2IL8A

Three-dimensional structure of interleukin 8 in solution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords INTERLEUKIN-8
publication title Three-dimensional structure of interleukin 8 in solution.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2il8A00
1RTOA 1WTPA 1EL0A 2DY7A 2B2UC 2FINB 1WD1A 1IKMA 2R3ZA 4X3TA 1O7YA 1O80A 2K03A 5E4WC 2FMMA 3R93A 4IUUA 2IL8A 2KEEA 1G91A 1X32A 1TVXA 3IL8A 1DOLA 3KUPA 4IUVA 2NYZD 1SSOA 5EJWA 2MGSA 1BNZA 2B2YA 4O42A 4XT1B 1ILPA 1HUNA 5EPKA 2D9UA 1U4LA 4LMQD 5CORA 3TN2A 1PDQA 2FHTA 2BDNA 3MWYW 1NCVA 1ZXTA 1HFNA 1QNKA 1RHPA 2SDFA 1QG7A 4MN3A 4NW2A 1B4OA 1XX8A 3H91A 5JJZA 1EIGA 1E0BA 4R9WA 1WTQA 1WTXA 1BF4A 1RJTA 2EOTA 3IFDA 4HAEA 1AP0A 4ZAIA 2N55A 5DNFA 1SAPA 1HUMA 1U4PA 2L4NA 1F9SA 3D6WA 2B2UA 1F2LA 2K1BA 2KOLA 2HDLA 2JYOA 3DEPA 5EQ0A 2K04A 1J8IA 5T1IA 3I3CA 1ILQA 2K28A 4DN4M 3HP3A 1Q3LA 1DOKA 1J9OA 3LWEA 3TZDA 2KUMA 1IKLA 1PFNA 2VXWA 2B2WC 3G7LA 1G6ZA 1NR2A 2KVMA 4QUFA 2MP1A 5D14A 1AZPA 1S4ZA 4X3UA 2EPBA 3ONAB 5CBEE 3FDTA 4ZKBB 4ZLTF 5EPLA 1WVLA 3KBXA 2HCCA 3QO2A 1BBXC 1SDFA 5T1GA 1WTOA 1HHVA 2EE1A 4UAIA 1O7ZA 3MTSA 2K01A 2X6LA 5COYA 1C8CA 1PFMA 1DOMA 1MSGA 5CBAE 3FPUB 5CMDA 4X3SA 1U4MA 1B53A 1HFGA 4ZKCB 4HCSA 1WTVA 2L11A 4IUTA 5EPJA 1CA6A 1B2TA 1X3PA 1ESRA 2B2WA 2RA4A 1QE6A 3Q6SA 1HA6A 1EOTA 4RWSC 1ICWA 4OIKA 2L9HA 2Q8RE 2HDMA 1X3QA 1IL8A 2B2VC 4IUPA 1M8AA 1MSHA 2NWGA 1EIHA 2MJ8A 4CJ1B 1DONA 1AZQA 5AFWA 4QUCA 4U68A 2B2TC 3P7JA 1NR4A 1CM9A 1MGSA 2K05A 1WD0A 5D65A 2FFKB 1B50A 4MHEA 4HSVA 3SVMA 3I8ZA 2CVRA 2KECA 1BO0A 1VMCA 3GV6A 2NZ1D 2RVLA 2HUGA 4IURA 4ZK9B 2HCIA 1NAPA 1F9QA 1U4RA 2J7ZA 4HEDA 4CJ2C 1WTWA 1JICA 4RAUC 1PFBA 1GUWA 3DM1A 2X6GA 3N52A 2L1BA 1MI2A 1KNEA 3GV3A 4X3KA 2L12A 2B2VA 3DEOA 1JE4A 1F9RA 2DY8A 2H1EA 1RTNA 1LV9A 1VMPA 1WTRA 2FJ2A 2KEDA 2RSOA 3I90A 4XDXA 2Q8TA 4R8IA 2JP1A 2N88A 3I91A 1RODA 2B2TA 2B2YC 5E4XA 1CA5A 5EKIA 4RA8A 1B3AA 1EQTA 4XT3B 1HRJA 1PLFA 3F2UA 1G2SA 1G2TA 1KNAA 1A15A 1ML0D 4OIJA 2MPMA 2XIWA 1XYIA 2M2LA 4IUQA 4CJ0B 1F9PA 2X69A 3UI2A 2RSNA 1DZ1A
chains in the Genus database with same CATH superfamily
2ZJQA 5JJLA 2PZTA 2FINB 1QB5D 1E1TA 1STAA 2IL8A 2KEEA 1X32A 3HKZE 2EQSA 4JI7L 1VQOA 1Q86C 4LWCA 3H09A 3HOYB 3D4WA 2Y0SB 1A8VA 1Y1WB 5M5WH 3GTLB 3TEHB 2CCZA 4JI4L 1PTOC 2WP8J 2NVTB 1AP0A 2NVXB 2XN9C 5ELBA 2N55A 1CHQD 5CYUA 2EY6A 5KIXA 3DEPA 1A62A 4EQOA 4BBSB 4FNFA 3IAYA 4HR7B 1BQQT 2RCNA 5C5LA 3JAME 5JEAG 3T1YQ 2Y0SE 4KY5A 4A3LH 1TWGB 3PGZA 3K7AB 2PCFB 1S4ZA 2MO0A 2KHSA 3A8IE 2J0TD 3CCJA 5I6WA 1BBXC 5M3FG 1JCKB 1VQGA 5M5XH 2JSOA 1PFSA 2JK8A 3CPWA 4DR1L 5CBAE 3D4RA 4Y52H 2PI2E 3EFXD 4C3IG 1PRTB 1YVCA 4MNOA 3I2ZA 2DUDA 4FF1A 2XSCA 2BH2A 5C0XI 3CCQA 2ZT9C 2L9HA 1XNQL 1X3QA 1VQ5A 2F0WA 3PUXA 3PIPA 2PYKA 1VDZA 4K8JA 2GA4B 3NUCA 4O1NA 1IW7C 1I4PA 4K5WA 3MXUA 3OYYA 1XWEA 2KECA 2RF4A 3PO2G 1N34Q 3TP7A 4DUZQ 4A3FH 4BY7H 1L1OB 1XTDA 1UWVA 1D5MC 1HR0Q 1KL9A 3S16B 2IX1A 3K0YA 3CF5A 4HIKA 1S72A 4LAAA 4XT3B 1AEXA 3R2TA 4XQNA 2Q2TA 1V43A 3A74A 3M4QA 1YI2A 1W6KA 3GTJB 2X69A 5C44H 1YITA 3K0XA 4L6TB 4A3IG 1VQNA 1XMQL 2DGYA 1RIPA 5IT9L 2XNAC 1BBUA 1IKMA 1TR5A 2NYZD 3KLSA 5E3FA 5C4JH 2K5HA 2E2HB 3HOWH 2L55A 3K6OA 4C3IB 2QDLA 4A3KH 1QG7A 4DR6Q 4PMBA 4R9WA 3T1YL 3RMHA 2WACA 2ASBA 1F9SA 4G7OC 3U9SA 1TT2A 5GADC 3LWUA 1PV4A 4DUYQ 2R7DA 1PFNA 3Q0AA 3BZCA 1QOHA 5E1FA 4WORA 5DAUA 2Z6KC 4JK1C 1ZYRD 1SFOB 4JOIA 3IFTA 3TMEA 2CFMA 1JWUD 3S14H 5COYA 1DOMA 1Q82C 2K75A 1HNZQ 1B53A 1RDPD 3NBHA 5L37A 2BCOA 4IUNA 3GTQH 3S1QH 1K0SA 4B3TL 2A69D 2HIXA 4GNXA 5ELOA 1B7YB 4A3IB 2PQAB 1KTKA 3S1NB 4MIUA 4NB3A 2B2TC 3GTGB 3A7AB 3PF5A 4DV0L 1WTHA 2FFKB 1HR0L 1PA6A 2CVRA 1KDAA 4DV4Q 2MFIA 3GDEA 1HTLD 1HTPA 1Q7YC 1D6EC 5C3EB 1SNPA 4FF2A 4A3DG 2B8GA 3A56A 4KV6A 3OWFA 1RTNA 4KKSA 2EY2A 5FLXE 4EQPA 3MA2B 2RSOA 4R8IA 2LY7A 2NVYH 1FJGL 3HG9A 4J1MA 4N9PA 4A3GG 2B8FA 1KAWA 1W6JA 4DXGA 2CW0C 1NTGA 4KD4A 1KRSA 1MJCA 4IPGA 2YTVA 1VQ4A 3M7GA 3FKIH 2RSNA 3TQYA 4CDFC 3K80C 4X62L 3H3VH 1WD1A 3I4MH 3AFQA 2E75C 2JXMB 1O80A 3R93A 2O4XA 4BY1H 1Q81C 3KUPA 3NTHA 1K8GA 3NTKA 1KAAA 1PZID 2SEBD 3EQLC 2D9UA 1SRUA 1OTCA 4E6IA 3V96A 5C3WA 2SDFA 5LMNL 2OQ0A 2XRQD 4RCNA 4LUVA 5IGCA 5KNBA 3PUWA 3KK7A 5C4HA 3HOXG 5K36H 1HUMA 3VYUA 3SK6A 4QIWB 3STBC 2WIIB 4R1JA 1EYCA 3HP3A 2ZXRA 2CWAA 4LK1C 4DAYA 1NUCA 1QWYA 2F4IA 5IGGA 1K8AC 1G6ZA 1HNWQ 5IYDH 2PO4A 2D5DA 1HNZL 3E9HA 4C3JH 2A6EC 5CBEE 3HFZB 2F0DA 4GKKL 1DM0B 3KYHC 4QIWE 2A8VA 4DR7Q 3CQZH 1L0WA 3OWEB 5ELFA 3QOJA 1G6PA 4KMUC 1DD2A 4A3GB 2L11A 4IUTA 2Q2HA 5FO8B 1HA6A 4JPBW 2B29A 3GTPH 2YYZA 3HZXA 2KHJA 5EGTA 4OX9L 1VQAA 5DEHA 3Q8DA 3OMGA 4MTKA 3CP0A 4V190 5LMNW 1VQ9A 1F77A 3VYRA 2JA5B 4X66Q 2KJXA 1E22A 1SEBD 3UDXA 1EWHA 4HSVA 3DXJC 3FRPB 3J80E 1BO0A 4JI0Q 1S40A 1XPUA 4LUOA 2R7ZB 5G3LD 3OOCA 2UXDQ 1H9RA 4ZQ3A 1AE3A 3HOXB 1JE4A 5IGDA 2JA7G 3S2HH 3UDFA 2Q2IA 5IGFA 4Q5VA 4RA8A 1B3AA 1GHJA 5FKAC 3TSSA 3KBGA 3W2DA 1EZ6A 1I3QB 3S15H 3CXCA 3HOZG 1LTTD 3UI2A 3H94A 3P75A 1HZCA 1EY8A 1A2UA 1YNXA 2XWBB 1VQCA 4P75A 4G7ZC 1II3A 3M7NA 3H0GH 4LF6L 1PMRA 1PDQA 4NXNL 5M3MH 1NCVA 1VQEA 3TP8A 2WKDA 3D3RA 4YY3L 4DNIA 3EA6A 1PH1A 3SDZA 2ZTEA 3CCRA 2L4NA 2K1BA 4DR4L 2K04A 4JI5Q 4DAMA 3W1BA 1VQLA 4WJ3M 1SNMA 5IYCH 4N8X1 3TZDA 1KLGD 3M3YH 4LJZC 3SXHA 1EY6A 1OXXK 2KCCA 2EYOA 3K57A 3G7LA 1EY0A 4QUFA 3HGBA 1EFWA 1B8AA 1Y8OB 5BN4A 5J1ZA 4DV1Q 5IGBA 2A68C 4NDXA 1LTID 1T5XD 1FNVA 1WVLA 3S1MB 2Z6BA 3GTOH 2YTXA 3GD7A 1D1IA 1Q8IA 4PMCA 5J22A 1QVGA 4RG1A 5CV7A 2JA7B 1B9NA 1SNOA 3NBHB 1TY0A 2H5XA 4V0BA 1JOKA 4KHZA 4NP5A 1HZ9A 1C48A 1Z9FA 5HY6A 4GNXB 1SYFA 4A3LG 3CAMA 1IL8A 2B2VC 3HOZB 2GVAA 2KCMA 1NY4A 1DCZA 2UXCL 1NR4A 1CM9A 1I6HB 5D65A 2L5TA 1J6QA 3A5ZB 1EYGA 2LKVA 4DA2A 4O2DA 2C9OA 1LTLA 2HCIA 4C2MB 1S5ED 2WKCA 1WTWA 1IYUA 1X3FA 2F0GA 5JJKA 2IW3A 4P72A 4PNYA 4LFAL 2TSSA 1F9RA 4UPAA 5C0XJ 2KENA 4I7AA 2QGQA 1O78A 2D0PA 3ZYYX 5FJ8H 4LFBQ 2VNUD 1SNCA 1Q8KA 3A0JA 3QG1A 1KNAA 2EXDA 4RH6A 1XYIA 2F0MA 2M2LA 2CH4W 1PVOA 4YWKA 2RQXA 4A93B 5M5WB 4A3FG 4XTCS 3U9OA 1PZJD 4P71A 1G91A 4BY7G 3CW2C 2F0TA 1JJ2A 4LF7L 3MZ5A 5CC4A 1HUNA 1L1OA 1CT1D 3KLWA 1U4LA 4N9TA 4DV2Q 2PPBC 3MWYW 4QCLA 3H6MA 2VQEQ 1B4OA 2ZXPA 1TY2A 5IT9E 1UUPA 1H95A 5C44G 5C6AA 2EIFA 1RD9D 1K3RA 2FXQA 2KOLA 4RKBA 3PQIA 2EYFA 3C1EA 5ISRA 5A35A 4KHPL 4RGTA 1D5ZC 4DAYB 1SMYC 4HJ9A 5M5XB 2UUCL 4RHRA 2OWOA 4AQYL 3FMCA 3HOWG 2CQOA 1B3QA 1ICFB 4Y7NH 4B3RL 1ENAA 3NTIA 3P20A 4LFCL 1BCPB 3P1HA 5EPLA 3QO2A 1LABA 3OIPA 5IE8A 2IJ0A 1IYVA 3Q6SA 4IQZA 1GUTA 2BE5D 2HDMA 2C35B 3ZJYC 4JW0A 2R92H 4GLAC 3BG3A 1XMOL 4O0AA 1AW7A 1WD0A 4BY7B 2OCEA 1T9HA 1GUOA 4KY7A 2VQFQ 1EZ8A 5JEAJ 2NZ1D 4B3ML 3PF4A 1K83H 4A3MB 1D2BA 1X54A 2F4VQ 3SK8A 2XVSA 4PG3A 5JVG3 1FNWA 3RZDH 5JPMC 2DNCA 2VUMH 1I94L 3GQBA 1EQQA 5C44B 4DK1A 3FP9A 2TMPA 1TWCB 1EWCA 1PYBA 1H9JA 4DFAA 3I73A 3L2PA 1Y1VH 4IUQA 5C4JB 4LNQA 2OTLA 3EN2A 1DJRD 1B44D 4KI0A 4L5RC 3HOWB 3A5UA 1DYQA 1Y8NB 2DY7A 1EYAA 1VQFA 4X3TA 5LL6S 5E4WC 3N6RA 1U0LA 4J15A 5M5YH 3D31A 4FXKC 2AUJD 1CZGA 1S5BD 1D1KA 4UP7A 4LMQD 3E0JA 2EJMA 4UY8C 1JWSD 1LTSD 1B1ZA 1E2WA 3W3AA 3RN5A 2Z4HA 1SJHD 3BVZA 5DNFA 3ULJA 1OXSC 1J8IA 3FKIG 5IIFA 2JYOA 2BOSA 3U58A 4HCEA 2RKSA 3I4MG 1ILQA 1Q3LA 3DUZA 4BY1G 5K5PA 1YEZA 1J9OA 4APVA 1FVIA 2F0QA 5FOBB 2GN5A 1PRTC 3LNNA 2VL6A 1X55A 2ES2A 2ZM6L 2EPBA 3ONAB 1CFMA 4DV6L 2UXBL 2B63B 5BR8Q 3E6ZX 3S1QB 5K36G 2D0OA 4JBMA 4TRDA 3T16A 2ZXOA 4JI6Q 2R93H 1QJOA 1ET6A 4X64Q 4A3CH 4DV3Q 1UE1A 4LF4Q 5I6YA 3RNUA 2E5LL 3CCSA 3GTKH 2SNSA 3J81c 4ALPA 1A3TA 3R2IA 5IYDG 1JOOA 4DV7L 2D62A 2PNHA 1KABA 3E9IA 4OWWB 4C3JG 2MJ8A 4MTNA 4FF4A 2F52A 5HURA 1FR3A 3P7JA 2K05A 5I9OA 1FGUA 3CC4A 4MHEA 2UUBQ 1K3BC 2YTYA 2NN6I 1TS3A 2F3WA 4JI3Q 4IPDA 3D0FA 2HUGA 2K52A 5IGEA 4CDDC 1UNSA 4HEDA 2E2IH 4ZCKA 4C56C 3DM1A 3X3NA 3DLLA 3DWQA 1J5EQ 1E2ZA 5JVH3 5C4XH 1VMPA 1M4VA 4CGYB 1IBLL 4RGNA 3FKIB 2MUYA 3MFGA 4GN5A 4F8MA 3BDCA 4BY1B 4OIJA 3AU7A 2XIWA 3MVVA 2IWHA 4JI1L 4X65L 1MJEA 4B3SQ 1LTBD 3GP7A 3J80i 3EVQA 4XQQA 1DZ1A 2I0QA 1TWFB 3GO5A 4DGZA 4IUUA 2CWPA 4JYAQ 1IW7D 4PQXA 1W2BA 4DR2Q 1SSOA 2AMCB 3DWAA 3FPPA 1ILPA 5CORA 1SNQA 3PIOA 1QNKA 1RHPA 3PIO3 2A19A 3U4VA 2Z8LA 5JJZA 2RDFA 1KLUD 3F2BA 4L8JA 1TU2B 2G9HD 3MXPA 4X6AH 1D8LA 3MAQA 4C3JB 5T1IA 3I3CA 3A7LA 3AEVA 1X3GA 4WRDA 1JB3A 5EKLA 4YCVA 5M3FB 3CQZB 4JI6L 2E2JB 3H0GG 1GUGA 3ULPA 1YHQA 2HD3A 5M3MG 3FDTA 4QL5A 2AWOA 3S1RB 1E1OA 1STNA 1V1QA 3GTPB 2AQ2B 1LT5D 1N9WA 3VR6A 1PFMA 3CC2A 1NMGA 2L15A 1CUKA 5IYCG 2F0OA 2RCFA 3NEMA 2NB0A 2B2WA 2F0HA 1ICWA 1M90C 1IBMQ 2Q8RE 4PZ8A 2OF1A 1UE5A 4LF9Q 3PO2B 3NPPA 4GOPA 4KJNA 3B6YA 1AN8A 2ZJPA 1JB7A 1DONA 2Q8IB 3KJOA 1AZQA 2MHVA 1J5EL 4IFDH 5JAVA 1MGSA 3AQQA 1PH8A 4F88A 1IL2A 1H9KA 1R4QB 3I72A 5EBCA 3S2HB 3KF6B 4JI8Q 2PW5A 1SROA 1Q90A 3N52A 4R8NA 3UDIA 4B3SL 3S15B 1N34L 3K5NA 2N88A 4H13C 4CKBA 5I2XA 5ELCA 4DUZL 5I9PA 1ESFA 3K59A 4JG2A 2A69C 1YIJA 5ELEA 1JORA 3H0GB 1E3PA 2JA8H 2J4XA 4ODGA 4EVOA 3NXWA 4J6HA 4AIMA 1I4HA 5M3MB 1TS4A 1Y1WH 3AB9A 4XYOA 2UUAQ 3K5LA 3GTLH 1HNXQ 1EL0A 2VZAA 3WWVA 1TWAH 2B2YA 4RKLA 1Q46A 1WJJA 1XXGA 3TN2A 1X9NA 5G3LF 1ET9A 4MN3A 1XX8A 3L9AX 1WTQA 3M3YB 1RJTA 2KA7A 2F0IA 2B2UA 4ULLA 1EQRA 3K7AH 1JJCB 4KHVA 1AE2A 3AFPA 4BXXH 4DR6L 5C4ZA 3F2DA 3D6CA 1SYBA 3GTOB 4H44C 4GKJQ 2F0FA 2CW0D 4DKAC 1EY7A 1Y14B 4POGA 4JI2Q 4A3BH 5HGQA 1GUSA 3UDGA 3J7A5 1I50H 2CHBD 2HCCA 4OXPA 3CU7A 4DUYL 2NVQH 1YJNA 1UE6A 1HR0W 4PMWA 1LT6D 1BR9A 4K0KQ 3FPUB 4X3SA 4ZUIA 1PTOH 3KF8A 2EZVA 3NQTA 1CA6A 3KLRA 2A6HC 4ABNA 1AH9A 4RWSC 3SHLA 3T1HQ 4LF5Q 3CMEA 4BBRH 1N32Q 1WCMH 3CHBD 4UHVA 5IWAQ 4IJHA 1MSHA 4HMJA 3TS2A 3STBD 1GHKA 2JA9A 1BKBA 1LTAD 1VQMA 2SNMA 4A3DB 1C4QA 3V05A 1K73C 4FVMA 3S16H 4IURA 5IOCA 1EEFD 1VCIA 3FEWX 1SXTA 4DV5Q 1PYWD 2L1BA 1R4PB 3J81j 4X3KA 2YU9B 2L12A 2VY3A 1STHA 3GTJH 4DV4L 1QNUA 1LUZA 3M85A 2LMCB 1YNNC 2K5NA 2I5MX 2VW9A 2R92G 4CDEC 1CI3M 1IBKQ 3SEBA 5AJ3Q 3OTOQ 4A75A 4IOCA 4B08A 3I4LA 1R9TH 4DK0A 1K9MC 4YHHQ 2EYMA 2E2HH 3S17H 1Q12A 2R3ZA 4K6LA 2EVBA 2VUMG 1TVXA 3J81L 1GJXA 2MGSA 2H4OA 4XT1B 3MXGA 2IPKD 2F0LA 3K5OA 1E7ZA 2FHTA 1SYDA 1BUVT 4Z9CB 4R4TA 1Y1VG 1JE5A 2K14A 3OW7A 3IFDA 4JOIC 1QVFA 4ZAIA 3ND9A 1YHAA 4C1NI 4CBVA 4FDBA 2KBNA 5EQ0A 3Q24A 1BCPF 2JQOA 5C3XA 4DN4M 3HOVH 1KD1C 2DJGC 2KUMA 2N3SA 4OO1H 5EKKA 2EYPA 4DNTB 1WFQA 4GNXC 4ZLTF 1FYCA 5D3DA 3G48A 1VQPA 2WFWA 1HNWL 1CTMA 4K14A 2HIVA 2DNEA 1TKWB 3R3OA 1ENFA 4NXMQ 4DR7L 4A4IA 4GOPB 4IJLA 3SE0A 1S5DD 1K83B 3ULLA 4DU9A 3NELA 1UEAB 5C3EH 3BZKA 3OMCA 2VUMB 4HN7A 2N8NA 1TXYA 2A1AA 2R93G 2DN8A 1EUJA 3HS0C 1NAPA 4R4OA 3T53B 4A3CG 4LF8Q 3CMAA 4X66L 1KNEA 1Y1VB 4BA2I 2A68D 3DEOA 4PZ6A 3BU2A 3VR4A 3G4SA 4JI0L 1PZKD 1WTRA 2FJ2A 1SJED 1STYA 2QILA 3CRKC 4K6DA 4LW1A 1DGSA 4L5QA 2UXDL 1HRJA 3F2UA 1G2SA 2EYLA 3U4ZA 1Z7TA 5FLMH 2R6GA 4HMIA 5M5YB 1CKNA 4EQ5A 4OWTB 2NUCA 1RTOA 4ZYSA 1G291 3MXNA 3IKJA 4H7BA 1A6XA 3NENA 5DM73 1QILA 5C4XG 1DOLA 4DR3Q 4IUVA 4EX5A 3PUYA 2UU9Q 3OPOA 2V4DA 1F2YA 1CHPD 4IOAA 1LTRD 4ILWA 3DHQA 1LO5D 4Q0FA 3BYYB 1BCPC 3CPFA 1SYGA 1F2LA 1ZEQX 4S3SA 3CCMA 1V9PA 4R4QA 1S3OA 3M4OH 4ID6A 3RR5A 3MEFA 4RFBA 1GVPA 4KJOA 2HHHQ 2CQAA 4HSPA 2R93B 2HT1A 1SYEA 4JI5L 5D14A 1HQMC 1I4GA 2DJFC 4UDUC 1B9MA 3GTKB 2G5DA 1X65A 4UAIA 1SBBB 2X6LA 4BS9A 1K8MA 4EQNA 3KF8B 5IYBH 4JV5Q 2K7VA 2VB2X 4DK3C 4HCSA 4DV1L 2JA5H 3L3OC 3VR3A 4WJWA 2M9VA 2WB1G 5EPJA 5F2DA 3E0EA 1YNJC 3BDOA 4JVZA 2R7ZH 1EEID 4CJ1B 4A3JH 4A3KG 1QCBD 3ER0A 3TZUA 3I70A 4FF3A 1XNRQ 5C4XB 1G8ZD 1KDCA 4M1UB 3SK5A 1U4RA 1V1PA 2XRSD 4XYQA 2JA6H 3VR5A 4G57A 2QEJC 2WINB 3RUZA 1V8QA 2A73B 1EY4A 1I3QH 3QIAA 5FK9C 1E24A 4POFA 2L0CA 2E76C 4DAPA 1ASZA 1CKOA 2P5ZX 2XTIA 1YBYA 2EYHA 3SR1A 4IFDG 3T51B 4A3FB 1O7LA 1ML0D 1KQSA 1TWHH 2MPMA 4RHSA 1PH5A 4FO2A 3HKZG 3Q23A 4K8IA 1L2FA 2F0PA 1STEA 2LXJA 4BWGB 1WTPA 4LFBL 2ZTCA 3GTMH 3KF6A 2CKZB 3I4OA 2RBMA 2BDOA 1N8RC 4JI4Q 1VF5C 5EJWA 5EAYA 2ICEC 4BA1I 2Z1CA 1X56A 2GVBA 4LUZA 3J7YW 1ZXTA 1HFNA 1E0BA 5H1SE 1BF4A 1I5FA 4CHTB 2OXPA 3CCLA 3K58A 4F7XA 2EDGA 1NSNS 2JA8G 2K5VA 5CV5A 2F03A 2Y0SG 4DV2L 1SLJA 1Z6HA 1I4QA 1NMFA 3H15A 1Y1WG 4A3KB 2VQEL 2K28A 1BDOA 1PHJA 4A76A 4OGQC 3M9BA 2A74C 2OT2A 2O5IC 3EROA 4U673 4DR1Q 3NWSA 4ZKBB 3K8AA 1EIYB 3PO3H 1CSQA 1A63A 1XNQQ 3MTSA 3VDYA 2PNRC 4QF4A 3S2DH 1ASYA 2RHSB 4BXXG 1K8OA 1UEBA 4YWMA 2RA4A 3F1ZA 4WFN3 4JC0A 3K7UC 2IT1A 3PUVA 2Z6KA 4QB4A 2I5HA 2LFNA 2EJGC 3S14B 4HJ7A 4A3BG 4HJ8A 3JAMc 1M8AA 4IN3A 3PSIA 4IZ8A 2EY1A 1EIHA 3CCEA 4U68A 1IHZA 4C3HH 2F3IA 1B50A 1CQVA 4QMGA 2LS01 3GTQB 1HZBA 4G7HC 1PRTD 3S24A 4F87A 3F2CA 1HPCA 3EJIA 5BN3A 1A2TA 5IP9H 4B9WA 2DY8A 2VQFL 4BBRG 2G9DA 1WCMG 2B39A 5CV9A 2JA8B 2KEDA 1PTOD 4A93H 2B2TA 3OHXC 2F4VL 1XMQQ 1SYCA 1L1OC 4XQJA 1GD7A 1SE8A 1TWAB 1CKNB 2VS1A 2R61A 5I2YA 4NPSA 3I55A 3I4NH 3BS1A 2NVYB 3MXNB 3Q22A 3CCUA 4DXFA 1OO9B 2MNAA 3D4DA 2FMMA 4IFDI 1BOSA 2F0VA 1I6VC 2KHIA 3OIQA 1BNZA 2QEXA 4O42A 3VYSA 1EIFA 3G6EA 3HOUH 5EPKA 1PH2A 4OL7A 1D5XC 4HJ5A 2BDNA 1PXUA 3I4MB 3CCVA 1STBA 3H91A 1EIGA 3TDQA 1WTXA 4I65A 4HJAA 1L0YB 3FVQA 4H02A 1MHWC 4A3BB 4KD3A 5KYIA 3J81E 1QUQA 1EU4A 4CKEA 3NP8A 1I50B 4DF7A 2K5WA 2NVQB 4DAVA 3CKIB 1H9SA 2I5LX 3UE1A 3U50C 2VXWA 1P8LA 3PIP3 2KVMA 1PH7A 3J7AV 3LGJA 1AZPA 1PTOB 3QJYA 2ZJRA 1JWMD 4KK7A 2BA0A 5FO9B 1SDFA 5T1GA 2EXZA 1IXRA 4BBRB 2ZTDA 4PZ7A 1WCMB 4B3TQ 2JEAI 3RN2A 2QCPX 1MSGA 1CSPA 2LSSA 5CMDA 1FD7D 1JQYD 1HFGA 4DPGA 2QW7A 3HOVG 1LACA 4NKLA 5BR8L 1I4XA 4DV0Q 3HEJA 2WV6D 4A3EH 4OO1G 3BDLA 4A3MH 1EY5A 4X64L 1NJIC 4MZ9A 1EYDA 2E2DC 2XGTA 2AUKA 4DV3L 4OHJA 1HCZA 5IP7H 4LF4L 5A2QL 3H3VI 3T4AC 2K5QA 1K28A 2F0SA 2JN4A 2RVLA 4RGOS 1PH9A 1V1PB 2YV5A 4ZK9B 1XJVA 1FJGQ 4RAUC 1TWCH 2RHQB 3GV3A 4QY7A 2UUBL 1YJWA 3MFYA 2BA1A 1R9TB 4JI3L 3RZOH 1X3EA 3S17B 3M4PA 1EQTA 4X62Q 1WYDA 5C3EG 1VQBA 1WOCA 1YZ6A 2RDHA 1HZAA 1F9PA 1TIID 1P16A 3VA5A 2AQ1B 2MQHA 3EIVA 1ZYRC 4IALA 1VQJA 3QOLA 1STGA 5KNDA 5LMNQ 1O7YA 4KKUA 4UP8A 2NN6H 3RLNA 4TQUS 1VQHA 1TQOA 1N33Q 1X6OA 4XXEA 1QZHA 3AMUA 1LM0A 4L5TA 1MKHA 3PV0A 1JR0D 2K6AA 5FLXc 3HOVB 2B3GA 1RKNA 5FLMG 2XWJB 3F8TA 5C0XH 1SNDA 4JYAL 2LXKA 4WJ4A 1EU3A 4DR2L 4HAEA 4OEMB 5I4DA 4RGMA 3W5OA 3D6WA 3FHWA 4FP5D 3BZDB 3HOYH 2EY5A 1Y69U 2C5CA 3PUZA 3NWTA 2NBFA 2B63H 4GKKQ 2BH8A 3M4YA 1C0AA 2NVTH 2NVXH 2AKWB 2NTTA 2MP1A 3CRLC 5E7NA 2I46A 5FJ8G 4BBSH 1HQRD 3DM3A 1EWIA 2SOBA 2PZUA 1CQFA 1VQKA 1C9OA 3KFUA 4HIMA 4OX9Q 1TWGH 3E3XA 1VQDA 5LL6X 4ZKCB 4KN7C 3NHHA 1ESRA 3NK9A 2K33A 1PH3A 1Z47A 4K5VA 1Q1EA 5HGTA 3BJUA 1NNXA 2NWGA 3SK4A 5J39A 3LX0A 4QUCA 5GROA 2NZOA 1IBML 4YWLA 3SVMA 3I8ZA 1H9MA 3KLSX 5JJIA 5BN5A 4LF9L 5IY0A 4OO1I 5IYBG 4GLXA 5DM63 4CJ2C 3RLOA 3A54A 2JA5G 1PFBA 2NZHA 1N36Q 2Q2UA 3TBIB 1TS5A 2B2VA 4TSSA 3BVMA 1S5CD 2R7ZG 1GXDC 1RODA 5EKIA 4JI8L 3C46A 3VYTA 4A3JG 3RD4A 1TWFH 1G51A 2F0EA 3L0OA 1N33L 2A6HD 4GS3A 4ME5A 4LF6Q 1PYSB 3NE5B 1UE7A 1FL0A 4NXNQ 2JA6G 3A55A 4QGUA 4R4CA 2WAQG 3J80c 1Y8PB 4L5SA 2A6ED 3ERSX 4YY3Q 1BVSA 5JEAH 4KKTA 3OW2A 1L0XB 4DR4Q 2QDBA 3PMFA 3JAML 3M4OB 1EQVA 2O2LD 2UUAL 2A5HA 1HNXL 2EOTA 5M3FH 1PH4A 2E2JH 2E74C 1A3VA 2ATWA 1D7QA 1GUWA 5JPNC 2HDLA 3KDFA 5CV8A 5C5MA 3TREA 4GN3B 4EGVA 1QUQB 4K5XA 1YNND 4C3IH 1F2MA 3S1RH 2F0JA 1SE2A 2Z4IA 3QB3A 5NUCA 3LWEA 1H9SB 1IKLA 1TS2A 2KCNA 2B2WC 4H0LC 2AWNA 4GOPC 1VQ6A 1GO3E 1VQ7A 2VB3X 2PZWA 3HKSA 3KBXA 3KOJA 1JJGA 4P2CB 4IO9A 4GKJL 1HHVA 2K01A 4JBWA 3T13A 3PO2H 1C8CA 2HQLA 4QJFA 4JI2L 5TSSA 4A3JB 4Y7NB 2V1CC 5LMUQ 2QA4A 2KQ3A 1SFOH 2UXCQ 2I07B 1X3PA 1QE6A 1C7YA 3G6JB 3V2TA 4K0KL 1WI5A 1JMCA 3C2PA 1CK1A 3C3LA 2F3VA 2JA6B 4YCWA 2WAQB 1YJ9A 1N36L 1E2VA 3PO3G 3J7AF 2RDGA 4R4IA 2E8GA 3T1HL 4LFAQ 4LF5L 4C1NK 1N32L 3GV6A 4YCUA 3KJPA 1CKMA 2QKIC 5IWAL 1K0RA 1HA5A 2R7FA 4NMZA 4A3IH 1EY9A 1ZKOA 2J7ZA 1JICA 1B70B 2K50A 1FGBD 2R92B 3S1NH 1KXLA 1MI2A 1TWHB 3GTGH 3X3MA 1HH2P 2ENBA 1CZWA 3HRZC 1BBWA 3ICEA 5GAGC 1LV9A 2MO1A 3J7ZC 4GLVB 3BVGA 3I90A 2EJFC 1VQIA 2WAQE 2B2YC 2D2CC 5E4XA 3UE0A 5CV4A 3NSWA 4DV5L 3GTMB 3CD6A 1PLFA 4C3HG 3VA7A 1KHIA 3RZDB 4QQBX 3A8JE 1EOVA 1UAPA 1DXMA 5KNCA 4LF7Q 1RCVD 4JBKA 3EBEA 1GKHA 3L7ZC 2AQ3B 4KLKA 2K4KA 2B2UC 1IBKL 2K03A 2Z0SA 5IP9G 4AH6A 5AJ3L 3OTOL 2IY5B 1AFPA 3E5SA 3TRZA 4YHHL 4A93G 1JOQA 4TVAB 1KIXA 1XPOA 1VQ8A 3TP6A 1A3UA 1HXYD 3WOEA 4KHPQ 2UUCQ 3C1FA 4HIDA 4FXGC 1WTVA 4AQYQ 1U4PA 1PH6A 3I4NG 3I56A 4DR5Q 4J8QA 1V1OA 1GUNA 4B3RQ 3PO3B 4LFCQ 1DOKA 4IFDJ 2PI2A 3JAMi 3HOUG 3S2DB 4FYDA 5KGUA 4OONA 5LMUL 4X3UA 1SMXA 1LLRD 3QWNA 4N8FA 3CC7A 1HJPA 2PW7A 4JCVE 4IPCA 1WTOA 1O7ZA 3I7FA 3IRBA 1IZ6A 3URYA 2IX0A 3QR8A 2ALYB 4K2KA 2IHEA 1U4MA 1LYLA 5IT9c 4M8AA 4UP9A 5GAEC 3J81i 4C3HB 1XMOQ 1XTCD 1B2TA 4JBJA 4A3DH 2FMCA 4AYBG 5CGKA 4B3MQ 1BCPD 4IUPA 5JOBA 1OXVA 3DWPA 5FLXL 4A3GH 3DMUA 1MIUA 1BXTA 2K32A 2YU9H 1OXUA 1I94Q 4NXML 2NTSA 4DNRB 2OQKA 2JE6I 1FNUA 2JEBI 1F9QA 4KN4C 1JT8A 5KYLA 4CKCA 3K5MA 3WDNA 2X6GA 4B9XA 2PQEA 4ZUJA 3T56B 2IHFA 1YHBA 4A3EG 4TKOB 2JJQA 1KRTA 4OWXB 5KEEA 5A2QE 4A3MG 3I4NB 4XDXA 2Q8TA 1I4RA 2JP1A 2QF7A 4LF8L 1ENCA 5IP7G 2E2IB 1G2TA 1MD2D 4L63B 1W3SA 5DLQE 5LHY1 3HOXH 1A0IA 4CJ0B 1YNJD 3HOUB 1RL2A 3MC0B 2F0NA 1T5EA 1SMYD 3BYTB 5KRUA 1RF2D 3ND8A 2OEOA 4CDCC 3WOFA 5CV6A 3R8BA 1EFID 3RLFA 1MBYA 4ZRZA 4RCOA 1SR3A 5CR3A 3ERQA 3IL8A 5ELDA 1S5FD 5D3IB 2HQEA 4K2LA 4I7ZC 1PRTF 4DR5L 3VR2A 5GQOA 5IODA 2F0UA 4GN4B 4NW2A 1F2ZA 4OELB 4YIJA 2BE5C 4DR3L 5FO7B 1GM5A 2CH4A 4AYBB 4JI7Q 1KDBA 1SAPA 1PTOF 3KDFB 2UU9L 1JC7A 3K81C 2ZM6Q 2UXBQ 2O5JC 2ID0A 4DV6Q 1LT3D 2NN6G 3A8KE 1IYJB 2AHOB 4KY6A 2Z9HA 1NR2A 1ONLA 2E5LQ 4AYBE 5C0XG 2WB1B 1SE4A 2HHHL 2ICIA 1VS0A 1QZGA 1SN8A 2EE1A 4A3EB 5EBDA 4DV7Q 3HOYG 2F0KA 2F1MA 4P74A 3NBIA 1M1KC 4RMFA 2B63G 3J80L 1NBWA 5J3BA 2KCTA 5M9OA 3S1MH 1EOTA 4PV1C 3O13A 4OIKA 3ITPA 4IPHA 1NE3A 3TP5A 2JA7H 4JV5L 3NQIA 4BBSG 2WB1E 2PQAA 5AFWA 2N78A 3SGIA 1OXTA 2EYJA 4XIGS 4G4KA 3W1GA 1VMCA 3RZOB 5ELNA 2N49A 4FXDA 1IBLQ 3HOZH 3MHBA 3OSOA 4HTHA 2PMZB 4HIOA 1GOZA 1LT4D 3G71A 1XNRL 4ME3A 1I6HH 4GZYC 5GAHC 1VF7A 2IX3A 2H1EA 1QVCA 4JI1Q 4X65Q 3HKZB 3I91A 1CA5A 3D8GA 2M00A 1Q1BA 1SE3A 1U5KA 1U9RA 4C2MH 3S9WA 3TS0A 2K5DA 3MEHA 1A15A 4DK6C 1LTGD 1O7IA 3H3VC 1KC8C 4KTAA 2OTJA 3PCOB 4P73A 1XPRA 2PMZE 3JC66 3AYHB
chains in the Genus database with same CATH topology
2PZTA 2FINB 1QB5D 1STAA 2IL8A 2KEEA 1X32A 3H09A 3HOYB 3D4WA 2Y0SB 1Y1WB 3GTLB 1PTOC 2WP8J 2NVTB 1AP0A 2NVXB 2XN9C 5ELBA 2N55A 1CHQD 5CYUA 2EY6A 5KIXA 3DEPA 4EQOA 4BBSB 4FNFA 3IAYA 4HR7B 1BQQT 5C5LA 3JAME 5JEAG 4KY5A 1TWGB 3K7AB 2PCFB 1S4ZA 2KHSA 3A8IE 2J0TD 5I6WA 1BBXC 1JCKB 2JSOA 5CBAE 3D4RA 3EFXD 4C3IG 1PRTB 4FF1A 2XSCA 5C0XI 2ZT9C 2L9HA 1X3QA 2F0WA 3PUXA 2PYKA 1VDZA 4K8JA 2GA4B 3NUCA 4O1NA 1IW7C 1I4PA 4K5WA 3MXUA 1XWEA 2KECA 3TP7A 1D5MC 3S16B 2IX1A 3K0YA 4LAAA 4XT3B 1AEXA 3R2TA 4XQNA 1V43A 1W6KA 3GTJB 2X69A 4L6TB 5IT9L 2XNAC 1IKMA 1TR5A 2NYZD 3KLSA 5E3FA 2E2HB 2L55A 3K6OA 4C3IB 1QG7A 4PMBA 4R9WA 3RMHA 2WACA 1F9SA 4G7OC 3U9SA 1TT2A 3LWUA 1PFNA 3Q0AA 1QOHA 5E1FA 4WORA 5DAUA 4JK1C 1ZYRD 1SFOB 3IFTA 3TMEA 1JWUD 5COYA 1DOMA 1B53A 1RDPD 3NBHA 2BCOA 4IUNA 2A69D 4A3IB 1KTKA 3S1NB 4MIUA 2B2TC 3GTGB 3A7AB 2FFKB 2CVRA 1KDAA 1HTLD 1HTPA 1D6EC 5C3EB 1SNPA 4FF2A 2B8GA 3A56A 4KV6A 3OWFA 1RTNA 4KKSA 5FLXE 2EY2A 4EQPA 3MA2B 2RSOA 4R8IA 2LY7A 3HG9A 4J1MA 4N9PA 2B8FA 1W6JA 4DXGA 2CW0C 4KD4A 3M7GA 2RSNA 1WD1A 2E75C 2JXMB 1O80A 3R93A 2O4XA 3KUPA 3NTHA 3NTKA 1KAAA 1PZID 2SEBD 3EQLC 2D9UA 4E6IA 3V96A 5C3WA 2SDFA 2XRQD 4RCNA 5IGCA 5KNBA 3PUWA 3KK7A 5C4HA 5K36H 1HUMA 3VYUA 3SK6A 4QIWB 2WIIB 1EYCA 3HP3A 2ZXRA 4LK1C 4DAYA 1NUCA 1QWYA 2F4IA 5IGGA 1G6ZA 2PO4A 2D5DA 2A6EC 5CBEE 2F0DA 1DM0B 3OWEB 5ELFA 3QOJA 4KMUC 1DD2A 4A3GB 2L11A 4IUTA 5FO8B 1HA6A 2YYZA 3HZXA 5EGTA 5DEHA 3OMGA 4V190 1F77A 3VYRA 2JA5B 2KJXA 1SEBD 1EWHA 4HSVA 3DXJC 3FRPB 3J80E 1BO0A 2R7ZB 5G3LD 3OOCA 1H9RA 4ZQ3A 3HOXB 1JE4A 5IGDA 5IGFA 4Q5VA 4RA8A 1B3AA 1GHJA 5FKAC 3TSSA 3KBGA 3W2DA 1EZ6A 1I3QB 1LTTD 3UI2A 3H94A 3P75A 1EY8A 1A2UA 2XWBB 4G7ZC 1II3A 3M7NA 1PMRA 1PDQA 1NCVA 3TP8A 2WKDA 3D3RA 3EA6A 3SDZA 2L4NA 2K1BA 2K04A 1SNMA 3TZDA 1KLGD 4LJZC 3SXHA 1EY6A 1OXXK 2KCCA 2EYOA 3K57A 3G7LA 1EY0A 4QUFA 3HGBA 1Y8OB 5BN4A 5J1ZA 5IGBA 2A68C 4NDXA 1LTID 1T5XD 1FNVA 1WVLA 3S1MB 3GD7A 1D1IA 1Q8IA 4PMCA 5J22A 5CV7A 2JA7B 1B9NA 1SNOA 1TY0A 4V0BA 1JOKA 4KHZA 4NP5A 1C48A 1SYFA 1IL8A 2B2VC 3HOZB 1DCZA 1NR4A 1CM9A 1I6HB 5D65A 2L5TA 2LKVA 4DA2A 2C9OA 2HCIA 4C2MB 1S5ED 2WKCA 1WTWA 1IYUA 2F0GA 2IW3A 4PNYA 2TSSA 1F9RA 5C0XJ 1O78A 3ZYYX 2VNUD 1SNCA 3QG1A 1KNAA 4RH6A 1XYIA 2F0MA 2M2LA 2RQXA 4A93B 5M5WB 4XTCS 3U9OA 1PZJD 1G91A 2F0TA 3MZ5A 5CC4A 1HUNA 1CT1D 1U4LA 4N9TA 2PPBC 3MWYW 4QCLA 3H6MA 1B4OA 2ZXPA 1TY2A 5IT9E 1UUPA 5C6AA 1RD9D 2KOLA 4RKBA 2EYFA 3C1EA 5ISRA 5A35A 4RGTA 1D5ZC 1SMYC 5M5XB 4RHRA 3FMCA 1ENAA 3NTIA 3P20A 1BCPB 3P1HA 5EPLA 3QO2A 1LABA 3OIPA 2IJ0A 1IYVA 3Q6SA 4IQZA 1GUTA 2BE5D 2HDMA 3BG3A 1AW7A 1WD0A 4BY7B 1GUOA 4KY7A 1EZ8A 5JEAJ 2NZ1D 4A3MB 1D2BA 3SK8A 2XVSA 5JVG3 1FNWA 5JPMC 2DNCA 3GQBA 5C44B 4DK1A 2TMPA 1TWCB 1EWCA 4DFAA 1H9JA 3I73A 4IUQA 5C4JB 1B44D 1DJRD 4KI0A 3HOWB 1DYQA 1Y8NB 2DY7A 1EYAA 4X3TA 5LL6S 5E4WC 3N6RA 3D31A 4FXKC 2AUJD 1CZGA 1S5BD 1D1KA 4LMQD 3E0JA 2EJMA 1JWSD 1LTSD 1B1ZA 1E2WA 3W3AA 2Z4HA 1SJHD 3BVZA 5DNFA 1OXSC 1J8IA 5IIFA 2JYOA 2BOSA 4HCEA 2RKSA 1ILQA 1Q3LA 3DUZA 5K5PA 1J9OA 2F0QA 5FOBB 1PRTC 3LNNA 2EPBA 3ONAB 1CFMA 2B63B 3E6ZX 3S1QB 5K36G 4TRDA 3T16A 2ZXOA 1QJOA 1ET6A 5I6YA 2SNSA 1A3TA 3R2IA 1JOOA 2D62A 1KABA 4C3JG 2MJ8A 4FF4A 5HURA 1FR3A 3P7JA 2K05A 5I9OA 4MHEA 2NN6I 1TS3A 2F3WA 2HUGA 5IGEA 1UNSA 4HEDA 4C56C 3DM1A 3X3NA 3DWQA 1E2ZA 5JVH3 1VMPA 1M4VA 4CGYB 4RGNA 3FKIB 2MUYA 3MFGA 4F8MA 3BDCA 4BY1B 4OIJA 3AU7A 2XIWA 3MVVA 2IWHA 1LTBD 3GP7A 3EVQA 4XQQA 1DZ1A 1TWFB 3GO5A 4DGZA 4IUUA 1IW7D 4PQXA 1SSOA 3DWAA 3FPPA 1ILPA 5CORA 1SNQA 1QNKA 1RHPA 3PIO3 2Z8LA 5JJZA 2RDFA 1KLUD 4L8JA 1TU2B 2G9HD 3MXPA 3MAQA 4C3JB 5T1IA 3I3CA 3A7LA 4WRDA 1JB3A 5EKLA 5M3FB 3CQZB 2E2JB 1GUGA 3FDTA 2AWOA 3S1RB 1STNA 3GTPB 2AQ2B 1LT5D 3VR6A 1PFMA 2F0OA 2NB0A 2B2WA 2F0HA 1ICWA 2Q8RE 2OF1A 3PO2B 3NPPA 4KJNA 1AN8A 1DONA 2Q8IB 1AZQA 2MHVA 4IFDH 5JAVA 1MGSA 4F88A 1H9KA 1R4QB 3I72A 5EBCA 3S2HB 2PW5A 1Q90A 3N52A 4R8NA 3S15B 3K5NA 2N88A 4H13C 4CKBA 5I2XA 5ELCA 5I9PA 1ESFA 3K59A 2A69C 5ELEA 1JORA 3H0GB 2J4XA 4ODGA 4EVOA 3NXWA 4J6HA 5M3MB 1I4HA 1TS4A 3AB9A 4XYOA 3K5LA 1EL0A 2B2YA 4RKLA 1XXGA 3TN2A 5G3LF 1ET9A 4MN3A 1XX8A 3L9AX 1WTQA 3M3YB 1RJTA 2KA7A 2F0IA 2B2UA 4ULLA 4KHVA 5C4ZA 3D6CA 1SYBA 3GTOB 4H44C 2F0FA 2CW0D 1EY7A 1GUSA 2CHBD 2HCCA 3CU7A 4PMWA 1LT6D 1BR9A 3FPUB 4X3SA 4ZUIA 1PTOH 3KF8A 2EZVA 3NQTA 1CA6A 3KLRA 2A6HC 4ABNA 4RWSC 3SHLA 3CHBD 1MSHA 4HMJA 1GHKA 1LTAD 2SNMA 4A3DB 1C4QA 3V05A 4FVMA 4IURA 5IOCA 1EEFD 1VCIA 3FEWX 1SXTA 1PYWD 2L1BA 1R4PB 4X3KA 2YU9B 2L12A 1STHA 1QNUA 3M85A 2LMCB 1YNNC 1CI3M 3SEBA 4B08A 3I4LA 2EYMA 1Q12A 2R3ZA 4K6LA 2EVBA 1TVXA 3J81L 1GJXA 2MGSA 2H4OA 4XT1B 3MXGA 2IPKD 2F0LA 3K5OA 2FHTA 1SYDA 1BUVT 4Z9CB 3OW7A 3IFDA 4ZAIA 3ND9A 4C1NI 4CBVA 5EQ0A 3Q24A 1BCPF 5C3XA 4DN4M 2KUMA 4OO1H 5EKKA 2EYPA 4DNTB 4ZLTF 1FYCA 5D3DA 1CTMA 4K14A 2DNEA 1TKWB 3R3OA 1ENFA 3SE0A 1S5DD 1K83B 4DU9A 1UEAB 3OMCA 2VUMB 4HN7A 2DN8A 3HS0C 1NAPA 3T53B 1KNEA 1Y1VB 4BA2I 2A68D 3DEOA 3VR4A 1PZKD 1WTRA 2FJ2A 1SJED 1STYA 2QILA 3CRKC 4K6DA 1HRJA 3F2UA 1G2SA 2EYLA 1Z7TA 2R6GA 4HMIA 5M5YB 2NUCA 1RTOA 4ZYSA 1G291 3MXNA 3IKJA 4H7BA 1A6XA 5DM73 1QILA 1DOLA 4IUVA 3PUYA 3OPOA 2V4DA 1F2YA 1CHPD 1LTRD 4ILWA 3DHQA 1LO5D 4Q0FA 3BYYB 1BCPC 1SYGA 1F2LA 1ZEQX 4S3SA 4ID6A 4RFBA 4KJOA 2CQAA 4HSPA 2R93B 1SYEA 5D14A 1HQMC 1I4GA 4UDUC 1B9MA 3GTKB 4UAIA 1SBBB 2X6LA 4BS9A 1K8MA 4EQNA 2K7VA 2VB2X 4HCSA 3L3OC 3VR3A 4WJWA 2M9VA 5EPJA 5F2DA 1YNJC 3BDOA 1EEID 4CJ1B 1QCBD 3TZUA 3I70A 4FF3A 5C4XB 1G8ZD 1KDCA 4M1UB 3SK5A 1U4RA 1V1PA 2XRSD 4XYQA 3VR5A 4G57A 2QEJC 2WINB 3RUZA 1V8QA 2A73B 1EY4A 3QIAA 5FK9C 2L0CA 2E76C 4DAPA 2EYHA 3SR1A 4IFDG 3T51B 4A3FB 1O7LA 1ML0D 2MPMA 4RHSA 4FO2A 3Q23A 4K8IA 2F0PA 1STEA 4BWGB 1WTPA 2RBMA 2BDOA 1VF5C 5EJWA 2ICEC 4BA1I 2Z1CA 3J7YW 1ZXTA 1HFNA 1E0BA 1BF4A 4CHTB 2OXPA 3K58A 4F7XA 2EDGA 1NSNS 5CV5A 2F03A 1Z6HA 1I4QA 4A3KB 2K28A 1BDOA 4OGQC 2A74C 2OT2A 2O5IC 3EROA 4U673 3NWSA 4ZKBB 3MTSA 2PNRC 4QF4A 1K8OA 2RA4A 4WFN3 2IT1A 3PUVA 4QB4A 2LFNA 2EJGC 3S14B 1M8AA 4IN3A 4IZ8A 1EIHA 2EY1A 4U68A 1IHZA 1B50A 1CQVA 4QMGA 2LS01 3GTQB 4G7HC 1PRTD 4F87A 1HPCA 3EJIA 5BN3A 1A2TA 4B9WA 2DY8A 2G9DA 5CV9A 2B39A 2JA8B 2KEDA 1PTOD 2B2TA 3OHXC 1SYCA 4XQJA 1TWAB 2R61A 5I2YA 3BS1A 2NVYB 3Q22A 4DXFA 1OO9B 3D4DA 2FMMA 4IFDI 1BOSA 2F0VA 1I6VC 3OIQA 1BNZA 4O42A 3VYSA 5EPKA 4OL7A 1D5XC 2BDNA 1PXUA 3I4MB 1STBA 3H91A 1EIGA 3TDQA 1WTXA 4I65A 1L0YB 3FVQA 4A3BB 4KD3A 5KYIA 3J81E 1EU4A 4CKEA 3NP8A 1I50B 4DF7A 2K5WA 2NVQB 4DAVA 3CKIB 1H9SA 2VXWA 3PIP3 2KVMA 3J7AV 1AZPA 1PTOB 3QJYA 1JWMD 4KK7A 2BA0A 5FO9B 1SDFA 5T1GA 2EXZA 4BBRB 1WCMB 2JEAI 2QCPX 1MSGA 5CMDA 1FD7D 1JQYD 1HFGA 1LACA 4NKLA 1I4XA 3HEJA 2WV6D 4OO1G 3BDLA 1EY5A 1EYDA 2E2DC 2AUKA 4OHJA 1HCZA 5A2QL 3T4AC 2K5QA 2F0SA 4RGOS 2RVLA 1V1PB 4ZK9B 4RAUC 3GV3A 3MFYA 2BA1A 1R9TB 3S17B 1EQTA 2RDHA 1F9PA 1TIID 3VA5A 2AQ1B 1ZYRC 4IALA 3QOLA 1STGA 5KNDA 1O7YA 4KKUA 2NN6H 4TQUS 1TQOA 4XXEA 3AMUA 3PV0A 1JR0D 2K6AA 3HOVB 1RKNA 2XWJB 5C0XH 1SNDA 1EU3A 4HAEA 5I4DA 4RGMA 3D6WA 4FP5D 3BZDB 2EY5A 1Y69U 2C5CA 3PUZA 3NWTA 2NBFA 3M4YA 2NTTA 2MP1A 3CRLC 2I46A 1HQRD 2SOBA 2PZUA 1CQFA 5LL6X 4ZKCB 4KN7C 3NHHA 1ESRA 3NK9A 2K33A 1Z47A 4K5VA 1Q1EA 5HGTA 2NWGA 3SK4A 5J39A 3LX0A 4QUCA 3SVMA 3I8ZA 1H9MA 3KLSX 5BN5A 4OO1I 5DM63 4CJ2C 3A54A 1PFBA 3TBIB 1TS5A 2B2VA 4TSSA 3BVMA 1S5CD 1GXDC 1RODA 5EKIA 3C46A 3VYTA 3RD4A 2F0EA 2A6HD 4ME5A 3NE5B 3A55A 1Y8PB 2A6ED 5JEAH 4KKTA 1L0XB 2QDBA 3PMFA 3JAML 3M4OB 1EQVA 2O2LD 2A5HA 2EOTA 2E74C 1A3VA 1GUWA 5JPNC 2HDLA 5CV8A 5C5MA 4EGVA 4K5XA 1YNND 1F2MA 2F0JA 1SE2A 2Z4IA 3QB3A 5NUCA 3LWEA 1H9SB 1IKLA 1TS2A 2KCNA 2B2WC 4H0LC 2AWNA 2VB3X 2PZWA 3KBXA 4P2CB 1HHVA 2K01A 4JBWA 3T13A 1C8CA 5TSSA 4A3JB 4Y7NB 2KQ3A 2I07B 1X3PA 1QE6A 3G6JB 3V2TA 3C2PA 1CK1A 3C3LA 2F3VA 2JA6B 2WAQB 1E2VA 3J7AF 2RDGA 4C1NK 3GV6A 2QKIC 1HA5A 4NMZA 1EY9A 1ZKOA 2J7ZA 1JICA 2R92B 1FGBD 1MI2A 1TWHB 3X3MA 2ENBA 1CZWA 3HRZC 1LV9A 3BVGA 3I90A 2EJFC 2B2YC 2D2CC 5E4XA 5CV4A 3NSWA 3GTMB 1PLFA 4C3HG 3VA7A 3RZDB 3A8JE 1UAPA 1DXMA 5KNCA 1RCVD 3L7ZC 2AQ3B 2B2UC 2K03A 1AFPA 3E5SA 1JOQA 3TP6A 1A3UA 1HXYD 3WOEA 3C1FA 4FXGC 1WTVA 1U4PA 4J8QA 1V1OA 1GUNA 3PO3B 1DOKA 4IFDJ 3S2DB 4FYDA 5KGUA 4X3UA 1LLRD 3QWNA 2PW7A 1WTOA 1O7ZA 3URYA 2IX0A 4K2KA 1U4MA 4M8AA 4C3HB 1XTCD 1B2TA 2FMCA 5CGKA 1BCPD 4IUPA 5JOBA 1OXVA 3DWPA 5FLXL 3DMUA 2K32A 1BXTA 1OXUA 2NTSA 4DNRB 2JE6I 1FNUA 2JEBI 1F9QA 4KN4C 5KYLA 4CKCA 3K5MA 3WDNA 2X6GA 4B9XA 2PQEA 4ZUJA 3T56B 4TKOB 5KEEA 5A2QE 3I4NB 4XDXA 2Q8TA 1I4RA 2JP1A 2QF7A 1ENCA 2E2IB 1G2TA 1MD2D 4L63B 5LHY1 4CJ0B 1YNJD 3HOUB 3MC0B 2F0NA 1T5EA 1SMYD 3BYTB 5KRUA 1RF2D 3ND8A 2OEOA 3WOFA 5CV6A 3R8BA 1EFID 3RLFA 1MBYA 4ZRZA 4RCOA 5CR3A 3ERQA 3IL8A 5ELDA 1S5FD 5D3IB 2HQEA 4K2LA 4I7ZC 1PRTF 3VR2A 5IODA 2F0UA 4NW2A 1F2ZA 4YIJA 2BE5C 5FO7B 4AYBB 1SAPA 1KDBA 1PTOF 1JC7A 2O5JC 2ID0A 1LT3D 2NN6G 3A8KE 4KY6A 1NR2A 1ONLA 5C0XG 2WB1B 1SE4A 2ICIA 2EE1A 4A3EB 5EBDA 2F0KA 2F1MA 3NBIA 3J80L 5M9OA 1EOTA 4PV1C 3O13A 4OIKA 3ITPA 3TP5A 3NQIA 5AFWA 1OXTA 2EYJA 4XIGS 4G4KA 1VMCA 3RZOB 4FXDA 3MHBA 3OSOA 4HTHA 2PMZB 1GOZA 1LT4D 4GZYC 1VF7A 2IX3A 2H1EA 3HKZB 3I91A 1CA5A 2M00A 1Q1BA 1SE3A 1U9RA 3D8GA 3S9WA 2K5DA 3MEHA 1A15A 1LTGD 3H3VC 4KTAA 4DK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RTO A;  1WTP A;  1EL0 A;  2DY7 A;  2B2U C;  2FIN B;  1WD1 A;  1IKM A;  2R3Z A;  4X3T A;  1O7Y A;  1O80 A;  2K03 A;  5E4W C;  2FMM A;  3R93 A;  4IUU A;  2IL8 A;  2KEE A;  1G91 A;  1X32 A;  1TVX A;  3IL8 A;  1DOL A;  3KUP A;  4IUV A;  2NYZ D;  1SSO A;  5EJW A;  2MGS A;  1BNZ A;  2B2Y A;  4O42 A;  4XT1 B;  1ILP A;  1HUN A;  5EPK A;  2D9U A;  1U4L A;  4LMQ D;  5COR A;  3TN2 A;  1PDQ A;  2FHT A;  2BDN A;  3MWY W;  1NCV A;  1ZXT A;  1HFN A;  1QNK A;  1RHP A;  2SDF A;  1QG7 A;  4MN3 A;  4NW2 A;  1B4O A;  1XX8 A;  3H91 A;  5JJZ A;  1EIG A;  1E0B A;  4R9W A;  1WTQ A;  1WTX A;  1BF4 A;  1RJT A;  2EOT A;  3IFD A;  4HAE A;  1AP0 A;  4ZAI A;  2N55 A;  5DNF A;  1SAP A;  1HUM A;  1U4P A;  2L4N A;  1F9S A;  3D6W A;  2B2U A;  1F2L A;  2K1B A;  2KOL A;  2HDL A;  2JYO A;  3DEP A;  5EQ0 A;  2K04 A;  1J8I A;  5T1I A;  3I3C A;  1ILQ A;  2K28 A;  4DN4 M;  3HP3 A;  1Q3L A;  1DOK A;  1J9O A;  3LWE A;  3TZD A;  2KUM A;  1IKL A;  1PFN A;  2VXW A;  2B2W C;  3G7L A;  1G6Z A;  1NR2 A;  2KVM A;  4QUF A;  2MP1 A;  5D14 A;  1AZP A;  1S4Z A;  4X3U A;  2EPB A;  3ONA B;  5CBE E;  3FDT A;  4ZKB B;  4ZLT F;  5EPL A;  1WVL A;  3KBX A;  2HCC A;  3QO2 A;  1BBX C;  1SDF A;  5T1G A;  1WTO A;  1HHV A;  2EE1 A;  4UAI A;  1O7Z A;  3MTS A;  2K01 A;  2X6L A;  5COY A;  1C8C A;  1PFM A;  1DOM A;  1MSG A;  5CBA E;  3FPU B;  5CMD A;  4X3S A;  1U4M A;  1B53 A;  1HFG A;  4ZKC B;  4HCS A;  1WTV A;  2L11 A;  4IUT A;  5EPJ A;  1CA6 A;  1B2T A;  1X3P A;  1ESR A;  2B2W A;  2RA4 A;  1QE6 A;  3Q6S A;  1HA6 A;  1EOT A;  4RWS C;  1ICW A;  4OIK A;  2L9H A;  2Q8R E;  2HDM A;  1X3Q A;  1IL8 A;  2B2V C;  4IUP A;  1M8A A;  1MSH A;  2NWG A;  1EIH A;  2MJ8 A;  4CJ1 B;  1DON A;  1AZQ A;  5AFW A;  4QUC A;  4U68 A;  2B2T C;  3P7J A;  1NR4 A;  1CM9 A;  1MGS A;  2K05 A;  1WD0 A;  5D65 A;  2FFK B;  1B50 A;  4MHE A;  4HSV A;  3SVM A;  3I8Z A;  2CVR A;  2KEC A;  1BO0 A;  1VMC A;  3GV6 A;  2NZ1 D;  2RVL A;  2HUG A;  4IUR A;  4ZK9 B;  2HCI A;  1NAP A;  1F9Q A;  1U4R A;  2J7Z A;  4HED A;  4CJ2 C;  1WTW A;  1JIC A;  4RAU C;  1PFB A;  1GUW A;  3DM1 A;  2X6G A;  3N52 A;  2L1B A;  1MI2 A;  1KNE A;  3GV3 A;  4X3K A;  2L12 A;  2B2V A;  3DEO A;  1JE4 A;  1F9R A;  2DY8 A;  2H1E A;  1RTN A;  1LV9 A;  1VMP A;  1WTR A;  2FJ2 A;  2KED A;  2RSO A;  3I90 A;  4XDX A;  2Q8T A;  4R8I A;  2JP1 A;  2N88 A;  3I91 A;  1ROD A;  2B2T A;  2B2Y C;  5E4X A;  1CA5 A;  5EKI A;  4RA8 A;  1B3A A;  1EQT A;  4XT3 B;  1HRJ A;  1PLF A;  3F2U A;  1G2S A;  1G2T A;  1KNA A;  1A15 A;  1ML0 D;  4OIJ A;  2MPM A;  2XIW A;  1XYI A;  2M2L A;  4IUQ A;  4CJ0 B;  1F9P A;  2X69 A;  3UI2 A;  2RSN A;  1DZ1 A; 
#chains in the Genus database with same CATH topology
 2ZJQ A;  5JJL A;  2PZT A;  2FIN B;  1QB5 D;  1E1T A;  1STA A;  2IL8 A;  2KEE A;  1X32 A;  3HKZ E;  2EQS A;  4JI7 L;  1VQO A;  1Q86 C;  4LWC A;  3H09 A;  3HOY B;  3D4W A;  2Y0S B;  1A8V A;  1Y1W B;  5M5W H;  3GTL B;  3TEH B;  2CCZ A;  4JI4 L;  1PTO C;  2WP8 J;  2NVT B;  1AP0 A;  2NVX B;  2XN9 C;  5ELB A;  2N55 A;  1CHQ D;  5CYU A;  2EY6 A;  5KIX A;  3DEP A;  1A62 A;  4EQO A;  4BBS B;  4FNF A;  3IAY A;  4HR7 B;  1BQQ T;  2RCN A;  5C5L A;  3JAM E;  5JEA G;  3T1Y Q;  2Y0S E;  4KY5 A;  4A3L H;  1TWG B;  3PGZ A;  3K7A B;  2PCF B;  1S4Z A;  2MO0 A;  2KHS A;  3A8I E;  2J0T D;  3CCJ A;  5I6W A;  1BBX C;  5M3F G;  1JCK B;  1VQG A;  5M5X H;  2JSO A;  1PFS A;  2JK8 A;  3CPW A;  4DR1 L;  5CBA E;  3D4R A;  4Y52 H;  2PI2 E;  3EFX D;  4C3I G;  1PRT B;  1YVC A;  4MNO A;  3I2Z A;  2DUD A;  4FF1 A;  2XSC A;  2BH2 A;  5C0X I;  3CCQ A;  2ZT9 C;  2L9H A;  1XNQ L;  1X3Q A;  1VQ5 A;  2F0W A;  3PUX A;  3PIP A;  2PYK A;  1VDZ A;  4K8J A;  2GA4 B;  3NUC A;  4O1N A;  1IW7 C;  1I4P A;  4K5W A;  3MXU A;  3OYY A;  1XWE A;  2KEC A;  2RF4 A;  3PO2 G;  1N34 Q;  3TP7 A;  4DUZ Q;  4A3F H;  4BY7 H;  1L1O B;  1XTD A;  1UWV A;  1D5M C;  1HR0 Q;  1KL9 A;  3S16 B;  2IX1 A;  3K0Y A;  3CF5 A;  4HIK A;  1S72 A;  4LAA A;  4XT3 B;  1AEX A;  3R2T A;  4XQN A;  2Q2T A;  1V43 A;  3A74 A;  3M4Q A;  1YI2 A;  1W6K A;  3GTJ B;  2X69 A;  5C44 H;  1YIT A;  3K0X A;  4L6T B;  4A3I G;  1VQN A;  1XMQ L;  2DGY A;  1RIP A;  5IT9 L;  2XNA C;  1BBU A;  1IKM A;  1TR5 A;  2NYZ D;  3KLS A;  5E3F A;  5C4J H;  2K5H A;  2E2H B;  3HOW H;  2L55 A;  3K6O A;  4C3I B;  2QDL A;  4A3K H;  1QG7 A;  4DR6 Q;  4PMB A;  4R9W A;  3T1Y L;  3RMH A;  2WAC A;  2ASB A;  1F9S A;  4G7O C;  3U9S A;  1TT2 A;  5GAD C;  3LWU A;  1PV4 A;  4DUY Q;  2R7D A;  1PFN A;  3Q0A A;  3BZC A;  1QOH A;  5E1F A;  4WOR A;  5DAU A;  2Z6K C;  4JK1 C;  1ZYR D;  1SFO B;  4JOI A;  3IFT A;  3TME A;  2CFM A;  1JWU D;  3S14 H;  5COY A;  1DOM A;  1Q82 C;  2K75 A;  1HNZ Q;  1B53 A;  1RDP D;  3NBH A;  5L37 A;  2BCO A;  4IUN A;  3GTQ H;  3S1Q H;  1K0S A;  4B3T L;  2A69 D;  2HIX A;  4GNX A;  5ELO A;  1B7Y B;  4A3I B;  2PQA B;  1KTK A;  3S1N B;  4MIU A;  4NB3 A;  2B2T C;  3GTG B;  3A7A B;  3PF5 A;  4DV0 L;  1WTH A;  2FFK B;  1HR0 L;  1PA6 A;  2CVR A;  1KDA A;  4DV4 Q;  2MFI A;  3GDE A;  1HTL D;  1HTP A;  1Q7Y C;  1D6E C;  5C3E B;  1SNP A;  4FF2 A;  4A3D G;  2B8G A;  3A56 A;  4KV6 A;  3OWF A;  1RTN A;  4KKS A;  2EY2 A;  5FLX E;  4EQP A;  3MA2 B;  2RSO A;  4R8I A;  2LY7 A;  2NVY H;  1FJG L;  3HG9 A;  4J1M A;  4N9P A;  4A3G G;  2B8F A;  1KAW A;  1W6J A;  4DXG A;  2CW0 C;  1NTG A;  4KD4 A;  1KRS A;  1MJC A;  4IPG A;  2YTV A;  1VQ4 A;  3M7G A;  3FKI H;  2RSN A;  3TQY A;  4CDF C;  3K80 C;  4X62 L;  3H3V H;  1WD1 A;  3I4M H;  3AFQ A;  2E75 C;  2JXM B;  1O80 A;  3R93 A;  2O4X A;  4BY1 H;  1Q81 C;  3KUP A;  3NTH A;  1K8G A;  3NTK A;  1KAA A;  1PZI D;  2SEB D;  3EQL C;  2D9U A;  1SRU A;  1OTC A;  4E6I A;  3V96 A;  5C3W A;  2SDF A;  5LMN L;  2OQ0 A;  2XRQ D;  4RCN A;  4LUV A;  5IGC A;  5KNB A;  3PUW A;  3KK7 A;  5C4H A;  3HOX G;  5K36 H;  1HUM A;  3VYU A;  3SK6 A;  4QIW B;  3STB C;  2WII B;  4R1J A;  1EYC A;  3HP3 A;  2ZXR A;  2CWA A;  4LK1 C;  4DAY A;  1NUC A;  1QWY A;  2F4I A;  5IGG A;  1K8A C;  1G6Z A;  1HNW Q;  5IYD H;  2PO4 A;  2D5D A;  1HNZ L;  3E9H A;  4C3J H;  2A6E C;  5CBE E;  3HFZ B;  2F0D A;  4GKK L;  1DM0 B;  3KYH C;  4QIW E;  2A8V A;  4DR7 Q;  3CQZ H;  1L0W A;  3OWE B;  5ELF A;  3QOJ A;  1G6P A;  4KMU C;  1DD2 A;  4A3G B;  2L11 A;  4IUT A;  2Q2H A;  5FO8 B;  1HA6 A;  4JPB W;  2B29 A;  3GTP H;  2YYZ A;  3HZX A;  2KHJ A;  5EGT A;  4OX9 L;  1VQA A;  5DEH A;  3Q8D A;  3OMG A;  4MTK A;  3CP0 A;  4V19 0;  5LMN W;  1VQ9 A;  1F77 A;  3VYR A;  2JA5 B;  4X66 Q;  2KJX A;  1E22 A;  1SEB D;  3UDX A;  1EWH A;  4HSV A;  3DXJ C;  3FRP B;  3J80 E;  1BO0 A;  4JI0 Q;  1S40 A;  1XPU A;  4LUO A;  2R7Z B;  5G3L D;  3OOC A;  2UXD Q;  1H9R A;  4ZQ3 A;  1AE3 A;  3HOX B;  1JE4 A;  5IGD A;  2JA7 G;  3S2H H;  3UDF A;  2Q2I A;  5IGF A;  4Q5V A;  4RA8 A;  1B3A A;  1GHJ A;  5FKA C;  3TSS A;  3KBG A;  3W2D A;  1EZ6 A;  1I3Q B;  3S15 H;  3CXC A;  3HOZ G;  1LTT D;  3UI2 A;  3H94 A;  3P75 A;  1HZC A;  1EY8 A;  1A2U A;  1YNX A;  2XWB B;  1VQC A;  4P75 A;  4G7Z C;  1II3 A;  3M7N A;  3H0G H;  4LF6 L;  1PMR A;  1PDQ A;  4NXN L;  5M3M H;  1NCV A;  1VQE A;  3TP8 A;  2WKD A;  3D3R A;  4YY3 L;  4DNI A;  3EA6 A;  1PH1 A;  3SDZ A;  2ZTE A;  3CCR A;  2L4N A;  2K1B A;  4DR4 L;  2K04 A;  4JI5 Q;  4DAM A;  3W1B A;  1VQL A;  4WJ3 M;  1SNM A;  5IYC H;  4N8X 1;  3TZD A;  1KLG D;  3M3Y H;  4LJZ C;  3SXH A;  1EY6 A;  1OXX K;  2KCC A;  2EYO A;  3K57 A;  3G7L A;  1EY0 A;  4QUF A;  3HGB A;  1EFW A;  1B8A A;  1Y8O B;  5BN4 A;  5J1Z A;  4DV1 Q;  5IGB A;  2A68 C;  4NDX A;  1LTI D;  1T5X D;  1FNV A;  1WVL A;  3S1M B;  2Z6B A;  3GTO H;  2YTX A;  3GD7 A;  1D1I A;  1Q8I A;  4PMC A;  5J22 A;  1QVG A;  4RG1 A;  5CV7 A;  2JA7 B;  1B9N A;  1SNO A;  3NBH B;  1TY0 A;  2H5X A;  4V0B A;  1JOK A;  4KHZ A;  4NP5 A;  1HZ9 A;  1C48 A;  1Z9F A;  5HY6 A;  4GNX B;  1SYF A;  4A3L G;  3CAM A;  1IL8 A;  2B2V C;  3HOZ B;  2GVA A;  2KCM A;  1NY4 A;  1DCZ A;  2UXC L;  1NR4 A;  1CM9 A;  1I6H B;  5D65 A;  2L5T A;  1J6Q A;  3A5Z B;  1EYG A;  2LKV A;  4DA2 A;  4O2D A;  2C9O A;  1LTL A;  2HCI A;  4C2M B;  1S5E D;  2WKC A;  1WTW A;  1IYU A;  1X3F A;  2F0G A;  5JJK A;  2IW3 A;  4P72 A;  4PNY A;  4LFA L;  2TSS A;  1F9R A;  4UPA A;  5C0X J;  2KEN A;  4I7A A;  2QGQ A;  1O78 A;  2D0P A;  3ZYY X;  5FJ8 H;  4LFB Q;  2VNU D;  1SNC A;  1Q8K A;  3A0J A;  3QG1 A;  1KNA A;  2EXD A;  4RH6 A;  1XYI A;  2F0M A;  2M2L A;  2CH4 W;  1PVO A;  4YWK A;  2RQX A;  4A93 B;  5M5W B;  4A3F G;  4XTC S;  3U9O A;  1PZJ D;  4P71 A;  1G91 A;  4BY7 G;  3CW2 C;  2F0T A;  1JJ2 A;  4LF7 L;  3MZ5 A;  5CC4 A;  1HUN A;  1L1O A;  1CT1 D;  3KLW A;  1U4L A;  4N9T A;  4DV2 Q;  2PPB C;  3MWY W;  4QCL A;  3H6M A;  2VQE Q;  1B4O A;  2ZXP A;  1TY2 A;  5IT9 E;  1UUP A;  1H95 A;  5C44 G;  5C6A A;  2EIF A;  1RD9 D;  1K3R A;  2FXQ A;  2KOL A;  4RKB A;  3PQI A;  2EYF A;  3C1E A;  5ISR A;  5A35 A;  4KHP L;  4RGT A;  1D5Z C;  4DAY B;  1SMY C;  4HJ9 A;  5M5X B;  2UUC L;  4RHR A;  2OWO A;  4AQY L;  3FMC A;  3HOW G;  2CQO A;  1B3Q A;  1ICF B;  4Y7N H;  4B3R L;  1ENA A;  3NTI A;  3P20 A;  4LFC L;  1BCP B;  3P1H A;  5EPL A;  3QO2 A;  1LAB A;  3OIP A;  5IE8 A;  2IJ0 A;  1IYV A;  3Q6S A;  4IQZ A;  1GUT A;  2BE5 D;  2HDM A;  2C35 B;  3ZJY C;  4JW0 A;  2R92 H;  4GLA C;  3BG3 A;  1XMO L;  4O0A A;  1AW7 A;  1WD0 A;  4BY7 B;  2OCE A;  1T9H A;  1GUO A;  4KY7 A;  2VQF Q;  1EZ8 A;  5JEA J;  2NZ1 D;  4B3M L;  3PF4 A;  1K83 H;  4A3M B;  1D2B A;  1X54 A;  2F4V Q;  3SK8 A;  2XVS A;  4PG3 A;  5JVG 3;  1FNW A;  3RZD H;  5JPM C;  2DNC A;  2VUM H;  1I94 L;  3GQB A;  1EQQ A;  5C44 B;  4DK1 A;  3FP9 A;  2TMP A;  1TWC B;  1EWC A;  1PYB A;  1H9J A;  4DFA A;  3I73 A;  3L2P A;  1Y1V H;  4IUQ A;  5C4J B;  4LNQ A;  2OTL A;  3EN2 A;  1DJR D;  1B44 D;  4KI0 A;  4L5R C;  3HOW B;  3A5U A;  1DYQ A;  1Y8N B;  2DY7 A;  1EYA A;  1VQF A;  4X3T A;  5LL6 S;  5E4W C;  3N6R A;  1U0L A;  4J15 A;  5M5Y H;  3D31 A;  4FXK C;  2AUJ D;  1CZG A;  1S5B D;  1D1K A;  4UP7 A;  4LMQ D;  3E0J A;  2EJM A;  4UY8 C;  1JWS D;  1LTS D;  1B1Z A;  1E2W A;  3W3A A;  3RN5 A;  2Z4H A;  1SJH D;  3BVZ A;  5DNF A;  3ULJ A;  1OXS C;  1J8I A;  3FKI G;  5IIF A;  2JYO A;  2BOS A;  3U58 A;  4HCE A;  2RKS A;  3I4M G;  1ILQ A;  1Q3L A;  3DUZ A;  4BY1 G;  5K5P A;  1YEZ A;  1J9O A;  4APV A;  1FVI A;  2F0Q A;  5FOB B;  2GN5 A;  1PRT C;  3LNN A;  2VL6 A;  1X55 A;  2ES2 A;  2ZM6 L;  2EPB A;  3ONA B;  1CFM A;  4DV6 L;  2UXB L;  2B63 B;  5BR8 Q;  3E6Z X;  3S1Q B;  5K36 G;  2D0O A;  4JBM A;  4TRD A;  3T16 A;  2ZXO A;  4JI6 Q;  2R93 H;  1QJO A;  1ET6 A;  4X64 Q;  4A3C H;  4DV3 Q;  1UE1 A;  4LF4 Q;  5I6Y A;  3RNU A;  2E5L L;  3CCS A;  3GTK H;  2SNS A;  3J81 c;  4ALP A;  1A3T A;  3R2I A;  5IYD G;  1JOO A;  4DV7 L;  2D62 A;  2PNH A;  1KAB A;  3E9I A;  4OWW B;  4C3J G;  2MJ8 A;  4MTN A;  4FF4 A;  2F52 A;  5HUR A;  1FR3 A;  3P7J A;  2K05 A;  5I9O A;  1FGU A;  3CC4 A;  4MHE A;  2UUB Q;  1K3B C;  2YTY A;  2NN6 I;  1TS3 A;  2F3W A;  4JI3 Q;  4IPD A;  3D0F A;  2HUG A;  2K52 A;  5IGE A;  4CDD C;  1UNS A;  4HED A;  2E2I H;  4ZCK A;  4C56 C;  3DM1 A;  3X3N A;  3DLL A;  3DWQ A;  1J5E Q;  1E2Z A;  5JVH 3;  5C4X H;  1VMP A;  1M4V A;  4CGY B;  1IBL L;  4RGN A;  3FKI B;  2MUY A;  3MFG A;  4GN5 A;  4F8M A;  3BDC A;  4BY1 B;  4OIJ A;  3AU7 A;  2XIW A;  3MVV A;  2IWH A;  4JI1 L;  4X65 L;  1MJE A;  4B3S Q;  1LTB D;  3GP7 A;  3J80 i;  3EVQ A;  4XQQ A;  1DZ1 A;  2I0Q A;  1TWF B;  3GO5 A;  4DGZ A;  4IUU A;  2CWP A;  4JYA Q;  1IW7 D;  4PQX A;  1W2B A;  4DR2 Q;  1SSO A;  2AMC B;  3DWA A;  3FPP A;  1ILP A;  5COR A;  1SNQ A;  3PIO A;  1QNK A;  1RHP A;  3PIO 3;  2A19 A;  3U4V A;  2Z8L A;  5JJZ A;  2RDF A;  1KLU D;  3F2B A;  4L8J A;  1TU2 B;  2G9H D;  3MXP A;  4X6A H;  1D8L A;  3MAQ A;  4C3J B;  5T1I A;  3I3C A;  3A7L A;  3AEV A;  1X3G A;  4WRD A;  1JB3 A;  5EKL A;  4YCV A;  5M3F B;  3CQZ B;  4JI6 L;  2E2J B;  3H0G G;  1GUG A;  3ULP A;  1YHQ A;  2HD3 A;  5M3M G;  3FDT A;  4QL5 A;  2AWO A;  3S1R B;  1E1O A;  1STN A;  1V1Q A;  3GTP B;  2AQ2 B;  1LT5 D;  1N9W A;  3VR6 A;  1PFM A;  3CC2 A;  1NMG A;  2L15 A;  1CUK A;  5IYC G;  2F0O A;  2RCF A;  3NEM A;  2NB0 A;  2B2W A;  2F0H A;  1ICW A;  1M90 C;  1IBM Q;  2Q8R E;  4PZ8 A;  2OF1 A;  1UE5 A;  4LF9 Q;  3PO2 B;  3NPP A;  4GOP A;  4KJN A;  3B6Y A;  1AN8 A;  2ZJP A;  1JB7 A;  1DON A;  2Q8I B;  3KJO A;  1AZQ A;  2MHV A;  1J5E L;  4IFD H;  5JAV A;  1MGS A;  3AQQ A;  1PH8 A;  4F88 A;  1IL2 A;  1H9K A;  1R4Q B;  3I72 A;  5EBC A;  3S2H B;  3KF6 B;  4JI8 Q;  2PW5 A;  1SRO A;  1Q90 A;  3N52 A;  4R8N A;  3UDI A;  4B3S L;  3S15 B;  1N34 L;  3K5N A;  2N88 A;  4H13 C;  4CKB A;  5I2X A;  5ELC A;  4DUZ L;  5I9P A;  1ESF A;  3K59 A;  4JG2 A;  2A69 C;  1YIJ A;  5ELE A;  1JOR A;  3H0G B;  1E3P A;  2JA8 H;  2J4X A;  4ODG A;  4EVO A;  3NXW A;  4J6H A;  4AIM A;  1I4H A;  5M3M B;  1TS4 A;  1Y1W H;  3AB9 A;  4XYO A;  2UUA Q;  3K5L A;  3GTL H;  1HNX Q;  1EL0 A;  2VZA A;  3WWV A;  1TWA H;  2B2Y A;  4RKL A;  1Q46 A;  1WJJ A;  1XXG A;  3TN2 A;  1X9N A;  5G3L F;  1ET9 A;  4MN3 A;  1XX8 A;  3L9A X;  1WTQ A;  3M3Y B;  1RJT A;  2KA7 A;  2F0I A;  2B2U A;  4ULL A;  1EQR A;  3K7A H;  1JJC B;  4KHV A;  1AE2 A;  3AFP A;  4BXX H;  4DR6 L;  5C4Z A;  3F2D A;  3D6C A;  1SYB A;  3GTO B;  4H44 C;  4GKJ Q;  2F0F A;  2CW0 D;  4DKA C;  1EY7 A;  1Y14 B;  4POG A;  4JI2 Q;  4A3B H;  5HGQ A;  1GUS A;  3UDG A;  3J7A 5;  1I50 H;  2CHB D;  2HCC A;  4OXP A;  3CU7 A;  4DUY L;  2NVQ H;  1YJN A;  1UE6 A;  1HR0 W;  4PMW A;  1LT6 D;  1BR9 A;  4K0K Q;  3FPU B;  4X3S A;  4ZUI A;  1PTO H;  3KF8 A;  2EZV A;  3NQT A;  1CA6 A;  3KLR A;  2A6H C;  4ABN A;  1AH9 A;  4RWS C;  3SHL A;  3T1H Q;  4LF5 Q;  3CME A;  4BBR H;  1N32 Q;  1WCM H;  3CHB D;  4UHV A;  5IWA Q;  4IJH A;  1MSH A;  4HMJ A;  3TS2 A;  3STB D;  1GHK A;  2JA9 A;  1BKB A;  1LTA D;  1VQM A;  2SNM A;  4A3D B;  1C4Q A;  3V05 A;  1K73 C;  4FVM A;  3S16 H;  4IUR A;  5IOC A;  1EEF D;  1VCI A;  3FEW X;  1SXT A;  4DV5 Q;  1PYW D;  2L1B A;  1R4P B;  3J81 j;  4X3K A;  2YU9 B;  2L12 A;  2VY3 A;  1STH A;  3GTJ H;  4DV4 L;  1QNU A;  1LUZ A;  3M85 A;  2LMC B;  1YNN C;  2K5N A;  2I5M X;  2VW9 A;  2R92 G;  4CDE C;  1CI3 M;  1IBK Q;  3SEB A;  5AJ3 Q;  3OTO Q;  4A75 A;  4IOC A;  4B08 A;  3I4L A;  1R9T H;  4DK0 A;  1K9M C;  4YHH Q;  2EYM A;  2E2H H;  3S17 H;  1Q12 A;  2R3Z A;  4K6L A;  2EVB A;  2VUM G;  1TVX A;  3J81 L;  1GJX A;  2MGS A;  2H4O A;  4XT1 B;  3MXG A;  2IPK D;  2F0L A;  3K5O A;  1E7Z A;  2FHT A;  1SYD A;  1BUV T;  4Z9C B;  4R4T A;  1Y1V G;  1JE5 A;  2K14 A;  3OW7 A;  3IFD A;  4JOI C;  1QVF A;  4ZAI A;  3ND9 A;  1YHA A;  4C1N I;  4CBV A;  4FDB A;  2KBN A;  5EQ0 A;  3Q24 A;  1BCP F;  2JQO A;  5C3X A;  4DN4 M;  3HOV H;  1KD1 C;  2DJG C;  2KUM A;  2N3S A;  4OO1 H;  5EKK A;  2EYP A;  4DNT B;  1WFQ A;  4GNX C;  4ZLT F;  1FYC A;  5D3D A;  3G48 A;  1VQP A;  2WFW A;  1HNW L;  1CTM A;  4K14 A;  2HIV A;  2DNE A;  1TKW B;  3R3O A;  1ENF A;  4NXM Q;  4DR7 L;  4A4I A;  4GOP B;  4IJL A;  3SE0 A;  1S5D D;  1K83 B;  3ULL A;  4DU9 A;  3NEL A;  1UEA B;  5C3E H;  3BZK A;  3OMC A;  2VUM B;  4HN7 A;  2N8N A;  1TXY A;  2A1A A;  2R93 G;  2DN8 A;  1EUJ A;  3HS0 C;  1NAP A;  4R4O A;  3T53 B;  4A3C G;  4LF8 Q;  3CMA A;  4X66 L;  1KNE A;  1Y1V B;  4BA2 I;  2A68 D;  3DEO A;  4PZ6 A;  3BU2 A;  3VR4 A;  3G4S A;  4JI0 L;  1PZK D;  1WTR A;  2FJ2 A;  1SJE D;  1STY A;  2QIL A;  3CRK C;  4K6D A;  4LW1 A;  1DGS A;  4L5Q A;  2UXD L;  1HRJ A;  3F2U A;  1G2S A;  2EYL A;  3U4Z A;  1Z7T A;  5FLM H;  2R6G A;  4HMI A;  5M5Y B;  1CKN A;  4EQ5 A;  4OWT B;  2NUC A;  1RTO A;  4ZYS A;  1G29 1;  3MXN A;  3IKJ A;  4H7B A;  1A6X A;  3NEN A;  5DM7 3;  1QIL A;  5C4X G;  1DOL A;  4DR3 Q;  4IUV A;  4EX5 A;  3PUY A;  2UU9 Q;  3OPO A;  2V4D A;  1F2Y A;  1CHP D;  4IOA A;  1LTR D;  4ILW A;  3DHQ A;  1LO5 D;  4Q0F A;  3BYY B;  1BCP C;  3CPF A;  1SYG A;  1F2L A;  1ZEQ X;  4S3S A;  3CCM A;  1V9P A;  4R4Q A;  1S3O A;  3M4O H;  4ID6 A;  3RR5 A;  3MEF A;  4RFB A;  1GVP A;  4KJO A;  2HHH Q;  2CQA A;  4HSP A;  2R93 B;  2HT1 A;  1SYE A;  4JI5 L;  5D14 A;  1HQM C;  1I4G A;  2DJF C;  4UDU C;  1B9M A;  3GTK B;  2G5D A;  1X65 A;  4UAI A;  1SBB B;  2X6L A;  4BS9 A;  1K8M A;  4EQN A;  3KF8 B;  5IYB H;  4JV5 Q;  2K7V A;  2VB2 X;  4DK3 C;  4HCS A;  4DV1 L;  2JA5 H;  3L3O C;  3VR3 A;  4WJW A;  2M9V A;  2WB1 G;  5EPJ A;  5F2D A;  3E0E A;  1YNJ C;  3BDO A;  4JVZ A;  2R7Z H;  1EEI D;  4CJ1 B;  4A3J H;  4A3K G;  1QCB D;  3ER0 A;  3TZU A;  3I70 A;  4FF3 A;  1XNR Q;  5C4X B;  1G8Z D;  1KDC A;  4M1U B;  3SK5 A;  1U4R A;  1V1P A;  2XRS D;  4XYQ A;  2JA6 H;  3VR5 A;  4G57 A;  2QEJ C;  2WIN B;  3RUZ A;  1V8Q A;  2A73 B;  1EY4 A;  1I3Q H;  3QIA A;  5FK9 C;  1E24 A;  4POF A;  2L0C A;  2E76 C;  4DAP A;  1ASZ A;  1CKO A;  2P5Z X;  2XTI A;  1YBY A;  2EYH A;  3SR1 A;  4IFD G;  3T51 B;  4A3F B;  1O7L A;  1ML0 D;  1KQS A;  1TWH H;  2MPM A;  4RHS A;  1PH5 A;  4FO2 A;  3HKZ G;  3Q23 A;  4K8I A;  1L2F A;  2F0P A;  1STE A;  2LXJ A;  4BWG B;  1WTP A;  4LFB L;  2ZTC A;  3GTM H;  3KF6 A;  2CKZ B;  3I4O A;  2RBM A;  2BDO A;  1N8R C;  4JI4 Q;  1VF5 C;  5EJW A;  5EAY A;  2ICE C;  4BA1 I;  2Z1C A;  1X56 A;  2GVB A;  4LUZ A;  3J7Y W;  1ZXT A;  1HFN A;  1E0B A;  5H1S E;  1BF4 A;  1I5F A;  4CHT B;  2OXP A;  3CCL A;  3K58 A;  4F7X A;  2EDG A;  1NSN S;  2JA8 G;  2K5V A;  5CV5 A;  2F03 A;  2Y0S G;  4DV2 L;  1SLJ A;  1Z6H A;  1I4Q A;  1NMF A;  3H15 A;  1Y1W G;  4A3K B;  2VQE L;  2K28 A;  1BDO A;  1PHJ A;  4A76 A;  4OGQ C;  3M9B A;  2A74 C;  2OT2 A;  2O5I C;  3ERO A;  4U67 3;  4DR1 Q;  3NWS A;  4ZKB B;  3K8A A;  1EIY B;  3PO3 H;  1CSQ A;  1A63 A;  1XNQ Q;  3MTS A;  3VDY A;  2PNR C;  4QF4 A;  3S2D H;  1ASY A;  2RHS B;  4BXX G;  1K8O A;  1UEB A;  4YWM A;  2RA4 A;  3F1Z A;  4WFN 3;  4JC0 A;  3K7U C;  2IT1 A;  3PUV A;  2Z6K A;  4QB4 A;  2I5H A;  2LFN A;  2EJG C;  3S14 B;  4HJ7 A;  4A3B G;  4HJ8 A;  3JAM c;  1M8A A;  4IN3 A;  3PSI A;  4IZ8 A;  2EY1 A;  1EIH A;  3CCE A;  4U68 A;  1IHZ A;  4C3H H;  2F3I A;  1B50 A;  1CQV A;  4QMG A;  2LS0 1;  3GTQ B;  1HZB A;  4G7H C;  1PRT D;  3S24 A;  4F87 A;  3F2C A;  1HPC A;  3EJI A;  5BN3 A;  1A2T A;  5IP9 H;  4B9W A;  2DY8 A;  2VQF L;  4BBR G;  2G9D A;  1WCM G;  2B39 A;  5CV9 A;  2JA8 B;  2KED A;  1PTO D;  4A93 H;  2B2T A;  3OHX C;  2F4V L;  1XMQ Q;  1SYC A;  1L1O C;  4XQJ A;  1GD7 A;  1SE8 A;  1TWA B;  1CKN B;  2VS1 A;  2R61 A;  5I2Y A;  4NPS A;  3I55 A;  3I4N H;  3BS1 A;  2NVY B;  3MXN B;  3Q22 A;  3CCU A;  4DXF A;  1OO9 B;  2MNA A;  3D4D A;  2FMM A;  4IFD I;  1BOS A;  2F0V A;  1I6V C;  2KHI A;  3OIQ A;  1BNZ A;  2QEX A;  4O42 A;  3VYS A;  1EIF A;  3G6E A;  3HOU H;  5EPK A;  1PH2 A;  4OL7 A;  1D5X C;  4HJ5 A;  2BDN A;  1PXU A;  3I4M B;  3CCV A;  1STB A;  3H91 A;  1EIG A;  3TDQ A;  1WTX A;  4I65 A;  4HJA A;  1L0Y B;  3FVQ A;  4H02 A;  1MHW C;  4A3B B;  4KD3 A;  5KYI A;  3J81 E;  1QUQ A;  1EU4 A;  4CKE A;  3NP8 A;  1I50 B;  4DF7 A;  2K5W A;  2NVQ B;  4DAV A;  3CKI B;  1H9S A;  2I5L X;  3UE1 A;  3U50 C;  2VXW A;  1P8L A;  3PIP 3;  2KVM A;  1PH7 A;  3J7A V;  3LGJ A;  1AZP A;  1PTO B;  3QJY A;  2ZJR A;  1JWM D;  4KK7 A;  2BA0 A;  5FO9 B;  1SDF A;  5T1G A;  2EXZ A;  1IXR A;  4BBR B;  2ZTD A;  4PZ7 A;  1WCM B;  4B3T Q;  2JEA I;  3RN2 A;  2QCP X;  1MSG A;  1CSP A;  2LSS A;  5CMD A;  1FD7 D;  1JQY D;  1HFG A;  4DPG A;  2QW7 A;  3HOV G;  1LAC A;  4NKL A;  5BR8 L;  1I4X A;  4DV0 Q;  3HEJ A;  2WV6 D;  4A3E H;  4OO1 G;  3BDL A;  4A3M H;  1EY5 A;  4X64 L;  1NJI C;  4MZ9 A;  1EYD A;  2E2D C;  2XGT A;  2AUK A;  4DV3 L;  4OHJ A;  1HCZ A;  5IP7 H;  4LF4 L;  5A2Q L;  3H3V I;  3T4A C;  2K5Q A;  1K28 A;  2F0S A;  2JN4 A;  2RVL A;  4RGO S;  1PH9 A;  1V1P B;  2YV5 A;  4ZK9 B;  1XJV A;  1FJG Q;  4RAU C;  1TWC H;  2RHQ B;  3GV3 A;  4QY7 A;  2UUB L;  1YJW A;  3MFY A;  2BA1 A;  1R9T B;  4JI3 L;  3RZO H;  1X3E A;  3S17 B;  3M4P A;  1EQT A;  4X62 Q;  1WYD A;  5C3E G;  1VQB A;  1WOC A;  1YZ6 A;  2RDH A;  1HZA A;  1F9P A;  1TII D;  1P16 A;  3VA5 A;  2AQ1 B;  2MQH A;  3EIV A;  1ZYR C;  4IAL A;  1VQJ A;  3QOL A;  1STG A;  5KND A;  5LMN Q;  1O7Y A;  4KKU A;  4UP8 A;  2NN6 H;  3RLN A;  4TQU S;  1VQH A;  1TQO A;  1N33 Q;  1X6O A;  4XXE A;  1QZH A;  3AMU A;  1LM0 A;  4L5T A;  1MKH A;  3PV0 A;  1JR0 D;  2K6A A;  5FLX c;  3HOV B;  2B3G A;  1RKN A;  5FLM G;  2XWJ B;  3F8T A;  5C0X H;  1SND A;  4JYA L;  2LXK A;  4WJ4 A;  1EU3 A;  4DR2 L;  4HAE A;  4OEM B;  5I4D A;  4RGM A;  3W5O A;  3D6W A;  3FHW A;  4FP5 D;  3BZD B;  3HOY H;  2EY5 A;  1Y69 U;  2C5C A;  3PUZ A;  3NWT A;  2NBF A;  2B63 H;  4GKK Q;  2BH8 A;  3M4Y A;  1C0A A;  2NVT H;  2NVX H;  2AKW B;  2NTT A;  2MP1 A;  3CRL C;  5E7N A;  2I46 A;  5FJ8 G;  4BBS H;  1HQR D;  3DM3 A;  1EWI A;  2SOB A;  2PZU A;  1CQF A;  1VQK A;  1C9O A;  3KFU A;  4HIM A;  4OX9 Q;  1TWG H;  3E3X A;  1VQD A;  5LL6 X;  4ZKC B;  4KN7 C;  3NHH A;  1ESR A;  3NK9 A;  2K33 A;  1PH3 A;  1Z47 A;  4K5V A;  1Q1E A;  5HGT A;  3BJU A;  1NNX A;  2NWG A;  3SK4 A;  5J39 A;  3LX0 A;  4QUC A;  5GRO A;  2NZO A;  1IBM L;  4YWL A;  3SVM A;  3I8Z A;  1H9M A;  3KLS X;  5JJI A;  5BN5 A;  4LF9 L;  5IY0 A;  4OO1 I;  5IYB G;  4GLX A;  5DM6 3;  4CJ2 C;  3RLO A;  3A54 A;  2JA5 G;  1PFB A;  2NZH A;  1N36 Q;  2Q2U A;  3TBI B;  1TS5 A;  2B2V A;  4TSS A;  3BVM A;  1S5C D;  2R7Z G;  1GXD C;  1ROD A;  5EKI A;  4JI8 L;  3C46 A;  3VYT A;  4A3J G;  3RD4 A;  1TWF H;  1G51 A;  2F0E A;  3L0O A;  1N33 L;  2A6H D;  4GS3 A;  4ME5 A;  4LF6 Q;  1PYS B;  3NE5 B;  1UE7 A;  1FL0 A;  4NXN Q;  2JA6 G;  3A55 A;  4QGU A;  4R4C A;  2WAQ G;  3J80 c;  1Y8P B;  4L5S A;  2A6E D;  3ERS X;  4YY3 Q;  1BVS A;  5JEA H;  4KKT A;  3OW2 A;  1L0X B;  4DR4 Q;  2QDB A;  3PMF A;  3JAM L;  3M4O B;  1EQV A;  2O2L D;  2UUA L;  2A5H A;  1HNX L;  2EOT A;  5M3F H;  1PH4 A;  2E2J H;  2E74 C;  1A3V A;  2ATW A;  1D7Q A;  1GUW A;  5JPN C;  2HDL A;  3KDF A;  5CV8 A;  5C5M A;  3TRE A;  4GN3 B;  4EGV A;  1QUQ B;  4K5X A;  1YNN D;  4C3I H;  1F2M A;  3S1R H;  2F0J A;  1SE2 A;  2Z4I A;  3QB3 A;  5NUC A;  3LWE A;  1H9S B;  1IKL A;  1TS2 A;  2KCN A;  2B2W C;  4H0L C;  2AWN A;  4GOP C;  1VQ6 A;  1GO3 E;  1VQ7 A;  2VB3 X;  2PZW A;  3HKS A;  3KBX A;  3KOJ A;  1JJG A;  4P2C B;  4IO9 A;  4GKJ L;  1HHV A;  2K01 A;  4JBW A;  3T13 A;  3PO2 H;  1C8C A;  2HQL A;  4QJF A;  4JI2 L;  5TSS A;  4A3J B;  4Y7N B;  2V1C C;  5LMU Q;  2QA4 A;  2KQ3 A;  1SFO H;  2UXC Q;  2I07 B;  1X3P A;  1QE6 A;  1C7Y A;  3G6J B;  3V2T A;  4K0K L;  1WI5 A;  1JMC A;  3C2P A;  1CK1 A;  3C3L A;  2F3V A;  2JA6 B;  4YCW A;  2WAQ B;  1YJ9 A;  1N36 L;  1E2V A;  3PO3 G;  3J7A F;  2RDG A;  4R4I A;  2E8G A;  3T1H L;  4LFA Q;  4LF5 L;  4C1N K;  1N32 L;  3GV6 A;  4YCU A;  3KJP A;  1CKM A;  2QKI C;  5IWA L;  1K0R A;  1HA5 A;  2R7F A;  4NMZ A;  4A3I H;  1EY9 A;  1ZKO A;  2J7Z A;  1JIC A;  1B70 B;  2K50 A;  1FGB D;  2R92 B;  3S1N H;  1KXL A;  1MI2 A;  1TWH B;  3GTG H;  3X3M A;  1HH2 P;  2ENB A;  1CZW A;  3HRZ C;  1BBW A;  3ICE A;  5GAG C;  1LV9 A;  2MO1 A;  3J7Z C;  4GLV B;  3BVG A;  3I90 A;  2EJF C;  1VQI A;  2WAQ E;  2B2Y C;  2D2C C;  5E4X A;  3UE0 A;  5CV4 A;  3NSW A;  4DV5 L;  3GTM B;  3CD6 A;  1PLF A;  4C3H G;  3VA7 A;  1KHI A;  3RZD B;  4QQB X;  3A8J E;  1EOV A;  1UAP A;  1DXM A;  5KNC A;  4LF7 Q;  1RCV D;  4JBK A;  3EBE A;  1GKH A;  3L7Z C;  2AQ3 B;  4KLK A;  2K4K A;  2B2U C;  1IBK L;  2K03 A;  2Z0S A;  5IP9 G;  4AH6 A;  5AJ3 L;  3OTO L;  2IY5 B;  1AFP A;  3E5S A;  3TRZ A;  4YHH L;  4A93 G;  1JOQ A;  4TVA B;  1KIX A;  1XPO A;  1VQ8 A;  3TP6 A;  1A3U A;  1HXY D;  3WOE A;  4KHP Q;  2UUC Q;  3C1F A;  4HID A;  4FXG C;  1WTV A;  4AQY Q;  1U4P A;  1PH6 A;  3I4N G;  3I56 A;  4DR5 Q;  4J8Q A;  1V1O A;  1GUN A;  4B3R Q;  3PO3 B;  4LFC Q;  1DOK A;  4IFD J;  2PI2 A;  3JAM i;  3HOU G;  3S2D B;  4FYD A;  5KGU A;  4OON A;  5LMU L;  4X3U A;  1SMX A;  1LLR D;  3QWN A;  4N8F A;  3CC7 A;  1HJP A;  2PW7 A;  4JCV E;  4IPC A;  1WTO A;  1O7Z A;  3I7F A;  3IRB A;  1IZ6 A;  3URY A;  2IX0 A;  3QR8 A;  2ALY B;  4K2K A;  2IHE A;  1U4M A;  1LYL A;  5IT9 c;  4M8A A;  4UP9 A;  5GAE C;  3J81 i;  4C3H B;  1XMO Q;  1XTC D;  1B2T A;  4JBJ A;  4A3D H;  2FMC A;  4AYB G;  5CGK A;  4B3M Q;  1BCP D;  4IUP A;  5JOB A;  1OXV A;  3DWP A;  5FLX L;  4A3G H;  3DMU A;  1MIU A;  1BXT A;  2K32 A;  2YU9 H;  1OXU A;  1I94 Q;  4NXM L;  2NTS A;  4DNR B;  2OQK A;  2JE6 I;  1FNU A;  2JEB I;  1F9Q A;  4KN4 C;  1JT8 A;  5KYL A;  4CKC A;  3K5M A;  3WDN A;  2X6G A;  4B9X A;  2PQE A;  4ZUJ A;  3T56 B;  2IHF A;  1YHB A;  4A3E G;  4TKO B;  2JJQ A;  1KRT A;  4OWX B;  5KEE A;  5A2Q E;  4A3M G;  3I4N B;  4XDX A;  2Q8T A;  1I4R A;  2JP1 A;  2QF7 A;  4LF8 L;  1ENC A;  5IP7 G;  2E2I B;  1G2T A;  1MD2 D;  4L63 B;  1W3S A;  5DLQ E;  5LHY 1;  3HOX H;  1A0I A;  4CJ0 B;  1YNJ D;  3HOU B;  1RL2 A;  3MC0 B;  2F0N A;  1T5E A;  1SMY D;  3BYT B;  5KRU A;  1RF2 D;  3ND8 A;  2OEO A;  4CDC C;  3WOF A;  5CV6 A;  3R8B A;  1EFI D;  3RLF A;  1MBY A;  4ZRZ A;  4RCO A;  1SR3 A;  5CR3 A;  3ERQ A;  3IL8 A;  5ELD A;  1S5F D;  5D3I B;  2HQE A;  4K2L A;  4I7Z C;  1PRT F;  4DR5 L;  3VR2 A;  5GQO A;  5IOD A;  2F0U A;  4GN4 B;  4NW2 A;  1F2Z A;  4OEL B;  4YIJ A;  2BE5 C;  4DR3 L;  5FO7 B;  1GM5 A;  2CH4 A;  4AYB B;  4JI7 Q;  1KDB A;  1SAP A;  1PTO F;  3KDF B;  2UU9 L;  1JC7 A;  3K81 C;  2ZM6 Q;  2UXB Q;  2O5J C;  2ID0 A;  4DV6 Q;  1LT3 D;  2NN6 G;  3A8K E;  1IYJ B;  2AHO B;  4KY6 A;  2Z9H A;  1NR2 A;  1ONL A;  2E5L Q;  4AYB E;  5C0X G;  2WB1 B;  1SE4 A;  2HHH L;  2ICI A;  1VS0 A;  1QZG A;  1SN8 A;  2EE1 A;  4A3E B;  5EBD A;  4DV7 Q;  3HOY G;  2F0K A;  2F1M A;  4P74 A;  3NBI A;  1M1K C;  4RMF A;  2B63 G;  3J80 L;  1NBW A;  5J3B A;  2KCT A;  5M9O A;  3S1M H;  1EOT A;  4PV1 C;  3O13 A;  4OIK A;  3ITP A;  4IPH A;  1NE3 A;  3TP5 A;  2JA7 H;  4JV5 L;  3NQI A;  4BBS G;  2WB1 E;  2PQA A;  5AFW A;  2N78 A;  3SGI A;  1OXT A;  2EYJ A;  4XIG S;  4G4K A;  3W1G A;  1VMC A;  3RZO B;  5ELN A;  2N49 A;  4FXD A;  1IBL Q;  3HOZ H;  3MHB A;  3OSO A;  4HTH A;  2PMZ B;  4HIO A;  1GOZ A;  1LT4 D;  3G71 A;  1XNR L;  4ME3 A;  1I6H H;  4GZY C;  5GAH C;  1VF7 A;  2IX3 A;  2H1E A;  1QVC A;  4JI1 Q;  4X65 Q;  3HKZ B;  3I91 A;  1CA5 A;  3D8G A;  2M00 A;  1Q1B A;  1SE3 A;  1U5K A;  1U9R A;  4C2M H;  3S9W A;  3TS0 A;  2K5D A;  3MEH A;  1A15 A;  4DK6 C;  1LTG D;  1O7I A;  3H3V C;  1KC8 C;  4KTA A;  2OTJ A;  3PCO B;  4P73 A;  1XPR A;  2PMZ E;  3JC6 6;  3AYH B; 
#chains in the Genus database with same CATH homology
 2PZT A;  2FIN B;  1QB5 D;  1STA A;  2IL8 A;  2KEE A;  1X32 A;  3H09 A;  3HOY B;  3D4W A;  2Y0S B;  1Y1W B;  3GTL B;  1PTO C;  2WP8 J;  2NVT B;  1AP0 A;  2NVX B;  2XN9 C;  5ELB A;  2N55 A;  1CHQ D;  5CYU A;  2EY6 A;  5KIX A;  3DEP A;  4EQO A;  4BBS B;  4FNF A;  3IAY A;  4HR7 B;  1BQQ T;  5C5L A;  3JAM E;  5JEA G;  4KY5 A;  1TWG B;  3K7A B;  2PCF B;  1S4Z A;  2KHS A;  3A8I E;  2J0T D;  5I6W A;  1BBX C;  1JCK B;  2JSO A;  5CBA E;  3D4R A;  3EFX D;  4C3I G;  1PRT B;  4FF1 A;  2XSC A;  5C0X I;  2ZT9 C;  2L9H A;  1X3Q A;  2F0W A;  3PUX A;  2PYK A;  1VDZ A;  4K8J A;  2GA4 B;  3NUC A;  4O1N A;  1IW7 C;  1I4P A;  4K5W A;  3MXU A;  1XWE A;  2KEC A;  3TP7 A;  1D5M C;  3S16 B;  2IX1 A;  3K0Y A;  4LAA A;  4XT3 B;  1AEX A;  3R2T A;  4XQN A;  1V43 A;  1W6K A;  3GTJ B;  2X69 A;  4L6T B;  5IT9 L;  2XNA C;  1IKM A;  1TR5 A;  2NYZ D;  3KLS A;  5E3F A;  2E2H B;  2L55 A;  3K6O A;  4C3I B;  1QG7 A;  4PMB A;  4R9W A;  3RMH A;  2WAC A;  1F9S A;  4G7O C;  3U9S A;  1TT2 A;  3LWU A;  1PFN A;  3Q0A A;  1QOH A;  5E1F A;  4WOR A;  5DAU A;  4JK1 C;  1ZYR D;  1SFO B;  3IFT A;  3TME A;  1JWU D;  5COY A;  1DOM A;  1B53 A;  1RDP D;  3NBH A;  2BCO A;  4IUN A;  2A69 D;  4A3I B;  1KTK A;  3S1N B;  4MIU A;  2B2T C;  3GTG B;  3A7A B;  2FFK B;  2CVR A;  1KDA A;  1HTL D;  1HTP A;  1D6E C;  5C3E B;  1SNP A;  4FF2 A;  2B8G A;  3A56 A;  4KV6 A;  3OWF A;  1RTN A;  4KKS A;  5FLX E;  2EY2 A;  4EQP A;  3MA2 B;  2RSO A;  4R8I A;  2LY7 A;  3HG9 A;  4J1M A;  4N9P A;  2B8F A;  1W6J A;  4DXG A;  2CW0 C;  4KD4 A;  3M7G A;  2RSN A;  1WD1 A;  2E75 C;  2JXM B;  1O80 A;  3R93 A;  2O4X A;  3KUP A;  3NTH A;  3NTK A;  1KAA A;  1PZI D;  2SEB D;  3EQL C;  2D9U A;  4E6I A;  3V96 A;  5C3W A;  2SDF A;  2XRQ D;  4RCN A;  5IGC A;  5KNB A;  3PUW A;  3KK7 A;  5C4H A;  5K36 H;  1HUM A;  3VYU A;  3SK6 A;  4QIW B;  2WII B;  1EYC A;  3HP3 A;  2ZXR A;  4LK1 C;  4DAY A;  1NUC A;  1QWY A;  2F4I A;  5IGG A;  1G6Z A;  2PO4 A;  2D5D A;  2A6E C;  5CBE E;  2F0D A;  1DM0 B;  3OWE B;  5ELF A;  3QOJ A;  4KMU C;  1DD2 A;  4A3G B;  2L11 A;  4IUT A;  5FO8 B;  1HA6 A;  2YYZ A;  3HZX A;  5EGT A;  5DEH A;  3OMG A;  4V19 0;  1F77 A;  3VYR A;  2JA5 B;  2KJX A;  1SEB D;  1EWH A;  4HSV A;  3DXJ C;  3FRP B;  3J80 E;  1BO0 A;  2R7Z B;  5G3L D;  3OOC A;  1H9R A;  4ZQ3 A;  3HOX B;  1JE4 A;  5IGD A;  5IGF A;  4Q5V A;  4RA8 A;  1B3A A;  1GHJ A;  5FKA C;  3TSS A;  3KBG A;  3W2D A;  1EZ6 A;  1I3Q B;  1LTT D;  3UI2 A;  3H94 A;  3P75 A;  1EY8 A;  1A2U A;  2XWB B;  4G7Z C;  1II3 A;  3M7N A;  1PMR A;  1PDQ A;  1NCV A;  3TP8 A;  2WKD A;  3D3R A;  3EA6 A;  3SDZ A;  2L4N A;  2K1B A;  2K04 A;  1SNM A;  3TZD A;  1KLG D;  4LJZ C;  3SXH A;  1EY6 A;  1OXX K;  2KCC A;  2EYO A;  3K57 A;  3G7L A;  1EY0 A;  4QUF A;  3HGB A;  1Y8O B;  5BN4 A;  5J1Z A;  5IGB A;  2A68 C;  4NDX A;  1LTI D;  1T5X D;  1FNV A;  1WVL A;  3S1M B;  3GD7 A;  1D1I A;  1Q8I A;  4PMC A;  5J22 A;  5CV7 A;  2JA7 B;  1B9N A;  1SNO A;  1TY0 A;  4V0B A;  1JOK A;  4KHZ A;  4NP5 A;  1C48 A;  1SYF A;  1IL8 A;  2B2V C;  3HOZ B;  1DCZ A;  1NR4 A;  1CM9 A;  1I6H B;  5D65 A;  2L5T A;  2LKV A;  4DA2 A;  2C9O A;  2HCI A;  4C2M B;  1S5E D;  2WKC A;  1WTW A;  1IYU A;  2F0G A;  2IW3 A;  4PNY A;  2TSS A;  1F9R A;  5C0X J;  1O78 A;  3ZYY X;  2VNU D;  1SNC A;  3QG1 A;  1KNA A;  4RH6 A;  1XYI A;  2F0M A;  2M2L A;  2RQX A;  4A93 B;  5M5W B;  4XTC S;  3U9O A;  1PZJ D;  1G91 A;  2F0T A;  3MZ5 A;  5CC4 A;  1HUN A;  1CT1 D;  1U4L A;  4N9T A;  2PPB C;  3MWY W;  4QCL A;  3H6M A;  1B4O A;  2ZXP A;  1TY2 A;  5IT9 E;  1UUP A;  5C6A A;  1RD9 D;  2KOL A;  4RKB A;  2EYF A;  3C1E A;  5ISR A;  5A35 A;  4RGT A;  1D5Z C;  1SMY C;  5M5X B;  4RHR A;  3FMC A;  1ENA A;  3NTI A;  3P20 A;  1BCP B;  3P1H A;  5EPL A;  3QO2 A;  1LAB A;  3OIP A;  2IJ0 A;  1IYV A;  3Q6S A;  4IQZ A;  1GUT A;  2BE5 D;  2HDM A;  3BG3 A;  1AW7 A;  1WD0 A;  4BY7 B;  1GUO A;  4KY7 A;  1EZ8 A;  5JEA J;  2NZ1 D;  4A3M B;  1D2B A;  3SK8 A;  2XVS A;  5JVG 3;  1FNW A;  5JPM C;  2DNC A;  3GQB A;  5C44 B;  4DK1 A;  2TMP A;  1TWC B;  1EWC A;  4DFA A;  1H9J A;  3I73 A;  4IUQ A;  5C4J B;  1B44 D;  1DJR D;  4KI0 A;  3HOW B;  1DYQ A;  1Y8N B;  2DY7 A;  1EYA A;  4X3T A;  5LL6 S;  5E4W C;  3N6R A;  3D31 A;  4FXK C;  2AUJ D;  1CZG A;  1S5B D;  1D1K A;  4LMQ D;  3E0J A;  2EJM A;  1JWS D;  1LTS D;  1B1Z A;  1E2W A;  3W3A A;  2Z4H A;  1SJH D;  3BVZ A;  5DNF A;  1OXS C;  1J8I A;  5IIF A;  2JYO A;  2BOS A;  4HCE A;  2RKS A;  1ILQ A;  1Q3L A;  3DUZ A;  5K5P A;  1J9O A;  2F0Q A;  5FOB B;  1PRT C;  3LNN A;  2EPB A;  3ONA B;  1CFM A;  2B63 B;  3E6Z X;  3S1Q B;  5K36 G;  4TRD A;  3T16 A;  2ZXO A;  1QJO A;  1ET6 A;  5I6Y A;  2SNS A;  1A3T A;  3R2I A;  1JOO A;  2D62 A;  1KAB A;  4C3J G;  2MJ8 A;  4FF4 A;  5HUR A;  1FR3 A;  3P7J A;  2K05 A;  5I9O A;  4MHE A;  2NN6 I;  1TS3 A;  2F3W A;  2HUG A;  5IGE A;  1UNS A;  4HED A;  4C56 C;  3DM1 A;  3X3N A;  3DWQ A;  1E2Z A;  5JVH 3;  1VMP A;  1M4V A;  4CGY B;  4RGN A;  3FKI B;  2MUY A;  3MFG A;  4F8M A;  3BDC A;  4BY1 B;  4OIJ A;  3AU7 A;  2XIW A;  3MVV A;  2IWH A;  1LTB D;  3GP7 A;  3EVQ A;  4XQQ A;  1DZ1 A;  1TWF B;  3GO5 A;  4DGZ A;  4IUU A;  1IW7 D;  4PQX A;  1SSO A;  3DWA A;  3FPP A;  1ILP A;  5COR A;  1SNQ A;  1QNK A;  1RHP A;  3PIO 3;  2Z8L A;  5JJZ A;  2RDF A;  1KLU D;  4L8J A;  1TU2 B;  2G9H D;  3MXP A;  3MAQ A;  4C3J B;  5T1I A;  3I3C A;  3A7L A;  4WRD A;  1JB3 A;  5EKL A;  5M3F B;  3CQZ B;  2E2J B;  1GUG A;  3FDT A;  2AWO A;  3S1R B;  1STN A;  3GTP B;  2AQ2 B;  1LT5 D;  3VR6 A;  1PFM A;  2F0O A;  2NB0 A;  2B2W A;  2F0H A;  1ICW A;  2Q8R E;  2OF1 A;  3PO2 B;  3NPP A;  4KJN A;  1AN8 A;  1DON A;  2Q8I B;  1AZQ A;  2MHV A;  4IFD H;  5JAV A;  1MGS A;  4F88 A;  1H9K A;  1R4Q B;  3I72 A;  5EBC A;  3S2H B;  2PW5 A;  1Q90 A;  3N52 A;  4R8N A;  3S15 B;  3K5N A;  2N88 A;  4H13 C;  4CKB A;  5I2X A;  5ELC A;  5I9P A;  1ESF A;  3K59 A;  2A69 C;  5ELE A;  1JOR A;  3H0G B;  2J4X A;  4ODG A;  4EVO A;  3NXW A;  4J6H A;  5M3M B;  1I4H A;  1TS4 A;  3AB9 A;  4XYO A;  3K5L A;  1EL0 A;  2B2Y A;  4RKL A;  1XXG A;  3TN2 A;  5G3L F;  1ET9 A;  4MN3 A;  1XX8 A;  3L9A X;  1WTQ A;  3M3Y B;  1RJT A;  2KA7 A;  2F0I A;  2B2U A;  4ULL A;  4KHV A;  5C4Z A;  3D6C A;  1SYB A;  3GTO B;  4H44 C;  2F0F A;  2CW0 D;  1EY7 A;  1GUS A;  2CHB D;  2HCC A;  3CU7 A;  4PMW A;  1LT6 D;  1BR9 A;  3FPU B;  4X3S A;  4ZUI A;  1PTO H;  3KF8 A;  2EZV A;  3NQT A;  1CA6 A;  3KLR A;  2A6H C;  4ABN A;  4RWS C;  3SHL A;  3CHB D;  1MSH A;  4HMJ A;  1GHK A;  1LTA D;  2SNM A;  4A3D B;  1C4Q A;  3V05 A;  4FVM A;  4IUR A;  5IOC A;  1EEF D;  1VCI A;  3FEW X;  1SXT A;  1PYW D;  2L1B A;  1R4P B;  4X3K A;  2YU9 B;  2L12 A;  1STH A;  1QNU A;  3M85 A;  2LMC B;  1YNN C;  1CI3 M;  3SEB A;  4B08 A;  3I4L A;  2EYM A;  1Q12 A;  2R3Z A;  4K6L A;  2EVB A;  1TVX A;  3J81 L;  1GJX A;  2MGS A;  2H4O A;  4XT1 B;  3MXG A;  2IPK D;  2F0L A;  3K5O A;  2FHT A;  1SYD A;  1BUV T;  4Z9C B;  3OW7 A;  3IFD A;  4ZAI A;  3ND9 A;  4C1N I;  4CBV A;  5EQ0 A;  3Q24 A;  1BCP F;  5C3X A;  4DN4 M;  2KUM A;  4OO1 H;  5EKK A;  2EYP A;  4DNT B;  4ZLT F;  1FYC A;  5D3D A;  1CTM A;  4K14 A;  2DNE A;  1TKW B;  3R3O A;  1ENF A;  3SE0 A;  1S5D D;  1K83 B;  4DU9 A;  1UEA B;  3OMC A;  2VUM B;  4HN7 A;  2DN8 A;  3HS0 C;  1NAP A;  3T53 B;  1KNE A;  1Y1V B;  4BA2 I;  2A68 D;  3DEO A;  3VR4 A;  1PZK D;  1WTR A;  2FJ2 A;  1SJE D;  1STY A;  2QIL A;  3CRK C;  4K6D A;  1HRJ A;  3F2U A;  1G2S A;  2EYL A;  1Z7T A;  2R6G A;  4HMI A;  5M5Y B;  2NUC A;  1RTO A;  4ZYS A;  1G29 1;  3MXN A;  3IKJ A;  4H7B A;  1A6X A;  5DM7 3;  1QIL A;  1DOL A;  4IUV A;  3PUY A;  3OPO A;  2V4D A;  1F2Y A;  1CHP D;  1LTR D;  4ILW A;  3DHQ A;  1LO5 D;  4Q0F A;  3BYY B;  1BCP C;  1SYG A;  1F2L A;  1ZEQ X;  4S3S A;  4ID6 A;  4RFB A;  4KJO A;  2CQA A;  4HSP A;  2R93 B;  1SYE A;  5D14 A;  1HQM C;  1I4G A;  4UDU C;  1B9M A;  3GTK B;  4UAI A;  1SBB B;  2X6L A;  4BS9 A;  1K8M A;  4EQN A;  2K7V A;  2VB2 X;  4HCS A;  3L3O C;  3VR3 A;  4WJW A;  2M9V A;  5EPJ A;  5F2D A;  1YNJ C;  3BDO A;  1EEI D;  4CJ1 B;  1QCB D;  3TZU A;  3I70 A;  4FF3 A;  5C4X B;  1G8Z D;  1KDC A;  4M1U B;  3SK5 A;  1U4R A;  1V1P A;  2XRS D;  4XYQ A;  3VR5 A;  4G57 A;  2QEJ C;  2WIN B;  3RUZ A;  1V8Q A;  2A73 B;  1EY4 A;  3QIA A;  5FK9 C;  2L0C A;  2E76 C;  4DAP A;  2EYH A;  3SR1 A;  4IFD G;  3T51 B;  4A3F B;  1O7L A;  1ML0 D;  2MPM A;  4RHS A;  4FO2 A;  3Q23 A;  4K8I A;  2F0P A;  1STE A;  4BWG B;  1WTP A;  2RBM A;  2BDO A;  1VF5 C;  5EJW A;  2ICE C;  4BA1 I;  2Z1C A;  3J7Y W;  1ZXT A;  1HFN A;  1E0B A;  1BF4 A;  4CHT B;  2OXP A;  3K58 A;  4F7X A;  2EDG A;  1NSN S;  5CV5 A;  2F03 A;  1Z6H A;  1I4Q A;  4A3K B;  2K28 A;  1BDO A;  4OGQ C;  2A74 C;  2OT2 A;  2O5I C;  3ERO A;  4U67 3;  3NWS A;  4ZKB B;  3MTS A;  2PNR C;  4QF4 A;  1K8O A;  2RA4 A;  4WFN 3;  2IT1 A;  3PUV A;  4QB4 A;  2LFN A;  2EJG C;  3S14 B;  1M8A A;  4IN3 A;  4IZ8 A;  1EIH A;  2EY1 A;  4U68 A;  1IHZ A;  1B50 A;  1CQV A;  4QMG A;  2LS0 1;  3GTQ B;  4G7H C;  1PRT D;  4F87 A;  1HPC A;  3EJI A;  5BN3 A;  1A2T A;  4B9W A;  2DY8 A;  2G9D A;  5CV9 A;  2B39 A;  2JA8 B;  2KED A;  1PTO D;  2B2T A;  3OHX C;  1SYC A;  4XQJ A;  1TWA B;  2R61 A;  5I2Y A;  3BS1 A;  2NVY B;  3Q22 A;  4DXF A;  1OO9 B;  3D4D A;  2FMM A;  4IFD I;  1BOS A;  2F0V A;  1I6V C;  3OIQ A;  1BNZ A;  4O42 A;  3VYS A;  5EPK A;  4OL7 A;  1D5X C;  2BDN A;  1PXU A;  3I4M B;  1STB A;  3H91 A;  1EIG A;  3TDQ A;  1WTX A;  4I65 A;  1L0Y B;  3FVQ A;  4A3B B;  4KD3 A;  5KYI A;  3J81 E;  1EU4 A;  4CKE A;  3NP8 A;  1I50 B;  4DF7 A;  2K5W A;  2NVQ B;  4DAV A;  3CKI B;  1H9S A;  2VXW A;  3PIP 3;  2KVM A;  3J7A V;  1AZP A;  1PTO B;  3QJY A;  1JWM D;  4KK7 A;  2BA0 A;  5FO9 B;  1SDF A;  5T1G A;  2EXZ A;  4BBR B;  1WCM B;  2JEA I;  2QCP X;  1MSG A;  5CMD A;  1FD7 D;  1JQY D;  1HFG A;  1LAC A;  4NKL A;  1I4X A;  3HEJ A;  2WV6 D;  4OO1 G;  3BDL A;  1EY5 A;  1EYD A;  2E2D C;  2AUK A;  4OHJ A;  1HCZ A;  5A2Q L;  3T4A C;  2K5Q A;  2F0S A;  4RGO S;  2RVL A;  1V1P B;  4ZK9 B;  4RAU C;  3GV3 A;  3MFY A;  2BA1 A;  1R9T B;  3S17 B;  1EQT A;  2RDH A;  1F9P A;  1TII D;  3VA5 A;  2AQ1 B;  1ZYR C;  4IAL A;  3QOL A;  1STG A;  5KND A;  1O7Y A;  4KKU A;  2NN6 H;  4TQU S;  1TQO A;  4XXE A;  3AMU A;  3PV0 A;  1JR0 D;  2K6A A;  3HOV B;  1RKN A;  2XWJ B;  5C0X H;  1SND A;  1EU3 A;  4HAE A;  5I4D A;  4RGM A;  3D6W A;  4FP5 D;  3BZD B;  2EY5 A;  1Y69 U;  2C5C A;  3PUZ A;  3NWT A;  2NBF A;  3M4Y A;  2NTT A;  2MP1 A;  3CRL C;  2I46 A;  1HQR D;  2SOB A;  2PZU A;  1CQF A;  5LL6 X;  4ZKC B;  4KN7 C;  3NHH A;  1ESR A;  3NK9 A;  2K33 A;  1Z47 A;  4K5V A;  1Q1E A;  5HGT A;  2NWG A;  3SK4 A;  5J39 A;  3LX0 A;  4QUC A;  3SVM A;  3I8Z A;  1H9M A;  3KLS X;  5BN5 A;  4OO1 I;  5DM6 3;  4CJ2 C;  3A54 A;  1PFB A;  3TBI B;  1TS5 A;  2B2V A;  4TSS A;  3BVM A;  1S5C D;  1GXD C;  1ROD A;  5EKI A;  3C46 A;  3VYT A;  3RD4 A;  2F0E A;  2A6H D;  4ME5 A;  3NE5 B;  3A55 A;  1Y8P B;  2A6E D;  5JEA H;  4KKT A;  1L0X B;  2QDB A;  3PMF A;  3JAM L;  3M4O B;  1EQV A;  2O2L D;  2A5H A;  2EOT A;  2E74 C;  1A3V A;  1GUW A;  5JPN C;  2HDL A;  5CV8 A;  5C5M A;  4EGV A;  4K5X A;  1YNN D;  1F2M A;  2F0J A;  1SE2 A;  2Z4I A;  3QB3 A;  5NUC A;  3LWE A;  1H9S B;  1IKL A;  1TS2 A;  2KCN A;  2B2W C;  4H0L C;  2AWN A;  2VB3 X;  2PZW A;  3KBX A;  4P2C B;  1HHV A;  2K01 A;  4JBW A;  3T13 A;  1C8C A;  5TSS A;  4A3J B;  4Y7N B;  2KQ3 A;  2I07 B;  1X3P A;  1QE6 A;  3G6J B;  3V2T A;  3C2P A;  1CK1 A;  3C3L A;  2F3V A;  2JA6 B;  2WAQ B;  1E2V A;  3J7A F;  2RDG A;  4C1N K;  3GV6 A;  2QKI C;  1HA5 A;  4NMZ A;  1EY9 A;  1ZKO A;  2J7Z A;  1JIC A;  2R92 B;  1FGB D;  1MI2 A;  1TWH B;  3X3M A;  2ENB A;  1CZW A;  3HRZ C;  1LV9 A;  3BVG A;  3I90 A;  2EJF C;  2B2Y C;  2D2C C;  5E4X A;  5CV4 A;  3NSW A;  3GTM B;  1PLF A;  4C3H G;  3VA7 A;  3RZD B;  3A8J E;  1UAP A;  1DXM A;  5KNC A;  1RCV D;  3L7Z C;  2AQ3 B;  2B2U C;  2K03 A;  1AFP A;  3E5S A;  1JOQ A;  3TP6 A;  1A3U A;  1HXY D;  3WOE A;  3C1F A;  4FXG C;  1WTV A;  1U4P A;  4J8Q A;  1V1O A;  1GUN A;  3PO3 B;  1DOK A;  4IFD J;  3S2D B;  4FYD A;  5KGU A;  4X3U A;  1LLR D;  3QWN A;  2PW7 A;  1WTO A;  1O7Z A;  3URY A;  2IX0 A;  4K2K A;  1U4M A;  4M8A A;  4C3H B;  1XTC D;  1B2T A;  2FMC A;  5CGK A;  1BCP D;  4IUP A;  5JOB A;  1OXV A;  3DWP A;  5FLX L;  3DMU A;  2K32 A;  1BXT A;  1OXU A;  2NTS A;  4DNR B;  2JE6 I;  1FNU A;  2JEB I;  1F9Q A;  4KN4 C;  5KYL A;  4CKC A;  3K5M A;  3WDN A;  2X6G A;  4B9X A;  2PQE A;  4ZUJ A;  3T56 B;  4TKO B;  5KEE A;  5A2Q E;  3I4N B;  4XDX A;  2Q8T A;  1I4R A;  2JP1 A;  2QF7 A;  1ENC A;  2E2I B;  1G2T A;  1MD2 D;  4L63 B;  5LHY 1;  4CJ0 B;  1YNJ D;  3HOU B;  3MC0 B;  2F0N A;  1T5E A;  1SMY D;  3BYT B;  5KRU A;  1RF2 D;  3ND8 A;  2OEO A;  3WOF A;  5CV6 A;  3R8B A;  1EFI D;  3RLF A;  1MBY A;  4ZRZ A;  4RCO A;  5CR3 A;  3ERQ A;  3IL8 A;  5ELD A;  1S5F D;  5D3I B;  2HQE A;  4K2L A;  4I7Z C;  1PRT F;  3VR2 A;  5IOD A;  2F0U A;  4NW2 A;  1F2Z A;  4YIJ A;  2BE5 C;  5FO7 B;  4AYB B;  1SAP A;  1KDB A;  1PTO F;  1JC7 A;  2O5J C;  2ID0 A;  1LT3 D;  2NN6 G;  3A8K E;  4KY6 A;  1NR2 A;  1ONL A;  5C0X G;  2WB1 B;  1SE4 A;  2ICI A;  2EE1 A;  4A3E B;  5EBD A;  2F0K A;  2F1M A;  3NBI A;  3J80 L;  5M9O A;  1EOT A;  4PV1 C;  3O13 A;  4OIK A;  3ITP A;  3TP5 A;  3NQI A;  5AFW A;  1OXT A;  2EYJ A;  4XIG S;  4G4K A;  1VMC A;  3RZO B;  4FXD A;  3MHB A;  3OSO A;  4HTH A;  2PMZ B;  1GOZ A;  1LT4 D;  4GZY C;  1VF7 A;  2IX3 A;  2H1E A;  3HKZ B;  3I91 A;  1CA5 A;  2M00 A;  1Q1B A;  1SE3 A;  1U9R A;  3D8G A;  3S9W A;  2K5D A;  3MEH A;  1A15 A;  1LTG D;  3H3V C;  4KTA A;  4DK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...