1NMFA

Major cold-shock protein, nmr, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR COLD-SHOCK PROTEIN
publication title Structure in solution of the major cold-shock protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
total genus 4
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1996-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1nmfA00
3HOUG 4NXNL 4LFAQ 2CWAA 2N3SA 2YV5A 2K5VA 1L1OB 4A4IA 4JG2A 4B3TQ 4B3RQ 4IPHA 1NMGA 1W3SA 2UUBQ 2D62A 4LFAL 5J3BA 1PA6A 4A93H 3AQQA 5IYBG 1WCMG 2YYZA 1J5EQ 3Q8DA 4IO9A 1YJNA 2UUCQ 3H3VH 3I4NG 4B3RL 2UUBL 1HZCA 1HR0W 2JA7H 4R4IA 1SR3A 2FXQA 5ELOA 1PYSB 2PQAB 2UUCL 4ALPA 1J5EL 1YNXA 1Z9FA 2DGYA 4H02A 4LUVA 4BBRH 1B8AA 2YTYA 2VNUD 3HKZG 2HHHQ 1EYGA 4A3JG 1L0WA 2HHHL 2ZTEA 5LMNQ 4RG1A 2JEAI 1EQRA 1HZBA 2K14A 1Q82C 1CSPA 1PH1A 3T1YQ 5LMNL 1Y14B 1VQ4A 3I4OA 4AQYQ 4JBMA 1EIFA 2Z6KC 4XTCS 1L1OA 4IPDA 3T1YL 1FJGQ 3M3YH 3S1QH 4LWCA 4A3GH 3AYHB 2KHIA 1KHIA 2QEXA 1C0AA 4PZ6A 2D0OA 3GTKH 3I7FA 4LF6Q 2JE6I 1NJIC 1H95A 2RHSB 2PQAA 5JJKA 3S2HH 3W1GA 5GAHC 2K50A 3FKIH 2OQKA 3CAMA 3PSIA 3J81j 4JI8L 4PMWA 4LF6L 2OCEA 3GTPH 1X3EA 4POFA 1PH9A 2OWOA 3D0FA 1Q12A 1OTCA 1HNWQ 3HOUH 1IXRA 1GD7A 4A75A 1KAWA 4NPSA 2VQFQ 3CCUA 4HJ8A 1M1KC 2R7ZG 2IY5B 4DR1L 2I5HA 3RLOA 1EOVA 4A3KG 3U58A 1OXVA 1UE5A 4GS3A 1NTGA 1UE1A 2D0PA 1YZ6A 2Z6KA 4APVA 2VQFL 1QZHA 1HNXQ 1Q1EA 1WCMH 5IYBH 3I4NH 5GAEC 1OXTA 2B63G 1KRTA 2EIFA 2KCMA 5BR8Q 5IWAQ 1I94Q 3K80C 4R4QA 4UP7A 2IT1A 2K75A 1HNXL 2ATWA 1YHQA 2OTLA 2NVTH 4P72A 4MNOA 3GTQH 5BR8L 4AYBG 4L5QA 2VZAA 4KLKA 1I94L 2UXBQ 1UWVA 1UE6A 3KF8B 4X66Q 1EUJA 3CPWA 4JBKA 4Y52H 1PV4A 3JAMc 1SMXA 1YJWA 4A3JH 1A62A 4DAYB 1HH2P 4X66L 1N32Q 3F2BA 4DR6L 4OO1G 2AWNA 1GM5A 1OXUA 3ER0A 5HGQA 1WYDA 4QQBX 1N32L 5C4JH 3PF5A 4IPGA 1KL9A 1R9TH 2AMCB 4PZ8A 1P8LA 1TWHH 4X65Q 3H3VI 3UDGA 1PVOA 1SN8A 3PUXA 4UP9A 3TREA 5GADC 5GAGC 4X62Q 3K0XA 4B3MQ 5IP7G 4X65L 4LF5Q 3FHWA 5IE8A 3OTOQ 3AEVA 4B3ML 3S1RH 1VQDA 1SRUA 4X62L 1TWCH 2AWOA 4DV5Q 2JA6G 4PG3A 1XMQL 1S40A 3PUYA 3OTOL 3CC2A 3I2ZA 3G6EA 2F4VQ 2UXDL 3HOXG 1QUQB 4DV5L 3KYHC 3TQYA 3KF6B 3STBC 3M7NA 2K5HA 2F4VL 5EAYA 1KXLA 4QGUA 4GKJQ 4C3JH 4GOPB 2H5XA 3HKZE 4X6AH 5JJLA 4DV0Q 2UUAL 1PH5A 3NELA 2ZTDA 2R7ZH 3GO5A 4MTNA 3PUVA 1KQSA 4JI6Q 5M3MG 4GOPC 4A3KH 5IP9G 4DV0L 1VQNA 1SLJA 1I6HH 3RZDH 3ULPA 3BZCA 2WAQG 1M90C 4J15A 2B63H 4WJ3M 2IX1A 4JBJA 2K4KA 5DLQE 4C2MH 1IBML 2OQ0A 3GD7A 4UY8C 2NVYH 4NXNQ 1GVPA 3HFZB 4DAMA 4B3SL 3EN2A 2IHFA 2RF4A 3EBEA 2IHEA 1K0RA 2MQHA 3TS0A 2A8VA 1CKMA 2RCNA 2WB1G 3W1BA 2JA8G 1TWAH 4JI4Q 3ULJA 4HJ9A 2CQOA 3RN2A 1QUQA 1WJJA 3I4MG 4DPGA 1E1OA 1AE3A 4NB3A 4BY1G 3KF6A 4OWXB 4JI4L 1UEBA 1AH9A 1MKHA 1VQFA 4GKJL 4GOPA 2GVBA 2MFIA 2PI2E 4R4TA 4UP8A 4DR4Q 2ALYB 2AKWB 4MZ9A 4KI0A 5IP7H 4AH6A 4JV5L 5JEAJ 4DR4L 3SGIA 2Z0SA 3DM3A 2V1CC 3UDIA 1EQQA 2JA6H 3PUWA 1JB7A 1V43A 3A0JA 5C0XG 1HZAA 2NN6I 3J80i 3JC66 3J81i 4JBWA 3S24A 3HOXH 1P16A 2E8GA 3KOJA 4OX9L 2JA9A 4A3FG 5LMNW 1T9HA 4OO1I 4GLAC 1E7ZA 1NBWA 1GKHA 3UE1A 1KC8C 1VQAA 2HIVA 3H15A 1HR0L 1VQJA 3CCMA 4A3CG 1X56A 3CCLA 5H1SE 5M3MH 3WWVA 5IP9H 1FGUA 5ELNA 1JMCA 3LGJA 4JC0A 1VQ6A 1A0IA 3PUZA 4JYAQ 3F8TA 4GN5A 1IBKL 1VCIA 1U5KA 4JI8Q 1JJGA 1G6PA 1TWGH 4KHZA 4DNIA 3GTOH 2EXDA 4LF9Q 4JYAL 1TWFH 2UXCL 4GKKQ 3G4SA 1SFOH 1K3RA 4DR1Q 4HJ7A 4LF9L 1CKOA 1Q86C 4GKKL 1MJEA 1SE8A 2I5LX 2JA8H 2MO0A 3U4ZA 4NXML 5C0XJ 3KFUA 1IYJB 3U4VA 3I4MH 2GVAA 2VQEQ 3T1HQ 5K36G 1PHJA 2E2JH 4BY1H 1FVIA 3H0GG 1PFSA 1RL2A 5GQOA 2K5NA 3S1MH 2VQEL 3T1HL 1X6OA 2YTXA 3J7ZC 4HIDA 3I56A 4DUYL 3S2DH 3STBD 3KDFB 4HIOA 1E1TA 1JE5A 4X64Q 2VW9A 1YHBA 1JJCB 5FLXc 4JI2Q 1L2FA 3M4OH 2I0QA 2WAQE 3CCVA 4DR6Q 1LYLA 2ID0A 3GTGH 4X64L 4C3HH 3TS2A 5E7NA 1G291 3CQZH 1O7IA 1PH3A 4JI2L 4DUZQ 1VQ9A 2KENA 2QA4A 4L5SA 1VQBA 2ZTCA 4A3MG 3ULLA 3HOVG 2LSSA 4A3FH 2E2HH 2PI2A 4DUZL 4O2DA 4A3EG 1VQHA 1JJ2A 4JI1Q 4DR7Q 1S72A 2KBNA 2MO1A 3HOWG 2B29A 4YY3Q 4A3CH 3ERSX 1XMQQ 4A3BG 3PV0A 4A3LG 4DR7L 4JI1L 1I50H 4OONA 4HIMA 1B70B 4DK6C 2JA5G 2UXDQ 4YY3L 1YI2A 2BA0A 1VQ8A 2UU9Q 3I55A 1VQEA 5M3FG 4JI5Q 1DGSA 3CP0A 4LF4Q 4LF7Q 4K0KQ 3ICEA 1Y1WG 2N49A 3KDFA 2UU9L 4DV1L 1ASYA 4JI5L 4Y7NH 4LF4L 4LF7L 2UUAQ 2R6GA 3L0OA 3E0EA 3CXCA 4P73A 4POGA 3NENA 3HKSA 5IYCG 4K0KL 3F1ZA 1X3GA 2R7DA 2JJQA 1N33Q 1VQOA 3A5ZB 2IX0A 4QY7A 3MEFA 5GROA 1G51A 1N33L 2HT1A 1N9WA 3K7AH 1XNRQ 3H0GH 2MNAA 3CCEA 1JT8A 1VQCA 3KLWA 3L2PA 1IBLL 3BZKA 1HNZL 1IBMQ 4DV7Q 4B3SQ 3CW2C 3M4PA 2WFWA 3PO3G 1XNRL 3J81c 2NVQH 4OWTB 2ZJRA 4R4OA 1S3OA 4DV7L 2PMZE 1PH4A 4WJ4A 3JAMi 1C9OA 3UE0A 2R92G 4YWKA 1B7YB 2KHJA 1N36Q 3A74A 5C4XG 1D8LA 1E22A 2NZHA 3PO2G 4GLVB 1K8AC 1YEZA 3E9HA 3CC4A 3NEMA 4QJFA 4YCWA 1CKNB 4GN3B 1N36L 2E2IH 4A3MH 1LUZA 1QVCA 3HOVH 1K83H 1VQIA 1AE2A 4P71A 1NY4A 4LW1A 2N78A 4JV5Q 4A3EH 1LM0A 4OWWB 2GN5A 4JI0Q 3K8AA 4IFDG 4P75A 3HOWH 2ZM6Q 3GTMH 4PZ7A 2Y0SG 4DR3Q 3TRZA 2VUMG 4A3BH 5C3EG 3S16H 4A3LH 4JI0L 1K8GA 4L5TA 2JA5H 1GO3E 1A8VA 1PYBA 1IL2A 2ZM6L 2ZJQA 4LUOA 3M85A 1EWIA 4DR3L 3OYYA 1YJ9A 5M3FH 1C7YA 1MIUA 2VS1A 2CWPA 4GN4B 4OX9Q 1NE3A 4AIMA 4IJHA 1Y1WH 4TQUS 2A19A 4EX5A 4IPCA 3CC7A 3B6YA 2DUDA 2E5LQ 3E9IA 4AYBE 1HR0Q 5IYCH 3BU2A 1L1OC 4B3TL 4GNXB 1XTDA 5M5XH 1VQMA 4JI3Q 2ASBA 1BVSA 2E5LL 1KD1C 1KRSA 1VQKA 5HY6A 1X55A 3M4QA 4JI3L 1CKNA 1Q46A 4C3IH 3CCQA 4GNXC 4A3IG 1K73C 1IBKQ 2JEBI 4A76A 2PNHA 1PH8A 1VQLA 2VY3A 4YHHQ 1HZ9A 2YTVA 2UXCQ 4BBSG 1QZGA 5JJIA 3HOYG 1V1QA 2N8NA 3RNUA 3PO3H 4R1JA 4YHHL 1YVCA 3G48A 3L7ZC 3KJOA 2CFMA 4HJAA 4LFCQ 3DLLA 4IFDJ 1PH2A 1XMOQ 1WFQA 3ZJYC 4YWMA 5FJ8G 4NXMQ 1X65A 2JK8A 2RHQB 2HQLA 3AFPA 4YWLA 1EFWA 4RMFA 2R92H 4JOIC 3HOZG 2B3GA 4LFCL 5LMUQ 5C4XH 3RZOH 2BH8A 1XMOL 1Q1BA 3S14H 4A3DG 3PO2H 4JCVE 3BJUA 4DR5Q 1QVGA 3D31A 5LMUL 4AQYL 4TVAB 1V9PA 1W2BA 1FJGL 4LNQA 4DV6Q 4DUYQ 1RIPA 4GNXA 1N8RC 4DR5L 2EQSA 2R7FA 1X3FA 3U50C 2YU9H 4BY7G 3F2DA 2F52A 4EQ5A 5C44G 4DV6L 1NMFA 2BH2A 2BA1A 2VUMH 1CUKA 5C3EH 3G71A 2A1AA 2XTIA 3GTJH 3J7A5 5FLMG 1J6QA 2ES2A 4YCVA 1Z47A 4BXXG 1VQPA 4O0AA 4BA2I 1CSQA 3UDXA 1YHAA 3TEHB 4IFDI 1I3QH 1U0LA 4JOIA 4QIWE 1HNWL 1WOCA 2F3IA 4LUZA 3VDYA 1YBYA 2KCTA 2HIXA 3PIPA 3NBHB 1X54A 3CMAA 1UE7A 1D7QA 1A63A 3M9BA 4LF8Q 5AJ3Q 2R93G 2WB1E 4FDBA 2ZJPA 1XJVA 5IYDG 4HJ5A 4XIGS 1YIJA 1YITA 1VS0A 2NVXH 5IWAL 1Y1VG 5M5WH 4A3IH 1XPRA 2CCZA 3RLNA 5AJ3L 4LF8L 3W5OA 2NN6G 4DV4Q 1TXYA 4JI7L 3KJPA 1SROA 2LXKA 1ASZA 3UDFA 3PGZA 4BBSH 4DV1Q 3F2CA 3HOYH 2UXBL 4DKAC 4DV4L 4BA1I 5C0XI 2Y0SE 3RN5A 4DR2Q 4A93G 3A5UA 2WP8J 5FJ8H 3S1NH 1WI5A 4DV3Q 5IY0A 3CPFA 1E24A 3HOZH 3CCSA 1E3PA 2JA7G 3MXNB 1BBWA 5M5YH 2NZOA 1BKBA 4DR2L 1VQ7A 4A3DH 3CD6A 4DV3L 1BBUA 1VQ5A 1IBLQ 1HNZQ 4IOAA 2CKZB 3K7UC 3K81C 4BBRG 1FL0A 3GDEA 2Q2TA 2XGTA 3RLFA 4BY7H 1OXXK 2K52A 3S17H 4ME3A 4LF5L 1HJPA 1XPUA 3J80c 4GLXA 1N34Q 5C44H 1LTLA 4IOCA 4YCUA 4JI7Q 2OTJA 2Q2UA 3PCOB 4P74A 1X9NA 4OXPA 1PH7A 1XPOA 1I5FA 1VQGA 2LXJA 2VL6A 5FLMH 1Q81C 1N34L 1Q7YC 1XNQQ 3PF4A 2I5MX 4KHPQ 2AHOB 3GTLH 4BXXH 1KIXA 2C35B 3EIVA 5JEAG 2QGQA 3IRBA 4KHPL 3RR5A 3FP9A 1MJCA 3AFQA 4DV2Q 1XNQL 4A3GG 1K9MC 4QL5A 3CF5A 4L5RC 2JQOA 1OXSC 4DK3C 4JI6L 4DV2L 2L15A 1IZ6A 1QVFA 4HIKA 3S15H 1PH6A 2Q2IA 4UPAA 2R93H 4LFBQ 3CCJA 2Q2HA 1EIYB 5IYDH 4IJLA 5IT9c 3CMEA 3CCRA 1Q8KA 1Y1VH 3FKIG 3OW2A 4LFBL 3PIOA 4R4CA
chains in the Genus database with same CATH superfamily
2L12A 4NXNL 4LFAQ 4J8QA 4FF3A 4HMIA 3EA6A 3H94A 3T4AC 4LFAL 3MFGA 1U4RA 3AQQA 5IYBG 2FMMA 3Q8DA 4IO9A 1YJNA 1VF7A 1HR0W 3DUZA 2EOTA 4ALPA 2PQEA 2PZWA 4JW0A 3QOJA 2YTYA 3WDNA 3NPPA 2F0KA 1JICA 1CZGA 4GZYC 3FEWX 2ZTEA 5LMNQ 3J80E 3J81E 4K14A 5CR3A 5LMNL 4JBMA 4JK1C 3EJIA 2KQ3A 3S1QH 4XTCS 4IPDA 3VR5A 4LWCA 3AYHB 2KHIA 2EYOA 1KHIA 3OIQA 1QB5D 2JE6I 1PYWD 2FHTA 3MXUA 1O7ZA 3S2HH 3W1GA 5I9PA 2A74C 2K50A 4PMWA 1STHA 4C3JB 3OOCA 3HOUH 4HCEA 2IY5B 4HJ8A 1BXTA 4DXGA 4C1NI 1SBBB 3U58A 1OXVA 1QE6A 2A6HD 1NTGA 1UE1A 2D0PA 4GS3A 5GAEC 1KRTA 3S15B 5BR8Q 5BN4A 1I94Q 4TKOB 4R4QA 4RHSA 2IT1A 3P75A 2B8GA 5BR8L 1I94L 2FFKB 3G6JB 1UWVA 5KIXA 3CPWA 2PW5A 2K33A 3JAMc 3DHQA 4DAYB 1SDFA 3SR1A 1Y69U 3F2BA 3T56B 3SK6A 4NDXA 4DR6L 1GM5A 3I72A 3ER0A 3IL8A 4F7XA 2AMCB 2JA7B 3MC0B 1CI3M 3TREA 1PFNA 5GAGC 1DZ1A 3IAYA 5IP7G 1BCPB 4KY6A 3C46A 3IKJA 2O5IC 1EQVA 5CC4A 1B50A 5EJWA 3AEVA 1XWEA 1TWCH 3CHBD 2JA6G 4FO2A 3PUYA 3VYSA 4CJ2C 3CC2A 3W2DA 5M9OA 4DU9A 5CV8A 3KF6B 3VR3A 3M7NA 3NTHA 5KYIA 4QGUA 4C3JH 4GOPB 1CQFA 3HKZE 3NQTA 2EVBA 1XYIA 3M3YB 5M3MB 1DONA 1RJTA 5K5PA 1LTAD 1STYA 2AUJD 2EZVA 1B3AA 2RKSA 3R93A 1AZQA 4WJ3M 1X3PA 1AEXA 3C1EA 4JBJA 2K4KA 1BDOA 4PV1C 2OQ0A 5L37A 1IBML 3GTPB 3OWEB 4CDEC 3EN2A 3EBEA 2IHEA 2HD3A 2JSOA 1GUSA 2WB1G 4C56C 4JI4Q 3ULJA 2CQOA 3RN2A 3I4MB 4OO1H 1AE3A 4BY1G 4JI4L 1TS4A 2QEJC 1SSOA 1AH9A 4GKJL 1C8CA 2MFIA 2PI2E 4IUTA 4MHEA 4R9WA 4KV6A 2DNCA 2PCFB 3VR6A 5FO7B 2HCCA 3A0JA 1HZAA 4RHRA 3JC66 4C3HG 2NBFA 5KEEA 3HOXH 4Z9CB 1JCKB 1ZKOA 1ESRA 2TMPA 4A3FG 5LMNW 3TP5A 3R2TA 1NBWA 2MHVA 4DA2A 3CCMA 2XWJB 5H1SE 2A5HA 5M3MH 1V1OA 3AB9A 1I50B 3K5OA 2WKDA 4JC0A 3ERQA 3X3MA 4G4KA 1HFNA 1E2WA 4ZUJA 2QF7A 4JI8Q 1GJXA 2UXCL 1KNAA 1PXUA 3DWQA 5IT9E 4RWSC 4HJ7A 3MXGA 1MJEA 2I5LX 1ONLA 1IKMA 2MO0A 3U4ZA 2R7ZB 3ND9A 1H9SA 1SYGA 3I4MH 3OMCA 5AFWA 1D5XC 3QOLA 1Q90A 2K5NA 1DM0B 1QILA 1UAPA 1K28A 4AYBB 1LABA 1GXDC 4X64Q 2VW9A 3A7AB 1EWHA 1ZYRD 3EROA 1JB3A 1I4QA 4JI2Q 2WAQE 3FDTA 3CCVA 5C0XH 1TWAB 5JPMC 4X64L 1G291 3C2PA 4JI2L 2KENA 3RUZA 4XYQA 3HOVG 1CK1A 1Z6HA 3P20A 4A3EB 1GUTA 2DJGC 1S72A 4QB4A 3HOWG 4YY3Q 4A3CH 1XMQQ 4A3BG 3S16B 1I50H 4OONA 2EXZA 1B70B 4DK6C 4YY3L 1YI2A 2RDGA 2L1BA 1E2VA 3I55A 1VQEA 4E6IA 1Y1WG 1TU2B 4MIUA 4Y7NH 2UUAQ 3L0OA 1KLGD 3NENA 1X3GA 5M5XB 1L0YB 1VQOA 1EU3A 3MEFA 5GROA 3LWUA 1OO9B 2B2UA 1S5CD 1XNRQ 2MNAA 4BS9A 3AU7A 3CCEA 3KLWA 2B8FA 1HNZL 3CW2C 2WFWA 5FLXL 1XNRL 1XX8A 3NTIA 2NVQH 1V1PA 1TWFB 4KN7C 3PQIA 1PH4A 1SFOB 3JAMi 1C9OA 1STGA 2E75C 1F2ZA 4WRDA 4RAUC 1WD1A 1D5MC 2AQ2B 3PO2B 4GLVB 4ZCKA 1B53A 3NEMA 2E2IH 4A3MH 3SXHA 2CVRA 1SE2A 5I2YA 4A3EH 4OWWB 1HCZA 3K8AA 4P75A 2ZM6Q 3DMUA 2Y0SG 1B9NA 5C3EG 3S16H 1K8GA 1A8VA 1IL2A 1GOZA 2ZM6L 1YJ9A 4OX9Q 2VS1A 4GN4B 1NE3A 3CQZB 3EQLC 2BE5C 2GA4B 4IPCA 1PTOD 4JVZA 3PMFA 4UDUC 4GNXB 5M5XH 4JI3Q 2Z9HA 3VR4A 1EY5A 2NVXB 2O5JC 4JI3L 1NNXA 3CCQA 1IBKQ 1L0XB 2JEBI 2MPMA 3WOFA 1U4MA 1LTID 1PH8A 1NCVA 2VY3A 2YTVA 4OGQC 3TP8A 5IGFA 2IJ0A 3RNUA 1CT1D 1YVCA 1FR3A 4HJAA 2F0HA 1SYEA 4NXMQ 1X65A 3EVQA 1PRTD 2L11A 3HOZG 1D6EC 4CKEA 5C4XH 4X3SA 4EGVA 4A3DG 3R8BA 3PO2H 3BJUA 5JJZA 3D31A 1FNUA 1V9PA 4DUYQ 1RIPA 1N8RC 2EQSA 2J4XA 2R7FA 3IFDA 4OHJA 3F2DA 4H44C 3D6CA 1W6KA 1PZJD 3E6ZX 2XRQD 5FLMG 1EOTA 3AMUA 1S5ED 1Z47A 3SK8A 1A3VA 2K03A 1EEFD 2A6EC 4NKLA 3P7JA 3PIPA 3NBHB 2RDHA 3CMAA 1UE7A 4LF8Q 4Q5VA 2WB1E 4FDBA 1XJVA 5IYDG 4HJ5A 1YIJA 2E2DC 2NVXH 5IWAL 3NUCA 1SYDA 2CCZA 4LF8L 4IFDI 3W5OA 2NN6G 2JA5B 1TXYA 5EBCA 3KJPA 2LXKA 1GUGA 3H6MA 2UXBL 1DXMA 2Q8IB 3T16A 1X32A 5ELCA 1GHKA 3TN2A 3A5UA 2WP8J 1WI5A 5ELBA 3CPFA 2EDGA 3K6OA 4N9PA 2JA7G 1BBWA 3I8ZA 1VQ7A 4NW2A 4G57A 3CD6A 2K7VA 1IBLQ 4C3IB 4BBRB 2WINB 4BY7H 1F9PA 1JC7A 3RMHA 4PMCA 1XPUA 4IN3A 4JI7Q 1LTLA 4DFAA 4IOCA 5CV5A 1YNJD 3PCOB 4P74A 4MN3A 4OXPA 1BOSA 4JI7L 1Q7YC 4KK7A 4BXXH 4I7ZC 1KIXA 4RKLA 2QGQA 1MJCA 5JAVA 2ICEC 3EFXD 1K9MC 4QL5A 2SNMA 3CF5A 1B44D 2F0IA 4DK3C 4ZK9B 5D3DA 1IZ6A 2Q2IA 3L9AX 3NE5B 3X3NA 5FO9B 2LMCB 2VUMB 3FKIG 4IUUA 3MEHA 4RA8A 4R8NA 5LL6X 3OW2A 1CZWA 5EKIA 4R4CA 1BQQT 2PW7A 1SNQA 2QCPX 5KNCA 1EWCA 2CWAA 1MGSA 1L1OB 4A4IA 4B3RQ 2UUBQ 2D62A 1WTXA 3MVVA 1PA6A 4A93H 2D2CC 1WCMB 2UUCQ 3I4NB 2F0SA 4B3RL 1FNVA 2PNRC 1HZCA 2UUBL 4R4IA 1SR3A 2PQAB 2UUCL 1A2TA 2DGYA 4DGZA 4H02A 4WORA 4BBRH 3J80L 1B8AA 3J81L 2Z4IA 3HKZG 2HHHQ 4BBSB 1HUNA 2F0MA 1A2UA 2HHHL 1XXGA 4RG1A 1EQRA 3VYUA 3E3XA 2K14A 4F88A 1Q82C 1CSPA 2OXPA 4DAPA 2X69A 1S5FD 1TWHB 1VQ4A 3I4OA 5M5YB 1STNA 1FJGQ 4HSPA 1GUWA 4A3GH 4F8MA 3OWFA 1MSGA 3D6WA 4J6HA 5I6WA 4LF6Q 1NJIC 2G5DA 3J81j 2OQKA 2X6LA 4LF6L 2QKIC 2OWOA 3D0FA 5C6AA 1HNWQ 1RTNA 2KUMA 3FPPA 4A75A 3CCUA 2R7ZG 4DR1L 3BS1A 2E76C 2WKCA 4KD3A 1JOKA 1I6HB 3H3VH 1CQVA 1E0BA 4IQZA 4TRDA 1WCMH 3I4NH 2B63G 5J39A 1LT5D 3QG1A 2F0UA 1JWSD 4C2MB 2NVTH 4P72A 4MNOA 3SDZA 4AYBG 2DY7A 2VZAA 4KLKA 3A54A 4L5QA 1W6JA 3KF8B 5CV6A 4Y52H 1EUJA 4JBKA 1PV4A 3LX0A 5C4ZA 1YJWA 1HA6A 4A3JH 1SMYD 1RTOA 2L5TA 2F3VA 5EQ0A 4QQBX 1DOMA 1WYDA 4KD4A 5IGCA 1TY2A 4X65Q 1PVOA 1P8LA 1TWHH 2BOSA 4C1NK 1PFMA 3PUXA 4B3MQ 4X62Q 1LT6D 2B2VC 4X65L 3OTOQ 4B3ML 3S1RH 4X62L 2KEEA 4DV5Q 3OTOL 3G6EA 2F4VQ 2UXDL 5BN5A 4DV5L 3KYHC 3TQYA 1SNMA 1SYBA 2F4VL 5EAYA 4K6LA 4X6AH 1EU4A 1STBA 4DAYA 3NELA 3GO5A 5A2QE 5IIFA 4A3KH 5IP9G 2K32A 2QDLA 1I6HH 2EYFA 3ULPA 4CDFC 2WAQG 5IGGA 4I7AA 3BYTB 2IX1A 1SJHD 2KCCA 3U9OA 3S2HB 2F0FA 2G9DA 5DLQE 4C2MH 4UY8C 1ILQA 4NXNQ 1GVPA 4B3SL 4U68A 4H0LC 1H9KA 4X3UA 3Q0AA 2BCOA 3HZXA 3TS0A 4XQNA 3HOUB 2RCNA 2LFNA 3JAME 2EYMA 4NB3A 1PTOF 3KF6A 1UEBA 1MKHA 3S1MB 4GOPA 2GVBA 3RD4A 2VB3X 4MZ9A 1B2TA 3TP6A 4JV5L 2KECA 3SGIA 2Z0SA 4KY7A 3NSWA 3DM3A 1EQQA 1TKWB 3SHLA 3PUWA 5E1FA 2NN6I 3M4YA 1P16A 1S4ZA 2E8GA 1RKNA 4G7ZC 1VMCA 4ZQ3A 2F0LA 1T9HA 4OO1I 1PRTF 1JE4A 3UE1A 2KHSA 1VQAA 2HIVA 2V4DA 2PO4A 1TWCB 5IT9L 1A0IA 1SNPA 3F8TA 1TQOA 4GN5A 2HDLA 4OL7A 3D3RA 4XYOA 3OMGA 1JJGA 4HR7B 1BR9A 1TWGH 4DNIA 3G4SA 5C3XA 1S5BD 2JA8H 1TVXA 3WOEA 2RBMA 3KFUA 1IYJB 2EY5A 1J8IA 5K36G 3H0GG 1JR0D 5I4DA 2A68D 5GQOA 3S1MH 2RVLA 2YTXA 1T5XD 1TS2A 4DF7A 4OEMB 4HIDA 5CGKA 3STBD 3KDFB 1MBYA 1E1TA 1JE5A 1KAAA 3BZDB 1YHBA 1SXTA 4N9TA 4DR6Q 2I0QA 3H09A 2ID0A 3GTGH 1EYDA 3VYRA 3TS2A 2EYJA 5E7NA 1PH3A 2QA4A 1IKLA 1LLRD 2LSSA 2PYKA 2PI2A 4FVMA 4O2DA 1JJ2A 2XWBB 4K2KA 2B2UC 2MO1A 3KBXA 2B29A 1ENFA 5BN3A 4ZUIA 4CGYB 5KNBA 2JA5G 1VQ8A 2BA0A 1WTHA 5C5MA 3V96A 5M3FB 4LF4Q 3HOXB 2N49A 1HUMA 4LF4L 3E0EA 1KDAA 5IYCG 1JORA 3F1ZA 4UAIA 1MHWC 2R7DA 2JJQA 2L0CA 3NQIA 1DOKA 2IX0A 1Y8NB 4TSSA 2F0GA 2ZXRA 3R3OA 4C3IG 1G51A 2HT1A 2JP1A 3K7AH 3ZYYX 2B2VA 1KDCA 1VQCA 2NB0A 1IBMQ 2J7ZA 1DD2A 1E2ZA 3PO3G 5IGEA 3J81c 2IWHA 4R4OA 2PMZE 4K5WA 5I6YA 4EQOA 2R92G 1YNNC 2KHJA 1N36Q 3RZOB 3A74A 4N8FA 4O1NA 3DWAA 1F9SA 3J7YW 1K8AC 3CC4A 3E9HA 5FK9C 1N36L 4GKJQ 4YCWA 4GN3B 3DM1A 1LUZA 1QVCA 1K83H 1LV9A 4FXKC 4LW1A 3T13A 2F0JA 4IFDG 2RA4A 4DR3Q 2VUMG 4A3LH 1PYBA 2ZJQA 4DR3L 1AZPA 3OYYA 5M3FH 1PLFA 5IOCA 1I3QB 4AIMA 4IJHA 3CC7A 2BDOA 3E9IA 4UHVA 4AYBE 1UUPA 5IODA 3BU2A 1L1OC 1O7LA 4B3TL 1XTDA 1LACA 1BVSA 2Z6BA 1VQKA 1I4XA 1M4VA 2PMZB 3BDOA 1K73C 4A76A 1HTLD 2UXCQ 4BBSG 1QZGA 2A6ED 2SNSA 3K5MA 1LTSD 3KJOA 4CKCA 1V8QA 4Y7NB 4YWLA 1KTKA 2D9UA 5KYLA 4RMFA 5LMUQ 1II3A 3RZOH 2BH8A 3S14H 1PTOB 3MZ5A 4JCVE 4JPBW 4DR5Q 4L6TB 2OT2A 2QDBA 5LMUL 3D4WA 4AQYL 4TVAB 1W2BA 1LTRD 4GNXA 4DR5L 3KK7A 1IW7C 4HN7A 5JOBA 5C44B 2NVQB 2BH2A 4KN4C 3LNNA 3C3LA 1B9MA 2BA1A 3NHHA 1CUKA 2QW7A 1GUOA 2XTIA 4PQXA 1ET6A 3A56A 1HPCA 4KY5A 4YCVA 3GTLB 2RQXA 4LMQD 4BA2I 1YHAA 3MXPA 3TEHB 3C1FA 3MAQA 1I3QH 1U0LA 4JOIA 5C4HA 2E2IB 4LUZA 2F3IA 2R3ZA 3VDYA 4A3MB 1YBYA 1PRTB 2KCTA 3CRLC 2HIXA 4RGNA 1A63A 2ZJPA 4CKBA 1Y1VB 4A3IH 4QUFA 2N88A 3I3CA 4DV4Q 1SROA 4ABNA 1ASZA 3UDFA 3PGZA 3MFYA 3HOYH 4DV4L 5A35A 4QF4A 2Q8RE 4DR2Q 5FJ8H 3S1NH 5IY0A 3I70A 3MXNB 3TDQA 4DR2L 2HCIA 1BBUA 1PTOH 1HNZQ 4FP5D 3K81C 2EJMA 2Q2TA 3VYTA 3NBHA 2X6GA 2A6HC 4LF5L 1MD2D 2ZXOA 1HJPA 4GLXA 1F9RA 5C44H 2OTJA 3SVMA 1XPOA 1EQTA 5C4XB 3GV3A 3GTLH 2DY8A 1PFBA 3IRBA 3RR5A 4CJ0B 3AFQA 2XSCA 5IGDA 1RD9D 3D4RA 5HGTA 4JI6L 3HG9A 1PH6A 2R93H 2Q2HA 1EIYB 5IT9c 3CCRA 1Y1VH 1PZKD 2ZXPA 3HOUG 2BDNA 2N3SA 2YV5A 4PMBA 1TY0A 4JG2A 4IPHA 1W3SA 3URYA 2YYZA 4WJWA 5DEHA 4B9WA 2VNUD 2KJXA 5ELOA 2KEDA 2WIIB 3GTQB 1YNXA 1Z9FA 4LUVA 1SYFA 2CQAA 1HTPA 2I46A 1L0WA 2E74C 3SK5A 3MWYW 1LT3D 2JEAI 1HZBA 4X3TA 5CV7A 1R9TB 5T1IA 2LY7A 3NBIA 1TR5A 4KJNA 1L1OA 1LT4D 5JEAH 1TS5A 2HUGA 3D4DA 5EBDA 2QEXA 2H1EA 4BY7B 1C0AA 5IGBA 1H9JA 2DN8A 2PQAA 5JJKA 1G91A 2F0DA 5GAHC 2K05A 2OCEA 1T5EA 5FKAC 1X3EA 4POFA 1PH9A 4C3JG 1Q12A 1OTCA 2NYZD 1MI2A 2EYHA 1NUCA 2I5HA 4IURA 4APVA 1YZ6A 1QZHA 1FNWA 2NTTA 2Z6KA 4XXEA 5IYBH 4M1UB 3DEPA 1KLUD 1OXTA 3DWPA 1WTPA 2EIFA 2KCMA 3DXJC 5DNFA 5IWAQ 3K80C 2ATWA 1BUVT 4ZKBB 1YHQA 2CH4A 4B08A 3GTQH 1PMRA 2UXBQ 1D1KA 5CV4A 4FXGC 1WVLA 5I2XA 3FPUB 1A62A 1ICFB 2EYPA 3I73A 1QNUA 1N32Q 2A69C 1G2TA 1IYVA 3PIP3 4OO1G 1QG7A 3BVMA 4A93B 1N32L 5C4JH 1R9TH 3H3VI 4PZ8A 1U9RA 2R61A 5GADC 2SDFA 3BDLA 4RGTA 5IE8A 1K0SA 3OIPA 1VQDA 1KNEA 2AWOA 2Z4HA 2JA6B 1BCPC 4HAEA 2K5WA 3HP3A 3HOXG 1QUQB 5A2QL 3KLRA 3KF8A 3TMEA 2H5XA 5CMDA 5JJLA 2ZTDA 4QMGA 4MTNA 1KQSA 4A3GB 5M3MG 4XQQA 4GOPC 3MHBA 1SLJA 4ZAIA 1VQNA 1CA5A 1HRJA 5G3LD 2F4IA 3BZCA 3I4LA 5D14A 5ELEA 1NR4A 1WTQA 3QJYA 4KKTA 3JAML 3GTOB 4K5VA 3GD7A 2NVYH 3HFZB 3BVGA 2RF4A 5I9OA 3QIAA 2MQHA 2A8VA 1CKMA 3W1BA 3I4MG 1F77A 4DPGA 1H9MA 4BY1B 2E2JB 1KABA 1JOOA 1VQFA 4V0BA 4R4TA 4UP8A 4DR4Q 2ALYB 2RSNA 3K58A 1X3QA 1Y8OB 2NVTB 5IP7H 3TZUA 4AH6A 3K5NA 2K1BA 4ZKCB 5JEAJ 4DR4L 3QB3A 2P5ZX 1J9OA 3UDIA 2IX3A 1G8ZD 3M4OB 2JA6H 2Z1CA 1JB7A 1V43A 4A3JB 5C0XG 4C3HB 4JBWA 1Z7TA 3KOJA 2JA9A 4CDDC 2E2HB 1H9RA 5C3WA 5EKKA 2NUCA 1GKHA 1KC8C 1HR0L 1SAPA 4A3CG 1X56A 4EQNA 3WWVA 5ELNA 1JMCA 3LGJA 3S1RB 1VQ6A 2VXWA 3PUZA 3TZDA 1VCIA 4LK1C 2O2LD 2FMCA 1QCBD 2B2TC 4KHZA 3NTKA 3DEOA 2EXDA 4LF9Q 4ZLTF 3GTOH 4GKKQ 4B9XA 5ELFA 1K3RA 4DR1Q 4LF9L 1SNDA 4GKKL 1SE8A 1EYCA 4K2LA 5CBEE 3U4VA 4CBVA 4A3KB 2ZT9C 1PHJA 2E2JH 4BY1H 1G6ZA 1FD7D 5JVG3 3FRPB 3GQBA 5EPJA 3FMCA 2JN4A 5FLXc 3M4OH 5FOBB 1LYLA 3NXWA 4C3HH 4RGMA 4DUZQ 4L5SA 1VQBA 2ZTCA 4A3MG 3HOVB 2B2WA 5DM73 4A3FH 2E2HH 3N52A 4DUZL 2TSSA 4A3EG 1LTBD 4JI1Q 3CRKC 1PRTC 1SE3A 2KBNA 3SE0A 3GTMB 2OEOA 1EY4A 3ERSX 5COYA 3PV0A 2KCNA 2MGSA 4A3BB 2H4OA 4JI1L 1EY8A 1SEBD 4HIMA 2UXDQ 5T1GA 1JQYD 2UU9Q 4HCSA 4LF7Q 1VF5C 3ICEA 3KDFA 4L8JA 5E4XA 4ULLA 2UU9L 4DV1L 1ASYA 2ICIA 3QO2A 4LF7L 3CXCA 2F0OA 4P73A 3HKSA 1QOHA 2O4XA 2F0TA 3A5ZB 3KBGA 1N9WA 3A8KE 2K5QA 3L2PA 4B3SQ 1SJED 1TWGB 4QIWB 2C5CA 1S3OA 4K5XA 4CHTB 1CHPD 3LWEA 4WJ4A 1DYQA 2FJ2A 1B7YB 5C4XG 2JXMB 2JA8B 2NTSA 1PZID 2DJFC 4KHVA 2NZHA 1CFMA 3PO2G 4QJFA 1CKNB 4X3KA 5EKLA 3HOVH 2YU9B 1JOQA 2N78A 4JV5Q 1LM0A 1GUNA 1DCZA 1VMPA 3HOWH 3GTMH 3D8GA 3PIO3 2C9OA 2Y0SB 4A3BH 3TRZA 5C3EB 3E5SA 4LUOA 1VDZA 1C7YA 3GTGB 2CWPA 2NWGA 3A8IE 2M2LA 1Y1WH 2Q8TA 2A19A 4EX5A 3ND8A 1YNJC 1IW7D 1I4PA 5NUCA 1VQMA 4QUCA 5HY6A 5ELDA 1BNZA 4GNXC 4NP5A 1WD0A 1BBXC 1O7YA 2K5DA 2PNHA 2N8NA 4K6DA 4RH6A 4R1JA 3G48A 3L7ZC 3QR8A 4V190 4IFDJ 4XDXA 3DLLA 4LFCQ 1PH2A 1WFQA 3AFPA 4F87A 3M7GA 4JOIC 3HOZB 2B3GA 4LFCL 4CJ1B 1Q1BA 4A3DB 1F2LA 1EL0A 4OIJA 1QVGA 3K7AB 4LNQA 3U9SA 4FYDA 2YU9H 4BY7G 3S17B 1X3FA 5DM63 4EQ5A 1U4PA 1NMFA 5C3EH 3G71A 1K8OA 1SNCA 3GTJH 3L3OC 2B2TA 1J6QA 4H13C 3BG3A 1NAPA 2B39A 4BXXG 4O0AA 1CSQA 3UDXA 1A6XA 1K83B 1X54A 3M9BA 1EIGA 1QNKA 3NWTA 1ET9A 1XPRA 2K28A 1BF4A 4DKAC 4NMZA 4BA1I 5C0XI 2HDMA 3BVZA 3Q24A 4A93G 4ILWA 4DV3Q 2F3WA 3HOZH 3CCSA 1EYAA 2NZOA 3TBIB 4LJZC 4A3DH 1HQRD 4DV3L 2K04A 1EY0A 1VQ5A 4U673 3K7UC 3SEBA 4BBRG 5G3LF 2RCFA 4DK1A 2XGTA 4PNYA 4RFBA 3RLFA 1OXXK 2K52A 5CORA 3S17H 2BE5D 3K57A 3J80c 4YCUA 4EVOA 2VB2X 3IFTA 2A73B 1VQGA 2VL6A 5FLMH 1LO5D 2SEBD 1XNQQ 2I5MX 2LS01 1NSNS 2AHOB 4QCLA 2C35B 3S14B 1C48A 1K8MA 4DV2Q 4A3GG 1XNQL 1SMYC 3F2UA 1F9QA 4L5RC 1UNSA 4OIKA 4XQJA 4DV2L 3GTKB 2Z8LA 3MXNA 4HIKA 3S15H 4YIJA 3NK9A 3CCJA 1D5ZC 4FF2A 4LFBQ 5IYDH 3CMEA 3FKIB 1WTRA 1ICWA 3BYYB 1EY9A 1KDBA 2NN6H 1JWUD 4J1MA 4Q0FA 4LFBL 1I4HA 2L4NA 2EE1A 2K5VA 4RKBA 1Q3LA 3HEJA 4B3TQ 1NMGA 5J3BA 1WCMG 3HRZC 1J5EQ 3I4NG 4IUQA 1RODA 2JA7H 3H3VC 2FXQA 2AQ1B 1PYSB 2CW0C 1J5EL 3J7AV 3CKIB 4KKUA 4A3IB 1LTGD 4H7BA 3MA2B 2F0EA 2EY6A 3HKZB 3S9WA 4I65A 2CHBD 1EYGA 3HOYB 4A3JG 3HGBA 5EPLA 2DNEA 5JVH3 5D65A 1PH1A 3S1NB 3T1YQ 1Y14B 4AQYQ 3QWNA 1EIFA 2Z6KC 3T1YL 5DAUA 3M3YH 1SNOA 4KTAA 1G2SA 4RCOA 3OPOA 4PZ6A 2D0OA 1XTCD 3GTKH 2A69D 3I7FA 1H95A 2RHSB 3UI2A 1BO0A 1HQMC 5ISRA 3FKIH 3CAMA 3PSIA 4O42A 4WFN3 4JI8L 3GTPH 2M00A 2NZ1D 1IXRA 1GD7A 1KAWA 4NPSA 2VQFQ 1M1KC 5HURA 3RLOA 1EOVA 4A3KG 1UE5A 1BCPD 3RZDB 1HNXQ 3P1HA 4KKSA 2VQFL 1Q1EA 1ML0D 5KRUA 2B63B 2R93B 4UP7A 1HNXL 2K75A 3N6RA 2QILA 2OTLA 4DNRB 1I4GA 3I90A 4G7OC 3GV6A 1UE6A 4X66Q 2G9HD 1SYCA 1SMXA 5KNDA 2EJGC 1HH2P 4X66L 3SK4A 3OSOA 2AWNA 4ZYSA 3HS0C 1OXUA 5HGQA 2F0QA 3TP7A 3PF5A 4IPGA 1KL9A 3CU7A 4ID6A 3UDGA 1SN8A 2XRSD 4UP9A 3K0XA 1AW7A 3VR2A 4LF5Q 3FHWA 1SE4A 3OHXC 1S5DD 1SRUA 4PG3A 1XMQL 1S40A 2EY1A 2A68C 3I2ZA 2ENBA 3STBC 2K5HA 1KXLA 1B1ZA 1EY7A 1Y8PB 1RF2D 4HMJA 4DV0Q 2K01A 2UUAL 1PH5A 1R4QB 1CA6A 4HSVA 2R7ZH 4JI6Q 3PUVA 4IZ8A 4DV0L 3ITPA 4RCNA 3RZDH 1IL8A 2WAQB 1M90C 3J7AF 4J15A 2B63H 2L9HA 3H91A 2F0WA 1EIHA 2N55A 4DAMA 2IHFA 1K0RA 3BDCA 2JA8G 1TWAH 1IYUA 4HJ9A 1QUQA 1WJJA 1E1OA 4XT1B 4OWXB 4ZRZA 1HFGA 2AKWB 3W3AA 4KI0A 3S2DB 1FGBD 1ENCA 2V1CC 2FINB 1QJOA 3K0YA 4KJOA 2KVMA 3J80i 5CBAE 4ODGA 3J81i 1WTWA 3S24A 1H9SB 1DOLA 4IUPA 4OX9L 4IUVA 5C4JB 4L63B 4GLAC 1E7ZA 2MUYA 3H15A 1VQJA 2B2YC 3CCLA 2J0TD 4DNTB 3Q23A 5IP9H 1FGUA 2XNAC 3K59A 4JYAQ 1ZEQX 1IBKL 1U5KA 1RHPA 1G6PA 2PZUA 1HHVA 2IPKD 4HEDA 4JYAL 2F0VA 1TWFH 4DN4M 4ME5A 2JYOA 1QWYA 2HQEA 1SFOH 1EEID 2XN9C 1MSHA 1CKOA 1Q86C 5F2DA 1TS3A 4NXML 2B2WC 5C0XJ 4KMUC 3VA5A 2GVAA 2VQEQ 3T1HQ 1B4OA 1FVIA 2RDFA 3H0GB 1AN8A 1PFSA 1RL2A 2VQEL 3T1HL 1X6OA 5CV9A 1D2BA 3J7ZC 3OW7A 3I56A 4DUYL 3S2DH 1A3UA 1EY6A 4BWGB 4HIOA 2NVYB 4IALA 4FXDA 1JJCB 1L2FA 2AUKA 2EJFC 1PDQA 3KUPA 3CQZH 1O7IA 1VQ9A 1K3BC 3ULLA 4K8IA 1CTMA 1VQHA 4DR7Q 1M8AA 1EZ6A 1O80A 3Q22A 1V1PB 3T53B 4A3LG 4DR7L 5E4WC 1ESFA 1STAA 3KLSA 4JI5Q 5M3FG 1DGSA 1O78A 3CP0A 3KLSX 4K0KQ 4JI5L 2OF1A 1WTVA 3NP8A 2R6GA 4POGA 4K0KL 2M9VA 2I07B 2F1MA 3I91A 4LAAA 1N33Q 1ZYRC 5EPKA 2L55A 3GP7A 2AQ3B 3VA7A 4R8IA 2PZTA 2CH4W 4QY7A 1N33L 4RGOS 5K36H 5CYUA 3H0GH 1JT8A 1HA5A 3BZKA 5J22A 1IBLL 4DV7Q 3M4PA 3PO3B 3FVQA 1DJRD 2XVSA 1JWMD 3A7LA 4OWTB 2ZJRA 4DV7L 2KA7A 2IL8A 5FO8B 3UE0A 2R92B 4YWKA 4IUNA 1D1IA 2WB1B 5FLXE 1UEAB 1D8LA 1EZ8A 1E22A 5LHY1 1YEZA 1B3QA 3TSSA 1VQIA 1AE2A 4P71A 1ENAA 1NY4A 5J1ZA 5LL6S 2GN5A 4JI0Q 4OELB 4PZ7A 2KOLA 2XIWA 4DK0A 4G7HC 2IW3A 4JI0L 4L5TA 2JA5H 1GO3E 4DXFA 2EY2A 3M85A 1EWIA 1MIUA 4M8AA 4HTHA 2PPBC 4TQUS 5E3FA 3B6YA 2DUDA 2E5LQ 1HR0Q 4XT3B 4A3FB 5IYCH 3T51B 2ASBA 2E5LL 1KD1C 1KRSA 1IHZA 1X55A 3M4QA 1CKNA 1Q46A 4C3IH 1A15A 5M5WB 4A3IG 1CHQD 1WTOA 1VQLA 4YHHQ 1HZ9A 3O13A 5JJIA 3HOYG 1V1QA 3PO3H 4YHHL 2CFMA 4K8JA 1XMOQ 3ZJYC 4YWMA 5FJ8G 2JK8A 2RHQB 2HQLA 1EFWA 2R92H 2MP1A 1XMOL 1RCVD 1NR2A 1LTTD 1BCPF 2B2YA 1FJGL 4DV6Q 1PTOC 2WV6D 3U50C 2F52A 5D3IB 1ILPA 1HXYD 5C44G 4IFDH 4DV6L 5EGTA 2VUMH 2A1AA 3J7A5 2ES2A 1U4LA 1VQPA 4S3SA 5TSSA 2RSOA 4FF1A 4QIWE 3A55A 1WOCA 4FNFA 2F0PA 2EYLA 4FF4A 1HNWL 5KGUA 2F03A 1D7QA 1F2MA 5AJ3Q 2R93G 2K6AA 1I6VC 3HOWB 4XIGS 1YITA 1VS0A 1I4RA 1Y1VG 2MJ8A 1YNND 1R4PB 3R2IA 3RLNA 5M5WH 5AJ3L 3Q6SA 1CM9A 4BBSH 4DV1Q 5C5LA 3F2CA 1STEA 3K5LA 1Y1WB 1C4QA 3E0JA 2Y0SE 3RN5A 1EFID 1E24A 1E3PA 5M5YH 1BKBA 3V2TA 1GHJA 1ZXTA 4CDCC 4IOAA 2CKZB 1FL0A 3GDEA 2EPBA 2F0NA 4ME3A 1A3TA 1TT2A 1AFPA 4DAVA 3V05A 1Q8IA 1N34Q 2Q2UA 2WACA 1X9NA 2SOBA 1PH7A 1N34L 1I5FA 2D5DA 2LXJA 3G7LA 3PF4A 1Q81C 4KHPQ 4P2CB 2CW0D 4N8X1 1TIID 3S1QB 3EIVA 5JEAG 4KHPL 3FP9A 1RDPD 3MTSA 3ONAB 2JQOA 1OXSC 3A8JE 5JPNC 2L15A 1QVFA 4UPAA 1FYCA 4IJLA 1AP0A 1F2YA 1Q8KA 2LKVA 3GTJB 3PIOA 4EQPA 4MTKA 3NWSA
chains in the Genus database with same CATH topology
3HOUG 4NXNL 4LFAQ 2CWAA 2N3SA 2YV5A 2K5VA 1L1OB 4A4IA 4JG2A 4B3TQ 4B3RQ 4IPHA 1NMGA 1W3SA 2UUBQ 2D62A 4LFAL 5J3BA 1PA6A 4A93H 3AQQA 5IYBG 1WCMG 2YYZA 1J5EQ 3Q8DA 4IO9A 1YJNA 2UUCQ 3H3VH 3I4NG 4B3RL 2UUBL 1HZCA 1HR0W 2JA7H 4R4IA 1SR3A 2FXQA 5ELOA 1PYSB 2PQAB 2UUCL 4ALPA 1J5EL 1YNXA 1Z9FA 2DGYA 4H02A 4LUVA 4BBRH 1B8AA 2YTYA 2VNUD 3HKZG 2HHHQ 1EYGA 4A3JG 1L0WA 2HHHL 2ZTEA 5LMNQ 4RG1A 2JEAI 1EQRA 1HZBA 2K14A 1Q82C 1CSPA 1PH1A 3T1YQ 5LMNL 1Y14B 1VQ4A 3I4OA 4AQYQ 4JBMA 1EIFA 2Z6KC 4XTCS 1L1OA 4IPDA 3T1YL 1FJGQ 3M3YH 3S1QH 4LWCA 4A3GH 3AYHB 2KHIA 1KHIA 2QEXA 1C0AA 4PZ6A 2D0OA 3GTKH 3I7FA 4LF6Q 2JE6I 1NJIC 1H95A 2RHSB 2PQAA 5JJKA 3S2HH 3W1GA 5GAHC 2K50A 3FKIH 2OQKA 3CAMA 3PSIA 3J81j 4JI8L 4PMWA 4LF6L 2OCEA 3GTPH 1X3EA 4POFA 1PH9A 2OWOA 3D0FA 1Q12A 1OTCA 1HNWQ 3HOUH 1IXRA 1GD7A 4A75A 1KAWA 4NPSA 2VQFQ 3CCUA 4HJ8A 1M1KC 2R7ZG 2IY5B 4DR1L 2I5HA 3RLOA 1EOVA 4A3KG 3U58A 1OXVA 1UE5A 4GS3A 1NTGA 1UE1A 2D0PA 1YZ6A 2Z6KA 4APVA 2VQFL 1QZHA 1HNXQ 1Q1EA 1WCMH 5IYBH 3I4NH 5GAEC 1OXTA 2B63G 1KRTA 2EIFA 2KCMA 5BR8Q 5IWAQ 1I94Q 3K80C 4R4QA 4UP7A 2IT1A 2K75A 1HNXL 2ATWA 1YHQA 2OTLA 2NVTH 4P72A 4MNOA 3GTQH 5BR8L 4AYBG 4L5QA 2VZAA 4KLKA 1I94L 2UXBQ 1UWVA 1UE6A 3KF8B 4X66Q 1EUJA 3CPWA 4JBKA 4Y52H 1PV4A 3JAMc 1SMXA 1YJWA 4A3JH 1A62A 4DAYB 1HH2P 4X66L 1N32Q 3F2BA 4DR6L 4OO1G 2AWNA 1GM5A 1OXUA 3ER0A 5HGQA 1WYDA 4QQBX 1N32L 5C4JH 3PF5A 4IPGA 1KL9A 1R9TH 2AMCB 4PZ8A 1P8LA 1TWHH 4X65Q 3H3VI 3UDGA 1PVOA 1SN8A 3PUXA 4UP9A 3TREA 5GADC 5GAGC 4X62Q 3K0XA 4B3MQ 5IP7G 4X65L 4LF5Q 3FHWA 5IE8A 3OTOQ 3AEVA 4B3ML 3S1RH 1VQDA 1SRUA 4X62L 1TWCH 2AWOA 4DV5Q 2JA6G 4PG3A 1XMQL 1S40A 3PUYA 3OTOL 3CC2A 3I2ZA 3G6EA 2F4VQ 2UXDL 3HOXG 1QUQB 4DV5L 3KYHC 3TQYA 3KF6B 3STBC 3M7NA 2K5HA 2F4VL 5EAYA 1KXLA 4QGUA 4GKJQ 4C3JH 4GOPB 2H5XA 3HKZE 4X6AH 5JJLA 4DV0Q 2UUAL 1PH5A 3NELA 2ZTDA 2R7ZH 3GO5A 4MTNA 3PUVA 1KQSA 4JI6Q 5M3MG 4GOPC 4A3KH 5IP9G 4DV0L 1VQNA 1SLJA 1I6HH 3RZDH 3ULPA 3BZCA 2WAQG 1M90C 4J15A 2B63H 4WJ3M 2IX1A 4JBJA 2K4KA 5DLQE 4C2MH 1IBML 2OQ0A 3GD7A 4UY8C 2NVYH 4NXNQ 1GVPA 3HFZB 4DAMA 4B3SL 3EN2A 2IHFA 2RF4A 3EBEA 2IHEA 1K0RA 2MQHA 3TS0A 2A8VA 1CKMA 2RCNA 2WB1G 3W1BA 2JA8G 1TWAH 4JI4Q 3ULJA 4HJ9A 2CQOA 3RN2A 1QUQA 1WJJA 3I4MG 4DPGA 1E1OA 1AE3A 4NB3A 4BY1G 3KF6A 4OWXB 4JI4L 1UEBA 1AH9A 1MKHA 1VQFA 4GKJL 4GOPA 2GVBA 2MFIA 2PI2E 4R4TA 4UP8A 4DR4Q 2ALYB 2AKWB 4MZ9A 4KI0A 5IP7H 4AH6A 4JV5L 5JEAJ 4DR4L 3SGIA 2Z0SA 3DM3A 2V1CC 3UDIA 1EQQA 2JA6H 3PUWA 1JB7A 1V43A 3A0JA 5C0XG 1HZAA 2NN6I 3J80i 3JC66 3J81i 4JBWA 3S24A 3HOXH 1P16A 2E8GA 3KOJA 4OX9L 2JA9A 4A3FG 5LMNW 1T9HA 4OO1I 4GLAC 1E7ZA 1NBWA 1GKHA 3UE1A 1KC8C 1VQAA 2HIVA 3H15A 1HR0L 1VQJA 3CCMA 4A3CG 1X56A 3CCLA 5H1SE 5M3MH 3WWVA 5IP9H 1FGUA 5ELNA 1JMCA 3LGJA 4JC0A 1VQ6A 1A0IA 3PUZA 4JYAQ 3F8TA 4GN5A 1IBKL 1VCIA 1U5KA 4JI8Q 1JJGA 1G6PA 1TWGH 4KHZA 4DNIA 3GTOH 2EXDA 4LF9Q 4JYAL 1TWFH 2UXCL 4GKKQ 3G4SA 1SFOH 1K3RA 4DR1Q 4HJ7A 4LF9L 1CKOA 1Q86C 4GKKL 1MJEA 1SE8A 2I5LX 2JA8H 2MO0A 3U4ZA 4NXML 5C0XJ 3KFUA 1IYJB 3U4VA 3I4MH 2GVAA 2VQEQ 3T1HQ 5K36G 1PHJA 2E2JH 4BY1H 1FVIA 3H0GG 1PFSA 1RL2A 5GQOA 2K5NA 3S1MH 2VQEL 3T1HL 1X6OA 2YTXA 3J7ZC 4HIDA 3I56A 4DUYL 3S2DH 3STBD 3KDFB 4HIOA 1E1TA 1JE5A 4X64Q 2VW9A 1YHBA 1JJCB 5FLXc 4JI2Q 1L2FA 3M4OH 2I0QA 2WAQE 3CCVA 4DR6Q 1LYLA 2ID0A 3GTGH 4X64L 4C3HH 3TS2A 5E7NA 1G291 3CQZH 1O7IA 1PH3A 4JI2L 4DUZQ 1VQ9A 2KENA 2QA4A 4L5SA 1VQBA 2ZTCA 4A3MG 3ULLA 3HOVG 2LSSA 4A3FH 2E2HH 2PI2A 4DUZL 4O2DA 4A3EG 1VQHA 1JJ2A 4JI1Q 4DR7Q 1S72A 2KBNA 2MO1A 3HOWG 2B29A 4YY3Q 4A3CH 3ERSX 1XMQQ 4A3BG 3PV0A 4A3LG 4DR7L 4JI1L 1I50H 4OONA 4HIMA 1B70B 4DK6C 2JA5G 2UXDQ 4YY3L 1YI2A 2BA0A 1VQ8A 2UU9Q 3I55A 1VQEA 5M3FG 4JI5Q 1DGSA 3CP0A 4LF4Q 4LF7Q 4K0KQ 3ICEA 1Y1WG 2N49A 3KDFA 2UU9L 4DV1L 1ASYA 4JI5L 4Y7NH 4LF4L 4LF7L 2UUAQ 2R6GA 3L0OA 3E0EA 3CXCA 4P73A 4POGA 3NENA 3HKSA 5IYCG 4K0KL 3F1ZA 1X3GA 2R7DA 2JJQA 1N33Q 1VQOA 3A5ZB 2IX0A 4QY7A 3MEFA 5GROA 1G51A 1N33L 2HT1A 1N9WA 3K7AH 1XNRQ 3H0GH 2MNAA 3CCEA 1JT8A 1VQCA 3KLWA 3L2PA 1IBLL 3BZKA 1HNZL 1IBMQ 4DV7Q 4B3SQ 3CW2C 3M4PA 2WFWA 3PO3G 1XNRL 3J81c 2NVQH 4OWTB 2ZJRA 4R4OA 1S3OA 4DV7L 2PMZE 1PH4A 4WJ4A 3JAMi 1C9OA 3UE0A 2R92G 4YWKA 1B7YB 2KHJA 1N36Q 3A74A 5C4XG 1D8LA 1E22A 2NZHA 3PO2G 4GLVB 1K8AC 1YEZA 3E9HA 3CC4A 3NEMA 4QJFA 4YCWA 1CKNB 4GN3B 1N36L 2E2IH 4A3MH 1LUZA 1QVCA 3HOVH 1K83H 1VQIA 1AE2A 4P71A 1NY4A 4LW1A 2N78A 4JV5Q 4A3EH 1LM0A 4OWWB 2GN5A 4JI0Q 3K8AA 4IFDG 4P75A 3HOWH 2ZM6Q 3GTMH 4PZ7A 2Y0SG 4DR3Q 3TRZA 2VUMG 4A3BH 5C3EG 3S16H 4A3LH 4JI0L 1K8GA 4L5TA 2JA5H 1GO3E 1A8VA 1PYBA 1IL2A 2ZM6L 2ZJQA 4LUOA 3M85A 1EWIA 4DR3L 3OYYA 1YJ9A 5M3FH 1C7YA 1MIUA 2VS1A 2CWPA 4GN4B 4OX9Q 1NE3A 4AIMA 4IJHA 1Y1WH 4TQUS 2A19A 4EX5A 4IPCA 3CC7A 3B6YA 2DUDA 2E5LQ 3E9IA 4AYBE 1HR0Q 5IYCH 3BU2A 1L1OC 4B3TL 4GNXB 1XTDA 5M5XH 1VQMA 4JI3Q 2ASBA 1BVSA 2E5LL 1KD1C 1KRSA 1VQKA 5HY6A 1X55A 3M4QA 4JI3L 1CKNA 1Q46A 4C3IH 3CCQA 4GNXC 4A3IG 1K73C 1IBKQ 2JEBI 4A76A 2PNHA 1PH8A 1VQLA 2VY3A 4YHHQ 1HZ9A 2YTVA 2UXCQ 4BBSG 1QZGA 5JJIA 3HOYG 1V1QA 2N8NA 3RNUA 3PO3H 4R1JA 4YHHL 1YVCA 3G48A 3L7ZC 3KJOA 2CFMA 4HJAA 4LFCQ 3DLLA 4IFDJ 1PH2A 1XMOQ 1WFQA 3ZJYC 4YWMA 5FJ8G 4NXMQ 1X65A 2JK8A 2RHQB 2HQLA 3AFPA 4YWLA 1EFWA 4RMFA 2R92H 4JOIC 3HOZG 2B3GA 4LFCL 5LMUQ 5C4XH 3RZOH 2BH8A 1XMOL 1Q1BA 3S14H 4A3DG 3PO2H 4JCVE 3BJUA 4DR5Q 1QVGA 3D31A 5LMUL 4AQYL 4TVAB 1V9PA 1W2BA 1FJGL 4LNQA 4DV6Q 4DUYQ 1RIPA 4GNXA 1N8RC 4DR5L 2EQSA 2R7FA 1X3FA 3U50C 2YU9H 4BY7G 3F2DA 2F52A 4EQ5A 5C44G 4DV6L 1NMFA 2BH2A 2BA1A 2VUMH 1CUKA 5C3EH 3G71A 2A1AA 2XTIA 3GTJH 3J7A5 5FLMG 1J6QA 2ES2A 4YCVA 1Z47A 4BXXG 1VQPA 4O0AA 4BA2I 1CSQA 3UDXA 1YHAA 3TEHB 4IFDI 1I3QH 1U0LA 4JOIA 4QIWE 1HNWL 1WOCA 2F3IA 4LUZA 3VDYA 1YBYA 2KCTA 2HIXA 3PIPA 3NBHB 1X54A 3CMAA 1UE7A 1D7QA 1A63A 3M9BA 4LF8Q 5AJ3Q 2R93G 2WB1E 4FDBA 2ZJPA 1XJVA 5IYDG 4HJ5A 4XIGS 1YIJA 1YITA 1VS0A 2NVXH 5IWAL 1Y1VG 5M5WH 4A3IH 1XPRA 2CCZA 3RLNA 5AJ3L 4LF8L 3W5OA 2NN6G 4DV4Q 1TXYA 4JI7L 3KJPA 1SROA 2LXKA 1ASZA 3UDFA 3PGZA 4BBSH 4DV1Q 3F2CA 3HOYH 2UXBL 4DKAC 4DV4L 4BA1I 5C0XI 2Y0SE 3RN5A 4DR2Q 4A93G 3A5UA 2WP8J 5FJ8H 3S1NH 1WI5A 4DV3Q 5IY0A 3CPFA 1E24A 3HOZH 3CCSA 1E3PA 2JA7G 3MXNB 1BBWA 5M5YH 2NZOA 1BKBA 4DR2L 1VQ7A 4A3DH 3CD6A 4DV3L 1BBUA 1VQ5A 1IBLQ 1HNZQ 4IOAA 2CKZB 3K7UC 3K81C 4BBRG 1FL0A 3GDEA 2Q2TA 2XGTA 3RLFA 4BY7H 1OXXK 2K52A 3S17H 4ME3A 4LF5L 1HJPA 1XPUA 3J80c 4GLXA 1N34Q 5C44H 1LTLA 4IOCA 4YCUA 4JI7Q 2OTJA 2Q2UA 3PCOB 4P74A 1X9NA 4OXPA 1PH7A 1XPOA 1I5FA 1VQGA 2LXJA 2VL6A 5FLMH 1Q81C 1N34L 1Q7YC 1XNQQ 3PF4A 2I5MX 4KHPQ 2AHOB 3GTLH 4BXXH 1KIXA 2C35B 3EIVA 5JEAG 2QGQA 3IRBA 4KHPL 3RR5A 3FP9A 1MJCA 3AFQA 4DV2Q 1XNQL 4A3GG 1K9MC 4QL5A 3CF5A 4L5RC 2JQOA 1OXSC 4DK3C 4JI6L 4DV2L 2L15A 1IZ6A 1QVFA 4HIKA 3S15H 1PH6A 2Q2IA 4UPAA 2R93H 4LFBQ 3CCJA 2Q2HA 1EIYB 5IYDH 4IJLA 5IT9c 3CMEA 3CCRA 1Q8KA 1Y1VH 3FKIG 3OW2A 4LFBL 3PIOA 4R4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOU G;  4NXN L;  4LFA Q;  2CWA A;  2N3S A;  2YV5 A;  2K5V A;  1L1O B;  4A4I A;  4JG2 A;  4B3T Q;  4B3R Q;  4IPH A;  1NMG A;  1W3S A;  2UUB Q;  2D62 A;  4LFA L;  5J3B A;  1PA6 A;  4A93 H;  3AQQ A;  5IYB G;  1WCM G;  2YYZ A;  1J5E Q;  3Q8D A;  4IO9 A;  1YJN A;  2UUC Q;  3H3V H;  3I4N G;  4B3R L;  2UUB L;  1HZC A;  1HR0 W;  2JA7 H;  4R4I A;  1SR3 A;  2FXQ A;  5ELO A;  1PYS B;  2PQA B;  2UUC L;  4ALP A;  1J5E L;  1YNX A;  1Z9F A;  2DGY A;  4H02 A;  4LUV A;  4BBR H;  1B8A A;  2YTY A;  2VNU D;  3HKZ G;  2HHH Q;  1EYG A;  4A3J G;  1L0W A;  2HHH L;  2ZTE A;  5LMN Q;  4RG1 A;  2JEA I;  1EQR A;  1HZB A;  2K14 A;  1Q82 C;  1CSP A;  1PH1 A;  3T1Y Q;  5LMN L;  1Y14 B;  1VQ4 A;  3I4O A;  4AQY Q;  4JBM A;  1EIF A;  2Z6K C;  4XTC S;  1L1O A;  4IPD A;  3T1Y L;  1FJG Q;  3M3Y H;  3S1Q H;  4LWC A;  4A3G H;  3AYH B;  2KHI A;  1KHI A;  2QEX A;  1C0A A;  4PZ6 A;  2D0O A;  3GTK H;  3I7F A;  4LF6 Q;  2JE6 I;  1NJI C;  1H95 A;  2RHS B;  2PQA A;  5JJK A;  3S2H H;  3W1G A;  5GAH C;  2K50 A;  3FKI H;  2OQK A;  3CAM A;  3PSI A;  3J81 j;  4JI8 L;  4PMW A;  4LF6 L;  2OCE A;  3GTP H;  1X3E A;  4POF A;  1PH9 A;  2OWO A;  3D0F A;  1Q12 A;  1OTC A;  1HNW Q;  3HOU H;  1IXR A;  1GD7 A;  4A75 A;  1KAW A;  4NPS A;  2VQF Q;  3CCU A;  4HJ8 A;  1M1K C;  2R7Z G;  2IY5 B;  4DR1 L;  2I5H A;  3RLO A;  1EOV A;  4A3K G;  3U58 A;  1OXV A;  1UE5 A;  4GS3 A;  1NTG A;  1UE1 A;  2D0P A;  1YZ6 A;  2Z6K A;  4APV A;  2VQF L;  1QZH A;  1HNX Q;  1Q1E A;  1WCM H;  5IYB H;  3I4N H;  5GAE C;  1OXT A;  2B63 G;  1KRT A;  2EIF A;  2KCM A;  5BR8 Q;  5IWA Q;  1I94 Q;  3K80 C;  4R4Q A;  4UP7 A;  2IT1 A;  2K75 A;  1HNX L;  2ATW A;  1YHQ A;  2OTL A;  2NVT H;  4P72 A;  4MNO A;  3GTQ H;  5BR8 L;  4AYB G;  4L5Q A;  2VZA A;  4KLK A;  1I94 L;  2UXB Q;  1UWV A;  1UE6 A;  3KF8 B;  4X66 Q;  1EUJ A;  3CPW A;  4JBK A;  4Y52 H;  1PV4 A;  3JAM c;  1SMX A;  1YJW A;  4A3J H;  1A62 A;  4DAY B;  1HH2 P;  4X66 L;  1N32 Q;  3F2B A;  4DR6 L;  4OO1 G;  2AWN A;  1GM5 A;  1OXU A;  3ER0 A;  5HGQ A;  1WYD A;  4QQB X;  1N32 L;  5C4J H;  3PF5 A;  4IPG A;  1KL9 A;  1R9T H;  2AMC B;  4PZ8 A;  1P8L A;  1TWH H;  4X65 Q;  3H3V I;  3UDG A;  1PVO A;  1SN8 A;  3PUX A;  4UP9 A;  3TRE A;  5GAD C;  5GAG C;  4X62 Q;  3K0X A;  4B3M Q;  5IP7 G;  4X65 L;  4LF5 Q;  3FHW A;  5IE8 A;  3OTO Q;  3AEV A;  4B3M L;  3S1R H;  1VQD A;  1SRU A;  4X62 L;  1TWC H;  2AWO A;  4DV5 Q;  2JA6 G;  4PG3 A;  1XMQ L;  1S40 A;  3PUY A;  3OTO L;  3CC2 A;  3I2Z A;  3G6E A;  2F4V Q;  2UXD L;  3HOX G;  1QUQ B;  4DV5 L;  3KYH C;  3TQY A;  3KF6 B;  3STB C;  3M7N A;  2K5H A;  2F4V L;  5EAY A;  1KXL A;  4QGU A;  4GKJ Q;  4C3J H;  4GOP B;  2H5X A;  3HKZ E;  4X6A H;  5JJL A;  4DV0 Q;  2UUA L;  1PH5 A;  3NEL A;  2ZTD A;  2R7Z H;  3GO5 A;  4MTN A;  3PUV A;  1KQS A;  4JI6 Q;  5M3M G;  4GOP C;  4A3K H;  5IP9 G;  4DV0 L;  1VQN A;  1SLJ A;  1I6H H;  3RZD H;  3ULP A;  3BZC A;  2WAQ G;  1M90 C;  4J15 A;  2B63 H;  4WJ3 M;  2IX1 A;  4JBJ A;  2K4K A;  5DLQ E;  4C2M H;  1IBM L;  2OQ0 A;  3GD7 A;  4UY8 C;  2NVY H;  4NXN Q;  1GVP A;  3HFZ B;  4DAM A;  4B3S L;  3EN2 A;  2IHF A;  2RF4 A;  3EBE A;  2IHE A;  1K0R A;  2MQH A;  3TS0 A;  2A8V A;  1CKM A;  2RCN A;  2WB1 G;  3W1B A;  2JA8 G;  1TWA H;  4JI4 Q;  3ULJ A;  4HJ9 A;  2CQO A;  3RN2 A;  1QUQ A;  1WJJ A;  3I4M G;  4DPG A;  1E1O A;  1AE3 A;  4NB3 A;  4BY1 G;  3KF6 A;  4OWX B;  4JI4 L;  1UEB A;  1AH9 A;  1MKH A;  1VQF A;  4GKJ L;  4GOP A;  2GVB A;  2MFI A;  2PI2 E;  4R4T A;  4UP8 A;  4DR4 Q;  2ALY B;  2AKW B;  4MZ9 A;  4KI0 A;  5IP7 H;  4AH6 A;  4JV5 L;  5JEA J;  4DR4 L;  3SGI A;  2Z0S A;  3DM3 A;  2V1C C;  3UDI A;  1EQQ A;  2JA6 H;  3PUW A;  1JB7 A;  1V43 A;  3A0J A;  5C0X G;  1HZA A;  2NN6 I;  3J80 i;  3JC6 6;  3J81 i;  4JBW A;  3S24 A;  3HOX H;  1P16 A;  2E8G A;  3KOJ A;  4OX9 L;  2JA9 A;  4A3F G;  5LMN W;  1T9H A;  4OO1 I;  4GLA C;  1E7Z A;  1NBW A;  1GKH A;  3UE1 A;  1KC8 C;  1VQA A;  2HIV A;  3H15 A;  1HR0 L;  1VQJ A;  3CCM A;  4A3C G;  1X56 A;  3CCL A;  5H1S E;  5M3M H;  3WWV A;  5IP9 H;  1FGU A;  5ELN A;  1JMC A;  3LGJ A;  4JC0 A;  1VQ6 A;  1A0I A;  3PUZ A;  4JYA Q;  3F8T A;  4GN5 A;  1IBK L;  1VCI A;  1U5K A;  4JI8 Q;  1JJG A;  1G6P A;  1TWG H;  4KHZ A;  4DNI A;  3GTO H;  2EXD A;  4LF9 Q;  4JYA L;  1TWF H;  2UXC L;  4GKK Q;  3G4S A;  1SFO H;  1K3R A;  4DR1 Q;  4HJ7 A;  4LF9 L;  1CKO A;  1Q86 C;  4GKK L;  1MJE A;  1SE8 A;  2I5L X;  2JA8 H;  2MO0 A;  3U4Z A;  4NXM L;  5C0X J;  3KFU A;  1IYJ B;  3U4V A;  3I4M H;  2GVA A;  2VQE Q;  3T1H Q;  5K36 G;  1PHJ A;  2E2J H;  4BY1 H;  1FVI A;  3H0G G;  1PFS A;  1RL2 A;  5GQO A;  2K5N A;  3S1M H;  2VQE L;  3T1H L;  1X6O A;  2YTX A;  3J7Z C;  4HID A;  3I56 A;  4DUY L;  3S2D H;  3STB D;  3KDF B;  4HIO A;  1E1T A;  1JE5 A;  4X64 Q;  2VW9 A;  1YHB A;  1JJC B;  5FLX c;  4JI2 Q;  1L2F A;  3M4O H;  2I0Q A;  2WAQ E;  3CCV A;  4DR6 Q;  1LYL A;  2ID0 A;  3GTG H;  4X64 L;  4C3H H;  3TS2 A;  5E7N A;  1G29 1;  3CQZ H;  1O7I A;  1PH3 A;  4JI2 L;  4DUZ Q;  1VQ9 A;  2KEN A;  2QA4 A;  4L5S A;  1VQB A;  2ZTC A;  4A3M G;  3ULL A;  3HOV G;  2LSS A;  4A3F H;  2E2H H;  2PI2 A;  4DUZ L;  4O2D A;  4A3E G;  1VQH A;  1JJ2 A;  4JI1 Q;  4DR7 Q;  1S72 A;  2KBN A;  2MO1 A;  3HOW G;  2B29 A;  4YY3 Q;  4A3C H;  3ERS X;  1XMQ Q;  4A3B G;  3PV0 A;  4A3L G;  4DR7 L;  4JI1 L;  1I50 H;  4OON A;  4HIM A;  1B70 B;  4DK6 C;  2JA5 G;  2UXD Q;  4YY3 L;  1YI2 A;  2BA0 A;  1VQ8 A;  2UU9 Q;  3I55 A;  1VQE A;  5M3F G;  4JI5 Q;  1DGS A;  3CP0 A;  4LF4 Q;  4LF7 Q;  4K0K Q;  3ICE A;  1Y1W G;  2N49 A;  3KDF A;  2UU9 L;  4DV1 L;  1ASY A;  4JI5 L;  4Y7N H;  4LF4 L;  4LF7 L;  2UUA Q;  2R6G A;  3L0O A;  3E0E A;  3CXC A;  4P73 A;  4POG A;  3NEN A;  3HKS A;  5IYC G;  4K0K L;  3F1Z A;  1X3G A;  2R7D A;  2JJQ A;  1N33 Q;  1VQO A;  3A5Z B;  2IX0 A;  4QY7 A;  3MEF A;  5GRO A;  1G51 A;  1N33 L;  2HT1 A;  1N9W A;  3K7A H;  1XNR Q;  3H0G H;  2MNA A;  3CCE A;  1JT8 A;  1VQC A;  3KLW A;  3L2P A;  1IBL L;  3BZK A;  1HNZ L;  1IBM Q;  4DV7 Q;  4B3S Q;  3CW2 C;  3M4P A;  2WFW A;  3PO3 G;  1XNR L;  3J81 c;  2NVQ H;  4OWT B;  2ZJR A;  4R4O A;  1S3O A;  4DV7 L;  2PMZ E;  1PH4 A;  4WJ4 A;  3JAM i;  1C9O A;  3UE0 A;  2R92 G;  4YWK A;  1B7Y B;  2KHJ A;  1N36 Q;  3A74 A;  5C4X G;  1D8L A;  1E22 A;  2NZH A;  3PO2 G;  4GLV B;  1K8A C;  1YEZ A;  3E9H A;  3CC4 A;  3NEM A;  4QJF A;  4YCW A;  1CKN B;  4GN3 B;  1N36 L;  2E2I H;  4A3M H;  1LUZ A;  1QVC A;  3HOV H;  1K83 H;  1VQI A;  1AE2 A;  4P71 A;  1NY4 A;  4LW1 A;  2N78 A;  4JV5 Q;  4A3E H;  1LM0 A;  4OWW B;  2GN5 A;  4JI0 Q;  3K8A A;  4IFD G;  4P75 A;  3HOW H;  2ZM6 Q;  3GTM H;  4PZ7 A;  2Y0S G;  4DR3 Q;  3TRZ A;  2VUM G;  4A3B H;  5C3E G;  3S16 H;  4A3L H;  4JI0 L;  1K8G A;  4L5T A;  2JA5 H;  1GO3 E;  1A8V A;  1PYB A;  1IL2 A;  2ZM6 L;  2ZJQ A;  4LUO A;  3M85 A;  1EWI A;  4DR3 L;  3OYY A;  1YJ9 A;  5M3F H;  1C7Y A;  1MIU A;  2VS1 A;  2CWP A;  4GN4 B;  4OX9 Q;  1NE3 A;  4AIM A;  4IJH A;  1Y1W H;  4TQU S;  2A19 A;  4EX5 A;  4IPC A;  3CC7 A;  3B6Y A;  2DUD A;  2E5L Q;  3E9I A;  4AYB E;  1HR0 Q;  5IYC H;  3BU2 A;  1L1O C;  4B3T L;  4GNX B;  1XTD A;  5M5X H;  1VQM A;  4JI3 Q;  2ASB A;  1BVS A;  2E5L L;  1KD1 C;  1KRS A;  1VQK A;  5HY6 A;  1X55 A;  3M4Q A;  4JI3 L;  1CKN A;  1Q46 A;  4C3I H;  3CCQ A;  4GNX C;  4A3I G;  1K73 C;  1IBK Q;  2JEB I;  4A76 A;  2PNH A;  1PH8 A;  1VQL A;  2VY3 A;  4YHH Q;  1HZ9 A;  2YTV A;  2UXC Q;  4BBS G;  1QZG A;  5JJI A;  3HOY G;  1V1Q A;  2N8N A;  3RNU A;  3PO3 H;  4R1J A;  4YHH L;  1YVC A;  3G48 A;  3L7Z C;  3KJO A;  2CFM A;  4HJA A;  4LFC Q;  3DLL A;  4IFD J;  1PH2 A;  1XMO Q;  1WFQ A;  3ZJY C;  4YWM A;  5FJ8 G;  4NXM Q;  1X65 A;  2JK8 A;  2RHQ B;  2HQL A;  3AFP A;  4YWL A;  1EFW A;  4RMF A;  2R92 H;  4JOI C;  3HOZ G;  2B3G A;  4LFC L;  5LMU Q;  5C4X H;  3RZO H;  2BH8 A;  1XMO L;  1Q1B A;  3S14 H;  4A3D G;  3PO2 H;  4JCV E;  3BJU A;  4DR5 Q;  1QVG A;  3D31 A;  5LMU L;  4AQY L;  4TVA B;  1V9P A;  1W2B A;  1FJG L;  4LNQ A;  4DV6 Q;  4DUY Q;  1RIP A;  4GNX A;  1N8R C;  4DR5 L;  2EQS A;  2R7F A;  1X3F A;  3U50 C;  2YU9 H;  4BY7 G;  3F2D A;  2F52 A;  4EQ5 A;  5C44 G;  4DV6 L;  1NMF A;  2BH2 A;  2BA1 A;  2VUM H;  1CUK A;  5C3E H;  3G71 A;  2A1A A;  2XTI A;  3GTJ H;  3J7A 5;  5FLM G;  1J6Q A;  2ES2 A;  4YCV A;  1Z47 A;  4BXX G;  1VQP A;  4O0A A;  4BA2 I;  1CSQ A;  3UDX A;  1YHA A;  3TEH B;  4IFD I;  1I3Q H;  1U0L A;  4JOI A;  4QIW E;  1HNW L;  1WOC A;  2F3I A;  4LUZ A;  3VDY A;  1YBY A;  2KCT A;  2HIX A;  3PIP A;  3NBH B;  1X54 A;  3CMA A;  1UE7 A;  1D7Q A;  1A63 A;  3M9B A;  4LF8 Q;  5AJ3 Q;  2R93 G;  2WB1 E;  4FDB A;  2ZJP A;  1XJV A;  5IYD G;  4HJ5 A;  4XIG S;  1YIJ A;  1YIT A;  1VS0 A;  2NVX H;  5IWA L;  1Y1V G;  5M5W H;  4A3I H;  1XPR A;  2CCZ A;  3RLN A;  5AJ3 L;  4LF8 L;  3W5O A;  2NN6 G;  4DV4 Q;  1TXY A;  4JI7 L;  3KJP A;  1SRO A;  2LXK A;  1ASZ A;  3UDF A;  3PGZ A;  4BBS H;  4DV1 Q;  3F2C A;  3HOY H;  2UXB L;  4DKA C;  4DV4 L;  4BA1 I;  5C0X I;  2Y0S E;  3RN5 A;  4DR2 Q;  4A93 G;  3A5U A;  2WP8 J;  5FJ8 H;  3S1N H;  1WI5 A;  4DV3 Q;  5IY0 A;  3CPF A;  1E24 A;  3HOZ H;  3CCS A;  1E3P A;  2JA7 G;  3MXN B;  1BBW A;  5M5Y H;  2NZO A;  1BKB A;  4DR2 L;  1VQ7 A;  4A3D H;  3CD6 A;  4DV3 L;  1BBU A;  1VQ5 A;  1IBL Q;  1HNZ Q;  4IOA A;  2CKZ B;  3K7U C;  3K81 C;  4BBR G;  1FL0 A;  3GDE A;  2Q2T A;  2XGT A;  3RLF A;  4BY7 H;  1OXX K;  2K52 A;  3S17 H;  4ME3 A;  4LF5 L;  1HJP A;  1XPU A;  3J80 c;  4GLX A;  1N34 Q;  5C44 H;  1LTL A;  4IOC A;  4YCU A;  4JI7 Q;  2OTJ A;  2Q2U A;  3PCO B;  4P74 A;  1X9N A;  4OXP A;  1PH7 A;  1XPO A;  1I5F A;  1VQG A;  2LXJ A;  2VL6 A;  5FLM H;  1Q81 C;  1N34 L;  1Q7Y C;  1XNQ Q;  3PF4 A;  2I5M X;  4KHP Q;  2AHO B;  3GTL H;  4BXX H;  1KIX A;  2C35 B;  3EIV A;  5JEA G;  2QGQ A;  3IRB A;  4KHP L;  3RR5 A;  3FP9 A;  1MJC A;  3AFQ A;  4DV2 Q;  1XNQ L;  4A3G G;  1K9M C;  4QL5 A;  3CF5 A;  4L5R C;  2JQO A;  1OXS C;  4DK3 C;  4JI6 L;  4DV2 L;  2L15 A;  1IZ6 A;  1QVF A;  4HIK A;  3S15 H;  1PH6 A;  2Q2I A;  4UPA A;  2R93 H;  4LFB Q;  3CCJ A;  2Q2H A;  1EIY B;  5IYD H;  4IJL A;  5IT9 c;  3CME A;  3CCR A;  1Q8K A;  1Y1V H;  3FKI G;  3OW2 A;  4LFB L;  3PIO A;  4R4C A; 
#chains in the Genus database with same CATH topology
 2L12 A;  4NXN L;  4LFA Q;  4J8Q A;  4FF3 A;  4HMI A;  3EA6 A;  3H94 A;  3T4A C;  4LFA L;  3MFG A;  1U4R A;  3AQQ A;  5IYB G;  2FMM A;  3Q8D A;  4IO9 A;  1YJN A;  1VF7 A;  1HR0 W;  3DUZ A;  2EOT A;  4ALP A;  2PQE A;  2PZW A;  4JW0 A;  3QOJ A;  2YTY A;  3WDN A;  3NPP A;  2F0K A;  1JIC A;  1CZG A;  4GZY C;  3FEW X;  2ZTE A;  5LMN Q;  3J80 E;  3J81 E;  4K14 A;  5CR3 A;  5LMN L;  4JBM A;  4JK1 C;  3EJI A;  2KQ3 A;  3S1Q H;  4XTC S;  4IPD A;  3VR5 A;  4LWC A;  3AYH B;  2KHI A;  2EYO A;  1KHI A;  3OIQ A;  1QB5 D;  2JE6 I;  1PYW D;  2FHT A;  3MXU A;  1O7Z A;  3S2H H;  3W1G A;  5I9P A;  2A74 C;  2K50 A;  4PMW A;  1STH A;  4C3J B;  3OOC A;  3HOU H;  4HCE A;  2IY5 B;  4HJ8 A;  1BXT A;  4DXG A;  4C1N I;  1SBB B;  3U58 A;  1OXV A;  1QE6 A;  2A6H D;  1NTG A;  1UE1 A;  2D0P A;  4GS3 A;  5GAE C;  1KRT A;  3S15 B;  5BR8 Q;  5BN4 A;  1I94 Q;  4TKO B;  4R4Q A;  4RHS A;  2IT1 A;  3P75 A;  2B8G A;  5BR8 L;  1I94 L;  2FFK B;  3G6J B;  1UWV A;  5KIX A;  3CPW A;  2PW5 A;  2K33 A;  3JAM c;  3DHQ A;  4DAY B;  1SDF A;  3SR1 A;  1Y69 U;  3F2B A;  3T56 B;  3SK6 A;  4NDX A;  4DR6 L;  1GM5 A;  3I72 A;  3ER0 A;  3IL8 A;  4F7X A;  2AMC B;  2JA7 B;  3MC0 B;  1CI3 M;  3TRE A;  1PFN A;  5GAG C;  1DZ1 A;  3IAY A;  5IP7 G;  1BCP B;  4KY6 A;  3C46 A;  3IKJ A;  2O5I C;  1EQV A;  5CC4 A;  1B50 A;  5EJW A;  3AEV A;  1XWE A;  1TWC H;  3CHB D;  2JA6 G;  4FO2 A;  3PUY A;  3VYS A;  4CJ2 C;  3CC2 A;  3W2D A;  5M9O A;  4DU9 A;  5CV8 A;  3KF6 B;  3VR3 A;  3M7N A;  3NTH A;  5KYI A;  4QGU A;  4C3J H;  4GOP B;  1CQF A;  3HKZ E;  3NQT A;  2EVB A;  1XYI A;  3M3Y B;  5M3M B;  1DON A;  1RJT A;  5K5P A;  1LTA D;  1STY A;  2AUJ D;  2EZV A;  1B3A A;  2RKS A;  3R93 A;  1AZQ A;  4WJ3 M;  1X3P A;  1AEX A;  3C1E A;  4JBJ A;  2K4K A;  1BDO A;  4PV1 C;  2OQ0 A;  5L37 A;  1IBM L;  3GTP B;  3OWE B;  4CDE C;  3EN2 A;  3EBE A;  2IHE A;  2HD3 A;  2JSO A;  1GUS A;  2WB1 G;  4C56 C;  4JI4 Q;  3ULJ A;  2CQO A;  3RN2 A;  3I4M B;  4OO1 H;  1AE3 A;  4BY1 G;  4JI4 L;  1TS4 A;  2QEJ C;  1SSO A;  1AH9 A;  4GKJ L;  1C8C A;  2MFI A;  2PI2 E;  4IUT A;  4MHE A;  4R9W A;  4KV6 A;  2DNC A;  2PCF B;  3VR6 A;  5FO7 B;  2HCC A;  3A0J A;  1HZA A;  4RHR A;  3JC6 6;  4C3H G;  2NBF A;  5KEE A;  3HOX H;  4Z9C B;  1JCK B;  1ZKO A;  1ESR A;  2TMP A;  4A3F G;  5LMN W;  3TP5 A;  3R2T A;  1NBW A;  2MHV A;  4DA2 A;  3CCM A;  2XWJ B;  5H1S E;  2A5H A;  5M3M H;  1V1O A;  3AB9 A;  1I50 B;  3K5O A;  2WKD A;  4JC0 A;  3ERQ A;  3X3M A;  4G4K A;  1HFN A;  1E2W A;  4ZUJ A;  2QF7 A;  4JI8 Q;  1GJX A;  2UXC L;  1KNA A;  1PXU A;  3DWQ A;  5IT9 E;  4RWS C;  4HJ7 A;  3MXG A;  1MJE A;  2I5L X;  1ONL A;  1IKM A;  2MO0 A;  3U4Z A;  2R7Z B;  3ND9 A;  1H9S A;  1SYG A;  3I4M H;  3OMC A;  5AFW A;  1D5X C;  3QOL A;  1Q90 A;  2K5N A;  1DM0 B;  1QIL A;  1UAP A;  1K28 A;  4AYB B;  1LAB A;  1GXD C;  4X64 Q;  2VW9 A;  3A7A B;  1EWH A;  1ZYR D;  3ERO A;  1JB3 A;  1I4Q A;  4JI2 Q;  2WAQ E;  3FDT A;  3CCV A;  5C0X H;  1TWA B;  5JPM C;  4X64 L;  1G29 1;  3C2P A;  4JI2 L;  2KEN A;  3RUZ A;  4XYQ A;  3HOV G;  1CK1 A;  1Z6H A;  3P20 A;  4A3E B;  1GUT A;  2DJG C;  1S72 A;  4QB4 A;  3HOW G;  4YY3 Q;  4A3C H;  1XMQ Q;  4A3B G;  3S16 B;  1I50 H;  4OON A;  2EXZ A;  1B70 B;  4DK6 C;  4YY3 L;  1YI2 A;  2RDG A;  2L1B A;  1E2V A;  3I55 A;  1VQE A;  4E6I A;  1Y1W G;  1TU2 B;  4MIU A;  4Y7N H;  2UUA Q;  3L0O A;  1KLG D;  3NEN A;  1X3G A;  5M5X B;  1L0Y B;  1VQO A;  1EU3 A;  3MEF A;  5GRO A;  3LWU A;  1OO9 B;  2B2U A;  1S5C D;  1XNR Q;  2MNA A;  4BS9 A;  3AU7 A;  3CCE A;  3KLW A;  2B8F A;  1HNZ L;  3CW2 C;  2WFW A;  5FLX L;  1XNR L;  1XX8 A;  3NTI A;  2NVQ H;  1V1P A;  1TWF B;  4KN7 C;  3PQI A;  1PH4 A;  1SFO B;  3JAM i;  1C9O A;  1STG A;  2E75 C;  1F2Z A;  4WRD A;  4RAU C;  1WD1 A;  1D5M C;  2AQ2 B;  3PO2 B;  4GLV B;  4ZCK A;  1B53 A;  3NEM A;  2E2I H;  4A3M H;  3SXH A;  2CVR A;  1SE2 A;  5I2Y A;  4A3E H;  4OWW B;  1HCZ A;  3K8A A;  4P75 A;  2ZM6 Q;  3DMU A;  2Y0S G;  1B9N A;  5C3E G;  3S16 H;  1K8G A;  1A8V A;  1IL2 A;  1GOZ A;  2ZM6 L;  1YJ9 A;  4OX9 Q;  2VS1 A;  4GN4 B;  1NE3 A;  3CQZ B;  3EQL C;  2BE5 C;  2GA4 B;  4IPC A;  1PTO D;  4JVZ A;  3PMF A;  4UDU C;  4GNX B;  5M5X H;  4JI3 Q;  2Z9H A;  3VR4 A;  1EY5 A;  2NVX B;  2O5J C;  4JI3 L;  1NNX A;  3CCQ A;  1IBK Q;  1L0X B;  2JEB I;  2MPM A;  3WOF A;  1U4M A;  1LTI D;  1PH8 A;  1NCV A;  2VY3 A;  2YTV A;  4OGQ C;  3TP8 A;  5IGF A;  2IJ0 A;  3RNU A;  1CT1 D;  1YVC A;  1FR3 A;  4HJA A;  2F0H A;  1SYE A;  4NXM Q;  1X65 A;  3EVQ A;  1PRT D;  2L11 A;  3HOZ G;  1D6E C;  4CKE A;  5C4X H;  4X3S A;  4EGV A;  4A3D G;  3R8B A;  3PO2 H;  3BJU A;  5JJZ A;  3D31 A;  1FNU A;  1V9P A;  4DUY Q;  1RIP A;  1N8R C;  2EQS A;  2J4X A;  2R7F A;  3IFD A;  4OHJ A;  3F2D A;  4H44 C;  3D6C A;  1W6K A;  1PZJ D;  3E6Z X;  2XRQ D;  5FLM G;  1EOT A;  3AMU A;  1S5E D;  1Z47 A;  3SK8 A;  1A3V A;  2K03 A;  1EEF D;  2A6E C;  4NKL A;  3P7J A;  3PIP A;  3NBH B;  2RDH A;  3CMA A;  1UE7 A;  4LF8 Q;  4Q5V A;  2WB1 E;  4FDB A;  1XJV A;  5IYD G;  4HJ5 A;  1YIJ A;  2E2D C;  2NVX H;  5IWA L;  3NUC A;  1SYD A;  2CCZ A;  4LF8 L;  4IFD I;  3W5O A;  2NN6 G;  2JA5 B;  1TXY A;  5EBC A;  3KJP A;  2LXK A;  1GUG A;  3H6M A;  2UXB L;  1DXM A;  2Q8I B;  3T16 A;  1X32 A;  5ELC A;  1GHK A;  3TN2 A;  3A5U A;  2WP8 J;  1WI5 A;  5ELB A;  3CPF A;  2EDG A;  3K6O A;  4N9P A;  2JA7 G;  1BBW A;  3I8Z A;  1VQ7 A;  4NW2 A;  4G57 A;  3CD6 A;  2K7V A;  1IBL Q;  4C3I B;  4BBR B;  2WIN B;  4BY7 H;  1F9P A;  1JC7 A;  3RMH A;  4PMC A;  1XPU A;  4IN3 A;  4JI7 Q;  1LTL A;  4DFA A;  4IOC A;  5CV5 A;  1YNJ D;  3PCO B;  4P74 A;  4MN3 A;  4OXP A;  1BOS A;  4JI7 L;  1Q7Y C;  4KK7 A;  4BXX H;  4I7Z C;  1KIX A;  4RKL A;  2QGQ A;  1MJC A;  5JAV A;  2ICE C;  3EFX D;  1K9M C;  4QL5 A;  2SNM A;  3CF5 A;  1B44 D;  2F0I A;  4DK3 C;  4ZK9 B;  5D3D A;  1IZ6 A;  2Q2I A;  3L9A X;  3NE5 B;  3X3N A;  5FO9 B;  2LMC B;  2VUM B;  3FKI G;  4IUU A;  3MEH A;  4RA8 A;  4R8N A;  5LL6 X;  3OW2 A;  1CZW A;  5EKI A;  4R4C A;  1BQQ T;  2PW7 A;  1SNQ A;  2QCP X;  5KNC A;  1EWC A;  2CWA A;  1MGS A;  1L1O B;  4A4I A;  4B3R Q;  2UUB Q;  2D62 A;  1WTX A;  3MVV A;  1PA6 A;  4A93 H;  2D2C C;  1WCM B;  2UUC Q;  3I4N B;  2F0S A;  4B3R L;  1FNV A;  2PNR C;  1HZC A;  2UUB L;  4R4I A;  1SR3 A;  2PQA B;  2UUC L;  1A2T A;  2DGY A;  4DGZ A;  4H02 A;  4WOR A;  4BBR H;  3J80 L;  1B8A A;  3J81 L;  2Z4I A;  3HKZ G;  2HHH Q;  4BBS B;  1HUN A;  2F0M A;  1A2U A;  2HHH L;  1XXG A;  4RG1 A;  1EQR A;  3VYU A;  3E3X A;  2K14 A;  4F88 A;  1Q82 C;  1CSP A;  2OXP A;  4DAP A;  2X69 A;  1S5F D;  1TWH B;  1VQ4 A;  3I4O A;  5M5Y B;  1STN A;  1FJG Q;  4HSP A;  1GUW A;  4A3G H;  4F8M A;  3OWF A;  1MSG A;  3D6W A;  4J6H A;  5I6W A;  4LF6 Q;  1NJI C;  2G5D A;  3J81 j;  2OQK A;  2X6L A;  4LF6 L;  2QKI C;  2OWO A;  3D0F A;  5C6A A;  1HNW Q;  1RTN A;  2KUM A;  3FPP A;  4A75 A;  3CCU A;  2R7Z G;  4DR1 L;  3BS1 A;  2E76 C;  2WKC A;  4KD3 A;  1JOK A;  1I6H B;  3H3V H;  1CQV A;  1E0B A;  4IQZ A;  4TRD A;  1WCM H;  3I4N H;  2B63 G;  5J39 A;  1LT5 D;  3QG1 A;  2F0U A;  1JWS D;  4C2M B;  2NVT H;  4P72 A;  4MNO A;  3SDZ A;  4AYB G;  2DY7 A;  2VZA A;  4KLK A;  3A54 A;  4L5Q A;  1W6J A;  3KF8 B;  5CV6 A;  4Y52 H;  1EUJ A;  4JBK A;  1PV4 A;  3LX0 A;  5C4Z A;  1YJW A;  1HA6 A;  4A3J H;  1SMY D;  1RTO A;  2L5T A;  2F3V A;  5EQ0 A;  4QQB X;  1DOM A;  1WYD A;  4KD4 A;  5IGC A;  1TY2 A;  4X65 Q;  1PVO A;  1P8L A;  1TWH H;  2BOS A;  4C1N K;  1PFM A;  3PUX A;  4B3M Q;  4X62 Q;  1LT6 D;  2B2V C;  4X65 L;  3OTO Q;  4B3M L;  3S1R H;  4X62 L;  2KEE A;  4DV5 Q;  3OTO L;  3G6E A;  2F4V Q;  2UXD L;  5BN5 A;  4DV5 L;  3KYH C;  3TQY A;  1SNM A;  1SYB A;  2F4V L;  5EAY A;  4K6L A;  4X6A H;  1EU4 A;  1STB A;  4DAY A;  3NEL A;  3GO5 A;  5A2Q E;  5IIF A;  4A3K H;  5IP9 G;  2K32 A;  2QDL A;  1I6H H;  2EYF A;  3ULP A;  4CDF C;  2WAQ G;  5IGG A;  4I7A A;  3BYT B;  2IX1 A;  1SJH D;  2KCC A;  3U9O A;  3S2H B;  2F0F A;  2G9D A;  5DLQ E;  4C2M H;  4UY8 C;  1ILQ A;  4NXN Q;  1GVP A;  4B3S L;  4U68 A;  4H0L C;  1H9K A;  4X3U A;  3Q0A A;  2BCO A;  3HZX A;  3TS0 A;  4XQN A;  3HOU B;  2RCN A;  2LFN A;  3JAM E;  2EYM A;  4NB3 A;  1PTO F;  3KF6 A;  1UEB A;  1MKH A;  3S1M B;  4GOP A;  2GVB A;  3RD4 A;  2VB3 X;  4MZ9 A;  1B2T A;  3TP6 A;  4JV5 L;  2KEC A;  3SGI A;  2Z0S A;  4KY7 A;  3NSW A;  3DM3 A;  1EQQ A;  1TKW B;  3SHL A;  3PUW A;  5E1F A;  2NN6 I;  3M4Y A;  1P16 A;  1S4Z A;  2E8G A;  1RKN A;  4G7Z C;  1VMC A;  4ZQ3 A;  2F0L A;  1T9H A;  4OO1 I;  1PRT F;  1JE4 A;  3UE1 A;  2KHS A;  1VQA A;  2HIV A;  2V4D A;  2PO4 A;  1TWC B;  5IT9 L;  1A0I A;  1SNP A;  3F8T A;  1TQO A;  4GN5 A;  2HDL A;  4OL7 A;  3D3R A;  4XYO A;  3OMG A;  1JJG A;  4HR7 B;  1BR9 A;  1TWG H;  4DNI A;  3G4S A;  5C3X A;  1S5B D;  2JA8 H;  1TVX A;  3WOE A;  2RBM A;  3KFU A;  1IYJ B;  2EY5 A;  1J8I A;  5K36 G;  3H0G G;  1JR0 D;  5I4D A;  2A68 D;  5GQO A;  3S1M H;  2RVL A;  2YTX A;  1T5X D;  1TS2 A;  4DF7 A;  4OEM B;  4HID A;  5CGK A;  3STB D;  3KDF B;  1MBY A;  1E1T A;  1JE5 A;  1KAA A;  3BZD B;  1YHB A;  1SXT A;  4N9T A;  4DR6 Q;  2I0Q A;  3H09 A;  2ID0 A;  3GTG H;  1EYD A;  3VYR A;  3TS2 A;  2EYJ A;  5E7N A;  1PH3 A;  2QA4 A;  1IKL A;  1LLR D;  2LSS A;  2PYK A;  2PI2 A;  4FVM A;  4O2D A;  1JJ2 A;  2XWB B;  4K2K A;  2B2U C;  2MO1 A;  3KBX A;  2B29 A;  1ENF A;  5BN3 A;  4ZUI A;  4CGY B;  5KNB A;  2JA5 G;  1VQ8 A;  2BA0 A;  1WTH A;  5C5M A;  3V96 A;  5M3F B;  4LF4 Q;  3HOX B;  2N49 A;  1HUM A;  4LF4 L;  3E0E A;  1KDA A;  5IYC G;  1JOR A;  3F1Z A;  4UAI A;  1MHW C;  2R7D A;  2JJQ A;  2L0C A;  3NQI A;  1DOK A;  2IX0 A;  1Y8N B;  4TSS A;  2F0G A;  2ZXR A;  3R3O A;  4C3I G;  1G51 A;  2HT1 A;  2JP1 A;  3K7A H;  3ZYY X;  2B2V A;  1KDC A;  1VQC A;  2NB0 A;  1IBM Q;  2J7Z A;  1DD2 A;  1E2Z A;  3PO3 G;  5IGE A;  3J81 c;  2IWH A;  4R4O A;  2PMZ E;  4K5W A;  5I6Y A;  4EQO A;  2R92 G;  1YNN C;  2KHJ A;  1N36 Q;  3RZO B;  3A74 A;  4N8F A;  4O1N A;  3DWA A;  1F9S A;  3J7Y W;  1K8A C;  3CC4 A;  3E9H A;  5FK9 C;  1N36 L;  4GKJ Q;  4YCW A;  4GN3 B;  3DM1 A;  1LUZ A;  1QVC A;  1K83 H;  1LV9 A;  4FXK C;  4LW1 A;  3T13 A;  2F0J A;  4IFD G;  2RA4 A;  4DR3 Q;  2VUM G;  4A3L H;  1PYB A;  2ZJQ A;  4DR3 L;  1AZP A;  3OYY A;  5M3F H;  1PLF A;  5IOC A;  1I3Q B;  4AIM A;  4IJH A;  3CC7 A;  2BDO A;  3E9I A;  4UHV A;  4AYB E;  1UUP A;  5IOD A;  3BU2 A;  1L1O C;  1O7L A;  4B3T L;  1XTD A;  1LAC A;  1BVS A;  2Z6B A;  1VQK A;  1I4X A;  1M4V A;  2PMZ B;  3BDO A;  1K73 C;  4A76 A;  1HTL D;  2UXC Q;  4BBS G;  1QZG A;  2A6E D;  2SNS A;  3K5M A;  1LTS D;  3KJO A;  4CKC A;  1V8Q A;  4Y7N B;  4YWL A;  1KTK A;  2D9U A;  5KYL A;  4RMF A;  5LMU Q;  1II3 A;  3RZO H;  2BH8 A;  3S14 H;  1PTO B;  3MZ5 A;  4JCV E;  4JPB W;  4DR5 Q;  4L6T B;  2OT2 A;  2QDB A;  5LMU L;  3D4W A;  4AQY L;  4TVA B;  1W2B A;  1LTR D;  4GNX A;  4DR5 L;  3KK7 A;  1IW7 C;  4HN7 A;  5JOB A;  5C44 B;  2NVQ B;  2BH2 A;  4KN4 C;  3LNN A;  3C3L A;  1B9M A;  2BA1 A;  3NHH A;  1CUK A;  2QW7 A;  1GUO A;  2XTI A;  4PQX A;  1ET6 A;  3A56 A;  1HPC A;  4KY5 A;  4YCV A;  3GTL B;  2RQX A;  4LMQ D;  4BA2 I;  1YHA A;  3MXP A;  3TEH B;  3C1F A;  3MAQ A;  1I3Q H;  1U0L A;  4JOI A;  5C4H A;  2E2I B;  4LUZ A;  2F3I A;  2R3Z A;  3VDY A;  4A3M B;  1YBY A;  1PRT B;  2KCT A;  3CRL C;  2HIX A;  4RGN A;  1A63 A;  2ZJP A;  4CKB A;  1Y1V B;  4A3I H;  4QUF A;  2N88 A;  3I3C A;  4DV4 Q;  1SRO A;  4ABN A;  1ASZ A;  3UDF A;  3PGZ A;  3MFY A;  3HOY H;  4DV4 L;  5A35 A;  4QF4 A;  2Q8R E;  4DR2 Q;  5FJ8 H;  3S1N H;  5IY0 A;  3I70 A;  3MXN B;  3TDQ A;  4DR2 L;  2HCI A;  1BBU A;  1PTO H;  1HNZ Q;  4FP5 D;  3K81 C;  2EJM A;  2Q2T A;  3VYT A;  3NBH A;  2X6G A;  2A6H C;  4LF5 L;  1MD2 D;  2ZXO A;  1HJP A;  4GLX A;  1F9R A;  5C44 H;  2OTJ A;  3SVM A;  1XPO A;  1EQT A;  5C4X B;  3GV3 A;  3GTL H;  2DY8 A;  1PFB A;  3IRB A;  3RR5 A;  4CJ0 B;  3AFQ A;  2XSC A;  5IGD A;  1RD9 D;  3D4R A;  5HGT A;  4JI6 L;  3HG9 A;  1PH6 A;  2R93 H;  2Q2H A;  1EIY B;  5IT9 c;  3CCR A;  1Y1V H;  1PZK D;  2ZXP A;  3HOU G;  2BDN A;  2N3S A;  2YV5 A;  4PMB A;  1TY0 A;  4JG2 A;  4IPH A;  1W3S A;  3URY A;  2YYZ A;  4WJW A;  5DEH A;  4B9W A;  2VNU D;  2KJX A;  5ELO A;  2KED A;  2WII B;  3GTQ B;  1YNX A;  1Z9F A;  4LUV A;  1SYF A;  2CQA A;  1HTP A;  2I46 A;  1L0W A;  2E74 C;  3SK5 A;  3MWY W;  1LT3 D;  2JEA I;  1HZB A;  4X3T A;  5CV7 A;  1R9T B;  5T1I A;  2LY7 A;  3NBI A;  1TR5 A;  4KJN A;  1L1O A;  1LT4 D;  5JEA H;  1TS5 A;  2HUG A;  3D4D A;  5EBD A;  2QEX A;  2H1E A;  4BY7 B;  1C0A A;  5IGB A;  1H9J A;  2DN8 A;  2PQA A;  5JJK A;  1G91 A;  2F0D A;  5GAH C;  2K05 A;  2OCE A;  1T5E A;  5FKA C;  1X3E A;  4POF A;  1PH9 A;  4C3J G;  1Q12 A;  1OTC A;  2NYZ D;  1MI2 A;  2EYH A;  1NUC A;  2I5H A;  4IUR A;  4APV A;  1YZ6 A;  1QZH A;  1FNW A;  2NTT A;  2Z6K A;  4XXE A;  5IYB H;  4M1U B;  3DEP A;  1KLU D;  1OXT A;  3DWP A;  1WTP A;  2EIF A;  2KCM A;  3DXJ C;  5DNF A;  5IWA Q;  3K80 C;  2ATW A;  1BUV T;  4ZKB B;  1YHQ A;  2CH4 A;  4B08 A;  3GTQ H;  1PMR A;  2UXB Q;  1D1K A;  5CV4 A;  4FXG C;  1WVL A;  5I2X A;  3FPU B;  1A62 A;  1ICF B;  2EYP A;  3I73 A;  1QNU A;  1N32 Q;  2A69 C;  1G2T A;  1IYV A;  3PIP 3;  4OO1 G;  1QG7 A;  3BVM A;  4A93 B;  1N32 L;  5C4J H;  1R9T H;  3H3V I;  4PZ8 A;  1U9R A;  2R61 A;  5GAD C;  2SDF A;  3BDL A;  4RGT A;  5IE8 A;  1K0S A;  3OIP A;  1VQD A;  1KNE A;  2AWO A;  2Z4H A;  2JA6 B;  1BCP C;  4HAE A;  2K5W A;  3HP3 A;  3HOX G;  1QUQ B;  5A2Q L;  3KLR A;  3KF8 A;  3TME A;  2H5X A;  5CMD A;  5JJL A;  2ZTD A;  4QMG A;  4MTN A;  1KQS A;  4A3G B;  5M3M G;  4XQQ A;  4GOP C;  3MHB A;  1SLJ A;  4ZAI A;  1VQN A;  1CA5 A;  1HRJ A;  5G3L D;  2F4I A;  3BZC A;  3I4L A;  5D14 A;  5ELE A;  1NR4 A;  1WTQ A;  3QJY A;  4KKT A;  3JAM L;  3GTO B;  4K5V A;  3GD7 A;  2NVY H;  3HFZ B;  3BVG A;  2RF4 A;  5I9O A;  3QIA A;  2MQH A;  2A8V A;  1CKM A;  3W1B A;  3I4M G;  1F77 A;  4DPG A;  1H9M A;  4BY1 B;  2E2J B;  1KAB A;  1JOO A;  1VQF A;  4V0B A;  4R4T A;  4UP8 A;  4DR4 Q;  2ALY B;  2RSN A;  3K58 A;  1X3Q A;  1Y8O B;  2NVT B;  5IP7 H;  3TZU A;  4AH6 A;  3K5N A;  2K1B A;  4ZKC B;  5JEA J;  4DR4 L;  3QB3 A;  2P5Z X;  1J9O A;  3UDI A;  2IX3 A;  1G8Z D;  3M4O B;  2JA6 H;  2Z1C A;  1JB7 A;  1V43 A;  4A3J B;  5C0X G;  4C3H B;  4JBW A;  1Z7T A;  3KOJ A;  2JA9 A;  4CDD C;  2E2H B;  1H9R A;  5C3W A;  5EKK A;  2NUC A;  1GKH A;  1KC8 C;  1HR0 L;  1SAP A;  4A3C G;  1X56 A;  4EQN A;  3WWV A;  5ELN A;  1JMC A;  3LGJ A;  3S1R B;  1VQ6 A;  2VXW A;  3PUZ A;  3TZD A;  1VCI A;  4LK1 C;  2O2L D;  2FMC A;  1QCB D;  2B2T C;  4KHZ A;  3NTK A;  3DEO A;  2EXD A;  4LF9 Q;  4ZLT F;  3GTO H;  4GKK Q;  4B9X A;  5ELF A;  1K3R A;  4DR1 Q;  4LF9 L;  1SND A;  4GKK L;  1SE8 A;  1EYC A;  4K2L A;  5CBE E;  3U4V A;  4CBV A;  4A3K B;  2ZT9 C;  1PHJ A;  2E2J H;  4BY1 H;  1G6Z A;  1FD7 D;  5JVG 3;  3FRP B;  3GQB A;  5EPJ A;  3FMC A;  2JN4 A;  5FLX c;  3M4O H;  5FOB B;  1LYL A;  3NXW A;  4C3H H;  4RGM A;  4DUZ Q;  4L5S A;  1VQB A;  2ZTC A;  4A3M G;  3HOV B;  2B2W A;  5DM7 3;  4A3F H;  2E2H H;  3N52 A;  4DUZ L;  2TSS A;  4A3E G;  1LTB D;  4JI1 Q;  3CRK C;  1PRT C;  1SE3 A;  2KBN A;  3SE0 A;  3GTM B;  2OEO A;  1EY4 A;  3ERS X;  5COY A;  3PV0 A;  2KCN A;  2MGS A;  4A3B B;  2H4O A;  4JI1 L;  1EY8 A;  1SEB D;  4HIM A;  2UXD Q;  5T1G A;  1JQY D;  2UU9 Q;  4HCS A;  4LF7 Q;  1VF5 C;  3ICE A;  3KDF A;  4L8J A;  5E4X A;  4ULL A;  2UU9 L;  4DV1 L;  1ASY A;  2ICI A;  3QO2 A;  4LF7 L;  3CXC A;  2F0O A;  4P73 A;  3HKS A;  1QOH A;  2O4X A;  2F0T A;  3A5Z B;  3KBG A;  1N9W A;  3A8K E;  2K5Q A;  3L2P A;  4B3S Q;  1SJE D;  1TWG B;  4QIW B;  2C5C A;  1S3O A;  4K5X A;  4CHT B;  1CHP D;  3LWE A;  4WJ4 A;  1DYQ A;  2FJ2 A;  1B7Y B;  5C4X G;  2JXM B;  2JA8 B;  2NTS A;  1PZI D;  2DJF C;  4KHV A;  2NZH A;  1CFM A;  3PO2 G;  4QJF A;  1CKN B;  4X3K A;  5EKL A;  3HOV H;  2YU9 B;  1JOQ A;  2N78 A;  4JV5 Q;  1LM0 A;  1GUN A;  1DCZ A;  1VMP A;  3HOW H;  3GTM H;  3D8G A;  3PIO 3;  2C9O A;  2Y0S B;  4A3B H;  3TRZ A;  5C3E B;  3E5S A;  4LUO A;  1VDZ A;  1C7Y A;  3GTG B;  2CWP A;  2NWG A;  3A8I E;  2M2L A;  1Y1W H;  2Q8T A;  2A19 A;  4EX5 A;  3ND8 A;  1YNJ C;  1IW7 D;  1I4P A;  5NUC A;  1VQM A;  4QUC A;  5HY6 A;  5ELD A;  1BNZ A;  4GNX C;  4NP5 A;  1WD0 A;  1BBX C;  1O7Y A;  2K5D A;  2PNH A;  2N8N A;  4K6D A;  4RH6 A;  4R1J A;  3G48 A;  3L7Z C;  3QR8 A;  4V19 0;  4IFD J;  4XDX A;  3DLL A;  4LFC Q;  1PH2 A;  1WFQ A;  3AFP A;  4F87 A;  3M7G A;  4JOI C;  3HOZ B;  2B3G A;  4LFC L;  4CJ1 B;  1Q1B A;  4A3D B;  1F2L A;  1EL0 A;  4OIJ A;  1QVG A;  3K7A B;  4LNQ A;  3U9S A;  4FYD A;  2YU9 H;  4BY7 G;  3S17 B;  1X3F A;  5DM6 3;  4EQ5 A;  1U4P A;  1NMF A;  5C3E H;  3G71 A;  1K8O A;  1SNC A;  3GTJ H;  3L3O C;  2B2T A;  1J6Q A;  4H13 C;  3BG3 A;  1NAP A;  2B39 A;  4BXX G;  4O0A A;  1CSQ A;  3UDX A;  1A6X A;  1K83 B;  1X54 A;  3M9B A;  1EIG A;  1QNK A;  3NWT A;  1ET9 A;  1XPR A;  2K28 A;  1BF4 A;  4DKA C;  4NMZ A;  4BA1 I;  5C0X I;  2HDM A;  3BVZ A;  3Q24 A;  4A93 G;  4ILW A;  4DV3 Q;  2F3W A;  3HOZ H;  3CCS A;  1EYA A;  2NZO A;  3TBI B;  4LJZ C;  4A3D H;  1HQR D;  4DV3 L;  2K04 A;  1EY0 A;  1VQ5 A;  4U67 3;  3K7U C;  3SEB A;  4BBR G;  5G3L F;  2RCF A;  4DK1 A;  2XGT A;  4PNY A;  4RFB A;  3RLF A;  1OXX K;  2K52 A;  5COR A;  3S17 H;  2BE5 D;  3K57 A;  3J80 c;  4YCU A;  4EVO A;  2VB2 X;  3IFT A;  2A73 B;  1VQG A;  2VL6 A;  5FLM H;  1LO5 D;  2SEB D;  1XNQ Q;  2I5M X;  2LS0 1;  1NSN S;  2AHO B;  4QCL A;  2C35 B;  3S14 B;  1C48 A;  1K8M A;  4DV2 Q;  4A3G G;  1XNQ L;  1SMY C;  3F2U A;  1F9Q A;  4L5R C;  1UNS A;  4OIK A;  4XQJ A;  4DV2 L;  3GTK B;  2Z8L A;  3MXN A;  4HIK A;  3S15 H;  4YIJ A;  3NK9 A;  3CCJ A;  1D5Z C;  4FF2 A;  4LFB Q;  5IYD H;  3CME A;  3FKI B;  1WTR A;  1ICW A;  3BYY B;  1EY9 A;  1KDB A;  2NN6 H;  1JWU D;  4J1M A;  4Q0F A;  4LFB L;  1I4H A;  2L4N A;  2EE1 A;  2K5V A;  4RKB A;  1Q3L A;  3HEJ A;  4B3T Q;  1NMG A;  5J3B A;  1WCM G;  3HRZ C;  1J5E Q;  3I4N G;  4IUQ A;  1ROD A;  2JA7 H;  3H3V C;  2FXQ A;  2AQ1 B;  1PYS B;  2CW0 C;  1J5E L;  3J7A V;  3CKI B;  4KKU A;  4A3I B;  1LTG D;  4H7B A;  3MA2 B;  2F0E A;  2EY6 A;  3HKZ B;  3S9W A;  4I65 A;  2CHB D;  1EYG A;  3HOY B;  4A3J G;  3HGB A;  5EPL A;  2DNE A;  5JVH 3;  5D65 A;  1PH1 A;  3S1N B;  3T1Y Q;  1Y14 B;  4AQY Q;  3QWN A;  1EIF A;  2Z6K C;  3T1Y L;  5DAU A;  3M3Y H;  1SNO A;  4KTA A;  1G2S A;  4RCO A;  3OPO A;  4PZ6 A;  2D0O A;  1XTC D;  3GTK H;  2A69 D;  3I7F A;  1H95 A;  2RHS B;  3UI2 A;  1BO0 A;  1HQM C;  5ISR A;  3FKI H;  3CAM A;  3PSI A;  4O42 A;  4WFN 3;  4JI8 L;  3GTP H;  2M00 A;  2NZ1 D;  1IXR A;  1GD7 A;  1KAW A;  4NPS A;  2VQF Q;  1M1K C;  5HUR A;  3RLO A;  1EOV A;  4A3K G;  1UE5 A;  1BCP D;  3RZD B;  1HNX Q;  3P1H A;  4KKS A;  2VQF L;  1Q1E A;  1ML0 D;  5KRU A;  2B63 B;  2R93 B;  4UP7 A;  1HNX L;  2K75 A;  3N6R A;  2QIL A;  2OTL A;  4DNR B;  1I4G A;  3I90 A;  4G7O C;  3GV6 A;  1UE6 A;  4X66 Q;  2G9H D;  1SYC A;  1SMX A;  5KND A;  2EJG C;  1HH2 P;  4X66 L;  3SK4 A;  3OSO A;  2AWN A;  4ZYS A;  3HS0 C;  1OXU A;  5HGQ A;  2F0Q A;  3TP7 A;  3PF5 A;  4IPG A;  1KL9 A;  3CU7 A;  4ID6 A;  3UDG A;  1SN8 A;  2XRS D;  4UP9 A;  3K0X A;  1AW7 A;  3VR2 A;  4LF5 Q;  3FHW A;  1SE4 A;  3OHX C;  1S5D D;  1SRU A;  4PG3 A;  1XMQ L;  1S40 A;  2EY1 A;  2A68 C;  3I2Z A;  2ENB A;  3STB C;  2K5H A;  1KXL A;  1B1Z A;  1EY7 A;  1Y8P B;  1RF2 D;  4HMJ A;  4DV0 Q;  2K01 A;  2UUA L;  1PH5 A;  1R4Q B;  1CA6 A;  4HSV A;  2R7Z H;  4JI6 Q;  3PUV A;  4IZ8 A;  4DV0 L;  3ITP A;  4RCN A;  3RZD H;  1IL8 A;  2WAQ B;  1M90 C;  3J7A F;  4J15 A;  2B63 H;  2L9H A;  3H91 A;  2F0W A;  1EIH A;  2N55 A;  4DAM A;  2IHF A;  1K0R A;  3BDC A;  2JA8 G;  1TWA H;  1IYU A;  4HJ9 A;  1QUQ A;  1WJJ A;  1E1O A;  4XT1 B;  4OWX B;  4ZRZ A;  1HFG A;  2AKW B;  3W3A A;  4KI0 A;  3S2D B;  1FGB D;  1ENC A;  2V1C C;  2FIN B;  1QJO A;  3K0Y A;  4KJO A;  2KVM A;  3J80 i;  5CBA E;  4ODG A;  3J81 i;  1WTW A;  3S24 A;  1H9S B;  1DOL A;  4IUP A;  4OX9 L;  4IUV A;  5C4J B;  4L63 B;  4GLA C;  1E7Z A;  2MUY A;  3H15 A;  1VQJ A;  2B2Y C;  3CCL A;  2J0T D;  4DNT B;  3Q23 A;  5IP9 H;  1FGU A;  2XNA C;  3K59 A;  4JYA Q;  1ZEQ X;  1IBK L;  1U5K A;  1RHP A;  1G6P A;  2PZU A;  1HHV A;  2IPK D;  4HED A;  4JYA L;  2F0V A;  1TWF H;  4DN4 M;  4ME5 A;  2JYO A;  1QWY A;  2HQE A;  1SFO H;  1EEI D;  2XN9 C;  1MSH A;  1CKO A;  1Q86 C;  5F2D A;  1TS3 A;  4NXM L;  2B2W C;  5C0X J;  4KMU C;  3VA5 A;  2GVA A;  2VQE Q;  3T1H Q;  1B4O A;  1FVI A;  2RDF A;  3H0G B;  1AN8 A;  1PFS A;  1RL2 A;  2VQE L;  3T1H L;  1X6O A;  5CV9 A;  1D2B A;  3J7Z C;  3OW7 A;  3I56 A;  4DUY L;  3S2D H;  1A3U A;  1EY6 A;  4BWG B;  4HIO A;  2NVY B;  4IAL A;  4FXD A;  1JJC B;  1L2F A;  2AUK A;  2EJF C;  1PDQ A;  3KUP A;  3CQZ H;  1O7I A;  1VQ9 A;  1K3B C;  3ULL A;  4K8I A;  1CTM A;  1VQH A;  4DR7 Q;  1M8A A;  1EZ6 A;  1O80 A;  3Q22 A;  1V1P B;  3T53 B;  4A3L G;  4DR7 L;  5E4W C;  1ESF A;  1STA A;  3KLS A;  4JI5 Q;  5M3F G;  1DGS A;  1O78 A;  3CP0 A;  3KLS X;  4K0K Q;  4JI5 L;  2OF1 A;  1WTV A;  3NP8 A;  2R6G A;  4POG A;  4K0K L;  2M9V A;  2I07 B;  2F1M A;  3I91 A;  4LAA A;  1N33 Q;  1ZYR C;  5EPK A;  2L55 A;  3GP7 A;  2AQ3 B;  3VA7 A;  4R8I A;  2PZT A;  2CH4 W;  4QY7 A;  1N33 L;  4RGO S;  5K36 H;  5CYU A;  3H0G H;  1JT8 A;  1HA5 A;  3BZK A;  5J22 A;  1IBL L;  4DV7 Q;  3M4P A;  3PO3 B;  3FVQ A;  1DJR D;  2XVS A;  1JWM D;  3A7L A;  4OWT B;  2ZJR A;  4DV7 L;  2KA7 A;  2IL8 A;  5FO8 B;  3UE0 A;  2R92 B;  4YWK A;  4IUN A;  1D1I A;  2WB1 B;  5FLX E;  1UEA B;  1D8L A;  1EZ8 A;  1E22 A;  5LHY 1;  1YEZ A;  1B3Q A;  3TSS A;  1VQI A;  1AE2 A;  4P71 A;  1ENA A;  1NY4 A;  5J1Z A;  5LL6 S;  2GN5 A;  4JI0 Q;  4OEL B;  4PZ7 A;  2KOL A;  2XIW A;  4DK0 A;  4G7H C;  2IW3 A;  4JI0 L;  4L5T A;  2JA5 H;  1GO3 E;  4DXF A;  2EY2 A;  3M85 A;  1EWI A;  1MIU A;  4M8A A;  4HTH A;  2PPB C;  4TQU S;  5E3F A;  3B6Y A;  2DUD A;  2E5L Q;  1HR0 Q;  4XT3 B;  4A3F B;  5IYC H;  3T51 B;  2ASB A;  2E5L L;  1KD1 C;  1KRS A;  1IHZ A;  1X55 A;  3M4Q A;  1CKN A;  1Q46 A;  4C3I H;  1A15 A;  5M5W B;  4A3I G;  1CHQ D;  1WTO A;  1VQL A;  4YHH Q;  1HZ9 A;  3O13 A;  5JJI A;  3HOY G;  1V1Q A;  3PO3 H;  4YHH L;  2CFM A;  4K8J A;  1XMO Q;  3ZJY C;  4YWM A;  5FJ8 G;  2JK8 A;  2RHQ B;  2HQL A;  1EFW A;  2R92 H;  2MP1 A;  1XMO L;  1RCV D;  1NR2 A;  1LTT D;  1BCP F;  2B2Y A;  1FJG L;  4DV6 Q;  1PTO C;  2WV6 D;  3U50 C;  2F52 A;  5D3I B;  1ILP A;  1HXY D;  5C44 G;  4IFD H;  4DV6 L;  5EGT A;  2VUM H;  2A1A A;  3J7A 5;  2ES2 A;  1U4L A;  1VQP A;  4S3S A;  5TSS A;  2RSO A;  4FF1 A;  4QIW E;  3A55 A;  1WOC A;  4FNF A;  2F0P A;  2EYL A;  4FF4 A;  1HNW L;  5KGU A;  2F03 A;  1D7Q A;  1F2M A;  5AJ3 Q;  2R93 G;  2K6A A;  1I6V C;  3HOW B;  4XIG S;  1YIT A;  1VS0 A;  1I4R A;  1Y1V G;  2MJ8 A;  1YNN D;  1R4P B;  3R2I A;  3RLN A;  5M5W H;  5AJ3 L;  3Q6S A;  1CM9 A;  4BBS H;  4DV1 Q;  5C5L A;  3F2C A;  1STE A;  3K5L A;  1Y1W B;  1C4Q A;  3E0J A;  2Y0S E;  3RN5 A;  1EFI D;  1E24 A;  1E3P A;  5M5Y H;  1BKB A;  3V2T A;  1GHJ A;  1ZXT A;  4CDC C;  4IOA A;  2CKZ B;  1FL0 A;  3GDE A;  2EPB A;  2F0N A;  4ME3 A;  1A3T A;  1TT2 A;  1AFP A;  4DAV A;  3V05 A;  1Q8I A;  1N34 Q;  2Q2U A;  2WAC A;  1X9N A;  2SOB A;  1PH7 A;  1N34 L;  1I5F A;  2D5D A;  2LXJ A;  3G7L A;  3PF4 A;  1Q81 C;  4KHP Q;  4P2C B;  2CW0 D;  4N8X 1;  1TII D;  3S1Q B;  3EIV A;  5JEA G;  4KHP L;  3FP9 A;  1RDP D;  3MTS A;  3ONA B;  2JQO A;  1OXS C;  3A8J E;  5JPN C;  2L15 A;  1QVF A;  4UPA A;  1FYC A;  4IJL A;  1AP0 A;  1F2Y A;  1Q8K A;  2LKV A;  3GTJ B;  3PIO A;  4EQP A;  4MTK A;  3NWS A; 
#chains in the Genus database with same CATH homology
 3HOU G;  4NXN L;  4LFA Q;  2CWA A;  2N3S A;  2YV5 A;  2K5V A;  1L1O B;  4A4I A;  4JG2 A;  4B3T Q;  4B3R Q;  4IPH A;  1NMG A;  1W3S A;  2UUB Q;  2D62 A;  4LFA L;  5J3B A;  1PA6 A;  4A93 H;  3AQQ A;  5IYB G;  1WCM G;  2YYZ A;  1J5E Q;  3Q8D A;  4IO9 A;  1YJN A;  2UUC Q;  3H3V H;  3I4N G;  4B3R L;  2UUB L;  1HZC A;  1HR0 W;  2JA7 H;  4R4I A;  1SR3 A;  2FXQ A;  5ELO A;  1PYS B;  2PQA B;  2UUC L;  4ALP A;  1J5E L;  1YNX A;  1Z9F A;  2DGY A;  4H02 A;  4LUV A;  4BBR H;  1B8A A;  2YTY A;  2VNU D;  3HKZ G;  2HHH Q;  1EYG A;  4A3J G;  1L0W A;  2HHH L;  2ZTE A;  5LMN Q;  4RG1 A;  2JEA I;  1EQR A;  1HZB A;  2K14 A;  1Q82 C;  1CSP A;  1PH1 A;  3T1Y Q;  5LMN L;  1Y14 B;  1VQ4 A;  3I4O A;  4AQY Q;  4JBM A;  1EIF A;  2Z6K C;  4XTC S;  1L1O A;  4IPD A;  3T1Y L;  1FJG Q;  3M3Y H;  3S1Q H;  4LWC A;  4A3G H;  3AYH B;  2KHI A;  1KHI A;  2QEX A;  1C0A A;  4PZ6 A;  2D0O A;  3GTK H;  3I7F A;  4LF6 Q;  2JE6 I;  1NJI C;  1H95 A;  2RHS B;  2PQA A;  5JJK A;  3S2H H;  3W1G A;  5GAH C;  2K50 A;  3FKI H;  2OQK A;  3CAM A;  3PSI A;  3J81 j;  4JI8 L;  4PMW A;  4LF6 L;  2OCE A;  3GTP H;  1X3E A;  4POF A;  1PH9 A;  2OWO A;  3D0F A;  1Q12 A;  1OTC A;  1HNW Q;  3HOU H;  1IXR A;  1GD7 A;  4A75 A;  1KAW A;  4NPS A;  2VQF Q;  3CCU A;  4HJ8 A;  1M1K C;  2R7Z G;  2IY5 B;  4DR1 L;  2I5H A;  3RLO A;  1EOV A;  4A3K G;  3U58 A;  1OXV A;  1UE5 A;  4GS3 A;  1NTG A;  1UE1 A;  2D0P A;  1YZ6 A;  2Z6K A;  4APV A;  2VQF L;  1QZH A;  1HNX Q;  1Q1E A;  1WCM H;  5IYB H;  3I4N H;  5GAE C;  1OXT A;  2B63 G;  1KRT A;  2EIF A;  2KCM A;  5BR8 Q;  5IWA Q;  1I94 Q;  3K80 C;  4R4Q A;  4UP7 A;  2IT1 A;  2K75 A;  1HNX L;  2ATW A;  1YHQ A;  2OTL A;  2NVT H;  4P72 A;  4MNO A;  3GTQ H;  5BR8 L;  4AYB G;  4L5Q A;  2VZA A;  4KLK A;  1I94 L;  2UXB Q;  1UWV A;  1UE6 A;  3KF8 B;  4X66 Q;  1EUJ A;  3CPW A;  4JBK A;  4Y52 H;  1PV4 A;  3JAM c;  1SMX A;  1YJW A;  4A3J H;  1A62 A;  4DAY B;  1HH2 P;  4X66 L;  1N32 Q;  3F2B A;  4DR6 L;  4OO1 G;  2AWN A;  1GM5 A;  1OXU A;  3ER0 A;  5HGQ A;  1WYD A;  4QQB X;  1N32 L;  5C4J H;  3PF5 A;  4IPG A;  1KL9 A;  1R9T H;  2AMC B;  4PZ8 A;  1P8L A;  1TWH H;  4X65 Q;  3H3V I;  3UDG A;  1PVO A;  1SN8 A;  3PUX A;  4UP9 A;  3TRE A;  5GAD C;  5GAG C;  4X62 Q;  3K0X A;  4B3M Q;  5IP7 G;  4X65 L;  4LF5 Q;  3FHW A;  5IE8 A;  3OTO Q;  3AEV A;  4B3M L;  3S1R H;  1VQD A;  1SRU A;  4X62 L;  1TWC H;  2AWO A;  4DV5 Q;  2JA6 G;  4PG3 A;  1XMQ L;  1S40 A;  3PUY A;  3OTO L;  3CC2 A;  3I2Z A;  3G6E A;  2F4V Q;  2UXD L;  3HOX G;  1QUQ B;  4DV5 L;  3KYH C;  3TQY A;  3KF6 B;  3STB C;  3M7N A;  2K5H A;  2F4V L;  5EAY A;  1KXL A;  4QGU A;  4GKJ Q;  4C3J H;  4GOP B;  2H5X A;  3HKZ E;  4X6A H;  5JJL A;  4DV0 Q;  2UUA L;  1PH5 A;  3NEL A;  2ZTD A;  2R7Z H;  3GO5 A;  4MTN A;  3PUV A;  1KQS A;  4JI6 Q;  5M3M G;  4GOP C;  4A3K H;  5IP9 G;  4DV0 L;  1VQN A;  1SLJ A;  1I6H H;  3RZD H;  3ULP A;  3BZC A;  2WAQ G;  1M90 C;  4J15 A;  2B63 H;  4WJ3 M;  2IX1 A;  4JBJ A;  2K4K A;  5DLQ E;  4C2M H;  1IBM L;  2OQ0 A;  3GD7 A;  4UY8 C;  2NVY H;  4NXN Q;  1GVP A;  3HFZ B;  4DAM A;  4B3S L;  3EN2 A;  2IHF A;  2RF4 A;  3EBE A;  2IHE A;  1K0R A;  2MQH A;  3TS0 A;  2A8V A;  1CKM A;  2RCN A;  2WB1 G;  3W1B A;  2JA8 G;  1TWA H;  4JI4 Q;  3ULJ A;  4HJ9 A;  2CQO A;  3RN2 A;  1QUQ A;  1WJJ A;  3I4M G;  4DPG A;  1E1O A;  1AE3 A;  4NB3 A;  4BY1 G;  3KF6 A;  4OWX B;  4JI4 L;  1UEB A;  1AH9 A;  1MKH A;  1VQF A;  4GKJ L;  4GOP A;  2GVB A;  2MFI A;  2PI2 E;  4R4T A;  4UP8 A;  4DR4 Q;  2ALY B;  2AKW B;  4MZ9 A;  4KI0 A;  5IP7 H;  4AH6 A;  4JV5 L;  5JEA J;  4DR4 L;  3SGI A;  2Z0S A;  3DM3 A;  2V1C C;  3UDI A;  1EQQ A;  2JA6 H;  3PUW A;  1JB7 A;  1V43 A;  3A0J A;  5C0X G;  1HZA A;  2NN6 I;  3J80 i;  3JC6 6;  3J81 i;  4JBW A;  3S24 A;  3HOX H;  1P16 A;  2E8G A;  3KOJ A;  4OX9 L;  2JA9 A;  4A3F G;  5LMN W;  1T9H A;  4OO1 I;  4GLA C;  1E7Z A;  1NBW A;  1GKH A;  3UE1 A;  1KC8 C;  1VQA A;  2HIV A;  3H15 A;  1HR0 L;  1VQJ A;  3CCM A;  4A3C G;  1X56 A;  3CCL A;  5H1S E;  5M3M H;  3WWV A;  5IP9 H;  1FGU A;  5ELN A;  1JMC A;  3LGJ A;  4JC0 A;  1VQ6 A;  1A0I A;  3PUZ A;  4JYA Q;  3F8T A;  4GN5 A;  1IBK L;  1VCI A;  1U5K A;  4JI8 Q;  1JJG A;  1G6P A;  1TWG H;  4KHZ A;  4DNI A;  3GTO H;  2EXD A;  4LF9 Q;  4JYA L;  1TWF H;  2UXC L;  4GKK Q;  3G4S A;  1SFO H;  1K3R A;  4DR1 Q;  4HJ7 A;  4LF9 L;  1CKO A;  1Q86 C;  4GKK L;  1MJE A;  1SE8 A;  2I5L X;  2JA8 H;  2MO0 A;  3U4Z A;  4NXM L;  5C0X J;  3KFU A;  1IYJ B;  3U4V A;  3I4M H;  2GVA A;  2VQE Q;  3T1H Q;  5K36 G;  1PHJ A;  2E2J H;  4BY1 H;  1FVI A;  3H0G G;  1PFS A;  1RL2 A;  5GQO A;  2K5N A;  3S1M H;  2VQE L;  3T1H L;  1X6O A;  2YTX A;  3J7Z C;  4HID A;  3I56 A;  4DUY L;  3S2D H;  3STB D;  3KDF B;  4HIO A;  1E1T A;  1JE5 A;  4X64 Q;  2VW9 A;  1YHB A;  1JJC B;  5FLX c;  4JI2 Q;  1L2F A;  3M4O H;  2I0Q A;  2WAQ E;  3CCV A;  4DR6 Q;  1LYL A;  2ID0 A;  3GTG H;  4X64 L;  4C3H H;  3TS2 A;  5E7N A;  1G29 1;  3CQZ H;  1O7I A;  1PH3 A;  4JI2 L;  4DUZ Q;  1VQ9 A;  2KEN A;  2QA4 A;  4L5S A;  1VQB A;  2ZTC A;  4A3M G;  3ULL A;  3HOV G;  2LSS A;  4A3F H;  2E2H H;  2PI2 A;  4DUZ L;  4O2D A;  4A3E G;  1VQH A;  1JJ2 A;  4JI1 Q;  4DR7 Q;  1S72 A;  2KBN A;  2MO1 A;  3HOW G;  2B29 A;  4YY3 Q;  4A3C H;  3ERS X;  1XMQ Q;  4A3B G;  3PV0 A;  4A3L G;  4DR7 L;  4JI1 L;  1I50 H;  4OON A;  4HIM A;  1B70 B;  4DK6 C;  2JA5 G;  2UXD Q;  4YY3 L;  1YI2 A;  2BA0 A;  1VQ8 A;  2UU9 Q;  3I55 A;  1VQE A;  5M3F G;  4JI5 Q;  1DGS A;  3CP0 A;  4LF4 Q;  4LF7 Q;  4K0K Q;  3ICE A;  1Y1W G;  2N49 A;  3KDF A;  2UU9 L;  4DV1 L;  1ASY A;  4JI5 L;  4Y7N H;  4LF4 L;  4LF7 L;  2UUA Q;  2R6G A;  3L0O A;  3E0E A;  3CXC A;  4P73 A;  4POG A;  3NEN A;  3HKS A;  5IYC G;  4K0K L;  3F1Z A;  1X3G A;  2R7D A;  2JJQ A;  1N33 Q;  1VQO A;  3A5Z B;  2IX0 A;  4QY7 A;  3MEF A;  5GRO A;  1G51 A;  1N33 L;  2HT1 A;  1N9W A;  3K7A H;  1XNR Q;  3H0G H;  2MNA A;  3CCE A;  1JT8 A;  1VQC A;  3KLW A;  3L2P A;  1IBL L;  3BZK A;  1HNZ L;  1IBM Q;  4DV7 Q;  4B3S Q;  3CW2 C;  3M4P A;  2WFW A;  3PO3 G;  1XNR L;  3J81 c;  2NVQ H;  4OWT B;  2ZJR A;  4R4O A;  1S3O A;  4DV7 L;  2PMZ E;  1PH4 A;  4WJ4 A;  3JAM i;  1C9O A;  3UE0 A;  2R92 G;  4YWK A;  1B7Y B;  2KHJ A;  1N36 Q;  3A74 A;  5C4X G;  1D8L A;  1E22 A;  2NZH A;  3PO2 G;  4GLV B;  1K8A C;  1YEZ A;  3E9H A;  3CC4 A;  3NEM A;  4QJF A;  4YCW A;  1CKN B;  4GN3 B;  1N36 L;  2E2I H;  4A3M H;  1LUZ A;  1QVC A;  3HOV H;  1K83 H;  1VQI A;  1AE2 A;  4P71 A;  1NY4 A;  4LW1 A;  2N78 A;  4JV5 Q;  4A3E H;  1LM0 A;  4OWW B;  2GN5 A;  4JI0 Q;  3K8A A;  4IFD G;  4P75 A;  3HOW H;  2ZM6 Q;  3GTM H;  4PZ7 A;  2Y0S G;  4DR3 Q;  3TRZ A;  2VUM G;  4A3B H;  5C3E G;  3S16 H;  4A3L H;  4JI0 L;  1K8G A;  4L5T A;  2JA5 H;  1GO3 E;  1A8V A;  1PYB A;  1IL2 A;  2ZM6 L;  2ZJQ A;  4LUO A;  3M85 A;  1EWI A;  4DR3 L;  3OYY A;  1YJ9 A;  5M3F H;  1C7Y A;  1MIU A;  2VS1 A;  2CWP A;  4GN4 B;  4OX9 Q;  1NE3 A;  4AIM A;  4IJH A;  1Y1W H;  4TQU S;  2A19 A;  4EX5 A;  4IPC A;  3CC7 A;  3B6Y A;  2DUD A;  2E5L Q;  3E9I A;  4AYB E;  1HR0 Q;  5IYC H;  3BU2 A;  1L1O C;  4B3T L;  4GNX B;  1XTD A;  5M5X H;  1VQM A;  4JI3 Q;  2ASB A;  1BVS A;  2E5L L;  1KD1 C;  1KRS A;  1VQK A;  5HY6 A;  1X55 A;  3M4Q A;  4JI3 L;  1CKN A;  1Q46 A;  4C3I H;  3CCQ A;  4GNX C;  4A3I G;  1K73 C;  1IBK Q;  2JEB I;  4A76 A;  2PNH A;  1PH8 A;  1VQL A;  2VY3 A;  4YHH Q;  1HZ9 A;  2YTV A;  2UXC Q;  4BBS G;  1QZG A;  5JJI A;  3HOY G;  1V1Q A;  2N8N A;  3RNU A;  3PO3 H;  4R1J A;  4YHH L;  1YVC A;  3G48 A;  3L7Z C;  3KJO A;  2CFM A;  4HJA A;  4LFC Q;  3DLL A;  4IFD J;  1PH2 A;  1XMO Q;  1WFQ A;  3ZJY C;  4YWM A;  5FJ8 G;  4NXM Q;  1X65 A;  2JK8 A;  2RHQ B;  2HQL A;  3AFP A;  4YWL A;  1EFW A;  4RMF A;  2R92 H;  4JOI C;  3HOZ G;  2B3G A;  4LFC L;  5LMU Q;  5C4X H;  3RZO H;  2BH8 A;  1XMO L;  1Q1B A;  3S14 H;  4A3D G;  3PO2 H;  4JCV E;  3BJU A;  4DR5 Q;  1QVG A;  3D31 A;  5LMU L;  4AQY L;  4TVA B;  1V9P A;  1W2B A;  1FJG L;  4LNQ A;  4DV6 Q;  4DUY Q;  1RIP A;  4GNX A;  1N8R C;  4DR5 L;  2EQS A;  2R7F A;  1X3F A;  3U50 C;  2YU9 H;  4BY7 G;  3F2D A;  2F52 A;  4EQ5 A;  5C44 G;  4DV6 L;  1NMF A;  2BH2 A;  2BA1 A;  2VUM H;  1CUK A;  5C3E H;  3G71 A;  2A1A A;  2XTI A;  3GTJ H;  3J7A 5;  5FLM G;  1J6Q A;  2ES2 A;  4YCV A;  1Z47 A;  4BXX G;  1VQP A;  4O0A A;  4BA2 I;  1CSQ A;  3UDX A;  1YHA A;  3TEH B;  4IFD I;  1I3Q H;  1U0L A;  4JOI A;  4QIW E;  1HNW L;  1WOC A;  2F3I A;  4LUZ A;  3VDY A;  1YBY A;  2KCT A;  2HIX A;  3PIP A;  3NBH B;  1X54 A;  3CMA A;  1UE7 A;  1D7Q A;  1A63 A;  3M9B A;  4LF8 Q;  5AJ3 Q;  2R93 G;  2WB1 E;  4FDB A;  2ZJP A;  1XJV A;  5IYD G;  4HJ5 A;  4XIG S;  1YIJ A;  1YIT A;  1VS0 A;  2NVX H;  5IWA L;  1Y1V G;  5M5W H;  4A3I H;  1XPR A;  2CCZ A;  3RLN A;  5AJ3 L;  4LF8 L;  3W5O A;  2NN6 G;  4DV4 Q;  1TXY A;  4JI7 L;  3KJP A;  1SRO A;  2LXK A;  1ASZ A;  3UDF A;  3PGZ A;  4BBS H;  4DV1 Q;  3F2C A;  3HOY H;  2UXB L;  4DKA C;  4DV4 L;  4BA1 I;  5C0X I;  2Y0S E;  3RN5 A;  4DR2 Q;  4A93 G;  3A5U A;  2WP8 J;  5FJ8 H;  3S1N H;  1WI5 A;  4DV3 Q;  5IY0 A;  3CPF A;  1E24 A;  3HOZ H;  3CCS A;  1E3P A;  2JA7 G;  3MXN B;  1BBW A;  5M5Y H;  2NZO A;  1BKB A;  4DR2 L;  1VQ7 A;  4A3D H;  3CD6 A;  4DV3 L;  1BBU A;  1VQ5 A;  1IBL Q;  1HNZ Q;  4IOA A;  2CKZ B;  3K7U C;  3K81 C;  4BBR G;  1FL0 A;  3GDE A;  2Q2T A;  2XGT A;  3RLF A;  4BY7 H;  1OXX K;  2K52 A;  3S17 H;  4ME3 A;  4LF5 L;  1HJP A;  1XPU A;  3J80 c;  4GLX A;  1N34 Q;  5C44 H;  1LTL A;  4IOC A;  4YCU A;  4JI7 Q;  2OTJ A;  2Q2U A;  3PCO B;  4P74 A;  1X9N A;  4OXP A;  1PH7 A;  1XPO A;  1I5F A;  1VQG A;  2LXJ A;  2VL6 A;  5FLM H;  1Q81 C;  1N34 L;  1Q7Y C;  1XNQ Q;  3PF4 A;  2I5M X;  4KHP Q;  2AHO B;  3GTL H;  4BXX H;  1KIX A;  2C35 B;  3EIV A;  5JEA G;  2QGQ A;  3IRB A;  4KHP L;  3RR5 A;  3FP9 A;  1MJC A;  3AFQ A;  4DV2 Q;  1XNQ L;  4A3G G;  1K9M C;  4QL5 A;  3CF5 A;  4L5R C;  2JQO A;  1OXS C;  4DK3 C;  4JI6 L;  4DV2 L;  2L15 A;  1IZ6 A;  1QVF A;  4HIK A;  3S15 H;  1PH6 A;  2Q2I A;  4UPA A;  2R93 H;  4LFB Q;  3CCJ A;  2Q2H A;  1EIY B;  5IYD H;  4IJL A;  5IT9 c;  3CME A;  3CCR A;  1Q8K A;  1Y1V H;  3FKI G;  3OW2 A;  4LFB L;  3PIO A;  4R4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...