1U4LA

Human rantes complexed to heparin-derived disaccharide i-s
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Attractant
molecule keywords Small inducible cytokine A5
publication title The X-ray structure of RANTES: heparin-derived disaccharides allows the rational design of chemokine inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1u4lA00
4R9WA 2B2TA 2L12A 1ILQA 1F2LA 4RA8A 4IUVA 1PFMA 1HRJA 4HSVA 4OIKA 5D14A 1KNAA 2XIWA 1S4ZA 5JJZA 3TN2A 5EPLA 3FPUB 3I91A 1M8AA 2K04A 4XT3B 3UI2A 1WTPA 2FINB 1EOTA 2FFKB 1ML0D 1LV9A 2KVMA 2SDFA 4NW2A 1SSOA 2KEEA 1J8IA 2HDLA 2N88A 4O42A 1WTQA 1PLFA 5EQ0A 1B2TA 2H1EA 1VMPA 2EOTA 2KECA 2CVRA 3G7LA 2HCIA 1WTWA 1F9QA 2MGSA 2L1BA 2B2VA 1WVLA 2DY7A 1NR2A 1VMCA 3F2UA 1HA6A 1B53A 1QNKA 3I90A 4UAIA 2RA4A 1EIHA 1J9OA 1CM9A 3D6WA 1WTOA 1O7ZA 2X6GA 1SDFA 1RODA 1ZXTA 2B2WA 3P7JA 1JE4A 5E4WC 2B2TC 1A15A 1HUNA 1X3QA 4HCSA 1CA6A 2NWGA 3I3CA 1DONA 1G2SA 4X3UA 1IKLA 1X32A 1X3PA 4IUUA 4X3TA 1U4RA 1O80A 2K03A 1CA5A 1HUMA 1MSHA 3Q6SA 2KUMA 4CJ2C 1E0BA 3DEOA 1EIGA 1WTVA 2K05A 2M2LA 1U4PA 1RTNA 1U4LA 1XYIA 1U4MA 1G6ZA 1F9PA 1O7YA 2B2YC 1PFNA 2FHTA 4OIJA 4RWSC 5CBEE 1SAPA 1WD1A 2IL8A 1B3AA 1G91A 2B2VC 2HUGA 1MI2A 3GV6A 1G2TA 2MP1A 5CORA 1QE6A 5CBAE 4MHEA 3ONAB 1BO0A 1WTRA 1B4OA 1DZ1A 2J7ZA 2FJ2A 1JICA 4DN4M 5EPJA 1ILPA 1NR4A 1MSGA 2EE1A 2N55A 1DOMA 2Q8RE 2RSNA 3DM1A 5CMDA 4R8IA 1AZQA 2B2UA 1DOKA 1HFGA 2KOLA 4IURA 1WD0A 1HHVA 1B50A 1F9SA 2X69A 4LMQD 1BF4A 2KEDA 1PFBA 3MTSA 4XDXA 4ZK9B 1ESRA 3TZDA 2MPMA 1AP0A 4QUFA 1PDQA 3N52A 3I8ZA 1F9RA 2L4NA 4MN3A 2FMMA 1QG7A 5COYA 2HDMA 4HEDA 4ZLTF 4ZAIA 3H91A 4CJ1B 1RHPA 2D9UA 4ZKBB 2EPBA 1KNEA 1AZPA 2RVLA 4QUCA 4RAUC 1ICWA 1MGSA 2K1BA 4X3SA 1HFNA 1DOLA 3MWYW 1NCVA 5D65A 3HP3A 1EL0A 2L9HA 5E4XA 5EJWA 2K28A 4IUTA 4ZKCB 2MJ8A 3IL8A 2R3ZA 1C8CA 2B2WC 2JP1A 4U68A 3KUPA 2NZ1D 1XX8A 2Q8TA 4XT1B 3FDTA 3GV3A 1IL8A 2X6LA 3LWEA 4X3KA 1BNZA 1NAPA 2B2UC 1WTXA 2DY8A 2B2YA 5EKIA 5EPKA 3SVMA 4HAEA 2JYOA 4IUQA 1RJTA 5T1GA 1BBXC 5T1IA 1GUWA 5AFWA 2BDNA 1IKMA 2VXWA 2HCCA 3QO2A 4IUPA 3DEPA 4CJ0B 2L11A 2NYZD 5DNFA 1Q3LA 3KBXA 2K01A 1RTOA 1EQTA 1TVXA 3IFDA 3R93A 2RSOA
chains in the Genus database with same CATH superfamily
1VQIA 4IUVA 5IP7H 2PCFB 2MUYA 1SFOH 3FRPB 4BBSB 3S1MB 1WTPA 2SDFA 4OO1H 2HDLA 5CYUA 4MTNA 1PH5A 4A3BG 1V1PB 1VQEA 3CAMA 4BBRG 5K36G 3FPPA 4Q5VA 4H13C 1DXMA 1BUVT 1VQ8A 4IFDH 3G6JB 4OGQC 4ZUIA 3M3YB 5M3FB 3J80E 1CK1A 2X6GA 1K3RA 4A3CG 1TR5A 1HUNA 4NP5A 2ZT9C 3VR4A 4OL7A 4QJFA 4LF9L 5M5WH 2JA8H 2KENA 3GTGH 2L5TA 1SYEA 2R92B 2JEBI 1U4RA 2MNAA 1M4VA 5TSSA 1U4LA 1NMFA 2Q2UA 4IPGA 4JI2Q 4NMZA 2E8GA 2OTJA 1Q12A 4X6AH 1HNZL 4AYBE 1D2BA 1C0AA 4QB4A 1TWFB 4B3ML 4BY7B 5C6AA 2CW0D 2RKSA 3J7ZC 1A8VA 4A3EG 4KJNA 2ID0A 4E6IA 3JAMc 2IT1A 2MO0A 2J0TD 1QJOA 3TZDA 3CCLA 3CD6A 3N52A 1AW7A 4A3JB 1HPCA 4MN3A 3MC0B 4R4IA 4X62Q 2HDMA 3QR8A 1OXVA 4LF4L 1DD2A 5FLMH 3AMUA 2RVLA 4DR4L 1HNZQ 4A3GB 2OT2A 1MGSA 2K1BA 2XVSA 1NCVA 4Y7NH 4B3MQ 1XTCD 2Q2IA 5KGUA 1CSPA 1NUCA 2B2WC 3EA6A 4JYAQ 5FO8B 3E5SA 3OTOL 5AJ3Q 1Y1WG 2OQ0A 4C1NK 2E5LL 2JA7B 1MBYA 1U5KA 2Z6KA 4X65L 4HJ5A 3ZYYX 5T1GA 4ME5A 2NN6I 3GTLB 4K5WA 1D8LA 2VXWA 3E9HA 4IPHA 3UE1A 2NYZD 3S9WA 5LMUQ 4LFAQ 4FYDA 2CH4A 5LMNW 2G9HD 3MVVA 4LF4Q 3I4LA 3GTKH 4JCVE 5M5YH 3ULPA 1XPRA 2QILA 5JPMC 3S14B 3FPUB 1Q86C 1EY7A 2VNUD 3FKIH 3WOFA 2B63B 1YNJC 4A3KB 4CHTB 3CRLC 4IO9A 2F0HA 2CVRA 2F0SA 1VQ4A 4X65Q 4A3DG 1F9QA 2KHSA 2WKCA 3K5LA 4HR7B 1K8GA 4IFDI 1YHQA 4P75A 5IGDA 2OQKA 3ULJA 1STEA 1EIHA 2UXDL 5M5XH 2UUAL 1NBWA 2G9DA 2KCMA 4J15A 4JI6L 5IP9H 5G3LF 2CWAA 5C44B 4DV1L 1NTGA 5FOBB 1K9MC 4FF4A 3F1ZA 1A3TA 1YHAA 3PUXA 2UXCQ 4RCOA 4H7BA 4HIMA 4L5RC 4H02A 1G91A 5KIXA 1G2TA 2EIFA 3R2TA 4DUYQ 4FF3A 1LABA 2I07B 3H09A 2FJ2A 4CKCA 1VQAA 2UUAQ 2F0NA 1N36L 1WD0A 1HFGA 2KOLA 4IPDA 4Q0FA 2NVTB 1CQFA 2D2CC 1B50A 1B44D 2K5NA 4QQBX 2LMCB 4A3BB 2WAQE 2L4NA 1T5XD 5C3XA 4DF7A 4BBRB 1Q81C 3A8IE 1TWGB 3DXJC 1KLUD 5GAHC 1KTKA 1Q82C 4PNYA 3CC4A 2QDLA 2EDGA 1A3UA 3HOZG 1L2FA 4C3HH 3M7GA 5IYBG 2QDBA 1N36Q 4XYQA 1UEBA 4GKKQ 2DN8A 3EFXD 1V1PA 2B2YA 1EWCA 1BR9A 1EEID 1ENFA 3JAME 3SXHA 1NY4A 3QO2A 4CGYB 3L9AX 1N32Q 2F0UA 4IALA 3AQQA 1EQTA 3HOVG 4A3LH 3AFQA 4HSVA 3K80C 4A93H 2VB2X 1FVIA 1PH7A 4M8AA 2KEEA 4A3EB 2VQEL 4EQNA 4DV5L 1YJWA 3EVQA 1ENCA 5A35A 2K52A 4KY5A 3X3NA 4F7XA 5HGTA 1XNQQ 1HZBA 1HA6A 1R9TB 4BY1G 2NN6G 1EFID 1W6KA 2IX3A 1UE6A 1UE1A 2NWGA 4LF5L 1J6QA 1VQOA 1Z7TA 3I4MB 1X3PA 4JG2A 5C3WA 3B6YA 2F3IA 4Z9CB 5IP7G 3MA2B 5KYIA 2VQEQ 4XYOA 1YNNC 1PZJD 3FHWA 5M3MB 4DNRB 1K0SA 3ITPA 1VQNA 1PTOH 1I3QH 2HUGA 4RGNA 3WOEA 1YVCA 1QWYA 5CBAE 5C0XH 4DR5Q 5I9PA 4ID6A 2PO4A 1ZEQX 2EVBA 4DN4M 3FEWX 2YU9H 1G51A 4IJLA 4IFDG 2JA5H 1B70B 1LTAD 2EYJA 2P5ZX 1TS5A 1AZQA 2C9OA 3G48A 3LNNA 4DV3Q 3D8GA 2N49A 1BF4A 1AH9A 2JA8G 3PIOA 1VQFA 4GZYC 1SE2A 2JQOA 3CHBD 4RH6A 5J22A 3C3LA 2Q2TA 2K32A 4WRDA 3STBC 1VQKA 1FNWA 1OXSC 5E1FA 2IHFA 4IUTA 4A75A 2R3ZA 4HN7A 3BZKA 1YNJD 2ZJRA 2AMCB 2R7ZH 1BQQT 4X66L 3M85A 3K0YA 1IL8A 2X6LA 3Q23A 1CKMA 1EYGA 1EY4A 1VQCA 3J80L 1CZGA 2E75C 2NVXB 1S5CD 2QW7A 2PPBC 3S17H 1LUZA 1SBBB 3CF5A 3PIO3 5IYDH 3RLFA 1IW7C 2PMZB 3U4ZA 4G7HC 3K5MA 4XXEA 1Y8OB 4JI5L 1CZWA 4DR6Q 3T13A 2R7DA 1DCZA 3IAYA 5FK9C 1LV9A 1X55A 2PNRC 4DR3Q 4O1NA 4ILWA 3RLOA 2EOTA 2F0OA 2GVBA 2L15A 3OW7A 4LW1A 2A69C 2RDGA 1GJXA 1JE5A 5EKLA 1STAA 4RKBA 4K2LA 1TY2A 4LUZA 1K8MA 1LT6D 4YWMA 1A15A 1JB3A 1PH2A 3I55A 1G2SA 5ELEA 3S1RB 5FKAC 3J7A5 1D1IA 1WI5A 4YCUA 3HOZB 4QIWB 3J81i 1PZKD 1XYIA 3NQIA 2WIIB 2F0PA 3FKIG 4L5QA 1X3FA 1D7QA 1QE6A 1I50B 5JJIA 4DK1A 1WTRA 3H94A 1KDBA 2K7VA 3K81C 2ZXPA 3OOCA 4ZRZA 3HOVB 3S16B 3EN2A 2AWOA 2EE1A 2MQHA 2Q8RE 3DM1A 3NELA 3PV0A 4JW0A 3ICEA 3RZOH 1PVOA 4X64Q 2ENBA 3CPWA 4XDXA 5IP9G 2E2DC 5M9OA 3LWUA 2FMMA 5IGCA 5ISRA 2E76C 1E2VA 4N9TA 3PMFA 3VR6A 5IY0A 1EY8A 3K7UC 3SDZA 5D65A 1JJCB 3IL8A 4U68A 1JQYD 3CP0A 1TS2A 4L5SA 4HIDA 4JBWA 3EIVA 3HFZB 3I4NH 1JOQA 2BDNA 1VQGA 1GUTA 3HOXH 3TS2A 2CQOA 1RIPA 1GOZA 2CHBD 4JOIA 3URYA 1SFOB 3KBXA 1HR0Q 4QGUA 4WJ3M 1Q1EA 1TWAH 4P73A 1L0XB 2E74C 5D14A 1YJ9A 1N34Q 1YNND 5LL6X 4A3DH 3CPFA 1F2YA 3HEJA 4DV6L 2C35B 1QCBD 4IPCA 3A5UA 2Q2HA 4L8JA 4C3HG 3LX0A 1TIID 4BA2I 3CMAA 1NJIC 2Q8IB 5M5WB 3RD4A 3GTGB 2IHEA 1PYSB 3F2UA 3X3MA 3K5NA 1OXUA 1VQ7A 3HKZE 2RBMA 2AUKA 3S2HH 2EXZA 4ZUJA 2B2TC 1M90C 1X3QA 3DWPA 4KMUC 1DGSA 1XPUA 4KKUA 3RNUA 4DR7L 3KLRA 3HZXA 5BR8L 2KHJA 3EQLC 1EIGA 1VF5C 4DV6Q 4A93G 1X9NA 2O4XA 3STBD 4XQJA 1VQHA 2Z6KC 1WD1A 4IOCA 2SOBA 4B3RL 3M4OH 2XGTA 1B3AA 1V1OA 5DAUA 1TKWB 3CU7A 3T1HL 3U4VA 1BOSA 2OCEA 4O0AA 2F0WA 5FLXE 3SR1A 1ILPA 2WB1B 4O2DA 1HA5A 4YWKA 3W5OA 3JAML 4R4QA 3OPOA 2GVAA 2A6HC 2K50A 3N6RA 3VDYA 4A3MH 2MFIA 4B3SL 1IW7D 4YY3L 4Y7NB 2CQAA 1PDQA 1U0LA 1F9RA 4DV2Q 4B3RQ 2GA4B 1YBYA 4DXFA 2UUCL 3QIAA 4YIJA 4KK7A 4A3FB 1SE4A 1BDOA 2Z6BA 1EU3A 2RF4A 1EFWA 2NZ1D 1W3SA 3H6MA 1EIFA 1U9RA 1X54A 3M4QA 2UU9Q 1UAPA 1KRTA 1Y1VH 3GTJB 2DY8A 2ES2A 4QL5A 1PYWD 3PO3H 2SNSA 2JA5G 3A7AB 4HIOA 1CUKA 3GTKB 5M5YB 3KOJA 5IYCH 4TQUS 3DMUA 3SK8A 1HNWL 2TMPA 4EGVA 4LF6L 5CC4A 1S40A 3IFDA 4RHRA 4BS9A 3HRZC 3RMHA 4DAYB 2K5HA 4R4TA 3JC66 3G4SA 1M8AA 3T51B 1PRTB 1PRTC 3R8BA 4JI0L 3K57A 1I94L 5DM63 2WINB 4NXNL 1SEBD 4XIGS 4APVA 1BCPB 3T4AC 1BCPC 3NTHA 1EQQA 3NE5B 1YITA 2R7ZG 4BY1H 3CW2C 2NN6H 1STBA 3KLWA 2Y0SG 2RA4A 2XRSD 4LF6Q 1AE2A 4H44C 4K6LA 1VQMA 2EQSA 3PF5A 2F1MA 4HCSA 4KD4A 5ELBA 3TMEA 3DHQA 5IYDG 1SE8A 1KXLA 1WFQA 1O80A 2E2IH 3PUWA 1U4PA 4DV7Q 4IZ8A 1C9OA 2B2YC 4DR2L 2BA0A 3GTOB 1SN8A 3HS0C 4DAPA 5J39A 5CORA 4HCEA 3AB9A 3HOUH 1YJNA 2A5HA 4U673 1SNMA 1JICA 1J5EL 3U50C 3OSOA 2F4VL 5CMDA 4UHVA 1TWCH 3KF8B 3U58A 2BA1A 2F0EA 3MTSA 3I73A 3VA7A 4KN7C 4DR2Q 1QG7A 4QIWE 2WKDA 4C3HB 4ZKBB 2UXBL 4QUCA 3UDFA 3QG1A 4FO2A 1ESFA 3CQZH 1HTLD 3W3AA 3T1YL 1II3A 4LF9Q 5CV9A 4JV5L 4N8X1 1IYVA 1LACA 2B2UC 1JT8A 2DGYA 3H15A 2A6EC 4DK0A 2EJGC 4IUQA 5IT9c 3RUZA 1HJPA 3GTQH 2HIXA 4A93B 1Q3LA 1ZYRC 4LFCL 2TSSA 3NPPA 1IZ6A 2YYZA 1SJED 5KYLA 1LYLA 5EGTA 2RSOA 5ELNA 2B2TA 2KA7A 2VQFL 1MD2D 5DLQE 3GTMH 2Z0SA 3DUZA 2E2JH 2EYPA 5EPLA 4DNIA 3RN5A 3ERSX 1A62A 4RHSA 2FFKB 4AQYL 3DWQA 4JV5Q 2F3WA 3D6CA 3GP7A 1FNVA 4O42A 3VR3A 3KF6B 4ZQ3A 4LJZC 1V8QA 1G291 3PSIA 4POGA 5CR3A 1QNKA 3I4NG 3I70A 1J9OA 1WYDA 3D6WA 1TS4A 1XXGA 4N9PA 4TSSA 3HOXG 2PYKA 3SE0A 4DR4Q 5I2XA 2A6HD 1SNPA 3CC7A 2F0KA 1BKBA 3W1BA 2QA4A 3IKJA 1QZGA 3PCOB 4DAVA 1XMOL 2PZUA 1PTOB 1I3QB 1PTOC 4PG3A 3C1FA 4CJ2C 3DEOA 3OTOQ 2K05A 1Y69U 1VQLA 2MHVA 1JR0D 3EJIA 2E5LQ 4GLAC 2JE6I 5C4XH 1SXTA 3QOJA 2B2VC 1HR0W 2JA5B 2XWBB 3ZJYC 1B9MA 3WWVA 4HJ7A 1D5ZC 3NEMA 4J6HA 1YEZA 4GS3A 1IBLL 3BDCA 2NVQB 2F0JA 4G7OC 2V1CC 4KHPL 2JA6H 2EZVA 1XMOQ 4IURA 4CKBA 4HMJA 4LNQA 2KEDA 1E24A 4JVZA 5EAYA 4J1MA 5C0XJ 3PF4A 3I8ZA 1S5ED 2Z4HA 2L55A 2KCTA 2R7ZB 2B8FA 5GAEC 3SK4A 1ICWA 4DAYA 2F0QA 1OTCA 4FVMA 1PRTD 2Y0SB 2UXDQ 1MHWC 4ME3A 1IBLQ 3UDGA 1E7ZA 2R61A 1EIYB 2D62A 3S17B 1RD9D 4JI6Q 1BNZA 1QVFA 1X3EA 2WB1E 4DV1Q 1RJTA 3CCSA 3S1NB 1IKMA 2HCCA 4K5VA 2F03A 4FXGC 5A2QE 4MIUA 5I4DA 3CCUA 4A3MG 3K5OA 3FP9A 3K8AA 4JBJA 1ILQA 4OIKA 5JJZA 2IX1A 1FNUA 2CCZA 1YHBA 1HXYD 2KVMA 4UPAA 3OMGA 5GAGC 4XTCS 5IE8A 2JSOA 4C3JH 1TU2B 2MGSA 4F87A 5FLXL 1CFMA 2HT1A 1B8AA 2N78A 1IHZA 1Y1VG 4UAIA 3PO3G 4LAAA 2XRQD 4FNFA 1SDFA 1AFPA 5IYCG 1KD1C 2DJFC 5E3FA 4K8JA 2DNEA 3NUCA 3UE0A 4AYBG 4NXML 3MEHA 1SMYC 3KF8A 3Q0AA 1XJVA 2K03A 5I6WA 1WTHA 3Q6SA 3HOWH 4EX5A 1E0BA 3CCJA 2IY5B 2KJXA 1F9PA 1PYBA 1HQMC 2V4DA 2H5XA 3DLLA 2PZTA 2EJMA 3GV6A 5CV7A 4ULLA 5C4JH 4H0LC 3WDNA 3MFYA 3CCMA 2QEXA 4JOIC 3RZOB 3QOLA 4A3JH 3M4YA 1OXTA 4EQOA 1A3VA 5LL6S 2CKZB 2A6ED 5C3EH 5K5PA 4A3GH 2B2UA 1GD7A 2D0PA 2HD3A 4K5XA 5GQOA 4LMQD 1ZYRD 2I5LX 2PQEA 4HMIA 1Y1WB 4QUFA 1HNXL 2RQXA 4DV5Q 2JA7H 2AQ2B 4CDDC 3AYHB 1T5EA 2HQLA 5JEAG 1AZPA 3J81c 4DK3C 2QKIC 1OO9B 2NZOA 4ZKCB 1EEFD 4A3IH 2XTIA 3HOXB 4DNTB 3HOUG 2XSCA 2AWNA 3I56A 4LF5Q 4RKLA 2KCCA 1GUOA 3KF6A 1LLRD 4KHVA 4KKTA 3NENA 3S14H 5BN5A 3L7ZC 1FD7D 5LHY1 3D3RA 4CJ0B 4G7ZC 2B63H 1SROA 4A3KH 4K8IA 3MXUA 4A3DB 2NZHA 4C56C 1DJRD 5F2DA 5J3BA 3Q24A 1PTOD 4YCVA 1LO5D 2O2LD 3V96A 2ZTEA 4TKOB 4UP8A 1QVGA 1GHJA 4DU9A 1GUNA 2NTSA 1SSOA 3K58A 1C7YA 2F0LA 3BU2A 3MXNB 2KECA 3S2HB 3G7LA 1WTWA 1I4RA 2B2VA 1S5BD 1Q1BA 1SMXA 2JXMB 2IWHA 5HY6A 2VW9A 5IODA 3VYSA 5C5LA 1ZXTA 1HZCA 4I7AA 3P1HA 3I3CA 1JWUD 3VA5A 1UNSA 3A55A 2NVYH 3M4OB 4N8FA 3LGJA 1LTTD 4X66Q 2LXKA 4LF8L 2K14A 2ZTDA 3EROA 1K83H 5CBEE 5JAVA 3OHXC 1YNXA 2CWPA 2MP1A 2A74C 5KNDA 3IFTA 4EVOA 1MIUA 2WAQG 4C3IH 1VCIA 4K6DA 5EPJA 4JI1L 1HCZA 4JI5Q 2N55A 3H3VC 4DV4L 3NP8A 2ZXOA 5KNCA 4RG1A 1GXDC 5ELCA 4JI8L 2LS01 4OHJA 2EXDA 2PQAB 4B3TL 3AFPA 4C2MB 4G4KA 4LF8Q 4IJHA 4PMWA 1XNRL 4GLVB 3G71A 2D9UA 1SNCA 4KHZA 5NUCA 1JJGA 3O13A 3QWNA 1H9MA 2LKVA 5JJLA 1Y1VB 4CDEC 3NWTA 4LK1C 5C4XG 3MXPA 4I7ZC 5EJWA 3PO3B 1C8CA 2LSSA 4HIKA 4JI1Q 3U9OA 4JK1C 4RGOS 2O5IC 4DUZL 3CCVA 4DV4Q 3K7AH 4AYBB 4ALPA 1WTXA 5HGQA 5EPKA 3SVMA 2EY6A 4J8QA 1LTID 5T1IA 1JMCA 2JA6G 3MZ5A 4LF7L 2XNAC 1IYJB 1TS3A 3F2CA 4B3TQ 1XPOA 4DPGA 5IWAL 5LMNL 4P2CB 2K01A 1F2ZA 1XNRQ 2MO1A 4QF4A 1VQ6A 4WORA 1SMYD 1SNOA 3S15H 3J7YW 3VYUA 1S4ZA 3J81E 1PH4A 1UWVA 4BY1B 4ABNA 2QF7A 2FINB 1J8IA 3A8JE 4NKLA 5I2YA 3S2DH 3I72A 4HTHA 5EBCA 2Y0SE 5EQ0A 1VMPA 1E22A 3PUZA 3I4MH 1QOHA 2K33A 1A0IA 1WVLA 4GNXB 1SNQA 4FF2A 3F8TA 2AKWB 1Q8KA 5IGFA 1BBUA 2AQ3B 1VQDA 2Z9HA 1O7ZA 3C1EA 1N9WA 3KLSX 3K0XA 1GUGA 2PI2A 1A6XA 2D5DA 4UP9A 2AHOB 3J7AV 1FJGL 3HOUB 1MJCA 3RR5A 5DM73 3R2IA 1CKOA 4P74A 4OX9L 2HHHL 1GO3E 1PFNA 1TY0A 2FHTA 3E9IA 3PO2H 2IL8A 2I5HA 3E0JA 3KJPA 1Q8IA 3C2PA 2JA8B 1QZHA 2YV5A 2JK8A 3NTKA 4C3JG 4K0KL 3ONAB 1TWCB 1F77A 3MAQA 2PZWA 1S3OA 1EU4A 3L3OC 4JBKA 2RSNA 2CW0C 1DOKA 5JPNC 2A68C 1VQJA 5J1ZA 2KBNA 4PZ8A 1E3PA 1HHVA 1BVSA 5A2QL 1SNDA 2F4IA 4I65A 3V05A 5G3LD 4IFDJ 4NPSA 3J80c 2KCNA 4OX9Q 3CQZB 3GDEA 2JEAI 1CQVA 1FR3A 4ZLTF 4MZ9A 3HOWG 1RDPD 1VS0A 3PIPA 1V9PA 2OEOA 5DEHA 1PMRA 3HP3A 3RZDH 2C5CA 1D5MC 2K5WA 2NTTA 3F2BA 3GTQB 1Y8NB 2LFNA 1NE3A 4A3JG 4JI3L 3TP7A 3MXNA 4OWXB 4DR7Q 4HAEA 5BR8Q 5C3EG 2PW5A 1RCVD 1EZ8A 1LTGD 4IUPA 1PH9A 4A3GG 3DEPA 3GTMB 4UY8C 3NK9A 2E2JB 4MNOA 2PI2E 1LTSD 1SLJA 2XN9C 3T1HQ 1F2LA 4RA8A 3TSSA 2JA7G 1I4HA 1ICFB 3SK5A 3PIP3 1IL2A 3I91A 2WAQB 1ML0D 3CXCA 4RFBA 2BH2A 1K28A 2A69D 1WTQA 5IGBA 1TWHH 1SYBA 1GVPA 4A3IG 2R6GA 4B3SQ 3CRKC 3OW2A 4IN3A 1I4GA 4YY3Q 4FDBA 1TQOA 1C48A 3MEFA 3NQTA 3P75A 4OWWB 3FVQA 2EYMA 5E4WC 4WFN3 3A56A 3FKIB 2UUCQ 4Y52H 2B63G 1LT3D 4A3KG 3HG9A 1H9SB 2BDOA 3L0OA 5C4XB 1I50H 2Z4IA 1EOVA 3E0EA 2KUMA 3IRBA 2ZTCA 1KIXA 1Z6HA 2PQAA 4AH6A 2M2LA 2O5JC 1HQRD 3ULLA 5M5XB 2R93H 5IOCA 4DAMA 2F0TA 1SAPA 2QEJC 2JJQA 1QVCA 3BVMA 2RHSB 1ET9A 3A7LA 4CBVA 4DGZA 2JA6B 2RHQB 2RDFA 1FGBD 1IBKL 1HNWQ 1M1KC 2J4XA 4K2KA 1Y14B 1JOKA 3R3OA 1PXUA 3J80i 4ODGA 1KAAA 5IGGA 4R8IA 3I4OA 1JWMD 2PMZE 1O78A 2X69A 1L0YB 4A76A 4JI0Q 5JEAH 1GUSA 3A8KE 4M1UB 4CDCC 5IIFA 1I94Q 4NXNQ 2B39A 3HKSA 5D3DA 2G5DA 3MXGA 4CJ1B 1WCMH 3M9BA 1EUJA 1A2TA 1T9HA 2BOSA 1IBKQ 2F3VA 1EQRA 1IXRA 1YZ6A 2K28A 3C46A 1QILA 1PH6A 3SHLA 3S1QH 5FJ8H 2Q8TA 2SEBD 1CI3M 2ICEC 1XMQL 4C3IG 2M9VA 1B1ZA 4JI2L 1IBML 1I6HH 3VR5A 4GNXA 4NDXA 4GOPB 4GOPC 1KL9A 3HOYH 4OELB 1KQSA 3ERQA 2F0FA 3J81j 1PH3A 3DM3A 1VDZA 1QB5D 1R4QB 1HRJA 4GLXA 1KNAA 4LWCA 4C3JB 1AN8A 3TN2A 3HKZG 3UI2A 1J5EQ 4XT3B 2ALYB 2DJGC 4TRDA 2F4VQ 1EOTA 4UDUC 4HJ8A 4JC0A 1KC8C 1XMQQ 1JWSD 5KRUA 3H3VI 2H1EA 1YI2A 1B2TA 3KBGA 3S24A 2ASBA 4POFA 4X62L 1IBMQ 1VQBA 2DY7A 1EQVA 5C4HA 4KTAA 3I90A 2E2HH 3GTPH 3HOWB 2UXBQ 1RKNA 1K73C 2IX0A 3H0GH 1JE4A 2VZAA 2A68D 3I7FA 3TZUA 4JYAL 2N3SA 1STGA 3PQIA 1MKHA 5AJ3L 4JBMA 4R1JA 2VUMH 1EY6A 1R4PB 2DNCA 2D0OA 4X3TA 3T1YQ 2F0GA 3RN2A 5C4JB 1HZ9A 2ICIA 1WTVA 1X56A 1G6ZA 1JORA 4ZYSA 5LMUL 1STNA 2OWOA 3GQBA 4LFAL 1CHPD 3M7NA 1ENAA 5C3EB 1STHA 3RLNA 3U9SA 3BZDB 1G6PA 3I4MG 4LFCQ 1TT2A 1P8LA 1AE3A 2J7ZA 3D4RA 3GD7A 4QCLA 1E1TA 3VYRA 2VQFQ 1NR4A 1JB7A 3BYYB 1DOMA 1GHKA 4UP7A 3T56B 5M3MG 4A3FH 1GKHA 4AQYQ 1Q7YC 3J7AF 1LM0A 1S5FD 5I6YA 1CTMA 2MPMA 3EBEA 2Z8LA 3A74A 4HEDA 4A3IB 3OIQA 2YU9B 3GTJH 2OXPA 3J81L 2VS1A 2VB3X 1WJJA 3D31A 2EY5A 3PO2G 3MWYW 4DKAC 1S72A 5E4XA 4GN3B 3BS1A 2UUBL 1V43A 1DYQA 3KFUA 4P71A 2NB0A 1KLGD 2K75A 4OO1I 3AU7A 3KK7A 2RCNA 3CCEA 3KYHC 2UXCL 4XQNA 3TP8A 1LTRD 5ELOA 2JYOA 4PMCA 3BYTB 4KY7A 3NBHB 3T53B 1KRSA 4DUYL 1L0WA 3R93A 1PH1A 3A54A 3L2PA 4F8MA 1EWIA 2I0QA 1SR3A 4P72A 3CMEA 3CKIB 4ZCKA 4B9XA 1CKNB 2B29A 2F52A 1H9SA 2UUBQ 1E2ZA 1H9RA 1EYDA 1BCPD 3PGZA 2XWJB 5H1SE 4DR1L 4KHPQ 2JN4A 1PLFA 3HGBA 1ASZA 2F0MA 3D4DA 1BXTA 3OMCA 4BBSH 4C1NI 3S1MH 5FO7B 2AQ1B 2NVYB 3JAMi 1XTDA 1JCKB 3K59A 4BXXH 4R4OA 3A0JA 3GTOH 1E1OA 2CH4W 1B3QA 1CA6A 1QNUA 2IW3A 4GKKL 1SYGA 1K83B 1X32A 1E2WA 3M3YH 5M3FH 2ATWA 1D1KA 4DR1Q 2BE5C 1SJHD 3TEHB 1N32L 1X6OA 4C3IB 3I2ZA 3Q8DA 4IQZA 2GN5A 4OONA 2ZJQA 2R92H 3TRZA 3TREA 2ZXRA 5FO9B 5IT9E 4RMFA 4MHEA 3K6OA 2EYFA 1NSNS 4GKJL 1VQ5A 4MTKA 3M4PA 1EL0A 1HZAA 1KABA 3QJYA 1TWFH 1P16A 3HKZB 4BY7H 5GROA 1PFBA 4ZK9B 1XNQL 1ESRA 4FF1A 4GOPA 3CCQA 1BBXC 5COYA 1SRUA 4KKSA 5CV8A 5JOBA 5L37A 4RAUC 1A2UA 1L1OB 1H95A 1L1OC 4KY6A 2R93G 4QMGA 3K7AB 1DOLA 4WJWA 2A1AA 2JP1A 4OWTB 4V190 3KUPA 3D4WA 4GKJQ 1TXYA 2HIVA 3BZCA 5I9OA 4NXMQ 5IGEA 3A5ZB 4HJ9A 4RGTA 1GUWA 1QUQB 3S15B 1KDCA 1Z47A 3MFGA 2CFMA 4DR5L 1RTOA 2LXJA 4RGMA 4HSPA 2WV6D 1UEAB 3GTLH 3S2DB 1LT4D 1X3GA 2H4OA 2SNMA 3TP6A 1PA6A 2B8GA 4XQQA 3I4NB 1RF2D 1WCMG 4DK6C 1VQ9A 1I6VC 4DV3L 2K6AA 1I4PA 2WFWA 2EYLA 4L5TA 2N8NA 5BN4A 1TWAB 2OF1A 5FJ8G 2AUJD 2L1BA 3PUVA 4OO1G 1I4XA 1XWEA 1HNXQ 3BVGA 2K5DA 1LTBD 2VL6A 2B2WA 3P7JA 1JOOA 3HOYG 1DM0B 3PO2B 1HUMA 1MSHA 2NBFA 3BG3A 2NVQH 1UUPA 4L63B 1ET6A 4KJOA 1PH8A 1UE7A 5C44H 1Z9FA 1W6JA 1D6EC 4AIMA 2K5QA 3MHBA 1BO0A 3BVZA 4DR6L 1B4OA 3UDIA 1EY0A 4DA2A 4IOAA 1JC7A 4R8NA 3T16A 3SK6A 5CV5A 4DR3L 5D3IB 1EYCA 2F0DA 3ND8A 3H0GG 2LY7A 3NBHA 3KDFB 3Q22A 2VUMG 5CV6A 1AP0A 1PHJA 3RZDB 1EZ6A 4G57A 4F88A 5E7NA 3DWAA 2NVTH 1RHPA 2WB1G 4PMBA 3S1NH 2PNHA 5GADC 1HFNA 2I46A 1CKNA 2L9HA 4A3BH 2KHIA 4A3MB 5FLMG 3TP5A 3G6EA 2R7FA 3OIPA 1BBWA 4BBRH 1Y8PB 4S3SA 5K36H 1V1QA 3GV3A 1TWGH 1NAPA 1I4QA 3CCRA 4CKEA 5JVH3 5AFWA 5EBDA 1N33L 4A3CH 5FLXc 4JI4L 4A3FG 1EYAA 4YCWA 1K8AC 1LT5D 2A8VA 4FXKC 2L12A 1TWHB 3BDOA 2XIWA 1ZKOA 4PQXA 2DUDA 5JVG3 2BE5D 4X64L 1HH2P 4EQ5A 4NW2A 4DXGA 2OTLA 2YTVA 2HCIA 1SYFA 4JI8Q 1C4QA 1VMCA 2EYOA 2Z1CA 1N33Q 1ASYA 4FXDA 4JI4Q 4HJAA 5C0XI 4A3EH 1CM9A 2A19A 1WTOA 3D0FA 1RODA 1O7IA 4V0BA 1A63A 2R93B 1IKLA 1R9TH 4IUUA 4PV1C 1CA5A 2K4KA 5KEEA 4FP5D 4DV0L 2IPKD 2HQEA 2RDHA 4DUZQ 2YTYA 4LFBL 4OIJA 1HR0L 1SYDA 4NB3A 4GNXC 4LF7Q 3OYYA 4IUNA 1MI2A 5C5MA 1L1OA 4BA1I 1PRTF 5IWAQ 5LMNQ 3OWEB 1Y1WH 2E2IB 1EY5A 1DZ1A 4BBSG 5M3MH 1N34L 1BCPF 5ELFA 4OXPA 4R4CA 4BXXG 1B7YB 1CT1D 1WCMB 4YHHL 1FGUA 3P20A 4JI7L 2FMCA 2YTXA 4OEMB 1QUQA 3BJUA 4DV0Q 1D5XC 3CC2A 4WJ4A 3NXWA 1SYCA 5M3FG 5CGKA 4LFBQ 4LUOA 3E3XA 3UDXA 3S1QB 1H9KA 2EPBA 1KNEA 2EJFC 2FXQA 3FMCA 1GM5A 4X3SA 4B08A 3E6ZX 1KDAA 2R92G 1I6HB 5JEAJ 1K3BC 4X3KA 3W1GA 3LWEA 3HOYB 1X65A 5EKIA 4YHHQ 1LTLA 4JI7Q 1K8OA 2EYHA 3TQYA 1FJGQ 2IJ0A 1Q90A 2HHHQ 1I5FA 2F0VA 2BH8A 5DNFA 4BY7G 2A73B 1H9JA 1NMGA 4R9WA 2NUCA 4QY7A 2KQ3A 4K0KQ 2NVXH 2JA9A 1PFMA 3SEBA 1JJ2A 3QB3A 3SGIA 4PZ6A 1PZID 2K04A 4A3LG 1G8ZD 1S5DD 5HURA 2E2HB 2N88A 4KV6A 3GTPB 2L0CA 4BWGB 1W2BA 5IT9L 1PV4A 3H0GB 3GO5A 4DV2L 1HTPA 2QGQA 1AEXA 1EWHA 3VR2A 3KJOA 1NR2A 3TS0A 1F2MA 1B53A 2VUMB 2K5VA 2VY3A 4GN5A 5ELDA 2WP8J 4A4IA 3TDQA 1NNXA 1B9NA 1DONA 4X3UA 2UU9L 3NSWA 1ONLA 4TVAB 5CV4A 2PW7A 1FYCA 3KDFA 1RTNA 1U4MA 3NHHA 4JI3Q 3KLSA 1O7YA 3H3VH 4RWSC 3S1RH 4JPBW 5JJKA 1EY9A 2BCOA 3HOZH 5KNBA 4B9WA 4RCNA 1OXXK 2ZM6L 5IYBH 1MJEA 4C2MH 4CDFC 4KN4C 1SE3A 4KLKA 4K14A 5C4ZA 3ER0A 3W2DA 1K0RA 4PZ7A 1MSGA 1PFSA 1CSQA 2QCPX 2RCFA 5C0XG 3NWSA 3NBIA 2EY2A 1F9SA 4KI0A 4DFAA 3TBIB 4KD3A 3F2DA 1WOCA 3HOVH 3S16H 2I5MX 4GN4B 3NTIA 1YIJA 2B3GA 2WACA 3H91A 4ZAIA 2ZJPA 2M00A 4L6TB 1PTOF 1VF7A 3PUYA 3OWFA 2ZM6Q 1FL0A 5EKKA 4EQPA 1KHIA 1STYA 3V2TA 2MJ8A 5C44G 1KAWA 1XX8A 3VYTA 1RL2A 4XT1B 3FDTA 2F0IA 4YWLA 4DV7L 4LUVA 1VQPA 3AEVA 1O7LA 3BDLA 1N8RC 1UE5A 1CHQD 2EY1A 3ND9A 2L11A 1TVXA 5BN3A 1IYUA 1Q46A
chains in the Genus database with same CATH topology
4IUVA 2PCFB 2MUYA 3FRPB 4BBSB 3S1MB 1WTPA 2SDFA 4OO1H 2HDLA 5CYUA 1V1PB 5K36G 3FPPA 4Q5VA 4H13C 1DXMA 1BUVT 4IFDH 3G6JB 4OGQC 4ZUIA 3M3YB 5M3FB 3J80E 1CK1A 2X6GA 1TR5A 1HUNA 4NP5A 2ZT9C 3VR4A 4OL7A 2L5TA 1SYEA 2R92B 2JEBI 1U4RA 1M4VA 5TSSA 1U4LA 4NMZA 1Q12A 1D2BA 4QB4A 1TWFB 4BY7B 5C6AA 2CW0D 2RKSA 4KJNA 2ID0A 4E6IA 2IT1A 2J0TD 1QJOA 3TZDA 3N52A 1AW7A 4A3JB 1HPCA 4MN3A 3MC0B 2HDMA 1OXVA 1DD2A 3AMUA 2RVLA 4A3GB 2OT2A 1MGSA 2K1BA 2XVSA 1NCVA 1XTCD 5KGUA 1NUCA 2B2WC 3EA6A 5FO8B 3E5SA 4C1NK 2JA7B 1MBYA 3ZYYX 5T1GA 4ME5A 2NN6I 3GTLB 4K5WA 2VXWA 2NYZD 3S9WA 4FYDA 2G9HD 3MVVA 3I4LA 2QILA 5JPMC 3S14B 3FPUB 1EY7A 2VNUD 3WOFA 2B63B 1YNJC 4A3KB 4CHTB 3CRLC 2F0HA 2CVRA 2F0SA 1F9QA 2KHSA 2WKCA 3K5LA 4HR7B 4IFDI 5IGDA 1STEA 1EIHA 2G9DA 5G3LF 5C44B 5FOBB 4FF4A 1A3TA 3PUXA 4RCOA 4H7BA 1G91A 5KIXA 1G2TA 3R2TA 4FF3A 1LABA 2I07B 3H09A 2FJ2A 4CKCA 2F0NA 1WD0A 1HFGA 2KOLA 4Q0FA 2NVTB 1CQFA 2D2CC 1B50A 1B44D 2LMCB 4A3BB 2L4NA 1T5XD 5C3XA 4DF7A 4BBRB 3A8IE 1TWGB 3DXJC 1KLUD 1KTKA 4PNYA 2EDGA 1A3UA 3M7GA 2QDBA 4XYQA 2DN8A 3EFXD 1V1PA 2B2YA 1EWCA 1BR9A 1EEID 1ENFA 3JAME 3SXHA 3QO2A 4CGYB 3L9AX 2F0UA 4IALA 1EQTA 4HSVA 2VB2X 4M8AA 2KEEA 4A3EB 4EQNA 3EVQA 1ENCA 5A35A 3X3NA 4KY5A 4F7XA 5HGTA 1HA6A 1R9TB 2NN6G 1EFID 1W6KA 2IX3A 2NWGA 3I4MB 1Z7TA 1X3PA 5C3WA 4Z9CB 3MA2B 5KYIA 4XYOA 1YNNC 1PZJD 5M3MB 4DNRB 3ITPA 1PTOH 2HUGA 4RGNA 3WOEA 1QWYA 5CBAE 5C0XH 5I9PA 4ID6A 2PO4A 1ZEQX 2EVBA 4DN4M 3FEWX 4IFDG 1LTAD 2EYJA 1TS5A 1AZQA 2C9OA 3LNNA 3D8GA 1BF4A 4GZYC 1SE2A 3CHBD 4RH6A 5J22A 3C3LA 2K32A 4WRDA 1FNWA 1OXSC 5E1FA 4IUTA 2R3ZA 4HN7A 1YNJD 1BQQT 3M85A 3K0YA 1IL8A 2X6LA 3Q23A 1EY4A 3J80L 1CZGA 2E75C 2NVXB 1S5CD 2PPBC 1SBBB 3PIO3 3RLFA 1IW7C 2PMZB 4G7HC 3K5MA 4XXEA 1Y8OB 1CZWA 3T13A 1DCZA 3IAYA 5FK9C 1LV9A 2PNRC 4O1NA 4ILWA 2EOTA 2F0OA 3OW7A 2A69C 2RDGA 1GJXA 5EKLA 1STAA 4RKBA 4K2LA 1TY2A 1K8MA 1LT6D 1A15A 1JB3A 1G2SA 5ELEA 3S1RB 5FKAC 1D1IA 3HOZB 4QIWB 1PZKD 1XYIA 3NQIA 2WIIB 2F0PA 1QE6A 1I50B 4DK1A 1WTRA 3H94A 1KDBA 2K7VA 2ZXPA 3OOCA 4ZRZA 3HOVB 3S16B 2AWOA 2EE1A 2Q8RE 3DM1A 3PV0A 2ENBA 4XDXA 2E2DC 5M9OA 3LWUA 2FMMA 5IGCA 5ISRA 2E76C 1E2VA 4N9TA 3PMFA 3VR6A 1EY8A 3SDZA 5D65A 3IL8A 4U68A 1JQYD 1TS2A 4JBWA 1JOQA 2BDNA 1GUTA 1GOZA 2CHBD 3URYA 1SFOB 3KBXA 1Q1EA 1L0XB 2E74C 5D14A 1YNND 5LL6X 1F2YA 3HEJA 1QCBD 4L8JA 4C3HG 3LX0A 1TIID 4BA2I 2Q8IB 5M5WB 3RD4A 3GTGB 3F2UA 3X3MA 3K5NA 1OXUA 2RBMA 2AUKA 2EXZA 4ZUJA 2B2TC 1X3QA 3DWPA 4KMUC 4KKUA 3KLRA 3HZXA 3EQLC 1EIGA 1VF5C 2O4XA 4XQJA 1WD1A 2SOBA 1B3AA 1V1OA 5DAUA 1TKWB 3CU7A 1BOSA 2F0WA 5FLXE 3SR1A 1ILPA 2WB1B 1HA5A 3JAML 3OPOA 2A6HC 3N6RA 1IW7D 4Y7NB 2CQAA 1PDQA 1F9RA 2GA4B 4DXFA 3QIAA 4YIJA 4KK7A 4A3FB 1SE4A 1BDOA 1EU3A 2NZ1D 3H6MA 1U9RA 1UAPA 3GTJB 2DY8A 1PYWD 2SNSA 3A7AB 3GTKB 5M5YB 4TQUS 3DMUA 3SK8A 2TMPA 4EGVA 5CC4A 3IFDA 4RHRA 4BS9A 3HRZC 3RMHA 1M8AA 3T51B 1PRTB 1PRTC 3R8BA 3K57A 5DM63 2WINB 1SEBD 4XIGS 1BCPB 3T4AC 1BCPC 3NTHA 3NE5B 2NN6H 1STBA 2RA4A 2XRSD 4H44C 4K6LA 2F1MA 4HCSA 4KD4A 5ELBA 3TMEA 3DHQA 1O80A 3PUWA 1U4PA 4IZ8A 2B2YC 2BA0A 3GTOB 3HS0C 4DAPA 5J39A 5CORA 4HCEA 3AB9A 2A5HA 4U673 1SNMA 1JICA 3OSOA 5CMDA 2BA1A 2F0EA 3MTSA 3I73A 3VA7A 4KN7C 1QG7A 2WKDA 4C3HB 4ZKBB 4QUCA 3QG1A 4FO2A 1ESFA 1HTLD 3W3AA 1II3A 5CV9A 1IYVA 1LACA 2B2UC 2A6EC 4DK0A 2EJGC 4IUQA 3RUZA 4A93B 1Q3LA 1ZYRC 2TSSA 3NPPA 2YYZA 1SJED 5KYLA 5EGTA 2RSOA 2B2TA 2KA7A 1MD2D 3DUZA 2EYPA 5EPLA 4RHSA 2FFKB 3DWQA 2F3WA 3D6CA 3GP7A 1FNVA 4O42A 3VR3A 4ZQ3A 4LJZC 1V8QA 1G291 5CR3A 1QNKA 3I70A 1J9OA 3D6WA 1TS4A 1XXGA 4N9PA 4TSSA 2PYKA 3SE0A 5I2XA 2A6HD 1SNPA 2F0KA 3IKJA 4DAVA 2PZUA 1PTOB 1I3QB 1PTOC 3C1FA 4CJ2C 3DEOA 2K05A 1Y69U 2MHVA 1JR0D 3EJIA 2JE6I 1SXTA 3QOJA 2B2VC 2JA5B 2XWBB 1B9MA 1D5ZC 4J6HA 3BDCA 2NVQB 2F0JA 4G7OC 2EZVA 4IURA 4CKBA 4HMJA 2KEDA 4J1MA 5C0XJ 3I8ZA 1S5ED 2Z4HA 2L55A 2R7ZB 2B8FA 3SK4A 1ICWA 4DAYA 2F0QA 4FVMA 1PRTD 2Y0SB 2R61A 2D62A 3S17B 1RD9D 1BNZA 1RJTA 3S1NB 1IKMA 2HCCA 4K5VA 2F03A 4FXGC 5A2QE 4MIUA 5I4DA 3K5OA 1ILQA 4OIKA 5JJZA 2IX1A 1FNUA 1HXYD 2KVMA 3OMGA 4XTCS 2JSOA 1TU2B 2MGSA 4F87A 5FLXL 1CFMA 1IHZA 4UAIA 4LAAA 2XRQD 4FNFA 1SDFA 1AFPA 5E3FA 4K8JA 2DNEA 3NUCA 3MEHA 1SMYC 3KF8A 3Q0AA 2K03A 5I6WA 3Q6SA 1E0BA 2KJXA 1F9PA 2V4DA 1HQMC 2PZTA 2EJMA 3GV6A 5CV7A 4ULLA 4H0LC 3WDNA 3MFYA 3RZOB 3QOLA 3M4YA 1OXTA 4EQOA 1A3VA 5LL6S 2A6ED 5K5PA 2B2UA 4K5XA 4LMQD 1ZYRD 2PQEA 4HMIA 1Y1WB 4QUFA 2RQXA 2AQ2B 1T5EA 5JEAG 1AZPA 2QKIC 1OO9B 4ZKCB 1EEFD 3HOXB 4DNTB 2XSCA 2AWNA 4RKLA 2KCCA 1GUOA 1LLRD 4KHVA 4KKTA 5BN5A 3L7ZC 1FD7D 5LHY1 3D3RA 4CJ0B 4G7ZC 4K8IA 3MXUA 4A3DB 4C56C 1DJRD 5F2DA 3Q24A 1PTOD 1LO5D 2O2LD 3V96A 4TKOB 1GHJA 4DU9A 1GUNA 2NTSA 1SSOA 3K58A 2F0LA 2KECA 3S2HB 3G7LA 1WTWA 1I4RA 2B2VA 1S5BD 1Q1BA 2JXMB 2IWHA 5IODA 3VYSA 5C5LA 1ZXTA 3P1HA 3I3CA 1JWUD 3VA5A 1UNSA 3A55A 3M4OB 1LTTD 3EROA 5CBEE 5JAVA 3OHXC 2MP1A 2A74C 5KNDA 3IFTA 4EVOA 1VCIA 4K6DA 5EPJA 1HCZA 2N55A 3H3VC 3NP8A 2ZXOA 5KNCA 1GXDC 5ELCA 2LS01 4OHJA 4C2MB 4G4KA 4PMWA 2D9UA 1SNCA 4KHZA 5NUCA 3O13A 3QWNA 1H9MA 2LKVA 1Y1VB 3NWTA 4LK1C 3MXPA 4I7ZC 5EJWA 3PO3B 1C8CA 3U9OA 4JK1C 4RGOS 2O5IC 4AYBB 1WTXA 5EPKA 3SVMA 2EY6A 4J8QA 1LTID 5T1IA 3MZ5A 2XNAC 1TS3A 4P2CB 2K01A 1F2ZA 4QF4A 4WORA 1SMYD 1SNOA 3J7YW 3VYUA 1S4ZA 3J81E 4BY1B 4ABNA 2QF7A 2FINB 1J8IA 3A8JE 4NKLA 5I2YA 3I72A 4HTHA 5EBCA 5EQ0A 1VMPA 3PUZA 1QOHA 2K33A 1WVLA 1SNQA 4FF2A 5IGFA 2AQ3B 1O7ZA 3C1EA 3KLSX 1GUGA 1A6XA 2D5DA 3J7AV 3HOUB 5DM73 3R2IA 1PFNA 1TY0A 2FHTA 2IL8A 3E0JA 3C2PA 1Q8IA 2JA8B 3NTKA 4C3JG 3ONAB 1TWCB 1F77A 3MAQA 2PZWA 1EU4A 3L3OC 2RSNA 2CW0C 1DOKA 5JPNC 2A68C 1HHVA 5J1ZA 5A2QL 1SNDA 2F4IA 4I65A 3V05A 5G3LD 4IFDJ 2KCNA 3CQZB 2JEAI 1CQVA 1FR3A 4ZLTF 1RDPD 2OEOA 5DEHA 1PMRA 3HP3A 2C5CA 1D5MC 2K5WA 2NTTA 3GTQB 1Y8NB 2LFNA 3TP7A 3MXNA 4HAEA 2PW5A 1RCVD 1EZ8A 1LTGD 4IUPA 3DEPA 3GTMB 3NK9A 2E2JB 1LTSD 2XN9C 1F2LA 4RA8A 3TSSA 1I4HA 3SK5A 3PIP3 3I91A 2WAQB 1ML0D 4RFBA 2A69D 1WTQA 5IGBA 1SYBA 2R6GA 3CRKC 4IN3A 1I4GA 1TQOA 1C48A 3NQTA 3P75A 3FVQA 2EYMA 5E4WC 4WFN3 3A56A 3FKIB 1LT3D 3HG9A 1H9SB 2BDOA 5C4XB 2Z4IA 2KUMA 1Z6HA 2M2LA 2O5JC 1HQRD 5M5XB 5IOCA 2F0TA 1SAPA 2QEJC 3BVMA 3A7LA 4CBVA 1ET9A 4DGZA 2JA6B 2RDFA 1FGBD 2J4XA 4K2KA 1JOKA 3R3OA 1PXUA 4ODGA 1KAAA 5IGGA 4R8IA 1JWMD 1O78A 2X69A 1L0YB 5JEAH 1GUSA 3A8KE 4M1UB 5IIFA 2B39A 5D3DA 3MXGA 4CJ1B 1A2TA 2BOSA 2F3VA 2K28A 3C46A 1QILA 3SHLA 2Q8TA 2SEBD 1CI3M 2ICEC 4C3IG 2M9VA 1B1ZA 3VR5A 4NDXA 3ERQA 2F0FA 1VDZA 1QB5D 1R4QB 1HRJA 1KNAA 4C3JB 1AN8A 3TN2A 3UI2A 4XT3B 4TRDA 1EOTA 4UDUC 1JWSD 5KRUA 1B2TA 2H1EA 3KBGA 2DY7A 1EQVA 5C4HA 4KTAA 3I90A 3HOWB 1RKNA 2IX0A 1JE4A 3TZUA 2A68D 1STGA 1EY6A 1R4PB 2DNCA 4X3TA 2F0GA 5C4JB 2ICIA 1WTVA 1G6ZA 1JORA 4ZYSA 1STNA 3GQBA 1CHPD 3M7NA 1ENAA 5C3EB 1STHA 3U9SA 3BZDB 1TT2A 2J7ZA 3D4RA 3GD7A 4QCLA 3VYRA 1NR4A 3BYYB 1DOMA 1GHKA 3T56B 3J7AF 1S5FD 5I6YA 1CTMA 2MPMA 2Z8LA 4HEDA 4A3IB 3OIQA 2YU9B 2OXPA 3J81L 2VB3X 3D31A 2EY5A 3MWYW 5E4XA 3BS1A 1V43A 1DYQA 2NB0A 1KLGD 4OO1I 3AU7A 3KK7A 4XQNA 3TP8A 1LTRD 2JYOA 4PMCA 3BYTB 4KY7A 3T53B 3R93A 3A54A 4F8MA 3CKIB 4B9XA 1H9SA 1E2ZA 1H9RA 1EYDA 1BCPD 2XWJB 1PLFA 3HGBA 2F0MA 3D4DA 1BXTA 3OMCA 4C1NI 5FO7B 2AQ1B 2NVYB 1JCKB 3K59A 1CA6A 1QNUA 2IW3A 1SYGA 1K83B 1X32A 1E2WA 1D1KA 2BE5C 1SJHD 4C3IB 4IQZA 2ZXRA 5FO9B 5IT9E 4MHEA 3K6OA 2EYFA 1NSNS 1EL0A 1KABA 3QJYA 3HKZB 1PFBA 4ZK9B 1ESRA 4FF1A 1BBXC 5COYA 4KKSA 5CV8A 5JOBA 4RAUC 1A2UA 4KY6A 4QMGA 3K7AB 1DOLA 4WJWA 2JP1A 4V190 3KUPA 3D4WA 5I9OA 5IGEA 4RGTA 1GUWA 3S15B 1KDCA 1Z47A 3MFGA 1RTOA 4RGMA 4HSPA 2WV6D 1UEAB 3S2DB 1LT4D 2H4OA 2SNMA 3TP6A 2B8GA 4XQQA 3I4NB 1RF2D 1I6VC 2K6AA 1I4PA 2EYLA 5BN4A 1TWAB 2OF1A 2AUJD 2L1BA 3PUVA 4OO1G 1I4XA 1XWEA 3BVGA 2K5DA 1LTBD 2B2WA 3P7JA 1JOOA 1DM0B 3PO2B 1HUMA 1MSHA 2NBFA 3BG3A 1UUPA 4L63B 1ET6A 4KJOA 1W6JA 1D6EC 2K5QA 3MHBA 1BO0A 3BVZA 1B4OA 1EY0A 4DA2A 1JC7A 4R8NA 3T16A 3SK6A 5CV5A 5D3IB 1EYCA 2F0DA 3ND8A 2LY7A 3NBHA 3Q22A 5CV6A 1AP0A 3RZDB 1EZ6A 4G57A 4F88A 3DWAA 1RHPA 4PMBA 1HFNA 2I46A 2L9HA 4A3MB 3TP5A 3OIPA 1Y8PB 4S3SA 5K36H 3GV3A 1NAPA 1I4QA 4CKEA 5JVH3 5AFWA 5EBDA 1EYAA 1LT5D 4FXKC 2L12A 1TWHB 3BDOA 2XIWA 1ZKOA 4PQXA 5JVG3 2BE5D 4NW2A 4DXGA 2HCIA 1SYFA 1C4QA 1VMCA 2EYOA 2Z1CA 4FXDA 5C0XI 1CM9A 1WTOA 1RODA 4V0BA 2R93B 1IKLA 4IUUA 4PV1C 1CA5A 5KEEA 4FP5D 2IPKD 2HQEA 2RDHA 4OIJA 1SYDA 4IUNA 1MI2A 5C5MA 4BA1I 1PRTF 3OWEB 2E2IB 1EY5A 1DZ1A 1BCPF 5ELFA 1CT1D 1WCMB 3P20A 2FMCA 1D5XC 3NXWA 1SYCA 5CGKA 3S1QB 1H9KA 2EPBA 1KNEA 2EJFC 3FMCA 4X3SA 4B08A 3E6ZX 1KDAA 1I6HB 5JEAJ 4X3KA 3LWEA 3HOYB 5EKIA 1K8OA 2EYHA 2IJ0A 1Q90A 2F0VA 5DNFA 2A73B 1H9JA 4R9WA 2NUCA 2KQ3A 1PFMA 3SEBA 3QB3A 1PZID 2K04A 1G8ZD 1S5DD 5HURA 2E2HB 2N88A 4KV6A 3GTPB 2L0CA 4BWGB 5IT9L 3H0GB 3GO5A 1HTPA 1AEXA 1EWHA 3VR2A 1NR2A 1F2MA 1B53A 2VUMB 5ELDA 2WP8J 3TDQA 1B9NA 1DONA 4X3UA 3NSWA 1ONLA 5CV4A 2PW7A 1FYCA 1RTNA 1U4MA 3NHHA 3KLSA 1O7YA 4RWSC 1EY9A 2BCOA 5KNBA 4B9WA 4RCNA 1OXXK 4KN4C 1SE3A 4K14A 5C4ZA 3W2DA 5C0XG 1MSGA 2QCPX 3NBIA 3NWSA 2EY2A 1F9SA 4KI0A 4DFAA 3TBIB 4KD3A 3NTIA 2WACA 3H91A 4ZAIA 2M00A 4L6TB 1PTOF 1VF7A 3PUYA 3OWFA 5EKKA 4EQPA 1STYA 3V2TA 2MJ8A 1XX8A 3VYTA 4XT1B 3FDTA 2F0IA 1O7LA 3BDLA 1CHQD 2EY1A 3ND9A 2L11A 1TVXA 5BN3A 1IYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9W A;  2B2T A;  2L12 A;  1ILQ A;  1F2L A;  4RA8 A;  4IUV A;  1PFM A;  1HRJ A;  4HSV A;  4OIK A;  5D14 A;  1KNA A;  2XIW A;  1S4Z A;  5JJZ A;  3TN2 A;  5EPL A;  3FPU B;  3I91 A;  1M8A A;  2K04 A;  4XT3 B;  3UI2 A;  1WTP A;  2FIN B;  1EOT A;  2FFK B;  1ML0 D;  1LV9 A;  2KVM A;  2SDF A;  4NW2 A;  1SSO A;  2KEE A;  1J8I A;  2HDL A;  2N88 A;  4O42 A;  1WTQ A;  1PLF A;  5EQ0 A;  1B2T A;  2H1E A;  1VMP A;  2EOT A;  2KEC A;  2CVR A;  3G7L A;  2HCI A;  1WTW A;  1F9Q A;  2MGS A;  2L1B A;  2B2V A;  1WVL A;  2DY7 A;  1NR2 A;  1VMC A;  3F2U A;  1HA6 A;  1B53 A;  1QNK A;  3I90 A;  4UAI A;  2RA4 A;  1EIH A;  1J9O A;  1CM9 A;  3D6W A;  1WTO A;  1O7Z A;  2X6G A;  1SDF A;  1ROD A;  1ZXT A;  2B2W A;  3P7J A;  1JE4 A;  5E4W C;  2B2T C;  1A15 A;  1HUN A;  1X3Q A;  4HCS A;  1CA6 A;  2NWG A;  3I3C A;  1DON A;  1G2S A;  4X3U A;  1IKL A;  1X32 A;  1X3P A;  4IUU A;  4X3T A;  1U4R A;  1O80 A;  2K03 A;  1CA5 A;  1HUM A;  1MSH A;  3Q6S A;  2KUM A;  4CJ2 C;  1E0B A;  3DEO A;  1EIG A;  1WTV A;  2K05 A;  2M2L A;  1U4P A;  1RTN A;  1U4L A;  1XYI A;  1U4M A;  1G6Z A;  1F9P A;  1O7Y A;  2B2Y C;  1PFN A;  2FHT A;  4OIJ A;  4RWS C;  5CBE E;  1SAP A;  1WD1 A;  2IL8 A;  1B3A A;  1G91 A;  2B2V C;  2HUG A;  1MI2 A;  3GV6 A;  1G2T A;  2MP1 A;  5COR A;  1QE6 A;  5CBA E;  4MHE A;  3ONA B;  1BO0 A;  1WTR A;  1B4O A;  1DZ1 A;  2J7Z A;  2FJ2 A;  1JIC A;  4DN4 M;  5EPJ A;  1ILP A;  1NR4 A;  1MSG A;  2EE1 A;  2N55 A;  1DOM A;  2Q8R E;  2RSN A;  3DM1 A;  5CMD A;  4R8I A;  1AZQ A;  2B2U A;  1DOK A;  1HFG A;  2KOL A;  4IUR A;  1WD0 A;  1HHV A;  1B50 A;  1F9S A;  2X69 A;  4LMQ D;  1BF4 A;  2KED A;  1PFB A;  3MTS A;  4XDX A;  4ZK9 B;  1ESR A;  3TZD A;  2MPM A;  1AP0 A;  4QUF A;  1PDQ A;  3N52 A;  3I8Z A;  1F9R A;  2L4N A;  4MN3 A;  2FMM A;  1QG7 A;  5COY A;  2HDM A;  4HED A;  4ZLT F;  4ZAI A;  3H91 A;  4CJ1 B;  1RHP A;  2D9U A;  4ZKB B;  2EPB A;  1KNE A;  1AZP A;  2RVL A;  4QUC A;  4RAU C;  1ICW A;  1MGS A;  2K1B A;  4X3S A;  1HFN A;  1DOL A;  3MWY W;  1NCV A;  5D65 A;  3HP3 A;  1EL0 A;  2L9H A;  5E4X A;  5EJW A;  2K28 A;  4IUT A;  4ZKC B;  2MJ8 A;  3IL8 A;  2R3Z A;  1C8C A;  2B2W C;  2JP1 A;  4U68 A;  3KUP A;  2NZ1 D;  1XX8 A;  2Q8T A;  4XT1 B;  3FDT A;  3GV3 A;  1IL8 A;  2X6L A;  3LWE A;  4X3K A;  1BNZ A;  1NAP A;  2B2U C;  1WTX A;  2DY8 A;  2B2Y A;  5EKI A;  5EPK A;  3SVM A;  4HAE A;  2JYO A;  4IUQ A;  1RJT A;  5T1G A;  1BBX C;  5T1I A;  1GUW A;  5AFW A;  2BDN A;  1IKM A;  2VXW A;  2HCC A;  3QO2 A;  4IUP A;  3DEP A;  4CJ0 B;  2L11 A;  2NYZ D;  5DNF A;  1Q3L A;  3KBX A;  2K01 A;  1RTO A;  1EQT A;  1TVX A;  3IFD A;  3R93 A;  2RSO A; 
#chains in the Genus database with same CATH topology
 1VQI A;  4IUV A;  5IP7 H;  2PCF B;  2MUY A;  1SFO H;  3FRP B;  4BBS B;  3S1M B;  1WTP A;  2SDF A;  4OO1 H;  2HDL A;  5CYU A;  4MTN A;  1PH5 A;  4A3B G;  1V1P B;  1VQE A;  3CAM A;  4BBR G;  5K36 G;  3FPP A;  4Q5V A;  4H13 C;  1DXM A;  1BUV T;  1VQ8 A;  4IFD H;  3G6J B;  4OGQ C;  4ZUI A;  3M3Y B;  5M3F B;  3J80 E;  1CK1 A;  2X6G A;  1K3R A;  4A3C G;  1TR5 A;  1HUN A;  4NP5 A;  2ZT9 C;  3VR4 A;  4OL7 A;  4QJF A;  4LF9 L;  5M5W H;  2JA8 H;  2KEN A;  3GTG H;  2L5T A;  1SYE A;  2R92 B;  2JEB I;  1U4R A;  2MNA A;  1M4V A;  5TSS A;  1U4L A;  1NMF A;  2Q2U A;  4IPG A;  4JI2 Q;  4NMZ A;  2E8G A;  2OTJ A;  1Q12 A;  4X6A H;  1HNZ L;  4AYB E;  1D2B A;  1C0A A;  4QB4 A;  1TWF B;  4B3M L;  4BY7 B;  5C6A A;  2CW0 D;  2RKS A;  3J7Z C;  1A8V A;  4A3E G;  4KJN A;  2ID0 A;  4E6I A;  3JAM c;  2IT1 A;  2MO0 A;  2J0T D;  1QJO A;  3TZD A;  3CCL A;  3CD6 A;  3N52 A;  1AW7 A;  4A3J B;  1HPC A;  4MN3 A;  3MC0 B;  4R4I A;  4X62 Q;  2HDM A;  3QR8 A;  1OXV A;  4LF4 L;  1DD2 A;  5FLM H;  3AMU A;  2RVL A;  4DR4 L;  1HNZ Q;  4A3G B;  2OT2 A;  1MGS A;  2K1B A;  2XVS A;  1NCV A;  4Y7N H;  4B3M Q;  1XTC D;  2Q2I A;  5KGU A;  1CSP A;  1NUC A;  2B2W C;  3EA6 A;  4JYA Q;  5FO8 B;  3E5S A;  3OTO L;  5AJ3 Q;  1Y1W G;  2OQ0 A;  4C1N K;  2E5L L;  2JA7 B;  1MBY A;  1U5K A;  2Z6K A;  4X65 L;  4HJ5 A;  3ZYY X;  5T1G A;  4ME5 A;  2NN6 I;  3GTL B;  4K5W A;  1D8L A;  2VXW A;  3E9H A;  4IPH A;  3UE1 A;  2NYZ D;  3S9W A;  5LMU Q;  4LFA Q;  4FYD A;  2CH4 A;  5LMN W;  2G9H D;  3MVV A;  4LF4 Q;  3I4L A;  3GTK H;  4JCV E;  5M5Y H;  3ULP A;  1XPR A;  2QIL A;  5JPM C;  3S14 B;  3FPU B;  1Q86 C;  1EY7 A;  2VNU D;  3FKI H;  3WOF A;  2B63 B;  1YNJ C;  4A3K B;  4CHT B;  3CRL C;  4IO9 A;  2F0H A;  2CVR A;  2F0S A;  1VQ4 A;  4X65 Q;  4A3D G;  1F9Q A;  2KHS A;  2WKC A;  3K5L A;  4HR7 B;  1K8G A;  4IFD I;  1YHQ A;  4P75 A;  5IGD A;  2OQK A;  3ULJ A;  1STE A;  1EIH A;  2UXD L;  5M5X H;  2UUA L;  1NBW A;  2G9D A;  2KCM A;  4J15 A;  4JI6 L;  5IP9 H;  5G3L F;  2CWA A;  5C44 B;  4DV1 L;  1NTG A;  5FOB B;  1K9M C;  4FF4 A;  3F1Z A;  1A3T A;  1YHA A;  3PUX A;  2UXC Q;  4RCO A;  4H7B A;  4HIM A;  4L5R C;  4H02 A;  1G91 A;  5KIX A;  1G2T A;  2EIF A;  3R2T A;  4DUY Q;  4FF3 A;  1LAB A;  2I07 B;  3H09 A;  2FJ2 A;  4CKC A;  1VQA A;  2UUA Q;  2F0N A;  1N36 L;  1WD0 A;  1HFG A;  2KOL A;  4IPD A;  4Q0F A;  2NVT B;  1CQF A;  2D2C C;  1B50 A;  1B44 D;  2K5N A;  4QQB X;  2LMC B;  4A3B B;  2WAQ E;  2L4N A;  1T5X D;  5C3X A;  4DF7 A;  4BBR B;  1Q81 C;  3A8I E;  1TWG B;  3DXJ C;  1KLU D;  5GAH C;  1KTK A;  1Q82 C;  4PNY A;  3CC4 A;  2QDL A;  2EDG A;  1A3U A;  3HOZ G;  1L2F A;  4C3H H;  3M7G A;  5IYB G;  2QDB A;  1N36 Q;  4XYQ A;  1UEB A;  4GKK Q;  2DN8 A;  3EFX D;  1V1P A;  2B2Y A;  1EWC A;  1BR9 A;  1EEI D;  1ENF A;  3JAM E;  3SXH A;  1NY4 A;  3QO2 A;  4CGY B;  3L9A X;  1N32 Q;  2F0U A;  4IAL A;  3AQQ A;  1EQT A;  3HOV G;  4A3L H;  3AFQ A;  4HSV A;  3K80 C;  4A93 H;  2VB2 X;  1FVI A;  1PH7 A;  4M8A A;  2KEE A;  4A3E B;  2VQE L;  4EQN A;  4DV5 L;  1YJW A;  3EVQ A;  1ENC A;  5A35 A;  2K52 A;  4KY5 A;  3X3N A;  4F7X A;  5HGT A;  1XNQ Q;  1HZB A;  1HA6 A;  1R9T B;  4BY1 G;  2NN6 G;  1EFI D;  1W6K A;  2IX3 A;  1UE6 A;  1UE1 A;  2NWG A;  4LF5 L;  1J6Q A;  1VQO A;  1Z7T A;  3I4M B;  1X3P A;  4JG2 A;  5C3W A;  3B6Y A;  2F3I A;  4Z9C B;  5IP7 G;  3MA2 B;  5KYI A;  2VQE Q;  4XYO A;  1YNN C;  1PZJ D;  3FHW A;  5M3M B;  4DNR B;  1K0S A;  3ITP A;  1VQN A;  1PTO H;  1I3Q H;  2HUG A;  4RGN A;  3WOE A;  1YVC A;  1QWY A;  5CBA E;  5C0X H;  4DR5 Q;  5I9P A;  4ID6 A;  2PO4 A;  1ZEQ X;  2EVB A;  4DN4 M;  3FEW X;  2YU9 H;  1G51 A;  4IJL A;  4IFD G;  2JA5 H;  1B70 B;  1LTA D;  2EYJ A;  2P5Z X;  1TS5 A;  1AZQ A;  2C9O A;  3G48 A;  3LNN A;  4DV3 Q;  3D8G A;  2N49 A;  1BF4 A;  1AH9 A;  2JA8 G;  3PIO A;  1VQF A;  4GZY C;  1SE2 A;  2JQO A;  3CHB D;  4RH6 A;  5J22 A;  3C3L A;  2Q2T A;  2K32 A;  4WRD A;  3STB C;  1VQK A;  1FNW A;  1OXS C;  5E1F A;  2IHF A;  4IUT A;  4A75 A;  2R3Z A;  4HN7 A;  3BZK A;  1YNJ D;  2ZJR A;  2AMC B;  2R7Z H;  1BQQ T;  4X66 L;  3M85 A;  3K0Y A;  1IL8 A;  2X6L A;  3Q23 A;  1CKM A;  1EYG A;  1EY4 A;  1VQC A;  3J80 L;  1CZG A;  2E75 C;  2NVX B;  1S5C D;  2QW7 A;  2PPB C;  3S17 H;  1LUZ A;  1SBB B;  3CF5 A;  3PIO 3;  5IYD H;  3RLF A;  1IW7 C;  2PMZ B;  3U4Z A;  4G7H C;  3K5M A;  4XXE A;  1Y8O B;  4JI5 L;  1CZW A;  4DR6 Q;  3T13 A;  2R7D A;  1DCZ A;  3IAY A;  5FK9 C;  1LV9 A;  1X55 A;  2PNR C;  4DR3 Q;  4O1N A;  4ILW A;  3RLO A;  2EOT A;  2F0O A;  2GVB A;  2L15 A;  3OW7 A;  4LW1 A;  2A69 C;  2RDG A;  1GJX A;  1JE5 A;  5EKL A;  1STA A;  4RKB A;  4K2L A;  1TY2 A;  4LUZ A;  1K8M A;  1LT6 D;  4YWM A;  1A15 A;  1JB3 A;  1PH2 A;  3I55 A;  1G2S A;  5ELE A;  3S1R B;  5FKA C;  3J7A 5;  1D1I A;  1WI5 A;  4YCU A;  3HOZ B;  4QIW B;  3J81 i;  1PZK D;  1XYI A;  3NQI A;  2WII B;  2F0P A;  3FKI G;  4L5Q A;  1X3F A;  1D7Q A;  1QE6 A;  1I50 B;  5JJI A;  4DK1 A;  1WTR A;  3H94 A;  1KDB A;  2K7V A;  3K81 C;  2ZXP A;  3OOC A;  4ZRZ A;  3HOV B;  3S16 B;  3EN2 A;  2AWO A;  2EE1 A;  2MQH A;  2Q8R E;  3DM1 A;  3NEL A;  3PV0 A;  4JW0 A;  3ICE A;  3RZO H;  1PVO A;  4X64 Q;  2ENB A;  3CPW A;  4XDX A;  5IP9 G;  2E2D C;  5M9O A;  3LWU A;  2FMM A;  5IGC A;  5ISR A;  2E76 C;  1E2V A;  4N9T A;  3PMF A;  3VR6 A;  5IY0 A;  1EY8 A;  3K7U C;  3SDZ A;  5D65 A;  1JJC B;  3IL8 A;  4U68 A;  1JQY D;  3CP0 A;  1TS2 A;  4L5S A;  4HID A;  4JBW A;  3EIV A;  3HFZ B;  3I4N H;  1JOQ A;  2BDN A;  1VQG A;  1GUT A;  3HOX H;  3TS2 A;  2CQO A;  1RIP A;  1GOZ A;  2CHB D;  4JOI A;  3URY A;  1SFO B;  3KBX A;  1HR0 Q;  4QGU A;  4WJ3 M;  1Q1E A;  1TWA H;  4P73 A;  1L0X B;  2E74 C;  5D14 A;  1YJ9 A;  1N34 Q;  1YNN D;  5LL6 X;  4A3D H;  3CPF A;  1F2Y A;  3HEJ A;  4DV6 L;  2C35 B;  1QCB D;  4IPC A;  3A5U A;  2Q2H A;  4L8J A;  4C3H G;  3LX0 A;  1TII D;  4BA2 I;  3CMA A;  1NJI C;  2Q8I B;  5M5W B;  3RD4 A;  3GTG B;  2IHE A;  1PYS B;  3F2U A;  3X3M A;  3K5N A;  1OXU A;  1VQ7 A;  3HKZ E;  2RBM A;  2AUK A;  3S2H H;  2EXZ A;  4ZUJ A;  2B2T C;  1M90 C;  1X3Q A;  3DWP A;  4KMU C;  1DGS A;  1XPU A;  4KKU A;  3RNU A;  4DR7 L;  3KLR A;  3HZX A;  5BR8 L;  2KHJ A;  3EQL C;  1EIG A;  1VF5 C;  4DV6 Q;  4A93 G;  1X9N A;  2O4X A;  3STB D;  4XQJ A;  1VQH A;  2Z6K C;  1WD1 A;  4IOC A;  2SOB A;  4B3R L;  3M4O H;  2XGT A;  1B3A A;  1V1O A;  5DAU A;  1TKW B;  3CU7 A;  3T1H L;  3U4V A;  1BOS A;  2OCE A;  4O0A A;  2F0W A;  5FLX E;  3SR1 A;  1ILP A;  2WB1 B;  4O2D A;  1HA5 A;  4YWK A;  3W5O A;  3JAM L;  4R4Q A;  3OPO A;  2GVA A;  2A6H C;  2K50 A;  3N6R A;  3VDY A;  4A3M H;  2MFI A;  4B3S L;  1IW7 D;  4YY3 L;  4Y7N B;  2CQA A;  1PDQ A;  1U0L A;  1F9R A;  4DV2 Q;  4B3R Q;  2GA4 B;  1YBY A;  4DXF A;  2UUC L;  3QIA A;  4YIJ A;  4KK7 A;  4A3F B;  1SE4 A;  1BDO A;  2Z6B A;  1EU3 A;  2RF4 A;  1EFW A;  2NZ1 D;  1W3S A;  3H6M A;  1EIF A;  1U9R A;  1X54 A;  3M4Q A;  2UU9 Q;  1UAP A;  1KRT A;  1Y1V H;  3GTJ B;  2DY8 A;  2ES2 A;  4QL5 A;  1PYW D;  3PO3 H;  2SNS A;  2JA5 G;  3A7A B;  4HIO A;  1CUK A;  3GTK B;  5M5Y B;  3KOJ A;  5IYC H;  4TQU S;  3DMU A;  3SK8 A;  1HNW L;  2TMP A;  4EGV A;  4LF6 L;  5CC4 A;  1S40 A;  3IFD A;  4RHR A;  4BS9 A;  3HRZ C;  3RMH A;  4DAY B;  2K5H A;  4R4T A;  3JC6 6;  3G4S A;  1M8A A;  3T51 B;  1PRT B;  1PRT C;  3R8B A;  4JI0 L;  3K57 A;  1I94 L;  5DM6 3;  2WIN B;  4NXN L;  1SEB D;  4XIG S;  4APV A;  1BCP B;  3T4A C;  1BCP C;  3NTH A;  1EQQ A;  3NE5 B;  1YIT A;  2R7Z G;  4BY1 H;  3CW2 C;  2NN6 H;  1STB A;  3KLW A;  2Y0S G;  2RA4 A;  2XRS D;  4LF6 Q;  1AE2 A;  4H44 C;  4K6L A;  1VQM A;  2EQS A;  3PF5 A;  2F1M A;  4HCS A;  4KD4 A;  5ELB A;  3TME A;  3DHQ A;  5IYD G;  1SE8 A;  1KXL A;  1WFQ A;  1O80 A;  2E2I H;  3PUW A;  1U4P A;  4DV7 Q;  4IZ8 A;  1C9O A;  2B2Y C;  4DR2 L;  2BA0 A;  3GTO B;  1SN8 A;  3HS0 C;  4DAP A;  5J39 A;  5COR A;  4HCE A;  3AB9 A;  3HOU H;  1YJN A;  2A5H A;  4U67 3;  1SNM A;  1JIC A;  1J5E L;  3U50 C;  3OSO A;  2F4V L;  5CMD A;  4UHV A;  1TWC H;  3KF8 B;  3U58 A;  2BA1 A;  2F0E A;  3MTS A;  3I73 A;  3VA7 A;  4KN7 C;  4DR2 Q;  1QG7 A;  4QIW E;  2WKD A;  4C3H B;  4ZKB B;  2UXB L;  4QUC A;  3UDF A;  3QG1 A;  4FO2 A;  1ESF A;  3CQZ H;  1HTL D;  3W3A A;  3T1Y L;  1II3 A;  4LF9 Q;  5CV9 A;  4JV5 L;  4N8X 1;  1IYV A;  1LAC A;  2B2U C;  1JT8 A;  2DGY A;  3H15 A;  2A6E C;  4DK0 A;  2EJG C;  4IUQ A;  5IT9 c;  3RUZ A;  1HJP A;  3GTQ H;  2HIX A;  4A93 B;  1Q3L A;  1ZYR C;  4LFC L;  2TSS A;  3NPP A;  1IZ6 A;  2YYZ A;  1SJE D;  5KYL A;  1LYL A;  5EGT A;  2RSO A;  5ELN A;  2B2T A;  2KA7 A;  2VQF L;  1MD2 D;  5DLQ E;  3GTM H;  2Z0S A;  3DUZ A;  2E2J H;  2EYP A;  5EPL A;  4DNI A;  3RN5 A;  3ERS X;  1A62 A;  4RHS A;  2FFK B;  4AQY L;  3DWQ A;  4JV5 Q;  2F3W A;  3D6C A;  3GP7 A;  1FNV A;  4O42 A;  3VR3 A;  3KF6 B;  4ZQ3 A;  4LJZ C;  1V8Q A;  1G29 1;  3PSI A;  4POG A;  5CR3 A;  1QNK A;  3I4N G;  3I70 A;  1J9O A;  1WYD A;  3D6W A;  1TS4 A;  1XXG A;  4N9P A;  4TSS A;  3HOX G;  2PYK A;  3SE0 A;  4DR4 Q;  5I2X A;  2A6H D;  1SNP A;  3CC7 A;  2F0K A;  1BKB A;  3W1B A;  2QA4 A;  3IKJ A;  1QZG A;  3PCO B;  4DAV A;  1XMO L;  2PZU A;  1PTO B;  1I3Q B;  1PTO C;  4PG3 A;  3C1F A;  4CJ2 C;  3DEO A;  3OTO Q;  2K05 A;  1Y69 U;  1VQL A;  2MHV A;  1JR0 D;  3EJI A;  2E5L Q;  4GLA C;  2JE6 I;  5C4X H;  1SXT A;  3QOJ A;  2B2V C;  1HR0 W;  2JA5 B;  2XWB B;  3ZJY C;  1B9M A;  3WWV A;  4HJ7 A;  1D5Z C;  3NEM A;  4J6H A;  1YEZ A;  4GS3 A;  1IBL L;  3BDC A;  2NVQ B;  2F0J A;  4G7O C;  2V1C C;  4KHP L;  2JA6 H;  2EZV A;  1XMO Q;  4IUR A;  4CKB A;  4HMJ A;  4LNQ A;  2KED A;  1E24 A;  4JVZ A;  5EAY A;  4J1M A;  5C0X J;  3PF4 A;  3I8Z A;  1S5E D;  2Z4H A;  2L55 A;  2KCT A;  2R7Z B;  2B8F A;  5GAE C;  3SK4 A;  1ICW A;  4DAY A;  2F0Q A;  1OTC A;  4FVM A;  1PRT D;  2Y0S B;  2UXD Q;  1MHW C;  4ME3 A;  1IBL Q;  3UDG A;  1E7Z A;  2R61 A;  1EIY B;  2D62 A;  3S17 B;  1RD9 D;  4JI6 Q;  1BNZ A;  1QVF A;  1X3E A;  2WB1 E;  4DV1 Q;  1RJT A;  3CCS A;  3S1N B;  1IKM A;  2HCC A;  4K5V A;  2F03 A;  4FXG C;  5A2Q E;  4MIU A;  5I4D A;  3CCU A;  4A3M G;  3K5O A;  3FP9 A;  3K8A A;  4JBJ A;  1ILQ A;  4OIK A;  5JJZ A;  2IX1 A;  1FNU A;  2CCZ A;  1YHB A;  1HXY D;  2KVM A;  4UPA A;  3OMG A;  5GAG C;  4XTC S;  5IE8 A;  2JSO A;  4C3J H;  1TU2 B;  2MGS A;  4F87 A;  5FLX L;  1CFM A;  2HT1 A;  1B8A A;  2N78 A;  1IHZ A;  1Y1V G;  4UAI A;  3PO3 G;  4LAA A;  2XRQ D;  4FNF A;  1SDF A;  1AFP A;  5IYC G;  1KD1 C;  2DJF C;  5E3F A;  4K8J A;  2DNE A;  3NUC A;  3UE0 A;  4AYB G;  4NXM L;  3MEH A;  1SMY C;  3KF8 A;  3Q0A A;  1XJV A;  2K03 A;  5I6W A;  1WTH A;  3Q6S A;  3HOW H;  4EX5 A;  1E0B A;  3CCJ A;  2IY5 B;  2KJX A;  1F9P A;  1PYB A;  1HQM C;  2V4D A;  2H5X A;  3DLL A;  2PZT A;  2EJM A;  3GV6 A;  5CV7 A;  4ULL A;  5C4J H;  4H0L C;  3WDN A;  3MFY A;  3CCM A;  2QEX A;  4JOI C;  3RZO B;  3QOL A;  4A3J H;  3M4Y A;  1OXT A;  4EQO A;  1A3V A;  5LL6 S;  2CKZ B;  2A6E D;  5C3E H;  5K5P A;  4A3G H;  2B2U A;  1GD7 A;  2D0P A;  2HD3 A;  4K5X A;  5GQO A;  4LMQ D;  1ZYR D;  2I5L X;  2PQE A;  4HMI A;  1Y1W B;  4QUF A;  1HNX L;  2RQX A;  4DV5 Q;  2JA7 H;  2AQ2 B;  4CDD C;  3AYH B;  1T5E A;  2HQL A;  5JEA G;  1AZP A;  3J81 c;  4DK3 C;  2QKI C;  1OO9 B;  2NZO A;  4ZKC B;  1EEF D;  4A3I H;  2XTI A;  3HOX B;  4DNT B;  3HOU G;  2XSC A;  2AWN A;  3I56 A;  4LF5 Q;  4RKL A;  2KCC A;  1GUO A;  3KF6 A;  1LLR D;  4KHV A;  4KKT A;  3NEN A;  3S14 H;  5BN5 A;  3L7Z C;  1FD7 D;  5LHY 1;  3D3R A;  4CJ0 B;  4G7Z C;  2B63 H;  1SRO A;  4A3K H;  4K8I A;  3MXU A;  4A3D B;  2NZH A;  4C56 C;  1DJR D;  5F2D A;  5J3B A;  3Q24 A;  1PTO D;  4YCV A;  1LO5 D;  2O2L D;  3V96 A;  2ZTE A;  4TKO B;  4UP8 A;  1QVG A;  1GHJ A;  4DU9 A;  1GUN A;  2NTS A;  1SSO A;  3K58 A;  1C7Y A;  2F0L A;  3BU2 A;  3MXN B;  2KEC A;  3S2H B;  3G7L A;  1WTW A;  1I4R A;  2B2V A;  1S5B D;  1Q1B A;  1SMX A;  2JXM B;  2IWH A;  5HY6 A;  2VW9 A;  5IOD A;  3VYS A;  5C5L A;  1ZXT A;  1HZC A;  4I7A A;  3P1H A;  3I3C A;  1JWU D;  3VA5 A;  1UNS A;  3A55 A;  2NVY H;  3M4O B;  4N8F A;  3LGJ A;  1LTT D;  4X66 Q;  2LXK A;  4LF8 L;  2K14 A;  2ZTD A;  3ERO A;  1K83 H;  5CBE E;  5JAV A;  3OHX C;  1YNX A;  2CWP A;  2MP1 A;  2A74 C;  5KND A;  3IFT A;  4EVO A;  1MIU A;  2WAQ G;  4C3I H;  1VCI A;  4K6D A;  5EPJ A;  4JI1 L;  1HCZ A;  4JI5 Q;  2N55 A;  3H3V C;  4DV4 L;  3NP8 A;  2ZXO A;  5KNC A;  4RG1 A;  1GXD C;  5ELC A;  4JI8 L;  2LS0 1;  4OHJ A;  2EXD A;  2PQA B;  4B3T L;  3AFP A;  4C2M B;  4G4K A;  4LF8 Q;  4IJH A;  4PMW A;  1XNR L;  4GLV B;  3G71 A;  2D9U A;  1SNC A;  4KHZ A;  5NUC A;  1JJG A;  3O13 A;  3QWN A;  1H9M A;  2LKV A;  5JJL A;  1Y1V B;  4CDE C;  3NWT A;  4LK1 C;  5C4X G;  3MXP A;  4I7Z C;  5EJW A;  3PO3 B;  1C8C A;  2LSS A;  4HIK A;  4JI1 Q;  3U9O A;  4JK1 C;  4RGO S;  2O5I C;  4DUZ L;  3CCV A;  4DV4 Q;  3K7A H;  4AYB B;  4ALP A;  1WTX A;  5HGQ A;  5EPK A;  3SVM A;  2EY6 A;  4J8Q A;  1LTI D;  5T1I A;  1JMC A;  2JA6 G;  3MZ5 A;  4LF7 L;  2XNA C;  1IYJ B;  1TS3 A;  3F2C A;  4B3T Q;  1XPO A;  4DPG A;  5IWA L;  5LMN L;  4P2C B;  2K01 A;  1F2Z A;  1XNR Q;  2MO1 A;  4QF4 A;  1VQ6 A;  4WOR A;  1SMY D;  1SNO A;  3S15 H;  3J7Y W;  3VYU A;  1S4Z A;  3J81 E;  1PH4 A;  1UWV A;  4BY1 B;  4ABN A;  2QF7 A;  2FIN B;  1J8I A;  3A8J E;  4NKL A;  5I2Y A;  3S2D H;  3I72 A;  4HTH A;  5EBC A;  2Y0S E;  5EQ0 A;  1VMP A;  1E22 A;  3PUZ A;  3I4M H;  1QOH A;  2K33 A;  1A0I A;  1WVL A;  4GNX B;  1SNQ A;  4FF2 A;  3F8T A;  2AKW B;  1Q8K A;  5IGF A;  1BBU A;  2AQ3 B;  1VQD A;  2Z9H A;  1O7Z A;  3C1E A;  1N9W A;  3KLS X;  3K0X A;  1GUG A;  2PI2 A;  1A6X A;  2D5D A;  4UP9 A;  2AHO B;  3J7A V;  1FJG L;  3HOU B;  1MJC A;  3RR5 A;  5DM7 3;  3R2I A;  1CKO A;  4P74 A;  4OX9 L;  2HHH L;  1GO3 E;  1PFN A;  1TY0 A;  2FHT A;  3E9I A;  3PO2 H;  2IL8 A;  2I5H A;  3E0J A;  3KJP A;  1Q8I A;  3C2P A;  2JA8 B;  1QZH A;  2YV5 A;  2JK8 A;  3NTK A;  4C3J G;  4K0K L;  3ONA B;  1TWC B;  1F77 A;  3MAQ A;  2PZW A;  1S3O A;  1EU4 A;  3L3O C;  4JBK A;  2RSN A;  2CW0 C;  1DOK A;  5JPN C;  2A68 C;  1VQJ A;  5J1Z A;  2KBN A;  4PZ8 A;  1E3P A;  1HHV A;  1BVS A;  5A2Q L;  1SND A;  2F4I A;  4I65 A;  3V05 A;  5G3L D;  4IFD J;  4NPS A;  3J80 c;  2KCN A;  4OX9 Q;  3CQZ B;  3GDE A;  2JEA I;  1CQV A;  1FR3 A;  4ZLT F;  4MZ9 A;  3HOW G;  1RDP D;  1VS0 A;  3PIP A;  1V9P A;  2OEO A;  5DEH A;  1PMR A;  3HP3 A;  3RZD H;  2C5C A;  1D5M C;  2K5W A;  2NTT A;  3F2B A;  3GTQ B;  1Y8N B;  2LFN A;  1NE3 A;  4A3J G;  4JI3 L;  3TP7 A;  3MXN A;  4OWX B;  4DR7 Q;  4HAE A;  5BR8 Q;  5C3E G;  2PW5 A;  1RCV D;  1EZ8 A;  1LTG D;  4IUP A;  1PH9 A;  4A3G G;  3DEP A;  3GTM B;  4UY8 C;  3NK9 A;  2E2J B;  4MNO A;  2PI2 E;  1LTS D;  1SLJ A;  2XN9 C;  3T1H Q;  1F2L A;  4RA8 A;  3TSS A;  2JA7 G;  1I4H A;  1ICF B;  3SK5 A;  3PIP 3;  1IL2 A;  3I91 A;  2WAQ B;  1ML0 D;  3CXC A;  4RFB A;  2BH2 A;  1K28 A;  2A69 D;  1WTQ A;  5IGB A;  1TWH H;  1SYB A;  1GVP A;  4A3I G;  2R6G A;  4B3S Q;  3CRK C;  3OW2 A;  4IN3 A;  1I4G A;  4YY3 Q;  4FDB A;  1TQO A;  1C48 A;  3MEF A;  3NQT A;  3P75 A;  4OWW B;  3FVQ A;  2EYM A;  5E4W C;  4WFN 3;  3A56 A;  3FKI B;  2UUC Q;  4Y52 H;  2B63 G;  1LT3 D;  4A3K G;  3HG9 A;  1H9S B;  2BDO A;  3L0O A;  5C4X B;  1I50 H;  2Z4I A;  1EOV A;  3E0E A;  2KUM A;  3IRB A;  2ZTC A;  1KIX A;  1Z6H A;  2PQA A;  4AH6 A;  2M2L A;  2O5J C;  1HQR D;  3ULL A;  5M5X B;  2R93 H;  5IOC A;  4DAM A;  2F0T A;  1SAP A;  2QEJ C;  2JJQ A;  1QVC A;  3BVM A;  2RHS B;  1ET9 A;  3A7L A;  4CBV A;  4DGZ A;  2JA6 B;  2RHQ B;  2RDF A;  1FGB D;  1IBK L;  1HNW Q;  1M1K C;  2J4X A;  4K2K A;  1Y14 B;  1JOK A;  3R3O A;  1PXU A;  3J80 i;  4ODG A;  1KAA A;  5IGG A;  4R8I A;  3I4O A;  1JWM D;  2PMZ E;  1O78 A;  2X69 A;  1L0Y B;  4A76 A;  4JI0 Q;  5JEA H;  1GUS A;  3A8K E;  4M1U B;  4CDC C;  5IIF A;  1I94 Q;  4NXN Q;  2B39 A;  3HKS A;  5D3D A;  2G5D A;  3MXG A;  4CJ1 B;  1WCM H;  3M9B A;  1EUJ A;  1A2T A;  1T9H A;  2BOS A;  1IBK Q;  2F3V A;  1EQR A;  1IXR A;  1YZ6 A;  2K28 A;  3C46 A;  1QIL A;  1PH6 A;  3SHL A;  3S1Q H;  5FJ8 H;  2Q8T A;  2SEB D;  1CI3 M;  2ICE C;  1XMQ L;  4C3I G;  2M9V A;  1B1Z A;  4JI2 L;  1IBM L;  1I6H H;  3VR5 A;  4GNX A;  4NDX A;  4GOP B;  4GOP C;  1KL9 A;  3HOY H;  4OEL B;  1KQS A;  3ERQ A;  2F0F A;  3J81 j;  1PH3 A;  3DM3 A;  1VDZ A;  1QB5 D;  1R4Q B;  1HRJ A;  4GLX A;  1KNA A;  4LWC A;  4C3J B;  1AN8 A;  3TN2 A;  3HKZ G;  3UI2 A;  1J5E Q;  4XT3 B;  2ALY B;  2DJG C;  4TRD A;  2F4V Q;  1EOT A;  4UDU C;  4HJ8 A;  4JC0 A;  1KC8 C;  1XMQ Q;  1JWS D;  5KRU A;  3H3V I;  2H1E A;  1YI2 A;  1B2T A;  3KBG A;  3S24 A;  2ASB A;  4POF A;  4X62 L;  1IBM Q;  1VQB A;  2DY7 A;  1EQV A;  5C4H A;  4KTA A;  3I90 A;  2E2H H;  3GTP H;  3HOW B;  2UXB Q;  1RKN A;  1K73 C;  2IX0 A;  3H0G H;  1JE4 A;  2VZA A;  2A68 D;  3I7F A;  3TZU A;  4JYA L;  2N3S A;  1STG A;  3PQI A;  1MKH A;  5AJ3 L;  4JBM A;  4R1J A;  2VUM H;  1EY6 A;  1R4P B;  2DNC A;  2D0O A;  4X3T A;  3T1Y Q;  2F0G A;  3RN2 A;  5C4J B;  1HZ9 A;  2ICI A;  1WTV A;  1X56 A;  1G6Z A;  1JOR A;  4ZYS A;  5LMU L;  1STN A;  2OWO A;  3GQB A;  4LFA L;  1CHP D;  3M7N A;  1ENA A;  5C3E B;  1STH A;  3RLN A;  3U9S A;  3BZD B;  1G6P A;  3I4M G;  4LFC Q;  1TT2 A;  1P8L A;  1AE3 A;  2J7Z A;  3D4R A;  3GD7 A;  4QCL A;  1E1T A;  3VYR A;  2VQF Q;  1NR4 A;  1JB7 A;  3BYY B;  1DOM A;  1GHK A;  4UP7 A;  3T56 B;  5M3M G;  4A3F H;  1GKH A;  4AQY Q;  1Q7Y C;  3J7A F;  1LM0 A;  1S5F D;  5I6Y A;  1CTM A;  2MPM A;  3EBE A;  2Z8L A;  3A74 A;  4HED A;  4A3I B;  3OIQ A;  2YU9 B;  3GTJ H;  2OXP A;  3J81 L;  2VS1 A;  2VB3 X;  1WJJ A;  3D31 A;  2EY5 A;  3PO2 G;  3MWY W;  4DKA C;  1S72 A;  5E4X A;  4GN3 B;  3BS1 A;  2UUB L;  1V43 A;  1DYQ A;  3KFU A;  4P71 A;  2NB0 A;  1KLG D;  2K75 A;  4OO1 I;  3AU7 A;  3KK7 A;  2RCN A;  3CCE A;  3KYH C;  2UXC L;  4XQN A;  3TP8 A;  1LTR D;  5ELO A;  2JYO A;  4PMC A;  3BYT B;  4KY7 A;  3NBH B;  3T53 B;  1KRS A;  4DUY L;  1L0W A;  3R93 A;  1PH1 A;  3A54 A;  3L2P A;  4F8M A;  1EWI A;  2I0Q A;  1SR3 A;  4P72 A;  3CME A;  3CKI B;  4ZCK A;  4B9X A;  1CKN B;  2B29 A;  2F52 A;  1H9S A;  2UUB Q;  1E2Z A;  1H9R A;  1EYD A;  1BCP D;  3PGZ A;  2XWJ B;  5H1S E;  4DR1 L;  4KHP Q;  2JN4 A;  1PLF A;  3HGB A;  1ASZ A;  2F0M A;  3D4D A;  1BXT A;  3OMC A;  4BBS H;  4C1N I;  3S1M H;  5FO7 B;  2AQ1 B;  2NVY B;  3JAM i;  1XTD A;  1JCK B;  3K59 A;  4BXX H;  4R4O A;  3A0J A;  3GTO H;  1E1O A;  2CH4 W;  1B3Q A;  1CA6 A;  1QNU A;  2IW3 A;  4GKK L;  1SYG A;  1K83 B;  1X32 A;  1E2W A;  3M3Y H;  5M3F H;  2ATW A;  1D1K A;  4DR1 Q;  2BE5 C;  1SJH D;  3TEH B;  1N32 L;  1X6O A;  4C3I B;  3I2Z A;  3Q8D A;  4IQZ A;  2GN5 A;  4OON A;  2ZJQ A;  2R92 H;  3TRZ A;  3TRE A;  2ZXR A;  5FO9 B;  5IT9 E;  4RMF A;  4MHE A;  3K6O A;  2EYF A;  1NSN S;  4GKJ L;  1VQ5 A;  4MTK A;  3M4P A;  1EL0 A;  1HZA A;  1KAB A;  3QJY A;  1TWF H;  1P16 A;  3HKZ B;  4BY7 H;  5GRO A;  1PFB A;  4ZK9 B;  1XNQ L;  1ESR A;  4FF1 A;  4GOP A;  3CCQ A;  1BBX C;  5COY A;  1SRU A;  4KKS A;  5CV8 A;  5JOB A;  5L37 A;  4RAU C;  1A2U A;  1L1O B;  1H95 A;  1L1O C;  4KY6 A;  2R93 G;  4QMG A;  3K7A B;  1DOL A;  4WJW A;  2A1A A;  2JP1 A;  4OWT B;  4V19 0;  3KUP A;  3D4W A;  4GKJ Q;  1TXY A;  2HIV A;  3BZC A;  5I9O A;  4NXM Q;  5IGE A;  3A5Z B;  4HJ9 A;  4RGT A;  1GUW A;  1QUQ B;  3S15 B;  1KDC A;  1Z47 A;  3MFG A;  2CFM A;  4DR5 L;  1RTO A;  2LXJ A;  4RGM A;  4HSP A;  2WV6 D;  1UEA B;  3GTL H;  3S2D B;  1LT4 D;  1X3G A;  2H4O A;  2SNM A;  3TP6 A;  1PA6 A;  2B8G A;  4XQQ A;  3I4N B;  1RF2 D;  1WCM G;  4DK6 C;  1VQ9 A;  1I6V C;  4DV3 L;  2K6A A;  1I4P A;  2WFW A;  2EYL A;  4L5T A;  2N8N A;  5BN4 A;  1TWA B;  2OF1 A;  5FJ8 G;  2AUJ D;  2L1B A;  3PUV A;  4OO1 G;  1I4X A;  1XWE A;  1HNX Q;  3BVG A;  2K5D A;  1LTB D;  2VL6 A;  2B2W A;  3P7J A;  1JOO A;  3HOY G;  1DM0 B;  3PO2 B;  1HUM A;  1MSH A;  2NBF A;  3BG3 A;  2NVQ H;  1UUP A;  4L63 B;  1ET6 A;  4KJO A;  1PH8 A;  1UE7 A;  5C44 H;  1Z9F A;  1W6J A;  1D6E C;  4AIM A;  2K5Q A;  3MHB A;  1BO0 A;  3BVZ A;  4DR6 L;  1B4O A;  3UDI A;  1EY0 A;  4DA2 A;  4IOA A;  1JC7 A;  4R8N A;  3T16 A;  3SK6 A;  5CV5 A;  4DR3 L;  5D3I B;  1EYC A;  2F0D A;  3ND8 A;  3H0G G;  2LY7 A;  3NBH A;  3KDF B;  3Q22 A;  2VUM G;  5CV6 A;  1AP0 A;  1PHJ A;  3RZD B;  1EZ6 A;  4G57 A;  4F88 A;  5E7N A;  3DWA A;  2NVT H;  1RHP A;  2WB1 G;  4PMB A;  3S1N H;  2PNH A;  5GAD C;  1HFN A;  2I46 A;  1CKN A;  2L9H A;  4A3B H;  2KHI A;  4A3M B;  5FLM G;  3TP5 A;  3G6E A;  2R7F A;  3OIP A;  1BBW A;  4BBR H;  1Y8P B;  4S3S A;  5K36 H;  1V1Q A;  3GV3 A;  1TWG H;  1NAP A;  1I4Q A;  3CCR A;  4CKE A;  5JVH 3;  5AFW A;  5EBD A;  1N33 L;  4A3C H;  5FLX c;  4JI4 L;  4A3F G;  1EYA A;  4YCW A;  1K8A C;  1LT5 D;  2A8V A;  4FXK C;  2L12 A;  1TWH B;  3BDO A;  2XIW A;  1ZKO A;  4PQX A;  2DUD A;  5JVG 3;  2BE5 D;  4X64 L;  1HH2 P;  4EQ5 A;  4NW2 A;  4DXG A;  2OTL A;  2YTV A;  2HCI A;  1SYF A;  4JI8 Q;  1C4Q A;  1VMC A;  2EYO A;  2Z1C A;  1N33 Q;  1ASY A;  4FXD A;  4JI4 Q;  4HJA A;  5C0X I;  4A3E H;  1CM9 A;  2A19 A;  1WTO A;  3D0F A;  1ROD A;  1O7I A;  4V0B A;  1A63 A;  2R93 B;  1IKL A;  1R9T H;  4IUU A;  4PV1 C;  1CA5 A;  2K4K A;  5KEE A;  4FP5 D;  4DV0 L;  2IPK D;  2HQE A;  2RDH A;  4DUZ Q;  2YTY A;  4LFB L;  4OIJ A;  1HR0 L;  1SYD A;  4NB3 A;  4GNX C;  4LF7 Q;  3OYY A;  4IUN A;  1MI2 A;  5C5M A;  1L1O A;  4BA1 I;  1PRT F;  5IWA Q;  5LMN Q;  3OWE B;  1Y1W H;  2E2I B;  1EY5 A;  1DZ1 A;  4BBS G;  5M3M H;  1N34 L;  1BCP F;  5ELF A;  4OXP A;  4R4C A;  4BXX G;  1B7Y B;  1CT1 D;  1WCM B;  4YHH L;  1FGU A;  3P20 A;  4JI7 L;  2FMC A;  2YTX A;  4OEM B;  1QUQ A;  3BJU A;  4DV0 Q;  1D5X C;  3CC2 A;  4WJ4 A;  3NXW A;  1SYC A;  5M3F G;  5CGK A;  4LFB Q;  4LUO A;  3E3X A;  3UDX A;  3S1Q B;  1H9K A;  2EPB A;  1KNE A;  2EJF C;  2FXQ A;  3FMC A;  1GM5 A;  4X3S A;  4B08 A;  3E6Z X;  1KDA A;  2R92 G;  1I6H B;  5JEA J;  1K3B C;  4X3K A;  3W1G A;  3LWE A;  3HOY B;  1X65 A;  5EKI A;  4YHH Q;  1LTL A;  4JI7 Q;  1K8O A;  2EYH A;  3TQY A;  1FJG Q;  2IJ0 A;  1Q90 A;  2HHH Q;  1I5F A;  2F0V A;  2BH8 A;  5DNF A;  4BY7 G;  2A73 B;  1H9J A;  1NMG A;  4R9W A;  2NUC A;  4QY7 A;  2KQ3 A;  4K0K Q;  2NVX H;  2JA9 A;  1PFM A;  3SEB A;  1JJ2 A;  3QB3 A;  3SGI A;  4PZ6 A;  1PZI D;  2K04 A;  4A3L G;  1G8Z D;  1S5D D;  5HUR A;  2E2H B;  2N88 A;  4KV6 A;  3GTP B;  2L0C A;  4BWG B;  1W2B A;  5IT9 L;  1PV4 A;  3H0G B;  3GO5 A;  4DV2 L;  1HTP A;  2QGQ A;  1AEX A;  1EWH A;  3VR2 A;  3KJO A;  1NR2 A;  3TS0 A;  1F2M A;  1B53 A;  2VUM B;  2K5V A;  2VY3 A;  4GN5 A;  5ELD A;  2WP8 J;  4A4I A;  3TDQ A;  1NNX A;  1B9N A;  1DON A;  4X3U A;  2UU9 L;  3NSW A;  1ONL A;  4TVA B;  5CV4 A;  2PW7 A;  1FYC A;  3KDF A;  1RTN A;  1U4M A;  3NHH A;  4JI3 Q;  3KLS A;  1O7Y A;  3H3V H;  4RWS C;  3S1R H;  4JPB W;  5JJK A;  1EY9 A;  2BCO A;  3HOZ H;  5KNB A;  4B9W A;  4RCN A;  1OXX K;  2ZM6 L;  5IYB H;  1MJE A;  4C2M H;  4CDF C;  4KN4 C;  1SE3 A;  4KLK A;  4K14 A;  5C4Z A;  3ER0 A;  3W2D A;  1K0R A;  4PZ7 A;  1MSG A;  1PFS A;  1CSQ A;  2QCP X;  2RCF A;  5C0X G;  3NWS A;  3NBI A;  2EY2 A;  1F9S A;  4KI0 A;  4DFA A;  3TBI B;  4KD3 A;  3F2D A;  1WOC A;  3HOV H;  3S16 H;  2I5M X;  4GN4 B;  3NTI A;  1YIJ A;  2B3G A;  2WAC A;  3H91 A;  4ZAI A;  2ZJP A;  2M00 A;  4L6T B;  1PTO F;  1VF7 A;  3PUY A;  3OWF A;  2ZM6 Q;  1FL0 A;  5EKK A;  4EQP A;  1KHI A;  1STY A;  3V2T A;  2MJ8 A;  5C44 G;  1KAW A;  1XX8 A;  3VYT A;  1RL2 A;  4XT1 B;  3FDT A;  2F0I A;  4YWL A;  4DV7 L;  4LUV A;  1VQP A;  3AEV A;  1O7L A;  3BDL A;  1N8R C;  1UE5 A;  1CHQ D;  2EY1 A;  3ND9 A;  2L11 A;  1TVX A;  5BN3 A;  1IYU A;  1Q46 A; 
#chains in the Genus database with same CATH homology
 4IUV A;  2PCF B;  2MUY A;  3FRP B;  4BBS B;  3S1M B;  1WTP A;  2SDF A;  4OO1 H;  2HDL A;  5CYU A;  1V1P B;  5K36 G;  3FPP A;  4Q5V A;  4H13 C;  1DXM A;  1BUV T;  4IFD H;  3G6J B;  4OGQ C;  4ZUI A;  3M3Y B;  5M3F B;  3J80 E;  1CK1 A;  2X6G A;  1TR5 A;  1HUN A;  4NP5 A;  2ZT9 C;  3VR4 A;  4OL7 A;  2L5T A;  1SYE A;  2R92 B;  2JEB I;  1U4R A;  1M4V A;  5TSS A;  1U4L A;  4NMZ A;  1Q12 A;  1D2B A;  4QB4 A;  1TWF B;  4BY7 B;  5C6A A;  2CW0 D;  2RKS A;  4KJN A;  2ID0 A;  4E6I A;  2IT1 A;  2J0T D;  1QJO A;  3TZD A;  3N52 A;  1AW7 A;  4A3J B;  1HPC A;  4MN3 A;  3MC0 B;  2HDM A;  1OXV A;  1DD2 A;  3AMU A;  2RVL A;  4A3G B;  2OT2 A;  1MGS A;  2K1B A;  2XVS A;  1NCV A;  1XTC D;  5KGU A;  1NUC A;  2B2W C;  3EA6 A;  5FO8 B;  3E5S A;  4C1N K;  2JA7 B;  1MBY A;  3ZYY X;  5T1G A;  4ME5 A;  2NN6 I;  3GTL B;  4K5W A;  2VXW A;  2NYZ D;  3S9W A;  4FYD A;  2G9H D;  3MVV A;  3I4L A;  2QIL A;  5JPM C;  3S14 B;  3FPU B;  1EY7 A;  2VNU D;  3WOF A;  2B63 B;  1YNJ C;  4A3K B;  4CHT B;  3CRL C;  2F0H A;  2CVR A;  2F0S A;  1F9Q A;  2KHS A;  2WKC A;  3K5L A;  4HR7 B;  4IFD I;  5IGD A;  1STE A;  1EIH A;  2G9D A;  5G3L F;  5C44 B;  5FOB B;  4FF4 A;  1A3T A;  3PUX A;  4RCO A;  4H7B A;  1G91 A;  5KIX A;  1G2T A;  3R2T A;  4FF3 A;  1LAB A;  2I07 B;  3H09 A;  2FJ2 A;  4CKC A;  2F0N A;  1WD0 A;  1HFG A;  2KOL A;  4Q0F A;  2NVT B;  1CQF A;  2D2C C;  1B50 A;  1B44 D;  2LMC B;  4A3B B;  2L4N A;  1T5X D;  5C3X A;  4DF7 A;  4BBR B;  3A8I E;  1TWG B;  3DXJ C;  1KLU D;  1KTK A;  4PNY A;  2EDG A;  1A3U A;  3M7G A;  2QDB A;  4XYQ A;  2DN8 A;  3EFX D;  1V1P A;  2B2Y A;  1EWC A;  1BR9 A;  1EEI D;  1ENF A;  3JAM E;  3SXH A;  3QO2 A;  4CGY B;  3L9A X;  2F0U A;  4IAL A;  1EQT A;  4HSV A;  2VB2 X;  4M8A A;  2KEE A;  4A3E B;  4EQN A;  3EVQ A;  1ENC A;  5A35 A;  3X3N A;  4KY5 A;  4F7X A;  5HGT A;  1HA6 A;  1R9T B;  2NN6 G;  1EFI D;  1W6K A;  2IX3 A;  2NWG A;  3I4M B;  1Z7T A;  1X3P A;  5C3W A;  4Z9C B;  3MA2 B;  5KYI A;  4XYO A;  1YNN C;  1PZJ D;  5M3M B;  4DNR B;  3ITP A;  1PTO H;  2HUG A;  4RGN A;  3WOE A;  1QWY A;  5CBA E;  5C0X H;  5I9P A;  4ID6 A;  2PO4 A;  1ZEQ X;  2EVB A;  4DN4 M;  3FEW X;  4IFD G;  1LTA D;  2EYJ A;  1TS5 A;  1AZQ A;  2C9O A;  3LNN A;  3D8G A;  1BF4 A;  4GZY C;  1SE2 A;  3CHB D;  4RH6 A;  5J22 A;  3C3L A;  2K32 A;  4WRD A;  1FNW A;  1OXS C;  5E1F A;  4IUT A;  2R3Z A;  4HN7 A;  1YNJ D;  1BQQ T;  3M85 A;  3K0Y A;  1IL8 A;  2X6L A;  3Q23 A;  1EY4 A;  3J80 L;  1CZG A;  2E75 C;  2NVX B;  1S5C D;  2PPB C;  1SBB B;  3PIO 3;  3RLF A;  1IW7 C;  2PMZ B;  4G7H C;  3K5M A;  4XXE A;  1Y8O B;  1CZW A;  3T13 A;  1DCZ A;  3IAY A;  5FK9 C;  1LV9 A;  2PNR C;  4O1N A;  4ILW A;  2EOT A;  2F0O A;  3OW7 A;  2A69 C;  2RDG A;  1GJX A;  5EKL A;  1STA A;  4RKB A;  4K2L A;  1TY2 A;  1K8M A;  1LT6 D;  1A15 A;  1JB3 A;  1G2S A;  5ELE A;  3S1R B;  5FKA C;  1D1I A;  3HOZ B;  4QIW B;  1PZK D;  1XYI A;  3NQI A;  2WII B;  2F0P A;  1QE6 A;  1I50 B;  4DK1 A;  1WTR A;  3H94 A;  1KDB A;  2K7V A;  2ZXP A;  3OOC A;  4ZRZ A;  3HOV B;  3S16 B;  2AWO A;  2EE1 A;  2Q8R E;  3DM1 A;  3PV0 A;  2ENB A;  4XDX A;  2E2D C;  5M9O A;  3LWU A;  2FMM A;  5IGC A;  5ISR A;  2E76 C;  1E2V A;  4N9T A;  3PMF A;  3VR6 A;  1EY8 A;  3SDZ A;  5D65 A;  3IL8 A;  4U68 A;  1JQY D;  1TS2 A;  4JBW A;  1JOQ A;  2BDN A;  1GUT A;  1GOZ A;  2CHB D;  3URY A;  1SFO B;  3KBX A;  1Q1E A;  1L0X B;  2E74 C;  5D14 A;  1YNN D;  5LL6 X;  1F2Y A;  3HEJ A;  1QCB D;  4L8J A;  4C3H G;  3LX0 A;  1TII D;  4BA2 I;  2Q8I B;  5M5W B;  3RD4 A;  3GTG B;  3F2U A;  3X3M A;  3K5N A;  1OXU A;  2RBM A;  2AUK A;  2EXZ A;  4ZUJ A;  2B2T C;  1X3Q A;  3DWP A;  4KMU C;  4KKU A;  3KLR A;  3HZX A;  3EQL C;  1EIG A;  1VF5 C;  2O4X A;  4XQJ A;  1WD1 A;  2SOB A;  1B3A A;  1V1O A;  5DAU A;  1TKW B;  3CU7 A;  1BOS A;  2F0W A;  5FLX E;  3SR1 A;  1ILP A;  2WB1 B;  1HA5 A;  3JAM L;  3OPO A;  2A6H C;  3N6R A;  1IW7 D;  4Y7N B;  2CQA A;  1PDQ A;  1F9R A;  2GA4 B;  4DXF A;  3QIA A;  4YIJ A;  4KK7 A;  4A3F B;  1SE4 A;  1BDO A;  1EU3 A;  2NZ1 D;  3H6M A;  1U9R A;  1UAP A;  3GTJ B;  2DY8 A;  1PYW D;  2SNS A;  3A7A B;  3GTK B;  5M5Y B;  4TQU S;  3DMU A;  3SK8 A;  2TMP A;  4EGV A;  5CC4 A;  3IFD A;  4RHR A;  4BS9 A;  3HRZ C;  3RMH A;  1M8A A;  3T51 B;  1PRT B;  1PRT C;  3R8B A;  3K57 A;  5DM6 3;  2WIN B;  1SEB D;  4XIG S;  1BCP B;  3T4A C;  1BCP C;  3NTH A;  3NE5 B;  2NN6 H;  1STB A;  2RA4 A;  2XRS D;  4H44 C;  4K6L A;  2F1M A;  4HCS A;  4KD4 A;  5ELB A;  3TME A;  3DHQ A;  1O80 A;  3PUW A;  1U4P A;  4IZ8 A;  2B2Y C;  2BA0 A;  3GTO B;  3HS0 C;  4DAP A;  5J39 A;  5COR A;  4HCE A;  3AB9 A;  2A5H A;  4U67 3;  1SNM A;  1JIC A;  3OSO A;  5CMD A;  2BA1 A;  2F0E A;  3MTS A;  3I73 A;  3VA7 A;  4KN7 C;  1QG7 A;  2WKD A;  4C3H B;  4ZKB B;  4QUC A;  3QG1 A;  4FO2 A;  1ESF A;  1HTL D;  3W3A A;  1II3 A;  5CV9 A;  1IYV A;  1LAC A;  2B2U C;  2A6E C;  4DK0 A;  2EJG C;  4IUQ A;  3RUZ A;  4A93 B;  1Q3L A;  1ZYR C;  2TSS A;  3NPP A;  2YYZ A;  1SJE D;  5KYL A;  5EGT A;  2RSO A;  2B2T A;  2KA7 A;  1MD2 D;  3DUZ A;  2EYP A;  5EPL A;  4RHS A;  2FFK B;  3DWQ A;  2F3W A;  3D6C A;  3GP7 A;  1FNV A;  4O42 A;  3VR3 A;  4ZQ3 A;  4LJZ C;  1V8Q A;  1G29 1;  5CR3 A;  1QNK A;  3I70 A;  1J9O A;  3D6W A;  1TS4 A;  1XXG A;  4N9P A;  4TSS A;  2PYK A;  3SE0 A;  5I2X A;  2A6H D;  1SNP A;  2F0K A;  3IKJ A;  4DAV A;  2PZU A;  1PTO B;  1I3Q B;  1PTO C;  3C1F A;  4CJ2 C;  3DEO A;  2K05 A;  1Y69 U;  2MHV A;  1JR0 D;  3EJI A;  2JE6 I;  1SXT A;  3QOJ A;  2B2V C;  2JA5 B;  2XWB B;  1B9M A;  1D5Z C;  4J6H A;  3BDC A;  2NVQ B;  2F0J A;  4G7O C;  2EZV A;  4IUR A;  4CKB A;  4HMJ A;  2KED A;  4J1M A;  5C0X J;  3I8Z A;  1S5E D;  2Z4H A;  2L55 A;  2R7Z B;  2B8F A;  3SK4 A;  1ICW A;  4DAY A;  2F0Q A;  4FVM A;  1PRT D;  2Y0S B;  2R61 A;  2D62 A;  3S17 B;  1RD9 D;  1BNZ A;  1RJT A;  3S1N B;  1IKM A;  2HCC A;  4K5V A;  2F03 A;  4FXG C;  5A2Q E;  4MIU A;  5I4D A;  3K5O A;  1ILQ A;  4OIK A;  5JJZ A;  2IX1 A;  1FNU A;  1HXY D;  2KVM A;  3OMG A;  4XTC S;  2JSO A;  1TU2 B;  2MGS A;  4F87 A;  5FLX L;  1CFM A;  1IHZ A;  4UAI A;  4LAA A;  2XRQ D;  4FNF A;  1SDF A;  1AFP A;  5E3F A;  4K8J A;  2DNE A;  3NUC A;  3MEH A;  1SMY C;  3KF8 A;  3Q0A A;  2K03 A;  5I6W A;  3Q6S A;  1E0B A;  2KJX A;  1F9P A;  2V4D A;  1HQM C;  2PZT A;  2EJM A;  3GV6 A;  5CV7 A;  4ULL A;  4H0L C;  3WDN A;  3MFY A;  3RZO B;  3QOL A;  3M4Y A;  1OXT A;  4EQO A;  1A3V A;  5LL6 S;  2A6E D;  5K5P A;  2B2U A;  4K5X A;  4LMQ D;  1ZYR D;  2PQE A;  4HMI A;  1Y1W B;  4QUF A;  2RQX A;  2AQ2 B;  1T5E A;  5JEA G;  1AZP A;  2QKI C;  1OO9 B;  4ZKC B;  1EEF D;  3HOX B;  4DNT B;  2XSC A;  2AWN A;  4RKL A;  2KCC A;  1GUO A;  1LLR D;  4KHV A;  4KKT A;  5BN5 A;  3L7Z C;  1FD7 D;  5LHY 1;  3D3R A;  4CJ0 B;  4G7Z C;  4K8I A;  3MXU A;  4A3D B;  4C56 C;  1DJR D;  5F2D A;  3Q24 A;  1PTO D;  1LO5 D;  2O2L D;  3V96 A;  4TKO B;  1GHJ A;  4DU9 A;  1GUN A;  2NTS A;  1SSO A;  3K58 A;  2F0L A;  2KEC A;  3S2H B;  3G7L A;  1WTW A;  1I4R A;  2B2V A;  1S5B D;  1Q1B A;  2JXM B;  2IWH A;  5IOD A;  3VYS A;  5C5L A;  1ZXT A;  3P1H A;  3I3C A;  1JWU D;  3VA5 A;  1UNS A;  3A55 A;  3M4O B;  1LTT D;  3ERO A;  5CBE E;  5JAV A;  3OHX C;  2MP1 A;  2A74 C;  5KND A;  3IFT A;  4EVO A;  1VCI A;  4K6D A;  5EPJ A;  1HCZ A;  2N55 A;  3H3V C;  3NP8 A;  2ZXO A;  5KNC A;  1GXD C;  5ELC A;  2LS0 1;  4OHJ A;  4C2M B;  4G4K A;  4PMW A;  2D9U A;  1SNC A;  4KHZ A;  5NUC A;  3O13 A;  3QWN A;  1H9M A;  2LKV A;  1Y1V B;  3NWT A;  4LK1 C;  3MXP A;  4I7Z C;  5EJW A;  3PO3 B;  1C8C A;  3U9O A;  4JK1 C;  4RGO S;  2O5I C;  4AYB B;  1WTX A;  5EPK A;  3SVM A;  2EY6 A;  4J8Q A;  1LTI D;  5T1I A;  3MZ5 A;  2XNA C;  1TS3 A;  4P2C B;  2K01 A;  1F2Z A;  4QF4 A;  4WOR A;  1SMY D;  1SNO A;  3J7Y W;  3VYU A;  1S4Z A;  3J81 E;  4BY1 B;  4ABN A;  2QF7 A;  2FIN B;  1J8I A;  3A8J E;  4NKL A;  5I2Y A;  3I72 A;  4HTH A;  5EBC A;  5EQ0 A;  1VMP A;  3PUZ A;  1QOH A;  2K33 A;  1WVL A;  1SNQ A;  4FF2 A;  5IGF A;  2AQ3 B;  1O7Z A;  3C1E A;  3KLS X;  1GUG A;  1A6X A;  2D5D A;  3J7A V;  3HOU B;  5DM7 3;  3R2I A;  1PFN A;  1TY0 A;  2FHT A;  2IL8 A;  3E0J A;  3C2P A;  1Q8I A;  2JA8 B;  3NTK A;  4C3J G;  3ONA B;  1TWC B;  1F77 A;  3MAQ A;  2PZW A;  1EU4 A;  3L3O C;  2RSN A;  2CW0 C;  1DOK A;  5JPN C;  2A68 C;  1HHV A;  5J1Z A;  5A2Q L;  1SND A;  2F4I A;  4I65 A;  3V05 A;  5G3L D;  4IFD J;  2KCN A;  3CQZ B;  2JEA I;  1CQV A;  1FR3 A;  4ZLT F;  1RDP D;  2OEO A;  5DEH A;  1PMR A;  3HP3 A;  2C5C A;  1D5M C;  2K5W A;  2NTT A;  3GTQ B;  1Y8N B;  2LFN A;  3TP7 A;  3MXN A;  4HAE A;  2PW5 A;  1RCV D;  1EZ8 A;  1LTG D;  4IUP A;  3DEP A;  3GTM B;  3NK9 A;  2E2J B;  1LTS D;  2XN9 C;  1F2L A;  4RA8 A;  3TSS A;  1I4H A;  3SK5 A;  3PIP 3;  3I91 A;  2WAQ B;  1ML0 D;  4RFB A;  2A69 D;  1WTQ A;  5IGB A;  1SYB A;  2R6G A;  3CRK C;  4IN3 A;  1I4G A;  1TQO A;  1C48 A;  3NQT A;  3P75 A;  3FVQ A;  2EYM A;  5E4W C;  4WFN 3;  3A56 A;  3FKI B;  1LT3 D;  3HG9 A;  1H9S B;  2BDO A;  5C4X B;  2Z4I A;  2KUM A;  1Z6H A;  2M2L A;  2O5J C;  1HQR D;  5M5X B;  5IOC A;  2F0T A;  1SAP A;  2QEJ C;  3BVM A;  3A7L A;  4CBV A;  1ET9 A;  4DGZ A;  2JA6 B;  2RDF A;  1FGB D;  2J4X A;  4K2K A;  1JOK A;  3R3O A;  1PXU A;  4ODG A;  1KAA A;  5IGG A;  4R8I A;  1JWM D;  1O78 A;  2X69 A;  1L0Y B;  5JEA H;  1GUS A;  3A8K E;  4M1U B;  5IIF A;  2B39 A;  5D3D A;  3MXG A;  4CJ1 B;  1A2T A;  2BOS A;  2F3V A;  2K28 A;  3C46 A;  1QIL A;  3SHL A;  2Q8T A;  2SEB D;  1CI3 M;  2ICE C;  4C3I G;  2M9V A;  1B1Z A;  3VR5 A;  4NDX A;  3ERQ A;  2F0F A;  1VDZ A;  1QB5 D;  1R4Q B;  1HRJ A;  1KNA A;  4C3J B;  1AN8 A;  3TN2 A;  3UI2 A;  4XT3 B;  4TRD A;  1EOT A;  4UDU C;  1JWS D;  5KRU A;  1B2T A;  2H1E A;  3KBG A;  2DY7 A;  1EQV A;  5C4H A;  4KTA A;  3I90 A;  3HOW B;  1RKN A;  2IX0 A;  1JE4 A;  3TZU A;  2A68 D;  1STG A;  1EY6 A;  1R4P B;  2DNC A;  4X3T A;  2F0G A;  5C4J B;  2ICI A;  1WTV A;  1G6Z A;  1JOR A;  4ZYS A;  1STN A;  3GQB A;  1CHP D;  3M7N A;  1ENA A;  5C3E B;  1STH A;  3U9S A;  3BZD B;  1TT2 A;  2J7Z A;  3D4R A;  3GD7 A;  4QCL A;  3VYR A;  1NR4 A;  3BYY B;  1DOM A;  1GHK A;  3T56 B;  3J7A F;  1S5F D;  5I6Y A;  1CTM A;  2MPM A;  2Z8L A;  4HED A;  4A3I B;  3OIQ A;  2YU9 B;  2OXP A;  3J81 L;  2VB3 X;  3D31 A;  2EY5 A;  3MWY W;  5E4X A;  3BS1 A;  1V43 A;  1DYQ A;  2NB0 A;  1KLG D;  4OO1 I;  3AU7 A;  3KK7 A;  4XQN A;  3TP8 A;  1LTR D;  2JYO A;  4PMC A;  3BYT B;  4KY7 A;  3T53 B;  3R93 A;  3A54 A;  4F8M A;  3CKI B;  4B9X A;  1H9S A;  1E2Z A;  1H9R A;  1EYD A;  1BCP D;  2XWJ B;  1PLF A;  3HGB A;  2F0M A;  3D4D A;  1BXT A;  3OMC A;  4C1N I;  5FO7 B;  2AQ1 B;  2NVY B;  1JCK B;  3K59 A;  1CA6 A;  1QNU A;  2IW3 A;  1SYG A;  1K83 B;  1X32 A;  1E2W A;  1D1K A;  2BE5 C;  1SJH D;  4C3I B;  4IQZ A;  2ZXR A;  5FO9 B;  5IT9 E;  4MHE A;  3K6O A;  2EYF A;  1NSN S;  1EL0 A;  1KAB A;  3QJY A;  3HKZ B;  1PFB A;  4ZK9 B;  1ESR A;  4FF1 A;  1BBX C;  5COY A;  4KKS A;  5CV8 A;  5JOB A;  4RAU C;  1A2U A;  4KY6 A;  4QMG A;  3K7A B;  1DOL A;  4WJW A;  2JP1 A;  4V19 0;  3KUP A;  3D4W A;  5I9O A;  5IGE A;  4RGT A;  1GUW A;  3S15 B;  1KDC A;  1Z47 A;  3MFG A;  1RTO A;  4RGM A;  4HSP A;  2WV6 D;  1UEA B;  3S2D B;  1LT4 D;  2H4O A;  2SNM A;  3TP6 A;  2B8G A;  4XQQ A;  3I4N B;  1RF2 D;  1I6V C;  2K6A A;  1I4P A;  2EYL A;  5BN4 A;  1TWA B;  2OF1 A;  2AUJ D;  2L1B A;  3PUV A;  4OO1 G;  1I4X A;  1XWE A;  3BVG A;  2K5D A;  1LTB D;  2B2W A;  3P7J A;  1JOO A;  1DM0 B;  3PO2 B;  1HUM A;  1MSH A;  2NBF A;  3BG3 A;  1UUP A;  4L63 B;  1ET6 A;  4KJO A;  1W6J A;  1D6E C;  2K5Q A;  3MHB A;  1BO0 A;  3BVZ A;  1B4O A;  1EY0 A;  4DA2 A;  1JC7 A;  4R8N A;  3T16 A;  3SK6 A;  5CV5 A;  5D3I B;  1EYC A;  2F0D A;  3ND8 A;  2LY7 A;  3NBH A;  3Q22 A;  5CV6 A;  1AP0 A;  3RZD B;  1EZ6 A;  4G57 A;  4F88 A;  3DWA A;  1RHP A;  4PMB A;  1HFN A;  2I46 A;  2L9H A;  4A3M B;  3TP5 A;  3OIP A;  1Y8P B;  4S3S A;  5K36 H;  3GV3 A;  1NAP A;  1I4Q A;  4CKE A;  5JVH 3;  5AFW A;  5EBD A;  1EYA A;  1LT5 D;  4FXK C;  2L12 A;  1TWH B;  3BDO A;  2XIW A;  1ZKO A;  4PQX A;  5JVG 3;  2BE5 D;  4NW2 A;  4DXG A;  2HCI A;  1SYF A;  1C4Q A;  1VMC A;  2EYO A;  2Z1C A;  4FXD A;  5C0X I;  1CM9 A;  1WTO A;  1ROD A;  4V0B A;  2R93 B;  1IKL A;  4IUU A;  4PV1 C;  1CA5 A;  5KEE A;  4FP5 D;  2IPK D;  2HQE A;  2RDH A;  4OIJ A;  1SYD A;  4IUN A;  1MI2 A;  5C5M A;  4BA1 I;  1PRT F;  3OWE B;  2E2I B;  1EY5 A;  1DZ1 A;  1BCP F;  5ELF A;  1CT1 D;  1WCM B;  3P20 A;  2FMC A;  1D5X C;  3NXW A;  1SYC A;  5CGK A;  3S1Q B;  1H9K A;  2EPB A;  1KNE A;  2EJF C;  3FMC A;  4X3S A;  4B08 A;  3E6Z X;  1KDA A;  1I6H B;  5JEA J;  4X3K A;  3LWE A;  3HOY B;  5EKI A;  1K8O A;  2EYH A;  2IJ0 A;  1Q90 A;  2F0V A;  5DNF A;  2A73 B;  1H9J A;  4R9W A;  2NUC A;  2KQ3 A;  1PFM A;  3SEB A;  3QB3 A;  1PZI D;  2K04 A;  1G8Z D;  1S5D D;  5HUR A;  2E2H B;  2N88 A;  4KV6 A;  3GTP B;  2L0C A;  4BWG B;  5IT9 L;  3H0G B;  3GO5 A;  1HTP A;  1AEX A;  1EWH A;  3VR2 A;  1NR2 A;  1F2M A;  1B53 A;  2VUM B;  5ELD A;  2WP8 J;  3TDQ A;  1B9N A;  1DON A;  4X3U A;  3NSW A;  1ONL A;  5CV4 A;  2PW7 A;  1FYC A;  1RTN A;  1U4M A;  3NHH A;  3KLS A;  1O7Y A;  4RWS C;  1EY9 A;  2BCO A;  5KNB A;  4B9W A;  4RCN A;  1OXX K;  4KN4 C;  1SE3 A;  4K14 A;  5C4Z A;  3W2D A;  5C0X G;  1MSG A;  2QCP X;  3NBI A;  3NWS A;  2EY2 A;  1F9S A;  4KI0 A;  4DFA A;  3TBI B;  4KD3 A;  3NTI A;  2WAC A;  3H91 A;  4ZAI A;  2M00 A;  4L6T B;  1PTO F;  1VF7 A;  3PUY A;  3OWF A;  5EKK A;  4EQP A;  1STY A;  3V2T A;  2MJ8 A;  1XX8 A;  3VYT A;  4XT1 B;  3FDT A;  2F0I A;  1O7L A;  3BDL A;  1CHQ D;  2EY1 A;  3ND9 A;  2L11 A;  1TVX A;  5BN3 A;  1IYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...