1NMFA

Major cold-shock protein, nmr, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
67
structure length
67
Chain Sequence
b'MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR COLD-SHOCK PROTEIN
publication title Structure in solution of the major cold-shock protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
total genus 4
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1996-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1nmfA00
1FGUA 4BBSH 4A3MH 1B70B 3M4QA 1MKHA 1N9WA 1X56A 3VDYA 2E5LL 1CKMA 5C0XI 1PFSA 2MFIA 2V1CC 3UDFA 4GNXB 4LF7L 4GN3B 4JI8L 2ATWA 3AEVA 1Q46A 2NVQH 1E1OA 2IT1A 1M90C 1N32L 2D0PA 2HT1A 2WAQE 1S72A 5C4XG 1HR0W 1X55A 2ALYB 4OX9L 1O7IA 4DV7L 3M9BA 2CKZB 1LM0A 5JEAJ 1C9OA 5GAEC 2I0QA 2DUDA 3K7AH 4X6AH 5M3MH 3J7A5 1VQIA 1N33Q 4O0AA 5GADC 2VY3A 1YIJA 1KRTA 3E9IA 4Y52H 1G6PA 4Y7NH 1YEZA 1JJ2A 2JA7G 4A3JG 1E3PA 2QA4A 5BR8L 3PUYA 5LMNL 2VZAA 3CP0A 3G71A 3A74A 1CKOA 4J15A 4P72A 4IFDG 4UPAA 5C44G 1ASYA 1RIPA 2N3SA 3S1MH 4A3CH 1AE3A 1IBKQ 4HIKA 3H0GH 4GLVB 4JI1Q 4LF5L 1NY4A 4LUZA 2B63H 1A63A 2B3GA 3PIPA 3M85A 4DR1Q 1PH4A 3FKIG 1PA6A 4DNIA 3K0XA 5M5YH 2R7ZH 1IBMQ 4IFDI 4DK6C 1VQ4A 2OWOA 2Q2TA 5IYBG 1E22A 4YY3Q 4GKJL 3I4MG 3RLNA 1IXRA 4QY7A 3HOWG 5C3EH 1EQRA 2K4KA 4P74A 2OTLA 1WCMG 2C35B 4X66Q 4JG2A 4LW1A 1KXLA 4YHHQ 4HJ9A 5M3FH 4DUYL 3ULPA 3CCUA 3TRZA 3UDIA 2UUCQ 1GVPA 3M4OH 5FJ8H 1VQGA 3GTKH 1KC8C 2WB1E 2K14A 4GNXA 4AYBE 4DR4Q 1FL0A 1UE1A 2YTXA 3S24A 3RNUA 1TWAH 3T1HQ 5C4JH 4HIMA 2JQOA 1HR0L 1K83H 1CUKA 4LF6L 2PI2A 3TEHB 4DR5Q 1SN8A 1YVCA 4A3FH 2AKWB 1X3GA 2VQEQ 1GKHA 2UUBQ 4K0KL 4A3BG 3CD6A 3ERSX 2N78A 2JA6G 3PO2G 4DR7Q 3GTMH 1K73C 5JJIA 3PGZA 3UE0A 4DK3C 2B29A 3W5OA 3JAMi 3KJPA 3RZDH 2Z6KA 4PZ8A 5C0XJ 1OXXK 1HNXQ 5C4XH 4P73A 2OQKA 2YTYA 3A5ZB 4R4TA 3HOYG 1K3RA 2ZM6Q 4HJ5A 3LGJA 2FXQA 4DUZL 1VQAA 1EQQA 1N33L 3CMAA 2AWOA 4L5RC 2ES2A 2BH8A 4R1JA 1HNZQ 3ULJA 3CPFA 2KHIA 1XPRA 3I7FA 4BY1G 2D0OA 4PZ7A 4IJHA 1FVIA 5J3BA 4A3JH 1PYBA 2YYZA 2ZTDA 3JC66 2R6GA 3CW2C 3K7UC 2UXCQ 3AYHB 4YWKA 5FLMG 1IBKL 1FJGQ 1JJCB 5C44H 3S2DH 2UXDQ 2LXKA 2KHJA 4DR1L 4B3SQ 3RZOH 5EAYA 3F2CA 3ICEA 3FKIH 1IBML 2QGQA 3U4VA 3CCVA 1YJWA 1Z47A 1K8GA 4IJLA 2L15A 4YY3L 3A0JA 1PH9A 2YU9H 4BA2I 3RR5A 1VQKA 4IFDJ 4MNOA 3HOWH 4A76A 4X66L 1JJGA 4JBKA 4QJFA 1VQNA 1BVSA 1LYLA 1Q12A 2Y0SE 4YHHL 3KF6B 4APVA 1SR3A 2MO0A 2BA1A 4DR2L 4YWMA 1CKNA 1Q82C 2HHHQ 1NMFA 1S3OA 3F2DA 1VQMA 3KLWA 3J81j 3CF5A 2KCMA 1SROA 1U5KA 1OXUA 3L7ZC 1N34Q 1R9TH 3TREA 2CWAA 1HH2P 4POFA 3M7NA 4OONA 5LMUQ 4C3HH 1H95A 4JBWA 1XJVA 4GKKQ 3S15H 1VQHA 2UUAL 4A3EG 3GTQH 5IP7G 1KAWA 2VQEL 2UUBL 1I6HH 2R93G 1X9NA 3GDEA 1NBWA 2N49A 1VQ9A 4YCUA 3TS2A 2VNUD 3IRBA 4DR7L 1MIUA 4DV0L 1M1KC 3G6EA 2JA6H 3PO2H 1PH2A 1VCIA 2EQSA 3BU2A 4IPGA 5IWAQ 3CCQA 1W2BA 4LFBQ 1KQSA 1PYSB 1NMGA 2A19A 2CWPA 3ZJYC 3PF4A 4R4CA 2NVXH 2NVTH 3ULLA 4XIGS 3HOUG 1OXTA 2ZTEA 4RMFA 4LUOA 1HNXL 1MJCA 3S2HH 3KDFA 3SGIA 4HJ8A 3GTLH 2E8GA 2VL6A 4B3RL 3OYYA 1L2FA 3KJOA 2ZM6L 1EYGA 3PUXA 3CCRA 2JA5G 2H5XA 4LFAQ 1XNRQ 4DV3Q 3HOYH 3AFQA 1PV4A 2JE6I 4AQYQ 1UE6A 1WFQA 4A3IG 1Y1WG 1Q86C 4P75A 1C0AA 2AWNA 5IYDH 4OWXB 3RLOA 1BBWA 2BA0A 2HIVA 2RHQB 4PZ6A 1L1OB 4BY1H 4LF8Q 1RL2A 3BZKA 3CCJA 2PMZE 3NBHB 5K36G 5E7NA 2A8VA 3S14H 5M5XH 4BY7H 4PMWA 1FJGL 4B3MQ 4JCVE 2F4VQ 2WAQG 2UXDL 4JI0Q 1Z9FA 2K5NA 1MJEA 3KF6A 4B3SL 3DM3A 2WP8J 2RCNA 4JI6Q 1OXSC 4GS3A 4O2DA 2OTJA 3E9HA 2JJQA 4X64Q 2I5MX 1N36Q 3NEMA 3I2ZA 4HIOA 2QEXA 3UDGA 1L0WA 1UE5A 1GD7A 4YWLA 4A93H 2KBNA 1W3SA 4IO9A 1ASZA 1YBYA 2GVAA 1PH6A 4A3DG 5GQOA 4JBMA 3HOVG 3HOZH 1PH8A 3TS0A 4DAMA 2R92H 4JI2Q 4DV6L 4UP7A 1EIFA 1Q7YC 1TXYA 1NTGA 1XMOQ 1B7YB 2MQHA 2VW9A 4A3LG 5AJ3Q 2CQOA 3EN2A 1D8LA 4JV5Q 4WJ4A 4JI5Q 4GKKL 1YJNA 1XMQQ 3S1RH 4DR6Q 4LUVA 1SFOH 2RHSB 3AFPA 4NXNQ 1DGSA 4A75A 1IL2A 1HZ9A 4DPGA 2ASBA 4GOPB 1LUZA 5IP7H 4A3EH 4A3GG 4UP8A 4DR3Q 4JI7Q 3G48A 4GNXC 2YTVA 3J80c 1B8AA 5IWAL 1QVCA 3HKZG 3CC4A 4LFBL 4OXPA 2VS1A 5JEAG 1KHIA 1CSPA 1VS0A 3L0OA 4LWCA 4IOCA 2K52A 2XTIA 3BJUA 3S16H 4DV4Q 2WB1G 2ZJPA 3KYHC 4JYAQ 4JI4Q 3HOUH 1QUQB 4P71A 4A3MG 1TWFH 4DAYB 3M3YH 1XNRL 4DV3L 2IHFA 4TQUS 3CAMA 4FDBA 2NVYH 2ZTCA 3PO3G 3J81c 1PH1A 4QL5A 2GN5A 2MNAA 1X3FA 1SLJA 2NN6G 4IPHA 3U4ZA 1EWIA 1Y14B 4A3IH 2Z6KC 1KL9A 2JA7H 1HNWQ 5IP9G 1GO3E 2CFMA 3PUWA 3PUZA 3CCEA 4LF8L 1QVFA 1VQ5A 4TVAB 4L5TA 5DLQE 1PH7A 1IZ6A 3S1NH 3NENA 1VQEA 3EBEA 4JI1L 1EFWA 4B3ML 2F4VL 4X62Q 4JI0L 4BA1I 3CQZH 3H15A 2NN6I 3S17H 4AIMA 4JI6L 1WOCA 4LF6Q 1XTDA 1A0IA 3FHWA 2PQAB 3FP9A 3I56A 3RN2A 4DV2Q 2E2IH 4JBJA 3F1ZA 5BR8Q 5IYBH 2NZOA 1OTCA 4LFCQ 1VQBA 4X64L 3MXNB 5GROA 1VQ8A 2CCZA 1N36L 3E0EA 2VQFQ 1I3QH 2Q2UA 4GN4B 3I4MH 4LF9Q 4B3TQ 1WCMH 3GO5A 1QZHA 2UUCL 1NE3A 2F52A 3UDXA 2ZJQA 2JK8A 1K9MC 3BZCA 2I5HA 2IX1A 1X6OA 3GD7A 3PCOB 4JI2L 4A3DH 3HOVH 4DR4L 2UXBQ 1EUJA 1CSQA 4KLKA 1X65A 5IE8A 4JI3Q 1I50H 3ER0A 3T1HL 1J5EQ 1IYJB 4NB3A 5AJ3L 5HY6A 4QIWE 4C3JH 4DR5L 3Q8DA 5IYCG 3A5UA 3EIVA 1GM5A 2Q2HA 4DR6L 1WJJA 4NXNL 2PNHA 1T9HA 5M3FG 4DV1Q 4BBRG 1TWCH 4A3BH 4DR3L 4JI7L 1AH9A 2LXJA 4A3GH 3W1GA 2Y0SG 4H02A 2I5LX 4IPDA 3I55A 1YJ9A 3PIOA 2PI2E 3STBC 1JT8A 2F3IA 4DV4L 4JYAL 4KI0A 4JI4L 3MEFA 1IBLQ 2EXDA 4ALPA 4X65Q 3D0FA 4R4IA 3HOXG 1HNZL 4KHZA 4R4OA 4LF4Q 4K0KQ 3J80i 1E24A 5H1SE 1S40A 1VQLA 3PO3H 4UP9A 1VQOA 4GLAC 1HNWL 2PQAA 1LTLA 3GTOH 2K5VA 5HGQA 3I4NG 3CPWA 1V43A 4OWTB 2UXCL 4OWWB 2ZJRA 4DV5Q 5IP9H 1U0LA 2K50A 1PH5A 5FLMH 4NXMQ 1KIXA 4IPCA 2E2HH 1Q8KA 4X62L 1VQ6A 3B6YA 4A3KG 4DUZQ 1Y1VG 3J81i 2GVBA 3DLLA 3RLFA 3CC2A 4OO1G 1SE8A 2JA9A 4DV2L 1Q1EA 3NELA 1I94Q 4LFCL 1AE2A 4A4IA 2HIXA 1C7YA 1VQ7A 2LSSA 1D7QA 2VQFL 3U58A 2IY5B 4LF9L 2VUMG 1X3EA 2Z0SA 4B3TL 2D62A 4HJAA 1HZCA 1G51A 2HHHL 1KRSA 1HZAA 1V9PA 4OO1I 1EIYB 3OTOQ 4WJ3M 1N34L 3T1YQ 3CCMA 4R4QA 2R7FA 3WWVA 1XNQQ 1UEBA 4MTNA 4KHPQ 4PG3A 2UXBL 1YHQA 4JI3L 5LMUL 1J5EL 3CXCA 2JA8G 5GAGC 3OW2A 4LNQA 4EQ5A 4BXXG 2R7DA 2AMCB 2EIFA 4YCVA 1N8RC 3PUVA 1TWGH 2OCEA 3HFZB 1G291 1WI5A 5IYCH 2UU9Q 1VQFA 4DV1L 2JEBI 2R93H 3W1BA 1UE7A 1YHBA 3HKZE 4HIDA 1YHAA 2IHEA 2RF4A 4DR2Q 1PHJA 1J6QA 4BBRH 1KD1C 3H3VI 2KCTA 3HKSA 3U50C 3G4SA 2WFWA 5ELNA 1QVGA 4POGA 1L1OA 3F8TA 1SMXA 4AYBG 4BBSG 1TWHH 4L5QA 1VQPA 2IX0A 5ELOA 4EX5A 3PF5A 2AHOB 1IBLL 4JOIA 4LFAL 2JA5H 1XPUA 2UUAQ 4YCWA 4AH6A 4X65L 4GLXA 4UY8C 4AQYL 3GTGH 2E5LQ 4LF4L 4C2MH 1CKNB 3HOXH 1Y1WH 1I5FA 4DV0Q 4LF7Q 1P8LA 4NPSA 4RG1A 2DGYA 4JI8Q 2ID0A 1N32Q 1L1OC 3AQQA 3PV0A 1PVOA 1E1TA 4C3IH 5FLXc 2E2JH 4DV5L 4OX9Q 3KF8B 4DV7Q 3KOJA 3I4NH 5M3MG 4JOIC 4NXML 2MO1A 5GAHC 4B3RQ 2Q2IA 3J7ZC 1QZGA 3KFUA 3CMEA 1VQJA 1YITA 1K0RA 1HJPA 4A3KH 1HZBA 1A62A 1Y1VH 2JEAI 3CCLA 3GTJH 4IOAA 3K8AA 5IYDG 5LMNQ 1YI2A 3HOZG 1I94L 3S1QH 2HQLA 3GTPH 4A3CG 1VQDA 1YNXA 5JJKA 3H0GG 3KDFB 4L5SA 4BY7G 4MZ9A 3M4PA 2B63G 2XGTA 1VQCA 1BBUA 1XPOA 4LF5Q 2K5HA 5M5WH 2YV5A 2VUMH 4GOPA 1Q81C 2R7ZG 3L2PA 3F2BA 1WYDA 3OTOL 3K80C 3RN5A 3T1YL 2A1AA 1XMOL 1XNQL 1NJIC 1OXVA 5LMNW 4KHPL 3TQYA 4A3LH 4ME3A 1E7ZA 1K8AC 4JV5L 3H3VH 4JI5L 2OQ0A 5C3EG 1XMQL 4GKJQ 2NZHA 3I4OA 4DKAC 2JA8H 3STBD 4A93G 2KENA 1QUQA 4GN5A 4BXXH 4GOPC 4QQBX 5JJLA 2UU9L 3D31A 5IY0A 3K81C 5FJ8G 4DUYQ 3PSIA 3CC7A 4XTCS 2K75A 2R92G 2N8NA 1EOVA 1P16A 1PH3A 1V1QA 4DV6Q 4JC0A 5C0XG 1SRUA 4HJ7A 1X54A 2BH2A 1JB7A 1JMCA 1UWVA 1BKBA 3JAMc 1Q1BA 1YZ6A 1HR0Q 1A8VA 1JE5A 5IT9c 3CCSA 4A3FG 4QGUA 3UE1A
chains in the Genus database with same CATH superfamily
1IYVA 4I7ZC 4V190 3M4QA 1MKHA 1N9WA 2E5LL 1IHZA 2V1CC 4GNXB 4GN3B 3AEVA 4RAUC 1E1OA 1M90C 1HR0W 2JA5B 4OX9L 5C5MA 4DV7L 2CKZB 1HQRD 2F0KA 3Q22A 2DUDA 5M3MH 1TKWB 3J7A5 1VQIA 3VR4A 4O0AA 3BDLA 1D2BA 3T16A 1KRTA 1G6PA 1LABA 2E2JB 2JA7G 3NQIA 3CHBD 2QA4A 5BR8L 2N55A 3G71A 3A74A 1CKOA 4J15A 2EDGA 3E3XA 2N3SA 3S1MH 4GZYC 1Y1VB 2B63H 4LUZA 1HRJA 1A63A 3PIPA 1PH4A 4H44C 3J7AF 2R7ZH 1IBMQ 2KCCA 4DK6C 2OWOA 1GJXA 5IYBG 1E22A 1WVLA 3ND8A 4G7HC 1IW7C 3HOWG 5HURA 3H09A 4P74A 2OTLA 2C35B 2RVLA 1LT6D 3SE0A 4DUYL 3UDIA 5KGUA 3M4OH 3GTKH 1KC8C 1TY2A 2HCCA 4C1NI 1PFNA 4GNXA 4ODGA 4AYBE 4DR4Q 1EOTA 3S24A 2YTXA 5G3LF 2RSNA 4HIMA 1HR0L 4KKUA 1YVCA 4A3FH 2UUBQ 1X3GA 1UEAB 3T4AC 4IUVA 4A3BG 2B8FA 3Q6SA 4RA8A 4J1MA 1PZJD 4IUUA 3SEBA 2F0DA 5D3DA 1H9SB 4AYBB 3RZDH 4XT1B 2KEDA 5IGCA 1OXXK 5C0XJ 3A5ZB 3ZYYX 1N33L 1C4QA 2SDFA 2F0QA 3ULJA 1XPRA 3R3OA 4PZ7A 1EL0A 2ZTDA 1CTMA 3JC66 5M3MB 2R6GA 3K7UC 2K33A 3AYHB 5FLMG 1JJCB 2EJMA 1SNPA 3ICEA 2QGQA 2PYKA 4G4KA 1CA6A 2WACA 3HGBA 3S1MB 1HHVA 4QUCA 1D5XC 2B63B 3MVVA 3IFTA 4IFDJ 5EJWA 5CV9A 4A76A 3HOWH 4JBKA 1NSNS 2R7ZB 1DOMA 1Q82C 1SR3A 2MO0A 3RUZA 3Q23A 2L0CA 4HR7B 3J81j 1VQMA 5CV6A 3L7ZC 4LJZC 1BBXC 3TREA 4POFA 1TS4A 4OONA 5LMUQ 1QWYA 4C3HH 2IW3A 3D3RA 5EPLA 3S15H 3M4OB 2K01A 1VQHA 2UUAL 4A3EG 3GTQH 3GTKB 1PFMA 5LL6X 1I6HH 2R93G 1NBWA 2N49A 3FPPA 1JR0D 4YCUA 4DR7L 3BZDB 1VCIA 4IPGA 5IWAQ 4LFBQ 1PYSB 2A19A 3BVMA 4IUPA 1JORA 1PRTF 2NVXH 1SAPA 4A3FB 1K28A 2PQEA 1SYFA 1HNXL 4HJ8A 3GTLH 2F0HA 2A69D 1S5FD 1L2FA 1BCPB 3CCRA 2TSSA 3A8IE 1H9MA 1PV4A 2JE6I 1WFQA 1MGSA 2JN4A 2MP1A 1Q86C 3RZDB 3QB3A 1JWUD 1HTPA 5IYDH 2HIVA 3R2IA 3P1HA 4X3KA 4XYQA 2A8VA 5K36G 4PMWA 1STNA 4HMIA 1VMPA 1Z9FA 5AFWA 2RDHA 3NQTA 5D3IB 3E9HA 3DUZA 4X64Q 4CHTB 5M9OA 3NEMA 1R4QB 1BCPD 1L0WA 2A6HC 2ZXOA 4JW0A 2J4XA 4LAAA 5GQOA 1PH8A 1RTNA 2D9UA 1EIFA 2RSOA 3HG9A 1Q7YC 1TXYA 3SDZA 1B7YB 4HEDA 3HOWB 3JAME 3EN2A 1D8LA 4QF4A 2K5DA 3CRKC 1XMQQ 3I91A 1SFOH 2RHSB 3AFPA 4NXNQ 4H0LC 2B2YA 5ELFA 4A3EH 4A3GG 3W3AA 1DJRD 1VMCA 2BDNA 1ONLA 4C3HB 1DOLA 1T5EA 3A7LA 3FVQA 1F9SA 5ELEA 4BBSB 1KHIA 1VS0A 2WINB 4PV1C 4IOCA 1I6HB 3BJUA 1FNWA 2J0TD 4RGOS 1X3PA 1QUQB 4A3MG 1TWFH 3VYUA 3M3YH 2NWGA 4ZKBB 4DV3L 2AQ3B 3J81c 4ZAIA 1XYIA 2FFKB 4QL5A 2NVXB 2NN6G 4IPHA 2Z6KC 3LX0A 3PIP3 4HSPA 3GTLB 2L1BA 1GUOA 5CV8A 2JYOA 4V0BA 2HD3A 4TVAB 1O7LA 1VQ5A 1IZ6A 3WOEA 3EBEA 1EWCA 1EEFD 5K36H 4K5VA 2NN6I 1PFBA 4AIMA 4JVZA 3LWEA 1HA5A 4JI6L 3A8KE 2BE5D 1GUSA 1XTDA 2PQAB 4XQJA 2F0SA 3I56A 2E2IH 3NHHA 2LMCB 1VQBA 3MXNB 3VR5A 2CCZA 1SEBD 3EJIA 1WCMH 3VR2A 4M1UB 1NE3A 1JWMD 1Y8NB 2JK8A 2IX1A 4DR4L 5E3FA 1EUJA 4RGMA 4Q5VA 4DU9A 1IYJB 5AJ3L 5HY6A 4QIWE 4KN7C 3A5UA 3EIVA 1CA5A 1BDOA 2Q2HA 1GM5A 3J7AV 4TSSA 1A15A 2DNCA 4DV1Q 4LMQD 1WTWA 1GHJA 4DR3L 1HFGA 1I6VC 2PZWA 1FNVA 4TKOB 3W1GA 4A3GH 2X6LA 1K83B 4H02A 2I5LX 1SYBA 1DOKA 3NUCA 1U4LA 3R8BA 4DV4L 4A3EB 4QIWB 4JYAL 4KY5A 4PNYA 1IBLQ 1H9KA 2EXDA 4NKLA 1RJTA 4O42A 4K0KQ 4LF4Q 3PMFA 1S40A 5C4XB 4TRDA 4GLAC 1HNWL 2PQAA 2NN6H 3CPWA 2AUJD 1TWFB 2PW5A 4F8MA 4DAVA 2ZJRA 1KDAA 4OWWB 3BG3A 1PH5A 4RWSC 4CJ1B 4X62L 1VQ6A 4A3KG 4DUZQ 1C8CA 1H9JA 3RLFA 1YNNC 2JA9A 2WKDA 4DV2L 1Q1EA 1I94Q 1NUCA 5IGFA 2PPBC 3J7YW 4FF2A 3J80L 4FP5D 2E2IB 1EIYB 3BS1A 3DMUA 3T1YQ 2UXBL 2WKCA 1UEBA 4KHPQ 3HS0C 5LMUL 5GAGC 3OW2A 1WCMB 2ZXRA 1TS3A 4BXXG 2IJ0A 5IGBA 2JEBI 1YHBA 4HIDA 2B2TA 1PHJA 2A6ED 2RDFA 3U50C 2F0LA 2WFWA 3NBHA 2IX0A 3PF5A 1XWEA 2AHOB 4A3GB 4GLXA 5CR3A 3MEHA 2B2TC 2E5LQ 1EQVA 4DXGA 4NPSA 5JJZA 1VF5C 1T5XD 1TVXA 3G7LA 2MUYA 1U4PA 4OX9Q 4DV7Q 4K5XA 1CZWA 1UNSA 2E76C 2Q2IA 3J7ZC 1QZGA 3C2PA 1TR5A 1YITA 3H6MA 3W2DA 4A3KH 2EY2A 3V2TA 2MHVA 3QO2A 3GTJH 4L8JA 2XWJB 2V4DA 5E4WC 2ZXPA 1ZYRC 4DA2A 3KDFB 4BY7G 3M4PA 1BBUA 1OO9B 4G7ZC 1CQVA 3L2PA 3F2BA 3OTOL 1XNQL 5LMNW 4UHVA 2RKSA 1BCPF 1E7ZA 3T56B 5C3EG 2OQ0A 1XMQL 2NZHA 2A68D 4J8QA 2KENA 1LV9A 4BXXH 4KK7A 1MHWC 1GUGA 5IY0A 3K81C 4DUYQ 3QWNA 3CC7A 4XTCS 2K7VA 2K28A 4S3SA 2R92G 4XDXA 2N8NA 2XWBB 4JC0A 5C0XG 1G2SA 1E0BA 3BVGA 4HJ7A 2XNAC 2A5HA 1BKBA 4IZ8A 1HR0Q 1A8VA 1JE5A 3MFGA 1ET9A 1B70B 1A3VA 4KHVA 4CDEC 5C0XI 1GUTA 3UDFA 1Q90A 1VDZA 3HOUB 5L37A 3LWUA 1CM9A 4OHJA 1JOOA 1X55A 2KEEA 2NVYB 4X6AH 3TP5A 1N33Q 1BO0A 1QILA 2VY3A 1YIJA 4KTAA 4QCLA 5LMNL 3HZXA 4P72A 4IFDG 1SMYD 1F2MA 2IWHA 5DNFA 5BN4A 1AE3A 2QEJC 1CHQD 4A3KB 1Z7TA 4GLVB 4N9TA 2L12A 4JI1Q 3GTJB 1IYUA 4YIJA 1KTKA 4DNIA 3VA7A 2F0PA 4IFDI 3IL8A 2Q2TA 4KMUC 2F0FA 3I4MG 1E2WA 3MFYA 5C3EH 1EQRA 3H94A 1I4PA 4FXKC 4LW1A 3ULPA 2UUCQ 2O4XA 5FLXL 1JE4A 3TZDA 3PQIA 1UE1A 3RNUA 5C0XH 2L55A 1TWAH 3FPUB 4IUNA 2PI2A 5KNBA 5CORA 1LO5D 1PTOD 2EVBA 4JPBW 4K0KL 2F1MA 3CD6A 3ERSX 4IUQA 2N78A 4DR7Q 2E74C 2G5DA 3MXGA 4IURA 4DK3C 2EJGC 2HDMA 4BS9A 1JICA 3JAMi 3KJPA 1HNXQ 2OQKA 1D5MC 2YTYA 4R4TA 1C48A 4HN7A 4DUZL 2AWOA 4R1JA 1TIID 4N8FA 3M4YA 1LLRD 3I7FA 1FVIA 3C1EA 4IFDH 1PRTC 1BQQT 2ICEC 1IBKL 3KLRA 2KHJA 1KDBA 4RCOA 5EKLA 5C3XA 5EAYA 3F2UA 1U4RA 3HP3A 4IJLA 4YY3L 2HQEA 2YU9H 2VXWA 1KLGD 1VQKA 2FHTA 1JJGA 2Y0SE 4APVA 1TS2A 2BA1A 1CKNA 1EY4A 4CDCC 1S3OA 5I9PA 1JQYD 3E6ZX 1SROA 1ESFA 1PZID 1R9TH 5C3EB 3M7NA 1H95A 1AN8A 3MAQA 1RTOA 5KRUA 5IP7G 2VQEL 1XX8A 4QB4A 2F0IA 4OL7A 2SNMA 1VQ9A 2Y0SB 1XTCD 1PH2A 2EQSA 1BUVT 1W2BA 1KQSA 5BN3A 3OPOA 2CWPA 3ZJYC 1KNEA 1J8IA 4XIGS 3U9SA 4EVOA 3S2HH 1MJCA 4FXDA 3SGIA 3OYYA 4LFAQ 2RCFA 4C56C 4DV3Q 2NZ1D 3GV3A 3AFQA 4FF3A 1Y1WG 3MXPA 4P75A 2EE1A 3QOLA 3KUPA 5FO9B 1JB3A 3RLOA 4NMZA 2BA0A 2RHQB 2AQ1B 1L1OB 3CCJA 1LACA 3S14H 1IW7D 1FJGL 2OF1A 2JXMB 4JCVE 2WAQG 2UXDL 3S1QB 2K5NA 1MJEA 4B3SL 4JI6Q 1HFNA 1SJHD 4O2DA 2OT2A 2JJQA 3NTKA 1NNXA 2I5MX 1UE5A 3PIO3 1WTHA 1W3SA 4IO9A 3QG1A 1ASZA 2GVAA 3K5NA 1PH6A 2EZVA 4DAMA 3TP7A 1NR4A 3P20A 1XMOQ 3K57A 1O7YA 4F7XA 5AJ3Q 3ERQA 3OMCA 2CQOA 5IT9E 4NDXA 4JV5Q 4JI5Q 1EYDA 4GKKL 3S1RH 4LUVA 1DGSA 1B4OA 4KD4A 4GOPB 1LUZA 5IP7H 1R9TB 4DR3Q 2F0UA 4GNXC 4XQQA 2YTVA 1B9NA 3J80c 1TY0A 5F2DA 3E0JA 4QMGA 4LWCA 2XTIA 4CKEA 4DV4Q 2WB1G 4JYAQ 2F3WA 1FGBD 1JCKB 1QJOA 2F0WA 4DAYB 1XNRL 4KJOA 1KNAA 1PH1A 1GHKA 1AW7A 2MNAA 1X3FA 3S2HB 2JA7H 3EROA 1KL9A 1HNWQ 5IP9G 1GO3E 2CFMA 3PUWA 1AZQA 3CCEA 3KBXA 4DNTB 4JI1L 4CKBA 4B3ML 4X62Q 1ENFA 4JI0L 3S17H 3NTIA 5A2QE 1WOCA 1MI2A 2F0VA 2N88A 4KKTA 1LT5D 4DV2Q 3S14B 5IYBH 1QNKA 1VQ8A 4BWGB 1N36L 3T13A 1BOSA 3GO5A 1QZHA 2UUCL 3UDXA 1G91A 2I5HA 3H3VC 3U9OA 3PCOB 2ZT9C 2UXBQ 4KLKA 1EY0A 5IE8A 4XT3B 3ER0A 1H9SA 3NPPA 3MHBA 3OSOA 4NB3A 2KCNA 1VF7A 3R93A 5C6AA 4DR6L 5J1ZA 2PNHA 2Z4HA 3C3LA 5M3FG 4DAYA 5CV4A 4BBRG 5J39A 4R8IA 4A3BH 3OIQA 3NXWA 4HCSA 1M8AA 3S1RB 2WIIB 1PTOF 2FJ2A 3STBC 4DK0A 4JI4L 3A56A 1IL8A 4ALPA 4ZYSA 3D0FA 3HOXG 4R4OA 4FF1A 2F0TA 1VQLA 1O7ZA 1WD1A 5JVH3 1DD2A 1V43A 3OHXC 3ONAB 5IP9H 1F77A 5EKKA 5FLMH 2E2HH 2EYLA 5IOCA 2A6HD 2LFNA 2NTTA 2JA7B 3B6YA 5CV5A 1EZ8A 2B2UA 2F0JA 3H91A 3DHQA 1VQ7A 1QCBD 3S17B 1ET6A 2IY5B 2NB0A 2LY7A 4LF9L 2Q8TA 2VUMG 4B3TL 1DM0B 4HJAA 1G51A 5EBCA 3OTOQ 2QF7A 3CCMA 2PZUA 2R7FA 1XNQQ 2XRSD 2H1EA 1CT1D 4JI3L 4HCEA 3DWQA 2CHBD 3SK5A 1UUPA 2R7DA 1TWGH 2OCEA 4I65A 2R93H 2EJFC 3O13A 4DR2Q 4BBRH 3S15B 3KK7A 1RD9D 3ND9A 5ELNA 3EQLC 3I8ZA 3GTQB 1PYWD 3F8TA 1WTQA 1BCPC 1TWHH 2B2YC 4L5QA 3VYRA 4C1NK 5ELOA 1VQPA 4LFAL 4A3BB 1V8QA 5LHY1 3SR1A 4K2KA 4YCWA 3GTGH 1Y8OB 5HGTA 1GUNA 3HOXH 4ME5A 4WRDA 1LTBD 3DXJC 4XQNA 4DV0Q 2G9DA 2CW0C 3CU7A 2ID0A 3AQQA 1EY5A 1SNCA 5FLXc 3KF8B 3T53B 4NXML 2MO1A 4FVMA 4F87A 2EOTA 3V96A 4B3RQ 1RKNA 3KFUA 3CMEA 1HJPA 5DEHA 2JEAI 2HUGA 4FYDA 3CCLA 4CKCA 4KJNA 5LMNQ 1WD0A 2E2HB 3GTPH 1YNXA 1F2LA 3H0GG 4MZ9A 5IGGA 2XGTA 1XPOA 2K5HA 1M4VA 2VUMH 4H7BA 1NAPA 3K80C 5I6WA 1XMOL 3N6RA 1OXVA 1EQTA 5NUCA 4JV5L 4JI5L 1JWSD 3I4OA 4ILWA 4ZUIA 2JSOA 4DKAC 2M00A 4A93G 1QUQA 3FDTA 1EU3A 1BNZA 2UU9L 3S9WA 4L63B 2F0MA 2F0OA 2K75A 1ESRA 3IKJA 1P16A 4UAIA 3MTSA 4DV6Q 1SFOB 1SNMA 1X54A 1TWGB 2PO4A 1JMCA 5I4DA 2D5DA 1Q1BA 1YZ6A 2R93B 1FGUA 4OGQC 4BBRB 4A3MH 1X56A 3VDYA 3SK6A 5J22A 3J81E 1A3UA 1BXTA 1PFSA 3URYA 4LF7L 2VB3X 5ELDA 1Q46A 1YNND 2K6AA 2HT1A 1S72A 3M3YB 3MXNA 1O7IA 1R4PB 4DF7A 1LM0A 1C9OA 3GTGB 1SSOA 2I0QA 3HOXB 5DM73 4M8AA 5A2QL 1B53A 5KNDA 1E3PA 2MPMA 3UI2A 4WFN3 2VZAA 3CP0A 4UDUC 2Z4IA 4OELB 1SNQA 1DONA 4UPAA 1ASYA 3OMGA 3AU7A 4RCNA 2DNEA 1IBKQ 3H0GH 1NY4A 2NTSA 3K0YA 3M85A 3FKIG 1PA6A 3HRZC 5M5YH 4B9WA 3GTPB 1KABA 3D4DA 4EQPA 3VR3A 4YY3Q 4GKJL 1IXRA 4QY7A 2K4KA 2L11A 2KUMA 1KXLA 3I4LA 4JK1C 3CCUA 3TRZA 1GVPA 1VQGA 2AUKA 4OEMB 2BOSA 3X3NA 1ICFB 3T1HQ 4NW2A 5C4JH 2JQOA 4LF6L 4DR5Q 1UAPA 1AEXA 2AKWB 2VQEQ 2G9HD 1SYDA 4E6IA 2B2WA 5IODA 3TSSA 2JA6G 3PO2G 2F3VA 5CC4A 2MGSA 3MWYW 1K73C 5ISRA 3K58A 1HTLD 4A3MB 1L0YB 1EY8A 4P73A 1ZYRD 1K3RA 3BYTB 3LGJA 1VQAA 1EQQA 3CMAA 5ELCA 2BH8A 2A6EC 3CPFA 1F2ZA 1PTOH 3TP6A 4BY1G 2D0OA 4ZQ3A 4IJHA 3NP8A 3NE5B 1PYBA 2SEBD 2YYZA 3CW2C 4HAEA 2UXCQ 2RDGA 4XXEA 5DM63 1FJGQ 2UXDQ 2KVMA 3K59A 2F0NA 4DR1L 4B3SQ 1MSGA 3C1FA 2IPKD 3VA5A 3FKIH 3JAML 2CH4A 3U4VA 3CCVA 1O78A 3OIPA 1YJWA 1MD2D 4CBVA 3H0GB 2L15A 3A0JA 5T1GA 1PH9A 4BA2I 3RR5A 2MJ8A 2AQ2B 4X66L 3X3MA 5M5YB 4YHHL 1TS5A 4DR2L 5CGKA 2HHHQ 1NMFA 4KY7A 1U5KA 2QDBA 1I4HA 1OXUA 2D2CC 1JOKA 1LTAD 4B08A 2CWAA 1W6JA 4K8IA 1QG7A 4GKKQ 4G57A 2O2LD 2O5JC 3GDEA 3TS2A 2VNUD 1FD7D 3SK8A 1LTID 5JPMC 1EFID 3SVMA 3G6EA 4DV0L 1M1KC 2JA6H 5C4JB 3PO2H 3BU2A 5KYIA 3C46A 3PF4A 1JC7A 2XIWA 2NVTH 1OXTA 4RMFA 4LUOA 3KDFA 2Q8IB 4CJ0B 2I07B 3OWFA 3IAYA 2VL6A 4B3RL 4K6DA 3KJOA 2ZM6L 1EYGA 2JA5G 3PUXA 2H5XA 1XNRQ 4DAPA 1SYEA 1UE6A 1WTRA 2AWNA 1FYCA 1BF4A 1ILQA 4BY1H 3CRLC 2F0GA 4PZ6A 2PMZE 1F9PA 1HXYD 3I3CA 5E7NA 2EXZA 3FRPB 4J6HA 4BY7H 3DM1A 4B3MQ 1LTTD 1PTOB 3I73A 4JI0Q 4G7OC 2WP8J 3CKIB 1PXUA 5K5PA 1OXSC 2DJFC 1V1PB 3OW7A 4EGVA 1N36Q 3I2ZA 4HIOA 2EYPA 2QEXA 3UDGA 1GD7A 2PMZB 4YWLA 2CH4W 2EYJA 2H4OA 1SJED 3QOJA 1YBYA 3QR8A 3NWTA 4OIKA 4JBMA 5C4HA 1CFMA 2R92H 5IGDA 4DV6L 4UP7A 2Z8LA 1NTGA 2O5IC 4A3LG 2MQHA 4C3JG 1ILPA 4WJ4A 4DR6Q 2NUCA 4A75A 1IL2A 4ZCKA 4DPGA 2ASBA 2QDLA 1LTGD 4K6LA 2TMPA 4FXGC 1CK1A 1B8AA 1Y8PB 2M9VA 1D6EC 4OXPA 5JEAG 3S16H 1CSPA 5FK9C 3L0OA 1LTSD 4RFBA 2F4IA 5EBDA 1RODA 4JI4Q 1MSHA 4KD3A 4P71A 2JA6B 1CZGA 5C5LA 3CAMA 4FDBA 1STGA 2ZTCA 4R9WA 2NVTB 4K5WA 1SLJA 3U4ZA 1Y14B 3D8GA 3PUZA 4LF8L 1QVFA 4QUFA 1ENAA 5DLQE 1PH7A 3DEOA 1GOZA 3N52A 1FNUA 1V1OA 2F4VL 5CV7A 2K04A 3H15A 1O80A 4IN3A 3BVZA 1F9QA 4BY1B 1DXMA 2RBMA 3FP9A 3RN2A 4JBJA 4BY7B 1SYCA 4FNFA 1YNJC 3I4MH 1WTVA 4GN4B 5BN5A 4U673 4LF9Q 3T51B 4B3TQ 2NBFA 5I6YA 2ZJQA 3BZCA 2CVRA 1X6OA 4JI2L 1U9RA 4JI3Q 1I50H 3T1HL 3E5SA 4C3JH 4DR5L 3Q8DA 1WJJA 1ZXTA 2R92B 3K5OA 1TWCH 2QW7A 4JI7L 1TWAB 1AH9A 1CI3M 1HUNA 2PW7A 4IPDA 3I55A 1JT8A 2F3IA 3DWPA 2XVSA 4H13C 1CQFA 4R4IA 4KHZA 3S16B 4C3IG 1LTLA 3GTOH 2K5VA 4WJWA 5HGQA 3I4NG 2UXCL 4OWTB 2IX3A 1JOQA 2K50A 1I4QA 5CBEE 4NXMQ 5KNCA 1KIXA 4IPCA 2GA4B 1Q8KA 4HSVA 1XXGA 3VYTA 2XRQD 3J81i 3DLLA 3ITPA 1SE8A 3EVQA 3NELA 2K32A 4LFCL 1G2TA 1DCZA 2HIXA 1C7YA 2LSSA 4ZUJA 2VQFL 4IUTA 1PDQA 1A2TA 2Z0SA 2D62A 2HHHL 1V9PA 1HZAA 1PLFA 5EPKA 4KN4C 2YU9B 5IGEA 2XSCA 3I4MB 1YHQA 2ENBA 3KLSX 4KY6A 1J5EL 3CXCA 2JA8G 2Z1CA 1D1IA 4EQ5A 4RKBA 2AMCB 1N8RC 3PUVA 2UU9Q 3K6OA 3W1BA 2J7ZA 1I50B 1QOHA 1KD1C 3Q0AA 4C3JB 2F03A 4PMBA 2EY5A 4K14A 1L1OA 4C3HG 4BBSG 1TWCB 4JOIA 1XPUA 3MA2B 4UY8C 4X65L 1HUMA 4C2MH 5C4ZA 1Y1WH 1K0SA 3D4RA 1P8LA 2Q8RE 2B8GA 4LF7Q 1L1OC 1PVOA 3PV0A 1TT2A 4C3IH 4DV5L 3KOJA 3I4NH 4JOIC 1KLUD 3NTHA 1K0RA 3GTOB 4L6TB 1A62A 4LK1C 4IOAA 1Q3LA 3K8AA 5E4XA 5IYDG 2HQLA 5KIXA 5FKAC 3L9AX 4A3CG 5JJKA 4L5SA 4CDDC 1B3QA 3P75A 3V05A 5M5WH 4GOPA 1Q81C 5EQ0A 2SNSA 1WYDA 1B50A 1ENCA 3RN5A 3DWAA 3MXUA 1EY6A 3TQYA 2K5WA 4RHSA 4ME3A 5I2YA 1K8AC 4GKJQ 1WTPA 4K2LA 1E2VA 2JA8H 2DY7A 3STBD 3A54A 4GOPC 1GXDC 5JJLA 2K03A 3D31A 1EU4A 5FJ8G 1BR9A 4CDFC 1Q8IA 1EOVA 3J80E 4RHRA 4ZLTF 2EYHA 1PH3A 3KLSA 2I46A 2BH2A 1PZKD 2K1BA 2A73B 1UWVA 3JAMc 3I70A 4LF6Q 4QGUA 3UE1A 2HDLA 4BBSH 1CKMA 2OXPA 2MFIA 2R61A 2LS01 2SOBA 4JI8L 2ATWA 2NVQH 2IT1A 1N32L 2D0PA 2WAQE 5C4XG 4ZKCB 2ALYB 3M9BA 5JEAJ 5GAEC 4C2MB 3K7AH 1Y1WB 5GADC 1CHPD 2PZTA 3TN2A 1EZ6A 3E9IA 4Y52H 1STEA 2BCOA 4C3IB 1YEZA 4Y7NH 1JJ2A 4A3JG 1X3QA 4N8X1 3I4NB 3PUYA 2B2VA 1I4RA 3I90A 4ZK9B 2WAQB 2A69C 5C44G 4PMCA 1RIPA 3GP7A 4A3CH 1RCVD 4HIKA 1LT4D 4LF5L 2CQAA 1II3A 2B3GA 2B2UC 4DR1Q 3K0XA 2B2VC 1VQ4A 1TU2B 2FMCA 3LNNA 3RD4A 1DZ1A 5M5WB 1FR3A 3RLNA 3SXHA 1WCMG 4X66Q 4JG2A 3IFDA 2QCPX 4K8JA 4YHHQ 1SE4A 5M3FH 4HJ9A 5FJ8H 1B3AA 2WB1E 2K14A 1SNOA 4MTKA 2JA8B 1FL0A 2CW0D 1K83H 1CUKA 1B1ZA 3TEHB 1SN8A 1G6ZA 1GKHA 5I2XA 3GTMH 5JJIA 4IQZA 4RGNA 3PGZA 3UE0A 1SE2A 2B29A 3W5OA 2WB1B 1RDPD 2Z6KA 3DEPA 4PZ8A 4KV6A 5T1IA 5C4XH 3HOYG 2ZM6Q 4HJ5A 2FXQA 3TZUA 4L5RC 4DXFA 4P2CB 2ES2A 4DN4M 1HNZQ 2NVQB 4U68A 2KHIA 2FINB 4HMJA 1SXTA 3AMUA 5J3BA 4A3JH 3K7AB 4YWKA 5C44H 3S2DH 1I4GA 4Y7NB 2LXKA 4ZRZA 4DK1A 3RZOH 2EYOA 1LT3D 3F2CA 1IBML 5IT9L 3EFXD 1Z47A 1K8GA 1SYGA 4HTHA 3NK9A 3RMHA 4I7AA 3SK4A 4MNOA 4QJFA 1VQNA 1BVSA 1LYLA 1Q12A 3D6CA 3L3OC 1B9MA 3KF6B 3HOZG 1B2TA 4YWMA 2BE5C 2L4NA 3F2DA 3KLWA 2NYZD 3CF5A 2KCMA 4EQNA 1N34Q 3A55A 1A6XA 1HH2P 3KF8A 4JBWA 5M3FB 1XJVA 1Y69U 3VYSA 1AFPA 1KAWA 2KHSA 2UUBL 1X9NA 4WORA 1NCVA 3IRBA 5KEEA 1MIUA 4KKSA 1A3TA 3CCQA 1TWHB 1NMGA 5FLXE 4R4CA 4MHEA 3ULLA 3HOUG 2ZTEA 2QILA 2E8GA 1J9OA 3GTMB 1W6KA 2ICIA 1STHA 3I72A 3HOYH 4AQYQ 2EY6A 4A3IG 1C0AA 1H9RA 2C9OA 4X3UA 1STYA 4OWXB 4LF8Q 1BBWA 1RL2A 3BZKA 4R8NA 3NBHB 5M5XH 1Z6HA 2RA4A 2PNRC 2F4VQ 2DJGC 1L0XB 1F2YA 3KF6A 3DM3A 4A3JB 2RCNA 3GQBA 1WTOA 3Q24A 1K8OA 1ICWA 2LKVA 4GS3A 1SNDA 1D5ZC 2OTJA 4N9PA 5C44B 3S2DB 2VUMB 2OEOA 4NP5A 2VB2X 4DFAA 5DAUA 4Q0FA 3SHLA 3RZOB 4A93H 1U4MA 2KBNA 2RQXA 2Z9HA 3A7AB 4A3DG 3HOVG 3HOZH 3TS0A 1D1KA 1NR2A 4JI2Q 5EGTA 2VW9A 1AZPA 5FO8B 4F88A 1YJNA 1HZ9A 3VR6A 4UP8A 4JI7Q 3G48A 1IKLA 3AB9A 5IWAL 1QVCA 1SDFA 3HKZG 5TSSA 3CC4A 4LFBL 1SE3A 2VS1A 3TBIB 2A74C 2K52A 2ZJPA 3KYHC 3HOUH 2B2WC 1RHPA 1KAAA 2IHFA 4TQUS 1K8MA 3NBIA 2NVYH 3PO3G 2GN5A 5JPNC 4A3IH 1EWIA 5JAVA 5LL6S 4OIJA 1ZEQX 1ZKOA 4L5TA 3S1NH 3NENA 3HOYB 1VQEA 2B39A 4DNRB 1EFWA 5FOBB 1LTRD 4BA1I 3BDOA 3CQZH 3OWEB 1G8ZD 2KJXA 4FF4A 1A0IA 3FHWA 3KBGA 3F1ZA 5BR8Q 5M5XB 1OTCA 2NZOA 2L9HA 4LFCQ 4X64L 5GROA 3E0EA 2VQFQ 1I3QH 2Q2UA 2F52A 2HCIA 1K9MC 1K3BC 5D65A 3MC0B 3GD7A 4A3DH 3HOVH 2KOLA 1CSQA 1X65A 4RH6A 4DGZA 1STBA 1J5EQ 4A93B 5C3WA 2KECA 5IYCG 4Z9CB 4X3SA 5CYUA 3D6WA 3HOZB 1EY9A 5G3LD 4NXNL 1T9HA 5E1FA 2EYFA 3QIAA 4FO2A 1QB5D 2E75C 2LXJA 3K5MA 2C5CA 5EPJA 2Y0SG 1YJ9A 2A68C 3PIOA 2PI2E 4KI0A 2K5QA 3MEFA 3NSWA 2P5ZX 4X65Q 1HNZL 2EPBA 3J80i 1E24A 2KA7A 2EY1A 2XN9C 5I9OA 5H1SE 1QE6A 3PO3H 4UP9A 1VQOA 1EEID 1HCZA 4XYOA 4DV5Q 2X6GA 1U0LA 1S4ZA 1E2ZA 1EY7A 2FMMA 1ML0D 3EA6A 4RGTA 4A3IB 1Y1VG 2GVBA 1HPCA 2PCFB 3CC2A 4OO1G 3S1NB 2DY8A 3WOFA 4RKLA 5JOBA 1AE2A 2X69A 4A4IA 5CMDA 1D7QA 3CQZB 1STAA 3U58A 3FMCA 5A35A 1X3EA 3FKIB 1PRTB 1HZCA 2Z6BA 1KRSA 4OO1I 1B44D 4WJ3M 1N34L 2JP1A 1X32A 4R4QA 4MIUA 3WWVA 2KQ3A 4MTNA 4PG3A 1I3QB 1SMYC 1KDCA 4LNQA 3R2TA 3NWSA 4CGYB 4O1NA 2EIFA 4YCVA 3J81L 3HFZB 5IYCH 1G291 1WI5A 4A3DB 1VQFA 4DV1L 3HOVB 3D4WA 2E2DC 2BDOA 1UE7A 3HKZE 1RF2D 1YHAA 2IHEA 2RF4A 2R3ZA 3MZ5A 1J6QA 3H3VI 1HQMC 2KCTA 3HKSA 3TDQA 1S5DD 3G4SA 1MBYA 1QVGA 4POGA 3BDCA 1DYQA 1SMXA 4AYBG 4IALA 1PRTD 4EX5A 1IBLL 3PO2B 2QKIC 2JA5H 2UUAQ 1F9RA 5COYA 4AH6A 5EKIA 4AQYL 4LF4L 3BYYB 1CKNB 2F0EA 4PQXA 3HKZB 1I5FA 4ULLA 4RG1A 4JI8Q 2DGYA 2WV6D 1AP0A 3WDNA 1V1PA 1N32Q 5CBAE 1E1TA 3GV6A 2E2JH 2EYMA 5M3MG 3FEWX 1PTOC 1YNJD 3P7JA 5GAHC 1EYAA 1IKMA 3PO3B 2IL8A 3TMEA 1VQJA 5D14A 1HZBA 4MN3A 1Y1VH 1YI2A 1I94L 3S1QH 4OO1H 1EYCA 4ID6A 1VQDA 2B63G 1S5CD 5ELBA 1VQCA 1EIGA 4LF5Q 2YV5A 2M2LA 2R7ZG 1S5BD 1EIHA 4ABNA 3T1YL 2A1AA 1WTXA 1NJIC 4KHPL 2L5TA 3M7GA 4A3LH 3K5LA 3HEJA 4B9XA 3H3VH 1SBBB 4GN5A 4CJ2C 4QQBX 5KYLA 3PSIA 1I4XA 3A8JE 5FO7B 2K05A 4EQOA 4X3TA 3OOCA 1GUWA 1V1QA 5JVG3 1A2UA 1SRUA 1HA6A 3G6JB 1EWHA 1TQOA 1QNUA 1JB7A 3TP8A 5JEAH 2DN8A 1PMRA 5IIFA 5IT9c 3CCSA 4A3FG 1S5ED 3QJYA
chains in the Genus database with same CATH topology
1FGUA 4BBSH 4A3MH 1B70B 3M4QA 1MKHA 1N9WA 1X56A 3VDYA 2E5LL 1CKMA 5C0XI 1PFSA 2MFIA 2V1CC 3UDFA 4GNXB 4LF7L 4GN3B 4JI8L 2ATWA 3AEVA 1Q46A 2NVQH 1E1OA 2IT1A 1M90C 1N32L 2D0PA 2HT1A 2WAQE 1S72A 5C4XG 1HR0W 1X55A 2ALYB 4OX9L 1O7IA 4DV7L 3M9BA 2CKZB 1LM0A 5JEAJ 1C9OA 5GAEC 2I0QA 2DUDA 3K7AH 4X6AH 5M3MH 3J7A5 1VQIA 1N33Q 4O0AA 5GADC 2VY3A 1YIJA 1KRTA 3E9IA 4Y52H 1G6PA 4Y7NH 1YEZA 1JJ2A 2JA7G 4A3JG 1E3PA 2QA4A 5BR8L 3PUYA 5LMNL 2VZAA 3CP0A 3G71A 3A74A 1CKOA 4J15A 4P72A 4IFDG 4UPAA 5C44G 1ASYA 1RIPA 2N3SA 3S1MH 4A3CH 1AE3A 1IBKQ 4HIKA 3H0GH 4GLVB 4JI1Q 4LF5L 1NY4A 4LUZA 2B63H 1A63A 2B3GA 3PIPA 3M85A 4DR1Q 1PH4A 3FKIG 1PA6A 4DNIA 3K0XA 5M5YH 2R7ZH 1IBMQ 4IFDI 4DK6C 1VQ4A 2OWOA 2Q2TA 5IYBG 1E22A 4YY3Q 4GKJL 3I4MG 3RLNA 1IXRA 4QY7A 3HOWG 5C3EH 1EQRA 2K4KA 4P74A 2OTLA 1WCMG 2C35B 4X66Q 4JG2A 4LW1A 1KXLA 4YHHQ 4HJ9A 5M3FH 4DUYL 3ULPA 3CCUA 3TRZA 3UDIA 2UUCQ 1GVPA 3M4OH 5FJ8H 1VQGA 3GTKH 1KC8C 2WB1E 2K14A 4GNXA 4AYBE 4DR4Q 1FL0A 1UE1A 2YTXA 3S24A 3RNUA 1TWAH 3T1HQ 5C4JH 4HIMA 2JQOA 1HR0L 1K83H 1CUKA 4LF6L 2PI2A 3TEHB 4DR5Q 1SN8A 1YVCA 4A3FH 2AKWB 1X3GA 2VQEQ 1GKHA 2UUBQ 4K0KL 4A3BG 3CD6A 3ERSX 2N78A 2JA6G 3PO2G 4DR7Q 3GTMH 1K73C 5JJIA 3PGZA 3UE0A 4DK3C 2B29A 3W5OA 3JAMi 3KJPA 3RZDH 2Z6KA 4PZ8A 5C0XJ 1OXXK 1HNXQ 5C4XH 4P73A 2OQKA 2YTYA 3A5ZB 4R4TA 3HOYG 1K3RA 2ZM6Q 4HJ5A 3LGJA 2FXQA 4DUZL 1VQAA 1EQQA 1N33L 3CMAA 2AWOA 4L5RC 2ES2A 2BH8A 4R1JA 1HNZQ 3ULJA 3CPFA 2KHIA 1XPRA 3I7FA 4BY1G 2D0OA 4PZ7A 4IJHA 1FVIA 5J3BA 4A3JH 1PYBA 2YYZA 2ZTDA 3JC66 2R6GA 3CW2C 3K7UC 2UXCQ 3AYHB 4YWKA 5FLMG 1IBKL 1FJGQ 1JJCB 5C44H 3S2DH 2UXDQ 2LXKA 2KHJA 4DR1L 4B3SQ 3RZOH 5EAYA 3F2CA 3ICEA 3FKIH 1IBML 2QGQA 3U4VA 3CCVA 1YJWA 1Z47A 1K8GA 4IJLA 2L15A 4YY3L 3A0JA 1PH9A 2YU9H 4BA2I 3RR5A 1VQKA 4IFDJ 4MNOA 3HOWH 4A76A 4X66L 1JJGA 4JBKA 4QJFA 1VQNA 1BVSA 1LYLA 1Q12A 2Y0SE 4YHHL 3KF6B 4APVA 1SR3A 2MO0A 2BA1A 4DR2L 4YWMA 1CKNA 1Q82C 2HHHQ 1NMFA 1S3OA 3F2DA 1VQMA 3KLWA 3J81j 3CF5A 2KCMA 1SROA 1U5KA 1OXUA 3L7ZC 1N34Q 1R9TH 3TREA 2CWAA 1HH2P 4POFA 3M7NA 4OONA 5LMUQ 4C3HH 1H95A 4JBWA 1XJVA 4GKKQ 3S15H 1VQHA 2UUAL 4A3EG 3GTQH 5IP7G 1KAWA 2VQEL 2UUBL 1I6HH 2R93G 1X9NA 3GDEA 1NBWA 2N49A 1VQ9A 4YCUA 3TS2A 2VNUD 3IRBA 4DR7L 1MIUA 4DV0L 1M1KC 3G6EA 2JA6H 3PO2H 1PH2A 1VCIA 2EQSA 3BU2A 4IPGA 5IWAQ 3CCQA 1W2BA 4LFBQ 1KQSA 1PYSB 1NMGA 2A19A 2CWPA 3ZJYC 3PF4A 4R4CA 2NVXH 2NVTH 3ULLA 4XIGS 3HOUG 1OXTA 2ZTEA 4RMFA 4LUOA 1HNXL 1MJCA 3S2HH 3KDFA 3SGIA 4HJ8A 3GTLH 2E8GA 2VL6A 4B3RL 3OYYA 1L2FA 3KJOA 2ZM6L 1EYGA 3PUXA 3CCRA 2JA5G 2H5XA 4LFAQ 1XNRQ 4DV3Q 3HOYH 3AFQA 1PV4A 2JE6I 4AQYQ 1UE6A 1WFQA 4A3IG 1Y1WG 1Q86C 4P75A 1C0AA 2AWNA 5IYDH 4OWXB 3RLOA 1BBWA 2BA0A 2HIVA 2RHQB 4PZ6A 1L1OB 4BY1H 4LF8Q 1RL2A 3BZKA 3CCJA 2PMZE 3NBHB 5K36G 5E7NA 2A8VA 3S14H 5M5XH 4BY7H 4PMWA 1FJGL 4B3MQ 4JCVE 2F4VQ 2WAQG 2UXDL 4JI0Q 1Z9FA 2K5NA 1MJEA 3KF6A 4B3SL 3DM3A 2WP8J 2RCNA 4JI6Q 1OXSC 4GS3A 4O2DA 2OTJA 3E9HA 2JJQA 4X64Q 2I5MX 1N36Q 3NEMA 3I2ZA 4HIOA 2QEXA 3UDGA 1L0WA 1UE5A 1GD7A 4YWLA 4A93H 2KBNA 1W3SA 4IO9A 1ASZA 1YBYA 2GVAA 1PH6A 4A3DG 5GQOA 4JBMA 3HOVG 3HOZH 1PH8A 3TS0A 4DAMA 2R92H 4JI2Q 4DV6L 4UP7A 1EIFA 1Q7YC 1TXYA 1NTGA 1XMOQ 1B7YB 2MQHA 2VW9A 4A3LG 5AJ3Q 2CQOA 3EN2A 1D8LA 4JV5Q 4WJ4A 4JI5Q 4GKKL 1YJNA 1XMQQ 3S1RH 4DR6Q 4LUVA 1SFOH 2RHSB 3AFPA 4NXNQ 1DGSA 4A75A 1IL2A 1HZ9A 4DPGA 2ASBA 4GOPB 1LUZA 5IP7H 4A3EH 4A3GG 4UP8A 4DR3Q 4JI7Q 3G48A 4GNXC 2YTVA 3J80c 1B8AA 5IWAL 1QVCA 3HKZG 3CC4A 4LFBL 4OXPA 2VS1A 5JEAG 1KHIA 1CSPA 1VS0A 3L0OA 4LWCA 4IOCA 2K52A 2XTIA 3BJUA 3S16H 4DV4Q 2WB1G 2ZJPA 3KYHC 4JYAQ 4JI4Q 3HOUH 1QUQB 4P71A 4A3MG 1TWFH 4DAYB 3M3YH 1XNRL 4DV3L 2IHFA 4TQUS 3CAMA 4FDBA 2NVYH 2ZTCA 3PO3G 3J81c 1PH1A 4QL5A 2GN5A 2MNAA 1X3FA 1SLJA 2NN6G 4IPHA 3U4ZA 1EWIA 1Y14B 4A3IH 2Z6KC 1KL9A 2JA7H 1HNWQ 5IP9G 1GO3E 2CFMA 3PUWA 3PUZA 3CCEA 4LF8L 1QVFA 1VQ5A 4TVAB 4L5TA 5DLQE 1PH7A 1IZ6A 3S1NH 3NENA 1VQEA 3EBEA 4JI1L 1EFWA 4B3ML 2F4VL 4X62Q 4JI0L 4BA1I 3CQZH 3H15A 2NN6I 3S17H 4AIMA 4JI6L 1WOCA 4LF6Q 1XTDA 1A0IA 3FHWA 2PQAB 3FP9A 3I56A 3RN2A 4DV2Q 2E2IH 4JBJA 3F1ZA 5BR8Q 5IYBH 2NZOA 1OTCA 4LFCQ 1VQBA 4X64L 3MXNB 5GROA 1VQ8A 2CCZA 1N36L 3E0EA 2VQFQ 1I3QH 2Q2UA 4GN4B 3I4MH 4LF9Q 4B3TQ 1WCMH 3GO5A 1QZHA 2UUCL 1NE3A 2F52A 3UDXA 2ZJQA 2JK8A 1K9MC 3BZCA 2I5HA 2IX1A 1X6OA 3GD7A 3PCOB 4JI2L 4A3DH 3HOVH 4DR4L 2UXBQ 1EUJA 1CSQA 4KLKA 1X65A 5IE8A 4JI3Q 1I50H 3ER0A 3T1HL 1J5EQ 1IYJB 4NB3A 5AJ3L 5HY6A 4QIWE 4C3JH 4DR5L 3Q8DA 5IYCG 3A5UA 3EIVA 1GM5A 2Q2HA 4DR6L 1WJJA 4NXNL 2PNHA 1T9HA 5M3FG 4DV1Q 4BBRG 1TWCH 4A3BH 4DR3L 4JI7L 1AH9A 2LXJA 4A3GH 3W1GA 2Y0SG 4H02A 2I5LX 4IPDA 3I55A 1YJ9A 3PIOA 2PI2E 3STBC 1JT8A 2F3IA 4DV4L 4JYAL 4KI0A 4JI4L 3MEFA 1IBLQ 2EXDA 4ALPA 4X65Q 3D0FA 4R4IA 3HOXG 1HNZL 4KHZA 4R4OA 4LF4Q 4K0KQ 3J80i 1E24A 5H1SE 1S40A 1VQLA 3PO3H 4UP9A 1VQOA 4GLAC 1HNWL 2PQAA 1LTLA 3GTOH 2K5VA 5HGQA 3I4NG 3CPWA 1V43A 4OWTB 2UXCL 4OWWB 2ZJRA 4DV5Q 5IP9H 1U0LA 2K50A 1PH5A 5FLMH 4NXMQ 1KIXA 4IPCA 2E2HH 1Q8KA 4X62L 1VQ6A 3B6YA 4A3KG 4DUZQ 1Y1VG 3J81i 2GVBA 3DLLA 3RLFA 3CC2A 4OO1G 1SE8A 2JA9A 4DV2L 1Q1EA 3NELA 1I94Q 4LFCL 1AE2A 4A4IA 2HIXA 1C7YA 1VQ7A 2LSSA 1D7QA 2VQFL 3U58A 2IY5B 4LF9L 2VUMG 1X3EA 2Z0SA 4B3TL 2D62A 4HJAA 1HZCA 1G51A 2HHHL 1KRSA 1HZAA 1V9PA 4OO1I 1EIYB 3OTOQ 4WJ3M 1N34L 3T1YQ 3CCMA 4R4QA 2R7FA 3WWVA 1XNQQ 1UEBA 4MTNA 4KHPQ 4PG3A 2UXBL 1YHQA 4JI3L 5LMUL 1J5EL 3CXCA 2JA8G 5GAGC 3OW2A 4LNQA 4EQ5A 4BXXG 2R7DA 2AMCB 2EIFA 4YCVA 1N8RC 3PUVA 1TWGH 2OCEA 3HFZB 1G291 1WI5A 5IYCH 2UU9Q 1VQFA 4DV1L 2JEBI 2R93H 3W1BA 1UE7A 1YHBA 3HKZE 4HIDA 1YHAA 2IHEA 2RF4A 4DR2Q 1PHJA 1J6QA 4BBRH 1KD1C 3H3VI 2KCTA 3HKSA 3U50C 3G4SA 2WFWA 5ELNA 1QVGA 4POGA 1L1OA 3F8TA 1SMXA 4AYBG 4BBSG 1TWHH 4L5QA 1VQPA 2IX0A 5ELOA 4EX5A 3PF5A 2AHOB 1IBLL 4JOIA 4LFAL 2JA5H 1XPUA 2UUAQ 4YCWA 4AH6A 4X65L 4GLXA 4UY8C 4AQYL 3GTGH 2E5LQ 4LF4L 4C2MH 1CKNB 3HOXH 1Y1WH 1I5FA 4DV0Q 4LF7Q 1P8LA 4NPSA 4RG1A 2DGYA 4JI8Q 2ID0A 1N32Q 1L1OC 3AQQA 3PV0A 1PVOA 1E1TA 4C3IH 5FLXc 2E2JH 4DV5L 4OX9Q 3KF8B 4DV7Q 3KOJA 3I4NH 5M3MG 4JOIC 4NXML 2MO1A 5GAHC 4B3RQ 2Q2IA 3J7ZC 1QZGA 3KFUA 3CMEA 1VQJA 1YITA 1K0RA 1HJPA 4A3KH 1HZBA 1A62A 1Y1VH 2JEAI 3CCLA 3GTJH 4IOAA 3K8AA 5IYDG 5LMNQ 1YI2A 3HOZG 1I94L 3S1QH 2HQLA 3GTPH 4A3CG 1VQDA 1YNXA 5JJKA 3H0GG 3KDFB 4L5SA 4BY7G 4MZ9A 3M4PA 2B63G 2XGTA 1VQCA 1BBUA 1XPOA 4LF5Q 2K5HA 5M5WH 2YV5A 2VUMH 4GOPA 1Q81C 2R7ZG 3L2PA 3F2BA 1WYDA 3OTOL 3K80C 3RN5A 3T1YL 2A1AA 1XMOL 1XNQL 1NJIC 1OXVA 5LMNW 4KHPL 3TQYA 4A3LH 4ME3A 1E7ZA 1K8AC 4JV5L 3H3VH 4JI5L 2OQ0A 5C3EG 1XMQL 4GKJQ 2NZHA 3I4OA 4DKAC 2JA8H 3STBD 4A93G 2KENA 1QUQA 4GN5A 4BXXH 4GOPC 4QQBX 5JJLA 2UU9L 3D31A 5IY0A 3K81C 5FJ8G 4DUYQ 3PSIA 3CC7A 4XTCS 2K75A 2R92G 2N8NA 1EOVA 1P16A 1PH3A 1V1QA 4DV6Q 4JC0A 5C0XG 1SRUA 4HJ7A 1X54A 2BH2A 1JB7A 1JMCA 1UWVA 1BKBA 3JAMc 1Q1BA 1YZ6A 1HR0Q 1A8VA 1JE5A 5IT9c 3CCSA 4A3FG 4QGUA 3UE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGU A;  4BBS H;  4A3M H;  1B70 B;  3M4Q A;  1MKH A;  1N9W A;  1X56 A;  3VDY A;  2E5L L;  1CKM A;  5C0X I;  1PFS A;  2MFI A;  2V1C C;  3UDF A;  4GNX B;  4LF7 L;  4GN3 B;  4JI8 L;  2ATW A;  3AEV A;  1Q46 A;  2NVQ H;  1E1O A;  2IT1 A;  1M90 C;  1N32 L;  2D0P A;  2HT1 A;  2WAQ E;  1S72 A;  5C4X G;  1HR0 W;  1X55 A;  2ALY B;  4OX9 L;  1O7I A;  4DV7 L;  3M9B A;  2CKZ B;  1LM0 A;  5JEA J;  1C9O A;  5GAE C;  2I0Q A;  2DUD A;  3K7A H;  4X6A H;  5M3M H;  3J7A 5;  1VQI A;  1N33 Q;  4O0A A;  5GAD C;  2VY3 A;  1YIJ A;  1KRT A;  3E9I A;  4Y52 H;  1G6P A;  4Y7N H;  1YEZ A;  1JJ2 A;  2JA7 G;  4A3J G;  1E3P A;  2QA4 A;  5BR8 L;  3PUY A;  5LMN L;  2VZA A;  3CP0 A;  3G71 A;  3A74 A;  1CKO A;  4J15 A;  4P72 A;  4IFD G;  4UPA A;  5C44 G;  1ASY A;  1RIP A;  2N3S A;  3S1M H;  4A3C H;  1AE3 A;  1IBK Q;  4HIK A;  3H0G H;  4GLV B;  4JI1 Q;  4LF5 L;  1NY4 A;  4LUZ A;  2B63 H;  1A63 A;  2B3G A;  3PIP A;  3M85 A;  4DR1 Q;  1PH4 A;  3FKI G;  1PA6 A;  4DNI A;  3K0X A;  5M5Y H;  2R7Z H;  1IBM Q;  4IFD I;  4DK6 C;  1VQ4 A;  2OWO A;  2Q2T A;  5IYB G;  1E22 A;  4YY3 Q;  4GKJ L;  3I4M G;  3RLN A;  1IXR A;  4QY7 A;  3HOW G;  5C3E H;  1EQR A;  2K4K A;  4P74 A;  2OTL A;  1WCM G;  2C35 B;  4X66 Q;  4JG2 A;  4LW1 A;  1KXL A;  4YHH Q;  4HJ9 A;  5M3F H;  4DUY L;  3ULP A;  3CCU A;  3TRZ A;  3UDI A;  2UUC Q;  1GVP A;  3M4O H;  5FJ8 H;  1VQG A;  3GTK H;  1KC8 C;  2WB1 E;  2K14 A;  4GNX A;  4AYB E;  4DR4 Q;  1FL0 A;  1UE1 A;  2YTX A;  3S24 A;  3RNU A;  1TWA H;  3T1H Q;  5C4J H;  4HIM A;  2JQO A;  1HR0 L;  1K83 H;  1CUK A;  4LF6 L;  2PI2 A;  3TEH B;  4DR5 Q;  1SN8 A;  1YVC A;  4A3F H;  2AKW B;  1X3G A;  2VQE Q;  1GKH A;  2UUB Q;  4K0K L;  4A3B G;  3CD6 A;  3ERS X;  2N78 A;  2JA6 G;  3PO2 G;  4DR7 Q;  3GTM H;  1K73 C;  5JJI A;  3PGZ A;  3UE0 A;  4DK3 C;  2B29 A;  3W5O A;  3JAM i;  3KJP A;  3RZD H;  2Z6K A;  4PZ8 A;  5C0X J;  1OXX K;  1HNX Q;  5C4X H;  4P73 A;  2OQK A;  2YTY A;  3A5Z B;  4R4T A;  3HOY G;  1K3R A;  2ZM6 Q;  4HJ5 A;  3LGJ A;  2FXQ A;  4DUZ L;  1VQA A;  1EQQ A;  1N33 L;  3CMA A;  2AWO A;  4L5R C;  2ES2 A;  2BH8 A;  4R1J A;  1HNZ Q;  3ULJ A;  3CPF A;  2KHI A;  1XPR A;  3I7F A;  4BY1 G;  2D0O A;  4PZ7 A;  4IJH A;  1FVI A;  5J3B A;  4A3J H;  1PYB A;  2YYZ A;  2ZTD A;  3JC6 6;  2R6G A;  3CW2 C;  3K7U C;  2UXC Q;  3AYH B;  4YWK A;  5FLM G;  1IBK L;  1FJG Q;  1JJC B;  5C44 H;  3S2D H;  2UXD Q;  2LXK A;  2KHJ A;  4DR1 L;  4B3S Q;  3RZO H;  5EAY A;  3F2C A;  3ICE A;  3FKI H;  1IBM L;  2QGQ A;  3U4V A;  3CCV A;  1YJW A;  1Z47 A;  1K8G A;  4IJL A;  2L15 A;  4YY3 L;  3A0J A;  1PH9 A;  2YU9 H;  4BA2 I;  3RR5 A;  1VQK A;  4IFD J;  4MNO A;  3HOW H;  4A76 A;  4X66 L;  1JJG A;  4JBK A;  4QJF A;  1VQN A;  1BVS A;  1LYL A;  1Q12 A;  2Y0S E;  4YHH L;  3KF6 B;  4APV A;  1SR3 A;  2MO0 A;  2BA1 A;  4DR2 L;  4YWM A;  1CKN A;  1Q82 C;  2HHH Q;  1NMF A;  1S3O A;  3F2D A;  1VQM A;  3KLW A;  3J81 j;  3CF5 A;  2KCM A;  1SRO A;  1U5K A;  1OXU A;  3L7Z C;  1N34 Q;  1R9T H;  3TRE A;  2CWA A;  1HH2 P;  4POF A;  3M7N A;  4OON A;  5LMU Q;  4C3H H;  1H95 A;  4JBW A;  1XJV A;  4GKK Q;  3S15 H;  1VQH A;  2UUA L;  4A3E G;  3GTQ H;  5IP7 G;  1KAW A;  2VQE L;  2UUB L;  1I6H H;  2R93 G;  1X9N A;  3GDE A;  1NBW A;  2N49 A;  1VQ9 A;  4YCU A;  3TS2 A;  2VNU D;  3IRB A;  4DR7 L;  1MIU A;  4DV0 L;  1M1K C;  3G6E A;  2JA6 H;  3PO2 H;  1PH2 A;  1VCI A;  2EQS A;  3BU2 A;  4IPG A;  5IWA Q;  3CCQ A;  1W2B A;  4LFB Q;  1KQS A;  1PYS B;  1NMG A;  2A19 A;  2CWP A;  3ZJY C;  3PF4 A;  4R4C A;  2NVX H;  2NVT H;  3ULL A;  4XIG S;  3HOU G;  1OXT A;  2ZTE A;  4RMF A;  4LUO A;  1HNX L;  1MJC A;  3S2H H;  3KDF A;  3SGI A;  4HJ8 A;  3GTL H;  2E8G A;  2VL6 A;  4B3R L;  3OYY A;  1L2F A;  3KJO A;  2ZM6 L;  1EYG A;  3PUX A;  3CCR A;  2JA5 G;  2H5X A;  4LFA Q;  1XNR Q;  4DV3 Q;  3HOY H;  3AFQ A;  1PV4 A;  2JE6 I;  4AQY Q;  1UE6 A;  1WFQ A;  4A3I G;  1Y1W G;  1Q86 C;  4P75 A;  1C0A A;  2AWN A;  5IYD H;  4OWX B;  3RLO A;  1BBW A;  2BA0 A;  2HIV A;  2RHQ B;  4PZ6 A;  1L1O B;  4BY1 H;  4LF8 Q;  1RL2 A;  3BZK A;  3CCJ A;  2PMZ E;  3NBH B;  5K36 G;  5E7N A;  2A8V A;  3S14 H;  5M5X H;  4BY7 H;  4PMW A;  1FJG L;  4B3M Q;  4JCV E;  2F4V Q;  2WAQ G;  2UXD L;  4JI0 Q;  1Z9F A;  2K5N A;  1MJE A;  3KF6 A;  4B3S L;  3DM3 A;  2WP8 J;  2RCN A;  4JI6 Q;  1OXS C;  4GS3 A;  4O2D A;  2OTJ A;  3E9H A;  2JJQ A;  4X64 Q;  2I5M X;  1N36 Q;  3NEM A;  3I2Z A;  4HIO A;  2QEX A;  3UDG A;  1L0W A;  1UE5 A;  1GD7 A;  4YWL A;  4A93 H;  2KBN A;  1W3S A;  4IO9 A;  1ASZ A;  1YBY A;  2GVA A;  1PH6 A;  4A3D G;  5GQO A;  4JBM A;  3HOV G;  3HOZ H;  1PH8 A;  3TS0 A;  4DAM A;  2R92 H;  4JI2 Q;  4DV6 L;  4UP7 A;  1EIF A;  1Q7Y C;  1TXY A;  1NTG A;  1XMO Q;  1B7Y B;  2MQH A;  2VW9 A;  4A3L G;  5AJ3 Q;  2CQO A;  3EN2 A;  1D8L A;  4JV5 Q;  4WJ4 A;  4JI5 Q;  4GKK L;  1YJN A;  1XMQ Q;  3S1R H;  4DR6 Q;  4LUV A;  1SFO H;  2RHS B;  3AFP A;  4NXN Q;  1DGS A;  4A75 A;  1IL2 A;  1HZ9 A;  4DPG A;  2ASB A;  4GOP B;  1LUZ A;  5IP7 H;  4A3E H;  4A3G G;  4UP8 A;  4DR3 Q;  4JI7 Q;  3G48 A;  4GNX C;  2YTV A;  3J80 c;  1B8A A;  5IWA L;  1QVC A;  3HKZ G;  3CC4 A;  4LFB L;  4OXP A;  2VS1 A;  5JEA G;  1KHI A;  1CSP A;  1VS0 A;  3L0O A;  4LWC A;  4IOC A;  2K52 A;  2XTI A;  3BJU A;  3S16 H;  4DV4 Q;  2WB1 G;  2ZJP A;  3KYH C;  4JYA Q;  4JI4 Q;  3HOU H;  1QUQ B;  4P71 A;  4A3M G;  1TWF H;  4DAY B;  3M3Y H;  1XNR L;  4DV3 L;  2IHF A;  4TQU S;  3CAM A;  4FDB A;  2NVY H;  2ZTC A;  3PO3 G;  3J81 c;  1PH1 A;  4QL5 A;  2GN5 A;  2MNA A;  1X3F A;  1SLJ A;  2NN6 G;  4IPH A;  3U4Z A;  1EWI A;  1Y14 B;  4A3I H;  2Z6K C;  1KL9 A;  2JA7 H;  1HNW Q;  5IP9 G;  1GO3 E;  2CFM A;  3PUW A;  3PUZ A;  3CCE A;  4LF8 L;  1QVF A;  1VQ5 A;  4TVA B;  4L5T A;  5DLQ E;  1PH7 A;  1IZ6 A;  3S1N H;  3NEN A;  1VQE A;  3EBE A;  4JI1 L;  1EFW A;  4B3M L;  2F4V L;  4X62 Q;  4JI0 L;  4BA1 I;  3CQZ H;  3H15 A;  2NN6 I;  3S17 H;  4AIM A;  4JI6 L;  1WOC A;  4LF6 Q;  1XTD A;  1A0I A;  3FHW A;  2PQA B;  3FP9 A;  3I56 A;  3RN2 A;  4DV2 Q;  2E2I H;  4JBJ A;  3F1Z A;  5BR8 Q;  5IYB H;  2NZO A;  1OTC A;  4LFC Q;  1VQB A;  4X64 L;  3MXN B;  5GRO A;  1VQ8 A;  2CCZ A;  1N36 L;  3E0E A;  2VQF Q;  1I3Q H;  2Q2U A;  4GN4 B;  3I4M H;  4LF9 Q;  4B3T Q;  1WCM H;  3GO5 A;  1QZH A;  2UUC L;  1NE3 A;  2F52 A;  3UDX A;  2ZJQ A;  2JK8 A;  1K9M C;  3BZC A;  2I5H A;  2IX1 A;  1X6O A;  3GD7 A;  3PCO B;  4JI2 L;  4A3D H;  3HOV H;  4DR4 L;  2UXB Q;  1EUJ A;  1CSQ A;  4KLK A;  1X65 A;  5IE8 A;  4JI3 Q;  1I50 H;  3ER0 A;  3T1H L;  1J5E Q;  1IYJ B;  4NB3 A;  5AJ3 L;  5HY6 A;  4QIW E;  4C3J H;  4DR5 L;  3Q8D A;  5IYC G;  3A5U A;  3EIV A;  1GM5 A;  2Q2H A;  4DR6 L;  1WJJ A;  4NXN L;  2PNH A;  1T9H A;  5M3F G;  4DV1 Q;  4BBR G;  1TWC H;  4A3B H;  4DR3 L;  4JI7 L;  1AH9 A;  2LXJ A;  4A3G H;  3W1G A;  2Y0S G;  4H02 A;  2I5L X;  4IPD A;  3I55 A;  1YJ9 A;  3PIO A;  2PI2 E;  3STB C;  1JT8 A;  2F3I A;  4DV4 L;  4JYA L;  4KI0 A;  4JI4 L;  3MEF A;  1IBL Q;  2EXD A;  4ALP A;  4X65 Q;  3D0F A;  4R4I A;  3HOX G;  1HNZ L;  4KHZ A;  4R4O A;  4LF4 Q;  4K0K Q;  3J80 i;  1E24 A;  5H1S E;  1S40 A;  1VQL A;  3PO3 H;  4UP9 A;  1VQO A;  4GLA C;  1HNW L;  2PQA A;  1LTL A;  3GTO H;  2K5V A;  5HGQ A;  3I4N G;  3CPW A;  1V43 A;  4OWT B;  2UXC L;  4OWW B;  2ZJR A;  4DV5 Q;  5IP9 H;  1U0L A;  2K50 A;  1PH5 A;  5FLM H;  4NXM Q;  1KIX A;  4IPC A;  2E2H H;  1Q8K A;  4X62 L;  1VQ6 A;  3B6Y A;  4A3K G;  4DUZ Q;  1Y1V G;  3J81 i;  2GVB A;  3DLL A;  3RLF A;  3CC2 A;  4OO1 G;  1SE8 A;  2JA9 A;  4DV2 L;  1Q1E A;  3NEL A;  1I94 Q;  4LFC L;  1AE2 A;  4A4I A;  2HIX A;  1C7Y A;  1VQ7 A;  2LSS A;  1D7Q A;  2VQF L;  3U58 A;  2IY5 B;  4LF9 L;  2VUM G;  1X3E A;  2Z0S A;  4B3T L;  2D62 A;  4HJA A;  1HZC A;  1G51 A;  2HHH L;  1KRS A;  1HZA A;  1V9P A;  4OO1 I;  1EIY B;  3OTO Q;  4WJ3 M;  1N34 L;  3T1Y Q;  3CCM A;  4R4Q A;  2R7F A;  3WWV A;  1XNQ Q;  1UEB A;  4MTN A;  4KHP Q;  4PG3 A;  2UXB L;  1YHQ A;  4JI3 L;  5LMU L;  1J5E L;  3CXC A;  2JA8 G;  5GAG C;  3OW2 A;  4LNQ A;  4EQ5 A;  4BXX G;  2R7D A;  2AMC B;  2EIF A;  4YCV A;  1N8R C;  3PUV A;  1TWG H;  2OCE A;  3HFZ B;  1G29 1;  1WI5 A;  5IYC H;  2UU9 Q;  1VQF A;  4DV1 L;  2JEB I;  2R93 H;  3W1B A;  1UE7 A;  1YHB A;  3HKZ E;  4HID A;  1YHA A;  2IHE A;  2RF4 A;  4DR2 Q;  1PHJ A;  1J6Q A;  4BBR H;  1KD1 C;  3H3V I;  2KCT A;  3HKS A;  3U50 C;  3G4S A;  2WFW A;  5ELN A;  1QVG A;  4POG A;  1L1O A;  3F8T A;  1SMX A;  4AYB G;  4BBS G;  1TWH H;  4L5Q A;  1VQP A;  2IX0 A;  5ELO A;  4EX5 A;  3PF5 A;  2AHO B;  1IBL L;  4JOI A;  4LFA L;  2JA5 H;  1XPU A;  2UUA Q;  4YCW A;  4AH6 A;  4X65 L;  4GLX A;  4UY8 C;  4AQY L;  3GTG H;  2E5L Q;  4LF4 L;  4C2M H;  1CKN B;  3HOX H;  1Y1W H;  1I5F A;  4DV0 Q;  4LF7 Q;  1P8L A;  4NPS A;  4RG1 A;  2DGY A;  4JI8 Q;  2ID0 A;  1N32 Q;  1L1O C;  3AQQ A;  3PV0 A;  1PVO A;  1E1T A;  4C3I H;  5FLX c;  2E2J H;  4DV5 L;  4OX9 Q;  3KF8 B;  4DV7 Q;  3KOJ A;  3I4N H;  5M3M G;  4JOI C;  4NXM L;  2MO1 A;  5GAH C;  4B3R Q;  2Q2I A;  3J7Z C;  1QZG A;  3KFU A;  3CME A;  1VQJ A;  1YIT A;  1K0R A;  1HJP A;  4A3K H;  1HZB A;  1A62 A;  1Y1V H;  2JEA I;  3CCL A;  3GTJ H;  4IOA A;  3K8A A;  5IYD G;  5LMN Q;  1YI2 A;  3HOZ G;  1I94 L;  3S1Q H;  2HQL A;  3GTP H;  4A3C G;  1VQD A;  1YNX A;  5JJK A;  3H0G G;  3KDF B;  4L5S A;  4BY7 G;  4MZ9 A;  3M4P A;  2B63 G;  2XGT A;  1VQC A;  1BBU A;  1XPO A;  4LF5 Q;  2K5H A;  5M5W H;  2YV5 A;  2VUM H;  4GOP A;  1Q81 C;  2R7Z G;  3L2P A;  3F2B A;  1WYD A;  3OTO L;  3K80 C;  3RN5 A;  3T1Y L;  2A1A A;  1XMO L;  1XNQ L;  1NJI C;  1OXV A;  5LMN W;  4KHP L;  3TQY A;  4A3L H;  4ME3 A;  1E7Z A;  1K8A C;  4JV5 L;  3H3V H;  4JI5 L;  2OQ0 A;  5C3E G;  1XMQ L;  4GKJ Q;  2NZH A;  3I4O A;  4DKA C;  2JA8 H;  3STB D;  4A93 G;  2KEN A;  1QUQ A;  4GN5 A;  4BXX H;  4GOP C;  4QQB X;  5JJL A;  2UU9 L;  3D31 A;  5IY0 A;  3K81 C;  5FJ8 G;  4DUY Q;  3PSI A;  3CC7 A;  4XTC S;  2K75 A;  2R92 G;  2N8N A;  1EOV A;  1P16 A;  1PH3 A;  1V1Q A;  4DV6 Q;  4JC0 A;  5C0X G;  1SRU A;  4HJ7 A;  1X54 A;  2BH2 A;  1JB7 A;  1JMC A;  1UWV A;  1BKB A;  3JAM c;  1Q1B A;  1YZ6 A;  1HR0 Q;  1A8V A;  1JE5 A;  5IT9 c;  3CCS A;  4A3F G;  4QGU A;  3UE1 A; 
#chains in the Genus database with same CATH topology
 1IYV A;  4I7Z C;  4V19 0;  3M4Q A;  1MKH A;  1N9W A;  2E5L L;  1IHZ A;  2V1C C;  4GNX B;  4GN3 B;  3AEV A;  4RAU C;  1E1O A;  1M90 C;  1HR0 W;  2JA5 B;  4OX9 L;  5C5M A;  4DV7 L;  2CKZ B;  1HQR D;  2F0K A;  3Q22 A;  2DUD A;  5M3M H;  1TKW B;  3J7A 5;  1VQI A;  3VR4 A;  4O0A A;  3BDL A;  1D2B A;  3T16 A;  1KRT A;  1G6P A;  1LAB A;  2E2J B;  2JA7 G;  3NQI A;  3CHB D;  2QA4 A;  5BR8 L;  2N55 A;  3G71 A;  3A74 A;  1CKO A;  4J15 A;  2EDG A;  3E3X A;  2N3S A;  3S1M H;  4GZY C;  1Y1V B;  2B63 H;  4LUZ A;  1HRJ A;  1A63 A;  3PIP A;  1PH4 A;  4H44 C;  3J7A F;  2R7Z H;  1IBM Q;  2KCC A;  4DK6 C;  2OWO A;  1GJX A;  5IYB G;  1E22 A;  1WVL A;  3ND8 A;  4G7H C;  1IW7 C;  3HOW G;  5HUR A;  3H09 A;  4P74 A;  2OTL A;  2C35 B;  2RVL A;  1LT6 D;  3SE0 A;  4DUY L;  3UDI A;  5KGU A;  3M4O H;  3GTK H;  1KC8 C;  1TY2 A;  2HCC A;  4C1N I;  1PFN A;  4GNX A;  4ODG A;  4AYB E;  4DR4 Q;  1EOT A;  3S24 A;  2YTX A;  5G3L F;  2RSN A;  4HIM A;  1HR0 L;  4KKU A;  1YVC A;  4A3F H;  2UUB Q;  1X3G A;  1UEA B;  3T4A C;  4IUV A;  4A3B G;  2B8F A;  3Q6S A;  4RA8 A;  4J1M A;  1PZJ D;  4IUU A;  3SEB A;  2F0D A;  5D3D A;  1H9S B;  4AYB B;  3RZD H;  4XT1 B;  2KED A;  5IGC A;  1OXX K;  5C0X J;  3A5Z B;  3ZYY X;  1N33 L;  1C4Q A;  2SDF A;  2F0Q A;  3ULJ A;  1XPR A;  3R3O A;  4PZ7 A;  1EL0 A;  2ZTD A;  1CTM A;  3JC6 6;  5M3M B;  2R6G A;  3K7U C;  2K33 A;  3AYH B;  5FLM G;  1JJC B;  2EJM A;  1SNP A;  3ICE A;  2QGQ A;  2PYK A;  4G4K A;  1CA6 A;  2WAC A;  3HGB A;  3S1M B;  1HHV A;  4QUC A;  1D5X C;  2B63 B;  3MVV A;  3IFT A;  4IFD J;  5EJW A;  5CV9 A;  4A76 A;  3HOW H;  4JBK A;  1NSN S;  2R7Z B;  1DOM A;  1Q82 C;  1SR3 A;  2MO0 A;  3RUZ A;  3Q23 A;  2L0C A;  4HR7 B;  3J81 j;  1VQM A;  5CV6 A;  3L7Z C;  4LJZ C;  1BBX C;  3TRE A;  4POF A;  1TS4 A;  4OON A;  5LMU Q;  1QWY A;  4C3H H;  2IW3 A;  3D3R A;  5EPL A;  3S15 H;  3M4O B;  2K01 A;  1VQH A;  2UUA L;  4A3E G;  3GTQ H;  3GTK B;  1PFM A;  5LL6 X;  1I6H H;  2R93 G;  1NBW A;  2N49 A;  3FPP A;  1JR0 D;  4YCU A;  4DR7 L;  3BZD B;  1VCI A;  4IPG A;  5IWA Q;  4LFB Q;  1PYS B;  2A19 A;  3BVM A;  4IUP A;  1JOR A;  1PRT F;  2NVX H;  1SAP A;  4A3F B;  1K28 A;  2PQE A;  1SYF A;  1HNX L;  4HJ8 A;  3GTL H;  2F0H A;  2A69 D;  1S5F D;  1L2F A;  1BCP B;  3CCR A;  2TSS A;  3A8I E;  1H9M A;  1PV4 A;  2JE6 I;  1WFQ A;  1MGS A;  2JN4 A;  2MP1 A;  1Q86 C;  3RZD B;  3QB3 A;  1JWU D;  1HTP A;  5IYD H;  2HIV A;  3R2I A;  3P1H A;  4X3K A;  4XYQ A;  2A8V A;  5K36 G;  4PMW A;  1STN A;  4HMI A;  1VMP A;  1Z9F A;  5AFW A;  2RDH A;  3NQT A;  5D3I B;  3E9H A;  3DUZ A;  4X64 Q;  4CHT B;  5M9O A;  3NEM A;  1R4Q B;  1BCP D;  1L0W A;  2A6H C;  2ZXO A;  4JW0 A;  2J4X A;  4LAA A;  5GQO A;  1PH8 A;  1RTN A;  2D9U A;  1EIF A;  2RSO A;  3HG9 A;  1Q7Y C;  1TXY A;  3SDZ A;  1B7Y B;  4HED A;  3HOW B;  3JAM E;  3EN2 A;  1D8L A;  4QF4 A;  2K5D A;  3CRK C;  1XMQ Q;  3I91 A;  1SFO H;  2RHS B;  3AFP A;  4NXN Q;  4H0L C;  2B2Y A;  5ELF A;  4A3E H;  4A3G G;  3W3A A;  1DJR D;  1VMC A;  2BDN A;  1ONL A;  4C3H B;  1DOL A;  1T5E A;  3A7L A;  3FVQ A;  1F9S A;  5ELE A;  4BBS B;  1KHI A;  1VS0 A;  2WIN B;  4PV1 C;  4IOC A;  1I6H B;  3BJU A;  1FNW A;  2J0T D;  4RGO S;  1X3P A;  1QUQ B;  4A3M G;  1TWF H;  3VYU A;  3M3Y H;  2NWG A;  4ZKB B;  4DV3 L;  2AQ3 B;  3J81 c;  4ZAI A;  1XYI A;  2FFK B;  4QL5 A;  2NVX B;  2NN6 G;  4IPH A;  2Z6K C;  3LX0 A;  3PIP 3;  4HSP A;  3GTL B;  2L1B A;  1GUO A;  5CV8 A;  2JYO A;  4V0B A;  2HD3 A;  4TVA B;  1O7L A;  1VQ5 A;  1IZ6 A;  3WOE A;  3EBE A;  1EWC A;  1EEF D;  5K36 H;  4K5V A;  2NN6 I;  1PFB A;  4AIM A;  4JVZ A;  3LWE A;  1HA5 A;  4JI6 L;  3A8K E;  2BE5 D;  1GUS A;  1XTD A;  2PQA B;  4XQJ A;  2F0S A;  3I56 A;  2E2I H;  3NHH A;  2LMC B;  1VQB A;  3MXN B;  3VR5 A;  2CCZ A;  1SEB D;  3EJI A;  1WCM H;  3VR2 A;  4M1U B;  1NE3 A;  1JWM D;  1Y8N B;  2JK8 A;  2IX1 A;  4DR4 L;  5E3F A;  1EUJ A;  4RGM A;  4Q5V A;  4DU9 A;  1IYJ B;  5AJ3 L;  5HY6 A;  4QIW E;  4KN7 C;  3A5U A;  3EIV A;  1CA5 A;  1BDO A;  2Q2H A;  1GM5 A;  3J7A V;  4TSS A;  1A15 A;  2DNC A;  4DV1 Q;  4LMQ D;  1WTW A;  1GHJ A;  4DR3 L;  1HFG A;  1I6V C;  2PZW A;  1FNV A;  4TKO B;  3W1G A;  4A3G H;  2X6L A;  1K83 B;  4H02 A;  2I5L X;  1SYB A;  1DOK A;  3NUC A;  1U4L A;  3R8B A;  4DV4 L;  4A3E B;  4QIW B;  4JYA L;  4KY5 A;  4PNY A;  1IBL Q;  1H9K A;  2EXD A;  4NKL A;  1RJT A;  4O42 A;  4K0K Q;  4LF4 Q;  3PMF A;  1S40 A;  5C4X B;  4TRD A;  4GLA C;  1HNW L;  2PQA A;  2NN6 H;  3CPW A;  2AUJ D;  1TWF B;  2PW5 A;  4F8M A;  4DAV A;  2ZJR A;  1KDA A;  4OWW B;  3BG3 A;  1PH5 A;  4RWS C;  4CJ1 B;  4X62 L;  1VQ6 A;  4A3K G;  4DUZ Q;  1C8C A;  1H9J A;  3RLF A;  1YNN C;  2JA9 A;  2WKD A;  4DV2 L;  1Q1E A;  1I94 Q;  1NUC A;  5IGF A;  2PPB C;  3J7Y W;  4FF2 A;  3J80 L;  4FP5 D;  2E2I B;  1EIY B;  3BS1 A;  3DMU A;  3T1Y Q;  2UXB L;  2WKC A;  1UEB A;  4KHP Q;  3HS0 C;  5LMU L;  5GAG C;  3OW2 A;  1WCM B;  2ZXR A;  1TS3 A;  4BXX G;  2IJ0 A;  5IGB A;  2JEB I;  1YHB A;  4HID A;  2B2T A;  1PHJ A;  2A6E D;  2RDF A;  3U50 C;  2F0L A;  2WFW A;  3NBH A;  2IX0 A;  3PF5 A;  1XWE A;  2AHO B;  4A3G B;  4GLX A;  5CR3 A;  3MEH A;  2B2T C;  2E5L Q;  1EQV A;  4DXG A;  4NPS A;  5JJZ A;  1VF5 C;  1T5X D;  1TVX A;  3G7L A;  2MUY A;  1U4P A;  4OX9 Q;  4DV7 Q;  4K5X A;  1CZW A;  1UNS A;  2E76 C;  2Q2I A;  3J7Z C;  1QZG A;  3C2P A;  1TR5 A;  1YIT A;  3H6M A;  3W2D A;  4A3K H;  2EY2 A;  3V2T A;  2MHV A;  3QO2 A;  3GTJ H;  4L8J A;  2XWJ B;  2V4D A;  5E4W C;  2ZXP A;  1ZYR C;  4DA2 A;  3KDF B;  4BY7 G;  3M4P A;  1BBU A;  1OO9 B;  4G7Z C;  1CQV A;  3L2P A;  3F2B A;  3OTO L;  1XNQ L;  5LMN W;  4UHV A;  2RKS A;  1BCP F;  1E7Z A;  3T56 B;  5C3E G;  2OQ0 A;  1XMQ L;  2NZH A;  2A68 D;  4J8Q A;  2KEN A;  1LV9 A;  4BXX H;  4KK7 A;  1MHW C;  1GUG A;  5IY0 A;  3K81 C;  4DUY Q;  3QWN A;  3CC7 A;  4XTC S;  2K7V A;  2K28 A;  4S3S A;  2R92 G;  4XDX A;  2N8N A;  2XWB B;  4JC0 A;  5C0X G;  1G2S A;  1E0B A;  3BVG A;  4HJ7 A;  2XNA C;  2A5H A;  1BKB A;  4IZ8 A;  1HR0 Q;  1A8V A;  1JE5 A;  3MFG A;  1ET9 A;  1B70 B;  1A3V A;  4KHV A;  4CDE C;  5C0X I;  1GUT A;  3UDF A;  1Q90 A;  1VDZ A;  3HOU B;  5L37 A;  3LWU A;  1CM9 A;  4OHJ A;  1JOO A;  1X55 A;  2KEE A;  2NVY B;  4X6A H;  3TP5 A;  1N33 Q;  1BO0 A;  1QIL A;  2VY3 A;  1YIJ A;  4KTA A;  4QCL A;  5LMN L;  3HZX A;  4P72 A;  4IFD G;  1SMY D;  1F2M A;  2IWH A;  5DNF A;  5BN4 A;  1AE3 A;  2QEJ C;  1CHQ D;  4A3K B;  1Z7T A;  4GLV B;  4N9T A;  2L12 A;  4JI1 Q;  3GTJ B;  1IYU A;  4YIJ A;  1KTK A;  4DNI A;  3VA7 A;  2F0P A;  4IFD I;  3IL8 A;  2Q2T A;  4KMU C;  2F0F A;  3I4M G;  1E2W A;  3MFY A;  5C3E H;  1EQR A;  3H94 A;  1I4P A;  4FXK C;  4LW1 A;  3ULP A;  2UUC Q;  2O4X A;  5FLX L;  1JE4 A;  3TZD A;  3PQI A;  1UE1 A;  3RNU A;  5C0X H;  2L55 A;  1TWA H;  3FPU B;  4IUN A;  2PI2 A;  5KNB A;  5COR A;  1LO5 D;  1PTO D;  2EVB A;  4JPB W;  4K0K L;  2F1M A;  3CD6 A;  3ERS X;  4IUQ A;  2N78 A;  4DR7 Q;  2E74 C;  2G5D A;  3MXG A;  4IUR A;  4DK3 C;  2EJG C;  2HDM A;  4BS9 A;  1JIC A;  3JAM i;  3KJP A;  1HNX Q;  2OQK A;  1D5M C;  2YTY A;  4R4T A;  1C48 A;  4HN7 A;  4DUZ L;  2AWO A;  4R1J A;  1TII D;  4N8F A;  3M4Y A;  1LLR D;  3I7F A;  1FVI A;  3C1E A;  4IFD H;  1PRT C;  1BQQ T;  2ICE C;  1IBK L;  3KLR A;  2KHJ A;  1KDB A;  4RCO A;  5EKL A;  5C3X A;  5EAY A;  3F2U A;  1U4R A;  3HP3 A;  4IJL A;  4YY3 L;  2HQE A;  2YU9 H;  2VXW A;  1KLG D;  1VQK A;  2FHT A;  1JJG A;  2Y0S E;  4APV A;  1TS2 A;  2BA1 A;  1CKN A;  1EY4 A;  4CDC C;  1S3O A;  5I9P A;  1JQY D;  3E6Z X;  1SRO A;  1ESF A;  1PZI D;  1R9T H;  5C3E B;  3M7N A;  1H95 A;  1AN8 A;  3MAQ A;  1RTO A;  5KRU A;  5IP7 G;  2VQE L;  1XX8 A;  4QB4 A;  2F0I A;  4OL7 A;  2SNM A;  1VQ9 A;  2Y0S B;  1XTC D;  1PH2 A;  2EQS A;  1BUV T;  1W2B A;  1KQS A;  5BN3 A;  3OPO A;  2CWP A;  3ZJY C;  1KNE A;  1J8I A;  4XIG S;  3U9S A;  4EVO A;  3S2H H;  1MJC A;  4FXD A;  3SGI A;  3OYY A;  4LFA Q;  2RCF A;  4C56 C;  4DV3 Q;  2NZ1 D;  3GV3 A;  3AFQ A;  4FF3 A;  1Y1W G;  3MXP A;  4P75 A;  2EE1 A;  3QOL A;  3KUP A;  5FO9 B;  1JB3 A;  3RLO A;  4NMZ A;  2BA0 A;  2RHQ B;  2AQ1 B;  1L1O B;  3CCJ A;  1LAC A;  3S14 H;  1IW7 D;  1FJG L;  2OF1 A;  2JXM B;  4JCV E;  2WAQ G;  2UXD L;  3S1Q B;  2K5N A;  1MJE A;  4B3S L;  4JI6 Q;  1HFN A;  1SJH D;  4O2D A;  2OT2 A;  2JJQ A;  3NTK A;  1NNX A;  2I5M X;  1UE5 A;  3PIO 3;  1WTH A;  1W3S A;  4IO9 A;  3QG1 A;  1ASZ A;  2GVA A;  3K5N A;  1PH6 A;  2EZV A;  4DAM A;  3TP7 A;  1NR4 A;  3P20 A;  1XMO Q;  3K57 A;  1O7Y A;  4F7X A;  5AJ3 Q;  3ERQ A;  3OMC A;  2CQO A;  5IT9 E;  4NDX A;  4JV5 Q;  4JI5 Q;  1EYD A;  4GKK L;  3S1R H;  4LUV A;  1DGS A;  1B4O A;  4KD4 A;  4GOP B;  1LUZ A;  5IP7 H;  1R9T B;  4DR3 Q;  2F0U A;  4GNX C;  4XQQ A;  2YTV A;  1B9N A;  3J80 c;  1TY0 A;  5F2D A;  3E0J A;  4QMG A;  4LWC A;  2XTI A;  4CKE A;  4DV4 Q;  2WB1 G;  4JYA Q;  2F3W A;  1FGB D;  1JCK B;  1QJO A;  2F0W A;  4DAY B;  1XNR L;  4KJO A;  1KNA A;  1PH1 A;  1GHK A;  1AW7 A;  2MNA A;  1X3F A;  3S2H B;  2JA7 H;  3ERO A;  1KL9 A;  1HNW Q;  5IP9 G;  1GO3 E;  2CFM A;  3PUW A;  1AZQ A;  3CCE A;  3KBX A;  4DNT B;  4JI1 L;  4CKB A;  4B3M L;  4X62 Q;  1ENF A;  4JI0 L;  3S17 H;  3NTI A;  5A2Q E;  1WOC A;  1MI2 A;  2F0V A;  2N88 A;  4KKT A;  1LT5 D;  4DV2 Q;  3S14 B;  5IYB H;  1QNK A;  1VQ8 A;  4BWG B;  1N36 L;  3T13 A;  1BOS A;  3GO5 A;  1QZH A;  2UUC L;  3UDX A;  1G91 A;  2I5H A;  3H3V C;  3U9O A;  3PCO B;  2ZT9 C;  2UXB Q;  4KLK A;  1EY0 A;  5IE8 A;  4XT3 B;  3ER0 A;  1H9S A;  3NPP A;  3MHB A;  3OSO A;  4NB3 A;  2KCN A;  1VF7 A;  3R93 A;  5C6A A;  4DR6 L;  5J1Z A;  2PNH A;  2Z4H A;  3C3L A;  5M3F G;  4DAY A;  5CV4 A;  4BBR G;  5J39 A;  4R8I A;  4A3B H;  3OIQ A;  3NXW A;  4HCS A;  1M8A A;  3S1R B;  2WII B;  1PTO F;  2FJ2 A;  3STB C;  4DK0 A;  4JI4 L;  3A56 A;  1IL8 A;  4ALP A;  4ZYS A;  3D0F A;  3HOX G;  4R4O A;  4FF1 A;  2F0T A;  1VQL A;  1O7Z A;  1WD1 A;  5JVH 3;  1DD2 A;  1V43 A;  3OHX C;  3ONA B;  5IP9 H;  1F77 A;  5EKK A;  5FLM H;  2E2H H;  2EYL A;  5IOC A;  2A6H D;  2LFN A;  2NTT A;  2JA7 B;  3B6Y A;  5CV5 A;  1EZ8 A;  2B2U A;  2F0J A;  3H91 A;  3DHQ A;  1VQ7 A;  1QCB D;  3S17 B;  1ET6 A;  2IY5 B;  2NB0 A;  2LY7 A;  4LF9 L;  2Q8T A;  2VUM G;  4B3T L;  1DM0 B;  4HJA A;  1G51 A;  5EBC A;  3OTO Q;  2QF7 A;  3CCM A;  2PZU A;  2R7F A;  1XNQ Q;  2XRS D;  2H1E A;  1CT1 D;  4JI3 L;  4HCE A;  3DWQ A;  2CHB D;  3SK5 A;  1UUP A;  2R7D A;  1TWG H;  2OCE A;  4I65 A;  2R93 H;  2EJF C;  3O13 A;  4DR2 Q;  4BBR H;  3S15 B;  3KK7 A;  1RD9 D;  3ND9 A;  5ELN A;  3EQL C;  3I8Z A;  3GTQ B;  1PYW D;  3F8T A;  1WTQ A;  1BCP C;  1TWH H;  2B2Y C;  4L5Q A;  3VYR A;  4C1N K;  5ELO A;  1VQP A;  4LFA L;  4A3B B;  1V8Q A;  5LHY 1;  3SR1 A;  4K2K A;  4YCW A;  3GTG H;  1Y8O B;  5HGT A;  1GUN A;  3HOX H;  4ME5 A;  4WRD A;  1LTB D;  3DXJ C;  4XQN A;  4DV0 Q;  2G9D A;  2CW0 C;  3CU7 A;  2ID0 A;  3AQQ A;  1EY5 A;  1SNC A;  5FLX c;  3KF8 B;  3T53 B;  4NXM L;  2MO1 A;  4FVM A;  4F87 A;  2EOT A;  3V96 A;  4B3R Q;  1RKN A;  3KFU A;  3CME A;  1HJP A;  5DEH A;  2JEA I;  2HUG A;  4FYD A;  3CCL A;  4CKC A;  4KJN A;  5LMN Q;  1WD0 A;  2E2H B;  3GTP H;  1YNX A;  1F2L A;  3H0G G;  4MZ9 A;  5IGG A;  2XGT A;  1XPO A;  2K5H A;  1M4V A;  2VUM H;  4H7B A;  1NAP A;  3K80 C;  5I6W A;  1XMO L;  3N6R A;  1OXV A;  1EQT A;  5NUC A;  4JV5 L;  4JI5 L;  1JWS D;  3I4O A;  4ILW A;  4ZUI A;  2JSO A;  4DKA C;  2M00 A;  4A93 G;  1QUQ A;  3FDT A;  1EU3 A;  1BNZ A;  2UU9 L;  3S9W A;  4L63 B;  2F0M A;  2F0O A;  2K75 A;  1ESR A;  3IKJ A;  1P16 A;  4UAI A;  3MTS A;  4DV6 Q;  1SFO B;  1SNM A;  1X54 A;  1TWG B;  2PO4 A;  1JMC A;  5I4D A;  2D5D A;  1Q1B A;  1YZ6 A;  2R93 B;  1FGU A;  4OGQ C;  4BBR B;  4A3M H;  1X56 A;  3VDY A;  3SK6 A;  5J22 A;  3J81 E;  1A3U A;  1BXT A;  1PFS A;  3URY A;  4LF7 L;  2VB3 X;  5ELD A;  1Q46 A;  1YNN D;  2K6A A;  2HT1 A;  1S72 A;  3M3Y B;  3MXN A;  1O7I A;  1R4P B;  4DF7 A;  1LM0 A;  1C9O A;  3GTG B;  1SSO A;  2I0Q A;  3HOX B;  5DM7 3;  4M8A A;  5A2Q L;  1B53 A;  5KND A;  1E3P A;  2MPM A;  3UI2 A;  4WFN 3;  2VZA A;  3CP0 A;  4UDU C;  2Z4I A;  4OEL B;  1SNQ A;  1DON A;  4UPA A;  1ASY A;  3OMG A;  3AU7 A;  4RCN A;  2DNE A;  1IBK Q;  3H0G H;  1NY4 A;  2NTS A;  3K0Y A;  3M85 A;  3FKI G;  1PA6 A;  3HRZ C;  5M5Y H;  4B9W A;  3GTP B;  1KAB A;  3D4D A;  4EQP A;  3VR3 A;  4YY3 Q;  4GKJ L;  1IXR A;  4QY7 A;  2K4K A;  2L11 A;  2KUM A;  1KXL A;  3I4L A;  4JK1 C;  3CCU A;  3TRZ A;  1GVP A;  1VQG A;  2AUK A;  4OEM B;  2BOS A;  3X3N A;  1ICF B;  3T1H Q;  4NW2 A;  5C4J H;  2JQO A;  4LF6 L;  4DR5 Q;  1UAP A;  1AEX A;  2AKW B;  2VQE Q;  2G9H D;  1SYD A;  4E6I A;  2B2W A;  5IOD A;  3TSS A;  2JA6 G;  3PO2 G;  2F3V A;  5CC4 A;  2MGS A;  3MWY W;  1K73 C;  5ISR A;  3K58 A;  1HTL D;  4A3M B;  1L0Y B;  1EY8 A;  4P73 A;  1ZYR D;  1K3R A;  3BYT B;  3LGJ A;  1VQA A;  1EQQ A;  3CMA A;  5ELC A;  2BH8 A;  2A6E C;  3CPF A;  1F2Z A;  1PTO H;  3TP6 A;  4BY1 G;  2D0O A;  4ZQ3 A;  4IJH A;  3NP8 A;  3NE5 B;  1PYB A;  2SEB D;  2YYZ A;  3CW2 C;  4HAE A;  2UXC Q;  2RDG A;  4XXE A;  5DM6 3;  1FJG Q;  2UXD Q;  2KVM A;  3K59 A;  2F0N A;  4DR1 L;  4B3S Q;  1MSG A;  3C1F A;  2IPK D;  3VA5 A;  3FKI H;  3JAM L;  2CH4 A;  3U4V A;  3CCV A;  1O78 A;  3OIP A;  1YJW A;  1MD2 D;  4CBV A;  3H0G B;  2L15 A;  3A0J A;  5T1G A;  1PH9 A;  4BA2 I;  3RR5 A;  2MJ8 A;  2AQ2 B;  4X66 L;  3X3M A;  5M5Y B;  4YHH L;  1TS5 A;  4DR2 L;  5CGK A;  2HHH Q;  1NMF A;  4KY7 A;  1U5K A;  2QDB A;  1I4H A;  1OXU A;  2D2C C;  1JOK A;  1LTA D;  4B08 A;  2CWA A;  1W6J A;  4K8I A;  1QG7 A;  4GKK Q;  4G57 A;  2O2L D;  2O5J C;  3GDE A;  3TS2 A;  2VNU D;  1FD7 D;  3SK8 A;  1LTI D;  5JPM C;  1EFI D;  3SVM A;  3G6E A;  4DV0 L;  1M1K C;  2JA6 H;  5C4J B;  3PO2 H;  3BU2 A;  5KYI A;  3C46 A;  3PF4 A;  1JC7 A;  2XIW A;  2NVT H;  1OXT A;  4RMF A;  4LUO A;  3KDF A;  2Q8I B;  4CJ0 B;  2I07 B;  3OWF A;  3IAY A;  2VL6 A;  4B3R L;  4K6D A;  3KJO A;  2ZM6 L;  1EYG A;  2JA5 G;  3PUX A;  2H5X A;  1XNR Q;  4DAP A;  1SYE A;  1UE6 A;  1WTR A;  2AWN A;  1FYC A;  1BF4 A;  1ILQ A;  4BY1 H;  3CRL C;  2F0G A;  4PZ6 A;  2PMZ E;  1F9P A;  1HXY D;  3I3C A;  5E7N A;  2EXZ A;  3FRP B;  4J6H A;  4BY7 H;  3DM1 A;  4B3M Q;  1LTT D;  1PTO B;  3I73 A;  4JI0 Q;  4G7O C;  2WP8 J;  3CKI B;  1PXU A;  5K5P A;  1OXS C;  2DJF C;  1V1P B;  3OW7 A;  4EGV A;  1N36 Q;  3I2Z A;  4HIO A;  2EYP A;  2QEX A;  3UDG A;  1GD7 A;  2PMZ B;  4YWL A;  2CH4 W;  2EYJ A;  2H4O A;  1SJE D;  3QOJ A;  1YBY A;  3QR8 A;  3NWT A;  4OIK A;  4JBM A;  5C4H A;  1CFM A;  2R92 H;  5IGD A;  4DV6 L;  4UP7 A;  2Z8L A;  1NTG A;  2O5I C;  4A3L G;  2MQH A;  4C3J G;  1ILP A;  4WJ4 A;  4DR6 Q;  2NUC A;  4A75 A;  1IL2 A;  4ZCK A;  4DPG A;  2ASB A;  2QDL A;  1LTG D;  4K6L A;  2TMP A;  4FXG C;  1CK1 A;  1B8A A;  1Y8P B;  2M9V A;  1D6E C;  4OXP A;  5JEA G;  3S16 H;  1CSP A;  5FK9 C;  3L0O A;  1LTS D;  4RFB A;  2F4I A;  5EBD A;  1ROD A;  4JI4 Q;  1MSH A;  4KD3 A;  4P71 A;  2JA6 B;  1CZG A;  5C5L A;  3CAM A;  4FDB A;  1STG A;  2ZTC A;  4R9W A;  2NVT B;  4K5W A;  1SLJ A;  3U4Z A;  1Y14 B;  3D8G A;  3PUZ A;  4LF8 L;  1QVF A;  4QUF A;  1ENA A;  5DLQ E;  1PH7 A;  3DEO A;  1GOZ A;  3N52 A;  1FNU A;  1V1O A;  2F4V L;  5CV7 A;  2K04 A;  3H15 A;  1O80 A;  4IN3 A;  3BVZ A;  1F9Q A;  4BY1 B;  1DXM A;  2RBM A;  3FP9 A;  3RN2 A;  4JBJ A;  4BY7 B;  1SYC A;  4FNF A;  1YNJ C;  3I4M H;  1WTV A;  4GN4 B;  5BN5 A;  4U67 3;  4LF9 Q;  3T51 B;  4B3T Q;  2NBF A;  5I6Y A;  2ZJQ A;  3BZC A;  2CVR A;  1X6O A;  4JI2 L;  1U9R A;  4JI3 Q;  1I50 H;  3T1H L;  3E5S A;  4C3J H;  4DR5 L;  3Q8D A;  1WJJ A;  1ZXT A;  2R92 B;  3K5O A;  1TWC H;  2QW7 A;  4JI7 L;  1TWA B;  1AH9 A;  1CI3 M;  1HUN A;  2PW7 A;  4IPD A;  3I55 A;  1JT8 A;  2F3I A;  3DWP A;  2XVS A;  4H13 C;  1CQF A;  4R4I A;  4KHZ A;  3S16 B;  4C3I G;  1LTL A;  3GTO H;  2K5V A;  4WJW A;  5HGQ A;  3I4N G;  2UXC L;  4OWT B;  2IX3 A;  1JOQ A;  2K50 A;  1I4Q A;  5CBE E;  4NXM Q;  5KNC A;  1KIX A;  4IPC A;  2GA4 B;  1Q8K A;  4HSV A;  1XXG A;  3VYT A;  2XRQ D;  3J81 i;  3DLL A;  3ITP A;  1SE8 A;  3EVQ A;  3NEL A;  2K32 A;  4LFC L;  1G2T A;  1DCZ A;  2HIX A;  1C7Y A;  2LSS A;  4ZUJ A;  2VQF L;  4IUT A;  1PDQ A;  1A2T A;  2Z0S A;  2D62 A;  2HHH L;  1V9P A;  1HZA A;  1PLF A;  5EPK A;  4KN4 C;  2YU9 B;  5IGE A;  2XSC A;  3I4M B;  1YHQ A;  2ENB A;  3KLS X;  4KY6 A;  1J5E L;  3CXC A;  2JA8 G;  2Z1C A;  1D1I A;  4EQ5 A;  4RKB A;  2AMC B;  1N8R C;  3PUV A;  2UU9 Q;  3K6O A;  3W1B A;  2J7Z A;  1I50 B;  1QOH A;  1KD1 C;  3Q0A A;  4C3J B;  2F03 A;  4PMB A;  2EY5 A;  4K14 A;  1L1O A;  4C3H G;  4BBS G;  1TWC B;  4JOI A;  1XPU A;  3MA2 B;  4UY8 C;  4X65 L;  1HUM A;  4C2M H;  5C4Z A;  1Y1W H;  1K0S A;  3D4R A;  1P8L A;  2Q8R E;  2B8G A;  4LF7 Q;  1L1O C;  1PVO A;  3PV0 A;  1TT2 A;  4C3I H;  4DV5 L;  3KOJ A;  3I4N H;  4JOI C;  1KLU D;  3NTH A;  1K0R A;  3GTO B;  4L6T B;  1A62 A;  4LK1 C;  4IOA A;  1Q3L A;  3K8A A;  5E4X A;  5IYD G;  2HQL A;  5KIX A;  5FKA C;  3L9A X;  4A3C G;  5JJK A;  4L5S A;  4CDD C;  1B3Q A;  3P75 A;  3V05 A;  5M5W H;  4GOP A;  1Q81 C;  5EQ0 A;  2SNS A;  1WYD A;  1B50 A;  1ENC A;  3RN5 A;  3DWA A;  3MXU A;  1EY6 A;  3TQY A;  2K5W A;  4RHS A;  4ME3 A;  5I2Y A;  1K8A C;  4GKJ Q;  1WTP A;  4K2L A;  1E2V A;  2JA8 H;  2DY7 A;  3STB D;  3A54 A;  4GOP C;  1GXD C;  5JJL A;  2K03 A;  3D31 A;  1EU4 A;  5FJ8 G;  1BR9 A;  4CDF C;  1Q8I A;  1EOV A;  3J80 E;  4RHR A;  4ZLT F;  2EYH A;  1PH3 A;  3KLS A;  2I46 A;  2BH2 A;  1PZK D;  2K1B A;  2A73 B;  1UWV A;  3JAM c;  3I70 A;  4LF6 Q;  4QGU A;  3UE1 A;  2HDL A;  4BBS H;  1CKM A;  2OXP A;  2MFI A;  2R61 A;  2LS0 1;  2SOB A;  4JI8 L;  2ATW A;  2NVQ H;  2IT1 A;  1N32 L;  2D0P A;  2WAQ E;  5C4X G;  4ZKC B;  2ALY B;  3M9B A;  5JEA J;  5GAE C;  4C2M B;  3K7A H;  1Y1W B;  5GAD C;  1CHP D;  2PZT A;  3TN2 A;  1EZ6 A;  3E9I A;  4Y52 H;  1STE A;  2BCO A;  4C3I B;  1YEZ A;  4Y7N H;  1JJ2 A;  4A3J G;  1X3Q A;  4N8X 1;  3I4N B;  3PUY A;  2B2V A;  1I4R A;  3I90 A;  4ZK9 B;  2WAQ B;  2A69 C;  5C44 G;  4PMC A;  1RIP A;  3GP7 A;  4A3C H;  1RCV D;  4HIK A;  1LT4 D;  4LF5 L;  2CQA A;  1II3 A;  2B3G A;  2B2U C;  4DR1 Q;  3K0X A;  2B2V C;  1VQ4 A;  1TU2 B;  2FMC A;  3LNN A;  3RD4 A;  1DZ1 A;  5M5W B;  1FR3 A;  3RLN A;  3SXH A;  1WCM G;  4X66 Q;  4JG2 A;  3IFD A;  2QCP X;  4K8J A;  4YHH Q;  1SE4 A;  5M3F H;  4HJ9 A;  5FJ8 H;  1B3A A;  2WB1 E;  2K14 A;  1SNO A;  4MTK A;  2JA8 B;  1FL0 A;  2CW0 D;  1K83 H;  1CUK A;  1B1Z A;  3TEH B;  1SN8 A;  1G6Z A;  1GKH A;  5I2X A;  3GTM H;  5JJI A;  4IQZ A;  4RGN A;  3PGZ A;  3UE0 A;  1SE2 A;  2B29 A;  3W5O A;  2WB1 B;  1RDP D;  2Z6K A;  3DEP A;  4PZ8 A;  4KV6 A;  5T1I A;  5C4X H;  3HOY G;  2ZM6 Q;  4HJ5 A;  2FXQ A;  3TZU A;  4L5R C;  4DXF A;  4P2C B;  2ES2 A;  4DN4 M;  1HNZ Q;  2NVQ B;  4U68 A;  2KHI A;  2FIN B;  4HMJ A;  1SXT A;  3AMU A;  5J3B A;  4A3J H;  3K7A B;  4YWK A;  5C44 H;  3S2D H;  1I4G A;  4Y7N B;  2LXK A;  4ZRZ A;  4DK1 A;  3RZO H;  2EYO A;  1LT3 D;  3F2C A;  1IBM L;  5IT9 L;  3EFX D;  1Z47 A;  1K8G A;  1SYG A;  4HTH A;  3NK9 A;  3RMH A;  4I7A A;  3SK4 A;  4MNO A;  4QJF A;  1VQN A;  1BVS A;  1LYL A;  1Q12 A;  3D6C A;  3L3O C;  1B9M A;  3KF6 B;  3HOZ G;  1B2T A;  4YWM A;  2BE5 C;  2L4N A;  3F2D A;  3KLW A;  2NYZ D;  3CF5 A;  2KCM A;  4EQN A;  1N34 Q;  3A55 A;  1A6X A;  1HH2 P;  3KF8 A;  4JBW A;  5M3F B;  1XJV A;  1Y69 U;  3VYS A;  1AFP A;  1KAW A;  2KHS A;  2UUB L;  1X9N A;  4WOR A;  1NCV A;  3IRB A;  5KEE A;  1MIU A;  4KKS A;  1A3T A;  3CCQ A;  1TWH B;  1NMG A;  5FLX E;  4R4C A;  4MHE A;  3ULL A;  3HOU G;  2ZTE A;  2QIL A;  2E8G A;  1J9O A;  3GTM B;  1W6K A;  2ICI A;  1STH A;  3I72 A;  3HOY H;  4AQY Q;  2EY6 A;  4A3I G;  1C0A A;  1H9R A;  2C9O A;  4X3U A;  1STY A;  4OWX B;  4LF8 Q;  1BBW A;  1RL2 A;  3BZK A;  4R8N A;  3NBH B;  5M5X H;  1Z6H A;  2RA4 A;  2PNR C;  2F4V Q;  2DJG C;  1L0X B;  1F2Y A;  3KF6 A;  3DM3 A;  4A3J B;  2RCN A;  3GQB A;  1WTO A;  3Q24 A;  1K8O A;  1ICW A;  2LKV A;  4GS3 A;  1SND A;  1D5Z C;  2OTJ A;  4N9P A;  5C44 B;  3S2D B;  2VUM B;  2OEO A;  4NP5 A;  2VB2 X;  4DFA A;  5DAU A;  4Q0F A;  3SHL A;  3RZO B;  4A93 H;  1U4M A;  2KBN A;  2RQX A;  2Z9H A;  3A7A B;  4A3D G;  3HOV G;  3HOZ H;  3TS0 A;  1D1K A;  1NR2 A;  4JI2 Q;  5EGT A;  2VW9 A;  1AZP A;  5FO8 B;  4F88 A;  1YJN A;  1HZ9 A;  3VR6 A;  4UP8 A;  4JI7 Q;  3G48 A;  1IKL A;  3AB9 A;  5IWA L;  1QVC A;  1SDF A;  3HKZ G;  5TSS A;  3CC4 A;  4LFB L;  1SE3 A;  2VS1 A;  3TBI B;  2A74 C;  2K52 A;  2ZJP A;  3KYH C;  3HOU H;  2B2W C;  1RHP A;  1KAA A;  2IHF A;  4TQU S;  1K8M A;  3NBI A;  2NVY H;  3PO3 G;  2GN5 A;  5JPN C;  4A3I H;  1EWI A;  5JAV A;  5LL6 S;  4OIJ A;  1ZEQ X;  1ZKO A;  4L5T A;  3S1N H;  3NEN A;  3HOY B;  1VQE A;  2B39 A;  4DNR B;  1EFW A;  5FOB B;  1LTR D;  4BA1 I;  3BDO A;  3CQZ H;  3OWE B;  1G8Z D;  2KJX A;  4FF4 A;  1A0I A;  3FHW A;  3KBG A;  3F1Z A;  5BR8 Q;  5M5X B;  1OTC A;  2NZO A;  2L9H A;  4LFC Q;  4X64 L;  5GRO A;  3E0E A;  2VQF Q;  1I3Q H;  2Q2U A;  2F52 A;  2HCI A;  1K9M C;  1K3B C;  5D65 A;  3MC0 B;  3GD7 A;  4A3D H;  3HOV H;  2KOL A;  1CSQ A;  1X65 A;  4RH6 A;  4DGZ A;  1STB A;  1J5E Q;  4A93 B;  5C3W A;  2KEC A;  5IYC G;  4Z9C B;  4X3S A;  5CYU A;  3D6W A;  3HOZ B;  1EY9 A;  5G3L D;  4NXN L;  1T9H A;  5E1F A;  2EYF A;  3QIA A;  4FO2 A;  1QB5 D;  2E75 C;  2LXJ A;  3K5M A;  2C5C A;  5EPJ A;  2Y0S G;  1YJ9 A;  2A68 C;  3PIO A;  2PI2 E;  4KI0 A;  2K5Q A;  3MEF A;  3NSW A;  2P5Z X;  4X65 Q;  1HNZ L;  2EPB A;  3J80 i;  1E24 A;  2KA7 A;  2EY1 A;  2XN9 C;  5I9O A;  5H1S E;  1QE6 A;  3PO3 H;  4UP9 A;  1VQO A;  1EEI D;  1HCZ A;  4XYO A;  4DV5 Q;  2X6G A;  1U0L A;  1S4Z A;  1E2Z A;  1EY7 A;  2FMM A;  1ML0 D;  3EA6 A;  4RGT A;  4A3I B;  1Y1V G;  2GVB A;  1HPC A;  2PCF B;  3CC2 A;  4OO1 G;  3S1N B;  2DY8 A;  3WOF A;  4RKL A;  5JOB A;  1AE2 A;  2X69 A;  4A4I A;  5CMD A;  1D7Q A;  3CQZ B;  1STA A;  3U58 A;  3FMC A;  5A35 A;  1X3E A;  3FKI B;  1PRT B;  1HZC A;  2Z6B A;  1KRS A;  4OO1 I;  1B44 D;  4WJ3 M;  1N34 L;  2JP1 A;  1X32 A;  4R4Q A;  4MIU A;  3WWV A;  2KQ3 A;  4MTN A;  4PG3 A;  1I3Q B;  1SMY C;  1KDC A;  4LNQ A;  3R2T A;  3NWS A;  4CGY B;  4O1N A;  2EIF A;  4YCV A;  3J81 L;  3HFZ B;  5IYC H;  1G29 1;  1WI5 A;  4A3D B;  1VQF A;  4DV1 L;  3HOV B;  3D4W A;  2E2D C;  2BDO A;  1UE7 A;  3HKZ E;  1RF2 D;  1YHA A;  2IHE A;  2RF4 A;  2R3Z A;  3MZ5 A;  1J6Q A;  3H3V I;  1HQM C;  2KCT A;  3HKS A;  3TDQ A;  1S5D D;  3G4S A;  1MBY A;  1QVG A;  4POG A;  3BDC A;  1DYQ A;  1SMX A;  4AYB G;  4IAL A;  1PRT D;  4EX5 A;  1IBL L;  3PO2 B;  2QKI C;  2JA5 H;  2UUA Q;  1F9R A;  5COY A;  4AH6 A;  5EKI A;  4AQY L;  4LF4 L;  3BYY B;  1CKN B;  2F0E A;  4PQX A;  3HKZ B;  1I5F A;  4ULL A;  4RG1 A;  4JI8 Q;  2DGY A;  2WV6 D;  1AP0 A;  3WDN A;  1V1P A;  1N32 Q;  5CBA E;  1E1T A;  3GV6 A;  2E2J H;  2EYM A;  5M3M G;  3FEW X;  1PTO C;  1YNJ D;  3P7J A;  5GAH C;  1EYA A;  1IKM A;  3PO3 B;  2IL8 A;  3TME A;  1VQJ A;  5D14 A;  1HZB A;  4MN3 A;  1Y1V H;  1YI2 A;  1I94 L;  3S1Q H;  4OO1 H;  1EYC A;  4ID6 A;  1VQD A;  2B63 G;  1S5C D;  5ELB A;  1VQC A;  1EIG A;  4LF5 Q;  2YV5 A;  2M2L A;  2R7Z G;  1S5B D;  1EIH A;  4ABN A;  3T1Y L;  2A1A A;  1WTX A;  1NJI C;  4KHP L;  2L5T A;  3M7G A;  4A3L H;  3K5L A;  3HEJ A;  4B9X A;  3H3V H;  1SBB B;  4GN5 A;  4CJ2 C;  4QQB X;  5KYL A;  3PSI A;  1I4X A;  3A8J E;  5FO7 B;  2K05 A;  4EQO A;  4X3T A;  3OOC A;  1GUW A;  1V1Q A;  5JVG 3;  1A2U A;  1SRU A;  1HA6 A;  3G6J B;  1EWH A;  1TQO A;  1QNU A;  1JB7 A;  3TP8 A;  5JEA H;  2DN8 A;  1PMR A;  5IIF A;  5IT9 c;  3CCS A;  4A3F G;  1S5E D;  3QJY A; 
#chains in the Genus database with same CATH homology
 1FGU A;  4BBS H;  4A3M H;  1B70 B;  3M4Q A;  1MKH A;  1N9W A;  1X56 A;  3VDY A;  2E5L L;  1CKM A;  5C0X I;  1PFS A;  2MFI A;  2V1C C;  3UDF A;  4GNX B;  4LF7 L;  4GN3 B;  4JI8 L;  2ATW A;  3AEV A;  1Q46 A;  2NVQ H;  1E1O A;  2IT1 A;  1M90 C;  1N32 L;  2D0P A;  2HT1 A;  2WAQ E;  1S72 A;  5C4X G;  1HR0 W;  1X55 A;  2ALY B;  4OX9 L;  1O7I A;  4DV7 L;  3M9B A;  2CKZ B;  1LM0 A;  5JEA J;  1C9O A;  5GAE C;  2I0Q A;  2DUD A;  3K7A H;  4X6A H;  5M3M H;  3J7A 5;  1VQI A;  1N33 Q;  4O0A A;  5GAD C;  2VY3 A;  1YIJ A;  1KRT A;  3E9I A;  4Y52 H;  1G6P A;  4Y7N H;  1YEZ A;  1JJ2 A;  2JA7 G;  4A3J G;  1E3P A;  2QA4 A;  5BR8 L;  3PUY A;  5LMN L;  2VZA A;  3CP0 A;  3G71 A;  3A74 A;  1CKO A;  4J15 A;  4P72 A;  4IFD G;  4UPA A;  5C44 G;  1ASY A;  1RIP A;  2N3S A;  3S1M H;  4A3C H;  1AE3 A;  1IBK Q;  4HIK A;  3H0G H;  4GLV B;  4JI1 Q;  4LF5 L;  1NY4 A;  4LUZ A;  2B63 H;  1A63 A;  2B3G A;  3PIP A;  3M85 A;  4DR1 Q;  1PH4 A;  3FKI G;  1PA6 A;  4DNI A;  3K0X A;  5M5Y H;  2R7Z H;  1IBM Q;  4IFD I;  4DK6 C;  1VQ4 A;  2OWO A;  2Q2T A;  5IYB G;  1E22 A;  4YY3 Q;  4GKJ L;  3I4M G;  3RLN A;  1IXR A;  4QY7 A;  3HOW G;  5C3E H;  1EQR A;  2K4K A;  4P74 A;  2OTL A;  1WCM G;  2C35 B;  4X66 Q;  4JG2 A;  4LW1 A;  1KXL A;  4YHH Q;  4HJ9 A;  5M3F H;  4DUY L;  3ULP A;  3CCU A;  3TRZ A;  3UDI A;  2UUC Q;  1GVP A;  3M4O H;  5FJ8 H;  1VQG A;  3GTK H;  1KC8 C;  2WB1 E;  2K14 A;  4GNX A;  4AYB E;  4DR4 Q;  1FL0 A;  1UE1 A;  2YTX A;  3S24 A;  3RNU A;  1TWA H;  3T1H Q;  5C4J H;  4HIM A;  2JQO A;  1HR0 L;  1K83 H;  1CUK A;  4LF6 L;  2PI2 A;  3TEH B;  4DR5 Q;  1SN8 A;  1YVC A;  4A3F H;  2AKW B;  1X3G A;  2VQE Q;  1GKH A;  2UUB Q;  4K0K L;  4A3B G;  3CD6 A;  3ERS X;  2N78 A;  2JA6 G;  3PO2 G;  4DR7 Q;  3GTM H;  1K73 C;  5JJI A;  3PGZ A;  3UE0 A;  4DK3 C;  2B29 A;  3W5O A;  3JAM i;  3KJP A;  3RZD H;  2Z6K A;  4PZ8 A;  5C0X J;  1OXX K;  1HNX Q;  5C4X H;  4P73 A;  2OQK A;  2YTY A;  3A5Z B;  4R4T A;  3HOY G;  1K3R A;  2ZM6 Q;  4HJ5 A;  3LGJ A;  2FXQ A;  4DUZ L;  1VQA A;  1EQQ A;  1N33 L;  3CMA A;  2AWO A;  4L5R C;  2ES2 A;  2BH8 A;  4R1J A;  1HNZ Q;  3ULJ A;  3CPF A;  2KHI A;  1XPR A;  3I7F A;  4BY1 G;  2D0O A;  4PZ7 A;  4IJH A;  1FVI A;  5J3B A;  4A3J H;  1PYB A;  2YYZ A;  2ZTD A;  3JC6 6;  2R6G A;  3CW2 C;  3K7U C;  2UXC Q;  3AYH B;  4YWK A;  5FLM G;  1IBK L;  1FJG Q;  1JJC B;  5C44 H;  3S2D H;  2UXD Q;  2LXK A;  2KHJ A;  4DR1 L;  4B3S Q;  3RZO H;  5EAY A;  3F2C A;  3ICE A;  3FKI H;  1IBM L;  2QGQ A;  3U4V A;  3CCV A;  1YJW A;  1Z47 A;  1K8G A;  4IJL A;  2L15 A;  4YY3 L;  3A0J A;  1PH9 A;  2YU9 H;  4BA2 I;  3RR5 A;  1VQK A;  4IFD J;  4MNO A;  3HOW H;  4A76 A;  4X66 L;  1JJG A;  4JBK A;  4QJF A;  1VQN A;  1BVS A;  1LYL A;  1Q12 A;  2Y0S E;  4YHH L;  3KF6 B;  4APV A;  1SR3 A;  2MO0 A;  2BA1 A;  4DR2 L;  4YWM A;  1CKN A;  1Q82 C;  2HHH Q;  1NMF A;  1S3O A;  3F2D A;  1VQM A;  3KLW A;  3J81 j;  3CF5 A;  2KCM A;  1SRO A;  1U5K A;  1OXU A;  3L7Z C;  1N34 Q;  1R9T H;  3TRE A;  2CWA A;  1HH2 P;  4POF A;  3M7N A;  4OON A;  5LMU Q;  4C3H H;  1H95 A;  4JBW A;  1XJV A;  4GKK Q;  3S15 H;  1VQH A;  2UUA L;  4A3E G;  3GTQ H;  5IP7 G;  1KAW A;  2VQE L;  2UUB L;  1I6H H;  2R93 G;  1X9N A;  3GDE A;  1NBW A;  2N49 A;  1VQ9 A;  4YCU A;  3TS2 A;  2VNU D;  3IRB A;  4DR7 L;  1MIU A;  4DV0 L;  1M1K C;  3G6E A;  2JA6 H;  3PO2 H;  1PH2 A;  1VCI A;  2EQS A;  3BU2 A;  4IPG A;  5IWA Q;  3CCQ A;  1W2B A;  4LFB Q;  1KQS A;  1PYS B;  1NMG A;  2A19 A;  2CWP A;  3ZJY C;  3PF4 A;  4R4C A;  2NVX H;  2NVT H;  3ULL A;  4XIG S;  3HOU G;  1OXT A;  2ZTE A;  4RMF A;  4LUO A;  1HNX L;  1MJC A;  3S2H H;  3KDF A;  3SGI A;  4HJ8 A;  3GTL H;  2E8G A;  2VL6 A;  4B3R L;  3OYY A;  1L2F A;  3KJO A;  2ZM6 L;  1EYG A;  3PUX A;  3CCR A;  2JA5 G;  2H5X A;  4LFA Q;  1XNR Q;  4DV3 Q;  3HOY H;  3AFQ A;  1PV4 A;  2JE6 I;  4AQY Q;  1UE6 A;  1WFQ A;  4A3I G;  1Y1W G;  1Q86 C;  4P75 A;  1C0A A;  2AWN A;  5IYD H;  4OWX B;  3RLO A;  1BBW A;  2BA0 A;  2HIV A;  2RHQ B;  4PZ6 A;  1L1O B;  4BY1 H;  4LF8 Q;  1RL2 A;  3BZK A;  3CCJ A;  2PMZ E;  3NBH B;  5K36 G;  5E7N A;  2A8V A;  3S14 H;  5M5X H;  4BY7 H;  4PMW A;  1FJG L;  4B3M Q;  4JCV E;  2F4V Q;  2WAQ G;  2UXD L;  4JI0 Q;  1Z9F A;  2K5N A;  1MJE A;  3KF6 A;  4B3S L;  3DM3 A;  2WP8 J;  2RCN A;  4JI6 Q;  1OXS C;  4GS3 A;  4O2D A;  2OTJ A;  3E9H A;  2JJQ A;  4X64 Q;  2I5M X;  1N36 Q;  3NEM A;  3I2Z A;  4HIO A;  2QEX A;  3UDG A;  1L0W A;  1UE5 A;  1GD7 A;  4YWL A;  4A93 H;  2KBN A;  1W3S A;  4IO9 A;  1ASZ A;  1YBY A;  2GVA A;  1PH6 A;  4A3D G;  5GQO A;  4JBM A;  3HOV G;  3HOZ H;  1PH8 A;  3TS0 A;  4DAM A;  2R92 H;  4JI2 Q;  4DV6 L;  4UP7 A;  1EIF A;  1Q7Y C;  1TXY A;  1NTG A;  1XMO Q;  1B7Y B;  2MQH A;  2VW9 A;  4A3L G;  5AJ3 Q;  2CQO A;  3EN2 A;  1D8L A;  4JV5 Q;  4WJ4 A;  4JI5 Q;  4GKK L;  1YJN A;  1XMQ Q;  3S1R H;  4DR6 Q;  4LUV A;  1SFO H;  2RHS B;  3AFP A;  4NXN Q;  1DGS A;  4A75 A;  1IL2 A;  1HZ9 A;  4DPG A;  2ASB A;  4GOP B;  1LUZ A;  5IP7 H;  4A3E H;  4A3G G;  4UP8 A;  4DR3 Q;  4JI7 Q;  3G48 A;  4GNX C;  2YTV A;  3J80 c;  1B8A A;  5IWA L;  1QVC A;  3HKZ G;  3CC4 A;  4LFB L;  4OXP A;  2VS1 A;  5JEA G;  1KHI A;  1CSP A;  1VS0 A;  3L0O A;  4LWC A;  4IOC A;  2K52 A;  2XTI A;  3BJU A;  3S16 H;  4DV4 Q;  2WB1 G;  2ZJP A;  3KYH C;  4JYA Q;  4JI4 Q;  3HOU H;  1QUQ B;  4P71 A;  4A3M G;  1TWF H;  4DAY B;  3M3Y H;  1XNR L;  4DV3 L;  2IHF A;  4TQU S;  3CAM A;  4FDB A;  2NVY H;  2ZTC A;  3PO3 G;  3J81 c;  1PH1 A;  4QL5 A;  2GN5 A;  2MNA A;  1X3F A;  1SLJ A;  2NN6 G;  4IPH A;  3U4Z A;  1EWI A;  1Y14 B;  4A3I H;  2Z6K C;  1KL9 A;  2JA7 H;  1HNW Q;  5IP9 G;  1GO3 E;  2CFM A;  3PUW A;  3PUZ A;  3CCE A;  4LF8 L;  1QVF A;  1VQ5 A;  4TVA B;  4L5T A;  5DLQ E;  1PH7 A;  1IZ6 A;  3S1N H;  3NEN A;  1VQE A;  3EBE A;  4JI1 L;  1EFW A;  4B3M L;  2F4V L;  4X62 Q;  4JI0 L;  4BA1 I;  3CQZ H;  3H15 A;  2NN6 I;  3S17 H;  4AIM A;  4JI6 L;  1WOC A;  4LF6 Q;  1XTD A;  1A0I A;  3FHW A;  2PQA B;  3FP9 A;  3I56 A;  3RN2 A;  4DV2 Q;  2E2I H;  4JBJ A;  3F1Z A;  5BR8 Q;  5IYB H;  2NZO A;  1OTC A;  4LFC Q;  1VQB A;  4X64 L;  3MXN B;  5GRO A;  1VQ8 A;  2CCZ A;  1N36 L;  3E0E A;  2VQF Q;  1I3Q H;  2Q2U A;  4GN4 B;  3I4M H;  4LF9 Q;  4B3T Q;  1WCM H;  3GO5 A;  1QZH A;  2UUC L;  1NE3 A;  2F52 A;  3UDX A;  2ZJQ A;  2JK8 A;  1K9M C;  3BZC A;  2I5H A;  2IX1 A;  1X6O A;  3GD7 A;  3PCO B;  4JI2 L;  4A3D H;  3HOV H;  4DR4 L;  2UXB Q;  1EUJ A;  1CSQ A;  4KLK A;  1X65 A;  5IE8 A;  4JI3 Q;  1I50 H;  3ER0 A;  3T1H L;  1J5E Q;  1IYJ B;  4NB3 A;  5AJ3 L;  5HY6 A;  4QIW E;  4C3J H;  4DR5 L;  3Q8D A;  5IYC G;  3A5U A;  3EIV A;  1GM5 A;  2Q2H A;  4DR6 L;  1WJJ A;  4NXN L;  2PNH A;  1T9H A;  5M3F G;  4DV1 Q;  4BBR G;  1TWC H;  4A3B H;  4DR3 L;  4JI7 L;  1AH9 A;  2LXJ A;  4A3G H;  3W1G A;  2Y0S G;  4H02 A;  2I5L X;  4IPD A;  3I55 A;  1YJ9 A;  3PIO A;  2PI2 E;  3STB C;  1JT8 A;  2F3I A;  4DV4 L;  4JYA L;  4KI0 A;  4JI4 L;  3MEF A;  1IBL Q;  2EXD A;  4ALP A;  4X65 Q;  3D0F A;  4R4I A;  3HOX G;  1HNZ L;  4KHZ A;  4R4O A;  4LF4 Q;  4K0K Q;  3J80 i;  1E24 A;  5H1S E;  1S40 A;  1VQL A;  3PO3 H;  4UP9 A;  1VQO A;  4GLA C;  1HNW L;  2PQA A;  1LTL A;  3GTO H;  2K5V A;  5HGQ A;  3I4N G;  3CPW A;  1V43 A;  4OWT B;  2UXC L;  4OWW B;  2ZJR A;  4DV5 Q;  5IP9 H;  1U0L A;  2K50 A;  1PH5 A;  5FLM H;  4NXM Q;  1KIX A;  4IPC A;  2E2H H;  1Q8K A;  4X62 L;  1VQ6 A;  3B6Y A;  4A3K G;  4DUZ Q;  1Y1V G;  3J81 i;  2GVB A;  3DLL A;  3RLF A;  3CC2 A;  4OO1 G;  1SE8 A;  2JA9 A;  4DV2 L;  1Q1E A;  3NEL A;  1I94 Q;  4LFC L;  1AE2 A;  4A4I A;  2HIX A;  1C7Y A;  1VQ7 A;  2LSS A;  1D7Q A;  2VQF L;  3U58 A;  2IY5 B;  4LF9 L;  2VUM G;  1X3E A;  2Z0S A;  4B3T L;  2D62 A;  4HJA A;  1HZC A;  1G51 A;  2HHH L;  1KRS A;  1HZA A;  1V9P A;  4OO1 I;  1EIY B;  3OTO Q;  4WJ3 M;  1N34 L;  3T1Y Q;  3CCM A;  4R4Q A;  2R7F A;  3WWV A;  1XNQ Q;  1UEB A;  4MTN A;  4KHP Q;  4PG3 A;  2UXB L;  1YHQ A;  4JI3 L;  5LMU L;  1J5E L;  3CXC A;  2JA8 G;  5GAG C;  3OW2 A;  4LNQ A;  4EQ5 A;  4BXX G;  2R7D A;  2AMC B;  2EIF A;  4YCV A;  1N8R C;  3PUV A;  1TWG H;  2OCE A;  3HFZ B;  1G29 1;  1WI5 A;  5IYC H;  2UU9 Q;  1VQF A;  4DV1 L;  2JEB I;  2R93 H;  3W1B A;  1UE7 A;  1YHB A;  3HKZ E;  4HID A;  1YHA A;  2IHE A;  2RF4 A;  4DR2 Q;  1PHJ A;  1J6Q A;  4BBR H;  1KD1 C;  3H3V I;  2KCT A;  3HKS A;  3U50 C;  3G4S A;  2WFW A;  5ELN A;  1QVG A;  4POG A;  1L1O A;  3F8T A;  1SMX A;  4AYB G;  4BBS G;  1TWH H;  4L5Q A;  1VQP A;  2IX0 A;  5ELO A;  4EX5 A;  3PF5 A;  2AHO B;  1IBL L;  4JOI A;  4LFA L;  2JA5 H;  1XPU A;  2UUA Q;  4YCW A;  4AH6 A;  4X65 L;  4GLX A;  4UY8 C;  4AQY L;  3GTG H;  2E5L Q;  4LF4 L;  4C2M H;  1CKN B;  3HOX H;  1Y1W H;  1I5F A;  4DV0 Q;  4LF7 Q;  1P8L A;  4NPS A;  4RG1 A;  2DGY A;  4JI8 Q;  2ID0 A;  1N32 Q;  1L1O C;  3AQQ A;  3PV0 A;  1PVO A;  1E1T A;  4C3I H;  5FLX c;  2E2J H;  4DV5 L;  4OX9 Q;  3KF8 B;  4DV7 Q;  3KOJ A;  3I4N H;  5M3M G;  4JOI C;  4NXM L;  2MO1 A;  5GAH C;  4B3R Q;  2Q2I A;  3J7Z C;  1QZG A;  3KFU A;  3CME A;  1VQJ A;  1YIT A;  1K0R A;  1HJP A;  4A3K H;  1HZB A;  1A62 A;  1Y1V H;  2JEA I;  3CCL A;  3GTJ H;  4IOA A;  3K8A A;  5IYD G;  5LMN Q;  1YI2 A;  3HOZ G;  1I94 L;  3S1Q H;  2HQL A;  3GTP H;  4A3C G;  1VQD A;  1YNX A;  5JJK A;  3H0G G;  3KDF B;  4L5S A;  4BY7 G;  4MZ9 A;  3M4P A;  2B63 G;  2XGT A;  1VQC A;  1BBU A;  1XPO A;  4LF5 Q;  2K5H A;  5M5W H;  2YV5 A;  2VUM H;  4GOP A;  1Q81 C;  2R7Z G;  3L2P A;  3F2B A;  1WYD A;  3OTO L;  3K80 C;  3RN5 A;  3T1Y L;  2A1A A;  1XMO L;  1XNQ L;  1NJI C;  1OXV A;  5LMN W;  4KHP L;  3TQY A;  4A3L H;  4ME3 A;  1E7Z A;  1K8A C;  4JV5 L;  3H3V H;  4JI5 L;  2OQ0 A;  5C3E G;  1XMQ L;  4GKJ Q;  2NZH A;  3I4O A;  4DKA C;  2JA8 H;  3STB D;  4A93 G;  2KEN A;  1QUQ A;  4GN5 A;  4BXX H;  4GOP C;  4QQB X;  5JJL A;  2UU9 L;  3D31 A;  5IY0 A;  3K81 C;  5FJ8 G;  4DUY Q;  3PSI A;  3CC7 A;  4XTC S;  2K75 A;  2R92 G;  2N8N A;  1EOV A;  1P16 A;  1PH3 A;  1V1Q A;  4DV6 Q;  4JC0 A;  5C0X G;  1SRU A;  4HJ7 A;  1X54 A;  2BH2 A;  1JB7 A;  1JMC A;  1UWV A;  1BKB A;  3JAM c;  1Q1B A;  1YZ6 A;  1HR0 Q;  1A8V A;  1JE5 A;  5IT9 c;  3CCS A;  4A3F G;  4QGU A;  3UE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...