2F0VA

Crystal structure of staphylococcal nuclease mutant v23l/v66l/i72l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0vA00
2F0DA 2F0FA 3T16A 5EKLA 5IGEA 5J22A 4DU9A 2F3VA 3MHBA 3VA5A 3NUCA 3QOJA 2PW7A 5CV8A 2EYMA 4K8IA 5KGUA 2RDFA 4ZUIA 2PW5A 1EYAA 5HGTA 4WORA 1STAA 3MEHA 2EY6A 5CC4A 1KAAA 3NK9A 4R8NA 1U9RA 2NUCA 3TP7A 1EY8A 4KV6A 2F0NA 3S9WA 3ERQA 1SNOA 1SYGA 2F0UA 2LKVA 4NP5A 5CV9A 3SXHA 4TRDA 3U9OA 5J39A 3D8GA 5IOCA 1F2YA 4K2LA 3EROA 2F0OA 2F0PA 5HURA 4K6DA 1TQOA 5I9PA 1EY6A 4H7BA 2F0WA 1ENAA 1JOQA 3E5SA 5ISRA 4EQNA 1STGA 4RKBA 2EY1A 2F0VA 3DHQA 1KABA 1TT2A 2PYKA 3OMCA 4J6HA 5IGGA 2KHSA 1KDCA 2OF1A 1STBA 1A3TA 2F0KA 2F0QA 1ENCA 4MIUA 4KTAA 1STHA 2F0JA 3NHHA 3QB3A 5NUCA 2EYFA 4KHVA 4IUNA 4NDXA 1JOOA 3RUZA 1A2TA 2WACA 5KYIA 4B9WA 4I65A 4J1MA 1EY4A 3SK5A 2F0IA 3HEJA 1SYFA 4ZQ3A 3MXPA 2F3WA 4EQOA 2HQEA 4KJOA 2F0LA 3C1EA 3D4WA 1SYEA 1A2UA 3OMGA 4LAAA 4PMBA 4QB4A 3T13A 2ENBA 5KIXA 1RKNA 1KDAA 2OEOA 1EY0A 3TP6A 1TR5A 4DGZA 1EY9A 1JOKA 4QF4A 3HZXA 4K5XA 4KY5A 5I6WA 1KDBA 1STYA 2SNSA 3BDCA 2EYOA 1SYCA 5CV4A 2KQ3A 3OWFA 4K14A 1F2MA 4ID6A 1A3UA 3C1FA 3H6MA 1EQVA 2F0TA 3P1HA 4IALA 4S3SA 1F2ZA 2RKSA 1SNMA 5C3WA 5C3XA 5KEEA 3QOLA 3TMEA 2EY2A 2F0HA 3D4DA 5EKKA 1NUCA 2F0SA 3OSOA 4N9TA 4K2KA 4EVOA 5I9OA 1EYCA 2PZWA 3TP5A 4KY6A 5E3FA 4B9XA 1EYDA 1STNA 4HMJA 5C6AA 5IGFA 4NMZA 4OL7A 4WRDA 1SNCA 5DEHA 2M00A 5JOBA 5I6YA 3BDLA 3SR1A 4F7XA 1II3A 4HMIA 1EY5A 1NSNS 1SYDA 1SNDA 2EY5A 2EYJA 1SYBA 4E6IA 1AEXA 5CGKA 5IGDA 5IIFA 3R3OA 5J1ZA 4F8MA 2EYPA 2EXZA 1SNQA 2F0EA 4KD3A 3TP8A 5K5PA 4PNYA 2F0GA 3P75A 2PZUA 4KD4A 2QDBA 2PQEA 4QMGA 4KY7A 1EZ6A 5CV5A 2EYHA 3SK4A 4DFAA 4ODGA 2EYLA 4N9PA 4YIJA 1IHZA 3SK8A 5DAUA 3NXWA 5CV6A 3MVVA 4DF7A 5F2DA 4K5VA 3ITPA 2PZTA 2SOBA 1SNPA 3DMUA 5CV7A 5C5LA 5IGBA 5M9OA 3NP8A 2RBMA 2SNMA 5JAVA 4IZ8A 2F0MA 4RKLA 5C4HA 3SK6A 5KYLA 4G57A 3MZ5A 5C4ZA 5IODA 3EVQA 3SHLA 2O4XA 4ME5A 5E1FA 5IGCA 3D6CA 1A3VA 3LX0A 1EZ8A 1EY7A 5EGTA 4K5WA 4K8JA 4NKLA 2OXPA 4ZUJA 4KJNA 3NQTA 4PMCA 5CR3A 4HTHA 4EQPA 3EJIA 3PMFA 3V2TA 1JORA 5KRUA 5C5MA
chains in the Genus database with same CATH superfamily
4PMWA 5FKAC 1CKOA 1MGSA 3GTKB 4R4CA 2XWJB 4QUCA 4HJ9A 4DR2L 4C1NI 3H3VH 2PW7A 1LACA 3OTOQ 1PH5A 4DUYL 1S5ED 2NWGA 5HGTA 4JI2L 2LFNA 4A3IB 2EXDA 3CC2A 3PQIA 2L5TA 1XJVA 2FJ2A 5CV9A 4A76A 5LL6X 1SFOH 2JEBI 2PQAA 3FVQA 2A68C 2CQOA 4JI7L 4K6DA 4DUZL 1ENAA 5C44H 4DPGA 1UE1A 4RKBA 1K83B 1PRTD 1GUSA 2NB0A 1TWAB 1AE3A 4DR5L 2Q2HA 3TS2A 2RSOA 3CMAA 1A0IA 1LT3D 4BY7H 4DK0A 2LXJA 1YITA 4ZLTF 3AFQA 3OIQA 2MP1A 3HEJA 1Y1VB 4BBSH 1AH9A 1NJIC 2RQXA 3I72A 2HHHL 4FXDA 1VQCA 3J7ZC 4IJHA 5CMDA 2Y0SE 1HNXQ 1KRSA 1N34Q 1KDBA 3I3CA 2OTLA 4RFBA 1EIFA 2JYOA 3W3AA 2NVYH 3H6MA 2WB1E 1VQBA 1QJOA 3UDIA 1HNWQ 1EEFD 4LWCA 4R4OA 3D3RA 4BXXH 3PO3G 1IKLA 5IGFA 4WRDA 2E2JB 4B3TL 5LMNW 2NTTA 3S1RB 1YZ6A 3TREA 2KEEA 2H4OA 5IIFA 1H9RA 3KF6A 3FMCA 1QVFA 5A2QE 3HOWG 4KD4A 3GV3A 1K0RA 1IYVA 2YU9B 4A3KG 3J7AV 2EYLA 2CHBD 1U4RA 3HKZE 1HA5A 4GLVB 1PXUA 4DUYQ 2F0MA 4JI4L 4RKLA 4DR2Q 1J5EQ 3E9IA 2KHIA 1KQSA 2Z9HA 1M4VA 4L5QA 4NKLA 4BWGB 1A8VA 4A3CH 1AFPA 3P7JA 2JSOA 2F1MA 2E5LL 3S17B 1Q8KA 4GS3A 1I4RA 4DN4M 1GXDC 4LW1A 2B2WA 2D0OA 1W6KA 5JJLA 1N33L 3MEFA 2UU9L 1X3FA 4WORA 3CC4A 3J80L 4BBSG 1RDPD 2MGSA 5ELFA 1PDQA 3BG3A 4LF8Q 2LKVA 3SXHA 1EQTA 1B53A 1WJJA 1PH6A 2RHQB 4YWMA 3CCMA 5JVH3 5DM73 5KNDA 2R92B 3K57A 4UDUC 4HIDA 1PFNA 2B2YC 5C0XJ 2B29A 5NUCA 5JVG3 3AU7A 3IFDA 1VMCA 1EY4A 4C2MH 5IYCG 5M3MB 1G2SA 2X69A 4PMBA 1BVSA 4YHHL 1VQFA 3I4NG 3AMUA 1SXTA 5IODA 3K7UC 1BCPB 1SYCA 4JW0A 4H02A 1NY4A 5C3WA 4HJ5A 1SNMA 4RMFA 4IOAA 4BA2I 1I4HA 3A7AB 3J81j 2EY2A 4JI4Q 3V96A 3HKZB 1WYDA 1R9TB 5IYDH 1NAPA 3H0GH 3M4OB 1WTXA 4WFN3 4A3IH 1EU3A 3VYUA 1DD2A 3BYYB 4HMIA 3RD4A 3J80E 1DZ1A 2Q2UA 1PFSA 2KECA 3T1YL 4IUUA 4OIKA 4R1JA 4PNYA 3L9AX 2PZUA 5C4XH 2F4VQ 2A69C 4KHPQ 2VL6A 3PO2G 2UU9Q 3W2DA 4MNOA 2JXMB 1HH2P 3ITPA 2R7ZG 4LUZA 1KTKA 1Y1VH 3GD7A 5IGCA 3D6CA 5GQOA 3PSIA 4KK7A 1N32Q 1IW7D 1YNND 3L7ZC 4K5WA 3OIPA 4CJ0B 5FLMH 4FF2A 2ZXPA 2WAQE 1B50A 2B2VC 4GOPA 2VQEL 1X3PA 2QEXA 4IFDH 4MTNA 1PTOD 1WOCA 1UNSA 4X6AH 2R93G 5C4XG 4GOPC 3PIO3 3GTJH 4CDCC 2K32A 1G51A 1HR0L 2ZXOA 2JK8A 2NUCA 4R9WA 3M4YA 1CM9A 1LM0A 1V1PB 4YWKA 4TRDA 3H3VC 3S1RH 3M85A 3GTQH 2F0OA 1Q7YC 2L1BA 5ELCA 2G9DA 1B44D 3J7A5 5IT9L 4B3TQ 1KC8C 5JJKA 1F9QA 2A73B 2QGQA 1NR4A 4KTAA 5C44B 4JI2Q 1UEBA 1VQ9A 4YCUA 2K5QA 4Z9CB 3HOYB 3S1NH 3OTOL 3HOVG 4YWLA 1Q81C 4O1NA 4KJOA 2VQEQ 4K6LA 1AZQA 1TXYA 2EZVA 2C5CA 2K5HA 2N55A 1RKNA 2XRQD 3L3OC 1K3RA 3A5UA 3TS0A 1EY0A 1JWMD 4HIOA 1QZHA 4HJ7A 4K5XA 4O42A 4BBSB 4M1UB 1DM0B 1GVPA 1OXUA 5E4XA 4ME3A 2CCZA 5GAHC 1WTVA 1O7YA 2E2HH 1L0WA 4DAYB 2R61A 1MI2A 1LYLA 1UE7A 2JA7G 1HZ9A 3GDEA 5COYA 3BS1A 1PZKD 3RZDH 3CCEA 1C7YA 2XWBB 4JI6L 3CD6A 1UWVA 1OXXK 4ALPA 4JI5L 4OX9L 4OEMB 3I4LA 3NTHA 3VDYA 1JJGA 2EXZA 3I4NB 2F0GA 3P75A 2Q2TA 3CCLA 5FJ8H 3A8KE 1JJCB 4J15A 4DK1A 4LFCQ 3PIP3 4B3ML 1HUNA 1TWCH 4Y52H 2QF7A 3ICEA 2KBNA 2SNMA 1SRUA 1SN8A 2C35B 2QEJC 2AUKA 4DV5Q 2PI2A 3EVQA 3SEBA 1EOVA 2ICEC 4XTCS 2K7VA 3CCQA 1GUGA 2IT1A 3RMHA 3RLOA 3V2TA 2PPBC 1HFGA 5LMNQ 4DAVA 3I4MB 1Z47A 1PTOF 2GA4B 1IL2A 5D3IB 2MO0A 4FVMA 4NXMQ 2NYZD 4CKEA 2RDFA 2ZJQA 4RGOS 2JP1A 2E2IB 1STAA 3MEHA 4A3MB 3PO3B 2EPBA 2DGYA 5IP9H 3HOVH 1U9RA 1KNEA 3U9OA 1JC7A 2EJMA 4KLKA 1PRTC 4LF4Q 1KLGD 5HURA 1VQOA 3DUZA 1STGA 4A3FG 2PYKA 3HOWB 5IP7H 4A3DB 1D5MC 2YV5A 3K58A 3HOZG 4LFAL 1CA5A 3J80i 1WTPA 1YVCA 2BOSA 3H91A 1A6XA 3KDFA 4RGTA 5FO9B 1JCKB 2QKIC 1BQQT 1A2UA 2Z6KC 4XDXA 4HR7B 3MC0B 2JA8B 1FNVA 4HCEA 1KRTA 3FPUB 1F9RA 4JBJA 1STYA 3OWFA 4K14A 3I55A 1EQVA 1NR2A 1LTLA 3GTMH 1ZKOA 2KUMA 2AMCB 4RA8A 3KF8A 5A35A 2IJ0A 3PCOB 1HCZA 4XYQA 2B2VA 4HEDA 5LMUL 2J0TD 1Q1BA 1R9TH 1NTGA 1VQIA 1HUMA 2E8GA 4B3RQ 5FOBB 1AE2A 3T53B 2KEDA 1DOLA 4C3HH 4YY3L 4DFAA 3T1HQ 1JE4A 4UPAA 1WTWA 5IWAL 4DV7L 3BZDB 5DLQE 1BBXC 1C48A 2RBMA 4AYBG 4OO1H 2HCIA 5IY0A 3H0GG 5KYLA 4FDBA 1UAPA 2O4XA 5E1FA 1E1TA 2D5DA 1A3VA 1QNUA 2OQ0A 3J7AF 5IYDG 3RN5A 4L5SA 2SDFA 4KJNA 3NQTA 3QWNA 5EKIA 4BY1B 1ML0D 1E22A 4CKBA 5JEAJ 4DV0Q 4KI0A 3RZOH 1X9NA 1KD1C 4DR3Q 3CQZB 1WTOA 2RCNA 3OPOA 4K8IA 1Z6HA 3RLNA 2R92G 4NXNL 5CC4A 1I4GA 5KNCA 2NVTB 3FPPA 1D2BA 2K33A 1QNKA 3RZDB 2CWPA 1WTHA 1K3BC 5IOCA 5I9PA 1JOQA 2R93H 5LL6S 5M5WH 1Q12A 5IGGA 1IBKQ 2OCEA 3TRZA 4RCNA 3SE0A 4POFA 2KCMA 2B39A 1XMOQ 1A3TA 4IOCA 3I90A 4A3JB 1VQAA 5ELOA 1WTQA 5FLMG 5CYUA 4A3BB 3W5OA 4EX5A 2WV6D 2WB1B 3J80c 1IYJB 2F3WA 2IHEA 1VF7A 4H0LC 2A6ED 2BH8A 2OEOA 3TP6A 3S1NB 1G6PA 4QF4A 1JOKA 5I6WA 5IYBG 1WCMH 3KJOA 3HOXH 3BZKA 2WINB 1G6ZA 1A3UA 1O78A 2D0PA 3GP7A 2MUYA 1TS5A 2Z1CA 4LNQA 1WCMG 5ELDA 4QCLA 2ZM6Q 2Y0SB 3ERSX 4I7ZC 4KY6A 5E3FA 4LMQD 4UP9A 1PHJA 2ZXRA 3VR5A 1LTID 1N36Q 1WVLA 3L2PA 1I5FA 4KD3A 1FL0A 2JA7B 1PYBA 4FF1A 1Z7TA 1GOZA 2FXQA 2VUMH 4RWSC 3ER0A 1NMGA 1PZID 1RTNA 1V1QA 1HZAA 1DXMA 2LXKA 1KL9A 5I4DA 1RCVD 3G48A 3S2DH 2SOBA 3DMUA 3OWEB 5CV7A 4AH6A 3KJPA 2HCCA 4GZYC 1J8IA 4QJFA 4DKAC 1EZ8A 1AP0A 2HD3A 1H95A 4CDFC 1OTCA 4IPDA 4PMCA 4EQPA 2JA8H 3S1MB 1LABA 4QIWB 3LWUA 3KLWA 1H9SB 4IPGA 2B8FA 1RTOA 3T51B 1YJWA 1PH7A 1Y1WH 1D5XC 4C3IB 2NZ1D 3KF6B 2BE5D 4DR4Q 1H9KA 3TQYA 5GADC 4R8NA 1EY8A 5IP9G 2UUAL 1SNOA 5EQ0A 1YNJC 1GUWA 1X6OA 5A2QL 3J7YW 3D31A 1ET6A 1DCZA 4H7BA 1T9HA 4FYDA 1HR0W 3UDXA 3PO3H 1BOSA 3GTPB 3EBEA 4L63B 3HOVB 4ULLA 4LFBQ 1PFMA 1WD1A 4X66L 1STHA 2F0JA 4A93G 3I7FA 3H09A 4P75A 4B9WA 4K0KQ 3WOFA 3PF4A 1JICA 1K9MC 3Q6SA 4ZQ3A 1ESRA 1FYCA 4DK6C 3T13A 3KBGA 2ENBA 2I5MX 5KIXA 1SLJA 4JV5Q 1SBBB 5CBEE 2ES2A 4BY1H 3PGZA 4DV3Q 3K5OA 4IALA 3E3XA 3OYYA 5FJ8G 4Q5VA 1CHPD 2K5VA 3CCSA 3D4DA 2NTSA 4JK1C 5I2XA 3EIVA 2WP8J 5C6AA 3S17H 3GTLB 3SR1A 4DV3L 5C0XG 3HFZB 4DV0L 3R3OA 4C56C 4F8MA 2B63H 3K81C 4GOPB 5E4WC 1PRTB 1EIYB 4X65L 1I4XA 1K8AC 1TU2B 1E2ZA 3KF8B 1RIPA 2B63G 3GQBA 4DNIA 3BVMA 3MVVA 3D4RA 3NELA 2HUGA 2IX3A 4U673 1QUQA 2UXCL 4PV1C 2NZHA 1VQHA 4G7HC 2VNUD 4IPHA 1MIUA 2LY7A 4ME5A 1IBKL 4YY3Q 2PI2E 5EGTA 1SDFA 2PNRC 4ZUJA 4BY7G 3EJIA 2IW3A 2TSSA 1Q8IA 1WD0A 5BR8L 2F3VA 1T5EA 1CKMA 4DR4L 4GKJQ 3KLSA 4C3HG 1F9SA 4C3JB 2VS1A 1AW7A 4JI1L 1D5ZC 3STBD 1S5FD 4DV6L 5M3MG 3DM3A 4NP5A 5M3FB 4IUVA 1X56A 4CKCA 1JQYD 1SROA 4A75A 4Q0FA 4DXGA 2QW7A 1VQ6A 2K50A 3S2HB 4JV5L 1EL0A 2N8NA 3VA7A 3DHQA 1KABA 1GJXA 1B2TA 2F0KA 4A3GG 4MIUA 3H0GB 3M4OH 3KLSX 3H94A 2EYFA 5M5WB 3U4ZA 5AFWA 4Y7NH 3DM1A 2ZTDA 3BJUA 1CQFA 3QR8A 5L37A 1PH1A 3MXPA 2HQEA 4B08A 3NTKA 2NVXB 3UE1A 3OMGA 2XVSA 1K8OA 3NBIA 4XXEA 3PUVA 1O7LA 1K8MA 1TR5A 1PZJD 1PH8A 5I9OA 4B3SQ 1N36L 2DNEA 3KUPA 3NWSA 1JMCA 1PTOB 1C4QA 4IUTA 5IP7G 4AYBE 2F0SA 2Z6KA 3M3YB 4N9TA 4DAYA 1WCMB 4R4IA 1Y1WB 1SMYC 1HHVA 3K6OA 3TP5A 4HMJA 5I6YA 3K8AA 1K0SA 2GVBA 2KCTA 5C4JH 3QG1A 2AWNA 1U4PA 5LMNL 5LHY1 1SNDA 1KIXA 2B2UA 3PUZA 4NB3A 3ULLA 1IBMQ 3ZJYC 3MFYA 1UUPA 3ULJA 3KOJA 2EQSA 3FP9A 1XPUA 3SGIA 1UE6A 1BCPF 1OXSC 1XTCD 2F4IA 5JPMC 3MFGA 2VUMB 4DXFA 1FGBD 4G57A 4BBRB 1EFID 1OO9B 4L5TA 4XQJA 4X64Q 3S2DB 4JYAQ 3HS0C 4A3EB 4LF4L 1D8LA 1BCPD 3S1QB 4JI5Q 4OX9Q 5IGEA 3HOYH 3MHBA 1X3QA 1O80A 1QILA 2IY5B 3S1MH 5ELEA 2JEAI 5JEAH 2VQFL 1VQ5A 1CT1D 1R4QB 2X6LA 3JAMc 3E0JA 2B2TA 1FR3A 1JB7A 1NBWA 1V8QA 3CHBD 1TQOA 2R7ZH 2DN8A 1Y1WG 1TWGB 1SAPA 5AJ3Q 3FHWA 4DAMA 4A3GB 3CMEA 3K0XA 4GN5A 4OIJA 1I4PA 1X3EA 2M9VA 4BA1I 1EU4A 1MHWC 4IUNA 1K28A 4BS9A 3GTPH 4A3CG 2WACA 5TSSA 1V1PA 4LFCL 1SYFA 3T1HL 4LF6L 1N9WA 3KDFB 1KHIA 3J81L 3C1EA 4WJ3M 3N52A 2K6AA 1VQGA 4CDEC 2MFIA 4KY5A 3S9WA 2FINB 4A3KH 1SE2A 4JI0L 1GD7A 4S3SA 5LMUQ 2K75A 1F77A 5FLXE 2RKSA 1X54A 5C3XA 5KEEA 5D3DA 1Q1EA 2F0HA 5T1IA 3UI2A 4DA2A 2VW9A 1X65A 2VXWA 2PZWA 3UDGA 3E0EA 4ILWA 4NMZA 4KN7C 5DEHA 3NBHA 4MN3A 3BDLA 3H15A 2CQAA 1GO3E 4G7ZC 5CGKA 2YYZA 4QQBX 5J1ZA 3U58A 1U4MA 3S2HH 3ONAB 4U68A 4PZ7A 3PUYA 1E0BA 4QMGA 1N8RC 1N32L 1DGSA 1EZ6A 2EYHA 4LF5L 2AWOA 1TWFB 3NTIA 1C8CA 1TS2A 4YIJA 1IHZA 2B2WC 3SK8A 4QGUA 2B63B 5CV6A 1U5KA 2EJFC 1C9OA 5IWAQ 1SE4A 3JAML 3MWYW 4R4QA 1SFOB 5EPKA 3CF5A 4LF9Q 3P20A 3AEVA 3H3VI 3S16H 4XT3B 3G7LA 3LX0A 2NVXH 4OXPA 2Z8LA 2AQ2B 1EY7A 1I94L 1QUQB 2OXPA 3AFPA 4B3RL 1R4PB 4HTHA 1FJGL 4HJAA 2K52A 2F0FA 2ALYB 3J81E 2K04A 3D6WA 3VA5A 3NUCA 2DY7A 5DM63 4GLXA 4X3TA 3D0FA 3FKIG 4UHVA 3M3YH 4KKSA 4GNXA 1CTMA 4NXML 2D62A 1NMFA 1VQMA 3GO5A 4DV4Q 1LTGD 3F2DA 1F2YA 1XX8A 3PUXA 4C3JH 1IKMA 3HOZH 3TBIB 1PYWD 2EVBA 4X62L 4FF3A 2F0QA 2PNHA 2EDGA 1IXRA 3Q0AA 4IO9A 4ZK9B 3GTKH 4CDDC 3VR2A 2C9OA 4HSPA 4OONA 2BE5C 3O13A 3K0YA 2FFKB 2NN6G 4KHPL 1FNUA 2PO4A 3D4WA 3CPWA 1L1OB 2ASBA 2QCPX 1A15A 2QILA 4C1NK 4A3LH 3VR4A 3BDCA 1I6VC 2KQ3A 1IL8A 2K5WA 3I4MG 3MTSA 4UP8A 1BKBA 1K83H 1OXVA 4X3KA 4LF8L 2A74C 3HOXG 3RN2A 1SMYD 4DV1Q 2OQKA 4IUPA 2AQ3B 4DV2L 4ABNA 4OWWB 1ENFA 1N33Q 3LWEA 1QB5D 1HQMC 4TSSA 5EPLA 5I2YA 2J4XA 1B3AA 4C3IG 5K5PA 3CQZH 1VQPA 2L15A 2LSSA 2RDGA 3A8JE 4DK3C 1PMRA 4IUQA 5C4JB 1XYIA 4ODGA 2F3IA 1QE6A 1SE8A 1LV9A 2FHTA 2G9HD 2NVYB 4FXGC 4CGYB 4DF7A 2HDLA 1ZXTA 4JC0A 4XQQA 3HGBA 1PTOC 1EFWA 4H44C 2E2JH 1BCPC 1HZBA 4TKOB 2RF4A 2B8GA 3CU7A 4L6TB 2NVQH 4A3KB 4LF9L 1UEAB 5CV8A 4A3EH 3IKJA 1HR0Q 2YU9H 1CK1A 3FKIB 1V43A 1QG7A 1XPOA 1GHKA 3NK9A 3TN2A 3U4VA 2F0NA 1ICWA 2JA9A 3HOXB 2KCNA 3AQQA 2EIFA 2F0PA 2JE6I 1PH9A 1HJPA 3C2PA 2F0WA 1VQ4A 5ISRA 2Q8TA 5M5XB 2E75C 2L55A 1CKNA 1RL2A 3DXJC 1PVOA 1LO5D 3IL8A 5KNBA 4ZCKA 1VDZA 3DLLA 1W3SA 2KHJA 5FLXL 4DR5Q 1YIJA 2F0LA 2OT2A 4A3JG 3VR6A 1STEA 2JA6B 5C4XB 4JBKA 1ZYRD 4A3BG 4P72A 2K14A 5CV4A 4PQXA 1L0YB 1LUZA 1G8ZD 3F8TA 3C1FA 1X55A 4OELB 4AIMA 3OHXC 1LTTD 1LTRD 4HCSA 4BY1G 4JBWA 1VQKA 1MBYA 1TS3A 2XN9C 3I73A 2VB3X 3CPFA 4IPCA 4IJLA 3MXNB 5BN4A 3CW2C 1JORA 4JI8L 2IHFA 1EUJA 4KN4C 5M3MH 2RVLA 3I91A 1EWHA 5CORA 4GN3B 3QJYA 1HNXL 1Y14B 4JBMA 4OGQC 5J3BA 1B4OA 4YHHQ 1G291 1IW7C 2DUDA 5JJZA 3A55A 2RCFA 1TS4A 2DJGC 2XSCA 3CKIB 1YJ9A 1DJRD 4HIMA 5C0XH 4DV1L 1Y8NB 4A3IG 4IZ8A 1CKNB 1YNXA 2QDLA 2F4VL 5K36G 4LUVA 3VYRA 1JWSD 5H1SE 1XPRA 3KBXA 1H9MA 3T1YQ 4DUZQ 5CR3A 5HY6A 3TSSA 3LNNA 3PMFA 3M7NA 3FDTA 5EKLA 4HJ8A 2YTXA 3C3LA 2MNAA 3HKSA 4R4TA 1S3OA 1EYAA 1I4QA 3DWPA 2Z6BA 1XXGA 5IYCH 2G5DA 4LJZC 3NBHB 1SYGA 2F0UA 2L0CA 2ZT9C 4RG1A 3R8BA 4K2LA 3K7AB 2R7FA 3DWQA 4EQNA 2JA5H 3F2UA 4JPBW 2F0VA 3N6RA 2YTVA 1TT2A 2EE1A 1JWUD 2KHSA 2E2HB 3QIAA 4A3DG 1J5EL 1EYGA 1IBLL 1YI2A 3VYTA 4A4IA 3NHHA 2A6HC 4CJ1B 2CW0D 2HIVA 3G4SA 3HOZB 1A2TA 1LTSD 3GTGH 1L0XB 2FMCA 2EOTA 3IFTA 5GAGC 1EQQA 1BR9A 1SYEA 4LAAA 1B9NA 1MSHA 5EPJA 1EY9A 2LMCB 3HZXA 1Q3LA 3GTQB 2OTJA 2EYOA 1XWEA 1TWCB 1F2MA 3G71A 1EQRA 1L1OA 2JA8G 1KXLA 1SJHD 1QOHA 2Y0SG 5E7NA 2L11A 4XQNA 1S5BD 1YJNA 1RJTA 2R7DA 4A3MG 1EYCA 3TEHB 2KOLA 1EYDA 1Q46A 4OL7A 3A0JA 3BYTB 1SNCA 2M00A 4JI3L 4X62Q 3A8IE 4JG2A 2E5LQ 4FP5D 1C0AA 2EYJA 4ZAIA 3HOUG 2JA6G 2MHVA 4NPSA 3V05A 4PZ6A 2MQHA 4JI8Q 2HHHQ 2KENA 3WOEA 1MKHA 1ASYA 2EJGC 3DEPA 2O2LD 1PYSB 1TY0A 1H9JA 4GKJL 3I70A 1MSGA 1QWYA 5EBCA 4RGMA 3KFUA 1ICFB 1VF5C 2Q8IB 2HDMA 4H13C 2A69D 4ZRZA 2MPMA 2UXBQ 1A62A 1FJGQ 1SR3A 1U0LA 4HSVA 1I94Q 4JI7Q 1I3QH 1LTBD 3GTOB 5ELBA 3U9SA 2A6EC 3FRPB 5J22A 1CZGA 3QOJA 2JN4A 3JAME 2K4KA 2UXCQ 2PW5A 2EY6A 1HNWL 3NE5B 4OWXB 1QZGA 1K8GA 2N88A 4KV6A 5G3LD 1E3PA 3D8GA 4X65Q 5DNFA 1B7YB 5GROA 3EROA 4OO1G 1EY6A 1JE5A 1N34L 5D65A 1O7IA 1BUVT 4J6HA 5IT9c 4XYOA 2PMZB 3HOYG 4DR1L 2XRSD 2JA5G 1LT6D 2D9UA 1S5CD 1VQ7A 5C44G 3I4MH 3R2IA 1MJCA 2RA4A 3K5MA 1JR0D 3OW2A 2A19A 3OOCA 2R3ZA 4JI0Q 4EQOA 1ILPA 2E2IH 1RHPA 3M4PA 4QB4A 3GTJB 4X3SA 4DGZA 1SSOA 1MJEA 1MD2D 2SEBD 2UUBQ 4LF6Q 4P74A 1HNZQ 3HOWH 2JA6H 2UUCL 4A3DH 2L9HA 4K0KL 4FNFA 1T5XD 1Y8OB 2A5HA 2IPKD 2A1AA 3OSOA 1PLFA 4KKUA 4GN4B 4DNTB 4C3JG 2HIXA 1EWIA 1U4LA 4F7XA 5AJ3L 1II3A 4PZ8A 1CZWA 1NSNS 2V1CC 4BXXG 5CBAE 1EOTA 1SYDA 1D1IA 2EY5A 1SYBA 2L4NA 1IBML 3CCVA 1Y69U 1XMQL 2EYPA 3K7AH 1ILQA 2B3GA 4DR7L 3X3MA 5EBDA 4N8X1 2K28A 1VQ8A 2XNAC 1X3GA 3JC66 4AQYL 2AQ1B 4N9PA 2PQAB 4LK1C 2E76C 1GUOA 2AKWB 2H1EA 4DV2Q 5D14A 4K5VA 2CWAA 2R7ZB 3MZ5A 2WIIB 2R93B 2VY3A 3NWTA 3AYHB 3VR3A 3PO2B 1PH3A 1M1KC 5K36H 1HZCA 3BVZA 1V9PA 1CFMA 1XNRQ 1JB3A 2UXDQ 2R6GA 4IURA 3EA6A 4X64L 3T16A 3A5ZB 3CC7A 1B70B 3NENA 4A3BH 4MHEA 1KNAA 3X3NA 3I2ZA 5IT9E 3SVMA 3BZCA 2EYMA 1PRTF 1XTDA 4KMUC 3M9BA 3MXNA 1GUTA 4QUFA 2VB2X 1D1KA 1GUNA 2ZJPA 2RHSB 4APVA 5ELNA 4DR6Q 4OWTB 2X6GA 4YCVA 4DV4L 4L5RC 1W2BA 2CFMA 4G7OC 2F03A 1ESFA 1KDCA 4WJWA 2OWOA 1PFBA 4FO2A 2I5LX 1CI3M 3TDQA 3CCJA 4NW2A 3I56A 4NDXA 1I50B 3WWVA 1VQJA 2BA0A 1ZEQX 2IL8A 1B8AA 2LS01 2ZM6L 2E2DC 4UP7A 2F52A 5G3LF 3ZYYX 3SK5A 2I07B 3MAQA 4JVZA 3OW7A 3BDOA 3F2BA 3CCRA 4A93B 1ZYRC 1HFNA 2ZJRA 1LLRD 4B3SL 5BR8Q 2NVTH 4JCVE 2JA7H 2HQLA 4ZYSA 2WAQG 3GTGB 3K5NA 2SNSA 3PV0A 4G4KA 4LF7L 1SMXA 2Z4HA 4RCOA 3S15H 1F2ZA 1DOMA 1XNQQ 3ND9A 5GAEC 1BF4A 5EKKA 3NPPA 4EVOA 4A3FH 2J7ZA 4DNRB 2ZTCA 1Q82C 4LF5Q 2XTIA 4EGVA 1XMOL 2BA1A 5EAYA 4C2MB 2F0EA 3TP8A 1VQLA 4TVAB 3F1ZA 2ID0A 2VUMG 5C3EG 4DAPA 4GNXC 4GKKQ 3KLRA 4KY7A 5CV5A 1VQEA 4JI1Q 2TMPA 4C3IH 2E74C 4YCWA 3HOUB 2PZTA 2RDHA 5C5LA 4JOIC 4P73A 2B2UC 1HXYD 2Q8RE 3CCUA 5C4HA 1BBUA 3SK6A 1HRJA 1VQDA 2RSNA 4HAEA 1WI5A 3W1BA 1S40A 1HQRD 3TZUA 4K8JA 5FLXc 1BDOA 3EQLC 1W6JA 2CVRA 4FXKC 3F2CA 5JJIA 3HRZC 2WFWA 1F2LA 4N8FA 4RAUC 1NNXA 1GHJA 1YNJD 4DU9A 5IYBH 4IFDG 1E24A 1QVGA 2I5HA 4A3LG 2H5XA 4BBRG 5C3EH 2KVMA 1I3QB 3R93A 3GTOH 1NE3A 4KHZA 4DV7Q 2JJQA 1E2WA 4RHSA 1RD9D 1E1OA 3T56B 4WJ4A 2GN5A 2XGTA 2I0QA 2CKZB 1IYUA 1QVCA 1I6HH 4A3EG 2EY1A 3OMCA 2M2LA 2OF1A 3A7LA 4GLAC 4QL5A 2VQFQ 1STBA 1TVXA 1M90C 1D6EC 1ENCA 1CUKA 2JQOA 2KA7A 1S72A 2UUAQ 1TWHH 3RLFA 4V190 3CXCA 2DNCA 4RGNA 5KYIA 3GTLH 1JT8A 5BN3A 3SDZA 2ZTEA 3NEMA 3S14H 5T1GA 1L2FA 4UAIA 2YTYA 3DEOA 3EFXD 3K5LA 4JYAL 1FVIA 1VCIA 4J8QA 2WKDA 1SJED 1YHBA 4I7AA 3RR5A 1M8AA 2CH4W 3QOLA 4QY7A 2NN6I 2CW0C 1NUCA 4JOIA 1AN8A 2O5JC 4K2KA 1G91A 4CHTB 1Y1VG 3Q23A 4POGA 4LFAQ 1XNQL 4B9XA 2AHOB 5M3FG 1TKWB 3VYSA 4LFBL 3BVGA 1PA6A 2FMMA 3WDNA 2NVQB 1HPCA 1QCBD 1K73C 2IWHA 2WAQB 3FKIH 1XNRL 2P5ZX 4QIWE 1PH4A 4KKTA 5M5YB 1KAWA 2V4DA 1E7ZA 1AZPA 3HP3A 3CRKC 1TY2A 4OO1I 1I50H 5JAVA 5M3FH 4FF4A 2Q2IA 5M5XH 4AQYQ 4DR6L 4IFDJ 3URYA 3DWAA 4R8IA 5C5MA 1CSQA 4MTKA 1S5DD 3QO2A 3PIPA 4M8AA 2NBFA 2VZAA 4F87A 3PO2H 4DV5L 2A8VA 4IQZA 3C46A 3I4NH 1VQNA 2NZOA 2N3SA 3TZDA 2B2TC 1J6QA 4A3FB 1KAAA 4UY8C 4RHRA 1RODA 3K59A 1TIID 1HNZL 3ERQA 1G2TA 1TWAH 1CHQD 4RH6A 3G6EA 2UXDL 1DONA 2Z4IA 5HGQA 4BY7B 3MA2B 2ATWA 2K01A 2A68D 3R2TA 1PTOH 2B2YA 1B3QA 4DV6Q 4PG3A 4JI6Q 4OHJA 3CAMA 5JPNC 1H9SA 4KHVA 4P2CB 3FEWX 3RUZA 3HOUH 3T4AC 1CSPA 3U50C 5JEAG 4DR3L 1J9OA 1V1OA 3HKZG 4DR1Q 2DJFC 1HA6A 4MZ9A 4ZKBB 4A3MH 1KDAA 4V0BA 3PIOA 4IFDI 3NSWA 3Q8DA 4ZKCB 4A93H 2D2CC 4XIGS 4ID6A 3P1HA 2F0TA 3L0OA 1E2VA 4O2DA 2HT1A 3CP0A 4O0AA 5C3EB 2IX0A 1YBYA 3MXGA 4Y7NB 1STNA 2GVAA 3S15B 3IAYA 1Y8PB 1B1ZA 1EY5A 4E6IA 1AEXA 4EQ5A 1F9PA 1O7ZA 3A74A 3Q22A 1ET9A 1I6HB 2BCOA 1HTLD 4HN7A 1BNZA 1NCVA 1RF2D 2QDBA 1EIHA 2PQEA 2I46A 3MXUA 3SK4A 2BH2A 1LT5D 4NXNQ 1DOKA 5FK9C 5BN5A 5DAUA 3UE0A 3ND8A 2A6HD 3I4OA 5EJWA 5IGBA 5M9OA 1YHAA 3M7GA 5C0XI 4XT1B 2PMZE 3GTMB 5IE8A 4GKKL 1Q90A 2K1BA 3SHLA 2JA5B 2CH4A 3KK7A 1HTPA 3S14B 1EEID 3J81c 4CJ2C 4LUOA 2AUJD 1OXTA 5KRUA 1BBWA 2K5NA 2F0DA 3I8ZA 1CQVA 3CRLC 3A54A 2ICIA 1P16A 1BO0A 5KGUA 4C3HB 4ZUIA 1Z9FA 4GNXB 3M4QA 4X66Q 3TP7A 1Q86C 4IN3A 4LF7Q 5J39A 3PF5A 4TQUS 1LT4D 1SEBD 1A63A 3IRBA 4BBRH 3BU2A 2KJXA 1VMPA 3E5SA 2UXBL 2N49A 2N78A 2O5IC 3A56A 3S1QH 2PCFB 3AB9A 3QB3A 1WTRA 1JOOA 1B9MA 3RZOB 2MJ8A 4I65A 4J1MA 3HG9A 3Q24A 2F0IA 3K80C 1TWHB 1BXTA 2IX1A 1EWCA 1CA6A 3PUWA 1D7QA 1FNWA 4HIKA 1EIGA 3G6JB 1TWFH 4JI3Q 1TWGH 1IZ6A 3UDFA 4A3GH 3TMEA 1ONLA 2DY8A 3S24A 5FO8B 3STBC 2QA4A 1FD7D 4F88A 2Z0SA 1VS0A 1JJ2A 2WKCA 4CBVA 3JAMi 2WB1G 2L12A 3W1GA 1ASZA 4A3JH 1DYQA 2UUCQ 3S16B 4B3MQ 5JOBA 2UUBL 3J81i 4L8JA 5IGDA 1PV4A 1SNQA 2R92H 1UE5A 1GM5A 3LGJA 3RNUA 3ULPA 1P8LA 4X3UA 1SE3A 1YEZA 1S4ZA 2K05A 3EN2A 3NXWA 5F2DA 2BDNA 1SNPA 1X32A 1WFQA 3E6ZX 3NP8A 4AYBB 5M5YH 1IBLQ 4P71A 1L1OC 1YHQA 5C4ZA 1LTAD 2MO1A 1PH2A 2NN6H 2XIWA 1FGUA 3NQIA 3GV6A 1GKHA 2K5DA 4DR7Q 3E9HA 2K03A 1XMQQ 2KCCA 3KYHC 2BDOA 3B6YA 1YNNC 1KLUD 5FO7B
chains in the Genus database with same CATH topology
4PMWA 5FKAC 1MGSA 3GTKB 2XWJB 4QUCA 4C1NI 2PW7A 1LACA 1S5ED 2NWGA 5HGTA 2LFNA 4A3IB 2L5TA 2FJ2A 5CV9A 5LL6X 2JEBI 3FVQA 2A68C 4K6DA 1ENAA 4RKBA 1K83B 1PRTD 1GUSA 2NB0A 1TWAB 2RSOA 1LT3D 4DK0A 4ZLTF 3OIQA 2MP1A 3HEJA 1Y1VB 4FXDA 2RQXA 3I72A 5CMDA 1KLUD 1KDBA 3I3CA 4RFBA 2JYOA 3W3AA 3H6MA 1QJOA 1EEFD 3D3RA 1IKLA 5IGFA 4WRDA 2E2JB 3S1RB 2NTTA 2KEEA 2H4OA 5IIFA 1H9RA 3FMCA 5A2QE 4KD4A 3GV3A 1IYVA 2YU9B 3J7AV 2EYLA 2CHBD 1U4RA 1HA5A 1PXUA 2F0MA 4RKLA 1M4VA 4NKLA 4BWGB 1AFPA 3P7JA 2JSOA 2F1MA 3S17B 1I4RA 4DN4M 1GXDC 2B2WA 1W6KA 4WORA 3J80L 1RDPD 2MGSA 5ELFA 1PDQA 3BG3A 2LKVA 3SXHA 1EQTA 1B53A 5JVH3 5DM73 5KNDA 2R92B 3K57A 4UDUC 1PFNA 2B2YC 5C0XJ 5NUCA 5JVG3 3AU7A 3IFDA 1VMCA 1EY4A 5M3MB 1G2SA 2X69A 4PMBA 3AMUA 1SXTA 5IODA 1BCPB 1SYCA 5C3WA 1SNMA 4BA2I 1I4HA 3A7AB 2EY2A 3V96A 3HKZB 1R9TB 1NAPA 3M4OB 1WTXA 4WFN3 1EU3A 3VYUA 1DD2A 3BYYB 4HMIA 3RD4A 3J80E 1DZ1A 2KECA 4IUUA 4OIKA 4PNYA 3L9AX 2PZUA 2A69C 3W2DA 2JXMB 3ITPA 1KTKA 3GD7A 5IGCA 3D6CA 4KK7A 1IW7D 1YNND 3L7ZC 4K5WA 3OIPA 4CJ0B 4FF2A 2ZXPA 1B50A 2B2VC 1X3PA 4IFDH 1PTOD 1UNSA 3PIO3 2K32A 2ZXOA 2NUCA 4R9WA 3M4YA 1CM9A 1V1PB 3H3VC 4TRDA 3M85A 2F0OA 2L1BA 5ELCA 2G9DA 1B44D 5IT9L 1F9QA 2A73B 1NR4A 4KTAA 5C44B 2K5QA 4Z9CB 3HOYB 4O1NA 4KJOA 1AZQA 4K6LA 2EZVA 2C5CA 2N55A 1RKNA 2XRQD 3L3OC 1EY0A 1JWMD 4K5XA 4O42A 4BBSB 1DM0B 4M1UB 1OXUA 5E4XA 1WTVA 1O7YA 2R61A 1MI2A 5COYA 3BS1A 1PZKD 2XWBB 1OXXK 3I4LA 3NTHA 2EXZA 3I4NB 2F0GA 3P75A 3A8KE 4DK1A 3PIP3 1HUNA 2QF7A 2SNMA 2QEJC 2AUKA 3EVQA 3SEBA 2ICEC 4XTCS 2K7VA 1GUGA 2IT1A 3RMHA 3V2TA 2PPBC 1HFGA 4DAVA 3I4MB 1Z47A 1PTOF 2GA4B 5D3IB 4FVMA 2NYZD 4CKEA 2RDFA 4RGOS 2JP1A 2E2IB 1STAA 3MEHA 4A3MB 3PO3B 2EPBA 1U9RA 1KNEA 3U9OA 1JC7A 2EJMA 1PRTC 1KLGD 5HURA 3DUZA 1STGA 2PYKA 3HOWB 4A3DB 1D5MC 3K58A 1CA5A 1WTPA 2BOSA 3H91A 1A6XA 4RGTA 5FO9B 1JCKB 2QKIC 1BQQT 1A2UA 4XDXA 4HR7B 3MC0B 2JA8B 1FNVA 4HCEA 3FPUB 1F9RA 1STYA 3OWFA 4K14A 1EQVA 1NR2A 1ZKOA 2KUMA 4RA8A 3KF8A 5A35A 2IJ0A 1HCZA 4XYQA 2B2VA 4HEDA 2J0TD 1Q1BA 1HUMA 5FOBB 3T53B 2KEDA 1DOLA 4DFAA 1JE4A 1WTWA 3BZDB 1BBXC 1C48A 2RBMA 4OO1H 2HCIA 5KYLA 1UAPA 2O4XA 5E1FA 2D5DA 1A3VA 1QNUA 3J7AF 2SDFA 4KJNA 3NQTA 3QWNA 5EKIA 4BY1B 1ML0D 4CKBA 5JEAJ 4KI0A 3CQZB 1WTOA 3OPOA 4K8IA 1Z6HA 5CC4A 1I4GA 5KNCA 2NVTB 3FPPA 1D2BA 2K33A 1QNKA 3RZDB 5IOCA 5I9PA 1JOQA 5LL6S 1Q12A 5IGGA 4RCNA 3SE0A 2B39A 1A3TA 3I90A 4A3JB 1WTQA 5CYUA 4A3BB 2WV6D 2WB1B 2F3WA 1VF7A 4H0LC 2A6ED 2OEOA 3TP6A 3S1NB 4QF4A 1JOKA 5I6WA 2WINB 1G6ZA 1A3UA 1O78A 3GP7A 2MUYA 1TS5A 2Z1CA 5ELDA 4QCLA 2Y0SB 4I7ZC 4KY6A 5E3FA 4LMQD 2ZXRA 3VR5A 1LTID 1WVLA 4KD3A 2JA7B 4FF1A 1Z7TA 1GOZA 4RWSC 1PZID 1RTNA 1DXMA 5I4DA 1RCVD 2SOBA 3DMUA 3OWEB 5CV7A 4GZYC 2HCCA 1J8IA 1EZ8A 1AP0A 4PMCA 4EQPA 3S1MB 1LABA 4QIWB 3LWUA 1H9SB 2B8FA 1RTOA 3T51B 1D5XC 4C3IB 2NZ1D 2BE5D 1H9KA 4R8NA 1EY8A 1SNOA 5EQ0A 1YNJC 1GUWA 5A2QL 3J7YW 3D31A 1ET6A 1DCZA 4H7BA 4FYDA 1BOSA 3GTPB 4L63B 3HOVB 4ULLA 1PFMA 1WD1A 1STHA 2F0JA 3H09A 4B9WA 3WOFA 1JICA 3Q6SA 4ZQ3A 1ESRA 1FYCA 3T13A 3KBGA 2ENBA 5KIXA 1SBBB 5CBEE 3K5OA 4IALA 4Q5VA 1CHPD 3D4DA 2NTSA 4JK1C 5I2XA 2WP8J 5C6AA 3GTLB 3SR1A 5C0XG 3R3OA 4C56C 4F8MA 5E4WC 1PRTB 1I4XA 1TU2B 1E2ZA 3GQBA 3BVMA 3MVVA 3D4RA 2HUGA 2IX3A 4U673 4PV1C 4G7HC 2VNUD 2LY7A 4ME5A 5EGTA 1SDFA 2PNRC 4ZUJA 3EJIA 2IW3A 2TSSA 1Q8IA 1WD0A 2F3VA 1T5EA 3KLSA 4C3HG 1F9SA 4C3JB 1AW7A 1D5ZC 1S5FD 4NP5A 5M3FB 4IUVA 4CKCA 1JQYD 4Q0FA 4DXGA 3S2HB 1EL0A 3VA7A 3DHQA 1KABA 1GJXA 1B2TA 2F0KA 4MIUA 3H0GB 3KLSX 3H94A 2EYFA 5M5WB 5AFWA 3DM1A 1CQFA 3MXPA 2HQEA 4B08A 3NTKA 2NVXB 3OMGA 2XVSA 1K8OA 3NBIA 4XXEA 3PUVA 1O7LA 1K8MA 1TR5A 1PZJD 5I9OA 2DNEA 3KUPA 3NWSA 1PTOB 1C4QA 4IUTA 2F0SA 3M3YB 4N9TA 4DAYA 1WCMB 1Y1WB 1SMYC 1HHVA 3K6OA 3TP5A 4HMJA 5I6YA 3QG1A 2AWNA 1U4PA 5LHY1 1SNDA 2B2UA 3PUZA 3MFYA 1UUPA 1BCPF 1OXSC 1XTCD 2F4IA 5JPMC 3MFGA 2VUMB 4DXFA 1FGBD 4G57A 4BBRB 1EFID 1OO9B 4XQJA 3S2DB 3HS0C 4A3EB 3S1QB 1BCPD 5IGEA 3MHBA 1X3QA 1O80A 1QILA 5ELEA 2JEAI 5JEAH 1CT1D 1R4QB 2X6LA 3E0JA 2B2TA 1FR3A 1V8QA 3CHBD 1TQOA 2DN8A 1TWGB 1SAPA 4A3GB 4OIJA 1I4PA 2M9VA 4BA1I 1EU4A 4IUNA 4BS9A 2WACA 5TSSA 1V1PA 1SYFA 3J81L 3C1EA 3N52A 2K6AA 4KY5A 3S9WA 2FINB 1SE2A 4S3SA 1F77A 5FLXE 2RKSA 5C3XA 5KEEA 5D3DA 1Q1EA 2F0HA 5T1IA 3UI2A 4DA2A 2VXWA 2PZWA 4ILWA 4NMZA 4KN7C 5DEHA 3NBHA 4MN3A 3BDLA 2CQAA 4G7ZC 5CGKA 2YYZA 5J1ZA 1U4MA 3ONAB 4U68A 3PUYA 1E0BA 4QMGA 1EZ6A 2EYHA 2AWOA 1TWFB 3NTIA 1C8CA 1TS2A 4YIJA 1IHZA 2B2WC 3SK8A 2B63B 5CV6A 2EJFC 1SE4A 3JAML 3MWYW 1SFOB 5EPKA 3P20A 4XT3B 3G7LA 3LX0A 2Z8LA 2AQ2B 1EY7A 2OXPA 1R4PB 4HTHA 2F0FA 3J81E 2K04A 3D6WA 3VA5A 3NUCA 2DY7A 5DM63 4X3TA 4KKSA 1CTMA 2D62A 3GO5A 1LTGD 1F2YA 1XX8A 3PUXA 1IKMA 3TBIB 1PYWD 2EVBA 4FF3A 2F0QA 2EDGA 3Q0AA 4ZK9B 3VR2A 2C9OA 4HSPA 2BE5C 3O13A 3K0YA 2FFKB 2NN6G 1FNUA 2PO4A 3D4WA 2QCPX 1A15A 2QILA 4C1NK 3VR4A 3BDCA 1I6VC 2KQ3A 1IL8A 2K5WA 3MTSA 1OXVA 4X3KA 2A74C 1SMYD 4IUPA 2AQ3B 4ABNA 1ENFA 3LWEA 1QB5D 1HQMC 4TSSA 5EPLA 5I2YA 2J4XA 1B3AA 4C3IG 5K5PA 2RDGA 3A8JE 1PMRA 4IUQA 5C4JB 1XYIA 4ODGA 1QE6A 2FHTA 1LV9A 2G9HD 2NVYB 4FXGC 4CGYB 4DF7A 2HDLA 1ZXTA 4XQQA 3HGBA 1PTOC 4H44C 1BCPC 4TKOB 2B8GA 3CU7A 4L6TB 4A3KB 1UEAB 5CV8A 3IKJA 1CK1A 3FKIB 1V43A 1QG7A 1GHKA 3NK9A 3TN2A 2F0NA 1ICWA 3HOXB 2KCNA 2F0PA 2JE6I 3C2PA 2F0WA 5ISRA 2Q8TA 5M5XB 2E75C 2L55A 3DXJC 1LO5D 3IL8A 5KNBA 1VDZA 5FLXL 2F0LA 2OT2A 3VR6A 1STEA 2JA6B 5C4XB 1ZYRD 5CV4A 4PQXA 1L0YB 1G8ZD 3C1FA 3OHXC 1LTTD 1LTRD 4HCSA 4JBWA 1MBYA 1TS3A 2XN9C 3I73A 2VB3X 5BN4A 1JORA 4KN4C 2RVLA 3I91A 1EWHA 5CORA 3QJYA 4OGQC 1B4OA 1G291 1IW7C 5JJZA 3A55A 1TS4A 3CKIB 2XSCA 1DJRD 5C0XH 1Y8NB 4IZ8A 5K36G 3VYRA 1JWSD 3KBXA 1H9MA 5CR3A 3TSSA 3LNNA 3PMFA 3M7NA 3FDTA 5EKLA 3C3LA 1EYAA 1I4QA 3DWPA 1XXGA 4LJZC 1SYGA 2F0UA 2L0CA 2ZT9C 3R8BA 4K2LA 3K7AB 3DWQA 4EQNA 3F2UA 2F0VA 3N6RA 1TT2A 2EE1A 1JWUD 2KHSA 2E2HB 3QIAA 3VYTA 3NHHA 2A6HC 4CJ1B 2CW0D 3HOZB 1A2TA 1LTSD 1L0XB 2FMCA 2EOTA 3IFTA 1BR9A 1SYEA 4LAAA 1B9NA 1MSHA 5EPJA 1EY9A 2LMCB 3HZXA 1Q3LA 3GTQB 2EYOA 1XWEA 1TWCB 1F2MA 1SJHD 1QOHA 2L11A 4XQNA 1S5BD 1RJTA 1EYCA 2KOLA 1EYDA 4OL7A 3BYTB 1SNCA 2M00A 3A8IE 4FP5D 2EYJA 4ZAIA 2MHVA 3V05A 3WOEA 2EJGC 3DEPA 2O2LD 1TY0A 1H9JA 3I70A 1MSGA 1QWYA 5EBCA 4RGMA 1VF5C 2Q8IB 2HDMA 4H13C 2A69D 4ZRZA 2MPMA 4HSVA 3GTOB 1LTBD 5ELBA 3U9SA 2A6EC 3FRPB 5J22A 1CZGA 3QOJA 3JAME 2PW5A 2EY6A 3NE5B 2N88A 4KV6A 5G3LD 3D8GA 5DNFA 3EROA 4OO1G 1EY6A 5D65A 1BUVT 4J6HA 4XYOA 2PMZB 2XRSD 1LT6D 2D9UA 1S5CD 3R2IA 2RA4A 3K5MA 1JR0D 3OOCA 2R3ZA 4EQOA 1ILPA 1RHPA 4QB4A 4X3SA 4DGZA 1SSOA 1MD2D 2SEBD 2L9HA 4FNFA 1T5XD 1Y8OB 2A5HA 2IPKD 3OSOA 1PLFA 4KKUA 4DNTB 4C3JG 1U4LA 4F7XA 1II3A 1CZWA 1NSNS 5CBAE 1EOTA 1SYDA 1D1IA 2EY5A 1SYBA 2L4NA 1Y69U 2EYPA 1ILQA 3X3MA 5EBDA 2K28A 2XNAC 2AQ1B 4N9PA 4LK1C 2E76C 1GUOA 2H1EA 5D14A 4K5VA 2R7ZB 3MZ5A 2WIIB 2R93B 3VR3A 3NWTA 3PO2B 5K36H 3BVZA 1CFMA 1JB3A 2R6GA 4IURA 3EA6A 3T16A 4MHEA 1KNAA 3X3NA 5IT9E 3SVMA 2EYMA 1PRTF 4KMUC 3MXNA 1GUTA 4QUFA 2VB2X 1D1KA 1GUNA 2X6GA 4G7OC 2F03A 1ESFA 1KDCA 4WJWA 1PFBA 4FO2A 1CI3M 3TDQA 4NW2A 4NDXA 1I50B 2BA0A 1ZEQX 2IL8A 2LS01 2E2DC 5G3LF 3ZYYX 3SK5A 2I07B 3MAQA 3OW7A 3BDOA 4A93B 1ZYRC 1HFNA 1LLRD 4ZYSA 3GTGB 3K5NA 2SNSA 3PV0A 4G4KA 2Z4HA 4RCOA 1F2ZA 1DOMA 3ND9A 1BF4A 5EKKA 3NPPA 4EVOA 2J7ZA 4DNRB 4EGVA 2BA1A 4C2MB 2F0EA 3TP8A 2ID0A 4DAPA 3KLRA 4KY7A 5CV5A 2TMPA 2E74C 3HOUB 2PZTA 2RDHA 5C5LA 2B2UC 1HXYD 2Q8RE 5C4HA 3SK6A 1HRJA 2RSNA 4HAEA 1HQRD 3TZUA 4K8JA 1BDOA 3EQLC 1W6JA 2CVRA 4FXKC 3HRZC 1F2LA 4RAUC 1GHJA 1YNJD 4DU9A 4IFDG 2KVMA 1I3QB 3R93A 4KHZA 1E2WA 4RHSA 1RD9D 3T56B 1IYUA 2EY1A 3OMCA 2M2LA 2OF1A 3A7LA 1STBA 1TVXA 1D6EC 1ENCA 2KA7A 3RLFA 4V190 2DNCA 4RGNA 5KYIA 5BN3A 3SDZA 5T1GA 4UAIA 3DEOA 3EFXD 3K5LA 1VCIA 4J8QA 2WKDA 1SJED 1M8AA 3QOLA 2NN6I 2CW0C 1NUCA 1AN8A 2O5JC 4K2KA 1G91A 4CHTB 3Q23A 4B9XA 1TKWB 3VYSA 3BVGA 2FMMA 3WDNA 2NVQB 1HPCA 1QCBD 2IWHA 2WAQB 4KKTA 5M5YB 2V4DA 1AZPA 3HP3A 3CRKC 1TY2A 4OO1I 5JAVA 4FF4A 4IFDJ 3URYA 3DWAA 4R8IA 5C5MA 1S5DD 3QO2A 4M8AA 2NBFA 4F87A 4IQZA 3C46A 3TZDA 2B2TC 4A3FB 1KAAA 4RHRA 1RODA 3K59A 1TIID 3ERQA 1G2TA 1CHQD 4RH6A 1DONA 2Z4IA 4BY7B 3MA2B 2K01A 2A68D 3R2TA 1PTOH 2B2YA 4OHJA 5JPNC 1H9SA 4KHVA 4P2CB 3FEWX 3RUZA 3T4AC 5JEAG 1J9OA 1V1OA 1HA6A 4ZKBB 1KDAA 4V0BA 4IFDI 3NSWA 4ZKCB 2D2CC 4XIGS 4ID6A 3P1HA 2F0TA 1E2VA 5C3EB 2IX0A 3MXGA 4Y7NB 1STNA 3S15B 3IAYA 1Y8PB 1B1ZA 1EY5A 4E6IA 1AEXA 1F9PA 1O7ZA 3Q22A 1I6HB 1ET9A 2BCOA 1HTLD 4HN7A 1BNZA 1NCVA 1RF2D 2QDBA 1EIHA 2PQEA 2I46A 3MXUA 3SK4A 1LT5D 1DOKA 5FK9C 5BN5A 5DAUA 3ND8A 2A6HD 5M9OA 5EJWA 5IGBA 3M7GA 5C0XI 4XT1B 3GTMB 1Q90A 2K1BA 3SHLA 2JA5B 3S14B 3KK7A 1HTPA 1EEID 4CJ2C 2AUJD 1OXTA 5KRUA 2F0DA 3I8ZA 1CQVA 3CRLC 3A54A 2ICIA 1BO0A 5KGUA 4C3HB 4ZUIA 3TP7A 4IN3A 5J39A 4TQUS 1LT4D 1SEBD 2KJXA 1VMPA 3E5SA 2O5IC 3A56A 2PCFB 3AB9A 3QB3A 1WTRA 1JOOA 1B9MA 3RZOB 2MJ8A 4I65A 4J1MA 3HG9A 3Q24A 2F0IA 1TWHB 1BXTA 2IX1A 1EWCA 1CA6A 3PUWA 1FNWA 1EIGA 3G6JB 3TMEA 1ONLA 2DY8A 5FO8B 1FD7D 4F88A 2WKCA 4CBVA 3S16B 2L12A 1DYQA 5JOBA 4L8JA 5IGDA 1SNQA 4X3UA 1SE3A 1S4ZA 2K05A 3NXWA 5F2DA 2BDNA 1SNPA 1X32A 3NP8A 3E6ZX 4AYBB 5C4ZA 1LTAD 2NN6H 2XIWA 3GV6A 2K5DA 3NQIA 2K03A 2KCCA 2BDOA 1YNNC 3GTJB 5FO7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0D A;  2F0F A;  3T16 A;  5EKL A;  5IGE A;  5J22 A;  4DU9 A;  2F3V A;  3MHB A;  3VA5 A;  3NUC A;  3QOJ A;  2PW7 A;  5CV8 A;  2EYM A;  4K8I A;  5KGU A;  2RDF A;  4ZUI A;  2PW5 A;  1EYA A;  5HGT A;  4WOR A;  1STA A;  3MEH A;  2EY6 A;  5CC4 A;  1KAA A;  3NK9 A;  4R8N A;  1U9R A;  2NUC A;  3TP7 A;  1EY8 A;  4KV6 A;  2F0N A;  3S9W A;  3ERQ A;  1SNO A;  1SYG A;  2F0U A;  2LKV A;  4NP5 A;  5CV9 A;  3SXH A;  4TRD A;  3U9O A;  5J39 A;  3D8G A;  5IOC A;  1F2Y A;  4K2L A;  3ERO A;  2F0O A;  2F0P A;  5HUR A;  4K6D A;  1TQO A;  5I9P A;  1EY6 A;  4H7B A;  2F0W A;  1ENA A;  1JOQ A;  3E5S A;  5ISR A;  4EQN A;  1STG A;  4RKB A;  2EY1 A;  2F0V A;  3DHQ A;  1KAB A;  1TT2 A;  2PYK A;  3OMC A;  4J6H A;  5IGG A;  2KHS A;  1KDC A;  2OF1 A;  1STB A;  1A3T A;  2F0K A;  2F0Q A;  1ENC A;  4MIU A;  4KTA A;  1STH A;  2F0J A;  3NHH A;  3QB3 A;  5NUC A;  2EYF A;  4KHV A;  4IUN A;  4NDX A;  1JOO A;  3RUZ A;  1A2T A;  2WAC A;  5KYI A;  4B9W A;  4I65 A;  4J1M A;  1EY4 A;  3SK5 A;  2F0I A;  3HEJ A;  1SYF A;  4ZQ3 A;  3MXP A;  2F3W A;  4EQO A;  2HQE A;  4KJO A;  2F0L A;  3C1E A;  3D4W A;  1SYE A;  1A2U A;  3OMG A;  4LAA A;  4PMB A;  4QB4 A;  3T13 A;  2ENB A;  5KIX A;  1RKN A;  1KDA A;  2OEO A;  1EY0 A;  3TP6 A;  1TR5 A;  4DGZ A;  1EY9 A;  1JOK A;  4QF4 A;  3HZX A;  4K5X A;  4KY5 A;  5I6W A;  1KDB A;  1STY A;  2SNS A;  3BDC A;  2EYO A;  1SYC A;  5CV4 A;  2KQ3 A;  3OWF A;  4K14 A;  1F2M A;  4ID6 A;  1A3U A;  3C1F A;  3H6M A;  1EQV A;  2F0T A;  3P1H A;  4IAL A;  4S3S A;  1F2Z A;  2RKS A;  1SNM A;  5C3W A;  5C3X A;  5KEE A;  3QOL A;  3TME A;  2EY2 A;  2F0H A;  3D4D A;  5EKK A;  1NUC A;  2F0S A;  3OSO A;  4N9T A;  4K2K A;  4EVO A;  5I9O A;  1EYC A;  2PZW A;  3TP5 A;  4KY6 A;  5E3F A;  4B9X A;  1EYD A;  1STN A;  4HMJ A;  5C6A A;  5IGF A;  4NMZ A;  4OL7 A;  4WRD A;  1SNC A;  5DEH A;  2M00 A;  5JOB A;  5I6Y A;  3BDL A;  3SR1 A;  4F7X A;  1II3 A;  4HMI A;  1EY5 A;  1NSN S;  1SYD A;  1SND A;  2EY5 A;  2EYJ A;  1SYB A;  4E6I A;  1AEX A;  5CGK A;  5IGD A;  5IIF A;  3R3O A;  5J1Z A;  4F8M A;  2EYP A;  2EXZ A;  1SNQ A;  2F0E A;  4KD3 A;  3TP8 A;  5K5P A;  4PNY A;  2F0G A;  3P75 A;  2PZU A;  4KD4 A;  2QDB A;  2PQE A;  4QMG A;  4KY7 A;  1EZ6 A;  5CV5 A;  2EYH A;  3SK4 A;  4DFA A;  4ODG A;  2EYL A;  4N9P A;  4YIJ A;  1IHZ A;  3SK8 A;  5DAU A;  3NXW A;  5CV6 A;  3MVV A;  4DF7 A;  5F2D A;  4K5V A;  3ITP A;  2PZT A;  2SOB A;  1SNP A;  3DMU A;  5CV7 A;  5C5L A;  5IGB A;  5M9O A;  3NP8 A;  2RBM A;  2SNM A;  5JAV A;  4IZ8 A;  2F0M A;  4RKL A;  5C4H A;  3SK6 A;  5KYL A;  4G57 A;  3MZ5 A;  5C4Z A;  5IOD A;  3EVQ A;  3SHL A;  2O4X A;  4ME5 A;  5E1F A;  5IGC A;  3D6C A;  1A3V A;  3LX0 A;  1EZ8 A;  1EY7 A;  5EGT A;  4K5W A;  4K8J A;  4NKL A;  2OXP A;  4ZUJ A;  4KJN A;  3NQT A;  4PMC A;  5CR3 A;  4HTH A;  4EQP A;  3EJI A;  3PMF A;  3V2T A;  1JOR A;  5KRU A;  5C5M A; 
#chains in the Genus database with same CATH topology
 4PMW A;  5FKA C;  1CKO A;  1MGS A;  3GTK B;  4R4C A;  2XWJ B;  4QUC A;  4HJ9 A;  4DR2 L;  4C1N I;  3H3V H;  2PW7 A;  1LAC A;  3OTO Q;  1PH5 A;  4DUY L;  1S5E D;  2NWG A;  5HGT A;  4JI2 L;  2LFN A;  4A3I B;  2EXD A;  3CC2 A;  3PQI A;  2L5T A;  1XJV A;  2FJ2 A;  5CV9 A;  4A76 A;  5LL6 X;  1SFO H;  2JEB I;  2PQA A;  3FVQ A;  2A68 C;  2CQO A;  4JI7 L;  4K6D A;  4DUZ L;  1ENA A;  5C44 H;  4DPG A;  1UE1 A;  4RKB A;  1K83 B;  1PRT D;  1GUS A;  2NB0 A;  1TWA B;  1AE3 A;  4DR5 L;  2Q2H A;  3TS2 A;  2RSO A;  3CMA A;  1A0I A;  1LT3 D;  4BY7 H;  4DK0 A;  2LXJ A;  1YIT A;  4ZLT F;  3AFQ A;  3OIQ A;  2MP1 A;  3HEJ A;  1Y1V B;  4BBS H;  1AH9 A;  1NJI C;  2RQX A;  3I72 A;  2HHH L;  4FXD A;  1VQC A;  3J7Z C;  4IJH A;  5CMD A;  2Y0S E;  1HNX Q;  1KRS A;  1N34 Q;  1KDB A;  3I3C A;  2OTL A;  4RFB A;  1EIF A;  2JYO A;  3W3A A;  2NVY H;  3H6M A;  2WB1 E;  1VQB A;  1QJO A;  3UDI A;  1HNW Q;  1EEF D;  4LWC A;  4R4O A;  3D3R A;  4BXX H;  3PO3 G;  1IKL A;  5IGF A;  4WRD A;  2E2J B;  4B3T L;  5LMN W;  2NTT A;  3S1R B;  1YZ6 A;  3TRE A;  2KEE A;  2H4O A;  5IIF A;  1H9R A;  3KF6 A;  3FMC A;  1QVF A;  5A2Q E;  3HOW G;  4KD4 A;  3GV3 A;  1K0R A;  1IYV A;  2YU9 B;  4A3K G;  3J7A V;  2EYL A;  2CHB D;  1U4R A;  3HKZ E;  1HA5 A;  4GLV B;  1PXU A;  4DUY Q;  2F0M A;  4JI4 L;  4RKL A;  4DR2 Q;  1J5E Q;  3E9I A;  2KHI A;  1KQS A;  2Z9H A;  1M4V A;  4L5Q A;  4NKL A;  4BWG B;  1A8V A;  4A3C H;  1AFP A;  3P7J A;  2JSO A;  2F1M A;  2E5L L;  3S17 B;  1Q8K A;  4GS3 A;  1I4R A;  4DN4 M;  1GXD C;  4LW1 A;  2B2W A;  2D0O A;  1W6K A;  5JJL A;  1N33 L;  3MEF A;  2UU9 L;  1X3F A;  4WOR A;  3CC4 A;  3J80 L;  4BBS G;  1RDP D;  2MGS A;  5ELF A;  1PDQ A;  3BG3 A;  4LF8 Q;  2LKV A;  3SXH A;  1EQT A;  1B53 A;  1WJJ A;  1PH6 A;  2RHQ B;  4YWM A;  3CCM A;  5JVH 3;  5DM7 3;  5KND A;  2R92 B;  3K57 A;  4UDU C;  4HID A;  1PFN A;  2B2Y C;  5C0X J;  2B29 A;  5NUC A;  5JVG 3;  3AU7 A;  3IFD A;  1VMC A;  1EY4 A;  4C2M H;  5IYC G;  5M3M B;  1G2S A;  2X69 A;  4PMB A;  1BVS A;  4YHH L;  1VQF A;  3I4N G;  3AMU A;  1SXT A;  5IOD A;  3K7U C;  1BCP B;  1SYC A;  4JW0 A;  4H02 A;  1NY4 A;  5C3W A;  4HJ5 A;  1SNM A;  4RMF A;  4IOA A;  4BA2 I;  1I4H A;  3A7A B;  3J81 j;  2EY2 A;  4JI4 Q;  3V96 A;  3HKZ B;  1WYD A;  1R9T B;  5IYD H;  1NAP A;  3H0G H;  3M4O B;  1WTX A;  4WFN 3;  4A3I H;  1EU3 A;  3VYU A;  1DD2 A;  3BYY B;  4HMI A;  3RD4 A;  3J80 E;  1DZ1 A;  2Q2U A;  1PFS A;  2KEC A;  3T1Y L;  4IUU A;  4OIK A;  4R1J A;  4PNY A;  3L9A X;  2PZU A;  5C4X H;  2F4V Q;  2A69 C;  4KHP Q;  2VL6 A;  3PO2 G;  2UU9 Q;  3W2D A;  4MNO A;  2JXM B;  1HH2 P;  3ITP A;  2R7Z G;  4LUZ A;  1KTK A;  1Y1V H;  3GD7 A;  5IGC A;  3D6C A;  5GQO A;  3PSI A;  4KK7 A;  1N32 Q;  1IW7 D;  1YNN D;  3L7Z C;  4K5W A;  3OIP A;  4CJ0 B;  5FLM H;  4FF2 A;  2ZXP A;  2WAQ E;  1B50 A;  2B2V C;  4GOP A;  2VQE L;  1X3P A;  2QEX A;  4IFD H;  4MTN A;  1PTO D;  1WOC A;  1UNS A;  4X6A H;  2R93 G;  5C4X G;  4GOP C;  3PIO 3;  3GTJ H;  4CDC C;  2K32 A;  1G51 A;  1HR0 L;  2ZXO A;  2JK8 A;  2NUC A;  4R9W A;  3M4Y A;  1CM9 A;  1LM0 A;  1V1P B;  4YWK A;  4TRD A;  3H3V C;  3S1R H;  3M85 A;  3GTQ H;  2F0O A;  1Q7Y C;  2L1B A;  5ELC A;  2G9D A;  1B44 D;  3J7A 5;  5IT9 L;  4B3T Q;  1KC8 C;  5JJK A;  1F9Q A;  2A73 B;  2QGQ A;  1NR4 A;  4KTA A;  5C44 B;  4JI2 Q;  1UEB A;  1VQ9 A;  4YCU A;  2K5Q A;  4Z9C B;  3HOY B;  3S1N H;  3OTO L;  3HOV G;  4YWL A;  1Q81 C;  4O1N A;  4KJO A;  2VQE Q;  4K6L A;  1AZQ A;  1TXY A;  2EZV A;  2C5C A;  2K5H A;  2N55 A;  1RKN A;  2XRQ D;  3L3O C;  1K3R A;  3A5U A;  3TS0 A;  1EY0 A;  1JWM D;  4HIO A;  1QZH A;  4HJ7 A;  4K5X A;  4O42 A;  4BBS B;  4M1U B;  1DM0 B;  1GVP A;  1OXU A;  5E4X A;  4ME3 A;  2CCZ A;  5GAH C;  1WTV A;  1O7Y A;  2E2H H;  1L0W A;  4DAY B;  2R61 A;  1MI2 A;  1LYL A;  1UE7 A;  2JA7 G;  1HZ9 A;  3GDE A;  5COY A;  3BS1 A;  1PZK D;  3RZD H;  3CCE A;  1C7Y A;  2XWB B;  4JI6 L;  3CD6 A;  1UWV A;  1OXX K;  4ALP A;  4JI5 L;  4OX9 L;  4OEM B;  3I4L A;  3NTH A;  3VDY A;  1JJG A;  2EXZ A;  3I4N B;  2F0G A;  3P75 A;  2Q2T A;  3CCL A;  5FJ8 H;  3A8K E;  1JJC B;  4J15 A;  4DK1 A;  4LFC Q;  3PIP 3;  4B3M L;  1HUN A;  1TWC H;  4Y52 H;  2QF7 A;  3ICE A;  2KBN A;  2SNM A;  1SRU A;  1SN8 A;  2C35 B;  2QEJ C;  2AUK A;  4DV5 Q;  2PI2 A;  3EVQ A;  3SEB A;  1EOV A;  2ICE C;  4XTC S;  2K7V A;  3CCQ A;  1GUG A;  2IT1 A;  3RMH A;  3RLO A;  3V2T A;  2PPB C;  1HFG A;  5LMN Q;  4DAV A;  3I4M B;  1Z47 A;  1PTO F;  2GA4 B;  1IL2 A;  5D3I B;  2MO0 A;  4FVM A;  4NXM Q;  2NYZ D;  4CKE A;  2RDF A;  2ZJQ A;  4RGO S;  2JP1 A;  2E2I B;  1STA A;  3MEH A;  4A3M B;  3PO3 B;  2EPB A;  2DGY A;  5IP9 H;  3HOV H;  1U9R A;  1KNE A;  3U9O A;  1JC7 A;  2EJM A;  4KLK A;  1PRT C;  4LF4 Q;  1KLG D;  5HUR A;  1VQO A;  3DUZ A;  1STG A;  4A3F G;  2PYK A;  3HOW B;  5IP7 H;  4A3D B;  1D5M C;  2YV5 A;  3K58 A;  3HOZ G;  4LFA L;  1CA5 A;  3J80 i;  1WTP A;  1YVC A;  2BOS A;  3H91 A;  1A6X A;  3KDF A;  4RGT A;  5FO9 B;  1JCK B;  2QKI C;  1BQQ T;  1A2U A;  2Z6K C;  4XDX A;  4HR7 B;  3MC0 B;  2JA8 B;  1FNV A;  4HCE A;  1KRT A;  3FPU B;  1F9R A;  4JBJ A;  1STY A;  3OWF A;  4K14 A;  3I55 A;  1EQV A;  1NR2 A;  1LTL A;  3GTM H;  1ZKO A;  2KUM A;  2AMC B;  4RA8 A;  3KF8 A;  5A35 A;  2IJ0 A;  3PCO B;  1HCZ A;  4XYQ A;  2B2V A;  4HED A;  5LMU L;  2J0T D;  1Q1B A;  1R9T H;  1NTG A;  1VQI A;  1HUM A;  2E8G A;  4B3R Q;  5FOB B;  1AE2 A;  3T53 B;  2KED A;  1DOL A;  4C3H H;  4YY3 L;  4DFA A;  3T1H Q;  1JE4 A;  4UPA A;  1WTW A;  5IWA L;  4DV7 L;  3BZD B;  5DLQ E;  1BBX C;  1C48 A;  2RBM A;  4AYB G;  4OO1 H;  2HCI A;  5IY0 A;  3H0G G;  5KYL A;  4FDB A;  1UAP A;  2O4X A;  5E1F A;  1E1T A;  2D5D A;  1A3V A;  1QNU A;  2OQ0 A;  3J7A F;  5IYD G;  3RN5 A;  4L5S A;  2SDF A;  4KJN A;  3NQT A;  3QWN A;  5EKI A;  4BY1 B;  1ML0 D;  1E22 A;  4CKB A;  5JEA J;  4DV0 Q;  4KI0 A;  3RZO H;  1X9N A;  1KD1 C;  4DR3 Q;  3CQZ B;  1WTO A;  2RCN A;  3OPO A;  4K8I A;  1Z6H A;  3RLN A;  2R92 G;  4NXN L;  5CC4 A;  1I4G A;  5KNC A;  2NVT B;  3FPP A;  1D2B A;  2K33 A;  1QNK A;  3RZD B;  2CWP A;  1WTH A;  1K3B C;  5IOC A;  5I9P A;  1JOQ A;  2R93 H;  5LL6 S;  5M5W H;  1Q12 A;  5IGG A;  1IBK Q;  2OCE A;  3TRZ A;  4RCN A;  3SE0 A;  4POF A;  2KCM A;  2B39 A;  1XMO Q;  1A3T A;  4IOC A;  3I90 A;  4A3J B;  1VQA A;  5ELO A;  1WTQ A;  5FLM G;  5CYU A;  4A3B B;  3W5O A;  4EX5 A;  2WV6 D;  2WB1 B;  3J80 c;  1IYJ B;  2F3W A;  2IHE A;  1VF7 A;  4H0L C;  2A6E D;  2BH8 A;  2OEO A;  3TP6 A;  3S1N B;  1G6P A;  4QF4 A;  1JOK A;  5I6W A;  5IYB G;  1WCM H;  3KJO A;  3HOX H;  3BZK A;  2WIN B;  1G6Z A;  1A3U A;  1O78 A;  2D0P A;  3GP7 A;  2MUY A;  1TS5 A;  2Z1C A;  4LNQ A;  1WCM G;  5ELD A;  4QCL A;  2ZM6 Q;  2Y0S B;  3ERS X;  4I7Z C;  4KY6 A;  5E3F A;  4LMQ D;  4UP9 A;  1PHJ A;  2ZXR A;  3VR5 A;  1LTI D;  1N36 Q;  1WVL A;  3L2P A;  1I5F A;  4KD3 A;  1FL0 A;  2JA7 B;  1PYB A;  4FF1 A;  1Z7T A;  1GOZ A;  2FXQ A;  2VUM H;  4RWS C;  3ER0 A;  1NMG A;  1PZI D;  1RTN A;  1V1Q A;  1HZA A;  1DXM A;  2LXK A;  1KL9 A;  5I4D A;  1RCV D;  3G48 A;  3S2D H;  2SOB A;  3DMU A;  3OWE B;  5CV7 A;  4AH6 A;  3KJP A;  2HCC A;  4GZY C;  1J8I A;  4QJF A;  4DKA C;  1EZ8 A;  1AP0 A;  2HD3 A;  1H95 A;  4CDF C;  1OTC A;  4IPD A;  4PMC A;  4EQP A;  2JA8 H;  3S1M B;  1LAB A;  4QIW B;  3LWU A;  3KLW A;  1H9S B;  4IPG A;  2B8F A;  1RTO A;  3T51 B;  1YJW A;  1PH7 A;  1Y1W H;  1D5X C;  4C3I B;  2NZ1 D;  3KF6 B;  2BE5 D;  4DR4 Q;  1H9K A;  3TQY A;  5GAD C;  4R8N A;  1EY8 A;  5IP9 G;  2UUA L;  1SNO A;  5EQ0 A;  1YNJ C;  1GUW A;  1X6O A;  5A2Q L;  3J7Y W;  3D31 A;  1ET6 A;  1DCZ A;  4H7B A;  1T9H A;  4FYD A;  1HR0 W;  3UDX A;  3PO3 H;  1BOS A;  3GTP B;  3EBE A;  4L63 B;  3HOV B;  4ULL A;  4LFB Q;  1PFM A;  1WD1 A;  4X66 L;  1STH A;  2F0J A;  4A93 G;  3I7F A;  3H09 A;  4P75 A;  4B9W A;  4K0K Q;  3WOF A;  3PF4 A;  1JIC A;  1K9M C;  3Q6S A;  4ZQ3 A;  1ESR A;  1FYC A;  4DK6 C;  3T13 A;  3KBG A;  2ENB A;  2I5M X;  5KIX A;  1SLJ A;  4JV5 Q;  1SBB B;  5CBE E;  2ES2 A;  4BY1 H;  3PGZ A;  4DV3 Q;  3K5O A;  4IAL A;  3E3X A;  3OYY A;  5FJ8 G;  4Q5V A;  1CHP D;  2K5V A;  3CCS A;  3D4D A;  2NTS A;  4JK1 C;  5I2X A;  3EIV A;  2WP8 J;  5C6A A;  3S17 H;  3GTL B;  3SR1 A;  4DV3 L;  5C0X G;  3HFZ B;  4DV0 L;  3R3O A;  4C56 C;  4F8M A;  2B63 H;  3K81 C;  4GOP B;  5E4W C;  1PRT B;  1EIY B;  4X65 L;  1I4X A;  1K8A C;  1TU2 B;  1E2Z A;  3KF8 B;  1RIP A;  2B63 G;  3GQB A;  4DNI A;  3BVM A;  3MVV A;  3D4R A;  3NEL A;  2HUG A;  2IX3 A;  4U67 3;  1QUQ A;  2UXC L;  4PV1 C;  2NZH A;  1VQH A;  4G7H C;  2VNU D;  4IPH A;  1MIU A;  2LY7 A;  4ME5 A;  1IBK L;  4YY3 Q;  2PI2 E;  5EGT A;  1SDF A;  2PNR C;  4ZUJ A;  4BY7 G;  3EJI A;  2IW3 A;  2TSS A;  1Q8I A;  1WD0 A;  5BR8 L;  2F3V A;  1T5E A;  1CKM A;  4DR4 L;  4GKJ Q;  3KLS A;  4C3H G;  1F9S A;  4C3J B;  2VS1 A;  1AW7 A;  4JI1 L;  1D5Z C;  3STB D;  1S5F D;  4DV6 L;  5M3M G;  3DM3 A;  4NP5 A;  5M3F B;  4IUV A;  1X56 A;  4CKC A;  1JQY D;  1SRO A;  4A75 A;  4Q0F A;  4DXG A;  2QW7 A;  1VQ6 A;  2K50 A;  3S2H B;  4JV5 L;  1EL0 A;  2N8N A;  3VA7 A;  3DHQ A;  1KAB A;  1GJX A;  1B2T A;  2F0K A;  4A3G G;  4MIU A;  3H0G B;  3M4O H;  3KLS X;  3H94 A;  2EYF A;  5M5W B;  3U4Z A;  5AFW A;  4Y7N H;  3DM1 A;  2ZTD A;  3BJU A;  1CQF A;  3QR8 A;  5L37 A;  1PH1 A;  3MXP A;  2HQE A;  4B08 A;  3NTK A;  2NVX B;  3UE1 A;  3OMG A;  2XVS A;  1K8O A;  3NBI A;  4XXE A;  3PUV A;  1O7L A;  1K8M A;  1TR5 A;  1PZJ D;  1PH8 A;  5I9O A;  4B3S Q;  1N36 L;  2DNE A;  3KUP A;  3NWS A;  1JMC A;  1PTO B;  1C4Q A;  4IUT A;  5IP7 G;  4AYB E;  2F0S A;  2Z6K A;  3M3Y B;  4N9T A;  4DAY A;  1WCM B;  4R4I A;  1Y1W B;  1SMY C;  1HHV A;  3K6O A;  3TP5 A;  4HMJ A;  5I6Y A;  3K8A A;  1K0S A;  2GVB A;  2KCT A;  5C4J H;  3QG1 A;  2AWN A;  1U4P A;  5LMN L;  5LHY 1;  1SND A;  1KIX A;  2B2U A;  3PUZ A;  4NB3 A;  3ULL A;  1IBM Q;  3ZJY C;  3MFY A;  1UUP A;  3ULJ A;  3KOJ A;  2EQS A;  3FP9 A;  1XPU A;  3SGI A;  1UE6 A;  1BCP F;  1OXS C;  1XTC D;  2F4I A;  5JPM C;  3MFG A;  2VUM B;  4DXF A;  1FGB D;  4G57 A;  4BBR B;  1EFI D;  1OO9 B;  4L5T A;  4XQJ A;  4X64 Q;  3S2D B;  4JYA Q;  3HS0 C;  4A3E B;  4LF4 L;  1D8L A;  1BCP D;  3S1Q B;  4JI5 Q;  4OX9 Q;  5IGE A;  3HOY H;  3MHB A;  1X3Q A;  1O80 A;  1QIL A;  2IY5 B;  3S1M H;  5ELE A;  2JEA I;  5JEA H;  2VQF L;  1VQ5 A;  1CT1 D;  1R4Q B;  2X6L A;  3JAM c;  3E0J A;  2B2T A;  1FR3 A;  1JB7 A;  1NBW A;  1V8Q A;  3CHB D;  1TQO A;  2R7Z H;  2DN8 A;  1Y1W G;  1TWG B;  1SAP A;  5AJ3 Q;  3FHW A;  4DAM A;  4A3G B;  3CME A;  3K0X A;  4GN5 A;  4OIJ A;  1I4P A;  1X3E A;  2M9V A;  4BA1 I;  1EU4 A;  1MHW C;  4IUN A;  1K28 A;  4BS9 A;  3GTP H;  4A3C G;  2WAC A;  5TSS A;  1V1P A;  4LFC L;  1SYF A;  3T1H L;  4LF6 L;  1N9W A;  3KDF B;  1KHI A;  3J81 L;  3C1E A;  4WJ3 M;  3N52 A;  2K6A A;  1VQG A;  4CDE C;  2MFI A;  4KY5 A;  3S9W A;  2FIN B;  4A3K H;  1SE2 A;  4JI0 L;  1GD7 A;  4S3S A;  5LMU Q;  2K75 A;  1F77 A;  5FLX E;  2RKS A;  1X54 A;  5C3X A;  5KEE A;  5D3D A;  1Q1E A;  2F0H A;  5T1I A;  3UI2 A;  4DA2 A;  2VW9 A;  1X65 A;  2VXW A;  2PZW A;  3UDG A;  3E0E A;  4ILW A;  4NMZ A;  4KN7 C;  5DEH A;  3NBH A;  4MN3 A;  3BDL A;  3H15 A;  2CQA A;  1GO3 E;  4G7Z C;  5CGK A;  2YYZ A;  4QQB X;  5J1Z A;  3U58 A;  1U4M A;  3S2H H;  3ONA B;  4U68 A;  4PZ7 A;  3PUY A;  1E0B A;  4QMG A;  1N8R C;  1N32 L;  1DGS A;  1EZ6 A;  2EYH A;  4LF5 L;  2AWO A;  1TWF B;  3NTI A;  1C8C A;  1TS2 A;  4YIJ A;  1IHZ A;  2B2W C;  3SK8 A;  4QGU A;  2B63 B;  5CV6 A;  1U5K A;  2EJF C;  1C9O A;  5IWA Q;  1SE4 A;  3JAM L;  3MWY W;  4R4Q A;  1SFO B;  5EPK A;  3CF5 A;  4LF9 Q;  3P20 A;  3AEV A;  3H3V I;  3S16 H;  4XT3 B;  3G7L A;  3LX0 A;  2NVX H;  4OXP A;  2Z8L A;  2AQ2 B;  1EY7 A;  1I94 L;  1QUQ B;  2OXP A;  3AFP A;  4B3R L;  1R4P B;  4HTH A;  1FJG L;  4HJA A;  2K52 A;  2F0F A;  2ALY B;  3J81 E;  2K04 A;  3D6W A;  3VA5 A;  3NUC A;  2DY7 A;  5DM6 3;  4GLX A;  4X3T A;  3D0F A;  3FKI G;  4UHV A;  3M3Y H;  4KKS A;  4GNX A;  1CTM A;  4NXM L;  2D62 A;  1NMF A;  1VQM A;  3GO5 A;  4DV4 Q;  1LTG D;  3F2D A;  1F2Y A;  1XX8 A;  3PUX A;  4C3J H;  1IKM A;  3HOZ H;  3TBI B;  1PYW D;  2EVB A;  4X62 L;  4FF3 A;  2F0Q A;  2PNH A;  2EDG A;  1IXR A;  3Q0A A;  4IO9 A;  4ZK9 B;  3GTK H;  4CDD C;  3VR2 A;  2C9O A;  4HSP A;  4OON A;  2BE5 C;  3O13 A;  3K0Y A;  2FFK B;  2NN6 G;  4KHP L;  1FNU A;  2PO4 A;  3D4W A;  3CPW A;  1L1O B;  2ASB A;  2QCP X;  1A15 A;  2QIL A;  4C1N K;  4A3L H;  3VR4 A;  3BDC A;  1I6V C;  2KQ3 A;  1IL8 A;  2K5W A;  3I4M G;  3MTS A;  4UP8 A;  1BKB A;  1K83 H;  1OXV A;  4X3K A;  4LF8 L;  2A74 C;  3HOX G;  3RN2 A;  1SMY D;  4DV1 Q;  2OQK A;  4IUP A;  2AQ3 B;  4DV2 L;  4ABN A;  4OWW B;  1ENF A;  1N33 Q;  3LWE A;  1QB5 D;  1HQM C;  4TSS A;  5EPL A;  5I2Y A;  2J4X A;  1B3A A;  4C3I G;  5K5P A;  3CQZ H;  1VQP A;  2L15 A;  2LSS A;  2RDG A;  3A8J E;  4DK3 C;  1PMR A;  4IUQ A;  5C4J B;  1XYI A;  4ODG A;  2F3I A;  1QE6 A;  1SE8 A;  1LV9 A;  2FHT A;  2G9H D;  2NVY B;  4FXG C;  4CGY B;  4DF7 A;  2HDL A;  1ZXT A;  4JC0 A;  4XQQ A;  3HGB A;  1PTO C;  1EFW A;  4H44 C;  2E2J H;  1BCP C;  1HZB A;  4TKO B;  2RF4 A;  2B8G A;  3CU7 A;  4L6T B;  2NVQ H;  4A3K B;  4LF9 L;  1UEA B;  5CV8 A;  4A3E H;  3IKJ A;  1HR0 Q;  2YU9 H;  1CK1 A;  3FKI B;  1V43 A;  1QG7 A;  1XPO A;  1GHK A;  3NK9 A;  3TN2 A;  3U4V A;  2F0N A;  1ICW A;  2JA9 A;  3HOX B;  2KCN A;  3AQQ A;  2EIF A;  2F0P A;  2JE6 I;  1PH9 A;  1HJP A;  3C2P A;  2F0W A;  1VQ4 A;  5ISR A;  2Q8T A;  5M5X B;  2E75 C;  2L55 A;  1CKN A;  1RL2 A;  3DXJ C;  1PVO A;  1LO5 D;  3IL8 A;  5KNB A;  4ZCK A;  1VDZ A;  3DLL A;  1W3S A;  2KHJ A;  5FLX L;  4DR5 Q;  1YIJ A;  2F0L A;  2OT2 A;  4A3J G;  3VR6 A;  1STE A;  2JA6 B;  5C4X B;  4JBK A;  1ZYR D;  4A3B G;  4P72 A;  2K14 A;  5CV4 A;  4PQX A;  1L0Y B;  1LUZ A;  1G8Z D;  3F8T A;  3C1F A;  1X55 A;  4OEL B;  4AIM A;  3OHX C;  1LTT D;  1LTR D;  4HCS A;  4BY1 G;  4JBW A;  1VQK A;  1MBY A;  1TS3 A;  2XN9 C;  3I73 A;  2VB3 X;  3CPF A;  4IPC A;  4IJL A;  3MXN B;  5BN4 A;  3CW2 C;  1JOR A;  4JI8 L;  2IHF A;  1EUJ A;  4KN4 C;  5M3M H;  2RVL A;  3I91 A;  1EWH A;  5COR A;  4GN3 B;  3QJY A;  1HNX L;  1Y14 B;  4JBM A;  4OGQ C;  5J3B A;  1B4O A;  4YHH Q;  1G29 1;  1IW7 C;  2DUD A;  5JJZ A;  3A55 A;  2RCF A;  1TS4 A;  2DJG C;  2XSC A;  3CKI B;  1YJ9 A;  1DJR D;  4HIM A;  5C0X H;  4DV1 L;  1Y8N B;  4A3I G;  4IZ8 A;  1CKN B;  1YNX A;  2QDL A;  2F4V L;  5K36 G;  4LUV A;  3VYR A;  1JWS D;  5H1S E;  1XPR A;  3KBX A;  1H9M A;  3T1Y Q;  4DUZ Q;  5CR3 A;  5HY6 A;  3TSS A;  3LNN A;  3PMF A;  3M7N A;  3FDT A;  5EKL A;  4HJ8 A;  2YTX A;  3C3L A;  2MNA A;  3HKS A;  4R4T A;  1S3O A;  1EYA A;  1I4Q A;  3DWP A;  2Z6B A;  1XXG A;  5IYC H;  2G5D A;  4LJZ C;  3NBH B;  1SYG A;  2F0U A;  2L0C A;  2ZT9 C;  4RG1 A;  3R8B A;  4K2L A;  3K7A B;  2R7F A;  3DWQ A;  4EQN A;  2JA5 H;  3F2U A;  4JPB W;  2F0V A;  3N6R A;  2YTV A;  1TT2 A;  2EE1 A;  1JWU D;  2KHS A;  2E2H B;  3QIA A;  4A3D G;  1J5E L;  1EYG A;  1IBL L;  1YI2 A;  3VYT A;  4A4I A;  3NHH A;  2A6H C;  4CJ1 B;  2CW0 D;  2HIV A;  3G4S A;  3HOZ B;  1A2T A;  1LTS D;  3GTG H;  1L0X B;  2FMC A;  2EOT A;  3IFT A;  5GAG C;  1EQQ A;  1BR9 A;  1SYE A;  4LAA A;  1B9N A;  1MSH A;  5EPJ A;  1EY9 A;  2LMC B;  3HZX A;  1Q3L A;  3GTQ B;  2OTJ A;  2EYO A;  1XWE A;  1TWC B;  1F2M A;  3G71 A;  1EQR A;  1L1O A;  2JA8 G;  1KXL A;  1SJH D;  1QOH A;  2Y0S G;  5E7N A;  2L11 A;  4XQN A;  1S5B D;  1YJN A;  1RJT A;  2R7D A;  4A3M G;  1EYC A;  3TEH B;  2KOL A;  1EYD A;  1Q46 A;  4OL7 A;  3A0J A;  3BYT B;  1SNC A;  2M00 A;  4JI3 L;  4X62 Q;  3A8I E;  4JG2 A;  2E5L Q;  4FP5 D;  1C0A A;  2EYJ A;  4ZAI A;  3HOU G;  2JA6 G;  2MHV A;  4NPS A;  3V05 A;  4PZ6 A;  2MQH A;  4JI8 Q;  2HHH Q;  2KEN A;  3WOE A;  1MKH A;  1ASY A;  2EJG C;  3DEP A;  2O2L D;  1PYS B;  1TY0 A;  1H9J A;  4GKJ L;  3I70 A;  1MSG A;  1QWY A;  5EBC A;  4RGM A;  3KFU A;  1ICF B;  1VF5 C;  2Q8I B;  2HDM A;  4H13 C;  2A69 D;  4ZRZ A;  2MPM A;  2UXB Q;  1A62 A;  1FJG Q;  1SR3 A;  1U0L A;  4HSV A;  1I94 Q;  4JI7 Q;  1I3Q H;  1LTB D;  3GTO B;  5ELB A;  3U9S A;  2A6E C;  3FRP B;  5J22 A;  1CZG A;  3QOJ A;  2JN4 A;  3JAM E;  2K4K A;  2UXC Q;  2PW5 A;  2EY6 A;  1HNW L;  3NE5 B;  4OWX B;  1QZG A;  1K8G A;  2N88 A;  4KV6 A;  5G3L D;  1E3P A;  3D8G A;  4X65 Q;  5DNF A;  1B7Y B;  5GRO A;  3ERO A;  4OO1 G;  1EY6 A;  1JE5 A;  1N34 L;  5D65 A;  1O7I A;  1BUV T;  4J6H A;  5IT9 c;  4XYO A;  2PMZ B;  3HOY G;  4DR1 L;  2XRS D;  2JA5 G;  1LT6 D;  2D9U A;  1S5C D;  1VQ7 A;  5C44 G;  3I4M H;  3R2I A;  1MJC A;  2RA4 A;  3K5M A;  1JR0 D;  3OW2 A;  2A19 A;  3OOC A;  2R3Z A;  4JI0 Q;  4EQO A;  1ILP A;  2E2I H;  1RHP A;  3M4P A;  4QB4 A;  3GTJ B;  4X3S A;  4DGZ A;  1SSO A;  1MJE A;  1MD2 D;  2SEB D;  2UUB Q;  4LF6 Q;  4P74 A;  1HNZ Q;  3HOW H;  2JA6 H;  2UUC L;  4A3D H;  2L9H A;  4K0K L;  4FNF A;  1T5X D;  1Y8O B;  2A5H A;  2IPK D;  2A1A A;  3OSO A;  1PLF A;  4KKU A;  4GN4 B;  4DNT B;  4C3J G;  2HIX A;  1EWI A;  1U4L A;  4F7X A;  5AJ3 L;  1II3 A;  4PZ8 A;  1CZW A;  1NSN S;  2V1C C;  4BXX G;  5CBA E;  1EOT A;  1SYD A;  1D1I A;  2EY5 A;  1SYB A;  2L4N A;  1IBM L;  3CCV A;  1Y69 U;  1XMQ L;  2EYP A;  3K7A H;  1ILQ A;  2B3G A;  4DR7 L;  3X3M A;  5EBD A;  4N8X 1;  2K28 A;  1VQ8 A;  2XNA C;  1X3G A;  3JC6 6;  4AQY L;  2AQ1 B;  4N9P A;  2PQA B;  4LK1 C;  2E76 C;  1GUO A;  2AKW B;  2H1E A;  4DV2 Q;  5D14 A;  4K5V A;  2CWA A;  2R7Z B;  3MZ5 A;  2WII B;  2R93 B;  2VY3 A;  3NWT A;  3AYH B;  3VR3 A;  3PO2 B;  1PH3 A;  1M1K C;  5K36 H;  1HZC A;  3BVZ A;  1V9P A;  1CFM A;  1XNR Q;  1JB3 A;  2UXD Q;  2R6G A;  4IUR A;  3EA6 A;  4X64 L;  3T16 A;  3A5Z B;  3CC7 A;  1B70 B;  3NEN A;  4A3B H;  4MHE A;  1KNA A;  3X3N A;  3I2Z A;  5IT9 E;  3SVM A;  3BZC A;  2EYM A;  1PRT F;  1XTD A;  4KMU C;  3M9B A;  3MXN A;  1GUT A;  4QUF A;  2VB2 X;  1D1K A;  1GUN A;  2ZJP A;  2RHS B;  4APV A;  5ELN A;  4DR6 Q;  4OWT B;  2X6G A;  4YCV A;  4DV4 L;  4L5R C;  1W2B A;  2CFM A;  4G7O C;  2F03 A;  1ESF A;  1KDC A;  4WJW A;  2OWO A;  1PFB A;  4FO2 A;  2I5L X;  1CI3 M;  3TDQ A;  3CCJ A;  4NW2 A;  3I56 A;  4NDX A;  1I50 B;  3WWV A;  1VQJ A;  2BA0 A;  1ZEQ X;  2IL8 A;  1B8A A;  2LS0 1;  2ZM6 L;  2E2D C;  4UP7 A;  2F52 A;  5G3L F;  3ZYY X;  3SK5 A;  2I07 B;  3MAQ A;  4JVZ A;  3OW7 A;  3BDO A;  3F2B A;  3CCR A;  4A93 B;  1ZYR C;  1HFN A;  2ZJR A;  1LLR D;  4B3S L;  5BR8 Q;  2NVT H;  4JCV E;  2JA7 H;  2HQL A;  4ZYS A;  2WAQ G;  3GTG B;  3K5N A;  2SNS A;  3PV0 A;  4G4K A;  4LF7 L;  1SMX A;  2Z4H A;  4RCO A;  3S15 H;  1F2Z A;  1DOM A;  1XNQ Q;  3ND9 A;  5GAE C;  1BF4 A;  5EKK A;  3NPP A;  4EVO A;  4A3F H;  2J7Z A;  4DNR B;  2ZTC A;  1Q82 C;  4LF5 Q;  2XTI A;  4EGV A;  1XMO L;  2BA1 A;  5EAY A;  4C2M B;  2F0E A;  3TP8 A;  1VQL A;  4TVA B;  3F1Z A;  2ID0 A;  2VUM G;  5C3E G;  4DAP A;  4GNX C;  4GKK Q;  3KLR A;  4KY7 A;  5CV5 A;  1VQE A;  4JI1 Q;  2TMP A;  4C3I H;  2E74 C;  4YCW A;  3HOU B;  2PZT A;  2RDH A;  5C5L A;  4JOI C;  4P73 A;  2B2U C;  1HXY D;  2Q8R E;  3CCU A;  5C4H A;  1BBU A;  3SK6 A;  1HRJ A;  1VQD A;  2RSN A;  4HAE A;  1WI5 A;  3W1B A;  1S40 A;  1HQR D;  3TZU A;  4K8J A;  5FLX c;  1BDO A;  3EQL C;  1W6J A;  2CVR A;  4FXK C;  3F2C A;  5JJI A;  3HRZ C;  2WFW A;  1F2L A;  4N8F A;  4RAU C;  1NNX A;  1GHJ A;  1YNJ D;  4DU9 A;  5IYB H;  4IFD G;  1E24 A;  1QVG A;  2I5H A;  4A3L G;  2H5X A;  4BBR G;  5C3E H;  2KVM A;  1I3Q B;  3R93 A;  3GTO H;  1NE3 A;  4KHZ A;  4DV7 Q;  2JJQ A;  1E2W A;  4RHS A;  1RD9 D;  1E1O A;  3T56 B;  4WJ4 A;  2GN5 A;  2XGT A;  2I0Q A;  2CKZ B;  1IYU A;  1QVC A;  1I6H H;  4A3E G;  2EY1 A;  3OMC A;  2M2L A;  2OF1 A;  3A7L A;  4GLA C;  4QL5 A;  2VQF Q;  1STB A;  1TVX A;  1M90 C;  1D6E C;  1ENC A;  1CUK A;  2JQO A;  2KA7 A;  1S72 A;  2UUA Q;  1TWH H;  3RLF A;  4V19 0;  3CXC A;  2DNC A;  4RGN A;  5KYI A;  3GTL H;  1JT8 A;  5BN3 A;  3SDZ A;  2ZTE A;  3NEM A;  3S14 H;  5T1G A;  1L2F A;  4UAI A;  2YTY A;  3DEO A;  3EFX D;  3K5L A;  4JYA L;  1FVI A;  1VCI A;  4J8Q A;  2WKD A;  1SJE D;  1YHB A;  4I7A A;  3RR5 A;  1M8A A;  2CH4 W;  3QOL A;  4QY7 A;  2NN6 I;  2CW0 C;  1NUC A;  4JOI A;  1AN8 A;  2O5J C;  4K2K A;  1G91 A;  4CHT B;  1Y1V G;  3Q23 A;  4POG A;  4LFA Q;  1XNQ L;  4B9X A;  2AHO B;  5M3F G;  1TKW B;  3VYS A;  4LFB L;  3BVG A;  1PA6 A;  2FMM A;  3WDN A;  2NVQ B;  1HPC A;  1QCB D;  1K73 C;  2IWH A;  2WAQ B;  3FKI H;  1XNR L;  2P5Z X;  4QIW E;  1PH4 A;  4KKT A;  5M5Y B;  1KAW A;  2V4D A;  1E7Z A;  1AZP A;  3HP3 A;  3CRK C;  1TY2 A;  4OO1 I;  1I50 H;  5JAV A;  5M3F H;  4FF4 A;  2Q2I A;  5M5X H;  4AQY Q;  4DR6 L;  4IFD J;  3URY A;  3DWA A;  4R8I A;  5C5M A;  1CSQ A;  4MTK A;  1S5D D;  3QO2 A;  3PIP A;  4M8A A;  2NBF A;  2VZA A;  4F87 A;  3PO2 H;  4DV5 L;  2A8V A;  4IQZ A;  3C46 A;  3I4N H;  1VQN A;  2NZO A;  2N3S A;  3TZD A;  2B2T C;  1J6Q A;  4A3F B;  1KAA A;  4UY8 C;  4RHR A;  1ROD A;  3K59 A;  1TII D;  1HNZ L;  3ERQ A;  1G2T A;  1TWA H;  1CHQ D;  4RH6 A;  3G6E A;  2UXD L;  1DON A;  2Z4I A;  5HGQ A;  4BY7 B;  3MA2 B;  2ATW A;  2K01 A;  2A68 D;  3R2T A;  1PTO H;  2B2Y A;  1B3Q A;  4DV6 Q;  4PG3 A;  4JI6 Q;  4OHJ A;  3CAM A;  5JPN C;  1H9S A;  4KHV A;  4P2C B;  3FEW X;  3RUZ A;  3HOU H;  3T4A C;  1CSP A;  3U50 C;  5JEA G;  4DR3 L;  1J9O A;  1V1O A;  3HKZ G;  4DR1 Q;  2DJF C;  1HA6 A;  4MZ9 A;  4ZKB B;  4A3M H;  1KDA A;  4V0B A;  3PIO A;  4IFD I;  3NSW A;  3Q8D A;  4ZKC B;  4A93 H;  2D2C C;  4XIG S;  4ID6 A;  3P1H A;  2F0T A;  3L0O A;  1E2V A;  4O2D A;  2HT1 A;  3CP0 A;  4O0A A;  5C3E B;  2IX0 A;  1YBY A;  3MXG A;  4Y7N B;  1STN A;  2GVA A;  3S15 B;  3IAY A;  1Y8P B;  1B1Z A;  1EY5 A;  4E6I A;  1AEX A;  4EQ5 A;  1F9P A;  1O7Z A;  3A74 A;  3Q22 A;  1ET9 A;  1I6H B;  2BCO A;  1HTL D;  4HN7 A;  1BNZ A;  1NCV A;  1RF2 D;  2QDB A;  1EIH A;  2PQE A;  2I46 A;  3MXU A;  3SK4 A;  2BH2 A;  1LT5 D;  4NXN Q;  1DOK A;  5FK9 C;  5BN5 A;  5DAU A;  3UE0 A;  3ND8 A;  2A6H D;  3I4O A;  5EJW A;  5IGB A;  5M9O A;  1YHA A;  3M7G A;  5C0X I;  4XT1 B;  2PMZ E;  3GTM B;  5IE8 A;  4GKK L;  1Q90 A;  2K1B A;  3SHL A;  2JA5 B;  2CH4 A;  3KK7 A;  1HTP A;  3S14 B;  1EEI D;  3J81 c;  4CJ2 C;  4LUO A;  2AUJ D;  1OXT A;  5KRU A;  1BBW A;  2K5N A;  2F0D A;  3I8Z A;  1CQV A;  3CRL C;  3A54 A;  2ICI A;  1P16 A;  1BO0 A;  5KGU A;  4C3H B;  4ZUI A;  1Z9F A;  4GNX B;  3M4Q A;  4X66 Q;  3TP7 A;  1Q86 C;  4IN3 A;  4LF7 Q;  5J39 A;  3PF5 A;  4TQU S;  1LT4 D;  1SEB D;  1A63 A;  3IRB A;  4BBR H;  3BU2 A;  2KJX A;  1VMP A;  3E5S A;  2UXB L;  2N49 A;  2N78 A;  2O5I C;  3A56 A;  3S1Q H;  2PCF B;  3AB9 A;  3QB3 A;  1WTR A;  1JOO A;  1B9M A;  3RZO B;  2MJ8 A;  4I65 A;  4J1M A;  3HG9 A;  3Q24 A;  2F0I A;  3K80 C;  1TWH B;  1BXT A;  2IX1 A;  1EWC A;  1CA6 A;  3PUW A;  1D7Q A;  1FNW A;  4HIK A;  1EIG A;  3G6J B;  1TWF H;  4JI3 Q;  1TWG H;  1IZ6 A;  3UDF A;  4A3G H;  3TME A;  1ONL A;  2DY8 A;  3S24 A;  5FO8 B;  3STB C;  2QA4 A;  1FD7 D;  4F88 A;  2Z0S A;  1VS0 A;  1JJ2 A;  2WKC A;  4CBV A;  3JAM i;  2WB1 G;  2L12 A;  3W1G A;  1ASZ A;  4A3J H;  1DYQ A;  2UUC Q;  3S16 B;  4B3M Q;  5JOB A;  2UUB L;  3J81 i;  4L8J A;  5IGD A;  1PV4 A;  1SNQ A;  2R92 H;  1UE5 A;  1GM5 A;  3LGJ A;  3RNU A;  3ULP A;  1P8L A;  4X3U A;  1SE3 A;  1YEZ A;  1S4Z A;  2K05 A;  3EN2 A;  3NXW A;  5F2D A;  2BDN A;  1SNP A;  1X32 A;  1WFQ A;  3E6Z X;  3NP8 A;  4AYB B;  5M5Y H;  1IBL Q;  4P71 A;  1L1O C;  1YHQ A;  5C4Z A;  1LTA D;  2MO1 A;  1PH2 A;  2NN6 H;  2XIW A;  1FGU A;  3NQI A;  3GV6 A;  1GKH A;  2K5D A;  4DR7 Q;  3E9H A;  2K03 A;  1XMQ Q;  2KCC A;  3KYH C;  2BDO A;  3B6Y A;  1YNN C;  1KLU D;  5FO7 B; 
#chains in the Genus database with same CATH homology
 4PMW A;  5FKA C;  1MGS A;  3GTK B;  2XWJ B;  4QUC A;  4C1N I;  2PW7 A;  1LAC A;  1S5E D;  2NWG A;  5HGT A;  2LFN A;  4A3I B;  2L5T A;  2FJ2 A;  5CV9 A;  5LL6 X;  2JEB I;  3FVQ A;  2A68 C;  4K6D A;  1ENA A;  4RKB A;  1K83 B;  1PRT D;  1GUS A;  2NB0 A;  1TWA B;  2RSO A;  1LT3 D;  4DK0 A;  4ZLT F;  3OIQ A;  2MP1 A;  3HEJ A;  1Y1V B;  4FXD A;  2RQX A;  3I72 A;  5CMD A;  1KLU D;  1KDB A;  3I3C A;  4RFB A;  2JYO A;  3W3A A;  3H6M A;  1QJO A;  1EEF D;  3D3R A;  1IKL A;  5IGF A;  4WRD A;  2E2J B;  3S1R B;  2NTT A;  2KEE A;  2H4O A;  5IIF A;  1H9R A;  3FMC A;  5A2Q E;  4KD4 A;  3GV3 A;  1IYV A;  2YU9 B;  3J7A V;  2EYL A;  2CHB D;  1U4R A;  1HA5 A;  1PXU A;  2F0M A;  4RKL A;  1M4V A;  4NKL A;  4BWG B;  1AFP A;  3P7J A;  2JSO A;  2F1M A;  3S17 B;  1I4R A;  4DN4 M;  1GXD C;  2B2W A;  1W6K A;  4WOR A;  3J80 L;  1RDP D;  2MGS A;  5ELF A;  1PDQ A;  3BG3 A;  2LKV A;  3SXH A;  1EQT A;  1B53 A;  5JVH 3;  5DM7 3;  5KND A;  2R92 B;  3K57 A;  4UDU C;  1PFN A;  2B2Y C;  5C0X J;  5NUC A;  5JVG 3;  3AU7 A;  3IFD A;  1VMC A;  1EY4 A;  5M3M B;  1G2S A;  2X69 A;  4PMB A;  3AMU A;  1SXT A;  5IOD A;  1BCP B;  1SYC A;  5C3W A;  1SNM A;  4BA2 I;  1I4H A;  3A7A B;  2EY2 A;  3V96 A;  3HKZ B;  1R9T B;  1NAP A;  3M4O B;  1WTX A;  4WFN 3;  1EU3 A;  3VYU A;  1DD2 A;  3BYY B;  4HMI A;  3RD4 A;  3J80 E;  1DZ1 A;  2KEC A;  4IUU A;  4OIK A;  4PNY A;  3L9A X;  2PZU A;  2A69 C;  3W2D A;  2JXM B;  3ITP A;  1KTK A;  3GD7 A;  5IGC A;  3D6C A;  4KK7 A;  1IW7 D;  1YNN D;  3L7Z C;  4K5W A;  3OIP A;  4CJ0 B;  4FF2 A;  2ZXP A;  1B50 A;  2B2V C;  1X3P A;  4IFD H;  1PTO D;  1UNS A;  3PIO 3;  2K32 A;  2ZXO A;  2NUC A;  4R9W A;  3M4Y A;  1CM9 A;  1V1P B;  3H3V C;  4TRD A;  3M85 A;  2F0O A;  2L1B A;  5ELC A;  2G9D A;  1B44 D;  5IT9 L;  1F9Q A;  2A73 B;  1NR4 A;  4KTA A;  5C44 B;  2K5Q A;  4Z9C B;  3HOY B;  4O1N A;  4KJO A;  1AZQ A;  4K6L A;  2EZV A;  2C5C A;  2N55 A;  1RKN A;  2XRQ D;  3L3O C;  1EY0 A;  1JWM D;  4K5X A;  4O42 A;  4BBS B;  1DM0 B;  4M1U B;  1OXU A;  5E4X A;  1WTV A;  1O7Y A;  2R61 A;  1MI2 A;  5COY A;  3BS1 A;  1PZK D;  2XWB B;  1OXX K;  3I4L A;  3NTH A;  2EXZ A;  3I4N B;  2F0G A;  3P75 A;  3A8K E;  4DK1 A;  3PIP 3;  1HUN A;  2QF7 A;  2SNM A;  2QEJ C;  2AUK A;  3EVQ A;  3SEB A;  2ICE C;  4XTC S;  2K7V A;  1GUG A;  2IT1 A;  3RMH A;  3V2T A;  2PPB C;  1HFG A;  4DAV A;  3I4M B;  1Z47 A;  1PTO F;  2GA4 B;  5D3I B;  4FVM A;  2NYZ D;  4CKE A;  2RDF A;  4RGO S;  2JP1 A;  2E2I B;  1STA A;  3MEH A;  4A3M B;  3PO3 B;  2EPB A;  1U9R A;  1KNE A;  3U9O A;  1JC7 A;  2EJM A;  1PRT C;  1KLG D;  5HUR A;  3DUZ A;  1STG A;  2PYK A;  3HOW B;  4A3D B;  1D5M C;  3K58 A;  1CA5 A;  1WTP A;  2BOS A;  3H91 A;  1A6X A;  4RGT A;  5FO9 B;  1JCK B;  2QKI C;  1BQQ T;  1A2U A;  4XDX A;  4HR7 B;  3MC0 B;  2JA8 B;  1FNV A;  4HCE A;  3FPU B;  1F9R A;  1STY A;  3OWF A;  4K14 A;  1EQV A;  1NR2 A;  1ZKO A;  2KUM A;  4RA8 A;  3KF8 A;  5A35 A;  2IJ0 A;  1HCZ A;  4XYQ A;  2B2V A;  4HED A;  2J0T D;  1Q1B A;  1HUM A;  5FOB B;  3T53 B;  2KED A;  1DOL A;  4DFA A;  1JE4 A;  1WTW A;  3BZD B;  1BBX C;  1C48 A;  2RBM A;  4OO1 H;  2HCI A;  5KYL A;  1UAP A;  2O4X A;  5E1F A;  2D5D A;  1A3V A;  1QNU A;  3J7A F;  2SDF A;  4KJN A;  3NQT A;  3QWN A;  5EKI A;  4BY1 B;  1ML0 D;  4CKB A;  5JEA J;  4KI0 A;  3CQZ B;  1WTO A;  3OPO A;  4K8I A;  1Z6H A;  5CC4 A;  1I4G A;  5KNC A;  2NVT B;  3FPP A;  1D2B A;  2K33 A;  1QNK A;  3RZD B;  5IOC A;  5I9P A;  1JOQ A;  5LL6 S;  1Q12 A;  5IGG A;  4RCN A;  3SE0 A;  2B39 A;  1A3T A;  3I90 A;  4A3J B;  1WTQ A;  5CYU A;  4A3B B;  2WV6 D;  2WB1 B;  2F3W A;  1VF7 A;  4H0L C;  2A6E D;  2OEO A;  3TP6 A;  3S1N B;  4QF4 A;  1JOK A;  5I6W A;  2WIN B;  1G6Z A;  1A3U A;  1O78 A;  3GP7 A;  2MUY A;  1TS5 A;  2Z1C A;  5ELD A;  4QCL A;  2Y0S B;  4I7Z C;  4KY6 A;  5E3F A;  4LMQ D;  2ZXR A;  3VR5 A;  1LTI D;  1WVL A;  4KD3 A;  2JA7 B;  4FF1 A;  1Z7T A;  1GOZ A;  4RWS C;  1PZI D;  1RTN A;  1DXM A;  5I4D A;  1RCV D;  2SOB A;  3DMU A;  3OWE B;  5CV7 A;  4GZY C;  2HCC A;  1J8I A;  1EZ8 A;  1AP0 A;  4PMC A;  4EQP A;  3S1M B;  1LAB A;  4QIW B;  3LWU A;  1H9S B;  2B8F A;  1RTO A;  3T51 B;  1D5X C;  4C3I B;  2NZ1 D;  2BE5 D;  1H9K A;  4R8N A;  1EY8 A;  1SNO A;  5EQ0 A;  1YNJ C;  1GUW A;  5A2Q L;  3J7Y W;  3D31 A;  1ET6 A;  1DCZ A;  4H7B A;  4FYD A;  1BOS A;  3GTP B;  4L63 B;  3HOV B;  4ULL A;  1PFM A;  1WD1 A;  1STH A;  2F0J A;  3H09 A;  4B9W A;  3WOF A;  1JIC A;  3Q6S A;  4ZQ3 A;  1ESR A;  1FYC A;  3T13 A;  3KBG A;  2ENB A;  5KIX A;  1SBB B;  5CBE E;  3K5O A;  4IAL A;  4Q5V A;  1CHP D;  3D4D A;  2NTS A;  4JK1 C;  5I2X A;  2WP8 J;  5C6A A;  3GTL B;  3SR1 A;  5C0X G;  3R3O A;  4C56 C;  4F8M A;  5E4W C;  1PRT B;  1I4X A;  1TU2 B;  1E2Z A;  3GQB A;  3BVM A;  3MVV A;  3D4R A;  2HUG A;  2IX3 A;  4U67 3;  4PV1 C;  4G7H C;  2VNU D;  2LY7 A;  4ME5 A;  5EGT A;  1SDF A;  2PNR C;  4ZUJ A;  3EJI A;  2IW3 A;  2TSS A;  1Q8I A;  1WD0 A;  2F3V A;  1T5E A;  3KLS A;  4C3H G;  1F9S A;  4C3J B;  1AW7 A;  1D5Z C;  1S5F D;  4NP5 A;  5M3F B;  4IUV A;  4CKC A;  1JQY D;  4Q0F A;  4DXG A;  3S2H B;  1EL0 A;  3VA7 A;  3DHQ A;  1KAB A;  1GJX A;  1B2T A;  2F0K A;  4MIU A;  3H0G B;  3KLS X;  3H94 A;  2EYF A;  5M5W B;  5AFW A;  3DM1 A;  1CQF A;  3MXP A;  2HQE A;  4B08 A;  3NTK A;  2NVX B;  3OMG A;  2XVS A;  1K8O A;  3NBI A;  4XXE A;  3PUV A;  1O7L A;  1K8M A;  1TR5 A;  1PZJ D;  5I9O A;  2DNE A;  3KUP A;  3NWS A;  1PTO B;  1C4Q A;  4IUT A;  2F0S A;  3M3Y B;  4N9T A;  4DAY A;  1WCM B;  1Y1W B;  1SMY C;  1HHV A;  3K6O A;  3TP5 A;  4HMJ A;  5I6Y A;  3QG1 A;  2AWN A;  1U4P A;  5LHY 1;  1SND A;  2B2U A;  3PUZ A;  3MFY A;  1UUP A;  1BCP F;  1OXS C;  1XTC D;  2F4I A;  5JPM C;  3MFG A;  2VUM B;  4DXF A;  1FGB D;  4G57 A;  4BBR B;  1EFI D;  1OO9 B;  4XQJ A;  3S2D B;  3HS0 C;  4A3E B;  3S1Q B;  1BCP D;  5IGE A;  3MHB A;  1X3Q A;  1O80 A;  1QIL A;  5ELE A;  2JEA I;  5JEA H;  1CT1 D;  1R4Q B;  2X6L A;  3E0J A;  2B2T A;  1FR3 A;  1V8Q A;  3CHB D;  1TQO A;  2DN8 A;  1TWG B;  1SAP A;  4A3G B;  4OIJ A;  1I4P A;  2M9V A;  4BA1 I;  1EU4 A;  4IUN A;  4BS9 A;  2WAC A;  5TSS A;  1V1P A;  1SYF A;  3J81 L;  3C1E A;  3N52 A;  2K6A A;  4KY5 A;  3S9W A;  2FIN B;  1SE2 A;  4S3S A;  1F77 A;  5FLX E;  2RKS A;  5C3X A;  5KEE A;  5D3D A;  1Q1E A;  2F0H A;  5T1I A;  3UI2 A;  4DA2 A;  2VXW A;  2PZW A;  4ILW A;  4NMZ A;  4KN7 C;  5DEH A;  3NBH A;  4MN3 A;  3BDL A;  2CQA A;  4G7Z C;  5CGK A;  2YYZ A;  5J1Z A;  1U4M A;  3ONA B;  4U68 A;  3PUY A;  1E0B A;  4QMG A;  1EZ6 A;  2EYH A;  2AWO A;  1TWF B;  3NTI A;  1C8C A;  1TS2 A;  4YIJ A;  1IHZ A;  2B2W C;  3SK8 A;  2B63 B;  5CV6 A;  2EJF C;  1SE4 A;  3JAM L;  3MWY W;  1SFO B;  5EPK A;  3P20 A;  4XT3 B;  3G7L A;  3LX0 A;  2Z8L A;  2AQ2 B;  1EY7 A;  2OXP A;  1R4P B;  4HTH A;  2F0F A;  3J81 E;  2K04 A;  3D6W A;  3VA5 A;  3NUC A;  2DY7 A;  5DM6 3;  4X3T A;  4KKS A;  1CTM A;  2D62 A;  3GO5 A;  1LTG D;  1F2Y A;  1XX8 A;  3PUX A;  1IKM A;  3TBI B;  1PYW D;  2EVB A;  4FF3 A;  2F0Q A;  2EDG A;  3Q0A A;  4ZK9 B;  3VR2 A;  2C9O A;  4HSP A;  2BE5 C;  3O13 A;  3K0Y A;  2FFK B;  2NN6 G;  1FNU A;  2PO4 A;  3D4W A;  2QCP X;  1A15 A;  2QIL A;  4C1N K;  3VR4 A;  3BDC A;  1I6V C;  2KQ3 A;  1IL8 A;  2K5W A;  3MTS A;  1OXV A;  4X3K A;  2A74 C;  1SMY D;  4IUP A;  2AQ3 B;  4ABN A;  1ENF A;  3LWE A;  1QB5 D;  1HQM C;  4TSS A;  5EPL A;  5I2Y A;  2J4X A;  1B3A A;  4C3I G;  5K5P A;  2RDG A;  3A8J E;  1PMR A;  4IUQ A;  5C4J B;  1XYI A;  4ODG A;  1QE6 A;  2FHT A;  1LV9 A;  2G9H D;  2NVY B;  4FXG C;  4CGY B;  4DF7 A;  2HDL A;  1ZXT A;  4XQQ A;  3HGB A;  1PTO C;  4H44 C;  1BCP C;  4TKO B;  2B8G A;  3CU7 A;  4L6T B;  4A3K B;  1UEA B;  5CV8 A;  3IKJ A;  1CK1 A;  3FKI B;  1V43 A;  1QG7 A;  1GHK A;  3NK9 A;  3TN2 A;  2F0N A;  1ICW A;  3HOX B;  2KCN A;  2F0P A;  2JE6 I;  3C2P A;  2F0W A;  5ISR A;  2Q8T A;  5M5X B;  2E75 C;  2L55 A;  3DXJ C;  1LO5 D;  3IL8 A;  5KNB A;  1VDZ A;  5FLX L;  2F0L A;  2OT2 A;  3VR6 A;  1STE A;  2JA6 B;  5C4X B;  1ZYR D;  5CV4 A;  4PQX A;  1L0Y B;  1G8Z D;  3C1F A;  3OHX C;  1LTT D;  1LTR D;  4HCS A;  4JBW A;  1MBY A;  1TS3 A;  2XN9 C;  3I73 A;  2VB3 X;  5BN4 A;  1JOR A;  4KN4 C;  2RVL A;  3I91 A;  1EWH A;  5COR A;  3QJY A;  4OGQ C;  1B4O A;  1G29 1;  1IW7 C;  5JJZ A;  3A55 A;  1TS4 A;  3CKI B;  2XSC A;  1DJR D;  5C0X H;  1Y8N B;  4IZ8 A;  5K36 G;  3VYR A;  1JWS D;  3KBX A;  1H9M A;  5CR3 A;  3TSS A;  3LNN A;  3PMF A;  3M7N A;  3FDT A;  5EKL A;  3C3L A;  1EYA A;  1I4Q A;  3DWP A;  1XXG A;  4LJZ C;  1SYG A;  2F0U A;  2L0C A;  2ZT9 C;  3R8B A;  4K2L A;  3K7A B;  3DWQ A;  4EQN A;  3F2U A;  2F0V A;  3N6R A;  1TT2 A;  2EE1 A;  1JWU D;  2KHS A;  2E2H B;  3QIA A;  3VYT A;  3NHH A;  2A6H C;  4CJ1 B;  2CW0 D;  3HOZ B;  1A2T A;  1LTS D;  1L0X B;  2FMC A;  2EOT A;  3IFT A;  1BR9 A;  1SYE A;  4LAA A;  1B9N A;  1MSH A;  5EPJ A;  1EY9 A;  2LMC B;  3HZX A;  1Q3L A;  3GTQ B;  2EYO A;  1XWE A;  1TWC B;  1F2M A;  1SJH D;  1QOH A;  2L11 A;  4XQN A;  1S5B D;  1RJT A;  1EYC A;  2KOL A;  1EYD A;  4OL7 A;  3BYT B;  1SNC A;  2M00 A;  3A8I E;  4FP5 D;  2EYJ A;  4ZAI A;  2MHV A;  3V05 A;  3WOE A;  2EJG C;  3DEP A;  2O2L D;  1TY0 A;  1H9J A;  3I70 A;  1MSG A;  1QWY A;  5EBC A;  4RGM A;  1VF5 C;  2Q8I B;  2HDM A;  4H13 C;  2A69 D;  4ZRZ A;  2MPM A;  4HSV A;  3GTO B;  1LTB D;  5ELB A;  3U9S A;  2A6E C;  3FRP B;  5J22 A;  1CZG A;  3QOJ A;  3JAM E;  2PW5 A;  2EY6 A;  3NE5 B;  2N88 A;  4KV6 A;  5G3L D;  3D8G A;  5DNF A;  3ERO A;  4OO1 G;  1EY6 A;  5D65 A;  1BUV T;  4J6H A;  4XYO A;  2PMZ B;  2XRS D;  1LT6 D;  2D9U A;  1S5C D;  3R2I A;  2RA4 A;  3K5M A;  1JR0 D;  3OOC A;  2R3Z A;  4EQO A;  1ILP A;  1RHP A;  4QB4 A;  4X3S A;  4DGZ A;  1SSO A;  1MD2 D;  2SEB D;  2L9H A;  4FNF A;  1T5X D;  1Y8O B;  2A5H A;  2IPK D;  3OSO A;  1PLF A;  4KKU A;  4DNT B;  4C3J G;  1U4L A;  4F7X A;  1II3 A;  1CZW A;  1NSN S;  5CBA E;  1EOT A;  1SYD A;  1D1I A;  2EY5 A;  1SYB A;  2L4N A;  1Y69 U;  2EYP A;  1ILQ A;  3X3M A;  5EBD A;  2K28 A;  2XNA C;  2AQ1 B;  4N9P A;  4LK1 C;  2E76 C;  1GUO A;  2H1E A;  5D14 A;  4K5V A;  2R7Z B;  3MZ5 A;  2WII B;  2R93 B;  3VR3 A;  3NWT A;  3PO2 B;  5K36 H;  3BVZ A;  1CFM A;  1JB3 A;  2R6G A;  4IUR A;  3EA6 A;  3T16 A;  4MHE A;  1KNA A;  3X3N A;  5IT9 E;  3SVM A;  2EYM A;  1PRT F;  4KMU C;  3MXN A;  1GUT A;  4QUF A;  2VB2 X;  1D1K A;  1GUN A;  2X6G A;  4G7O C;  2F03 A;  1ESF A;  1KDC A;  4WJW A;  1PFB A;  4FO2 A;  1CI3 M;  3TDQ A;  4NW2 A;  4NDX A;  1I50 B;  2BA0 A;  1ZEQ X;  2IL8 A;  2LS0 1;  2E2D C;  5G3L F;  3ZYY X;  3SK5 A;  2I07 B;  3MAQ A;  3OW7 A;  3BDO A;  4A93 B;  1ZYR C;  1HFN A;  1LLR D;  4ZYS A;  3GTG B;  3K5N A;  2SNS A;  3PV0 A;  4G4K A;  2Z4H A;  4RCO A;  1F2Z A;  1DOM A;  3ND9 A;  1BF4 A;  5EKK A;  3NPP A;  4EVO A;  2J7Z A;  4DNR B;  4EGV A;  2BA1 A;  4C2M B;  2F0E A;  3TP8 A;  2ID0 A;  4DAP A;  3KLR A;  4KY7 A;  5CV5 A;  2TMP A;  2E74 C;  3HOU B;  2PZT A;  2RDH A;  5C5L A;  2B2U C;  1HXY D;  2Q8R E;  5C4H A;  3SK6 A;  1HRJ A;  2RSN A;  4HAE A;  1HQR D;  3TZU A;  4K8J A;  1BDO A;  3EQL C;  1W6J A;  2CVR A;  4FXK C;  3HRZ C;  1F2L A;  4RAU C;  1GHJ A;  1YNJ D;  4DU9 A;  4IFD G;  2KVM A;  1I3Q B;  3R93 A;  4KHZ A;  1E2W A;  4RHS A;  1RD9 D;  3T56 B;  1IYU A;  2EY1 A;  3OMC A;  2M2L A;  2OF1 A;  3A7L A;  1STB A;  1TVX A;  1D6E C;  1ENC A;  2KA7 A;  3RLF A;  4V19 0;  2DNC A;  4RGN A;  5KYI A;  5BN3 A;  3SDZ A;  5T1G A;  4UAI A;  3DEO A;  3EFX D;  3K5L A;  1VCI A;  4J8Q A;  2WKD A;  1SJE D;  1M8A A;  3QOL A;  2NN6 I;  2CW0 C;  1NUC A;  1AN8 A;  2O5J C;  4K2K A;  1G91 A;  4CHT B;  3Q23 A;  4B9X A;  1TKW B;  3VYS A;  3BVG A;  2FMM A;  3WDN A;  2NVQ B;  1HPC A;  1QCB D;  2IWH A;  2WAQ B;  4KKT A;  5M5Y B;  2V4D A;  1AZP A;  3HP3 A;  3CRK C;  1TY2 A;  4OO1 I;  5JAV A;  4FF4 A;  4IFD J;  3URY A;  3DWA A;  4R8I A;  5C5M A;  1S5D D;  3QO2 A;  4M8A A;  2NBF A;  4F87 A;  4IQZ A;  3C46 A;  3TZD A;  2B2T C;  4A3F B;  1KAA A;  4RHR A;  1ROD A;  3K59 A;  1TII D;  3ERQ A;  1G2T A;  1CHQ D;  4RH6 A;  1DON A;  2Z4I A;  4BY7 B;  3MA2 B;  2K01 A;  2A68 D;  3R2T A;  1PTO H;  2B2Y A;  4OHJ A;  5JPN C;  1H9S A;  4KHV A;  4P2C B;  3FEW X;  3RUZ A;  3T4A C;  5JEA G;  1J9O A;  1V1O A;  1HA6 A;  4ZKB B;  1KDA A;  4V0B A;  4IFD I;  3NSW A;  4ZKC B;  2D2C C;  4XIG S;  4ID6 A;  3P1H A;  2F0T A;  1E2V A;  5C3E B;  2IX0 A;  3MXG A;  4Y7N B;  1STN A;  3S15 B;  3IAY A;  1Y8P B;  1B1Z A;  1EY5 A;  4E6I A;  1AEX A;  1F9P A;  1O7Z A;  3Q22 A;  1I6H B;  1ET9 A;  2BCO A;  1HTL D;  4HN7 A;  1BNZ A;  1NCV A;  1RF2 D;  2QDB A;  1EIH A;  2PQE A;  2I46 A;  3MXU A;  3SK4 A;  1LT5 D;  1DOK A;  5FK9 C;  5BN5 A;  5DAU A;  3ND8 A;  2A6H D;  5M9O A;  5EJW A;  5IGB A;  3M7G A;  5C0X I;  4XT1 B;  3GTM B;  1Q90 A;  2K1B A;  3SHL A;  2JA5 B;  3S14 B;  3KK7 A;  1HTP A;  1EEI D;  4CJ2 C;  2AUJ D;  1OXT A;  5KRU A;  2F0D A;  3I8Z A;  1CQV A;  3CRL C;  3A54 A;  2ICI A;  1BO0 A;  5KGU A;  4C3H B;  4ZUI A;  3TP7 A;  4IN3 A;  5J39 A;  4TQU S;  1LT4 D;  1SEB D;  2KJX A;  1VMP A;  3E5S A;  2O5I C;  3A56 A;  2PCF B;  3AB9 A;  3QB3 A;  1WTR A;  1JOO A;  1B9M A;  3RZO B;  2MJ8 A;  4I65 A;  4J1M A;  3HG9 A;  3Q24 A;  2F0I A;  1TWH B;  1BXT A;  2IX1 A;  1EWC A;  1CA6 A;  3PUW A;  1FNW A;  1EIG A;  3G6J B;  3TME A;  1ONL A;  2DY8 A;  5FO8 B;  1FD7 D;  4F88 A;  2WKC A;  4CBV A;  3S16 B;  2L12 A;  1DYQ A;  5JOB A;  4L8J A;  5IGD A;  1SNQ A;  4X3U A;  1SE3 A;  1S4Z A;  2K05 A;  3NXW A;  5F2D A;  2BDN A;  1SNP A;  1X32 A;  3NP8 A;  3E6Z X;  4AYB B;  5C4Z A;  1LTA D;  2NN6 H;  2XIW A;  3GV6 A;  2K5D A;  3NQI A;  2K03 A;  2KCC A;  2BDO A;  1YNN C;  3GTJ B;  5FO7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...