4MHEA

Crystal structure of cc-chemokine 18
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
SAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 18
publication title Structures of human CCL18, CCL3, and CCL4 reveal molecular determinants for quaternary structures and sensitivity to insulin-degrading enzyme.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4mheA00
2IL8A 1G91A 1ILQA 2KVMA 5E4WC 2B2UC 1PDQA 1DOLA 2B2YA 1F9QA 2K28A 2D9UA 1BNZA 1EQTA 2FFKB 2M2LA 1U4LA 1DZ1A 4IUPA 1B53A 1C8CA 1WTOA 2DY8A 1QNKA 1EOTA 2MJ8A 2SDFA 4HEDA 5EQ0A 1EL0A 1NAPA 2K1BA 3DEPA 5EJWA 3GV6A 5CORA 1WD1A 2KECA 2KEDA 2B2YC 1JICA 1MSGA 1QE6A 2B2UA 1NR4A 2DY7A 2HDMA 3F2UA 5CBEE 2MPMA 2X69A 1RJTA 3DM1A 1ICWA 4X3TA 2NWGA 1B4OA 1TVXA 4IUTA 1KNEA 1CM9A 1SAPA 1DOMA 2J7ZA 2KOLA 2K05A 4MHEA 1JE4A 2K04A 4X3UA 4QUFA 2FJ2A 2JYOA 3IL8A 1AZPA 1WVLA 1F2LA 1B2TA 2CVRA 1G6ZA 2R3ZA 5T1GA 1HUNA 5T1IA 2L4NA 2Q8RE 1PLFA 2X6LA 1HRJA 1XX8A 2KUMA 1XYIA 2HUGA 4R9WA 4XT3B 3MWYW 1RODA 2X6GA 2L12A 1HA6A 2XIWA 3KUPA 2FMMA 3FPUB 3N52A 4XT1B 5EPLA 2JP1A 1Q3LA 1WTRA 1E0BA 1O7YA 1F9RA 2EOTA 1MGSA 4CJ1B 2MP1A 1VMPA 2L1BA 2MGSA 1DONA 3QO2A 5EPJA 1IL8A 3ONAB 4ZKBB 2HCCA 1GUWA 1SDFA 4LMQD 4MN3A 1B50A 1NCVA 1F9PA 1QG7A 3FDTA 4IUVA 4IURA 1WD0A 1RHPA 4IUQA 1RTOA 3MTSA 1MSHA 4HAEA 4RAUC 3TN2A 2FHTA 3SVMA 5D14A 1AP0A 2N55A 1U4MA 3KBXA 4O42A 5EPKA 5COYA 1WTQA 1J8IA 1B3AA 1EIHA 2K03A 5D65A 1WTWA 1O7ZA 1PFMA 3I3CA 2B2VC 1EIGA 3H91A 3UI2A 3Q6SA 1F9SA 2EE1A 1KNAA 5CMDA 1U4PA 1HFGA 1LV9A 2K01A 4XDXA 4CJ2C 1IKMA 3LWEA 1BBXC 1WTVA 1VMCA 2RSOA 5CBAE 2L11A 3I8ZA 4U68A 4ZK9B 1HHVA 5JJZA 5EKIA 1S4ZA 4ZAIA 1X3PA 3DEOA 1CA6A 2KEEA 4RA8A 1NR2A 2BDNA 3GV3A 2L9HA 4OIKA 3I90A 1ILPA 4DN4M 3G7LA 4HSVA 2RSNA 2B2VA 4ZKCB 1PFBA 2EPBA 1PFNA 1G2SA 2NYZD 4ZLTF 1WTXA 2N88A 2H1EA 5E4XA 2FINB 2VXWA 4RWSC 5DNFA 1MI2A 4OIJA 1DOKA 4IUUA 1ML0D 3D6WA 1X32A 1IKLA 1BF4A 2B2WC 1J9OA 1HFNA 1X3QA 1G2TA 4HCSA 4R8IA 2B2TA 3P7JA 1ESRA 4CJ0B 2Q8TA 1ZXTA 1A15A 4QUCA 1SSOA 2HDLA 1U4RA 4NW2A 4UAIA 1O80A 1M8AA 5AFWA 1AZQA 2NZ1D 3R93A 3I91A 3IFDA 4X3SA 4X3KA 1CA5A 2HCIA 2RA4A 2B2WA 3TZDA 1HUMA 1RTNA 3HP3A 1WTPA 2B2TC 2RVLA 1BO0A
chains in the Genus database with same CATH superfamily
3VR6A 1N32L 1YNNC 1PDQA 4HMIA 1Y1WH 3OMCA 5IGDA 1HNXL 1U4LA 3VA7A 1GVPA 3D4RA 1QNKA 1NSNS 2B63B 2EYJA 1U9RA 2EXDA 1O7IA 1STYA 4ALPA 2VUMH 4JCVE 5CBEE 2NVYB 1MJEA 1ICWA 1VQGA 3CD6A 4XQQA 3M7NA 3KJPA 2IPKD 1WOCA 1EIFA 1PTOD 4AQYL 3M85A 5JVH3 3EVQA 1B70B 4JI3L 4FNFA 4C1NK 4DV3L 4JV5Q 2F0JA 2VB2X 2FMMA 3GTJB 4KN7C 1WTRA 1E0BA 4K8JA 1GUOA 5CV7A 4ZKBB 1I4GA 1FVIA 1PTOC 2KCCA 2K5QA 1D1KA 1M90C 1AH9A 5I9OA 4JI1L 3KDFA 4RGNA 1C9OA 2Y0SG 2E2IB 4Y7NH 1KAAA 3L9AX 3PO2G 1N34Q 2FXQA 5CMDA 1N9WA 3AFQA 3L7ZC 1JB7A 3PF5A 1Q81C 3HOYB 2ALYB 2RSOA 2HQLA 1HTLD 5A2QL 4ZAIA 2O5JC 2KEEA 4LF4Q 3T56B 5I4DA 3WDNA 3CCVA 3FMCA 1S5BD 4DN4M 2IY5B 1YVCA 4A3LH 1M1KC 3KF8B 2H1EA 2WP8J 3BDCA 2I46A 2QW7A 4DK1A 5IP9G 3PUZA 1X56A 2Q2IA 3MXUA 4IPHA 3IAYA 2DUDA 1JJCB 4BBRH 4DV4Q 4ME3A 1HFNA 1VQCA 5IYCH 5KNCA 4F8MA 2VW9A 3OWEB 3JAMi 4GKJQ 5C44H 4C3JG 1NE3A 4LNQA 4X65L 4X3SA 3CXCA 1S40A 5CGKA 1XNRL 2VQFQ 4LFCL 3EBEA 1RTNA 4RKLA 2QEJC 2IL8A 1H9RA 3S1NH 1GD7A 1LO5D 1ZYRD 3FP9A 2RCNA 3M4OH 1WTOA 5CV6A 4P75A 3LGJA 1CKOA 2OF1A 4DR3L 3NP8A 2DY7A 2HDMA 3UDXA 4OEMB 4A3IB 1TVXA 4M8AA 4DV7L 2EYPA 2J7ZA 1HH2P 2MQHA 4ODGA 1ZYRC 2L4NA 1E2VA 5LL6S 3GTQB 4OELB 5ISRA 1I94Q 1PYBA 4WJ3M 2JA5H 1D5MC 3JAML 1JOQA 3CC7A 1F77A 2EY2A 1EIYB 1G291 2ZTDA 1F9RA 4DV5L 2HCCA 4K8IA 3RZDH 2Z1CA 5IY0A 4LFBL 1WTHA 1SYEA 1EZ6A 1JCKB 2YTXA 4KY6A 1RHPA 2JA8B 4O42A 4BA2I 1B9NA 1KABA 1B3AA 4A3EH 4A3MG 1OXUA 1UE7A 1PFMA 1OXTA 4CHTB 2E76C 1QB5D 4JOIC 2F0LA 3I4LA 1NMFA 3G6JB 2QCPX 3VYSA 1I4RA 1TXYA 4DAYA 5M3FB 1IYUA 1UNSA 4FVMA 4JBMA 1A2TA 5JJZA 1QVCA 1CA6A 2F1MA 3I90A 4C3HG 2UUCL 3S1RH 2NYZD 1FNWA 3VA5A 2FINB 1HZAA 3BU2A 2IHFA 4JG2A 4A3JH 4G57A 1BF4A 1EWHA 4OWXB 3U4VA 3OOCA 4YWLA 3A54A 3C46A 5JVG3 3NEMA 5HGQA 4DNRB 1EY9A 1AZQA 3CPFA 5LMUL 3CMAA 4A3BG 3X3NA 1I4XA 4LF9L 5LMNL 3K5MA 5AJ3Q 4G7HC 3SK5A 2SEBD 2K4KA 2B2UC 5CV5A 3AFPA 3K59A 1R9TH 1PH6A 2D9UA 1V1OA 2M2LA 2JA7B 1TKWB 5ELBA 3TS2A 2IW3A 2DY8A 3F2BA 1PRTF 1D2BA 3DEPA 3FVQA 5C4HA 2PPBC 2YU9B 3I4NB 1TWAB 4ID6A 1TQOA 3C1FA 3CC4A 2EJFC 1X65A 4A3DB 2XN9C 1HJPA 1CFMA 1Z7TA 3F8TA 4HSPA 3D6CA 4C3IH 1PFSA 1N33L 4B3TQ 3IL8A 1WVLA 1QUQA 1ONLA 5T1IA 5ELOA 2X6LA 3GD7A 1B7YB 3LWUA 1SEBD 2PW7A 3FPUB 1VQ4A 3Q22A 4CJ1B 3SHLA 2OTLA 1STEA 3K7AB 4PZ8A 3NWSA 3Q24A 4JI8L 4AYBG 3H15A 1TS4A 1JORA 1JMCA 4E6IA 4RAUC 1RTOA 2R7ZG 2R92H 1SNOA 2VNUD 2PQEA 4DFAA 3KBXA 2NBFA 5FO8B 2M9VA 5FLMG 3PO3H 2A69D 3VR2A 4A3KB 5G3LD 4HJ9A 1LTSD 2K5DA 2J4XA 3M4YA 3H0GG 2D0OA 4KHPQ 3OW7A 1HR0Q 1GUGA 2A5HA 3TDQA 4FDBA 2BDNA 1V1PA 3HG9A 3HOWH 1PH2A 3GTMH 3P75A 3S1MH 2A6ED 1Q1BA 5A35A 3CCUA 1VQHA 2EYLA 2A69C 3E3XA 3HOUG 1DOKA 4K6DA 2JK8A 3ULLA 1JJ2A 4GLXA 4LFAL 2AUJD 3S1QH 4JV5L 5NUCA 5IP7H 3P7JA 4BA1I 5JJIA 4KY5A 1CHQD 4OWTB 4LJZC 3AYHB 2A6EC 1OTCA 2KJXA 3W2DA 3VDYA 2N49A 5IOCA 2F3WA 1Y1WG 5EKKA 1KRSA 1HUMA 1L1OC 4AIMA 1HQRD 1WTPA 3PO2B 3LNNA 2LXKA 3S16H 4BY7B 4JI5Q 4OWWB 2N8NA 1EY5A 5BN3A 5C4XB 2VUMG 3K8AA 3HOVG 4CBVA 1IBLQ 1VQEA 1PXUA 1I4HA 1T9HA 2GVAA 2L15A 4KI0A 4GS3A 2VQEL 3J7ZC 1K8GA 4ZQ3A 2K04A 2NVXB 4MZ9A 4LK1C 2D62A 1SRUA 1X3GA 3CW2C 4GN5A 1PLFA 1LTTD 5ELFA 3E0JA 4XT3B 4DV4L 1SYGA 2JN4A 1HA6A 1HTPA 1XXGA 4MTKA 4R8NA 1SMXA 2FMCA 4H44C 4JYAQ 4XIGS 4GKJL 4CKBA 1TWCB 1GUWA 3MZ5A 1TWFH 3M7GA 2F4VL 4YCWA 2VQFL 2KHJA 3J7YW 4UY8C 4EQNA 2Q2HA 3P1HA 3RN5A 1O7ZA 5C4JH 3MXNA 3I4MB 1LV9A 1UE5A 1IKMA 4LF6Q 1K3BC 4N9PA 4DF7A 4NPSA 1E2WA 4G7ZC 2L11A 1KRTA 2HHHL 4A3LG 2MNAA 3H09A 4R4CA 4J15A 3NSWA 5M5YB 1U0LA 1Y1VH 2GVBA 1FJGL 2AKWB 3M3YB 1Q8KA 4BBRG 5DNFA 2K52A 4A3GH 4DR7Q 1I94L 1A3VA 1IKLA 1LTLA 1RIPA 4V190 5BN5A 3Q0AA 1UUPA 5C44G 1B1ZA 1STAA 4GOPB 4HN7A 1YEZA 1PHJA 3E9IA 3JAMc 3T1HL 1TR5A 3A7LA 1E3PA 1VF7A 2F3VA 2A73B 3QB3A 3I91A 2RDHA 4JI2L 3HOZB 1XMQQ 2IT1A 4DR5Q 3HEJA 2C9OA 3TP8A 5M9OA 1DZ1A 1W3SA 1EOTA 4A93H 2L0CA 2UUBQ 1DYQA 3E5SA 1NNXA 1N36Q 2E2DC 4ME5A 1AFPA 1TS3A 4K0KQ 1HXYD 2A6HD 2LMCB 1SYDA 1KNEA 2KOLA 1X55A 3S14H 1B2TA 4A76A 2JA5G 3TSSA 3HRZC 5FO7B 5M5XB 1KL9A 2QILA 1H9SB 2HQEA 1EQVA 3UDIA 3S15H 1CQVA 1KDCA 4MNOA 4YCVA 5EPLA 4L5TA 4EQ5A 1WFQA 5J39A 1LABA 3NPPA 4LF7Q 2A6HC 1HNWL 1VQFA 2VZAA 1IL8A 2EZVA 3HGBA 2F0DA 5IT9L 3KF6A 4M1UB 3HZXA 4A3EG 4HAEA 3MTSA 2JEBI 5FOBB 3SVMA 5CR3A 2TMPA 1G8ZD 1VQ9A 1LM0A 4H0LC 1EIHA 4KLKA 3RZOB 1TWHH 4IUNA 3MXPA 2NVTH 2N78A 3E0EA 1KNAA 1STNA 4GNXC 3BJUA 4PG3A 5EAYA 1CK1A 5FK9C 1HHVA 1CKNB 1SBBB 2XGTA 4IN3A 1JT8A 1NR2A 4PMCA 1A6XA 5C3EH 4XYQA 2AQ2B 1A3TA 3W1BA 4DK0A 1VQIA 1SXTA 4A3JG 1QWYA 2F0OA 3OHXC 2PO4A 1BCPD 3BYYB 1WYDA 1YHBA 2VS1A 3I4OA 5DLQE 2WINB 4LF5Q 4NB3A 1Y69U 2KCNA 2R6GA 3TEHB 2CQOA 3G4SA 2R7ZB 4NW2A 1L2FA 1PRTD 2JSOA 4JI0L 1SNCA 3AB9A 3RUZA 1BCPC 1S5ED 1NJIC 2Z4HA 2PZUA 4DV0Q 4JVZA 4QCLA 5CV9A 2O4XA 1CSPA 3IRBA 3OYYA 1SYBA 1F9QA 1VQPA 1FR3A 3H0GB 1JWSD 1SR3A 3QOLA 3TP6A 2CW0D 4QMGA 3CCMA 1GHJA 1SE8A 1GJXA 1I50H 2RQXA 3GQBA 1PRTC 2Z8LA 4HEDA 4DXFA 2NN6I 3GV6A 1K28A 4PQXA 4C3IG 2B2UA 1XPUA 1CZGA 1XNQQ 1S5DD 1STHA 1I6HB 3FKIH 4IUTA 2K05A 2UXDQ 3X3MA 5JJLA 1BVSA 3T53B 2CVRA 2CW0C 5T1GA 4P72A 3J7AF 2E2HB 5LHY1 2PNRC 3SR1A 4R4QA 2ZXOA 4DAMA 4HTHA 3UDFA 5C5LA 4FF2A 3EQLC 4XT1B 4HR7B 1UE1A 3PUYA 4POFA 1Y1WB 2MP1A 1Q12A 1MD2D 3HOVH 2R92G 4LMQD 4MN3A 4NXML 3SK6A 4UP7A 4WJ4A 3GTPB 1LT3D 4IUQA 3PO3G 2VUMB 3CPWA 5JOBA 4YY3Q 4ZYSA 3I55A 1F2YA 1LACA 4HMJA 5COYA 4JI5L 2Z6KC 4DR2Q 3CCEA 2NVYH 4DR6Q 2R7FA 2OEOA 4KKUA 1JJGA 1IBLL 1H9JA 3HOWG 3KYHC 3J81E 3DWAA 1K83B 1PZKD 3CMEA 1EFID 3WWVA 3GV3A 2ES2A 5C3WA 4JI7Q 4HIOA 2UXCQ 4LWCA 1PFNA 3GTJH 3D4DA 4CGYB 1WI5A 4C1NI 1BOSA 2R93B 2F0PA 1L0YB 5IP7G 4X64Q 3D6WA 1X32A 3NBIA 5C6AA 1SNMA 1IYJB 1WCMG 1MHWC 3OPOA 1V1QA 2RHSB 1G2TA 3BG3A 4X6AH 2B2TA 4JYAL 4LW1A 5IGCA 2E2JB 2OCEA 4A75A 4PZ6A 1CSQA 2ICEC 4XXEA 2QGQA 1YHQA 3IFDA 2WAQG 2D0PA 4S3SA 1IBMQ 3HOYH 1JOKA 5I6YA 2K28A 4P74A 3I56A 4L5QA 4CDCC 1S72A 1K3RA 1I4QA 4RG1A 4LF6L 5KGUA 3DMUA 4OX9Q 1L1OA 4AH6A 1HNZQ 3PV0A 2KEDA 2MO1A 2Y0SE 4QY7A 3ZYYX 3F2UA 4GKKL 2OTJA 1RJTA 4DK3C 1SAPA 2ZT9C 3HFZB 4TRDA 2MUYA 1CQFA 2LFNA 2AQ3B 4X62Q 4DR7L 4WJWA 2ZJRA 3T4AC 4A3FB 4J1MA 4P71A 4F7XA 1CZWA 1Z47A 3KK7A 1MGSA 2QKIC 4GN4B 3VYRA 3S1NB 3S17B 3PUXA 4RCOA 1SDFA 3M4OB 4HJ7A 5M5WH 5C3XA 2F0EA 5GAEC 2XRQD 2G9DA 5JPMC 1XMQL 1GM5A 1EEFD 4OO1I 4R4OA 3NHHA 2N55A 2UU9Q 2Q8IB 2UUAQ 1ICFB 3HKZG 5D65A 2K6AA 1HCZA 3AMUA 5M3MB 1BBXC 3PMFA 1WTVA 1P8LA 2BH8A 3HOXH 4CDFC 4FO2A 4EX5A 1SJED 1Y1VG 3OTOQ 3CCLA 4BXXH 1Q1EA 5E1FA 3GTQH 4FXDA 2OXPA 4K0KL 1CUKA 1JQYD 2L9HA 1B3QA 4A3GG 3U50C 3DWQA 2EPBA 2L55A 1VQOA 3Q23A 4HJAA 1PV4A 4DV6Q 1PZID 2XNAC 4EQOA 2LSSA 1HZCA 2KENA 5FLXc 1DM0B 1FD7D 2A68D 2MHVA 3A55A 3D31A 1HR0W 4QGUA 1J9OA 4R8IA 1XTDA 2WB1G 1A3UA 1ZXTA 3OWFA 1IYVA 2HDLA 3M4QA 2JA8H 3NQTA 2BH2A 2B8GA 1VQKA 2RA4A 1H9KA 1IXRA 1GXDC 4B9XA 4IPGA 5M3FH 2A68C 2HD3A 5IT9c 1IZ6A 4A93G 1NUCA 4QJFA 5IWAL 4DUYQ 1BBUA 4WRDA 3CCRA 4DR4L 3S1RB 2PI2E 4BBSH 2Z6BA 3RLFA 3BS1A 2NUCA 4JBJA 5HGTA 5F2DA 5EJWA 1SROA 1XPRA 3GTKH 3UE0A 1MSGA 1RL2A 4DR1Q 5J3BA 1X54A 2K33A 1DOMA 4OXPA 3H3VC 1AZPA 1F2LA 2R3ZA 4ILWA 1LTID 3Q8DA 3SXHA 4X66L 4K2KA 5JEAH 2JA6H 1PYSB 2VB3X 1FYCA 1OXSC 5BR8L 1UAPA 3KOJA 1BR9A 3QO2A 4CDEC 4KY7A 3NTHA 2JA7H 1B9MA 1PVOA 1IL2A 4YHHL 3CU7A 1F2ZA 4DV0L 1MSHA 1XMOL 2KA7A 1PH4A 1PYWD 1RDPD 2YU9H 2O5IC 3I4NH 2EYHA 5GROA 3UI2A 3VR5A 3URYA 5FJ8H 2QEXA 4A3DH 4B3SL 2EE1A 1U4PA 1JOOA 1MBYA 2NVQH 4JPBW 1ENCA 2K32A 4JC0A 4K6LA 5C3EG 1E1TA 2PZWA 2YV5A 1XNQL 3MVVA 5EBDA 1HA5A 1ASZA 4H02A 2UXDL 2M00A 1PFBA 1A62A 3AU7A 2WACA 3G71A 4JI6Q 3VR4A 4GNXA 3CKIB 2B39A 3G48A 3ITPA 2C5CA 5D3IB 2K14A 3RLOA 1ML0D 2NB0A 2H5XA 3K80C 1Q7YC 4HCEA 3KBGA 5C0XI 3J80i 1CHPD 1TWGH 1X3FA 2ID0A 4FP5D 1JC7A 4H13C 1YJNA 1VQJA 4DV1Q 4DV2Q 3BZKA 1EYGA 1DXMA 2RDGA 3V2TA 5JAVA 3PO3B 1NTGA 2KQ3A 2WIIB 2HT1A 3ZJYC 1Y14B 2KCTA 1CA5A 4ZUIA 1L0XB 1FGBD 1D5ZC 3K57A 3HP3A 1R4QB 2B2TC 2RVLA 3ER0A 3CC2A 2B2YA 4POGA 4AYBE 4TSSA 5KNDA 4DR2L 1EQTA 3S1MB 1B53A 1PH7A 2B3GA 1Q82C 4DR6L 2ZM6Q 3QR8A 3I7FA 2SDFA 5K36G 1EL0A 1I3QB 1PH1A 3FKIG 1VQ5A 2F52A 1WCMH 3E9HA 2ZJQA 1PTOF 4XQJA 3UDGA 1XYIA 2UXCL 2Y0SB 2CQAA 1Y8NB 4QIWE 2HIXA 3J80L 3T13A 3SK4A 3S2DH 2PMZE 4N9TA 4OONA 4BY1H 2L12A 3ND9A 2B8FA 1N34L 2B29A 3EIVA 3EJIA 3S16B 1Y8OB 2B63G 4RGTA 4LF4L 2F0UA 1NCVA 3FDTA 5C4XH 4HIMA 4K2LA 3D0FA 1IBML 1AP0A 1K8AC 4KKTA 1U4MA 2JE6I 4EVOA 5ELDA 2LKVA 2E75C 4JI3Q 2E5LQ 4CDDC 3CQZB 3PCOB 3H91A 4C3JB 1QVFA 3KLSA 3BVZA 1TU2B 2IX0A 2GN5A 2R61A 1HNZL 1VQLA 2NVXH 3MC0B 4PV1C 3GTLB 5DM63 1VQNA 2Z6KA 3V05A 3K0YA 3CAMA 4OO1H 4HSVA 1G2SA 5BN4A 4ZLTF 3GTGH 4JI1Q 3OW2A 1TWFB 1HZBA 4CKEA 4MIUA 4RCNA 1TWCH 5HY6A 1LT5D 2AHOB 4DK6C 3EN2A 4A4IA 1FNUA 1A8VA 1ESRA 2N3SA 1W6KA 1U4RA 1O80A 2F0VA 5AFWA 2NZ1D 4UHVA 3TMEA 2ATWA 3HOYG 3TP7A 3P20A 2DN8A 1Q90A 2G5DA 1ILQA 3K0XA 5E4WC 3PIOA 2IX1A 2F0GA 2UU9L 2EYMA 3R2IA 1D6EC 5IE8A 2QF7A 1VQAA 1K8OA 3T16A 1OXVA 1KLGD 4IFDJ 1Q8IA 4A3GB 5CORA 2ICIA 4JBWA 4KHZA 4DKAC 3OTOL 4IO9A 4YCUA 2GA4B 5GQOA 2Q2UA 4L6TB 5KEEA 4X65Q 3DM1A 4GLAC 1XNRQ 4IFDI 1GUNA 2NWGA 4LFCQ 2OQ0A 4QUFA 4A3MB 1KTKA 3WOEA 5CV4A 5DM73 1VQ8A 4DV6L 2HIVA 4K14A 5J22A 2XRSD 1LLRD 2UXBQ 4EGVA 1V1PB 1WJJA 4N8FA 4JK1C 1SE4A 3PIO3 5E3FA 1KDBA 4KN4C 3N52A 3M9BA 1S5CD 3O13A 4DR3Q 4C2MB 1YIJA 4C3HB 3CHBD 1CI3M 1VMPA 2A74C 5IYDH 2SNSA 3H3VI 4R1JA 4DV7Q 4Y52H 1SNQA 1WD0A 4YWMA 5IGGA 3NBHB 4G4KA 4TKOB 5FLXL 2EYFA 3RD4A 3BZDB 2F0TA 4WORA 4DUYL 2DJFC 3K58A 2K03A 1HZ9A 3HOXG 3CF5A 1EIGA 4ZRZA 3Q6SA 4FF1A 4BXXG 2K01A 1GUSA 2K5NA 4YWKA 1STBA 3EFXD 3UE1A 4DV5Q 4A3BB 4U68A 3I8ZA 4DR1L 1LTBD 5M5XH 3S15B 2AQ1B 5EKLA 3G7LA 2RSNA 5IT9E 1X3EA 4G7OC 1Q46A 5AJ3L 2F0SA 2CFMA 4IUUA 4KJOA 2XWJB 3C1EA 3ULJA 2DJGC 3U9OA 2JA8G 3GDEA 3GP7A 1XTCD 4J6HA 1EY8A 3U58A 4QUCA 3GTOH 4DU9A 1TWHB 1Q86C 3FPPA 1M8AA 2RKSA 2PQAB 3C3LA 5M3FG 2WKCA 4B3RQ 3RZOH 1DD2A 4RHRA 5GAGC 2PCFB 4B3TL 2K75A 1G91A 4BBSG 1Y8PB 4LUVA 1E7ZA 5C0XH 1VQ6A 1TS5A 4J8QA 3CCJA 3A74A 2QDBA 1C8CA 4GOPC 4GLVB 4QB4A 4AYBB 1L0WA 4ZCKA 3AQQA 1D1IA 3KF8A 4DUZQ 1JE5A 4Q0FA 2B2YC 4IPDA 2MPMA 1O78A 2CWPA 5LMUQ 1II3A 4XYOA 1FL0A 1D8LA 1DGSA 2I5HA 4LF9Q 1CM9A 5LMNQ 4X3UA 1JE4A 1PTOB 5JEAG 1SFOH 2Q2TA 3MEFA 5LL6X 4P2CB 2JA6G 5JEAJ 2NN6G 4TVAB 1XX8A 2KUMA 4QIWB 2PMZB 4KHPL 5ELNA 1HR0L 2JA7G 1DONA 1EYAA 4Q5VA 3S2HH 3ND8A 2RHQB 1EY0A 1I50B 5K36H 1F9PA 4XQNA 4I7AA 3HOUB 2PYKA 1N33Q 3HKSA 3I4NG 3NQIA 5G3LF 3T51B 5FJ8G 4A3DG 3J7AV 1PA6A 1KXLA 4RFBA 3FKIB 1LTGD 1V43A 5KIXA 4LF8Q 1QCBD 1I6HH 3LX0A 3M4PA 4KD4A 4NXNQ 1JWUD 4I7ZC 4JI8Q 4B9WA 5IODA 3T1YQ 2J0TD 1PH3A 1VQ7A 1S5FD 1TIID 2CH4W 3KFUA 3R2TA 1WTXA 2B63H 3HOVB 3PGZA 5FO9B 5I9PA 3J80c 4K5XA 1PH5A 5J1ZA 1IBKQ 2B2WC 2CWAA 3GTPH 4HCSA 3IFTA 4N8X1 4F87A 4CJ0B 4A3KG 3KLWA 3B6YA 1X6OA 4DGZA 4B3MQ 2NZHA 2BCOA 3S24A 1TT2A 2AMCB 3GO5A 5D3DA 1BUVT 1SJHD 3TBIB 3NE5B 1IHZA 4A3CH 4FF4A 1K83H 1OO9B 2E5LL 1BNZA 4LFAQ 4FF3A 3KF6B 5KYIA 4KTAA 2ZTCA 4ZUJA 3J81L 2YTVA 2V1CC 2KECA 1BBWA 2R93H 1K0SA 2F0KA 5A2QE 4Y7NB 1B8AA 1B4OA 2XWBB 2Z0SA 3BZCA 3D4WA 3MHBA 2E2IH 3VR3A 2QA4A 1HUNA 4BY1G 2EY1A 2E2JH 4O0AA 2LY7A 1O7LA 1VQMA 1QZHA 1EU3A 1E22A 4BY7G 2JP1A 1O7YA 5C5MA 2K5HA 1EY4A 3A8JE 3A5ZB 5C4XG 2L1BA 4JW0A 1YNXA 1E24A 4PMWA 1J5EQ 4IFDH 1SNDA 4NKLA 2VQEQ 3ONAB 3RNUA 4BBRB 2WV6D 3L0OA 3JC66 1ENFA 3ULPA 5C44B 1HQMC 1EU4A 5I2XA 5I6WA 2WAQE 4KK7A 2B2VC 3SEBA 2H4OA 2MFIA 4O2DA 3I72A 1EZ8A 4K5WA 2MO0A 2SOBA 1VMCA 3FHWA 1RD9D 2JQOA 5L37A 3H3VH 1FNVA 2KHSA 4OO1G 3DEOA 4KKSA 2F4VQ 4IOAA 4A3FH 1TY0A 2VY3A 3I73A 1ZEQX 3TQYA 3FEWX 1K9MC 2ZTEA 4DR5L 3F1ZA 1GKHA 5M5WB 3QWNA 2UXBL 2LXJA 3S17H 3W3AA 3K5LA 1K8MA 1X3QA 3CP0A 3JAME 1YHAA 4A3IH 2UUBL 5IGBA 1M4VA 1N36L 1A2UA 4RGOS 1SSOA 4UAIA 2HHHQ 1Z6HA 2JA5B 3I4MG 1QNUA 4RHSA 3BVMA 1S3OA 3HOXB 1FJGQ 1KD1C 5M3MH 1KLUD 4DAPA 5KYLA 3ERSX 1JB3A 2KHIA 3RZDB 1QOHA 1UEAB 1ZKOA 1EYCA 1KHIA 4IUPA 4JI4Q 5FKAC 4TQUS 2MJ8A 1GOZA 2DNCA 3T1HQ 1YBYA 3BDLA 1NAPA 2K1BA 4LF7L 1AN8A 3NWTA 2IJ0A 4A3EB 3S9WA 5TSSA 1QE6A 2D2CC 3HKZE 1CTMA 4RKBA 4JI2Q 3QOJA 3CCQA 4MHEA 4HJ5A 5HURA 1YNJD 2I07B 2F0WA 1YI2A 2RCFA 1X9NA 3HOZG 2XSCA 4LUZA 2HUGA 3EROA 3MWYW 1Q3LA 5JPNC 5IYDG 4IQZA 4APVA 1CKMA 2VL6A 5EPJA 1G51A 3KDFB 4BS9A 3RLNA 2O2LD 2K5WA 4A3JB 1SE3A 4L8JA 4BBSB 1B50A 1YNJC 1QJOA 2YYZA 4B3RL 3TZUA 2BA0A 1D5XC 4QQBX 3MAQA 2WB1E 3TN2A 5CV8A 4K5VA 3GTKB 4FXKC 2AWOA 1G6PA 2F4IA 1P16A 1SN8A 1V8QA 4UP9A 1VS0A 1GO3E 5IYBH 2PZTA 3VYUA 2F0NA 1NY4A 3DLLA 4DNTB 4LF5L 2EVBA 2RF4A 1F2MA 2NN6H 4L63B 3NELA 3NTIA 4B08A 1HNWQ 4DUZL 1R9TB 2ZXRA 1RKNA 5CC4A 1A63A 1S4ZA 5EGTA 2JA6B 1BCPF 5IIFA 1AW7A 2F3IA 5E7NA 1L1OB 2AWNA 2SNMA 4O1NA 2VXWA 3WOFA 4GZYC 3AEVA 3H6MA 1TWAH 4C3IB 4DPGA 4ABNA 2IHEA 1A15A 3NUCA 5IGEA 3DM3A 1LT4D 1TS2A 1CT1D 2E8GA 3R93A 3J81j 2ENBA 2F0QA 5C0XG 4OGQC 1C0AA 1NBWA 2TSSA 3TZDA 1LYLA 2NVQB 3CRKC 5GADC 5C0XJ 1DJRD 1BO0A 2CKZB 2OQKA 4HIDA 2XTIA 3K7AH 2JJQA 5KNBA 2OWOA 2EYOA 4LF8L 3R3OA 1J6QA 3V96A 2R92B 1B44D 1QILA 5EQ0A 1ET6A 4QL5A 4NXNL 1LUZA 1WD1A 2G9HD 1KC8C 1JICA 4GN3B 4JI0Q 1NR4A 1SMYD 4NMZA 3T1YL 1TWGB 1UE6A 3R8BA 3I2ZA 3DXJC 4V0BA 4A3KH 1W6JA 4GOPA 2JYOA 4OL7A 3BVGA 3DUZA 1T5EA 2PI2A 2Q8RE 4YY3L 1IW7D 1XJVA 3MFYA 3HOWB 1IBKL 3GTMB 1RODA 2X6GA 5CYUA 3KUPA 2C35B 4KD3A 1SMYC 1VCIA 3PUVA 4KMUC 4F88A 2F03A 2F0IA 2MGSA 1UEBA 2I5MX 5ELCA 4B3ML 1H9MA 2EQSA 3S1QB 3SGIA 4JI7L 1IW7C 1EY7A 1KIXA 1BDOA 1Z9FA 4DA2A 4DAYB 5D14A 3L2PA 1WCMB 4IZ8A 3J80E 2F0HA 1I3QH 3K7UC 4IPCA 1ASYA 1N32Q 5EPKA 3F2DA 4FYDA 1AE2A 1AEXA 1JR0D 4RMFA 4X64L 1HNXQ 2BE5D 1F9SA 2OT2A 1HFGA 1VDZA 4XDXA 1DCZA 1BQQT 4CJ2C 3S2DB 3NBHA 2CHBD 1ET9A 1XPOA 5CBAE 2WAQB 3FRPB 3PO2H 1W2BA 1BXTA 3J81c 4BY1B 4RA8A 4NXMQ 4BY7H 3CRLC 1H9SA 3F2CA 4YIJA 1ILPA 1K73C 1C4QA 4ZKCB 4L5SA 2NTSA 1PZJD 2N88A 2BE5C 1GUTA 5E4XA 5EBCA 4OIJA 4AQYQ 1UWVA 3RN2A 2BA1A 4MTNA 4DV3Q 3L3OC 1QZGA 2D5DA 1R4PB 2K5VA 2I5LX 2YTYA 5IP9H 3DWPA 2K50A 3A8IE 4PZ7A 1N8RC 2Q8TA 4OX9L 1JWMD 1J5EL 1E1OA 1YJ9A 1MIUA 2ZXPA 2BOSA 3K5NA 2DNEA 4X3KA 3CQZH 4A3CG 3NENA 4C3JH 1VF5C 2B2WA 2F0FA 3MA2B 2EJGC 2AUKA 1FGUA 1MKHA 2RBMA 2KVMA 3SK8A 4RGMA 2EDGA 1CKNA 4X62L 4PMBA 4DXGA 1YZ6A 3GTLH 3J7A5 2PQAA 4FXGC 5GAHC 3MEHA 4LAAA 4Z9CB 3NTKA 3QIAA 1A0IA 1K0RA 1SNPA 2R93G 3GTGB 1EEID 1I5FA 3DHQA 4R4IA 2QDLA 4BWGB 1E2ZA 1VQDA 2EIFA 1QUQB 3STBD 2Z4IA 3PUWA 1U5KA 2EY5A 3TP5A 2X69A 4IALA 3H94A 2A19A 4X3TA 5C4JB 1YITA 1J8IA 4WFN3 2FJ2A 2IX3A 1KAWA 3HKZB 3PSIA 1SE2A 3I4MH 2DGYA 4DAVA 4XTCS 1ENAA 1EQQA 3MXGA 4IJLA 1HRJA 2EXZA 3BYTB 2UUAL 1V9PA 2A8VA 3STBC 1QVGA 4IFDG 1Y1VB 4GNXB 1EUJA 2ZJPA 5M5YH 2EOTA 3TRZA 3M3YH 4P73A 5LMNW 4GKKQ 2LS01 1I4PA 2JA9A 3VYTA 1PMRA 1QG7A 4IUVA 3PF4A 3W1GA 2Z9HA 4I65A 1MJCA 2FHTA 3I70A 3MFGA 1EY6A 3BDOA 2PW5A 1WTQA 5DAUA 5IYCG 3U9SA 2WB1B 1VQBA 3NK9A 3C2PA 1WTWA 1T5XD 4JI4L 2WKDA 5C4ZA 1EYDA 3ICEA 3HOZH 4A3MH 4A3FG 1SLJA 3TS0A 4KJNA 2I0QA 3A7AB 5EKIA 3PIPA 2RDFA 1EWCA 1EOVA 2E74C 3ERQA 4OIKA 1NMGA 1LTRD 5K5PA 1BCPB 4A93B 2B2VA 3U4ZA 1XWEA 1LT6D 4C2MH 4C3HH 5FLXE 2ASBA 1MI2A 2KBNA 4CKCA 4A3IG 3CCSA 1EWIA 3RR5A 3TREA 2A1AA 3G6EA 3S14B 4ULLA 3QG1A 4LUOA 1PRTB 2EJMA 5DEHA 4L5RC 5M3MG 3KLRA 5H1SE 1AE3A 4LFBQ 3E6ZX 4RH6A 2CH4A 3PIP3 2R7DA 5KRUA 3RMHA 3K5OA 1C48A 4A3BH 1DOLA 4C56C 4NP5A 1SYCA 2FFKB 4HJ8A 1BKBA 4JBKA 3A0JA 2NZOA 3K6OA 4EQPA 4IOCA 2F0MA 1HPCA 2NVTB 1RF2D 4UPAA 2UUCQ 3K81C 4UP8A 1G6ZA 1EFWA 3GTOB 1H95A 4PNYA 4U673 2V4DA 5IWAQ 4R9WA 4DR4Q 2BDOA 5C3EB 3OSOA 2XIWA 1TY2A 5ELEA 3D3RA 2KCMA 2WFWA 3A5UA 4H7BA 4DNIA 2CCZA 2PNHA 3KLSX 4KV6A 4IURA 3PQIA 4IJHA 4JOIA 1LTAD 4JI6L 3D8GA 3HS0C 3MXNB 5IYBG 3KJOA 1D7QA 3OMGA 3A8KE 3OIQA 3QJYA 3A56A 4NDXA 5I2YA 4X66Q 3OIPA 2EY6A 1KDAA 2JEAI 2R7ZH 2NTTA 1GHKA 3I3CA 1SFOB 3EA6A 1I6VC 4DV1L 3LWEA 1PTOH 5BR8Q 5FLMH 4DV2L 3IKJA 4HIKA 4R4TA 3SDZA 4ZK9B 1PH9A 2L5TA 1PH8A 1X3PA 4KHVA 2XVSA 3H0GH 1RCVD 4YHHQ 4OHJA 1C7YA 2P5ZX 3W5OA 1XMOQ 3S2HB 4RWSC 1KQSA 3SE0A 2K7VA 2IWHA 1YNND 4B3SQ 3HOUH 2ZM6L 2JXMB 1ESFA 1EQRA 4QF4A 3NXWA 2E2HH 4UDUC 1STGA 1OXXK 1SYFA 3N6RA 3J81i 5JJKA 1YJWA 2HCIA 5IGFA
chains in the Genus database with same CATH topology
3VR6A 1YNNC 1PDQA 4HMIA 3OMCA 5IGDA 1U4LA 3VA7A 3D4RA 1QNKA 1NSNS 2B63B 2EYJA 1U9RA 1STYA 5CBEE 2NVYB 1ICWA 4XQQA 3M7NA 2IPKD 1PTOD 3M85A 5JVH3 3EVQA 4C1NK 4FNFA 2F0JA 2VB2X 2FMMA 3GTJB 4KN7C 1WTRA 1E0BA 4K8JA 1GUOA 5CV7A 4ZKBB 1I4GA 1PTOC 2KCCA 2K5QA 1D1KA 5I9OA 4RGNA 2E2IB 1KAAA 3L9AX 5CMDA 3L7ZC 3HOYB 2RSOA 1HTLD 5A2QL 4ZAIA 2O5JC 2KEEA 3T56B 5I4DA 3WDNA 3FMCA 1S5BD 4DN4M 2H1EA 2WP8J 3BDCA 2I46A 4DK1A 3PUZA 3MXUA 3IAYA 1HFNA 5KNCA 4F8MA 3OWEB 4C3JG 4X3SA 5CGKA 1RTNA 4RKLA 2QEJC 2IL8A 1H9RA 1LO5D 1ZYRD 1WTOA 5CV6A 2OF1A 3NP8A 2DY7A 2HDMA 4A3IB 1TVXA 4M8AA 2EYPA 2J7ZA 4ODGA 1ZYRC 2L4NA 1E2VA 5LL6S 3GTQB 5ISRA 1D5MC 3JAML 1JOQA 1F77A 2EY2A 1G291 1F9RA 2HCCA 4K8IA 2Z1CA 1SYEA 1EZ6A 1JCKB 4KY6A 1RHPA 2JA8B 4O42A 4BA2I 1B9NA 1KABA 1B3AA 1OXUA 1PFMA 1OXTA 4CHTB 2E76C 1QB5D 3VYSA 2F0LA 3G6JB 3I4LA 2QCPX 1I4RA 4DAYA 5M3FB 1IYUA 1UNSA 4FVMA 1A2TA 5JJZA 1CA6A 2F1MA 3I90A 4C3HG 2NYZD 1FNWA 3VA5A 2FINB 4G57A 1BF4A 1EWHA 3OOCA 3A54A 3C46A 5JVG3 4DNRB 1EY9A 1AZQA 3X3NA 1I4XA 3K5MA 4G7HC 3SK5A 2SEBD 2B2UC 5CV5A 3K59A 2D9UA 1V1OA 2M2LA 2JA7B 1TKWB 5ELBA 2IW3A 2DY8A 1PRTF 1D2BA 3DEPA 3FVQA 5C4HA 2PPBC 2YU9B 3I4NB 1TWAB 4ID6A 1TQOA 3C1FA 2EJFC 4A3DB 2XN9C 1CFMA 1Z7TA 4HSPA 3D6CA 3IL8A 1WVLA 1ONLA 5T1IA 2X6LA 3GD7A 3LWUA 1SEBD 2PW7A 3FPUB 3Q22A 4CJ1B 3SHLA 1STEA 3K7AB 3Q24A 3NWSA 1TS4A 1JORA 4E6IA 4RAUC 1RTOA 1SNOA 2VNUD 2PQEA 4DFAA 3KBXA 2NBFA 5FO8B 2M9VA 2A69D 3VR2A 4A3KB 5G3LD 1LTSD 2K5DA 2J4XA 3M4YA 3OW7A 1GUGA 2A5HA 3TDQA 2BDNA 1V1PA 3HG9A 3P75A 2A6ED 1Q1BA 5A35A 2EYLA 2A69C 1DOKA 4K6DA 2AUJD 5NUCA 3P7JA 4BA1I 4KY5A 1CHQD 4LJZC 2A6EC 2KJXA 3W2DA 5IOCA 2F3WA 5EKKA 1HUMA 1HQRD 1WTPA 3PO2B 3LNNA 4BY7B 1EY5A 5BN3A 5C4XB 4CBVA 1PXUA 1I4HA 4KI0A 4ZQ3A 2K04A 2NVXB 4LK1C 2D62A 1PLFA 1LTTD 5ELFA 3E0JA 4XT3B 1SYGA 1HA6A 1HTPA 1XXGA 4R8NA 4H44C 2FMCA 4XIGS 4CKBA 1TWCB 1GUWA 3MZ5A 3M7GA 3J7YW 4EQNA 3P1HA 1O7ZA 3MXNA 3I4MB 1LV9A 1IKMA 4DF7A 4N9PA 4G7ZC 1E2WA 2L11A 3H09A 3NSWA 5M5YB 3M3YB 5DNFA 1A3VA 1IKLA 4V190 5BN5A 3Q0AA 1UUPA 1B1ZA 1STAA 4HN7A 1TR5A 3A7LA 1VF7A 2F3VA 2A73B 3QB3A 3I91A 2RDHA 3HOZB 2IT1A 3HEJA 2C9OA 3TP8A 5M9OA 1DZ1A 1EOTA 2L0CA 1DYQA 3E5SA 2E2DC 4ME5A 1AFPA 1TS3A 1HXYD 2A6HD 2LMCB 1SYDA 1KNEA 2KOLA 1B2TA 3TSSA 3HRZC 5FO7B 5M5XB 2QILA 1H9SB 2HQEA 1EQVA 1CQVA 1KDCA 5EPLA 5J39A 1LABA 3NPPA 2A6HC 1IL8A 2EZVA 3HGBA 2F0DA 5IT9L 4M1UB 3HZXA 4HAEA 3MTSA 2JEBI 5FOBB 3SVMA 5CR3A 2TMPA 1G8ZD 4H0LC 1EIHA 3RZOB 4IUNA 3MXPA 1KNAA 1STNA 1CK1A 5FK9C 1HHVA 1SBBB 4IN3A 1NR2A 4PMCA 1A6XA 4XYQA 2AQ2B 1A3TA 4DK0A 1SXTA 1QWYA 2F0OA 3OHXC 2PO4A 1BCPD 3BYYB 2WINB 1Y69U 2KCNA 2R6GA 2R7ZB 4NW2A 1PRTD 2JSOA 1SNCA 3AB9A 3RUZA 1BCPC 1S5ED 2Z4HA 2PZUA 4QCLA 5CV9A 2O4XA 1SYBA 1F9QA 1FR3A 3H0GB 1JWSD 3TP6A 3QOLA 2CW0D 4QMGA 1GHJA 1GJXA 2RQXA 3GQBA 1PRTC 2Z8LA 4HEDA 4DXFA 2NN6I 3GV6A 4PQXA 4C3IG 2B2UA 1CZGA 1S5DD 1STHA 1I6HB 4IUTA 2K05A 3X3MA 3T53B 2CVRA 2CW0C 5T1GA 3J7AF 2E2HB 5LHY1 2PNRC 3SR1A 2ZXOA 4HTHA 5C5LA 4FF2A 3EQLC 4XT1B 4HR7B 3PUYA 1Y1WB 2MP1A 1Q12A 1MD2D 4LMQD 4MN3A 3SK6A 3GTPB 1LT3D 4IUQA 2VUMB 5JOBA 4ZYSA 1F2YA 1LACA 4HMJA 5COYA 2OEOA 4KKUA 1H9JA 3J81E 3DWAA 1K83B 1PZKD 1EFID 3GV3A 5C3WA 1PFNA 3D4DA 4CGYB 4C1NI 1BOSA 2R93B 2F0PA 1L0YB 3D6WA 1X32A 3NBIA 5C6AA 1SNMA 3OPOA 1G2TA 3BG3A 2B2TA 5IGCA 2E2JB 2ICEC 4XXEA 3IFDA 4S3SA 1JOKA 5I6YA 2K28A 1I4QA 5KGUA 3DMUA 3PV0A 2KEDA 3ZYYX 3F2UA 1RJTA 1SAPA 2ZT9C 4TRDA 2MUYA 1CQFA 2LFNA 2AQ3B 4WJWA 3T4AC 4A3FB 4J1MA 4F7XA 1CZWA 1Z47A 3KK7A 1MGSA 2QKIC 3VYRA 3S1NB 3S17B 3PUXA 4RCOA 1SDFA 3M4OB 5C3XA 2F0EA 2XRQD 2G9DA 5JPMC 1EEFD 4OO1I 3NHHA 2N55A 2Q8IB 5D65A 2K6AA 1HCZA 3AMUA 5M3MB 1BBXC 3PMFA 1WTVA 4FO2A 1SJED 1Q1EA 5E1FA 4FXDA 2OXPA 1JQYD 2L9HA 3DWQA 2EPBA 2L55A 3Q23A 1PZID 2XNAC 4EQOA 1DM0B 1FD7D 2A68D 2MHVA 3A55A 3D31A 1J9OA 4R8IA 1A3UA 1ZXTA 3OWFA 1IYVA 2HDLA 3NQTA 2B8GA 2RA4A 1H9KA 1GXDC 4B9XA 2A68C 1NUCA 4WRDA 3S1RB 3RLFA 3BS1A 2NUCA 5HGTA 5F2DA 5EJWA 1MSGA 2K33A 1DOMA 3H3VC 1AZPA 1F2LA 2R3ZA 4ILWA 1LTID 3SXHA 5JEAH 4K2KA 2VB3X 1FYCA 1OXSC 1UAPA 1BR9A 3QO2A 4KY7A 3NTHA 1B9MA 3CU7A 1F2ZA 1MSHA 2KA7A 1PYWD 1RDPD 2O5IC 2EYHA 3UI2A 3VR5A 3URYA 2EE1A 1U4PA 1JOOA 1MBYA 1ENCA 2K32A 4K6LA 2PZWA 3MVVA 5EBDA 1HA5A 2M00A 1PFBA 3AU7A 2WACA 3VR4A 3CKIB 2B39A 3ITPA 2C5CA 5D3IB 1ML0D 2NB0A 4HCEA 3KBGA 5C0XI 1CHPD 2ID0A 4FP5D 1JC7A 4H13C 1DXMA 2RDGA 3V2TA 5JAVA 3PO3B 2KQ3A 2WIIB 1CA5A 4ZUIA 1L0XB 1FGBD 1D5ZC 3K57A 3HP3A 1R4QB 2B2TC 2RVLA 2B2YA 4TSSA 5KNDA 1EQTA 3S1MB 1B53A 2SDFA 5K36G 1EL0A 1I3QB 1PTOF 4XQJA 1XYIA 2Y0SB 2CQAA 1Y8NB 3J80L 3T13A 3SK4A 4N9TA 2L12A 3ND9A 2B8FA 3EJIA 3S16B 1Y8OB 4RGTA 2F0UA 1NCVA 3FDTA 4K2LA 1AP0A 4KKTA 1U4MA 2JE6I 4EVOA 5ELDA 2LKVA 2E75C 3CQZB 3H91A 4C3JB 3KLSA 3BVZA 1TU2B 2IX0A 2R61A 3MC0B 4PV1C 3GTLB 5DM63 3V05A 3K0YA 4OO1H 4HSVA 1G2SA 5BN4A 4ZLTF 1TWFB 4CKEA 4MIUA 4RCNA 1LT5D 1FNUA 1ESRA 1W6KA 1U4RA 1O80A 2F0VA 5AFWA 2NZ1D 3TMEA 3TP7A 3P20A 2DN8A 1Q90A 1ILQA 5E4WC 2IX1A 2F0GA 2EYMA 3R2IA 1D6EC 2QF7A 1K8OA 3T16A 1OXVA 1KLGD 4IFDJ 1Q8IA 4A3GB 5CORA 2ICIA 4JBWA 4KHZA 2GA4B 4L6TB 5KEEA 3DM1A 4IFDI 1GUNA 2NWGA 4QUFA 4A3MB 1KTKA 3WOEA 5CV4A 5DM73 4K14A 5J22A 2XRSD 1LLRD 4EGVA 1V1PB 4JK1C 1SE4A 3PIO3 5E3FA 1KDBA 4KN4C 3N52A 1S5CD 3O13A 4C2MB 4C3HB 3CHBD 1CI3M 1VMPA 2A74C 2SNSA 1SNQA 1WD0A 5IGGA 4G4KA 4TKOB 5FLXL 2EYFA 3RD4A 3BZDB 2F0TA 4WORA 3K58A 2K03A 1EIGA 4ZRZA 3Q6SA 4FF1A 2K01A 1GUSA 1STBA 3EFXD 4A3BB 4U68A 3I8ZA 1LTBD 3S15B 2AQ1B 5EKLA 3G7LA 2RSNA 5IT9E 4G7OC 2F0SA 4IUUA 4KJOA 2XWJB 3C1EA 3U9OA 3GP7A 1XTCD 4J6HA 1EY8A 4QUCA 4DU9A 1TWHB 3FPPA 1M8AA 2RKSA 3C3LA 2WKCA 1DD2A 4RHRA 2PCFB 1G91A 1Y8PB 5C0XH 1TS5A 4J8QA 2QDBA 1C8CA 4QB4A 4AYBB 1D1IA 3KF8A 4Q0FA 2B2YC 2MPMA 1O78A 1II3A 4XYOA 1CM9A 4X3UA 1JE4A 1PTOB 5JEAG 5LL6X 4P2CB 5JEAJ 2NN6G 1XX8A 2KUMA 4QIWB 2PMZB 1DONA 1EYAA 4Q5VA 3ND8A 1EY0A 1I50B 5K36H 1F9PA 4XQNA 3HOUB 2PYKA 3NQIA 5G3LF 3T51B 3J7AV 4RFBA 3FKIB 1LTGD 1V43A 5KIXA 1QCBD 3LX0A 4KD4A 1JWUD 4I7ZC 4B9WA 5IODA 2J0TD 1S5FD 1TIID 3R2TA 1WTXA 3HOVB 5FO9B 5I9PA 4K5XA 5J1ZA 2B2WC 4HCSA 3IFTA 4F87A 4CJ0B 4DGZA 2BCOA 1TT2A 3GO5A 5D3DA 1BUVT 1SJHD 3TBIB 3NE5B 1IHZA 4FF4A 1OO9B 1BNZA 4FF3A 5KYIA 4KTAA 4ZUJA 3J81L 2KECA 2F0KA 5A2QE 4Y7NB 1B4OA 2XWBB 3D4WA 3MHBA 3VR3A 1HUNA 2EY1A 2LY7A 1O7LA 1EU3A 2JP1A 1O7YA 5C5MA 1EY4A 3A8JE 2L1BA 4PMWA 4IFDH 1SNDA 4NKLA 3ONAB 4BBRB 2WV6D 1ENFA 5C44B 1HQMC 1EU4A 5I2XA 5I6WA 4KK7A 2B2VC 3SEBA 2H4OA 3I72A 1EZ8A 4K5WA 2SOBA 1VMCA 1RD9D 4OO1G 1FNVA 2KHSA 3DEOA 4KKSA 1TY0A 3I73A 1ZEQX 3FEWX 5M5WB 3QWNA 3W3AA 3K5LA 1K8MA 1X3QA 3JAME 5IGBA 1M4VA 1A2UA 4RGOS 1SSOA 4UAIA 1Z6HA 2JA5B 1QNUA 4RHSA 3BVMA 3HOXB 1KLUD 4DAPA 5KYLA 1JB3A 3RZDB 1QOHA 1UEAB 1ZKOA 1EYCA 4IUPA 5FKAC 4TQUS 2MJ8A 1GOZA 2DNCA 3BDLA 1NAPA 2K1BA 1AN8A 3NWTA 2IJ0A 4A3EB 3S9WA 5TSSA 1QE6A 2D2CC 1CTMA 4RKBA 3QOJA 4MHEA 5HURA 1YNJD 2I07B 2F0WA 2XSCA 2HUGA 3EROA 3MWYW 1Q3LA 5JPNC 4IQZA 5EPJA 4BS9A 4A3JB 2O2LD 2K5WA 4BBSB 1SE3A 4L8JA 1B50A 1YNJC 1QJOA 2YYZA 3TZUA 2BA0A 1D5XC 3MAQA 3TN2A 5CV8A 4K5VA 3GTKB 4FXKC 2AWOA 2F4IA 1V8QA 2PZTA 3VYUA 2F0NA 4DNTB 2EVBA 1F2MA 2NN6H 4L63B 3NTIA 4B08A 1R9TB 2ZXRA 1RKNA 5CC4A 1S4ZA 5EGTA 2JA6B 1BCPF 5IIFA 1AW7A 2AWNA 2SNMA 4O1NA 2VXWA 3WOFA 4GZYC 3H6MA 4C3IB 4ABNA 3NUCA 1A15A 5IGEA 1LT4D 1TS2A 1CT1D 3R93A 2ENBA 2F0QA 5C0XG 4OGQC 2TSSA 3TZDA 2NVQB 3CRKC 5C0XJ 1BO0A 1DJRD 5KNBA 2EYOA 3R3OA 3V96A 2R92B 1B44D 1QILA 5EQ0A 1ET6A 1WD1A 2G9HD 1JICA 1NR4A 1SMYD 4NMZA 1TWGB 3R8BA 3DXJC 4V0BA 1W6JA 2JYOA 4OL7A 3BVGA 3DUZA 1T5EA 2Q8RE 1IW7D 3MFYA 3HOWB 3GTMB 1RODA 2X6GA 5CYUA 3KUPA 4KD3A 1SMYC 1VCIA 3PUVA 4KMUC 4F88A 2F03A 2F0IA 2MGSA 5ELCA 1H9MA 3S1QB 1IW7C 1EY7A 1BDOA 4DA2A 5D14A 1WCMB 4IZ8A 3J80E 2F0HA 5EPKA 4FYDA 1AEXA 1JR0D 2BE5D 1F9SA 2OT2A 1HFGA 1VDZA 4XDXA 1DCZA 1BQQT 4CJ2C 3S2DB 3NBHA 2CHBD 1ET9A 5CBAE 2WAQB 3FRPB 1BXTA 4BY1B 4RA8A 3CRLC 1H9SA 4YIJA 1ILPA 1C4QA 4ZKCB 2NTSA 1PZJD 2N88A 2BE5C 1GUTA 5E4XA 5EBCA 4OIJA 2BA1A 3L3OC 2D5DA 1R4PB 3DWPA 3A8IE 2Q8TA 1JWMD 2ZXPA 2BOSA 3K5NA 2DNEA 4X3KA 1VF5C 2B2WA 2F0FA 3MA2B 2EJGC 2AUKA 2RBMA 2KVMA 3SK8A 4RGMA 2EDGA 4PMBA 4DXGA 4FXGC 3MEHA 4LAAA 4Z9CB 3NTKA 3QIAA 1SNPA 3GTGB 1EEID 3DHQA 4BWGB 1E2ZA 2Z4IA 3PUWA 2EY5A 3TP5A 2X69A 4IALA 3H94A 4X3TA 5C4JB 1J8IA 4WFN3 2FJ2A 2IX3A 3HKZB 1SE2A 4DAVA 4XTCS 1ENAA 3MXGA 1HRJA 2EXZA 3BYTB 4IFDG 1Y1VB 2EOTA 2LS01 1I4PA 3VYTA 1PMRA 1QG7A 4IUVA 4I65A 2FHTA 3I70A 3MFGA 1EY6A 3BDOA 2PW5A 1WTQA 5DAUA 3U9SA 2WB1B 3NK9A 3C2PA 1WTWA 1T5XD 2WKDA 5C4ZA 1EYDA 4KJNA 3A7AB 5EKIA 2RDFA 1EWCA 2E74C 3ERQA 4OIKA 1LTRD 5K5PA 1BCPB 4A93B 2B2VA 1XWEA 1LT6D 5FLXE 1MI2A 4CKCA 3S14B 4ULLA 3QG1A 1PRTB 2EJMA 5DEHA 3KLRA 3E6ZX 4RH6A 3PIP3 5KRUA 3RMHA 3K5OA 1C48A 1DOLA 4C56C 4NP5A 1SYCA 2FFKB 3K6OA 4EQPA 2F0MA 1HPCA 2NVTB 1RF2D 1G6ZA 3GTOB 4PNYA 4U673 2V4DA 4R9WA 2BDOA 5C3EB 3OSOA 2XIWA 1TY2A 5ELEA 3D3RA 4H7BA 3KLSX 4KV6A 4IURA 1LTAD 3D8GA 3HS0C 3OMGA 3A8KE 3OIQA 3QJYA 3A56A 4NDXA 5I2YA 3OIPA 2EY6A 1KDAA 2JEAI 2NTTA 1GHKA 3I3CA 1SFOB 3EA6A 1I6VC 3LWEA 1PTOH 3IKJA 3SDZA 4ZK9B 2L5TA 1X3PA 4KHVA 2XVSA 1RCVD 4OHJA 3S2HB 4RWSC 3SE0A 2K7VA 2IWHA 1YNND 2JXMB 1ESFA 4QF4A 3NXWA 4UDUC 1STGA 1OXXK 1SYFA 3N6RA 2HCIA 5IGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IL8 A;  1G91 A;  1ILQ A;  2KVM A;  5E4W C;  2B2U C;  1PDQ A;  1DOL A;  2B2Y A;  1F9Q A;  2K28 A;  2D9U A;  1BNZ A;  1EQT A;  2FFK B;  2M2L A;  1U4L A;  1DZ1 A;  4IUP A;  1B53 A;  1C8C A;  1WTO A;  2DY8 A;  1QNK A;  1EOT A;  2MJ8 A;  2SDF A;  4HED A;  5EQ0 A;  1EL0 A;  1NAP A;  2K1B A;  3DEP A;  5EJW A;  3GV6 A;  5COR A;  1WD1 A;  2KEC A;  2KED A;  2B2Y C;  1JIC A;  1MSG A;  1QE6 A;  2B2U A;  1NR4 A;  2DY7 A;  2HDM A;  3F2U A;  5CBE E;  2MPM A;  2X69 A;  1RJT A;  3DM1 A;  1ICW A;  4X3T A;  2NWG A;  1B4O A;  1TVX A;  4IUT A;  1KNE A;  1CM9 A;  1SAP A;  1DOM A;  2J7Z A;  2KOL A;  2K05 A;  4MHE A;  1JE4 A;  2K04 A;  4X3U A;  4QUF A;  2FJ2 A;  2JYO A;  3IL8 A;  1AZP A;  1WVL A;  1F2L A;  1B2T A;  2CVR A;  1G6Z A;  2R3Z A;  5T1G A;  1HUN A;  5T1I A;  2L4N A;  2Q8R E;  1PLF A;  2X6L A;  1HRJ A;  1XX8 A;  2KUM A;  1XYI A;  2HUG A;  4R9W A;  4XT3 B;  3MWY W;  1ROD A;  2X6G A;  2L12 A;  1HA6 A;  2XIW A;  3KUP A;  2FMM A;  3FPU B;  3N52 A;  4XT1 B;  5EPL A;  2JP1 A;  1Q3L A;  1WTR A;  1E0B A;  1O7Y A;  1F9R A;  2EOT A;  1MGS A;  4CJ1 B;  2MP1 A;  1VMP A;  2L1B A;  2MGS A;  1DON A;  3QO2 A;  5EPJ A;  1IL8 A;  3ONA B;  4ZKB B;  2HCC A;  1GUW A;  1SDF A;  4LMQ D;  4MN3 A;  1B50 A;  1NCV A;  1F9P A;  1QG7 A;  3FDT A;  4IUV A;  4IUR A;  1WD0 A;  1RHP A;  4IUQ A;  1RTO A;  3MTS A;  1MSH A;  4HAE A;  4RAU C;  3TN2 A;  2FHT A;  3SVM A;  5D14 A;  1AP0 A;  2N55 A;  1U4M A;  3KBX A;  4O42 A;  5EPK A;  5COY A;  1WTQ A;  1J8I A;  1B3A A;  1EIH A;  2K03 A;  5D65 A;  1WTW A;  1O7Z A;  1PFM A;  3I3C A;  2B2V C;  1EIG A;  3H91 A;  3UI2 A;  3Q6S A;  1F9S A;  2EE1 A;  1KNA A;  5CMD A;  1U4P A;  1HFG A;  1LV9 A;  2K01 A;  4XDX A;  4CJ2 C;  1IKM A;  3LWE A;  1BBX C;  1WTV A;  1VMC A;  2RSO A;  5CBA E;  2L11 A;  3I8Z A;  4U68 A;  4ZK9 B;  1HHV A;  5JJZ A;  5EKI A;  1S4Z A;  4ZAI A;  1X3P A;  3DEO A;  1CA6 A;  2KEE A;  4RA8 A;  1NR2 A;  2BDN A;  3GV3 A;  2L9H A;  4OIK A;  3I90 A;  1ILP A;  4DN4 M;  3G7L A;  4HSV A;  2RSN A;  2B2V A;  4ZKC B;  1PFB A;  2EPB A;  1PFN A;  1G2S A;  2NYZ D;  4ZLT F;  1WTX A;  2N88 A;  2H1E A;  5E4X A;  2FIN B;  2VXW A;  4RWS C;  5DNF A;  1MI2 A;  4OIJ A;  1DOK A;  4IUU A;  1ML0 D;  3D6W A;  1X32 A;  1IKL A;  1BF4 A;  2B2W C;  1J9O A;  1HFN A;  1X3Q A;  1G2T A;  4HCS A;  4R8I A;  2B2T A;  3P7J A;  1ESR A;  4CJ0 B;  2Q8T A;  1ZXT A;  1A15 A;  4QUC A;  1SSO A;  2HDL A;  1U4R A;  4NW2 A;  4UAI A;  1O80 A;  1M8A A;  5AFW A;  1AZQ A;  2NZ1 D;  3R93 A;  3I91 A;  3IFD A;  4X3S A;  4X3K A;  1CA5 A;  2HCI A;  2RA4 A;  2B2W A;  3TZD A;  1HUM A;  1RTN A;  3HP3 A;  1WTP A;  2B2T C;  2RVL A;  1BO0 A; 
#chains in the Genus database with same CATH topology
 3VR6 A;  1N32 L;  1YNN C;  1PDQ A;  4HMI A;  1Y1W H;  3OMC A;  5IGD A;  1HNX L;  1U4L A;  3VA7 A;  1GVP A;  3D4R A;  1QNK A;  1NSN S;  2B63 B;  2EYJ A;  1U9R A;  2EXD A;  1O7I A;  1STY A;  4ALP A;  2VUM H;  4JCV E;  5CBE E;  2NVY B;  1MJE A;  1ICW A;  1VQG A;  3CD6 A;  4XQQ A;  3M7N A;  3KJP A;  2IPK D;  1WOC A;  1EIF A;  1PTO D;  4AQY L;  3M85 A;  5JVH 3;  3EVQ A;  1B70 B;  4JI3 L;  4FNF A;  4C1N K;  4DV3 L;  4JV5 Q;  2F0J A;  2VB2 X;  2FMM A;  3GTJ B;  4KN7 C;  1WTR A;  1E0B A;  4K8J A;  1GUO A;  5CV7 A;  4ZKB B;  1I4G A;  1FVI A;  1PTO C;  2KCC A;  2K5Q A;  1D1K A;  1M90 C;  1AH9 A;  5I9O A;  4JI1 L;  3KDF A;  4RGN A;  1C9O A;  2Y0S G;  2E2I B;  4Y7N H;  1KAA A;  3L9A X;  3PO2 G;  1N34 Q;  2FXQ A;  5CMD A;  1N9W A;  3AFQ A;  3L7Z C;  1JB7 A;  3PF5 A;  1Q81 C;  3HOY B;  2ALY B;  2RSO A;  2HQL A;  1HTL D;  5A2Q L;  4ZAI A;  2O5J C;  2KEE A;  4LF4 Q;  3T56 B;  5I4D A;  3WDN A;  3CCV A;  3FMC A;  1S5B D;  4DN4 M;  2IY5 B;  1YVC A;  4A3L H;  1M1K C;  3KF8 B;  2H1E A;  2WP8 J;  3BDC A;  2I46 A;  2QW7 A;  4DK1 A;  5IP9 G;  3PUZ A;  1X56 A;  2Q2I A;  3MXU A;  4IPH A;  3IAY A;  2DUD A;  1JJC B;  4BBR H;  4DV4 Q;  4ME3 A;  1HFN A;  1VQC A;  5IYC H;  5KNC A;  4F8M A;  2VW9 A;  3OWE B;  3JAM i;  4GKJ Q;  5C44 H;  4C3J G;  1NE3 A;  4LNQ A;  4X65 L;  4X3S A;  3CXC A;  1S40 A;  5CGK A;  1XNR L;  2VQF Q;  4LFC L;  3EBE A;  1RTN A;  4RKL A;  2QEJ C;  2IL8 A;  1H9R A;  3S1N H;  1GD7 A;  1LO5 D;  1ZYR D;  3FP9 A;  2RCN A;  3M4O H;  1WTO A;  5CV6 A;  4P75 A;  3LGJ A;  1CKO A;  2OF1 A;  4DR3 L;  3NP8 A;  2DY7 A;  2HDM A;  3UDX A;  4OEM B;  4A3I B;  1TVX A;  4M8A A;  4DV7 L;  2EYP A;  2J7Z A;  1HH2 P;  2MQH A;  4ODG A;  1ZYR C;  2L4N A;  1E2V A;  5LL6 S;  3GTQ B;  4OEL B;  5ISR A;  1I94 Q;  1PYB A;  4WJ3 M;  2JA5 H;  1D5M C;  3JAM L;  1JOQ A;  3CC7 A;  1F77 A;  2EY2 A;  1EIY B;  1G29 1;  2ZTD A;  1F9R A;  4DV5 L;  2HCC A;  4K8I A;  3RZD H;  2Z1C A;  5IY0 A;  4LFB L;  1WTH A;  1SYE A;  1EZ6 A;  1JCK B;  2YTX A;  4KY6 A;  1RHP A;  2JA8 B;  4O42 A;  4BA2 I;  1B9N A;  1KAB A;  1B3A A;  4A3E H;  4A3M G;  1OXU A;  1UE7 A;  1PFM A;  1OXT A;  4CHT B;  2E76 C;  1QB5 D;  4JOI C;  2F0L A;  3I4L A;  1NMF A;  3G6J B;  2QCP X;  3VYS A;  1I4R A;  1TXY A;  4DAY A;  5M3F B;  1IYU A;  1UNS A;  4FVM A;  4JBM A;  1A2T A;  5JJZ A;  1QVC A;  1CA6 A;  2F1M A;  3I90 A;  4C3H G;  2UUC L;  3S1R H;  2NYZ D;  1FNW A;  3VA5 A;  2FIN B;  1HZA A;  3BU2 A;  2IHF A;  4JG2 A;  4A3J H;  4G57 A;  1BF4 A;  1EWH A;  4OWX B;  3U4V A;  3OOC A;  4YWL A;  3A54 A;  3C46 A;  5JVG 3;  3NEM A;  5HGQ A;  4DNR B;  1EY9 A;  1AZQ A;  3CPF A;  5LMU L;  3CMA A;  4A3B G;  3X3N A;  1I4X A;  4LF9 L;  5LMN L;  3K5M A;  5AJ3 Q;  4G7H C;  3SK5 A;  2SEB D;  2K4K A;  2B2U C;  5CV5 A;  3AFP A;  3K59 A;  1R9T H;  1PH6 A;  2D9U A;  1V1O A;  2M2L A;  2JA7 B;  1TKW B;  5ELB A;  3TS2 A;  2IW3 A;  2DY8 A;  3F2B A;  1PRT F;  1D2B A;  3DEP A;  3FVQ A;  5C4H A;  2PPB C;  2YU9 B;  3I4N B;  1TWA B;  4ID6 A;  1TQO A;  3C1F A;  3CC4 A;  2EJF C;  1X65 A;  4A3D B;  2XN9 C;  1HJP A;  1CFM A;  1Z7T A;  3F8T A;  4HSP A;  3D6C A;  4C3I H;  1PFS A;  1N33 L;  4B3T Q;  3IL8 A;  1WVL A;  1QUQ A;  1ONL A;  5T1I A;  5ELO A;  2X6L A;  3GD7 A;  1B7Y B;  3LWU A;  1SEB D;  2PW7 A;  3FPU B;  1VQ4 A;  3Q22 A;  4CJ1 B;  3SHL A;  2OTL A;  1STE A;  3K7A B;  4PZ8 A;  3NWS A;  3Q24 A;  4JI8 L;  4AYB G;  3H15 A;  1TS4 A;  1JOR A;  1JMC A;  4E6I A;  4RAU C;  1RTO A;  2R7Z G;  2R92 H;  1SNO A;  2VNU D;  2PQE A;  4DFA A;  3KBX A;  2NBF A;  5FO8 B;  2M9V A;  5FLM G;  3PO3 H;  2A69 D;  3VR2 A;  4A3K B;  5G3L D;  4HJ9 A;  1LTS D;  2K5D A;  2J4X A;  3M4Y A;  3H0G G;  2D0O A;  4KHP Q;  3OW7 A;  1HR0 Q;  1GUG A;  2A5H A;  3TDQ A;  4FDB A;  2BDN A;  1V1P A;  3HG9 A;  3HOW H;  1PH2 A;  3GTM H;  3P75 A;  3S1M H;  2A6E D;  1Q1B A;  5A35 A;  3CCU A;  1VQH A;  2EYL A;  2A69 C;  3E3X A;  3HOU G;  1DOK A;  4K6D A;  2JK8 A;  3ULL A;  1JJ2 A;  4GLX A;  4LFA L;  2AUJ D;  3S1Q H;  4JV5 L;  5NUC A;  5IP7 H;  3P7J A;  4BA1 I;  5JJI A;  4KY5 A;  1CHQ D;  4OWT B;  4LJZ C;  3AYH B;  2A6E C;  1OTC A;  2KJX A;  3W2D A;  3VDY A;  2N49 A;  5IOC A;  2F3W A;  1Y1W G;  5EKK A;  1KRS A;  1HUM A;  1L1O C;  4AIM A;  1HQR D;  1WTP A;  3PO2 B;  3LNN A;  2LXK A;  3S16 H;  4BY7 B;  4JI5 Q;  4OWW B;  2N8N A;  1EY5 A;  5BN3 A;  5C4X B;  2VUM G;  3K8A A;  3HOV G;  4CBV A;  1IBL Q;  1VQE A;  1PXU A;  1I4H A;  1T9H A;  2GVA A;  2L15 A;  4KI0 A;  4GS3 A;  2VQE L;  3J7Z C;  1K8G A;  4ZQ3 A;  2K04 A;  2NVX B;  4MZ9 A;  4LK1 C;  2D62 A;  1SRU A;  1X3G A;  3CW2 C;  4GN5 A;  1PLF A;  1LTT D;  5ELF A;  3E0J A;  4XT3 B;  4DV4 L;  1SYG A;  2JN4 A;  1HA6 A;  1HTP A;  1XXG A;  4MTK A;  4R8N A;  1SMX A;  2FMC A;  4H44 C;  4JYA Q;  4XIG S;  4GKJ L;  4CKB A;  1TWC B;  1GUW A;  3MZ5 A;  1TWF H;  3M7G A;  2F4V L;  4YCW A;  2VQF L;  2KHJ A;  3J7Y W;  4UY8 C;  4EQN A;  2Q2H A;  3P1H A;  3RN5 A;  1O7Z A;  5C4J H;  3MXN A;  3I4M B;  1LV9 A;  1UE5 A;  1IKM A;  4LF6 Q;  1K3B C;  4N9P A;  4DF7 A;  4NPS A;  1E2W A;  4G7Z C;  2L11 A;  1KRT A;  2HHH L;  4A3L G;  2MNA A;  3H09 A;  4R4C A;  4J15 A;  3NSW A;  5M5Y B;  1U0L A;  1Y1V H;  2GVB A;  1FJG L;  2AKW B;  3M3Y B;  1Q8K A;  4BBR G;  5DNF A;  2K52 A;  4A3G H;  4DR7 Q;  1I94 L;  1A3V A;  1IKL A;  1LTL A;  1RIP A;  4V19 0;  5BN5 A;  3Q0A A;  1UUP A;  5C44 G;  1B1Z A;  1STA A;  4GOP B;  4HN7 A;  1YEZ A;  1PHJ A;  3E9I A;  3JAM c;  3T1H L;  1TR5 A;  3A7L A;  1E3P A;  1VF7 A;  2F3V A;  2A73 B;  3QB3 A;  3I91 A;  2RDH A;  4JI2 L;  3HOZ B;  1XMQ Q;  2IT1 A;  4DR5 Q;  3HEJ A;  2C9O A;  3TP8 A;  5M9O A;  1DZ1 A;  1W3S A;  1EOT A;  4A93 H;  2L0C A;  2UUB Q;  1DYQ A;  3E5S A;  1NNX A;  1N36 Q;  2E2D C;  4ME5 A;  1AFP A;  1TS3 A;  4K0K Q;  1HXY D;  2A6H D;  2LMC B;  1SYD A;  1KNE A;  2KOL A;  1X55 A;  3S14 H;  1B2T A;  4A76 A;  2JA5 G;  3TSS A;  3HRZ C;  5FO7 B;  5M5X B;  1KL9 A;  2QIL A;  1H9S B;  2HQE A;  1EQV A;  3UDI A;  3S15 H;  1CQV A;  1KDC A;  4MNO A;  4YCV A;  5EPL A;  4L5T A;  4EQ5 A;  1WFQ A;  5J39 A;  1LAB A;  3NPP A;  4LF7 Q;  2A6H C;  1HNW L;  1VQF A;  2VZA A;  1IL8 A;  2EZV A;  3HGB A;  2F0D A;  5IT9 L;  3KF6 A;  4M1U B;  3HZX A;  4A3E G;  4HAE A;  3MTS A;  2JEB I;  5FOB B;  3SVM A;  5CR3 A;  2TMP A;  1G8Z D;  1VQ9 A;  1LM0 A;  4H0L C;  1EIH A;  4KLK A;  3RZO B;  1TWH H;  4IUN A;  3MXP A;  2NVT H;  2N78 A;  3E0E A;  1KNA A;  1STN A;  4GNX C;  3BJU A;  4PG3 A;  5EAY A;  1CK1 A;  5FK9 C;  1HHV A;  1CKN B;  1SBB B;  2XGT A;  4IN3 A;  1JT8 A;  1NR2 A;  4PMC A;  1A6X A;  5C3E H;  4XYQ A;  2AQ2 B;  1A3T A;  3W1B A;  4DK0 A;  1VQI A;  1SXT A;  4A3J G;  1QWY A;  2F0O A;  3OHX C;  2PO4 A;  1BCP D;  3BYY B;  1WYD A;  1YHB A;  2VS1 A;  3I4O A;  5DLQ E;  2WIN B;  4LF5 Q;  4NB3 A;  1Y69 U;  2KCN A;  2R6G A;  3TEH B;  2CQO A;  3G4S A;  2R7Z B;  4NW2 A;  1L2F A;  1PRT D;  2JSO A;  4JI0 L;  1SNC A;  3AB9 A;  3RUZ A;  1BCP C;  1S5E D;  1NJI C;  2Z4H A;  2PZU A;  4DV0 Q;  4JVZ A;  4QCL A;  5CV9 A;  2O4X A;  1CSP A;  3IRB A;  3OYY A;  1SYB A;  1F9Q A;  1VQP A;  1FR3 A;  3H0G B;  1JWS D;  1SR3 A;  3QOL A;  3TP6 A;  2CW0 D;  4QMG A;  3CCM A;  1GHJ A;  1SE8 A;  1GJX A;  1I50 H;  2RQX A;  3GQB A;  1PRT C;  2Z8L A;  4HED A;  4DXF A;  2NN6 I;  3GV6 A;  1K28 A;  4PQX A;  4C3I G;  2B2U A;  1XPU A;  1CZG A;  1XNQ Q;  1S5D D;  1STH A;  1I6H B;  3FKI H;  4IUT A;  2K05 A;  2UXD Q;  3X3M A;  5JJL A;  1BVS A;  3T53 B;  2CVR A;  2CW0 C;  5T1G A;  4P72 A;  3J7A F;  2E2H B;  5LHY 1;  2PNR C;  3SR1 A;  4R4Q A;  2ZXO A;  4DAM A;  4HTH A;  3UDF A;  5C5L A;  4FF2 A;  3EQL C;  4XT1 B;  4HR7 B;  1UE1 A;  3PUY A;  4POF A;  1Y1W B;  2MP1 A;  1Q12 A;  1MD2 D;  3HOV H;  2R92 G;  4LMQ D;  4MN3 A;  4NXM L;  3SK6 A;  4UP7 A;  4WJ4 A;  3GTP B;  1LT3 D;  4IUQ A;  3PO3 G;  2VUM B;  3CPW A;  5JOB A;  4YY3 Q;  4ZYS A;  3I55 A;  1F2Y A;  1LAC A;  4HMJ A;  5COY A;  4JI5 L;  2Z6K C;  4DR2 Q;  3CCE A;  2NVY H;  4DR6 Q;  2R7F A;  2OEO A;  4KKU A;  1JJG A;  1IBL L;  1H9J A;  3HOW G;  3KYH C;  3J81 E;  3DWA A;  1K83 B;  1PZK D;  3CME A;  1EFI D;  3WWV A;  3GV3 A;  2ES2 A;  5C3W A;  4JI7 Q;  4HIO A;  2UXC Q;  4LWC A;  1PFN A;  3GTJ H;  3D4D A;  4CGY B;  1WI5 A;  4C1N I;  1BOS A;  2R93 B;  2F0P A;  1L0Y B;  5IP7 G;  4X64 Q;  3D6W A;  1X32 A;  3NBI A;  5C6A A;  1SNM A;  1IYJ B;  1WCM G;  1MHW C;  3OPO A;  1V1Q A;  2RHS B;  1G2T A;  3BG3 A;  4X6A H;  2B2T A;  4JYA L;  4LW1 A;  5IGC A;  2E2J B;  2OCE A;  4A75 A;  4PZ6 A;  1CSQ A;  2ICE C;  4XXE A;  2QGQ A;  1YHQ A;  3IFD A;  2WAQ G;  2D0P A;  4S3S A;  1IBM Q;  3HOY H;  1JOK A;  5I6Y A;  2K28 A;  4P74 A;  3I56 A;  4L5Q A;  4CDC C;  1S72 A;  1K3R A;  1I4Q A;  4RG1 A;  4LF6 L;  5KGU A;  3DMU A;  4OX9 Q;  1L1O A;  4AH6 A;  1HNZ Q;  3PV0 A;  2KED A;  2MO1 A;  2Y0S E;  4QY7 A;  3ZYY X;  3F2U A;  4GKK L;  2OTJ A;  1RJT A;  4DK3 C;  1SAP A;  2ZT9 C;  3HFZ B;  4TRD A;  2MUY A;  1CQF A;  2LFN A;  2AQ3 B;  4X62 Q;  4DR7 L;  4WJW A;  2ZJR A;  3T4A C;  4A3F B;  4J1M A;  4P71 A;  4F7X A;  1CZW A;  1Z47 A;  3KK7 A;  1MGS A;  2QKI C;  4GN4 B;  3VYR A;  3S1N B;  3S17 B;  3PUX A;  4RCO A;  1SDF A;  3M4O B;  4HJ7 A;  5M5W H;  5C3X A;  2F0E A;  5GAE C;  2XRQ D;  2G9D A;  5JPM C;  1XMQ L;  1GM5 A;  1EEF D;  4OO1 I;  4R4O A;  3NHH A;  2N55 A;  2UU9 Q;  2Q8I B;  2UUA Q;  1ICF B;  3HKZ G;  5D65 A;  2K6A A;  1HCZ A;  3AMU A;  5M3M B;  1BBX C;  3PMF A;  1WTV A;  1P8L A;  2BH8 A;  3HOX H;  4CDF C;  4FO2 A;  4EX5 A;  1SJE D;  1Y1V G;  3OTO Q;  3CCL A;  4BXX H;  1Q1E A;  5E1F A;  3GTQ H;  4FXD A;  2OXP A;  4K0K L;  1CUK A;  1JQY D;  2L9H A;  1B3Q A;  4A3G G;  3U50 C;  3DWQ A;  2EPB A;  2L55 A;  1VQO A;  3Q23 A;  4HJA A;  1PV4 A;  4DV6 Q;  1PZI D;  2XNA C;  4EQO A;  2LSS A;  1HZC A;  2KEN A;  5FLX c;  1DM0 B;  1FD7 D;  2A68 D;  2MHV A;  3A55 A;  3D31 A;  1HR0 W;  4QGU A;  1J9O A;  4R8I A;  1XTD A;  2WB1 G;  1A3U A;  1ZXT A;  3OWF A;  1IYV A;  2HDL A;  3M4Q A;  2JA8 H;  3NQT A;  2BH2 A;  2B8G A;  1VQK A;  2RA4 A;  1H9K A;  1IXR A;  1GXD C;  4B9X A;  4IPG A;  5M3F H;  2A68 C;  2HD3 A;  5IT9 c;  1IZ6 A;  4A93 G;  1NUC A;  4QJF A;  5IWA L;  4DUY Q;  1BBU A;  4WRD A;  3CCR A;  4DR4 L;  3S1R B;  2PI2 E;  4BBS H;  2Z6B A;  3RLF A;  3BS1 A;  2NUC A;  4JBJ A;  5HGT A;  5F2D A;  5EJW A;  1SRO A;  1XPR A;  3GTK H;  3UE0 A;  1MSG A;  1RL2 A;  4DR1 Q;  5J3B A;  1X54 A;  2K33 A;  1DOM A;  4OXP A;  3H3V C;  1AZP A;  1F2L A;  2R3Z A;  4ILW A;  1LTI D;  3Q8D A;  3SXH A;  4X66 L;  4K2K A;  5JEA H;  2JA6 H;  1PYS B;  2VB3 X;  1FYC A;  1OXS C;  5BR8 L;  1UAP A;  3KOJ A;  1BR9 A;  3QO2 A;  4CDE C;  4KY7 A;  3NTH A;  2JA7 H;  1B9M A;  1PVO A;  1IL2 A;  4YHH L;  3CU7 A;  1F2Z A;  4DV0 L;  1MSH A;  1XMO L;  2KA7 A;  1PH4 A;  1PYW D;  1RDP D;  2YU9 H;  2O5I C;  3I4N H;  2EYH A;  5GRO A;  3UI2 A;  3VR5 A;  3URY A;  5FJ8 H;  2QEX A;  4A3D H;  4B3S L;  2EE1 A;  1U4P A;  1JOO A;  1MBY A;  2NVQ H;  4JPB W;  1ENC A;  2K32 A;  4JC0 A;  4K6L A;  5C3E G;  1E1T A;  2PZW A;  2YV5 A;  1XNQ L;  3MVV A;  5EBD A;  1HA5 A;  1ASZ A;  4H02 A;  2UXD L;  2M00 A;  1PFB A;  1A62 A;  3AU7 A;  2WAC A;  3G71 A;  4JI6 Q;  3VR4 A;  4GNX A;  3CKI B;  2B39 A;  3G48 A;  3ITP A;  2C5C A;  5D3I B;  2K14 A;  3RLO A;  1ML0 D;  2NB0 A;  2H5X A;  3K80 C;  1Q7Y C;  4HCE A;  3KBG A;  5C0X I;  3J80 i;  1CHP D;  1TWG H;  1X3F A;  2ID0 A;  4FP5 D;  1JC7 A;  4H13 C;  1YJN A;  1VQJ A;  4DV1 Q;  4DV2 Q;  3BZK A;  1EYG A;  1DXM A;  2RDG A;  3V2T A;  5JAV A;  3PO3 B;  1NTG A;  2KQ3 A;  2WII B;  2HT1 A;  3ZJY C;  1Y14 B;  2KCT A;  1CA5 A;  4ZUI A;  1L0X B;  1FGB D;  1D5Z C;  3K57 A;  3HP3 A;  1R4Q B;  2B2T C;  2RVL A;  3ER0 A;  3CC2 A;  2B2Y A;  4POG A;  4AYB E;  4TSS A;  5KND A;  4DR2 L;  1EQT A;  3S1M B;  1B53 A;  1PH7 A;  2B3G A;  1Q82 C;  4DR6 L;  2ZM6 Q;  3QR8 A;  3I7F A;  2SDF A;  5K36 G;  1EL0 A;  1I3Q B;  1PH1 A;  3FKI G;  1VQ5 A;  2F52 A;  1WCM H;  3E9H A;  2ZJQ A;  1PTO F;  4XQJ A;  3UDG A;  1XYI A;  2UXC L;  2Y0S B;  2CQA A;  1Y8N B;  4QIW E;  2HIX A;  3J80 L;  3T13 A;  3SK4 A;  3S2D H;  2PMZ E;  4N9T A;  4OON A;  4BY1 H;  2L12 A;  3ND9 A;  2B8F A;  1N34 L;  2B29 A;  3EIV A;  3EJI A;  3S16 B;  1Y8O B;  2B63 G;  4RGT A;  4LF4 L;  2F0U A;  1NCV A;  3FDT A;  5C4X H;  4HIM A;  4K2L A;  3D0F A;  1IBM L;  1AP0 A;  1K8A C;  4KKT A;  1U4M A;  2JE6 I;  4EVO A;  5ELD A;  2LKV A;  2E75 C;  4JI3 Q;  2E5L Q;  4CDD C;  3CQZ B;  3PCO B;  3H91 A;  4C3J B;  1QVF A;  3KLS A;  3BVZ A;  1TU2 B;  2IX0 A;  2GN5 A;  2R61 A;  1HNZ L;  1VQL A;  2NVX H;  3MC0 B;  4PV1 C;  3GTL B;  5DM6 3;  1VQN A;  2Z6K A;  3V05 A;  3K0Y A;  3CAM A;  4OO1 H;  4HSV A;  1G2S A;  5BN4 A;  4ZLT F;  3GTG H;  4JI1 Q;  3OW2 A;  1TWF B;  1HZB A;  4CKE A;  4MIU A;  4RCN A;  1TWC H;  5HY6 A;  1LT5 D;  2AHO B;  4DK6 C;  3EN2 A;  4A4I A;  1FNU A;  1A8V A;  1ESR A;  2N3S A;  1W6K A;  1U4R A;  1O80 A;  2F0V A;  5AFW A;  2NZ1 D;  4UHV A;  3TME A;  2ATW A;  3HOY G;  3TP7 A;  3P20 A;  2DN8 A;  1Q90 A;  2G5D A;  1ILQ A;  3K0X A;  5E4W C;  3PIO A;  2IX1 A;  2F0G A;  2UU9 L;  2EYM A;  3R2I A;  1D6E C;  5IE8 A;  2QF7 A;  1VQA A;  1K8O A;  3T16 A;  1OXV A;  1KLG D;  4IFD J;  1Q8I A;  4A3G B;  5COR A;  2ICI A;  4JBW A;  4KHZ A;  4DKA C;  3OTO L;  4IO9 A;  4YCU A;  2GA4 B;  5GQO A;  2Q2U A;  4L6T B;  5KEE A;  4X65 Q;  3DM1 A;  4GLA C;  1XNR Q;  4IFD I;  1GUN A;  2NWG A;  4LFC Q;  2OQ0 A;  4QUF A;  4A3M B;  1KTK A;  3WOE A;  5CV4 A;  5DM7 3;  1VQ8 A;  4DV6 L;  2HIV A;  4K14 A;  5J22 A;  2XRS D;  1LLR D;  2UXB Q;  4EGV A;  1V1P B;  1WJJ A;  4N8F A;  4JK1 C;  1SE4 A;  3PIO 3;  5E3F A;  1KDB A;  4KN4 C;  3N52 A;  3M9B A;  1S5C D;  3O13 A;  4DR3 Q;  4C2M B;  1YIJ A;  4C3H B;  3CHB D;  1CI3 M;  1VMP A;  2A74 C;  5IYD H;  2SNS A;  3H3V I;  4R1J A;  4DV7 Q;  4Y52 H;  1SNQ A;  1WD0 A;  4YWM A;  5IGG A;  3NBH B;  4G4K A;  4TKO B;  5FLX L;  2EYF A;  3RD4 A;  3BZD B;  2F0T A;  4WOR A;  4DUY L;  2DJF C;  3K58 A;  2K03 A;  1HZ9 A;  3HOX G;  3CF5 A;  1EIG A;  4ZRZ A;  3Q6S A;  4FF1 A;  4BXX G;  2K01 A;  1GUS A;  2K5N A;  4YWK A;  1STB A;  3EFX D;  3UE1 A;  4DV5 Q;  4A3B B;  4U68 A;  3I8Z A;  4DR1 L;  1LTB D;  5M5X H;  3S15 B;  2AQ1 B;  5EKL A;  3G7L A;  2RSN A;  5IT9 E;  1X3E A;  4G7O C;  1Q46 A;  5AJ3 L;  2F0S A;  2CFM A;  4IUU A;  4KJO A;  2XWJ B;  3C1E A;  3ULJ A;  2DJG C;  3U9O A;  2JA8 G;  3GDE A;  3GP7 A;  1XTC D;  4J6H A;  1EY8 A;  3U58 A;  4QUC A;  3GTO H;  4DU9 A;  1TWH B;  1Q86 C;  3FPP A;  1M8A A;  2RKS A;  2PQA B;  3C3L A;  5M3F G;  2WKC A;  4B3R Q;  3RZO H;  1DD2 A;  4RHR A;  5GAG C;  2PCF B;  4B3T L;  2K75 A;  1G91 A;  4BBS G;  1Y8P B;  4LUV A;  1E7Z A;  5C0X H;  1VQ6 A;  1TS5 A;  4J8Q A;  3CCJ A;  3A74 A;  2QDB A;  1C8C A;  4GOP C;  4GLV B;  4QB4 A;  4AYB B;  1L0W A;  4ZCK A;  3AQQ A;  1D1I A;  3KF8 A;  4DUZ Q;  1JE5 A;  4Q0F A;  2B2Y C;  4IPD A;  2MPM A;  1O78 A;  2CWP A;  5LMU Q;  1II3 A;  4XYO A;  1FL0 A;  1D8L A;  1DGS A;  2I5H A;  4LF9 Q;  1CM9 A;  5LMN Q;  4X3U A;  1JE4 A;  1PTO B;  5JEA G;  1SFO H;  2Q2T A;  3MEF A;  5LL6 X;  4P2C B;  2JA6 G;  5JEA J;  2NN6 G;  4TVA B;  1XX8 A;  2KUM A;  4QIW B;  2PMZ B;  4KHP L;  5ELN A;  1HR0 L;  2JA7 G;  1DON A;  1EYA A;  4Q5V A;  3S2H H;  3ND8 A;  2RHQ B;  1EY0 A;  1I50 B;  5K36 H;  1F9P A;  4XQN A;  4I7A A;  3HOU B;  2PYK A;  1N33 Q;  3HKS A;  3I4N G;  3NQI A;  5G3L F;  3T51 B;  5FJ8 G;  4A3D G;  3J7A V;  1PA6 A;  1KXL A;  4RFB A;  3FKI B;  1LTG D;  1V43 A;  5KIX A;  4LF8 Q;  1QCB D;  1I6H H;  3LX0 A;  3M4P A;  4KD4 A;  4NXN Q;  1JWU D;  4I7Z C;  4JI8 Q;  4B9W A;  5IOD A;  3T1Y Q;  2J0T D;  1PH3 A;  1VQ7 A;  1S5F D;  1TII D;  2CH4 W;  3KFU A;  3R2T A;  1WTX A;  2B63 H;  3HOV B;  3PGZ A;  5FO9 B;  5I9P A;  3J80 c;  4K5X A;  1PH5 A;  5J1Z A;  1IBK Q;  2B2W C;  2CWA A;  3GTP H;  4HCS A;  3IFT A;  4N8X 1;  4F87 A;  4CJ0 B;  4A3K G;  3KLW A;  3B6Y A;  1X6O A;  4DGZ A;  4B3M Q;  2NZH A;  2BCO A;  3S24 A;  1TT2 A;  2AMC B;  3GO5 A;  5D3D A;  1BUV T;  1SJH D;  3TBI B;  3NE5 B;  1IHZ A;  4A3C H;  4FF4 A;  1K83 H;  1OO9 B;  2E5L L;  1BNZ A;  4LFA Q;  4FF3 A;  3KF6 B;  5KYI A;  4KTA A;  2ZTC A;  4ZUJ A;  3J81 L;  2YTV A;  2V1C C;  2KEC A;  1BBW A;  2R93 H;  1K0S A;  2F0K A;  5A2Q E;  4Y7N B;  1B8A A;  1B4O A;  2XWB B;  2Z0S A;  3BZC A;  3D4W A;  3MHB A;  2E2I H;  3VR3 A;  2QA4 A;  1HUN A;  4BY1 G;  2EY1 A;  2E2J H;  4O0A A;  2LY7 A;  1O7L A;  1VQM A;  1QZH A;  1EU3 A;  1E22 A;  4BY7 G;  2JP1 A;  1O7Y A;  5C5M A;  2K5H A;  1EY4 A;  3A8J E;  3A5Z B;  5C4X G;  2L1B A;  4JW0 A;  1YNX A;  1E24 A;  4PMW A;  1J5E Q;  4IFD H;  1SND A;  4NKL A;  2VQE Q;  3ONA B;  3RNU A;  4BBR B;  2WV6 D;  3L0O A;  3JC6 6;  1ENF A;  3ULP A;  5C44 B;  1HQM C;  1EU4 A;  5I2X A;  5I6W A;  2WAQ E;  4KK7 A;  2B2V C;  3SEB A;  2H4O A;  2MFI A;  4O2D A;  3I72 A;  1EZ8 A;  4K5W A;  2MO0 A;  2SOB A;  1VMC A;  3FHW A;  1RD9 D;  2JQO A;  5L37 A;  3H3V H;  1FNV A;  2KHS A;  4OO1 G;  3DEO A;  4KKS A;  2F4V Q;  4IOA A;  4A3F H;  1TY0 A;  2VY3 A;  3I73 A;  1ZEQ X;  3TQY A;  3FEW X;  1K9M C;  2ZTE A;  4DR5 L;  3F1Z A;  1GKH A;  5M5W B;  3QWN A;  2UXB L;  2LXJ A;  3S17 H;  3W3A A;  3K5L A;  1K8M A;  1X3Q A;  3CP0 A;  3JAM E;  1YHA A;  4A3I H;  2UUB L;  5IGB A;  1M4V A;  1N36 L;  1A2U A;  4RGO S;  1SSO A;  4UAI A;  2HHH Q;  1Z6H A;  2JA5 B;  3I4M G;  1QNU A;  4RHS A;  3BVM A;  1S3O A;  3HOX B;  1FJG Q;  1KD1 C;  5M3M H;  1KLU D;  4DAP A;  5KYL A;  3ERS X;  1JB3 A;  2KHI A;  3RZD B;  1QOH A;  1UEA B;  1ZKO A;  1EYC A;  1KHI A;  4IUP A;  4JI4 Q;  5FKA C;  4TQU S;  2MJ8 A;  1GOZ A;  2DNC A;  3T1H Q;  1YBY A;  3BDL A;  1NAP A;  2K1B A;  4LF7 L;  1AN8 A;  3NWT A;  2IJ0 A;  4A3E B;  3S9W A;  5TSS A;  1QE6 A;  2D2C C;  3HKZ E;  1CTM A;  4RKB A;  4JI2 Q;  3QOJ A;  3CCQ A;  4MHE A;  4HJ5 A;  5HUR A;  1YNJ D;  2I07 B;  2F0W A;  1YI2 A;  2RCF A;  1X9N A;  3HOZ G;  2XSC A;  4LUZ A;  2HUG A;  3ERO A;  3MWY W;  1Q3L A;  5JPN C;  5IYD G;  4IQZ A;  4APV A;  1CKM A;  2VL6 A;  5EPJ A;  1G51 A;  3KDF B;  4BS9 A;  3RLN A;  2O2L D;  2K5W A;  4A3J B;  1SE3 A;  4L8J A;  4BBS B;  1B50 A;  1YNJ C;  1QJO A;  2YYZ A;  4B3R L;  3TZU A;  2BA0 A;  1D5X C;  4QQB X;  3MAQ A;  2WB1 E;  3TN2 A;  5CV8 A;  4K5V A;  3GTK B;  4FXK C;  2AWO A;  1G6P A;  2F4I A;  1P16 A;  1SN8 A;  1V8Q A;  4UP9 A;  1VS0 A;  1GO3 E;  5IYB H;  2PZT A;  3VYU A;  2F0N A;  1NY4 A;  3DLL A;  4DNT B;  4LF5 L;  2EVB A;  2RF4 A;  1F2M A;  2NN6 H;  4L63 B;  3NEL A;  3NTI A;  4B08 A;  1HNW Q;  4DUZ L;  1R9T B;  2ZXR A;  1RKN A;  5CC4 A;  1A63 A;  1S4Z A;  5EGT A;  2JA6 B;  1BCP F;  5IIF A;  1AW7 A;  2F3I A;  5E7N A;  1L1O B;  2AWN A;  2SNM A;  4O1N A;  2VXW A;  3WOF A;  4GZY C;  3AEV A;  3H6M A;  1TWA H;  4C3I B;  4DPG A;  4ABN A;  2IHE A;  1A15 A;  3NUC A;  5IGE A;  3DM3 A;  1LT4 D;  1TS2 A;  1CT1 D;  2E8G A;  3R93 A;  3J81 j;  2ENB A;  2F0Q A;  5C0X G;  4OGQ C;  1C0A A;  1NBW A;  2TSS A;  3TZD A;  1LYL A;  2NVQ B;  3CRK C;  5GAD C;  5C0X J;  1DJR D;  1BO0 A;  2CKZ B;  2OQK A;  4HID A;  2XTI A;  3K7A H;  2JJQ A;  5KNB A;  2OWO A;  2EYO A;  4LF8 L;  3R3O A;  1J6Q A;  3V96 A;  2R92 B;  1B44 D;  1QIL A;  5EQ0 A;  1ET6 A;  4QL5 A;  4NXN L;  1LUZ A;  1WD1 A;  2G9H D;  1KC8 C;  1JIC A;  4GN3 B;  4JI0 Q;  1NR4 A;  1SMY D;  4NMZ A;  3T1Y L;  1TWG B;  1UE6 A;  3R8B A;  3I2Z A;  3DXJ C;  4V0B A;  4A3K H;  1W6J A;  4GOP A;  2JYO A;  4OL7 A;  3BVG A;  3DUZ A;  1T5E A;  2PI2 A;  2Q8R E;  4YY3 L;  1IW7 D;  1XJV A;  3MFY A;  3HOW B;  1IBK L;  3GTM B;  1ROD A;  2X6G A;  5CYU A;  3KUP A;  2C35 B;  4KD3 A;  1SMY C;  1VCI A;  3PUV A;  4KMU C;  4F88 A;  2F03 A;  2F0I A;  2MGS A;  1UEB A;  2I5M X;  5ELC A;  4B3M L;  1H9M A;  2EQS A;  3S1Q B;  3SGI A;  4JI7 L;  1IW7 C;  1EY7 A;  1KIX A;  1BDO A;  1Z9F A;  4DA2 A;  4DAY B;  5D14 A;  3L2P A;  1WCM B;  4IZ8 A;  3J80 E;  2F0H A;  1I3Q H;  3K7U C;  4IPC A;  1ASY A;  1N32 Q;  5EPK A;  3F2D A;  4FYD A;  1AE2 A;  1AEX A;  1JR0 D;  4RMF A;  4X64 L;  1HNX Q;  2BE5 D;  1F9S A;  2OT2 A;  1HFG A;  1VDZ A;  4XDX A;  1DCZ A;  1BQQ T;  4CJ2 C;  3S2D B;  3NBH A;  2CHB D;  1ET9 A;  1XPO A;  5CBA E;  2WAQ B;  3FRP B;  3PO2 H;  1W2B A;  1BXT A;  3J81 c;  4BY1 B;  4RA8 A;  4NXM Q;  4BY7 H;  3CRL C;  1H9S A;  3F2C A;  4YIJ A;  1ILP A;  1K73 C;  1C4Q A;  4ZKC B;  4L5S A;  2NTS A;  1PZJ D;  2N88 A;  2BE5 C;  1GUT A;  5E4X A;  5EBC A;  4OIJ A;  4AQY Q;  1UWV A;  3RN2 A;  2BA1 A;  4MTN A;  4DV3 Q;  3L3O C;  1QZG A;  2D5D A;  1R4P B;  2K5V A;  2I5L X;  2YTY A;  5IP9 H;  3DWP A;  2K50 A;  3A8I E;  4PZ7 A;  1N8R C;  2Q8T A;  4OX9 L;  1JWM D;  1J5E L;  1E1O A;  1YJ9 A;  1MIU A;  2ZXP A;  2BOS A;  3K5N A;  2DNE A;  4X3K A;  3CQZ H;  4A3C G;  3NEN A;  4C3J H;  1VF5 C;  2B2W A;  2F0F A;  3MA2 B;  2EJG C;  2AUK A;  1FGU A;  1MKH A;  2RBM A;  2KVM A;  3SK8 A;  4RGM A;  2EDG A;  1CKN A;  4X62 L;  4PMB A;  4DXG A;  1YZ6 A;  3GTL H;  3J7A 5;  2PQA A;  4FXG C;  5GAH C;  3MEH A;  4LAA A;  4Z9C B;  3NTK A;  3QIA A;  1A0I A;  1K0R A;  1SNP A;  2R93 G;  3GTG B;  1EEI D;  1I5F A;  3DHQ A;  4R4I A;  2QDL A;  4BWG B;  1E2Z A;  1VQD A;  2EIF A;  1QUQ B;  3STB D;  2Z4I A;  3PUW A;  1U5K A;  2EY5 A;  3TP5 A;  2X69 A;  4IAL A;  3H94 A;  2A19 A;  4X3T A;  5C4J B;  1YIT A;  1J8I A;  4WFN 3;  2FJ2 A;  2IX3 A;  1KAW A;  3HKZ B;  3PSI A;  1SE2 A;  3I4M H;  2DGY A;  4DAV A;  4XTC S;  1ENA A;  1EQQ A;  3MXG A;  4IJL A;  1HRJ A;  2EXZ A;  3BYT B;  2UUA L;  1V9P A;  2A8V A;  3STB C;  1QVG A;  4IFD G;  1Y1V B;  4GNX B;  1EUJ A;  2ZJP A;  5M5Y H;  2EOT A;  3TRZ A;  3M3Y H;  4P73 A;  5LMN W;  4GKK Q;  2LS0 1;  1I4P A;  2JA9 A;  3VYT A;  1PMR A;  1QG7 A;  4IUV A;  3PF4 A;  3W1G A;  2Z9H A;  4I65 A;  1MJC A;  2FHT A;  3I70 A;  3MFG A;  1EY6 A;  3BDO A;  2PW5 A;  1WTQ A;  5DAU A;  5IYC G;  3U9S A;  2WB1 B;  1VQB A;  3NK9 A;  3C2P A;  1WTW A;  1T5X D;  4JI4 L;  2WKD A;  5C4Z A;  1EYD A;  3ICE A;  3HOZ H;  4A3M H;  4A3F G;  1SLJ A;  3TS0 A;  4KJN A;  2I0Q A;  3A7A B;  5EKI A;  3PIP A;  2RDF A;  1EWC A;  1EOV A;  2E74 C;  3ERQ A;  4OIK A;  1NMG A;  1LTR D;  5K5P A;  1BCP B;  4A93 B;  2B2V A;  3U4Z A;  1XWE A;  1LT6 D;  4C2M H;  4C3H H;  5FLX E;  2ASB A;  1MI2 A;  2KBN A;  4CKC A;  4A3I G;  3CCS A;  1EWI A;  3RR5 A;  3TRE A;  2A1A A;  3G6E A;  3S14 B;  4ULL A;  3QG1 A;  4LUO A;  1PRT B;  2EJM A;  5DEH A;  4L5R C;  5M3M G;  3KLR A;  5H1S E;  1AE3 A;  4LFB Q;  3E6Z X;  4RH6 A;  2CH4 A;  3PIP 3;  2R7D A;  5KRU A;  3RMH A;  3K5O A;  1C48 A;  4A3B H;  1DOL A;  4C56 C;  4NP5 A;  1SYC A;  2FFK B;  4HJ8 A;  1BKB A;  4JBK A;  3A0J A;  2NZO A;  3K6O A;  4EQP A;  4IOC A;  2F0M A;  1HPC A;  2NVT B;  1RF2 D;  4UPA A;  2UUC Q;  3K81 C;  4UP8 A;  1G6Z A;  1EFW A;  3GTO B;  1H95 A;  4PNY A;  4U67 3;  2V4D A;  5IWA Q;  4R9W A;  4DR4 Q;  2BDO A;  5C3E B;  3OSO A;  2XIW A;  1TY2 A;  5ELE A;  3D3R A;  2KCM A;  2WFW A;  3A5U A;  4H7B A;  4DNI A;  2CCZ A;  2PNH A;  3KLS X;  4KV6 A;  4IUR A;  3PQI A;  4IJH A;  4JOI A;  1LTA D;  4JI6 L;  3D8G A;  3HS0 C;  3MXN B;  5IYB G;  3KJO A;  1D7Q A;  3OMG A;  3A8K E;  3OIQ A;  3QJY A;  3A56 A;  4NDX A;  5I2Y A;  4X66 Q;  3OIP A;  2EY6 A;  1KDA A;  2JEA I;  2R7Z H;  2NTT A;  1GHK A;  3I3C A;  1SFO B;  3EA6 A;  1I6V C;  4DV1 L;  3LWE A;  1PTO H;  5BR8 Q;  5FLM H;  4DV2 L;  3IKJ A;  4HIK A;  4R4T A;  3SDZ A;  4ZK9 B;  1PH9 A;  2L5T A;  1PH8 A;  1X3P A;  4KHV A;  2XVS A;  3H0G H;  1RCV D;  4YHH Q;  4OHJ A;  1C7Y A;  2P5Z X;  3W5O A;  1XMO Q;  3S2H B;  4RWS C;  1KQS A;  3SE0 A;  2K7V A;  2IWH A;  1YNN D;  4B3S Q;  3HOU H;  2ZM6 L;  2JXM B;  1ESF A;  1EQR A;  4QF4 A;  3NXW A;  2E2H H;  4UDU C;  1STG A;  1OXX K;  1SYF A;  3N6R A;  3J81 i;  5JJK A;  1YJW A;  2HCI A;  5IGF A; 
#chains in the Genus database with same CATH homology
 3VR6 A;  1YNN C;  1PDQ A;  4HMI A;  3OMC A;  5IGD A;  1U4L A;  3VA7 A;  3D4R A;  1QNK A;  1NSN S;  2B63 B;  2EYJ A;  1U9R A;  1STY A;  5CBE E;  2NVY B;  1ICW A;  4XQQ A;  3M7N A;  2IPK D;  1PTO D;  3M85 A;  5JVH 3;  3EVQ A;  4C1N K;  4FNF A;  2F0J A;  2VB2 X;  2FMM A;  3GTJ B;  4KN7 C;  1WTR A;  1E0B A;  4K8J A;  1GUO A;  5CV7 A;  4ZKB B;  1I4G A;  1PTO C;  2KCC A;  2K5Q A;  1D1K A;  5I9O A;  4RGN A;  2E2I B;  1KAA A;  3L9A X;  5CMD A;  3L7Z C;  3HOY B;  2RSO A;  1HTL D;  5A2Q L;  4ZAI A;  2O5J C;  2KEE A;  3T56 B;  5I4D A;  3WDN A;  3FMC A;  1S5B D;  4DN4 M;  2H1E A;  2WP8 J;  3BDC A;  2I46 A;  4DK1 A;  3PUZ A;  3MXU A;  3IAY A;  1HFN A;  5KNC A;  4F8M A;  3OWE B;  4C3J G;  4X3S A;  5CGK A;  1RTN A;  4RKL A;  2QEJ C;  2IL8 A;  1H9R A;  1LO5 D;  1ZYR D;  1WTO A;  5CV6 A;  2OF1 A;  3NP8 A;  2DY7 A;  2HDM A;  4A3I B;  1TVX A;  4M8A A;  2EYP A;  2J7Z A;  4ODG A;  1ZYR C;  2L4N A;  1E2V A;  5LL6 S;  3GTQ B;  5ISR A;  1D5M C;  3JAM L;  1JOQ A;  1F77 A;  2EY2 A;  1G29 1;  1F9R A;  2HCC A;  4K8I A;  2Z1C A;  1SYE A;  1EZ6 A;  1JCK B;  4KY6 A;  1RHP A;  2JA8 B;  4O42 A;  4BA2 I;  1B9N A;  1KAB A;  1B3A A;  1OXU A;  1PFM A;  1OXT A;  4CHT B;  2E76 C;  1QB5 D;  3VYS A;  2F0L A;  3G6J B;  3I4L A;  2QCP X;  1I4R A;  4DAY A;  5M3F B;  1IYU A;  1UNS A;  4FVM A;  1A2T A;  5JJZ A;  1CA6 A;  2F1M A;  3I90 A;  4C3H G;  2NYZ D;  1FNW A;  3VA5 A;  2FIN B;  4G57 A;  1BF4 A;  1EWH A;  3OOC A;  3A54 A;  3C46 A;  5JVG 3;  4DNR B;  1EY9 A;  1AZQ A;  3X3N A;  1I4X A;  3K5M A;  4G7H C;  3SK5 A;  2SEB D;  2B2U C;  5CV5 A;  3K59 A;  2D9U A;  1V1O A;  2M2L A;  2JA7 B;  1TKW B;  5ELB A;  2IW3 A;  2DY8 A;  1PRT F;  1D2B A;  3DEP A;  3FVQ A;  5C4H A;  2PPB C;  2YU9 B;  3I4N B;  1TWA B;  4ID6 A;  1TQO A;  3C1F A;  2EJF C;  4A3D B;  2XN9 C;  1CFM A;  1Z7T A;  4HSP A;  3D6C A;  3IL8 A;  1WVL A;  1ONL A;  5T1I A;  2X6L A;  3GD7 A;  3LWU A;  1SEB D;  2PW7 A;  3FPU B;  3Q22 A;  4CJ1 B;  3SHL A;  1STE A;  3K7A B;  3Q24 A;  3NWS A;  1TS4 A;  1JOR A;  4E6I A;  4RAU C;  1RTO A;  1SNO A;  2VNU D;  2PQE A;  4DFA A;  3KBX A;  2NBF A;  5FO8 B;  2M9V A;  2A69 D;  3VR2 A;  4A3K B;  5G3L D;  1LTS D;  2K5D A;  2J4X A;  3M4Y A;  3OW7 A;  1GUG A;  2A5H A;  3TDQ A;  2BDN A;  1V1P A;  3HG9 A;  3P75 A;  2A6E D;  1Q1B A;  5A35 A;  2EYL A;  2A69 C;  1DOK A;  4K6D A;  2AUJ D;  5NUC A;  3P7J A;  4BA1 I;  4KY5 A;  1CHQ D;  4LJZ C;  2A6E C;  2KJX A;  3W2D A;  5IOC A;  2F3W A;  5EKK A;  1HUM A;  1HQR D;  1WTP A;  3PO2 B;  3LNN A;  4BY7 B;  1EY5 A;  5BN3 A;  5C4X B;  4CBV A;  1PXU A;  1I4H A;  4KI0 A;  4ZQ3 A;  2K04 A;  2NVX B;  4LK1 C;  2D62 A;  1PLF A;  1LTT D;  5ELF A;  3E0J A;  4XT3 B;  1SYG A;  1HA6 A;  1HTP A;  1XXG A;  4R8N A;  4H44 C;  2FMC A;  4XIG S;  4CKB A;  1TWC B;  1GUW A;  3MZ5 A;  3M7G A;  3J7Y W;  4EQN A;  3P1H A;  1O7Z A;  3MXN A;  3I4M B;  1LV9 A;  1IKM A;  4DF7 A;  4N9P A;  4G7Z C;  1E2W A;  2L11 A;  3H09 A;  3NSW A;  5M5Y B;  3M3Y B;  5DNF A;  1A3V A;  1IKL A;  4V19 0;  5BN5 A;  3Q0A A;  1UUP A;  1B1Z A;  1STA A;  4HN7 A;  1TR5 A;  3A7L A;  1VF7 A;  2F3V A;  2A73 B;  3QB3 A;  3I91 A;  2RDH A;  3HOZ B;  2IT1 A;  3HEJ A;  2C9O A;  3TP8 A;  5M9O A;  1DZ1 A;  1EOT A;  2L0C A;  1DYQ A;  3E5S A;  2E2D C;  4ME5 A;  1AFP A;  1TS3 A;  1HXY D;  2A6H D;  2LMC B;  1SYD A;  1KNE A;  2KOL A;  1B2T A;  3TSS A;  3HRZ C;  5FO7 B;  5M5X B;  2QIL A;  1H9S B;  2HQE A;  1EQV A;  1CQV A;  1KDC A;  5EPL A;  5J39 A;  1LAB A;  3NPP A;  2A6H C;  1IL8 A;  2EZV A;  3HGB A;  2F0D A;  5IT9 L;  4M1U B;  3HZX A;  4HAE A;  3MTS A;  2JEB I;  5FOB B;  3SVM A;  5CR3 A;  2TMP A;  1G8Z D;  4H0L C;  1EIH A;  3RZO B;  4IUN A;  3MXP A;  1KNA A;  1STN A;  1CK1 A;  5FK9 C;  1HHV A;  1SBB B;  4IN3 A;  1NR2 A;  4PMC A;  1A6X A;  4XYQ A;  2AQ2 B;  1A3T A;  4DK0 A;  1SXT A;  1QWY A;  2F0O A;  3OHX C;  2PO4 A;  1BCP D;  3BYY B;  2WIN B;  1Y69 U;  2KCN A;  2R6G A;  2R7Z B;  4NW2 A;  1PRT D;  2JSO A;  1SNC A;  3AB9 A;  3RUZ A;  1BCP C;  1S5E D;  2Z4H A;  2PZU A;  4QCL A;  5CV9 A;  2O4X A;  1SYB A;  1F9Q A;  1FR3 A;  3H0G B;  1JWS D;  3TP6 A;  3QOL A;  2CW0 D;  4QMG A;  1GHJ A;  1GJX A;  2RQX A;  3GQB A;  1PRT C;  2Z8L A;  4HED A;  4DXF A;  2NN6 I;  3GV6 A;  4PQX A;  4C3I G;  2B2U A;  1CZG A;  1S5D D;  1STH A;  1I6H B;  4IUT A;  2K05 A;  3X3M A;  3T53 B;  2CVR A;  2CW0 C;  5T1G A;  3J7A F;  2E2H B;  5LHY 1;  2PNR C;  3SR1 A;  2ZXO A;  4HTH A;  5C5L A;  4FF2 A;  3EQL C;  4XT1 B;  4HR7 B;  3PUY A;  1Y1W B;  2MP1 A;  1Q12 A;  1MD2 D;  4LMQ D;  4MN3 A;  3SK6 A;  3GTP B;  1LT3 D;  4IUQ A;  2VUM B;  5JOB A;  4ZYS A;  1F2Y A;  1LAC A;  4HMJ A;  5COY A;  2OEO A;  4KKU A;  1H9J A;  3J81 E;  3DWA A;  1K83 B;  1PZK D;  1EFI D;  3GV3 A;  5C3W A;  1PFN A;  3D4D A;  4CGY B;  4C1N I;  1BOS A;  2R93 B;  2F0P A;  1L0Y B;  3D6W A;  1X32 A;  3NBI A;  5C6A A;  1SNM A;  3OPO A;  1G2T A;  3BG3 A;  2B2T A;  5IGC A;  2E2J B;  2ICE C;  4XXE A;  3IFD A;  4S3S A;  1JOK A;  5I6Y A;  2K28 A;  1I4Q A;  5KGU A;  3DMU A;  3PV0 A;  2KED A;  3ZYY X;  3F2U A;  1RJT A;  1SAP A;  2ZT9 C;  4TRD A;  2MUY A;  1CQF A;  2LFN A;  2AQ3 B;  4WJW A;  3T4A C;  4A3F B;  4J1M A;  4F7X A;  1CZW A;  1Z47 A;  3KK7 A;  1MGS A;  2QKI C;  3VYR A;  3S1N B;  3S17 B;  3PUX A;  4RCO A;  1SDF A;  3M4O B;  5C3X A;  2F0E A;  2XRQ D;  2G9D A;  5JPM C;  1EEF D;  4OO1 I;  3NHH A;  2N55 A;  2Q8I B;  5D65 A;  2K6A A;  1HCZ A;  3AMU A;  5M3M B;  1BBX C;  3PMF A;  1WTV A;  4FO2 A;  1SJE D;  1Q1E A;  5E1F A;  4FXD A;  2OXP A;  1JQY D;  2L9H A;  3DWQ A;  2EPB A;  2L55 A;  3Q23 A;  1PZI D;  2XNA C;  4EQO A;  1DM0 B;  1FD7 D;  2A68 D;  2MHV A;  3A55 A;  3D31 A;  1J9O A;  4R8I A;  1A3U A;  1ZXT A;  3OWF A;  1IYV A;  2HDL A;  3NQT A;  2B8G A;  2RA4 A;  1H9K A;  1GXD C;  4B9X A;  2A68 C;  1NUC A;  4WRD A;  3S1R B;  3RLF A;  3BS1 A;  2NUC A;  5HGT A;  5F2D A;  5EJW A;  1MSG A;  2K33 A;  1DOM A;  3H3V C;  1AZP A;  1F2L A;  2R3Z A;  4ILW A;  1LTI D;  3SXH A;  5JEA H;  4K2K A;  2VB3 X;  1FYC A;  1OXS C;  1UAP A;  1BR9 A;  3QO2 A;  4KY7 A;  3NTH A;  1B9M A;  3CU7 A;  1F2Z A;  1MSH A;  2KA7 A;  1PYW D;  1RDP D;  2O5I C;  2EYH A;  3UI2 A;  3VR5 A;  3URY A;  2EE1 A;  1U4P A;  1JOO A;  1MBY A;  1ENC A;  2K32 A;  4K6L A;  2PZW A;  3MVV A;  5EBD A;  1HA5 A;  2M00 A;  1PFB A;  3AU7 A;  2WAC A;  3VR4 A;  3CKI B;  2B39 A;  3ITP A;  2C5C A;  5D3I B;  1ML0 D;  2NB0 A;  4HCE A;  3KBG A;  5C0X I;  1CHP D;  2ID0 A;  4FP5 D;  1JC7 A;  4H13 C;  1DXM A;  2RDG A;  3V2T A;  5JAV A;  3PO3 B;  2KQ3 A;  2WII B;  1CA5 A;  4ZUI A;  1L0X B;  1FGB D;  1D5Z C;  3K57 A;  3HP3 A;  1R4Q B;  2B2T C;  2RVL A;  2B2Y A;  4TSS A;  5KND A;  1EQT A;  3S1M B;  1B53 A;  2SDF A;  5K36 G;  1EL0 A;  1I3Q B;  1PTO F;  4XQJ A;  1XYI A;  2Y0S B;  2CQA A;  1Y8N B;  3J80 L;  3T13 A;  3SK4 A;  4N9T A;  2L12 A;  3ND9 A;  2B8F A;  3EJI A;  3S16 B;  1Y8O B;  4RGT A;  2F0U A;  1NCV A;  3FDT A;  4K2L A;  1AP0 A;  4KKT A;  1U4M A;  2JE6 I;  4EVO A;  5ELD A;  2LKV A;  2E75 C;  3CQZ B;  3H91 A;  4C3J B;  3KLS A;  3BVZ A;  1TU2 B;  2IX0 A;  2R61 A;  3MC0 B;  4PV1 C;  3GTL B;  5DM6 3;  3V05 A;  3K0Y A;  4OO1 H;  4HSV A;  1G2S A;  5BN4 A;  4ZLT F;  1TWF B;  4CKE A;  4MIU A;  4RCN A;  1LT5 D;  1FNU A;  1ESR A;  1W6K A;  1U4R A;  1O80 A;  2F0V A;  5AFW A;  2NZ1 D;  3TME A;  3TP7 A;  3P20 A;  2DN8 A;  1Q90 A;  1ILQ A;  5E4W C;  2IX1 A;  2F0G A;  2EYM A;  3R2I A;  1D6E C;  2QF7 A;  1K8O A;  3T16 A;  1OXV A;  1KLG D;  4IFD J;  1Q8I A;  4A3G B;  5COR A;  2ICI A;  4JBW A;  4KHZ A;  2GA4 B;  4L6T B;  5KEE A;  3DM1 A;  4IFD I;  1GUN A;  2NWG A;  4QUF A;  4A3M B;  1KTK A;  3WOE A;  5CV4 A;  5DM7 3;  4K14 A;  5J22 A;  2XRS D;  1LLR D;  4EGV A;  1V1P B;  4JK1 C;  1SE4 A;  3PIO 3;  5E3F A;  1KDB A;  4KN4 C;  3N52 A;  1S5C D;  3O13 A;  4C2M B;  4C3H B;  3CHB D;  1CI3 M;  1VMP A;  2A74 C;  2SNS A;  1SNQ A;  1WD0 A;  5IGG A;  4G4K A;  4TKO B;  5FLX L;  2EYF A;  3RD4 A;  3BZD B;  2F0T A;  4WOR A;  3K58 A;  2K03 A;  1EIG A;  4ZRZ A;  3Q6S A;  4FF1 A;  2K01 A;  1GUS A;  1STB A;  3EFX D;  4A3B B;  4U68 A;  3I8Z A;  1LTB D;  3S15 B;  2AQ1 B;  5EKL A;  3G7L A;  2RSN A;  5IT9 E;  4G7O C;  2F0S A;  4IUU A;  4KJO A;  2XWJ B;  3C1E A;  3U9O A;  3GP7 A;  1XTC D;  4J6H A;  1EY8 A;  4QUC A;  4DU9 A;  1TWH B;  3FPP A;  1M8A A;  2RKS A;  3C3L A;  2WKC A;  1DD2 A;  4RHR A;  2PCF B;  1G91 A;  1Y8P B;  5C0X H;  1TS5 A;  4J8Q A;  2QDB A;  1C8C A;  4QB4 A;  4AYB B;  1D1I A;  3KF8 A;  4Q0F A;  2B2Y C;  2MPM A;  1O78 A;  1II3 A;  4XYO A;  1CM9 A;  4X3U A;  1JE4 A;  1PTO B;  5JEA G;  5LL6 X;  4P2C B;  5JEA J;  2NN6 G;  1XX8 A;  2KUM A;  4QIW B;  2PMZ B;  1DON A;  1EYA A;  4Q5V A;  3ND8 A;  1EY0 A;  1I50 B;  5K36 H;  1F9P A;  4XQN A;  3HOU B;  2PYK A;  3NQI A;  5G3L F;  3T51 B;  3J7A V;  4RFB A;  3FKI B;  1LTG D;  1V43 A;  5KIX A;  1QCB D;  3LX0 A;  4KD4 A;  1JWU D;  4I7Z C;  4B9W A;  5IOD A;  2J0T D;  1S5F D;  1TII D;  3R2T A;  1WTX A;  3HOV B;  5FO9 B;  5I9P A;  4K5X A;  5J1Z A;  2B2W C;  4HCS A;  3IFT A;  4F87 A;  4CJ0 B;  4DGZ A;  2BCO A;  1TT2 A;  3GO5 A;  5D3D A;  1BUV T;  1SJH D;  3TBI B;  3NE5 B;  1IHZ A;  4FF4 A;  1OO9 B;  1BNZ A;  4FF3 A;  5KYI A;  4KTA A;  4ZUJ A;  3J81 L;  2KEC A;  2F0K A;  5A2Q E;  4Y7N B;  1B4O A;  2XWB B;  3D4W A;  3MHB A;  3VR3 A;  1HUN A;  2EY1 A;  2LY7 A;  1O7L A;  1EU3 A;  2JP1 A;  1O7Y A;  5C5M A;  1EY4 A;  3A8J E;  2L1B A;  4PMW A;  4IFD H;  1SND A;  4NKL A;  3ONA B;  4BBR B;  2WV6 D;  1ENF A;  5C44 B;  1HQM C;  1EU4 A;  5I2X A;  5I6W A;  4KK7 A;  2B2V C;  3SEB A;  2H4O A;  3I72 A;  1EZ8 A;  4K5W A;  2SOB A;  1VMC A;  1RD9 D;  4OO1 G;  1FNV A;  2KHS A;  3DEO A;  4KKS A;  1TY0 A;  3I73 A;  1ZEQ X;  3FEW X;  5M5W B;  3QWN A;  3W3A A;  3K5L A;  1K8M A;  1X3Q A;  3JAM E;  5IGB A;  1M4V A;  1A2U A;  4RGO S;  1SSO A;  4UAI A;  1Z6H A;  2JA5 B;  1QNU A;  4RHS A;  3BVM A;  3HOX B;  1KLU D;  4DAP A;  5KYL A;  1JB3 A;  3RZD B;  1QOH A;  1UEA B;  1ZKO A;  1EYC A;  4IUP A;  5FKA C;  4TQU S;  2MJ8 A;  1GOZ A;  2DNC A;  3BDL A;  1NAP A;  2K1B A;  1AN8 A;  3NWT A;  2IJ0 A;  4A3E B;  3S9W A;  5TSS A;  1QE6 A;  2D2C C;  1CTM A;  4RKB A;  3QOJ A;  4MHE A;  5HUR A;  1YNJ D;  2I07 B;  2F0W A;  2XSC A;  2HUG A;  3ERO A;  3MWY W;  1Q3L A;  5JPN C;  4IQZ A;  5EPJ A;  4BS9 A;  4A3J B;  2O2L D;  2K5W A;  4BBS B;  1SE3 A;  4L8J A;  1B50 A;  1YNJ C;  1QJO A;  2YYZ A;  3TZU A;  2BA0 A;  1D5X C;  3MAQ A;  3TN2 A;  5CV8 A;  4K5V A;  3GTK B;  4FXK C;  2AWO A;  2F4I A;  1V8Q A;  2PZT A;  3VYU A;  2F0N A;  4DNT B;  2EVB A;  1F2M A;  2NN6 H;  4L63 B;  3NTI A;  4B08 A;  1R9T B;  2ZXR A;  1RKN A;  5CC4 A;  1S4Z A;  5EGT A;  2JA6 B;  1BCP F;  5IIF A;  1AW7 A;  2AWN A;  2SNM A;  4O1N A;  2VXW A;  3WOF A;  4GZY C;  3H6M A;  4C3I B;  4ABN A;  3NUC A;  1A15 A;  5IGE A;  1LT4 D;  1TS2 A;  1CT1 D;  3R93 A;  2ENB A;  2F0Q A;  5C0X G;  4OGQ C;  2TSS A;  3TZD A;  2NVQ B;  3CRK C;  5C0X J;  1BO0 A;  1DJR D;  5KNB A;  2EYO A;  3R3O A;  3V96 A;  2R92 B;  1B44 D;  1QIL A;  5EQ0 A;  1ET6 A;  1WD1 A;  2G9H D;  1JIC A;  1NR4 A;  1SMY D;  4NMZ A;  1TWG B;  3R8B A;  3DXJ C;  4V0B A;  1W6J A;  2JYO A;  4OL7 A;  3BVG A;  3DUZ A;  1T5E A;  2Q8R E;  1IW7 D;  3MFY A;  3HOW B;  3GTM B;  1ROD A;  2X6G A;  5CYU A;  3KUP A;  4KD3 A;  1SMY C;  1VCI A;  3PUV A;  4KMU C;  4F88 A;  2F03 A;  2F0I A;  2MGS A;  5ELC A;  1H9M A;  3S1Q B;  1IW7 C;  1EY7 A;  1BDO A;  4DA2 A;  5D14 A;  1WCM B;  4IZ8 A;  3J80 E;  2F0H A;  5EPK A;  4FYD A;  1AEX A;  1JR0 D;  2BE5 D;  1F9S A;  2OT2 A;  1HFG A;  1VDZ A;  4XDX A;  1DCZ A;  1BQQ T;  4CJ2 C;  3S2D B;  3NBH A;  2CHB D;  1ET9 A;  5CBA E;  2WAQ B;  3FRP B;  1BXT A;  4BY1 B;  4RA8 A;  3CRL C;  1H9S A;  4YIJ A;  1ILP A;  1C4Q A;  4ZKC B;  2NTS A;  1PZJ D;  2N88 A;  2BE5 C;  1GUT A;  5E4X A;  5EBC A;  4OIJ A;  2BA1 A;  3L3O C;  2D5D A;  1R4P B;  3DWP A;  3A8I E;  2Q8T A;  1JWM D;  2ZXP A;  2BOS A;  3K5N A;  2DNE A;  4X3K A;  1VF5 C;  2B2W A;  2F0F A;  3MA2 B;  2EJG C;  2AUK A;  2RBM A;  2KVM A;  3SK8 A;  4RGM A;  2EDG A;  4PMB A;  4DXG A;  4FXG C;  3MEH A;  4LAA A;  4Z9C B;  3NTK A;  3QIA A;  1SNP A;  3GTG B;  1EEI D;  3DHQ A;  4BWG B;  1E2Z A;  2Z4I A;  3PUW A;  2EY5 A;  3TP5 A;  2X69 A;  4IAL A;  3H94 A;  4X3T A;  5C4J B;  1J8I A;  4WFN 3;  2FJ2 A;  2IX3 A;  3HKZ B;  1SE2 A;  4DAV A;  4XTC S;  1ENA A;  3MXG A;  1HRJ A;  2EXZ A;  3BYT B;  4IFD G;  1Y1V B;  2EOT A;  2LS0 1;  1I4P A;  3VYT A;  1PMR A;  1QG7 A;  4IUV A;  4I65 A;  2FHT A;  3I70 A;  3MFG A;  1EY6 A;  3BDO A;  2PW5 A;  1WTQ A;  5DAU A;  3U9S A;  2WB1 B;  3NK9 A;  3C2P A;  1WTW A;  1T5X D;  2WKD A;  5C4Z A;  1EYD A;  4KJN A;  3A7A B;  5EKI A;  2RDF A;  1EWC A;  2E74 C;  3ERQ A;  4OIK A;  1LTR D;  5K5P A;  1BCP B;  4A93 B;  2B2V A;  1XWE A;  1LT6 D;  5FLX E;  1MI2 A;  4CKC A;  3S14 B;  4ULL A;  3QG1 A;  1PRT B;  2EJM A;  5DEH A;  3KLR A;  3E6Z X;  4RH6 A;  3PIP 3;  5KRU A;  3RMH A;  3K5O A;  1C48 A;  1DOL A;  4C56 C;  4NP5 A;  1SYC A;  2FFK B;  3K6O A;  4EQP A;  2F0M A;  1HPC A;  2NVT B;  1RF2 D;  1G6Z A;  3GTO B;  4PNY A;  4U67 3;  2V4D A;  4R9W A;  2BDO A;  5C3E B;  3OSO A;  2XIW A;  1TY2 A;  5ELE A;  3D3R A;  4H7B A;  3KLS X;  4KV6 A;  4IUR A;  1LTA D;  3D8G A;  3HS0 C;  3OMG A;  3A8K E;  3OIQ A;  3QJY A;  3A56 A;  4NDX A;  5I2Y A;  3OIP A;  2EY6 A;  1KDA A;  2JEA I;  2NTT A;  1GHK A;  3I3C A;  1SFO B;  3EA6 A;  1I6V C;  3LWE A;  1PTO H;  3IKJ A;  3SDZ A;  4ZK9 B;  2L5T A;  1X3P A;  4KHV A;  2XVS A;  1RCV D;  4OHJ A;  3S2H B;  4RWS C;  3SE0 A;  2K7V A;  2IWH A;  1YNN D;  2JXM B;  1ESF A;  4QF4 A;  3NXW A;  4UDU C;  1STG A;  1OXX K;  1SYF A;  3N6R A;  2HCI A;  5IGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...