1NMFA

Major cold-shock protein, nmr, 20 structures
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
67
structure length
67
Chain Sequence
MLEGKVKWFNSEKGFGFIEVEGQDDVFVHFSAIQGEGFKTLEEGQAVSFEIVEGNRGPQAANVTKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure in solution of the major cold-shock protein from Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulation
molecule keywords MAJOR COLD-SHOCK PROTEIN
total genus 4
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 1996-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1nmfA00
3G4SA 1YHBA 2Q2HA 5C4JH 1N8RC 2R93H 2UUAQ 1A0IA 2DGYA 1OXXK 4A3MG 1FL0A 1VQPA 1I3QH 3PUYA 4DAYB 1R9TH 1N36L 1FJGL 3HOXH 3EBEA 3TREA 5GAHC 1SRUA 1UEBA 1KQSA 4QIWE 3OTOL 4HIDA 2JA5G 2EQSA 1M1KC 1EIFA 4JI5L 3CW2C 2WB1G 1CSQA 1KL9A 2VQFQ 1KHIA 4PG3A 4IFDI 1ASYA 2Q2IA 1YI2A 3BZKA 3U50C 1VQ9A 5C0XG 2N49A 4O0AA 3KDFB 1AE2A 3BJUA 1JB7A 3MXNB 1C0AA 4LFCQ 4L5SA 2JJQA 4R4QA 3S14H 3HKSA 4DV0L 2H5XA 4BXXH 1HZ9A 3K7UC 2OQKA 4RG1A 4XTCS 1AH9A 4B3TL 1U5KA 2CCZA 1X6OA 2ZTDA 1VQGA 2EXDA 5AJ3Q 1HZBA 3F2CA 1Q1BA 3K81C 1OXVA 4JC0A 4X64Q 4B3ML 4NPSA 4QJFA 1W2BA 1HNZQ 4YY3Q 4TQUS 3AYHB 1TWFH 1VCIA 2MO1A 2N3SA 3GTLH 2UXCL 1BBWA 3PO3G 3TRZA 5C0XJ 3G71A 3PCOB 2Z0SA 1IBLQ 2R7FA 5IYBG 3PO3H 2B63G 3BZCA 4R4TA 3CCUA 1VQ8A 4LUVA 3JC66 1NTGA 4LUOA 4Y7NH 1XNQQ 1NMGA 1SMXA 3DLLA 3CCVA 2UXDL 4DR7Q 1IBML 4OWTB 4H02A 1DGSA 3CC2A 5C44G 3RNUA 4LFAL 5JJKA 1L0WA 2ALYB 4DUZL 4DR2Q 4BY1G 1QZHA 2IX0A 4A3IG 1YHQA 3GTMH 3H3VI 1HNWL 1UE6A 5IP7G 1X56A 4GLVB 2AHOB 4X62Q 3CXCA 1VQ6A 4OWWB 1KXLA 4A3KH 2ZTCA 5IP9G 5C4XH 1A8VA 3KFUA 3AFQA 4JI4L 1PH4A 1OXUA 2HIXA 1VQOA 2JA8H 3PIOA 1B8AA 2PI2A 2Y0SG 2NZOA 2MFIA 3HKZG 4DKAC 4DUYQ 2VNUD 4JI0L 1SN8A 3RN5A 4DR3Q 2ZJPA 3AQQA 3A5ZB 2ATWA 2K5NA 4HIOA 4JI8L 4DV6L 1YJ9A 3ICEA 2E2IH 1TXYA 2PMZE 1N9WA 1YBYA 5M3MH 2K5VA 2ASBA 5JEAG 3CCSA 2QEXA 3UDXA 4A3FH 4OO1I 1KRTA 2R7ZH 3UE0A 1CUKA 2YTYA 1PV4A 1KIXA 2BA1A 2K14A 2R7ZG 1HR0L 4YHHL 2LXJA 2CFMA 1VQBA 4C3JH 3PSIA 4GOPC 3HOZH 2ID0A 3H15A 1YVCA 3TEHB 2Q2UA 1YJWA 2F4VQ 1YNXA 3AFPA 1JJ2A 3S1NH 1UE5A 3M9BA 3M85A 3F2BA 4YWLA 5JEAJ 4DV2L 1I5FA 5C3EG 4LFCL 1Y1VG 1PH5A 1YHAA 4UP8A 4JI1L 4DV0Q 5ELOA 1T9HA 4GNXB 3PV0A 2VUMG 3U58A 4ALPA 3PGZA 5AJ3L 3CMAA 2A8VA 2ZM6L 4DR5Q 3HOWH 4PZ8A 4OX9Q 4KHZA 5EAYA 2K52A 2VL6A 2D0PA 1N34Q 3E9HA 4GS3A 3JAMi 4AQYL 2R6GA 4X6AH 4A3JG 2OCEA 1L1OB 1VQMA 3GD7A 1K8AC 3OW2A 1JMCA 2R93G 2MNAA 1IBLL 1B7YB 4JYAQ 2KCTA 2R7DA 1QVCA 3FKIH 5LMUQ 2HT1A 4BA2I 2N8NA 3F1ZA 4DV3L 4A3DG 4JV5Q 2IHEA 3LGJA 4QY7A 4KHPL 1ASZA 3KF8B 4APVA 2GN5A 3GTGH 1JT8A 4IPCA 1XMQL 4DR7L 1A62A 1B70B 3HOUH 5IYCG 1VQNA 1WFQA 4DR2L 3I4NG 1GO3E 4A3LH 3RN2A 1HNWQ 1HZAA 4PZ6A 1Q81C 1V1QA 4A93H 1E1OA 2A1AA 2E8GA 3I7FA 2GVBA 4JI2L 4DPGA 3HOYG 1KRSA 1W3SA 4A3GH 4JI4Q 3OYYA 3H0GG 1Q7YC 2NVQH 3A0JA 3GO5A 1G6PA 1PH1A 1BBUA 3S16H 2CKZB 1GVPA 3PUVA 3B6YA 4KI0A 1OTCA 4DV5Q 4JI0Q 4GN3B 1XPRA 1VQJA 1XNRL 3PF5A 1JE5A 3KYHC 1PA6A 1NBWA 1XJVA 5HY6A 4LFBL 3ULLA 4JI8Q 4B3RL 1NE3A 1L2FA 5LMNL 4DR6L 4JI6L 1IBKQ 2JA7G 4DR4Q 1X3EA 3J81c 1K73C 3K0XA 4GKJQ 4JBWA 1XPUA 1V9PA 3W1BA 2LSSA 2HQLA 1HNXQ 4IPGA 4MZ9A 3KF6A 4IFDG 3K8AA 2RCNA 5C44H 3RR5A 4POFA 4YHHQ 5GQOA 1EIYB 3OTOQ 4ME3A 2YV5A 5H1SE 4YCUA 3VDYA 1K83H 5IY0A 2PI2E 2VQFL 1LTLA 1V43A 4NXMQ 1UE7A 4DR1Q 4AYBE 3J81i 4GOPA 2IY5B 4HJ5A 3U4VA 3F8TA 1E1TA 1WYDA 1EFWA 3WWVA 3MEFA 3GTJH 3UDFA 2CWPA 3I4OA 2I0QA 2R92H 2JE6I 4QQBX 2UXBL 4B3TQ 1CKNA 1SLJA 2K50A 2VW9A 1KD1C 1QVGA 4DV7Q 4A3JH 2KCMA 4HJ7A 3CC4A 4DR5L 1EQRA 1G291 4LUZA 3Q8DA 4BA1I 1N34L 4OXPA 4X64L 1XMOL 1TWHH 1VQLA 4YCWA 4DV1Q 3M3YH 5C0XI 1X3FA 1VQFA 4JYAL 3J7A5 4L5QA 1HH2P 1VQAA 1PH7A 1QUQA 4HJ8A 1NJIC 2D62A 5LMUL 3K7AH 4NXNL 4HIKA 3T1YQ 1MKHA 1J5EL 2GVAA 3CMEA 2RF4A 3GTPH 4IJHA 3J80c 2HHHQ 1GD7A 4BXXG 4KHPQ 1H95A 4YWMA 3HOVH 2JQOA 2B3GA 1MIUA 3TS0A 1PYBA 1XNQL 1VS0A 2YTXA 1K8GA 1X65A 4A4IA 1XPOA 4GNXA 1NY4A 4IPHA 1EQQA 3RLFA 5M3FG 4DUZQ 4BY7H 4GLXA 2BH2A 1I50H 5M5WH 1E3PA 3NENA 5M5XH 4JI7L 4X62L 4J15A 4IFDJ 5FJ8G 3M4OH 3J80i 3S15H 3CCMA 3J7ZC 3GDEA 3ULPA 4P74A 4BBSH 2ES2A 3M4PA 4DV5L 3CD6A 2A19A 4LF5Q 1UWVA 4OONA 2MO0A 4DUYL 4A3IH 3D0FA 1QVFA 3UDGA 4LFBQ 3S1RH 4IJLA 5IWAL 5BR8L 2UUBQ 4B3RQ 4C3HH 4L5TA 2I5HA 2OWOA 1SE8A 4P71A 5LMNQ 3CCLA 4DR6Q 5C4XG 4DR4L 4LF8Q 5DLQE 4GKJL 4UPAA 2JA8G 4YCVA 5IT9c 1YIJA 2UUCQ 4LF7L 4IO9A 1HNXL 2L15A 2YTVA 1Q1EA 1X54A 2AWOA 3HFZB 5FLMG 1TWCH 2JA7H 1P16A 2DUDA 2KHJA 4DK3C 4LF4L 4C2MH 3GTQH 1FGUA 3HOZG 2Z6KA 3J81j 1HR0Q 4BY1H 4LWCA 1SR3A 4DK6C 4HJAA 3KDFA 4RMFA 4LF6L 4K0KL 4DR1L 3L7ZC 1WCMH 2F4VL 4LF9Q 4R4CA 1TWGH 1SFOH 4UY8C 4DV2Q 2XTIA 1Q12A 4A3MH 4DV4L 3D31A 2VQEQ 2VUMH 4JI1Q 4EQ5A 2UXBQ 1D7QA 3S2HH 3CPWA 4DV7L 4JBKA 1GM5A 1IZ6A 2I5MX 1Q46A 1VQDA 3ER0A 4Y52H 3KF6B 1XMOQ 3GTKH 2ZM6Q 3FP9A 1IXRA 3A74A 3KJPA 3CCEA 4DV1L 1Q86C 3T1HQ 4HJ9A 2NVXH 1E24A 4OWXB 2FXQA 3K80C 1PH3A 1S3OA 1LM0A 1VQCA 1PHJA 3W1GA 2UUAL 3GTOH 4P75A 1Y1VH 4B3SL 2HHHL 1EOVA 3ULJA 1L1OA 3PF4A 1FJGQ 1N32L 3CPFA 3KLWA 4JOIA 2ZJRA 4A3CH 4A3BH 2Y0SE 2D0OA 2IHFA 1Q8KA 3U4ZA 4YWKA 3CCRA 1Y1WG 4JI5Q 4FDBA 1MJCA 1XMQQ 3HOXG 2PNHA 1OXTA 1PH6A 1Y1WH 3A5UA 2JA5H 4DNIA 4X65Q 3H0GH 3I4MG 4JI7Q 4JBMA 2JA9A 5IYBH 3PO2G 1EWIA 1SROA 4JI2Q 4HIMA 4IOAA 5IP9H 4R4OA 3UDIA 3CP0A 1RL2A 4GOPB 3PO2H 1LUZA 3L0OA 1VQHA 3PUWA 3TS2A 1Z9FA 2CQOA 4R4IA 5GADC 5IYCH 2OTLA 2B63H 1WI5A 4JOIC 4DAMA 2JA6H 3I4NH 5IE8A 1VQEA 3RLNA 4YY3L 1OXSC 1VQIA 4MTNA 1HJPA 3HOUG 2F52A 2I5LX 2OTJA 5IYDH 4C3IH 3DM3A 1Z47A 2KBNA 2WP8J 2UUCL 4JI6Q 2AKWB 1WOCA 3HOYH 4GKKQ 4A3FG 3SGIA 2E2JH 1M90C 3E0EA 5FLXc 4P73A 4A3EH 1X55A 2ZJQA 4X66Q 1I94L 3S1QH 2UXDQ 4EX5A 3AEVA 4BBRH 1I6HH 2K4KA 4AIMA 3KOJA 4LFAQ 2QGQA 1TWAH 2KENA 3RLOA 2UU9Q 1CKOA 4WJ3M 4PZ7A 3KJOA 3UE1A 4GNXC 2E2HH 4LF6Q 4K0KQ 3S1MH 4A76A 3G6EA 3IRBA 4NXML 3H3VH 2E5LL 1P8LA 1QZGA 1N33L 1AE3A 4BBSG 1A63A 2B29A 3I56A 1E7ZA 3E9IA 5ELNA 5M3MG 5M5YH 2EIFA 2WB1E 4JBJA 2VQEL 2Q2TA 3I55A 3STBD 1RIPA 2WFWA 1O7IA 3EN2A 5HGQA 4DR3L 2V1CC 2C35B 3CQZH 4QGUA 4JI3Q 3G48A 4GN4B 4JCVE 1FVIA 2JEAI 1HZCA 4MNOA 3HOWG 3T1HL 3RZOH 1CKNB 3BU2A 3I4MH 5GAEC 1S72A 4LW1A 4IPDA 2BH8A 3TQYA 4A3BG 3ERSX 2PQAB 2R92G 2IX1A 5K36G 4B3SQ 1D8LA 1N32Q 3FKIG 3T1YL 1J5EQ 4NXNQ 3S17H 1L1OC 4AH6A 5LMNW 1JJCB 1YEZA 3JAMc 3RZDH 4KLKA 1N36Q 3CC7A 4TVAB 4UP9A 5M3FH 2RHQB 2WAQE 5E7NA 1VQ7A 4OO1G 2VS1A 3PUXA 1NMFA 4A3CG 3STBC 1YJNA 1IYJB 4X65L 4IOCA 1X9NA 4A3LG 5GROA 1J6QA 2CWAA 3PUZA 4A93G 2JA6G 4GN5A 3ZJYC 3L2PA 4A3GG 5C3EH 4A3KG 3HKZE 5J3BA 1VQKA 2ZTEA 4A3DH 2YYZA 3M4QA 2N78A 3CCJA 4OX9L 4BY7G 4LF5L 4B3MQ 2F3IA 1X3GA 4AQYQ 1G51A 2XGTA 2QA4A 1PH9A 3S2DH 1IL2A 4A75A 1HNZL 3CF5A 1CSPA 1PVOA 1MJEA 2VZAA 3I2ZA 4WJ4A 5BR8Q 1KAWA 5IWAQ 2LXKA 1LYLA 2UUBL 2UXCQ 2IT1A 4AYBG 2JK8A 4JG2A 2RHSB 5FLMH 4LF8L 4GLAC 4DV3Q 4JV5L 4GKKL 1BVSA 3EIVA 4LF7Q 1E22A 2K75A 3HOVG 1VQ5A 2NVTH 4L5RC 4X66L 1I94Q 4R1JA 2BA0A 4LNQA 1K3RA 1YZ6A 1C7YA 2NVYH 1EYGA 4LF4Q 1CKMA 1XTDA 2JEBI 1IBMQ 2UU9L 5JJIA 2MQHA 5GAGC 1Y14B 1UE1A 4A3EG 2OQ0A 3CAMA 1PFSA 2HIVA 2VY3A 4BBRG 1GKHA 1K0RA 2KHIA 3S24A 4POGA 2K5HA 3PIPA 5FJ8H 2E5LQ 2NN6I 3NBHB 1N33Q 1BKBA 1S40A 1PH2A 4LF9L 1PH8A 1JJGA 2NZHA 4DV4Q 1EUJA 1VQ4A 5IP7H 4XIGS 1QUQB 2WAQG 4O2DA 2YU9H 4UP7A 1YITA 3NELA 4QL5A 1PYSB 1Q82C 2AWNA 1KC8C 1K9MC 1XNRQ 5IYDG 1C9OA 4JI3L 3FHWA 1U0LA 4P72A 1WCMG 1WJJA 4NB3A 3CCQA 2Z6KC 2NN6G 2PQAA 1HR0W 4DV6Q 1IBKL 2AMCB 5JJLA 4PMWA 3NEMA 3M7NA 3F2DA 3W5OA
chains in the Genus database with same CATH superfamily
2DGYA 2EPBA 2A6HD 4A3MG 4DAYB 1N36L 1PFMA 2SNSA 3HOXH 1Y8PB 1KQSA 4HIDA 1FGBD 3T16A 1H9SB 2EQSA 2H1EA 4QUCA 1DXMA 1GUTA 4JI5L 4IFDI 3DUZA 2Q2IA 3J7AV 1VQ9A 2N49A 3FPUB 1F9SA 2CH4W 2EVBA 4OO1H 3MXNB 1LV9A 4R4QA 4KK7A 4DGZA 2OQKA 4RGNA 1AH9A 4B3TL 5AJ3Q 4B3ML 1OXVA 1AFPA 4NPSA 3S9WA 2MPMA 1W2BA 4YY3Q 4ZUIA 1K83B 2UXCL 3TP8A 2WB1B 3TRZA 5C0XJ 4RAUC 1AZQA 2EDGA 2R7FA 5IODA 5IYBG 2R93B 3CCUA 1HXYD 4IUTA 2WV6D 4LUVA 3PMFA 1EZ6A 5IGDA 2G5DA 4FXDA 4OWTB 3EA6A 3FDTA 5JJKA 1L0WA 4DUZL 1QZHA 4DR2Q 1GOZA 1HNWL 1UE6A 4IZ8A 4GLVB 3LWEA 3OWEB 1IYUA 3CXCA 4OWWB 1I4GA 1KXLA 3QOLA 1S5FD 3S1QB 2WAQB 4JI4L 4N8X1 2HIXA 1VQOA 5CMDA 2JA8H 1CQFA 1B8AA 2PI2A 4RCOA 2DJFC 4DUYQ 2VNUD 2JXMB 1G8ZD 3AQQA 4ILWA 1HQRD 2K5NA 4EQPA 4R8IA 2PMZE 2K5VA 5JEAG 2R92B 3I4LA 3UDXA 4A3FH 1KRTA 2XN9C 1PZJD 4K2KA 4G4KA 4HCEA 4YHHL 4GOPC 1BBXC 2ID0A 5CV8A 1ICFB 2F4VQ 5I6YA 3M85A 4YWLA 4DV2L 5C3EG 2JA6B 4LFCL 1R4PB 1SNQA 3MFYA 2F3VA 4K14A 1KNEA 1T9HA 2LMCB 2VUMG 3U58A 4ALPA 5M5YB 1EIHA 2ZM6L 4DR5Q 5EAYA 2D0PA 3E9HA 4AQYL 5KNDA 1TWCB 5CBAE 2OCEA 1JMCA 3GD7A 1H95A 4H44C 4UHVA 2MNAA 1QVCA 4DAYA 4ABNA 1U4PA 3MC0B 5EBDA 4N8FA 4KHPL 1ASZA 2GN5A 3BDOA 3K5OA 1JT8A 5IYCG 1VQNA 1WFQA 4C1NK 1TWFB 3Q24A 1GO3E 3S1RB 1SNDA 2E8GA 2V4DA 3H0GG 3I91A 1Q7YC 2R3ZA 2RSNA 1PH1A 1BBUA 2J4XA 4DV5Q 4JI0Q 3G7LA 1WCMB 2F0NA 1DCZA 2B39A 1PFBA 5HY6A 1GUOA 4MHEA 5C6AA 1SYFA 4KD4A 3S15B 4DR6L 1X3EA 5C4XB 3K0XA 5I4DA 3R8BA 1LACA 2DY8A 1LO5D 3BDLA 1JR0D 2CHBD 3GTPB 4IPGA 3KF6A 2E75C 5C5MA 2NVXB 3CRLC 2YV5A 4K5WA 1T5XD 4YCUA 1LTLA 3FPPA 3V05A 3BZDB 5EGTA 5J1ZA 1KLUD 4RA8A 4C3JG 2IY5B 2RVLA 2EY6A 2QEJC 3W2DA 1WYDA 3MEFA 2UXBL 2JE6I 5JPMC 4B3TQ 3LNNA 1KD1C 1XX8A 4DV7Q 4HJ7A 1EQRA 2RBMA 4LUZA 3URYA 4BA1I 1XMOL 1TWHH 1A15A 3A8IE 2NVTB 1TVXA 1HRJA 1HH2P 1TR5A 4QB4A 1QUQA 2NTTA 1LTAD 2D62A 3MWYW 3I72A 3MAQA 2RF4A 3GP7A 4QCLA 2HHHQ 4DA2A 1IYVA 4F7XA 2O5IC 1X65A 1XPOA 3BVMA 4GNXA 3NUCA 4IPHA 1WTOA 1EQQA 3RLFA 2IX3A 4DUZQ 2K03A 1E3PA 3D4DA 1ZYRD 4X3KA 3J80i 3S15H 4CKBA 4P74A 2FJ2A 1DM0B 4QMGA 3M4PA 2A73B 5C4HA 1KNAA 4OONA 2A68C 3MA2B 4LFBQ 4R8NA 2UUBQ 3NE5B 2Z1CA 3R3OA 3RZDB 4DF7A 4L5TA 2OWOA 1HQMC 3GQBA 5C4XG 2F1MA 4DR4L 1O7YA 1S5BD 5DLQE 4UPAA 3NHHA 4WRDA 1K3BC 2UUCQ 2FMCA 4IO9A 5I9PA 4WJWA 3HFZB 1FD7D 5FLMG 1P16A 2Q8IB 4C2MH 1TS5A 4BY1H 3KDFA 1KDAA 3CRKC 4C3JB 4DR1L 1M8AA 4IURA 4BBRB 3C3LA 1SFOH 1TWGH 3TZUA 3OMGA 4DV2Q 1EYCA 3SK8A 3S14B 4ID6A 1YNJC 1DONA 3CHBD 1IZ6A 1RTNA 4B08A 1VQDA 1IXRA 1BXTA 3A74A 3KJPA 1ICWA 3CCEA 4HJ9A 3S16B 3HOWB 2A6EC 2UUAL 4A3DB 3TP5A 3GTOH 4P75A 4XT3B 2PCFB 3BVZA 3ULJA 3PF4A 2K33A 1VF7A 1TT2A 5D3IB 2D0OA 1SFOB 3U4ZA 3CCRA 4JI5Q 5IT9E 4G7OC 1MJCA 4KMUC 5E4XA 1BOSA 2PNHA 1JWMD 3EVQA 5FK9C 1DD2A 4DNIA 4K5XA 2Z9HA 1A6XA 4JBMA 1CFMA 1SROA 1WTRA 2Q8TA 1H9RA 4IOAA 4K2LA 5KYLA 4R4OA 4GOPB 1DOKA 3TS2A 3L0OA 1Z9FA 4JOIC 4A3GB 2JA6H 2B8FA 1EU4A 4YY3L 1OXSC 2SOBA 1VQIA 2XNAC 1JC7A 2OTJA 4HAEA 1BR9A 2XIWA 3SXHA 4DFAA 2B2WA 2K6AA 3HOYH 4C3HG 4OEMB 1FNVA 1SSOA 1E2WA 1M4VA 2WKDA 3RLOA 1I4XA 1CKOA 1KLGD 4A3IB 3IRBA 2E5LL 1N33L 1AE3A 4NP5A 1E7ZA 5ELNA 2VQEL 2WB1E 1W6JA 1QILA 3C2PA 1HFNA 1STAA 2EE1A 1V1PA 1C4QA 3IKJA 2ZT9C 3G48A 3VYRA 3T1HL 3VYSA 5CGKA 5GAEC 4EQOA 2BH8A 4K8JA 3TQYA 1CA5A 5G3LD 3ERSX 2IX1A 5K36G 1CT1D 1D8LA 1PRTF 1RTOA 2HCIA 2J0TD 2RHQB 5EPKA 3PUXA 3HOUB 3QWNA 3STBC 5AFWA 1O78A 4IOCA 5GROA 2B8GA 3GTKB 3P1HA 1LLRD 3HOVB 4S3SA 3ZJYC 4A3FB 2K01A 2TMPA 3VYUA 4CGYB 2HDMA 1QOHA 2ZXRA 2F3IA 4AQYQ 2XGTA 1TY0A 1EWCA 3BG3A 1CSPA 1HNZL 1MJEA 2UUBL 1TQOA 3T53B 2IT1A 3OHXC 4JG2A 1EU3A 4GLAC 5IGFA 3VR4A 4JV5L 1PRTC 4GKKL 3HOVG 1VMCA 1PTOC 4X66L 4R1JA 1U4MA 4JW0A 1YZ6A 1C7YA 4LF4Q 1H9KA 2JEBI 4HSVA 1IBMQ 2UU9L 4I65A 1Y14B 4BY7B 2CQAA 2HIVA 3HS0C 1K0RA 3KFUA 2K5HA 2K28A 3PIPA 2NN6I 3NBHB 3NK9A 3J81E 4LF9L 1NUCA 4C56C 1NR2A 2K5QA 5IP7H 2WAQG 1EIGA 3RD4A 3HRZC 1A3VA 4KY7A 2AWNA 3PIP3 2D9UA 3O13A 1D1KA 1WJJA 3CCQA 5EBCA 2NN6G 2PQAA 2F0KA 4ZCKA 4XYOA 5JJLA 3F2DA 2Q2TA 4RGOS 1YHBA 2Q2HA 5C4JH 5CC4A 2UUAQ 1A0IA 1OXXK 1FL0A 1VQPA 2M00A 1I3QH 3PUYA 1R9TH 3EBEA 3TREA 4XXEA 1GUSA 3OTOL 1JWUD 4ZQ3A 4ZKBB 1M1KC 1HUMA 1RF2D 2GA4B 4F88A 1CSQA 1KL9A 4K6LA 1KHIA 1LT3D 3E0JA 1ASYA 3BZKA 2QF7A 3U50C 2AQ2B 3K6OA 5CV9A 1RCVD 1JB7A 2F0HA 2RCFA 2JJQA 4LAAA 5KGUA 4DV0L 2H5XA 1V1OA 2YU9B 1B44D 2RDFA 2FFKB 3F2CA 1Q1BA 2D5DA 2JN4A 1VDZA 2EOTA 3K5MA 1VCIA 2MO1A 3GTLH 4JPBW 4HN7A 3G71A 3TP7A 1KDBA 1PRTB 4TSSA 3TZDA 3PO3H 2HD3A 2J7ZA 4PNYA 4R4TA 1VQ8A 3JC66 1NTGA 4Y7NH 1XNQQ 5KIXA 4RWSC 4H02A 1DGSA 5EJWA 2LS01 2EJMA 2ALYB 2F0WA 1YHQA 2EXZA 1WD1A 2AHOB 3C1EA 5JVG3 1ML0D 1K8MA 5K5PA 1A8VA 1FYCA 1OXUA 1ZEQX 1EWHA 3HKZG 4DKAC 1EL0A 4DR3Q 3I4NB 3A5ZB 2ATWA 4M1UB 4DV6L 1TXYA 5A35A 1N9WA 1R4QB 3QOJA 4WORA 5C5LA 1B53A 2R7ZH 4OELB 1F9QA 3FEWX 3UE0A 1PV4A 2YTYA 2JA5B 1E0BA 5M5XB 2ENBA 2R7ZG 1HFGA 1VF5C 2CFMA 3M7GA 3PSIA 4G7HC 3J80L 1EQVA 2VB2X 4KV6A 2Q2UA 1YJWA 3A7LA 1YNXA 3S1NH 5FO9B 1NCVA 1UE5A 3M9BA 3F2BA 5I9OA 1I5FA 4L8JA 1ESFA 2EYOA 2B63B 1NAPA 4JI1L 1BCPF 1PTOH 2F03A 4EQNA 3P7JA 2L9HA 3PGZA 5AJ3L 4Q5VA 1C48A 2RKSA 3HOWH 4J8QA 4H7BA 2B2UA 4GS3A 3JAMi 4X6AH 3KLSX 4AYBB 1VQMA 1K8AC 2R93G 3FKIH 4JV5Q 4EVOA 4A3DG 3LGJA 4HR7B 4V190 2BE5C 4APVA 5I2XA 2F0SA 2K5WA 3BYTB 4DR7L 1XMQL 2G9HD 2A68D 5ELBA 1TKWB 1L0YB 1HNWQ 1HZAA 4PZ6A 1V1QA 4A93H 2A1AA 3ND9A 4DPGA 3VR2A 4A3GH 4JI4Q 3GO5A 1G6PA 3TDQA 1EZ8A 2R7ZB 4KI0A 1OTCA 1D6EC 4NMZA 5DAUA 1JE5A 3KYHC 1B1ZA 4PMCA 4TKOB 4JI8Q 2PW7A 3SR1A 1AN8A 3GTGB 1GJXA 1JWSD 5DM73 4G7ZC 1TU2B 3J7YW 1K73C 3A55A 1XPUA 1V9PA 5J22A 3W1BA 5K36H 1J8IA 1HNXQ 4C3HB 3H0GB 3K8AA 1AZPA 3RR5A 4KKUA 4POFA 3RUZA 5GQOA 3OTOQ 3NTHA 1K8OA 3VDYA 1GUGA 4AYBE 1SNOA 5JPNC 1ONLA 4LMQD 2CW0D 3F8TA 2JA7B 1EFWA 3GTJH 3UDFA 3I4OA 4RFBA 4QQBX 2X6GA 1SLJA 1GUWA 2KCMA 2VXWA 5EKIA 4X64L 2HUGA 5KNCA 1VQLA 4YCWA 4DV1Q 5C0XI 1X3FA 1VQFA 4Q0FA 1B3QA 1NR4A 4JYAL 4L5QA 4QF4A 1NJIC 5LMUL 1CM9A 5IT9L 3J81L 1SE2A 1YNND 1S5DD 3K7AH 4NXNL 1MKHA 1J5EL 4BWGB 3CMEA 3GTPH 4LK1C 4KHPQ 4YWMA 1KDCA 3AU7A 3HOVH 3DWAA 1XNQL 2YTXA 4I7ZC 1IKMA 1EY8A 4X3SA 1HA5A 3HOXB 4X62L 3FRPB 4IFDJ 4FXGC 1I4HA 4DXGA 2XVSA 4KD3A 2ES2A 1IHZA 2B2YA 3CD6A 1FNWA 1RDPD 2MO0A 4A3IH 2PPBC 3D0FA 3S1RH 1PXUA 4IJLA 5IWAL 5F2DA 2JP1A 4GKJL 3BVGA 1Q1EA 1SYEA 2AWOA 2JA7H 2DUDA 4DK3C 4LF4L 1B9MA 2Z6KA 4DK6C 2E2DC 4N9PA 2BCOA 5KYIA 2K05A 4K0KL 4UAIA 4XDXA 4LF9Q 4C1NI 5JJZA 2XTIA 4A3MH 2F0OA 1D5ZC 4JI1Q 4EQ5A 3SVMA 1HTPA 1LTBD 4DV7L 4NW2A 2I5MX 1Q46A 3ER0A 3KF6B 5I6WA 3GTKH 4IALA 1T5EA 3VR5A 1G6ZA 2FXQA 3K80C 1PH3A 1S3OA 2F4IA 3ITPA 1PHJA 1N32L 4X3UA 2HHHL 3CPFA 3KLWA 2BE5D 2ZJRA 4I7AA 1FR3A 4YWKA 2ICIA 1XMQQ 1TWHB 4CKEA 4ZRZA 3DM1A 2PW5A 2JA5H 1EYDA 5LL6X 5IYBH 3PO2G 1RL2A 1SE4A 1LUZA 5E3FA 4BA2I 4R4IA 2B63H 3I4NH 1J9OA 1S5CD 1ENCA 3P20A 2EJFC 3SK4A 4MTNA 5ISRA 3HOUG 4HCSA 5IYDH 2EYPA 1EEFD 4B9WA 4BS9A 1Z47A 2KBNA 2UUCL 5A2QE 3TBIB 3SGIA 5BN4A 1IW7D 4A3EH 4F8MA 4X3TA 1I6VC 4BBRH 3K5NA 3DHQA 4AIMA 3SHLA 1TWAH 2KENA 4WJ3M 4LF6Q 3UE1A 4RGTA 1G91A 4A76A 3G6EA 1AP0A 2B29A 3IFDA 4XQNA 4UDUC 2NWGA 2EYLA 3I55A 2PZWA 4CJ2C 3STBD 1UEAB 3NPPA 2WFWA 1O7IA 1SNMA 4CDEC 4HMJA 4DR3L 2V1CC 4QGUA 4JI3Q 4GN4B 4JCVE 1FVIA 3BDCA 3TN2A 3HOWG 4KKSA 3RZOH 3BU2A 1Y69U 4LW1A 1MHWC 3FKIG 1J5EQ 4NXNQ 3S17H 1JJCB 3RZDH 2K5DA 3UI2A 4TVAB 3MTSA 2NBFA 2NTSA 4UP9A 3QB3A 4L63B 5M3FH 2WAQE 1QCBD 4DN4M 1F77A 1QE6A 4A3CG 1YJNA 1IYJB 4DNRB 4X65L 1LT6D 1X9NA 4A3LG 1J6QA 1JORA 1YNNC 3PUZA 5C3EB 2JA6G 1Y8OB 4GN5A 3L2PA 5FO7B 1D2BA 3SEBA 3D3RA 2L4NA 3M4QA 2N78A 4OX9L 1STBA 1TWGB 4BY7G 3OMCA 1X3GA 3S2DH 1G51A 2QA4A 1IL8A 3KK7A 4HEDA 5IWAQ 1KAWA 2UXCQ 3R93A 2XRSD 2RHSB 2F0FA 2SNMA 2XWJB 5FLMH 4LF8L 5IGBA 1BVSA 2TSSA 1E22A 2NVTH 1I94Q 2BA0A 2RDGA 3NXWA 3Q23A 1S4ZA 4FNFA 3MXNA 2NVYH 1EYGA 2Z8LA 4A3EG 1UE1A 2K04A 4KJOA 3GTQB 2VY3A 3K58A 1E2VA 4BBRG 1GKHA 4POGA 3SK6A 1N33Q 3K57A 1PH8A 3CU7A 2O4XA 4DNTB 1JJGA 4DV4Q 2RQXA 1U4RA 1KC8C 3MXUA 3WOFA 1K9MC 4CBVA 3FHWA 4P72A 5C44B 3KBXA 1I6HB 1SXTA 2AMCB 4KKTA 3HP3A 2AUJD 2R93H 1F2YA 2L0CA 5IGEA 5GAHC 1ZYRC 5ELCA 4TRDA 3IFTA 5M5WB 3CW2C 2WB1G 2VQFQ 3EJIA 1CQVA 1YI2A 5T1GA 1CHQD 3I8ZA 3CQZB 3Q0AA 5C0XG 1AE2A 1SDFA 2K32A 3BJUA 3GV3A 1C0AA 1LABA 3SE0A 4DK0A 1HZ9A 3I3CA 4XTCS 3J7AF 5CYUA 3NTIA 3OIPA 2CCZA 1X6OA 4FF3A 1PMRA 1VQGA 2EXDA 1HZBA 3K81C 4JC0A 4X64Q 3NSWA 4QJFA 5IGGA 1HNZQ 3AYHB 5FLXE 1BQQT 1JICA 1SYBA 1IBLQ 3T13A 2QILA 3BZCA 1X3PA 1JOQA 3H3VC 3DLLA 3CCVA 3CC2A 4FF2A 3RNUA 4C3IG 2F3WA 5C3XA 3EQLC 2IX0A 4A3IG 1STEA 5IP7G 4V0BA 3VA7A 4X62Q 4A3KH 1RODA 3AFQA 1ESRA 3C1FA 3PIOA 2DJGC 4JI0L 4H13C 1EFID 2R61A 3ICEA 2E2IH 2ASBA 1YBYA 3CCSA 3LX0A 1EY9A 1WD0A 1SE3A 4OO1I 4HSPA 5JVH3 2I07B 3DEOA 1CUKA 1KIXA 2BA1A 2KUMA 2K14A 3NTKA 1HR0L 1BO0A 1VQBA 4C3JH 1SJHD 1EEID 1PTOD 1FNUA 2F0IA 1YVCA 3TEHB 1A3TA 3DXJC 1ZXTA 4DAVA 5JEAJ 1PH5A 1YHAA 5A2QL 2IJ0A 4MN3A 1JCKB 3PV0A 3CMAA 1TIID 2F0GA 4O1NA 4OX9Q 4C3IB 1N34Q 2K52A 3J80E 1A2TA 5CORA 2R6GA 2K1BA 4A3JG 4ULLA 3K0YA 3OSOA 3OW2A 3NWTA 3QJYA 2PO4A 2HT1A 1IKLA 2IHEA 2VB3X 4QY7A 3KF8B 3GTGH 4IPCA 1A62A 3HEJA 2HQEA 1B70B 3I4NG 2IPKD 4DR2L 3GTLB 2ICEC 2PMZB 1WTXA 3QO2A 1E1OA 3I7FA 2OEOA 2GVBA 3MHBA 4DK1A 3HOYG 1W3SA 4KY6A 3C46A 2NVQH 1G2SA 5T1IA 3A0JA 2CKZB 2Z6BA 3PUVA 5ELEA 4ZK9B 3EFXD 1HCZA 1PA6A 4KJNA 4IUVA 1XJVA 5LL6S 3ULLA 3N6RA 4OIJA 1LT4D 4B3RL 4HTHA 4RGMA 3NQTA 1L2FA 5LMNL 2ZXPA 3J81c 2PYKA 2QCPX 5KRUA 4RKLA 2JA8B 4IFDG 4MZ9A 5C4JB 2F0JA 3I73A 5C44H 4YHHQ 5EKLA 2B2WC 1PLFA 1K83H 2VQFL 1V43A 1UE7A 4FF1A 3J81i 1QB5D 1XWEA 3F2UA 3AB9A 3U4VA 3R2IA 3WWVA 2CWPA 2EY1A 2KHSA 2I0QA 2R92H 1QVGA 1PFNA 2A69D 1EY0A 2X6LA 4DR5L 1RHPA 1B50A 3A8JE 2NN6H 3Q8DA 4OXPA 1RJTA 2P5ZX 1SYCA 1VQAA 1PH7A 1SNCA 4HJ8A 4IUUA 1F2LA 1QJOA 2MP1A 3T1YQ 4HIKA 1CK1A 3J80c 1GD7A 4OGQC 3G6JB 2CVRA 5IOCA 1K8GA 2KQ3A 2EYJA 3E6ZX 2BDOA 5M3FG 4BY7H 1MBYA 1I50H 5M5WH 3OWFA 5M5XH 3VR6A 4JI7L 1Q3LA 4IUPA 5FJ8G 2XRQD 5FOBB 4CDDC 3CCMA 4ODGA 1IW7C 4NKLA 3GDEA 3ULPA 4BBSH 2EYFA 4DV5L 2A19A 3GTMB 1B3AA 1XYIA 3UDGA 2EY2A 3NBIA 5BR8L 1LTTD 4C3HH 2I5HA 5DM63 3CCLA 4DR6Q 5HURA 4LF8Q 1WTQA 4J1MA 5IT9c 2IWHA 3D6CA 3GTOB 5EPLA 2L15A 2YTVA 5TSSA 1HNXL 1TWCH 1WTHA 4YIJA 3KUPA 3HOZG 2KHJA 2E2IB 3J81j 2A6ED 1HR0Q 2DY7A 1HPCA 4HJAA 3T51B 4FF4A 3I70A 4RMFA 5FLXL 1WCMH 4N9TA 2HCCA 1VMPA 4DV4L 2VQEQ 4QUFA 2UXBQ 1D7QA 3S2HH 2RSOA 4XQJA 1NSNS 4RHRA 4Y52H 2WIIB 1WTWA 1XMOQ 2L5TA 1K28A 3D8GA 4DV1L 1Y8NB 3T1HQ 2NVXH 1E24A 4OWXB 3T56B 3ONAB 2FMMA 3TP6A 1I3QB 1EYAA 1R9TB 1ILPA 1LM0A 1VQCA 3ERQA 3W1GA 5J39A 4B3SL 1EOVA 3X3NA 1FJGQ 5EKKA 1STYA 2MHVA 4A3BH 1DZ1A 2WACA 1ET9A 3NQIA 4FDBA 4MIUA 3HOXG 3HGBA 1SJED 2A69C 1PH6A 1QG7A 4G57A 1QNKA 3L3OC 4IUQA 1EWIA 2F0MA 4JI2Q 3IL8A 3LWUA 3MZ5A 1VQHA 2CQOA 1QWYA 5GADC 1W6KA 4RKBA 1EY5A 1U9RA 4CDCC 3RLNA 4XYQA 1ENFA 2JYOA 1HJPA 2F0DA 1F2MA 2CW0C 4C3IH 1JOOA 2Z4IA 3ZYYX 4KTAA 3HG9A 2KECA 1SNPA 1XXGA 1WOCA 2BDNA 5IGCA 1WTPA 4A3FG 1B4OA 3E0EA 4FXKC 5FLXc 1X55A 4X66Q 4EX5A 3AEVA 1I6HH 1Q90A 2K4KA 3KOJA 4LFAQ 2QGQA 2B2VC 1ZKOA 2E2HH 4GNXC 1PZKD 3PIO3 3Q22A 2F0VA 3FMCA 3H3VH 1QZGA 4CDFC 3E9IA 4WFN3 2EIFA 3K59A 4JBJA 5IIFA 1G2TA 3RMHA 3EN2A 3HKZB 2C35B 3GV6A 1KABA 2JEAI 1HZCA 2XSCA 1JE4A 2MUYA 1S72A 1F9RA 1BUVT 3QIAA 1EY7A 1GXDC 1DOMA 1N32Q 3TSSA 3T1YL 1JB3A 1L1OC 1AW7A 4AH6A 5LMNW 1YEZA 2RA4A 4KLKA 1N36Q 3CC7A 1PZID 1X3QA 1F2ZA 2KEEA 1C8CA 1VQ7A 2VS1A 4DXFA 1NMFA 1TS3A 2Q8RE 3ND8A 2CWAA 4C2MB 5C3EH 4A3KG 3HKZE 5J3BA 2ZTEA 5FKAC 3CCJA 4JVZA 4LF5L 1I50B 4B3MQ 1HHVA 2QDBA 1PH9A 4A75A 3CF5A 1UNSA 2KOLA 4WJ4A 2B2TA 5CV7A 5BR8Q 2X69A 1LYLA 3KLSA 4FP5D 2E76C 3DMUA 2JK8A 3MXPA 1BDOA 1JOKA 1PTOF 4DV3Q 4K6DA 3S17B 3EIVA 1MD2D 1VQ5A 4L5RC 1ILQA 4LNQA 1UAPA 3U9OA 1DYQA 3QR8A 1CKMA 1XTDA 1STNA 5D3DA 2NVYB 1ENAA 1KTKA 3Q6SA 2I46A 2OQ0A 1PFSA 1XTCD 3CAMA 2F0QA 2AUKA 1DJRD 2KHIA 2E5LQ 1PH2A 2A5HA 3P75A 2NZHA 3HOYB 1EUJA 2N55A 1QUQB 4O2DA 4ZLTF 2YU9H 1KAAA 3NELA 1PYSB 4QL5A 1Q82C 2N88A 4P2CB 5IYDG 1U0LA 3D6WA 2F0UA 2Z6KC 2L12A 1HR0W 2DNCA 4PQXA 1IBKL 4PMWA 1CHPD 1CZWA 3G4SA 4K5VA 2PNRC 1N8RC 2KEDA 4HMIA 3TMEA 1FJGL 2E74C 1SRUA 1UEBA 4QIWE 2L55A 2JA5G 1EIFA 5BN3A 3KBGA 4PG3A 2B2VA 2DN8A 1O7LA 2MJ8A 4O0AA 3KDFB 5KEEA 1HA6A 3E5SA 4LFCQ 1RD9D 5JOBA 4L5SA 3S14H 3HKSA 4E6IA 4BXXH 3K7UC 4RG1A 1U5KA 1SMYD 2ZTDA 2M2LA 3I4MG 3FVQA 5CV6A 3V2TA 4TQUS 2EZVA 1TWFH 2N3SA 2Z4HA 1E2ZA 1BBWA 2PZTA 3PO3G 2NB0A 3PCOB 4OHJA 2Z0SA 1II3A 1JQYD 2B63G 2KVMA 2F0PA 3GTJB 4LUOA 1NMGA 1SMXA 2UXDL 5COYA 1IBML 4DR7Q 3S2DB 5C44G 4LFAL 4XQQA 4BY1G 2OF1A 3GTMH 3H3VI 4KY5A 1X56A 4BBSB 1VQ6A 2ZTCA 5IP9G 2EYMA 5CR3A 2EJGC 5C4XH 1PH4A 2LFNA 2B2UC 2NZOA 2MFIA 2Y0SG 1SN8A 4U68A 3RN5A 2ZJPA 1A2UA 2KCNA 4HIOA 4JI8L 1YJ9A 1Y1VB 5M3MH 4Z9CB 2QEXA 3VYTA 1EY6A 1SBBB 3JAME 5DNFA 4U673 1MSHA 3I4MB 3HOZB 1B2TA 2MGSA 2LXJA 3HOZH 1SYDA 3H15A 1SAPA 1GUNA 3AFPA 1PRTD 2NUCA 1JJ2A 3R2TA 1Y1VG 2ZXOA 4UP8A 4DV0Q 5KNBA 5ELOA 1LT5D 3H91A 4GNXB 2KA7A 2A8VA 2HDLA 3KF8A 4PZ8A 4KHZA 2VL6A 4JK1C 1LTSD 4RH6A 1L1OB 4JYAQ 4KHVA 1B7YB 3DWQA 2KCTA 2R7DA 1IBLL 2E2JB 5LMUQ 2N8NA 3F1ZA 4DV3L 4FVMA 5FO8B 3D4RA 2IW3A 3M4OB 5LHY1 5D14A 1L0XB 3PQIA 3M3YB 3DEPA 2OXPA 2KJXA 3HOUH 3EROA 5C0XH 4A3LH 3RN2A 1Q81C 1STGA 2SDFA 4JI2L 3A7AB 1KRSA 2K7VA 3OYYA 3S16H 3OIQA 1GVPA 3I90A 3B6YA 4GN3B 1XPRA 1VQJA 4QIWB 1XNRL 3PF5A 2M9VA 5JEAH 2PZUA 1NBWA 1HTLD 4LFBL 5E1FA 1X32A 4O42A 2CH4A 1NE3A 4JI6L 1IBKQ 2JA7G 4DR4Q 3VA5A 2JSOA 4GKJQ 4JBWA 4IN3A 2LSSA 3SK5A 2HQLA 5BN5A 1BF4A 2L1BA 2RCNA 3SDZA 2VUMB 2FINB 4B9XA 2LY7A 1V8QA 1MI2A 1D1IA 1EIYB 4ME3A 5H1SE 5NUCA 1EY4A 5IY0A 2PI2E 4NXMQ 4DR1Q 1H9MA 4GOPA 4HJ5A 2O5JC 1EOTA 4DAPA 1E1TA 3WDNA 2AQ3B 3BS1A 3NWSA 4L6TB 5EPJA 1CKNA 2K50A 2VW9A 4A3JH 4OL7A 3CC4A 1G291 1N34L 4A3JB 1TWAB 5C3WA 3W3AA 3M3YH 3J7A5 1SMYC 5E4WC 2GVAA 4IJHA 3V96A 4ME5A 3NBHA 4BXXG 2B2TC 2JQOA 4RCNA 2B3GA 1MIUA 2RDHA 2B2YC 2L11A 1PYBA 3TS0A 2O2LD 1VS0A 4LJZC 2FHTA 4A4IA 3D4WA 1NY4A 3OW7A 1NNXA 2WKCA 4GLXA 2BH2A 3NENA 3VR3A 3M4YA 4J15A 3M4OH 2OT2A 3MXGA 1V1PB 3J7ZC 5L37A 2D2CC 2Y0SB 4R9WA 4LF5Q 1UWVA 4DUYL 1Y1WB 1QVFA 3AMUA 4B3RQ 4ZUJA 1SE8A 4P71A 5LMNQ 5M3FB 2JA8G 3K7AB 4YCVA 1YIJA 1TS2A 4LF7L 1PTOB 1X54A 2NYZD 3GTQH 1FGUA 1D5MC 5M9OA 1CA6A 3H6MA 4LWCA 1SR3A 1HUNA 4LF6L 4A3EB 3A56A 3RZOB 1AEXA 1BCPB 3L7ZC 2F4VL 3QG1A 1MSGA 4R4CA 4UY8C 1Z6HA 1GHKA 4KN7C 1Q12A 3D31A 2VUMH 2A74C 3S1NB 1BCPC 3NP8A 1A3UA 1CI3M 5DEHA 3CPWA 4JBKA 4RHSA 1GM5A 2ZM6Q 3FP9A 3S1MB 2LKVA 1UUPA 1Q86C 2A6HC 1WTVA 4FO2A 3PO2B 2AQ1B 1F9PA 4ZAIA 4PMBA 4Y7NB 1LTRD 1I4PA 1Z7TA 1MGSA 3A54A 1PYWD 1O80A 1H9SA 1Y1VH 5M3MB 1B9NA 1L1OA 1PDQA 4JOIA 4A3CH 2F0TA 2Y0SE 3FKIB 2IHFA 1Q8KA 4XT1B 3K5LA 1Y1WG 1OXTA 3E3XA 1WVLA 1Y1WH 3A5UA 4X65Q 3H0GH 5ELFA 4JI7Q 3MEHA 2JA9A 4MTKA 3DWPA 4DU9A 4GZYC 4HIMA 1STHA 5IP9H 3UDIA 3PO2H 3CP0A 4A93B 3CKIB 3PUWA 2NVQB 1GHJA 4CJ0B 5IYCH 2OTLA 1WI5A 2KCCA 4DAMA 3H09A 5IE8A 1VQEA 4CJ1B 2G9DA 1OO9B 1CZGA 2F52A 2I5LX 4M8AA 3PO3B 3DM3A 1K0SA 2WP8J 4JI6Q 1EQTA 2AKWB 4GKKQ 2SEBD 2E2JH 3WOEA 1M90C 2ZJQA 4P73A 1RKNA 1TS4A 1I94L 3S1QH 2UXDQ 2UU9Q 4PZ7A 3KJOA 4K0KQ 2NZ1D 3S1MH 3S2HB 1I4RA 4NXML 1P8LA 3H94A 4H0LC 2EYHA 4IFDH 4BBSG 3X3MA 1A63A 2C5CA 3I56A 5M5YH 5M3MG 4FYDA 1RIPA 1SYGA 5HGQA 4CHTB 3CQZH 4MNOA 2QDLA 1CKNB 1I4QA 3I4MH 3HZXA 2H4OA 3BYYB 3MFGA 4IPDA 1BNZA 4A3BG 2PQAB 2R92G 4ZKCB 5HGTA 4A3KB 4B3SQ 4IUNA 5ELDA 1U4LA 1LTGD 3JAMc 4A3MB 1ET6A 2BOSA 2PQEA 5JAVA 5E7NA 4OO1G 4EGVA 1S5ED 1D5XC 4F87A 2IL8A 2QW7A 4A93G 2C9OA 5CBEE 4A3BB 4A3GG 5I2YA 5CV4A 1VQKA 4A3DH 4OIKA 2YYZA 5EQ0A 4J6HA 1Q8IA 1O7ZA 1LTID 3MVVA 1PVOA 1IL2A 2EY5A 2VZAA 3I2ZA 2LXKA 4AYBG 3T4AC 2WINB 5CV5A 3U9SA 3KLRA 4LF7Q 2K75A 1H9JA 2XWBB 3IAYA 5G3LF 4NDXA 1K3RA 4CKCA 3A8KE 1CTMA 2F0LA 5JJIA 2MQHA 5GAGC 5D65A 2F0EA 3S24A 4BY1B 5FJ8H 1TY2A 1BKBA 4IQZA 4PV1C 1S40A 3OOCA 1VQ4A 3OPOA 4XIGS 4UP7A 2QKIC 4ZYSA 1YITA 4KN4C 1XNRQ 4K8IA 5C4ZA 3L9AX 1C9OA 4JI3L 3N52A 1WCMG 4NB3A 2E2HB 1SEBD 2DNEA 1YNJD 3JAML 4DV6Q 1BCPD 1DOLA 1QNUA 3M7NA 3NEMA 3W5OA
chains in the Genus database with same CATH topology
3G4SA 1YHBA 2Q2HA 5C4JH 1N8RC 2R93H 2UUAQ 1A0IA 2DGYA 1OXXK 4A3MG 1FL0A 1VQPA 1I3QH 3PUYA 4DAYB 1R9TH 1N36L 1FJGL 3HOXH 3EBEA 3TREA 5GAHC 1SRUA 1UEBA 1KQSA 4QIWE 3OTOL 4HIDA 2JA5G 2EQSA 1M1KC 1EIFA 4JI5L 3CW2C 2WB1G 1CSQA 1KL9A 2VQFQ 1KHIA 4PG3A 4IFDI 1ASYA 2Q2IA 1YI2A 3BZKA 3U50C 1VQ9A 5C0XG 2N49A 4O0AA 3KDFB 1AE2A 3BJUA 1JB7A 3MXNB 1C0AA 4LFCQ 4L5SA 2JJQA 4R4QA 3S14H 3HKSA 4DV0L 2H5XA 4BXXH 1HZ9A 3K7UC 2OQKA 4RG1A 4XTCS 1AH9A 4B3TL 1U5KA 2CCZA 1X6OA 2ZTDA 1VQGA 2EXDA 5AJ3Q 1HZBA 3F2CA 1Q1BA 3K81C 1OXVA 4JC0A 4X64Q 4B3ML 4NPSA 4QJFA 1W2BA 1HNZQ 4YY3Q 4TQUS 3AYHB 1TWFH 1VCIA 2MO1A 2N3SA 3GTLH 2UXCL 1BBWA 3PO3G 3TRZA 5C0XJ 3G71A 3PCOB 2Z0SA 1IBLQ 2R7FA 5IYBG 3PO3H 2B63G 3BZCA 4R4TA 3CCUA 1VQ8A 4LUVA 3JC66 1NTGA 4LUOA 4Y7NH 1XNQQ 1NMGA 1SMXA 3DLLA 3CCVA 2UXDL 4DR7Q 1IBML 4OWTB 4H02A 1DGSA 3CC2A 5C44G 3RNUA 4LFAL 5JJKA 1L0WA 2ALYB 4DUZL 4DR2Q 4BY1G 1QZHA 2IX0A 4A3IG 1YHQA 3GTMH 3H3VI 1HNWL 1UE6A 5IP7G 1X56A 4GLVB 2AHOB 4X62Q 3CXCA 1VQ6A 4OWWB 1KXLA 4A3KH 2ZTCA 5IP9G 5C4XH 1A8VA 3KFUA 3AFQA 4JI4L 1PH4A 1OXUA 2HIXA 1VQOA 2JA8H 3PIOA 1B8AA 2PI2A 2Y0SG 2NZOA 2MFIA 3HKZG 4DKAC 4DUYQ 2VNUD 4JI0L 1SN8A 3RN5A 4DR3Q 2ZJPA 3AQQA 3A5ZB 2ATWA 2K5NA 4HIOA 4JI8L 4DV6L 1YJ9A 3ICEA 2E2IH 1TXYA 2PMZE 1N9WA 1YBYA 5M3MH 2K5VA 2ASBA 5JEAG 3CCSA 2QEXA 3UDXA 4A3FH 4OO1I 1KRTA 2R7ZH 3UE0A 1CUKA 2YTYA 1PV4A 1KIXA 2BA1A 2K14A 2R7ZG 1HR0L 4YHHL 2LXJA 2CFMA 1VQBA 4C3JH 3PSIA 4GOPC 3HOZH 2ID0A 3H15A 1YVCA 3TEHB 2Q2UA 1YJWA 2F4VQ 1YNXA 3AFPA 1JJ2A 3S1NH 1UE5A 3M9BA 3M85A 3F2BA 4YWLA 5JEAJ 4DV2L 1I5FA 5C3EG 4LFCL 1Y1VG 1PH5A 1YHAA 4UP8A 4JI1L 4DV0Q 5ELOA 1T9HA 4GNXB 3PV0A 2VUMG 3U58A 4ALPA 3PGZA 5AJ3L 3CMAA 2A8VA 2ZM6L 4DR5Q 3HOWH 4PZ8A 4OX9Q 4KHZA 5EAYA 2K52A 2VL6A 2D0PA 1N34Q 3E9HA 4GS3A 3JAMi 4AQYL 2R6GA 4X6AH 4A3JG 2OCEA 1L1OB 1VQMA 3GD7A 1K8AC 3OW2A 1JMCA 2R93G 2MNAA 1IBLL 1B7YB 4JYAQ 2KCTA 2R7DA 1QVCA 3FKIH 5LMUQ 2HT1A 4BA2I 2N8NA 3F1ZA 4DV3L 4A3DG 4JV5Q 2IHEA 3LGJA 4QY7A 4KHPL 1ASZA 3KF8B 4APVA 2GN5A 3GTGH 1JT8A 4IPCA 1XMQL 4DR7L 1A62A 1B70B 3HOUH 5IYCG 1VQNA 1WFQA 4DR2L 3I4NG 1GO3E 4A3LH 3RN2A 1HNWQ 1HZAA 4PZ6A 1Q81C 1V1QA 4A93H 1E1OA 2A1AA 2E8GA 3I7FA 2GVBA 4JI2L 4DPGA 3HOYG 1KRSA 1W3SA 4A3GH 4JI4Q 3OYYA 3H0GG 1Q7YC 2NVQH 3A0JA 3GO5A 1G6PA 1PH1A 1BBUA 3S16H 2CKZB 1GVPA 3PUVA 3B6YA 4KI0A 1OTCA 4DV5Q 4JI0Q 4GN3B 1XPRA 1VQJA 1XNRL 3PF5A 1JE5A 3KYHC 1PA6A 1NBWA 1XJVA 5HY6A 4LFBL 3ULLA 4JI8Q 4B3RL 1NE3A 1L2FA 5LMNL 4DR6L 4JI6L 1IBKQ 2JA7G 4DR4Q 1X3EA 3J81c 1K73C 3K0XA 4GKJQ 4JBWA 1XPUA 1V9PA 3W1BA 2LSSA 2HQLA 1HNXQ 4IPGA 4MZ9A 3KF6A 4IFDG 3K8AA 2RCNA 5C44H 3RR5A 4POFA 4YHHQ 5GQOA 1EIYB 3OTOQ 4ME3A 2YV5A 5H1SE 4YCUA 3VDYA 1K83H 5IY0A 2PI2E 2VQFL 1LTLA 1V43A 4NXMQ 1UE7A 4DR1Q 4AYBE 3J81i 4GOPA 2IY5B 4HJ5A 3U4VA 3F8TA 1E1TA 1WYDA 1EFWA 3WWVA 3MEFA 3GTJH 3UDFA 2CWPA 3I4OA 2I0QA 2R92H 2JE6I 4QQBX 2UXBL 4B3TQ 1CKNA 1SLJA 2K50A 2VW9A 1KD1C 1QVGA 4DV7Q 4A3JH 2KCMA 4HJ7A 3CC4A 4DR5L 1EQRA 1G291 4LUZA 3Q8DA 4BA1I 1N34L 4OXPA 4X64L 1XMOL 1TWHH 1VQLA 4YCWA 4DV1Q 3M3YH 5C0XI 1X3FA 1VQFA 4JYAL 3J7A5 4L5QA 1HH2P 1VQAA 1PH7A 1QUQA 4HJ8A 1NJIC 2D62A 5LMUL 3K7AH 4NXNL 4HIKA 3T1YQ 1MKHA 1J5EL 2GVAA 3CMEA 2RF4A 3GTPH 4IJHA 3J80c 2HHHQ 1GD7A 4BXXG 4KHPQ 1H95A 4YWMA 3HOVH 2JQOA 2B3GA 1MIUA 3TS0A 1PYBA 1XNQL 1VS0A 2YTXA 1K8GA 1X65A 4A4IA 1XPOA 4GNXA 1NY4A 4IPHA 1EQQA 3RLFA 5M3FG 4DUZQ 4BY7H 4GLXA 2BH2A 1I50H 5M5WH 1E3PA 3NENA 5M5XH 4JI7L 4X62L 4J15A 4IFDJ 5FJ8G 3M4OH 3J80i 3S15H 3CCMA 3J7ZC 3GDEA 3ULPA 4P74A 4BBSH 2ES2A 3M4PA 4DV5L 3CD6A 2A19A 4LF5Q 1UWVA 4OONA 2MO0A 4DUYL 4A3IH 3D0FA 1QVFA 3UDGA 4LFBQ 3S1RH 4IJLA 5IWAL 5BR8L 2UUBQ 4B3RQ 4C3HH 4L5TA 2I5HA 2OWOA 1SE8A 4P71A 5LMNQ 3CCLA 4DR6Q 5C4XG 4DR4L 4LF8Q 5DLQE 4GKJL 4UPAA 2JA8G 4YCVA 5IT9c 1YIJA 2UUCQ 4LF7L 4IO9A 1HNXL 2L15A 2YTVA 1Q1EA 1X54A 2AWOA 3HFZB 5FLMG 1TWCH 2JA7H 1P16A 2DUDA 2KHJA 4DK3C 4LF4L 4C2MH 3GTQH 1FGUA 3HOZG 2Z6KA 3J81j 1HR0Q 4BY1H 4LWCA 1SR3A 4DK6C 4HJAA 3KDFA 4RMFA 4LF6L 4K0KL 4DR1L 3L7ZC 1WCMH 2F4VL 4LF9Q 4R4CA 1TWGH 1SFOH 4UY8C 4DV2Q 2XTIA 1Q12A 4A3MH 4DV4L 3D31A 2VQEQ 2VUMH 4JI1Q 4EQ5A 2UXBQ 1D7QA 3S2HH 3CPWA 4DV7L 4JBKA 1GM5A 1IZ6A 2I5MX 1Q46A 1VQDA 3ER0A 4Y52H 3KF6B 1XMOQ 3GTKH 2ZM6Q 3FP9A 1IXRA 3A74A 3KJPA 3CCEA 4DV1L 1Q86C 3T1HQ 4HJ9A 2NVXH 1E24A 4OWXB 2FXQA 3K80C 1PH3A 1S3OA 1LM0A 1VQCA 1PHJA 3W1GA 2UUAL 3GTOH 4P75A 1Y1VH 4B3SL 2HHHL 1EOVA 3ULJA 1L1OA 3PF4A 1FJGQ 1N32L 3CPFA 3KLWA 4JOIA 2ZJRA 4A3CH 4A3BH 2Y0SE 2D0OA 2IHFA 1Q8KA 3U4ZA 4YWKA 3CCRA 1Y1WG 4JI5Q 4FDBA 1MJCA 1XMQQ 3HOXG 2PNHA 1OXTA 1PH6A 1Y1WH 3A5UA 2JA5H 4DNIA 4X65Q 3H0GH 3I4MG 4JI7Q 4JBMA 2JA9A 5IYBH 3PO2G 1EWIA 1SROA 4JI2Q 4HIMA 4IOAA 5IP9H 4R4OA 3UDIA 3CP0A 1RL2A 4GOPB 3PO2H 1LUZA 3L0OA 1VQHA 3PUWA 3TS2A 1Z9FA 2CQOA 4R4IA 5GADC 5IYCH 2OTLA 2B63H 1WI5A 4JOIC 4DAMA 2JA6H 3I4NH 5IE8A 1VQEA 3RLNA 4YY3L 1OXSC 1VQIA 4MTNA 1HJPA 3HOUG 2F52A 2I5LX 2OTJA 5IYDH 4C3IH 3DM3A 1Z47A 2KBNA 2WP8J 2UUCL 4JI6Q 2AKWB 1WOCA 3HOYH 4GKKQ 4A3FG 3SGIA 2E2JH 1M90C 3E0EA 5FLXc 4P73A 4A3EH 1X55A 2ZJQA 4X66Q 1I94L 3S1QH 2UXDQ 4EX5A 3AEVA 4BBRH 1I6HH 2K4KA 4AIMA 3KOJA 4LFAQ 2QGQA 1TWAH 2KENA 3RLOA 2UU9Q 1CKOA 4WJ3M 4PZ7A 3KJOA 3UE1A 4GNXC 2E2HH 4LF6Q 4K0KQ 3S1MH 4A76A 3G6EA 3IRBA 4NXML 3H3VH 2E5LL 1P8LA 1QZGA 1N33L 1AE3A 4BBSG 1A63A 2B29A 3I56A 1E7ZA 3E9IA 5ELNA 5M3MG 5M5YH 2EIFA 2WB1E 4JBJA 2VQEL 2Q2TA 3I55A 3STBD 1RIPA 2WFWA 1O7IA 3EN2A 5HGQA 4DR3L 2V1CC 2C35B 3CQZH 4QGUA 4JI3Q 3G48A 4GN4B 4JCVE 1FVIA 2JEAI 1HZCA 4MNOA 3HOWG 3T1HL 3RZOH 1CKNB 3BU2A 3I4MH 5GAEC 1S72A 4LW1A 4IPDA 2BH8A 3TQYA 4A3BG 3ERSX 2PQAB 2R92G 2IX1A 5K36G 4B3SQ 1D8LA 1N32Q 3FKIG 3T1YL 1J5EQ 4NXNQ 3S17H 1L1OC 4AH6A 5LMNW 1JJCB 1YEZA 3JAMc 3RZDH 4KLKA 1N36Q 3CC7A 4TVAB 4UP9A 5M3FH 2RHQB 2WAQE 5E7NA 1VQ7A 4OO1G 2VS1A 3PUXA 1NMFA 4A3CG 3STBC 1YJNA 1IYJB 4X65L 4IOCA 1X9NA 4A3LG 5GROA 1J6QA 2CWAA 3PUZA 4A93G 2JA6G 4GN5A 3ZJYC 3L2PA 4A3GG 5C3EH 4A3KG 3HKZE 5J3BA 1VQKA 2ZTEA 4A3DH 2YYZA 3M4QA 2N78A 3CCJA 4OX9L 4BY7G 4LF5L 4B3MQ 2F3IA 1X3GA 4AQYQ 1G51A 2XGTA 2QA4A 1PH9A 3S2DH 1IL2A 4A75A 1HNZL 3CF5A 1CSPA 1PVOA 1MJEA 2VZAA 3I2ZA 4WJ4A 5BR8Q 1KAWA 5IWAQ 2LXKA 1LYLA 2UUBL 2UXCQ 2IT1A 4AYBG 2JK8A 4JG2A 2RHSB 5FLMH 4LF8L 4GLAC 4DV3Q 4JV5L 4GKKL 1BVSA 3EIVA 4LF7Q 1E22A 2K75A 3HOVG 1VQ5A 2NVTH 4L5RC 4X66L 1I94Q 4R1JA 2BA0A 4LNQA 1K3RA 1YZ6A 1C7YA 2NVYH 1EYGA 4LF4Q 1CKMA 1XTDA 2JEBI 1IBMQ 2UU9L 5JJIA 2MQHA 5GAGC 1Y14B 1UE1A 4A3EG 2OQ0A 3CAMA 1PFSA 2HIVA 2VY3A 4BBRG 1GKHA 1K0RA 2KHIA 3S24A 4POGA 2K5HA 3PIPA 5FJ8H 2E5LQ 2NN6I 3NBHB 1N33Q 1BKBA 1S40A 1PH2A 4LF9L 1PH8A 1JJGA 2NZHA 4DV4Q 1EUJA 1VQ4A 5IP7H 4XIGS 1QUQB 2WAQG 4O2DA 2YU9H 4UP7A 1YITA 3NELA 4QL5A 1PYSB 1Q82C 2AWNA 1KC8C 1K9MC 1XNRQ 5IYDG 1C9OA 4JI3L 3FHWA 1U0LA 4P72A 1WCMG 1WJJA 4NB3A 3CCQA 2Z6KC 2NN6G 2PQAA 1HR0W 4DV6Q 1IBKL 2AMCB 5JJLA 4PMWA 3NEMA 3M7NA 3F2DA 3W5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S A;  1YHB A;  2Q2H A;  5C4J H;  1N8R C;  2R93 H;  2UUA Q;  1A0I A;  2DGY A;  1OXX K;  4A3M G;  1FL0 A;  1VQP A;  1I3Q H;  3PUY A;  4DAY B;  1R9T H;  1N36 L;  1FJG L;  3HOX H;  3EBE A;  3TRE A;  5GAH C;  1SRU A;  1UEB A;  1KQS A;  4QIW E;  3OTO L;  4HID A;  2JA5 G;  2EQS A;  1M1K C;  1EIF A;  4JI5 L;  3CW2 C;  2WB1 G;  1CSQ A;  1KL9 A;  2VQF Q;  1KHI A;  4PG3 A;  4IFD I;  1ASY A;  2Q2I A;  1YI2 A;  3BZK A;  3U50 C;  1VQ9 A;  5C0X G;  2N49 A;  4O0A A;  3KDF B;  1AE2 A;  3BJU A;  1JB7 A;  3MXN B;  1C0A A;  4LFC Q;  4L5S A;  2JJQ A;  4R4Q A;  3S14 H;  3HKS A;  4DV0 L;  2H5X A;  4BXX H;  1HZ9 A;  3K7U C;  2OQK A;  4RG1 A;  4XTC S;  1AH9 A;  4B3T L;  1U5K A;  2CCZ A;  1X6O A;  2ZTD A;  1VQG A;  2EXD A;  5AJ3 Q;  1HZB A;  3F2C A;  1Q1B A;  3K81 C;  1OXV A;  4JC0 A;  4X64 Q;  4B3M L;  4NPS A;  4QJF A;  1W2B A;  1HNZ Q;  4YY3 Q;  4TQU S;  3AYH B;  1TWF H;  1VCI A;  2MO1 A;  2N3S A;  3GTL H;  2UXC L;  1BBW A;  3PO3 G;  3TRZ A;  5C0X J;  3G71 A;  3PCO B;  2Z0S A;  1IBL Q;  2R7F A;  5IYB G;  3PO3 H;  2B63 G;  3BZC A;  4R4T A;  3CCU A;  1VQ8 A;  4LUV A;  3JC6 6;  1NTG A;  4LUO A;  4Y7N H;  1XNQ Q;  1NMG A;  1SMX A;  3DLL A;  3CCV A;  2UXD L;  4DR7 Q;  1IBM L;  4OWT B;  4H02 A;  1DGS A;  3CC2 A;  5C44 G;  3RNU A;  4LFA L;  5JJK A;  1L0W A;  2ALY B;  4DUZ L;  4DR2 Q;  4BY1 G;  1QZH A;  2IX0 A;  4A3I G;  1YHQ A;  3GTM H;  3H3V I;  1HNW L;  1UE6 A;  5IP7 G;  1X56 A;  4GLV B;  2AHO B;  4X62 Q;  3CXC A;  1VQ6 A;  4OWW B;  1KXL A;  4A3K H;  2ZTC A;  5IP9 G;  5C4X H;  1A8V A;  3KFU A;  3AFQ A;  4JI4 L;  1PH4 A;  1OXU A;  2HIX A;  1VQO A;  2JA8 H;  3PIO A;  1B8A A;  2PI2 A;  2Y0S G;  2NZO A;  2MFI A;  3HKZ G;  4DKA C;  4DUY Q;  2VNU D;  4JI0 L;  1SN8 A;  3RN5 A;  4DR3 Q;  2ZJP A;  3AQQ A;  3A5Z B;  2ATW A;  2K5N A;  4HIO A;  4JI8 L;  4DV6 L;  1YJ9 A;  3ICE A;  2E2I H;  1TXY A;  2PMZ E;  1N9W A;  1YBY A;  5M3M H;  2K5V A;  2ASB A;  5JEA G;  3CCS A;  2QEX A;  3UDX A;  4A3F H;  4OO1 I;  1KRT A;  2R7Z H;  3UE0 A;  1CUK A;  2YTY A;  1PV4 A;  1KIX A;  2BA1 A;  2K14 A;  2R7Z G;  1HR0 L;  4YHH L;  2LXJ A;  2CFM A;  1VQB A;  4C3J H;  3PSI A;  4GOP C;  3HOZ H;  2ID0 A;  3H15 A;  1YVC A;  3TEH B;  2Q2U A;  1YJW A;  2F4V Q;  1YNX A;  3AFP A;  1JJ2 A;  3S1N H;  1UE5 A;  3M9B A;  3M85 A;  3F2B A;  4YWL A;  5JEA J;  4DV2 L;  1I5F A;  5C3E G;  4LFC L;  1Y1V G;  1PH5 A;  1YHA A;  4UP8 A;  4JI1 L;  4DV0 Q;  5ELO A;  1T9H A;  4GNX B;  3PV0 A;  2VUM G;  3U58 A;  4ALP A;  3PGZ A;  5AJ3 L;  3CMA A;  2A8V A;  2ZM6 L;  4DR5 Q;  3HOW H;  4PZ8 A;  4OX9 Q;  4KHZ A;  5EAY A;  2K52 A;  2VL6 A;  2D0P A;  1N34 Q;  3E9H A;  4GS3 A;  3JAM i;  4AQY L;  2R6G A;  4X6A H;  4A3J G;  2OCE A;  1L1O B;  1VQM A;  3GD7 A;  1K8A C;  3OW2 A;  1JMC A;  2R93 G;  2MNA A;  1IBL L;  1B7Y B;  4JYA Q;  2KCT A;  2R7D A;  1QVC A;  3FKI H;  5LMU Q;  2HT1 A;  4BA2 I;  2N8N A;  3F1Z A;  4DV3 L;  4A3D G;  4JV5 Q;  2IHE A;  3LGJ A;  4QY7 A;  4KHP L;  1ASZ A;  3KF8 B;  4APV A;  2GN5 A;  3GTG H;  1JT8 A;  4IPC A;  1XMQ L;  4DR7 L;  1A62 A;  1B70 B;  3HOU H;  5IYC G;  1VQN A;  1WFQ A;  4DR2 L;  3I4N G;  1GO3 E;  4A3L H;  3RN2 A;  1HNW Q;  1HZA A;  4PZ6 A;  1Q81 C;  1V1Q A;  4A93 H;  1E1O A;  2A1A A;  2E8G A;  3I7F A;  2GVB A;  4JI2 L;  4DPG A;  3HOY G;  1KRS A;  1W3S A;  4A3G H;  4JI4 Q;  3OYY A;  3H0G G;  1Q7Y C;  2NVQ H;  3A0J A;  3GO5 A;  1G6P A;  1PH1 A;  1BBU A;  3S16 H;  2CKZ B;  1GVP A;  3PUV A;  3B6Y A;  4KI0 A;  1OTC A;  4DV5 Q;  4JI0 Q;  4GN3 B;  1XPR A;  1VQJ A;  1XNR L;  3PF5 A;  1JE5 A;  3KYH C;  1PA6 A;  1NBW A;  1XJV A;  5HY6 A;  4LFB L;  3ULL A;  4JI8 Q;  4B3R L;  1NE3 A;  1L2F A;  5LMN L;  4DR6 L;  4JI6 L;  1IBK Q;  2JA7 G;  4DR4 Q;  1X3E A;  3J81 c;  1K73 C;  3K0X A;  4GKJ Q;  4JBW A;  1XPU A;  1V9P A;  3W1B A;  2LSS A;  2HQL A;  1HNX Q;  4IPG A;  4MZ9 A;  3KF6 A;  4IFD G;  3K8A A;  2RCN A;  5C44 H;  3RR5 A;  4POF A;  4YHH Q;  5GQO A;  1EIY B;  3OTO Q;  4ME3 A;  2YV5 A;  5H1S E;  4YCU A;  3VDY A;  1K83 H;  5IY0 A;  2PI2 E;  2VQF L;  1LTL A;  1V43 A;  4NXM Q;  1UE7 A;  4DR1 Q;  4AYB E;  3J81 i;  4GOP A;  2IY5 B;  4HJ5 A;  3U4V A;  3F8T A;  1E1T A;  1WYD A;  1EFW A;  3WWV A;  3MEF A;  3GTJ H;  3UDF A;  2CWP A;  3I4O A;  2I0Q A;  2R92 H;  2JE6 I;  4QQB X;  2UXB L;  4B3T Q;  1CKN A;  1SLJ A;  2K50 A;  2VW9 A;  1KD1 C;  1QVG A;  4DV7 Q;  4A3J H;  2KCM A;  4HJ7 A;  3CC4 A;  4DR5 L;  1EQR A;  1G29 1;  4LUZ A;  3Q8D A;  4BA1 I;  1N34 L;  4OXP A;  4X64 L;  1XMO L;  1TWH H;  1VQL A;  4YCW A;  4DV1 Q;  3M3Y H;  5C0X I;  1X3F A;  1VQF A;  4JYA L;  3J7A 5;  4L5Q A;  1HH2 P;  1VQA A;  1PH7 A;  1QUQ A;  4HJ8 A;  1NJI C;  2D62 A;  5LMU L;  3K7A H;  4NXN L;  4HIK A;  3T1Y Q;  1MKH A;  1J5E L;  2GVA A;  3CME A;  2RF4 A;  3GTP H;  4IJH A;  3J80 c;  2HHH Q;  1GD7 A;  4BXX G;  4KHP Q;  1H95 A;  4YWM A;  3HOV H;  2JQO A;  2B3G A;  1MIU A;  3TS0 A;  1PYB A;  1XNQ L;  1VS0 A;  2YTX A;  1K8G A;  1X65 A;  4A4I A;  1XPO A;  4GNX A;  1NY4 A;  4IPH A;  1EQQ A;  3RLF A;  5M3F G;  4DUZ Q;  4BY7 H;  4GLX A;  2BH2 A;  1I50 H;  5M5W H;  1E3P A;  3NEN A;  5M5X H;  4JI7 L;  4X62 L;  4J15 A;  4IFD J;  5FJ8 G;  3M4O H;  3J80 i;  3S15 H;  3CCM A;  3J7Z C;  3GDE A;  3ULP A;  4P74 A;  4BBS H;  2ES2 A;  3M4P A;  4DV5 L;  3CD6 A;  2A19 A;  4LF5 Q;  1UWV A;  4OON A;  2MO0 A;  4DUY L;  4A3I H;  3D0F A;  1QVF A;  3UDG A;  4LFB Q;  3S1R H;  4IJL A;  5IWA L;  5BR8 L;  2UUB Q;  4B3R Q;  4C3H H;  4L5T A;  2I5H A;  2OWO A;  1SE8 A;  4P71 A;  5LMN Q;  3CCL A;  4DR6 Q;  5C4X G;  4DR4 L;  4LF8 Q;  5DLQ E;  4GKJ L;  4UPA A;  2JA8 G;  4YCV A;  5IT9 c;  1YIJ A;  2UUC Q;  4LF7 L;  4IO9 A;  1HNX L;  2L15 A;  2YTV A;  1Q1E A;  1X54 A;  2AWO A;  3HFZ B;  5FLM G;  1TWC H;  2JA7 H;  1P16 A;  2DUD A;  2KHJ A;  4DK3 C;  4LF4 L;  4C2M H;  3GTQ H;  1FGU A;  3HOZ G;  2Z6K A;  3J81 j;  1HR0 Q;  4BY1 H;  4LWC A;  1SR3 A;  4DK6 C;  4HJA A;  3KDF A;  4RMF A;  4LF6 L;  4K0K L;  4DR1 L;  3L7Z C;  1WCM H;  2F4V L;  4LF9 Q;  4R4C A;  1TWG H;  1SFO H;  4UY8 C;  4DV2 Q;  2XTI A;  1Q12 A;  4A3M H;  4DV4 L;  3D31 A;  2VQE Q;  2VUM H;  4JI1 Q;  4EQ5 A;  2UXB Q;  1D7Q A;  3S2H H;  3CPW A;  4DV7 L;  4JBK A;  1GM5 A;  1IZ6 A;  2I5M X;  1Q46 A;  1VQD A;  3ER0 A;  4Y52 H;  3KF6 B;  1XMO Q;  3GTK H;  2ZM6 Q;  3FP9 A;  1IXR A;  3A74 A;  3KJP A;  3CCE A;  4DV1 L;  1Q86 C;  3T1H Q;  4HJ9 A;  2NVX H;  1E24 A;  4OWX B;  2FXQ A;  3K80 C;  1PH3 A;  1S3O A;  1LM0 A;  1VQC A;  1PHJ A;  3W1G A;  2UUA L;  3GTO H;  4P75 A;  1Y1V H;  4B3S L;  2HHH L;  1EOV A;  3ULJ A;  1L1O A;  3PF4 A;  1FJG Q;  1N32 L;  3CPF A;  3KLW A;  4JOI A;  2ZJR A;  4A3C H;  4A3B H;  2Y0S E;  2D0O A;  2IHF A;  1Q8K A;  3U4Z A;  4YWK A;  3CCR A;  1Y1W G;  4JI5 Q;  4FDB A;  1MJC A;  1XMQ Q;  3HOX G;  2PNH A;  1OXT A;  1PH6 A;  1Y1W H;  3A5U A;  2JA5 H;  4DNI A;  4X65 Q;  3H0G H;  3I4M G;  4JI7 Q;  4JBM A;  2JA9 A;  5IYB H;  3PO2 G;  1EWI A;  1SRO A;  4JI2 Q;  4HIM A;  4IOA A;  5IP9 H;  4R4O A;  3UDI A;  3CP0 A;  1RL2 A;  4GOP B;  3PO2 H;  1LUZ A;  3L0O A;  1VQH A;  3PUW A;  3TS2 A;  1Z9F A;  2CQO A;  4R4I A;  5GAD C;  5IYC H;  2OTL A;  2B63 H;  1WI5 A;  4JOI C;  4DAM A;  2JA6 H;  3I4N H;  5IE8 A;  1VQE A;  3RLN A;  4YY3 L;  1OXS C;  1VQI A;  4MTN A;  1HJP A;  3HOU G;  2F52 A;  2I5L X;  2OTJ A;  5IYD H;  4C3I H;  3DM3 A;  1Z47 A;  2KBN A;  2WP8 J;  2UUC L;  4JI6 Q;  2AKW B;  1WOC A;  3HOY H;  4GKK Q;  4A3F G;  3SGI A;  2E2J H;  1M90 C;  3E0E A;  5FLX c;  4P73 A;  4A3E H;  1X55 A;  2ZJQ A;  4X66 Q;  1I94 L;  3S1Q H;  2UXD Q;  4EX5 A;  3AEV A;  4BBR H;  1I6H H;  2K4K A;  4AIM A;  3KOJ A;  4LFA Q;  2QGQ A;  1TWA H;  2KEN A;  3RLO A;  2UU9 Q;  1CKO A;  4WJ3 M;  4PZ7 A;  3KJO A;  3UE1 A;  4GNX C;  2E2H H;  4LF6 Q;  4K0K Q;  3S1M H;  4A76 A;  3G6E A;  3IRB A;  4NXM L;  3H3V H;  2E5L L;  1P8L A;  1QZG A;  1N33 L;  1AE3 A;  4BBS G;  1A63 A;  2B29 A;  3I56 A;  1E7Z A;  3E9I A;  5ELN A;  5M3M G;  5M5Y H;  2EIF A;  2WB1 E;  4JBJ A;  2VQE L;  2Q2T A;  3I55 A;  3STB D;  1RIP A;  2WFW A;  1O7I A;  3EN2 A;  5HGQ A;  4DR3 L;  2V1C C;  2C35 B;  3CQZ H;  4QGU A;  4JI3 Q;  3G48 A;  4GN4 B;  4JCV E;  1FVI A;  2JEA I;  1HZC A;  4MNO A;  3HOW G;  3T1H L;  3RZO H;  1CKN B;  3BU2 A;  3I4M H;  5GAE C;  1S72 A;  4LW1 A;  4IPD A;  2BH8 A;  3TQY A;  4A3B G;  3ERS X;  2PQA B;  2R92 G;  2IX1 A;  5K36 G;  4B3S Q;  1D8L A;  1N32 Q;  3FKI G;  3T1Y L;  1J5E Q;  4NXN Q;  3S17 H;  1L1O C;  4AH6 A;  5LMN W;  1JJC B;  1YEZ A;  3JAM c;  3RZD H;  4KLK A;  1N36 Q;  3CC7 A;  4TVA B;  4UP9 A;  5M3F H;  2RHQ B;  2WAQ E;  5E7N A;  1VQ7 A;  4OO1 G;  2VS1 A;  3PUX A;  1NMF A;  4A3C G;  3STB C;  1YJN A;  1IYJ B;  4X65 L;  4IOC A;  1X9N A;  4A3L G;  5GRO A;  1J6Q A;  2CWA A;  3PUZ A;  4A93 G;  2JA6 G;  4GN5 A;  3ZJY C;  3L2P A;  4A3G G;  5C3E H;  4A3K G;  3HKZ E;  5J3B A;  1VQK A;  2ZTE A;  4A3D H;  2YYZ A;  3M4Q A;  2N78 A;  3CCJ A;  4OX9 L;  4BY7 G;  4LF5 L;  4B3M Q;  2F3I A;  1X3G A;  4AQY Q;  1G51 A;  2XGT A;  2QA4 A;  1PH9 A;  3S2D H;  1IL2 A;  4A75 A;  1HNZ L;  3CF5 A;  1CSP A;  1PVO A;  1MJE A;  2VZA A;  3I2Z A;  4WJ4 A;  5BR8 Q;  1KAW A;  5IWA Q;  2LXK A;  1LYL A;  2UUB L;  2UXC Q;  2IT1 A;  4AYB G;  2JK8 A;  4JG2 A;  2RHS B;  5FLM H;  4LF8 L;  4GLA C;  4DV3 Q;  4JV5 L;  4GKK L;  1BVS A;  3EIV A;  4LF7 Q;  1E22 A;  2K75 A;  3HOV G;  1VQ5 A;  2NVT H;  4L5R C;  4X66 L;  1I94 Q;  4R1J A;  2BA0 A;  4LNQ A;  1K3R A;  1YZ6 A;  1C7Y A;  2NVY H;  1EYG A;  4LF4 Q;  1CKM A;  1XTD A;  2JEB I;  1IBM Q;  2UU9 L;  5JJI A;  2MQH A;  5GAG C;  1Y14 B;  1UE1 A;  4A3E G;  2OQ0 A;  3CAM A;  1PFS A;  2HIV A;  2VY3 A;  4BBR G;  1GKH A;  1K0R A;  2KHI A;  3S24 A;  4POG A;  2K5H A;  3PIP A;  5FJ8 H;  2E5L Q;  2NN6 I;  3NBH B;  1N33 Q;  1BKB A;  1S40 A;  1PH2 A;  4LF9 L;  1PH8 A;  1JJG A;  2NZH A;  4DV4 Q;  1EUJ A;  1VQ4 A;  5IP7 H;  4XIG S;  1QUQ B;  2WAQ G;  4O2D A;  2YU9 H;  4UP7 A;  1YIT A;  3NEL A;  4QL5 A;  1PYS B;  1Q82 C;  2AWN A;  1KC8 C;  1K9M C;  1XNR Q;  5IYD G;  1C9O A;  4JI3 L;  3FHW A;  1U0L A;  4P72 A;  1WCM G;  1WJJ A;  4NB3 A;  3CCQ A;  2Z6K C;  2NN6 G;  2PQA A;  1HR0 W;  4DV6 Q;  1IBK L;  2AMC B;  5JJL A;  4PMW A;  3NEM A;  3M7N A;  3F2D A;  3W5O A; 
#chains in the Genus database with same CATH topology
 2DGY A;  2EPB A;  2A6H D;  4A3M G;  4DAY B;  1N36 L;  1PFM A;  2SNS A;  3HOX H;  1Y8P B;  1KQS A;  4HID A;  1FGB D;  3T16 A;  1H9S B;  2EQS A;  2H1E A;  4QUC A;  1DXM A;  1GUT A;  4JI5 L;  4IFD I;  3DUZ A;  2Q2I A;  3J7A V;  1VQ9 A;  2N49 A;  3FPU B;  1F9S A;  2CH4 W;  2EVB A;  4OO1 H;  3MXN B;  1LV9 A;  4R4Q A;  4KK7 A;  4DGZ A;  2OQK A;  4RGN A;  1AH9 A;  4B3T L;  5AJ3 Q;  4B3M L;  1OXV A;  1AFP A;  4NPS A;  3S9W A;  2MPM A;  1W2B A;  4YY3 Q;  4ZUI A;  1K83 B;  2UXC L;  3TP8 A;  2WB1 B;  3TRZ A;  5C0X J;  4RAU C;  1AZQ A;  2EDG A;  2R7F A;  5IOD A;  5IYB G;  2R93 B;  3CCU A;  1HXY D;  4IUT A;  2WV6 D;  4LUV A;  3PMF A;  1EZ6 A;  5IGD A;  2G5D A;  4FXD A;  4OWT B;  3EA6 A;  3FDT A;  5JJK A;  1L0W A;  4DUZ L;  1QZH A;  4DR2 Q;  1GOZ A;  1HNW L;  1UE6 A;  4IZ8 A;  4GLV B;  3LWE A;  3OWE B;  1IYU A;  3CXC A;  4OWW B;  1I4G A;  1KXL A;  3QOL A;  1S5F D;  3S1Q B;  2WAQ B;  4JI4 L;  4N8X 1;  2HIX A;  1VQO A;  5CMD A;  2JA8 H;  1CQF A;  1B8A A;  2PI2 A;  4RCO A;  2DJF C;  4DUY Q;  2VNU D;  2JXM B;  1G8Z D;  3AQQ A;  4ILW A;  1HQR D;  2K5N A;  4EQP A;  4R8I A;  2PMZ E;  2K5V A;  5JEA G;  2R92 B;  3I4L A;  3UDX A;  4A3F H;  1KRT A;  2XN9 C;  1PZJ D;  4K2K A;  4G4K A;  4HCE A;  4YHH L;  4GOP C;  1BBX C;  2ID0 A;  5CV8 A;  1ICF B;  2F4V Q;  5I6Y A;  3M85 A;  4YWL A;  4DV2 L;  5C3E G;  2JA6 B;  4LFC L;  1R4P B;  1SNQ A;  3MFY A;  2F3V A;  4K14 A;  1KNE A;  1T9H A;  2LMC B;  2VUM G;  3U58 A;  4ALP A;  5M5Y B;  1EIH A;  2ZM6 L;  4DR5 Q;  5EAY A;  2D0P A;  3E9H A;  4AQY L;  5KND A;  1TWC B;  5CBA E;  2OCE A;  1JMC A;  3GD7 A;  1H95 A;  4H44 C;  4UHV A;  2MNA A;  1QVC A;  4DAY A;  4ABN A;  1U4P A;  3MC0 B;  5EBD A;  4N8F A;  4KHP L;  1ASZ A;  2GN5 A;  3BDO A;  3K5O A;  1JT8 A;  5IYC G;  1VQN A;  1WFQ A;  4C1N K;  1TWF B;  3Q24 A;  1GO3 E;  3S1R B;  1SND A;  2E8G A;  2V4D A;  3H0G G;  3I91 A;  1Q7Y C;  2R3Z A;  2RSN A;  1PH1 A;  1BBU A;  2J4X A;  4DV5 Q;  4JI0 Q;  3G7L A;  1WCM B;  2F0N A;  1DCZ A;  2B39 A;  1PFB A;  5HY6 A;  1GUO A;  4MHE A;  5C6A A;  1SYF A;  4KD4 A;  3S15 B;  4DR6 L;  1X3E A;  5C4X B;  3K0X A;  5I4D A;  3R8B A;  1LAC A;  2DY8 A;  1LO5 D;  3BDL A;  1JR0 D;  2CHB D;  3GTP B;  4IPG A;  3KF6 A;  2E75 C;  5C5M A;  2NVX B;  3CRL C;  2YV5 A;  4K5W A;  1T5X D;  4YCU A;  1LTL A;  3FPP A;  3V05 A;  3BZD B;  5EGT A;  5J1Z A;  1KLU D;  4RA8 A;  4C3J G;  2IY5 B;  2RVL A;  2EY6 A;  2QEJ C;  3W2D A;  1WYD A;  3MEF A;  2UXB L;  2JE6 I;  5JPM C;  4B3T Q;  3LNN A;  1KD1 C;  1XX8 A;  4DV7 Q;  4HJ7 A;  1EQR A;  2RBM A;  4LUZ A;  3URY A;  4BA1 I;  1XMO L;  1TWH H;  1A15 A;  3A8I E;  2NVT B;  1TVX A;  1HRJ A;  1HH2 P;  1TR5 A;  4QB4 A;  1QUQ A;  2NTT A;  1LTA D;  2D62 A;  3MWY W;  3I72 A;  3MAQ A;  2RF4 A;  3GP7 A;  4QCL A;  2HHH Q;  4DA2 A;  1IYV A;  4F7X A;  2O5I C;  1X65 A;  1XPO A;  3BVM A;  4GNX A;  3NUC A;  4IPH A;  1WTO A;  1EQQ A;  3RLF A;  2IX3 A;  4DUZ Q;  2K03 A;  1E3P A;  3D4D A;  1ZYR D;  4X3K A;  3J80 i;  3S15 H;  4CKB A;  4P74 A;  2FJ2 A;  1DM0 B;  4QMG A;  3M4P A;  2A73 B;  5C4H A;  1KNA A;  4OON A;  2A68 C;  3MA2 B;  4LFB Q;  4R8N A;  2UUB Q;  3NE5 B;  2Z1C A;  3R3O A;  3RZD B;  4DF7 A;  4L5T A;  2OWO A;  1HQM C;  3GQB A;  5C4X G;  2F1M A;  4DR4 L;  1O7Y A;  1S5B D;  5DLQ E;  4UPA A;  3NHH A;  4WRD A;  1K3B C;  2UUC Q;  2FMC A;  4IO9 A;  5I9P A;  4WJW A;  3HFZ B;  1FD7 D;  5FLM G;  1P16 A;  2Q8I B;  4C2M H;  1TS5 A;  4BY1 H;  3KDF A;  1KDA A;  3CRK C;  4C3J B;  4DR1 L;  1M8A A;  4IUR A;  4BBR B;  3C3L A;  1SFO H;  1TWG H;  3TZU A;  3OMG A;  4DV2 Q;  1EYC A;  3SK8 A;  3S14 B;  4ID6 A;  1YNJ C;  1DON A;  3CHB D;  1IZ6 A;  1RTN A;  4B08 A;  1VQD A;  1IXR A;  1BXT A;  3A74 A;  3KJP A;  1ICW A;  3CCE A;  4HJ9 A;  3S16 B;  3HOW B;  2A6E C;  2UUA L;  4A3D B;  3TP5 A;  3GTO H;  4P75 A;  4XT3 B;  2PCF B;  3BVZ A;  3ULJ A;  3PF4 A;  2K33 A;  1VF7 A;  1TT2 A;  5D3I B;  2D0O A;  1SFO B;  3U4Z A;  3CCR A;  4JI5 Q;  5IT9 E;  4G7O C;  1MJC A;  4KMU C;  5E4X A;  1BOS A;  2PNH A;  1JWM D;  3EVQ A;  5FK9 C;  1DD2 A;  4DNI A;  4K5X A;  2Z9H A;  1A6X A;  4JBM A;  1CFM A;  1SRO A;  1WTR A;  2Q8T A;  1H9R A;  4IOA A;  4K2L A;  5KYL A;  4R4O A;  4GOP B;  1DOK A;  3TS2 A;  3L0O A;  1Z9F A;  4JOI C;  4A3G B;  2JA6 H;  2B8F A;  1EU4 A;  4YY3 L;  1OXS C;  2SOB A;  1VQI A;  2XNA C;  1JC7 A;  2OTJ A;  4HAE A;  1BR9 A;  2XIW A;  3SXH A;  4DFA A;  2B2W A;  2K6A A;  3HOY H;  4C3H G;  4OEM B;  1FNV A;  1SSO A;  1E2W A;  1M4V A;  2WKD A;  3RLO A;  1I4X A;  1CKO A;  1KLG D;  4A3I B;  3IRB A;  2E5L L;  1N33 L;  1AE3 A;  4NP5 A;  1E7Z A;  5ELN A;  2VQE L;  2WB1 E;  1W6J A;  1QIL A;  3C2P A;  1HFN A;  1STA A;  2EE1 A;  1V1P A;  1C4Q A;  3IKJ A;  2ZT9 C;  3G48 A;  3VYR A;  3T1H L;  3VYS A;  5CGK A;  5GAE C;  4EQO A;  2BH8 A;  4K8J A;  3TQY A;  1CA5 A;  5G3L D;  3ERS X;  2IX1 A;  5K36 G;  1CT1 D;  1D8L A;  1PRT F;  1RTO A;  2HCI A;  2J0T D;  2RHQ B;  5EPK A;  3PUX A;  3HOU B;  3QWN A;  3STB C;  5AFW A;  1O78 A;  4IOC A;  5GRO A;  2B8G A;  3GTK B;  3P1H A;  1LLR D;  3HOV B;  4S3S A;  3ZJY C;  4A3F B;  2K01 A;  2TMP A;  3VYU A;  4CGY B;  2HDM A;  1QOH A;  2ZXR A;  2F3I A;  4AQY Q;  2XGT A;  1TY0 A;  1EWC A;  3BG3 A;  1CSP A;  1HNZ L;  1MJE A;  2UUB L;  1TQO A;  3T53 B;  2IT1 A;  3OHX C;  4JG2 A;  1EU3 A;  4GLA C;  5IGF A;  3VR4 A;  4JV5 L;  1PRT C;  4GKK L;  3HOV G;  1VMC A;  1PTO C;  4X66 L;  4R1J A;  1U4M A;  4JW0 A;  1YZ6 A;  1C7Y A;  4LF4 Q;  1H9K A;  2JEB I;  4HSV A;  1IBM Q;  2UU9 L;  4I65 A;  1Y14 B;  4BY7 B;  2CQA A;  2HIV A;  3HS0 C;  1K0R A;  3KFU A;  2K5H A;  2K28 A;  3PIP A;  2NN6 I;  3NBH B;  3NK9 A;  3J81 E;  4LF9 L;  1NUC A;  4C56 C;  1NR2 A;  2K5Q A;  5IP7 H;  2WAQ G;  1EIG A;  3RD4 A;  3HRZ C;  1A3V A;  4KY7 A;  2AWN A;  3PIP 3;  2D9U A;  3O13 A;  1D1K A;  1WJJ A;  3CCQ A;  5EBC A;  2NN6 G;  2PQA A;  2F0K A;  4ZCK A;  4XYO A;  5JJL A;  3F2D A;  2Q2T A;  4RGO S;  1YHB A;  2Q2H A;  5C4J H;  5CC4 A;  2UUA Q;  1A0I A;  1OXX K;  1FL0 A;  1VQP A;  2M00 A;  1I3Q H;  3PUY A;  1R9T H;  3EBE A;  3TRE A;  4XXE A;  1GUS A;  3OTO L;  1JWU D;  4ZQ3 A;  4ZKB B;  1M1K C;  1HUM A;  1RF2 D;  2GA4 B;  4F88 A;  1CSQ A;  1KL9 A;  4K6L A;  1KHI A;  1LT3 D;  3E0J A;  1ASY A;  3BZK A;  2QF7 A;  3U50 C;  2AQ2 B;  3K6O A;  5CV9 A;  1RCV D;  1JB7 A;  2F0H A;  2RCF A;  2JJQ A;  4LAA A;  5KGU A;  4DV0 L;  2H5X A;  1V1O A;  2YU9 B;  1B44 D;  2RDF A;  2FFK B;  3F2C A;  1Q1B A;  2D5D A;  2JN4 A;  1VDZ A;  2EOT A;  3K5M A;  1VCI A;  2MO1 A;  3GTL H;  4JPB W;  4HN7 A;  3G71 A;  3TP7 A;  1KDB A;  1PRT B;  4TSS A;  3TZD A;  3PO3 H;  2HD3 A;  2J7Z A;  4PNY A;  4R4T A;  1VQ8 A;  3JC6 6;  1NTG A;  4Y7N H;  1XNQ Q;  5KIX A;  4RWS C;  4H02 A;  1DGS A;  5EJW A;  2LS0 1;  2EJM A;  2ALY B;  2F0W A;  1YHQ A;  2EXZ A;  1WD1 A;  2AHO B;  3C1E A;  5JVG 3;  1ML0 D;  1K8M A;  5K5P A;  1A8V A;  1FYC A;  1OXU A;  1ZEQ X;  1EWH A;  3HKZ G;  4DKA C;  1EL0 A;  4DR3 Q;  3I4N B;  3A5Z B;  2ATW A;  4M1U B;  4DV6 L;  1TXY A;  5A35 A;  1N9W A;  1R4Q B;  3QOJ A;  4WOR A;  5C5L A;  1B53 A;  2R7Z H;  4OEL B;  1F9Q A;  3FEW X;  3UE0 A;  1PV4 A;  2YTY A;  2JA5 B;  1E0B A;  5M5X B;  2ENB A;  2R7Z G;  1HFG A;  1VF5 C;  2CFM A;  3M7G A;  3PSI A;  4G7H C;  3J80 L;  1EQV A;  2VB2 X;  4KV6 A;  2Q2U A;  1YJW A;  3A7L A;  1YNX A;  3S1N H;  5FO9 B;  1NCV A;  1UE5 A;  3M9B A;  3F2B A;  5I9O A;  1I5F A;  4L8J A;  1ESF A;  2EYO A;  2B63 B;  1NAP A;  4JI1 L;  1BCP F;  1PTO H;  2F03 A;  4EQN A;  3P7J A;  2L9H A;  3PGZ A;  5AJ3 L;  4Q5V A;  1C48 A;  2RKS A;  3HOW H;  4J8Q A;  4H7B A;  2B2U A;  4GS3 A;  3JAM i;  4X6A H;  3KLS X;  4AYB B;  1VQM A;  1K8A C;  2R93 G;  3FKI H;  4JV5 Q;  4EVO A;  4A3D G;  3LGJ A;  4HR7 B;  4V19 0;  2BE5 C;  4APV A;  5I2X A;  2F0S A;  2K5W A;  3BYT B;  4DR7 L;  1XMQ L;  2G9H D;  2A68 D;  5ELB A;  1TKW B;  1L0Y B;  1HNW Q;  1HZA A;  4PZ6 A;  1V1Q A;  4A93 H;  2A1A A;  3ND9 A;  4DPG A;  3VR2 A;  4A3G H;  4JI4 Q;  3GO5 A;  1G6P A;  3TDQ A;  1EZ8 A;  2R7Z B;  4KI0 A;  1OTC A;  1D6E C;  4NMZ A;  5DAU A;  1JE5 A;  3KYH C;  1B1Z A;  4PMC A;  4TKO B;  4JI8 Q;  2PW7 A;  3SR1 A;  1AN8 A;  3GTG B;  1GJX A;  1JWS D;  5DM7 3;  4G7Z C;  1TU2 B;  3J7Y W;  1K73 C;  3A55 A;  1XPU A;  1V9P A;  5J22 A;  3W1B A;  5K36 H;  1J8I A;  1HNX Q;  4C3H B;  3H0G B;  3K8A A;  1AZP A;  3RR5 A;  4KKU A;  4POF A;  3RUZ A;  5GQO A;  3OTO Q;  3NTH A;  1K8O A;  3VDY A;  1GUG A;  4AYB E;  1SNO A;  5JPN C;  1ONL A;  4LMQ D;  2CW0 D;  3F8T A;  2JA7 B;  1EFW A;  3GTJ H;  3UDF A;  3I4O A;  4RFB A;  4QQB X;  2X6G A;  1SLJ A;  1GUW A;  2KCM A;  2VXW A;  5EKI A;  4X64 L;  2HUG A;  5KNC A;  1VQL A;  4YCW A;  4DV1 Q;  5C0X I;  1X3F A;  1VQF A;  4Q0F A;  1B3Q A;  1NR4 A;  4JYA L;  4L5Q A;  4QF4 A;  1NJI C;  5LMU L;  1CM9 A;  5IT9 L;  3J81 L;  1SE2 A;  1YNN D;  1S5D D;  3K7A H;  4NXN L;  1MKH A;  1J5E L;  4BWG B;  3CME A;  3GTP H;  4LK1 C;  4KHP Q;  4YWM A;  1KDC A;  3AU7 A;  3HOV H;  3DWA A;  1XNQ L;  2YTX A;  4I7Z C;  1IKM A;  1EY8 A;  4X3S A;  1HA5 A;  3HOX B;  4X62 L;  3FRP B;  4IFD J;  4FXG C;  1I4H A;  4DXG A;  2XVS A;  4KD3 A;  2ES2 A;  1IHZ A;  2B2Y A;  3CD6 A;  1FNW A;  1RDP D;  2MO0 A;  4A3I H;  2PPB C;  3D0F A;  3S1R H;  1PXU A;  4IJL A;  5IWA L;  5F2D A;  2JP1 A;  4GKJ L;  3BVG A;  1Q1E A;  1SYE A;  2AWO A;  2JA7 H;  2DUD A;  4DK3 C;  4LF4 L;  1B9M A;  2Z6K A;  4DK6 C;  2E2D C;  4N9P A;  2BCO A;  5KYI A;  2K05 A;  4K0K L;  4UAI A;  4XDX A;  4LF9 Q;  4C1N I;  5JJZ A;  2XTI A;  4A3M H;  2F0O A;  1D5Z C;  4JI1 Q;  4EQ5 A;  3SVM A;  1HTP A;  1LTB D;  4DV7 L;  4NW2 A;  2I5M X;  1Q46 A;  3ER0 A;  3KF6 B;  5I6W A;  3GTK H;  4IAL A;  1T5E A;  3VR5 A;  1G6Z A;  2FXQ A;  3K80 C;  1PH3 A;  1S3O A;  2F4I A;  3ITP A;  1PHJ A;  1N32 L;  4X3U A;  2HHH L;  3CPF A;  3KLW A;  2BE5 D;  2ZJR A;  4I7A A;  1FR3 A;  4YWK A;  2ICI A;  1XMQ Q;  1TWH B;  4CKE A;  4ZRZ A;  3DM1 A;  2PW5 A;  2JA5 H;  1EYD A;  5LL6 X;  5IYB H;  3PO2 G;  1RL2 A;  1SE4 A;  1LUZ A;  5E3F A;  4BA2 I;  4R4I A;  2B63 H;  3I4N H;  1J9O A;  1S5C D;  1ENC A;  3P20 A;  2EJF C;  3SK4 A;  4MTN A;  5ISR A;  3HOU G;  4HCS A;  5IYD H;  2EYP A;  1EEF D;  4B9W A;  4BS9 A;  1Z47 A;  2KBN A;  2UUC L;  5A2Q E;  3TBI B;  3SGI A;  5BN4 A;  1IW7 D;  4A3E H;  4F8M A;  4X3T A;  1I6V C;  4BBR H;  3K5N A;  3DHQ A;  4AIM A;  3SHL A;  1TWA H;  2KEN A;  4WJ3 M;  4LF6 Q;  3UE1 A;  4RGT A;  1G91 A;  4A76 A;  3G6E A;  1AP0 A;  2B29 A;  3IFD A;  4XQN A;  4UDU C;  2NWG A;  2EYL A;  3I55 A;  2PZW A;  4CJ2 C;  3STB D;  1UEA B;  3NPP A;  2WFW A;  1O7I A;  1SNM A;  4CDE C;  4HMJ A;  4DR3 L;  2V1C C;  4QGU A;  4JI3 Q;  4GN4 B;  4JCV E;  1FVI A;  3BDC A;  3TN2 A;  3HOW G;  4KKS A;  3RZO H;  3BU2 A;  1Y69 U;  4LW1 A;  1MHW C;  3FKI G;  1J5E Q;  4NXN Q;  3S17 H;  1JJC B;  3RZD H;  2K5D A;  3UI2 A;  4TVA B;  3MTS A;  2NBF A;  2NTS A;  4UP9 A;  3QB3 A;  4L63 B;  5M3F H;  2WAQ E;  1QCB D;  4DN4 M;  1F77 A;  1QE6 A;  4A3C G;  1YJN A;  1IYJ B;  4DNR B;  4X65 L;  1LT6 D;  1X9N A;  4A3L G;  1J6Q A;  1JOR A;  1YNN C;  3PUZ A;  5C3E B;  2JA6 G;  1Y8O B;  4GN5 A;  3L2P A;  5FO7 B;  1D2B A;  3SEB A;  3D3R A;  2L4N A;  3M4Q A;  2N78 A;  4OX9 L;  1STB A;  1TWG B;  4BY7 G;  3OMC A;  1X3G A;  3S2D H;  1G51 A;  2QA4 A;  1IL8 A;  3KK7 A;  4HED A;  5IWA Q;  1KAW A;  2UXC Q;  3R93 A;  2XRS D;  2RHS B;  2F0F A;  2SNM A;  2XWJ B;  5FLM H;  4LF8 L;  5IGB A;  1BVS A;  2TSS A;  1E22 A;  2NVT H;  1I94 Q;  2BA0 A;  2RDG A;  3NXW A;  3Q23 A;  1S4Z A;  4FNF A;  3MXN A;  2NVY H;  1EYG A;  2Z8L A;  4A3E G;  1UE1 A;  2K04 A;  4KJO A;  3GTQ B;  2VY3 A;  3K58 A;  1E2V A;  4BBR G;  1GKH A;  4POG A;  3SK6 A;  1N33 Q;  3K57 A;  1PH8 A;  3CU7 A;  2O4X A;  4DNT B;  1JJG A;  4DV4 Q;  2RQX A;  1U4R A;  1KC8 C;  3MXU A;  3WOF A;  1K9M C;  4CBV A;  3FHW A;  4P72 A;  5C44 B;  3KBX A;  1I6H B;  1SXT A;  2AMC B;  4KKT A;  3HP3 A;  2AUJ D;  2R93 H;  1F2Y A;  2L0C A;  5IGE A;  5GAH C;  1ZYR C;  5ELC A;  4TRD A;  3IFT A;  5M5W B;  3CW2 C;  2WB1 G;  2VQF Q;  3EJI A;  1CQV A;  1YI2 A;  5T1G A;  1CHQ D;  3I8Z A;  3CQZ B;  3Q0A A;  5C0X G;  1AE2 A;  1SDF A;  2K32 A;  3BJU A;  3GV3 A;  1C0A A;  1LAB A;  3SE0 A;  4DK0 A;  1HZ9 A;  3I3C A;  4XTC S;  3J7A F;  5CYU A;  3NTI A;  3OIP A;  2CCZ A;  1X6O A;  4FF3 A;  1PMR A;  1VQG A;  2EXD A;  1HZB A;  3K81 C;  4JC0 A;  4X64 Q;  3NSW A;  4QJF A;  5IGG A;  1HNZ Q;  3AYH B;  5FLX E;  1BQQ T;  1JIC A;  1SYB A;  1IBL Q;  3T13 A;  2QIL A;  3BZC A;  1X3P A;  1JOQ A;  3H3V C;  3DLL A;  3CCV A;  3CC2 A;  4FF2 A;  3RNU A;  4C3I G;  2F3W A;  5C3X A;  3EQL C;  2IX0 A;  4A3I G;  1STE A;  5IP7 G;  4V0B A;  3VA7 A;  4X62 Q;  4A3K H;  1ROD A;  3AFQ A;  1ESR A;  3C1F A;  3PIO A;  2DJG C;  4JI0 L;  4H13 C;  1EFI D;  2R61 A;  3ICE A;  2E2I H;  2ASB A;  1YBY A;  3CCS A;  3LX0 A;  1EY9 A;  1WD0 A;  1SE3 A;  4OO1 I;  4HSP A;  5JVH 3;  2I07 B;  3DEO A;  1CUK A;  1KIX A;  2BA1 A;  2KUM A;  2K14 A;  3NTK A;  1HR0 L;  1BO0 A;  1VQB A;  4C3J H;  1SJH D;  1EEI D;  1PTO D;  1FNU A;  2F0I A;  1YVC A;  3TEH B;  1A3T A;  3DXJ C;  1ZXT A;  4DAV A;  5JEA J;  1PH5 A;  1YHA A;  5A2Q L;  2IJ0 A;  4MN3 A;  1JCK B;  3PV0 A;  3CMA A;  1TII D;  2F0G A;  4O1N A;  4OX9 Q;  4C3I B;  1N34 Q;  2K52 A;  3J80 E;  1A2T A;  5COR A;  2R6G A;  2K1B A;  4A3J G;  4ULL A;  3K0Y A;  3OSO A;  3OW2 A;  3NWT A;  3QJY A;  2PO4 A;  2HT1 A;  1IKL A;  2IHE A;  2VB3 X;  4QY7 A;  3KF8 B;  3GTG H;  4IPC A;  1A62 A;  3HEJ A;  2HQE A;  1B70 B;  3I4N G;  2IPK D;  4DR2 L;  3GTL B;  2ICE C;  2PMZ B;  1WTX A;  3QO2 A;  1E1O A;  3I7F A;  2OEO A;  2GVB A;  3MHB A;  4DK1 A;  3HOY G;  1W3S A;  4KY6 A;  3C46 A;  2NVQ H;  1G2S A;  5T1I A;  3A0J A;  2CKZ B;  2Z6B A;  3PUV A;  5ELE A;  4ZK9 B;  3EFX D;  1HCZ A;  1PA6 A;  4KJN A;  4IUV A;  1XJV A;  5LL6 S;  3ULL A;  3N6R A;  4OIJ A;  1LT4 D;  4B3R L;  4HTH A;  4RGM A;  3NQT A;  1L2F A;  5LMN L;  2ZXP A;  3J81 c;  2PYK A;  2QCP X;  5KRU A;  4RKL A;  2JA8 B;  4IFD G;  4MZ9 A;  5C4J B;  2F0J A;  3I73 A;  5C44 H;  4YHH Q;  5EKL A;  2B2W C;  1PLF A;  1K83 H;  2VQF L;  1V43 A;  1UE7 A;  4FF1 A;  3J81 i;  1QB5 D;  1XWE A;  3F2U A;  3AB9 A;  3U4V A;  3R2I A;  3WWV A;  2CWP A;  2EY1 A;  2KHS A;  2I0Q A;  2R92 H;  1QVG A;  1PFN A;  2A69 D;  1EY0 A;  2X6L A;  4DR5 L;  1RHP A;  1B50 A;  3A8J E;  2NN6 H;  3Q8D A;  4OXP A;  1RJT A;  2P5Z X;  1SYC A;  1VQA A;  1PH7 A;  1SNC A;  4HJ8 A;  4IUU A;  1F2L A;  1QJO A;  2MP1 A;  3T1Y Q;  4HIK A;  1CK1 A;  3J80 c;  1GD7 A;  4OGQ C;  3G6J B;  2CVR A;  5IOC A;  1K8G A;  2KQ3 A;  2EYJ A;  3E6Z X;  2BDO A;  5M3F G;  4BY7 H;  1MBY A;  1I50 H;  5M5W H;  3OWF A;  5M5X H;  3VR6 A;  4JI7 L;  1Q3L A;  4IUP A;  5FJ8 G;  2XRQ D;  5FOB B;  4CDD C;  3CCM A;  4ODG A;  1IW7 C;  4NKL A;  3GDE A;  3ULP A;  4BBS H;  2EYF A;  4DV5 L;  2A19 A;  3GTM B;  1B3A A;  1XYI A;  3UDG A;  2EY2 A;  3NBI A;  5BR8 L;  1LTT D;  4C3H H;  2I5H A;  5DM6 3;  3CCL A;  4DR6 Q;  5HUR A;  4LF8 Q;  1WTQ A;  4J1M A;  5IT9 c;  2IWH A;  3D6C A;  3GTO B;  5EPL A;  2L15 A;  2YTV A;  5TSS A;  1HNX L;  1TWC H;  1WTH A;  4YIJ A;  3KUP A;  3HOZ G;  2KHJ A;  2E2I B;  3J81 j;  2A6E D;  1HR0 Q;  2DY7 A;  1HPC A;  4HJA A;  3T51 B;  4FF4 A;  3I70 A;  4RMF A;  5FLX L;  1WCM H;  4N9T A;  2HCC A;  1VMP A;  4DV4 L;  2VQE Q;  4QUF A;  2UXB Q;  1D7Q A;  3S2H H;  2RSO A;  4XQJ A;  1NSN S;  4RHR A;  4Y52 H;  2WII B;  1WTW A;  1XMO Q;  2L5T A;  1K28 A;  3D8G A;  4DV1 L;  1Y8N B;  3T1H Q;  2NVX H;  1E24 A;  4OWX B;  3T56 B;  3ONA B;  2FMM A;  3TP6 A;  1I3Q B;  1EYA A;  1R9T B;  1ILP A;  1LM0 A;  1VQC A;  3ERQ A;  3W1G A;  5J39 A;  4B3S L;  1EOV A;  3X3N A;  1FJG Q;  5EKK A;  1STY A;  2MHV A;  4A3B H;  1DZ1 A;  2WAC A;  1ET9 A;  3NQI A;  4FDB A;  4MIU A;  3HOX G;  3HGB A;  1SJE D;  2A69 C;  1PH6 A;  1QG7 A;  4G57 A;  1QNK A;  3L3O C;  4IUQ A;  1EWI A;  2F0M A;  4JI2 Q;  3IL8 A;  3LWU A;  3MZ5 A;  1VQH A;  2CQO A;  1QWY A;  5GAD C;  1W6K A;  4RKB A;  1EY5 A;  1U9R A;  4CDC C;  3RLN A;  4XYQ A;  1ENF A;  2JYO A;  1HJP A;  2F0D A;  1F2M A;  2CW0 C;  4C3I H;  1JOO A;  2Z4I A;  3ZYY X;  4KTA A;  3HG9 A;  2KEC A;  1SNP A;  1XXG A;  1WOC A;  2BDN A;  5IGC A;  1WTP A;  4A3F G;  1B4O A;  3E0E A;  4FXK C;  5FLX c;  1X55 A;  4X66 Q;  4EX5 A;  3AEV A;  1I6H H;  1Q90 A;  2K4K A;  3KOJ A;  4LFA Q;  2QGQ A;  2B2V C;  1ZKO A;  2E2H H;  4GNX C;  1PZK D;  3PIO 3;  3Q22 A;  2F0V A;  3FMC A;  3H3V H;  1QZG A;  4CDF C;  3E9I A;  4WFN 3;  2EIF A;  3K59 A;  4JBJ A;  5IIF A;  1G2T A;  3RMH A;  3EN2 A;  3HKZ B;  2C35 B;  3GV6 A;  1KAB A;  2JEA I;  1HZC A;  2XSC A;  1JE4 A;  2MUY A;  1S72 A;  1F9R A;  1BUV T;  3QIA A;  1EY7 A;  1GXD C;  1DOM A;  1N32 Q;  3TSS A;  3T1Y L;  1JB3 A;  1L1O C;  1AW7 A;  4AH6 A;  5LMN W;  1YEZ A;  2RA4 A;  4KLK A;  1N36 Q;  3CC7 A;  1PZI D;  1X3Q A;  1F2Z A;  2KEE A;  1C8C A;  1VQ7 A;  2VS1 A;  4DXF A;  1NMF A;  1TS3 A;  2Q8R E;  3ND8 A;  2CWA A;  4C2M B;  5C3E H;  4A3K G;  3HKZ E;  5J3B A;  2ZTE A;  5FKA C;  3CCJ A;  4JVZ A;  4LF5 L;  1I50 B;  4B3M Q;  1HHV A;  2QDB A;  1PH9 A;  4A75 A;  3CF5 A;  1UNS A;  2KOL A;  4WJ4 A;  2B2T A;  5CV7 A;  5BR8 Q;  2X69 A;  1LYL A;  3KLS A;  4FP5 D;  2E76 C;  3DMU A;  2JK8 A;  3MXP A;  1BDO A;  1JOK A;  1PTO F;  4DV3 Q;  4K6D A;  3S17 B;  3EIV A;  1MD2 D;  1VQ5 A;  4L5R C;  1ILQ A;  4LNQ A;  1UAP A;  3U9O A;  1DYQ A;  3QR8 A;  1CKM A;  1XTD A;  1STN A;  5D3D A;  2NVY B;  1ENA A;  1KTK A;  3Q6S A;  2I46 A;  2OQ0 A;  1PFS A;  1XTC D;  3CAM A;  2F0Q A;  2AUK A;  1DJR D;  2KHI A;  2E5L Q;  1PH2 A;  2A5H A;  3P75 A;  2NZH A;  3HOY B;  1EUJ A;  2N55 A;  1QUQ B;  4O2D A;  4ZLT F;  2YU9 H;  1KAA A;  3NEL A;  1PYS B;  4QL5 A;  1Q82 C;  2N88 A;  4P2C B;  5IYD G;  1U0L A;  3D6W A;  2F0U A;  2Z6K C;  2L12 A;  1HR0 W;  2DNC A;  4PQX A;  1IBK L;  4PMW A;  1CHP D;  1CZW A;  3G4S A;  4K5V A;  2PNR C;  1N8R C;  2KED A;  4HMI A;  3TME A;  1FJG L;  2E74 C;  1SRU A;  1UEB A;  4QIW E;  2L55 A;  2JA5 G;  1EIF A;  5BN3 A;  3KBG A;  4PG3 A;  2B2V A;  2DN8 A;  1O7L A;  2MJ8 A;  4O0A A;  3KDF B;  5KEE A;  1HA6 A;  3E5S A;  4LFC Q;  1RD9 D;  5JOB A;  4L5S A;  3S14 H;  3HKS A;  4E6I A;  4BXX H;  3K7U C;  4RG1 A;  1U5K A;  1SMY D;  2ZTD A;  2M2L A;  3I4M G;  3FVQ A;  5CV6 A;  3V2T A;  4TQU S;  2EZV A;  1TWF H;  2N3S A;  2Z4H A;  1E2Z A;  1BBW A;  2PZT A;  3PO3 G;  2NB0 A;  3PCO B;  4OHJ A;  2Z0S A;  1II3 A;  1JQY D;  2B63 G;  2KVM A;  2F0P A;  3GTJ B;  4LUO A;  1NMG A;  1SMX A;  2UXD L;  5COY A;  1IBM L;  4DR7 Q;  3S2D B;  5C44 G;  4LFA L;  4XQQ A;  4BY1 G;  2OF1 A;  3GTM H;  3H3V I;  4KY5 A;  1X56 A;  4BBS B;  1VQ6 A;  2ZTC A;  5IP9 G;  2EYM A;  5CR3 A;  2EJG C;  5C4X H;  1PH4 A;  2LFN A;  2B2U C;  2NZO A;  2MFI A;  2Y0S G;  1SN8 A;  4U68 A;  3RN5 A;  2ZJP A;  1A2U A;  2KCN A;  4HIO A;  4JI8 L;  1YJ9 A;  1Y1V B;  5M3M H;  4Z9C B;  2QEX A;  3VYT A;  1EY6 A;  1SBB B;  3JAM E;  5DNF A;  4U67 3;  1MSH A;  3I4M B;  3HOZ B;  1B2T A;  2MGS A;  2LXJ A;  3HOZ H;  1SYD A;  3H15 A;  1SAP A;  1GUN A;  3AFP A;  1PRT D;  2NUC A;  1JJ2 A;  3R2T A;  1Y1V G;  2ZXO A;  4UP8 A;  4DV0 Q;  5KNB A;  5ELO A;  1LT5 D;  3H91 A;  4GNX B;  2KA7 A;  2A8V A;  2HDL A;  3KF8 A;  4PZ8 A;  4KHZ A;  2VL6 A;  4JK1 C;  1LTS D;  4RH6 A;  1L1O B;  4JYA Q;  4KHV A;  1B7Y B;  3DWQ A;  2KCT A;  2R7D A;  1IBL L;  2E2J B;  5LMU Q;  2N8N A;  3F1Z A;  4DV3 L;  4FVM A;  5FO8 B;  3D4R A;  2IW3 A;  3M4O B;  5LHY 1;  5D14 A;  1L0X B;  3PQI A;  3M3Y B;  3DEP A;  2OXP A;  2KJX A;  3HOU H;  3ERO A;  5C0X H;  4A3L H;  3RN2 A;  1Q81 C;  1STG A;  2SDF A;  4JI2 L;  3A7A B;  1KRS A;  2K7V A;  3OYY A;  3S16 H;  3OIQ A;  1GVP A;  3I90 A;  3B6Y A;  4GN3 B;  1XPR A;  1VQJ A;  4QIW B;  1XNR L;  3PF5 A;  2M9V A;  5JEA H;  2PZU A;  1NBW A;  1HTL D;  4LFB L;  5E1F A;  1X32 A;  4O42 A;  2CH4 A;  1NE3 A;  4JI6 L;  1IBK Q;  2JA7 G;  4DR4 Q;  3VA5 A;  2JSO A;  4GKJ Q;  4JBW A;  4IN3 A;  2LSS A;  3SK5 A;  2HQL A;  5BN5 A;  1BF4 A;  2L1B A;  2RCN A;  3SDZ A;  2VUM B;  2FIN B;  4B9X A;  2LY7 A;  1V8Q A;  1MI2 A;  1D1I A;  1EIY B;  4ME3 A;  5H1S E;  5NUC A;  1EY4 A;  5IY0 A;  2PI2 E;  4NXM Q;  4DR1 Q;  1H9M A;  4GOP A;  4HJ5 A;  2O5J C;  1EOT A;  4DAP A;  1E1T A;  3WDN A;  2AQ3 B;  3BS1 A;  3NWS A;  4L6T B;  5EPJ A;  1CKN A;  2K50 A;  2VW9 A;  4A3J H;  4OL7 A;  3CC4 A;  1G29 1;  1N34 L;  4A3J B;  1TWA B;  5C3W A;  3W3A A;  3M3Y H;  3J7A 5;  1SMY C;  5E4W C;  2GVA A;  4IJH A;  3V96 A;  4ME5 A;  3NBH A;  4BXX G;  2B2T C;  2JQO A;  4RCN A;  2B3G A;  1MIU A;  2RDH A;  2B2Y C;  2L11 A;  1PYB A;  3TS0 A;  2O2L D;  1VS0 A;  4LJZ C;  2FHT A;  4A4I A;  3D4W A;  1NY4 A;  3OW7 A;  1NNX A;  2WKC A;  4GLX A;  2BH2 A;  3NEN A;  3VR3 A;  3M4Y A;  4J15 A;  3M4O H;  2OT2 A;  3MXG A;  1V1P B;  3J7Z C;  5L37 A;  2D2C C;  2Y0S B;  4R9W A;  4LF5 Q;  1UWV A;  4DUY L;  1Y1W B;  1QVF A;  3AMU A;  4B3R Q;  4ZUJ A;  1SE8 A;  4P71 A;  5LMN Q;  5M3F B;  2JA8 G;  3K7A B;  4YCV A;  1YIJ A;  1TS2 A;  4LF7 L;  1PTO B;  1X54 A;  2NYZ D;  3GTQ H;  1FGU A;  1D5M C;  5M9O A;  1CA6 A;  3H6M A;  4LWC A;  1SR3 A;  1HUN A;  4LF6 L;  4A3E B;  3A56 A;  3RZO B;  1AEX A;  1BCP B;  3L7Z C;  2F4V L;  3QG1 A;  1MSG A;  4R4C A;  4UY8 C;  1Z6H A;  1GHK A;  4KN7 C;  1Q12 A;  3D31 A;  2VUM H;  2A74 C;  3S1N B;  1BCP C;  3NP8 A;  1A3U A;  1CI3 M;  5DEH A;  3CPW A;  4JBK A;  4RHS A;  1GM5 A;  2ZM6 Q;  3FP9 A;  3S1M B;  2LKV A;  1UUP A;  1Q86 C;  2A6H C;  1WTV A;  4FO2 A;  3PO2 B;  2AQ1 B;  1F9P A;  4ZAI A;  4PMB A;  4Y7N B;  1LTR D;  1I4P A;  1Z7T A;  1MGS A;  3A54 A;  1PYW D;  1O80 A;  1H9S A;  1Y1V H;  5M3M B;  1B9N A;  1L1O A;  1PDQ A;  4JOI A;  4A3C H;  2F0T A;  2Y0S E;  3FKI B;  2IHF A;  1Q8K A;  4XT1 B;  3K5L A;  1Y1W G;  1OXT A;  3E3X A;  1WVL A;  1Y1W H;  3A5U A;  4X65 Q;  3H0G H;  5ELF A;  4JI7 Q;  3MEH A;  2JA9 A;  4MTK A;  3DWP A;  4DU9 A;  4GZY C;  4HIM A;  1STH A;  5IP9 H;  3UDI A;  3PO2 H;  3CP0 A;  4A93 B;  3CKI B;  3PUW A;  2NVQ B;  1GHJ A;  4CJ0 B;  5IYC H;  2OTL A;  1WI5 A;  2KCC A;  4DAM A;  3H09 A;  5IE8 A;  1VQE A;  4CJ1 B;  2G9D A;  1OO9 B;  1CZG A;  2F52 A;  2I5L X;  4M8A A;  3PO3 B;  3DM3 A;  1K0S A;  2WP8 J;  4JI6 Q;  1EQT A;  2AKW B;  4GKK Q;  2SEB D;  2E2J H;  3WOE A;  1M90 C;  2ZJQ A;  4P73 A;  1RKN A;  1TS4 A;  1I94 L;  3S1Q H;  2UXD Q;  2UU9 Q;  4PZ7 A;  3KJO A;  4K0K Q;  2NZ1 D;  3S1M H;  3S2H B;  1I4R A;  4NXM L;  1P8L A;  3H94 A;  4H0L C;  2EYH A;  4IFD H;  4BBS G;  3X3M A;  1A63 A;  2C5C A;  3I56 A;  5M5Y H;  5M3M G;  4FYD A;  1RIP A;  1SYG A;  5HGQ A;  4CHT B;  3CQZ H;  4MNO A;  2QDL A;  1CKN B;  1I4Q A;  3I4M H;  3HZX A;  2H4O A;  3BYY B;  3MFG A;  4IPD A;  1BNZ A;  4A3B G;  2PQA B;  2R92 G;  4ZKC B;  5HGT A;  4A3K B;  4B3S Q;  4IUN A;  5ELD A;  1U4L A;  1LTG D;  3JAM c;  4A3M B;  1ET6 A;  2BOS A;  2PQE A;  5JAV A;  5E7N A;  4OO1 G;  4EGV A;  1S5E D;  1D5X C;  4F87 A;  2IL8 A;  2QW7 A;  4A93 G;  2C9O A;  5CBE E;  4A3B B;  4A3G G;  5I2Y A;  5CV4 A;  1VQK A;  4A3D H;  4OIK A;  2YYZ A;  5EQ0 A;  4J6H A;  1Q8I A;  1O7Z A;  1LTI D;  3MVV A;  1PVO A;  1IL2 A;  2EY5 A;  2VZA A;  3I2Z A;  2LXK A;  4AYB G;  3T4A C;  2WIN B;  5CV5 A;  3U9S A;  3KLR A;  4LF7 Q;  2K75 A;  1H9J A;  2XWB B;  3IAY A;  5G3L F;  4NDX A;  1K3R A;  4CKC A;  3A8K E;  1CTM A;  2F0L A;  5JJI A;  2MQH A;  5GAG C;  5D65 A;  2F0E A;  3S24 A;  4BY1 B;  5FJ8 H;  1TY2 A;  1BKB A;  4IQZ A;  4PV1 C;  1S40 A;  3OOC A;  1VQ4 A;  3OPO A;  4XIG S;  4UP7 A;  2QKI C;  4ZYS A;  1YIT A;  4KN4 C;  1XNR Q;  4K8I A;  5C4Z A;  3L9A X;  1C9O A;  4JI3 L;  3N52 A;  1WCM G;  4NB3 A;  2E2H B;  1SEB D;  2DNE A;  1YNJ D;  3JAM L;  4DV6 Q;  1BCP D;  1DOL A;  1QNU A;  3M7N A;  3NEM A;  3W5O A; 
#chains in the Genus database with same CATH homology
 3G4S A;  1YHB A;  2Q2H A;  5C4J H;  1N8R C;  2R93 H;  2UUA Q;  1A0I A;  2DGY A;  1OXX K;  4A3M G;  1FL0 A;  1VQP A;  1I3Q H;  3PUY A;  4DAY B;  1R9T H;  1N36 L;  1FJG L;  3HOX H;  3EBE A;  3TRE A;  5GAH C;  1SRU A;  1UEB A;  1KQS A;  4QIW E;  3OTO L;  4HID A;  2JA5 G;  2EQS A;  1M1K C;  1EIF A;  4JI5 L;  3CW2 C;  2WB1 G;  1CSQ A;  1KL9 A;  2VQF Q;  1KHI A;  4PG3 A;  4IFD I;  1ASY A;  2Q2I A;  1YI2 A;  3BZK A;  3U50 C;  1VQ9 A;  5C0X G;  2N49 A;  4O0A A;  3KDF B;  1AE2 A;  3BJU A;  1JB7 A;  3MXN B;  1C0A A;  4LFC Q;  4L5S A;  2JJQ A;  4R4Q A;  3S14 H;  3HKS A;  4DV0 L;  2H5X A;  4BXX H;  1HZ9 A;  3K7U C;  2OQK A;  4RG1 A;  4XTC S;  1AH9 A;  4B3T L;  1U5K A;  2CCZ A;  1X6O A;  2ZTD A;  1VQG A;  2EXD A;  5AJ3 Q;  1HZB A;  3F2C A;  1Q1B A;  3K81 C;  1OXV A;  4JC0 A;  4X64 Q;  4B3M L;  4NPS A;  4QJF A;  1W2B A;  1HNZ Q;  4YY3 Q;  4TQU S;  3AYH B;  1TWF H;  1VCI A;  2MO1 A;  2N3S A;  3GTL H;  2UXC L;  1BBW A;  3PO3 G;  3TRZ A;  5C0X J;  3G71 A;  3PCO B;  2Z0S A;  1IBL Q;  2R7F A;  5IYB G;  3PO3 H;  2B63 G;  3BZC A;  4R4T A;  3CCU A;  1VQ8 A;  4LUV A;  3JC6 6;  1NTG A;  4LUO A;  4Y7N H;  1XNQ Q;  1NMG A;  1SMX A;  3DLL A;  3CCV A;  2UXD L;  4DR7 Q;  1IBM L;  4OWT B;  4H02 A;  1DGS A;  3CC2 A;  5C44 G;  3RNU A;  4LFA L;  5JJK A;  1L0W A;  2ALY B;  4DUZ L;  4DR2 Q;  4BY1 G;  1QZH A;  2IX0 A;  4A3I G;  1YHQ A;  3GTM H;  3H3V I;  1HNW L;  1UE6 A;  5IP7 G;  1X56 A;  4GLV B;  2AHO B;  4X62 Q;  3CXC A;  1VQ6 A;  4OWW B;  1KXL A;  4A3K H;  2ZTC A;  5IP9 G;  5C4X H;  1A8V A;  3KFU A;  3AFQ A;  4JI4 L;  1PH4 A;  1OXU A;  2HIX A;  1VQO A;  2JA8 H;  3PIO A;  1B8A A;  2PI2 A;  2Y0S G;  2NZO A;  2MFI A;  3HKZ G;  4DKA C;  4DUY Q;  2VNU D;  4JI0 L;  1SN8 A;  3RN5 A;  4DR3 Q;  2ZJP A;  3AQQ A;  3A5Z B;  2ATW A;  2K5N A;  4HIO A;  4JI8 L;  4DV6 L;  1YJ9 A;  3ICE A;  2E2I H;  1TXY A;  2PMZ E;  1N9W A;  1YBY A;  5M3M H;  2K5V A;  2ASB A;  5JEA G;  3CCS A;  2QEX A;  3UDX A;  4A3F H;  4OO1 I;  1KRT A;  2R7Z H;  3UE0 A;  1CUK A;  2YTY A;  1PV4 A;  1KIX A;  2BA1 A;  2K14 A;  2R7Z G;  1HR0 L;  4YHH L;  2LXJ A;  2CFM A;  1VQB A;  4C3J H;  3PSI A;  4GOP C;  3HOZ H;  2ID0 A;  3H15 A;  1YVC A;  3TEH B;  2Q2U A;  1YJW A;  2F4V Q;  1YNX A;  3AFP A;  1JJ2 A;  3S1N H;  1UE5 A;  3M9B A;  3M85 A;  3F2B A;  4YWL A;  5JEA J;  4DV2 L;  1I5F A;  5C3E G;  4LFC L;  1Y1V G;  1PH5 A;  1YHA A;  4UP8 A;  4JI1 L;  4DV0 Q;  5ELO A;  1T9H A;  4GNX B;  3PV0 A;  2VUM G;  3U58 A;  4ALP A;  3PGZ A;  5AJ3 L;  3CMA A;  2A8V A;  2ZM6 L;  4DR5 Q;  3HOW H;  4PZ8 A;  4OX9 Q;  4KHZ A;  5EAY A;  2K52 A;  2VL6 A;  2D0P A;  1N34 Q;  3E9H A;  4GS3 A;  3JAM i;  4AQY L;  2R6G A;  4X6A H;  4A3J G;  2OCE A;  1L1O B;  1VQM A;  3GD7 A;  1K8A C;  3OW2 A;  1JMC A;  2R93 G;  2MNA A;  1IBL L;  1B7Y B;  4JYA Q;  2KCT A;  2R7D A;  1QVC A;  3FKI H;  5LMU Q;  2HT1 A;  4BA2 I;  2N8N A;  3F1Z A;  4DV3 L;  4A3D G;  4JV5 Q;  2IHE A;  3LGJ A;  4QY7 A;  4KHP L;  1ASZ A;  3KF8 B;  4APV A;  2GN5 A;  3GTG H;  1JT8 A;  4IPC A;  1XMQ L;  4DR7 L;  1A62 A;  1B70 B;  3HOU H;  5IYC G;  1VQN A;  1WFQ A;  4DR2 L;  3I4N G;  1GO3 E;  4A3L H;  3RN2 A;  1HNW Q;  1HZA A;  4PZ6 A;  1Q81 C;  1V1Q A;  4A93 H;  1E1O A;  2A1A A;  2E8G A;  3I7F A;  2GVB A;  4JI2 L;  4DPG A;  3HOY G;  1KRS A;  1W3S A;  4A3G H;  4JI4 Q;  3OYY A;  3H0G G;  1Q7Y C;  2NVQ H;  3A0J A;  3GO5 A;  1G6P A;  1PH1 A;  1BBU A;  3S16 H;  2CKZ B;  1GVP A;  3PUV A;  3B6Y A;  4KI0 A;  1OTC A;  4DV5 Q;  4JI0 Q;  4GN3 B;  1XPR A;  1VQJ A;  1XNR L;  3PF5 A;  1JE5 A;  3KYH C;  1PA6 A;  1NBW A;  1XJV A;  5HY6 A;  4LFB L;  3ULL A;  4JI8 Q;  4B3R L;  1NE3 A;  1L2F A;  5LMN L;  4DR6 L;  4JI6 L;  1IBK Q;  2JA7 G;  4DR4 Q;  1X3E A;  3J81 c;  1K73 C;  3K0X A;  4GKJ Q;  4JBW A;  1XPU A;  1V9P A;  3W1B A;  2LSS A;  2HQL A;  1HNX Q;  4IPG A;  4MZ9 A;  3KF6 A;  4IFD G;  3K8A A;  2RCN A;  5C44 H;  3RR5 A;  4POF A;  4YHH Q;  5GQO A;  1EIY B;  3OTO Q;  4ME3 A;  2YV5 A;  5H1S E;  4YCU A;  3VDY A;  1K83 H;  5IY0 A;  2PI2 E;  2VQF L;  1LTL A;  1V43 A;  4NXM Q;  1UE7 A;  4DR1 Q;  4AYB E;  3J81 i;  4GOP A;  2IY5 B;  4HJ5 A;  3U4V A;  3F8T A;  1E1T A;  1WYD A;  1EFW A;  3WWV A;  3MEF A;  3GTJ H;  3UDF A;  2CWP A;  3I4O A;  2I0Q A;  2R92 H;  2JE6 I;  4QQB X;  2UXB L;  4B3T Q;  1CKN A;  1SLJ A;  2K50 A;  2VW9 A;  1KD1 C;  1QVG A;  4DV7 Q;  4A3J H;  2KCM A;  4HJ7 A;  3CC4 A;  4DR5 L;  1EQR A;  1G29 1;  4LUZ A;  3Q8D A;  4BA1 I;  1N34 L;  4OXP A;  4X64 L;  1XMO L;  1TWH H;  1VQL A;  4YCW A;  4DV1 Q;  3M3Y H;  5C0X I;  1X3F A;  1VQF A;  4JYA L;  3J7A 5;  4L5Q A;  1HH2 P;  1VQA A;  1PH7 A;  1QUQ A;  4HJ8 A;  1NJI C;  2D62 A;  5LMU L;  3K7A H;  4NXN L;  4HIK A;  3T1Y Q;  1MKH A;  1J5E L;  2GVA A;  3CME A;  2RF4 A;  3GTP H;  4IJH A;  3J80 c;  2HHH Q;  1GD7 A;  4BXX G;  4KHP Q;  1H95 A;  4YWM A;  3HOV H;  2JQO A;  2B3G A;  1MIU A;  3TS0 A;  1PYB A;  1XNQ L;  1VS0 A;  2YTX A;  1K8G A;  1X65 A;  4A4I A;  1XPO A;  4GNX A;  1NY4 A;  4IPH A;  1EQQ A;  3RLF A;  5M3F G;  4DUZ Q;  4BY7 H;  4GLX A;  2BH2 A;  1I50 H;  5M5W H;  1E3P A;  3NEN A;  5M5X H;  4JI7 L;  4X62 L;  4J15 A;  4IFD J;  5FJ8 G;  3M4O H;  3J80 i;  3S15 H;  3CCM A;  3J7Z C;  3GDE A;  3ULP A;  4P74 A;  4BBS H;  2ES2 A;  3M4P A;  4DV5 L;  3CD6 A;  2A19 A;  4LF5 Q;  1UWV A;  4OON A;  2MO0 A;  4DUY L;  4A3I H;  3D0F A;  1QVF A;  3UDG A;  4LFB Q;  3S1R H;  4IJL A;  5IWA L;  5BR8 L;  2UUB Q;  4B3R Q;  4C3H H;  4L5T A;  2I5H A;  2OWO A;  1SE8 A;  4P71 A;  5LMN Q;  3CCL A;  4DR6 Q;  5C4X G;  4DR4 L;  4LF8 Q;  5DLQ E;  4GKJ L;  4UPA A;  2JA8 G;  4YCV A;  5IT9 c;  1YIJ A;  2UUC Q;  4LF7 L;  4IO9 A;  1HNX L;  2L15 A;  2YTV A;  1Q1E A;  1X54 A;  2AWO A;  3HFZ B;  5FLM G;  1TWC H;  2JA7 H;  1P16 A;  2DUD A;  2KHJ A;  4DK3 C;  4LF4 L;  4C2M H;  3GTQ H;  1FGU A;  3HOZ G;  2Z6K A;  3J81 j;  1HR0 Q;  4BY1 H;  4LWC A;  1SR3 A;  4DK6 C;  4HJA A;  3KDF A;  4RMF A;  4LF6 L;  4K0K L;  4DR1 L;  3L7Z C;  1WCM H;  2F4V L;  4LF9 Q;  4R4C A;  1TWG H;  1SFO H;  4UY8 C;  4DV2 Q;  2XTI A;  1Q12 A;  4A3M H;  4DV4 L;  3D31 A;  2VQE Q;  2VUM H;  4JI1 Q;  4EQ5 A;  2UXB Q;  1D7Q A;  3S2H H;  3CPW A;  4DV7 L;  4JBK A;  1GM5 A;  1IZ6 A;  2I5M X;  1Q46 A;  1VQD A;  3ER0 A;  4Y52 H;  3KF6 B;  1XMO Q;  3GTK H;  2ZM6 Q;  3FP9 A;  1IXR A;  3A74 A;  3KJP A;  3CCE A;  4DV1 L;  1Q86 C;  3T1H Q;  4HJ9 A;  2NVX H;  1E24 A;  4OWX B;  2FXQ A;  3K80 C;  1PH3 A;  1S3O A;  1LM0 A;  1VQC A;  1PHJ A;  3W1G A;  2UUA L;  3GTO H;  4P75 A;  1Y1V H;  4B3S L;  2HHH L;  1EOV A;  3ULJ A;  1L1O A;  3PF4 A;  1FJG Q;  1N32 L;  3CPF A;  3KLW A;  4JOI A;  2ZJR A;  4A3C H;  4A3B H;  2Y0S E;  2D0O A;  2IHF A;  1Q8K A;  3U4Z A;  4YWK A;  3CCR A;  1Y1W G;  4JI5 Q;  4FDB A;  1MJC A;  1XMQ Q;  3HOX G;  2PNH A;  1OXT A;  1PH6 A;  1Y1W H;  3A5U A;  2JA5 H;  4DNI A;  4X65 Q;  3H0G H;  3I4M G;  4JI7 Q;  4JBM A;  2JA9 A;  5IYB H;  3PO2 G;  1EWI A;  1SRO A;  4JI2 Q;  4HIM A;  4IOA A;  5IP9 H;  4R4O A;  3UDI A;  3CP0 A;  1RL2 A;  4GOP B;  3PO2 H;  1LUZ A;  3L0O A;  1VQH A;  3PUW A;  3TS2 A;  1Z9F A;  2CQO A;  4R4I A;  5GAD C;  5IYC H;  2OTL A;  2B63 H;  1WI5 A;  4JOI C;  4DAM A;  2JA6 H;  3I4N H;  5IE8 A;  1VQE A;  3RLN A;  4YY3 L;  1OXS C;  1VQI A;  4MTN A;  1HJP A;  3HOU G;  2F52 A;  2I5L X;  2OTJ A;  5IYD H;  4C3I H;  3DM3 A;  1Z47 A;  2KBN A;  2WP8 J;  2UUC L;  4JI6 Q;  2AKW B;  1WOC A;  3HOY H;  4GKK Q;  4A3F G;  3SGI A;  2E2J H;  1M90 C;  3E0E A;  5FLX c;  4P73 A;  4A3E H;  1X55 A;  2ZJQ A;  4X66 Q;  1I94 L;  3S1Q H;  2UXD Q;  4EX5 A;  3AEV A;  4BBR H;  1I6H H;  2K4K A;  4AIM A;  3KOJ A;  4LFA Q;  2QGQ A;  1TWA H;  2KEN A;  3RLO A;  2UU9 Q;  1CKO A;  4WJ3 M;  4PZ7 A;  3KJO A;  3UE1 A;  4GNX C;  2E2H H;  4LF6 Q;  4K0K Q;  3S1M H;  4A76 A;  3G6E A;  3IRB A;  4NXM L;  3H3V H;  2E5L L;  1P8L A;  1QZG A;  1N33 L;  1AE3 A;  4BBS G;  1A63 A;  2B29 A;  3I56 A;  1E7Z A;  3E9I A;  5ELN A;  5M3M G;  5M5Y H;  2EIF A;  2WB1 E;  4JBJ A;  2VQE L;  2Q2T A;  3I55 A;  3STB D;  1RIP A;  2WFW A;  1O7I A;  3EN2 A;  5HGQ A;  4DR3 L;  2V1C C;  2C35 B;  3CQZ H;  4QGU A;  4JI3 Q;  3G48 A;  4GN4 B;  4JCV E;  1FVI A;  2JEA I;  1HZC A;  4MNO A;  3HOW G;  3T1H L;  3RZO H;  1CKN B;  3BU2 A;  3I4M H;  5GAE C;  1S72 A;  4LW1 A;  4IPD A;  2BH8 A;  3TQY A;  4A3B G;  3ERS X;  2PQA B;  2R92 G;  2IX1 A;  5K36 G;  4B3S Q;  1D8L A;  1N32 Q;  3FKI G;  3T1Y L;  1J5E Q;  4NXN Q;  3S17 H;  1L1O C;  4AH6 A;  5LMN W;  1JJC B;  1YEZ A;  3JAM c;  3RZD H;  4KLK A;  1N36 Q;  3CC7 A;  4TVA B;  4UP9 A;  5M3F H;  2RHQ B;  2WAQ E;  5E7N A;  1VQ7 A;  4OO1 G;  2VS1 A;  3PUX A;  1NMF A;  4A3C G;  3STB C;  1YJN A;  1IYJ B;  4X65 L;  4IOC A;  1X9N A;  4A3L G;  5GRO A;  1J6Q A;  2CWA A;  3PUZ A;  4A93 G;  2JA6 G;  4GN5 A;  3ZJY C;  3L2P A;  4A3G G;  5C3E H;  4A3K G;  3HKZ E;  5J3B A;  1VQK A;  2ZTE A;  4A3D H;  2YYZ A;  3M4Q A;  2N78 A;  3CCJ A;  4OX9 L;  4BY7 G;  4LF5 L;  4B3M Q;  2F3I A;  1X3G A;  4AQY Q;  1G51 A;  2XGT A;  2QA4 A;  1PH9 A;  3S2D H;  1IL2 A;  4A75 A;  1HNZ L;  3CF5 A;  1CSP A;  1PVO A;  1MJE A;  2VZA A;  3I2Z A;  4WJ4 A;  5BR8 Q;  1KAW A;  5IWA Q;  2LXK A;  1LYL A;  2UUB L;  2UXC Q;  2IT1 A;  4AYB G;  2JK8 A;  4JG2 A;  2RHS B;  5FLM H;  4LF8 L;  4GLA C;  4DV3 Q;  4JV5 L;  4GKK L;  1BVS A;  3EIV A;  4LF7 Q;  1E22 A;  2K75 A;  3HOV G;  1VQ5 A;  2NVT H;  4L5R C;  4X66 L;  1I94 Q;  4R1J A;  2BA0 A;  4LNQ A;  1K3R A;  1YZ6 A;  1C7Y A;  2NVY H;  1EYG A;  4LF4 Q;  1CKM A;  1XTD A;  2JEB I;  1IBM Q;  2UU9 L;  5JJI A;  2MQH A;  5GAG C;  1Y14 B;  1UE1 A;  4A3E G;  2OQ0 A;  3CAM A;  1PFS A;  2HIV A;  2VY3 A;  4BBR G;  1GKH A;  1K0R A;  2KHI A;  3S24 A;  4POG A;  2K5H A;  3PIP A;  5FJ8 H;  2E5L Q;  2NN6 I;  3NBH B;  1N33 Q;  1BKB A;  1S40 A;  1PH2 A;  4LF9 L;  1PH8 A;  1JJG A;  2NZH A;  4DV4 Q;  1EUJ A;  1VQ4 A;  5IP7 H;  4XIG S;  1QUQ B;  2WAQ G;  4O2D A;  2YU9 H;  4UP7 A;  1YIT A;  3NEL A;  4QL5 A;  1PYS B;  1Q82 C;  2AWN A;  1KC8 C;  1K9M C;  1XNR Q;  5IYD G;  1C9O A;  4JI3 L;  3FHW A;  1U0L A;  4P72 A;  1WCM G;  1WJJ A;  4NB3 A;  3CCQ A;  2Z6K C;  2NN6 G;  2PQA A;  1HR0 W;  4DV6 Q;  1IBK L;  2AMC B;  5JJL A;  4PMW A;  3NEM A;  3M7N A;  3F2D A;  3W5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...