 1XMOQ 2JA5G 5DNFA 4OEMB 4L5TA 1IYUA 2LS01 5HY6A 4PV1C 4BY1G 4J1MA 2PQAA 3UI2A 2A74C 5CC4A 1FNUA 3VR6A 4DAMA 1DOLA 1F2MA 4JI1Q 4RCNA 3CMAA 3KF6B 3ULPA 1J5EL 1W3SA 2Q2UA 1IZ6A 2D0PA 3UDXA 1EWHA 4FVMA 2DJGC 2TSSA 4IO9A 1IL8A 1TS5A 3KJPA 3EJIA 3KBXA 4KJNA 2R7ZH 3S1NH 2F0EA 2DJFC 4PMCA 4A3GH 3E6ZX 1EOVA 3MVVA 2EYMA 1I6VC 3K7AB 4GS3A 2VQFL 2Z1CA 4A76A 1TIID 2F0DA 5FO7B 4DA2A 3J7AF 2BE5C 1MHWC 1PH5A 1EU3A 2MUYA 5A35A 2NVQB 4A3JG 5C5MA 3BVGA 4C3HB 2Y0SE 4K5VA 1V1PA 1UWVA 1B1ZA 4QY7A 1VS0A 4YY3L 2K5WA 1Y1VH 2F03A 3GTJB 4KHPQ 1D8LA 3TP8A 4XXEA 3K59A 2L4NA 5C4JB 3AQQA 5JEAJ 3PO2B 4DR2L 1NMGA 2WAQG 4OIJA 2TMPA 1NE3A 4JI5L 2MJ8A 4FXKC 4B3TL 2K28A 2IPKD 1PFNA 4ID6A 4WJWA 4DV5L 3PO3H 4FF4A 1WCMG 3AB9A 3HS0C 1XPUA 3HFZB 4L5SA 1GUTA 1KNEA 4JI2Q 3RMHA 1PTOF 3MFGA 4X64L 3J81i 2LSSA 5JEAH 2VQFQ 4LF9Q 3T53B 4NXNQ 1EL0A 1SXTA 5KEEA 1C0AA 5JVG3 1X32A 2R6GA 1I50H 2PNRC 4HJ5A 5JJLA 2I5LX 2F0GA 4A3MH 1NAPA 4KHZA 2UXDQ 4FO2A 2K01A 4EQOA 5C6AA 5GAEC 2P5ZX 4DR1Q 4NB3A 1ZEQX 3I4OA 2QF7A 1SAPA 3SK5A 4GN3B 1GUOA 3K80C 4YCUA 5BR8Q 3R3OA 1CA5A 1EQTA 1KTKA 1H9SB 1RODA 3A8IE 3P20A 1CKMA 5JPMC 2F0UA 5M3MH 2ZXPA 1RTOA 4GNXB 4FF2A 3NQTA 2A69C 4CHTB 3S2HH 2RHSB 1I94L 4DV5Q 4DUZL 4C2MB 3BYYB 1TR5A 4DR6L 2MPMA 4GKKL 2WV6D 1S72A 1SJED 2MGSA 3UDIA 1A6XA 1ML0D 4M1UB 1LO5D 3TSSA 3KK7A 2K14A 1XTDA 3A5ZB 4JYAQ 1HQMC 2XIWA 1U4LA 1PH9A 3PUZA 4LW1A 1JWUD 1P8LA 1RCVD 2MP1A 1X3PA 3HP3A 1RHPA 4BBSG 2A6HC 3IRBA 1A3TA 3I70A 3QWNA 4HN7A 1R4QB 2CH4W 5IGFA 3SGIA 3S1QH 2B2WC 1VQAA 4DV7Q 4B3TQ 5D65A 1E2ZA 4C3HG 3BDLA 4MTKA 2HHHQ 1HR0W 2UXBL 1LT5D 1S5BD 4XT1B 4FF1A 1W6JA 3GTGB 3D31A 3T1HQ 2K7VA 3W1BA 5EBDA 1S5ED 4OONA 4HIMA 3KLWA 1VQEA 1U0LA 1LTGD 3I4MB 3KLRA 1E1OA 4LF4Q 1FYCA 4DNTB 4BWGB 1X3EA 4GNXA 1JORA 3V96A 1JOOA 4JCVE 1J9OA 4X65Q 1ZYRC 4A93G 3SE0A 4AYBE 1VQCA 4LFAQ 2VUMH 4LFBQ 1SMYD 3CCSA 4L63B 3NTIA 3HEJA 2JYOA 4BY1B 3D4WA 4IUPA 4G57A 1B53A 1LTID 2XWJB 3HOYH 2BA0A 2JA5B 1HNXQ 3TBIB 4IUTA 4XDXA 2EJMA 3S2DB 3MEFA 4YHHL 5I9PA 4DNIA 1EY6A 1JB3A 2CWPA 3TREA 2NZOA 3PV0A 2A6HD 5H1SE 2Q8RE 3F2DA 2K05A 2E5LL 3Q24A 2JA8G 4GLAC 1BBWA 3S1NB 4GKJL 4JI3Q 5FLXE 4PZ7A 4HIOA 4HAEA 3K5OA 4L5QA 4A3FG 4LF7L 1OXVA 4IUNA 1Y8OB 1CKOA 3M4QA 5IGBA 4POFA 3J7YW 3VR4A 2B39A 2E2HB 2PI2E 3AYHB 1EQQA 4FDBA 5D3DA 2LY7A 2ZTDA 4RCOA 4JG2A 4XTCS 1FNWA 1T9HA 1E24A 2EYOA 3GTJH 1HCZA 1QUQB 5JAVA 1IHZA 4ZKBB 4YHHQ 3PQIA 2QKIC 2DN8A 1KXLA 4DK0A 4DK6C 3MA2B 4JOIA 3HOWH 2HIVA 4H02A 1STNA 2F0SA 2F0WA 5IP7H 3DM3A 2AQ1B 1VQNA 4A3BH 2JK8A 1CK1A 3K7AH 2EJGC 4DV0Q 4OWXB 4OELB 2LMCB 1WD1A 1E2WA 1SEBD 3H09A 1ICFB 4YWMA 4HTHA 1S40A 1NBWA 4JI5Q 1LYLA 3Q23A 1SMYC 2CFMA 4DR2Q 3F2CA 2H4OA 4QJFA 1KNAA 2Q8IB 3TP6A 4X3UA 2F0KA 1X3FA 3W5OA 3DHQA 2JA7B 2YTYA 4C3JB 1DGSA 1VF5C 1II3A 3TP5A 2R93B 4TRDA 1EY9A 1U5KA 1PTOH 1CFMA 4KKUA 1VQPA 2A68C 1HZCA 1AP0A 3I4MG 4LF6L 5J39A 1CHQD 2JJQA 2WACA 1PH1A 3OW7A 1STGA 3HOXH 3I7FA 2CWAA 3D4DA 3CMEA 4NXNL 1AE2A 4BY7B 5C0XH 3F8TA 1JJ2A 1ASZA 3MEHA 3M7NA 5C0XI 3LX0A 3K5LA 5JJZA 1SJHD 1C48A 1U9RA 1AH9A 4LF5L 1KLGD 1WJJA 5IYCH 1C7YA 4MHEA 1HH2P 2GA4B 1IW7D 5M3MB 4P73A 3I4NG 1HFGA 1K83B 4IOAA 1IKLA 2F0HA 1SE4A 3J81L 2IX3A 2BH8A 3MAQA 2E2JH 1QNKA 1WTRA 5FLMH 3DM1A 1MKHA 1WVLA 2UUCQ 2WB1E 3ERSX 2JA8H 2O5IC 1BBXC 4JI8L 1XX8A 1VF7A 2SDFA 2MNAA 3FKIH 2IX0A 3LWEA 2Z9HA 1JWSD 3V05A 4A3LG 4NKLA 1Y69U 1JMCA 2WFWA 1TWAB 4K2KA 2FINB 3S24A 3KBGA 1H9MA 4RKLA 4IJLA 3OHXC 3P75A 4C3HH 1F9QA 1M1KC 4A93H 4IUQA 2MO0A 2F3VA 5AJ3L 3J80E 4B3RQ 4HR7B 3QB3A 2GVAA 1CHPD 4ULLA 4JV5Q 2KHSA 2SEBD 5EGTA 4H44C 3GV6A 1EIGA 3O13A 4GOPC 4J15A 1D6EC 4OHJA 4KV6A 1E2VA 2QDLA 1AEXA 4R4CA 4DR5Q 2UU9Q 1XPOA 3NEMA 2HIXA 4DF7A 4K5XA 4NXMQ 1IYJB 4MIUA 1STEA 5EQ0A 1VQIA 4A75A 2Q8TA 5JEAG 3K7UC 4B3ML 1VQ8A 4QIWE 4O0AA 3M3YB 1ZXTA 2K33A 4PMWA 2V4DA 4LF6Q 4HSVA 3VR2A 1P16A 4PMBA 1HNWQ 1MSGA 2UXCL 1J6QA 1G8ZD 1SNPA 3K6OA 1AZQA 5KGUA 2KUMA 1S4ZA 1N34Q 5C44B 2PW7A 1PXUA 3U50C 4FP5D 4KLKA 3GTQB 1HQRD 1F2ZA 5M5WB 1SE3A 5IWAL 1IYVA 1X3QA 1K9MC 1GHKA 2KHIA 4NDXA 4UAIA 4GZYC 3AMUA 3S14B 1EY4A 3OWEB 3BZCA 1PYSB 2B2UC 3LNNA 5COYA 1TWCH 1WTVA 4U673 4F7XA 3AFQA 3PF4A 2RF4A 4HIDA 2PZTA 5IP7G 1PH7A 2MHVA 1A2UA 3OSOA 4BY7G 4TKOB 2L15A 1ET6A 3BVZA 1BCPC 2F4VQ 1WOCA 3G7LA 4IN3A 4P74A 3RN2A 2PQAB 1G91A 4Y7NH 1R9TB 1GUNA 2GVBA 3UE0A 1QZGA 4LNQA 5LMNW 5M3FH 3FP9A 2RA4A 3PGZA 5JOBA 4ALPA 4M8AA 1PTOC 1I6HB 3KYHC 4P72A 1CT1D 5CORA 3J80c 1CUKA 3RZOH 1TVXA 2HDMA 2PPBC 4R4IA 3ITPA 2B8GA 1BF4A 1I3QB 1PZKD 3CU7A 4KY5A 5TSSA 4QCLA 2C35B 1PFMA 2L9HA 4R4OA 4X3TA 3K8AA 5C0XG 4DN4M 1L0YB 2VB3X 3SK8A 4NMZA 2E2IB 2EQSA 3TS0A 1F2LA 1Y8NB 1VQFA 5IGEA 2BCOA 1JC7A 2QDBA 2Z6BA 2I07B 4RAUC 4JI6Q 4ZK9B 3S1MB 1NJIC 5IGCA 3J81c 1J5EQ 1DCZA 1SSOA 4O42A 1Q46A 1RL2A 3L7ZC 2EXDA 4Y52H 2CKZB 2EVBA 3SR1A 1EY7A 4CKBA 5D3IB 1Y8PB 3ER0A 4H7BA 3GTLH 2Z8LA 3HKZB 4KI0A 4KJOA 1EQRA 4CKEA 2KENA 1EWCA 2GN5A 5IYCG 5K5PA 3M85A 2XSCA 1EY0A 1PRTC 3I56A 3E9IA 1RD9D 2RSOA 4BY1H 3J80i 4P2CB 2E2IH 4LF8L 1TKWB 3T1YL 1CZGA 4A3EG 2VY3A 1IXRA 1IBKL 4APVA 4JI7L 3DEOA 5C5LA 2DNCA 2F0QA 3ERQA 3L2PA 4BXXH 2FMMA 1GKHA 5EJWA 5C4JH 1X56A 2WKDA 1K8MA 2F1MA 1KD1C 4IFDH 4X66L 3A5UA 4GN4B 1Q90A 3C2PA 4IQZA 1W6KA 4E6IA 1PRTB 2E2DC 4DV6L 5HGTA 4DK1A 3E5SA 1MD2D 2N55A 4UHVA 3A7LA 2QILA 3VA7A 1OXTA 1WTXA 5CR3A 2WKCA 5E3FA 5J3BA 2HUGA 1I50B 2AWNA 3I3CA 1XJVA 5ISRA 1DD2A 5LL6X 2ZXOA 2IHFA 2IHEA 3LWUA 1B44D 4LAAA 5FK9C 1IKMA 5C4ZA 5I2XA 5K36H 3HZXA 2H5XA 3TQYA 2R3ZA 1IBLQ 2HCIA 2MO1A 4R8IA 2IX1A 3CD6A 5FOBB 4XQQA 3HOZG 1BNZA 3K5MA 4R8NA 1EYGA 5JJIA 4DR4L 1TWAH 1GVPA 1SYBA 2J4XA 1G6PA 1MGSA 4IALA 3EFXD 4LUOA 5CGKA 4L6TB 3S2HB 2NVTH 4DAYA 1K3RA 3I4LA 1DJRD 5CV5A 3JAMi 3GDEA 4BS9A 4B3MQ 1VQOA 4I65A 3DXJC 3FPUB 4C3JG 1O80A 1SYEA 4DAPA 4YCWA 1I4HA 3E3XA 1YNJD 5EPLA 3BZDB 1YVCA 3C1FA 3M4PA 1ESRA 3MXNB 2KCCA 4KY7A 2WAQE 4BY7H 1X9NA 3FEWX 5E4WC 4JYAL 3GTOH 1JT8A 2M00A 4IUUA 2J7ZA 1TWCB 2K5NA 1DONA 4A3IG 2OWOA 4CDFC 4K0KQ 3DUZA 1VCIA 1STAA 2K5DA 4LK1C 2N88A 1X54A 4L8JA 4B3SQ 1IL2A 2CVRA 2EYLA 4IFDG 3I4NH 1D5MC 1V1OA 4Q0FA 3VYRA 4N8X1 2R93H 1RKNA 2AKWB 1N33Q 2EY5A 1W2BA 3PMFA 2Q2HA 3U9OA 4IPGA 3VYTA 5C4XH 4PQXA 4ZUIA 3FDTA 2JA9A 4B08A 4R9WA 1NY4A 3GTQH 3TRZA 3S1RH 4HSPA 2KOLA 4EQNA 2EIFA 2ICIA 2WIIB 3IFDA 4F87A 2FFKB 2NB0A 4C2MH 1I3QH 1SDFA 2RKSA 3S9WA 2DY7A 3STBC 1GOZA 5IT9c 1L0WA 4JI8Q 3A7AB 4DV1Q 4GNXC 3GO5A 1JJGA 5CV9A 1I4PA 3PO2G 1I4QA 2NTSA 2JA6B 1DOKA 3I4NB 1R9TH 1WYDA 3KF6A 5I9OA 3AU7A 3I55A 4CDEC 1HNXL 5M3FB 1QE6A 4LF8Q 3PIO3 2ATWA 3H3VC 1KAAA 5ELEA 5IYBG 4JV5L 2L12A 4IPHA 3NWSA 4JBWA 1A2TA 1EWIA 3I90A 5G3LD 1YJWA 3PUYA 5ELBA 3JAME 1GM5A 1CZWA 4A93B 1YHQA 4A3CG 2B63H 1KABA 5G3LF 1PDQA 1MIUA 5CMDA 2JA7G 2AWOA 1E22A 5FO8B 4K5WA 3CC7A 2Z4IA 1FNVA 3A54A 2PO4A 2E2HH 2XGTA 3F1ZA 4LMQD 1L1OC 3L3OC 1Q1EA 2QGQA 3D4RA 1L1OA 2F0OA 1JJCB 1KL9A 5IODA 2ZM6Q 2PMZE 3E0JA 4BBRB 3T16A 3NTHA 4BBSB 1VMCA 3PIOA 5C4XG 3P1HA 4KKTA 3NENA 4DR7Q 5KNCA 1HZAA 2KJXA 5J1ZA 2EYPA 4X66Q 2O2LD 3BJUA 3CHBD 2VB2X 1ZYRD 5CBEE 1RDPD 3Q8DA 3GTGH 2NUCA 4C3JH 4DV6Q 2A6EC 1B8AA 2OEOA 2UUCL 4X62Q 2F0FA 3A56A 3H3VI 4BA2I 1HXYD 3TZDA 4RH6A 3HOYG 3T1HL 3PSIA 4QUCA 2PCFB 3K5NA 5T1IA 2BH2A 1VQ7A 3HGBA 3S16H 1N36L 3I8ZA 3ZJYC 2QEXA 2F52A 4B9XA 3RR5A 2L1BA 4RKBA 4EQ5A 4WJ3M 2RCNA 3NTKA 2N3SA 3CF5A 1K83H 4O2DA 2ZT9C 3DMUA 4YIJA 4LFCL 4DR7L 2E2JB 1WTOA 2CQAA 4U68A 2Q2TA 2NVTB 4YWLA 1LTAD 2AQ2B 3S1RB 3M4YA 3JAMc 3UE1A 1EFWA 2NWGA 1QVFA 3N6RA 1YI2A 1RJTA 3I72A 3RZOB 1DZ1A 2YTVA 4JK1C 2D2CC 4IJHA 3I4MH 1SE2A 3CPWA 1SR3A 3PUVA 4ZQ3A 3U9SA 1PV4A 4OO1G 2PYKA 1TU2B 5AFWA 5I2YA 1ESFA 1WI5A 3VDYA 1XPRA 2BDNA 4BXXG 1B4OA 2EY2A 1DM0B 3GTPB 4G7ZC 4BBSH 2HD3A 2A1AA 2FXQA 1UNSA 5LL6S 1K73C 4GKJQ 2WAQB 1JOKA 3NUCA 1GUGA 1VQHA 3OWFA 1FD7D 1VQDA 4OO1H 3CQZH 4DR5L 3D8GA 5M3MG 2UU9L 1X6OA 3IL8A 1KIXA 3ULJA 1HNZL 4LFCQ 1JICA 2AUKA 4GLXA 1SYDA 2B2TC 1PYBA 4DPGA 1AE3A 4DAYB 4X62L 1EUJA 4NPSA 4RA8A 2A68D 1N33L 3JAML 2AUJD 3DWPA 2JSOA 4DV2L 3AFPA 2JXMB 1KHIA 1T5XD 1HNWL 1STYA 5IY0A 4P75A 3Q22A 2M9VA 4JI1L 1JB7A 1GJXA 5IGGA 1PTOB 4A3EH 2FJ2A 1PRTD 3CCEA 4OWWB 3H3VH 1FR3A 4CDDC 2BE5D 4A3JH 1S5CD 3H15A 1STHA 5LHY1 2KQ3A 1YITA 4RGNA 1BDOA 5E7NA 3BDOA 1Y1WG 1EZ8A 2F0VA 2F0LA 3MHBA 4OL7A 4CJ2C 5IT9L 4NP5A 4PG3A 4X65L 2YU9B 4K14A 4A3KG 1BOSA 5F2DA 2SNMA 5IWAQ 4CJ1B 3PUXA 4LFAL 2B3GA 2E8GA 4RHRA 3L0OA 3VYSA 2R7DA 4DV3L 2KHJA 3W3AA 1B7YB 4UP9A 5IT9E 1SNQA 1WTHA 3CCVA 5GAHC 4B9WA 4DAVA 2ZM6L 2SNSA 4DV4L 5KNDA 1K0RA 4BA1I 1TWHB 1Z7TA 4CGYB 1S3OA 5A2QE 1QILA 3HKSA 3LGJA 1LTLA 1UEBA 1X65A 4X3KA 3T51B 3CCMA 4A3FB 3R2TA 2YTXA 2B2UA 1B3AA 3K58A 1YJNA 3CQZB 4KD3A 1WCMB 3MXGA 1J8IA 5IE8A 1SE8A 4KHVA 1G2SA 3ND8A 2I46A 1B9NA 4JPBW 1DOMA 4J8QA 2R7FA 3CRLC 1HPCA 1ZKOA 4JI0Q 1O7LA 2NN6I 5T1GA 5I6YA 3J80L 2A73B 3TN2A 5CV6A 2NVYH 1A3VA 4A3GG 1SYCA 1YEZA 1B70B 1YIJA 4DUYL 2PW5A 1ILPA 2EYHA 2KEDA 3MFYA 4A3JB 1CKNB 4DR1L 4R4QA 3PUWA 2Y0SG 4P71A 2QCPX 1BUVT 2XRQD 2K75A 1EEID 2JA5H 1JQYD 4EX5A 4H0LC 3J7A5 4EGVA 1HUNA 1AZPA 3FRPB 4ZCKA 3MZ5A 1AW7A 3A8JE 4H13C 3MWYW 1LABA 3PCOB 4RGTA 5DM73 2G9DA 4WORA 2YYZA 4JW0A 3U4VA 4O1NA 3ZYYX 1K28A 2EPBA 2K1BA 3BU2A 1I94Q 1F77A 4J6HA 2IT1A 4CDCC 2A69D 1V1QA 1SFOB 3OIPA 4PZ6A 5DAUA 2DGYA 2RBMA 1Q81C 3G6JB 1C8CA 2BDOA 2K32A 3PIP3 2LFNA 2EY6A 3ND9A 4GLVB 1TWHH 2EY1A 1D5ZC 4UDUC 5IIFA 3J7ZC 4R4TA 4KY6A 3SK4A 5FLXc 1VQ9A 1QVCA 1OTCA 3CPFA 4L5RC 4DV4Q 3HOXB 1E1TA 5IGDA 5GADC 3OMCA 2MFIA 3TP7A 5CV8A 4K6DA 3RLOA 4HJ7A 3K0YA 4A3DH 5ELOA 2R92H 2R61A 2ES2A 1QVGA 1HHVA 4X6AH 2KCMA 2F3IA 1EIFA 2EYFA 1EY5A 2J0TD 2QEJC 5DM63 4AQYQ 2M2LA 5BN3A 2L0CA 1PH2A 2F0PA 2Q2IA 4KKSA 1B50A 2LKVA 4AYBB 2ICEC 4C1NI 2F0IA 3GV3A 2G5DA 4HJAA 5IOCA 4YCVA 1V8QA 3X3NA 5IYDG 1T5EA 5E1FA 1A8VA 4LF4L 1ENFA 2I5MX 1HUMA 1U4RA 2K5VA 3QR8A 5CV7A 2B63G 1LT3D 3Q0AA 3TS2A 1JR0D 1F9RA 2K04A 5KYIA 4CJ0B 1UE6A 4LWCA 3C3LA
chains in the Genus database with same CATH topology
1VMPA 3L9AX 2BA1A 1QG7A 1R4PB 3GP7A 1HTPA 4OGQC 3GTMB 1LTRD 2JEBI 4NW2A 1QCBD 4ME5A 4KMUC 3H0GB 1PFBA 3GTLB 1SYFA 2DNEA 1TY0A 1LTTD 4XYOA 1QB5D 2ID0A 4C3IB 1K8OA 1UEAB 2WP8J 1GHJA 4FYDA 1H9SA 3MXPA 1D5XC 2B2YA 1LACA 4DXFA 4K8IA 2E75C 5EPJA 4DGZA 5D14A 4S3SA 2XWBB 1EYDA 4IUVA 1LV9A 1DYQA 4TSSA 4IFDI 3QJYA 1EY8A 1TWGB 1Q12A 1G291 4KK7A 4ZAIA 3KLSA 3BVMA 2XN9C 1EU4A 1STBA 1JE4A 4IURA 2F0MA 1OXXK 3I73A 3P7JA 4RHSA 1TQOA 3EQLC 4KN4C 5FKAC 2R7ZB 2EE1A 1Z47A 2NN6H 2E74C 3H6MA 1HA5A 3VR3A 2K5QA 4XIGS 1BCPD 2B8FA 5JPNC 2VUMB 2IJ0A 3EA6A 3HG9A 1NR2A 1QWYA 4G7HC 5EKIA 2RSNA 3D3RA 1EEFD 1F9SA 3R93A 2X69A 1D1IA 2OXPA 1F9PA 2B2WA 2O4XA 4RWSC 4DXGA 1RTNA 1L0XB 3T13A 1C4QA 1NSNS 1TWFB 3HOVB 1WTQA 1GUSA 4RFBA 3F2UA 1ICWA 1Q3LA 1M4VA 1BO0A 3FMCA 1H9JA 2RQXA 2JEAI 4TQUS 1KDBA 1LTBD 2Z4HA 2A6ED 3KF8A 1EYCA 3HOWB 5E4XA 3NWTA 3SVMA 3PO3B 1Q8IA 2D62A 1DXMA 1I4XA 3OPOA 2PZUA 1HRJA 4ZUJA 3WDNA 2PZWA 4QF4A 5I6WA 3OIQA 3M4OB 1B9MA 2K6AA 3DWQA 2PMZB 1HTLD 2WB1B 5C4HA 2AQ3B 1I4RA 3HOUB 4EVOA 4A3MB 1H9KA 2C9OA 3H94A 4HMJA 1KDCA 3QO2A 2JE6I 4ODGA 1PYWD 3I91A 2KCNA 1NCVA 2CW0C 2EOTA 1XYIA 1IW7C 4HCSA 3R2IA 1LLRD 3J7AV 5CV4A 1QOHA 4A3IB 1G6ZA 1JWMD 1EIHA 1BQQT 1SYGA 5HURA 3NP8A 2IL8A 2RDHA 1FGBD 1MBYA 1D2BA 3FKIB 3FVQA 2IWHA 3WOEA 1NUCA 2F0JA 1BR9A 1A3UA 3BDCA 5FLXL 4FNFA 4HCEA 3NBHA 2X6LA 2C5CA 4HMIA 4C56C 1BCPF 1HFNA 2SOBA 1SNCA 3NHHA 5EBCA 3M7GA 1XXGA 4V190 5C4XB 3VR5A 4V0BA 3T56B 3HOZB 2RVLA 1EQVA 4N9PA 4QMGA 5KYLA 3NK9A 4C3IG 1KDAA 5CYUA 1GUWA 3GTOB 2RDFA 2NN6G 1ET9A 3IFTA 1A15A 3SEBA 1SBBB 1ENAA 2IW3A 2CW0D 3TDQA 1I4GA 3GQBA 3KUPA 2RDGA 3TMEA 5C3EB 5JVH3 3BG3A 2EZVA 5M9OA 2H1EA 3FPPA 1CTMA 3OMGA 1JOQA 1BXTA 4OO1I 3T4AC 2HCCA 2ZXRA 3NPPA 5NUCA 4KTAA 5BN5A 3C46A 1YNNC 4N9TA 4Y7NB 1U4MA 1D1KA 4K6LA 4WRDA 3S16B 5K36G 2XVSA 5EPKA 3QOJA 2NBFA 3A8KE 2FHTA 5ELFA 3R8BA 1PZID 2B2VC 3HRZC 2VXWA 5KNBA 3MC0B 5ELDA 1TS2A 1V43A 4G7OC 3QOLA 2F3WA 4QB4A 5C0XJ 3VA5A 2NZ1D 2KEEA 4HEDA 1JCKB 1OXSC 3NBIA 5EKKA 1F2YA 2PQEA 2K03A 3DWAA 4A3BB 5KRUA 2DY8A 1OXUA 4CBVA 5J22A 1H9RA 2KVMA 4A3KB 2F0NA 3C1EA 4FF3A 1O78A 1ILQA 1SNDA 1ONLA 3BYTB 3SXHA 1PRTF 1YNJC 3GD7A 1Y1WB 1V1PB 2D9UA 3A55A 3EVQA 2D5DA 1TS3A 4LJZC 4QUFA 5FO9B 2EDGA 3NXWA 2NVYB 2E76C 2R92B 4ZYSA 4PNYA 4RGMA 5EKLA 1S5DD 4KD4A 1M8AA 3URYA 4DU9A 4DNRB 2FMCA 2BOSA 2NVXB 2L55A 1TY2A 3D6WA 5I4DA 1U4PA 4I7ZC 1MI2A 3H91A 1NR4A 2EXZA 3CRKC 3RZDB 3RLFA 5C3XA 4Z9CB 4ZKCB 4WFN3 2A5HA 1PLFA 1VDZA 2B2YC 1UAPA 3W2DA 3N52A 1PMRA 1EOTA 5DEHA 2B2VA 4XT3B 3OOCA 4ILWA 2KECA 4ZLTF 1WD0A 5KIXA 1AN8A 3IAYA 1SNMA 4A3DB 1G2TA 2L5TA 3KLSX 1MSHA 4K2LA 3VYUA 4F88A 2NTTA 4EQPA 1TS4A 1EYAA 2NYZD 1O7YA 4A3EB 4XQNA 5ELCA 3QIAA 2XRSD 3MXNA 3SHLA 1EFID 3MXUA 3ONAB 3RD4A 1SNOA 1S5FD 5BN4A 1Y1VB 4C1NK 2F0TA 3K57A 1PTOD 1LT4D 1BCPB 2XNAC 3WOFA 1CQVA 1QNUA 1OO9B 3RUZA 1CM9A 4ZRZA 1WTPA 1GXDC 3D6CA 4IFDJ 2KA7A 1KLUD 5A2QL 1TT2A 4IZ8A 2VNUD 1EZ6A 4G4KA 3SDZA 1XTCD 2O5JC 1RF2D 1UUPA 3IKJA 1CA6A 3Q6SA 2EJFC 1PZJD 2X6GA 3CKIB 5CBAE 1E0BA 5M5YB 4KN7C 2B2TA 3EROA 3BS1A 2G9HD 3DEPA 3NSWA 4K8JA 1CQFA 2CHBD 4FXGC 4QIWB 3S17B 4MN3A 3NQIA 2Y0SB 5M5XB 2OT2A 2F4IA 1LT6D 1XWEA 4XYQA 1LTSD 5C3WA 1B2TA 4A3GB 2B63B 2WINB 1Z6HA 1Q1BA 1O7ZA 3TZUA 2OF1A 4ABNA 4DFAA 4F8MA 3X3MA 3HOYB 1HA6A 2EYJA 4XQJA 3GTKB 2HDLA 4RGOS 1CI3M 4Q5VA 1ENCA 3S1QB 4X3SA 3SK6A 1WTWA 2JA8B 1YNND 3J81E 3V2TA 1QJOA 3MTSA 3S15B 1AFPA 3QG1A 4CKCA 4FXDA 3NE5B 2ENBA 4OIKA 2HQEA 2JP1A 2L11A 5DNFA 1IYUA 2LS01 4PV1C 4J1MA 3UI2A 2A74C 5CC4A 1FNUA 3VR6A 1DOLA 1F2MA 4RCNA 1EWHA 4FVMA 2TSSA 1IL8A 1TS5A 3EJIA 3KBXA 4KJNA 2F0EA 4PMCA 3E6ZX 3MVVA 2EYMA 1I6VC 3K7AB 2Z1CA 1TIID 2F0DA 5FO7B 3J7AF 4DA2A 2BE5C 1EU3A 2MUYA 5A35A 2NVQB 5C5MA 3BVGA 4C3HB 4K5VA 1V1PA 1B1ZA 2K5WA 2F03A 3GTJB 3TP8A 4XXEA 3K59A 2L4NA 5C4JB 5JEAJ 3PO2B 4OIJA 2TMPA 2MJ8A 4FXKC 2K28A 2IPKD 1PFNA 4ID6A 4WJWA 4FF4A 3AB9A 3HS0C 1GUTA 1KNEA 3RMHA 1PTOF 3MFGA 5JEAH 3T53B 1EL0A 1SXTA 5KEEA 5JVG3 1X32A 2R6GA 2PNRC 2F0GA 1NAPA 4KHZA 4FO2A 2K01A 4EQOA 5C6AA 1ZEQX 2QF7A 1SAPA 3SK5A 1GUOA 3R3OA 1CA5A 1EQTA 1KTKA 1H9SB 1RODA 3A8IE 3P20A 5JPMC 2F0UA 2ZXPA 1RTOA 4FF2A 3NQTA 2A69C 4CHTB 4C2MB 3BYYB 1TR5A 2MPMA 2WV6D 1SJED 2MGSA 1A6XA 1ML0D 4M1UB 1LO5D 3TSSA 3KK7A 1HQMC 2XIWA 1U4LA 3PUZA 1JWUD 1RCVD 2MP1A 1X3PA 3HP3A 1RHPA 2A6HC 1A3TA 3I70A 3QWNA 4HN7A 1R4QB 5IGFA 2B2WC 5D65A 1E2ZA 4C3HG 3BDLA 1LT5D 1S5BD 4XT1B 4FF1A 1W6JA 3GTGB 3D31A 2K7VA 5EBDA 1S5ED 1LTGD 3I4MB 3KLRA 1FYCA 4DNTB 4BWGB 1JORA 3V96A 1JOOA 1J9OA 1ZYRC 3SE0A 1SMYD 4L63B 3NTIA 3HEJA 2JYOA 4BY1B 3D4WA 4IUPA 4G57A 1B53A 1LTID 2XWJB 2BA0A 2JA5B 3TBIB 4IUTA 4XDXA 2EJMA 3S2DB 5I9PA 1EY6A 1JB3A 3PV0A 2A6HD 2Q8RE 2K05A 3Q24A 3S1NB 5FLXE 4HAEA 3K5OA 1OXVA 4IUNA 1Y8OB 5IGBA 3J7YW 3VR4A 2B39A 2E2HB 5D3DA 2LY7A 4RCOA 4XTCS 1FNWA 2EYOA 1HCZA 5JAVA 1IHZA 4ZKBB 2QKIC 2DN8A 4DK0A 3MA2B 1STNA 2F0SA 2F0WA 2AQ1B 1CK1A 2EJGC 2LMCB 1WD1A 1E2WA 1SEBD 3H09A 4HTHA 3Q23A 1SMYC 2H4OA 1KNAA 2Q8IB 3TP6A 4X3UA 2F0KA 3DHQA 2JA7B 4C3JB 3TP5A 1VF5C 1II3A 2R93B 4TRDA 1EY9A 1PTOH 1CFMA 4KKUA 2A68C 1AP0A 5J39A 1CHQD 2WACA 3OW7A 1STGA 3D4DA 4BY7B 5C0XH 3M7NA 3MEHA 5C0XI 3LX0A 3K5LA 5JJZA 1SJHD 1C48A 1U9RA 1KLGD 4MHEA 2GA4B 1IW7D 5M3MB 1HFGA 1K83B 1IKLA 2F0HA 1SE4A 3J81L 2IX3A 3MAQA 1QNKA 1WTRA 3DM1A 1WVLA 2O5IC 1BBXC 1XX8A 1VF7A 2SDFA 2IX0A 3LWEA 3V05A 1JWSD 4NKLA 1Y69U 1TWAB 4K2KA 2FINB 3KBGA 1H9MA 4RKLA 3OHXC 3P75A 1F9QA 4IUQA 3J80E 2F3VA 4HR7B 3QB3A 4ULLA 1CHPD 2KHSA 2SEBD 5EGTA 4H44C 3GV6A 1EIGA 3O13A 1D6EC 4OHJA 4KV6A 1E2VA 1AEXA 4DF7A 4K5XA 4MIUA 1STEA 5EQ0A 2Q8TA 5JEAG 3M3YB 1ZXTA 2K33A 4PMWA 2V4DA 4HSVA 3VR2A 4PMBA 1MSGA 1G8ZD 1SNPA 3K6OA 1AZQA 5KGUA 2KUMA 1S4ZA 5C44B 2PW7A 1PXUA 4FP5D 3GTQB 1HQRD 1F2ZA 5M5WB 1SE3A 1IYVA 1X3QA 1GHKA 4NDXA 4UAIA 4GZYC 3AMUA 3S14B 1EY4A 3OWEB 2B2UC 3LNNA 5COYA 1WTVA 4U673 4F7XA 2PZTA 2MHVA 1A2UA 3OSOA 4TKOB 1ET6A 3BVZA 1BCPC 3G7LA 4IN3A 1G91A 1R9TB 1GUNA 2RA4A 5JOBA 4M8AA 1PTOC 1I6HB 1CT1D 5CORA 1TVXA 2HDMA 2PPBC 3ITPA 2B8GA 1BF4A 1I3QB 1PZKD 3CU7A 4KY5A 5TSSA 4QCLA 1PFMA 2L9HA 4X3TA 5C0XG 4DN4M 1L0YB 2VB3X 3SK8A 4NMZA 2E2IB 1F2LA 1Y8NB 5IGEA 2BCOA 1JC7A 2QDBA 2I07B 4RAUC 4ZK9B 3S1MB 5IGCA 1DCZA 1SSOA 4O42A 3L7ZC 2EVBA 3SR1A 1EY7A 4CKBA 5D3IB 1Y8PB 4H7BA 2Z8LA 3HKZB 4KI0A 4KJOA 4CKEA 1EWCA 5K5PA 3M85A 2XSCA 1EY0A 1PRTC 1RD9D 2RSOA 4P2CB 1TKWB 1CZGA 3DEOA 5C5LA 2DNCA 2F0QA 3ERQA 2FMMA 5EJWA 2WKDA 1K8MA 2F1MA 4IFDH 1Q90A 3C2PA 4IQZA 1W6KA 4E6IA 1PRTB 2E2DC 5HGTA 4DK1A 3E5SA 1MD2D 2N55A 3A7LA 2QILA 3VA7A 1OXTA 1WTXA 5CR3A 2WKCA 5E3FA 2HUGA 1I50B 2AWNA 3I3CA 5ISRA 1DD2A 5LL6X 2ZXOA 3LWUA 1B44D 4LAAA 5FK9C 1IKMA 5C4ZA 5I2XA 5K36H 3HZXA 2R3ZA 2IX1A 2HCIA 4R8IA 5FOBB 4XQQA 1BNZA 3K5MA 4R8NA 1SYBA 2J4XA 1MGSA 4IALA 3EFXD 5CGKA 4L6TB 3S2HB 4DAYA 3I4LA 1DJRD 5CV5A 4BS9A 4I65A 3DXJC 3FPUB 4C3JG 1O80A 1SYEA 4DAPA 1I4HA 1YNJD 5EPLA 3BZDB 3C1FA 1ESRA 2KCCA 4KY7A 3FEWX 5E4WC 2M00A 4IUUA 2J7ZA 1TWCB 1DONA 3DUZA 1VCIA 1STAA 2K5DA 4LK1C 2N88A 4L8JA 2CVRA 2EYLA 4IFDG 1D5MC 1V1OA 4Q0FA 3VYRA 1RKNA 2EY5A 3PMFA 3U9OA 3VYTA 4PQXA 4ZUIA 3FDTA 4B08A 4R9WA 4HSPA 2KOLA 4EQNA 2ICIA 2WIIB 3IFDA 4F87A 2FFKB 2NB0A 1SDFA 2RKSA 3S9WA 2DY7A 1GOZA 3A7AB 3GO5A 5CV9A 1I4PA 1I4QA 2NTSA 2JA6B 1DOKA 3I4NB 5I9OA 3AU7A 5M3FB 1QE6A 3PIO3 3H3VC 1KAAA 5ELEA 2L12A 3NWSA 4JBWA 1A2TA 3I90A 5G3LD 3PUYA 5ELBA 3JAME 1CZWA 4A93B 1KABA 5G3LF 1PDQA 5CMDA 2AWOA 5FO8B 4K5WA 2Z4IA 1FNVA 3A54A 2PO4A 4LMQD 3L3OC 1Q1EA 3D4RA 2F0OA 5IODA 3E0JA 4BBRB 3T16A 3NTHA 4BBSB 1VMCA 3P1HA 4KKTA 5KNCA 2KJXA 5J1ZA 2EYPA 2O2LD 3CHBD 2VB2X 1ZYRD 5CBEE 1RDPD 2NUCA 2A6EC 2OEOA 2F0FA 3A56A 4BA2I 1HXYD 3TZDA 4RH6A 4QUCA 2PCFB 3K5NA 5T1IA 3HGBA 3I8ZA 4B9XA 2L1BA 4RKBA 3NTKA 2ZT9C 3DMUA 4YIJA 2E2JB 1WTOA 2CQAA 4U68A 2NVTB 1LTAD 2AQ2B 3S1RB 3M4YA 2NWGA 3N6RA 1RJTA 3I72A 3RZOB 1DZ1A 4JK1C 2D2CC 1SE2A 3PUVA 4ZQ3A 3U9SA 4OO1G 2PYKA 1TU2B 5AFWA 5I2YA 1ESFA 2BDNA 1B4OA 2EY2A 1DM0B 3GTPB 4G7ZC 1UNSA 5LL6S 2WAQB 1JOKA 3NUCA 1GUGA 3OWFA 1FD7D 4OO1H 3D8GA 3IL8A 1JICA 2AUKA 1SYDA 2B2TC 4RA8A 2A68D 3JAML 2AUJD 3DWPA 2JSOA 2JXMB 1T5XD 1STYA 3Q22A 2M9VA 1GJXA 5IGGA 1PTOB 2FJ2A 1PRTD 1FR3A 2BE5D 1S5CD 1STHA 5LHY1 2KQ3A 4RGNA 1BDOA 3BDOA 1EZ8A 2F0VA 2F0LA 3MHBA 4OL7A 4CJ2C 5IT9L 4NP5A 2YU9B 4K14A 1BOSA 5F2DA 2SNMA 4CJ1B 3PUXA 4RHRA 3VYSA 3W3AA 5IT9E 1SNQA 4DAVA 4B9WA 2SNSA 5KNDA 4BA1I 1TWHB 1Z7TA 4CGYB 5A2QE 1QILA 4X3KA 3T51B 4A3FB 3R2TA 2B2UA 1B3AA 3K58A 3CQZB 4KD3A 1WCMB 3MXGA 1J8IA 4KHVA 1G2SA 3ND8A 2I46A 1B9NA 1DOMA 4J8QA 3CRLC 1HPCA 1ZKOA 1O7LA 2NN6I 5T1GA 5I6YA 3J80L 2A73B 3TN2A 5CV6A 1A3VA 1SYCA 2PW5A 1ILPA 2EYHA 2KEDA 3MFYA 4A3JB 3PUWA 2QCPX 1BUVT 2XRQD 1EEID 1JQYD 4H0LC 4EGVA 1HUNA 1AZPA 3FRPB 3MZ5A 1AW7A 3A8JE 4H13C 3MWYW 1LABA 4RGTA 5DM73 2G9DA 4WORA 2YYZA 4O1NA 3ZYYX 2EPBA 2K1BA 1F77A 4J6HA 2IT1A 2A69D 1SFOB 3OIPA 5DAUA 2RBMA 3G6JB 1C8CA 2BDOA 2K32A 3PIP3 2LFNA 2EY6A 3ND9A 2EY1A 1D5ZC 4UDUC 5IIFA 4KY6A 3SK4A 3HOXB 5IGDA 3OMCA 3TP7A 5CV8A 4K6DA 3K0YA 2R61A 1HHVA 2EYFA 1EY5A 2J0TD 2QEJC 5DM63 2M2LA 5BN3A 2L0CA 2F0PA 4KKSA 1B50A 2LKVA 4AYBB 2ICEC 4C1NI 2F0IA 3GV3A 5IOCA 1V8QA 3X3NA 1T5EA 5E1FA 1ENFA 1HUMA 1U4RA 5CV7A 1LT3D 3Q0AA 1JR0D 1F9RA 2K04A 5KYIA 4CJ0B 3C3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MTS A;  4UAI A;  3IL8 A;  1M8A A;  1X32 A;  1ILP A;  1VMP A;  2KED A;  3DEO A;  5JJZ A;  2H1E A;  2EE1 A;  1JIC A;  2JYO A;  2FMM A;  2B2U C;  1NAP A;  2CVR A;  4OIK A;  5COY A;  5EJW A;  1CM9 A;  2B2T C;  4IUP A;  1WTP A;  1B53 A;  1VMC A;  1WTV A;  3D6W A;  2K01 A;  3QO2 A;  4MHE A;  1U4P A;  1QG7 A;  2JP1 A;  2L11 A;  2HCC A;  1MI2 A;  1HUN A;  3I91 A;  1AZP A;  4IUT A;  4XDX A;  1HFG A;  3H91 A;  1NR4 A;  4RA8 A;  1NCV A;  1IKL A;  1SAP A;  5DNF A;  3FDT A;  4NW2 A;  3MWY W;  2EOT A;  1QNK A;  1NR2 A;  1WTR A;  1XYI A;  4HCS A;  4ZKC B;  4R9W A;  3DM1 A;  1PLF A;  3G7L A;  3UI2 A;  1CA5 A;  1U4M A;  1EQT A;  2B2Y C;  2N55 A;  1WVL A;  1G91 A;  2Q8R E;  1ROD A;  5CBE E;  1BBX C;  2EPB A;  2K1B A;  2K05 A;  1RTO A;  5EKI A;  1CA6 A;  2FJ2 A;  1DOL A;  1XX8 A;  2RSN A;  2KOL A;  2SDF A;  2RA4 A;  3LWE A;  3Q6S A;  3N52 A;  1G6Z A;  1PFB A;  1EOT A;  3IFD A;  5EPK A;  3TZD A;  1EIH A;  2FFK B;  1F9S A;  4QUC A;  1SDF A;  3R93 A;  1C8C A;  2X69 A;  1WTX A;  5COR A;  2DY7 A;  2B2V A;  2X6G A;  2MPM A;  5T1I A;  4HAE A;  2FIN B;  2IL8 A;  5CBA E;  1E0B A;  1F9P A;  2B2W A;  2FHT A;  2HUG A;  3I8Z A;  1TVX A;  2HDM A;  4XT3 B;  1IL8 A;  3KBX A;  3I3C A;  4RWS C;  2B2T A;  1RTN A;  2KEC A;  1F9Q A;  4ZLT F;  2L1B A;  2MGS A;  4CJ2 C;  1BF4 A;  1WD0 A;  4IUQ A;  1ML0 D;  2B2V C;  1DOK A;  3DEP A;  4CJ1 B;  1PFM A;  2L9H A;  1IKM A;  2B2Y A;  1U4L A;  2XIW A;  4X3T A;  1WTQ A;  2VXW A;  2X6L A;  3GV6 A;  1EIG A;  4MN3 A;  1WTO A;  2MP1 A;  1QE6 A;  2R3Z A;  4U68 A;  1X3P A;  2HCI A;  4DN4 M;  4R8I A;  4ZKB B;  3F2U A;  1RHP A;  1ICW A;  3HP3 A;  1G2T A;  1HFN A;  5EPJ A;  2NZ1 D;  5D14 A;  1BNZ A;  1MSH A;  2NWG A;  1F2L A;  1Q3L A;  1BO0 A;  2KEE A;  2L12 A;  1RJT A;  1DZ1 A;  4HED A;  1MGS A;  1HHV A;  4IUV A;  3I90 A;  2B2W C;  1LV9 A;  1B2T A;  2K03 A;  5EQ0 A;  5D65 A;  4RAU C;  2RVL A;  4X3K A;  2DY8 A;  2Q8T A;  4ZK9 B;  2L4N A;  2B2U A;  1B3A A;  1O7Z A;  4XT1 B;  2M2L A;  1WD1 A;  1SSO A;  1PDQ A;  4O42 A;  2KVM A;  1ZXT A;  2NYZ D;  5CMD A;  1O7Y A;  5E4X A;  4OIJ A;  5AFW A;  1J8I A;  1GUW A;  1B50 A;  3FPU B;  4HSV A;  1O80 A;  2MJ8 A;  1MSG A;  1G2S A;  2BDN A;  1PFN A;  2K28 A;  3GV3 A;  1ILQ A;  1B4O A;  3SVM A;  1KNA A;  4ZAI A;  4X3U A;  1HA6 A;  1AZQ A;  2D9U A;  1DOM A;  5EPL A;  1A15 A;  1JE4 A;  1ESR A;  2HDL A;  4IUR A;  3ONA B;  2KUM A;  1S4Z A;  4LMQ D;  1KNE A;  1HUM A;  1AP0 A;  5E4W C;  1U4R A;  4QUF A;  2RSO A;  3P7J A;  5T1G A;  1HRJ A;  4X3S A;  4IUU A;  3TN2 A;  3KUP A;  2J7Z A;  1J9O A;  1F9R A;  2K04 A;  1DON A;  1WTW A;  1EL0 A;  4CJ0 B;  1X3Q A;  2N88 A; 
#chains in the Genus database with same CATH topology
 1VMP A;  3L9A X;  2BA1 A;  1CSP A;  3OYY A;  3GTP H;  1C9O A;  1QG7 A;  1R4P B;  3GP7 A;  1KAW A;  1HTP A;  4OGQ C;  1XMQ Q;  3GTM B;  1JE5 A;  1LTR D;  3HOU G;  2JN4 A;  2JEB I;  4NW2 A;  5LMN Q;  4JC0 A;  1HZ9 A;  1QCB D;  4ME5 A;  1PA6 A;  4KMU C;  4DV2 Q;  3H0G B;  1A63 A;  1KQS A;  1PFB A;  3OTO Q;  3GTL B;  1SYF A;  2DNE A;  1TY0 A;  4A3L H;  3GTK H;  1IBM Q;  4LF7 Q;  3PO3 G;  1LTT D;  3EBE A;  4XYO A;  1N34 L;  1QB5 D;  2ID0 A;  4C3I B;  1K8O A;  4UP8 A;  1UEA B;  4A3F H;  2WP8 J;  1GHJ A;  3CCU A;  4FYD A;  1H9S A;  3MXP A;  4JBK A;  2YV5 A;  4A3K H;  1D5X C;  2AHO B;  2B2Y A;  3M9B A;  5FJ8 G;  4B3S L;  3GTM H;  1LAC A;  4DXF A;  4K8I A;  2E75 C;  5EPJ A;  4DGZ A;  5LMN L;  5D14 A;  4S3S A;  3K0X A;  2NZH A;  1A62 A;  1L2F A;  5IP9 H;  2XWB B;  1UE7 A;  1WCM H;  1K3B C;  1EYD A;  1XMQ L;  1XMO L;  3S15 H;  4IUV A;  4QGU A;  1LV9 A;  2Z6K C;  1DYQ A;  1FGU A;  4POG A;  4TSS A;  2YU9 H;  1N9W A;  2UUA L;  4IFD I;  3FKI G;  1I5F A;  2VQE Q;  1MJE A;  2K52 A;  3QJY A;  1EY8 A;  1YJ9 A;  1TWG B;  1Q12 A;  1D7Q A;  1G29 1;  4KK7 A;  4ZAI A;  3KLS A;  3BVM A;  2XN9 C;  1EU4 A;  1STB A;  1JE4 A;  4MNO A;  4IUR A;  2OTL A;  4QQB X;  5IP9 G;  2F0M A;  1OXX K;  3I73 A;  2A8V A;  3P7J A;  2VS1 A;  4RHS A;  1TQO A;  3EQL C;  5FLM G;  2OTJ A;  4KN4 C;  5FKA C;  3KOJ A;  5HGQ A;  4MZ9 A;  2R7Z B;  4A3D G;  2EE1 A;  2ALY B;  1Z47 A;  2NN6 H;  2E74 C;  4YY3 Q;  3H6M A;  1HA5 A;  4LUV A;  2K5Q A;  3VR3 A;  4XIG S;  2JQO A;  2B29 A;  1BCP D;  2B8F A;  5JPN C;  2VUM B;  2IJ0 A;  3RNU A;  3EA6 A;  3HG9 A;  2R7Z G;  1NR2 A;  1SFO H;  1QWY A;  4JI6 L;  2Z6K A;  3JC6 6;  4BBR G;  4WJ4 A;  3PO2 H;  4G7H C;  2UUA Q;  4UY8 C;  2ASB A;  5EKI A;  2RSN A;  5EAY A;  3D3R A;  1EEF D;  1F9S A;  3R93 A;  2X69 A;  3NEL A;  4LF9 L;  1SRU A;  1D1I A;  2OXP A;  1F9P A;  2B2W A;  4DV3 Q;  2O4X A;  4RWS C;  2KCT A;  4DXG A;  1RTN A;  4JI4 L;  1L0X B;  3T13 A;  1C4Q A;  1NSN S;  4K0K L;  1TWF B;  3HOV B;  2DUD A;  1WTQ A;  2PI2 A;  1GUS A;  4RFB A;  3NBH B;  1GO3 E;  3F2U A;  1ICW A;  1X55 A;  3RN5 A;  1Y1W H;  4UP7 A;  1Q3L A;  1M4V A;  3B6Y A;  1BO0 A;  3FMC A;  2R92 G;  1H9J A;  2RQX A;  2JEA I;  3HOV G;  4TQU S;  3G4S A;  1KDB A;  3F2B A;  1LTB D;  2Z4H A;  2A6E D;  3CCJ A;  3KF8 A;  1EYC A;  3HOW B;  4AQY L;  5E4X A;  3NWT A;  2JA6 G;  3D0F A;  3SVM A;  4GOP A;  3PO3 B;  1Q8I A;  4GOP B;  2D62 A;  1DXM A;  4JI4 Q;  2UUB L;  4OX9 Q;  1MJC A;  1I4X A;  2ZJR A;  3OPO A;  2K50 A;  2PZU A;  2VL6 A;  4A3I H;  4ZUJ A;  1HRJ A;  3WDN A;  2OQK A;  2XTI A;  2PZW A;  4QF4 A;  1PFS A;  3J81 j;  5I6W A;  3PF5 A;  3OIQ A;  3M4O B;  1B9M A;  3W1G A;  2K6A A;  3DWQ A;  2PMZ B;  1HTL D;  2WB1 B;  3HKZ E;  5C4H A;  1PH4 A;  4HJ9 A;  2AQ3 B;  1I4R A;  1QZH A;  3HOU B;  4EVO A;  4A3M B;  1H9K A;  1V9P A;  2C9O A;  3H94 A;  4HMJ A;  1KDC A;  2LXJ A;  3U4Z A;  3QO2 A;  2JE6 I;  1VQL A;  4ODG A;  1PYW D;  3CP0 A;  3TEH B;  1N8R C;  1VQ6 A;  3I91 A;  3BZK A;  1YHB A;  2KCN A;  1NCV A;  2OQ0 A;  1SLJ A;  2CW0 C;  1LM0 A;  2EOT A;  1TWG H;  4KHP L;  1XYI A;  1IW7 C;  1L1O B;  4HCS A;  4A4I A;  1Y1V G;  3R2I A;  1LLR D;  1A0I A;  3J7A V;  5FJ8 H;  3S17 H;  2CQO A;  5CV4 A;  1QOH A;  4A3I B;  1G6Z A;  1JWM D;  4YWK A;  3CAM A;  1EIH A;  1BQQ T;  1NTG A;  1SYG A;  5HUR A;  3NP8 A;  2IL8 A;  3E0E A;  1EIY B;  2RDH A;  1FGB D;  1MBY A;  1D2B A;  3FKI B;  2V1C C;  3FVQ A;  1HR0 Q;  2IWH A;  1NUC A;  3WOE A;  2F0J A;  2QW7 A;  1HNZ Q;  4DKA C;  1BR9 A;  4HIK A;  2CCZ A;  1A3U A;  3BDC A;  5DLQ E;  5FLX L;  4FNF A;  4HCE A;  3NBH A;  2X6L A;  4DK3 C;  1UE1 A;  2C5C A;  4HMI A;  4C56 C;  1BCP F;  1ASY A;  1HFN A;  2SOB A;  1SNC A;  5C3E H;  3NHH A;  4A3M G;  2VW9 A;  5EBC A;  3M7G A;  5C3E G;  1XXG A;  4V19 0;  5C4X B;  4A3C H;  3VR5 A;  4V0B A;  3T56 B;  3HOZ B;  2ZTC A;  4C3I H;  2RVL A;  1EQV A;  2I5H A;  4N9P A;  4QMG A;  2QA4 A;  5KYL A;  2NVX H;  3NK9 A;  4C3I G;  2UUB Q;  3HOX G;  1KDA A;  4OX9 L;  1E3P A;  1N32 L;  5CYU A;  5BR8 L;  1GUW A;  3S2D H;  3GTO B;  2RDF A;  1FVI A;  1SMX A;  3AEV A;  2NN6 G;  5JJK A;  1ET9 A;  3IFT A;  2HQL A;  1A15 A;  1TWF H;  1FJG Q;  2VZA A;  3SEB A;  1ENA A;  1SBB B;  1N36 Q;  2IW3 A;  4MTN A;  2CW0 D;  4JI0 L;  3TDQ A;  4OWT B;  4BBR H;  1I4G A;  3GQB A;  3KUP A;  2RDG A;  4I7A A;  3TME A;  3A0J A;  5M5W H;  3A74 A;  5C3E B;  5JVH 3;  3BG3 A;  1BBU A;  3CXC A;  2EZV A;  3EN2 A;  5M9O A;  2H1E A;  1KRS A;  3FPP A;  1CTM A;  3OMG A;  3ULL A;  4DUY Q;  1JOQ A;  1BXT A;  4OO1 I;  3T4A C;  1CKN A;  1Q8K A;  3K81 C;  3CCL A;  2HCC A;  2ZXR A;  4DV0 L;  3E9H A;  3NPP A;  5NUC A;  4IOC A;  4KTA A;  5BN5 A;  4JBM A;  3C46 A;  1YNN C;  4OXP A;  1LUZ A;  4N9T A;  3WWV A;  3CCQ A;  4Y7N B;  1U4M A;  2LXK A;  5M3F G;  1D1K A;  4K6L A;  4WRD A;  3M3Y H;  5GRO A;  3S16 B;  1FJG L;  5K36 G;  2XVS A;  2Z0S A;  1G51 A;  1TXY A;  5EPK A;  3QOJ A;  2JA6 H;  2ZJP A;  2NBF A;  1PH8 A;  3A8K E;  2FHT A;  3HOV H;  5ELF A;  3R8B A;  1PZI D;  3HOU H;  1HJP A;  4A3B G;  4R1J A;  2B2V C;  1IBM L;  1HZB A;  3HRZ C;  2VXW A;  5KNB A;  3S14 H;  3MC0 B;  5ELD A;  1TS2 A;  4IPD A;  1V43 A;  3QOL A;  2F3W A;  4QB4 A;  4G7O C;  3KF8 B;  5C0X J;  3VA5 A;  2NZ1 D;  1IBL L;  3I2Z A;  2KEE A;  4JBJ A;  4HED A;  2N78 A;  1JCK B;  5M5Y H;  1OXS C;  5IYB H;  4DR4 Q;  3NBI A;  5EKK A;  1F2Y A;  2PQE A;  2K03 A;  3DWA A;  4A3B B;  5KRU A;  1PHJ A;  2DY8 A;  4DR3 L;  1OXU A;  4CBV A;  5J22 A;  1H9R A;  2KVM A;  4A3K B;  4GN5 A;  1XNR L;  1KC8 C;  2F0N A;  4JI2 L;  3C1E A;  1M90 C;  4X64 Q;  4FF3 A;  1O78 A;  3KFU A;  1ILQ A;  1SND A;  1ONL A;  3BYT B;  4JI3 L;  1PRT F;  1YNJ C;  3GD7 A;  1V1P B;  2D9U A;  3A55 A;  3SXH A;  1Y1W B;  3HOW G;  4TVA B;  3EVQ A;  2CH4 A;  2D0O A;  4B3R L;  2D5D A;  2VQE L;  1TS3 A;  4LJZ C;  2MQH A;  4QUF A;  5FO9 B;  2EDG A;  3NXW A;  2NVY B;  2AMC B;  2E76 C;  2K5H A;  2R92 B;  4ZYS A;  4JVZ A;  5GQO A;  4PNY A;  4RGM A;  1SRO A;  1X3G A;  1S5D D;  5EKL A;  4KD4 A;  1M8A A;  3URY A;  4DU9 A;  1O7I A;  4DNR B;  1VQJ A;  2FMC A;  2BOS A;  2NVX B;  2L55 A;  1TY2 A;  3D6W A;  5I4D A;  4JOI C;  3CCR A;  1U4P A;  4I7Z C;  1MI2 A;  3H91 A;  1NR4 A;  1IBK Q;  4JI7 Q;  2EXZ A;  3CRK C;  3RZD B;  3RLF A;  3STB D;  5C3X A;  4Z9C B;  4ZKC B;  4WFN 3;  2A5H A;  4DR3 Q;  1PLF A;  1VDZ A;  5M5X H;  2B2Y C;  4DR6 Q;  3M4O H;  1UAP A;  3W2D A;  3N52 A;  1PMR A;  3KDF B;  1EOT A;  5DEH A;  3PIP A;  3G6E A;  1XNQ L;  2UXC Q;  3U58 A;  5C44 G;  2B2V A;  4HJ8 A;  1HR0 L;  5LMU L;  4XT3 B;  3H0G G;  3OOC A;  2PNH A;  1VQ5 A;  4ILW A;  2KEC A;  4ZLT F;  5GAG C;  1RIP A;  4DV1 L;  1WD0 A;  1I6H H;  5KIX A;  2VUM G;  1AN8 A;  2JA7 H;  4QL5 A;  4GKK Q;  3HOZ H;  3IAY A;  1SNM A;  4A3D B;  1G2T A;  2L5T A;  1VQ4 A;  3KLS X;  1MSH A;  4K2L A;  2RCF A;  1VQM A;  3VYU A;  1XNR Q;  4F88 A;  1E7Z A;  2NTT A;  3H0G H;  1Q7Y C;  4LF5 Q;  1B3Q A;  1NNX A;  4EQP A;  1H95 A;  2F4V L;  3UDF A;  1TS4 A;  3KJO A;  1EYA A;  1XNQ Q;  2NYZ D;  1O7Y A;  4A3E B;  1SN8 A;  4XQN A;  3OW2 A;  5ELC A;  4ME3 A;  3EIV A;  2ZJQ A;  1K8A C;  3QIA A;  1N32 Q;  2IY5 B;  2XRS D;  3MXN A;  3SHL A;  1BKB A;  1Y14 B;  1VQK A;  1EFI D;  3MXU A;  3ONA B;  3RD4 A;  4AYB G;  1SNO A;  1S5F D;  3CC2 A;  4LFB L;  5IYD H;  5C44 H;  5BN4 A;  1Y1V B;  1GD7 A;  3RZD H;  4C1N K;  2F0T A;  1Z9F A;  1PTO D;  3K57 A;  1WFQ A;  1Q82 C;  1LT4 D;  1BCP B;  2XNA C;  5AJ3 Q;  3WOF A;  2A19 A;  1CQV A;  1QNU A;  2RHQ B;  1OO9 B;  3RUZ A;  1CM9 A;  4ZRZ A;  1WTP A;  1GXD C;  4RMF A;  3D6C A;  2WB1 G;  4IFD J;  2KA7 A;  1KLU D;  5A2Q L;  1TT2 A;  1Q86 C;  4IZ8 A;  2VNU D;  1EZ6 A;  2NVQ H;  4G4K A;  3SDZ A;  5L37 A;  1XTC D;  2O5J C;  1RF2 D;  1UUP A;  3IKJ A;  4NXM L;  1CA6 A;  2I0Q A;  3Q6S A;  1KRT A;  1K0S A;  1FL0 A;  2EJF C;  2N8N A;  1K8G A;  1PZJ D;  2X6G A;  1CSQ A;  3CKI B;  5CBA E;  1E0B A;  3CC4 A;  2R93 G;  5M5Y B;  1NMF A;  2E5L Q;  3T1Y Q;  4KN7 C;  2B2T A;  3ERO A;  3BS1 A;  2G9H D;  3G71 A;  3DLL A;  3DEP A;  3NSW A;  1PH3 A;  1YNX A;  2UXD L;  4K8J A;  1CQF A;  2CHB D;  3KDF A;  4FXG C;  4QIW B;  3S17 B;  2ZTE A;  4MN3 A;  4N8F A;  3NQI A;  1UE5 A;  4LUZ A;  4UPA A;  2Y0S B;  5M5X B;  2OT2 A;  2F4I A;  5ELN A;  1LT6 D;  3UDG A;  4PZ8 A;  1XWE A;  3FHW A;  4XYQ A;  1LTS D;  1PH6 A;  5C3W A;  1B2T A;  2UXB Q;  4A3G B;  2B63 B;  2WIN B;  1Z6H A;  1Q1B A;  4DV7 L;  1O7Z A;  3TZU A;  3S1M H;  2OF1 A;  4AH6 A;  4DUZ Q;  2HT1 A;  1QUQ A;  1VQG A;  4RG1 A;  3CW2 C;  4ABN A;  3RLN A;  4DFA A;  4F8M A;  3X3M A;  3HOY B;  1HA6 A;  2EYJ A;  4XQJ A;  1YZ6 A;  2HDL A;  3GTK B;  1VQB A;  4RGO S;  4AIM A;  3HKZ G;  3OTO L;  1CI3 M;  1YHA A;  4Q5V A;  1ENC A;  3S1Q B;  1YBY A;  1BVS A;  4X3S A;  3SK6 A;  4IPC A;  1WTW A;  5LMU Q;  2KBN A;  1PVO A;  2JA8 B;  1YNN D;  3J81 E;  3V2T A;  2OCE A;  1QJO A;  3MTS A;  3S15 B;  2K4K A;  1AFP A;  3QG1 A;  4CKC A;  3G48 A;  4FXD A;  3NE5 B;  2ENB A;  4OIK A;  2HQE A;  2N49 A;  3ICE A;  2JP1 A;  2L11 A;  2HHH L;  1XMO Q;  2JA5 G;  5DNF A;  4OEM B;  4L5T A;  1IYU A;  2LS0 1;  5HY6 A;  4PV1 C;  4BY1 G;  4J1M A;  2PQA A;  3UI2 A;  2A74 C;  5CC4 A;  1FNU A;  3VR6 A;  4DAM A;  1DOL A;  1F2M A;  4JI1 Q;  4RCN A;  3CMA A;  3KF6 B;  3ULP A;  1J5E L;  1W3S A;  2Q2U A;  1IZ6 A;  2D0P A;  3UDX A;  1EWH A;  4FVM A;  2DJG C;  2TSS A;  4IO9 A;  1IL8 A;  1TS5 A;  3KJP A;  3EJI A;  3KBX A;  4KJN A;  2R7Z H;  3S1N H;  2F0E A;  2DJF C;  4PMC A;  4A3G H;  3E6Z X;  1EOV A;  3MVV A;  2EYM A;  1I6V C;  3K7A B;  4GS3 A;  2VQF L;  2Z1C A;  4A76 A;  1TII D;  2F0D A;  5FO7 B;  4DA2 A;  3J7A F;  2BE5 C;  1MHW C;  1PH5 A;  1EU3 A;  2MUY A;  5A35 A;  2NVQ B;  4A3J G;  5C5M A;  3BVG A;  4C3H B;  2Y0S E;  4K5V A;  1V1P A;  1UWV A;  1B1Z A;  4QY7 A;  1VS0 A;  4YY3 L;  2K5W A;  1Y1V H;  2F03 A;  3GTJ B;  4KHP Q;  1D8L A;  3TP8 A;  4XXE A;  3K59 A;  2L4N A;  5C4J B;  3AQQ A;  5JEA J;  3PO2 B;  4DR2 L;  1NMG A;  2WAQ G;  4OIJ A;  2TMP A;  1NE3 A;  4JI5 L;  2MJ8 A;  4FXK C;  4B3T L;  2K28 A;  2IPK D;  1PFN A;  4ID6 A;  4WJW A;  4DV5 L;  3PO3 H;  4FF4 A;  1WCM G;  3AB9 A;  3HS0 C;  1XPU A;  3HFZ B;  4L5S A;  1GUT A;  1KNE A;  4JI2 Q;  3RMH A;  1PTO F;  3MFG A;  4X64 L;  3J81 i;  2LSS A;  5JEA H;  2VQF Q;  4LF9 Q;  3T53 B;  4NXN Q;  1EL0 A;  1SXT A;  5KEE A;  1C0A A;  5JVG 3;  1X32 A;  2R6G A;  1I50 H;  2PNR C;  4HJ5 A;  5JJL A;  2I5L X;  2F0G A;  4A3M H;  1NAP A;  4KHZ A;  2UXD Q;  4FO2 A;  2K01 A;  4EQO A;  5C6A A;  5GAE C;  2P5Z X;  4DR1 Q;  4NB3 A;  1ZEQ X;  3I4O A;  2QF7 A;  1SAP A;  3SK5 A;  4GN3 B;  1GUO A;  3K80 C;  4YCU A;  5BR8 Q;  3R3O A;  1CA5 A;  1EQT A;  1KTK A;  1H9S B;  1ROD A;  3A8I E;  3P20 A;  1CKM A;  5JPM C;  2F0U A;  5M3M H;  2ZXP A;  1RTO A;  4GNX B;  4FF2 A;  3NQT A;  2A69 C;  4CHT B;  3S2H H;  2RHS B;  1I94 L;  4DV5 Q;  4DUZ L;  4C2M B;  3BYY B;  1TR5 A;  4DR6 L;  2MPM A;  4GKK L;  2WV6 D;  1S72 A;  1SJE D;  2MGS A;  3UDI A;  1A6X A;  1ML0 D;  4M1U B;  1LO5 D;  3TSS A;  3KK7 A;  2K14 A;  1XTD A;  3A5Z B;  4JYA Q;  1HQM C;  2XIW A;  1U4L A;  1PH9 A;  3PUZ A;  4LW1 A;  1JWU D;  1P8L A;  1RCV D;  2MP1 A;  1X3P A;  3HP3 A;  1RHP A;  4BBS G;  2A6H C;  3IRB A;  1A3T A;  3I70 A;  3QWN A;  4HN7 A;  1R4Q B;  2CH4 W;  5IGF A;  3SGI A;  3S1Q H;  2B2W C;  1VQA A;  4DV7 Q;  4B3T Q;  5D65 A;  1E2Z A;  4C3H G;  3BDL A;  4MTK A;  2HHH Q;  1HR0 W;  2UXB L;  1LT5 D;  1S5B D;  4XT1 B;  4FF1 A;  1W6J A;  3GTG B;  3D31 A;  3T1H Q;  2K7V A;  3W1B A;  5EBD A;  1S5E D;  4OON A;  4HIM A;  3KLW A;  1VQE A;  1U0L A;  1LTG D;  3I4M B;  3KLR A;  1E1O A;  4LF4 Q;  1FYC A;  4DNT B;  4BWG B;  1X3E A;  4GNX A;  1JOR A;  3V96 A;  1JOO A;  4JCV E;  1J9O A;  4X65 Q;  1ZYR C;  4A93 G;  3SE0 A;  4AYB E;  1VQC A;  4LFA Q;  2VUM H;  4LFB Q;  1SMY D;  3CCS A;  4L63 B;  3NTI A;  3HEJ A;  2JYO A;  4BY1 B;  3D4W A;  4IUP A;  4G57 A;  1B53 A;  1LTI D;  2XWJ B;  3HOY H;  2BA0 A;  2JA5 B;  1HNX Q;  3TBI B;  4IUT A;  4XDX A;  2EJM A;  3S2D B;  3MEF A;  4YHH L;  5I9P A;  4DNI A;  1EY6 A;  1JB3 A;  2CWP A;  3TRE A;  2NZO A;  3PV0 A;  2A6H D;  5H1S E;  2Q8R E;  3F2D A;  2K05 A;  2E5L L;  3Q24 A;  2JA8 G;  4GLA C;  1BBW A;  3S1N B;  4GKJ L;  4JI3 Q;  5FLX E;  4PZ7 A;  4HIO A;  4HAE A;  3K5O A;  4L5Q A;  4A3F G;  4LF7 L;  1OXV A;  4IUN A;  1Y8O B;  1CKO A;  3M4Q A;  5IGB A;  4POF A;  3J7Y W;  3VR4 A;  2B39 A;  2E2H B;  2PI2 E;  3AYH B;  1EQQ A;  4FDB A;  5D3D A;  2LY7 A;  2ZTD A;  4RCO A;  4JG2 A;  4XTC S;  1FNW A;  1T9H A;  1E24 A;  2EYO A;  3GTJ H;  1HCZ A;  1QUQ B;  5JAV A;  1IHZ A;  4ZKB B;  4YHH Q;  3PQI A;  2QKI C;  2DN8 A;  1KXL A;  4DK0 A;  4DK6 C;  3MA2 B;  4JOI A;  3HOW H;  2HIV A;  4H02 A;  1STN A;  2F0S A;  2F0W A;  5IP7 H;  3DM3 A;  2AQ1 B;  1VQN A;  4A3B H;  2JK8 A;  1CK1 A;  3K7A H;  2EJG C;  4DV0 Q;  4OWX B;  4OEL B;  2LMC B;  1WD1 A;  1E2W A;  1SEB D;  3H09 A;  1ICF B;  4YWM A;  4HTH A;  1S40 A;  1NBW A;  4JI5 Q;  1LYL A;  3Q23 A;  1SMY C;  2CFM A;  4DR2 Q;  3F2C A;  2H4O A;  4QJF A;  1KNA A;  2Q8I B;  3TP6 A;  4X3U A;  2F0K A;  1X3F A;  3W5O A;  3DHQ A;  2JA7 B;  2YTY A;  4C3J B;  1DGS A;  1VF5 C;  1II3 A;  3TP5 A;  2R93 B;  4TRD A;  1EY9 A;  1U5K A;  1PTO H;  1CFM A;  4KKU A;  1VQP A;  2A68 C;  1HZC A;  1AP0 A;  3I4M G;  4LF6 L;  5J39 A;  1CHQ D;  2JJQ A;  2WAC A;  1PH1 A;  3OW7 A;  1STG A;  3HOX H;  3I7F A;  2CWA A;  3D4D A;  3CME A;  4NXN L;  1AE2 A;  4BY7 B;  5C0X H;  3F8T A;  1JJ2 A;  1ASZ A;  3MEH A;  3M7N A;  5C0X I;  3LX0 A;  3K5L A;  5JJZ A;  1SJH D;  1C48 A;  1U9R A;  1AH9 A;  4LF5 L;  1KLG D;  1WJJ A;  5IYC H;  1C7Y A;  4MHE A;  1HH2 P;  2GA4 B;  1IW7 D;  5M3M B;  4P73 A;  3I4N G;  1HFG A;  1K83 B;  4IOA A;  1IKL A;  2F0H A;  1SE4 A;  3J81 L;  2IX3 A;  2BH8 A;  3MAQ A;  2E2J H;  1QNK A;  1WTR A;  5FLM H;  3DM1 A;  1MKH A;  1WVL A;  2UUC Q;  2WB1 E;  3ERS X;  2JA8 H;  2O5I C;  1BBX C;  4JI8 L;  1XX8 A;  1VF7 A;  2SDF A;  2MNA A;  3FKI H;  2IX0 A;  3LWE A;  2Z9H A;  1JWS D;  3V05 A;  4A3L G;  4NKL A;  1Y69 U;  1JMC A;  2WFW A;  1TWA B;  4K2K A;  2FIN B;  3S24 A;  3KBG A;  1H9M A;  4RKL A;  4IJL A;  3OHX C;  3P75 A;  4C3H H;  1F9Q A;  1M1K C;  4A93 H;  4IUQ A;  2MO0 A;  2F3V A;  5AJ3 L;  3J80 E;  4B3R Q;  4HR7 B;  3QB3 A;  2GVA A;  1CHP D;  4ULL A;  4JV5 Q;  2KHS A;  2SEB D;  5EGT A;  4H44 C;  3GV6 A;  1EIG A;  3O13 A;  4GOP C;  4J15 A;  1D6E C;  4OHJ A;  4KV6 A;  1E2V A;  2QDL A;  1AEX A;  4R4C A;  4DR5 Q;  2UU9 Q;  1XPO A;  3NEM A;  2HIX A;  4DF7 A;  4K5X A;  4NXM Q;  1IYJ B;  4MIU A;  1STE A;  5EQ0 A;  1VQI A;  4A75 A;  2Q8T A;  5JEA G;  3K7U C;  4B3M L;  1VQ8 A;  4QIW E;  4O0A A;  3M3Y B;  1ZXT A;  2K33 A;  4PMW A;  2V4D A;  4LF6 Q;  4HSV A;  3VR2 A;  1P16 A;  4PMB A;  1HNW Q;  1MSG A;  2UXC L;  1J6Q A;  1G8Z D;  1SNP A;  3K6O A;  1AZQ A;  5KGU A;  2KUM A;  1S4Z A;  1N34 Q;  5C44 B;  2PW7 A;  1PXU A;  3U50 C;  4FP5 D;  4KLK A;  3GTQ B;  1HQR D;  1F2Z A;  5M5W B;  1SE3 A;  5IWA L;  1IYV A;  1X3Q A;  1K9M C;  1GHK A;  2KHI A;  4NDX A;  4UAI A;  4GZY C;  3AMU A;  3S14 B;  1EY4 A;  3OWE B;  3BZC A;  1PYS B;  2B2U C;  3LNN A;  5COY A;  1TWC H;  1WTV A;  4U67 3;  4F7X A;  3AFQ A;  3PF4 A;  2RF4 A;  4HID A;  2PZT A;  5IP7 G;  1PH7 A;  2MHV A;  1A2U A;  3OSO A;  4BY7 G;  4TKO B;  2L15 A;  1ET6 A;  3BVZ A;  1BCP C;  2F4V Q;  1WOC A;  3G7L A;  4IN3 A;  4P74 A;  3RN2 A;  2PQA B;  1G91 A;  4Y7N H;  1R9T B;  1GUN A;  2GVB A;  3UE0 A;  1QZG A;  4LNQ A;  5LMN W;  5M3F H;  3FP9 A;  2RA4 A;  3PGZ A;  5JOB A;  4ALP A;  4M8A A;  1PTO C;  1I6H B;  3KYH C;  4P72 A;  1CT1 D;  5COR A;  3J80 c;  1CUK A;  3RZO H;  1TVX A;  2HDM A;  2PPB C;  4R4I A;  3ITP A;  2B8G A;  1BF4 A;  1I3Q B;  1PZK D;  3CU7 A;  4KY5 A;  5TSS A;  4QCL A;  2C35 B;  1PFM A;  2L9H A;  4R4O A;  4X3T A;  3K8A A;  5C0X G;  4DN4 M;  1L0Y B;  2VB3 X;  3SK8 A;  4NMZ A;  2E2I B;  2EQS A;  3TS0 A;  1F2L A;  1Y8N B;  1VQF A;  5IGE A;  2BCO A;  1JC7 A;  2QDB A;  2Z6B A;  2I07 B;  4RAU C;  4JI6 Q;  4ZK9 B;  3S1M B;  1NJI C;  5IGC A;  3J81 c;  1J5E Q;  1DCZ A;  1SSO A;  4O42 A;  1Q46 A;  1RL2 A;  3L7Z C;  2EXD A;  4Y52 H;  2CKZ B;  2EVB A;  3SR1 A;  1EY7 A;  4CKB A;  5D3I B;  1Y8P B;  3ER0 A;  4H7B A;  3GTL H;  2Z8L A;  3HKZ B;  4KI0 A;  4KJO A;  1EQR A;  4CKE A;  2KEN A;  1EWC A;  2GN5 A;  5IYC G;  5K5P A;  3M85 A;  2XSC A;  1EY0 A;  1PRT C;  3I56 A;  3E9I A;  1RD9 D;  2RSO A;  4BY1 H;  3J80 i;  4P2C B;  2E2I H;  4LF8 L;  1TKW B;  3T1Y L;  1CZG A;  4A3E G;  2VY3 A;  1IXR A;  1IBK L;  4APV A;  4JI7 L;  3DEO A;  5C5L A;  2DNC A;  2F0Q A;  3ERQ A;  3L2P A;  4BXX H;  2FMM A;  1GKH A;  5EJW A;  5C4J H;  1X56 A;  2WKD A;  1K8M A;  2F1M A;  1KD1 C;  4IFD H;  4X66 L;  3A5U A;  4GN4 B;  1Q90 A;  3C2P A;  4IQZ A;  1W6K A;  4E6I A;  1PRT B;  2E2D C;  4DV6 L;  5HGT A;  4DK1 A;  3E5S A;  1MD2 D;  2N55 A;  4UHV A;  3A7L A;  2QIL A;  3VA7 A;  1OXT A;  1WTX A;  5CR3 A;  2WKC A;  5E3F A;  5J3B A;  2HUG A;  1I50 B;  2AWN A;  3I3C A;  1XJV A;  5ISR A;  1DD2 A;  5LL6 X;  2ZXO A;  2IHF A;  2IHE A;  3LWU A;  1B44 D;  4LAA A;  5FK9 C;  1IKM A;  5C4Z A;  5I2X A;  5K36 H;  3HZX A;  2H5X A;  3TQY A;  2R3Z A;  1IBL Q;  2HCI A;  2MO1 A;  4R8I A;  2IX1 A;  3CD6 A;  5FOB B;  4XQQ A;  3HOZ G;  1BNZ A;  3K5M A;  4R8N A;  1EYG A;  5JJI A;  4DR4 L;  1TWA H;  1GVP A;  1SYB A;  2J4X A;  1G6P A;  1MGS A;  4IAL A;  3EFX D;  4LUO A;  5CGK A;  4L6T B;  3S2H B;  2NVT H;  4DAY A;  1K3R A;  3I4L A;  1DJR D;  5CV5 A;  3JAM i;  3GDE A;  4BS9 A;  4B3M Q;  1VQO A;  4I65 A;  3DXJ C;  3FPU B;  4C3J G;  1O80 A;  1SYE A;  4DAP A;  4YCW A;  1I4H A;  3E3X A;  1YNJ D;  5EPL A;  3BZD B;  1YVC A;  3C1F A;  3M4P A;  1ESR A;  3MXN B;  2KCC A;  4KY7 A;  2WAQ E;  4BY7 H;  1X9N A;  3FEW X;  5E4W C;  4JYA L;  3GTO H;  1JT8 A;  2M00 A;  4IUU A;  2J7Z A;  1TWC B;  2K5N A;  1DON A;  4A3I G;  2OWO A;  4CDF C;  4K0K Q;  3DUZ A;  1VCI A;  1STA A;  2K5D A;  4LK1 C;  2N88 A;  1X54 A;  4L8J A;  4B3S Q;  1IL2 A;  2CVR A;  2EYL A;  4IFD G;  3I4N H;  1D5M C;  1V1O A;  4Q0F A;  3VYR A;  4N8X 1;  2R93 H;  1RKN A;  2AKW B;  1N33 Q;  2EY5 A;  1W2B A;  3PMF A;  2Q2H A;  3U9O A;  4IPG A;  3VYT A;  5C4X H;  4PQX A;  4ZUI A;  3FDT A;  2JA9 A;  4B08 A;  4R9W A;  1NY4 A;  3GTQ H;  3TRZ A;  3S1R H;  4HSP A;  2KOL A;  4EQN A;  2EIF A;  2ICI A;  2WII B;  3IFD A;  4F87 A;  2FFK B;  2NB0 A;  4C2M H;  1I3Q H;  1SDF A;  2RKS A;  3S9W A;  2DY7 A;  3STB C;  1GOZ A;  5IT9 c;  1L0W A;  4JI8 Q;  3A7A B;  4DV1 Q;  4GNX C;  3GO5 A;  1JJG A;  5CV9 A;  1I4P A;  3PO2 G;  1I4Q A;  2NTS A;  2JA6 B;  1DOK A;  3I4N B;  1R9T H;  1WYD A;  3KF6 A;  5I9O A;  3AU7 A;  3I55 A;  4CDE C;  1HNX L;  5M3F B;  1QE6 A;  4LF8 Q;  3PIO 3;  2ATW A;  3H3V C;  1KAA A;  5ELE A;  5IYB G;  4JV5 L;  2L12 A;  4IPH A;  3NWS A;  4JBW A;  1A2T A;  1EWI A;  3I90 A;  5G3L D;  1YJW A;  3PUY A;  5ELB A;  3JAM E;  1GM5 A;  1CZW A;  4A93 B;  1YHQ A;  4A3C G;  2B63 H;  1KAB A;  5G3L F;  1PDQ A;  1MIU A;  5CMD A;  2JA7 G;  2AWO A;  1E22 A;  5FO8 B;  4K5W A;  3CC7 A;  2Z4I A;  1FNV A;  3A54 A;  2PO4 A;  2E2H H;  2XGT A;  3F1Z A;  4LMQ D;  1L1O C;  3L3O C;  1Q1E A;  2QGQ A;  3D4R A;  1L1O A;  2F0O A;  1JJC B;  1KL9 A;  5IOD A;  2ZM6 Q;  2PMZ E;  3E0J A;  4BBR B;  3T16 A;  3NTH A;  4BBS B;  1VMC A;  3PIO A;  5C4X G;  3P1H A;  4KKT A;  3NEN A;  4DR7 Q;  5KNC A;  1HZA A;  2KJX A;  5J1Z A;  2EYP A;  4X66 Q;  2O2L D;  3BJU A;  3CHB D;  2VB2 X;  1ZYR D;  5CBE E;  1RDP D;  3Q8D A;  3GTG H;  2NUC A;  4C3J H;  4DV6 Q;  2A6E C;  1B8A A;  2OEO A;  2UUC L;  4X62 Q;  2F0F A;  3A56 A;  3H3V I;  4BA2 I;  1HXY D;  3TZD A;  4RH6 A;  3HOY G;  3T1H L;  3PSI A;  4QUC A;  2PCF B;  3K5N A;  5T1I A;  2BH2 A;  1VQ7 A;  3HGB A;  3S16 H;  1N36 L;  3I8Z A;  3ZJY C;  2QEX A;  2F52 A;  4B9X A;  3RR5 A;  2L1B A;  4RKB A;  4EQ5 A;  4WJ3 M;  2RCN A;  3NTK A;  2N3S A;  3CF5 A;  1K83 H;  4O2D A;  2ZT9 C;  3DMU A;  4YIJ A;  4LFC L;  4DR7 L;  2E2J B;  1WTO A;  2CQA A;  4U68 A;  2Q2T A;  2NVT B;  4YWL A;  1LTA D;  2AQ2 B;  3S1R B;  3M4Y A;  3JAM c;  3UE1 A;  1EFW A;  2NWG A;  1QVF A;  3N6R A;  1YI2 A;  1RJT A;  3I72 A;  3RZO B;  1DZ1 A;  2YTV A;  4JK1 C;  2D2C C;  4IJH A;  3I4M H;  1SE2 A;  3CPW A;  1SR3 A;  3PUV A;  4ZQ3 A;  3U9S A;  1PV4 A;  4OO1 G;  2PYK A;  1TU2 B;  5AFW A;  5I2Y A;  1ESF A;  1WI5 A;  3VDY A;  1XPR A;  2BDN A;  4BXX G;  1B4O A;  2EY2 A;  1DM0 B;  3GTP B;  4G7Z C;  4BBS H;  2HD3 A;  2A1A A;  2FXQ A;  1UNS A;  5LL6 S;  1K73 C;  4GKJ Q;  2WAQ B;  1JOK A;  3NUC A;  1GUG A;  1VQH A;  3OWF A;  1FD7 D;  1VQD A;  4OO1 H;  3CQZ H;  4DR5 L;  3D8G A;  5M3M G;  2UU9 L;  1X6O A;  3IL8 A;  1KIX A;  3ULJ A;  1HNZ L;  4LFC Q;  1JIC A;  2AUK A;  4GLX A;  1SYD A;  2B2T C;  1PYB A;  4DPG A;  1AE3 A;  4DAY B;  4X62 L;  1EUJ A;  4NPS A;  4RA8 A;  2A68 D;  1N33 L;  3JAM L;  2AUJ D;  3DWP A;  2JSO A;  4DV2 L;  3AFP A;  2JXM B;  1KHI A;  1T5X D;  1HNW L;  1STY A;  5IY0 A;  4P75 A;  3Q22 A;  2M9V A;  4JI1 L;  1JB7 A;  1GJX A;  5IGG A;  1PTO B;  4A3E H;  2FJ2 A;  1PRT D;  3CCE A;  4OWW B;  3H3V H;  1FR3 A;  4CDD C;  2BE5 D;  4A3J H;  1S5C D;  3H15 A;  1STH A;  5LHY 1;  2KQ3 A;  1YIT A;  4RGN A;  1BDO A;  5E7N A;  3BDO A;  1Y1W G;  1EZ8 A;  2F0V A;  2F0L A;  3MHB A;  4OL7 A;  4CJ2 C;  5IT9 L;  4NP5 A;  4PG3 A;  4X65 L;  2YU9 B;  4K14 A;  4A3K G;  1BOS A;  5F2D A;  2SNM A;  5IWA Q;  4CJ1 B;  3PUX A;  4LFA L;  2B3G A;  2E8G A;  4RHR A;  3L0O A;  3VYS A;  2R7D A;  4DV3 L;  2KHJ A;  3W3A A;  1B7Y B;  4UP9 A;  5IT9 E;  1SNQ A;  1WTH A;  3CCV A;  5GAH C;  4B9W A;  4DAV A;  2ZM6 L;  2SNS A;  4DV4 L;  5KND A;  1K0R A;  4BA1 I;  1TWH B;  1Z7T A;  4CGY B;  1S3O A;  5A2Q E;  1QIL A;  3HKS A;  3LGJ A;  1LTL A;  1UEB A;  1X65 A;  4X3K A;  3T51 B;  3CCM A;  4A3F B;  3R2T A;  2YTX A;  2B2U A;  1B3A A;  3K58 A;  1YJN A;  3CQZ B;  4KD3 A;  1WCM B;  3MXG A;  1J8I A;  5IE8 A;  1SE8 A;  4KHV A;  1G2S A;  3ND8 A;  2I46 A;  1B9N A;  4JPB W;  1DOM A;  4J8Q A;  2R7F A;  3CRL C;  1HPC A;  1ZKO A;  4JI0 Q;  1O7L A;  2NN6 I;  5T1G A;  5I6Y A;  3J80 L;  2A73 B;  3TN2 A;  5CV6 A;  2NVY H;  1A3V A;  4A3G G;  1SYC A;  1YEZ A;  1B70 B;  1YIJ A;  4DUY L;  2PW5 A;  1ILP A;  2EYH A;  2KED A;  3MFY A;  4A3J B;  1CKN B;  4DR1 L;  4R4Q A;  3PUW A;  2Y0S G;  4P71 A;  2QCP X;  1BUV T;  2XRQ D;  2K75 A;  1EEI D;  2JA5 H;  1JQY D;  4EX5 A;  4H0L C;  3J7A 5;  4EGV A;  1HUN A;  1AZP A;  3FRP B;  4ZCK A;  3MZ5 A;  1AW7 A;  3A8J E;  4H13 C;  3MWY W;  1LAB A;  3PCO B;  4RGT A;  5DM7 3;  2G9D A;  4WOR A;  2YYZ A;  4JW0 A;  3U4V A;  4O1N A;  3ZYY X;  1K28 A;  2EPB A;  2K1B A;  3BU2 A;  1I94 Q;  1F77 A;  4J6H A;  2IT1 A;  4CDC C;  2A69 D;  1V1Q A;  1SFO B;  3OIP A;  4PZ6 A;  5DAU A;  2DGY A;  2RBM A;  1Q81 C;  3G6J B;  1C8C A;  2BDO A;  2K32 A;  3PIP 3;  2LFN A;  2EY6 A;  3ND9 A;  4GLV B;  1TWH H;  2EY1 A;  1D5Z C;  4UDU C;  5IIF A;  3J7Z C;  4R4T A;  4KY6 A;  3SK4 A;  5FLX c;  1VQ9 A;  1QVC A;  1OTC A;  3CPF A;  4L5R C;  4DV4 Q;  3HOX B;  1E1T A;  5IGD A;  5GAD C;  3OMC A;  2MFI A;  3TP7 A;  5CV8 A;  4K6D A;  3RLO A;  4HJ7 A;  3K0Y A;  4A3D H;  5ELO A;  2R92 H;  2R61 A;  2ES2 A;  1QVG A;  1HHV A;  4X6A H;  2KCM A;  2F3I A;  1EIF A;  2EYF A;  1EY5 A;  2J0T D;  2QEJ C;  5DM6 3;  4AQY Q;  2M2L A;  5BN3 A;  2L0C A;  1PH2 A;  2F0P A;  2Q2I A;  4KKS A;  1B50 A;  2LKV A;  4AYB B;  2ICE C;  4C1N I;  2F0I A;  3GV3 A;  2G5D A;  4HJA A;  5IOC A;  4YCV A;  1V8Q A;  3X3N A;  5IYD G;  1T5E A;  5E1F A;  1A8V A;  4LF4 L;  1ENF A;  2I5M X;  1HUM A;  1U4R A;  2K5V A;  3QR8 A;  5CV7 A;  2B63 G;  1LT3 D;  3Q0A A;  3TS2 A;  1JR0 D;  1F9R A;  2K04 A;  5KYI A;  4CJ0 B;  1UE6 A;  4LWC A;  3C3L A; 
#chains in the Genus database with same CATH homology
 1VMP A;  3L9A X;  2BA1 A;  1QG7 A;  1R4P B;  3GP7 A;  1HTP A;  4OGQ C;  3GTM B;  1LTR D;  2JEB I;  4NW2 A;  1QCB D;  4ME5 A;  4KMU C;  3H0G B;  1PFB A;  3GTL B;  1SYF A;  2DNE A;  1TY0 A;  1LTT D;  4XYO A;  1QB5 D;  2ID0 A;  4C3I B;  1K8O A;  1UEA B;  2WP8 J;  1GHJ A;  4FYD A;  1H9S A;  3MXP A;  1D5X C;  2B2Y A;  1LAC A;  4DXF A;  4K8I A;  2E75 C;  5EPJ A;  4DGZ A;  5D14 A;  4S3S A;  2XWB B;  1EYD A;  4IUV A;  1LV9 A;  1DYQ A;  4TSS A;  4IFD I;  3QJY A;  1EY8 A;  1TWG B;  1Q12 A;  1G29 1;  4KK7 A;  4ZAI A;  3KLS A;  3BVM A;  2XN9 C;  1EU4 A;  1STB A;  1JE4 A;  4IUR A;  2F0M A;  1OXX K;  3I73 A;  3P7J A;  4RHS A;  1TQO A;  3EQL C;  4KN4 C;  5FKA C;  2R7Z B;  2EE1 A;  1Z47 A;  2NN6 H;  2E74 C;  3H6M A;  1HA5 A;  3VR3 A;  2K5Q A;  4XIG S;  1BCP D;  2B8F A;  5JPN C;  2VUM B;  2IJ0 A;  3EA6 A;  3HG9 A;  1NR2 A;  1QWY A;  4G7H C;  5EKI A;  2RSN A;  3D3R A;  1EEF D;  1F9S A;  3R93 A;  2X69 A;  1D1I A;  2OXP A;  1F9P A;  2B2W A;  2O4X A;  4RWS C;  4DXG A;  1RTN A;  1L0X B;  3T13 A;  1C4Q A;  1NSN S;  1TWF B;  3HOV B;  1WTQ A;  1GUS A;  4RFB A;  3F2U A;  1ICW A;  1Q3L A;  1M4V A;  1BO0 A;  3FMC A;  1H9J A;  2RQX A;  2JEA I;  4TQU S;  1KDB A;  1LTB D;  2Z4H A;  2A6E D;  3KF8 A;  1EYC A;  3HOW B;  5E4X A;  3NWT A;  3SVM A;  3PO3 B;  1Q8I A;  2D62 A;  1DXM A;  1I4X A;  3OPO A;  2PZU A;  1HRJ A;  4ZUJ A;  3WDN A;  2PZW A;  4QF4 A;  5I6W A;  3OIQ A;  3M4O B;  1B9M A;  2K6A A;  3DWQ A;  2PMZ B;  1HTL D;  2WB1 B;  5C4H A;  2AQ3 B;  1I4R A;  3HOU B;  4EVO A;  4A3M B;  1H9K A;  2C9O A;  3H94 A;  4HMJ A;  1KDC A;  3QO2 A;  2JE6 I;  4ODG A;  1PYW D;  3I91 A;  2KCN A;  1NCV A;  2CW0 C;  2EOT A;  1XYI A;  1IW7 C;  4HCS A;  3R2I A;  1LLR D;  3J7A V;  5CV4 A;  1QOH A;  4A3I B;  1G6Z A;  1JWM D;  1EIH A;  1BQQ T;  1SYG A;  5HUR A;  3NP8 A;  2IL8 A;  2RDH A;  1FGB D;  1MBY A;  1D2B A;  3FKI B;  3FVQ A;  2IWH A;  3WOE A;  1NUC A;  2F0J A;  1BR9 A;  1A3U A;  3BDC A;  5FLX L;  4FNF A;  4HCE A;  3NBH A;  2X6L A;  2C5C A;  4HMI A;  4C56 C;  1BCP F;  1HFN A;  2SOB A;  1SNC A;  3NHH A;  5EBC A;  3M7G A;  1XXG A;  4V19 0;  5C4X B;  3VR5 A;  4V0B A;  3T56 B;  3HOZ B;  2RVL A;  1EQV A;  4N9P A;  4QMG A;  5KYL A;  3NK9 A;  4C3I G;  1KDA A;  5CYU A;  1GUW A;  3GTO B;  2RDF A;  2NN6 G;  1ET9 A;  3IFT A;  1A15 A;  3SEB A;  1SBB B;  1ENA A;  2IW3 A;  2CW0 D;  3TDQ A;  1I4G A;  3GQB A;  3KUP A;  2RDG A;  3TME A;  5C3E B;  5JVH 3;  3BG3 A;  2EZV A;  5M9O A;  2H1E A;  3FPP A;  1CTM A;  3OMG A;  1JOQ A;  1BXT A;  4OO1 I;  3T4A C;  2HCC A;  2ZXR A;  3NPP A;  5NUC A;  4KTA A;  5BN5 A;  3C46 A;  1YNN C;  4N9T A;  4Y7N B;  1U4M A;  1D1K A;  4K6L A;  4WRD A;  3S16 B;  5K36 G;  2XVS A;  5EPK A;  3QOJ A;  2NBF A;  3A8K E;  2FHT A;  5ELF A;  3R8B A;  1PZI D;  2B2V C;  3HRZ C;  2VXW A;  5KNB A;  3MC0 B;  5ELD A;  1TS2 A;  1V43 A;  4G7O C;  3QOL A;  2F3W A;  4QB4 A;  5C0X J;  3VA5 A;  2NZ1 D;  2KEE A;  4HED A;  1JCK B;  1OXS C;  3NBI A;  5EKK A;  1F2Y A;  2PQE A;  2K03 A;  3DWA A;  4A3B B;  5KRU A;  2DY8 A;  1OXU A;  4CBV A;  5J22 A;  1H9R A;  2KVM A;  4A3K B;  2F0N A;  3C1E A;  4FF3 A;  1O78 A;  1ILQ A;  1SND A;  1ONL A;  3BYT B;  3SXH A;  1PRT F;  1YNJ C;  3GD7 A;  1Y1W B;  1V1P B;  2D9U A;  3A55 A;  3EVQ A;  2D5D A;  1TS3 A;  4LJZ C;  4QUF A;  5FO9 B;  2EDG A;  3NXW A;  2NVY B;  2E76 C;  2R92 B;  4ZYS A;  4PNY A;  4RGM A;  5EKL A;  1S5D D;  4KD4 A;  1M8A A;  3URY A;  4DU9 A;  4DNR B;  2FMC A;  2BOS A;  2NVX B;  2L55 A;  1TY2 A;  3D6W A;  5I4D A;  1U4P A;  4I7Z C;  1MI2 A;  3H91 A;  1NR4 A;  2EXZ A;  3CRK C;  3RZD B;  3RLF A;  5C3X A;  4Z9C B;  4ZKC B;  4WFN 3;  2A5H A;  1PLF A;  1VDZ A;  2B2Y C;  1UAP A;  3W2D A;  3N52 A;  1PMR A;  1EOT A;  5DEH A;  2B2V A;  4XT3 B;  3OOC A;  4ILW A;  2KEC A;  4ZLT F;  1WD0 A;  5KIX A;  1AN8 A;  3IAY A;  1SNM A;  4A3D B;  1G2T A;  2L5T A;  3KLS X;  1MSH A;  4K2L A;  3VYU A;  4F88 A;  2NTT A;  4EQP A;  1TS4 A;  1EYA A;  2NYZ D;  1O7Y A;  4A3E B;  4XQN A;  5ELC A;  3QIA A;  2XRS D;  3MXN A;  3SHL A;  1EFI D;  3MXU A;  3ONA B;  3RD4 A;  1SNO A;  1S5F D;  5BN4 A;  1Y1V B;  4C1N K;  2F0T A;  3K57 A;  1PTO D;  1LT4 D;  1BCP B;  2XNA C;  3WOF A;  1CQV A;  1QNU A;  1OO9 B;  3RUZ A;  1CM9 A;  4ZRZ A;  1WTP A;  1GXD C;  3D6C A;  4IFD J;  2KA7 A;  1KLU D;  5A2Q L;  1TT2 A;  4IZ8 A;  2VNU D;  1EZ6 A;  4G4K A;  3SDZ A;  1XTC D;  2O5J C;  1RF2 D;  1UUP A;  3IKJ A;  1CA6 A;  3Q6S A;  2EJF C;  1PZJ D;  2X6G A;  3CKI B;  5CBA E;  1E0B A;  5M5Y B;  4KN7 C;  2B2T A;  3ERO A;  3BS1 A;  2G9H D;  3DEP A;  3NSW A;  4K8J A;  1CQF A;  2CHB D;  4FXG C;  4QIW B;  3S17 B;  4MN3 A;  3NQI A;  2Y0S B;  5M5X B;  2OT2 A;  2F4I A;  1LT6 D;  1XWE A;  4XYQ A;  1LTS D;  5C3W A;  1B2T A;  4A3G B;  2B63 B;  2WIN B;  1Z6H A;  1Q1B A;  1O7Z A;  3TZU A;  2OF1 A;  4ABN A;  4DFA A;  4F8M A;  3X3M A;  3HOY B;  1HA6 A;  2EYJ A;  4XQJ A;  3GTK B;  2HDL A;  4RGO S;  1CI3 M;  4Q5V A;  1ENC A;  3S1Q B;  4X3S A;  3SK6 A;  1WTW A;  2JA8 B;  1YNN D;  3J81 E;  3V2T A;  1QJO A;  3MTS A;  3S15 B;  1AFP A;  3QG1 A;  4CKC A;  4FXD A;  3NE5 B;  2ENB A;  4OIK A;  2HQE A;  2JP1 A;  2L11 A;  5DNF A;  1IYU A;  2LS0 1;  4PV1 C;  4J1M A;  3UI2 A;  2A74 C;  5CC4 A;  1FNU A;  3VR6 A;  1DOL A;  1F2M A;  4RCN A;  1EWH A;  4FVM A;  2TSS A;  1IL8 A;  1TS5 A;  3EJI A;  3KBX A;  4KJN A;  2F0E A;  4PMC A;  3E6Z X;  3MVV A;  2EYM A;  1I6V C;  3K7A B;  2Z1C A;  1TII D;  2F0D A;  5FO7 B;  3J7A F;  4DA2 A;  2BE5 C;  1EU3 A;  2MUY A;  5A35 A;  2NVQ B;  5C5M A;  3BVG A;  4C3H B;  4K5V A;  1V1P A;  1B1Z A;  2K5W A;  2F03 A;  3GTJ B;  3TP8 A;  4XXE A;  3K59 A;  2L4N A;  5C4J B;  5JEA J;  3PO2 B;  4OIJ A;  2TMP A;  2MJ8 A;  4FXK C;  2K28 A;  2IPK D;  1PFN A;  4ID6 A;  4WJW A;  4FF4 A;  3AB9 A;  3HS0 C;  1GUT A;  1KNE A;  3RMH A;  1PTO F;  3MFG A;  5JEA H;  3T53 B;  1EL0 A;  1SXT A;  5KEE A;  5JVG 3;  1X32 A;  2R6G A;  2PNR C;  2F0G A;  1NAP A;  4KHZ A;  4FO2 A;  2K01 A;  4EQO A;  5C6A A;  1ZEQ X;  2QF7 A;  1SAP A;  3SK5 A;  1GUO A;  3R3O A;  1CA5 A;  1EQT A;  1KTK A;  1H9S B;  1ROD A;  3A8I E;  3P20 A;  5JPM C;  2F0U A;  2ZXP A;  1RTO A;  4FF2 A;  3NQT A;  2A69 C;  4CHT B;  4C2M B;  3BYY B;  1TR5 A;  2MPM A;  2WV6 D;  1SJE D;  2MGS A;  1A6X A;  1ML0 D;  4M1U B;  1LO5 D;  3TSS A;  3KK7 A;  1HQM C;  2XIW A;  1U4L A;  3PUZ A;  1JWU D;  1RCV D;  2MP1 A;  1X3P A;  3HP3 A;  1RHP A;  2A6H C;  1A3T A;  3I70 A;  3QWN A;  4HN7 A;  1R4Q B;  5IGF A;  2B2W C;  5D65 A;  1E2Z A;  4C3H G;  3BDL A;  1LT5 D;  1S5B D;  4XT1 B;  4FF1 A;  1W6J A;  3GTG B;  3D31 A;  2K7V A;  5EBD A;  1S5E D;  1LTG D;  3I4M B;  3KLR A;  1FYC A;  4DNT B;  4BWG B;  1JOR A;  3V96 A;  1JOO A;  1J9O A;  1ZYR C;  3SE0 A;  1SMY D;  4L63 B;  3NTI A;  3HEJ A;  2JYO A;  4BY1 B;  3D4W A;  4IUP A;  4G57 A;  1B53 A;  1LTI D;  2XWJ B;  2BA0 A;  2JA5 B;  3TBI B;  4IUT A;  4XDX A;  2EJM A;  3S2D B;  5I9P A;  1EY6 A;  1JB3 A;  3PV0 A;  2A6H D;  2Q8R E;  2K05 A;  3Q24 A;  3S1N B;  5FLX E;  4HAE A;  3K5O A;  1OXV A;  4IUN A;  1Y8O B;  5IGB A;  3J7Y W;  3VR4 A;  2B39 A;  2E2H B;  5D3D A;  2LY7 A;  4RCO A;  4XTC S;  1FNW A;  2EYO A;  1HCZ A;  5JAV A;  1IHZ A;  4ZKB B;  2QKI C;  2DN8 A;  4DK0 A;  3MA2 B;  1STN A;  2F0S A;  2F0W A;  2AQ1 B;  1CK1 A;  2EJG C;  2LMC B;  1WD1 A;  1E2W A;  1SEB D;  3H09 A;  4HTH A;  3Q23 A;  1SMY C;  2H4O A;  1KNA A;  2Q8I B;  3TP6 A;  4X3U A;  2F0K A;  3DHQ A;  2JA7 B;  4C3J B;  3TP5 A;  1VF5 C;  1II3 A;  2R93 B;  4TRD A;  1EY9 A;  1PTO H;  1CFM A;  4KKU A;  2A68 C;  1AP0 A;  5J39 A;  1CHQ D;  2WAC A;  3OW7 A;  1STG A;  3D4D A;  4BY7 B;  5C0X H;  3M7N A;  3MEH A;  5C0X I;  3LX0 A;  3K5L A;  5JJZ A;  1SJH D;  1C48 A;  1U9R A;  1KLG D;  4MHE A;  2GA4 B;  1IW7 D;  5M3M B;  1HFG A;  1K83 B;  1IKL A;  2F0H A;  1SE4 A;  3J81 L;  2IX3 A;  3MAQ A;  1QNK A;  1WTR A;  3DM1 A;  1WVL A;  2O5I C;  1BBX C;  1XX8 A;  1VF7 A;  2SDF A;  2IX0 A;  3LWE A;  3V05 A;  1JWS D;  4NKL A;  1Y69 U;  1TWA B;  4K2K A;  2FIN B;  3KBG A;  1H9M A;  4RKL A;  3OHX C;  3P75 A;  1F9Q A;  4IUQ A;  3J80 E;  2F3V A;  4HR7 B;  3QB3 A;  4ULL A;  1CHP D;  2KHS A;  2SEB D;  5EGT A;  4H44 C;  3GV6 A;  1EIG A;  3O13 A;  1D6E C;  4OHJ A;  4KV6 A;  1E2V A;  1AEX A;  4DF7 A;  4K5X A;  4MIU A;  1STE A;  5EQ0 A;  2Q8T A;  5JEA G;  3M3Y B;  1ZXT A;  2K33 A;  4PMW A;  2V4D A;  4HSV A;  3VR2 A;  4PMB A;  1MSG A;  1G8Z D;  1SNP A;  3K6O A;  1AZQ A;  5KGU A;  2KUM A;  1S4Z A;  5C44 B;  2PW7 A;  1PXU A;  4FP5 D;  3GTQ B;  1HQR D;  1F2Z A;  5M5W B;  1SE3 A;  1IYV A;  1X3Q A;  1GHK A;  4NDX A;  4UAI A;  4GZY C;  3AMU A;  3S14 B;  1EY4 A;  3OWE B;  2B2U C;  3LNN A;  5COY A;  1WTV A;  4U67 3;  4F7X A;  2PZT A;  2MHV A;  1A2U A;  3OSO A;  4TKO B;  1ET6 A;  3BVZ A;  1BCP C;  3G7L A;  4IN3 A;  1G91 A;  1R9T B;  1GUN A;  2RA4 A;  5JOB A;  4M8A A;  1PTO C;  1I6H B;  1CT1 D;  5COR A;  1TVX A;  2HDM A;  2PPB C;  3ITP A;  2B8G A;  1BF4 A;  1I3Q B;  1PZK D;  3CU7 A;  4KY5 A;  5TSS A;  4QCL A;  1PFM A;  2L9H A;  4X3T A;  5C0X G;  4DN4 M;  1L0Y B;  2VB3 X;  3SK8 A;  4NMZ A;  2E2I B;  1F2L A;  1Y8N B;  5IGE A;  2BCO A;  1JC7 A;  2QDB A;  2I07 B;  4RAU C;  4ZK9 B;  3S1M B;  5IGC A;  1DCZ A;  1SSO A;  4O42 A;  3L7Z C;  2EVB A;  3SR1 A;  1EY7 A;  4CKB A;  5D3I B;  1Y8P B;  4H7B A;  2Z8L A;  3HKZ B;  4KI0 A;  4KJO A;  4CKE A;  1EWC A;  5K5P A;  3M85 A;  2XSC A;  1EY0 A;  1PRT C;  1RD9 D;  2RSO A;  4P2C B;  1TKW B;  1CZG A;  3DEO A;  5C5L A;  2DNC A;  2F0Q A;  3ERQ A;  2FMM A;  5EJW A;  2WKD A;  1K8M A;  2F1M A;  4IFD H;  1Q90 A;  3C2P A;  4IQZ A;  1W6K A;  4E6I A;  1PRT B;  2E2D C;  5HGT A;  4DK1 A;  3E5S A;  1MD2 D;  2N55 A;  3A7L A;  2QIL A;  3VA7 A;  1OXT A;  1WTX A;  5CR3 A;  2WKC A;  5E3F A;  2HUG A;  1I50 B;  2AWN A;  3I3C A;  5ISR A;  1DD2 A;  5LL6 X;  2ZXO A;  3LWU A;  1B44 D;  4LAA A;  5FK9 C;  1IKM A;  5C4Z A;  5I2X A;  5K36 H;  3HZX A;  2R3Z A;  2IX1 A;  2HCI A;  4R8I A;  5FOB B;  4XQQ A;  1BNZ A;  3K5M A;  4R8N A;  1SYB A;  2J4X A;  1MGS A;  4IAL A;  3EFX D;  5CGK A;  4L6T B;  3S2H B;  4DAY A;  3I4L A;  1DJR D;  5CV5 A;  4BS9 A;  4I65 A;  3DXJ C;  3FPU B;  4C3J G;  1O80 A;  1SYE A;  4DAP A;  1I4H A;  1YNJ D;  5EPL A;  3BZD B;  3C1F A;  1ESR A;  2KCC A;  4KY7 A;  3FEW X;  5E4W C;  2M00 A;  4IUU A;  2J7Z A;  1TWC B;  1DON A;  3DUZ A;  1VCI A;  1STA A;  2K5D A;  4LK1 C;  2N88 A;  4L8J A;  2CVR A;  2EYL A;  4IFD G;  1D5M C;  1V1O A;  4Q0F A;  3VYR A;  1RKN A;  2EY5 A;  3PMF A;  3U9O A;  3VYT A;  4PQX A;  4ZUI A;  3FDT A;  4B08 A;  4R9W A;  4HSP A;  2KOL A;  4EQN A;  2ICI A;  2WII B;  3IFD A;  4F87 A;  2FFK B;  2NB0 A;  1SDF A;  2RKS A;  3S9W A;  2DY7 A;  1GOZ A;  3A7A B;  3GO5 A;  5CV9 A;  1I4P A;  1I4Q A;  2NTS A;  2JA6 B;  1DOK A;  3I4N B;  5I9O A;  3AU7 A;  5M3F B;  1QE6 A;  3PIO 3;  3H3V C;  1KAA A;  5ELE A;  2L12 A;  3NWS A;  4JBW A;  1A2T A;  3I90 A;  5G3L D;  3PUY A;  5ELB A;  3JAM E;  1CZW A;  4A93 B;  1KAB A;  5G3L F;  1PDQ A;  5CMD A;  2AWO A;  5FO8 B;  4K5W A;  2Z4I A;  1FNV A;  3A54 A;  2PO4 A;  4LMQ D;  3L3O C;  1Q1E A;  3D4R A;  2F0O A;  5IOD A;  3E0J A;  4BBR B;  3T16 A;  3NTH A;  4BBS B;  1VMC A;  3P1H A;  4KKT A;  5KNC A;  2KJX A;  5J1Z A;  2EYP A;  2O2L D;  3CHB D;  2VB2 X;  1ZYR D;  5CBE E;  1RDP D;  2NUC A;  2A6E C;  2OEO A;  2F0F A;  3A56 A;  4BA2 I;  1HXY D;  3TZD A;  4RH6 A;  4QUC A;  2PCF B;  3K5N A;  5T1I A;  3HGB A;  3I8Z A;  4B9X A;  2L1B A;  4RKB A;  3NTK A;  2ZT9 C;  3DMU A;  4YIJ A;  2E2J B;  1WTO A;  2CQA A;  4U68 A;  2NVT B;  1LTA D;  2AQ2 B;  3S1R B;  3M4Y A;  2NWG A;  3N6R A;  1RJT A;  3I72 A;  3RZO B;  1DZ1 A;  4JK1 C;  2D2C C;  1SE2 A;  3PUV A;  4ZQ3 A;  3U9S A;  4OO1 G;  2PYK A;  1TU2 B;  5AFW A;  5I2Y A;  1ESF A;  2BDN A;  1B4O A;  2EY2 A;  1DM0 B;  3GTP B;  4G7Z C;  1UNS A;  5LL6 S;  2WAQ B;  1JOK A;  3NUC A;  1GUG A;  3OWF A;  1FD7 D;  4OO1 H;  3D8G A;  3IL8 A;  1JIC A;  2AUK A;  1SYD A;  2B2T C;  4RA8 A;  2A68 D;  3JAM L;  2AUJ D;  3DWP A;  2JSO A;  2JXM B;  1T5X D;  1STY A;  3Q22 A;  2M9V A;  1GJX A;  5IGG A;  1PTO B;  2FJ2 A;  1PRT D;  1FR3 A;  2BE5 D;  1S5C D;  1STH A;  5LHY 1;  2KQ3 A;  4RGN A;  1BDO A;  3BDO A;  1EZ8 A;  2F0V A;  2F0L A;  3MHB A;  4OL7 A;  4CJ2 C;  5IT9 L;  4NP5 A;  2YU9 B;  4K14 A;  1BOS A;  5F2D A;  2SNM A;  4CJ1 B;  3PUX A;  4RHR A;  3VYS A;  3W3A A;  5IT9 E;  1SNQ A;  4DAV A;  4B9W A;  2SNS A;  5KND A;  4BA1 I;  1TWH B;  1Z7T A;  4CGY B;  5A2Q E;  1QIL A;  4X3K A;  3T51 B;  4A3F B;  3R2T A;  2B2U A;  1B3A A;  3K58 A;  3CQZ B;  4KD3 A;  1WCM B;  3MXG A;  1J8I A;  4KHV A;  1G2S A;  3ND8 A;  2I46 A;  1B9N A;  1DOM A;  4J8Q A;  3CRL C;  1HPC A;  1ZKO A;  1O7L A;  2NN6 I;  5T1G A;  5I6Y A;  3J80 L;  2A73 B;  3TN2 A;  5CV6 A;  1A3V A;  1SYC A;  2PW5 A;  1ILP A;  2EYH A;  2KED A;  3MFY A;  4A3J B;  3PUW A;  2QCP X;  1BUV T;  2XRQ D;  1EEI D;  1JQY D;  4H0L C;  4EGV A;  1HUN A;  1AZP A;  3FRP B;  3MZ5 A;  1AW7 A;  3A8J E;  4H13 C;  3MWY W;  1LAB A;  4RGT A;  5DM7 3;  2G9D A;  4WOR A;  2YYZ A;  4O1N A;  3ZYY X;  2EPB A;  2K1B A;  1F77 A;  4J6H A;  2IT1 A;  2A69 D;  1SFO B;  3OIP A;  5DAU A;  2RBM A;  3G6J B;  1C8C A;  2BDO A;  2K32 A;  3PIP 3;  2LFN A;  2EY6 A;  3ND9 A;  2EY1 A;  1D5Z C;  4UDU C;  5IIF A;  4KY6 A;  3SK4 A;  3HOX B;  5IGD A;  3OMC A;  3TP7 A;  5CV8 A;  4K6D A;  3K0Y A;  2R61 A;  1HHV A;  2EYF A;  1EY5 A;  2J0T D;  2QEJ C;  5DM6 3;  2M2L A;  5BN3 A;  2L0C A;  2F0P A;  4KKS A;  1B50 A;  2LKV A;  4AYB B;  2ICE C;  4C1N I;  2F0I A;  3GV3 A;  5IOC A;  1V8Q A;  3X3N A;  1T5E A;  5E1F A;  1ENF A;  1HUM A;  1U4R A;  5CV7 A;  1LT3 D;  3Q0A A;  1JR0 D;  1F9R A;  2K04 A;  5KYI A;  4CJ0 B;  3C3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...