1NMFA

Major cold-shock protein, nmr, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords MAJOR COLD-SHOCK PROTEIN
publication title Structure in solution of the major cold-shock protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 4
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1996-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1nmfA00
4GLAC 4B3SQ 4HJ5A 2JJQA 1YEZA 3KJOA 1EOVA 1CKOA 4GN3B 2ZTCA 2A8VA 4QL5A 1MJCA 1BBUA 4A4IA 2VUMH 3GTGH 3AEVA 4NXNQ 4PMWA 1N8RC 1Q12A 1PH2A 1J5EQ 2RF4A 4A3GG 4HIMA 1ASYA 4OX9L 3BU2A 1PYBA 4JI1Q 3RLNA 4DAYB 4LUOA 1C7YA 4K0KL 2UXDL 1UE5A 1G51A 3KF6B 3RLFA 3KFUA 4LWCA 1CKMA 4DV5L 1IL2A 2OCEA 1KD1C 4LFBL 3F8TA 3CCMA 3PIPA 5IP7G 3UDXA 1VQBA 4LW1A 1YHAA 5M3MG 1HNXL 4NXML 3PUWA 3GTMH 3HOVH 3S2DH 3I4OA 1JJCB 3GDEA 4C3IH 3NELA 3PO3H 1PV4A 2VL6A 4B3ML 1D7QA 1WI5A 1X9NA 1G6PA 4B3SL 1QUQB 2Y0SG 2WP8J 1VQJA 4A3EH 4A3LG 4P75A 4GOPB 1I6HH 2F3IA 4DR6Q 2YTXA 4JOIA 3CAMA 1VQLA 5FLXc 5GAHC 1IBLQ 4YCWA 1O7IA 4PZ7A 4NXNL 1Z47A 1XNRQ 1J5EL 2VQFQ 4X62L 4HJ9A 1HH2P 2CWPA 2LXJA 3SGIA 3ULJA 1SE8A 3H3VH 3HOUG 4OO1I 2ZM6Q 2YTVA 5IYCG 4ALPA 4JI1L 1NMFA 3GTPH 2R92G 3S16H 2ATWA 3EBEA 2VZAA 3L7ZC 4A75A 3OTOQ 1HZAA 4LF5L 4P73A 1SR3A 2NVXH 4POFA 3TS2A 3G6EA 3JAMc 1K8GA 4XIGS 1XMQQ 3D31A 5C3EH 2UUCQ 1Y1VG 4A93H 4UY8C 1E7ZA 5ELNA 1PH9A 2YYZA 1Z9FA 3PIOA 1WYDA 4J15A 1QZHA 2MFIA 1I94Q 1PH8A 4DR6L 3KDFB 5IYDG 1XNRL 4A3JG 4LF4Q 2JA7H 4L5RC 1FVIA 1CUKA 4A3FG 3CD6A 1VQGA 3HKZG 2VQFL 2PI2E 3CMEA 3ERSX 1UWVA 1QZGA 1WCMG 1OXSC 2Z6KC 1PH4A 3HOXH 1N9WA 2ZM6L 2JEBI 1AE2A 1W3SA 5JJKA 4GOPC 4BY1H 4DV2Q 1VQOA 2Q2HA 4X6AH 4A3CH 2I5MX 3FP9A 4PZ6A 3A5UA 3J81j 3RNUA 3E9IA 3OTOL 1I5FA 2B3GA 2LSSA 1SLJA 1VQDA 2CQOA 3AFPA 3J80c 4L5SA 4DR2L 4A3MH 4ME3A 5M5XH 1L1OA 2PNHA 4YWLA 1XMQL 2BH8A 3J81c 1L2FA 2R7FA 3MEFA 5LMNW 3PV0A 2ZJQA 4A93G 3PUZA 1SRUA 1P16A 4RG1A 4YWKA 1I94L 3G48A 3AYHB 4LF4L 1TWCH 1NY4A 4IJHA 5LMNL 4DR4Q 2Q2TA 1KQSA 3GTLH 3AQQA 1VQ7A 1UE7A 1S3OA 1PHJA 4GNXA 3MXNB 5IP9G 4DV2L 1X3FA 5JEAJ 3KLWA 1NTGA 1VQAA 3F2DA 3KYHC 4GS3A 5EAYA 4A3GH 3RN5A 3KJPA 2HIVA 1PA6A 1HJPA 2F4VQ 3S1MH 4A3DG 4BBSH 4TQUS 1VQ8A 1PH5A 4AYBE 3STBC 2IY5B 2E5LQ 5JJIA 2B29A 3JC66 1X65A 4HJAA 1L0WA 1LUZA 1IZ6A 1U0LA 4DAMA 2OTJA 1XJVA 5M3MH 4DV5Q 2DGYA 3TREA 4C3JH 4JYAQ 2BA1A 1YHBA 2MO1A 4X64Q 4HIOA 2DUDA 3S1RH 2YV5A 5HGQA 5C4JH 3CF5A 3W1BA 3S14H 3I4NG 2UXCQ 5C0XJ 4DR4L 3ER0A 2C35B 4B3MQ 4A3LH 3CPWA 1YIJA 4APVA 4IFDJ 4GLXA 3GO5A 5IWAQ 5C0XI 4H02A 4IOCA 2ZTEA 5FJ8G 1PH1A 1WJJA 3HOUH 1PH7A 1M1KC 1RIPA 4LF7Q 2F4VL 4JV5Q 1VQ6A 5IYCH 1I50H 2JEAI 4IFDI 3RN2A 4X62Q 2R92H 1V1QA 2E5LL 4IO9A 2AMCB 4X65Q 2K52A 4BBSG 3Q8DA 4JI6Q 3PGZA 4JBJA 3H15A 4JI7Q 3CP0A 4LUZA 2LXKA 3B6YA 1SROA 3KOJA 4JYAL 4LF5Q 1S40A 1HZBA 4R4OA 3W1GA 4X64L 4Y7NH 1OXXK 1Y1VH 4R4CA 2YTYA 1GKHA 4GN5A 2UXCL 2KHJA 3A74A 3BZCA 2YU9H 2GVAA 4JOIC 1YITA 1X55A 4AQYQ 1CSPA 4HJ8A 1IBKQ 2HIXA 4QJFA 2E2IH 1VQCA 1YJWA 5IYDH 4A3JH 5IWAL 1VQ9A 4A3FH 2NVYH 3M85A 1KRSA 3F2CA 1HR0Q 1E24A 2NZHA 3GTQH 1TWGH 1WCMH 4P71A 4QGUA 1TWFH 1L1OB 2R7DA 4O2DA 3I2ZA 3U4VA 1C9OA 1K8AC 4LF7L 1KAWA 3GTKH 4A3BG 2JA5G 3GD7A 5IE8A 1BBWA 1V9PA 2JA6G 2N8NA 2HT1A 5FLMG 4X65L 4GKKQ 2ZTDA 3TRZA 4JV5L 2F52A 4JI6L 4AIMA 1Y14B 4JG2A 4JI7L 1YJNA 2PQAB 3M3YH 4IPGA 2OQ0A 4DV0Q 3K80C 4NPSA 1N33L 2OTLA 4LF6Q 3J7ZC 2K5NA 4GN4B 5IT9c 4P74A 4XTCS 4DR2Q 1VQFA 4LFCL 4AH6A 1UE6A 1S72A 1JB7A 1HR0W 4WJ3M 1AE3A 2AKWB 3W5OA 3CCQA 4AQYL 1VQMA 4LF8Q 4OO1G 1B7YB 1AH9A 3S1QH 1VQEA 4IPHA 1IBKL 3D0FA 2B63H 4DR7Q 4QQBX 3BJUA 1HR0L 2OQKA 2RHSB 2K4KA 2GN5A 2HQLA 3A5ZB 3UDIA 4BBRG 5LMNQ 1XMOQ 4DUYQ 1VQNA 2UU9Q 5IP9H 2CFMA 2UUAQ 4GKKL 2IHEA 1IXRA 2ID0A 4C3HH 4A3IG 4DR5Q 3F1ZA 2WB1E 1EQRA 1Y1WH 3PUVA 2KBNA 2MQHA 4EQ5A 2VW9A 1Q8KA 1L1OC 2WAQE 4LNQA 4A3DH 1UEBA 1YJ9A 2ASBA 3CMAA 4DV0L 3H3VI 1TWAH 1JE5A 5GQOA 3K0XA 3UE0A 4LF6L 1T9HA 1E3PA 2JE6I 2R93G 5GADC 1M90C 4BY7G 2L15A 2K75A 3CCJA 4LF8L 4PZ8A 4DR3Q 4DV4Q 1DGSA 1KL9A 1K83H 1JJGA 3DM3A 3RLOA 1EIYB 3CCLA 4L5QA 1WOCA 4DR7L 3I4NH 3CPFA 2E2JH 2PI2A 3CCEA 2NVTH 1VCIA 2Z0SA 2XTIA 2AWOA 1XMOL 3M4PA 4DUYL 4HIDA 3T1YQ 2UU9L 4B3TQ 2I5LX 2R7ZG 1QUQA 3J80i 1OXUA 5FJ8H 1W2BA 2UUAL 3K8AA 1EYGA 1IBMQ 4DR5L 3G71A 3PO2G 4QY7A 3DLLA 4JBMA 1N36Q 1LYLA 3J81i 1N32Q 4R1JA 4PG3A 3PCOB 3CCVA 1PH3A 1YHQA 1A63A 1B70B 1Y1WG 3HOWG 2MNAA 1C0AA 2NN6G 3FKIG 4DUZQ 1X56A 1Q86C 3M7NA 1KHIA 2JA9A 3AFQA 3PUXA 3TEHB 1HZCA 3NBHB 3LGJA 1SFOH 1U5KA 1QVFA 4DR3L 3HOZG 4DV4L 1XNQQ 1SMXA 4BXXG 1HNWQ 1Q7YC 1NE3A 2B63G 2NVQH 5JJLA 2FXQA 2CKZB 5LMUQ 3CC2A 4OXPA 3M4OH 4KHZA 3E9HA 5C4XG 3T1YL 1X6OA 2XGTA 1P8LA 4B3TL 5BR8Q 4Y52H 5JEAG 1KRTA 1ASZA 1B8AA 5IY0A 2D0OA 1NJIC 5M5YH 1IBML 2ZJPA 3S17H 3S1NH 1EIFA 3HKSA 3NENA 1TWHH 2V1CC 1KXLA 4DV6Q 4A3BH 5DLQE 1N36L 4GLVB 1MJEA 3E0EA 4DPGA 5AJ3Q 2JA5H 2JA6H 4KHPL 3L0OA 3I4MG 1N32L 2VNUD 1GM5A 2Y0SE 1YVCA 5FLMH 3CCUA 4DUZL 3CC4A 1XPRA 4YCVA 4IOAA 3RR5A 4DK3C 1YBYA 1GD7A 2JA8G 4DR1Q 4JI5Q 1XNQL 3I7FA 3HOYG 3ICEA 3PF4A 1KIXA 3FHWA 1HNWL 1OXVA 5C0XG 4DV7Q 1N33Q 4BA2I 5LMUL 3K81C 4RMFA 3U58A 4O0AA 4JCVE 2NZOA 5C44H 4LFCQ 4KLKA 4AYBG 4IFDG 3M4QA 2H5XA 1PYSB 5BR8L 3I56A 2PMZE 1GO3E 2KENA 2EIFA 4B3RQ 4DV6L 1LM0A 4BBRH 4JBKA 3RZDH 4JI4Q 1MIUA 5AJ3L 2OWOA 1HNZQ 4A3IH 2BA0A 4WJ4A 2K14A 1CKNA 4EX5A 1K9MC 3UDGA 1K0RA 1E22A 1K3RA 2ALYB 4DR1L 4YHHQ 2VS1A 3HKZE 1KC8C 4JI5L 3UDFA 2AHOB 3HFZB 5M3FG 1VQKA 1FJGQ 1VQ4A 3RZOH 1Q1BA 5ELOA 2CWAA 4R4TA 2R93H 1A8VA 5IYBG 4BY7H 2N3SA 4JI2Q 4NB3A 4DV7L 2VQEQ 4A3KG 3K7AH 4FDBA 1N34Q 1WFQA 4MTNA 1PH6A 3U4ZA 2WFWA 2KCTA 3VDYA 2A1AA 2UUBQ 3H0GH 3CXCA 4GNXB 1JMCA 1OTCA 1A0IA 2EQSA 3S2HH 1GVPA 5C44G 2VY3A 3M9BA 2IX1A 4B3RL 1R9TH 1XPUA 4P72A 3TQYA 1LTLA 4HIKA 4DKAC 4HJ7A 1QVCA 4JI4L 2VUMG 2R7ZH 2JQOA 1EWIA 1V43A 4UP9A 1HNZL 1PFSA 5HY6A 4DV3Q 4LFAQ 4POGA 1BKBA 3PO2H 1SN8A 4OWTB 1JJ2A 3KF8B 2UXBQ 4QIWE 3G4SA 3EN2A 2I0QA 3JAMi 1H95A 3WWVA 5K36G 4L5TA 2KHIA 4YHHL 1XTDA 1A62A 1D8LA 2QGQA 3FKIH 1K73C 1EFWA 1FJGL 3HOWH 5E7NA 3F2BA 1JT8A 4MNOA 2D0PA 3ZJYC 1CSQA 1Q46A 2HHHQ 4JI2L 2E8GA 2VQEL 3HOVG 3ULLA 1N34L 3T1HQ 4IPDA 3PO3G 2UUBL 3CW2C 4TVAB 4YWMA 4OWWB 1Q82C 3HOZH 4GKJQ 4BXXH 4JC0A 3CCRA 4IJLA 3GTJH 2EXDA 3KF6A 4KI0A 3K7UC 4JI8Q 4DV1Q 3H0GG 4A3EG 1IBLL 1TXYA 1EQQA 4LUVA 4LF9Q 2AWNA 2N49A 4R4IA 4X66Q 1G291 5C4XH 2N78A 4GNXC 4OONA 3U50C 5M5WH 3IRBA 5J3BA 1IYJB 2K5VA 2ZJRA 4DV3L 4LFAL 1FGUA 1E1TA 1HZ9A 1NBWA 1Q1EA 4UP7A 3I55A 3CCSA 1X3EA 1EUJA 4A76A 2E2HH 3S15H 5GAGC 2UXBL 2RHQB 2Z6KA 3ULPA 2K50A 3I4MH 2CCZA 1MKHA 2IHFA 4GOPA 3PUYA 1RL2A 1UE1A 4KHPQ 4YY3Q 4R4QA 2D62A 2UUCL 2QA4A 1QVGA 1OXTA 2HHHL 4JI3Q 5H1SE 3J7A5 2JA8H 3T1HL 5C3EG 2GVBA 2QEXA 2NN6I 3UE1A 4GKJL 3HOYH 3A0JA 1VQPA 1PVOA 4JBWA 2PQAA 3NEMA 2BH2A 2A19A 4DV1L 4JI8L 3L2PA 2KCMA 2WB1G 5GAEC 4LF9L 4X66L 4JI0Q 4MZ9A 1YZ6A 2WAQG 2ES2A 2Q2UA 1CKNB 1E1OA 1VS0A 2JA7G 3CQZH 1VQIA 2IX0A 1NMGA 1X54A 5GROA 2R6GA 1J6QA 4YCUA 3HOXG 2I5HA 4BY1G 1FL0A 4DNIA 4BA1I 1I3QH 3PF5A 1Q81C 4UPAA 4A3CG 2IT1A 1YI2A 1VQ5A 1BVSA 3GTOH 1XPOA 3PSIA 4YY3L 3KDFA 1VQHA 4OX9Q 4K0KQ 2UXDQ 3BZKA 4JI3L 2K5HA 4DK6C 4A3MG 1X3GA 5IP7H 1YNXA 3CC7A 4C2MH 5M3FH 4LFBQ 2RCNA 3STBD 2MO0A 2JK8A 5IYBH 4NXMQ 1HNXQ 3OW2A 2Q2IA 4UP8A 4A3KH 3EIVA 3S24A 3OYYA 4IPCA 4OWXB 4JI0L 3TS0A
chains in the Genus database with same CATH superfamily
1HFNA 2K5WA 4F8MA 3I3CA 2F0SA 4QL5A 3AEVA 1DXMA 1EQVA 1JOKA 4A3GG 5KYLA 1EYDA 1JQYD 3NTIA 1SEBD 1ASYA 3PO2B 1PYBA 3RLNA 3LNNA 4LUOA 3T51B 4JW0A 3KF6B 3KFUA 1GXDC 1V8QA 1IL2A 1RTNA 5IP7G 2KHSA 5IT9E 3OIPA 4M8AA 3GDEA 4C3IH 3N6RA 2VL6A 1SNMA 4B3ML 1D7QA 1DD2A 5EBCA 4B3SL 1QUQB 1DCZA 4CJ1B 4A3LG 1KNEA 2F3IA 4ZQ3A 4DR6Q 2YTXA 4ZRZA 1Z47A 3NUCA 2PW7A 1FD7D 2B2YA 1SE8A 4LJZC 3S15B 2YTVA 1F2ZA 2E2HB 4JI1L 5KIXA 1NMFA 1TS4A 1B50A 3D6WA 2VZAA 4A75A 4A3MB 5M5XB 1F9RA 1S5DD 2NVXH 2A73B 3TS2A 2UUCQ 1HA6A 5C3EH 1Y1VG 1WTWA 1FNVA 4K14A 1PZKD 2YYZA 1Z9FA 3PIOA 1JOQA 4QCLA 2BOSA 2A68D 2JA7H 5I2YA 1FVIA 3CQZB 3S1QH 3HKZG 1QZGA 3ERSX 2PW5A 2Z6KC 3HOXH 3TZDA 3S1MB 2I5MX 4PZ6A 3RNUA 3J81j 3OTOL 4OELB 1O7ZA 3AFPA 1IHZA 3I8ZA 3EVQA 1XMQL 2BH8A 1L2FA 2HCCA 3GP7A 4KN7C 2VB2X 2DN8A 3S14B 4A3KB 2F0HA 1SRUA 3OOCA 1EY6A 1I94L 3MHBA 1B44D 3QO2A 2EE1A 3SK6A 1SMYC 2VB3X 3ONAB 1WD1A 4IJHA 2E74C 3QG1A 3BDCA 1VQ7A 1UE7A 1S3OA 4ILWA 5IP9G 4DV2L 1VQAA 5I2XA 1IYVA 5EAYA 4GS3A 4CKBA 4CHTB 3MXUA 1QB5D 2HIVA 1HJPA 3VA5A 1D1IA 2IY5B 2DY8A 3VR4A 2B39A 3JC66 4KY7A 1Y1VB 2F0GA 2XWBB 4DAMA 3OW7A 4DV5Q 3TREA 4C3JH 4JYAQ 2BA1A 1YHBA 4R8NA 4HIOA 5EPLA 1ENFA 1PRTF 1HUNA 5CBEE 2NZ1D 3C2PA 5J1ZA 3ER0A 2C35B 2NVYB 2F0QA 3BG3A 2SNMA 2B2WC 1TWFB 4GLXA 1AEXA 1PH1A 2ZTEA 5FJ8G 4CJ2C 1EFID 1M1KC 1RIPA 5TSSA 5FKAC 5T1IA 1JC7A 3BVZA 2LY7A 3QIAA 4JI6Q 5DEHA 3QWNA 4F87A 2ZT9C 2NVXB 2LXKA 3L3OC 1ZEQX 5C3EB 3Q23A 1I4QA 4GN5A 4C3JG 1PLFA 2N88A 2EOTA 1CSPA 4ZKBB 4PQXA 1EU4A 4QJFA 1VQCA 3WOEA 4A3FH 1KRSA 3TSSA 1WCMH 1XPRA 4QGUA 3HOXB 4JV5L 1EIGA 1U4MA 2F0NA 4V0BA 1C9OA 1WTOA 1K8AC 1KAWA 4A3BG 5JPNC 2JA5G 5IE8A 1V9PA 5K5PA 5FLMG 2SEBD 2RSNA 4X65L 3TRZA 2F52A 2N55A 3X3MA 1O7LA 1CA5A 1JWUD 4JG2A 4G7ZC 3MVVA 1R4PB 4IPGA 4LK1C 4B08A 4RGOS 5FLXL 1E0BA 1Q90A 4F7XA 2B8FA 1N33L 2XWJB 1X32A 3QJYA 3D4WA 1HR0W 1AE3A 1QCBD 4ID6A 4XXEA 1ENAA 2NVTB 3E0JA 3MAQA 1HR0L 2RHSB 2K4KA 2GN5A 2L4NA 3A5ZB 5LMNQ 1XMOQ 3SK8A 3W2DA 2CFMA 2K33A 3OSOA 4A3IG 4TRDA 3K58A 2NN6H 4A3DH 4DV0L 5GQOA 3I73A 4BY7G 2K75A 2PZUA 3CCJA 4C3JB 3MXGA 4PZ8A 4DR3Q 2EZVA 4RCNA 1WVLA 3CCLA 1EIYB 1CA6A 3I4NH 3CPFA 1F2LA 1VCIA 2DNEA 4K8JA 5JVH3 3S1NB 4DUYL 4HIDA 2UU9L 2Z4HA 4A3BB 1BCPD 2JA5B 2RQXA 3E5SA 4CDEC 5FO9B 2NN6G 4DUZQ 3R8BA 1TY0A 3SK5A 3PUXA 3E6ZX 3TEHB 2VXWA 3LGJA 4MIUA 4ABNA 1XNQQ 5IGGA 1HNWQ 1Q7YC 1BR9A 2NVQH 5JJLA 3CC2A 1IKMA 1OO9B 3H91A 2EYLA 1X6OA 2XGTA 5C4ZA 4B3TL 5BR8Q 1ASZA 1B8AA 3S17H 5CV5A 1TWHH 4A3IB 4DV6Q 4DNTB 5DLQE 5EJWA 2KCNA 3L0OA 5T1GA 3I4MG 3SXHA 3CCUA 1DOLA 4H7BA 1MBYA 1LTGD 1K28A 2F0KA 2AUKA 2Z9HA 4IOAA 1YBYA 2JA8G 4BY7B 1NSNS 4JI5Q 3EROA 2F0LA 3HOYG 1PRTC 1ZYRC 2EJMA 3PF4A 2HCIA 2R61A 5LMUL 4ZAIA 5C44H 1QNKA 4AYBG 3D8GA 3I56A 1BXTA 5FK9C 4S3SA 2NYZD 2BCOA 5FLXE 1G8ZD 1K8OA 2B2WA 2EIFA 1LM0A 4B9XA 4BBRH 5C5MA 4JI4Q 1NR2A 4EGVA 5C5LA 1LO5D 3UI2A 2H4OA 4EX5A 4A3DB 1K9MC 3ZYYX 4YHHQ 1Q3LA 3HKZE 1KC8C 2AHOB 2CW0C 1FJGQ 2KOLA 5E3FA 2D2CC 2CWAA 1A8VA 3CRKC 2N3SA 3P75A 4CGYB 4DV7L 1WFQA 2NTTA 3Q6SA 3U4ZA 2RSOA 2KCTA 1QE6A 3VDYA 1SNCA 3CXCA 1KDBA 2EQSA 3K5LA 1F9QA 5C44G 1XPUA 4P72A 4WRDA 2JQOA 2R7ZH 4DV3Q 4LFAQ 4POGA 3NHHA 4QUFA 1SN8A 1U4PA 3KF8B 3NWSA 3G4SA 3D4DA 3K57A 2NB0A 1H95A 3WWVA 5K36G 2F0UA 2QGQA 3FKIH 1K73C 1EFWA 3F2BA 5KGUA 3TP7A 5CV8A 1SYCA 1Q46A 4JI2L 1FGBD 2E8GA 1N34L 1A3UA 1CFMA 3QOJA 4R9WA 1Q82C 4BXXH 4JC0A 3CU7A 1EIHA 3MFYA 2NVQB 3KF6A 5C6AA 3K7UC 4A3EG 1EQQA 4P2CB 2KUMA 4LUVA 2N49A 4XQQA 5C4XH 2N78A 4GNXC 3U50C 1L0YB 1U4LA 1EY7A 1TKWB 5J3BA 2ZJRA 1CQFA 3CCSA 1Q1EA 4A76A 3RUZA 1EUJA 1XX8A 5GAGC 3AB9A 3ULPA 1EY4A 1H9JA 3PUYA 3BVGA 4KHPQ 4YY3Q 2D62A 2XVSA 3J7A5 1Z7TA 1PXUA 2NN6I 4GKJL 2WACA 2BH2A 3NEMA 1PZJD 4HSPA 2L12A 4LF9L 5EPJA 4X66L 5C44B 2WAQG 4NW2A 5A35A 4IFDH 1ZXTA 3GTGB 1JWMD 1QNUA 2R6GA 2Z6BA 4FVMA 1YNNC 2L9HA 4BY1G 1WTHA 4DNIA 4UAIA 1I3QH 1Q81C 3A56A 3GTOH 1XPOA 3VR6A 2EDGA 3CRLC 3GTMB 3STBD 1F77A 2RDHA 5IYBH 1V1OA 5M9OA 2Q2IA 5CV7A 4CJ0B 4KTAA 1O78A 1S5CD 4IPCA 4OWXB 3TP5A 4A3EB 3C1EA 4B3SQ 5C3WA 1CKOA 2RCFA 3A8JE 5E4XA 1JE4A 2EY1A 1BBUA 2VUMH 2R7ZB 2BE5C 1DYQA 1PTOH 5D14A 3BU2A 1HTPA 3G6JB 4H0LC 4JI1Q 3TBIB 4G4KA 1LT3D 2D5DA 3RLFA 3K59A 1CKMA 1K0SA 4LFBL 2BE5D 2EY2A 2QDBA 3F8TA 4X3SA 3PIPA 1VQBA 2A6HC 4NXML 1HNXL 2MUYA 3NELA 5CYUA 3WOFA 4HEDA 4RGMA 1WI5A 1X9NA 1G6PA 1VQJA 3NBHA 2XIWA 4P75A 2GA4B 1VQLA 5GAHC 5C4XB 1O7IA 1U4RA 2I46A 4IUNA 4NXNL 4BY1B 1J5EL 3HOUG 3FPPA 4ALPA 3H3VC 2A69C 1SJHD 3OTOQ 2D9UA 4P73A 5IODA 1EL0A 4POFA 5HGTA 3JAMc 3P1HA 1XMQQ 4DK0A 1F2YA 2MJ8A 1E7ZA 5ELNA 1GUSA 4QUCA 1PH9A 2KEEA 1E2VA 2KCCA 1I94Q 3KDFB 5IYDG 4PMCA 1XNRL 4A3JG 4DU9A 1VQGA 3CMEA 2C9OA 3FDTA 1N9WA 4HMIA 5E4WC 5JJKA 4GOPC 3IKJA 4DV2Q 2F0VA 4X6AH 4A3CH 3FP9A 5D3DA 2LSSA 1W6JA 1SLJA 1VQDA 4L5SA 3J80c 5FO8B 5JJZA 2BDNA 3HRZC 4A3MH 4ME3A 1HHVA 5M5XH 1FNUA 2PNHA 4FXGC 3J81c 3MEFA 3S1RB 3MXPA 1SE3A 3PUZA 4RG1A 2Q8RE 3J80L 1EYCA 3NSWA 5FO7B 3R93A 4TKOB 3J81L 1KLGD 2OT2A 3U9OA 4GNXA 1TVXA 5BN5A 4C3HG 3H94A 4A3GH 1LTSD 1PTOB 1MGSA 3S1MH 2AQ2B 3EJIA 4TQUS 4AYBE 1HPCA 2B29A 4JPBW 2ZXOA 3MA2B 2OTJA 3BS1A 1ONLA 2MO1A 2YV5A 2DJFC 3CF5A 4KHVA 3S14H 1MI2A 1VMCA 1CZWA 3RD4A 1DJRD 4ZUJA 3SK4A 4A3LH 1TWGB 4IFDJ 4FNFA 3GO5A 5J22A 3GTKB 4H02A 4IOCA 2K32A 1PH7A 2MPMA 4JV5Q 2SOBA 4IFDI 4X62Q 1V1QA 4X65Q 3H6MA 2K52A 3NQIA 3PGZA 3H15A 1NCVA 4LUZA 1SROA 1SBBB 4LF5Q 5I9OA 2B2VA 4R4OA 4X64L 1EZ6A 5BN4A 1Y1VH 1CQVA 1GKHA 2UXCL 2KHJA 3BZCA 2YU9H 2GVAA 4JOIC 4QIWB 4CKCA 1X55A 1YITA 3EA6A 2JN4A 2E2IH 4XQJA 4NDXA 1YJWA 1VQ9A 1TT2A 2NVYH 2O4XA 4N9PA 1E24A 1HR0Q 4P71A 1TWFH 4LF7L 2R7DA 3U4VA 2ICEC 3GD7A 1BBWA 2HDLA 2N8NA 2HT1A 1U9RA 2KECA 3IL8A 2F0FA 1HFGA 4JI7L 1RD9D 4DV0Q 3K80C 1DM0B 1B1ZA 2OTLA 1KDCA 2K5NA 3I90A 4GN4B 4Z9CB 1STGA 4DR2Q 1VQFA 4LFCL 2A68C 5JAVA 4MHEA 4AQYL 2NTSA 1VQMA 4OO1G 1D2BA 1IBKL 1CT1D 2L11A 3D0FA 4QQBX 1HTLD 2K6AA 2OQKA 4RA8A 1STHA 4DUYQ 3VYTA 2UU9Q 1H9SA 5IP9H 4IN3A 3OHXC 2XN9C 1X3PA 4GKKL 1A2TA 4A3GB 5ELEA 1EQRA 1AZPA 2MQHA 4EQ5A 1L1OC 1SDFA 2WAQE 3J80E 4LNQA 2ASBA 3CMAA 2AUJD 1TWAH 1JE5A 3K0XA 3UE0A 2EJGC 5NUCA 2JE6I 1H9RA 4DAYA 3V2TA 2EXZA 5IOCA 1MSHA 2FMMA 2K01A 4CDDC 1KL9A 4G7HC 3A55A 1WOCA 2QDLA 4DR7L 1IW7D 1F9SA 3EQLC 3CCEA 2NVTH 3M4PA 3BDLA 4B3TQ 2I5LX 1A3TA 1OXUA 5FJ8H 5KNBA 2UUAL 1RODA 4PG3A 4EQPA 3CCVA 1A63A 4FP5D 1B70B 5CV9A 1S5BD 3HOWG 3ND9A 1PRTB 1Q86C 1KHIA 3AFQA 1HZCA 3NBHB 5C3XA 2MGSA 2EYOA 3OIQA 3KF8A 2E2DC 2X6GA 2G9DA 2YU9B 4LMQD 2FXQA 5LMUQ 1CK1A 4OXPA 1LT6D 5AFWA 4RHRA 3Q24A 2E2IB 2PZTA 5JEAG 3RZDB 3HKZB 3E3XA 1NJIC 1IBML 3S1NH 3NENA 4KJNA 4A3BH 1N36L 3E0EA 1N32L 2JA5H 4PV1C 3Q22A 5FLMH 1YVCA 1TR5A 3J7AV 3A8IE 1STNA 3RR5A 1DOMA 4F88A 1KIXA 3FHWA 4N9TA 5D65A 5C0XG 4DV7Q 4BA2I 2XNAC 3K81C 2F0OA 5G3LF 4RMFA 3MZ5A 1LTAD 2G9HD 2QEJC 4JCVE 1ILPA 1R9TB 4E6IA 3OWEB 1Y69U 2A74C 1BQQT 3KLSA 2OWOA 1AP0A 4A3IH 4IUTA 3KBGA 4OIJA 1JR0D 3UDGA 4V190 1K0RA 3OMCA 1R4QB 1E22A 1TWAB 3UDFA 5M3FG 3RZOH 1D5ZC 4HN7A 5ELOA 4R4TA 2JYOA 4BY7H 4JI2Q 2V4DA 4C1NI 5IIFA 4FDBA 4KKUA 1N34Q 1PH6A 2WFWA 2A1AA 5ELCA 2M00A 1XTCD 4GNXB 1A0IA 2QF7A 4FF2A 1LV9A 2HDMA 3TQYA 1LTLA 4HIKA 2PO4A 3G7LA 4X3KA 4DKAC 1CI3M 1EWIA 1V43A 4CBVA 1EY0A 3VR2A 4OWTB 1RDPD 4QIWE 3K5NA 2AQ1B 2HD3A 4Y52H 2CHBD 2L5TA 1GUOA 3ZJYC 2D0PA 1CSQA 1STEA 3HOVG 1Y8OB 2VQEL 3ULLA 3OWFA 1II3A 2Q8TA 1GOZA 4U673 1WTRA 4WFN3 2UUBL 3PO3G 4OIKA 3K0YA 4GKJQ 2CVRA 1ESFA 1ZKOA 2EXDA 3K6OA 1BCPC 2CH4W 4LF9Q 4X66Q 1HQRD 2KEDA 2SDFA 5DM73 5M5WH 2K5VA 1SSOA 1QZHA 3I55A 1GUWA 4RGTA 4J8QA 5DM63 2Z6KA 2K50A 3I4MH 1MKHA 1EWCA 2UUCL 4DF7A 5M3FB 1V1PB 1RTOA 3A8KE 1D5MC 2HHHL 5H1SE 2JA8H 2K5DA 3T1HL 1ICWA 2QEXA 5D3IB 1IYUA 3HOYH 2F0MA 4JBWA 2PQAA 4TSSA 2EYFA 4DV1L 3L2PA 2A6ED 2WB1G 2F4IA 4DAPA 1YZ6A 5I6WA 2ES2A 2Q2UA 2PPBC 1CKNB 1E1OA 1VS0A 2F3VA 4WORA 1VQIA 2IX0A 3KK7A 4I65A 5GROA 1J6QA 3NK9A 4YCUA 1ENCA 4Q5VA 1FL0A 4K6DA 5KEEA 3PF5A 1G6ZA 5IGDA 2IT1A 1BVSA 3PSIA 3KDFA 2KVMA 3BZKA 2H1EA 1KTKA 1YNXA 3CC7A 3RZOB 4IUUA 4LFBQ 2RCNA 3PO3B 2JK8A 4NXMQ 1HNXQ 4FF4A 1PMRA 3OW2A 4UP8A 1PYWD 3TS0A 1I6HB 1H9SB 4HJ5A 1YEZA 3KJOA 1EOVA 4GN3B 2ZTCA 3NWTA 5I4DA 4CKEA 3NTHA 1MJCA 3GTGH 1ICFB 4KKTA 4NXNQ 1Q12A 1J5EQ 1AFPA 4ODGA 4OX9L 4DAYB 1EWHA 1C7YA 2UXDL 1SAPA 1G51A 2F0PA 3NQTA 5K36H 4LWCA 5ELBA 2NUCA 4DV5L 2EY6A 2OCEA 4OL7A 1KD1C 1B53A 3CCMA 1PDQA 4LW1A 1YHAA 5M3MG 3GTMH 3PUWA 3S2DH 3I4OA 1SYFA 2WB1B 2O5JC 4BS9A 2E75C 2L1BA 2Y0SG 5CMDA 4A3EH 3TDQA 2J7ZA 4GOPB 1KNAA 3CAMA 3V05A 1XNRQ 1IBLQ 4PZ7A 2TMPA 5M5WB 1BO0A 4J6HA 4HJ9A 2CWPA 2LXJA 5IYCG 2X69A 2Z4IA 4DXGA 3GTPH 1LTRD 1YNJD 4MTKA 2R92G 3S16H 3EBEA 3I4MB 1Y8PB 2WV6D 3L7ZC 4YIJA 1BNZA 1HZAA 2BDOA 2F0WA 1GUNA 4X3UA 2JA8B 3GV6A 4DXFA 2R3ZA 4UY8C 3HOYB 1X3QA 1SE2A 3GTLB 3NXWA 1PH8A 4ZYSA 4AYBB 5JOBA 4L5RC 1CUKA 5C4HA 2VQFL 1UWVA 1OXSC 3RMHA 2ZM6L 1AE2A 4BY1H 4R8IA 2HQEA 2Q2HA 1UAPA 2PZWA 2P5ZX 2CQOA 3MEHA 5M3MB 1E2WA 2R7FA 5LMNW 3PV0A 2ZJQA 2Y0SB 2RDFA 4YWKA 3G48A 5CV4A 4NP5A 1JB3A 4LF4L 1KDAA 1QILA 5LMNL 2EYPA 3AQQA 3MXNB 4RHSA 3KLWA 5EKLA 1NTGA 4U68A 3F2DA 3KYHC 2R92B 5CORA 1T5EA 3DWQA 3RN5A 4BBSH 4DAVA 3STBC 4CDCC 4CDFC 1MD2D 4L6TB 4HJAA 1JWSD 1L0WA 4Y7NB 1IZ6A 1EQTA 1XJVA 3S2DB 1BUVT 2DGYA 4X64Q 2DUDA 4RCOA 3QOLA 5HGQA 5IGFA 3K5MA 3S1RH 3W1BA 1I4GA 4RKLA 2UXCQ 2NWGA 4DR4L 1KLUD 3C1FA 4B3MQ 4K5VA 1YIJA 4APVA 1E2ZA 5EPKA 3HOUH 2OXPA 4LF7Q 2F4VL 1VQ6A 3GTPB 2F0EA 3RN2A 4C1NK 4DFAA 2I07B 3S16B 1F9PA 2E5LL 5CV6A 4RGNA 4BBSG 4K2KA 3Q8DA 2IL8A 4JBJA 4JI7Q 2IPKD 3B6YA 4EVOA 3KOJA 1HZBA 1OXXK 2LMCB 4KY5A 2JP1A 4AQYQ 3MC0B 1QOHA 1RF2D 4HCSA 2WAQB 1IBKQ 2B2YC 1ML0D 4RWSC 5IYDH 2Z8LA 4A3JH 3WDNA 5IWAL 1K3BC 1AZQA 1FNWA 3DXJC 1PFMA 1TWGH 1Q8IA 1SE4A 4Q0FA 1L1OB 4O2DA 5JPMC 3I2ZA 2O5IC 3GTKH 2JA6G 3VA7A 1SYGA 4GKKQ 4O42A 4N8FA 4AIMA 1LT4D 5HURA 2PQAB 3NTKA 3M3YH 2OQ0A 4NPSA 2M2LA 3J7ZC 1TS2A 1KAAA 5IT9c 4P74A 5I6YA 1JB7A 4WJ3M 4G57A 1S72A 2AKWB 4JK1C 3W5OA 3CCQA 1BDOA 1B7YB 1SNDA 1AH9A 3PMFA 4DR7Q 3JAML 2HQLA 3UDIA 1HXYD 3A7LA 2E76C 3BYYB 4KV6A 4I7AA 2UUAQ 1EEFD 1IXRA 2IHEA 4C3HH 2WB1E 1RJTA 2IX3A 2KBNA 4BBSB 1Q8KA 5CGKA 2KJXA 2OEOA 1YJ9A 3O13A 2EYJA 4LF6L 1T9HA 1SFOB 3BYTB 4DK1A 2R93G 4RKBA 2ZXPA 5GADC 3D3RA 1M90C 2CH4A 4K8IA 2PCFB 2XRSD 3I4LA 1XYIA 4LF8L 3IAYA 1DGSA 1K83H 3DM3A 3RLOA 1J9OA 1RCVD 4L5QA 4EQNA 3M4OB 2E2JH 5IGCA 1A6XA 1I4PA 1SNQA 2XTIA 2JSOA 2AWOA 1TY2A 2K05A 2NBFA 5E1FA 3J80i 3HOUB 1EYGA 1IBMQ 4DR5L 4FO2A 4ZUIA 3G71A 3PO2G 3DEPA 1LYLA 3J81i 1N36Q 1WTQA 3BZDB 1N32Q 1TIID 2CQAA 4R1JA 1YHQA 2MNAA 1C0AA 1X56A 4N8X1 3M7NA 2WKCA 2JA9A 1STYA 1U5KA 1QVFA 3HOZG 4DV4L 1SMXA 4ME5A 1C48A 1UNSA 1S5ED 2B63G 2CKZB 1J8IA 1KABA 2F3WA 3T1YL 4A3JB 1P8LA 1W6KA 3R2IA 1KRTA 4MN3A 2D0OA 5M5YH 2ZJPA 5DNFA 1EIFA 1QWYA 1QG7A 2V1CC 3I72A 3KLRA 4KHPL 4GLVB 3T4AC 2VNUD 1LTTD 4KKSA 1GM5A 2Y0SE 4DGZA 3M3YB 5ELFA 1C8CA 1GUTA 1Z6HA 2O2LD 2ENBA 3ICEA 4C56C 1CHPD 4K2LA 1N33Q 3S2HB 1K8MA 4OO1H 3U58A 1V1PA 4KLKA 3M4QA 2H5XA 1PYSB 3URYA 4HAEA 1GO3E 5KNCA 4JBKA 3RZDH 1MIUA 1HUMA 5AJ3L 4FYDA 4C3HB 1JORA 1S4ZA 2K14A 1CKNA 4ZCKA 4EQOA 1K3RA 1DOKA 2OF1A 3PIO3 4DR1L 2VS1A 3TN2A 3HFZB 1VQKA 4DN4M 1VQ4A 3HEJA 3HOZB 3JAME 3SE0A 3T16A 1BCPB 2VQEQ 4A3KG 3IFTA 3K7AH 3GTJB 2B63B 4MTNA 2UUBQ 3H0GH 1K83B 1JMCA 1WTXA 1OTCA 1O7YA 4K5WA 1GVPA 1FR3A 2E2JB 3OPOA 2F0TA 4B3RL 1R9TH 4HJ7A 1QVCA 1BCPF 4UP9A 4FF3A 1HNZL 4WJWA 5HY6A 4LAAA 1BKBA 3J7YW 1PFBA 1UUPA 2EYHA 1AN8A 2RDGA 2KHIA 3HOWH 1XTDA 1A62A 1D8LA 4ZKCB 4MNOA 2HHHQ 1GUGA 3J81E 1IW7C 1B4OA 1CZGA 3T1HQ 4C3IG 3W3AA 4XQNA 3CW2C 1HRJA 3CCRA 1I6VC 4IJLA 2LS01 4DV1Q 1LT5D 1G2TA 3H0GG 1TXYA 4KK7A 3X3NA 2AWNA 4R4IA 4L8JA 2KA7A 3D6CA 4OONA 5L37A 1NNXA 5JEAH 5BN3A 5M5YB 3BDOA 1HZ9A 2I0QA 4UP7A 2IWHA 2UXBL 5I9PA 1SYEA 2CCZA 4GOPA 1GHJA 4QMGA 1A3VA 1UE1A 2ICIA 4R4QA 4C2MB 2QA4A 4RH6A 1CHQD 1EEID 1UEAB 2J4XA 5C3EG 5DAUA 2GVBA 1EOTA 5CC4A 3UE1A 1VQPA 1PVOA 2J0TD 2A19A 3C46A 5F2DA 4JI8L 5C0XH 2KCMA 1DZ1A 2JA7G 3HOXG 1SMYD 2I5HA 4UPAA 1ET6A 2EPBA 3DWPA 1YI2A 1L0XB 1JOOA 4OX9Q 1TS5A 3MWYW 3ND8A 2UXDQ 4JI3L 2K5HA 4DK6C 4M1UB 2JXMB 5M3FH 4IALA 1SNPA 4C3IB 1AW7A 1H9KA 3K7AB 2G5DA 4JI0L 3H0GB 4FF1A 4UHVA 4GLAC 2JJQA 2A8VA 4O1NA 4H13C 4A4IA 4PMWA 3R3OA 1N8RC 1PH2A 2RF4A 3DUZA 3LWEA 3IFDA 4HIMA 1D1KA 4KY6A 4K0KL 3N52A 1UE5A 1CM9A 1PTOC 4B9WA 3HOWB 3C3LA 1M8AA 3CHBD 3MXNA 3F2UA 3UDXA 2B2UC 5A2QL 3HOVH 2QW7A 1JJCB 1PTOD 3PO3H 1PV4A 1M4VA 4BWGB 2WP8J 2JA7B 3S1QB 4G7OC 1I6HH 4JOIA 2RA4A 1VDZA 5FLXc 4YCWA 4ULLA 4X62L 2VQFQ 1HH2P 3SGIA 1H9MA 3ULJA 3H3VH 4OO1I 3QB3A 2ZM6Q 4PMBA 2MP1A 2K5QA 2ATWA 5KRUA 1TU2B 4LF5L 4RAUC 1SR3A 2EYMA 4OEMB 2C5CA 4K5XA 1MHWC 3G6EA 1K8GA 4XIGS 3D31A 4PNYA 4A93H 1B3AA 1I4XA 3V96A 1WYDA 4J15A 2PQEA 2PNRC 2MFIA 4DR6L 4LF4Q 3T13A 4A3FG 3CD6A 2PI2E 1WCMG 1PH4A 2JEBI 1W3SA 1T5XD 3NPPA 1VQOA 4JVZA 3A5UA 3K5OA 3E9IA 1I5FA 3T53B 4NKLA 2B3GA 4DNRB 1JCKB 4ZLTF 4DR2L 3NE5B 1L1OA 2A6EC 4YWLA 3D4RA 4A93G 3M7GA 1P16A 4IUVA 1WTPA 1XXGA 1NR4A 3AYHB 1TWCH 1NY4A 4DR4Q 2Q2TA 2MHVA 1KQSA 3GTLH 1LTBD 2RKSA 4H44C 1HCZA 3ITPA 2WIIB 1PHJA 4I7ZC 5CBAE 1X3FA 5JEAJ 4XYQA 1PA6A 3KJPA 4L63B 2F4VQ 4A3DG 1VQ8A 1CTMA 1SYBA 1TS3A 3MFGA 1PH5A 2X6LA 3FRPB 2E5LQ 3SDZA 1ILQA 1XWEA 2PMZB 1X65A 1LUZA 1U0LA 3HOVB 5M3MH 1STAA 4IURA 4FXDA 5C4JH 5EQ0A 3I4NG 5C0XJ 2FHTA 4OHJA 2FFKB 5KYIA 4A3FB 3CPWA 4K6LA 1WCMB 3VR5A 5IWAQ 5C0XI 3NBIA 1WJJA 3U9SA 5A2QE 5IYCH 1I50H 2JEAI 4QF4A 4XT3B 1Y8NB 1ESRA 2R92H 4IO9A 2AMCB 2KQ3A 4DA2A 5IGEA 2SNSA 3HP3A 3CP0A 2LKVA 4JYAL 1D6EC 1S40A 2WINB 1HQMC 3W1GA 4Y7NH 4A93B 3DHQA 4R4CA 5EKKA 2YTYA 3M4YA 3A74A 3TP6A 5FOBB 2RVLA 2AQ3B 2QCPX 1PRTD 1ZYRD 4HJ8A 2HIXA 1IL8A 3HS0C 1YNJC 3M85A 3GTQH 3F2CA 1F2MA 2NZHA 5JJIA 1QJOA 1PZID 1TQOA 1DONA 3TZUA 3HG9A 2QILA 2ZTDA 1IKLA 4JI6L 4QB4A 1Y14B 1VMPA 1YJNA 1GJXA 3AU7A 3HZXA 4LF6Q 3I91A 4XTCS 4AH6A 2B2UA 1UE6A 3I4NB 4UDUC 2CW0D 4LF8Q 5G3LD 4XT1B 1VQEA 5LL6X 4IPHA 2F03A 1TWCB 5EKIA 3BJUA 4BBRG 1VQNA 3CKIB 3DEOA 3HGBA 2QKIC 2ID0A 4DR5Q 3F1ZA 1Y1WH 3PUVA 1VF7A 2VW9A 3FMCA 4HMJA 1UEBA 1NUCA 3H3VI 3SR1A 3P7JA 1E3PA 2L15A 2IJ0A 2F0JA 4DV4Q 3A54A 2K1BA 5C4JB 1JJGA 1B9NA 1WTVA 2F1MA 3AMUA 1B3QA 2PI2A 2Z0SA 1EZ8A 1B9MA 3S17B 1XMOL 3T1YQ 1TWHB 1FYCA 2R7ZG 1QUQA 5IGBA 2FINB 1W2BA 3K8AA 2EY5A 2EJFC 1I50B 4QY7A 3VYRA 3DLLA 1WD0A 4JBMA 1SXTA 3PCOB 4IUQA 3DMUA 1PH3A 1Y1WG 3FKIG 5LL6S 2B2TC 3GQBA 1EYAA 1SFOH 4DR3L 1LABA 2M9VA 4BXXG 2DJGC 1NE3A 4GZYC 2L0CA 3M4OH 4KHZA 1G2SA 3DWAA 3E9HA 4HCEA 3T56B 3EFXD 5EGTA 5C4XG 1RHPA 4BBRB 4FXKC 5IY0A 2ZXRA 3GTQB 3HKSA 1KXLA 1PFNA 2EVBA 3A7AB 1EY9A 1MJEA 4DPGA 3PIP3 4HR7B 5AJ3Q 2JA6H 1YNND 4DUZL 1I4HA 3LWUA 3CC4A 3ERQA 2B2VC 1SNOA 4YCVA 4DK3C 4IUPA 1GD7A 1A15A 4DR1Q 4XDXA 1XNQL 3I7FA 5J39A 2LFNA 1HNWL 4KJOA 1RKNA 4IZ8A 1OXVA 3PQIA 5LHY1 2K28A 3TP8A 4O0AA 2NZOA 4LFCQ 4HTHA 4IFDG 1SJED 3TMEA 5BR8L 1EU3A 3VYSA 2PMZE 4ZK9B 3VR3A 2KENA 4B3RQ 4DV6L 1BF4A 3SHLA 3Q0AA 3LX0A 1HNZQ 1G91A 5KNDA 3MTSA 1Y1WB 2BA0A 3DM1A 4WJ4A 1SYDA 3FKIB 2DNCA 1LLRD 2ALYB 4HSVA 4JI5L 1Q1BA 2R93H 4IQZA 5IYBG 4NB3A 3SEBA 3FEWX 3L9AX 4KD4A 2A6HD 1JICA 5CR3A 2PYKA 1LTID 2WKDA 3S2HH 5ELDA 2Q8IB 2VY3A 3M9BA 5ISRA 2K03A 2IX1A 2K7VA 2VUMG 4JI4L 2XRQD 5IT9L 1LACA 1PFSA 2HUGA 4KMUC 1GHKA 3PO2H 1JJ2A 2UXBQ 3EN2A 3FVQA 3P20A 3R2TA 3S9WA 1A2UA 2F0IA 1NAPA 4KN4C 4L5TA 3JAMi 4YHHL 1FJGL 1JT8A 2A69D 5E7NA 3SVMA 1O80A 1S5FD 1B2TA 4IPDA 3HOZH 4TVAB 4YWMA 4OWWB 2K04A 3GTJH 3OMGA 4KI0A 3KUPA 4J1MA 4JI8Q 1ET9A 2FJ2A 2RBMA 1IBLL 2B63H 3H09A 1EY5A 1G291 3KLSX 5JVG3 3IRBA 1I3QB 1D5XC 1IYJB 4X3TA 2IW3A 4DV3L 4LFAL 1FGUA 2B8GA 1E1TA 1NBWA 3S15H 3GTOB 1X3EA 2E2HH 3J7AF 2RHQB 2JA6B 3VYUA 2IHFA 1MSGA 1RL2A 1VF5C 1OXTA 1QVGA 4JI3Q 3I70A 1STBA 3A0JA 3BVMA 1BBXC 3GV3A 5GAEC 4JI0Q 2TSSA 4MZ9A 2Z1CA 4KD3A 2L55A 3KBXA 3CQZH 1BOSA 2VUMB 1NMGA 1X54A 1I4RA 5EBDA 4OGQC 4BA1I 2XSCA 4A3CG 1HA5A 1VQ5A 2DY7A 4YY3L 4XYOA 1VQHA 3NP8A 4K0KQ 1C4QA 2A5HA 2F0DA 4A3MG 1X3GA 5IP7H 3FPUB 4C2MH 4NMZA 1EY8A 1PTOF 2B2TA 2R93B 2FMCA 3QR8A 2MO0A 4A3KH 3EIVA 3S24A 3OYYA 5COYA 4RFBA
chains in the Genus database with same CATH topology
4GLAC 4B3SQ 4HJ5A 2JJQA 1YEZA 3KJOA 1EOVA 1CKOA 4GN3B 2ZTCA 2A8VA 4QL5A 1MJCA 1BBUA 4A4IA 2VUMH 3GTGH 3AEVA 4NXNQ 4PMWA 1N8RC 1Q12A 1PH2A 1J5EQ 2RF4A 4A3GG 4HIMA 1ASYA 4OX9L 3BU2A 1PYBA 4JI1Q 3RLNA 4DAYB 4LUOA 1C7YA 4K0KL 2UXDL 1UE5A 1G51A 3KF6B 3RLFA 3KFUA 4LWCA 1CKMA 4DV5L 1IL2A 2OCEA 1KD1C 4LFBL 3F8TA 3CCMA 3PIPA 5IP7G 3UDXA 1VQBA 4LW1A 1YHAA 5M3MG 1HNXL 4NXML 3PUWA 3GTMH 3HOVH 3S2DH 3I4OA 1JJCB 3GDEA 4C3IH 3NELA 3PO3H 1PV4A 2VL6A 4B3ML 1D7QA 1WI5A 1X9NA 1G6PA 4B3SL 1QUQB 2Y0SG 2WP8J 1VQJA 4A3EH 4A3LG 4P75A 4GOPB 1I6HH 2F3IA 4DR6Q 2YTXA 4JOIA 3CAMA 1VQLA 5FLXc 5GAHC 1IBLQ 4YCWA 1O7IA 4PZ7A 4NXNL 1Z47A 1XNRQ 1J5EL 2VQFQ 4X62L 4HJ9A 1HH2P 2CWPA 2LXJA 3SGIA 3ULJA 1SE8A 3H3VH 3HOUG 4OO1I 2ZM6Q 2YTVA 5IYCG 4ALPA 4JI1L 1NMFA 3GTPH 2R92G 3S16H 2ATWA 3EBEA 2VZAA 3L7ZC 4A75A 3OTOQ 1HZAA 4LF5L 4P73A 1SR3A 2NVXH 4POFA 3TS2A 3G6EA 3JAMc 1K8GA 4XIGS 1XMQQ 3D31A 5C3EH 2UUCQ 1Y1VG 4A93H 4UY8C 1E7ZA 5ELNA 1PH9A 2YYZA 1Z9FA 3PIOA 1WYDA 4J15A 1QZHA 2MFIA 1I94Q 1PH8A 4DR6L 3KDFB 5IYDG 1XNRL 4A3JG 4LF4Q 2JA7H 4L5RC 1FVIA 1CUKA 4A3FG 3CD6A 1VQGA 3HKZG 2VQFL 2PI2E 3CMEA 3ERSX 1UWVA 1QZGA 1WCMG 1OXSC 2Z6KC 1PH4A 3HOXH 1N9WA 2ZM6L 2JEBI 1AE2A 1W3SA 5JJKA 4GOPC 4BY1H 4DV2Q 1VQOA 2Q2HA 4X6AH 4A3CH 2I5MX 3FP9A 4PZ6A 3A5UA 3J81j 3RNUA 3E9IA 3OTOL 1I5FA 2B3GA 2LSSA 1SLJA 1VQDA 2CQOA 3AFPA 3J80c 4L5SA 4DR2L 4A3MH 4ME3A 5M5XH 1L1OA 2PNHA 4YWLA 1XMQL 2BH8A 3J81c 1L2FA 2R7FA 3MEFA 5LMNW 3PV0A 2ZJQA 4A93G 3PUZA 1SRUA 1P16A 4RG1A 4YWKA 1I94L 3G48A 3AYHB 4LF4L 1TWCH 1NY4A 4IJHA 5LMNL 4DR4Q 2Q2TA 1KQSA 3GTLH 3AQQA 1VQ7A 1UE7A 1S3OA 1PHJA 4GNXA 3MXNB 5IP9G 4DV2L 1X3FA 5JEAJ 3KLWA 1NTGA 1VQAA 3F2DA 3KYHC 4GS3A 5EAYA 4A3GH 3RN5A 3KJPA 2HIVA 1PA6A 1HJPA 2F4VQ 3S1MH 4A3DG 4BBSH 4TQUS 1VQ8A 1PH5A 4AYBE 3STBC 2IY5B 2E5LQ 5JJIA 2B29A 3JC66 1X65A 4HJAA 1L0WA 1LUZA 1IZ6A 1U0LA 4DAMA 2OTJA 1XJVA 5M3MH 4DV5Q 2DGYA 3TREA 4C3JH 4JYAQ 2BA1A 1YHBA 2MO1A 4X64Q 4HIOA 2DUDA 3S1RH 2YV5A 5HGQA 5C4JH 3CF5A 3W1BA 3S14H 3I4NG 2UXCQ 5C0XJ 4DR4L 3ER0A 2C35B 4B3MQ 4A3LH 3CPWA 1YIJA 4APVA 4IFDJ 4GLXA 3GO5A 5IWAQ 5C0XI 4H02A 4IOCA 2ZTEA 5FJ8G 1PH1A 1WJJA 3HOUH 1PH7A 1M1KC 1RIPA 4LF7Q 2F4VL 4JV5Q 1VQ6A 5IYCH 1I50H 2JEAI 4IFDI 3RN2A 4X62Q 2R92H 1V1QA 2E5LL 4IO9A 2AMCB 4X65Q 2K52A 4BBSG 3Q8DA 4JI6Q 3PGZA 4JBJA 3H15A 4JI7Q 3CP0A 4LUZA 2LXKA 3B6YA 1SROA 3KOJA 4JYAL 4LF5Q 1S40A 1HZBA 4R4OA 3W1GA 4X64L 4Y7NH 1OXXK 1Y1VH 4R4CA 2YTYA 1GKHA 4GN5A 2UXCL 2KHJA 3A74A 3BZCA 2YU9H 2GVAA 4JOIC 1YITA 1X55A 4AQYQ 1CSPA 4HJ8A 1IBKQ 2HIXA 4QJFA 2E2IH 1VQCA 1YJWA 5IYDH 4A3JH 5IWAL 1VQ9A 4A3FH 2NVYH 3M85A 1KRSA 3F2CA 1HR0Q 1E24A 2NZHA 3GTQH 1TWGH 1WCMH 4P71A 4QGUA 1TWFH 1L1OB 2R7DA 4O2DA 3I2ZA 3U4VA 1C9OA 1K8AC 4LF7L 1KAWA 3GTKH 4A3BG 2JA5G 3GD7A 5IE8A 1BBWA 1V9PA 2JA6G 2N8NA 2HT1A 5FLMG 4X65L 4GKKQ 2ZTDA 3TRZA 4JV5L 2F52A 4JI6L 4AIMA 1Y14B 4JG2A 4JI7L 1YJNA 2PQAB 3M3YH 4IPGA 2OQ0A 4DV0Q 3K80C 4NPSA 1N33L 2OTLA 4LF6Q 3J7ZC 2K5NA 4GN4B 5IT9c 4P74A 4XTCS 4DR2Q 1VQFA 4LFCL 4AH6A 1UE6A 1S72A 1JB7A 1HR0W 4WJ3M 1AE3A 2AKWB 3W5OA 3CCQA 4AQYL 1VQMA 4LF8Q 4OO1G 1B7YB 1AH9A 3S1QH 1VQEA 4IPHA 1IBKL 3D0FA 2B63H 4DR7Q 4QQBX 3BJUA 1HR0L 2OQKA 2RHSB 2K4KA 2GN5A 2HQLA 3A5ZB 3UDIA 4BBRG 5LMNQ 1XMOQ 4DUYQ 1VQNA 2UU9Q 5IP9H 2CFMA 2UUAQ 4GKKL 2IHEA 1IXRA 2ID0A 4C3HH 4A3IG 4DR5Q 3F1ZA 2WB1E 1EQRA 1Y1WH 3PUVA 2KBNA 2MQHA 4EQ5A 2VW9A 1Q8KA 1L1OC 2WAQE 4LNQA 4A3DH 1UEBA 1YJ9A 2ASBA 3CMAA 4DV0L 3H3VI 1TWAH 1JE5A 5GQOA 3K0XA 3UE0A 4LF6L 1T9HA 1E3PA 2JE6I 2R93G 5GADC 1M90C 4BY7G 2L15A 2K75A 3CCJA 4LF8L 4PZ8A 4DR3Q 4DV4Q 1DGSA 1KL9A 1K83H 1JJGA 3DM3A 3RLOA 1EIYB 3CCLA 4L5QA 1WOCA 4DR7L 3I4NH 3CPFA 2E2JH 2PI2A 3CCEA 2NVTH 1VCIA 2Z0SA 2XTIA 2AWOA 1XMOL 3M4PA 4DUYL 4HIDA 3T1YQ 2UU9L 4B3TQ 2I5LX 2R7ZG 1QUQA 3J80i 1OXUA 5FJ8H 1W2BA 2UUAL 3K8AA 1EYGA 1IBMQ 4DR5L 3G71A 3PO2G 4QY7A 3DLLA 4JBMA 1N36Q 1LYLA 3J81i 1N32Q 4R1JA 4PG3A 3PCOB 3CCVA 1PH3A 1YHQA 1A63A 1B70B 1Y1WG 3HOWG 2MNAA 1C0AA 2NN6G 3FKIG 4DUZQ 1X56A 1Q86C 3M7NA 1KHIA 2JA9A 3AFQA 3PUXA 3TEHB 1HZCA 3NBHB 3LGJA 1SFOH 1U5KA 1QVFA 4DR3L 3HOZG 4DV4L 1XNQQ 1SMXA 4BXXG 1HNWQ 1Q7YC 1NE3A 2B63G 2NVQH 5JJLA 2FXQA 2CKZB 5LMUQ 3CC2A 4OXPA 3M4OH 4KHZA 3E9HA 5C4XG 3T1YL 1X6OA 2XGTA 1P8LA 4B3TL 5BR8Q 4Y52H 5JEAG 1KRTA 1ASZA 1B8AA 5IY0A 2D0OA 1NJIC 5M5YH 1IBML 2ZJPA 3S17H 3S1NH 1EIFA 3HKSA 3NENA 1TWHH 2V1CC 1KXLA 4DV6Q 4A3BH 5DLQE 1N36L 4GLVB 1MJEA 3E0EA 4DPGA 5AJ3Q 2JA5H 2JA6H 4KHPL 3L0OA 3I4MG 1N32L 2VNUD 1GM5A 2Y0SE 1YVCA 5FLMH 3CCUA 4DUZL 3CC4A 1XPRA 4YCVA 4IOAA 3RR5A 4DK3C 1YBYA 1GD7A 2JA8G 4DR1Q 4JI5Q 1XNQL 3I7FA 3HOYG 3ICEA 3PF4A 1KIXA 3FHWA 1HNWL 1OXVA 5C0XG 4DV7Q 1N33Q 4BA2I 5LMUL 3K81C 4RMFA 3U58A 4O0AA 4JCVE 2NZOA 5C44H 4LFCQ 4KLKA 4AYBG 4IFDG 3M4QA 2H5XA 1PYSB 5BR8L 3I56A 2PMZE 1GO3E 2KENA 2EIFA 4B3RQ 4DV6L 1LM0A 4BBRH 4JBKA 3RZDH 4JI4Q 1MIUA 5AJ3L 2OWOA 1HNZQ 4A3IH 2BA0A 4WJ4A 2K14A 1CKNA 4EX5A 1K9MC 3UDGA 1K0RA 1E22A 1K3RA 2ALYB 4DR1L 4YHHQ 2VS1A 3HKZE 1KC8C 4JI5L 3UDFA 2AHOB 3HFZB 5M3FG 1VQKA 1FJGQ 1VQ4A 3RZOH 1Q1BA 5ELOA 2CWAA 4R4TA 2R93H 1A8VA 5IYBG 4BY7H 2N3SA 4JI2Q 4NB3A 4DV7L 2VQEQ 4A3KG 3K7AH 4FDBA 1N34Q 1WFQA 4MTNA 1PH6A 3U4ZA 2WFWA 2KCTA 3VDYA 2A1AA 2UUBQ 3H0GH 3CXCA 4GNXB 1JMCA 1OTCA 1A0IA 2EQSA 3S2HH 1GVPA 5C44G 2VY3A 3M9BA 2IX1A 4B3RL 1R9TH 1XPUA 4P72A 3TQYA 1LTLA 4HIKA 4DKAC 4HJ7A 1QVCA 4JI4L 2VUMG 2R7ZH 2JQOA 1EWIA 1V43A 4UP9A 1HNZL 1PFSA 5HY6A 4DV3Q 4LFAQ 4POGA 1BKBA 3PO2H 1SN8A 4OWTB 1JJ2A 3KF8B 2UXBQ 4QIWE 3G4SA 3EN2A 2I0QA 3JAMi 1H95A 3WWVA 5K36G 4L5TA 2KHIA 4YHHL 1XTDA 1A62A 1D8LA 2QGQA 3FKIH 1K73C 1EFWA 1FJGL 3HOWH 5E7NA 3F2BA 1JT8A 4MNOA 2D0PA 3ZJYC 1CSQA 1Q46A 2HHHQ 4JI2L 2E8GA 2VQEL 3HOVG 3ULLA 1N34L 3T1HQ 4IPDA 3PO3G 2UUBL 3CW2C 4TVAB 4YWMA 4OWWB 1Q82C 3HOZH 4GKJQ 4BXXH 4JC0A 3CCRA 4IJLA 3GTJH 2EXDA 3KF6A 4KI0A 3K7UC 4JI8Q 4DV1Q 3H0GG 4A3EG 1IBLL 1TXYA 1EQQA 4LUVA 4LF9Q 2AWNA 2N49A 4R4IA 4X66Q 1G291 5C4XH 2N78A 4GNXC 4OONA 3U50C 5M5WH 3IRBA 5J3BA 1IYJB 2K5VA 2ZJRA 4DV3L 4LFAL 1FGUA 1E1TA 1HZ9A 1NBWA 1Q1EA 4UP7A 3I55A 3CCSA 1X3EA 1EUJA 4A76A 2E2HH 3S15H 5GAGC 2UXBL 2RHQB 2Z6KA 3ULPA 2K50A 3I4MH 2CCZA 1MKHA 2IHFA 4GOPA 3PUYA 1RL2A 1UE1A 4KHPQ 4YY3Q 4R4QA 2D62A 2UUCL 2QA4A 1QVGA 1OXTA 2HHHL 4JI3Q 5H1SE 3J7A5 2JA8H 3T1HL 5C3EG 2GVBA 2QEXA 2NN6I 3UE1A 4GKJL 3HOYH 3A0JA 1VQPA 1PVOA 4JBWA 2PQAA 3NEMA 2BH2A 2A19A 4DV1L 4JI8L 3L2PA 2KCMA 2WB1G 5GAEC 4LF9L 4X66L 4JI0Q 4MZ9A 1YZ6A 2WAQG 2ES2A 2Q2UA 1CKNB 1E1OA 1VS0A 2JA7G 3CQZH 1VQIA 2IX0A 1NMGA 1X54A 5GROA 2R6GA 1J6QA 4YCUA 3HOXG 2I5HA 4BY1G 1FL0A 4DNIA 4BA1I 1I3QH 3PF5A 1Q81C 4UPAA 4A3CG 2IT1A 1YI2A 1VQ5A 1BVSA 3GTOH 1XPOA 3PSIA 4YY3L 3KDFA 1VQHA 4OX9Q 4K0KQ 2UXDQ 3BZKA 4JI3L 2K5HA 4DK6C 4A3MG 1X3GA 5IP7H 1YNXA 3CC7A 4C2MH 5M3FH 4LFBQ 2RCNA 3STBD 2MO0A 2JK8A 5IYBH 4NXMQ 1HNXQ 3OW2A 2Q2IA 4UP8A 4A3KH 3EIVA 3S24A 3OYYA 4IPCA 4OWXB 4JI0L 3TS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLA C;  4B3S Q;  4HJ5 A;  2JJQ A;  1YEZ A;  3KJO A;  1EOV A;  1CKO A;  4GN3 B;  2ZTC A;  2A8V A;  4QL5 A;  1MJC A;  1BBU A;  4A4I A;  2VUM H;  3GTG H;  3AEV A;  4NXN Q;  4PMW A;  1N8R C;  1Q12 A;  1PH2 A;  1J5E Q;  2RF4 A;  4A3G G;  4HIM A;  1ASY A;  4OX9 L;  3BU2 A;  1PYB A;  4JI1 Q;  3RLN A;  4DAY B;  4LUO A;  1C7Y A;  4K0K L;  2UXD L;  1UE5 A;  1G51 A;  3KF6 B;  3RLF A;  3KFU A;  4LWC A;  1CKM A;  4DV5 L;  1IL2 A;  2OCE A;  1KD1 C;  4LFB L;  3F8T A;  3CCM A;  3PIP A;  5IP7 G;  3UDX A;  1VQB A;  4LW1 A;  1YHA A;  5M3M G;  1HNX L;  4NXM L;  3PUW A;  3GTM H;  3HOV H;  3S2D H;  3I4O A;  1JJC B;  3GDE A;  4C3I H;  3NEL A;  3PO3 H;  1PV4 A;  2VL6 A;  4B3M L;  1D7Q A;  1WI5 A;  1X9N A;  1G6P A;  4B3S L;  1QUQ B;  2Y0S G;  2WP8 J;  1VQJ A;  4A3E H;  4A3L G;  4P75 A;  4GOP B;  1I6H H;  2F3I A;  4DR6 Q;  2YTX A;  4JOI A;  3CAM A;  1VQL A;  5FLX c;  5GAH C;  1IBL Q;  4YCW A;  1O7I A;  4PZ7 A;  4NXN L;  1Z47 A;  1XNR Q;  1J5E L;  2VQF Q;  4X62 L;  4HJ9 A;  1HH2 P;  2CWP A;  2LXJ A;  3SGI A;  3ULJ A;  1SE8 A;  3H3V H;  3HOU G;  4OO1 I;  2ZM6 Q;  2YTV A;  5IYC G;  4ALP A;  4JI1 L;  1NMF A;  3GTP H;  2R92 G;  3S16 H;  2ATW A;  3EBE A;  2VZA A;  3L7Z C;  4A75 A;  3OTO Q;  1HZA A;  4LF5 L;  4P73 A;  1SR3 A;  2NVX H;  4POF A;  3TS2 A;  3G6E A;  3JAM c;  1K8G A;  4XIG S;  1XMQ Q;  3D31 A;  5C3E H;  2UUC Q;  1Y1V G;  4A93 H;  4UY8 C;  1E7Z A;  5ELN A;  1PH9 A;  2YYZ A;  1Z9F A;  3PIO A;  1WYD A;  4J15 A;  1QZH A;  2MFI A;  1I94 Q;  1PH8 A;  4DR6 L;  3KDF B;  5IYD G;  1XNR L;  4A3J G;  4LF4 Q;  2JA7 H;  4L5R C;  1FVI A;  1CUK A;  4A3F G;  3CD6 A;  1VQG A;  3HKZ G;  2VQF L;  2PI2 E;  3CME A;  3ERS X;  1UWV A;  1QZG A;  1WCM G;  1OXS C;  2Z6K C;  1PH4 A;  3HOX H;  1N9W A;  2ZM6 L;  2JEB I;  1AE2 A;  1W3S A;  5JJK A;  4GOP C;  4BY1 H;  4DV2 Q;  1VQO A;  2Q2H A;  4X6A H;  4A3C H;  2I5M X;  3FP9 A;  4PZ6 A;  3A5U A;  3J81 j;  3RNU A;  3E9I A;  3OTO L;  1I5F A;  2B3G A;  2LSS A;  1SLJ A;  1VQD A;  2CQO A;  3AFP A;  3J80 c;  4L5S A;  4DR2 L;  4A3M H;  4ME3 A;  5M5X H;  1L1O A;  2PNH A;  4YWL A;  1XMQ L;  2BH8 A;  3J81 c;  1L2F A;  2R7F A;  3MEF A;  5LMN W;  3PV0 A;  2ZJQ A;  4A93 G;  3PUZ A;  1SRU A;  1P16 A;  4RG1 A;  4YWK A;  1I94 L;  3G48 A;  3AYH B;  4LF4 L;  1TWC H;  1NY4 A;  4IJH A;  5LMN L;  4DR4 Q;  2Q2T A;  1KQS A;  3GTL H;  3AQQ A;  1VQ7 A;  1UE7 A;  1S3O A;  1PHJ A;  4GNX A;  3MXN B;  5IP9 G;  4DV2 L;  1X3F A;  5JEA J;  3KLW A;  1NTG A;  1VQA A;  3F2D A;  3KYH C;  4GS3 A;  5EAY A;  4A3G H;  3RN5 A;  3KJP A;  2HIV A;  1PA6 A;  1HJP A;  2F4V Q;  3S1M H;  4A3D G;  4BBS H;  4TQU S;  1VQ8 A;  1PH5 A;  4AYB E;  3STB C;  2IY5 B;  2E5L Q;  5JJI A;  2B29 A;  3JC6 6;  1X65 A;  4HJA A;  1L0W A;  1LUZ A;  1IZ6 A;  1U0L A;  4DAM A;  2OTJ A;  1XJV A;  5M3M H;  4DV5 Q;  2DGY A;  3TRE A;  4C3J H;  4JYA Q;  2BA1 A;  1YHB A;  2MO1 A;  4X64 Q;  4HIO A;  2DUD A;  3S1R H;  2YV5 A;  5HGQ A;  5C4J H;  3CF5 A;  3W1B A;  3S14 H;  3I4N G;  2UXC Q;  5C0X J;  4DR4 L;  3ER0 A;  2C35 B;  4B3M Q;  4A3L H;  3CPW A;  1YIJ A;  4APV A;  4IFD J;  4GLX A;  3GO5 A;  5IWA Q;  5C0X I;  4H02 A;  4IOC A;  2ZTE A;  5FJ8 G;  1PH1 A;  1WJJ A;  3HOU H;  1PH7 A;  1M1K C;  1RIP A;  4LF7 Q;  2F4V L;  4JV5 Q;  1VQ6 A;  5IYC H;  1I50 H;  2JEA I;  4IFD I;  3RN2 A;  4X62 Q;  2R92 H;  1V1Q A;  2E5L L;  4IO9 A;  2AMC B;  4X65 Q;  2K52 A;  4BBS G;  3Q8D A;  4JI6 Q;  3PGZ A;  4JBJ A;  3H15 A;  4JI7 Q;  3CP0 A;  4LUZ A;  2LXK A;  3B6Y A;  1SRO A;  3KOJ A;  4JYA L;  4LF5 Q;  1S40 A;  1HZB A;  4R4O A;  3W1G A;  4X64 L;  4Y7N H;  1OXX K;  1Y1V H;  4R4C A;  2YTY A;  1GKH A;  4GN5 A;  2UXC L;  2KHJ A;  3A74 A;  3BZC A;  2YU9 H;  2GVA A;  4JOI C;  1YIT A;  1X55 A;  4AQY Q;  1CSP A;  4HJ8 A;  1IBK Q;  2HIX A;  4QJF A;  2E2I H;  1VQC A;  1YJW A;  5IYD H;  4A3J H;  5IWA L;  1VQ9 A;  4A3F H;  2NVY H;  3M85 A;  1KRS A;  3F2C A;  1HR0 Q;  1E24 A;  2NZH A;  3GTQ H;  1TWG H;  1WCM H;  4P71 A;  4QGU A;  1TWF H;  1L1O B;  2R7D A;  4O2D A;  3I2Z A;  3U4V A;  1C9O A;  1K8A C;  4LF7 L;  1KAW A;  3GTK H;  4A3B G;  2JA5 G;  3GD7 A;  5IE8 A;  1BBW A;  1V9P A;  2JA6 G;  2N8N A;  2HT1 A;  5FLM G;  4X65 L;  4GKK Q;  2ZTD A;  3TRZ A;  4JV5 L;  2F52 A;  4JI6 L;  4AIM A;  1Y14 B;  4JG2 A;  4JI7 L;  1YJN A;  2PQA B;  3M3Y H;  4IPG A;  2OQ0 A;  4DV0 Q;  3K80 C;  4NPS A;  1N33 L;  2OTL A;  4LF6 Q;  3J7Z C;  2K5N A;  4GN4 B;  5IT9 c;  4P74 A;  4XTC S;  4DR2 Q;  1VQF A;  4LFC L;  4AH6 A;  1UE6 A;  1S72 A;  1JB7 A;  1HR0 W;  4WJ3 M;  1AE3 A;  2AKW B;  3W5O A;  3CCQ A;  4AQY L;  1VQM A;  4LF8 Q;  4OO1 G;  1B7Y B;  1AH9 A;  3S1Q H;  1VQE A;  4IPH A;  1IBK L;  3D0F A;  2B63 H;  4DR7 Q;  4QQB X;  3BJU A;  1HR0 L;  2OQK A;  2RHS B;  2K4K A;  2GN5 A;  2HQL A;  3A5Z B;  3UDI A;  4BBR G;  5LMN Q;  1XMO Q;  4DUY Q;  1VQN A;  2UU9 Q;  5IP9 H;  2CFM A;  2UUA Q;  4GKK L;  2IHE A;  1IXR A;  2ID0 A;  4C3H H;  4A3I G;  4DR5 Q;  3F1Z A;  2WB1 E;  1EQR A;  1Y1W H;  3PUV A;  2KBN A;  2MQH A;  4EQ5 A;  2VW9 A;  1Q8K A;  1L1O C;  2WAQ E;  4LNQ A;  4A3D H;  1UEB A;  1YJ9 A;  2ASB A;  3CMA A;  4DV0 L;  3H3V I;  1TWA H;  1JE5 A;  5GQO A;  3K0X A;  3UE0 A;  4LF6 L;  1T9H A;  1E3P A;  2JE6 I;  2R93 G;  5GAD C;  1M90 C;  4BY7 G;  2L15 A;  2K75 A;  3CCJ A;  4LF8 L;  4PZ8 A;  4DR3 Q;  4DV4 Q;  1DGS A;  1KL9 A;  1K83 H;  1JJG A;  3DM3 A;  3RLO A;  1EIY B;  3CCL A;  4L5Q A;  1WOC A;  4DR7 L;  3I4N H;  3CPF A;  2E2J H;  2PI2 A;  3CCE A;  2NVT H;  1VCI A;  2Z0S A;  2XTI A;  2AWO A;  1XMO L;  3M4P A;  4DUY L;  4HID A;  3T1Y Q;  2UU9 L;  4B3T Q;  2I5L X;  2R7Z G;  1QUQ A;  3J80 i;  1OXU A;  5FJ8 H;  1W2B A;  2UUA L;  3K8A A;  1EYG A;  1IBM Q;  4DR5 L;  3G71 A;  3PO2 G;  4QY7 A;  3DLL A;  4JBM A;  1N36 Q;  1LYL A;  3J81 i;  1N32 Q;  4R1J A;  4PG3 A;  3PCO B;  3CCV A;  1PH3 A;  1YHQ A;  1A63 A;  1B70 B;  1Y1W G;  3HOW G;  2MNA A;  1C0A A;  2NN6 G;  3FKI G;  4DUZ Q;  1X56 A;  1Q86 C;  3M7N A;  1KHI A;  2JA9 A;  3AFQ A;  3PUX A;  3TEH B;  1HZC A;  3NBH B;  3LGJ A;  1SFO H;  1U5K A;  1QVF A;  4DR3 L;  3HOZ G;  4DV4 L;  1XNQ Q;  1SMX A;  4BXX G;  1HNW Q;  1Q7Y C;  1NE3 A;  2B63 G;  2NVQ H;  5JJL A;  2FXQ A;  2CKZ B;  5LMU Q;  3CC2 A;  4OXP A;  3M4O H;  4KHZ A;  3E9H A;  5C4X G;  3T1Y L;  1X6O A;  2XGT A;  1P8L A;  4B3T L;  5BR8 Q;  4Y52 H;  5JEA G;  1KRT A;  1ASZ A;  1B8A A;  5IY0 A;  2D0O A;  1NJI C;  5M5Y H;  1IBM L;  2ZJP A;  3S17 H;  3S1N H;  1EIF A;  3HKS A;  3NEN A;  1TWH H;  2V1C C;  1KXL A;  4DV6 Q;  4A3B H;  5DLQ E;  1N36 L;  4GLV B;  1MJE A;  3E0E A;  4DPG A;  5AJ3 Q;  2JA5 H;  2JA6 H;  4KHP L;  3L0O A;  3I4M G;  1N32 L;  2VNU D;  1GM5 A;  2Y0S E;  1YVC A;  5FLM H;  3CCU A;  4DUZ L;  3CC4 A;  1XPR A;  4YCV A;  4IOA A;  3RR5 A;  4DK3 C;  1YBY A;  1GD7 A;  2JA8 G;  4DR1 Q;  4JI5 Q;  1XNQ L;  3I7F A;  3HOY G;  3ICE A;  3PF4 A;  1KIX A;  3FHW A;  1HNW L;  1OXV A;  5C0X G;  4DV7 Q;  1N33 Q;  4BA2 I;  5LMU L;  3K81 C;  4RMF A;  3U58 A;  4O0A A;  4JCV E;  2NZO A;  5C44 H;  4LFC Q;  4KLK A;  4AYB G;  4IFD G;  3M4Q A;  2H5X A;  1PYS B;  5BR8 L;  3I56 A;  2PMZ E;  1GO3 E;  2KEN A;  2EIF A;  4B3R Q;  4DV6 L;  1LM0 A;  4BBR H;  4JBK A;  3RZD H;  4JI4 Q;  1MIU A;  5AJ3 L;  2OWO A;  1HNZ Q;  4A3I H;  2BA0 A;  4WJ4 A;  2K14 A;  1CKN A;  4EX5 A;  1K9M C;  3UDG A;  1K0R A;  1E22 A;  1K3R A;  2ALY B;  4DR1 L;  4YHH Q;  2VS1 A;  3HKZ E;  1KC8 C;  4JI5 L;  3UDF A;  2AHO B;  3HFZ B;  5M3F G;  1VQK A;  1FJG Q;  1VQ4 A;  3RZO H;  1Q1B A;  5ELO A;  2CWA A;  4R4T A;  2R93 H;  1A8V A;  5IYB G;  4BY7 H;  2N3S A;  4JI2 Q;  4NB3 A;  4DV7 L;  2VQE Q;  4A3K G;  3K7A H;  4FDB A;  1N34 Q;  1WFQ A;  4MTN A;  1PH6 A;  3U4Z A;  2WFW A;  2KCT A;  3VDY A;  2A1A A;  2UUB Q;  3H0G H;  3CXC A;  4GNX B;  1JMC A;  1OTC A;  1A0I A;  2EQS A;  3S2H H;  1GVP A;  5C44 G;  2VY3 A;  3M9B A;  2IX1 A;  4B3R L;  1R9T H;  1XPU A;  4P72 A;  3TQY A;  1LTL A;  4HIK A;  4DKA C;  4HJ7 A;  1QVC A;  4JI4 L;  2VUM G;  2R7Z H;  2JQO A;  1EWI A;  1V43 A;  4UP9 A;  1HNZ L;  1PFS A;  5HY6 A;  4DV3 Q;  4LFA Q;  4POG A;  1BKB A;  3PO2 H;  1SN8 A;  4OWT B;  1JJ2 A;  3KF8 B;  2UXB Q;  4QIW E;  3G4S A;  3EN2 A;  2I0Q A;  3JAM i;  1H95 A;  3WWV A;  5K36 G;  4L5T A;  2KHI A;  4YHH L;  1XTD A;  1A62 A;  1D8L A;  2QGQ A;  3FKI H;  1K73 C;  1EFW A;  1FJG L;  3HOW H;  5E7N A;  3F2B A;  1JT8 A;  4MNO A;  2D0P A;  3ZJY C;  1CSQ A;  1Q46 A;  2HHH Q;  4JI2 L;  2E8G A;  2VQE L;  3HOV G;  3ULL A;  1N34 L;  3T1H Q;  4IPD A;  3PO3 G;  2UUB L;  3CW2 C;  4TVA B;  4YWM A;  4OWW B;  1Q82 C;  3HOZ H;  4GKJ Q;  4BXX H;  4JC0 A;  3CCR A;  4IJL A;  3GTJ H;  2EXD A;  3KF6 A;  4KI0 A;  3K7U C;  4JI8 Q;  4DV1 Q;  3H0G G;  4A3E G;  1IBL L;  1TXY A;  1EQQ A;  4LUV A;  4LF9 Q;  2AWN A;  2N49 A;  4R4I A;  4X66 Q;  1G29 1;  5C4X H;  2N78 A;  4GNX C;  4OON A;  3U50 C;  5M5W H;  3IRB A;  5J3B A;  1IYJ B;  2K5V A;  2ZJR A;  4DV3 L;  4LFA L;  1FGU A;  1E1T A;  1HZ9 A;  1NBW A;  1Q1E A;  4UP7 A;  3I55 A;  3CCS A;  1X3E A;  1EUJ A;  4A76 A;  2E2H H;  3S15 H;  5GAG C;  2UXB L;  2RHQ B;  2Z6K A;  3ULP A;  2K50 A;  3I4M H;  2CCZ A;  1MKH A;  2IHF A;  4GOP A;  3PUY A;  1RL2 A;  1UE1 A;  4KHP Q;  4YY3 Q;  4R4Q A;  2D62 A;  2UUC L;  2QA4 A;  1QVG A;  1OXT A;  2HHH L;  4JI3 Q;  5H1S E;  3J7A 5;  2JA8 H;  3T1H L;  5C3E G;  2GVB A;  2QEX A;  2NN6 I;  3UE1 A;  4GKJ L;  3HOY H;  3A0J A;  1VQP A;  1PVO A;  4JBW A;  2PQA A;  3NEM A;  2BH2 A;  2A19 A;  4DV1 L;  4JI8 L;  3L2P A;  2KCM A;  2WB1 G;  5GAE C;  4LF9 L;  4X66 L;  4JI0 Q;  4MZ9 A;  1YZ6 A;  2WAQ G;  2ES2 A;  2Q2U A;  1CKN B;  1E1O A;  1VS0 A;  2JA7 G;  3CQZ H;  1VQI A;  2IX0 A;  1NMG A;  1X54 A;  5GRO A;  2R6G A;  1J6Q A;  4YCU A;  3HOX G;  2I5H A;  4BY1 G;  1FL0 A;  4DNI A;  4BA1 I;  1I3Q H;  3PF5 A;  1Q81 C;  4UPA A;  4A3C G;  2IT1 A;  1YI2 A;  1VQ5 A;  1BVS A;  3GTO H;  1XPO A;  3PSI A;  4YY3 L;  3KDF A;  1VQH A;  4OX9 Q;  4K0K Q;  2UXD Q;  3BZK A;  4JI3 L;  2K5H A;  4DK6 C;  4A3M G;  1X3G A;  5IP7 H;  1YNX A;  3CC7 A;  4C2M H;  5M3F H;  4LFB Q;  2RCN A;  3STB D;  2MO0 A;  2JK8 A;  5IYB H;  4NXM Q;  1HNX Q;  3OW2 A;  2Q2I A;  4UP8 A;  4A3K H;  3EIV A;  3S24 A;  3OYY A;  4IPC A;  4OWX B;  4JI0 L;  3TS0 A; 
#chains in the Genus database with same CATH topology
 1HFN A;  2K5W A;  4F8M A;  3I3C A;  2F0S A;  4QL5 A;  3AEV A;  1DXM A;  1EQV A;  1JOK A;  4A3G G;  5KYL A;  1EYD A;  1JQY D;  3NTI A;  1SEB D;  1ASY A;  3PO2 B;  1PYB A;  3RLN A;  3LNN A;  4LUO A;  3T51 B;  4JW0 A;  3KF6 B;  3KFU A;  1GXD C;  1V8Q A;  1IL2 A;  1RTN A;  5IP7 G;  2KHS A;  5IT9 E;  3OIP A;  4M8A A;  3GDE A;  4C3I H;  3N6R A;  2VL6 A;  1SNM A;  4B3M L;  1D7Q A;  1DD2 A;  5EBC A;  4B3S L;  1QUQ B;  1DCZ A;  4CJ1 B;  4A3L G;  1KNE A;  2F3I A;  4ZQ3 A;  4DR6 Q;  2YTX A;  4ZRZ A;  1Z47 A;  3NUC A;  2PW7 A;  1FD7 D;  2B2Y A;  1SE8 A;  4LJZ C;  3S15 B;  2YTV A;  1F2Z A;  2E2H B;  4JI1 L;  5KIX A;  1NMF A;  1TS4 A;  1B50 A;  3D6W A;  2VZA A;  4A75 A;  4A3M B;  5M5X B;  1F9R A;  1S5D D;  2NVX H;  2A73 B;  3TS2 A;  2UUC Q;  1HA6 A;  5C3E H;  1Y1V G;  1WTW A;  1FNV A;  4K14 A;  1PZK D;  2YYZ A;  1Z9F A;  3PIO A;  1JOQ A;  4QCL A;  2BOS A;  2A68 D;  2JA7 H;  5I2Y A;  1FVI A;  3CQZ B;  3S1Q H;  3HKZ G;  1QZG A;  3ERS X;  2PW5 A;  2Z6K C;  3HOX H;  3TZD A;  3S1M B;  2I5M X;  4PZ6 A;  3RNU A;  3J81 j;  3OTO L;  4OEL B;  1O7Z A;  3AFP A;  1IHZ A;  3I8Z A;  3EVQ A;  1XMQ L;  2BH8 A;  1L2F A;  2HCC A;  3GP7 A;  4KN7 C;  2VB2 X;  2DN8 A;  3S14 B;  4A3K B;  2F0H A;  1SRU A;  3OOC A;  1EY6 A;  1I94 L;  3MHB A;  1B44 D;  3QO2 A;  2EE1 A;  3SK6 A;  1SMY C;  2VB3 X;  3ONA B;  1WD1 A;  4IJH A;  2E74 C;  3QG1 A;  3BDC A;  1VQ7 A;  1UE7 A;  1S3O A;  4ILW A;  5IP9 G;  4DV2 L;  1VQA A;  5I2X A;  1IYV A;  5EAY A;  4GS3 A;  4CKB A;  4CHT B;  3MXU A;  1QB5 D;  2HIV A;  1HJP A;  3VA5 A;  1D1I A;  2IY5 B;  2DY8 A;  3VR4 A;  2B39 A;  3JC6 6;  4KY7 A;  1Y1V B;  2F0G A;  2XWB B;  4DAM A;  3OW7 A;  4DV5 Q;  3TRE A;  4C3J H;  4JYA Q;  2BA1 A;  1YHB A;  4R8N A;  4HIO A;  5EPL A;  1ENF A;  1PRT F;  1HUN A;  5CBE E;  2NZ1 D;  3C2P A;  5J1Z A;  3ER0 A;  2C35 B;  2NVY B;  2F0Q A;  3BG3 A;  2SNM A;  2B2W C;  1TWF B;  4GLX A;  1AEX A;  1PH1 A;  2ZTE A;  5FJ8 G;  4CJ2 C;  1EFI D;  1M1K C;  1RIP A;  5TSS A;  5FKA C;  5T1I A;  1JC7 A;  3BVZ A;  2LY7 A;  3QIA A;  4JI6 Q;  5DEH A;  3QWN A;  4F87 A;  2ZT9 C;  2NVX B;  2LXK A;  3L3O C;  1ZEQ X;  5C3E B;  3Q23 A;  1I4Q A;  4GN5 A;  4C3J G;  1PLF A;  2N88 A;  2EOT A;  1CSP A;  4ZKB B;  4PQX A;  1EU4 A;  4QJF A;  1VQC A;  3WOE A;  4A3F H;  1KRS A;  3TSS A;  1WCM H;  1XPR A;  4QGU A;  3HOX B;  4JV5 L;  1EIG A;  1U4M A;  2F0N A;  4V0B A;  1C9O A;  1WTO A;  1K8A C;  1KAW A;  4A3B G;  5JPN C;  2JA5 G;  5IE8 A;  1V9P A;  5K5P A;  5FLM G;  2SEB D;  2RSN A;  4X65 L;  3TRZ A;  2F52 A;  2N55 A;  3X3M A;  1O7L A;  1CA5 A;  1JWU D;  4JG2 A;  4G7Z C;  3MVV A;  1R4P B;  4IPG A;  4LK1 C;  4B08 A;  4RGO S;  5FLX L;  1E0B A;  1Q90 A;  4F7X A;  2B8F A;  1N33 L;  2XWJ B;  1X32 A;  3QJY A;  3D4W A;  1HR0 W;  1AE3 A;  1QCB D;  4ID6 A;  4XXE A;  1ENA A;  2NVT B;  3E0J A;  3MAQ A;  1HR0 L;  2RHS B;  2K4K A;  2GN5 A;  2L4N A;  3A5Z B;  5LMN Q;  1XMO Q;  3SK8 A;  3W2D A;  2CFM A;  2K33 A;  3OSO A;  4A3I G;  4TRD A;  3K58 A;  2NN6 H;  4A3D H;  4DV0 L;  5GQO A;  3I73 A;  4BY7 G;  2K75 A;  2PZU A;  3CCJ A;  4C3J B;  3MXG A;  4PZ8 A;  4DR3 Q;  2EZV A;  4RCN A;  1WVL A;  3CCL A;  1EIY B;  1CA6 A;  3I4N H;  3CPF A;  1F2L A;  1VCI A;  2DNE A;  4K8J A;  5JVH 3;  3S1N B;  4DUY L;  4HID A;  2UU9 L;  2Z4H A;  4A3B B;  1BCP D;  2JA5 B;  2RQX A;  3E5S A;  4CDE C;  5FO9 B;  2NN6 G;  4DUZ Q;  3R8B A;  1TY0 A;  3SK5 A;  3PUX A;  3E6Z X;  3TEH B;  2VXW A;  3LGJ A;  4MIU A;  4ABN A;  1XNQ Q;  5IGG A;  1HNW Q;  1Q7Y C;  1BR9 A;  2NVQ H;  5JJL A;  3CC2 A;  1IKM A;  1OO9 B;  3H91 A;  2EYL A;  1X6O A;  2XGT A;  5C4Z A;  4B3T L;  5BR8 Q;  1ASZ A;  1B8A A;  3S17 H;  5CV5 A;  1TWH H;  4A3I B;  4DV6 Q;  4DNT B;  5DLQ E;  5EJW A;  2KCN A;  3L0O A;  5T1G A;  3I4M G;  3SXH A;  3CCU A;  1DOL A;  4H7B A;  1MBY A;  1LTG D;  1K28 A;  2F0K A;  2AUK A;  2Z9H A;  4IOA A;  1YBY A;  2JA8 G;  4BY7 B;  1NSN S;  4JI5 Q;  3ERO A;  2F0L A;  3HOY G;  1PRT C;  1ZYR C;  2EJM A;  3PF4 A;  2HCI A;  2R61 A;  5LMU L;  4ZAI A;  5C44 H;  1QNK A;  4AYB G;  3D8G A;  3I56 A;  1BXT A;  5FK9 C;  4S3S A;  2NYZ D;  2BCO A;  5FLX E;  1G8Z D;  1K8O A;  2B2W A;  2EIF A;  1LM0 A;  4B9X A;  4BBR H;  5C5M A;  4JI4 Q;  1NR2 A;  4EGV A;  5C5L A;  1LO5 D;  3UI2 A;  2H4O A;  4EX5 A;  4A3D B;  1K9M C;  3ZYY X;  4YHH Q;  1Q3L A;  3HKZ E;  1KC8 C;  2AHO B;  2CW0 C;  1FJG Q;  2KOL A;  5E3F A;  2D2C C;  2CWA A;  1A8V A;  3CRK C;  2N3S A;  3P75 A;  4CGY B;  4DV7 L;  1WFQ A;  2NTT A;  3Q6S A;  3U4Z A;  2RSO A;  2KCT A;  1QE6 A;  3VDY A;  1SNC A;  3CXC A;  1KDB A;  2EQS A;  3K5L A;  1F9Q A;  5C44 G;  1XPU A;  4P72 A;  4WRD A;  2JQO A;  2R7Z H;  4DV3 Q;  4LFA Q;  4POG A;  3NHH A;  4QUF A;  1SN8 A;  1U4P A;  3KF8 B;  3NWS A;  3G4S A;  3D4D A;  3K57 A;  2NB0 A;  1H95 A;  3WWV A;  5K36 G;  2F0U A;  2QGQ A;  3FKI H;  1K73 C;  1EFW A;  3F2B A;  5KGU A;  3TP7 A;  5CV8 A;  1SYC A;  1Q46 A;  4JI2 L;  1FGB D;  2E8G A;  1N34 L;  1A3U A;  1CFM A;  3QOJ A;  4R9W A;  1Q82 C;  4BXX H;  4JC0 A;  3CU7 A;  1EIH A;  3MFY A;  2NVQ B;  3KF6 A;  5C6A A;  3K7U C;  4A3E G;  1EQQ A;  4P2C B;  2KUM A;  4LUV A;  2N49 A;  4XQQ A;  5C4X H;  2N78 A;  4GNX C;  3U50 C;  1L0Y B;  1U4L A;  1EY7 A;  1TKW B;  5J3B A;  2ZJR A;  1CQF A;  3CCS A;  1Q1E A;  4A76 A;  3RUZ A;  1EUJ A;  1XX8 A;  5GAG C;  3AB9 A;  3ULP A;  1EY4 A;  1H9J A;  3PUY A;  3BVG A;  4KHP Q;  4YY3 Q;  2D62 A;  2XVS A;  3J7A 5;  1Z7T A;  1PXU A;  2NN6 I;  4GKJ L;  2WAC A;  2BH2 A;  3NEM A;  1PZJ D;  4HSP A;  2L12 A;  4LF9 L;  5EPJ A;  4X66 L;  5C44 B;  2WAQ G;  4NW2 A;  5A35 A;  4IFD H;  1ZXT A;  3GTG B;  1JWM D;  1QNU A;  2R6G A;  2Z6B A;  4FVM A;  1YNN C;  2L9H A;  4BY1 G;  1WTH A;  4DNI A;  4UAI A;  1I3Q H;  1Q81 C;  3A56 A;  3GTO H;  1XPO A;  3VR6 A;  2EDG A;  3CRL C;  3GTM B;  3STB D;  1F77 A;  2RDH A;  5IYB H;  1V1O A;  5M9O A;  2Q2I A;  5CV7 A;  4CJ0 B;  4KTA A;  1O78 A;  1S5C D;  4IPC A;  4OWX B;  3TP5 A;  4A3E B;  3C1E A;  4B3S Q;  5C3W A;  1CKO A;  2RCF A;  3A8J E;  5E4X A;  1JE4 A;  2EY1 A;  1BBU A;  2VUM H;  2R7Z B;  2BE5 C;  1DYQ A;  1PTO H;  5D14 A;  3BU2 A;  1HTP A;  3G6J B;  4H0L C;  4JI1 Q;  3TBI B;  4G4K A;  1LT3 D;  2D5D A;  3RLF A;  3K59 A;  1CKM A;  1K0S A;  4LFB L;  2BE5 D;  2EY2 A;  2QDB A;  3F8T A;  4X3S A;  3PIP A;  1VQB A;  2A6H C;  4NXM L;  1HNX L;  2MUY A;  3NEL A;  5CYU A;  3WOF A;  4HED A;  4RGM A;  1WI5 A;  1X9N A;  1G6P A;  1VQJ A;  3NBH A;  2XIW A;  4P75 A;  2GA4 B;  1VQL A;  5GAH C;  5C4X B;  1O7I A;  1U4R A;  2I46 A;  4IUN A;  4NXN L;  4BY1 B;  1J5E L;  3HOU G;  3FPP A;  4ALP A;  3H3V C;  2A69 C;  1SJH D;  3OTO Q;  2D9U A;  4P73 A;  5IOD A;  1EL0 A;  4POF A;  5HGT A;  3JAM c;  3P1H A;  1XMQ Q;  4DK0 A;  1F2Y A;  2MJ8 A;  1E7Z A;  5ELN A;  1GUS A;  4QUC A;  1PH9 A;  2KEE A;  1E2V A;  2KCC A;  1I94 Q;  3KDF B;  5IYD G;  4PMC A;  1XNR L;  4A3J G;  4DU9 A;  1VQG A;  3CME A;  2C9O A;  3FDT A;  1N9W A;  4HMI A;  5E4W C;  5JJK A;  4GOP C;  3IKJ A;  4DV2 Q;  2F0V A;  4X6A H;  4A3C H;  3FP9 A;  5D3D A;  2LSS A;  1W6J A;  1SLJ A;  1VQD A;  4L5S A;  3J80 c;  5FO8 B;  5JJZ A;  2BDN A;  3HRZ C;  4A3M H;  4ME3 A;  1HHV A;  5M5X H;  1FNU A;  2PNH A;  4FXG C;  3J81 c;  3MEF A;  3S1R B;  3MXP A;  1SE3 A;  3PUZ A;  4RG1 A;  2Q8R E;  3J80 L;  1EYC A;  3NSW A;  5FO7 B;  3R93 A;  4TKO B;  3J81 L;  1KLG D;  2OT2 A;  3U9O A;  4GNX A;  1TVX A;  5BN5 A;  4C3H G;  3H94 A;  4A3G H;  1LTS D;  1PTO B;  1MGS A;  3S1M H;  2AQ2 B;  3EJI A;  4TQU S;  4AYB E;  1HPC A;  2B29 A;  4JPB W;  2ZXO A;  3MA2 B;  2OTJ A;  3BS1 A;  1ONL A;  2MO1 A;  2YV5 A;  2DJF C;  3CF5 A;  4KHV A;  3S14 H;  1MI2 A;  1VMC A;  1CZW A;  3RD4 A;  1DJR D;  4ZUJ A;  3SK4 A;  4A3L H;  1TWG B;  4IFD J;  4FNF A;  3GO5 A;  5J22 A;  3GTK B;  4H02 A;  4IOC A;  2K32 A;  1PH7 A;  2MPM A;  4JV5 Q;  2SOB A;  4IFD I;  4X62 Q;  1V1Q A;  4X65 Q;  3H6M A;  2K52 A;  3NQI A;  3PGZ A;  3H15 A;  1NCV A;  4LUZ A;  1SRO A;  1SBB B;  4LF5 Q;  5I9O A;  2B2V A;  4R4O A;  4X64 L;  1EZ6 A;  5BN4 A;  1Y1V H;  1CQV A;  1GKH A;  2UXC L;  2KHJ A;  3BZC A;  2YU9 H;  2GVA A;  4JOI C;  4QIW B;  4CKC A;  1X55 A;  1YIT A;  3EA6 A;  2JN4 A;  2E2I H;  4XQJ A;  4NDX A;  1YJW A;  1VQ9 A;  1TT2 A;  2NVY H;  2O4X A;  4N9P A;  1E24 A;  1HR0 Q;  4P71 A;  1TWF H;  4LF7 L;  2R7D A;  3U4V A;  2ICE C;  3GD7 A;  1BBW A;  2HDL A;  2N8N A;  2HT1 A;  1U9R A;  2KEC A;  3IL8 A;  2F0F A;  1HFG A;  4JI7 L;  1RD9 D;  4DV0 Q;  3K80 C;  1DM0 B;  1B1Z A;  2OTL A;  1KDC A;  2K5N A;  3I90 A;  4GN4 B;  4Z9C B;  1STG A;  4DR2 Q;  1VQF A;  4LFC L;  2A68 C;  5JAV A;  4MHE A;  4AQY L;  2NTS A;  1VQM A;  4OO1 G;  1D2B A;  1IBK L;  1CT1 D;  2L11 A;  3D0F A;  4QQB X;  1HTL D;  2K6A A;  2OQK A;  4RA8 A;  1STH A;  4DUY Q;  3VYT A;  2UU9 Q;  1H9S A;  5IP9 H;  4IN3 A;  3OHX C;  2XN9 C;  1X3P A;  4GKK L;  1A2T A;  4A3G B;  5ELE A;  1EQR A;  1AZP A;  2MQH A;  4EQ5 A;  1L1O C;  1SDF A;  2WAQ E;  3J80 E;  4LNQ A;  2ASB A;  3CMA A;  2AUJ D;  1TWA H;  1JE5 A;  3K0X A;  3UE0 A;  2EJG C;  5NUC A;  2JE6 I;  1H9R A;  4DAY A;  3V2T A;  2EXZ A;  5IOC A;  1MSH A;  2FMM A;  2K01 A;  4CDD C;  1KL9 A;  4G7H C;  3A55 A;  1WOC A;  2QDL A;  4DR7 L;  1IW7 D;  1F9S A;  3EQL C;  3CCE A;  2NVT H;  3M4P A;  3BDL A;  4B3T Q;  2I5L X;  1A3T A;  1OXU A;  5FJ8 H;  5KNB A;  2UUA L;  1ROD A;  4PG3 A;  4EQP A;  3CCV A;  1A63 A;  4FP5 D;  1B70 B;  5CV9 A;  1S5B D;  3HOW G;  3ND9 A;  1PRT B;  1Q86 C;  1KHI A;  3AFQ A;  1HZC A;  3NBH B;  5C3X A;  2MGS A;  2EYO A;  3OIQ A;  3KF8 A;  2E2D C;  2X6G A;  2G9D A;  2YU9 B;  4LMQ D;  2FXQ A;  5LMU Q;  1CK1 A;  4OXP A;  1LT6 D;  5AFW A;  4RHR A;  3Q24 A;  2E2I B;  2PZT A;  5JEA G;  3RZD B;  3HKZ B;  3E3X A;  1NJI C;  1IBM L;  3S1N H;  3NEN A;  4KJN A;  4A3B H;  1N36 L;  3E0E A;  1N32 L;  2JA5 H;  4PV1 C;  3Q22 A;  5FLM H;  1YVC A;  1TR5 A;  3J7A V;  3A8I E;  1STN A;  3RR5 A;  1DOM A;  4F88 A;  1KIX A;  3FHW A;  4N9T A;  5D65 A;  5C0X G;  4DV7 Q;  4BA2 I;  2XNA C;  3K81 C;  2F0O A;  5G3L F;  4RMF A;  3MZ5 A;  1LTA D;  2G9H D;  2QEJ C;  4JCV E;  1ILP A;  1R9T B;  4E6I A;  3OWE B;  1Y69 U;  2A74 C;  1BQQ T;  3KLS A;  2OWO A;  1AP0 A;  4A3I H;  4IUT A;  3KBG A;  4OIJ A;  1JR0 D;  3UDG A;  4V19 0;  1K0R A;  3OMC A;  1R4Q B;  1E22 A;  1TWA B;  3UDF A;  5M3F G;  3RZO H;  1D5Z C;  4HN7 A;  5ELO A;  4R4T A;  2JYO A;  4BY7 H;  4JI2 Q;  2V4D A;  4C1N I;  5IIF A;  4FDB A;  4KKU A;  1N34 Q;  1PH6 A;  2WFW A;  2A1A A;  5ELC A;  2M00 A;  1XTC D;  4GNX B;  1A0I A;  2QF7 A;  4FF2 A;  1LV9 A;  2HDM A;  3TQY A;  1LTL A;  4HIK A;  2PO4 A;  3G7L A;  4X3K A;  4DKA C;  1CI3 M;  1EWI A;  1V43 A;  4CBV A;  1EY0 A;  3VR2 A;  4OWT B;  1RDP D;  4QIW E;  3K5N A;  2AQ1 B;  2HD3 A;  4Y52 H;  2CHB D;  2L5T A;  1GUO A;  3ZJY C;  2D0P A;  1CSQ A;  1STE A;  3HOV G;  1Y8O B;  2VQE L;  3ULL A;  3OWF A;  1II3 A;  2Q8T A;  1GOZ A;  4U67 3;  1WTR A;  4WFN 3;  2UUB L;  3PO3 G;  4OIK A;  3K0Y A;  4GKJ Q;  2CVR A;  1ESF A;  1ZKO A;  2EXD A;  3K6O A;  1BCP C;  2CH4 W;  4LF9 Q;  4X66 Q;  1HQR D;  2KED A;  2SDF A;  5DM7 3;  5M5W H;  2K5V A;  1SSO A;  1QZH A;  3I55 A;  1GUW A;  4RGT A;  4J8Q A;  5DM6 3;  2Z6K A;  2K50 A;  3I4M H;  1MKH A;  1EWC A;  2UUC L;  4DF7 A;  5M3F B;  1V1P B;  1RTO A;  3A8K E;  1D5M C;  2HHH L;  5H1S E;  2JA8 H;  2K5D A;  3T1H L;  1ICW A;  2QEX A;  5D3I B;  1IYU A;  3HOY H;  2F0M A;  4JBW A;  2PQA A;  4TSS A;  2EYF A;  4DV1 L;  3L2P A;  2A6E D;  2WB1 G;  2F4I A;  4DAP A;  1YZ6 A;  5I6W A;  2ES2 A;  2Q2U A;  2PPB C;  1CKN B;  1E1O A;  1VS0 A;  2F3V A;  4WOR A;  1VQI A;  2IX0 A;  3KK7 A;  4I65 A;  5GRO A;  1J6Q A;  3NK9 A;  4YCU A;  1ENC A;  4Q5V A;  1FL0 A;  4K6D A;  5KEE A;  3PF5 A;  1G6Z A;  5IGD A;  2IT1 A;  1BVS A;  3PSI A;  3KDF A;  2KVM A;  3BZK A;  2H1E A;  1KTK A;  1YNX A;  3CC7 A;  3RZO B;  4IUU A;  4LFB Q;  2RCN A;  3PO3 B;  2JK8 A;  4NXM Q;  1HNX Q;  4FF4 A;  1PMR A;  3OW2 A;  4UP8 A;  1PYW D;  3TS0 A;  1I6H B;  1H9S B;  4HJ5 A;  1YEZ A;  3KJO A;  1EOV A;  4GN3 B;  2ZTC A;  3NWT A;  5I4D A;  4CKE A;  3NTH A;  1MJC A;  3GTG H;  1ICF B;  4KKT A;  4NXN Q;  1Q12 A;  1J5E Q;  1AFP A;  4ODG A;  4OX9 L;  4DAY B;  1EWH A;  1C7Y A;  2UXD L;  1SAP A;  1G51 A;  2F0P A;  3NQT A;  5K36 H;  4LWC A;  5ELB A;  2NUC A;  4DV5 L;  2EY6 A;  2OCE A;  4OL7 A;  1KD1 C;  1B53 A;  3CCM A;  1PDQ A;  4LW1 A;  1YHA A;  5M3M G;  3GTM H;  3PUW A;  3S2D H;  3I4O A;  1SYF A;  2WB1 B;  2O5J C;  4BS9 A;  2E75 C;  2L1B A;  2Y0S G;  5CMD A;  4A3E H;  3TDQ A;  2J7Z A;  4GOP B;  1KNA A;  3CAM A;  3V05 A;  1XNR Q;  1IBL Q;  4PZ7 A;  2TMP A;  5M5W B;  1BO0 A;  4J6H A;  4HJ9 A;  2CWP A;  2LXJ A;  5IYC G;  2X69 A;  2Z4I A;  4DXG A;  3GTP H;  1LTR D;  1YNJ D;  4MTK A;  2R92 G;  3S16 H;  3EBE A;  3I4M B;  1Y8P B;  2WV6 D;  3L7Z C;  4YIJ A;  1BNZ A;  1HZA A;  2BDO A;  2F0W A;  1GUN A;  4X3U A;  2JA8 B;  3GV6 A;  4DXF A;  2R3Z A;  4UY8 C;  3HOY B;  1X3Q A;  1SE2 A;  3GTL B;  3NXW A;  1PH8 A;  4ZYS A;  4AYB B;  5JOB A;  4L5R C;  1CUK A;  5C4H A;  2VQF L;  1UWV A;  1OXS C;  3RMH A;  2ZM6 L;  1AE2 A;  4BY1 H;  4R8I A;  2HQE A;  2Q2H A;  1UAP A;  2PZW A;  2P5Z X;  2CQO A;  3MEH A;  5M3M B;  1E2W A;  2R7F A;  5LMN W;  3PV0 A;  2ZJQ A;  2Y0S B;  2RDF A;  4YWK A;  3G48 A;  5CV4 A;  4NP5 A;  1JB3 A;  4LF4 L;  1KDA A;  1QIL A;  5LMN L;  2EYP A;  3AQQ A;  3MXN B;  4RHS A;  3KLW A;  5EKL A;  1NTG A;  4U68 A;  3F2D A;  3KYH C;  2R92 B;  5COR A;  1T5E A;  3DWQ A;  3RN5 A;  4BBS H;  4DAV A;  3STB C;  4CDC C;  4CDF C;  1MD2 D;  4L6T B;  4HJA A;  1JWS D;  1L0W A;  4Y7N B;  1IZ6 A;  1EQT A;  1XJV A;  3S2D B;  1BUV T;  2DGY A;  4X64 Q;  2DUD A;  4RCO A;  3QOL A;  5HGQ A;  5IGF A;  3K5M A;  3S1R H;  3W1B A;  1I4G A;  4RKL A;  2UXC Q;  2NWG A;  4DR4 L;  1KLU D;  3C1F A;  4B3M Q;  4K5V A;  1YIJ A;  4APV A;  1E2Z A;  5EPK A;  3HOU H;  2OXP A;  4LF7 Q;  2F4V L;  1VQ6 A;  3GTP B;  2F0E A;  3RN2 A;  4C1N K;  4DFA A;  2I07 B;  3S16 B;  1F9P A;  2E5L L;  5CV6 A;  4RGN A;  4BBS G;  4K2K A;  3Q8D A;  2IL8 A;  4JBJ A;  4JI7 Q;  2IPK D;  3B6Y A;  4EVO A;  3KOJ A;  1HZB A;  1OXX K;  2LMC B;  4KY5 A;  2JP1 A;  4AQY Q;  3MC0 B;  1QOH A;  1RF2 D;  4HCS A;  2WAQ B;  1IBK Q;  2B2Y C;  1ML0 D;  4RWS C;  5IYD H;  2Z8L A;  4A3J H;  3WDN A;  5IWA L;  1K3B C;  1AZQ A;  1FNW A;  3DXJ C;  1PFM A;  1TWG H;  1Q8I A;  1SE4 A;  4Q0F A;  1L1O B;  4O2D A;  5JPM C;  3I2Z A;  2O5I C;  3GTK H;  2JA6 G;  3VA7 A;  1SYG A;  4GKK Q;  4O42 A;  4N8F A;  4AIM A;  1LT4 D;  5HUR A;  2PQA B;  3NTK A;  3M3Y H;  2OQ0 A;  4NPS A;  2M2L A;  3J7Z C;  1TS2 A;  1KAA A;  5IT9 c;  4P74 A;  5I6Y A;  1JB7 A;  4WJ3 M;  4G57 A;  1S72 A;  2AKW B;  4JK1 C;  3W5O A;  3CCQ A;  1BDO A;  1B7Y B;  1SND A;  1AH9 A;  3PMF A;  4DR7 Q;  3JAM L;  2HQL A;  3UDI A;  1HXY D;  3A7L A;  2E76 C;  3BYY B;  4KV6 A;  4I7A A;  2UUA Q;  1EEF D;  1IXR A;  2IHE A;  4C3H H;  2WB1 E;  1RJT A;  2IX3 A;  2KBN A;  4BBS B;  1Q8K A;  5CGK A;  2KJX A;  2OEO A;  1YJ9 A;  3O13 A;  2EYJ A;  4LF6 L;  1T9H A;  1SFO B;  3BYT B;  4DK1 A;  2R93 G;  4RKB A;  2ZXP A;  5GAD C;  3D3R A;  1M90 C;  2CH4 A;  4K8I A;  2PCF B;  2XRS D;  3I4L A;  1XYI A;  4LF8 L;  3IAY A;  1DGS A;  1K83 H;  3DM3 A;  3RLO A;  1J9O A;  1RCV D;  4L5Q A;  4EQN A;  3M4O B;  2E2J H;  5IGC A;  1A6X A;  1I4P A;  1SNQ A;  2XTI A;  2JSO A;  2AWO A;  1TY2 A;  2K05 A;  2NBF A;  5E1F A;  3J80 i;  3HOU B;  1EYG A;  1IBM Q;  4DR5 L;  4FO2 A;  4ZUI A;  3G71 A;  3PO2 G;  3DEP A;  1LYL A;  3J81 i;  1N36 Q;  1WTQ A;  3BZD B;  1N32 Q;  1TII D;  2CQA A;  4R1J A;  1YHQ A;  2MNA A;  1C0A A;  1X56 A;  4N8X 1;  3M7N A;  2WKC A;  2JA9 A;  1STY A;  1U5K A;  1QVF A;  3HOZ G;  4DV4 L;  1SMX A;  4ME5 A;  1C48 A;  1UNS A;  1S5E D;  2B63 G;  2CKZ B;  1J8I A;  1KAB A;  2F3W A;  3T1Y L;  4A3J B;  1P8L A;  1W6K A;  3R2I A;  1KRT A;  4MN3 A;  2D0O A;  5M5Y H;  2ZJP A;  5DNF A;  1EIF A;  1QWY A;  1QG7 A;  2V1C C;  3I72 A;  3KLR A;  4KHP L;  4GLV B;  3T4A C;  2VNU D;  1LTT D;  4KKS A;  1GM5 A;  2Y0S E;  4DGZ A;  3M3Y B;  5ELF A;  1C8C A;  1GUT A;  1Z6H A;  2O2L D;  2ENB A;  3ICE A;  4C56 C;  1CHP D;  4K2L A;  1N33 Q;  3S2H B;  1K8M A;  4OO1 H;  3U58 A;  1V1P A;  4KLK A;  3M4Q A;  2H5X A;  1PYS B;  3URY A;  4HAE A;  1GO3 E;  5KNC A;  4JBK A;  3RZD H;  1MIU A;  1HUM A;  5AJ3 L;  4FYD A;  4C3H B;  1JOR A;  1S4Z A;  2K14 A;  1CKN A;  4ZCK A;  4EQO A;  1K3R A;  1DOK A;  2OF1 A;  3PIO 3;  4DR1 L;  2VS1 A;  3TN2 A;  3HFZ B;  1VQK A;  4DN4 M;  1VQ4 A;  3HEJ A;  3HOZ B;  3JAM E;  3SE0 A;  3T16 A;  1BCP B;  2VQE Q;  4A3K G;  3IFT A;  3K7A H;  3GTJ B;  2B63 B;  4MTN A;  2UUB Q;  3H0G H;  1K83 B;  1JMC A;  1WTX A;  1OTC A;  1O7Y A;  4K5W A;  1GVP A;  1FR3 A;  2E2J B;  3OPO A;  2F0T A;  4B3R L;  1R9T H;  4HJ7 A;  1QVC A;  1BCP F;  4UP9 A;  4FF3 A;  1HNZ L;  4WJW A;  5HY6 A;  4LAA A;  1BKB A;  3J7Y W;  1PFB A;  1UUP A;  2EYH A;  1AN8 A;  2RDG A;  2KHI A;  3HOW H;  1XTD A;  1A62 A;  1D8L A;  4ZKC B;  4MNO A;  2HHH Q;  1GUG A;  3J81 E;  1IW7 C;  1B4O A;  1CZG A;  3T1H Q;  4C3I G;  3W3A A;  4XQN A;  3CW2 C;  1HRJ A;  3CCR A;  1I6V C;  4IJL A;  2LS0 1;  4DV1 Q;  1LT5 D;  1G2T A;  3H0G G;  1TXY A;  4KK7 A;  3X3N A;  2AWN A;  4R4I A;  4L8J A;  2KA7 A;  3D6C A;  4OON A;  5L37 A;  1NNX A;  5JEA H;  5BN3 A;  5M5Y B;  3BDO A;  1HZ9 A;  2I0Q A;  4UP7 A;  2IWH A;  2UXB L;  5I9P A;  1SYE A;  2CCZ A;  4GOP A;  1GHJ A;  4QMG A;  1A3V A;  1UE1 A;  2ICI A;  4R4Q A;  4C2M B;  2QA4 A;  4RH6 A;  1CHQ D;  1EEI D;  1UEA B;  2J4X A;  5C3E G;  5DAU A;  2GVB A;  1EOT A;  5CC4 A;  3UE1 A;  1VQP A;  1PVO A;  2J0T D;  2A19 A;  3C46 A;  5F2D A;  4JI8 L;  5C0X H;  2KCM A;  1DZ1 A;  2JA7 G;  3HOX G;  1SMY D;  2I5H A;  4UPA A;  1ET6 A;  2EPB A;  3DWP A;  1YI2 A;  1L0X B;  1JOO A;  4OX9 Q;  1TS5 A;  3MWY W;  3ND8 A;  2UXD Q;  4JI3 L;  2K5H A;  4DK6 C;  4M1U B;  2JXM B;  5M3F H;  4IAL A;  1SNP A;  4C3I B;  1AW7 A;  1H9K A;  3K7A B;  2G5D A;  4JI0 L;  3H0G B;  4FF1 A;  4UHV A;  4GLA C;  2JJQ A;  2A8V A;  4O1N A;  4H13 C;  4A4I A;  4PMW A;  3R3O A;  1N8R C;  1PH2 A;  2RF4 A;  3DUZ A;  3LWE A;  3IFD A;  4HIM A;  1D1K A;  4KY6 A;  4K0K L;  3N52 A;  1UE5 A;  1CM9 A;  1PTO C;  4B9W A;  3HOW B;  3C3L A;  1M8A A;  3CHB D;  3MXN A;  3F2U A;  3UDX A;  2B2U C;  5A2Q L;  3HOV H;  2QW7 A;  1JJC B;  1PTO D;  3PO3 H;  1PV4 A;  1M4V A;  4BWG B;  2WP8 J;  2JA7 B;  3S1Q B;  4G7O C;  1I6H H;  4JOI A;  2RA4 A;  1VDZ A;  5FLX c;  4YCW A;  4ULL A;  4X62 L;  2VQF Q;  1HH2 P;  3SGI A;  1H9M A;  3ULJ A;  3H3V H;  4OO1 I;  3QB3 A;  2ZM6 Q;  4PMB A;  2MP1 A;  2K5Q A;  2ATW A;  5KRU A;  1TU2 B;  4LF5 L;  4RAU C;  1SR3 A;  2EYM A;  4OEM B;  2C5C A;  4K5X A;  1MHW C;  3G6E A;  1K8G A;  4XIG S;  3D31 A;  4PNY A;  4A93 H;  1B3A A;  1I4X A;  3V96 A;  1WYD A;  4J15 A;  2PQE A;  2PNR C;  2MFI A;  4DR6 L;  4LF4 Q;  3T13 A;  4A3F G;  3CD6 A;  2PI2 E;  1WCM G;  1PH4 A;  2JEB I;  1W3S A;  1T5X D;  3NPP A;  1VQO A;  4JVZ A;  3A5U A;  3K5O A;  3E9I A;  1I5F A;  3T53 B;  4NKL A;  2B3G A;  4DNR B;  1JCK B;  4ZLT F;  4DR2 L;  3NE5 B;  1L1O A;  2A6E C;  4YWL A;  3D4R A;  4A93 G;  3M7G A;  1P16 A;  4IUV A;  1WTP A;  1XXG A;  1NR4 A;  3AYH B;  1TWC H;  1NY4 A;  4DR4 Q;  2Q2T A;  2MHV A;  1KQS A;  3GTL H;  1LTB D;  2RKS A;  4H44 C;  1HCZ A;  3ITP A;  2WII B;  1PHJ A;  4I7Z C;  5CBA E;  1X3F A;  5JEA J;  4XYQ A;  1PA6 A;  3KJP A;  4L63 B;  2F4V Q;  4A3D G;  1VQ8 A;  1CTM A;  1SYB A;  1TS3 A;  3MFG A;  1PH5 A;  2X6L A;  3FRP B;  2E5L Q;  3SDZ A;  1ILQ A;  1XWE A;  2PMZ B;  1X65 A;  1LUZ A;  1U0L A;  3HOV B;  5M3M H;  1STA A;  4IUR A;  4FXD A;  5C4J H;  5EQ0 A;  3I4N G;  5C0X J;  2FHT A;  4OHJ A;  2FFK B;  5KYI A;  4A3F B;  3CPW A;  4K6L A;  1WCM B;  3VR5 A;  5IWA Q;  5C0X I;  3NBI A;  1WJJ A;  3U9S A;  5A2Q E;  5IYC H;  1I50 H;  2JEA I;  4QF4 A;  4XT3 B;  1Y8N B;  1ESR A;  2R92 H;  4IO9 A;  2AMC B;  2KQ3 A;  4DA2 A;  5IGE A;  2SNS A;  3HP3 A;  3CP0 A;  2LKV A;  4JYA L;  1D6E C;  1S40 A;  2WIN B;  1HQM C;  3W1G A;  4Y7N H;  4A93 B;  3DHQ A;  4R4C A;  5EKK A;  2YTY A;  3M4Y A;  3A74 A;  3TP6 A;  5FOB B;  2RVL A;  2AQ3 B;  2QCP X;  1PRT D;  1ZYR D;  4HJ8 A;  2HIX A;  1IL8 A;  3HS0 C;  1YNJ C;  3M85 A;  3GTQ H;  3F2C A;  1F2M A;  2NZH A;  5JJI A;  1QJO A;  1PZI D;  1TQO A;  1DON A;  3TZU A;  3HG9 A;  2QIL A;  2ZTD A;  1IKL A;  4JI6 L;  4QB4 A;  1Y14 B;  1VMP A;  1YJN A;  1GJX A;  3AU7 A;  3HZX A;  4LF6 Q;  3I91 A;  4XTC S;  4AH6 A;  2B2U A;  1UE6 A;  3I4N B;  4UDU C;  2CW0 D;  4LF8 Q;  5G3L D;  4XT1 B;  1VQE A;  5LL6 X;  4IPH A;  2F03 A;  1TWC B;  5EKI A;  3BJU A;  4BBR G;  1VQN A;  3CKI B;  3DEO A;  3HGB A;  2QKI C;  2ID0 A;  4DR5 Q;  3F1Z A;  1Y1W H;  3PUV A;  1VF7 A;  2VW9 A;  3FMC A;  4HMJ A;  1UEB A;  1NUC A;  3H3V I;  3SR1 A;  3P7J A;  1E3P A;  2L15 A;  2IJ0 A;  2F0J A;  4DV4 Q;  3A54 A;  2K1B A;  5C4J B;  1JJG A;  1B9N A;  1WTV A;  2F1M A;  3AMU A;  1B3Q A;  2PI2 A;  2Z0S A;  1EZ8 A;  1B9M A;  3S17 B;  1XMO L;  3T1Y Q;  1TWH B;  1FYC A;  2R7Z G;  1QUQ A;  5IGB A;  2FIN B;  1W2B A;  3K8A A;  2EY5 A;  2EJF C;  1I50 B;  4QY7 A;  3VYR A;  3DLL A;  1WD0 A;  4JBM A;  1SXT A;  3PCO B;  4IUQ A;  3DMU A;  1PH3 A;  1Y1W G;  3FKI G;  5LL6 S;  2B2T C;  3GQB A;  1EYA A;  1SFO H;  4DR3 L;  1LAB A;  2M9V A;  4BXX G;  2DJG C;  1NE3 A;  4GZY C;  2L0C A;  3M4O H;  4KHZ A;  1G2S A;  3DWA A;  3E9H A;  4HCE A;  3T56 B;  3EFX D;  5EGT A;  5C4X G;  1RHP A;  4BBR B;  4FXK C;  5IY0 A;  2ZXR A;  3GTQ B;  3HKS A;  1KXL A;  1PFN A;  2EVB A;  3A7A B;  1EY9 A;  1MJE A;  4DPG A;  3PIP 3;  4HR7 B;  5AJ3 Q;  2JA6 H;  1YNN D;  4DUZ L;  1I4H A;  3LWU A;  3CC4 A;  3ERQ A;  2B2V C;  1SNO A;  4YCV A;  4DK3 C;  4IUP A;  1GD7 A;  1A15 A;  4DR1 Q;  4XDX A;  1XNQ L;  3I7F A;  5J39 A;  2LFN A;  1HNW L;  4KJO A;  1RKN A;  4IZ8 A;  1OXV A;  3PQI A;  5LHY 1;  2K28 A;  3TP8 A;  4O0A A;  2NZO A;  4LFC Q;  4HTH A;  4IFD G;  1SJE D;  3TME A;  5BR8 L;  1EU3 A;  3VYS A;  2PMZ E;  4ZK9 B;  3VR3 A;  2KEN A;  4B3R Q;  4DV6 L;  1BF4 A;  3SHL A;  3Q0A A;  3LX0 A;  1HNZ Q;  1G91 A;  5KND A;  3MTS A;  1Y1W B;  2BA0 A;  3DM1 A;  4WJ4 A;  1SYD A;  3FKI B;  2DNC A;  1LLR D;  2ALY B;  4HSV A;  4JI5 L;  1Q1B A;  2R93 H;  4IQZ A;  5IYB G;  4NB3 A;  3SEB A;  3FEW X;  3L9A X;  4KD4 A;  2A6H D;  1JIC A;  5CR3 A;  2PYK A;  1LTI D;  2WKD A;  3S2H H;  5ELD A;  2Q8I B;  2VY3 A;  3M9B A;  5ISR A;  2K03 A;  2IX1 A;  2K7V A;  2VUM G;  4JI4 L;  2XRQ D;  5IT9 L;  1LAC A;  1PFS A;  2HUG A;  4KMU C;  1GHK A;  3PO2 H;  1JJ2 A;  2UXB Q;  3EN2 A;  3FVQ A;  3P20 A;  3R2T A;  3S9W A;  1A2U A;  2F0I A;  1NAP A;  4KN4 C;  4L5T A;  3JAM i;  4YHH L;  1FJG L;  1JT8 A;  2A69 D;  5E7N A;  3SVM A;  1O80 A;  1S5F D;  1B2T A;  4IPD A;  3HOZ H;  4TVA B;  4YWM A;  4OWW B;  2K04 A;  3GTJ H;  3OMG A;  4KI0 A;  3KUP A;  4J1M A;  4JI8 Q;  1ET9 A;  2FJ2 A;  2RBM A;  1IBL L;  2B63 H;  3H09 A;  1EY5 A;  1G29 1;  3KLS X;  5JVG 3;  3IRB A;  1I3Q B;  1D5X C;  1IYJ B;  4X3T A;  2IW3 A;  4DV3 L;  4LFA L;  1FGU A;  2B8G A;  1E1T A;  1NBW A;  3S15 H;  3GTO B;  1X3E A;  2E2H H;  3J7A F;  2RHQ B;  2JA6 B;  3VYU A;  2IHF A;  1MSG A;  1RL2 A;  1VF5 C;  1OXT A;  1QVG A;  4JI3 Q;  3I70 A;  1STB A;  3A0J A;  3BVM A;  1BBX C;  3GV3 A;  5GAE C;  4JI0 Q;  2TSS A;  4MZ9 A;  2Z1C A;  4KD3 A;  2L55 A;  3KBX A;  3CQZ H;  1BOS A;  2VUM B;  1NMG A;  1X54 A;  1I4R A;  5EBD A;  4OGQ C;  4BA1 I;  2XSC A;  4A3C G;  1HA5 A;  1VQ5 A;  2DY7 A;  4YY3 L;  4XYO A;  1VQH A;  3NP8 A;  4K0K Q;  1C4Q A;  2A5H A;  2F0D A;  4A3M G;  1X3G A;  5IP7 H;  3FPU B;  4C2M H;  4NMZ A;  1EY8 A;  1PTO F;  2B2T A;  2R93 B;  2FMC A;  3QR8 A;  2MO0 A;  4A3K H;  3EIV A;  3S24 A;  3OYY A;  5COY A;  4RFB A; 
#chains in the Genus database with same CATH homology
 4GLA C;  4B3S Q;  4HJ5 A;  2JJQ A;  1YEZ A;  3KJO A;  1EOV A;  1CKO A;  4GN3 B;  2ZTC A;  2A8V A;  4QL5 A;  1MJC A;  1BBU A;  4A4I A;  2VUM H;  3GTG H;  3AEV A;  4NXN Q;  4PMW A;  1N8R C;  1Q12 A;  1PH2 A;  1J5E Q;  2RF4 A;  4A3G G;  4HIM A;  1ASY A;  4OX9 L;  3BU2 A;  1PYB A;  4JI1 Q;  3RLN A;  4DAY B;  4LUO A;  1C7Y A;  4K0K L;  2UXD L;  1UE5 A;  1G51 A;  3KF6 B;  3RLF A;  3KFU A;  4LWC A;  1CKM A;  4DV5 L;  1IL2 A;  2OCE A;  1KD1 C;  4LFB L;  3F8T A;  3CCM A;  3PIP A;  5IP7 G;  3UDX A;  1VQB A;  4LW1 A;  1YHA A;  5M3M G;  1HNX L;  4NXM L;  3PUW A;  3GTM H;  3HOV H;  3S2D H;  3I4O A;  1JJC B;  3GDE A;  4C3I H;  3NEL A;  3PO3 H;  1PV4 A;  2VL6 A;  4B3M L;  1D7Q A;  1WI5 A;  1X9N A;  1G6P A;  4B3S L;  1QUQ B;  2Y0S G;  2WP8 J;  1VQJ A;  4A3E H;  4A3L G;  4P75 A;  4GOP B;  1I6H H;  2F3I A;  4DR6 Q;  2YTX A;  4JOI A;  3CAM A;  1VQL A;  5FLX c;  5GAH C;  1IBL Q;  4YCW A;  1O7I A;  4PZ7 A;  4NXN L;  1Z47 A;  1XNR Q;  1J5E L;  2VQF Q;  4X62 L;  4HJ9 A;  1HH2 P;  2CWP A;  2LXJ A;  3SGI A;  3ULJ A;  1SE8 A;  3H3V H;  3HOU G;  4OO1 I;  2ZM6 Q;  2YTV A;  5IYC G;  4ALP A;  4JI1 L;  1NMF A;  3GTP H;  2R92 G;  3S16 H;  2ATW A;  3EBE A;  2VZA A;  3L7Z C;  4A75 A;  3OTO Q;  1HZA A;  4LF5 L;  4P73 A;  1SR3 A;  2NVX H;  4POF A;  3TS2 A;  3G6E A;  3JAM c;  1K8G A;  4XIG S;  1XMQ Q;  3D31 A;  5C3E H;  2UUC Q;  1Y1V G;  4A93 H;  4UY8 C;  1E7Z A;  5ELN A;  1PH9 A;  2YYZ A;  1Z9F A;  3PIO A;  1WYD A;  4J15 A;  1QZH A;  2MFI A;  1I94 Q;  1PH8 A;  4DR6 L;  3KDF B;  5IYD G;  1XNR L;  4A3J G;  4LF4 Q;  2JA7 H;  4L5R C;  1FVI A;  1CUK A;  4A3F G;  3CD6 A;  1VQG A;  3HKZ G;  2VQF L;  2PI2 E;  3CME A;  3ERS X;  1UWV A;  1QZG A;  1WCM G;  1OXS C;  2Z6K C;  1PH4 A;  3HOX H;  1N9W A;  2ZM6 L;  2JEB I;  1AE2 A;  1W3S A;  5JJK A;  4GOP C;  4BY1 H;  4DV2 Q;  1VQO A;  2Q2H A;  4X6A H;  4A3C H;  2I5M X;  3FP9 A;  4PZ6 A;  3A5U A;  3J81 j;  3RNU A;  3E9I A;  3OTO L;  1I5F A;  2B3G A;  2LSS A;  1SLJ A;  1VQD A;  2CQO A;  3AFP A;  3J80 c;  4L5S A;  4DR2 L;  4A3M H;  4ME3 A;  5M5X H;  1L1O A;  2PNH A;  4YWL A;  1XMQ L;  2BH8 A;  3J81 c;  1L2F A;  2R7F A;  3MEF A;  5LMN W;  3PV0 A;  2ZJQ A;  4A93 G;  3PUZ A;  1SRU A;  1P16 A;  4RG1 A;  4YWK A;  1I94 L;  3G48 A;  3AYH B;  4LF4 L;  1TWC H;  1NY4 A;  4IJH A;  5LMN L;  4DR4 Q;  2Q2T A;  1KQS A;  3GTL H;  3AQQ A;  1VQ7 A;  1UE7 A;  1S3O A;  1PHJ A;  4GNX A;  3MXN B;  5IP9 G;  4DV2 L;  1X3F A;  5JEA J;  3KLW A;  1NTG A;  1VQA A;  3F2D A;  3KYH C;  4GS3 A;  5EAY A;  4A3G H;  3RN5 A;  3KJP A;  2HIV A;  1PA6 A;  1HJP A;  2F4V Q;  3S1M H;  4A3D G;  4BBS H;  4TQU S;  1VQ8 A;  1PH5 A;  4AYB E;  3STB C;  2IY5 B;  2E5L Q;  5JJI A;  2B29 A;  3JC6 6;  1X65 A;  4HJA A;  1L0W A;  1LUZ A;  1IZ6 A;  1U0L A;  4DAM A;  2OTJ A;  1XJV A;  5M3M H;  4DV5 Q;  2DGY A;  3TRE A;  4C3J H;  4JYA Q;  2BA1 A;  1YHB A;  2MO1 A;  4X64 Q;  4HIO A;  2DUD A;  3S1R H;  2YV5 A;  5HGQ A;  5C4J H;  3CF5 A;  3W1B A;  3S14 H;  3I4N G;  2UXC Q;  5C0X J;  4DR4 L;  3ER0 A;  2C35 B;  4B3M Q;  4A3L H;  3CPW A;  1YIJ A;  4APV A;  4IFD J;  4GLX A;  3GO5 A;  5IWA Q;  5C0X I;  4H02 A;  4IOC A;  2ZTE A;  5FJ8 G;  1PH1 A;  1WJJ A;  3HOU H;  1PH7 A;  1M1K C;  1RIP A;  4LF7 Q;  2F4V L;  4JV5 Q;  1VQ6 A;  5IYC H;  1I50 H;  2JEA I;  4IFD I;  3RN2 A;  4X62 Q;  2R92 H;  1V1Q A;  2E5L L;  4IO9 A;  2AMC B;  4X65 Q;  2K52 A;  4BBS G;  3Q8D A;  4JI6 Q;  3PGZ A;  4JBJ A;  3H15 A;  4JI7 Q;  3CP0 A;  4LUZ A;  2LXK A;  3B6Y A;  1SRO A;  3KOJ A;  4JYA L;  4LF5 Q;  1S40 A;  1HZB A;  4R4O A;  3W1G A;  4X64 L;  4Y7N H;  1OXX K;  1Y1V H;  4R4C A;  2YTY A;  1GKH A;  4GN5 A;  2UXC L;  2KHJ A;  3A74 A;  3BZC A;  2YU9 H;  2GVA A;  4JOI C;  1YIT A;  1X55 A;  4AQY Q;  1CSP A;  4HJ8 A;  1IBK Q;  2HIX A;  4QJF A;  2E2I H;  1VQC A;  1YJW A;  5IYD H;  4A3J H;  5IWA L;  1VQ9 A;  4A3F H;  2NVY H;  3M85 A;  1KRS A;  3F2C A;  1HR0 Q;  1E24 A;  2NZH A;  3GTQ H;  1TWG H;  1WCM H;  4P71 A;  4QGU A;  1TWF H;  1L1O B;  2R7D A;  4O2D A;  3I2Z A;  3U4V A;  1C9O A;  1K8A C;  4LF7 L;  1KAW A;  3GTK H;  4A3B G;  2JA5 G;  3GD7 A;  5IE8 A;  1BBW A;  1V9P A;  2JA6 G;  2N8N A;  2HT1 A;  5FLM G;  4X65 L;  4GKK Q;  2ZTD A;  3TRZ A;  4JV5 L;  2F52 A;  4JI6 L;  4AIM A;  1Y14 B;  4JG2 A;  4JI7 L;  1YJN A;  2PQA B;  3M3Y H;  4IPG A;  2OQ0 A;  4DV0 Q;  3K80 C;  4NPS A;  1N33 L;  2OTL A;  4LF6 Q;  3J7Z C;  2K5N A;  4GN4 B;  5IT9 c;  4P74 A;  4XTC S;  4DR2 Q;  1VQF A;  4LFC L;  4AH6 A;  1UE6 A;  1S72 A;  1JB7 A;  1HR0 W;  4WJ3 M;  1AE3 A;  2AKW B;  3W5O A;  3CCQ A;  4AQY L;  1VQM A;  4LF8 Q;  4OO1 G;  1B7Y B;  1AH9 A;  3S1Q H;  1VQE A;  4IPH A;  1IBK L;  3D0F A;  2B63 H;  4DR7 Q;  4QQB X;  3BJU A;  1HR0 L;  2OQK A;  2RHS B;  2K4K A;  2GN5 A;  2HQL A;  3A5Z B;  3UDI A;  4BBR G;  5LMN Q;  1XMO Q;  4DUY Q;  1VQN A;  2UU9 Q;  5IP9 H;  2CFM A;  2UUA Q;  4GKK L;  2IHE A;  1IXR A;  2ID0 A;  4C3H H;  4A3I G;  4DR5 Q;  3F1Z A;  2WB1 E;  1EQR A;  1Y1W H;  3PUV A;  2KBN A;  2MQH A;  4EQ5 A;  2VW9 A;  1Q8K A;  1L1O C;  2WAQ E;  4LNQ A;  4A3D H;  1UEB A;  1YJ9 A;  2ASB A;  3CMA A;  4DV0 L;  3H3V I;  1TWA H;  1JE5 A;  5GQO A;  3K0X A;  3UE0 A;  4LF6 L;  1T9H A;  1E3P A;  2JE6 I;  2R93 G;  5GAD C;  1M90 C;  4BY7 G;  2L15 A;  2K75 A;  3CCJ A;  4LF8 L;  4PZ8 A;  4DR3 Q;  4DV4 Q;  1DGS A;  1KL9 A;  1K83 H;  1JJG A;  3DM3 A;  3RLO A;  1EIY B;  3CCL A;  4L5Q A;  1WOC A;  4DR7 L;  3I4N H;  3CPF A;  2E2J H;  2PI2 A;  3CCE A;  2NVT H;  1VCI A;  2Z0S A;  2XTI A;  2AWO A;  1XMO L;  3M4P A;  4DUY L;  4HID A;  3T1Y Q;  2UU9 L;  4B3T Q;  2I5L X;  2R7Z G;  1QUQ A;  3J80 i;  1OXU A;  5FJ8 H;  1W2B A;  2UUA L;  3K8A A;  1EYG A;  1IBM Q;  4DR5 L;  3G71 A;  3PO2 G;  4QY7 A;  3DLL A;  4JBM A;  1N36 Q;  1LYL A;  3J81 i;  1N32 Q;  4R1J A;  4PG3 A;  3PCO B;  3CCV A;  1PH3 A;  1YHQ A;  1A63 A;  1B70 B;  1Y1W G;  3HOW G;  2MNA A;  1C0A A;  2NN6 G;  3FKI G;  4DUZ Q;  1X56 A;  1Q86 C;  3M7N A;  1KHI A;  2JA9 A;  3AFQ A;  3PUX A;  3TEH B;  1HZC A;  3NBH B;  3LGJ A;  1SFO H;  1U5K A;  1QVF A;  4DR3 L;  3HOZ G;  4DV4 L;  1XNQ Q;  1SMX A;  4BXX G;  1HNW Q;  1Q7Y C;  1NE3 A;  2B63 G;  2NVQ H;  5JJL A;  2FXQ A;  2CKZ B;  5LMU Q;  3CC2 A;  4OXP A;  3M4O H;  4KHZ A;  3E9H A;  5C4X G;  3T1Y L;  1X6O A;  2XGT A;  1P8L A;  4B3T L;  5BR8 Q;  4Y52 H;  5JEA G;  1KRT A;  1ASZ A;  1B8A A;  5IY0 A;  2D0O A;  1NJI C;  5M5Y H;  1IBM L;  2ZJP A;  3S17 H;  3S1N H;  1EIF A;  3HKS A;  3NEN A;  1TWH H;  2V1C C;  1KXL A;  4DV6 Q;  4A3B H;  5DLQ E;  1N36 L;  4GLV B;  1MJE A;  3E0E A;  4DPG A;  5AJ3 Q;  2JA5 H;  2JA6 H;  4KHP L;  3L0O A;  3I4M G;  1N32 L;  2VNU D;  1GM5 A;  2Y0S E;  1YVC A;  5FLM H;  3CCU A;  4DUZ L;  3CC4 A;  1XPR A;  4YCV A;  4IOA A;  3RR5 A;  4DK3 C;  1YBY A;  1GD7 A;  2JA8 G;  4DR1 Q;  4JI5 Q;  1XNQ L;  3I7F A;  3HOY G;  3ICE A;  3PF4 A;  1KIX A;  3FHW A;  1HNW L;  1OXV A;  5C0X G;  4DV7 Q;  1N33 Q;  4BA2 I;  5LMU L;  3K81 C;  4RMF A;  3U58 A;  4O0A A;  4JCV E;  2NZO A;  5C44 H;  4LFC Q;  4KLK A;  4AYB G;  4IFD G;  3M4Q A;  2H5X A;  1PYS B;  5BR8 L;  3I56 A;  2PMZ E;  1GO3 E;  2KEN A;  2EIF A;  4B3R Q;  4DV6 L;  1LM0 A;  4BBR H;  4JBK A;  3RZD H;  4JI4 Q;  1MIU A;  5AJ3 L;  2OWO A;  1HNZ Q;  4A3I H;  2BA0 A;  4WJ4 A;  2K14 A;  1CKN A;  4EX5 A;  1K9M C;  3UDG A;  1K0R A;  1E22 A;  1K3R A;  2ALY B;  4DR1 L;  4YHH Q;  2VS1 A;  3HKZ E;  1KC8 C;  4JI5 L;  3UDF A;  2AHO B;  3HFZ B;  5M3F G;  1VQK A;  1FJG Q;  1VQ4 A;  3RZO H;  1Q1B A;  5ELO A;  2CWA A;  4R4T A;  2R93 H;  1A8V A;  5IYB G;  4BY7 H;  2N3S A;  4JI2 Q;  4NB3 A;  4DV7 L;  2VQE Q;  4A3K G;  3K7A H;  4FDB A;  1N34 Q;  1WFQ A;  4MTN A;  1PH6 A;  3U4Z A;  2WFW A;  2KCT A;  3VDY A;  2A1A A;  2UUB Q;  3H0G H;  3CXC A;  4GNX B;  1JMC A;  1OTC A;  1A0I A;  2EQS A;  3S2H H;  1GVP A;  5C44 G;  2VY3 A;  3M9B A;  2IX1 A;  4B3R L;  1R9T H;  1XPU A;  4P72 A;  3TQY A;  1LTL A;  4HIK A;  4DKA C;  4HJ7 A;  1QVC A;  4JI4 L;  2VUM G;  2R7Z H;  2JQO A;  1EWI A;  1V43 A;  4UP9 A;  1HNZ L;  1PFS A;  5HY6 A;  4DV3 Q;  4LFA Q;  4POG A;  1BKB A;  3PO2 H;  1SN8 A;  4OWT B;  1JJ2 A;  3KF8 B;  2UXB Q;  4QIW E;  3G4S A;  3EN2 A;  2I0Q A;  3JAM i;  1H95 A;  3WWV A;  5K36 G;  4L5T A;  2KHI A;  4YHH L;  1XTD A;  1A62 A;  1D8L A;  2QGQ A;  3FKI H;  1K73 C;  1EFW A;  1FJG L;  3HOW H;  5E7N A;  3F2B A;  1JT8 A;  4MNO A;  2D0P A;  3ZJY C;  1CSQ A;  1Q46 A;  2HHH Q;  4JI2 L;  2E8G A;  2VQE L;  3HOV G;  3ULL A;  1N34 L;  3T1H Q;  4IPD A;  3PO3 G;  2UUB L;  3CW2 C;  4TVA B;  4YWM A;  4OWW B;  1Q82 C;  3HOZ H;  4GKJ Q;  4BXX H;  4JC0 A;  3CCR A;  4IJL A;  3GTJ H;  2EXD A;  3KF6 A;  4KI0 A;  3K7U C;  4JI8 Q;  4DV1 Q;  3H0G G;  4A3E G;  1IBL L;  1TXY A;  1EQQ A;  4LUV A;  4LF9 Q;  2AWN A;  2N49 A;  4R4I A;  4X66 Q;  1G29 1;  5C4X H;  2N78 A;  4GNX C;  4OON A;  3U50 C;  5M5W H;  3IRB A;  5J3B A;  1IYJ B;  2K5V A;  2ZJR A;  4DV3 L;  4LFA L;  1FGU A;  1E1T A;  1HZ9 A;  1NBW A;  1Q1E A;  4UP7 A;  3I55 A;  3CCS A;  1X3E A;  1EUJ A;  4A76 A;  2E2H H;  3S15 H;  5GAG C;  2UXB L;  2RHQ B;  2Z6K A;  3ULP A;  2K50 A;  3I4M H;  2CCZ A;  1MKH A;  2IHF A;  4GOP A;  3PUY A;  1RL2 A;  1UE1 A;  4KHP Q;  4YY3 Q;  4R4Q A;  2D62 A;  2UUC L;  2QA4 A;  1QVG A;  1OXT A;  2HHH L;  4JI3 Q;  5H1S E;  3J7A 5;  2JA8 H;  3T1H L;  5C3E G;  2GVB A;  2QEX A;  2NN6 I;  3UE1 A;  4GKJ L;  3HOY H;  3A0J A;  1VQP A;  1PVO A;  4JBW A;  2PQA A;  3NEM A;  2BH2 A;  2A19 A;  4DV1 L;  4JI8 L;  3L2P A;  2KCM A;  2WB1 G;  5GAE C;  4LF9 L;  4X66 L;  4JI0 Q;  4MZ9 A;  1YZ6 A;  2WAQ G;  2ES2 A;  2Q2U A;  1CKN B;  1E1O A;  1VS0 A;  2JA7 G;  3CQZ H;  1VQI A;  2IX0 A;  1NMG A;  1X54 A;  5GRO A;  2R6G A;  1J6Q A;  4YCU A;  3HOX G;  2I5H A;  4BY1 G;  1FL0 A;  4DNI A;  4BA1 I;  1I3Q H;  3PF5 A;  1Q81 C;  4UPA A;  4A3C G;  2IT1 A;  1YI2 A;  1VQ5 A;  1BVS A;  3GTO H;  1XPO A;  3PSI A;  4YY3 L;  3KDF A;  1VQH A;  4OX9 Q;  4K0K Q;  2UXD Q;  3BZK A;  4JI3 L;  2K5H A;  4DK6 C;  4A3M G;  1X3G A;  5IP7 H;  1YNX A;  3CC7 A;  4C2M H;  5M3F H;  4LFB Q;  2RCN A;  3STB D;  2MO0 A;  2JK8 A;  5IYB H;  4NXM Q;  1HNX Q;  3OW2 A;  2Q2I A;  4UP8 A;  4A3K H;  3EIV A;  3S24 A;  3OYY A;  4IPC A;  4OWX B;  4JI0 L;  3TS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...