1U4LA

Human rantes complexed to heparin-derived disaccharide i-s
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small inducible cytokine A5
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Attractant
total genus 13
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4lA00
1HFGA 1O7YA 3ONAB 2D9UA 1CM9A 1J8IA 1JE4A 5EPJA 1HFNA 4U68A 5E4XA 1KNEA 4MHEA 2KEDA 4QUCA 1NR2A 1TVXA 2IL8A 2JYOA 1ILQA 1MSGA 4X3KA 4XT1B 3TZDA 4HSVA 1G2TA 2X69A 5D65A 1F2LA 5DNFA 1QG7A 3TN2A 2SDFA 5EKIA 1AP0A 4RWSC 2B2YC 3F2UA 4NW2A 1HRJA 2Q8TA 2FINB 3D6WA 4RA8A 1B50A 1MGSA 2HCIA 1DOKA 1B2TA 5AFWA 2B2VC 2JP1A 1F9QA 1X32A 1IL8A 2K01A 2L12A 2KEEA 1G2SA 3HP3A 4XDXA 1WTOA 1B4OA 2EOTA 1XYIA 1MSHA 1SAPA 1ICWA 2RSOA 1F9PA 3H91A 2Q8RE 4UAIA 4X3TA 1WD1A 4CJ1B 1WD0A 1G6ZA 1F9RA 1PFNA 2M2LA 2H1EA 1XX8A 4XT3B 1HHVA 1RTNA 1BNZA 2NZ1D 3I3CA 1KNAA 1WVLA 1U4RA 1DOLA 2L1BA 1DZ1A 2R3ZA 2B2YA 2K03A 5COYA 1F9SA 1U4MA 1WTPA 1NAPA 1ML0D 1ESRA 2L11A 2N88A 2B2VA 2J7ZA 5EJWA 2XIWA 5T1IA 2KVMA 3DEPA 3P7JA 4QUFA 3KBXA 5CBEE 1O7ZA 1PDQA 2RA4A 2NWGA 2NYZD 4CJ2C 2K28A 3UI2A 2BDNA 1SSOA 4MN3A 1EIHA 4IUVA 5D14A 1EIGA 2KUMA 4DN4M 2X6LA 1AZPA 1CA6A 2N55A 1ILPA 1HA6A 4LMQD 1PLFA 2HCCA 2MGSA 4IUPA 1SDFA 1VMPA 4IURA 1B53A 3QO2A 1EL0A 2VXWA 1Q3LA 1G91A 3KUPA 3I90A 1X3QA 1WTRA 1ZXTA 1WTXA 1RJTA 1BF4A 1E0BA 1X3PA 1J9OA 1NCVA 1IKMA 1IKLA 2FJ2A 2RSNA 2DY7A 4OIJA 2CVRA 1DONA 3G7LA 4IUTA 1CA5A 1GUWA 2B2UA 2B2TA 3R93A 2K04A 3MTSA 2B2WC 1JICA 2FFKB 3GV3A 5JJZA 3I91A 4ZAIA 2KOLA 2EPBA 2B2UC 2HDMA 1EOTA 2EE1A 2K1BA 2L4NA 2X6GA 2B2TC 4R9WA 4X3SA 4ZK9B 1PFBA 3FDTA 2L9HA 1PFMA 4ZLTF 1RTOA 2DY8A 2FHTA 2K05A 2MPMA 1BBXC 3N52A 2FMMA 1QE6A 3MWYW 1C8CA 1HUMA 4ZKBB 2HDLA 3DEOA 1U4PA 5EPLA 5EPKA 2MP1A 1AZQA 2HUGA 4X3UA 4HAEA 4O42A 4RAUC 1QNKA 4IUQA 1B3AA 5E4WC 1O80A 1RHPA 3FPUB 4IUUA 3SVMA 1DOMA 1M8AA 3IFDA 3IL8A 4CJ0B 3LWEA 2B2WA 4HCSA 5CBAE 3I8ZA 2KECA 1U4LA 3GV6A 4ZKCB 5EQ0A 2RVLA 1WTWA 1WTVA 1VMCA 1WTQA 1MI2A 5T1GA 1BO0A 4HEDA 1NR4A 3Q6SA 5CMDA 1LV9A 5CORA 4OIKA 1RODA 1S4ZA 2MJ8A 4R8IA 1HUNA 1EQTA 3DM1A 1A15A
chains in the Genus database with same CATH superfamily
2JA6H 2WINB 1LTSD 1X65A 3HKZB 1MSGA 4UP8A 3G6EA 4DF7A 3GTGH 2XRSD 4CHTB 2SDFA 2YU9B 1CZGA 3R8BA 1A3VA 1B50A 3D6WA 2PNRC 2HCIA 4L5SA 3TMEA 1X6OA 1PHJA 4OX9Q 2EY1A 3I72A 1VQOA 3F1ZA 1WD1A 1PXUA 2ZXOA 1QNUA 2LS01 1RTNA 3F2CA 2VQFL 4JG2A 1I6HB 3IKJA 2SEBD 1CT1D 5GAEC 2K03A 1WTPA 2MQHA 1FR3A 4A4IA 1F2MA 1YJWA 3S1NB 1I4GA 1QUQA 2MO0A 1QWYA 3DEPA 3H0GH 4P75A 4OWWB 2PQEA 3RZOH 1PV4A 4GN4B 1V1QA 1VDZA 1CKNA 3CP0A 2F0TA 1V8QA 2Z4IA 4DV2Q 4KTAA 2LXKA 3S1MB 3MEFA 5KGUA 3PO3B 1SNOA 1DD2A 2OQKA 1V1PB 2Z9HA 3D8GA 4TSSA 2L15A 1I6VC 3OMCA 2XTIA 1L0WA 2KCNA 5DEHA 4C2MH 1SMYD 4JV5Q 3BS1A 1AN8A 1K9MC 1SN8A 5C0XJ 4K2KA 1A6XA 3MC0B 3JAMi 5LMNW 2Q8IB 4BY1B 4A3DG 3L0OA 4Y7NB 1D2BA 3I4MH 3ZJYC 3SE0A 4IUNA 5HGTA 2KHSA 5EPKA 3HOUB 1HR0L 3FKIG 1RHPA 1KDBA 1XXGA 3X3NA 3GTMH 2KBNA 4CJ0B 2E2DC 3V2TA 3STBD 1VQFA 4K5VA 1HA6A 1U4LA 1WTQA 4BBSB 3S16B 2QDBA 5LHY1 1HXYD 2YTXA 3I4NG 4NXNQ 3Q6SA 3I4LA 4RGNA 3ULJA 5M5XB 4LUOA 1E1OA 1O7YA 1VQAA 1Q1BA 1FYCA 1QUQB 3VYTA 5GQOA 2KCTA 1F2LA 4ZQ3A 2JA8G 1D6EC 3UDGA 2WAQG 3S1RH 2F0HA 2Q8TA 5I9PA 1CQVA 3HP3A 3CQZH 4A3EH 5IP7H 1XMOQ 1CHQD 2Y0SB 4IO9A 1XTCD 4UAIA 4JI7Q 1XNRL 2LY7A 3NXWA 2UUAQ 1YBYA 2ENBA 3A8IE 3PO3G 2DGYA 2EDGA 3HRZC 1G51A 4L5RC 1DZ1A 1U5KA 5COYA 3VA5A 1I50H 4QCLA 1I3QB 4O2DA 1A63A 2KVMA 4XYOA 1SFOH 1S3OA 3A7LA 5BN3A 1PZJD 1Y1WH 1EZ8A 1TR5A 1Z47A 1HTLD 2LXJA 2QGQA 2LFNA 3BZKA 3VR6A 2EYJA 1TWCH 2A6HD 2JEBI 3C1FA 4YHHQ 4QY7A 1S5CD 2MGSA 2R93G 2JSOA 3OMGA 4KHPL 3PO2G 2VXWA 4IJLA 3AQQA 3G6JB 2OQ0A 3ND8A 1E22A 2HHHQ 3PF4A 1K3RA 2ZJPA 2OXPA 3NTKA 1IKMA 1DM0B 1WFQA 4AYBG 3PUWA 2Q2TA 4KKSA 4BBRH 4O0AA 3NBHB 4HJ7A 1O7LA 3GV3A 3CC7A 3QR8A 2L4NA 2X6GA 2D2CC 4ZK9B 3CPWA 3CCVA 2KCCA 3DWPA 1UE7A 3NENA 3TREA 3T53B 2WKCA 4IALA 3HOVH 3OSOA 5C0XH 4IUUA 1C9OA 3HKSA 3GQBA 1K0SA 3RUZA 1STYA 4DUZQ 3O13A 4EX5A 4CGYB 1EIFA 4A3IB 2R7ZG 1BO0A 1D1IA 3PUXA 2B3GA 2Y0SG 3RMHA 1ESFA 1KD1C 4QUCA 1Q8IA 2NVYH 1I94Q 2Q2HA 2JYOA 3TZDA 2X69A 4L5TA 1QG7A 3GTPH 1HR0W 4R4QA 4X62Q 5FO7B 3OW7A 4CDEC 5K36H 3SXHA 4L8JA 3EN2A 2I0QA 5GADC 5GAGC 3S17B 4NB3A 3BJUA 1V43A 2Q2IA 3CCLA 1EQVA 3MXPA 4OWXB 2UXDQ 5M3MB 4OEMB 2F0FA 2NB0A 2Z8LA 2B2YA 4LFAL 4POFA 1S72A 3MA2B 4GOPC 1BR9A 4BY7H 4P2CB 3SHLA 3NTHA 2JA5B 4YWLA 1BCPB 4HSPA 3HEJA 3KF8A 3U9OA 3M4OH 1QB5D 4K6LA 4DA2A 2K28A 4MTNA 4EQNA 4JPBW 3S14H 3CCUA 1GUNA 1EIGA 4DV2L 3A8JE 3CXCA 2R92H 2NN6I 3CPFA 1QJOA 1HPCA 1TKWB 4KD3A 3K5NA 1YI2A 4X65Q 4DR7Q 4DAPA 2F1MA 2K33A 4A3GH 3PQIA 3AYHB 1LLRD 3VYSA 3PIP3 2RF4A 3U4VA 2E2IH 1NCVA 1AEXA 4JV5L 3MXGA 1SEBD 3GDEA 3FP9A 3S24A 1BBWA 2B2WC 3OPOA 4NXMQ 4TQUS 2NBFA 4PZ8A 1SYCA 1EY9A 3U50C 1PFMA 4JCVE 4PNYA 1SMXA 1XWEA 1PH6A 3PV0A 4DNTB 4RHSA 2AMCB 1H9RA 4OONA 3L2PA 4MZ9A 1TWHB 4HMJA 3CC4A 3ER0A 5CBAE 4K0KQ 5M9OA 4BXXH 1VMCA 3CHBD 1UEAB 1VQNA 4C3HG 4NXNL 5IT9E 2PZTA 3TEHB 3HOXH 4OO1H 2VUMB 3L7ZC 3DM1A 1M4VA 1VQ9A 2EYOA 2IY5B 5IY0A 2CCZA 1IL2A 5A2QL 4XT1B 2F4VQ 2EXDA 5D65A 3HOYH 2VZAA 2XRQD 3KF8B 3L3OC 3PUVA 3OWFA 2OF1A 1X32A 1XMOL 4OGQC 2GVBA 1NUCA 4G57A 4KI0A 4JI7L 4FF2A 4RCOA 2UUAL 3I4OA 1VQKA 4DR2Q 1XX8A 2JA7B 2A1AA 2NZ1D 1U4RA 4PMBA 4A3KB 1L1OC 1NNXA 1OXSC 2IW3A 1SNMA 5KYLA 3M85A 1F9SA 5IYDG 1YVCA 4FO2A 2IJ0A 3J80L 2J7ZA 1KLGD 4K2LA 1PTOB 4QUFA 1N9WA 2K7VA 4EVOA 1EFID 3STBC 4B3SQ 2G5DA 1MJEA 4R4OA 4BA1I 3K7AB 1MKHA 3S2HH 2NN6G 5ELDA 3CCEA 1EL0A 3KUPA 2HHHL 2P5ZX 1YIJA 2IHEA 1VQJA 4PG3A 1AE2A 2CVRA 5I2XA 3OHXC 1YJNA 2CFMA 4IUTA 1Y1VH 2ID0A 1I4RA 3OIPA 1JT8A 1ET6A 4ZAIA 4RFBA 2VUMG 3OIQA 3FDTA 2BH2A 1WTHA 1VQDA 3A56A 1UEBA 2K05A 3AMUA 5C4JH 1WCMH 1E3PA 1DJRD 2GN5A 1QNKA 4P71A 3HFZB 2I5HA 3K81C 1Q82C 3DUZA 5FO9B 4DUZL 3I8ZA 1K8OA 2WB1E 2PO4A 4ILWA 3KFUA 4KN7C 1VS0A 3I7FA 1E1TA 3TZUA 1GUSA 1RODA 1S4ZA 2DNCA 1I4QA 1VQIA 5LMUQ 1H9MA 2JJQA 2B63H 2IWHA 2SOBA 1PYBA 3ONAB 4PV1C 1STHA 1CM9A 2D9UA 1I94L 1SE8A 4K8JA 1BOSA 5KRUA 2ICEC 3UDXA 4DR6Q 1HJPA 4C3IH 5FLMH 4LFBL 3DWAA 2F52A 4X62L 5CGKA 4BA2I 1STEA 4DXFA 3SK4A 4G7ZC 3GTLH 1RIPA 3ERQA 2VB3X 2F3WA 4F88A 1B4OA 1PYWD 2RDHA 2WP8J 2PQAA 3DLLA 3KJPA 4QGUA 2UXDL 5C4ZA 3A5UA 1VQGA 3NWSA 1BDOA 4YCVA 2PZWA 4LK1C 3TQYA 1VF7A 4CDDC 4DAYB 2BH8A 2L1BA 3R2TA 1RF2D 5ELFA 2PW5A 1PA6A 1JMCA 4JYAQ 2AUKA 4YWKA 2J4XA 3KBXA 1IYUA 2H4OA 1AW7A 4M8AA 3SR1A 1IHZA 4A3JB 3V05A 4EQ5A 1KDAA 4NDXA 1NJIC 2XWBB 4LJZC 1TS2A 4UY8C 5FJ8H 2F0LA 2C35B 3EQLC 3PSIA 1YHQA 3V96A 1EYDA 4DR7L 1CKMA 1B53A 4GN3B 5FLXc 1BUVT 3I90A 2I07B 4HIOA 3NBIA 3ZYYX 4EGVA 3EIVA 2MHVA 1CA5A 1RDPD 2O4XA 2PW7A 4JI0L 1EEFD 5BN4A 4NXML 4P74A 4RG1A 4C3JH 3HOZG 2UU9Q 1UE5A 1G8ZD 1Z6HA 1IBMQ 4JOIC 2Z6KA 4B3TQ 3Q24A 1Q1EA 1KHIA 3NQTA 1TT2A 3CD6A 3MXNA 5C3EH 1FD7D 3RR5A 1PRTC 1UWVA 3Q8DA 1O80A 3SVMA 3FPUB 1QVCA 1DOMA 1NMGA 2G9HD 4MTKA 3D6CA 4K0KL 3KBGA 1NE3A 3CRKC 2PQAB 1NR4A 2F0KA 3BU2A 4OELB 3BDLA 5C6AA 3BG3A 5M5YB 1EQTA 2NVQB 1J8IA 4JI1Q 5I9OA 2WFWA 1LTLA 3AU7A 4UP7A 1ILQA 2VB2X 2F4VL 4HSVA 1ASYA 4A93B 1HA5A 4A3FB 2XVSA 5JJIA 1TWGB 4WORA 3FVQA 1I6HH 1V1PA 1AP0A 3SK8A 1TWAB 4RGMA 1ASZA 2NVTB 2B2VC 4CBVA 3S1NH 1IL8A 3I56A 2KEEA 1BXTA 2RKSA 2F0JA 4HJ5A 1F2ZA 1W6JA 4DR2L 4LFCQ 4QJFA 5C4XB 4A3DB 4LF9Q 1KTKA 2R3ZA 3S1MH 2ALYB 5FOBB 1MIUA 3Q22A 1N34L 2IX3A 1SR3A 5DLQE 2A19A 3FKIB 2ZTDA 5A2QE 1Y14B 4R4TA 1EIYB 3QIAA 5JPMC 1WOCA 1EEID 1X3GA 2CKZB 4B3SL 4DR4Q 4QQBX 3UI2A 1Y8OB 2F0UA 4FXKC 1ENAA 3I4NB 1AZPA 4H7BA 1TWFB 4IUPA 4A3CG 2ZM6Q 1WI5A 1SROA 3MXNB 2PI2E 2TSSA 5EKKA 4DK0A 2PNHA 4BY1H 4I7AA 2Q2UA 1HQRD 1BF4A 3C1EA 4HTHA 4TRDA 5FK9C 2JA8B 1TXYA 2WAQB 1YNXA 1DONA 1MJCA 3HOWG 3HOUH 1AE3A 3J80E 3T1HL 4CKBA 2JA9A 5IGEA 1FNWA 1CUKA 2N8NA 4FF1A 4BBSH 4X3SA 3M4PA 3NE5B 3S1QH 4Q5VA 2MUYA 4U673 4IQZA 4OWTB 4IFDJ 1QE6A 1V1OA 4A93G 5M5XH 2C5CA 4A3FG 2PMZB 1TY2A 1FNVA 2E2JB 2SNSA 3D31A 5IT9L 2AQ3B 5IP9H 4OHJA 5FLXL 1WTVA 1WTWA 2R61A 3BYYB 4GZYC 1FJGQ 3AEVA 1EWIA 1K3BC 3VDYA 4RMFA 3TP6A 5C4XG 1Z9FA 4KY7A 5IWAQ 3M3YB 4GOPB 4LW1A 1P16A 4DV4Q 2EJFC 2EY6A 2VQEQ 2R93B 5C5MA 4DV3L 1LT6D 3PO2B 2E76C 5DNFA 4DR5Q 4HCEA 3TP8A 5EKIA 3L9AX 3HGBA 3E0EA 3F2BA 1EYCA 1I3QH 1B2TA 2A5HA 2JP1A 4GNXC 2K5WA 1SYFA 4AYBB 3RNUA 2KA7A 2EOTA 2EY2A 3CMEA 2DNEA 4JI6Q 4AQYL 3NBHA 3K6OA 1GJXA 2N78A 3ULPA 1O7IA 4LWCA 3AB9A 4KY6A 4JYAL 5HY6A 3RZOB 3PCOB 4KV6A 4DKAC 3JAMc 1GOZA 2RHSB 1STGA 1SNQA 4XYQA 3U9SA 5I6WA 4A3BH 4K14A 4CJ2C 2R7ZB 3SK6A 2UUBQ 1U0LA 2R6GA 4H0LC 1TQOA 3D4RA 2BA1A 3ULLA 2NZOA 5D3IB 4OL7A 4LF8Q 2HD3A 4C2MB 3PIOA 4R4IA 3E0JA 5C44G 2QCPX 3R3OA 1CK1A 3E5SA 3SGIA 4XIGS 2QA4A 2DUDA 3I2ZA 4DR3Q 3WWVA 4B3ML 1GHJA 2JA6G 3K57A 3M9BA 1XPRA 4WRDA 4B3RQ 4DK6C 2UU9L 3GP7A 2A6EC 3C46A 1PZKD 2HDMA 2K14A 1L0YB 4A3IH 1IBML 2B2TC 1I4HA 4XQNA 2V4DA 2BE5C 4B3TL 2DY8A 4HIDA 4K5XA 1VQEA 2QF7A 3T16A 5CYUA 5FKAC 2OCEA 1IBLQ 3MXUA 1SJHD 3CCMA 4FP5D 2EJMA 2IPKD 1A8VA 2KECA 4WFN3 2F0WA 1CQFA 2ICIA 3HKZE 4YCUA 1L1OB 1RD9D 2KHIA 2QDLA 5I6YA 2BOSA 5IYBH 3NELA 2DN8A 5E1FA 3A55A 4IFDH 1N32Q 2M00A 3S17H 4JI1L 2IT1A 2B39A 3J80i 2KEDA 2EXZA 2K5HA 3H0GG 4X3KA 1KIXA 1GUGA 2EYHA 5M3MH 1PZID 2HIVA 2EIFA 4NW2A 4A3LH 1VQHA 3E9HA 2OEOA 5AFWA 1HUNA 4GN5A 2L12A 4LF6Q 4ME5A 1EYGA 3GO5A 1T5EA 3H91A 2JA5H 1WD0A 2R7FA 5C4HA 1VQ4A 4DXGA 4XT3B 1HHVA 1BNZA 1KXLA 4B9WA 1VCIA 1SFOB 4R4CA 1SBBB 3M4QA 4J15A 1X3EA 4JI4Q 1JOKA 2MNAA 3QOLA 4WJWA 5IYCH 4DK1A 1A0IA 1TWCB 3I4MG 4DNIA 2JN4A 5CBEE 1NMFA 4RGTA 2QILA 1SXTA 4OX9L 3KLSX 1KAWA 4K8IA 4B9XA 2ZXPA 2A74C 4C3HB 1LTGD 1NSNS 4QIWE 3KDFA 1JJCB 5D14A 1LT5D 1ILPA 2MFIA 2ZM6L 3KLRA 2B8FA 4LNQA 1SDFA 2XN9C 1II3A 4N9PA 2NTTA 1Q3LA 4JI8Q 3TP7A 1PRTD 1SYBA 4UPAA 1SE4A 5BN5A 1CTMA 4KJOA 2HIXA 1FL0A 5ELEA 5JEAJ 3ICEA 1B44D 4C1NK 1VQBA 2NZHA 5J1ZA 1TWHH 2HQLA 5JJZA 3U4ZA 3IFTA 3I91A 4JW0A 2KOLA 2EPBA 2ATWA 3HOVB 1VF5C 2K1BA 5CV4A 3RN5A 2K32A 2WB1B 5EGTA 1D5ZC 1STBA 3GTKB 4A3EG 4WJ4A 5IP7G 3RLFA 4IUQA 4GLXA 3IFDA 3LWEA 1B8AA 2BCOA 1B3QA 5IGCA 1J6QA 3I70A 4GLVB 3J7YW 3K7UC 1D5XC 1JOQA 4JI3Q 4OIKA 5IWAL 2NTSA 3X3MA 2MJ8A 4R8IA 3GTQH 2VQEL 5E4XA 1PH4A 1Y1WG 2JA7H 1EY0A 3TN2A 1B9NA 3GTOB 3KF6B 4A3KH 3HS0C 4CDFC 2VY3A 3F2UA 3CCQA 1HRJA 5JAVA 1IW7C 3TS2A 5IOCA 4JC0A 2JXMB 3KDFB 1PTOH 4JI6L 1HH2P 1O78A 1U9RA 3AFQA 5FLXE 1PFNA 3UE1A 2AWOA 4BY7B 1WVLA 3MHBA 4KKTA 1DOLA 2CH4A 1B1ZA 1OXXK 3SEBA 4BBRG 2JK8A 3K7AH 1Y8NB 3K5LA 1ML0D 2E2HB 2N88A 4HJ9A 2QEJC 1PH2A 5A35A 3CCSA 2RA4A 1EY6A 3IAYA 3H94A 3HOVG 4A3MH 1VQ5A 2OWOA 1EQRA 2N55A 2TMPA 2WB1G 3FHWA 4A76A 3RN2A 1H9SA 2ZTEA 4HIMA 5C0XG 5LL6X 4LF8L 2E2IB 4C1NI 4IURA 4IN3A 3BDOA 4X66Q 4K5WA 1W2BA 4KKUA 4DNRB 2ZTCA 3S2DB 3SDZA 1J9OA 4JK1C 3DXJC 2YV5A 1IKLA 4DR3L 3D3RA 3P75A 4B3RL 1IBKQ 1YHBA 3OOCA 3I55A 3W1BA 2DJFC 1EU4A 3PGZA 4YHHL 4X6AH 2F0MA 1YNJC 4JVZA 4TVAB 4ZUJA 3P1HA 1KLUD 3JC66 3J81c 1RTOA 4FDBA 5K36G 2FMMA 3A74A 4DGZA 1JCKB 1EY7A 2EY5A 4LF5Q 3DEOA 2N3SA 3WDNA 1YEZA 2AWNA 2HUGA 1IBLL 3LGJA 4DAYA 1JWSD 5JEAH 1HCZA 1W3SA 4ZUIA 2L0CA 1IYVA 1K83H 2QKIC 2JE6I 1LTID 3NK9A 1OTCA 1OO9B 2WV6D 3A5ZB 4BY7G 5EPJA 3HOYB 2MO1A 2E5LQ 4GKKQ 4QMGA 2GA4B 5M3FH 1V9PA 1GHKA 1XPUA 4UHVA 5E3FA 1NBWA 4GNXA 1BVSA 3P20A 4XQJA 3CCJA 2IX0A 4CKCA 1A3UA 2R92G 1DOKA 1VQMA 4LF6L 2K01A 5IGFA 1QZHA 1MSHA 1Q12A 4A3GG 3HOZB 5NUCA 1H9SB 2VNUD 1JQYD 1UAPA 1YNNC 2M2LA 4A3JH 4YCWA 4LF4Q 2RDGA 3CC2A 5F2DA 3ND9A 3RLOA 1Z7TA 1XJVA 4JI4L 1U4MA 3W2DA 1JWUD 4FXGC 2LMCB 2XWJB 3T4AC 4KMUC 1BKBA 1O7ZA 5DAUA 3UDFA 2A6ED 3OW2A 3S2HB 1Q90A 4NKLA 3J7AV 1PRTF 1LO5D 2BE5D 1QZGA 4LMQD 5ISRA 3H3VH 4JI8L 3W1GA 2B8GA 4RKBA 1VQLA 4BXXG 1EY5A 1WTRA 1Y1VB 1ZXTA 5IGBA 1WTXA 1E0BA 3J7A5 3HOXG 4OO1G 4N8X1 4GLAC 2PCFB 2K5NA 2Z1CA 4ZYSA 5KNDA 1GUWA 1B70B 2B2TA 4ABNA 4DV7Q 2SNMA 4LUVA 5C4JB 4QF4A 5CV8A 3QG1A 2EQSA 3T51B 1PFBA 1CZWA 1YITA 3HOYG 1LTBD 4X65L 2ZXRA 3MWYW 1HUMA 1LACA 5M5YH 4GNXB 2LKVA 4I65A 2CW0C 4IZ8A 1B7YB 1C4QA 2F0VA 4RAUC 2NUCA 5FO8B 5CC4A 1SYDA 1D5MC 4O1NA 5EQ0A 2CQAA 4FVMA 3HG9A 1UE1A 1OXTA 2RCFA 1A3TA 4JI3L 1TWAH 2A73B 2NVTH 1MBYA 1BQQT 2KJXA 2EYFA 1UE6A 4JI5Q 3TP5A 1CI3M 2K6AA 4U68A 1K8AC 3QB3A 1TVXA 2V1CC 3TS0A 4A3DH 3JAME 1K8GA 2B29A 2B2YC 3J81L 5J39A 2FINB 4RA8A 1LT4D 2NVXB 1JC7A 1FGUA 1W6KA 2A68C 2HQEA 1ENFA 1WTOA 2F0IA 3HOWB 2YU9H 3FKIH 1RCVD 1OXUA 2D62A 4CJ1B 1Q86C 2K5QA 1S5FD 1E24A 4N8FA 3I3CA 1X55A 4HJ8A 1KNAA 1GM5A 3I4NH 1N33Q 1K8MA 1PH7A 2XNAC 1Y1VG 3C2PA 4S3SA 5EJWA 3VA7A 2E75C 5C3WA 1PH5A 3IRBA 4P72A 3EJIA 4CDCC 4LF7Q 3VYRA 2BDNA 1SSOA 4MN3A 2JA8H 1PTOC 1WCMG 1SYGA 2D0PA 2EJGC 4H44C 5J3BA 1PLFA 4APVA 4X66L 4GOPA 1TS3A 3D4WA 3NHHA 2KCMA 3KOJA 1X3PA 3PO3H 2BA0A 2B63G 1IBKL 2E2JH 5M5WB 1Q8KA 3MTSA 1IZ6A 1SYEA 1ENCA 4PMWA 5EBDA 1I5FA 3NQIA 4RHRA 3AFPA 5C3EB 4WJ3M 4C3IG 5FLMG 1Y69U 3J81j 1SLJA 1ET9A 1BBXC 4LF5L 1C8CA 3M3YH 3A0JA 4ZKBB 5TSSA 1VQ8A 2HDLA 1EYAA 4Y7NH 1AZQA 3CF5A 3RZDB 3K0YA 4O42A 1IW7D 2R93H 3CCRA 3A54A 3PO2H 3GTJB 2B2WA 2IHFA 2DJGC 1R9TB 4LAAA 3K5MA 4J6HA 1HZCA 5IE8A 3K8AA 4QL5A 3DMUA 3N6RA 4JI2Q 4FF4A 1E2WA 3S16H 1T5XD 2E5LL 1DXMA 1HZ9A 2PZUA 1JE4A 4GKKL 3S15B 4LFAQ 4L5QA 1EWHA 2JEAI 3NPPA 1SNDA 5C44B 4XQQA 3QOJA 5FJ8G 3K0XA 4XDXA 1XYIA 1FVIA 3MZ5A 2CWPA 1Q81C 3NEMA 5I2YA 5IGDA 2JA6B 4C56C 3K5OA 3OYYA 2Q8RE 1G6ZA 1LYLA 5AJ3Q 5LMUL 3VYUA 4ALPA 1A2TA 4LF4L 2LSSA 3GTGB 2R7ZH 3BYTB 4KD4A 4HN7A 2E74C 2ASBA 4QIWB 3CAMA 3W3AA 4DR6L 3TSSA 1TIID 5CR3A 2F0SA 4C3JG 5T1IA 4XXEA 2L55A 5JPNC 4F8MA 4ZCKA 3P7JA 1EFWA 3QWNA 5C3XA 1HNWQ 4LUZA 3G48A 2C9OA 3GD7A 1YNJD 1EIHA 1TS4A 5GROA 1K73C 2A8VA 4DN4M 5C3EG 2Z0SA 1L1OA 4F87A 2PYKA 1CSPA 1ZYRC 2F0NA 3HKZG 4MNOA 1X3FA 1VMPA 5GAHC 1QVGA 3H0GB 1X9NA 1X3QA 4P73A 2RQXA 2AKWB 5JJKA 5EKLA 3LWUA 2O5IC 4A75A 1F77A 1GVPA 1J5EQ 3S1QB 1TU2B 4DV7L 3M7NA 1KQSA 1I4XA 2F3VA 3R2IA 2B2UC 3MEHA 1EY4A 1P8LA 2YTVA 4YY3Q 4V0BA 4POGA 1M90C 1KL9A 2WIIB 3H3VC 2CQOA 4E6IA 4GKJQ 1N36Q 1U4PA 2PPBC 2MP1A 1KRSA 4X3UA 1C7YA 4L63B 4PZ6A 1EZ6A 3UDIA 3U58A 1GO3E 1CKNB 1HNZQ 2R7DA 5T1GA 4R1JA 1EOVA 1QILA 3I4MB 3E9IA 1YNND 2F4IA 1RL2A 1KC8C 1JE5A 2XSCA 4H02A 3TDQA 4JI5L 3NSWA 2F3IA 2RCNA 1A15A 5LL6S 1KNEA 4MHEA 3PIO3 3GTMB 2M9VA 2IL8A 4HR7B 3VR4A 2JQOA 1GD7A 2WACA 1JOOA 5IIFA 1VQPA 3J7AF 3F8TA 4HMIA 1MGSA 4DAMA 2K52A 5ELOA 1Q46A 1SAPA 4BY1G 5G3LD 2UUCQ 1BCPD 3FRPB 2XGTA 4DR1Q 1PFSA 4C3HH 4PMCA 1N33L 3EROA 1PMRA 3KYHC 2AQ2B 4NP5A 3S1RB 3HOUG 1NAPA 1CHPD 1DCZA 3CQZB 4A3EB 1ESRA 2Z4HA 4A3BB 4BBSG 4DUYQ 4LF7L 4IOCA 2KHJA 3J81E 1SJED 2UXCQ 3BVZA 4BS9A 2KUMA 4LFCL 2X6LA 1XNQQ 1MD2D 3URYA 4DV1Q 2A69D 1I50B 2H5XA 2HCCA 4YWMA 3H15A 4LF9L 4CKEA 3T1YQ 2WAQE 4H13C 4DV6Q 2F0GA 5IP9G 1AH9A 1LTRD 2CW0D 2Z6KC 1H95A 5K5PA 1Y1WB 1UNSA 2FMCA 5DM63 4IFDI 2IX1A 2DY7A 1D8LA 3GTKH 5EBCA 3M7GA 3KF6A 5IYDH 4K6DA 2F0DA 4DR4L 1JORA 1JICA 2L5TA 3F2DA 2RHQB 2PMZE 3J80c 2VW9A 2F0EA 4R9WA 5C0XI 4KJNA 1ONLA 1RKNA 4AIMA 2VL6A 4PZ7A 2EZVA 1JWMD 1KAAA 4LFBQ 4BBRB 4DU9A 2I5MX 5E4WC 4DV5Q 1VQ7A 4DAVA 3IL8A 2A68D 2NN6H 3A7AB 4F7XA 4DV0Q 4X64Q 3H09A 3GTOH 2OTJA 2Z6BA 4JBJA 4IPHA 4M1UB 1LV9A 5J22A 1N8RC 4JOIA 4JI2L 1NTGA 2J0TD 3E6ZX 5KNCA 3FPPA 4KHZA 1BBUA 3JAML 5I4DA 3C3LA 3NTIA 1H9JA 5BR8Q 5JVG3 5JOBA 3D4DA 2QEXA 2K4KA 1XMQQ 4AYBE 2VUMH 4DPGA 1NY4A 4A3BG 2K5DA 5IODA 3KJOA 1H9KA 4RWSC 1PH8A 1E2ZA 5IGGA 3H6MA 3FEWX 3PIPA 1UUPA 3DWQA 1F2YA 1LM0A 1FJGL 2E8GA 2E2HH 1CFMA 2YYZA 1PTOD 3RD4A 2I46A 1ICWA 5JVH3 2RSOA 2RDFA 2NVYB 3G4SA 5AJ3L 4X3TA 1IYJB 2AQ1B 1F9RA 2ZJRA 1CSQA 2EVBA 1S5DD 4DV4L 3GTPB 3HZXA 3CKIB 1VQ6A 1LUZA 3BZCA 3DHQA 3MFGA 4DR5L 2K75A 1QCBD 2B2VA 2Y0SE 2XIWA 1LTTD 1HNXQ 4L6TB 1HNWL 5ELCA 4A3IG 1SNPA 2QW7A 4JI0Q 3S2DH 5CV5A 5LMNQ 4IUVA 4KHVA 1CA6A 2F0QA 1AFPA 4ULLA 2AUJD 2O5JC 4RH6A 3EBEA 1X54A 1G91A 4ODGA 1JJGA 4QB4A 1R4QB 3MVVA 3M4OB 5IYBG 5CV7A 2UXBQ 3NP8A 2RSNA 1IXRA 3A8KE 1A62A 1J5EL 3S14B 3VR2A 3LNNA 4IFDG 3CU7A 1SRUA 2R92B 1D7QA 3KLSA 1FGBD 1GXDC 2K04A 2CHBD 1PH1A 2UUBL 4ME3A 2K50A 5M3MG 4A3GB 2EE1A 5DM73 4YY3L 3OTOQ 3KK7A 1PRTB 4IPGA 4Q0FA 4A3LG 5ELBA 4EQPA 4GKJL 1HZBA 4I7ZC 1N36L 1VQCA 3J81i 3VR5A 1C0AA 4OXPA 4GS3A 5E7NA 3D0FA 1EWCA 5D3DA 4OO1I 3CMAA 1M8AA 1ZKOA 2JA5G 2CWAA 1HNZL 1STNA 3I73A 1SMYC 2RVLA 3GTQB 2PI2A 2GVAA 1ZEQX 4IJHA 5CMDA 1JB3A 5CORA 2EYMA 1LT3D 5KNBA 1T9HA 4HEDA 5IYCG 1HFNA 3RLNA 2ES2A 3HOZH 2F0PA 1L0XB 3E3XA 2F03A 3MAQA 1N34Q 4G4KA 5G3LF 1BCPF 3BDCA 3CRLC 3CW2C 1CKOA 3M4YA 3HOXB 1JB7A 1B9MA 4XTCS 3BVGA 4UP9A 2UUCL 3B6YA 4IPDA 1XPOA 4DR1L 1E7ZA 1PVOA 1ZYRD 4RKLA 1N32L 4NMZA 1DGSA 4J1MA 2VQFQ 3G71A 3PUYA 1PYSB 1EU3A 3WOEA 1HZAA 2OTLA 4DK3C 1EUJA 4R8NA 3UE0A 4N9TA 4A3MB 4DUYL 1GKHA 1WYDA 2K5VA 5ELNA 2NWGA 4KN4C 3T1HQ 2UXCL 1XNQL 4UDUC 4DV1L 4EQOA 4RCNA 4G7OC 1TS5A 3T1YL 4DV6L 3QJYA 3DM3A 3K80C 2HT1A 3QO2A 3OWEB 3MFYA 4HJAA 1YZ6A 1I4PA 1DYQA 4KK7A 4OIJA 1GUTA 5HGQA 3T56B 3S9WA 2B2UA 1WJJA 1PH3A 1SE3A 2FFKB 1S5BD 1M1KC 2JA7G 1Y8PB 4HIKA 1EOTA 2A6HC 4JBWA 1BCPC 2G9DA 2L9HA 4A3KG 4ZLTF 2FHTA 1SE2A 2MPMA 4FNFA 3BVMA 4YIJA 5L37A 4DV3Q 2CH4W 3NWTA 5KEEA 4HAEA 4DV5L 2WKDA 4B08A 4A3CH 1HR0Q 1EY8A 1K83B 4DV0L 4HCSA 4X64L 4ZKCB 3Q0AA 1X56A 5CV9A 1YHAA 1KRTA 5M3FB 2NVXH 4AQYQ 1JJ2A 3ITPA 1WCMB 3T13A 5BR8L 1E2VA 1HFGA 2RBMA 3HOWH 1KDCA 2ZJQA 1TY0A 1QVFA 2A69C 1R4PB 1D1KA 1XMQL 1NR2A 2AHOB 1KABA 2N49A 2OT2A 1G2TA 3SK5A 1PTOF 1XTDA 4MIUA 2NVQH 2KENA 3LX0A 3NUCA 4A3MG 2KQ3A 3H3VI 3K58A 1OXVA 2ZT9C 4A93H 1F9QA 1SNCA 4A3FH 1G2SA 2B63B 1TWGH 1C48A 2I5LX 4ID6A 3VR3A 3WOFA 1YJ9A 1F9PA 1FNUA 3TBIB 3W5OA 2FXQA 1XNRQ 2H1EA 4NPSA 5IT9c 4C3IB 4BWGB 4Y52H 1Q7YC 4J8QA 4Z9CB 5C4XH 2D0OA 3GTLB 4IOAA 4ZRZA 3ERSX 5KIXA 5H1SE 2L11A 5KYIA 3PF5A 1HNXL 1LABA 3EVQA 1LTAD 4IPCA 4JBKA 4B3MQ 4V190 3BZDB 1PDQA 1PH9A 3TRZA 5CV6A 2NYZD 5LMNL 1QOHA 5M5WH 1A2UA 3PMFA 5JEAG 1JR0D 3Q23A 4RGOS 3EA6A 3EFXD 4KHPQ 2YTYA 3K59A 2F0OA 1L2FA 1TWFH 5C5LA 1RJTA 2UXBL 1HQMC 2FJ2A 1HTPA 3G7LA 3RZDH 5JJLA 1G6PA 3KLWA 3FMCA 4JBMA 3R93A 5M3FG 3GTJH 1S40A 3J7ZC 3OTOL 1R9TH 5EAYA 2EYPA 4KLKA 1EQQA 4FYDA 3N52A 2BDOA 1ICFB 4FF3A 5EPLA 4TKOB 2O2LD 3S15H 1MHWC 1B3AA 1GUOA 5HURA 4C3JB 2VS1A 1STAA 4FXDA 4G7HC 3GV6A 4A3JG 4DFAA 2EYLA 1MI2A 5C44H 1S5ED 4KY5A 3PUZA 4PQXA 1K28A 1K0RA 4AH6A 1G291 2D5DA
chains in the Genus database with same CATH topology
2WINB 1LTSD 3HKZB 1MSGA 4DF7A 2XRSD 4CHTB 2SDFA 2YU9B 1CZGA 3R8BA 1A3VA 1B50A 3D6WA 2PNRC 2HCIA 3TMEA 2EY1A 3I72A 1WD1A 1PXUA 2ZXOA 1QNUA 2LS01 1RTNA 1I6HB 3IKJA 2SEBD 1CT1D 2K03A 1WTPA 1FR3A 1F2MA 3S1NB 1I4GA 1QWYA 3DEPA 2PQEA 1VDZA 2F0TA 1V8QA 2Z4IA 4KTAA 3S1MB 5KGUA 3PO3B 1SNOA 1DD2A 1V1PB 3D8GA 4TSSA 1I6VC 3OMCA 2KCNA 5DEHA 1SMYD 3BS1A 1AN8A 5C0XJ 4K2KA 1A6XA 3MC0B 2Q8IB 4BY1B 4Y7NB 1D2BA 3SE0A 4IUNA 5HGTA 2KHSA 5EPKA 3HOUB 1RHPA 1KDBA 1XXGA 3X3NA 4CJ0B 2E2DC 3V2TA 4K5VA 1HA6A 1U4LA 1WTQA 4BBSB 3S16B 2QDBA 5LHY1 1HXYD 3Q6SA 3I4LA 4RGNA 5M5XB 1O7YA 1Q1BA 1FYCA 3VYTA 1F2LA 4ZQ3A 1D6EC 2F0HA 2Q8TA 5I9PA 1CQVA 3HP3A 1CHQD 2Y0SB 1XTCD 4UAIA 2LY7A 3NXWA 2ENBA 3A8IE 2EDGA 3HRZC 1DZ1A 4QCLA 5COYA 3VA5A 1I3QB 2KVMA 4XYOA 3A7LA 5BN3A 1PZJD 1EZ8A 1TR5A 1Z47A 1HTLD 2LFNA 3VR6A 2EYJA 2A6HD 2JEBI 3C1FA 1S5CD 2MGSA 2JSOA 3OMGA 2VXWA 3G6JB 3ND8A 2OXPA 3NTKA 1IKMA 1DM0B 3PUWA 4KKSA 1O7LA 3GV3A 2L4NA 2X6GA 2D2CC 4ZK9B 2KCCA 3DWPA 3T53B 2WKCA 4IALA 3OSOA 5C0XH 4IUUA 3GQBA 3RUZA 1STYA 3O13A 4A3IB 4CGYB 1BO0A 1D1IA 3PUXA 3RMHA 1ESFA 4QUCA 1Q8IA 2JYOA 3TZDA 2X69A 1QG7A 5FO7B 3OW7A 5K36H 3SXHA 4L8JA 3S17B 1V43A 1EQVA 3MXPA 5M3MB 2F0FA 2NB0A 2Z8LA 2B2YA 3MA2B 1BR9A 4P2CB 3SHLA 3NTHA 2JA5B 1BCPB 4HSPA 3HEJA 3KF8A 3U9OA 1QB5D 4K6LA 4DA2A 2K28A 4EQNA 1GUNA 1EIGA 3A8JE 2NN6I 1QJOA 1HPCA 1TKWB 4KD3A 3K5NA 4DAPA 2F1MA 2K33A 1LLRD 3VYSA 3PIP3 1NCVA 1AEXA 3MXGA 1SEBD 2B2WC 3OPOA 4TQUS 2NBFA 1SYCA 1EY9A 1PFMA 4PNYA 1XWEA 3PV0A 4DNTB 4RHSA 1H9RA 1TWHB 4HMJA 5CBAE 5M9OA 1VMCA 3CHBD 1UEAB 4C3HG 5IT9E 2PZTA 4OO1H 2VUMB 3L7ZC 3DM1A 1M4VA 2EYOA 5A2QL 4XT1B 5D65A 2XRQD 3L3OC 3PUVA 3OWFA 2OF1A 1X32A 4OGQC 1NUCA 4G57A 4KI0A 4FF2A 4RCOA 1XX8A 2JA7B 2NZ1D 1U4RA 4PMBA 4A3KB 1OXSC 2IW3A 1SNMA 5KYLA 3M85A 1F9SA 4FO2A 2IJ0A 3J80L 2J7ZA 1KLGD 4K2LA 1PTOB 4QUFA 2K7VA 4EVOA 1EFID 4BA1I 3K7AB 2NN6G 5ELDA 1EL0A 3KUPA 2CVRA 5I2XA 3OHXC 4IUTA 2ID0A 1I4RA 3OIPA 1ET6A 4ZAIA 4RFBA 3OIQA 3FDTA 3A56A 2K05A 3AMUA 1DJRD 1QNKA 3DUZA 5FO9B 3I8ZA 1K8OA 2PO4A 4ILWA 4KN7C 3TZUA 1GUSA 1RODA 1S4ZA 2DNCA 1I4QA 1H9MA 2IWHA 2SOBA 3ONAB 4PV1C 1STHA 1CM9A 2D9UA 4K8JA 1BOSA 5KRUA 2ICEC 3DWAA 5CGKA 4BA2I 1STEA 4DXFA 3SK4A 4G7ZC 3ERQA 2VB3X 2F3WA 4F88A 1B4OA 1PYWD 2RDHA 2WP8J 5C4ZA 3NWSA 1BDOA 2PZWA 4LK1C 1VF7A 2L1BA 3R2TA 1RF2D 5ELFA 2PW5A 2AUKA 2J4XA 3KBXA 1IYUA 2H4OA 1AW7A 4M8AA 3SR1A 1IHZA 4A3JB 3V05A 1KDAA 4NDXA 2XWBB 4LJZC 1TS2A 2F0LA 3EQLC 3V96A 1EYDA 1B53A 1BUVT 3I90A 2I07B 3NBIA 3ZYYX 4EGVA 2MHVA 1CA5A 1RDPD 2O4XA 2PW7A 1EEFD 5BN4A 1G8ZD 1Z6HA 3Q24A 1Q1EA 3NQTA 1TT2A 3MXNA 1FD7D 1PRTC 3SVMA 1O80A 3FPUB 1DOMA 2G9HD 3D6CA 3KBGA 3CRKC 1NR4A 2F0KA 3BDLA 5C6AA 3BG3A 5M5YB 1EQTA 2NVQB 1J8IA 5I9OA 3AU7A 1ILQA 2VB2X 4HSVA 4A93B 1HA5A 4A3FB 2XVSA 1TWGB 4WORA 3FVQA 1AP0A 1V1PA 3SK8A 1TWAB 4RGMA 2NVTB 2B2VC 4CBVA 1IL8A 2KEEA 1BXTA 2RKSA 2F0JA 1F2ZA 1W6JA 5C4XB 4A3DB 1KTKA 2R3ZA 5FOBB 3Q22A 2IX3A 3FKIB 5A2QE 3QIAA 5JPMC 1EEID 3UI2A 1Y8OB 2F0UA 4FXKC 1ENAA 3I4NB 1AZPA 4H7BA 1TWFB 4IUPA 2TSSA 5EKKA 4DK0A 1HQRD 1BF4A 3C1EA 4HTHA 4TRDA 5FK9C 2JA8B 2WAQB 1DONA 3J80E 4CKBA 5IGEA 1FNWA 4FF1A 4X3SA 3NE5B 4Q5VA 2MUYA 4U673 4IQZA 4IFDJ 1QE6A 1V1OA 2C5CA 2PMZB 1TY2A 1FNVA 2E2JB 2SNSA 3D31A 5IT9L 2AQ3B 4OHJA 5FLXL 1WTVA 1WTWA 2R61A 3BYYB 4GZYC 3TP6A 4KY7A 3M3YB 2EJFC 2EY6A 2R93B 5C5MA 1LT6D 3PO2B 2E76C 5DNFA 4HCEA 3TP8A 5EKIA 3L9AX 3HGBA 1EYCA 1B2TA 2A5HA 2JP1A 2K5WA 1SYFA 4AYBB 2KA7A 2EOTA 2EY2A 2DNEA 3NBHA 3K6OA 1GJXA 3AB9A 4KY6A 3RZOB 4KV6A 1GOZA 1STGA 1SNQA 4XYQA 3U9SA 5I6WA 4K14A 4CJ2C 2R7ZB 3SK6A 2R6GA 4H0LC 1TQOA 3D4RA 2BA1A 5D3IB 4OL7A 4C2MB 3E0JA 2QCPX 3R3OA 1CK1A 3E5SA 4XIGS 1GHJA 3K57A 4WRDA 3GP7A 2A6EC 3C46A 1PZKD 2HDMA 1L0YB 2B2TC 1I4HA 4XQNA 2V4DA 2BE5C 2DY8A 4K5XA 2QF7A 3T16A 5CYUA 5FKAC 3MXUA 1SJHD 4FP5D 2EJMA 2IPKD 2KECA 4WFN3 2F0WA 1CQFA 2ICIA 5I6YA 1RD9D 2BOSA 2DN8A 5E1FA 3A55A 4IFDH 2M00A 2IT1A 2B39A 2KEDA 2EXZA 4X3KA 1GUGA 2EYHA 1PZID 4NW2A 2OEOA 5AFWA 1HUNA 2L12A 4ME5A 3GO5A 1T5EA 3H91A 1WD0A 5C4HA 4DXGA 4XT3B 1HHVA 1BNZA 4B9WA 1VCIA 1SFOB 1SBBB 1JOKA 3QOLA 4WJWA 4DK1A 1TWCB 5CBEE 4RGTA 2QILA 1SXTA 3KLSX 4B9XA 4K8IA 4C3HB 2ZXPA 2A74C 1LTGD 1NSNS 5D14A 1LT5D 1ILPA 3KLRA 2B8FA 1SDFA 2XN9C 1II3A 4N9PA 2NTTA 1Q3LA 3TP7A 1PRTD 1SYBA 1SE4A 5BN5A 1CTMA 4KJOA 5ELEA 5JEAJ 1B44D 4C1NK 5J1ZA 5JJZA 3IFTA 3I91A 2KOLA 2EPBA 3HOVB 1VF5C 2K1BA 5CV4A 2K32A 2WB1B 5EGTA 1D5ZC 1STBA 3GTKB 3RLFA 4IUQA 3IFDA 3LWEA 2BCOA 5IGCA 3I70A 3J7YW 1D5XC 1JOQA 4OIKA 2NTSA 3X3MA 2MJ8A 4R8IA 5E4XA 1EY0A 3TN2A 1B9NA 3GTOB 3HS0C 3F2UA 1HRJA 5JAVA 1IW7C 5IOCA 2JXMB 1PTOH 1O78A 1U9RA 5FLXE 1PFNA 2AWOA 4BY7B 1WVLA 3MHBA 4KKTA 1DOLA 1B1ZA 1OXXK 3SEBA 1Y8NB 3K5LA 1ML0D 2E2HB 2N88A 2QEJC 5A35A 2RA4A 1EY6A 3IAYA 3H94A 2TMPA 2N55A 1H9SA 5C0XG 5LL6X 2E2IB 4C1NI 4IURA 4IN3A 3BDOA 4K5WA 4KKUA 4DNRB 3S2DB 3SDZA 1J9OA 4JK1C 3DXJC 1IKLA 3D3RA 3P75A 3OOCA 1EU4A 2F0MA 1YNJC 4ZUJA 3P1HA 1KLUD 1RTOA 5K36G 2FMMA 4DGZA 1JCKB 1EY7A 2EY5A 3DEOA 3WDNA 2AWNA 2HUGA 4DAYA 1JWSD 5JEAH 1HCZA 4ZUIA 2L0CA 1IYVA 2QKIC 2JE6I 1LTID 3NK9A 1OO9B 2WV6D 5EPJA 3HOYB 4QMGA 2GA4B 1GHKA 5E3FA 3P20A 4XQJA 2IX0A 4CKCA 1A3UA 1DOKA 2K01A 5IGFA 1MSHA 1Q12A 3HOZB 5NUCA 1H9SB 2VNUD 1JQYD 1UAPA 1YNNC 2M2LA 2RDGA 5F2DA 3ND9A 1Z7TA 1U4MA 3W2DA 1JWUD 4FXGC 2LMCB 2XWJB 3T4AC 4KMUC 1O7ZA 5DAUA 2A6ED 3S2HB 1Q90A 4NKLA 3J7AV 1PRTF 1LO5D 2BE5D 4LMQD 5ISRA 2B8GA 4RKBA 1EY5A 1WTRA 1Y1VB 1ZXTA 5IGBA 1WTXA 1E0BA 4OO1G 2PCFB 1GUWA 2Z1CA 4ZYSA 5KNDA 2B2TA 4ABNA 2SNMA 5C4JB 4QF4A 5CV8A 3QG1A 3T51B 1PFBA 1CZWA 1LTBD 2ZXRA 3MWYW 1HUMA 1LACA 2LKVA 4I65A 2CW0C 4IZ8A 1C4QA 2F0VA 4RAUC 2NUCA 5FO8B 5CC4A 1SYDA 1D5MC 4O1NA 5EQ0A 2CQAA 4FVMA 3HG9A 1OXTA 1A3TA 2A73B 1MBYA 1BQQT 2KJXA 2EYFA 3TP5A 1CI3M 2K6AA 4U68A 3QB3A 1TVXA 3JAME 2B2YC 3J81L 5J39A 2FINB 4RA8A 1LT4D 2NVXB 1JC7A 1W6KA 2A68C 2HQEA 1ENFA 1WTOA 2F0IA 3HOWB 1RCVD 1OXUA 2D62A 4CJ1B 2K5QA 1S5FD 3I3CA 1KNAA 1K8MA 2XNAC 3C2PA 4S3SA 5EJWA 3VA7A 2E75C 5C3WA 3EJIA 3VYRA 2BDNA 1SSOA 4MN3A 1PTOC 1SYGA 2EJGC 4H44C 1PLFA 1TS3A 3D4WA 3NHHA 1X3PA 2BA0A 5M5WB 3MTSA 1SYEA 1ENCA 4PMWA 5EBDA 3NQIA 4RHRA 5C3EB 4C3IG 1Y69U 1ET9A 1BBXC 1C8CA 4ZKBB 5TSSA 2HDLA 1EYAA 1AZQA 3RZDB 3K0YA 4O42A 1IW7D 3A54A 3GTJB 2B2WA 1R9TB 4LAAA 3K5MA 4J6HA 3DMUA 3N6RA 4FF4A 1E2WA 1T5XD 1DXMA 2PZUA 1JE4A 3S15B 1EWHA 2JEAI 3NPPA 1SNDA 5C44B 4XQQA 3QOJA 4XDXA 1XYIA 3MZ5A 5IGDA 5I2YA 2JA6B 4C56C 3K5OA 2Q8RE 1G6ZA 3VYUA 1A2TA 3GTGB 3BYTB 4KD4A 4HN7A 2E74C 4QIWB 3W3AA 3TSSA 1TIID 5CR3A 2F0SA 4C3JG 5T1IA 4XXEA 2L55A 5JPNC 4F8MA 3P7JA 3QWNA 5C3XA 2C9OA 3GD7A 1YNJD 1EIHA 1TS4A 4DN4M 4F87A 2PYKA 1ZYRC 2F0NA 1VMPA 3H0GB 1X3QA 2RQXA 5EKLA 3LWUA 2O5IC 1F77A 3S1QB 1TU2B 3M7NA 1I4XA 2F3VA 3R2IA 2B2UC 3MEHA 1EY4A 4V0BA 2WIIB 3H3VC 4E6IA 1U4PA 2PPBC 2MP1A 4X3UA 4L63B 1EZ6A 5T1GA 3I4MB 1QILA 1YNND 2F4IA 2XSCA 3TDQA 3NSWA 1A15A 5LL6S 1KNEA 4MHEA 3PIO3 3GTMB 2M9VA 2IL8A 4HR7B 3VR4A 2WACA 1JOOA 5IIFA 3J7AF 4HMIA 1MGSA 1SAPA 5G3LD 1BCPD 3FRPB 4PMCA 3EROA 1PMRA 2AQ2B 4NP5A 3S1RB 1NAPA 1CHPD 1DCZA 3CQZB 4A3EB 1ESRA 2Z4HA 4A3BB 3J81E 1SJED 3BVZA 4BS9A 2KUMA 2X6LA 1MD2D 3URYA 2A69D 1I50B 2HCCA 4CKEA 4H13C 2F0GA 1LTRD 2CW0D 5K5PA 1Y1WB 1UNSA 2FMCA 5DM63 4IFDI 2IX1A 2DY7A 5EBCA 3M7GA 4K6DA 2F0DA 1JORA 1JICA 2L5TA 2F0EA 4R9WA 5C0XI 4KJNA 1ONLA 1RKNA 2EZVA 1JWMD 1KAAA 4BBRB 4DU9A 5E4WC 4DAVA 3IL8A 2A68D 2NN6H 3A7AB 4F7XA 3H09A 4M1UB 1LV9A 5J22A 2J0TD 3E6ZX 5KNCA 3FPPA 4KHZA 3JAML 5I4DA 3C3LA 3NTIA 1H9JA 5JVG3 5JOBA 3D4DA 2K5DA 5IODA 1H9KA 4RWSC 1E2ZA 5IGGA 3H6MA 3FEWX 1UUPA 3DWQA 1F2YA 1CFMA 2YYZA 1PTOD 3RD4A 2I46A 1ICWA 5JVH3 2RSOA 2RDFA 2NVYB 4X3TA 2AQ1B 1F9RA 2EVBA 1S5DD 3GTPB 3HZXA 3CKIB 3DHQA 3MFGA 1QCBD 2B2VA 2XIWA 1LTTD 4L6TB 5ELCA 1SNPA 5CV5A 4IUVA 4KHVA 1CA6A 2F0QA 1AFPA 4ULLA 2AUJD 2O5JC 4RH6A 1G91A 4ODGA 4QB4A 1R4QB 3MVVA 3M4OB 5CV7A 3NP8A 2RSNA 3A8KE 3S14B 3VR2A 3LNNA 4IFDG 3CU7A 2R92B 3KLSA 1FGBD 1GXDC 2K04A 2CHBD 4A3GB 2EE1A 5DM73 3KK7A 1PRTB 4Q0FA 5ELBA 4EQPA 4I7ZC 3VR5A 1EWCA 5D3DA 4OO1I 1M8AA 1ZKOA 1STNA 3I73A 1SMYC 2RVLA 3GTQB 1ZEQX 5CMDA 1JB3A 5CORA 2EYMA 1LT3D 5KNBA 4HEDA 1HFNA 2F0PA 1L0XB 2F03A 3MAQA 4G4KA 5G3LF 1BCPF 3BDCA 3CRLC 3M4YA 3HOXB 1B9MA 4XTCS 3BVGA 1ZYRD 4RKLA 4NMZA 4J1MA 3PUYA 1EU3A 3WOEA 4R8NA 4N9TA 4A3MB 2NWGA 4KN4C 4UDUC 4EQOA 4RCNA 4G7OC 1TS5A 3QJYA 3QO2A 3OWEB 3MFYA 1I4PA 1DYQA 4KK7A 4OIJA 1GUTA 3T56B 3S9WA 2B2UA 1SE3A 2FFKB 1S5BD 1Y8PB 1EOTA 2A6HC 4JBWA 1BCPC 2G9DA 2L9HA 4ZLTF 2FHTA 1SE2A 2MPMA 4FNFA 3BVMA 4YIJA 3NWTA 5KEEA 4HAEA 2WKDA 4B08A 1EY8A 1K83B 4HCSA 4ZKCB 3Q0AA 5CV9A 5M3FB 3ITPA 1WCMB 3T13A 1E2VA 1HFGA 2RBMA 1KDCA 1TY0A 2A69C 1R4PB 1D1KA 1NR2A 1KABA 2OT2A 1G2TA 3SK5A 1PTOF 4MIUA 3LX0A 3NUCA 2KQ3A 3K58A 1OXVA 2ZT9C 1F9QA 1SNCA 1G2SA 2B63B 1C48A 4ID6A 3VR3A 3WOFA 1F9PA 1FNUA 3TBIB 2H1EA 4C3IB 4BWGB 4J8QA 4Z9CB 3GTLB 4ZRZA 5KIXA 2L11A 5KYIA 1LABA 3EVQA 1LTAD 4V190 3BZDB 1PDQA 5CV6A 2NYZD 1QOHA 1A2UA 3PMFA 5JEAG 1JR0D 3Q23A 4RGOS 3EA6A 3EFXD 3K59A 2F0OA 5C5LA 1RJTA 1HQMC 2FJ2A 1HTPA 3G7LA 3FMCA 3R93A 2EYPA 4FYDA 3N52A 2BDOA 4FF3A 5EPLA 4TKOB 2O2LD 1B3AA 1GUOA 5HURA 4C3JB 1STAA 4FXDA 4G7HC 3GV6A 4DFAA 2EYLA 1MI2A 1S5ED 4KY5A 3PUZA 4PQXA 1G291 2D5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HFG A;  1O7Y A;  3ONA B;  2D9U A;  1CM9 A;  1J8I A;  1JE4 A;  5EPJ A;  1HFN A;  4U68 A;  5E4X A;  1KNE A;  4MHE A;  2KED A;  4QUC A;  1NR2 A;  1TVX A;  2IL8 A;  2JYO A;  1ILQ A;  1MSG A;  4X3K A;  4XT1 B;  3TZD A;  4HSV A;  1G2T A;  2X69 A;  5D65 A;  1F2L A;  5DNF A;  1QG7 A;  3TN2 A;  2SDF A;  5EKI A;  1AP0 A;  4RWS C;  2B2Y C;  3F2U A;  4NW2 A;  1HRJ A;  2Q8T A;  2FIN B;  3D6W A;  4RA8 A;  1B50 A;  1MGS A;  2HCI A;  1DOK A;  1B2T A;  5AFW A;  2B2V C;  2JP1 A;  1F9Q A;  1X32 A;  1IL8 A;  2K01 A;  2L12 A;  2KEE A;  1G2S A;  3HP3 A;  4XDX A;  1WTO A;  1B4O A;  2EOT A;  1XYI A;  1MSH A;  1SAP A;  1ICW A;  2RSO A;  1F9P A;  3H91 A;  2Q8R E;  4UAI A;  4X3T A;  1WD1 A;  4CJ1 B;  1WD0 A;  1G6Z A;  1F9R A;  1PFN A;  2M2L A;  2H1E A;  1XX8 A;  4XT3 B;  1HHV A;  1RTN A;  1BNZ A;  2NZ1 D;  3I3C A;  1KNA A;  1WVL A;  1U4R A;  1DOL A;  2L1B A;  1DZ1 A;  2R3Z A;  2B2Y A;  2K03 A;  5COY A;  1F9S A;  1U4M A;  1WTP A;  1NAP A;  1ML0 D;  1ESR A;  2L11 A;  2N88 A;  2B2V A;  2J7Z A;  5EJW A;  2XIW A;  5T1I A;  2KVM A;  3DEP A;  3P7J A;  4QUF A;  3KBX A;  5CBE E;  1O7Z A;  1PDQ A;  2RA4 A;  2NWG A;  2NYZ D;  4CJ2 C;  2K28 A;  3UI2 A;  2BDN A;  1SSO A;  4MN3 A;  1EIH A;  4IUV A;  5D14 A;  1EIG A;  2KUM A;  4DN4 M;  2X6L A;  1AZP A;  1CA6 A;  2N55 A;  1ILP A;  1HA6 A;  4LMQ D;  1PLF A;  2HCC A;  2MGS A;  4IUP A;  1SDF A;  1VMP A;  4IUR A;  1B53 A;  3QO2 A;  1EL0 A;  2VXW A;  1Q3L A;  1G91 A;  3KUP A;  3I90 A;  1X3Q A;  1WTR A;  1ZXT A;  1WTX A;  1RJT A;  1BF4 A;  1E0B A;  1X3P A;  1J9O A;  1NCV A;  1IKM A;  1IKL A;  2FJ2 A;  2RSN A;  2DY7 A;  4OIJ A;  2CVR A;  1DON A;  3G7L A;  4IUT A;  1CA5 A;  1GUW A;  2B2U A;  2B2T A;  3R93 A;  2K04 A;  3MTS A;  2B2W C;  1JIC A;  2FFK B;  3GV3 A;  5JJZ A;  3I91 A;  4ZAI A;  2KOL A;  2EPB A;  2B2U C;  2HDM A;  1EOT A;  2EE1 A;  2K1B A;  2L4N A;  2X6G A;  2B2T C;  4R9W A;  4X3S A;  4ZK9 B;  1PFB A;  3FDT A;  2L9H A;  1PFM A;  4ZLT F;  1RTO A;  2DY8 A;  2FHT A;  2K05 A;  2MPM A;  1BBX C;  3N52 A;  2FMM A;  1QE6 A;  3MWY W;  1C8C A;  1HUM A;  4ZKB B;  2HDL A;  3DEO A;  1U4P A;  5EPL A;  5EPK A;  2MP1 A;  1AZQ A;  2HUG A;  4X3U A;  4HAE A;  4O42 A;  4RAU C;  1QNK A;  4IUQ A;  1B3A A;  5E4W C;  1O80 A;  1RHP A;  3FPU B;  4IUU A;  3SVM A;  1DOM A;  1M8A A;  3IFD A;  3IL8 A;  4CJ0 B;  3LWE A;  2B2W A;  4HCS A;  5CBA E;  3I8Z A;  2KEC A;  1U4L A;  3GV6 A;  4ZKC B;  5EQ0 A;  2RVL A;  1WTW A;  1WTV A;  1VMC A;  1WTQ A;  1MI2 A;  5T1G A;  1BO0 A;  4HED A;  1NR4 A;  3Q6S A;  5CMD A;  1LV9 A;  5COR A;  4OIK A;  1ROD A;  1S4Z A;  2MJ8 A;  4R8I A;  1HUN A;  1EQT A;  3DM1 A;  1A15 A; 
#chains in the Genus database with same CATH topology
 2JA6 H;  2WIN B;  1LTS D;  1X65 A;  3HKZ B;  1MSG A;  4UP8 A;  3G6E A;  4DF7 A;  3GTG H;  2XRS D;  4CHT B;  2SDF A;  2YU9 B;  1CZG A;  3R8B A;  1A3V A;  1B50 A;  3D6W A;  2PNR C;  2HCI A;  4L5S A;  3TME A;  1X6O A;  1PHJ A;  4OX9 Q;  2EY1 A;  3I72 A;  1VQO A;  3F1Z A;  1WD1 A;  1PXU A;  2ZXO A;  1QNU A;  2LS0 1;  1RTN A;  3F2C A;  2VQF L;  4JG2 A;  1I6H B;  3IKJ A;  2SEB D;  1CT1 D;  5GAE C;  2K03 A;  1WTP A;  2MQH A;  1FR3 A;  4A4I A;  1F2M A;  1YJW A;  3S1N B;  1I4G A;  1QUQ A;  2MO0 A;  1QWY A;  3DEP A;  3H0G H;  4P75 A;  4OWW B;  2PQE A;  3RZO H;  1PV4 A;  4GN4 B;  1V1Q A;  1VDZ A;  1CKN A;  3CP0 A;  2F0T A;  1V8Q A;  2Z4I A;  4DV2 Q;  4KTA A;  2LXK A;  3S1M B;  3MEF A;  5KGU A;  3PO3 B;  1SNO A;  1DD2 A;  2OQK A;  1V1P B;  2Z9H A;  3D8G A;  4TSS A;  2L15 A;  1I6V C;  3OMC A;  2XTI A;  1L0W A;  2KCN A;  5DEH A;  4C2M H;  1SMY D;  4JV5 Q;  3BS1 A;  1AN8 A;  1K9M C;  1SN8 A;  5C0X J;  4K2K A;  1A6X A;  3MC0 B;  3JAM i;  5LMN W;  2Q8I B;  4BY1 B;  4A3D G;  3L0O A;  4Y7N B;  1D2B A;  3I4M H;  3ZJY C;  3SE0 A;  4IUN A;  5HGT A;  2KHS A;  5EPK A;  3HOU B;  1HR0 L;  3FKI G;  1RHP A;  1KDB A;  1XXG A;  3X3N A;  3GTM H;  2KBN A;  4CJ0 B;  2E2D C;  3V2T A;  3STB D;  1VQF A;  4K5V A;  1HA6 A;  1U4L A;  1WTQ A;  4BBS B;  3S16 B;  2QDB A;  5LHY 1;  1HXY D;  2YTX A;  3I4N G;  4NXN Q;  3Q6S A;  3I4L A;  4RGN A;  3ULJ A;  5M5X B;  4LUO A;  1E1O A;  1O7Y A;  1VQA A;  1Q1B A;  1FYC A;  1QUQ B;  3VYT A;  5GQO A;  2KCT A;  1F2L A;  4ZQ3 A;  2JA8 G;  1D6E C;  3UDG A;  2WAQ G;  3S1R H;  2F0H A;  2Q8T A;  5I9P A;  1CQV A;  3HP3 A;  3CQZ H;  4A3E H;  5IP7 H;  1XMO Q;  1CHQ D;  2Y0S B;  4IO9 A;  1XTC D;  4UAI A;  4JI7 Q;  1XNR L;  2LY7 A;  3NXW A;  2UUA Q;  1YBY A;  2ENB A;  3A8I E;  3PO3 G;  2DGY A;  2EDG A;  3HRZ C;  1G51 A;  4L5R C;  1DZ1 A;  1U5K A;  5COY A;  3VA5 A;  1I50 H;  4QCL A;  1I3Q B;  4O2D A;  1A63 A;  2KVM A;  4XYO A;  1SFO H;  1S3O A;  3A7L A;  5BN3 A;  1PZJ D;  1Y1W H;  1EZ8 A;  1TR5 A;  1Z47 A;  1HTL D;  2LXJ A;  2QGQ A;  2LFN A;  3BZK A;  3VR6 A;  2EYJ A;  1TWC H;  2A6H D;  2JEB I;  3C1F A;  4YHH Q;  4QY7 A;  1S5C D;  2MGS A;  2R93 G;  2JSO A;  3OMG A;  4KHP L;  3PO2 G;  2VXW A;  4IJL A;  3AQQ A;  3G6J B;  2OQ0 A;  3ND8 A;  1E22 A;  2HHH Q;  3PF4 A;  1K3R A;  2ZJP A;  2OXP A;  3NTK A;  1IKM A;  1DM0 B;  1WFQ A;  4AYB G;  3PUW A;  2Q2T A;  4KKS A;  4BBR H;  4O0A A;  3NBH B;  4HJ7 A;  1O7L A;  3GV3 A;  3CC7 A;  3QR8 A;  2L4N A;  2X6G A;  2D2C C;  4ZK9 B;  3CPW A;  3CCV A;  2KCC A;  3DWP A;  1UE7 A;  3NEN A;  3TRE A;  3T53 B;  2WKC A;  4IAL A;  3HOV H;  3OSO A;  5C0X H;  4IUU A;  1C9O A;  3HKS A;  3GQB A;  1K0S A;  3RUZ A;  1STY A;  4DUZ Q;  3O13 A;  4EX5 A;  4CGY B;  1EIF A;  4A3I B;  2R7Z G;  1BO0 A;  1D1I A;  3PUX A;  2B3G A;  2Y0S G;  3RMH A;  1ESF A;  1KD1 C;  4QUC A;  1Q8I A;  2NVY H;  1I94 Q;  2Q2H A;  2JYO A;  3TZD A;  2X69 A;  4L5T A;  1QG7 A;  3GTP H;  1HR0 W;  4R4Q A;  4X62 Q;  5FO7 B;  3OW7 A;  4CDE C;  5K36 H;  3SXH A;  4L8J A;  3EN2 A;  2I0Q A;  5GAD C;  5GAG C;  3S17 B;  4NB3 A;  3BJU A;  1V43 A;  2Q2I A;  3CCL A;  1EQV A;  3MXP A;  4OWX B;  2UXD Q;  5M3M B;  4OEM B;  2F0F A;  2NB0 A;  2Z8L A;  2B2Y A;  4LFA L;  4POF A;  1S72 A;  3MA2 B;  4GOP C;  1BR9 A;  4BY7 H;  4P2C B;  3SHL A;  3NTH A;  2JA5 B;  4YWL A;  1BCP B;  4HSP A;  3HEJ A;  3KF8 A;  3U9O A;  3M4O H;  1QB5 D;  4K6L A;  4DA2 A;  2K28 A;  4MTN A;  4EQN A;  4JPB W;  3S14 H;  3CCU A;  1GUN A;  1EIG A;  4DV2 L;  3A8J E;  3CXC A;  2R92 H;  2NN6 I;  3CPF A;  1QJO A;  1HPC A;  1TKW B;  4KD3 A;  3K5N A;  1YI2 A;  4X65 Q;  4DR7 Q;  4DAP A;  2F1M A;  2K33 A;  4A3G H;  3PQI A;  3AYH B;  1LLR D;  3VYS A;  3PIP 3;  2RF4 A;  3U4V A;  2E2I H;  1NCV A;  1AEX A;  4JV5 L;  3MXG A;  1SEB D;  3GDE A;  3FP9 A;  3S24 A;  1BBW A;  2B2W C;  3OPO A;  4NXM Q;  4TQU S;  2NBF A;  4PZ8 A;  1SYC A;  1EY9 A;  3U50 C;  1PFM A;  4JCV E;  4PNY A;  1SMX A;  1XWE A;  1PH6 A;  3PV0 A;  4DNT B;  4RHS A;  2AMC B;  1H9R A;  4OON A;  3L2P A;  4MZ9 A;  1TWH B;  4HMJ A;  3CC4 A;  3ER0 A;  5CBA E;  4K0K Q;  5M9O A;  4BXX H;  1VMC A;  3CHB D;  1UEA B;  1VQN A;  4C3H G;  4NXN L;  5IT9 E;  2PZT A;  3TEH B;  3HOX H;  4OO1 H;  2VUM B;  3L7Z C;  3DM1 A;  1M4V A;  1VQ9 A;  2EYO A;  2IY5 B;  5IY0 A;  2CCZ A;  1IL2 A;  5A2Q L;  4XT1 B;  2F4V Q;  2EXD A;  5D65 A;  3HOY H;  2VZA A;  2XRQ D;  3KF8 B;  3L3O C;  3PUV A;  3OWF A;  2OF1 A;  1X32 A;  1XMO L;  4OGQ C;  2GVB A;  1NUC A;  4G57 A;  4KI0 A;  4JI7 L;  4FF2 A;  4RCO A;  2UUA L;  3I4O A;  1VQK A;  4DR2 Q;  1XX8 A;  2JA7 B;  2A1A A;  2NZ1 D;  1U4R A;  4PMB A;  4A3K B;  1L1O C;  1NNX A;  1OXS C;  2IW3 A;  1SNM A;  5KYL A;  3M85 A;  1F9S A;  5IYD G;  1YVC A;  4FO2 A;  2IJ0 A;  3J80 L;  2J7Z A;  1KLG D;  4K2L A;  1PTO B;  4QUF A;  1N9W A;  2K7V A;  4EVO A;  1EFI D;  3STB C;  4B3S Q;  2G5D A;  1MJE A;  4R4O A;  4BA1 I;  3K7A B;  1MKH A;  3S2H H;  2NN6 G;  5ELD A;  3CCE A;  1EL0 A;  3KUP A;  2HHH L;  2P5Z X;  1YIJ A;  2IHE A;  1VQJ A;  4PG3 A;  1AE2 A;  2CVR A;  5I2X A;  3OHX C;  1YJN A;  2CFM A;  4IUT A;  1Y1V H;  2ID0 A;  1I4R A;  3OIP A;  1JT8 A;  1ET6 A;  4ZAI A;  4RFB A;  2VUM G;  3OIQ A;  3FDT A;  2BH2 A;  1WTH A;  1VQD A;  3A56 A;  1UEB A;  2K05 A;  3AMU A;  5C4J H;  1WCM H;  1E3P A;  1DJR D;  2GN5 A;  1QNK A;  4P71 A;  3HFZ B;  2I5H A;  3K81 C;  1Q82 C;  3DUZ A;  5FO9 B;  4DUZ L;  3I8Z A;  1K8O A;  2WB1 E;  2PO4 A;  4ILW A;  3KFU A;  4KN7 C;  1VS0 A;  3I7F A;  1E1T A;  3TZU A;  1GUS A;  1ROD A;  1S4Z A;  2DNC A;  1I4Q A;  1VQI A;  5LMU Q;  1H9M A;  2JJQ A;  2B63 H;  2IWH A;  2SOB A;  1PYB A;  3ONA B;  4PV1 C;  1STH A;  1CM9 A;  2D9U A;  1I94 L;  1SE8 A;  4K8J A;  1BOS A;  5KRU A;  2ICE C;  3UDX A;  4DR6 Q;  1HJP A;  4C3I H;  5FLM H;  4LFB L;  3DWA A;  2F52 A;  4X62 L;  5CGK A;  4BA2 I;  1STE A;  4DXF A;  3SK4 A;  4G7Z C;  3GTL H;  1RIP A;  3ERQ A;  2VB3 X;  2F3W A;  4F88 A;  1B4O A;  1PYW D;  2RDH A;  2WP8 J;  2PQA A;  3DLL A;  3KJP A;  4QGU A;  2UXD L;  5C4Z A;  3A5U A;  1VQG A;  3NWS A;  1BDO A;  4YCV A;  2PZW A;  4LK1 C;  3TQY A;  1VF7 A;  4CDD C;  4DAY B;  2BH8 A;  2L1B A;  3R2T A;  1RF2 D;  5ELF A;  2PW5 A;  1PA6 A;  1JMC A;  4JYA Q;  2AUK A;  4YWK A;  2J4X A;  3KBX A;  1IYU A;  2H4O A;  1AW7 A;  4M8A A;  3SR1 A;  1IHZ A;  4A3J B;  3V05 A;  4EQ5 A;  1KDA A;  4NDX A;  1NJI C;  2XWB B;  4LJZ C;  1TS2 A;  4UY8 C;  5FJ8 H;  2F0L A;  2C35 B;  3EQL C;  3PSI A;  1YHQ A;  3V96 A;  1EYD A;  4DR7 L;  1CKM A;  1B53 A;  4GN3 B;  5FLX c;  1BUV T;  3I90 A;  2I07 B;  4HIO A;  3NBI A;  3ZYY X;  4EGV A;  3EIV A;  2MHV A;  1CA5 A;  1RDP D;  2O4X A;  2PW7 A;  4JI0 L;  1EEF D;  5BN4 A;  4NXM L;  4P74 A;  4RG1 A;  4C3J H;  3HOZ G;  2UU9 Q;  1UE5 A;  1G8Z D;  1Z6H A;  1IBM Q;  4JOI C;  2Z6K A;  4B3T Q;  3Q24 A;  1Q1E A;  1KHI A;  3NQT A;  1TT2 A;  3CD6 A;  3MXN A;  5C3E H;  1FD7 D;  3RR5 A;  1PRT C;  1UWV A;  3Q8D A;  1O80 A;  3SVM A;  3FPU B;  1QVC A;  1DOM A;  1NMG A;  2G9H D;  4MTK A;  3D6C A;  4K0K L;  3KBG A;  1NE3 A;  3CRK C;  2PQA B;  1NR4 A;  2F0K A;  3BU2 A;  4OEL B;  3BDL A;  5C6A A;  3BG3 A;  5M5Y B;  1EQT A;  2NVQ B;  1J8I A;  4JI1 Q;  5I9O A;  2WFW A;  1LTL A;  3AU7 A;  4UP7 A;  1ILQ A;  2VB2 X;  2F4V L;  4HSV A;  1ASY A;  4A93 B;  1HA5 A;  4A3F B;  2XVS A;  5JJI A;  1TWG B;  4WOR A;  3FVQ A;  1I6H H;  1V1P A;  1AP0 A;  3SK8 A;  1TWA B;  4RGM A;  1ASZ A;  2NVT B;  2B2V C;  4CBV A;  3S1N H;  1IL8 A;  3I56 A;  2KEE A;  1BXT A;  2RKS A;  2F0J A;  4HJ5 A;  1F2Z A;  1W6J A;  4DR2 L;  4LFC Q;  4QJF A;  5C4X B;  4A3D B;  4LF9 Q;  1KTK A;  2R3Z A;  3S1M H;  2ALY B;  5FOB B;  1MIU A;  3Q22 A;  1N34 L;  2IX3 A;  1SR3 A;  5DLQ E;  2A19 A;  3FKI B;  2ZTD A;  5A2Q E;  1Y14 B;  4R4T A;  1EIY B;  3QIA A;  5JPM C;  1WOC A;  1EEI D;  1X3G A;  2CKZ B;  4B3S L;  4DR4 Q;  4QQB X;  3UI2 A;  1Y8O B;  2F0U A;  4FXK C;  1ENA A;  3I4N B;  1AZP A;  4H7B A;  1TWF B;  4IUP A;  4A3C G;  2ZM6 Q;  1WI5 A;  1SRO A;  3MXN B;  2PI2 E;  2TSS A;  5EKK A;  4DK0 A;  2PNH A;  4BY1 H;  4I7A A;  2Q2U A;  1HQR D;  1BF4 A;  3C1E A;  4HTH A;  4TRD A;  5FK9 C;  2JA8 B;  1TXY A;  2WAQ B;  1YNX A;  1DON A;  1MJC A;  3HOW G;  3HOU H;  1AE3 A;  3J80 E;  3T1H L;  4CKB A;  2JA9 A;  5IGE A;  1FNW A;  1CUK A;  2N8N A;  4FF1 A;  4BBS H;  4X3S A;  3M4P A;  3NE5 B;  3S1Q H;  4Q5V A;  2MUY A;  4U67 3;  4IQZ A;  4OWT B;  4IFD J;  1QE6 A;  1V1O A;  4A93 G;  5M5X H;  2C5C A;  4A3F G;  2PMZ B;  1TY2 A;  1FNV A;  2E2J B;  2SNS A;  3D31 A;  5IT9 L;  2AQ3 B;  5IP9 H;  4OHJ A;  5FLX L;  1WTV A;  1WTW A;  2R61 A;  3BYY B;  4GZY C;  1FJG Q;  3AEV A;  1EWI A;  1K3B C;  3VDY A;  4RMF A;  3TP6 A;  5C4X G;  1Z9F A;  4KY7 A;  5IWA Q;  3M3Y B;  4GOP B;  4LW1 A;  1P16 A;  4DV4 Q;  2EJF C;  2EY6 A;  2VQE Q;  2R93 B;  5C5M A;  4DV3 L;  1LT6 D;  3PO2 B;  2E76 C;  5DNF A;  4DR5 Q;  4HCE A;  3TP8 A;  5EKI A;  3L9A X;  3HGB A;  3E0E A;  3F2B A;  1EYC A;  1I3Q H;  1B2T A;  2A5H A;  2JP1 A;  4GNX C;  2K5W A;  1SYF A;  4AYB B;  3RNU A;  2KA7 A;  2EOT A;  2EY2 A;  3CME A;  2DNE A;  4JI6 Q;  4AQY L;  3NBH A;  3K6O A;  1GJX A;  2N78 A;  3ULP A;  1O7I A;  4LWC A;  3AB9 A;  4KY6 A;  4JYA L;  5HY6 A;  3RZO B;  3PCO B;  4KV6 A;  4DKA C;  3JAM c;  1GOZ A;  2RHS B;  1STG A;  1SNQ A;  4XYQ A;  3U9S A;  5I6W A;  4A3B H;  4K14 A;  4CJ2 C;  2R7Z B;  3SK6 A;  2UUB Q;  1U0L A;  2R6G A;  4H0L C;  1TQO A;  3D4R A;  2BA1 A;  3ULL A;  2NZO A;  5D3I B;  4OL7 A;  4LF8 Q;  2HD3 A;  4C2M B;  3PIO A;  4R4I A;  3E0J A;  5C44 G;  2QCP X;  3R3O A;  1CK1 A;  3E5S A;  3SGI A;  4XIG S;  2QA4 A;  2DUD A;  3I2Z A;  4DR3 Q;  3WWV A;  4B3M L;  1GHJ A;  2JA6 G;  3K57 A;  3M9B A;  1XPR A;  4WRD A;  4B3R Q;  4DK6 C;  2UU9 L;  3GP7 A;  2A6E C;  3C46 A;  1PZK D;  2HDM A;  2K14 A;  1L0Y B;  4A3I H;  1IBM L;  2B2T C;  1I4H A;  4XQN A;  2V4D A;  2BE5 C;  4B3T L;  2DY8 A;  4HID A;  4K5X A;  1VQE A;  2QF7 A;  3T16 A;  5CYU A;  5FKA C;  2OCE A;  1IBL Q;  3MXU A;  1SJH D;  3CCM A;  4FP5 D;  2EJM A;  2IPK D;  1A8V A;  2KEC A;  4WFN 3;  2F0W A;  1CQF A;  2ICI A;  3HKZ E;  4YCU A;  1L1O B;  1RD9 D;  2KHI A;  2QDL A;  5I6Y A;  2BOS A;  5IYB H;  3NEL A;  2DN8 A;  5E1F A;  3A55 A;  4IFD H;  1N32 Q;  2M00 A;  3S17 H;  4JI1 L;  2IT1 A;  2B39 A;  3J80 i;  2KED A;  2EXZ A;  2K5H A;  3H0G G;  4X3K A;  1KIX A;  1GUG A;  2EYH A;  5M3M H;  1PZI D;  2HIV A;  2EIF A;  4NW2 A;  4A3L H;  1VQH A;  3E9H A;  2OEO A;  5AFW A;  1HUN A;  4GN5 A;  2L12 A;  4LF6 Q;  4ME5 A;  1EYG A;  3GO5 A;  1T5E A;  3H91 A;  2JA5 H;  1WD0 A;  2R7F A;  5C4H A;  1VQ4 A;  4DXG A;  4XT3 B;  1HHV A;  1BNZ A;  1KXL A;  4B9W A;  1VCI A;  1SFO B;  4R4C A;  1SBB B;  3M4Q A;  4J15 A;  1X3E A;  4JI4 Q;  1JOK A;  2MNA A;  3QOL A;  4WJW A;  5IYC H;  4DK1 A;  1A0I A;  1TWC B;  3I4M G;  4DNI A;  2JN4 A;  5CBE E;  1NMF A;  4RGT A;  2QIL A;  1SXT A;  4OX9 L;  3KLS X;  1KAW A;  4K8I A;  4B9X A;  2ZXP A;  2A74 C;  4C3H B;  1LTG D;  1NSN S;  4QIW E;  3KDF A;  1JJC B;  5D14 A;  1LT5 D;  1ILP A;  2MFI A;  2ZM6 L;  3KLR A;  2B8F A;  4LNQ A;  1SDF A;  2XN9 C;  1II3 A;  4N9P A;  2NTT A;  1Q3L A;  4JI8 Q;  3TP7 A;  1PRT D;  1SYB A;  4UPA A;  1SE4 A;  5BN5 A;  1CTM A;  4KJO A;  2HIX A;  1FL0 A;  5ELE A;  5JEA J;  3ICE A;  1B44 D;  4C1N K;  1VQB A;  2NZH A;  5J1Z A;  1TWH H;  2HQL A;  5JJZ A;  3U4Z A;  3IFT A;  3I91 A;  4JW0 A;  2KOL A;  2EPB A;  2ATW A;  3HOV B;  1VF5 C;  2K1B A;  5CV4 A;  3RN5 A;  2K32 A;  2WB1 B;  5EGT A;  1D5Z C;  1STB A;  3GTK B;  4A3E G;  4WJ4 A;  5IP7 G;  3RLF A;  4IUQ A;  4GLX A;  3IFD A;  3LWE A;  1B8A A;  2BCO A;  1B3Q A;  5IGC A;  1J6Q A;  3I70 A;  4GLV B;  3J7Y W;  3K7U C;  1D5X C;  1JOQ A;  4JI3 Q;  4OIK A;  5IWA L;  2NTS A;  3X3M A;  2MJ8 A;  4R8I A;  3GTQ H;  2VQE L;  5E4X A;  1PH4 A;  1Y1W G;  2JA7 H;  1EY0 A;  3TN2 A;  1B9N A;  3GTO B;  3KF6 B;  4A3K H;  3HS0 C;  4CDF C;  2VY3 A;  3F2U A;  3CCQ A;  1HRJ A;  5JAV A;  1IW7 C;  3TS2 A;  5IOC A;  4JC0 A;  2JXM B;  3KDF B;  1PTO H;  4JI6 L;  1HH2 P;  1O78 A;  1U9R A;  3AFQ A;  5FLX E;  1PFN A;  3UE1 A;  2AWO A;  4BY7 B;  1WVL A;  3MHB A;  4KKT A;  1DOL A;  2CH4 A;  1B1Z A;  1OXX K;  3SEB A;  4BBR G;  2JK8 A;  3K7A H;  1Y8N B;  3K5L A;  1ML0 D;  2E2H B;  2N88 A;  4HJ9 A;  2QEJ C;  1PH2 A;  5A35 A;  3CCS A;  2RA4 A;  1EY6 A;  3IAY A;  3H94 A;  3HOV G;  4A3M H;  1VQ5 A;  2OWO A;  1EQR A;  2N55 A;  2TMP A;  2WB1 G;  3FHW A;  4A76 A;  3RN2 A;  1H9S A;  2ZTE A;  4HIM A;  5C0X G;  5LL6 X;  4LF8 L;  2E2I B;  4C1N I;  4IUR A;  4IN3 A;  3BDO A;  4X66 Q;  4K5W A;  1W2B A;  4KKU A;  4DNR B;  2ZTC A;  3S2D B;  3SDZ A;  1J9O A;  4JK1 C;  3DXJ C;  2YV5 A;  1IKL A;  4DR3 L;  3D3R A;  3P75 A;  4B3R L;  1IBK Q;  1YHB A;  3OOC A;  3I55 A;  3W1B A;  2DJF C;  1EU4 A;  3PGZ A;  4YHH L;  4X6A H;  2F0M A;  1YNJ C;  4JVZ A;  4TVA B;  4ZUJ A;  3P1H A;  1KLU D;  3JC6 6;  3J81 c;  1RTO A;  4FDB A;  5K36 G;  2FMM A;  3A74 A;  4DGZ A;  1JCK B;  1EY7 A;  2EY5 A;  4LF5 Q;  3DEO A;  2N3S A;  3WDN A;  1YEZ A;  2AWN A;  2HUG A;  1IBL L;  3LGJ A;  4DAY A;  1JWS D;  5JEA H;  1HCZ A;  1W3S A;  4ZUI A;  2L0C A;  1IYV A;  1K83 H;  2QKI C;  2JE6 I;  1LTI D;  3NK9 A;  1OTC A;  1OO9 B;  2WV6 D;  3A5Z B;  4BY7 G;  5EPJ A;  3HOY B;  2MO1 A;  2E5L Q;  4GKK Q;  4QMG A;  2GA4 B;  5M3F H;  1V9P A;  1GHK A;  1XPU A;  4UHV A;  5E3F A;  1NBW A;  4GNX A;  1BVS A;  3P20 A;  4XQJ A;  3CCJ A;  2IX0 A;  4CKC A;  1A3U A;  2R92 G;  1DOK A;  1VQM A;  4LF6 L;  2K01 A;  5IGF A;  1QZH A;  1MSH A;  1Q12 A;  4A3G G;  3HOZ B;  5NUC A;  1H9S B;  2VNU D;  1JQY D;  1UAP A;  1YNN C;  2M2L A;  4A3J H;  4YCW A;  4LF4 Q;  2RDG A;  3CC2 A;  5F2D A;  3ND9 A;  3RLO A;  1Z7T A;  1XJV A;  4JI4 L;  1U4M A;  3W2D A;  1JWU D;  4FXG C;  2LMC B;  2XWJ B;  3T4A C;  4KMU C;  1BKB A;  1O7Z A;  5DAU A;  3UDF A;  2A6E D;  3OW2 A;  3S2H B;  1Q90 A;  4NKL A;  3J7A V;  1PRT F;  1LO5 D;  2BE5 D;  1QZG A;  4LMQ D;  5ISR A;  3H3V H;  4JI8 L;  3W1G A;  2B8G A;  4RKB A;  1VQL A;  4BXX G;  1EY5 A;  1WTR A;  1Y1V B;  1ZXT A;  5IGB A;  1WTX A;  1E0B A;  3J7A 5;  3HOX G;  4OO1 G;  4N8X 1;  4GLA C;  2PCF B;  2K5N A;  2Z1C A;  4ZYS A;  5KND A;  1GUW A;  1B70 B;  2B2T A;  4ABN A;  4DV7 Q;  2SNM A;  4LUV A;  5C4J B;  4QF4 A;  5CV8 A;  3QG1 A;  2EQS A;  3T51 B;  1PFB A;  1CZW A;  1YIT A;  3HOY G;  1LTB D;  4X65 L;  2ZXR A;  3MWY W;  1HUM A;  1LAC A;  5M5Y H;  4GNX B;  2LKV A;  4I65 A;  2CW0 C;  4IZ8 A;  1B7Y B;  1C4Q A;  2F0V A;  4RAU C;  2NUC A;  5FO8 B;  5CC4 A;  1SYD A;  1D5M C;  4O1N A;  5EQ0 A;  2CQA A;  4FVM A;  3HG9 A;  1UE1 A;  1OXT A;  2RCF A;  1A3T A;  4JI3 L;  1TWA H;  2A73 B;  2NVT H;  1MBY A;  1BQQ T;  2KJX A;  2EYF A;  1UE6 A;  4JI5 Q;  3TP5 A;  1CI3 M;  2K6A A;  4U68 A;  1K8A C;  3QB3 A;  1TVX A;  2V1C C;  3TS0 A;  4A3D H;  3JAM E;  1K8G A;  2B29 A;  2B2Y C;  3J81 L;  5J39 A;  2FIN B;  4RA8 A;  1LT4 D;  2NVX B;  1JC7 A;  1FGU A;  1W6K A;  2A68 C;  2HQE A;  1ENF A;  1WTO A;  2F0I A;  3HOW B;  2YU9 H;  3FKI H;  1RCV D;  1OXU A;  2D62 A;  4CJ1 B;  1Q86 C;  2K5Q A;  1S5F D;  1E24 A;  4N8F A;  3I3C A;  1X55 A;  4HJ8 A;  1KNA A;  1GM5 A;  3I4N H;  1N33 Q;  1K8M A;  1PH7 A;  2XNA C;  1Y1V G;  3C2P A;  4S3S A;  5EJW A;  3VA7 A;  2E75 C;  5C3W A;  1PH5 A;  3IRB A;  4P72 A;  3EJI A;  4CDC C;  4LF7 Q;  3VYR A;  2BDN A;  1SSO A;  4MN3 A;  2JA8 H;  1PTO C;  1WCM G;  1SYG A;  2D0P A;  2EJG C;  4H44 C;  5J3B A;  1PLF A;  4APV A;  4X66 L;  4GOP A;  1TS3 A;  3D4W A;  3NHH A;  2KCM A;  3KOJ A;  1X3P A;  3PO3 H;  2BA0 A;  2B63 G;  1IBK L;  2E2J H;  5M5W B;  1Q8K A;  3MTS A;  1IZ6 A;  1SYE A;  1ENC A;  4PMW A;  5EBD A;  1I5F A;  3NQI A;  4RHR A;  3AFP A;  5C3E B;  4WJ3 M;  4C3I G;  5FLM G;  1Y69 U;  3J81 j;  1SLJ A;  1ET9 A;  1BBX C;  4LF5 L;  1C8C A;  3M3Y H;  3A0J A;  4ZKB B;  5TSS A;  1VQ8 A;  2HDL A;  1EYA A;  4Y7N H;  1AZQ A;  3CF5 A;  3RZD B;  3K0Y A;  4O42 A;  1IW7 D;  2R93 H;  3CCR A;  3A54 A;  3PO2 H;  3GTJ B;  2B2W A;  2IHF A;  2DJG C;  1R9T B;  4LAA A;  3K5M A;  4J6H A;  1HZC A;  5IE8 A;  3K8A A;  4QL5 A;  3DMU A;  3N6R A;  4JI2 Q;  4FF4 A;  1E2W A;  3S16 H;  1T5X D;  2E5L L;  1DXM A;  1HZ9 A;  2PZU A;  1JE4 A;  4GKK L;  3S15 B;  4LFA Q;  4L5Q A;  1EWH A;  2JEA I;  3NPP A;  1SND A;  5C44 B;  4XQQ A;  3QOJ A;  5FJ8 G;  3K0X A;  4XDX A;  1XYI A;  1FVI A;  3MZ5 A;  2CWP A;  1Q81 C;  3NEM A;  5I2Y A;  5IGD A;  2JA6 B;  4C56 C;  3K5O A;  3OYY A;  2Q8R E;  1G6Z A;  1LYL A;  5AJ3 Q;  5LMU L;  3VYU A;  4ALP A;  1A2T A;  4LF4 L;  2LSS A;  3GTG B;  2R7Z H;  3BYT B;  4KD4 A;  4HN7 A;  2E74 C;  2ASB A;  4QIW B;  3CAM A;  3W3A A;  4DR6 L;  3TSS A;  1TII D;  5CR3 A;  2F0S A;  4C3J G;  5T1I A;  4XXE A;  2L55 A;  5JPN C;  4F8M A;  4ZCK A;  3P7J A;  1EFW A;  3QWN A;  5C3X A;  1HNW Q;  4LUZ A;  3G48 A;  2C9O A;  3GD7 A;  1YNJ D;  1EIH A;  1TS4 A;  5GRO A;  1K73 C;  2A8V A;  4DN4 M;  5C3E G;  2Z0S A;  1L1O A;  4F87 A;  2PYK A;  1CSP A;  1ZYR C;  2F0N A;  3HKZ G;  4MNO A;  1X3F A;  1VMP A;  5GAH C;  1QVG A;  3H0G B;  1X9N A;  1X3Q A;  4P73 A;  2RQX A;  2AKW B;  5JJK A;  5EKL A;  3LWU A;  2O5I C;  4A75 A;  1F77 A;  1GVP A;  1J5E Q;  3S1Q B;  1TU2 B;  4DV7 L;  3M7N A;  1KQS A;  1I4X A;  2F3V A;  3R2I A;  2B2U C;  3MEH A;  1EY4 A;  1P8L A;  2YTV A;  4YY3 Q;  4V0B A;  4POG A;  1M90 C;  1KL9 A;  2WII B;  3H3V C;  2CQO A;  4E6I A;  4GKJ Q;  1N36 Q;  1U4P A;  2PPB C;  2MP1 A;  1KRS A;  4X3U A;  1C7Y A;  4L63 B;  4PZ6 A;  1EZ6 A;  3UDI A;  3U58 A;  1GO3 E;  1CKN B;  1HNZ Q;  2R7D A;  5T1G A;  4R1J A;  1EOV A;  1QIL A;  3I4M B;  3E9I A;  1YNN D;  2F4I A;  1RL2 A;  1KC8 C;  1JE5 A;  2XSC A;  4H02 A;  3TDQ A;  4JI5 L;  3NSW A;  2F3I A;  2RCN A;  1A15 A;  5LL6 S;  1KNE A;  4MHE A;  3PIO 3;  3GTM B;  2M9V A;  2IL8 A;  4HR7 B;  3VR4 A;  2JQO A;  1GD7 A;  2WAC A;  1JOO A;  5IIF A;  1VQP A;  3J7A F;  3F8T A;  4HMI A;  1MGS A;  4DAM A;  2K52 A;  5ELO A;  1Q46 A;  1SAP A;  4BY1 G;  5G3L D;  2UUC Q;  1BCP D;  3FRP B;  2XGT A;  4DR1 Q;  1PFS A;  4C3H H;  4PMC A;  1N33 L;  3ERO A;  1PMR A;  3KYH C;  2AQ2 B;  4NP5 A;  3S1R B;  3HOU G;  1NAP A;  1CHP D;  1DCZ A;  3CQZ B;  4A3E B;  1ESR A;  2Z4H A;  4A3B B;  4BBS G;  4DUY Q;  4LF7 L;  4IOC A;  2KHJ A;  3J81 E;  1SJE D;  2UXC Q;  3BVZ A;  4BS9 A;  2KUM A;  4LFC L;  2X6L A;  1XNQ Q;  1MD2 D;  3URY A;  4DV1 Q;  2A69 D;  1I50 B;  2H5X A;  2HCC A;  4YWM A;  3H15 A;  4LF9 L;  4CKE A;  3T1Y Q;  2WAQ E;  4H13 C;  4DV6 Q;  2F0G A;  5IP9 G;  1AH9 A;  1LTR D;  2CW0 D;  2Z6K C;  1H95 A;  5K5P A;  1Y1W B;  1UNS A;  2FMC A;  5DM6 3;  4IFD I;  2IX1 A;  2DY7 A;  1D8L A;  3GTK H;  5EBC A;  3M7G A;  3KF6 A;  5IYD H;  4K6D A;  2F0D A;  4DR4 L;  1JOR A;  1JIC A;  2L5T A;  3F2D A;  2RHQ B;  2PMZ E;  3J80 c;  2VW9 A;  2F0E A;  4R9W A;  5C0X I;  4KJN A;  1ONL A;  1RKN A;  4AIM A;  2VL6 A;  4PZ7 A;  2EZV A;  1JWM D;  1KAA A;  4LFB Q;  4BBR B;  4DU9 A;  2I5M X;  5E4W C;  4DV5 Q;  1VQ7 A;  4DAV A;  3IL8 A;  2A68 D;  2NN6 H;  3A7A B;  4F7X A;  4DV0 Q;  4X64 Q;  3H09 A;  3GTO H;  2OTJ A;  2Z6B A;  4JBJ A;  4IPH A;  4M1U B;  1LV9 A;  5J22 A;  1N8R C;  4JOI A;  4JI2 L;  1NTG A;  2J0T D;  3E6Z X;  5KNC A;  3FPP A;  4KHZ A;  1BBU A;  3JAM L;  5I4D A;  3C3L A;  3NTI A;  1H9J A;  5BR8 Q;  5JVG 3;  5JOB A;  3D4D A;  2QEX A;  2K4K A;  1XMQ Q;  4AYB E;  2VUM H;  4DPG A;  1NY4 A;  4A3B G;  2K5D A;  5IOD A;  3KJO A;  1H9K A;  4RWS C;  1PH8 A;  1E2Z A;  5IGG A;  3H6M A;  3FEW X;  3PIP A;  1UUP A;  3DWQ A;  1F2Y A;  1LM0 A;  1FJG L;  2E8G A;  2E2H H;  1CFM A;  2YYZ A;  1PTO D;  3RD4 A;  2I46 A;  1ICW A;  5JVH 3;  2RSO A;  2RDF A;  2NVY B;  3G4S A;  5AJ3 L;  4X3T A;  1IYJ B;  2AQ1 B;  1F9R A;  2ZJR A;  1CSQ A;  2EVB A;  1S5D D;  4DV4 L;  3GTP B;  3HZX A;  3CKI B;  1VQ6 A;  1LUZ A;  3BZC A;  3DHQ A;  3MFG A;  4DR5 L;  2K75 A;  1QCB D;  2B2V A;  2Y0S E;  2XIW A;  1LTT D;  1HNX Q;  4L6T B;  1HNW L;  5ELC A;  4A3I G;  1SNP A;  2QW7 A;  4JI0 Q;  3S2D H;  5CV5 A;  5LMN Q;  4IUV A;  4KHV A;  1CA6 A;  2F0Q A;  1AFP A;  4ULL A;  2AUJ D;  2O5J C;  4RH6 A;  3EBE A;  1X54 A;  1G91 A;  4ODG A;  1JJG A;  4QB4 A;  1R4Q B;  3MVV A;  3M4O B;  5IYB G;  5CV7 A;  2UXB Q;  3NP8 A;  2RSN A;  1IXR A;  3A8K E;  1A62 A;  1J5E L;  3S14 B;  3VR2 A;  3LNN A;  4IFD G;  3CU7 A;  1SRU A;  2R92 B;  1D7Q A;  3KLS A;  1FGB D;  1GXD C;  2K04 A;  2CHB D;  1PH1 A;  2UUB L;  4ME3 A;  2K50 A;  5M3M G;  4A3G B;  2EE1 A;  5DM7 3;  4YY3 L;  3OTO Q;  3KK7 A;  1PRT B;  4IPG A;  4Q0F A;  4A3L G;  5ELB A;  4EQP A;  4GKJ L;  1HZB A;  4I7Z C;  1N36 L;  1VQC A;  3J81 i;  3VR5 A;  1C0A A;  4OXP A;  4GS3 A;  5E7N A;  3D0F A;  1EWC A;  5D3D A;  4OO1 I;  3CMA A;  1M8A A;  1ZKO A;  2JA5 G;  2CWA A;  1HNZ L;  1STN A;  3I73 A;  1SMY C;  2RVL A;  3GTQ B;  2PI2 A;  2GVA A;  1ZEQ X;  4IJH A;  5CMD A;  1JB3 A;  5COR A;  2EYM A;  1LT3 D;  5KNB A;  1T9H A;  4HED A;  5IYC G;  1HFN A;  3RLN A;  2ES2 A;  3HOZ H;  2F0P A;  1L0X B;  3E3X A;  2F03 A;  3MAQ A;  1N34 Q;  4G4K A;  5G3L F;  1BCP F;  3BDC A;  3CRL C;  3CW2 C;  1CKO A;  3M4Y A;  3HOX B;  1JB7 A;  1B9M A;  4XTC S;  3BVG A;  4UP9 A;  2UUC L;  3B6Y A;  4IPD A;  1XPO A;  4DR1 L;  1E7Z A;  1PVO A;  1ZYR D;  4RKL A;  1N32 L;  4NMZ A;  1DGS A;  4J1M A;  2VQF Q;  3G71 A;  3PUY A;  1PYS B;  1EU3 A;  3WOE A;  1HZA A;  2OTL A;  4DK3 C;  1EUJ A;  4R8N A;  3UE0 A;  4N9T A;  4A3M B;  4DUY L;  1GKH A;  1WYD A;  2K5V A;  5ELN A;  2NWG A;  4KN4 C;  3T1H Q;  2UXC L;  1XNQ L;  4UDU C;  4DV1 L;  4EQO A;  4RCN A;  4G7O C;  1TS5 A;  3T1Y L;  4DV6 L;  3QJY A;  3DM3 A;  3K80 C;  2HT1 A;  3QO2 A;  3OWE B;  3MFY A;  4HJA A;  1YZ6 A;  1I4P A;  1DYQ A;  4KK7 A;  4OIJ A;  1GUT A;  5HGQ A;  3T56 B;  3S9W A;  2B2U A;  1WJJ A;  1PH3 A;  1SE3 A;  2FFK B;  1S5B D;  1M1K C;  2JA7 G;  1Y8P B;  4HIK A;  1EOT A;  2A6H C;  4JBW A;  1BCP C;  2G9D A;  2L9H A;  4A3K G;  4ZLT F;  2FHT A;  1SE2 A;  2MPM A;  4FNF A;  3BVM A;  4YIJ A;  5L37 A;  4DV3 Q;  2CH4 W;  3NWT A;  5KEE A;  4HAE A;  4DV5 L;  2WKD A;  4B08 A;  4A3C H;  1HR0 Q;  1EY8 A;  1K83 B;  4DV0 L;  4HCS A;  4X64 L;  4ZKC B;  3Q0A A;  1X56 A;  5CV9 A;  1YHA A;  1KRT A;  5M3F B;  2NVX H;  4AQY Q;  1JJ2 A;  3ITP A;  1WCM B;  3T13 A;  5BR8 L;  1E2V A;  1HFG A;  2RBM A;  3HOW H;  1KDC A;  2ZJQ A;  1TY0 A;  1QVF A;  2A69 C;  1R4P B;  1D1K A;  1XMQ L;  1NR2 A;  2AHO B;  1KAB A;  2N49 A;  2OT2 A;  1G2T A;  3SK5 A;  1PTO F;  1XTD A;  4MIU A;  2NVQ H;  2KEN A;  3LX0 A;  3NUC A;  4A3M G;  2KQ3 A;  3H3V I;  3K58 A;  1OXV A;  2ZT9 C;  4A93 H;  1F9Q A;  1SNC A;  4A3F H;  1G2S A;  2B63 B;  1TWG H;  1C48 A;  2I5L X;  4ID6 A;  3VR3 A;  3WOF A;  1YJ9 A;  1F9P A;  1FNU A;  3TBI B;  3W5O A;  2FXQ A;  1XNR Q;  2H1E A;  4NPS A;  5IT9 c;  4C3I B;  4BWG B;  4Y52 H;  1Q7Y C;  4J8Q A;  4Z9C B;  5C4X H;  2D0O A;  3GTL B;  4IOA A;  4ZRZ A;  3ERS X;  5KIX A;  5H1S E;  2L11 A;  5KYI A;  3PF5 A;  1HNX L;  1LAB A;  3EVQ A;  1LTA D;  4IPC A;  4JBK A;  4B3M Q;  4V19 0;  3BZD B;  1PDQ A;  1PH9 A;  3TRZ A;  5CV6 A;  2NYZ D;  5LMN L;  1QOH A;  5M5W H;  1A2U A;  3PMF A;  5JEA G;  1JR0 D;  3Q23 A;  4RGO S;  3EA6 A;  3EFX D;  4KHP Q;  2YTY A;  3K59 A;  2F0O A;  1L2F A;  1TWF H;  5C5L A;  1RJT A;  2UXB L;  1HQM C;  2FJ2 A;  1HTP A;  3G7L A;  3RZD H;  5JJL A;  1G6P A;  3KLW A;  3FMC A;  4JBM A;  3R93 A;  5M3F G;  3GTJ H;  1S40 A;  3J7Z C;  3OTO L;  1R9T H;  5EAY A;  2EYP A;  4KLK A;  1EQQ A;  4FYD A;  3N52 A;  2BDO A;  1ICF B;  4FF3 A;  5EPL A;  4TKO B;  2O2L D;  3S15 H;  1MHW C;  1B3A A;  1GUO A;  5HUR A;  4C3J B;  2VS1 A;  1STA A;  4FXD A;  4G7H C;  3GV6 A;  4A3J G;  4DFA A;  2EYL A;  1MI2 A;  5C44 H;  1S5E D;  4KY5 A;  3PUZ A;  4PQX A;  1K28 A;  1K0R A;  4AH6 A;  1G29 1;  2D5D A; 
#chains in the Genus database with same CATH homology
 2WIN B;  1LTS D;  3HKZ B;  1MSG A;  4DF7 A;  2XRS D;  4CHT B;  2SDF A;  2YU9 B;  1CZG A;  3R8B A;  1A3V A;  1B50 A;  3D6W A;  2PNR C;  2HCI A;  3TME A;  2EY1 A;  3I72 A;  1WD1 A;  1PXU A;  2ZXO A;  1QNU A;  2LS0 1;  1RTN A;  1I6H B;  3IKJ A;  2SEB D;  1CT1 D;  2K03 A;  1WTP A;  1FR3 A;  1F2M A;  3S1N B;  1I4G A;  1QWY A;  3DEP A;  2PQE A;  1VDZ A;  2F0T A;  1V8Q A;  2Z4I A;  4KTA A;  3S1M B;  5KGU A;  3PO3 B;  1SNO A;  1DD2 A;  1V1P B;  3D8G A;  4TSS A;  1I6V C;  3OMC A;  2KCN A;  5DEH A;  1SMY D;  3BS1 A;  1AN8 A;  5C0X J;  4K2K A;  1A6X A;  3MC0 B;  2Q8I B;  4BY1 B;  4Y7N B;  1D2B A;  3SE0 A;  4IUN A;  5HGT A;  2KHS A;  5EPK A;  3HOU B;  1RHP A;  1KDB A;  1XXG A;  3X3N A;  4CJ0 B;  2E2D C;  3V2T A;  4K5V A;  1HA6 A;  1U4L A;  1WTQ A;  4BBS B;  3S16 B;  2QDB A;  5LHY 1;  1HXY D;  3Q6S A;  3I4L A;  4RGN A;  5M5X B;  1O7Y A;  1Q1B A;  1FYC A;  3VYT A;  1F2L A;  4ZQ3 A;  1D6E C;  2F0H A;  2Q8T A;  5I9P A;  1CQV A;  3HP3 A;  1CHQ D;  2Y0S B;  1XTC D;  4UAI A;  2LY7 A;  3NXW A;  2ENB A;  3A8I E;  2EDG A;  3HRZ C;  1DZ1 A;  4QCL A;  5COY A;  3VA5 A;  1I3Q B;  2KVM A;  4XYO A;  3A7L A;  5BN3 A;  1PZJ D;  1EZ8 A;  1TR5 A;  1Z47 A;  1HTL D;  2LFN A;  3VR6 A;  2EYJ A;  2A6H D;  2JEB I;  3C1F A;  1S5C D;  2MGS A;  2JSO A;  3OMG A;  2VXW A;  3G6J B;  3ND8 A;  2OXP A;  3NTK A;  1IKM A;  1DM0 B;  3PUW A;  4KKS A;  1O7L A;  3GV3 A;  2L4N A;  2X6G A;  2D2C C;  4ZK9 B;  2KCC A;  3DWP A;  3T53 B;  2WKC A;  4IAL A;  3OSO A;  5C0X H;  4IUU A;  3GQB A;  3RUZ A;  1STY A;  3O13 A;  4A3I B;  4CGY B;  1BO0 A;  1D1I A;  3PUX A;  3RMH A;  1ESF A;  4QUC A;  1Q8I A;  2JYO A;  3TZD A;  2X69 A;  1QG7 A;  5FO7 B;  3OW7 A;  5K36 H;  3SXH A;  4L8J A;  3S17 B;  1V43 A;  1EQV A;  3MXP A;  5M3M B;  2F0F A;  2NB0 A;  2Z8L A;  2B2Y A;  3MA2 B;  1BR9 A;  4P2C B;  3SHL A;  3NTH A;  2JA5 B;  1BCP B;  4HSP A;  3HEJ A;  3KF8 A;  3U9O A;  1QB5 D;  4K6L A;  4DA2 A;  2K28 A;  4EQN A;  1GUN A;  1EIG A;  3A8J E;  2NN6 I;  1QJO A;  1HPC A;  1TKW B;  4KD3 A;  3K5N A;  4DAP A;  2F1M A;  2K33 A;  1LLR D;  3VYS A;  3PIP 3;  1NCV A;  1AEX A;  3MXG A;  1SEB D;  2B2W C;  3OPO A;  4TQU S;  2NBF A;  1SYC A;  1EY9 A;  1PFM A;  4PNY A;  1XWE A;  3PV0 A;  4DNT B;  4RHS A;  1H9R A;  1TWH B;  4HMJ A;  5CBA E;  5M9O A;  1VMC A;  3CHB D;  1UEA B;  4C3H G;  5IT9 E;  2PZT A;  4OO1 H;  2VUM B;  3L7Z C;  3DM1 A;  1M4V A;  2EYO A;  5A2Q L;  4XT1 B;  5D65 A;  2XRQ D;  3L3O C;  3PUV A;  3OWF A;  2OF1 A;  1X32 A;  4OGQ C;  1NUC A;  4G57 A;  4KI0 A;  4FF2 A;  4RCO A;  1XX8 A;  2JA7 B;  2NZ1 D;  1U4R A;  4PMB A;  4A3K B;  1OXS C;  2IW3 A;  1SNM A;  5KYL A;  3M85 A;  1F9S A;  4FO2 A;  2IJ0 A;  3J80 L;  2J7Z A;  1KLG D;  4K2L A;  1PTO B;  4QUF A;  2K7V A;  4EVO A;  1EFI D;  4BA1 I;  3K7A B;  2NN6 G;  5ELD A;  1EL0 A;  3KUP A;  2CVR A;  5I2X A;  3OHX C;  4IUT A;  2ID0 A;  1I4R A;  3OIP A;  1ET6 A;  4ZAI A;  4RFB A;  3OIQ A;  3FDT A;  3A56 A;  2K05 A;  3AMU A;  1DJR D;  1QNK A;  3DUZ A;  5FO9 B;  3I8Z A;  1K8O A;  2PO4 A;  4ILW A;  4KN7 C;  3TZU A;  1GUS A;  1ROD A;  1S4Z A;  2DNC A;  1I4Q A;  1H9M A;  2IWH A;  2SOB A;  3ONA B;  4PV1 C;  1STH A;  1CM9 A;  2D9U A;  4K8J A;  1BOS A;  5KRU A;  2ICE C;  3DWA A;  5CGK A;  4BA2 I;  1STE A;  4DXF A;  3SK4 A;  4G7Z C;  3ERQ A;  2VB3 X;  2F3W A;  4F88 A;  1B4O A;  1PYW D;  2RDH A;  2WP8 J;  5C4Z A;  3NWS A;  1BDO A;  2PZW A;  4LK1 C;  1VF7 A;  2L1B A;  3R2T A;  1RF2 D;  5ELF A;  2PW5 A;  2AUK A;  2J4X A;  3KBX A;  1IYU A;  2H4O A;  1AW7 A;  4M8A A;  3SR1 A;  1IHZ A;  4A3J B;  3V05 A;  1KDA A;  4NDX A;  2XWB B;  4LJZ C;  1TS2 A;  2F0L A;  3EQL C;  3V96 A;  1EYD A;  1B53 A;  1BUV T;  3I90 A;  2I07 B;  3NBI A;  3ZYY X;  4EGV A;  2MHV A;  1CA5 A;  1RDP D;  2O4X A;  2PW7 A;  1EEF D;  5BN4 A;  1G8Z D;  1Z6H A;  3Q24 A;  1Q1E A;  3NQT A;  1TT2 A;  3MXN A;  1FD7 D;  1PRT C;  3SVM A;  1O80 A;  3FPU B;  1DOM A;  2G9H D;  3D6C A;  3KBG A;  3CRK C;  1NR4 A;  2F0K A;  3BDL A;  5C6A A;  3BG3 A;  5M5Y B;  1EQT A;  2NVQ B;  1J8I A;  5I9O A;  3AU7 A;  1ILQ A;  2VB2 X;  4HSV A;  4A93 B;  1HA5 A;  4A3F B;  2XVS A;  1TWG B;  4WOR A;  3FVQ A;  1AP0 A;  1V1P A;  3SK8 A;  1TWA B;  4RGM A;  2NVT B;  2B2V C;  4CBV A;  1IL8 A;  2KEE A;  1BXT A;  2RKS A;  2F0J A;  1F2Z A;  1W6J A;  5C4X B;  4A3D B;  1KTK A;  2R3Z A;  5FOB B;  3Q22 A;  2IX3 A;  3FKI B;  5A2Q E;  3QIA A;  5JPM C;  1EEI D;  3UI2 A;  1Y8O B;  2F0U A;  4FXK C;  1ENA A;  3I4N B;  1AZP A;  4H7B A;  1TWF B;  4IUP A;  2TSS A;  5EKK A;  4DK0 A;  1HQR D;  1BF4 A;  3C1E A;  4HTH A;  4TRD A;  5FK9 C;  2JA8 B;  2WAQ B;  1DON A;  3J80 E;  4CKB A;  5IGE A;  1FNW A;  4FF1 A;  4X3S A;  3NE5 B;  4Q5V A;  2MUY A;  4U67 3;  4IQZ A;  4IFD J;  1QE6 A;  1V1O A;  2C5C A;  2PMZ B;  1TY2 A;  1FNV A;  2E2J B;  2SNS A;  3D31 A;  5IT9 L;  2AQ3 B;  4OHJ A;  5FLX L;  1WTV A;  1WTW A;  2R61 A;  3BYY B;  4GZY C;  3TP6 A;  4KY7 A;  3M3Y B;  2EJF C;  2EY6 A;  2R93 B;  5C5M A;  1LT6 D;  3PO2 B;  2E76 C;  5DNF A;  4HCE A;  3TP8 A;  5EKI A;  3L9A X;  3HGB A;  1EYC A;  1B2T A;  2A5H A;  2JP1 A;  2K5W A;  1SYF A;  4AYB B;  2KA7 A;  2EOT A;  2EY2 A;  2DNE A;  3NBH A;  3K6O A;  1GJX A;  3AB9 A;  4KY6 A;  3RZO B;  4KV6 A;  1GOZ A;  1STG A;  1SNQ A;  4XYQ A;  3U9S A;  5I6W A;  4K14 A;  4CJ2 C;  2R7Z B;  3SK6 A;  2R6G A;  4H0L C;  1TQO A;  3D4R A;  2BA1 A;  5D3I B;  4OL7 A;  4C2M B;  3E0J A;  2QCP X;  3R3O A;  1CK1 A;  3E5S A;  4XIG S;  1GHJ A;  3K57 A;  4WRD A;  3GP7 A;  2A6E C;  3C46 A;  1PZK D;  2HDM A;  1L0Y B;  2B2T C;  1I4H A;  4XQN A;  2V4D A;  2BE5 C;  2DY8 A;  4K5X A;  2QF7 A;  3T16 A;  5CYU A;  5FKA C;  3MXU A;  1SJH D;  4FP5 D;  2EJM A;  2IPK D;  2KEC A;  4WFN 3;  2F0W A;  1CQF A;  2ICI A;  5I6Y A;  1RD9 D;  2BOS A;  2DN8 A;  5E1F A;  3A55 A;  4IFD H;  2M00 A;  2IT1 A;  2B39 A;  2KED A;  2EXZ A;  4X3K A;  1GUG A;  2EYH A;  1PZI D;  4NW2 A;  2OEO A;  5AFW A;  1HUN A;  2L12 A;  4ME5 A;  3GO5 A;  1T5E A;  3H91 A;  1WD0 A;  5C4H A;  4DXG A;  4XT3 B;  1HHV A;  1BNZ A;  4B9W A;  1VCI A;  1SFO B;  1SBB B;  1JOK A;  3QOL A;  4WJW A;  4DK1 A;  1TWC B;  5CBE E;  4RGT A;  2QIL A;  1SXT A;  3KLS X;  4B9X A;  4K8I A;  4C3H B;  2ZXP A;  2A74 C;  1LTG D;  1NSN S;  5D14 A;  1LT5 D;  1ILP A;  3KLR A;  2B8F A;  1SDF A;  2XN9 C;  1II3 A;  4N9P A;  2NTT A;  1Q3L A;  3TP7 A;  1PRT D;  1SYB A;  1SE4 A;  5BN5 A;  1CTM A;  4KJO A;  5ELE A;  5JEA J;  1B44 D;  4C1N K;  5J1Z A;  5JJZ A;  3IFT A;  3I91 A;  2KOL A;  2EPB A;  3HOV B;  1VF5 C;  2K1B A;  5CV4 A;  2K32 A;  2WB1 B;  5EGT A;  1D5Z C;  1STB A;  3GTK B;  3RLF A;  4IUQ A;  3IFD A;  3LWE A;  2BCO A;  5IGC A;  3I70 A;  3J7Y W;  1D5X C;  1JOQ A;  4OIK A;  2NTS A;  3X3M A;  2MJ8 A;  4R8I A;  5E4X A;  1EY0 A;  3TN2 A;  1B9N A;  3GTO B;  3HS0 C;  3F2U A;  1HRJ A;  5JAV A;  1IW7 C;  5IOC A;  2JXM B;  1PTO H;  1O78 A;  1U9R A;  5FLX E;  1PFN A;  2AWO A;  4BY7 B;  1WVL A;  3MHB A;  4KKT A;  1DOL A;  1B1Z A;  1OXX K;  3SEB A;  1Y8N B;  3K5L A;  1ML0 D;  2E2H B;  2N88 A;  2QEJ C;  5A35 A;  2RA4 A;  1EY6 A;  3IAY A;  3H94 A;  2TMP A;  2N55 A;  1H9S A;  5C0X G;  5LL6 X;  2E2I B;  4C1N I;  4IUR A;  4IN3 A;  3BDO A;  4K5W A;  4KKU A;  4DNR B;  3S2D B;  3SDZ A;  1J9O A;  4JK1 C;  3DXJ C;  1IKL A;  3D3R A;  3P75 A;  3OOC A;  1EU4 A;  2F0M A;  1YNJ C;  4ZUJ A;  3P1H A;  1KLU D;  1RTO A;  5K36 G;  2FMM A;  4DGZ A;  1JCK B;  1EY7 A;  2EY5 A;  3DEO A;  3WDN A;  2AWN A;  2HUG A;  4DAY A;  1JWS D;  5JEA H;  1HCZ A;  4ZUI A;  2L0C A;  1IYV A;  2QKI C;  2JE6 I;  1LTI D;  3NK9 A;  1OO9 B;  2WV6 D;  5EPJ A;  3HOY B;  4QMG A;  2GA4 B;  1GHK A;  5E3F A;  3P20 A;  4XQJ A;  2IX0 A;  4CKC A;  1A3U A;  1DOK A;  2K01 A;  5IGF A;  1MSH A;  1Q12 A;  3HOZ B;  5NUC A;  1H9S B;  2VNU D;  1JQY D;  1UAP A;  1YNN C;  2M2L A;  2RDG A;  5F2D A;  3ND9 A;  1Z7T A;  1U4M A;  3W2D A;  1JWU D;  4FXG C;  2LMC B;  2XWJ B;  3T4A C;  4KMU C;  1O7Z A;  5DAU A;  2A6E D;  3S2H B;  1Q90 A;  4NKL A;  3J7A V;  1PRT F;  1LO5 D;  2BE5 D;  4LMQ D;  5ISR A;  2B8G A;  4RKB A;  1EY5 A;  1WTR A;  1Y1V B;  1ZXT A;  5IGB A;  1WTX A;  1E0B A;  4OO1 G;  2PCF B;  1GUW A;  2Z1C A;  4ZYS A;  5KND A;  2B2T A;  4ABN A;  2SNM A;  5C4J B;  4QF4 A;  5CV8 A;  3QG1 A;  3T51 B;  1PFB A;  1CZW A;  1LTB D;  2ZXR A;  3MWY W;  1HUM A;  1LAC A;  2LKV A;  4I65 A;  2CW0 C;  4IZ8 A;  1C4Q A;  2F0V A;  4RAU C;  2NUC A;  5FO8 B;  5CC4 A;  1SYD A;  1D5M C;  4O1N A;  5EQ0 A;  2CQA A;  4FVM A;  3HG9 A;  1OXT A;  1A3T A;  2A73 B;  1MBY A;  1BQQ T;  2KJX A;  2EYF A;  3TP5 A;  1CI3 M;  2K6A A;  4U68 A;  3QB3 A;  1TVX A;  3JAM E;  2B2Y C;  3J81 L;  5J39 A;  2FIN B;  4RA8 A;  1LT4 D;  2NVX B;  1JC7 A;  1W6K A;  2A68 C;  2HQE A;  1ENF A;  1WTO A;  2F0I A;  3HOW B;  1RCV D;  1OXU A;  2D62 A;  4CJ1 B;  2K5Q A;  1S5F D;  3I3C A;  1KNA A;  1K8M A;  2XNA C;  3C2P A;  4S3S A;  5EJW A;  3VA7 A;  2E75 C;  5C3W A;  3EJI A;  3VYR A;  2BDN A;  1SSO A;  4MN3 A;  1PTO C;  1SYG A;  2EJG C;  4H44 C;  1PLF A;  1TS3 A;  3D4W A;  3NHH A;  1X3P A;  2BA0 A;  5M5W B;  3MTS A;  1SYE A;  1ENC A;  4PMW A;  5EBD A;  3NQI A;  4RHR A;  5C3E B;  4C3I G;  1Y69 U;  1ET9 A;  1BBX C;  1C8C A;  4ZKB B;  5TSS A;  2HDL A;  1EYA A;  1AZQ A;  3RZD B;  3K0Y A;  4O42 A;  1IW7 D;  3A54 A;  3GTJ B;  2B2W A;  1R9T B;  4LAA A;  3K5M A;  4J6H A;  3DMU A;  3N6R A;  4FF4 A;  1E2W A;  1T5X D;  1DXM A;  2PZU A;  1JE4 A;  3S15 B;  1EWH A;  2JEA I;  3NPP A;  1SND A;  5C44 B;  4XQQ A;  3QOJ A;  4XDX A;  1XYI A;  3MZ5 A;  5IGD A;  5I2Y A;  2JA6 B;  4C56 C;  3K5O A;  2Q8R E;  1G6Z A;  3VYU A;  1A2T A;  3GTG B;  3BYT B;  4KD4 A;  4HN7 A;  2E74 C;  4QIW B;  3W3A A;  3TSS A;  1TII D;  5CR3 A;  2F0S A;  4C3J G;  5T1I A;  4XXE A;  2L55 A;  5JPN C;  4F8M A;  3P7J A;  3QWN A;  5C3X A;  2C9O A;  3GD7 A;  1YNJ D;  1EIH A;  1TS4 A;  4DN4 M;  4F87 A;  2PYK A;  1ZYR C;  2F0N A;  1VMP A;  3H0G B;  1X3Q A;  2RQX A;  5EKL A;  3LWU A;  2O5I C;  1F77 A;  3S1Q B;  1TU2 B;  3M7N A;  1I4X A;  2F3V A;  3R2I A;  2B2U C;  3MEH A;  1EY4 A;  4V0B A;  2WII B;  3H3V C;  4E6I A;  1U4P A;  2PPB C;  2MP1 A;  4X3U A;  4L63 B;  1EZ6 A;  5T1G A;  3I4M B;  1QIL A;  1YNN D;  2F4I A;  2XSC A;  3TDQ A;  3NSW A;  1A15 A;  5LL6 S;  1KNE A;  4MHE A;  3PIO 3;  3GTM B;  2M9V A;  2IL8 A;  4HR7 B;  3VR4 A;  2WAC A;  1JOO A;  5IIF A;  3J7A F;  4HMI A;  1MGS A;  1SAP A;  5G3L D;  1BCP D;  3FRP B;  4PMC A;  3ERO A;  1PMR A;  2AQ2 B;  4NP5 A;  3S1R B;  1NAP A;  1CHP D;  1DCZ A;  3CQZ B;  4A3E B;  1ESR A;  2Z4H A;  4A3B B;  3J81 E;  1SJE D;  3BVZ A;  4BS9 A;  2KUM A;  2X6L A;  1MD2 D;  3URY A;  2A69 D;  1I50 B;  2HCC A;  4CKE A;  4H13 C;  2F0G A;  1LTR D;  2CW0 D;  5K5P A;  1Y1W B;  1UNS A;  2FMC A;  5DM6 3;  4IFD I;  2IX1 A;  2DY7 A;  5EBC A;  3M7G A;  4K6D A;  2F0D A;  1JOR A;  1JIC A;  2L5T A;  2F0E A;  4R9W A;  5C0X I;  4KJN A;  1ONL A;  1RKN A;  2EZV A;  1JWM D;  1KAA A;  4BBR B;  4DU9 A;  5E4W C;  4DAV A;  3IL8 A;  2A68 D;  2NN6 H;  3A7A B;  4F7X A;  3H09 A;  4M1U B;  1LV9 A;  5J22 A;  2J0T D;  3E6Z X;  5KNC A;  3FPP A;  4KHZ A;  3JAM L;  5I4D A;  3C3L A;  3NTI A;  1H9J A;  5JVG 3;  5JOB A;  3D4D A;  2K5D A;  5IOD A;  1H9K A;  4RWS C;  1E2Z A;  5IGG A;  3H6M A;  3FEW X;  1UUP A;  3DWQ A;  1F2Y A;  1CFM A;  2YYZ A;  1PTO D;  3RD4 A;  2I46 A;  1ICW A;  5JVH 3;  2RSO A;  2RDF A;  2NVY B;  4X3T A;  2AQ1 B;  1F9R A;  2EVB A;  1S5D D;  3GTP B;  3HZX A;  3CKI B;  3DHQ A;  3MFG A;  1QCB D;  2B2V A;  2XIW A;  1LTT D;  4L6T B;  5ELC A;  1SNP A;  5CV5 A;  4IUV A;  4KHV A;  1CA6 A;  2F0Q A;  1AFP A;  4ULL A;  2AUJ D;  2O5J C;  4RH6 A;  1G91 A;  4ODG A;  4QB4 A;  1R4Q B;  3MVV A;  3M4O B;  5CV7 A;  3NP8 A;  2RSN A;  3A8K E;  3S14 B;  3VR2 A;  3LNN A;  4IFD G;  3CU7 A;  2R92 B;  3KLS A;  1FGB D;  1GXD C;  2K04 A;  2CHB D;  4A3G B;  2EE1 A;  5DM7 3;  3KK7 A;  1PRT B;  4Q0F A;  5ELB A;  4EQP A;  4I7Z C;  3VR5 A;  1EWC A;  5D3D A;  4OO1 I;  1M8A A;  1ZKO A;  1STN A;  3I73 A;  1SMY C;  2RVL A;  3GTQ B;  1ZEQ X;  5CMD A;  1JB3 A;  5COR A;  2EYM A;  1LT3 D;  5KNB A;  4HED A;  1HFN A;  2F0P A;  1L0X B;  2F03 A;  3MAQ A;  4G4K A;  5G3L F;  1BCP F;  3BDC A;  3CRL C;  3M4Y A;  3HOX B;  1B9M A;  4XTC S;  3BVG A;  1ZYR D;  4RKL A;  4NMZ A;  4J1M A;  3PUY A;  1EU3 A;  3WOE A;  4R8N A;  4N9T A;  4A3M B;  2NWG A;  4KN4 C;  4UDU C;  4EQO A;  4RCN A;  4G7O C;  1TS5 A;  3QJY A;  3QO2 A;  3OWE B;  3MFY A;  1I4P A;  1DYQ A;  4KK7 A;  4OIJ A;  1GUT A;  3T56 B;  3S9W A;  2B2U A;  1SE3 A;  2FFK B;  1S5B D;  1Y8P B;  1EOT A;  2A6H C;  4JBW A;  1BCP C;  2G9D A;  2L9H A;  4ZLT F;  2FHT A;  1SE2 A;  2MPM A;  4FNF A;  3BVM A;  4YIJ A;  3NWT A;  5KEE A;  4HAE A;  2WKD A;  4B08 A;  1EY8 A;  1K83 B;  4HCS A;  4ZKC B;  3Q0A A;  5CV9 A;  5M3F B;  3ITP A;  1WCM B;  3T13 A;  1E2V A;  1HFG A;  2RBM A;  1KDC A;  1TY0 A;  2A69 C;  1R4P B;  1D1K A;  1NR2 A;  1KAB A;  2OT2 A;  1G2T A;  3SK5 A;  1PTO F;  4MIU A;  3LX0 A;  3NUC A;  2KQ3 A;  3K58 A;  1OXV A;  2ZT9 C;  1F9Q A;  1SNC A;  1G2S A;  2B63 B;  1C48 A;  4ID6 A;  3VR3 A;  3WOF A;  1F9P A;  1FNU A;  3TBI B;  2H1E A;  4C3I B;  4BWG B;  4J8Q A;  4Z9C B;  3GTL B;  4ZRZ A;  5KIX A;  2L11 A;  5KYI A;  1LAB A;  3EVQ A;  1LTA D;  4V19 0;  3BZD B;  1PDQ A;  5CV6 A;  2NYZ D;  1QOH A;  1A2U A;  3PMF A;  5JEA G;  1JR0 D;  3Q23 A;  4RGO S;  3EA6 A;  3EFX D;  3K59 A;  2F0O A;  5C5L A;  1RJT A;  1HQM C;  2FJ2 A;  1HTP A;  3G7L A;  3FMC A;  3R93 A;  2EYP A;  4FYD A;  3N52 A;  2BDO A;  4FF3 A;  5EPL A;  4TKO B;  2O2L D;  1B3A A;  1GUO A;  5HUR A;  4C3J B;  1STA A;  4FXD A;  4G7H C;  3GV6 A;  4DFA A;  2EYL A;  1MI2 A;  1S5E D;  4KY5 A;  3PUZ A;  4PQX A;  1G29 1;  2D5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...