1E7ZA

Crystal structure of the emap2/rna binding domain of the p43 protein from human aminoacyl-trna synthetase complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
173
structure length
173
Chain Sequence
AKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIKLEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II
publication title Structure of the Emapii Domain of Human Aminoacyl-tRNA Synthetase Complex Reveals Evolutionary Dimeric Mimicry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding domain
total genus 38
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1e7zA00
4OO1I 4JI7L 4DV1L 1WYDA 1S3OA 2AWNA 4APVA 1VQ8A 1J6QA 1C0AA 4K0KQ 3CC7A 4PZ6A 2JQOA 1FJGL 2IY5B 1TXYA 3J81i 4DUYQ 3ERSX 2OTJA 4IJLA 4DPGA 3OTOQ 1VQ4A 3TEHB 4KHPL 2N49A 2PI2A 5JJKA 3GTOH 4NB3A 4DR2L 2RCNA 2E2JH 1Y1VG 4WJ3M 2WB1E 4B3TQ 2AHOB 2XTIA 1Y1VH 2C35B 1L2FA 4HJAA 4C3JH 2CQOA 1KD1C 3EIVA 3PO2G 4OXPA 3RZDH 4JG2A 4L5TA 1TWFH 1C9OA 1X6OA 2ZTDA 4A3MG 1QZHA 1I94Q 3PO2H 2NZOA 1EWIA 1TWAH 1ASZA 1EFWA 5LMNW 1YHQA 1W3SA 1VQJA 3L7ZC 4IFDJ 2RHSB 3PUVA 3PUXA 1K8AC 1CKNB 4B3MQ 2WFWA 3KLWA 5LMUL 2R7DA 3GTQH 3K7AH 1NMFA 5IYCG 1VQNA 3M7NA 3J80c 4OO1G 1Z9FA 5IYCH 1VCIA 5C3EH 1Q86C 1QZGA 2KCMA 1EIFA 1CKNA 2Y0SE 4YHHQ 4DUZL 3TRZA 4JI5L 4MTNA 4DV2Q 2OQKA 3D0FA 2ID0A 2K52A 4LFAL 3S2DH 4UP9A 5K36G 3PIPA 4HJ7A 5EAYA 2MO0A 5IE8A 3I4NH 4RG1A 5JJLA 3RLOA 3KFUA 4BA2I 1IBML 4IJHA 4UP8A 1HNXL 4C2MH 2MO1A 2WAQE 4JI2Q 2ZJRA 3T1HL 1QVFA 1L1OC 4JOIC 3CD6A 4GKJQ 1FL0A 3GTJH 1YNXA 4A76A 3ICEA 3ULJA 4YY3L 4BBSG 2A8VA 3E0EA 3AFQA 2RF4A 3D31A 4LWCA 4C3IH 4BBSH 2K5VA 4IOAA 2VL6A 3KJPA 1G51A 1VQDA 4LFBQ 1HNWQ 4K0KL 2ZTCA 1Q12A 3STBD 1NTGA 1X3FA 2BH2A 4DUYL 1MJCA 1XTDA 1SMXA 3OTOL 5FLXc 3A74A 4JBMA 2IX1A 4GLXA 4A3CG 4A3CH 1GVPA 4NPSA 4KLKA 2A1AA 4HJ8A 4B3TL 4LF7L 2A19A 3BJUA 1HNZL 3AFPA 1XMOQ 4JYAL 1BKBA 1SRUA 3DLLA 1X55A 2IHFA 2JEBI 1IBKQ 2JA8G 2UU9Q 2PQAB 5BR8Q 2NVQH 1VQ6A 3HOWH 4DV7L 1K8GA 4JI1Q 5FLMG 2ZJPA 4NXMQ 2L15A 3I55A 3S14H 4L5QA 5JJIA 2R6GA 2CWPA 2KBNA 4DR1L 4A3GH 3HOVG 2AKWB 4B3ML 4A3DG 1KIXA 1VQHA 4A3DH 4YHHL 5AJ3Q 2UUCQ 5IYDG 5IP9G 4R4IA 1WJJA 4DV2L 5C4XH 3B6YA 4A3BH 5IYDH 1P16A 2QGQA 1HH2P 4GLAC 3HOZG 1KC8C 2Z6KC 2B63G 3HOZH 1K3RA 1I6HH 3KDFA 1RIPA 3F8TA 1WFQA 2NN6G 4TVAB 4JI2L 4GKJL 2LXKA 1E22A 2UXCQ 1E24A 3CP0A 4O0AA 4P71A 3KF6B 2UUBQ 2KHJA 1B8AA 5IWAQ 2Q2TA 2VNUD 2Q2UA 1E3PA 5M3FH 1QUQA 1UE1A 2ZM6L 4DR3Q 3S1QH 3S15H 4LFBL 1IYJB 1HNWL 4GLVB 4XTCS 3KF6A 2ALYB 1SFOH 4B3SQ 2K50A 1C7YA 1EYGA 3HKZG 1N32Q 4QGUA 5GAHC 4Y7NH 2JA9A 1N34Q 4AYBE 3JAMc 1UWVA 3CCVA 1G6PA 4GN5A 3M9BA 1LM0A 1E1OA 2I5HA 4EX5A 2VUMH 3DM3A 3NENA 5H1SE 2QEXA 4A3KH 1IBKL 5HY6A 3U50C 2HIVA 3A5ZB 4PZ8A 5ELOA 1OXTA 2UU9L 4YY3Q 5BR8L 1LTLA 1PYBA 3STBC 3IRBA 4JI1L 3PCOB 2ATWA 1P8LA 1WOCA 4NXML 3I7FA 4YWMA 1Q1BA 1YEZA 2UUAQ 4A3LG 4HJ5A 2I5MX 4A3LH 4GOPC 3ULLA 4AIMA 2R92G 3H3VI 3SGIA 4OWTB 4POGA 2H5XA 2R92H 1N33Q 4BY1G 5AJ3L 2UUCL 4BY1H 5HGQA 2WB1G 3WWVA 3UE0A 2WP8J 2OTLA 3RLFA 2D0PA 4YWLA 2EXDA 2R7FA 4X66L 4Y52H 2EQSA 1N36Q 2JEAI 3CAMA 2E2HH 3ZJYC 4J15A 1I5FA 2I5LX 4BXXH 3HFZB 1Q82C 2LSSA 2YU9H 1QVGA 3K81C 4JI8Q 1YHAA 4OWWB 1JJGA 3TS2A 1T9HA 2UXCL 4DR6Q 4L5SA 4GN3B 4HIMA 4IPHA 4P72A 2UUBL 5IWAL 3CCMA 3UDFA 1OXUA 3BU2A 5C3EG 2Y0SG 3EBEA 1M90C 3S1NH 1AH9A 2IX0A 4DR3L 3CCRA 3G6EA 4JC0A 3NELA 4GNXC 1YITA 4B3SL 3HKSA 4YCWA 4DV3Q 1YJ9A 1XNRQ 1N32L 3CW2C 1PV4A 2VS1A 5C0XI 1N34L 4DV0Q 4MNOA 4LF6Q 3CMAA 1VS0A 3I4NG 3F2CA 3FHWA 1D8LA 2WAQG 4EQ5A 1BBUA 1XPUA 4QQBX 5GQOA 4A93H 1Q7YC 3KJOA 3G4SA 3PV0A 1XNQQ 2F3IA 3EN2A 3M4PA 1B70B 3TREA 3GO5A 4PG3A 4LF4L 4DV4Q 1L1OB 2JA7G 2JA5G 2I0QA 1Q1EA 2JA7H 2UUAL 2JA5H 4DAYB 3T1YQ 1R9TH 2F4VQ 2BA1A 3GD7A 1UE7A 5M3MH 1J5EQ 1CKMA 1L1OA 4JOIA 4DNIA 2PI2E 2VQEQ 4A75A 1N33L 4DR7Q 4UPAA 1PFSA 5GAGC 3OW2A 1B7YB 3RZOH 4IOCA 2HQLA 4PMWA 1U5KA 1PH9A 1N9WA 2VW9A 3I4MG 1PHJA 1N36L 1NJIC 1SR3A 3I4MH 1KHIA 1VQAA 1V43A 4AH6A 3HOWG 1AE3A 2BH8A 4JI8L 4X65Q 3W1GA 1BBWA 3F1ZA 3K80C 4LUOA 1YJWA 1I94L 4A3GG 5J3BA 5M5XH 4DR6L 2IHEA 2PQAA 3UDXA 1HZCA 2HT1A 4JBWA 3CCUA 5M5WH 1GKHA 4X6AH 3RN2A 4LNQA 4P75A 2JJQA 4JI0Q 3GTKH 2NZHA 5IYBG 2K5NA 4C3HH 2YTXA 4JCVE 5IYBH 4DV3L 1XPRA 1PH4A 1XNRL 4A3BG 1A0IA 3NBHB 4DV0L 4A3JG 4MZ9A 4LF6L 5IT9c 3H0GH 4A3JH 1UEBA 4QJFA 1VQFA 2GN5A 2YTYA 4X64Q 4NXNQ 1PVOA 1K73C 2ASBA 1HR0Q 1PA6A 3BZKA 1X3GA 5DLQE 1HZBA 1MJEA 1SN8A 1MKHA 2Z0SA 3UDGA 3PO3G 3CC4A 4X62Q 1JB7A 4DV4L 3S17H 3PO3H 1NBWA 2BA0A 2AMCB 4OONA 4P73A 2Z6KA 1Y1WG 5IP7G 3NEMA 4GN4B 5M3FG 3GDEA 1K83H 1Y1WH 4LF5Q 5IP7H 3T1YL 2R93H 2B3GA 3KYHC 1G291 4LUVA 4A3FG 3PUZA 4TQUS 1OXSC 2PMZE 2GVBA 3UDIA 2K4KA 1KL9A 5M5YH 1TWGH 4AYBG 4A3FH 2NVYH 4BBRG 2MFIA 3AQQA 3AEVA 4BBRH 1VQPA 3AYHB 1SE8A 2YV5A 1L0WA 3CPFA 3S1RH 4IFDI 2UXBQ 2CCZA 2VUMG 2K75A 4OWXB 3L2PA 4KI0A 3KOJA 3CMEA 1FVIA 3MEFA 3MXNB 4A3KG 1WI5A 1EIYB 1XMOL 3PUWA 2VY3A 3TS0A 3I2ZA 2Q2HA 4LUZA 3CXCA 1IL2A 2XGTA 2VQFQ 4HJ9A 4X65L 2MQHA 4JBKA 2E5LQ 3S24A 1YVCA 1D7QA 1KXLA 4O2DA 3CCJA 2PNHA 4B3RQ 1EUJA 4P74A 3G71A 2QA4A 1XJVA 1X56A 4PZ7A 1S40A 3G48A 1N8RC 4JI4Q 3H15A 4JI0L 4ALPA 4DR4Q 4GOPB 1PH8A 3HOUH 1NE3A 3CCSA 1EQRA 3M4OH 1LUZA 4DV5Q 4OX9Q 2CKZB 2CWAA 1AE2A 1HNXQ 3PGZA 3J81c 4GOPA 2IT1A 1VQ5A 5ELNA 5C4XG 1XMQQ 1BVSA 4BXXG 4IFDG 1CSQA 1Y14B 4NXNL 3W1BA 1VQOA 1HR0L 3L0OA 1JJCB 1OXVA 4DV6Q 4R4QA 1VQIA 3PIOA 4X62L 4JI6Q 2B29A 3J81j 4DR5Q 2HHHQ 3M4QA 3CPWA 1KQSA 4R1JA 4JV5Q 4IPDA 4LF5L 2K5HA 3K8AA 1VQLA 3M85A 4XIGS 1VQKA 3CCQA 5GADC 3RLNA 2N8NA 3U4ZA 1CUKA 1VQBA 2N3SA 3VDYA 4POFA 4LF7Q 1HNZQ 2V1CC 3ER0A 4GNXB 4JYAQ 3H3VH 2UXBL 4JI3Q 4QL5A 2E2IH 2DUDA 1PH3A 4DV7Q 1V9PA 3OYYA 3J80i 3ULPA 4A93G 1ASYA 1OXXK 3PF4A 4GNXA 4RMFA 3E9HA 4A3MH 2HIXA 2R7ZG 3S16H 3CC2A 2NVXH 4AQYQ 4DR1Q 2R7ZH 1A63A 3RN5A 4GKKQ 1EOVA 4R4OA 3CCLA 1IXRA 2VQFL 1E1TA 3I4OA 3S2HH 2E5LL 1PH1A 1JT8A 1SROA 5M3MG 3J7ZC 4B3RL 1Q8KA 1Z47A 1I50H 2EIFA 1S72A 4JI4L 1JE5A 4R4TA 1KRSA 5IY0A 5GAEC 1MIUA 1HZ9A 2D0OA 1PH6A 1IBLQ 2ZTEA 1UE5A 3GTGH 2DGYA 4DR4L 3A5UA 1CKOA 3GTLH 4DV5L 2AWOA 3U58A 1QVCA 4OX9L 1TWHH 2GVAA 1EQQA 1E7ZA 1XPOA 5LMNQ 4L5RC 3PF5A 5C0XG 1XMQL 1YBYA 3HOYG 1W2BA 2UXDQ 4QY7A 1A8VA 1VQEA 3HOYH 1JMCA 2MNAA 4UY8C 1SLJA 1YHBA 2KENA 1GM5A 3A0JA 4QIWE 4LF8Q 5C44G 2ZM6Q 4JBJA 4R4CA 4DV6L 1HR0W 5C44H 3W5OA 4JI6L 3LGJA 3F2DA 4DR5L 2HHHL 4JV5L 3M3YH 2FXQA 2OCEA 1HJPA 4YCVA 5JEAG 3GTPH 1X3EA 1LYLA 2F52A 1KRTA 5FJ8G 1X9NA 4LF9Q 2OWOA 3CQZH 5C4JH 2JA6G 5FJ8H 1K0RA 2NN6I 4A3IG 3KF8B 2CFMA 2JA6H 2NVTH 4A3IH 3H0GG 1VQGA 4ME3A 4YCUA 2YYZA 4FDBA 4JI3L 4LFCQ 2JA8H 1YZ6A 1DGSA 1A62A 4KHZA 3CF5A 4A3EG 4A3EH 4JI7Q 1OTCA 5C0XJ 4DV1Q 5FLMH 3E9IA 3Q8DA 1XNQL 4AQYL 4LW1A 5GROA 4GS3A 4DAMA 2K14A 3FP9A 3RR5A 1YIJA 3PUYA 1FJGQ 3HOVH 4GKKL 4DK6C 1IZ6A 1VQCA 1Q46A 2R93G 3K7UC 4HIKA 4BY7G 4KHPQ 2F4VL 1U0LA 4DK3C 4BY7H 3K0XA 1RL2A 3JC66 1J5EL 4HIDA 2YTVA 1X65A 5IP9H 4DR2Q 4WJ4A 5JEAJ 1IBLL 4X66Q 3KDFB 2VQEL 1FGUA 4DR7L 1O7IA 2E8GA 1NMGA 1PH7A 3U4VA 1CSPA 4YWKA 3RNUA 3J7A5 2B63H 2KCTA 1Q81C 1M1KC 1YJNA 4BA1I 3F2BA 5LMNL 1VQ7A 1H95A 2Q2IA 1KAWA 3PSIA 1QUQB 2OQ0A 2UXDL 4UP7A 4HIOA 3S1MH 1X54A 1HZAA 2JE6I 4H02A 2RHQB 5LMUQ 2KHIA 1PH5A 4LF8L 3TQYA 3JAMi 2ES2A 3BZCA 2N78A 1YI2A 1GO3E 2VZAA 4DUZQ 1TWCH 4IO9A 1JJ2A 4JI5Q 2LXJA 3FKIG 3UE1A 1VQMA 3I56A 1I3QH 3FKIH 4A4IA 3GTMH 3HOXG 4LFAQ 3HOUG 3HKZE 1VQ9A 4LF9L 3HOXH 3CCEA 4IPGA 5E7NA 2D62A 4DKAC 1PYSB 4IPCA 1PH2A 1IBMQ 2JK8A 1GD7A 3T1HQ 1NY4A 4LFCL 1K9MC 1WCMG 1V1QA 2ZJQA 4LF4Q 1UE6A 4X64L 1WCMH
chains in the Genus database with same CATH superfamily
3DWAA 3S2HB 1J8IA 5TSSA 1S3OA 2AWNA 1Q3LA 3SR1A 3MXUA 4NW2A 4HCSA 5M3MB 3QB3A 1FJGL 4ZUIA 1CT1D 3K5LA 1EYCA 1G2SA 2N49A 4O42A 5JJKA 4NB3A 3URYA 2XTIA 3HRZC 2C35B 1QJOA 4C3JG 1L2FA 1VDZA 3RZDH 4L5TA 1C9OA 4A3MG 1ASZA 5C44B 3EQLC 5LMNW 1EFWA 3L7ZC 1K8AC 5LMUL 4MIUA 2VB3X 1QZGA 2KCMA 3P7JA 1HA5A 2QILA 4YHHQ 4DUZL 3MHBA 4MTNA 4DV2Q 2JA6B 2K52A 4LFAL 1CA5A 4FXGC 5IOCA 1CI3M 2Z8LA 4XDXA 4DAPA 2EYOA 1S5CD 1A3UA 3RLOA 1IBML 4IJHA 4UP8A 1HNXL 2MO1A 4JI2Q 4GKJQ 1L1OC 3M4YA 4FNFA 4A76A 1WTOA 5D14A 2EOTA 4C3IH 1BO0A 2R93B 3G7LA 4N9PA 4BY7B 1G51A 1HNWQ 5M5YB 2ZTCA 1X3FA 3BYYB 3OTOL 3A74A 3KK7A 4GLXA 4KLKA 1XTCD 3HGBA 4B3TL 2IHFA 5CYUA 2UU9Q 3KF8A 4DV7L 1RKNA 2ZJPA 4I7ZC 4UAIA 1EZ8A 2L15A 3I55A 4NKLA 1SEBD 1LT5D 4WFN3 3HOVG 1V1PB 2C5CA 3VR6A 1LTSD 5AJ3Q 5C4XH 2SEBD 4CDDC 1HH2P 2EY5A 4IQZA 1EIGA 1KC8C 2Z6KC 2B63G 1Y8PB 2BCOA 2L11A 1I6HH 3OIPA 1RIPA 4JW0A 4TVAB 3KBGA 1E0BA 2LXKA 2MP1A 2NN6H 1SE2A 1M4VA 4CKEA 5EPJA 1ENCA 2KHJA 4ZUJA 1O80A 2Q2UA 1QUQA 3TP5A 4LFBL 3S15H 1MD2D 2XN9C 2E2JB 2K50A 2EY2A 1N32Q 5FKAC 1EOTA 3HG9A 4HSPA 2AUKA 5GAHC 2CH4A 2JA9A 2FFKB 2KCCA 3QIAA 4C3JB 3CCVA 1YNNC 1TIID 1S5DD 3M9BA 2I5HA 1E1OA 1TWFB 5H1SE 1S5FD 1TWAB 4A3MB 1IBKL 2HIVA 4KN7C 4PZ8A 5CR3A 2NYZD 2M2LA 2ATWA 1P8LA 2J0TD 1WOCA 1YEZA 3D3RA 4HMIA 3KLSX 4GOPC 2RDHA 4OWTB 1PLFA 2H5XA 2KUMA 2UUCL 1DONA 3WWVA 5JAVA 3NBIA 5CGKA 3LX0A 4Y52H 2B2UA 4X66L 5FLXE 2EQSA 3CAMA 2E2HH 1I5FA 1GUTA 1SBBB 4QIWB 4IALA 1ET6A 2YU9H 4OWWB 1YHAA 2EXZA 2J7ZA 4DR6Q 3K6OA 4HIMA 4K5VA 5IWAL 1HUMA 3UDFA 4B9XA 3S1NH 2F0WA 2Y0SG 1AH9A 5I9PA 5CMDA 1LTTD 4RKBA 1PZJD 1YITA 1XNRQ 3F2UA 4XT1B 5C0XI 1TU2B 2EZVA 2NVQB 1D8LA 2DN8A 4EQ5A 4QQBX 2MPMA 3KJOA 1XNQQ 3M4PA 3GO5A 3HOVB 1EEID 3MFYA 5I2YA 1SYBA 1L1OB 3A7AB 2I0QA 2UUAL 3TMEA 2JA5H 1HRJA 2F4VQ 3GD7A 3OOCA 4JOIA 4I7AA 1K3BC 4A75A 1N33L 1F2YA 4UPAA 4DAYA 5GAGC 2B63B 3OW2A 4XYOA 1ZXTA 2HQLA 5KNBA 1L0XB 3KBXA 3I4MG 1PHJA 1NNXA 2KCNA 1VQAA 1V43A 4AH6A 1LTID 4XYQA 3MEHA 3W1GA 3F1ZA 4FVMA 1JOQA 1D5MC 2Q8RE 5M5XH 2IHEA 3DWQA 3ND8A 1SAPA 1GKHA 3RN2A 1KDBA 2JJQA 4JI0Q 5I4DA 3GTKH 2K1BA 4JCVE 1PH4A 5C4XG 1A0IA 1EFID 4HN7A 4H0LC 4LF6L 5IGDA 4N8X1 5LL6X 1LLRD 1VQFA 2GN5A 3KLRA 3FMCA 1PVOA 2JYOA 2WV6D 1LTGD 3SK4A 5KNCA 1MKHA 3UDGA 5C3WA 2AQ2B 3N6RA 1RJTA 3C1FA 4X3UA 2AMCB 4P73A 5KYLA 2QCPX 4RGMA 3NE5B 1G291 4A3FG 3PUZA 1OXSC 5ISRA 4AYBG 5CORA 1AN8A 3AQQA 2A73B 1PTOB 2EDGA 4BBRH 2K33A 1VQPA 1SE8A 1HQMC 1ICWA 2CW0D 3I4LA 4OWXB 3NWTA 4QUCA 1PZKD 3CXCA 3NQTA 3MXNA 4HJ9A 4X65L 2Y0SB 1EY5A 4KY6A 4L8JA 5KGUA 2SOBA 1KXLA 1D1KA 2QA4A 2O5IC 2K05A 1SYCA 3MC0B 2OXPA 1B9MA 4GOPB 1PH8A 4RWSC 1EY7A 3CCSA 1EQRA 1F77A 1LUZA 3HP3A 4RGOS 3M4OH 4ZK9B 3SK8A 2CQAA 1LTAD 1MI2A 4DA2A 2F0IA 5C5LA 1GXDC 2F3WA 1RTNA 2ENBA 4IFDH 2H1EA 3ND9A 3L0OA 1R9TB 4DV6Q 4R4QA 3PIOA 2PO4A 4OEMB 4IPDA 4LF5L 3K8AA 1VQLA 5DM73 3CCQA 3RZOB 3RLNA 4QB4A 1SNCA 3W2DA 4CDEC 4R8NA 5I6YA 3OWFA 1B9NA 4FF2A 3IKJA 3I4MB 2F4IA 4YIJA 1DXMA 1HTPA 3ER0A 2UXBL 2E2IH 5FO9B 4RHRA 1ASYA 1BOSA 4GNXA 3CC2A 4UDUC 1A63A 1PXUA 2QKIC 4LMQD 4CKBA 2VQFL 3S2HH 2E5LL 3SHLA 3J7AF 5C4XB 2DJGC 5FK9C 1TS4A 3FPPA 1ZKOA 5EKLA 1PH6A 1IBLQ 1HZ9A 2ZTEA 4DR4L 2A5HA 5KNDA 5K36H 3EVQA 3V96A 1CKOA 2Q8IB 4DV5L 2EYHA 2A68D 1K28A 3VR2A 4KN4C 1Q90A 1W2BA 3NHHA 4UY8C 1SLJA 1X32A 4QIWE 2PMZB 2ZM6Q 5C44H 5EKKA 4EVOA 4A3FB 3AB9A 4DR5L 1WTPA 4KMUC 4AYBB 3ERQA 5ELDA 1HJPA 5IGFA 1X3EA 4LF9Q 1KRTA 1X9NA 4CBVA 5FJ8G 1MBYA 2B2VA 5IGBA 2OWOA 1HFGA 4A3IG 2ZXRA 3KF8B 2JA6H 4LFCQ 1DGSA 1A62A 3VR5A 5C0XJ 5IGCA 1XNQL 1C4QA 2RCFA 5GROA 3C2PA 3N52A 4GS3A 1FJGQ 4ZAIA 2PZUA 1IZ6A 1VQCA 1Q46A 1SNPA 1STBA 2F4VL 4BY7H 3A56A 1RF2D 1X65A 4WJ4A 3VYSA 4DR7L 1FGUA 3U9SA 1PH7A 3U4VA 1Q81C 1H95A 2GA4B 2Q2IA 2L55A 1EWCA 1QUQB 4CDCC 5KRUA 4UP7A 1X54A 2JE6I 5DNFA 5LMUQ 1FNWA 2NTSA 4LF8L 2N55A 2ES2A 2SNSA 1YI2A 1JE4A 2KVMA 2VZAA 2K04A 1TWCH 4DUZQ 1JJ2A 2LXJA 1KLGD 3UE1A 4FYDA 3NSWA 1I3QH 3HOXG 4LFAQ 3PQIA 2NBFA 4IPCA 1H9JA 1IBMQ 2EJFC 3S16B 1T5EA 1GD7A 2IY5B 4DV1L 3R2IA 4APVA 3D4WA 2XVSA 1S5ED 3M7GA 2K01A 2JQOA 3FEWX 1U4LA 2E2DC 2KA7A 3GTGB 2OTJA 4DPGA 3OTOQ 1VQ4A 1RHPA 4KV6A 2BDOA 5I6WA 4J6HA 2PI2A 4R8IA 1TWHB 3MA2B 2E2JH 1Y1VG 3A8KE 3J7YW 1ET9A 4B3TQ 2AHOB 4K5WA 4HJAA 1WTQA 4C3JH 4CJ2C 4X3SA 1PYWD 5E4WC 1TWFH 4HTHA 1X6OA 3ZYYX 1I94Q 1TWAH 1YHQA 1V1OA 3PUVA 3PUXA 1CQFA 1CKNB 2WFWA 5JPMC 3M7NA 3GTQH 5IYCG 1NMFA 5IODA 3M3YB 4OO1G 1Q86C 1EY0A 5C3EH 3GTKB 1B3AA 2Y0SE 3TRZA 3L9AX 1F9RA 4A3IB 3D0FA 2ID0A 3NK9A 5K36G 4HAEA 5EAYA 2MO0A 5IE8A 3I4NH 1DOMA 1GUWA 4BA2I 2HD3A 1CQVA 2ZJRA 1O78A 3CD6A 1YNND 2KHSA 4CJ0B 4YY3L 4BBSG 2A8VA 3D31A 2RF4A 4LWCA 5JJZA 1SYFA 2K5VA 3O13A 2RSNA 3NTKA 3KJPA 4LFBQ 4OHJA 4ZCKA 4DUYL 1MJCA 1XTDA 1SMXA 2JSOA 5FLXc 4A3CG 1B2TA 2A1AA 2A6HC 2A19A 3BJUA 1IBKQ 1DZ1A 2NVQH 1O7YA 5C4HA 1JOKA 1SNDA 1H9KA 2KBNA 4B3ML 3RUZA 3HKZB 1U9RA 1D5ZC 4Q5VA 3K5OA 4A3DG 1NSNS 1VQHA 3HOXB 2UUCQ 5IYDG 4ME5A 4EQNA 4ODGA 1EY4A 1JICA 2BOSA 2RBMA 5DM63 3HOZG 4U673 1VF5C 1I4GA 3MXGA 1H9SA 3KDFA 4RH6A 5T1IA 1R4PB 3J80L 1WTVA 3KF6B 1B8AA 5IWAQ 2ZM6L 1BXTA 4DNRB 1C7YA 3LWUA 4KK7A 3H91A 4QGUA 1Y1VB 4AYBE 2OF1A 2SNMA 4GN5A 3C46A 1G6PA 2E2IB 1A3TA 4A3KH 1HHVA 3A5ZB 3DUZA 5BR8L 5G3LD 1LTLA 1PYBA 3STBC 2F0QA 3GQBA 3EJIA 2AQ3B 1AFPA 4H13C 4NXML 2UUAQ 4A3LG 4HJ5A 5C4ZA 4AIMA 2R92G 1AP0A 3S2DB 1N33Q 4BY1G 1JB3A 5HGQA 2WB1G 2WP8J 5EGTA 1QG7A 4DK0A 2K6AA 1SMYC 4LAAA 3TDQA 1PTOH 4J15A 4MN3A 3ZJYC 1R4QB 2I5LX 2WKDA 3I91A 4BBSB 4KHVA 2LSSA 3K81C 1CZWA 1T9HA 2UXCL 4IPHA 4ABNA 1BF4A 1OXUA 3BU2A 2QF7A 5C3EG 1ZYRC 4HR7B 4DR3L 3G6EA 1D2BA 4JC0A 1Z6HA 1VMCA 3HKSA 4B3SL 1Y8OB 2VS1A 1AW7A 1N34L 4MNOA 1X3QA 4LF6Q 2L9HA 1VS0A 3I4NG 1QOHA 1I4RA 3IL8A 1GJXA 5GQOA 1Q7YC 3NUCA 3D6CA 2XRSD 3G4SA 3PV0A 2F3IA 4A3GB 3KUPA 3TREA 4RGTA 4TRDA 4A3DB 1Q1EA 5DAUA 1R9TH 3OWEB 4JPBW 1WTRA 1PFMA 3JAML 4DU9A 2D9UA 3HOZB 1EWHA 1B7YB 3RZOH 1C8CA 1U5KA 1HFNA 5T1GA 1Q8IA 3QOLA 4LJZC 1N36L 1SR3A 1D5XC 1KTKA 3I4MH 2PCFB 1GUGA 1AE3A 1AEXA 1TVXA 1UNSA 3J7AV 4PMBA 4X65Q 1BBWA 2O2LD 3K80C 1I94L 2JP1A 5AFWA 2N88A 3UDXA 3P1HA 1TWCB 3GV3A 1HZCA 2JXMB 2HT1A 1I3QB 4LK1C 4X6AH 4P75A 4C3HG 5IYBG 5JEAH 2YTXA 5C5MA 3NBHB 2M00A 4DV0L 4A3JG 1KDCA 5M9OA 3H0GH 1BDOA 1I4HA 1SXTA 4X64Q 4NXNQ 2Q8TA 3I72A 3DEOA 3BZKA 1X3GA 5DLQE 1SN8A 3NTHA 4K6DA 4DV4L 1NBWA 2R92B 1Y1WG 5IP7G 3NEMA 4PNYA 4LF5Q 4BY1B 2B3GA 4LUVA 1PTOC 4TQUS 2WB1B 3UDIA 4A3FH 4PMCA 2RKSA 2MFIA 1RTOA 1STAA 5KIXA 2YV5A 1L0WA 4IFDI 2UXBQ 4P2CB 4A3KG 4G57A 5ELCA 1EIYB 1F2MA 4ILWA 2F0HA 3I2ZA 1C48A 3GTQB 2VQFQ 5C3EB 1H9MA 2E5LQ 3S24A 3H3VC 5CC4A 1VMPA 3G71A 2B2TC 3G48A 1B50A 4L6TB 5IGEA 3T13A 4ALPA 4DR4Q 1UUPA 3HOUH 3I4NB 4DV5Q 2CKZB 1NCVA 1GUSA 2B2YA 2CWAA 2K03A 3WOFA 3PGZA 2I46A 3U9OA 4XT3B 1VQ5A 5ELNA 5ELFA 1BVSA 1CSQA 1SE3A 3E0JA 2F0SA 3X3NA 1HR0L 1K8MA 3BDCA 1OXVA 1BCPC 1VQIA 1NUCA 3QWNA 4X62L 2B29A 3D8GA 4DR5Q 3M4QA 3M85A 3CRLC 3IAYA 2N8NA 1CUKA 5IT9L 3VDYA 1PTOF 2XWJB 1S5BD 1SSOA 3OMGA 1HNZQ 4LF7Q 4JYAQ 1T5XD 4RCNA 3SK5A 1V9PA 1DOLA 3OYYA 3ULPA 1OXXK 1GHJA 4RMFA 2IPKD 3S16H 3Q0AA 2NVXH 4K14A 3RN5A 2PW5A 4R4OA 5M5WB 3DEPA 1K0SA 2IW3A 1PH1A 4C3HB 1G2TA 1SROA 4J8QA 3ONAB 1E2VA 2ZT9C 4IUPA 3J7ZC 4JI4L 4K2LA 4R4TA 4DR7Q 3GTGH 4A3JB 1UE5A 2MHVA 2DGYA 2XWBB 3A5UA 2E74C 4OX9L 2AWOA 1QVCA 1TWHH 1MSHA 1CHQD 1SJED 1GOZA 2WIIB 3DXJC 1XPOA 2SDFA 3ITPA 3FVQA 2BDNA 1XMQL 1HCZA 3HOYG 4QY7A 1A8VA 1VQEA 1LABA 2NZ1D 4H7BA 1Y1WB 3A0JA 4LF8Q 1O7LA 4JBJA 4N8FA 1TWGB 4WRDA 2NVYB 1BCPF 2HHHL 4ZRZA 1DCZA 4KY7A 3M3YH 4YCVA 5JEAG 1NR4A 1VF7A 3OSOA 2CHBD 3J81L 1LYLA 2IX1A 1IYVA 5FJ8H 1K0RA 5A2QL 4A3IH 3GP7A 3QJYA 3H0GG 4ZKCB 4A3KB 4JVZA 4RKLA 1ENAA 1VQGA 4ME3A 2YYZA 4FDBA 1LTBD 2PZTA 2RA4A 2EYMA 3CF5A 4A3EG 2A6EC 4DV1Q 3E9IA 5CV8A 3Q8DA 4AQYL 4LW1A 4C1NK 1YIJA 3R93A 4DAMA 4GKKL 3PUYA 3C3LA 4HIKA 1SDFA 1M8AA 1TY2A 3NPPA 1U4PA 4IURA 5FOBB 3K0XA 1RL2A 2OEOA 4DGZA 3JC66 2YTVA 5IP9H 4F87A 1H9SB 3KDFB 5DEHA 1NMGA 1GUOA 4YWKA 3RNUA 3J7A5 3H94A 1PRTC 1SYDA 3OPOA 1M1KC 1YJNA 5LMNL 2QDLA 2OQ0A 4HIOA 4H02A 3TZUA 3Q23A 4DAVA 5JVG3 5FO7B 1JR0D 5KEEA 1ESFA 3BZCA 1EIHA 5ELBA 1GO3E 4IO9A 1VQMA 3I56A 4A4IA 1XWEA 3HOUG 5EKIA 1VQ9A 3HOXH 1STGA 1TR5A 1WCMG 1V1QA 2ZJQA 4LF4Q 4X64L 4NXNL 4YY3Q 2A6HD 4JI7L 3K5MA 2EYPA 1TY0A 2PPBC 1J6QA 2B2UC 1I50B 4PZ6A 2F0PA 1IKMA 1TXYA 3J81i 4DUYQ 1BCPB 4IJLA 4KHPL 1JWSD 3TBIB 2RDFA 3QOJA 4G4KA 3HS0C 1HA6A 3GTOH 2AUJD 4DR2L 2WB1E 1Y1VH 1E2WA 2CQOA 3SEBA 1KD1C 3HOYB 3EIVA 3PO2G 3A55A 4JG2A 1QZHA 5CBAE 2ZTDA 1L0YB 1PRTF 2EVBA 4IFDJ 1VQJA 1F2LA 2F0LA 4B3MQ 3KLWA 2AQ1B 2R7DA 1VQNA 1SYEA 4ZQ3A 3P75A 1Z9FA 5IYCH 1VCIA 4OO1H 3CQZB 5C4JB 1ESRA 1SE4A 1ONLA 2FJ2A 3H0GB 2BE5C 2CVRA 3S2DH 2JA8B 1LT4D 5JJLA 4A3EB 1LT6D 3R8BA 3UI2A 1WD1A 3NTIA 4JOIC 1KABA 1FL0A 4NMZA 5JOBA 1YNXA 4DFAA 3V2TA 3ULJA 3E0EA 4BBSH 3KLSA 4IOAA 5CV5A 1NR2A 1VQDA 4K0KL 2EY1A 3STBD 2B2WA 4NDXA 2J4XA 4JBMA 4A3CH 2F3VA 4NPSA 1F9PA 1BQQT 4HJ8A 1HUNA 4LF7L 1HNZL 3AFPA 4OELB 1XMOQ 4JYAL 1BKBA 3VR4A 2EYLA 2JEBI 2D5DA 3OHXC 5BR8Q 1VQ6A 5LL6S 3HOWH 1B53A 1SMYD 1K8GA 2QDBA 1JORA 4NXMQ 3S14H 5JJIA 3D4RA 2R6GA 4A3GH 4DN4M 1PDQA 2L12A 3LWEA 4C56C 1G91A 4KJOA 3GTMB 1KIXA 1TT2A 3HOUB 4A3DH 1V1PA 1GUNA 5IP9G 1WJJA 3C1EA 5IYDH 3BDLA 4GLAC 1FD7D 3RD4A 3HOZH 1K3RA 1WCMB 1CK1A 1WFQA 4IZ8A 4KKSA 1DYQA 1E22A 1PRTB 1E24A 3CP0A 4P71A 2UXCQ 3CU7A 2X6GA 2L4NA 3S1QH 4DR3Q 4N9TA 2IL8A 4GLVB 3T53B 1B3QA 2ALYB 2VB2X 4B3SQ 1EYGA 3HKZG 4ZLTF 1N34Q 3E5SA 1QE6A 5EQ0A 2VUMH 3PO2B 3NENA 1LO5D 1AZPA 1BNZA 3MZ5A 2NVXB 2EYJA 3U50C 5ELOA 4HEDA 1QCBD 4JI1L 3PCOB 2K5QA 1X3PA 4X3KA 4YWMA 2C9OA 4A3LH 1SJHD 3H3VI 3SGIA 2R92H 4BY1H 4QF4A 3UE0A 2OTLA 2D0PA 4YWLA 2R7FA 4ZKBB 4CHTB 1N36Q 2JEAI 5I9OA 3QG1A 3GTJB 2IJ0A 1MHWC 4CGYB 5J1ZA 3IFDA 4BXXH 1Q82C 1IHZA 5BN4A 2K32A 1IL8A 1QILA 4L5SA 4X3TA 5CV7A 4P72A 2UUBL 2EE1A 2IX0A 3CCRA 4HCEA 4GNXC 1YJ9A 1DJRD 2DNEA 4DV0Q 3DMUA 3LNNA 3CMAA 1PTOD 1V8QA 3EA6A 3F2CA 3FHWA 2WAQG 1BBUA 1G8ZD 2IX3A 1HXYD 4ID6A 3EN2A 1WD0A 2EY6A 1EQTA 4LF4L 4DV4Q 2JA7G 2Z4IA 2F03A 1QNKA 1RODA 4DAYB 1SNOA 1J5EQ 1CKMA 1L1OA 4G7HC 1W6KA 2VQEQ 4CJ1B 5CV9A 3VYRA 3CHBD 4PMWA 1I6VC 3BZDB 1PH9A 2VW9A 2HCIA 1NJIC 1WTHA 3JAME 1JOOA 2KEDA 2KQ3A 4XQJA 3T56B 2DNCA 3HOWG 1GHKA 2BH8A 2JN4A 1TS2A 2B2VC 4JI8L 5COYA 5LHY1 5M3FB 1YJWA 2CH4W 4A3GG 2PQAA 3BVMA 1SFOB 1F2ZA 1MSGA 4JBWA 3CCUA 1FNVA 3MVVA 5M5WH 4Y7NB 1WTXA 4LNQA 1BCPD 2NZHA 4C3HH 5IYBH 4DV3L 1EQVA 2P5ZX 3E6ZX 5EPLA 2NTTA 4K8IA 2QW7A 3D6WA 2WKCA 2ZXOA 4A3JH 3H6MA 4RCOA 1K73C 2LKVA 1HR0Q 4FO2A 4M8AA 1HZBA 1MJEA 3PO3G 3CC4A 4X62Q 1JB7A 2Z6KA 4GN4B 4OIJA 1Y1WH 5IP7H 3T1YL 3KYHC 3CRKC 3GTOB 2PMZE 2GVBA 1KL9A 3T16A 1TWGH 4IUQA 2NVYH 3TP8A 2L1BA 3TP7A 3T4AC 2CCZA 2VUMG 2K75A 4QUFA 1YNJC 1EY6A 2HDLA 3KOJA 3CMEA 3MEFA 3MXNB 3VA7A 1WI5A 4XQQA 1XMOL 3PUWA 3TS0A 5BN3A 3G6JB 1JWMD 2Q2HA 2RDGA 1IL2A 2XGTA 3R2TA 2ZXPA 5C6AA 1YVCA 1D7QA 4O2DA 3CCJA 1EUJA 4P74A 4JI4Q 1XJVA 1X56A 4PZ7A 1S40A 4K6LA 4EQOA 2XIWA 1NE3A 2WAQB 4OX9Q 2G9HD 1AE2A 2K5DA 5F2DA 1A6XA 4GOPA 2IT1A 1XMQQ 4BXXG 1Y14B 2JA7B 5D3DA 2TMPA 2A6ED 4J1MA 2F1MA 2PNRC 2HHHQ 1KQSA 1CTMA 3A7LA 1F9SA 1CHPD 5IIFA 1VQKA 4DXFA 4XIGS 1IW7C 5GADC 3U4ZA 1VQBA 4WJWA 4POFA 2QEJC 3BS1A 2V1CC 1UEAB 4GNXB 4FF3A 3H3VH 3HOWB 2DUDA 3J80i 3OIQA 2WINB 2Z1CA 3PF4A 5IT9E 3E9HA 2R7ZG 2HIXA 3S14B 4AQYQ 4DR1Q 2E75C 3P20A 1PRTD 1STNA 1II3A 5D65A 4GKKQ 3HZXA 3CCLA 1IXRA 3A8JE 1B4OA 2LY7A 2MGSA 3BG3A 4B3RL 1EEFD 1Q8KA 1Z47A 1I50H 1EY8A 2EIFA 1S72A 1KRSA 1MIUA 2D0OA 1Z7TA 1I4PA 3U58A 1STEA 4QMGA 2B39A 1CA6A 5LMNQ 3FRPB 1SNQA 1YBYA 3S17B 3PO3B 4XXEA 2PQEA 2RSOA 2XNAC 3HOYH 2MNAA 1K83B 1YHBA 2KENA 3S1QB 2NB0A 2R3ZA 1RCVD 3BDOA 3W5OA 4JI6L 2FHTA 4JV5L 4K2KA 2FXQA 3S1RB 3EROA 1CZGA 3CQZH 1FYCA 2F0GA 1U4MA 2NWGA 5C4JH 2VUMB 1XYIA 2FMCA 2RQXA 3I8ZA 4JI3L 2JA8H 1FNUA 2F0DA 4KHZA 4A3EH 4JI7Q 3J81E 1OTCA 1A3VA 3TP6A 3T51B 5FLMH 1UAPA 5A2QE 1AZQA 1A2TA 3FP9A 3RR5A 1LTRD 5NUCA 1HQRD 3Q22A 4KHPQ 1LT3D 1J5EL 4HIDA 4DR2Q 5JEAJ 2DJFC 2VQEL 1JQYD 1O7IA 2E8GA 3W3AA 4IUVA 1EU3A 4IN3A 4BA1I 3F2BA 2BE5D 1F9QA 3L3OC 2LS01 2UXDL 3V05A 3S1MH 3OW7A 5K5PA 2RHQB 4DXGA 1PH5A 3K57A 3TQYA 3JAMi 2Z6BA 2L0CA 3BVGA 3FKIG 3K5NA 3GTMH 3PIP3 2NUCA 3HKZE 4FXKC 3CCEA 3DM1A 2EPBA 1DOKA 2FMMA 5E7NA 1WVLA 1PH2A 3AU7A 1NY4A 2R7ZB 3TN2A 1UE6A 1WCMH 4OO1I 1WYDA 2R61A 1VQ8A 1SYGA 2XRQD 2RVLA 1C0AA 4K0KQ 3CC7A 5BN5A 5ELEA 3ERSX 4EGVA 2KJXA 3IFTA 1OO9B 3TEHB 1SNMA 4KTAA 3GTLB 4WORA 4C1NI 1EL0A 2RCNA 4WJ3M 1TKWB 5CBEE 1JCKB 1A15A 4OXPA 1IKLA 3PO2H 2NZOA 1EWIA 4BWGB 4GZYC 1W3SA 2RHSB 5HGTA 1FGBD 3K7AH 4OL7A 3J80c 3GTPB 1EIFA 1I4QA 2VXWA 1CKNA 4JI5L 2OQKA 2NVTB 4UP9A 3HEJA 3PIPA 2F0OA 1XXGA 4RG1A 3KFUA 1QVFA 4C2MH 2WAQE 4Q0FA 3T1HL 3GTJH 5CV4A 3ICEA 1BBXC 4C3IG 3AFQA 2PZWA 2VL6A 2L5TA 1PZID 2K7VA 2A69C 1Q12A 2E76C 1NTGA 2BH2A 3MXPA 4F88A 2G9DA 3TZDA 2F0KA 4OGQC 3E3XA 1GVPA 4KD4A 1A2UA 4QCLA 4IUUA 2JA8G 1SRUA 4FP5D 1X55A 3DLLA 1D6EC 4B08A 2PQAB 2HDMA 4JI1Q 5FLMG 2DY8A 4L5QA 4DR1L 2CWPA 1DD2A 1PMRA 2AKWB 4E6IA 3FKIB 3NWSA 2WACA 5HURA 3K59A 4YHHL 3MFGA 4R4IA 2TSSA 4DV2L 4A3BH 3B6YA 1P16A 2B8GA 5EPKA 2QGQA 2Z9HA 1HPCA 3VA5A 1U4RA 3F8TA 3FDTA 3FPUB 2NN6G 4JI2L 2HUGA 4HSVA 2OT2A 4GKJL 3PIO3 3MAQA 4O0AA 1KDAA 1KLUD 2UUBQ 2Q2TA 2VNUD 4RFBA 1E3PA 5M3FH 3NP8A 1UE1A 1HNWL 1IYJB 4XTCS 3KF6A 1SFOH 3BVZA 4HMJA 4Y7NH 3JAMc 1UWVA 2X6LA 1ENFA 3RZDB 1LM0A 1KAAA 4EX5A 3DM3A 5JVH3 2QEXA 5G3LF 5HY6A 5FO8B 1OXTA 2UU9L 4EQPA 2O5JC 1K8OA 3IRBA 3DWPA 2D2CC 3I7FA 1Q1BA 2B2YC 5FLXL 1QNUA 2I5MX 5JPNC 3PMFA 3ULLA 3K58A 4POGA 4DNTB 5AJ3L 2HQEA 4L63B 3I73A 2PYKA 3RLFA 3TSSA 2EXDA 1Y69U 1TS5A 3VYTA 3X3MA 1LACA 3HFZB 4V190 4C3IB 4U68A 1QVGA 4JI8Q 1JJGA 3TS2A 4GN3B 3CCMA 1KNAA 3EBEA 1M90C 1MGSA 2MUYA 1EZ6A 3NELA 4YCWA 4DV3Q 1N32L 1B44D 3CW2C 1PV4A 2X69A 5E4XA 4CDFC 1WTWA 3MWYW 4RHSA 4RAUC 5D3IB 1I4XA 1XPUA 1O7ZA 4G7OC 4A93H 2F0JA 1B70B 4JK1C 1YNJD 4PG3A 4TSSA 2JA5G 4KY5A 3MTSA 2LMCB 2JA7H 3T1YQ 2BA1A 4RA8A 1UE7A 5M3MH 4DNIA 3SXHA 2PI2E 2HCCA 5A35A 1PFSA 2K28A 1STHA 4MHEA 4IOCA 1I6HB 4K5XA 1IYUA 1N9WA 4ULLA 1KHIA 5C0XH 3S1MB 2F0TA 3GV6A 1JWUD 2EYFA 1PFNA 4S3SA 5J39A 2F0FA 4UHVA 4LUOA 3S15B 3A8IE 5J3BA 4DR6L 2KECA 2K5NA 4A3BG 2XSCA 3VR3A 1XPRA 1E2ZA 3NXWA 4H44C 2O4XA 1XNRL 1ZYRD 2DY7A 4KJNA 3VYUA 4MZ9A 1PFBA 1IW7D 5IT9c 1UEBA 4QJFA 2EJGC 3NBHA 2YTYA 2ASBA 1PA6A 3CKIB 2Z0SA 5I2XA 4KKUA 3S17H 4FF4A 3PO3H 2BA0A 3K0YA 4OONA 4K8JA 5M3FG 3GDEA 1K83H 2B8FA 2R93H 5E3FA 1J9OA 2F0NA 5M5YH 2K4KA 1XX8A 4BBRG 1STYA 3J80E 2E2HB 3AEVA 4ZYSA 3AYHB 4M1UB 3S1RH 3CPFA 5IGGA 1ML0D 2PW7A 1NAPA 3L2PA 4KI0A 2YU9B 3SVMA 1RD9D 2M9VA 2H4OA 1FVIA 3I3CA 1BUVT 5EBDA 2VY3A 4LUZA 4RGNA 3S1NB 3K7AB 4JBKA 2MQHA 3QR8A 2ICEC 3S9WA 1W6JA 2PNHA 4FF1A 4B3RQ 1N8RC 2FINB 2MJ8A 3H15A 4JI0L 4DF7A 2Z4HA 4MTKA 4C2MB 1HNXQ 3J81c 1TQOA 3QO2A 1EYAA 4IFDG 3W1BA 1VQOA 2ICIA 2JA5B 1JJCB 1QB5D 4JI6Q 3J81j 3SE0A 3CPWA 1EY9A 4R1JA 4TKOB 4F7XA 4JV5Q 1H9RA 2K5HA 4G7ZC 1KNEA 2F0MA 2N3SA 3OMCA 4V0BA 5C3XA 3WOEA 3DHQA 2K5WA 3SK6A 2F0EA 4JI3Q 4QL5A 1PH3A 4DV7Q 4A93G 4PV1C 4IUNA 4KD3A 4A3MH 5M5XB 1LV9A 4B9WA 2R7ZH 1HTLD 3Q6SA 5EBCA 1CFMA 1EOVA 1S4ZA 1EYDA 3I90A 1E1TA 3I4OA 1JT8A 5M3MG 1D1IA 3D4DA 5EJWA 4A3BB 2CW0C 1JE5A 5IY0A 5GAEC 1ILPA 3GTLH 2A74C 4PQXA 4IUTA 2GVAA 4R9WA 1EQQA 1JC7A 1E7ZA 1TS3A 4L5RC 2B2WC 3PF5A 5C0XG 2I07B 2UXDQ 2EJMA 1QWYA 4BS9A 1JMCA 1GM5A 5L37A 1ILQA 4KKTA 5C44G 1HR0W 4DV6L 4R4CA 4OIKA 3I70A 1EU4A 3LGJA 3F2DA 2V4DA 4BBRB 3WDNA 3NQIA 2OCEA 3GTPH 1CM9A 3AMUA 2F52A 1B1ZA 2JA6G 1BR9A 2NN6I 2CFMA 3SDZA 2NVTH 1RDPD 3A54A 4YCUA 1G6ZA 1YZ6A 1ZEQX 2KOLA 2KEEA 1DM0B 2K14A 3HOVH 4DK6C 2R93G 3K7UC 4BY7G 2LFNA 1U0LA 3RMHA 4DK3C 3M4OB 1FR3A 2G5DA 1IBLL 4X66Q 1CSPA 4DK1A 4XQNA 2B63H 2KCTA 3Q24A 4I65A 1ICFB 1VQ7A 1KAWA 3PSIA 3EFXD 3R3OA 3BYTB 1HZAA 5E1FA 2KHIA 4F8MA 4CKCA 2N78A 1Y8NB 2F0UA 4JI5Q 2A68C 3FKIH 4O1NA 4Z9CB 2A69D 2F0VA 4LF9L 4FXDA 5J22A 4IPGA 5KYIA 2D62A 4DKAC 1PYSB 4A93B 2JK8A 3T1HQ 3H09A 4LFCL 5CV6A 2B2TA 1K9MC 4HJ7A 4NP5A 2IWHA
chains in the Genus database with same CATH topology
4OO1I 4JI7L 4DV1L 1WYDA 1S3OA 2AWNA 4APVA 1VQ8A 1J6QA 1C0AA 4K0KQ 3CC7A 4PZ6A 2JQOA 1FJGL 2IY5B 1TXYA 3J81i 4DUYQ 3ERSX 2OTJA 4IJLA 4DPGA 3OTOQ 1VQ4A 3TEHB 4KHPL 2N49A 2PI2A 5JJKA 3GTOH 4NB3A 4DR2L 2RCNA 2E2JH 1Y1VG 4WJ3M 2WB1E 4B3TQ 2AHOB 2XTIA 1Y1VH 2C35B 1L2FA 4HJAA 4C3JH 2CQOA 1KD1C 3EIVA 3PO2G 4OXPA 3RZDH 4JG2A 4L5TA 1TWFH 1C9OA 1X6OA 2ZTDA 4A3MG 1QZHA 1I94Q 3PO2H 2NZOA 1EWIA 1TWAH 1ASZA 1EFWA 5LMNW 1YHQA 1W3SA 1VQJA 3L7ZC 4IFDJ 2RHSB 3PUVA 3PUXA 1K8AC 1CKNB 4B3MQ 2WFWA 3KLWA 5LMUL 2R7DA 3GTQH 3K7AH 1NMFA 5IYCG 1VQNA 3M7NA 3J80c 4OO1G 1Z9FA 5IYCH 1VCIA 5C3EH 1Q86C 1QZGA 2KCMA 1EIFA 1CKNA 2Y0SE 4YHHQ 4DUZL 3TRZA 4JI5L 4MTNA 4DV2Q 2OQKA 3D0FA 2ID0A 2K52A 4LFAL 3S2DH 4UP9A 5K36G 3PIPA 4HJ7A 5EAYA 2MO0A 5IE8A 3I4NH 4RG1A 5JJLA 3RLOA 3KFUA 4BA2I 1IBML 4IJHA 4UP8A 1HNXL 4C2MH 2MO1A 2WAQE 4JI2Q 2ZJRA 3T1HL 1QVFA 1L1OC 4JOIC 3CD6A 4GKJQ 1FL0A 3GTJH 1YNXA 4A76A 3ICEA 3ULJA 4YY3L 4BBSG 2A8VA 3E0EA 3AFQA 2RF4A 3D31A 4LWCA 4C3IH 4BBSH 2K5VA 4IOAA 2VL6A 3KJPA 1G51A 1VQDA 4LFBQ 1HNWQ 4K0KL 2ZTCA 1Q12A 3STBD 1NTGA 1X3FA 2BH2A 4DUYL 1MJCA 1XTDA 1SMXA 3OTOL 5FLXc 3A74A 4JBMA 2IX1A 4GLXA 4A3CG 4A3CH 1GVPA 4NPSA 4KLKA 2A1AA 4HJ8A 4B3TL 4LF7L 2A19A 3BJUA 1HNZL 3AFPA 1XMOQ 4JYAL 1BKBA 1SRUA 3DLLA 1X55A 2IHFA 2JEBI 1IBKQ 2JA8G 2UU9Q 2PQAB 5BR8Q 2NVQH 1VQ6A 3HOWH 4DV7L 1K8GA 4JI1Q 5FLMG 2ZJPA 4NXMQ 2L15A 3I55A 3S14H 4L5QA 5JJIA 2R6GA 2CWPA 2KBNA 4DR1L 4A3GH 3HOVG 2AKWB 4B3ML 4A3DG 1KIXA 1VQHA 4A3DH 4YHHL 5AJ3Q 2UUCQ 5IYDG 5IP9G 4R4IA 1WJJA 4DV2L 5C4XH 3B6YA 4A3BH 5IYDH 1P16A 2QGQA 1HH2P 4GLAC 3HOZG 1KC8C 2Z6KC 2B63G 3HOZH 1K3RA 1I6HH 3KDFA 1RIPA 3F8TA 1WFQA 2NN6G 4TVAB 4JI2L 4GKJL 2LXKA 1E22A 2UXCQ 1E24A 3CP0A 4O0AA 4P71A 3KF6B 2UUBQ 2KHJA 1B8AA 5IWAQ 2Q2TA 2VNUD 2Q2UA 1E3PA 5M3FH 1QUQA 1UE1A 2ZM6L 4DR3Q 3S1QH 3S15H 4LFBL 1IYJB 1HNWL 4GLVB 4XTCS 3KF6A 2ALYB 1SFOH 4B3SQ 2K50A 1C7YA 1EYGA 3HKZG 1N32Q 4QGUA 5GAHC 4Y7NH 2JA9A 1N34Q 4AYBE 3JAMc 1UWVA 3CCVA 1G6PA 4GN5A 3M9BA 1LM0A 1E1OA 2I5HA 4EX5A 2VUMH 3DM3A 3NENA 5H1SE 2QEXA 4A3KH 1IBKL 5HY6A 3U50C 2HIVA 3A5ZB 4PZ8A 5ELOA 1OXTA 2UU9L 4YY3Q 5BR8L 1LTLA 1PYBA 3STBC 3IRBA 4JI1L 3PCOB 2ATWA 1P8LA 1WOCA 4NXML 3I7FA 4YWMA 1Q1BA 1YEZA 2UUAQ 4A3LG 4HJ5A 2I5MX 4A3LH 4GOPC 3ULLA 4AIMA 2R92G 3H3VI 3SGIA 4OWTB 4POGA 2H5XA 2R92H 1N33Q 4BY1G 5AJ3L 2UUCL 4BY1H 5HGQA 2WB1G 3WWVA 3UE0A 2WP8J 2OTLA 3RLFA 2D0PA 4YWLA 2EXDA 2R7FA 4X66L 4Y52H 2EQSA 1N36Q 2JEAI 3CAMA 2E2HH 3ZJYC 4J15A 1I5FA 2I5LX 4BXXH 3HFZB 1Q82C 2LSSA 2YU9H 1QVGA 3K81C 4JI8Q 1YHAA 4OWWB 1JJGA 3TS2A 1T9HA 2UXCL 4DR6Q 4L5SA 4GN3B 4HIMA 4IPHA 4P72A 2UUBL 5IWAL 3CCMA 3UDFA 1OXUA 3BU2A 5C3EG 2Y0SG 3EBEA 1M90C 3S1NH 1AH9A 2IX0A 4DR3L 3CCRA 3G6EA 4JC0A 3NELA 4GNXC 1YITA 4B3SL 3HKSA 4YCWA 4DV3Q 1YJ9A 1XNRQ 1N32L 3CW2C 1PV4A 2VS1A 5C0XI 1N34L 4DV0Q 4MNOA 4LF6Q 3CMAA 1VS0A 3I4NG 3F2CA 3FHWA 1D8LA 2WAQG 4EQ5A 1BBUA 1XPUA 4QQBX 5GQOA 4A93H 1Q7YC 3KJOA 3G4SA 3PV0A 1XNQQ 2F3IA 3EN2A 3M4PA 1B70B 3TREA 3GO5A 4PG3A 4LF4L 4DV4Q 1L1OB 2JA7G 2JA5G 2I0QA 1Q1EA 2JA7H 2UUAL 2JA5H 4DAYB 3T1YQ 1R9TH 2F4VQ 2BA1A 3GD7A 1UE7A 5M3MH 1J5EQ 1CKMA 1L1OA 4JOIA 4DNIA 2PI2E 2VQEQ 4A75A 1N33L 4DR7Q 4UPAA 1PFSA 5GAGC 3OW2A 1B7YB 3RZOH 4IOCA 2HQLA 4PMWA 1U5KA 1PH9A 1N9WA 2VW9A 3I4MG 1PHJA 1N36L 1NJIC 1SR3A 3I4MH 1KHIA 1VQAA 1V43A 4AH6A 3HOWG 1AE3A 2BH8A 4JI8L 4X65Q 3W1GA 1BBWA 3F1ZA 3K80C 4LUOA 1YJWA 1I94L 4A3GG 5J3BA 5M5XH 4DR6L 2IHEA 2PQAA 3UDXA 1HZCA 2HT1A 4JBWA 3CCUA 5M5WH 1GKHA 4X6AH 3RN2A 4LNQA 4P75A 2JJQA 4JI0Q 3GTKH 2NZHA 5IYBG 2K5NA 4C3HH 2YTXA 4JCVE 5IYBH 4DV3L 1XPRA 1PH4A 1XNRL 4A3BG 1A0IA 3NBHB 4DV0L 4A3JG 4MZ9A 4LF6L 5IT9c 3H0GH 4A3JH 1UEBA 4QJFA 1VQFA 2GN5A 2YTYA 4X64Q 4NXNQ 1PVOA 1K73C 2ASBA 1HR0Q 1PA6A 3BZKA 1X3GA 5DLQE 1HZBA 1MJEA 1SN8A 1MKHA 2Z0SA 3UDGA 3PO3G 3CC4A 4X62Q 1JB7A 4DV4L 3S17H 3PO3H 1NBWA 2BA0A 2AMCB 4OONA 4P73A 2Z6KA 1Y1WG 5IP7G 3NEMA 4GN4B 5M3FG 3GDEA 1K83H 1Y1WH 4LF5Q 5IP7H 3T1YL 2R93H 2B3GA 3KYHC 1G291 4LUVA 4A3FG 3PUZA 4TQUS 1OXSC 2PMZE 2GVBA 3UDIA 2K4KA 1KL9A 5M5YH 1TWGH 4AYBG 4A3FH 2NVYH 4BBRG 2MFIA 3AQQA 3AEVA 4BBRH 1VQPA 3AYHB 1SE8A 2YV5A 1L0WA 3CPFA 3S1RH 4IFDI 2UXBQ 2CCZA 2VUMG 2K75A 4OWXB 3L2PA 4KI0A 3KOJA 3CMEA 1FVIA 3MEFA 3MXNB 4A3KG 1WI5A 1EIYB 1XMOL 3PUWA 2VY3A 3TS0A 3I2ZA 2Q2HA 4LUZA 3CXCA 1IL2A 2XGTA 2VQFQ 4HJ9A 4X65L 2MQHA 4JBKA 2E5LQ 3S24A 1YVCA 1D7QA 1KXLA 4O2DA 3CCJA 2PNHA 4B3RQ 1EUJA 4P74A 3G71A 2QA4A 1XJVA 1X56A 4PZ7A 1S40A 3G48A 1N8RC 4JI4Q 3H15A 4JI0L 4ALPA 4DR4Q 4GOPB 1PH8A 3HOUH 1NE3A 3CCSA 1EQRA 3M4OH 1LUZA 4DV5Q 4OX9Q 2CKZB 2CWAA 1AE2A 1HNXQ 3PGZA 3J81c 4GOPA 2IT1A 1VQ5A 5ELNA 5C4XG 1XMQQ 1BVSA 4BXXG 4IFDG 1CSQA 1Y14B 4NXNL 3W1BA 1VQOA 1HR0L 3L0OA 1JJCB 1OXVA 4DV6Q 4R4QA 1VQIA 3PIOA 4X62L 4JI6Q 2B29A 3J81j 4DR5Q 2HHHQ 3M4QA 3CPWA 1KQSA 4R1JA 4JV5Q 4IPDA 4LF5L 2K5HA 3K8AA 1VQLA 3M85A 4XIGS 1VQKA 3CCQA 5GADC 3RLNA 2N8NA 3U4ZA 1CUKA 1VQBA 2N3SA 3VDYA 4POFA 4LF7Q 1HNZQ 2V1CC 3ER0A 4GNXB 4JYAQ 3H3VH 2UXBL 4JI3Q 4QL5A 2E2IH 2DUDA 1PH3A 4DV7Q 1V9PA 3OYYA 3J80i 3ULPA 4A93G 1ASYA 1OXXK 3PF4A 4GNXA 4RMFA 3E9HA 4A3MH 2HIXA 2R7ZG 3S16H 3CC2A 2NVXH 4AQYQ 4DR1Q 2R7ZH 1A63A 3RN5A 4GKKQ 1EOVA 4R4OA 3CCLA 1IXRA 2VQFL 1E1TA 3I4OA 3S2HH 2E5LL 1PH1A 1JT8A 1SROA 5M3MG 3J7ZC 4B3RL 1Q8KA 1Z47A 1I50H 2EIFA 1S72A 4JI4L 1JE5A 4R4TA 1KRSA 5IY0A 5GAEC 1MIUA 1HZ9A 2D0OA 1PH6A 1IBLQ 2ZTEA 1UE5A 3GTGH 2DGYA 4DR4L 3A5UA 1CKOA 3GTLH 4DV5L 2AWOA 3U58A 1QVCA 4OX9L 1TWHH 2GVAA 1EQQA 1E7ZA 1XPOA 5LMNQ 4L5RC 3PF5A 5C0XG 1XMQL 1YBYA 3HOYG 1W2BA 2UXDQ 4QY7A 1A8VA 1VQEA 3HOYH 1JMCA 2MNAA 4UY8C 1SLJA 1YHBA 2KENA 1GM5A 3A0JA 4QIWE 4LF8Q 5C44G 2ZM6Q 4JBJA 4R4CA 4DV6L 1HR0W 5C44H 3W5OA 4JI6L 3LGJA 3F2DA 4DR5L 2HHHL 4JV5L 3M3YH 2FXQA 2OCEA 1HJPA 4YCVA 5JEAG 3GTPH 1X3EA 1LYLA 2F52A 1KRTA 5FJ8G 1X9NA 4LF9Q 2OWOA 3CQZH 5C4JH 2JA6G 5FJ8H 1K0RA 2NN6I 4A3IG 3KF8B 2CFMA 2JA6H 2NVTH 4A3IH 3H0GG 1VQGA 4ME3A 4YCUA 2YYZA 4FDBA 4JI3L 4LFCQ 2JA8H 1YZ6A 1DGSA 1A62A 4KHZA 3CF5A 4A3EG 4A3EH 4JI7Q 1OTCA 5C0XJ 4DV1Q 5FLMH 3E9IA 3Q8DA 1XNQL 4AQYL 4LW1A 5GROA 4GS3A 4DAMA 2K14A 3FP9A 3RR5A 1YIJA 3PUYA 1FJGQ 3HOVH 4GKKL 4DK6C 1IZ6A 1VQCA 1Q46A 2R93G 3K7UC 4HIKA 4BY7G 4KHPQ 2F4VL 1U0LA 4DK3C 4BY7H 3K0XA 1RL2A 3JC66 1J5EL 4HIDA 2YTVA 1X65A 5IP9H 4DR2Q 4WJ4A 5JEAJ 1IBLL 4X66Q 3KDFB 2VQEL 1FGUA 4DR7L 1O7IA 2E8GA 1NMGA 1PH7A 3U4VA 1CSPA 4YWKA 3RNUA 3J7A5 2B63H 2KCTA 1Q81C 1M1KC 1YJNA 4BA1I 3F2BA 5LMNL 1VQ7A 1H95A 2Q2IA 1KAWA 3PSIA 1QUQB 2OQ0A 2UXDL 4UP7A 4HIOA 3S1MH 1X54A 1HZAA 2JE6I 4H02A 2RHQB 5LMUQ 2KHIA 1PH5A 4LF8L 3TQYA 3JAMi 2ES2A 3BZCA 2N78A 1YI2A 1GO3E 2VZAA 4DUZQ 1TWCH 4IO9A 1JJ2A 4JI5Q 2LXJA 3FKIG 3UE1A 1VQMA 3I56A 1I3QH 3FKIH 4A4IA 3GTMH 3HOXG 4LFAQ 3HOUG 3HKZE 1VQ9A 4LF9L 3HOXH 3CCEA 4IPGA 5E7NA 2D62A 4DKAC 1PYSB 4IPCA 1PH2A 1IBMQ 2JK8A 1GD7A 3T1HQ 1NY4A 4LFCL 1K9MC 1WCMG 1V1QA 2ZJQA 4LF4Q 1UE6A 4X64L 1WCMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 I;  4JI7 L;  4DV1 L;  1WYD A;  1S3O A;  2AWN A;  4APV A;  1VQ8 A;  1J6Q A;  1C0A A;  4K0K Q;  3CC7 A;  4PZ6 A;  2JQO A;  1FJG L;  2IY5 B;  1TXY A;  3J81 i;  4DUY Q;  3ERS X;  2OTJ A;  4IJL A;  4DPG A;  3OTO Q;  1VQ4 A;  3TEH B;  4KHP L;  2N49 A;  2PI2 A;  5JJK A;  3GTO H;  4NB3 A;  4DR2 L;  2RCN A;  2E2J H;  1Y1V G;  4WJ3 M;  2WB1 E;  4B3T Q;  2AHO B;  2XTI A;  1Y1V H;  2C35 B;  1L2F A;  4HJA A;  4C3J H;  2CQO A;  1KD1 C;  3EIV A;  3PO2 G;  4OXP A;  3RZD H;  4JG2 A;  4L5T A;  1TWF H;  1C9O A;  1X6O A;  2ZTD A;  4A3M G;  1QZH A;  1I94 Q;  3PO2 H;  2NZO A;  1EWI A;  1TWA H;  1ASZ A;  1EFW A;  5LMN W;  1YHQ A;  1W3S A;  1VQJ A;  3L7Z C;  4IFD J;  2RHS B;  3PUV A;  3PUX A;  1K8A C;  1CKN B;  4B3M Q;  2WFW A;  3KLW A;  5LMU L;  2R7D A;  3GTQ H;  3K7A H;  1NMF A;  5IYC G;  1VQN A;  3M7N A;  3J80 c;  4OO1 G;  1Z9F A;  5IYC H;  1VCI A;  5C3E H;  1Q86 C;  1QZG A;  2KCM A;  1EIF A;  1CKN A;  2Y0S E;  4YHH Q;  4DUZ L;  3TRZ A;  4JI5 L;  4MTN A;  4DV2 Q;  2OQK A;  3D0F A;  2ID0 A;  2K52 A;  4LFA L;  3S2D H;  4UP9 A;  5K36 G;  3PIP A;  4HJ7 A;  5EAY A;  2MO0 A;  5IE8 A;  3I4N H;  4RG1 A;  5JJL A;  3RLO A;  3KFU A;  4BA2 I;  1IBM L;  4IJH A;  4UP8 A;  1HNX L;  4C2M H;  2MO1 A;  2WAQ E;  4JI2 Q;  2ZJR A;  3T1H L;  1QVF A;  1L1O C;  4JOI C;  3CD6 A;  4GKJ Q;  1FL0 A;  3GTJ H;  1YNX A;  4A76 A;  3ICE A;  3ULJ A;  4YY3 L;  4BBS G;  2A8V A;  3E0E A;  3AFQ A;  2RF4 A;  3D31 A;  4LWC A;  4C3I H;  4BBS H;  2K5V A;  4IOA A;  2VL6 A;  3KJP A;  1G51 A;  1VQD A;  4LFB Q;  1HNW Q;  4K0K L;  2ZTC A;  1Q12 A;  3STB D;  1NTG A;  1X3F A;  2BH2 A;  4DUY L;  1MJC A;  1XTD A;  1SMX A;  3OTO L;  5FLX c;  3A74 A;  4JBM A;  2IX1 A;  4GLX A;  4A3C G;  4A3C H;  1GVP A;  4NPS A;  4KLK A;  2A1A A;  4HJ8 A;  4B3T L;  4LF7 L;  2A19 A;  3BJU A;  1HNZ L;  3AFP A;  1XMO Q;  4JYA L;  1BKB A;  1SRU A;  3DLL A;  1X55 A;  2IHF A;  2JEB I;  1IBK Q;  2JA8 G;  2UU9 Q;  2PQA B;  5BR8 Q;  2NVQ H;  1VQ6 A;  3HOW H;  4DV7 L;  1K8G A;  4JI1 Q;  5FLM G;  2ZJP A;  4NXM Q;  2L15 A;  3I55 A;  3S14 H;  4L5Q A;  5JJI A;  2R6G A;  2CWP A;  2KBN A;  4DR1 L;  4A3G H;  3HOV G;  2AKW B;  4B3M L;  4A3D G;  1KIX A;  1VQH A;  4A3D H;  4YHH L;  5AJ3 Q;  2UUC Q;  5IYD G;  5IP9 G;  4R4I A;  1WJJ A;  4DV2 L;  5C4X H;  3B6Y A;  4A3B H;  5IYD H;  1P16 A;  2QGQ A;  1HH2 P;  4GLA C;  3HOZ G;  1KC8 C;  2Z6K C;  2B63 G;  3HOZ H;  1K3R A;  1I6H H;  3KDF A;  1RIP A;  3F8T A;  1WFQ A;  2NN6 G;  4TVA B;  4JI2 L;  4GKJ L;  2LXK A;  1E22 A;  2UXC Q;  1E24 A;  3CP0 A;  4O0A A;  4P71 A;  3KF6 B;  2UUB Q;  2KHJ A;  1B8A A;  5IWA Q;  2Q2T A;  2VNU D;  2Q2U A;  1E3P A;  5M3F H;  1QUQ A;  1UE1 A;  2ZM6 L;  4DR3 Q;  3S1Q H;  3S15 H;  4LFB L;  1IYJ B;  1HNW L;  4GLV B;  4XTC S;  3KF6 A;  2ALY B;  1SFO H;  4B3S Q;  2K50 A;  1C7Y A;  1EYG A;  3HKZ G;  1N32 Q;  4QGU A;  5GAH C;  4Y7N H;  2JA9 A;  1N34 Q;  4AYB E;  3JAM c;  1UWV A;  3CCV A;  1G6P A;  4GN5 A;  3M9B A;  1LM0 A;  1E1O A;  2I5H A;  4EX5 A;  2VUM H;  3DM3 A;  3NEN A;  5H1S E;  2QEX A;  4A3K H;  1IBK L;  5HY6 A;  3U50 C;  2HIV A;  3A5Z B;  4PZ8 A;  5ELO A;  1OXT A;  2UU9 L;  4YY3 Q;  5BR8 L;  1LTL A;  1PYB A;  3STB C;  3IRB A;  4JI1 L;  3PCO B;  2ATW A;  1P8L A;  1WOC A;  4NXM L;  3I7F A;  4YWM A;  1Q1B A;  1YEZ A;  2UUA Q;  4A3L G;  4HJ5 A;  2I5M X;  4A3L H;  4GOP C;  3ULL A;  4AIM A;  2R92 G;  3H3V I;  3SGI A;  4OWT B;  4POG A;  2H5X A;  2R92 H;  1N33 Q;  4BY1 G;  5AJ3 L;  2UUC L;  4BY1 H;  5HGQ A;  2WB1 G;  3WWV A;  3UE0 A;  2WP8 J;  2OTL A;  3RLF A;  2D0P A;  4YWL A;  2EXD A;  2R7F A;  4X66 L;  4Y52 H;  2EQS A;  1N36 Q;  2JEA I;  3CAM A;  2E2H H;  3ZJY C;  4J15 A;  1I5F A;  2I5L X;  4BXX H;  3HFZ B;  1Q82 C;  2LSS A;  2YU9 H;  1QVG A;  3K81 C;  4JI8 Q;  1YHA A;  4OWW B;  1JJG A;  3TS2 A;  1T9H A;  2UXC L;  4DR6 Q;  4L5S A;  4GN3 B;  4HIM A;  4IPH A;  4P72 A;  2UUB L;  5IWA L;  3CCM A;  3UDF A;  1OXU A;  3BU2 A;  5C3E G;  2Y0S G;  3EBE A;  1M90 C;  3S1N H;  1AH9 A;  2IX0 A;  4DR3 L;  3CCR A;  3G6E A;  4JC0 A;  3NEL A;  4GNX C;  1YIT A;  4B3S L;  3HKS A;  4YCW A;  4DV3 Q;  1YJ9 A;  1XNR Q;  1N32 L;  3CW2 C;  1PV4 A;  2VS1 A;  5C0X I;  1N34 L;  4DV0 Q;  4MNO A;  4LF6 Q;  3CMA A;  1VS0 A;  3I4N G;  3F2C A;  3FHW A;  1D8L A;  2WAQ G;  4EQ5 A;  1BBU A;  1XPU A;  4QQB X;  5GQO A;  4A93 H;  1Q7Y C;  3KJO A;  3G4S A;  3PV0 A;  1XNQ Q;  2F3I A;  3EN2 A;  3M4P A;  1B70 B;  3TRE A;  3GO5 A;  4PG3 A;  4LF4 L;  4DV4 Q;  1L1O B;  2JA7 G;  2JA5 G;  2I0Q A;  1Q1E A;  2JA7 H;  2UUA L;  2JA5 H;  4DAY B;  3T1Y Q;  1R9T H;  2F4V Q;  2BA1 A;  3GD7 A;  1UE7 A;  5M3M H;  1J5E Q;  1CKM A;  1L1O A;  4JOI A;  4DNI A;  2PI2 E;  2VQE Q;  4A75 A;  1N33 L;  4DR7 Q;  4UPA A;  1PFS A;  5GAG C;  3OW2 A;  1B7Y B;  3RZO H;  4IOC A;  2HQL A;  4PMW A;  1U5K A;  1PH9 A;  1N9W A;  2VW9 A;  3I4M G;  1PHJ A;  1N36 L;  1NJI C;  1SR3 A;  3I4M H;  1KHI A;  1VQA A;  1V43 A;  4AH6 A;  3HOW G;  1AE3 A;  2BH8 A;  4JI8 L;  4X65 Q;  3W1G A;  1BBW A;  3F1Z A;  3K80 C;  4LUO A;  1YJW A;  1I94 L;  4A3G G;  5J3B A;  5M5X H;  4DR6 L;  2IHE A;  2PQA A;  3UDX A;  1HZC A;  2HT1 A;  4JBW A;  3CCU A;  5M5W H;  1GKH A;  4X6A H;  3RN2 A;  4LNQ A;  4P75 A;  2JJQ A;  4JI0 Q;  3GTK H;  2NZH A;  5IYB G;  2K5N A;  4C3H H;  2YTX A;  4JCV E;  5IYB H;  4DV3 L;  1XPR A;  1PH4 A;  1XNR L;  4A3B G;  1A0I A;  3NBH B;  4DV0 L;  4A3J G;  4MZ9 A;  4LF6 L;  5IT9 c;  3H0G H;  4A3J H;  1UEB A;  4QJF A;  1VQF A;  2GN5 A;  2YTY A;  4X64 Q;  4NXN Q;  1PVO A;  1K73 C;  2ASB A;  1HR0 Q;  1PA6 A;  3BZK A;  1X3G A;  5DLQ E;  1HZB A;  1MJE A;  1SN8 A;  1MKH A;  2Z0S A;  3UDG A;  3PO3 G;  3CC4 A;  4X62 Q;  1JB7 A;  4DV4 L;  3S17 H;  3PO3 H;  1NBW A;  2BA0 A;  2AMC B;  4OON A;  4P73 A;  2Z6K A;  1Y1W G;  5IP7 G;  3NEM A;  4GN4 B;  5M3F G;  3GDE A;  1K83 H;  1Y1W H;  4LF5 Q;  5IP7 H;  3T1Y L;  2R93 H;  2B3G A;  3KYH C;  1G29 1;  4LUV A;  4A3F G;  3PUZ A;  4TQU S;  1OXS C;  2PMZ E;  2GVB A;  3UDI A;  2K4K A;  1KL9 A;  5M5Y H;  1TWG H;  4AYB G;  4A3F H;  2NVY H;  4BBR G;  2MFI A;  3AQQ A;  3AEV A;  4BBR H;  1VQP A;  3AYH B;  1SE8 A;  2YV5 A;  1L0W A;  3CPF A;  3S1R H;  4IFD I;  2UXB Q;  2CCZ A;  2VUM G;  2K75 A;  4OWX B;  3L2P A;  4KI0 A;  3KOJ A;  3CME A;  1FVI A;  3MEF A;  3MXN B;  4A3K G;  1WI5 A;  1EIY B;  1XMO L;  3PUW A;  2VY3 A;  3TS0 A;  3I2Z A;  2Q2H A;  4LUZ A;  3CXC A;  1IL2 A;  2XGT A;  2VQF Q;  4HJ9 A;  4X65 L;  2MQH A;  4JBK A;  2E5L Q;  3S24 A;  1YVC A;  1D7Q A;  1KXL A;  4O2D A;  3CCJ A;  2PNH A;  4B3R Q;  1EUJ A;  4P74 A;  3G71 A;  2QA4 A;  1XJV A;  1X56 A;  4PZ7 A;  1S40 A;  3G48 A;  1N8R C;  4JI4 Q;  3H15 A;  4JI0 L;  4ALP A;  4DR4 Q;  4GOP B;  1PH8 A;  3HOU H;  1NE3 A;  3CCS A;  1EQR A;  3M4O H;  1LUZ A;  4DV5 Q;  4OX9 Q;  2CKZ B;  2CWA A;  1AE2 A;  1HNX Q;  3PGZ A;  3J81 c;  4GOP A;  2IT1 A;  1VQ5 A;  5ELN A;  5C4X G;  1XMQ Q;  1BVS A;  4BXX G;  4IFD G;  1CSQ A;  1Y14 B;  4NXN L;  3W1B A;  1VQO A;  1HR0 L;  3L0O A;  1JJC B;  1OXV A;  4DV6 Q;  4R4Q A;  1VQI A;  3PIO A;  4X62 L;  4JI6 Q;  2B29 A;  3J81 j;  4DR5 Q;  2HHH Q;  3M4Q A;  3CPW A;  1KQS A;  4R1J A;  4JV5 Q;  4IPD A;  4LF5 L;  2K5H A;  3K8A A;  1VQL A;  3M85 A;  4XIG S;  1VQK A;  3CCQ A;  5GAD C;  3RLN A;  2N8N A;  3U4Z A;  1CUK A;  1VQB A;  2N3S A;  3VDY A;  4POF A;  4LF7 Q;  1HNZ Q;  2V1C C;  3ER0 A;  4GNX B;  4JYA Q;  3H3V H;  2UXB L;  4JI3 Q;  4QL5 A;  2E2I H;  2DUD A;  1PH3 A;  4DV7 Q;  1V9P A;  3OYY A;  3J80 i;  3ULP A;  4A93 G;  1ASY A;  1OXX K;  3PF4 A;  4GNX A;  4RMF A;  3E9H A;  4A3M H;  2HIX A;  2R7Z G;  3S16 H;  3CC2 A;  2NVX H;  4AQY Q;  4DR1 Q;  2R7Z H;  1A63 A;  3RN5 A;  4GKK Q;  1EOV A;  4R4O A;  3CCL A;  1IXR A;  2VQF L;  1E1T A;  3I4O A;  3S2H H;  2E5L L;  1PH1 A;  1JT8 A;  1SRO A;  5M3M G;  3J7Z C;  4B3R L;  1Q8K A;  1Z47 A;  1I50 H;  2EIF A;  1S72 A;  4JI4 L;  1JE5 A;  4R4T A;  1KRS A;  5IY0 A;  5GAE C;  1MIU A;  1HZ9 A;  2D0O A;  1PH6 A;  1IBL Q;  2ZTE A;  1UE5 A;  3GTG H;  2DGY A;  4DR4 L;  3A5U A;  1CKO A;  3GTL H;  4DV5 L;  2AWO A;  3U58 A;  1QVC A;  4OX9 L;  1TWH H;  2GVA A;  1EQQ A;  1E7Z A;  1XPO A;  5LMN Q;  4L5R C;  3PF5 A;  5C0X G;  1XMQ L;  1YBY A;  3HOY G;  1W2B A;  2UXD Q;  4QY7 A;  1A8V A;  1VQE A;  3HOY H;  1JMC A;  2MNA A;  4UY8 C;  1SLJ A;  1YHB A;  2KEN A;  1GM5 A;  3A0J A;  4QIW E;  4LF8 Q;  5C44 G;  2ZM6 Q;  4JBJ A;  4R4C A;  4DV6 L;  1HR0 W;  5C44 H;  3W5O A;  4JI6 L;  3LGJ A;  3F2D A;  4DR5 L;  2HHH L;  4JV5 L;  3M3Y H;  2FXQ A;  2OCE A;  1HJP A;  4YCV A;  5JEA G;  3GTP H;  1X3E A;  1LYL A;  2F52 A;  1KRT A;  5FJ8 G;  1X9N A;  4LF9 Q;  2OWO A;  3CQZ H;  5C4J H;  2JA6 G;  5FJ8 H;  1K0R A;  2NN6 I;  4A3I G;  3KF8 B;  2CFM A;  2JA6 H;  2NVT H;  4A3I H;  3H0G G;  1VQG A;  4ME3 A;  4YCU A;  2YYZ A;  4FDB A;  4JI3 L;  4LFC Q;  2JA8 H;  1YZ6 A;  1DGS A;  1A62 A;  4KHZ A;  3CF5 A;  4A3E G;  4A3E H;  4JI7 Q;  1OTC A;  5C0X J;  4DV1 Q;  5FLM H;  3E9I A;  3Q8D A;  1XNQ L;  4AQY L;  4LW1 A;  5GRO A;  4GS3 A;  4DAM A;  2K14 A;  3FP9 A;  3RR5 A;  1YIJ A;  3PUY A;  1FJG Q;  3HOV H;  4GKK L;  4DK6 C;  1IZ6 A;  1VQC A;  1Q46 A;  2R93 G;  3K7U C;  4HIK A;  4BY7 G;  4KHP Q;  2F4V L;  1U0L A;  4DK3 C;  4BY7 H;  3K0X A;  1RL2 A;  3JC6 6;  1J5E L;  4HID A;  2YTV A;  1X65 A;  5IP9 H;  4DR2 Q;  4WJ4 A;  5JEA J;  1IBL L;  4X66 Q;  3KDF B;  2VQE L;  1FGU A;  4DR7 L;  1O7I A;  2E8G A;  1NMG A;  1PH7 A;  3U4V A;  1CSP A;  4YWK A;  3RNU A;  3J7A 5;  2B63 H;  2KCT A;  1Q81 C;  1M1K C;  1YJN A;  4BA1 I;  3F2B A;  5LMN L;  1VQ7 A;  1H95 A;  2Q2I A;  1KAW A;  3PSI A;  1QUQ B;  2OQ0 A;  2UXD L;  4UP7 A;  4HIO A;  3S1M H;  1X54 A;  1HZA A;  2JE6 I;  4H02 A;  2RHQ B;  5LMU Q;  2KHI A;  1PH5 A;  4LF8 L;  3TQY A;  3JAM i;  2ES2 A;  3BZC A;  2N78 A;  1YI2 A;  1GO3 E;  2VZA A;  4DUZ Q;  1TWC H;  4IO9 A;  1JJ2 A;  4JI5 Q;  2LXJ A;  3FKI G;  3UE1 A;  1VQM A;  3I56 A;  1I3Q H;  3FKI H;  4A4I A;  3GTM H;  3HOX G;  4LFA Q;  3HOU G;  3HKZ E;  1VQ9 A;  4LF9 L;  3HOX H;  3CCE A;  4IPG A;  5E7N A;  2D62 A;  4DKA C;  1PYS B;  4IPC A;  1PH2 A;  1IBM Q;  2JK8 A;  1GD7 A;  3T1H Q;  1NY4 A;  4LFC L;  1K9M C;  1WCM G;  1V1Q A;  2ZJQ A;  4LF4 Q;  1UE6 A;  4X64 L;  1WCM H; 
#chains in the Genus database with same CATH topology
 3DWA A;  3S2H B;  1J8I A;  5TSS A;  1S3O A;  2AWN A;  1Q3L A;  3SR1 A;  3MXU A;  4NW2 A;  4HCS A;  5M3M B;  3QB3 A;  1FJG L;  4ZUI A;  1CT1 D;  3K5L A;  1EYC A;  1G2S A;  2N49 A;  4O42 A;  5JJK A;  4NB3 A;  3URY A;  2XTI A;  3HRZ C;  2C35 B;  1QJO A;  4C3J G;  1L2F A;  1VDZ A;  3RZD H;  4L5T A;  1C9O A;  4A3M G;  1ASZ A;  5C44 B;  3EQL C;  5LMN W;  1EFW A;  3L7Z C;  1K8A C;  5LMU L;  4MIU A;  2VB3 X;  1QZG A;  2KCM A;  3P7J A;  1HA5 A;  2QIL A;  4YHH Q;  4DUZ L;  3MHB A;  4MTN A;  4DV2 Q;  2JA6 B;  2K52 A;  4LFA L;  1CA5 A;  4FXG C;  5IOC A;  1CI3 M;  2Z8L A;  4XDX A;  4DAP A;  2EYO A;  1S5C D;  1A3U A;  3RLO A;  1IBM L;  4IJH A;  4UP8 A;  1HNX L;  2MO1 A;  4JI2 Q;  4GKJ Q;  1L1O C;  3M4Y A;  4FNF A;  4A76 A;  1WTO A;  5D14 A;  2EOT A;  4C3I H;  1BO0 A;  2R93 B;  3G7L A;  4N9P A;  4BY7 B;  1G51 A;  1HNW Q;  5M5Y B;  2ZTC A;  1X3F A;  3BYY B;  3OTO L;  3A74 A;  3KK7 A;  4GLX A;  4KLK A;  1XTC D;  3HGB A;  4B3T L;  2IHF A;  5CYU A;  2UU9 Q;  3KF8 A;  4DV7 L;  1RKN A;  2ZJP A;  4I7Z C;  4UAI A;  1EZ8 A;  2L15 A;  3I55 A;  4NKL A;  1SEB D;  1LT5 D;  4WFN 3;  3HOV G;  1V1P B;  2C5C A;  3VR6 A;  1LTS D;  5AJ3 Q;  5C4X H;  2SEB D;  4CDD C;  1HH2 P;  2EY5 A;  4IQZ A;  1EIG A;  1KC8 C;  2Z6K C;  2B63 G;  1Y8P B;  2BCO A;  2L11 A;  1I6H H;  3OIP A;  1RIP A;  4JW0 A;  4TVA B;  3KBG A;  1E0B A;  2LXK A;  2MP1 A;  2NN6 H;  1SE2 A;  1M4V A;  4CKE A;  5EPJ A;  1ENC A;  2KHJ A;  4ZUJ A;  1O80 A;  2Q2U A;  1QUQ A;  3TP5 A;  4LFB L;  3S15 H;  1MD2 D;  2XN9 C;  2E2J B;  2K50 A;  2EY2 A;  1N32 Q;  5FKA C;  1EOT A;  3HG9 A;  4HSP A;  2AUK A;  5GAH C;  2CH4 A;  2JA9 A;  2FFK B;  2KCC A;  3QIA A;  4C3J B;  3CCV A;  1YNN C;  1TII D;  1S5D D;  3M9B A;  2I5H A;  1E1O A;  1TWF B;  5H1S E;  1S5F D;  1TWA B;  4A3M B;  1IBK L;  2HIV A;  4KN7 C;  4PZ8 A;  5CR3 A;  2NYZ D;  2M2L A;  2ATW A;  1P8L A;  2J0T D;  1WOC A;  1YEZ A;  3D3R A;  4HMI A;  3KLS X;  4GOP C;  2RDH A;  4OWT B;  1PLF A;  2H5X A;  2KUM A;  2UUC L;  1DON A;  3WWV A;  5JAV A;  3NBI A;  5CGK A;  3LX0 A;  4Y52 H;  2B2U A;  4X66 L;  5FLX E;  2EQS A;  3CAM A;  2E2H H;  1I5F A;  1GUT A;  1SBB B;  4QIW B;  4IAL A;  1ET6 A;  2YU9 H;  4OWW B;  1YHA A;  2EXZ A;  2J7Z A;  4DR6 Q;  3K6O A;  4HIM A;  4K5V A;  5IWA L;  1HUM A;  3UDF A;  4B9X A;  3S1N H;  2F0W A;  2Y0S G;  1AH9 A;  5I9P A;  5CMD A;  1LTT D;  4RKB A;  1PZJ D;  1YIT A;  1XNR Q;  3F2U A;  4XT1 B;  5C0X I;  1TU2 B;  2EZV A;  2NVQ B;  1D8L A;  2DN8 A;  4EQ5 A;  4QQB X;  2MPM A;  3KJO A;  1XNQ Q;  3M4P A;  3GO5 A;  3HOV B;  1EEI D;  3MFY A;  5I2Y A;  1SYB A;  1L1O B;  3A7A B;  2I0Q A;  2UUA L;  3TME A;  2JA5 H;  1HRJ A;  2F4V Q;  3GD7 A;  3OOC A;  4JOI A;  4I7A A;  1K3B C;  4A75 A;  1N33 L;  1F2Y A;  4UPA A;  4DAY A;  5GAG C;  2B63 B;  3OW2 A;  4XYO A;  1ZXT A;  2HQL A;  5KNB A;  1L0X B;  3KBX A;  3I4M G;  1PHJ A;  1NNX A;  2KCN A;  1VQA A;  1V43 A;  4AH6 A;  1LTI D;  4XYQ A;  3MEH A;  3W1G A;  3F1Z A;  4FVM A;  1JOQ A;  1D5M C;  2Q8R E;  5M5X H;  2IHE A;  3DWQ A;  3ND8 A;  1SAP A;  1GKH A;  3RN2 A;  1KDB A;  2JJQ A;  4JI0 Q;  5I4D A;  3GTK H;  2K1B A;  4JCV E;  1PH4 A;  5C4X G;  1A0I A;  1EFI D;  4HN7 A;  4H0L C;  4LF6 L;  5IGD A;  4N8X 1;  5LL6 X;  1LLR D;  1VQF A;  2GN5 A;  3KLR A;  3FMC A;  1PVO A;  2JYO A;  2WV6 D;  1LTG D;  3SK4 A;  5KNC A;  1MKH A;  3UDG A;  5C3W A;  2AQ2 B;  3N6R A;  1RJT A;  3C1F A;  4X3U A;  2AMC B;  4P73 A;  5KYL A;  2QCP X;  4RGM A;  3NE5 B;  1G29 1;  4A3F G;  3PUZ A;  1OXS C;  5ISR A;  4AYB G;  5COR A;  1AN8 A;  3AQQ A;  2A73 B;  1PTO B;  2EDG A;  4BBR H;  2K33 A;  1VQP A;  1SE8 A;  1HQM C;  1ICW A;  2CW0 D;  3I4L A;  4OWX B;  3NWT A;  4QUC A;  1PZK D;  3CXC A;  3NQT A;  3MXN A;  4HJ9 A;  4X65 L;  2Y0S B;  1EY5 A;  4KY6 A;  4L8J A;  5KGU A;  2SOB A;  1KXL A;  1D1K A;  2QA4 A;  2O5I C;  2K05 A;  1SYC A;  3MC0 B;  2OXP A;  1B9M A;  4GOP B;  1PH8 A;  4RWS C;  1EY7 A;  3CCS A;  1EQR A;  1F77 A;  1LUZ A;  3HP3 A;  4RGO S;  3M4O H;  4ZK9 B;  3SK8 A;  2CQA A;  1LTA D;  1MI2 A;  4DA2 A;  2F0I A;  5C5L A;  1GXD C;  2F3W A;  1RTN A;  2ENB A;  4IFD H;  2H1E A;  3ND9 A;  3L0O A;  1R9T B;  4DV6 Q;  4R4Q A;  3PIO A;  2PO4 A;  4OEM B;  4IPD A;  4LF5 L;  3K8A A;  1VQL A;  5DM7 3;  3CCQ A;  3RZO B;  3RLN A;  4QB4 A;  1SNC A;  3W2D A;  4CDE C;  4R8N A;  5I6Y A;  3OWF A;  1B9N A;  4FF2 A;  3IKJ A;  3I4M B;  2F4I A;  4YIJ A;  1DXM A;  1HTP A;  3ER0 A;  2UXB L;  2E2I H;  5FO9 B;  4RHR A;  1ASY A;  1BOS A;  4GNX A;  3CC2 A;  4UDU C;  1A63 A;  1PXU A;  2QKI C;  4LMQ D;  4CKB A;  2VQF L;  3S2H H;  2E5L L;  3SHL A;  3J7A F;  5C4X B;  2DJG C;  5FK9 C;  1TS4 A;  3FPP A;  1ZKO A;  5EKL A;  1PH6 A;  1IBL Q;  1HZ9 A;  2ZTE A;  4DR4 L;  2A5H A;  5KND A;  5K36 H;  3EVQ A;  3V96 A;  1CKO A;  2Q8I B;  4DV5 L;  2EYH A;  2A68 D;  1K28 A;  3VR2 A;  4KN4 C;  1Q90 A;  1W2B A;  3NHH A;  4UY8 C;  1SLJ A;  1X32 A;  4QIW E;  2PMZ B;  2ZM6 Q;  5C44 H;  5EKK A;  4EVO A;  4A3F B;  3AB9 A;  4DR5 L;  1WTP A;  4KMU C;  4AYB B;  3ERQ A;  5ELD A;  1HJP A;  5IGF A;  1X3E A;  4LF9 Q;  1KRT A;  1X9N A;  4CBV A;  5FJ8 G;  1MBY A;  2B2V A;  5IGB A;  2OWO A;  1HFG A;  4A3I G;  2ZXR A;  3KF8 B;  2JA6 H;  4LFC Q;  1DGS A;  1A62 A;  3VR5 A;  5C0X J;  5IGC A;  1XNQ L;  1C4Q A;  2RCF A;  5GRO A;  3C2P A;  3N52 A;  4GS3 A;  1FJG Q;  4ZAI A;  2PZU A;  1IZ6 A;  1VQC A;  1Q46 A;  1SNP A;  1STB A;  2F4V L;  4BY7 H;  3A56 A;  1RF2 D;  1X65 A;  4WJ4 A;  3VYS A;  4DR7 L;  1FGU A;  3U9S A;  1PH7 A;  3U4V A;  1Q81 C;  1H95 A;  2GA4 B;  2Q2I A;  2L55 A;  1EWC A;  1QUQ B;  4CDC C;  5KRU A;  4UP7 A;  1X54 A;  2JE6 I;  5DNF A;  5LMU Q;  1FNW A;  2NTS A;  4LF8 L;  2N55 A;  2ES2 A;  2SNS A;  1YI2 A;  1JE4 A;  2KVM A;  2VZA A;  2K04 A;  1TWC H;  4DUZ Q;  1JJ2 A;  2LXJ A;  1KLG D;  3UE1 A;  4FYD A;  3NSW A;  1I3Q H;  3HOX G;  4LFA Q;  3PQI A;  2NBF A;  4IPC A;  1H9J A;  1IBM Q;  2EJF C;  3S16 B;  1T5E A;  1GD7 A;  2IY5 B;  4DV1 L;  3R2I A;  4APV A;  3D4W A;  2XVS A;  1S5E D;  3M7G A;  2K01 A;  2JQO A;  3FEW X;  1U4L A;  2E2D C;  2KA7 A;  3GTG B;  2OTJ A;  4DPG A;  3OTO Q;  1VQ4 A;  1RHP A;  4KV6 A;  2BDO A;  5I6W A;  4J6H A;  2PI2 A;  4R8I A;  1TWH B;  3MA2 B;  2E2J H;  1Y1V G;  3A8K E;  3J7Y W;  1ET9 A;  4B3T Q;  2AHO B;  4K5W A;  4HJA A;  1WTQ A;  4C3J H;  4CJ2 C;  4X3S A;  1PYW D;  5E4W C;  1TWF H;  4HTH A;  1X6O A;  3ZYY X;  1I94 Q;  1TWA H;  1YHQ A;  1V1O A;  3PUV A;  3PUX A;  1CQF A;  1CKN B;  2WFW A;  5JPM C;  3M7N A;  3GTQ H;  5IYC G;  1NMF A;  5IOD A;  3M3Y B;  4OO1 G;  1Q86 C;  1EY0 A;  5C3E H;  3GTK B;  1B3A A;  2Y0S E;  3TRZ A;  3L9A X;  1F9R A;  4A3I B;  3D0F A;  2ID0 A;  3NK9 A;  5K36 G;  4HAE A;  5EAY A;  2MO0 A;  5IE8 A;  3I4N H;  1DOM A;  1GUW A;  4BA2 I;  2HD3 A;  1CQV A;  2ZJR A;  1O78 A;  3CD6 A;  1YNN D;  2KHS A;  4CJ0 B;  4YY3 L;  4BBS G;  2A8V A;  3D31 A;  2RF4 A;  4LWC A;  5JJZ A;  1SYF A;  2K5V A;  3O13 A;  2RSN A;  3NTK A;  3KJP A;  4LFB Q;  4OHJ A;  4ZCK A;  4DUY L;  1MJC A;  1XTD A;  1SMX A;  2JSO A;  5FLX c;  4A3C G;  1B2T A;  2A1A A;  2A6H C;  2A19 A;  3BJU A;  1IBK Q;  1DZ1 A;  2NVQ H;  1O7Y A;  5C4H A;  1JOK A;  1SND A;  1H9K A;  2KBN A;  4B3M L;  3RUZ A;  3HKZ B;  1U9R A;  1D5Z C;  4Q5V A;  3K5O A;  4A3D G;  1NSN S;  1VQH A;  3HOX B;  2UUC Q;  5IYD G;  4ME5 A;  4EQN A;  4ODG A;  1EY4 A;  1JIC A;  2BOS A;  2RBM A;  5DM6 3;  3HOZ G;  4U67 3;  1VF5 C;  1I4G A;  3MXG A;  1H9S A;  3KDF A;  4RH6 A;  5T1I A;  1R4P B;  3J80 L;  1WTV A;  3KF6 B;  1B8A A;  5IWA Q;  2ZM6 L;  1BXT A;  4DNR B;  1C7Y A;  3LWU A;  4KK7 A;  3H91 A;  4QGU A;  1Y1V B;  4AYB E;  2OF1 A;  2SNM A;  4GN5 A;  3C46 A;  1G6P A;  2E2I B;  1A3T A;  4A3K H;  1HHV A;  3A5Z B;  3DUZ A;  5BR8 L;  5G3L D;  1LTL A;  1PYB A;  3STB C;  2F0Q A;  3GQB A;  3EJI A;  2AQ3 B;  1AFP A;  4H13 C;  4NXM L;  2UUA Q;  4A3L G;  4HJ5 A;  5C4Z A;  4AIM A;  2R92 G;  1AP0 A;  3S2D B;  1N33 Q;  4BY1 G;  1JB3 A;  5HGQ A;  2WB1 G;  2WP8 J;  5EGT A;  1QG7 A;  4DK0 A;  2K6A A;  1SMY C;  4LAA A;  3TDQ A;  1PTO H;  4J15 A;  4MN3 A;  3ZJY C;  1R4Q B;  2I5L X;  2WKD A;  3I91 A;  4BBS B;  4KHV A;  2LSS A;  3K81 C;  1CZW A;  1T9H A;  2UXC L;  4IPH A;  4ABN A;  1BF4 A;  1OXU A;  3BU2 A;  2QF7 A;  5C3E G;  1ZYR C;  4HR7 B;  4DR3 L;  3G6E A;  1D2B A;  4JC0 A;  1Z6H A;  1VMC A;  3HKS A;  4B3S L;  1Y8O B;  2VS1 A;  1AW7 A;  1N34 L;  4MNO A;  1X3Q A;  4LF6 Q;  2L9H A;  1VS0 A;  3I4N G;  1QOH A;  1I4R A;  3IL8 A;  1GJX A;  5GQO A;  1Q7Y C;  3NUC A;  3D6C A;  2XRS D;  3G4S A;  3PV0 A;  2F3I A;  4A3G B;  3KUP A;  3TRE A;  4RGT A;  4TRD A;  4A3D B;  1Q1E A;  5DAU A;  1R9T H;  3OWE B;  4JPB W;  1WTR A;  1PFM A;  3JAM L;  4DU9 A;  2D9U A;  3HOZ B;  1EWH A;  1B7Y B;  3RZO H;  1C8C A;  1U5K A;  1HFN A;  5T1G A;  1Q8I A;  3QOL A;  4LJZ C;  1N36 L;  1SR3 A;  1D5X C;  1KTK A;  3I4M H;  2PCF B;  1GUG A;  1AE3 A;  1AEX A;  1TVX A;  1UNS A;  3J7A V;  4PMB A;  4X65 Q;  1BBW A;  2O2L D;  3K80 C;  1I94 L;  2JP1 A;  5AFW A;  2N88 A;  3UDX A;  3P1H A;  1TWC B;  3GV3 A;  1HZC A;  2JXM B;  2HT1 A;  1I3Q B;  4LK1 C;  4X6A H;  4P75 A;  4C3H G;  5IYB G;  5JEA H;  2YTX A;  5C5M A;  3NBH B;  2M00 A;  4DV0 L;  4A3J G;  1KDC A;  5M9O A;  3H0G H;  1BDO A;  1I4H A;  1SXT A;  4X64 Q;  4NXN Q;  2Q8T A;  3I72 A;  3DEO A;  3BZK A;  1X3G A;  5DLQ E;  1SN8 A;  3NTH A;  4K6D A;  4DV4 L;  1NBW A;  2R92 B;  1Y1W G;  5IP7 G;  3NEM A;  4PNY A;  4LF5 Q;  4BY1 B;  2B3G A;  4LUV A;  1PTO C;  4TQU S;  2WB1 B;  3UDI A;  4A3F H;  4PMC A;  2RKS A;  2MFI A;  1RTO A;  1STA A;  5KIX A;  2YV5 A;  1L0W A;  4IFD I;  2UXB Q;  4P2C B;  4A3K G;  4G57 A;  5ELC A;  1EIY B;  1F2M A;  4ILW A;  2F0H A;  3I2Z A;  1C48 A;  3GTQ B;  2VQF Q;  5C3E B;  1H9M A;  2E5L Q;  3S24 A;  3H3V C;  5CC4 A;  1VMP A;  3G71 A;  2B2T C;  3G48 A;  1B50 A;  4L6T B;  5IGE A;  3T13 A;  4ALP A;  4DR4 Q;  1UUP A;  3HOU H;  3I4N B;  4DV5 Q;  2CKZ B;  1NCV A;  1GUS A;  2B2Y A;  2CWA A;  2K03 A;  3WOF A;  3PGZ A;  2I46 A;  3U9O A;  4XT3 B;  1VQ5 A;  5ELN A;  5ELF A;  1BVS A;  1CSQ A;  1SE3 A;  3E0J A;  2F0S A;  3X3N A;  1HR0 L;  1K8M A;  3BDC A;  1OXV A;  1BCP C;  1VQI A;  1NUC A;  3QWN A;  4X62 L;  2B29 A;  3D8G A;  4DR5 Q;  3M4Q A;  3M85 A;  3CRL C;  3IAY A;  2N8N A;  1CUK A;  5IT9 L;  3VDY A;  1PTO F;  2XWJ B;  1S5B D;  1SSO A;  3OMG A;  1HNZ Q;  4LF7 Q;  4JYA Q;  1T5X D;  4RCN A;  3SK5 A;  1V9P A;  1DOL A;  3OYY A;  3ULP A;  1OXX K;  1GHJ A;  4RMF A;  2IPK D;  3S16 H;  3Q0A A;  2NVX H;  4K14 A;  3RN5 A;  2PW5 A;  4R4O A;  5M5W B;  3DEP A;  1K0S A;  2IW3 A;  1PH1 A;  4C3H B;  1G2T A;  1SRO A;  4J8Q A;  3ONA B;  1E2V A;  2ZT9 C;  4IUP A;  3J7Z C;  4JI4 L;  4K2L A;  4R4T A;  4DR7 Q;  3GTG H;  4A3J B;  1UE5 A;  2MHV A;  2DGY A;  2XWB B;  3A5U A;  2E74 C;  4OX9 L;  2AWO A;  1QVC A;  1TWH H;  1MSH A;  1CHQ D;  1SJE D;  1GOZ A;  2WII B;  3DXJ C;  1XPO A;  2SDF A;  3ITP A;  3FVQ A;  2BDN A;  1XMQ L;  1HCZ A;  3HOY G;  4QY7 A;  1A8V A;  1VQE A;  1LAB A;  2NZ1 D;  4H7B A;  1Y1W B;  3A0J A;  4LF8 Q;  1O7L A;  4JBJ A;  4N8F A;  1TWG B;  4WRD A;  2NVY B;  1BCP F;  2HHH L;  4ZRZ A;  1DCZ A;  4KY7 A;  3M3Y H;  4YCV A;  5JEA G;  1NR4 A;  1VF7 A;  3OSO A;  2CHB D;  3J81 L;  1LYL A;  2IX1 A;  1IYV A;  5FJ8 H;  1K0R A;  5A2Q L;  4A3I H;  3GP7 A;  3QJY A;  3H0G G;  4ZKC B;  4A3K B;  4JVZ A;  4RKL A;  1ENA A;  1VQG A;  4ME3 A;  2YYZ A;  4FDB A;  1LTB D;  2PZT A;  2RA4 A;  2EYM A;  3CF5 A;  4A3E G;  2A6E C;  4DV1 Q;  3E9I A;  5CV8 A;  3Q8D A;  4AQY L;  4LW1 A;  4C1N K;  1YIJ A;  3R93 A;  4DAM A;  4GKK L;  3PUY A;  3C3L A;  4HIK A;  1SDF A;  1M8A A;  1TY2 A;  3NPP A;  1U4P A;  4IUR A;  5FOB B;  3K0X A;  1RL2 A;  2OEO A;  4DGZ A;  3JC6 6;  2YTV A;  5IP9 H;  4F87 A;  1H9S B;  3KDF B;  5DEH A;  1NMG A;  1GUO A;  4YWK A;  3RNU A;  3J7A 5;  3H94 A;  1PRT C;  1SYD A;  3OPO A;  1M1K C;  1YJN A;  5LMN L;  2QDL A;  2OQ0 A;  4HIO A;  4H02 A;  3TZU A;  3Q23 A;  4DAV A;  5JVG 3;  5FO7 B;  1JR0 D;  5KEE A;  1ESF A;  3BZC A;  1EIH A;  5ELB A;  1GO3 E;  4IO9 A;  1VQM A;  3I56 A;  4A4I A;  1XWE A;  3HOU G;  5EKI A;  1VQ9 A;  3HOX H;  1STG A;  1TR5 A;  1WCM G;  1V1Q A;  2ZJQ A;  4LF4 Q;  4X64 L;  4NXN L;  4YY3 Q;  2A6H D;  4JI7 L;  3K5M A;  2EYP A;  1TY0 A;  2PPB C;  1J6Q A;  2B2U C;  1I50 B;  4PZ6 A;  2F0P A;  1IKM A;  1TXY A;  3J81 i;  4DUY Q;  1BCP B;  4IJL A;  4KHP L;  1JWS D;  3TBI B;  2RDF A;  3QOJ A;  4G4K A;  3HS0 C;  1HA6 A;  3GTO H;  2AUJ D;  4DR2 L;  2WB1 E;  1Y1V H;  1E2W A;  2CQO A;  3SEB A;  1KD1 C;  3HOY B;  3EIV A;  3PO2 G;  3A55 A;  4JG2 A;  1QZH A;  5CBA E;  2ZTD A;  1L0Y B;  1PRT F;  2EVB A;  4IFD J;  1VQJ A;  1F2L A;  2F0L A;  4B3M Q;  3KLW A;  2AQ1 B;  2R7D A;  1VQN A;  1SYE A;  4ZQ3 A;  3P75 A;  1Z9F A;  5IYC H;  1VCI A;  4OO1 H;  3CQZ B;  5C4J B;  1ESR A;  1SE4 A;  1ONL A;  2FJ2 A;  3H0G B;  2BE5 C;  2CVR A;  3S2D H;  2JA8 B;  1LT4 D;  5JJL A;  4A3E B;  1LT6 D;  3R8B A;  3UI2 A;  1WD1 A;  3NTI A;  4JOI C;  1KAB A;  1FL0 A;  4NMZ A;  5JOB A;  1YNX A;  4DFA A;  3V2T A;  3ULJ A;  3E0E A;  4BBS H;  3KLS A;  4IOA A;  5CV5 A;  1NR2 A;  1VQD A;  4K0K L;  2EY1 A;  3STB D;  2B2W A;  4NDX A;  2J4X A;  4JBM A;  4A3C H;  2F3V A;  4NPS A;  1F9P A;  1BQQ T;  4HJ8 A;  1HUN A;  4LF7 L;  1HNZ L;  3AFP A;  4OEL B;  1XMO Q;  4JYA L;  1BKB A;  3VR4 A;  2EYL A;  2JEB I;  2D5D A;  3OHX C;  5BR8 Q;  1VQ6 A;  5LL6 S;  3HOW H;  1B53 A;  1SMY D;  1K8G A;  2QDB A;  1JOR A;  4NXM Q;  3S14 H;  5JJI A;  3D4R A;  2R6G A;  4A3G H;  4DN4 M;  1PDQ A;  2L12 A;  3LWE A;  4C56 C;  1G91 A;  4KJO A;  3GTM B;  1KIX A;  1TT2 A;  3HOU B;  4A3D H;  1V1P A;  1GUN A;  5IP9 G;  1WJJ A;  3C1E A;  5IYD H;  3BDL A;  4GLA C;  1FD7 D;  3RD4 A;  3HOZ H;  1K3R A;  1WCM B;  1CK1 A;  1WFQ A;  4IZ8 A;  4KKS A;  1DYQ A;  1E22 A;  1PRT B;  1E24 A;  3CP0 A;  4P71 A;  2UXC Q;  3CU7 A;  2X6G A;  2L4N A;  3S1Q H;  4DR3 Q;  4N9T A;  2IL8 A;  4GLV B;  3T53 B;  1B3Q A;  2ALY B;  2VB2 X;  4B3S Q;  1EYG A;  3HKZ G;  4ZLT F;  1N34 Q;  3E5S A;  1QE6 A;  5EQ0 A;  2VUM H;  3PO2 B;  3NEN A;  1LO5 D;  1AZP A;  1BNZ A;  3MZ5 A;  2NVX B;  2EYJ A;  3U50 C;  5ELO A;  4HED A;  1QCB D;  4JI1 L;  3PCO B;  2K5Q A;  1X3P A;  4X3K A;  4YWM A;  2C9O A;  4A3L H;  1SJH D;  3H3V I;  3SGI A;  2R92 H;  4BY1 H;  4QF4 A;  3UE0 A;  2OTL A;  2D0P A;  4YWL A;  2R7F A;  4ZKB B;  4CHT B;  1N36 Q;  2JEA I;  5I9O A;  3QG1 A;  3GTJ B;  2IJ0 A;  1MHW C;  4CGY B;  5J1Z A;  3IFD A;  4BXX H;  1Q82 C;  1IHZ A;  5BN4 A;  2K32 A;  1IL8 A;  1QIL A;  4L5S A;  4X3T A;  5CV7 A;  4P72 A;  2UUB L;  2EE1 A;  2IX0 A;  3CCR A;  4HCE A;  4GNX C;  1YJ9 A;  1DJR D;  2DNE A;  4DV0 Q;  3DMU A;  3LNN A;  3CMA A;  1PTO D;  1V8Q A;  3EA6 A;  3F2C A;  3FHW A;  2WAQ G;  1BBU A;  1G8Z D;  2IX3 A;  1HXY D;  4ID6 A;  3EN2 A;  1WD0 A;  2EY6 A;  1EQT A;  4LF4 L;  4DV4 Q;  2JA7 G;  2Z4I A;  2F03 A;  1QNK A;  1ROD A;  4DAY B;  1SNO A;  1J5E Q;  1CKM A;  1L1O A;  4G7H C;  1W6K A;  2VQE Q;  4CJ1 B;  5CV9 A;  3VYR A;  3CHB D;  4PMW A;  1I6V C;  3BZD B;  1PH9 A;  2VW9 A;  2HCI A;  1NJI C;  1WTH A;  3JAM E;  1JOO A;  2KED A;  2KQ3 A;  4XQJ A;  3T56 B;  2DNC A;  3HOW G;  1GHK A;  2BH8 A;  2JN4 A;  1TS2 A;  2B2V C;  4JI8 L;  5COY A;  5LHY 1;  5M3F B;  1YJW A;  2CH4 W;  4A3G G;  2PQA A;  3BVM A;  1SFO B;  1F2Z A;  1MSG A;  4JBW A;  3CCU A;  1FNV A;  3MVV A;  5M5W H;  4Y7N B;  1WTX A;  4LNQ A;  1BCP D;  2NZH A;  4C3H H;  5IYB H;  4DV3 L;  1EQV A;  2P5Z X;  3E6Z X;  5EPL A;  2NTT A;  4K8I A;  2QW7 A;  3D6W A;  2WKC A;  2ZXO A;  4A3J H;  3H6M A;  4RCO A;  1K73 C;  2LKV A;  1HR0 Q;  4FO2 A;  4M8A A;  1HZB A;  1MJE A;  3PO3 G;  3CC4 A;  4X62 Q;  1JB7 A;  2Z6K A;  4GN4 B;  4OIJ A;  1Y1W H;  5IP7 H;  3T1Y L;  3KYH C;  3CRK C;  3GTO B;  2PMZ E;  2GVB A;  1KL9 A;  3T16 A;  1TWG H;  4IUQ A;  2NVY H;  3TP8 A;  2L1B A;  3TP7 A;  3T4A C;  2CCZ A;  2VUM G;  2K75 A;  4QUF A;  1YNJ C;  1EY6 A;  2HDL A;  3KOJ A;  3CME A;  3MEF A;  3MXN B;  3VA7 A;  1WI5 A;  4XQQ A;  1XMO L;  3PUW A;  3TS0 A;  5BN3 A;  3G6J B;  1JWM D;  2Q2H A;  2RDG A;  1IL2 A;  2XGT A;  3R2T A;  2ZXP A;  5C6A A;  1YVC A;  1D7Q A;  4O2D A;  3CCJ A;  1EUJ A;  4P74 A;  4JI4 Q;  1XJV A;  1X56 A;  4PZ7 A;  1S40 A;  4K6L A;  4EQO A;  2XIW A;  1NE3 A;  2WAQ B;  4OX9 Q;  2G9H D;  1AE2 A;  2K5D A;  5F2D A;  1A6X A;  4GOP A;  2IT1 A;  1XMQ Q;  4BXX G;  1Y14 B;  2JA7 B;  5D3D A;  2TMP A;  2A6E D;  4J1M A;  2F1M A;  2PNR C;  2HHH Q;  1KQS A;  1CTM A;  3A7L A;  1F9S A;  1CHP D;  5IIF A;  1VQK A;  4DXF A;  4XIG S;  1IW7 C;  5GAD C;  3U4Z A;  1VQB A;  4WJW A;  4POF A;  2QEJ C;  3BS1 A;  2V1C C;  1UEA B;  4GNX B;  4FF3 A;  3H3V H;  3HOW B;  2DUD A;  3J80 i;  3OIQ A;  2WIN B;  2Z1C A;  3PF4 A;  5IT9 E;  3E9H A;  2R7Z G;  2HIX A;  3S14 B;  4AQY Q;  4DR1 Q;  2E75 C;  3P20 A;  1PRT D;  1STN A;  1II3 A;  5D65 A;  4GKK Q;  3HZX A;  3CCL A;  1IXR A;  3A8J E;  1B4O A;  2LY7 A;  2MGS A;  3BG3 A;  4B3R L;  1EEF D;  1Q8K A;  1Z47 A;  1I50 H;  1EY8 A;  2EIF A;  1S72 A;  1KRS A;  1MIU A;  2D0O A;  1Z7T A;  1I4P A;  3U58 A;  1STE A;  4QMG A;  2B39 A;  1CA6 A;  5LMN Q;  3FRP B;  1SNQ A;  1YBY A;  3S17 B;  3PO3 B;  4XXE A;  2PQE A;  2RSO A;  2XNA C;  3HOY H;  2MNA A;  1K83 B;  1YHB A;  2KEN A;  3S1Q B;  2NB0 A;  2R3Z A;  1RCV D;  3BDO A;  3W5O A;  4JI6 L;  2FHT A;  4JV5 L;  4K2K A;  2FXQ A;  3S1R B;  3ERO A;  1CZG A;  3CQZ H;  1FYC A;  2F0G A;  1U4M A;  2NWG A;  5C4J H;  2VUM B;  1XYI A;  2FMC A;  2RQX A;  3I8Z A;  4JI3 L;  2JA8 H;  1FNU A;  2F0D A;  4KHZ A;  4A3E H;  4JI7 Q;  3J81 E;  1OTC A;  1A3V A;  3TP6 A;  3T51 B;  5FLM H;  1UAP A;  5A2Q E;  1AZQ A;  1A2T A;  3FP9 A;  3RR5 A;  1LTR D;  5NUC A;  1HQR D;  3Q22 A;  4KHP Q;  1LT3 D;  1J5E L;  4HID A;  4DR2 Q;  5JEA J;  2DJF C;  2VQE L;  1JQY D;  1O7I A;  2E8G A;  3W3A A;  4IUV A;  1EU3 A;  4IN3 A;  4BA1 I;  3F2B A;  2BE5 D;  1F9Q A;  3L3O C;  2LS0 1;  2UXD L;  3V05 A;  3S1M H;  3OW7 A;  5K5P A;  2RHQ B;  4DXG A;  1PH5 A;  3K57 A;  3TQY A;  3JAM i;  2Z6B A;  2L0C A;  3BVG A;  3FKI G;  3K5N A;  3GTM H;  3PIP 3;  2NUC A;  3HKZ E;  4FXK C;  3CCE A;  3DM1 A;  2EPB A;  1DOK A;  2FMM A;  5E7N A;  1WVL A;  1PH2 A;  3AU7 A;  1NY4 A;  2R7Z B;  3TN2 A;  1UE6 A;  1WCM H;  4OO1 I;  1WYD A;  2R61 A;  1VQ8 A;  1SYG A;  2XRQ D;  2RVL A;  1C0A A;  4K0K Q;  3CC7 A;  5BN5 A;  5ELE A;  3ERS X;  4EGV A;  2KJX A;  3IFT A;  1OO9 B;  3TEH B;  1SNM A;  4KTA A;  3GTL B;  4WOR A;  4C1N I;  1EL0 A;  2RCN A;  4WJ3 M;  1TKW B;  5CBE E;  1JCK B;  1A15 A;  4OXP A;  1IKL A;  3PO2 H;  2NZO A;  1EWI A;  4BWG B;  4GZY C;  1W3S A;  2RHS B;  5HGT A;  1FGB D;  3K7A H;  4OL7 A;  3J80 c;  3GTP B;  1EIF A;  1I4Q A;  2VXW A;  1CKN A;  4JI5 L;  2OQK A;  2NVT B;  4UP9 A;  3HEJ A;  3PIP A;  2F0O A;  1XXG A;  4RG1 A;  3KFU A;  1QVF A;  4C2M H;  2WAQ E;  4Q0F A;  3T1H L;  3GTJ H;  5CV4 A;  3ICE A;  1BBX C;  4C3I G;  3AFQ A;  2PZW A;  2VL6 A;  2L5T A;  1PZI D;  2K7V A;  2A69 C;  1Q12 A;  2E76 C;  1NTG A;  2BH2 A;  3MXP A;  4F88 A;  2G9D A;  3TZD A;  2F0K A;  4OGQ C;  3E3X A;  1GVP A;  4KD4 A;  1A2U A;  4QCL A;  4IUU A;  2JA8 G;  1SRU A;  4FP5 D;  1X55 A;  3DLL A;  1D6E C;  4B08 A;  2PQA B;  2HDM A;  4JI1 Q;  5FLM G;  2DY8 A;  4L5Q A;  4DR1 L;  2CWP A;  1DD2 A;  1PMR A;  2AKW B;  4E6I A;  3FKI B;  3NWS A;  2WAC A;  5HUR A;  3K59 A;  4YHH L;  3MFG A;  4R4I A;  2TSS A;  4DV2 L;  4A3B H;  3B6Y A;  1P16 A;  2B8G A;  5EPK A;  2QGQ A;  2Z9H A;  1HPC A;  3VA5 A;  1U4R A;  3F8T A;  3FDT A;  3FPU B;  2NN6 G;  4JI2 L;  2HUG A;  4HSV A;  2OT2 A;  4GKJ L;  3PIO 3;  3MAQ A;  4O0A A;  1KDA A;  1KLU D;  2UUB Q;  2Q2T A;  2VNU D;  4RFB A;  1E3P A;  5M3F H;  3NP8 A;  1UE1 A;  1HNW L;  1IYJ B;  4XTC S;  3KF6 A;  1SFO H;  3BVZ A;  4HMJ A;  4Y7N H;  3JAM c;  1UWV A;  2X6L A;  1ENF A;  3RZD B;  1LM0 A;  1KAA A;  4EX5 A;  3DM3 A;  5JVH 3;  2QEX A;  5G3L F;  5HY6 A;  5FO8 B;  1OXT A;  2UU9 L;  4EQP A;  2O5J C;  1K8O A;  3IRB A;  3DWP A;  2D2C C;  3I7F A;  1Q1B A;  2B2Y C;  5FLX L;  1QNU A;  2I5M X;  5JPN C;  3PMF A;  3ULL A;  3K58 A;  4POG A;  4DNT B;  5AJ3 L;  2HQE A;  4L63 B;  3I73 A;  2PYK A;  3RLF A;  3TSS A;  2EXD A;  1Y69 U;  1TS5 A;  3VYT A;  3X3M A;  1LAC A;  3HFZ B;  4V19 0;  4C3I B;  4U68 A;  1QVG A;  4JI8 Q;  1JJG A;  3TS2 A;  4GN3 B;  3CCM A;  1KNA A;  3EBE A;  1M90 C;  1MGS A;  2MUY A;  1EZ6 A;  3NEL A;  4YCW A;  4DV3 Q;  1N32 L;  1B44 D;  3CW2 C;  1PV4 A;  2X69 A;  5E4X A;  4CDF C;  1WTW A;  3MWY W;  4RHS A;  4RAU C;  5D3I B;  1I4X A;  1XPU A;  1O7Z A;  4G7O C;  4A93 H;  2F0J A;  1B70 B;  4JK1 C;  1YNJ D;  4PG3 A;  4TSS A;  2JA5 G;  4KY5 A;  3MTS A;  2LMC B;  2JA7 H;  3T1Y Q;  2BA1 A;  4RA8 A;  1UE7 A;  5M3M H;  4DNI A;  3SXH A;  2PI2 E;  2HCC A;  5A35 A;  1PFS A;  2K28 A;  1STH A;  4MHE A;  4IOC A;  1I6H B;  4K5X A;  1IYU A;  1N9W A;  4ULL A;  1KHI A;  5C0X H;  3S1M B;  2F0T A;  3GV6 A;  1JWU D;  2EYF A;  1PFN A;  4S3S A;  5J39 A;  2F0F A;  4UHV A;  4LUO A;  3S15 B;  3A8I E;  5J3B A;  4DR6 L;  2KEC A;  2K5N A;  4A3B G;  2XSC A;  3VR3 A;  1XPR A;  1E2Z A;  3NXW A;  4H44 C;  2O4X A;  1XNR L;  1ZYR D;  2DY7 A;  4KJN A;  3VYU A;  4MZ9 A;  1PFB A;  1IW7 D;  5IT9 c;  1UEB A;  4QJF A;  2EJG C;  3NBH A;  2YTY A;  2ASB A;  1PA6 A;  3CKI B;  2Z0S A;  5I2X A;  4KKU A;  3S17 H;  4FF4 A;  3PO3 H;  2BA0 A;  3K0Y A;  4OON A;  4K8J A;  5M3F G;  3GDE A;  1K83 H;  2B8F A;  2R93 H;  5E3F A;  1J9O A;  2F0N A;  5M5Y H;  2K4K A;  1XX8 A;  4BBR G;  1STY A;  3J80 E;  2E2H B;  3AEV A;  4ZYS A;  3AYH B;  4M1U B;  3S1R H;  3CPF A;  5IGG A;  1ML0 D;  2PW7 A;  1NAP A;  3L2P A;  4KI0 A;  2YU9 B;  3SVM A;  1RD9 D;  2M9V A;  2H4O A;  1FVI A;  3I3C A;  1BUV T;  5EBD A;  2VY3 A;  4LUZ A;  4RGN A;  3S1N B;  3K7A B;  4JBK A;  2MQH A;  3QR8 A;  2ICE C;  3S9W A;  1W6J A;  2PNH A;  4FF1 A;  4B3R Q;  1N8R C;  2FIN B;  2MJ8 A;  3H15 A;  4JI0 L;  4DF7 A;  2Z4H A;  4MTK A;  4C2M B;  1HNX Q;  3J81 c;  1TQO A;  3QO2 A;  1EYA A;  4IFD G;  3W1B A;  1VQO A;  2ICI A;  2JA5 B;  1JJC B;  1QB5 D;  4JI6 Q;  3J81 j;  3SE0 A;  3CPW A;  1EY9 A;  4R1J A;  4TKO B;  4F7X A;  4JV5 Q;  1H9R A;  2K5H A;  4G7Z C;  1KNE A;  2F0M A;  2N3S A;  3OMC A;  4V0B A;  5C3X A;  3WOE A;  3DHQ A;  2K5W A;  3SK6 A;  2F0E A;  4JI3 Q;  4QL5 A;  1PH3 A;  4DV7 Q;  4A93 G;  4PV1 C;  4IUN A;  4KD3 A;  4A3M H;  5M5X B;  1LV9 A;  4B9W A;  2R7Z H;  1HTL D;  3Q6S A;  5EBC A;  1CFM A;  1EOV A;  1S4Z A;  1EYD A;  3I90 A;  1E1T A;  3I4O A;  1JT8 A;  5M3M G;  1D1I A;  3D4D A;  5EJW A;  4A3B B;  2CW0 C;  1JE5 A;  5IY0 A;  5GAE C;  1ILP A;  3GTL H;  2A74 C;  4PQX A;  4IUT A;  2GVA A;  4R9W A;  1EQQ A;  1JC7 A;  1E7Z A;  1TS3 A;  4L5R C;  2B2W C;  3PF5 A;  5C0X G;  2I07 B;  2UXD Q;  2EJM A;  1QWY A;  4BS9 A;  1JMC A;  1GM5 A;  5L37 A;  1ILQ A;  4KKT A;  5C44 G;  1HR0 W;  4DV6 L;  4R4C A;  4OIK A;  3I70 A;  1EU4 A;  3LGJ A;  3F2D A;  2V4D A;  4BBR B;  3WDN A;  3NQI A;  2OCE A;  3GTP H;  1CM9 A;  3AMU A;  2F52 A;  1B1Z A;  2JA6 G;  1BR9 A;  2NN6 I;  2CFM A;  3SDZ A;  2NVT H;  1RDP D;  3A54 A;  4YCU A;  1G6Z A;  1YZ6 A;  1ZEQ X;  2KOL A;  2KEE A;  1DM0 B;  2K14 A;  3HOV H;  4DK6 C;  2R93 G;  3K7U C;  4BY7 G;  2LFN A;  1U0L A;  3RMH A;  4DK3 C;  3M4O B;  1FR3 A;  2G5D A;  1IBL L;  4X66 Q;  1CSP A;  4DK1 A;  4XQN A;  2B63 H;  2KCT A;  3Q24 A;  4I65 A;  1ICF B;  1VQ7 A;  1KAW A;  3PSI A;  3EFX D;  3R3O A;  3BYT B;  1HZA A;  5E1F A;  2KHI A;  4F8M A;  4CKC A;  2N78 A;  1Y8N B;  2F0U A;  4JI5 Q;  2A68 C;  3FKI H;  4O1N A;  4Z9C B;  2A69 D;  2F0V A;  4LF9 L;  4FXD A;  5J22 A;  4IPG A;  5KYI A;  2D62 A;  4DKA C;  1PYS B;  4A93 B;  2JK8 A;  3T1H Q;  3H09 A;  4LFC L;  5CV6 A;  2B2T A;  1K9M C;  4HJ7 A;  4NP5 A;  2IWH A; 
#chains in the Genus database with same CATH homology
 4OO1 I;  4JI7 L;  4DV1 L;  1WYD A;  1S3O A;  2AWN A;  4APV A;  1VQ8 A;  1J6Q A;  1C0A A;  4K0K Q;  3CC7 A;  4PZ6 A;  2JQO A;  1FJG L;  2IY5 B;  1TXY A;  3J81 i;  4DUY Q;  3ERS X;  2OTJ A;  4IJL A;  4DPG A;  3OTO Q;  1VQ4 A;  3TEH B;  4KHP L;  2N49 A;  2PI2 A;  5JJK A;  3GTO H;  4NB3 A;  4DR2 L;  2RCN A;  2E2J H;  1Y1V G;  4WJ3 M;  2WB1 E;  4B3T Q;  2AHO B;  2XTI A;  1Y1V H;  2C35 B;  1L2F A;  4HJA A;  4C3J H;  2CQO A;  1KD1 C;  3EIV A;  3PO2 G;  4OXP A;  3RZD H;  4JG2 A;  4L5T A;  1TWF H;  1C9O A;  1X6O A;  2ZTD A;  4A3M G;  1QZH A;  1I94 Q;  3PO2 H;  2NZO A;  1EWI A;  1TWA H;  1ASZ A;  1EFW A;  5LMN W;  1YHQ A;  1W3S A;  1VQJ A;  3L7Z C;  4IFD J;  2RHS B;  3PUV A;  3PUX A;  1K8A C;  1CKN B;  4B3M Q;  2WFW A;  3KLW A;  5LMU L;  2R7D A;  3GTQ H;  3K7A H;  1NMF A;  5IYC G;  1VQN A;  3M7N A;  3J80 c;  4OO1 G;  1Z9F A;  5IYC H;  1VCI A;  5C3E H;  1Q86 C;  1QZG A;  2KCM A;  1EIF A;  1CKN A;  2Y0S E;  4YHH Q;  4DUZ L;  3TRZ A;  4JI5 L;  4MTN A;  4DV2 Q;  2OQK A;  3D0F A;  2ID0 A;  2K52 A;  4LFA L;  3S2D H;  4UP9 A;  5K36 G;  3PIP A;  4HJ7 A;  5EAY A;  2MO0 A;  5IE8 A;  3I4N H;  4RG1 A;  5JJL A;  3RLO A;  3KFU A;  4BA2 I;  1IBM L;  4IJH A;  4UP8 A;  1HNX L;  4C2M H;  2MO1 A;  2WAQ E;  4JI2 Q;  2ZJR A;  3T1H L;  1QVF A;  1L1O C;  4JOI C;  3CD6 A;  4GKJ Q;  1FL0 A;  3GTJ H;  1YNX A;  4A76 A;  3ICE A;  3ULJ A;  4YY3 L;  4BBS G;  2A8V A;  3E0E A;  3AFQ A;  2RF4 A;  3D31 A;  4LWC A;  4C3I H;  4BBS H;  2K5V A;  4IOA A;  2VL6 A;  3KJP A;  1G51 A;  1VQD A;  4LFB Q;  1HNW Q;  4K0K L;  2ZTC A;  1Q12 A;  3STB D;  1NTG A;  1X3F A;  2BH2 A;  4DUY L;  1MJC A;  1XTD A;  1SMX A;  3OTO L;  5FLX c;  3A74 A;  4JBM A;  2IX1 A;  4GLX A;  4A3C G;  4A3C H;  1GVP A;  4NPS A;  4KLK A;  2A1A A;  4HJ8 A;  4B3T L;  4LF7 L;  2A19 A;  3BJU A;  1HNZ L;  3AFP A;  1XMO Q;  4JYA L;  1BKB A;  1SRU A;  3DLL A;  1X55 A;  2IHF A;  2JEB I;  1IBK Q;  2JA8 G;  2UU9 Q;  2PQA B;  5BR8 Q;  2NVQ H;  1VQ6 A;  3HOW H;  4DV7 L;  1K8G A;  4JI1 Q;  5FLM G;  2ZJP A;  4NXM Q;  2L15 A;  3I55 A;  3S14 H;  4L5Q A;  5JJI A;  2R6G A;  2CWP A;  2KBN A;  4DR1 L;  4A3G H;  3HOV G;  2AKW B;  4B3M L;  4A3D G;  1KIX A;  1VQH A;  4A3D H;  4YHH L;  5AJ3 Q;  2UUC Q;  5IYD G;  5IP9 G;  4R4I A;  1WJJ A;  4DV2 L;  5C4X H;  3B6Y A;  4A3B H;  5IYD H;  1P16 A;  2QGQ A;  1HH2 P;  4GLA C;  3HOZ G;  1KC8 C;  2Z6K C;  2B63 G;  3HOZ H;  1K3R A;  1I6H H;  3KDF A;  1RIP A;  3F8T A;  1WFQ A;  2NN6 G;  4TVA B;  4JI2 L;  4GKJ L;  2LXK A;  1E22 A;  2UXC Q;  1E24 A;  3CP0 A;  4O0A A;  4P71 A;  3KF6 B;  2UUB Q;  2KHJ A;  1B8A A;  5IWA Q;  2Q2T A;  2VNU D;  2Q2U A;  1E3P A;  5M3F H;  1QUQ A;  1UE1 A;  2ZM6 L;  4DR3 Q;  3S1Q H;  3S15 H;  4LFB L;  1IYJ B;  1HNW L;  4GLV B;  4XTC S;  3KF6 A;  2ALY B;  1SFO H;  4B3S Q;  2K50 A;  1C7Y A;  1EYG A;  3HKZ G;  1N32 Q;  4QGU A;  5GAH C;  4Y7N H;  2JA9 A;  1N34 Q;  4AYB E;  3JAM c;  1UWV A;  3CCV A;  1G6P A;  4GN5 A;  3M9B A;  1LM0 A;  1E1O A;  2I5H A;  4EX5 A;  2VUM H;  3DM3 A;  3NEN A;  5H1S E;  2QEX A;  4A3K H;  1IBK L;  5HY6 A;  3U50 C;  2HIV A;  3A5Z B;  4PZ8 A;  5ELO A;  1OXT A;  2UU9 L;  4YY3 Q;  5BR8 L;  1LTL A;  1PYB A;  3STB C;  3IRB A;  4JI1 L;  3PCO B;  2ATW A;  1P8L A;  1WOC A;  4NXM L;  3I7F A;  4YWM A;  1Q1B A;  1YEZ A;  2UUA Q;  4A3L G;  4HJ5 A;  2I5M X;  4A3L H;  4GOP C;  3ULL A;  4AIM A;  2R92 G;  3H3V I;  3SGI A;  4OWT B;  4POG A;  2H5X A;  2R92 H;  1N33 Q;  4BY1 G;  5AJ3 L;  2UUC L;  4BY1 H;  5HGQ A;  2WB1 G;  3WWV A;  3UE0 A;  2WP8 J;  2OTL A;  3RLF A;  2D0P A;  4YWL A;  2EXD A;  2R7F A;  4X66 L;  4Y52 H;  2EQS A;  1N36 Q;  2JEA I;  3CAM A;  2E2H H;  3ZJY C;  4J15 A;  1I5F A;  2I5L X;  4BXX H;  3HFZ B;  1Q82 C;  2LSS A;  2YU9 H;  1QVG A;  3K81 C;  4JI8 Q;  1YHA A;  4OWW B;  1JJG A;  3TS2 A;  1T9H A;  2UXC L;  4DR6 Q;  4L5S A;  4GN3 B;  4HIM A;  4IPH A;  4P72 A;  2UUB L;  5IWA L;  3CCM A;  3UDF A;  1OXU A;  3BU2 A;  5C3E G;  2Y0S G;  3EBE A;  1M90 C;  3S1N H;  1AH9 A;  2IX0 A;  4DR3 L;  3CCR A;  3G6E A;  4JC0 A;  3NEL A;  4GNX C;  1YIT A;  4B3S L;  3HKS A;  4YCW A;  4DV3 Q;  1YJ9 A;  1XNR Q;  1N32 L;  3CW2 C;  1PV4 A;  2VS1 A;  5C0X I;  1N34 L;  4DV0 Q;  4MNO A;  4LF6 Q;  3CMA A;  1VS0 A;  3I4N G;  3F2C A;  3FHW A;  1D8L A;  2WAQ G;  4EQ5 A;  1BBU A;  1XPU A;  4QQB X;  5GQO A;  4A93 H;  1Q7Y C;  3KJO A;  3G4S A;  3PV0 A;  1XNQ Q;  2F3I A;  3EN2 A;  3M4P A;  1B70 B;  3TRE A;  3GO5 A;  4PG3 A;  4LF4 L;  4DV4 Q;  1L1O B;  2JA7 G;  2JA5 G;  2I0Q A;  1Q1E A;  2JA7 H;  2UUA L;  2JA5 H;  4DAY B;  3T1Y Q;  1R9T H;  2F4V Q;  2BA1 A;  3GD7 A;  1UE7 A;  5M3M H;  1J5E Q;  1CKM A;  1L1O A;  4JOI A;  4DNI A;  2PI2 E;  2VQE Q;  4A75 A;  1N33 L;  4DR7 Q;  4UPA A;  1PFS A;  5GAG C;  3OW2 A;  1B7Y B;  3RZO H;  4IOC A;  2HQL A;  4PMW A;  1U5K A;  1PH9 A;  1N9W A;  2VW9 A;  3I4M G;  1PHJ A;  1N36 L;  1NJI C;  1SR3 A;  3I4M H;  1KHI A;  1VQA A;  1V43 A;  4AH6 A;  3HOW G;  1AE3 A;  2BH8 A;  4JI8 L;  4X65 Q;  3W1G A;  1BBW A;  3F1Z A;  3K80 C;  4LUO A;  1YJW A;  1I94 L;  4A3G G;  5J3B A;  5M5X H;  4DR6 L;  2IHE A;  2PQA A;  3UDX A;  1HZC A;  2HT1 A;  4JBW A;  3CCU A;  5M5W H;  1GKH A;  4X6A H;  3RN2 A;  4LNQ A;  4P75 A;  2JJQ A;  4JI0 Q;  3GTK H;  2NZH A;  5IYB G;  2K5N A;  4C3H H;  2YTX A;  4JCV E;  5IYB H;  4DV3 L;  1XPR A;  1PH4 A;  1XNR L;  4A3B G;  1A0I A;  3NBH B;  4DV0 L;  4A3J G;  4MZ9 A;  4LF6 L;  5IT9 c;  3H0G H;  4A3J H;  1UEB A;  4QJF A;  1VQF A;  2GN5 A;  2YTY A;  4X64 Q;  4NXN Q;  1PVO A;  1K73 C;  2ASB A;  1HR0 Q;  1PA6 A;  3BZK A;  1X3G A;  5DLQ E;  1HZB A;  1MJE A;  1SN8 A;  1MKH A;  2Z0S A;  3UDG A;  3PO3 G;  3CC4 A;  4X62 Q;  1JB7 A;  4DV4 L;  3S17 H;  3PO3 H;  1NBW A;  2BA0 A;  2AMC B;  4OON A;  4P73 A;  2Z6K A;  1Y1W G;  5IP7 G;  3NEM A;  4GN4 B;  5M3F G;  3GDE A;  1K83 H;  1Y1W H;  4LF5 Q;  5IP7 H;  3T1Y L;  2R93 H;  2B3G A;  3KYH C;  1G29 1;  4LUV A;  4A3F G;  3PUZ A;  4TQU S;  1OXS C;  2PMZ E;  2GVB A;  3UDI A;  2K4K A;  1KL9 A;  5M5Y H;  1TWG H;  4AYB G;  4A3F H;  2NVY H;  4BBR G;  2MFI A;  3AQQ A;  3AEV A;  4BBR H;  1VQP A;  3AYH B;  1SE8 A;  2YV5 A;  1L0W A;  3CPF A;  3S1R H;  4IFD I;  2UXB Q;  2CCZ A;  2VUM G;  2K75 A;  4OWX B;  3L2P A;  4KI0 A;  3KOJ A;  3CME A;  1FVI A;  3MEF A;  3MXN B;  4A3K G;  1WI5 A;  1EIY B;  1XMO L;  3PUW A;  2VY3 A;  3TS0 A;  3I2Z A;  2Q2H A;  4LUZ A;  3CXC A;  1IL2 A;  2XGT A;  2VQF Q;  4HJ9 A;  4X65 L;  2MQH A;  4JBK A;  2E5L Q;  3S24 A;  1YVC A;  1D7Q A;  1KXL A;  4O2D A;  3CCJ A;  2PNH A;  4B3R Q;  1EUJ A;  4P74 A;  3G71 A;  2QA4 A;  1XJV A;  1X56 A;  4PZ7 A;  1S40 A;  3G48 A;  1N8R C;  4JI4 Q;  3H15 A;  4JI0 L;  4ALP A;  4DR4 Q;  4GOP B;  1PH8 A;  3HOU H;  1NE3 A;  3CCS A;  1EQR A;  3M4O H;  1LUZ A;  4DV5 Q;  4OX9 Q;  2CKZ B;  2CWA A;  1AE2 A;  1HNX Q;  3PGZ A;  3J81 c;  4GOP A;  2IT1 A;  1VQ5 A;  5ELN A;  5C4X G;  1XMQ Q;  1BVS A;  4BXX G;  4IFD G;  1CSQ A;  1Y14 B;  4NXN L;  3W1B A;  1VQO A;  1HR0 L;  3L0O A;  1JJC B;  1OXV A;  4DV6 Q;  4R4Q A;  1VQI A;  3PIO A;  4X62 L;  4JI6 Q;  2B29 A;  3J81 j;  4DR5 Q;  2HHH Q;  3M4Q A;  3CPW A;  1KQS A;  4R1J A;  4JV5 Q;  4IPD A;  4LF5 L;  2K5H A;  3K8A A;  1VQL A;  3M85 A;  4XIG S;  1VQK A;  3CCQ A;  5GAD C;  3RLN A;  2N8N A;  3U4Z A;  1CUK A;  1VQB A;  2N3S A;  3VDY A;  4POF A;  4LF7 Q;  1HNZ Q;  2V1C C;  3ER0 A;  4GNX B;  4JYA Q;  3H3V H;  2UXB L;  4JI3 Q;  4QL5 A;  2E2I H;  2DUD A;  1PH3 A;  4DV7 Q;  1V9P A;  3OYY A;  3J80 i;  3ULP A;  4A93 G;  1ASY A;  1OXX K;  3PF4 A;  4GNX A;  4RMF A;  3E9H A;  4A3M H;  2HIX A;  2R7Z G;  3S16 H;  3CC2 A;  2NVX H;  4AQY Q;  4DR1 Q;  2R7Z H;  1A63 A;  3RN5 A;  4GKK Q;  1EOV A;  4R4O A;  3CCL A;  1IXR A;  2VQF L;  1E1T A;  3I4O A;  3S2H H;  2E5L L;  1PH1 A;  1JT8 A;  1SRO A;  5M3M G;  3J7Z C;  4B3R L;  1Q8K A;  1Z47 A;  1I50 H;  2EIF A;  1S72 A;  4JI4 L;  1JE5 A;  4R4T A;  1KRS A;  5IY0 A;  5GAE C;  1MIU A;  1HZ9 A;  2D0O A;  1PH6 A;  1IBL Q;  2ZTE A;  1UE5 A;  3GTG H;  2DGY A;  4DR4 L;  3A5U A;  1CKO A;  3GTL H;  4DV5 L;  2AWO A;  3U58 A;  1QVC A;  4OX9 L;  1TWH H;  2GVA A;  1EQQ A;  1E7Z A;  1XPO A;  5LMN Q;  4L5R C;  3PF5 A;  5C0X G;  1XMQ L;  1YBY A;  3HOY G;  1W2B A;  2UXD Q;  4QY7 A;  1A8V A;  1VQE A;  3HOY H;  1JMC A;  2MNA A;  4UY8 C;  1SLJ A;  1YHB A;  2KEN A;  1GM5 A;  3A0J A;  4QIW E;  4LF8 Q;  5C44 G;  2ZM6 Q;  4JBJ A;  4R4C A;  4DV6 L;  1HR0 W;  5C44 H;  3W5O A;  4JI6 L;  3LGJ A;  3F2D A;  4DR5 L;  2HHH L;  4JV5 L;  3M3Y H;  2FXQ A;  2OCE A;  1HJP A;  4YCV A;  5JEA G;  3GTP H;  1X3E A;  1LYL A;  2F52 A;  1KRT A;  5FJ8 G;  1X9N A;  4LF9 Q;  2OWO A;  3CQZ H;  5C4J H;  2JA6 G;  5FJ8 H;  1K0R A;  2NN6 I;  4A3I G;  3KF8 B;  2CFM A;  2JA6 H;  2NVT H;  4A3I H;  3H0G G;  1VQG A;  4ME3 A;  4YCU A;  2YYZ A;  4FDB A;  4JI3 L;  4LFC Q;  2JA8 H;  1YZ6 A;  1DGS A;  1A62 A;  4KHZ A;  3CF5 A;  4A3E G;  4A3E H;  4JI7 Q;  1OTC A;  5C0X J;  4DV1 Q;  5FLM H;  3E9I A;  3Q8D A;  1XNQ L;  4AQY L;  4LW1 A;  5GRO A;  4GS3 A;  4DAM A;  2K14 A;  3FP9 A;  3RR5 A;  1YIJ A;  3PUY A;  1FJG Q;  3HOV H;  4GKK L;  4DK6 C;  1IZ6 A;  1VQC A;  1Q46 A;  2R93 G;  3K7U C;  4HIK A;  4BY7 G;  4KHP Q;  2F4V L;  1U0L A;  4DK3 C;  4BY7 H;  3K0X A;  1RL2 A;  3JC6 6;  1J5E L;  4HID A;  2YTV A;  1X65 A;  5IP9 H;  4DR2 Q;  4WJ4 A;  5JEA J;  1IBL L;  4X66 Q;  3KDF B;  2VQE L;  1FGU A;  4DR7 L;  1O7I A;  2E8G A;  1NMG A;  1PH7 A;  3U4V A;  1CSP A;  4YWK A;  3RNU A;  3J7A 5;  2B63 H;  2KCT A;  1Q81 C;  1M1K C;  1YJN A;  4BA1 I;  3F2B A;  5LMN L;  1VQ7 A;  1H95 A;  2Q2I A;  1KAW A;  3PSI A;  1QUQ B;  2OQ0 A;  2UXD L;  4UP7 A;  4HIO A;  3S1M H;  1X54 A;  1HZA A;  2JE6 I;  4H02 A;  2RHQ B;  5LMU Q;  2KHI A;  1PH5 A;  4LF8 L;  3TQY A;  3JAM i;  2ES2 A;  3BZC A;  2N78 A;  1YI2 A;  1GO3 E;  2VZA A;  4DUZ Q;  1TWC H;  4IO9 A;  1JJ2 A;  4JI5 Q;  2LXJ A;  3FKI G;  3UE1 A;  1VQM A;  3I56 A;  1I3Q H;  3FKI H;  4A4I A;  3GTM H;  3HOX G;  4LFA Q;  3HOU G;  3HKZ E;  1VQ9 A;  4LF9 L;  3HOX H;  3CCE A;  4IPG A;  5E7N A;  2D62 A;  4DKA C;  1PYS B;  4IPC A;  1PH2 A;  1IBM Q;  2JK8 A;  1GD7 A;  3T1H Q;  1NY4 A;  4LFC L;  1K9M C;  1WCM G;  1V1Q A;  2ZJQ A;  4LF4 Q;  1UE6 A;  4X64 L;  1WCM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...