1E7ZA

Crystal structure of the emap2/rna binding domain of the p43 protein from human aminoacyl-trna synthetase complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
173
Chain Sequence
AKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIKLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II
publication title Structure of the Emapii Domain of Human Aminoacyl-tRNA Synthetase Complex Reveals Evolutionary Dimeric Mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding domain
total genus 38
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1e7zA00
4DV7L 3T1YL 4X62L 1OXXK 4O0AA 5LMNQ 1I5FA 4A3IH 1XPOA 1V9PA 2JA6G 4X62Q 3NENA 1QVCA 4C2MH 4A3EH 4JOIC 3CC2A 2K50A 3JC66 4R4IA 4DR1Q 4AYBG 4BA2I 4B3RQ 2Q2HA 3JAMc 4QL5A 5GADC 1WFQA 2LSSA 2Z0SA 3HFZB 2HHHL 3CQZH 3GTQH 4LF9Q 1IBKQ 3CC4A 4BBSH 1N33L 2VS1A 3HOYG 5C0XG 4JG2A 3CCUA 2A1AA 4GOPC 1VQ9A 4DUYQ 4JI4Q 1I6HH 1VQEA 4AYBE 5ELOA 4DV3Q 4HIOA 2UUAL 5GAHC 1G291 1GVPA 2HIVA 4BY1G 2RHSB 1QZGA 1K8AC 4DK3C 3CC7A 1VQFA 4BY7G 4OWTB 3ULJA 1NMGA 1L0WA 3B6YA 1Z9FA 1V1QA 2NVYH 3W1GA 3K7UC 1VQMA 1BKBA 1VQAA 3CPFA 3ULLA 4C3JH 3KDFB 4C3HH 4DV5Q 2F4VQ 3I4NH 1C9OA 2D62A 1PH4A 1XTDA 3KF6A 4DV1Q 1PA6A 4DUZL 1N36Q 2N3SA 3HOWG 1VQLA 5IWAL 3CCEA 4MTNA 2VY3A 1L2FA 1UEBA 4HJ7A 2NZHA 1EWIA 1EOVA 5HY6A 3F2DA 3CPWA 3M4PA 2E5LQ 1HNWL 4JI1L 5C44H 4LF4Q 4B3TL 1Y1WH 5C0XJ 1SRUA 3S24A 1J5EL 1PH3A 2C35B 2KCMA 4DR6L 1SLJA 1ASYA 4POFA 1L1OC 4YY3L 1VQ8A 1CKMA 4A3CH 1QUQA 1OXSC 1PFSA 4YCUA 2VUMG 3F1ZA 1HZAA 1IBLL 1OTCA 1SFOH 3U58A 2UUBL 2N8NA 3E9IA 3I4MG 1UWVA 4POGA 1KXLA 4DR4L 1XMQQ 4EQ5A 4OXPA 2R6GA 5IYCH 2K5VA 1VQIA 4RMFA 3W5OA 3CCSA 4A3DG 3RNUA 3FHWA 4IJHA 2UUCL 3BJUA 5M3MG 2Q2TA 5GAGC 2YV5A 1YHQA 2K14A 3DLLA 3KFUA 1M90C 2WB1G 3NBHB 5ELNA 3PO2H 2LXKA 3CCLA 1A62A 4DV4L 3CW2C 1AE2A 1KHIA 5BR8Q 4OONA 1HZ9A 1W2BA 4L5QA 4ME3A 1J6QA 2UXCL 4Y52H 4GS3A 3G6EA 2NVQH 5IP7G 4JBMA 2ID0A 1YNXA 3I7FA 1N34Q 5JJIA 1CUKA 2E2IH 1VQKA 1E7ZA 1NE3A 3I56A 1MJCA 2WB1E 3ICEA 2R93G 3GTMH 2HQLA 3L0OA 1EFWA 1AE3A 1HH2P 3H15A 4JI7L 4OWXB 2B63G 1YITA 1TWGH 4A3FH 4JI7Q 5E7NA 1XNQL 2QA4A 4LFCQ 2GVBA 3M7NA 4A76A 3GD7A 1VQCA 4X65L 4HIKA 3A5ZB 3S2HH 4HJAA 4LF6L 4LF7Q 4A3MG 4PZ7A 1KD1C 2GVAA 3CCJA 2CQOA 4A3LH 2Q2IA 4DR2L 2F52A 2ZJPA 3HOZH 4IPHA 2JA7H 3HOUG 3ERSX 4KHPL 4X66L 1BVSA 1KIXA 2UXDQ 1BBUA 2JQOA 5HGQA 5K36G 1VQBA 3A74A 3ZJYC 4YHHL 1NJIC 1HR0W 3FKIG 1CKOA 5C4XG 2D0PA 4NXNL 3PIOA 3MEFA 2OTJA 2B3GA 5FLMH 2WP8J 4LUZA 5AJ3L 2Y0SG 1SN8A 2WAQG 5IY0A 4JI6Q 3H3VH 5M5WH 3CAMA 4JV5L 4BA1I 4R1JA 3CP0A 1D7QA 2K5NA 3SGIA 2HIXA 2CCZA 4JBJA 1IL2A 1QUQB 2K75A 1K8GA 3H0GH 5IP9H 2E8GA 3RLFA 1N32Q 1PVOA 1XPUA 2DGYA 1VCIA 1VQHA 5FJ8H 3PO3H 2HT1A 1TXYA 5LMNL 1HZCA 4A3KH 3S1RH 3M4OH 2OCEA 2Z6KC 2ZTCA 1VQ5A 2RCNA 2ZTEA 1Q46A 3PUVA 5C4JH 1E22A 1EQRA 4DR1L 2ASBA 4B3RL 1V43A 4IJLA 4X64Q 1HR0Q 4QY7A 1Y1VH 1YZ6A 2MO0A 4IO9A 4K0KL 4GLVB 5GROA 4LF9L 3BU2A 1IBKL 3TS2A 3KF8B 2R7ZH 4BBSG 4A93H 4DUYL 1NTGA 2CWPA 3D0FA 1KRSA 4JI4L 1B7YB 1VQ7A 4DV2Q 4K0KQ 2WFWA 2ALYB 4YCVA 4MNOA 4DV3L 4B3MQ 3AQQA 1Q86C 3S2DH 1C0AA 2ZTDA 2R92G 4QQBX 4NPSA 3HKSA 4TQUS 4OO1I 2JA6H 1D8LA 3K0XA 3GTOH 4X6AH 1EUJA 2RF4A 1TWFH 2FXQA 1YEZA 5IT9c 4DR5Q 1YJWA 4A3GH 1LYLA 4O2DA 2IX1A 5GAEC 4DV5L 2F4VL 2E2JH 2VNUD 3E9HA 3RR5A 3CCRA 1XPRA 4LF8Q 2AMCB 4DV1L 3T1HQ 3I4NG 1N36L 3HOVG 3J80i 1E1TA 1TWAH 1X65A 3K80C 4BXXG 3HOYH 2N78A 3HOXH 3I2ZA 3GTPH 4HIMA 1NMFA 2KHJA 1OXVA 1EIFA 4LFBQ 1RIPA 1FVIA 2E5LL 2AWOA 2WAQE 1XMOQ 2AKWB 1HZBA 4GN5A 4NB3A 4KLKA 1UE5A 3HKZE 1IYJB 3UDGA 4LF4L 3KOJA 4BY1H 1VQ6A 3K8AA 1SR3A 4A4IA 2MFIA 5IYBG 5M3FG 1IZ6A 4YCWA 2ZM6Q 1SROA 4BBRG 4AH6A 3G71A 3NEMA 5JJLA 3U50C 2PMZE 4MZ9A 4L5TA 3MXNB 3RLOA 4A3JH 3TREA 1SE8A 3A5UA 4A3CG 4OO1G 2MO1A 2VQFQ 1K0RA 2BH2A 4YWKA 3F8TA 3RN2A 4J15A 3K81C 1U5KA 5M5YH 2AWNA 4GNXA 2JJQA 1Q81C 1E24A 1CSQA 4QJFA 1XMQL 4GKJQ 4LW1A 4JI0Q 1FGUA 5LMUQ 1JMCA 1PH1A 2UU9L 3U4VA 3J81i 1JT8A 1CSPA 1HNXQ 5C3EG 2UU9Q 4LF5Q 4PMWA 5BR8L 3U4ZA 3CF5A 4DR3Q 4GLXA 2JK8A 3M4QA 1T9HA 2JEAI 1H95A 4UPAA 1W3SA 1WI5A 3PV0A 1X9NA 2EXDA 2JA5G 3H3VI 4IPGA 3S1MH 1PYBA 1N34L 4GOPB 1GO3E 1A0IA 3DM3A 1YVCA 3EN2A 3Q8DA 3J7ZC 4P73A 2ATWA 2VUMH 2CKZB 2KBNA 2KHIA 1KAWA 1PH8A 2IX0A 4UP7A 2VQEQ 4R4OA 3TEHB 1JJGA 3UDIA 1VQJA 5M5XH 1HNZQ 4IOCA 1QZHA 3UDXA 3OTOQ 4LFCL 1FJGQ 1QVFA 2L15A 4NXMQ 1X56A 4Y7NH 4A3DH 1Q8KA 1GM5A 2OQ0A 4LF7L 4OX9Q 2QGQA 2ZJQA 3VDYA 1OXTA 2VW9A 3S1NH 4JI3Q 3KLWA 3HOZG 1N8RC 3GTLH 2E2HH 1YJ9A 2UXDL 4TVAB 1MKHA 4LFAQ 5IP7H 3AFPA 3M9BA 4JYAQ 1WCMG 2PNHA 4R4QA 2N49A 3CD6A 1VQ4A 4JBWA 5JEAG 2R93H 1IBML 5FLMG 4JI6L 1XJVA 5J3BA 1IBMQ 3GTKH 2OWOA 2OTLA 1K83H 3UE0A 4WJ4A 1Q1EA 1I50H 5H1SE 2BH8A 3E0EA 2A19A 3UDFA 3KJOA 1S40A 4R4TA 1S72A 2IHFA 1YHBA 1G51A 3AFQA 3WWVA 1N32L 3H0GG 1G6PA 1UE1A 4GNXB 3ULPA 1EIYB 2JA8G 3HOUH 4JCVE 4GN4B 4B3SQ 4UP9A 2H5XA 3KJPA 4JBKA 4OWWB 4P72A 4DV6Q 1P16A 1B8AA 4A3IG 4IFDJ 4X64L 4P75A 1TWHH 4A3EG 1HR0L 3J80c 4JI8Q 3W1BA 4AQYQ 1Y1VG 3TRZA 2NZOA 5IYDH 4JOIA 2YTXA 2JA9A 1BBWA 2KENA 3GTJH 2R7ZG 4DR7Q 1LM0A 2IHEA 3TS0A 2R7DA 5JEAJ 4DV0L 5GQOA 4DV2L 4DK6C 3NELA 4IPCA 4JI2Q 3RZDH 1Q82C 2A8VA 4A3BH 5DLQE 1P8LA 4DV0Q 4B3ML 4KHZA 4GOPA 1WJJA 4L5RC 2LXJA 1WYDA 4XTCS 3RZOH 4GN3B 3PUXA 2GN5A 4DV7Q 3T1YQ 2D0OA 4H02A 2XGTA 4DR5L 4FDBA 3PCOB 4A3GG 3L7ZC 1KL9A 1A63A 1UE6A 3PUZA 4LF8L 1JJCB 2CWAA 3HKZG 3T1HL 1YI2A 1AH9A 1I3QH 2BA0A 1EYGA 2Q2UA 3OYYA 2HHHQ 2NVTH 4PZ6A 2K5HA 3HOXG 1JJ2A 2JEBI 4KI0A 3S16H 1E3PA 1N33Q 4LFBL 3J81c 1QVGA 2PI2A 1XMOL 3AYHB 1PH9A 3I4OA 3IRBA 4PG3A 3PSIA 2R92H 1VQGA 3OW2A 1NBWA 2V1CC 5C44G 2I5HA 2UUAQ 1K9MC 2OQKA 2F3IA 3GO5A 2ZM6L 1Y1WG 1PH2A 3BZKA 2PQAA 2K52A 4BY7H 1NY4A 2EQSA 3PGZA 2VZAA 4IOAA 4YWLA 4DPGA 4ALPA 2YU9H 4JI5L 1WOCA 2VQFL 2I5LX 4A75A 4A3JG 4LUOA 1O7IA 3S1QH 1HJPA 2B29A 4JI5Q 1L1OA 3HOVH 2AHOB 1YJNA 2I5MX 4BXXH 4GKJL 4QIWE 3M3YH 3JAMi 1K73C 4JI0L 3AEVA 1UE7A 3HOWH 1VS0A 3L2PA 3G4SA 4DUZQ 5LMUL 1YBYA 1VQPA 4C3IH 3CCQA 5IWAQ 3PO2G 4IFDI 5IYCG 3F2BA 4LNQA 1R9TH 3PIPA 1X6OA 4HJ5A 1EQQA 1HNXL 1CKNA 1DGSA 4LF5L 4DR3L 1PH5A 1FL0A 1Y14B 4P74A 4LUVA 4JI1Q 4DAMA 5IYBH 5M3FH 4B3TQ 4LWCA 3S14H 3I4MH 4BBRH 1X55A 2RHQB 4AIMA 4GLAC 1J5EQ 3J81j 1Q7YC 3J7A5 4DR6Q 1MIUA 4GNXC 3A0JA 4YY3Q 1SMXA 2MNAA 4APVA 4QGUA 2VQEL 2UXBL 1JE5A 1TWCH 2NN6I 2YTYA 2DUDA 1VQOA 1IBLQ 2UXBQ 1C7YA 1HNZL 3G48A 1ASZA 3OTOL 2UUBQ 4UY8C 3BZCA 3CCVA 2JE6I 1K3RA 4YWMA 5EAYA 4NXML 1FJGL 3RN5A 3STBD 1Z47A 1RL2A 1VQNA 4A3FG 3S17H 4DR4Q 4P71A 4OX9L 1X54A 1MJEA 5M3MH 1I94L 2UUCQ 3D31A 4JI3L 5C3EH 2QEXA 1I94Q 3EIVA 3S15H 4IFDG 1KQSA 4A3LG 3UE1A 4LFAL 1PYSB 2YTVA 2JA7G 4DV4Q 2JA5H 1PH6A 4GKKL 1PHJA 4JYAL 1VQDA 3PF5A 2UXCQ 2VL6A 3PF4A 4GKKQ 2I0QA 2EIFA 3F2CA 1OXUA 2CFMA 4WJ3M 2PI2E 2YYZA 1PH7A 3LGJA 1Q12A 2ES2A 2B63H 1S3OA 2K4KA 2PQAB 4RG1A 3FP9A 2IY5B 1GKHA 4DAYB 3GDEA 5FLXc 1XNQQ 3CCMA 2NN6G 1XNRL 3M85A 2NVXH 4JC0A 4XIGS 3GTGH 3TQYA 4X65Q 4A3MH 1XNRQ 1N9WA 1L1OB 4LF6Q 4DNIA 3KF6B 5IP9G 4B3SL 3KDFA 3K7AH 3KYHC 5LMNW 4DR2Q 2KCTA 5FJ8G 2MQHA 1U0LA 4HIDA 3PO3G 4DV6L 3STBC 1GD7A 4PZ8A 1IXRA 4R4CA 4HJ9A 4A3KG 1X3EA 5IE8A 4X66Q 1KRTA 3ER0A 3PUYA 1WCMH 4KHPQ 1M1KC 5C4XH 3FKIH 2Z6KA 1B70B 4L5SA 4JI8L 4YHHQ 4AQYL 1CKNB 1YIJA 4UP8A 4NXNQ 5C0XI 5IYDG 3CMEA 1JB7A 1LTLA 1E1OA 2ZJRA 1A8VA 5AJ3Q 1Q1BA 4DR7L 3CMAA 4DKAC 2BA1A 2IT1A 1LUZA 4JI2L 4EX5A 4JV5Q 4A93G 1HNWQ 3PUWA 3RLNA 5JJKA 3EBEA 4A3BG 1X3GA 4HJ8A 3CXCA 3I55A 2JA8H 1PV4A 4IPDA 1YHAA 2Y0SE 1X3FA 2R7FA 1KC8C 2XTIA
chains in the Genus database with same CATH superfamily
4DV7L 4NW2A 4DN4M 4S3SA 5LMNQ 1I5FA 1V9PA 4X62Q 4RHRA 1F2ZA 4DR1Q 5IOCA 1PRTD 3JAMc 4G7HC 2Z0SA 2HHHL 3CQZH 4LF9Q 1TU2B 4QB4A 3EJIA 4XYQA 3NXWA 3CCUA 2LFNA 4DUYQ 2HQEA 4ULLA 5COYA 3GTQB 2A68D 1EOTA 4HIOA 1I4HA 1G291 5K5PA 1O7YA 3ULJA 3MXGA 4F87A 1V1QA 3W1GA 1VQMA 1X32A 1VQAA 5I2YA 4C3HH 4DV5Q 1ZKOA 4FVMA 1WTWA 1TIID 4UHVA 4DV1Q 1N36Q 2NVYB 2N3SA 3HOWG 3CCEA 2PZWA 3TDQA 3HKZB 4C3JB 2NZHA 1QWYA 2EY2A 4QUCA 4FXGC 3CPWA 3M4PA 3F2DA 1PZJD 1M8AA 5C44H 3W3AA 1BCPB 1JOOA 2DJGC 3NPPA 3X3NA 1CKMA 1ICWA 3K0YA 5JPMC 3I4LA 3F1ZA 3I91A 1SFOH 3U58A 4HN7A 4KN4C 2N8NA 4KK7A 3I4MG 4DR4L 4OXPA 1EL0A 2K5VA 1VQIA 3KFUA 4ZQ3A 2B8GA 2YV5A 5GAGC 1M90C 1JOQA 3CU7A 4QMGA 2WIIB 2JP1A 5G3LF 1A62A 5E4XA 2OF1A 1AE2A 4DXGA 4ME3A 2F0TA 5CV6A 4Y52H 4GS3A 3G6EA 5IP7G 1SNPA 1A2UA 2ID0A 3I7FA 1N34Q 1JORA 1NE3A 2WB1E 4HTHA 1HH2P 3P20A 5ELDA 1YITA 4A3FH 1AP0A 1SXTA 2E2IB 3G6JB 3S2HH 4HJAA 4LF6L 2F0VA 5IGEA 1FGBD 2CQOA 4A3LH 4DR2L 1B1ZA 4BWGB 4WRDA 3NBIA 3FVQA 1HA5A 2F0UA 4X66L 4EQPA 1KIXA 5K36G 1JB3A 4G57A 3ZJYC 1NJIC 1CKOA 3DHQA 3HOZB 2EVBA 4K6DA 4LUZA 5AJ3L 2A6HD 2Y0SG 1SN8A 2WAQG 3TP5A 3BVMA 1NSNS 1E2VA 1QUQB 1K8GA 2K5WA 2B2VA 3KBXA 1PVOA 1GHKA 1XPUA 2DGYA 5C5LA 1SYEA 1VCIA 5FJ8H 4DK0A 1HZCA 1EYDA 4A3KH 3S1RH 3M4OH 2RCNA 3Q24A 4XDXA 1B4OA 1JOKA 3PO3B 4IJLA 2J7ZA 1HR0Q 2MO0A 4DA2A 3TS2A 3BU2A 2MGSA 2F0QA 5FKAC 4BBSG 1EQTA 2SEBD 5CGKA 1VQ7A 4K0KQ 4LMQD 1EY8A 4DV3L 4B3MQ 3K57A 3URYA 5IT9E 1DOLA 1HUMA 4TQUS 1DONA 3PQIA 3K0XA 3PIO3 2K04A 1LTAD 1EUJA 2FXQA 3S2DB 1YJWA 5ELEA 1LYLA 2HDLA 1A3TA 2ZXRA 3NWSA 1HQMC 3RR5A 2E76C 3I4NG 2L55A 1FNVA 2EY6A 2IPKD 3GP7A 3GTPH 4IQZA 1NMFA 5J1ZA 4FXKC 2E2JB 1OXVA 2GA4B 2NUCA 4MHEA 4GN5A 1HZBA 4NB3A 1D5MC 3KOJA 1A3VA 1SR3A 5IYBG 1D5XC 2K28A 3WDNA 4WFN3 2ZM6Q 1SROA 5JJLA 4AH6A 1QNKA 2F0NA 1BOSA 3D4DA 3EFXD 3MXNB 4MZ9A 4OGQC 2BH2A 3RN2A 2A74C 5M5YH 5CMDA 3K5NA 1C8CA 4GZYC 4X3TA 1E24A 4QJFA 1XMQL 1SEBD 4CDDC 2SNSA 1MHWC 1FNUA 1QNUA 4I65A 3U4VA 1EYCA 1CSPA 1D2BA 3BVZA 3M4QA 1T9HA 4DAVA 2EXDA 2JA5G 1U9RA 5CORA 1PYBA 3Q8DA 3LWEA 4P73A 4R4OA 2KA7A 1ONLA 1JJGA 3S1MB 4EQNA 4IOCA 2VUMB 4LFCL 4Y7NH 3H94A 4PQXA 2HCIA 1LTSD 2RBMA 3IFTA 4OX9Q 2ZJQA 1PDQA 1STNA 1GHJA 1EY7A 1N8RC 3GTLH 1PTOH 3E6ZX 4A3DB 4CDFC 3SR1A 1YJ9A 2UXDL 1WTHA 3W2DA 3S1NB 2PNHA 2N49A 2E2HB 1S5ED 5FLXL 1XJVA 2QEJC 2F0JA 1MI2A 2OWOA 3AMUA 4ZAIA 5H1SE 2VB3X 3E0EA 2A19A 2L9HA 4CKEA 1S72A 3A54A 2IHFA 3OOCA 1G51A 3WWVA 3GTKB 3H0GG 3MXNA 1Y8OB 2Z8LA 1SE3A 2EDGA 4I7AA 3HZXA 3FDTA 4DV6Q 3LNNA 3EROA 4JI8Q 5IYDH 1Y1VG 3A8IE 1S5FD 1KTKA 4FP5D 1BBWA 2KENA 1RDPD 5C4JB 3ND8A 2R7ZG 1TWHB 4DR7Q 1LM0A 2IHEA 5I9OA 5JEAJ 3RZDH 4DV2L 2DNCA 4A3BH 2XRQD 4DV0Q 4KHZA 2B2UC 3WOFA 1IKMA 3PUXA 5CV4A 4DV7Q 2D0OA 2MHVA 2V4DA 1HTLD 2XGTA 4K5VA 4DR5L 3PCOB 4A3GG 3L7ZC 1KL9A 3NTHA 3Q23A 1UE6A 1VMCA 3HKZG 4C3JG 2BA0A 2AQ2B 2F0EA 2Q2UA 3J81E 3OYYA 3OSOA 2HHHQ 2Z6BA 3QOLA 1V1PB 5G3LD 4PZ6A 3HOXG 2JEBI 4B9XA 2X69A 2WV6D 1PH9A 3MTSA 3IRBA 2NVTB 3PSIA 1GXDC 5EGTA 2XVSA 1RJTA 1OO9B 4PNYA 1F77A 3PGZA 1UEAB 1HHVA 4DPGA 1LT5D 2B2WC 4A75A 4A3JG 3V2TA 1STGA 3S1QH 2B29A 4JI5Q 3HOVH 4BXXH 3R8BA 1YJNA 1PMRA 4GKJL 1K73C 4JI0L 2PW5A 1C4QA 3R3OA 5LMUL 4IFDI 3CCQA 1I4PA 4CHTB 1X6OA 1EQQA 1CKNA 4LF5L 3HOWB 2RVLA 5F2DA 3S14H 4ODGA 4CDEC 4AIMA 1R9TB 1MIUA 2VQEL 5M3FB 4BBRB 1TWCH 1WTRA 1AFPA 2P5ZX 1HNZL 1U4RA 2OEOA 3G48A 4UY8C 1FJGL 3BZCA 3CCVA 4NXML 4X6AH 5EAYA 1Z47A 3T51B 1VQNA 4DR4Q 5EQ0A 1I94L 2RDFA 3I4MB 1CI3M 4JI3L 5C3EH 2K32A 5M5XB 4LFAL 1PYSB 4IALA 1TS3A 2BCOA 4GKKL 1PHJA 1V1PA 2VL6A 2I0QA 1R4QB 1ENCA 1PH7A 4OELB 2ES2A 2K4KA 2IY5B 1GKHA 3GDEA 5FLXc 4H0LC 1ZYRD 3GTGH 3TQYA 1L1OB 4LF6Q 3DWPA 4B3SL 5HGTA 3KYHC 1GUOA 1SMYD 1BQQT 4DR2Q 3PO3G 4HIDA 4PZ8A 1X3EA 3KLSX 4X66Q 1ML0D 2VXWA 1Z6HA 1M1KC 5C4XH 2Z6KA 1B70B 3MVVA 4AQYL 1SNMA 1T5EA 3DMUA 4TRDA 3NUCA 4UP8A 3TP7A 3R2IA 2K1BA 3N6RA 3NWTA 5AJ3Q 4ZK9B 3RUZA 2BA1A 5FO7B 4NMZA 4JI2L 1KDBA 4A93G 1TS4A 1S5BD 3EBEA 1X3QA 4DF7A 3I55A 1YNJC 1X3FA 2R7FA 1KC8C 1VF5C 3ONAB 1OXXK 1XPOA 1FD7D 2ZXOA 4JW0A 3NENA 1QVCA 3JAME 1EIHA 4JOIC 3DEPA 1JE4A 3NTKA 3T13A 4DK1A 3BVGA 4BA2I 2Q2HA 4QL5A 3LWUA 2LSSA 2D5DA 2RDHA 4A3EB 4C2MB 3CC4A 4UAIA 5A2QL 5C0XG 4JG2A 4GOPC 2A1AA 3VYTA 1G91A 1STYA 5I6WA 5CV5A 1IW7D 1EY9A 4JPBW 1I6HH 5BN3A 4AYBE 4KY5A 4BBSB 2ZT9C 4DV3Q 2UUAL 1S4ZA 5GAHC 1TY2A 2RHSB 1E2WA 1K8AC 4DK3C 1VQFA 4R9WA 4OWTB 1NMGA 2MJ8A 2FMMA 3B6YA 4KTAA 2NYZD 2QILA 1RF2D 1I4RA 3KDFB 2Z4HA 1C9OA 5LHY1 3MA2B 1BXTA 2I46A 5IWAL 4PV1C 2VY3A 1L2FA 4HJ7A 2BOSA 2R3ZA 3I4NB 1PRTC 2E74C 1HNWL 1HXYD 3E3XA 5KNDA 2PMZB 2PQEA 3SDZA 4U673 1GUTA 1KDCA 5TSSA 1L1OC 4POFA 1DOKA 3EA6A 4YY3L 4A3CH 4OO1H 2A68C 2NTTA 4WORA 1Y1WB 2VUMG 1V8QA 2LMCB 1OTCA 3D4RA 2SNMA 4CJ2C 1XMQQ 4CKCA 1PTOF 2WINB 4RMFA 4A3DG 1CZGA 3RNUA 4IJHA 2UUCL 1YHQA 1BUVT 2WB1G 3PO2H 5KEEA 2LXKA 3KBGA 1V1OA 1W2BA 1VDZA 4FXDA 4KMUC 4JBMA 5E4WC 5JJIA 1VQKA 1E7ZA 1C48A 3ICEA 2ENBA 3L0OA 3D6CA 4HCSA 1WD0A 3H15A 1EFWA 2B2YA 1WTOA 1TWGH 4JI7Q 2KEEA 4RCOA 2EY1A 4LFCQ 3SE0A 1NNXA 2GVAA 3CCJA 4DNRB 4IPHA 1H9KA 3HOUG 3ERSX 5T1GA 2UXDQ 4K8IA 5IGFA 3BZDB 3NTIA 5HGQA 4G7ZC 4YHHL 4K8JA 3FKIG 5KRUA 2D0PA 2A6EC 3MEFA 2OTJA 2B3GA 5JAVA 3GV3A 5EJWA 2MP1A 5M5WH 4R1JA 3CP0A 1D7QA 2K5NA 3SGIA 2CCZA 3I72A 2QW7A 5IP9H 3RLFA 1ILQA 3I90A 1PLFA 4N9TA 5DNFA 3C2PA 3E0JA 1TXYA 1DXMA 1FNWA 2OCEA 2ZTCA 1S5CD 1Q46A 1HQRD 3H0GB 3KK7A 3PUVA 5C4JH 1WTPA 2F0SA 2FMCA 1QJOA 1YZ6A 4JVZA 4IO9A 4GLVB 2KOLA 1F2LA 1SNDA 4IUVA 4CGYB 3J7AV 3NQTA 1JCKB 1KRSA 1Y1VB 4U68A 4DV2Q 1NR4A 3AQQA 2A6HC 3RD4A 3K5MA 1Q86C 2R7ZB 3D3RA 4QQBX 2F0OA 4LK1C 3GTOB 2O2LD 4PMBA 2H1EA 2KCNA 3GTOH 3TP8A 5J39A 1TWFH 1YEZA 4OIKA 4DR5Q 2QKIC 2NB0A 4O2DA 5GAEC 2VNUD 2JA6B 2PYKA 1XPRA 1X65A 4A3GB 2N78A 1BNZA 1ET6A 4HIMA 1D6EC 1EIFA 1RD9D 1TWAB 3HOYB 4CKBA 4XT1B 3HOXB 3K8AA 4A4IA 4M8AA 5M3FG 4YCWA 4BBRG 3U50C 2F0HA 4L5TA 3MAQA 2L0CA 4BY1B 2MO1A 1U4PA 4NP5A 1CA6A 2XRSD 3K81C 1U5KA 4GNXA 4RKBA 3DWAA 2IL8A 3DXJC 2K05A 2KECA 4A3JB 4GKJQ 4JI0Q 3GQBA 2A73B 5LL6S 5LMUQ 3A8KE 1PH1A 1SE2A 2UU9Q 2H4OA 5T1IA 4LF5Q 1K28A 2TMPA 3ERQA 3NQIA 3PV0A 1CHPD 1X9NA 5DEHA 3TZUA 3H3VI 3DM3A 1Z7TA 3OHXC 4C1NI 2KBNA 1PH8A 2VQEQ 4V190 1IL8A 1VQJA 5M5XH 1HNZQ 1QZHA 2NVQB 3UDXA 1FJGQ 4NXMQ 1JWMD 1Q8KA 1GM5A 2F4IA 2QGQA 3VDYA 4F88A 4JI3Q 4TVAB 1MKHA 4LFAQ 1H9SA 5IP7H 1BBXC 4X3SA 1WCMG 1A6XA 3H91A 3L3OC 4JI6L 1IBMQ 5J3BA 2OTLA 4ZKCB 1K83H 5CBEE 4WJ4A 1I50H 3PIP3 3KJOA 3HS0C 3VR2A 2PPBC 2R93B 2NN6H 1PYWD 4R4TA 3NHHA 1YHBA 3AFQA 1SNQA 3A7LA 1UE1A 4XQNA 4DXFA 1EIYB 2JA8G 2KHSA 2KCCA 3G7LA 3HEJA 4JCVE 4B3SQ 4JBKA 5I4DA 1SYDA 4P72A 5K36H 3KUPA 5EKLA 5C3XA 4A3IG 1PZKD 4X64L 4A3EG 1PXUA 1B9NA 5KGUA 3X3MA 4AQYQ 3TRZA 2NZOA 1BCPC 2YTXA 2B2VC 2XNAC 3TS0A 1HCZA 2PZTA 5GQOA 4DK6C 4JI2Q 3GTJB 1WYDA 3P75A 2GN5A 1CHQD 4A93B 1Y8NB 1PTOD 5IODA 3PUZA 4LF8L 4G4KA 3R93A 3QR8A 1I4XA 4DAPA 1LACA 4XT3B 3I70A 1QB5D 3NE5B 4KI0A 1E3PA 1DM0B 1VF7A 1HFGA 4I7ZC 1QVGA 2PI2A 2HUGA 1I3QB 1SYBA 4TSSA 2V1CC 3SK4A 3S16B 1MSHA 2I5HA 2F0LA 2UUAQ 4BS9A 2F3IA 2NZ1D 1Y1WG 1CM9A 4FNFA 1J9OA 4BY7H 3NK9A 5KNCA 2F3WA 4DAYA 4IOAA 1H9RA 4ALPA 2R92B 2YU9H 4LUOA 1STBA 3MFGA 1LT6D 5EPKA 4QIWE 1I6VC 5EKKA 5IWAQ 5IYCG 3PIPA 3L9AX 1HNXL 1PFMA 1HTPA 3M3YB 2ZXPA 4DR3L 1FL0A 1HNWQ 4LUVA 5IYBH 4C3IB 2MPMA 4HEDA 2RHQB 5DAUA 3CRLC 3J81j 1Q7YC 3J7A5 3IFDA 1F9RA 4YY3Q 1LTBD 1LTGD 5C4ZA 2YTYA 2DUDA 2UXBQ 2K5QA 3A7AB 1ASZA 1IL2A 2JE6I 2CW0D 3RN5A 1RL2A 4B9WA 1WD1A 4M1UB 3AU7A 4P71A 5M3MH 3MXPA 2UUCQ 2LS01 3KLRA 3DEOA 3S17B 3EIVA 1DCZA 1HRJA 3IKJA 2YTVA 2JA7G 2JA5H 2EOTA 2WB1B 1CQVA 1KNEA 2K7VA 3PF4A 1K8OA 3S15B 2SOBA 3F2CA 3MFYA 1B3AA 4MN3A 1JICA 4J1MA 2YYZA 3LGJA 5FLXE 1G2TA 2B63H 5C5MA 2CHBD 4H13C 4RG1A 2XIWA 4PMCA 3M85A 4JC0A 3OPOA 4A3MH 1XNRQ 1BF4A 3C1EA 1PFNA 2CVRA 1U0LA 2RDGA 2NVXB 1GD7A 1IXRA 1NCVA 3ER0A 4FF4A 5L37A 3VR5A 1FYCA 3K7AB 4YHHQ 4L5SA 3HOUB 1CKNB 5C0XI 1XX8A 2I07B 5IYDG 4V0BA 2ZJRA 1A8VA 2HDMA 1Q1BA 3FKIB 3BYTB 4EX5A 2XN9C 1B50A 4XXEA 2N55A 4A3BG 1X3GA 3R2TA 1X3PA 3EVQA 3CXCA 2O4XA 2Y0SE 2WAQE 2ICIA 4C1NK 4X62L 3DWQA 3N52A 2JA6G 1ZYRC 3CC2A 3JC66 1GUGA 4R4IA 2EYOA 3RZOB 5IGCA 4AYBG 4DNTB 2JXMB 4KY6A 2XWJB 2X6GA 5GADC 1WFQA 1SMYC 3GTQH 3UI2A 3HOYG 1QCBD 4KKSA 2F1MA 1VQ9A 4ABNA 1EZ6A 2EE1A 2M9VA 1TQOA 3CQZB 1RKNA 3FRPB 4QUFA 1SAPA 4L6TB 5ELOA 1LV9A 2F0GA 1GVPA 2HIVA 3H6MA 4BY1G 1AW7A 4OEMB 1W6KA 2C9OA 1SYCA 1L0WA 4L63B 5CC4A 3T4AC 1Z9FA 2NVYH 5ELCA 4IUTA 2B2TC 4C3JH 5C4HA 2D62A 1KDAA 1PH4A 2PO4A 2KVMA 4TKOB 1VQLA 4MTNA 1UEBA 2CH4A 4C3HB 3T16A 1F9QA 4B08A 1UNSA 2OXPA 2MUYA 1JC7A 1EYAA 3DM1A 5HY6A 1GUNA 5JVG3 4IZ8A 4XYOA 5C0XJ 4N8X1 2D2CC 2NWGA 1PH3A 2C35B 2KCMA 5FO8B 1SLJA 2JSOA 1ASYA 1BDOA 1IW7C 3RMHA 3BS1A 1VQ8A 1OXSC 1O7LA 1STHA 1DZ1A 4IN3A 3WOEA 4HR7B 1UWVA 4IURA 4POGA 5HURA 1KXLA 4EQ5A 1PFBA 3Q22A 2O5IC 1SFOB 2Q2TA 1AN8A 4X3KA 3DLLA 5ELNA 5IGBA 1A15A 1EY4A 1HZ9A 2K5DA 2NVQH 1YNXA 1CUKA 2E2IH 1CT1D 3V05A 1MJCA 3TBIB 2R93G 2HQLA 1AE3A 4OWXB 5E7NA 1XNQL 2AQ1B 2EYHA 5D14A 1VQCA 4X65L 1TVXA 4PZ7A 1KD1C 1CTMA 5D3DA 2Q2IA 4RAUC 2F52A 3HOZH 4KHPL 1JWUD 3S2HB 1VQBA 5C4XG 4NXNL 5JEAH 5FLMH 5EPJA 4JI6Q 1LTTD 2EYPA 1G6ZA 1WCMB 4BA1I 4JBJA 2E8GA 1TS2A 1HPCA 3PO3H 1VQHA 4KJNA 3J80L 2Z6KC 2DN8A 2ZTEA 1EU3A 1D1IA 1EQRA 4XQJA 5I2XA 2ASBA 2JA8B 4B3RL 1V43A 4X64Q 3S1RB 4A3KB 1AEXA 5GROA 1IBKL 1I4QA 4A3IB 1O78A 1RTOA 1ENAA 1FR3A 4A93H 3TSSA 3S9WA 3D0FA 4JI4L 1STAA 3EQLC 5A2QE 4EVOA 1G2SA 1K0SA 2WFWA 5CYUA 4MNOA 1C0AA 1DD2A 3S2DH 4K5WA 2WKDA 2R92G 4NPSA 1M4VA 3HKSA 1D8LA 5IIFA 2RF4A 2IX1A 2F4VL 2E2JH 2CQAA 3E9HA 1EFID 4LF8Q 1SDFA 3J80i 1E1TA 1LTRD 4IUNA 4P2CB 2A5HA 2KHJA 1RODA 4C3IG 1RIPA 3A8JE 3VA7A 2E5LL 2AWOA 2AKWB 3OW7A 1SJED 4LF4L 4HAEA 3HKZE 3Q0AA 3GTPB 1VQ6A 2MFIA 1IZ6A 3QO2A 4RHSA 1SE8A 3A5UA 4A3CG 4OO1G 2C5CA 2JN4A 1K0RA 5KYIA 3F8TA 1EWCA 2JJQA 1S5DD 3HRZC 4LW1A 1MBYA 2IJ0A 5EKIA 2O5JC 1KAAA 4QF4A 5M5YB 2KEDA 1JMCA 3C46A 1SNCA 1EZ8A 1JT8A 1HNXQ 4UDUC 3I3CA 4PMWA 2DJFC 3OWEB 3VYSA 5BR8L 3CF5A 1LT3D 4DR3Q 4GLXA 1ILPA 1WI5A 3O13A 3U9SA 4ZKBB 4IPGA 3S1MH 2QCPX 1GO3E 1A0IA 2Z9HA 3EN2A 2ATWA 2VUMH 3VR6A 2CKZB 4KHVA 1I4GA 1KAWA 2IX0A 4UP7A 3UDIA 5DM63 1X56A 4A3DH 1A3UA 1NUCA 4LF7L 2RA4A 3GTMB 2J4XA 2F03A 4O1NA 1OXTA 1W6JA 3S1NH 4IFDH 3KLWA 4Z9CB 4R8IA 4Y7NB 1T5XD 2E2HH 1DJRD 4ZCKA 4RWSC 1KLUD 3M9BA 4R4QA 2B2YC 3GTLB 4JBWA 1PTOB 1IYUA 2B8FA 1H9MA 1QOHA 1YNJD 4OIJA 2JA7B 3GTKH 3UE0A 1Q1EA 2EPBA 3UDFA 3VA5A 1N32L 1L0XB 2K01A 1WTQA 4GNXB 3ULPA 3HOUH 4GN4B 3TZDA 1XWEA 4L8JA 3BDCA 4OWWB 1P16A 1B8AA 1TWHH 3D4WA 4FF3A 3J80c 1EIGA 2F3VA 2JA9A 1SBBB 4DV0L 2EJFC 4IPCA 3V96A 1Q82C 4F8MA 5DLQE 1P8LA 4KKUA 1WJJA 4EGVA 4XTCS 3RZOH 4YIJA 5EPLA 3RZDB 4H02A 4A3BB 2BE5D 4FDBA 3E5SA 1A63A 1AZPA 1BCPF 3OMGA 3ZYYX 1JJCB 3T1HL 2F0MA 1CA5A 4C3HG 1EYGA 2NVTH 1H9SB 3CHBD 1JJ2A 2K5HA 4AYBB 5D65A 1JWSD 4LFBL 5FOBB 1XMOL 3AYHB 1MGSA 1WTVA 2K6AA 3I4OA 4PG3A 4CBVA 3OW2A 1NBWA 5C44G 2OQKA 3GO5A 1PH2A 2PQAA 2K52A 1NY4A 2EQSA 2HCCA 4FF1A 1SE4A 4H7BA 4JI5L 4XQQA 2VQFL 2I5LX 3QB3A 1YNND 5ELBA 1O7IA 1HJPA 3NSWA 2AHOB 2G9HD 4K2KA 3J7AF 5J22A 3MWYW 1UE7A 3HOWH 1VS0A 1VQPA 1YBYA 3S1QB 1PTOC 5KYLA 4LNQA 3HOVB 1R9TH 1CFMA 5KIXA 1GJXA 3OMCA 4P74A 2EYLA 2VB2X 4N9PA 4LWCA 5M3FH 4BBRH 1X55A 2XSCA 3ND9A 5D3IB 2EZVA 3H3VC 2QDLA 4GNXC 2MNAA 4QGUA 3S14B 2PW7A 4Q5VA 3SXHA 3C3LA 4HSPA 1D1KA 2RQXA 1A2TA 1C7YA 1EY6A 3I4MH 3OTOL 3D6WA 3STBD 2L12A 4A3FG 1TWCB 1X54A 2LKVA 1MJEA 3TMEA 2A6ED 1MD2D 3D31A 4RGTA 1I94Q 3AB9A 4RA8A 2A69D 1KQSA 4A3LG 1LO5D 3UE1A 1Y8PB 2NBFA 4RH6A 4JYAL 5C3EB 4DU9A 4GKKQ 1ET9A 2EIFA 1TR5A 1BO0A 1LLRD 1OXUA 4WJ3M 4RFBA 5I9PA 3BG3A 3LX0A 3A56A 4DAYB 1XNQQ 2FINB 3CCMA 2NN6G 3CKIB 2EYFA 4IUUA 5BN5A 4X65Q 4RGMA 4DNIA 3KF6B 2RSNA 5LMNW 3QOJA 3SK8A 2KCTA 1L0YB 2MQHA 4K6LA 5FJ8G 2CW0C 4HJ9A 4R4CA 1EY0A 4A3KG 3GTGB 4KHPQ 1EWHA 1KRTA 3PUYA 1WCMH 2EXZA 3K5LA 4MTKA 3VR3A 1YIJA 4NXNQ 3CMEA 5C4XB 1TT2A 4DKAC 2IT1A 1QE6A 1LUZA 3SK5A 3RLNA 2F0PA 5JJKA 4HJ8A 2JA8H 4IPDA 1YHAA 2X6LA 4R8NA 1JB7A 2XTIA 5BN4A 3T1YL 4HSVA 4O0AA 2AUKA 2F0FA 1R4PB 4A3IH 4A3EH 4C2MH 5M9OA 2K50A 5LL6X 4IUPA 3U9OA 4B3RQ 3BYYB 3HFZB 3SEBA 5IGDA 1IBKQ 4BBSH 1N33L 2VS1A 4JI4Q 1HUNA 1VQEA 2BDOA 5IT9L 3MHBA 5CV7A 1B44D 3H09A 1QZGA 1I6HB 3CC7A 2K03A 4BY7G 5AFWA 3K7UC 4CDCC 5FO9B 1BKBA 3CPFA 3ULLA 2F4VQ 3I4NH 1XTDA 3KF6A 1PA6A 2IX3A 4DUZL 3SHLA 5EBCA 1HA6A 2AQ3B 2SDFA 1EWIA 1EOVA 3T53B 1F2YA 2E5LQ 4JI1L 3IL8A 3FPUB 4B3TL 4LF4Q 4NKLA 1Y1WH 1SRUA 3S24A 1J5EL 4Q0FA 4DR6L 1IYVA 2PCFB 1QUQA 1PFSA 4YCUA 1EQVA 1HZAA 1IBLL 1QG7A 2D9UA 2UUBL 2L5TA 5ISRA 3BDOA 3E9IA 5C6AA 1SYFA 2R6GA 5IYCH 3W5OA 3CCSA 5KNBA 4ID6A 2Q8TA 3FHWA 3BJUA 5M3MG 2K14A 3NBHB 4ZYSA 3CCLA 3MEHA 3K59A 4DV4L 3CW2C 1KHIA 5BR8Q 4OONA 4L5QA 1J6QA 2K33A 3HGBA 2UXCL 4FYDA 4RGNA 3PO2B 4E6IA 3I56A 2BDNA 4KKTA 3GTMH 4JI7L 3OWFA 4EQOA 2EYJA 2B63G 2RSOA 1D5ZC 2QA4A 4OHJA 2GVBA 3M7NA 4A76A 3GD7A 4HIKA 1LTID 3A5ZB 3M4YA 4LF7Q 2DY7A 3M7GA 4A3MG 1TWGB 1BCPD 2ZJPA 2JA7H 2TSSA 1WTXA 1BVSA 1BBUA 2JQOA 3A74A 1HR0W 4G7OC 3PIOA 5DM73 1ENFA 1Q90A 2WP8J 4QCLA 3H3VH 5IY0A 5JVH3 3QWNA 2IW3A 3CAMA 4JV5L 3K5OA 2HIXA 2K75A 4H44C 1B9MA 3H0GH 4HMJA 1N32Q 5M5WB 1XXGA 2HT1A 5E3FA 5LMNL 1G8ZD 2B2UA 3K6OA 1VQ5A 1E22A 4ZLTF 4DR1L 1F9SA 3DUZA 2KUMA 2PNRC 4J6HA 1PZID 3P1HA 1EY5A 4QY7A 1Y1VH 3F2UA 4LF9L 3NBHA 2F0WA 4KY7A 4RGOS 3KF8B 2R7ZH 5FK9C 4DUYL 1NTGA 2CWPA 1B7YB 1DOMA 1GUSA 3QJYA 1KABA 1F2MA 4YCVA 3KLSA 3CRKC 5E1FA 4X3UA 2ZTDA 1Q3LA 2EJGC 1XYIA 4OO1I 2JA6H 1HFNA 4JK1C 4KJOA 5IT9c 1CQFA 4A3GH 4RCNA 3NP8A 4DV5L 2B2WA 4RKLA 5CBAE 3J81L 2AMCB 3CCRA 4DV1L 3T1HQ 1N36L 2B2TA 3HOVG 1TWAH 1TKWB 3K80C 4BXXG 1TWFB 3HOYH 1IKLA 4F7XA 3HOXH 1DYQA 3I2ZA 1SYGA 2EYMA 4N8FA 2OT2A 4LFBQ 2L1BA 1FVIA 1XMOQ 4KLKA 1UE5A 1IYJB 3UDGA 4BY1H 2Z1CA 4C56C 1STEA 3G71A 4J8QA 3NEMA 4ME5A 2PMZE 4K14A 3RLOA 2Q8RE 3TREA 4A3JH 1B2TA 5C44B 1GOZA 4QIWB 1Q8IA 2VQFQ 4YWKA 4J15A 2PZUA 3I73A 2AWNA 1B3QA 1Q81C 2KJXA 1CSQA 2RKSA 3K58A 3J7YW 2QF7A 1FGUA 5JJZA 2EJMA 1PRTF 1EU4A 2XWBB 3I8ZA 1ZXTA 2UU9L 3J81i 5NUCA 3PMFA 5C3EG 3U4ZA 2JK8A 2JEAI 1H95A 4UPAA 1W3SA 3KF8A 3P7JA 1N34L 4GOPB 2HD3A 1F9PA 1YVCA 3J7ZC 4HMIA 2KHIA 1O80A 3TEHB 2F0IA 3Q6SA 3C1FA 4LJZC 3OTOQ 1QVFA 2L15A 2OQ0A 3FEWX 3TP6A 2VW9A 2G5DA 1CK1A 1ESFA 4LAAA 4A3FB 3HOZG 1TY0A 2IWHA 3AFPA 4ZUIA 4JYAQ 2KQ3A 3CD6A 1VQ4A 5JEAG 2R93H 1IBML 5CR3A 5FLMG 1PRTB 1RTNA 4FF2A 1JR0D 4K2LA 4OL7A 2BH8A 1S40A 2F0KA 4KN7C 2E75C 2G9DA 1G6PA 2R61A 1K83B 1WVLA 1XTCD 1I50B 3BDLA 4UP9A 2H5XA 3KJPA 3TN2A 4KV6A 1J8IA 3J80E 4IFDJ 4P75A 1HR0L 1SNOA 1UAPA 1VMPA 3W1BA 4JOIA 3M4OB 2WKCA 4NDXA 3GTJH 1O7ZA 1GUWA 4ZUJA 2R7DA 2Y0SB 4K0KL 2WAQB 3NELA 2A8VA 2JYOA 4B3ML 4O42A 4GOPA 4L5RC 3SVMA 2LXJA 3VR4A 4DFAA 4GN3B 2DY8A 3HP3A 3T1YQ 1LABA 3JAML 1E2ZA 3IAYA 1KLGD 2QDBA 5I6YA 2CWAA 1AH9A 1YI2A 1I3QH 1KNAA 1CZWA 2Z4IA 1RCVD 3QIAA 5C0XH 3FPPA 3S16H 1RHPA 1N33Q 3J81c 4DGZA 4KD4A 2LY7A 2ICEC 2RCFA 1NR2A 2N88A 2FFKB 2R92H 1VQGA 1H9JA 1ICFB 3D8GA 1K9MC 1JQYD 2ZM6L 3BZKA 1II3A 1LT4D 2VZAA 3MZ5A 4YWLA 1WOCA 5CV9A 1L1OA 2Q8IB 3OIPA 4BY7B 2I5MX 3M3YH 2E2DC 3JAMi 3AEVA 2YU9B 2BE5C 4DUZQ 3L2PA 1NAPA 3G4SA 1QILA 1U4LA 4C3IH 2DNEA 4K5XA 4WJWA 3F2BA 1ESRA 5C3WA 4HJ5A 1DGSA 1PH5A 1Y14B 4DAMA 3PO2G 2EY5A 4JI1Q 3FMCA 4B3TQ 4GLAC 1J5EQ 4DR6Q 3A0JA 1E0BA 3ITPA 1SMXA 1UUPA 4APVA 2UXBL 1JE5A 1U4MA 2M2LA 2NN6I 1VQOA 1Y69U 1IBLQ 3VYUA 2J0TD 2UUBQ 1IHZA 4YWMA 1K3RA 3S17H 4KD3A 5ELFA 4OX9L 1YNNC 1SSOA 2FJ2A 1EEID 2QEXA 3S15H 4IFDG 5M3MB 4DV4Q 1PH6A 1VQDA 3PF5A 2UXCQ 1AZQA 2M00A 2CH4W 4HCEA 5IGGA 1B53A 2AUJD 2CFMA 2PI2E 2JA5B 1K3BC 1MSGA 1Q12A 3MC0B 1S3OA 2PQAB 4MIUA 3FP9A 5JOBA 2WACA 1XNRL 5EBDA 2NVXH 4XIGS 1N9WA 2B63B 4IUQA 5IP9G 2NTSA 2B39A 2L11A 3KDFA 3K7AH 3SK6A 4CJ0B 1SJHD 5A35A 4DV6L 3STBC 3HG9A 5IE8A 4A3MB 1EEFD 4ILWA 3FKIH 3GV6A 2F0DA 4ZRZA 4JI8L 1TS5A 3A55A 3OIQA 4FO2A 2A69C 1LTLA 1E1OA 5CV8A 3VYRA 4CJ1B 1ZEQX 4DR7L 2L4NA 3CMAA 1BR9A 4JV5Q 2FHTA 3PUWA 3QG1A 1K8MA 3MXUA 1PV4A 3T56B 5JPNC 2ALYB
chains in the Genus database with same CATH topology
4DV7L 3T1YL 4X62L 1OXXK 4O0AA 5LMNQ 1I5FA 4A3IH 1XPOA 1V9PA 2JA6G 4X62Q 3NENA 1QVCA 4C2MH 4A3EH 4JOIC 3CC2A 2K50A 3JC66 4R4IA 4DR1Q 4AYBG 4BA2I 4B3RQ 2Q2HA 3JAMc 4QL5A 5GADC 1WFQA 2LSSA 2Z0SA 3HFZB 2HHHL 3CQZH 3GTQH 4LF9Q 1IBKQ 3CC4A 4BBSH 1N33L 2VS1A 3HOYG 5C0XG 4JG2A 3CCUA 2A1AA 4GOPC 1VQ9A 4DUYQ 4JI4Q 1I6HH 1VQEA 4AYBE 5ELOA 4DV3Q 4HIOA 2UUAL 5GAHC 1G291 1GVPA 2HIVA 4BY1G 2RHSB 1QZGA 1K8AC 4DK3C 3CC7A 1VQFA 4BY7G 4OWTB 3ULJA 1NMGA 1L0WA 3B6YA 1Z9FA 1V1QA 2NVYH 3W1GA 3K7UC 1VQMA 1BKBA 1VQAA 3CPFA 3ULLA 4C3JH 3KDFB 4C3HH 4DV5Q 2F4VQ 3I4NH 1C9OA 2D62A 1PH4A 1XTDA 3KF6A 4DV1Q 1PA6A 4DUZL 1N36Q 2N3SA 3HOWG 1VQLA 5IWAL 3CCEA 4MTNA 2VY3A 1L2FA 1UEBA 4HJ7A 2NZHA 1EWIA 1EOVA 5HY6A 3F2DA 3CPWA 3M4PA 2E5LQ 1HNWL 4JI1L 5C44H 4LF4Q 4B3TL 1Y1WH 5C0XJ 1SRUA 3S24A 1J5EL 1PH3A 2C35B 2KCMA 4DR6L 1SLJA 1ASYA 4POFA 1L1OC 4YY3L 1VQ8A 1CKMA 4A3CH 1QUQA 1OXSC 1PFSA 4YCUA 2VUMG 3F1ZA 1HZAA 1IBLL 1OTCA 1SFOH 3U58A 2UUBL 2N8NA 3E9IA 3I4MG 1UWVA 4POGA 1KXLA 4DR4L 1XMQQ 4EQ5A 4OXPA 2R6GA 5IYCH 2K5VA 1VQIA 4RMFA 3W5OA 3CCSA 4A3DG 3RNUA 3FHWA 4IJHA 2UUCL 3BJUA 5M3MG 2Q2TA 5GAGC 2YV5A 1YHQA 2K14A 3DLLA 3KFUA 1M90C 2WB1G 3NBHB 5ELNA 3PO2H 2LXKA 3CCLA 1A62A 4DV4L 3CW2C 1AE2A 1KHIA 5BR8Q 4OONA 1HZ9A 1W2BA 4L5QA 4ME3A 1J6QA 2UXCL 4Y52H 4GS3A 3G6EA 2NVQH 5IP7G 4JBMA 2ID0A 1YNXA 3I7FA 1N34Q 5JJIA 1CUKA 2E2IH 1VQKA 1E7ZA 1NE3A 3I56A 1MJCA 2WB1E 3ICEA 2R93G 3GTMH 2HQLA 3L0OA 1EFWA 1AE3A 1HH2P 3H15A 4JI7L 4OWXB 2B63G 1YITA 1TWGH 4A3FH 4JI7Q 5E7NA 1XNQL 2QA4A 4LFCQ 2GVBA 3M7NA 4A76A 3GD7A 1VQCA 4X65L 4HIKA 3A5ZB 3S2HH 4HJAA 4LF6L 4LF7Q 4A3MG 4PZ7A 1KD1C 2GVAA 3CCJA 2CQOA 4A3LH 2Q2IA 4DR2L 2F52A 2ZJPA 3HOZH 4IPHA 2JA7H 3HOUG 3ERSX 4KHPL 4X66L 1BVSA 1KIXA 2UXDQ 1BBUA 2JQOA 5HGQA 5K36G 1VQBA 3A74A 3ZJYC 4YHHL 1NJIC 1HR0W 3FKIG 1CKOA 5C4XG 2D0PA 4NXNL 3PIOA 3MEFA 2OTJA 2B3GA 5FLMH 2WP8J 4LUZA 5AJ3L 2Y0SG 1SN8A 2WAQG 5IY0A 4JI6Q 3H3VH 5M5WH 3CAMA 4JV5L 4BA1I 4R1JA 3CP0A 1D7QA 2K5NA 3SGIA 2HIXA 2CCZA 4JBJA 1IL2A 1QUQB 2K75A 1K8GA 3H0GH 5IP9H 2E8GA 3RLFA 1N32Q 1PVOA 1XPUA 2DGYA 1VCIA 1VQHA 5FJ8H 3PO3H 2HT1A 1TXYA 5LMNL 1HZCA 4A3KH 3S1RH 3M4OH 2OCEA 2Z6KC 2ZTCA 1VQ5A 2RCNA 2ZTEA 1Q46A 3PUVA 5C4JH 1E22A 1EQRA 4DR1L 2ASBA 4B3RL 1V43A 4IJLA 4X64Q 1HR0Q 4QY7A 1Y1VH 1YZ6A 2MO0A 4IO9A 4K0KL 4GLVB 5GROA 4LF9L 3BU2A 1IBKL 3TS2A 3KF8B 2R7ZH 4BBSG 4A93H 4DUYL 1NTGA 2CWPA 3D0FA 1KRSA 4JI4L 1B7YB 1VQ7A 4DV2Q 4K0KQ 2WFWA 2ALYB 4YCVA 4MNOA 4DV3L 4B3MQ 3AQQA 1Q86C 3S2DH 1C0AA 2ZTDA 2R92G 4QQBX 4NPSA 3HKSA 4TQUS 4OO1I 2JA6H 1D8LA 3K0XA 3GTOH 4X6AH 1EUJA 2RF4A 1TWFH 2FXQA 1YEZA 5IT9c 4DR5Q 1YJWA 4A3GH 1LYLA 4O2DA 2IX1A 5GAEC 4DV5L 2F4VL 2E2JH 2VNUD 3E9HA 3RR5A 3CCRA 1XPRA 4LF8Q 2AMCB 4DV1L 3T1HQ 3I4NG 1N36L 3HOVG 3J80i 1E1TA 1TWAH 1X65A 3K80C 4BXXG 3HOYH 2N78A 3HOXH 3I2ZA 3GTPH 4HIMA 1NMFA 2KHJA 1OXVA 1EIFA 4LFBQ 1RIPA 1FVIA 2E5LL 2AWOA 2WAQE 1XMOQ 2AKWB 1HZBA 4GN5A 4NB3A 4KLKA 1UE5A 3HKZE 1IYJB 3UDGA 4LF4L 3KOJA 4BY1H 1VQ6A 3K8AA 1SR3A 4A4IA 2MFIA 5IYBG 5M3FG 1IZ6A 4YCWA 2ZM6Q 1SROA 4BBRG 4AH6A 3G71A 3NEMA 5JJLA 3U50C 2PMZE 4MZ9A 4L5TA 3MXNB 3RLOA 4A3JH 3TREA 1SE8A 3A5UA 4A3CG 4OO1G 2MO1A 2VQFQ 1K0RA 2BH2A 4YWKA 3F8TA 3RN2A 4J15A 3K81C 1U5KA 5M5YH 2AWNA 4GNXA 2JJQA 1Q81C 1E24A 1CSQA 4QJFA 1XMQL 4GKJQ 4LW1A 4JI0Q 1FGUA 5LMUQ 1JMCA 1PH1A 2UU9L 3U4VA 3J81i 1JT8A 1CSPA 1HNXQ 5C3EG 2UU9Q 4LF5Q 4PMWA 5BR8L 3U4ZA 3CF5A 4DR3Q 4GLXA 2JK8A 3M4QA 1T9HA 2JEAI 1H95A 4UPAA 1W3SA 1WI5A 3PV0A 1X9NA 2EXDA 2JA5G 3H3VI 4IPGA 3S1MH 1PYBA 1N34L 4GOPB 1GO3E 1A0IA 3DM3A 1YVCA 3EN2A 3Q8DA 3J7ZC 4P73A 2ATWA 2VUMH 2CKZB 2KBNA 2KHIA 1KAWA 1PH8A 2IX0A 4UP7A 2VQEQ 4R4OA 3TEHB 1JJGA 3UDIA 1VQJA 5M5XH 1HNZQ 4IOCA 1QZHA 3UDXA 3OTOQ 4LFCL 1FJGQ 1QVFA 2L15A 4NXMQ 1X56A 4Y7NH 4A3DH 1Q8KA 1GM5A 2OQ0A 4LF7L 4OX9Q 2QGQA 2ZJQA 3VDYA 1OXTA 2VW9A 3S1NH 4JI3Q 3KLWA 3HOZG 1N8RC 3GTLH 2E2HH 1YJ9A 2UXDL 4TVAB 1MKHA 4LFAQ 5IP7H 3AFPA 3M9BA 4JYAQ 1WCMG 2PNHA 4R4QA 2N49A 3CD6A 1VQ4A 4JBWA 5JEAG 2R93H 1IBML 5FLMG 4JI6L 1XJVA 5J3BA 1IBMQ 3GTKH 2OWOA 2OTLA 1K83H 3UE0A 4WJ4A 1Q1EA 1I50H 5H1SE 2BH8A 3E0EA 2A19A 3UDFA 3KJOA 1S40A 4R4TA 1S72A 2IHFA 1YHBA 1G51A 3AFQA 3WWVA 1N32L 3H0GG 1G6PA 1UE1A 4GNXB 3ULPA 1EIYB 2JA8G 3HOUH 4JCVE 4GN4B 4B3SQ 4UP9A 2H5XA 3KJPA 4JBKA 4OWWB 4P72A 4DV6Q 1P16A 1B8AA 4A3IG 4IFDJ 4X64L 4P75A 1TWHH 4A3EG 1HR0L 3J80c 4JI8Q 3W1BA 4AQYQ 1Y1VG 3TRZA 2NZOA 5IYDH 4JOIA 2YTXA 2JA9A 1BBWA 2KENA 3GTJH 2R7ZG 4DR7Q 1LM0A 2IHEA 3TS0A 2R7DA 5JEAJ 4DV0L 5GQOA 4DV2L 4DK6C 3NELA 4IPCA 4JI2Q 3RZDH 1Q82C 2A8VA 4A3BH 5DLQE 1P8LA 4DV0Q 4B3ML 4KHZA 4GOPA 1WJJA 4L5RC 2LXJA 1WYDA 4XTCS 3RZOH 4GN3B 3PUXA 2GN5A 4DV7Q 3T1YQ 2D0OA 4H02A 2XGTA 4DR5L 4FDBA 3PCOB 4A3GG 3L7ZC 1KL9A 1A63A 1UE6A 3PUZA 4LF8L 1JJCB 2CWAA 3HKZG 3T1HL 1YI2A 1AH9A 1I3QH 2BA0A 1EYGA 2Q2UA 3OYYA 2HHHQ 2NVTH 4PZ6A 2K5HA 3HOXG 1JJ2A 2JEBI 4KI0A 3S16H 1E3PA 1N33Q 4LFBL 3J81c 1QVGA 2PI2A 1XMOL 3AYHB 1PH9A 3I4OA 3IRBA 4PG3A 3PSIA 2R92H 1VQGA 3OW2A 1NBWA 2V1CC 5C44G 2I5HA 2UUAQ 1K9MC 2OQKA 2F3IA 3GO5A 2ZM6L 1Y1WG 1PH2A 3BZKA 2PQAA 2K52A 4BY7H 1NY4A 2EQSA 3PGZA 2VZAA 4IOAA 4YWLA 4DPGA 4ALPA 2YU9H 4JI5L 1WOCA 2VQFL 2I5LX 4A75A 4A3JG 4LUOA 1O7IA 3S1QH 1HJPA 2B29A 4JI5Q 1L1OA 3HOVH 2AHOB 1YJNA 2I5MX 4BXXH 4GKJL 4QIWE 3M3YH 3JAMi 1K73C 4JI0L 3AEVA 1UE7A 3HOWH 1VS0A 3L2PA 3G4SA 4DUZQ 5LMUL 1YBYA 1VQPA 4C3IH 3CCQA 5IWAQ 3PO2G 4IFDI 5IYCG 3F2BA 4LNQA 1R9TH 3PIPA 1X6OA 4HJ5A 1EQQA 1HNXL 1CKNA 1DGSA 4LF5L 4DR3L 1PH5A 1FL0A 1Y14B 4P74A 4LUVA 4JI1Q 4DAMA 5IYBH 5M3FH 4B3TQ 4LWCA 3S14H 3I4MH 4BBRH 1X55A 2RHQB 4AIMA 4GLAC 1J5EQ 3J81j 1Q7YC 3J7A5 4DR6Q 1MIUA 4GNXC 3A0JA 4YY3Q 1SMXA 2MNAA 4APVA 4QGUA 2VQEL 2UXBL 1JE5A 1TWCH 2NN6I 2YTYA 2DUDA 1VQOA 1IBLQ 2UXBQ 1C7YA 1HNZL 3G48A 1ASZA 3OTOL 2UUBQ 4UY8C 3BZCA 3CCVA 2JE6I 1K3RA 4YWMA 5EAYA 4NXML 1FJGL 3RN5A 3STBD 1Z47A 1RL2A 1VQNA 4A3FG 3S17H 4DR4Q 4P71A 4OX9L 1X54A 1MJEA 5M3MH 1I94L 2UUCQ 3D31A 4JI3L 5C3EH 2QEXA 1I94Q 3EIVA 3S15H 4IFDG 1KQSA 4A3LG 3UE1A 4LFAL 1PYSB 2YTVA 2JA7G 4DV4Q 2JA5H 1PH6A 4GKKL 1PHJA 4JYAL 1VQDA 3PF5A 2UXCQ 2VL6A 3PF4A 4GKKQ 2I0QA 2EIFA 3F2CA 1OXUA 2CFMA 4WJ3M 2PI2E 2YYZA 1PH7A 3LGJA 1Q12A 2ES2A 2B63H 1S3OA 2K4KA 2PQAB 4RG1A 3FP9A 2IY5B 1GKHA 4DAYB 3GDEA 5FLXc 1XNQQ 3CCMA 2NN6G 1XNRL 3M85A 2NVXH 4JC0A 4XIGS 3GTGH 3TQYA 4X65Q 4A3MH 1XNRQ 1N9WA 1L1OB 4LF6Q 4DNIA 3KF6B 5IP9G 4B3SL 3KDFA 3K7AH 3KYHC 5LMNW 4DR2Q 2KCTA 5FJ8G 2MQHA 1U0LA 4HIDA 3PO3G 4DV6L 3STBC 1GD7A 4PZ8A 1IXRA 4R4CA 4HJ9A 4A3KG 1X3EA 5IE8A 4X66Q 1KRTA 3ER0A 3PUYA 1WCMH 4KHPQ 1M1KC 5C4XH 3FKIH 2Z6KA 1B70B 4L5SA 4JI8L 4YHHQ 4AQYL 1CKNB 1YIJA 4UP8A 4NXNQ 5C0XI 5IYDG 3CMEA 1JB7A 1LTLA 1E1OA 2ZJRA 1A8VA 5AJ3Q 1Q1BA 4DR7L 3CMAA 4DKAC 2BA1A 2IT1A 1LUZA 4JI2L 4EX5A 4JV5Q 4A93G 1HNWQ 3PUWA 3RLNA 5JJKA 3EBEA 4A3BG 1X3GA 4HJ8A 3CXCA 3I55A 2JA8H 1PV4A 4IPDA 1YHAA 2Y0SE 1X3FA 2R7FA 1KC8C 2XTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 L;  3T1Y L;  4X62 L;  1OXX K;  4O0A A;  5LMN Q;  1I5F A;  4A3I H;  1XPO A;  1V9P A;  2JA6 G;  4X62 Q;  3NEN A;  1QVC A;  4C2M H;  4A3E H;  4JOI C;  3CC2 A;  2K50 A;  3JC6 6;  4R4I A;  4DR1 Q;  4AYB G;  4BA2 I;  4B3R Q;  2Q2H A;  3JAM c;  4QL5 A;  5GAD C;  1WFQ A;  2LSS A;  2Z0S A;  3HFZ B;  2HHH L;  3CQZ H;  3GTQ H;  4LF9 Q;  1IBK Q;  3CC4 A;  4BBS H;  1N33 L;  2VS1 A;  3HOY G;  5C0X G;  4JG2 A;  3CCU A;  2A1A A;  4GOP C;  1VQ9 A;  4DUY Q;  4JI4 Q;  1I6H H;  1VQE A;  4AYB E;  5ELO A;  4DV3 Q;  4HIO A;  2UUA L;  5GAH C;  1G29 1;  1GVP A;  2HIV A;  4BY1 G;  2RHS B;  1QZG A;  1K8A C;  4DK3 C;  3CC7 A;  1VQF A;  4BY7 G;  4OWT B;  3ULJ A;  1NMG A;  1L0W A;  3B6Y A;  1Z9F A;  1V1Q A;  2NVY H;  3W1G A;  3K7U C;  1VQM A;  1BKB A;  1VQA A;  3CPF A;  3ULL A;  4C3J H;  3KDF B;  4C3H H;  4DV5 Q;  2F4V Q;  3I4N H;  1C9O A;  2D62 A;  1PH4 A;  1XTD A;  3KF6 A;  4DV1 Q;  1PA6 A;  4DUZ L;  1N36 Q;  2N3S A;  3HOW G;  1VQL A;  5IWA L;  3CCE A;  4MTN A;  2VY3 A;  1L2F A;  1UEB A;  4HJ7 A;  2NZH A;  1EWI A;  1EOV A;  5HY6 A;  3F2D A;  3CPW A;  3M4P A;  2E5L Q;  1HNW L;  4JI1 L;  5C44 H;  4LF4 Q;  4B3T L;  1Y1W H;  5C0X J;  1SRU A;  3S24 A;  1J5E L;  1PH3 A;  2C35 B;  2KCM A;  4DR6 L;  1SLJ A;  1ASY A;  4POF A;  1L1O C;  4YY3 L;  1VQ8 A;  1CKM A;  4A3C H;  1QUQ A;  1OXS C;  1PFS A;  4YCU A;  2VUM G;  3F1Z A;  1HZA A;  1IBL L;  1OTC A;  1SFO H;  3U58 A;  2UUB L;  2N8N A;  3E9I A;  3I4M G;  1UWV A;  4POG A;  1KXL A;  4DR4 L;  1XMQ Q;  4EQ5 A;  4OXP A;  2R6G A;  5IYC H;  2K5V A;  1VQI A;  4RMF A;  3W5O A;  3CCS A;  4A3D G;  3RNU A;  3FHW A;  4IJH A;  2UUC L;  3BJU A;  5M3M G;  2Q2T A;  5GAG C;  2YV5 A;  1YHQ A;  2K14 A;  3DLL A;  3KFU A;  1M90 C;  2WB1 G;  3NBH B;  5ELN A;  3PO2 H;  2LXK A;  3CCL A;  1A62 A;  4DV4 L;  3CW2 C;  1AE2 A;  1KHI A;  5BR8 Q;  4OON A;  1HZ9 A;  1W2B A;  4L5Q A;  4ME3 A;  1J6Q A;  2UXC L;  4Y52 H;  4GS3 A;  3G6E A;  2NVQ H;  5IP7 G;  4JBM A;  2ID0 A;  1YNX A;  3I7F A;  1N34 Q;  5JJI A;  1CUK A;  2E2I H;  1VQK A;  1E7Z A;  1NE3 A;  3I56 A;  1MJC A;  2WB1 E;  3ICE A;  2R93 G;  3GTM H;  2HQL A;  3L0O A;  1EFW A;  1AE3 A;  1HH2 P;  3H15 A;  4JI7 L;  4OWX B;  2B63 G;  1YIT A;  1TWG H;  4A3F H;  4JI7 Q;  5E7N A;  1XNQ L;  2QA4 A;  4LFC Q;  2GVB A;  3M7N A;  4A76 A;  3GD7 A;  1VQC A;  4X65 L;  4HIK A;  3A5Z B;  3S2H H;  4HJA A;  4LF6 L;  4LF7 Q;  4A3M G;  4PZ7 A;  1KD1 C;  2GVA A;  3CCJ A;  2CQO A;  4A3L H;  2Q2I A;  4DR2 L;  2F52 A;  2ZJP A;  3HOZ H;  4IPH A;  2JA7 H;  3HOU G;  3ERS X;  4KHP L;  4X66 L;  1BVS A;  1KIX A;  2UXD Q;  1BBU A;  2JQO A;  5HGQ A;  5K36 G;  1VQB A;  3A74 A;  3ZJY C;  4YHH L;  1NJI C;  1HR0 W;  3FKI G;  1CKO A;  5C4X G;  2D0P A;  4NXN L;  3PIO A;  3MEF A;  2OTJ A;  2B3G A;  5FLM H;  2WP8 J;  4LUZ A;  5AJ3 L;  2Y0S G;  1SN8 A;  2WAQ G;  5IY0 A;  4JI6 Q;  3H3V H;  5M5W H;  3CAM A;  4JV5 L;  4BA1 I;  4R1J A;  3CP0 A;  1D7Q A;  2K5N A;  3SGI A;  2HIX A;  2CCZ A;  4JBJ A;  1IL2 A;  1QUQ B;  2K75 A;  1K8G A;  3H0G H;  5IP9 H;  2E8G A;  3RLF A;  1N32 Q;  1PVO A;  1XPU A;  2DGY A;  1VCI A;  1VQH A;  5FJ8 H;  3PO3 H;  2HT1 A;  1TXY A;  5LMN L;  1HZC A;  4A3K H;  3S1R H;  3M4O H;  2OCE A;  2Z6K C;  2ZTC A;  1VQ5 A;  2RCN A;  2ZTE A;  1Q46 A;  3PUV A;  5C4J H;  1E22 A;  1EQR A;  4DR1 L;  2ASB A;  4B3R L;  1V43 A;  4IJL A;  4X64 Q;  1HR0 Q;  4QY7 A;  1Y1V H;  1YZ6 A;  2MO0 A;  4IO9 A;  4K0K L;  4GLV B;  5GRO A;  4LF9 L;  3BU2 A;  1IBK L;  3TS2 A;  3KF8 B;  2R7Z H;  4BBS G;  4A93 H;  4DUY L;  1NTG A;  2CWP A;  3D0F A;  1KRS A;  4JI4 L;  1B7Y B;  1VQ7 A;  4DV2 Q;  4K0K Q;  2WFW A;  2ALY B;  4YCV A;  4MNO A;  4DV3 L;  4B3M Q;  3AQQ A;  1Q86 C;  3S2D H;  1C0A A;  2ZTD A;  2R92 G;  4QQB X;  4NPS A;  3HKS A;  4TQU S;  4OO1 I;  2JA6 H;  1D8L A;  3K0X A;  3GTO H;  4X6A H;  1EUJ A;  2RF4 A;  1TWF H;  2FXQ A;  1YEZ A;  5IT9 c;  4DR5 Q;  1YJW A;  4A3G H;  1LYL A;  4O2D A;  2IX1 A;  5GAE C;  4DV5 L;  2F4V L;  2E2J H;  2VNU D;  3E9H A;  3RR5 A;  3CCR A;  1XPR A;  4LF8 Q;  2AMC B;  4DV1 L;  3T1H Q;  3I4N G;  1N36 L;  3HOV G;  3J80 i;  1E1T A;  1TWA H;  1X65 A;  3K80 C;  4BXX G;  3HOY H;  2N78 A;  3HOX H;  3I2Z A;  3GTP H;  4HIM A;  1NMF A;  2KHJ A;  1OXV A;  1EIF A;  4LFB Q;  1RIP A;  1FVI A;  2E5L L;  2AWO A;  2WAQ E;  1XMO Q;  2AKW B;  1HZB A;  4GN5 A;  4NB3 A;  4KLK A;  1UE5 A;  3HKZ E;  1IYJ B;  3UDG A;  4LF4 L;  3KOJ A;  4BY1 H;  1VQ6 A;  3K8A A;  1SR3 A;  4A4I A;  2MFI A;  5IYB G;  5M3F G;  1IZ6 A;  4YCW A;  2ZM6 Q;  1SRO A;  4BBR G;  4AH6 A;  3G71 A;  3NEM A;  5JJL A;  3U50 C;  2PMZ E;  4MZ9 A;  4L5T A;  3MXN B;  3RLO A;  4A3J H;  3TRE A;  1SE8 A;  3A5U A;  4A3C G;  4OO1 G;  2MO1 A;  2VQF Q;  1K0R A;  2BH2 A;  4YWK A;  3F8T A;  3RN2 A;  4J15 A;  3K81 C;  1U5K A;  5M5Y H;  2AWN A;  4GNX A;  2JJQ A;  1Q81 C;  1E24 A;  1CSQ A;  4QJF A;  1XMQ L;  4GKJ Q;  4LW1 A;  4JI0 Q;  1FGU A;  5LMU Q;  1JMC A;  1PH1 A;  2UU9 L;  3U4V A;  3J81 i;  1JT8 A;  1CSP A;  1HNX Q;  5C3E G;  2UU9 Q;  4LF5 Q;  4PMW A;  5BR8 L;  3U4Z A;  3CF5 A;  4DR3 Q;  4GLX A;  2JK8 A;  3M4Q A;  1T9H A;  2JEA I;  1H95 A;  4UPA A;  1W3S A;  1WI5 A;  3PV0 A;  1X9N A;  2EXD A;  2JA5 G;  3H3V I;  4IPG A;  3S1M H;  1PYB A;  1N34 L;  4GOP B;  1GO3 E;  1A0I A;  3DM3 A;  1YVC A;  3EN2 A;  3Q8D A;  3J7Z C;  4P73 A;  2ATW A;  2VUM H;  2CKZ B;  2KBN A;  2KHI A;  1KAW A;  1PH8 A;  2IX0 A;  4UP7 A;  2VQE Q;  4R4O A;  3TEH B;  1JJG A;  3UDI A;  1VQJ A;  5M5X H;  1HNZ Q;  4IOC A;  1QZH A;  3UDX A;  3OTO Q;  4LFC L;  1FJG Q;  1QVF A;  2L15 A;  4NXM Q;  1X56 A;  4Y7N H;  4A3D H;  1Q8K A;  1GM5 A;  2OQ0 A;  4LF7 L;  4OX9 Q;  2QGQ A;  2ZJQ A;  3VDY A;  1OXT A;  2VW9 A;  3S1N H;  4JI3 Q;  3KLW A;  3HOZ G;  1N8R C;  3GTL H;  2E2H H;  1YJ9 A;  2UXD L;  4TVA B;  1MKH A;  4LFA Q;  5IP7 H;  3AFP A;  3M9B A;  4JYA Q;  1WCM G;  2PNH A;  4R4Q A;  2N49 A;  3CD6 A;  1VQ4 A;  4JBW A;  5JEA G;  2R93 H;  1IBM L;  5FLM G;  4JI6 L;  1XJV A;  5J3B A;  1IBM Q;  3GTK H;  2OWO A;  2OTL A;  1K83 H;  3UE0 A;  4WJ4 A;  1Q1E A;  1I50 H;  5H1S E;  2BH8 A;  3E0E A;  2A19 A;  3UDF A;  3KJO A;  1S40 A;  4R4T A;  1S72 A;  2IHF A;  1YHB A;  1G51 A;  3AFQ A;  3WWV A;  1N32 L;  3H0G G;  1G6P A;  1UE1 A;  4GNX B;  3ULP A;  1EIY B;  2JA8 G;  3HOU H;  4JCV E;  4GN4 B;  4B3S Q;  4UP9 A;  2H5X A;  3KJP A;  4JBK A;  4OWW B;  4P72 A;  4DV6 Q;  1P16 A;  1B8A A;  4A3I G;  4IFD J;  4X64 L;  4P75 A;  1TWH H;  4A3E G;  1HR0 L;  3J80 c;  4JI8 Q;  3W1B A;  4AQY Q;  1Y1V G;  3TRZ A;  2NZO A;  5IYD H;  4JOI A;  2YTX A;  2JA9 A;  1BBW A;  2KEN A;  3GTJ H;  2R7Z G;  4DR7 Q;  1LM0 A;  2IHE A;  3TS0 A;  2R7D A;  5JEA J;  4DV0 L;  5GQO A;  4DV2 L;  4DK6 C;  3NEL A;  4IPC A;  4JI2 Q;  3RZD H;  1Q82 C;  2A8V A;  4A3B H;  5DLQ E;  1P8L A;  4DV0 Q;  4B3M L;  4KHZ A;  4GOP A;  1WJJ A;  4L5R C;  2LXJ A;  1WYD A;  4XTC S;  3RZO H;  4GN3 B;  3PUX A;  2GN5 A;  4DV7 Q;  3T1Y Q;  2D0O A;  4H02 A;  2XGT A;  4DR5 L;  4FDB A;  3PCO B;  4A3G G;  3L7Z C;  1KL9 A;  1A63 A;  1UE6 A;  3PUZ A;  4LF8 L;  1JJC B;  2CWA A;  3HKZ G;  3T1H L;  1YI2 A;  1AH9 A;  1I3Q H;  2BA0 A;  1EYG A;  2Q2U A;  3OYY A;  2HHH Q;  2NVT H;  4PZ6 A;  2K5H A;  3HOX G;  1JJ2 A;  2JEB I;  4KI0 A;  3S16 H;  1E3P A;  1N33 Q;  4LFB L;  3J81 c;  1QVG A;  2PI2 A;  1XMO L;  3AYH B;  1PH9 A;  3I4O A;  3IRB A;  4PG3 A;  3PSI A;  2R92 H;  1VQG A;  3OW2 A;  1NBW A;  2V1C C;  5C44 G;  2I5H A;  2UUA Q;  1K9M C;  2OQK A;  2F3I A;  3GO5 A;  2ZM6 L;  1Y1W G;  1PH2 A;  3BZK A;  2PQA A;  2K52 A;  4BY7 H;  1NY4 A;  2EQS A;  3PGZ A;  2VZA A;  4IOA A;  4YWL A;  4DPG A;  4ALP A;  2YU9 H;  4JI5 L;  1WOC A;  2VQF L;  2I5L X;  4A75 A;  4A3J G;  4LUO A;  1O7I A;  3S1Q H;  1HJP A;  2B29 A;  4JI5 Q;  1L1O A;  3HOV H;  2AHO B;  1YJN A;  2I5M X;  4BXX H;  4GKJ L;  4QIW E;  3M3Y H;  3JAM i;  1K73 C;  4JI0 L;  3AEV A;  1UE7 A;  3HOW H;  1VS0 A;  3L2P A;  3G4S A;  4DUZ Q;  5LMU L;  1YBY A;  1VQP A;  4C3I H;  3CCQ A;  5IWA Q;  3PO2 G;  4IFD I;  5IYC G;  3F2B A;  4LNQ A;  1R9T H;  3PIP A;  1X6O A;  4HJ5 A;  1EQQ A;  1HNX L;  1CKN A;  1DGS A;  4LF5 L;  4DR3 L;  1PH5 A;  1FL0 A;  1Y14 B;  4P74 A;  4LUV A;  4JI1 Q;  4DAM A;  5IYB H;  5M3F H;  4B3T Q;  4LWC A;  3S14 H;  3I4M H;  4BBR H;  1X55 A;  2RHQ B;  4AIM A;  4GLA C;  1J5E Q;  3J81 j;  1Q7Y C;  3J7A 5;  4DR6 Q;  1MIU A;  4GNX C;  3A0J A;  4YY3 Q;  1SMX A;  2MNA A;  4APV A;  4QGU A;  2VQE L;  2UXB L;  1JE5 A;  1TWC H;  2NN6 I;  2YTY A;  2DUD A;  1VQO A;  1IBL Q;  2UXB Q;  1C7Y A;  1HNZ L;  3G48 A;  1ASZ A;  3OTO L;  2UUB Q;  4UY8 C;  3BZC A;  3CCV A;  2JE6 I;  1K3R A;  4YWM A;  5EAY A;  4NXM L;  1FJG L;  3RN5 A;  3STB D;  1Z47 A;  1RL2 A;  1VQN A;  4A3F G;  3S17 H;  4DR4 Q;  4P71 A;  4OX9 L;  1X54 A;  1MJE A;  5M3M H;  1I94 L;  2UUC Q;  3D31 A;  4JI3 L;  5C3E H;  2QEX A;  1I94 Q;  3EIV A;  3S15 H;  4IFD G;  1KQS A;  4A3L G;  3UE1 A;  4LFA L;  1PYS B;  2YTV A;  2JA7 G;  4DV4 Q;  2JA5 H;  1PH6 A;  4GKK L;  1PHJ A;  4JYA L;  1VQD A;  3PF5 A;  2UXC Q;  2VL6 A;  3PF4 A;  4GKK Q;  2I0Q A;  2EIF A;  3F2C A;  1OXU A;  2CFM A;  4WJ3 M;  2PI2 E;  2YYZ A;  1PH7 A;  3LGJ A;  1Q12 A;  2ES2 A;  2B63 H;  1S3O A;  2K4K A;  2PQA B;  4RG1 A;  3FP9 A;  2IY5 B;  1GKH A;  4DAY B;  3GDE A;  5FLX c;  1XNQ Q;  3CCM A;  2NN6 G;  1XNR L;  3M85 A;  2NVX H;  4JC0 A;  4XIG S;  3GTG H;  3TQY A;  4X65 Q;  4A3M H;  1XNR Q;  1N9W A;  1L1O B;  4LF6 Q;  4DNI A;  3KF6 B;  5IP9 G;  4B3S L;  3KDF A;  3K7A H;  3KYH C;  5LMN W;  4DR2 Q;  2KCT A;  5FJ8 G;  2MQH A;  1U0L A;  4HID A;  3PO3 G;  4DV6 L;  3STB C;  1GD7 A;  4PZ8 A;  1IXR A;  4R4C A;  4HJ9 A;  4A3K G;  1X3E A;  5IE8 A;  4X66 Q;  1KRT A;  3ER0 A;  3PUY A;  1WCM H;  4KHP Q;  1M1K C;  5C4X H;  3FKI H;  2Z6K A;  1B70 B;  4L5S A;  4JI8 L;  4YHH Q;  4AQY L;  1CKN B;  1YIJ A;  4UP8 A;  4NXN Q;  5C0X I;  5IYD G;  3CME A;  1JB7 A;  1LTL A;  1E1O A;  2ZJR A;  1A8V A;  5AJ3 Q;  1Q1B A;  4DR7 L;  3CMA A;  4DKA C;  2BA1 A;  2IT1 A;  1LUZ A;  4JI2 L;  4EX5 A;  4JV5 Q;  4A93 G;  1HNW Q;  3PUW A;  3RLN A;  5JJK A;  3EBE A;  4A3B G;  1X3G A;  4HJ8 A;  3CXC A;  3I55 A;  2JA8 H;  1PV4 A;  4IPD A;  1YHA A;  2Y0S E;  1X3F A;  2R7F A;  1KC8 C;  2XTI A; 
#chains in the Genus database with same CATH topology
 4DV7 L;  4NW2 A;  4DN4 M;  4S3S A;  5LMN Q;  1I5F A;  1V9P A;  4X62 Q;  4RHR A;  1F2Z A;  4DR1 Q;  5IOC A;  1PRT D;  3JAM c;  4G7H C;  2Z0S A;  2HHH L;  3CQZ H;  4LF9 Q;  1TU2 B;  4QB4 A;  3EJI A;  4XYQ A;  3NXW A;  3CCU A;  2LFN A;  4DUY Q;  2HQE A;  4ULL A;  5COY A;  3GTQ B;  2A68 D;  1EOT A;  4HIO A;  1I4H A;  1G29 1;  5K5P A;  1O7Y A;  3ULJ A;  3MXG A;  4F87 A;  1V1Q A;  3W1G A;  1VQM A;  1X32 A;  1VQA A;  5I2Y A;  4C3H H;  4DV5 Q;  1ZKO A;  4FVM A;  1WTW A;  1TII D;  4UHV A;  4DV1 Q;  1N36 Q;  2NVY B;  2N3S A;  3HOW G;  3CCE A;  2PZW A;  3TDQ A;  3HKZ B;  4C3J B;  2NZH A;  1QWY A;  2EY2 A;  4QUC A;  4FXG C;  3CPW A;  3M4P A;  3F2D A;  1PZJ D;  1M8A A;  5C44 H;  3W3A A;  1BCP B;  1JOO A;  2DJG C;  3NPP A;  3X3N A;  1CKM A;  1ICW A;  3K0Y A;  5JPM C;  3I4L A;  3F1Z A;  3I91 A;  1SFO H;  3U58 A;  4HN7 A;  4KN4 C;  2N8N A;  4KK7 A;  3I4M G;  4DR4 L;  4OXP A;  1EL0 A;  2K5V A;  1VQI A;  3KFU A;  4ZQ3 A;  2B8G A;  2YV5 A;  5GAG C;  1M90 C;  1JOQ A;  3CU7 A;  4QMG A;  2WII B;  2JP1 A;  5G3L F;  1A62 A;  5E4X A;  2OF1 A;  1AE2 A;  4DXG A;  4ME3 A;  2F0T A;  5CV6 A;  4Y52 H;  4GS3 A;  3G6E A;  5IP7 G;  1SNP A;  1A2U A;  2ID0 A;  3I7F A;  1N34 Q;  1JOR A;  1NE3 A;  2WB1 E;  4HTH A;  1HH2 P;  3P20 A;  5ELD A;  1YIT A;  4A3F H;  1AP0 A;  1SXT A;  2E2I B;  3G6J B;  3S2H H;  4HJA A;  4LF6 L;  2F0V A;  5IGE A;  1FGB D;  2CQO A;  4A3L H;  4DR2 L;  1B1Z A;  4BWG B;  4WRD A;  3NBI A;  3FVQ A;  1HA5 A;  2F0U A;  4X66 L;  4EQP A;  1KIX A;  5K36 G;  1JB3 A;  4G57 A;  3ZJY C;  1NJI C;  1CKO A;  3DHQ A;  3HOZ B;  2EVB A;  4K6D A;  4LUZ A;  5AJ3 L;  2A6H D;  2Y0S G;  1SN8 A;  2WAQ G;  3TP5 A;  3BVM A;  1NSN S;  1E2V A;  1QUQ B;  1K8G A;  2K5W A;  2B2V A;  3KBX A;  1PVO A;  1GHK A;  1XPU A;  2DGY A;  5C5L A;  1SYE A;  1VCI A;  5FJ8 H;  4DK0 A;  1HZC A;  1EYD A;  4A3K H;  3S1R H;  3M4O H;  2RCN A;  3Q24 A;  4XDX A;  1B4O A;  1JOK A;  3PO3 B;  4IJL A;  2J7Z A;  1HR0 Q;  2MO0 A;  4DA2 A;  3TS2 A;  3BU2 A;  2MGS A;  2F0Q A;  5FKA C;  4BBS G;  1EQT A;  2SEB D;  5CGK A;  1VQ7 A;  4K0K Q;  4LMQ D;  1EY8 A;  4DV3 L;  4B3M Q;  3K57 A;  3URY A;  5IT9 E;  1DOL A;  1HUM A;  4TQU S;  1DON A;  3PQI A;  3K0X A;  3PIO 3;  2K04 A;  1LTA D;  1EUJ A;  2FXQ A;  3S2D B;  1YJW A;  5ELE A;  1LYL A;  2HDL A;  1A3T A;  2ZXR A;  3NWS A;  1HQM C;  3RR5 A;  2E76 C;  3I4N G;  2L55 A;  1FNV A;  2EY6 A;  2IPK D;  3GP7 A;  3GTP H;  4IQZ A;  1NMF A;  5J1Z A;  4FXK C;  2E2J B;  1OXV A;  2GA4 B;  2NUC A;  4MHE A;  4GN5 A;  1HZB A;  4NB3 A;  1D5M C;  3KOJ A;  1A3V A;  1SR3 A;  5IYB G;  1D5X C;  2K28 A;  3WDN A;  4WFN 3;  2ZM6 Q;  1SRO A;  5JJL A;  4AH6 A;  1QNK A;  2F0N A;  1BOS A;  3D4D A;  3EFX D;  3MXN B;  4MZ9 A;  4OGQ C;  2BH2 A;  3RN2 A;  2A74 C;  5M5Y H;  5CMD A;  3K5N A;  1C8C A;  4GZY C;  4X3T A;  1E24 A;  4QJF A;  1XMQ L;  1SEB D;  4CDD C;  2SNS A;  1MHW C;  1FNU A;  1QNU A;  4I65 A;  3U4V A;  1EYC A;  1CSP A;  1D2B A;  3BVZ A;  3M4Q A;  1T9H A;  4DAV A;  2EXD A;  2JA5 G;  1U9R A;  5COR A;  1PYB A;  3Q8D A;  3LWE A;  4P73 A;  4R4O A;  2KA7 A;  1ONL A;  1JJG A;  3S1M B;  4EQN A;  4IOC A;  2VUM B;  4LFC L;  4Y7N H;  3H94 A;  4PQX A;  2HCI A;  1LTS D;  2RBM A;  3IFT A;  4OX9 Q;  2ZJQ A;  1PDQ A;  1STN A;  1GHJ A;  1EY7 A;  1N8R C;  3GTL H;  1PTO H;  3E6Z X;  4A3D B;  4CDF C;  3SR1 A;  1YJ9 A;  2UXD L;  1WTH A;  3W2D A;  3S1N B;  2PNH A;  2N49 A;  2E2H B;  1S5E D;  5FLX L;  1XJV A;  2QEJ C;  2F0J A;  1MI2 A;  2OWO A;  3AMU A;  4ZAI A;  5H1S E;  2VB3 X;  3E0E A;  2A19 A;  2L9H A;  4CKE A;  1S72 A;  3A54 A;  2IHF A;  3OOC A;  1G51 A;  3WWV A;  3GTK B;  3H0G G;  3MXN A;  1Y8O B;  2Z8L A;  1SE3 A;  2EDG A;  4I7A A;  3HZX A;  3FDT A;  4DV6 Q;  3LNN A;  3ERO A;  4JI8 Q;  5IYD H;  1Y1V G;  3A8I E;  1S5F D;  1KTK A;  4FP5 D;  1BBW A;  2KEN A;  1RDP D;  5C4J B;  3ND8 A;  2R7Z G;  1TWH B;  4DR7 Q;  1LM0 A;  2IHE A;  5I9O A;  5JEA J;  3RZD H;  4DV2 L;  2DNC A;  4A3B H;  2XRQ D;  4DV0 Q;  4KHZ A;  2B2U C;  3WOF A;  1IKM A;  3PUX A;  5CV4 A;  4DV7 Q;  2D0O A;  2MHV A;  2V4D A;  1HTL D;  2XGT A;  4K5V A;  4DR5 L;  3PCO B;  4A3G G;  3L7Z C;  1KL9 A;  3NTH A;  3Q23 A;  1UE6 A;  1VMC A;  3HKZ G;  4C3J G;  2BA0 A;  2AQ2 B;  2F0E A;  2Q2U A;  3J81 E;  3OYY A;  3OSO A;  2HHH Q;  2Z6B A;  3QOL A;  1V1P B;  5G3L D;  4PZ6 A;  3HOX G;  2JEB I;  4B9X A;  2X69 A;  2WV6 D;  1PH9 A;  3MTS A;  3IRB A;  2NVT B;  3PSI A;  1GXD C;  5EGT A;  2XVS A;  1RJT A;  1OO9 B;  4PNY A;  1F77 A;  3PGZ A;  1UEA B;  1HHV A;  4DPG A;  1LT5 D;  2B2W C;  4A75 A;  4A3J G;  3V2T A;  1STG A;  3S1Q H;  2B29 A;  4JI5 Q;  3HOV H;  4BXX H;  3R8B A;  1YJN A;  1PMR A;  4GKJ L;  1K73 C;  4JI0 L;  2PW5 A;  1C4Q A;  3R3O A;  5LMU L;  4IFD I;  3CCQ A;  1I4P A;  4CHT B;  1X6O A;  1EQQ A;  1CKN A;  4LF5 L;  3HOW B;  2RVL A;  5F2D A;  3S14 H;  4ODG A;  4CDE C;  4AIM A;  1R9T B;  1MIU A;  2VQE L;  5M3F B;  4BBR B;  1TWC H;  1WTR A;  1AFP A;  2P5Z X;  1HNZ L;  1U4R A;  2OEO A;  3G48 A;  4UY8 C;  1FJG L;  3BZC A;  3CCV A;  4NXM L;  4X6A H;  5EAY A;  1Z47 A;  3T51 B;  1VQN A;  4DR4 Q;  5EQ0 A;  1I94 L;  2RDF A;  3I4M B;  1CI3 M;  4JI3 L;  5C3E H;  2K32 A;  5M5X B;  4LFA L;  1PYS B;  4IAL A;  1TS3 A;  2BCO A;  4GKK L;  1PHJ A;  1V1P A;  2VL6 A;  2I0Q A;  1R4Q B;  1ENC A;  1PH7 A;  4OEL B;  2ES2 A;  2K4K A;  2IY5 B;  1GKH A;  3GDE A;  5FLX c;  4H0L C;  1ZYR D;  3GTG H;  3TQY A;  1L1O B;  4LF6 Q;  3DWP A;  4B3S L;  5HGT A;  3KYH C;  1GUO A;  1SMY D;  1BQQ T;  4DR2 Q;  3PO3 G;  4HID A;  4PZ8 A;  1X3E A;  3KLS X;  4X66 Q;  1ML0 D;  2VXW A;  1Z6H A;  1M1K C;  5C4X H;  2Z6K A;  1B70 B;  3MVV A;  4AQY L;  1SNM A;  1T5E A;  3DMU A;  4TRD A;  3NUC A;  4UP8 A;  3TP7 A;  3R2I A;  2K1B A;  3N6R A;  3NWT A;  5AJ3 Q;  4ZK9 B;  3RUZ A;  2BA1 A;  5FO7 B;  4NMZ A;  4JI2 L;  1KDB A;  4A93 G;  1TS4 A;  1S5B D;  3EBE A;  1X3Q A;  4DF7 A;  3I55 A;  1YNJ C;  1X3F A;  2R7F A;  1KC8 C;  1VF5 C;  3ONA B;  1OXX K;  1XPO A;  1FD7 D;  2ZXO A;  4JW0 A;  3NEN A;  1QVC A;  3JAM E;  1EIH A;  4JOI C;  3DEP A;  1JE4 A;  3NTK A;  3T13 A;  4DK1 A;  3BVG A;  4BA2 I;  2Q2H A;  4QL5 A;  3LWU A;  2LSS A;  2D5D A;  2RDH A;  4A3E B;  4C2M B;  3CC4 A;  4UAI A;  5A2Q L;  5C0X G;  4JG2 A;  4GOP C;  2A1A A;  3VYT A;  1G91 A;  1STY A;  5I6W A;  5CV5 A;  1IW7 D;  1EY9 A;  4JPB W;  1I6H H;  5BN3 A;  4AYB E;  4KY5 A;  4BBS B;  2ZT9 C;  4DV3 Q;  2UUA L;  1S4Z A;  5GAH C;  1TY2 A;  2RHS B;  1E2W A;  1K8A C;  4DK3 C;  1VQF A;  4R9W A;  4OWT B;  1NMG A;  2MJ8 A;  2FMM A;  3B6Y A;  4KTA A;  2NYZ D;  2QIL A;  1RF2 D;  1I4R A;  3KDF B;  2Z4H A;  1C9O A;  5LHY 1;  3MA2 B;  1BXT A;  2I46 A;  5IWA L;  4PV1 C;  2VY3 A;  1L2F A;  4HJ7 A;  2BOS A;  2R3Z A;  3I4N B;  1PRT C;  2E74 C;  1HNW L;  1HXY D;  3E3X A;  5KND A;  2PMZ B;  2PQE A;  3SDZ A;  4U67 3;  1GUT A;  1KDC A;  5TSS A;  1L1O C;  4POF A;  1DOK A;  3EA6 A;  4YY3 L;  4A3C H;  4OO1 H;  2A68 C;  2NTT A;  4WOR A;  1Y1W B;  2VUM G;  1V8Q A;  2LMC B;  1OTC A;  3D4R A;  2SNM A;  4CJ2 C;  1XMQ Q;  4CKC A;  1PTO F;  2WIN B;  4RMF A;  4A3D G;  1CZG A;  3RNU A;  4IJH A;  2UUC L;  1YHQ A;  1BUV T;  2WB1 G;  3PO2 H;  5KEE A;  2LXK A;  3KBG A;  1V1O A;  1W2B A;  1VDZ A;  4FXD A;  4KMU C;  4JBM A;  5E4W C;  5JJI A;  1VQK A;  1E7Z A;  1C48 A;  3ICE A;  2ENB A;  3L0O A;  3D6C A;  4HCS A;  1WD0 A;  3H15 A;  1EFW A;  2B2Y A;  1WTO A;  1TWG H;  4JI7 Q;  2KEE A;  4RCO A;  2EY1 A;  4LFC Q;  3SE0 A;  1NNX A;  2GVA A;  3CCJ A;  4DNR B;  4IPH A;  1H9K A;  3HOU G;  3ERS X;  5T1G A;  2UXD Q;  4K8I A;  5IGF A;  3BZD B;  3NTI A;  5HGQ A;  4G7Z C;  4YHH L;  4K8J A;  3FKI G;  5KRU A;  2D0P A;  2A6E C;  3MEF A;  2OTJ A;  2B3G A;  5JAV A;  3GV3 A;  5EJW A;  2MP1 A;  5M5W H;  4R1J A;  3CP0 A;  1D7Q A;  2K5N A;  3SGI A;  2CCZ A;  3I72 A;  2QW7 A;  5IP9 H;  3RLF A;  1ILQ A;  3I90 A;  1PLF A;  4N9T A;  5DNF A;  3C2P A;  3E0J A;  1TXY A;  1DXM A;  1FNW A;  2OCE A;  2ZTC A;  1S5C D;  1Q46 A;  1HQR D;  3H0G B;  3KK7 A;  3PUV A;  5C4J H;  1WTP A;  2F0S A;  2FMC A;  1QJO A;  1YZ6 A;  4JVZ A;  4IO9 A;  4GLV B;  2KOL A;  1F2L A;  1SND A;  4IUV A;  4CGY B;  3J7A V;  3NQT A;  1JCK B;  1KRS A;  1Y1V B;  4U68 A;  4DV2 Q;  1NR4 A;  3AQQ A;  2A6H C;  3RD4 A;  3K5M A;  1Q86 C;  2R7Z B;  3D3R A;  4QQB X;  2F0O A;  4LK1 C;  3GTO B;  2O2L D;  4PMB A;  2H1E A;  2KCN A;  3GTO H;  3TP8 A;  5J39 A;  1TWF H;  1YEZ A;  4OIK A;  4DR5 Q;  2QKI C;  2NB0 A;  4O2D A;  5GAE C;  2VNU D;  2JA6 B;  2PYK A;  1XPR A;  1X65 A;  4A3G B;  2N78 A;  1BNZ A;  1ET6 A;  4HIM A;  1D6E C;  1EIF A;  1RD9 D;  1TWA B;  3HOY B;  4CKB A;  4XT1 B;  3HOX B;  3K8A A;  4A4I A;  4M8A A;  5M3F G;  4YCW A;  4BBR G;  3U50 C;  2F0H A;  4L5T A;  3MAQ A;  2L0C A;  4BY1 B;  2MO1 A;  1U4P A;  4NP5 A;  1CA6 A;  2XRS D;  3K81 C;  1U5K A;  4GNX A;  4RKB A;  3DWA A;  2IL8 A;  3DXJ C;  2K05 A;  2KEC A;  4A3J B;  4GKJ Q;  4JI0 Q;  3GQB A;  2A73 B;  5LL6 S;  5LMU Q;  3A8K E;  1PH1 A;  1SE2 A;  2UU9 Q;  2H4O A;  5T1I A;  4LF5 Q;  1K28 A;  2TMP A;  3ERQ A;  3NQI A;  3PV0 A;  1CHP D;  1X9N A;  5DEH A;  3TZU A;  3H3V I;  3DM3 A;  1Z7T A;  3OHX C;  4C1N I;  2KBN A;  1PH8 A;  2VQE Q;  4V19 0;  1IL8 A;  1VQJ A;  5M5X H;  1HNZ Q;  1QZH A;  2NVQ B;  3UDX A;  1FJG Q;  4NXM Q;  1JWM D;  1Q8K A;  1GM5 A;  2F4I A;  2QGQ A;  3VDY A;  4F88 A;  4JI3 Q;  4TVA B;  1MKH A;  4LFA Q;  1H9S A;  5IP7 H;  1BBX C;  4X3S A;  1WCM G;  1A6X A;  3H91 A;  3L3O C;  4JI6 L;  1IBM Q;  5J3B A;  2OTL A;  4ZKC B;  1K83 H;  5CBE E;  4WJ4 A;  1I50 H;  3PIP 3;  3KJO A;  3HS0 C;  3VR2 A;  2PPB C;  2R93 B;  2NN6 H;  1PYW D;  4R4T A;  3NHH A;  1YHB A;  3AFQ A;  1SNQ A;  3A7L A;  1UE1 A;  4XQN A;  4DXF A;  1EIY B;  2JA8 G;  2KHS A;  2KCC A;  3G7L A;  3HEJ A;  4JCV E;  4B3S Q;  4JBK A;  5I4D A;  1SYD A;  4P72 A;  5K36 H;  3KUP A;  5EKL A;  5C3X A;  4A3I G;  1PZK D;  4X64 L;  4A3E G;  1PXU A;  1B9N A;  5KGU A;  3X3M A;  4AQY Q;  3TRZ A;  2NZO A;  1BCP C;  2YTX A;  2B2V C;  2XNA C;  3TS0 A;  1HCZ A;  2PZT A;  5GQO A;  4DK6 C;  4JI2 Q;  3GTJ B;  1WYD A;  3P75 A;  2GN5 A;  1CHQ D;  4A93 B;  1Y8N B;  1PTO D;  5IOD A;  3PUZ A;  4LF8 L;  4G4K A;  3R93 A;  3QR8 A;  1I4X A;  4DAP A;  1LAC A;  4XT3 B;  3I70 A;  1QB5 D;  3NE5 B;  4KI0 A;  1E3P A;  1DM0 B;  1VF7 A;  1HFG A;  4I7Z C;  1QVG A;  2PI2 A;  2HUG A;  1I3Q B;  1SYB A;  4TSS A;  2V1C C;  3SK4 A;  3S16 B;  1MSH A;  2I5H A;  2F0L A;  2UUA Q;  4BS9 A;  2F3I A;  2NZ1 D;  1Y1W G;  1CM9 A;  4FNF A;  1J9O A;  4BY7 H;  3NK9 A;  5KNC A;  2F3W A;  4DAY A;  4IOA A;  1H9R A;  4ALP A;  2R92 B;  2YU9 H;  4LUO A;  1STB A;  3MFG A;  1LT6 D;  5EPK A;  4QIW E;  1I6V C;  5EKK A;  5IWA Q;  5IYC G;  3PIP A;  3L9A X;  1HNX L;  1PFM A;  1HTP A;  3M3Y B;  2ZXP A;  4DR3 L;  1FL0 A;  1HNW Q;  4LUV A;  5IYB H;  4C3I B;  2MPM A;  4HED A;  2RHQ B;  5DAU A;  3CRL C;  3J81 j;  1Q7Y C;  3J7A 5;  3IFD A;  1F9R A;  4YY3 Q;  1LTB D;  1LTG D;  5C4Z A;  2YTY A;  2DUD A;  2UXB Q;  2K5Q A;  3A7A B;  1ASZ A;  1IL2 A;  2JE6 I;  2CW0 D;  3RN5 A;  1RL2 A;  4B9W A;  1WD1 A;  4M1U B;  3AU7 A;  4P71 A;  5M3M H;  3MXP A;  2UUC Q;  2LS0 1;  3KLR A;  3DEO A;  3S17 B;  3EIV A;  1DCZ A;  1HRJ A;  3IKJ A;  2YTV A;  2JA7 G;  2JA5 H;  2EOT A;  2WB1 B;  1CQV A;  1KNE A;  2K7V A;  3PF4 A;  1K8O A;  3S15 B;  2SOB A;  3F2C A;  3MFY A;  1B3A A;  4MN3 A;  1JIC A;  4J1M A;  2YYZ A;  3LGJ A;  5FLX E;  1G2T A;  2B63 H;  5C5M A;  2CHB D;  4H13 C;  4RG1 A;  2XIW A;  4PMC A;  3M85 A;  4JC0 A;  3OPO A;  4A3M H;  1XNR Q;  1BF4 A;  3C1E A;  1PFN A;  2CVR A;  1U0L A;  2RDG A;  2NVX B;  1GD7 A;  1IXR A;  1NCV A;  3ER0 A;  4FF4 A;  5L37 A;  3VR5 A;  1FYC A;  3K7A B;  4YHH Q;  4L5S A;  3HOU B;  1CKN B;  5C0X I;  1XX8 A;  2I07 B;  5IYD G;  4V0B A;  2ZJR A;  1A8V A;  2HDM A;  1Q1B A;  3FKI B;  3BYT B;  4EX5 A;  2XN9 C;  1B50 A;  4XXE A;  2N55 A;  4A3B G;  1X3G A;  3R2T A;  1X3P A;  3EVQ A;  3CXC A;  2O4X A;  2Y0S E;  2WAQ E;  2ICI A;  4C1N K;  4X62 L;  3DWQ A;  3N52 A;  2JA6 G;  1ZYR C;  3CC2 A;  3JC6 6;  1GUG A;  4R4I A;  2EYO A;  3RZO B;  5IGC A;  4AYB G;  4DNT B;  2JXM B;  4KY6 A;  2XWJ B;  2X6G A;  5GAD C;  1WFQ A;  1SMY C;  3GTQ H;  3UI2 A;  3HOY G;  1QCB D;  4KKS A;  2F1M A;  1VQ9 A;  4ABN A;  1EZ6 A;  2EE1 A;  2M9V A;  1TQO A;  3CQZ B;  1RKN A;  3FRP B;  4QUF A;  1SAP A;  4L6T B;  5ELO A;  1LV9 A;  2F0G A;  1GVP A;  2HIV A;  3H6M A;  4BY1 G;  1AW7 A;  4OEM B;  1W6K A;  2C9O A;  1SYC A;  1L0W A;  4L63 B;  5CC4 A;  3T4A C;  1Z9F A;  2NVY H;  5ELC A;  4IUT A;  2B2T C;  4C3J H;  5C4H A;  2D62 A;  1KDA A;  1PH4 A;  2PO4 A;  2KVM A;  4TKO B;  1VQL A;  4MTN A;  1UEB A;  2CH4 A;  4C3H B;  3T16 A;  1F9Q A;  4B08 A;  1UNS A;  2OXP A;  2MUY A;  1JC7 A;  1EYA A;  3DM1 A;  5HY6 A;  1GUN A;  5JVG 3;  4IZ8 A;  4XYO A;  5C0X J;  4N8X 1;  2D2C C;  2NWG A;  1PH3 A;  2C35 B;  2KCM A;  5FO8 B;  1SLJ A;  2JSO A;  1ASY A;  1BDO A;  1IW7 C;  3RMH A;  3BS1 A;  1VQ8 A;  1OXS C;  1O7L A;  1STH A;  1DZ1 A;  4IN3 A;  3WOE A;  4HR7 B;  1UWV A;  4IUR A;  4POG A;  5HUR A;  1KXL A;  4EQ5 A;  1PFB A;  3Q22 A;  2O5I C;  1SFO B;  2Q2T A;  1AN8 A;  4X3K A;  3DLL A;  5ELN A;  5IGB A;  1A15 A;  1EY4 A;  1HZ9 A;  2K5D A;  2NVQ H;  1YNX A;  1CUK A;  2E2I H;  1CT1 D;  3V05 A;  1MJC A;  3TBI B;  2R93 G;  2HQL A;  1AE3 A;  4OWX B;  5E7N A;  1XNQ L;  2AQ1 B;  2EYH A;  5D14 A;  1VQC A;  4X65 L;  1TVX A;  4PZ7 A;  1KD1 C;  1CTM A;  5D3D A;  2Q2I A;  4RAU C;  2F52 A;  3HOZ H;  4KHP L;  1JWU D;  3S2H B;  1VQB A;  5C4X G;  4NXN L;  5JEA H;  5FLM H;  5EPJ A;  4JI6 Q;  1LTT D;  2EYP A;  1G6Z A;  1WCM B;  4BA1 I;  4JBJ A;  2E8G A;  1TS2 A;  1HPC A;  3PO3 H;  1VQH A;  4KJN A;  3J80 L;  2Z6K C;  2DN8 A;  2ZTE A;  1EU3 A;  1D1I A;  1EQR A;  4XQJ A;  5I2X A;  2ASB A;  2JA8 B;  4B3R L;  1V43 A;  4X64 Q;  3S1R B;  4A3K B;  1AEX A;  5GRO A;  1IBK L;  1I4Q A;  4A3I B;  1O78 A;  1RTO A;  1ENA A;  1FR3 A;  4A93 H;  3TSS A;  3S9W A;  3D0F A;  4JI4 L;  1STA A;  3EQL C;  5A2Q E;  4EVO A;  1G2S A;  1K0S A;  2WFW A;  5CYU A;  4MNO A;  1C0A A;  1DD2 A;  3S2D H;  4K5W A;  2WKD A;  2R92 G;  4NPS A;  1M4V A;  3HKS A;  1D8L A;  5IIF A;  2RF4 A;  2IX1 A;  2F4V L;  2E2J H;  2CQA A;  3E9H A;  1EFI D;  4LF8 Q;  1SDF A;  3J80 i;  1E1T A;  1LTR D;  4IUN A;  4P2C B;  2A5H A;  2KHJ A;  1ROD A;  4C3I G;  1RIP A;  3A8J E;  3VA7 A;  2E5L L;  2AWO A;  2AKW B;  3OW7 A;  1SJE D;  4LF4 L;  4HAE A;  3HKZ E;  3Q0A A;  3GTP B;  1VQ6 A;  2MFI A;  1IZ6 A;  3QO2 A;  4RHS A;  1SE8 A;  3A5U A;  4A3C G;  4OO1 G;  2C5C A;  2JN4 A;  1K0R A;  5KYI A;  3F8T A;  1EWC A;  2JJQ A;  1S5D D;  3HRZ C;  4LW1 A;  1MBY A;  2IJ0 A;  5EKI A;  2O5J C;  1KAA A;  4QF4 A;  5M5Y B;  2KED A;  1JMC A;  3C46 A;  1SNC A;  1EZ8 A;  1JT8 A;  1HNX Q;  4UDU C;  3I3C A;  4PMW A;  2DJF C;  3OWE B;  3VYS A;  5BR8 L;  3CF5 A;  1LT3 D;  4DR3 Q;  4GLX A;  1ILP A;  1WI5 A;  3O13 A;  3U9S A;  4ZKB B;  4IPG A;  3S1M H;  2QCP X;  1GO3 E;  1A0I A;  2Z9H A;  3EN2 A;  2ATW A;  2VUM H;  3VR6 A;  2CKZ B;  4KHV A;  1I4G A;  1KAW A;  2IX0 A;  4UP7 A;  3UDI A;  5DM6 3;  1X56 A;  4A3D H;  1A3U A;  1NUC A;  4LF7 L;  2RA4 A;  3GTM B;  2J4X A;  2F03 A;  4O1N A;  1OXT A;  1W6J A;  3S1N H;  4IFD H;  3KLW A;  4Z9C B;  4R8I A;  4Y7N B;  1T5X D;  2E2H H;  1DJR D;  4ZCK A;  4RWS C;  1KLU D;  3M9B A;  4R4Q A;  2B2Y C;  3GTL B;  4JBW A;  1PTO B;  1IYU A;  2B8F A;  1H9M A;  1QOH A;  1YNJ D;  4OIJ A;  2JA7 B;  3GTK H;  3UE0 A;  1Q1E A;  2EPB A;  3UDF A;  3VA5 A;  1N32 L;  1L0X B;  2K01 A;  1WTQ A;  4GNX B;  3ULP A;  3HOU H;  4GN4 B;  3TZD A;  1XWE A;  4L8J A;  3BDC A;  4OWW B;  1P16 A;  1B8A A;  1TWH H;  3D4W A;  4FF3 A;  3J80 c;  1EIG A;  2F3V A;  2JA9 A;  1SBB B;  4DV0 L;  2EJF C;  4IPC A;  3V96 A;  1Q82 C;  4F8M A;  5DLQ E;  1P8L A;  4KKU A;  1WJJ A;  4EGV A;  4XTC S;  3RZO H;  4YIJ A;  5EPL A;  3RZD B;  4H02 A;  4A3B B;  2BE5 D;  4FDB A;  3E5S A;  1A63 A;  1AZP A;  1BCP F;  3OMG A;  3ZYY X;  1JJC B;  3T1H L;  2F0M A;  1CA5 A;  4C3H G;  1EYG A;  2NVT H;  1H9S B;  3CHB D;  1JJ2 A;  2K5H A;  4AYB B;  5D65 A;  1JWS D;  4LFB L;  5FOB B;  1XMO L;  3AYH B;  1MGS A;  1WTV A;  2K6A A;  3I4O A;  4PG3 A;  4CBV A;  3OW2 A;  1NBW A;  5C44 G;  2OQK A;  3GO5 A;  1PH2 A;  2PQA A;  2K52 A;  1NY4 A;  2EQS A;  2HCC A;  4FF1 A;  1SE4 A;  4H7B A;  4JI5 L;  4XQQ A;  2VQF L;  2I5L X;  3QB3 A;  1YNN D;  5ELB A;  1O7I A;  1HJP A;  3NSW A;  2AHO B;  2G9H D;  4K2K A;  3J7A F;  5J22 A;  3MWY W;  1UE7 A;  3HOW H;  1VS0 A;  1VQP A;  1YBY A;  3S1Q B;  1PTO C;  5KYL A;  4LNQ A;  3HOV B;  1R9T H;  1CFM A;  5KIX A;  1GJX A;  3OMC A;  4P74 A;  2EYL A;  2VB2 X;  4N9P A;  4LWC A;  5M3F H;  4BBR H;  1X55 A;  2XSC A;  3ND9 A;  5D3I B;  2EZV A;  3H3V C;  2QDL A;  4GNX C;  2MNA A;  4QGU A;  3S14 B;  2PW7 A;  4Q5V A;  3SXH A;  3C3L A;  4HSP A;  1D1K A;  2RQX A;  1A2T A;  1C7Y A;  1EY6 A;  3I4M H;  3OTO L;  3D6W A;  3STB D;  2L12 A;  4A3F G;  1TWC B;  1X54 A;  2LKV A;  1MJE A;  3TME A;  2A6E D;  1MD2 D;  3D31 A;  4RGT A;  1I94 Q;  3AB9 A;  4RA8 A;  2A69 D;  1KQS A;  4A3L G;  1LO5 D;  3UE1 A;  1Y8P B;  2NBF A;  4RH6 A;  4JYA L;  5C3E B;  4DU9 A;  4GKK Q;  1ET9 A;  2EIF A;  1TR5 A;  1BO0 A;  1LLR D;  1OXU A;  4WJ3 M;  4RFB A;  5I9P A;  3BG3 A;  3LX0 A;  3A56 A;  4DAY B;  1XNQ Q;  2FIN B;  3CCM A;  2NN6 G;  3CKI B;  2EYF A;  4IUU A;  5BN5 A;  4X65 Q;  4RGM A;  4DNI A;  3KF6 B;  2RSN A;  5LMN W;  3QOJ A;  3SK8 A;  2KCT A;  1L0Y B;  2MQH A;  4K6L A;  5FJ8 G;  2CW0 C;  4HJ9 A;  4R4C A;  1EY0 A;  4A3K G;  3GTG B;  4KHP Q;  1EWH A;  1KRT A;  3PUY A;  1WCM H;  2EXZ A;  3K5L A;  4MTK A;  3VR3 A;  1YIJ A;  4NXN Q;  3CME A;  5C4X B;  1TT2 A;  4DKA C;  2IT1 A;  1QE6 A;  1LUZ A;  3SK5 A;  3RLN A;  2F0P A;  5JJK A;  4HJ8 A;  2JA8 H;  4IPD A;  1YHA A;  2X6L A;  4R8N A;  1JB7 A;  2XTI A;  5BN4 A;  3T1Y L;  4HSV A;  4O0A A;  2AUK A;  2F0F A;  1R4P B;  4A3I H;  4A3E H;  4C2M H;  5M9O A;  2K50 A;  5LL6 X;  4IUP A;  3U9O A;  4B3R Q;  3BYY B;  3HFZ B;  3SEB A;  5IGD A;  1IBK Q;  4BBS H;  1N33 L;  2VS1 A;  4JI4 Q;  1HUN A;  1VQE A;  2BDO A;  5IT9 L;  3MHB A;  5CV7 A;  1B44 D;  3H09 A;  1QZG A;  1I6H B;  3CC7 A;  2K03 A;  4BY7 G;  5AFW A;  3K7U C;  4CDC C;  5FO9 B;  1BKB A;  3CPF A;  3ULL A;  2F4V Q;  3I4N H;  1XTD A;  3KF6 A;  1PA6 A;  2IX3 A;  4DUZ L;  3SHL A;  5EBC A;  1HA6 A;  2AQ3 B;  2SDF A;  1EWI A;  1EOV A;  3T53 B;  1F2Y A;  2E5L Q;  4JI1 L;  3IL8 A;  3FPU B;  4B3T L;  4LF4 Q;  4NKL A;  1Y1W H;  1SRU A;  3S24 A;  1J5E L;  4Q0F A;  4DR6 L;  1IYV A;  2PCF B;  1QUQ A;  1PFS A;  4YCU A;  1EQV A;  1HZA A;  1IBL L;  1QG7 A;  2D9U A;  2UUB L;  2L5T A;  5ISR A;  3BDO A;  3E9I A;  5C6A A;  1SYF A;  2R6G A;  5IYC H;  3W5O A;  3CCS A;  5KNB A;  4ID6 A;  2Q8T A;  3FHW A;  3BJU A;  5M3M G;  2K14 A;  3NBH B;  4ZYS A;  3CCL A;  3MEH A;  3K59 A;  4DV4 L;  3CW2 C;  1KHI A;  5BR8 Q;  4OON A;  4L5Q A;  1J6Q A;  2K33 A;  3HGB A;  2UXC L;  4FYD A;  4RGN A;  3PO2 B;  4E6I A;  3I56 A;  2BDN A;  4KKT A;  3GTM H;  4JI7 L;  3OWF A;  4EQO A;  2EYJ A;  2B63 G;  2RSO A;  1D5Z C;  2QA4 A;  4OHJ A;  2GVB A;  3M7N A;  4A76 A;  3GD7 A;  4HIK A;  1LTI D;  3A5Z B;  3M4Y A;  4LF7 Q;  2DY7 A;  3M7G A;  4A3M G;  1TWG B;  1BCP D;  2ZJP A;  2JA7 H;  2TSS A;  1WTX A;  1BVS A;  1BBU A;  2JQO A;  3A74 A;  1HR0 W;  4G7O C;  3PIO A;  5DM7 3;  1ENF A;  1Q90 A;  2WP8 J;  4QCL A;  3H3V H;  5IY0 A;  5JVH 3;  3QWN A;  2IW3 A;  3CAM A;  4JV5 L;  3K5O A;  2HIX A;  2K75 A;  4H44 C;  1B9M A;  3H0G H;  4HMJ A;  1N32 Q;  5M5W B;  1XXG A;  2HT1 A;  5E3F A;  5LMN L;  1G8Z D;  2B2U A;  3K6O A;  1VQ5 A;  1E22 A;  4ZLT F;  4DR1 L;  1F9S A;  3DUZ A;  2KUM A;  2PNR C;  4J6H A;  1PZI D;  3P1H A;  1EY5 A;  4QY7 A;  1Y1V H;  3F2U A;  4LF9 L;  3NBH A;  2F0W A;  4KY7 A;  4RGO S;  3KF8 B;  2R7Z H;  5FK9 C;  4DUY L;  1NTG A;  2CWP A;  1B7Y B;  1DOM A;  1GUS A;  3QJY A;  1KAB A;  1F2M A;  4YCV A;  3KLS A;  3CRK C;  5E1F A;  4X3U A;  2ZTD A;  1Q3L A;  2EJG C;  1XYI A;  4OO1 I;  2JA6 H;  1HFN A;  4JK1 C;  4KJO A;  5IT9 c;  1CQF A;  4A3G H;  4RCN A;  3NP8 A;  4DV5 L;  2B2W A;  4RKL A;  5CBA E;  3J81 L;  2AMC B;  3CCR A;  4DV1 L;  3T1H Q;  1N36 L;  2B2T A;  3HOV G;  1TWA H;  1TKW B;  3K80 C;  4BXX G;  1TWF B;  3HOY H;  1IKL A;  4F7X A;  3HOX H;  1DYQ A;  3I2Z A;  1SYG A;  2EYM A;  4N8F A;  2OT2 A;  4LFB Q;  2L1B A;  1FVI A;  1XMO Q;  4KLK A;  1UE5 A;  1IYJ B;  3UDG A;  4BY1 H;  2Z1C A;  4C56 C;  1STE A;  3G71 A;  4J8Q A;  3NEM A;  4ME5 A;  2PMZ E;  4K14 A;  3RLO A;  2Q8R E;  3TRE A;  4A3J H;  1B2T A;  5C44 B;  1GOZ A;  4QIW B;  1Q8I A;  2VQF Q;  4YWK A;  4J15 A;  2PZU A;  3I73 A;  2AWN A;  1B3Q A;  1Q81 C;  2KJX A;  1CSQ A;  2RKS A;  3K58 A;  3J7Y W;  2QF7 A;  1FGU A;  5JJZ A;  2EJM A;  1PRT F;  1EU4 A;  2XWB B;  3I8Z A;  1ZXT A;  2UU9 L;  3J81 i;  5NUC A;  3PMF A;  5C3E G;  3U4Z A;  2JK8 A;  2JEA I;  1H95 A;  4UPA A;  1W3S A;  3KF8 A;  3P7J A;  1N34 L;  4GOP B;  2HD3 A;  1F9P A;  1YVC A;  3J7Z C;  4HMI A;  2KHI A;  1O80 A;  3TEH B;  2F0I A;  3Q6S A;  3C1F A;  4LJZ C;  3OTO Q;  1QVF A;  2L15 A;  2OQ0 A;  3FEW X;  3TP6 A;  2VW9 A;  2G5D A;  1CK1 A;  1ESF A;  4LAA A;  4A3F B;  3HOZ G;  1TY0 A;  2IWH A;  3AFP A;  4ZUI A;  4JYA Q;  2KQ3 A;  3CD6 A;  1VQ4 A;  5JEA G;  2R93 H;  1IBM L;  5CR3 A;  5FLM G;  1PRT B;  1RTN A;  4FF2 A;  1JR0 D;  4K2L A;  4OL7 A;  2BH8 A;  1S40 A;  2F0K A;  4KN7 C;  2E75 C;  2G9D A;  1G6P A;  2R61 A;  1K83 B;  1WVL A;  1XTC D;  1I50 B;  3BDL A;  4UP9 A;  2H5X A;  3KJP A;  3TN2 A;  4KV6 A;  1J8I A;  3J80 E;  4IFD J;  4P75 A;  1HR0 L;  1SNO A;  1UAP A;  1VMP A;  3W1B A;  4JOI A;  3M4O B;  2WKC A;  4NDX A;  3GTJ H;  1O7Z A;  1GUW A;  4ZUJ A;  2R7D A;  2Y0S B;  4K0K L;  2WAQ B;  3NEL A;  2A8V A;  2JYO A;  4B3M L;  4O42 A;  4GOP A;  4L5R C;  3SVM A;  2LXJ A;  3VR4 A;  4DFA A;  4GN3 B;  2DY8 A;  3HP3 A;  3T1Y Q;  1LAB A;  3JAM L;  1E2Z A;  3IAY A;  1KLG D;  2QDB A;  5I6Y A;  2CWA A;  1AH9 A;  1YI2 A;  1I3Q H;  1KNA A;  1CZW A;  2Z4I A;  1RCV D;  3QIA A;  5C0X H;  3FPP A;  3S16 H;  1RHP A;  1N33 Q;  3J81 c;  4DGZ A;  4KD4 A;  2LY7 A;  2ICE C;  2RCF A;  1NR2 A;  2N88 A;  2FFK B;  2R92 H;  1VQG A;  1H9J A;  1ICF B;  3D8G A;  1K9M C;  1JQY D;  2ZM6 L;  3BZK A;  1II3 A;  1LT4 D;  2VZA A;  3MZ5 A;  4YWL A;  1WOC A;  5CV9 A;  1L1O A;  2Q8I B;  3OIP A;  4BY7 B;  2I5M X;  3M3Y H;  2E2D C;  3JAM i;  3AEV A;  2YU9 B;  2BE5 C;  4DUZ Q;  3L2P A;  1NAP A;  3G4S A;  1QIL A;  1U4L A;  4C3I H;  2DNE A;  4K5X A;  4WJW A;  3F2B A;  1ESR A;  5C3W A;  4HJ5 A;  1DGS A;  1PH5 A;  1Y14 B;  4DAM A;  3PO2 G;  2EY5 A;  4JI1 Q;  3FMC A;  4B3T Q;  4GLA C;  1J5E Q;  4DR6 Q;  3A0J A;  1E0B A;  3ITP A;  1SMX A;  1UUP A;  4APV A;  2UXB L;  1JE5 A;  1U4M A;  2M2L A;  2NN6 I;  1VQO A;  1Y69 U;  1IBL Q;  3VYU A;  2J0T D;  2UUB Q;  1IHZ A;  4YWM A;  1K3R A;  3S17 H;  4KD3 A;  5ELF A;  4OX9 L;  1YNN C;  1SSO A;  2FJ2 A;  1EEI D;  2QEX A;  3S15 H;  4IFD G;  5M3M B;  4DV4 Q;  1PH6 A;  1VQD A;  3PF5 A;  2UXC Q;  1AZQ A;  2M00 A;  2CH4 W;  4HCE A;  5IGG A;  1B53 A;  2AUJ D;  2CFM A;  2PI2 E;  2JA5 B;  1K3B C;  1MSG A;  1Q12 A;  3MC0 B;  1S3O A;  2PQA B;  4MIU A;  3FP9 A;  5JOB A;  2WAC A;  1XNR L;  5EBD A;  2NVX H;  4XIG S;  1N9W A;  2B63 B;  4IUQ A;  5IP9 G;  2NTS A;  2B39 A;  2L11 A;  3KDF A;  3K7A H;  3SK6 A;  4CJ0 B;  1SJH D;  5A35 A;  4DV6 L;  3STB C;  3HG9 A;  5IE8 A;  4A3M B;  1EEF D;  4ILW A;  3FKI H;  3GV6 A;  2F0D A;  4ZRZ A;  4JI8 L;  1TS5 A;  3A55 A;  3OIQ A;  4FO2 A;  2A69 C;  1LTL A;  1E1O A;  5CV8 A;  3VYR A;  4CJ1 B;  1ZEQ X;  4DR7 L;  2L4N A;  3CMA A;  1BR9 A;  4JV5 Q;  2FHT A;  3PUW A;  3QG1 A;  1K8M A;  3MXU A;  1PV4 A;  3T56 B;  5JPN C;  2ALY B; 
#chains in the Genus database with same CATH homology
 4DV7 L;  3T1Y L;  4X62 L;  1OXX K;  4O0A A;  5LMN Q;  1I5F A;  4A3I H;  1XPO A;  1V9P A;  2JA6 G;  4X62 Q;  3NEN A;  1QVC A;  4C2M H;  4A3E H;  4JOI C;  3CC2 A;  2K50 A;  3JC6 6;  4R4I A;  4DR1 Q;  4AYB G;  4BA2 I;  4B3R Q;  2Q2H A;  3JAM c;  4QL5 A;  5GAD C;  1WFQ A;  2LSS A;  2Z0S A;  3HFZ B;  2HHH L;  3CQZ H;  3GTQ H;  4LF9 Q;  1IBK Q;  3CC4 A;  4BBS H;  1N33 L;  2VS1 A;  3HOY G;  5C0X G;  4JG2 A;  3CCU A;  2A1A A;  4GOP C;  1VQ9 A;  4DUY Q;  4JI4 Q;  1I6H H;  1VQE A;  4AYB E;  5ELO A;  4DV3 Q;  4HIO A;  2UUA L;  5GAH C;  1G29 1;  1GVP A;  2HIV A;  4BY1 G;  2RHS B;  1QZG A;  1K8A C;  4DK3 C;  3CC7 A;  1VQF A;  4BY7 G;  4OWT B;  3ULJ A;  1NMG A;  1L0W A;  3B6Y A;  1Z9F A;  1V1Q A;  2NVY H;  3W1G A;  3K7U C;  1VQM A;  1BKB A;  1VQA A;  3CPF A;  3ULL A;  4C3J H;  3KDF B;  4C3H H;  4DV5 Q;  2F4V Q;  3I4N H;  1C9O A;  2D62 A;  1PH4 A;  1XTD A;  3KF6 A;  4DV1 Q;  1PA6 A;  4DUZ L;  1N36 Q;  2N3S A;  3HOW G;  1VQL A;  5IWA L;  3CCE A;  4MTN A;  2VY3 A;  1L2F A;  1UEB A;  4HJ7 A;  2NZH A;  1EWI A;  1EOV A;  5HY6 A;  3F2D A;  3CPW A;  3M4P A;  2E5L Q;  1HNW L;  4JI1 L;  5C44 H;  4LF4 Q;  4B3T L;  1Y1W H;  5C0X J;  1SRU A;  3S24 A;  1J5E L;  1PH3 A;  2C35 B;  2KCM A;  4DR6 L;  1SLJ A;  1ASY A;  4POF A;  1L1O C;  4YY3 L;  1VQ8 A;  1CKM A;  4A3C H;  1QUQ A;  1OXS C;  1PFS A;  4YCU A;  2VUM G;  3F1Z A;  1HZA A;  1IBL L;  1OTC A;  1SFO H;  3U58 A;  2UUB L;  2N8N A;  3E9I A;  3I4M G;  1UWV A;  4POG A;  1KXL A;  4DR4 L;  1XMQ Q;  4EQ5 A;  4OXP A;  2R6G A;  5IYC H;  2K5V A;  1VQI A;  4RMF A;  3W5O A;  3CCS A;  4A3D G;  3RNU A;  3FHW A;  4IJH A;  2UUC L;  3BJU A;  5M3M G;  2Q2T A;  5GAG C;  2YV5 A;  1YHQ A;  2K14 A;  3DLL A;  3KFU A;  1M90 C;  2WB1 G;  3NBH B;  5ELN A;  3PO2 H;  2LXK A;  3CCL A;  1A62 A;  4DV4 L;  3CW2 C;  1AE2 A;  1KHI A;  5BR8 Q;  4OON A;  1HZ9 A;  1W2B A;  4L5Q A;  4ME3 A;  1J6Q A;  2UXC L;  4Y52 H;  4GS3 A;  3G6E A;  2NVQ H;  5IP7 G;  4JBM A;  2ID0 A;  1YNX A;  3I7F A;  1N34 Q;  5JJI A;  1CUK A;  2E2I H;  1VQK A;  1E7Z A;  1NE3 A;  3I56 A;  1MJC A;  2WB1 E;  3ICE A;  2R93 G;  3GTM H;  2HQL A;  3L0O A;  1EFW A;  1AE3 A;  1HH2 P;  3H15 A;  4JI7 L;  4OWX B;  2B63 G;  1YIT A;  1TWG H;  4A3F H;  4JI7 Q;  5E7N A;  1XNQ L;  2QA4 A;  4LFC Q;  2GVB A;  3M7N A;  4A76 A;  3GD7 A;  1VQC A;  4X65 L;  4HIK A;  3A5Z B;  3S2H H;  4HJA A;  4LF6 L;  4LF7 Q;  4A3M G;  4PZ7 A;  1KD1 C;  2GVA A;  3CCJ A;  2CQO A;  4A3L H;  2Q2I A;  4DR2 L;  2F52 A;  2ZJP A;  3HOZ H;  4IPH A;  2JA7 H;  3HOU G;  3ERS X;  4KHP L;  4X66 L;  1BVS A;  1KIX A;  2UXD Q;  1BBU A;  2JQO A;  5HGQ A;  5K36 G;  1VQB A;  3A74 A;  3ZJY C;  4YHH L;  1NJI C;  1HR0 W;  3FKI G;  1CKO A;  5C4X G;  2D0P A;  4NXN L;  3PIO A;  3MEF A;  2OTJ A;  2B3G A;  5FLM H;  2WP8 J;  4LUZ A;  5AJ3 L;  2Y0S G;  1SN8 A;  2WAQ G;  5IY0 A;  4JI6 Q;  3H3V H;  5M5W H;  3CAM A;  4JV5 L;  4BA1 I;  4R1J A;  3CP0 A;  1D7Q A;  2K5N A;  3SGI A;  2HIX A;  2CCZ A;  4JBJ A;  1IL2 A;  1QUQ B;  2K75 A;  1K8G A;  3H0G H;  5IP9 H;  2E8G A;  3RLF A;  1N32 Q;  1PVO A;  1XPU A;  2DGY A;  1VCI A;  1VQH A;  5FJ8 H;  3PO3 H;  2HT1 A;  1TXY A;  5LMN L;  1HZC A;  4A3K H;  3S1R H;  3M4O H;  2OCE A;  2Z6K C;  2ZTC A;  1VQ5 A;  2RCN A;  2ZTE A;  1Q46 A;  3PUV A;  5C4J H;  1E22 A;  1EQR A;  4DR1 L;  2ASB A;  4B3R L;  1V43 A;  4IJL A;  4X64 Q;  1HR0 Q;  4QY7 A;  1Y1V H;  1YZ6 A;  2MO0 A;  4IO9 A;  4K0K L;  4GLV B;  5GRO A;  4LF9 L;  3BU2 A;  1IBK L;  3TS2 A;  3KF8 B;  2R7Z H;  4BBS G;  4A93 H;  4DUY L;  1NTG A;  2CWP A;  3D0F A;  1KRS A;  4JI4 L;  1B7Y B;  1VQ7 A;  4DV2 Q;  4K0K Q;  2WFW A;  2ALY B;  4YCV A;  4MNO A;  4DV3 L;  4B3M Q;  3AQQ A;  1Q86 C;  3S2D H;  1C0A A;  2ZTD A;  2R92 G;  4QQB X;  4NPS A;  3HKS A;  4TQU S;  4OO1 I;  2JA6 H;  1D8L A;  3K0X A;  3GTO H;  4X6A H;  1EUJ A;  2RF4 A;  1TWF H;  2FXQ A;  1YEZ A;  5IT9 c;  4DR5 Q;  1YJW A;  4A3G H;  1LYL A;  4O2D A;  2IX1 A;  5GAE C;  4DV5 L;  2F4V L;  2E2J H;  2VNU D;  3E9H A;  3RR5 A;  3CCR A;  1XPR A;  4LF8 Q;  2AMC B;  4DV1 L;  3T1H Q;  3I4N G;  1N36 L;  3HOV G;  3J80 i;  1E1T A;  1TWA H;  1X65 A;  3K80 C;  4BXX G;  3HOY H;  2N78 A;  3HOX H;  3I2Z A;  3GTP H;  4HIM A;  1NMF A;  2KHJ A;  1OXV A;  1EIF A;  4LFB Q;  1RIP A;  1FVI A;  2E5L L;  2AWO A;  2WAQ E;  1XMO Q;  2AKW B;  1HZB A;  4GN5 A;  4NB3 A;  4KLK A;  1UE5 A;  3HKZ E;  1IYJ B;  3UDG A;  4LF4 L;  3KOJ A;  4BY1 H;  1VQ6 A;  3K8A A;  1SR3 A;  4A4I A;  2MFI A;  5IYB G;  5M3F G;  1IZ6 A;  4YCW A;  2ZM6 Q;  1SRO A;  4BBR G;  4AH6 A;  3G71 A;  3NEM A;  5JJL A;  3U50 C;  2PMZ E;  4MZ9 A;  4L5T A;  3MXN B;  3RLO A;  4A3J H;  3TRE A;  1SE8 A;  3A5U A;  4A3C G;  4OO1 G;  2MO1 A;  2VQF Q;  1K0R A;  2BH2 A;  4YWK A;  3F8T A;  3RN2 A;  4J15 A;  3K81 C;  1U5K A;  5M5Y H;  2AWN A;  4GNX A;  2JJQ A;  1Q81 C;  1E24 A;  1CSQ A;  4QJF A;  1XMQ L;  4GKJ Q;  4LW1 A;  4JI0 Q;  1FGU A;  5LMU Q;  1JMC A;  1PH1 A;  2UU9 L;  3U4V A;  3J81 i;  1JT8 A;  1CSP A;  1HNX Q;  5C3E G;  2UU9 Q;  4LF5 Q;  4PMW A;  5BR8 L;  3U4Z A;  3CF5 A;  4DR3 Q;  4GLX A;  2JK8 A;  3M4Q A;  1T9H A;  2JEA I;  1H95 A;  4UPA A;  1W3S A;  1WI5 A;  3PV0 A;  1X9N A;  2EXD A;  2JA5 G;  3H3V I;  4IPG A;  3S1M H;  1PYB A;  1N34 L;  4GOP B;  1GO3 E;  1A0I A;  3DM3 A;  1YVC A;  3EN2 A;  3Q8D A;  3J7Z C;  4P73 A;  2ATW A;  2VUM H;  2CKZ B;  2KBN A;  2KHI A;  1KAW A;  1PH8 A;  2IX0 A;  4UP7 A;  2VQE Q;  4R4O A;  3TEH B;  1JJG A;  3UDI A;  1VQJ A;  5M5X H;  1HNZ Q;  4IOC A;  1QZH A;  3UDX A;  3OTO Q;  4LFC L;  1FJG Q;  1QVF A;  2L15 A;  4NXM Q;  1X56 A;  4Y7N H;  4A3D H;  1Q8K A;  1GM5 A;  2OQ0 A;  4LF7 L;  4OX9 Q;  2QGQ A;  2ZJQ A;  3VDY A;  1OXT A;  2VW9 A;  3S1N H;  4JI3 Q;  3KLW A;  3HOZ G;  1N8R C;  3GTL H;  2E2H H;  1YJ9 A;  2UXD L;  4TVA B;  1MKH A;  4LFA Q;  5IP7 H;  3AFP A;  3M9B A;  4JYA Q;  1WCM G;  2PNH A;  4R4Q A;  2N49 A;  3CD6 A;  1VQ4 A;  4JBW A;  5JEA G;  2R93 H;  1IBM L;  5FLM G;  4JI6 L;  1XJV A;  5J3B A;  1IBM Q;  3GTK H;  2OWO A;  2OTL A;  1K83 H;  3UE0 A;  4WJ4 A;  1Q1E A;  1I50 H;  5H1S E;  2BH8 A;  3E0E A;  2A19 A;  3UDF A;  3KJO A;  1S40 A;  4R4T A;  1S72 A;  2IHF A;  1YHB A;  1G51 A;  3AFQ A;  3WWV A;  1N32 L;  3H0G G;  1G6P A;  1UE1 A;  4GNX B;  3ULP A;  1EIY B;  2JA8 G;  3HOU H;  4JCV E;  4GN4 B;  4B3S Q;  4UP9 A;  2H5X A;  3KJP A;  4JBK A;  4OWW B;  4P72 A;  4DV6 Q;  1P16 A;  1B8A A;  4A3I G;  4IFD J;  4X64 L;  4P75 A;  1TWH H;  4A3E G;  1HR0 L;  3J80 c;  4JI8 Q;  3W1B A;  4AQY Q;  1Y1V G;  3TRZ A;  2NZO A;  5IYD H;  4JOI A;  2YTX A;  2JA9 A;  1BBW A;  2KEN A;  3GTJ H;  2R7Z G;  4DR7 Q;  1LM0 A;  2IHE A;  3TS0 A;  2R7D A;  5JEA J;  4DV0 L;  5GQO A;  4DV2 L;  4DK6 C;  3NEL A;  4IPC A;  4JI2 Q;  3RZD H;  1Q82 C;  2A8V A;  4A3B H;  5DLQ E;  1P8L A;  4DV0 Q;  4B3M L;  4KHZ A;  4GOP A;  1WJJ A;  4L5R C;  2LXJ A;  1WYD A;  4XTC S;  3RZO H;  4GN3 B;  3PUX A;  2GN5 A;  4DV7 Q;  3T1Y Q;  2D0O A;  4H02 A;  2XGT A;  4DR5 L;  4FDB A;  3PCO B;  4A3G G;  3L7Z C;  1KL9 A;  1A63 A;  1UE6 A;  3PUZ A;  4LF8 L;  1JJC B;  2CWA A;  3HKZ G;  3T1H L;  1YI2 A;  1AH9 A;  1I3Q H;  2BA0 A;  1EYG A;  2Q2U A;  3OYY A;  2HHH Q;  2NVT H;  4PZ6 A;  2K5H A;  3HOX G;  1JJ2 A;  2JEB I;  4KI0 A;  3S16 H;  1E3P A;  1N33 Q;  4LFB L;  3J81 c;  1QVG A;  2PI2 A;  1XMO L;  3AYH B;  1PH9 A;  3I4O A;  3IRB A;  4PG3 A;  3PSI A;  2R92 H;  1VQG A;  3OW2 A;  1NBW A;  2V1C C;  5C44 G;  2I5H A;  2UUA Q;  1K9M C;  2OQK A;  2F3I A;  3GO5 A;  2ZM6 L;  1Y1W G;  1PH2 A;  3BZK A;  2PQA A;  2K52 A;  4BY7 H;  1NY4 A;  2EQS A;  3PGZ A;  2VZA A;  4IOA A;  4YWL A;  4DPG A;  4ALP A;  2YU9 H;  4JI5 L;  1WOC A;  2VQF L;  2I5L X;  4A75 A;  4A3J G;  4LUO A;  1O7I A;  3S1Q H;  1HJP A;  2B29 A;  4JI5 Q;  1L1O A;  3HOV H;  2AHO B;  1YJN A;  2I5M X;  4BXX H;  4GKJ L;  4QIW E;  3M3Y H;  3JAM i;  1K73 C;  4JI0 L;  3AEV A;  1UE7 A;  3HOW H;  1VS0 A;  3L2P A;  3G4S A;  4DUZ Q;  5LMU L;  1YBY A;  1VQP A;  4C3I H;  3CCQ A;  5IWA Q;  3PO2 G;  4IFD I;  5IYC G;  3F2B A;  4LNQ A;  1R9T H;  3PIP A;  1X6O A;  4HJ5 A;  1EQQ A;  1HNX L;  1CKN A;  1DGS A;  4LF5 L;  4DR3 L;  1PH5 A;  1FL0 A;  1Y14 B;  4P74 A;  4LUV A;  4JI1 Q;  4DAM A;  5IYB H;  5M3F H;  4B3T Q;  4LWC A;  3S14 H;  3I4M H;  4BBR H;  1X55 A;  2RHQ B;  4AIM A;  4GLA C;  1J5E Q;  3J81 j;  1Q7Y C;  3J7A 5;  4DR6 Q;  1MIU A;  4GNX C;  3A0J A;  4YY3 Q;  1SMX A;  2MNA A;  4APV A;  4QGU A;  2VQE L;  2UXB L;  1JE5 A;  1TWC H;  2NN6 I;  2YTY A;  2DUD A;  1VQO A;  1IBL Q;  2UXB Q;  1C7Y A;  1HNZ L;  3G48 A;  1ASZ A;  3OTO L;  2UUB Q;  4UY8 C;  3BZC A;  3CCV A;  2JE6 I;  1K3R A;  4YWM A;  5EAY A;  4NXM L;  1FJG L;  3RN5 A;  3STB D;  1Z47 A;  1RL2 A;  1VQN A;  4A3F G;  3S17 H;  4DR4 Q;  4P71 A;  4OX9 L;  1X54 A;  1MJE A;  5M3M H;  1I94 L;  2UUC Q;  3D31 A;  4JI3 L;  5C3E H;  2QEX A;  1I94 Q;  3EIV A;  3S15 H;  4IFD G;  1KQS A;  4A3L G;  3UE1 A;  4LFA L;  1PYS B;  2YTV A;  2JA7 G;  4DV4 Q;  2JA5 H;  1PH6 A;  4GKK L;  1PHJ A;  4JYA L;  1VQD A;  3PF5 A;  2UXC Q;  2VL6 A;  3PF4 A;  4GKK Q;  2I0Q A;  2EIF A;  3F2C A;  1OXU A;  2CFM A;  4WJ3 M;  2PI2 E;  2YYZ A;  1PH7 A;  3LGJ A;  1Q12 A;  2ES2 A;  2B63 H;  1S3O A;  2K4K A;  2PQA B;  4RG1 A;  3FP9 A;  2IY5 B;  1GKH A;  4DAY B;  3GDE A;  5FLX c;  1XNQ Q;  3CCM A;  2NN6 G;  1XNR L;  3M85 A;  2NVX H;  4JC0 A;  4XIG S;  3GTG H;  3TQY A;  4X65 Q;  4A3M H;  1XNR Q;  1N9W A;  1L1O B;  4LF6 Q;  4DNI A;  3KF6 B;  5IP9 G;  4B3S L;  3KDF A;  3K7A H;  3KYH C;  5LMN W;  4DR2 Q;  2KCT A;  5FJ8 G;  2MQH A;  1U0L A;  4HID A;  3PO3 G;  4DV6 L;  3STB C;  1GD7 A;  4PZ8 A;  1IXR A;  4R4C A;  4HJ9 A;  4A3K G;  1X3E A;  5IE8 A;  4X66 Q;  1KRT A;  3ER0 A;  3PUY A;  1WCM H;  4KHP Q;  1M1K C;  5C4X H;  3FKI H;  2Z6K A;  1B70 B;  4L5S A;  4JI8 L;  4YHH Q;  4AQY L;  1CKN B;  1YIJ A;  4UP8 A;  4NXN Q;  5C0X I;  5IYD G;  3CME A;  1JB7 A;  1LTL A;  1E1O A;  2ZJR A;  1A8V A;  5AJ3 Q;  1Q1B A;  4DR7 L;  3CMA A;  4DKA C;  2BA1 A;  2IT1 A;  1LUZ A;  4JI2 L;  4EX5 A;  4JV5 Q;  4A93 G;  1HNW Q;  3PUW A;  3RLN A;  5JJK A;  3EBE A;  4A3B G;  1X3G A;  4HJ8 A;  3CXC A;  3I55 A;  2JA8 H;  1PV4 A;  4IPD A;  1YHA A;  2Y0S E;  1X3F A;  2R7F A;  1KC8 C;  2XTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...