1E7ZA

Crystal structure of the emap2/rna binding domain of the p43 protein from human aminoacyl-trna synthetase complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
173
Chain Sequence
AKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIKLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding domain
molecule keywords ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II
publication title Structure of the Emapii Domain of Human Aminoacyl-tRNA Synthetase Complex Reveals Evolutionary Dimeric Mimicry
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1e7zA00
4NXNQ 2UU9L 3NENA 2BA1A 2ZM6Q 1HR0W 1FJGL 1G51A 2N78A 4NB3A 1SFOH 4YCVA 4DR3Q 1OXTA 1SE8A 3EN2A 4HJ5A 4DV2Q 3PCOB 4GN4B 2D62A 3L7ZC 2OWOA 2JA6G 2NVTH 1JJ2A 4DV4Q 2JJQA 2AWOA 4AQYL 1KAWA 1KRSA 1MIUA 3RZDH 4LF6L 1U0LA 5HGQA 4HIMA 1GM5A 1UWVA 4IPCA 1C7YA 4FDBA 4JBJA 1I94L 1IYJB 4Y7NH 1VQ9A 3AFQA 5JJIA 1G291 1VQHA 5IYBG 3UDGA 4A3KH 4X66Q 4DV0Q 2F3IA 4LF9L 3CQZH 2C35B 4QY7A 4APVA 4A76A 2H5XA 1AE3A 2K75A 3KJPA 2R92H 5C0XI 2HHHL 4QGUA 1OXXK 4DV7Q 3HOWH 2LXKA 3S17H 4YWKA 4JI4L 4LF8Q 2VNUD 1QUQA 2I5LX 4DPGA 1GO3E 3AYHB 4UPAA 1N34Q 3S1QH 3CXCA 5BR8Q 1N32L 1HZCA 3ER0A 2B63H 3GTMH 2B29A 3K7AH 1Q1EA 3CW2C 1Z9FA 1BBUA 3PO2G 4A3MG 4X6AH 2E5LL 2UU9Q 1YJ9A 4GN5A 3ULLA 1VQIA 3MEFA 4DK6C 1FJGQ 3CPFA 1OXVA 2LSSA 1YVCA 2FXQA 3HKSA 1YHQA 1HNXL 3HOVG 3H0GG 1KIXA 1A0IA 1WJJA 4X62L 3J81c 2HT1A 1RL2A 4AQYQ 2RF4A 2ZTEA 5JEAJ 1QVGA 4LF6Q 4JI2L 3M4OH 1B70B 1L2FA 5H1SE 4YHHL 3RN2A 3I4MH 1CKMA 4BBSG 4BXXG 2XTIA 4MNOA 1I94Q 5IY0A 3AFPA 4LW1A 1MJEA 1EFWA 1LUZA 1K0RA 4GLXA 1HNZL 5JJKA 1VQ4A 2ATWA 2R7FA 4LF9Q 3T1YQ 2YTYA 1X3EA 4HIKA 1E1OA 1NJIC 3B6YA 4BY7H 1CSQA 2IY5B 4ALPA 1NMGA 4HJ7A 3TS2A 4JI4Q 2HQLA 3GTKH 1CKNA 2LXJA 1JE5A 1N33Q 2HIVA 1A8VA 2K5NA 1V9PA 1IL2A 2VY3A 3K0XA 1HH2P 4KLKA 5IWAL 1N32Q 4WJ4A 4R4QA 2EQSA 4DK3C 1X9NA 2E2HH 2E5LQ 2R7DA 4DR4L 4DR6L 1XJVA 4A3JG 1L1OA 1FGUA 1YJWA 4PG3A 1K3RA 1M90C 4HIOA 3KF6A 5FLXc 4JCVE 4OO1G 4GN3B 3GTGH 4IFDG 1L1OC 1KHIA 5IYBH 4DV6Q 3S1NH 3K80C 3CF5A 4IOAA 4YHHQ 1ASYA 2YTXA 2WB1G 2PQAB 1TWAH 5FJ8G 3UDIA 2JQOA 3I7FA 4QIWE 3S24A 1KD1C 1HNZQ 2DGYA 1I5FA 2VW9A 3RZOH 4JYAL 1OXUA 2RHSB 2EIFA 2PI2A 5LMUL 4JI6Q 1VQLA 2UXCQ 2V1CC 1WI5A 5M3MG 4EQ5A 1WFQA 4UP7A 1V1QA 3KYHC 3PGZA 4WJ3M 2VQFL 2GVBA 3PO2H 4A3MH 1XMQL 4Y52H 3K8AA 3TEHB 1MKHA 1R9TH 5IWAQ 4DR1L 3PF4A 4BBRG 1BVSA 3HOVH 4ME3A 5J3BA 3H0GH 4IFDI 5IYDH 4LNQA 4DR4Q 4GOPB 3I56A 2NVQH 2Q2IA 1XTDA 5LMNW 2VL6A 4DR6Q 4R4IA 1PA6A 4UP8A 3UDXA 4PZ7A 2JA9A 2UUBL 2GVAA 3S2DH 3ERSX 4BBSH 4BXXH 3L0OA 3CCRA 1BKBA 1VQCA 1E3PA 4A3EH 4RG1A 4P73A 1VQFA 4DV5L 2N3SA 4PZ8A 2D0PA 1VQ5A 5GROA 3OTOQ 3E0EA 1OTCA 3GTJH 4DV3L 2ZJPA 1X3GA 2NVYH 2PI2E 4IPGA 2F4VQ 1K8AC 1S40A 4A3FG 4LUOA 4UP9A 2JK8A 4JYAQ 4J15A 5C4JH 1K73C 3GDEA 3TS0A 1PH4A 3M3YH 4L5QA 3ULPA 1Q46A 3TREA 3GD7A 4C3HH 1XNRL 2N8NA 1LYLA 1YNXA 3BZCA 2CFMA 1PHJA 4GS3A 1C9OA 2YTVA 1E7ZA 2VQFQ 1XPRA 2R6GA 2CWPA 1AE2A 2I5MX 2PMZE 2ALYB 4DR1Q 4A3JH 4LF7L 1VQ6A 3CCEA 3GTPH 2A19A 2R93G 2BA0A 3IRBA 3PUZA 4DUZL 4A3LG 1EQQA 3STBC 1P16A 2Y0SE 2VZAA 3Q8DA 4LFBL 2D0OA 1I6HH 2CKZB 3F1ZA 3PF5A 2JEAI 1H95A 3UE0A 3CCUA 3KDFB 3GTLH 2AHOB 1LM0A 5GAHC 1PH6A 3CP0A 5FJ8H 1HZ9A 4HJ8A 3I55A 2PNHA 1GKHA 3KJOA 3CCJA 1ASZA 2Z6KC 3HFZB 4C3IH 1NBWA 4OWTB 4TVAB 5C44G 1JB7A 3AEVA 3I4OA 1EUJA 4B3ML 3S15H 5IT9c 3W1GA 4DV3Q 3GTQH 5JJLA 2OTLA 5M3MH 1T9HA 4L5TA 1V43A 4HJ9A 4A3BG 1PVOA 3T1HL 1VQGA 3FP9A 1IBKL 1Y14B 2K4KA 4JG2A 1LTLA 3TRZA 2Y0SG 4A3GG 1EOVA 1SN8A 3NEMA 3CMEA 3TQYA 4AH6A 4P71A 4DR2L 4JBMA 1XNRQ 3PO3G 4DR7L 3L2PA 4B3SL 4OWXB 1G6PA 4OXPA 1VCIA 1NE3A 2IT1A 2PQAA 5EAYA 3HOUG 2ZTDA 3MXNB 4JC0A 1VQMA 1K9MC 3JAMi 4LF4L 5M5WH 2JA7G 2Q2UA 4LF7Q 3RLNA 1XPUA 1PYSB 1PYBA 2E2JH 4P74A 1QVFA 1WCMG 3G48A 4PMWA 3F2CA 3PV0A 2WAQE 1SMXA 1VQEA 4LFBQ 3CCLA 4KHPL 2HHHQ 2JEBI 3KLWA 4GKKL 3NBHB 2RHQB 2YYZA 3A5UA 4MTNA 4BY1G 4IFDJ 2WP8J 4A3FH 3FHWA 1X55A 1VQ8A 2OQKA 1SLJA 2WB1E 3BU2A 2AKWB 1VQAA 3OYYA 4B3MQ 3PSIA 4POFA 4A3DG 2VQEL 4IO9A 1J5EL 2JA6H 1UE1A 1BBWA 3T1HQ 2WAQG 1HNWL 1IBKQ 1NMFA 3OW2A 4POGA 4L5SA 5IP9G 3ULJA 1HNXQ 1YZ6A 4DR2Q 1TWGH 4X62Q 1JJGA 1PH5A 4DR7Q 3DLLA 1B7YB 4TQUS 2E8GA 2Q2HA 4JI2Q 3F2DA 1PH9A 1IBML 1VQKA 1O7IA 1YBYA 3CCQA 3CC4A 2R93H 4A4IA 1UE5A 5GAGC 4LF4Q 1YEZA 1NTGA 4A3LH 2NVXH 4GKJL 1FL0A 3H3VH 5C4XG 4LUVA 3ICEA 4AIMA 3G6EA 4DKAC 3VDYA 4EX5A 1XMOL 1CSPA 1TXYA 1UE6A 5E7NA 3HOYG 2UUAL 1VQOA 2L15A 1Y1VG 5C44H 3CC2A 4K0KL 1Q8KA 4R4CA 3U50C 1HR0L 3E9IA 3E9HA 4A3BH 1YITA 2A1AA 3CMAA 4AYBG 4OX9L 2R92G 3S16H 3U58A 5IYCG 3K7UC 4A3GH 4DUYL 4OO1I 2VQEQ 1CKOA 1J5EQ 3PO3H 2KHIA 3S1RH 3HKZG 3M9BA 3KDFA 3UDFA 4YY3L 4NXML 3HOUH 1HNWQ 2I0QA 3RLOA 3J7ZC 1TWCH 2Z0SA 4DR3L 1PH8A 2BH8A 3BJUA 2UXBL 4X64L 2JA7H 3D0FA 1QVCA 4JI5L 1Q1BA 1IBMQ 1S3OA 4L5RC 4PZ6A 1WCMH 1N36L 2NN6G 1X65A 4A3IG 3M85A 1VQ7A 4GKJQ 1TWFH 1JJCB 1Q7YC 1IBLL 5K36G 2AMCB 4LFCL 4DR5L 4YWLA 1CKNB 4GLAC 3CCMA 4IPHA 4R1JA 3J80i 1S72A 1KC8C 3H15A 5LMUQ 4C2MH 4BY1H 4JI1L 2QGQA 2UUAQ 3KFUA 1X3FA 3A5ZB 3S14H 4OWWB 1MJCA 4DAYB 4K0KQ 2CCZA 1EWIA 3DM3A 2ID0A 3NELA 4IJHA 4JBKA 1HR0Q 2BH2A 2KCMA 2IHEA 1EYGA 3UE1A 4A3DH 4JV5L 1XMQQ 5GADC 3KF6B 4GLVB 5GQOA 4OX9Q 1K8GA 3HOXG 4R4OA 5C0XG 1YI2A 4DUYQ 4B3TL 4UY8C 5M3FG 1WOCA 2WFWA 4XTCS 1J6QA 4YY3Q 3JC66 4NXMQ 2NN6I 4LUZA 2UUBQ 4QL5A 4RMFA 5M5YH 5FLMG 2UXBQ 4OONA 2KENA 2NZOA 4X64Q 2Z6KA 3M7NA 2NZHA 3J81j 1VQPA 1TWHH 4JI5Q 5C4XH 4JI7L 2JE6I 4DV5Q 2VUMG 1EIFA 1AH9A 1YHBA 1IZ6A 1N36Q 3JAMc 3G71A 4DV1L 4A3CG 3FKIG 3PUVA 4O2DA 3HOYH 1IBLQ 5AJ3L 2IX1A 3PUYA 4DR5Q 4LFCQ 2CQOA 3M4PA 4H02A 2K5VA 1Y1VH 1SRUA 1PH2A 2XGTA 2E2IH 2YV5A 3T1YL 3U4ZA 2K50A 4JI1Q 2UXDL 3M4QA 1W2BA 4JI8L 1D7QA 5IYCH 3PIPA 4BBRH 1Y1WG 2OCEA 3STBD 3PUWA 4JI0L 4JV5Q 2R7ZG 1HZBA 3RLFA 1Q12A 4O0AA 3RN5A 3H3VI 1IXRA 3PIOA 1N33L 2VS1A 4KI0A 1U5KA 1JT8A 1VQJA 4DAMA 4GNXB 1C0AA 4B3TQ 2F52A 2JA8G 1X6OA 1OXSC 1KRTA 4DUZQ 3G4SA 3BZKA 1X54A 4JOIA 3HOZG 4QJFA 4A3IH 4X65L 4KHZA 5IYDG 4B3RL 1UE7A 3CAMA 2JA5G 2MQHA 1YHAA 4JOIC 2KHJA 3D31A 3GO5A 3ZJYC 5C3EG 1Q86C 1N8RC 4JI7Q 3I4NG 4DV6L 1PH3A 3A0JA 5DLQE 4DV1Q 1P8LA 2K52A 1VQDA 4P72A 4GOPA 5AJ3Q 1HJPA 5IP7G 4A3EG 1EQRA 4BA1I 1YIJA 2CWAA 2K14A 4GOPC 4DNIA 4A93G 2UUCL 2EXDA 2KBNA 4JBWA 4JI6L 4A75A 2UXCL 5IE8A 1NY4A 4QQBX 3EIVA 2IHFA 2UXDQ 4JI8Q 2DUDA 3HOXH 4B3SQ 4C3JH 5JEAG 1XNQL 3F2BA 2A8VA 5LMNL 2QA4A 1VQNA 3WWVA 3J81i 4JI0Q 3CPWA 4AYBE 5M3FH 3J7A5 1W3SA 1VQBA 1XPOA 1PH1A 1QUQB 4LWCA 4MZ9A 1DGSA 3HKZE 4NPSA 1KL9A 5FLMH 1Q81C 1JMCA 4LF5L 4YCWA 2RCNA 4JI3L 1UEBA 2K5HA 1PFSA 2VUMH 3CCVA 4KHPQ 4LFAL 4A3KG 4GKKQ 4A3CH 3FKIH 4X65Q 5ELNA 2N49A 3CC7A 2ASBA 4B3RQ 1PV4A 3EBEA 5M5XH 3LGJA 3W5OA 4IJLA 1GD7A 1Z47A 2MO0A 3PUXA 1CUKA 1E22A 1RIPA 3OTOL 3HOWG 4XIGS 2KCTA 4HJAA 3K81C 2MO1A 5ELOA 2F4VL 1E1TA 4NXNL 3J80c 4P75A 3AQQA 3RR5A 1FVIA 1PH7A 1D8LA 1K83H 2ZM6L 1Y1WH 2UUCQ 1KXLA 2B63G 2QEXA 2OTJA 2HIXA 2R7ZH 3S1MH 4HIDA 4YWMA 3F8TA 4DV2L 1VS0A 3GTOH 1E24A 1WYDA 3SGIA 3KF8B 4DV4L 1XNQQ 1EIYB 5LMNQ 1I50H 5HY6A 1HZAA 3RNUA 2B3GA 2IX0A 2JA8H 3W1BA 4BA2I 2Q2TA 2MFIA 2AWNA 1M1KC 4IOCA 3HOZH 1Q82C 2YU9H 3U4VA 1N9WA 3A74A 4X66L 1I3QH 5C0XJ 1X56A 4DV0L 3CD6A 4LF5Q 1XMOQ 3I4MG 1YJNA 2JA5H 4JI3Q 2GN5A 4YCUA 1L0WA 5C3EH 3I4NH 4IPDA 4LFAQ 1A62A 1A63A 2ES2A 2MNAA 2ZTCA 1QZGA 1SROA 3S2HH 3I2ZA 1SR3A 4DV7L 2ZJQA 1L1OB 2I5HA 5IP7H 4LF8L 4GNXA 1N34L 4BY7G 2ZJRA 4A93H 5BR8L 2OQ0A 1GVPA 1B8AA 1KQSA 4R4TA 5IP9H 5GAEC 4GNXC 3KOJA 1QZHA 3CCSA
chains in the Genus database with same CATH superfamily
5LL6X 3NENA 3NBHA 2N78A 4K2KA 4F87A 1OXTA 1DD2A 1F2ZA 4GN4B 1FD7D 2D62A 2OWOA 1CI3M 3FVQA 4O42A 1F2YA 2AUKA 5FO7B 4ZLTF 5EBDA 1KAWA 4EGVA 5HGQA 3MVVA 4IPCA 1C7YA 2B39A 5JJIA 5IYBG 4A3KH 3UDGA 1TIID 4DV0Q 1RD9D 1KDAA 4U68A 1ZKOA 2K75A 2EJGC 4V0BA 5C0XI 3Q22A 4QGUA 1E2WA 4LF8Q 1GO3E 5BR8Q 1IL8A 3ER0A 4HAEA 2PPBC 3K7AH 1Z9FA 2B2UA 2XN9C 3PO2G 1A2TA 3HOUB 2UU9Q 4KTAA 4DK6C 1LTID 1YNJD 3CPFA 2JA7B 1SXTA 2A6HC 1WJJA 1RL2A 2ZTEA 3T53B 1QVGA 4LF6Q 1JWMD 2XNAC 5NUCA 4YHHL 3I4MH 1CKMA 2BE5D 3AFPA 3CU7A 5ISRA 5CBEE 1LUZA 1K0RA 4MN3A 5JJKA 5CV7A 3ONAB 1X3EA 3KF8A 2A6ED 4ODGA 3B6YA 1OO9B 4BY7H 2IY5B 3KBXA 4PMCA 4JI4Q 3CHBD 4C3HG 4N9TA 2HIVA 4ZKCB 1N32Q 1SYCA 4R4QA 1RJTA 4DR4L 4DAYA 1LTBD 3BS1A 4A3JG 3OIQA 1K3RA 3TBIB 4HIOA 3KF6A 2BDNA 2MP1A 2K01A 4CDDC 2B2WA 3S1NH 2QF7A 2EY1A 4QUFA 2PQAB 4GZYC 4TKOB 3UDIA 4QIWE 1I5FA 3J7AV 1OXUA 2PI2A 4JI6Q 4IURA 5A2QL 1SEBD 4BBRB 1V1QA 4OIJA 3PGZA 4WJ3M 3AB9A 4JVZA 1SE4A 1NNXA 4A3MH 4Y52H 3K8AA 1U4PA 5DEHA 5IWAQ 4DR1L 3C46A 1BVSA 3HOVH 1CT1D 3H0GH 4GOPB 5LMNW 2VL6A 3ITPA 4BWGB 1PA6A 3SHLA 2JA9A 2UUBL 4C56C 3S2DH 2XVSA 2V4DA 3ERSX 4DNRB 4BBSH 1LT3D 4A3EH 2N3SA 4CKBA 3D6WA 2RDGA 1BXTA 4HCSA 4NW2A 1GJXA 5CYUA 1EZ6A 1X3GA 2PI2E 3TSSA 3JAME 1S40A 2OEOA 4UP9A 1W6JA 1U4LA 5CC4A 3GV3A 1A15A 1PH4A 5DNFA 3TREA 2N8NA 3LWUA 3LX0A 1YNXA 1JE4A 1JOQA 3R8BA 3QJYA 4NP5A 2YTVA 1XPRA 4FXKC 2M2LA 4GNXC 4LF7L 4QCLA 1MI2A 1T5XD 1CFMA 4A3LG 1EQQA 1P16A 1QE6A 4EVOA 1ICWA 2JEAI 5JJZA 1S5BD 1QJOA 4CDFC 4M8AA 4C1NK 1GKHA 4KJNA 3HFZB 2MGSA 4MHEA 3W1GA 3GTQH 5KRUA 5M3MH 3SK6A 4A3BG 1PVOA 1SNQA 3H6MA 1SNMA 3WOFA 2EJFC 4JG2A 1EWCA 3G6JB 3RUZA 4A3GG 1SN8A 5KNBA 3PO3G 4AH6A 4P71A 1I50B 2F0PA 4B3SL 1VCIA 2IT1A 2F0KA 4DF7A 3BG3A 3MXNB 1K9MC 3JAMi 1BBXC 5M5WH 1QB5D 1SBBB 2Q2UA 1PTOD 2KQ3A 3RLNA 1RCVD 5CV8A 3G48A 1EYAA 1I4RA 3IL8A 4BS9A 4LFBQ 1DONA 4KHPL 4GKKL 4BY1G 2SEBD 4A3FH 2EZVA 3FHWA 1X55A 3X3MA 1VQ8A 1SLJA 1JWSD 2AKWB 5KEEA 2RVLA 3K5MA 1XXGA 3PSIA 3KLSA 2VQEL 4IO9A 5KIXA 1SFOB 1Y8NB 1U4RA 2NVTB 1WTVA 1IBKQ 5IP9G 3ULJA 2PW7A 4DR2Q 4ME5A 3RZDB 1PRTD 4TQUS 2Q2HA 1VQKA 2PZTA 1NTGA 4GKJL 3H3VH 1I4XA 4LUVA 4AIMA 4DKAC 4EX5A 1CSPA 1UE6A 3HOYG 2R92B 5JOBA 2UUAL 2LY7A 2EXZA 3CC2A 2F4IA 1HR0L 2AUJD 5IODA 3E9HA 5EJWA 3GTMB 4AYBG 1NSNS 3E0JA 3VR2A 1ILPA 2IX3A 1CKOA 3P20A 2O4XA 2KHIA 3MC0B 2ZXOA 3HKZG 3M9BA 2CQAA 3KDFA 3HOUH 1C8CA 2JA7H 3M4OB 2TSSA 4H0LC 2BCOA 2DN8A 3OHXC 2KOLA 2F1MA 4CGYB 3URYA 4A3IG 1X65A 1B1ZA 3I3CA 4UDUC 3M85A 1VQ7A 5ELCA 3VR5A 2IJ0A 1LO5D 2DNEA 5G3LF 2O2LD 2VB3X 4KMUC 4JI1L 1X3FA 4OWWB 1H9SB 4IJHA 2ID0A 4JBKA 2BH2A 1EYGA 4GLVB 4OX9Q 4C3JG 5C0XG 1PYWD 4K5XA 2E2HB 1Y8PB 4DUYQ 4G7ZC 4PMBA 1WOCA 2WFWA 2PQEA 4NXMQ 3JC66 2NN6I 4LUZA 2UUBQ 2UXBQ 3GTGB 5FLMG 2NZOA 4X64Q 2EDGA 2JE6I 1YHBA 1N36Q 1ONLA 3G71A 3WOEA 3FKIG 2L55A 3PUVA 2EYMA 3KK7A 4LFCQ 2CQOA 4H02A 3RZOB 1S5FD 1Y1VH 1PH2A 4KHVA 1R4PB 3DWAA 1QOHA 4K5VA 3ND9A 5HURA 3M4QA 4JI8L 1D7QA 3TZUA 5IYCH 3PO2B 4BBRH 2OCEA 4JV5Q 3PUWA 5CORA 2R7ZG 1A3TA 1R9TB 2CW0D 1Q12A 3PIOA 4Z9CB 1VQJA 1C0AA 3W2DA 2EE1A 1EY6A 1X6OA 1OXSC 5HGTA 3QIAA 1X54A 4RHRA 1KNEA 4G7OC 1EEFD 1JR0D 4B3RL 1F2MA 5EQ0A 1YHAA 2KHJA 3D31A 5C3EG 4RAUC 4JI7Q 3I4NG 3ERQA 1PH3A 3A0JA 1HRJA 1EYCA 4XXEA 4P72A 4GOPA 1HJPA 4BA1I 1CK1A 1PDQA 2CWAA 5C4JB 4CJ0B 3E3XA 1IKMA 4IQZA 5E1FA 5ELDA 5IE8A 2WIIB 3EIVA 2UXDQ 4NDXA 4B3SQ 1SNPA 2KA7A 2ZT9C 1PTOB 1H9JA 1EZ8A 4A3JB 1SJED 1W3SA 3OIPA 1PH1A 4LWCA 3NTIA 1KL9A 4YCWA 1UEBA 2K5HA 3I70A 1Z7TA 3CCVA 4KHPQ 3GTLB 4GKKQ 2QCPX 1QG7A 5ELNA 3SK4A 2XRSD 1PV4A 1KLGD 1B9MA 1STEA 3K58A 3NWTA 2MO0A 3K0YA 2F0EA 3DUZA 1E22A 3VYRA 4DFAA 3HOWG 4XIGS 1K3BC 2MO1A 2F3VA 5ELOA 5I9PA 2ENBA 1E1TA 1LTTD 2F4VL 3A56A 1PRTB 3AQQA 3RR5A 1FVIA 2KCCA 2LFNA 3SK5A 2HIXA 5EPJA 1E24A 5CBAE 3SGIA 3KF8B 4ZCKA 1I50H 4QIWB 4DA2A 1X3PA 4XQNA 1BR9A 2IX0A 3LNNA 1BCPD 2Q2TA 1AZQA 3X3NA 2L4NA 3K6OA 1Q82C 5C4ZA 3CD6A 3A74A 1S5DD 4MTKA 4DV0L 3HZXA 4DN4M 4LFAQ 3MXNA 1ET6A 2MNAA 1STAA 2ZJQA 2MJ8A 4LF8L 2ZJRA 5BR8L 1B8AA 1KQSA 4R4TA 3KOJA 1FNWA 4GLXA 3CCSA 1WTHA 5E4WC 2UU9L 5JEAH 2EYPA 1HR0W 4L8JA 1SFOH 1TWGB 1X3QA 4YCVA 3K5LA 3PCOB 2NVTH 3L7ZC 5JVG3 2JA6G 1KRSA 3RZDH 2B2TA 4LF6L 4HIMA 1GM5A 3D4RA 4HCEA 1EIGA 3SXHA 1VQ9A 1Q3LA 1VQHA 1EL0A 2EYOA 5C3WA 3MZ5A 2R92H 4FF4A 2HHHL 4DV7Q 2LXKA 4A3BB 3QOLA 4JI4L 2VNUD 2HCIA 2I5LX 1FNUA 3AYHB 1G2TA 3CXCA 4A3GB 4DU9A 3PO3B 3GTMH 1N32L 3S1RB 1PXUA 1YJ9A 5J1ZA 3MEFA 1FJGQ 1OXVA 2LSSA 1YHQA 3HKSA 4CKEA 1HNXL 2N88A 2DY7A 4X62L 3J81c 3M4OH 1QWYA 3IFTA 5H1SE 1GUTA 1ZEQX 2CH4A 1DJRD 1GUOA 5M9OA 4C2MB 4BY1B 4HIKA 1BOSA 1ENFA 1CSQA 1CHQD 4OELB 1NMGA 4HSPA 1ESRA 3GTKH 4DAVA 1JE5A 2XSCA 3D6CA 3UI2A 3K0XA 5IWAL 3EVQA 2EQSA 2XIWA 3T51B 2E2HH 2E5LQ 2R7DA 2EYLA 5EPKA 1FGUA 1YJWA 3LWEA 1TWHB 1M90C 4GN3B 3GTGH 4IFDG 4S3SA 1L1OC 5E4XA 5IYBH 4MIUA 3K80C 3HOYB 2K04A 4EQPA 2RKSA 2D2CC 1KD1C 3S24A 1HNZQ 2DGYA 1EYDA 1SYFA 3RZOH 1GUNA 2RHSB 4AYBB 3SE0A 1VQLA 4UHVA 1TS3A 1WI5A 4EQ5A 1WFQA 4PV1C 1EWHA 1II3A 1E0BA 3PO2H 4G7HC 1XMQL 3H3VC 1PRTF 1PZKD 3I90A 1R9TH 4RHSA 1EEID 1C4QA 3QO2A 3D3RA 4IUUA 5IYDH 4LNQA 2Q2IA 1XTDA 2I07B 4R4IA 4A3IB 5LL6S 2RDFA 2A73B 4PZ7A 3E6ZX 1SYGA 3OOCA 3L0OA 2AQ2B 1VQFA 1KAAA 3FMCA 5GROA 2EY5A 2K28A 3E0EA 3NE5B 1HQRD 4IPGA 2F4VQ 1K8AC 2SNMA 1NUCA 4LUOA 3HGBA 4IZ8A 4JYAQ 4J15A 5C4JH 4K6LA 3AMUA 3TS0A 3PIO3 1Q46A 1VF5C 2FFKB 3GD7A 4PNYA 4C3HH 4C3JB 1BCPB 5D3DA 1FYCA 1ENAA 1C9OA 2VQFQ 4KY6A 1PTOH 2R6GA 2O5IC 3SDZA 4A3JH 4N8X1 3CCEA 1IW7C 2R93G 4DUZL 3STBC 3Q8DA 4LFBL 2D0OA 3OPOA 4FNFA 3F1ZA 3PF5A 5M5XB 2H4OA 1AFPA 3KDFB 3GTLH 2AHOB 5GAHC 3CP0A 4HJ8A 2PNHA 2QEJC 4OWTB 1JB7A 3WDNA 2KHSA 3J81E 5JJLA 1X32A 1K83B 1VDZA 4RA8A 1M4VA 3VR3A 2R7ZB 3I91A 3P1HA 1DOMA 1IBKL 1GUSA 1LTLA 3TRZA 4FF1A 4HN7A 4DR2L 3TQYA 4JBMA 1KTKA 1XNRQ 4OXPA 1NE3A 5A2QE 3HRZC 1VQMA 3TN2A 1RODA 1I3QB 1QVFA 4P74A 4ZQ3A 2K5WA 1KABA 2SDFA 5C3EB 3I4NB 2Q8IB 4IALA 3R2IA 2WAQE 3MEHA 1MHWC 3CCLA 2HHHQ 3KLWA 4DGZA 2F0OA 1WD0A 3A54A 2YYZA 1PZJD 5JPMC 4MTNA 2OF1A 1HFGA 2MHVA 1TS4A 2Q8RE 2OQKA 3BU2A 1VQAA 3N52A 3NSWA 2EYJA 4A3DG 1BBWA 2WAQG 3OW2A 1HNXQ 1STYA 2HCCA 1TWGH 4X62Q 2E2DC 2PNRC 1JJGA 4DR7Q 3J81L 2F03A 3K57A 1B7YB 2B2VA 3F2DA 2G9DA 2K05A 3CCQA 4A4IA 4Y7NB 4A3LH 4FVMA 1Y1VB 1FL0A 2BDOA 5C4XG 2Q8TA 1LTAD 3G6EA 3VDYA 1HTPA 1VQOA 5I6WA 3HOWB 4KKUA 5FO8B 3E9IA 3S1QB 3BYTB 3VA7A 4A3BH 2A1AA 4UAIA 4KK7A 4OX9L 3HG9A 1B53A 3DWPA 2A68D 4DUYL 4A3GH 1TY2A 3BVGA 1J5EQ 3PO3H 4OO1I 3S1RH 1JORA 1SSOA 3UDFA 4NXML 2I0QA 2UXBL 4DR3L 1EY7A 4X64L 2NYZD 3D0FA 1QVCA 4ZAIA 1N36L 3R93A 1AN8A 2AMCB 4LFCL 4K2LA 4YWLA 5KNCA 1G8ZD 3CCMA 1ZXTA 4IPHA 1AZPA 1CA5A 3H15A 3DEPA 4C2MH 4BY1H 3KFUA 5ELEA 2KEDA 1JCKB 4K0KQ 4JV5L 2F0LA 2IHEA 1XMQQ 1PMRA 4KKSA 5GQOA 3HOXG 4F8MA 1DOLA 4OGQC 3HS0C 4R4OA 1WTOA 1SMYC 3T13A 1BCPF 2NBFA 5M3FG 2BOSA 2SOBA 4XTCS 4K6DA 3K59A 1I4GA 4QL5A 1U9RA 1F9QA 2E74C 2Z6KA 2NZHA 1TWHH 4JI5Q 4JI7L 3PQIA 2WACA 4O2DA 3HOYH 1STHA 5CMDA 1SRUA 5C3XA 2XGTA 3T1YL 3U4ZA 4K8IA 2WV6D 2UXDL 2L0CA 3H91A 3C1EA 2BE5C 2MPMA 3RLFA 5COYA 1IXRA 2J0TD 2KCNA 1EIHA 1N33L 3MFYA 2VS1A 2CH4W 2PW5A 1F9SA 4DAMA 4B3TQ 2NVQB 1TQOA 4DUZQ 4JOIA 3HOZG 4QJFA 5FK9C 4A3IH 2K7VA 4KHZA 1UE7A 3CAMA 1IKLA 3IFDA 4JPBW 3ZJYC 1Q86C 1ESFA 4QB4A 4DV6L 1WTWA 4DV1Q 3Q6SA 1SE3A 2HUGA 1B44D 3G7LA 4A3EG 3D4WA 3M3YB 3FDTA 4A93G 1IYUA 1EY8A 2EXDA 2UXCL 4EQOA 2IHFA 4G4KA 4G57A 1BDOA 4C3JH 5BN5A 4RKBA 5C0XH 1O7YA 2QA4A 3WWVA 2KEEA 4AYBE 4J8QA 3J7A5 4Q5VA 3SR1A 4XQQA 1Q90A 1K8OA 4MZ9A 3HKZE 5FLMH 2SNSA 5KGUA 1QCBD 1STGA 1PFSA 1JC7A 1S4ZA 4LFAL 4NKLA 3FKIH 2ASBA 5M5XH 1GD7A 1I6VC 4FF3A 2F0GA 3S15B 1TT2A 3PUXA 4IUNA 2B2YC 3OTOL 2KCTA 1CHPD 2VB2X 3NTHA 5J22A 3J80c 1K83H 1G2SA 2UUCQ 3S9WA 2B63G 2R7ZH 1O7ZA 4HIDA 1C48A 3GTOH 1E2ZA 3DWQA 4XT3B 1BO0A 1YNNC 1HZAA 1HXYD 5F2DA 2CVRA 1NAPA 2MFIA 2E2JB 1M1KC 4IOCA 1JICA 1I3QH 1X56A 3MTSA 2RSNA 4LF5Q 5T1IA 5C3EH 3I4NH 1FNVA 4KY7A 1A63A 3KUPA 2ES2A 1QZGA 3GTKB 1SR3A 4DV7L 2O5JC 5CV9A 2I5HA 1F9RA 2FMCA 4GNXA 4FO2A 4OEMB 1ENCA 2M00A 2PCFB 1GVPA 5GAEC 3BVMA 2GA4B 2QILA 4NXNQ 3I4LA 2XRQD 3NXWA 1FJGL 3SK8A 4NB3A 4DR3Q 1SE8A 3EN2A 5I6YA 3DHQA 1JJ2A 1B9NA 4ZUIA 4DV4Q 2JJQA 3VA5A 2AWOA 2R93B 1MIUA 4FDBA 1IYJB 4Y7NH 2F0DA 2F3WA 3I8ZA 3SEBA 4X66Q 2F3IA 3TMEA 3D4DA 4APVA 2F0HA 2M9VA 1AE3A 3KJPA 5IGFA 1PTOC 5JAVA 3HOWH 4YWKA 4DPGA 4UPAA 1N34Q 3S1QH 3VR4A 1HZCA 4X3UA 4XT1B 2F0WA 1MSHA 1Q1EA 1BBUA 1I4QA 2NUCA 2E5LL 3ULLA 1TWCB 2B2UC 1HA6A 1YVCA 2FXQA 4JW0A 1V1PB 1A0IA 2DJFC 1A3UA 3CRKC 3KLSX 5T1GA 4AQYQ 2RF4A 5JEAJ 1B70B 1HPCA 5CV4A 1TWFB 4HEDA 4RGOS 3RN2A 1KDBA 4BXXG 2XTIA 4MNOA 1I94Q 4LW1A 1MJEA 1EFWA 1HNZL 3BDLA 1PRTC 4LF9Q 4C3HB 3T1YQ 2A69C 3S14B 4KKTA 1E1OA 1NJIC 2DNCA 4ALPA 4OHJA 1JOOA 4CHTB 4HJ7A 4A3DB 3DMUA 2HQLA 4RH6A 2LXJA 2WAQB 1N33Q 1V9PA 1IHZA 1IL2A 2VY3A 4KLKA 3NTKA 1X9NA 2MUYA 3C1FA 4DK3C 2L9HA 3QR8A 2F0SA 1GUWA 3J80E 5C4XB 4JCVE 4OO1G 2L5TA 2RBMA 1KHIA 3C3LA 4DV6Q 1TS5A 1F2LA 1MSGA 3RD4A 1CQVA 1ASYA 2WB1G 4ULLA 2B2WC 3QG1A 3A7LA 5FJ8G 4FXGC 2IL8A 3EA6A 1A3VA 4C3IG 4JYAL 1EU3A 4H44C 2EIFA 2UXCQ 1STNA 4UP7A 3A55A 1CZGA 2OXPA 5AFWA 1AP0A 3KYHC 5EKIA 2VQFL 2EPBA 2GVBA 1G6ZA 1SYEA 3TEHB 2X69A 3O13A 2D5DA 4BBRG 5J3BA 2NVQH 4DR6Q 5IGBA 4UP8A 2R61A 3UDXA 4TSSA 4DAPA 3CCRA 1D1IA 1E3PA 1R4QB 4RG1A 4P73A 4DV5L 4DK1A 2D0PA 3R3OA 3SVMA 4RGNA 3OTOQ 4XQJA 1OTCA 2ZJPA 2F0QA 5JVH3 3J80L 2JK8A 2K32A 3GDEA 3M3YH 4L5QA 3ULPA 3HOXB 1QNUA 1XNRL 3AU7A 5M3FB 4X3TA 3QWNA 1DCZA 1E7ZA 1EQVA 2CWPA 2PMZE 2ALYB 4XYOA 1VQ6A 3IKJA 1GOZA 3EQLC 4IFDH 1DM0B 2Y0SE 2VZAA 3F2UA 1I6HH 2CKZB 5J39A 3UE0A 3CCUA 1ET9A 1PH6A 1HZ9A 1STBA 2TMPA 3I55A 3KJOA 3CCJA 1ASZA 4RGMA 2Z6KC 4TRDA 3Q23A 1NBWA 4M1UB 4TVAB 5C44G 1EUJA 3S15H 4DV3Q 1UUPA 2OTLA 1NR2A 5KYIA 4L5TA 1V43A 5KYLA 3S1MB 3FP9A 2RSOA 1Y14B 2K4KA 3QB3A 2Y0SG 2HDLA 1IW7D 4DR7L 3L2PA 1B4OA 3A8JE 5EAYA 2ZTDA 4JC0A 1KNAA 1MD2D 2G9HD 3HOZB 2YU9B 1RTOA 1XPUA 1PYSB 1PYBA 5I4DA 2E2JH 4KV6A 1WCMG 3K5OA 2F0VA 3PV0A 1SMXA 3S2HB 2FJ2A 2JEBI 4FP5D 1RF2D 1CM9A 2RHQB 3A5UA 4A93B 4JK1C 1CA6A 2A6HD 4IUQA 1TR5A 4CBVA 3OMGA 3OYYA 1DXMA 2F0JA 4B3MQ 1SAPA 2AQ3B 4POFA 1J5EL 1I4HA 1UE1A 1PTOF 3T1HQ 4L5SA 1YZ6A 1HA5A 3A8KE 1CZWA 3NBIA 4L63B 3DLLA 1O7IA 2R93H 4I7AA 1RDPD 5GAGC 4LF4Q 1YEZA 2NVXH 2R3ZA 3CQZB 2B8GA 1LV9A 4HMJA 1GXDC 1EOTA 1K28A 1TXYA 3J7AF 4B9WA 2L15A 1BCPC 2K33A 3MXPA 2K03A 3T56B 3S17B 2Z6BA 3M7GA 4K0KL 1Q8KA 3HKZB 1ML0D 3CMAA 2B63B 2R92G 1NCVA 3U58A 2Z8LA 2JP1A 4RCNA 3K7UC 4OL7A 3BVZA 1HNWQ 2ICIA 1A6XA 3RLOA 3J7ZC 1TWCH 1PH8A 3BJUA 5JPNC 2A5HA 4JI5L 1IBMQ 1S3OA 3H09A 4L5RC 3D8GA 2NN6G 5K36G 1TWFH 1JJCB 4DXGA 1Q7YC 3I73A 4WORA 1CKNB 1LTRD 3NUCA 4GLAC 1V1PA 3MXGA 1KC8C 3TZDA 3K5NA 3A5ZB 3S14H 2NTTA 2CCZA 1EWIA 1ZYRC 4A3DH 4KN7C 1RKNA 5GADC 1SYBA 2NB0A 3CRLC 1D5MC 2F0IA 1K8GA 4E6IA 1YI2A 4B3TL 4UY8C 2Z1CA 3ZYYX 3FKIB 4YY3Q 2ICEC 2NWGA 4RMFA 1L0XB 2WKCA 3MA2B 4OONA 2KENA 3J81j 3DXJC 4P2CB 5C4XH 4DV5Q 2VUMG 1EIFA 1AH9A 1IZ6A 3JAMc 4DV1L 3L9AX 4A3CG 1TWAB 4QF4A 5I2YA 1IBLQ 2X6GA 2IX1A 4DR5Q 1XX8A 1KLUD 2KECA 3A7AB 3GTOB 2YV5A 1GHJA 4CJ1B 1SMYD 4F7XA 2VXWA 3PIPA 1Y1WG 1HZBA 1JWUD 3DM1A 5C5LA 4B08A 3RN5A 3H3VI 3GV6A 1HUNA 3NK9A 2NZ1D 1SDFA 1JT8A 4GNXB 3KLRA 1TKWB 2NTSA 2F52A 2JA8G 1KRTA 3BYYB 3G4SA 4LJZC 1VF7A 2PZWA 1AEXA 3TP5A 5IYDG 2DJGC 2JA5G 1N8RC 2G5DA 4H13C 1GHKA 3RMHA 3GTJB 1EFID 1P8LA 2K52A 1WVLA 2NVYB 1BUVT 3QOJA 5AJ3Q 5IP7G 4XYQA 4GOPC 1HTLD 4Q0FA 4DNIA 2UUCL 2ZXRA 4HSVA 4A75A 1NY4A 5FKAC 4I7ZC 2DUDA 3HOXH 3F2BA 1F9PA 1BNZA 1VQNA 3J81i 4JI0Q 4YIJA 3CPWA 5M3FH 2D9UA 1VQBA 1FR3A 3GTPB 2P5ZX 5E3FA 3HP3A 4NPSA 1JMCA 2EY2A 4IUVA 2L1BA 2WKDA 5D65A 4LF5L 4ABNA 4A3KG 2WB1B 2RA4A 3NP8A 5LHY1 4X65Q 2N49A 3V2TA 3LGJA 1LT5D 4IJLA 4C3IB 3KBGA 1Z47A 1J9OA 2E75C 1CUKA 1RIPA 3TP6A 4R8IA 2J4XA 4EQNA 1LTGD 4HJAA 4ILWA 2PZUA 3OMCA 4NXNL 1EY0A 1D8LA 1NR4A 1KXLA 4KJOA 5EKKA 3S1MH 2B8FA 1O7LA 1PFBA 3F8TA 4YWMA 1WYDA 5EKLA 4DV4L 1XNQQ 1EIYB 5LMNQ 2K6AA 3TDQA 3RNUA 1Q8IA 3W1BA 2K5DA 4BA2I 4V190 3HOZH 2YU9H 1H9RA 5C0XJ 4X66L 1WTQA 3I4MG 4JI3Q 2GN5A 2J7ZA 3MFGA 4YCUA 4IPDA 1LLRD 1A62A 4N9PA 3S2HH 2Z9HA 4J6HA 3BZDB 2FHTA 3PMFA 3A8IE 1N34L 4BY7G 4A93H 2OQ0A 2JA6B 2JXMB 1YNND 5IP9H 2QDBA 3VYSA 1QZHA 3NPPA 2F0TA 3OWEB 2HD3A 4CDEC 2BA1A 3P7JA 1WD1A 4CKCA 1SE2A 2ZM6Q 1G51A 4HJ5A 2OTJA 4DV2Q 5CGKA 4AQYL 2EOTA 3GP7A 5FOBB 1U0LA 1WTPA 1UNSA 1UWVA 1YNJC 4JBJA 1I94L 2B2TC 1D1KA 3AFQA 1G291 1WTXA 1I4PA 5IIFA 4LF9L 1LABA 3CQZH 1UEAB 2C35B 4QY7A 4A76A 4FYDA 2H5XA 5C44B 2PMZB 1OXXK 3FPUB 3S17H 2AQ1B 4K14A 2QDLA 3S16B 1QUQA 5A35A 3EJIA 2Y0SB 2N55A 5BN4A 2A6EC 2B63H 1T5EA 2B29A 4DNTB 3CW2C 4X6AH 4A3MG 4GN5A 2JYOA 1O80A 1VQIA 2X6LA 1L0YB 3HOVG 4IUPA 1UAPA 3H0GG 1KIXA 3GQBA 1WCMB 2HT1A 3T4AC 1IYVA 4JI2L 4KN4C 3JAML 1L2FA 1FGBD 2RDHA 4BBSG 5IY0A 1D5XC 4PQXA 1VQ4A 2ATWA 2R7FA 2YTYA 1BF4A 1SYDA 4HMIA 3TS2A 4FF2A 2XWJB 1VMPA 2FMMA 1CKNA 4ZK9B 2K5NA 1A8VA 2ZXPA 1HH2P 5ELFA 4WJ4A 5FO9B 1A2UA 1I6HB 3TP7A 1EQTA 4DR6L 5M5YB 1XJVA 1L1OA 1TU2B 4PG3A 1Z6HA 1V1OA 4ZRZA 5FLXc 2F0MA 1PFNA 2LKVA 1EY4A 2A68C 2A69D 1XTCD 3VYTA 3CF5A 4IOAA 4YHHQ 5C4HA 2EYHA 2YTXA 3U9SA 1B3AA 1TWAH 2IWHA 2E2IB 2JQOA 3I7FA 3FRPB 2VW9A 5LMUL 5C5MA 1CTMA 2V1CC 2JSOA 3MWYW 5M3MG 1U4MA 2I46A 2CHBD 1MKHA 1B3QA 3PF4A 3V96A 1BQQT 4ME3A 4IFDI 1JQYD 1E2VA 4DR4Q 3I56A 5IGEA 1HFNA 1K0SA 2L11A 2GVAA 2FINB 4K5WA 4BXXH 1BKBA 1VQCA 5TSSA 5BN3A 3FPPA 4PZ8A 1VQ5A 3GTJH 4DV3L 1J8IA 2NVYH 4OIKA 5D3IB 3PIP3 4A3FG 1SNDA 1K73C 1D6EC 4J1MA 1LYLA 3BZCA 4NMZA 2CFMA 1PHJA 4GS3A 2NVXB 3OW7A 1AE2A 2I5MX 4DR1Q 1VMCA 2F0NA 4LMQD 3GTPH 1HHVA 2A19A 2VUMB 4OO1H 2BA0A 1H9KA 3IRBA 3PUZA 4HR7B 1LT4D 4WFN3 1D2BA 1H95A 2IW3A 3J7YW 4FXDA 1LM0A 5FJ8H 1O78A 4C3IH 3AEVA 5EPLA 3I4OA 4RKLA 4B3ML 5IT9c 4ZKBB 1T9HA 4XDXA 3M4YA 2DY8A 3N6RA 3HEJA 4HJ9A 1Y1WB 3T1HL 1VQGA 1TS2A 4WRDA 5IGGA 1EOVA 3NEMA 3CMEA 4R8NA 3I72A 2E76C 1G6PA 4OWXB 2WINB 2JA8B 3HOUG 2PQAA 1AW7A 5ELBA 4LF4L 5IGCA 1PLFA 2JA7G 4I65A 4KY5A 4LF7Q 2JA5B 3NQIA 4PMWA 3F2CA 3NQTA 1VQEA 2C5CA 1HCZA 3IAYA 3NBHB 3R2TA 4IFDJ 2QW7A 4X3KA 2WP8J 2Z4HA 3MHBA 5FLXE 2WB1E 2RCFA 1Y8OB 1B2TA 5EGTA 4QUCA 2JA6H 1B50A 1F77A 1HNWL 2QKIC 1NMFA 4POGA 4X3SA 2HDMA 1PH5A 1HUMA 4JI2Q 2E8GA 1IBML 1PH9A 1YBYA 2F0UA 3CC4A 2L12A 4ID6A 1UE5A 1KDCA 4A3KB 5K5PA 2PYKA 1MBYA 1EY9A 2B2VC 2EY6A 4KD4A 3NHHA 5C6AA 3ICEA 1CQFA 1LTSD 1XMOL 5E7NA 4DXFA 1Y1VG 3E5SA 5C44H 4R4CA 3U50C 3U9OA 3VYUA 5CV5A 4ZUJA 1YITA 4RFBA 3DEOA 3S16H 3K7AB 2OT2A 5CR3A 5IYCG 1DYQA 2VQEQ 4U673 1S5CD 4YY3L 2EYFA 2Z0SA 2BH8A 5FLXL 1RTNA 2H1EA 1Q1BA 3I4MB 4PZ6A 1WCMH 4CJ2C 1D5ZC 1ICFB 4GKJQ 1IBLL 4RCOA 2LMCB 4DR5L 2XWBB 5IOCA 4R1JA 3J80i 1S72A 4LAAA 5LMUQ 4RWSC 4BY7B 1PZID 1HQMC 2QGQA 3EROA 2UUAQ 4DK0A 1MJCA 3BDOA 4DAYB 3DM3A 3NELA 1LT6D 1XYIA 1HR0Q 2KCMA 1QILA 3UE1A 3KF6B 1RHPA 1TVXA 1K8MA 5DM73 5I9OA 3P75A 1H9MA 3MXUA 1J6QA 2PO4A 5IT9E 2CW0C 5M5YH 5L37A 3M7NA 3S1NB 1VQPA 5DM63 1DZ1A 5D14A 5AJ3L 2K1BA 3PUYA 3M4PA 1GUGA 1ZYRD 2K5VA 3W3AA 4IUTA 1LACA 2E2IH 2LS01 2K50A 4JI1Q 1W2BA 4F88A 1QNKA 2HQEA 4A3MB 1G91A 3CKIB 1WTRA 4N8FA 3STBD 4JI0L 4O0AA 5EBCA 4KI0A 1U5KA 3L3OC 3H0GB 3HOVB 3V05A 2K5QA 3OSOA 1V8QA 2Z4IA 3BZKA 3C2PA 3S2DB 4BBSB 2NN6H 4X65L 4A3EB 5K36H 1SJHD 2MQHA 4QMGA 4JOIC 3Q24A 3GO5A 3BDCA 2EJMA 5DLQE 1DOKA 1VQDA 4R9WA 1EY5A 5IGDA 3TP8A 5IT9L 1SNCA 3MAQA 5KNDA 1EQRA 1YIJA 2K14A 2KJXA 2KBNA 4JBWA 4JI6L 4KD3A 4O1NA 4QQBX 1EU4A 4JI8Q 1ILQA 5JEAG 1XNQL 4CDCC 2A8VA 5LMNL 1JOKA 1M8AA 1XPOA 1PFMA 1QUQB 4B9XA 1DGSA 5I2XA 1Q81C 2KUMA 1H9SA 2RCNA 4JI3L 4C1NI 2VUMH 2KVMA 3OWFA 4A3CH 4B3RQ 3CC7A 3EBEA 1MGSA 3T16A 3W5OA 2B2YA 4IN3A 3GTQB 5G3LD 5M3MB 4K8JA 3K81C 1XWEA 4P75A 1PH7A 1W6KA 2IPKD 5DAUA 2ZM6L 1Y1WH 4LK1C 2QEXA 2A74C 4L6TB 3VR6A 4DV2L 1VS0A 4ZYSA 1S5ED 1Y69U 5HY6A 5M5WB 2B3GA 1SNOA 2C9OA 2JA8H 2AWNA 3FEWX 1JB3A 3H94A 3U4VA 1N9WA 3Q0AA 2EVBA 1XMOQ 1YJNA 2JA5H 1L0WA 3EFXD 1TY0A 2F0FA 3ND8A 2JN4A 2ZTCA 1SROA 3I2ZA 4A3FB 1L1OB 5IP7H 2RQXA 5CV6A 4H7BA 4WJWA 3NWSA 4HTHA 4RGTA
chains in the Genus database with same CATH topology
4NXNQ 2UU9L 3NENA 2BA1A 2ZM6Q 1HR0W 1FJGL 1G51A 2N78A 4NB3A 1SFOH 4YCVA 4DR3Q 1OXTA 1SE8A 3EN2A 4HJ5A 4DV2Q 3PCOB 4GN4B 2D62A 3L7ZC 2OWOA 2JA6G 2NVTH 1JJ2A 4DV4Q 2JJQA 2AWOA 4AQYL 1KAWA 1KRSA 1MIUA 3RZDH 4LF6L 1U0LA 5HGQA 4HIMA 1GM5A 1UWVA 4IPCA 1C7YA 4FDBA 4JBJA 1I94L 1IYJB 4Y7NH 1VQ9A 3AFQA 5JJIA 1G291 1VQHA 5IYBG 3UDGA 4A3KH 4X66Q 4DV0Q 2F3IA 4LF9L 3CQZH 2C35B 4QY7A 4APVA 4A76A 2H5XA 1AE3A 2K75A 3KJPA 2R92H 5C0XI 2HHHL 4QGUA 1OXXK 4DV7Q 3HOWH 2LXKA 3S17H 4YWKA 4JI4L 4LF8Q 2VNUD 1QUQA 2I5LX 4DPGA 1GO3E 3AYHB 4UPAA 1N34Q 3S1QH 3CXCA 5BR8Q 1N32L 1HZCA 3ER0A 2B63H 3GTMH 2B29A 3K7AH 1Q1EA 3CW2C 1Z9FA 1BBUA 3PO2G 4A3MG 4X6AH 2E5LL 2UU9Q 1YJ9A 4GN5A 3ULLA 1VQIA 3MEFA 4DK6C 1FJGQ 3CPFA 1OXVA 2LSSA 1YVCA 2FXQA 3HKSA 1YHQA 1HNXL 3HOVG 3H0GG 1KIXA 1A0IA 1WJJA 4X62L 3J81c 2HT1A 1RL2A 4AQYQ 2RF4A 2ZTEA 5JEAJ 1QVGA 4LF6Q 4JI2L 3M4OH 1B70B 1L2FA 5H1SE 4YHHL 3RN2A 3I4MH 1CKMA 4BBSG 4BXXG 2XTIA 4MNOA 1I94Q 5IY0A 3AFPA 4LW1A 1MJEA 1EFWA 1LUZA 1K0RA 4GLXA 1HNZL 5JJKA 1VQ4A 2ATWA 2R7FA 4LF9Q 3T1YQ 2YTYA 1X3EA 4HIKA 1E1OA 1NJIC 3B6YA 4BY7H 1CSQA 2IY5B 4ALPA 1NMGA 4HJ7A 3TS2A 4JI4Q 2HQLA 3GTKH 1CKNA 2LXJA 1JE5A 1N33Q 2HIVA 1A8VA 2K5NA 1V9PA 1IL2A 2VY3A 3K0XA 1HH2P 4KLKA 5IWAL 1N32Q 4WJ4A 4R4QA 2EQSA 4DK3C 1X9NA 2E2HH 2E5LQ 2R7DA 4DR4L 4DR6L 1XJVA 4A3JG 1L1OA 1FGUA 1YJWA 4PG3A 1K3RA 1M90C 4HIOA 3KF6A 5FLXc 4JCVE 4OO1G 4GN3B 3GTGH 4IFDG 1L1OC 1KHIA 5IYBH 4DV6Q 3S1NH 3K80C 3CF5A 4IOAA 4YHHQ 1ASYA 2YTXA 2WB1G 2PQAB 1TWAH 5FJ8G 3UDIA 2JQOA 3I7FA 4QIWE 3S24A 1KD1C 1HNZQ 2DGYA 1I5FA 2VW9A 3RZOH 4JYAL 1OXUA 2RHSB 2EIFA 2PI2A 5LMUL 4JI6Q 1VQLA 2UXCQ 2V1CC 1WI5A 5M3MG 4EQ5A 1WFQA 4UP7A 1V1QA 3KYHC 3PGZA 4WJ3M 2VQFL 2GVBA 3PO2H 4A3MH 1XMQL 4Y52H 3K8AA 3TEHB 1MKHA 1R9TH 5IWAQ 4DR1L 3PF4A 4BBRG 1BVSA 3HOVH 4ME3A 5J3BA 3H0GH 4IFDI 5IYDH 4LNQA 4DR4Q 4GOPB 3I56A 2NVQH 2Q2IA 1XTDA 5LMNW 2VL6A 4DR6Q 4R4IA 1PA6A 4UP8A 3UDXA 4PZ7A 2JA9A 2UUBL 2GVAA 3S2DH 3ERSX 4BBSH 4BXXH 3L0OA 3CCRA 1BKBA 1VQCA 1E3PA 4A3EH 4RG1A 4P73A 1VQFA 4DV5L 2N3SA 4PZ8A 2D0PA 1VQ5A 5GROA 3OTOQ 3E0EA 1OTCA 3GTJH 4DV3L 2ZJPA 1X3GA 2NVYH 2PI2E 4IPGA 2F4VQ 1K8AC 1S40A 4A3FG 4LUOA 4UP9A 2JK8A 4JYAQ 4J15A 5C4JH 1K73C 3GDEA 3TS0A 1PH4A 3M3YH 4L5QA 3ULPA 1Q46A 3TREA 3GD7A 4C3HH 1XNRL 2N8NA 1LYLA 1YNXA 3BZCA 2CFMA 1PHJA 4GS3A 1C9OA 2YTVA 1E7ZA 2VQFQ 1XPRA 2R6GA 2CWPA 1AE2A 2I5MX 2PMZE 2ALYB 4DR1Q 4A3JH 4LF7L 1VQ6A 3CCEA 3GTPH 2A19A 2R93G 2BA0A 3IRBA 3PUZA 4DUZL 4A3LG 1EQQA 3STBC 1P16A 2Y0SE 2VZAA 3Q8DA 4LFBL 2D0OA 1I6HH 2CKZB 3F1ZA 3PF5A 2JEAI 1H95A 3UE0A 3CCUA 3KDFB 3GTLH 2AHOB 1LM0A 5GAHC 1PH6A 3CP0A 5FJ8H 1HZ9A 4HJ8A 3I55A 2PNHA 1GKHA 3KJOA 3CCJA 1ASZA 2Z6KC 3HFZB 4C3IH 1NBWA 4OWTB 4TVAB 5C44G 1JB7A 3AEVA 3I4OA 1EUJA 4B3ML 3S15H 5IT9c 3W1GA 4DV3Q 3GTQH 5JJLA 2OTLA 5M3MH 1T9HA 4L5TA 1V43A 4HJ9A 4A3BG 1PVOA 3T1HL 1VQGA 3FP9A 1IBKL 1Y14B 2K4KA 4JG2A 1LTLA 3TRZA 2Y0SG 4A3GG 1EOVA 1SN8A 3NEMA 3CMEA 3TQYA 4AH6A 4P71A 4DR2L 4JBMA 1XNRQ 3PO3G 4DR7L 3L2PA 4B3SL 4OWXB 1G6PA 4OXPA 1VCIA 1NE3A 2IT1A 2PQAA 5EAYA 3HOUG 2ZTDA 3MXNB 4JC0A 1VQMA 1K9MC 3JAMi 4LF4L 5M5WH 2JA7G 2Q2UA 4LF7Q 3RLNA 1XPUA 1PYSB 1PYBA 2E2JH 4P74A 1QVFA 1WCMG 3G48A 4PMWA 3F2CA 3PV0A 2WAQE 1SMXA 1VQEA 4LFBQ 3CCLA 4KHPL 2HHHQ 2JEBI 3KLWA 4GKKL 3NBHB 2RHQB 2YYZA 3A5UA 4MTNA 4BY1G 4IFDJ 2WP8J 4A3FH 3FHWA 1X55A 1VQ8A 2OQKA 1SLJA 2WB1E 3BU2A 2AKWB 1VQAA 3OYYA 4B3MQ 3PSIA 4POFA 4A3DG 2VQEL 4IO9A 1J5EL 2JA6H 1UE1A 1BBWA 3T1HQ 2WAQG 1HNWL 1IBKQ 1NMFA 3OW2A 4POGA 4L5SA 5IP9G 3ULJA 1HNXQ 1YZ6A 4DR2Q 1TWGH 4X62Q 1JJGA 1PH5A 4DR7Q 3DLLA 1B7YB 4TQUS 2E8GA 2Q2HA 4JI2Q 3F2DA 1PH9A 1IBML 1VQKA 1O7IA 1YBYA 3CCQA 3CC4A 2R93H 4A4IA 1UE5A 5GAGC 4LF4Q 1YEZA 1NTGA 4A3LH 2NVXH 4GKJL 1FL0A 3H3VH 5C4XG 4LUVA 3ICEA 4AIMA 3G6EA 4DKAC 3VDYA 4EX5A 1XMOL 1CSPA 1TXYA 1UE6A 5E7NA 3HOYG 2UUAL 1VQOA 2L15A 1Y1VG 5C44H 3CC2A 4K0KL 1Q8KA 4R4CA 3U50C 1HR0L 3E9IA 3E9HA 4A3BH 1YITA 2A1AA 3CMAA 4AYBG 4OX9L 2R92G 3S16H 3U58A 5IYCG 3K7UC 4A3GH 4DUYL 4OO1I 2VQEQ 1CKOA 1J5EQ 3PO3H 2KHIA 3S1RH 3HKZG 3M9BA 3KDFA 3UDFA 4YY3L 4NXML 3HOUH 1HNWQ 2I0QA 3RLOA 3J7ZC 1TWCH 2Z0SA 4DR3L 1PH8A 2BH8A 3BJUA 2UXBL 4X64L 2JA7H 3D0FA 1QVCA 4JI5L 1Q1BA 1IBMQ 1S3OA 4L5RC 4PZ6A 1WCMH 1N36L 2NN6G 1X65A 4A3IG 3M85A 1VQ7A 4GKJQ 1TWFH 1JJCB 1Q7YC 1IBLL 5K36G 2AMCB 4LFCL 4DR5L 4YWLA 1CKNB 4GLAC 3CCMA 4IPHA 4R1JA 3J80i 1S72A 1KC8C 3H15A 5LMUQ 4C2MH 4BY1H 4JI1L 2QGQA 2UUAQ 3KFUA 1X3FA 3A5ZB 3S14H 4OWWB 1MJCA 4DAYB 4K0KQ 2CCZA 1EWIA 3DM3A 2ID0A 3NELA 4IJHA 4JBKA 1HR0Q 2BH2A 2KCMA 2IHEA 1EYGA 3UE1A 4A3DH 4JV5L 1XMQQ 5GADC 3KF6B 4GLVB 5GQOA 4OX9Q 1K8GA 3HOXG 4R4OA 5C0XG 1YI2A 4DUYQ 4B3TL 4UY8C 5M3FG 1WOCA 2WFWA 4XTCS 1J6QA 4YY3Q 3JC66 4NXMQ 2NN6I 4LUZA 2UUBQ 4QL5A 4RMFA 5M5YH 5FLMG 2UXBQ 4OONA 2KENA 2NZOA 4X64Q 2Z6KA 3M7NA 2NZHA 3J81j 1VQPA 1TWHH 4JI5Q 5C4XH 4JI7L 2JE6I 4DV5Q 2VUMG 1EIFA 1AH9A 1YHBA 1IZ6A 1N36Q 3JAMc 3G71A 4DV1L 4A3CG 3FKIG 3PUVA 4O2DA 3HOYH 1IBLQ 5AJ3L 2IX1A 3PUYA 4DR5Q 4LFCQ 2CQOA 3M4PA 4H02A 2K5VA 1Y1VH 1SRUA 1PH2A 2XGTA 2E2IH 2YV5A 3T1YL 3U4ZA 2K50A 4JI1Q 2UXDL 3M4QA 1W2BA 4JI8L 1D7QA 5IYCH 3PIPA 4BBRH 1Y1WG 2OCEA 3STBD 3PUWA 4JI0L 4JV5Q 2R7ZG 1HZBA 3RLFA 1Q12A 4O0AA 3RN5A 3H3VI 1IXRA 3PIOA 1N33L 2VS1A 4KI0A 1U5KA 1JT8A 1VQJA 4DAMA 4GNXB 1C0AA 4B3TQ 2F52A 2JA8G 1X6OA 1OXSC 1KRTA 4DUZQ 3G4SA 3BZKA 1X54A 4JOIA 3HOZG 4QJFA 4A3IH 4X65L 4KHZA 5IYDG 4B3RL 1UE7A 3CAMA 2JA5G 2MQHA 1YHAA 4JOIC 2KHJA 3D31A 3GO5A 3ZJYC 5C3EG 1Q86C 1N8RC 4JI7Q 3I4NG 4DV6L 1PH3A 3A0JA 5DLQE 4DV1Q 1P8LA 2K52A 1VQDA 4P72A 4GOPA 5AJ3Q 1HJPA 5IP7G 4A3EG 1EQRA 4BA1I 1YIJA 2CWAA 2K14A 4GOPC 4DNIA 4A93G 2UUCL 2EXDA 2KBNA 4JBWA 4JI6L 4A75A 2UXCL 5IE8A 1NY4A 4QQBX 3EIVA 2IHFA 2UXDQ 4JI8Q 2DUDA 3HOXH 4B3SQ 4C3JH 5JEAG 1XNQL 3F2BA 2A8VA 5LMNL 2QA4A 1VQNA 3WWVA 3J81i 4JI0Q 3CPWA 4AYBE 5M3FH 3J7A5 1W3SA 1VQBA 1XPOA 1PH1A 1QUQB 4LWCA 4MZ9A 1DGSA 3HKZE 4NPSA 1KL9A 5FLMH 1Q81C 1JMCA 4LF5L 4YCWA 2RCNA 4JI3L 1UEBA 2K5HA 1PFSA 2VUMH 3CCVA 4KHPQ 4LFAL 4A3KG 4GKKQ 4A3CH 3FKIH 4X65Q 5ELNA 2N49A 3CC7A 2ASBA 4B3RQ 1PV4A 3EBEA 5M5XH 3LGJA 3W5OA 4IJLA 1GD7A 1Z47A 2MO0A 3PUXA 1CUKA 1E22A 1RIPA 3OTOL 3HOWG 4XIGS 2KCTA 4HJAA 3K81C 2MO1A 5ELOA 2F4VL 1E1TA 4NXNL 3J80c 4P75A 3AQQA 3RR5A 1FVIA 1PH7A 1D8LA 1K83H 2ZM6L 1Y1WH 2UUCQ 1KXLA 2B63G 2QEXA 2OTJA 2HIXA 2R7ZH 3S1MH 4HIDA 4YWMA 3F8TA 4DV2L 1VS0A 3GTOH 1E24A 1WYDA 3SGIA 3KF8B 4DV4L 1XNQQ 1EIYB 5LMNQ 1I50H 5HY6A 1HZAA 3RNUA 2B3GA 2IX0A 2JA8H 3W1BA 4BA2I 2Q2TA 2MFIA 2AWNA 1M1KC 4IOCA 3HOZH 1Q82C 2YU9H 3U4VA 1N9WA 3A74A 4X66L 1I3QH 5C0XJ 1X56A 4DV0L 3CD6A 4LF5Q 1XMOQ 3I4MG 1YJNA 2JA5H 4JI3Q 2GN5A 4YCUA 1L0WA 5C3EH 3I4NH 4IPDA 4LFAQ 1A62A 1A63A 2ES2A 2MNAA 2ZTCA 1QZGA 1SROA 3S2HH 3I2ZA 1SR3A 4DV7L 2ZJQA 1L1OB 2I5HA 5IP7H 4LF8L 4GNXA 1N34L 4BY7G 2ZJRA 4A93H 5BR8L 2OQ0A 1GVPA 1B8AA 1KQSA 4R4TA 5IP9H 5GAEC 4GNXC 3KOJA 1QZHA 3CCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN Q;  2UU9 L;  3NEN A;  2BA1 A;  2ZM6 Q;  1HR0 W;  1FJG L;  1G51 A;  2N78 A;  4NB3 A;  1SFO H;  4YCV A;  4DR3 Q;  1OXT A;  1SE8 A;  3EN2 A;  4HJ5 A;  4DV2 Q;  3PCO B;  4GN4 B;  2D62 A;  3L7Z C;  2OWO A;  2JA6 G;  2NVT H;  1JJ2 A;  4DV4 Q;  2JJQ A;  2AWO A;  4AQY L;  1KAW A;  1KRS A;  1MIU A;  3RZD H;  4LF6 L;  1U0L A;  5HGQ A;  4HIM A;  1GM5 A;  1UWV A;  4IPC A;  1C7Y A;  4FDB A;  4JBJ A;  1I94 L;  1IYJ B;  4Y7N H;  1VQ9 A;  3AFQ A;  5JJI A;  1G29 1;  1VQH A;  5IYB G;  3UDG A;  4A3K H;  4X66 Q;  4DV0 Q;  2F3I A;  4LF9 L;  3CQZ H;  2C35 B;  4QY7 A;  4APV A;  4A76 A;  2H5X A;  1AE3 A;  2K75 A;  3KJP A;  2R92 H;  5C0X I;  2HHH L;  4QGU A;  1OXX K;  4DV7 Q;  3HOW H;  2LXK A;  3S17 H;  4YWK A;  4JI4 L;  4LF8 Q;  2VNU D;  1QUQ A;  2I5L X;  4DPG A;  1GO3 E;  3AYH B;  4UPA A;  1N34 Q;  3S1Q H;  3CXC A;  5BR8 Q;  1N32 L;  1HZC A;  3ER0 A;  2B63 H;  3GTM H;  2B29 A;  3K7A H;  1Q1E A;  3CW2 C;  1Z9F A;  1BBU A;  3PO2 G;  4A3M G;  4X6A H;  2E5L L;  2UU9 Q;  1YJ9 A;  4GN5 A;  3ULL A;  1VQI A;  3MEF A;  4DK6 C;  1FJG Q;  3CPF A;  1OXV A;  2LSS A;  1YVC A;  2FXQ A;  3HKS A;  1YHQ A;  1HNX L;  3HOV G;  3H0G G;  1KIX A;  1A0I A;  1WJJ A;  4X62 L;  3J81 c;  2HT1 A;  1RL2 A;  4AQY Q;  2RF4 A;  2ZTE A;  5JEA J;  1QVG A;  4LF6 Q;  4JI2 L;  3M4O H;  1B70 B;  1L2F A;  5H1S E;  4YHH L;  3RN2 A;  3I4M H;  1CKM A;  4BBS G;  4BXX G;  2XTI A;  4MNO A;  1I94 Q;  5IY0 A;  3AFP A;  4LW1 A;  1MJE A;  1EFW A;  1LUZ A;  1K0R A;  4GLX A;  1HNZ L;  5JJK A;  1VQ4 A;  2ATW A;  2R7F A;  4LF9 Q;  3T1Y Q;  2YTY A;  1X3E A;  4HIK A;  1E1O A;  1NJI C;  3B6Y A;  4BY7 H;  1CSQ A;  2IY5 B;  4ALP A;  1NMG A;  4HJ7 A;  3TS2 A;  4JI4 Q;  2HQL A;  3GTK H;  1CKN A;  2LXJ A;  1JE5 A;  1N33 Q;  2HIV A;  1A8V A;  2K5N A;  1V9P A;  1IL2 A;  2VY3 A;  3K0X A;  1HH2 P;  4KLK A;  5IWA L;  1N32 Q;  4WJ4 A;  4R4Q A;  2EQS A;  4DK3 C;  1X9N A;  2E2H H;  2E5L Q;  2R7D A;  4DR4 L;  4DR6 L;  1XJV A;  4A3J G;  1L1O A;  1FGU A;  1YJW A;  4PG3 A;  1K3R A;  1M90 C;  4HIO A;  3KF6 A;  5FLX c;  4JCV E;  4OO1 G;  4GN3 B;  3GTG H;  4IFD G;  1L1O C;  1KHI A;  5IYB H;  4DV6 Q;  3S1N H;  3K80 C;  3CF5 A;  4IOA A;  4YHH Q;  1ASY A;  2YTX A;  2WB1 G;  2PQA B;  1TWA H;  5FJ8 G;  3UDI A;  2JQO A;  3I7F A;  4QIW E;  3S24 A;  1KD1 C;  1HNZ Q;  2DGY A;  1I5F A;  2VW9 A;  3RZO H;  4JYA L;  1OXU A;  2RHS B;  2EIF A;  2PI2 A;  5LMU L;  4JI6 Q;  1VQL A;  2UXC Q;  2V1C C;  1WI5 A;  5M3M G;  4EQ5 A;  1WFQ A;  4UP7 A;  1V1Q A;  3KYH C;  3PGZ A;  4WJ3 M;  2VQF L;  2GVB A;  3PO2 H;  4A3M H;  1XMQ L;  4Y52 H;  3K8A A;  3TEH B;  1MKH A;  1R9T H;  5IWA Q;  4DR1 L;  3PF4 A;  4BBR G;  1BVS A;  3HOV H;  4ME3 A;  5J3B A;  3H0G H;  4IFD I;  5IYD H;  4LNQ A;  4DR4 Q;  4GOP B;  3I56 A;  2NVQ H;  2Q2I A;  1XTD A;  5LMN W;  2VL6 A;  4DR6 Q;  4R4I A;  1PA6 A;  4UP8 A;  3UDX A;  4PZ7 A;  2JA9 A;  2UUB L;  2GVA A;  3S2D H;  3ERS X;  4BBS H;  4BXX H;  3L0O A;  3CCR A;  1BKB A;  1VQC A;  1E3P A;  4A3E H;  4RG1 A;  4P73 A;  1VQF A;  4DV5 L;  2N3S A;  4PZ8 A;  2D0P A;  1VQ5 A;  5GRO A;  3OTO Q;  3E0E A;  1OTC A;  3GTJ H;  4DV3 L;  2ZJP A;  1X3G A;  2NVY H;  2PI2 E;  4IPG A;  2F4V Q;  1K8A C;  1S40 A;  4A3F G;  4LUO A;  4UP9 A;  2JK8 A;  4JYA Q;  4J15 A;  5C4J H;  1K73 C;  3GDE A;  3TS0 A;  1PH4 A;  3M3Y H;  4L5Q A;  3ULP A;  1Q46 A;  3TRE A;  3GD7 A;  4C3H H;  1XNR L;  2N8N A;  1LYL A;  1YNX A;  3BZC A;  2CFM A;  1PHJ A;  4GS3 A;  1C9O A;  2YTV A;  1E7Z A;  2VQF Q;  1XPR A;  2R6G A;  2CWP A;  1AE2 A;  2I5M X;  2PMZ E;  2ALY B;  4DR1 Q;  4A3J H;  4LF7 L;  1VQ6 A;  3CCE A;  3GTP H;  2A19 A;  2R93 G;  2BA0 A;  3IRB A;  3PUZ A;  4DUZ L;  4A3L G;  1EQQ A;  3STB C;  1P16 A;  2Y0S E;  2VZA A;  3Q8D A;  4LFB L;  2D0O A;  1I6H H;  2CKZ B;  3F1Z A;  3PF5 A;  2JEA I;  1H95 A;  3UE0 A;  3CCU A;  3KDF B;  3GTL H;  2AHO B;  1LM0 A;  5GAH C;  1PH6 A;  3CP0 A;  5FJ8 H;  1HZ9 A;  4HJ8 A;  3I55 A;  2PNH A;  1GKH A;  3KJO A;  3CCJ A;  1ASZ A;  2Z6K C;  3HFZ B;  4C3I H;  1NBW A;  4OWT B;  4TVA B;  5C44 G;  1JB7 A;  3AEV A;  3I4O A;  1EUJ A;  4B3M L;  3S15 H;  5IT9 c;  3W1G A;  4DV3 Q;  3GTQ H;  5JJL A;  2OTL A;  5M3M H;  1T9H A;  4L5T A;  1V43 A;  4HJ9 A;  4A3B G;  1PVO A;  3T1H L;  1VQG A;  3FP9 A;  1IBK L;  1Y14 B;  2K4K A;  4JG2 A;  1LTL A;  3TRZ A;  2Y0S G;  4A3G G;  1EOV A;  1SN8 A;  3NEM A;  3CME A;  3TQY A;  4AH6 A;  4P71 A;  4DR2 L;  4JBM A;  1XNR Q;  3PO3 G;  4DR7 L;  3L2P A;  4B3S L;  4OWX B;  1G6P A;  4OXP A;  1VCI A;  1NE3 A;  2IT1 A;  2PQA A;  5EAY A;  3HOU G;  2ZTD A;  3MXN B;  4JC0 A;  1VQM A;  1K9M C;  3JAM i;  4LF4 L;  5M5W H;  2JA7 G;  2Q2U A;  4LF7 Q;  3RLN A;  1XPU A;  1PYS B;  1PYB A;  2E2J H;  4P74 A;  1QVF A;  1WCM G;  3G48 A;  4PMW A;  3F2C A;  3PV0 A;  2WAQ E;  1SMX A;  1VQE A;  4LFB Q;  3CCL A;  4KHP L;  2HHH Q;  2JEB I;  3KLW A;  4GKK L;  3NBH B;  2RHQ B;  2YYZ A;  3A5U A;  4MTN A;  4BY1 G;  4IFD J;  2WP8 J;  4A3F H;  3FHW A;  1X55 A;  1VQ8 A;  2OQK A;  1SLJ A;  2WB1 E;  3BU2 A;  2AKW B;  1VQA A;  3OYY A;  4B3M Q;  3PSI A;  4POF A;  4A3D G;  2VQE L;  4IO9 A;  1J5E L;  2JA6 H;  1UE1 A;  1BBW A;  3T1H Q;  2WAQ G;  1HNW L;  1IBK Q;  1NMF A;  3OW2 A;  4POG A;  4L5S A;  5IP9 G;  3ULJ A;  1HNX Q;  1YZ6 A;  4DR2 Q;  1TWG H;  4X62 Q;  1JJG A;  1PH5 A;  4DR7 Q;  3DLL A;  1B7Y B;  4TQU S;  2E8G A;  2Q2H A;  4JI2 Q;  3F2D A;  1PH9 A;  1IBM L;  1VQK A;  1O7I A;  1YBY A;  3CCQ A;  3CC4 A;  2R93 H;  4A4I A;  1UE5 A;  5GAG C;  4LF4 Q;  1YEZ A;  1NTG A;  4A3L H;  2NVX H;  4GKJ L;  1FL0 A;  3H3V H;  5C4X G;  4LUV A;  3ICE A;  4AIM A;  3G6E A;  4DKA C;  3VDY A;  4EX5 A;  1XMO L;  1CSP A;  1TXY A;  1UE6 A;  5E7N A;  3HOY G;  2UUA L;  1VQO A;  2L15 A;  1Y1V G;  5C44 H;  3CC2 A;  4K0K L;  1Q8K A;  4R4C A;  3U50 C;  1HR0 L;  3E9I A;  3E9H A;  4A3B H;  1YIT A;  2A1A A;  3CMA A;  4AYB G;  4OX9 L;  2R92 G;  3S16 H;  3U58 A;  5IYC G;  3K7U C;  4A3G H;  4DUY L;  4OO1 I;  2VQE Q;  1CKO A;  1J5E Q;  3PO3 H;  2KHI A;  3S1R H;  3HKZ G;  3M9B A;  3KDF A;  3UDF A;  4YY3 L;  4NXM L;  3HOU H;  1HNW Q;  2I0Q A;  3RLO A;  3J7Z C;  1TWC H;  2Z0S A;  4DR3 L;  1PH8 A;  2BH8 A;  3BJU A;  2UXB L;  4X64 L;  2JA7 H;  3D0F A;  1QVC A;  4JI5 L;  1Q1B A;  1IBM Q;  1S3O A;  4L5R C;  4PZ6 A;  1WCM H;  1N36 L;  2NN6 G;  1X65 A;  4A3I G;  3M85 A;  1VQ7 A;  4GKJ Q;  1TWF H;  1JJC B;  1Q7Y C;  1IBL L;  5K36 G;  2AMC B;  4LFC L;  4DR5 L;  4YWL A;  1CKN B;  4GLA C;  3CCM A;  4IPH A;  4R1J A;  3J80 i;  1S72 A;  1KC8 C;  3H15 A;  5LMU Q;  4C2M H;  4BY1 H;  4JI1 L;  2QGQ A;  2UUA Q;  3KFU A;  1X3F A;  3A5Z B;  3S14 H;  4OWW B;  1MJC A;  4DAY B;  4K0K Q;  2CCZ A;  1EWI A;  3DM3 A;  2ID0 A;  3NEL A;  4IJH A;  4JBK A;  1HR0 Q;  2BH2 A;  2KCM A;  2IHE A;  1EYG A;  3UE1 A;  4A3D H;  4JV5 L;  1XMQ Q;  5GAD C;  3KF6 B;  4GLV B;  5GQO A;  4OX9 Q;  1K8G A;  3HOX G;  4R4O A;  5C0X G;  1YI2 A;  4DUY Q;  4B3T L;  4UY8 C;  5M3F G;  1WOC A;  2WFW A;  4XTC S;  1J6Q A;  4YY3 Q;  3JC6 6;  4NXM Q;  2NN6 I;  4LUZ A;  2UUB Q;  4QL5 A;  4RMF A;  5M5Y H;  5FLM G;  2UXB Q;  4OON A;  2KEN A;  2NZO A;  4X64 Q;  2Z6K A;  3M7N A;  2NZH A;  3J81 j;  1VQP A;  1TWH H;  4JI5 Q;  5C4X H;  4JI7 L;  2JE6 I;  4DV5 Q;  2VUM G;  1EIF A;  1AH9 A;  1YHB A;  1IZ6 A;  1N36 Q;  3JAM c;  3G71 A;  4DV1 L;  4A3C G;  3FKI G;  3PUV A;  4O2D A;  3HOY H;  1IBL Q;  5AJ3 L;  2IX1 A;  3PUY A;  4DR5 Q;  4LFC Q;  2CQO A;  3M4P A;  4H02 A;  2K5V A;  1Y1V H;  1SRU A;  1PH2 A;  2XGT A;  2E2I H;  2YV5 A;  3T1Y L;  3U4Z A;  2K50 A;  4JI1 Q;  2UXD L;  3M4Q A;  1W2B A;  4JI8 L;  1D7Q A;  5IYC H;  3PIP A;  4BBR H;  1Y1W G;  2OCE A;  3STB D;  3PUW A;  4JI0 L;  4JV5 Q;  2R7Z G;  1HZB A;  3RLF A;  1Q12 A;  4O0A A;  3RN5 A;  3H3V I;  1IXR A;  3PIO A;  1N33 L;  2VS1 A;  4KI0 A;  1U5K A;  1JT8 A;  1VQJ A;  4DAM A;  4GNX B;  1C0A A;  4B3T Q;  2F52 A;  2JA8 G;  1X6O A;  1OXS C;  1KRT A;  4DUZ Q;  3G4S A;  3BZK A;  1X54 A;  4JOI A;  3HOZ G;  4QJF A;  4A3I H;  4X65 L;  4KHZ A;  5IYD G;  4B3R L;  1UE7 A;  3CAM A;  2JA5 G;  2MQH A;  1YHA A;  4JOI C;  2KHJ A;  3D31 A;  3GO5 A;  3ZJY C;  5C3E G;  1Q86 C;  1N8R C;  4JI7 Q;  3I4N G;  4DV6 L;  1PH3 A;  3A0J A;  5DLQ E;  4DV1 Q;  1P8L A;  2K52 A;  1VQD A;  4P72 A;  4GOP A;  5AJ3 Q;  1HJP A;  5IP7 G;  4A3E G;  1EQR A;  4BA1 I;  1YIJ A;  2CWA A;  2K14 A;  4GOP C;  4DNI A;  4A93 G;  2UUC L;  2EXD A;  2KBN A;  4JBW A;  4JI6 L;  4A75 A;  2UXC L;  5IE8 A;  1NY4 A;  4QQB X;  3EIV A;  2IHF A;  2UXD Q;  4JI8 Q;  2DUD A;  3HOX H;  4B3S Q;  4C3J H;  5JEA G;  1XNQ L;  3F2B A;  2A8V A;  5LMN L;  2QA4 A;  1VQN A;  3WWV A;  3J81 i;  4JI0 Q;  3CPW A;  4AYB E;  5M3F H;  3J7A 5;  1W3S A;  1VQB A;  1XPO A;  1PH1 A;  1QUQ B;  4LWC A;  4MZ9 A;  1DGS A;  3HKZ E;  4NPS A;  1KL9 A;  5FLM H;  1Q81 C;  1JMC A;  4LF5 L;  4YCW A;  2RCN A;  4JI3 L;  1UEB A;  2K5H A;  1PFS A;  2VUM H;  3CCV A;  4KHP Q;  4LFA L;  4A3K G;  4GKK Q;  4A3C H;  3FKI H;  4X65 Q;  5ELN A;  2N49 A;  3CC7 A;  2ASB A;  4B3R Q;  1PV4 A;  3EBE A;  5M5X H;  3LGJ A;  3W5O A;  4IJL A;  1GD7 A;  1Z47 A;  2MO0 A;  3PUX A;  1CUK A;  1E22 A;  1RIP A;  3OTO L;  3HOW G;  4XIG S;  2KCT A;  4HJA A;  3K81 C;  2MO1 A;  5ELO A;  2F4V L;  1E1T A;  4NXN L;  3J80 c;  4P75 A;  3AQQ A;  3RR5 A;  1FVI A;  1PH7 A;  1D8L A;  1K83 H;  2ZM6 L;  1Y1W H;  2UUC Q;  1KXL A;  2B63 G;  2QEX A;  2OTJ A;  2HIX A;  2R7Z H;  3S1M H;  4HID A;  4YWM A;  3F8T A;  4DV2 L;  1VS0 A;  3GTO H;  1E24 A;  1WYD A;  3SGI A;  3KF8 B;  4DV4 L;  1XNQ Q;  1EIY B;  5LMN Q;  1I50 H;  5HY6 A;  1HZA A;  3RNU A;  2B3G A;  2IX0 A;  2JA8 H;  3W1B A;  4BA2 I;  2Q2T A;  2MFI A;  2AWN A;  1M1K C;  4IOC A;  3HOZ H;  1Q82 C;  2YU9 H;  3U4V A;  1N9W A;  3A74 A;  4X66 L;  1I3Q H;  5C0X J;  1X56 A;  4DV0 L;  3CD6 A;  4LF5 Q;  1XMO Q;  3I4M G;  1YJN A;  2JA5 H;  4JI3 Q;  2GN5 A;  4YCU A;  1L0W A;  5C3E H;  3I4N H;  4IPD A;  4LFA Q;  1A62 A;  1A63 A;  2ES2 A;  2MNA A;  2ZTC A;  1QZG A;  1SRO A;  3S2H H;  3I2Z A;  1SR3 A;  4DV7 L;  2ZJQ A;  1L1O B;  2I5H A;  5IP7 H;  4LF8 L;  4GNX A;  1N34 L;  4BY7 G;  2ZJR A;  4A93 H;  5BR8 L;  2OQ0 A;  1GVP A;  1B8A A;  1KQS A;  4R4T A;  5IP9 H;  5GAE C;  4GNX C;  3KOJ A;  1QZH A;  3CCS A; 
#chains in the Genus database with same CATH topology
 5LL6 X;  3NEN A;  3NBH A;  2N78 A;  4K2K A;  4F87 A;  1OXT A;  1DD2 A;  1F2Z A;  4GN4 B;  1FD7 D;  2D62 A;  2OWO A;  1CI3 M;  3FVQ A;  4O42 A;  1F2Y A;  2AUK A;  5FO7 B;  4ZLT F;  5EBD A;  1KAW A;  4EGV A;  5HGQ A;  3MVV A;  4IPC A;  1C7Y A;  2B39 A;  5JJI A;  5IYB G;  4A3K H;  3UDG A;  1TII D;  4DV0 Q;  1RD9 D;  1KDA A;  4U68 A;  1ZKO A;  2K75 A;  2EJG C;  4V0B A;  5C0X I;  3Q22 A;  4QGU A;  1E2W A;  4LF8 Q;  1GO3 E;  5BR8 Q;  1IL8 A;  3ER0 A;  4HAE A;  2PPB C;  3K7A H;  1Z9F A;  2B2U A;  2XN9 C;  3PO2 G;  1A2T A;  3HOU B;  2UU9 Q;  4KTA A;  4DK6 C;  1LTI D;  1YNJ D;  3CPF A;  2JA7 B;  1SXT A;  2A6H C;  1WJJ A;  1RL2 A;  2ZTE A;  3T53 B;  1QVG A;  4LF6 Q;  1JWM D;  2XNA C;  5NUC A;  4YHH L;  3I4M H;  1CKM A;  2BE5 D;  3AFP A;  3CU7 A;  5ISR A;  5CBE E;  1LUZ A;  1K0R A;  4MN3 A;  5JJK A;  5CV7 A;  3ONA B;  1X3E A;  3KF8 A;  2A6E D;  4ODG A;  3B6Y A;  1OO9 B;  4BY7 H;  2IY5 B;  3KBX A;  4PMC A;  4JI4 Q;  3CHB D;  4C3H G;  4N9T A;  2HIV A;  4ZKC B;  1N32 Q;  1SYC A;  4R4Q A;  1RJT A;  4DR4 L;  4DAY A;  1LTB D;  3BS1 A;  4A3J G;  3OIQ A;  1K3R A;  3TBI B;  4HIO A;  3KF6 A;  2BDN A;  2MP1 A;  2K01 A;  4CDD C;  2B2W A;  3S1N H;  2QF7 A;  2EY1 A;  4QUF A;  2PQA B;  4GZY C;  4TKO B;  3UDI A;  4QIW E;  1I5F A;  3J7A V;  1OXU A;  2PI2 A;  4JI6 Q;  4IUR A;  5A2Q L;  1SEB D;  4BBR B;  1V1Q A;  4OIJ A;  3PGZ A;  4WJ3 M;  3AB9 A;  4JVZ A;  1SE4 A;  1NNX A;  4A3M H;  4Y52 H;  3K8A A;  1U4P A;  5DEH A;  5IWA Q;  4DR1 L;  3C46 A;  1BVS A;  3HOV H;  1CT1 D;  3H0G H;  4GOP B;  5LMN W;  2VL6 A;  3ITP A;  4BWG B;  1PA6 A;  3SHL A;  2JA9 A;  2UUB L;  4C56 C;  3S2D H;  2XVS A;  2V4D A;  3ERS X;  4DNR B;  4BBS H;  1LT3 D;  4A3E H;  2N3S A;  4CKB A;  3D6W A;  2RDG A;  1BXT A;  4HCS A;  4NW2 A;  1GJX A;  5CYU A;  1EZ6 A;  1X3G A;  2PI2 E;  3TSS A;  3JAM E;  1S40 A;  2OEO A;  4UP9 A;  1W6J A;  1U4L A;  5CC4 A;  3GV3 A;  1A15 A;  1PH4 A;  5DNF A;  3TRE A;  2N8N A;  3LWU A;  3LX0 A;  1YNX A;  1JE4 A;  1JOQ A;  3R8B A;  3QJY A;  4NP5 A;  2YTV A;  1XPR A;  4FXK C;  2M2L A;  4GNX C;  4LF7 L;  4QCL A;  1MI2 A;  1T5X D;  1CFM A;  4A3L G;  1EQQ A;  1P16 A;  1QE6 A;  4EVO A;  1ICW A;  2JEA I;  5JJZ A;  1S5B D;  1QJO A;  4CDF C;  4M8A A;  4C1N K;  1GKH A;  4KJN A;  3HFZ B;  2MGS A;  4MHE A;  3W1G A;  3GTQ H;  5KRU A;  5M3M H;  3SK6 A;  4A3B G;  1PVO A;  1SNQ A;  3H6M A;  1SNM A;  3WOF A;  2EJF C;  4JG2 A;  1EWC A;  3G6J B;  3RUZ A;  4A3G G;  1SN8 A;  5KNB A;  3PO3 G;  4AH6 A;  4P71 A;  1I50 B;  2F0P A;  4B3S L;  1VCI A;  2IT1 A;  2F0K A;  4DF7 A;  3BG3 A;  3MXN B;  1K9M C;  3JAM i;  1BBX C;  5M5W H;  1QB5 D;  1SBB B;  2Q2U A;  1PTO D;  2KQ3 A;  3RLN A;  1RCV D;  5CV8 A;  3G48 A;  1EYA A;  1I4R A;  3IL8 A;  4BS9 A;  4LFB Q;  1DON A;  4KHP L;  4GKK L;  4BY1 G;  2SEB D;  4A3F H;  2EZV A;  3FHW A;  1X55 A;  3X3M A;  1VQ8 A;  1SLJ A;  1JWS D;  2AKW B;  5KEE A;  2RVL A;  3K5M A;  1XXG A;  3PSI A;  3KLS A;  2VQE L;  4IO9 A;  5KIX A;  1SFO B;  1Y8N B;  1U4R A;  2NVT B;  1WTV A;  1IBK Q;  5IP9 G;  3ULJ A;  2PW7 A;  4DR2 Q;  4ME5 A;  3RZD B;  1PRT D;  4TQU S;  2Q2H A;  1VQK A;  2PZT A;  1NTG A;  4GKJ L;  3H3V H;  1I4X A;  4LUV A;  4AIM A;  4DKA C;  4EX5 A;  1CSP A;  1UE6 A;  3HOY G;  2R92 B;  5JOB A;  2UUA L;  2LY7 A;  2EXZ A;  3CC2 A;  2F4I A;  1HR0 L;  2AUJ D;  5IOD A;  3E9H A;  5EJW A;  3GTM B;  4AYB G;  1NSN S;  3E0J A;  3VR2 A;  1ILP A;  2IX3 A;  1CKO A;  3P20 A;  2O4X A;  2KHI A;  3MC0 B;  2ZXO A;  3HKZ G;  3M9B A;  2CQA A;  3KDF A;  3HOU H;  1C8C A;  2JA7 H;  3M4O B;  2TSS A;  4H0L C;  2BCO A;  2DN8 A;  3OHX C;  2KOL A;  2F1M A;  4CGY B;  3URY A;  4A3I G;  1X65 A;  1B1Z A;  3I3C A;  4UDU C;  3M85 A;  1VQ7 A;  5ELC A;  3VR5 A;  2IJ0 A;  1LO5 D;  2DNE A;  5G3L F;  2O2L D;  2VB3 X;  4KMU C;  4JI1 L;  1X3F A;  4OWW B;  1H9S B;  4IJH A;  2ID0 A;  4JBK A;  2BH2 A;  1EYG A;  4GLV B;  4OX9 Q;  4C3J G;  5C0X G;  1PYW D;  4K5X A;  2E2H B;  1Y8P B;  4DUY Q;  4G7Z C;  4PMB A;  1WOC A;  2WFW A;  2PQE A;  4NXM Q;  3JC6 6;  2NN6 I;  4LUZ A;  2UUB Q;  2UXB Q;  3GTG B;  5FLM G;  2NZO A;  4X64 Q;  2EDG A;  2JE6 I;  1YHB A;  1N36 Q;  1ONL A;  3G71 A;  3WOE A;  3FKI G;  2L55 A;  3PUV A;  2EYM A;  3KK7 A;  4LFC Q;  2CQO A;  4H02 A;  3RZO B;  1S5F D;  1Y1V H;  1PH2 A;  4KHV A;  1R4P B;  3DWA A;  1QOH A;  4K5V A;  3ND9 A;  5HUR A;  3M4Q A;  4JI8 L;  1D7Q A;  3TZU A;  5IYC H;  3PO2 B;  4BBR H;  2OCE A;  4JV5 Q;  3PUW A;  5COR A;  2R7Z G;  1A3T A;  1R9T B;  2CW0 D;  1Q12 A;  3PIO A;  4Z9C B;  1VQJ A;  1C0A A;  3W2D A;  2EE1 A;  1EY6 A;  1X6O A;  1OXS C;  5HGT A;  3QIA A;  1X54 A;  4RHR A;  1KNE A;  4G7O C;  1EEF D;  1JR0 D;  4B3R L;  1F2M A;  5EQ0 A;  1YHA A;  2KHJ A;  3D31 A;  5C3E G;  4RAU C;  4JI7 Q;  3I4N G;  3ERQ A;  1PH3 A;  3A0J A;  1HRJ A;  1EYC A;  4XXE A;  4P72 A;  4GOP A;  1HJP A;  4BA1 I;  1CK1 A;  1PDQ A;  2CWA A;  5C4J B;  4CJ0 B;  3E3X A;  1IKM A;  4IQZ A;  5E1F A;  5ELD A;  5IE8 A;  2WII B;  3EIV A;  2UXD Q;  4NDX A;  4B3S Q;  1SNP A;  2KA7 A;  2ZT9 C;  1PTO B;  1H9J A;  1EZ8 A;  4A3J B;  1SJE D;  1W3S A;  3OIP A;  1PH1 A;  4LWC A;  3NTI A;  1KL9 A;  4YCW A;  1UEB A;  2K5H A;  3I70 A;  1Z7T A;  3CCV A;  4KHP Q;  3GTL B;  4GKK Q;  2QCP X;  1QG7 A;  5ELN A;  3SK4 A;  2XRS D;  1PV4 A;  1KLG D;  1B9M A;  1STE A;  3K58 A;  3NWT A;  2MO0 A;  3K0Y A;  2F0E A;  3DUZ A;  1E22 A;  3VYR A;  4DFA A;  3HOW G;  4XIG S;  1K3B C;  2MO1 A;  2F3V A;  5ELO A;  5I9P A;  2ENB A;  1E1T A;  1LTT D;  2F4V L;  3A56 A;  1PRT B;  3AQQ A;  3RR5 A;  1FVI A;  2KCC A;  2LFN A;  3SK5 A;  2HIX A;  5EPJ A;  1E24 A;  5CBA E;  3SGI A;  3KF8 B;  4ZCK A;  1I50 H;  4QIW B;  4DA2 A;  1X3P A;  4XQN A;  1BR9 A;  2IX0 A;  3LNN A;  1BCP D;  2Q2T A;  1AZQ A;  3X3N A;  2L4N A;  3K6O A;  1Q82 C;  5C4Z A;  3CD6 A;  3A74 A;  1S5D D;  4MTK A;  4DV0 L;  3HZX A;  4DN4 M;  4LFA Q;  3MXN A;  1ET6 A;  2MNA A;  1STA A;  2ZJQ A;  2MJ8 A;  4LF8 L;  2ZJR A;  5BR8 L;  1B8A A;  1KQS A;  4R4T A;  3KOJ A;  1FNW A;  4GLX A;  3CCS A;  1WTH A;  5E4W C;  2UU9 L;  5JEA H;  2EYP A;  1HR0 W;  4L8J A;  1SFO H;  1TWG B;  1X3Q A;  4YCV A;  3K5L A;  3PCO B;  2NVT H;  3L7Z C;  5JVG 3;  2JA6 G;  1KRS A;  3RZD H;  2B2T A;  4LF6 L;  4HIM A;  1GM5 A;  3D4R A;  4HCE A;  1EIG A;  3SXH A;  1VQ9 A;  1Q3L A;  1VQH A;  1EL0 A;  2EYO A;  5C3W A;  3MZ5 A;  2R92 H;  4FF4 A;  2HHH L;  4DV7 Q;  2LXK A;  4A3B B;  3QOL A;  4JI4 L;  2VNU D;  2HCI A;  2I5L X;  1FNU A;  3AYH B;  1G2T A;  3CXC A;  4A3G B;  4DU9 A;  3PO3 B;  3GTM H;  1N32 L;  3S1R B;  1PXU A;  1YJ9 A;  5J1Z A;  3MEF A;  1FJG Q;  1OXV A;  2LSS A;  1YHQ A;  3HKS A;  4CKE A;  1HNX L;  2N88 A;  2DY7 A;  4X62 L;  3J81 c;  3M4O H;  1QWY A;  3IFT A;  5H1S E;  1GUT A;  1ZEQ X;  2CH4 A;  1DJR D;  1GUO A;  5M9O A;  4C2M B;  4BY1 B;  4HIK A;  1BOS A;  1ENF A;  1CSQ A;  1CHQ D;  4OEL B;  1NMG A;  4HSP A;  1ESR A;  3GTK H;  4DAV A;  1JE5 A;  2XSC A;  3D6C A;  3UI2 A;  3K0X A;  5IWA L;  3EVQ A;  2EQS A;  2XIW A;  3T51 B;  2E2H H;  2E5L Q;  2R7D A;  2EYL A;  5EPK A;  1FGU A;  1YJW A;  3LWE A;  1TWH B;  1M90 C;  4GN3 B;  3GTG H;  4IFD G;  4S3S A;  1L1O C;  5E4X A;  5IYB H;  4MIU A;  3K80 C;  3HOY B;  2K04 A;  4EQP A;  2RKS A;  2D2C C;  1KD1 C;  3S24 A;  1HNZ Q;  2DGY A;  1EYD A;  1SYF A;  3RZO H;  1GUN A;  2RHS B;  4AYB B;  3SE0 A;  1VQL A;  4UHV A;  1TS3 A;  1WI5 A;  4EQ5 A;  1WFQ A;  4PV1 C;  1EWH A;  1II3 A;  1E0B A;  3PO2 H;  4G7H C;  1XMQ L;  3H3V C;  1PRT F;  1PZK D;  3I90 A;  1R9T H;  4RHS A;  1EEI D;  1C4Q A;  3QO2 A;  3D3R A;  4IUU A;  5IYD H;  4LNQ A;  2Q2I A;  1XTD A;  2I07 B;  4R4I A;  4A3I B;  5LL6 S;  2RDF A;  2A73 B;  4PZ7 A;  3E6Z X;  1SYG A;  3OOC A;  3L0O A;  2AQ2 B;  1VQF A;  1KAA A;  3FMC A;  5GRO A;  2EY5 A;  2K28 A;  3E0E A;  3NE5 B;  1HQR D;  4IPG A;  2F4V Q;  1K8A C;  2SNM A;  1NUC A;  4LUO A;  3HGB A;  4IZ8 A;  4JYA Q;  4J15 A;  5C4J H;  4K6L A;  3AMU A;  3TS0 A;  3PIO 3;  1Q46 A;  1VF5 C;  2FFK B;  3GD7 A;  4PNY A;  4C3H H;  4C3J B;  1BCP B;  5D3D A;  1FYC A;  1ENA A;  1C9O A;  2VQF Q;  4KY6 A;  1PTO H;  2R6G A;  2O5I C;  3SDZ A;  4A3J H;  4N8X 1;  3CCE A;  1IW7 C;  2R93 G;  4DUZ L;  3STB C;  3Q8D A;  4LFB L;  2D0O A;  3OPO A;  4FNF A;  3F1Z A;  3PF5 A;  5M5X B;  2H4O A;  1AFP A;  3KDF B;  3GTL H;  2AHO B;  5GAH C;  3CP0 A;  4HJ8 A;  2PNH A;  2QEJ C;  4OWT B;  1JB7 A;  3WDN A;  2KHS A;  3J81 E;  5JJL A;  1X32 A;  1K83 B;  1VDZ A;  4RA8 A;  1M4V A;  3VR3 A;  2R7Z B;  3I91 A;  3P1H A;  1DOM A;  1IBK L;  1GUS A;  1LTL A;  3TRZ A;  4FF1 A;  4HN7 A;  4DR2 L;  3TQY A;  4JBM A;  1KTK A;  1XNR Q;  4OXP A;  1NE3 A;  5A2Q E;  3HRZ C;  1VQM A;  3TN2 A;  1ROD A;  1I3Q B;  1QVF A;  4P74 A;  4ZQ3 A;  2K5W A;  1KAB A;  2SDF A;  5C3E B;  3I4N B;  2Q8I B;  4IAL A;  3R2I A;  2WAQ E;  3MEH A;  1MHW C;  3CCL A;  2HHH Q;  3KLW A;  4DGZ A;  2F0O A;  1WD0 A;  3A54 A;  2YYZ A;  1PZJ D;  5JPM C;  4MTN A;  2OF1 A;  1HFG A;  2MHV A;  1TS4 A;  2Q8R E;  2OQK A;  3BU2 A;  1VQA A;  3N52 A;  3NSW A;  2EYJ A;  4A3D G;  1BBW A;  2WAQ G;  3OW2 A;  1HNX Q;  1STY A;  2HCC A;  1TWG H;  4X62 Q;  2E2D C;  2PNR C;  1JJG A;  4DR7 Q;  3J81 L;  2F03 A;  3K57 A;  1B7Y B;  2B2V A;  3F2D A;  2G9D A;  2K05 A;  3CCQ A;  4A4I A;  4Y7N B;  4A3L H;  4FVM A;  1Y1V B;  1FL0 A;  2BDO A;  5C4X G;  2Q8T A;  1LTA D;  3G6E A;  3VDY A;  1HTP A;  1VQO A;  5I6W A;  3HOW B;  4KKU A;  5FO8 B;  3E9I A;  3S1Q B;  3BYT B;  3VA7 A;  4A3B H;  2A1A A;  4UAI A;  4KK7 A;  4OX9 L;  3HG9 A;  1B53 A;  3DWP A;  2A68 D;  4DUY L;  4A3G H;  1TY2 A;  3BVG A;  1J5E Q;  3PO3 H;  4OO1 I;  3S1R H;  1JOR A;  1SSO A;  3UDF A;  4NXM L;  2I0Q A;  2UXB L;  4DR3 L;  1EY7 A;  4X64 L;  2NYZ D;  3D0F A;  1QVC A;  4ZAI A;  1N36 L;  3R93 A;  1AN8 A;  2AMC B;  4LFC L;  4K2L A;  4YWL A;  5KNC A;  1G8Z D;  3CCM A;  1ZXT A;  4IPH A;  1AZP A;  1CA5 A;  3H15 A;  3DEP A;  4C2M H;  4BY1 H;  3KFU A;  5ELE A;  2KED A;  1JCK B;  4K0K Q;  4JV5 L;  2F0L A;  2IHE A;  1XMQ Q;  1PMR A;  4KKS A;  5GQO A;  3HOX G;  4F8M A;  1DOL A;  4OGQ C;  3HS0 C;  4R4O A;  1WTO A;  1SMY C;  3T13 A;  1BCP F;  2NBF A;  5M3F G;  2BOS A;  2SOB A;  4XTC S;  4K6D A;  3K59 A;  1I4G A;  4QL5 A;  1U9R A;  1F9Q A;  2E74 C;  2Z6K A;  2NZH A;  1TWH H;  4JI5 Q;  4JI7 L;  3PQI A;  2WAC A;  4O2D A;  3HOY H;  1STH A;  5CMD A;  1SRU A;  5C3X A;  2XGT A;  3T1Y L;  3U4Z A;  4K8I A;  2WV6 D;  2UXD L;  2L0C A;  3H91 A;  3C1E A;  2BE5 C;  2MPM A;  3RLF A;  5COY A;  1IXR A;  2J0T D;  2KCN A;  1EIH A;  1N33 L;  3MFY A;  2VS1 A;  2CH4 W;  2PW5 A;  1F9S A;  4DAM A;  4B3T Q;  2NVQ B;  1TQO A;  4DUZ Q;  4JOI A;  3HOZ G;  4QJF A;  5FK9 C;  4A3I H;  2K7V A;  4KHZ A;  1UE7 A;  3CAM A;  1IKL A;  3IFD A;  4JPB W;  3ZJY C;  1Q86 C;  1ESF A;  4QB4 A;  4DV6 L;  1WTW A;  4DV1 Q;  3Q6S A;  1SE3 A;  2HUG A;  1B44 D;  3G7L A;  4A3E G;  3D4W A;  3M3Y B;  3FDT A;  4A93 G;  1IYU A;  1EY8 A;  2EXD A;  2UXC L;  4EQO A;  2IHF A;  4G4K A;  4G57 A;  1BDO A;  4C3J H;  5BN5 A;  4RKB A;  5C0X H;  1O7Y A;  2QA4 A;  3WWV A;  2KEE A;  4AYB E;  4J8Q A;  3J7A 5;  4Q5V A;  3SR1 A;  4XQQ A;  1Q90 A;  1K8O A;  4MZ9 A;  3HKZ E;  5FLM H;  2SNS A;  5KGU A;  1QCB D;  1STG A;  1PFS A;  1JC7 A;  1S4Z A;  4LFA L;  4NKL A;  3FKI H;  2ASB A;  5M5X H;  1GD7 A;  1I6V C;  4FF3 A;  2F0G A;  3S15 B;  1TT2 A;  3PUX A;  4IUN A;  2B2Y C;  3OTO L;  2KCT A;  1CHP D;  2VB2 X;  3NTH A;  5J22 A;  3J80 c;  1K83 H;  1G2S A;  2UUC Q;  3S9W A;  2B63 G;  2R7Z H;  1O7Z A;  4HID A;  1C48 A;  3GTO H;  1E2Z A;  3DWQ A;  4XT3 B;  1BO0 A;  1YNN C;  1HZA A;  1HXY D;  5F2D A;  2CVR A;  1NAP A;  2MFI A;  2E2J B;  1M1K C;  4IOC A;  1JIC A;  1I3Q H;  1X56 A;  3MTS A;  2RSN A;  4LF5 Q;  5T1I A;  5C3E H;  3I4N H;  1FNV A;  4KY7 A;  1A63 A;  3KUP A;  2ES2 A;  1QZG A;  3GTK B;  1SR3 A;  4DV7 L;  2O5J C;  5CV9 A;  2I5H A;  1F9R A;  2FMC A;  4GNX A;  4FO2 A;  4OEM B;  1ENC A;  2M00 A;  2PCF B;  1GVP A;  5GAE C;  3BVM A;  2GA4 B;  2QIL A;  4NXN Q;  3I4L A;  2XRQ D;  3NXW A;  1FJG L;  3SK8 A;  4NB3 A;  4DR3 Q;  1SE8 A;  3EN2 A;  5I6Y A;  3DHQ A;  1JJ2 A;  1B9N A;  4ZUI A;  4DV4 Q;  2JJQ A;  3VA5 A;  2AWO A;  2R93 B;  1MIU A;  4FDB A;  1IYJ B;  4Y7N H;  2F0D A;  2F3W A;  3I8Z A;  3SEB A;  4X66 Q;  2F3I A;  3TME A;  3D4D A;  4APV A;  2F0H A;  2M9V A;  1AE3 A;  3KJP A;  5IGF A;  1PTO C;  5JAV A;  3HOW H;  4YWK A;  4DPG A;  4UPA A;  1N34 Q;  3S1Q H;  3VR4 A;  1HZC A;  4X3U A;  4XT1 B;  2F0W A;  1MSH A;  1Q1E A;  1BBU A;  1I4Q A;  2NUC A;  2E5L L;  3ULL A;  1TWC B;  2B2U C;  1HA6 A;  1YVC A;  2FXQ A;  4JW0 A;  1V1P B;  1A0I A;  2DJF C;  1A3U A;  3CRK C;  3KLS X;  5T1G A;  4AQY Q;  2RF4 A;  5JEA J;  1B70 B;  1HPC A;  5CV4 A;  1TWF B;  4HED A;  4RGO S;  3RN2 A;  1KDB A;  4BXX G;  2XTI A;  4MNO A;  1I94 Q;  4LW1 A;  1MJE A;  1EFW A;  1HNZ L;  3BDL A;  1PRT C;  4LF9 Q;  4C3H B;  3T1Y Q;  2A69 C;  3S14 B;  4KKT A;  1E1O A;  1NJI C;  2DNC A;  4ALP A;  4OHJ A;  1JOO A;  4CHT B;  4HJ7 A;  4A3D B;  3DMU A;  2HQL A;  4RH6 A;  2LXJ A;  2WAQ B;  1N33 Q;  1V9P A;  1IHZ A;  1IL2 A;  2VY3 A;  4KLK A;  3NTK A;  1X9N A;  2MUY A;  3C1F A;  4DK3 C;  2L9H A;  3QR8 A;  2F0S A;  1GUW A;  3J80 E;  5C4X B;  4JCV E;  4OO1 G;  2L5T A;  2RBM A;  1KHI A;  3C3L A;  4DV6 Q;  1TS5 A;  1F2L A;  1MSG A;  3RD4 A;  1CQV A;  1ASY A;  2WB1 G;  4ULL A;  2B2W C;  3QG1 A;  3A7L A;  5FJ8 G;  4FXG C;  2IL8 A;  3EA6 A;  1A3V A;  4C3I G;  4JYA L;  1EU3 A;  4H44 C;  2EIF A;  2UXC Q;  1STN A;  4UP7 A;  3A55 A;  1CZG A;  2OXP A;  5AFW A;  1AP0 A;  3KYH C;  5EKI A;  2VQF L;  2EPB A;  2GVB A;  1G6Z A;  1SYE A;  3TEH B;  2X69 A;  3O13 A;  2D5D A;  4BBR G;  5J3B A;  2NVQ H;  4DR6 Q;  5IGB A;  4UP8 A;  2R61 A;  3UDX A;  4TSS A;  4DAP A;  3CCR A;  1D1I A;  1E3P A;  1R4Q B;  4RG1 A;  4P73 A;  4DV5 L;  4DK1 A;  2D0P A;  3R3O A;  3SVM A;  4RGN A;  3OTO Q;  4XQJ A;  1OTC A;  2ZJP A;  2F0Q A;  5JVH 3;  3J80 L;  2JK8 A;  2K32 A;  3GDE A;  3M3Y H;  4L5Q A;  3ULP A;  3HOX B;  1QNU A;  1XNR L;  3AU7 A;  5M3F B;  4X3T A;  3QWN A;  1DCZ A;  1E7Z A;  1EQV A;  2CWP A;  2PMZ E;  2ALY B;  4XYO A;  1VQ6 A;  3IKJ A;  1GOZ A;  3EQL C;  4IFD H;  1DM0 B;  2Y0S E;  2VZA A;  3F2U A;  1I6H H;  2CKZ B;  5J39 A;  3UE0 A;  3CCU A;  1ET9 A;  1PH6 A;  1HZ9 A;  1STB A;  2TMP A;  3I55 A;  3KJO A;  3CCJ A;  1ASZ A;  4RGM A;  2Z6K C;  4TRD A;  3Q23 A;  1NBW A;  4M1U B;  4TVA B;  5C44 G;  1EUJ A;  3S15 H;  4DV3 Q;  1UUP A;  2OTL A;  1NR2 A;  5KYI A;  4L5T A;  1V43 A;  5KYL A;  3S1M B;  3FP9 A;  2RSO A;  1Y14 B;  2K4K A;  3QB3 A;  2Y0S G;  2HDL A;  1IW7 D;  4DR7 L;  3L2P A;  1B4O A;  3A8J E;  5EAY A;  2ZTD A;  4JC0 A;  1KNA A;  1MD2 D;  2G9H D;  3HOZ B;  2YU9 B;  1RTO A;  1XPU A;  1PYS B;  1PYB A;  5I4D A;  2E2J H;  4KV6 A;  1WCM G;  3K5O A;  2F0V A;  3PV0 A;  1SMX A;  3S2H B;  2FJ2 A;  2JEB I;  4FP5 D;  1RF2 D;  1CM9 A;  2RHQ B;  3A5U A;  4A93 B;  4JK1 C;  1CA6 A;  2A6H D;  4IUQ A;  1TR5 A;  4CBV A;  3OMG A;  3OYY A;  1DXM A;  2F0J A;  4B3M Q;  1SAP A;  2AQ3 B;  4POF A;  1J5E L;  1I4H A;  1UE1 A;  1PTO F;  3T1H Q;  4L5S A;  1YZ6 A;  1HA5 A;  3A8K E;  1CZW A;  3NBI A;  4L63 B;  3DLL A;  1O7I A;  2R93 H;  4I7A A;  1RDP D;  5GAG C;  4LF4 Q;  1YEZ A;  2NVX H;  2R3Z A;  3CQZ B;  2B8G A;  1LV9 A;  4HMJ A;  1GXD C;  1EOT A;  1K28 A;  1TXY A;  3J7A F;  4B9W A;  2L15 A;  1BCP C;  2K33 A;  3MXP A;  2K03 A;  3T56 B;  3S17 B;  2Z6B A;  3M7G A;  4K0K L;  1Q8K A;  3HKZ B;  1ML0 D;  3CMA A;  2B63 B;  2R92 G;  1NCV A;  3U58 A;  2Z8L A;  2JP1 A;  4RCN A;  3K7U C;  4OL7 A;  3BVZ A;  1HNW Q;  2ICI A;  1A6X A;  3RLO A;  3J7Z C;  1TWC H;  1PH8 A;  3BJU A;  5JPN C;  2A5H A;  4JI5 L;  1IBM Q;  1S3O A;  3H09 A;  4L5R C;  3D8G A;  2NN6 G;  5K36 G;  1TWF H;  1JJC B;  4DXG A;  1Q7Y C;  3I73 A;  4WOR A;  1CKN B;  1LTR D;  3NUC A;  4GLA C;  1V1P A;  3MXG A;  1KC8 C;  3TZD A;  3K5N A;  3A5Z B;  3S14 H;  2NTT A;  2CCZ A;  1EWI A;  1ZYR C;  4A3D H;  4KN7 C;  1RKN A;  5GAD C;  1SYB A;  2NB0 A;  3CRL C;  1D5M C;  2F0I A;  1K8G A;  4E6I A;  1YI2 A;  4B3T L;  4UY8 C;  2Z1C A;  3ZYY X;  3FKI B;  4YY3 Q;  2ICE C;  2NWG A;  4RMF A;  1L0X B;  2WKC A;  3MA2 B;  4OON A;  2KEN A;  3J81 j;  3DXJ C;  4P2C B;  5C4X H;  4DV5 Q;  2VUM G;  1EIF A;  1AH9 A;  1IZ6 A;  3JAM c;  4DV1 L;  3L9A X;  4A3C G;  1TWA B;  4QF4 A;  5I2Y A;  1IBL Q;  2X6G A;  2IX1 A;  4DR5 Q;  1XX8 A;  1KLU D;  2KEC A;  3A7A B;  3GTO B;  2YV5 A;  1GHJ A;  4CJ1 B;  1SMY D;  4F7X A;  2VXW A;  3PIP A;  1Y1W G;  1HZB A;  1JWU D;  3DM1 A;  5C5L A;  4B08 A;  3RN5 A;  3H3V I;  3GV6 A;  1HUN A;  3NK9 A;  2NZ1 D;  1SDF A;  1JT8 A;  4GNX B;  3KLR A;  1TKW B;  2NTS A;  2F52 A;  2JA8 G;  1KRT A;  3BYY B;  3G4S A;  4LJZ C;  1VF7 A;  2PZW A;  1AEX A;  3TP5 A;  5IYD G;  2DJG C;  2JA5 G;  1N8R C;  2G5D A;  4H13 C;  1GHK A;  3RMH A;  3GTJ B;  1EFI D;  1P8L A;  2K52 A;  1WVL A;  2NVY B;  1BUV T;  3QOJ A;  5AJ3 Q;  5IP7 G;  4XYQ A;  4GOP C;  1HTL D;  4Q0F A;  4DNI A;  2UUC L;  2ZXR A;  4HSV A;  4A75 A;  1NY4 A;  5FKA C;  4I7Z C;  2DUD A;  3HOX H;  3F2B A;  1F9P A;  1BNZ A;  1VQN A;  3J81 i;  4JI0 Q;  4YIJ A;  3CPW A;  5M3F H;  2D9U A;  1VQB A;  1FR3 A;  3GTP B;  2P5Z X;  5E3F A;  3HP3 A;  4NPS A;  1JMC A;  2EY2 A;  4IUV A;  2L1B A;  2WKD A;  5D65 A;  4LF5 L;  4ABN A;  4A3K G;  2WB1 B;  2RA4 A;  3NP8 A;  5LHY 1;  4X65 Q;  2N49 A;  3V2T A;  3LGJ A;  1LT5 D;  4IJL A;  4C3I B;  3KBG A;  1Z47 A;  1J9O A;  2E75 C;  1CUK A;  1RIP A;  3TP6 A;  4R8I A;  2J4X A;  4EQN A;  1LTG D;  4HJA A;  4ILW A;  2PZU A;  3OMC A;  4NXN L;  1EY0 A;  1D8L A;  1NR4 A;  1KXL A;  4KJO A;  5EKK A;  3S1M H;  2B8F A;  1O7L A;  1PFB A;  3F8T A;  4YWM A;  1WYD A;  5EKL A;  4DV4 L;  1XNQ Q;  1EIY B;  5LMN Q;  2K6A A;  3TDQ A;  3RNU A;  1Q8I A;  3W1B A;  2K5D A;  4BA2 I;  4V19 0;  3HOZ H;  2YU9 H;  1H9R A;  5C0X J;  4X66 L;  1WTQ A;  3I4M G;  4JI3 Q;  2GN5 A;  2J7Z A;  3MFG A;  4YCU A;  4IPD A;  1LLR D;  1A62 A;  4N9P A;  3S2H H;  2Z9H A;  4J6H A;  3BZD B;  2FHT A;  3PMF A;  3A8I E;  1N34 L;  4BY7 G;  4A93 H;  2OQ0 A;  2JA6 B;  2JXM B;  1YNN D;  5IP9 H;  2QDB A;  3VYS A;  1QZH A;  3NPP A;  2F0T A;  3OWE B;  2HD3 A;  4CDE C;  2BA1 A;  3P7J A;  1WD1 A;  4CKC A;  1SE2 A;  2ZM6 Q;  1G51 A;  4HJ5 A;  2OTJ A;  4DV2 Q;  5CGK A;  4AQY L;  2EOT A;  3GP7 A;  5FOB B;  1U0L A;  1WTP A;  1UNS A;  1UWV A;  1YNJ C;  4JBJ A;  1I94 L;  2B2T C;  1D1K A;  3AFQ A;  1G29 1;  1WTX A;  1I4P A;  5IIF A;  4LF9 L;  1LAB A;  3CQZ H;  1UEA B;  2C35 B;  4QY7 A;  4A76 A;  4FYD A;  2H5X A;  5C44 B;  2PMZ B;  1OXX K;  3FPU B;  3S17 H;  2AQ1 B;  4K14 A;  2QDL A;  3S16 B;  1QUQ A;  5A35 A;  3EJI A;  2Y0S B;  2N55 A;  5BN4 A;  2A6E C;  2B63 H;  1T5E A;  2B29 A;  4DNT B;  3CW2 C;  4X6A H;  4A3M G;  4GN5 A;  2JYO A;  1O80 A;  1VQI A;  2X6L A;  1L0Y B;  3HOV G;  4IUP A;  1UAP A;  3H0G G;  1KIX A;  3GQB A;  1WCM B;  2HT1 A;  3T4A C;  1IYV A;  4JI2 L;  4KN4 C;  3JAM L;  1L2F A;  1FGB D;  2RDH A;  4BBS G;  5IY0 A;  1D5X C;  4PQX A;  1VQ4 A;  2ATW A;  2R7F A;  2YTY A;  1BF4 A;  1SYD A;  4HMI A;  3TS2 A;  4FF2 A;  2XWJ B;  1VMP A;  2FMM A;  1CKN A;  4ZK9 B;  2K5N A;  1A8V A;  2ZXP A;  1HH2 P;  5ELF A;  4WJ4 A;  5FO9 B;  1A2U A;  1I6H B;  3TP7 A;  1EQT A;  4DR6 L;  5M5Y B;  1XJV A;  1L1O A;  1TU2 B;  4PG3 A;  1Z6H A;  1V1O A;  4ZRZ A;  5FLX c;  2F0M A;  1PFN A;  2LKV A;  1EY4 A;  2A68 C;  2A69 D;  1XTC D;  3VYT A;  3CF5 A;  4IOA A;  4YHH Q;  5C4H A;  2EYH A;  2YTX A;  3U9S A;  1B3A A;  1TWA H;  2IWH A;  2E2I B;  2JQO A;  3I7F A;  3FRP B;  2VW9 A;  5LMU L;  5C5M A;  1CTM A;  2V1C C;  2JSO A;  3MWY W;  5M3M G;  1U4M A;  2I46 A;  2CHB D;  1MKH A;  1B3Q A;  3PF4 A;  3V96 A;  1BQQ T;  4ME3 A;  4IFD I;  1JQY D;  1E2V A;  4DR4 Q;  3I56 A;  5IGE A;  1HFN A;  1K0S A;  2L11 A;  2GVA A;  2FIN B;  4K5W A;  4BXX H;  1BKB A;  1VQC A;  5TSS A;  5BN3 A;  3FPP A;  4PZ8 A;  1VQ5 A;  3GTJ H;  4DV3 L;  1J8I A;  2NVY H;  4OIK A;  5D3I B;  3PIP 3;  4A3F G;  1SND A;  1K73 C;  1D6E C;  4J1M A;  1LYL A;  3BZC A;  4NMZ A;  2CFM A;  1PHJ A;  4GS3 A;  2NVX B;  3OW7 A;  1AE2 A;  2I5M X;  4DR1 Q;  1VMC A;  2F0N A;  4LMQ D;  3GTP H;  1HHV A;  2A19 A;  2VUM B;  4OO1 H;  2BA0 A;  1H9K A;  3IRB A;  3PUZ A;  4HR7 B;  1LT4 D;  4WFN 3;  1D2B A;  1H95 A;  2IW3 A;  3J7Y W;  4FXD A;  1LM0 A;  5FJ8 H;  1O78 A;  4C3I H;  3AEV A;  5EPL A;  3I4O A;  4RKL A;  4B3M L;  5IT9 c;  4ZKB B;  1T9H A;  4XDX A;  3M4Y A;  2DY8 A;  3N6R A;  3HEJ A;  4HJ9 A;  1Y1W B;  3T1H L;  1VQG A;  1TS2 A;  4WRD A;  5IGG A;  1EOV A;  3NEM A;  3CME A;  4R8N A;  3I72 A;  2E76 C;  1G6P A;  4OWX B;  2WIN B;  2JA8 B;  3HOU G;  2PQA A;  1AW7 A;  5ELB A;  4LF4 L;  5IGC A;  1PLF A;  2JA7 G;  4I65 A;  4KY5 A;  4LF7 Q;  2JA5 B;  3NQI A;  4PMW A;  3F2C A;  3NQT A;  1VQE A;  2C5C A;  1HCZ A;  3IAY A;  3NBH B;  3R2T A;  4IFD J;  2QW7 A;  4X3K A;  2WP8 J;  2Z4H A;  3MHB A;  5FLX E;  2WB1 E;  2RCF A;  1Y8O B;  1B2T A;  5EGT A;  4QUC A;  2JA6 H;  1B50 A;  1F77 A;  1HNW L;  2QKI C;  1NMF A;  4POG A;  4X3S A;  2HDM A;  1PH5 A;  1HUM A;  4JI2 Q;  2E8G A;  1IBM L;  1PH9 A;  1YBY A;  2F0U A;  3CC4 A;  2L12 A;  4ID6 A;  1UE5 A;  1KDC A;  4A3K B;  5K5P A;  2PYK A;  1MBY A;  1EY9 A;  2B2V C;  2EY6 A;  4KD4 A;  3NHH A;  5C6A A;  3ICE A;  1CQF A;  1LTS D;  1XMO L;  5E7N A;  4DXF A;  1Y1V G;  3E5S A;  5C44 H;  4R4C A;  3U50 C;  3U9O A;  3VYU A;  5CV5 A;  4ZUJ A;  1YIT A;  4RFB A;  3DEO A;  3S16 H;  3K7A B;  2OT2 A;  5CR3 A;  5IYC G;  1DYQ A;  2VQE Q;  4U67 3;  1S5C D;  4YY3 L;  2EYF A;  2Z0S A;  2BH8 A;  5FLX L;  1RTN A;  2H1E A;  1Q1B A;  3I4M B;  4PZ6 A;  1WCM H;  4CJ2 C;  1D5Z C;  1ICF B;  4GKJ Q;  1IBL L;  4RCO A;  2LMC B;  4DR5 L;  2XWB B;  5IOC A;  4R1J A;  3J80 i;  1S72 A;  4LAA A;  5LMU Q;  4RWS C;  4BY7 B;  1PZI D;  1HQM C;  2QGQ A;  3ERO A;  2UUA Q;  4DK0 A;  1MJC A;  3BDO A;  4DAY B;  3DM3 A;  3NEL A;  1LT6 D;  1XYI A;  1HR0 Q;  2KCM A;  1QIL A;  3UE1 A;  3KF6 B;  1RHP A;  1TVX A;  1K8M A;  5DM7 3;  5I9O A;  3P75 A;  1H9M A;  3MXU A;  1J6Q A;  2PO4 A;  5IT9 E;  2CW0 C;  5M5Y H;  5L37 A;  3M7N A;  3S1N B;  1VQP A;  5DM6 3;  1DZ1 A;  5D14 A;  5AJ3 L;  2K1B A;  3PUY A;  3M4P A;  1GUG A;  1ZYR D;  2K5V A;  3W3A A;  4IUT A;  1LAC A;  2E2I H;  2LS0 1;  2K50 A;  4JI1 Q;  1W2B A;  4F88 A;  1QNK A;  2HQE A;  4A3M B;  1G91 A;  3CKI B;  1WTR A;  4N8F A;  3STB D;  4JI0 L;  4O0A A;  5EBC A;  4KI0 A;  1U5K A;  3L3O C;  3H0G B;  3HOV B;  3V05 A;  2K5Q A;  3OSO A;  1V8Q A;  2Z4I A;  3BZK A;  3C2P A;  3S2D B;  4BBS B;  2NN6 H;  4X65 L;  4A3E B;  5K36 H;  1SJH D;  2MQH A;  4QMG A;  4JOI C;  3Q24 A;  3GO5 A;  3BDC A;  2EJM A;  5DLQ E;  1DOK A;  1VQD A;  4R9W A;  1EY5 A;  5IGD A;  3TP8 A;  5IT9 L;  1SNC A;  3MAQ A;  5KND A;  1EQR A;  1YIJ A;  2K14 A;  2KJX A;  2KBN A;  4JBW A;  4JI6 L;  4KD3 A;  4O1N A;  4QQB X;  1EU4 A;  4JI8 Q;  1ILQ A;  5JEA G;  1XNQ L;  4CDC C;  2A8V A;  5LMN L;  1JOK A;  1M8A A;  1XPO A;  1PFM A;  1QUQ B;  4B9X A;  1DGS A;  5I2X A;  1Q81 C;  2KUM A;  1H9S A;  2RCN A;  4JI3 L;  4C1N I;  2VUM H;  2KVM A;  3OWF A;  4A3C H;  4B3R Q;  3CC7 A;  3EBE A;  1MGS A;  3T16 A;  3W5O A;  2B2Y A;  4IN3 A;  3GTQ B;  5G3L D;  5M3M B;  4K8J A;  3K81 C;  1XWE A;  4P75 A;  1PH7 A;  1W6K A;  2IPK D;  5DAU A;  2ZM6 L;  1Y1W H;  4LK1 C;  2QEX A;  2A74 C;  4L6T B;  3VR6 A;  4DV2 L;  1VS0 A;  4ZYS A;  1S5E D;  1Y69 U;  5HY6 A;  5M5W B;  2B3G A;  1SNO A;  2C9O A;  2JA8 H;  2AWN A;  3FEW X;  1JB3 A;  3H94 A;  3U4V A;  1N9W A;  3Q0A A;  2EVB A;  1XMO Q;  1YJN A;  2JA5 H;  1L0W A;  3EFX D;  1TY0 A;  2F0F A;  3ND8 A;  2JN4 A;  2ZTC A;  1SRO A;  3I2Z A;  4A3F B;  1L1O B;  5IP7 H;  2RQX A;  5CV6 A;  4H7B A;  4WJW A;  3NWS A;  4HTH A;  4RGT A; 
#chains in the Genus database with same CATH homology
 4NXN Q;  2UU9 L;  3NEN A;  2BA1 A;  2ZM6 Q;  1HR0 W;  1FJG L;  1G51 A;  2N78 A;  4NB3 A;  1SFO H;  4YCV A;  4DR3 Q;  1OXT A;  1SE8 A;  3EN2 A;  4HJ5 A;  4DV2 Q;  3PCO B;  4GN4 B;  2D62 A;  3L7Z C;  2OWO A;  2JA6 G;  2NVT H;  1JJ2 A;  4DV4 Q;  2JJQ A;  2AWO A;  4AQY L;  1KAW A;  1KRS A;  1MIU A;  3RZD H;  4LF6 L;  1U0L A;  5HGQ A;  4HIM A;  1GM5 A;  1UWV A;  4IPC A;  1C7Y A;  4FDB A;  4JBJ A;  1I94 L;  1IYJ B;  4Y7N H;  1VQ9 A;  3AFQ A;  5JJI A;  1G29 1;  1VQH A;  5IYB G;  3UDG A;  4A3K H;  4X66 Q;  4DV0 Q;  2F3I A;  4LF9 L;  3CQZ H;  2C35 B;  4QY7 A;  4APV A;  4A76 A;  2H5X A;  1AE3 A;  2K75 A;  3KJP A;  2R92 H;  5C0X I;  2HHH L;  4QGU A;  1OXX K;  4DV7 Q;  3HOW H;  2LXK A;  3S17 H;  4YWK A;  4JI4 L;  4LF8 Q;  2VNU D;  1QUQ A;  2I5L X;  4DPG A;  1GO3 E;  3AYH B;  4UPA A;  1N34 Q;  3S1Q H;  3CXC A;  5BR8 Q;  1N32 L;  1HZC A;  3ER0 A;  2B63 H;  3GTM H;  2B29 A;  3K7A H;  1Q1E A;  3CW2 C;  1Z9F A;  1BBU A;  3PO2 G;  4A3M G;  4X6A H;  2E5L L;  2UU9 Q;  1YJ9 A;  4GN5 A;  3ULL A;  1VQI A;  3MEF A;  4DK6 C;  1FJG Q;  3CPF A;  1OXV A;  2LSS A;  1YVC A;  2FXQ A;  3HKS A;  1YHQ A;  1HNX L;  3HOV G;  3H0G G;  1KIX A;  1A0I A;  1WJJ A;  4X62 L;  3J81 c;  2HT1 A;  1RL2 A;  4AQY Q;  2RF4 A;  2ZTE A;  5JEA J;  1QVG A;  4LF6 Q;  4JI2 L;  3M4O H;  1B70 B;  1L2F A;  5H1S E;  4YHH L;  3RN2 A;  3I4M H;  1CKM A;  4BBS G;  4BXX G;  2XTI A;  4MNO A;  1I94 Q;  5IY0 A;  3AFP A;  4LW1 A;  1MJE A;  1EFW A;  1LUZ A;  1K0R A;  4GLX A;  1HNZ L;  5JJK A;  1VQ4 A;  2ATW A;  2R7F A;  4LF9 Q;  3T1Y Q;  2YTY A;  1X3E A;  4HIK A;  1E1O A;  1NJI C;  3B6Y A;  4BY7 H;  1CSQ A;  2IY5 B;  4ALP A;  1NMG A;  4HJ7 A;  3TS2 A;  4JI4 Q;  2HQL A;  3GTK H;  1CKN A;  2LXJ A;  1JE5 A;  1N33 Q;  2HIV A;  1A8V A;  2K5N A;  1V9P A;  1IL2 A;  2VY3 A;  3K0X A;  1HH2 P;  4KLK A;  5IWA L;  1N32 Q;  4WJ4 A;  4R4Q A;  2EQS A;  4DK3 C;  1X9N A;  2E2H H;  2E5L Q;  2R7D A;  4DR4 L;  4DR6 L;  1XJV A;  4A3J G;  1L1O A;  1FGU A;  1YJW A;  4PG3 A;  1K3R A;  1M90 C;  4HIO A;  3KF6 A;  5FLX c;  4JCV E;  4OO1 G;  4GN3 B;  3GTG H;  4IFD G;  1L1O C;  1KHI A;  5IYB H;  4DV6 Q;  3S1N H;  3K80 C;  3CF5 A;  4IOA A;  4YHH Q;  1ASY A;  2YTX A;  2WB1 G;  2PQA B;  1TWA H;  5FJ8 G;  3UDI A;  2JQO A;  3I7F A;  4QIW E;  3S24 A;  1KD1 C;  1HNZ Q;  2DGY A;  1I5F A;  2VW9 A;  3RZO H;  4JYA L;  1OXU A;  2RHS B;  2EIF A;  2PI2 A;  5LMU L;  4JI6 Q;  1VQL A;  2UXC Q;  2V1C C;  1WI5 A;  5M3M G;  4EQ5 A;  1WFQ A;  4UP7 A;  1V1Q A;  3KYH C;  3PGZ A;  4WJ3 M;  2VQF L;  2GVB A;  3PO2 H;  4A3M H;  1XMQ L;  4Y52 H;  3K8A A;  3TEH B;  1MKH A;  1R9T H;  5IWA Q;  4DR1 L;  3PF4 A;  4BBR G;  1BVS A;  3HOV H;  4ME3 A;  5J3B A;  3H0G H;  4IFD I;  5IYD H;  4LNQ A;  4DR4 Q;  4GOP B;  3I56 A;  2NVQ H;  2Q2I A;  1XTD A;  5LMN W;  2VL6 A;  4DR6 Q;  4R4I A;  1PA6 A;  4UP8 A;  3UDX A;  4PZ7 A;  2JA9 A;  2UUB L;  2GVA A;  3S2D H;  3ERS X;  4BBS H;  4BXX H;  3L0O A;  3CCR A;  1BKB A;  1VQC A;  1E3P A;  4A3E H;  4RG1 A;  4P73 A;  1VQF A;  4DV5 L;  2N3S A;  4PZ8 A;  2D0P A;  1VQ5 A;  5GRO A;  3OTO Q;  3E0E A;  1OTC A;  3GTJ H;  4DV3 L;  2ZJP A;  1X3G A;  2NVY H;  2PI2 E;  4IPG A;  2F4V Q;  1K8A C;  1S40 A;  4A3F G;  4LUO A;  4UP9 A;  2JK8 A;  4JYA Q;  4J15 A;  5C4J H;  1K73 C;  3GDE A;  3TS0 A;  1PH4 A;  3M3Y H;  4L5Q A;  3ULP A;  1Q46 A;  3TRE A;  3GD7 A;  4C3H H;  1XNR L;  2N8N A;  1LYL A;  1YNX A;  3BZC A;  2CFM A;  1PHJ A;  4GS3 A;  1C9O A;  2YTV A;  1E7Z A;  2VQF Q;  1XPR A;  2R6G A;  2CWP A;  1AE2 A;  2I5M X;  2PMZ E;  2ALY B;  4DR1 Q;  4A3J H;  4LF7 L;  1VQ6 A;  3CCE A;  3GTP H;  2A19 A;  2R93 G;  2BA0 A;  3IRB A;  3PUZ A;  4DUZ L;  4A3L G;  1EQQ A;  3STB C;  1P16 A;  2Y0S E;  2VZA A;  3Q8D A;  4LFB L;  2D0O A;  1I6H H;  2CKZ B;  3F1Z A;  3PF5 A;  2JEA I;  1H95 A;  3UE0 A;  3CCU A;  3KDF B;  3GTL H;  2AHO B;  1LM0 A;  5GAH C;  1PH6 A;  3CP0 A;  5FJ8 H;  1HZ9 A;  4HJ8 A;  3I55 A;  2PNH A;  1GKH A;  3KJO A;  3CCJ A;  1ASZ A;  2Z6K C;  3HFZ B;  4C3I H;  1NBW A;  4OWT B;  4TVA B;  5C44 G;  1JB7 A;  3AEV A;  3I4O A;  1EUJ A;  4B3M L;  3S15 H;  5IT9 c;  3W1G A;  4DV3 Q;  3GTQ H;  5JJL A;  2OTL A;  5M3M H;  1T9H A;  4L5T A;  1V43 A;  4HJ9 A;  4A3B G;  1PVO A;  3T1H L;  1VQG A;  3FP9 A;  1IBK L;  1Y14 B;  2K4K A;  4JG2 A;  1LTL A;  3TRZ A;  2Y0S G;  4A3G G;  1EOV A;  1SN8 A;  3NEM A;  3CME A;  3TQY A;  4AH6 A;  4P71 A;  4DR2 L;  4JBM A;  1XNR Q;  3PO3 G;  4DR7 L;  3L2P A;  4B3S L;  4OWX B;  1G6P A;  4OXP A;  1VCI A;  1NE3 A;  2IT1 A;  2PQA A;  5EAY A;  3HOU G;  2ZTD A;  3MXN B;  4JC0 A;  1VQM A;  1K9M C;  3JAM i;  4LF4 L;  5M5W H;  2JA7 G;  2Q2U A;  4LF7 Q;  3RLN A;  1XPU A;  1PYS B;  1PYB A;  2E2J H;  4P74 A;  1QVF A;  1WCM G;  3G48 A;  4PMW A;  3F2C A;  3PV0 A;  2WAQ E;  1SMX A;  1VQE A;  4LFB Q;  3CCL A;  4KHP L;  2HHH Q;  2JEB I;  3KLW A;  4GKK L;  3NBH B;  2RHQ B;  2YYZ A;  3A5U A;  4MTN A;  4BY1 G;  4IFD J;  2WP8 J;  4A3F H;  3FHW A;  1X55 A;  1VQ8 A;  2OQK A;  1SLJ A;  2WB1 E;  3BU2 A;  2AKW B;  1VQA A;  3OYY A;  4B3M Q;  3PSI A;  4POF A;  4A3D G;  2VQE L;  4IO9 A;  1J5E L;  2JA6 H;  1UE1 A;  1BBW A;  3T1H Q;  2WAQ G;  1HNW L;  1IBK Q;  1NMF A;  3OW2 A;  4POG A;  4L5S A;  5IP9 G;  3ULJ A;  1HNX Q;  1YZ6 A;  4DR2 Q;  1TWG H;  4X62 Q;  1JJG A;  1PH5 A;  4DR7 Q;  3DLL A;  1B7Y B;  4TQU S;  2E8G A;  2Q2H A;  4JI2 Q;  3F2D A;  1PH9 A;  1IBM L;  1VQK A;  1O7I A;  1YBY A;  3CCQ A;  3CC4 A;  2R93 H;  4A4I A;  1UE5 A;  5GAG C;  4LF4 Q;  1YEZ A;  1NTG A;  4A3L H;  2NVX H;  4GKJ L;  1FL0 A;  3H3V H;  5C4X G;  4LUV A;  3ICE A;  4AIM A;  3G6E A;  4DKA C;  3VDY A;  4EX5 A;  1XMO L;  1CSP A;  1TXY A;  1UE6 A;  5E7N A;  3HOY G;  2UUA L;  1VQO A;  2L15 A;  1Y1V G;  5C44 H;  3CC2 A;  4K0K L;  1Q8K A;  4R4C A;  3U50 C;  1HR0 L;  3E9I A;  3E9H A;  4A3B H;  1YIT A;  2A1A A;  3CMA A;  4AYB G;  4OX9 L;  2R92 G;  3S16 H;  3U58 A;  5IYC G;  3K7U C;  4A3G H;  4DUY L;  4OO1 I;  2VQE Q;  1CKO A;  1J5E Q;  3PO3 H;  2KHI A;  3S1R H;  3HKZ G;  3M9B A;  3KDF A;  3UDF A;  4YY3 L;  4NXM L;  3HOU H;  1HNW Q;  2I0Q A;  3RLO A;  3J7Z C;  1TWC H;  2Z0S A;  4DR3 L;  1PH8 A;  2BH8 A;  3BJU A;  2UXB L;  4X64 L;  2JA7 H;  3D0F A;  1QVC A;  4JI5 L;  1Q1B A;  1IBM Q;  1S3O A;  4L5R C;  4PZ6 A;  1WCM H;  1N36 L;  2NN6 G;  1X65 A;  4A3I G;  3M85 A;  1VQ7 A;  4GKJ Q;  1TWF H;  1JJC B;  1Q7Y C;  1IBL L;  5K36 G;  2AMC B;  4LFC L;  4DR5 L;  4YWL A;  1CKN B;  4GLA C;  3CCM A;  4IPH A;  4R1J A;  3J80 i;  1S72 A;  1KC8 C;  3H15 A;  5LMU Q;  4C2M H;  4BY1 H;  4JI1 L;  2QGQ A;  2UUA Q;  3KFU A;  1X3F A;  3A5Z B;  3S14 H;  4OWW B;  1MJC A;  4DAY B;  4K0K Q;  2CCZ A;  1EWI A;  3DM3 A;  2ID0 A;  3NEL A;  4IJH A;  4JBK A;  1HR0 Q;  2BH2 A;  2KCM A;  2IHE A;  1EYG A;  3UE1 A;  4A3D H;  4JV5 L;  1XMQ Q;  5GAD C;  3KF6 B;  4GLV B;  5GQO A;  4OX9 Q;  1K8G A;  3HOX G;  4R4O A;  5C0X G;  1YI2 A;  4DUY Q;  4B3T L;  4UY8 C;  5M3F G;  1WOC A;  2WFW A;  4XTC S;  1J6Q A;  4YY3 Q;  3JC6 6;  4NXM Q;  2NN6 I;  4LUZ A;  2UUB Q;  4QL5 A;  4RMF A;  5M5Y H;  5FLM G;  2UXB Q;  4OON A;  2KEN A;  2NZO A;  4X64 Q;  2Z6K A;  3M7N A;  2NZH A;  3J81 j;  1VQP A;  1TWH H;  4JI5 Q;  5C4X H;  4JI7 L;  2JE6 I;  4DV5 Q;  2VUM G;  1EIF A;  1AH9 A;  1YHB A;  1IZ6 A;  1N36 Q;  3JAM c;  3G71 A;  4DV1 L;  4A3C G;  3FKI G;  3PUV A;  4O2D A;  3HOY H;  1IBL Q;  5AJ3 L;  2IX1 A;  3PUY A;  4DR5 Q;  4LFC Q;  2CQO A;  3M4P A;  4H02 A;  2K5V A;  1Y1V H;  1SRU A;  1PH2 A;  2XGT A;  2E2I H;  2YV5 A;  3T1Y L;  3U4Z A;  2K50 A;  4JI1 Q;  2UXD L;  3M4Q A;  1W2B A;  4JI8 L;  1D7Q A;  5IYC H;  3PIP A;  4BBR H;  1Y1W G;  2OCE A;  3STB D;  3PUW A;  4JI0 L;  4JV5 Q;  2R7Z G;  1HZB A;  3RLF A;  1Q12 A;  4O0A A;  3RN5 A;  3H3V I;  1IXR A;  3PIO A;  1N33 L;  2VS1 A;  4KI0 A;  1U5K A;  1JT8 A;  1VQJ A;  4DAM A;  4GNX B;  1C0A A;  4B3T Q;  2F52 A;  2JA8 G;  1X6O A;  1OXS C;  1KRT A;  4DUZ Q;  3G4S A;  3BZK A;  1X54 A;  4JOI A;  3HOZ G;  4QJF A;  4A3I H;  4X65 L;  4KHZ A;  5IYD G;  4B3R L;  1UE7 A;  3CAM A;  2JA5 G;  2MQH A;  1YHA A;  4JOI C;  2KHJ A;  3D31 A;  3GO5 A;  3ZJY C;  5C3E G;  1Q86 C;  1N8R C;  4JI7 Q;  3I4N G;  4DV6 L;  1PH3 A;  3A0J A;  5DLQ E;  4DV1 Q;  1P8L A;  2K52 A;  1VQD A;  4P72 A;  4GOP A;  5AJ3 Q;  1HJP A;  5IP7 G;  4A3E G;  1EQR A;  4BA1 I;  1YIJ A;  2CWA A;  2K14 A;  4GOP C;  4DNI A;  4A93 G;  2UUC L;  2EXD A;  2KBN A;  4JBW A;  4JI6 L;  4A75 A;  2UXC L;  5IE8 A;  1NY4 A;  4QQB X;  3EIV A;  2IHF A;  2UXD Q;  4JI8 Q;  2DUD A;  3HOX H;  4B3S Q;  4C3J H;  5JEA G;  1XNQ L;  3F2B A;  2A8V A;  5LMN L;  2QA4 A;  1VQN A;  3WWV A;  3J81 i;  4JI0 Q;  3CPW A;  4AYB E;  5M3F H;  3J7A 5;  1W3S A;  1VQB A;  1XPO A;  1PH1 A;  1QUQ B;  4LWC A;  4MZ9 A;  1DGS A;  3HKZ E;  4NPS A;  1KL9 A;  5FLM H;  1Q81 C;  1JMC A;  4LF5 L;  4YCW A;  2RCN A;  4JI3 L;  1UEB A;  2K5H A;  1PFS A;  2VUM H;  3CCV A;  4KHP Q;  4LFA L;  4A3K G;  4GKK Q;  4A3C H;  3FKI H;  4X65 Q;  5ELN A;  2N49 A;  3CC7 A;  2ASB A;  4B3R Q;  1PV4 A;  3EBE A;  5M5X H;  3LGJ A;  3W5O A;  4IJL A;  1GD7 A;  1Z47 A;  2MO0 A;  3PUX A;  1CUK A;  1E22 A;  1RIP A;  3OTO L;  3HOW G;  4XIG S;  2KCT A;  4HJA A;  3K81 C;  2MO1 A;  5ELO A;  2F4V L;  1E1T A;  4NXN L;  3J80 c;  4P75 A;  3AQQ A;  3RR5 A;  1FVI A;  1PH7 A;  1D8L A;  1K83 H;  2ZM6 L;  1Y1W H;  2UUC Q;  1KXL A;  2B63 G;  2QEX A;  2OTJ A;  2HIX A;  2R7Z H;  3S1M H;  4HID A;  4YWM A;  3F8T A;  4DV2 L;  1VS0 A;  3GTO H;  1E24 A;  1WYD A;  3SGI A;  3KF8 B;  4DV4 L;  1XNQ Q;  1EIY B;  5LMN Q;  1I50 H;  5HY6 A;  1HZA A;  3RNU A;  2B3G A;  2IX0 A;  2JA8 H;  3W1B A;  4BA2 I;  2Q2T A;  2MFI A;  2AWN A;  1M1K C;  4IOC A;  3HOZ H;  1Q82 C;  2YU9 H;  3U4V A;  1N9W A;  3A74 A;  4X66 L;  1I3Q H;  5C0X J;  1X56 A;  4DV0 L;  3CD6 A;  4LF5 Q;  1XMO Q;  3I4M G;  1YJN A;  2JA5 H;  4JI3 Q;  2GN5 A;  4YCU A;  1L0W A;  5C3E H;  3I4N H;  4IPD A;  4LFA Q;  1A62 A;  1A63 A;  2ES2 A;  2MNA A;  2ZTC A;  1QZG A;  1SRO A;  3S2H H;  3I2Z A;  1SR3 A;  4DV7 L;  2ZJQ A;  1L1O B;  2I5H A;  5IP7 H;  4LF8 L;  4GNX A;  1N34 L;  4BY7 G;  2ZJR A;  4A93 H;  5BR8 L;  2OQ0 A;  1GVP A;  1B8A A;  1KQS A;  4R4T A;  5IP9 H;  5GAE C;  4GNX C;  3KOJ A;  1QZH A;  3CCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...