1NMFA

Major cold-shock protein, nmr, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR COLD-SHOCK PROTEIN
publication title Structure in solution of the major cold-shock protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
total genus 4
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1996-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1nmfA00
2K5HA 1N34Q 3NELA 2HIXA 4TVAB 3A0JA 3T1YQ 3H3VI 1N9WA 4DR1Q 4A3GH 1QUQA 4P74A 1X56A 1YIJA 4OXPA 4X65Q 1IBLQ 2NN6G 3M3YH 1Q81C 1N36Q 1SLJA 5M3MG 2VL6A 4R4IA 4JBKA 4NXML 4A3DG 3VDYA 4QQBX 1UEBA 3CMEA 5M5XH 1PVOA 4QL5A 1MJEA 1SE8A 2GVAA 5IP7G 1I94L 1V43A 4YY3L 3GTKH 1LYLA 1QVGA 1PYBA 3AQQA 1E7ZA 4EX5A 4GLXA 2JA5G 3F8TA 4TQUS 1UE6A 5LMUQ 2Z0SA 4A76A 4B3RL 1JT8A 1UE1A 2NN6I 5IYBG 4IJHA 4BY1G 1KRTA 3J81i 3I2ZA 4QJFA 1J5EQ 1CUKA 2IX1A 3GTQH 2QEXA 1PH6A 4R1JA 1HR0Q 2YU9H 3TQYA 2A1AA 4DR6Q 1I5FA 5M3FG 4B3TL 1XJVA 2PMZE 3B6YA 2ES2A 4LFBQ 4DV4L 4DR4L 4X6AH 2Z6KC 3OW2A 1VQEA 3JAMc 1HNWQ 3DM3A 1OXXK 3PF5A 1SFOH 4NPSA 1LTLA 3PUYA 2KENA 1VQ4A 5ELOA 1M1KC 3CW2C 4GN4B 4A3KG 2R7FA 3S1RH 3TS2A 3RR5A 1UE5A 4LF6Q 2NVXH 1QUQB 1KL9A 1YEZA 4A3MH 3PO2H 3J81j 4P71A 2ASBA 1VQHA 3M9BA 3HOZH 4A3EH 4LF7Q 4LF9L 3PO3G 2KBNA 1X3GA 3U50C 4ALPA 5HGQA 5IWAL 3PUWA 4PZ7A 4DV7Q 4IOAA 1XTDA 4KI0A 4JI2Q 4YHHQ 4DUYQ 2E5LQ 2F4VQ 4BXXH 1B7YB 4OONA 2UUAL 4A3CG 2HT1A 2PNHA 2OTJA 4LFCQ 1JB7A 4A3BG 1WCMG 4JV5L 3E0EA 4JI3L 1YVCA 4JV5Q 5IT9c 4GOPA 2N78A 1CKNA 4GNXC 1Y1WG 1PH4A 4JI6Q 1VS0A 4HIMA 4AH6A 3I4OA 4DUZQ 3F2BA 2UUCL 1N33Q 1XMQL 3HOYG 4JI0Q 2EIFA 3GD7A 1OTCA 1Y1VG 4LF8L 3JC66 4DAMA 1SR3A 1G291 2Y0SG 3CCQA 5M5WH 4JG2A 3J80c 3CCMA 4BBSH 2F3IA 2UUBL 3NEMA 2CWPA 1EQRA 5C4XG 3EIVA 4DV5Q 1UWVA 1PYSB 3HOVH 1PH8A 2JQOA 3KF6B 3UE0A 4DPGA 1WFQA 3EN2A 3UE1A 5C0XG 4FDBA 3STBC 2UXDQ 5AJ3Q 4LF4L 2JA8G 1B8AA 4IJLA 1FVIA 1HNZQ 3F1ZA 2IY5B 5GROA 1G6PA 4X62Q 3HOXH 4L5SA 1HZAA 3W5OA 1CKOA 3H0GG 1QZHA 2K5NA 2NVTH 4BBRH 1N8RC 1XPRA 4GOPB 1NE3A 5HY6A 2VUMH 1VQNA 4HIOA 1CKMA 1V1QA 3CXCA 1K9MC 5C0XI 3S16H 4DK3C 1CSPA 1WYDA 2OCEA 3GTLH 1MKHA 1R9TH 4B3MQ 1HH2P 2PQAB 4GNXB 2UXCL 1VQJA 4X66Q 4DR5L 3TEHB 1M90C 4O0AA 2YYZA 1EFWA 1JJCB 1DGSA 1V9PA 4QGUA 3FKIG 5FJ8H 1VQ6A 2B3GA 3PUVA 2D0PA 1I6HH 1G51A 1PH2A 2ZM6L 3HOWH 1B70B 5C44G 4AIMA 5C4JH 3PUXA 3S1MH 2R93G 2GN5A 4DV6L 3ULPA 1ASYA 1KHIA 3CCJA 3AFPA 3HFZB 4DR2L 4A3JG 3S1QH 3T1HQ 1HNXQ 5EAYA 1C0AA 1OXTA 4AQYQ 1VQDA 2JA9A 4P73A 3RLOA 1XMOL 5FLMH 4JOIA 3CC2A 1XNRQ 3HOUH 4K0KQ 1E24A 4L5RC 2K5VA 2YTXA 3STBD 3D0FA 1IBKQ 1YNXA 1IXRA 4JYAQ 2D62A 1A63A 1KD1C 4JI8Q 1PH9A 1NTGA 2VS1A 3I4MH 1OXUA 4RG1A 1D8LA 1OXSC 3G71A 1PV4A 2K4KA 3AEVA 3CCVA 4LFAL 4JBMA 2OQ0A 2WAQG 3K7UC 1GM5A 2HHHQ 4LF5L 2QA4A 2IT1A 4POFA 4A3FH 3CCUA 5JJIA 1X3EA 1Q86C 2JA7H 1IBML 2JA6G 4JC0A 1H95A 5IY0A 2L15A 4HIKA 2UXBL 1Y14B 5C3EG 3S2DH 4ME3A 1MJCA 1NMFA 3UDFA 4DV0Q 4PG3A 3I4NG 2XGTA 4C2MH 4OO1G 2K14A 2LXKA 5JEAG 1KXLA 1VQIA 1EOVA 2BA0A 5J3BA 3RN2A 4JI7L 5GAEC 4DK6C 2OWOA 4LUOA 1FJGL 2IHFA 4GKJL 4JI5L 2I5HA 4WJ3M 2MO1A 1OXVA 1E1TA 4IFDG 3PCOB 5IYDG 4A3LH 2B63H 4KHPQ 2GVBA 2K50A 5M5YH 4JI4L 2AWNA 4YCVA 2QGQA 4OO1I 4A3IH 3KF6A 2R92H 2Z6KA 1TWGH 3OTOQ 2R7ZG 4C3JH 4P72A 3RNUA 1YZ6A 1EYGA 4OX9L 1N34L 1JJGA 4UP8A 3T1YL 4BA2I 3CD6A 3ICEA 1S3OA 1IYJB 2N49A 4HJ9A 2AKWB 1X9NA 4OX9Q 1EIFA 1K8GA 4KLKA 2VW9A 2MFIA 4X65L 4IFDI 1MIUA 1RL2A 4R4OA 3J81c 3H15A 1P8LA 2VQEL 4DV1L 1N36L 1SROA 5IYCH 3RZOH 1YJNA 1HJPA 4C3IH 4HJ7A 3PV0A 2ID0A 5LMNW 3H3VH 5IP9H 2VQFQ 5BR8Q 4DV3Q 4X64Q 4IPCA 3M4OH 4DR4Q 2PQAA 2N8NA 2WAQE 4GNXA 3W1GA 5LMUL 4KHZA 3GTOH 3HKZE 1BBWA 4YCUA 3CCEA 2CCZA 1J5EL 4NXNQ 3M85A 4DR3Q 3K7AH 4BY7G 4LUZA 2JEAI 4EQ5A 1HR0L 3CP0A 3BU2A 2C35B 1YJWA 4A93H 1Q7YC 3BZCA 3ERSX 1L2FA 1VQFA 4DV2Q 4A3GG 3PGZA 4DR6L 3MEFA 3L7ZC 2KHIA 1L1OC 3A5ZB 4LFBL 4IOCA 3LGJA 2OQKA 4H02A 1KIXA 1HNWL 3KYHC 1E3PA 2ATWA 3G6EA 3BJUA 4DR7Q 4GN3B 5M3MH 3K0XA 2FXQA 1SMXA 4A3DH 3WWVA 4LF6L 4GS3A 1U5KA 4HJAA 4OWXB 4R4QA 4UPAA 3TS0A 2IX0A 5IP7H 3FHWA 3S24A 4LF7L 1N32Q 5C0XJ 4GKKQ 3S1NH 3IRBA 1Z9FA 4DV7L 2IHEA 1VQ8A 4A4IA 4YCWA 4YHHL 4DUYL 2PI2A 2JA5H 2E5LL 3A74A 1KQSA 2F4VL 1BVSA 4L5QA 1ASZA 4J15A 3M4PA 4LFCL 5IYBH 4BY1H 1EUJA 2RHSB 1JE5A 5LMNQ 1GVPA 4IO9A 2MO0A 1PH3A 2E2HH 1XNQQ 3S14H 3PF4A 4IPDA 2F52A 1HZ9A 3A5UA 4JI6L 2LSSA 1C9OA 3W1BA 4JI1Q 5H1SE 2EQSA 1E1OA 1GD7A 1YHAA 5M3FH 1VQMA 5K36G 4DUZL 2OTLA 4POGA 1N33L 3KF8B 3J7A5 2K52A 4BA1I 5JJLA 3DLLA 3E9HA 3OYYA 1SN8A 3F2CA 2MNAA 4LFAQ 4A3KH 3ER0A 1FGUA 4NXMQ 4DKAC 5E7NA 1VQ7A 3KFUA 4A3MG 3PO2G 3CCRA 2ZJRA 4JCVE 2BH8A 3HOZG 1VQ5A 4JBJA 2DGYA 3J7ZC 4DV5L 4A3EG 1I94Q 2UU9L 3PO3H 2BA1A 4YY3Q 1YHQA 5GAGC 1S72A 4B3SL 3PUZA 4BXXG 1YITA 4LW1A 4PMWA 4A3CH 4B3RQ 4A3BH 1A8VA 1WCMH 5AJ3L 2PI2E 2UXDL 2DUDA 3I56A 2HIVA 1HNZL 1Y1WH 3ZJYC 3TRZA 3D31A 3K8AA 1VQLA 1I3QH 2YTYA 2CQOA 4B3TQ 2XTIA 2Q2HA 4JOIC 3HOYH 2KHJA 3PIOA 2JK8A 4DV4Q 3RN5A 1X55A 1Y1VH 1HR0W 1GKHA 3AYHB 1VQ9A 4HJ8A 1YHBA 3HKZG 1P16A 2RF4A 4R4TA 1TWHH 2AMCB 3GDEA 1FL0A 3Q8DA 1XPUA 4BBSG 4L5TA 3CCLA 4YWKA 3ULLA 5C4XH 4B3ML 1AH9A 4X66L 4LF9Q 4MNOA 3K81C 1VQBA 5IWAQ 3HOVG 1IL2A 1K0RA 1AE2A 2NZOA 2H5XA 4AYBG 4MTNA 3JAMi 1NY4A 2R6GA 1IZ6A 2UUAQ 2YV5A 2WFWA 3KLWA 4MZ9A 3RLFA 2VQEQ 4DV1Q 2I0QA 4RMFA 1I50H 4JI3Q 2JA8H 2ZTEA 5IE8A 3KOJA 1VQCA 2AHOB 2Q2TA 2EXDA 5JEAJ 3HOXG 3GO5A 3H0GH 1WOCA 3T1HL 2UUCQ 4BBRG 1NJIC 1XMQQ 1HNXL 2Q2UA 3GTGH 3GTMH 1K3RA 4LUVA 4AQYL 1VQPA 1XNRL 4K0KL 2KCTA 4LF8Q 3CCSA 1LM0A 2BH2A 1W3SA 1Q82C 2VUMG 1RIPA 1BBUA 1HZBA 5GADC 3ULJA 2WB1G 1IBKL 4IFDJ 1X54A 4JYAL 3NENA 5JJKA 4JI8L 2E8GA 2UUBQ 4DR1L 2KCMA 2VY3A 4YWMA 3UDXA 4P75A 2K75A 3CAMA 1IBLL 2I5LX 3CPWA 1T9HA 1QZGA 1EWIA 1Q1EA 3FKIH 2WP8J 5FJ8G 4HIDA 2HHHL 5ELNA 4GLVB 4APVA 2ZJPA 2NVYH 2RHQB 2NZHA 3HOWG 3U58A 1Q1BA 5C44H 1E22A 2ZTDA 2E2JH 4LF4Q 2R93H 4DNIA 3J80i 3L2PA 1U0LA 3NBHB 4A3JH 4PZ8A 1TWFH 4IPGA 4GN5A 1S40A 4DV0L 2RCNA 4GOPC 3HOUG 2V1CC 2D0OA 5FLMG 3U4ZA 1AE3A 4QY7A 4UP7A 3CC4A 1Q8KA 2R7DA 1K73C 1YJ9A 1TWAH 1A0IA 1J6QA 3GTJH 2ZJQA 4OWTB 1PFSA 4Y7NH 1X3FA 1JJ2A 3SGIA 3CC7A 3I4MG 2UXCQ 3UDGA 1KAWA 4DR5Q 1NBWA 3CMAA 2VZAA 1C7YA 4AYBE 1Q12A 1KRSA 4KHPL 1TWCH 2CKZB 1CSQA 1PA6A 4LNQA 1L1OA 2CWAA 3TREA 2ZM6Q 4A3FG 3OTOL 1VCIA 3MXNB 4XTCS 2JJQA 5GQOA 4C3HH 3KJOA 3F2DA 2JA7G 3RLNA 1X65A 3AFQA 2Q2IA 1Z47A 4HJ5A 4DV6Q 2JA6H 3CQZH 1LUZA 2N3SA 5C3EH 4DR2Q 4JI2L 4OWWB 2UU9Q 1Q46A 1K83H 1O7IA 2HQLA 1KC8C 1PH7A 1PH1A 3I4NH 1XMOQ 1HZCA 4B3SQ 2AWOA 2WB1E 2ALYB 1NMGA 2I5MX 1K8AC 1EIYB 1XPOA 4R4CA 3S15H 2VNUD 3K80C 3E9IA 1JMCA 2ZTCA 4XIGS 3U4VA 3I7FA 2YTVA 1QVCA 5BR8L 3PSIA 4X64L 2VQFL 1X6OA 4DV3L 1EQQA 4JI0L 3S2HH 3KDFA 1GO3E 3FP9A 3UDIA 4DAYB 1A62A 3KJPA 1VQOA 1PH5A 4UY8C 1D7QA 1VQGA 2JEBI 5IYDH 4A3LG 2B63G 4NXNL 1L0WA 3G48A 4DR3L 4LF5Q 4A3IG 1CKNB 3BZKA 2R92G 2R7ZH 1WI5A 4IPHA 3M7NA 4A75A 1W2BA 1YI2A 4DV2L 1IBMQ 1VQAA 2E2IH 2UXBQ 4QIWE 1L1OB 1WJJA 2JE6I 2LXJA 1PHJA 2A19A 1YBYA 2CFMA 4PZ6A 4UP9A 4DR7L 1QVFA 3S17H 1BKBA 5IYCG 2MQHA 4GLAC 3M4QA 4YWLA 3EBEA 4JI7Q 1UE7A 3CF5A 4X62L 4NB3A 4O2DA 5DLQE 1N32L 1FJGQ 2A8VA 5IP9G 4GKKL 4WJ4A 4GKJQ 4JI5Q 3CPFA 4JBWA 3GTPH 4LWCA 3L0OA 3G4SA 2B29A 4JI4Q 2Y0SE 5LMNL 1XNQL 5GAHC 4BY7H 1SRUA 2NVQH 3PIPA 4Y52H 3I55A 5FLXc 3KDFB 3RZDH 4A93G 3HKSA 4JI1L 1TXYA 1VQKA
chains in the Genus database with same CATH superfamily
2K5HA 3T1YQ 4DR1Q 1D5ZC 4FF1A 4PMCA 3CHBD 3NBIA 2A5HA 1Q81C 1G8ZD 5M3MG 1NSNS 3TZDA 3SE0A 3HP3A 1JB3A 5COYA 1MJEA 1SE8A 5KIXA 2JA8B 5IP7G 1I50B 4YY3L 3J7AF 1LYLA 1QVGA 1PYBA 4G7HC 1CHQD 4LMQD 4A76A 1X32A 4B3RL 2WINB 3GTKH 1CUKA 1HR0Q 4DR6Q 2D2CC 4RWSC 5M3FG 4B3TL 2PMZE 3B6YA 2ES2A 3AB9A 4DR4L 1NAPA 4KMUC 1RTOA 2K5WA 3DM3A 2EOTA 1BO0A 3UI2A 1F2ZA 3FKIB 3RR5A 1EWCA 1EEFD 3Q6SA 4P71A 3HOZH 5IGDA 3PO3G 1X3GA 4IUQA 4DV7Q 4IOAA 4O42A 1TWFB 4A3CG 3K0YA 4A3BG 1RHPA 1JB7A 2N78A 1QE6A 1CKNA 1Y1WG 1GUWA 1D1KA 1TWAB 4HIMA 2X69A 4JI0Q 1OTCA 3GD7A 3KLSX 5IIFA 3PMFA 1I4RA 1SR3A 1G291 1PDQA 3CCMA 5KEEA 2CVRA 1PRTF 4ZYSA 3HKZB 1U4RA 1PTOD 2CWPA 1EQRA 2EJFC 1U4PA 4DV5Q 1UWVA 3NHHA 2JA6B 5EJWA 3HOVH 2JQOA 4KN7C 1WFQA 2F0TA 4FDBA 3STBC 5AJ3Q 4LF4L 4QCLA 2K28A 4IJLA 1FVIA 3F1ZA 1EOTA 3H0GG 1QZHA 4BBRH 2L55A 1N8RC 5KRUA 3S2HB 1G2SA 1NE3A 5HY6A 1ZYRC 1EY0A 4HIOA 2B2UA 1CKMA 1K9MC 3R2TA 1S5ED 4F87A 2XVSA 1WYDA 2HD3A 3RD4A 5IT9L 1EY6A 4B3MQ 1HH2P 2BE5C 2PQAB 2UXCL 3TEHB 3KK7A 1EFWA 3MA2B 1DGSA 2N55A 2OEOA 2QW7A 4DAPA 3A56A 1PH2A 3W2DA 2K1BA 3S17B 5C4JH 4QMGA 3NQIA 3FVQA 2GN5A 3ULPA 4CJ0B 2ICEC 2RDGA 2Q8TA 4A3JG 3AFPA 1SSOA 3MFYA 4IUTA 1OXTA 4AQYQ 2JA9A 4P73A 3RLOA 3CC2A 4JOIA 3A7LA 3AU7A 3J80E 1T5XD 3STBD 5C6AA 1XYIA 3LX0A 1KD1C 1SYBA 1F2YA 2VS1A 3RZDB 3I4MH 1OXUA 1FR3A 4A3GB 3AEVA 1A2TA 4JBMA 1D6EC 2HHHQ 1ZYRD 3OIQA 4KKUA 4POFA 2QA4A 5CV9A 3TP7A 1SYEA 2EY6A 2JA7H 2A74C 5IY0A 2BE5D 2UXBL 5C3EG 3D3RA 5I9PA 3QIAA 1DOLA 4UAIA 3I4NG 2F0HA 1O78A 2KUMA 2FHTA 1YNNC 5JEAG 5IGFA 4N8FA 3FMCA 3P75A 3GTQB 5ELDA 2YU9B 3R93A 2MO1A 5IYDG 2B63H 1CTMA 5ELCA 2RDHA 4K6LA 2R92H 2Z6KA 1CM9A 4CDCC 1STYA 1CQFA 4XYQA 1N34L 4FF4A 3ICEA 1DCZA 1S3OA 2N49A 1EIFA 1WD0A 4KLKA 1WVLA 5FLXE 4ZKCB 1N36L 1SROA 2ICIA 1HXYD 2SNSA 4KHVA 3H3VH 2EYPA 4CJ2C 4EQNA 4ZRZA 4DV3Q 3M4OH 1ICFB 2PQAA 2IW3A 1PFMA 4I7AA 1BBWA 1YNND 3M85A 2DY8A 3HGBA 5KYIA 1F2MA 3KBXA 1C4QA 3CP0A 1YJWA 3ERSX 3VYUA 1PTOB 5M5WB 1H9SB 3MEFA 3VYTA 1L1OC 4OHJA 2D5DA 2LY7A 3JAML 1KDCA 1E3PA 1RCVD 2NN6H 4HMIA 2F0GA 3BJUA 4GN3B 4A3DH 4MHEA 1U5KA 5CBEE 2RVLA 3PIO3 2FJ2A 4O1NA 1ZKOA 4IQZA 4R4QA 4DXFA 4UPAA 1N32Q 2EVBA 4ABNA 5LHY1 2JA5H 4YCWA 4YHHL 3A74A 1KQSA 2F0WA 3DWQA 2EY1A 1SYCA 1UAPA 5NUCA 1K28A 4LFCL 5IYBH 3S14H 1GVPA 2MO0A 2E2HH 2VUMB 3PF4A 4IPDA 2F52A 2K5DA 2K04A 1O80A 3S16B 2QDLA 2OTLA 4POGA 1N33L 2PNRC 4FNFA 5JJLA 3DLLA 5T1IA 3VR4A 2G9DA 2HCCA 1EU4A 1FGUA 4NXMQ 2AQ1B 2ZXPA 1Z7TA 1ONLA 4A3MG 2IWHA 2ZJRA 2BH8A 3HOWB 4RGMA 4JBJA 2DGYA 3J7ZC 4A3EG 4XT1B 3S1MB 5GAGC 1S72A 4B3SL 3PUZA 1MHWC 1YITA 1II3A 1WCMH 2JSOA 2PI2E 2Q8RE 2UXDL 5L37A 3HEJA 1O7ZA 1HPCA 3BDLA 2EPBA 4DF7A 2I07B 2XIWA 2WIIB 2CQOA 1GUGA 1HR0W 2JK8A 4DV4Q 5FO8B 1GKHA 4PNYA 1YHBA 3D4DA 3BS1A 2KEEA 4I65A 1XPUA 4BBSG 2F0MA 5C4XH 5C3WA 1AH9A 4X66L 4LF9Q 4X3KA 3K81C 2E75C 3QJYA 5D65A 2EE1A 4AYBG 2TMPA 2YV5A 1IKLA 2EYFA 1R4QB 1KLUD 1VQCA 2EXDA 3A54A 3GO5A 3T4AC 3T1HL 4LUVA 1LV9A 3CCSA 1LM0A 3HRZC 1Q82C 3OSOA 1RIPA 1BBUA 3ULJA 4C1NK 1UUPA 4IFDJ 3NENA 2KCMA 1CQVA 3CAMA 3TBIB 1QZGA 2O5IC 5FK9C 1ILQA 1JOOA 1KABA 5ELNA 4GLVB 2NVYH 1SJHD 1LTGD 3U58A 3BVMA 1E22A 3FEWX 3QG1A 1LTRD 3RZOB 3DMUA 4DNIA 3J80i 3MZ5A 1CZGA 5JVH3 1ZEQX 4DV0L 1SXTA 1QB5D 4QB4A 5FLMG 2L11A 3CC4A 1Q8KA 5G3LD 1YJ9A 3GTOB 1BCPF 1J6QA 2ZJQA 1PYWD 1PFSA 1X3FA 2L5TA 2MHVA 3CC7A 2RDFA 2G5DA 3A8JE 4IUUA 4DR5Q 3UDGA 3OIPA 1SDFA 1TWCH 1AN8A 5CV5A 4NKLA 2ZM6Q 3OTOL 4DNTB 4ZK9B 2JJQA 4C3HH 1O7LA 1Z47A 4DGZA 4DR2Q 4XXEA 2UU9Q 1Q46A 1PH7A 4NP5A 3VYRA 3DXJC 3J81L 3OWFA 5FO9B 4ZQ3A 3K59A 1K8AC 3QO2A 2VNUD 1L0XB 3E9IA 3SK5A 4BY1B 1GJXA 2Z8LA 3I7FA 2VQFL 3FPPA 3R3OA 5BR8L 2B2UC 1GO3E 4MIUA 4DAYB 1VQOA 2WV6D 1AEXA 1K3BC 4LF5Q 1L0WA 2NZ1D 4DR3L 1HTPA 4A3IG 4A75A 3H94A 4KJOA 4A3KB 1W2BA 1F9RA 1IBMQ 3D4RA 1AZPA 3C1FA 2E2IH 1B50A 3DHQA 1L1OB 1PZID 4TSSA 1NR2A 1NNXA 1PHJA 1HTLD 1BUVT 5DM73 3CF5A 4X62L 4NB3A 5BN5A 2A8VA 4GKKL 4K2KA 4WJ4A 4GKJQ 1S5DD 1A15A 3VA7A 4LWCA 4HMJA 2FFKB 2B29A 1KNEA 2ENBA 1CI3M 4BY7H 2EYJA 3PIPA 4Y52H 1C48A 3I55A 2Y0SB 4A93G 1VQKA 3NELA 2HIXA 1SNCA 5I4DA 1QUQA 1PXUA 3J7YW 4K8IA 3KBGA 5IGCA 1JQYD 4R4IA 4Q5VA 1UEBA 1XX8A 1XWEA 2AUKA 3WOFA 5M5XH 2MP1A 4RGOS 2EYHA 4GLXA 1D2BA 2DNEA 2JN4A 2Z0SA 5JJZA 3GTMB 1JT8A 2DJGC 1J5EQ 1JORA 2X6LA 3MXGA 2Z4HA 2A1AA 1CHPD 2ZXRA 3FDTA 4LK1C 1LTAD 4X6AH 2Z6KC 2F0JA 3PF5A 1H9JA 2XSCA 1SFOH 1LTLA 1VQ4A 1M1KC 2F0DA 3MHBA 4GN4B 3S1RH 1YNJC 4X3TA 4KJNA 2NVXH 4LF6Q 1KL9A 3PO2H 2PO4A 1QNUA 5C44B 2E2JB 2R93B 1R4PB 4ALPA 2Z4IA 5HGQA 5IWAL 4KI0A 2E5LQ 2F4VQ 1IHZA 1B7YB 4OONA 2HT1A 2PNHA 2OTJA 4JV5L 4JI3L 3BVZA 1YVCA 4L8JA 2DY7A 1EY8A 1PH4A 4JI6Q 1DXMA 1CK1A 3HOYG 4Y7NB 1Y1VG 4IN3A 4LF8L 3JC66 2XWJB 4OL7A 2WAQB 3J80c 3GQBA 2UUBL 1LTID 2J7ZA 3LWUA 1PYSB 2CH4W 3CQZB 1PH8A 3UE0A 5EGTA 1K83B 2SOBA 5C0XG 1YNJD 2JA8G 1B8AA 4XQJA 1HNZQ 4G7ZC 1G6PA 3HOXH 4L5SA 3JAME 3E5SA 1HCZA 1LT6D 2KHSA 4C3JG 5C0XI 2OCEA 3BYYB 3ND9A 2PCFB 1BNZA 1MKHA 1R9TH 2R7ZB 4ZUIA 4GNXB 1STAA 1F77A 3DEOA 3FRPB 1V9PA 1V1OA 5EPKA 3FKIG 1VQ6A 2D0PA 1I6HH 3C46A 5DNFA 2HCIA 1B70B 3PUXA 4DV6L 1LT4D 1KHIA 1EEID 1EQVA 1HNXQ 5EAYA 3NSWA 1C0AA 3A55A 1XNRQ 1GUOA 1VQDA 5FOBB 1SMYD 1XMOL 3HOUH 2QF7A 1E24A 3GTPB 1VMCA 2K5VA 2LFNA 5KGUA 1IBKQ 4EQPA 2A69C 3GV3A 3C2PA 1A63A 4JI8Q 2NVQB 3NWSA 1D8LA 2K4KA 1H9MA 3D6CA 3K7UC 1GM5A 1C8CA 2IT1A 4A3FH 3RUZA 1DD2A 2JA6G 4JC0A 4HIKA 1K8MA 1TT2A 1NMFA 2B39A 4FXDA 2K14A 1BR9A 5GAEC 1PTOC 4DK6C 1LT3D 3GTKB 2RSOA 3T53B 3G7LA 1SNMA 4JI5L 1Y69U 2ZT9C 4A3LH 4KHPQ 2K50A 4JI4L 3L3OC 4C3JH 3QOJA 3WDNA 3RNUA 2A69D 1YZ6A 5DM63 3C1EA 1JJGA 1Z6HA 4KD3A 3T1YL 1X9NA 3HOZB 2MFIA 5IOCA 1RL2A 4XQQA 3SXHA 1E0BA 1HJPA 4C3IH 4IZ8A 1W6KA 4HJ7A 3PV0A 5IP9H 1BOSA 1VF5C 1D5XC 4X64Q 4IPCA 4GNXA 2EY2A 3W1GA 3NPPA 4YCUA 2CCZA 4ZCKA 1B9MA 3KF8A 3K7AH 5A2QE 3VA5A 1B9NA 2JEAI 5LL6X 2R3ZA 1HR0L 1SYDA 4EGVA 1Q7YC 4DR6L 4A3GG 1IYVA 4L63B 3A5ZB 1TIID 1IW7D 3RMHA 1KIXA 2E74C 3KYHC 4H44C 3HOVB 5M3MH 3LNNA 5CGKA 1SMXA 1E2ZA 4JVZA 3WWVA 2A73B 4GS3A 3VYSA 2K01A 2C9OA 2IX0A 5IP7H 3FHWA 1A2UA 3HS0C 2F0KA 3S1NH 1WTHA 4PV1C 4DV7L 2IHEA 2Z9HA 1GUSA 1BVSA 4BBRB 3M4PA 5LMNQ 1JE5A 1XNQQ 5D3IB 1S5BD 1HZ9A 1Y8OB 4HAEA 2WB1B 5H1SE 1GD7A 5M3FH 5K36G 2PQEA 4BA1I 3E9HA 3OYYA 3F2CA 3E3XA 5CMDA 3MC0B 3E0JA 5E7NA 1VQ7A 1VQ5A 4DV5L 1I94Q 5C4JB 3SK6A 3PO3H 2J4XA 1YHQA 2IL8A 4BXXG 1SYGA 4LW1A 4A3CH 2RQXA 1A8VA 2BDOA 3BVGA 5AJ3L 4A3BH 5IGBA 2HIVA 1Y1WH 3ZJYC 3TRZA 3D31A 3K8AA 1I3QH 2XTIA 1FYCA 2KHJA 2PW5A 3I4MB 4HJ8A 1P16A 2Z6BA 2AMCB 3GDEA 2OT2A 3CCLA 4B3ML 1JWSD 1EY4A 3ULLA 1RF2D 2JA7B 3NE5B 1VQBA 1S4ZA 1K0RA 1EYCA 4JPBW 3TN2A 4MTNA 3VR3A 3JAMi 1IZ6A 2UUAQ 3KLWA 4KY7A 4RMFA 1MGSA 5EPLA 3K58A 2ZTEA 3KOJA 2AHOB 2Q2TA 3EA6A 3H0GH 1MSGA 2UUCQ 2EYLA 1XMQQ 4AQYL 2VUMG 1HZBA 2B63B 3OOCA 4RHSA 1UNSA 2E8GA 4X3UA 2R92B 2C5CA 2VY3A 4YWMA 3UDXA 4P75A 3HG9A 2QEJC 1QCBD 4K5XA 4IUVA 4FVMA 1IBLL 1T9HA 1EFID 5FJ8G 2HHHL 3H6MA 2NZHA 2PMZB 3HOWG 1Q1BA 3I4LA 2ZTDA 5HGTA 4A3JH 2K6AA 1WTVA 4GN5A 3H09A 5ELBA 1XXGA 2RCNA 3M4OB 3U4ZA 4UP7A 2R7DA 4RGNA 4TRDA 4XDXA 5I2YA 2KA7A 3GTJH 1I6VC 3OMCA 1C7YA 4AYBE 3WOEA 1KRSA 4HCSA 1CSQA 4LNQA 3MVVA 2CWAA 3TREA 1VCIA 1JOKA 5GQOA 1KAAA 3OWEB 3RLNA 3AFQA 2IJ0A 4A3DB 2N3SA 5C3EH 4JI2L 2RKSA 2KECA 4OWWB 1TS5A 4YIJA 1O7IA 2HQLA 5IGGA 3PIP3 3I4NH 1ZXTA 4B3SQ 2JA5B 2ALYB 3X3NA 5JEAH 1NMGA 1EIYB 3EJIA 1JMCA 5C5LA 1D5MC 2ZTCA 4HSPA 3S14B 2FMCA 2E2HB 2YTVA 4DV3L 1SNOA 3KDFA 3V2TA 3KJPA 1PH5A 1D7QA 2A68C 5IYDH 1STBA 4M1UB 3G48A 4LJZC 1B3AA 3OHXC 5JVG3 1AZQA 1TKWB 2B8FA 1WI5A 4IPHA 1BBXC 1YI2A 3SDZA 1VQAA 2JP1A 1WJJA 2JE6I 4Q0FA 5EKKA 2K5QA 2VB2X 2A19A 3ITPA 4QIWB 3SHLA 4RH6A 1QVFA 1BKBA 5IYCG 2MQHA 3M4QA 3EBEA 4JI7Q 1UE7A 1SNPA 4G7OC 1PRTB 1WCMB 1N32L 1FJGQ 4QF4A 1RJTA 2CH4A 5AFWA 2F4IA 2B2TA 2NTSA 3G4SA 2Y0SE 5GAHC 2NWGA 3TSSA 5EBDA 3T13A 2XNAC 5CORA 4TVAB 4OX9Q 3A0JA 1N9WA 2RSNA 3FPUB 4HN7A 2FINB 3QR8A 5C4XB 4HSVA 2A68D 4OXPA 1STHA 4X65Q 3OPOA 3M3YH 1SLJA 2VL6A 4NXML 4ZAIA 3VDYA 3CMEA 1PVOA 1ENAA 4QL5A 2DNCA 1V43A 4EX5A 4XQNA 1E7ZA 3BG3A 3F8TA 4TQUS 1UE6A 2CW0C 5LMUQ 4CDDC 1GXDC 2F0EA 4HCEA 1QOHA 1UE1A 1FNUA 4IJHA 4BY1G 4WORA 3J81i 3I2ZA 4QJFA 1CA5A 2IX1A 2X6GA 2QEXA 1PH6A 2M2LA 1Y8PB 3TQYA 1GHKA 1I5FA 3OMGA 1XJVA 2F03A 4LFBQ 4DV4L 1HNWQ 1VQEA 3JAMc 3BDOA 1QNKA 4NPSA 2F0PA 2KENA 5ELOA 3CW2C 1EU3A 4A3KG 1PFNA 1QUQB 2NVYB 2OXPA 4A3MH 3J81j 4HTHA 2EDGA 1VMPA 4A3EH 4LF7Q 4LF9L 2K33A 3U50C 1XTDA 4F7XA 2B2WA 4DUYQ 4OIKA 2MUYA 5E4WC 3TZUA 2VXWA 5CC4A 3E0EA 1GUNA 4GOPA 1LABA 1RD9D 4GNXC 1I4HA 1I4XA 3I4OA 3F2BA 4DUZQ 2EYOA 4ULLA 2CW0D 4DAMA 4KK7A 2Y0SG 3NWTA 4BBSH 1TWCB 4JG2A 5CV7A 2F0SA 3J7AV 4K5WA 1F2LA 1SNDA 4C3HB 3CRLC 4ME5A 1TR5A 1U4MA 4B9XA 4HR7B 4OIJA 2F0IA 4DPGA 3EN2A 1EIHA 3UE1A 1H9KA 1KDBA 2MGSA 3DM1A 1EYAA 2HUGA 1WD1A 2HDLA 5GROA 3EVQA 4X62Q 2K5NA 2NVTH 1J8IA 3I72A 1VQNA 1KLGD 5BN4A 1V1QA 1ML0D 2ZXOA 4DK3C 1CSPA 1Y8NB 3GTLH 2KJXA 4CKBA 5CV4A 2QCPX 5I6WA 4DR5L 1M90C 4O0AA 1FNWA 1JJCB 4XYOA 2E2IB 1G51A 1Q3LA 3MTSA 2DJFC 1WTOA 5IT9E 2ZM6L 5C44G 1BCPD 4AIMA 4N9TA 5EBCA 4IURA 2R93G 1EZ8A 2AQ3B 3I8ZA 1X3PA 3CCJA 4DR2L 2HQEA 3S1QH 3A8IE 4FP5D 1NR4A 4K0KQ 5FLMH 3R2IA 4DAVA 4L5RC 5DAUA 3T51B 1YNXA 2OF1A 1VF7A 3BDCA 4CGYB 4JYAQ 3M7GA 1PH9A 4BY7B 1F9PA 1G6ZA 4RG1A 3CKIB 3N6RA 3G71A 1PV4A 4R9WA 5M9OA 4LFAL 2WAQG 4LF5L 2F0FA 3CCUA 4H7BA 1O7YA 3ERQA 5JJIA 1X3EA 1QG7A 1IBML 4C56C 1S5CD 5M5XB 1Y14B 3S2DH 4ME3A 3UDFA 4OO1G 1L0YB 4C2MH 4IALA 2LXKA 1DOKA 1HFNA 4CKEA 4OELB 2O5JC 4LUOA 2KOLA 2BDNA 4CBVA 4GKJL 2F0LA 2PZTA 4WJ3M 4IFDG 1E1TA 2L4NA 3V05A 5M5YH 4OO1I 4YCVA 4A3IH 1SFOB 2R7ZG 1TWGH 5FLXL 1U4LA 3I3CA 1TU2B 3S1RB 1ICWA 4BA2I 3CD6A 4WRDA 2NVXB 1IYJB 3PO2B 3P7JA 1K8GA 2VW9A 4FXKC 4IFDI 1MIUA 1TS3A 3J81c 2VQEL 2NYZD 1P8LA 3H15A 4DV1L 4KKTA 1PLFA 4MTKA 3MAQA 3S9WA 3DWAA 4B08A 2DN8A 4K8JA 4KHZA 3HKZE 1I4PA 1SNQA 3CCEA 3NQTA 1J5EL 2KEDA 4NXNQ 4EQ5A 3IAYA 4DNRB 3U9OA 3BU2A 4A93H 1NCVA 4DV2Q 1VQFA 3PGZA 5CR3A 2F1MA 3L7ZC 2KHIA 2PYKA 1FGBD 3LGJA 4IOCA 2OQKA 1SMYC 1CA6A 2RA4A 1Q8IA 2ATWA 4DR7Q 2FXQA 1K8OA 4LF6L 4UHVA 4OWXB 2FMMA 4NMZA 4I7ZC 2F3WA 3IRBA 1AP0A 2EY5A 1VQ8A 2GA4B 4A4IA 1JE4A 2PI2A 3NUCA 2E5LL 3HOXB 2F4VL 4CDEC 4L5QA 4KTAA 4CKCA 4IO9A 4DN4M 3I90A 4TKOB 4JI6L 4F88A 1ET9A 4JI1Q 1STNA 1E1OA 1YHAA 2EQSA 3IKJA 1VQMA 3KF8B 2EJGC 2K7VA 1HA5A 1QWYA 1R9TB 2PZUA 1SN8A 2MPMA 4RCNA 3ER0A 1XTCD 2CQAA 1I6HB 1BCPB 3QOLA 3KFUA 3C3LA 3CCRA 4JCVE 3HOZG 2M00A 5F2DA 3KLSA 4YY3Q 5KNCA 3EQLC 3P20A 3LWEA 1WTPA 1M8AA 3EROA 2PW7A 3ND8A 4B3RQ 3HOUB 4CHTB 2DUDA 3I56A 1HNZL 3D8GA 1HUNA 1RODA 2B2TC 1DONA 1IYUA 4B3TQ 2Q2HA 3IL8A 3HOYH 1KDAA 4V190 4EQOA 3RN5A 4DR4Q 1X55A 1Y1VH 3AYHB 2EJMA 3R8BA 1EY7A 3HKZG 1EY9A 4R4TA 1TWHH 3D4WA 1V8QA 3Q8DA 4BS9A 4HEDA 3TP6A 4L5TA 4A3FB 4YWKA 3H3VC 1HQRD 3MXPA 3HOVG 1AE2A 2WKCA 1ET6A 1NY4A 4Z9CB 2R6GA 3K5MA 5C0XH 1LT5D 2WFWA 3RLFA 4MZ9A 2JA8H 1I50H 3G6JB 1PTOF 5IE8A 1WTQA 3K5NA 1IW7C 5JEAJ 5K5PA 2KCNA 3SR1A 1WOCA 4BBRG 5C3XA 1HNXL 5CYUA 1FNVA 1K3RA 1XNRL 2KCTA 3V96A 3MWYW 5GADC 1BDOA 2WB1G 1IBKL 4RKBA 3ONAB 4NDXA 4JI8L 4DR1L 1SE2A 4ZUJA 1RDPD 4OEMB 4C3JB 2K75A 1Q90A 4IUPA 1PZKD 1HUMA 1EWIA 3FKIH 2WP8J 4HIDA 2D9UA 4APVA 1UEAB 2RHQB 3NTKA 3NTIA 4LF4Q 5E3FA 4P2CB 3L2PA 2B2WC 4C3IB 1U0LA 3NBHB 5EKIA 1TWFH 1LTBD 4GOPC 4S3SA 2D0OA 2F0NA 5J22A 5CV8A 1TWAH 1A0IA 3K7AB 4OWTB 3SGIA 3I4MG 2UXCQ 2L1BA 2VZAA 4KHPL 2F3VA 2SEBD 1TS2A 5ELEA 1PA6A 3GV6A 3K57A 3MXNB 1GUTA 1PRTC 5KNDA 5M3MB 3U9SA 2JA7G 2JA6H 2Q2IA 4HJ5A 1VDZA 4R8IA 3BZDB 1KC8C 2E2DC 1PH1A 3S1NB 1HZCA 3QB3A 1GHJA 2A6EC 2IPKD 3K6OA 4R4CA 1XPOA 3S15H 4J8QA 4XIGS 3U4VA 2XRQD 4JI0L 4X64L 3S2HH 1X6OA 3J81E 1EQQA 3S15B 5EQ0A 1HHVA 5M3FB 4UY8C 4RGTA 2B63G 1QJOA 4JW0A 3VR6A 2R92G 5LL6S 2KQ3A 3CRKC 2UXBQ 4QIWE 3PQIA 1HFGA 5BN3A 4RKLA 2LXJA 2LKVA 3PO3B 3VR5A 3S17H 1BQQT 3T16A 2K03A 1PRTD 3OW7A 4A3BB 4O2DA 3I91A 4L6TB 1WTXA 1Y1WB 3CPFA 1SE3A 1I3QB 2LS01 3L0OA 4FYDA 5LMNL 1XNQL 3X3MA 1SRUA 2A6ED 1EQTA 2B2YA 5E1FA 3KDFB 4RA8A 3RZDH 4DK0A 3Q22A 1N34Q 4A3GH 1S5FD 3H3VI 3NTHA 2NBFA 1X56A 3NBHA 3NXWA 4P74A 5J39A 3CU7A 1YIJA 1AW7A 4DA2A 1IBLQ 2NN6G 5CV6A 1N36Q 1ILPA 4JBKA 2J0TD 4A3DG 4IUNA 4QQBX 1BF4A 2GVAA 1I94L 2MJ8A 3AQQA 5EPJA 1LTSD 1DYQA 2JA5G 1ENCA 2K32A 3H0GB 3F2UA 3K5LA 3SEBA 3SVMA 1KXLA 2NN6I 5IYBG 1KRTA 3GTQH 1B3QA 1JWUD 2YU9H 4R1JA 3ZYYX 3Q23A 4KD4A 3MXNA 5KYLA 2TSSA 5K36H 4E6IA 3OW2A 1OXXK 3DWPA 1HQMC 3I73A 2PPBC 3PUYA 1GOZA 4XT3B 1RTNA 2R7FA 3TS2A 3GP7A 1J9OA 1UE5A 1YEZA 4ODGA 2F0QA 2ASBA 1VQHA 2G9HD 2KCCA 3M9BA 4WFN3 2O4XA 2KBNA 4FF3A 1EL0A 1TVXA 2E76C 3PUWA 4PZ7A 2R61A 5KNBA 1TY2A 4JI2Q 4YHHQ 4A3JB 4BXXH 2UUAL 5I2XA 1SE4A 4LFCQ 1WCMG 5IT9c 1A3UA 4K6DA 1VS0A 4AH6A 3GTJB 2NTTA 2UUCL 1N33Q 1XMQL 2EIFA 2IX3A 1LO5D 5JAVA 1MI2A 4PMBA 3CCQA 1PTOH 5M5WH 2F3IA 1B2TA 3NEMA 5C4XG 3EIVA 4K5VA 1WTRA 1JOQA 1WTWA 5C3EB 3KF6B 1MBYA 4EVOA 2NB0A 3I4NB 2UXDQ 2BCOA 4UDUC 5CBAE 1AFPA 3D6WA 3IFDA 2IY5B 2EXZA 1BXTA 5I9OA 1HZAA 2N88A 3QWNA 3W5OA 1CKOA 3W3AA 3NK9A 1XPRA 2NUCA 1IL8A 4GOPB 2K05A 2VUMH 1B44D 3CXCA 1EZ6A 2EZVA 2RBMA 3S16H 4K2LA 1CT1D 4ZKBB 1VQJA 2H1EA 4X66Q 2YYZA 4RHRA 4QGUA 5FJ8H 2B2VA 2B3GA 1LTTD 3PUVA 2JXMB 3HOWH 4OGQC 3S1MH 1ASYA 2CHBD 3HFZB 4N9PA 4LAAA 1EIGA 3T1HQ 3URYA 1U9RA 1FD7D 3K5OA 4FO2A 1CZWA 3M4YA 5E4XA 2YTXA 3D0FA 1EY5A 1IXRA 4ID6A 2D62A 1NTGA 4BWGB 1TY0A 1OXSC 3CCVA 2OQ0A 3T56B 2VB3X 5G3LF 3M3YB 4C3HG 1Q86C 1H95A 2L15A 4F8MA 1MJCA 4ZLTF 5C4HA 4DV0Q 4PG3A 2XGTA 1DZ1A 2AUJD 4X3SA 1VQIA 1EOVA 2BA0A 5J3BA 3TMEA 3RN2A 4JI7L 2OWOA 4MN3A 4KY6A 3TP8A 1B53A 3O13A 1FJGL 2IHFA 5T1GA 4KKSA 2I5HA 1OXVA 2WKDA 3PCOB 1DJRD 1H9SA 2GVBA 2AWNA 2H4OA 2QGQA 3KF6A 4M8AA 3OTOQ 1PMRA 4C1NI 4P72A 2QILA 1SBBB 5FO7B 1EYGA 4OX9L 4UP8A 3TP5A 5C5MA 4HJ9A 4A3MB 2AKWB 4DU9A 2I46A 4DXGA 3NP8A 4A3EB 4X65L 4R4OA 5IYCH 3RZOH 1YJNA 5DEHA 2ID0A 5TSSA 5LMNW 1CFMA 5A2QL 3IFTA 2PZWA 2VQFQ 5BR8Q 4KN4C 2P5ZX 2N8NA 2WAQE 1KNAA 4FXGC 5LMUL 3GTOH 1EYDA 1V1PB 1BCPC 4DR3Q 1TS4A 4BY7G 4LUZA 3VR2A 2C35B 5ELFA 3BZCA 1B1ZA 1L2FA 5IODA 4BBSB 5JPMC 4LFBL 4H02A 1HNWL 1JICA 3MEHA 1SYFA 2XN9C 4N8X1 3G6EA 3K0XA 1W6JA 4AYBB 5ISRA 4HJAA 4J6HA 4V0BA 4U68A 3TS0A 3S24A 4LF7L 5C0XJ 4GKKQ 1Z9FA 4DUYL 4K14A 2NVTB 1DOMA 1ASZA 4J15A 2Z1CA 4BY1H 1EUJA 2RHSB 1PH3A 3A5UA 2LSSA 1C9OA 3W1BA 3SK4A 4DUZL 2AQ2B 3J7A5 3GTLB 2K52A 3L9AX 3N52A 3E6ZX 1SEBD 1ESRA 3MFGA 4NW2A 3KLRA 2MNAA 5JOBA 1EWHA 4LFAQ 4A3KH 1A3TA 1F9SA 2RCFA 2LMCB 3J80L 4DKAC 1QILA 4WJWA 3PO2G 4QUCA 2UU9L 2BA1A 2SDFA 3S1QB 4PMWA 1I4QA 2EYMA 1LACA 1E2WA 1KTKA 1HRJA 4H0LC 2F0VA 3KUPA 2Q8IB 1VQLA 2L9HA 1G2TA 2YTYA 5JPNC 4H13C 2L12A 1SAPA 4JOIC 3PIOA 2B2YC 1VQ9A 2A6HC 2RF4A 4KV6A 1FL0A 5A35A 1RKNA 1SJED 2L0CA 5HURA 4MNOA 2SNMA 5IWAQ 1IL2A 3HZXA 2NZOA 2H5XA 4RCOA 3TDQA 3S2DB 4DFAA 4GZYC 2VQEQ 4C2MB 4DV1Q 1V1PA 2I0QA 4JI3Q 2JYOA 4R8NA 4JV5Q 1K0SA 5IGEA 4RAUC 5FKAC 3HOXG 5D3DA 1NJIC 2HDMA 2Q2UA 3GTGH 3GTMH 4CJ1B 1VQPA 4K0KL 4LF8Q 1H9RA 2BH2A 1W3SA 1STGA 3GTGB 2QKIC 3DUZA 1X54A 4JYAL 5M5YB 1MD2D 5JJKA 4A3IB 2UUBQ 1E2VA 1TWGB 1A6XA 3DEPA 2I5LX 4PQXA 3BYTB 3CPWA 2A6HD 1Q1EA 2M9VA 2F0UA 1DM0B 1MSHA 1HA6A 4J1MA 2ZJPA 1STEA 2QDBA 4JK1C 5C44H 3A8KE 2E2JH 1LLRD 2R93H 1JCKB 4G57A 5EKLA 1PFBA 4PZ8A 1S40A 4IPGA 5J1ZA 3Q0AA 4CDFC 3HOUG 2V1CC 4G4KA 1D1IA 1AE3A 4QY7A 1A3VA 1K73C 1I4GA 4DAYA 1JWMD 2V4DA 3AMUA 4B9WA 4Y7NH 3H91A 1ENFA 1JJ2A 4A93B 1KAWA 1NBWA 3CMAA 1B4OA 1Q12A 1G91A 2CKZB 1L1OA 4A3FG 4QUFA 4XTCS 3KJOA 3A7AB 3F2DA 2XRSD 1X65A 4DV6Q 2O2LD 3CQZH 1LUZA 3I70A 1K83H 4OO1H 1XMOQ 2AWOA 2WB1E 2KVMA 2I5MX 3K80C 4RFBA 5I6YA 4KY5A 4U673 3Q24A 1PZJD 3SK8A 1QVCA 1IKMA 3PSIA 3FP9A 3UDIA 4IFDH 1A62A 3EFXD 1VQGA 2JEBI 4A3LG 1JC7A 4NXNL 1CKNB 3BZKA 1NUCA 2R7ZH 3M7NA 3P1HA 4DV2L 2BOSA 2B2VC 1T5EA 1ESFA 1YBYA 2CFMA 4PZ6A 1OO9B 4UP9A 4DR7L 4GLAC 2WACA 4YWLA 4C3IG 2B8GA 4FF2A 5DLQE 1TQOA 5IP9G 1JR0D 4JI5Q 1F9QA 5C4ZA 4DK1A 3MXUA 4JBWA 2F0OA 3GTPH 2XWBB 5D14A 1M4VA 3HOYB 4JI4Q 1Y1VB 2NVQH 1X3QA 4ILWA 5FLXc 1TWHB 3HKSA 4JI1L 1TXYA
chains in the Genus database with same CATH topology
2K5HA 1N34Q 3NELA 2HIXA 4TVAB 3A0JA 3T1YQ 3H3VI 1N9WA 4DR1Q 4A3GH 1QUQA 4P74A 1X56A 1YIJA 4OXPA 4X65Q 1IBLQ 2NN6G 3M3YH 1Q81C 1N36Q 1SLJA 5M3MG 2VL6A 4R4IA 4JBKA 4NXML 4A3DG 3VDYA 4QQBX 1UEBA 3CMEA 5M5XH 1PVOA 4QL5A 1MJEA 1SE8A 2GVAA 5IP7G 1I94L 1V43A 4YY3L 3GTKH 1LYLA 1QVGA 1PYBA 3AQQA 1E7ZA 4EX5A 4GLXA 2JA5G 3F8TA 4TQUS 1UE6A 5LMUQ 2Z0SA 4A76A 4B3RL 1JT8A 1UE1A 2NN6I 5IYBG 4IJHA 4BY1G 1KRTA 3J81i 3I2ZA 4QJFA 1J5EQ 1CUKA 2IX1A 3GTQH 2QEXA 1PH6A 4R1JA 1HR0Q 2YU9H 3TQYA 2A1AA 4DR6Q 1I5FA 5M3FG 4B3TL 1XJVA 2PMZE 3B6YA 2ES2A 4LFBQ 4DV4L 4DR4L 4X6AH 2Z6KC 3OW2A 1VQEA 3JAMc 1HNWQ 3DM3A 1OXXK 3PF5A 1SFOH 4NPSA 1LTLA 3PUYA 2KENA 1VQ4A 5ELOA 1M1KC 3CW2C 4GN4B 4A3KG 2R7FA 3S1RH 3TS2A 3RR5A 1UE5A 4LF6Q 2NVXH 1QUQB 1KL9A 1YEZA 4A3MH 3PO2H 3J81j 4P71A 2ASBA 1VQHA 3M9BA 3HOZH 4A3EH 4LF7Q 4LF9L 3PO3G 2KBNA 1X3GA 3U50C 4ALPA 5HGQA 5IWAL 3PUWA 4PZ7A 4DV7Q 4IOAA 1XTDA 4KI0A 4JI2Q 4YHHQ 4DUYQ 2E5LQ 2F4VQ 4BXXH 1B7YB 4OONA 2UUAL 4A3CG 2HT1A 2PNHA 2OTJA 4LFCQ 1JB7A 4A3BG 1WCMG 4JV5L 3E0EA 4JI3L 1YVCA 4JV5Q 5IT9c 4GOPA 2N78A 1CKNA 4GNXC 1Y1WG 1PH4A 4JI6Q 1VS0A 4HIMA 4AH6A 3I4OA 4DUZQ 3F2BA 2UUCL 1N33Q 1XMQL 3HOYG 4JI0Q 2EIFA 3GD7A 1OTCA 1Y1VG 4LF8L 3JC66 4DAMA 1SR3A 1G291 2Y0SG 3CCQA 5M5WH 4JG2A 3J80c 3CCMA 4BBSH 2F3IA 2UUBL 3NEMA 2CWPA 1EQRA 5C4XG 3EIVA 4DV5Q 1UWVA 1PYSB 3HOVH 1PH8A 2JQOA 3KF6B 3UE0A 4DPGA 1WFQA 3EN2A 3UE1A 5C0XG 4FDBA 3STBC 2UXDQ 5AJ3Q 4LF4L 2JA8G 1B8AA 4IJLA 1FVIA 1HNZQ 3F1ZA 2IY5B 5GROA 1G6PA 4X62Q 3HOXH 4L5SA 1HZAA 3W5OA 1CKOA 3H0GG 1QZHA 2K5NA 2NVTH 4BBRH 1N8RC 1XPRA 4GOPB 1NE3A 5HY6A 2VUMH 1VQNA 4HIOA 1CKMA 1V1QA 3CXCA 1K9MC 5C0XI 3S16H 4DK3C 1CSPA 1WYDA 2OCEA 3GTLH 1MKHA 1R9TH 4B3MQ 1HH2P 2PQAB 4GNXB 2UXCL 1VQJA 4X66Q 4DR5L 3TEHB 1M90C 4O0AA 2YYZA 1EFWA 1JJCB 1DGSA 1V9PA 4QGUA 3FKIG 5FJ8H 1VQ6A 2B3GA 3PUVA 2D0PA 1I6HH 1G51A 1PH2A 2ZM6L 3HOWH 1B70B 5C44G 4AIMA 5C4JH 3PUXA 3S1MH 2R93G 2GN5A 4DV6L 3ULPA 1ASYA 1KHIA 3CCJA 3AFPA 3HFZB 4DR2L 4A3JG 3S1QH 3T1HQ 1HNXQ 5EAYA 1C0AA 1OXTA 4AQYQ 1VQDA 2JA9A 4P73A 3RLOA 1XMOL 5FLMH 4JOIA 3CC2A 1XNRQ 3HOUH 4K0KQ 1E24A 4L5RC 2K5VA 2YTXA 3STBD 3D0FA 1IBKQ 1YNXA 1IXRA 4JYAQ 2D62A 1A63A 1KD1C 4JI8Q 1PH9A 1NTGA 2VS1A 3I4MH 1OXUA 4RG1A 1D8LA 1OXSC 3G71A 1PV4A 2K4KA 3AEVA 3CCVA 4LFAL 4JBMA 2OQ0A 2WAQG 3K7UC 1GM5A 2HHHQ 4LF5L 2QA4A 2IT1A 4POFA 4A3FH 3CCUA 5JJIA 1X3EA 1Q86C 2JA7H 1IBML 2JA6G 4JC0A 1H95A 5IY0A 2L15A 4HIKA 2UXBL 1Y14B 5C3EG 3S2DH 4ME3A 1MJCA 1NMFA 3UDFA 4DV0Q 4PG3A 3I4NG 2XGTA 4C2MH 4OO1G 2K14A 2LXKA 5JEAG 1KXLA 1VQIA 1EOVA 2BA0A 5J3BA 3RN2A 4JI7L 5GAEC 4DK6C 2OWOA 4LUOA 1FJGL 2IHFA 4GKJL 4JI5L 2I5HA 4WJ3M 2MO1A 1OXVA 1E1TA 4IFDG 3PCOB 5IYDG 4A3LH 2B63H 4KHPQ 2GVBA 2K50A 5M5YH 4JI4L 2AWNA 4YCVA 2QGQA 4OO1I 4A3IH 3KF6A 2R92H 2Z6KA 1TWGH 3OTOQ 2R7ZG 4C3JH 4P72A 3RNUA 1YZ6A 1EYGA 4OX9L 1N34L 1JJGA 4UP8A 3T1YL 4BA2I 3CD6A 3ICEA 1S3OA 1IYJB 2N49A 4HJ9A 2AKWB 1X9NA 4OX9Q 1EIFA 1K8GA 4KLKA 2VW9A 2MFIA 4X65L 4IFDI 1MIUA 1RL2A 4R4OA 3J81c 3H15A 1P8LA 2VQEL 4DV1L 1N36L 1SROA 5IYCH 3RZOH 1YJNA 1HJPA 4C3IH 4HJ7A 3PV0A 2ID0A 5LMNW 3H3VH 5IP9H 2VQFQ 5BR8Q 4DV3Q 4X64Q 4IPCA 3M4OH 4DR4Q 2PQAA 2N8NA 2WAQE 4GNXA 3W1GA 5LMUL 4KHZA 3GTOH 3HKZE 1BBWA 4YCUA 3CCEA 2CCZA 1J5EL 4NXNQ 3M85A 4DR3Q 3K7AH 4BY7G 4LUZA 2JEAI 4EQ5A 1HR0L 3CP0A 3BU2A 2C35B 1YJWA 4A93H 1Q7YC 3BZCA 3ERSX 1L2FA 1VQFA 4DV2Q 4A3GG 3PGZA 4DR6L 3MEFA 3L7ZC 2KHIA 1L1OC 3A5ZB 4LFBL 4IOCA 3LGJA 2OQKA 4H02A 1KIXA 1HNWL 3KYHC 1E3PA 2ATWA 3G6EA 3BJUA 4DR7Q 4GN3B 5M3MH 3K0XA 2FXQA 1SMXA 4A3DH 3WWVA 4LF6L 4GS3A 1U5KA 4HJAA 4OWXB 4R4QA 4UPAA 3TS0A 2IX0A 5IP7H 3FHWA 3S24A 4LF7L 1N32Q 5C0XJ 4GKKQ 3S1NH 3IRBA 1Z9FA 4DV7L 2IHEA 1VQ8A 4A4IA 4YCWA 4YHHL 4DUYL 2PI2A 2JA5H 2E5LL 3A74A 1KQSA 2F4VL 1BVSA 4L5QA 1ASZA 4J15A 3M4PA 4LFCL 5IYBH 4BY1H 1EUJA 2RHSB 1JE5A 5LMNQ 1GVPA 4IO9A 2MO0A 1PH3A 2E2HH 1XNQQ 3S14H 3PF4A 4IPDA 2F52A 1HZ9A 3A5UA 4JI6L 2LSSA 1C9OA 3W1BA 4JI1Q 5H1SE 2EQSA 1E1OA 1GD7A 1YHAA 5M3FH 1VQMA 5K36G 4DUZL 2OTLA 4POGA 1N33L 3KF8B 3J7A5 2K52A 4BA1I 5JJLA 3DLLA 3E9HA 3OYYA 1SN8A 3F2CA 2MNAA 4LFAQ 4A3KH 3ER0A 1FGUA 4NXMQ 4DKAC 5E7NA 1VQ7A 3KFUA 4A3MG 3PO2G 3CCRA 2ZJRA 4JCVE 2BH8A 3HOZG 1VQ5A 4JBJA 2DGYA 3J7ZC 4DV5L 4A3EG 1I94Q 2UU9L 3PO3H 2BA1A 4YY3Q 1YHQA 5GAGC 1S72A 4B3SL 3PUZA 4BXXG 1YITA 4LW1A 4PMWA 4A3CH 4B3RQ 4A3BH 1A8VA 1WCMH 5AJ3L 2PI2E 2UXDL 2DUDA 3I56A 2HIVA 1HNZL 1Y1WH 3ZJYC 3TRZA 3D31A 3K8AA 1VQLA 1I3QH 2YTYA 2CQOA 4B3TQ 2XTIA 2Q2HA 4JOIC 3HOYH 2KHJA 3PIOA 2JK8A 4DV4Q 3RN5A 1X55A 1Y1VH 1HR0W 1GKHA 3AYHB 1VQ9A 4HJ8A 1YHBA 3HKZG 1P16A 2RF4A 4R4TA 1TWHH 2AMCB 3GDEA 1FL0A 3Q8DA 1XPUA 4BBSG 4L5TA 3CCLA 4YWKA 3ULLA 5C4XH 4B3ML 1AH9A 4X66L 4LF9Q 4MNOA 3K81C 1VQBA 5IWAQ 3HOVG 1IL2A 1K0RA 1AE2A 2NZOA 2H5XA 4AYBG 4MTNA 3JAMi 1NY4A 2R6GA 1IZ6A 2UUAQ 2YV5A 2WFWA 3KLWA 4MZ9A 3RLFA 2VQEQ 4DV1Q 2I0QA 4RMFA 1I50H 4JI3Q 2JA8H 2ZTEA 5IE8A 3KOJA 1VQCA 2AHOB 2Q2TA 2EXDA 5JEAJ 3HOXG 3GO5A 3H0GH 1WOCA 3T1HL 2UUCQ 4BBRG 1NJIC 1XMQQ 1HNXL 2Q2UA 3GTGH 3GTMH 1K3RA 4LUVA 4AQYL 1VQPA 1XNRL 4K0KL 2KCTA 4LF8Q 3CCSA 1LM0A 2BH2A 1W3SA 1Q82C 2VUMG 1RIPA 1BBUA 1HZBA 5GADC 3ULJA 2WB1G 1IBKL 4IFDJ 1X54A 4JYAL 3NENA 5JJKA 4JI8L 2E8GA 2UUBQ 4DR1L 2KCMA 2VY3A 4YWMA 3UDXA 4P75A 2K75A 3CAMA 1IBLL 2I5LX 3CPWA 1T9HA 1QZGA 1EWIA 1Q1EA 3FKIH 2WP8J 5FJ8G 4HIDA 2HHHL 5ELNA 4GLVB 4APVA 2ZJPA 2NVYH 2RHQB 2NZHA 3HOWG 3U58A 1Q1BA 5C44H 1E22A 2ZTDA 2E2JH 4LF4Q 2R93H 4DNIA 3J80i 3L2PA 1U0LA 3NBHB 4A3JH 4PZ8A 1TWFH 4IPGA 4GN5A 1S40A 4DV0L 2RCNA 4GOPC 3HOUG 2V1CC 2D0OA 5FLMG 3U4ZA 1AE3A 4QY7A 4UP7A 3CC4A 1Q8KA 2R7DA 1K73C 1YJ9A 1TWAH 1A0IA 1J6QA 3GTJH 2ZJQA 4OWTB 1PFSA 4Y7NH 1X3FA 1JJ2A 3SGIA 3CC7A 3I4MG 2UXCQ 3UDGA 1KAWA 4DR5Q 1NBWA 3CMAA 2VZAA 1C7YA 4AYBE 1Q12A 1KRSA 4KHPL 1TWCH 2CKZB 1CSQA 1PA6A 4LNQA 1L1OA 2CWAA 3TREA 2ZM6Q 4A3FG 3OTOL 1VCIA 3MXNB 4XTCS 2JJQA 5GQOA 4C3HH 3KJOA 3F2DA 2JA7G 3RLNA 1X65A 3AFQA 2Q2IA 1Z47A 4HJ5A 4DV6Q 2JA6H 3CQZH 1LUZA 2N3SA 5C3EH 4DR2Q 4JI2L 4OWWB 2UU9Q 1Q46A 1K83H 1O7IA 2HQLA 1KC8C 1PH7A 1PH1A 3I4NH 1XMOQ 1HZCA 4B3SQ 2AWOA 2WB1E 2ALYB 1NMGA 2I5MX 1K8AC 1EIYB 1XPOA 4R4CA 3S15H 2VNUD 3K80C 3E9IA 1JMCA 2ZTCA 4XIGS 3U4VA 3I7FA 2YTVA 1QVCA 5BR8L 3PSIA 4X64L 2VQFL 1X6OA 4DV3L 1EQQA 4JI0L 3S2HH 3KDFA 1GO3E 3FP9A 3UDIA 4DAYB 1A62A 3KJPA 1VQOA 1PH5A 4UY8C 1D7QA 1VQGA 2JEBI 5IYDH 4A3LG 2B63G 4NXNL 1L0WA 3G48A 4DR3L 4LF5Q 4A3IG 1CKNB 3BZKA 2R92G 2R7ZH 1WI5A 4IPHA 3M7NA 4A75A 1W2BA 1YI2A 4DV2L 1IBMQ 1VQAA 2E2IH 2UXBQ 4QIWE 1L1OB 1WJJA 2JE6I 2LXJA 1PHJA 2A19A 1YBYA 2CFMA 4PZ6A 4UP9A 4DR7L 1QVFA 3S17H 1BKBA 5IYCG 2MQHA 4GLAC 3M4QA 4YWLA 3EBEA 4JI7Q 1UE7A 3CF5A 4X62L 4NB3A 4O2DA 5DLQE 1N32L 1FJGQ 2A8VA 5IP9G 4GKKL 4WJ4A 4GKJQ 4JI5Q 3CPFA 4JBWA 3GTPH 4LWCA 3L0OA 3G4SA 2B29A 4JI4Q 2Y0SE 5LMNL 1XNQL 5GAHC 4BY7H 1SRUA 2NVQH 3PIPA 4Y52H 3I55A 5FLXc 3KDFB 3RZDH 4A93G 3HKSA 4JI1L 1TXYA 1VQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K5H A;  1N34 Q;  3NEL A;  2HIX A;  4TVA B;  3A0J A;  3T1Y Q;  3H3V I;  1N9W A;  4DR1 Q;  4A3G H;  1QUQ A;  4P74 A;  1X56 A;  1YIJ A;  4OXP A;  4X65 Q;  1IBL Q;  2NN6 G;  3M3Y H;  1Q81 C;  1N36 Q;  1SLJ A;  5M3M G;  2VL6 A;  4R4I A;  4JBK A;  4NXM L;  4A3D G;  3VDY A;  4QQB X;  1UEB A;  3CME A;  5M5X H;  1PVO A;  4QL5 A;  1MJE A;  1SE8 A;  2GVA A;  5IP7 G;  1I94 L;  1V43 A;  4YY3 L;  3GTK H;  1LYL A;  1QVG A;  1PYB A;  3AQQ A;  1E7Z A;  4EX5 A;  4GLX A;  2JA5 G;  3F8T A;  4TQU S;  1UE6 A;  5LMU Q;  2Z0S A;  4A76 A;  4B3R L;  1JT8 A;  1UE1 A;  2NN6 I;  5IYB G;  4IJH A;  4BY1 G;  1KRT A;  3J81 i;  3I2Z A;  4QJF A;  1J5E Q;  1CUK A;  2IX1 A;  3GTQ H;  2QEX A;  1PH6 A;  4R1J A;  1HR0 Q;  2YU9 H;  3TQY A;  2A1A A;  4DR6 Q;  1I5F A;  5M3F G;  4B3T L;  1XJV A;  2PMZ E;  3B6Y A;  2ES2 A;  4LFB Q;  4DV4 L;  4DR4 L;  4X6A H;  2Z6K C;  3OW2 A;  1VQE A;  3JAM c;  1HNW Q;  3DM3 A;  1OXX K;  3PF5 A;  1SFO H;  4NPS A;  1LTL A;  3PUY A;  2KEN A;  1VQ4 A;  5ELO A;  1M1K C;  3CW2 C;  4GN4 B;  4A3K G;  2R7F A;  3S1R H;  3TS2 A;  3RR5 A;  1UE5 A;  4LF6 Q;  2NVX H;  1QUQ B;  1KL9 A;  1YEZ A;  4A3M H;  3PO2 H;  3J81 j;  4P71 A;  2ASB A;  1VQH A;  3M9B A;  3HOZ H;  4A3E H;  4LF7 Q;  4LF9 L;  3PO3 G;  2KBN A;  1X3G A;  3U50 C;  4ALP A;  5HGQ A;  5IWA L;  3PUW A;  4PZ7 A;  4DV7 Q;  4IOA A;  1XTD A;  4KI0 A;  4JI2 Q;  4YHH Q;  4DUY Q;  2E5L Q;  2F4V Q;  4BXX H;  1B7Y B;  4OON A;  2UUA L;  4A3C G;  2HT1 A;  2PNH A;  2OTJ A;  4LFC Q;  1JB7 A;  4A3B G;  1WCM G;  4JV5 L;  3E0E A;  4JI3 L;  1YVC A;  4JV5 Q;  5IT9 c;  4GOP A;  2N78 A;  1CKN A;  4GNX C;  1Y1W G;  1PH4 A;  4JI6 Q;  1VS0 A;  4HIM A;  4AH6 A;  3I4O A;  4DUZ Q;  3F2B A;  2UUC L;  1N33 Q;  1XMQ L;  3HOY G;  4JI0 Q;  2EIF A;  3GD7 A;  1OTC A;  1Y1V G;  4LF8 L;  3JC6 6;  4DAM A;  1SR3 A;  1G29 1;  2Y0S G;  3CCQ A;  5M5W H;  4JG2 A;  3J80 c;  3CCM A;  4BBS H;  2F3I A;  2UUB L;  3NEM A;  2CWP A;  1EQR A;  5C4X G;  3EIV A;  4DV5 Q;  1UWV A;  1PYS B;  3HOV H;  1PH8 A;  2JQO A;  3KF6 B;  3UE0 A;  4DPG A;  1WFQ A;  3EN2 A;  3UE1 A;  5C0X G;  4FDB A;  3STB C;  2UXD Q;  5AJ3 Q;  4LF4 L;  2JA8 G;  1B8A A;  4IJL A;  1FVI A;  1HNZ Q;  3F1Z A;  2IY5 B;  5GRO A;  1G6P A;  4X62 Q;  3HOX H;  4L5S A;  1HZA A;  3W5O A;  1CKO A;  3H0G G;  1QZH A;  2K5N A;  2NVT H;  4BBR H;  1N8R C;  1XPR A;  4GOP B;  1NE3 A;  5HY6 A;  2VUM H;  1VQN A;  4HIO A;  1CKM A;  1V1Q A;  3CXC A;  1K9M C;  5C0X I;  3S16 H;  4DK3 C;  1CSP A;  1WYD A;  2OCE A;  3GTL H;  1MKH A;  1R9T H;  4B3M Q;  1HH2 P;  2PQA B;  4GNX B;  2UXC L;  1VQJ A;  4X66 Q;  4DR5 L;  3TEH B;  1M90 C;  4O0A A;  2YYZ A;  1EFW A;  1JJC B;  1DGS A;  1V9P A;  4QGU A;  3FKI G;  5FJ8 H;  1VQ6 A;  2B3G A;  3PUV A;  2D0P A;  1I6H H;  1G51 A;  1PH2 A;  2ZM6 L;  3HOW H;  1B70 B;  5C44 G;  4AIM A;  5C4J H;  3PUX A;  3S1M H;  2R93 G;  2GN5 A;  4DV6 L;  3ULP A;  1ASY A;  1KHI A;  3CCJ A;  3AFP A;  3HFZ B;  4DR2 L;  4A3J G;  3S1Q H;  3T1H Q;  1HNX Q;  5EAY A;  1C0A A;  1OXT A;  4AQY Q;  1VQD A;  2JA9 A;  4P73 A;  3RLO A;  1XMO L;  5FLM H;  4JOI A;  3CC2 A;  1XNR Q;  3HOU H;  4K0K Q;  1E24 A;  4L5R C;  2K5V A;  2YTX A;  3STB D;  3D0F A;  1IBK Q;  1YNX A;  1IXR A;  4JYA Q;  2D62 A;  1A63 A;  1KD1 C;  4JI8 Q;  1PH9 A;  1NTG A;  2VS1 A;  3I4M H;  1OXU A;  4RG1 A;  1D8L A;  1OXS C;  3G71 A;  1PV4 A;  2K4K A;  3AEV A;  3CCV A;  4LFA L;  4JBM A;  2OQ0 A;  2WAQ G;  3K7U C;  1GM5 A;  2HHH Q;  4LF5 L;  2QA4 A;  2IT1 A;  4POF A;  4A3F H;  3CCU A;  5JJI A;  1X3E A;  1Q86 C;  2JA7 H;  1IBM L;  2JA6 G;  4JC0 A;  1H95 A;  5IY0 A;  2L15 A;  4HIK A;  2UXB L;  1Y14 B;  5C3E G;  3S2D H;  4ME3 A;  1MJC A;  1NMF A;  3UDF A;  4DV0 Q;  4PG3 A;  3I4N G;  2XGT A;  4C2M H;  4OO1 G;  2K14 A;  2LXK A;  5JEA G;  1KXL A;  1VQI A;  1EOV A;  2BA0 A;  5J3B A;  3RN2 A;  4JI7 L;  5GAE C;  4DK6 C;  2OWO A;  4LUO A;  1FJG L;  2IHF A;  4GKJ L;  4JI5 L;  2I5H A;  4WJ3 M;  2MO1 A;  1OXV A;  1E1T A;  4IFD G;  3PCO B;  5IYD G;  4A3L H;  2B63 H;  4KHP Q;  2GVB A;  2K50 A;  5M5Y H;  4JI4 L;  2AWN A;  4YCV A;  2QGQ A;  4OO1 I;  4A3I H;  3KF6 A;  2R92 H;  2Z6K A;  1TWG H;  3OTO Q;  2R7Z G;  4C3J H;  4P72 A;  3RNU A;  1YZ6 A;  1EYG A;  4OX9 L;  1N34 L;  1JJG A;  4UP8 A;  3T1Y L;  4BA2 I;  3CD6 A;  3ICE A;  1S3O A;  1IYJ B;  2N49 A;  4HJ9 A;  2AKW B;  1X9N A;  4OX9 Q;  1EIF A;  1K8G A;  4KLK A;  2VW9 A;  2MFI A;  4X65 L;  4IFD I;  1MIU A;  1RL2 A;  4R4O A;  3J81 c;  3H15 A;  1P8L A;  2VQE L;  4DV1 L;  1N36 L;  1SRO A;  5IYC H;  3RZO H;  1YJN A;  1HJP A;  4C3I H;  4HJ7 A;  3PV0 A;  2ID0 A;  5LMN W;  3H3V H;  5IP9 H;  2VQF Q;  5BR8 Q;  4DV3 Q;  4X64 Q;  4IPC A;  3M4O H;  4DR4 Q;  2PQA A;  2N8N A;  2WAQ E;  4GNX A;  3W1G A;  5LMU L;  4KHZ A;  3GTO H;  3HKZ E;  1BBW A;  4YCU A;  3CCE A;  2CCZ A;  1J5E L;  4NXN Q;  3M85 A;  4DR3 Q;  3K7A H;  4BY7 G;  4LUZ A;  2JEA I;  4EQ5 A;  1HR0 L;  3CP0 A;  3BU2 A;  2C35 B;  1YJW A;  4A93 H;  1Q7Y C;  3BZC A;  3ERS X;  1L2F A;  1VQF A;  4DV2 Q;  4A3G G;  3PGZ A;  4DR6 L;  3MEF A;  3L7Z C;  2KHI A;  1L1O C;  3A5Z B;  4LFB L;  4IOC A;  3LGJ A;  2OQK A;  4H02 A;  1KIX A;  1HNW L;  3KYH C;  1E3P A;  2ATW A;  3G6E A;  3BJU A;  4DR7 Q;  4GN3 B;  5M3M H;  3K0X A;  2FXQ A;  1SMX A;  4A3D H;  3WWV A;  4LF6 L;  4GS3 A;  1U5K A;  4HJA A;  4OWX B;  4R4Q A;  4UPA A;  3TS0 A;  2IX0 A;  5IP7 H;  3FHW A;  3S24 A;  4LF7 L;  1N32 Q;  5C0X J;  4GKK Q;  3S1N H;  3IRB A;  1Z9F A;  4DV7 L;  2IHE A;  1VQ8 A;  4A4I A;  4YCW A;  4YHH L;  4DUY L;  2PI2 A;  2JA5 H;  2E5L L;  3A74 A;  1KQS A;  2F4V L;  1BVS A;  4L5Q A;  1ASZ A;  4J15 A;  3M4P A;  4LFC L;  5IYB H;  4BY1 H;  1EUJ A;  2RHS B;  1JE5 A;  5LMN Q;  1GVP A;  4IO9 A;  2MO0 A;  1PH3 A;  2E2H H;  1XNQ Q;  3S14 H;  3PF4 A;  4IPD A;  2F52 A;  1HZ9 A;  3A5U A;  4JI6 L;  2LSS A;  1C9O A;  3W1B A;  4JI1 Q;  5H1S E;  2EQS A;  1E1O A;  1GD7 A;  1YHA A;  5M3F H;  1VQM A;  5K36 G;  4DUZ L;  2OTL A;  4POG A;  1N33 L;  3KF8 B;  3J7A 5;  2K52 A;  4BA1 I;  5JJL A;  3DLL A;  3E9H A;  3OYY A;  1SN8 A;  3F2C A;  2MNA A;  4LFA Q;  4A3K H;  3ER0 A;  1FGU A;  4NXM Q;  4DKA C;  5E7N A;  1VQ7 A;  3KFU A;  4A3M G;  3PO2 G;  3CCR A;  2ZJR A;  4JCV E;  2BH8 A;  3HOZ G;  1VQ5 A;  4JBJ A;  2DGY A;  3J7Z C;  4DV5 L;  4A3E G;  1I94 Q;  2UU9 L;  3PO3 H;  2BA1 A;  4YY3 Q;  1YHQ A;  5GAG C;  1S72 A;  4B3S L;  3PUZ A;  4BXX G;  1YIT A;  4LW1 A;  4PMW A;  4A3C H;  4B3R Q;  4A3B H;  1A8V A;  1WCM H;  5AJ3 L;  2PI2 E;  2UXD L;  2DUD A;  3I56 A;  2HIV A;  1HNZ L;  1Y1W H;  3ZJY C;  3TRZ A;  3D31 A;  3K8A A;  1VQL A;  1I3Q H;  2YTY A;  2CQO A;  4B3T Q;  2XTI A;  2Q2H A;  4JOI C;  3HOY H;  2KHJ A;  3PIO A;  2JK8 A;  4DV4 Q;  3RN5 A;  1X55 A;  1Y1V H;  1HR0 W;  1GKH A;  3AYH B;  1VQ9 A;  4HJ8 A;  1YHB A;  3HKZ G;  1P16 A;  2RF4 A;  4R4T A;  1TWH H;  2AMC B;  3GDE A;  1FL0 A;  3Q8D A;  1XPU A;  4BBS G;  4L5T A;  3CCL A;  4YWK A;  3ULL A;  5C4X H;  4B3M L;  1AH9 A;  4X66 L;  4LF9 Q;  4MNO A;  3K81 C;  1VQB A;  5IWA Q;  3HOV G;  1IL2 A;  1K0R A;  1AE2 A;  2NZO A;  2H5X A;  4AYB G;  4MTN A;  3JAM i;  1NY4 A;  2R6G A;  1IZ6 A;  2UUA Q;  2YV5 A;  2WFW A;  3KLW A;  4MZ9 A;  3RLF A;  2VQE Q;  4DV1 Q;  2I0Q A;  4RMF A;  1I50 H;  4JI3 Q;  2JA8 H;  2ZTE A;  5IE8 A;  3KOJ A;  1VQC A;  2AHO B;  2Q2T A;  2EXD A;  5JEA J;  3HOX G;  3GO5 A;  3H0G H;  1WOC A;  3T1H L;  2UUC Q;  4BBR G;  1NJI C;  1XMQ Q;  1HNX L;  2Q2U A;  3GTG H;  3GTM H;  1K3R A;  4LUV A;  4AQY L;  1VQP A;  1XNR L;  4K0K L;  2KCT A;  4LF8 Q;  3CCS A;  1LM0 A;  2BH2 A;  1W3S A;  1Q82 C;  2VUM G;  1RIP A;  1BBU A;  1HZB A;  5GAD C;  3ULJ A;  2WB1 G;  1IBK L;  4IFD J;  1X54 A;  4JYA L;  3NEN A;  5JJK A;  4JI8 L;  2E8G A;  2UUB Q;  4DR1 L;  2KCM A;  2VY3 A;  4YWM A;  3UDX A;  4P75 A;  2K75 A;  3CAM A;  1IBL L;  2I5L X;  3CPW A;  1T9H A;  1QZG A;  1EWI A;  1Q1E A;  3FKI H;  2WP8 J;  5FJ8 G;  4HID A;  2HHH L;  5ELN A;  4GLV B;  4APV A;  2ZJP A;  2NVY H;  2RHQ B;  2NZH A;  3HOW G;  3U58 A;  1Q1B A;  5C44 H;  1E22 A;  2ZTD A;  2E2J H;  4LF4 Q;  2R93 H;  4DNI A;  3J80 i;  3L2P A;  1U0L A;  3NBH B;  4A3J H;  4PZ8 A;  1TWF H;  4IPG A;  4GN5 A;  1S40 A;  4DV0 L;  2RCN A;  4GOP C;  3HOU G;  2V1C C;  2D0O A;  5FLM G;  3U4Z A;  1AE3 A;  4QY7 A;  4UP7 A;  3CC4 A;  1Q8K A;  2R7D A;  1K73 C;  1YJ9 A;  1TWA H;  1A0I A;  1J6Q A;  3GTJ H;  2ZJQ A;  4OWT B;  1PFS A;  4Y7N H;  1X3F A;  1JJ2 A;  3SGI A;  3CC7 A;  3I4M G;  2UXC Q;  3UDG A;  1KAW A;  4DR5 Q;  1NBW A;  3CMA A;  2VZA A;  1C7Y A;  4AYB E;  1Q12 A;  1KRS A;  4KHP L;  1TWC H;  2CKZ B;  1CSQ A;  1PA6 A;  4LNQ A;  1L1O A;  2CWA A;  3TRE A;  2ZM6 Q;  4A3F G;  3OTO L;  1VCI A;  3MXN B;  4XTC S;  2JJQ A;  5GQO A;  4C3H H;  3KJO A;  3F2D A;  2JA7 G;  3RLN A;  1X65 A;  3AFQ A;  2Q2I A;  1Z47 A;  4HJ5 A;  4DV6 Q;  2JA6 H;  3CQZ H;  1LUZ A;  2N3S A;  5C3E H;  4DR2 Q;  4JI2 L;  4OWW B;  2UU9 Q;  1Q46 A;  1K83 H;  1O7I A;  2HQL A;  1KC8 C;  1PH7 A;  1PH1 A;  3I4N H;  1XMO Q;  1HZC A;  4B3S Q;  2AWO A;  2WB1 E;  2ALY B;  1NMG A;  2I5M X;  1K8A C;  1EIY B;  1XPO A;  4R4C A;  3S15 H;  2VNU D;  3K80 C;  3E9I A;  1JMC A;  2ZTC A;  4XIG S;  3U4V A;  3I7F A;  2YTV A;  1QVC A;  5BR8 L;  3PSI A;  4X64 L;  2VQF L;  1X6O A;  4DV3 L;  1EQQ A;  4JI0 L;  3S2H H;  3KDF A;  1GO3 E;  3FP9 A;  3UDI A;  4DAY B;  1A62 A;  3KJP A;  1VQO A;  1PH5 A;  4UY8 C;  1D7Q A;  1VQG A;  2JEB I;  5IYD H;  4A3L G;  2B63 G;  4NXN L;  1L0W A;  3G48 A;  4DR3 L;  4LF5 Q;  4A3I G;  1CKN B;  3BZK A;  2R92 G;  2R7Z H;  1WI5 A;  4IPH A;  3M7N A;  4A75 A;  1W2B A;  1YI2 A;  4DV2 L;  1IBM Q;  1VQA A;  2E2I H;  2UXB Q;  4QIW E;  1L1O B;  1WJJ A;  2JE6 I;  2LXJ A;  1PHJ A;  2A19 A;  1YBY A;  2CFM A;  4PZ6 A;  4UP9 A;  4DR7 L;  1QVF A;  3S17 H;  1BKB A;  5IYC G;  2MQH A;  4GLA C;  3M4Q A;  4YWL A;  3EBE A;  4JI7 Q;  1UE7 A;  3CF5 A;  4X62 L;  4NB3 A;  4O2D A;  5DLQ E;  1N32 L;  1FJG Q;  2A8V A;  5IP9 G;  4GKK L;  4WJ4 A;  4GKJ Q;  4JI5 Q;  3CPF A;  4JBW A;  3GTP H;  4LWC A;  3L0O A;  3G4S A;  2B29 A;  4JI4 Q;  2Y0S E;  5LMN L;  1XNQ L;  5GAH C;  4BY7 H;  1SRU A;  2NVQ H;  3PIP A;  4Y52 H;  3I55 A;  5FLX c;  3KDF B;  3RZD H;  4A93 G;  3HKS A;  4JI1 L;  1TXY A;  1VQK A; 
#chains in the Genus database with same CATH topology
 2K5H A;  3T1Y Q;  4DR1 Q;  1D5Z C;  4FF1 A;  4PMC A;  3CHB D;  3NBI A;  2A5H A;  1Q81 C;  1G8Z D;  5M3M G;  1NSN S;  3TZD A;  3SE0 A;  3HP3 A;  1JB3 A;  5COY A;  1MJE A;  1SE8 A;  5KIX A;  2JA8 B;  5IP7 G;  1I50 B;  4YY3 L;  3J7A F;  1LYL A;  1QVG A;  1PYB A;  4G7H C;  1CHQ D;  4LMQ D;  4A76 A;  1X32 A;  4B3R L;  2WIN B;  3GTK H;  1CUK A;  1HR0 Q;  4DR6 Q;  2D2C C;  4RWS C;  5M3F G;  4B3T L;  2PMZ E;  3B6Y A;  2ES2 A;  3AB9 A;  4DR4 L;  1NAP A;  4KMU C;  1RTO A;  2K5W A;  3DM3 A;  2EOT A;  1BO0 A;  3UI2 A;  1F2Z A;  3FKI B;  3RR5 A;  1EWC A;  1EEF D;  3Q6S A;  4P71 A;  3HOZ H;  5IGD A;  3PO3 G;  1X3G A;  4IUQ A;  4DV7 Q;  4IOA A;  4O42 A;  1TWF B;  4A3C G;  3K0Y A;  4A3B G;  1RHP A;  1JB7 A;  2N78 A;  1QE6 A;  1CKN A;  1Y1W G;  1GUW A;  1D1K A;  1TWA B;  4HIM A;  2X69 A;  4JI0 Q;  1OTC A;  3GD7 A;  3KLS X;  5IIF A;  3PMF A;  1I4R A;  1SR3 A;  1G29 1;  1PDQ A;  3CCM A;  5KEE A;  2CVR A;  1PRT F;  4ZYS A;  3HKZ B;  1U4R A;  1PTO D;  2CWP A;  1EQR A;  2EJF C;  1U4P A;  4DV5 Q;  1UWV A;  3NHH A;  2JA6 B;  5EJW A;  3HOV H;  2JQO A;  4KN7 C;  1WFQ A;  2F0T A;  4FDB A;  3STB C;  5AJ3 Q;  4LF4 L;  4QCL A;  2K28 A;  4IJL A;  1FVI A;  3F1Z A;  1EOT A;  3H0G G;  1QZH A;  4BBR H;  2L55 A;  1N8R C;  5KRU A;  3S2H B;  1G2S A;  1NE3 A;  5HY6 A;  1ZYR C;  1EY0 A;  4HIO A;  2B2U A;  1CKM A;  1K9M C;  3R2T A;  1S5E D;  4F87 A;  2XVS A;  1WYD A;  2HD3 A;  3RD4 A;  5IT9 L;  1EY6 A;  4B3M Q;  1HH2 P;  2BE5 C;  2PQA B;  2UXC L;  3TEH B;  3KK7 A;  1EFW A;  3MA2 B;  1DGS A;  2N55 A;  2OEO A;  2QW7 A;  4DAP A;  3A56 A;  1PH2 A;  3W2D A;  2K1B A;  3S17 B;  5C4J H;  4QMG A;  3NQI A;  3FVQ A;  2GN5 A;  3ULP A;  4CJ0 B;  2ICE C;  2RDG A;  2Q8T A;  4A3J G;  3AFP A;  1SSO A;  3MFY A;  4IUT A;  1OXT A;  4AQY Q;  2JA9 A;  4P73 A;  3RLO A;  3CC2 A;  4JOI A;  3A7L A;  3AU7 A;  3J80 E;  1T5X D;  3STB D;  5C6A A;  1XYI A;  3LX0 A;  1KD1 C;  1SYB A;  1F2Y A;  2VS1 A;  3RZD B;  3I4M H;  1OXU A;  1FR3 A;  4A3G B;  3AEV A;  1A2T A;  4JBM A;  1D6E C;  2HHH Q;  1ZYR D;  3OIQ A;  4KKU A;  4POF A;  2QA4 A;  5CV9 A;  3TP7 A;  1SYE A;  2EY6 A;  2JA7 H;  2A74 C;  5IY0 A;  2BE5 D;  2UXB L;  5C3E G;  3D3R A;  5I9P A;  3QIA A;  1DOL A;  4UAI A;  3I4N G;  2F0H A;  1O78 A;  2KUM A;  2FHT A;  1YNN C;  5JEA G;  5IGF A;  4N8F A;  3FMC A;  3P75 A;  3GTQ B;  5ELD A;  2YU9 B;  3R93 A;  2MO1 A;  5IYD G;  2B63 H;  1CTM A;  5ELC A;  2RDH A;  4K6L A;  2R92 H;  2Z6K A;  1CM9 A;  4CDC C;  1STY A;  1CQF A;  4XYQ A;  1N34 L;  4FF4 A;  3ICE A;  1DCZ A;  1S3O A;  2N49 A;  1EIF A;  1WD0 A;  4KLK A;  1WVL A;  5FLX E;  4ZKC B;  1N36 L;  1SRO A;  2ICI A;  1HXY D;  2SNS A;  4KHV A;  3H3V H;  2EYP A;  4CJ2 C;  4EQN A;  4ZRZ A;  4DV3 Q;  3M4O H;  1ICF B;  2PQA A;  2IW3 A;  1PFM A;  4I7A A;  1BBW A;  1YNN D;  3M85 A;  2DY8 A;  3HGB A;  5KYI A;  1F2M A;  3KBX A;  1C4Q A;  3CP0 A;  1YJW A;  3ERS X;  3VYU A;  1PTO B;  5M5W B;  1H9S B;  3MEF A;  3VYT A;  1L1O C;  4OHJ A;  2D5D A;  2LY7 A;  3JAM L;  1KDC A;  1E3P A;  1RCV D;  2NN6 H;  4HMI A;  2F0G A;  3BJU A;  4GN3 B;  4A3D H;  4MHE A;  1U5K A;  5CBE E;  2RVL A;  3PIO 3;  2FJ2 A;  4O1N A;  1ZKO A;  4IQZ A;  4R4Q A;  4DXF A;  4UPA A;  1N32 Q;  2EVB A;  4ABN A;  5LHY 1;  2JA5 H;  4YCW A;  4YHH L;  3A74 A;  1KQS A;  2F0W A;  3DWQ A;  2EY1 A;  1SYC A;  1UAP A;  5NUC A;  1K28 A;  4LFC L;  5IYB H;  3S14 H;  1GVP A;  2MO0 A;  2E2H H;  2VUM B;  3PF4 A;  4IPD A;  2F52 A;  2K5D A;  2K04 A;  1O80 A;  3S16 B;  2QDL A;  2OTL A;  4POG A;  1N33 L;  2PNR C;  4FNF A;  5JJL A;  3DLL A;  5T1I A;  3VR4 A;  2G9D A;  2HCC A;  1EU4 A;  1FGU A;  4NXM Q;  2AQ1 B;  2ZXP A;  1Z7T A;  1ONL A;  4A3M G;  2IWH A;  2ZJR A;  2BH8 A;  3HOW B;  4RGM A;  4JBJ A;  2DGY A;  3J7Z C;  4A3E G;  4XT1 B;  3S1M B;  5GAG C;  1S72 A;  4B3S L;  3PUZ A;  1MHW C;  1YIT A;  1II3 A;  1WCM H;  2JSO A;  2PI2 E;  2Q8R E;  2UXD L;  5L37 A;  3HEJ A;  1O7Z A;  1HPC A;  3BDL A;  2EPB A;  4DF7 A;  2I07 B;  2XIW A;  2WII B;  2CQO A;  1GUG A;  1HR0 W;  2JK8 A;  4DV4 Q;  5FO8 B;  1GKH A;  4PNY A;  1YHB A;  3D4D A;  3BS1 A;  2KEE A;  4I65 A;  1XPU A;  4BBS G;  2F0M A;  5C4X H;  5C3W A;  1AH9 A;  4X66 L;  4LF9 Q;  4X3K A;  3K81 C;  2E75 C;  3QJY A;  5D65 A;  2EE1 A;  4AYB G;  2TMP A;  2YV5 A;  1IKL A;  2EYF A;  1R4Q B;  1KLU D;  1VQC A;  2EXD A;  3A54 A;  3GO5 A;  3T4A C;  3T1H L;  4LUV A;  1LV9 A;  3CCS A;  1LM0 A;  3HRZ C;  1Q82 C;  3OSO A;  1RIP A;  1BBU A;  3ULJ A;  4C1N K;  1UUP A;  4IFD J;  3NEN A;  2KCM A;  1CQV A;  3CAM A;  3TBI B;  1QZG A;  2O5I C;  5FK9 C;  1ILQ A;  1JOO A;  1KAB A;  5ELN A;  4GLV B;  2NVY H;  1SJH D;  1LTG D;  3U58 A;  3BVM A;  1E22 A;  3FEW X;  3QG1 A;  1LTR D;  3RZO B;  3DMU A;  4DNI A;  3J80 i;  3MZ5 A;  1CZG A;  5JVH 3;  1ZEQ X;  4DV0 L;  1SXT A;  1QB5 D;  4QB4 A;  5FLM G;  2L11 A;  3CC4 A;  1Q8K A;  5G3L D;  1YJ9 A;  3GTO B;  1BCP F;  1J6Q A;  2ZJQ A;  1PYW D;  1PFS A;  1X3F A;  2L5T A;  2MHV A;  3CC7 A;  2RDF A;  2G5D A;  3A8J E;  4IUU A;  4DR5 Q;  3UDG A;  3OIP A;  1SDF A;  1TWC H;  1AN8 A;  5CV5 A;  4NKL A;  2ZM6 Q;  3OTO L;  4DNT B;  4ZK9 B;  2JJQ A;  4C3H H;  1O7L A;  1Z47 A;  4DGZ A;  4DR2 Q;  4XXE A;  2UU9 Q;  1Q46 A;  1PH7 A;  4NP5 A;  3VYR A;  3DXJ C;  3J81 L;  3OWF A;  5FO9 B;  4ZQ3 A;  3K59 A;  1K8A C;  3QO2 A;  2VNU D;  1L0X B;  3E9I A;  3SK5 A;  4BY1 B;  1GJX A;  2Z8L A;  3I7F A;  2VQF L;  3FPP A;  3R3O A;  5BR8 L;  2B2U C;  1GO3 E;  4MIU A;  4DAY B;  1VQO A;  2WV6 D;  1AEX A;  1K3B C;  4LF5 Q;  1L0W A;  2NZ1 D;  4DR3 L;  1HTP A;  4A3I G;  4A75 A;  3H94 A;  4KJO A;  4A3K B;  1W2B A;  1F9R A;  1IBM Q;  3D4R A;  1AZP A;  3C1F A;  2E2I H;  1B50 A;  3DHQ A;  1L1O B;  1PZI D;  4TSS A;  1NR2 A;  1NNX A;  1PHJ A;  1HTL D;  1BUV T;  5DM7 3;  3CF5 A;  4X62 L;  4NB3 A;  5BN5 A;  2A8V A;  4GKK L;  4K2K A;  4WJ4 A;  4GKJ Q;  1S5D D;  1A15 A;  3VA7 A;  4LWC A;  4HMJ A;  2FFK B;  2B29 A;  1KNE A;  2ENB A;  1CI3 M;  4BY7 H;  2EYJ A;  3PIP A;  4Y52 H;  1C48 A;  3I55 A;  2Y0S B;  4A93 G;  1VQK A;  3NEL A;  2HIX A;  1SNC A;  5I4D A;  1QUQ A;  1PXU A;  3J7Y W;  4K8I A;  3KBG A;  5IGC A;  1JQY D;  4R4I A;  4Q5V A;  1UEB A;  1XX8 A;  1XWE A;  2AUK A;  3WOF A;  5M5X H;  2MP1 A;  4RGO S;  2EYH A;  4GLX A;  1D2B A;  2DNE A;  2JN4 A;  2Z0S A;  5JJZ A;  3GTM B;  1JT8 A;  2DJG C;  1J5E Q;  1JOR A;  2X6L A;  3MXG A;  2Z4H A;  2A1A A;  1CHP D;  2ZXR A;  3FDT A;  4LK1 C;  1LTA D;  4X6A H;  2Z6K C;  2F0J A;  3PF5 A;  1H9J A;  2XSC A;  1SFO H;  1LTL A;  1VQ4 A;  1M1K C;  2F0D A;  3MHB A;  4GN4 B;  3S1R H;  1YNJ C;  4X3T A;  4KJN A;  2NVX H;  4LF6 Q;  1KL9 A;  3PO2 H;  2PO4 A;  1QNU A;  5C44 B;  2E2J B;  2R93 B;  1R4P B;  4ALP A;  2Z4I A;  5HGQ A;  5IWA L;  4KI0 A;  2E5L Q;  2F4V Q;  1IHZ A;  1B7Y B;  4OON A;  2HT1 A;  2PNH A;  2OTJ A;  4JV5 L;  4JI3 L;  3BVZ A;  1YVC A;  4L8J A;  2DY7 A;  1EY8 A;  1PH4 A;  4JI6 Q;  1DXM A;  1CK1 A;  3HOY G;  4Y7N B;  1Y1V G;  4IN3 A;  4LF8 L;  3JC6 6;  2XWJ B;  4OL7 A;  2WAQ B;  3J80 c;  3GQB A;  2UUB L;  1LTI D;  2J7Z A;  3LWU A;  1PYS B;  2CH4 W;  3CQZ B;  1PH8 A;  3UE0 A;  5EGT A;  1K83 B;  2SOB A;  5C0X G;  1YNJ D;  2JA8 G;  1B8A A;  4XQJ A;  1HNZ Q;  4G7Z C;  1G6P A;  3HOX H;  4L5S A;  3JAM E;  3E5S A;  1HCZ A;  1LT6 D;  2KHS A;  4C3J G;  5C0X I;  2OCE A;  3BYY B;  3ND9 A;  2PCF B;  1BNZ A;  1MKH A;  1R9T H;  2R7Z B;  4ZUI A;  4GNX B;  1STA A;  1F77 A;  3DEO A;  3FRP B;  1V9P A;  1V1O A;  5EPK A;  3FKI G;  1VQ6 A;  2D0P A;  1I6H H;  3C46 A;  5DNF A;  2HCI A;  1B70 B;  3PUX A;  4DV6 L;  1LT4 D;  1KHI A;  1EEI D;  1EQV A;  1HNX Q;  5EAY A;  3NSW A;  1C0A A;  3A55 A;  1XNR Q;  1GUO A;  1VQD A;  5FOB B;  1SMY D;  1XMO L;  3HOU H;  2QF7 A;  1E24 A;  3GTP B;  1VMC A;  2K5V A;  2LFN A;  5KGU A;  1IBK Q;  4EQP A;  2A69 C;  3GV3 A;  3C2P A;  1A63 A;  4JI8 Q;  2NVQ B;  3NWS A;  1D8L A;  2K4K A;  1H9M A;  3D6C A;  3K7U C;  1GM5 A;  1C8C A;  2IT1 A;  4A3F H;  3RUZ A;  1DD2 A;  2JA6 G;  4JC0 A;  4HIK A;  1K8M A;  1TT2 A;  1NMF A;  2B39 A;  4FXD A;  2K14 A;  1BR9 A;  5GAE C;  1PTO C;  4DK6 C;  1LT3 D;  3GTK B;  2RSO A;  3T53 B;  3G7L A;  1SNM A;  4JI5 L;  1Y69 U;  2ZT9 C;  4A3L H;  4KHP Q;  2K50 A;  4JI4 L;  3L3O C;  4C3J H;  3QOJ A;  3WDN A;  3RNU A;  2A69 D;  1YZ6 A;  5DM6 3;  3C1E A;  1JJG A;  1Z6H A;  4KD3 A;  3T1Y L;  1X9N A;  3HOZ B;  2MFI A;  5IOC A;  1RL2 A;  4XQQ A;  3SXH A;  1E0B A;  1HJP A;  4C3I H;  4IZ8 A;  1W6K A;  4HJ7 A;  3PV0 A;  5IP9 H;  1BOS A;  1VF5 C;  1D5X C;  4X64 Q;  4IPC A;  4GNX A;  2EY2 A;  3W1G A;  3NPP A;  4YCU A;  2CCZ A;  4ZCK A;  1B9M A;  3KF8 A;  3K7A H;  5A2Q E;  3VA5 A;  1B9N A;  2JEA I;  5LL6 X;  2R3Z A;  1HR0 L;  1SYD A;  4EGV A;  1Q7Y C;  4DR6 L;  4A3G G;  1IYV A;  4L63 B;  3A5Z B;  1TII D;  1IW7 D;  3RMH A;  1KIX A;  2E74 C;  3KYH C;  4H44 C;  3HOV B;  5M3M H;  3LNN A;  5CGK A;  1SMX A;  1E2Z A;  4JVZ A;  3WWV A;  2A73 B;  4GS3 A;  3VYS A;  2K01 A;  2C9O A;  2IX0 A;  5IP7 H;  3FHW A;  1A2U A;  3HS0 C;  2F0K A;  3S1N H;  1WTH A;  4PV1 C;  4DV7 L;  2IHE A;  2Z9H A;  1GUS A;  1BVS A;  4BBR B;  3M4P A;  5LMN Q;  1JE5 A;  1XNQ Q;  5D3I B;  1S5B D;  1HZ9 A;  1Y8O B;  4HAE A;  2WB1 B;  5H1S E;  1GD7 A;  5M3F H;  5K36 G;  2PQE A;  4BA1 I;  3E9H A;  3OYY A;  3F2C A;  3E3X A;  5CMD A;  3MC0 B;  3E0J A;  5E7N A;  1VQ7 A;  1VQ5 A;  4DV5 L;  1I94 Q;  5C4J B;  3SK6 A;  3PO3 H;  2J4X A;  1YHQ A;  2IL8 A;  4BXX G;  1SYG A;  4LW1 A;  4A3C H;  2RQX A;  1A8V A;  2BDO A;  3BVG A;  5AJ3 L;  4A3B H;  5IGB A;  2HIV A;  1Y1W H;  3ZJY C;  3TRZ A;  3D31 A;  3K8A A;  1I3Q H;  2XTI A;  1FYC A;  2KHJ A;  2PW5 A;  3I4M B;  4HJ8 A;  1P16 A;  2Z6B A;  2AMC B;  3GDE A;  2OT2 A;  3CCL A;  4B3M L;  1JWS D;  1EY4 A;  3ULL A;  1RF2 D;  2JA7 B;  3NE5 B;  1VQB A;  1S4Z A;  1K0R A;  1EYC A;  4JPB W;  3TN2 A;  4MTN A;  3VR3 A;  3JAM i;  1IZ6 A;  2UUA Q;  3KLW A;  4KY7 A;  4RMF A;  1MGS A;  5EPL A;  3K58 A;  2ZTE A;  3KOJ A;  2AHO B;  2Q2T A;  3EA6 A;  3H0G H;  1MSG A;  2UUC Q;  2EYL A;  1XMQ Q;  4AQY L;  2VUM G;  1HZB A;  2B63 B;  3OOC A;  4RHS A;  1UNS A;  2E8G A;  4X3U A;  2R92 B;  2C5C A;  2VY3 A;  4YWM A;  3UDX A;  4P75 A;  3HG9 A;  2QEJ C;  1QCB D;  4K5X A;  4IUV A;  4FVM A;  1IBL L;  1T9H A;  1EFI D;  5FJ8 G;  2HHH L;  3H6M A;  2NZH A;  2PMZ B;  3HOW G;  1Q1B A;  3I4L A;  2ZTD A;  5HGT A;  4A3J H;  2K6A A;  1WTV A;  4GN5 A;  3H09 A;  5ELB A;  1XXG A;  2RCN A;  3M4O B;  3U4Z A;  4UP7 A;  2R7D A;  4RGN A;  4TRD A;  4XDX A;  5I2Y A;  2KA7 A;  3GTJ H;  1I6V C;  3OMC A;  1C7Y A;  4AYB E;  3WOE A;  1KRS A;  4HCS A;  1CSQ A;  4LNQ A;  3MVV A;  2CWA A;  3TRE A;  1VCI A;  1JOK A;  5GQO A;  1KAA A;  3OWE B;  3RLN A;  3AFQ A;  2IJ0 A;  4A3D B;  2N3S A;  5C3E H;  4JI2 L;  2RKS A;  2KEC A;  4OWW B;  1TS5 A;  4YIJ A;  1O7I A;  2HQL A;  5IGG A;  3PIP 3;  3I4N H;  1ZXT A;  4B3S Q;  2JA5 B;  2ALY B;  3X3N A;  5JEA H;  1NMG A;  1EIY B;  3EJI A;  1JMC A;  5C5L A;  1D5M C;  2ZTC A;  4HSP A;  3S14 B;  2FMC A;  2E2H B;  2YTV A;  4DV3 L;  1SNO A;  3KDF A;  3V2T A;  3KJP A;  1PH5 A;  1D7Q A;  2A68 C;  5IYD H;  1STB A;  4M1U B;  3G48 A;  4LJZ C;  1B3A A;  3OHX C;  5JVG 3;  1AZQ A;  1TKW B;  2B8F A;  1WI5 A;  4IPH A;  1BBX C;  1YI2 A;  3SDZ A;  1VQA A;  2JP1 A;  1WJJ A;  2JE6 I;  4Q0F A;  5EKK A;  2K5Q A;  2VB2 X;  2A19 A;  3ITP A;  4QIW B;  3SHL A;  4RH6 A;  1QVF A;  1BKB A;  5IYC G;  2MQH A;  3M4Q A;  3EBE A;  4JI7 Q;  1UE7 A;  1SNP A;  4G7O C;  1PRT B;  1WCM B;  1N32 L;  1FJG Q;  4QF4 A;  1RJT A;  2CH4 A;  5AFW A;  2F4I A;  2B2T A;  2NTS A;  3G4S A;  2Y0S E;  5GAH C;  2NWG A;  3TSS A;  5EBD A;  3T13 A;  2XNA C;  5COR A;  4TVA B;  4OX9 Q;  3A0J A;  1N9W A;  2RSN A;  3FPU B;  4HN7 A;  2FIN B;  3QR8 A;  5C4X B;  4HSV A;  2A68 D;  4OXP A;  1STH A;  4X65 Q;  3OPO A;  3M3Y H;  1SLJ A;  2VL6 A;  4NXM L;  4ZAI A;  3VDY A;  3CME A;  1PVO A;  1ENA A;  4QL5 A;  2DNC A;  1V43 A;  4EX5 A;  4XQN A;  1E7Z A;  3BG3 A;  3F8T A;  4TQU S;  1UE6 A;  2CW0 C;  5LMU Q;  4CDD C;  1GXD C;  2F0E A;  4HCE A;  1QOH A;  1UE1 A;  1FNU A;  4IJH A;  4BY1 G;  4WOR A;  3J81 i;  3I2Z A;  4QJF A;  1CA5 A;  2IX1 A;  2X6G A;  2QEX A;  1PH6 A;  2M2L A;  1Y8P B;  3TQY A;  1GHK A;  1I5F A;  3OMG A;  1XJV A;  2F03 A;  4LFB Q;  4DV4 L;  1HNW Q;  1VQE A;  3JAM c;  3BDO A;  1QNK A;  4NPS A;  2F0P A;  2KEN A;  5ELO A;  3CW2 C;  1EU3 A;  4A3K G;  1PFN A;  1QUQ B;  2NVY B;  2OXP A;  4A3M H;  3J81 j;  4HTH A;  2EDG A;  1VMP A;  4A3E H;  4LF7 Q;  4LF9 L;  2K33 A;  3U50 C;  1XTD A;  4F7X A;  2B2W A;  4DUY Q;  4OIK A;  2MUY A;  5E4W C;  3TZU A;  2VXW A;  5CC4 A;  3E0E A;  1GUN A;  4GOP A;  1LAB A;  1RD9 D;  4GNX C;  1I4H A;  1I4X A;  3I4O A;  3F2B A;  4DUZ Q;  2EYO A;  4ULL A;  2CW0 D;  4DAM A;  4KK7 A;  2Y0S G;  3NWT A;  4BBS H;  1TWC B;  4JG2 A;  5CV7 A;  2F0S A;  3J7A V;  4K5W A;  1F2L A;  1SND A;  4C3H B;  3CRL C;  4ME5 A;  1TR5 A;  1U4M A;  4B9X A;  4HR7 B;  4OIJ A;  2F0I A;  4DPG A;  3EN2 A;  1EIH A;  3UE1 A;  1H9K A;  1KDB A;  2MGS A;  3DM1 A;  1EYA A;  2HUG A;  1WD1 A;  2HDL A;  5GRO A;  3EVQ A;  4X62 Q;  2K5N A;  2NVT H;  1J8I A;  3I72 A;  1VQN A;  1KLG D;  5BN4 A;  1V1Q A;  1ML0 D;  2ZXO A;  4DK3 C;  1CSP A;  1Y8N B;  3GTL H;  2KJX A;  4CKB A;  5CV4 A;  2QCP X;  5I6W A;  4DR5 L;  1M90 C;  4O0A A;  1FNW A;  1JJC B;  4XYO A;  2E2I B;  1G51 A;  1Q3L A;  3MTS A;  2DJF C;  1WTO A;  5IT9 E;  2ZM6 L;  5C44 G;  1BCP D;  4AIM A;  4N9T A;  5EBC A;  4IUR A;  2R93 G;  1EZ8 A;  2AQ3 B;  3I8Z A;  1X3P A;  3CCJ A;  4DR2 L;  2HQE A;  3S1Q H;  3A8I E;  4FP5 D;  1NR4 A;  4K0K Q;  5FLM H;  3R2I A;  4DAV A;  4L5R C;  5DAU A;  3T51 B;  1YNX A;  2OF1 A;  1VF7 A;  3BDC A;  4CGY B;  4JYA Q;  3M7G A;  1PH9 A;  4BY7 B;  1F9P A;  1G6Z A;  4RG1 A;  3CKI B;  3N6R A;  3G71 A;  1PV4 A;  4R9W A;  5M9O A;  4LFA L;  2WAQ G;  4LF5 L;  2F0F A;  3CCU A;  4H7B A;  1O7Y A;  3ERQ A;  5JJI A;  1X3E A;  1QG7 A;  1IBM L;  4C56 C;  1S5C D;  5M5X B;  1Y14 B;  3S2D H;  4ME3 A;  3UDF A;  4OO1 G;  1L0Y B;  4C2M H;  4IAL A;  2LXK A;  1DOK A;  1HFN A;  4CKE A;  4OEL B;  2O5J C;  4LUO A;  2KOL A;  2BDN A;  4CBV A;  4GKJ L;  2F0L A;  2PZT A;  4WJ3 M;  4IFD G;  1E1T A;  2L4N A;  3V05 A;  5M5Y H;  4OO1 I;  4YCV A;  4A3I H;  1SFO B;  2R7Z G;  1TWG H;  5FLX L;  1U4L A;  3I3C A;  1TU2 B;  3S1R B;  1ICW A;  4BA2 I;  3CD6 A;  4WRD A;  2NVX B;  1IYJ B;  3PO2 B;  3P7J A;  1K8G A;  2VW9 A;  4FXK C;  4IFD I;  1MIU A;  1TS3 A;  3J81 c;  2VQE L;  2NYZ D;  1P8L A;  3H15 A;  4DV1 L;  4KKT A;  1PLF A;  4MTK A;  3MAQ A;  3S9W A;  3DWA A;  4B08 A;  2DN8 A;  4K8J A;  4KHZ A;  3HKZ E;  1I4P A;  1SNQ A;  3CCE A;  3NQT A;  1J5E L;  2KED A;  4NXN Q;  4EQ5 A;  3IAY A;  4DNR B;  3U9O A;  3BU2 A;  4A93 H;  1NCV A;  4DV2 Q;  1VQF A;  3PGZ A;  5CR3 A;  2F1M A;  3L7Z C;  2KHI A;  2PYK A;  1FGB D;  3LGJ A;  4IOC A;  2OQK A;  1SMY C;  1CA6 A;  2RA4 A;  1Q8I A;  2ATW A;  4DR7 Q;  2FXQ A;  1K8O A;  4LF6 L;  4UHV A;  4OWX B;  2FMM A;  4NMZ A;  4I7Z C;  2F3W A;  3IRB A;  1AP0 A;  2EY5 A;  1VQ8 A;  2GA4 B;  4A4I A;  1JE4 A;  2PI2 A;  3NUC A;  2E5L L;  3HOX B;  2F4V L;  4CDE C;  4L5Q A;  4KTA A;  4CKC A;  4IO9 A;  4DN4 M;  3I90 A;  4TKO B;  4JI6 L;  4F88 A;  1ET9 A;  4JI1 Q;  1STN A;  1E1O A;  1YHA A;  2EQS A;  3IKJ A;  1VQM A;  3KF8 B;  2EJG C;  2K7V A;  1HA5 A;  1QWY A;  1R9T B;  2PZU A;  1SN8 A;  2MPM A;  4RCN A;  3ER0 A;  1XTC D;  2CQA A;  1I6H B;  1BCP B;  3QOL A;  3KFU A;  3C3L A;  3CCR A;  4JCV E;  3HOZ G;  2M00 A;  5F2D A;  3KLS A;  4YY3 Q;  5KNC A;  3EQL C;  3P20 A;  3LWE A;  1WTP A;  1M8A A;  3ERO A;  2PW7 A;  3ND8 A;  4B3R Q;  3HOU B;  4CHT B;  2DUD A;  3I56 A;  1HNZ L;  3D8G A;  1HUN A;  1ROD A;  2B2T C;  1DON A;  1IYU A;  4B3T Q;  2Q2H A;  3IL8 A;  3HOY H;  1KDA A;  4V19 0;  4EQO A;  3RN5 A;  4DR4 Q;  1X55 A;  1Y1V H;  3AYH B;  2EJM A;  3R8B A;  1EY7 A;  3HKZ G;  1EY9 A;  4R4T A;  1TWH H;  3D4W A;  1V8Q A;  3Q8D A;  4BS9 A;  4HED A;  3TP6 A;  4L5T A;  4A3F B;  4YWK A;  3H3V C;  1HQR D;  3MXP A;  3HOV G;  1AE2 A;  2WKC A;  1ET6 A;  1NY4 A;  4Z9C B;  2R6G A;  3K5M A;  5C0X H;  1LT5 D;  2WFW A;  3RLF A;  4MZ9 A;  2JA8 H;  1I50 H;  3G6J B;  1PTO F;  5IE8 A;  1WTQ A;  3K5N A;  1IW7 C;  5JEA J;  5K5P A;  2KCN A;  3SR1 A;  1WOC A;  4BBR G;  5C3X A;  1HNX L;  5CYU A;  1FNV A;  1K3R A;  1XNR L;  2KCT A;  3V96 A;  3MWY W;  5GAD C;  1BDO A;  2WB1 G;  1IBK L;  4RKB A;  3ONA B;  4NDX A;  4JI8 L;  4DR1 L;  1SE2 A;  4ZUJ A;  1RDP D;  4OEM B;  4C3J B;  2K75 A;  1Q90 A;  4IUP A;  1PZK D;  1HUM A;  1EWI A;  3FKI H;  2WP8 J;  4HID A;  2D9U A;  4APV A;  1UEA B;  2RHQ B;  3NTK A;  3NTI A;  4LF4 Q;  5E3F A;  4P2C B;  3L2P A;  2B2W C;  4C3I B;  1U0L A;  3NBH B;  5EKI A;  1TWF H;  1LTB D;  4GOP C;  4S3S A;  2D0O A;  2F0N A;  5J22 A;  5CV8 A;  1TWA H;  1A0I A;  3K7A B;  4OWT B;  3SGI A;  3I4M G;  2UXC Q;  2L1B A;  2VZA A;  4KHP L;  2F3V A;  2SEB D;  1TS2 A;  5ELE A;  1PA6 A;  3GV6 A;  3K57 A;  3MXN B;  1GUT A;  1PRT C;  5KND A;  5M3M B;  3U9S A;  2JA7 G;  2JA6 H;  2Q2I A;  4HJ5 A;  1VDZ A;  4R8I A;  3BZD B;  1KC8 C;  2E2D C;  1PH1 A;  3S1N B;  1HZC A;  3QB3 A;  1GHJ A;  2A6E C;  2IPK D;  3K6O A;  4R4C A;  1XPO A;  3S15 H;  4J8Q A;  4XIG S;  3U4V A;  2XRQ D;  4JI0 L;  4X64 L;  3S2H H;  1X6O A;  3J81 E;  1EQQ A;  3S15 B;  5EQ0 A;  1HHV A;  5M3F B;  4UY8 C;  4RGT A;  2B63 G;  1QJO A;  4JW0 A;  3VR6 A;  2R92 G;  5LL6 S;  2KQ3 A;  3CRK C;  2UXB Q;  4QIW E;  3PQI A;  1HFG A;  5BN3 A;  4RKL A;  2LXJ A;  2LKV A;  3PO3 B;  3VR5 A;  3S17 H;  1BQQ T;  3T16 A;  2K03 A;  1PRT D;  3OW7 A;  4A3B B;  4O2D A;  3I91 A;  4L6T B;  1WTX A;  1Y1W B;  3CPF A;  1SE3 A;  1I3Q B;  2LS0 1;  3L0O A;  4FYD A;  5LMN L;  1XNQ L;  3X3M A;  1SRU A;  2A6E D;  1EQT A;  2B2Y A;  5E1F A;  3KDF B;  4RA8 A;  3RZD H;  4DK0 A;  3Q22 A;  1N34 Q;  4A3G H;  1S5F D;  3H3V I;  3NTH A;  2NBF A;  1X56 A;  3NBH A;  3NXW A;  4P74 A;  5J39 A;  3CU7 A;  1YIJ A;  1AW7 A;  4DA2 A;  1IBL Q;  2NN6 G;  5CV6 A;  1N36 Q;  1ILP A;  4JBK A;  2J0T D;  4A3D G;  4IUN A;  4QQB X;  1BF4 A;  2GVA A;  1I94 L;  2MJ8 A;  3AQQ A;  5EPJ A;  1LTS D;  1DYQ A;  2JA5 G;  1ENC A;  2K32 A;  3H0G B;  3F2U A;  3K5L A;  3SEB A;  3SVM A;  1KXL A;  2NN6 I;  5IYB G;  1KRT A;  3GTQ H;  1B3Q A;  1JWU D;  2YU9 H;  4R1J A;  3ZYY X;  3Q23 A;  4KD4 A;  3MXN A;  5KYL A;  2TSS A;  5K36 H;  4E6I A;  3OW2 A;  1OXX K;  3DWP A;  1HQM C;  3I73 A;  2PPB C;  3PUY A;  1GOZ A;  4XT3 B;  1RTN A;  2R7F A;  3TS2 A;  3GP7 A;  1J9O A;  1UE5 A;  1YEZ A;  4ODG A;  2F0Q A;  2ASB A;  1VQH A;  2G9H D;  2KCC A;  3M9B A;  4WFN 3;  2O4X A;  2KBN A;  4FF3 A;  1EL0 A;  1TVX A;  2E76 C;  3PUW A;  4PZ7 A;  2R61 A;  5KNB A;  1TY2 A;  4JI2 Q;  4YHH Q;  4A3J B;  4BXX H;  2UUA L;  5I2X A;  1SE4 A;  4LFC Q;  1WCM G;  5IT9 c;  1A3U A;  4K6D A;  1VS0 A;  4AH6 A;  3GTJ B;  2NTT A;  2UUC L;  1N33 Q;  1XMQ L;  2EIF A;  2IX3 A;  1LO5 D;  5JAV A;  1MI2 A;  4PMB A;  3CCQ A;  1PTO H;  5M5W H;  2F3I A;  1B2T A;  3NEM A;  5C4X G;  3EIV A;  4K5V A;  1WTR A;  1JOQ A;  1WTW A;  5C3E B;  3KF6 B;  1MBY A;  4EVO A;  2NB0 A;  3I4N B;  2UXD Q;  2BCO A;  4UDU C;  5CBA E;  1AFP A;  3D6W A;  3IFD A;  2IY5 B;  2EXZ A;  1BXT A;  5I9O A;  1HZA A;  2N88 A;  3QWN A;  3W5O A;  1CKO A;  3W3A A;  3NK9 A;  1XPR A;  2NUC A;  1IL8 A;  4GOP B;  2K05 A;  2VUM H;  1B44 D;  3CXC A;  1EZ6 A;  2EZV A;  2RBM A;  3S16 H;  4K2L A;  1CT1 D;  4ZKB B;  1VQJ A;  2H1E A;  4X66 Q;  2YYZ A;  4RHR A;  4QGU A;  5FJ8 H;  2B2V A;  2B3G A;  1LTT D;  3PUV A;  2JXM B;  3HOW H;  4OGQ C;  3S1M H;  1ASY A;  2CHB D;  3HFZ B;  4N9P A;  4LAA A;  1EIG A;  3T1H Q;  3URY A;  1U9R A;  1FD7 D;  3K5O A;  4FO2 A;  1CZW A;  3M4Y A;  5E4X A;  2YTX A;  3D0F A;  1EY5 A;  1IXR A;  4ID6 A;  2D62 A;  1NTG A;  4BWG B;  1TY0 A;  1OXS C;  3CCV A;  2OQ0 A;  3T56 B;  2VB3 X;  5G3L F;  3M3Y B;  4C3H G;  1Q86 C;  1H95 A;  2L15 A;  4F8M A;  1MJC A;  4ZLT F;  5C4H A;  4DV0 Q;  4PG3 A;  2XGT A;  1DZ1 A;  2AUJ D;  4X3S A;  1VQI A;  1EOV A;  2BA0 A;  5J3B A;  3TME A;  3RN2 A;  4JI7 L;  2OWO A;  4MN3 A;  4KY6 A;  3TP8 A;  1B53 A;  3O13 A;  1FJG L;  2IHF A;  5T1G A;  4KKS A;  2I5H A;  1OXV A;  2WKD A;  3PCO B;  1DJR D;  1H9S A;  2GVB A;  2AWN A;  2H4O A;  2QGQ A;  3KF6 A;  4M8A A;  3OTO Q;  1PMR A;  4C1N I;  4P72 A;  2QIL A;  1SBB B;  5FO7 B;  1EYG A;  4OX9 L;  4UP8 A;  3TP5 A;  5C5M A;  4HJ9 A;  4A3M B;  2AKW B;  4DU9 A;  2I46 A;  4DXG A;  3NP8 A;  4A3E B;  4X65 L;  4R4O A;  5IYC H;  3RZO H;  1YJN A;  5DEH A;  2ID0 A;  5TSS A;  5LMN W;  1CFM A;  5A2Q L;  3IFT A;  2PZW A;  2VQF Q;  5BR8 Q;  4KN4 C;  2P5Z X;  2N8N A;  2WAQ E;  1KNA A;  4FXG C;  5LMU L;  3GTO H;  1EYD A;  1V1P B;  1BCP C;  4DR3 Q;  1TS4 A;  4BY7 G;  4LUZ A;  3VR2 A;  2C35 B;  5ELF A;  3BZC A;  1B1Z A;  1L2F A;  5IOD A;  4BBS B;  5JPM C;  4LFB L;  4H02 A;  1HNW L;  1JIC A;  3MEH A;  1SYF A;  2XN9 C;  4N8X 1;  3G6E A;  3K0X A;  1W6J A;  4AYB B;  5ISR A;  4HJA A;  4J6H A;  4V0B A;  4U68 A;  3TS0 A;  3S24 A;  4LF7 L;  5C0X J;  4GKK Q;  1Z9F A;  4DUY L;  4K14 A;  2NVT B;  1DOM A;  1ASZ A;  4J15 A;  2Z1C A;  4BY1 H;  1EUJ A;  2RHS B;  1PH3 A;  3A5U A;  2LSS A;  1C9O A;  3W1B A;  3SK4 A;  4DUZ L;  2AQ2 B;  3J7A 5;  3GTL B;  2K52 A;  3L9A X;  3N52 A;  3E6Z X;  1SEB D;  1ESR A;  3MFG A;  4NW2 A;  3KLR A;  2MNA A;  5JOB A;  1EWH A;  4LFA Q;  4A3K H;  1A3T A;  1F9S A;  2RCF A;  2LMC B;  3J80 L;  4DKA C;  1QIL A;  4WJW A;  3PO2 G;  4QUC A;  2UU9 L;  2BA1 A;  2SDF A;  3S1Q B;  4PMW A;  1I4Q A;  2EYM A;  1LAC A;  1E2W A;  1KTK A;  1HRJ A;  4H0L C;  2F0V A;  3KUP A;  2Q8I B;  1VQL A;  2L9H A;  1G2T A;  2YTY A;  5JPN C;  4H13 C;  2L12 A;  1SAP A;  4JOI C;  3PIO A;  2B2Y C;  1VQ9 A;  2A6H C;  2RF4 A;  4KV6 A;  1FL0 A;  5A35 A;  1RKN A;  1SJE D;  2L0C A;  5HUR A;  4MNO A;  2SNM A;  5IWA Q;  1IL2 A;  3HZX A;  2NZO A;  2H5X A;  4RCO A;  3TDQ A;  3S2D B;  4DFA A;  4GZY C;  2VQE Q;  4C2M B;  4DV1 Q;  1V1P A;  2I0Q A;  4JI3 Q;  2JYO A;  4R8N A;  4JV5 Q;  1K0S A;  5IGE A;  4RAU C;  5FKA C;  3HOX G;  5D3D A;  1NJI C;  2HDM A;  2Q2U A;  3GTG H;  3GTM H;  4CJ1 B;  1VQP A;  4K0K L;  4LF8 Q;  1H9R A;  2BH2 A;  1W3S A;  1STG A;  3GTG B;  2QKI C;  3DUZ A;  1X54 A;  4JYA L;  5M5Y B;  1MD2 D;  5JJK A;  4A3I B;  2UUB Q;  1E2V A;  1TWG B;  1A6X A;  3DEP A;  2I5L X;  4PQX A;  3BYT B;  3CPW A;  2A6H D;  1Q1E A;  2M9V A;  2F0U A;  1DM0 B;  1MSH A;  1HA6 A;  4J1M A;  2ZJP A;  1STE A;  2QDB A;  4JK1 C;  5C44 H;  3A8K E;  2E2J H;  1LLR D;  2R93 H;  1JCK B;  4G57 A;  5EKL A;  1PFB A;  4PZ8 A;  1S40 A;  4IPG A;  5J1Z A;  3Q0A A;  4CDF C;  3HOU G;  2V1C C;  4G4K A;  1D1I A;  1AE3 A;  4QY7 A;  1A3V A;  1K73 C;  1I4G A;  4DAY A;  1JWM D;  2V4D A;  3AMU A;  4B9W A;  4Y7N H;  3H91 A;  1ENF A;  1JJ2 A;  4A93 B;  1KAW A;  1NBW A;  3CMA A;  1B4O A;  1Q12 A;  1G91 A;  2CKZ B;  1L1O A;  4A3F G;  4QUF A;  4XTC S;  3KJO A;  3A7A B;  3F2D A;  2XRS D;  1X65 A;  4DV6 Q;  2O2L D;  3CQZ H;  1LUZ A;  3I70 A;  1K83 H;  4OO1 H;  1XMO Q;  2AWO A;  2WB1 E;  2KVM A;  2I5M X;  3K80 C;  4RFB A;  5I6Y A;  4KY5 A;  4U67 3;  3Q24 A;  1PZJ D;  3SK8 A;  1QVC A;  1IKM A;  3PSI A;  3FP9 A;  3UDI A;  4IFD H;  1A62 A;  3EFX D;  1VQG A;  2JEB I;  4A3L G;  1JC7 A;  4NXN L;  1CKN B;  3BZK A;  1NUC A;  2R7Z H;  3M7N A;  3P1H A;  4DV2 L;  2BOS A;  2B2V C;  1T5E A;  1ESF A;  1YBY A;  2CFM A;  4PZ6 A;  1OO9 B;  4UP9 A;  4DR7 L;  4GLA C;  2WAC A;  4YWL A;  4C3I G;  2B8G A;  4FF2 A;  5DLQ E;  1TQO A;  5IP9 G;  1JR0 D;  4JI5 Q;  1F9Q A;  5C4Z A;  4DK1 A;  3MXU A;  4JBW A;  2F0O A;  3GTP H;  2XWB B;  5D14 A;  1M4V A;  3HOY B;  4JI4 Q;  1Y1V B;  2NVQ H;  1X3Q A;  4ILW A;  5FLX c;  1TWH B;  3HKS A;  4JI1 L;  1TXY A; 
#chains in the Genus database with same CATH homology
 2K5H A;  1N34 Q;  3NEL A;  2HIX A;  4TVA B;  3A0J A;  3T1Y Q;  3H3V I;  1N9W A;  4DR1 Q;  4A3G H;  1QUQ A;  4P74 A;  1X56 A;  1YIJ A;  4OXP A;  4X65 Q;  1IBL Q;  2NN6 G;  3M3Y H;  1Q81 C;  1N36 Q;  1SLJ A;  5M3M G;  2VL6 A;  4R4I A;  4JBK A;  4NXM L;  4A3D G;  3VDY A;  4QQB X;  1UEB A;  3CME A;  5M5X H;  1PVO A;  4QL5 A;  1MJE A;  1SE8 A;  2GVA A;  5IP7 G;  1I94 L;  1V43 A;  4YY3 L;  3GTK H;  1LYL A;  1QVG A;  1PYB A;  3AQQ A;  1E7Z A;  4EX5 A;  4GLX A;  2JA5 G;  3F8T A;  4TQU S;  1UE6 A;  5LMU Q;  2Z0S A;  4A76 A;  4B3R L;  1JT8 A;  1UE1 A;  2NN6 I;  5IYB G;  4IJH A;  4BY1 G;  1KRT A;  3J81 i;  3I2Z A;  4QJF A;  1J5E Q;  1CUK A;  2IX1 A;  3GTQ H;  2QEX A;  1PH6 A;  4R1J A;  1HR0 Q;  2YU9 H;  3TQY A;  2A1A A;  4DR6 Q;  1I5F A;  5M3F G;  4B3T L;  1XJV A;  2PMZ E;  3B6Y A;  2ES2 A;  4LFB Q;  4DV4 L;  4DR4 L;  4X6A H;  2Z6K C;  3OW2 A;  1VQE A;  3JAM c;  1HNW Q;  3DM3 A;  1OXX K;  3PF5 A;  1SFO H;  4NPS A;  1LTL A;  3PUY A;  2KEN A;  1VQ4 A;  5ELO A;  1M1K C;  3CW2 C;  4GN4 B;  4A3K G;  2R7F A;  3S1R H;  3TS2 A;  3RR5 A;  1UE5 A;  4LF6 Q;  2NVX H;  1QUQ B;  1KL9 A;  1YEZ A;  4A3M H;  3PO2 H;  3J81 j;  4P71 A;  2ASB A;  1VQH A;  3M9B A;  3HOZ H;  4A3E H;  4LF7 Q;  4LF9 L;  3PO3 G;  2KBN A;  1X3G A;  3U50 C;  4ALP A;  5HGQ A;  5IWA L;  3PUW A;  4PZ7 A;  4DV7 Q;  4IOA A;  1XTD A;  4KI0 A;  4JI2 Q;  4YHH Q;  4DUY Q;  2E5L Q;  2F4V Q;  4BXX H;  1B7Y B;  4OON A;  2UUA L;  4A3C G;  2HT1 A;  2PNH A;  2OTJ A;  4LFC Q;  1JB7 A;  4A3B G;  1WCM G;  4JV5 L;  3E0E A;  4JI3 L;  1YVC A;  4JV5 Q;  5IT9 c;  4GOP A;  2N78 A;  1CKN A;  4GNX C;  1Y1W G;  1PH4 A;  4JI6 Q;  1VS0 A;  4HIM A;  4AH6 A;  3I4O A;  4DUZ Q;  3F2B A;  2UUC L;  1N33 Q;  1XMQ L;  3HOY G;  4JI0 Q;  2EIF A;  3GD7 A;  1OTC A;  1Y1V G;  4LF8 L;  3JC6 6;  4DAM A;  1SR3 A;  1G29 1;  2Y0S G;  3CCQ A;  5M5W H;  4JG2 A;  3J80 c;  3CCM A;  4BBS H;  2F3I A;  2UUB L;  3NEM A;  2CWP A;  1EQR A;  5C4X G;  3EIV A;  4DV5 Q;  1UWV A;  1PYS B;  3HOV H;  1PH8 A;  2JQO A;  3KF6 B;  3UE0 A;  4DPG A;  1WFQ A;  3EN2 A;  3UE1 A;  5C0X G;  4FDB A;  3STB C;  2UXD Q;  5AJ3 Q;  4LF4 L;  2JA8 G;  1B8A A;  4IJL A;  1FVI A;  1HNZ Q;  3F1Z A;  2IY5 B;  5GRO A;  1G6P A;  4X62 Q;  3HOX H;  4L5S A;  1HZA A;  3W5O A;  1CKO A;  3H0G G;  1QZH A;  2K5N A;  2NVT H;  4BBR H;  1N8R C;  1XPR A;  4GOP B;  1NE3 A;  5HY6 A;  2VUM H;  1VQN A;  4HIO A;  1CKM A;  1V1Q A;  3CXC A;  1K9M C;  5C0X I;  3S16 H;  4DK3 C;  1CSP A;  1WYD A;  2OCE A;  3GTL H;  1MKH A;  1R9T H;  4B3M Q;  1HH2 P;  2PQA B;  4GNX B;  2UXC L;  1VQJ A;  4X66 Q;  4DR5 L;  3TEH B;  1M90 C;  4O0A A;  2YYZ A;  1EFW A;  1JJC B;  1DGS A;  1V9P A;  4QGU A;  3FKI G;  5FJ8 H;  1VQ6 A;  2B3G A;  3PUV A;  2D0P A;  1I6H H;  1G51 A;  1PH2 A;  2ZM6 L;  3HOW H;  1B70 B;  5C44 G;  4AIM A;  5C4J H;  3PUX A;  3S1M H;  2R93 G;  2GN5 A;  4DV6 L;  3ULP A;  1ASY A;  1KHI A;  3CCJ A;  3AFP A;  3HFZ B;  4DR2 L;  4A3J G;  3S1Q H;  3T1H Q;  1HNX Q;  5EAY A;  1C0A A;  1OXT A;  4AQY Q;  1VQD A;  2JA9 A;  4P73 A;  3RLO A;  1XMO L;  5FLM H;  4JOI A;  3CC2 A;  1XNR Q;  3HOU H;  4K0K Q;  1E24 A;  4L5R C;  2K5V A;  2YTX A;  3STB D;  3D0F A;  1IBK Q;  1YNX A;  1IXR A;  4JYA Q;  2D62 A;  1A63 A;  1KD1 C;  4JI8 Q;  1PH9 A;  1NTG A;  2VS1 A;  3I4M H;  1OXU A;  4RG1 A;  1D8L A;  1OXS C;  3G71 A;  1PV4 A;  2K4K A;  3AEV A;  3CCV A;  4LFA L;  4JBM A;  2OQ0 A;  2WAQ G;  3K7U C;  1GM5 A;  2HHH Q;  4LF5 L;  2QA4 A;  2IT1 A;  4POF A;  4A3F H;  3CCU A;  5JJI A;  1X3E A;  1Q86 C;  2JA7 H;  1IBM L;  2JA6 G;  4JC0 A;  1H95 A;  5IY0 A;  2L15 A;  4HIK A;  2UXB L;  1Y14 B;  5C3E G;  3S2D H;  4ME3 A;  1MJC A;  1NMF A;  3UDF A;  4DV0 Q;  4PG3 A;  3I4N G;  2XGT A;  4C2M H;  4OO1 G;  2K14 A;  2LXK A;  5JEA G;  1KXL A;  1VQI A;  1EOV A;  2BA0 A;  5J3B A;  3RN2 A;  4JI7 L;  5GAE C;  4DK6 C;  2OWO A;  4LUO A;  1FJG L;  2IHF A;  4GKJ L;  4JI5 L;  2I5H A;  4WJ3 M;  2MO1 A;  1OXV A;  1E1T A;  4IFD G;  3PCO B;  5IYD G;  4A3L H;  2B63 H;  4KHP Q;  2GVB A;  2K50 A;  5M5Y H;  4JI4 L;  2AWN A;  4YCV A;  2QGQ A;  4OO1 I;  4A3I H;  3KF6 A;  2R92 H;  2Z6K A;  1TWG H;  3OTO Q;  2R7Z G;  4C3J H;  4P72 A;  3RNU A;  1YZ6 A;  1EYG A;  4OX9 L;  1N34 L;  1JJG A;  4UP8 A;  3T1Y L;  4BA2 I;  3CD6 A;  3ICE A;  1S3O A;  1IYJ B;  2N49 A;  4HJ9 A;  2AKW B;  1X9N A;  4OX9 Q;  1EIF A;  1K8G A;  4KLK A;  2VW9 A;  2MFI A;  4X65 L;  4IFD I;  1MIU A;  1RL2 A;  4R4O A;  3J81 c;  3H15 A;  1P8L A;  2VQE L;  4DV1 L;  1N36 L;  1SRO A;  5IYC H;  3RZO H;  1YJN A;  1HJP A;  4C3I H;  4HJ7 A;  3PV0 A;  2ID0 A;  5LMN W;  3H3V H;  5IP9 H;  2VQF Q;  5BR8 Q;  4DV3 Q;  4X64 Q;  4IPC A;  3M4O H;  4DR4 Q;  2PQA A;  2N8N A;  2WAQ E;  4GNX A;  3W1G A;  5LMU L;  4KHZ A;  3GTO H;  3HKZ E;  1BBW A;  4YCU A;  3CCE A;  2CCZ A;  1J5E L;  4NXN Q;  3M85 A;  4DR3 Q;  3K7A H;  4BY7 G;  4LUZ A;  2JEA I;  4EQ5 A;  1HR0 L;  3CP0 A;  3BU2 A;  2C35 B;  1YJW A;  4A93 H;  1Q7Y C;  3BZC A;  3ERS X;  1L2F A;  1VQF A;  4DV2 Q;  4A3G G;  3PGZ A;  4DR6 L;  3MEF A;  3L7Z C;  2KHI A;  1L1O C;  3A5Z B;  4LFB L;  4IOC A;  3LGJ A;  2OQK A;  4H02 A;  1KIX A;  1HNW L;  3KYH C;  1E3P A;  2ATW A;  3G6E A;  3BJU A;  4DR7 Q;  4GN3 B;  5M3M H;  3K0X A;  2FXQ A;  1SMX A;  4A3D H;  3WWV A;  4LF6 L;  4GS3 A;  1U5K A;  4HJA A;  4OWX B;  4R4Q A;  4UPA A;  3TS0 A;  2IX0 A;  5IP7 H;  3FHW A;  3S24 A;  4LF7 L;  1N32 Q;  5C0X J;  4GKK Q;  3S1N H;  3IRB A;  1Z9F A;  4DV7 L;  2IHE A;  1VQ8 A;  4A4I A;  4YCW A;  4YHH L;  4DUY L;  2PI2 A;  2JA5 H;  2E5L L;  3A74 A;  1KQS A;  2F4V L;  1BVS A;  4L5Q A;  1ASZ A;  4J15 A;  3M4P A;  4LFC L;  5IYB H;  4BY1 H;  1EUJ A;  2RHS B;  1JE5 A;  5LMN Q;  1GVP A;  4IO9 A;  2MO0 A;  1PH3 A;  2E2H H;  1XNQ Q;  3S14 H;  3PF4 A;  4IPD A;  2F52 A;  1HZ9 A;  3A5U A;  4JI6 L;  2LSS A;  1C9O A;  3W1B A;  4JI1 Q;  5H1S E;  2EQS A;  1E1O A;  1GD7 A;  1YHA A;  5M3F H;  1VQM A;  5K36 G;  4DUZ L;  2OTL A;  4POG A;  1N33 L;  3KF8 B;  3J7A 5;  2K52 A;  4BA1 I;  5JJL A;  3DLL A;  3E9H A;  3OYY A;  1SN8 A;  3F2C A;  2MNA A;  4LFA Q;  4A3K H;  3ER0 A;  1FGU A;  4NXM Q;  4DKA C;  5E7N A;  1VQ7 A;  3KFU A;  4A3M G;  3PO2 G;  3CCR A;  2ZJR A;  4JCV E;  2BH8 A;  3HOZ G;  1VQ5 A;  4JBJ A;  2DGY A;  3J7Z C;  4DV5 L;  4A3E G;  1I94 Q;  2UU9 L;  3PO3 H;  2BA1 A;  4YY3 Q;  1YHQ A;  5GAG C;  1S72 A;  4B3S L;  3PUZ A;  4BXX G;  1YIT A;  4LW1 A;  4PMW A;  4A3C H;  4B3R Q;  4A3B H;  1A8V A;  1WCM H;  5AJ3 L;  2PI2 E;  2UXD L;  2DUD A;  3I56 A;  2HIV A;  1HNZ L;  1Y1W H;  3ZJY C;  3TRZ A;  3D31 A;  3K8A A;  1VQL A;  1I3Q H;  2YTY A;  2CQO A;  4B3T Q;  2XTI A;  2Q2H A;  4JOI C;  3HOY H;  2KHJ A;  3PIO A;  2JK8 A;  4DV4 Q;  3RN5 A;  1X55 A;  1Y1V H;  1HR0 W;  1GKH A;  3AYH B;  1VQ9 A;  4HJ8 A;  1YHB A;  3HKZ G;  1P16 A;  2RF4 A;  4R4T A;  1TWH H;  2AMC B;  3GDE A;  1FL0 A;  3Q8D A;  1XPU A;  4BBS G;  4L5T A;  3CCL A;  4YWK A;  3ULL A;  5C4X H;  4B3M L;  1AH9 A;  4X66 L;  4LF9 Q;  4MNO A;  3K81 C;  1VQB A;  5IWA Q;  3HOV G;  1IL2 A;  1K0R A;  1AE2 A;  2NZO A;  2H5X A;  4AYB G;  4MTN A;  3JAM i;  1NY4 A;  2R6G A;  1IZ6 A;  2UUA Q;  2YV5 A;  2WFW A;  3KLW A;  4MZ9 A;  3RLF A;  2VQE Q;  4DV1 Q;  2I0Q A;  4RMF A;  1I50 H;  4JI3 Q;  2JA8 H;  2ZTE A;  5IE8 A;  3KOJ A;  1VQC A;  2AHO B;  2Q2T A;  2EXD A;  5JEA J;  3HOX G;  3GO5 A;  3H0G H;  1WOC A;  3T1H L;  2UUC Q;  4BBR G;  1NJI C;  1XMQ Q;  1HNX L;  2Q2U A;  3GTG H;  3GTM H;  1K3R A;  4LUV A;  4AQY L;  1VQP A;  1XNR L;  4K0K L;  2KCT A;  4LF8 Q;  3CCS A;  1LM0 A;  2BH2 A;  1W3S A;  1Q82 C;  2VUM G;  1RIP A;  1BBU A;  1HZB A;  5GAD C;  3ULJ A;  2WB1 G;  1IBK L;  4IFD J;  1X54 A;  4JYA L;  3NEN A;  5JJK A;  4JI8 L;  2E8G A;  2UUB Q;  4DR1 L;  2KCM A;  2VY3 A;  4YWM A;  3UDX A;  4P75 A;  2K75 A;  3CAM A;  1IBL L;  2I5L X;  3CPW A;  1T9H A;  1QZG A;  1EWI A;  1Q1E A;  3FKI H;  2WP8 J;  5FJ8 G;  4HID A;  2HHH L;  5ELN A;  4GLV B;  4APV A;  2ZJP A;  2NVY H;  2RHQ B;  2NZH A;  3HOW G;  3U58 A;  1Q1B A;  5C44 H;  1E22 A;  2ZTD A;  2E2J H;  4LF4 Q;  2R93 H;  4DNI A;  3J80 i;  3L2P A;  1U0L A;  3NBH B;  4A3J H;  4PZ8 A;  1TWF H;  4IPG A;  4GN5 A;  1S40 A;  4DV0 L;  2RCN A;  4GOP C;  3HOU G;  2V1C C;  2D0O A;  5FLM G;  3U4Z A;  1AE3 A;  4QY7 A;  4UP7 A;  3CC4 A;  1Q8K A;  2R7D A;  1K73 C;  1YJ9 A;  1TWA H;  1A0I A;  1J6Q A;  3GTJ H;  2ZJQ A;  4OWT B;  1PFS A;  4Y7N H;  1X3F A;  1JJ2 A;  3SGI A;  3CC7 A;  3I4M G;  2UXC Q;  3UDG A;  1KAW A;  4DR5 Q;  1NBW A;  3CMA A;  2VZA A;  1C7Y A;  4AYB E;  1Q12 A;  1KRS A;  4KHP L;  1TWC H;  2CKZ B;  1CSQ A;  1PA6 A;  4LNQ A;  1L1O A;  2CWA A;  3TRE A;  2ZM6 Q;  4A3F G;  3OTO L;  1VCI A;  3MXN B;  4XTC S;  2JJQ A;  5GQO A;  4C3H H;  3KJO A;  3F2D A;  2JA7 G;  3RLN A;  1X65 A;  3AFQ A;  2Q2I A;  1Z47 A;  4HJ5 A;  4DV6 Q;  2JA6 H;  3CQZ H;  1LUZ A;  2N3S A;  5C3E H;  4DR2 Q;  4JI2 L;  4OWW B;  2UU9 Q;  1Q46 A;  1K83 H;  1O7I A;  2HQL A;  1KC8 C;  1PH7 A;  1PH1 A;  3I4N H;  1XMO Q;  1HZC A;  4B3S Q;  2AWO A;  2WB1 E;  2ALY B;  1NMG A;  2I5M X;  1K8A C;  1EIY B;  1XPO A;  4R4C A;  3S15 H;  2VNU D;  3K80 C;  3E9I A;  1JMC A;  2ZTC A;  4XIG S;  3U4V A;  3I7F A;  2YTV A;  1QVC A;  5BR8 L;  3PSI A;  4X64 L;  2VQF L;  1X6O A;  4DV3 L;  1EQQ A;  4JI0 L;  3S2H H;  3KDF A;  1GO3 E;  3FP9 A;  3UDI A;  4DAY B;  1A62 A;  3KJP A;  1VQO A;  1PH5 A;  4UY8 C;  1D7Q A;  1VQG A;  2JEB I;  5IYD H;  4A3L G;  2B63 G;  4NXN L;  1L0W A;  3G48 A;  4DR3 L;  4LF5 Q;  4A3I G;  1CKN B;  3BZK A;  2R92 G;  2R7Z H;  1WI5 A;  4IPH A;  3M7N A;  4A75 A;  1W2B A;  1YI2 A;  4DV2 L;  1IBM Q;  1VQA A;  2E2I H;  2UXB Q;  4QIW E;  1L1O B;  1WJJ A;  2JE6 I;  2LXJ A;  1PHJ A;  2A19 A;  1YBY A;  2CFM A;  4PZ6 A;  4UP9 A;  4DR7 L;  1QVF A;  3S17 H;  1BKB A;  5IYC G;  2MQH A;  4GLA C;  3M4Q A;  4YWL A;  3EBE A;  4JI7 Q;  1UE7 A;  3CF5 A;  4X62 L;  4NB3 A;  4O2D A;  5DLQ E;  1N32 L;  1FJG Q;  2A8V A;  5IP9 G;  4GKK L;  4WJ4 A;  4GKJ Q;  4JI5 Q;  3CPF A;  4JBW A;  3GTP H;  4LWC A;  3L0O A;  3G4S A;  2B29 A;  4JI4 Q;  2Y0S E;  5LMN L;  1XNQ L;  5GAH C;  4BY7 H;  1SRU A;  2NVQ H;  3PIP A;  4Y52 H;  3I55 A;  5FLX c;  3KDF B;  3RZD H;  4A93 G;  3HKS A;  4JI1 L;  1TXY A;  1VQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...