1U4LA

Human rantes complexed to heparin-derived disaccharide i-s
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A5
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Attractant
total genus 13
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4lA00
4MN3A 1B3AA 2KVMA 3UI2A 5T1GA 1WTVA 2HDLA 2NZ1D 2X6LA 2R3ZA 2Q8RE 4X3KA 5D14A 4R8IA 3DEOA 3KBXA 1B2TA 1J9OA 4RAUC 1XYIA 3G7LA 2JYOA 2L1BA 2L9HA 2RVLA 1EOTA 3R93A 1U4RA 4RA8A 5EKIA 3MTSA 2EPBA 4R9WA 1DONA 1BNZA 2KEEA 3I90A 2KEDA 1NR2A 3FDTA 5T1IA 1CM9A 1A15A 2B2TC 1XX8A 2FHTA 2M2LA 4IUTA 4CJ2C 4IUQA 2L11A 3TN2A 4DN4M 1J8IA 1GUWA 1TVXA 5EPLA 3LWEA 5EPKA 1F9QA 1E0BA 4CJ0B 3I91A 1U4LA 1PFMA 2FFKB 2B2YC 1G2SA 1DOMA 2J7ZA 1VMPA 3N52A 5E4WC 2D9UA 1NAPA 4UAIA 2EE1A 1F9PA 2MPMA 2Q8TA 1WD1A 5EPJA 2RSNA 1G6ZA 1IKMA 1ICWA 2H1EA 1SDFA 3Q6SA 1RTNA 4U68A 1G2TA 4HAEA 2FJ2A 1X3PA 2N88A 4QUCA 1WTQA 3ONAB 4IUUA 2L4NA 1EIHA 1S4ZA 2CVRA 2KUMA 1BO0A 4IUPA 3QO2A 1MGSA 3MWYW 1F2LA 1SSOA 1JICA 3I3CA 1HRJA 1PDQA 1U4MA 5JJZA 1WD0A 1DZ1A 1NR4A 3F2UA 1PFBA 1PLFA 1AP0A 1MI2A 4RWSC 1O7YA 1QG7A 1HUMA 4HEDA 4OIJA 5AFWA 4MHEA 1WTPA 2HUGA 2HDMA 1O7ZA 1B50A 2DY7A 4ZLTF 1RTOA 1QE6A 1HUNA 1EQTA 4X3TA 2K01A 2X69A 1Q3LA 4HSVA 1ZXTA 2B2UA 1VMCA 3DM1A 2SDFA 1ILPA 1IL8A 1MSGA 1NCVA 2B2VA 1F9RA 1JE4A 4CJ1B 1EL0A 4QUFA 2K03A 1PFNA 3GV6A 1WTWA 5D65A 2HCCA 1AZPA 4OIKA 1WTOA 2K05A 2NWGA 1RHPA 3GV3A 1AZQA 1CA5A 1HFNA 2RA4A 5E4XA 2N55A 4IUVA 1LV9A 4LMQD 1HFGA 4O42A 1O80A 2EOTA 3FPUB 3I8ZA 4IURA 5COYA 3DEPA 1G91A 5EQ0A 3IL8A 1IKLA 2IL8A 4ZKCB 1RJTA 2K1BA 5CBAE 2FMMA 1ML0D 3P7JA 4X3SA 3HP3A 4HCSA 2XIWA 1ILQA 5CORA 1C8CA 2KECA 1KNEA 4XT1B 1KNAA 1B53A 5DNFA 1WTRA 2KOLA 2VXWA 2DY8A 1HHVA 2BDNA 5EJWA 1BBXC 1B4OA 1BF4A 5CBEE 3KUPA 3D6WA 2NYZD 2B2UC 2HCIA 2RSOA 4XDXA 1U4PA 4ZK9B 3SVMA 1HA6A 2B2VC 2MJ8A 1QNKA 4NW2A 1CA6A 4XT3B 1ESRA 3TZDA 1DOKA 1X32A 1X3QA 2K28A 2MGSA 2K04A 1WVLA 2B2TA 1F9SA 1RODA 1DOLA 1SAPA 5CMDA 2MP1A 1WTXA 3H91A 3IFDA 4ZKBB 2B2WC 2B2WA 1MSHA 1EIGA 4X3UA 2FINB 4ZAIA 2X6GA 2JP1A 1M8AA 2L12A 2B2YA
chains in the Genus database with same CATH superfamily
1IW7D 2KVMA 3K8AA 3NBIA 1SROA 2YV5A 2NZ1D 1R4PB 4X3KA 1A0IA 2K4KA 2KHJA 3CQZH 1B2TA 2K7VA 5C5MA 4PMCA 3CPWA 3I4NB 4CDFC 2NUCA 3OIPA 4LW1A 3S16H 3S1QB 5M5YB 3TREA 5CV9A 1HNXQ 1CM9A 3T1YL 2RHQB 3UE0A 5CV8A 4DXFA 5EPKA 4CDEC 1F9QA 4CKCA 5CV4A 4A3KG 1MHWC 1A3VA 1H95A 1WCMH 1X3FA 4N9PA 3TS2A 1X55A 2D9UA 1Z9FA 5IYBG 2F0FA 2BCOA 1SDFA 1E22A 1N36Q 2NVQB 3PSIA 1EFWA 1E2VA 3S15H 1RIPA 1YBYA 1KRTA 4H13C 1S4ZA 3A7AB 1K0SA 2F0OA 1JB7A 1K28A 4A93G 1MGSA 3MWYW 4A3IH 2K5HA 3KLSA 1VQDA 4EVOA 1Q46A 1FVIA 3S16B 5C0XG 1GXDC 4KY6A 5AFWA 1WTPA 5I9PA 2HDMA 1Q81C 1HTLD 1X3EA 4OEMB 2YU9H 5J3BA 4DR1Q 3STBC 2LKVA 4LFCL 4YHHQ 2E2HH 2GN5A 1PFNA 4N8FA 4ZUIA 1AZQA 4CHTB 5C3EG 1PV4A 1DYQA 3HKSA 4RGMA 1XMQL 2I0QA 2UXBQ 4O2DA 1XTDA 1NBWA 1RD9D 1RJTA 2NZOA 2FMMA 2PQAA 2QF7A 1SN8A 4JI7Q 5KGUA 2F0NA 2XWBB 4YCWA 5C0XI 2PZUA 3DXJC 2B2UC 3SVMA 2CFMA 1PTOH 3ULJA 2Q2IA 4UHVA 2YU9B 4GS3A 3I4LA 3NBHA 2XRSD 1SYFA 1HJPA 3EN2A 2F4IA 4IJLA 2E2HB 2JEAI 3BZCA 3UI2A 1B3AA 2OQ0A 4L8JA 4JI5L 1STEA 2K52A 4MZ9A 2ZXRA 2AHOB 3HOUH 1SNMA 3RLOA 1BVSA 3A55A 4RH6A 3PUXA 3HFZB 1PRTF 1EU4A 2F4VQ 4DR6L 1WCMG 5KNCA 1UE6A 3KDFA 1SE2A 3MHBA 3W1GA 1VS0A 4C3HH 4OGQC 3HKZE 1QILA 5KNBA 4WJ4A 1TR5A 4LF5Q 4ODGA 2JA5G 2CW0C 3M85A 3BVZA 2NVYH 4GLAC 1EQQA 2Q8TA 3H3VH 3NP8A 1IKMA 5BR8L 1UNSA 1OXTA 4P75A 4KI0A 4P71A 3J80i 1YNNC 4RHRA 3W1BA 4A3IG 2R92G 1LLRD 4KHPL 1EY8A 3HS0C 3CW2C 3GTKH 3GTPH 3B6YA 3TRZA 4J15A 1X54A 1IBMQ 2E2IB 4B08A 2PMZE 3QO2A 1STHA 2ALYB 4JI2L 1SEBD 1NUCA 4LF9L 2QDLA 1O7YA 1S40A 4HR7B 1X65A 1IBKL 3EBEA 1ET6A 2PW7A 4DK1A 4AYBB 3T4AC 4C3HB 1EWCA 1WTWA 3CCUA 1TWCH 4R4IA 3V05A 2AKWB 1S3OA 2F0LA 2HT1A 2JA6G 2NVYB 2HHHL 3TP8A 2AUJD 3K58A 4DV1Q 1SYCA 1E24A 1ILQA 4Y7NH 1TQOA 3I56A 1L1OC 3GO5A 3BYTB 4DAMA 4DAPA 3GTKB 2CQOA 2K75A 2GVAA 3RLNA 3GTPB 3VA7A 3MZ5A 1BF4A 3AQQA 1HZAA 5IYDH 2JE6I 3ZYYX 2KJXA 5JEAH 1JORA 5C3WA 3RZOH 1X32A 4DV6L 4DFAA 1B7YB 3I4MB 5KNDA 1YJNA 5IWAQ 4DV7Q 2B2WC 4JI6L 3U4ZA 1V1QA 1LTGD 1L0YB 1S5FD 3MAQA 3HOXG 3HOUG 2VQEQ 2LMCB 2RDHA 1GUGA 1G8ZD 1QCBD 3KF8B 4HTHA 4KHVA 2A73B 2H5XA 4Y7NB 1K3BC 4DUZL 1R9TH 4A3MH 4R9WA 2RHSB 3I90A 5T1IA 5C3XA 4DR5Q 4DN4M 1PTOD 2D0PA 1VQNA 3CMAA 2PW5A 5ISRA 3UDFA 3X3NA 3G48A 1AE2A 4GOPB 5C0XJ 1BKBA 2G9HD 5EKLA 2EQSA 1DGSA 5DAUA 4WFN3 1OXUA 1CK1A 1K8MA 2WB1G 1EIYB 4X62L 4BXXH 2UXDL 4PZ7A 4DXGA 1RTNA 1YNJD 3CC4A 1VF7A 1I50H 5JJLA 3I55A 4HAEA 1Q1BA 2A5HA 3PIOA 1X3GA 2UUAQ 3CCEA 1SSOA 1EQRA 1CKMA 1A3TA 1IL2A 1NR4A 4DR3L 4A3MB 1Q12A 1IBLL 4EQNA 1WOCA 4X3TA 3I4OA 1VMCA 1ZYRC 1EU3A 1PH8A 3D31A 3R8BA 3TP5A 4BBRH 4OIKA 1SE4A 2E74C 4HJ8A 3H0GG 3SHLA 3D8GA 1P8LA 4K8JA 2Y0SB 4S3SA 1TS4A 3PIPA 1CSPA 2CHBD 5ELBA 2GVBA 4HCSA 3UDGA 3T1YQ 1B53A 1ZEQX 3KF6A 3HRZC 4DR7L 1HHVA 1FGUA 3MVVA 2L0CA 4K8IA 5F2DA 3I73A 3D6WA 2NYZD 4ZK9B 1HZCA 2ZXPA 5J22A 2KCCA 2O4XA 2RCNA 3S1MH 4JBWA 4BY1H 1O7LA 4G7ZC 5FO8B 4DKAC 1XTCD 1W3SA 4DV4L 1BQQT 4CDCC 4B3ML 2CWAA 4RFBA 2JP1A 2F03A 5D14A 4BBRB 4MN3A 4A3LH 2X6LA 2R3ZA 4DPGA 2UU9L 3HKZB 4PMBA 1K83H 2Z0SA 1TT2A 2RQXA 3M7GA 1EZ8A 1N34L 1FNWA 1TS2A 2Q2TA 2QILA 1EOTA 1ONLA 5FK9C 5C5LA 3J81j 1MJEA 3J7AF 4EQOA 2B2TC 3PO3H 2E2JH 4IUQA 1S5ED 3FKIH 4GN5A 2EYLA 4I7AA 3LNNA 3BJUA 1RCVD 1F77A 2Z6KC 3S1MB 4BXXG 4BY1B 1MKHA 3M3YB 1NY4A 1XMQQ 2FXQA 4FXKC 2Q2HA 1SNCA 3EFXD 3HOWG 2RSNA 1SRUA 1T5XD 4ZCKA 1BCPC 3VYSA 3KF8A 4C2MB 4PZ6A 1M1KC 2R93H 4YWKA 4KHZA 3RD4A 1MIUA 1TXYA 1K83B 3C1EA 1LTAD 1JICA 3F2UA 1EIFA 5TSSA 2OEOA 1PZJD 1HUMA 4OL7A 2F0PA 2L15A 1B70B 1B50A 1PH9A 4GOPA 3BG3A 2M00A 1D1IA 3FKIB 3KBGA 3JAMi 4FF3A 4JCVE 1JE4A 3SDZA 4CJ1B 1FD7D 2A1AA 3GTMB 3HKZG 2R6GA 1WTOA 1CKNB 3KLWA 2RA4A 1GUTA 1VCIA 4IUVA 3ITPA 2WKDA 1SNOA 4L5RC 1G91A 3W3AA 3M9BA 3RN2A 3CC2A 3S14H 1DM0B 1LABA 4DR6Q 3FEWX 2R93B 2EYFA 1VQGA 2KOLA 2VXWA 2Z9HA 2IX1A 2PZWA 1XPOA 4F88A 4BY7H 4HMIA 2IHFA 3NSWA 2F3WA 2PPBC 2OWOA 2VZAA 1BCPF 1PH2A 2F4VL 2MJ8A 1Y1VH 4DV3L 4QGUA 3TZDA 1X3QA 4KLKA 1CFMA 2R7ZG 2I5HA 4A3GH 2QKIC 2UXCQ 1GD7A 2K5DA 5C4ZA 4A3LG 2A6EC 4JI8Q 5GAHC 4JOIA 4BBSH 1A8VA 2FINB 4HCEA 4WORA 5K36H 1V1PB 5EBCA 4IOCA 1B8AA 3D4RA 4JI2Q 3CHBD 3SXHA 4LNQA 1K3RA 4LF9Q 3GTQB 2YTVA 3PGZA 1SYBA 3BU2A 3SGIA 3C46A 1IBKQ 3K81C 4Q5VA 3C3LA 3PF5A 3PO3G 4LFBL 1GHJA 1NMGA 3FKIG 2WIIB 2KEEA 1YZ6A 3S1NH 1EY7A 2WP8J 4KD4A 1XX8A 2FHTA 4BY7B 2Z6BA 3TN2A 1YITA 5CGKA 3HOYH 1GUWA 2KHIA 4QMGA 3H15A 1Y1VB 2K14A 1BDOA 1K0RA 1CUKA 4A3GB 5CYUA 3ULPA 1QVGA 1CHQD 4XYOA 1I4HA 2MPMA 3VYUA 2CH4W 2V4DA 4A3JH 3A8IE 1PZID 1IZ6A 2EXZA 3I72A 3IFTA 4IFDH 3OIQA 5D3IB 3J80E 2WINB 5LMUQ 5C44H 1B9MA 2F3VA 2I07B 3CCQA 4IUUA 3VR2A 5FLXc 1GKHA 3M4PA 1YHAA 4IUPA 1KLGD 2F1MA 1RDPD 2JA8G 1ET9A 2PI2E 2EZVA 2BE5C 3S1RH 4B3RQ 2DNEA 1O7ZA 4HJ5A 1DJRD 1KIXA 4QJFA 5LMNQ 4ME5A 4JI6Q 3R2IA 2UUBL 3OWEB 2EY2A 3EROA 2LXJA 2LY7A 1TWFH 1QB5D 1TWAH 3VYTA 1MSGA 4HMJA 1NCVA 2F0KA 1F9RA 1HNZQ 4KKSA 5IWAL 1RL2A 3GV3A 4IALA 1ENFA 3U9SA 4DV7L 1JB3A 1AW7A 1KABA 4KY5A 1V9PA 4B3TQ 1FNUA 2F0EA 2RCFA 4A3JB 1YHQA 3ICEA 4DUZQ 1AN8A 5EQ0A 1TY2A 5BN4A 2ZT9C 5C44B 2ATWA 2HQLA 4Q0FA 4CGYB 3TS0A 4A3CH 2Z8LA 3QWNA 5EJWA 3NTIA 5CBEE 3G71A 1L0XB 2HCIA 1LTSD 2EYJA 3SK4A 5M3MG 4DR5L 1S5DD 4L5QA 4BBSG 1CSQA 2ZTEA 2UXDQ 4XXEA 1CKNA 2PZTA 5K36G 2DN8A 2AWOA 1TWFB 1TWAB 4ZKBB 3FRPB 1EIGA 2A68D 4C3JG 4I7ZC 1QUQA 3I4NH 1LTRD 5M5YH 4AYBE 4H02A 2F0VA 1G51A 5D3DA 4YCUA 1PRTD 1CQFA 2A8VA 2B63G 1J9OA 4P72A 2D0OA 4PMWA 5JVH3 3HOYG 2WACA 5E3FA 3S2DH 1IYUA 1SLJA 4JK1C 1E1OA 2F3IA 3PO2H 4QQBX 1L1OB 4JG2A 1H9SA 1V1PA 3J80L 3PIP3 4A3DH 1QJOA 4K6DA 1G6ZA 1Y8NB 4X6AH 3MC0B 2DJFC 1G2TA 2IW3A 4DAYB 4DR7Q 1AFPA 3BYYB 2R7FA 1EIHA 4O0AA 5KYLA 1V43A 1KLUD 3HZXA 1AP0A 2Z1CA 1D6EC 1FNVA 1HZBA 4DV4Q 4DV5L 3S2DB 3KLRA 4YCVA 1QE6A 1STNA 4B3MQ 2X69A 1PH3A 1ZXTA 1NSNS 2B2UA 3PO2B 2RBMA 2SEBD 1FYCA 4PNYA 2UU9Q 2RKSA 3F1ZA 1AZPA 1LACA 2NWGA 3CP0A 5IT9L 4JPBW 2NTSA 4A3DB 1B9NA 1HFGA 2SNSA 1N34Q 5COYA 4BA1I 4DNIA 1EYCA 2A6HC 4X3SA 4X66L 5JPMC 4AQYL 2MHVA 5H1SE 2JA7H 5C6AA 3NEMA 1VQHA 4JC0A 2JJQA 1SE3A 2EJGC 3ND9A 1KDCA 4QB4A 2RSOA 4HJ7A 1HNWQ 3JC66 2V1CC 2F0TA 1Y8OB 3SK6A 5M5XH 4PZ8A 3I4NG 3NPPA 3H91A 4P73A 4KD3A 3HOZH 1WFQA 4A3EH 5E7NA 1WI5A 2K5QA 2KHSA 1K8GA 5IP9G 4MTKA 5DEHA 1XPUA 2XVSA 3G7LA 4WRDA 4KN7C 1BXTA 5M9OA 4G7HC 2Y0SE 3K5OA 2JA7B 1XJVA 5EKIA 3MTSA 1I4GA 1BNZA 2HQEA 2LFNA 3RLFA 2M2LA 2I5LX 2F0DA 3JAMc 2F0QA 3UDIA 4CKBA 1VQOA 4OO1H 4L6TB 1GJXA 1EYAA 3CCRA 1DOMA 5E4WC 5M5XB 2NB0A 1HQRD 4UAIA 4A4IA 2E2IH 3PCOB 2EE1A 1C48A 3WDNA 1IW7C 3I7FA 4LUVA 3CC7A 1NJIC 4DR4Q 3D6CA 3HOZB 4A3EB 1EEID 4APVA 1Z6HA 2KBNA 4ZRZA 3ONAB 4BS9A 5ELOA 2D62A 3U4VA 2A69D 3KFUA 4DV3Q 1DZ1A 1WYDA 4J1MA 4JW0A 4A3BH 1L1OA 3S24A 4C1NI 4U673 2DY7A 4ZLTF 2HIVA 4F8MA 4DK0A 1AEXA 1BOSA 1I4XA 4QIWB 3JAME 2UXCL 3SK8A 2XN9C 5KYIA 4JI8L 5KIXA 4QL5A 5ELEA 4DAYA 1TKWB 2N55A 4ZUJA 3QOJA 5KRUA 2EOTA 2G5DA 3I8ZA 5GAGC 4LFBQ 2IL8A 2OTLA 3GD7A 5ELCA 2IHEA 4X64L 1VQFA 3S9WA 2DY8A 1X9NA 1BCPB 1B4OA 2UUCL 3I4MH 5C4JH 1EY6A 3K0XA 4CBVA 3SK5A 4CDDC 3VDYA 5DM73 4A3BB 2C9OA 1LM0A 1JWUD 3IFDA 4M8AA 2QCPX 3CCJA 2YTYA 1WTVA 5T1GA 5K5PA 2MQHA 4Y52H 1XNQQ 3ND8A 5LMUL 4R8NA 4FP5D 1GM5A 5GQOA 3K80C 5CV6A 4LUOA 1XYIA 3MFGA 4K5VA 4CKEA 4RA8A 5BN5A 2UUBQ 1FGBD 3DWQA 4OO1G 2LSSA 3FDTA 1EL0A 2MUYA 4C3IH 5C4JB 4B3RL 3TZUA 4FO2A 5LMNL 2AQ2B 4JBKA 3URYA 3Q0AA 2A19A 5DM63 1TWHH 1B3QA 3AEVA 1UEBA 1HNZL 1JOQA 2XRQD 1E7ZA 4IUNA 4NP5A 3T53B 1F9PA 1MBYA 3D4WA 3ER0A 5C4HA 1XMOQ 3Q6SA 3H09A 3AYHB 3PUYA 4B3TL 3EA6A 4O1NA 1HR0Q 4AYBG 1EZ6A 3CCLA 4C3HG 3BZDB 4K2KA 4KTAA 1YJWA 2RDGA 3CXCA 1PFBA 2DGYA 1CT1D 2CCZA 4OO1I 1DD2A 4EX5A 1PH7A 5E1FA 5M5WH 1VQLA 3T1HQ 1HUNA 1EQTA 1PXUA 1SJHD 4R1JA 4C3IB 2EY6A 2PI2A 1D8LA 2SDFA 2ZM6L 3TBIB 3J81c 2K03A 1TWHB 3K5NA 5E4XA 4LMQD 2PYKA 1R4QB 1WTHA 3RUZA 5C4XH 1VQ7A 4KV6A 5IGBA 3GDEA 5GROA 1BUVT 4FDBA 3OHXC 2J0TD 2TMPA 3I4MG 5IP7H 1BCPD 3AMUA 3IRBA 1D5ZC 3TP7A 4DNRB 1OXSC 1Y1WH 2VUMH 1JJ2A 4UP7A 1VQJA 3H3VI 3K5MA 4JBMA 1EY0A 3GTJB 3BDOA 1ESRA 4PQXA 2MO1A 5M5WB 1L0WA 1WVLA 2B2TA 1Q86C 1EYGA 2E5LQ 1HXYD 4K6LA 1CKOA 3C1FA 3E3XA 1MSHA 4HN7A 4RKBA 4ZAIA 2Z6KA 1LT5D 3K7UC 4B9WA 2F52A 5BN3A 5IYDG 5C4XB 4MTNA 5JEAG 2EVBA 4DV5Q 2BDOA 4GNXC 1YI2A 2L1BA 2L9HA 3EVQA 3MXGA 1U4RA 2SOBA 4YWMA 5JPNC 5HURA 2BA1A 5JVG3 1JR0D 3M3YH 3HOVB 1H9KA 1Y1WB 1H9MA 2VUMB 1A15A 1YEZA 3P75A 1STBA 3NENA 3OPOA 4K14A 1F2ZA 3LWEA 3NTHA 1S5BD 3I91A 4C2MH 1H9RA 1Y8PB 2F0IA 5CV5A 4DV0Q 1I94Q 3E6ZX 2XGTA 4X66Q 4C56C 5EPJA 1WD1A 3KK7A 4AQYQ 2H1EA 5HGTA 4A3MG 1JOKA 1JC7A 3A74A 3OW2A 1EWHA 3AU7A 1U5KA 1JT8A 2ZJQA 2OQKA 1KAWA 3RZDB 1EWIA 1V8QA 5IY0A 2CVRA 1SE8A 5FJ8H 3CKIB 3I3CA 3SE0A 5FLMH 3QG1A 2WAQB 1EOVA 1ASZA 1VQBA 3GTMH 2LXKA 2Y0SG 2XSCA 3F8TA 2F0UA 4PG3A 1QVFA 1K8OA 1PTOC 4KJNA 1RTOA 1HNWL 1VQ8A 3VR6A 2JN4A 3NXWA 4IPCA 1STAA 4QF4A 3GV6A 3J7A5 1FJGL 1S5CD 3AB9A 4J8QA 1RHPA 1F2MA 1KDAA 2P5ZX 3PMFA 4DK6C 4X65Q 3H6MA 1ZKOA 5IYCH 1LO5D 1YNJC 5IGEA 5IP7G 1C7YA 1SMYD 1SNDA 4XT1B 3K7AH 3ZJYC 2K5NA 4BBRG 3D4DA 1U4PA 4K5XA 3O13A 1OXVA 3PQIA 2IX3A 1DOKA 1O7IA 2CKZB 3GQBA 4RGTA 3DMUA 5EAYA 2B29A 2ZTCA 3GTQH 2DUDA 1EEFD 4H7BA 3F2BA 1CI3M 2R61A 1SYGA 2FFKB 2F0MA 1GOZA 1SFOH 5IGGA 1SYEA 5IOCA 4DR4L 1BR9A 1A2TA 4F87A 4LF8L 3RNUA 5I6WA 2NN6H 5G3LF 4BY1G 2QW7A 5GADC 3DLLA 1Z7TA 3E9IA 3T51B 2ICIA 4A3FH 4QCLA 1O78A 4JI4Q 3U9OA 2NVTB 4JV5L 2MO0A 2N78A 3K7AB 2NZHA 1SNQA 5IGCA 1TVXA 2DNCA 5EPLA 1ENCA 1XNRQ 1U4LA 2JEBI 3RR5A 2Z4HA 3SR1A 4XQJA 3CF5A 3GTGH 5AJ3L 2WV6D 4DR2L 1Q82C 2XWJB 4Z9CB 1VQMA 4UP8A 1EQVA 1NNXA 3NWTA 4X64Q 4JBJA 3TEHB 4EGVA 2OXPA 3L9AX 5JOBA 3F2DA 1SFOB 1BBWA 2UUCQ 2L4NA 4A75A 1D7QA 3NQTA 1U4MA 5JJZA 3CAMA 1D2BA 1ASYA 1QG7A 1QOHA 4A3FB 4UPAA 2QA4A 1PYSB 4ZQ3A 4OWWB 2HIXA 1Q3LA 1HH2P 2D5DA 1Q7YC 1I3QH 1JCKB 1P16A 3K0YA 4ZYSA 2R93G 4QUFA 4LFAL 3E5SA 5IYCG 5D65A 2HCCA 1KD1C 4NXNL 3GTGB 1RF2D 1LV9A 2F0WA 2DJGC 3DUZA 4DV2L 4J6HA 4IZ8A 1M4VA 3K57A 1XNQL 2K1BA 2XIWA 5DNFA 1UAPA 2JQOA 2VB2X 3CCVA 1BBXC 4DK3C 2WFWA 4AIMA 1K73C 1VQ4A 4POFA 5JEAJ 1STYA 2KCTA 2B2VC 1QNKA 4ME3A 4N9TA 1BBUA 1PA6A 2ZXOA 2HD3A 2MGSA 3DWPA 2ICEC 4IPGA 3QIAA 1F9SA 1T9HA 1K8AC 1SAPA 4JOIC 1I3QB 2AUKA 4OXPA 3UE1A 5LHY1 5I9OA 2VW9A 5M3FB 4BY7G 1EY5A 1QZGA 1XMOL 4N8X1 4QIWE 4A3KH 2Q8RE 4LF4L 5FLXE 1E3PA 1EY9A 2B3GA 1Y1VG 5FO7B 1HR0L 4A3GG 3CPFA 5IYBH 3MXNB 1II3A 3NQIA 3KJPA 2ZJRA 1HCZA 2KA7A 5GAEC 2ZM6Q 3CMEA 1RKNA 1CQVA 2WKCA 2N49A 3T1HL 3RMHA 4DGZA 3OMCA 3PF4A 3T16A 4A93H 3BZKA 3J81i 3STBD 2B2YC 3PIO3 4LK1C 4NMZA 4OWXB 1GHKA 5C0XH 1WJJA 1X6OA 4G4KA 3GTLH 1KTKA 1LTTD 4HIMA 3DWAA 4G57A 1Q90A 2N88A 4K0KQ 4A3KB 3NBHB 3VA5A 2I5MX 5C3EH 1PDQA 3NELA 1A62A 1JOOA 4POGA 3EIVA 2HUGA 4A3JG 1OO9B 2EJMA 2BH8A 3NWSA 4IFDG 2K01A 2TSSA 2PQEA 5C44G 1YIJA 3EQLC 3DM1A 5HY6A 5IGDA 2E75C 2E5LL 4LF6Q 4DU9A 4A93B 2D2CC 3AFQA 5ELFA 3SEBA 3RN5A 1EUJA 2B8GA 1YHBA 1XWEA 3FPUB 1AH9A 2R7DA 3OSOA 3GTLB 1PFSA 4GKJQ 3A8JE 5CORA 3BVGA 4K2LA 4BA2I 1YNXA 1Q1EA 2JXMB 2N8NA 2BDNA 5C3EB 2QGQA 1GUOA 1KAAA 4LF7L 1KL9A 4TVAB 3LX0A 4IFDI 1I5FA 2F0SA 2SNMA 4RCNA 2ZTDA 1NMFA 3OYYA 2Z4IA 1PH6A 2CW0D 1D5MC 5L37A 2B39A 3PUVA 1I6HH 3BDCA 4DV0L 1OTCA 5FLXL 1I94L 2X6GA 4A3CG 1Q8IA 2AMCB 4H0LC 1UWVA 3HGBA 2K5WA 2JA9A 1YNND 3TSSA 3CCMA 2JA5H 3HG9A 3VR5A 4R8IA 1T5EA 3KBXA 1UUPA 3J7ZC 1A6XA 3OWFA 3G6EA 2A74C 3GTOH 4F7XA 1DONA 4XQQA 4IUTA 3CQZB 3ULLA 2BH2A 2R92H 1PH1A 1FJGQ 3OW7A 2PNRC 4LAAA 4R4CA 4ULLA 2A68C 1I6HB 2IT1A 4X65L 1WCMB 4G7OC 1TU2B 2NVXH 4JI3Q 1TIID 2KENA 1PRTC 3MXNA 3M4YA 3PO2G 4RCOA 1LYLA 2KCMA 2IWHA 5LL6X 2JA5B 1M90C 2BOSA 4PV1C 2JA6H 1C9OA 3OOCA 2PCFB 3U58A 3S15B 4A3DG 4R4QA 3I2ZA 1Y69U 3GTOB 1H9JA 4EQPA 4A3IB 4GNXB 2R92B 1KQSA 1JJCB 1LTLA 2VS1A 3IKJA 4GKKL 1KHIA 1TS5A 3W5OA 2AQ3B 4LF8Q 2K05A 4GLVB 2CH4A 4QY7A 5KEEA 3OTOQ 4FXGC 4YY3Q 4DAVA 4JI1L 1JMCA 4ZKCB 3G4SA 1ML0D 4JV5Q 2NVXB 5EBDA 1KC8C 3DM3A 4HJ9A 4FF2A 3TDQA 3HOXH 1SBBB 3KUPA 4JI4L 3FVQA 1GVPA 4KMUC 2JA6B 4NXMQ 1W6KA 5AJ3Q 4DR2Q 1XPRA 2QEJC 4GN3B 5J1ZA 4JVZA 1XNRL 5DLQE 3UDXA 1DOLA 2ZJPA 2WAQE 5CMDA 2JA7G 2B2WA 1PTOB 5A2QE 2ES2A 2O2LD 4GN4B 1HZ9A 1I4PA 1GUSA 2XNAC 1F2YA 4DUYL 1NTGA 3NHHA 4RAUC 2JYOA 2NTTA 1CTMA 5ELNA 1VQ6A 1NE3A 4RHSA 2KEDA 3HOXB 1JQYD 1LT3D 1QNUA 2XTIA 3MXPA 4LFAQ 3HOZG 4R4OA 2L11A 4A3EG 4NXNQ 2QDBA 1G6PA 1TWGH 1PYWD 2PO4A 1E2WA 2GA4B 3KF6B 1ZYRD 4DV2Q 1SNPA 1TY0A 2J7ZA 3HOUB 1CZGA 3N52A 1DCZA 1NAPA 1GUNA 4V190 1VQPA 4IFDJ 2IX0A 3HEJA 4HJAA 2OT2A 2O5IC 2M9VA 3T56B 1N9WA 2I46A 4I65A 2KUMA 3H0GH 4GLXA 1WD0A 2WB1B 2EYPA 4RWSC 4YIJA 4FVMA 3LGJA 4L63B 4NPSA 1UEAB 2KCNA 4LWCA 4KY7A 3DHQA 2L5TA 1IL8A 1FL0A 1TWGB 2KQ3A 1VQ9A 4LF4Q 1VQKA 1CA5A 1HFNA 4B3SQ 1QVCA 2VQFL 2ASBA 4A3BG 3IL8A 2ENBA 4IPDA 5IGFA 4LJZC 2O5JC 1TWCB 3GTJH 1J5EQ 3EJIA 2MNAA 1V1OA 3WOEA 2A69C 2Q8IB 1S72A 3JAML 5LMNW 1VQAA 1GO3E 4EQ5A 3H0GB 1PMRA 2EDGA 4E6IA 4XDXA 4B9XA 4GNXA 4JI0Q 4JYAQ 3L0OA 4NW2A 4IPHA 3A54A 1IXRA 3S17H 2JK8A 3ERSX 4M1UB 5A2QL 3QR8A 4L5TA 2K32A 4XQNA 1M8AA 3RZOB 2L12A 1N32Q 2FMCA 5G3LD 4OX9L 3S2HH 2JSOA 3Q22A 1LT6D 4MIUA 3WWVA 3HOVH 4KJOA 2RDFA 3DEOA 1XXGA 4OHJA 3QOLA 4K0KL 1KRSA 2OCEA 3A0JA 3HOWH 2EYOA 3V96A 4YWLA 3WOFA 4KKUA 4KKTA 3CU7A 1NR2A 1X56A 3VR3A 3Q24A 1J8IA 1K9MC 4FF1A 1LUZA 1E0BA 1IYJB 3LWUA 4XYQA 4CJ0B 3J81E 1R9TB 2NBFA 1JJGA 1ICFB 3S17B 4LF6L 5J39A 2ID0A 3RZDH 1C4QA 2K6AA 3M4OH 1N33L 4K5WA 2OTJA 2EIFA 4C3IG 1X3PA 4IO9A 1LT4D 1U0LA 3S2HB 4GKJL 1PH4A 4LF7Q 2H4OA 3MFYA 1A63A 3G6JB 4P74A 4FF4A 1I50B 3HOWB 3A8KE 3FHWA 3QB3A 4MHEA 1ESFA 5I4DA 4DA2A 1VF5C 1HNXL 2MFIA 5LL6S 2E8GA 1OXXK 2A6ED 1PVOA 2EY1A 3FMCA 3K5LA 1O80A 3W2DA 3PV0A 4IURA 1CHPD 1Y14B 3KYHC 4WJ3M 2R7ZH 3M4OB 4FNFA 1D5XC 2N3SA 4C1NK 1W6JA 1C8CA 5CV7A 1N36L 1YVCA 1I4QA 4DF7A 3X3MA 3K59A 1STGA 4BWGB 4V0BA 3NTKA 4L5SA 1KDBA 1L2FA 5C4XG 2K28A 3A56A 4ID6A 4OELB 2K04A 2F0HA 3J7YW 4LFCQ 3R3OA 2MP1A 3C2PA 2Q2UA 3FPPA 2OF1A 4MNOA 2PMZB 3HOVG 1Y1WG 1W2BA 2VUMG 1QWYA 4DR1L 2HDLA 4YHHL 2IJ0A 1IHZA 1Q8KA 3VR4A 3FP9A 2NVTH 2BA0A 2E76C 4JI3L 2EYHA 2R7ZB 1LTID 1U9RA 4IQZA 3OMGA 5A35A 1SXTA 3M4QA 2RVLA 4RKLA 2UXBL 3R93A 1E2ZA 3N6RA 2EPBA 4GKKQ 4IJHA 3BVMA 3PUWA 2BE5D 3J81L 4JI7L 1I6VC 2K50A 2VB3X 2YTXA 3IAYA 1SR3A 2B8FA 3H3VC 1PFMA 4TRDA 1N8RC 2JA8H 1G2SA 2AWNA 1ENAA 1PTOF 1VMPA 4JI1Q 1HA5A 3PO3B 4NKLA 4TKOB 2E2JB 2LS01 2WAQG 3E0JA 1LTBD 4JI5Q 1DXMA 5IODA 3OTOL 2F0GA 4YY3L 2RF4A 2FJ2A 3L7ZC 1BO0A 1QUQB 5IIFA 1CZWA 1HRJA 4RG1A 5HGQA 1PLFA 2IY5B 4HEDA 4OIJA 3AFPA 2C5CA 5IE8A 4NXML 3T13A 3Q23A 4HSVA 4OWTB 3VYRA 1JE5A 2B2VA 5FOBB 1E1TA 3A5UA 4TQUS 5FJ8G 2JA8B 3ERQA 2CWPA 4DUYQ 5BR8Q 3L2PA 1A2UA 5EGTA 5M3MH 5NUCA 1EYDA 1JWMD 5FLMG 4UP9A 4O42A 4LF5L 4OONA 1TS3A 3DEPA 4H44C 4KHPQ 4LUZA 1H9SB 3J80c 1KNEA 5CR3A 1VQ5A 1EFID 1HQMC 1KNAA 4KK7A 5FO9B 4C3JH 1EY4A 1VDZA 4UDUC 4AH6A 4GOPC 2EY5A 2K33A 1IBML 1SJED 4DNTB 3S14B 1PRTB 2J4XA 5FKAC 1CA6A 1JWSD 4R4TA 4XT3B 2B63H 3PUZA 4P2CB 1C0AA 5JJIA 5M3FH 4ILWA 4RGOS 3P1HA 1RODA 3L3OC 1AE3A 1WTXA 1FR3A 4X3UA 3M7NA 2HHHQ 2B2YA 3CRLC 3KOJA 4KN4C 2K5VA 3A7LA 1G291 1QZHA 2EXDA 1SMYC 5M3MB 4HIOA 5I6YA 4BBSB 1PZKD 4HIDA 5IT9c 3CRKC 4NDXA 2F0JA 4DV1L 1PH5A 1HPCA 2C35B 4C3JB 1KXLA 4HSPA 2IPKD 4ABNA 4CJ2C 4HIKA 1VQCA 4DV6Q 4ALPA 1UE1A 2B63B 1VQIA 3NE5B 3H94A 1I4RA 3MA2B 2VQFQ 3S1NB 2NN6G 3KLSX 2VNUD 3TMEA 5I2XA 3E9HA 3HOYB 2EJFC 3BS1A 3F2CA 1HTPA 3U50C 4A3FG 2E2DC 4B3SL 1ICWA 4FXDA 3NK9A 2EYMA 4U68A 4XTCS 1VQEA 3MEFA 2A6HD 4QUCA 5CC4A 1WTQA 4RGNA 1J6QA 3TP6A 1F2LA 2PQAB 2VQEL 1J5EL 3TQYA 5IT9E 3E0EA 2QEXA 1MI2A 1SYDA 5ELDA 1PYBA 3D0FA 4JI0L 1B44D 3MEHA 4JYAL 1IYVA 4A76A 4OX9Q 1ILPA 2NN6I 1B1ZA 4WJWA 3S1RB 2PNHA 1MD2D 3NUCA 4IN3A 2VY3A 4X62Q 1UE7A 1HR0W 4RMFA 1UE5A 1YJ9A 2CQAA 5I2YA 1N32L 2L55A 4NB3A 3P20A 3GP7A 4IOAA 4UY8C 1IKLA 3MXUA 3J7AV 3BDLA 3P7JA 5CBAE 3S1QH 3V2TA 3HP3A 4GZYC 2KECA 4XIGS 1WTRA 1PHJA 1MJCA 4TSSA 4DR3Q 2UUAL 1D1KA 5EKKA 5M3FG 1IBLQ 1HA6A 3D3RA 2YYZA 3K6OA 5IP9H 2AQ1B 3I70A 3KJOA 3Q8DA 1N33Q 5JJKA 4FYDA 3KDFB 3CD6A 2WB1E 2G9DA 3CCSA 1A3UA 3QJYA 3R2TA 3A5ZB 5JAVA 1Z47A 2VL6A 2NVQH 1SMXA
chains in the Genus database with same CATH topology
1IW7D 2KVMA 3NBIA 2NZ1D 1R4PB 4X3KA 1B2TA 2K7VA 5C5MA 4PMCA 3I4NB 2NUCA 3OIPA 3S1QB 5M5YB 5CV9A 1CM9A 5CV8A 4DXFA 5EPKA 1F9QA 4CKCA 5CV4A 1A3VA 4N9PA 2D9UA 2F0FA 2BCOA 1SDFA 2NVQB 1E2VA 4H13C 1S4ZA 3A7AB 2F0OA 1MGSA 3MWYW 3KLSA 4EVOA 3S16B 5C0XG 1GXDC 4KY6A 5AFWA 1WTPA 5I9PA 2HDMA 1HTLD 2LKVA 1PFNA 4ZUIA 1AZQA 4CHTB 1DYQA 4RGMA 1RD9D 1RJTA 2FMMA 2QF7A 5KGUA 2F0NA 2XWBB 5C0XI 2PZUA 3DXJC 2B2UC 3SVMA 1PTOH 2YU9B 3I4LA 3NBHA 2XRSD 1SYFA 2F4IA 2E2HB 2JEAI 3UI2A 1B3AA 4L8JA 1STEA 2ZXRA 1SNMA 3A55A 4RH6A 3PUXA 1PRTF 1EU4A 5KNCA 1SE2A 3MHBA 4OGQC 5KNBA 1QILA 1TR5A 4ODGA 2CW0C 3M85A 3BVZA 2Q8TA 3NP8A 1IKMA 1UNSA 1OXTA 4KI0A 1YNNC 4RHRA 1LLRD 1EY8A 3HS0C 2E2IB 4B08A 3QO2A 1STHA 1SEBD 1NUCA 1O7YA 4HR7B 1ET6A 2PW7A 4DK1A 4AYBB 3T4AC 4C3HB 1EWCA 1WTWA 3V05A 2F0LA 2NVYB 3TP8A 2AUJD 3K58A 1SYCA 1ILQA 1TQOA 3GO5A 3BYTB 4DAPA 3GTKB 3GTPB 3VA7A 3MZ5A 1BF4A 2JE6I 3ZYYX 2KJXA 5JEAH 1JORA 5C3WA 1X32A 4DFAA 3I4MB 5KNDA 2B2WC 1LTGD 1L0YB 1S5FD 3MAQA 2LMCB 2RDHA 1GUGA 1G8ZD 1QCBD 4HTHA 4KHVA 2A73B 4Y7NB 4R9WA 3I90A 5T1IA 5C3XA 4DN4M 1PTOD 2PW5A 5ISRA 3X3NA 5C0XJ 2G9HD 5EKLA 5DAUA 4WFN3 1OXUA 1CK1A 1K8MA 4DXGA 1RTNA 1YNJD 1VF7A 4HAEA 1Q1BA 2A5HA 1SSOA 1A3TA 1NR4A 4A3MB 1Q12A 4EQNA 4X3TA 1VMCA 1ZYRC 1EU3A 3D31A 3R8BA 3TP5A 4OIKA 1SE4A 2E74C 3SHLA 3D8GA 4K8JA 2Y0SB 4S3SA 1TS4A 2CHBD 5ELBA 4HCSA 1B53A 1ZEQX 3HRZC 1HHVA 3MVVA 2L0CA 4K8IA 5F2DA 3I73A 3D6WA 2NYZD 4ZK9B 2ZXPA 5J22A 2KCCA 2O4XA 4JBWA 1O7LA 4G7ZC 5FO8B 1XTCD 1BQQT 4RFBA 2JP1A 2F03A 5D14A 4BBRB 4MN3A 2X6LA 2R3ZA 3HKZB 4PMBA 1TT2A 2RQXA 3M7GA 1EZ8A 1FNWA 1TS2A 2QILA 1EOTA 1ONLA 5FK9C 5C5LA 3J7AF 4EQOA 2B2TC 4IUQA 1S5ED 2EYLA 3LNNA 1RCVD 1F77A 3S1MB 4BY1B 3M3YB 4FXKC 1SNCA 3EFXD 2RSNA 1T5XD 1BCPC 3VYSA 3KF8A 4C2MB 4KHZA 3RD4A 1K83B 3C1EA 1LTAD 1JICA 3F2UA 5TSSA 2OEOA 1PZJD 1HUMA 4OL7A 2F0PA 1B50A 3BG3A 2M00A 1D1IA 3FKIB 3KBGA 4FF3A 3SDZA 1JE4A 4CJ1B 1FD7D 3GTMB 2R6GA 1WTOA 2RA4A 1GUTA 1VCIA 4IUVA 3ITPA 2WKDA 1SNOA 1G91A 3W3AA 1DM0B 1LABA 3FEWX 2R93B 2EYFA 2KOLA 2VXWA 2IX1A 2PZWA 4F88A 4HMIA 3NSWA 2F3WA 2PPBC 1BCPF 2MJ8A 3TZDA 1X3QA 1CFMA 2QKIC 2K5DA 5C4ZA 2A6EC 2FINB 4HCEA 4WORA 5K36H 1V1PB 5EBCA 3D4RA 3SXHA 3CHBD 3GTQB 1SYBA 3C46A 4Q5VA 3C3LA 1GHJA 2WIIB 2KEEA 1EY7A 4KD4A 2WP8J 1XX8A 2FHTA 4BY7B 3TN2A 5CGKA 1GUWA 4QMGA 1Y1VB 1BDOA 4A3GB 5CYUA 1CHQD 4XYOA 1I4HA 2MPMA 3VYUA 2V4DA 3A8IE 1PZID 3I72A 2EXZA 3IFTA 4IFDH 3OIQA 5D3IB 3J80E 2WINB 1B9MA 2F3VA 2I07B 4IUUA 3VR2A 4IUPA 1KLGD 2F1MA 1RDPD 1ET9A 2EZVA 2BE5C 2DNEA 1O7ZA 1DJRD 4ME5A 3R2IA 3OWEB 2EY2A 3EROA 2LY7A 1QB5D 3VYTA 1MSGA 4HMJA 1NCVA 2F0KA 1F9RA 4KKSA 3GV3A 4IALA 1ENFA 3U9SA 1JB3A 1AW7A 1KABA 4KY5A 1FNUA 2F0EA 4A3JB 1AN8A 5EQ0A 1TY2A 5BN4A 2ZT9C 5C44B 4Q0FA 4CGYB 2Z8LA 3QWNA 5EJWA 3NTIA 5CBEE 1L0XB 2HCIA 1LTSD 2EYJA 3SK4A 1S5DD 4XXEA 2PZTA 5K36G 2DN8A 2AWOA 1TWFB 1TWAB 4ZKBB 3FRPB 1EIGA 2A68D 4C3JG 4I7ZC 1LTRD 2F0VA 5D3DA 1PRTD 1CQFA 1J9OA 4PMWA 5JVH3 2WACA 5E3FA 1IYUA 4JK1C 1H9SA 1V1PA 3J80L 3PIP3 1QJOA 4K6DA 1G6ZA 1Y8NB 3MC0B 1G2TA 2IW3A 1AFPA 3BYYB 1EIHA 5KYLA 1V43A 1KLUD 3HZXA 1AP0A 2Z1CA 1D6EC 1FNVA 3S2DB 3KLRA 1QE6A 1STNA 2X69A 1ZXTA 1NSNS 2B2UA 3PO2B 2RBMA 2SEBD 1FYCA 4PNYA 2RKSA 1AZPA 1LACA 2NWGA 5IT9L 2NTSA 4A3DB 1B9NA 1HFGA 2SNSA 5COYA 4BA1I 1EYCA 2A6HC 4X3SA 5JPMC 2MHVA 5C6AA 1SE3A 2EJGC 3ND9A 1KDCA 4QB4A 2RSOA 2F0TA 1Y8OB 3SK6A 3NPPA 3H91A 4KD3A 2K5QA 2KHSA 5DEHA 2XVSA 3G7LA 4WRDA 4KN7C 1BXTA 5M9OA 4G7HC 3K5OA 2JA7B 5EKIA 3MTSA 1I4GA 1BNZA 2HQEA 2LFNA 3RLFA 2M2LA 2F0DA 2F0QA 4CKBA 4OO1H 4L6TB 1GJXA 1EYAA 1DOMA 5E4WC 5M5XB 2NB0A 1HQRD 4UAIA 2EE1A 1C48A 3WDNA 1IW7C 3D6CA 3HOZB 4A3EB 1EEID 1Z6HA 4ZRZA 3ONAB 4BS9A 2D62A 2A69D 1DZ1A 4J1MA 4C1NI 4U673 2DY7A 4ZLTF 4F8MA 4DK0A 1AEXA 1BOSA 1I4XA 4QIWB 3JAME 3SK8A 2XN9C 5KYIA 5KIXA 5ELEA 4DAYA 1TKWB 2N55A 4ZUJA 3QOJA 5KRUA 2EOTA 3I8ZA 2IL8A 3GD7A 5ELCA 3S9WA 2DY8A 1BCPB 1B4OA 1EY6A 4CBVA 3SK5A 5DM73 4A3BB 2C9OA 1JWUD 3IFDA 4M8AA 2QCPX 1WTVA 5T1GA 5K5PA 3ND8A 4R8NA 4FP5D 5CV6A 1XYIA 3MFGA 4K5VA 4CKEA 4RA8A 5BN5A 1FGBD 3DWQA 4OO1G 3FDTA 1EL0A 2MUYA 5C4JB 3TZUA 4FO2A 2AQ2B 3URYA 3Q0AA 5DM63 1JOQA 2XRQD 4IUNA 4NP5A 3T53B 1F9PA 1MBYA 3D4WA 5C4HA 3Q6SA 3H09A 3PUYA 3EA6A 4O1NA 1EZ6A 4C3HG 3BZDB 4K2KA 4KTAA 2RDGA 1PFBA 1CT1D 4OO1I 1DD2A 5E1FA 1HUNA 1EQTA 1PXUA 1SJHD 4C3IB 2EY6A 2SDFA 3TBIB 2K03A 1TWHB 3K5NA 5E4XA 4LMQD 2PYKA 1R4QB 3RUZA 4KV6A 5IGBA 1BUVT 3OHXC 2J0TD 2TMPA 3AMUA 1BCPD 4DNRB 1D5ZC 3TP7A 1OXSC 3K5MA 1EY0A 3GTJB 3BDOA 1ESRA 4PQXA 5M5WB 1WVLA 2B2TA 1HXYD 4K6LA 3C1FA 1MSHA 4HN7A 4RKBA 4ZAIA 1LT5D 4B9WA 5BN3A 5C4XB 5JEAG 2EVBA 2BDOA 2L1BA 2L9HA 3EVQA 3MXGA 1U4RA 2SOBA 5JPNC 5HURA 2BA1A 5JVG3 1JR0D 3HOVB 1H9KA 1Y1WB 1H9MA 2VUMB 1A15A 3P75A 1STBA 3OPOA 4K14A 1F2ZA 3LWEA 3NTHA 1S5BD 3I91A 1H9RA 1Y8PB 2F0IA 5CV5A 3E6ZX 4C56C 5EPJA 1WD1A 3KK7A 2H1EA 5HGTA 1JOKA 1JC7A 1EWHA 3AU7A 3RZDB 1V8QA 2CVRA 3CKIB 3I3CA 3SE0A 3QG1A 2WAQB 2XSCA 2F0UA 1K8OA 1PTOC 4KJNA 1RTOA 3VR6A 3NXWA 1STAA 4QF4A 3GV6A 1S5CD 3AB9A 4J8QA 1RHPA 1F2MA 1KDAA 3PMFA 3H6MA 1ZKOA 1LO5D 1YNJC 5IGEA 1SMYD 1SNDA 4XT1B 3D4DA 1U4PA 4K5XA 3O13A 1OXVA 2IX3A 1DOKA 3GQBA 4RGTA 3DMUA 1EEFD 4H7BA 1CI3M 2R61A 1SYGA 2FFKB 2F0MA 1GOZA 5IGGA 1SYEA 5IOCA 1BR9A 1A2TA 4F87A 5I6WA 2NN6H 5G3LF 1Z7TA 3T51B 2ICIA 4QCLA 1O78A 3U9OA 2NVTB 3K7AB 1SNQA 5IGCA 1TVXA 2DNCA 5EPLA 1ENCA 1U4LA 2JEBI 2Z4HA 3SR1A 4XQJA 2WV6D 2XWJB 4Z9CB 1EQVA 3NWTA 4EGVA 2OXPA 3L9AX 5JOBA 1SFOB 2L4NA 3NQTA 1U4MA 5JJZA 1D2BA 1QG7A 1QOHA 4A3FB 4ZQ3A 1Q3LA 2D5DA 3K0YA 1JCKB 4ZYSA 4QUFA 3E5SA 5D65A 2HCCA 3GTGB 1RF2D 1LV9A 2F0WA 3DUZA 4J6HA 4IZ8A 1M4VA 3K57A 2K1BA 2XIWA 5DNFA 1UAPA 2VB2X 1BBXC 5JEAJ 1STYA 2B2VC 1QNKA 4N9TA 2ZXOA 2MGSA 3DWPA 2ICEC 3QIAA 1F9SA 1SAPA 1I3QB 2AUKA 5LHY1 5I9OA 5M3FB 1EY5A 2Q8RE 5FLXE 1EY9A 5FO7B 1II3A 3NQIA 1HCZA 2KA7A 1RKNA 1CQVA 2WKCA 3RMHA 4DGZA 3OMCA 3T16A 3PIO3 2B2YC 4LK1C 4NMZA 1GHKA 5C0XH 4G4KA 1KTKA 1LTTD 3DWAA 4G57A 1Q90A 2N88A 4A3KB 3VA5A 1PDQA 1JOOA 2HUGA 1OO9B 2EJMA 3NWSA 4IFDG 2K01A 2TSSA 2PQEA 3EQLC 3DM1A 5IGDA 2E75C 4DU9A 4A93B 2D2CC 5ELFA 3SEBA 2B8GA 1XWEA 3FPUB 3OSOA 3GTLB 3A8JE 5CORA 3BVGA 4K2LA 4BA2I 1Q1EA 2JXMB 2BDNA 5C3EB 1GUOA 1KAAA 3LX0A 4IFDI 2F0SA 2SNMA 4RCNA 2Z4IA 2CW0D 1D5MC 2B39A 3PUVA 3BDCA 5FLXL 2X6GA 1Q8IA 4H0LC 3HGBA 2K5WA 1YNND 3TSSA 3HG9A 3VR5A 4R8IA 1T5EA 3KBXA 1UUPA 1A6XA 3OWFA 2A74C 4F7XA 1DONA 4XQQA 4IUTA 3CQZB 3OW7A 2PNRC 4LAAA 4ULLA 2A68C 1I6HB 2IT1A 4G7OC 1WCMB 1TU2B 1TIID 1PRTC 3MXNA 3M4YA 4RCOA 2IWHA 5LL6X 2JA5B 2BOSA 4PV1C 3OOCA 2PCFB 3S15B 1Y69U 3GTOB 1H9JA 4EQPA 4A3IB 2R92B 3IKJA 1TS5A 2AQ3B 2K05A 5KEEA 4FXGC 4DAVA 4ZKCB 1ML0D 2NVXB 5EBDA 4FF2A 3TDQA 1SBBB 3KUPA 3FVQA 4KMUC 2JA6B 1W6KA 2QEJC 5J1ZA 1DOLA 5CMDA 2B2WA 1PTOB 5A2QE 2O2LD 1I4PA 1GUSA 2XNAC 1F2YA 3NHHA 4RAUC 2JYOA 2NTTA 1CTMA 4RHSA 2KEDA 3HOXB 1JQYD 1LT3D 1QNUA 3MXPA 3HOUB 2L11A 2QDBA 1PYWD 2PO4A 1E2WA 2GA4B 1ZYRD 1SNPA 1TY0A 2J7ZA 1CZGA 3N52A 1DCZA 1NAPA 1GUNA 4V190 4IFDJ 2IX0A 3HEJA 2OT2A 2O5IC 2M9VA 3T56B 2I46A 4I65A 2KUMA 1WD0A 2WB1B 2EYPA 4RWSC 4YIJA 4FVMA 4L63B 1UEAB 2KCNA 4KY7A 2L5TA 1IL8A 3DHQA 1TWGB 2KQ3A 1CA5A 1HFNA 3IL8A 2ENBA 5IGFA 4LJZC 2O5JC 1TWCB 3EJIA 1V1OA 3WOEA 2A69C 2Q8IB 3JAML 3H0GB 1PMRA 2EDGA 4E6IA 4XDXA 4B9XA 4NW2A 3A54A 4M1UB 5A2QL 2K32A 4XQNA 1M8AA 3RZOB 2L12A 2FMCA 5G3LD 2JSOA 3Q22A 1LT6D 4MIUA 4KJOA 2RDFA 3DEOA 1XXGA 4OHJA 3QOLA 2EYOA 3V96A 3WOFA 4KKUA 4KKTA 3CU7A 1NR2A 3VR3A 3Q24A 1J8IA 4FF1A 1E0BA 4CJ0B 3LWUA 4XYQA 3J81E 1R9TB 2NBFA 3S17B 5J39A 2ID0A 1C4QA 2K6AA 4K5WA 4C3IG 1X3PA 1LT4D 3S2HB 2H4OA 3MFYA 3G6JB 4FF4A 1I50B 3HOWB 3A8KE 3QB3A 4MHEA 1ESFA 5I4DA 4DA2A 1VF5C 5LL6S 1OXXK 2A6ED 2EY1A 3FMCA 3K5LA 1O80A 3W2DA 3PV0A 4IURA 1CHPD 3M4OB 4FNFA 1D5XC 4C1NK 1W6JA 1C8CA 5CV7A 1I4QA 4DF7A 3X3MA 3K59A 1STGA 4BWGB 4V0BA 3NTKA 1KDBA 2K28A 3A56A 4ID6A 2K04A 2F0HA 3J7YW 3R3OA 2MP1A 3C2PA 3FPPA 2OF1A 2PMZB 1QWYA 2HDLA 2IJ0A 1IHZA 3VR4A 2BA0A 2E76C 2EYHA 2R7ZB 1LTID 1U9RA 4IQZA 3OMGA 5A35A 1SXTA 2RVLA 4RKLA 3R93A 1E2ZA 3N6RA 2EPBA 3BVMA 3PUWA 2BE5D 3J81L 1I6VC 2VB3X 3IAYA 2B8FA 3H3VC 1PFMA 4TRDA 1G2SA 2AWNA 1ENAA 1PTOF 1VMPA 1HA5A 3PO3B 4NKLA 4TKOB 2E2JB 2LS01 3E0JA 1LTBD 1DXMA 5IODA 2F0GA 2FJ2A 3L7ZC 1BO0A 5IIFA 1CZWA 1HRJA 1PLFA 4HEDA 4OIJA 2C5CA 3T13A 3Q23A 4HSVA 3VYRA 2B2VA 5FOBB 4TQUS 2JA8B 3ERQA 1A2UA 5EGTA 5NUCA 1EYDA 1JWMD 4O42A 1TS3A 3DEPA 4H44C 1H9SB 1KNEA 5CR3A 1EFID 1HQMC 1KNAA 4KK7A 5FO9B 1EY4A 1VDZA 4UDUC 2EY5A 2K33A 1SJED 4DNTB 3S14B 1PRTB 2J4XA 5FKAC 1CA6A 1JWSD 4XT3B 3PUZA 4P2CB 4ILWA 4RGOS 3P1HA 1RODA 3L3OC 1WTXA 1FR3A 4X3UA 3M7NA 2B2YA 3CRLC 4KN4C 3A7LA 1G291 1SMYC 5M3MB 5I6YA 4BBSB 1PZKD 3CRKC 4NDXA 2F0JA 1HPCA 4C3JB 4HSPA 2IPKD 4ABNA 4CJ2C 2B63B 3NE5B 3H94A 1I4RA 3MA2B 3S1NB 2NN6G 3KLSX 2VNUD 3TMEA 5I2XA 3HOYB 2EJFC 3BS1A 1HTPA 2E2DC 1ICWA 4FXDA 3NK9A 2EYMA 4U68A 4XTCS 2A6HD 4QUCA 5CC4A 1WTQA 4RGNA 3TP6A 1F2LA 5IT9E 1MI2A 1SYDA 5ELDA 1B44D 3MEHA 1IYVA 1ILPA 2NN6I 1B1ZA 4WJWA 3S1RB 1MD2D 3NUCA 4IN3A 2CQAA 5I2YA 2L55A 3P20A 3GP7A 1IKLA 3MXUA 3J7AV 3BDLA 3P7JA 5CBAE 4GZYC 3V2TA 3HP3A 2KECA 4XIGS 1WTRA 4TSSA 1D1KA 5EKKA 1HA6A 3D3RA 2YYZA 3K6OA 2AQ1B 3I70A 4FYDA 2G9DA 1A3UA 3QJYA 3R2TA 5JAVA 1Z47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN3 A;  1B3A A;  2KVM A;  3UI2 A;  5T1G A;  1WTV A;  2HDL A;  2NZ1 D;  2X6L A;  2R3Z A;  2Q8R E;  4X3K A;  5D14 A;  4R8I A;  3DEO A;  3KBX A;  1B2T A;  1J9O A;  4RAU C;  1XYI A;  3G7L A;  2JYO A;  2L1B A;  2L9H A;  2RVL A;  1EOT A;  3R93 A;  1U4R A;  4RA8 A;  5EKI A;  3MTS A;  2EPB A;  4R9W A;  1DON A;  1BNZ A;  2KEE A;  3I90 A;  2KED A;  1NR2 A;  3FDT A;  5T1I A;  1CM9 A;  1A15 A;  2B2T C;  1XX8 A;  2FHT A;  2M2L A;  4IUT A;  4CJ2 C;  4IUQ A;  2L11 A;  3TN2 A;  4DN4 M;  1J8I A;  1GUW A;  1TVX A;  5EPL A;  3LWE A;  5EPK A;  1F9Q A;  1E0B A;  4CJ0 B;  3I91 A;  1U4L A;  1PFM A;  2FFK B;  2B2Y C;  1G2S A;  1DOM A;  2J7Z A;  1VMP A;  3N52 A;  5E4W C;  2D9U A;  1NAP A;  4UAI A;  2EE1 A;  1F9P A;  2MPM A;  2Q8T A;  1WD1 A;  5EPJ A;  2RSN A;  1G6Z A;  1IKM A;  1ICW A;  2H1E A;  1SDF A;  3Q6S A;  1RTN A;  4U68 A;  1G2T A;  4HAE A;  2FJ2 A;  1X3P A;  2N88 A;  4QUC A;  1WTQ A;  3ONA B;  4IUU A;  2L4N A;  1EIH A;  1S4Z A;  2CVR A;  2KUM A;  1BO0 A;  4IUP A;  3QO2 A;  1MGS A;  3MWY W;  1F2L A;  1SSO A;  1JIC A;  3I3C A;  1HRJ A;  1PDQ A;  1U4M A;  5JJZ A;  1WD0 A;  1DZ1 A;  1NR4 A;  3F2U A;  1PFB A;  1PLF A;  1AP0 A;  1MI2 A;  4RWS C;  1O7Y A;  1QG7 A;  1HUM A;  4HED A;  4OIJ A;  5AFW A;  4MHE A;  1WTP A;  2HUG A;  2HDM A;  1O7Z A;  1B50 A;  2DY7 A;  4ZLT F;  1RTO A;  1QE6 A;  1HUN A;  1EQT A;  4X3T A;  2K01 A;  2X69 A;  1Q3L A;  4HSV A;  1ZXT A;  2B2U A;  1VMC A;  3DM1 A;  2SDF A;  1ILP A;  1IL8 A;  1MSG A;  1NCV A;  2B2V A;  1F9R A;  1JE4 A;  4CJ1 B;  1EL0 A;  4QUF A;  2K03 A;  1PFN A;  3GV6 A;  1WTW A;  5D65 A;  2HCC A;  1AZP A;  4OIK A;  1WTO A;  2K05 A;  2NWG A;  1RHP A;  3GV3 A;  1AZQ A;  1CA5 A;  1HFN A;  2RA4 A;  5E4X A;  2N55 A;  4IUV A;  1LV9 A;  4LMQ D;  1HFG A;  4O42 A;  1O80 A;  2EOT A;  3FPU B;  3I8Z A;  4IUR A;  5COY A;  3DEP A;  1G91 A;  5EQ0 A;  3IL8 A;  1IKL A;  2IL8 A;  4ZKC B;  1RJT A;  2K1B A;  5CBA E;  2FMM A;  1ML0 D;  3P7J A;  4X3S A;  3HP3 A;  4HCS A;  2XIW A;  1ILQ A;  5COR A;  1C8C A;  2KEC A;  1KNE A;  4XT1 B;  1KNA A;  1B53 A;  5DNF A;  1WTR A;  2KOL A;  2VXW A;  2DY8 A;  1HHV A;  2BDN A;  5EJW A;  1BBX C;  1B4O A;  1BF4 A;  5CBE E;  3KUP A;  3D6W A;  2NYZ D;  2B2U C;  2HCI A;  2RSO A;  4XDX A;  1U4P A;  4ZK9 B;  3SVM A;  1HA6 A;  2B2V C;  2MJ8 A;  1QNK A;  4NW2 A;  1CA6 A;  4XT3 B;  1ESR A;  3TZD A;  1DOK A;  1X32 A;  1X3Q A;  2K28 A;  2MGS A;  2K04 A;  1WVL A;  2B2T A;  1F9S A;  1ROD A;  1DOL A;  1SAP A;  5CMD A;  2MP1 A;  1WTX A;  3H91 A;  3IFD A;  4ZKB B;  2B2W C;  2B2W A;  1MSH A;  1EIG A;  4X3U A;  2FIN B;  4ZAI A;  2X6G A;  2JP1 A;  1M8A A;  2L12 A;  2B2Y A; 
#chains in the Genus database with same CATH topology
 1IW7 D;  2KVM A;  3K8A A;  3NBI A;  1SRO A;  2YV5 A;  2NZ1 D;  1R4P B;  4X3K A;  1A0I A;  2K4K A;  2KHJ A;  3CQZ H;  1B2T A;  2K7V A;  5C5M A;  4PMC A;  3CPW A;  3I4N B;  4CDF C;  2NUC A;  3OIP A;  4LW1 A;  3S16 H;  3S1Q B;  5M5Y B;  3TRE A;  5CV9 A;  1HNX Q;  1CM9 A;  3T1Y L;  2RHQ B;  3UE0 A;  5CV8 A;  4DXF A;  5EPK A;  4CDE C;  1F9Q A;  4CKC A;  5CV4 A;  4A3K G;  1MHW C;  1A3V A;  1H95 A;  1WCM H;  1X3F A;  4N9P A;  3TS2 A;  1X55 A;  2D9U A;  1Z9F A;  5IYB G;  2F0F A;  2BCO A;  1SDF A;  1E22 A;  1N36 Q;  2NVQ B;  3PSI A;  1EFW A;  1E2V A;  3S15 H;  1RIP A;  1YBY A;  1KRT A;  4H13 C;  1S4Z A;  3A7A B;  1K0S A;  2F0O A;  1JB7 A;  1K28 A;  4A93 G;  1MGS A;  3MWY W;  4A3I H;  2K5H A;  3KLS A;  1VQD A;  4EVO A;  1Q46 A;  1FVI A;  3S16 B;  5C0X G;  1GXD C;  4KY6 A;  5AFW A;  1WTP A;  5I9P A;  2HDM A;  1Q81 C;  1HTL D;  1X3E A;  4OEM B;  2YU9 H;  5J3B A;  4DR1 Q;  3STB C;  2LKV A;  4LFC L;  4YHH Q;  2E2H H;  2GN5 A;  1PFN A;  4N8F A;  4ZUI A;  1AZQ A;  4CHT B;  5C3E G;  1PV4 A;  1DYQ A;  3HKS A;  4RGM A;  1XMQ L;  2I0Q A;  2UXB Q;  4O2D A;  1XTD A;  1NBW A;  1RD9 D;  1RJT A;  2NZO A;  2FMM A;  2PQA A;  2QF7 A;  1SN8 A;  4JI7 Q;  5KGU A;  2F0N A;  2XWB B;  4YCW A;  5C0X I;  2PZU A;  3DXJ C;  2B2U C;  3SVM A;  2CFM A;  1PTO H;  3ULJ A;  2Q2I A;  4UHV A;  2YU9 B;  4GS3 A;  3I4L A;  3NBH A;  2XRS D;  1SYF A;  1HJP A;  3EN2 A;  2F4I A;  4IJL A;  2E2H B;  2JEA I;  3BZC A;  3UI2 A;  1B3A A;  2OQ0 A;  4L8J A;  4JI5 L;  1STE A;  2K52 A;  4MZ9 A;  2ZXR A;  2AHO B;  3HOU H;  1SNM A;  3RLO A;  1BVS A;  3A55 A;  4RH6 A;  3PUX A;  3HFZ B;  1PRT F;  1EU4 A;  2F4V Q;  4DR6 L;  1WCM G;  5KNC A;  1UE6 A;  3KDF A;  1SE2 A;  3MHB A;  3W1G A;  1VS0 A;  4C3H H;  4OGQ C;  3HKZ E;  1QIL A;  5KNB A;  4WJ4 A;  1TR5 A;  4LF5 Q;  4ODG A;  2JA5 G;  2CW0 C;  3M85 A;  3BVZ A;  2NVY H;  4GLA C;  1EQQ A;  2Q8T A;  3H3V H;  3NP8 A;  1IKM A;  5BR8 L;  1UNS A;  1OXT A;  4P75 A;  4KI0 A;  4P71 A;  3J80 i;  1YNN C;  4RHR A;  3W1B A;  4A3I G;  2R92 G;  1LLR D;  4KHP L;  1EY8 A;  3HS0 C;  3CW2 C;  3GTK H;  3GTP H;  3B6Y A;  3TRZ A;  4J15 A;  1X54 A;  1IBM Q;  2E2I B;  4B08 A;  2PMZ E;  3QO2 A;  1STH A;  2ALY B;  4JI2 L;  1SEB D;  1NUC A;  4LF9 L;  2QDL A;  1O7Y A;  1S40 A;  4HR7 B;  1X65 A;  1IBK L;  3EBE A;  1ET6 A;  2PW7 A;  4DK1 A;  4AYB B;  3T4A C;  4C3H B;  1EWC A;  1WTW A;  3CCU A;  1TWC H;  4R4I A;  3V05 A;  2AKW B;  1S3O A;  2F0L A;  2HT1 A;  2JA6 G;  2NVY B;  2HHH L;  3TP8 A;  2AUJ D;  3K58 A;  4DV1 Q;  1SYC A;  1E24 A;  1ILQ A;  4Y7N H;  1TQO A;  3I56 A;  1L1O C;  3GO5 A;  3BYT B;  4DAM A;  4DAP A;  3GTK B;  2CQO A;  2K75 A;  2GVA A;  3RLN A;  3GTP B;  3VA7 A;  3MZ5 A;  1BF4 A;  3AQQ A;  1HZA A;  5IYD H;  2JE6 I;  3ZYY X;  2KJX A;  5JEA H;  1JOR A;  5C3W A;  3RZO H;  1X32 A;  4DV6 L;  4DFA A;  1B7Y B;  3I4M B;  5KND A;  1YJN A;  5IWA Q;  4DV7 Q;  2B2W C;  4JI6 L;  3U4Z A;  1V1Q A;  1LTG D;  1L0Y B;  1S5F D;  3MAQ A;  3HOX G;  3HOU G;  2VQE Q;  2LMC B;  2RDH A;  1GUG A;  1G8Z D;  1QCB D;  3KF8 B;  4HTH A;  4KHV A;  2A73 B;  2H5X A;  4Y7N B;  1K3B C;  4DUZ L;  1R9T H;  4A3M H;  4R9W A;  2RHS B;  3I90 A;  5T1I A;  5C3X A;  4DR5 Q;  4DN4 M;  1PTO D;  2D0P A;  1VQN A;  3CMA A;  2PW5 A;  5ISR A;  3UDF A;  3X3N A;  3G48 A;  1AE2 A;  4GOP B;  5C0X J;  1BKB A;  2G9H D;  5EKL A;  2EQS A;  1DGS A;  5DAU A;  4WFN 3;  1OXU A;  1CK1 A;  1K8M A;  2WB1 G;  1EIY B;  4X62 L;  4BXX H;  2UXD L;  4PZ7 A;  4DXG A;  1RTN A;  1YNJ D;  3CC4 A;  1VF7 A;  1I50 H;  5JJL A;  3I55 A;  4HAE A;  1Q1B A;  2A5H A;  3PIO A;  1X3G A;  2UUA Q;  3CCE A;  1SSO A;  1EQR A;  1CKM A;  1A3T A;  1IL2 A;  1NR4 A;  4DR3 L;  4A3M B;  1Q12 A;  1IBL L;  4EQN A;  1WOC A;  4X3T A;  3I4O A;  1VMC A;  1ZYR C;  1EU3 A;  1PH8 A;  3D31 A;  3R8B A;  3TP5 A;  4BBR H;  4OIK A;  1SE4 A;  2E74 C;  4HJ8 A;  3H0G G;  3SHL A;  3D8G A;  1P8L A;  4K8J A;  2Y0S B;  4S3S A;  1TS4 A;  3PIP A;  1CSP A;  2CHB D;  5ELB A;  2GVB A;  4HCS A;  3UDG A;  3T1Y Q;  1B53 A;  1ZEQ X;  3KF6 A;  3HRZ C;  4DR7 L;  1HHV A;  1FGU A;  3MVV A;  2L0C A;  4K8I A;  5F2D A;  3I73 A;  3D6W A;  2NYZ D;  4ZK9 B;  1HZC A;  2ZXP A;  5J22 A;  2KCC A;  2O4X A;  2RCN A;  3S1M H;  4JBW A;  4BY1 H;  1O7L A;  4G7Z C;  5FO8 B;  4DKA C;  1XTC D;  1W3S A;  4DV4 L;  1BQQ T;  4CDC C;  4B3M L;  2CWA A;  4RFB A;  2JP1 A;  2F03 A;  5D14 A;  4BBR B;  4MN3 A;  4A3L H;  2X6L A;  2R3Z A;  4DPG A;  2UU9 L;  3HKZ B;  4PMB A;  1K83 H;  2Z0S A;  1TT2 A;  2RQX A;  3M7G A;  1EZ8 A;  1N34 L;  1FNW A;  1TS2 A;  2Q2T A;  2QIL A;  1EOT A;  1ONL A;  5FK9 C;  5C5L A;  3J81 j;  1MJE A;  3J7A F;  4EQO A;  2B2T C;  3PO3 H;  2E2J H;  4IUQ A;  1S5E D;  3FKI H;  4GN5 A;  2EYL A;  4I7A A;  3LNN A;  3BJU A;  1RCV D;  1F77 A;  2Z6K C;  3S1M B;  4BXX G;  4BY1 B;  1MKH A;  3M3Y B;  1NY4 A;  1XMQ Q;  2FXQ A;  4FXK C;  2Q2H A;  1SNC A;  3EFX D;  3HOW G;  2RSN A;  1SRU A;  1T5X D;  4ZCK A;  1BCP C;  3VYS A;  3KF8 A;  4C2M B;  4PZ6 A;  1M1K C;  2R93 H;  4YWK A;  4KHZ A;  3RD4 A;  1MIU A;  1TXY A;  1K83 B;  3C1E A;  1LTA D;  1JIC A;  3F2U A;  1EIF A;  5TSS A;  2OEO A;  1PZJ D;  1HUM A;  4OL7 A;  2F0P A;  2L15 A;  1B70 B;  1B50 A;  1PH9 A;  4GOP A;  3BG3 A;  2M00 A;  1D1I A;  3FKI B;  3KBG A;  3JAM i;  4FF3 A;  4JCV E;  1JE4 A;  3SDZ A;  4CJ1 B;  1FD7 D;  2A1A A;  3GTM B;  3HKZ G;  2R6G A;  1WTO A;  1CKN B;  3KLW A;  2RA4 A;  1GUT A;  1VCI A;  4IUV A;  3ITP A;  2WKD A;  1SNO A;  4L5R C;  1G91 A;  3W3A A;  3M9B A;  3RN2 A;  3CC2 A;  3S14 H;  1DM0 B;  1LAB A;  4DR6 Q;  3FEW X;  2R93 B;  2EYF A;  1VQG A;  2KOL A;  2VXW A;  2Z9H A;  2IX1 A;  2PZW A;  1XPO A;  4F88 A;  4BY7 H;  4HMI A;  2IHF A;  3NSW A;  2F3W A;  2PPB C;  2OWO A;  2VZA A;  1BCP F;  1PH2 A;  2F4V L;  2MJ8 A;  1Y1V H;  4DV3 L;  4QGU A;  3TZD A;  1X3Q A;  4KLK A;  1CFM A;  2R7Z G;  2I5H A;  4A3G H;  2QKI C;  2UXC Q;  1GD7 A;  2K5D A;  5C4Z A;  4A3L G;  2A6E C;  4JI8 Q;  5GAH C;  4JOI A;  4BBS H;  1A8V A;  2FIN B;  4HCE A;  4WOR A;  5K36 H;  1V1P B;  5EBC A;  4IOC A;  1B8A A;  3D4R A;  4JI2 Q;  3CHB D;  3SXH A;  4LNQ A;  1K3R A;  4LF9 Q;  3GTQ B;  2YTV A;  3PGZ A;  1SYB A;  3BU2 A;  3SGI A;  3C46 A;  1IBK Q;  3K81 C;  4Q5V A;  3C3L A;  3PF5 A;  3PO3 G;  4LFB L;  1GHJ A;  1NMG A;  3FKI G;  2WII B;  2KEE A;  1YZ6 A;  3S1N H;  1EY7 A;  2WP8 J;  4KD4 A;  1XX8 A;  2FHT A;  4BY7 B;  2Z6B A;  3TN2 A;  1YIT A;  5CGK A;  3HOY H;  1GUW A;  2KHI A;  4QMG A;  3H15 A;  1Y1V B;  2K14 A;  1BDO A;  1K0R A;  1CUK A;  4A3G B;  5CYU A;  3ULP A;  1QVG A;  1CHQ D;  4XYO A;  1I4H A;  2MPM A;  3VYU A;  2CH4 W;  2V4D A;  4A3J H;  3A8I E;  1PZI D;  1IZ6 A;  2EXZ A;  3I72 A;  3IFT A;  4IFD H;  3OIQ A;  5D3I B;  3J80 E;  2WIN B;  5LMU Q;  5C44 H;  1B9M A;  2F3V A;  2I07 B;  3CCQ A;  4IUU A;  3VR2 A;  5FLX c;  1GKH A;  3M4P A;  1YHA A;  4IUP A;  1KLG D;  2F1M A;  1RDP D;  2JA8 G;  1ET9 A;  2PI2 E;  2EZV A;  2BE5 C;  3S1R H;  4B3R Q;  2DNE A;  1O7Z A;  4HJ5 A;  1DJR D;  1KIX A;  4QJF A;  5LMN Q;  4ME5 A;  4JI6 Q;  3R2I A;  2UUB L;  3OWE B;  2EY2 A;  3ERO A;  2LXJ A;  2LY7 A;  1TWF H;  1QB5 D;  1TWA H;  3VYT A;  1MSG A;  4HMJ A;  1NCV A;  2F0K A;  1F9R A;  1HNZ Q;  4KKS A;  5IWA L;  1RL2 A;  3GV3 A;  4IAL A;  1ENF A;  3U9S A;  4DV7 L;  1JB3 A;  1AW7 A;  1KAB A;  4KY5 A;  1V9P A;  4B3T Q;  1FNU A;  2F0E A;  2RCF A;  4A3J B;  1YHQ A;  3ICE A;  4DUZ Q;  1AN8 A;  5EQ0 A;  1TY2 A;  5BN4 A;  2ZT9 C;  5C44 B;  2ATW A;  2HQL A;  4Q0F A;  4CGY B;  3TS0 A;  4A3C H;  2Z8L A;  3QWN A;  5EJW A;  3NTI A;  5CBE E;  3G71 A;  1L0X B;  2HCI A;  1LTS D;  2EYJ A;  3SK4 A;  5M3M G;  4DR5 L;  1S5D D;  4L5Q A;  4BBS G;  1CSQ A;  2ZTE A;  2UXD Q;  4XXE A;  1CKN A;  2PZT A;  5K36 G;  2DN8 A;  2AWO A;  1TWF B;  1TWA B;  4ZKB B;  3FRP B;  1EIG A;  2A68 D;  4C3J G;  4I7Z C;  1QUQ A;  3I4N H;  1LTR D;  5M5Y H;  4AYB E;  4H02 A;  2F0V A;  1G51 A;  5D3D A;  4YCU A;  1PRT D;  1CQF A;  2A8V A;  2B63 G;  1J9O A;  4P72 A;  2D0O A;  4PMW A;  5JVH 3;  3HOY G;  2WAC A;  5E3F A;  3S2D H;  1IYU A;  1SLJ A;  4JK1 C;  1E1O A;  2F3I A;  3PO2 H;  4QQB X;  1L1O B;  4JG2 A;  1H9S A;  1V1P A;  3J80 L;  3PIP 3;  4A3D H;  1QJO A;  4K6D A;  1G6Z A;  1Y8N B;  4X6A H;  3MC0 B;  2DJF C;  1G2T A;  2IW3 A;  4DAY B;  4DR7 Q;  1AFP A;  3BYY B;  2R7F A;  1EIH A;  4O0A A;  5KYL A;  1V43 A;  1KLU D;  3HZX A;  1AP0 A;  2Z1C A;  1D6E C;  1FNV A;  1HZB A;  4DV4 Q;  4DV5 L;  3S2D B;  3KLR A;  4YCV A;  1QE6 A;  1STN A;  4B3M Q;  2X69 A;  1PH3 A;  1ZXT A;  1NSN S;  2B2U A;  3PO2 B;  2RBM A;  2SEB D;  1FYC A;  4PNY A;  2UU9 Q;  2RKS A;  3F1Z A;  1AZP A;  1LAC A;  2NWG A;  3CP0 A;  5IT9 L;  4JPB W;  2NTS A;  4A3D B;  1B9N A;  1HFG A;  2SNS A;  1N34 Q;  5COY A;  4BA1 I;  4DNI A;  1EYC A;  2A6H C;  4X3S A;  4X66 L;  5JPM C;  4AQY L;  2MHV A;  5H1S E;  2JA7 H;  5C6A A;  3NEM A;  1VQH A;  4JC0 A;  2JJQ A;  1SE3 A;  2EJG C;  3ND9 A;  1KDC A;  4QB4 A;  2RSO A;  4HJ7 A;  1HNW Q;  3JC6 6;  2V1C C;  2F0T A;  1Y8O B;  3SK6 A;  5M5X H;  4PZ8 A;  3I4N G;  3NPP A;  3H91 A;  4P73 A;  4KD3 A;  3HOZ H;  1WFQ A;  4A3E H;  5E7N A;  1WI5 A;  2K5Q A;  2KHS A;  1K8G A;  5IP9 G;  4MTK A;  5DEH A;  1XPU A;  2XVS A;  3G7L A;  4WRD A;  4KN7 C;  1BXT A;  5M9O A;  4G7H C;  2Y0S E;  3K5O A;  2JA7 B;  1XJV A;  5EKI A;  3MTS A;  1I4G A;  1BNZ A;  2HQE A;  2LFN A;  3RLF A;  2M2L A;  2I5L X;  2F0D A;  3JAM c;  2F0Q A;  3UDI A;  4CKB A;  1VQO A;  4OO1 H;  4L6T B;  1GJX A;  1EYA A;  3CCR A;  1DOM A;  5E4W C;  5M5X B;  2NB0 A;  1HQR D;  4UAI A;  4A4I A;  2E2I H;  3PCO B;  2EE1 A;  1C48 A;  3WDN A;  1IW7 C;  3I7F A;  4LUV A;  3CC7 A;  1NJI C;  4DR4 Q;  3D6C A;  3HOZ B;  4A3E B;  1EEI D;  4APV A;  1Z6H A;  2KBN A;  4ZRZ A;  3ONA B;  4BS9 A;  5ELO A;  2D62 A;  3U4V A;  2A69 D;  3KFU A;  4DV3 Q;  1DZ1 A;  1WYD A;  4J1M A;  4JW0 A;  4A3B H;  1L1O A;  3S24 A;  4C1N I;  4U67 3;  2DY7 A;  4ZLT F;  2HIV A;  4F8M A;  4DK0 A;  1AEX A;  1BOS A;  1I4X A;  4QIW B;  3JAM E;  2UXC L;  3SK8 A;  2XN9 C;  5KYI A;  4JI8 L;  5KIX A;  4QL5 A;  5ELE A;  4DAY A;  1TKW B;  2N55 A;  4ZUJ A;  3QOJ A;  5KRU A;  2EOT A;  2G5D A;  3I8Z A;  5GAG C;  4LFB Q;  2IL8 A;  2OTL A;  3GD7 A;  5ELC A;  2IHE A;  4X64 L;  1VQF A;  3S9W A;  2DY8 A;  1X9N A;  1BCP B;  1B4O A;  2UUC L;  3I4M H;  5C4J H;  1EY6 A;  3K0X A;  4CBV A;  3SK5 A;  4CDD C;  3VDY A;  5DM7 3;  4A3B B;  2C9O A;  1LM0 A;  1JWU D;  3IFD A;  4M8A A;  2QCP X;  3CCJ A;  2YTY A;  1WTV A;  5T1G A;  5K5P A;  2MQH A;  4Y52 H;  1XNQ Q;  3ND8 A;  5LMU L;  4R8N A;  4FP5 D;  1GM5 A;  5GQO A;  3K80 C;  5CV6 A;  4LUO A;  1XYI A;  3MFG A;  4K5V A;  4CKE A;  4RA8 A;  5BN5 A;  2UUB Q;  1FGB D;  3DWQ A;  4OO1 G;  2LSS A;  3FDT A;  1EL0 A;  2MUY A;  4C3I H;  5C4J B;  4B3R L;  3TZU A;  4FO2 A;  5LMN L;  2AQ2 B;  4JBK A;  3URY A;  3Q0A A;  2A19 A;  5DM6 3;  1TWH H;  1B3Q A;  3AEV A;  1UEB A;  1HNZ L;  1JOQ A;  2XRQ D;  1E7Z A;  4IUN A;  4NP5 A;  3T53 B;  1F9P A;  1MBY A;  3D4W A;  3ER0 A;  5C4H A;  1XMO Q;  3Q6S A;  3H09 A;  3AYH B;  3PUY A;  4B3T L;  3EA6 A;  4O1N A;  1HR0 Q;  4AYB G;  1EZ6 A;  3CCL A;  4C3H G;  3BZD B;  4K2K A;  4KTA A;  1YJW A;  2RDG A;  3CXC A;  1PFB A;  2DGY A;  1CT1 D;  2CCZ A;  4OO1 I;  1DD2 A;  4EX5 A;  1PH7 A;  5E1F A;  5M5W H;  1VQL A;  3T1H Q;  1HUN A;  1EQT A;  1PXU A;  1SJH D;  4R1J A;  4C3I B;  2EY6 A;  2PI2 A;  1D8L A;  2SDF A;  2ZM6 L;  3TBI B;  3J81 c;  2K03 A;  1TWH B;  3K5N A;  5E4X A;  4LMQ D;  2PYK A;  1R4Q B;  1WTH A;  3RUZ A;  5C4X H;  1VQ7 A;  4KV6 A;  5IGB A;  3GDE A;  5GRO A;  1BUV T;  4FDB A;  3OHX C;  2J0T D;  2TMP A;  3I4M G;  5IP7 H;  1BCP D;  3AMU A;  3IRB A;  1D5Z C;  3TP7 A;  4DNR B;  1OXS C;  1Y1W H;  2VUM H;  1JJ2 A;  4UP7 A;  1VQJ A;  3H3V I;  3K5M A;  4JBM A;  1EY0 A;  3GTJ B;  3BDO A;  1ESR A;  4PQX A;  2MO1 A;  5M5W B;  1L0W A;  1WVL A;  2B2T A;  1Q86 C;  1EYG A;  2E5L Q;  1HXY D;  4K6L A;  1CKO A;  3C1F A;  3E3X A;  1MSH A;  4HN7 A;  4RKB A;  4ZAI A;  2Z6K A;  1LT5 D;  3K7U C;  4B9W A;  2F52 A;  5BN3 A;  5IYD G;  5C4X B;  4MTN A;  5JEA G;  2EVB A;  4DV5 Q;  2BDO A;  4GNX C;  1YI2 A;  2L1B A;  2L9H A;  3EVQ A;  3MXG A;  1U4R A;  2SOB A;  4YWM A;  5JPN C;  5HUR A;  2BA1 A;  5JVG 3;  1JR0 D;  3M3Y H;  3HOV B;  1H9K A;  1Y1W B;  1H9M A;  2VUM B;  1A15 A;  1YEZ A;  3P75 A;  1STB A;  3NEN A;  3OPO A;  4K14 A;  1F2Z A;  3LWE A;  3NTH A;  1S5B D;  3I91 A;  4C2M H;  1H9R A;  1Y8P B;  2F0I A;  5CV5 A;  4DV0 Q;  1I94 Q;  3E6Z X;  2XGT A;  4X66 Q;  4C56 C;  5EPJ A;  1WD1 A;  3KK7 A;  4AQY Q;  2H1E A;  5HGT A;  4A3M G;  1JOK A;  1JC7 A;  3A74 A;  3OW2 A;  1EWH A;  3AU7 A;  1U5K A;  1JT8 A;  2ZJQ A;  2OQK A;  1KAW A;  3RZD B;  1EWI A;  1V8Q A;  5IY0 A;  2CVR A;  1SE8 A;  5FJ8 H;  3CKI B;  3I3C A;  3SE0 A;  5FLM H;  3QG1 A;  2WAQ B;  1EOV A;  1ASZ A;  1VQB A;  3GTM H;  2LXK A;  2Y0S G;  2XSC A;  3F8T A;  2F0U A;  4PG3 A;  1QVF A;  1K8O A;  1PTO C;  4KJN A;  1RTO A;  1HNW L;  1VQ8 A;  3VR6 A;  2JN4 A;  3NXW A;  4IPC A;  1STA A;  4QF4 A;  3GV6 A;  3J7A 5;  1FJG L;  1S5C D;  3AB9 A;  4J8Q A;  1RHP A;  1F2M A;  1KDA A;  2P5Z X;  3PMF A;  4DK6 C;  4X65 Q;  3H6M A;  1ZKO A;  5IYC H;  1LO5 D;  1YNJ C;  5IGE A;  5IP7 G;  1C7Y A;  1SMY D;  1SND A;  4XT1 B;  3K7A H;  3ZJY C;  2K5N A;  4BBR G;  3D4D A;  1U4P A;  4K5X A;  3O13 A;  1OXV A;  3PQI A;  2IX3 A;  1DOK A;  1O7I A;  2CKZ B;  3GQB A;  4RGT A;  3DMU A;  5EAY A;  2B29 A;  2ZTC A;  3GTQ H;  2DUD A;  1EEF D;  4H7B A;  3F2B A;  1CI3 M;  2R61 A;  1SYG A;  2FFK B;  2F0M A;  1GOZ A;  1SFO H;  5IGG A;  1SYE A;  5IOC A;  4DR4 L;  1BR9 A;  1A2T A;  4F87 A;  4LF8 L;  3RNU A;  5I6W A;  2NN6 H;  5G3L F;  4BY1 G;  2QW7 A;  5GAD C;  3DLL A;  1Z7T A;  3E9I A;  3T51 B;  2ICI A;  4A3F H;  4QCL A;  1O78 A;  4JI4 Q;  3U9O A;  2NVT B;  4JV5 L;  2MO0 A;  2N78 A;  3K7A B;  2NZH A;  1SNQ A;  5IGC A;  1TVX A;  2DNC A;  5EPL A;  1ENC A;  1XNR Q;  1U4L A;  2JEB I;  3RR5 A;  2Z4H A;  3SR1 A;  4XQJ A;  3CF5 A;  3GTG H;  5AJ3 L;  2WV6 D;  4DR2 L;  1Q82 C;  2XWJ B;  4Z9C B;  1VQM A;  4UP8 A;  1EQV A;  1NNX A;  3NWT A;  4X64 Q;  4JBJ A;  3TEH B;  4EGV A;  2OXP A;  3L9A X;  5JOB A;  3F2D A;  1SFO B;  1BBW A;  2UUC Q;  2L4N A;  4A75 A;  1D7Q A;  3NQT A;  1U4M A;  5JJZ A;  3CAM A;  1D2B A;  1ASY A;  1QG7 A;  1QOH A;  4A3F B;  4UPA A;  2QA4 A;  1PYS B;  4ZQ3 A;  4OWW B;  2HIX A;  1Q3L A;  1HH2 P;  2D5D A;  1Q7Y C;  1I3Q H;  1JCK B;  1P16 A;  3K0Y A;  4ZYS A;  2R93 G;  4QUF A;  4LFA L;  3E5S A;  5IYC G;  5D65 A;  2HCC A;  1KD1 C;  4NXN L;  3GTG B;  1RF2 D;  1LV9 A;  2F0W A;  2DJG C;  3DUZ A;  4DV2 L;  4J6H A;  4IZ8 A;  1M4V A;  3K57 A;  1XNQ L;  2K1B A;  2XIW A;  5DNF A;  1UAP A;  2JQO A;  2VB2 X;  3CCV A;  1BBX C;  4DK3 C;  2WFW A;  4AIM A;  1K73 C;  1VQ4 A;  4POF A;  5JEA J;  1STY A;  2KCT A;  2B2V C;  1QNK A;  4ME3 A;  4N9T A;  1BBU A;  1PA6 A;  2ZXO A;  2HD3 A;  2MGS A;  3DWP A;  2ICE C;  4IPG A;  3QIA A;  1F9S A;  1T9H A;  1K8A C;  1SAP A;  4JOI C;  1I3Q B;  2AUK A;  4OXP A;  3UE1 A;  5LHY 1;  5I9O A;  2VW9 A;  5M3F B;  4BY7 G;  1EY5 A;  1QZG A;  1XMO L;  4N8X 1;  4QIW E;  4A3K H;  2Q8R E;  4LF4 L;  5FLX E;  1E3P A;  1EY9 A;  2B3G A;  1Y1V G;  5FO7 B;  1HR0 L;  4A3G G;  3CPF A;  5IYB H;  3MXN B;  1II3 A;  3NQI A;  3KJP A;  2ZJR A;  1HCZ A;  2KA7 A;  5GAE C;  2ZM6 Q;  3CME A;  1RKN A;  1CQV A;  2WKC A;  2N49 A;  3T1H L;  3RMH A;  4DGZ A;  3OMC A;  3PF4 A;  3T16 A;  4A93 H;  3BZK A;  3J81 i;  3STB D;  2B2Y C;  3PIO 3;  4LK1 C;  4NMZ A;  4OWX B;  1GHK A;  5C0X H;  1WJJ A;  1X6O A;  4G4K A;  3GTL H;  1KTK A;  1LTT D;  4HIM A;  3DWA A;  4G57 A;  1Q90 A;  2N88 A;  4K0K Q;  4A3K B;  3NBH B;  3VA5 A;  2I5M X;  5C3E H;  1PDQ A;  3NEL A;  1A62 A;  1JOO A;  4POG A;  3EIV A;  2HUG A;  4A3J G;  1OO9 B;  2EJM A;  2BH8 A;  3NWS A;  4IFD G;  2K01 A;  2TSS A;  2PQE A;  5C44 G;  1YIJ A;  3EQL C;  3DM1 A;  5HY6 A;  5IGD A;  2E75 C;  2E5L L;  4LF6 Q;  4DU9 A;  4A93 B;  2D2C C;  3AFQ A;  5ELF A;  3SEB A;  3RN5 A;  1EUJ A;  2B8G A;  1YHB A;  1XWE A;  3FPU B;  1AH9 A;  2R7D A;  3OSO A;  3GTL B;  1PFS A;  4GKJ Q;  3A8J E;  5COR A;  3BVG A;  4K2L A;  4BA2 I;  1YNX A;  1Q1E A;  2JXM B;  2N8N A;  2BDN A;  5C3E B;  2QGQ A;  1GUO A;  1KAA A;  4LF7 L;  1KL9 A;  4TVA B;  3LX0 A;  4IFD I;  1I5F A;  2F0S A;  2SNM A;  4RCN A;  2ZTD A;  1NMF A;  3OYY A;  2Z4I A;  1PH6 A;  2CW0 D;  1D5M C;  5L37 A;  2B39 A;  3PUV A;  1I6H H;  3BDC A;  4DV0 L;  1OTC A;  5FLX L;  1I94 L;  2X6G A;  4A3C G;  1Q8I A;  2AMC B;  4H0L C;  1UWV A;  3HGB A;  2K5W A;  2JA9 A;  1YNN D;  3TSS A;  3CCM A;  2JA5 H;  3HG9 A;  3VR5 A;  4R8I A;  1T5E A;  3KBX A;  1UUP A;  3J7Z C;  1A6X A;  3OWF A;  3G6E A;  2A74 C;  3GTO H;  4F7X A;  1DON A;  4XQQ A;  4IUT A;  3CQZ B;  3ULL A;  2BH2 A;  2R92 H;  1PH1 A;  1FJG Q;  3OW7 A;  2PNR C;  4LAA A;  4R4C A;  4ULL A;  2A68 C;  1I6H B;  2IT1 A;  4X65 L;  1WCM B;  4G7O C;  1TU2 B;  2NVX H;  4JI3 Q;  1TII D;  2KEN A;  1PRT C;  3MXN A;  3M4Y A;  3PO2 G;  4RCO A;  1LYL A;  2KCM A;  2IWH A;  5LL6 X;  2JA5 B;  1M90 C;  2BOS A;  4PV1 C;  2JA6 H;  1C9O A;  3OOC A;  2PCF B;  3U58 A;  3S15 B;  4A3D G;  4R4Q A;  3I2Z A;  1Y69 U;  3GTO B;  1H9J A;  4EQP A;  4A3I B;  4GNX B;  2R92 B;  1KQS A;  1JJC B;  1LTL A;  2VS1 A;  3IKJ A;  4GKK L;  1KHI A;  1TS5 A;  3W5O A;  2AQ3 B;  4LF8 Q;  2K05 A;  4GLV B;  2CH4 A;  4QY7 A;  5KEE A;  3OTO Q;  4FXG C;  4YY3 Q;  4DAV A;  4JI1 L;  1JMC A;  4ZKC B;  3G4S A;  1ML0 D;  4JV5 Q;  2NVX B;  5EBD A;  1KC8 C;  3DM3 A;  4HJ9 A;  4FF2 A;  3TDQ A;  3HOX H;  1SBB B;  3KUP A;  4JI4 L;  3FVQ A;  1GVP A;  4KMU C;  2JA6 B;  4NXM Q;  1W6K A;  5AJ3 Q;  4DR2 Q;  1XPR A;  2QEJ C;  4GN3 B;  5J1Z A;  4JVZ A;  1XNR L;  5DLQ E;  3UDX A;  1DOL A;  2ZJP A;  2WAQ E;  5CMD A;  2JA7 G;  2B2W A;  1PTO B;  5A2Q E;  2ES2 A;  2O2L D;  4GN4 B;  1HZ9 A;  1I4P A;  1GUS A;  2XNA C;  1F2Y A;  4DUY L;  1NTG A;  3NHH A;  4RAU C;  2JYO A;  2NTT A;  1CTM A;  5ELN A;  1VQ6 A;  1NE3 A;  4RHS A;  2KED A;  3HOX B;  1JQY D;  1LT3 D;  1QNU A;  2XTI A;  3MXP A;  4LFA Q;  3HOZ G;  4R4O A;  2L11 A;  4A3E G;  4NXN Q;  2QDB A;  1G6P A;  1TWG H;  1PYW D;  2PO4 A;  1E2W A;  2GA4 B;  3KF6 B;  1ZYR D;  4DV2 Q;  1SNP A;  1TY0 A;  2J7Z A;  3HOU B;  1CZG A;  3N52 A;  1DCZ A;  1NAP A;  1GUN A;  4V19 0;  1VQP A;  4IFD J;  2IX0 A;  3HEJ A;  4HJA A;  2OT2 A;  2O5I C;  2M9V A;  3T56 B;  1N9W A;  2I46 A;  4I65 A;  2KUM A;  3H0G H;  4GLX A;  1WD0 A;  2WB1 B;  2EYP A;  4RWS C;  4YIJ A;  4FVM A;  3LGJ A;  4L63 B;  4NPS A;  1UEA B;  2KCN A;  4LWC A;  4KY7 A;  3DHQ A;  2L5T A;  1IL8 A;  1FL0 A;  1TWG B;  2KQ3 A;  1VQ9 A;  4LF4 Q;  1VQK A;  1CA5 A;  1HFN A;  4B3S Q;  1QVC A;  2VQF L;  2ASB A;  4A3B G;  3IL8 A;  2ENB A;  4IPD A;  5IGF A;  4LJZ C;  2O5J C;  1TWC B;  3GTJ H;  1J5E Q;  3EJI A;  2MNA A;  1V1O A;  3WOE A;  2A69 C;  2Q8I B;  1S72 A;  3JAM L;  5LMN W;  1VQA A;  1GO3 E;  4EQ5 A;  3H0G B;  1PMR A;  2EDG A;  4E6I A;  4XDX A;  4B9X A;  4GNX A;  4JI0 Q;  4JYA Q;  3L0O A;  4NW2 A;  4IPH A;  3A54 A;  1IXR A;  3S17 H;  2JK8 A;  3ERS X;  4M1U B;  5A2Q L;  3QR8 A;  4L5T A;  2K32 A;  4XQN A;  1M8A A;  3RZO B;  2L12 A;  1N32 Q;  2FMC A;  5G3L D;  4OX9 L;  3S2H H;  2JSO A;  3Q22 A;  1LT6 D;  4MIU A;  3WWV A;  3HOV H;  4KJO A;  2RDF A;  3DEO A;  1XXG A;  4OHJ A;  3QOL A;  4K0K L;  1KRS A;  2OCE A;  3A0J A;  3HOW H;  2EYO A;  3V96 A;  4YWL A;  3WOF A;  4KKU A;  4KKT A;  3CU7 A;  1NR2 A;  1X56 A;  3VR3 A;  3Q24 A;  1J8I A;  1K9M C;  4FF1 A;  1LUZ A;  1E0B A;  1IYJ B;  3LWU A;  4XYQ A;  4CJ0 B;  3J81 E;  1R9T B;  2NBF A;  1JJG A;  1ICF B;  3S17 B;  4LF6 L;  5J39 A;  2ID0 A;  3RZD H;  1C4Q A;  2K6A A;  3M4O H;  1N33 L;  4K5W A;  2OTJ A;  2EIF A;  4C3I G;  1X3P A;  4IO9 A;  1LT4 D;  1U0L A;  3S2H B;  4GKJ L;  1PH4 A;  4LF7 Q;  2H4O A;  3MFY A;  1A63 A;  3G6J B;  4P74 A;  4FF4 A;  1I50 B;  3HOW B;  3A8K E;  3FHW A;  3QB3 A;  4MHE A;  1ESF A;  5I4D A;  4DA2 A;  1VF5 C;  1HNX L;  2MFI A;  5LL6 S;  2E8G A;  1OXX K;  2A6E D;  1PVO A;  2EY1 A;  3FMC A;  3K5L A;  1O80 A;  3W2D A;  3PV0 A;  4IUR A;  1CHP D;  1Y14 B;  3KYH C;  4WJ3 M;  2R7Z H;  3M4O B;  4FNF A;  1D5X C;  2N3S A;  4C1N K;  1W6J A;  1C8C A;  5CV7 A;  1N36 L;  1YVC A;  1I4Q A;  4DF7 A;  3X3M A;  3K59 A;  1STG A;  4BWG B;  4V0B A;  3NTK A;  4L5S A;  1KDB A;  1L2F A;  5C4X G;  2K28 A;  3A56 A;  4ID6 A;  4OEL B;  2K04 A;  2F0H A;  3J7Y W;  4LFC Q;  3R3O A;  2MP1 A;  3C2P A;  2Q2U A;  3FPP A;  2OF1 A;  4MNO A;  2PMZ B;  3HOV G;  1Y1W G;  1W2B A;  2VUM G;  1QWY A;  4DR1 L;  2HDL A;  4YHH L;  2IJ0 A;  1IHZ A;  1Q8K A;  3VR4 A;  3FP9 A;  2NVT H;  2BA0 A;  2E76 C;  4JI3 L;  2EYH A;  2R7Z B;  1LTI D;  1U9R A;  4IQZ A;  3OMG A;  5A35 A;  1SXT A;  3M4Q A;  2RVL A;  4RKL A;  2UXB L;  3R93 A;  1E2Z A;  3N6R A;  2EPB A;  4GKK Q;  4IJH A;  3BVM A;  3PUW A;  2BE5 D;  3J81 L;  4JI7 L;  1I6V C;  2K50 A;  2VB3 X;  2YTX A;  3IAY A;  1SR3 A;  2B8F A;  3H3V C;  1PFM A;  4TRD A;  1N8R C;  2JA8 H;  1G2S A;  2AWN A;  1ENA A;  1PTO F;  1VMP A;  4JI1 Q;  1HA5 A;  3PO3 B;  4NKL A;  4TKO B;  2E2J B;  2LS0 1;  2WAQ G;  3E0J A;  1LTB D;  4JI5 Q;  1DXM A;  5IOD A;  3OTO L;  2F0G A;  4YY3 L;  2RF4 A;  2FJ2 A;  3L7Z C;  1BO0 A;  1QUQ B;  5IIF A;  1CZW A;  1HRJ A;  4RG1 A;  5HGQ A;  1PLF A;  2IY5 B;  4HED A;  4OIJ A;  3AFP A;  2C5C A;  5IE8 A;  4NXM L;  3T13 A;  3Q23 A;  4HSV A;  4OWT B;  3VYR A;  1JE5 A;  2B2V A;  5FOB B;  1E1T A;  3A5U A;  4TQU S;  5FJ8 G;  2JA8 B;  3ERQ A;  2CWP A;  4DUY Q;  5BR8 Q;  3L2P A;  1A2U A;  5EGT A;  5M3M H;  5NUC A;  1EYD A;  1JWM D;  5FLM G;  4UP9 A;  4O42 A;  4LF5 L;  4OON A;  1TS3 A;  3DEP A;  4H44 C;  4KHP Q;  4LUZ A;  1H9S B;  3J80 c;  1KNE A;  5CR3 A;  1VQ5 A;  1EFI D;  1HQM C;  1KNA A;  4KK7 A;  5FO9 B;  4C3J H;  1EY4 A;  1VDZ A;  4UDU C;  4AH6 A;  4GOP C;  2EY5 A;  2K33 A;  1IBM L;  1SJE D;  4DNT B;  3S14 B;  1PRT B;  2J4X A;  5FKA C;  1CA6 A;  1JWS D;  4R4T A;  4XT3 B;  2B63 H;  3PUZ A;  4P2C B;  1C0A A;  5JJI A;  5M3F H;  4ILW A;  4RGO S;  3P1H A;  1ROD A;  3L3O C;  1AE3 A;  1WTX A;  1FR3 A;  4X3U A;  3M7N A;  2HHH Q;  2B2Y A;  3CRL C;  3KOJ A;  4KN4 C;  2K5V A;  3A7L A;  1G29 1;  1QZH A;  2EXD A;  1SMY C;  5M3M B;  4HIO A;  5I6Y A;  4BBS B;  1PZK D;  4HID A;  5IT9 c;  3CRK C;  4NDX A;  2F0J A;  4DV1 L;  1PH5 A;  1HPC A;  2C35 B;  4C3J B;  1KXL A;  4HSP A;  2IPK D;  4ABN A;  4CJ2 C;  4HIK A;  1VQC A;  4DV6 Q;  4ALP A;  1UE1 A;  2B63 B;  1VQI A;  3NE5 B;  3H94 A;  1I4R A;  3MA2 B;  2VQF Q;  3S1N B;  2NN6 G;  3KLS X;  2VNU D;  3TME A;  5I2X A;  3E9H A;  3HOY B;  2EJF C;  3BS1 A;  3F2C A;  1HTP A;  3U50 C;  4A3F G;  2E2D C;  4B3S L;  1ICW A;  4FXD A;  3NK9 A;  2EYM A;  4U68 A;  4XTC S;  1VQE A;  3MEF A;  2A6H D;  4QUC A;  5CC4 A;  1WTQ A;  4RGN A;  1J6Q A;  3TP6 A;  1F2L A;  2PQA B;  2VQE L;  1J5E L;  3TQY A;  5IT9 E;  3E0E A;  2QEX A;  1MI2 A;  1SYD A;  5ELD A;  1PYB A;  3D0F A;  4JI0 L;  1B44 D;  3MEH A;  4JYA L;  1IYV A;  4A76 A;  4OX9 Q;  1ILP A;  2NN6 I;  1B1Z A;  4WJW A;  3S1R B;  2PNH A;  1MD2 D;  3NUC A;  4IN3 A;  2VY3 A;  4X62 Q;  1UE7 A;  1HR0 W;  4RMF A;  1UE5 A;  1YJ9 A;  2CQA A;  5I2Y A;  1N32 L;  2L55 A;  4NB3 A;  3P20 A;  3GP7 A;  4IOA A;  4UY8 C;  1IKL A;  3MXU A;  3J7A V;  3BDL A;  3P7J A;  5CBA E;  3S1Q H;  3V2T A;  3HP3 A;  4GZY C;  2KEC A;  4XIG S;  1WTR A;  1PHJ A;  1MJC A;  4TSS A;  4DR3 Q;  2UUA L;  1D1K A;  5EKK A;  5M3F G;  1IBL Q;  1HA6 A;  3D3R A;  2YYZ A;  3K6O A;  5IP9 H;  2AQ1 B;  3I70 A;  3KJO A;  3Q8D A;  1N33 Q;  5JJK A;  4FYD A;  3KDF B;  3CD6 A;  2WB1 E;  2G9D A;  3CCS A;  1A3U A;  3QJY A;  3R2T A;  3A5Z B;  5JAV A;  1Z47 A;  2VL6 A;  2NVQ H;  1SMX A; 
#chains in the Genus database with same CATH homology
 1IW7 D;  2KVM A;  3NBI A;  2NZ1 D;  1R4P B;  4X3K A;  1B2T A;  2K7V A;  5C5M A;  4PMC A;  3I4N B;  2NUC A;  3OIP A;  3S1Q B;  5M5Y B;  5CV9 A;  1CM9 A;  5CV8 A;  4DXF A;  5EPK A;  1F9Q A;  4CKC A;  5CV4 A;  1A3V A;  4N9P A;  2D9U A;  2F0F A;  2BCO A;  1SDF A;  2NVQ B;  1E2V A;  4H13 C;  1S4Z A;  3A7A B;  2F0O A;  1MGS A;  3MWY W;  3KLS A;  4EVO A;  3S16 B;  5C0X G;  1GXD C;  4KY6 A;  5AFW A;  1WTP A;  5I9P A;  2HDM A;  1HTL D;  2LKV A;  1PFN A;  4ZUI A;  1AZQ A;  4CHT B;  1DYQ A;  4RGM A;  1RD9 D;  1RJT A;  2FMM A;  2QF7 A;  5KGU A;  2F0N A;  2XWB B;  5C0X I;  2PZU A;  3DXJ C;  2B2U C;  3SVM A;  1PTO H;  2YU9 B;  3I4L A;  3NBH A;  2XRS D;  1SYF A;  2F4I A;  2E2H B;  2JEA I;  3UI2 A;  1B3A A;  4L8J A;  1STE A;  2ZXR A;  1SNM A;  3A55 A;  4RH6 A;  3PUX A;  1PRT F;  1EU4 A;  5KNC A;  1SE2 A;  3MHB A;  4OGQ C;  5KNB A;  1QIL A;  1TR5 A;  4ODG A;  2CW0 C;  3M85 A;  3BVZ A;  2Q8T A;  3NP8 A;  1IKM A;  1UNS A;  1OXT A;  4KI0 A;  1YNN C;  4RHR A;  1LLR D;  1EY8 A;  3HS0 C;  2E2I B;  4B08 A;  3QO2 A;  1STH A;  1SEB D;  1NUC A;  1O7Y A;  4HR7 B;  1ET6 A;  2PW7 A;  4DK1 A;  4AYB B;  3T4A C;  4C3H B;  1EWC A;  1WTW A;  3V05 A;  2F0L A;  2NVY B;  3TP8 A;  2AUJ D;  3K58 A;  1SYC A;  1ILQ A;  1TQO A;  3GO5 A;  3BYT B;  4DAP A;  3GTK B;  3GTP B;  3VA7 A;  3MZ5 A;  1BF4 A;  2JE6 I;  3ZYY X;  2KJX A;  5JEA H;  1JOR A;  5C3W A;  1X32 A;  4DFA A;  3I4M B;  5KND A;  2B2W C;  1LTG D;  1L0Y B;  1S5F D;  3MAQ A;  2LMC B;  2RDH A;  1GUG A;  1G8Z D;  1QCB D;  4HTH A;  4KHV A;  2A73 B;  4Y7N B;  4R9W A;  3I90 A;  5T1I A;  5C3X A;  4DN4 M;  1PTO D;  2PW5 A;  5ISR A;  3X3N A;  5C0X J;  2G9H D;  5EKL A;  5DAU A;  4WFN 3;  1OXU A;  1CK1 A;  1K8M A;  4DXG A;  1RTN A;  1YNJ D;  1VF7 A;  4HAE A;  1Q1B A;  2A5H A;  1SSO A;  1A3T A;  1NR4 A;  4A3M B;  1Q12 A;  4EQN A;  4X3T A;  1VMC A;  1ZYR C;  1EU3 A;  3D31 A;  3R8B A;  3TP5 A;  4OIK A;  1SE4 A;  2E74 C;  3SHL A;  3D8G A;  4K8J A;  2Y0S B;  4S3S A;  1TS4 A;  2CHB D;  5ELB A;  4HCS A;  1B53 A;  1ZEQ X;  3HRZ C;  1HHV A;  3MVV A;  2L0C A;  4K8I A;  5F2D A;  3I73 A;  3D6W A;  2NYZ D;  4ZK9 B;  2ZXP A;  5J22 A;  2KCC A;  2O4X A;  4JBW A;  1O7L A;  4G7Z C;  5FO8 B;  1XTC D;  1BQQ T;  4RFB A;  2JP1 A;  2F03 A;  5D14 A;  4BBR B;  4MN3 A;  2X6L A;  2R3Z A;  3HKZ B;  4PMB A;  1TT2 A;  2RQX A;  3M7G A;  1EZ8 A;  1FNW A;  1TS2 A;  2QIL A;  1EOT A;  1ONL A;  5FK9 C;  5C5L A;  3J7A F;  4EQO A;  2B2T C;  4IUQ A;  1S5E D;  2EYL A;  3LNN A;  1RCV D;  1F77 A;  3S1M B;  4BY1 B;  3M3Y B;  4FXK C;  1SNC A;  3EFX D;  2RSN A;  1T5X D;  1BCP C;  3VYS A;  3KF8 A;  4C2M B;  4KHZ A;  3RD4 A;  1K83 B;  3C1E A;  1LTA D;  1JIC A;  3F2U A;  5TSS A;  2OEO A;  1PZJ D;  1HUM A;  4OL7 A;  2F0P A;  1B50 A;  3BG3 A;  2M00 A;  1D1I A;  3FKI B;  3KBG A;  4FF3 A;  3SDZ A;  1JE4 A;  4CJ1 B;  1FD7 D;  3GTM B;  2R6G A;  1WTO A;  2RA4 A;  1GUT A;  1VCI A;  4IUV A;  3ITP A;  2WKD A;  1SNO A;  1G91 A;  3W3A A;  1DM0 B;  1LAB A;  3FEW X;  2R93 B;  2EYF A;  2KOL A;  2VXW A;  2IX1 A;  2PZW A;  4F88 A;  4HMI A;  3NSW A;  2F3W A;  2PPB C;  1BCP F;  2MJ8 A;  3TZD A;  1X3Q A;  1CFM A;  2QKI C;  2K5D A;  5C4Z A;  2A6E C;  2FIN B;  4HCE A;  4WOR A;  5K36 H;  1V1P B;  5EBC A;  3D4R A;  3SXH A;  3CHB D;  3GTQ B;  1SYB A;  3C46 A;  4Q5V A;  3C3L A;  1GHJ A;  2WII B;  2KEE A;  1EY7 A;  4KD4 A;  2WP8 J;  1XX8 A;  2FHT A;  4BY7 B;  3TN2 A;  5CGK A;  1GUW A;  4QMG A;  1Y1V B;  1BDO A;  4A3G B;  5CYU A;  1CHQ D;  4XYO A;  1I4H A;  2MPM A;  3VYU A;  2V4D A;  3A8I E;  1PZI D;  3I72 A;  2EXZ A;  3IFT A;  4IFD H;  3OIQ A;  5D3I B;  3J80 E;  2WIN B;  1B9M A;  2F3V A;  2I07 B;  4IUU A;  3VR2 A;  4IUP A;  1KLG D;  2F1M A;  1RDP D;  1ET9 A;  2EZV A;  2BE5 C;  2DNE A;  1O7Z A;  1DJR D;  4ME5 A;  3R2I A;  3OWE B;  2EY2 A;  3ERO A;  2LY7 A;  1QB5 D;  3VYT A;  1MSG A;  4HMJ A;  1NCV A;  2F0K A;  1F9R A;  4KKS A;  3GV3 A;  4IAL A;  1ENF A;  3U9S A;  1JB3 A;  1AW7 A;  1KAB A;  4KY5 A;  1FNU A;  2F0E A;  4A3J B;  1AN8 A;  5EQ0 A;  1TY2 A;  5BN4 A;  2ZT9 C;  5C44 B;  4Q0F A;  4CGY B;  2Z8L A;  3QWN A;  5EJW A;  3NTI A;  5CBE E;  1L0X B;  2HCI A;  1LTS D;  2EYJ A;  3SK4 A;  1S5D D;  4XXE A;  2PZT A;  5K36 G;  2DN8 A;  2AWO A;  1TWF B;  1TWA B;  4ZKB B;  3FRP B;  1EIG A;  2A68 D;  4C3J G;  4I7Z C;  1LTR D;  2F0V A;  5D3D A;  1PRT D;  1CQF A;  1J9O A;  4PMW A;  5JVH 3;  2WAC A;  5E3F A;  1IYU A;  4JK1 C;  1H9S A;  1V1P A;  3J80 L;  3PIP 3;  1QJO A;  4K6D A;  1G6Z A;  1Y8N B;  3MC0 B;  1G2T A;  2IW3 A;  1AFP A;  3BYY B;  1EIH A;  5KYL A;  1V43 A;  1KLU D;  3HZX A;  1AP0 A;  2Z1C A;  1D6E C;  1FNV A;  3S2D B;  3KLR A;  1QE6 A;  1STN A;  2X69 A;  1ZXT A;  1NSN S;  2B2U A;  3PO2 B;  2RBM A;  2SEB D;  1FYC A;  4PNY A;  2RKS A;  1AZP A;  1LAC A;  2NWG A;  5IT9 L;  2NTS A;  4A3D B;  1B9N A;  1HFG A;  2SNS A;  5COY A;  4BA1 I;  1EYC A;  2A6H C;  4X3S A;  5JPM C;  2MHV A;  5C6A A;  1SE3 A;  2EJG C;  3ND9 A;  1KDC A;  4QB4 A;  2RSO A;  2F0T A;  1Y8O B;  3SK6 A;  3NPP A;  3H91 A;  4KD3 A;  2K5Q A;  2KHS A;  5DEH A;  2XVS A;  3G7L A;  4WRD A;  4KN7 C;  1BXT A;  5M9O A;  4G7H C;  3K5O A;  2JA7 B;  5EKI A;  3MTS A;  1I4G A;  1BNZ A;  2HQE A;  2LFN A;  3RLF A;  2M2L A;  2F0D A;  2F0Q A;  4CKB A;  4OO1 H;  4L6T B;  1GJX A;  1EYA A;  1DOM A;  5E4W C;  5M5X B;  2NB0 A;  1HQR D;  4UAI A;  2EE1 A;  1C48 A;  3WDN A;  1IW7 C;  3D6C A;  3HOZ B;  4A3E B;  1EEI D;  1Z6H A;  4ZRZ A;  3ONA B;  4BS9 A;  2D62 A;  2A69 D;  1DZ1 A;  4J1M A;  4C1N I;  4U67 3;  2DY7 A;  4ZLT F;  4F8M A;  4DK0 A;  1AEX A;  1BOS A;  1I4X A;  4QIW B;  3JAM E;  3SK8 A;  2XN9 C;  5KYI A;  5KIX A;  5ELE A;  4DAY A;  1TKW B;  2N55 A;  4ZUJ A;  3QOJ A;  5KRU A;  2EOT A;  3I8Z A;  2IL8 A;  3GD7 A;  5ELC A;  3S9W A;  2DY8 A;  1BCP B;  1B4O A;  1EY6 A;  4CBV A;  3SK5 A;  5DM7 3;  4A3B B;  2C9O A;  1JWU D;  3IFD A;  4M8A A;  2QCP X;  1WTV A;  5T1G A;  5K5P A;  3ND8 A;  4R8N A;  4FP5 D;  5CV6 A;  1XYI A;  3MFG A;  4K5V A;  4CKE A;  4RA8 A;  5BN5 A;  1FGB D;  3DWQ A;  4OO1 G;  3FDT A;  1EL0 A;  2MUY A;  5C4J B;  3TZU A;  4FO2 A;  2AQ2 B;  3URY A;  3Q0A A;  5DM6 3;  1JOQ A;  2XRQ D;  4IUN A;  4NP5 A;  3T53 B;  1F9P A;  1MBY A;  3D4W A;  5C4H A;  3Q6S A;  3H09 A;  3PUY A;  3EA6 A;  4O1N A;  1EZ6 A;  4C3H G;  3BZD B;  4K2K A;  4KTA A;  2RDG A;  1PFB A;  1CT1 D;  4OO1 I;  1DD2 A;  5E1F A;  1HUN A;  1EQT A;  1PXU A;  1SJH D;  4C3I B;  2EY6 A;  2SDF A;  3TBI B;  2K03 A;  1TWH B;  3K5N A;  5E4X A;  4LMQ D;  2PYK A;  1R4Q B;  3RUZ A;  4KV6 A;  5IGB A;  1BUV T;  3OHX C;  2J0T D;  2TMP A;  3AMU A;  1BCP D;  4DNR B;  1D5Z C;  3TP7 A;  1OXS C;  3K5M A;  1EY0 A;  3GTJ B;  3BDO A;  1ESR A;  4PQX A;  5M5W B;  1WVL A;  2B2T A;  1HXY D;  4K6L A;  3C1F A;  1MSH A;  4HN7 A;  4RKB A;  4ZAI A;  1LT5 D;  4B9W A;  5BN3 A;  5C4X B;  5JEA G;  2EVB A;  2BDO A;  2L1B A;  2L9H A;  3EVQ A;  3MXG A;  1U4R A;  2SOB A;  5JPN C;  5HUR A;  2BA1 A;  5JVG 3;  1JR0 D;  3HOV B;  1H9K A;  1Y1W B;  1H9M A;  2VUM B;  1A15 A;  3P75 A;  1STB A;  3OPO A;  4K14 A;  1F2Z A;  3LWE A;  3NTH A;  1S5B D;  3I91 A;  1H9R A;  1Y8P B;  2F0I A;  5CV5 A;  3E6Z X;  4C56 C;  5EPJ A;  1WD1 A;  3KK7 A;  2H1E A;  5HGT A;  1JOK A;  1JC7 A;  1EWH A;  3AU7 A;  3RZD B;  1V8Q A;  2CVR A;  3CKI B;  3I3C A;  3SE0 A;  3QG1 A;  2WAQ B;  2XSC A;  2F0U A;  1K8O A;  1PTO C;  4KJN A;  1RTO A;  3VR6 A;  3NXW A;  1STA A;  4QF4 A;  3GV6 A;  1S5C D;  3AB9 A;  4J8Q A;  1RHP A;  1F2M A;  1KDA A;  3PMF A;  3H6M A;  1ZKO A;  1LO5 D;  1YNJ C;  5IGE A;  1SMY D;  1SND A;  4XT1 B;  3D4D A;  1U4P A;  4K5X A;  3O13 A;  1OXV A;  2IX3 A;  1DOK A;  3GQB A;  4RGT A;  3DMU A;  1EEF D;  4H7B A;  1CI3 M;  2R61 A;  1SYG A;  2FFK B;  2F0M A;  1GOZ A;  5IGG A;  1SYE A;  5IOC A;  1BR9 A;  1A2T A;  4F87 A;  5I6W A;  2NN6 H;  5G3L F;  1Z7T A;  3T51 B;  2ICI A;  4QCL A;  1O78 A;  3U9O A;  2NVT B;  3K7A B;  1SNQ A;  5IGC A;  1TVX A;  2DNC A;  5EPL A;  1ENC A;  1U4L A;  2JEB I;  2Z4H A;  3SR1 A;  4XQJ A;  2WV6 D;  2XWJ B;  4Z9C B;  1EQV A;  3NWT A;  4EGV A;  2OXP A;  3L9A X;  5JOB A;  1SFO B;  2L4N A;  3NQT A;  1U4M A;  5JJZ A;  1D2B A;  1QG7 A;  1QOH A;  4A3F B;  4ZQ3 A;  1Q3L A;  2D5D A;  3K0Y A;  1JCK B;  4ZYS A;  4QUF A;  3E5S A;  5D65 A;  2HCC A;  3GTG B;  1RF2 D;  1LV9 A;  2F0W A;  3DUZ A;  4J6H A;  4IZ8 A;  1M4V A;  3K57 A;  2K1B A;  2XIW A;  5DNF A;  1UAP A;  2VB2 X;  1BBX C;  5JEA J;  1STY A;  2B2V C;  1QNK A;  4N9T A;  2ZXO A;  2MGS A;  3DWP A;  2ICE C;  3QIA A;  1F9S A;  1SAP A;  1I3Q B;  2AUK A;  5LHY 1;  5I9O A;  5M3F B;  1EY5 A;  2Q8R E;  5FLX E;  1EY9 A;  5FO7 B;  1II3 A;  3NQI A;  1HCZ A;  2KA7 A;  1RKN A;  1CQV A;  2WKC A;  3RMH A;  4DGZ A;  3OMC A;  3T16 A;  3PIO 3;  2B2Y C;  4LK1 C;  4NMZ A;  1GHK A;  5C0X H;  4G4K A;  1KTK A;  1LTT D;  3DWA A;  4G57 A;  1Q90 A;  2N88 A;  4A3K B;  3VA5 A;  1PDQ A;  1JOO A;  2HUG A;  1OO9 B;  2EJM A;  3NWS A;  4IFD G;  2K01 A;  2TSS A;  2PQE A;  3EQL C;  3DM1 A;  5IGD A;  2E75 C;  4DU9 A;  4A93 B;  2D2C C;  5ELF A;  3SEB A;  2B8G A;  1XWE A;  3FPU B;  3OSO A;  3GTL B;  3A8J E;  5COR A;  3BVG A;  4K2L A;  4BA2 I;  1Q1E A;  2JXM B;  2BDN A;  5C3E B;  1GUO A;  1KAA A;  3LX0 A;  4IFD I;  2F0S A;  2SNM A;  4RCN A;  2Z4I A;  2CW0 D;  1D5M C;  2B39 A;  3PUV A;  3BDC A;  5FLX L;  2X6G A;  1Q8I A;  4H0L C;  3HGB A;  2K5W A;  1YNN D;  3TSS A;  3HG9 A;  3VR5 A;  4R8I A;  1T5E A;  3KBX A;  1UUP A;  1A6X A;  3OWF A;  2A74 C;  4F7X A;  1DON A;  4XQQ A;  4IUT A;  3CQZ B;  3OW7 A;  2PNR C;  4LAA A;  4ULL A;  2A68 C;  1I6H B;  2IT1 A;  4G7O C;  1WCM B;  1TU2 B;  1TII D;  1PRT C;  3MXN A;  3M4Y A;  4RCO A;  2IWH A;  5LL6 X;  2JA5 B;  2BOS A;  4PV1 C;  3OOC A;  2PCF B;  3S15 B;  1Y69 U;  3GTO B;  1H9J A;  4EQP A;  4A3I B;  2R92 B;  3IKJ A;  1TS5 A;  2AQ3 B;  2K05 A;  5KEE A;  4FXG C;  4DAV A;  4ZKC B;  1ML0 D;  2NVX B;  5EBD A;  4FF2 A;  3TDQ A;  1SBB B;  3KUP A;  3FVQ A;  4KMU C;  2JA6 B;  1W6K A;  2QEJ C;  5J1Z A;  1DOL A;  5CMD A;  2B2W A;  1PTO B;  5A2Q E;  2O2L D;  1I4P A;  1GUS A;  2XNA C;  1F2Y A;  3NHH A;  4RAU C;  2JYO A;  2NTT A;  1CTM A;  4RHS A;  2KED A;  3HOX B;  1JQY D;  1LT3 D;  1QNU A;  3MXP A;  3HOU B;  2L11 A;  2QDB A;  1PYW D;  2PO4 A;  1E2W A;  2GA4 B;  1ZYR D;  1SNP A;  1TY0 A;  2J7Z A;  1CZG A;  3N52 A;  1DCZ A;  1NAP A;  1GUN A;  4V19 0;  4IFD J;  2IX0 A;  3HEJ A;  2OT2 A;  2O5I C;  2M9V A;  3T56 B;  2I46 A;  4I65 A;  2KUM A;  1WD0 A;  2WB1 B;  2EYP A;  4RWS C;  4YIJ A;  4FVM A;  4L63 B;  1UEA B;  2KCN A;  4KY7 A;  2L5T A;  1IL8 A;  3DHQ A;  1TWG B;  2KQ3 A;  1CA5 A;  1HFN A;  3IL8 A;  2ENB A;  5IGF A;  4LJZ C;  2O5J C;  1TWC B;  3EJI A;  1V1O A;  3WOE A;  2A69 C;  2Q8I B;  3JAM L;  3H0G B;  1PMR A;  2EDG A;  4E6I A;  4XDX A;  4B9X A;  4NW2 A;  3A54 A;  4M1U B;  5A2Q L;  2K32 A;  4XQN A;  1M8A A;  3RZO B;  2L12 A;  2FMC A;  5G3L D;  2JSO A;  3Q22 A;  1LT6 D;  4MIU A;  4KJO A;  2RDF A;  3DEO A;  1XXG A;  4OHJ A;  3QOL A;  2EYO A;  3V96 A;  3WOF A;  4KKU A;  4KKT A;  3CU7 A;  1NR2 A;  3VR3 A;  3Q24 A;  1J8I A;  4FF1 A;  1E0B A;  4CJ0 B;  3LWU A;  4XYQ A;  3J81 E;  1R9T B;  2NBF A;  3S17 B;  5J39 A;  2ID0 A;  1C4Q A;  2K6A A;  4K5W A;  4C3I G;  1X3P A;  1LT4 D;  3S2H B;  2H4O A;  3MFY A;  3G6J B;  4FF4 A;  1I50 B;  3HOW B;  3A8K E;  3QB3 A;  4MHE A;  1ESF A;  5I4D A;  4DA2 A;  1VF5 C;  5LL6 S;  1OXX K;  2A6E D;  2EY1 A;  3FMC A;  3K5L A;  1O80 A;  3W2D A;  3PV0 A;  4IUR A;  1CHP D;  3M4O B;  4FNF A;  1D5X C;  4C1N K;  1W6J A;  1C8C A;  5CV7 A;  1I4Q A;  4DF7 A;  3X3M A;  3K59 A;  1STG A;  4BWG B;  4V0B A;  3NTK A;  1KDB A;  2K28 A;  3A56 A;  4ID6 A;  2K04 A;  2F0H A;  3J7Y W;  3R3O A;  2MP1 A;  3C2P A;  3FPP A;  2OF1 A;  2PMZ B;  1QWY A;  2HDL A;  2IJ0 A;  1IHZ A;  3VR4 A;  2BA0 A;  2E76 C;  2EYH A;  2R7Z B;  1LTI D;  1U9R A;  4IQZ A;  3OMG A;  5A35 A;  1SXT A;  2RVL A;  4RKL A;  3R93 A;  1E2Z A;  3N6R A;  2EPB A;  3BVM A;  3PUW A;  2BE5 D;  3J81 L;  1I6V C;  2VB3 X;  3IAY A;  2B8F A;  3H3V C;  1PFM A;  4TRD A;  1G2S A;  2AWN A;  1ENA A;  1PTO F;  1VMP A;  1HA5 A;  3PO3 B;  4NKL A;  4TKO B;  2E2J B;  2LS0 1;  3E0J A;  1LTB D;  1DXM A;  5IOD A;  2F0G A;  2FJ2 A;  3L7Z C;  1BO0 A;  5IIF A;  1CZW A;  1HRJ A;  1PLF A;  4HED A;  4OIJ A;  2C5C A;  3T13 A;  3Q23 A;  4HSV A;  3VYR A;  2B2V A;  5FOB B;  4TQU S;  2JA8 B;  3ERQ A;  1A2U A;  5EGT A;  5NUC A;  1EYD A;  1JWM D;  4O42 A;  1TS3 A;  3DEP A;  4H44 C;  1H9S B;  1KNE A;  5CR3 A;  1EFI D;  1HQM C;  1KNA A;  4KK7 A;  5FO9 B;  1EY4 A;  1VDZ A;  4UDU C;  2EY5 A;  2K33 A;  1SJE D;  4DNT B;  3S14 B;  1PRT B;  2J4X A;  5FKA C;  1CA6 A;  1JWS D;  4XT3 B;  3PUZ A;  4P2C B;  4ILW A;  4RGO S;  3P1H A;  1ROD A;  3L3O C;  1WTX A;  1FR3 A;  4X3U A;  3M7N A;  2B2Y A;  3CRL C;  4KN4 C;  3A7L A;  1G29 1;  1SMY C;  5M3M B;  5I6Y A;  4BBS B;  1PZK D;  3CRK C;  4NDX A;  2F0J A;  1HPC A;  4C3J B;  4HSP A;  2IPK D;  4ABN A;  4CJ2 C;  2B63 B;  3NE5 B;  3H94 A;  1I4R A;  3MA2 B;  3S1N B;  2NN6 G;  3KLS X;  2VNU D;  3TME A;  5I2X A;  3HOY B;  2EJF C;  3BS1 A;  1HTP A;  2E2D C;  1ICW A;  4FXD A;  3NK9 A;  2EYM A;  4U68 A;  4XTC S;  2A6H D;  4QUC A;  5CC4 A;  1WTQ A;  4RGN A;  3TP6 A;  1F2L A;  5IT9 E;  1MI2 A;  1SYD A;  5ELD A;  1B44 D;  3MEH A;  1IYV A;  1ILP A;  2NN6 I;  1B1Z A;  4WJW A;  3S1R B;  1MD2 D;  3NUC A;  4IN3 A;  2CQA A;  5I2Y A;  2L55 A;  3P20 A;  3GP7 A;  1IKL A;  3MXU A;  3J7A V;  3BDL A;  3P7J A;  5CBA E;  4GZY C;  3V2T A;  3HP3 A;  2KEC A;  4XIG S;  1WTR A;  4TSS A;  1D1K A;  5EKK A;  1HA6 A;  3D3R A;  2YYZ A;  3K6O A;  2AQ1 B;  3I70 A;  4FYD A;  2G9D A;  1A3U A;  3QJY A;  3R2T A;  5JAV A;  1Z47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...