2F0VA

Crystal structure of staphylococcal nuclease mutant v23l/v66l/i72l
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0vA00
2EY6A 5J39A 1EY0A 2SOBA 4MIUA 1SYCA 4QF4A 1STNA 4PNYA 5CV7A 5C4ZA 5J22A 4KHVA 3T13A 3C1FA 5NUCA 5C5MA 4PMBA 4QB4A 5KYIA 1JOQA 2EYPA 2EYLA 1NSNS 3NHHA 3SXHA 2F0EA 4DU9A 5IGGA 4NDXA 1A2UA 4B9WA 4B9XA 5KRUA 4K14A 2F0UA 4IUNA 2F0PA 3VA5A 2F0VA 4K2KA 1KDCA 5C6AA 1KAAA 1KDBA 1JOOA 3T16A 3PMFA 4TRDA 5KEEA 5M9OA 4F8MA 2KHSA 4KJOA 4KY6A 5E1FA 5CV8A 4KD3A 3TMEA 3C1EA 2M00A 1EY9A 1SNDA 2NUCA 1EY8A 4ZQ3A 5KIXA 2F0OA 2F0HA 4H7BA 3QOLA 2PZWA 3D4WA 5IGBA 2F0QA 2EXZA 4S3SA 2F0GA 5KGUA 1EYCA 3DMUA 2F3VA 3HZXA 3P75A 5F2DA 3D4DA 5EKKA 4K8IA 5IIFA 5DEHA 2QDBA 4DGZA 5IGEA 4PMCA 3HEJA 3ITPA 1F2YA 4K5WA 5J1ZA 3OMCA 5CV4A 5EGTA 4E6IA 2PQEA 3LX0A 5IGFA 2F0SA 1SNOA 3D8GA 4K6DA 3SHLA 5EKLA 5IGCA 3TP7A 4K8JA 1SNMA 4HMJA 4K5XA 5E3FA 4DF7A 3R3OA 2EY1A 5CR3A 3QOJA 3BDLA 5CV5A 2HQEA 2PZTA 1JORA 2EY2A 2F0NA 1STHA 3EROA 3NP8A 4ID6A 3MXPA 4WRDA 4ZUJA 5IODA 4HMIA 5CGKA 5JAVA 1STBA 4YIJA 4ZUIA 1U9RA 1SYBA 3MZ5A 2EYHA 1TR5A 3EVQA 2F0MA 1EZ8A 1SNPA 3MEHA 4K2LA 2RKSA 1EY6A 2PW7A 1KABA 4NKLA 5CV9A 4DFAA 2PW5A 4ME5A 3SR1A 5I9PA 4R8NA 3TP8A 5C3WA 2EYJA 2F0TA 1SYEA 1EZ6A 2OXPA 2EYFA 2F0LA 3NXWA 5IOCA 4KY7A 1EY5A 1A3VA 4N9PA 4J1MA 5CC4A 4N9TA 5I6YA 1II3A 4K5VA 1AEXA 2O4XA 3BDCA 3H6MA 4LAAA 4QMGA 2LKVA 5K5PA 3ERQA 5IGDA 1ENCA 1SNCA 3TP5A 1EY7A 2F3WA 1STYA 3NUCA 3QB3A 1A2TA 2OF1A 4NMZA 1STAA 2F0DA 4EVOA 5C3XA 2OEOA 1SYDA 3OWFA 4WORA 5I6WA 1KDAA 1F2ZA 2WACA 1TT2A 5KYLA 1SYFA 2ENBA 3V2TA 5C5LA 3NK9A 4ODGA 1IHZA 4EQOA 5C4HA 4IZ8A 3E5SA 4KY5A 3MHBA 3NQTA 2EYOA 2RBMA 2RDFA 2PZUA 1NUCA 3EJIA 1EYDA 1A3TA 1EYAA 3MVVA 4G57A 4KJNA 2F0FA 2SNMA 5DAUA 4EQNA 5HGTA 1SNQA 2PYKA 4RKLA 1SYGA 1JOKA 4IALA 4KTAA 5I9OA 4KD4A 1A3UA 2SNSA 3SK4A 2F0WA 2EYMA 3U9OA 3S9WA 4KV6A 3OSOA 1ENAA 4EQPA 5ISRA 3TP6A 1EQVA 1EY4A 2KQ3A 1F2MA 1STGA 3OMGA 3RUZA 3SK5A 3DHQA 4J6HA 1RKNA 2F0KA 4HTHA 4NP5A 1TQOA 5JOBA 4F7XA 3P1HA 5HURA 4I65A 2F0IA 4RKBA 3SK6A 3D6CA 2EY5A 5CV6A 3SK8A 4OL7A 2F0JA
chains in the Genus database with same CATH superfamily
4DAYA 3L3OC 3UDGA 2F3IA 2TSSA 3I4OA 4DV5L 5CV7A 3TBIB 1BXTA 2NWGA 1RDPD 2KHJA 2QILA 2EYLA 4X3SA 2IT1A 3DWAA 2BDNA 3AFPA 1GUGA 1SEBD 2B63H 1CKNA 3T1YQ 2Q2HA 3BVGA 1RCVD 2E2HB 5BR8L 1X3EA 3FP9A 1UEBA 4P75A 4BY7G 3TZUA 2R7FA 1B3QA 3NTHA 4ZQ3A 2KCNA 1M90C 4KI0A 2B2VA 3D6WA 2K01A 2F0GA 3T56B 1E1TA 4DR7L 5KNDA 5EKKA 4A3EB 2RSOA 5I2XA 4A3DH 2MO0A 2J4XA 2R7DA 2A8VA 3EQLC 2MJ8A 4O42A 2YV5A 4PZ7A 2KECA 2A68C 1XTCD 1AP0A 1IYUA 2IX1A 3FKIG 2Z6KA 4C3JH 3K6OA 3J80L 3G4SA 1EOTA 1H9MA 1T5XD 2EJFC 3R2IA 1HPCA 2JA5H 2A68D 2OCEA 4EX5A 2RKSA 5BN4A 2Z6BA 2RF4A 4BY7B 5C3WA 3NXWA 2CH4W 2D0PA 1B70B 4LF6L 3NE5B 1II3A 4B3TQ 2O4XA 2B8GA 1LTAD 1QILA 1X3GA 4KKTA 2WV6D 3J81L 2DY7A 1VQEA 4G7OC 3HOYH 4QY7A 3QB3A 4NMZA 3UE0A 1PZJD 1PFNA 1ET9A 1RF2D 5D65A 1ILPA 3FKIB 3L0OA 1EEFD 1Q86C 1VQIA 1TIID 2EOTA 3EJIA 2YTXA 5DAUA 2NVYB 4X3TA 3J80E 4QCLA 3KLWA 4XT1B 2YYZA 2ATWA 3KF6A 3J80c 2JA6H 2AKWB 2GA4B 3HRZC 4JI2Q 1I4PA 4MTKA 5JPNC 3QG1A 3QWNA 4IFDJ 1SLJA 4IPDA 2JA8H 1CQFA 2R93G 1D8LA 2I5MX 3KJPA 4HEDA 1VQ4A 1K8MA 1VMPA 4UP8A 3URYA 2ZJPA 1CM9A 2K28A 4BS9A 1ICWA 1I4HA 3J81E 1TWGB 2X6LA 3J81c 4XXEA 2O5JC 1G6PA 2E74C 2B2YA 2L5TA 4A3GG 1GUTA 4DN4M 3S17B 1KDBA 2F4VL 1JOOA 2VB3X 2PI2E 5M9OA 1A63A 2OQKA 3MXNB 3PF4A 4A4IA 2BCOA 2M00A 1PH2A 1SNDA 2R93B 4DR3Q 2UUBQ 4OO1G 1MIUA 2XWBB 1ESRA 1EEID 5F2DA 2C35B 2QDBA 4MN3A 4DGZA 3T53B 3HOZG 3CMAA 1HNXL 5EGTA 3F2DA 2F0SA 2VUMH 1LUZA 3FVQA 3H3VC 4HMJA 1RL2A 4A3GB 1H95A 4JI7L 3KYHC 4LF7Q 2KVMA 3K7AB 1PH6A 4QJFA 4RAUC 4DA2A 2NYZD 3FPUB 4ZUIA 1YHBA 1BKBA 1LT4D 3DXJC 3OYYA 2PW7A 2PW5A 4ZYSA 3I73A 1CKMA 3PIOA 3RMHA 4LF9L 1YJWA 3PO3G 1JB3A 4JV5Q 1NMGA 3GV3A 4DKAC 2A69C 1PDQA 1I6HH 2G5DA 3GTOB 1X56A 1Y14B 3HOZB 4RWSC 1QB5D 1OXTA 1ICFB 4LF8L 4IPCA 4R4QA 4BY7H 2OEOA 4B3RL 3CKIB 2RHQB 5KYLA 3FPPA 1SE3A 5LMNW 5JJLA 4IZ8A 4WRDA 4OO1I 5J39A 4LMQD 2HUGA 2Z0SA 4EQNA 4Y7NH 2F0FA 1BVSA 1A15A 2DY8A 3VYSA 4AIMA 4LFAQ 2IX3A 3S9WA 3TREA 3UI2A 2UUCQ 3PUVA 4AQYL 4A3LG 1K83B 4FDBA 5GAGC 1TQOA 1B3AA 4FVMA 2VNUD 3D6CA 5FJ8G 4X6AH 4GKKL 4CJ1B 5K36H 2BDOA 3MA2B 2EY6A 3K8AA 3KBXA 1BNZA 1HXYD 3C1FA 4IPGA 3VR3A 1N36Q 4JCVE 1FJGQ 5C44G 2JA9A 3NHHA 4UP9A 1LTTD 4P74A 3OPOA 1FL0A 1TY2A 3E0EA 1X3FA 4YCUA 4LFCL 4B3ML 2ASBA 1UEAB 4JYAQ 2J7ZA 3S1QB 2F0VA 3C2PA 1SAPA 1EQRA 2B2TA 4X3UA 1TWGH 2ZTCA 1GUWA 1D7QA 3TMEA 1SE4A 2GN5A 2VL6A 4XQNA 1EY8A 1DXMA 2EXZA 3AU7A 3ONAB 3OIPA 3CU7A 2A6ED 1HA6A 2D62A 5G3LF 4GZYC 4IURA 2JP1A 4K5WA 4BBRH 1J8IA 1K8GA 1EIYB 4CDCC 1H9RA 4JI3Q 5C44B 3JC66 3IAYA 4RGOS 2R93H 1PRTF 1STHA 3MXPA 2DUDA 4DR6Q 4WJWA 2RVLA 4CBVA 4NKLA 1E2ZA 5I4DA 3H09A 1JB7A 4FF4A 5EAYA 4NW2A 2E5LL 1OO9B 3IFTA 2FJ2A 3E9HA 4DR4Q 1ASZA 4ALPA 4A3GH 2L1BA 2RCNA 4DV4L 2HHHL 1SRUA 2B2VC 4LWCA 1KXLA 1C0AA 4Q0FA 4HJ7A 4TSSA 4FF3A 1QUQA 3Q8DA 2JSOA 1AFPA 4EVOA 4UY8C 1M4VA 2E8GA 2KEDA 1KDAA 4BY1G 1YEZA 1E22A 2RDHA 2I5HA 1B53A 4OO1H 1JJGA 3E5SA 5BN3A 2K5NA 1JCKB 1B9MA 5IYDG 1SXTA 5HGTA 3MXGA 3RD4A 2I46A 3T1YL 1HFGA 3I90A 1HQRD 5GAHC 4C1NI 4HCEA 1Q46A 4EQPA 1NCVA 5CMDA 1Y1WG 1Q90A 2QW7A 4O1NA 4ZAIA 4F7XA 4DNRB 3Q0AA 1AN8A 1HJPA 5FK9C 3PCOB 1D6EC 3I55A 1Z9FA 4H44C 2E2JB 1YNNC 4ZCKA 4GNXC 1SYCA 4PNYA 4L8JA 2CWPA 1PFBA 4BY1B 3NELA 4JI6Q 3PO3H 1QVCA 4G7HC 1RTOA 4NDXA 1S5CD 2TMPA 2F0PA 3MTSA 5M5XB 1B50A 4K2KA 2ZT9C 3A0JA 4JI8Q 3BG3A 1Y1WB 4XTCS 4PG3A 3TQYA 4KJOA 3HFZB 1DCZA 2KHIA 5H1SE 4H7BA 3DEPA 1HHVA 1I50B 4NXNQ 1EL0A 3HOVG 1X55A 1UE6A 4R4OA 3G71A 1QNKA 2F03A 1FR3A 4CDEC 1PH1A 1TWAB 4A3LH 1AH9A 2JE6I 1C9OA 5DNFA 4GLVB 2Q8TA 3D4RA 1I6VC 2B2WC 2HQEA 3RR5A 5FJ8H 5D3DA 4A3MH 1HNZQ 2ZTEA 2B2YC 2VZAA 1STBA 1VCIA 4YIJA 5J3BA 2K1BA 3J80i 4EGVA 5IP7H 5JEAH 3SR1A 2NVXB 4JI2L 4IUUA 2OQ0A 1EU4A 4YHHQ 1MJCA 3ERSX 5I6YA 1Z47A 2MHVA 3DM1A 4CDFC 3HOVB 3VYUA 1DD2A 1FGUA 3GQBA 5C4XG 1NAPA 2G9HD 2BH8A 1G6ZA 1K9MC 3GD7A 2D0OA 3KFUA 4YWKA 3I4MG 4R1JA 2B39A 4XQQA 4WORA 2DJFC 3J81i 3LNNA 1G2SA 1RHPA 1E24A 5GAEC 1VQCA 1IHZA 4MIUA 1KNAA 2CWAA 1ILQA 4KJNA 4RKLA 4JC0A 1B8AA 4XT3B 1GKHA 1EFID 2EJMA 2FXQA 2UU9Q 1PLFA 4OWTB 1STGA 4PZ6A 4LNQA 5C0XI 5JOBA 3HGBA 1YJ9A 3BDOA 4DUYL 4DR3L 2UUBL 1SMXA 5C4XB 5IP9G 3BU2A 3I4MB 3RZOH 1STNA 1SE2A 3OW2A 3GTQB 3I8ZA 3RLOA 2V4DA 5KYIA 2OTJA 2WB1E 4A75A 5EJWA 4N8X1 1A2UA 2MO1A 4FXGC 5LMNL 4DR5L 1KIXA 2E2JH 4KN4C 1UE1A 3B6YA 2K14A 5FO8B 4BY1H 3RN5A 4HN7A 4HIDA 2N3SA 1Q82C 1E1OA 1I4RA 2PZWA 1LTBD 2AMCB 4S3SA 4J8QA 5M5WH 4A3FG 1TS2A 3RN2A 3D4DA 2NVTB 1A6XA 1FVIA 3SEBA 1NBWA 1E3PA 4DV1Q 1TWHB 2JXMB 2D5DA 5GADC 3PIP3 4JI0Q 1J5EQ 1Q1BA 1SNMA 3CCRA 1WFQA 2CW0C 3HS0C 3JAML 1YI2A 1SFOB 4R8IA 4L63B 3NPPA 4NXMQ 1I50H 5ELOA 1DZ1A 3WWVA 1CKOA 3QIAA 3CF5A 5M5YB 4XYQA 4DFAA 1HZAA 3CCMA 4LFAL 4KHPQ 1JWMD 2B2TC 5IOCA 2F0LA 4L6TB 4QIWE 3S14B 3QO2A 2UUCL 4A3FB 1BDOA 5LL6X 3L7ZC 1XPRA 3GTMB 2KCCA 3TP5A 1VQMA 1K8OA 2JA7G 4IO9A 2D9UA 2N78A 4JI1Q 1WTWA 2NVXH 1E2VA 1F2ZA 1N36L 3JAME 1FJGL 2RBMA 2AWNA 3JAMc 3OW7A 1EQTA 3N6RA 2DNEA 5LL6S 1PHJA 3IFDA 4JYAL 3BYTB 4IUVA 1BCPC 4AH6A 3A54A 1EQVA 4LUZA 1KC8C 1TWCH 4FO2A 2QA4A 3M7GA 3X3MA 1K8AC 2JJQA 2Q8IB 2JA7B 1BCPD 1HZCA 1LO5D 4L5QA 3MFGA 3L2PA 5C5MA 1VDZA 3ND9A 4FNFA 4DU9A 3NSWA 1NJIC 3S2HB 2BE5C 5COYA 5EPJA 4YWMA 2WAQE 5C4XH 5M3MH 4DR6L 3GTKB 3I4MH 3HOWB 1F2LA 1B9NA 3STBD 2A74C 1B2TA 4TVAB 5JVG3 4KD3A 5FLMG 3BVMA 2NUCA 2F0OA 2F0HA 3M4QA 4A3EG 2IHEA 5GQOA 2PO4A 1DYQA 4GOPB 4C1NK 1GM5A 1VQPA 3ZYYX 3F2BA 2O2LD 3OMCA 3SDZA 2PQEA 1X54A 1TS4A 5EPKA 5IGCA 4A93G 1IBMQ 3R3OA 1VQ8A 1Q3LA 3QOJA 1X9NA 2PZTA 1QNUA 5E7NA 5IP9H 4HJAA 2NVTH 4RGTA 1O7YA 1CSQA 1U9RA 4L5RC 4KMUC 1HFNA 4OWWB 5I9PA 2JQOA 1WTQA 1Z7TA 2EYJA 2QEXA 1EZ6A 3SVMA 4IJLA 3A8KE 2AUJD 4IJHA 1SFOH 2MGSA 4HJ9A 1B7YB 1F9SA 4G7ZC 4F87A 3GTPH 3I70A 1W2BA 1A2TA 4A93B 1H9SB 1SYDA 2KOLA 1OXVA 2R7ZG 3S14H 1BR9A 1VS0A 4JI6L 3OTOL 5FO7B 3NQTA 1WD1A 4A3FH 4LFBQ 1PTOB 1EYDA 1VQHA 1WYDA 1IW7C 1K73C 2PYKA 1B44D 2XIWA 1JQYD 3A55A 4JPBW 4HSVA 4LJZC 5ISRA 4DAPA 4GNXA 1IW7D 2QCPX 3TDQA 3P1HA 1RIPA 4A3IH 5CV6A 3J7AV 2XRQD 4LK1C 1KRTA 3TRZA 5IT9L 2QGQA 1STEA 1PH5A 2R7ZB 2JN4A 2UXDQ 4DR2L 1C4QA 3U4VA 1JE5A 2KENA 3J7A5 4IFDH 3HKZG 2F0EA 4JW0A 1S4ZA 1CUKA 4B9XA 2JA7H 3MWYW 1OXUA 4IUNA 4HIKA 1YHQA 3PGZA 1HNZL 1OTCA 3RNUA 4GKJL 1KAAA 3I56A 3T16A 3TEHB 3K59A 1QVGA 1R4PB 5JJZA 5CV8A 2ZJRA 3I7FA 2LFNA 2GVAA 3Q22A 1K3RA 1PFMA 1X3QA 3M4YA 2WB1G 3S2HH 3K57A 1BBUA 1SMYD 4DK3C 1IZ6A 1F9RA 1CKNB 4YHHL 3I4LA 3KDFA 5LMUQ 2OTLA 5IGEA 2B2WA 4QUCA 4X65Q 5IT9E 3GTKH 4U673 3F8TA 2VQFQ 4L5SA 5HY6A 3SHLA 5IT9c 5AJ3Q 2HT1A 1FNWA 4IPHA 1DM0B 4BBSG 3HKZB 1WTOA 5EKIA 4HJ5A 3CCLA 3M7NA 2IJ0A 4A76A 2F0NA 3EA6A 2QF7A 4AYBE 3NENA 4CKBA 4RGMA 4LF4Q 2IPKD 4RFBA 3P7JA 1VQOA 1VQKA 2RHSB 2HQLA 2EVBA 2OXPA 1LM0A 3VA7A 2HIVA 3AB9A 3D31A 4B3SQ 2WB1B 2E2HH 3HG9A 2UU9L 3SE0A 4IQZA 4LAAA 3U50C 3E6ZX 3CQZB 4C56C 2K33A 4M1UB 2AQ3B 3PUYA 1V1OA 4BBSB 4KK7A 2B3GA 4A3EH 3MHBA 1QE6A 1JWUD 2ZJQA 1N9WA 1F77A 3BZKA 4KTAA 3G6JB 4DPGA 5IYCG 2FINB 4A93H 4GLXA 2F0KA 1D5XC 4K0KQ 3SK6A 1PTOH 3A8IE 2JEAI 3KLRA 3VR5A 1TS3A 3AFQA 2VXWA 3NBIA 1O7ZA 2E75C 3KF6B 4ABNA 4TQUS 4DV1L 3BZDB 1VQ7A 2RDGA 2QEJC 4XYOA 2N8NA 5T1IA 2EZVA 2IHFA 3D0FA 3KF8A 4JI0L 2L11A 3PO2G 1XMQL 2IW3A 5IGGA 3NWSA 3Q23A 5C4JB 3CC2A 4R9WA 4NXML 3FKIH 1G91A 3ULJA 2R7ZH 2L15A 2NTSA 4HR7B 3CXCA 3W2DA 2NVYH 1T5EA 1JJ2A 1Y8PB 4KHPL 3PSIA 2XSCA 2H4OA 4OX9L 4ZKCB 3NBHB 3VYTA 1EIFA 2FMCA 3HEJA 2WAQG 3ITPA 4UHVA 4V190 3G7LA 4A3JG 1SNOA 3D8GA 5EKLA 4JI1L 4K8JA 4FYDA 3PO2B 2K5HA 2PMZE 1ONLA 2XGTA 4JBWA 3ND8A 1PTOC 4H0LC 1IBLQ 3NP8A 3OWEB 3JAMi 1DONA 2A6EC 4DV7Q 4DUZQ 1EY6A 3T4AC 5EQ0A 4X64L 1MJEA 1I94Q 4Y52H 1PTOD 3EFXD 4M8AA 3D3RA 1GJXA 3S17H 4GN5A 3H6MA 5IY0A 2WAQB 1FNVA 1HZ9A 3OOCA 3VR2A 1IXRA 4P73A 3IKJA 2WKDA 4A3JB 5T1GA 1D1KA 5I6WA 1Q8KA 3MEFA 3PQIA 1L1OB 1GUNA 4EQOA 2AUKA 2LY7A 5IWAQ 4LF5Q 3RLNA 3CQZH 1XNQL 1A8VA 1BUVT 3GTGB 2Z9HA 1I4GA 3U9OA 1NR4A 1GHJA 1PRTB 3K7AH 4KHZA 2YU9B 4FF1A 3V05A 2H1EA 1O7IA 1V9PA 1HZBA 4P71A 1EY0A 1CHPD 2SOBA 3CW2C 3FEWX 5JJIA 2Q2IA 1NR2A 3GTOH 2R6GA 2RSNA 2CHBD 3O13A 1NSNS 1JMCA 3HOZH 2PNRC 2B29A 3S1RB 3HOUG 4B9WA 1I4XA 2AQ2B 5KRUA 4RA8A 3NTKA 3CRKC 1PZKD 3VYRA 4K6LA 3A7LA 2K5DA 5FKAC 1L2FA 1XPOA 1E0BA 1DOMA 2Q2TA 3OHXC 1HNWQ 1CFMA 5C4JH 5IYCH 1K83H 3EBEA 3ULPA 3DWPA 1EWIA 3FDTA 1YZ6A 5A35A 3AQQA 1ZKOA 3J7YW 3HOUB 1EWHA 4C3HG 3K58A 3J81j 5ELFA 1BCPF 4K2LA 2ZM6Q 3S15B 1MKHA 2CVRA 3GTLB 4ME5A 2MP1A 5HGQA 1U0LA 4R8NA 3K5NA 2M9VA 1EY5A 3MFYA 4B3TL 3PO2H 3L9AX 3S1QH 3CC7A 3Q6SA 4K5VA 2V1CC 3KOJA 4DR1Q 3VR4A 2EXDA 3J7AF 4N8FA 4AYBG 5M3FG 5C0XG 4KLKA 1ENFA 2F0DA 4X66Q 1D2BA 5C5LA 4OIKA 2JK8A 2RDFA 4C3HB 4X62Q 4V0BA 3GTJB 4HCSA 3WOEA 5C44H 1AE2A 1R9TB 2N88A 3E0JA 1BO0A 1QUQB 3HKSA 1ZYRC 3UDXA 1LACA 4A3JH 2UUAQ 1N33Q 1PVOA 2KQ3A 2WP8J 1RKNA 2NZ1D 4B08A 1BBXC 2F0IA 1XWEA 1ZYRD 3N52A 3OWFA 4G4KA 3J7ZC 1QCBD 1Z6HA 4AYBB 5M3FB 4YWLA 4PMWA 1LYLA 3GTGH 5LMUL 2P5ZX 3UE1A 4ZLTF 4X65L 4U68A 1CSPA 2HDMA 5CORA 1QWYA 5AJ3L 2KA7A 1GO3E 2K32A 5CYUA 3U9SA 3K5MA 3X3NA 3GV6A 2F0UA 1KNEA 1J9OA 1JE4A 5IYBG 3RZDB 2F4IA 1S5BD 3EIVA 1NMFA 4R4IA 4LF4L 3E3XA 1LTSD 1X6OA 1TWFB 3C1EA 1EY9A 2VW9A 3IL8A 1KQSA 1C8CA 4B3SL 3KK7A 1HCZA 1JR0D 2NBFA 4K8IA 2QKIC 2LXJA 2KCTA 1WOCA 1V1PA 5J1ZA 1AW7A 3T1HQ 2K05A 3M4OB 1WVLA 1M1KC 3VDYA 4LF7L 4JBKA 2QDLA 3K81C 5CV5A 2XRSD 1SSOA 2NVQB 2K03A 1IL2A 2PQAA 2VB2X 1KTKA 5CGKA 1N32Q 3ZJYC 4NB3A 1TR5A 3WOFA 1KABA 5G3LD 1YHAA 2NB0A 5IYDH 1MSHA 1SYEA 4JV5L 4P72A 5M5XH 1VQFA 3H94A 4DNIA 4N9PA 3C46A 2J0TD 1X3PA 1PRTD 3FHWA 5DM73 1Y1WH 2EIFA 3IRBA 2X6GA 3S15H 4HIOA 5DM63 2DN8A 2IX0A 2OF1A 5C3XA 2ALYB 4C2MB 3TN2A 2ZXPA 3ICEA 1W6JA 1AZQA 2JYOA 1TWAH 1JOKA 4IALA 5I9OA 1SDFA 1VQGA 4FXKC 4KD4A 1BQQT 2N55A 1B4OA 1A62A 3VR6A 1F2MA 4UAIA 4X3KA 2PMZB 4AQYQ 2D2CC 3HOYG 2SDFA 4C3HH 4ULLA 4DV0Q 3SK8A 1HQMC 4DK0A 4EQ5A 4GKKQ 1R9TH 5FO9B 2I5LX 1Q12A 1OXSC 5EPLA 1NTGA 5JJKA 5JVH3 3HOVH 1K28A 2EYPA 1LT6D 3ER0A 3MC0B 3R93A 2A5HA 1S72A 2VQEQ 3K5LA 1L0YB 1DJRD 3S2DB 1KRSA 2Z4IA 3HOWG 4KN7C 3VA5A 5M3FH 5C0XH 3PF5A 1IBLL 1KDCA 2JA8G 1XPUA 4DV7L 4QUFA 4GLAC 5C0XJ 4DUZL 2DJGC 1I94L 2O5IC 3HOYB 1H9SA 1RJTA 3CCSA 1VQ5A 2F3VA 1XJVA 2ZXOA 1U4MA 1OXXK 2B8FA 4BA1I 5IIFA 2RCFA 4JI3L 2CH4A 5E4XA 4CDDC 3RZDH 2MPMA 2Z8LA 1VQAA 3STBC 1ESFA 4K6DA 4DF7A 1MI2A 4QL5A 1PYWD 5CR3A 3BVZA 4DAMA 2SEBD 3GTQH 3P20A 3CCJA 2JA8B 1PA6A 4LF5L 2EPBA 1SNPA 3A7AB 4DK1A 3M4OH 4DR4L 2L9HA 2KCMA 2B2UA 1PXUA 5FLXL 4A3BG 2BOSA 1M8AA 4JOIC 1X65A 2I0QA 2NVQH 1HTPA 1YBYA 4JI4Q 1SNCA 4GS3A 1UWVA 4Q5VA 3H3VI 1NNXA 1CZGA 4CHTB 3UDIA 1HR0Q 4RHSA 4XIGS 2HCCA 1TT2A 1IYJB 2R92G 5C4HA 2K4KA 4KY5A 2PZUA 3W1GA 1TWHH 3NTIA 2MNAA 3KJOA 3BYYB 1SYGA 3NQIA 5GROA 1G291 3BZCA 5A2QL 2EYMA 1YIJA 1UUPA 1Y8OB 4C2MH 4LUOA 4A3BB 3DHQA 3C3LA 5FLXE 4I65A 2X69A 2VUMB 5M5YH 5FLXc 3PIPA 4BA2I 4A3CG 2F0JA 3U4ZA 3PIO3 3AMUA 1W6KA 1HNWL 1PFSA 1I4QA 4ILWA 1HR0W 3MXNA 4QQBX 5NUCA 4HSPA 4WFN3 2R92B 4QB4A 1PTOF 3I72A 1XMOQ 1JOQA 3GTMH 1NY4A 3M9BA 4MTNA 3A5ZB 1LT3D 2DNCA 3CC4A 1GOZA 2F52A 3H15A 4FXDA 5IE8A 2MQHA 4JI8L 1FGBD 1B1ZA 1I6HB 2E2DC 5A2QE 1K3BC 4RH6A 4XDXA 2LS01 4F8MA 2ZM6L 5E1FA 5K36G 1VF7A 1I3QB 2AHOB 4JI5Q 3QOLA 2F0QA 4NXNL 1O80A 1EYCA 2EQSA 3DMUA 3S2DH 3SGIA 3TZDA 4DR1L 1SR3A 2FHTA 4Y7NB 5CV4A 5TSSA 4E6IA 1IBKQ 5IGFA 1CI3M 2C5CA 3TP7A 2AQ1B 2L12A 4YCWA 5E3FA 5LHY1 2EY1A 4X66L 1J6QA 2Y0SE 4DAYB 1G8ZD 1UAPA 2EY2A 1SMYC 1VQDA 1KLGD 2I07B 1TKWB 2AWOA 4OHJA 4X62L 3M3YB 2EYHA 1U5KA 4UDUC 3CMEA 4ZK9B 1XYIA 1GUOA 3CAMA 3TP8A 1O78A 1IKLA 5BN5A 3A8JE 2UUAL 4KY7A 1N33L 4BBRG 2IWHA 5K5PA 4POGA 3AEVA 3HOWH 4DNTB 4HIMA 1EIHA 3CD6A 3H3VH 3CPWA 1JJCB 4OIJA 2IY5B 1STAA 4QGUA 1MHWC 2LMCB 1Y1VG 1PV4A 2DGYA 3F2UA 4ZKBB 1KAWA 1EIGA 1SROA 4J15A 4IN3A 4JG2A 3CCVA 1CK1A 3MVVA 4PV1C 2CQOA 2A6HC 4Z9CB 2HCIA 2NTTA 1WJJA 3NBHA 3OSOA 3I3CA 4CJ2C 1U4LA 2K5QA 1CA6A 2K5VA 4J6HA 4BBRB 4KKUA 2A6HD 3F2CA 2UXBQ 1EUJA 1PH4A 1MGSA 2MFIA 4OL7A 1WTXA 5FLMH 1CT1D 4DUYQ 1EWCA 2OWOA 1DGSA 3W3AA 1BOSA 1HH2P 3CPFA 1TS5A 4P2CB 1Y1VB 4ZRZA 1QZHA 1QOHA 1LTGD 3T1HL 4A3BH 3FMCA 2NZHA 2WINB 4DV3Q 4GNXB 3SXHA 3I2ZA 2WKCA 2K75A 4DAVA 4BXXG 2K6AA 4OXPA 2K5WA 5LMNQ 2E2IB 2JEBI 4DR5Q 1VQ6A 1N32L 2R3ZA 3CCUA 1XXGA 4JBJA 5CBAE 3I4NG 4GOPC 4KY6A 1LABA 2R92H 1N34Q 1Y69U 5KIXA 4DXFA 2EDGA 2ES2A 1RODA 3MXUA 1L1OA 3P75A 1CTMA 2XTIA 1E2WA 1H9KA 5DEHA 2KUMA 4PMCA 4QIWB 4HJ8A 3PUXA 1F2YA 1PH3A 1DOKA 4OELB 1J5EL 1DOLA 4DV2Q 4RHRA 4RCNA 2HD3A 3PUZA 1I3QH 1KHIA 2K50A 1GHKA 3H0GG 2A69D 4A3CH 1Q8IA 1SE8A 2K7VA 1SYBA 2WFWA 3KDFB 2RA4A 2F0MA 2M2LA 4FF2A 1LTID 3I4NB 4RMFA 4DV6Q 1K0SA 2EYFA 5E4WC 2BH2A 4J1MA 4N9TA 3CRLC 3R2TA 5KNBA 4DK6C 3PO3B 4R4CA 1Q81C 3M3YH 4DV0L 1LLRD 2VY3A 4A3MG 1SYFA 4O0AA 1X32A 1A0IA 3GO5A 3H0GB 4MNOA 1AZPA 5IP7G 5JEAG 1PMRA 2VQEL 4KV6A 1H9JA 2C9OA 1ENAA 3S24A 2NZOA 1EY4A 1QG7A 4BWGB 4YY3Q 3SK5A 3S16B 2B2UC 1WCMG 1ASYA 4OGQC 3CHBD 3KUPA 2XN9C 1GXDC 4A3MB 2L4NA 4KHVA 2PCFB 1I5FA 2ICIA 1XNRQ 1RTNA 3GDEA 1Q1EA 5ELNA 1V1QA 4A3KG 1S5DD 4KKSA 2Q2UA 3HP3A 4APVA 3DWQA 1F9PA 1TVXA 4BBSH 1S40A 1TU2B 4I7AA 2UXCQ 1Y1VH 4MZ9A 4JVZA 4UPAA 1FNUA 2KHSA 3K7UC 4FP5D 1TY0A 1WCMB 2YTVA 2LSSA 3KF8B 5IGBA 1NE3A 2KBNA 1UNSA 1KD1C 5KGUA 3TS2A 1JC7A 2G9DA 1JT8A 1HUMA 4DV5Q 4CKEA 1HUNA 4IUQA 3TSSA 4JI4L 4GN4B 2E2IH 3LX0A 1IBML 2R61A 1FD7D 1PZID 2LXKA 3M4PA 3MAQA 2ZXRA 4K5XA 3LWEA 3UDFA 3KLSX 1D5ZC 3V96A 1LTLA 1PYBA 4A3KB 3BDLA 1HR0L 1VF5C 5BR8Q 4ZUJA 5FOBB 5JAVA 1WTRA 1L0WA 4JOIA 1JICA 3LWUA 1G2TA 2PI2A 4CGYB 1MBYA 1TXYA 3K0XA 2Z6KC 1PH9A 3DEOA 1VQ9A 3CCQA 3RZOB 1A3VA 4DR7Q 2WIIB 1D5MC 4QMGA 2Y0SG 4PZ8A 4BXXH 2LKVA 4WJ3M 4JK1C 1JWSD 2MUYA 1ENCA 1STYA 2K04A 2A1AA 2BA0A 4DXGA 3NEMA 4H02A 5ELCA 3I4NH 3S1NB 4HAEA 4LFBL 3NK9A 5CBEE 1XMOL 2EYOA 1NUCA 4G57A 3OTOQ 2NN6G 1SBBB 1SNQA 1YNND 5EBDA 1A3UA 5M5WB 1UE7A 2FFKB 1C48A 2E76C 3FRPB 1T9HA 1VQNA 1MSGA 4LF6Q 2CKZB 3HOXG 3OMGA 3RUZA 3PUWA 3M85A 1P16A 3H0GH 2Y0SB 4OONA 3WDNA 1EOVA 1GVPA 1LTRD 4TKOB 1BCPB 4RKBA 1K0RA 2EY5A 4POFA 1YJNA 4JI5L 3G6EA 2PNHA 4QF4A 2KJXA 4F88A 5C4ZA 2UXDL 3S1MB 4OEMB 1PYSB 2EE1A 1IBKL 4PMBA 3K0YA 4DR2Q 3S16H 1S5FD 3W1BA 4RGNA 4K14A 2CFMA 4IOCA 1U4RA 4L5TA 3I91A 5C3EG 5KEEA 3HOXB 1QJOA 4GKJQ 1WTPA 5KNCA 1EFWA 3KLSA 1L0XB 4JBMA 3D4WA 4PQXA 1CZWA 2XVSA 2NN6I 5DLQE 4ME3A 4XQJA 1G51A 2YU9H 5JEAJ 5D14A 2VQFL 2CQAA 1QZGA 4IUPA 1VQLA 4OWXB 3H91A 2Z4HA 2Q8RE 4CJ0B 1CHQD 3DM3A 5M3MG 1WCMH 1N8RC 4YCVA 1WTVA 1JORA 4C3IG 3BJUA 5ELBA 2IL8A 4ID6A 1XX8A 1S5ED 1TWCB 3NWTA 2F4VQ 4CKCA 3MZ5A 1EZ8A 1YNJC 5C3EB 2CCZA 3T51B 3S1RH 4GN3B 1IYVA 1WTHA 2L55A 1R4QB 5D3IB 4A3KH 1YNJD 2GVBA 1AEXA 1PH8A 1S3OA 1VQBA 1Y8NB 2Z1CA 3QR8A 2B63G 3ERQA 1VQJA 3HKZE 2UXBL 1HNXQ 1BF4A 3ULLA 1L1OC 1HRJA 3NUCA 2ZTDA 3PV0A 2F1MA 4MHEA 4JI7Q 2WACA 5M3MB 2RQXA 1E7ZA 4ODGA 4C3IB 3LGJA 1EYAA 1PRTC 3E9IA 4DV3L 3KBGA 1W3SA 1KL9A 1CA5A 4H13C 3RLFA 3SK4A 4IUTA 2EJGC 2KEEA 4LF9Q 3HOUH 4LW1A 4RCOA 1LT5D 3S1NH 1AE3A 3CP0A 4A3DG 5AFWA 4K0KL 4HTHA 3DUZA 4NP5A 5HURA 1WD0A 1MD2D 4O2DA 2PPBC 1N34L 2B63B 3GTLH 4C3JG 4LF8Q 3TP6A 1U4PA 1D1IA 4B3RQ 3W5OA 2JA5G 5J22A 3T13A 2VS1A 2FMMA 1SJHD 1LV9A 4LUVA 3EN2A 4DV2L 1EU3A 4GOPA 2K52A 1XMQQ 1XTDA 2A73B 1ZXTA 3A5UA 5C6AA 5EBCA 4A3DB 1HA5A 3PMFA 5ELEA 4TRDA 4A3IG 1QVFA 3S1MH 3GTPB 1SN8A 4I7ZC 3GTJH 2A19A 4DV6L 1Q7YC 2CW0D 2ICEC 4IOAA 4C3JB 1P8LA 2NN6H 3HZXA 4OX9Q 2YTYA 1PH7A 1GUSA 2JA5B 1SJED 4IFDG 2JA6G 3HOXH 3OIQA 1C7YA 4LFCQ 4B3MQ 1HTLD 1EYGA 3BS1A 3K5OA 3EROA 3R8BA 1VMCA 5IODA 4HMIA 1EQQA 4UP7A 2H5XA 3EVQA 4R4TA 3MEHA 4A3IB 5IGDA 5CV9A 2OT2A 1ET6A 4RG1A 1V1PB 3F1ZA 3CCEA 2F0TA 4X64Q 5JPMC 1F9QA 1ML0D 1GD7A 2ID0A 1O7LA 1V43A 1KLUD 5CC4A 3A56A 4YY3L 2XWJB 1ZEQX 1FYCA 3BDCA 2L0CA 2PQAB 1EY7A 2F3WA 2JA6B 1TWFH 3K80C 5C3EH 5ELDA 3AYHB 1YVCA 2HDLA 3QJYA 2ENBA 3V2TA 1WI5A 5IWAL 3DLLA 1XNRL 1A3TA 5I2YA 2SNMA 1CQVA 2SNSA 3GP7A 2F0WA 2E5LQ 4IFDI 1XNQQ 3Q24A 1RD9D 3A74A 4WJ4A 1V8QA 2N49A 4DV4Q 2XNAC 3U58A 5L37A 2HHHQ 2VUMG 2UXCL 2HIXA 1YITA 1IL8A 1YNXA 4NPSA 4C3IH 5IYBH 3G48A 2BE5D 3TS0A 1IKMA 1UE5A 2BA1A 1BBWA
chains in the Genus database with same CATH topology
4DAYA 3L3OC 2TSSA 5CV7A 3TBIB 1BXTA 2NWGA 1RDPD 2QILA 2EYLA 4X3SA 2IT1A 3DWAA 2BDNA 1GUGA 1SEBD 3BVGA 1RCVD 2E2HB 3TZUA 3NTHA 4ZQ3A 2KCNA 4KI0A 2B2VA 3D6WA 2K01A 2F0GA 3T56B 5KNDA 5EKKA 4A3EB 2RSOA 5I2XA 2J4XA 3EQLC 2MJ8A 4O42A 2KECA 2A68C 1XTCD 1AP0A 1IYUA 2IX1A 3K6OA 3J80L 1EOTA 1H9MA 1T5XD 2EJFC 3R2IA 1HPCA 2A68D 2RKSA 5BN4A 4BY7B 5C3WA 3NXWA 3NE5B 1II3A 2O4XA 2B8GA 1LTAD 1QILA 4KKTA 2WV6D 3J81L 2DY7A 4G7OC 3QB3A 4NMZA 1PZJD 1PFNA 1ET9A 1RF2D 5D65A 1ILPA 3FKIB 1EEFD 1TIID 2EOTA 3EJIA 5DAUA 2NVYB 4X3TA 3J80E 4QCLA 4XT1B 2YYZA 2GA4B 3HRZC 1I4PA 5JPNC 3QG1A 3QWNA 4IFDJ 1CQFA 4HEDA 1K8MA 1VMPA 3URYA 1CM9A 2K28A 4BS9A 1ICWA 1I4HA 3J81E 1TWGB 2X6LA 4XXEA 2O5JC 2E74C 2B2YA 2L5TA 1GUTA 4DN4M 3S17B 1KDBA 1JOOA 2VB3X 5M9OA 2BCOA 2M00A 2R93B 1SNDA 4OO1G 2XWBB 1ESRA 1EEID 5F2DA 2QDBA 4MN3A 4DGZA 3T53B 5EGTA 2F0SA 3FVQA 3H3VC 4HMJA 4A3GB 2KVMA 3K7AB 4RAUC 4DA2A 2NYZD 3FPUB 4ZUIA 1LT4D 3DXJC 2PW7A 2PW5A 4ZYSA 3I73A 3RMHA 1JB3A 3GV3A 2A69C 1PDQA 3GTOB 3HOZB 4RWSC 1QB5D 1OXTA 2OEOA 3CKIB 5KYLA 3FPPA 1SE3A 4IZ8A 4WRDA 4OO1I 5J39A 4LMQD 2HUGA 4EQNA 2F0FA 1A15A 2DY8A 3VYSA 2IX3A 3S9WA 3UI2A 3PUVA 1K83B 1TQOA 1B3AA 4FVMA 2VNUD 3D6CA 4CJ1B 5K36H 2BDOA 3MA2B 2EY6A 3KBXA 1BNZA 1HXYD 3C1FA 3VR3A 3NHHA 1LTTD 3OPOA 1TY2A 1UEAB 2J7ZA 3S1QB 2F0VA 3C2PA 1SAPA 4X3UA 2B2TA 1GUWA 3TMEA 1SE4A 4XQNA 1EY8A 1DXMA 2EXZA 3AU7A 3ONAB 3OIPA 3CU7A 2A6ED 1HA6A 2D62A 5G3LF 4GZYC 4IURA 2JP1A 4K5WA 1J8IA 1H9RA 5C44B 3IAYA 4RGOS 1PRTF 1STHA 3MXPA 4WJWA 2RVLA 4CBVA 4NKLA 1E2ZA 5I4DA 3H09A 4FF4A 4NW2A 1OO9B 3IFTA 2FJ2A 2L1BA 2B2VC 4Q0FA 4TSSA 4FF3A 2JSOA 1AFPA 4EVOA 1M4VA 2KEDA 1KDAA 2RDHA 1B53A 4OO1H 3E5SA 5BN3A 1JCKB 1B9MA 1SXTA 5HGTA 3MXGA 3RD4A 2I46A 1HFGA 3I90A 1HQRD 4C1NI 4HCEA 4EQPA 1NCVA 5CMDA 1Q90A 4O1NA 4ZAIA 4F7XA 4DNRB 3Q0AA 1AN8A 5FK9C 1D6EC 4H44C 2E2JB 1YNNC 1SYCA 4PNYA 4L8JA 1PFBA 4BY1B 4G7HC 1RTOA 4NDXA 1S5CD 2TMPA 2F0PA 3MTSA 5M5XB 1B50A 4K2KA 2ZT9C 3BG3A 1Y1WB 4XTCS 4KJOA 1DCZA 4H7BA 3DEPA 1HHVA 1I50B 1EL0A 1QNKA 2F03A 1FR3A 1TWAB 2JE6I 5DNFA 2Q8TA 3D4RA 1I6VC 2B2WC 2HQEA 5D3DA 2B2YC 1STBA 1VCIA 4YIJA 2K1BA 4EGVA 5JEAH 3SR1A 2NVXB 4IUUA 1EU4A 5I6YA 1Z47A 2MHVA 3DM1A 3HOVB 3VYUA 1DD2A 3GQBA 1NAPA 2G9HD 1G6ZA 3GD7A 2B39A 4XQQA 4WORA 3LNNA 1G2SA 1RHPA 1IHZA 4MIUA 1KNAA 1ILQA 4KJNA 4RKLA 4XT3B 1EFID 2EJMA 1PLFA 1STGA 5C0XI 5JOBA 3HGBA 3BDOA 5C4XB 3I4MB 1STNA 1SE2A 3GTQB 3I8ZA 2V4DA 5KYIA 5EJWA 1A2UA 4FXGC 4KN4C 5FO8B 4HN7A 1I4RA 2PZWA 1LTBD 4S3SA 4J8QA 1TS2A 3D4DA 2NVTB 1A6XA 3SEBA 1TWHB 2JXMB 2D5DA 3PIP3 1Q1BA 1SNMA 2CW0C 3HS0C 3JAML 1SFOB 4R8IA 4L63B 3NPPA 1DZ1A 3QIAA 5M5YB 4XYQA 4DFAA 1JWMD 2B2TC 5IOCA 2F0LA 4L6TB 3S14B 3QO2A 4A3FB 1BDOA 5LL6X 3L7ZC 3GTMB 2KCCA 3TP5A 1K8OA 2D9UA 1WTWA 1E2VA 1F2ZA 3JAME 2RBMA 2AWNA 3OW7A 1EQTA 3N6RA 2DNEA 5LL6S 3IFDA 3BYTB 4IUVA 1BCPC 3A54A 1EQVA 4FO2A 3M7GA 3X3MA 2Q8IB 2JA7B 1BCPD 1LO5D 3MFGA 5C5MA 1VDZA 3ND9A 4FNFA 4DU9A 3NSWA 3S2HB 2BE5C 5COYA 5EPJA 3GTKB 3HOWB 1F2LA 1B9NA 2A74C 1B2TA 5JVG3 4KD3A 3BVMA 2NUCA 2F0OA 2F0HA 2PO4A 1DYQA 4C1NK 3ZYYX 2O2LD 3OMCA 3SDZA 2PQEA 5EPKA 1TS4A 5IGCA 3R3OA 1Q3LA 3QOJA 2PZTA 1QNUA 4RGTA 1O7YA 1U9RA 4KMUC 1HFNA 5I9PA 1WTQA 1Z7TA 2EYJA 1EZ6A 3SVMA 3A8KE 2AUJD 2MGSA 1F9SA 4G7ZC 4F87A 3I70A 1A2TA 4A93B 1H9SB 1SYDA 2KOLA 1OXVA 1BR9A 5FO7B 3NQTA 1WD1A 1PTOB 1EYDA 1IW7C 2PYKA 1B44D 2XIWA 1JQYD 3A55A 4HSVA 4LJZC 5ISRA 4DAPA 1IW7D 2QCPX 3TDQA 3P1HA 5CV6A 3J7AV 2XRQD 4LK1C 5IT9L 1STEA 2R7ZB 1C4QA 4IFDH 2F0EA 1S4ZA 4B9XA 3MWYW 1OXUA 4IUNA 1KAAA 3T16A 3K59A 1R4PB 5JJZA 5CV8A 2LFNA 3Q22A 1PFMA 1X3QA 3M4YA 3K57A 1SMYD 1F9RA 3I4LA 5IGEA 2B2WA 4QUCA 5IT9E 4U673 3SHLA 1FNWA 1DM0B 3HKZB 1WTOA 5EKIA 3M7NA 2IJ0A 2F0NA 3EA6A 2QF7A 4CKBA 4RGMA 2IPKD 4RFBA 3P7JA 2EVBA 2OXPA 3VA7A 3AB9A 3D31A 2WB1B 3HG9A 3SE0A 4IQZA 4LAAA 3E6ZX 3CQZB 4C56C 2K33A 4M1UB 2AQ3B 3PUYA 1V1OA 4BBSB 4KK7A 3MHBA 1QE6A 1JWUD 1F77A 4KTAA 3G6JB 2FINB 2F0KA 1D5XC 3SK6A 1PTOH 3A8IE 2JEAI 3KLRA 3VR5A 1TS3A 2VXWA 3NBIA 1O7ZA 2E75C 4ABNA 4TQUS 3BZDB 2RDGA 2QEJC 4XYOA 2EZVA 5T1IA 3KF8A 2L11A 2IW3A 5IGGA 3NWSA 3Q23A 5C4JB 4R9WA 1G91A 2NTSA 4HR7B 3W2DA 1T5EA 1Y8PB 2XSCA 2H4OA 4ZKCB 3VYTA 2FMCA 3HEJA 3ITPA 4V190 3G7LA 1SNOA 3D8GA 5EKLA 4K8JA 4FYDA 3PO2B 1ONLA 4JBWA 3ND8A 1PTOC 4H0LC 3NP8A 3OWEB 1DONA 2A6EC 1EY6A 3T4AC 5EQ0A 1PTOD 3EFXD 4M8AA 3D3RA 1GJXA 3H6MA 2WAQB 1FNVA 3OOCA 3VR2A 3IKJA 2WKDA 4A3JB 5T1GA 1D1KA 5I6WA 1GUNA 4EQOA 2AUKA 2LY7A 3GTGB 1BUVT 1I4GA 3U9OA 1NR4A 1GHJA 1PRTB 4KHZA 2YU9B 4FF1A 3V05A 2H1EA 1EY0A 1CHPD 2SOBA 3FEWX 1NR2A 2R6GA 2RSNA 2CHBD 3O13A 1NSNS 2PNRC 3S1RB 4B9WA 1I4XA 2AQ2B 5KRUA 4RA8A 3NTKA 3CRKC 1PZKD 3VYRA 4K6LA 3A7LA 2K5DA 5FKAC 1E0BA 1DOMA 3OHXC 1CFMA 3DWPA 3FDTA 5A35A 1ZKOA 3J7YW 3HOUB 1EWHA 4C3HG 3K58A 5ELFA 1BCPF 4K2LA 3S15B 2CVRA 3GTLB 4ME5A 2MP1A 3K5NA 4R8NA 2M9VA 1EY5A 3MFYA 3L9AX 3Q6SA 4K5VA 3VR4A 3J7AF 5C0XG 1ENFA 2F0DA 1D2BA 5C5LA 4OIKA 2RDFA 4C3HB 4V0BA 3GTJB 4HCSA 3WOEA 1R9TB 2N88A 3E0JA 1BO0A 1ZYRC 1LACA 2KQ3A 2WP8J 1RKNA 2NZ1D 4B08A 1BBXC 2F0IA 1XWEA 1ZYRD 3N52A 3OWFA 4G4KA 1QCBD 1Z6HA 4AYBB 5M3FB 4PMWA 4ZLTF 4U68A 2HDMA 5CORA 1QWYA 2KA7A 5CYUA 2K32A 3U9SA 3K5MA 3X3NA 3GV6A 2F0UA 1KNEA 1J9OA 1JE4A 3RZDB 2F4IA 1S5BD 1LTSD 1TWFB 3C1EA 1EY9A 3IL8A 1C8CA 3KK7A 1HCZA 1JR0D 2NBFA 4K8IA 2QKIC 1V1PA 5J1ZA 1AW7A 2K05A 3M4OB 1WVLA 5CV5A 2XRSD 1SSOA 2NVQB 2K03A 2VB2X 1KTKA 5CGKA 1TR5A 3WOFA 1KABA 5G3LD 2NB0A 1MSHA 1SYEA 3H94A 4N9PA 3C46A 2J0TD 1X3PA 1PRTD 5DM73 2X6GA 5DM63 2DN8A 2IX0A 2OF1A 5C3XA 4C2MB 3TN2A 2ZXPA 1W6JA 1AZQA 2JYOA 1JOKA 4IALA 5I9OA 1SDFA 4KD4A 4FXKC 1BQQT 2N55A 1B4OA 3VR6A 1F2MA 4UAIA 4X3KA 2PMZB 2D2CC 2SDFA 4ULLA 3SK8A 1HQMC 4DK0A 5FO9B 1Q12A 1OXSC 5EPLA 5JVH3 2EYPA 1LT6D 3R93A 3MC0B 2A5HA 3K5LA 1L0YB 1DJRD 3S2DB 2Z4IA 4KN7C 3VA5A 5C0XH 1KDCA 4QUFA 5C0XJ 2O5IC 3HOYB 1H9SA 1RJTA 2F3VA 2ZXOA 5IIFA 1U4MA 1OXXK 2B8FA 4BA1I 5E4XA 2MPMA 2Z8LA 1ESFA 4K6DA 4DF7A 1MI2A 1PYWD 5CR3A 3BVZA 2SEBD 3P20A 2JA8B 2EPBA 1SNPA 3A7AB 4DK1A 2L9HA 2B2UA 1PXUA 5FLXL 2BOSA 1M8AA 1HTPA 1SNCA 4Q5VA 1CZGA 4CHTB 4RHSA 4XIGS 2HCCA 1TT2A 5C4HA 4KY5A 2PZUA 3NTIA 3BYYB 1SYGA 3NQIA 1G291 5A2QL 2EYMA 1UUPA 1Y8OB 4A3BB 3DHQA 3C3LA 5FLXE 4I65A 2X69A 2VUMB 4BA2I 2F0JA 3PIO3 3AMUA 1W6KA 1I4QA 4ILWA 3MXNA 5NUCA 4HSPA 4WFN3 2R92B 4QB4A 1PTOF 3I72A 1JOQA 1LT3D 2DNCA 1GOZA 4FXDA 1FGBD 1B1ZA 1I6HB 2E2DC 5A2QE 4RH6A 4XDXA 2LS01 4F8MA 5E1FA 5K36G 1VF7A 1I3QB 3QOLA 2F0QA 1O80A 1EYCA 3DMUA 3TZDA 2FHTA 4Y7NB 5CV4A 5TSSA 4E6IA 5IGFA 1CI3M 2C5CA 3TP7A 2AQ1B 2L12A 5E3FA 5LHY1 2EY1A 1G8ZD 1UAPA 2EY2A 1SMYC 1KLGD 2I07B 1TKWB 2AWOA 4OHJA 3M3YB 2EYHA 4UDUC 4ZK9B 1XYIA 1GUOA 3TP8A 1O78A 1IKLA 5BN5A 3A8JE 4KY7A 2IWHA 5K5PA 4DNTB 1EIHA 4OIJA 1STAA 2LMCB 3F2UA 4ZKBB 1EIGA 4IN3A 1CK1A 3MVVA 4PV1C 2A6HC 4Z9CB 2HCIA 2NTTA 3NBHA 3OSOA 3I3CA 4CJ2C 1U4LA 2K5QA 1CA6A 4J6HA 4BBRB 4KKUA 2A6HD 1MGSA 4OL7A 1WTXA 1CT1D 1EWCA 3W3AA 1BOSA 1TS5A 4P2CB 1Y1VB 4ZRZA 1QOHA 1LTGD 3FMCA 2WINB 3SXHA 2WKCA 4DAVA 2K6AA 2K5WA 2E2IB 2JEBI 2R3ZA 1XXGA 5CBAE 4KY6A 1LABA 1Y69U 5KIXA 4DXFA 2EDGA 1RODA 3MXUA 3P75A 1CTMA 1E2WA 1H9KA 5DEHA 2KUMA 4PMCA 4QIWB 3PUXA 1F2YA 1DOKA 1DOLA 4RHRA 4RCNA 3PUZA 1GHKA 2A69D 1Q8IA 2K7VA 1SYBA 2RA4A 2F0MA 2M2LA 4FF2A 1LTID 3I4NB 2EYFA 5E4WC 4J1MA 4N9TA 3CRLC 3R2TA 5KNBA 3PO3B 1LLRD 1SYFA 1X32A 3GO5A 3H0GB 1AZPA 5JEAG 1PMRA 4KV6A 1H9JA 2C9OA 1ENAA 1EY4A 1QG7A 4BWGB 3SK5A 3S16B 2B2UC 4OGQC 3CHBD 3KUPA 2XN9C 1GXDC 4A3MB 2L4NA 4KHVA 2PCFB 2ICIA 1RTNA 1Q1EA 1S5DD 4KKSA 3HP3A 3DWQA 1F9PA 1TVXA 1TU2B 1FNUA 2KHSA 4FP5D 1TY0A 1WCMB 5IGBA 1UNSA 5KGUA 1JC7A 2G9DA 1HUMA 4CKEA 1HUNA 4IUQA 3TSSA 3LX0A 2R61A 1FD7D 1PZID 3MAQA 2ZXRA 4K5XA 3LWEA 3KLSX 1D5ZC 3V96A 4A3KB 3BDLA 1VF5C 4ZUJA 5FOBB 5JAVA 1WTRA 1JICA 3LWUA 1G2TA 4CGYB 1MBYA 3DEOA 3RZOB 1A3VA 2WIIB 1D5MC 4QMGA 2LKVA 4JK1C 1JWSD 2MUYA 1ENCA 1STYA 2K04A 2BA0A 4DXGA 5ELCA 3S1NB 4HAEA 3NK9A 5CBEE 2EYOA 1NUCA 4G57A 2NN6G 1SBBB 1SNQA 1YNND 5EBDA 1A3UA 5M5WB 2FFKB 1C48A 2E76C 3FRPB 1MSGA 3OMGA 3RUZA 3PUWA 3M85A 2Y0SB 3WDNA 1LTRD 4TKOB 1BCPB 4RKBA 2EY5A 4QF4A 2KJXA 4F88A 5C4ZA 3S1MB 2EE1A 4PMBA 3K0YA 1S5FD 4RGNA 4K14A 1U4RA 3I91A 5KEEA 3HOXB 1QJOA 1WTPA 5KNCA 3KLSA 1L0XB 3D4WA 4PQXA 1CZWA 2XVSA 2NN6I 4XQJA 5JEAJ 5D14A 2CQAA 4IUPA 3H91A 2Z4HA 2Q8RE 4CJ0B 1CHQD 1WTVA 1JORA 4C3IG 5ELBA 2IL8A 4ID6A 1XX8A 1S5ED 1TWCB 3NWTA 4CKCA 3MZ5A 1EZ8A 1YNJC 5C3EB 3T51B 1IYVA 2L55A 1R4QB 5D3IB 1YNJD 1AEXA 1Y8NB 2Z1CA 3ERQA 1BF4A 1HRJA 3NUCA 3PV0A 2F1MA 4MHEA 2WACA 5M3MB 2RQXA 4ODGA 4C3IB 1EYAA 1PRTC 3KBGA 1CA5A 4H13C 3RLFA 3SK4A 4IUTA 2EJGC 2KEEA 4RCOA 1LT5D 5AFWA 5HURA 3DUZA 4HTHA 4NP5A 1WD0A 1MD2D 2PPBC 2B63B 4C3JG 3TP6A 1U4PA 1D1IA 5J22A 3T13A 2FMMA 1SJHD 1LV9A 1EU3A 2A73B 1ZXTA 5C6AA 5EBCA 4A3DB 1HA5A 3PMFA 5ELEA 4TRDA 3GTPB 4I7ZC 2CW0D 2ICEC 4C3JB 2NN6H 3HZXA 1GUSA 2JA5B 1SJED 4IFDG 3OIQA 1HTLD 3BS1A 3K5OA 3EROA 5IODA 1VMCA 4HMIA 3EVQA 3MEHA 4A3IB 5IGDA 5CV9A 2OT2A 1ET6A 1V1PB 2F0TA 5JPMC 1F9QA 1ML0D 2ID0A 1O7LA 1V43A 1KLUD 5CC4A 3A56A 2XWJB 1ZEQX 1FYCA 3BDCA 2L0CA 1EY7A 2F3WA 2JA6B 5ELDA 2HDLA 3QJYA 2ENBA 3V2TA 1A3TA 5I2YA 2SNMA 1CQVA 2SNSA 3GP7A 2F0WA 4IFDI 3Q24A 1RD9D 1V8QA 2XNAC 1IL8A 2BE5D 1IKMA 2BA1A 3R8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY6 A;  5J39 A;  1EY0 A;  2SOB A;  4MIU A;  1SYC A;  4QF4 A;  1STN A;  4PNY A;  5CV7 A;  5C4Z A;  5J22 A;  4KHV A;  3T13 A;  3C1F A;  5NUC A;  5C5M A;  4PMB A;  4QB4 A;  5KYI A;  1JOQ A;  2EYP A;  2EYL A;  1NSN S;  3NHH A;  3SXH A;  2F0E A;  4DU9 A;  5IGG A;  4NDX A;  1A2U A;  4B9W A;  4B9X A;  5KRU A;  4K14 A;  2F0U A;  4IUN A;  2F0P A;  3VA5 A;  2F0V A;  4K2K A;  1KDC A;  5C6A A;  1KAA A;  1KDB A;  1JOO A;  3T16 A;  3PMF A;  4TRD A;  5KEE A;  5M9O A;  4F8M A;  2KHS A;  4KJO A;  4KY6 A;  5E1F A;  5CV8 A;  4KD3 A;  3TME A;  3C1E A;  2M00 A;  1EY9 A;  1SND A;  2NUC A;  1EY8 A;  4ZQ3 A;  5KIX A;  2F0O A;  2F0H A;  4H7B A;  3QOL A;  2PZW A;  3D4W A;  5IGB A;  2F0Q A;  2EXZ A;  4S3S A;  2F0G A;  5KGU A;  1EYC A;  3DMU A;  2F3V A;  3HZX A;  3P75 A;  5F2D A;  3D4D A;  5EKK A;  4K8I A;  5IIF A;  5DEH A;  2QDB A;  4DGZ A;  5IGE A;  4PMC A;  3HEJ A;  3ITP A;  1F2Y A;  4K5W A;  5J1Z A;  3OMC A;  5CV4 A;  5EGT A;  4E6I A;  2PQE A;  3LX0 A;  5IGF A;  2F0S A;  1SNO A;  3D8G A;  4K6D A;  3SHL A;  5EKL A;  5IGC A;  3TP7 A;  4K8J A;  1SNM A;  4HMJ A;  4K5X A;  5E3F A;  4DF7 A;  3R3O A;  2EY1 A;  5CR3 A;  3QOJ A;  3BDL A;  5CV5 A;  2HQE A;  2PZT A;  1JOR A;  2EY2 A;  2F0N A;  1STH A;  3ERO A;  3NP8 A;  4ID6 A;  3MXP A;  4WRD A;  4ZUJ A;  5IOD A;  4HMI A;  5CGK A;  5JAV A;  1STB A;  4YIJ A;  4ZUI A;  1U9R A;  1SYB A;  3MZ5 A;  2EYH A;  1TR5 A;  3EVQ A;  2F0M A;  1EZ8 A;  1SNP A;  3MEH A;  4K2L A;  2RKS A;  1EY6 A;  2PW7 A;  1KAB A;  4NKL A;  5CV9 A;  4DFA A;  2PW5 A;  4ME5 A;  3SR1 A;  5I9P A;  4R8N A;  3TP8 A;  5C3W A;  2EYJ A;  2F0T A;  1SYE A;  1EZ6 A;  2OXP A;  2EYF A;  2F0L A;  3NXW A;  5IOC A;  4KY7 A;  1EY5 A;  1A3V A;  4N9P A;  4J1M A;  5CC4 A;  4N9T A;  5I6Y A;  1II3 A;  4K5V A;  1AEX A;  2O4X A;  3BDC A;  3H6M A;  4LAA A;  4QMG A;  2LKV A;  5K5P A;  3ERQ A;  5IGD A;  1ENC A;  1SNC A;  3TP5 A;  1EY7 A;  2F3W A;  1STY A;  3NUC A;  3QB3 A;  1A2T A;  2OF1 A;  4NMZ A;  1STA A;  2F0D A;  4EVO A;  5C3X A;  2OEO A;  1SYD A;  3OWF A;  4WOR A;  5I6W A;  1KDA A;  1F2Z A;  2WAC A;  1TT2 A;  5KYL A;  1SYF A;  2ENB A;  3V2T A;  5C5L A;  3NK9 A;  4ODG A;  1IHZ A;  4EQO A;  5C4H A;  4IZ8 A;  3E5S A;  4KY5 A;  3MHB A;  3NQT A;  2EYO A;  2RBM A;  2RDF A;  2PZU A;  1NUC A;  3EJI A;  1EYD A;  1A3T A;  1EYA A;  3MVV A;  4G57 A;  4KJN A;  2F0F A;  2SNM A;  5DAU A;  4EQN A;  5HGT A;  1SNQ A;  2PYK A;  4RKL A;  1SYG A;  1JOK A;  4IAL A;  4KTA A;  5I9O A;  4KD4 A;  1A3U A;  2SNS A;  3SK4 A;  2F0W A;  2EYM A;  3U9O A;  3S9W A;  4KV6 A;  3OSO A;  1ENA A;  4EQP A;  5ISR A;  3TP6 A;  1EQV A;  1EY4 A;  2KQ3 A;  1F2M A;  1STG A;  3OMG A;  3RUZ A;  3SK5 A;  3DHQ A;  4J6H A;  1RKN A;  2F0K A;  4HTH A;  4NP5 A;  1TQO A;  5JOB A;  4F7X A;  3P1H A;  5HUR A;  4I65 A;  2F0I A;  4RKB A;  3SK6 A;  3D6C A;  2EY5 A;  5CV6 A;  3SK8 A;  4OL7 A;  2F0J A; 
#chains in the Genus database with same CATH topology
 4DAY A;  3L3O C;  3UDG A;  2F3I A;  2TSS A;  3I4O A;  4DV5 L;  5CV7 A;  3TBI B;  1BXT A;  2NWG A;  1RDP D;  2KHJ A;  2QIL A;  2EYL A;  4X3S A;  2IT1 A;  3DWA A;  2BDN A;  3AFP A;  1GUG A;  1SEB D;  2B63 H;  1CKN A;  3T1Y Q;  2Q2H A;  3BVG A;  1RCV D;  2E2H B;  5BR8 L;  1X3E A;  3FP9 A;  1UEB A;  4P75 A;  4BY7 G;  3TZU A;  2R7F A;  1B3Q A;  3NTH A;  4ZQ3 A;  2KCN A;  1M90 C;  4KI0 A;  2B2V A;  3D6W A;  2K01 A;  2F0G A;  3T56 B;  1E1T A;  4DR7 L;  5KND A;  5EKK A;  4A3E B;  2RSO A;  5I2X A;  4A3D H;  2MO0 A;  2J4X A;  2R7D A;  2A8V A;  3EQL C;  2MJ8 A;  4O42 A;  2YV5 A;  4PZ7 A;  2KEC A;  2A68 C;  1XTC D;  1AP0 A;  1IYU A;  2IX1 A;  3FKI G;  2Z6K A;  4C3J H;  3K6O A;  3J80 L;  3G4S A;  1EOT A;  1H9M A;  1T5X D;  2EJF C;  3R2I A;  1HPC A;  2JA5 H;  2A68 D;  2OCE A;  4EX5 A;  2RKS A;  5BN4 A;  2Z6B A;  2RF4 A;  4BY7 B;  5C3W A;  3NXW A;  2CH4 W;  2D0P A;  1B70 B;  4LF6 L;  3NE5 B;  1II3 A;  4B3T Q;  2O4X A;  2B8G A;  1LTA D;  1QIL A;  1X3G A;  4KKT A;  2WV6 D;  3J81 L;  2DY7 A;  1VQE A;  4G7O C;  3HOY H;  4QY7 A;  3QB3 A;  4NMZ A;  3UE0 A;  1PZJ D;  1PFN A;  1ET9 A;  1RF2 D;  5D65 A;  1ILP A;  3FKI B;  3L0O A;  1EEF D;  1Q86 C;  1VQI A;  1TII D;  2EOT A;  3EJI A;  2YTX A;  5DAU A;  2NVY B;  4X3T A;  3J80 E;  4QCL A;  3KLW A;  4XT1 B;  2YYZ A;  2ATW A;  3KF6 A;  3J80 c;  2JA6 H;  2AKW B;  2GA4 B;  3HRZ C;  4JI2 Q;  1I4P A;  4MTK A;  5JPN C;  3QG1 A;  3QWN A;  4IFD J;  1SLJ A;  4IPD A;  2JA8 H;  1CQF A;  2R93 G;  1D8L A;  2I5M X;  3KJP A;  4HED A;  1VQ4 A;  1K8M A;  1VMP A;  4UP8 A;  3URY A;  2ZJP A;  1CM9 A;  2K28 A;  4BS9 A;  1ICW A;  1I4H A;  3J81 E;  1TWG B;  2X6L A;  3J81 c;  4XXE A;  2O5J C;  1G6P A;  2E74 C;  2B2Y A;  2L5T A;  4A3G G;  1GUT A;  4DN4 M;  3S17 B;  1KDB A;  2F4V L;  1JOO A;  2VB3 X;  2PI2 E;  5M9O A;  1A63 A;  2OQK A;  3MXN B;  3PF4 A;  4A4I A;  2BCO A;  2M00 A;  1PH2 A;  1SND A;  2R93 B;  4DR3 Q;  2UUB Q;  4OO1 G;  1MIU A;  2XWB B;  1ESR A;  1EEI D;  5F2D A;  2C35 B;  2QDB A;  4MN3 A;  4DGZ A;  3T53 B;  3HOZ G;  3CMA A;  1HNX L;  5EGT A;  3F2D A;  2F0S A;  2VUM H;  1LUZ A;  3FVQ A;  3H3V C;  4HMJ A;  1RL2 A;  4A3G B;  1H95 A;  4JI7 L;  3KYH C;  4LF7 Q;  2KVM A;  3K7A B;  1PH6 A;  4QJF A;  4RAU C;  4DA2 A;  2NYZ D;  3FPU B;  4ZUI A;  1YHB A;  1BKB A;  1LT4 D;  3DXJ C;  3OYY A;  2PW7 A;  2PW5 A;  4ZYS A;  3I73 A;  1CKM A;  3PIO A;  3RMH A;  4LF9 L;  1YJW A;  3PO3 G;  1JB3 A;  4JV5 Q;  1NMG A;  3GV3 A;  4DKA C;  2A69 C;  1PDQ A;  1I6H H;  2G5D A;  3GTO B;  1X56 A;  1Y14 B;  3HOZ B;  4RWS C;  1QB5 D;  1OXT A;  1ICF B;  4LF8 L;  4IPC A;  4R4Q A;  4BY7 H;  2OEO A;  4B3R L;  3CKI B;  2RHQ B;  5KYL A;  3FPP A;  1SE3 A;  5LMN W;  5JJL A;  4IZ8 A;  4WRD A;  4OO1 I;  5J39 A;  4LMQ D;  2HUG A;  2Z0S A;  4EQN A;  4Y7N H;  2F0F A;  1BVS A;  1A15 A;  2DY8 A;  3VYS A;  4AIM A;  4LFA Q;  2IX3 A;  3S9W A;  3TRE A;  3UI2 A;  2UUC Q;  3PUV A;  4AQY L;  4A3L G;  1K83 B;  4FDB A;  5GAG C;  1TQO A;  1B3A A;  4FVM A;  2VNU D;  3D6C A;  5FJ8 G;  4X6A H;  4GKK L;  4CJ1 B;  5K36 H;  2BDO A;  3MA2 B;  2EY6 A;  3K8A A;  3KBX A;  1BNZ A;  1HXY D;  3C1F A;  4IPG A;  3VR3 A;  1N36 Q;  4JCV E;  1FJG Q;  5C44 G;  2JA9 A;  3NHH A;  4UP9 A;  1LTT D;  4P74 A;  3OPO A;  1FL0 A;  1TY2 A;  3E0E A;  1X3F A;  4YCU A;  4LFC L;  4B3M L;  2ASB A;  1UEA B;  4JYA Q;  2J7Z A;  3S1Q B;  2F0V A;  3C2P A;  1SAP A;  1EQR A;  2B2T A;  4X3U A;  1TWG H;  2ZTC A;  1GUW A;  1D7Q A;  3TME A;  1SE4 A;  2GN5 A;  2VL6 A;  4XQN A;  1EY8 A;  1DXM A;  2EXZ A;  3AU7 A;  3ONA B;  3OIP A;  3CU7 A;  2A6E D;  1HA6 A;  2D62 A;  5G3L F;  4GZY C;  4IUR A;  2JP1 A;  4K5W A;  4BBR H;  1J8I A;  1K8G A;  1EIY B;  4CDC C;  1H9R A;  4JI3 Q;  5C44 B;  3JC6 6;  3IAY A;  4RGO S;  2R93 H;  1PRT F;  1STH A;  3MXP A;  2DUD A;  4DR6 Q;  4WJW A;  2RVL A;  4CBV A;  4NKL A;  1E2Z A;  5I4D A;  3H09 A;  1JB7 A;  4FF4 A;  5EAY A;  4NW2 A;  2E5L L;  1OO9 B;  3IFT A;  2FJ2 A;  3E9H A;  4DR4 Q;  1ASZ A;  4ALP A;  4A3G H;  2L1B A;  2RCN A;  4DV4 L;  2HHH L;  1SRU A;  2B2V C;  4LWC A;  1KXL A;  1C0A A;  4Q0F A;  4HJ7 A;  4TSS A;  4FF3 A;  1QUQ A;  3Q8D A;  2JSO A;  1AFP A;  4EVO A;  4UY8 C;  1M4V A;  2E8G A;  2KED A;  1KDA A;  4BY1 G;  1YEZ A;  1E22 A;  2RDH A;  2I5H A;  1B53 A;  4OO1 H;  1JJG A;  3E5S A;  5BN3 A;  2K5N A;  1JCK B;  1B9M A;  5IYD G;  1SXT A;  5HGT A;  3MXG A;  3RD4 A;  2I46 A;  3T1Y L;  1HFG A;  3I90 A;  1HQR D;  5GAH C;  4C1N I;  4HCE A;  1Q46 A;  4EQP A;  1NCV A;  5CMD A;  1Y1W G;  1Q90 A;  2QW7 A;  4O1N A;  4ZAI A;  4F7X A;  4DNR B;  3Q0A A;  1AN8 A;  1HJP A;  5FK9 C;  3PCO B;  1D6E C;  3I55 A;  1Z9F A;  4H44 C;  2E2J B;  1YNN C;  4ZCK A;  4GNX C;  1SYC A;  4PNY A;  4L8J A;  2CWP A;  1PFB A;  4BY1 B;  3NEL A;  4JI6 Q;  3PO3 H;  1QVC A;  4G7H C;  1RTO A;  4NDX A;  1S5C D;  2TMP A;  2F0P A;  3MTS A;  5M5X B;  1B50 A;  4K2K A;  2ZT9 C;  3A0J A;  4JI8 Q;  3BG3 A;  1Y1W B;  4XTC S;  4PG3 A;  3TQY A;  4KJO A;  3HFZ B;  1DCZ A;  2KHI A;  5H1S E;  4H7B A;  3DEP A;  1HHV A;  1I50 B;  4NXN Q;  1EL0 A;  3HOV G;  1X55 A;  1UE6 A;  4R4O A;  3G71 A;  1QNK A;  2F03 A;  1FR3 A;  4CDE C;  1PH1 A;  1TWA B;  4A3L H;  1AH9 A;  2JE6 I;  1C9O A;  5DNF A;  4GLV B;  2Q8T A;  3D4R A;  1I6V C;  2B2W C;  2HQE A;  3RR5 A;  5FJ8 H;  5D3D A;  4A3M H;  1HNZ Q;  2ZTE A;  2B2Y C;  2VZA A;  1STB A;  1VCI A;  4YIJ A;  5J3B A;  2K1B A;  3J80 i;  4EGV A;  5IP7 H;  5JEA H;  3SR1 A;  2NVX B;  4JI2 L;  4IUU A;  2OQ0 A;  1EU4 A;  4YHH Q;  1MJC A;  3ERS X;  5I6Y A;  1Z47 A;  2MHV A;  3DM1 A;  4CDF C;  3HOV B;  3VYU A;  1DD2 A;  1FGU A;  3GQB A;  5C4X G;  1NAP A;  2G9H D;  2BH8 A;  1G6Z A;  1K9M C;  3GD7 A;  2D0O A;  3KFU A;  4YWK A;  3I4M G;  4R1J A;  2B39 A;  4XQQ A;  4WOR A;  2DJF C;  3J81 i;  3LNN A;  1G2S A;  1RHP A;  1E24 A;  5GAE C;  1VQC A;  1IHZ A;  4MIU A;  1KNA A;  2CWA A;  1ILQ A;  4KJN A;  4RKL A;  4JC0 A;  1B8A A;  4XT3 B;  1GKH A;  1EFI D;  2EJM A;  2FXQ A;  2UU9 Q;  1PLF A;  4OWT B;  1STG A;  4PZ6 A;  4LNQ A;  5C0X I;  5JOB A;  3HGB A;  1YJ9 A;  3BDO A;  4DUY L;  4DR3 L;  2UUB L;  1SMX A;  5C4X B;  5IP9 G;  3BU2 A;  3I4M B;  3RZO H;  1STN A;  1SE2 A;  3OW2 A;  3GTQ B;  3I8Z A;  3RLO A;  2V4D A;  5KYI A;  2OTJ A;  2WB1 E;  4A75 A;  5EJW A;  4N8X 1;  1A2U A;  2MO1 A;  4FXG C;  5LMN L;  4DR5 L;  1KIX A;  2E2J H;  4KN4 C;  1UE1 A;  3B6Y A;  2K14 A;  5FO8 B;  4BY1 H;  3RN5 A;  4HN7 A;  4HID A;  2N3S A;  1Q82 C;  1E1O A;  1I4R A;  2PZW A;  1LTB D;  2AMC B;  4S3S A;  4J8Q A;  5M5W H;  4A3F G;  1TS2 A;  3RN2 A;  3D4D A;  2NVT B;  1A6X A;  1FVI A;  3SEB A;  1NBW A;  1E3P A;  4DV1 Q;  1TWH B;  2JXM B;  2D5D A;  5GAD C;  3PIP 3;  4JI0 Q;  1J5E Q;  1Q1B A;  1SNM A;  3CCR A;  1WFQ A;  2CW0 C;  3HS0 C;  3JAM L;  1YI2 A;  1SFO B;  4R8I A;  4L63 B;  3NPP A;  4NXM Q;  1I50 H;  5ELO A;  1DZ1 A;  3WWV A;  1CKO A;  3QIA A;  3CF5 A;  5M5Y B;  4XYQ A;  4DFA A;  1HZA A;  3CCM A;  4LFA L;  4KHP Q;  1JWM D;  2B2T C;  5IOC A;  2F0L A;  4L6T B;  4QIW E;  3S14 B;  3QO2 A;  2UUC L;  4A3F B;  1BDO A;  5LL6 X;  3L7Z C;  1XPR A;  3GTM B;  2KCC A;  3TP5 A;  1VQM A;  1K8O A;  2JA7 G;  4IO9 A;  2D9U A;  2N78 A;  4JI1 Q;  1WTW A;  2NVX H;  1E2V A;  1F2Z A;  1N36 L;  3JAM E;  1FJG L;  2RBM A;  2AWN A;  3JAM c;  3OW7 A;  1EQT A;  3N6R A;  2DNE A;  5LL6 S;  1PHJ A;  3IFD A;  4JYA L;  3BYT B;  4IUV A;  1BCP C;  4AH6 A;  3A54 A;  1EQV A;  4LUZ A;  1KC8 C;  1TWC H;  4FO2 A;  2QA4 A;  3M7G A;  3X3M A;  1K8A C;  2JJQ A;  2Q8I B;  2JA7 B;  1BCP D;  1HZC A;  1LO5 D;  4L5Q A;  3MFG A;  3L2P A;  5C5M A;  1VDZ A;  3ND9 A;  4FNF A;  4DU9 A;  3NSW A;  1NJI C;  3S2H B;  2BE5 C;  5COY A;  5EPJ A;  4YWM A;  2WAQ E;  5C4X H;  5M3M H;  4DR6 L;  3GTK B;  3I4M H;  3HOW B;  1F2L A;  1B9N A;  3STB D;  2A74 C;  1B2T A;  4TVA B;  5JVG 3;  4KD3 A;  5FLM G;  3BVM A;  2NUC A;  2F0O A;  2F0H A;  3M4Q A;  4A3E G;  2IHE A;  5GQO A;  2PO4 A;  1DYQ A;  4GOP B;  4C1N K;  1GM5 A;  1VQP A;  3ZYY X;  3F2B A;  2O2L D;  3OMC A;  3SDZ A;  2PQE A;  1X54 A;  1TS4 A;  5EPK A;  5IGC A;  4A93 G;  1IBM Q;  3R3O A;  1VQ8 A;  1Q3L A;  3QOJ A;  1X9N A;  2PZT A;  1QNU A;  5E7N A;  5IP9 H;  4HJA A;  2NVT H;  4RGT A;  1O7Y A;  1CSQ A;  1U9R A;  4L5R C;  4KMU C;  1HFN A;  4OWW B;  5I9P A;  2JQO A;  1WTQ A;  1Z7T A;  2EYJ A;  2QEX A;  1EZ6 A;  3SVM A;  4IJL A;  3A8K E;  2AUJ D;  4IJH A;  1SFO H;  2MGS A;  4HJ9 A;  1B7Y B;  1F9S A;  4G7Z C;  4F87 A;  3GTP H;  3I70 A;  1W2B A;  1A2T A;  4A93 B;  1H9S B;  1SYD A;  2KOL A;  1OXV A;  2R7Z G;  3S14 H;  1BR9 A;  1VS0 A;  4JI6 L;  3OTO L;  5FO7 B;  3NQT A;  1WD1 A;  4A3F H;  4LFB Q;  1PTO B;  1EYD A;  1VQH A;  1WYD A;  1IW7 C;  1K73 C;  2PYK A;  1B44 D;  2XIW A;  1JQY D;  3A55 A;  4JPB W;  4HSV A;  4LJZ C;  5ISR A;  4DAP A;  4GNX A;  1IW7 D;  2QCP X;  3TDQ A;  3P1H A;  1RIP A;  4A3I H;  5CV6 A;  3J7A V;  2XRQ D;  4LK1 C;  1KRT A;  3TRZ A;  5IT9 L;  2QGQ A;  1STE A;  1PH5 A;  2R7Z B;  2JN4 A;  2UXD Q;  4DR2 L;  1C4Q A;  3U4V A;  1JE5 A;  2KEN A;  3J7A 5;  4IFD H;  3HKZ G;  2F0E A;  4JW0 A;  1S4Z A;  1CUK A;  4B9X A;  2JA7 H;  3MWY W;  1OXU A;  4IUN A;  4HIK A;  1YHQ A;  3PGZ A;  1HNZ L;  1OTC A;  3RNU A;  4GKJ L;  1KAA A;  3I56 A;  3T16 A;  3TEH B;  3K59 A;  1QVG A;  1R4P B;  5JJZ A;  5CV8 A;  2ZJR A;  3I7F A;  2LFN A;  2GVA A;  3Q22 A;  1K3R A;  1PFM A;  1X3Q A;  3M4Y A;  2WB1 G;  3S2H H;  3K57 A;  1BBU A;  1SMY D;  4DK3 C;  1IZ6 A;  1F9R A;  1CKN B;  4YHH L;  3I4L A;  3KDF A;  5LMU Q;  2OTL A;  5IGE A;  2B2W A;  4QUC A;  4X65 Q;  5IT9 E;  3GTK H;  4U67 3;  3F8T A;  2VQF Q;  4L5S A;  5HY6 A;  3SHL A;  5IT9 c;  5AJ3 Q;  2HT1 A;  1FNW A;  4IPH A;  1DM0 B;  4BBS G;  3HKZ B;  1WTO A;  5EKI A;  4HJ5 A;  3CCL A;  3M7N A;  2IJ0 A;  4A76 A;  2F0N A;  3EA6 A;  2QF7 A;  4AYB E;  3NEN A;  4CKB A;  4RGM A;  4LF4 Q;  2IPK D;  4RFB A;  3P7J A;  1VQO A;  1VQK A;  2RHS B;  2HQL A;  2EVB A;  2OXP A;  1LM0 A;  3VA7 A;  2HIV A;  3AB9 A;  3D31 A;  4B3S Q;  2WB1 B;  2E2H H;  3HG9 A;  2UU9 L;  3SE0 A;  4IQZ A;  4LAA A;  3U50 C;  3E6Z X;  3CQZ B;  4C56 C;  2K33 A;  4M1U B;  2AQ3 B;  3PUY A;  1V1O A;  4BBS B;  4KK7 A;  2B3G A;  4A3E H;  3MHB A;  1QE6 A;  1JWU D;  2ZJQ A;  1N9W A;  1F77 A;  3BZK A;  4KTA A;  3G6J B;  4DPG A;  5IYC G;  2FIN B;  4A93 H;  4GLX A;  2F0K A;  1D5X C;  4K0K Q;  3SK6 A;  1PTO H;  3A8I E;  2JEA I;  3KLR A;  3VR5 A;  1TS3 A;  3AFQ A;  2VXW A;  3NBI A;  1O7Z A;  2E75 C;  3KF6 B;  4ABN A;  4TQU S;  4DV1 L;  3BZD B;  1VQ7 A;  2RDG A;  2QEJ C;  4XYO A;  2N8N A;  5T1I A;  2EZV A;  2IHF A;  3D0F A;  3KF8 A;  4JI0 L;  2L11 A;  3PO2 G;  1XMQ L;  2IW3 A;  5IGG A;  3NWS A;  3Q23 A;  5C4J B;  3CC2 A;  4R9W A;  4NXM L;  3FKI H;  1G91 A;  3ULJ A;  2R7Z H;  2L15 A;  2NTS A;  4HR7 B;  3CXC A;  3W2D A;  2NVY H;  1T5E A;  1JJ2 A;  1Y8P B;  4KHP L;  3PSI A;  2XSC A;  2H4O A;  4OX9 L;  4ZKC B;  3NBH B;  3VYT A;  1EIF A;  2FMC A;  3HEJ A;  2WAQ G;  3ITP A;  4UHV A;  4V19 0;  3G7L A;  4A3J G;  1SNO A;  3D8G A;  5EKL A;  4JI1 L;  4K8J A;  4FYD A;  3PO2 B;  2K5H A;  2PMZ E;  1ONL A;  2XGT A;  4JBW A;  3ND8 A;  1PTO C;  4H0L C;  1IBL Q;  3NP8 A;  3OWE B;  3JAM i;  1DON A;  2A6E C;  4DV7 Q;  4DUZ Q;  1EY6 A;  3T4A C;  5EQ0 A;  4X64 L;  1MJE A;  1I94 Q;  4Y52 H;  1PTO D;  3EFX D;  4M8A A;  3D3R A;  1GJX A;  3S17 H;  4GN5 A;  3H6M A;  5IY0 A;  2WAQ B;  1FNV A;  1HZ9 A;  3OOC A;  3VR2 A;  1IXR A;  4P73 A;  3IKJ A;  2WKD A;  4A3J B;  5T1G A;  1D1K A;  5I6W A;  1Q8K A;  3MEF A;  3PQI A;  1L1O B;  1GUN A;  4EQO A;  2AUK A;  2LY7 A;  5IWA Q;  4LF5 Q;  3RLN A;  3CQZ H;  1XNQ L;  1A8V A;  1BUV T;  3GTG B;  2Z9H A;  1I4G A;  3U9O A;  1NR4 A;  1GHJ A;  1PRT B;  3K7A H;  4KHZ A;  2YU9 B;  4FF1 A;  3V05 A;  2H1E A;  1O7I A;  1V9P A;  1HZB A;  4P71 A;  1EY0 A;  1CHP D;  2SOB A;  3CW2 C;  3FEW X;  5JJI A;  2Q2I A;  1NR2 A;  3GTO H;  2R6G A;  2RSN A;  2CHB D;  3O13 A;  1NSN S;  1JMC A;  3HOZ H;  2PNR C;  2B29 A;  3S1R B;  3HOU G;  4B9W A;  1I4X A;  2AQ2 B;  5KRU A;  4RA8 A;  3NTK A;  3CRK C;  1PZK D;  3VYR A;  4K6L A;  3A7L A;  2K5D A;  5FKA C;  1L2F A;  1XPO A;  1E0B A;  1DOM A;  2Q2T A;  3OHX C;  1HNW Q;  1CFM A;  5C4J H;  5IYC H;  1K83 H;  3EBE A;  3ULP A;  3DWP A;  1EWI A;  3FDT A;  1YZ6 A;  5A35 A;  3AQQ A;  1ZKO A;  3J7Y W;  3HOU B;  1EWH A;  4C3H G;  3K58 A;  3J81 j;  5ELF A;  1BCP F;  4K2L A;  2ZM6 Q;  3S15 B;  1MKH A;  2CVR A;  3GTL B;  4ME5 A;  2MP1 A;  5HGQ A;  1U0L A;  4R8N A;  3K5N A;  2M9V A;  1EY5 A;  3MFY A;  4B3T L;  3PO2 H;  3L9A X;  3S1Q H;  3CC7 A;  3Q6S A;  4K5V A;  2V1C C;  3KOJ A;  4DR1 Q;  3VR4 A;  2EXD A;  3J7A F;  4N8F A;  4AYB G;  5M3F G;  5C0X G;  4KLK A;  1ENF A;  2F0D A;  4X66 Q;  1D2B A;  5C5L A;  4OIK A;  2JK8 A;  2RDF A;  4C3H B;  4X62 Q;  4V0B A;  3GTJ B;  4HCS A;  3WOE A;  5C44 H;  1AE2 A;  1R9T B;  2N88 A;  3E0J A;  1BO0 A;  1QUQ B;  3HKS A;  1ZYR C;  3UDX A;  1LAC A;  4A3J H;  2UUA Q;  1N33 Q;  1PVO A;  2KQ3 A;  2WP8 J;  1RKN A;  2NZ1 D;  4B08 A;  1BBX C;  2F0I A;  1XWE A;  1ZYR D;  3N52 A;  3OWF A;  4G4K A;  3J7Z C;  1QCB D;  1Z6H A;  4AYB B;  5M3F B;  4YWL A;  4PMW A;  1LYL A;  3GTG H;  5LMU L;  2P5Z X;  3UE1 A;  4ZLT F;  4X65 L;  4U68 A;  1CSP A;  2HDM A;  5COR A;  1QWY A;  5AJ3 L;  2KA7 A;  1GO3 E;  2K32 A;  5CYU A;  3U9S A;  3K5M A;  3X3N A;  3GV6 A;  2F0U A;  1KNE A;  1J9O A;  1JE4 A;  5IYB G;  3RZD B;  2F4I A;  1S5B D;  3EIV A;  1NMF A;  4R4I A;  4LF4 L;  3E3X A;  1LTS D;  1X6O A;  1TWF B;  3C1E A;  1EY9 A;  2VW9 A;  3IL8 A;  1KQS A;  1C8C A;  4B3S L;  3KK7 A;  1HCZ A;  1JR0 D;  2NBF A;  4K8I A;  2QKI C;  2LXJ A;  2KCT A;  1WOC A;  1V1P A;  5J1Z A;  1AW7 A;  3T1H Q;  2K05 A;  3M4O B;  1WVL A;  1M1K C;  3VDY A;  4LF7 L;  4JBK A;  2QDL A;  3K81 C;  5CV5 A;  2XRS D;  1SSO A;  2NVQ B;  2K03 A;  1IL2 A;  2PQA A;  2VB2 X;  1KTK A;  5CGK A;  1N32 Q;  3ZJY C;  4NB3 A;  1TR5 A;  3WOF A;  1KAB A;  5G3L D;  1YHA A;  2NB0 A;  5IYD H;  1MSH A;  1SYE A;  4JV5 L;  4P72 A;  5M5X H;  1VQF A;  3H94 A;  4DNI A;  4N9P A;  3C46 A;  2J0T D;  1X3P A;  1PRT D;  3FHW A;  5DM7 3;  1Y1W H;  2EIF A;  3IRB A;  2X6G A;  3S15 H;  4HIO A;  5DM6 3;  2DN8 A;  2IX0 A;  2OF1 A;  5C3X A;  2ALY B;  4C2M B;  3TN2 A;  2ZXP A;  3ICE A;  1W6J A;  1AZQ A;  2JYO A;  1TWA H;  1JOK A;  4IAL A;  5I9O A;  1SDF A;  1VQG A;  4FXK C;  4KD4 A;  1BQQ T;  2N55 A;  1B4O A;  1A62 A;  3VR6 A;  1F2M A;  4UAI A;  4X3K A;  2PMZ B;  4AQY Q;  2D2C C;  3HOY G;  2SDF A;  4C3H H;  4ULL A;  4DV0 Q;  3SK8 A;  1HQM C;  4DK0 A;  4EQ5 A;  4GKK Q;  1R9T H;  5FO9 B;  2I5L X;  1Q12 A;  1OXS C;  5EPL A;  1NTG A;  5JJK A;  5JVH 3;  3HOV H;  1K28 A;  2EYP A;  1LT6 D;  3ER0 A;  3MC0 B;  3R93 A;  2A5H A;  1S72 A;  2VQE Q;  3K5L A;  1L0Y B;  1DJR D;  3S2D B;  1KRS A;  2Z4I A;  3HOW G;  4KN7 C;  3VA5 A;  5M3F H;  5C0X H;  3PF5 A;  1IBL L;  1KDC A;  2JA8 G;  1XPU A;  4DV7 L;  4QUF A;  4GLA C;  5C0X J;  4DUZ L;  2DJG C;  1I94 L;  2O5I C;  3HOY B;  1H9S A;  1RJT A;  3CCS A;  1VQ5 A;  2F3V A;  1XJV A;  2ZXO A;  1U4M A;  1OXX K;  2B8F A;  4BA1 I;  5IIF A;  2RCF A;  4JI3 L;  2CH4 A;  5E4X A;  4CDD C;  3RZD H;  2MPM A;  2Z8L A;  1VQA A;  3STB C;  1ESF A;  4K6D A;  4DF7 A;  1MI2 A;  4QL5 A;  1PYW D;  5CR3 A;  3BVZ A;  4DAM A;  2SEB D;  3GTQ H;  3P20 A;  3CCJ A;  2JA8 B;  1PA6 A;  4LF5 L;  2EPB A;  1SNP A;  3A7A B;  4DK1 A;  3M4O H;  4DR4 L;  2L9H A;  2KCM A;  2B2U A;  1PXU A;  5FLX L;  4A3B G;  2BOS A;  1M8A A;  4JOI C;  1X65 A;  2I0Q A;  2NVQ H;  1HTP A;  1YBY A;  4JI4 Q;  1SNC A;  4GS3 A;  1UWV A;  4Q5V A;  3H3V I;  1NNX A;  1CZG A;  4CHT B;  3UDI A;  1HR0 Q;  4RHS A;  4XIG S;  2HCC A;  1TT2 A;  1IYJ B;  2R92 G;  5C4H A;  2K4K A;  4KY5 A;  2PZU A;  3W1G A;  1TWH H;  3NTI A;  2MNA A;  3KJO A;  3BYY B;  1SYG A;  3NQI A;  5GRO A;  1G29 1;  3BZC A;  5A2Q L;  2EYM A;  1YIJ A;  1UUP A;  1Y8O B;  4C2M H;  4LUO A;  4A3B B;  3DHQ A;  3C3L A;  5FLX E;  4I65 A;  2X69 A;  2VUM B;  5M5Y H;  5FLX c;  3PIP A;  4BA2 I;  4A3C G;  2F0J A;  3U4Z A;  3PIO 3;  3AMU A;  1W6K A;  1HNW L;  1PFS A;  1I4Q A;  4ILW A;  1HR0 W;  3MXN A;  4QQB X;  5NUC A;  4HSP A;  4WFN 3;  2R92 B;  4QB4 A;  1PTO F;  3I72 A;  1XMO Q;  1JOQ A;  3GTM H;  1NY4 A;  3M9B A;  4MTN A;  3A5Z B;  1LT3 D;  2DNC A;  3CC4 A;  1GOZ A;  2F52 A;  3H15 A;  4FXD A;  5IE8 A;  2MQH A;  4JI8 L;  1FGB D;  1B1Z A;  1I6H B;  2E2D C;  5A2Q E;  1K3B C;  4RH6 A;  4XDX A;  2LS0 1;  4F8M A;  2ZM6 L;  5E1F A;  5K36 G;  1VF7 A;  1I3Q B;  2AHO B;  4JI5 Q;  3QOL A;  2F0Q A;  4NXN L;  1O80 A;  1EYC A;  2EQS A;  3DMU A;  3S2D H;  3SGI A;  3TZD A;  4DR1 L;  1SR3 A;  2FHT A;  4Y7N B;  5CV4 A;  5TSS A;  4E6I A;  1IBK Q;  5IGF A;  1CI3 M;  2C5C A;  3TP7 A;  2AQ1 B;  2L12 A;  4YCW A;  5E3F A;  5LHY 1;  2EY1 A;  4X66 L;  1J6Q A;  2Y0S E;  4DAY B;  1G8Z D;  1UAP A;  2EY2 A;  1SMY C;  1VQD A;  1KLG D;  2I07 B;  1TKW B;  2AWO A;  4OHJ A;  4X62 L;  3M3Y B;  2EYH A;  1U5K A;  4UDU C;  3CME A;  4ZK9 B;  1XYI A;  1GUO A;  3CAM A;  3TP8 A;  1O78 A;  1IKL A;  5BN5 A;  3A8J E;  2UUA L;  4KY7 A;  1N33 L;  4BBR G;  2IWH A;  5K5P A;  4POG A;  3AEV A;  3HOW H;  4DNT B;  4HIM A;  1EIH A;  3CD6 A;  3H3V H;  3CPW A;  1JJC B;  4OIJ A;  2IY5 B;  1STA A;  4QGU A;  1MHW C;  2LMC B;  1Y1V G;  1PV4 A;  2DGY A;  3F2U A;  4ZKB B;  1KAW A;  1EIG A;  1SRO A;  4J15 A;  4IN3 A;  4JG2 A;  3CCV A;  1CK1 A;  3MVV A;  4PV1 C;  2CQO A;  2A6H C;  4Z9C B;  2HCI A;  2NTT A;  1WJJ A;  3NBH A;  3OSO A;  3I3C A;  4CJ2 C;  1U4L A;  2K5Q A;  1CA6 A;  2K5V A;  4J6H A;  4BBR B;  4KKU A;  2A6H D;  3F2C A;  2UXB Q;  1EUJ A;  1PH4 A;  1MGS A;  2MFI A;  4OL7 A;  1WTX A;  5FLM H;  1CT1 D;  4DUY Q;  1EWC A;  2OWO A;  1DGS A;  3W3A A;  1BOS A;  1HH2 P;  3CPF A;  1TS5 A;  4P2C B;  1Y1V B;  4ZRZ A;  1QZH A;  1QOH A;  1LTG D;  3T1H L;  4A3B H;  3FMC A;  2NZH A;  2WIN B;  4DV3 Q;  4GNX B;  3SXH A;  3I2Z A;  2WKC A;  2K75 A;  4DAV A;  4BXX G;  2K6A A;  4OXP A;  2K5W A;  5LMN Q;  2E2I B;  2JEB I;  4DR5 Q;  1VQ6 A;  1N32 L;  2R3Z A;  3CCU A;  1XXG A;  4JBJ A;  5CBA E;  3I4N G;  4GOP C;  4KY6 A;  1LAB A;  2R92 H;  1N34 Q;  1Y69 U;  5KIX A;  4DXF A;  2EDG A;  2ES2 A;  1ROD A;  3MXU A;  1L1O A;  3P75 A;  1CTM A;  2XTI A;  1E2W A;  1H9K A;  5DEH A;  2KUM A;  4PMC A;  4QIW B;  4HJ8 A;  3PUX A;  1F2Y A;  1PH3 A;  1DOK A;  4OEL B;  1J5E L;  1DOL A;  4DV2 Q;  4RHR A;  4RCN A;  2HD3 A;  3PUZ A;  1I3Q H;  1KHI A;  2K50 A;  1GHK A;  3H0G G;  2A69 D;  4A3C H;  1Q8I A;  1SE8 A;  2K7V A;  1SYB A;  2WFW A;  3KDF B;  2RA4 A;  2F0M A;  2M2L A;  4FF2 A;  1LTI D;  3I4N B;  4RMF A;  4DV6 Q;  1K0S A;  2EYF A;  5E4W C;  2BH2 A;  4J1M A;  4N9T A;  3CRL C;  3R2T A;  5KNB A;  4DK6 C;  3PO3 B;  4R4C A;  1Q81 C;  3M3Y H;  4DV0 L;  1LLR D;  2VY3 A;  4A3M G;  1SYF A;  4O0A A;  1X32 A;  1A0I A;  3GO5 A;  3H0G B;  4MNO A;  1AZP A;  5IP7 G;  5JEA G;  1PMR A;  2VQE L;  4KV6 A;  1H9J A;  2C9O A;  1ENA A;  3S24 A;  2NZO A;  1EY4 A;  1QG7 A;  4BWG B;  4YY3 Q;  3SK5 A;  3S16 B;  2B2U C;  1WCM G;  1ASY A;  4OGQ C;  3CHB D;  3KUP A;  2XN9 C;  1GXD C;  4A3M B;  2L4N A;  4KHV A;  2PCF B;  1I5F A;  2ICI A;  1XNR Q;  1RTN A;  3GDE A;  1Q1E A;  5ELN A;  1V1Q A;  4A3K G;  1S5D D;  4KKS A;  2Q2U A;  3HP3 A;  4APV A;  3DWQ A;  1F9P A;  1TVX A;  4BBS H;  1S40 A;  1TU2 B;  4I7A A;  2UXC Q;  1Y1V H;  4MZ9 A;  4JVZ A;  4UPA A;  1FNU A;  2KHS A;  3K7U C;  4FP5 D;  1TY0 A;  1WCM B;  2YTV A;  2LSS A;  3KF8 B;  5IGB A;  1NE3 A;  2KBN A;  1UNS A;  1KD1 C;  5KGU A;  3TS2 A;  1JC7 A;  2G9D A;  1JT8 A;  1HUM A;  4DV5 Q;  4CKE A;  1HUN A;  4IUQ A;  3TSS A;  4JI4 L;  4GN4 B;  2E2I H;  3LX0 A;  1IBM L;  2R61 A;  1FD7 D;  1PZI D;  2LXK A;  3M4P A;  3MAQ A;  2ZXR A;  4K5X A;  3LWE A;  3UDF A;  3KLS X;  1D5Z C;  3V96 A;  1LTL A;  1PYB A;  4A3K B;  3BDL A;  1HR0 L;  1VF5 C;  5BR8 Q;  4ZUJ A;  5FOB B;  5JAV A;  1WTR A;  1L0W A;  4JOI A;  1JIC A;  3LWU A;  1G2T A;  2PI2 A;  4CGY B;  1MBY A;  1TXY A;  3K0X A;  2Z6K C;  1PH9 A;  3DEO A;  1VQ9 A;  3CCQ A;  3RZO B;  1A3V A;  4DR7 Q;  2WII B;  1D5M C;  4QMG A;  2Y0S G;  4PZ8 A;  4BXX H;  2LKV A;  4WJ3 M;  4JK1 C;  1JWS D;  2MUY A;  1ENC A;  1STY A;  2K04 A;  2A1A A;  2BA0 A;  4DXG A;  3NEM A;  4H02 A;  5ELC A;  3I4N H;  3S1N B;  4HAE A;  4LFB L;  3NK9 A;  5CBE E;  1XMO L;  2EYO A;  1NUC A;  4G57 A;  3OTO Q;  2NN6 G;  1SBB B;  1SNQ A;  1YNN D;  5EBD A;  1A3U A;  5M5W B;  1UE7 A;  2FFK B;  1C48 A;  2E76 C;  3FRP B;  1T9H A;  1VQN A;  1MSG A;  4LF6 Q;  2CKZ B;  3HOX G;  3OMG A;  3RUZ A;  3PUW A;  3M85 A;  1P16 A;  3H0G H;  2Y0S B;  4OON A;  3WDN A;  1EOV A;  1GVP A;  1LTR D;  4TKO B;  1BCP B;  4RKB A;  1K0R A;  2EY5 A;  4POF A;  1YJN A;  4JI5 L;  3G6E A;  2PNH A;  4QF4 A;  2KJX A;  4F88 A;  5C4Z A;  2UXD L;  3S1M B;  4OEM B;  1PYS B;  2EE1 A;  1IBK L;  4PMB A;  3K0Y A;  4DR2 Q;  3S16 H;  1S5F D;  3W1B A;  4RGN A;  4K14 A;  2CFM A;  4IOC A;  1U4R A;  4L5T A;  3I91 A;  5C3E G;  5KEE A;  3HOX B;  1QJO A;  4GKJ Q;  1WTP A;  5KNC A;  1EFW A;  3KLS A;  1L0X B;  4JBM A;  3D4W A;  4PQX A;  1CZW A;  2XVS A;  2NN6 I;  5DLQ E;  4ME3 A;  4XQJ A;  1G51 A;  2YU9 H;  5JEA J;  5D14 A;  2VQF L;  2CQA A;  1QZG A;  4IUP A;  1VQL A;  4OWX B;  3H91 A;  2Z4H A;  2Q8R E;  4CJ0 B;  1CHQ D;  3DM3 A;  5M3M G;  1WCM H;  1N8R C;  4YCV A;  1WTV A;  1JOR A;  4C3I G;  3BJU A;  5ELB A;  2IL8 A;  4ID6 A;  1XX8 A;  1S5E D;  1TWC B;  3NWT A;  2F4V Q;  4CKC A;  3MZ5 A;  1EZ8 A;  1YNJ C;  5C3E B;  2CCZ A;  3T51 B;  3S1R H;  4GN3 B;  1IYV A;  1WTH A;  2L55 A;  1R4Q B;  5D3I B;  4A3K H;  1YNJ D;  2GVB A;  1AEX A;  1PH8 A;  1S3O A;  1VQB A;  1Y8N B;  2Z1C A;  3QR8 A;  2B63 G;  3ERQ A;  1VQJ A;  3HKZ E;  2UXB L;  1HNX Q;  1BF4 A;  3ULL A;  1L1O C;  1HRJ A;  3NUC A;  2ZTD A;  3PV0 A;  2F1M A;  4MHE A;  4JI7 Q;  2WAC A;  5M3M B;  2RQX A;  1E7Z A;  4ODG A;  4C3I B;  3LGJ A;  1EYA A;  1PRT C;  3E9I A;  4DV3 L;  3KBG A;  1W3S A;  1KL9 A;  1CA5 A;  4H13 C;  3RLF A;  3SK4 A;  4IUT A;  2EJG C;  2KEE A;  4LF9 Q;  3HOU H;  4LW1 A;  4RCO A;  1LT5 D;  3S1N H;  1AE3 A;  3CP0 A;  4A3D G;  5AFW A;  4K0K L;  4HTH A;  3DUZ A;  4NP5 A;  5HUR A;  1WD0 A;  1MD2 D;  4O2D A;  2PPB C;  1N34 L;  2B63 B;  3GTL H;  4C3J G;  4LF8 Q;  3TP6 A;  1U4P A;  1D1I A;  4B3R Q;  3W5O A;  2JA5 G;  5J22 A;  3T13 A;  2VS1 A;  2FMM A;  1SJH D;  1LV9 A;  4LUV A;  3EN2 A;  4DV2 L;  1EU3 A;  4GOP A;  2K52 A;  1XMQ Q;  1XTD A;  2A73 B;  1ZXT A;  3A5U A;  5C6A A;  5EBC A;  4A3D B;  1HA5 A;  3PMF A;  5ELE A;  4TRD A;  4A3I G;  1QVF A;  3S1M H;  3GTP B;  1SN8 A;  4I7Z C;  3GTJ H;  2A19 A;  4DV6 L;  1Q7Y C;  2CW0 D;  2ICE C;  4IOA A;  4C3J B;  1P8L A;  2NN6 H;  3HZX A;  4OX9 Q;  2YTY A;  1PH7 A;  1GUS A;  2JA5 B;  1SJE D;  4IFD G;  2JA6 G;  3HOX H;  3OIQ A;  1C7Y A;  4LFC Q;  4B3M Q;  1HTL D;  1EYG A;  3BS1 A;  3K5O A;  3ERO A;  3R8B A;  1VMC A;  5IOD A;  4HMI A;  1EQQ A;  4UP7 A;  2H5X A;  3EVQ A;  4R4T A;  3MEH A;  4A3I B;  5IGD A;  5CV9 A;  2OT2 A;  1ET6 A;  4RG1 A;  1V1P B;  3F1Z A;  3CCE A;  2F0T A;  4X64 Q;  5JPM C;  1F9Q A;  1ML0 D;  1GD7 A;  2ID0 A;  1O7L A;  1V43 A;  1KLU D;  5CC4 A;  3A56 A;  4YY3 L;  2XWJ B;  1ZEQ X;  1FYC A;  3BDC A;  2L0C A;  2PQA B;  1EY7 A;  2F3W A;  2JA6 B;  1TWF H;  3K80 C;  5C3E H;  5ELD A;  3AYH B;  1YVC A;  2HDL A;  3QJY A;  2ENB A;  3V2T A;  1WI5 A;  5IWA L;  3DLL A;  1XNR L;  1A3T A;  5I2Y A;  2SNM A;  1CQV A;  2SNS A;  3GP7 A;  2F0W A;  2E5L Q;  4IFD I;  1XNQ Q;  3Q24 A;  1RD9 D;  3A74 A;  4WJ4 A;  1V8Q A;  2N49 A;  4DV4 Q;  2XNA C;  3U58 A;  5L37 A;  2HHH Q;  2VUM G;  2UXC L;  2HIX A;  1YIT A;  1IL8 A;  1YNX A;  4NPS A;  4C3I H;  5IYB H;  3G48 A;  2BE5 D;  3TS0 A;  1IKM A;  1UE5 A;  2BA1 A;  1BBW A; 
#chains in the Genus database with same CATH homology
 4DAY A;  3L3O C;  2TSS A;  5CV7 A;  3TBI B;  1BXT A;  2NWG A;  1RDP D;  2QIL A;  2EYL A;  4X3S A;  2IT1 A;  3DWA A;  2BDN A;  1GUG A;  1SEB D;  3BVG A;  1RCV D;  2E2H B;  3TZU A;  3NTH A;  4ZQ3 A;  2KCN A;  4KI0 A;  2B2V A;  3D6W A;  2K01 A;  2F0G A;  3T56 B;  5KND A;  5EKK A;  4A3E B;  2RSO A;  5I2X A;  2J4X A;  3EQL C;  2MJ8 A;  4O42 A;  2KEC A;  2A68 C;  1XTC D;  1AP0 A;  1IYU A;  2IX1 A;  3K6O A;  3J80 L;  1EOT A;  1H9M A;  1T5X D;  2EJF C;  3R2I A;  1HPC A;  2A68 D;  2RKS A;  5BN4 A;  4BY7 B;  5C3W A;  3NXW A;  3NE5 B;  1II3 A;  2O4X A;  2B8G A;  1LTA D;  1QIL A;  4KKT A;  2WV6 D;  3J81 L;  2DY7 A;  4G7O C;  3QB3 A;  4NMZ A;  1PZJ D;  1PFN A;  1ET9 A;  1RF2 D;  5D65 A;  1ILP A;  3FKI B;  1EEF D;  1TII D;  2EOT A;  3EJI A;  5DAU A;  2NVY B;  4X3T A;  3J80 E;  4QCL A;  4XT1 B;  2YYZ A;  2GA4 B;  3HRZ C;  1I4P A;  5JPN C;  3QG1 A;  3QWN A;  4IFD J;  1CQF A;  4HED A;  1K8M A;  1VMP A;  3URY A;  1CM9 A;  2K28 A;  4BS9 A;  1ICW A;  1I4H A;  3J81 E;  1TWG B;  2X6L A;  4XXE A;  2O5J C;  2E74 C;  2B2Y A;  2L5T A;  1GUT A;  4DN4 M;  3S17 B;  1KDB A;  1JOO A;  2VB3 X;  5M9O A;  2BCO A;  2M00 A;  2R93 B;  1SND A;  4OO1 G;  2XWB B;  1ESR A;  1EEI D;  5F2D A;  2QDB A;  4MN3 A;  4DGZ A;  3T53 B;  5EGT A;  2F0S A;  3FVQ A;  3H3V C;  4HMJ A;  4A3G B;  2KVM A;  3K7A B;  4RAU C;  4DA2 A;  2NYZ D;  3FPU B;  4ZUI A;  1LT4 D;  3DXJ C;  2PW7 A;  2PW5 A;  4ZYS A;  3I73 A;  3RMH A;  1JB3 A;  3GV3 A;  2A69 C;  1PDQ A;  3GTO B;  3HOZ B;  4RWS C;  1QB5 D;  1OXT A;  2OEO A;  3CKI B;  5KYL A;  3FPP A;  1SE3 A;  4IZ8 A;  4WRD A;  4OO1 I;  5J39 A;  4LMQ D;  2HUG A;  4EQN A;  2F0F A;  1A15 A;  2DY8 A;  3VYS A;  2IX3 A;  3S9W A;  3UI2 A;  3PUV A;  1K83 B;  1TQO A;  1B3A A;  4FVM A;  2VNU D;  3D6C A;  4CJ1 B;  5K36 H;  2BDO A;  3MA2 B;  2EY6 A;  3KBX A;  1BNZ A;  1HXY D;  3C1F A;  3VR3 A;  3NHH A;  1LTT D;  3OPO A;  1TY2 A;  1UEA B;  2J7Z A;  3S1Q B;  2F0V A;  3C2P A;  1SAP A;  4X3U A;  2B2T A;  1GUW A;  3TME A;  1SE4 A;  4XQN A;  1EY8 A;  1DXM A;  2EXZ A;  3AU7 A;  3ONA B;  3OIP A;  3CU7 A;  2A6E D;  1HA6 A;  2D62 A;  5G3L F;  4GZY C;  4IUR A;  2JP1 A;  4K5W A;  1J8I A;  1H9R A;  5C44 B;  3IAY A;  4RGO S;  1PRT F;  1STH A;  3MXP A;  4WJW A;  2RVL A;  4CBV A;  4NKL A;  1E2Z A;  5I4D A;  3H09 A;  4FF4 A;  4NW2 A;  1OO9 B;  3IFT A;  2FJ2 A;  2L1B A;  2B2V C;  4Q0F A;  4TSS A;  4FF3 A;  2JSO A;  1AFP A;  4EVO A;  1M4V A;  2KED A;  1KDA A;  2RDH A;  1B53 A;  4OO1 H;  3E5S A;  5BN3 A;  1JCK B;  1B9M A;  1SXT A;  5HGT A;  3MXG A;  3RD4 A;  2I46 A;  1HFG A;  3I90 A;  1HQR D;  4C1N I;  4HCE A;  4EQP A;  1NCV A;  5CMD A;  1Q90 A;  4O1N A;  4ZAI A;  4F7X A;  4DNR B;  3Q0A A;  1AN8 A;  5FK9 C;  1D6E C;  4H44 C;  2E2J B;  1YNN C;  1SYC A;  4PNY A;  4L8J A;  1PFB A;  4BY1 B;  4G7H C;  1RTO A;  4NDX A;  1S5C D;  2TMP A;  2F0P A;  3MTS A;  5M5X B;  1B50 A;  4K2K A;  2ZT9 C;  3BG3 A;  1Y1W B;  4XTC S;  4KJO A;  1DCZ A;  4H7B A;  3DEP A;  1HHV A;  1I50 B;  1EL0 A;  1QNK A;  2F03 A;  1FR3 A;  1TWA B;  2JE6 I;  5DNF A;  2Q8T A;  3D4R A;  1I6V C;  2B2W C;  2HQE A;  5D3D A;  2B2Y C;  1STB A;  1VCI A;  4YIJ A;  2K1B A;  4EGV A;  5JEA H;  3SR1 A;  2NVX B;  4IUU A;  1EU4 A;  5I6Y A;  1Z47 A;  2MHV A;  3DM1 A;  3HOV B;  3VYU A;  1DD2 A;  3GQB A;  1NAP A;  2G9H D;  1G6Z A;  3GD7 A;  2B39 A;  4XQQ A;  4WOR A;  3LNN A;  1G2S A;  1RHP A;  1IHZ A;  4MIU A;  1KNA A;  1ILQ A;  4KJN A;  4RKL A;  4XT3 B;  1EFI D;  2EJM A;  1PLF A;  1STG A;  5C0X I;  5JOB A;  3HGB A;  3BDO A;  5C4X B;  3I4M B;  1STN A;  1SE2 A;  3GTQ B;  3I8Z A;  2V4D A;  5KYI A;  5EJW A;  1A2U A;  4FXG C;  4KN4 C;  5FO8 B;  4HN7 A;  1I4R A;  2PZW A;  1LTB D;  4S3S A;  4J8Q A;  1TS2 A;  3D4D A;  2NVT B;  1A6X A;  3SEB A;  1TWH B;  2JXM B;  2D5D A;  3PIP 3;  1Q1B A;  1SNM A;  2CW0 C;  3HS0 C;  3JAM L;  1SFO B;  4R8I A;  4L63 B;  3NPP A;  1DZ1 A;  3QIA A;  5M5Y B;  4XYQ A;  4DFA A;  1JWM D;  2B2T C;  5IOC A;  2F0L A;  4L6T B;  3S14 B;  3QO2 A;  4A3F B;  1BDO A;  5LL6 X;  3L7Z C;  3GTM B;  2KCC A;  3TP5 A;  1K8O A;  2D9U A;  1WTW A;  1E2V A;  1F2Z A;  3JAM E;  2RBM A;  2AWN A;  3OW7 A;  1EQT A;  3N6R A;  2DNE A;  5LL6 S;  3IFD A;  3BYT B;  4IUV A;  1BCP C;  3A54 A;  1EQV A;  4FO2 A;  3M7G A;  3X3M A;  2Q8I B;  2JA7 B;  1BCP D;  1LO5 D;  3MFG A;  5C5M A;  1VDZ A;  3ND9 A;  4FNF A;  4DU9 A;  3NSW A;  3S2H B;  2BE5 C;  5COY A;  5EPJ A;  3GTK B;  3HOW B;  1F2L A;  1B9N A;  2A74 C;  1B2T A;  5JVG 3;  4KD3 A;  3BVM A;  2NUC A;  2F0O A;  2F0H A;  2PO4 A;  1DYQ A;  4C1N K;  3ZYY X;  2O2L D;  3OMC A;  3SDZ A;  2PQE A;  5EPK A;  1TS4 A;  5IGC A;  3R3O A;  1Q3L A;  3QOJ A;  2PZT A;  1QNU A;  4RGT A;  1O7Y A;  1U9R A;  4KMU C;  1HFN A;  5I9P A;  1WTQ A;  1Z7T A;  2EYJ A;  1EZ6 A;  3SVM A;  3A8K E;  2AUJ D;  2MGS A;  1F9S A;  4G7Z C;  4F87 A;  3I70 A;  1A2T A;  4A93 B;  1H9S B;  1SYD A;  2KOL A;  1OXV A;  1BR9 A;  5FO7 B;  3NQT A;  1WD1 A;  1PTO B;  1EYD A;  1IW7 C;  2PYK A;  1B44 D;  2XIW A;  1JQY D;  3A55 A;  4HSV A;  4LJZ C;  5ISR A;  4DAP A;  1IW7 D;  2QCP X;  3TDQ A;  3P1H A;  5CV6 A;  3J7A V;  2XRQ D;  4LK1 C;  5IT9 L;  1STE A;  2R7Z B;  1C4Q A;  4IFD H;  2F0E A;  1S4Z A;  4B9X A;  3MWY W;  1OXU A;  4IUN A;  1KAA A;  3T16 A;  3K59 A;  1R4P B;  5JJZ A;  5CV8 A;  2LFN A;  3Q22 A;  1PFM A;  1X3Q A;  3M4Y A;  3K57 A;  1SMY D;  1F9R A;  3I4L A;  5IGE A;  2B2W A;  4QUC A;  5IT9 E;  4U67 3;  3SHL A;  1FNW A;  1DM0 B;  3HKZ B;  1WTO A;  5EKI A;  3M7N A;  2IJ0 A;  2F0N A;  3EA6 A;  2QF7 A;  4CKB A;  4RGM A;  2IPK D;  4RFB A;  3P7J A;  2EVB A;  2OXP A;  3VA7 A;  3AB9 A;  3D31 A;  2WB1 B;  3HG9 A;  3SE0 A;  4IQZ A;  4LAA A;  3E6Z X;  3CQZ B;  4C56 C;  2K33 A;  4M1U B;  2AQ3 B;  3PUY A;  1V1O A;  4BBS B;  4KK7 A;  3MHB A;  1QE6 A;  1JWU D;  1F77 A;  4KTA A;  3G6J B;  2FIN B;  2F0K A;  1D5X C;  3SK6 A;  1PTO H;  3A8I E;  2JEA I;  3KLR A;  3VR5 A;  1TS3 A;  2VXW A;  3NBI A;  1O7Z A;  2E75 C;  4ABN A;  4TQU S;  3BZD B;  2RDG A;  2QEJ C;  4XYO A;  2EZV A;  5T1I A;  3KF8 A;  2L11 A;  2IW3 A;  5IGG A;  3NWS A;  3Q23 A;  5C4J B;  4R9W A;  1G91 A;  2NTS A;  4HR7 B;  3W2D A;  1T5E A;  1Y8P B;  2XSC A;  2H4O A;  4ZKC B;  3VYT A;  2FMC A;  3HEJ A;  3ITP A;  4V19 0;  3G7L A;  1SNO A;  3D8G A;  5EKL A;  4K8J A;  4FYD A;  3PO2 B;  1ONL A;  4JBW A;  3ND8 A;  1PTO C;  4H0L C;  3NP8 A;  3OWE B;  1DON A;  2A6E C;  1EY6 A;  3T4A C;  5EQ0 A;  1PTO D;  3EFX D;  4M8A A;  3D3R A;  1GJX A;  3H6M A;  2WAQ B;  1FNV A;  3OOC A;  3VR2 A;  3IKJ A;  2WKD A;  4A3J B;  5T1G A;  1D1K A;  5I6W A;  1GUN A;  4EQO A;  2AUK A;  2LY7 A;  3GTG B;  1BUV T;  1I4G A;  3U9O A;  1NR4 A;  1GHJ A;  1PRT B;  4KHZ A;  2YU9 B;  4FF1 A;  3V05 A;  2H1E A;  1EY0 A;  1CHP D;  2SOB A;  3FEW X;  1NR2 A;  2R6G A;  2RSN A;  2CHB D;  3O13 A;  1NSN S;  2PNR C;  3S1R B;  4B9W A;  1I4X A;  2AQ2 B;  5KRU A;  4RA8 A;  3NTK A;  3CRK C;  1PZK D;  3VYR A;  4K6L A;  3A7L A;  2K5D A;  5FKA C;  1E0B A;  1DOM A;  3OHX C;  1CFM A;  3DWP A;  3FDT A;  5A35 A;  1ZKO A;  3J7Y W;  3HOU B;  1EWH A;  4C3H G;  3K58 A;  5ELF A;  1BCP F;  4K2L A;  3S15 B;  2CVR A;  3GTL B;  4ME5 A;  2MP1 A;  3K5N A;  4R8N A;  2M9V A;  1EY5 A;  3MFY A;  3L9A X;  3Q6S A;  4K5V A;  3VR4 A;  3J7A F;  5C0X G;  1ENF A;  2F0D A;  1D2B A;  5C5L A;  4OIK A;  2RDF A;  4C3H B;  4V0B A;  3GTJ B;  4HCS A;  3WOE A;  1R9T B;  2N88 A;  3E0J A;  1BO0 A;  1ZYR C;  1LAC A;  2KQ3 A;  2WP8 J;  1RKN A;  2NZ1 D;  4B08 A;  1BBX C;  2F0I A;  1XWE A;  1ZYR D;  3N52 A;  3OWF A;  4G4K A;  1QCB D;  1Z6H A;  4AYB B;  5M3F B;  4PMW A;  4ZLT F;  4U68 A;  2HDM A;  5COR A;  1QWY A;  2KA7 A;  5CYU A;  2K32 A;  3U9S A;  3K5M A;  3X3N A;  3GV6 A;  2F0U A;  1KNE A;  1J9O A;  1JE4 A;  3RZD B;  2F4I A;  1S5B D;  1LTS D;  1TWF B;  3C1E A;  1EY9 A;  3IL8 A;  1C8C A;  3KK7 A;  1HCZ A;  1JR0 D;  2NBF A;  4K8I A;  2QKI C;  1V1P A;  5J1Z A;  1AW7 A;  2K05 A;  3M4O B;  1WVL A;  5CV5 A;  2XRS D;  1SSO A;  2NVQ B;  2K03 A;  2VB2 X;  1KTK A;  5CGK A;  1TR5 A;  3WOF A;  1KAB A;  5G3L D;  2NB0 A;  1MSH A;  1SYE A;  3H94 A;  4N9P A;  3C46 A;  2J0T D;  1X3P A;  1PRT D;  5DM7 3;  2X6G A;  5DM6 3;  2DN8 A;  2IX0 A;  2OF1 A;  5C3X A;  4C2M B;  3TN2 A;  2ZXP A;  1W6J A;  1AZQ A;  2JYO A;  1JOK A;  4IAL A;  5I9O A;  1SDF A;  4KD4 A;  4FXK C;  1BQQ T;  2N55 A;  1B4O A;  3VR6 A;  1F2M A;  4UAI A;  4X3K A;  2PMZ B;  2D2C C;  2SDF A;  4ULL A;  3SK8 A;  1HQM C;  4DK0 A;  5FO9 B;  1Q12 A;  1OXS C;  5EPL A;  5JVH 3;  2EYP A;  1LT6 D;  3R93 A;  3MC0 B;  2A5H A;  3K5L A;  1L0Y B;  1DJR D;  3S2D B;  2Z4I A;  4KN7 C;  3VA5 A;  5C0X H;  1KDC A;  4QUF A;  5C0X J;  2O5I C;  3HOY B;  1H9S A;  1RJT A;  2F3V A;  2ZXO A;  5IIF A;  1U4M A;  1OXX K;  2B8F A;  4BA1 I;  5E4X A;  2MPM A;  2Z8L A;  1ESF A;  4K6D A;  4DF7 A;  1MI2 A;  1PYW D;  5CR3 A;  3BVZ A;  2SEB D;  3P20 A;  2JA8 B;  2EPB A;  1SNP A;  3A7A B;  4DK1 A;  2L9H A;  2B2U A;  1PXU A;  5FLX L;  2BOS A;  1M8A A;  1HTP A;  1SNC A;  4Q5V A;  1CZG A;  4CHT B;  4RHS A;  4XIG S;  2HCC A;  1TT2 A;  5C4H A;  4KY5 A;  2PZU A;  3NTI A;  3BYY B;  1SYG A;  3NQI A;  1G29 1;  5A2Q L;  2EYM A;  1UUP A;  1Y8O B;  4A3B B;  3DHQ A;  3C3L A;  5FLX E;  4I65 A;  2X69 A;  2VUM B;  4BA2 I;  2F0J A;  3PIO 3;  3AMU A;  1W6K A;  1I4Q A;  4ILW A;  3MXN A;  5NUC A;  4HSP A;  4WFN 3;  2R92 B;  4QB4 A;  1PTO F;  3I72 A;  1JOQ A;  1LT3 D;  2DNC A;  1GOZ A;  4FXD A;  1FGB D;  1B1Z A;  1I6H B;  2E2D C;  5A2Q E;  4RH6 A;  4XDX A;  2LS0 1;  4F8M A;  5E1F A;  5K36 G;  1VF7 A;  1I3Q B;  3QOL A;  2F0Q A;  1O80 A;  1EYC A;  3DMU A;  3TZD A;  2FHT A;  4Y7N B;  5CV4 A;  5TSS A;  4E6I A;  5IGF A;  1CI3 M;  2C5C A;  3TP7 A;  2AQ1 B;  2L12 A;  5E3F A;  5LHY 1;  2EY1 A;  1G8Z D;  1UAP A;  2EY2 A;  1SMY C;  1KLG D;  2I07 B;  1TKW B;  2AWO A;  4OHJ A;  3M3Y B;  2EYH A;  4UDU C;  4ZK9 B;  1XYI A;  1GUO A;  3TP8 A;  1O78 A;  1IKL A;  5BN5 A;  3A8J E;  4KY7 A;  2IWH A;  5K5P A;  4DNT B;  1EIH A;  4OIJ A;  1STA A;  2LMC B;  3F2U A;  4ZKB B;  1EIG A;  4IN3 A;  1CK1 A;  3MVV A;  4PV1 C;  2A6H C;  4Z9C B;  2HCI A;  2NTT A;  3NBH A;  3OSO A;  3I3C A;  4CJ2 C;  1U4L A;  2K5Q A;  1CA6 A;  4J6H A;  4BBR B;  4KKU A;  2A6H D;  1MGS A;  4OL7 A;  1WTX A;  1CT1 D;  1EWC A;  3W3A A;  1BOS A;  1TS5 A;  4P2C B;  1Y1V B;  4ZRZ A;  1QOH A;  1LTG D;  3FMC A;  2WIN B;  3SXH A;  2WKC A;  4DAV A;  2K6A A;  2K5W A;  2E2I B;  2JEB I;  2R3Z A;  1XXG A;  5CBA E;  4KY6 A;  1LAB A;  1Y69 U;  5KIX A;  4DXF A;  2EDG A;  1ROD A;  3MXU A;  3P75 A;  1CTM A;  1E2W A;  1H9K A;  5DEH A;  2KUM A;  4PMC A;  4QIW B;  3PUX A;  1F2Y A;  1DOK A;  1DOL A;  4RHR A;  4RCN A;  3PUZ A;  1GHK A;  2A69 D;  1Q8I A;  2K7V A;  1SYB A;  2RA4 A;  2F0M A;  2M2L A;  4FF2 A;  1LTI D;  3I4N B;  2EYF A;  5E4W C;  4J1M A;  4N9T A;  3CRL C;  3R2T A;  5KNB A;  3PO3 B;  1LLR D;  1SYF A;  1X32 A;  3GO5 A;  3H0G B;  1AZP A;  5JEA G;  1PMR A;  4KV6 A;  1H9J A;  2C9O A;  1ENA A;  1EY4 A;  1QG7 A;  4BWG B;  3SK5 A;  3S16 B;  2B2U C;  4OGQ C;  3CHB D;  3KUP A;  2XN9 C;  1GXD C;  4A3M B;  2L4N A;  4KHV A;  2PCF B;  2ICI A;  1RTN A;  1Q1E A;  1S5D D;  4KKS A;  3HP3 A;  3DWQ A;  1F9P A;  1TVX A;  1TU2 B;  1FNU A;  2KHS A;  4FP5 D;  1TY0 A;  1WCM B;  5IGB A;  1UNS A;  5KGU A;  1JC7 A;  2G9D A;  1HUM A;  4CKE A;  1HUN A;  4IUQ A;  3TSS A;  3LX0 A;  2R61 A;  1FD7 D;  1PZI D;  3MAQ A;  2ZXR A;  4K5X A;  3LWE A;  3KLS X;  1D5Z C;  3V96 A;  4A3K B;  3BDL A;  1VF5 C;  4ZUJ A;  5FOB B;  5JAV A;  1WTR A;  1JIC A;  3LWU A;  1G2T A;  4CGY B;  1MBY A;  3DEO A;  3RZO B;  1A3V A;  2WII B;  1D5M C;  4QMG A;  2LKV A;  4JK1 C;  1JWS D;  2MUY A;  1ENC A;  1STY A;  2K04 A;  2BA0 A;  4DXG A;  5ELC A;  3S1N B;  4HAE A;  3NK9 A;  5CBE E;  2EYO A;  1NUC A;  4G57 A;  2NN6 G;  1SBB B;  1SNQ A;  1YNN D;  5EBD A;  1A3U A;  5M5W B;  2FFK B;  1C48 A;  2E76 C;  3FRP B;  1MSG A;  3OMG A;  3RUZ A;  3PUW A;  3M85 A;  2Y0S B;  3WDN A;  1LTR D;  4TKO B;  1BCP B;  4RKB A;  2EY5 A;  4QF4 A;  2KJX A;  4F88 A;  5C4Z A;  3S1M B;  2EE1 A;  4PMB A;  3K0Y A;  1S5F D;  4RGN A;  4K14 A;  1U4R A;  3I91 A;  5KEE A;  3HOX B;  1QJO A;  1WTP A;  5KNC A;  3KLS A;  1L0X B;  3D4W A;  4PQX A;  1CZW A;  2XVS A;  2NN6 I;  4XQJ A;  5JEA J;  5D14 A;  2CQA A;  4IUP A;  3H91 A;  2Z4H A;  2Q8R E;  4CJ0 B;  1CHQ D;  1WTV A;  1JOR A;  4C3I G;  5ELB A;  2IL8 A;  4ID6 A;  1XX8 A;  1S5E D;  1TWC B;  3NWT A;  4CKC A;  3MZ5 A;  1EZ8 A;  1YNJ C;  5C3E B;  3T51 B;  1IYV A;  2L55 A;  1R4Q B;  5D3I B;  1YNJ D;  1AEX A;  1Y8N B;  2Z1C A;  3ERQ A;  1BF4 A;  1HRJ A;  3NUC A;  3PV0 A;  2F1M A;  4MHE A;  2WAC A;  5M3M B;  2RQX A;  4ODG A;  4C3I B;  1EYA A;  1PRT C;  3KBG A;  1CA5 A;  4H13 C;  3RLF A;  3SK4 A;  4IUT A;  2EJG C;  2KEE A;  4RCO A;  1LT5 D;  5AFW A;  5HUR A;  3DUZ A;  4HTH A;  4NP5 A;  1WD0 A;  1MD2 D;  2PPB C;  2B63 B;  4C3J G;  3TP6 A;  1U4P A;  1D1I A;  5J22 A;  3T13 A;  2FMM A;  1SJH D;  1LV9 A;  1EU3 A;  2A73 B;  1ZXT A;  5C6A A;  5EBC A;  4A3D B;  1HA5 A;  3PMF A;  5ELE A;  4TRD A;  3GTP B;  4I7Z C;  2CW0 D;  2ICE C;  4C3J B;  2NN6 H;  3HZX A;  1GUS A;  2JA5 B;  1SJE D;  4IFD G;  3OIQ A;  1HTL D;  3BS1 A;  3K5O A;  3ERO A;  5IOD A;  1VMC A;  4HMI A;  3EVQ A;  3MEH A;  4A3I B;  5IGD A;  5CV9 A;  2OT2 A;  1ET6 A;  1V1P B;  2F0T A;  5JPM C;  1F9Q A;  1ML0 D;  2ID0 A;  1O7L A;  1V43 A;  1KLU D;  5CC4 A;  3A56 A;  2XWJ B;  1ZEQ X;  1FYC A;  3BDC A;  2L0C A;  1EY7 A;  2F3W A;  2JA6 B;  5ELD A;  2HDL A;  3QJY A;  2ENB A;  3V2T A;  1A3T A;  5I2Y A;  2SNM A;  1CQV A;  2SNS A;  3GP7 A;  2F0W A;  4IFD I;  3Q24 A;  1RD9 D;  1V8Q A;  2XNA C;  1IL8 A;  2BE5 D;  1IKM A;  2BA1 A;  3R8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...