2IL8A

Three-dimensional structure of interleukin 8 in solution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
71
structure length
71
Chain Sequence
b'AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-8
publication title Three-dimensional structure of interleukin 8 in solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1990-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2il8A00
5E4WC 3FPUB 4DN4M 1VMPA 1ESRA 3F2UA 1DZ1A 1PLFA 4X3KA 1SSOA 1MSHA 1DOMA 4HAEA 2DY7A 1AZQA 2X69A 5D65A 4X3UA 1O7ZA 1HUNA 1X32A 2FINB 3MTSA 1HUMA 3LWEA 4MHEA 2B2TA 5EPKA 2KEDA 1GUWA 1X3PA 5CORA 4X3TA 1RJTA 2RVLA 2B2YA 2K1BA 4NW2A 3KUPA 4UAIA 4RAUC 5EJWA 1TVXA 2MP1A 2B2VA 1MSGA 2RA4A 3TZDA 1J9OA 1EIGA 2FMMA 4ZKCB 1U4MA 1HFNA 2FHTA 1M8AA 3I91A 4RA8A 1BBXC 1AP0A 1RODA 4IUUA 4ZLTF 1WTWA 5EQ0A 1B50A 2B2WC 3R93A 4XT3B 3P7JA 2K05A 5JJZA 1ICWA 1NR4A 1JICA 1NR2A 2N55A 3QO2A 2EE1A 4OIKA 1ILQA 5E4XA 5T1GA 1HFGA 1LV9A 1U4RA 1NCVA 1U4PA 2IL8A 1F9SA 1O7YA 4O42A 4IUVA 1CA5A 1F2LA 1O80A 2KECA 1WVLA 1BNZA 1ILPA 2BDNA 2JYOA 4ZAIA 1DONA 3I90A 1XX8A 2JP1A 1WTVA 3TN2A 4IUTA 4X3SA 4HEDA 2KVMA 2RSOA 2HUGA 4IURA 1EIHA 4XDXA 1CA6A 1JE4A 4HSVA 2EOTA 4CJ2C 5EPJA 1DOKA 3I3CA 1PFNA 1G2SA 2HCIA 2N88A 5DNFA 4QUFA 2RSNA 1HHVA 2L4NA 2MGSA 2L1BA 3D6WA 1DOLA 3I8ZA 5CBEE 3FDTA 2NYZD 2L11A 1KNAA 4ZKBB 3DM1A 1MI2A 4ZK9B 2XIWA 4MN3A 1IKMA 5COYA 2H1EA 2VXWA 2B2UC 1NAPA 1WTQA 3SVMA 4IUQA 5AFWA 1QE6A 3ONAB 1S4ZA 1C8CA 1RTOA 1G91A 2D9UA 3HP3A 1AZPA 1HRJA 1BO0A 1IKLA 3KBXA 1G2TA 2HDLA 1B2TA 1PDQA 2R3ZA 1RHPA 2CVRA 4QUCA 5EPLA 1XYIA 2B2WA 2K03A 5CBAE 1PFMA 1EL0A 1Q3LA 1F9QA 1B53A 1MGSA 4IUPA 1WTRA 4XT1B 2L9HA 1WD0A 2Q8TA 1CM9A 2M2LA 3GV6A 3Q6SA 5CMDA 2KUMA 3IFDA 1BF4A 2EPBA 2HCCA 5T1IA 1X3QA 3G7LA 3DEOA 2SDFA 3MWYW 4U68A 2MJ8A 4RWSC 1WD1A 1EOTA 2FJ2A 4OIJA 2X6LA 3IL8A 2MPMA 5EKIA 1SDFA 1B4OA 1KNEA 2Q8RE 1QG7A 1WTPA 1QNKA 3DEPA 2K04A 1EQTA 2KEEA 4LMQD 5D14A 4CJ0B 1F9PA 2KOLA 1U4LA 3N52A 1WTOA 1SAPA 1G6ZA 2B2TC 1HA6A 3GV3A 3UI2A 3H91A 1F9RA 1E0BA 2B2YC 2J7ZA 2NZ1D 1PFBA 2DY8A 1RTNA 1ZXTA 2FFKB 2K01A 1IL8A 2X6GA 4R9WA 4R8IA 2B2VC 1B3AA 4HCSA 1J8IA 2HDMA 1VMCA 2K28A 2L12A 2NWGA 1ML0D 1WTXA 4CJ1B 2B2UA 1A15A
chains in the Genus database with same CATH superfamily
3J81L 3GTLH 1CTMA 4IQZA 3AQQA 3T1YQ 3I56A 5C4JB 1VQPA 3CMEA 3QWNA 5C3EG 3CW2C 4IOCA 2JA5G 2F0QA 1C4QA 2RDGA 3T4AC 4ZKCB 2FMMA 1SNMA 1ICFB 5IWAQ 2HIXA 1FGBD 2KA7A 5I9OA 1B70B 1H9JA 3SEBA 2CQAA 4G7OC 1S5ED 4DR7L 5C4ZA 2YTXA 5JJIA 2F0TA 2KCTA 3VYTA 4DU9A 5I9PA 1JORA 5IY0A 2Q2TA 2VB2X 3TS0A 3SGIA 3HOXH 3NTHA 3KOJA 2WACA 3WOFA 1X65A 1JWSD 2K33A 5HGTA 4HJ5A 3IRBA 3B6YA 3PCOB 3E6ZX 2VY3A 1O7IA 1EQQA 1HHVA 2WFWA 4ID6A 4A3LG 2SNSA 2C35B 1D6EC 1CSPA 3HOUG 1NAPA 3SVMA 3VDYA 3BZCA 4LWCA 3OMCA 4OXPA 4DNIA 1YZ6A 1WJJA 4ZYSA 5IP7H 1VQIA 3MXGA 2I5LX 5FK9C 3KLSA 4IUPA 1TWHB 1Q1BA 5CV7A 2VW9A 3WDNA 5EAYA 2A6HC 1KLUD 2KENA 3G7LA 3PUZA 4LFCQ 2QCPX 1N8RC 3X3MA 4HCEA 1VQ4A 4XYQA 1CHPD 3A56A 4X64Q 2BOSA 2KOLA 5JAVA 1BUVT 3S1RB 4KD4A 2NZ1D 2J7ZA 2ICEC 4DV5Q 4Z9CB 3BYTB 4NPSA 3JAME 1EZ6A 2K28A 4C3IB 4UP7A 1W2BA 4HJ7A 1JB3A 5JJKA 4C3HB 2B63B 4S3SA 3QJYA 1AW7A 4FYDA 1Q8IA 2JA8B 4JI0Q 1B44D 3S17B 2H5XA 2WB1G 2RF4A 2YV5A 3Q8DA 2A69D 1H9RA 4JI6Q 4K8IA 2DUDA 2E2IB 4LFAL 5E7NA 1D7QA 1ICWA 4IALA 1HNZL 2N55A 3GTKB 5HGQA 1HFGA 2BCOA 4O42A 5F2DA 1NMGA 3RMHA 5IYDH 3ZJYC 1OXSC 5ELFA 4K0KL 3PO3G 4R4QA 2I0QA 5C5MA 4IN3A 4ZUIA 1PFNA 1SNQA 1EYGA 4FF2A 4JV5Q 3KFUA 3QB3A 2AKWB 1DYQA 4N8X1 1DOLA 1IL2A 2ZM6Q 3PIO3 4OX9Q 2Z1CA 4K14A 3GTOH 1VQNA 2O5JC 1S5CD 4OO1I 4POFA 4O1NA 1TWGB 1HXYD 3JAML 5ISRA 2BH8A 3PUVA 1QE6A 3URYA 3HP3A 3KBXA 2IX3A 1G2TA 1K3RA 1XTCD 1PDQA 4AIMA 4DR2L 3OW7A 4DAPA 4A3IG 5IGFA 2XGTA 1CUKA 4FVMA 4YWMA 4DK1A 1SBBB 3W3AA 1KRTA 3AYHB 2DN8A 2OF1A 3W1BA 2Q8TA 2JA6B 2RKSA 3E0JA 5KNCA 4JI3Q 4A76A 3CC4A 1UEBA 3OTOL 2K52A 5GQOA 1YBYA 3NELA 1EOTA 3SHLA 1VQGA 1TKWB 4OONA 2Z6KA 1N9WA 1A0IA 3T1HL 5D14A 2B39A 3HEJA 1WCMH 1W3SA 4JVZA 2UUAL 4JI2L 2F0JA 3UI2A 2XRQD 2IWHA 2UXCQ 2ZXPA 1PFBA 4JI7Q 3SXHA 4HCSA 3D3RA 4JI5Q 1J8IA 2WKCA 1ML0D 2EJMA 2F4VQ 4Q0FA 1JJCB 4B3TL 4NXNQ 1DOMA 2K6AA 2TMPA 3T16A 5M9OA 4PMCA 4C3JB 4J1MA 4A3DG 2XNAC 2LSSA 1XWEA 5EPKA 2N49A 5FKAC 4EQOA 1A2UA 1GUWA 5JEAG 1M90C 1I4QA 2D2CC 2F3WA 2RCFA 1KD1C 1B9MA 1J9OA 2AWNA 1I50B 1U4MA 5C44B 4V190 5LMNQ 1TU2B 1XNRL 4BY7B 1LTTD 3R2IA 1NR4A 5M5YB 2EXDA 4JBKA 2F0EA 3A5ZB 2F3VA 4X62Q 3PO2G 2J0TD 2NVTB 4NXML 4C2MH 1YJWA 4TQUS 1A63A 1LT3D 2RSOA 2HUGA 5CV9A 1XXGA 1SE8A 5KGUA 1DJRD 1DOKA 1YHQA 2F4IA 3CC2A 4KHPQ 3I7FA 4LF9L 3HOZG 5DNFA 2AUKA 2CCZA 2OWOA 1TY2A 1JE5A 2PZUA 1LT4D 1JJ2A 2NBFA 1VQDA 2G9DA 3C1EA 4ZKBB 1WI5A 4XTCS 2E74C 1YJ9A 1NBWA 1STGA 4ME3A 1KLGD 4DR1Q 2EXZA 4CDDC 1JOQA 4IUQA 4FP5D 2UXBQ 2AMCB 1G91A 1RIPA 2F0DA 2JN4A 3J80i 4C2MB 2Z6KC 2K03A 3JC66 5IYCG 3I4LA 3L3OC 1Y8PB 3GTJB 2PW7A 4FXGC 3EFXD 5DM63 3S14H 1GHKA 3QG1A 3U4ZA 2KUMA 2YTVA 1TWAB 5J39A 1BBUA 3FEWX 2BE5C 3U50C 2E2JH 3S24A 1PTOH 1SMXA 4A3GG 2NB0A 3ZYYX 2Q8RE 2Y0SB 1QG7A 2RHQB 4YWLA 1E1TA 3I55A 3N52A 4R1JA 3ULJA 2K4KA 2ZJPA 5JEAJ 1NJIC 1PYWD 3C46A 1F9RA 3BVMA 3R3OA 2AUJD 4KN7C 4R8IA 3HGBA 1GHJA 4A3FG 4CDCC 2NN6H 4KHZA 4DGZA 2B2UA 1EY4A 5C4HA 3GP7A 4P73A 2K5VA 1HPCA 2X69A 2MFIA 2N78A 2VQEL 2FINB 3HOWB 4R4TA 1EZ8A 1FGUA 1KTKA 1W6KA 4HMJA 5C0XG 4KY5A 1BQQT 3U9OA 5I2YA 1XNQQ 1IW7D 2PW5A 3E9HA 5IYDG 1HTLD 1AEXA 3KJOA 2FHTA 2OTJA 2R6GA 3VR4A 2A69C 1XMOL 1FR3A 3M4YA 1ZYRD 3DWAA 1D5XC 4AYBB 3RUZA 3ERQA 3SK4A 3ICEA 3STBD 4LFCL 3TS2A 3HOVH 4R4CA 4B3SL 3M4QA 2ENBA 2YYZA 1DXMA 2OQKA 4X64L 1GJXA 1BNZA 4IZ8A 4ULLA 1DONA 5BN4A 3S1QH 4ABNA 3HKZB 3EA6A 2G5DA 1IYUA 1H95A 1X3GA 3PUXA 4CHTB 3VYUA 3I4NG 2LFNA 1SRUA 4TSSA 1YJNA 2E2HH 3MXNA 4A3KB 3DM1A 1GVPA 4J8QA 4LF6L 2A74C 2VUMH 3SDZA 4P71A 1C48A 2ZTCA 4H7BA 3NTKA 1YEZA 2QDLA 5M5XH 4HJ8A 2NVYH 4IFDI 1IKLA 2HDLA 5CC4A 4JI6L 4A75A 3S1QB 4O0AA 1UUPA 1K83H 5M3MH 2EY5A 1XPOA 4C56C 3MXNB 3K58A 1EY0A 4A3EB 3J7ZC 1YI2A 3Q24A 3GV6A 3Q6SA 4P72A 2A1AA 1VQJA 4CGYB 3DWPA 1FL0A 2FXQA 3HOYH 3I73A 4EQPA 3H94A 1OTCA 5FJ8H 2IX0A 1VQ6A 4JK1C 2F0HA 1KXLA 4JYAL 3MXUA 5D3IB 1VF7A 3DEPA 2GA4B 3TP8A 3D4RA 2Q8IB 3OYYA 5JPMC 1PYBA 3M4OB 2QA4A 5C0XJ 2R7ZG 4G7HC 4R9WA 1ZXTA 2K01A 2ZM6L 1EWHA 4DAYA 2A6HD 4V0BA 1EY8A 2F3IA 3V96A 2CHBD 1PLFA 4LFAQ 4WJ4A 5C4XG 1EEFD 3K81C 3S1MB 2SOBA 3AB9A 3J81i 5C3EB 2UU9L 5CORA 4X3TA 5M3FG 2R92G 2RVLA 4A3JH 2F52A 4UY8C 1VQHA 1TIID 2LY7A 3GTQB 1K0RA 5M5WB 4DAYB 2IHFA 3F2DA 4DV4Q 1G8ZD 4K0KQ 4IUUA 2JXMB 1LT6D 5EQ0A 2WIIB 2JK8A 1VQ9A 5IGBA 3EJIA 3BZKA 4JPBW 3S2HH 4WJ3M 4HIMA 1HQRD 1ENAA 4U673 4YCUA 1TWFH 1MJCA 1XPRA 5K36H 1Q90A 4BY1G 1HZ9A 4IO9A 2CW0D 1Y69U 1IZ6A 3BYYB 4XDXA 2YU9B 4JI7L 5G3LD 4JI5L 1S5BD 4F7XA 1B3QA 5CV8A 4WFN3 4DR2Q 3NEMA 2F4VL 1LTLA 2L4NA 2RBMA 2AQ2B 3NBHA 2NYZD 3HOUB 3QIAA 2IHEA 4MN3A 2A6ED 1IBKL 5A2QE 5JVG3 4G7ZC 4RGOS 3OTOQ 1DCZA 2XTIA 3FKIB 1SFOH 4DK0A 1C0AA 2KHSA 4Y7NB 1D1KA 1BO0A 3GO5A 4DNTB 1HQMC 3P75A 1SR3A 3NXWA 2IPKD 5JJLA 1EWCA 5IOCA 4FXKC 1PH7A 4BBSB 1II3A 3T1HQ 1EU3A 2KQ3A 3LNNA 3NPPA 3NBHB 5JPNC 2EZVA 1HR0W 1QCBD 2UUAQ 5IE8A 2N8NA 2XN9C 3NSWA 2BDOA 5FLXE 3SR1A 2EPBA 4A3CH 2ZXOA 4X62L 2Z6BA 1ET6A 1GUGA 2EYJA 4DAVA 4B3TQ 1LM0A 4DR6Q 1BCPB 1EQTA 4CJ0B 4KHPL 1F9PA 1G6ZA 4OEMB 2Y0SE 3VR6A 3GV3A 1PYSB 1V43A 3CMAA 2KBNA 3A7LA 2Z4HA 4DV6L 4KV6A 4IPHA 2I5HA 1LTGD 1KAWA 4GLXA 3BG3A 4DR1L 5C4JH 2DY7A 2UXBL 4RH6A 4HSPA 3H0GG 1JCKB 5EBCA 2WB1B 3TZUA 5KIXA 2Z4IA 2CH4W 2B2YA 2OT2A 3PQIA 1YNJD 2RCNA 5A2QL 4NXMQ 2LS01 3O13A 4QY7A 1M8AA 3VR5A 1HCZA 3L7ZC 3CPFA 3J7AV 2BA0A 4XT3B 3AFQA 4L5SA 3OHXC 1KIXA 1ZYRC 4LF9Q 5CV6A 4LJZC 2EY2A 3STBC 4KKUA 2Q2IA 3ERSX 4AYBE 1QWYA 3K5OA 3F2CA 1F9SA 4DV3Q 1WVLA 3EIVA 1ILPA 1O7LA 1WTHA 2EIFA 5FLXL 1N33L 4XQQA 1CSQA 4DV1L 1EEID 2ZT9C 4JBMA 4KMUC 2KHIA 2GN5A 3V05A 1AH9A 3KJPA 4I7AA 5M3MG 3ITPA 3D6WA 4HMIA 3FPPA 1BCPC 2ZJQA 3RLOA 1MI2A 3A74A 4A3BB 1FNVA 1XNQL 5AFWA 3G71A 2JA7H 3CRLC 5FJ8G 2H4OA 3Q22A 3JAMi 5I6YA 2OCEA 4JBJA 1Q3LA 1TWHH 4YCVA 4K5WA 2L9HA 4PNYA 1PHJA 3SK5A 1EU4A 5ELDA 1Q81C 3PF5A 1VQOA 3CCUA 4RWSC 3EN2A 4TVAB 4GN5A 3K5MA 3S1NB 3P1HA 1PFSA 2B3GA 3DMUA 2P5ZX 4CKEA 2QEXA 2VQEQ 4PZ8A 5BN5A 2JA7B 3S1RH 4B3ML 2F0OA 1I4HA 1MIUA 3E0EA 1K73C 4WRDA 3D31A 2B2YC 1ENFA 1J6QA 1HA5A 2F0MA 3N6RA 3MFYA 2EYPA 3BDCA 4C3IH 4R4IA 1HNWQ 4KHVA 2BE5D 3CF5A 2K50A 3DLLA 1XMOQ 3FPUB 4DN4M 1VMPA 2UUCL 2E76C 1K3BC 4C3HH 3L2PA 3UDIA 3VYRA 4HJ9A 4A3DB 2B63H 1AZQA 4UP8A 4OELB 3LWEA 1EYDA 2B2TA 1SN8A 1VQLA 2JA8H 3S17H 3SK6A 3TP7A 4B3SQ 4BBRG 1MSGA 1HFNA 1Y14B 1CKNB 3LGJA 1PA6A 2E2IH 4GKKQ 4NKLA 2B2WC 1B50A 3V2TA 1VQ8A 3GTKH 2PNHA 3NQTA 4NB3A 1JICA 1NR2A 4QJFA 3PO2B 3A55A 1LACA 1Y1VG 3NE5B 1OXXK 3MZ5A 3S2DB 4LF6Q 3CP0A 1AE2A 4KKTA 2F0IA 2R7DA 2ZTDA 3CCSA 3HOZB 2NTTA 1IYVA 2CW0C 1LABA 1RD9D 3EQLC 3AFPA 5I4DA 1V1QA 1LO5D 4CDEC 1EY9A 1VQ5A 2EY1A 1TWGH 4LNQA 4A3CG 1S72A 2A6EC 1WTQA 3CHBD 2KCMA 4KK7A 3DM3A 1KC8C 3S16B 2LXJA 1B2TA 1KDAA 4DV4L 2PYKA 4QUCA 1XYIA 3HKSA 4IJHA 1E2ZA 1ASZA 4JYAQ 3KF8A 1L2FA 1Q1EA 1EL0A 2N3SA 1SYDA 3D4DA 3KYHC 4L5TA 2JA6H 3J7YW 4XT1B 1VQAA 2ZXRA 1P8LA 1A62A 3PUWA 4UHVA 1GM5A 4BXXG 3OWFA 5AJ3L 2DNCA 4WORA 4GN4B 2SDFA 4A3GB 1S5FD 2MO1A 3S9WA 2MPMA 3CQZB 3KF8B 3C1FA 1Q46A 1WTPA 2KEEA 4NP5A 3T56B 4HR7B 1UWVA 1IHZA 4A3MG 1WTOA 2UU9Q 2B2TC 4KJNA 4M8AA 1BCPF 1PMRA 1RTNA 4A3FB 4K5VA 1IL8A 1B3AA 2NWGA 3H6MA 4CJ1B 4A93G 1UEAB 1LTSD 3F2UA 1ASYA 4C3JH 4YWKA 4QQBX 1FNUA 5KNBA 4KKSA 5LMNW 1JOOA 1D2BA 2KEDA 3OW2A 1V8QA 1HNXQ 1CT1D 4RAUC 4DA2A 1I50H 4MTKA 4EGVA 2WB1E 5C44H 4NDXA 5HY6A 1TS3A 1BBXC 1YNJC 2SEBD 2KCNA 3BDLA 4BY7H 3DUZA 5M5YH 1TY0A 1OXUA 4ZCKA 1I6HB 4DV7Q 1LTID 2D0PA 4ILWA 3CCVA 1TS2A 2B8GA 4DR6L 3I4OA 2NVTH 1MHWC 1V1PA 3ER0A 5IGCA 2G9HD 2F0KA 5FO9B 1CHQD 1IBKQ 3FMCA 3HOXG 4GOPA 1JE4A 4KLKA 2EY6A 1GUTA 2F0LA 2HQEA 3QOLA 3I4NB 1TS5A 1CZWA 2B29A 3M9BA 2CFMA 4DXGA 2MQHA 1V1PB 4ME5A 3X3NA 4HIOA 2VXWA 2F0SA 1IBLQ 2WAQG 1LTRD 4GOPB 3AU7A 1S4ZA 1X3EA 5IT9c 1D1IA 4IJLA 4RGMA 2CVRA 4GN3B 3GTJH 5HURA 2DJFC 3AMUA 1L0YB 1MBYA 2AWOA 1F9QA 5ELOA 3QOJA 4JW0A 5C3WA 1TWAH 1WD0A 5IP7G 1KABA 2MO0A 4OWWB 1A3UA 2LXKA 1S5DD 1X3QA 4DV6Q 4DV3L 2HT1A 3DEOA 1E24A 1LTAD 1E7ZA 5IP9H 1DGSA 3IL8A 4LAAA 4GS3A 2AQ1B 1SDFA 2B63G 5G3LF 5I6WA 4X66Q 4KY6A 1SNCA 2C5CA 4KY7A 4KN4C 5C0XI 3TP5A 4HIKA 3IFTA 2R7ZB 4B08A 4BWGB 2BA1A 1C7YA 1EQVA 1PH5A 2I5MX 4RHSA 4DKAC 2JQOA 2HDMA 2L12A 4P74A 2FMCA 5NUCA 3A54A 1P16A 4IPCA 5C4XB 1WOCA 4BA1I 1H9SA 3RZOB 5IT9E 3HOWH 1SYFA 2CWPA 2R92B 3I72A 4XYOA 4HIDA 1SROA 1VDZA 2UUBQ 4X65L 2ZTEA 2PO4A 1N33Q 4RA8A 3I91A 3CPWA 1AP0A 1RF2D 4DV1Q 3NP8A 3A0JA 2F0WA 4GOPC 1H9SB 3J80c 1DM0B 4EVOA 1S40A 2F0FA 3K8AA 4DXFA 5JJZA 2A5HA 3K7UC 1L0XB 1H9KA 1XJVA 2NVQH 5EKLA 5CV5A 2BH2A 1CFMA 2A73B 4BY1B 2NVXB 3KBGA 1SYGA 4P75A 3CCLA 1KHIA 1IXRA 4L8JA 1CA6A 4KI0A 4HSVA 3H3VC 1HH2P 1HNWL 1Q8KA 3RNUA 3WOEA 2EQSA 1BBWA 4A3KH 1R4PB 3MXPA 1QVGA 1ET9A 4MTNA 3M7GA 1RL2A 1KDBA 1BOSA 5FO7B 2NVQB 3H3VI 1YNNC 4AH6A 1A8VA 4PZ7A 4LF4L 4GKKL 2VQFL 3VA5A 4IPDA 3A8IE 5IT9L 4A3EH 1MGSA 1SXTA 4DUYQ 3KLRA 1WTRA 4B3MQ 1BCPD 5ELCA 2R93B 2JEAI 4MIUA 3D8GA 1HTPA 3GTGB 4B3RQ 1LYLA 2JEBI 4YY3Q 1T9HA 4C3JG 3PIPA 2UUCQ 2E5LL 4TRDA 2E75C 3MEHA 3OIQA 3Q23A 3M4OH 4QIWB 4M1UB 4JI8Q 2FFKB 3CXCA 3CCQA 4APVA 1WCMG 1SNDA 2Z8LA 5DAUA 3NQIA 5L37A 3I4MB 4LUZA 3RR5A 1TWCB 3H0GB 3S1MH 1MSHA 1ENCA 2XVSA 5C3EH 3G48A 2JE6I 4RKLA 1X32A 4MHEA 3BZDB 1QZHA 5E3FA 1F2ZA 3GTQH 4DK6C 5M5WH 2QW7A 3K7AB 1Z7TA 2PZTA 4EQ5A 1K8AC 1S3OA 3R2TA 5EGTA 1N34L 1Y1WB 1EWIA 5GROA 4PMWA 3CKIB 3P7JA 2A68D 3NTIA 5IIFA 4GLVB 2MHVA 1E1OA 3GTMH 1B1ZA 1C9OA 1LV9A 1O7YA 1PH3A 1F2LA 5EKKA 3D4WA 2BDNA 2JA5B 2PNRC 3GD7A 3TN2A 4HEDA 1I4XA 2YU9H 1EIHA 1JWUD 1KDCA 4CJ2C 1CI3M 1IBML 1EFID 4CBVA 4KJOA 4RGNA 4OWTB 4A3LH 1TS4A 1MD2D 1JOKA 4HJAA 4DV0Q 1YHAA 4JI4L 3HOUH 2DNEA 3I8ZA 3OPOA 4K5XA 1M1KC 2QEJC 3MC0B 3RN5A 4G57A 1QB5D 4NMZA 4F87A 3FKIH 3GTMB 5AJ3Q 2M00A 4Y7NH 1HNXL 3MHBA 4DF7A 2HD3A 4LF5Q 4PG3A 2QILA 3CC7A 1FJGL 2Y0SG 4BBSH 4PQXA 1R9TH 2PPBC 1K0SA 3J81c 4LF7L 1SE2A 1B53A 1HZBA 4DV7L 1A3TA 3ULLA 5CMDA 1BF4A 3M3YB 2YTYA 4EX5A 2MJ8A 3GDEA 3K59A 1ESFA 1VQMA 2X6LA 1MJEA 1BDOA 1X3FA 1X9NA 1N32L 2KHJA 3ND9A 4BS9A 4YHHL 1A3VA 1QNKA 3HOWG 4GKJQ 4C1NI 1TR5A 1HA6A 4YIJA 3H91A 3M4PA 1F77A 1R9TB 1I3QB 1EOVA 1PZJD 3UDGA 4GNXA 1N36Q 1PRTC 2LMCB 1U4RA 1SMYD 1A15A 2F0GA 4ZUJA 4AYBG 1IBLL 2XRSD 1E22A 2ICIA 3TDQA 1Y8NB 1YHBA 2NN6G 1UE6A 2EYHA 5C5LA 2E8GA 4BBRB 2RDHA 1GUNA 3VR3A 3KUPA 4IOAA 1QILA 1Z47A 2MP1A 3RZDB 1T5XD 1STAA 4J15A 3LWUA 2DGYA 4GNXB 1SJHD 2R7FA 4N9PA 4X6AH 3R93A 3H09A 4L6TB 1JJGA 1NTGA 3QO2A 1X6OA 4OIKA 1Y1VB 2IJ0A 4XXEA 2IL8A 4X66L 3HOVG 1O80A 4WJWA 1WTVA 1Q86C 5FO8B 4FF3A 1VF5C 5J3BA 1UNSA 1SYCA 3HS0C 5EPJA 3M7NA 1G51A 2WV6D 1GXDC 1GUSA 3EVQA 4DFAA 5KRUA 3KDFB 2OTLA 5I2XA 3TRZA 2JSOA 5DEHA 4A3BH 1PH4A 5COYA 3MVVA 1HZAA 5LL6X 1VQKA 2ZJRA 2F03A 4C1NK 3G6JB 3ONAB 1I94Q 2UUBL 4CDFC 4B9WA 4A3IH 2CKZB 4JCVE 4UPAA 3RD4A 1PTOF 2VUMG 3PO3B 2AQ3B 2CH4A 1VQ7A 2B2WA 2VZAA 4K2KA 3BDOA 5FOBB 1YITA 3HKZE 1KRSA 3TREA 2PI2A 4P2CB 4GNXC 3S1NH 4RHRA 4A4IA 3S15B 4JOIC 1RDPD 3VYSA 3HOYG 2K5NA 5IODA 2D62A 5CV4A 4A3MB 2A19A 4A3IB 4JBWA 1DD2A 5D3DA 4F88A 1L1OA 1E0BA 2PQAA 4QIWE 1X56A 3MA2B 2X6GA 4X65Q 4FF1A 4A93B 4OO1H 4I65A 4OHJA 5CR3A 1RCVD 5E1FA 2QGQA 4A3DH 2HHHQ 1DZ1A 2O4XA 3GTLB 5JEAH 2F0UA 1CZGA 1STNA 3UE1A 4Q5VA 3HFZB 5DM73 3PGZA 1L1OB 5GAEC 1AE3A 5GAGC 2PQAB 4NW2A 4DR4Q 3FP9A 3PIP3 1UAPA 1EQRA 1JB7A 3OOCA 4DUYL 1G6PA 4A3JG 2OEOA 5LMUQ 4DK3C 1STBA 3JAMc 1IYJB 2A68C 3PO2H 4B3RL 1CKNA 4YY3L 1K8OA 2O2LD 2VS1A 1U4PA 4K6DA 4IUVA 3CAMA 3S2DH 2A8VA 5DLQE 4KD3A 3FKIG 3W5OA 4ZAIA 3I90A 1XX8A 4QMGA 3HOXB 3U4VA 3HOZH 5K36G 1F2MA 4UDUC 4JI8L 1PRTF 3LX0A 3I3CA 2ATWA 1SYBA 5A35A 5LL6S 4QGUA 4BBSG 1EFWA 2K75A 1GOZA 1JR0D 1ZEQX 4LF4Q 1BKBA 2VQFQ 2F0NA 1K28A 1PH1A 2WAQB 1A2TA 1YVCA 3C2PA 3MEFA 4DV2L 5LHY1 2F0PA 4LUOA 1D5ZC 3CD6A 5IYCH 3S16H 4LFBQ 3UDFA 1SEBD 3E9IA 2E5LQ 2E2DC 5GAHC 4H13C 1PH6A 5EBDA 4R8NA 2Z9HA 4RG1A 1LT5D 1CM9A 3F2BA 1V9PA 1L1OC 1I6VC 1SNPA 4A3GH 2EDGA 2TSSA 1KL9A 1WD1A 2PMZB 1QOHA 4TKOB 3CQZH 5KEEA 4OIJA 3GTPH 1QNUA 1B9NA 2L5TA 4L5QA 1O78A 1YNND 1L0WA 4L63B 3KK7A 4DV0L 4A3FH 3T53B 4GZYC 3K57A 1Z9FA 3PV0A 2OXPA 4ODGA 5C3XA 2IX1A 1N34Q 1VMCA 2UXDL 1QJOA 1I4PA 3NENA 4B9XA 3HZXA 3HG9A 1SMYC 1NNXA 4X3KA 3BVZA 4QCLA 1SSOA 1HJPA 5BN3A 4LF5L 5C0XH 2ASBA 5D65A 2MUYA 1HUMA 2K5DA 1B8AA 1X3PA 3EBEA 3GTPB 4UAIA 1LUZA 3FRPB 3NWTA 4JC0A 1TVXA 3K6OA 2RA4A 3CCRA 2C9OA 3RN2A 4LF8L 4DR5L 4H02A 1SLJA 1JT8A 4ZLTF 4HTHA 1J5EL 1Q7YC 1E2WA 1EY7A 1PZKD 1IBMQ 1I6HH 2R61A 2K05A 1MKHA 1PH9A 2Z0SA 4XQNA 4DUZQ 4JI4Q 1SJED 2WP8J 4A3BG 4GKJL 1CA5A 1M4VA 1EIFA 2QDBA 2J4XA 1I4RA 4PV1C 2KVMA 4LW1A 3IAYA 3C3LA 1VQCA 1H9MA 5FLMH 2EJGC 3PMFA 4RFBA 1FJGQ 3I4NH 2RDFA 1N36L 1EY5A 1F2YA 1PTOD 2RSNA 5IYBH 2V1CC 4AQYL 4LF7Q 5JVH3 2HIVA 3PF4A 1KNAA 2L15A 3GTOB 1SE3A 3E3XA 3TQYA 3PSIA 4CKBA 2EYMA 4H0LC 1OO9B 1AZPA 1XMQL 2JA7G 1N32Q 4DR3L 1VCIA 4YHHQ 5CBAE 1GUOA 4K2LA 1K9MC 4E6IA 2L0CA 3T13A 3TP6A 4RGTA 2M2LA 3U58A 3G6EA 5KYLA 4DNRB 3L0OA 3H3VH 2XSCA 4OO1G 2NTSA 1ONLA 1X54A 1JQYD 3KF6A 4ZRZA 1KNEA 4FF4A 3A7AB 4J6HA 4N9TA 4LMQD 3GQBA 2R7ZH 3PUYA 4G4KA 1CK1A 3OWEB 1EYCA 3D6CA 5H1SE 1WCMB 4O2DA 3OMGA 1U9RA 2QF7A 5K5PA 3UDXA 2PI2E 5C4XH 1VQEA 3KF6B 1ESRA 4C3IG 3RZOH 2XWJB 5M3FH 3CRKC 3NK9A 5ELEA 2GVBA 1I94L 1HR0L 2R92H 4IFDH 1O7ZA 4C3HG 1CKMA 3BS1A 5GADC 2XWBB 2K1BA 3K5LA 1Y8OB 5KNDA 3AEVA 1PZID 1FYCA 2JA8G 1EIGA 2SNMA 1D5MC 1EUJA 4LUVA 2RHSB 5JOBA 3A8JE 4QL5A 1FNWA 3FHWA 1WTWA 4JI1Q 2VB3X 4OGQC 1TT2A 3T1YL 1V1OA 1PH8A 3A5UA 1PRTD 3CU7A 1STHA 2K7VA 3CCJA 3OSOA 4RKBA 3K5NA 5BR8Q 4RCOA 1NCVA 2NVXH 4BY1H 5IGGA 3R8BA 4MZ9A 5M3FB 2JYOA 2MNAA 5IWAL 1WFQA 2JP1A 1U0LA 1STYA 4F8MA 3KLSX 3Q0AA 1LLRD 2N88A 5KYIA 3KLWA 2HHHL 4DPGA 5CBEE 4QF4A 1T5EA 2XIWA 1IKMA 1PH2A 1OXVA 1FVIA 3TSSA 4RMFA 2Q2HA 4DR4L 1BR9A 1AN8A 2WAQE 2D9UA 5J22A 1EYAA 2AHOB 5LMUL 1A6XA 1D8LA 1Z6HA 1R4QB 5C6AA 1QUQA 2R93H 3HRZC 3S14B 2VNUD 1XPUA 1NSNS 2HCCA 5T1IA 2JA6G 3GTGH 4Y52H 4KTAA 3FVQA 2K14A 3BJUA 1JWMD 3BU2A 1WYDA 4N8FA 4DR7Q 2IW3A 4OL7A 2FJ2A 3K80C 2E2JB 3W1GA 3F8TA 1PTOB 2PMZE 4ALPA 4JG2A 2JJQA 2NZHA 2PCFB 1QUQB 1EIYB 2D5DA 4IUNA 3J80E 3I4MH 3UE0A 1WTXA 1TWCH 1K8GA 3H0GH 1SYEA 5E4WC 3H15A 3IKJA 4LFBL 1KAAA 1VS0A 3DWQA 2DJGC 1RJTA 3K7AH 4K8JA 5J1ZA 1B7YB 3TBIB 4DV5L 3TZDA 1Y1WH 4HN7A 5FLMG 2NUCA 5C44G 1RKNA 3J7AF 1SNOA 3I70A 1W6JA 3ND8A 5IYBG 4BY7G 1ILQA 1KQSA 1JC7A 1TXYA 3HOVB 1SE4A 4JI0L 1VQBA 4POGA 2JA5H 2HQLA 3J7A5 1I5FA 2VL6A 2I07B 4IUTA 4X3SA 4DV2Q 4IURA 2K32A 4R4OA 4ZQ3A 2EOTA 2KCCA 2PQEA 2HCIA 4K6LA 4QUFA 4XIGS 1PTOC 2EJFC 4L5RC 2MGSA 2L1BA 4IPGA 1JMCA 1QVCA 1GD7A 3FDTA 2O5IC 2L11A 1X55A 3RLFA 2E2HB 2OQ0A 4ZK9B 1E2VA 1TQOA 1Q82C 2H1EA 1LTBD 2B2UC 4MNOA 3J80L 2VUMB 1GO3E 3DHQA 5M5XB 2RQXA 1PRTB 4JV5L 1RHPA 2NVYB 4FDBA 1PFMA 3T51B 2KJXA 1QZGA 4OX9L 1K83B 5M3MB 2GVAA 4DUZL 2CQOA 3E5SA 3IFDA 2IT1A 3M3YH 1NMFA 4U68A 5ELBA 1ZKOA 3HOYB 2UXDQ 1HNZQ 2NN6I 2EYOA 4IFDG 2K04A 5IP9G 3D0FA 1U4LA 3F1ZA 3DXJC 1I3QH 1BVSA 1OXTA 2D0OA 2K5HA 2DY8A 1I4GA 4JI3L 3NWSA 3VR2A 2F1MA 4OWXB 1XTDA 4RCNA 4LF8Q 2I46A 2JA9A 2K5QA 3BVGA 5CYUA 4DR5Q 5ELNA 5FLXc 1CQVA 1J5EQ 2ID0A 4HAEA 1NE3A 2QKIC 4BBRH 4X3UA 1U5KA 1HUNA 3MTSA 2B8FA 4PZ6A 3RZDH 2UXCL 5EJWA 3WWVA 1CQFA 3P20A 2B2VA 4A3JB 2Q2UA 2M9VA 1K8MA 4DAMA 3MFGA 3QR8A 2NZOA 2F0VA 1G291 1RODA 1Q12A 4I7ZC 3PIOA 3NUCA 4FNFA 3A8KE 4NXNL 1NY4A 3NBIA 4JOIA 1Y1VH 1AFPA 2IY5B 1HZCA 5E4XA 2EE1A 5T1GA 3S2HB 4LK1C 3U9SA 4AQYQ 1TWFB 1PV4A 2KECA 2K5WA 1VQFA 5TSSA 1EY6A 2WKDA 3J81E 2L55A 3HKZG 5LMNL 1XMQQ 4FO2A 1G2SA 1FD7D 3VA7A 2WINB 4JI2Q 3ULPA 4DR3Q 3G4SA 5CGKA 1PXUA 1YNXA 3K0XA 2R93G 1E3PA 3OIPA 3W2DA 4PMBA 4A3KG 4CKCA 4EQNA 1CKOA 3K0YA 1NUCA 3KDFA 1C8CA 1RTOA 3PO3H 1HRJA 1SFOB 3CCMA 1GKHA 3SE0A 3L9AX 2R3ZA 5EPLA 2CWAA 3I2ZA 3RLNA 4FXDA 2PZWA 2EYLA 2ES2A 1PVOA 4JI1L 4IFDJ 4UP9A 3J81j 1QVFA 4BXXH 2EVBA 5BR8L 4A3EG 3I4MG 3TMEA 5IGDA 3S15H 3EROA 1XNRQ 3MWYW 3NHHA 3MAQA 1BXTA 1UE1A 4BA2I 1UE5A 1UE7A 2ALYB 2EYFA 5EKIA 5IGEA 4QB4A 1B4OA 4A3MH 1HR0Q 3SK8A 2LKVA 1IW7C 4XQJA 1SAPA 1STEA 3CCEA 3M85A 4YCWA 2V4DA 4H44C 1Y1WG 4A93H 2B2VC 3TEHB 1YIJA 4GLAC
chains in the Genus database with same CATH topology
3J81L 1CTMA 4IQZA 5C4JB 3QWNA 2F0QA 1C4QA 2RDGA 3T4AC 4ZKCB 2FMMA 1SNMA 1FGBD 2KA7A 5I9OA 1H9JA 3SEBA 2CQAA 4G7OC 1S5ED 5C4ZA 2F0TA 3VYTA 4DU9A 5I9PA 1JORA 2VB2X 3NTHA 2WACA 3WOFA 1JWSD 2K33A 5HGTA 3E6ZX 1HHVA 4ID6A 2SNSA 1D6EC 1NAPA 3SVMA 3OMCA 4ZYSA 3MXGA 5FK9C 3KLSA 4IUPA 1TWHB 1Q1BA 5CV7A 3WDNA 2A6HC 1KLUD 3G7LA 3PUZA 2QCPX 3X3MA 4HCEA 4XYQA 1CHPD 3A56A 2BOSA 2KOLA 5JAVA 1BUVT 3S1RB 4KD4A 2NZ1D 2J7ZA 2ICEC 4Z9CB 3BYTB 3JAME 1EZ6A 2K28A 4C3IB 1JB3A 4C3HB 2B63B 4S3SA 3QJYA 1AW7A 4FYDA 1Q8IA 2JA8B 3S17B 1B44D 2A69D 1H9RA 4K8IA 2E2IB 1ICWA 4IALA 2N55A 3GTKB 1HFGA 2BCOA 4O42A 5F2DA 3RMHA 1OXSC 5ELFA 5C5MA 4IN3A 4ZUIA 1PFNA 1SNQA 4FF2A 3QB3A 1DYQA 1DOLA 3PIO3 2Z1CA 4K14A 2O5JC 1S5CD 4OO1I 4O1NA 1TWGB 1HXYD 3JAML 5ISRA 3PUVA 1QE6A 3URYA 3HP3A 3KBXA 2IX3A 1G2TA 1XTCD 1PDQA 3OW7A 4DAPA 5IGFA 4FVMA 4DK1A 1SBBB 3W3AA 2DN8A 2OF1A 2Q8TA 2JA6B 2RKSA 3E0JA 5KNCA 1EOTA 3SHLA 1TKWB 5D14A 2B39A 3HEJA 2F0JA 3UI2A 2XRQD 2IWHA 2ZXPA 1PFBA 3SXHA 4HCSA 3D3RA 1J8IA 2WKCA 1ML0D 2EJMA 4Q0FA 1DOMA 2K6AA 2TMPA 3T16A 5M9OA 4PMCA 4C3JB 4J1MA 2XNAC 1XWEA 5EPKA 5FKAC 4EQOA 1A2UA 1GUWA 5JEAG 1I4QA 2D2CC 2F3WA 1B9MA 1J9OA 2AWNA 1I50B 1U4MA 5C44B 4V190 1TU2B 4BY7B 1LTTD 3R2IA 1NR4A 5M5YB 2F0EA 2F3VA 2J0TD 2NVTB 4TQUS 1LT3D 2RSOA 2HUGA 5CV9A 1XXGA 5KGUA 1DJRD 1DOKA 2F4IA 5DNFA 2AUKA 1TY2A 2PZUA 1LT4D 2NBFA 2G9DA 3C1EA 4ZKBB 4XTCS 2E74C 1STGA 1KLGD 2EXZA 1JOQA 4IUQA 4FP5D 1G91A 2F0DA 4C2MB 2K03A 3I4LA 3L3OC 1Y8PB 3GTJB 2PW7A 4FXGC 3EFXD 5DM63 1GHKA 3QG1A 2KUMA 1TWAB 5J39A 3FEWX 2BE5C 1PTOH 2NB0A 3ZYYX 2Q8RE 2Y0SB 1QG7A 3N52A 5JEAJ 3C46A 1PYWD 1F9RA 3BVMA 3R3OA 2AUJD 4KN7C 4R8IA 3HGBA 1GHJA 2NN6H 4KHZA 4DGZA 2B2UA 1EY4A 5C4HA 3GP7A 1HPCA 2X69A 2FINB 3HOWB 1EZ8A 1KTKA 1W6KA 4HMJA 5C0XG 4KY5A 1BQQT 3U9OA 5I2YA 1IW7D 2PW5A 1HTLD 1AEXA 2FHTA 2R6GA 3VR4A 2A69C 1FR3A 3M4YA 1ZYRD 3DWAA 1D5XC 4AYBB 3RUZA 3ERQA 3SK4A 2ENBA 2YYZA 1DXMA 1GJXA 1BNZA 4IZ8A 4ULLA 1DONA 5BN4A 4ABNA 3HKZB 3EA6A 1IYUA 3PUXA 4CHTB 3VYUA 2LFNA 4TSSA 3MXNA 4A3KB 3DM1A 4J8QA 2A74C 3SDZA 1C48A 4H7BA 3NTKA 4IFDI 1IKLA 2HDLA 5CC4A 3S1QB 1UUPA 2EY5A 4C56C 3K58A 1EY0A 4A3EB 3Q24A 3GV6A 3Q6SA 4CGYB 3DWPA 3I73A 4EQPA 3H94A 2IX0A 4JK1C 2F0HA 3MXUA 5D3IB 1VF7A 3DEPA 2GA4B 3TP8A 3D4RA 2Q8IB 5JPMC 3M4OB 5C0XJ 4G7HC 4R9WA 1ZXTA 2K01A 1EWHA 4DAYA 2A6HD 4V0BA 1EY8A 3V96A 2CHBD 1PLFA 1EEFD 3S1MB 2SOBA 3AB9A 5C3EB 5CORA 4X3TA 2RVLA 2LY7A 1TIID 3GTQB 5M5WB 1G8ZD 4IUUA 2JXMB 1LT6D 5EQ0A 2WIIB 5IGBA 3EJIA 1HQRD 1ENAA 4U673 5K36H 1Q90A 2CW0D 1Y69U 3BYYB 4XDXA 2YU9B 5G3LD 1S5BD 4F7XA 5CV8A 4WFN3 2L4NA 2RBMA 2AQ2B 3NBHA 2NYZD 3HOUB 3QIAA 4MN3A 2A6ED 5A2QE 5JVG3 4G7ZC 4RGOS 1DCZA 3FKIB 4DK0A 2KHSA 4Y7NB 1D1KA 1BO0A 3GO5A 4DNTB 1HQMC 3P75A 3NXWA 2IPKD 1EWCA 5IOCA 4FXKC 4BBSB 1II3A 1EU3A 2KQ3A 3LNNA 3NPPA 5JPNC 2EZVA 1QCBD 2XN9C 3NSWA 2BDOA 5FLXE 3SR1A 2EPBA 2ZXOA 1ET6A 1GUGA 2EYJA 4DAVA 1BCPB 1EQTA 4CJ0B 1F9PA 1G6ZA 3VR6A 3GV3A 1V43A 3A7LA 2Z4HA 4KV6A 1LTGD 3BG3A 2DY7A 4RH6A 4HSPA 1JCKB 5EBCA 2WB1B 3TZUA 5KIXA 2Z4IA 2B2YA 2OT2A 1YNJD 5A2QL 2LS01 3O13A 3VR5A 1M8AA 1HCZA 3L7ZC 3J7AV 2BA0A 4XT3B 3OHXC 1ZYRC 5CV6A 4LJZC 2EY2A 4KKUA 1QWYA 3K5OA 1F9SA 1WVLA 1ILPA 1O7LA 5FLXL 4XQQA 1EEID 2ZT9C 4KMUC 3V05A 3ITPA 3D6WA 4HMIA 3FPPA 1BCPC 1MI2A 4A3BB 1FNVA 5AFWA 3CRLC 2H4OA 3Q22A 5I6YA 1Q3LA 4K5WA 2L9HA 4PNYA 3SK5A 1EU4A 5ELDA 4RWSC 3S1NB 3K5MA 3P1HA 3DMUA 4CKEA 5BN5A 2JA7B 2F0OA 1I4HA 4WRDA 3D31A 2B2YC 1ENFA 1HA5A 2F0MA 3N6RA 3MFYA 2EYPA 3BDCA 4KHVA 2BE5D 3FPUB 4DN4M 1VMPA 2E76C 4A3DB 3VYRA 1AZQA 3LWEA 1EYDA 2B2TA 3SK6A 3TP7A 1MSGA 1HFNA 4NKLA 2B2WC 1B50A 3V2TA 3NQTA 1JICA 1NR2A 3PO2B 3A55A 1LACA 3NE5B 1OXXK 3MZ5A 3S2DB 4KKTA 2F0IA 3HOZB 2NTTA 1IYVA 2CW0C 1LABA 1RD9D 3EQLC 5I4DA 1LO5D 1EY9A 2EY1A 2A6EC 1WTQA 3CHBD 4KK7A 3S16B 1B2TA 1KDAA 2PYKA 4QUCA 1XYIA 1E2ZA 3KF8A 1EL0A 1Q1EA 1SYDA 3D4DA 3J7YW 4XT1B 2ZXRA 3PUWA 3OWFA 2DNCA 4WORA 2SDFA 4A3GB 1S5FD 3S9WA 2MPMA 3CQZB 3C1FA 1WTPA 2KEEA 4NP5A 3T56B 4HR7B 1IHZA 1WTOA 2B2TC 4KJNA 4M8AA 1BCPF 1PMRA 1RTNA 4A3FB 4K5VA 1IL8A 1B3AA 2NWGA 3H6MA 4CJ1B 1UEAB 1LTSD 3F2UA 1FNUA 5KNBA 4KKSA 1JOOA 1D2BA 2KEDA 1V8QA 1CT1D 4RAUC 4DA2A 4EGVA 4NDXA 1TS3A 1BBXC 1YNJC 2SEBD 2KCNA 3BDLA 3DUZA 1TY0A 1OXUA 1I6HB 1LTID 4ILWA 1TS2A 2B8GA 1V1PA 5IGCA 2G9HD 2F0KA 5FO9B 1CHQD 3FMCA 1JE4A 2EY6A 1GUTA 2F0LA 2HQEA 3QOLA 3I4NB 1TS5A 1CZWA 4DXGA 1V1PB 4ME5A 3X3NA 2VXWA 2F0SA 1LTRD 3AU7A 1S4ZA 1D1IA 4RGMA 2CVRA 5HURA 3AMUA 1L0YB 1MBYA 2AWOA 1F9QA 3QOJA 5C3WA 1WD0A 1KABA 1A3UA 1S5DD 1X3QA 3DEOA 1LTAD 3IL8A 4LAAA 2AQ1B 1SDFA 5G3LF 5I6WA 4KY6A 1SNCA 2C5CA 4KY7A 4KN4C 5C0XI 3TP5A 3IFTA 2R7ZB 4B08A 4BWGB 2BA1A 1EQVA 4RHSA 2HDMA 2L12A 5NUCA 2FMCA 3A54A 5C4XB 4BA1I 1H9SA 3RZOB 5IT9E 1SYFA 2R92B 3I72A 4XYOA 1VDZA 2PO4A 4RA8A 3I91A 1AP0A 1RF2D 3NP8A 2F0WA 1H9SB 1DM0B 4EVOA 2F0FA 4DXFA 5JJZA 2A5HA 1L0XB 1H9KA 5EKLA 5CV5A 1CFMA 2A73B 4BY1B 2NVXB 3KBGA 1SYGA 4L8JA 1CA6A 4KI0A 4HSVA 3H3VC 3WOEA 1R4PB 3MXPA 1ET9A 3M7GA 1KDBA 1BOSA 5FO7B 2NVQB 1YNNC 3VA5A 3A8IE 5IT9L 1MGSA 1SXTA 3KLRA 1WTRA 1BCPD 5ELCA 2R93B 2JEAI 4MIUA 3D8GA 1HTPA 3GTGB 2JEBI 4C3JG 4TRDA 2E75C 3MEHA 3OIQA 3Q23A 4QIWB 4M1UB 2FFKB 1SNDA 2Z8LA 5DAUA 3NQIA 3I4MB 1TWCB 3H0GB 1MSHA 1ENCA 2XVSA 2JE6I 4RKLA 1X32A 4MHEA 3BZDB 5E3FA 1F2ZA 3K7AB 1Z7TA 2PZTA 3R2TA 5EGTA 1Y1WB 4PMWA 3CKIB 3P7JA 2A68D 3NTIA 5IIFA 2MHVA 1B1ZA 1LV9A 1O7YA 1F2LA 5EKKA 3D4WA 2BDNA 2JA5B 2PNRC 3GD7A 3TN2A 4HEDA 1I4XA 1EIHA 1JWUD 1KDCA 4CJ2C 1CI3M 1EFID 4CBVA 4KJOA 4RGNA 1TS4A 1MD2D 1JOKA 2DNEA 3I8ZA 3OPOA 4K5XA 2QEJC 3MC0B 4G57A 1QB5D 4NMZA 4F87A 3GTMB 2M00A 3MHBA 4DF7A 2QILA 4PQXA 2PPBC 1SE2A 1B53A 1A3TA 5CMDA 1BF4A 3M3YB 2MJ8A 3K59A 1ESFA 2X6LA 1BDOA 3ND9A 4BS9A 1A3VA 1QNKA 4C1NI 1TR5A 1HA6A 4YIJA 3H91A 1F77A 1R9TB 1I3QB 1PZJD 1PRTC 2LMCB 1U4RA 1SMYD 1A15A 2F0GA 4ZUJA 2XRSD 2ICIA 3TDQA 1Y8NB 2NN6G 2EYHA 5C5LA 4BBRB 2RDHA 1GUNA 3VR3A 3KUPA 1QILA 1Z47A 2MP1A 3RZDB 1T5XD 1STAA 3LWUA 1SJHD 4N9PA 3R93A 3H09A 4L6TB 3QO2A 4OIKA 1Y1VB 2IJ0A 4XXEA 2IL8A 1O80A 4WJWA 1WTVA 5FO8B 4FF3A 1VF5C 1UNSA 1SYCA 3HS0C 5EPJA 3M7NA 2WV6D 1GXDC 1GUSA 3EVQA 4DFAA 5KRUA 5I2XA 2JSOA 5DEHA 5COYA 3MVVA 5LL6X 2F03A 4C1NK 3G6JB 3ONAB 4B9WA 3RD4A 1PTOF 3PO3B 2AQ3B 2B2WA 4K2KA 3BDOA 5FOBB 4P2CB 4RHRA 3S15B 1RDPD 3VYSA 5IODA 2D62A 5CV4A 4A3MB 4A3IB 4JBWA 1DD2A 5D3DA 4F88A 1E0BA 3MA2B 2X6GA 4FF1A 4A93B 4OO1H 4I65A 4OHJA 5CR3A 1RCVD 5E1FA 1DZ1A 2O4XA 3GTLB 5JEAH 2F0UA 1CZGA 1STNA 4Q5VA 5DM73 4NW2A 3PIP3 1UAPA 3OOCA 2OEOA 1STBA 2A68C 1K8OA 2O2LD 1U4PA 4K6DA 4IUVA 4KD3A 4ZAIA 3I90A 1XX8A 4QMGA 3HOXB 5K36G 1F2MA 4UDUC 1PRTF 3LX0A 3I3CA 1SYBA 5A35A 5LL6S 1GOZA 1JR0D 1ZEQX 2F0NA 2WAQB 1A2TA 3C2PA 5LHY1 2F0PA 1D5ZC 1SEBD 2E2DC 4H13C 5EBDA 4R8NA 1LT5D 1CM9A 1I6VC 1SNPA 2EDGA 2TSSA 1WD1A 2PMZB 1QOHA 4TKOB 5KEEA 4OIJA 1QNUA 1B9NA 2L5TA 1O78A 1YNND 4L63B 3KK7A 3T53B 4GZYC 3K57A 3PV0A 2OXPA 4ODGA 5C3XA 2IX1A 1VMCA 1QJOA 1I4PA 4B9XA 3HZXA 3HG9A 1SMYC 4X3KA 3BVZA 4QCLA 1SSOA 5BN3A 5C0XH 5D65A 2MUYA 1HUMA 2K5DA 1X3PA 3GTPB 4UAIA 3FRPB 3NWTA 1TVXA 3K6OA 2RA4A 2C9OA 4ZLTF 4HTHA 1E2WA 1EY7A 1PZKD 2R61A 2K05A 4XQNA 1SJED 2WP8J 1CA5A 1M4VA 2QDBA 2J4XA 1I4RA 4PV1C 2KVMA 3IAYA 3C3LA 1H9MA 2EJGC 3PMFA 4RFBA 2RDFA 1EY5A 1F2YA 1PTOD 2RSNA 5JVH3 1KNAA 3GTOB 1SE3A 4CKBA 2EYMA 4H0LC 1OO9B 1AZPA 1VCIA 5CBAE 1GUOA 4K2LA 4E6IA 2L0CA 3T13A 3TP6A 4RGTA 2M2LA 5KYLA 4DNRB 2XSCA 4OO1G 2NTSA 1ONLA 1JQYD 4ZRZA 1KNEA 4FF4A 3A7AB 4J6HA 4N9TA 4LMQD 3GQBA 3PUYA 4G4KA 1CK1A 3OWEB 1EYCA 3D6CA 1WCMB 3OMGA 1U9RA 2QF7A 5K5PA 1ESRA 4C3IG 2XWJB 3CRKC 3NK9A 5ELEA 4IFDH 1O7ZA 4C3HG 3BS1A 2XWBB 2K1BA 3K5LA 1Y8OB 5KNDA 1PZID 1FYCA 1EIGA 2SNMA 1D5MC 5JOBA 3A8JE 1FNWA 1WTWA 2VB3X 4OGQC 1TT2A 1V1OA 1PRTD 3CU7A 1STHA 2K7VA 3OSOA 4RKBA 3K5NA 4RCOA 1NCVA 5IGGA 3R8BA 5M3FB 2JYOA 2JP1A 1STYA 4F8MA 3KLSX 3Q0AA 1LLRD 2N88A 5KYIA 5CBEE 4QF4A 1T5EA 2XIWA 1IKMA 1OXVA 3TSSA 1BR9A 1AN8A 2D9UA 5J22A 1EYAA 1A6XA 1Z6HA 1R4QB 5C6AA 3HRZC 3S14B 2VNUD 1NSNS 2HCCA 5T1IA 4KTAA 3FVQA 1JWMD 2IW3A 4OL7A 2FJ2A 2E2JB 1PTOB 2PCFB 2D5DA 4IUNA 3J80E 1WTXA 1SYEA 5E4WC 3IKJA 1KAAA 3DWQA 1RJTA 4K8JA 5J1ZA 3TBIB 3TZDA 4HN7A 2NUCA 1RKNA 3J7AF 1SNOA 3I70A 1W6JA 3ND8A 1ILQA 1JC7A 3HOVB 1SE4A 2I07B 4IUTA 4X3SA 4IURA 2K32A 4ZQ3A 2EOTA 2KCCA 2PQEA 2HCIA 4K6LA 4QUFA 4XIGS 1PTOC 2EJFC 2MGSA 2L1BA 3FDTA 2O5IC 2L11A 3RLFA 2E2HB 4ZK9B 1E2VA 1TQOA 2H1EA 1LTBD 2B2UC 3J80L 2VUMB 3DHQA 5M5XB 1PRTB 2RQXA 1RHPA 2NVYB 1PFMA 3T51B 2KJXA 1K83B 5M3MB 3E5SA 3IFDA 2IT1A 4U68A 5ELBA 1ZKOA 3HOYB 2NN6I 2EYOA 4IFDG 2K04A 1U4LA 3DXJC 1OXTA 2DY8A 1I4GA 3NWSA 3VR2A 2F1MA 4RCNA 2I46A 2K5QA 3BVGA 5CYUA 1CQVA 2ID0A 4HAEA 2QKIC 4X3UA 1HUNA 3MTSA 2B8FA 5EJWA 4A3JB 1CQFA 3P20A 2B2VA 2M9VA 1K8MA 3MFGA 2F0VA 1G291 4I7ZC 1RODA 1Q12A 3NUCA 4FNFA 3A8KE 3NBIA 1AFPA 5E4XA 2EE1A 5T1GA 3S2HB 4LK1C 3U9SA 1TWFB 2KECA 2K5WA 5TSSA 1EY6A 2WKDA 3J81E 2L55A 4FO2A 1G2SA 1FD7D 3VA7A 2WINB 5CGKA 1PXUA 3OIPA 3W2DA 4PMBA 4CKCA 4EQNA 3K0YA 1NUCA 1C8CA 1RTOA 1HRJA 1SFOB 3SE0A 3L9AX 2R3ZA 5EPLA 4FXDA 2PZWA 2EYLA 4IFDJ 2EVBA 3TMEA 5IGDA 3EROA 3MWYW 3NHHA 3MAQA 1BXTA 4BA2I 5IGEA 2EYFA 5EKIA 4QB4A 1B4OA 3SK8A 2LKVA 1IW7C 4XQJA 1SAPA 1STEA 3M85A 2V4DA 4H44C 2B2VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E4W C;  3FPU B;  4DN4 M;  1VMP A;  1ESR A;  3F2U A;  1DZ1 A;  1PLF A;  4X3K A;  1SSO A;  1MSH A;  1DOM A;  4HAE A;  2DY7 A;  1AZQ A;  2X69 A;  5D65 A;  4X3U A;  1O7Z A;  1HUN A;  1X32 A;  2FIN B;  3MTS A;  1HUM A;  3LWE A;  4MHE A;  2B2T A;  5EPK A;  2KED A;  1GUW A;  1X3P A;  5COR A;  4X3T A;  1RJT A;  2RVL A;  2B2Y A;  2K1B A;  4NW2 A;  3KUP A;  4UAI A;  4RAU C;  5EJW A;  1TVX A;  2MP1 A;  2B2V A;  1MSG A;  2RA4 A;  3TZD A;  1J9O A;  1EIG A;  2FMM A;  4ZKC B;  1U4M A;  1HFN A;  2FHT A;  1M8A A;  3I91 A;  4RA8 A;  1BBX C;  1AP0 A;  1ROD A;  4IUU A;  4ZLT F;  1WTW A;  5EQ0 A;  1B50 A;  2B2W C;  3R93 A;  4XT3 B;  3P7J A;  2K05 A;  5JJZ A;  1ICW A;  1NR4 A;  1JIC A;  1NR2 A;  2N55 A;  3QO2 A;  2EE1 A;  4OIK A;  1ILQ A;  5E4X A;  5T1G A;  1HFG A;  1LV9 A;  1U4R A;  1NCV A;  1U4P A;  2IL8 A;  1F9S A;  1O7Y A;  4O42 A;  4IUV A;  1CA5 A;  1F2L A;  1O80 A;  2KEC A;  1WVL A;  1BNZ A;  1ILP A;  2BDN A;  2JYO A;  4ZAI A;  1DON A;  3I90 A;  1XX8 A;  2JP1 A;  1WTV A;  3TN2 A;  4IUT A;  4X3S A;  4HED A;  2KVM A;  2RSO A;  2HUG A;  4IUR A;  1EIH A;  4XDX A;  1CA6 A;  1JE4 A;  4HSV A;  2EOT A;  4CJ2 C;  5EPJ A;  1DOK A;  3I3C A;  1PFN A;  1G2S A;  2HCI A;  2N88 A;  5DNF A;  4QUF A;  2RSN A;  1HHV A;  2L4N A;  2MGS A;  2L1B A;  3D6W A;  1DOL A;  3I8Z A;  5CBE E;  3FDT A;  2NYZ D;  2L11 A;  1KNA A;  4ZKB B;  3DM1 A;  1MI2 A;  4ZK9 B;  2XIW A;  4MN3 A;  1IKM A;  5COY A;  2H1E A;  2VXW A;  2B2U C;  1NAP A;  1WTQ A;  3SVM A;  4IUQ A;  5AFW A;  1QE6 A;  3ONA B;  1S4Z A;  1C8C A;  1RTO A;  1G91 A;  2D9U A;  3HP3 A;  1AZP A;  1HRJ A;  1BO0 A;  1IKL A;  3KBX A;  1G2T A;  2HDL A;  1B2T A;  1PDQ A;  2R3Z A;  1RHP A;  2CVR A;  4QUC A;  5EPL A;  1XYI A;  2B2W A;  2K03 A;  5CBA E;  1PFM A;  1EL0 A;  1Q3L A;  1F9Q A;  1B53 A;  1MGS A;  4IUP A;  1WTR A;  4XT1 B;  2L9H A;  1WD0 A;  2Q8T A;  1CM9 A;  2M2L A;  3GV6 A;  3Q6S A;  5CMD A;  2KUM A;  3IFD A;  1BF4 A;  2EPB A;  2HCC A;  5T1I A;  1X3Q A;  3G7L A;  3DEO A;  2SDF A;  3MWY W;  4U68 A;  2MJ8 A;  4RWS C;  1WD1 A;  1EOT A;  2FJ2 A;  4OIJ A;  2X6L A;  3IL8 A;  2MPM A;  5EKI A;  1SDF A;  1B4O A;  1KNE A;  2Q8R E;  1QG7 A;  1WTP A;  1QNK A;  3DEP A;  2K04 A;  1EQT A;  2KEE A;  4LMQ D;  5D14 A;  4CJ0 B;  1F9P A;  2KOL A;  1U4L A;  3N52 A;  1WTO A;  1SAP A;  1G6Z A;  2B2T C;  1HA6 A;  3GV3 A;  3UI2 A;  3H91 A;  1F9R A;  1E0B A;  2B2Y C;  2J7Z A;  2NZ1 D;  1PFB A;  2DY8 A;  1RTN A;  1ZXT A;  2FFK B;  2K01 A;  1IL8 A;  2X6G A;  4R9W A;  4R8I A;  2B2V C;  1B3A A;  4HCS A;  1J8I A;  2HDM A;  1VMC A;  2K28 A;  2L12 A;  2NWG A;  1ML0 D;  1WTX A;  4CJ1 B;  2B2U A;  1A15 A; 
#chains in the Genus database with same CATH topology
 3J81 L;  3GTL H;  1CTM A;  4IQZ A;  3AQQ A;  3T1Y Q;  3I56 A;  5C4J B;  1VQP A;  3CME A;  3QWN A;  5C3E G;  3CW2 C;  4IOC A;  2JA5 G;  2F0Q A;  1C4Q A;  2RDG A;  3T4A C;  4ZKC B;  2FMM A;  1SNM A;  1ICF B;  5IWA Q;  2HIX A;  1FGB D;  2KA7 A;  5I9O A;  1B70 B;  1H9J A;  3SEB A;  2CQA A;  4G7O C;  1S5E D;  4DR7 L;  5C4Z A;  2YTX A;  5JJI A;  2F0T A;  2KCT A;  3VYT A;  4DU9 A;  5I9P A;  1JOR A;  5IY0 A;  2Q2T A;  2VB2 X;  3TS0 A;  3SGI A;  3HOX H;  3NTH A;  3KOJ A;  2WAC A;  3WOF A;  1X65 A;  1JWS D;  2K33 A;  5HGT A;  4HJ5 A;  3IRB A;  3B6Y A;  3PCO B;  3E6Z X;  2VY3 A;  1O7I A;  1EQQ A;  1HHV A;  2WFW A;  4ID6 A;  4A3L G;  2SNS A;  2C35 B;  1D6E C;  1CSP A;  3HOU G;  1NAP A;  3SVM A;  3VDY A;  3BZC A;  4LWC A;  3OMC A;  4OXP A;  4DNI A;  1YZ6 A;  1WJJ A;  4ZYS A;  5IP7 H;  1VQI A;  3MXG A;  2I5L X;  5FK9 C;  3KLS A;  4IUP A;  1TWH B;  1Q1B A;  5CV7 A;  2VW9 A;  3WDN A;  5EAY A;  2A6H C;  1KLU D;  2KEN A;  3G7L A;  3PUZ A;  4LFC Q;  2QCP X;  1N8R C;  3X3M A;  4HCE A;  1VQ4 A;  4XYQ A;  1CHP D;  3A56 A;  4X64 Q;  2BOS A;  2KOL A;  5JAV A;  1BUV T;  3S1R B;  4KD4 A;  2NZ1 D;  2J7Z A;  2ICE C;  4DV5 Q;  4Z9C B;  3BYT B;  4NPS A;  3JAM E;  1EZ6 A;  2K28 A;  4C3I B;  4UP7 A;  1W2B A;  4HJ7 A;  1JB3 A;  5JJK A;  4C3H B;  2B63 B;  4S3S A;  3QJY A;  1AW7 A;  4FYD A;  1Q8I A;  2JA8 B;  4JI0 Q;  1B44 D;  3S17 B;  2H5X A;  2WB1 G;  2RF4 A;  2YV5 A;  3Q8D A;  2A69 D;  1H9R A;  4JI6 Q;  4K8I A;  2DUD A;  2E2I B;  4LFA L;  5E7N A;  1D7Q A;  1ICW A;  4IAL A;  1HNZ L;  2N55 A;  3GTK B;  5HGQ A;  1HFG A;  2BCO A;  4O42 A;  5F2D A;  1NMG A;  3RMH A;  5IYD H;  3ZJY C;  1OXS C;  5ELF A;  4K0K L;  3PO3 G;  4R4Q A;  2I0Q A;  5C5M A;  4IN3 A;  4ZUI A;  1PFN A;  1SNQ A;  1EYG A;  4FF2 A;  4JV5 Q;  3KFU A;  3QB3 A;  2AKW B;  1DYQ A;  4N8X 1;  1DOL A;  1IL2 A;  2ZM6 Q;  3PIO 3;  4OX9 Q;  2Z1C A;  4K14 A;  3GTO H;  1VQN A;  2O5J C;  1S5C D;  4OO1 I;  4POF A;  4O1N A;  1TWG B;  1HXY D;  3JAM L;  5ISR A;  2BH8 A;  3PUV A;  1QE6 A;  3URY A;  3HP3 A;  3KBX A;  2IX3 A;  1G2T A;  1K3R A;  1XTC D;  1PDQ A;  4AIM A;  4DR2 L;  3OW7 A;  4DAP A;  4A3I G;  5IGF A;  2XGT A;  1CUK A;  4FVM A;  4YWM A;  4DK1 A;  1SBB B;  3W3A A;  1KRT A;  3AYH B;  2DN8 A;  2OF1 A;  3W1B A;  2Q8T A;  2JA6 B;  2RKS A;  3E0J A;  5KNC A;  4JI3 Q;  4A76 A;  3CC4 A;  1UEB A;  3OTO L;  2K52 A;  5GQO A;  1YBY A;  3NEL A;  1EOT A;  3SHL A;  1VQG A;  1TKW B;  4OON A;  2Z6K A;  1N9W A;  1A0I A;  3T1H L;  5D14 A;  2B39 A;  3HEJ A;  1WCM H;  1W3S A;  4JVZ A;  2UUA L;  4JI2 L;  2F0J A;  3UI2 A;  2XRQ D;  2IWH A;  2UXC Q;  2ZXP A;  1PFB A;  4JI7 Q;  3SXH A;  4HCS A;  3D3R A;  4JI5 Q;  1J8I A;  2WKC A;  1ML0 D;  2EJM A;  2F4V Q;  4Q0F A;  1JJC B;  4B3T L;  4NXN Q;  1DOM A;  2K6A A;  2TMP A;  3T16 A;  5M9O A;  4PMC A;  4C3J B;  4J1M A;  4A3D G;  2XNA C;  2LSS A;  1XWE A;  5EPK A;  2N49 A;  5FKA C;  4EQO A;  1A2U A;  1GUW A;  5JEA G;  1M90 C;  1I4Q A;  2D2C C;  2F3W A;  2RCF A;  1KD1 C;  1B9M A;  1J9O A;  2AWN A;  1I50 B;  1U4M A;  5C44 B;  4V19 0;  5LMN Q;  1TU2 B;  1XNR L;  4BY7 B;  1LTT D;  3R2I A;  1NR4 A;  5M5Y B;  2EXD A;  4JBK A;  2F0E A;  3A5Z B;  2F3V A;  4X62 Q;  3PO2 G;  2J0T D;  2NVT B;  4NXM L;  4C2M H;  1YJW A;  4TQU S;  1A63 A;  1LT3 D;  2RSO A;  2HUG A;  5CV9 A;  1XXG A;  1SE8 A;  5KGU A;  1DJR D;  1DOK A;  1YHQ A;  2F4I A;  3CC2 A;  4KHP Q;  3I7F A;  4LF9 L;  3HOZ G;  5DNF A;  2AUK A;  2CCZ A;  2OWO A;  1TY2 A;  1JE5 A;  2PZU A;  1LT4 D;  1JJ2 A;  2NBF A;  1VQD A;  2G9D A;  3C1E A;  4ZKB B;  1WI5 A;  4XTC S;  2E74 C;  1YJ9 A;  1NBW A;  1STG A;  4ME3 A;  1KLG D;  4DR1 Q;  2EXZ A;  4CDD C;  1JOQ A;  4IUQ A;  4FP5 D;  2UXB Q;  2AMC B;  1G91 A;  1RIP A;  2F0D A;  2JN4 A;  3J80 i;  4C2M B;  2Z6K C;  2K03 A;  3JC6 6;  5IYC G;  3I4L A;  3L3O C;  1Y8P B;  3GTJ B;  2PW7 A;  4FXG C;  3EFX D;  5DM6 3;  3S14 H;  1GHK A;  3QG1 A;  3U4Z A;  2KUM A;  2YTV A;  1TWA B;  5J39 A;  1BBU A;  3FEW X;  2BE5 C;  3U50 C;  2E2J H;  3S24 A;  1PTO H;  1SMX A;  4A3G G;  2NB0 A;  3ZYY X;  2Q8R E;  2Y0S B;  1QG7 A;  2RHQ B;  4YWL A;  1E1T A;  3I55 A;  3N52 A;  4R1J A;  3ULJ A;  2K4K A;  2ZJP A;  5JEA J;  1NJI C;  1PYW D;  3C46 A;  1F9R A;  3BVM A;  3R3O A;  2AUJ D;  4KN7 C;  4R8I A;  3HGB A;  1GHJ A;  4A3F G;  4CDC C;  2NN6 H;  4KHZ A;  4DGZ A;  2B2U A;  1EY4 A;  5C4H A;  3GP7 A;  4P73 A;  2K5V A;  1HPC A;  2X69 A;  2MFI A;  2N78 A;  2VQE L;  2FIN B;  3HOW B;  4R4T A;  1EZ8 A;  1FGU A;  1KTK A;  1W6K A;  4HMJ A;  5C0X G;  4KY5 A;  1BQQ T;  3U9O A;  5I2Y A;  1XNQ Q;  1IW7 D;  2PW5 A;  3E9H A;  5IYD G;  1HTL D;  1AEX A;  3KJO A;  2FHT A;  2OTJ A;  2R6G A;  3VR4 A;  2A69 C;  1XMO L;  1FR3 A;  3M4Y A;  1ZYR D;  3DWA A;  1D5X C;  4AYB B;  3RUZ A;  3ERQ A;  3SK4 A;  3ICE A;  3STB D;  4LFC L;  3TS2 A;  3HOV H;  4R4C A;  4B3S L;  3M4Q A;  2ENB A;  2YYZ A;  1DXM A;  2OQK A;  4X64 L;  1GJX A;  1BNZ A;  4IZ8 A;  4ULL A;  1DON A;  5BN4 A;  3S1Q H;  4ABN A;  3HKZ B;  3EA6 A;  2G5D A;  1IYU A;  1H95 A;  1X3G A;  3PUX A;  4CHT B;  3VYU A;  3I4N G;  2LFN A;  1SRU A;  4TSS A;  1YJN A;  2E2H H;  3MXN A;  4A3K B;  3DM1 A;  1GVP A;  4J8Q A;  4LF6 L;  2A74 C;  2VUM H;  3SDZ A;  4P71 A;  1C48 A;  2ZTC A;  4H7B A;  3NTK A;  1YEZ A;  2QDL A;  5M5X H;  4HJ8 A;  2NVY H;  4IFD I;  1IKL A;  2HDL A;  5CC4 A;  4JI6 L;  4A75 A;  3S1Q B;  4O0A A;  1UUP A;  1K83 H;  5M3M H;  2EY5 A;  1XPO A;  4C56 C;  3MXN B;  3K58 A;  1EY0 A;  4A3E B;  3J7Z C;  1YI2 A;  3Q24 A;  3GV6 A;  3Q6S A;  4P72 A;  2A1A A;  1VQJ A;  4CGY B;  3DWP A;  1FL0 A;  2FXQ A;  3HOY H;  3I73 A;  4EQP A;  3H94 A;  1OTC A;  5FJ8 H;  2IX0 A;  1VQ6 A;  4JK1 C;  2F0H A;  1KXL A;  4JYA L;  3MXU A;  5D3I B;  1VF7 A;  3DEP A;  2GA4 B;  3TP8 A;  3D4R A;  2Q8I B;  3OYY A;  5JPM C;  1PYB A;  3M4O B;  2QA4 A;  5C0X J;  2R7Z G;  4G7H C;  4R9W A;  1ZXT A;  2K01 A;  2ZM6 L;  1EWH A;  4DAY A;  2A6H D;  4V0B A;  1EY8 A;  2F3I A;  3V96 A;  2CHB D;  1PLF A;  4LFA Q;  4WJ4 A;  5C4X G;  1EEF D;  3K81 C;  3S1M B;  2SOB A;  3AB9 A;  3J81 i;  5C3E B;  2UU9 L;  5COR A;  4X3T A;  5M3F G;  2R92 G;  2RVL A;  4A3J H;  2F52 A;  4UY8 C;  1VQH A;  1TII D;  2LY7 A;  3GTQ B;  1K0R A;  5M5W B;  4DAY B;  2IHF A;  3F2D A;  4DV4 Q;  1G8Z D;  4K0K Q;  4IUU A;  2JXM B;  1LT6 D;  5EQ0 A;  2WII B;  2JK8 A;  1VQ9 A;  5IGB A;  3EJI A;  3BZK A;  4JPB W;  3S2H H;  4WJ3 M;  4HIM A;  1HQR D;  1ENA A;  4U67 3;  4YCU A;  1TWF H;  1MJC A;  1XPR A;  5K36 H;  1Q90 A;  4BY1 G;  1HZ9 A;  4IO9 A;  2CW0 D;  1Y69 U;  1IZ6 A;  3BYY B;  4XDX A;  2YU9 B;  4JI7 L;  5G3L D;  4JI5 L;  1S5B D;  4F7X A;  1B3Q A;  5CV8 A;  4WFN 3;  4DR2 Q;  3NEM A;  2F4V L;  1LTL A;  2L4N A;  2RBM A;  2AQ2 B;  3NBH A;  2NYZ D;  3HOU B;  3QIA A;  2IHE A;  4MN3 A;  2A6E D;  1IBK L;  5A2Q E;  5JVG 3;  4G7Z C;  4RGO S;  3OTO Q;  1DCZ A;  2XTI A;  3FKI B;  1SFO H;  4DK0 A;  1C0A A;  2KHS A;  4Y7N B;  1D1K A;  1BO0 A;  3GO5 A;  4DNT B;  1HQM C;  3P75 A;  1SR3 A;  3NXW A;  2IPK D;  5JJL A;  1EWC A;  5IOC A;  4FXK C;  1PH7 A;  4BBS B;  1II3 A;  3T1H Q;  1EU3 A;  2KQ3 A;  3LNN A;  3NPP A;  3NBH B;  5JPN C;  2EZV A;  1HR0 W;  1QCB D;  2UUA Q;  5IE8 A;  2N8N A;  2XN9 C;  3NSW A;  2BDO A;  5FLX E;  3SR1 A;  2EPB A;  4A3C H;  2ZXO A;  4X62 L;  2Z6B A;  1ET6 A;  1GUG A;  2EYJ A;  4DAV A;  4B3T Q;  1LM0 A;  4DR6 Q;  1BCP B;  1EQT A;  4CJ0 B;  4KHP L;  1F9P A;  1G6Z A;  4OEM B;  2Y0S E;  3VR6 A;  3GV3 A;  1PYS B;  1V43 A;  3CMA A;  2KBN A;  3A7L A;  2Z4H A;  4DV6 L;  4KV6 A;  4IPH A;  2I5H A;  1LTG D;  1KAW A;  4GLX A;  3BG3 A;  4DR1 L;  5C4J H;  2DY7 A;  2UXB L;  4RH6 A;  4HSP A;  3H0G G;  1JCK B;  5EBC A;  2WB1 B;  3TZU A;  5KIX A;  2Z4I A;  2CH4 W;  2B2Y A;  2OT2 A;  3PQI A;  1YNJ D;  2RCN A;  5A2Q L;  4NXM Q;  2LS0 1;  3O13 A;  4QY7 A;  1M8A A;  3VR5 A;  1HCZ A;  3L7Z C;  3CPF A;  3J7A V;  2BA0 A;  4XT3 B;  3AFQ A;  4L5S A;  3OHX C;  1KIX A;  1ZYR C;  4LF9 Q;  5CV6 A;  4LJZ C;  2EY2 A;  3STB C;  4KKU A;  2Q2I A;  3ERS X;  4AYB E;  1QWY A;  3K5O A;  3F2C A;  1F9S A;  4DV3 Q;  1WVL A;  3EIV A;  1ILP A;  1O7L A;  1WTH A;  2EIF A;  5FLX L;  1N33 L;  4XQQ A;  1CSQ A;  4DV1 L;  1EEI D;  2ZT9 C;  4JBM A;  4KMU C;  2KHI A;  2GN5 A;  3V05 A;  1AH9 A;  3KJP A;  4I7A A;  5M3M G;  3ITP A;  3D6W A;  4HMI A;  3FPP A;  1BCP C;  2ZJQ A;  3RLO A;  1MI2 A;  3A74 A;  4A3B B;  1FNV A;  1XNQ L;  5AFW A;  3G71 A;  2JA7 H;  3CRL C;  5FJ8 G;  2H4O A;  3Q22 A;  3JAM i;  5I6Y A;  2OCE A;  4JBJ A;  1Q3L A;  1TWH H;  4YCV A;  4K5W A;  2L9H A;  4PNY A;  1PHJ A;  3SK5 A;  1EU4 A;  5ELD A;  1Q81 C;  3PF5 A;  1VQO A;  3CCU A;  4RWS C;  3EN2 A;  4TVA B;  4GN5 A;  3K5M A;  3S1N B;  3P1H A;  1PFS A;  2B3G A;  3DMU A;  2P5Z X;  4CKE A;  2QEX A;  2VQE Q;  4PZ8 A;  5BN5 A;  2JA7 B;  3S1R H;  4B3M L;  2F0O A;  1I4H A;  1MIU A;  3E0E A;  1K73 C;  4WRD A;  3D31 A;  2B2Y C;  1ENF A;  1J6Q A;  1HA5 A;  2F0M A;  3N6R A;  3MFY A;  2EYP A;  3BDC A;  4C3I H;  4R4I A;  1HNW Q;  4KHV A;  2BE5 D;  3CF5 A;  2K50 A;  3DLL A;  1XMO Q;  3FPU B;  4DN4 M;  1VMP A;  2UUC L;  2E76 C;  1K3B C;  4C3H H;  3L2P A;  3UDI A;  3VYR A;  4HJ9 A;  4A3D B;  2B63 H;  1AZQ A;  4UP8 A;  4OEL B;  3LWE A;  1EYD A;  2B2T A;  1SN8 A;  1VQL A;  2JA8 H;  3S17 H;  3SK6 A;  3TP7 A;  4B3S Q;  4BBR G;  1MSG A;  1HFN A;  1Y14 B;  1CKN B;  3LGJ A;  1PA6 A;  2E2I H;  4GKK Q;  4NKL A;  2B2W C;  1B50 A;  3V2T A;  1VQ8 A;  3GTK H;  2PNH A;  3NQT A;  4NB3 A;  1JIC A;  1NR2 A;  4QJF A;  3PO2 B;  3A55 A;  1LAC A;  1Y1V G;  3NE5 B;  1OXX K;  3MZ5 A;  3S2D B;  4LF6 Q;  3CP0 A;  1AE2 A;  4KKT A;  2F0I A;  2R7D A;  2ZTD A;  3CCS A;  3HOZ B;  2NTT A;  1IYV A;  2CW0 C;  1LAB A;  1RD9 D;  3EQL C;  3AFP A;  5I4D A;  1V1Q A;  1LO5 D;  4CDE C;  1EY9 A;  1VQ5 A;  2EY1 A;  1TWG H;  4LNQ A;  4A3C G;  1S72 A;  2A6E C;  1WTQ A;  3CHB D;  2KCM A;  4KK7 A;  3DM3 A;  1KC8 C;  3S16 B;  2LXJ A;  1B2T A;  1KDA A;  4DV4 L;  2PYK A;  4QUC A;  1XYI A;  3HKS A;  4IJH A;  1E2Z A;  1ASZ A;  4JYA Q;  3KF8 A;  1L2F A;  1Q1E A;  1EL0 A;  2N3S A;  1SYD A;  3D4D A;  3KYH C;  4L5T A;  2JA6 H;  3J7Y W;  4XT1 B;  1VQA A;  2ZXR A;  1P8L A;  1A62 A;  3PUW A;  4UHV A;  1GM5 A;  4BXX G;  3OWF A;  5AJ3 L;  2DNC A;  4WOR A;  4GN4 B;  2SDF A;  4A3G B;  1S5F D;  2MO1 A;  3S9W A;  2MPM A;  3CQZ B;  3KF8 B;  3C1F A;  1Q46 A;  1WTP A;  2KEE A;  4NP5 A;  3T56 B;  4HR7 B;  1UWV A;  1IHZ A;  4A3M G;  1WTO A;  2UU9 Q;  2B2T C;  4KJN A;  4M8A A;  1BCP F;  1PMR A;  1RTN A;  4A3F B;  4K5V A;  1IL8 A;  1B3A A;  2NWG A;  3H6M A;  4CJ1 B;  4A93 G;  1UEA B;  1LTS D;  3F2U A;  1ASY A;  4C3J H;  4YWK A;  4QQB X;  1FNU A;  5KNB A;  4KKS A;  5LMN W;  1JOO A;  1D2B A;  2KED A;  3OW2 A;  1V8Q A;  1HNX Q;  1CT1 D;  4RAU C;  4DA2 A;  1I50 H;  4MTK A;  4EGV A;  2WB1 E;  5C44 H;  4NDX A;  5HY6 A;  1TS3 A;  1BBX C;  1YNJ C;  2SEB D;  2KCN A;  3BDL A;  4BY7 H;  3DUZ A;  5M5Y H;  1TY0 A;  1OXU A;  4ZCK A;  1I6H B;  4DV7 Q;  1LTI D;  2D0P A;  4ILW A;  3CCV A;  1TS2 A;  2B8G A;  4DR6 L;  3I4O A;  2NVT H;  1MHW C;  1V1P A;  3ER0 A;  5IGC A;  2G9H D;  2F0K A;  5FO9 B;  1CHQ D;  1IBK Q;  3FMC A;  3HOX G;  4GOP A;  1JE4 A;  4KLK A;  2EY6 A;  1GUT A;  2F0L A;  2HQE A;  3QOL A;  3I4N B;  1TS5 A;  1CZW A;  2B29 A;  3M9B A;  2CFM A;  4DXG A;  2MQH A;  1V1P B;  4ME5 A;  3X3N A;  4HIO A;  2VXW A;  2F0S A;  1IBL Q;  2WAQ G;  1LTR D;  4GOP B;  3AU7 A;  1S4Z A;  1X3E A;  5IT9 c;  1D1I A;  4IJL A;  4RGM A;  2CVR A;  4GN3 B;  3GTJ H;  5HUR A;  2DJF C;  3AMU A;  1L0Y B;  1MBY A;  2AWO A;  1F9Q A;  5ELO A;  3QOJ A;  4JW0 A;  5C3W A;  1TWA H;  1WD0 A;  5IP7 G;  1KAB A;  2MO0 A;  4OWW B;  1A3U A;  2LXK A;  1S5D D;  1X3Q A;  4DV6 Q;  4DV3 L;  2HT1 A;  3DEO A;  1E24 A;  1LTA D;  1E7Z A;  5IP9 H;  1DGS A;  3IL8 A;  4LAA A;  4GS3 A;  2AQ1 B;  1SDF A;  2B63 G;  5G3L F;  5I6W A;  4X66 Q;  4KY6 A;  1SNC A;  2C5C A;  4KY7 A;  4KN4 C;  5C0X I;  3TP5 A;  4HIK A;  3IFT A;  2R7Z B;  4B08 A;  4BWG B;  2BA1 A;  1C7Y A;  1EQV A;  1PH5 A;  2I5M X;  4RHS A;  4DKA C;  2JQO A;  2HDM A;  2L12 A;  4P74 A;  2FMC A;  5NUC A;  3A54 A;  1P16 A;  4IPC A;  5C4X B;  1WOC A;  4BA1 I;  1H9S A;  3RZO B;  5IT9 E;  3HOW H;  1SYF A;  2CWP A;  2R92 B;  3I72 A;  4XYO A;  4HID A;  1SRO A;  1VDZ A;  2UUB Q;  4X65 L;  2ZTE A;  2PO4 A;  1N33 Q;  4RA8 A;  3I91 A;  3CPW A;  1AP0 A;  1RF2 D;  4DV1 Q;  3NP8 A;  3A0J A;  2F0W A;  4GOP C;  1H9S B;  3J80 c;  1DM0 B;  4EVO A;  1S40 A;  2F0F A;  3K8A A;  4DXF A;  5JJZ A;  2A5H A;  3K7U C;  1L0X B;  1H9K A;  1XJV A;  2NVQ H;  5EKL A;  5CV5 A;  2BH2 A;  1CFM A;  2A73 B;  4BY1 B;  2NVX B;  3KBG A;  1SYG A;  4P75 A;  3CCL A;  1KHI A;  1IXR A;  4L8J A;  1CA6 A;  4KI0 A;  4HSV A;  3H3V C;  1HH2 P;  1HNW L;  1Q8K A;  3RNU A;  3WOE A;  2EQS A;  1BBW A;  4A3K H;  1R4P B;  3MXP A;  1QVG A;  1ET9 A;  4MTN A;  3M7G A;  1RL2 A;  1KDB A;  1BOS A;  5FO7 B;  2NVQ B;  3H3V I;  1YNN C;  4AH6 A;  1A8V A;  4PZ7 A;  4LF4 L;  4GKK L;  2VQF L;  3VA5 A;  4IPD A;  3A8I E;  5IT9 L;  4A3E H;  1MGS A;  1SXT A;  4DUY Q;  3KLR A;  1WTR A;  4B3M Q;  1BCP D;  5ELC A;  2R93 B;  2JEA I;  4MIU A;  3D8G A;  1HTP A;  3GTG B;  4B3R Q;  1LYL A;  2JEB I;  4YY3 Q;  1T9H A;  4C3J G;  3PIP A;  2UUC Q;  2E5L L;  4TRD A;  2E75 C;  3MEH A;  3OIQ A;  3Q23 A;  3M4O H;  4QIW B;  4M1U B;  4JI8 Q;  2FFK B;  3CXC A;  3CCQ A;  4APV A;  1WCM G;  1SND A;  2Z8L A;  5DAU A;  3NQI A;  5L37 A;  3I4M B;  4LUZ A;  3RR5 A;  1TWC B;  3H0G B;  3S1M H;  1MSH A;  1ENC A;  2XVS A;  5C3E H;  3G48 A;  2JE6 I;  4RKL A;  1X32 A;  4MHE A;  3BZD B;  1QZH A;  5E3F A;  1F2Z A;  3GTQ H;  4DK6 C;  5M5W H;  2QW7 A;  3K7A B;  1Z7T A;  2PZT A;  4EQ5 A;  1K8A C;  1S3O A;  3R2T A;  5EGT A;  1N34 L;  1Y1W B;  1EWI A;  5GRO A;  4PMW A;  3CKI B;  3P7J A;  2A68 D;  3NTI A;  5IIF A;  4GLV B;  2MHV A;  1E1O A;  3GTM H;  1B1Z A;  1C9O A;  1LV9 A;  1O7Y A;  1PH3 A;  1F2L A;  5EKK A;  3D4W A;  2BDN A;  2JA5 B;  2PNR C;  3GD7 A;  3TN2 A;  4HED A;  1I4X A;  2YU9 H;  1EIH A;  1JWU D;  1KDC A;  4CJ2 C;  1CI3 M;  1IBM L;  1EFI D;  4CBV A;  4KJO A;  4RGN A;  4OWT B;  4A3L H;  1TS4 A;  1MD2 D;  1JOK A;  4HJA A;  4DV0 Q;  1YHA A;  4JI4 L;  3HOU H;  2DNE A;  3I8Z A;  3OPO A;  4K5X A;  1M1K C;  2QEJ C;  3MC0 B;  3RN5 A;  4G57 A;  1QB5 D;  4NMZ A;  4F87 A;  3FKI H;  3GTM B;  5AJ3 Q;  2M00 A;  4Y7N H;  1HNX L;  3MHB A;  4DF7 A;  2HD3 A;  4LF5 Q;  4PG3 A;  2QIL A;  3CC7 A;  1FJG L;  2Y0S G;  4BBS H;  4PQX A;  1R9T H;  2PPB C;  1K0S A;  3J81 c;  4LF7 L;  1SE2 A;  1B53 A;  1HZB A;  4DV7 L;  1A3T A;  3ULL A;  5CMD A;  1BF4 A;  3M3Y B;  2YTY A;  4EX5 A;  2MJ8 A;  3GDE A;  3K59 A;  1ESF A;  1VQM A;  2X6L A;  1MJE A;  1BDO A;  1X3F A;  1X9N A;  1N32 L;  2KHJ A;  3ND9 A;  4BS9 A;  4YHH L;  1A3V A;  1QNK A;  3HOW G;  4GKJ Q;  4C1N I;  1TR5 A;  1HA6 A;  4YIJ A;  3H91 A;  3M4P A;  1F77 A;  1R9T B;  1I3Q B;  1EOV A;  1PZJ D;  3UDG A;  4GNX A;  1N36 Q;  1PRT C;  2LMC B;  1U4R A;  1SMY D;  1A15 A;  2F0G A;  4ZUJ A;  4AYB G;  1IBL L;  2XRS D;  1E22 A;  2ICI A;  3TDQ A;  1Y8N B;  1YHB A;  2NN6 G;  1UE6 A;  2EYH A;  5C5L A;  2E8G A;  4BBR B;  2RDH A;  1GUN A;  3VR3 A;  3KUP A;  4IOA A;  1QIL A;  1Z47 A;  2MP1 A;  3RZD B;  1T5X D;  1STA A;  4J15 A;  3LWU A;  2DGY A;  4GNX B;  1SJH D;  2R7F A;  4N9P A;  4X6A H;  3R93 A;  3H09 A;  4L6T B;  1JJG A;  1NTG A;  3QO2 A;  1X6O A;  4OIK A;  1Y1V B;  2IJ0 A;  4XXE A;  2IL8 A;  4X66 L;  3HOV G;  1O80 A;  4WJW A;  1WTV A;  1Q86 C;  5FO8 B;  4FF3 A;  1VF5 C;  5J3B A;  1UNS A;  1SYC A;  3HS0 C;  5EPJ A;  3M7N A;  1G51 A;  2WV6 D;  1GXD C;  1GUS A;  3EVQ A;  4DFA A;  5KRU A;  3KDF B;  2OTL A;  5I2X A;  3TRZ A;  2JSO A;  5DEH A;  4A3B H;  1PH4 A;  5COY A;  3MVV A;  1HZA A;  5LL6 X;  1VQK A;  2ZJR A;  2F03 A;  4C1N K;  3G6J B;  3ONA B;  1I94 Q;  2UUB L;  4CDF C;  4B9W A;  4A3I H;  2CKZ B;  4JCV E;  4UPA A;  3RD4 A;  1PTO F;  2VUM G;  3PO3 B;  2AQ3 B;  2CH4 A;  1VQ7 A;  2B2W A;  2VZA A;  4K2K A;  3BDO A;  5FOB B;  1YIT A;  3HKZ E;  1KRS A;  3TRE A;  2PI2 A;  4P2C B;  4GNX C;  3S1N H;  4RHR A;  4A4I A;  3S15 B;  4JOI C;  1RDP D;  3VYS A;  3HOY G;  2K5N A;  5IOD A;  2D62 A;  5CV4 A;  4A3M B;  2A19 A;  4A3I B;  4JBW A;  1DD2 A;  5D3D A;  4F88 A;  1L1O A;  1E0B A;  2PQA A;  4QIW E;  1X56 A;  3MA2 B;  2X6G A;  4X65 Q;  4FF1 A;  4A93 B;  4OO1 H;  4I65 A;  4OHJ A;  5CR3 A;  1RCV D;  5E1F A;  2QGQ A;  4A3D H;  2HHH Q;  1DZ1 A;  2O4X A;  3GTL B;  5JEA H;  2F0U A;  1CZG A;  1STN A;  3UE1 A;  4Q5V A;  3HFZ B;  5DM7 3;  3PGZ A;  1L1O B;  5GAE C;  1AE3 A;  5GAG C;  2PQA B;  4NW2 A;  4DR4 Q;  3FP9 A;  3PIP 3;  1UAP A;  1EQR A;  1JB7 A;  3OOC A;  4DUY L;  1G6P A;  4A3J G;  2OEO A;  5LMU Q;  4DK3 C;  1STB A;  3JAM c;  1IYJ B;  2A68 C;  3PO2 H;  4B3R L;  1CKN A;  4YY3 L;  1K8O A;  2O2L D;  2VS1 A;  1U4P A;  4K6D A;  4IUV A;  3CAM A;  3S2D H;  2A8V A;  5DLQ E;  4KD3 A;  3FKI G;  3W5O A;  4ZAI A;  3I90 A;  1XX8 A;  4QMG A;  3HOX B;  3U4V A;  3HOZ H;  5K36 G;  1F2M A;  4UDU C;  4JI8 L;  1PRT F;  3LX0 A;  3I3C A;  2ATW A;  1SYB A;  5A35 A;  5LL6 S;  4QGU A;  4BBS G;  1EFW A;  2K75 A;  1GOZ A;  1JR0 D;  1ZEQ X;  4LF4 Q;  1BKB A;  2VQF Q;  2F0N A;  1K28 A;  1PH1 A;  2WAQ B;  1A2T A;  1YVC A;  3C2P A;  3MEF A;  4DV2 L;  5LHY 1;  2F0P A;  4LUO A;  1D5Z C;  3CD6 A;  5IYC H;  3S16 H;  4LFB Q;  3UDF A;  1SEB D;  3E9I A;  2E5L Q;  2E2D C;  5GAH C;  4H13 C;  1PH6 A;  5EBD A;  4R8N A;  2Z9H A;  4RG1 A;  1LT5 D;  1CM9 A;  3F2B A;  1V9P A;  1L1O C;  1I6V C;  1SNP A;  4A3G H;  2EDG A;  2TSS A;  1KL9 A;  1WD1 A;  2PMZ B;  1QOH A;  4TKO B;  3CQZ H;  5KEE A;  4OIJ A;  3GTP H;  1QNU A;  1B9N A;  2L5T A;  4L5Q A;  1O78 A;  1YNN D;  1L0W A;  4L63 B;  3KK7 A;  4DV0 L;  4A3F H;  3T53 B;  4GZY C;  3K57 A;  1Z9F A;  3PV0 A;  2OXP A;  4ODG A;  5C3X A;  2IX1 A;  1N34 Q;  1VMC A;  2UXD L;  1QJO A;  1I4P A;  3NEN A;  4B9X A;  3HZX A;  3HG9 A;  1SMY C;  1NNX A;  4X3K A;  3BVZ A;  4QCL A;  1SSO A;  1HJP A;  5BN3 A;  4LF5 L;  5C0X H;  2ASB A;  5D65 A;  2MUY A;  1HUM A;  2K5D A;  1B8A A;  1X3P A;  3EBE A;  3GTP B;  4UAI A;  1LUZ A;  3FRP B;  3NWT A;  4JC0 A;  1TVX A;  3K6O A;  2RA4 A;  3CCR A;  2C9O A;  3RN2 A;  4LF8 L;  4DR5 L;  4H02 A;  1SLJ A;  1JT8 A;  4ZLT F;  4HTH A;  1J5E L;  1Q7Y C;  1E2W A;  1EY7 A;  1PZK D;  1IBM Q;  1I6H H;  2R61 A;  2K05 A;  1MKH A;  1PH9 A;  2Z0S A;  4XQN A;  4DUZ Q;  4JI4 Q;  1SJE D;  2WP8 J;  4A3B G;  4GKJ L;  1CA5 A;  1M4V A;  1EIF A;  2QDB A;  2J4X A;  1I4R A;  4PV1 C;  2KVM A;  4LW1 A;  3IAY A;  3C3L A;  1VQC A;  1H9M A;  5FLM H;  2EJG C;  3PMF A;  4RFB A;  1FJG Q;  3I4N H;  2RDF A;  1N36 L;  1EY5 A;  1F2Y A;  1PTO D;  2RSN A;  5IYB H;  2V1C C;  4AQY L;  4LF7 Q;  5JVH 3;  2HIV A;  3PF4 A;  1KNA A;  2L15 A;  3GTO B;  1SE3 A;  3E3X A;  3TQY A;  3PSI A;  4CKB A;  2EYM A;  4H0L C;  1OO9 B;  1AZP A;  1XMQ L;  2JA7 G;  1N32 Q;  4DR3 L;  1VCI A;  4YHH Q;  5CBA E;  1GUO A;  4K2L A;  1K9M C;  4E6I A;  2L0C A;  3T13 A;  3TP6 A;  4RGT A;  2M2L A;  3U58 A;  3G6E A;  5KYL A;  4DNR B;  3L0O A;  3H3V H;  2XSC A;  4OO1 G;  2NTS A;  1ONL A;  1X54 A;  1JQY D;  3KF6 A;  4ZRZ A;  1KNE A;  4FF4 A;  3A7A B;  4J6H A;  4N9T A;  4LMQ D;  3GQB A;  2R7Z H;  3PUY A;  4G4K A;  1CK1 A;  3OWE B;  1EYC A;  3D6C A;  5H1S E;  1WCM B;  4O2D A;  3OMG A;  1U9R A;  2QF7 A;  5K5P A;  3UDX A;  2PI2 E;  5C4X H;  1VQE A;  3KF6 B;  1ESR A;  4C3I G;  3RZO H;  2XWJ B;  5M3F H;  3CRK C;  3NK9 A;  5ELE A;  2GVB A;  1I94 L;  1HR0 L;  2R92 H;  4IFD H;  1O7Z A;  4C3H G;  1CKM A;  3BS1 A;  5GAD C;  2XWB B;  2K1B A;  3K5L A;  1Y8O B;  5KND A;  3AEV A;  1PZI D;  1FYC A;  2JA8 G;  1EIG A;  2SNM A;  1D5M C;  1EUJ A;  4LUV A;  2RHS B;  5JOB A;  3A8J E;  4QL5 A;  1FNW A;  3FHW A;  1WTW A;  4JI1 Q;  2VB3 X;  4OGQ C;  1TT2 A;  3T1Y L;  1V1O A;  1PH8 A;  3A5U A;  1PRT D;  3CU7 A;  1STH A;  2K7V A;  3CCJ A;  3OSO A;  4RKB A;  3K5N A;  5BR8 Q;  4RCO A;  1NCV A;  2NVX H;  4BY1 H;  5IGG A;  3R8B A;  4MZ9 A;  5M3F B;  2JYO A;  2MNA A;  5IWA L;  1WFQ A;  2JP1 A;  1U0L A;  1STY A;  4F8M A;  3KLS X;  3Q0A A;  1LLR D;  2N88 A;  5KYI A;  3KLW A;  2HHH L;  4DPG A;  5CBE E;  4QF4 A;  1T5E A;  2XIW A;  1IKM A;  1PH2 A;  1OXV A;  1FVI A;  3TSS A;  4RMF A;  2Q2H A;  4DR4 L;  1BR9 A;  1AN8 A;  2WAQ E;  2D9U A;  5J22 A;  1EYA A;  2AHO B;  5LMU L;  1A6X A;  1D8L A;  1Z6H A;  1R4Q B;  5C6A A;  1QUQ A;  2R93 H;  3HRZ C;  3S14 B;  2VNU D;  1XPU A;  1NSN S;  2HCC A;  5T1I A;  2JA6 G;  3GTG H;  4Y52 H;  4KTA A;  3FVQ A;  2K14 A;  3BJU A;  1JWM D;  3BU2 A;  1WYD A;  4N8F A;  4DR7 Q;  2IW3 A;  4OL7 A;  2FJ2 A;  3K80 C;  2E2J B;  3W1G A;  3F8T A;  1PTO B;  2PMZ E;  4ALP A;  4JG2 A;  2JJQ A;  2NZH A;  2PCF B;  1QUQ B;  1EIY B;  2D5D A;  4IUN A;  3J80 E;  3I4M H;  3UE0 A;  1WTX A;  1TWC H;  1K8G A;  3H0G H;  1SYE A;  5E4W C;  3H15 A;  3IKJ A;  4LFB L;  1KAA A;  1VS0 A;  3DWQ A;  2DJG C;  1RJT A;  3K7A H;  4K8J A;  5J1Z A;  1B7Y B;  3TBI B;  4DV5 L;  3TZD A;  1Y1W H;  4HN7 A;  5FLM G;  2NUC A;  5C44 G;  1RKN A;  3J7A F;  1SNO A;  3I70 A;  1W6J A;  3ND8 A;  5IYB G;  4BY7 G;  1ILQ A;  1KQS A;  1JC7 A;  1TXY A;  3HOV B;  1SE4 A;  4JI0 L;  1VQB A;  4POG A;  2JA5 H;  2HQL A;  3J7A 5;  1I5F A;  2VL6 A;  2I07 B;  4IUT A;  4X3S A;  4DV2 Q;  4IUR A;  2K32 A;  4R4O A;  4ZQ3 A;  2EOT A;  2KCC A;  2PQE A;  2HCI A;  4K6L A;  4QUF A;  4XIG S;  1PTO C;  2EJF C;  4L5R C;  2MGS A;  2L1B A;  4IPG A;  1JMC A;  1QVC A;  1GD7 A;  3FDT A;  2O5I C;  2L11 A;  1X55 A;  3RLF A;  2E2H B;  2OQ0 A;  4ZK9 B;  1E2V A;  1TQO A;  1Q82 C;  2H1E A;  1LTB D;  2B2U C;  4MNO A;  3J80 L;  2VUM B;  1GO3 E;  3DHQ A;  5M5X B;  2RQX A;  1PRT B;  4JV5 L;  1RHP A;  2NVY B;  4FDB A;  1PFM A;  3T51 B;  2KJX A;  1QZG A;  4OX9 L;  1K83 B;  5M3M B;  2GVA A;  4DUZ L;  2CQO A;  3E5S A;  3IFD A;  2IT1 A;  3M3Y H;  1NMF A;  4U68 A;  5ELB A;  1ZKO A;  3HOY B;  2UXD Q;  1HNZ Q;  2NN6 I;  2EYO A;  4IFD G;  2K04 A;  5IP9 G;  3D0F A;  1U4L A;  3F1Z A;  3DXJ C;  1I3Q H;  1BVS A;  1OXT A;  2D0O A;  2K5H A;  2DY8 A;  1I4G A;  4JI3 L;  3NWS A;  3VR2 A;  2F1M A;  4OWX B;  1XTD A;  4RCN A;  4LF8 Q;  2I46 A;  2JA9 A;  2K5Q A;  3BVG A;  5CYU A;  4DR5 Q;  5ELN A;  5FLX c;  1CQV A;  1J5E Q;  2ID0 A;  4HAE A;  1NE3 A;  2QKI C;  4BBR H;  4X3U A;  1U5K A;  1HUN A;  3MTS A;  2B8F A;  4PZ6 A;  3RZD H;  2UXC L;  5EJW A;  3WWV A;  1CQF A;  3P20 A;  2B2V A;  4A3J B;  2Q2U A;  2M9V A;  1K8M A;  4DAM A;  3MFG A;  3QR8 A;  2NZO A;  2F0V A;  1G29 1;  1ROD A;  1Q12 A;  4I7Z C;  3PIO A;  3NUC A;  4FNF A;  3A8K E;  4NXN L;  1NY4 A;  3NBI A;  4JOI A;  1Y1V H;  1AFP A;  2IY5 B;  1HZC A;  5E4X A;  2EE1 A;  5T1G A;  3S2H B;  4LK1 C;  3U9S A;  4AQY Q;  1TWF B;  1PV4 A;  2KEC A;  2K5W A;  1VQF A;  5TSS A;  1EY6 A;  2WKD A;  3J81 E;  2L55 A;  3HKZ G;  5LMN L;  1XMQ Q;  4FO2 A;  1G2S A;  1FD7 D;  3VA7 A;  2WIN B;  4JI2 Q;  3ULP A;  4DR3 Q;  3G4S A;  5CGK A;  1PXU A;  1YNX A;  3K0X A;  2R93 G;  1E3P A;  3OIP A;  3W2D A;  4PMB A;  4A3K G;  4CKC A;  4EQN A;  1CKO A;  3K0Y A;  1NUC A;  3KDF A;  1C8C A;  1RTO A;  3PO3 H;  1HRJ A;  1SFO B;  3CCM A;  1GKH A;  3SE0 A;  3L9A X;  2R3Z A;  5EPL A;  2CWA A;  3I2Z A;  3RLN A;  4FXD A;  2PZW A;  2EYL A;  2ES2 A;  1PVO A;  4JI1 L;  4IFD J;  4UP9 A;  3J81 j;  1QVF A;  4BXX H;  2EVB A;  5BR8 L;  4A3E G;  3I4M G;  3TME A;  5IGD A;  3S15 H;  3ERO A;  1XNR Q;  3MWY W;  3NHH A;  3MAQ A;  1BXT A;  1UE1 A;  4BA2 I;  1UE5 A;  1UE7 A;  2ALY B;  2EYF A;  5EKI A;  5IGE A;  4QB4 A;  1B4O A;  4A3M H;  1HR0 Q;  3SK8 A;  2LKV A;  1IW7 C;  4XQJ A;  1SAP A;  1STE A;  3CCE A;  3M85 A;  4YCW A;  2V4D A;  4H44 C;  1Y1W G;  4A93 H;  2B2V C;  3TEH B;  1YIJ A;  4GLA C; 
#chains in the Genus database with same CATH homology
 3J81 L;  1CTM A;  4IQZ A;  5C4J B;  3QWN A;  2F0Q A;  1C4Q A;  2RDG A;  3T4A C;  4ZKC B;  2FMM A;  1SNM A;  1FGB D;  2KA7 A;  5I9O A;  1H9J A;  3SEB A;  2CQA A;  4G7O C;  1S5E D;  5C4Z A;  2F0T A;  3VYT A;  4DU9 A;  5I9P A;  1JOR A;  2VB2 X;  3NTH A;  2WAC A;  3WOF A;  1JWS D;  2K33 A;  5HGT A;  3E6Z X;  1HHV A;  4ID6 A;  2SNS A;  1D6E C;  1NAP A;  3SVM A;  3OMC A;  4ZYS A;  3MXG A;  5FK9 C;  3KLS A;  4IUP A;  1TWH B;  1Q1B A;  5CV7 A;  3WDN A;  2A6H C;  1KLU D;  3G7L A;  3PUZ A;  2QCP X;  3X3M A;  4HCE A;  4XYQ A;  1CHP D;  3A56 A;  2BOS A;  2KOL A;  5JAV A;  1BUV T;  3S1R B;  4KD4 A;  2NZ1 D;  2J7Z A;  2ICE C;  4Z9C B;  3BYT B;  3JAM E;  1EZ6 A;  2K28 A;  4C3I B;  1JB3 A;  4C3H B;  2B63 B;  4S3S A;  3QJY A;  1AW7 A;  4FYD A;  1Q8I A;  2JA8 B;  3S17 B;  1B44 D;  2A69 D;  1H9R A;  4K8I A;  2E2I B;  1ICW A;  4IAL A;  2N55 A;  3GTK B;  1HFG A;  2BCO A;  4O42 A;  5F2D A;  3RMH A;  1OXS C;  5ELF A;  5C5M A;  4IN3 A;  4ZUI A;  1PFN A;  1SNQ A;  4FF2 A;  3QB3 A;  1DYQ A;  1DOL A;  3PIO 3;  2Z1C A;  4K14 A;  2O5J C;  1S5C D;  4OO1 I;  4O1N A;  1TWG B;  1HXY D;  3JAM L;  5ISR A;  3PUV A;  1QE6 A;  3URY A;  3HP3 A;  3KBX A;  2IX3 A;  1G2T A;  1XTC D;  1PDQ A;  3OW7 A;  4DAP A;  5IGF A;  4FVM A;  4DK1 A;  1SBB B;  3W3A A;  2DN8 A;  2OF1 A;  2Q8T A;  2JA6 B;  2RKS A;  3E0J A;  5KNC A;  1EOT A;  3SHL A;  1TKW B;  5D14 A;  2B39 A;  3HEJ A;  2F0J A;  3UI2 A;  2XRQ D;  2IWH A;  2ZXP A;  1PFB A;  3SXH A;  4HCS A;  3D3R A;  1J8I A;  2WKC A;  1ML0 D;  2EJM A;  4Q0F A;  1DOM A;  2K6A A;  2TMP A;  3T16 A;  5M9O A;  4PMC A;  4C3J B;  4J1M A;  2XNA C;  1XWE A;  5EPK A;  5FKA C;  4EQO A;  1A2U A;  1GUW A;  5JEA G;  1I4Q A;  2D2C C;  2F3W A;  1B9M A;  1J9O A;  2AWN A;  1I50 B;  1U4M A;  5C44 B;  4V19 0;  1TU2 B;  4BY7 B;  1LTT D;  3R2I A;  1NR4 A;  5M5Y B;  2F0E A;  2F3V A;  2J0T D;  2NVT B;  4TQU S;  1LT3 D;  2RSO A;  2HUG A;  5CV9 A;  1XXG A;  5KGU A;  1DJR D;  1DOK A;  2F4I A;  5DNF A;  2AUK A;  1TY2 A;  2PZU A;  1LT4 D;  2NBF A;  2G9D A;  3C1E A;  4ZKB B;  4XTC S;  2E74 C;  1STG A;  1KLG D;  2EXZ A;  1JOQ A;  4IUQ A;  4FP5 D;  1G91 A;  2F0D A;  4C2M B;  2K03 A;  3I4L A;  3L3O C;  1Y8P B;  3GTJ B;  2PW7 A;  4FXG C;  3EFX D;  5DM6 3;  1GHK A;  3QG1 A;  2KUM A;  1TWA B;  5J39 A;  3FEW X;  2BE5 C;  1PTO H;  2NB0 A;  3ZYY X;  2Q8R E;  2Y0S B;  1QG7 A;  3N52 A;  5JEA J;  3C46 A;  1PYW D;  1F9R A;  3BVM A;  3R3O A;  2AUJ D;  4KN7 C;  4R8I A;  3HGB A;  1GHJ A;  2NN6 H;  4KHZ A;  4DGZ A;  2B2U A;  1EY4 A;  5C4H A;  3GP7 A;  1HPC A;  2X69 A;  2FIN B;  3HOW B;  1EZ8 A;  1KTK A;  1W6K A;  4HMJ A;  5C0X G;  4KY5 A;  1BQQ T;  3U9O A;  5I2Y A;  1IW7 D;  2PW5 A;  1HTL D;  1AEX A;  2FHT A;  2R6G A;  3VR4 A;  2A69 C;  1FR3 A;  3M4Y A;  1ZYR D;  3DWA A;  1D5X C;  4AYB B;  3RUZ A;  3ERQ A;  3SK4 A;  2ENB A;  2YYZ A;  1DXM A;  1GJX A;  1BNZ A;  4IZ8 A;  4ULL A;  1DON A;  5BN4 A;  4ABN A;  3HKZ B;  3EA6 A;  1IYU A;  3PUX A;  4CHT B;  3VYU A;  2LFN A;  4TSS A;  3MXN A;  4A3K B;  3DM1 A;  4J8Q A;  2A74 C;  3SDZ A;  1C48 A;  4H7B A;  3NTK A;  4IFD I;  1IKL A;  2HDL A;  5CC4 A;  3S1Q B;  1UUP A;  2EY5 A;  4C56 C;  3K58 A;  1EY0 A;  4A3E B;  3Q24 A;  3GV6 A;  3Q6S A;  4CGY B;  3DWP A;  3I73 A;  4EQP A;  3H94 A;  2IX0 A;  4JK1 C;  2F0H A;  3MXU A;  5D3I B;  1VF7 A;  3DEP A;  2GA4 B;  3TP8 A;  3D4R A;  2Q8I B;  5JPM C;  3M4O B;  5C0X J;  4G7H C;  4R9W A;  1ZXT A;  2K01 A;  1EWH A;  4DAY A;  2A6H D;  4V0B A;  1EY8 A;  3V96 A;  2CHB D;  1PLF A;  1EEF D;  3S1M B;  2SOB A;  3AB9 A;  5C3E B;  5COR A;  4X3T A;  2RVL A;  2LY7 A;  1TII D;  3GTQ B;  5M5W B;  1G8Z D;  4IUU A;  2JXM B;  1LT6 D;  5EQ0 A;  2WII B;  5IGB A;  3EJI A;  1HQR D;  1ENA A;  4U67 3;  5K36 H;  1Q90 A;  2CW0 D;  1Y69 U;  3BYY B;  4XDX A;  2YU9 B;  5G3L D;  1S5B D;  4F7X A;  5CV8 A;  4WFN 3;  2L4N A;  2RBM A;  2AQ2 B;  3NBH A;  2NYZ D;  3HOU B;  3QIA A;  4MN3 A;  2A6E D;  5A2Q E;  5JVG 3;  4G7Z C;  4RGO S;  1DCZ A;  3FKI B;  4DK0 A;  2KHS A;  4Y7N B;  1D1K A;  1BO0 A;  3GO5 A;  4DNT B;  1HQM C;  3P75 A;  3NXW A;  2IPK D;  1EWC A;  5IOC A;  4FXK C;  4BBS B;  1II3 A;  1EU3 A;  2KQ3 A;  3LNN A;  3NPP A;  5JPN C;  2EZV A;  1QCB D;  2XN9 C;  3NSW A;  2BDO A;  5FLX E;  3SR1 A;  2EPB A;  2ZXO A;  1ET6 A;  1GUG A;  2EYJ A;  4DAV A;  1BCP B;  1EQT A;  4CJ0 B;  1F9P A;  1G6Z A;  3VR6 A;  3GV3 A;  1V43 A;  3A7L A;  2Z4H A;  4KV6 A;  1LTG D;  3BG3 A;  2DY7 A;  4RH6 A;  4HSP A;  1JCK B;  5EBC A;  2WB1 B;  3TZU A;  5KIX A;  2Z4I A;  2B2Y A;  2OT2 A;  1YNJ D;  5A2Q L;  2LS0 1;  3O13 A;  3VR5 A;  1M8A A;  1HCZ A;  3L7Z C;  3J7A V;  2BA0 A;  4XT3 B;  3OHX C;  1ZYR C;  5CV6 A;  4LJZ C;  2EY2 A;  4KKU A;  1QWY A;  3K5O A;  1F9S A;  1WVL A;  1ILP A;  1O7L A;  5FLX L;  4XQQ A;  1EEI D;  2ZT9 C;  4KMU C;  3V05 A;  3ITP A;  3D6W A;  4HMI A;  3FPP A;  1BCP C;  1MI2 A;  4A3B B;  1FNV A;  5AFW A;  3CRL C;  2H4O A;  3Q22 A;  5I6Y A;  1Q3L A;  4K5W A;  2L9H A;  4PNY A;  3SK5 A;  1EU4 A;  5ELD A;  4RWS C;  3S1N B;  3K5M A;  3P1H A;  3DMU A;  4CKE A;  5BN5 A;  2JA7 B;  2F0O A;  1I4H A;  4WRD A;  3D31 A;  2B2Y C;  1ENF A;  1HA5 A;  2F0M A;  3N6R A;  3MFY A;  2EYP A;  3BDC A;  4KHV A;  2BE5 D;  3FPU B;  4DN4 M;  1VMP A;  2E76 C;  4A3D B;  3VYR A;  1AZQ A;  3LWE A;  1EYD A;  2B2T A;  3SK6 A;  3TP7 A;  1MSG A;  1HFN A;  4NKL A;  2B2W C;  1B50 A;  3V2T A;  3NQT A;  1JIC A;  1NR2 A;  3PO2 B;  3A55 A;  1LAC A;  3NE5 B;  1OXX K;  3MZ5 A;  3S2D B;  4KKT A;  2F0I A;  3HOZ B;  2NTT A;  1IYV A;  2CW0 C;  1LAB A;  1RD9 D;  3EQL C;  5I4D A;  1LO5 D;  1EY9 A;  2EY1 A;  2A6E C;  1WTQ A;  3CHB D;  4KK7 A;  3S16 B;  1B2T A;  1KDA A;  2PYK A;  4QUC A;  1XYI A;  1E2Z A;  3KF8 A;  1EL0 A;  1Q1E A;  1SYD A;  3D4D A;  3J7Y W;  4XT1 B;  2ZXR A;  3PUW A;  3OWF A;  2DNC A;  4WOR A;  2SDF A;  4A3G B;  1S5F D;  3S9W A;  2MPM A;  3CQZ B;  3C1F A;  1WTP A;  2KEE A;  4NP5 A;  3T56 B;  4HR7 B;  1IHZ A;  1WTO A;  2B2T C;  4KJN A;  4M8A A;  1BCP F;  1PMR A;  1RTN A;  4A3F B;  4K5V A;  1IL8 A;  1B3A A;  2NWG A;  3H6M A;  4CJ1 B;  1UEA B;  1LTS D;  3F2U A;  1FNU A;  5KNB A;  4KKS A;  1JOO A;  1D2B A;  2KED A;  1V8Q A;  1CT1 D;  4RAU C;  4DA2 A;  4EGV A;  4NDX A;  1TS3 A;  1BBX C;  1YNJ C;  2SEB D;  2KCN A;  3BDL A;  3DUZ A;  1TY0 A;  1OXU A;  1I6H B;  1LTI D;  4ILW A;  1TS2 A;  2B8G A;  1V1P A;  5IGC A;  2G9H D;  2F0K A;  5FO9 B;  1CHQ D;  3FMC A;  1JE4 A;  2EY6 A;  1GUT A;  2F0L A;  2HQE A;  3QOL A;  3I4N B;  1TS5 A;  1CZW A;  4DXG A;  1V1P B;  4ME5 A;  3X3N A;  2VXW A;  2F0S A;  1LTR D;  3AU7 A;  1S4Z A;  1D1I A;  4RGM A;  2CVR A;  5HUR A;  3AMU A;  1L0Y B;  1MBY A;  2AWO A;  1F9Q A;  3QOJ A;  5C3W A;  1WD0 A;  1KAB A;  1A3U A;  1S5D D;  1X3Q A;  3DEO A;  1LTA D;  3IL8 A;  4LAA A;  2AQ1 B;  1SDF A;  5G3L F;  5I6W A;  4KY6 A;  1SNC A;  2C5C A;  4KY7 A;  4KN4 C;  5C0X I;  3TP5 A;  3IFT A;  2R7Z B;  4B08 A;  4BWG B;  2BA1 A;  1EQV A;  4RHS A;  2HDM A;  2L12 A;  5NUC A;  2FMC A;  3A54 A;  5C4X B;  4BA1 I;  1H9S A;  3RZO B;  5IT9 E;  1SYF A;  2R92 B;  3I72 A;  4XYO A;  1VDZ A;  2PO4 A;  4RA8 A;  3I91 A;  1AP0 A;  1RF2 D;  3NP8 A;  2F0W A;  1H9S B;  1DM0 B;  4EVO A;  2F0F A;  4DXF A;  5JJZ A;  2A5H A;  1L0X B;  1H9K A;  5EKL A;  5CV5 A;  1CFM A;  2A73 B;  4BY1 B;  2NVX B;  3KBG A;  1SYG A;  4L8J A;  1CA6 A;  4KI0 A;  4HSV A;  3H3V C;  3WOE A;  1R4P B;  3MXP A;  1ET9 A;  3M7G A;  1KDB A;  1BOS A;  5FO7 B;  2NVQ B;  1YNN C;  3VA5 A;  3A8I E;  5IT9 L;  1MGS A;  1SXT A;  3KLR A;  1WTR A;  1BCP D;  5ELC A;  2R93 B;  2JEA I;  4MIU A;  3D8G A;  1HTP A;  3GTG B;  2JEB I;  4C3J G;  4TRD A;  2E75 C;  3MEH A;  3OIQ A;  3Q23 A;  4QIW B;  4M1U B;  2FFK B;  1SND A;  2Z8L A;  5DAU A;  3NQI A;  3I4M B;  1TWC B;  3H0G B;  1MSH A;  1ENC A;  2XVS A;  2JE6 I;  4RKL A;  1X32 A;  4MHE A;  3BZD B;  5E3F A;  1F2Z A;  3K7A B;  1Z7T A;  2PZT A;  3R2T A;  5EGT A;  1Y1W B;  4PMW A;  3CKI B;  3P7J A;  2A68 D;  3NTI A;  5IIF A;  2MHV A;  1B1Z A;  1LV9 A;  1O7Y A;  1F2L A;  5EKK A;  3D4W A;  2BDN A;  2JA5 B;  2PNR C;  3GD7 A;  3TN2 A;  4HED A;  1I4X A;  1EIH A;  1JWU D;  1KDC A;  4CJ2 C;  1CI3 M;  1EFI D;  4CBV A;  4KJO A;  4RGN A;  1TS4 A;  1MD2 D;  1JOK A;  2DNE A;  3I8Z A;  3OPO A;  4K5X A;  2QEJ C;  3MC0 B;  4G57 A;  1QB5 D;  4NMZ A;  4F87 A;  3GTM B;  2M00 A;  3MHB A;  4DF7 A;  2QIL A;  4PQX A;  2PPB C;  1SE2 A;  1B53 A;  1A3T A;  5CMD A;  1BF4 A;  3M3Y B;  2MJ8 A;  3K59 A;  1ESF A;  2X6L A;  1BDO A;  3ND9 A;  4BS9 A;  1A3V A;  1QNK A;  4C1N I;  1TR5 A;  1HA6 A;  4YIJ A;  3H91 A;  1F77 A;  1R9T B;  1I3Q B;  1PZJ D;  1PRT C;  2LMC B;  1U4R A;  1SMY D;  1A15 A;  2F0G A;  4ZUJ A;  2XRS D;  2ICI A;  3TDQ A;  1Y8N B;  2NN6 G;  2EYH A;  5C5L A;  4BBR B;  2RDH A;  1GUN A;  3VR3 A;  3KUP A;  1QIL A;  1Z47 A;  2MP1 A;  3RZD B;  1T5X D;  1STA A;  3LWU A;  1SJH D;  4N9P A;  3R93 A;  3H09 A;  4L6T B;  3QO2 A;  4OIK A;  1Y1V B;  2IJ0 A;  4XXE A;  2IL8 A;  1O80 A;  4WJW A;  1WTV A;  5FO8 B;  4FF3 A;  1VF5 C;  1UNS A;  1SYC A;  3HS0 C;  5EPJ A;  3M7N A;  2WV6 D;  1GXD C;  1GUS A;  3EVQ A;  4DFA A;  5KRU A;  5I2X A;  2JSO A;  5DEH A;  5COY A;  3MVV A;  5LL6 X;  2F03 A;  4C1N K;  3G6J B;  3ONA B;  4B9W A;  3RD4 A;  1PTO F;  3PO3 B;  2AQ3 B;  2B2W A;  4K2K A;  3BDO A;  5FOB B;  4P2C B;  4RHR A;  3S15 B;  1RDP D;  3VYS A;  5IOD A;  2D62 A;  5CV4 A;  4A3M B;  4A3I B;  4JBW A;  1DD2 A;  5D3D A;  4F88 A;  1E0B A;  3MA2 B;  2X6G A;  4FF1 A;  4A93 B;  4OO1 H;  4I65 A;  4OHJ A;  5CR3 A;  1RCV D;  5E1F A;  1DZ1 A;  2O4X A;  3GTL B;  5JEA H;  2F0U A;  1CZG A;  1STN A;  4Q5V A;  5DM7 3;  4NW2 A;  3PIP 3;  1UAP A;  3OOC A;  2OEO A;  1STB A;  2A68 C;  1K8O A;  2O2L D;  1U4P A;  4K6D A;  4IUV A;  4KD3 A;  4ZAI A;  3I90 A;  1XX8 A;  4QMG A;  3HOX B;  5K36 G;  1F2M A;  4UDU C;  1PRT F;  3LX0 A;  3I3C A;  1SYB A;  5A35 A;  5LL6 S;  1GOZ A;  1JR0 D;  1ZEQ X;  2F0N A;  2WAQ B;  1A2T A;  3C2P A;  5LHY 1;  2F0P A;  1D5Z C;  1SEB D;  2E2D C;  4H13 C;  5EBD A;  4R8N A;  1LT5 D;  1CM9 A;  1I6V C;  1SNP A;  2EDG A;  2TSS A;  1WD1 A;  2PMZ B;  1QOH A;  4TKO B;  5KEE A;  4OIJ A;  1QNU A;  1B9N A;  2L5T A;  1O78 A;  1YNN D;  4L63 B;  3KK7 A;  3T53 B;  4GZY C;  3K57 A;  3PV0 A;  2OXP A;  4ODG A;  5C3X A;  2IX1 A;  1VMC A;  1QJO A;  1I4P A;  4B9X A;  3HZX A;  3HG9 A;  1SMY C;  4X3K A;  3BVZ A;  4QCL A;  1SSO A;  5BN3 A;  5C0X H;  5D65 A;  2MUY A;  1HUM A;  2K5D A;  1X3P A;  3GTP B;  4UAI A;  3FRP B;  3NWT A;  1TVX A;  3K6O A;  2RA4 A;  2C9O A;  4ZLT F;  4HTH A;  1E2W A;  1EY7 A;  1PZK D;  2R61 A;  2K05 A;  4XQN A;  1SJE D;  2WP8 J;  1CA5 A;  1M4V A;  2QDB A;  2J4X A;  1I4R A;  4PV1 C;  2KVM A;  3IAY A;  3C3L A;  1H9M A;  2EJG C;  3PMF A;  4RFB A;  2RDF A;  1EY5 A;  1F2Y A;  1PTO D;  2RSN A;  5JVH 3;  1KNA A;  3GTO B;  1SE3 A;  4CKB A;  2EYM A;  4H0L C;  1OO9 B;  1AZP A;  1VCI A;  5CBA E;  1GUO A;  4K2L A;  4E6I A;  2L0C A;  3T13 A;  3TP6 A;  4RGT A;  2M2L A;  5KYL A;  4DNR B;  2XSC A;  4OO1 G;  2NTS A;  1ONL A;  1JQY D;  4ZRZ A;  1KNE A;  4FF4 A;  3A7A B;  4J6H A;  4N9T A;  4LMQ D;  3GQB A;  3PUY A;  4G4K A;  1CK1 A;  3OWE B;  1EYC A;  3D6C A;  1WCM B;  3OMG A;  1U9R A;  2QF7 A;  5K5P A;  1ESR A;  4C3I G;  2XWJ B;  3CRK C;  3NK9 A;  5ELE A;  4IFD H;  1O7Z A;  4C3H G;  3BS1 A;  2XWB B;  2K1B A;  3K5L A;  1Y8O B;  5KND A;  1PZI D;  1FYC A;  1EIG A;  2SNM A;  1D5M C;  5JOB A;  3A8J E;  1FNW A;  1WTW A;  2VB3 X;  4OGQ C;  1TT2 A;  1V1O A;  1PRT D;  3CU7 A;  1STH A;  2K7V A;  3OSO A;  4RKB A;  3K5N A;  4RCO A;  1NCV A;  5IGG A;  3R8B A;  5M3F B;  2JYO A;  2JP1 A;  1STY A;  4F8M A;  3KLS X;  3Q0A A;  1LLR D;  2N88 A;  5KYI A;  5CBE E;  4QF4 A;  1T5E A;  2XIW A;  1IKM A;  1OXV A;  3TSS A;  1BR9 A;  1AN8 A;  2D9U A;  5J22 A;  1EYA A;  1A6X A;  1Z6H A;  1R4Q B;  5C6A A;  3HRZ C;  3S14 B;  2VNU D;  1NSN S;  2HCC A;  5T1I A;  4KTA A;  3FVQ A;  1JWM D;  2IW3 A;  4OL7 A;  2FJ2 A;  2E2J B;  1PTO B;  2PCF B;  2D5D A;  4IUN A;  3J80 E;  1WTX A;  1SYE A;  5E4W C;  3IKJ A;  1KAA A;  3DWQ A;  1RJT A;  4K8J A;  5J1Z A;  3TBI B;  3TZD A;  4HN7 A;  2NUC A;  1RKN A;  3J7A F;  1SNO A;  3I70 A;  1W6J A;  3ND8 A;  1ILQ A;  1JC7 A;  3HOV B;  1SE4 A;  2I07 B;  4IUT A;  4X3S A;  4IUR A;  2K32 A;  4ZQ3 A;  2EOT A;  2KCC A;  2PQE A;  2HCI A;  4K6L A;  4QUF A;  4XIG S;  1PTO C;  2EJF C;  2MGS A;  2L1B A;  3FDT A;  2O5I C;  2L11 A;  3RLF A;  2E2H B;  4ZK9 B;  1E2V A;  1TQO A;  2H1E A;  1LTB D;  2B2U C;  3J80 L;  2VUM B;  3DHQ A;  5M5X B;  1PRT B;  2RQX A;  1RHP A;  2NVY B;  1PFM A;  3T51 B;  2KJX A;  1K83 B;  5M3M B;  3E5S A;  3IFD A;  2IT1 A;  4U68 A;  5ELB A;  1ZKO A;  3HOY B;  2NN6 I;  2EYO A;  4IFD G;  2K04 A;  1U4L A;  3DXJ C;  1OXT A;  2DY8 A;  1I4G A;  3NWS A;  3VR2 A;  2F1M A;  4RCN A;  2I46 A;  2K5Q A;  3BVG A;  5CYU A;  1CQV A;  2ID0 A;  4HAE A;  2QKI C;  4X3U A;  1HUN A;  3MTS A;  2B8F A;  5EJW A;  4A3J B;  1CQF A;  3P20 A;  2B2V A;  2M9V A;  1K8M A;  3MFG A;  2F0V A;  1G29 1;  4I7Z C;  1ROD A;  1Q12 A;  3NUC A;  4FNF A;  3A8K E;  3NBI A;  1AFP A;  5E4X A;  2EE1 A;  5T1G A;  3S2H B;  4LK1 C;  3U9S A;  1TWF B;  2KEC A;  2K5W A;  5TSS A;  1EY6 A;  2WKD A;  3J81 E;  2L55 A;  4FO2 A;  1G2S A;  1FD7 D;  3VA7 A;  2WIN B;  5CGK A;  1PXU A;  3OIP A;  3W2D A;  4PMB A;  4CKC A;  4EQN A;  3K0Y A;  1NUC A;  1C8C A;  1RTO A;  1HRJ A;  1SFO B;  3SE0 A;  3L9A X;  2R3Z A;  5EPL A;  4FXD A;  2PZW A;  2EYL A;  4IFD J;  2EVB A;  3TME A;  5IGD A;  3ERO A;  3MWY W;  3NHH A;  3MAQ A;  1BXT A;  4BA2 I;  5IGE A;  2EYF A;  5EKI A;  4QB4 A;  1B4O A;  3SK8 A;  2LKV A;  1IW7 C;  4XQJ A;  1SAP A;  1STE A;  3M85 A;  2V4D A;  4H44 C;  2B2V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...