2IL8A

Three-dimensional structure of interleukin 8 in solution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-8
publication title Three-dimensional structure of interleukin 8 in solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2il8A00
1NCVA 1WTOA 1DOMA 1RTNA 5CBAE 5EQ0A 3I3CA 5E4WC 3TZDA 1M8AA 4CJ0B 2HUGA 3Q6SA 3DEOA 1AZQA 2R3ZA 1RHPA 4XDXA 1CM9A 2L11A 2SDFA 2KOLA 4LMQD 4R8IA 1IKLA 4IUTA 1IKMA 2X69A 2B2YC 1HHVA 2N88A 2IL8A 1WD1A 4IUPA 2FMMA 4MN3A 2H1EA 4ZKBB 1AZPA 3TN2A 4X3KA 3SVMA 1QE6A 1PFBA 3I8ZA 1DOKA 1MI2A 1WTXA 1U4LA 1TVXA 1BNZA 1G91A 1U4MA 3P7JA 2K05A 1EIHA 2MGSA 3G7LA 3KBXA 1DOLA 4X3UA 1PLFA 2K1BA 2M2LA 1WTRA 1CA6A 1EOTA 2J7ZA 1BO0A 1XX8A 2BDNA 1C8CA 1QG7A 1NR4A 2K28A 1RTOA 2VXWA 4RWSC 1JE4A 5D65A 1SSOA 1U4PA 1B53A 4U68A 5AFWA 4XT3B 4CJ2C 3ONAB 2KVMA 1O80A 1F9SA 3I90A 2B2TC 1F9PA 1WVLA 2X6GA 1DONA 2FHTA 1WTPA 2L1BA 2XIWA 5EPLA 2N55A 2FJ2A 5E4XA 4DN4M 1AP0A 2KECA 4R9WA 1CA5A 5CORA 5EPJA 3FPUB 1RJTA 3FDTA 2HCCA 2RSOA 5T1GA 4HEDA 1GUWA 1KNAA 2CVRA 2B2UA 1IL8A 4IUVA 5JJZA 4IUUA 5EPKA 1J9OA 2B2VA 4OIJA 1PFMA 2L12A 4XT1B 2DY8A 1ICWA 3MWYW 5EJWA 1HFNA 1B2TA 1X3PA 1DZ1A 3I91A 1A15A 1ML0D 3GV6A 1F2LA 4HCSA 1G2TA 1LV9A 1KNEA 1X3QA 2L9HA 4NW2A 4OIKA 1B3AA 2EOTA 5CBEE 2EPBA 2K01A 3HP3A 3N52A 3GV3A 4RAUC 1MSHA 2JYOA 2KEEA 1VMCA 4HAEA 5CMDA 4QUFA 1NAPA 2B2YA 2Q8RE 1WTWA 2HDLA 3LWEA 1HUMA 1B4OA 5DNFA 1NR2A 3IL8A 1WTVA 5T1IA 2KEDA 2HCIA 1MGSA 2K04A 3KUPA 1XYIA 1MSGA 2FFKB 2B2WC 2MPMA 2RA4A 1VMPA 1Q3LA 4ZAIA 1G2SA 3IFDA 1ESRA 3DEPA 1J8IA 1SAPA 2L4NA 1O7ZA 4ZKCB 4ZLTF 4UAIA 3UI2A 3H91A 4IUQA 1HRJA 4HSVA 5COYA 4IURA 2EE1A 4ZK9B 1EL0A 1EQTA 5EKIA 1ILQA 1F9QA 2K03A 1O7YA 2RVLA 1WD0A 1RODA 1HUNA 2KUMA 2NWGA 3F2UA 1BBXC 1F9RA 2B2TA 4CJ1B 1E0BA 2JP1A 3D6WA 1PDQA 1PFNA 3DM1A 5D14A 1WTQA 2RSNA 1QNKA 4MHEA 1S4ZA 1HFGA 1BF4A 2DY7A 1ZXTA 4X3SA 2B2WA 4X3TA 1X32A 3MTSA 1EIGA 2D9UA 1U4RA 4O42A 1G6ZA 1B50A 4RA8A 2FINB 4QUCA 2NZ1D 3R93A 2B2UC 2MJ8A 2NYZD 3QO2A 2B2VC 1JICA 1ILPA 2HDMA 1SDFA 1HA6A 2X6LA 2MP1A 2Q8TA
chains in the Genus database with same CATH superfamily
3HOXH 1MJCA 4IN3A 1VQ8A 4XDXA 3GTMH 1CM9A 1KL9A 3I70A 3CXCA 1HHVA 4K2KA 3F2CA 3T16A 1STYA 5DM63 4PMCA 3AQQA 4HJAA 1A8VA 4X3UA 3TMEA 3H6MA 1UUPA 3T1HL 3HKZE 5D65A 2VXWA 3S9WA 4DPGA 1VQ5A 4LF9Q 1B53A 2F0OA 4X65Q 1KRTA 2UUCQ 1PA6A 3D8GA 1VQHA 1TWFH 4A3BB 2XIWA 4AYBB 5M5XB 4DN4M 1ESFA 4NXML 4R9WA 1HZBA 1G6PA 5EGTA 4A3IB 1TXYA 2OTLA 1I6HB 5KGUA 3V2TA 2K52A 3RD4A 2WB1B 4DR5Q 2L12A 2CQAA 2SOBA 1JWUD 5EJWA 1VQBA 3R2IA 5CV8A 1SMYC 2NN6H 4PZ7A 1KNEA 1PTOH 5BR8L 2BE5C 4LFAL 3S1QB 4N8FA 1BCPB 1K8AC 2BA0A 4KMUC 1K0SA 3M9BA 1S5ED 1WJJA 5HY6A 2LKVA 5C3EB 1Y1VB 5DNFA 1AFPA 2Z6BA 5C4XH 4KJOA 1TWAB 3QIAA 1BCPD 3KLRA 4DAYB 2E2IB 1K3BC 2F4VL 3RZDB 3NEMA 5LL6S 3UI2A 3VA7A 1I4RA 1N8RC 3T1HQ 4IQZA 3K7AH 5DLQE 3H3VI 3RN5A 5EKIA 4OGQC 4CKEA 5J39A 2ZJQA 1WD0A 3E6ZX 1TWCB 2RSNA 2YU9H 4NXMQ 3KYHC 4IALA 4X3SA 2PNRC 4FVMA 3T13A 1N36Q 5IT9c 4QL5A 2E76C 1VQCA 2DN8A 3QO2A 1JICA 4P2CB 2K7VA 1D2BA 4DU9A 5IY0A 2LMCB 3ICEA 5CBAE 5E4WC 4GOPB 2C35B 2HUGA 1HA5A 2R7DA 5BR8Q 4KJNA 1T9HA 4LFAQ 4OO1I 1A3UA 5M5XH 3MFGA 2A5HA 2QILA 4NKLA 1QVCA 4A3IH 2MO1A 3CQZB 4IUPA 1I6HH 1BUVT 1KDBA 2BCOA 2Z6KA 4IUNA 1VQGA 3H3VC 1GUTA 1U4LA 2ASBA 1YNND 2F4VQ 4BY7G 1EQVA 2B63G 1HTPA 3KF8B 1PLFA 4MZ9A 4CDEC 1A2UA 3CPFA 1WTRA 1DYQA 1CKNA 4RWSC 1IBML 1KLGD 2OTJA 4NXNQ 2XNAC 3NTKA 1QUQB 2KVMA 1E24A 1EYCA 3NBIA 1PH3A 1VF7A 4H13C 4G7HC 4JBJA 3AMUA 5C44G 2WP8J 3IFTA 4EVOA 3E9HA 2K5DA 5I9OA 1U0LA 3RZDH 3JAML 4A76A 4WJ3M 1SROA 2Q2HA 4ILWA 4C3IG 1T5EA 1DXMA 1F2YA 3PIOA 3RR5A 4KKUA 4G57A 4HCSA 5E7NA 5JVG3 3BG3A 4U673 2JK8A 4OWWB 5IGEA 3ULLA 4E6IA 1Z47A 5LMNQ 2AWOA 1S5BD 5CMDA 3P1HA 1TWCH 1Q12A 5JJLA 1SYDA 3MC0B 4GN5A 3U9OA 3MEHA 3J7AV 3ULJA 4A3BG 1PZJD 4AYBG 4HMIA 3TZUA 2MPMA 1MHWC 2HIVA 2NZOA 3AB9A 2K5WA 1VMPA 4JCVE 2UU9L 4DK1A 3HGBA 4OEMB 3M85A 4BBSB 2L4NA 4ZLTF 4K0KL 1Z9FA 4QJFA 5CGKA 1E1OA 4UP8A 2PZUA 1OXSC 3G4SA 4XIGS 1NUCA 1STNA 2MO0A 2A68D 5GAGC 4FXDA 4PZ6A 3CQZH 5C0XI 1K8GA 3NHHA 3CMEA 3EROA 5DEHA 5C3EG 4QMGA 2KENA 2Q8IB 4JI7L 5M3MG 2R7ZB 2G9HD 1Y8OB 4J6HA 1A3VA 1WOCA 4JI0L 1NCVA 3D3RA 2IX1A 4R1JA 2JA8G 3H09A 1RHPA 2PZWA 3ERQA 4JPBW 2ENBA 4L5QA 1ENCA 2EJMA 2KOLA 3RZOB 4IUTA 3G6JB 1JOKA 1SE4A 2F0PA 3G71A 1UEAB 3HEJA 3S14H 4HTHA 4B9XA 2I5LX 2IL8A 4DV7Q 1WD1A 1VS0A 4LFBL 1VQ6A 5J22A 2K5HA 2K4KA 3M4QA 4A75A 3U58A 2PQEA 1U4MA 2UU9Q 3P7JA 2PCFB 3MXNA 1TY2A 4YWKA 2QEJC 4K0KQ 3T4AC 3S1RB 3OHXC 3I4OA 1VF5C 2F0NA 1MKHA 1AE3A 4HIMA 3PF4A 2ZTEA 2GVAA 2R7FA 1F9SA 1JB7A 1PYWD 3T56B 1AH9A 5GROA 2WV6D 3LX0A 2A6HC 2EY5A 3J81L 1LACA 3P20A 1L1OA 4KTAA 4BBSH 3M4PA 4JI6Q 4A3EH 4IFDH 2JE6I 3OMGA 4ULLA 1LTRD 5CV4A 5IP9H 4JI0Q 1QVFA 4F7XA 1ML0D 1A2TA 3Q22A 1G2TA 4HJ9A 1Y8PB 1X3QA 3MXUA 1BQQT 4Y52H 5M5YB 3E0EA 4OXPA 1CKMA 4AYBE 5FO9B 5FKAC 1X65A 3T1YL 3CU7A 2SNMA 3BJUA 2CWPA 5TSSA 5KNBA 1YZ6A 2P5ZX 5GADC 1NR2A 4JI5L 1SR3A 5FLMH 2F0WA 2DNCA 1CZGA 1YEZA 3K6OA 4H7BA 4UY8C 1HQMC 2K5NA 4IURA 4ZK9B 1O7IA 5JVH3 1O7YA 2MQHA 3MAQA 1BBXC 2EYJA 1PDQA 1LTID 1H9SA 1ZYRC 4FDBA 1PH7A 5K5PA 5KNCA 1Q90A 4DV5L 2IX3A 1B50A 5ELNA 3A7AB 1Y1WB 3L9AX 2ZJPA 1EIYB 4YWMA 4LF8L 1VQEA 4DXGA 5JPMC 4RMFA 5D3IB 2R3ZA 4RH6A 5I6YA 4OX9L 5IGDA 5IOCA 2L11A 4K8IA 3S16B 4C3HH 2E2HB 4M8AA 1N33Q 2A6EC 4DV6L 4JI5Q 1X3EA 4BWGB 1BNZA 2CW0C 2LXKA 1DOLA 1N32L 4DR7L 1XX8A 4GKKQ 1SNPA 2OT2A 3V96A 4U68A 4ID6A 1NSNS 2PQAA 5ELOA 1M4VA 4A4IA 1VQFA 4DAYA 3NK9A 4XQQA 3JAMc 1SRUA 2R92B 1H9JA 3L0OA 2F3IA 3PV0A 4O0AA 1PHJA 1E2VA 4LF7Q 3IRBA 5BN3A 2HCCA 4DV5Q 1SXTA 3HOVH 2VL6A 4A3CH 3KLSA 5E3FA 1IL8A 1S3OA 1DGSA 4P71A 2CHBD 4YWLA 4J1MA 4GKJL 1BKBA 1X3GA 2DY8A 2D2CC 1MIUA 1UE1A 4LF8Q 5IGCA 1F2LA 4R4OA 3GV3A 2JYOA 3E5SA 1KTKA 1ZYRD 5FLXc 1RKNA 5J1ZA 5HGQA 4K6DA 3PO2G 1TS4A 4A93B 4FXGC 4DV6Q 1SYBA 1Q82C 1MGSA 4GOPA 1Y1WH 4FP5D 2R93G 2PI2A 2XTIA 5JEAJ 5JEAG 4DUZQ 3KDFB 4F8MA 2EJGC 4DR7Q 3MEFA 3EFXD 2DNEA 4R4QA 1EQTA 1B44D 3DWQA 3A74A 4MIUA 2D0PA 1HNWL 1EYGA 4IJLA 5C4ZA 4B3TL 3S16H 1MJEA 3SXHA 2E2HH 3KF8A 1EY8A 1KAWA 2KCMA 5C3XA 4BXXG 2CW0D 3CAMA 2RF4A 3GP7A 1ICFB 3GTPB 4GNXC 2BH2A 4BS9A 1QUQA 2CH4W 3I55A 4GKJQ 3C2PA 2ZXOA 1ILPA 1JJ2A 4IPGA 3OIPA 5EQ0A 1QZGA 1YBYA 2OWOA 1QVGA 2A1AA 5IYCH 4LJZC 4ZUJA 2B2YC 1SNCA 5C0XG 4RHSA 5ELEA 3FKIB 2XVSA 4LAAA 4X3KA 1TY0A 3HS0C 1MI2A 2RQXA 3FVQA 3MVVA 4EQNA 1Q1BA 2M2LA 1E2ZA 3K59A 1J6QA 1DM0B 1RTOA 1ZKOA 1DD2A 1U4PA 1EQRA 1HNXL 3J81c 1B70B 1VDZA 3D6CA 3JAMi 1W6KA 3QJYA 1HNWQ 4B3TQ 3PF5A 2EYPA 3I90A 3TRZA 1BCPF 3U4ZA 1WVLA 2MUYA 2XRQD 4A93H 2FJ2A 1PMRA 1PVOA 4GS3A 1NY4A 2LFNA 1XNRL 4R8NA 5FJ8G 2JA7G 3FEWX 5IGGA 1KRSA 3SK6A 4WFN3 1IYUA 3CHBD 1LT5D 3J7A5 1YHQA 3VR3A 1QILA 4LUOA 1PFMA 4HJ7A 2JXMB 2WKCA 2Z4HA 1STAA 1EWIA 4YHHL 4DV2Q 2F0UA 4GZYC 1I4QA 1S5CD 4NW2A 1B3AA 1TS2A 3NTHA 1Q81C 4JYAL 4RGOS 1H9RA 1EY9A 1EFWA 4Y7NH 2R61A 2R92G 3K58A 1WFQA 2L15A 3GTPH 3EBEA 3HOYG 1HQRD 1C7YA 1D5ZC 1PTOC 3I56A 1G2SA 1JWSD 4X66Q 3HOZG 2OCEA 2RHSB 3PO3G 1TIID 2Q2TA 3I2ZA 4HJ5A 4LF5Q 2A69C 1EY4A 1RODA 2KUMA 1QWYA 4DK3C 1FL0A 2DJGC 1B9MA 4RCNA 5ELFA 3LGJA 4HIKA 4DR1Q 1VQLA 1ZXTA 1XNRQ 1V1OA 1XJVA 4NDXA 1KDCA 4RA8A 4X64L 2NZ1D 3SGIA 1IHZA 4R4CA 4DUYQ 1YNXA 1PRTB 4YHHQ 2YTVA 1JOOA 1HXYD 3T53B 2VB2X 1KABA 1HTLD 1SE8A 2XGTA 3E9IA 3I3CA 2VY3A 1XPRA 1D5MC 3RLNA 4JYAQ 2MNAA 2KCCA 1HH2P 4LMQD 4CHTB 1PRTD 4O1NA 1GJXA 2PZTA 4KKTA 2M00A 4RG1A 1LTTD 5JAVA 4QQBX 3Q8DA 3O13A 4BY7B 2B63B 3S17B 1FR3A 2AHOB 4H44C 1DCZA 4XQNA 1X56A 1CHQD 2K28A 3J81i 1YI2A 4A3FG 4DKAC 2H5XA 4LF4L 3K0XA 4DAVA 3ND8A 2F3WA 3I4NG 5C44B 2Y0SB 1V9PA 4CKBA 3FKIG 4X64Q 2F0DA 2KJXA 1JORA 1PYBA 5EPKA 5EBCA 4C3IB 5G3LD 2EIFA 1WTHA 2R6GA 3M4OH 3EIVA 4LNQA 5EKLA 2BH8A 4OIKA 2IX0A 2L9HA 2NVQB 2O5JC 3CMAA 2VQFL 4H0LC 1ZEQX 4DNIA 1EZ8A 1ET6A 1SYCA 4AH6A 1A6XA 2PMZB 2KEDA 3KBGA 4J8QA 3TBIB 2B2WC 1JR0D 3W3AA 1VQ7A 2F0JA 3S2HH 3H15A 2EY6A 2OQKA 4XQJA 1L0WA 3GTGH 3WOEA 4KY7A 4JG2A 4MNOA 2K03A 2IY5B 4JBKA 1JMCA 4LF4Q 3S1MB 4IPCA 1HPCA 4NB3A 4EQ5A 3HOUG 2JP1A 3C3LA 4MHEA 1BF4A 3K7UC 1I5FA 3BZKA 4KY5A 2B63H 3S17H 5M3MB 2F0LA 3OOCA 3QOJA 4R4IA 5A2QE 1X3FA 1F2MA 2GVBA 4HIDA 1ONLA 1SDFA 1TT2A 5D3DA 2JA8B 3AU7A 1NNXA 2N3SA 4APVA 1YHAA 3K0YA 3A55A 1TS5A 1KIXA 4S3SA 2IHFA 4WRDA 4C2MB 2F0FA 4JI4L 2FMMA 1FNUA 3CCUA 3I8ZA 4RGMA 4ALPA 2N78A 4C3IH 2FXQA 3H94A 3G7LA 3S15B 2VW9A 1EOTA 1VQAA 2ZM6L 4L5SA 1W6JA 3QR8A 4G4KA 1VQMA 2CH4A 2ICIA 3J7YW 4CKCA 5IYDG 4A3BH 3OTOL 1K0RA 2FHTA 5IYBG 1UEBA 4JOIC 3FRPB 3W2DA 2RSOA 4IOCA 2B2UA 2JEBI 3Q24A 1SYFA 2QA4A 2PO4A 4LFCL 1K73C 3UE1A 1SMYD 1LYLA 1DZ1A 3I91A 3BDCA 2BE5D 3TS0A 4BY1G 5IIFA 5CBEE 1XMOL 3S1QH 2KEEA 1JCKB 1TKWB 2NVTB 3CCQA 2LXJA 2RBMA 5C3EH 1GD7A 3OW7A 1Y1VH 1IL2A 3FPPA 4KV6A 4JI4Q 3SEBA 4FNFA 5M3MH 4OWTB 1WTVA 1TWAH 2E2IH 2Y0SG 2F0EA 2EZVA 4WJ4A 3DWPA 4OELB 2JA5B 1EFID 2PW5A 4DR3L 2JA8H 2ZM6Q 4HSVA 3CCJA 4L5TA 4A3LH 5IODA 3VDYA 1FYCA 4K14A 4A3GG 3OTOQ 3TEHB 3DM1A 2CWAA 3RNUA 1X55A 1I6VC 1X32A 2N8NA 1TQOA 1B7YB 3S15H 3QB3A 3CC2A 5FLXL 3CCSA 2ZXRA 2Q8TA 4LUZA 3QWNA 3I4LA 1D1IA 1U5KA 2Z4IA 4HR7B 1IBMQ 3GTQB 2E2DC 2EYOA 1CZWA 2OEOA 3D0FA 4JBMA 2LS01 1RF2D 5K36G 1BR9A 3VYSA 2MHVA 4A3JG 2F0MA 2UUAL 1X54A 4UP9A 3R2TA 1VQPA 1IBKL 3SVMA 4B3ML 3QOLA 1I50B 1TVXA 1CQVA 4K5XA 2HQEA 1NBWA 5CV6A 1XPUA 2YTXA 3NELA 1K28A 4YCWA 4DR3Q 1TWHB 2ZTDA 2J7ZA 3CD6A 3BS1A 1JE4A 3KLWA 1GVPA 4PG3A 3ONAB 2NVTH 3D31A 1A3TA 1V43A 1O80A 1YNJC 4CDDC 2D0OA 2K33A 1DONA 1SMXA 1EQQA 2Z9HA 5KRUA 5CV7A 1VQKA 4JI2L 3CPWA 2VS1A 5CC4A 1KNAA 4IUVA 2B2VA 4IZ8A 1EZ6A 5NUCA 2I5HA 1GM5A 1S5DD 2WAQB 2EJFC 3K8AA 4ZCKA 2Y0SE 4MTNA 3V05A 1VQ9A 4OWXB 3KLSX 3TDQA 2Q8RE 3PO2B 2AUKA 4BBRB 2UUAQ 2KHIA 1HUMA 1IBKQ 3NP8A 4F88A 2O5IC 1H95A 2DGYA 4PMWA 2R93B 4JV5L 4LW1A 4JI7Q 2CKZB 2K32A 4ME5A 3H91A 2PNHA 3H3VH 5COYA 4L5RC 4DXFA 1Q46A 2SEBD 4ZUIA 1SNDA 2HT1A 5LHY1 2NWGA 5J3BA 3WOFA 2B2TA 2PMZE 3I4MG 1H9MA 2K6AA 4FF4A 2DY7A 4JI2Q 2RDGA 3NE5B 1BDOA 1LTBD 3MTSA 3J80E 4LFBQ 5CV9A 3OMCA 2R7ZH 2A74C 1JC7A 3HOWB 2ICEC 4ZAIA 5IGBA 2JA5G 1EYDA 1VQDA 3A5ZB 1RTNA 3P75A 2NTSA 1YNJD 4OO1H 4CJ0B 5A35A 2DJFC 4FF3A 3RZOH 3GDEA 4R8IA 2GA4B 1BBWA 5F2DA 5LMUL 1XNQL 1EIFA 4CDFC 2VUMG 2H1EA 3TN2A 3D4DA 1DOKA 1LTSD 3A5UA 1WTXA 2N49A 1G91A 3A7LA 4K2LA 2BDOA 3S1RH 1NR4A 3TQYA 2AQ2B 1SSOA 3MZ5A 2JQOA 1CI3M 1JWMD 2F4IA 1X6OA 5I6WA 3T1YQ 4QIWB 4IPDA 2A6HD 1F9PA 1Q86C 2X6GA 1WTPA 1YITA 1TS3A 1UNSA 3WWVA 3CP0A 2JA7B 2R93H 2AMCB 1C9OA 3RN2A 3ULPA 4O2DA 5T1GA 4POFA 3MXGA 5JEAH 4LK1C 1CFMA 4G7OC 1GUSA 3PCOB 1KXLA 5IP9G 5M5YH 2EPBA 3N52A 4M1UB 4I7ZC 2F3VA 1H9KA 3HOYB 5LMUQ 1XNQQ 1PYSB 2JA6G 1E7ZA 2D5DA 2Z6KC 1SFOB 1F2ZA 1UAPA 3VYRA 3HOZB 3PO3B 1ESRA 3K81C 4DGZA 2WKDA 1ASYA 1O7ZA 1K3RA 3W5OA 5ELBA 4K6LA 2EYMA 1PRTF 4IO9A 3EN2A 1ENFA 2A8VA 1LTLA 4OX9Q 2G5DA 1F9RA 3S2DB 2JSOA 2WAQG 5FOBB 3BZDB 3KOJA 4TKOB 1EY5A 1S4ZA 2MFIA 1HFGA 3EJIA 2EXDA 3K5MA 2I07B 2B2WA 4JI8L 4BBRG 2FINB 1LTGD 1C0AA 4P72A 1G51A 4G7ZC 1N32Q 1WTOA 3AYHB 1B3QA 1N34L 2BA1A 1SN8A 5FJ8H 2A6ED 2JA7H 3FP9A 1MD2D 4ZYSA 3ZJYC 5G3LF 3OWEB 1PH2A 3SK4A 1XMQL 4CDCC 1EY0A 4C3HG 2E74C 2SNSA 1HR0W 1RDPD 3BDLA 2NZHA 4OONA 1RCVD 4A3DG 2K14A 2K1BA 2F03A 2F0GA 4MTKA 4A3FB 2BDNA 1C8CA 3HOWG 4JC0A 4ODGA 3B6YA 1JT8A 4XT3B 4LF6L 1LO5D 1HNZL 1FJGL 4L63B 2R92H 1M90C 2J4XA 2O4XA 3KJOA 3HOYH 3I4NB 4DF7A 5C0XJ 1M1KC 1V8QA 1CA5A 1RJTA 2TMPA 4JI8Q 1B9NA 2H4OA 1T5XD 3HOZH 4GLAC 5FO8B 2L55A 3NWTA 5JJZA 4B3SL 3HOVG 3W1GA 2I46A 1ICWA 1X3PA 4X62L 3RUZA 2M9VA 1PH9A 4OL7A 2OF1A 4GLVB 2NN6I 1N34Q 1MSHA 3S2DH 4HAEA 1PZID 3F1ZA 3BU2A 4A3KG 1STBA 3IL8A 2ES2A 1V1QA 3L7ZC 3URYA 3CKIB 3NBHB 1XPOA 3UDXA 1S72A 3X3NA 4XYOA 1J8IA 1I4XA 2WAQE 4DV0L 1K9MC 1Z7TA 1TR5A 4ME3A 4N9TA 1I4PA 4GNXB 1GKHA 4LF6Q 1ILQA 1F9QA 3RLFA 2Q2IA 4B08A 1HUNA 3HOUB 1EYAA 5KIXA 2YV5A 5JOBA 1D5XC 5AJ3L 1A0IA 1RD9D 2JN4A 3DHQA 4V0BA 3CCRA 1CUKA 3AFQA 1PH6A 4X3TA 5HGTA 4LWCA 2E2JB 2EY1A 2F0IA 1IXRA 1FGBD 4B3SQ 4JW0A 3F2BA 3SK5A 1IW7C 1GUOA 3N6RA 4JBWA 2Q2UA 1EL0A 1OXVA 3H0GG 2K5VA 4C3JB 3EQLC 3HOXB 1HNXQ 3L2PA 2K75A 2F0KA 3VR5A 1II3A 3I4NH 3TS2A 2AQ1B 3HKZG 5KYIA 2SDFA 1IKLA 2QKIC 4B3RL 5FO7B 2UXBL 3HG9A 3FKIH 4PNYA 1NTGA 1PFBA 2KBNA 4DA2A 4DR2L 2K05A 1EIHA 1NJIC 1CA6A 3E3XA 4KHZA 4BA1I 5IP7G 3U4VA 2NUCA 5M3FG 4AQYL 3GTLB 4HCEA 3GQBA 5ISRA 3K5OA 3MXNB 4YY3L 3G6EA 5DM73 4DR6L 5AJ3Q 5I2XA 2Z0SA 2HQLA 2N55A 5E4XA 1LLRD 2RKSA 1PH8A 2HIXA 1C4QA 3OSOA 4HEDA 1GUWA 3VYUA 1ASZA 1XTCD 2F0SA 5IWAL 4C1NI 1HJPA 3UDIA 1HFNA 4BY1B 4LF9L 4OHJA 4QCLA 4JK1C 2ZJRA 3SDZA 4QIWE 5C5MA 1PTOB 3HOUH 2K01A 3HP3A 2IJ0A 2EVBA 3NWSA 3EA6A 4FF1A 3OIQA 3PGZA 2UXBQ 1WTWA 3KF6B 3WDNA 2E2JH 1PTOD 1BBUA 3CW2C 1OXUA 4DR2Q 2WIIB 1YHBA 3OYYA 5C3WA 4WORA 4DR5L 5C6AA 1VQJA 1SAPA 1IBLL 3RLOA 3C1EA 3J80L 2IHEA 1CTMA 2A69D 4Q0FA 5IE8A 4AQYQ 3PUXA 1FVIA 3CRLC 2EE1A 5KNDA 2E75C 3K7AB 4YY3Q 1SEBD 2WINB 4DR6Q 4A3GB 4FXKC 3D6WA 4XXEA 2I5MX 4UP7A 4WJWA 1OO9B 2YU9B 5CR3A 1SLJA 4O42A 2Z8LA 3UE0A 5IWAQ 1CSPA 3DUZA 1H9SB 2HDMA 2ZXPA 3GTLH 1QJOA 2AQ3B 5E1FA 1WCMG 1FGUA 3TZDA 4RKLA 3VR4A 1AZQA 3Q6SA 4IPHA 5IYDH 3KJPA 4X6AH 1U9RA 2A19A 5IYBH 2ZT9C 4A3JB 2F52A 1HZCA 2X69A 2B8GA 2VZAA 1E22A 1N36L 3TP7A 3TREA 3PIP3 4A3MG 1AZPA 1QE6A 2K50A 5H1SE 4BY7H 3U9SA 4GOPC 2OXPA 2CCZA 2XWBB 3A54A 4F87A 1IBLQ 5IGFA 4BY1H 3M3YB 1YNNC 1RL2A 3NPPA 3GTOB 4RGNA 1FD7D 4IJHA 4C3JG 5DAUA 1I4GA 3HOXG 1KHIA 3BYTB 3UDFA 3KK7A 1GXDC 4EX5A 2VQFQ 5C44H 2L1BA 2KHJA 3L3OC 3TP5A 3PMFA 2PQAB 3NQIA 1BOSA 1QNUA 3OPOA 4FF2A 1KQSA 4IFDI 3NXWA 4PMBA 1GHKA 2JJQA 1OTCA 2NVQH 4NXNL 4A3GH 1EU3A 3F8TA 4KHVA 4RAUC 3K57A 1CK1A 2QF7A 1Q7YC 1DJRD 2CFMA 1SNQA 2HDLA 2RCFA 3LWEA 1UE7A 3KDFA 4N9PA 1Y69U 1FNWA 1EWHA 2WACA 4HIOA 1EOVA 1L0YB 1Q3LA 4C1NK 1GHJA 3DM3A 3DEPA 1SBBB 3STBC 4DV3L 3DXJC 4ZKCB 3S1NB 3A8JE 4UAIA 2B29A 2E8GA 2V1CC 1WYDA 4ZRZA 4DNRB 1YJNA 4ZQ3A 4GN4B 4HSPA 5LMNL 5C5LA 5K36H 3S1MH 1NMFA 4A3JH 1PXUA 3F2UA 4P73A 3KFUA 2NN6G 1K8OA 3I4MB 1E0BA 4GN3B 1S5FD 2PYKA 2V4DA 2DUDA 2A68C 4HMJA 1U4RA 1CT1D 3BVGA 1PH1A 3M3YH 1K8MA 5C4XG 3GTOH 3ZYYX 4CJ1B 1A63A 1GOZA 1IYVA 2QDLA 4QY7A 2QEXA 3HRZC 3DLLA 2AKWB 4POGA 2JA9A 3K5NA 4JI3L 4C2MH 4TQUS 1AE2A 2VUMB 5CV5A 3S14B 1EWCA 4ZKBB 1STGA 3PSIA 3GTJB 2B39A 4KHPL 2KQ3A 5IT9E 1C48A 1GUGA 4DV3Q 4JI1L 4LFCQ 3A56A 4NPSA 2G9DA 1AW7A 3VYTA 3FHWA 2VQEL 3CC7A 1R9TB 2ZTCA 1XMOQ 3NBHA 1E3PA 1PH5A 5LMNW 2F0HA 2J0TD 1E1TA 4DV7L 2LSSA 3CCEA 1JE5A 1Y8NB 4K5WA 3STBD 2JEAI 4KK7A 4A3IG 4GNXA 3TP8A 2AWNA 3S1NH 4A3EB 3E0JA 4QF4A 4XT1B 2WB1G 4NP5A 3QG1A 1O7LA 2F0QA 3NTIA 4IOAA 1LV9A 5M5WB 3TP6A 1LUZA 3I4MH 4TVAB 3AEVA 1FNVA 4DK6C 1B1ZA 4JI3Q 1NE3A 3U50C 1W3SA 2A73B 2B2YA 5JPNC 2JA6B 1KD1C 3J80c 4RHRA 1Y1VG 5T1IA 3KUPA 2K04A 3C1FA 1S40A 4KHPQ 2RA4A 3SE0A 2KA7A 2E5LL 4JI6L 2JA5H 1LABA 4JI1Q 3HFZB 2VQEQ 2CQOA 3CC4A 2C9OA 2F1MA 4A3LG 1KAAA 2IT1A 1ENAA 2VUMH 2EDGA 1QNKA 3IKJA 3GTJH 4P75A 2B3GA 1SYGA 5L37A 1W2BA 1SE2A 1CSQA 3G48A 3GTKB 4B3MQ 3CF5A 1JOQA 2UXCL 3DWAA 1I4HA 3IAYA 2XN9C 1R9TH 4DR4L 1DOMA 3GTQH 1Q8IA 3RMHA 4V190 4NMZA 2IPKD 1P8LA 1V1PB 4EQPA 5C4JB 1NMGA 4C3HB 2N88A 1XWEA 4MN3A 4L8JA 1I50H 2YYZA 2E5LQ 3CCLA 4EQOA 3PIO3 4A3DB 2QW7A 3F2DA 1PZKD 1TWHH 1QB5D 4B9WA 3KF6A 2QGQA 5M5WH 3BDOA 3BVMA 1SYEA 1UWVA 4CJ2C 1VQ4A 2ID0A 1BXTA 4Z9CB 4DV4L 3MHBA 3NUCA 2JA6H 2XSCA 5KEEA 1N33L 2KECA 1RIPA 3DMUA 5CORA 5EPJA 2WB1E 2EYHA 4JVZA 4J15A 3HOVB 4IUUA 4DAPA 4JV5Q 2UXCQ 3NSWA 4OIJA 3SHLA 3MWYW 4GKKL 1B2TA 4DR4Q 1A15A 3AFPA 4P74A 2VNUD 3LNNA 3OW2A 5JJKA 5CYUA 2RCNA 1LT3D 2EY2A 1JQYD 1I94L 1L2FA 3I72A 5I4DA 3NENA 2QDBA 1NAPA 3PO2H 4BBRH 3J80i 4LF7L 4A3KB 3BZCA 5C4HA 1B4OA 3GTKH 3S24A 2HCIA 1UE5A 1XYIA 5EKKA 5I9PA 4C56C 1EEID 1UE6A 4IFDJ 4BBSG 1O78A 1N9WA 1Z6HA 4A3EG 1HRJA 4IFDG 4LUVA 1D1KA 4QB4A 3TSSA 1QZHA 4UDUC 4BA2I 4DV4Q 1LT6D 2L5TA 4K5VA 4BXXH 1Y14B 1BVSA 5C4JH 1WTQA 1R4QB 5ELCA 1QCBD 4A3DH 3VA5A 1HR0L 2D9UA 3K5LA 4TSSA 2B2UC 4DV1L 2MJ8A 2NYZD 4PZ8A 3HOWH 4DUZL 5FLMG 3H0GB 5LL6X 2R7ZG 3MXPA 2PI2E 2X6LA 1EU4A 1ET9A 2HD3A 3M7NA 3DEOA 5GQOA 5A2QL 1VCIA 3HKZB 1E2WA 4KY6A 1I94Q 4OO1G 4KN4C 2L0CA 3Q0AA 4UPAA 5M9OA 2K5QA 4AIMA 5C0XH 3GO5A 1D6EC 2VB3X 3NQTA 4YCVA 3MA2B 1WI5A 1STEA 2EYFA 3I7FA 1HA6A 3A8IE 3KBXA 1HZAA 2RHQB 4XTCS 5M3FB 2PPBC 2UXDL 1HZ9A 3EVQA 1Q8KA 4DFAA 1PV4A 1JB3A 1SJED 2B8FA 1OXXK 1PTOF 3M7GA 4A3KH 2EYLA 1KC8C 3D4RA 3ITPA 1SNMA 3ER0A 4N8X1 3FDTA 3K80C 1HR0Q 2CVRA 3CCVA 1TU2B 4DV1Q 2LY7A 1LT4D 2NTTA 2KHSA 1STHA 3PUZA 2XWJB 1SNOA 3GV6A 3R8BA 1D8LA 3W1BA 3OWFA 2UUBL 2EOTA 3SR1A 1GO3E 2NBFA 1VMCA 2C5CA 2EQSA 1VQNA 5JJIA 3JAME 1CKNB 4Y7NB 4DNTB 1K83B 4RCOA 4I7AA 1SFOH 2GN5A 3A0JA 5EBDA 5BN5A 3MFYA 3PUVA 1CQFA 3PO3H 1HCZA 1PFSA 3PUWA 3H0GH 3IFDA 3X3MA 1EEFD 1GUNA 4RGTA 2ATWA 4A3CG 2NVYB 2UXDQ 4IUQA 4DV2L 4UHVA 1YJWA 1L0XB 2TSSA 3VR6A 4EGVA 3UDGA 1JJGA 1OXTA 1JJCB 3ERSX 4FYDA 2NVXB 2RVLA 2QCPX 2IWHA 4K8JA 2I0QA 3ND9A 4DK0A 3R3OA 5GAEC 1A62A 3PUYA 1F77A 1PFNA 5D14A 5FLXE 3J81j 3D4WA 3GD7A 2PW7A 1AEXA 2EXZA 4JOIA 1XMQQ 1B8AA 1LTAD 1VQOA 3PQIA 4H02A 4X66L 5IP7H 5M3FH 2IW3A 4FO2A 4HN7A 2B2VC 1SJHD 1Y1WG 1Q1EA 2MP1A 1WCMB 2KCTA 4LF5L 5IT9L 4PQXA 2HHHL 2UUBQ 1M8AA 1R4PB 2XRSD 2Z1CA 4ABNA 3Q23A 1G8ZD 1HNZQ 1FJGQ 1J5EL 4GLXA 3CRKC 1IKMA 1I3QB 4DR1L 1YIJA 4DAMA 4A3MB 1PRTC 3BYYB 3JC66 2RDFA 1SE3A 3BVZA 1L1OC 2MGSA 3I73A 1P16A 4Q5VA 4DUYL 2WFWA 1TWGB 4A3FH 1VQIA 5HURA 1BO0A 2F0TA 1CKOA 1QG7A 4X62Q 2BOSA 5AFWA 1EY6A 3J7AF 1EUJA 1KDAA 4KKSA 2ALYB 3GTMB 2B2TC 3FMCA 1AP0A 1K83H 4I65A 5EPLA 4R4TA 5IYCG 1YVCA 3FPUB 2D62A 4KN7C 1QOHA 4YCUA 1XXGA 1MBYA 4TRDA 2NVYH 1J9OA 1IYJB 4CGYB 3PIPA 3HZXA 2KCNA 3M4OB 4HJ8A 1IZ6A 5I2YA 4DV0Q 4L6TB 2HHHQ 2NVXH 2AUJD 4PV1C 4YIJA 3C46A 3J81E 5EAYA 5FK9C 1G291 3CCMA 1X9NA 4QUFA 1YJ9A 1J5EQ 3A8KE 3VR2A 4CBVA 1TWFB 1KLUD 1LM0A 4KI0A 2FMCA 4A93G 1MSGA 2FFKB 2YTYA 5GAHC 3T51B 5KYLA 3J7ZC 3S2HB 1WCMH 4KD4A 2F0VA 5BN4A 2O2LD 1V1PA 4KLKA 3GTGB 3LWUA 4X65L 3HKSA 2UUCL 1L1OB 4RKBA 1XTDA 1I3QH 1D7QA 4KD3A 4A3MH 4B3RQ 5ELDA 1PH4A 1CHPD 1EIGA 1G6ZA 3M4YA 5C4XB 4QUCA 3R93A 1IW7D 4RFBA 2OQ0A 1TWGH 4QGUA 2RDHA 2NB0A 4XYQA 3SK8A 1BCPC 1AN8A 4C3JH 1EY7A
chains in the Genus database with same CATH topology
4IN3A 4XDXA 1CM9A 3I70A 1HHVA 4K2KA 3T16A 1STYA 5DM63 4PMCA 4X3UA 3TMEA 3H6MA 1UUPA 5D65A 2VXWA 3S9WA 1B53A 2F0OA 3D8GA 4A3BB 2XIWA 4AYBB 5M5XB 4DN4M 1ESFA 4R9WA 5EGTA 4A3IB 1I6HB 5KGUA 3V2TA 3RD4A 2WB1B 2L12A 2CQAA 2SOBA 1JWUD 5EJWA 3R2IA 5CV8A 1SMYC 2NN6H 1KNEA 1PTOH 2BE5C 3S1QB 1BCPB 2BA0A 4KMUC 1S5ED 2LKVA 5C3EB 1Y1VB 5DNFA 1AFPA 4KJOA 1TWAB 3QIAA 1BCPD 3KLRA 2E2IB 3RZDB 5LL6S 3UI2A 3VA7A 1I4RA 4IQZA 5EKIA 4OGQC 4CKEA 5J39A 1WD0A 3E6ZX 1TWCB 2RSNA 4IALA 4X3SA 2PNRC 4FVMA 3T13A 2E76C 2DN8A 3QO2A 1JICA 4P2CB 2K7VA 1D2BA 4DU9A 2LMCB 5CBAE 5E4WC 2HUGA 1HA5A 4KJNA 4OO1I 1A3UA 3MFGA 2A5HA 2QILA 4NKLA 3CQZB 4IUPA 1BUVT 1KDBA 2BCOA 4IUNA 3H3VC 1GUTA 1U4LA 1YNND 1EQVA 1HTPA 1PLFA 1WTRA 1A2UA 1DYQA 4RWSC 1KLGD 2XNAC 3NTKA 2KVMA 1EYCA 3NBIA 1VF7A 4H13C 4G7HC 3AMUA 2WP8J 3IFTA 4EVOA 2K5DA 5I9OA 3JAML 4ILWA 4C3IG 1T5EA 1DXMA 1F2YA 4KKUA 4G57A 4HCSA 5JVG3 3BG3A 4U673 5IGEA 4E6IA 1Z47A 2AWOA 1S5BD 5CMDA 3P1HA 1Q12A 1SYDA 3MC0B 3U9OA 3MEHA 3J7AV 1PZJD 4HMIA 3TZUA 2MPMA 3AB9A 2K5WA 1VMPA 4DK1A 3HGBA 3M85A 4BBSB 2L4NA 4ZLTF 5CGKA 2PZUA 1OXSC 4XIGS 1NUCA 1STNA 4FXDA 2A68D 5C0XI 3NHHA 3EROA 5DEHA 4QMGA 2Q8IB 2R7ZB 2G9HD 1Y8OB 4J6HA 1A3VA 1NCVA 3D3RA 2IX1A 3H09A 1RHPA 2PZWA 3ERQA 2ENBA 1ENCA 2EJMA 2KOLA 3RZOB 4IUTA 3G6JB 1JOKA 1SE4A 2F0PA 1UEAB 3HEJA 4HTHA 4B9XA 2IL8A 1WD1A 5J22A 2PQEA 1U4MA 3P7JA 2PCFB 3MXNA 1TY2A 2QEJC 3T4AC 3S1RB 3OHXC 1VF5C 2F0NA 1F9SA 1PYWD 3T56B 2WV6D 3LX0A 2A6HC 2EY5A 3J81L 1LACA 3P20A 4KTAA 4IFDH 2JE6I 3OMGA 4ULLA 1LTRD 5CV4A 4F7XA 1ML0D 1A2TA 3Q22A 1G2TA 1Y8PB 1X3QA 3MXUA 1BQQT 5M5YB 5FO9B 5FKAC 2SNMA 3CU7A 5TSSA 5KNBA 1NR2A 2F0WA 2DNCA 1CZGA 3K6OA 4H7BA 1HQMC 4IURA 4ZK9B 5JVH3 1O7YA 3MAQA 1BBXC 2EYJA 1PDQA 1LTID 1H9SA 1ZYRC 5K5PA 5KNCA 1Q90A 2IX3A 1B50A 3A7AB 1Y1WB 3L9AX 4DXGA 5JPMC 5D3IB 2R3ZA 4RH6A 5I6YA 5IGDA 5IOCA 2L11A 4K8IA 3S16B 2E2HB 4M8AA 2A6EC 4BWGB 1BNZA 2CW0C 1DOLA 1XX8A 1SNPA 2OT2A 3V96A 4U68A 4ID6A 1NSNS 1M4VA 4DAYA 3NK9A 4XQQA 2R92B 1H9JA 3PV0A 1E2VA 5BN3A 2HCCA 1SXTA 3KLSA 5E3FA 1IL8A 2CHBD 4J1MA 2DY8A 2D2CC 5IGCA 1F2LA 3GV3A 2JYOA 3E5SA 1KTKA 1ZYRD 1RKNA 5J1ZA 4K6DA 1TS4A 4A93B 4FXGC 1SYBA 1MGSA 4FP5D 5JEAJ 5JEAG 4F8MA 2EJGC 3EFXD 2DNEA 1EQTA 1B44D 3DWQA 4MIUA 5C4ZA 3SXHA 3KF8A 1EY8A 5C3XA 2CW0D 3GP7A 3GTPB 4BS9A 3C2PA 2ZXOA 1ILPA 3OIPA 5EQ0A 4LJZC 4ZUJA 2B2YC 1SNCA 5C0XG 4RHSA 5ELEA 3FKIB 2XVSA 4LAAA 4X3KA 1TY0A 3HS0C 1MI2A 2RQXA 3FVQA 3MVVA 4EQNA 1Q1BA 2M2LA 1E2ZA 3K59A 1DM0B 1RTOA 1ZKOA 1DD2A 1U4PA 1VDZA 3D6CA 1W6KA 3QJYA 2EYPA 3I90A 1BCPF 1WVLA 2MUYA 2XRQD 2FJ2A 1PMRA 2LFNA 4R8NA 3FEWX 5IGGA 3SK6A 4WFN3 1IYUA 3CHBD 1LT5D 3VR3A 1QILA 1PFMA 2JXMB 2WKCA 2Z4HA 1STAA 2F0UA 4GZYC 1I4QA 1S5CD 4NW2A 1B3AA 1TS2A 3NTHA 4RGOS 1H9RA 1EY9A 2R61A 3K58A 1HQRD 1D5ZC 1PTOC 1G2SA 1JWSD 1TIID 2A69C 1EY4A 1RODA 2KUMA 1QWYA 1B9MA 4RCNA 5ELFA 1ZXTA 1V1OA 4NDXA 1KDCA 4RA8A 2NZ1D 1IHZA 1PRTB 1JOOA 1HXYD 3T53B 2VB2X 1KABA 1HTLD 3I3CA 1D5MC 2KCCA 4LMQD 4CHTB 1PRTD 4O1NA 1GJXA 2PZTA 4KKTA 2M00A 1LTTD 5JAVA 3O13A 4BY7B 2B63B 3S17B 1FR3A 4H44C 1DCZA 4XQNA 1CHQD 2K28A 4DAVA 3ND8A 2F3WA 5C44B 2Y0SB 4CKBA 2F0DA 2KJXA 1JORA 5EPKA 5EBCA 4C3IB 5G3LD 2R6GA 5EKLA 4OIKA 2IX0A 2L9HA 2NVQB 2O5JC 4H0LC 1ZEQX 1EZ8A 1ET6A 1SYCA 1A6XA 2PMZB 2KEDA 3KBGA 4J8QA 3TBIB 2B2WC 1JR0D 3W3AA 2F0JA 2EY6A 4XQJA 3WOEA 4KY7A 2K03A 3S1MB 1HPCA 2JP1A 3C3LA 4MHEA 1BF4A 4KY5A 5M3MB 2F0LA 3OOCA 3QOJA 5A2QE 1F2MA 1ONLA 1SDFA 1TT2A 5D3DA 2JA8B 3AU7A 3K0YA 3A55A 1TS5A 4S3SA 4WRDA 4C2MB 2F0FA 2FMMA 1FNUA 3I8ZA 4RGMA 3H94A 3G7LA 3S15B 1EOTA 1W6JA 4G4KA 2ICIA 3J7YW 4CKCA 2FHTA 3FRPB 3W2DA 2RSOA 2B2UA 2JEBI 3Q24A 1SYFA 2PO4A 1SMYD 1DZ1A 3I91A 3BDCA 2BE5D 5IIFA 5CBEE 2KEEA 1JCKB 1TKWB 2NVTB 2RBMA 3OW7A 3FPPA 4KV6A 3SEBA 4FNFA 1WTVA 2F0EA 2EZVA 3DWPA 2JA5B 1EFID 2PW5A 4HSVA 5IODA 1FYCA 4K14A 3DM1A 1I6VC 1X32A 1TQOA 3QB3A 5FLXL 2ZXRA 2Q8TA 3QWNA 3I4LA 1D1IA 3GTQB 2Z4IA 4HR7B 2E2DC 2EYOA 1CZWA 2OEOA 2LS01 1RF2D 5K36G 1BR9A 3VYSA 2MHVA 2F0MA 3R2TA 3SVMA 3QOLA 1I50B 1TVXA 1CQVA 4K5XA 2HQEA 5CV6A 1TWHB 2J7ZA 3BS1A 1JE4A 3ONAB 3D31A 1A3TA 1V43A 1O80A 1YNJC 2K33A 1DONA 5KRUA 5CV7A 5CC4A 1KNAA 4IUVA 2B2VA 4IZ8A 1EZ6A 5NUCA 1S5DD 2WAQB 2EJFC 3V05A 3KLSX 3TDQA 2Q8RE 3PO2B 2AUKA 4BBRB 1HUMA 3NP8A 4F88A 2O5IC 4PMWA 2R93B 2K32A 4ME5A 3H91A 5COYA 4DXFA 2SEBD 4ZUIA 1SNDA 5LHY1 2NWGA 3WOFA 2B2TA 1H9MA 2K6AA 4FF4A 2DY7A 2RDGA 3NE5B 1BDOA 1LTBD 3MTSA 3J80E 5CV9A 3OMCA 2A74C 1JC7A 3HOWB 2ICEC 5IGBA 4ZAIA 1EYDA 1RTNA 3P75A 2NTSA 1YNJD 4OO1H 4CJ0B 5A35A 4FF3A 4R8IA 2GA4B 5F2DA 2H1EA 3TN2A 3D4DA 1DOKA 1LTSD 1WTXA 1G91A 3A7LA 4K2LA 2BDOA 1NR4A 2AQ2B 1SSOA 3MZ5A 1CI3M 1JWMD 2F4IA 5I6WA 4QIWB 2A6HD 1F9PA 2X6GA 1WTPA 1TS3A 1UNSA 2JA7B 5T1GA 3MXGA 5JEAH 4LK1C 1CFMA 4G7OC 1GUSA 2EPBA 3N52A 4M1UB 4I7ZC 2F3VA 1H9KA 3HOYB 2D5DA 1SFOB 1F2ZA 1UAPA 3VYRA 3HOZB 3PO3B 1ESRA 4DGZA 2WKDA 1O7ZA 5ELBA 4K6LA 2EYMA 1PRTF 1ENFA 1F9RA 3S2DB 2JSOA 5FOBB 3BZDB 4TKOB 1EY5A 1S4ZA 1HFGA 3EJIA 3K5MA 2I07B 2B2WA 2FINB 1LTGD 4G7ZC 1WTOA 2BA1A 2A6ED 1MD2D 4ZYSA 5G3LF 3OWEB 3SK4A 1EY0A 4C3HG 2E74C 2SNSA 1RDPD 3BDLA 1RCVD 2K1BA 2F03A 2F0GA 4A3FB 2BDNA 1C8CA 4ODGA 4XT3B 1LO5D 4L63B 2J4XA 2O4XA 3I4NB 4DF7A 5C0XJ 1V8QA 1CA5A 1RJTA 2TMPA 1B9NA 2H4OA 1T5XD 5FO8B 2L55A 3NWTA 5JJZA 2I46A 1ICWA 1X3PA 3RUZA 2M9VA 4OL7A 2OF1A 2NN6I 1MSHA 4HAEA 1PZID 1STBA 3IL8A 3L7ZC 3URYA 3CKIB 3X3NA 4XYOA 1J8IA 1I4XA 1Z7TA 1TR5A 4N9TA 1I4PA 1ILQA 1F9QA 3RLFA 4B08A 1HUNA 3HOUB 1EYAA 5KIXA 5JOBA 1D5XC 1RD9D 3DHQA 4V0BA 4X3TA 5HGTA 2E2JB 2EY1A 2F0IA 1FGBD 3SK5A 1IW7C 1GUOA 3N6RA 4JBWA 1EL0A 1OXVA 4C3JB 3EQLC 3HOXB 2F0KA 3VR5A 1II3A 2AQ1B 5KYIA 2SDFA 1IKLA 2QKIC 5FO7B 3HG9A 4PNYA 1PFBA 4DA2A 2K05A 1EIHA 1CA6A 4KHZA 4BA1I 2NUCA 3GTLB 4HCEA 3GQBA 5ISRA 3K5OA 5DM73 5I2XA 2N55A 5E4XA 1LLRD 2RKSA 1C4QA 3OSOA 4HEDA 1GUWA 3VYUA 1XTCD 2F0SA 4C1NI 1HFNA 4BY1B 4OHJA 4QCLA 4JK1C 3SDZA 5C5MA 1PTOB 2K01A 3HP3A 2IJ0A 2EVBA 3NWSA 3EA6A 4FF1A 3OIQA 1WTWA 3WDNA 1PTOD 1OXUA 2WIIB 5C3WA 4WORA 5C6AA 1SAPA 3C1EA 3J80L 1CTMA 2A69D 4Q0FA 3PUXA 3CRLC 2EE1A 5KNDA 2E75C 3K7AB 1SEBD 2WINB 4A3GB 4FXKC 3D6WA 4XXEA 4WJWA 1OO9B 2YU9B 5CR3A 4O42A 2Z8LA 3DUZA 1H9SB 2HDMA 2ZXPA 1QJOA 2AQ3B 5E1FA 3TZDA 4RKLA 3VR4A 1AZQA 3Q6SA 1U9RA 2ZT9C 4A3JB 2X69A 2B8GA 3TP7A 3PIP3 1AZPA 1QE6A 3U9SA 2OXPA 2XWBB 3A54A 4F87A 5IGFA 3M3YB 1YNNC 3NPPA 3GTOB 4RGNA 1FD7D 4C3JG 5DAUA 1I4GA 3BYTB 3KK7A 1GXDC 2L1BA 3L3OC 3TP5A 3PMFA 3NQIA 1BOSA 1QNUA 3OPOA 4FF2A 4IFDI 3NXWA 4PMBA 1GHKA 1EU3A 4KHVA 4RAUC 3K57A 1CK1A 2QF7A 1DJRD 1SNQA 2HDLA 3LWEA 4N9PA 1Y69U 1FNWA 1EWHA 2WACA 1L0YB 1Q3LA 4C1NK 1GHJA 3DEPA 1SBBB 3DXJC 4ZKCB 3S1NB 3A8JE 4UAIA 4ZRZA 4DNRB 4ZQ3A 4HSPA 5K36H 5C5LA 1PXUA 3F2UA 2NN6G 1K8OA 3I4MB 1E0BA 1S5FD 2PYKA 2V4DA 2A68C 4HMJA 1U4RA 1CT1D 3BVGA 1K8MA 3ZYYX 4CJ1B 1GOZA 1IYVA 3HRZC 3K5NA 4TQUS 2VUMB 5CV5A 3S14B 1EWCA 4ZKBB 1STGA 3GTJB 2B39A 2KQ3A 5IT9E 1C48A 1GUGA 3A56A 2G9DA 1AW7A 3VYTA 1R9TB 3NBHA 2F0HA 2J0TD 1Y8NB 4K5WA 2JEAI 4KK7A 3TP8A 2AWNA 4A3EB 3E0JA 4QF4A 4XT1B 4NP5A 3QG1A 1O7LA 2F0QA 3NTIA 1LV9A 5M5WB 3TP6A 1FNVA 1B1ZA 2A73B 2B2YA 5JPNC 2JA6B 4RHRA 5T1IA 3KUPA 2K04A 3C1FA 2RA4A 3SE0A 2KA7A 1LABA 2C9OA 2F1MA 1KAAA 2IT1A 1ENAA 2EDGA 1QNKA 3IKJA 1SYGA 1SE2A 3GTKB 1JOQA 3DWAA 1I4HA 3IAYA 2XN9C 1DOMA 1Q8IA 3RMHA 4V190 4NMZA 2IPKD 1V1PB 4EQPA 5C4JB 4C3HB 2N88A 1XWEA 4MN3A 4L8JA 2YYZA 4A3DB 4EQOA 3PIO3 1PZKD 1QB5D 4B9WA 3BDOA 3BVMA 1SYEA 4CJ2C 2ID0A 1BXTA 4Z9CB 3MHBA 3NUCA 2XSCA 5KEEA 2KECA 3DMUA 5CORA 5EPJA 2EYHA 3HOVB 4IUUA 4DAPA 3NSWA 4OIJA 3SHLA 3MWYW 1B2TA 1A15A 2VNUD 3LNNA 5CYUA 1LT3D 2EY2A 1JQYD 3I72A 5I4DA 2QDBA 1NAPA 4A3KB 5C4HA 1B4OA 2HCIA 1XYIA 5EKKA 5I9PA 4C56C 1EEID 4IFDJ 1O78A 1Z6HA 1HRJA 4IFDG 1D1KA 4QB4A 3TSSA 4UDUC 4BA2I 1LT6D 2L5TA 4K5VA 1WTQA 1R4QB 5ELCA 1QCBD 3VA5A 2D9UA 3K5LA 4TSSA 2B2UC 2MJ8A 2NYZD 3H0GB 5LL6X 3MXPA 2X6LA 1EU4A 1ET9A 3M7NA 3DEOA 5A2QL 1VCIA 3HKZB 1E2WA 4KY6A 4OO1G 4KN4C 2L0CA 3Q0AA 5M9OA 2K5QA 5C0XH 3GO5A 1D6EC 2VB3X 3NQTA 3MA2B 1STEA 2EYFA 1HA6A 3A8IE 3KBXA 4XTCS 5M3FB 2PPBC 3EVQA 4DFAA 1JB3A 1SJED 2B8FA 1OXXK 1PTOF 3M7GA 2EYLA 3D4RA 3ITPA 1SNMA 3FDTA 2CVRA 1TU2B 2LY7A 1LT4D 2NTTA 2KHSA 1STHA 2XWJB 3PUZA 1SNOA 3GV6A 3R8BA 3OWFA 2EOTA 3SR1A 2NBFA 1VMCA 2C5CA 3JAME 4Y7NB 4DNTB 1K83B 4RCOA 5EBDA 5BN5A 3MFYA 3PUVA 1CQFA 1HCZA 3PUWA 3IFDA 3X3MA 1EEFD 1GUNA 4RGTA 2NVYB 4IUQA 1L0XB 2TSSA 3VR6A 4EGVA 1OXTA 4FYDA 2NVXB 2RVLA 2QCPX 2IWHA 4K8JA 3ND9A 4DK0A 3R3OA 3PUYA 1F77A 1PFNA 5D14A 5FLXE 3D4WA 3GD7A 2PW7A 1AEXA 2EXZA 1LTAD 2IW3A 4FO2A 4HN7A 2B2VC 1SJHD 1Q1EA 2MP1A 1WCMB 5IT9L 4PQXA 1M8AA 1R4PB 2XRSD 2Z1CA 4ABNA 3Q23A 1G8ZD 3CRKC 1IKMA 1I3QB 4A3MB 1PRTC 3BYYB 2RDFA 1SE3A 3BVZA 2MGSA 3I73A 4Q5VA 1TWGB 5HURA 1BO0A 2F0TA 1QG7A 2BOSA 5AFWA 1EY6A 3J7AF 1KDAA 4KKSA 3GTMB 2B2TC 3FMCA 1AP0A 4I65A 5EPLA 3FPUB 2D62A 4KN7C 1QOHA 1XXGA 1MBYA 4TRDA 1J9OA 4CGYB 3HZXA 2KCNA 3M4OB 5I2YA 4L6TB 2AUJD 4PV1C 4YIJA 3C46A 3J81E 5FK9C 1G291 4QUFA 3A8KE 3VR2A 4CBVA 1TWFB 1KLUD 4KI0A 2FMCA 1MSGA 2FFKB 3T51B 5KYLA 3S2HB 5BN4A 4KD4A 2F0VA 2O2LD 1V1PA 3GTGB 3LWUA 4RKBA 4KD3A 5ELDA 1CHPD 1EIGA 1G6ZA 3M4YA 5C4XB 4QUCA 3R93A 1IW7D 4RFBA 2RDHA 2NB0A 4XYQA 3SK8A 1BCPC 1AN8A 1EY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NCV A;  1WTO A;  1DOM A;  1RTN A;  5CBA E;  5EQ0 A;  3I3C A;  5E4W C;  3TZD A;  1M8A A;  4CJ0 B;  2HUG A;  3Q6S A;  3DEO A;  1AZQ A;  2R3Z A;  1RHP A;  4XDX A;  1CM9 A;  2L11 A;  2SDF A;  2KOL A;  4LMQ D;  4R8I A;  1IKL A;  4IUT A;  1IKM A;  2X69 A;  2B2Y C;  1HHV A;  2N88 A;  2IL8 A;  1WD1 A;  4IUP A;  2FMM A;  4MN3 A;  2H1E A;  4ZKB B;  1AZP A;  3TN2 A;  4X3K A;  3SVM A;  1QE6 A;  1PFB A;  3I8Z A;  1DOK A;  1MI2 A;  1WTX A;  1U4L A;  1TVX A;  1BNZ A;  1G91 A;  1U4M A;  3P7J A;  2K05 A;  1EIH A;  2MGS A;  3G7L A;  3KBX A;  1DOL A;  4X3U A;  1PLF A;  2K1B A;  2M2L A;  1WTR A;  1CA6 A;  1EOT A;  2J7Z A;  1BO0 A;  1XX8 A;  2BDN A;  1C8C A;  1QG7 A;  1NR4 A;  2K28 A;  1RTO A;  2VXW A;  4RWS C;  1JE4 A;  5D65 A;  1SSO A;  1U4P A;  1B53 A;  4U68 A;  5AFW A;  4XT3 B;  4CJ2 C;  3ONA B;  2KVM A;  1O80 A;  1F9S A;  3I90 A;  2B2T C;  1F9P A;  1WVL A;  2X6G A;  1DON A;  2FHT A;  1WTP A;  2L1B A;  2XIW A;  5EPL A;  2N55 A;  2FJ2 A;  5E4X A;  4DN4 M;  1AP0 A;  2KEC A;  4R9W A;  1CA5 A;  5COR A;  5EPJ A;  3FPU B;  1RJT A;  3FDT A;  2HCC A;  2RSO A;  5T1G A;  4HED A;  1GUW A;  1KNA A;  2CVR A;  2B2U A;  1IL8 A;  4IUV A;  5JJZ A;  4IUU A;  5EPK A;  1J9O A;  2B2V A;  4OIJ A;  1PFM A;  2L12 A;  4XT1 B;  2DY8 A;  1ICW A;  3MWY W;  5EJW A;  1HFN A;  1B2T A;  1X3P A;  1DZ1 A;  3I91 A;  1A15 A;  1ML0 D;  3GV6 A;  1F2L A;  4HCS A;  1G2T A;  1LV9 A;  1KNE A;  1X3Q A;  2L9H A;  4NW2 A;  4OIK A;  1B3A A;  2EOT A;  5CBE E;  2EPB A;  2K01 A;  3HP3 A;  3N52 A;  3GV3 A;  4RAU C;  1MSH A;  2JYO A;  2KEE A;  1VMC A;  4HAE A;  5CMD A;  4QUF A;  1NAP A;  2B2Y A;  2Q8R E;  1WTW A;  2HDL A;  3LWE A;  1HUM A;  1B4O A;  5DNF A;  1NR2 A;  3IL8 A;  1WTV A;  5T1I A;  2KED A;  2HCI A;  1MGS A;  2K04 A;  3KUP A;  1XYI A;  1MSG A;  2FFK B;  2B2W C;  2MPM A;  2RA4 A;  1VMP A;  1Q3L A;  4ZAI A;  1G2S A;  3IFD A;  1ESR A;  3DEP A;  1J8I A;  1SAP A;  2L4N A;  1O7Z A;  4ZKC B;  4ZLT F;  4UAI A;  3UI2 A;  3H91 A;  4IUQ A;  1HRJ A;  4HSV A;  5COY A;  4IUR A;  2EE1 A;  4ZK9 B;  1EL0 A;  1EQT A;  5EKI A;  1ILQ A;  1F9Q A;  2K03 A;  1O7Y A;  2RVL A;  1WD0 A;  1ROD A;  1HUN A;  2KUM A;  2NWG A;  3F2U A;  1BBX C;  1F9R A;  2B2T A;  4CJ1 B;  1E0B A;  2JP1 A;  3D6W A;  1PDQ A;  1PFN A;  3DM1 A;  5D14 A;  1WTQ A;  2RSN A;  1QNK A;  4MHE A;  1S4Z A;  1HFG A;  1BF4 A;  2DY7 A;  1ZXT A;  4X3S A;  2B2W A;  4X3T A;  1X32 A;  3MTS A;  1EIG A;  2D9U A;  1U4R A;  4O42 A;  1G6Z A;  1B50 A;  4RA8 A;  2FIN B;  4QUC A;  2NZ1 D;  3R93 A;  2B2U C;  2MJ8 A;  2NYZ D;  3QO2 A;  2B2V C;  1JIC A;  1ILP A;  2HDM A;  1SDF A;  1HA6 A;  2X6L A;  2MP1 A;  2Q8T A; 
#chains in the Genus database with same CATH topology
 3HOX H;  1MJC A;  4IN3 A;  1VQ8 A;  4XDX A;  3GTM H;  1CM9 A;  1KL9 A;  3I70 A;  3CXC A;  1HHV A;  4K2K A;  3F2C A;  3T16 A;  1STY A;  5DM6 3;  4PMC A;  3AQQ A;  4HJA A;  1A8V A;  4X3U A;  3TME A;  3H6M A;  1UUP A;  3T1H L;  3HKZ E;  5D65 A;  2VXW A;  3S9W A;  4DPG A;  1VQ5 A;  4LF9 Q;  1B53 A;  2F0O A;  4X65 Q;  1KRT A;  2UUC Q;  1PA6 A;  3D8G A;  1VQH A;  1TWF H;  4A3B B;  2XIW A;  4AYB B;  5M5X B;  4DN4 M;  1ESF A;  4NXM L;  4R9W A;  1HZB A;  1G6P A;  5EGT A;  4A3I B;  1TXY A;  2OTL A;  1I6H B;  5KGU A;  3V2T A;  2K52 A;  3RD4 A;  2WB1 B;  4DR5 Q;  2L12 A;  2CQA A;  2SOB A;  1JWU D;  5EJW A;  1VQB A;  3R2I A;  5CV8 A;  1SMY C;  2NN6 H;  4PZ7 A;  1KNE A;  1PTO H;  5BR8 L;  2BE5 C;  4LFA L;  3S1Q B;  4N8F A;  1BCP B;  1K8A C;  2BA0 A;  4KMU C;  1K0S A;  3M9B A;  1S5E D;  1WJJ A;  5HY6 A;  2LKV A;  5C3E B;  1Y1V B;  5DNF A;  1AFP A;  2Z6B A;  5C4X H;  4KJO A;  1TWA B;  3QIA A;  1BCP D;  3KLR A;  4DAY B;  2E2I B;  1K3B C;  2F4V L;  3RZD B;  3NEM A;  5LL6 S;  3UI2 A;  3VA7 A;  1I4R A;  1N8R C;  3T1H Q;  4IQZ A;  3K7A H;  5DLQ E;  3H3V I;  3RN5 A;  5EKI A;  4OGQ C;  4CKE A;  5J39 A;  2ZJQ A;  1WD0 A;  3E6Z X;  1TWC B;  2RSN A;  2YU9 H;  4NXM Q;  3KYH C;  4IAL A;  4X3S A;  2PNR C;  4FVM A;  3T13 A;  1N36 Q;  5IT9 c;  4QL5 A;  2E76 C;  1VQC A;  2DN8 A;  3QO2 A;  1JIC A;  4P2C B;  2K7V A;  1D2B A;  4DU9 A;  5IY0 A;  2LMC B;  3ICE A;  5CBA E;  5E4W C;  4GOP B;  2C35 B;  2HUG A;  1HA5 A;  2R7D A;  5BR8 Q;  4KJN A;  1T9H A;  4LFA Q;  4OO1 I;  1A3U A;  5M5X H;  3MFG A;  2A5H A;  2QIL A;  4NKL A;  1QVC A;  4A3I H;  2MO1 A;  3CQZ B;  4IUP A;  1I6H H;  1BUV T;  1KDB A;  2BCO A;  2Z6K A;  4IUN A;  1VQG A;  3H3V C;  1GUT A;  1U4L A;  2ASB A;  1YNN D;  2F4V Q;  4BY7 G;  1EQV A;  2B63 G;  1HTP A;  3KF8 B;  1PLF A;  4MZ9 A;  4CDE C;  1A2U A;  3CPF A;  1WTR A;  1DYQ A;  1CKN A;  4RWS C;  1IBM L;  1KLG D;  2OTJ A;  4NXN Q;  2XNA C;  3NTK A;  1QUQ B;  2KVM A;  1E24 A;  1EYC A;  3NBI A;  1PH3 A;  1VF7 A;  4H13 C;  4G7H C;  4JBJ A;  3AMU A;  5C44 G;  2WP8 J;  3IFT A;  4EVO A;  3E9H A;  2K5D A;  5I9O A;  1U0L A;  3RZD H;  3JAM L;  4A76 A;  4WJ3 M;  1SRO A;  2Q2H A;  4ILW A;  4C3I G;  1T5E A;  1DXM A;  1F2Y A;  3PIO A;  3RR5 A;  4KKU A;  4G57 A;  4HCS A;  5E7N A;  5JVG 3;  3BG3 A;  4U67 3;  2JK8 A;  4OWW B;  5IGE A;  3ULL A;  4E6I A;  1Z47 A;  5LMN Q;  2AWO A;  1S5B D;  5CMD A;  3P1H A;  1TWC H;  1Q12 A;  5JJL A;  1SYD A;  3MC0 B;  4GN5 A;  3U9O A;  3MEH A;  3J7A V;  3ULJ A;  4A3B G;  1PZJ D;  4AYB G;  4HMI A;  3TZU A;  2MPM A;  1MHW C;  2HIV A;  2NZO A;  3AB9 A;  2K5W A;  1VMP A;  4JCV E;  2UU9 L;  4DK1 A;  3HGB A;  4OEM B;  3M85 A;  4BBS B;  2L4N A;  4ZLT F;  4K0K L;  1Z9F A;  4QJF A;  5CGK A;  1E1O A;  4UP8 A;  2PZU A;  1OXS C;  3G4S A;  4XIG S;  1NUC A;  1STN A;  2MO0 A;  2A68 D;  5GAG C;  4FXD A;  4PZ6 A;  3CQZ H;  5C0X I;  1K8G A;  3NHH A;  3CME A;  3ERO A;  5DEH A;  5C3E G;  4QMG A;  2KEN A;  2Q8I B;  4JI7 L;  5M3M G;  2R7Z B;  2G9H D;  1Y8O B;  4J6H A;  1A3V A;  1WOC A;  4JI0 L;  1NCV A;  3D3R A;  2IX1 A;  4R1J A;  2JA8 G;  3H09 A;  1RHP A;  2PZW A;  3ERQ A;  4JPB W;  2ENB A;  4L5Q A;  1ENC A;  2EJM A;  2KOL A;  3RZO B;  4IUT A;  3G6J B;  1JOK A;  1SE4 A;  2F0P A;  3G71 A;  1UEA B;  3HEJ A;  3S14 H;  4HTH A;  4B9X A;  2I5L X;  2IL8 A;  4DV7 Q;  1WD1 A;  1VS0 A;  4LFB L;  1VQ6 A;  5J22 A;  2K5H A;  2K4K A;  3M4Q A;  4A75 A;  3U58 A;  2PQE A;  1U4M A;  2UU9 Q;  3P7J A;  2PCF B;  3MXN A;  1TY2 A;  4YWK A;  2QEJ C;  4K0K Q;  3T4A C;  3S1R B;  3OHX C;  3I4O A;  1VF5 C;  2F0N A;  1MKH A;  1AE3 A;  4HIM A;  3PF4 A;  2ZTE A;  2GVA A;  2R7F A;  1F9S A;  1JB7 A;  1PYW D;  3T56 B;  1AH9 A;  5GRO A;  2WV6 D;  3LX0 A;  2A6H C;  2EY5 A;  3J81 L;  1LAC A;  3P20 A;  1L1O A;  4KTA A;  4BBS H;  3M4P A;  4JI6 Q;  4A3E H;  4IFD H;  2JE6 I;  3OMG A;  4ULL A;  1LTR D;  5CV4 A;  5IP9 H;  4JI0 Q;  1QVF A;  4F7X A;  1ML0 D;  1A2T A;  3Q22 A;  1G2T A;  4HJ9 A;  1Y8P B;  1X3Q A;  3MXU A;  1BQQ T;  4Y52 H;  5M5Y B;  3E0E A;  4OXP A;  1CKM A;  4AYB E;  5FO9 B;  5FKA C;  1X65 A;  3T1Y L;  3CU7 A;  2SNM A;  3BJU A;  2CWP A;  5TSS A;  5KNB A;  1YZ6 A;  2P5Z X;  5GAD C;  1NR2 A;  4JI5 L;  1SR3 A;  5FLM H;  2F0W A;  2DNC A;  1CZG A;  1YEZ A;  3K6O A;  4H7B A;  4UY8 C;  1HQM C;  2K5N A;  4IUR A;  4ZK9 B;  1O7I A;  5JVH 3;  1O7Y A;  2MQH A;  3MAQ A;  1BBX C;  2EYJ A;  1PDQ A;  1LTI D;  1H9S A;  1ZYR C;  4FDB A;  1PH7 A;  5K5P A;  5KNC A;  1Q90 A;  4DV5 L;  2IX3 A;  1B50 A;  5ELN A;  3A7A B;  1Y1W B;  3L9A X;  2ZJP A;  1EIY B;  4YWM A;  4LF8 L;  1VQE A;  4DXG A;  5JPM C;  4RMF A;  5D3I B;  2R3Z A;  4RH6 A;  5I6Y A;  4OX9 L;  5IGD A;  5IOC A;  2L11 A;  4K8I A;  3S16 B;  4C3H H;  2E2H B;  4M8A A;  1N33 Q;  2A6E C;  4DV6 L;  4JI5 Q;  1X3E A;  4BWG B;  1BNZ A;  2CW0 C;  2LXK A;  1DOL A;  1N32 L;  4DR7 L;  1XX8 A;  4GKK Q;  1SNP A;  2OT2 A;  3V96 A;  4U68 A;  4ID6 A;  1NSN S;  2PQA A;  5ELO A;  1M4V A;  4A4I A;  1VQF A;  4DAY A;  3NK9 A;  4XQQ A;  3JAM c;  1SRU A;  2R92 B;  1H9J A;  3L0O A;  2F3I A;  3PV0 A;  4O0A A;  1PHJ A;  1E2V A;  4LF7 Q;  3IRB A;  5BN3 A;  2HCC A;  4DV5 Q;  1SXT A;  3HOV H;  2VL6 A;  4A3C H;  3KLS A;  5E3F A;  1IL8 A;  1S3O A;  1DGS A;  4P71 A;  2CHB D;  4YWL A;  4J1M A;  4GKJ L;  1BKB A;  1X3G A;  2DY8 A;  2D2C C;  1MIU A;  1UE1 A;  4LF8 Q;  5IGC A;  1F2L A;  4R4O A;  3GV3 A;  2JYO A;  3E5S A;  1KTK A;  1ZYR D;  5FLX c;  1RKN A;  5J1Z A;  5HGQ A;  4K6D A;  3PO2 G;  1TS4 A;  4A93 B;  4FXG C;  4DV6 Q;  1SYB A;  1Q82 C;  1MGS A;  4GOP A;  1Y1W H;  4FP5 D;  2R93 G;  2PI2 A;  2XTI A;  5JEA J;  5JEA G;  4DUZ Q;  3KDF B;  4F8M A;  2EJG C;  4DR7 Q;  3MEF A;  3EFX D;  2DNE A;  4R4Q A;  1EQT A;  1B44 D;  3DWQ A;  3A74 A;  4MIU A;  2D0P A;  1HNW L;  1EYG A;  4IJL A;  5C4Z A;  4B3T L;  3S16 H;  1MJE A;  3SXH A;  2E2H H;  3KF8 A;  1EY8 A;  1KAW A;  2KCM A;  5C3X A;  4BXX G;  2CW0 D;  3CAM A;  2RF4 A;  3GP7 A;  1ICF B;  3GTP B;  4GNX C;  2BH2 A;  4BS9 A;  1QUQ A;  2CH4 W;  3I55 A;  4GKJ Q;  3C2P A;  2ZXO A;  1ILP A;  1JJ2 A;  4IPG A;  3OIP A;  5EQ0 A;  1QZG A;  1YBY A;  2OWO A;  1QVG A;  2A1A A;  5IYC H;  4LJZ C;  4ZUJ A;  2B2Y C;  1SNC A;  5C0X G;  4RHS A;  5ELE A;  3FKI B;  2XVS A;  4LAA A;  4X3K A;  1TY0 A;  3HS0 C;  1MI2 A;  2RQX A;  3FVQ A;  3MVV A;  4EQN A;  1Q1B A;  2M2L A;  1E2Z A;  3K59 A;  1J6Q A;  1DM0 B;  1RTO A;  1ZKO A;  1DD2 A;  1U4P A;  1EQR A;  1HNX L;  3J81 c;  1B70 B;  1VDZ A;  3D6C A;  3JAM i;  1W6K A;  3QJY A;  1HNW Q;  4B3T Q;  3PF5 A;  2EYP A;  3I90 A;  3TRZ A;  1BCP F;  3U4Z A;  1WVL A;  2MUY A;  2XRQ D;  4A93 H;  2FJ2 A;  1PMR A;  1PVO A;  4GS3 A;  1NY4 A;  2LFN A;  1XNR L;  4R8N A;  5FJ8 G;  2JA7 G;  3FEW X;  5IGG A;  1KRS A;  3SK6 A;  4WFN 3;  1IYU A;  3CHB D;  1LT5 D;  3J7A 5;  1YHQ A;  3VR3 A;  1QIL A;  4LUO A;  1PFM A;  4HJ7 A;  2JXM B;  2WKC A;  2Z4H A;  1STA A;  1EWI A;  4YHH L;  4DV2 Q;  2F0U A;  4GZY C;  1I4Q A;  1S5C D;  4NW2 A;  1B3A A;  1TS2 A;  3NTH A;  1Q81 C;  4JYA L;  4RGO S;  1H9R A;  1EY9 A;  1EFW A;  4Y7N H;  2R61 A;  2R92 G;  3K58 A;  1WFQ A;  2L15 A;  3GTP H;  3EBE A;  3HOY G;  1HQR D;  1C7Y A;  1D5Z C;  1PTO C;  3I56 A;  1G2S A;  1JWS D;  4X66 Q;  3HOZ G;  2OCE A;  2RHS B;  3PO3 G;  1TII D;  2Q2T A;  3I2Z A;  4HJ5 A;  4LF5 Q;  2A69 C;  1EY4 A;  1ROD A;  2KUM A;  1QWY A;  4DK3 C;  1FL0 A;  2DJG C;  1B9M A;  4RCN A;  5ELF A;  3LGJ A;  4HIK A;  4DR1 Q;  1VQL A;  1ZXT A;  1XNR Q;  1V1O A;  1XJV A;  4NDX A;  1KDC A;  4RA8 A;  4X64 L;  2NZ1 D;  3SGI A;  1IHZ A;  4R4C A;  4DUY Q;  1YNX A;  1PRT B;  4YHH Q;  2YTV A;  1JOO A;  1HXY D;  3T53 B;  2VB2 X;  1KAB A;  1HTL D;  1SE8 A;  2XGT A;  3E9I A;  3I3C A;  2VY3 A;  1XPR A;  1D5M C;  3RLN A;  4JYA Q;  2MNA A;  2KCC A;  1HH2 P;  4LMQ D;  4CHT B;  1PRT D;  4O1N A;  1GJX A;  2PZT A;  4KKT A;  2M00 A;  4RG1 A;  1LTT D;  5JAV A;  4QQB X;  3Q8D A;  3O13 A;  4BY7 B;  2B63 B;  3S17 B;  1FR3 A;  2AHO B;  4H44 C;  1DCZ A;  4XQN A;  1X56 A;  1CHQ D;  2K28 A;  3J81 i;  1YI2 A;  4A3F G;  4DKA C;  2H5X A;  4LF4 L;  3K0X A;  4DAV A;  3ND8 A;  2F3W A;  3I4N G;  5C44 B;  2Y0S B;  1V9P A;  4CKB A;  3FKI G;  4X64 Q;  2F0D A;  2KJX A;  1JOR A;  1PYB A;  5EPK A;  5EBC A;  4C3I B;  5G3L D;  2EIF A;  1WTH A;  2R6G A;  3M4O H;  3EIV A;  4LNQ A;  5EKL A;  2BH8 A;  4OIK A;  2IX0 A;  2L9H A;  2NVQ B;  2O5J C;  3CMA A;  2VQF L;  4H0L C;  1ZEQ X;  4DNI A;  1EZ8 A;  1ET6 A;  1SYC A;  4AH6 A;  1A6X A;  2PMZ B;  2KED A;  3KBG A;  4J8Q A;  3TBI B;  2B2W C;  1JR0 D;  3W3A A;  1VQ7 A;  2F0J A;  3S2H H;  3H15 A;  2EY6 A;  2OQK A;  4XQJ A;  1L0W A;  3GTG H;  3WOE A;  4KY7 A;  4JG2 A;  4MNO A;  2K03 A;  2IY5 B;  4JBK A;  1JMC A;  4LF4 Q;  3S1M B;  4IPC A;  1HPC A;  4NB3 A;  4EQ5 A;  3HOU G;  2JP1 A;  3C3L A;  4MHE A;  1BF4 A;  3K7U C;  1I5F A;  3BZK A;  4KY5 A;  2B63 H;  3S17 H;  5M3M B;  2F0L A;  3OOC A;  3QOJ A;  4R4I A;  5A2Q E;  1X3F A;  1F2M A;  2GVB A;  4HID A;  1ONL A;  1SDF A;  1TT2 A;  5D3D A;  2JA8 B;  3AU7 A;  1NNX A;  2N3S A;  4APV A;  1YHA A;  3K0Y A;  3A55 A;  1TS5 A;  1KIX A;  4S3S A;  2IHF A;  4WRD A;  4C2M B;  2F0F A;  4JI4 L;  2FMM A;  1FNU A;  3CCU A;  3I8Z A;  4RGM A;  4ALP A;  2N78 A;  4C3I H;  2FXQ A;  3H94 A;  3G7L A;  3S15 B;  2VW9 A;  1EOT A;  1VQA A;  2ZM6 L;  4L5S A;  1W6J A;  3QR8 A;  4G4K A;  1VQM A;  2CH4 A;  2ICI A;  3J7Y W;  4CKC A;  5IYD G;  4A3B H;  3OTO L;  1K0R A;  2FHT A;  5IYB G;  1UEB A;  4JOI C;  3FRP B;  3W2D A;  2RSO A;  4IOC A;  2B2U A;  2JEB I;  3Q24 A;  1SYF A;  2QA4 A;  2PO4 A;  4LFC L;  1K73 C;  3UE1 A;  1SMY D;  1LYL A;  1DZ1 A;  3I91 A;  3BDC A;  2BE5 D;  3TS0 A;  4BY1 G;  5IIF A;  5CBE E;  1XMO L;  3S1Q H;  2KEE A;  1JCK B;  1TKW B;  2NVT B;  3CCQ A;  2LXJ A;  2RBM A;  5C3E H;  1GD7 A;  3OW7 A;  1Y1V H;  1IL2 A;  3FPP A;  4KV6 A;  4JI4 Q;  3SEB A;  4FNF A;  5M3M H;  4OWT B;  1WTV A;  1TWA H;  2E2I H;  2Y0S G;  2F0E A;  2EZV A;  4WJ4 A;  3DWP A;  4OEL B;  2JA5 B;  1EFI D;  2PW5 A;  4DR3 L;  2JA8 H;  2ZM6 Q;  4HSV A;  3CCJ A;  4L5T A;  4A3L H;  5IOD A;  3VDY A;  1FYC A;  4K14 A;  4A3G G;  3OTO Q;  3TEH B;  3DM1 A;  2CWA A;  3RNU A;  1X55 A;  1I6V C;  1X32 A;  2N8N A;  1TQO A;  1B7Y B;  3S15 H;  3QB3 A;  3CC2 A;  5FLX L;  3CCS A;  2ZXR A;  2Q8T A;  4LUZ A;  3QWN A;  3I4L A;  1D1I A;  1U5K A;  2Z4I A;  4HR7 B;  1IBM Q;  3GTQ B;  2E2D C;  2EYO A;  1CZW A;  2OEO A;  3D0F A;  4JBM A;  2LS0 1;  1RF2 D;  5K36 G;  1BR9 A;  3VYS A;  2MHV A;  4A3J G;  2F0M A;  2UUA L;  1X54 A;  4UP9 A;  3R2T A;  1VQP A;  1IBK L;  3SVM A;  4B3M L;  3QOL A;  1I50 B;  1TVX A;  1CQV A;  4K5X A;  2HQE A;  1NBW A;  5CV6 A;  1XPU A;  2YTX A;  3NEL A;  1K28 A;  4YCW A;  4DR3 Q;  1TWH B;  2ZTD A;  2J7Z A;  3CD6 A;  3BS1 A;  1JE4 A;  3KLW A;  1GVP A;  4PG3 A;  3ONA B;  2NVT H;  3D31 A;  1A3T A;  1V43 A;  1O80 A;  1YNJ C;  4CDD C;  2D0O A;  2K33 A;  1DON A;  1SMX A;  1EQQ A;  2Z9H A;  5KRU A;  5CV7 A;  1VQK A;  4JI2 L;  3CPW A;  2VS1 A;  5CC4 A;  1KNA A;  4IUV A;  2B2V A;  4IZ8 A;  1EZ6 A;  5NUC A;  2I5H A;  1GM5 A;  1S5D D;  2WAQ B;  2EJF C;  3K8A A;  4ZCK A;  2Y0S E;  4MTN A;  3V05 A;  1VQ9 A;  4OWX B;  3KLS X;  3TDQ A;  2Q8R E;  3PO2 B;  2AUK A;  4BBR B;  2UUA Q;  2KHI A;  1HUM A;  1IBK Q;  3NP8 A;  4F88 A;  2O5I C;  1H95 A;  2DGY A;  4PMW A;  2R93 B;  4JV5 L;  4LW1 A;  4JI7 Q;  2CKZ B;  2K32 A;  4ME5 A;  3H91 A;  2PNH A;  3H3V H;  5COY A;  4L5R C;  4DXF A;  1Q46 A;  2SEB D;  4ZUI A;  1SND A;  2HT1 A;  5LHY 1;  2NWG A;  5J3B A;  3WOF A;  2B2T A;  2PMZ E;  3I4M G;  1H9M A;  2K6A A;  4FF4 A;  2DY7 A;  4JI2 Q;  2RDG A;  3NE5 B;  1BDO A;  1LTB D;  3MTS A;  3J80 E;  4LFB Q;  5CV9 A;  3OMC A;  2R7Z H;  2A74 C;  1JC7 A;  3HOW B;  2ICE C;  4ZAI A;  5IGB A;  2JA5 G;  1EYD A;  1VQD A;  3A5Z B;  1RTN A;  3P75 A;  2NTS A;  1YNJ D;  4OO1 H;  4CJ0 B;  5A35 A;  2DJF C;  4FF3 A;  3RZO H;  3GDE A;  4R8I A;  2GA4 B;  1BBW A;  5F2D A;  5LMU L;  1XNQ L;  1EIF A;  4CDF C;  2VUM G;  2H1E A;  3TN2 A;  3D4D A;  1DOK A;  1LTS D;  3A5U A;  1WTX A;  2N49 A;  1G91 A;  3A7L A;  4K2L A;  2BDO A;  3S1R H;  1NR4 A;  3TQY A;  2AQ2 B;  1SSO A;  3MZ5 A;  2JQO A;  1CI3 M;  1JWM D;  2F4I A;  1X6O A;  5I6W A;  3T1Y Q;  4QIW B;  4IPD A;  2A6H D;  1F9P A;  1Q86 C;  2X6G A;  1WTP A;  1YIT A;  1TS3 A;  1UNS A;  3WWV A;  3CP0 A;  2JA7 B;  2R93 H;  2AMC B;  1C9O A;  3RN2 A;  3ULP A;  4O2D A;  5T1G A;  4POF A;  3MXG A;  5JEA H;  4LK1 C;  1CFM A;  4G7O C;  1GUS A;  3PCO B;  1KXL A;  5IP9 G;  5M5Y H;  2EPB A;  3N52 A;  4M1U B;  4I7Z C;  2F3V A;  1H9K A;  3HOY B;  5LMU Q;  1XNQ Q;  1PYS B;  2JA6 G;  1E7Z A;  2D5D A;  2Z6K C;  1SFO B;  1F2Z A;  1UAP A;  3VYR A;  3HOZ B;  3PO3 B;  1ESR A;  3K81 C;  4DGZ A;  2WKD A;  1ASY A;  1O7Z A;  1K3R A;  3W5O A;  5ELB A;  4K6L A;  2EYM A;  1PRT F;  4IO9 A;  3EN2 A;  1ENF A;  2A8V A;  1LTL A;  4OX9 Q;  2G5D A;  1F9R A;  3S2D B;  2JSO A;  2WAQ G;  5FOB B;  3BZD B;  3KOJ A;  4TKO B;  1EY5 A;  1S4Z A;  2MFI A;  1HFG A;  3EJI A;  2EXD A;  3K5M A;  2I07 B;  2B2W A;  4JI8 L;  4BBR G;  2FIN B;  1LTG D;  1C0A A;  4P72 A;  1G51 A;  4G7Z C;  1N32 Q;  1WTO A;  3AYH B;  1B3Q A;  1N34 L;  2BA1 A;  1SN8 A;  5FJ8 H;  2A6E D;  2JA7 H;  3FP9 A;  1MD2 D;  4ZYS A;  3ZJY C;  5G3L F;  3OWE B;  1PH2 A;  3SK4 A;  1XMQ L;  4CDC C;  1EY0 A;  4C3H G;  2E74 C;  2SNS A;  1HR0 W;  1RDP D;  3BDL A;  2NZH A;  4OON A;  1RCV D;  4A3D G;  2K14 A;  2K1B A;  2F03 A;  2F0G A;  4MTK A;  4A3F B;  2BDN A;  1C8C A;  3HOW G;  4JC0 A;  4ODG A;  3B6Y A;  1JT8 A;  4XT3 B;  4LF6 L;  1LO5 D;  1HNZ L;  1FJG L;  4L63 B;  2R92 H;  1M90 C;  2J4X A;  2O4X A;  3KJO A;  3HOY H;  3I4N B;  4DF7 A;  5C0X J;  1M1K C;  1V8Q A;  1CA5 A;  1RJT A;  2TMP A;  4JI8 Q;  1B9N A;  2H4O A;  1T5X D;  3HOZ H;  4GLA C;  5FO8 B;  2L55 A;  3NWT A;  5JJZ A;  4B3S L;  3HOV G;  3W1G A;  2I46 A;  1ICW A;  1X3P A;  4X62 L;  3RUZ A;  2M9V A;  1PH9 A;  4OL7 A;  2OF1 A;  4GLV B;  2NN6 I;  1N34 Q;  1MSH A;  3S2D H;  4HAE A;  1PZI D;  3F1Z A;  3BU2 A;  4A3K G;  1STB A;  3IL8 A;  2ES2 A;  1V1Q A;  3L7Z C;  3URY A;  3CKI B;  3NBH B;  1XPO A;  3UDX A;  1S72 A;  3X3N A;  4XYO A;  1J8I A;  1I4X A;  2WAQ E;  4DV0 L;  1K9M C;  1Z7T A;  1TR5 A;  4ME3 A;  4N9T A;  1I4P A;  4GNX B;  1GKH A;  4LF6 Q;  1ILQ A;  1F9Q A;  3RLF A;  2Q2I A;  4B08 A;  1HUN A;  3HOU B;  1EYA A;  5KIX A;  2YV5 A;  5JOB A;  1D5X C;  5AJ3 L;  1A0I A;  1RD9 D;  2JN4 A;  3DHQ A;  4V0B A;  3CCR A;  1CUK A;  3AFQ A;  1PH6 A;  4X3T A;  5HGT A;  4LWC A;  2E2J B;  2EY1 A;  2F0I A;  1IXR A;  1FGB D;  4B3S Q;  4JW0 A;  3F2B A;  3SK5 A;  1IW7 C;  1GUO A;  3N6R A;  4JBW A;  2Q2U A;  1EL0 A;  1OXV A;  3H0G G;  2K5V A;  4C3J B;  3EQL C;  3HOX B;  1HNX Q;  3L2P A;  2K75 A;  2F0K A;  3VR5 A;  1II3 A;  3I4N H;  3TS2 A;  2AQ1 B;  3HKZ G;  5KYI A;  2SDF A;  1IKL A;  2QKI C;  4B3R L;  5FO7 B;  2UXB L;  3HG9 A;  3FKI H;  4PNY A;  1NTG A;  1PFB A;  2KBN A;  4DA2 A;  4DR2 L;  2K05 A;  1EIH A;  1NJI C;  1CA6 A;  3E3X A;  4KHZ A;  4BA1 I;  5IP7 G;  3U4V A;  2NUC A;  5M3F G;  4AQY L;  3GTL B;  4HCE A;  3GQB A;  5ISR A;  3K5O A;  3MXN B;  4YY3 L;  3G6E A;  5DM7 3;  4DR6 L;  5AJ3 Q;  5I2X A;  2Z0S A;  2HQL A;  2N55 A;  5E4X A;  1LLR D;  2RKS A;  1PH8 A;  2HIX A;  1C4Q A;  3OSO A;  4HED A;  1GUW A;  3VYU A;  1ASZ A;  1XTC D;  2F0S A;  5IWA L;  4C1N I;  1HJP A;  3UDI A;  1HFN A;  4BY1 B;  4LF9 L;  4OHJ A;  4QCL A;  4JK1 C;  2ZJR A;  3SDZ A;  4QIW E;  5C5M A;  1PTO B;  3HOU H;  2K01 A;  3HP3 A;  2IJ0 A;  2EVB A;  3NWS A;  3EA6 A;  4FF1 A;  3OIQ A;  3PGZ A;  2UXB Q;  1WTW A;  3KF6 B;  3WDN A;  2E2J H;  1PTO D;  1BBU A;  3CW2 C;  1OXU A;  4DR2 Q;  2WII B;  1YHB A;  3OYY A;  5C3W A;  4WOR A;  4DR5 L;  5C6A A;  1VQJ A;  1SAP A;  1IBL L;  3RLO A;  3C1E A;  3J80 L;  2IHE A;  1CTM A;  2A69 D;  4Q0F A;  5IE8 A;  4AQY Q;  3PUX A;  1FVI A;  3CRL C;  2EE1 A;  5KND A;  2E75 C;  3K7A B;  4YY3 Q;  1SEB D;  2WIN B;  4DR6 Q;  4A3G B;  4FXK C;  3D6W A;  4XXE A;  2I5M X;  4UP7 A;  4WJW A;  1OO9 B;  2YU9 B;  5CR3 A;  1SLJ A;  4O42 A;  2Z8L A;  3UE0 A;  5IWA Q;  1CSP A;  3DUZ A;  1H9S B;  2HDM A;  2ZXP A;  3GTL H;  1QJO A;  2AQ3 B;  5E1F A;  1WCM G;  1FGU A;  3TZD A;  4RKL A;  3VR4 A;  1AZQ A;  3Q6S A;  4IPH A;  5IYD H;  3KJP A;  4X6A H;  1U9R A;  2A19 A;  5IYB H;  2ZT9 C;  4A3J B;  2F52 A;  1HZC A;  2X69 A;  2B8G A;  2VZA A;  1E22 A;  1N36 L;  3TP7 A;  3TRE A;  3PIP 3;  4A3M G;  1AZP A;  1QE6 A;  2K50 A;  5H1S E;  4BY7 H;  3U9S A;  4GOP C;  2OXP A;  2CCZ A;  2XWB B;  3A54 A;  4F87 A;  1IBL Q;  5IGF A;  4BY1 H;  3M3Y B;  1YNN C;  1RL2 A;  3NPP A;  3GTO B;  4RGN A;  1FD7 D;  4IJH A;  4C3J G;  5DAU A;  1I4G A;  3HOX G;  1KHI A;  3BYT B;  3UDF A;  3KK7 A;  1GXD C;  4EX5 A;  2VQF Q;  5C44 H;  2L1B A;  2KHJ A;  3L3O C;  3TP5 A;  3PMF A;  2PQA B;  3NQI A;  1BOS A;  1QNU A;  3OPO A;  4FF2 A;  1KQS A;  4IFD I;  3NXW A;  4PMB A;  1GHK A;  2JJQ A;  1OTC A;  2NVQ H;  4NXN L;  4A3G H;  1EU3 A;  3F8T A;  4KHV A;  4RAU C;  3K57 A;  1CK1 A;  2QF7 A;  1Q7Y C;  1DJR D;  2CFM A;  1SNQ A;  2HDL A;  2RCF A;  3LWE A;  1UE7 A;  3KDF A;  4N9P A;  1Y69 U;  1FNW A;  1EWH A;  2WAC A;  4HIO A;  1EOV A;  1L0Y B;  1Q3L A;  4C1N K;  1GHJ A;  3DM3 A;  3DEP A;  1SBB B;  3STB C;  4DV3 L;  3DXJ C;  4ZKC B;  3S1N B;  3A8J E;  4UAI A;  2B29 A;  2E8G A;  2V1C C;  1WYD A;  4ZRZ A;  4DNR B;  1YJN A;  4ZQ3 A;  4GN4 B;  4HSP A;  5LMN L;  5C5L A;  5K36 H;  3S1M H;  1NMF A;  4A3J H;  1PXU A;  3F2U A;  4P73 A;  3KFU A;  2NN6 G;  1K8O A;  3I4M B;  1E0B A;  4GN3 B;  1S5F D;  2PYK A;  2V4D A;  2DUD A;  2A68 C;  4HMJ A;  1U4R A;  1CT1 D;  3BVG A;  1PH1 A;  3M3Y H;  1K8M A;  5C4X G;  3GTO H;  3ZYY X;  4CJ1 B;  1A63 A;  1GOZ A;  1IYV A;  2QDL A;  4QY7 A;  2QEX A;  3HRZ C;  3DLL A;  2AKW B;  4POG A;  2JA9 A;  3K5N A;  4JI3 L;  4C2M H;  4TQU S;  1AE2 A;  2VUM B;  5CV5 A;  3S14 B;  1EWC A;  4ZKB B;  1STG A;  3PSI A;  3GTJ B;  2B39 A;  4KHP L;  2KQ3 A;  5IT9 E;  1C48 A;  1GUG A;  4DV3 Q;  4JI1 L;  4LFC Q;  3A56 A;  4NPS A;  2G9D A;  1AW7 A;  3VYT A;  3FHW A;  2VQE L;  3CC7 A;  1R9T B;  2ZTC A;  1XMO Q;  3NBH A;  1E3P A;  1PH5 A;  5LMN W;  2F0H A;  2J0T D;  1E1T A;  4DV7 L;  2LSS A;  3CCE A;  1JE5 A;  1Y8N B;  4K5W A;  3STB D;  2JEA I;  4KK7 A;  4A3I G;  4GNX A;  3TP8 A;  2AWN A;  3S1N H;  4A3E B;  3E0J A;  4QF4 A;  4XT1 B;  2WB1 G;  4NP5 A;  3QG1 A;  1O7L A;  2F0Q A;  3NTI A;  4IOA A;  1LV9 A;  5M5W B;  3TP6 A;  1LUZ A;  3I4M H;  4TVA B;  3AEV A;  1FNV A;  4DK6 C;  1B1Z A;  4JI3 Q;  1NE3 A;  3U50 C;  1W3S A;  2A73 B;  2B2Y A;  5JPN C;  2JA6 B;  1KD1 C;  3J80 c;  4RHR A;  1Y1V G;  5T1I A;  3KUP A;  2K04 A;  3C1F A;  1S40 A;  4KHP Q;  2RA4 A;  3SE0 A;  2KA7 A;  2E5L L;  4JI6 L;  2JA5 H;  1LAB A;  4JI1 Q;  3HFZ B;  2VQE Q;  2CQO A;  3CC4 A;  2C9O A;  2F1M A;  4A3L G;  1KAA A;  2IT1 A;  1ENA A;  2VUM H;  2EDG A;  1QNK A;  3IKJ A;  3GTJ H;  4P75 A;  2B3G A;  1SYG A;  5L37 A;  1W2B A;  1SE2 A;  1CSQ A;  3G48 A;  3GTK B;  4B3M Q;  3CF5 A;  1JOQ A;  2UXC L;  3DWA A;  1I4H A;  3IAY A;  2XN9 C;  1R9T H;  4DR4 L;  1DOM A;  3GTQ H;  1Q8I A;  3RMH A;  4V19 0;  4NMZ A;  2IPK D;  1P8L A;  1V1P B;  4EQP A;  5C4J B;  1NMG A;  4C3H B;  2N88 A;  1XWE A;  4MN3 A;  4L8J A;  1I50 H;  2YYZ A;  2E5L Q;  3CCL A;  4EQO A;  3PIO 3;  4A3D B;  2QW7 A;  3F2D A;  1PZK D;  1TWH H;  1QB5 D;  4B9W A;  3KF6 A;  2QGQ A;  5M5W H;  3BDO A;  3BVM A;  1SYE A;  1UWV A;  4CJ2 C;  1VQ4 A;  2ID0 A;  1BXT A;  4Z9C B;  4DV4 L;  3MHB A;  3NUC A;  2JA6 H;  2XSC A;  5KEE A;  1N33 L;  2KEC A;  1RIP A;  3DMU A;  5COR A;  5EPJ A;  2WB1 E;  2EYH A;  4JVZ A;  4J15 A;  3HOV B;  4IUU A;  4DAP A;  4JV5 Q;  2UXC Q;  3NSW A;  4OIJ A;  3SHL A;  3MWY W;  4GKK L;  1B2T A;  4DR4 Q;  1A15 A;  3AFP A;  4P74 A;  2VNU D;  3LNN A;  3OW2 A;  5JJK A;  5CYU A;  2RCN A;  1LT3 D;  2EY2 A;  1JQY D;  1I94 L;  1L2F A;  3I72 A;  5I4D A;  3NEN A;  2QDB A;  1NAP A;  3PO2 H;  4BBR H;  3J80 i;  4LF7 L;  4A3K B;  3BZC A;  5C4H A;  1B4O A;  3GTK H;  3S24 A;  2HCI A;  1UE5 A;  1XYI A;  5EKK A;  5I9P A;  4C56 C;  1EEI D;  1UE6 A;  4IFD J;  4BBS G;  1O78 A;  1N9W A;  1Z6H A;  4A3E G;  1HRJ A;  4IFD G;  4LUV A;  1D1K A;  4QB4 A;  3TSS A;  1QZH A;  4UDU C;  4BA2 I;  4DV4 Q;  1LT6 D;  2L5T A;  4K5V A;  4BXX H;  1Y14 B;  1BVS A;  5C4J H;  1WTQ A;  1R4Q B;  5ELC A;  1QCB D;  4A3D H;  3VA5 A;  1HR0 L;  2D9U A;  3K5L A;  4TSS A;  2B2U C;  4DV1 L;  2MJ8 A;  2NYZ D;  4PZ8 A;  3HOW H;  4DUZ L;  5FLM G;  3H0G B;  5LL6 X;  2R7Z G;  3MXP A;  2PI2 E;  2X6L A;  1EU4 A;  1ET9 A;  2HD3 A;  3M7N A;  3DEO A;  5GQO A;  5A2Q L;  1VCI A;  3HKZ B;  1E2W A;  4KY6 A;  1I94 Q;  4OO1 G;  4KN4 C;  2L0C A;  3Q0A A;  4UPA A;  5M9O A;  2K5Q A;  4AIM A;  5C0X H;  3GO5 A;  1D6E C;  2VB3 X;  3NQT A;  4YCV A;  3MA2 B;  1WI5 A;  1STE A;  2EYF A;  3I7F A;  1HA6 A;  3A8I E;  3KBX A;  1HZA A;  2RHQ B;  4XTC S;  5M3F B;  2PPB C;  2UXD L;  1HZ9 A;  3EVQ A;  1Q8K A;  4DFA A;  1PV4 A;  1JB3 A;  1SJE D;  2B8F A;  1OXX K;  1PTO F;  3M7G A;  4A3K H;  2EYL A;  1KC8 C;  3D4R A;  3ITP A;  1SNM A;  3ER0 A;  4N8X 1;  3FDT A;  3K80 C;  1HR0 Q;  2CVR A;  3CCV A;  1TU2 B;  4DV1 Q;  2LY7 A;  1LT4 D;  2NTT A;  2KHS A;  1STH A;  3PUZ A;  2XWJ B;  1SNO A;  3GV6 A;  3R8B A;  1D8L A;  3W1B A;  3OWF A;  2UUB L;  2EOT A;  3SR1 A;  1GO3 E;  2NBF A;  1VMC A;  2C5C A;  2EQS A;  1VQN A;  5JJI A;  3JAM E;  1CKN B;  4Y7N B;  4DNT B;  1K83 B;  4RCO A;  4I7A A;  1SFO H;  2GN5 A;  3A0J A;  5EBD A;  5BN5 A;  3MFY A;  3PUV A;  1CQF A;  3PO3 H;  1HCZ A;  1PFS A;  3PUW A;  3H0G H;  3IFD A;  3X3M A;  1EEF D;  1GUN A;  4RGT A;  2ATW A;  4A3C G;  2NVY B;  2UXD Q;  4IUQ A;  4DV2 L;  4UHV A;  1YJW A;  1L0X B;  2TSS A;  3VR6 A;  4EGV A;  3UDG A;  1JJG A;  1OXT A;  1JJC B;  3ERS X;  4FYD A;  2NVX B;  2RVL A;  2QCP X;  2IWH A;  4K8J A;  2I0Q A;  3ND9 A;  4DK0 A;  3R3O A;  5GAE C;  1A62 A;  3PUY A;  1F77 A;  1PFN A;  5D14 A;  5FLX E;  3J81 j;  3D4W A;  3GD7 A;  2PW7 A;  1AEX A;  2EXZ A;  4JOI A;  1XMQ Q;  1B8A A;  1LTA D;  1VQO A;  3PQI A;  4H02 A;  4X66 L;  5IP7 H;  5M3F H;  2IW3 A;  4FO2 A;  4HN7 A;  2B2V C;  1SJH D;  1Y1W G;  1Q1E A;  2MP1 A;  1WCM B;  2KCT A;  4LF5 L;  5IT9 L;  4PQX A;  2HHH L;  2UUB Q;  1M8A A;  1R4P B;  2XRS D;  2Z1C A;  4ABN A;  3Q23 A;  1G8Z D;  1HNZ Q;  1FJG Q;  1J5E L;  4GLX A;  3CRK C;  1IKM A;  1I3Q B;  4DR1 L;  1YIJ A;  4DAM A;  4A3M B;  1PRT C;  3BYY B;  3JC6 6;  2RDF A;  1SE3 A;  3BVZ A;  1L1O C;  2MGS A;  3I73 A;  1P16 A;  4Q5V A;  4DUY L;  2WFW A;  1TWG B;  4A3F H;  1VQI A;  5HUR A;  1BO0 A;  2F0T A;  1CKO A;  1QG7 A;  4X62 Q;  2BOS A;  5AFW A;  1EY6 A;  3J7A F;  1EUJ A;  1KDA A;  4KKS A;  2ALY B;  3GTM B;  2B2T C;  3FMC A;  1AP0 A;  1K83 H;  4I65 A;  5EPL A;  4R4T A;  5IYC G;  1YVC A;  3FPU B;  2D62 A;  4KN7 C;  1QOH A;  4YCU A;  1XXG A;  1MBY A;  4TRD A;  2NVY H;  1J9O A;  1IYJ B;  4CGY B;  3PIP A;  3HZX A;  2KCN A;  3M4O B;  4HJ8 A;  1IZ6 A;  5I2Y A;  4DV0 Q;  4L6T B;  2HHH Q;  2NVX H;  2AUJ D;  4PV1 C;  4YIJ A;  3C46 A;  3J81 E;  5EAY A;  5FK9 C;  1G29 1;  3CCM A;  1X9N A;  4QUF A;  1YJ9 A;  1J5E Q;  3A8K E;  3VR2 A;  4CBV A;  1TWF B;  1KLU D;  1LM0 A;  4KI0 A;  2FMC A;  4A93 G;  1MSG A;  2FFK B;  2YTY A;  5GAH C;  3T51 B;  5KYL A;  3J7Z C;  3S2H B;  1WCM H;  4KD4 A;  2F0V A;  5BN4 A;  2O2L D;  1V1P A;  4KLK A;  3GTG B;  3LWU A;  4X65 L;  3HKS A;  2UUC L;  1L1O B;  4RKB A;  1XTD A;  1I3Q H;  1D7Q A;  4KD3 A;  4A3M H;  4B3R Q;  5ELD A;  1PH4 A;  1CHP D;  1EIG A;  1G6Z A;  3M4Y A;  5C4X B;  4QUC A;  3R93 A;  1IW7 D;  4RFB A;  2OQ0 A;  1TWG H;  4QGU A;  2RDH A;  2NB0 A;  4XYQ A;  3SK8 A;  1BCP C;  1AN8 A;  4C3J H;  1EY7 A; 
#chains in the Genus database with same CATH homology
 4IN3 A;  4XDX A;  1CM9 A;  3I70 A;  1HHV A;  4K2K A;  3T16 A;  1STY A;  5DM6 3;  4PMC A;  4X3U A;  3TME A;  3H6M A;  1UUP A;  5D65 A;  2VXW A;  3S9W A;  1B53 A;  2F0O A;  3D8G A;  4A3B B;  2XIW A;  4AYB B;  5M5X B;  4DN4 M;  1ESF A;  4R9W A;  5EGT A;  4A3I B;  1I6H B;  5KGU A;  3V2T A;  3RD4 A;  2WB1 B;  2L12 A;  2CQA A;  2SOB A;  1JWU D;  5EJW A;  3R2I A;  5CV8 A;  1SMY C;  2NN6 H;  1KNE A;  1PTO H;  2BE5 C;  3S1Q B;  1BCP B;  2BA0 A;  4KMU C;  1S5E D;  2LKV A;  5C3E B;  1Y1V B;  5DNF A;  1AFP A;  4KJO A;  1TWA B;  3QIA A;  1BCP D;  3KLR A;  2E2I B;  3RZD B;  5LL6 S;  3UI2 A;  3VA7 A;  1I4R A;  4IQZ A;  5EKI A;  4OGQ C;  4CKE A;  5J39 A;  1WD0 A;  3E6Z X;  1TWC B;  2RSN A;  4IAL A;  4X3S A;  2PNR C;  4FVM A;  3T13 A;  2E76 C;  2DN8 A;  3QO2 A;  1JIC A;  4P2C B;  2K7V A;  1D2B A;  4DU9 A;  2LMC B;  5CBA E;  5E4W C;  2HUG A;  1HA5 A;  4KJN A;  4OO1 I;  1A3U A;  3MFG A;  2A5H A;  2QIL A;  4NKL A;  3CQZ B;  4IUP A;  1BUV T;  1KDB A;  2BCO A;  4IUN A;  3H3V C;  1GUT A;  1U4L A;  1YNN D;  1EQV A;  1HTP A;  1PLF A;  1WTR A;  1A2U A;  1DYQ A;  4RWS C;  1KLG D;  2XNA C;  3NTK A;  2KVM A;  1EYC A;  3NBI A;  1VF7 A;  4H13 C;  4G7H C;  3AMU A;  2WP8 J;  3IFT A;  4EVO A;  2K5D A;  5I9O A;  3JAM L;  4ILW A;  4C3I G;  1T5E A;  1DXM A;  1F2Y A;  4KKU A;  4G57 A;  4HCS A;  5JVG 3;  3BG3 A;  4U67 3;  5IGE A;  4E6I A;  1Z47 A;  2AWO A;  1S5B D;  5CMD A;  3P1H A;  1Q12 A;  1SYD A;  3MC0 B;  3U9O A;  3MEH A;  3J7A V;  1PZJ D;  4HMI A;  3TZU A;  2MPM A;  3AB9 A;  2K5W A;  1VMP A;  4DK1 A;  3HGB A;  3M85 A;  4BBS B;  2L4N A;  4ZLT F;  5CGK A;  2PZU A;  1OXS C;  4XIG S;  1NUC A;  1STN A;  4FXD A;  2A68 D;  5C0X I;  3NHH A;  3ERO A;  5DEH A;  4QMG A;  2Q8I B;  2R7Z B;  2G9H D;  1Y8O B;  4J6H A;  1A3V A;  1NCV A;  3D3R A;  2IX1 A;  3H09 A;  1RHP A;  2PZW A;  3ERQ A;  2ENB A;  1ENC A;  2EJM A;  2KOL A;  3RZO B;  4IUT A;  3G6J B;  1JOK A;  1SE4 A;  2F0P A;  1UEA B;  3HEJ A;  4HTH A;  4B9X A;  2IL8 A;  1WD1 A;  5J22 A;  2PQE A;  1U4M A;  3P7J A;  2PCF B;  3MXN A;  1TY2 A;  2QEJ C;  3T4A C;  3S1R B;  3OHX C;  1VF5 C;  2F0N A;  1F9S A;  1PYW D;  3T56 B;  2WV6 D;  3LX0 A;  2A6H C;  2EY5 A;  3J81 L;  1LAC A;  3P20 A;  4KTA A;  4IFD H;  2JE6 I;  3OMG A;  4ULL A;  1LTR D;  5CV4 A;  4F7X A;  1ML0 D;  1A2T A;  3Q22 A;  1G2T A;  1Y8P B;  1X3Q A;  3MXU A;  1BQQ T;  5M5Y B;  5FO9 B;  5FKA C;  2SNM A;  3CU7 A;  5TSS A;  5KNB A;  1NR2 A;  2F0W A;  2DNC A;  1CZG A;  3K6O A;  4H7B A;  1HQM C;  4IUR A;  4ZK9 B;  5JVH 3;  1O7Y A;  3MAQ A;  1BBX C;  2EYJ A;  1PDQ A;  1LTI D;  1H9S A;  1ZYR C;  5K5P A;  5KNC A;  1Q90 A;  2IX3 A;  1B50 A;  3A7A B;  1Y1W B;  3L9A X;  4DXG A;  5JPM C;  5D3I B;  2R3Z A;  4RH6 A;  5I6Y A;  5IGD A;  5IOC A;  2L11 A;  4K8I A;  3S16 B;  2E2H B;  4M8A A;  2A6E C;  4BWG B;  1BNZ A;  2CW0 C;  1DOL A;  1XX8 A;  1SNP A;  2OT2 A;  3V96 A;  4U68 A;  4ID6 A;  1NSN S;  1M4V A;  4DAY A;  3NK9 A;  4XQQ A;  2R92 B;  1H9J A;  3PV0 A;  1E2V A;  5BN3 A;  2HCC A;  1SXT A;  3KLS A;  5E3F A;  1IL8 A;  2CHB D;  4J1M A;  2DY8 A;  2D2C C;  5IGC A;  1F2L A;  3GV3 A;  2JYO A;  3E5S A;  1KTK A;  1ZYR D;  1RKN A;  5J1Z A;  4K6D A;  1TS4 A;  4A93 B;  4FXG C;  1SYB A;  1MGS A;  4FP5 D;  5JEA J;  5JEA G;  4F8M A;  2EJG C;  3EFX D;  2DNE A;  1EQT A;  1B44 D;  3DWQ A;  4MIU A;  5C4Z A;  3SXH A;  3KF8 A;  1EY8 A;  5C3X A;  2CW0 D;  3GP7 A;  3GTP B;  4BS9 A;  3C2P A;  2ZXO A;  1ILP A;  3OIP A;  5EQ0 A;  4LJZ C;  4ZUJ A;  2B2Y C;  1SNC A;  5C0X G;  4RHS A;  5ELE A;  3FKI B;  2XVS A;  4LAA A;  4X3K A;  1TY0 A;  3HS0 C;  1MI2 A;  2RQX A;  3FVQ A;  3MVV A;  4EQN A;  1Q1B A;  2M2L A;  1E2Z A;  3K59 A;  1DM0 B;  1RTO A;  1ZKO A;  1DD2 A;  1U4P A;  1VDZ A;  3D6C A;  1W6K A;  3QJY A;  2EYP A;  3I90 A;  1BCP F;  1WVL A;  2MUY A;  2XRQ D;  2FJ2 A;  1PMR A;  2LFN A;  4R8N A;  3FEW X;  5IGG A;  3SK6 A;  4WFN 3;  1IYU A;  3CHB D;  1LT5 D;  3VR3 A;  1QIL A;  1PFM A;  2JXM B;  2WKC A;  2Z4H A;  1STA A;  2F0U A;  4GZY C;  1I4Q A;  1S5C D;  4NW2 A;  1B3A A;  1TS2 A;  3NTH A;  4RGO S;  1H9R A;  1EY9 A;  2R61 A;  3K58 A;  1HQR D;  1D5Z C;  1PTO C;  1G2S A;  1JWS D;  1TII D;  2A69 C;  1EY4 A;  1ROD A;  2KUM A;  1QWY A;  1B9M A;  4RCN A;  5ELF A;  1ZXT A;  1V1O A;  4NDX A;  1KDC A;  4RA8 A;  2NZ1 D;  1IHZ A;  1PRT B;  1JOO A;  1HXY D;  3T53 B;  2VB2 X;  1KAB A;  1HTL D;  3I3C A;  1D5M C;  2KCC A;  4LMQ D;  4CHT B;  1PRT D;  4O1N A;  1GJX A;  2PZT A;  4KKT A;  2M00 A;  1LTT D;  5JAV A;  3O13 A;  4BY7 B;  2B63 B;  3S17 B;  1FR3 A;  4H44 C;  1DCZ A;  4XQN A;  1CHQ D;  2K28 A;  4DAV A;  3ND8 A;  2F3W A;  5C44 B;  2Y0S B;  4CKB A;  2F0D A;  2KJX A;  1JOR A;  5EPK A;  5EBC A;  4C3I B;  5G3L D;  2R6G A;  5EKL A;  4OIK A;  2IX0 A;  2L9H A;  2NVQ B;  2O5J C;  4H0L C;  1ZEQ X;  1EZ8 A;  1ET6 A;  1SYC A;  1A6X A;  2PMZ B;  2KED A;  3KBG A;  4J8Q A;  3TBI B;  2B2W C;  1JR0 D;  3W3A A;  2F0J A;  2EY6 A;  4XQJ A;  3WOE A;  4KY7 A;  2K03 A;  3S1M B;  1HPC A;  2JP1 A;  3C3L A;  4MHE A;  1BF4 A;  4KY5 A;  5M3M B;  2F0L A;  3OOC A;  3QOJ A;  5A2Q E;  1F2M A;  1ONL A;  1SDF A;  1TT2 A;  5D3D A;  2JA8 B;  3AU7 A;  3K0Y A;  3A55 A;  1TS5 A;  4S3S A;  4WRD A;  4C2M B;  2F0F A;  2FMM A;  1FNU A;  3I8Z A;  4RGM A;  3H94 A;  3G7L A;  3S15 B;  1EOT A;  1W6J A;  4G4K A;  2ICI A;  3J7Y W;  4CKC A;  2FHT A;  3FRP B;  3W2D A;  2RSO A;  2B2U A;  2JEB I;  3Q24 A;  1SYF A;  2PO4 A;  1SMY D;  1DZ1 A;  3I91 A;  3BDC A;  2BE5 D;  5IIF A;  5CBE E;  2KEE A;  1JCK B;  1TKW B;  2NVT B;  2RBM A;  3OW7 A;  3FPP A;  4KV6 A;  3SEB A;  4FNF A;  1WTV A;  2F0E A;  2EZV A;  3DWP A;  2JA5 B;  1EFI D;  2PW5 A;  4HSV A;  5IOD A;  1FYC A;  4K14 A;  3DM1 A;  1I6V C;  1X32 A;  1TQO A;  3QB3 A;  5FLX L;  2ZXR A;  2Q8T A;  3QWN A;  3I4L A;  1D1I A;  3GTQ B;  2Z4I A;  4HR7 B;  2E2D C;  2EYO A;  1CZW A;  2OEO A;  2LS0 1;  1RF2 D;  5K36 G;  1BR9 A;  3VYS A;  2MHV A;  2F0M A;  3R2T A;  3SVM A;  3QOL A;  1I50 B;  1TVX A;  1CQV A;  4K5X A;  2HQE A;  5CV6 A;  1TWH B;  2J7Z A;  3BS1 A;  1JE4 A;  3ONA B;  3D31 A;  1A3T A;  1V43 A;  1O80 A;  1YNJ C;  2K33 A;  1DON A;  5KRU A;  5CV7 A;  5CC4 A;  1KNA A;  4IUV A;  2B2V A;  4IZ8 A;  1EZ6 A;  5NUC A;  1S5D D;  2WAQ B;  2EJF C;  3V05 A;  3KLS X;  3TDQ A;  2Q8R E;  3PO2 B;  2AUK A;  4BBR B;  1HUM A;  3NP8 A;  4F88 A;  2O5I C;  4PMW A;  2R93 B;  2K32 A;  4ME5 A;  3H91 A;  5COY A;  4DXF A;  2SEB D;  4ZUI A;  1SND A;  5LHY 1;  2NWG A;  3WOF A;  2B2T A;  1H9M A;  2K6A A;  4FF4 A;  2DY7 A;  2RDG A;  3NE5 B;  1BDO A;  1LTB D;  3MTS A;  3J80 E;  5CV9 A;  3OMC A;  2A74 C;  1JC7 A;  3HOW B;  2ICE C;  5IGB A;  4ZAI A;  1EYD A;  1RTN A;  3P75 A;  2NTS A;  1YNJ D;  4OO1 H;  4CJ0 B;  5A35 A;  4FF3 A;  4R8I A;  2GA4 B;  5F2D A;  2H1E A;  3TN2 A;  3D4D A;  1DOK A;  1LTS D;  1WTX A;  1G91 A;  3A7L A;  4K2L A;  2BDO A;  1NR4 A;  2AQ2 B;  1SSO A;  3MZ5 A;  1CI3 M;  1JWM D;  2F4I A;  5I6W A;  4QIW B;  2A6H D;  1F9P A;  2X6G A;  1WTP A;  1TS3 A;  1UNS A;  2JA7 B;  5T1G A;  3MXG A;  5JEA H;  4LK1 C;  1CFM A;  4G7O C;  1GUS A;  2EPB A;  3N52 A;  4M1U B;  4I7Z C;  2F3V A;  1H9K A;  3HOY B;  2D5D A;  1SFO B;  1F2Z A;  1UAP A;  3VYR A;  3HOZ B;  3PO3 B;  1ESR A;  4DGZ A;  2WKD A;  1O7Z A;  5ELB A;  4K6L A;  2EYM A;  1PRT F;  1ENF A;  1F9R A;  3S2D B;  2JSO A;  5FOB B;  3BZD B;  4TKO B;  1EY5 A;  1S4Z A;  1HFG A;  3EJI A;  3K5M A;  2I07 B;  2B2W A;  2FIN B;  1LTG D;  4G7Z C;  1WTO A;  2BA1 A;  2A6E D;  1MD2 D;  4ZYS A;  5G3L F;  3OWE B;  3SK4 A;  1EY0 A;  4C3H G;  2E74 C;  2SNS A;  1RDP D;  3BDL A;  1RCV D;  2K1B A;  2F03 A;  2F0G A;  4A3F B;  2BDN A;  1C8C A;  4ODG A;  4XT3 B;  1LO5 D;  4L63 B;  2J4X A;  2O4X A;  3I4N B;  4DF7 A;  5C0X J;  1V8Q A;  1CA5 A;  1RJT A;  2TMP A;  1B9N A;  2H4O A;  1T5X D;  5FO8 B;  2L55 A;  3NWT A;  5JJZ A;  2I46 A;  1ICW A;  1X3P A;  3RUZ A;  2M9V A;  4OL7 A;  2OF1 A;  2NN6 I;  1MSH A;  4HAE A;  1PZI D;  1STB A;  3IL8 A;  3L7Z C;  3URY A;  3CKI B;  3X3N A;  4XYO A;  1J8I A;  1I4X A;  1Z7T A;  1TR5 A;  4N9T A;  1I4P A;  1ILQ A;  1F9Q A;  3RLF A;  4B08 A;  1HUN A;  3HOU B;  1EYA A;  5KIX A;  5JOB A;  1D5X C;  1RD9 D;  3DHQ A;  4V0B A;  4X3T A;  5HGT A;  2E2J B;  2EY1 A;  2F0I A;  1FGB D;  3SK5 A;  1IW7 C;  1GUO A;  3N6R A;  4JBW A;  1EL0 A;  1OXV A;  4C3J B;  3EQL C;  3HOX B;  2F0K A;  3VR5 A;  1II3 A;  2AQ1 B;  5KYI A;  2SDF A;  1IKL A;  2QKI C;  5FO7 B;  3HG9 A;  4PNY A;  1PFB A;  4DA2 A;  2K05 A;  1EIH A;  1CA6 A;  4KHZ A;  4BA1 I;  2NUC A;  3GTL B;  4HCE A;  3GQB A;  5ISR A;  3K5O A;  5DM7 3;  5I2X A;  2N55 A;  5E4X A;  1LLR D;  2RKS A;  1C4Q A;  3OSO A;  4HED A;  1GUW A;  3VYU A;  1XTC D;  2F0S A;  4C1N I;  1HFN A;  4BY1 B;  4OHJ A;  4QCL A;  4JK1 C;  3SDZ A;  5C5M A;  1PTO B;  2K01 A;  3HP3 A;  2IJ0 A;  2EVB A;  3NWS A;  3EA6 A;  4FF1 A;  3OIQ A;  1WTW A;  3WDN A;  1PTO D;  1OXU A;  2WII B;  5C3W A;  4WOR A;  5C6A A;  1SAP A;  3C1E A;  3J80 L;  1CTM A;  2A69 D;  4Q0F A;  3PUX A;  3CRL C;  2EE1 A;  5KND A;  2E75 C;  3K7A B;  1SEB D;  2WIN B;  4A3G B;  4FXK C;  3D6W A;  4XXE A;  4WJW A;  1OO9 B;  2YU9 B;  5CR3 A;  4O42 A;  2Z8L A;  3DUZ A;  1H9S B;  2HDM A;  2ZXP A;  1QJO A;  2AQ3 B;  5E1F A;  3TZD A;  4RKL A;  3VR4 A;  1AZQ A;  3Q6S A;  1U9R A;  2ZT9 C;  4A3J B;  2X69 A;  2B8G A;  3TP7 A;  3PIP 3;  1AZP A;  1QE6 A;  3U9S A;  2OXP A;  2XWB B;  3A54 A;  4F87 A;  5IGF A;  3M3Y B;  1YNN C;  3NPP A;  3GTO B;  4RGN A;  1FD7 D;  4C3J G;  5DAU A;  1I4G A;  3BYT B;  3KK7 A;  1GXD C;  2L1B A;  3L3O C;  3TP5 A;  3PMF A;  3NQI A;  1BOS A;  1QNU A;  3OPO A;  4FF2 A;  4IFD I;  3NXW A;  4PMB A;  1GHK A;  1EU3 A;  4KHV A;  4RAU C;  3K57 A;  1CK1 A;  2QF7 A;  1DJR D;  1SNQ A;  2HDL A;  3LWE A;  4N9P A;  1Y69 U;  1FNW A;  1EWH A;  2WAC A;  1L0Y B;  1Q3L A;  4C1N K;  1GHJ A;  3DEP A;  1SBB B;  3DXJ C;  4ZKC B;  3S1N B;  3A8J E;  4UAI A;  4ZRZ A;  4DNR B;  4ZQ3 A;  4HSP A;  5K36 H;  5C5L A;  1PXU A;  3F2U A;  2NN6 G;  1K8O A;  3I4M B;  1E0B A;  1S5F D;  2PYK A;  2V4D A;  2A68 C;  4HMJ A;  1U4R A;  1CT1 D;  3BVG A;  1K8M A;  3ZYY X;  4CJ1 B;  1GOZ A;  1IYV A;  3HRZ C;  3K5N A;  4TQU S;  2VUM B;  5CV5 A;  3S14 B;  1EWC A;  4ZKB B;  1STG A;  3GTJ B;  2B39 A;  2KQ3 A;  5IT9 E;  1C48 A;  1GUG A;  3A56 A;  2G9D A;  1AW7 A;  3VYT A;  1R9T B;  3NBH A;  2F0H A;  2J0T D;  1Y8N B;  4K5W A;  2JEA I;  4KK7 A;  3TP8 A;  2AWN A;  4A3E B;  3E0J A;  4QF4 A;  4XT1 B;  4NP5 A;  3QG1 A;  1O7L A;  2F0Q A;  3NTI A;  1LV9 A;  5M5W B;  3TP6 A;  1FNV A;  1B1Z A;  2A73 B;  2B2Y A;  5JPN C;  2JA6 B;  4RHR A;  5T1I A;  3KUP A;  2K04 A;  3C1F A;  2RA4 A;  3SE0 A;  2KA7 A;  1LAB A;  2C9O A;  2F1M A;  1KAA A;  2IT1 A;  1ENA A;  2EDG A;  1QNK A;  3IKJ A;  1SYG A;  1SE2 A;  3GTK B;  1JOQ A;  3DWA A;  1I4H A;  3IAY A;  2XN9 C;  1DOM A;  1Q8I A;  3RMH A;  4V19 0;  4NMZ A;  2IPK D;  1V1P B;  4EQP A;  5C4J B;  4C3H B;  2N88 A;  1XWE A;  4MN3 A;  4L8J A;  2YYZ A;  4A3D B;  4EQO A;  3PIO 3;  1PZK D;  1QB5 D;  4B9W A;  3BDO A;  3BVM A;  1SYE A;  4CJ2 C;  2ID0 A;  1BXT A;  4Z9C B;  3MHB A;  3NUC A;  2XSC A;  5KEE A;  2KEC A;  3DMU A;  5COR A;  5EPJ A;  2EYH A;  3HOV B;  4IUU A;  4DAP A;  3NSW A;  4OIJ A;  3SHL A;  3MWY W;  1B2T A;  1A15 A;  2VNU D;  3LNN A;  5CYU A;  1LT3 D;  2EY2 A;  1JQY D;  3I72 A;  5I4D A;  2QDB A;  1NAP A;  4A3K B;  5C4H A;  1B4O A;  2HCI A;  1XYI A;  5EKK A;  5I9P A;  4C56 C;  1EEI D;  4IFD J;  1O78 A;  1Z6H A;  1HRJ A;  4IFD G;  1D1K A;  4QB4 A;  3TSS A;  4UDU C;  4BA2 I;  1LT6 D;  2L5T A;  4K5V A;  1WTQ A;  1R4Q B;  5ELC A;  1QCB D;  3VA5 A;  2D9U A;  3K5L A;  4TSS A;  2B2U C;  2MJ8 A;  2NYZ D;  3H0G B;  5LL6 X;  3MXP A;  2X6L A;  1EU4 A;  1ET9 A;  3M7N A;  3DEO A;  5A2Q L;  1VCI A;  3HKZ B;  1E2W A;  4KY6 A;  4OO1 G;  4KN4 C;  2L0C A;  3Q0A A;  5M9O A;  2K5Q A;  5C0X H;  3GO5 A;  1D6E C;  2VB3 X;  3NQT A;  3MA2 B;  1STE A;  2EYF A;  1HA6 A;  3A8I E;  3KBX A;  4XTC S;  5M3F B;  2PPB C;  3EVQ A;  4DFA A;  1JB3 A;  1SJE D;  2B8F A;  1OXX K;  1PTO F;  3M7G A;  2EYL A;  3D4R A;  3ITP A;  1SNM A;  3FDT A;  2CVR A;  1TU2 B;  2LY7 A;  1LT4 D;  2NTT A;  2KHS A;  1STH A;  2XWJ B;  3PUZ A;  1SNO A;  3GV6 A;  3R8B A;  3OWF A;  2EOT A;  3SR1 A;  2NBF A;  1VMC A;  2C5C A;  3JAM E;  4Y7N B;  4DNT B;  1K83 B;  4RCO A;  5EBD A;  5BN5 A;  3MFY A;  3PUV A;  1CQF A;  1HCZ A;  3PUW A;  3IFD A;  3X3M A;  1EEF D;  1GUN A;  4RGT A;  2NVY B;  4IUQ A;  1L0X B;  2TSS A;  3VR6 A;  4EGV A;  1OXT A;  4FYD A;  2NVX B;  2RVL A;  2QCP X;  2IWH A;  4K8J A;  3ND9 A;  4DK0 A;  3R3O A;  3PUY A;  1F77 A;  1PFN A;  5D14 A;  5FLX E;  3D4W A;  3GD7 A;  2PW7 A;  1AEX A;  2EXZ A;  1LTA D;  2IW3 A;  4FO2 A;  4HN7 A;  2B2V C;  1SJH D;  1Q1E A;  2MP1 A;  1WCM B;  5IT9 L;  4PQX A;  1M8A A;  1R4P B;  2XRS D;  2Z1C A;  4ABN A;  3Q23 A;  1G8Z D;  3CRK C;  1IKM A;  1I3Q B;  4A3M B;  1PRT C;  3BYY B;  2RDF A;  1SE3 A;  3BVZ A;  2MGS A;  3I73 A;  4Q5V A;  1TWG B;  5HUR A;  1BO0 A;  2F0T A;  1QG7 A;  2BOS A;  5AFW A;  1EY6 A;  3J7A F;  1KDA A;  4KKS A;  3GTM B;  2B2T C;  3FMC A;  1AP0 A;  4I65 A;  5EPL A;  3FPU B;  2D62 A;  4KN7 C;  1QOH A;  1XXG A;  1MBY A;  4TRD A;  1J9O A;  4CGY B;  3HZX A;  2KCN A;  3M4O B;  5I2Y A;  4L6T B;  2AUJ D;  4PV1 C;  4YIJ A;  3C46 A;  3J81 E;  5FK9 C;  1G29 1;  4QUF A;  3A8K E;  3VR2 A;  4CBV A;  1TWF B;  1KLU D;  4KI0 A;  2FMC A;  1MSG A;  2FFK B;  3T51 B;  5KYL A;  3S2H B;  5BN4 A;  4KD4 A;  2F0V A;  2O2L D;  1V1P A;  3GTG B;  3LWU A;  4RKB A;  4KD3 A;  5ELD A;  1CHP D;  1EIG A;  1G6Z A;  3M4Y A;  5C4X B;  4QUC A;  3R93 A;  1IW7 D;  4RFB A;  2RDH A;  2NB0 A;  4XYQ A;  3SK8 A;  1BCP C;  1AN8 A;  1EY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...