2IL8A

Three-dimensional structure of interleukin 8 in solution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of interleukin 8 in solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords INTERLEUKIN-8
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2il8A00
1WD0A 1SAPA 1PFNA 1PLFA 4X3UA 5DNFA 1HUMA 1B3AA 4DN4M 1F2LA 1A15A 4HAEA 2FFKB 2B2VC 4LMQD 3GV6A 2H1EA 2FJ2A 5D65A 1B2TA 1VMPA 1DOLA 3KBXA 2RSNA 4X3TA 2KUMA 1CA5A 2HDMA 1F9PA 2FHTA 3DEOA 1EL0A 1G2SA 1WTXA 4R8IA 4MN3A 2KVMA 1AZQA 4CJ0B 2KOLA 3MWYW 1IKMA 1B53A 2KEDA 1CA6A 4MHEA 1B4OA 4UAIA 2RVLA 4ZKCB 3I90A 4RWSC 1BO0A 2DY8A 4X3SA 2B2WC 2HCCA 1C8CA 1NCVA 1HFGA 1MI2A 2L9HA 2CVRA 4OIKA 3SVMA 2HUGA 1RTNA 1U4MA 3DEPA 2MP1A 1AP0A 2K28A 2XIWA 1M8AA 3H91A 5T1GA 2K03A 4U68A 4XT3B 2FMMA 1SSOA 1VMCA 2K1BA 3I91A 2KECA 2JP1A 1CM9A 3GV3A 1PDQA 1LV9A 1EIGA 1O7YA 3D6WA 2L12A 2M2LA 4XT1B 4ZLTF 3P7JA 2B2VA 5EPLA 2D9UA 4IUPA 2EPBA 2JYOA 3ONAB 4IUUA 5COYA 1HFNA 1HRJA 2L1BA 1NAPA 1ZXTA 1BNZA 1J9OA 1MSGA 1WTVA 1MSHA 1SDFA 2NZ1D 1AZPA 1QE6A 4XDXA 1F9RA 4IUTA 3TZDA 4CJ2C 1JICA 5CMDA 1BBXC 5T1IA 2IL8A 4IUVA 4RA8A 2B2WA 3F2UA 1E0BA 3UI2A 5E4WC 1O80A 3Q6SA 1BF4A 1PFBA 1EQTA 1RODA 2EE1A 1DOMA 1G6ZA 5EJWA 1X3PA 1ESRA 4CJ1B 4QUFA 3LWEA 1J8IA 1ML0D 5EKIA 1WTRA 2VXWA 1QG7A 1B50A 3HP3A 2N55A 2MPMA 1DOKA 1WTQA 1X32A 2K05A 5CBAE 5EPKA 1WD1A 1XX8A 1IKLA 5AFWA 2L4NA 3MTSA 1ICWA 1Q3LA 1JE4A 4RAUC 5E4XA 4R9WA 4ZK9B 1PFMA 2NYZD 1RTOA 5EQ0A 1X3QA 1RJTA 3IFDA 5CBEE 1WTPA 2Q8RE 1F9SA 1IL8A 1F9QA 2BDNA 2N88A 3R93A 1KNEA 2DY7A 1RHPA 2FINB 2K04A 3G7LA 2MGSA 4ZKBB 1DZ1A 4IUQA 4O42A 1ILQA 1S4ZA 1WVLA 1HUNA 2B2UA 3N52A 4HCSA 4IURA 2B2TC 2HDLA 5D14A 4ZAIA 1U4RA 1WTWA 1EOTA 2SDFA 1O7ZA 4NW2A 4QUCA 2L11A 5EPJA 1EIHA 4HSVA 3I8ZA 2X69A 3KUPA 1GUWA 2X6GA 1G91A 3FPUB 2Q8TA 1MGSA 1U4PA 2RA4A 1G2TA 5JJZA 2B2YC 1DONA 4HEDA 3I3CA 1TVXA 1WTOA 2EOTA 2NWGA 1HA6A 2HCIA 3TN2A 1HHVA 5CORA 2R3ZA 1NR2A 3FDTA 2B2YA 2B2TA 1U4LA 3QO2A 4X3KA 1NR4A 2K01A 2B2UC 2RSOA 2J7ZA 2X6LA 2MJ8A 1XYIA 4OIJA 2KEEA 1KNAA 1ILPA 3IL8A 1QNKA 3DM1A
chains in the Genus database with same CATH superfamily
1Q12A 2NZOA 4PQXA 4RCNA 1GM5A 2BE5D 4LF6Q 5IODA 2PZUA 1TY2A 1UE7A 5CV7A 4DAMA 5C44B 2E2IH 4A3JG 4NDXA 2UUBQ 1CZGA 4MNOA 4FXDA 4DV6L 4JG2A 2NTSA 4CJ0B 2KOLA 3A8KE 1V9PA 4DAYA 5LL6X 1CA6A 5C4XG 3T53B 1EYGA 1JOKA 5E1FA 3GTOH 3HG9A 3MXUA 4WORA 2MP1A 3L9AX 1M8AA 2BA1A 5T1GA 1Q1BA 5HGQA 1L0XB 1VQHA 1I3QH 1CSPA 3PUYA 4XT1B 3M3YH 1FL0A 4N9TA 3I4NB 1LYLA 4IUPA 4IZ8A 3AYHB 4LK1C 1H9RA 1HFNA 4JI4Q 1NMGA 1MSGA 3PGZA 3C46A 3HOWH 2IL8A 4OO1G 2SNSA 1E2VA 4HIMA 1EU3A 3EBEA 1T5EA 1IW7C 4NXML 2C35B 2UUAL 4ZYSA 4QGUA 5EAYA 3GTPB 1RDPD 1GUGA 2WAQE 4TQUS 3T13A 3R93A 1E2ZA 3S1MB 3VYTA 3OIQA 1VQ9A 3F2BA 3ND8A 2GVAA 3I55A 1Y1WH 3M85A 1YVCA 1U4RA 1O7ZA 1U0LA 2ZT9C 3M4PA 2L11A 4GNXC 3L2PA 2WAQB 3C3LA 3VDYA 4DV0Q 3J81i 4MTKA 4A3FB 4A3LG 5ELCA 1U4PA 3OMGA 2K5DA 2RDHA 3IAYA 1WCMH 2VL6A 2KCTA 3A74A 4YCUA 5ELFA 4DK0A 2JA7B 3A55A 2PNHA 2J7ZA 3PF4A 3S2DB 5DM73 1X3GA 4C3HG 2JEAI 3E3XA 3H0GG 4BBRB 4DV4Q 1QWYA 1VQGA 2QEXA 1KXLA 3BVZA 2QEJC 3BG3A 4HCEA 3HOZB 5DNFA 5M9OA 4PZ7A 4K2LA 2FFKB 2KCNA 2H1EA 3I4MG 1B2TA 3OWEB 1M1KC 1EL0A 2EVBA 2KVMA 2QILA 2ALYB 1AZQA 2E2IB 3HOYB 4N9PA 2F0NA 3HS0C 2YYZA 1LUZA 5EBDA 2B2WC 3CD6A 1M4VA 4GLXA 2VUMB 2IY5B 1BUVT 2G9DA 4GOPB 2AUKA 5GADC 3TP8A 3I4NG 5M5XH 5ELBA 3P7JA 2I0QA 1C4QA 2D9UA 2EPBA 3I4LA 2V1CC 4DR4L 3B6YA 1PMRA 5FLXE 3BVMA 4AYBE 4LF9Q 1EYCA 1OXUA 4YCVA 2NZ1D 1QE6A 2V4DA 1JICA 1XMOL 1BCPF 3H94A 5T1IA 4IUVA 2LXKA 2PYKA 3I7FA 5H1SE 1D1IA 2EE1A 1SFOH 1IBKL 2GN5A 1JR0D 1CK1A 4CDFC 4JVZA 1KHIA 2B29A 4B3ML 1D5MC 4GKKL 3K7UC 1N36Q 1XX8A 1Q7YC 3X3NA 3EN2A 3MC0B 4BBRH 1JE4A 1WI5A 3PMFA 1RTOA 1H9MA 5CBEE 5IE8A 1VQBA 1VQCA 4DV2Q 3T1YQ 4O2DA 3LWUA 3UDXA 4CDDC 1WTWA 4DV7L 3K57A 2H4OA 4XYQA 3G48A 1HZ9A 2A69C 1FD7D 4JBWA 3WWVA 4RMFA 4K2KA 1K0RA 1K8MA 1II3A 2PMZE 1G91A 1W6JA 4DKAC 2ENBA 2A6EC 4RGNA 3SK4A 1WTOA 1CKNB 4XQQA 2BH2A 3PIOA 1I4HA 3KLWA 1JQYD 1UUPA 3VR5A 5KEEA 1BVSA 3VR3A 3TDQA 1OXSC 1K8OA 3QO2A 1ZYRC 4UP7A 1XYIA 2F0TA 2CQOA 1JC7A 4A3EH 1ILPA 1L1OA 2JA5B 1KRSA 1TWHB 3AU7A 3S24A 4L6TB 2B3GA 1VQEA 5C6AA 4IOAA 1VMPA 1DOLA 1OXVA 2A1AA 2RHQB 5JPMC 2HHHQ 5EKKA 3CW2C 5CV8A 3GQBA 3G71A 3KLSX 1GHKA 1HQMC 3GTJB 1CHPD 2I46A 3I90A 4RWSC 4DV5Q 4FF1A 2G5DA 1ICFB 2ZTDA 4BXXG 4GS3A 4UPAA 2F0VA 4BY1B 1DGSA 1JMCA 2WAQG 4DK6C 4RGMA 1JB7A 1JJCB 1EWHA 2F0SA 3TREA 3W1BA 4LF7Q 2ID0A 4GZYC 1SDFA 3S15H 4IFDI 4WRDA 1E22A 3J81c 4DV5L 1K8GA 4XIGS 4EX5A 1QVCA 1R9TB 3PQIA 3GP7A 1BF4A 4HSPA 1I94Q 3AFQA 1SYCA 3QR8A 1SMYD 5EKIA 2K4KA 1QG7A 5KNDA 4DUYQ 3AMUA 5IT9E 1X32A 5CV5A 3VR4A 4ME3A 5EKLA 2N78A 5AJ3L 4XQJA 4WJ4A 3H3VI 1JJ2A 3HOXH 2LXJA 1Y69U 2K04A 2F03A 2WFWA 2UUCL 4L5QA 2OQ0A 2GVBA 3FKIB 1A2UA 3N52A 3PUZA 2AHOB 3ULLA 1VDZA 1F2MA 2B2TC 1XNQL 2OF1A 2XRSD 3FHWA 4NW2A 3E6ZX 4DR6Q 2X69A 2EYFA 1VQFA 3OOCA 5FJ8H 3CCSA 3EJIA 1RF2D 1GUTA 4F8MA 1EY0A 4ZRZA 3Q23A 2NVTH 4AQYQ 4B3MQ 2AWNA 1JJGA 3VA5A 3PO3H 2K01A 3JAML 3GTLH 4YCWA 2WV6D 3RN5A 4K5WA 5C0XG 2O5IC 3NBIA 2JA5G 5M5WH 1A6XA 2R7ZG 5F2DA 1X3EA 3HRZC 4QJFA 3M4OH 1RL2A 2PZTA 4GN3B 5M3MH 5IGFA 2KUMA 1CA5A 3RD4A 1YIJA 5C4XB 1AE2A 3D6CA 5IGDA 1HQRD 4DR7L 4PNYA 2K7VA 3DLLA 1K3RA 3PIP3 4EGVA 1L1OB 1DCZA 3MFYA 2XN9C 4PZ8A 1AP0A 4LF9L 1SYBA 3VR2A 1C7YA 1XPOA 1XPRA 1SNMA 3V96A 1Q81C 3GV3A 1G8ZD 5IGGA 3GTMB 1EIGA 1PXUA 2R7ZH 2EZVA 4OELB 1S5CD 1VQOA 2F3VA 5FO7B 4IUUA 1NAPA 4JK1C 1WTVA 1X6OA 3PCOB 3TBIB 3RZDH 3T4AC 3R2TA 4DUZL 1NBWA 4H02A 1SRUA 3MEHA 2K6AA 3DWQA 1EEFD 5GAGC 4A3DB 2EY5A 1ML0D 1WTRA 1B50A 2KHSA 3HP3A 2A73B 1WD1A 1HR0L 4GKJL 2F0FA 4IFDH 1EUJA 2VQFL 1RJTA 1Z7TA 1D1KA 2TSSA 5I2YA 1E24A 5BN5A 3HOXG 4R4CA 5C4XH 2UXDQ 1ENCA 4FF2A 1N33Q 1BBUA 1PZKD 3TSSA 4JW0A 1S5ED 3H3VC 1YHQA 4OX9L 1UNSA 1EQQA 2CQAA 3RZOH 1PTOC 4DR7Q 1ENFA 5LHY1 3HGBA 2WB1E 1MIUA 2CKZB 2C9OA 2JA7G 2YTYA 1G51A 2DJFC 4JI5Q 4A75A 2RHSB 3S1NB 4PZ6A 3FDTA 2ASBA 4G7HC 2Y0SE 2VW9A 4FO2A 5I9PA 4TVAB 5JAVA 2CWAA 3JAMi 5C3EG 3J7ZC 4C3JH 3FEWX 1DJRD 2UUAQ 2QDLA 4NXMQ 2Y0SB 4JI1L 5KYLA 1NJIC 4LMQD 2XWJB 2MUYA 4AQYL 1ZYRD 1TWHH 2FHTA 2NVQH 5C4HA 2I07B 2HT1A 3MXGA 5IWAL 3GTGB 4ZCKA 4A3EB 3NWSA 3S14H 1OO9B 1YBYA 4ZKCB 1EFID 4JI7L 4APVA 3OTOQ 2F0GA 1C8CA 5IYCH 1IL2A 5C0XI 2MFIA 3H0GB 2LKVA 2EDGA 1JCKB 1K8AC 4JI4L 4U68A 2R92G 1LTLA 1VMCA 4P2CB 2Z8LA 3F1ZA 4KY6A 3W5OA 1FNVA 4C1NI 3D4RA 3NPPA 1UE6A 2IJ0A 2KBNA 4C56C 1ZXTA 5JJIA 2NVXB 4OXPA 3RZOB 4HIDA 3TZDA 4IUTA 5CMDA 5FOBB 3ITPA 4KV6A 4FF3A 3J80L 2VNUD 1O80A 1CQVA 1EQTA 1PH2A 1PYWD 3M9BA 4EVOA 2R93G 3LWEA 3SK6A 1TKWB 1KC8C 1PRTC 3AQQA 4A3GB 2L4NA 3MAQA 3PO3G 4JI6Q 1PYBA 3GTPH 5M3MG 2N88A 3GDEA 4IUQA 1WVLA 1S4ZA 1Y8OB 4Y7NB 1HUNA 4BY1G 3LGJA 3MXPA 2O2LD 4ILWA 1CZWA 4R8NA 1HNXL 5IGEA 4JPBW 2N8NA 4JI2L 1WJJA 4IQZA 2EYHA 1EEID 1EY9A 1TR5A 4LF8L 2AQ3B 1HXYD 4G57A 4B3TL 2NVXH 2KCMA 4NKLA 3EQLC 4JBJA 1AFPA 3A0JA 1GOZA 2UU9L 2H5XA 3FRPB 4RFBA 3VYRA 5ELDA 2L55A 1I4QA 1U4LA 4JOIC 1V1PA 1QUQA 2MJ8A 1V43A 5EBCA 4ZUIA 5CV9A 4PG3A 4YY3Q 1LTID 4R4OA 4RG1A 4QY7A 3CCJA 3J7YW 1STBA 2R7FA 4LF4L 2B63G 2EJGC 5IYBH 3J7AF 5I6WA 1WTXA 4LF5L 1CKOA 5DLQE 1IYUA 4UAIA 4O1NA 1DM0B 1IZ6A 4YWLA 5C3WA 1SJED 1X54A 3OWFA 1PH5A 2XIWA 2EXDA 3QG1A 1UAPA 2K1BA 5CGKA 1PDQA 2A68C 4A3KH 3FP9A 2L12A 3P20A 4A3FG 3L7ZC 4P73A 4KJOA 3HKZB 5HY6A 3E5SA 4E6IA 1VQ7A 1RIPA 1PRTB 2B2WA 3Q6SA 2AWOA 4B3RQ 1EZ6A 3G6JB 4CDCC 2WIIB 4ME5A 4YWMA 1IBKQ 4NP5A 5JEAJ 4Z9CB 4V190 4I7ZC 3AB9A 4JV5Q 3STBC 4QIWE 4OHJA 2BH8A 1N8RC 2CCZA 3R3OA 2K5HA 3K6OA 2NYZD 1X3QA 1VQAA 3PO2G 2Z6KC 2ZXRA 2DY7A 3G7LA 4V0BA 5IYDH 1VCIA 1DZ1A 1EOVA 1KLGD 3CCRA 4JOIA 4IJLA 2UU9Q 2OTJA 3EFXD 3OW7A 1Y1VH 1PH3A 1QZHA 2IPKD 5E7NA 2E8GA 3KJPA 2CH4W 4YY3L 1GUWA 3I72A 4O0AA 3SE0A 1O7LA 2A6HD 3T16A 3X3MA 1D2BA 5JJZA 3G6EA 3SEBA 1R4PB 2RBMA 1Y1WB 4K0KQ 1E3PA 4MTNA 4ABNA 2WKCA 5HURA 4EQNA 3OHXC 1NR2A 3A7AB 2BOSA 1QILA 3J7A5 1JWUD 4B3SL 2I5MX 2NVYB 4A4IA 1E2WA 1WD0A 1CHQD 1SAPA 3K58A 2EYLA 1BR9A 2JA5H 1VF7A 1HUMA 5IIFA 1F2LA 1A15A 2EY2A 1LT4D 4FNFA 4X3TA 1IW7D 4QCLA 3DEOA 4OO1H 1VQ6A 1CSQA 5M3FB 3L3OC 1B53A 4KMUC 3ULJA 2KEDA 1HNWQ 2DNEA 2RVLA 1K9MC 1PTOB 3PSIA 1NCVA 3W2DA 1LACA 4CKBA 1C0AA 3NP8A 4XT3B 2EJMA 3CHBD 2D0OA 2JP1A 4BWGB 2Y0SG 3JAME 3UDFA 4S3SA 1KDBA 2B2VA 1SYDA 5IP7H 3FVQA 3ONAB 3H3VH 3Q22A 1XWEA 4DR1Q 4XDXA 4ALPA 2OCEA 2D0PA 2YU9H 3UI2A 2JA6G 4UHVA 1TU2B 4A3CH 4LFCQ 4ZUJA 2NVTB 1STYA 1FR3A 1HTPA 4IPHA 3GTQH 5J3BA 3PV0A 1S72A 1V1QA 1WCMG 4G7OC 3OYYA 2R61A 2JEBI 5FK9C 4X65Q 4JYAL 1LM0A 5AFWA 1X9NA 4WJWA 1KABA 3KDFA 2CWPA 3DWAA 3HOXB 2MGSA 5C0XH 2ZXOA 4J1MA 4UP8A 4IPCA 1EQRA 2F0LA 2XSCA 1LTAD 1EOTA 2BDOA 1I4RA 2IWHA 2QW7A 3TQYA 5TSSA 2IW3A 1NUCA 1F77A 1Z9FA 3K5MA 4OX9Q 1SNQA 1PA6A 1DONA 2O5JC 4LFAQ 2R7DA 1U9RA 2ZJQA 2A19A 3C1EA 1HNZL 1VQDA 1HHVA 4C3IG 1VQMA 1VQ8A 2WB1B 3RLOA 1NR4A 1I3QB 2RSOA 2F0HA 1AH9A 2EYMA 1AEXA 4XYOA 4P72A 1KNAA 4NXNL 2F0OA 3DM1A 1K83B 3MA2B 1HR0Q 2IHFA 1B3AA 5C44G 5C3EB 1HCZA 2HQLA 1GO3E 4DR3L 2NB0A 3N6RA 2RSNA 3M7GA 3NSWA 1BBWA 1PH8A 3A54A 1BO0A 1TQOA 2E74C 2DY8A 1TT2A 3SK5A 4OIKA 2DUDA 4GKJQ 5KIXA 2KCCA 3H6MA 3T56B 3CCQA 1EIFA 2KECA 1S3OA 4OO1I 2IHEA 2JJQA 2ZXPA 3DWPA 3I4MB 2LS01 5I4DA 4K8JA 2Z4IA 2K33A 1KAAA 2ICEC 4TSSA 1OXXK 4CJ2C 1P16A 4NPSA 3J81L 1VQ5A 2GA4B 3D4WA 2DN8A 4JI8L 3NQIA 4RHRA 3MXNB 2YTXA 1ESRA 4MIUA 2A68D 3TP7A 2F4VQ 5M5XB 2N55A 2Q8IB 3RR5A 1DOKA 3NWTA 4XQNA 4KKTA 2LMCB 2MQHA 1GUOA 2JA7H 1N32Q 3KK7A 5M3FG 3H15A 2CHBD 3S1QB 3I70A 1SYFA 1F9SA 3PUWA 4L5TA 3Q8DA 1C48A 2YV5A 1RD9D 1XNRL 2CW0C 4X66L 1LT5D 4C2MH 1IBMQ 1K0SA 2E5LL 2E2DC 3NXWA 4QUCA 2Q2UA 3I8ZA 1STNA 3HFZB 3KUPA 4HJ8A 1FVIA 2AQ2B 1B44D 2E76C 4HJ5A 3K81C 1MGSA 1B9MA 5FLXL 2K5WA 4QL5A 4DPGA 4JYAQ 4A3LH 2PI2E 2AQ1B 1PH9A 3FMCA 2B2TA 2AMCB 5J1ZA 3HOWG 4PMBA 1H9SB 4A3CG 4JCVE 2XVSA 3HKZE 4OWXB 4C3JB 3CQZB 1VF5C 2FJ2A 3A5UA 3CRLC 3CCVA 4HIKA 1F9PA 2K52A 1BCPC 5D3DA 1PH4A 1FGUA 1VQ4A 3A8IE 1VQNA 4PMCA 1EYDA 3UE0A 1OTCA 4YIJA 3E0EA 3M4OB 1Q82C 2L15A 1WOCA 1N9WA 4DAVA 4A93B 1RTNA 1A3TA 1U4MA 2MHVA 1QNUA 2HIVA 1SSOA 3SXHA 1EWIA 1IYVA 1IBLL 3ERQA 1O7YA 3D6WA 2Q2IA 4H0LC 1I6HB 1I94L 4KHPQ 5C4ZA 4X64Q 1VQPA 2G9HD 1J5EQ 1YNJD 2XTIA 2F0MA 3S17B 1YZ6A 4BBSH 3K5LA 1J5EL 1SROA 4OWTB 4LF7L 4BY7G 3QB3A 5C4JH 4KHPL 3NE5B 1YNXA 2J0TD 4CJ1B 2RDGA 1CT1D 5KGUA 5IYCG 2E2HH 3M4YA 1W2BA 4C3IH 3CPWA 1MKHA 2F0IA 2VB2X 4TKOB 3IFDA 1KIXA 3NUCA 2B63B 3Q24A 4PMWA 1SE2A 2NN6G 4HJ7A 4O42A 1I5FA 3TS0A 3PO2H 3CCMA 1VQKA 4A3MH 3Q0AA 3DM3A 3J80i 3AFPA 1SNDA 2O4XA 3JC66 1NTGA 1UEAB 2XGTA 1NY4A 1U5KA 1BKBA 3SDZA 1L2FA 3BDCA 1Q46A 4GLVB 5BN3A 5ISRA 4WJ3M 3LX0A 3KLSA 4YHHQ 4A3KB 2HCIA 3FKIH 3A56A 3KF6A 4GOPC 4B3RL 1JORA 3VYUA 5IT9L 3PIO3 4BY1H 3M7NA 1QNKA 5JPNC 5M5YH 4NB3A 3NQTA 1A63A 2A69D 2B2VC 3RUZA 1IBML 3TEHB 1SMXA 3BJUA 2RQXA 1G2SA 2WKDA 1TWGH 3PO3B 2F52A 5BR8Q 4MHEA 1B4OA 5M5WB 5IYDG 2PW7A 5HGTA 1R9TH 2LY7A 1SE8A 1KAWA 2Q2TA 1D5ZC 2FMMA 4AYBB 2M9VA 2F4VL 1EY5A 2JN4A 1EY8A 1AE3A 1YHAA 2KJXA 4M8AA 3OMCA 5I6YA 1X56A 3F8TA 1JOQA 4IJHA 1O7IA 1AZPA 4BA1I 3S17H 1S5BD 2EJFC 1I6VC 3ER0A 1W6KA 1K73C 2F3IA 4NMZA 3CC2A 4B9XA 2ZM6L 1NMFA 1D6EC 1EIYB 3CKIB 5ELOA 3HOUG 1D7QA 2F3WA 3KF6B 4OWWB 3HOVB 1CKNA 4F87A 1K83H 3WOEA 1TS2A 3MTSA 4RAUC 4LF8Q 4ZK9B 5NUCA 3E0JA 3K0XA 1LTRD 1SJHD 3D4DA 1FYCA 4JI2Q 4RCOA 1KD1C 1Y8PB 1W3SA 4WFN3 1I50B 2NVYH 4A93G 5DAUA 2F1MA 1SYEA 4QIWB 1HNXQ 1FGBD 4ZAIA 4H7BA 2YTVA 2ZTCA 1DD2A 3K80C 1EIHA 2Z6KA 4RHSA 4H13C 4B9WA 4AYBG 3CF5A 2D62A 1GXDC 3H09A 1YHBA 1ASZA 2D5DA 1LLRD 1S40A 4GNXA 5M3MB 1ENAA 1FNWA 1LT6D 1YNND 4DXGA 2JSOA 2QCPX 4F88A 2K75A 3GTMH 2EIFA 2X6LA 2R92H 2IT1A 2R7ZB 2Q2HA 1XMQQ 2JA6B 3T1HL 3IL8A 4AH6A 3NENA 4QB4A 4AIMA 1BOSA 1PFNA 3HOUB 2EXZA 1AW7A 4HAEA 1UE1A 3K0YA 1NNXA 1HNZQ 3GTQB 2NBFA 2DJGC 4I7AA 4CKCA 4CKEA 3E9HA 4MN3A 2RCNA 1I50H 3IRBA 1IKMA 1K28A 4A3DH 4KN7C 3HOWB 5LMNQ 4X3SA 2IX1A 5FLMH 2VY3A 4U673 5E3FA 4HR7B 1QVFA 1SXTA 2M00A 2RF4A 3GD7A 2K03A 4OL7A 3MHBA 3I91A 3F2CA 3CCEA 1CM9A 1J6QA 3RMHA 3HOVG 1SNCA 2KA7A 4C3JG 1Q1EA 1R4QB 1ZKOA 1TWAB 5EPLA 1STAA 3CMEA 2NVQB 3KDFB 4LFCL 1ET9A 4DGZA 1A3UA 4QQBX 5K36H 4GN5A 4A3MG 4X65L 4RA8A 1V1OA 4GOPA 5E4WC 2IX0A 1QJOA 1JWSD 1QCBD 4N8X1 2YU9B 5G3LD 4A3DG 4OGQC 4RGTA 1TWFH 4DV6Q 4DV1L 4P74A 3KF8B 3I73A 1CFMA 1V1PB 1A62A 3NHHA 1VQIA 2K5NA 3U9SA 3V05A 5IT9c 1IKLA 1ICWA 1S5FD 4C1NK 5IP9H 1SNPA 1LT3D 1X3FA 4X6AH 2K14A 4LFBQ 1VS0A 4B08A 3T1HQ 3W3AA 2ATWA 1G291 2FINB 4POFA 5IP7G 1Z47A 2F0PA 3LNNA 1HTLD 3E9IA 5CC4A 2HIXA 3EROA 4C3IB 2UUBL 5JJKA 2PQAB 1SFOB 5LMUL 3S16H 2E2HB 4HTHA 5JJLA 4LF6L 2SDFA 4A93H 2E2JB 1PZJD 4XXEA 2PPBC 3HOZG 4IALA 2L5TA 1CUKA 3QOLA 1KTKA 4PV1C 1JE5A 3U50C 2UXCQ 4CGYB 1RKNA 2PW5A 4F7XA 2NWGA 2A8VA 2F0EA 1ET6A 3TN2A 3ND9A 3HOYH 3R2IA 2B2YA 5IOCA 1KRTA 2D2CC 2B2UC 2JA9A 3RLFA 2VQEQ 1JB3A 2A6HC 2DNCA 1YNJC 1STGA 2R92B 3A5ZB 1SE3A 4BS9A 1YJNA 4KTAA 4LNQA 1X55A 4M1UB 2AKWB 1LTBD 4OEMB 1KDCA 2NZHA 1CKMA 5C3EH 2PI2A 3OW2A 1HH2P 2WP8J 3GTOB 1QZGA 2BA0A 2NN6H 2QF7A 1GUNA 4JBKA 3DMUA 1E1TA 1E1OA 3MXNA 3NELA 2HCCA 5LMNW 2IX3A 1RCVD 2L9HA 5J39A 2QA4A 1STEA 2EYPA 1SBBB 1SE4A 1A3VA 2K28A 1F2YA 4LUVA 1VQLA 2J4XA 4JV5L 2NTTA 5BR8L 4IFDG 3S1QH 2PNRC 1BCPB 1PRTD 2CH4A 2R6GA 3DXJC 2FMCA 4X62L 1I4GA 4BA2I 3I4OA 4LWCA 1YJ9A 3J81j 3J7AV 2JQOA 3IFTA 1PTOF 1PFBA 5A35A 1G6ZA 1KQSA 3M4QA 3QJYA 1X3PA 3EA6A 1LTSD 3U4VA 1ASYA 4JI3L 3S1MH 5BN4A 1J8IA 3TS2A 2AUJD 2MPMA 2EYJA 4YHHL 2K05A 3OIPA 5FKAC 5EPKA 2QGQA 4ODGA 4A3BG 4DAPA 1XXGA 2ICIA 4R9WA 2PMZB 3CPFA 3S9WA 3AEVA 2F0WA 2SNMA 3R8BA 1WTPA 3EIVA 4A3FH 1RHPA 1S5DD 4LJZC 4QF4A 4EQPA 2B2UA 1FNUA 4LF4Q 3QIAA 1XNQQ 1H9SA 5FLXc 3EVQA 3OSOA 3S15B 3S16B 5FJ8G 2OT2A 4HSVA 1QOHA 2KQ3A 5CR3A 2Z9HA 1Q8KA 1NE3A 5EGTA 3TRZA 3D3RA 2X6GA 4TRDA 3D31A 5KYIA 4DV3Q 5JVG3 4L8JA 1HPCA 1TVXA 1TY0A 3S2DH 1PHJA 2P5ZX 1B8AA 4Y52H 5IGBA 1KLUD 2I5HA 1YI2A 5K36G 1SNOA 2EY1A 1PFSA 1M90C 1H95A 3KBGA 4N8FA 5A2QL 2MO0A 4GLAC 4UDUC 1Q86C 4POGA 4K5VA 3S2HH 2JE6I 1V8QA 1TS4A 3J81E 3D0FA 2N49A 3GV6A 3PIPA 2VB3X 3CQZH 4IPGA 1TIID 4XTCS 4MZ9A 2HDMA 1E7ZA 2KHIA 4R8IA 5C4JB 4JC0A 4UY8C 4LUZA 1IBLQ 2JA6H 1XPUA 4DU9A 4A3IB 4DFAA 4FDBA 2R93H 4RGOS 4HIOA 3L0OA 3I2ZA 1YNNC 5GROA 1MJCA 4HMIA 1PH7A 1PVOA 3H91A 1MJEA 4X64L 5IP9G 5LMUQ 3M3YB 3GTLB 2UXBL 2K5VA 3TP5A 1QUQB 3STBD 3HOZH 1X65A 2DGYA 1N34Q 4HN7A 2L1BA 1Y14B 5D3IB 2XWBB 4LFBL 1DYQA 3RLNA 4A3JH 1PTOH 1F9RA 1B7YB 1GHJA 4LW1A 3P1HA 3CCUA 1BXTA 4JI0Q 3FKIG 3SHLA 4DV1Q 1A8VA 2VUMH 4CHTB 2OEOA 1L0WA 1PYSB 1EFWA 4R4TA 4DA2A 1Q3LA 1TWCB 3HOYG 1PFMA 4JI7Q 5EQ0A 3SK8A 2C5CA 3K8AA 5C0XJ 2BDNA 1KNEA 2MO1A 5FLMG 2WINB 3KYHC 4FXGC 1ILQA 4IURA 4IOCA 4KHZA 3BZKA 4DR5Q 1MHWC 4KD4A 3CRKC 4DXFA 3CU7A 4L63B 3OTOL 1H9JA 4LAAA 5LMNL 4ZQ3A 2Q8TA 4Q0FA 4K6DA 3K59A 2RA4A 4KK7A 1N32L 3MFGA 5IWAQ 3I3CA 1ZEQX 2E5LQ 4A3JB 2EOTA 4J6HA 4JI5L 2F0QA 2F0KA 2K5QA 1WFQA 4X66Q 2E2JH 4JI1Q 4IFDJ 3KLRA 4X3KA 3KF8A 1AN8A 5ELEA 1B3QA 3VA7A 1WTHA 4OIJA 4JI8Q 1L1OC 4RKBA 1XMQL 3BZDB 1PLFA 4X3UA 4A3GG 4CBVA 1LABA 5KRUA 1T5XD 1TS5A 2OXPA 5JOBA 2ZJRA 4DR4Q 4K8IA 3DUZA 1IYJB 1HZBA 1LTTD 5LL6S 4CDEC 5GAEC 2UXDL 3NTKA 4R1JA 3ZYYX 1A0IA 4DR2Q 3SGIA 3HKZG 2EQSA 3F2DA 3SR1A 2VQFQ 5JVH3 1QVGA 3MEFA 3SVMA 3DHQA 1VQJA 2A5HA 1HZCA 1N33L 4BBRG 1WCMB 1G6PA 2CFMA 3BVGA 3PUVA 2M2LA 1XJVA 2I5LX 1EQVA 5L37A 4KLKA 3VYSA 4DUZQ 1EY4A 1I4XA 5GQOA 4G4KA 3QWNA 2CW0D 2F0DA 5ELNA 1BCPD 3J80c 1STHA 4EQOA 4DNTB 1YJWA 1E0BA 1EU4A 3H0GH 4H44C 4J8QA 5FO9B 1ESFA 1SYGA 3A7LA 2ES2A 2HQEA 4DR2L 4JBMA 5DEHA 2F0UA 3S14B 2A6ED 2PQAA 2TMPA 3WOFA 3RN2A 2QDBA 2VXWA 2ZM6Q 3FPPA 4OONA 2SEBD 4DR3Q 2LFNA 3ERSX 2NN6I 1PTOD 2E75C 3CAMA 4GNXB 3BS1A 3K7AB 4HMJA 4K5XA 5IY0A 4A3KG 2B8GA 2Q8RE 2EYOA 1F9QA 4IUNA 3CP0A 3UDGA 3G4SA 4KI0A 3HEJA 2XRQD 1C9OA 2Z1CA 4KY5A 3BU2A 3ICEA 5CV4A 1PRTF 4BY7B 5D14A 4A76A 4DF7A 5I9OA 3ZJYC 1F2ZA 4LFAL 2K32A 4A3BB 3NEMA 2JXMB 2XNAC 2KENA 4UP9A 1G2TA 5CYUA 3TMEA 1TXYA 3MVVA 4KKSA 3PF5A 1QB5D 4DR5L 2WB1G 1OXTA 5C5MA 1HA6A 3GTGH 2OTLA 1PH6A 1LO5D 4ID6A 2B8FA 2PZWA 1IHZA 1UWVA 1SEBD 4J15A 4KN4C 2MNAA 2PCFB 1Y1VB 1L0YB 3I4MH 3HKSA 2A74C 3OPOA 5C5LA 3UDIA 3URYA 5KNCA 4DR1L 1Y1VG 4DN4M 1B9NA 4DNRB 3K5NA 2SOBA 3NK9A 1SLJA 3K7AH 4R4QA 3KBXA 4L5SA 1UE5A 1SR3A 2HD3A 5JEAH 4P75A 3P75A 3NTIA 1GVPA 3MWYW 2KHJA 4JI0L 3JAMc 4KHVA 4FVMA 5M5YB 5AJ3Q 1MI2A 1GUSA 1NSNS 5IGCA 1TWGB 2HUGA 3K5OA 4DR6L 5KNBA 3CC7A 4DK3C 1MD2D 3BDOA 4DUYL 1HNWL 2R93B 3U58A 1SMYC 1LV9A 3BYTB 4ZLTF 2L0CA 3CC4A 2UUCQ 1HR0W 2OQKA 2Z0SA 5COYA 4A3IG 3CCLA 1I4PA 1BBXC 3KFUA 5K5PA 4FP5D 5CV6A 5FO8B 4B3SQ 3ULPA 3TP6A 1N34L 2EY6A 3CMAA 2JK8A 5EJWA 1DXMA 1B1ZA 3C1FA 4QUFA 3S1RH 2UXBQ 1I6HH 3UE1A 1LTGD 3CXCA 2BCOA 2PO4A 1XTCD 2JA8H 1YEZA 1D5XC 3BZCA 3TZUA 3HOVH 4KY7A 1T9HA 1IL8A 3WDNA 1IXRA 2F0JA 4A3IH 1JOOA 1TWCH 3O13A 2HHHL 2HDLA 5J22A 2PQEA 1BQQT 4BY7H 4K0KL 1ONLA 3A8JE 4FYDA 4KJNA 1P8LA 2WACA 1A2TA 4KD3A 4FXKC 2ZJPA 4IPDA 4RKLA 2Z6BA 4DK1A 4G7ZC 4A3EG 1CTMA 1EYAA 3GTKB 4A3MB 4DV3L 2VUMG 1KL9A 2KEEA 4Q5VA 3D8GA 3KJOA 1EWCA 1KDAA 4FF4A 1TS3A 3NBHA 3BYYB 1Y8NB 4I65A 2OWOA 2LSSA 3C2PA 4DV7Q 4P71A 5D65A 3NTHA 1FJGQ 1O78A 3S1RB 4JI3Q 1GKHA 4DV2L 3T1YL 1PV4A 3HZXA 4DNIA 1Q8IA 2RKSA 2F4IA 5JEAG 3I56A 4BBSB 3HOUH 1JWMD 1HFGA 5DM63 4YWKA 2CVRA 3T51B 3DEPA 4EQ5A 1SN8A 3GO5A 3MZ5A 1PZID 1PH1A 1N36L 1XNRQ 4LF5Q 1HJPA 4L5RC 2JYOA 1FJGL 1H9KA 3PO2B 5A2QE 1HRJA 4LUOA 2RDFA 1BNZA 1J9OA 4ULLA 1MSHA 1XMOQ 5IYBG 2B63H 3V2TA 1B70B 1GD7A 3QOJA 3F2UA 4C3HB 2VZAA 1CQFA 4GKKQ 4HJ9A 1HA5A 4X62Q 4HJAA 2QKIC 2RCFA 1RODA 1DOMA 4A3GH 1TWAH 4DAYB 5C3XA 5C44H 4Y7NH 2K50A 4IN3A 3VR6A 3PUXA 1WYDA 1WTQA 5CBAE 1TWFB 4R4IA 4IO9A 4GN4B 5E4XA 1EZ8A 2JA8B 1Y1WG 2JA8G 3U4ZA 4ZKBB 5I2XA 3NBHB 4HCSA 1D8LA 3S2HB 2ZTEA 4K6LA 4KKUA 3U9OA 1GJXA 1MBYA 5G3LF 3I4NH 2VS1A 4BXXH 1JT8A 5EPJA 2FXQA 2NUCA 5GAHC 3KOJA 4B3TQ 3W1GA 3J80E 4DV4L 1CI3M 3FPUB 2BE5C 1YITA 1UEBA 4JI6L 1Z6HA 2VQEL 2B2YC 3RZDB 1XTDA 4RH6A 4HEDA 3RNUA 2N3SA 2B39A 1Q90A 2Z4HA 4A3BH 1HZAA 4QMGA 3S1NH 1EY7A 5CORA 2R3ZA 4C3HH 5M3FH 1BDOA 2UXCL 1K3BC 4BBSG 3BDLA 3GTKH 3IKJA 4K14A 4NXNQ 4DV0L 4C2MB 1EY6A 3GTJH
chains in the Genus database with same CATH topology
1Q12A 4PQXA 4RCNA 2BE5D 5IODA 2PZUA 1TY2A 5CV7A 5C44B 4NDXA 1CZGA 4FXDA 2NTSA 4CJ0B 2KOLA 3A8KE 5LL6X 4DAYA 1CA6A 3T53B 1JOKA 5E1FA 3HG9A 3MXUA 4WORA 2MP1A 3L9AX 1M8AA 2BA1A 5T1GA 1Q1BA 1L0XB 3PUYA 4XT1B 4N9TA 3I4NB 4IUPA 4IZ8A 4LK1C 1H9RA 1HFNA 1MSGA 3C46A 2IL8A 4OO1G 2SNSA 1E2VA 1EU3A 1T5EA 1IW7C 4ZYSA 3GTPB 1RDPD 1GUGA 4TQUS 3T13A 3R93A 1E2ZA 3S1MB 3VYTA 3OIQA 3ND8A 3M85A 1U4RA 1O7ZA 2ZT9C 2L11A 2WAQB 3C3LA 4A3FB 5ELCA 1U4PA 3OMGA 2K5DA 2RDHA 3IAYA 5ELFA 2JA7B 4DK0A 3A55A 2J7ZA 3S2DB 5DM73 4C3HG 2JEAI 4BBRB 1QWYA 3BVZA 2QEJC 3BG3A 4HCEA 3HOZB 5DNFA 5M9OA 4K2LA 2FFKB 2KCNA 2H1EA 1B2TA 3OWEB 1EL0A 2EVBA 2KVMA 2QILA 1AZQA 2E2IB 3HOYB 4N9PA 2F0NA 3HS0C 2YYZA 5EBDA 2B2WC 1M4VA 2VUMB 1BUVT 2G9DA 2AUKA 3TP8A 5ELBA 3P7JA 1C4QA 2D9UA 2EPBA 3I4LA 1PMRA 5FLXE 3BVMA 1EYCA 1OXUA 2NZ1D 1QE6A 2V4DA 1JICA 1BCPF 3H94A 5T1IA 4IUVA 2PYKA 1D1IA 2EE1A 1JR0D 1CK1A 1D5MC 1XX8A 3X3NA 3MC0B 1JE4A 3PMFA 1RTOA 1H9MA 5CBEE 3LWUA 1WTWA 3K57A 2H4OA 4XYQA 2A69C 1FD7D 4JBWA 4K2KA 1K8MA 1II3A 1G91A 1W6JA 2ENBA 2A6EC 4RGNA 3SK4A 1WTOA 4XQQA 1I4HA 1JQYD 1UUPA 3VR5A 5KEEA 3VR3A 3TDQA 1OXSC 1K8OA 3QO2A 1ZYRC 1XYIA 2F0TA 1JC7A 1ILPA 2JA5B 1TWHB 3AU7A 4L6TB 5C6AA 1VMPA 1DOLA 1OXVA 5JPMC 5EKKA 5CV8A 3GQBA 1GHKA 3KLSX 1HQMC 3GTJB 1CHPD 2I46A 3I90A 4RWSC 4FF1A 2F0VA 4BY1B 4RGMA 1EWHA 2F0SA 2ID0A 4GZYC 1SDFA 4IFDI 4WRDA 4XIGS 1R9TB 3GP7A 1BF4A 4HSPA 1SYCA 1SMYD 5EKIA 1QG7A 5KNDA 3AMUA 5IT9E 1X32A 5CV5A 3VR4A 5EKLA 4XQJA 1Y69U 2K04A 2F03A 3FKIB 1A2UA 3N52A 3PUZA 1VDZA 1F2MA 2B2TC 2OF1A 2XRSD 4NW2A 3E6ZX 2X69A 2EYFA 3OOCA 3EJIA 1RF2D 1GUTA 4F8MA 1EY0A 4ZRZA 3Q23A 2AWNA 3VA5A 2K01A 3JAML 2WV6D 4K5WA 5C0XG 2O5IC 3NBIA 1A6XA 5F2DA 3HRZC 2PZTA 5IGFA 2KUMA 1CA5A 3RD4A 5C4XB 3D6CA 5IGDA 1HQRD 4PNYA 2K7VA 3PIP3 4EGVA 1DCZA 3MFYA 2XN9C 1AP0A 1SYBA 3VR2A 1SNMA 3V96A 3GV3A 1G8ZD 5IGGA 3GTMB 1EIGA 1PXUA 2EZVA 1S5CD 2F3VA 5FO7B 4IUUA 1NAPA 4JK1C 1WTVA 3TBIB 3T4AC 3R2TA 3MEHA 2K6AA 3DWQA 1EEFD 4A3DB 2EY5A 1ML0D 1WTRA 1B50A 2KHSA 3HP3A 2A73B 1WD1A 2F0FA 4IFDH 1RJTA 1Z7TA 1D1KA 2TSSA 5I2YA 5BN5A 1ENCA 4FF2A 1PZKD 3TSSA 1S5ED 3H3VC 1UNSA 2CQAA 1PTOC 1ENFA 5LHY1 3HGBA 2C9OA 3S1NB 3FDTA 4G7HC 4FO2A 5I9PA 5JAVA 3FEWX 1DJRD 2Y0SB 5KYLA 4LMQD 2XWJB 2MUYA 1ZYRD 2FHTA 5C4HA 2I07B 3MXGA 3GTGB 4A3EB 3NWSA 1OO9B 4ZKCB 1EFID 2F0GA 1C8CA 5C0XI 3H0GB 2LKVA 2EDGA 1JCKB 4U68A 1VMCA 4P2CB 2Z8LA 4KY6A 1FNVA 4C1NI 3D4RA 3NPPA 2IJ0A 4C56C 1ZXTA 2NVXB 3RZOB 3TZDA 4IUTA 5CMDA 5FOBB 3ITPA 4KV6A 4FF3A 3J80L 2VNUD 1O80A 1CQVA 1EQTA 1PYWD 4EVOA 3LWEA 3SK6A 1TKWB 1PRTC 4A3GB 2L4NA 3MAQA 2N88A 4IUQA 1WVLA 1S4ZA 1Y8OB 4Y7NB 1HUNA 3MXPA 2O2LD 4ILWA 1CZWA 4R8NA 5IGEA 4IQZA 2EYHA 1EEID 1EY9A 1TR5A 2AQ3B 1HXYD 4G57A 4NKLA 3EQLC 1AFPA 1GOZA 3FRPB 3VYRA 4RFBA 5ELDA 2L55A 1I4QA 1U4LA 1V1PA 2MJ8A 1V43A 5EBCA 4ZUIA 5CV9A 1LTID 3J7YW 1STBA 2EJGC 3J7AF 5I6WA 1WTXA 1IYUA 4UAIA 4O1NA 1DM0B 5C3WA 1SJED 3OWFA 2XIWA 3QG1A 1UAPA 2K1BA 5CGKA 1PDQA 2A68C 2L12A 3P20A 3L7ZC 4KJOA 3HKZB 3E5SA 4E6IA 1PRTB 2B2WA 3Q6SA 2AWOA 1EZ6A 3G6JB 2WIIB 4ME5A 4NP5A 5JEAJ 4Z9CB 4V190 4I7ZC 3AB9A 4OHJA 3R3OA 3K6OA 2NYZD 1X3QA 2ZXRA 2DY7A 3G7LA 4V0BA 1VCIA 1DZ1A 1KLGD 3EFXD 3OW7A 2IPKD 1GUWA 3I72A 3SE0A 1O7LA 2A6HD 3T16A 3X3MA 1D2BA 5JJZA 3SEBA 1R4PB 2RBMA 1Y1WB 4ABNA 2WKCA 5HURA 4EQNA 3OHXC 1NR2A 3A7AB 2BOSA 1QILA 1JWUD 2NVYB 1E2WA 1WD0A 1CHQD 3K58A 1SAPA 2EYLA 1BR9A 1VF7A 1HUMA 5IIFA 1F2LA 1A15A 2EY2A 1LT4D 4FNFA 4X3TA 1IW7D 4QCLA 3DEOA 4OO1H 5M3FB 3L3OC 1B53A 4KMUC 2KEDA 2DNEA 2RVLA 1PTOB 1NCVA 3W2DA 1LACA 4CKBA 3NP8A 4XT3B 2EJMA 3CHBD 2JP1A 4BWGB 3JAME 4S3SA 1KDBA 2B2VA 1SYDA 3FVQA 3ONAB 3Q22A 1XWEA 4XDXA 3UI2A 1TU2B 4ZUJA 2NVTB 1STYA 1FR3A 1HTPA 3PV0A 4G7OC 2R61A 2JEBI 5FK9C 5AFWA 4WJWA 1KABA 3DWAA 3HOXB 2MGSA 5C0XH 2ZXOA 4J1MA 2F0LA 2XSCA 1LTAD 1EOTA 2BDOA 1I4RA 2IWHA 5TSSA 2IW3A 1NUCA 1F77A 3K5MA 1SNQA 1DONA 2O5JC 1U9RA 3C1EA 1HHVA 4C3IG 2WB1B 1NR4A 1I3QB 2RSOA 2F0HA 2EYMA 1AEXA 4XYOA 1KNAA 2F0OA 3DM1A 1K83B 3MA2B 1B3AA 5C3EB 1HCZA 2NB0A 3N6RA 2RSNA 3M7GA 3NSWA 3A54A 1BO0A 1TQOA 2E74C 2DY8A 1TT2A 3SK5A 4OIKA 5KIXA 2KCCA 3H6MA 3T56B 2KECA 4OO1I 2ZXPA 3DWPA 3I4MB 2LS01 5I4DA 4K8JA 2Z4IA 2K33A 1KAAA 2ICEC 4TSSA 1OXXK 4CJ2C 3J81L 2GA4B 3D4WA 2DN8A 3NQIA 4RHRA 1ESRA 4MIUA 2A68D 3TP7A 5M5XB 2N55A 2Q8IB 1DOKA 3NWTA 4XQNA 4KKTA 2LMCB 1GUOA 3KK7A 2CHBD 3S1QB 3I70A 1SYFA 1F9SA 3PUWA 1C48A 1RD9D 2CW0C 1LT5D 2E2DC 3NXWA 4QUCA 3I8ZA 1STNA 3KUPA 2AQ2B 1B44D 2E76C 1MGSA 1B9MA 5FLXL 2K5WA 2AQ1B 3FMCA 2B2TA 5J1ZA 4PMBA 1H9SB 2XVSA 4C3JB 3CQZB 1VF5C 2FJ2A 3CRLC 1F9PA 1BCPC 5D3DA 3A8IE 4PMCA 1EYDA 4YIJA 3M4OB 4DAVA 4A93B 1RTNA 1A3TA 1U4MA 2MHVA 1QNUA 1SSOA 3SXHA 1IYVA 3ERQA 1O7YA 3D6WA 4H0LC 1I6HB 5C4ZA 2G9HD 1YNJD 2F0MA 3S17B 3K5LA 3QB3A 3NE5B 2J0TD 4CJ1B 2RDGA 1CT1D 5KGUA 3M4YA 2F0IA 2VB2X 4TKOB 3IFDA 3NUCA 2B63B 3Q24A 4PMWA 1SE2A 2NN6G 4O42A 3Q0AA 1SNDA 2O4XA 1UEAB 3SDZA 3BDCA 5BN3A 5ISRA 3LX0A 3KLSA 4A3KB 2HCIA 3A56A 1JORA 3VYUA 5IT9L 3PIO3 3M7NA 1QNKA 5JPNC 3NQTA 2A69D 2B2VC 3RUZA 2RQXA 1G2SA 2WKDA 3PO3B 4MHEA 1B4OA 5M5WB 2PW7A 5HGTA 2LY7A 1D5ZC 2FMMA 4AYBB 2M9VA 1EY5A 1EY8A 5I6YA 2KJXA 3OMCA 4M8AA 1JOQA 1AZPA 4BA1I 1S5BD 2EJFC 1I6VC 1W6KA 4NMZA 4B9XA 1D6EC 3CKIB 2F3WA 3HOVB 4F87A 3WOEA 1TS2A 3MTSA 4RAUC 4ZK9B 5NUCA 3E0JA 1LTRD 1SJHD 3D4DA 1FYCA 4RCOA 1Y8PB 4WFN3 1I50B 5DAUA 2F1MA 1SYEA 4QIWB 1FGBD 4ZAIA 4H7BA 1DD2A 1EIHA 4RHSA 4H13C 4B9WA 2D62A 1GXDC 3H09A 2D5DA 1LLRD 5M3MB 1ENAA 1FNWA 1LT6D 1YNND 4DXGA 2JSOA 2QCPX 4F88A 2X6LA 2IT1A 2R7ZB 2JA6B 3IL8A 4QB4A 1BOSA 1PFNA 3HOUB 2EXZA 1AW7A 4HAEA 3K0YA 3GTQB 2NBFA 4CKCA 4CKEA 4MN3A 1IKMA 4KN7C 3HOWB 4X3SA 2IX1A 4U673 5E3FA 4HR7B 1SXTA 2M00A 3GD7A 2K03A 4OL7A 3MHBA 3I91A 1CM9A 3RMHA 1SNCA 2KA7A 4C3JG 1Q1EA 1R4QB 1ZKOA 1TWAB 5EPLA 1STAA 2NVQB 4DGZA 1ET9A 1A3UA 5K36H 4RA8A 1V1OA 5E4WC 2IX0A 2YU9B 1QJOA 1JWSD 1QCBD 5G3LD 4OGQC 4RGTA 3I73A 1CFMA 1V1PB 3NHHA 3U9SA 3V05A 1IKLA 1ICWA 1S5FD 4C1NK 1SNPA 1LT3D 4B08A 3W3AA 1G291 2FINB 1Z47A 2F0PA 3LNNA 1HTLD 5CC4A 3EROA 4C3IB 1SFOB 2E2HB 4HTHA 2SDFA 2E2JB 1PZJD 4XXEA 2PPBC 4IALA 2L5TA 3QOLA 1KTKA 4PV1C 4CGYB 1RKNA 2PW5A 4F7XA 2NWGA 2F0EA 1ET6A 3TN2A 3ND9A 3R2IA 2B2YA 5IOCA 2D2CC 2B2UC 3RLFA 1JB3A 2A6HC 2DNCA 1YNJC 1STGA 2R92B 1SE3A 4BS9A 4KTAA 4M1UB 1LTBD 1KDCA 2WP8J 3GTOB 2BA0A 2NN6H 2QF7A 1GUNA 3DMUA 3MXNA 2HCCA 2IX3A 1RCVD 2L9HA 5J39A 1STEA 2EYPA 1SBBB 1SE4A 1A3VA 2K28A 1F2YA 2J4XA 2NTTA 4IFDG 2PNRC 1BCPB 1PRTD 2R6GA 3DXJC 2FMCA 1I4GA 4BA2I 3J7AV 3IFTA 1PTOF 1PFBA 5A35A 1G6ZA 3QJYA 1X3PA 3EA6A 1LTSD 5BN4A 1J8IA 2AUJD 2MPMA 2EYJA 2K05A 3OIPA 5FKAC 5EPKA 4ODGA 4DAPA 1XXGA 2ICIA 4R9WA 2PMZB 3S9WA 2F0WA 2SNMA 3R8BA 1WTPA 1RHPA 1S5DD 4LJZC 4QF4A 4EQPA 2B2UA 1FNUA 3QIAA 1H9SA 3EVQA 3OSOA 3S15B 3S16B 2OT2A 4HSVA 1QOHA 2KQ3A 5CR3A 5EGTA 3D3RA 2X6GA 4TRDA 3D31A 5KYIA 5JVG3 4L8JA 1HPCA 1TVXA 1TY0A 5IGBA 1KLUD 5K36G 1SNOA 2EY1A 3KBGA 5A2QL 4UDUC 4K5VA 2JE6I 1V8QA 1TS4A 3J81E 3GV6A 2VB3X 1TIID 4XTCS 2HDMA 4R8IA 5C4JB 4DU9A 4A3IB 4DFAA 4RGOS 1YNNC 4HMIA 3H91A 3M3YB 3GTLB 3TP5A 4HN7A 2L1BA 5D3IB 2XWBB 1DYQA 1PTOH 1F9RA 1GHJA 3P1HA 1BXTA 3SHLA 4CHTB 2OEOA 4DA2A 1Q3LA 1TWCB 1PFMA 5EQ0A 3SK8A 2C5CA 5C0XJ 2BDNA 1KNEA 2WINB 4FXGC 1ILQA 4IURA 4KHZA 4KD4A 3CRKC 4DXFA 3CU7A 4L63B 1H9JA 4LAAA 4ZQ3A 2Q8TA 4Q0FA 4K6DA 3K59A 2RA4A 4KK7A 3MFGA 3I3CA 1ZEQX 4A3JB 2EOTA 4J6HA 2F0QA 2F0KA 2K5QA 4IFDJ 3KLRA 4X3KA 3KF8A 1AN8A 5ELEA 3VA7A 4OIJA 4RKBA 3BZDB 1PLFA 4X3UA 4CBVA 1LABA 5KRUA 1T5XD 1TS5A 2OXPA 5JOBA 4K8IA 3DUZA 1LTTD 5LL6S 3NTKA 3ZYYX 3SR1A 5JVH3 3SVMA 3DHQA 2A5HA 1WCMB 3BVGA 3PUVA 2M2LA 1EQVA 3VYSA 1EY4A 1I4XA 4G4KA 3QWNA 2CW0D 2F0DA 1BCPD 1STHA 4EQOA 4DNTB 1E0BA 1EU4A 4H44C 4J8QA 5FO9B 1ESFA 1SYGA 3A7LA 2HQEA 5DEHA 2F0UA 3S14B 2A6ED 2TMPA 3WOFA 2QDBA 2VXWA 3FPPA 2SEBD 2LFNA 2NN6I 1PTOD 2E75C 3BS1A 3K7AB 4HMJA 4K5XA 2B8GA 2Q8RE 2EYOA 1F9QA 4IUNA 4KI0A 3HEJA 2XRQD 2Z1CA 4KY5A 5CV4A 1PRTF 4BY7B 5D14A 4DF7A 5I9OA 1F2ZA 2K32A 4A3BB 2JXMB 2XNAC 1G2TA 5CYUA 3TMEA 3MVVA 4KKSA 1QB5D 1OXTA 5C5MA 1HA6A 1LO5D 4ID6A 2B8FA 2PZWA 1IHZA 1SEBD 4KN4C 2PCFB 1Y1VB 1L0YB 2A74C 3OPOA 5C5LA 3URYA 5KNCA 4DN4M 1B9NA 4DNRB 3K5NA 2SOBA 3NK9A 3KBXA 5JEAH 3P75A 3NTIA 3MWYW 4KHVA 4FVMA 5M5YB 1MI2A 1GUSA 1NSNS 5IGCA 1TWGB 2HUGA 3K5OA 5KNBA 1MD2D 3BDOA 2R93B 1SMYC 1LV9A 3BYTB 4ZLTF 2L0CA 5COYA 1I4PA 1BBXC 5K5PA 4FP5D 5CV6A 5FO8B 3TP6A 2EY6A 5EJWA 1DXMA 1B1ZA 3C1FA 4QUFA 1LTGD 2BCOA 2PO4A 1XTCD 1D5XC 3TZUA 4KY7A 1IL8A 3WDNA 2F0JA 1JOOA 3O13A 2HDLA 5J22A 2PQEA 1BQQT 1ONLA 3A8JE 4FYDA 4KJNA 2WACA 1A2TA 4KD3A 4FXKC 4RKLA 4DK1A 4G7ZC 1CTMA 1EYAA 3GTKB 4A3MB 2KEEA 4Q5VA 3D8GA 1EWCA 1KDAA 4FF4A 1TS3A 3NBHA 3BYYB 1Y8NB 4I65A 3C2PA 5D65A 3NTHA 1O78A 3S1RB 3HZXA 1Q8IA 2RKSA 2F4IA 5JEAG 4BBSB 1JWMD 1HFGA 5DM63 2CVRA 3T51B 3DEPA 3GO5A 3MZ5A 1PZID 2JYOA 1H9KA 3PO2B 5A2QE 1HRJA 2RDFA 1BNZA 1J9OA 4ULLA 1MSHA 3V2TA 3QOJA 3F2UA 4C3HB 1CQFA 1HA5A 2QKIC 1RODA 1DOMA 5C3XA 4IN3A 3VR6A 3PUXA 1WTQA 5CBAE 1TWFB 5E4XA 1EZ8A 2JA8B 4ZKBB 5I2XA 4HCSA 3S2HB 4KKUA 4K6LA 3U9OA 1GJXA 1MBYA 5G3LF 5EPJA 2NUCA 3J80E 1CI3M 3FPUB 2BE5C 1Z6HA 2B2YC 3RZDB 4RH6A 4HEDA 2B39A 1Q90A 2Z4HA 4QMGA 1EY7A 5CORA 2R3ZA 1BDOA 3BDLA 3IKJA 4K14A 4C2MB 1EY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WD0 A;  1SAP A;  1PFN A;  1PLF A;  4X3U A;  5DNF A;  1HUM A;  1B3A A;  4DN4 M;  1F2L A;  1A15 A;  4HAE A;  2FFK B;  2B2V C;  4LMQ D;  3GV6 A;  2H1E A;  2FJ2 A;  5D65 A;  1B2T A;  1VMP A;  1DOL A;  3KBX A;  2RSN A;  4X3T A;  2KUM A;  1CA5 A;  2HDM A;  1F9P A;  2FHT A;  3DEO A;  1EL0 A;  1G2S A;  1WTX A;  4R8I A;  4MN3 A;  2KVM A;  1AZQ A;  4CJ0 B;  2KOL A;  3MWY W;  1IKM A;  1B53 A;  2KED A;  1CA6 A;  4MHE A;  1B4O A;  4UAI A;  2RVL A;  4ZKC B;  3I90 A;  4RWS C;  1BO0 A;  2DY8 A;  4X3S A;  2B2W C;  2HCC A;  1C8C A;  1NCV A;  1HFG A;  1MI2 A;  2L9H A;  2CVR A;  4OIK A;  3SVM A;  2HUG A;  1RTN A;  1U4M A;  3DEP A;  2MP1 A;  1AP0 A;  2K28 A;  2XIW A;  1M8A A;  3H91 A;  5T1G A;  2K03 A;  4U68 A;  4XT3 B;  2FMM A;  1SSO A;  1VMC A;  2K1B A;  3I91 A;  2KEC A;  2JP1 A;  1CM9 A;  3GV3 A;  1PDQ A;  1LV9 A;  1EIG A;  1O7Y A;  3D6W A;  2L12 A;  2M2L A;  4XT1 B;  4ZLT F;  3P7J A;  2B2V A;  5EPL A;  2D9U A;  4IUP A;  2EPB A;  2JYO A;  3ONA B;  4IUU A;  5COY A;  1HFN A;  1HRJ A;  2L1B A;  1NAP A;  1ZXT A;  1BNZ A;  1J9O A;  1MSG A;  1WTV A;  1MSH A;  1SDF A;  2NZ1 D;  1AZP A;  1QE6 A;  4XDX A;  1F9R A;  4IUT A;  3TZD A;  4CJ2 C;  1JIC A;  5CMD A;  1BBX C;  5T1I A;  2IL8 A;  4IUV A;  4RA8 A;  2B2W A;  3F2U A;  1E0B A;  3UI2 A;  5E4W C;  1O80 A;  3Q6S A;  1BF4 A;  1PFB A;  1EQT A;  1ROD A;  2EE1 A;  1DOM A;  1G6Z A;  5EJW A;  1X3P A;  1ESR A;  4CJ1 B;  4QUF A;  3LWE A;  1J8I A;  1ML0 D;  5EKI A;  1WTR A;  2VXW A;  1QG7 A;  1B50 A;  3HP3 A;  2N55 A;  2MPM A;  1DOK A;  1WTQ A;  1X32 A;  2K05 A;  5CBA E;  5EPK A;  1WD1 A;  1XX8 A;  1IKL A;  5AFW A;  2L4N A;  3MTS A;  1ICW A;  1Q3L A;  1JE4 A;  4RAU C;  5E4X A;  4R9W A;  4ZK9 B;  1PFM A;  2NYZ D;  1RTO A;  5EQ0 A;  1X3Q A;  1RJT A;  3IFD A;  5CBE E;  1WTP A;  2Q8R E;  1F9S A;  1IL8 A;  1F9Q A;  2BDN A;  2N88 A;  3R93 A;  1KNE A;  2DY7 A;  1RHP A;  2FIN B;  2K04 A;  3G7L A;  2MGS A;  4ZKB B;  1DZ1 A;  4IUQ A;  4O42 A;  1ILQ A;  1S4Z A;  1WVL A;  1HUN A;  2B2U A;  3N52 A;  4HCS A;  4IUR A;  2B2T C;  2HDL A;  5D14 A;  4ZAI A;  1U4R A;  1WTW A;  1EOT A;  2SDF A;  1O7Z A;  4NW2 A;  4QUC A;  2L11 A;  5EPJ A;  1EIH A;  4HSV A;  3I8Z A;  2X69 A;  3KUP A;  1GUW A;  2X6G A;  1G91 A;  3FPU B;  2Q8T A;  1MGS A;  1U4P A;  2RA4 A;  1G2T A;  5JJZ A;  2B2Y C;  1DON A;  4HED A;  3I3C A;  1TVX A;  1WTO A;  2EOT A;  2NWG A;  1HA6 A;  2HCI A;  3TN2 A;  1HHV A;  5COR A;  2R3Z A;  1NR2 A;  3FDT A;  2B2Y A;  2B2T A;  1U4L A;  3QO2 A;  4X3K A;  1NR4 A;  2K01 A;  2B2U C;  2RSO A;  2J7Z A;  2X6L A;  2MJ8 A;  1XYI A;  4OIJ A;  2KEE A;  1KNA A;  1ILP A;  3IL8 A;  1QNK A;  3DM1 A; 
#chains in the Genus database with same CATH topology
 1Q12 A;  2NZO A;  4PQX A;  4RCN A;  1GM5 A;  2BE5 D;  4LF6 Q;  5IOD A;  2PZU A;  1TY2 A;  1UE7 A;  5CV7 A;  4DAM A;  5C44 B;  2E2I H;  4A3J G;  4NDX A;  2UUB Q;  1CZG A;  4MNO A;  4FXD A;  4DV6 L;  4JG2 A;  2NTS A;  4CJ0 B;  2KOL A;  3A8K E;  1V9P A;  4DAY A;  5LL6 X;  1CA6 A;  5C4X G;  3T53 B;  1EYG A;  1JOK A;  5E1F A;  3GTO H;  3HG9 A;  3MXU A;  4WOR A;  2MP1 A;  3L9A X;  1M8A A;  2BA1 A;  5T1G A;  1Q1B A;  5HGQ A;  1L0X B;  1VQH A;  1I3Q H;  1CSP A;  3PUY A;  4XT1 B;  3M3Y H;  1FL0 A;  4N9T A;  3I4N B;  1LYL A;  4IUP A;  4IZ8 A;  3AYH B;  4LK1 C;  1H9R A;  1HFN A;  4JI4 Q;  1NMG A;  1MSG A;  3PGZ A;  3C46 A;  3HOW H;  2IL8 A;  4OO1 G;  2SNS A;  1E2V A;  4HIM A;  1EU3 A;  3EBE A;  1T5E A;  1IW7 C;  4NXM L;  2C35 B;  2UUA L;  4ZYS A;  4QGU A;  5EAY A;  3GTP B;  1RDP D;  1GUG A;  2WAQ E;  4TQU S;  3T13 A;  3R93 A;  1E2Z A;  3S1M B;  3VYT A;  3OIQ A;  1VQ9 A;  3F2B A;  3ND8 A;  2GVA A;  3I55 A;  1Y1W H;  3M85 A;  1YVC A;  1U4R A;  1O7Z A;  1U0L A;  2ZT9 C;  3M4P A;  2L11 A;  4GNX C;  3L2P A;  2WAQ B;  3C3L A;  3VDY A;  4DV0 Q;  3J81 i;  4MTK A;  4A3F B;  4A3L G;  5ELC A;  1U4P A;  3OMG A;  2K5D A;  2RDH A;  3IAY A;  1WCM H;  2VL6 A;  2KCT A;  3A74 A;  4YCU A;  5ELF A;  4DK0 A;  2JA7 B;  3A55 A;  2PNH A;  2J7Z A;  3PF4 A;  3S2D B;  5DM7 3;  1X3G A;  4C3H G;  2JEA I;  3E3X A;  3H0G G;  4BBR B;  4DV4 Q;  1QWY A;  1VQG A;  2QEX A;  1KXL A;  3BVZ A;  2QEJ C;  3BG3 A;  4HCE A;  3HOZ B;  5DNF A;  5M9O A;  4PZ7 A;  4K2L A;  2FFK B;  2KCN A;  2H1E A;  3I4M G;  1B2T A;  3OWE B;  1M1K C;  1EL0 A;  2EVB A;  2KVM A;  2QIL A;  2ALY B;  1AZQ A;  2E2I B;  3HOY B;  4N9P A;  2F0N A;  3HS0 C;  2YYZ A;  1LUZ A;  5EBD A;  2B2W C;  3CD6 A;  1M4V A;  4GLX A;  2VUM B;  2IY5 B;  1BUV T;  2G9D A;  4GOP B;  2AUK A;  5GAD C;  3TP8 A;  3I4N G;  5M5X H;  5ELB A;  3P7J A;  2I0Q A;  1C4Q A;  2D9U A;  2EPB A;  3I4L A;  2V1C C;  4DR4 L;  3B6Y A;  1PMR A;  5FLX E;  3BVM A;  4AYB E;  4LF9 Q;  1EYC A;  1OXU A;  4YCV A;  2NZ1 D;  1QE6 A;  2V4D A;  1JIC A;  1XMO L;  1BCP F;  3H94 A;  5T1I A;  4IUV A;  2LXK A;  2PYK A;  3I7F A;  5H1S E;  1D1I A;  2EE1 A;  1SFO H;  1IBK L;  2GN5 A;  1JR0 D;  1CK1 A;  4CDF C;  4JVZ A;  1KHI A;  2B29 A;  4B3M L;  1D5M C;  4GKK L;  3K7U C;  1N36 Q;  1XX8 A;  1Q7Y C;  3X3N A;  3EN2 A;  3MC0 B;  4BBR H;  1JE4 A;  1WI5 A;  3PMF A;  1RTO A;  1H9M A;  5CBE E;  5IE8 A;  1VQB A;  1VQC A;  4DV2 Q;  3T1Y Q;  4O2D A;  3LWU A;  3UDX A;  4CDD C;  1WTW A;  4DV7 L;  3K57 A;  2H4O A;  4XYQ A;  3G48 A;  1HZ9 A;  2A69 C;  1FD7 D;  4JBW A;  3WWV A;  4RMF A;  4K2K A;  1K0R A;  1K8M A;  1II3 A;  2PMZ E;  1G91 A;  1W6J A;  4DKA C;  2ENB A;  2A6E C;  4RGN A;  3SK4 A;  1WTO A;  1CKN B;  4XQQ A;  2BH2 A;  3PIO A;  1I4H A;  3KLW A;  1JQY D;  1UUP A;  3VR5 A;  5KEE A;  1BVS A;  3VR3 A;  3TDQ A;  1OXS C;  1K8O A;  3QO2 A;  1ZYR C;  4UP7 A;  1XYI A;  2F0T A;  2CQO A;  1JC7 A;  4A3E H;  1ILP A;  1L1O A;  2JA5 B;  1KRS A;  1TWH B;  3AU7 A;  3S24 A;  4L6T B;  2B3G A;  1VQE A;  5C6A A;  4IOA A;  1VMP A;  1DOL A;  1OXV A;  2A1A A;  2RHQ B;  5JPM C;  2HHH Q;  5EKK A;  3CW2 C;  5CV8 A;  3GQB A;  3G71 A;  3KLS X;  1GHK A;  1HQM C;  3GTJ B;  1CHP D;  2I46 A;  3I90 A;  4RWS C;  4DV5 Q;  4FF1 A;  2G5D A;  1ICF B;  2ZTD A;  4BXX G;  4GS3 A;  4UPA A;  2F0V A;  4BY1 B;  1DGS A;  1JMC A;  2WAQ G;  4DK6 C;  4RGM A;  1JB7 A;  1JJC B;  1EWH A;  2F0S A;  3TRE A;  3W1B A;  4LF7 Q;  2ID0 A;  4GZY C;  1SDF A;  3S15 H;  4IFD I;  4WRD A;  1E22 A;  3J81 c;  4DV5 L;  1K8G A;  4XIG S;  4EX5 A;  1QVC A;  1R9T B;  3PQI A;  3GP7 A;  1BF4 A;  4HSP A;  1I94 Q;  3AFQ A;  1SYC A;  3QR8 A;  1SMY D;  5EKI A;  2K4K A;  1QG7 A;  5KND A;  4DUY Q;  3AMU A;  5IT9 E;  1X32 A;  5CV5 A;  3VR4 A;  4ME3 A;  5EKL A;  2N78 A;  5AJ3 L;  4XQJ A;  4WJ4 A;  3H3V I;  1JJ2 A;  3HOX H;  2LXJ A;  1Y69 U;  2K04 A;  2F03 A;  2WFW A;  2UUC L;  4L5Q A;  2OQ0 A;  2GVB A;  3FKI B;  1A2U A;  3N52 A;  3PUZ A;  2AHO B;  3ULL A;  1VDZ A;  1F2M A;  2B2T C;  1XNQ L;  2OF1 A;  2XRS D;  3FHW A;  4NW2 A;  3E6Z X;  4DR6 Q;  2X69 A;  2EYF A;  1VQF A;  3OOC A;  5FJ8 H;  3CCS A;  3EJI A;  1RF2 D;  1GUT A;  4F8M A;  1EY0 A;  4ZRZ A;  3Q23 A;  2NVT H;  4AQY Q;  4B3M Q;  2AWN A;  1JJG A;  3VA5 A;  3PO3 H;  2K01 A;  3JAM L;  3GTL H;  4YCW A;  2WV6 D;  3RN5 A;  4K5W A;  5C0X G;  2O5I C;  3NBI A;  2JA5 G;  5M5W H;  1A6X A;  2R7Z G;  5F2D A;  1X3E A;  3HRZ C;  4QJF A;  3M4O H;  1RL2 A;  2PZT A;  4GN3 B;  5M3M H;  5IGF A;  2KUM A;  1CA5 A;  3RD4 A;  1YIJ A;  5C4X B;  1AE2 A;  3D6C A;  5IGD A;  1HQR D;  4DR7 L;  4PNY A;  2K7V A;  3DLL A;  1K3R A;  3PIP 3;  4EGV A;  1L1O B;  1DCZ A;  3MFY A;  2XN9 C;  4PZ8 A;  1AP0 A;  4LF9 L;  1SYB A;  3VR2 A;  1C7Y A;  1XPO A;  1XPR A;  1SNM A;  3V96 A;  1Q81 C;  3GV3 A;  1G8Z D;  5IGG A;  3GTM B;  1EIG A;  1PXU A;  2R7Z H;  2EZV A;  4OEL B;  1S5C D;  1VQO A;  2F3V A;  5FO7 B;  4IUU A;  1NAP A;  4JK1 C;  1WTV A;  1X6O A;  3PCO B;  3TBI B;  3RZD H;  3T4A C;  3R2T A;  4DUZ L;  1NBW A;  4H02 A;  1SRU A;  3MEH A;  2K6A A;  3DWQ A;  1EEF D;  5GAG C;  4A3D B;  2EY5 A;  1ML0 D;  1WTR A;  1B50 A;  2KHS A;  3HP3 A;  2A73 B;  1WD1 A;  1HR0 L;  4GKJ L;  2F0F A;  4IFD H;  1EUJ A;  2VQF L;  1RJT A;  1Z7T A;  1D1K A;  2TSS A;  5I2Y A;  1E24 A;  5BN5 A;  3HOX G;  4R4C A;  5C4X H;  2UXD Q;  1ENC A;  4FF2 A;  1N33 Q;  1BBU A;  1PZK D;  3TSS A;  4JW0 A;  1S5E D;  3H3V C;  1YHQ A;  4OX9 L;  1UNS A;  1EQQ A;  2CQA A;  3RZO H;  1PTO C;  4DR7 Q;  1ENF A;  5LHY 1;  3HGB A;  2WB1 E;  1MIU A;  2CKZ B;  2C9O A;  2JA7 G;  2YTY A;  1G51 A;  2DJF C;  4JI5 Q;  4A75 A;  2RHS B;  3S1N B;  4PZ6 A;  3FDT A;  2ASB A;  4G7H C;  2Y0S E;  2VW9 A;  4FO2 A;  5I9P A;  4TVA B;  5JAV A;  2CWA A;  3JAM i;  5C3E G;  3J7Z C;  4C3J H;  3FEW X;  1DJR D;  2UUA Q;  2QDL A;  4NXM Q;  2Y0S B;  4JI1 L;  5KYL A;  1NJI C;  4LMQ D;  2XWJ B;  2MUY A;  4AQY L;  1ZYR D;  1TWH H;  2FHT A;  2NVQ H;  5C4H A;  2I07 B;  2HT1 A;  3MXG A;  5IWA L;  3GTG B;  4ZCK A;  4A3E B;  3NWS A;  3S14 H;  1OO9 B;  1YBY A;  4ZKC B;  1EFI D;  4JI7 L;  4APV A;  3OTO Q;  2F0G A;  1C8C A;  5IYC H;  1IL2 A;  5C0X I;  2MFI A;  3H0G B;  2LKV A;  2EDG A;  1JCK B;  1K8A C;  4JI4 L;  4U68 A;  2R92 G;  1LTL A;  1VMC A;  4P2C B;  2Z8L A;  3F1Z A;  4KY6 A;  3W5O A;  1FNV A;  4C1N I;  3D4R A;  3NPP A;  1UE6 A;  2IJ0 A;  2KBN A;  4C56 C;  1ZXT A;  5JJI A;  2NVX B;  4OXP A;  3RZO B;  4HID A;  3TZD A;  4IUT A;  5CMD A;  5FOB B;  3ITP A;  4KV6 A;  4FF3 A;  3J80 L;  2VNU D;  1O80 A;  1CQV A;  1EQT A;  1PH2 A;  1PYW D;  3M9B A;  4EVO A;  2R93 G;  3LWE A;  3SK6 A;  1TKW B;  1KC8 C;  1PRT C;  3AQQ A;  4A3G B;  2L4N A;  3MAQ A;  3PO3 G;  4JI6 Q;  1PYB A;  3GTP H;  5M3M G;  2N88 A;  3GDE A;  4IUQ A;  1WVL A;  1S4Z A;  1Y8O B;  4Y7N B;  1HUN A;  4BY1 G;  3LGJ A;  3MXP A;  2O2L D;  4ILW A;  1CZW A;  4R8N A;  1HNX L;  5IGE A;  4JPB W;  2N8N A;  4JI2 L;  1WJJ A;  4IQZ A;  2EYH A;  1EEI D;  1EY9 A;  1TR5 A;  4LF8 L;  2AQ3 B;  1HXY D;  4G57 A;  4B3T L;  2NVX H;  2KCM A;  4NKL A;  3EQL C;  4JBJ A;  1AFP A;  3A0J A;  1GOZ A;  2UU9 L;  2H5X A;  3FRP B;  4RFB A;  3VYR A;  5ELD A;  2L55 A;  1I4Q A;  1U4L A;  4JOI C;  1V1P A;  1QUQ A;  2MJ8 A;  1V43 A;  5EBC A;  4ZUI A;  5CV9 A;  4PG3 A;  4YY3 Q;  1LTI D;  4R4O A;  4RG1 A;  4QY7 A;  3CCJ A;  3J7Y W;  1STB A;  2R7F A;  4LF4 L;  2B63 G;  2EJG C;  5IYB H;  3J7A F;  5I6W A;  1WTX A;  4LF5 L;  1CKO A;  5DLQ E;  1IYU A;  4UAI A;  4O1N A;  1DM0 B;  1IZ6 A;  4YWL A;  5C3W A;  1SJE D;  1X54 A;  3OWF A;  1PH5 A;  2XIW A;  2EXD A;  3QG1 A;  1UAP A;  2K1B A;  5CGK A;  1PDQ A;  2A68 C;  4A3K H;  3FP9 A;  2L12 A;  3P20 A;  4A3F G;  3L7Z C;  4P73 A;  4KJO A;  3HKZ B;  5HY6 A;  3E5S A;  4E6I A;  1VQ7 A;  1RIP A;  1PRT B;  2B2W A;  3Q6S A;  2AWO A;  4B3R Q;  1EZ6 A;  3G6J B;  4CDC C;  2WII B;  4ME5 A;  4YWM A;  1IBK Q;  4NP5 A;  5JEA J;  4Z9C B;  4V19 0;  4I7Z C;  3AB9 A;  4JV5 Q;  3STB C;  4QIW E;  4OHJ A;  2BH8 A;  1N8R C;  2CCZ A;  3R3O A;  2K5H A;  3K6O A;  2NYZ D;  1X3Q A;  1VQA A;  3PO2 G;  2Z6K C;  2ZXR A;  2DY7 A;  3G7L A;  4V0B A;  5IYD H;  1VCI A;  1DZ1 A;  1EOV A;  1KLG D;  3CCR A;  4JOI A;  4IJL A;  2UU9 Q;  2OTJ A;  3EFX D;  3OW7 A;  1Y1V H;  1PH3 A;  1QZH A;  2IPK D;  5E7N A;  2E8G A;  3KJP A;  2CH4 W;  4YY3 L;  1GUW A;  3I72 A;  4O0A A;  3SE0 A;  1O7L A;  2A6H D;  3T16 A;  3X3M A;  1D2B A;  5JJZ A;  3G6E A;  3SEB A;  1R4P B;  2RBM A;  1Y1W B;  4K0K Q;  1E3P A;  4MTN A;  4ABN A;  2WKC A;  5HUR A;  4EQN A;  3OHX C;  1NR2 A;  3A7A B;  2BOS A;  1QIL A;  3J7A 5;  1JWU D;  4B3S L;  2I5M X;  2NVY B;  4A4I A;  1E2W A;  1WD0 A;  1CHQ D;  1SAP A;  3K58 A;  2EYL A;  1BR9 A;  2JA5 H;  1VF7 A;  1HUM A;  5IIF A;  1F2L A;  1A15 A;  2EY2 A;  1LT4 D;  4FNF A;  4X3T A;  1IW7 D;  4QCL A;  3DEO A;  4OO1 H;  1VQ6 A;  1CSQ A;  5M3F B;  3L3O C;  1B53 A;  4KMU C;  3ULJ A;  2KED A;  1HNW Q;  2DNE A;  2RVL A;  1K9M C;  1PTO B;  3PSI A;  1NCV A;  3W2D A;  1LAC A;  4CKB A;  1C0A A;  3NP8 A;  4XT3 B;  2EJM A;  3CHB D;  2D0O A;  2JP1 A;  4BWG B;  2Y0S G;  3JAM E;  3UDF A;  4S3S A;  1KDB A;  2B2V A;  1SYD A;  5IP7 H;  3FVQ A;  3ONA B;  3H3V H;  3Q22 A;  1XWE A;  4DR1 Q;  4XDX A;  4ALP A;  2OCE A;  2D0P A;  2YU9 H;  3UI2 A;  2JA6 G;  4UHV A;  1TU2 B;  4A3C H;  4LFC Q;  4ZUJ A;  2NVT B;  1STY A;  1FR3 A;  1HTP A;  4IPH A;  3GTQ H;  5J3B A;  3PV0 A;  1S72 A;  1V1Q A;  1WCM G;  4G7O C;  3OYY A;  2R61 A;  2JEB I;  5FK9 C;  4X65 Q;  4JYA L;  1LM0 A;  5AFW A;  1X9N A;  4WJW A;  1KAB A;  3KDF A;  2CWP A;  3DWA A;  3HOX B;  2MGS A;  5C0X H;  2ZXO A;  4J1M A;  4UP8 A;  4IPC A;  1EQR A;  2F0L A;  2XSC A;  1LTA D;  1EOT A;  2BDO A;  1I4R A;  2IWH A;  2QW7 A;  3TQY A;  5TSS A;  2IW3 A;  1NUC A;  1F77 A;  1Z9F A;  3K5M A;  4OX9 Q;  1SNQ A;  1PA6 A;  1DON A;  2O5J C;  4LFA Q;  2R7D A;  1U9R A;  2ZJQ A;  2A19 A;  3C1E A;  1HNZ L;  1VQD A;  1HHV A;  4C3I G;  1VQM A;  1VQ8 A;  2WB1 B;  3RLO A;  1NR4 A;  1I3Q B;  2RSO A;  2F0H A;  1AH9 A;  2EYM A;  1AEX A;  4XYO A;  4P72 A;  1KNA A;  4NXN L;  2F0O A;  3DM1 A;  1K83 B;  3MA2 B;  1HR0 Q;  2IHF A;  1B3A A;  5C44 G;  5C3E B;  1HCZ A;  2HQL A;  1GO3 E;  4DR3 L;  2NB0 A;  3N6R A;  2RSN A;  3M7G A;  3NSW A;  1BBW A;  1PH8 A;  3A54 A;  1BO0 A;  1TQO A;  2E74 C;  2DY8 A;  1TT2 A;  3SK5 A;  4OIK A;  2DUD A;  4GKJ Q;  5KIX A;  2KCC A;  3H6M A;  3T56 B;  3CCQ A;  1EIF A;  2KEC A;  1S3O A;  4OO1 I;  2IHE A;  2JJQ A;  2ZXP A;  3DWP A;  3I4M B;  2LS0 1;  5I4D A;  4K8J A;  2Z4I A;  2K33 A;  1KAA A;  2ICE C;  4TSS A;  1OXX K;  4CJ2 C;  1P16 A;  4NPS A;  3J81 L;  1VQ5 A;  2GA4 B;  3D4W A;  2DN8 A;  4JI8 L;  3NQI A;  4RHR A;  3MXN B;  2YTX A;  1ESR A;  4MIU A;  2A68 D;  3TP7 A;  2F4V Q;  5M5X B;  2N55 A;  2Q8I B;  3RR5 A;  1DOK A;  3NWT A;  4XQN A;  4KKT A;  2LMC B;  2MQH A;  1GUO A;  2JA7 H;  1N32 Q;  3KK7 A;  5M3F G;  3H15 A;  2CHB D;  3S1Q B;  3I70 A;  1SYF A;  1F9S A;  3PUW A;  4L5T A;  3Q8D A;  1C48 A;  2YV5 A;  1RD9 D;  1XNR L;  2CW0 C;  4X66 L;  1LT5 D;  4C2M H;  1IBM Q;  1K0S A;  2E5L L;  2E2D C;  3NXW A;  4QUC A;  2Q2U A;  3I8Z A;  1STN A;  3HFZ B;  3KUP A;  4HJ8 A;  1FVI A;  2AQ2 B;  1B44 D;  2E76 C;  4HJ5 A;  3K81 C;  1MGS A;  1B9M A;  5FLX L;  2K5W A;  4QL5 A;  4DPG A;  4JYA Q;  4A3L H;  2PI2 E;  2AQ1 B;  1PH9 A;  3FMC A;  2B2T A;  2AMC B;  5J1Z A;  3HOW G;  4PMB A;  1H9S B;  4A3C G;  4JCV E;  2XVS A;  3HKZ E;  4OWX B;  4C3J B;  3CQZ B;  1VF5 C;  2FJ2 A;  3A5U A;  3CRL C;  3CCV A;  4HIK A;  1F9P A;  2K52 A;  1BCP C;  5D3D A;  1PH4 A;  1FGU A;  1VQ4 A;  3A8I E;  1VQN A;  4PMC A;  1EYD A;  3UE0 A;  1OTC A;  4YIJ A;  3E0E A;  3M4O B;  1Q82 C;  2L15 A;  1WOC A;  1N9W A;  4DAV A;  4A93 B;  1RTN A;  1A3T A;  1U4M A;  2MHV A;  1QNU A;  2HIV A;  1SSO A;  3SXH A;  1EWI A;  1IYV A;  1IBL L;  3ERQ A;  1O7Y A;  3D6W A;  2Q2I A;  4H0L C;  1I6H B;  1I94 L;  4KHP Q;  5C4Z A;  4X64 Q;  1VQP A;  2G9H D;  1J5E Q;  1YNJ D;  2XTI A;  2F0M A;  3S17 B;  1YZ6 A;  4BBS H;  3K5L A;  1J5E L;  1SRO A;  4OWT B;  4LF7 L;  4BY7 G;  3QB3 A;  5C4J H;  4KHP L;  3NE5 B;  1YNX A;  2J0T D;  4CJ1 B;  2RDG A;  1CT1 D;  5KGU A;  5IYC G;  2E2H H;  3M4Y A;  1W2B A;  4C3I H;  3CPW A;  1MKH A;  2F0I A;  2VB2 X;  4TKO B;  3IFD A;  1KIX A;  3NUC A;  2B63 B;  3Q24 A;  4PMW A;  1SE2 A;  2NN6 G;  4HJ7 A;  4O42 A;  1I5F A;  3TS0 A;  3PO2 H;  3CCM A;  1VQK A;  4A3M H;  3Q0A A;  3DM3 A;  3J80 i;  3AFP A;  1SND A;  2O4X A;  3JC6 6;  1NTG A;  1UEA B;  2XGT A;  1NY4 A;  1U5K A;  1BKB A;  3SDZ A;  1L2F A;  3BDC A;  1Q46 A;  4GLV B;  5BN3 A;  5ISR A;  4WJ3 M;  3LX0 A;  3KLS A;  4YHH Q;  4A3K B;  2HCI A;  3FKI H;  3A56 A;  3KF6 A;  4GOP C;  4B3R L;  1JOR A;  3VYU A;  5IT9 L;  3PIO 3;  4BY1 H;  3M7N A;  1QNK A;  5JPN C;  5M5Y H;  4NB3 A;  3NQT A;  1A63 A;  2A69 D;  2B2V C;  3RUZ A;  1IBM L;  3TEH B;  1SMX A;  3BJU A;  2RQX A;  1G2S A;  2WKD A;  1TWG H;  3PO3 B;  2F52 A;  5BR8 Q;  4MHE A;  1B4O A;  5M5W B;  5IYD G;  2PW7 A;  5HGT A;  1R9T H;  2LY7 A;  1SE8 A;  1KAW A;  2Q2T A;  1D5Z C;  2FMM A;  4AYB B;  2M9V A;  2F4V L;  1EY5 A;  2JN4 A;  1EY8 A;  1AE3 A;  1YHA A;  2KJX A;  4M8A A;  3OMC A;  5I6Y A;  1X56 A;  3F8T A;  1JOQ A;  4IJH A;  1O7I A;  1AZP A;  4BA1 I;  3S17 H;  1S5B D;  2EJF C;  1I6V C;  3ER0 A;  1W6K A;  1K73 C;  2F3I A;  4NMZ A;  3CC2 A;  4B9X A;  2ZM6 L;  1NMF A;  1D6E C;  1EIY B;  3CKI B;  5ELO A;  3HOU G;  1D7Q A;  2F3W A;  3KF6 B;  4OWW B;  3HOV B;  1CKN A;  4F87 A;  1K83 H;  3WOE A;  1TS2 A;  3MTS A;  4RAU C;  4LF8 Q;  4ZK9 B;  5NUC A;  3E0J A;  3K0X A;  1LTR D;  1SJH D;  3D4D A;  1FYC A;  4JI2 Q;  4RCO A;  1KD1 C;  1Y8P B;  1W3S A;  4WFN 3;  1I50 B;  2NVY H;  4A93 G;  5DAU A;  2F1M A;  1SYE A;  4QIW B;  1HNX Q;  1FGB D;  4ZAI A;  4H7B A;  2YTV A;  2ZTC A;  1DD2 A;  3K80 C;  1EIH A;  2Z6K A;  4RHS A;  4H13 C;  4B9W A;  4AYB G;  3CF5 A;  2D62 A;  1GXD C;  3H09 A;  1YHB A;  1ASZ A;  2D5D A;  1LLR D;  1S40 A;  4GNX A;  5M3M B;  1ENA A;  1FNW A;  1LT6 D;  1YNN D;  4DXG A;  2JSO A;  2QCP X;  4F88 A;  2K75 A;  3GTM H;  2EIF A;  2X6L A;  2R92 H;  2IT1 A;  2R7Z B;  2Q2H A;  1XMQ Q;  2JA6 B;  3T1H L;  3IL8 A;  4AH6 A;  3NEN A;  4QB4 A;  4AIM A;  1BOS A;  1PFN A;  3HOU B;  2EXZ A;  1AW7 A;  4HAE A;  1UE1 A;  3K0Y A;  1NNX A;  1HNZ Q;  3GTQ B;  2NBF A;  2DJG C;  4I7A A;  4CKC A;  4CKE A;  3E9H A;  4MN3 A;  2RCN A;  1I50 H;  3IRB A;  1IKM A;  1K28 A;  4A3D H;  4KN7 C;  3HOW B;  5LMN Q;  4X3S A;  2IX1 A;  5FLM H;  2VY3 A;  4U67 3;  5E3F A;  4HR7 B;  1QVF A;  1SXT A;  2M00 A;  2RF4 A;  3GD7 A;  2K03 A;  4OL7 A;  3MHB A;  3I91 A;  3F2C A;  3CCE A;  1CM9 A;  1J6Q A;  3RMH A;  3HOV G;  1SNC A;  2KA7 A;  4C3J G;  1Q1E A;  1R4Q B;  1ZKO A;  1TWA B;  5EPL A;  1STA A;  3CME A;  2NVQ B;  3KDF B;  4LFC L;  1ET9 A;  4DGZ A;  1A3U A;  4QQB X;  5K36 H;  4GN5 A;  4A3M G;  4X65 L;  4RA8 A;  1V1O A;  4GOP A;  5E4W C;  2IX0 A;  1QJO A;  1JWS D;  1QCB D;  4N8X 1;  2YU9 B;  5G3L D;  4A3D G;  4OGQ C;  4RGT A;  1TWF H;  4DV6 Q;  4DV1 L;  4P74 A;  3KF8 B;  3I73 A;  1CFM A;  1V1P B;  1A62 A;  3NHH A;  1VQI A;  2K5N A;  3U9S A;  3V05 A;  5IT9 c;  1IKL A;  1ICW A;  1S5F D;  4C1N K;  5IP9 H;  1SNP A;  1LT3 D;  1X3F A;  4X6A H;  2K14 A;  4LFB Q;  1VS0 A;  4B08 A;  3T1H Q;  3W3A A;  2ATW A;  1G29 1;  2FIN B;  4POF A;  5IP7 G;  1Z47 A;  2F0P A;  3LNN A;  1HTL D;  3E9I A;  5CC4 A;  2HIX A;  3ERO A;  4C3I B;  2UUB L;  5JJK A;  2PQA B;  1SFO B;  5LMU L;  3S16 H;  2E2H B;  4HTH A;  5JJL A;  4LF6 L;  2SDF A;  4A93 H;  2E2J B;  1PZJ D;  4XXE A;  2PPB C;  3HOZ G;  4IAL A;  2L5T A;  1CUK A;  3QOL A;  1KTK A;  4PV1 C;  1JE5 A;  3U50 C;  2UXC Q;  4CGY B;  1RKN A;  2PW5 A;  4F7X A;  2NWG A;  2A8V A;  2F0E A;  1ET6 A;  3TN2 A;  3ND9 A;  3HOY H;  3R2I A;  2B2Y A;  5IOC A;  1KRT A;  2D2C C;  2B2U C;  2JA9 A;  3RLF A;  2VQE Q;  1JB3 A;  2A6H C;  2DNC A;  1YNJ C;  1STG A;  2R92 B;  3A5Z B;  1SE3 A;  4BS9 A;  1YJN A;  4KTA A;  4LNQ A;  1X55 A;  4M1U B;  2AKW B;  1LTB D;  4OEM B;  1KDC A;  2NZH A;  1CKM A;  5C3E H;  2PI2 A;  3OW2 A;  1HH2 P;  2WP8 J;  3GTO B;  1QZG A;  2BA0 A;  2NN6 H;  2QF7 A;  1GUN A;  4JBK A;  3DMU A;  1E1T A;  1E1O A;  3MXN A;  3NEL A;  2HCC A;  5LMN W;  2IX3 A;  1RCV D;  2L9H A;  5J39 A;  2QA4 A;  1STE A;  2EYP A;  1SBB B;  1SE4 A;  1A3V A;  2K28 A;  1F2Y A;  4LUV A;  1VQL A;  2J4X A;  4JV5 L;  2NTT A;  5BR8 L;  4IFD G;  3S1Q H;  2PNR C;  1BCP B;  1PRT D;  2CH4 A;  2R6G A;  3DXJ C;  2FMC A;  4X62 L;  1I4G A;  4BA2 I;  3I4O A;  4LWC A;  1YJ9 A;  3J81 j;  3J7A V;  2JQO A;  3IFT A;  1PTO F;  1PFB A;  5A35 A;  1G6Z A;  1KQS A;  3M4Q A;  3QJY A;  1X3P A;  3EA6 A;  1LTS D;  3U4V A;  1ASY A;  4JI3 L;  3S1M H;  5BN4 A;  1J8I A;  3TS2 A;  2AUJ D;  2MPM A;  2EYJ A;  4YHH L;  2K05 A;  3OIP A;  5FKA C;  5EPK A;  2QGQ A;  4ODG A;  4A3B G;  4DAP A;  1XXG A;  2ICI A;  4R9W A;  2PMZ B;  3CPF A;  3S9W A;  3AEV A;  2F0W A;  2SNM A;  3R8B A;  1WTP A;  3EIV A;  4A3F H;  1RHP A;  1S5D D;  4LJZ C;  4QF4 A;  4EQP A;  2B2U A;  1FNU A;  4LF4 Q;  3QIA A;  1XNQ Q;  1H9S A;  5FLX c;  3EVQ A;  3OSO A;  3S15 B;  3S16 B;  5FJ8 G;  2OT2 A;  4HSV A;  1QOH A;  2KQ3 A;  5CR3 A;  2Z9H A;  1Q8K A;  1NE3 A;  5EGT A;  3TRZ A;  3D3R A;  2X6G A;  4TRD A;  3D31 A;  5KYI A;  4DV3 Q;  5JVG 3;  4L8J A;  1HPC A;  1TVX A;  1TY0 A;  3S2D H;  1PHJ A;  2P5Z X;  1B8A A;  4Y52 H;  5IGB A;  1KLU D;  2I5H A;  1YI2 A;  5K36 G;  1SNO A;  2EY1 A;  1PFS A;  1M90 C;  1H95 A;  3KBG A;  4N8F A;  5A2Q L;  2MO0 A;  4GLA C;  4UDU C;  1Q86 C;  4POG A;  4K5V A;  3S2H H;  2JE6 I;  1V8Q A;  1TS4 A;  3J81 E;  3D0F A;  2N49 A;  3GV6 A;  3PIP A;  2VB3 X;  3CQZ H;  4IPG A;  1TII D;  4XTC S;  4MZ9 A;  2HDM A;  1E7Z A;  2KHI A;  4R8I A;  5C4J B;  4JC0 A;  4UY8 C;  4LUZ A;  1IBL Q;  2JA6 H;  1XPU A;  4DU9 A;  4A3I B;  4DFA A;  4FDB A;  2R93 H;  4RGO S;  4HIO A;  3L0O A;  3I2Z A;  1YNN C;  5GRO A;  1MJC A;  4HMI A;  1PH7 A;  1PVO A;  3H91 A;  1MJE A;  4X64 L;  5IP9 G;  5LMU Q;  3M3Y B;  3GTL B;  2UXB L;  2K5V A;  3TP5 A;  1QUQ B;  3STB D;  3HOZ H;  1X65 A;  2DGY A;  1N34 Q;  4HN7 A;  2L1B A;  1Y14 B;  5D3I B;  2XWB B;  4LFB L;  1DYQ A;  3RLN A;  4A3J H;  1PTO H;  1F9R A;  1B7Y B;  1GHJ A;  4LW1 A;  3P1H A;  3CCU A;  1BXT A;  4JI0 Q;  3FKI G;  3SHL A;  4DV1 Q;  1A8V A;  2VUM H;  4CHT B;  2OEO A;  1L0W A;  1PYS B;  1EFW A;  4R4T A;  4DA2 A;  1Q3L A;  1TWC B;  3HOY G;  1PFM A;  4JI7 Q;  5EQ0 A;  3SK8 A;  2C5C A;  3K8A A;  5C0X J;  2BDN A;  1KNE A;  2MO1 A;  5FLM G;  2WIN B;  3KYH C;  4FXG C;  1ILQ A;  4IUR A;  4IOC A;  4KHZ A;  3BZK A;  4DR5 Q;  1MHW C;  4KD4 A;  3CRK C;  4DXF A;  3CU7 A;  4L63 B;  3OTO L;  1H9J A;  4LAA A;  5LMN L;  4ZQ3 A;  2Q8T A;  4Q0F A;  4K6D A;  3K59 A;  2RA4 A;  4KK7 A;  1N32 L;  3MFG A;  5IWA Q;  3I3C A;  1ZEQ X;  2E5L Q;  4A3J B;  2EOT A;  4J6H A;  4JI5 L;  2F0Q A;  2F0K A;  2K5Q A;  1WFQ A;  4X66 Q;  2E2J H;  4JI1 Q;  4IFD J;  3KLR A;  4X3K A;  3KF8 A;  1AN8 A;  5ELE A;  1B3Q A;  3VA7 A;  1WTH A;  4OIJ A;  4JI8 Q;  1L1O C;  4RKB A;  1XMQ L;  3BZD B;  1PLF A;  4X3U A;  4A3G G;  4CBV A;  1LAB A;  5KRU A;  1T5X D;  1TS5 A;  2OXP A;  5JOB A;  2ZJR A;  4DR4 Q;  4K8I A;  3DUZ A;  1IYJ B;  1HZB A;  1LTT D;  5LL6 S;  4CDE C;  5GAE C;  2UXD L;  3NTK A;  4R1J A;  3ZYY X;  1A0I A;  4DR2 Q;  3SGI A;  3HKZ G;  2EQS A;  3F2D A;  3SR1 A;  2VQF Q;  5JVH 3;  1QVG A;  3MEF A;  3SVM A;  3DHQ A;  1VQJ A;  2A5H A;  1HZC A;  1N33 L;  4BBR G;  1WCM B;  1G6P A;  2CFM A;  3BVG A;  3PUV A;  2M2L A;  1XJV A;  2I5L X;  1EQV A;  5L37 A;  4KLK A;  3VYS A;  4DUZ Q;  1EY4 A;  1I4X A;  5GQO A;  4G4K A;  3QWN A;  2CW0 D;  2F0D A;  5ELN A;  1BCP D;  3J80 c;  1STH A;  4EQO A;  4DNT B;  1YJW A;  1E0B A;  1EU4 A;  3H0G H;  4H44 C;  4J8Q A;  5FO9 B;  1ESF A;  1SYG A;  3A7L A;  2ES2 A;  2HQE A;  4DR2 L;  4JBM A;  5DEH A;  2F0U A;  3S14 B;  2A6E D;  2PQA A;  2TMP A;  3WOF A;  3RN2 A;  2QDB A;  2VXW A;  2ZM6 Q;  3FPP A;  4OON A;  2SEB D;  4DR3 Q;  2LFN A;  3ERS X;  2NN6 I;  1PTO D;  2E75 C;  3CAM A;  4GNX B;  3BS1 A;  3K7A B;  4HMJ A;  4K5X A;  5IY0 A;  4A3K G;  2B8G A;  2Q8R E;  2EYO A;  1F9Q A;  4IUN A;  3CP0 A;  3UDG A;  3G4S A;  4KI0 A;  3HEJ A;  2XRQ D;  1C9O A;  2Z1C A;  4KY5 A;  3BU2 A;  3ICE A;  5CV4 A;  1PRT F;  4BY7 B;  5D14 A;  4A76 A;  4DF7 A;  5I9O A;  3ZJY C;  1F2Z A;  4LFA L;  2K32 A;  4A3B B;  3NEM A;  2JXM B;  2XNA C;  2KEN A;  4UP9 A;  1G2T A;  5CYU A;  3TME A;  1TXY A;  3MVV A;  4KKS A;  3PF5 A;  1QB5 D;  4DR5 L;  2WB1 G;  1OXT A;  5C5M A;  1HA6 A;  3GTG H;  2OTL A;  1PH6 A;  1LO5 D;  4ID6 A;  2B8F A;  2PZW A;  1IHZ A;  1UWV A;  1SEB D;  4J15 A;  4KN4 C;  2MNA A;  2PCF B;  1Y1V B;  1L0Y B;  3I4M H;  3HKS A;  2A74 C;  3OPO A;  5C5L A;  3UDI A;  3URY A;  5KNC A;  4DR1 L;  1Y1V G;  4DN4 M;  1B9N A;  4DNR B;  3K5N A;  2SOB A;  3NK9 A;  1SLJ A;  3K7A H;  4R4Q A;  3KBX A;  4L5S A;  1UE5 A;  1SR3 A;  2HD3 A;  5JEA H;  4P75 A;  3P75 A;  3NTI A;  1GVP A;  3MWY W;  2KHJ A;  4JI0 L;  3JAM c;  4KHV A;  4FVM A;  5M5Y B;  5AJ3 Q;  1MI2 A;  1GUS A;  1NSN S;  5IGC A;  1TWG B;  2HUG A;  3K5O A;  4DR6 L;  5KNB A;  3CC7 A;  4DK3 C;  1MD2 D;  3BDO A;  4DUY L;  1HNW L;  2R93 B;  3U58 A;  1SMY C;  1LV9 A;  3BYT B;  4ZLT F;  2L0C A;  3CC4 A;  2UUC Q;  1HR0 W;  2OQK A;  2Z0S A;  5COY A;  4A3I G;  3CCL A;  1I4P A;  1BBX C;  3KFU A;  5K5P A;  4FP5 D;  5CV6 A;  5FO8 B;  4B3S Q;  3ULP A;  3TP6 A;  1N34 L;  2EY6 A;  3CMA A;  2JK8 A;  5EJW A;  1DXM A;  1B1Z A;  3C1F A;  4QUF A;  3S1R H;  2UXB Q;  1I6H H;  3UE1 A;  1LTG D;  3CXC A;  2BCO A;  2PO4 A;  1XTC D;  2JA8 H;  1YEZ A;  1D5X C;  3BZC A;  3TZU A;  3HOV H;  4KY7 A;  1T9H A;  1IL8 A;  3WDN A;  1IXR A;  2F0J A;  4A3I H;  1JOO A;  1TWC H;  3O13 A;  2HHH L;  2HDL A;  5J22 A;  2PQE A;  1BQQ T;  4BY7 H;  4K0K L;  1ONL A;  3A8J E;  4FYD A;  4KJN A;  1P8L A;  2WAC A;  1A2T A;  4KD3 A;  4FXK C;  2ZJP A;  4IPD A;  4RKL A;  2Z6B A;  4DK1 A;  4G7Z C;  4A3E G;  1CTM A;  1EYA A;  3GTK B;  4A3M B;  4DV3 L;  2VUM G;  1KL9 A;  2KEE A;  4Q5V A;  3D8G A;  3KJO A;  1EWC A;  1KDA A;  4FF4 A;  1TS3 A;  3NBH A;  3BYY B;  1Y8N B;  4I65 A;  2OWO A;  2LSS A;  3C2P A;  4DV7 Q;  4P71 A;  5D65 A;  3NTH A;  1FJG Q;  1O78 A;  3S1R B;  4JI3 Q;  1GKH A;  4DV2 L;  3T1Y L;  1PV4 A;  3HZX A;  4DNI A;  1Q8I A;  2RKS A;  2F4I A;  5JEA G;  3I56 A;  4BBS B;  3HOU H;  1JWM D;  1HFG A;  5DM6 3;  4YWK A;  2CVR A;  3T51 B;  3DEP A;  4EQ5 A;  1SN8 A;  3GO5 A;  3MZ5 A;  1PZI D;  1PH1 A;  1N36 L;  1XNR Q;  4LF5 Q;  1HJP A;  4L5R C;  2JYO A;  1FJG L;  1H9K A;  3PO2 B;  5A2Q E;  1HRJ A;  4LUO A;  2RDF A;  1BNZ A;  1J9O A;  4ULL A;  1MSH A;  1XMO Q;  5IYB G;  2B63 H;  3V2T A;  1B70 B;  1GD7 A;  3QOJ A;  3F2U A;  4C3H B;  2VZA A;  1CQF A;  4GKK Q;  4HJ9 A;  1HA5 A;  4X62 Q;  4HJA A;  2QKI C;  2RCF A;  1ROD A;  1DOM A;  4A3G H;  1TWA H;  4DAY B;  5C3X A;  5C44 H;  4Y7N H;  2K50 A;  4IN3 A;  3VR6 A;  3PUX A;  1WYD A;  1WTQ A;  5CBA E;  1TWF B;  4R4I A;  4IO9 A;  4GN4 B;  5E4X A;  1EZ8 A;  2JA8 B;  1Y1W G;  2JA8 G;  3U4Z A;  4ZKB B;  5I2X A;  3NBH B;  4HCS A;  1D8L A;  3S2H B;  2ZTE A;  4K6L A;  4KKU A;  3U9O A;  1GJX A;  1MBY A;  5G3L F;  3I4N H;  2VS1 A;  4BXX H;  1JT8 A;  5EPJ A;  2FXQ A;  2NUC A;  5GAH C;  3KOJ A;  4B3T Q;  3W1G A;  3J80 E;  4DV4 L;  1CI3 M;  3FPU B;  2BE5 C;  1YIT A;  1UEB A;  4JI6 L;  1Z6H A;  2VQE L;  2B2Y C;  3RZD B;  1XTD A;  4RH6 A;  4HED A;  3RNU A;  2N3S A;  2B39 A;  1Q90 A;  2Z4H A;  4A3B H;  1HZA A;  4QMG A;  3S1N H;  1EY7 A;  5COR A;  2R3Z A;  4C3H H;  5M3F H;  1BDO A;  2UXC L;  1K3B C;  4BBS G;  3BDL A;  3GTK H;  3IKJ A;  4K14 A;  4NXN Q;  4DV0 L;  4C2M B;  1EY6 A;  3GTJ H; 
#chains in the Genus database with same CATH homology
 1Q12 A;  4PQX A;  4RCN A;  2BE5 D;  5IOD A;  2PZU A;  1TY2 A;  5CV7 A;  5C44 B;  4NDX A;  1CZG A;  4FXD A;  2NTS A;  4CJ0 B;  2KOL A;  3A8K E;  5LL6 X;  4DAY A;  1CA6 A;  3T53 B;  1JOK A;  5E1F A;  3HG9 A;  3MXU A;  4WOR A;  2MP1 A;  3L9A X;  1M8A A;  2BA1 A;  5T1G A;  1Q1B A;  1L0X B;  3PUY A;  4XT1 B;  4N9T A;  3I4N B;  4IUP A;  4IZ8 A;  4LK1 C;  1H9R A;  1HFN A;  1MSG A;  3C46 A;  2IL8 A;  4OO1 G;  2SNS A;  1E2V A;  1EU3 A;  1T5E A;  1IW7 C;  4ZYS A;  3GTP B;  1RDP D;  1GUG A;  4TQU S;  3T13 A;  3R93 A;  1E2Z A;  3S1M B;  3VYT A;  3OIQ A;  3ND8 A;  3M85 A;  1U4R A;  1O7Z A;  2ZT9 C;  2L11 A;  2WAQ B;  3C3L A;  4A3F B;  5ELC A;  1U4P A;  3OMG A;  2K5D A;  2RDH A;  3IAY A;  5ELF A;  2JA7 B;  4DK0 A;  3A55 A;  2J7Z A;  3S2D B;  5DM7 3;  4C3H G;  2JEA I;  4BBR B;  1QWY A;  3BVZ A;  2QEJ C;  3BG3 A;  4HCE A;  3HOZ B;  5DNF A;  5M9O A;  4K2L A;  2FFK B;  2KCN A;  2H1E A;  1B2T A;  3OWE B;  1EL0 A;  2EVB A;  2KVM A;  2QIL A;  1AZQ A;  2E2I B;  3HOY B;  4N9P A;  2F0N A;  3HS0 C;  2YYZ A;  5EBD A;  2B2W C;  1M4V A;  2VUM B;  1BUV T;  2G9D A;  2AUK A;  3TP8 A;  5ELB A;  3P7J A;  1C4Q A;  2D9U A;  2EPB A;  3I4L A;  1PMR A;  5FLX E;  3BVM A;  1EYC A;  1OXU A;  2NZ1 D;  1QE6 A;  2V4D A;  1JIC A;  1BCP F;  3H94 A;  5T1I A;  4IUV A;  2PYK A;  1D1I A;  2EE1 A;  1JR0 D;  1CK1 A;  1D5M C;  1XX8 A;  3X3N A;  3MC0 B;  1JE4 A;  3PMF A;  1RTO A;  1H9M A;  5CBE E;  3LWU A;  1WTW A;  3K57 A;  2H4O A;  4XYQ A;  2A69 C;  1FD7 D;  4JBW A;  4K2K A;  1K8M A;  1II3 A;  1G91 A;  1W6J A;  2ENB A;  2A6E C;  4RGN A;  3SK4 A;  1WTO A;  4XQQ A;  1I4H A;  1JQY D;  1UUP A;  3VR5 A;  5KEE A;  3VR3 A;  3TDQ A;  1OXS C;  1K8O A;  3QO2 A;  1ZYR C;  1XYI A;  2F0T A;  1JC7 A;  1ILP A;  2JA5 B;  1TWH B;  3AU7 A;  4L6T B;  5C6A A;  1VMP A;  1DOL A;  1OXV A;  5JPM C;  5EKK A;  5CV8 A;  3GQB A;  1GHK A;  3KLS X;  1HQM C;  3GTJ B;  1CHP D;  2I46 A;  3I90 A;  4RWS C;  4FF1 A;  2F0V A;  4BY1 B;  4RGM A;  1EWH A;  2F0S A;  2ID0 A;  4GZY C;  1SDF A;  4IFD I;  4WRD A;  4XIG S;  1R9T B;  3GP7 A;  1BF4 A;  4HSP A;  1SYC A;  1SMY D;  5EKI A;  1QG7 A;  5KND A;  3AMU A;  5IT9 E;  1X32 A;  5CV5 A;  3VR4 A;  5EKL A;  4XQJ A;  1Y69 U;  2K04 A;  2F03 A;  3FKI B;  1A2U A;  3N52 A;  3PUZ A;  1VDZ A;  1F2M A;  2B2T C;  2OF1 A;  2XRS D;  4NW2 A;  3E6Z X;  2X69 A;  2EYF A;  3OOC A;  3EJI A;  1RF2 D;  1GUT A;  4F8M A;  1EY0 A;  4ZRZ A;  3Q23 A;  2AWN A;  3VA5 A;  2K01 A;  3JAM L;  2WV6 D;  4K5W A;  5C0X G;  2O5I C;  3NBI A;  1A6X A;  5F2D A;  3HRZ C;  2PZT A;  5IGF A;  2KUM A;  1CA5 A;  3RD4 A;  5C4X B;  3D6C A;  5IGD A;  1HQR D;  4PNY A;  2K7V A;  3PIP 3;  4EGV A;  1DCZ A;  3MFY A;  2XN9 C;  1AP0 A;  1SYB A;  3VR2 A;  1SNM A;  3V96 A;  3GV3 A;  1G8Z D;  5IGG A;  3GTM B;  1EIG A;  1PXU A;  2EZV A;  1S5C D;  2F3V A;  5FO7 B;  4IUU A;  1NAP A;  4JK1 C;  1WTV A;  3TBI B;  3T4A C;  3R2T A;  3MEH A;  2K6A A;  3DWQ A;  1EEF D;  4A3D B;  2EY5 A;  1ML0 D;  1WTR A;  1B50 A;  2KHS A;  3HP3 A;  2A73 B;  1WD1 A;  2F0F A;  4IFD H;  1RJT A;  1Z7T A;  1D1K A;  2TSS A;  5I2Y A;  5BN5 A;  1ENC A;  4FF2 A;  1PZK D;  3TSS A;  1S5E D;  3H3V C;  1UNS A;  2CQA A;  1PTO C;  1ENF A;  5LHY 1;  3HGB A;  2C9O A;  3S1N B;  3FDT A;  4G7H C;  4FO2 A;  5I9P A;  5JAV A;  3FEW X;  1DJR D;  2Y0S B;  5KYL A;  4LMQ D;  2XWJ B;  2MUY A;  1ZYR D;  2FHT A;  5C4H A;  2I07 B;  3MXG A;  3GTG B;  4A3E B;  3NWS A;  1OO9 B;  4ZKC B;  1EFI D;  2F0G A;  1C8C A;  5C0X I;  3H0G B;  2LKV A;  2EDG A;  1JCK B;  4U68 A;  1VMC A;  4P2C B;  2Z8L A;  4KY6 A;  1FNV A;  4C1N I;  3D4R A;  3NPP A;  2IJ0 A;  4C56 C;  1ZXT A;  2NVX B;  3RZO B;  3TZD A;  4IUT A;  5CMD A;  5FOB B;  3ITP A;  4KV6 A;  4FF3 A;  3J80 L;  2VNU D;  1O80 A;  1CQV A;  1EQT A;  1PYW D;  4EVO A;  3LWE A;  3SK6 A;  1TKW B;  1PRT C;  4A3G B;  2L4N A;  3MAQ A;  2N88 A;  4IUQ A;  1WVL A;  1S4Z A;  1Y8O B;  4Y7N B;  1HUN A;  3MXP A;  2O2L D;  4ILW A;  1CZW A;  4R8N A;  5IGE A;  4IQZ A;  2EYH A;  1EEI D;  1EY9 A;  1TR5 A;  2AQ3 B;  1HXY D;  4G57 A;  4NKL A;  3EQL C;  1AFP A;  1GOZ A;  3FRP B;  3VYR A;  4RFB A;  5ELD A;  2L55 A;  1I4Q A;  1U4L A;  1V1P A;  2MJ8 A;  1V43 A;  5EBC A;  4ZUI A;  5CV9 A;  1LTI D;  3J7Y W;  1STB A;  2EJG C;  3J7A F;  5I6W A;  1WTX A;  1IYU A;  4UAI A;  4O1N A;  1DM0 B;  5C3W A;  1SJE D;  3OWF A;  2XIW A;  3QG1 A;  1UAP A;  2K1B A;  5CGK A;  1PDQ A;  2A68 C;  2L12 A;  3P20 A;  3L7Z C;  4KJO A;  3HKZ B;  3E5S A;  4E6I A;  1PRT B;  2B2W A;  3Q6S A;  2AWO A;  1EZ6 A;  3G6J B;  2WII B;  4ME5 A;  4NP5 A;  5JEA J;  4Z9C B;  4V19 0;  4I7Z C;  3AB9 A;  4OHJ A;  3R3O A;  3K6O A;  2NYZ D;  1X3Q A;  2ZXR A;  2DY7 A;  3G7L A;  4V0B A;  1VCI A;  1DZ1 A;  1KLG D;  3EFX D;  3OW7 A;  2IPK D;  1GUW A;  3I72 A;  3SE0 A;  1O7L A;  2A6H D;  3T16 A;  3X3M A;  1D2B A;  5JJZ A;  3SEB A;  1R4P B;  2RBM A;  1Y1W B;  4ABN A;  2WKC A;  5HUR A;  4EQN A;  3OHX C;  1NR2 A;  3A7A B;  2BOS A;  1QIL A;  1JWU D;  2NVY B;  1E2W A;  1WD0 A;  1CHQ D;  3K58 A;  1SAP A;  2EYL A;  1BR9 A;  1VF7 A;  1HUM A;  5IIF A;  1F2L A;  1A15 A;  2EY2 A;  1LT4 D;  4FNF A;  4X3T A;  1IW7 D;  4QCL A;  3DEO A;  4OO1 H;  5M3F B;  3L3O C;  1B53 A;  4KMU C;  2KED A;  2DNE A;  2RVL A;  1PTO B;  1NCV A;  3W2D A;  1LAC A;  4CKB A;  3NP8 A;  4XT3 B;  2EJM A;  3CHB D;  2JP1 A;  4BWG B;  3JAM E;  4S3S A;  1KDB A;  2B2V A;  1SYD A;  3FVQ A;  3ONA B;  3Q22 A;  1XWE A;  4XDX A;  3UI2 A;  1TU2 B;  4ZUJ A;  2NVT B;  1STY A;  1FR3 A;  1HTP A;  3PV0 A;  4G7O C;  2R61 A;  2JEB I;  5FK9 C;  5AFW A;  4WJW A;  1KAB A;  3DWA A;  3HOX B;  2MGS A;  5C0X H;  2ZXO A;  4J1M A;  2F0L A;  2XSC A;  1LTA D;  1EOT A;  2BDO A;  1I4R A;  2IWH A;  5TSS A;  2IW3 A;  1NUC A;  1F77 A;  3K5M A;  1SNQ A;  1DON A;  2O5J C;  1U9R A;  3C1E A;  1HHV A;  4C3I G;  2WB1 B;  1NR4 A;  1I3Q B;  2RSO A;  2F0H A;  2EYM A;  1AEX A;  4XYO A;  1KNA A;  2F0O A;  3DM1 A;  1K83 B;  3MA2 B;  1B3A A;  5C3E B;  1HCZ A;  2NB0 A;  3N6R A;  2RSN A;  3M7G A;  3NSW A;  3A54 A;  1BO0 A;  1TQO A;  2E74 C;  2DY8 A;  1TT2 A;  3SK5 A;  4OIK A;  5KIX A;  2KCC A;  3H6M A;  3T56 B;  2KEC A;  4OO1 I;  2ZXP A;  3DWP A;  3I4M B;  2LS0 1;  5I4D A;  4K8J A;  2Z4I A;  2K33 A;  1KAA A;  2ICE C;  4TSS A;  1OXX K;  4CJ2 C;  3J81 L;  2GA4 B;  3D4W A;  2DN8 A;  3NQI A;  4RHR A;  1ESR A;  4MIU A;  2A68 D;  3TP7 A;  5M5X B;  2N55 A;  2Q8I B;  1DOK A;  3NWT A;  4XQN A;  4KKT A;  2LMC B;  1GUO A;  3KK7 A;  2CHB D;  3S1Q B;  3I70 A;  1SYF A;  1F9S A;  3PUW A;  1C48 A;  1RD9 D;  2CW0 C;  1LT5 D;  2E2D C;  3NXW A;  4QUC A;  3I8Z A;  1STN A;  3KUP A;  2AQ2 B;  1B44 D;  2E76 C;  1MGS A;  1B9M A;  5FLX L;  2K5W A;  2AQ1 B;  3FMC A;  2B2T A;  5J1Z A;  4PMB A;  1H9S B;  2XVS A;  4C3J B;  3CQZ B;  1VF5 C;  2FJ2 A;  3CRL C;  1F9P A;  1BCP C;  5D3D A;  3A8I E;  4PMC A;  1EYD A;  4YIJ A;  3M4O B;  4DAV A;  4A93 B;  1RTN A;  1A3T A;  1U4M A;  2MHV A;  1QNU A;  1SSO A;  3SXH A;  1IYV A;  3ERQ A;  1O7Y A;  3D6W A;  4H0L C;  1I6H B;  5C4Z A;  2G9H D;  1YNJ D;  2F0M A;  3S17 B;  3K5L A;  3QB3 A;  3NE5 B;  2J0T D;  4CJ1 B;  2RDG A;  1CT1 D;  5KGU A;  3M4Y A;  2F0I A;  2VB2 X;  4TKO B;  3IFD A;  3NUC A;  2B63 B;  3Q24 A;  4PMW A;  1SE2 A;  2NN6 G;  4O42 A;  3Q0A A;  1SND A;  2O4X A;  1UEA B;  3SDZ A;  3BDC A;  5BN3 A;  5ISR A;  3LX0 A;  3KLS A;  4A3K B;  2HCI A;  3A56 A;  1JOR A;  3VYU A;  5IT9 L;  3PIO 3;  3M7N A;  1QNK A;  5JPN C;  3NQT A;  2A69 D;  2B2V C;  3RUZ A;  2RQX A;  1G2S A;  2WKD A;  3PO3 B;  4MHE A;  1B4O A;  5M5W B;  2PW7 A;  5HGT A;  2LY7 A;  1D5Z C;  2FMM A;  4AYB B;  2M9V A;  1EY5 A;  1EY8 A;  5I6Y A;  2KJX A;  3OMC A;  4M8A A;  1JOQ A;  1AZP A;  4BA1 I;  1S5B D;  2EJF C;  1I6V C;  1W6K A;  4NMZ A;  4B9X A;  1D6E C;  3CKI B;  2F3W A;  3HOV B;  4F87 A;  3WOE A;  1TS2 A;  3MTS A;  4RAU C;  4ZK9 B;  5NUC A;  3E0J A;  1LTR D;  1SJH D;  3D4D A;  1FYC A;  4RCO A;  1Y8P B;  4WFN 3;  1I50 B;  5DAU A;  2F1M A;  1SYE A;  4QIW B;  1FGB D;  4ZAI A;  4H7B A;  1DD2 A;  1EIH A;  4RHS A;  4H13 C;  4B9W A;  2D62 A;  1GXD C;  3H09 A;  2D5D A;  1LLR D;  5M3M B;  1ENA A;  1FNW A;  1LT6 D;  1YNN D;  4DXG A;  2JSO A;  2QCP X;  4F88 A;  2X6L A;  2IT1 A;  2R7Z B;  2JA6 B;  3IL8 A;  4QB4 A;  1BOS A;  1PFN A;  3HOU B;  2EXZ A;  1AW7 A;  4HAE A;  3K0Y A;  3GTQ B;  2NBF A;  4CKC A;  4CKE A;  4MN3 A;  1IKM A;  4KN7 C;  3HOW B;  4X3S A;  2IX1 A;  4U67 3;  5E3F A;  4HR7 B;  1SXT A;  2M00 A;  3GD7 A;  2K03 A;  4OL7 A;  3MHB A;  3I91 A;  1CM9 A;  3RMH A;  1SNC A;  2KA7 A;  4C3J G;  1Q1E A;  1R4Q B;  1ZKO A;  1TWA B;  5EPL A;  1STA A;  2NVQ B;  4DGZ A;  1ET9 A;  1A3U A;  5K36 H;  4RA8 A;  1V1O A;  5E4W C;  2IX0 A;  2YU9 B;  1QJO A;  1JWS D;  1QCB D;  5G3L D;  4OGQ C;  4RGT A;  3I73 A;  1CFM A;  1V1P B;  3NHH A;  3U9S A;  3V05 A;  1IKL A;  1ICW A;  1S5F D;  4C1N K;  1SNP A;  1LT3 D;  4B08 A;  3W3A A;  1G29 1;  2FIN B;  1Z47 A;  2F0P A;  3LNN A;  1HTL D;  5CC4 A;  3ERO A;  4C3I B;  1SFO B;  2E2H B;  4HTH A;  2SDF A;  2E2J B;  1PZJ D;  4XXE A;  2PPB C;  4IAL A;  2L5T A;  3QOL A;  1KTK A;  4PV1 C;  4CGY B;  1RKN A;  2PW5 A;  4F7X A;  2NWG A;  2F0E A;  1ET6 A;  3TN2 A;  3ND9 A;  3R2I A;  2B2Y A;  5IOC A;  2D2C C;  2B2U C;  3RLF A;  1JB3 A;  2A6H C;  2DNC A;  1YNJ C;  1STG A;  2R92 B;  1SE3 A;  4BS9 A;  4KTA A;  4M1U B;  1LTB D;  1KDC A;  2WP8 J;  3GTO B;  2BA0 A;  2NN6 H;  2QF7 A;  1GUN A;  3DMU A;  3MXN A;  2HCC A;  2IX3 A;  1RCV D;  2L9H A;  5J39 A;  1STE A;  2EYP A;  1SBB B;  1SE4 A;  1A3V A;  2K28 A;  1F2Y A;  2J4X A;  2NTT A;  4IFD G;  2PNR C;  1BCP B;  1PRT D;  2R6G A;  3DXJ C;  2FMC A;  1I4G A;  4BA2 I;  3J7A V;  3IFT A;  1PTO F;  1PFB A;  5A35 A;  1G6Z A;  3QJY A;  1X3P A;  3EA6 A;  1LTS D;  5BN4 A;  1J8I A;  2AUJ D;  2MPM A;  2EYJ A;  2K05 A;  3OIP A;  5FKA C;  5EPK A;  4ODG A;  4DAP A;  1XXG A;  2ICI A;  4R9W A;  2PMZ B;  3S9W A;  2F0W A;  2SNM A;  3R8B A;  1WTP A;  1RHP A;  1S5D D;  4LJZ C;  4QF4 A;  4EQP A;  2B2U A;  1FNU A;  3QIA A;  1H9S A;  3EVQ A;  3OSO A;  3S15 B;  3S16 B;  2OT2 A;  4HSV A;  1QOH A;  2KQ3 A;  5CR3 A;  5EGT A;  3D3R A;  2X6G A;  4TRD A;  3D31 A;  5KYI A;  5JVG 3;  4L8J A;  1HPC A;  1TVX A;  1TY0 A;  5IGB A;  1KLU D;  5K36 G;  1SNO A;  2EY1 A;  3KBG A;  5A2Q L;  4UDU C;  4K5V A;  2JE6 I;  1V8Q A;  1TS4 A;  3J81 E;  3GV6 A;  2VB3 X;  1TII D;  4XTC S;  2HDM A;  4R8I A;  5C4J B;  4DU9 A;  4A3I B;  4DFA A;  4RGO S;  1YNN C;  4HMI A;  3H91 A;  3M3Y B;  3GTL B;  3TP5 A;  4HN7 A;  2L1B A;  5D3I B;  2XWB B;  1DYQ A;  1PTO H;  1F9R A;  1GHJ A;  3P1H A;  1BXT A;  3SHL A;  4CHT B;  2OEO A;  4DA2 A;  1Q3L A;  1TWC B;  1PFM A;  5EQ0 A;  3SK8 A;  2C5C A;  5C0X J;  2BDN A;  1KNE A;  2WIN B;  4FXG C;  1ILQ A;  4IUR A;  4KHZ A;  4KD4 A;  3CRK C;  4DXF A;  3CU7 A;  4L63 B;  1H9J A;  4LAA A;  4ZQ3 A;  2Q8T A;  4Q0F A;  4K6D A;  3K59 A;  2RA4 A;  4KK7 A;  3MFG A;  3I3C A;  1ZEQ X;  4A3J B;  2EOT A;  4J6H A;  2F0Q A;  2F0K A;  2K5Q A;  4IFD J;  3KLR A;  4X3K A;  3KF8 A;  1AN8 A;  5ELE A;  3VA7 A;  4OIJ A;  4RKB A;  3BZD B;  1PLF A;  4X3U A;  4CBV A;  1LAB A;  5KRU A;  1T5X D;  1TS5 A;  2OXP A;  5JOB A;  4K8I A;  3DUZ A;  1LTT D;  5LL6 S;  3NTK A;  3ZYY X;  3SR1 A;  5JVH 3;  3SVM A;  3DHQ A;  2A5H A;  1WCM B;  3BVG A;  3PUV A;  2M2L A;  1EQV A;  3VYS A;  1EY4 A;  1I4X A;  4G4K A;  3QWN A;  2CW0 D;  2F0D A;  1BCP D;  1STH A;  4EQO A;  4DNT B;  1E0B A;  1EU4 A;  4H44 C;  4J8Q A;  5FO9 B;  1ESF A;  1SYG A;  3A7L A;  2HQE A;  5DEH A;  2F0U A;  3S14 B;  2A6E D;  2TMP A;  3WOF A;  2QDB A;  2VXW A;  3FPP A;  2SEB D;  2LFN A;  2NN6 I;  1PTO D;  2E75 C;  3BS1 A;  3K7A B;  4HMJ A;  4K5X A;  2B8G A;  2Q8R E;  2EYO A;  1F9Q A;  4IUN A;  4KI0 A;  3HEJ A;  2XRQ D;  2Z1C A;  4KY5 A;  5CV4 A;  1PRT F;  4BY7 B;  5D14 A;  4DF7 A;  5I9O A;  1F2Z A;  2K32 A;  4A3B B;  2JXM B;  2XNA C;  1G2T A;  5CYU A;  3TME A;  3MVV A;  4KKS A;  1QB5 D;  1OXT A;  5C5M A;  1HA6 A;  1LO5 D;  4ID6 A;  2B8F A;  2PZW A;  1IHZ A;  1SEB D;  4KN4 C;  2PCF B;  1Y1V B;  1L0Y B;  2A74 C;  3OPO A;  5C5L A;  3URY A;  5KNC A;  4DN4 M;  1B9N A;  4DNR B;  3K5N A;  2SOB A;  3NK9 A;  3KBX A;  5JEA H;  3P75 A;  3NTI A;  3MWY W;  4KHV A;  4FVM A;  5M5Y B;  1MI2 A;  1GUS A;  1NSN S;  5IGC A;  1TWG B;  2HUG A;  3K5O A;  5KNB A;  1MD2 D;  3BDO A;  2R93 B;  1SMY C;  1LV9 A;  3BYT B;  4ZLT F;  2L0C A;  5COY A;  1I4P A;  1BBX C;  5K5P A;  4FP5 D;  5CV6 A;  5FO8 B;  3TP6 A;  2EY6 A;  5EJW A;  1DXM A;  1B1Z A;  3C1F A;  4QUF A;  1LTG D;  2BCO A;  2PO4 A;  1XTC D;  1D5X C;  3TZU A;  4KY7 A;  1IL8 A;  3WDN A;  2F0J A;  1JOO A;  3O13 A;  2HDL A;  5J22 A;  2PQE A;  1BQQ T;  1ONL A;  3A8J E;  4FYD A;  4KJN A;  2WAC A;  1A2T A;  4KD3 A;  4FXK C;  4RKL A;  4DK1 A;  4G7Z C;  1CTM A;  1EYA A;  3GTK B;  4A3M B;  2KEE A;  4Q5V A;  3D8G A;  1EWC A;  1KDA A;  4FF4 A;  1TS3 A;  3NBH A;  3BYY B;  1Y8N B;  4I65 A;  3C2P A;  5D65 A;  3NTH A;  1O78 A;  3S1R B;  3HZX A;  1Q8I A;  2RKS A;  2F4I A;  5JEA G;  4BBS B;  1JWM D;  1HFG A;  5DM6 3;  2CVR A;  3T51 B;  3DEP A;  3GO5 A;  3MZ5 A;  1PZI D;  2JYO A;  1H9K A;  3PO2 B;  5A2Q E;  1HRJ A;  2RDF A;  1BNZ A;  1J9O A;  4ULL A;  1MSH A;  3V2T A;  3QOJ A;  3F2U A;  4C3H B;  1CQF A;  1HA5 A;  2QKI C;  1ROD A;  1DOM A;  5C3X A;  4IN3 A;  3VR6 A;  3PUX A;  1WTQ A;  5CBA E;  1TWF B;  5E4X A;  1EZ8 A;  2JA8 B;  4ZKB B;  5I2X A;  4HCS A;  3S2H B;  4KKU A;  4K6L A;  3U9O A;  1GJX A;  1MBY A;  5G3L F;  5EPJ A;  2NUC A;  3J80 E;  1CI3 M;  3FPU B;  2BE5 C;  1Z6H A;  2B2Y C;  3RZD B;  4RH6 A;  4HED A;  2B39 A;  1Q90 A;  2Z4H A;  4QMG A;  1EY7 A;  5COR A;  2R3Z A;  1BDO A;  3BDL A;  3IKJ A;  4K14 A;  4C2M B;  1EY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...