4MHEA

Crystal structure of cc-chemokine 18
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
SAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords C-C motif chemokine 18
publication title Structures of human CCL18, CCL3, and CCL4 reveal molecular determinants for quaternary structures and sensitivity to insulin-degrading enzyme.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4mheA00
1NR4A 1J9OA 4R9WA 3DEPA 1MSHA 2NWGA 1B3AA 4R8IA 1WTPA 3DEOA 2J7ZA 4IURA 2EOTA 2KUMA 1WVLA 4MHEA 1PFNA 1J8IA 2FJ2A 5E4WC 3LWEA 1A15A 3ONAB 1ILPA 2RSNA 3N52A 1AZPA 2B2UA 1ESRA 1G91A 1GUWA 2XIWA 1RHPA 2EE1A 1VMCA 3KUPA 1DOKA 2FHTA 2JP1A 1RTOA 1HHVA 1DOMA 2MP1A 2MJ8A 5T1IA 5T1GA 1B53A 5CORA 4CJ1B 1IKLA 1AP0A 4IUTA 5EPJA 4QUFA 3SVMA 2K01A 3IFDA 2B2UC 2N88A 4HSVA 1RJTA 1DOLA 4X3UA 5CMDA 1C8CA 2IL8A 1X3PA 1F2LA 2RSOA 4X3TA 4RWSC 1Q3LA 2BDNA 1DZ1A 2H1EA 2B2VC 2L12A 1F9PA 2CVRA 3IL8A 4OIJA 1QG7A 1PFMA 1CA5A 1PFBA 2FMMA 1EL0A 2KVMA 3GV3A 3Q6SA 4XDXA 2K28A 2NZ1D 2B2YC 3MTSA 4HAEA 1WTWA 3G7LA 2M2LA 1KNAA 3FDTA 5DNFA 1SSOA 2B2WC 2HUGA 2K05A 2R3ZA 3KBXA 4QUCA 1EIHA 3F2UA 4IUPA 2HDLA 1RODA 2FFKB 2DY7A 2RVLA 1XYIA 1SAPA 3TZDA 2K1BA 2B2VA 1G2SA 1ZXTA 1JE4A 3FPUB 3UI2A 1NAPA 1E0BA 1RTNA 1EIGA 2B2YA 2L1BA 4XT3B 1X3QA 2B2TA 4NW2A 4ZAIA 4DN4M 5EKIA 4LMQD 1O80A 1ML0D 1JICA 1LV9A 2B2WA 2JYOA 2KEDA 1EOTA 2NYZD 1U4MA 5CBAE 4CJ0B 1DONA 1U4PA 2Q8RE 1O7ZA 2KECA 2KOLA 2SDFA 3QO2A 1F9QA 4MN3A 2HDMA 1HUMA 3D6WA 3I8ZA 4X3SA 1WTQA 2B2TC 2Q8TA 1X32A 3GV6A 1CA6A 1SDFA 4IUQA 1BBXC 1HA6A 1PLFA 4X3KA 2D9UA 1F9RA 4HCSA 1KNEA 4ZK9B 1CM9A 3P7JA 4CJ2C 1WD1A 3DM1A 1U4LA 2DY8A 5D14A 2L4NA 1HFGA 4O42A 2HCIA 5EJWA 1U4RA 1B2TA 1M8AA 1F9SA 1WD0A 5EPLA 1AZQA 1PDQA 3I91A 4RAUC 5EQ0A 1BO0A 2HCCA 3R93A 1EQTA 2X6LA 5COYA 3HP3A 2L9HA 4RA8A 5EPKA 4ZLTF 1WTVA 1HFNA 1XX8A 1B4OA 1MSGA 1B50A 1TVXA 4XT1B 4ZKCB 2KEEA 4IUVA 2N55A 1WTXA 4IUUA 1MGSA 1IKMA 2L11A 3TN2A 1BF4A 5D65A 1S4ZA 1O7YA 1ICWA 4UAIA 1BNZA 3MWYW 5JJZA 3I90A 1IL8A 1MI2A 1NR2A 1QE6A 2EPBA 1G2TA 1HRJA 5AFWA 2K04A 1NCVA 1HUNA 1VMPA 2MPMA 1WTRA 4U68A 2FINB 2X69A 4ZKBB 1G6ZA 2K03A 4OIKA 2VXWA 2X6GA 5E4XA 2MGSA 1ILQA 4HEDA 2RA4A 1WTOA 1QNKA 3H91A 3I3CA 5CBEE
chains in the Genus database with same CATH superfamily
4IFDI 1GUOA 2NWGA 4DR7L 2KENA 3BJUA 3QIAA 3BVZA 4IURA 3PV0A 1STNA 4KY5A 2UUAQ 5ELBA 2XN9C 3BZDB 4C3IH 1IBMQ 4FF1A 5D3IB 2B2UA 2NVYB 4X66Q 1IBLL 3RNUA 2WFWA 1S3OA 1EYGA 2QF7A 3FVQA 3BZKA 4R4IA 3JC66 4HIOA 1HHVA 1PYSB 3G4SA 2F0QA 3GD7A 2D2CC 1PRTC 2N8NA 2ZJQA 2R7ZB 2K01A 1SJHD 3T53B 3OTOL 2ICEC 3ITPA 3GTGB 2Z0SA 4PMBA 4X3TA 2E2IH 1PVOA 2CVRA 3HOUG 1PFMA 3N6RA 1VQBA 2F0VA 4GKKQ 1DJRD 2B8GA 5JOBA 5IGEA 4IFDJ 5M5WB 1ZYRC 3E5SA 1X3EA 2PW5A 4JC0A 1XWEA 3NWSA 4BWGB 3S1RH 1SE8A 5IWAL 4H7BA 4C2MH 3KJPA 5FO7B 4BY7G 2WB1B 4PMCA 2JA8G 1EQQA 4Q5VA 3GTOH 3LNNA 3RR5A 1AE2A 3S9WA 4LF7Q 1IZ6A 1EIGA 2B63B 1V8QA 2A19A 1X54A 1CKMA 5EKIA 1PYWD 1QOHA 4ZCKA 1O80A 4DV0L 1BXTA 4A76A 1TWCH 5M5XB 2A6EC 2IW3A 1RDPD 3D3RA 3I4NB 1AEXA 3CF5A 1CUKA 1SMXA 3HOUH 5FLMG 4J1MA 4P75A 3CRLC 1F9RA 1KNEA 3A0JA 3LX0A 1VQDA 4QGUA 3PUXA 1AN8A 3KF6A 1PH9A 2K75A 4EGVA 4PZ6A 1B2TA 3PUZA 1TT2A 2PZUA 2JXMB 4ZLTF 4E6IA 1D7QA 3J7AV 4BY7H 1MJCA 4HSPA 4ULLA 2JA8H 2JA6B 4A75A 4RFBA 1UE1A 3BDCA 4QCLA 1JR0D 3OSOA 4A3LG 2F0JA 2Z6KA 1YBYA 1JMCA 2MO1A 2AUKA 3FPPA 2EPBA 3PIO3 2K32A 3JAME 1KQSA 2A68C 4OEMB 1HUNA 4LW1A 1Y69U 2HD3A 4KHPQ 3D4DA 1R9TH 1WTOA 5FLMH 2K5VA 1TWHB 3L2PA 1S5ED 5BN3A 4WJ3M 1I4PA 3CAMA 5IT9c 3M4PA 2LY7A 4B3ML 1B44D 3UDXA 4EQPA 2YTXA 4BA2I 1I4QA 1PRTD 4IOCA 5LL6S 3KUPA 4GNXC 3A8JE 4A3LH 1B9MA 1Y1WG 3D4RA 1OXUA 3NTKA 5T1IA 4XXEA 3ULPA 2NVTB 1LTBD 4LFBQ 4DUZL 1X56A 1C8CA 4HIKA 4YCVA 2ZT9C 5FLXc 1PH5A 1DZ1A 3OWFA 5IY0A 3CCMA 3HOWH 4JV5L 1KHIA 2L15A 1ZYRD 4JYAQ 4BS9A 4K5WA 3E3XA 3E9HA 2K05A 3D6CA 5BR8L 4DR1L 4LF5L 5J39A 4IUPA 5IT9L 2VZAA 3I73A 3GP7A 3MXNB 5M3FB 4RHSA 3HOVG 4M8AA 4RMFA 4HJ9A 3UI2A 1XNQL 2NZOA 4A3FB 2EYOA 2RDGA 1K3RA 3RN5A 4I7ZC 4DPGA 1Y1WH 3J81j 1JICA 4JI2Q 4DR5L 1G51A 1KXLA 2ZTCA 1DONA 1U4PA 2WAQE 1UE7A 4MN3A 1F9QA 5JPNC 1HJPA 1V1QA 3H0GB 4FF4A 2OWOA 1EYAA 3FHWA 5FLXL 4DAYA 5ELOA 2CWAA 4M1UB 3P7JA 3SXHA 5IE8A 1TWFH 1M8AA 4YCWA 4JBMA 5JEAJ 1BO0A 4A3MG 1SYEA 3T13A 3HOVH 4GS3A 3NP8A 2KCMA 1Y8OB 3CP0A 3A54A 5IP9G 2A68D 2ID0A 5JVG3 1BF4A 4HJ5A 4CKCA 1NTGA 4UP7A 1CSQA 2V1CC 5GAGC 3I4MH 4PV1C 1JJ2A 1RIPA 2UU9Q 1G6ZA 4DGZA 3K5NA 4TRDA 3J7AF 2K03A 5E4XA 4DK0A 3H15A 1QNKA 3H91A 4XQQA 2A8VA 4DXFA 3ZYYX 2HIVA 1KD1C 1KC8C 4A3GG 3M4YA 4TQUS 1BKBA 1IBKQ 1LTLA 3CCLA 2GA4B 3U4VA 4A3MH 5E4WC 1CHQD 3AYHB 3W1GA 4DUYL 3ND8A 3N52A 4DAVA 1SNQA 4P73A 2YU9H 1G91A 5EKKA 2SOBA 1GUGA 5C4XB 5IP9H 1PH7A 1RTOA 3S1QH 2MP1A 3CCSA 4C3HB 3SVMA 1N36L 3S1MH 1JWSD 3H09A 2LFNA 1L1OA 4MZ9A 1GXDC 3TMEA 2E2HH 2MNAA 5L37A 4XYQA 5J22A 3H3VC 1YNNC 4P2CB 4EX5A 3EBEA 5TSSA 4CGYB 2NTSA 1I3QH 1ONLA 3Q6SA 3PMFA 2R7ZG 3Q8DA 3L3OC 4A3GH 3VYUA 3KBXA 2NN6G 3D0FA 1LTRD 1NNXA 1QJOA 1SR3A 4FF2A 4G7OC 4BXXG 2E2DC 2KCTA 1D2BA 2O5IC 3RMHA 3W3AA 4GLVB 3CQZB 1DD2A 3M9BA 5HGTA 2QDLA 4A3CG 2NYZD 2E2JB 3ND9A 2D5DA 4CJ0B 1YHAA 2Q8RE 3QO2A 3J7A5 2VQEQ 3X3NA 1WJJA 3D6WA 2WB1G 2J0TD 1E2VA 4X3SA 1P8LA 2UXBL 2VNUD 1C4QA 3OMGA 2F4IA 2D9UA 2B8FA 2L4NA 1HFGA 2R7ZH 1YJNA 4B3RQ 3GTGH 1ZEQX 4BA1I 2NN6H 5EPLA 3QR8A 4NXNQ 1J5EL 3CW2C 1LTAD 1D5MC 1EQTA 1V1PB 4DAPA 5EPKA 3UE1A 1FL0A 4BXXH 3CKIB 1HR0W 3SEBA 4OWWB 2BOSA 1O7IA 1O7YA 1PH8A 4A3CH 4Y52H 2KHSA 1QILA 3MWYW 1K83H 3I90A 1NR2A 4C3IB 5I6YA 1BUVT 2JEBI 5I4DA 2JA6G 1I6VC 2AWOA 4L5RC 4X62L 1Q1BA 1Q8IA 3HEJA 4LUZA 5ELFA 2QILA 3GTPB 5M5XH 3J7YW 4GOPC 3DEOA 2B3GA 1ET9A 1OXSC 3E0JA 2Z1CA 2EJGC 2WV6D 3NWTA 4GKJQ 2CKZB 2F0HA 1ESRA 5C5LA 4UY8C 2KCCA 4MTNA 5DM63 3PIP3 4NXML 2VY3A 4L5QA 1VF5C 1YNND 3U4ZA 5AJ3Q 3S1RB 4OX9Q 3O13A 2TMPA 4C2MB 1MKHA 1BR9A 2JA6H 1SEBD 2NTTA 2JA9A 4FO2A 3T56B 5GAEC 4A3IG 1CA5A 4V190 2KVMA 2PQAB 4O1NA 2RBMA 4JI7L 3M4OH 1TWCB 3HKSA 1KNAA 2MHVA 3AMUA 2HDLA 1RODA 2FFKB 3Q0AA 1HXYD 1ASZA 3HOUB 4OO1G 1FYCA 4DV3L 1HR0Q 5IGDA 2HT1A 3OIQA 4CDFC 4ZAIA 2OF1A 2FXQA 3LWUA 1U4MA 1HNXQ 4A3KG 2O2LD 1HZ9A 1XYIA 4KKTA 5M3FG 2OCEA 4HTHA 4BY7B 2JA8B 4B08A 2IJ0A 4A3FG 4A3IH 1CA6A 1EQVA 3MXNA 1SDFA 1KTKA 4X3KA 3HKZB 5M3MG 4WORA 2DY8A 3AQQA 2DNCA 2NVTH 4HN7A 4O0AA 3OMCA 1H9KA 2Z4HA 4POGA 1R9TB 2G5DA 4DV6Q 5COYA 1CT1D 3GTKH 1FNUA 3SR1A 4OO1H 4OWTB 2VQFQ 2AUJD 3J81E 2N55A 1EQRA 2NZHA 4IUUA 3AU7A 4KK7A 1PYBA 3NTIA 5CV7A 3AFPA 4F87A 5C4ZA 2EYJA 4R4OA 3V2TA 4A3KH 5M3FH 4N8X1 1YHBA 4ME3A 4B9WA 4H02A 2RKSA 3MFGA 1FJGQ 4QQBX 3URYA 5J1ZA 2NB0A 2IPKD 3I3CA 1YITA 2PQEA 5M3MH 3TDQA 4X65L 1MSHA 3PCOB 1B7YB 5KYIA 1LT5D 3M7GA 1F77A 2C9OA 2EOTA 1MD2D 5EKLA 1IL2A 3CPFA 4NDXA 4L5TA 3HOWB 1LTSD 2QGQA 4OXPA 3T1YQ 3PF4A 4DV4L 3HRZC 1WCMG 5ELEA 1B9NA 1JCKB 2GVAA 4IQZA 5IGBA 4LFAQ 5C5MA 1DOMA 3KOJA 1LO5D 1IHZA 1GKHA 2K5QA 2K5WA 5LHY1 1PHJA 1OXXK 4LF6Q 4K14A 1Y1WB 4B9XA 3G48A 4NB3A 5E3FA 3IRBA 4HAEA 2IWHA 4C3HG 3G7LA 2BA1A 3RD4A 4JI6Q 5JJIA 1SRUA 3E6ZX 4P71A 5FO8B 2EYFA 1WFQA 3RLFA 5C0XJ 3H3VH 3PIOA 5J3BA 3J80E 2OTLA 4DR7Q 1WCMH 1TWFB 4TVAB 2HQEA 1B70B 4FNFA 1TY2A 1Q12A 1QVGA 3HOVB 1D1IA 3MA2B 2R93B 5IGGA 5JJKA 3NK9A 5DLQE 2F3VA 1S5DD 3JAMi 1HA6A 1GVPA 3NSWA 4RCNA 5IYDG 3I4MB 1MIUA 2M9VA 1U5KA 1PXUA 4C3HH 2LS01 2NUCA 3FP9A 3OTOQ 4JPBW 4IO9A 4CDEC 2OTJA 4AYBG 1N34L 1KIXA 1AZQA 3R93A 3NHHA 3BDLA 4IZ8A 4DR3L 3L9AX 4C56C 2E5LL 4XT1B 1H9SB 4JK1C 4DNRB 5KNBA 2K33A 3DWPA 1GM5A 3TS0A 2A5HA 3A8KE 4A3MB 4HJ7A 1SE2A 2ZJPA 4DR2L 2WINB 5AFWA 5IWAQ 3D4WA 4A3BB 4LUVA 2X69A 2YU9B 4KD3A 3KF8B 1V1PA 1LT6D 3CQZH 2F0LA 3B6YA 3NTHA 1O7LA 2E2JH 2EXDA 3I4LA 4DV0Q 5IYDH 3SE0A 5IOCA 3AEVA 3BYTB 2XWBB 1LABA 4JCVE 3TEHB 2UUCL 2E2HB 4Q0FA 1BCPB 5A2QL 1G8ZD 4GN3B 4HIDA 2V4DA 2E75C 5G3LD 1I3QB 1BOSA 4IPCA 1EZ6A 3BYYB 3KBGA 2EJFC 4FP5D 4IPHA 4A3GB 3VYRA 2MJ8A 4KHVA 2BH8A 2E8GA 3MEFA 1V9PA 3A5UA 2LSSA 4POFA 3I2ZA 2AQ2B 3I56A 2F0TA 2F0NA 2FMMA 1A62A 2B2YC 1WTWA 2QW7A 2WIIB 5KRUA 4LF9L 1CZWA 1I4HA 4K5XA 1BCPC 4R4QA 3EA6A 4A93B 1XTCD 2UXDL 2JK8A 1ZXTA 3ERSX 4XTCS 2RDHA 3GTPH 1I4RA 4B3MQ 1KAAA 5BN5A 2PQAA 3G71A 1EOTA 5CBAE 1N9WA 2KECA 2PI2A 3K59A 3A7LA 3P1HA 2PI2E 1CHPD 1X32A 1CSPA 3MC0B 1PLFA 5EAYA 4ZYSA 5GROA 3UDGA 2K5NA 1WD1A 1K83B 4QIWE 1Y8PB 3KK7A 2XSCA 3K7AH 1E24A 3WDNA 4GLXA 1QB5D 2HCCA 5CV4A 4N9PA 4R8NA 3HKZG 4FDBA 4KY6A 2IX1A 1BVSA 3NQIA 2FMCA 3TZUA 2IY5B 1BBWA 5IP7G 5BR8Q 4LF5Q 2HQLA 4EVOA 4KV6A 1W6JA 2ZTEA 2NVXH 3SK6A 1QE6A 2DGYA 4RG1A 2VXWA 4AIMA 3T1HL 2EY6A 3CCUA 4LWCA 5I2YA 2F0FA 4RKLA 1S72A 1PA6A 3HG9A 2OEOA 2XRSD 4X64L 1B3AA 2WKDA 2J7ZA 3GQBA 4DAMA 2F4VL 1OXVA 1XNRL 1SMYC 5LMUL 4GNXB 3CCQA 4QL5A 1VQ5A 4GLAC 1GUWA 1BBUA 3HOXB 1STHA 1SNCA 3M4OB 4JI8L 2R6GA 5IP7H 5CV8A 1DOKA 4AQYL 5H1SE 2R7FA 4EQOA 2LKVA 1G291 4ID6A 1EFWA 1IKLA 5DEHA 1M1KC 1B8AA 3HOWG 2F3IA 3NPPA 1Q3LA 3VYSA 1GOZA 2Y0SB 3EIVA 3BG3A 4KJNA 1PFBA 1BCPD 1IYUA 4IOAA 3S1NH 3GV3A 4LFCQ 2EDGA 1VQCA 2UUAL 4HIMA 4YCUA 3C46A 1IBML 2UXCL 3T51B 1VQ8A 4X66L 1N32Q 1Q46A 3T4AC 4A3IB 1EIYB 2YYZA 1G2SA 5CV5A 4G7HC 4K2KA 1YVCA 1K0RA 3TBIB 3G6JB 4NW2A 1GHKA 4L6TB 4DN4M 4DF7A 4DA2A 2JA7B 3K0YA 2SDFA 3GTKB 4K0KL 4DUYQ 1H9JA 1FNVA 4TSSA 5E7NA 1X9NA 2PMZB 2PZWA 4GKKL 2KHIA 1EWCA 2K14A 4IUQA 3PUYA 1Q7YC 3K5LA 1H95A 4A3KB 1UE6A 2RF4A 3R8BA 3D31A 3PIPA 2R93G 1SYGA 5LL6X 3I91A 5EQ0A 2X6LA 1PRTF 1W6KA 2A6ED 1WTVA 3EFXD 5M3MB 3MHBA 4HMJA 3I4MG 3KDFB 2ZTDA 1S4ZA 4YY3Q 4UAIA 2XTIA 5JJZA 4OGQC 3I72A 1SYFA 1EYDA 2FINB 3OYYA 2B39A 4DK6C 2ENBA 1S40A 4HEDA 2IX3A 2F0DA 4YHHQ 5CBEE 2LMCB 3HOZB 2KJXA 1Q1EA 1GUTA 4PMWA 4LF8L 5I6WA 1H9SA 1SMYD 4H0LC 4DR4Q 1A6XA 1OXTA 4A3BG 1TXYA 2R93H 4BBRB 2JJQA 2KUMA 2UXBQ 3M4QA 3I4OA 1BDOA 2RSNA 3CCRA 2XIWA 1SE3A 1X55A 3KF8A 1QZGA 3W5OA 1FNWA 2IHEA 3H3VI 1YNXA 2VW9A 4EQ5A 4QUFA 3VR6A 3CCEA 4S3SA 3S24A 1EEFD 3NBHB 1C0AA 5BN4A 4FYDA 1A3TA 1WCMB 2B2VC 5K36G 3BU2A 2TSSA 1MJEA 3CC4A 2B2WC 4A3BH 3HZXA 1A2UA 2RVLA 1STEA 4LNQA 2I0QA 4JI4Q 3S15B 1STBA 1E0BA 3HGBA 5GADC 2ZXPA 1L0XB 4X6AH 4LMQD 1SBBB 3J81i 3C3LA 3BVGA 3UE0A 4A93G 1T5XD 2A73B 4G57A 1RKNA 1XPRA 3CU7A 3A74A 2H5XA 1SYBA 2VS1A 3KLWA 4JOIC 4RGMA 4JYAL 2Q8TA 2K52A 4LUOA 5K36H 4A3JB 5KIXA 1X6OA 1KL9A 1Z47A 4O42A 4HMIA 4KLKA 1B1ZA 4JBWA 1FR3A 4L63B 2EYMA 4RA8A 2L9HA 4K6DA 3ZJYC 2F0WA 2RQXA 2RHQB 1PFSA 1LT3D 5F2DA 4JI7Q 2EIFA 1TWGH 1I4GA 1XPUA 5M5YH 1VQKA 4AYBB 1XTDA 2KHJA 4A93H 2K04A 4QF4A 3U50C 1LACA 1NE3A 2H4OA 4U68A 2CCZA 3ICEA 3K6OA 2WB1E 1JE5A 2RHSB 3P75A 2RDFA 2XNAC 1PZKD 4GOPB 1STAA 1IW7C 1ET6A 4IJLA 3DUZA 1Q90A 4B3TQ 2F1MA 1MBYA 2E76C 1VQLA 4WRDA 3NE5B 3W1BA 3EVQA 2FJ2A 3A55A 1A15A 2D62A 3GTLB 1Q82C 3AFQA 3MZ5A 3QOJA 3NQTA 2QDBA 2D0OA 2UU9L 3J80i 3GO5A 1UUPA 1VQAA 4DXGA 3F2CA 4OHJA 4XIGS 2N88A 1I50H 1RJTA 3GTJH 2IL8A 2AWNA 4Y7NH 1SXTA 1SLJA 3HOXG 4JI5Q 2QEXA 3LGJA 1HNWL 4GNXA 1T5EA 4C1NK 2F0GA 3NXWA 5K5PA 1DYQA 5A35A 4LF4Q 2Y0SG 3H94A 4QJFA 1K3BC 4XT3B 2L5TA 3K7UC 4JG2A 5CGKA 5C44B 2R61A 3K7AB 1STYA 2K5HA 2F0IA 1HQRD 4NPSA 1O7ZA 2KOLA 4HJAA 1N33L 1NMFA 1HPCA 3MXGA 3RLOA 1K73C 2BE5C 1X3FA 4DKAC 3HOXH 4FVMA 1PTOC 1Z7TA 2ALYB 5FK9C 1I5FA 4J6HA 2NVXB 4A4IA 4ZK9B 1L0WA 4F8MA 2JA7G 2EQSA 2MUYA 2HCIA 1SYCA 1LTGD 3MXPA 1KAWA 1AFPA 3K80C 1DXMA 1B50A 2PNRC 1XMQQ 1WTXA 3C2PA 3F8TA 3FEWX 3GDEA 2I07B 3MVVA 1NCVA 1VQNA 3S2HB 2OQKA 1WTRA 4ZKBB 1IW7D 3JAMc 2A6HC 2CWPA 4DV5Q 3FRPB 3KFUA 4DK1A 5JEAG 4B3RL 5IT9E 1S5FD 2JA7H 3CHBD 3K58A 5KYLA 3KDFA 4NXNL 4JI1Q 5CV6A 1KDCA 1Z6HA 1GD7A 3QWNA 3ULLA 4JI3Q 2N78A 2OQ0A 5KGUA 1AZPA 3HOZG 4NP5A 3S1NB 4RGNA 3UDIA 4Z9CB 4YWKA 2A69C 4BBRG 1N34Q 4P74A 3DXJC 2PO4A 5EPJA 4KN4C 5FLXE 2E5LQ 4KI0A 1X65A 4JBJA 4RWSC 1VQIA 1Q8KA 1A3VA 3TSSA 3JAML 4OIJA 4PZ8A 1VQ9A 5JEAH 4L5SA 3E0EA 5I2XA 1EL0A 1YIJA 1HZBA 1KRSA 2ZM6Q 1K8OA 4IUNA 5NUCA 4GKJL 4P72A 1R4QB 4KJOA 2DUDA 4DV2Q 3Q23A 3DMUA 2F52A 1EOVA 5JPMC 3HOZH 1NMGA 2KA7A 1V1OA 4R4TA 3NBHA 4UP9A 4JOIA 1IYJB 1E2WA 2UUCQ 2BE5D 3KJOA 4KY7A 4BBRH 2JYOA 4A3EB 3QB3A 3WOEA 1PTOD 3S16H 5KNCA 1GJXA 4K2LA 4DK3C 1YJWA 4HJ8A 3NEMA 3GV6A 5HURA 1TKWB 2XRQD 3K57A 2EYLA 5HY6A 2KBNA 2Z6KC 1F9SA 5FO9B 4HCEA 4BBSH 4RAUC 1HR0L 3K8AA 5C3EG 3C1EA 3QG1A 1MSGA 4A3JG 2KEEA 3I55A 4U673 3RUZA 4J15A 1HNXL 4ODGA 1N8RC 3G6EA 1EY7A 1SNMA 2F03A 1JJGA 1IBLQ 1BNZA 2A6HD 4CHTB 5IYBG 3ULJA 4DV7L 1AE3A 4DV1L 1JORA 5I9PA 1JJCB 4CKBA 4OIKA 3M85A 1LT4D 3VYTA 3PUVA 2NVQB 3DEPA 4C3JB 3DM3A 1I94L 2EY2A 4DV6L 4DU9A 3CPWA 1P16A 1QNUA 2WAQB 3PQIA 1TQOA 4K5VA 4AYBE 5C3EH 1JOOA 1VQGA 4A3JH 2A69D 1M90C 2EE1A 1X3GA 4RGOS 2JP1A 4GOPA 2CQAA 4DAYB 3PO3H 3RLNA 1CKNB 5IYBH 3U9OA 2PYKA 2O5JC 1BQQT 2EY1A 3K81C 5IODA 1JB7A 4UPAA 2B29A 3SK4A 5C6AA 5CMDA 1CQVA 1X3PA 1S5CD 2RSOA 2DNEA 2BDOA 3S14H 1I6HH 1E2ZA 1QG7A 1HA5A 3KLRA 2VB3X 1K0SA 1PMRA 1GHJA 2NZ1D 1DGSA 3V05A 1ASYA 1A3UA 3T1YL 2F0MA 2MFIA 4IJHA 2Z4IA 4JI0L 1JE4A 4XQNA 4EQNA 3BZCA 4APVA 4X64Q 3IKJA 2SNMA 5GQOA 3V96A 1TU2B 1LV9A 1OTCA 5LMUQ 3GTLH 1GUNA 5KNDA 4B3SL 3QOLA 3S17H 1TWGB 5C44G 1I4XA 1ZKOA 1QZHA 1TS4A 4JI6L 4HCSA 3BS1A 4LAAA 5M5YB 4CJ2C 3DM1A 4RKBA 4QMGA 5EJWA 3MFYA 2Z9HA 4NMZA 2Q2UA 1ICFB 5G3LF 1PH3A 2NN6I 3PSIA 2YTYA 4MNOA 1PTOH 1A2TA 3PUWA 4KN7C 1L1OB 5LMNL 4CKEA 1STGA 3FMCA 1C7YA 2MQHA 4A3DG 2UXCQ 1KDAA 1QVCA 4DR6L 1JQYD 1IL8A 1JOKA 1LTID 2JA5B 1SE4A 2MPMA 2BA0A 3PGZA 1SNDA 2I5LX 2O4XA 2K6AA 3DWQA 5ISRA 2RA4A 4ME5A 4WFN3 1DOLA 5C44H 4DUZQ 1VQ4A 2QKIC 3BVMA 1XMOL 4K0KQ 3KYHC 2ZXOA 3DLLA 4JV5Q 1I50B 2RCNA 3GTJB 1C48A 4Y7NB 3OWEB 1J8IA 1CK1A 1L1OC 5IYCG 4DR1Q 5C4JB 4OWXB 4RCOA 3HKZE 3RN2A 1ESFA 1XPOA 4A3DH 1KABA 2NBFA 1XNQQ 3HOYB 4QB4A 5T1GA 1AP0A 2KCNA 4PQXA 1PH6A 1Q86C 1EFID 2HHHL 3U9SA 4DR5Q 1DCZA 2JEAI 3VR4A 2BDNA 2L55A 3R3OA 4BY1G 1B3QA 2M00A 3RZOH 4XDXA 4PNYA 4YWMA 1SSOA 2R3ZA 2CHBD 4DNIA 3S2HH 1K8GA 1EIHA 5E1FA 2UUBL 3TP7A 3TZDA 3MAQA 1CZGA 2EYPA 4K8IA 5IYCH 1HH2P 3BDOA 3L0OA 1PV4A 3FPUB 1JOQA 4UHVA 4LF8Q 1LUZA 1RTNA 1SJED 1HNZL 3TS2A 3WOFA 2OXPA 1HZAA 1PZID 4QY7A 2G9DA 1HUMA 3GTQH 3CD6A 1E22A 4J8QA 1D5ZC 4F88A 1ENFA 2JQOA 2GN5A 4ABNA 1YHQA 1EU3A 4BY1H 2EJMA 4A3EG 5IGCA 5C0XG 1C9OA 2CW0C 3OPOA 3SDZA 4F7XA 1E3PA 4IPDA 3MEHA 1NSNS 3ERQA 3P20A 1HQMC 2IHFA 1B4OA 1EUJA 4IPGA 2G9HD 2P5ZX 4OO1I 4I65A 4IUVA 5D3DA 1UE5A 3TN2A 5JVH3 1D1KA 4DFAA 3J81c 1ENCA 3F2DA 5C3WA 3K0XA 1YNJC 1Y1VG 1E1TA 1JT8A 3VR2A 4FF3A 2X6GA 2AQ3B 1BCPF 2JE6I 3R2IA 1N36Q 3PO2B 1ILQA 3C1FA 5FKAC 1HTLD 4YWLA 4A3EH 1J9OA 4R9WA 1DM0B 5C0XH 4LF7L 1WTPA 2VUMG 2PCFB 4K8JA 3I7FA 4MHEA 4XYOA 3LWEA 1VF7A 1F2MA 5KEEA 1QUQB 2EVBA 4YIJA 4FXKC 1RHPA 2AMCB 4C3JG 3CCVA 5DAUA 5CC4A 5IIFA 1UEAB 5ELNA 1LYLA 1XXGA 2EXZA 2WAQG 3IFTA 1B53A 5GAHC 3J81L 1Y1VH 1R4PB 1VDZA 4ZUJA 3RZDB 1VQHA 4G7ZC 2ZXRA 3NBIA 1FGBD 3TP6A 1QVFA 2L12A 4ZRZA 1F9PA 3CC2A 3KLSX 2Q8IB 3FKIG 5ELDA 3S16B 3CCJA 1EY5A 4LJZC 1VQEA 1CFMA 1RF2D 2M2LA 2VUMH 2WKCA 2XWJB 4R4CA 2OT2A 1CKNA 1Y14B 2PW7A 1PZJD 2NVQH 3EROA 4K6LA 4C3JH 1J5EQ 1RL2A 4KHPL 2B2YA 4OONA 1AH9A 4IALA 1K8MA 3J80c 4BBSB 2DN8A 2K5DA 2QEJC 1KDBA 2F0KA 3STBC 1LM0A 1FGUA 1TWAH 1NY4A 2B2TC 2CW0D 4LFCL 1BBXC 3FKIH 3CXCA 5A2QE 5HGQA 5D14A 4X62Q 1N32L 1PH1A 2LXKA 2CH4A 1TS5A 1EY9A 2WACA 1SROA 4IN3A 3OHXC 1Q81C 3M3YH 2MO0A 2XVSA 1WD0A 1RCVD 3EQLC 1HNWQ 3HP3A 4LFBL 1LLRD 3NELA 4XQJA 2LXJA 3A7AB 1YNJD 1MGSA 1RD9D 2F0EA 2ATWA 2JN4A 3OIPA 3J80L 3TRZA 5C3EB 4NXMQ 2ASBA 1A63A 4IFDG 2KQ3A 1SFOH 4KKSA 4CDDC 5EGTA 4V0BA 3K5OA 3PO3B 3J7ZC 4ZQ3A 1NUCA 1Z9FA 2Z6BA 2F0UA 2JA5G 1N33Q 1HTPA 4CBVA 5C3XA 1KRTA 4JI2L 1PFNA 3S14B 2YTVA 1I6HB 1EYCA 1XJVA 4JVZA 2N3SA 1VQMA 4YY3L 2C5CA 4ALPA 1K28A 1E1OA 4GN4B 3S15H 1CKOA 3SK8A 4DV3Q 2F0PA 5CORA 3M7NA 2Z8LA 3GTMB 4KHZA 4IFDH 3IFDA 4YHHL 3R2TA 1F2LA 2PNHA 2PPBC 2EY5A 5JAVA 4DR4L 1VQJA 3HOYG 2NVYH 4RGTA 5ELCA 2K28A 3S2DB 2N49A 3EJIA 2JA5H 2B63G 5JJLA 2R7DA 2R92B 4OELB 1VS0A 1AW7A 2E74C 3S17B 2EZVA 1VCIA 1TS2A 2C35B 4R1JA 1WOCA 3I4NG 2AHOB 3SK5A 3STBD 2KEDA 1GO3E 4UP8A 5CV9A 4FXGC 1PTOB 1QCBD 3VR5A 1S5BD 3SGIA 5C4JH 1IBKL 5M5WH 3DWAA 2QA4A 4WJWA 4H13C 2HIXA 2A1AA 4L8JA 5I9OA 3HOYH 1CM9A 1EY0A 2L0CA 2J4XA 1VQOA 2B63H 1U4RA 3NUCA 4RHRA 4JI4L 4X65Q 1PDQA 1UAPA 2I46A 1MHWC 5EBDA 1XX8A 1OO9B 5M9OA 1UEBA 5FOBB 2Y0SE 4I7AA 3TP8A 3I4NH 2WP8J 1IKMA 2AKWB 2E2IB 1J6QA 1WTHA 5IGFA 1MI2A 4DV4Q 1EU4A 1JWMD 1HRJA 4PZ7A 1VMPA 4JW0A 2A74C 1SNOA 3L7ZC 1WYDA 4A3DB 1JB3A 3I70A 3GTOB 1JWUD 3TQYA 4N9TA 3OOCA 1WI5A 1CTMA 1ENAA 1WVLA 1SNPA 3A8IE 1YI2A 3U58A 2PMZE 3PO2G 1ILPA 2VQEL 1PH2A 3MXUA 1L0YB 2SEBD 4GN5A 2F0OA 3RZOB 4N8FA 4AH6A 4NKLA 1TWHH 4ZUIA 4QIWB 3IAYA 5DM73 3OW2A 2CH4W 3Q22A 2Q2TA 4CJ1B 4O2DA 4IUTA 3CC7A 1F2ZA 1KLGD 3NENA 4MTKA 2B2UC 4KMUC 4HSVA 4X3UA 4JBKA 3CMAA 1VQFA 4B3TL 1QUQA 1UNSA 2VB2X 3UDFA 4DV7Q 3OW7A 5C4HA 1A8VA 1D6EC 5DNFA 4DV1Q 3GTQB 3F2UA 2F3WA 4TKOB 3PO2H 1SAPA 3A56A 4RH6A 1T9HA 1TIID 2B2VA 3VR3A 3H0GG 4BY1B 1EIFA 1NJIC 1I94Q 3KF6B 4FXDA 2L1BA 1X3QA 2B2TA 1UWVA 3TREA 4DR3Q 1YJ9A 3CRKC 2B2WA 1ML0D 4LK1C 4CDCC 1W3SA 2Q2HA 4JI5L 2DJGC 3D8GA 5LMNW 3T16A 1WTQA 1CQFA 1U9RA 4DR2Q 1II3A 1EY8A 2BCOA 3CMEA 4OL7A 4BBSG 4A3FH 2DJFC 2F0SA 1Y8NB 2I5MX 1HZCA 4LF4L 3TP5A 3RZDH 1HFNA 5AJ3L 4OX9L 3H0GH 5C0XI 1LTTD 4UDUC 1TVXA 1H9RA 1D8LA 4KKUA 3X3MA 2I5HA 2L11A 1H9MA 2IT1A 1ICWA 2K7VA 2VL6A 1FVIA 4DNTB 2CFMA 1HCZA 4JI0Q 2MGSA 1YZ6A 3Q24A 1A0IA 2IX0A 1NBWA 1U0LA 1NR4A 1E7ZA 2PZTA 1F2YA 2Q2IA 3F2BA 1Y1VB 5C4XG 4R8IA 1GUSA 1D5XC 4B3SQ 2JSOA 1FD7D 3F1ZA 5CR3A 4KD4A 1XMQL 4LF9Q 3ONAB 4KTAA 3K5MA 4WJ4A 3PO3G 5CYUA 1VMCA 3DHQA 1YEZA 3EN2A 2UXDQ 2VUMB 2ZJRA 1PTOF 1IXRA 1TR5A 1TS3A 2FHTA 3SHLA 1W2BA 1VQ6A 5LMNQ 4G4KA 4DV5L 2BH2A 1CI3M 1EWIA 1JC7A 2H1EA 4MIUA 3VA5A 4JI1L 2YV5A 3IL8A 5EBCA 1EEID 1SYDA 2VQFL 4DR6Q 2AQ1B 3MTSA 1EZ8A 4JI3L 5C4XH 3FDTA 2ICIA 3AB9A 1VQPA 2HUGA 4QUCA 1L2FA 2DY7A 1TWAB 3E9IA 2K1BA 3FKIB 2K4KA 5FJ8G 1XMOQ 1K9MC 1NAPA 3HS0C 1FJGL 1K8AC 3H6MA 4HR7B 2K50A 2QCPX 3M3YB 2XGTA 2R92G 2D0PA 1M4VA 1PH4A 2HDMA 1EWHA 1IYVA 4PG3A 2GVBA 3HFZB 3I8ZA 1QWYA 2ZM6L 3WWVA 3T1HQ 3QJYA 4DV2L 3PF5A 1EY4A 1U4LA 3GTMH 4GZYC 3ER0A 2HHHQ 3S1QB 4ILWA 1G6PA 4LFAL 1SFOB 1TY0A 1EY6A 4H44C 3S1MB 4C3IG 5FJ8H 4ZKCB 1V43A 2F4VQ 1KLUD 3S2DH 2ES2A 1XNRQ 4LF6L 5D65A 1O78A 2RCFA 2EYHA 4C1NI 2R92H 3VA7A 2UUBQ 4JI8Q 1PRTB 2SNSA 1G2TA 2CQOA 4AQYQ 3W2DA 1VQ7A 1HNZQ 1SN8A 3VDYA 3KLSA 3A5ZB
chains in the Genus database with same CATH topology
4IFDI 1GUOA 2NWGA 3QIAA 3BVZA 4IURA 3PV0A 1STNA 4KY5A 5ELBA 2XN9C 3BZDB 4FF1A 5D3IB 2B2UA 2NVYB 2QF7A 3FVQA 1HHVA 2F0QA 3GD7A 2D2CC 1PRTC 2R7ZB 2K01A 1SJHD 3T53B 2ICEC 3ITPA 3GTGB 4PMBA 4X3TA 2CVRA 1PFMA 3N6RA 2F0VA 1DJRD 2B8GA 5JOBA 5IGEA 4IFDJ 5M5WB 1ZYRC 3E5SA 2PW5A 1XWEA 3NWSA 4BWGB 4H7BA 5FO7B 2WB1B 4PMCA 4Q5VA 3LNNA 3S9WA 1EIGA 2B63B 1V8QA 5EKIA 1PYWD 1QOHA 1O80A 1BXTA 5M5XB 2A6EC 2IW3A 1RDPD 3D3RA 3I4NB 1AEXA 4J1MA 3CRLC 1F9RA 1KNEA 3LX0A 3PUXA 1AN8A 4EGVA 1B2TA 3PUZA 1TT2A 2PZUA 2JXMB 4ZLTF 4E6IA 3J7AV 4HSPA 4ULLA 2JA6B 4RFBA 3BDCA 4QCLA 1JR0D 3OSOA 2F0JA 2AUKA 3FPPA 2EPBA 3PIO3 2K32A 3JAME 2A68C 1HUNA 1Y69U 3D4DA 1WTOA 1TWHB 1S5ED 5BN3A 1I4PA 2LY7A 1B44D 4EQPA 4BA2I 1I4QA 1PRTD 5LL6S 3KUPA 3A8JE 1B9MA 3D4RA 1OXUA 3NTKA 5T1IA 4XXEA 2NVTB 1LTBD 1C8CA 2ZT9C 1DZ1A 3OWFA 1ZYRD 4BS9A 4K5WA 2K05A 3D6CA 5J39A 4IUPA 5IT9L 3I73A 3GP7A 5M3FB 4RHSA 4M8AA 3UI2A 4A3FB 2EYOA 2RDGA 4I7ZC 1JICA 1DONA 1U4PA 4MN3A 1F9QA 5JPNC 4FF4A 3H0GB 1EYAA 5FLXL 4DAYA 4M1UB 3SXHA 3P7JA 1M8AA 5JEAJ 1BO0A 1SYEA 3T13A 3NP8A 1Y8OB 3A54A 2A68D 2ID0A 5JVG3 1BF4A 4CKCA 4PV1C 1G6ZA 4DGZA 3K5NA 4TRDA 3J7AF 2K03A 5E4XA 4DK0A 1QNKA 3H91A 4XQQA 4DXFA 3ZYYX 3M4YA 4TQUS 2GA4B 5E4WC 1CHQD 3ND8A 3N52A 4DAVA 1SNQA 1G91A 5EKKA 2SOBA 1GUGA 5C4XB 1RTOA 2MP1A 4C3HB 3SVMA 1JWSD 3H09A 2LFNA 1GXDC 3TMEA 4XYQA 5J22A 3H3VC 1YNNC 4P2CB 5TSSA 4CGYB 2NTSA 1ONLA 3Q6SA 3PMFA 3L3OC 3VYUA 3KBXA 2NN6G 1LTRD 1QJOA 4FF2A 4G7OC 2E2DC 1D2BA 2O5IC 3RMHA 3W3AA 3CQZB 1DD2A 5HGTA 2E2JB 2NYZD 3ND9A 2D5DA 4CJ0B 2Q8RE 3QO2A 3X3NA 3D6WA 2J0TD 1E2VA 4X3SA 2VNUD 1C4QA 3OMGA 2F4IA 2D9UA 2B8FA 2L4NA 1HFGA 1ZEQX 4BA1I 2NN6H 5EPLA 1LTAD 1D5MC 1EQTA 1V1PB 4DAPA 5EPKA 3CKIB 3SEBA 2BOSA 1O7YA 2KHSA 1QILA 3MWYW 3I90A 1NR2A 4C3IB 5I6YA 5I4DA 1BUVT 2JEBI 1I6VC 2AWOA 1Q1BA 1Q8IA 3HEJA 5ELFA 2QILA 3GTPB 3J7YW 3DEOA 1ET9A 1OXSC 3E0JA 2Z1CA 2EJGC 2WV6D 3NWTA 2F0HA 1ESRA 5C5LA 2KCCA 5DM63 3PIP3 1VF5C 1YNND 3S1RB 3O13A 2TMPA 4C2MB 1BR9A 1SEBD 2NTTA 4FO2A 3T56B 1CA5A 4V190 2KVMA 4O1NA 2RBMA 1TWCB 1KNAA 2MHVA 3AMUA 2HDLA 1RODA 2FFKB 3Q0AA 1HXYD 3HOUB 4OO1G 1FYCA 5IGDA 3OIQA 4ZAIA 2OF1A 3LWUA 1U4MA 2O2LD 1XYIA 4KKTA 4HTHA 4BY7B 2JA8B 4B08A 2IJ0A 1CA6A 1EQVA 3MXNA 1SDFA 1KTKA 4X3KA 3HKZB 4WORA 2DY8A 2DNCA 4HN7A 3OMCA 1H9KA 2Z4HA 1R9TB 5COYA 1CT1D 1FNUA 3SR1A 4OO1H 2AUJD 3J81E 2N55A 4IUUA 3AU7A 4KK7A 3NTIA 5CV7A 4F87A 5C4ZA 2EYJA 3V2TA 4B9WA 2RKSA 3MFGA 3URYA 5J1ZA 2NB0A 2IPKD 3I3CA 2PQEA 3TDQA 1MSHA 5KYIA 1LT5D 3M7GA 1F77A 2C9OA 2EOTA 1MD2D 5EKLA 4NDXA 3HOWB 1LTSD 3HRZC 5ELEA 1B9NA 1JCKB 4IQZA 5IGBA 5C5MA 1DOMA 1LO5D 1IHZA 2K5QA 2K5WA 5LHY1 1OXXK 4K14A 1Y1WB 4B9XA 5E3FA 4HAEA 2IWHA 4C3HG 3G7LA 2BA1A 3RD4A 3E6ZX 5FO8B 2EYFA 3RLFA 5C0XJ 3J80E 1TWFB 2HQEA 4FNFA 1TY2A 1Q12A 3HOVB 1D1IA 3MA2B 2R93B 5IGGA 3NK9A 2F3VA 1S5DD 1HA6A 3NSWA 4RCNA 3I4MB 2M9VA 1PXUA 2LS01 2NUCA 1AZQA 3R93A 3NHHA 3BDLA 4IZ8A 3L9AX 4C56C 4XT1B 1H9SB 4JK1C 4DNRB 5KNBA 2K33A 3DWPA 2A5HA 3A8KE 4A3MB 1SE2A 2WINB 5AFWA 3D4WA 4A3BB 2X69A 2YU9B 4KD3A 1V1PA 1LT6D 2F0LA 3NTHA 1O7LA 3I4LA 3SE0A 5IOCA 3BYTB 2XWBB 1LABA 2E2HB 4Q0FA 1BCPB 5A2QL 1G8ZD 2V4DA 2E75C 5G3LD 1I3QB 1BOSA 1EZ6A 3BYYB 3KBGA 2EJFC 4FP5D 4A3GB 3VYRA 2MJ8A 4KHVA 2AQ2B 2F0TA 2F0NA 2FMMA 2B2YC 1WTWA 2WIIB 5KRUA 1CZWA 1I4HA 4K5XA 1BCPC 3EA6A 4A93B 1XTCD 1ZXTA 4XTCS 2RDHA 1I4RA 1KAAA 5BN5A 1EOTA 5CBAE 2KECA 3K59A 3A7LA 3P1HA 1CHPD 1X32A 3MC0B 1PLFA 4ZYSA 1WD1A 1K83B 1Y8PB 3KK7A 2XSCA 3WDNA 1QB5D 2HCCA 5CV4A 4N9PA 4R8NA 4KY6A 2IX1A 3NQIA 2FMCA 3TZUA 4EVOA 4KV6A 1W6JA 3SK6A 1QE6A 2VXWA 2EY6A 5I2YA 2F0FA 4RKLA 3HG9A 2OEOA 2XRSD 1B3AA 2WKDA 2J7ZA 3GQBA 1OXVA 1SMYC 1GUWA 3HOXB 1STHA 1SNCA 3M4OB 2R6GA 5CV8A 1DOKA 4EQOA 2LKVA 1G291 4ID6A 1IKLA 5DEHA 3NPPA 1Q3LA 3VYSA 1GOZA 2Y0SB 3BG3A 4KJNA 1PFBA 1BCPD 1IYUA 3GV3A 2EDGA 3C46A 3T51B 3T4AC 4A3IB 2YYZA 1G2SA 5CV5A 4G7HC 4K2KA 3TBIB 3G6JB 4NW2A 1GHKA 4L6TB 4DN4M 4DF7A 4DA2A 2JA7B 3K0YA 2SDFA 3GTKB 1H9JA 1FNVA 4TSSA 2PMZB 2PZWA 1EWCA 4IUQA 3PUYA 3K5LA 4A3KB 3R8BA 3D31A 1SYGA 5LL6X 3I91A 5EQ0A 2X6LA 1PRTF 1W6KA 2A6ED 1WTVA 3EFXD 5M3MB 3MHBA 4HMJA 1S4ZA 4UAIA 5JJZA 4OGQC 3I72A 1SYFA 1EYDA 2FINB 2B39A 2ENBA 4HEDA 2IX3A 2F0DA 5CBEE 2LMCB 3HOZB 2KJXA 1Q1EA 1GUTA 4PMWA 5I6WA 1H9SA 1SMYD 4H0LC 1A6XA 1OXTA 4BBRB 2KUMA 1BDOA 2RSNA 2XIWA 1SE3A 3KF8A 1FNWA 4QUFA 3VR6A 4S3SA 1EEFD 5BN4A 4FYDA 1A3TA 1WCMB 2B2VC 5K36G 2TSSA 2B2WC 3HZXA 1A2UA 2RVLA 1STEA 1STBA 1E0BA 3HGBA 2ZXPA 1L0XB 4LMQD 1SBBB 3C3LA 3BVGA 1T5XD 2A73B 4G57A 1RKNA 3CU7A 1SYBA 4RGMA 2Q8TA 5K36H 4A3JB 5KIXA 1Z47A 4O42A 4HMIA 1B1ZA 4JBWA 1FR3A 4L63B 2EYMA 4RA8A 2L9HA 4K6DA 2F0WA 2RQXA 1LT3D 5F2DA 1I4GA 4AYBB 2K04A 4QF4A 1LACA 2H4OA 4U68A 3K6OA 3P75A 2RDFA 2XNAC 1PZKD 1STAA 1IW7C 1ET6A 3DUZA 1Q90A 2F1MA 1MBYA 2E76C 4WRDA 3NE5B 3EVQA 2FJ2A 3A55A 1A15A 2D62A 3GTLB 3MZ5A 3QOJA 3NQTA 2QDBA 3GO5A 1UUPA 4DXGA 4OHJA 4XIGS 2N88A 1RJTA 2IL8A 2AWNA 1SXTA 1T5EA 4C1NK 2F0GA 3NXWA 5K5PA 1DYQA 5A35A 3H94A 4XT3B 2L5TA 5CGKA 5C44B 2R61A 3K7AB 1STYA 2F0IA 1HQRD 1O7ZA 2KOLA 3MXGA 1HPCA 2BE5C 4FVMA 1PTOC 1Z7TA 5FK9C 4J6HA 2NVXB 4ZK9B 4F8MA 2MUYA 2HCIA 1SYCA 1LTGD 3MXPA 1AFPA 1DXMA 1B50A 2PNRC 1WTXA 3C2PA 3FEWX 2I07B 3MVVA 1NCVA 3S2HB 1WTRA 4ZKBB 1IW7D 2A6HC 3FRPB 4DK1A 5JEAG 5IT9E 1S5FD 3CHBD 3K58A 5KYLA 5CV6A 1KDCA 1Z6HA 3QWNA 5KGUA 1AZPA 4NP5A 3S1NB 4RGNA 4Z9CB 2A69C 3DXJC 2PO4A 5EPJA 4KN4C 5FLXE 4KI0A 4RWSC 1A3VA 3TSSA 3JAML 4OIJA 5JEAH 5I2XA 1EL0A 1K8OA 4IUNA 5NUCA 1R4QB 4KJOA 3Q23A 3DMUA 5JPMC 2KA7A 1V1OA 3NBHA 1E2WA 2BE5D 4KY7A 2JYOA 4A3EB 3QB3A 3WOEA 1PTOD 5KNCA 1GJXA 4K2LA 3GV6A 5HURA 1TKWB 2XRQD 3K57A 2EYLA 1F9SA 5FO9B 4HCEA 4RAUC 3C1EA 3QG1A 1MSGA 2KEEA 4U673 3RUZA 4ODGA 2F03A 1EY7A 1SNMA 1BNZA 2A6HD 4CHTB 1JORA 5I9PA 4CKBA 4OIKA 3M85A 1LT4D 3VYTA 3PUVA 2NVQB 3DEPA 4C3JB 2EY2A 4DU9A 1QNUA 2WAQB 1TQOA 4K5VA 1JOOA 2A69D 2EE1A 4RGOS 2JP1A 2CQAA 3U9OA 2PYKA 2O5JC 1BQQT 2EY1A 5IODA 5C6AA 3SK4A 5CMDA 1CQVA 1X3PA 1S5CD 2RSOA 2DNEA 2BDOA 1E2ZA 1QG7A 1HA5A 3KLRA 2VB3X 1PMRA 1GHJA 2NZ1D 3V05A 1A3UA 2F0MA 2Z4IA 1JE4A 4XQNA 4EQNA 3IKJA 2SNMA 3V96A 1TU2B 1LV9A 1GUNA 5KNDA 3QOLA 1TWGB 1I4XA 1ZKOA 5M5YB 1TS4A 4HCSA 3BS1A 4LAAA 4CJ2C 3DM1A 4RKBA 4QMGA 5EJWA 3MFYA 4NMZA 5G3LF 2NN6I 1PTOH 1A2TA 3PUWA 4KN7C 4CKEA 1STGA 3FMCA 1KDAA 1JQYD 1IL8A 1JOKA 1LTID 2JA5B 1SE4A 2MPMA 2BA0A 1SNDA 2O4XA 2K6AA 3DWQA 5ISRA 2RA4A 4ME5A 4WFN3 1DOLA 2QKIC 3BVMA 2ZXOA 1I50B 3GTJB 1C48A 4Y7NB 3OWEB 1J8IA 1CK1A 5C4JB 4RCOA 1ESFA 1KABA 2NBFA 3HOYB 4QB4A 5T1GA 1AP0A 2KCNA 4PQXA 1EFID 3U9SA 1DCZA 2JEAI 3VR4A 2BDNA 2L55A 3R3OA 2M00A 4XDXA 4PNYA 1SSOA 2R3ZA 2CHBD 1EIHA 5E1FA 3TP7A 3TZDA 3MAQA 1CZGA 2EYPA 4K8IA 3BDOA 3FPUB 1JOQA 1RTNA 1SJED 3WOFA 2OXPA 1PZID 2G9DA 1HUMA 4J8QA 1D5ZC 4F88A 1ENFA 4ABNA 1EU3A 2EJMA 5IGCA 5C0XG 2CW0C 3OPOA 3SDZA 4F7XA 3MEHA 1NSNS 3ERQA 3P20A 1HQMC 1B4OA 2G9HD 4OO1I 4I65A 4IUVA 5D3DA 3TN2A 5JVH3 1D1KA 4DFAA 1ENCA 5C3WA 1YNJC 3VR2A 4FF3A 2X6GA 2AQ3B 1BCPF 2JE6I 3R2IA 3PO2B 1ILQA 3C1FA 5FKAC 1HTLD 1J9OA 4R9WA 1DM0B 5C0XH 1WTPA 2PCFB 4K8JA 4MHEA 4XYOA 3LWEA 1VF7A 1F2MA 5KEEA 2EVBA 4YIJA 4FXKC 1RHPA 4C3JG 5DAUA 5CC4A 5IIFA 1UEAB 1XXGA 2EXZA 3IFTA 1B53A 3J81L 1R4PB 1VDZA 4ZUJA 3RZDB 4G7ZC 2ZXRA 3NBIA 1FGBD 3TP6A 2L12A 4ZRZA 1F9PA 3KLSX 2Q8IB 5ELDA 3S16B 1EY5A 4LJZC 1CFMA 1RF2D 2M2LA 2WKCA 2XWJB 2OT2A 2PW7A 1PZJD 3EROA 4K6LA 2B2YA 4IALA 1K8MA 4BBSB 2DN8A 2K5DA 2QEJC 1KDBA 2F0KA 2B2TC 2CW0D 1BBXC 5A2QE 5D14A 1TS5A 1EY9A 2WACA 4IN3A 3OHXC 2XVSA 1WD0A 1RCVD 3EQLC 3HP3A 1LLRD 4XQJA 3A7AB 1YNJD 1MGSA 1RD9D 2F0EA 3OIPA 3J80L 5C3EB 4IFDG 2KQ3A 4KKSA 5EGTA 4V0BA 3K5OA 3PO3B 4ZQ3A 1NUCA 2F0UA 1HTPA 4CBVA 5C3XA 1PFNA 3S14B 1I6HB 1EYCA 2C5CA 3SK8A 2F0PA 5CORA 3M7NA 2Z8LA 3GTMB 4KHZA 4IFDH 3IFDA 3R2TA 1F2LA 2PPBC 2EY5A 5JAVA 4RGTA 5ELCA 2K28A 3S2DB 3EJIA 2R92B 1AW7A 2E74C 3S17B 2EZVA 1VCIA 1TS2A 3SK5A 2KEDA 5CV9A 4FXGC 1PTOB 1QCBD 3VR5A 1S5BD 3DWAA 4WJWA 4H13C 4L8JA 5I9OA 1CM9A 1EY0A 2L0CA 2J4XA 1U4RA 3NUCA 4RHRA 1PDQA 1UAPA 2I46A 5EBDA 1XX8A 1OO9B 5M9OA 5FOBB 3TP8A 2WP8J 1IKMA 2E2IB 5IGFA 1MI2A 1EU4A 1JWMD 1HRJA 1VMPA 2A74C 1SNOA 3L7ZC 4A3DB 1JB3A 3I70A 3GTOB 1JWUD 4N9TA 3OOCA 1CTMA 1ENAA 1WVLA 1SNPA 3A8IE 1ILPA 3MXUA 1L0YB 2SEBD 2F0OA 3RZOB 4NKLA 4ZUIA 3IAYA 4QIWB 5DM73 3Q22A 4CJ1B 4IUTA 1F2ZA 1KLGD 2B2UC 4KMUC 4HSVA 4X3UA 1UNSA 2VB2X 3OW7A 5C4HA 1D6EC 5DNFA 3GTQB 3F2UA 2F3WA 4TKOB 1SAPA 3A56A 4RH6A 1TIID 2B2VA 3VR3A 4BY1B 4FXDA 2L1BA 1X3QA 2B2TA 3CRKC 2B2WA 1ML0D 4LK1C 3D8GA 3T16A 1WTQA 1CQFA 1U9RA 1II3A 1EY8A 2BCOA 4OL7A 2F0SA 1Y8NB 3TP5A 1HFNA 5C0XI 1LTTD 4UDUC 1TVXA 1H9RA 4KKUA 3X3MA 2L11A 1H9MA 2IT1A 1ICWA 2K7VA 4DNTB 1HCZA 2MGSA 3Q24A 2IX0A 1NR4A 2PZTA 1F2YA 1Y1VB 4R8IA 1GUSA 1D5XC 2JSOA 1FD7D 5CR3A 4KD4A 3ONAB 4KTAA 3K5MA 5CYUA 1VMCA 3DHQA 2VUMB 1PTOF 1TS3A 1TR5A 2FHTA 3SHLA 4G4KA 1CI3M 1JC7A 2H1EA 4MIUA 3VA5A 3IL8A 5EBCA 1EEID 1SYDA 2AQ1B 3MTSA 1EZ8A 3FDTA 2ICIA 3AB9A 2HUGA 4QUCA 2DY7A 1TWAB 2K1BA 3FKIB 1NAPA 3HS0C 3H6MA 4HR7B 2QCPX 3M3YB 1M4VA 2HDMA 1EWHA 1IYVA 3I8ZA 1QWYA 3QJYA 4GZYC 1EY4A 1U4LA 3S1QB 4ILWA 1SFOB 1TY0A 1EY6A 4H44C 3S1MB 4C3IG 4ZKCB 1V43A 1KLUD 5D65A 1O78A 2EYHA 4C1NI 3VA7A 1PRTB 2SNSA 1G2TA 3W2DA 3KLSA 3S15B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR4 A;  1J9O A;  4R9W A;  3DEP A;  1MSH A;  2NWG A;  1B3A A;  4R8I A;  1WTP A;  3DEO A;  2J7Z A;  4IUR A;  2EOT A;  2KUM A;  1WVL A;  4MHE A;  1PFN A;  1J8I A;  2FJ2 A;  5E4W C;  3LWE A;  1A15 A;  3ONA B;  1ILP A;  2RSN A;  3N52 A;  1AZP A;  2B2U A;  1ESR A;  1G91 A;  1GUW A;  2XIW A;  1RHP A;  2EE1 A;  1VMC A;  3KUP A;  1DOK A;  2FHT A;  2JP1 A;  1RTO A;  1HHV A;  1DOM A;  2MP1 A;  2MJ8 A;  5T1I A;  5T1G A;  1B53 A;  5COR A;  4CJ1 B;  1IKL A;  1AP0 A;  4IUT A;  5EPJ A;  4QUF A;  3SVM A;  2K01 A;  3IFD A;  2B2U C;  2N88 A;  4HSV A;  1RJT A;  1DOL A;  4X3U A;  5CMD A;  1C8C A;  2IL8 A;  1X3P A;  1F2L A;  2RSO A;  4X3T A;  4RWS C;  1Q3L A;  2BDN A;  1DZ1 A;  2H1E A;  2B2V C;  2L12 A;  1F9P A;  2CVR A;  3IL8 A;  4OIJ A;  1QG7 A;  1PFM A;  1CA5 A;  1PFB A;  2FMM A;  1EL0 A;  2KVM A;  3GV3 A;  3Q6S A;  4XDX A;  2K28 A;  2NZ1 D;  2B2Y C;  3MTS A;  4HAE A;  1WTW A;  3G7L A;  2M2L A;  1KNA A;  3FDT A;  5DNF A;  1SSO A;  2B2W C;  2HUG A;  2K05 A;  2R3Z A;  3KBX A;  4QUC A;  1EIH A;  3F2U A;  4IUP A;  2HDL A;  1ROD A;  2FFK B;  2DY7 A;  2RVL A;  1XYI A;  1SAP A;  3TZD A;  2K1B A;  2B2V A;  1G2S A;  1ZXT A;  1JE4 A;  3FPU B;  3UI2 A;  1NAP A;  1E0B A;  1RTN A;  1EIG A;  2B2Y A;  2L1B A;  4XT3 B;  1X3Q A;  2B2T A;  4NW2 A;  4ZAI A;  4DN4 M;  5EKI A;  4LMQ D;  1O80 A;  1ML0 D;  1JIC A;  1LV9 A;  2B2W A;  2JYO A;  2KED A;  1EOT A;  2NYZ D;  1U4M A;  5CBA E;  4CJ0 B;  1DON A;  1U4P A;  2Q8R E;  1O7Z A;  2KEC A;  2KOL A;  2SDF A;  3QO2 A;  1F9Q A;  4MN3 A;  2HDM A;  1HUM A;  3D6W A;  3I8Z A;  4X3S A;  1WTQ A;  2B2T C;  2Q8T A;  1X32 A;  3GV6 A;  1CA6 A;  1SDF A;  4IUQ A;  1BBX C;  1HA6 A;  1PLF A;  4X3K A;  2D9U A;  1F9R A;  4HCS A;  1KNE A;  4ZK9 B;  1CM9 A;  3P7J A;  4CJ2 C;  1WD1 A;  3DM1 A;  1U4L A;  2DY8 A;  5D14 A;  2L4N A;  1HFG A;  4O42 A;  2HCI A;  5EJW A;  1U4R A;  1B2T A;  1M8A A;  1F9S A;  1WD0 A;  5EPL A;  1AZQ A;  1PDQ A;  3I91 A;  4RAU C;  5EQ0 A;  1BO0 A;  2HCC A;  3R93 A;  1EQT A;  2X6L A;  5COY A;  3HP3 A;  2L9H A;  4RA8 A;  5EPK A;  4ZLT F;  1WTV A;  1HFN A;  1XX8 A;  1B4O A;  1MSG A;  1B50 A;  1TVX A;  4XT1 B;  4ZKC B;  2KEE A;  4IUV A;  2N55 A;  1WTX A;  4IUU A;  1MGS A;  1IKM A;  2L11 A;  3TN2 A;  1BF4 A;  5D65 A;  1S4Z A;  1O7Y A;  1ICW A;  4UAI A;  1BNZ A;  3MWY W;  5JJZ A;  3I90 A;  1IL8 A;  1MI2 A;  1NR2 A;  1QE6 A;  2EPB A;  1G2T A;  1HRJ A;  5AFW A;  2K04 A;  1NCV A;  1HUN A;  1VMP A;  2MPM A;  1WTR A;  4U68 A;  2FIN B;  2X69 A;  4ZKB B;  1G6Z A;  2K03 A;  4OIK A;  2VXW A;  2X6G A;  5E4X A;  2MGS A;  1ILQ A;  4HED A;  2RA4 A;  1WTO A;  1QNK A;  3H91 A;  3I3C A;  5CBE E; 
#chains in the Genus database with same CATH topology
 4IFD I;  1GUO A;  2NWG A;  4DR7 L;  2KEN A;  3BJU A;  3QIA A;  3BVZ A;  4IUR A;  3PV0 A;  1STN A;  4KY5 A;  2UUA Q;  5ELB A;  2XN9 C;  3BZD B;  4C3I H;  1IBM Q;  4FF1 A;  5D3I B;  2B2U A;  2NVY B;  4X66 Q;  1IBL L;  3RNU A;  2WFW A;  1S3O A;  1EYG A;  2QF7 A;  3FVQ A;  3BZK A;  4R4I A;  3JC6 6;  4HIO A;  1HHV A;  1PYS B;  3G4S A;  2F0Q A;  3GD7 A;  2D2C C;  1PRT C;  2N8N A;  2ZJQ A;  2R7Z B;  2K01 A;  1SJH D;  3T53 B;  3OTO L;  2ICE C;  3ITP A;  3GTG B;  2Z0S A;  4PMB A;  4X3T A;  2E2I H;  1PVO A;  2CVR A;  3HOU G;  1PFM A;  3N6R A;  1VQB A;  2F0V A;  4GKK Q;  1DJR D;  2B8G A;  5JOB A;  5IGE A;  4IFD J;  5M5W B;  1ZYR C;  3E5S A;  1X3E A;  2PW5 A;  4JC0 A;  1XWE A;  3NWS A;  4BWG B;  3S1R H;  1SE8 A;  5IWA L;  4H7B A;  4C2M H;  3KJP A;  5FO7 B;  4BY7 G;  2WB1 B;  4PMC A;  2JA8 G;  1EQQ A;  4Q5V A;  3GTO H;  3LNN A;  3RR5 A;  1AE2 A;  3S9W A;  4LF7 Q;  1IZ6 A;  1EIG A;  2B63 B;  1V8Q A;  2A19 A;  1X54 A;  1CKM A;  5EKI A;  1PYW D;  1QOH A;  4ZCK A;  1O80 A;  4DV0 L;  1BXT A;  4A76 A;  1TWC H;  5M5X B;  2A6E C;  2IW3 A;  1RDP D;  3D3R A;  3I4N B;  1AEX A;  3CF5 A;  1CUK A;  1SMX A;  3HOU H;  5FLM G;  4J1M A;  4P75 A;  3CRL C;  1F9R A;  1KNE A;  3A0J A;  3LX0 A;  1VQD A;  4QGU A;  3PUX A;  1AN8 A;  3KF6 A;  1PH9 A;  2K75 A;  4EGV A;  4PZ6 A;  1B2T A;  3PUZ A;  1TT2 A;  2PZU A;  2JXM B;  4ZLT F;  4E6I A;  1D7Q A;  3J7A V;  4BY7 H;  1MJC A;  4HSP A;  4ULL A;  2JA8 H;  2JA6 B;  4A75 A;  4RFB A;  1UE1 A;  3BDC A;  4QCL A;  1JR0 D;  3OSO A;  4A3L G;  2F0J A;  2Z6K A;  1YBY A;  1JMC A;  2MO1 A;  2AUK A;  3FPP A;  2EPB A;  3PIO 3;  2K32 A;  3JAM E;  1KQS A;  2A68 C;  4OEM B;  1HUN A;  4LW1 A;  1Y69 U;  2HD3 A;  4KHP Q;  3D4D A;  1R9T H;  1WTO A;  5FLM H;  2K5V A;  1TWH B;  3L2P A;  1S5E D;  5BN3 A;  4WJ3 M;  1I4P A;  3CAM A;  5IT9 c;  3M4P A;  2LY7 A;  4B3M L;  1B44 D;  3UDX A;  4EQP A;  2YTX A;  4BA2 I;  1I4Q A;  1PRT D;  4IOC A;  5LL6 S;  3KUP A;  4GNX C;  3A8J E;  4A3L H;  1B9M A;  1Y1W G;  3D4R A;  1OXU A;  3NTK A;  5T1I A;  4XXE A;  3ULP A;  2NVT B;  1LTB D;  4LFB Q;  4DUZ L;  1X56 A;  1C8C A;  4HIK A;  4YCV A;  2ZT9 C;  5FLX c;  1PH5 A;  1DZ1 A;  3OWF A;  5IY0 A;  3CCM A;  3HOW H;  4JV5 L;  1KHI A;  2L15 A;  1ZYR D;  4JYA Q;  4BS9 A;  4K5W A;  3E3X A;  3E9H A;  2K05 A;  3D6C A;  5BR8 L;  4DR1 L;  4LF5 L;  5J39 A;  4IUP A;  5IT9 L;  2VZA A;  3I73 A;  3GP7 A;  3MXN B;  5M3F B;  4RHS A;  3HOV G;  4M8A A;  4RMF A;  4HJ9 A;  3UI2 A;  1XNQ L;  2NZO A;  4A3F B;  2EYO A;  2RDG A;  1K3R A;  3RN5 A;  4I7Z C;  4DPG A;  1Y1W H;  3J81 j;  1JIC A;  4JI2 Q;  4DR5 L;  1G51 A;  1KXL A;  2ZTC A;  1DON A;  1U4P A;  2WAQ E;  1UE7 A;  4MN3 A;  1F9Q A;  5JPN C;  1HJP A;  1V1Q A;  3H0G B;  4FF4 A;  2OWO A;  1EYA A;  3FHW A;  5FLX L;  4DAY A;  5ELO A;  2CWA A;  4M1U B;  3P7J A;  3SXH A;  5IE8 A;  1TWF H;  1M8A A;  4YCW A;  4JBM A;  5JEA J;  1BO0 A;  4A3M G;  1SYE A;  3T13 A;  3HOV H;  4GS3 A;  3NP8 A;  2KCM A;  1Y8O B;  3CP0 A;  3A54 A;  5IP9 G;  2A68 D;  2ID0 A;  5JVG 3;  1BF4 A;  4HJ5 A;  4CKC A;  1NTG A;  4UP7 A;  1CSQ A;  2V1C C;  5GAG C;  3I4M H;  4PV1 C;  1JJ2 A;  1RIP A;  2UU9 Q;  1G6Z A;  4DGZ A;  3K5N A;  4TRD A;  3J7A F;  2K03 A;  5E4X A;  4DK0 A;  3H15 A;  1QNK A;  3H91 A;  4XQQ A;  2A8V A;  4DXF A;  3ZYY X;  2HIV A;  1KD1 C;  1KC8 C;  4A3G G;  3M4Y A;  4TQU S;  1BKB A;  1IBK Q;  1LTL A;  3CCL A;  2GA4 B;  3U4V A;  4A3M H;  5E4W C;  1CHQ D;  3AYH B;  3W1G A;  4DUY L;  3ND8 A;  3N52 A;  4DAV A;  1SNQ A;  4P73 A;  2YU9 H;  1G91 A;  5EKK A;  2SOB A;  1GUG A;  5C4X B;  5IP9 H;  1PH7 A;  1RTO A;  3S1Q H;  2MP1 A;  3CCS A;  4C3H B;  3SVM A;  1N36 L;  3S1M H;  1JWS D;  3H09 A;  2LFN A;  1L1O A;  4MZ9 A;  1GXD C;  3TME A;  2E2H H;  2MNA A;  5L37 A;  4XYQ A;  5J22 A;  3H3V C;  1YNN C;  4P2C B;  4EX5 A;  3EBE A;  5TSS A;  4CGY B;  2NTS A;  1I3Q H;  1ONL A;  3Q6S A;  3PMF A;  2R7Z G;  3Q8D A;  3L3O C;  4A3G H;  3VYU A;  3KBX A;  2NN6 G;  3D0F A;  1LTR D;  1NNX A;  1QJO A;  1SR3 A;  4FF2 A;  4G7O C;  4BXX G;  2E2D C;  2KCT A;  1D2B A;  2O5I C;  3RMH A;  3W3A A;  4GLV B;  3CQZ B;  1DD2 A;  3M9B A;  5HGT A;  2QDL A;  4A3C G;  2NYZ D;  2E2J B;  3ND9 A;  2D5D A;  4CJ0 B;  1YHA A;  2Q8R E;  3QO2 A;  3J7A 5;  2VQE Q;  3X3N A;  1WJJ A;  3D6W A;  2WB1 G;  2J0T D;  1E2V A;  4X3S A;  1P8L A;  2UXB L;  2VNU D;  1C4Q A;  3OMG A;  2F4I A;  2D9U A;  2B8F A;  2L4N A;  1HFG A;  2R7Z H;  1YJN A;  4B3R Q;  3GTG H;  1ZEQ X;  4BA1 I;  2NN6 H;  5EPL A;  3QR8 A;  4NXN Q;  1J5E L;  3CW2 C;  1LTA D;  1D5M C;  1EQT A;  1V1P B;  4DAP A;  5EPK A;  3UE1 A;  1FL0 A;  4BXX H;  3CKI B;  1HR0 W;  3SEB A;  4OWW B;  2BOS A;  1O7I A;  1O7Y A;  1PH8 A;  4A3C H;  4Y52 H;  2KHS A;  1QIL A;  3MWY W;  1K83 H;  3I90 A;  1NR2 A;  4C3I B;  5I6Y A;  1BUV T;  2JEB I;  5I4D A;  2JA6 G;  1I6V C;  2AWO A;  4L5R C;  4X62 L;  1Q1B A;  1Q8I A;  3HEJ A;  4LUZ A;  5ELF A;  2QIL A;  3GTP B;  5M5X H;  3J7Y W;  4GOP C;  3DEO A;  2B3G A;  1ET9 A;  1OXS C;  3E0J A;  2Z1C A;  2EJG C;  2WV6 D;  3NWT A;  4GKJ Q;  2CKZ B;  2F0H A;  1ESR A;  5C5L A;  4UY8 C;  2KCC A;  4MTN A;  5DM6 3;  3PIP 3;  4NXM L;  2VY3 A;  4L5Q A;  1VF5 C;  1YNN D;  3U4Z A;  5AJ3 Q;  3S1R B;  4OX9 Q;  3O13 A;  2TMP A;  4C2M B;  1MKH A;  1BR9 A;  2JA6 H;  1SEB D;  2NTT A;  2JA9 A;  4FO2 A;  3T56 B;  5GAE C;  4A3I G;  1CA5 A;  4V19 0;  2KVM A;  2PQA B;  4O1N A;  2RBM A;  4JI7 L;  3M4O H;  1TWC B;  3HKS A;  1KNA A;  2MHV A;  3AMU A;  2HDL A;  1ROD A;  2FFK B;  3Q0A A;  1HXY D;  1ASZ A;  3HOU B;  4OO1 G;  1FYC A;  4DV3 L;  1HR0 Q;  5IGD A;  2HT1 A;  3OIQ A;  4CDF C;  4ZAI A;  2OF1 A;  2FXQ A;  3LWU A;  1U4M A;  1HNX Q;  4A3K G;  2O2L D;  1HZ9 A;  1XYI A;  4KKT A;  5M3F G;  2OCE A;  4HTH A;  4BY7 B;  2JA8 B;  4B08 A;  2IJ0 A;  4A3F G;  4A3I H;  1CA6 A;  1EQV A;  3MXN A;  1SDF A;  1KTK A;  4X3K A;  3HKZ B;  5M3M G;  4WOR A;  2DY8 A;  3AQQ A;  2DNC A;  2NVT H;  4HN7 A;  4O0A A;  3OMC A;  1H9K A;  2Z4H A;  4POG A;  1R9T B;  2G5D A;  4DV6 Q;  5COY A;  1CT1 D;  3GTK H;  1FNU A;  3SR1 A;  4OO1 H;  4OWT B;  2VQF Q;  2AUJ D;  3J81 E;  2N55 A;  1EQR A;  2NZH A;  4IUU A;  3AU7 A;  4KK7 A;  1PYB A;  3NTI A;  5CV7 A;  3AFP A;  4F87 A;  5C4Z A;  2EYJ A;  4R4O A;  3V2T A;  4A3K H;  5M3F H;  4N8X 1;  1YHB A;  4ME3 A;  4B9W A;  4H02 A;  2RKS A;  3MFG A;  1FJG Q;  4QQB X;  3URY A;  5J1Z A;  2NB0 A;  2IPK D;  3I3C A;  1YIT A;  2PQE A;  5M3M H;  3TDQ A;  4X65 L;  1MSH A;  3PCO B;  1B7Y B;  5KYI A;  1LT5 D;  3M7G A;  1F77 A;  2C9O A;  2EOT A;  1MD2 D;  5EKL A;  1IL2 A;  3CPF A;  4NDX A;  4L5T A;  3HOW B;  1LTS D;  2QGQ A;  4OXP A;  3T1Y Q;  3PF4 A;  4DV4 L;  3HRZ C;  1WCM G;  5ELE A;  1B9N A;  1JCK B;  2GVA A;  4IQZ A;  5IGB A;  4LFA Q;  5C5M A;  1DOM A;  3KOJ A;  1LO5 D;  1IHZ A;  1GKH A;  2K5Q A;  2K5W A;  5LHY 1;  1PHJ A;  1OXX K;  4LF6 Q;  4K14 A;  1Y1W B;  4B9X A;  3G48 A;  4NB3 A;  5E3F A;  3IRB A;  4HAE A;  2IWH A;  4C3H G;  3G7L A;  2BA1 A;  3RD4 A;  4JI6 Q;  5JJI A;  1SRU A;  3E6Z X;  4P71 A;  5FO8 B;  2EYF A;  1WFQ A;  3RLF A;  5C0X J;  3H3V H;  3PIO A;  5J3B A;  3J80 E;  2OTL A;  4DR7 Q;  1WCM H;  1TWF B;  4TVA B;  2HQE A;  1B70 B;  4FNF A;  1TY2 A;  1Q12 A;  1QVG A;  3HOV B;  1D1I A;  3MA2 B;  2R93 B;  5IGG A;  5JJK A;  3NK9 A;  5DLQ E;  2F3V A;  1S5D D;  3JAM i;  1HA6 A;  1GVP A;  3NSW A;  4RCN A;  5IYD G;  3I4M B;  1MIU A;  2M9V A;  1U5K A;  1PXU A;  4C3H H;  2LS0 1;  2NUC A;  3FP9 A;  3OTO Q;  4JPB W;  4IO9 A;  4CDE C;  2OTJ A;  4AYB G;  1N34 L;  1KIX A;  1AZQ A;  3R93 A;  3NHH A;  3BDL A;  4IZ8 A;  4DR3 L;  3L9A X;  4C56 C;  2E5L L;  4XT1 B;  1H9S B;  4JK1 C;  4DNR B;  5KNB A;  2K33 A;  3DWP A;  1GM5 A;  3TS0 A;  2A5H A;  3A8K E;  4A3M B;  4HJ7 A;  1SE2 A;  2ZJP A;  4DR2 L;  2WIN B;  5AFW A;  5IWA Q;  3D4W A;  4A3B B;  4LUV A;  2X69 A;  2YU9 B;  4KD3 A;  3KF8 B;  1V1P A;  1LT6 D;  3CQZ H;  2F0L A;  3B6Y A;  3NTH A;  1O7L A;  2E2J H;  2EXD A;  3I4L A;  4DV0 Q;  5IYD H;  3SE0 A;  5IOC A;  3AEV A;  3BYT B;  2XWB B;  1LAB A;  4JCV E;  3TEH B;  2UUC L;  2E2H B;  4Q0F A;  1BCP B;  5A2Q L;  1G8Z D;  4GN3 B;  4HID A;  2V4D A;  2E75 C;  5G3L D;  1I3Q B;  1BOS A;  4IPC A;  1EZ6 A;  3BYY B;  3KBG A;  2EJF C;  4FP5 D;  4IPH A;  4A3G B;  3VYR A;  2MJ8 A;  4KHV A;  2BH8 A;  2E8G A;  3MEF A;  1V9P A;  3A5U A;  2LSS A;  4POF A;  3I2Z A;  2AQ2 B;  3I56 A;  2F0T A;  2F0N A;  2FMM A;  1A62 A;  2B2Y C;  1WTW A;  2QW7 A;  2WII B;  5KRU A;  4LF9 L;  1CZW A;  1I4H A;  4K5X A;  1BCP C;  4R4Q A;  3EA6 A;  4A93 B;  1XTC D;  2UXD L;  2JK8 A;  1ZXT A;  3ERS X;  4XTC S;  2RDH A;  3GTP H;  1I4R A;  4B3M Q;  1KAA A;  5BN5 A;  2PQA A;  3G71 A;  1EOT A;  5CBA E;  1N9W A;  2KEC A;  2PI2 A;  3K59 A;  3A7L A;  3P1H A;  2PI2 E;  1CHP D;  1X32 A;  1CSP A;  3MC0 B;  1PLF A;  5EAY A;  4ZYS A;  5GRO A;  3UDG A;  2K5N A;  1WD1 A;  1K83 B;  4QIW E;  1Y8P B;  3KK7 A;  2XSC A;  3K7A H;  1E24 A;  3WDN A;  4GLX A;  1QB5 D;  2HCC A;  5CV4 A;  4N9P A;  4R8N A;  3HKZ G;  4FDB A;  4KY6 A;  2IX1 A;  1BVS A;  3NQI A;  2FMC A;  3TZU A;  2IY5 B;  1BBW A;  5IP7 G;  5BR8 Q;  4LF5 Q;  2HQL A;  4EVO A;  4KV6 A;  1W6J A;  2ZTE A;  2NVX H;  3SK6 A;  1QE6 A;  2DGY A;  4RG1 A;  2VXW A;  4AIM A;  3T1H L;  2EY6 A;  3CCU A;  4LWC A;  5I2Y A;  2F0F A;  4RKL A;  1S72 A;  1PA6 A;  3HG9 A;  2OEO A;  2XRS D;  4X64 L;  1B3A A;  2WKD A;  2J7Z A;  3GQB A;  4DAM A;  2F4V L;  1OXV A;  1XNR L;  1SMY C;  5LMU L;  4GNX B;  3CCQ A;  4QL5 A;  1VQ5 A;  4GLA C;  1GUW A;  1BBU A;  3HOX B;  1STH A;  1SNC A;  3M4O B;  4JI8 L;  2R6G A;  5IP7 H;  5CV8 A;  1DOK A;  4AQY L;  5H1S E;  2R7F A;  4EQO A;  2LKV A;  1G29 1;  4ID6 A;  1EFW A;  1IKL A;  5DEH A;  1M1K C;  1B8A A;  3HOW G;  2F3I A;  3NPP A;  1Q3L A;  3VYS A;  1GOZ A;  2Y0S B;  3EIV A;  3BG3 A;  4KJN A;  1PFB A;  1BCP D;  1IYU A;  4IOA A;  3S1N H;  3GV3 A;  4LFC Q;  2EDG A;  1VQC A;  2UUA L;  4HIM A;  4YCU A;  3C46 A;  1IBM L;  2UXC L;  3T51 B;  1VQ8 A;  4X66 L;  1N32 Q;  1Q46 A;  3T4A C;  4A3I B;  1EIY B;  2YYZ A;  1G2S A;  5CV5 A;  4G7H C;  4K2K A;  1YVC A;  1K0R A;  3TBI B;  3G6J B;  4NW2 A;  1GHK A;  4L6T B;  4DN4 M;  4DF7 A;  4DA2 A;  2JA7 B;  3K0Y A;  2SDF A;  3GTK B;  4K0K L;  4DUY Q;  1H9J A;  1FNV A;  4TSS A;  5E7N A;  1X9N A;  2PMZ B;  2PZW A;  4GKK L;  2KHI A;  1EWC A;  2K14 A;  4IUQ A;  3PUY A;  1Q7Y C;  3K5L A;  1H95 A;  4A3K B;  1UE6 A;  2RF4 A;  3R8B A;  3D31 A;  3PIP A;  2R93 G;  1SYG A;  5LL6 X;  3I91 A;  5EQ0 A;  2X6L A;  1PRT F;  1W6K A;  2A6E D;  1WTV A;  3EFX D;  5M3M B;  3MHB A;  4HMJ A;  3I4M G;  3KDF B;  2ZTD A;  1S4Z A;  4YY3 Q;  4UAI A;  2XTI A;  5JJZ A;  4OGQ C;  3I72 A;  1SYF A;  1EYD A;  2FIN B;  3OYY A;  2B39 A;  4DK6 C;  2ENB A;  1S40 A;  4HED A;  2IX3 A;  2F0D A;  4YHH Q;  5CBE E;  2LMC B;  3HOZ B;  2KJX A;  1Q1E A;  1GUT A;  4PMW A;  4LF8 L;  5I6W A;  1H9S A;  1SMY D;  4H0L C;  4DR4 Q;  1A6X A;  1OXT A;  4A3B G;  1TXY A;  2R93 H;  4BBR B;  2JJQ A;  2KUM A;  2UXB Q;  3M4Q A;  3I4O A;  1BDO A;  2RSN A;  3CCR A;  2XIW A;  1SE3 A;  1X55 A;  3KF8 A;  1QZG A;  3W5O A;  1FNW A;  2IHE A;  3H3V I;  1YNX A;  2VW9 A;  4EQ5 A;  4QUF A;  3VR6 A;  3CCE A;  4S3S A;  3S24 A;  1EEF D;  3NBH B;  1C0A A;  5BN4 A;  4FYD A;  1A3T A;  1WCM B;  2B2V C;  5K36 G;  3BU2 A;  2TSS A;  1MJE A;  3CC4 A;  2B2W C;  4A3B H;  3HZX A;  1A2U A;  2RVL A;  1STE A;  4LNQ A;  2I0Q A;  4JI4 Q;  3S15 B;  1STB A;  1E0B A;  3HGB A;  5GAD C;  2ZXP A;  1L0X B;  4X6A H;  4LMQ D;  1SBB B;  3J81 i;  3C3L A;  3BVG A;  3UE0 A;  4A93 G;  1T5X D;  2A73 B;  4G57 A;  1RKN A;  1XPR A;  3CU7 A;  3A74 A;  2H5X A;  1SYB A;  2VS1 A;  3KLW A;  4JOI C;  4RGM A;  4JYA L;  2Q8T A;  2K52 A;  4LUO A;  5K36 H;  4A3J B;  5KIX A;  1X6O A;  1KL9 A;  1Z47 A;  4O42 A;  4HMI A;  4KLK A;  1B1Z A;  4JBW A;  1FR3 A;  4L63 B;  2EYM A;  4RA8 A;  2L9H A;  4K6D A;  3ZJY C;  2F0W A;  2RQX A;  2RHQ B;  1PFS A;  1LT3 D;  5F2D A;  4JI7 Q;  2EIF A;  1TWG H;  1I4G A;  1XPU A;  5M5Y H;  1VQK A;  4AYB B;  1XTD A;  2KHJ A;  4A93 H;  2K04 A;  4QF4 A;  3U50 C;  1LAC A;  1NE3 A;  2H4O A;  4U68 A;  2CCZ A;  3ICE A;  3K6O A;  2WB1 E;  1JE5 A;  2RHS B;  3P75 A;  2RDF A;  2XNA C;  1PZK D;  4GOP B;  1STA A;  1IW7 C;  1ET6 A;  4IJL A;  3DUZ A;  1Q90 A;  4B3T Q;  2F1M A;  1MBY A;  2E76 C;  1VQL A;  4WRD A;  3NE5 B;  3W1B A;  3EVQ A;  2FJ2 A;  3A55 A;  1A15 A;  2D62 A;  3GTL B;  1Q82 C;  3AFQ A;  3MZ5 A;  3QOJ A;  3NQT A;  2QDB A;  2D0O A;  2UU9 L;  3J80 i;  3GO5 A;  1UUP A;  1VQA A;  4DXG A;  3F2C A;  4OHJ A;  4XIG S;  2N88 A;  1I50 H;  1RJT A;  3GTJ H;  2IL8 A;  2AWN A;  4Y7N H;  1SXT A;  1SLJ A;  3HOX G;  4JI5 Q;  2QEX A;  3LGJ A;  1HNW L;  4GNX A;  1T5E A;  4C1N K;  2F0G A;  3NXW A;  5K5P A;  1DYQ A;  5A35 A;  4LF4 Q;  2Y0S G;  3H94 A;  4QJF A;  1K3B C;  4XT3 B;  2L5T A;  3K7U C;  4JG2 A;  5CGK A;  5C44 B;  2R61 A;  3K7A B;  1STY A;  2K5H A;  2F0I A;  1HQR D;  4NPS A;  1O7Z A;  2KOL A;  4HJA A;  1N33 L;  1NMF A;  1HPC A;  3MXG A;  3RLO A;  1K73 C;  2BE5 C;  1X3F A;  4DKA C;  3HOX H;  4FVM A;  1PTO C;  1Z7T A;  2ALY B;  5FK9 C;  1I5F A;  4J6H A;  2NVX B;  4A4I A;  4ZK9 B;  1L0W A;  4F8M A;  2JA7 G;  2EQS A;  2MUY A;  2HCI A;  1SYC A;  1LTG D;  3MXP A;  1KAW A;  1AFP A;  3K80 C;  1DXM A;  1B50 A;  2PNR C;  1XMQ Q;  1WTX A;  3C2P A;  3F8T A;  3FEW X;  3GDE A;  2I07 B;  3MVV A;  1NCV A;  1VQN A;  3S2H B;  2OQK A;  1WTR A;  4ZKB B;  1IW7 D;  3JAM c;  2A6H C;  2CWP A;  4DV5 Q;  3FRP B;  3KFU A;  4DK1 A;  5JEA G;  4B3R L;  5IT9 E;  1S5F D;  2JA7 H;  3CHB D;  3K58 A;  5KYL A;  3KDF A;  4NXN L;  4JI1 Q;  5CV6 A;  1KDC A;  1Z6H A;  1GD7 A;  3QWN A;  3ULL A;  4JI3 Q;  2N78 A;  2OQ0 A;  5KGU A;  1AZP A;  3HOZ G;  4NP5 A;  3S1N B;  4RGN A;  3UDI A;  4Z9C B;  4YWK A;  2A69 C;  4BBR G;  1N34 Q;  4P74 A;  3DXJ C;  2PO4 A;  5EPJ A;  4KN4 C;  5FLX E;  2E5L Q;  4KI0 A;  1X65 A;  4JBJ A;  4RWS C;  1VQI A;  1Q8K A;  1A3V A;  3TSS A;  3JAM L;  4OIJ A;  4PZ8 A;  1VQ9 A;  5JEA H;  4L5S A;  3E0E A;  5I2X A;  1EL0 A;  1YIJ A;  1HZB A;  1KRS A;  2ZM6 Q;  1K8O A;  4IUN A;  5NUC A;  4GKJ L;  4P72 A;  1R4Q B;  4KJO A;  2DUD A;  4DV2 Q;  3Q23 A;  3DMU A;  2F52 A;  1EOV A;  5JPM C;  3HOZ H;  1NMG A;  2KA7 A;  1V1O A;  4R4T A;  3NBH A;  4UP9 A;  4JOI A;  1IYJ B;  1E2W A;  2UUC Q;  2BE5 D;  3KJO A;  4KY7 A;  4BBR H;  2JYO A;  4A3E B;  3QB3 A;  3WOE A;  1PTO D;  3S16 H;  5KNC A;  1GJX A;  4K2L A;  4DK3 C;  1YJW A;  4HJ8 A;  3NEM A;  3GV6 A;  5HUR A;  1TKW B;  2XRQ D;  3K57 A;  2EYL A;  5HY6 A;  2KBN A;  2Z6K C;  1F9S A;  5FO9 B;  4HCE A;  4BBS H;  4RAU C;  1HR0 L;  3K8A A;  5C3E G;  3C1E A;  3QG1 A;  1MSG A;  4A3J G;  2KEE A;  3I55 A;  4U67 3;  3RUZ A;  4J15 A;  1HNX L;  4ODG A;  1N8R C;  3G6E A;  1EY7 A;  1SNM A;  2F03 A;  1JJG A;  1IBL Q;  1BNZ A;  2A6H D;  4CHT B;  5IYB G;  3ULJ A;  4DV7 L;  1AE3 A;  4DV1 L;  1JOR A;  5I9P A;  1JJC B;  4CKB A;  4OIK A;  3M85 A;  1LT4 D;  3VYT A;  3PUV A;  2NVQ B;  3DEP A;  4C3J B;  3DM3 A;  1I94 L;  2EY2 A;  4DV6 L;  4DU9 A;  3CPW A;  1P16 A;  1QNU A;  2WAQ B;  3PQI A;  1TQO A;  4K5V A;  4AYB E;  5C3E H;  1JOO A;  1VQG A;  4A3J H;  2A69 D;  1M90 C;  2EE1 A;  1X3G A;  4RGO S;  2JP1 A;  4GOP A;  2CQA A;  4DAY B;  3PO3 H;  3RLN A;  1CKN B;  5IYB H;  3U9O A;  2PYK A;  2O5J C;  1BQQ T;  2EY1 A;  3K81 C;  5IOD A;  1JB7 A;  4UPA A;  2B29 A;  3SK4 A;  5C6A A;  5CMD A;  1CQV A;  1X3P A;  1S5C D;  2RSO A;  2DNE A;  2BDO A;  3S14 H;  1I6H H;  1E2Z A;  1QG7 A;  1HA5 A;  3KLR A;  2VB3 X;  1K0S A;  1PMR A;  1GHJ A;  2NZ1 D;  1DGS A;  3V05 A;  1ASY A;  1A3U A;  3T1Y L;  2F0M A;  2MFI A;  4IJH A;  2Z4I A;  4JI0 L;  1JE4 A;  4XQN A;  4EQN A;  3BZC A;  4APV A;  4X64 Q;  3IKJ A;  2SNM A;  5GQO A;  3V96 A;  1TU2 B;  1LV9 A;  1OTC A;  5LMU Q;  3GTL H;  1GUN A;  5KND A;  4B3S L;  3QOL A;  3S17 H;  1TWG B;  5C44 G;  1I4X A;  1ZKO A;  1QZH A;  1TS4 A;  4JI6 L;  4HCS A;  3BS1 A;  4LAA A;  5M5Y B;  4CJ2 C;  3DM1 A;  4RKB A;  4QMG A;  5EJW A;  3MFY A;  2Z9H A;  4NMZ A;  2Q2U A;  1ICF B;  5G3L F;  1PH3 A;  2NN6 I;  3PSI A;  2YTY A;  4MNO A;  1PTO H;  1A2T A;  3PUW A;  4KN7 C;  1L1O B;  5LMN L;  4CKE A;  1STG A;  3FMC A;  1C7Y A;  2MQH A;  4A3D G;  2UXC Q;  1KDA A;  1QVC A;  4DR6 L;  1JQY D;  1IL8 A;  1JOK A;  1LTI D;  2JA5 B;  1SE4 A;  2MPM A;  2BA0 A;  3PGZ A;  1SND A;  2I5L X;  2O4X A;  2K6A A;  3DWQ A;  5ISR A;  2RA4 A;  4ME5 A;  4WFN 3;  1DOL A;  5C44 H;  4DUZ Q;  1VQ4 A;  2QKI C;  3BVM A;  1XMO L;  4K0K Q;  3KYH C;  2ZXO A;  3DLL A;  4JV5 Q;  1I50 B;  2RCN A;  3GTJ B;  1C48 A;  4Y7N B;  3OWE B;  1J8I A;  1CK1 A;  1L1O C;  5IYC G;  4DR1 Q;  5C4J B;  4OWX B;  4RCO A;  3HKZ E;  3RN2 A;  1ESF A;  1XPO A;  4A3D H;  1KAB A;  2NBF A;  1XNQ Q;  3HOY B;  4QB4 A;  5T1G A;  1AP0 A;  2KCN A;  4PQX A;  1PH6 A;  1Q86 C;  1EFI D;  2HHH L;  3U9S A;  4DR5 Q;  1DCZ A;  2JEA I;  3VR4 A;  2BDN A;  2L55 A;  3R3O A;  4BY1 G;  1B3Q A;  2M00 A;  3RZO H;  4XDX A;  4PNY A;  4YWM A;  1SSO A;  2R3Z A;  2CHB D;  4DNI A;  3S2H H;  1K8G A;  1EIH A;  5E1F A;  2UUB L;  3TP7 A;  3TZD A;  3MAQ A;  1CZG A;  2EYP A;  4K8I A;  5IYC H;  1HH2 P;  3BDO A;  3L0O A;  1PV4 A;  3FPU B;  1JOQ A;  4UHV A;  4LF8 Q;  1LUZ A;  1RTN A;  1SJE D;  1HNZ L;  3TS2 A;  3WOF A;  2OXP A;  1HZA A;  1PZI D;  4QY7 A;  2G9D A;  1HUM A;  3GTQ H;  3CD6 A;  1E22 A;  4J8Q A;  1D5Z C;  4F88 A;  1ENF A;  2JQO A;  2GN5 A;  4ABN A;  1YHQ A;  1EU3 A;  4BY1 H;  2EJM A;  4A3E G;  5IGC A;  5C0X G;  1C9O A;  2CW0 C;  3OPO A;  3SDZ A;  4F7X A;  1E3P A;  4IPD A;  3MEH A;  1NSN S;  3ERQ A;  3P20 A;  1HQM C;  2IHF A;  1B4O A;  1EUJ A;  4IPG A;  2G9H D;  2P5Z X;  4OO1 I;  4I65 A;  4IUV A;  5D3D A;  1UE5 A;  3TN2 A;  5JVH 3;  1D1K A;  4DFA A;  3J81 c;  1ENC A;  3F2D A;  5C3W A;  3K0X A;  1YNJ C;  1Y1V G;  1E1T A;  1JT8 A;  3VR2 A;  4FF3 A;  2X6G A;  2AQ3 B;  1BCP F;  2JE6 I;  3R2I A;  1N36 Q;  3PO2 B;  1ILQ A;  3C1F A;  5FKA C;  1HTL D;  4YWL A;  4A3E H;  1J9O A;  4R9W A;  1DM0 B;  5C0X H;  4LF7 L;  1WTP A;  2VUM G;  2PCF B;  4K8J A;  3I7F A;  4MHE A;  4XYO A;  3LWE A;  1VF7 A;  1F2M A;  5KEE A;  1QUQ B;  2EVB A;  4YIJ A;  4FXK C;  1RHP A;  2AMC B;  4C3J G;  3CCV A;  5DAU A;  5CC4 A;  5IIF A;  1UEA B;  5ELN A;  1LYL A;  1XXG A;  2EXZ A;  2WAQ G;  3IFT A;  1B53 A;  5GAH C;  3J81 L;  1Y1V H;  1R4P B;  1VDZ A;  4ZUJ A;  3RZD B;  1VQH A;  4G7Z C;  2ZXR A;  3NBI A;  1FGB D;  3TP6 A;  1QVF A;  2L12 A;  4ZRZ A;  1F9P A;  3CC2 A;  3KLS X;  2Q8I B;  3FKI G;  5ELD A;  3S16 B;  3CCJ A;  1EY5 A;  4LJZ C;  1VQE A;  1CFM A;  1RF2 D;  2M2L A;  2VUM H;  2WKC A;  2XWJ B;  4R4C A;  2OT2 A;  1CKN A;  1Y14 B;  2PW7 A;  1PZJ D;  2NVQ H;  3ERO A;  4K6L A;  4C3J H;  1J5E Q;  1RL2 A;  4KHP L;  2B2Y A;  4OON A;  1AH9 A;  4IAL A;  1K8M A;  3J80 c;  4BBS B;  2DN8 A;  2K5D A;  2QEJ C;  1KDB A;  2F0K A;  3STB C;  1LM0 A;  1FGU A;  1TWA H;  1NY4 A;  2B2T C;  2CW0 D;  4LFC L;  1BBX C;  3FKI H;  3CXC A;  5A2Q E;  5HGQ A;  5D14 A;  4X62 Q;  1N32 L;  1PH1 A;  2LXK A;  2CH4 A;  1TS5 A;  1EY9 A;  2WAC A;  1SRO A;  4IN3 A;  3OHX C;  1Q81 C;  3M3Y H;  2MO0 A;  2XVS A;  1WD0 A;  1RCV D;  3EQL C;  1HNW Q;  3HP3 A;  4LFB L;  1LLR D;  3NEL A;  4XQJ A;  2LXJ A;  3A7A B;  1YNJ D;  1MGS A;  1RD9 D;  2F0E A;  2ATW A;  2JN4 A;  3OIP A;  3J80 L;  3TRZ A;  5C3E B;  4NXM Q;  2ASB A;  1A63 A;  4IFD G;  2KQ3 A;  1SFO H;  4KKS A;  4CDD C;  5EGT A;  4V0B A;  3K5O A;  3PO3 B;  3J7Z C;  4ZQ3 A;  1NUC A;  1Z9F A;  2Z6B A;  2F0U A;  2JA5 G;  1N33 Q;  1HTP A;  4CBV A;  5C3X A;  1KRT A;  4JI2 L;  1PFN A;  3S14 B;  2YTV A;  1I6H B;  1EYC A;  1XJV A;  4JVZ A;  2N3S A;  1VQM A;  4YY3 L;  2C5C A;  4ALP A;  1K28 A;  1E1O A;  4GN4 B;  3S15 H;  1CKO A;  3SK8 A;  4DV3 Q;  2F0P A;  5COR A;  3M7N A;  2Z8L A;  3GTM B;  4KHZ A;  4IFD H;  3IFD A;  4YHH L;  3R2T A;  1F2L A;  2PNH A;  2PPB C;  2EY5 A;  5JAV A;  4DR4 L;  1VQJ A;  3HOY G;  2NVY H;  4RGT A;  5ELC A;  2K28 A;  3S2D B;  2N49 A;  3EJI A;  2JA5 H;  2B63 G;  5JJL A;  2R7D A;  2R92 B;  4OEL B;  1VS0 A;  1AW7 A;  2E74 C;  3S17 B;  2EZV A;  1VCI A;  1TS2 A;  2C35 B;  4R1J A;  1WOC A;  3I4N G;  2AHO B;  3SK5 A;  3STB D;  2KED A;  1GO3 E;  4UP8 A;  5CV9 A;  4FXG C;  1PTO B;  1QCB D;  3VR5 A;  1S5B D;  3SGI A;  5C4J H;  1IBK L;  5M5W H;  3DWA A;  2QA4 A;  4WJW A;  4H13 C;  2HIX A;  2A1A A;  4L8J A;  5I9O A;  3HOY H;  1CM9 A;  1EY0 A;  2L0C A;  2J4X A;  1VQO A;  2B63 H;  1U4R A;  3NUC A;  4RHR A;  4JI4 L;  4X65 Q;  1PDQ A;  1UAP A;  2I46 A;  1MHW C;  5EBD A;  1XX8 A;  1OO9 B;  5M9O A;  1UEB A;  5FOB B;  2Y0S E;  4I7A A;  3TP8 A;  3I4N H;  2WP8 J;  1IKM A;  2AKW B;  2E2I B;  1J6Q A;  1WTH A;  5IGF A;  1MI2 A;  4DV4 Q;  1EU4 A;  1JWM D;  1HRJ A;  4PZ7 A;  1VMP A;  4JW0 A;  2A74 C;  1SNO A;  3L7Z C;  1WYD A;  4A3D B;  1JB3 A;  3I70 A;  3GTO B;  1JWU D;  3TQY A;  4N9T A;  3OOC A;  1WI5 A;  1CTM A;  1ENA A;  1WVL A;  1SNP A;  3A8I E;  1YI2 A;  3U58 A;  2PMZ E;  3PO2 G;  1ILP A;  2VQE L;  1PH2 A;  3MXU A;  1L0Y B;  2SEB D;  4GN5 A;  2F0O A;  3RZO B;  4N8F A;  4AH6 A;  4NKL A;  1TWH H;  4ZUI A;  4QIW B;  3IAY A;  5DM7 3;  3OW2 A;  2CH4 W;  3Q22 A;  2Q2T A;  4CJ1 B;  4O2D A;  4IUT A;  3CC7 A;  1F2Z A;  1KLG D;  3NEN A;  4MTK A;  2B2U C;  4KMU C;  4HSV A;  4X3U A;  4JBK A;  3CMA A;  1VQF A;  4B3T L;  1QUQ A;  1UNS A;  2VB2 X;  3UDF A;  4DV7 Q;  3OW7 A;  5C4H A;  1A8V A;  1D6E C;  5DNF A;  4DV1 Q;  3GTQ B;  3F2U A;  2F3W A;  4TKO B;  3PO2 H;  1SAP A;  3A56 A;  4RH6 A;  1T9H A;  1TII D;  2B2V A;  3VR3 A;  3H0G G;  4BY1 B;  1EIF A;  1NJI C;  1I94 Q;  3KF6 B;  4FXD A;  2L1B A;  1X3Q A;  2B2T A;  1UWV A;  3TRE A;  4DR3 Q;  1YJ9 A;  3CRK C;  2B2W A;  1ML0 D;  4LK1 C;  4CDC C;  1W3S A;  2Q2H A;  4JI5 L;  2DJG C;  3D8G A;  5LMN W;  3T16 A;  1WTQ A;  1CQF A;  1U9R A;  4DR2 Q;  1II3 A;  1EY8 A;  2BCO A;  3CME A;  4OL7 A;  4BBS G;  4A3F H;  2DJF C;  2F0S A;  1Y8N B;  2I5M X;  1HZC A;  4LF4 L;  3TP5 A;  3RZD H;  1HFN A;  5AJ3 L;  4OX9 L;  3H0G H;  5C0X I;  1LTT D;  4UDU C;  1TVX A;  1H9R A;  1D8L A;  4KKU A;  3X3M A;  2I5H A;  2L11 A;  1H9M A;  2IT1 A;  1ICW A;  2K7V A;  2VL6 A;  1FVI A;  4DNT B;  2CFM A;  1HCZ A;  4JI0 Q;  2MGS A;  1YZ6 A;  3Q24 A;  1A0I A;  2IX0 A;  1NBW A;  1U0L A;  1NR4 A;  1E7Z A;  2PZT A;  1F2Y A;  2Q2I A;  3F2B A;  1Y1V B;  5C4X G;  4R8I A;  1GUS A;  1D5X C;  4B3S Q;  2JSO A;  1FD7 D;  3F1Z A;  5CR3 A;  4KD4 A;  1XMQ L;  4LF9 Q;  3ONA B;  4KTA A;  3K5M A;  4WJ4 A;  3PO3 G;  5CYU A;  1VMC A;  3DHQ A;  1YEZ A;  3EN2 A;  2UXD Q;  2VUM B;  2ZJR A;  1PTO F;  1IXR A;  1TR5 A;  1TS3 A;  2FHT A;  3SHL A;  1W2B A;  1VQ6 A;  5LMN Q;  4G4K A;  4DV5 L;  2BH2 A;  1CI3 M;  1EWI A;  1JC7 A;  2H1E A;  4MIU A;  3VA5 A;  4JI1 L;  2YV5 A;  3IL8 A;  5EBC A;  1EEI D;  1SYD A;  2VQF L;  4DR6 Q;  2AQ1 B;  3MTS A;  1EZ8 A;  4JI3 L;  5C4X H;  3FDT A;  2ICI A;  3AB9 A;  1VQP A;  2HUG A;  4QUC A;  1L2F A;  2DY7 A;  1TWA B;  3E9I A;  2K1B A;  3FKI B;  2K4K A;  5FJ8 G;  1XMO Q;  1K9M C;  1NAP A;  3HS0 C;  1FJG L;  1K8A C;  3H6M A;  4HR7 B;  2K50 A;  2QCP X;  3M3Y B;  2XGT A;  2R92 G;  2D0P A;  1M4V A;  1PH4 A;  2HDM A;  1EWH A;  1IYV A;  4PG3 A;  2GVB A;  3HFZ B;  3I8Z A;  1QWY A;  2ZM6 L;  3WWV A;  3T1H Q;  3QJY A;  4DV2 L;  3PF5 A;  1EY4 A;  1U4L A;  3GTM H;  4GZY C;  3ER0 A;  2HHH Q;  3S1Q B;  4ILW A;  1G6P A;  4LFA L;  1SFO B;  1TY0 A;  1EY6 A;  4H44 C;  3S1M B;  4C3I G;  5FJ8 H;  4ZKC B;  1V43 A;  2F4V Q;  1KLU D;  3S2D H;  2ES2 A;  1XNR Q;  4LF6 L;  5D65 A;  1O78 A;  2RCF A;  2EYH A;  4C1N I;  2R92 H;  3VA7 A;  2UUB Q;  4JI8 Q;  1PRT B;  2SNS A;  1G2T A;  2CQO A;  4AQY Q;  3W2D A;  1VQ7 A;  1HNZ Q;  1SN8 A;  3VDY A;  3KLS A;  3A5Z B; 
#chains in the Genus database with same CATH homology
 4IFD I;  1GUO A;  2NWG A;  3QIA A;  3BVZ A;  4IUR A;  3PV0 A;  1STN A;  4KY5 A;  5ELB A;  2XN9 C;  3BZD B;  4FF1 A;  5D3I B;  2B2U A;  2NVY B;  2QF7 A;  3FVQ A;  1HHV A;  2F0Q A;  3GD7 A;  2D2C C;  1PRT C;  2R7Z B;  2K01 A;  1SJH D;  3T53 B;  2ICE C;  3ITP A;  3GTG B;  4PMB A;  4X3T A;  2CVR A;  1PFM A;  3N6R A;  2F0V A;  1DJR D;  2B8G A;  5JOB A;  5IGE A;  4IFD J;  5M5W B;  1ZYR C;  3E5S A;  2PW5 A;  1XWE A;  3NWS A;  4BWG B;  4H7B A;  5FO7 B;  2WB1 B;  4PMC A;  4Q5V A;  3LNN A;  3S9W A;  1EIG A;  2B63 B;  1V8Q A;  5EKI A;  1PYW D;  1QOH A;  1O80 A;  1BXT A;  5M5X B;  2A6E C;  2IW3 A;  1RDP D;  3D3R A;  3I4N B;  1AEX A;  4J1M A;  3CRL C;  1F9R A;  1KNE A;  3LX0 A;  3PUX A;  1AN8 A;  4EGV A;  1B2T A;  3PUZ A;  1TT2 A;  2PZU A;  2JXM B;  4ZLT F;  4E6I A;  3J7A V;  4HSP A;  4ULL A;  2JA6 B;  4RFB A;  3BDC A;  4QCL A;  1JR0 D;  3OSO A;  2F0J A;  2AUK A;  3FPP A;  2EPB A;  3PIO 3;  2K32 A;  3JAM E;  2A68 C;  1HUN A;  1Y69 U;  3D4D A;  1WTO A;  1TWH B;  1S5E D;  5BN3 A;  1I4P A;  2LY7 A;  1B44 D;  4EQP A;  4BA2 I;  1I4Q A;  1PRT D;  5LL6 S;  3KUP A;  3A8J E;  1B9M A;  3D4R A;  1OXU A;  3NTK A;  5T1I A;  4XXE A;  2NVT B;  1LTB D;  1C8C A;  2ZT9 C;  1DZ1 A;  3OWF A;  1ZYR D;  4BS9 A;  4K5W A;  2K05 A;  3D6C A;  5J39 A;  4IUP A;  5IT9 L;  3I73 A;  3GP7 A;  5M3F B;  4RHS A;  4M8A A;  3UI2 A;  4A3F B;  2EYO A;  2RDG A;  4I7Z C;  1JIC A;  1DON A;  1U4P A;  4MN3 A;  1F9Q A;  5JPN C;  4FF4 A;  3H0G B;  1EYA A;  5FLX L;  4DAY A;  4M1U B;  3SXH A;  3P7J A;  1M8A A;  5JEA J;  1BO0 A;  1SYE A;  3T13 A;  3NP8 A;  1Y8O B;  3A54 A;  2A68 D;  2ID0 A;  5JVG 3;  1BF4 A;  4CKC A;  4PV1 C;  1G6Z A;  4DGZ A;  3K5N A;  4TRD A;  3J7A F;  2K03 A;  5E4X A;  4DK0 A;  1QNK A;  3H91 A;  4XQQ A;  4DXF A;  3ZYY X;  3M4Y A;  4TQU S;  2GA4 B;  5E4W C;  1CHQ D;  3ND8 A;  3N52 A;  4DAV A;  1SNQ A;  1G91 A;  5EKK A;  2SOB A;  1GUG A;  5C4X B;  1RTO A;  2MP1 A;  4C3H B;  3SVM A;  1JWS D;  3H09 A;  2LFN A;  1GXD C;  3TME A;  4XYQ A;  5J22 A;  3H3V C;  1YNN C;  4P2C B;  5TSS A;  4CGY B;  2NTS A;  1ONL A;  3Q6S A;  3PMF A;  3L3O C;  3VYU A;  3KBX A;  2NN6 G;  1LTR D;  1QJO A;  4FF2 A;  4G7O C;  2E2D C;  1D2B A;  2O5I C;  3RMH A;  3W3A A;  3CQZ B;  1DD2 A;  5HGT A;  2E2J B;  2NYZ D;  3ND9 A;  2D5D A;  4CJ0 B;  2Q8R E;  3QO2 A;  3X3N A;  3D6W A;  2J0T D;  1E2V A;  4X3S A;  2VNU D;  1C4Q A;  3OMG A;  2F4I A;  2D9U A;  2B8F A;  2L4N A;  1HFG A;  1ZEQ X;  4BA1 I;  2NN6 H;  5EPL A;  1LTA D;  1D5M C;  1EQT A;  1V1P B;  4DAP A;  5EPK A;  3CKI B;  3SEB A;  2BOS A;  1O7Y A;  2KHS A;  1QIL A;  3MWY W;  3I90 A;  1NR2 A;  4C3I B;  5I6Y A;  5I4D A;  1BUV T;  2JEB I;  1I6V C;  2AWO A;  1Q1B A;  1Q8I A;  3HEJ A;  5ELF A;  2QIL A;  3GTP B;  3J7Y W;  3DEO A;  1ET9 A;  1OXS C;  3E0J A;  2Z1C A;  2EJG C;  2WV6 D;  3NWT A;  2F0H A;  1ESR A;  5C5L A;  2KCC A;  5DM6 3;  3PIP 3;  1VF5 C;  1YNN D;  3S1R B;  3O13 A;  2TMP A;  4C2M B;  1BR9 A;  1SEB D;  2NTT A;  4FO2 A;  3T56 B;  1CA5 A;  4V19 0;  2KVM A;  4O1N A;  2RBM A;  1TWC B;  1KNA A;  2MHV A;  3AMU A;  2HDL A;  1ROD A;  2FFK B;  3Q0A A;  1HXY D;  3HOU B;  4OO1 G;  1FYC A;  5IGD A;  3OIQ A;  4ZAI A;  2OF1 A;  3LWU A;  1U4M A;  2O2L D;  1XYI A;  4KKT A;  4HTH A;  4BY7 B;  2JA8 B;  4B08 A;  2IJ0 A;  1CA6 A;  1EQV A;  3MXN A;  1SDF A;  1KTK A;  4X3K A;  3HKZ B;  4WOR A;  2DY8 A;  2DNC A;  4HN7 A;  3OMC A;  1H9K A;  2Z4H A;  1R9T B;  5COY A;  1CT1 D;  1FNU A;  3SR1 A;  4OO1 H;  2AUJ D;  3J81 E;  2N55 A;  4IUU A;  3AU7 A;  4KK7 A;  3NTI A;  5CV7 A;  4F87 A;  5C4Z A;  2EYJ A;  3V2T A;  4B9W A;  2RKS A;  3MFG A;  3URY A;  5J1Z A;  2NB0 A;  2IPK D;  3I3C A;  2PQE A;  3TDQ A;  1MSH A;  5KYI A;  1LT5 D;  3M7G A;  1F77 A;  2C9O A;  2EOT A;  1MD2 D;  5EKL A;  4NDX A;  3HOW B;  1LTS D;  3HRZ C;  5ELE A;  1B9N A;  1JCK B;  4IQZ A;  5IGB A;  5C5M A;  1DOM A;  1LO5 D;  1IHZ A;  2K5Q A;  2K5W A;  5LHY 1;  1OXX K;  4K14 A;  1Y1W B;  4B9X A;  5E3F A;  4HAE A;  2IWH A;  4C3H G;  3G7L A;  2BA1 A;  3RD4 A;  3E6Z X;  5FO8 B;  2EYF A;  3RLF A;  5C0X J;  3J80 E;  1TWF B;  2HQE A;  4FNF A;  1TY2 A;  1Q12 A;  3HOV B;  1D1I A;  3MA2 B;  2R93 B;  5IGG A;  3NK9 A;  2F3V A;  1S5D D;  1HA6 A;  3NSW A;  4RCN A;  3I4M B;  2M9V A;  1PXU A;  2LS0 1;  2NUC A;  1AZQ A;  3R93 A;  3NHH A;  3BDL A;  4IZ8 A;  3L9A X;  4C56 C;  4XT1 B;  1H9S B;  4JK1 C;  4DNR B;  5KNB A;  2K33 A;  3DWP A;  2A5H A;  3A8K E;  4A3M B;  1SE2 A;  2WIN B;  5AFW A;  3D4W A;  4A3B B;  2X69 A;  2YU9 B;  4KD3 A;  1V1P A;  1LT6 D;  2F0L A;  3NTH A;  1O7L A;  3I4L A;  3SE0 A;  5IOC A;  3BYT B;  2XWB B;  1LAB A;  2E2H B;  4Q0F A;  1BCP B;  5A2Q L;  1G8Z D;  2V4D A;  2E75 C;  5G3L D;  1I3Q B;  1BOS A;  1EZ6 A;  3BYY B;  3KBG A;  2EJF C;  4FP5 D;  4A3G B;  3VYR A;  2MJ8 A;  4KHV A;  2AQ2 B;  2F0T A;  2F0N A;  2FMM A;  2B2Y C;  1WTW A;  2WII B;  5KRU A;  1CZW A;  1I4H A;  4K5X A;  1BCP C;  3EA6 A;  4A93 B;  1XTC D;  1ZXT A;  4XTC S;  2RDH A;  1I4R A;  1KAA A;  5BN5 A;  1EOT A;  5CBA E;  2KEC A;  3K59 A;  3A7L A;  3P1H A;  1CHP D;  1X32 A;  3MC0 B;  1PLF A;  4ZYS A;  1WD1 A;  1K83 B;  1Y8P B;  3KK7 A;  2XSC A;  3WDN A;  1QB5 D;  2HCC A;  5CV4 A;  4N9P A;  4R8N A;  4KY6 A;  2IX1 A;  3NQI A;  2FMC A;  3TZU A;  4EVO A;  4KV6 A;  1W6J A;  3SK6 A;  1QE6 A;  2VXW A;  2EY6 A;  5I2Y A;  2F0F A;  4RKL A;  3HG9 A;  2OEO A;  2XRS D;  1B3A A;  2WKD A;  2J7Z A;  3GQB A;  1OXV A;  1SMY C;  1GUW A;  3HOX B;  1STH A;  1SNC A;  3M4O B;  2R6G A;  5CV8 A;  1DOK A;  4EQO A;  2LKV A;  1G29 1;  4ID6 A;  1IKL A;  5DEH A;  3NPP A;  1Q3L A;  3VYS A;  1GOZ A;  2Y0S B;  3BG3 A;  4KJN A;  1PFB A;  1BCP D;  1IYU A;  3GV3 A;  2EDG A;  3C46 A;  3T51 B;  3T4A C;  4A3I B;  2YYZ A;  1G2S A;  5CV5 A;  4G7H C;  4K2K A;  3TBI B;  3G6J B;  4NW2 A;  1GHK A;  4L6T B;  4DN4 M;  4DF7 A;  4DA2 A;  2JA7 B;  3K0Y A;  2SDF A;  3GTK B;  1H9J A;  1FNV A;  4TSS A;  2PMZ B;  2PZW A;  1EWC A;  4IUQ A;  3PUY A;  3K5L A;  4A3K B;  3R8B A;  3D31 A;  1SYG A;  5LL6 X;  3I91 A;  5EQ0 A;  2X6L A;  1PRT F;  1W6K A;  2A6E D;  1WTV A;  3EFX D;  5M3M B;  3MHB A;  4HMJ A;  1S4Z A;  4UAI A;  5JJZ A;  4OGQ C;  3I72 A;  1SYF A;  1EYD A;  2FIN B;  2B39 A;  2ENB A;  4HED A;  2IX3 A;  2F0D A;  5CBE E;  2LMC B;  3HOZ B;  2KJX A;  1Q1E A;  1GUT A;  4PMW A;  5I6W A;  1H9S A;  1SMY D;  4H0L C;  1A6X A;  1OXT A;  4BBR B;  2KUM A;  1BDO A;  2RSN A;  2XIW A;  1SE3 A;  3KF8 A;  1FNW A;  4QUF A;  3VR6 A;  4S3S A;  1EEF D;  5BN4 A;  4FYD A;  1A3T A;  1WCM B;  2B2V C;  5K36 G;  2TSS A;  2B2W C;  3HZX A;  1A2U A;  2RVL A;  1STE A;  1STB A;  1E0B A;  3HGB A;  2ZXP A;  1L0X B;  4LMQ D;  1SBB B;  3C3L A;  3BVG A;  1T5X D;  2A73 B;  4G57 A;  1RKN A;  3CU7 A;  1SYB A;  4RGM A;  2Q8T A;  5K36 H;  4A3J B;  5KIX A;  1Z47 A;  4O42 A;  4HMI A;  1B1Z A;  4JBW A;  1FR3 A;  4L63 B;  2EYM A;  4RA8 A;  2L9H A;  4K6D A;  2F0W A;  2RQX A;  1LT3 D;  5F2D A;  1I4G A;  4AYB B;  2K04 A;  4QF4 A;  1LAC A;  2H4O A;  4U68 A;  3K6O A;  3P75 A;  2RDF A;  2XNA C;  1PZK D;  1STA A;  1IW7 C;  1ET6 A;  3DUZ A;  1Q90 A;  2F1M A;  1MBY A;  2E76 C;  4WRD A;  3NE5 B;  3EVQ A;  2FJ2 A;  3A55 A;  1A15 A;  2D62 A;  3GTL B;  3MZ5 A;  3QOJ A;  3NQT A;  2QDB A;  3GO5 A;  1UUP A;  4DXG A;  4OHJ A;  4XIG S;  2N88 A;  1RJT A;  2IL8 A;  2AWN A;  1SXT A;  1T5E A;  4C1N K;  2F0G A;  3NXW A;  5K5P A;  1DYQ A;  5A35 A;  3H94 A;  4XT3 B;  2L5T A;  5CGK A;  5C44 B;  2R61 A;  3K7A B;  1STY A;  2F0I A;  1HQR D;  1O7Z A;  2KOL A;  3MXG A;  1HPC A;  2BE5 C;  4FVM A;  1PTO C;  1Z7T A;  5FK9 C;  4J6H A;  2NVX B;  4ZK9 B;  4F8M A;  2MUY A;  2HCI A;  1SYC A;  1LTG D;  3MXP A;  1AFP A;  1DXM A;  1B50 A;  2PNR C;  1WTX A;  3C2P A;  3FEW X;  2I07 B;  3MVV A;  1NCV A;  3S2H B;  1WTR A;  4ZKB B;  1IW7 D;  2A6H C;  3FRP B;  4DK1 A;  5JEA G;  5IT9 E;  1S5F D;  3CHB D;  3K58 A;  5KYL A;  5CV6 A;  1KDC A;  1Z6H A;  3QWN A;  5KGU A;  1AZP A;  4NP5 A;  3S1N B;  4RGN A;  4Z9C B;  2A69 C;  3DXJ C;  2PO4 A;  5EPJ A;  4KN4 C;  5FLX E;  4KI0 A;  4RWS C;  1A3V A;  3TSS A;  3JAM L;  4OIJ A;  5JEA H;  5I2X A;  1EL0 A;  1K8O A;  4IUN A;  5NUC A;  1R4Q B;  4KJO A;  3Q23 A;  3DMU A;  5JPM C;  2KA7 A;  1V1O A;  3NBH A;  1E2W A;  2BE5 D;  4KY7 A;  2JYO A;  4A3E B;  3QB3 A;  3WOE A;  1PTO D;  5KNC A;  1GJX A;  4K2L A;  3GV6 A;  5HUR A;  1TKW B;  2XRQ D;  3K57 A;  2EYL A;  1F9S A;  5FO9 B;  4HCE A;  4RAU C;  3C1E A;  3QG1 A;  1MSG A;  2KEE A;  4U67 3;  3RUZ A;  4ODG A;  2F03 A;  1EY7 A;  1SNM A;  1BNZ A;  2A6H D;  4CHT B;  1JOR A;  5I9P A;  4CKB A;  4OIK A;  3M85 A;  1LT4 D;  3VYT A;  3PUV A;  2NVQ B;  3DEP A;  4C3J B;  2EY2 A;  4DU9 A;  1QNU A;  2WAQ B;  1TQO A;  4K5V A;  1JOO A;  2A69 D;  2EE1 A;  4RGO S;  2JP1 A;  2CQA A;  3U9O A;  2PYK A;  2O5J C;  1BQQ T;  2EY1 A;  5IOD A;  5C6A A;  3SK4 A;  5CMD A;  1CQV A;  1X3P A;  1S5C D;  2RSO A;  2DNE A;  2BDO A;  1E2Z A;  1QG7 A;  1HA5 A;  3KLR A;  2VB3 X;  1PMR A;  1GHJ A;  2NZ1 D;  3V05 A;  1A3U A;  2F0M A;  2Z4I A;  1JE4 A;  4XQN A;  4EQN A;  3IKJ A;  2SNM A;  3V96 A;  1TU2 B;  1LV9 A;  1GUN A;  5KND A;  3QOL A;  1TWG B;  1I4X A;  1ZKO A;  5M5Y B;  1TS4 A;  4HCS A;  3BS1 A;  4LAA A;  4CJ2 C;  3DM1 A;  4RKB A;  4QMG A;  5EJW A;  3MFY A;  4NMZ A;  5G3L F;  2NN6 I;  1PTO H;  1A2T A;  3PUW A;  4KN7 C;  4CKE A;  1STG A;  3FMC A;  1KDA A;  1JQY D;  1IL8 A;  1JOK A;  1LTI D;  2JA5 B;  1SE4 A;  2MPM A;  2BA0 A;  1SND A;  2O4X A;  2K6A A;  3DWQ A;  5ISR A;  2RA4 A;  4ME5 A;  4WFN 3;  1DOL A;  2QKI C;  3BVM A;  2ZXO A;  1I50 B;  3GTJ B;  1C48 A;  4Y7N B;  3OWE B;  1J8I A;  1CK1 A;  5C4J B;  4RCO A;  1ESF A;  1KAB A;  2NBF A;  3HOY B;  4QB4 A;  5T1G A;  1AP0 A;  2KCN A;  4PQX A;  1EFI D;  3U9S A;  1DCZ A;  2JEA I;  3VR4 A;  2BDN A;  2L55 A;  3R3O A;  2M00 A;  4XDX A;  4PNY A;  1SSO A;  2R3Z A;  2CHB D;  1EIH A;  5E1F A;  3TP7 A;  3TZD A;  3MAQ A;  1CZG A;  2EYP A;  4K8I A;  3BDO A;  3FPU B;  1JOQ A;  1RTN A;  1SJE D;  3WOF A;  2OXP A;  1PZI D;  2G9D A;  1HUM A;  4J8Q A;  1D5Z C;  4F88 A;  1ENF A;  4ABN A;  1EU3 A;  2EJM A;  5IGC A;  5C0X G;  2CW0 C;  3OPO A;  3SDZ A;  4F7X A;  3MEH A;  1NSN S;  3ERQ A;  3P20 A;  1HQM C;  1B4O A;  2G9H D;  4OO1 I;  4I65 A;  4IUV A;  5D3D A;  3TN2 A;  5JVH 3;  1D1K A;  4DFA A;  1ENC A;  5C3W A;  1YNJ C;  3VR2 A;  4FF3 A;  2X6G A;  2AQ3 B;  1BCP F;  2JE6 I;  3R2I A;  3PO2 B;  1ILQ A;  3C1F A;  5FKA C;  1HTL D;  1J9O A;  4R9W A;  1DM0 B;  5C0X H;  1WTP A;  2PCF B;  4K8J A;  4MHE A;  4XYO A;  3LWE A;  1VF7 A;  1F2M A;  5KEE A;  2EVB A;  4YIJ A;  4FXK C;  1RHP A;  4C3J G;  5DAU A;  5CC4 A;  5IIF A;  1UEA B;  1XXG A;  2EXZ A;  3IFT A;  1B53 A;  3J81 L;  1R4P B;  1VDZ A;  4ZUJ A;  3RZD B;  4G7Z C;  2ZXR A;  3NBI A;  1FGB D;  3TP6 A;  2L12 A;  4ZRZ A;  1F9P A;  3KLS X;  2Q8I B;  5ELD A;  3S16 B;  1EY5 A;  4LJZ C;  1CFM A;  1RF2 D;  2M2L A;  2WKC A;  2XWJ B;  2OT2 A;  2PW7 A;  1PZJ D;  3ERO A;  4K6L A;  2B2Y A;  4IAL A;  1K8M A;  4BBS B;  2DN8 A;  2K5D A;  2QEJ C;  1KDB A;  2F0K A;  2B2T C;  2CW0 D;  1BBX C;  5A2Q E;  5D14 A;  1TS5 A;  1EY9 A;  2WAC A;  4IN3 A;  3OHX C;  2XVS A;  1WD0 A;  1RCV D;  3EQL C;  3HP3 A;  1LLR D;  4XQJ A;  3A7A B;  1YNJ D;  1MGS A;  1RD9 D;  2F0E A;  3OIP A;  3J80 L;  5C3E B;  4IFD G;  2KQ3 A;  4KKS A;  5EGT A;  4V0B A;  3K5O A;  3PO3 B;  4ZQ3 A;  1NUC A;  2F0U A;  1HTP A;  4CBV A;  5C3X A;  1PFN A;  3S14 B;  1I6H B;  1EYC A;  2C5C A;  3SK8 A;  2F0P A;  5COR A;  3M7N A;  2Z8L A;  3GTM B;  4KHZ A;  4IFD H;  3IFD A;  3R2T A;  1F2L A;  2PPB C;  2EY5 A;  5JAV A;  4RGT A;  5ELC A;  2K28 A;  3S2D B;  3EJI A;  2R92 B;  1AW7 A;  2E74 C;  3S17 B;  2EZV A;  1VCI A;  1TS2 A;  3SK5 A;  2KED A;  5CV9 A;  4FXG C;  1PTO B;  1QCB D;  3VR5 A;  1S5B D;  3DWA A;  4WJW A;  4H13 C;  4L8J A;  5I9O A;  1CM9 A;  1EY0 A;  2L0C A;  2J4X A;  1U4R A;  3NUC A;  4RHR A;  1PDQ A;  1UAP A;  2I46 A;  5EBD A;  1XX8 A;  1OO9 B;  5M9O A;  5FOB B;  3TP8 A;  2WP8 J;  1IKM A;  2E2I B;  5IGF A;  1MI2 A;  1EU4 A;  1JWM D;  1HRJ A;  1VMP A;  2A74 C;  1SNO A;  3L7Z C;  4A3D B;  1JB3 A;  3I70 A;  3GTO B;  1JWU D;  4N9T A;  3OOC A;  1CTM A;  1ENA A;  1WVL A;  1SNP A;  3A8I E;  1ILP A;  3MXU A;  1L0Y B;  2SEB D;  2F0O A;  3RZO B;  4NKL A;  4ZUI A;  3IAY A;  4QIW B;  5DM7 3;  3Q22 A;  4CJ1 B;  4IUT A;  1F2Z A;  1KLG D;  2B2U C;  4KMU C;  4HSV A;  4X3U A;  1UNS A;  2VB2 X;  3OW7 A;  5C4H A;  1D6E C;  5DNF A;  3GTQ B;  3F2U A;  2F3W A;  4TKO B;  1SAP A;  3A56 A;  4RH6 A;  1TII D;  2B2V A;  3VR3 A;  4BY1 B;  4FXD A;  2L1B A;  1X3Q A;  2B2T A;  3CRK C;  2B2W A;  1ML0 D;  4LK1 C;  3D8G A;  3T16 A;  1WTQ A;  1CQF A;  1U9R A;  1II3 A;  1EY8 A;  2BCO A;  4OL7 A;  2F0S A;  1Y8N B;  3TP5 A;  1HFN A;  5C0X I;  1LTT D;  4UDU C;  1TVX A;  1H9R A;  4KKU A;  3X3M A;  2L11 A;  1H9M A;  2IT1 A;  1ICW A;  2K7V A;  4DNT B;  1HCZ A;  2MGS A;  3Q24 A;  2IX0 A;  1NR4 A;  2PZT A;  1F2Y A;  1Y1V B;  4R8I A;  1GUS A;  1D5X C;  2JSO A;  1FD7 D;  5CR3 A;  4KD4 A;  3ONA B;  4KTA A;  3K5M A;  5CYU A;  1VMC A;  3DHQ A;  2VUM B;  1PTO F;  1TS3 A;  1TR5 A;  2FHT A;  3SHL A;  4G4K A;  1CI3 M;  1JC7 A;  2H1E A;  4MIU A;  3VA5 A;  3IL8 A;  5EBC A;  1EEI D;  1SYD A;  2AQ1 B;  3MTS A;  1EZ8 A;  3FDT A;  2ICI A;  3AB9 A;  2HUG A;  4QUC A;  2DY7 A;  1TWA B;  2K1B A;  3FKI B;  1NAP A;  3HS0 C;  3H6M A;  4HR7 B;  2QCP X;  3M3Y B;  1M4V A;  2HDM A;  1EWH A;  1IYV A;  3I8Z A;  1QWY A;  3QJY A;  4GZY C;  1EY4 A;  1U4L A;  3S1Q B;  4ILW A;  1SFO B;  1TY0 A;  1EY6 A;  4H44 C;  3S1M B;  4C3I G;  4ZKC B;  1V43 A;  1KLU D;  5D65 A;  1O78 A;  2EYH A;  4C1N I;  3VA7 A;  1PRT B;  2SNS A;  1G2T A;  3W2D A;  3KLS A;  3S15 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...