3S17H

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s17H00
2VQEL 1YIJA 3ULPA 1NY4A 4K0KL 2DGYA 1VQJA 1HNXQ 4R4IA 1MJEA 2UUBL 5JEAG 1QVGA 1C7YA 3I55A 2ATWA 4A3DH 4JBWA 4GKKL 4X6AH 1X3EA 1UWVA 1SR3A 4NPSA 4JI8Q 4A3LH 2KBNA 3I4MG 2Q2IA 1VQNA 4GN4B 3CMAA 4JCVE 2CCZA 4DR1L 3RLOA 2MO1A 1I5FA 3RLNA 2VZAA 2GN5A 1GD7A 4IFDG 1WCMH 1AH9A 2JA8G 1K8AC 4A3CH 2WP8J 4R1JA 1B7YB 3ULLA 5LMNW 2PMZE 3CCMA 1Z47A 1U5KA 1VQ5A 3GTOH 4FDBA 4AIMA 1IL2A 2JEAI 4KHPQ 2N3SA 4JI8L 5C44H 3J81i 4JBKA 2AMCB 2V1CC 2R93G 2UU9Q 2KHJA 5GROA 1DGSA 4DV2Q 2B29A 1LYLA 3SGIA 3TQYA 1XJVA 3CC2A 1A0IA 3A0JA 4XTCS 3T1HL 4LF6Q 3K7UC 2BA1A 4A3JH 1L1OB 1G6PA 5LMUQ 3CCQA 1TWAH 1PH5A 5EAYA 4H02A 3I7FA 4KHPL 5C4XH 3BJUA 2JA5H 1VQ7A 2K5HA 1HNZQ 2H5XA 2UU9L 4JI5Q 4Y7NH 1GO3E 1YHBA 5C3EG 4DV2L 4DV5Q 1JJGA 2PQAA 2YU9H 2NZOA 4RMFA 1K9MC 2BH2A 4LF6L 3OTOQ 1X3FA 2HIXA 4R4CA 2B63G 3KYHC 2K5NA 4XIGS 5M5YH 5LMUL 1JB7A 3BZCA 2ZM6Q 3PO2H 4DR7Q 4BBSH 1Q1BA 5FLMH 1D7QA 2L15A 1PH2A 4JI4Q 1PH4A 1PH1A 1XTDA 1Z9FA 4JC0A 3RR5A 3J81c 4LF7Q 4JI5L 3KLWA 4AYBE 5IWAL 4NXML 1PVOA 4QJFA 3HOUH 3HOXH 3S1MH 4YWMA 4DKAC 5JJLA 5IP9G 4A3KG 4O2DA 3FKIH 1M1KC 2ZTEA 3PO3H 3OW2A 1QUQA 2IX0A 3OTOL 2GVBA 3CCRA 3T1YQ 2ZJRA 2JE6I 2ZTDA 4DV4Q 4C3HH 3CMEA 4O0AA 4BBRH 2ZM6L 1N34Q 4DR7L 5HGQA 4GKJL 1I94Q 3L2PA 4HJAA 4DV1Q 2IHFA 4HIOA 4QQBX 2GVAA 2F3IA 2UUCQ 3S1RH 3TEHB 3H3VH 4POFA 2VUMG 1B70B 2IY5B 1Q1EA 1Q46A 4LF8L 5JJIA 3PF5A 4A3DG 2JEBI 3W5OA 1OXVA 4GOPC 3KDFB 4A3LG 3PSIA 4GNXC 2VY3A 4HJ5A 3TREA 3T1YL 4DV4L 1KD1C 3ERSX 4YCUA 3U4ZA 3UE1A 1ASZA 2JA7H 4A3GH 1S72A 4Y52H 3PUZA 1K0RA 2K14A 5M3FH 1EUJA 1I94L 5LMNQ 1CUKA 4AYBG 4DV1L 4BY1H 4B3TL 4BY7H 1WCMG 1YNXA 3CQZH 3KF6A 4LUZA 1VQPA 1KIXA 1PYBA 4OWWB 4A3CG 1VQLA 4X62L 4R4OA 1FJGL 3EIVA 4YWLA 2NVXH 3F2DA 4EQ5A 2R6GA 3K81C 3CCUA 2DUDA 1Y1VH 1D8LA 1BBWA 3G71A 4LFBQ 2BH8A 1VQAA 2NZHA 1TWGH 5C44G 1GM5A 3F2BA 1OTCA 3PUYA 1XNRQ 1HNWQ 1XPOA 5K36G 1X6OA 2ALYB 2ID0A 2K50A 1HZCA 1V43A 1E1OA 2EIFA 3CPFA 3E9IA 4TVAB 5LMNL 4JI7Q 1KXLA 3W1BA 1MIUA 5AJ3L 4A3IG 4IPGA 1B8AA 5C4JH 4DUZQ 4BXXG 3I4OA 4A3EG 1UEBA 1SN8A 1VQDA 3PIPA 1XMQQ 1J5EQ 3CCVA 1N33Q 5C4XG 2OTJA 2UXDL 1CSPA 1M90C 2I5HA 1IBKQ 2JA9A 3AEVA 4LWCA 1SFOH 4L5RC 1XNRL 3FP9A 2N78A 4IOAA 4YCVA 4QL5A 2RHSB 2WFWA 4KI0A 3RN2A 3H3VI 2E8GA 5GAHC 3NENA 4DUYQ 3M7NA 1CKNA 2HIVA 3KOJA 3BU2A 3CAMA 2IHEA 3UDFA 4DUZL 1S40A 1NJIC 3F1ZA 1N8RC 5ELOA 3RZDH 3K0XA 3H15A 1E22A 5FLMG 2UUAQ 2PNHA 1IBKL 2E5LQ 4YCWA 1UE7A 5FJ8G 1SLJA 4NXNQ 3F2CA 3J80c 3HOXG 1HR0L 4B3SL 5IYCH 2Z0SA 3E9HA 4JI1Q 2VQFQ 1VQBA 2FXQA 5IYBG 3FKIG 3J81j 4X66Q 3JAMi 4DR4Q 5GADC 2D62A 4DUYL 3ZJYC 3HOWH 3AFPA 2F4VQ 1VQ6A 1TWCH 2LSSA 4BBRG 3GDEA 4HJ7A 3KJOA 1Y14B 4UPAA 1HJPA 4LFCQ 1HNXL 1YVCA 2VW9A 2QA4A 1X9NA 1PV4A 4OONA 3M9BA 2E5LL 2NVTH 3M4QA 1QUQB 4LF9Q 3L7ZC 1VS0A 4NXNL 2YTVA 4JI3Q 2Q2HA 5IE8A 2YTYA 5J3BA 1PH3A 3ULJA 4HIDA 2I5LX 3CXCA 1PH8A 3HOYH 1NMGA 4RG1A 1QVCA 4A3FH 4GLVB 3GTQH 2R7ZG 2JA7G 4DR3Q 1Q86C 1KAWA 1BBUA 4LFAQ 2OQ0A 4JI2Q 5M3FG 1TWHH 3H0GH 4LW1A 4BY1G 1PA6A 4BY7G 4GOPA 5M3MG 3HKZE 3W1GA 2XGTA 4HIMA 1L2FA 1TWFH 4GS3A 4GNXA 4OX9Q 2LXJA 1PYSB 2IT1A 2OQKA 4JBJA 4LUOA 4LUVA 4QY7A 4LF9L 3GTMH 4MZ9A 3K80C 4JI3L 4JYAQ 3KF8B 3GTLH 4IO9A 2LXKA 4X64Q 1Y1VG 3JAMc 3IRBA 3A5UA 2HQLA 1FL0A 1WFQA 4LF5Q 4A93H 1N36Q 5IYDH 4AQYQ 4JI2L 1T9HA 1QZHA 1PH9A 3PUVA 3HOVH 1P8LA 3U4VA 1HH2P 4OX9L 2OWOA 1NBWA 1YITA 1XPRA 1XNQQ 1VQIA 2K75A 1KL9A 3CPWA 2KCMA 1HNZL 4A75A 2CWAA 4NB3A 2KENA 5C0XI 3S2HH 3WWVA 4DV5L 1L0WA 2A8VA 2OTLA 3MEFA 1VQOA 1K83H 4YHHQ 1Q81C 4B3MQ 4LF5L 2KHIA 3HKZG 3GD7A 4AQYL 2JA6H 3J7A5 2C35B 1GKHA 3GO5A 3K7AH 4YY3Q 4A3MH 2A1AA 3PV0A 2MO0A 4DV6Q 1SMXA 1Q8KA 4UP9A 1J6QA 2RCNA 4BA1I 1VQFA 1E1TA 3CP0A 4PMWA 4JI4L 4OWTB 1P16A 1E7ZA 4LF7L 3S15H 4GN5A 2PI2E 2ES2A 2AWNA 1JE5A 1U0LA 1YJ9A 1CKNB 4YHHL 5IYCG 5IP7H 1K8GA 3BZKA 4JI0Q 1AE2A 2YTXA 1A63A 1NTGA 3I4NH 1N34L 2HT1A 3HOWG 3AYHB 1MJCA 4DV6L 1IBMQ 3AFQA 4POGA 1WI5A 2K5VA 5GAEC 1IXRA 1YJWA 4P75A 5IT9c 5C0XG 1Q82C 4C3IH 1KRSA 1YBYA 3STBD 2HHHQ 2UUCL 1A8VA 1KHIA 3S16H 2E2HH 1SE8A 4X65Q 1L1OA 2K4KA 2K52A 3S24A 5FLXc 1KC8C 4P74A 3M3YH 2R93H 4JI0L 3J80i 3B6YA 1LTLA 1X3GA 1W3SA 4A76A 3PF4A 5E7NA 1TXYA 2N49A 3EBEA 1EFWA 4A3JG 2HHHL 2F52A 2NN6I 3H0GG 4HIKA 3LGJA 5JJKA 1EIFA 2JA5G 4LFBL 5M5WH 2MNAA 4J15A 4JYAL 2Z6KA 3NBHB 3UE0A 1HNWL 3U58A 5C0XJ 2E2JH 3CCSA 1WJJA 1MKHA 3KFUA 5C3EH 4LNQA 4GOPB 4JOIA 1XMOQ 1HZAA 4GNXB 4JBMA 4JI7L 4UP8A 3RN5A 3G6EA 1FGUA 2B63H 3A74A 2D0PA 3AQQA 3VDYA 1VQKA 3PO2G 4BBSG 1Q12A 1X65A 1W2BA 1XMQL 1J5EL 1N33L 2UXBQ 1OXSC 4DV7Q 2R7DA 2PQAB 1H95A 5HY6A 4K0KQ 3I56A 3CCLA 3HOUG 4DNIA 1NE3A 1N32Q 1HZBA 1UE5A 4IPHA 4P72A 3HFZB 2QEXA 4A3KH 1PH6A 3PO3G 2WB1G 2NN6G 1JT8A 4ME3A 3UDGA 2JA6G 1ASYA 4JV5Q 4C2MH 1VQ4A 1QZGA 1L1OC 2PI2A 1G51A 4WJ4A 4DR1Q 5DLQE 2JQOA 2UXBL 2UUAL 4IPDA 3FHWA 4DPGA 1LUZA 1EWIA 1JJCB 3E0EA 1IYJB 1YI2A 3UDIA 2VUMH 4A3BH 1KQSA 1N32L 4JI1L 2VQFL 1BKBA 1GVPA 1SROA 4IOCA 3CF5A 4HJ8A 4X66L 4DR4L 2WAQE 5IP7G 4JV5L 1Y1WH 4IJHA 3EN2A 4PZ8A 3UDXA 1VCIA 4PG3A 1EQQA 2Q2UA 2F4VL 3L0OA 3I4NG 4A3GG 3K8AA 1BVSA 2CQOA 1IBLQ 2Z6KC 4L5QA 4PZ6A 3PUXA 3CCEA 1EYGA 4LFCL 3T1HQ 3GTGH 1X56A 3NELA 2IX1A 1C0AA 4JOIC 3ER0A 1VQEA 5GAGC 1JMCA 2E2IH 4EX5A 2MQHA 1CKMA 1R9TH 3G4SA 3PIOA 4DAMA 3J7ZC 2Y0SE 3F8TA 4UY8C 4AH6A 3KF6B 1A62A 4DR3L 1G291 3HOZH 3A5ZB 1QVFA 1IBLL 4LFAL 4DK3C 2I0QA 3G48A 2R92H 3CW2C 1KRTA 5JEAJ 1LM0A 3M4OH 4A3IH 3CC7A 1XPUA 4BXXH 2WAQG 1S3OA 1V1QA 1X55A 4OXPA 2JK8A 4ALPA 4A3EH 1Q7YC 4L5TA 4X64L 2ZJQA 2D0OA 4DV0Q 1PHJA 3TRZA 3D0FA 2VS1A 4OWXB 4OO1I 3Q8DA 4DAYB 1E24A 4APVA 2JJQA 4P71A 1OXTA 4QIWE 5IWAQ 3I2ZA 4NXMQ 4IFDJ 1V9PA 1N36L 3PUWA 3U50C 4A4IA 3HKSA 4GLAC 1RL2A 4MNOA 1WYDA 4JI6Q 1HR0W 2XTIA 1XNQL 3TS2A 3S2DH 4JG2A 2AHOB 3KJPA 4GKJQ 3NEMA 2Y0SG 4IPCA 4DV0L 1SRUA 1X54A 1I50H 2A19A 2CWPA 2RF4A 5ELNA 2ZJPA 3D31A 3GTKH 4BA2I 4PZ7A 3RZOH 3PCOB 1OXUA 5FJ8H 1JJ2A 2YV5A 4B3ML 4LF8Q 3RNUA 2EXDA 1UE6A 3I4MH 1EIYB 4YY3L 1VQCA 5IYBH 1I6HH 3GTJH 1E3PA 4B3RQ 2CKZB 1UE1A 2N8NA 4JI6L 4DR5Q 2VL6A 3M4PA 1FVIA 1VQMA 1K73C 1OXXK 4OO1G 1I3QH 3M85A 2AWOA 1K3RA 1RIPA 1EOVA 2JA8H 1YEZA 5GQOA 5IY0A 4B3TQ 3S17H 1PFSA 2KCTA 2RHQB 4R4QA 3S1QH 2EQSA 1VQ9A 4A3BG 2AKWB 4X62Q 1C9OA 1NMFA 4L5SA 1FJGQ 2NVQH 4WJ3M 3CC4A 3HOYG 4B3RL 1N9WA 1IBML 1Y1WG 4A3FG 4A93G 4DR5L 3DM3A 3TS0A 2R7ZH 4UP7A 3S1NH 2ZTCA 4TQUS 1YJNA 3CCJA 4DR2Q 2NVYH 2WB1E 2CFMA 2R7FA 2OCEA 5M3MH 4DV3Q 4DR6Q 4P73A 5AJ3Q 4X65L 4KLKA 1YHQA 1CKOA 1EQRA 2Q2TA 2MFIA 3PGZA 3JC66 1AE3A 5BR8Q 2UXDQ 3MXNB 1WOCA 5M5XH 5IYDG 2I5MX 2QGQA 4QGUA 3HOVG 5H1SE 4DR2L 1HZ9A 4LF4Q 4HJ9A 1VQHA 2R92G 3S14H 3GTPH 4DR6L 2YYZA 4DV3L 1YZ6A 4YWKA 4IJLA 1IZ6A 4GN3B 2UXCQ 3OYYA 2B3GA 4C3JH 2VQEQ 3HOZG 2ASBA 3ICEA 1VQ8A 3DLLA 4IFDI 4R4TA 1YHAA 5BR8L 2UUBQ 2VNUD 4DK6C 5IP9H 4GKKQ 1XMOL 4B3SQ 1HR0Q 1CSQA 1VQGA 2BA0A 1PH7A 4LF4L 4KHZA 4MTNA 4A3MG 3RLFA 3KDFA 4GLXA 3CD6A 3STBC 2UXCL 1O7IA 4DV7L
chains in the Genus database with same CATH superfamily
2IX3A 1VDZA 1NY4A 5TSSA 2K28A 3K59A 2Q8RE 3OHXC 5C6AA 3I55A 1F9SA 4A3DH 4GKKL 4X6AH 5I6WA 3CQZB 3CMAA 4C56C 3PMFA 3D4WA 3DM1A 1Q90A 2DNCA 2NVXB 1I5FA 3EVQA 5KIXA 1SE4A 1K8AC 2WP8J 3ULLA 5LMNW 2DN8A 3CCMA 1Z47A 4PQXA 5A2QL 4FDBA 4PMBA 2R93G 4JBKA 2UU9Q 4FO2A 5IT9L 1JCKB 2NWGA 4H7BA 1WTRA 2BA1A 1F9PA 4OGQC 4JVZA 1CHPD 3CCQA 1K8OA 3I7FA 2E2JB 3S9WA 5E1FA 2XRQD 2UU9L 4JI5Q 4Y7NH 2F0KA 5DAUA 2HDLA 1TIID 1S5CD 1YHBA 4LK1C 1JJGA 2YU9H 3I70A 4RMFA 2BH2A 2RA4A 1X3FA 5KRUA 4R4CA 2B63G 3KYHC 2K5NA 5M5YH 3BZCA 4NMZA 1DYQA 4BBSH 1Q1BA 5FLMH 2BE5D 1XTDA 1Z9FA 4JI5L 4NXML 3HOUH 5I4DA 4YWMA 2LY7A 1BXTA 4O2DA 1M1KC 1QUQA 1PRTF 2ZJRA 4QIWB 3CMEA 5JAVA 3D3RA 1N34Q 1IHZA 4GKJL 1VMPA 3NXWA 1NSNS 2GVAA 1O7ZA 3N6RA 1EEFD 4POFA 2VUMG 4R8IA 2HUGA 5CV5A 3MEHA 2NTSA 1TWHB 2VY3A 4HJ5A 3I90A 1LT5D 1STYA 2MJ8A 4FYDA 1S72A 1CI3M 2K14A 4BY1H 4BY7H 4AYBG 4B3TL 1WCMG 3CQZH 3KF6A 3ERQA 4OWWB 2CVRA 4A3CG 4X62L 1WTPA 5J22A 2NVXH 4EQ5A 2R6GA 1PRTD 1IL8A 3G71A 1GM5A 2TMPA 1LTRD 2QDBA 3F2BA 3PUYA 1XNRQ 1HNWQ 5K36G 3F2UA 4TVAB 1V43A 2A68C 1E1OA 2EIFA 3CPFA 1HQRD 2B2WC 5FOBB 1F2LA 1WTQA 1JC7A 3OMCA 4DUZQ 1Z6HA 3I8ZA 4FF2A 1SN8A 3CKIB 2WB1B 1XMQQ 1G6ZA 4MIUA 2I5HA 4L5RC 1XNRL 4CDCC 3H3VI 2RHSB 3FEWX 1MHWC 2C5CA 1F77A 5JVH3 3S15B 4DUYQ 1FR3A 3T13A 4DUZL 3SK8A 1S40A 2D9UA 4KY7A 2ZT9C 1E22A 4O1NA 3V05A 4XQQA 2RSOA 5D65A 5FJ8G 1HR0L 4JI1Q 2F0QA 3FKIG 1I3QB 3P1HA 1QB5D 4DUYL 1EZ6A 3S16B 1HPCA 3A54A 2LMCB 5C0XH 2FHTA 3M3YB 4LFCQ 2R93B 4ID6A 2VW9A 4RH6A 1FD7D 1QUQB 3IKJA 5J3BA 1RKNA 4HIDA 3CXCA 1PH8A 3NTKA 2NVYB 4GLVB 1GJXA 3GTQH 2JA7G 1Q86C 1KAWA 1ZYRD 5M3FG 1TWHH 3H0GH 2F0WA 4GOPA 1KLGD 4HIMA 3W1GA 2XGTA 4GNXA 2LXJA 1UAPA 2LXKA 4RCNA 3GV3A 2B63B 2VXWA 4ZAIA 1WFQA 2B8GA 5I2YA 4R8NA 3U4VA 3LWEA 5D3IB 2EYFA 1CQFA 3PIP3 3MVVA 4OL7A 4ZCKA 3IFTA 1XNQQ 2K75A 2RDHA 4NB3A 3I91A 4DV5L 2LS01 2OTLA 4X3TA 1EY6A 4YHHQ 2KHIA 1HRJA 1O80A 2PNRC 2C35B 1GKHA 3GO5A 5FO7B 3PV0A 4DV6Q 1XTCD 2VUMB 1J6QA 3CP0A 4PMWA 3WOFA 1P16A 3S15H 2PI2E 4A93B 1SYGA 4K6LA 2R3ZA 4YHHL 5IYCG 1DD2A 1BF4A 2F0JA 4AYBB 1A63A 1WCMB 2HT1A 1A2TA 3Q23A 4DV6L 2FMMA 4POGA 2VB2X 2K5VA 1YJWA 2OF1A 5IT9c 2UUCL 3ND9A 3S16H 1KHIA 1RDPD 1JE4A 4X65Q 1L1OA 3M3YH 2R93H 1KDCA 3Q0AA 4ZKCB 3R8BA 4E6IA 4KMUC 1RD9D 3T51B 2Z6BA 3MA2B 1B2TA 4PMCA 4ZYSA 2B2TC 3LGJA 5JJKA 1TS4A 4ZK9B 5I9OA 3NPPA 2Z6KA 3NBHB 5K5PA 1ZXTA 5C0XJ 1WJJA 4KJOA 3VR3A 4GOPB 4GNXB 4JBMA 2B63H 3A74A 4K2KA 3H6MA 2D0PA 2A5HA 3D4RA 4KY5A 1N33L 2UXBQ 1H9RA 1SNDA 1R4PB 1I6HB 2PQAB 3I56A 2F3VA 1N32Q 1PTOB 1DZ1A 2MHVA 5LL6S 2NN6G 4BS9A 4ME3A 1ASYA 3BDOA 3J80E 1PMRA 1DM0B 4P2CB 3S1QB 1G51A 1GUOA 4WJ4A 1JR0D 1QOHA 4DR1Q 1O7YA 5DLQE 2UXBL 2EJMA 2EYOA 2B39A 3K6OA 1YI2A 1BO0A 2VUMH 4A3BH 1N32L 2JXMB 1BKBA 1SROA 4IOCA 2JA7B 5DNFA 5M3FB 1JWSD 3VR5A 4PZ8A 3J7YW 3MWYW 4A93H 4QUFA 3DXJC 1JQYD 4L5QA 3PUXA 3CCEA 2AQ2B 2EJGC 4QB4A 1X56A 3NELA 2IX1A 4JOIC 4X3SA 1VQEA 1ICFB 3OSOA 2A74C 1D6EC 4DAMA 3S14B 4UY8C 1JORA 4FF3A 4AH6A 2EY2A 4KV6A 5ISRA 3JAME 1K3BC 1AEXA 2Z9HA 2I0QA 1CQVA 1SYFA 1LM0A 1DOKA 1U4LA 3J7AF 4L5TA 4X64L 3TRZA 4DV0Q 4APVA 1SSOA 2JJQA 4QIWE 3I2ZA 3PUWA 2MGSA 4GLAC 3BG3A 1SAPA 1RL2A 2A68D 4JI6Q 3LNNA 4NDXA 1ICWA 3QR8A 2AHOB 1S5DD 1V1PB 3NEMA 2Y0SG 4DV0L 1ILQA 1X54A 2ZJPA 4BA2I 1AP0A 4KHVA 2HQEA 1OXUA 1SNOA 2KHSA 5FJ8H 1JJ2A 2YV5A 1ESFA 2QILA 1I6HH 1EIYB 1VQCA 1V1OA 1BDOA 3DEOA 3KLSA 4JI6L 2NUCA 3S1MH 2C9OA 4DR5Q 3M4PA 4OO1G 3M85A 2B8FA 4OHJA 1RTOA 1RIPA 2JA8H 1YEZA 5GQOA 5IY0A 4HEDA 3S17H 1A6XA 3S1QH 2Z1CA 1VQ9A 5C4ZA 1FJGQ 4KKTA 4EQPA 1PFNA 3CC4A 1X3PA 2KEDA 1O7LA 4DK1A 3OWFA 3KF8A 3L3OC 4DR5L 4FXKC 4KD4A 4DAPA 2WB1E 5IGDA 2HCCA 1EYCA 2K33A 2K04A 1YHQA 1CKOA 1TR5A 3A56A 5HURA 3JC66 4CBVA 2EYPA 1AZQA 2UXDQ 2J0TD 4KJNA 3DWQA 4DF7A 1WOCA 4B9XA 4QGUA 2QGQA 3S14H 1VQHA 2PPBC 3GTPH 1XXGA 2UXCQ 3OIQA 2ASBA 4HN7A 3DLLA 4ZLTF 5CGKA 1PZJD 1XMOL 1AFPA 3EROA 2XRSD 4KY6A 3K5LA 2A69C 3HS0C 4RWSC 3S1RB 3I4LA 2PQEA 3CD6A 2UXCL 1JWMD 4KN7C 2DY8A 3ULPA 4C1NI 1LTID 3BVMA 1YIJA 4K0KL 1ILPA 1VQJA 1JOOA 1HNXQ 1MJEA 2ATWA 4TRDA 3HG9A 1UWVA 3D6CA 4NPSA 5JPMC 1LTTD 3I4MG 2WACA 4GN4B 1VQNA 1CZGA 3RLOA 2PO4A 3RLNA 4IFDG 1WTXA 1HUMA 1SJHD 2B2YC 5EBCA 1B7YB 1H9SB 1U5KA 1VQ5A 5DM73 2JEAI 1SJED 2V4DA 5KYIA 5C44H 2F0EA 5C4HA 3Q6SA 1XJVA 3A0JA 3T1HL 4LF6Q 5ELDA 2GA4B 3RD4A 5FLXL 1PH5A 5F2DA 5EJWA 1HCZA 2K6AA 2EY6A 3W3AA 1STAA 1HNZQ 1KTKA 1PDQA 4K5WA 4RGOS 4LF6L 2EYHA 3OTOQ 2Y0SB 1STBA 1JB7A 1D1IA 2ZM6Q 1PH2A 4JC0A 4F87A 4LF7Q 3AB9A 3KLWA 2AQ3B 4AYBE 5IWAL 2B2WA 4QJFA 3VR2A 1PVOA 4RKLA 2NYZD 3CCRA 3MXGA 2GVBA 3OTOL 5KYLA 3T1YQ 2JE6I 2ZTDA 2ZM6L 2NVTB 1E2WA 3L2PA 4DV1Q 1ENFA 2F3IA 3S1RH 1D5MC 4LF8L 2CH4A 4K5VA 1ONLA 4A3LG 5CC4A 3T1YL 1ZKOA 2K1BA 1KD1C 1CK1A 3WDNA 4ZUIA 4XXEA 4DV1L 3TDQA 3QG1A 1PYBA 2B2UC 1W6JA 2A6HC 1CT1D 3D4DA 2DUDA 2FMCA 1Y1VH 4LFBQ 4RGTA 2G5DA 1BCPB 1X6OA 2ID0A 2K50A 3E9IA 2EPBA 2Q8IB 1KXLA 3W1BA 1MIUA 3A8KE 2K03A 1IW7C 3PIPA 1J5EQ 5C4XG 1M90C 4HCSA 3AEVA 1GUSA 3NHHA 3FP9A 1ML0D 4YCVA 2WFWA 3TN2A 3RN2A 1SYDA 2NBFA 1HFGA 3NENA 1RCVD 2TSSA 2N88A 1CKNA 1U4MA 2FFKB 3CAMA 2IHEA 4X3KA 4C1NK 3CRLC 4JK1C 1S5FD 1AN8A 3LX0A 2QDLA 2E5LQ 1UE7A 3F2CA 3HOXG 4QUCA 3E9HA 4G7HC 4N8FA 2CH4W 5IYBG 5GADC 3Q22A 1SE2A 3HOWH 5CYUA 3AFPA 2F4VQ 2F0SA 1Q8IA 4BBRG 3GDEA 2O5IC 2E2HB 3KJOA 1Y14B 4IUQA 1YVCA 3VYRA 1GOZA 2E5LL 2NVTH 3M4QA 2YTVA 4ILWA 3ULJA 5JPNC 5LL6X 1IYVA 1NMGA 2R7ZG 5CBAE 4JI2Q 3MXNA 2Z4IA 3T53B 3H94A 5M3MG 1OO9B 4UHVA 5CV9A 2O5JC 3A7AB 2Q8TA 3K80C 1MSGA 4JYAQ 2XSCA 5M5XB 2CQAA 2PMZB 3P20A 4IUUA 2HQLA 3UI2A 3X3MA 4HMJA 1GXDC 4WFN3 1N36Q 4AQYQ 2BCOA 4JI2L 1PH9A 2WKCA 1HH2P 1NBWA 4C3JG 3DWAA 3TP6A 2CWAA 2KENA 5C0XI 1T5EA 3WWVA 1L0WA 2A8VA 1JWUD 1VQOA 3V96A 1Q81C 4B3MQ 4AQYL 3GD7A 2JA6H 1D2BA 4YY3Q 1R4QB 1EQTA 2MO0A 2O2LD 2F0LA 2RCNA 2KCCA 3VR6A 1E7ZA 1MSHA 1JE5A 1LLRD 1CKNB 5IP7H 1K8GA 4JI0Q 1AE2A 3GTGB 1NTGA 1N34L 4HCEA 2A69D 1NR2A 3AFQA 5A2QE 1QJOA 1EU3A 2K5QA 4P75A 4YIJA 2HHHQ 1YBYA 1GHKA 2E2HH 4WORA 3S24A 5IT9E 5FLXc 1KC8C 2RVLA 4FXGC 4JI0L 3E3XA 1LTLA 4ZUJA 4TSSA 4DAYA 3MFYA 5E7NA 4QCLA 3EBEA 4DGZA 1EFWA 3E6ZX 4A3JG 2HHHL 5C4XB 2KA7A 1DJRD 3EFXD 5D14A 2JA5G 1F2MA 5E4XA 1DXMA 2SEBD 2ZXRA 1HNWL 4J8QA 4FVMA 5HGTA 3U58A 2E2JH 3S2DB 1U4PA 4JOIA 1HZAA 3ITPA 5LHY1 4UP8A 3RN5A 5BN5A 1I50B 5T1GA 1LTBD 3RZOB 1EQVA 1VQKA 1XMQL 5KNDA 2K05A 3HOXB 4IUVA 4IUPA 5KNBA 2R7DA 4NP5A 5HY6A 1H95A 5CBEE 3GTJB 1GUWA 4EVOA 3OW7A 1UE5A 3PO3G 3HFZB 5DEHA 2QEXA 4C3HG 3NTIA 2JYOA 4G7OC 2EE1A 2NVQB 1C4QA 3FPUB 1EIGA 3FHWA 1EWIA 4XT1B 1KQSA 1XWEA 4JI1L 1GVPA 1KLUD 2R7ZB 3CF5A 3S1NB 4HJ8A 3EN2A 3UDXA 2Q2UA 5M3MB 3I4NG 2CQOA 1A15A 1EYGA 4LFCL 3GTGH 3BVGA 3K5OA 3K57A 1JMCA 2RBMA 2MQHA 1CKMA 5C3XA 1EEID 2PW5A 3J7ZC 2Y0SE 3F8TA 3NQTA 3KF6B 1A62A 3A5ZB 2KECA 3T4AC 5IGCA 4N9TA 4L8JA 4ZKBB 5J39A 4C3JB 5KNCA 1KRTA 1I4HA 1S3OA 1V1QA 4OXPA 1YNJC 1TU2B 2A6HD 1GUNA 1PHJA 2VS1A 4DAYB 2XWBB 4NW2A 3AMUA 2A6EC 4IFDJ 1V9PA 2D5DA 4TKOB 1HXYD 3K5MA 4M8AA 1B3AA 4U68A 1WYDA 2XTIA 1XNQL 3TS2A 3S2DH 4EQNA 3K0YA 3KJPA 4IPCA 1QCBD 2CWPA 1IW7D 1I50H 1B4OA 2RF4A 5ELNA 1PFMA 3RZOH 1BR9A 1A2UA 3SK5A 1KAAA 1UE6A 4CJ1B 1TY2A 5IYBH 4ABNA 3GTJH 1ZEQX 1UE1A 2N8NA 2PCFB 1K73C 1I3QH 1Z7TA 2AWOA 3BYYB 3O13A 4K8JA 2BOSA 3FDTA 4BWGB 4R4QA 2EQSA 2AKWB 1NMFA 3KLSX 1X3QA 3HRZC 2NVQH 4JPBW 4WJ3M 2E75C 4KD3A 4QMGA 1WTHA 4A3JB 1N9WA 1Y1WG 3DM3A 3TS0A 2R7ZH 3S1NH 1PZKD 1YJNA 5NUCA 3CCJA 2JA5B 2NVYH 1SYCA 5M3MH 1TY0A 5AJ3Q 4X65L 1KDAA 3MZ5A 2PZUA 1U4RA 3MXPA 1AW7A 1LV9A 1TKWB 1H9MA 2MP1A 3OIPA 5IYDG 2I5MX 3HOVG 3NWTA 1ENCA 4HJ9A 2R92G 1TVXA 2DNEA 1YZ6A 4YWKA 4IJLA 3OYYA 3VA7A 2B3GA 4C3JH 2VQEQ 3HOZG 3PO3B 3FKIB 1K83B 2ENBA 3K7AB 4C3HB 2VNUD 4ZQ3A 4ODGA 4B3SQ 4PV1C 1VQGA 3DMUA 4CHTB 1PH7A 1B9MA 4JW0A 4KHZA 4A3MG 1CM9A 1A3VA 3STBC 4M1UB 2VQEL 1M4VA 2DGYA 5J1ZA 3R3OA 2QW7A 1S5ED 5JEAG 1TS2A 3N52A 2EYJA 3M7GA 2JP1A 2KBNA 2F0PA 3ND8A 2CCZA 4JCVE 4RHSA 1QNUA 1FNWA 4DR1L 1GD7A 5I9PA 1WCMH 1V8QA 4DFAA 4A3CH 4R1JA 2PMZE 4CKEA 4AIMA 2X69A 3J81i 4HSPA 2AMCB 3RUZA 2KHJA 4MHEA 3SK6A 3OWEB 3TBIB 3C2PA 5C4JB 5K36H 1X32A 3CC2A 2XIWA 4XTCS 3K7UC 4A3JH 1L1OB 1G6PA 1SFOB 1YNNC 5EGTA 3BJUA 2JA5H 4RGMA 1VQ7A 1GUTA 1STHA 4X3UA 1PRTB 4RGNA 1RHPA 1GO3E 1I4QA 2XNAC 3TP8A 4LJZC 3G6JB 2HIXA 4XIGS 1NR4A 4K2LA 2F0NA 5ELCA 4CDFC 4JI4Q 1PH1A 4XYOA 3J81c 2QF7A 1NNXA 3DHQA 4DKAC 5JJLA 5IP9G 4A3KG 2RQXA 3FKIH 3PO3H 2ZTEA 4HR7B 3OW2A 4IN3A 1A3UA 2PW7A 1PTOH 4C3HH 2F0DA 5CMDA 2XN9C 5HGQA 1I94Q 1EY8A 4HJAA 2EY5A 2IHFA 3GV6A 1Q1EA 1Q46A 4K6DA 4LAAA 1L0YB 1EZ8A 1I4PA 4A3DG 3W5OA 2IPKD 1OXVA 3C3LA 1GUGA 4GOPC 1WTOA 2KOLA 4GNXC 2L5TA 1SE3A 2X6LA 3ERSX 4YCUA 2G9HD 3UE1A 2JA7H 4Y52H 3QO2A 1K0RA 3GTMB 5M3FH 1I94L 3GTLB 1YNXA 4LUZA 2PYKA 1KIXA 1EIHA 2WKDA 3R2IA 1VQLA 1FJGL 3EIVA 3HEJA 5CV4A 3F2DA 4G57A 3K81C 1PTOC 3CCUA 1D8LA 1BBWA 5KEEA 3HOVB 5BN3A 2NZHA 1F2ZA 2DJGC 1OTCA 2X6GA 1XPOA 2J4XA 4RHRA 2M2LA 1HZCA 2QKIC 1TS5A 3HOZB 4JI7Q 4A3IG 4Q5VA 5C4JH 4BXXG 3I4OA 2E76C 3S2HB 1LT4D 1LACA 1VQDA 1SNCA 4IALA 3CCVA 1EL0A 2OTJA 3VYUA 2NZ1D 1IBKQ 2UXDL 2JA9A 4A3MB 1SFOH 4DU9A 4QL5A 4CGYB 4KI0A 1IKMA 2E8GA 5GAHC 2HIVA 5DM63 3KOJA 3BU2A 4DK0A 3F1ZA 1N8RC 1CA5A 5ELOA 3K0XA 3NUCA 5FLMG 4DXGA 2I46A 1S4ZA 4N8X1 2Z4HA 5KGUA 1YNJD 2UUAQ 1IBKL 1KNAA 4YCWA 4UDUC 4NXNQ 3J80c 2A73B 5IYCH 2VQFQ 2A6ED 5IGBA 2FXQA 3NSWA 4X66Q 3HZXA 3JAMi 4DR4Q 2D62A 3ZJYC 3VA5A 1VQ6A 2R61A 4HJ7A 5ELBA 1HJPA 1HNXL 1X9NA 3EA6A 1Y8OB 3M9BA 2SDFA 4I65A 3URYA 3L7ZC 1VS0A 4NXNL 4LF9Q 4JI3Q 2IL8A 2Q2HA 5IE8A 2L11A 2YTYA 1PH3A 4G7ZC 2QEJC 1B1ZA 4DR3Q 4LFAQ 1QWYA 4BY1G 4BY7G 1L2FA 4GS3A 4QY7A 4LF9L 3GTMH 3D8GA 4MZ9A 4JI3L 1EY9A 1K28A 3KF8B 3GTLH 1EY5A 4IO9A 3SK4A 3JAMc 5FKAC 1NAPA 3A5UA 1ENAA 1K0SA 1FL0A 3G7LA 5IYDH 4V190 1T9HA 4CJ2C 1QZHA 3HOVH 3GP7A 4B9WA 1F9RA 3MHBA 1XPRA 1VQIA 1U9RA 4DAVA 4A3KB 1HNZL 4A75A 3S2HH 4I7AA 2SNMA 2O4XA 4OEMB 2NN6H 3HKZG 3J7A5 2K01A 1D1KA 2DJFC 5C5LA 2Z8LA 1KNEA 1ESRA 3H91A 4A3MH 4NKLA 2A1AA 1Y69U 1HTPA 1Q8KA 2HD3A 4UP9A 1E1TA 2VB3X 4OWTB 1K8MA 4LF7L 4ME5A 4GN5A 2RCFA 2RSNA 5JEAH 1U0LA 1YJ9A 3BZKA 2XVSA 4RCOA 1HTLD 2IJ0A 1FNUA 1IBMQ 4EQOA 1WI5A 1IXRA 5E3FA 5C0XG 3IFDA 1KRSA 3STBD 2RDFA 1SE8A 2K4KA 2RKSA 1S5BD 4P74A 5AFWA 3QJYA 3H09A 4L63B 3M4OB 2K5WA 4A3IB 3OMGA 4IUNA 4A76A 5FLXE 2EY1A 3OOCA 3V2TA 4B08A 1STGA 3H0GG 3QOLA 4HIKA 4XQJA 1EIFA 4F7XA 1B9NA 5L37A 4LFBL 3NE5B 4UAIA 2YU9B 3NP8A 2KCNA 4J15A 1PZID 1TT2A 1QNKA 5CV8A 1MKHA 1B44D 5A35A 3Q24A 2EYMA 2L55A 5FK9C 3G6EA 3SR1A 4CDEC 3NQIA 1FYCA 4GZYC 3AQQA 3PO2G 3VDYA 1Q12A 1X65A 1W2BA 1J5EL 1BNZA 4L6TB 4CKBA 4F88A 4XT3B 4DV7Q 3I4MB 1YNND 2L4NA 3TZDA 3SVMA 4RKBA 1HZBA 2G9DA 3BYTB 1MBYA 5I6YA 4A3KH 1KDBA 1PH6A 2WB1G 1G2SA 4JV5Q 3UDGA 1VQ4A 1QZGA 3C46A 4OO1H 1EWCA 2JQOA 2L12A 1LUZA 2F0HA 3E0EA 1IYJB 4K14A 4JV5L 4BY1B 1GHJA 4IJHA 2F4VL 4BY7B 4CJ0B 1LTAD 1LTGD 1VCIA 4PG3A 1RJTA 3E5SA 2EOTA 4A3GG 3K8AA 1BVSA 1PTOF 3R93A 3WOEA 4PZ6A 3NWSA 3A7LA 1C0AA 2WIIB 5GAGC 1VF5C 3EQLC 1I4RA 3G4SA 2BDNA 1F9QA 1Y8PB 1G291 4HSVA 1BBXC 1KABA 3G48A 2MUYA 5JEAJ 2NB0A 3SEBA 3M4OH 4A3IH 1XPUA 1J9OA 4BXXH 1FGBD 2WAQG 1VQ8A 1X55A 4K5XA 4ALPA 2JK8A 1Q7YC 4JYAL 2ZJQA 4WRDA 3HKZB 1E24A 1PTOD 3LWUA 4P71A 4NXMQ 2B2TA 3GQBA 4K8IA 1N36L 3FPPA 4A4IA 2EXZA 3MXUA 4GKJQ 1H9KA 2F3WA 2A19A 3D31A 4PZ7A 3C1EA 1BCPC 4H44C 1IKLA 4B3ML 3RMHA 2EYLA 2EXDA 3I4MH 4YY3L 3K5NA 2EJFC 1XX8A 1OXXK 4IFDH 3A8JE 3GTOB 2IWHA 5JJZA 4B3TQ 2KCTA 4A3BG 4X62Q 1C9OA 2F0FA 4L5SA 5G3LF 3DWPA 3GTQB 2E2DC 3HOYG 3DUZA 3H0GB 4A3FG 4A93G 4Q0FA 1MGSA 1TWAB 4UP7A 2ZTCA 1RODA 1B53A 3I72A 4KTAA 2R7FA 2OCEA 4DV3Q 4P73A 2K32A 4DN4M 3FRPB 2Q2TA 2MFIA 3TMEA 3PIO3 5EPLA 1JOKA 2CW0D 3PGZA 1I6VC 1AE3A 3MXNB 3SE0A 3MAQA 3PO2B 1G2TA 1UNSA 5M5XH 3QIAA 1HZ9A 4LF4Q 5CORA 4DV3L 1E2VA 1D5ZC 5G3LD 1IZ6A 4GN3B 1II3A 1QG7A 3KBGA 2I07B 4R4TA 2UUBQ 1SNQA 4DK6C 4BBRB 5JVG3 1HR0Q 1A3TA 1CSQA 3U9OA 2BA0A 4LF4L 2K7VA 3RLFA 4DA2A 2ZXOA 3KDFA 3J81L 4GLXA 4XQNA 3SXHA 1LTSD 4R4IA 2UUBL 1QVGA 1C7YA 4A3GB 4JBWA 1X3EA 1SR3A 4JI8Q 1RF2D 4A3LH 1SYBA 2Q2IA 3E0JA 5M9OA 2F0GA 5IIFA 2MO1A 1B3QA 2VZAA 1CFMA 2GN5A 3IL8A 4C3IG 1AH9A 2JA8G 4DXFA 1FNVA 1TWGB 3BVZA 4KK7A 3GTOH 1IL2A 4KHPQ 2N3SA 1E2ZA 4JI8L 2JN4A 1SXTA 4S3SA 2XWJB 2V1CC 5GROA 1TS3A 3I73A 2KQ3A 1DGSA 4DV2Q 2B29A 1LYLA 3SGIA 1DCZA 3TQYA 1WTVA 4V0BA 2WAQB 1A0IA 3T56B 3NBHA 1G8ZD 3M4YA 4QF4A 4FF1A 5LMUQ 3EJIA 4EGVA 1TWAH 2B2VC 5EAYA 4OIKA 5FO9B 4H02A 4KHPL 5C4XH 3CU7A 1DOLA 2K5HA 2H5XA 2N55A 2K5DA 4DV5Q 5C3EG 4DV2L 1HQMC 2PQAA 2NZOA 1K9MC 3RZDB 5C5MA 2PZTA 2F1MA 2EVBA 5LMUL 3PO2H 4DR7Q 2L15A 1PH4A 3SHLA 3RR5A 5CR3A 3HOXH 1TWCB 2KVMA 3J81E 2IX0A 1NUCA 1L0XB 4IZ8A 4DV4Q 4O0AA 4BBRH 4DR7L 1SBBB 4A3BB 1WD0A 1LABA 1WD1A 3J80L 4HIOA 4QQBX 4J6HA 2KUMA 2UUCQ 3TEHB 3H3VH 3X3NA 2RDGA 1B70B 3HOYB 2IY5B 5JJIA 4A3FB 3PF5A 2JEBI 3QOJA 1EY4A 1C8CA 3KDFB 3PSIA 1EFID 5IGEA 3TREA 4DV4L 3U4ZA 1ASZA 1TWFB 4A3GH 1BOSA 1EYAA 3PUZA 1EUJA 1EWHA 1CUKA 5LMNQ 1HHVA 3BZDB 1VQPA 4R4OA 5JOBA 4YWLA 4HAEA 2OEOA 2SNSA 2BH8A 1VQAA 1STEA 1MI2A 1TWGH 1PYWD 4R9WA 5C44G 2B2YA 2F0MA 1D7QA 2ALYB 1SMYC 3H3VC 4N9PA 5LMNL 2AUKA 5AJ3L 2HCIA 1B8AA 4IPGA 3TP5A 1H9JA 3JAML 4A3EG 1UEBA 1N33Q 3P7JA 3BDLA 1CSPA 4LWCA 1Q3LA 1V1PA 4KN4C 2N78A 4IOAA 3FMCA 3M7NA 1BCPF 3UDFA 1NJIC 1EY0A 3MTSA 3RZDH 3H15A 2M00A 2F0OA 1CA6A 2DY7A 4OELB 2PNHA 4OIJA 5IOCA 3I4NB 2AQ1B 1SLJA 1LT3D 4B3SL 3S1MB 2MPMA 2Z0SA 1DONA 1WTWA 1VQBA 3J81j 2EDGA 1QILA 4C3IB 2JA8B 1TWCH 3S17B 1TQOA 2LSSA 1LO5D 5I2XA 1XYIA 3A55A 4UPAA 1EOTA 1WVLA 2QA4A 1PV4A 4OONA 5D3DA 1D5XC 4CKCA 1EYDA 3DEPA 2H4OA 5E4WC 1BCPD 1E0BA 4ULLA 2I5LX 3D6WA 3ONAB 3HOYH 4RG1A 1QVCA 4A3FH 3J7AV 1BBUA 4Z9CB 2OQ0A 4LW1A 4XYQA 1I4GA 1PA6A 5M5WB 4OX9Q 3HKZE 1TWFH 3NK9A 4JBJA 1PYSB 2IT1A 2OQKA 4LUOA 2F0IA 4LUVA 5C3EB 1Y8NB 4RFBA 2QCPX 4X64Q 1Y1VG 3VR4A 4ZRZA 5FO8B 2OXPA 2JSOA 3IRBA 4DNRB 2B2UA 3GTPB 1PFBA 4LF5Q 2F0UA 3AU7A 3PUVA 1P8LA 4OX9L 2OWOA 5IODA 1YITA 4FXDA 1IYUA 2H1EA 1KL9A 3CPWA 2KCMA 4C2MB 1STNA 5ELEA 3MEFA 1K83H 4LF5L 4WJWA 3K7AH 5EBDA 3SDZA 1SMXA 4BA1I 1VQFA 4JI4L 1Y1WB 2ES2A 2AWNA 4MN3A 2F0TA 2LFNA 1H9SA 2IW3A 2WV6D 2YTXA 3I4NH 3HOWG 3TZUA 3AYHB 1MJCA 2F03A 2E2IB 1RTNA 5GAEC 2L1BA 1R9TB 1Q82C 4C3IH 1G91A 3BS1A 1A8VA 5C44B 3L9AX 5CV6A 3QWNA 3A8IE 2K52A 1JICA 2FINB 5EPJA 2R92B 1NCVA 3J80i 3B6YA 1UEAB 1X3GA 1W3SA 3PF4A 5IGFA 1EU4A 4A3EB 1CZWA 1TXYA 1BQQT 2N49A 4H13C 1SNPA 2ZXPA 2F52A 2NN6I 3CRKC 2P5ZX 2BE5C 4HTHA 4FP5D 2CHBD 5M5WH 2MNAA 3K58A 1PLFA 4KKUA 1EY7A 4O42A 3UE0A 3CCSA 3KFUA 5C3EH 4LNQA 2FJ2A 1UUPA 2AUJD 1XMOQ 4JI7L 1FGUA 3GTKB 4FNFA 4BBSG 1B50A 1OXSC 5EKKA 4K0KQ 3QB3A 3CCLA 1T5XD 4F8MA 3HOUG 4DNIA 1NE3A 4IPHA 5EKIA 4P72A 4J1MA 1JT8A 1QE6A 2JA6G 4C2MH 1HA5A 1O78A 3KK7A 1L1OC 2PI2A 1JOQA 2KJXA 4XDXA 2UUAL 3KLRA 4IPDA 5T1IA 3ZYYX 4DPGA 1JJCB 1PRTC 2CW0C 2L0CA 4LMQD 1HUNA 3UDIA 2VQFL 4DR4L 4X66L 2WAQE 5IP7G 1Y1WH 1EQQA 3NTHA 1VF7A 3L0OA 1IBLQ 1PXUA 2Z6KC 3T1HQ 1Y1VB 1MD2D 2WINB 3ER0A 3MFGA 1CHQD 2E2IH 4EX5A 1VMCA 4KKSA 1R9TH 1SDFA 3PIOA 2HDMA 4DR3L 1LT6D 1QVFA 4IQZA 1IBLL 4LFAL 3NBIA 2ICEC 4IURA 3T16A 4DK3C 2R92H 3CW2C 3U9SA 1J8IA 3CC7A 4A3EH 1AZPA 3HOZH 4G4KA 2ICIA 2D2CC 2D0OA 4OO1I 3D0FA 4OWXB 3OPOA 3Q8DA 4MTKA 1OXTA 5IWAQ 1DOMA 3CHBD 1JB3A 1I4XA 3U50C 5ELFA 3HKSA 4PNYA 1SMYD 4MNOA 1HR0W 3IAYA 2L9HA 1SEBD 4JG2A 3I3CA 1F2YA 4A3DB 3FVQA 1SYEA 1SRUA 5EPKA 3GTKH 2F4IA 3PCOB 3HOWB 1M8AA 4LF8Q 3RNUA 5CV7A 1E3PA 4B3RQ 2CKZB 5IGGA 1ZYRC 5COYA 2VL6A 1FVIA 1VQMA 3MC0B 3P75A 1K3RA 1EOVA 1ET9A 1PFSA 2BDOA 2RHQB 5EQ0A 3VYSA 1W6KA 2LKVA 2OT2A 1HA6A 3BDCA 4HMIA 4CDDC 4B3RL 4FF4A 1IBML 3HGBA 2NTTA 5C3WA 3C1FA 4TQUS 2J7ZA 4DR2Q 3KBXA 2CFMA 4DR6Q 3TP7A 4U673 4Y7NB 4DNTB 4KLKA 1BUVT 1EQRA 2EZVA 5BR8Q 5M5YB 1CTMA 3VYTA 2SOBA 4BBSB 2M9VA 4IUTA 5H1SE 4DR2L 2PZWA 2F0VA 3PQIA 5EKLA 4DR6L 2YYZA 5BN4A 4RA8A 3HOUB 3HP3A 1HFNA 4H0LC 3TSSA 1SNMA 3ICEA 4IFDI 4I7ZC 3R2TA 2JA6B 2E74C 1C48A 1YHAA 5BR8L 5IP9H 4GKKQ 3W2DA 2B2VA 2KEEA 4MTNA 4RAUC 1ET6A 3KUPA 1O7IA 4DV7L
chains in the Genus database with same CATH topology
2VQEL 1YIJA 3ULPA 1NY4A 4K0KL 2DGYA 1VQJA 1HNXQ 4R4IA 1MJEA 2UUBL 5JEAG 1QVGA 1C7YA 3I55A 2ATWA 4A3DH 4JBWA 4GKKL 4X6AH 1X3EA 1UWVA 1SR3A 4NPSA 4JI8Q 4A3LH 2KBNA 3I4MG 2Q2IA 1VQNA 4GN4B 3CMAA 4JCVE 2CCZA 4DR1L 3RLOA 2MO1A 1I5FA 3RLNA 2VZAA 2GN5A 1GD7A 4IFDG 1WCMH 1AH9A 2JA8G 1K8AC 4A3CH 2WP8J 4R1JA 1B7YB 3ULLA 5LMNW 2PMZE 3CCMA 1Z47A 1U5KA 1VQ5A 3GTOH 4FDBA 4AIMA 1IL2A 2JEAI 4KHPQ 2N3SA 4JI8L 5C44H 3J81i 4JBKA 2AMCB 2V1CC 2R93G 2UU9Q 2KHJA 5GROA 1DGSA 4DV2Q 2B29A 1LYLA 3SGIA 3TQYA 1XJVA 3CC2A 1A0IA 3A0JA 4XTCS 3T1HL 4LF6Q 3K7UC 2BA1A 4A3JH 1L1OB 1G6PA 5LMUQ 3CCQA 1TWAH 1PH5A 5EAYA 4H02A 3I7FA 4KHPL 5C4XH 3BJUA 2JA5H 1VQ7A 2K5HA 1HNZQ 2H5XA 2UU9L 4JI5Q 4Y7NH 1GO3E 1YHBA 5C3EG 4DV2L 4DV5Q 1JJGA 2PQAA 2YU9H 2NZOA 4RMFA 1K9MC 2BH2A 4LF6L 3OTOQ 1X3FA 2HIXA 4R4CA 2B63G 3KYHC 2K5NA 4XIGS 5M5YH 5LMUL 1JB7A 3BZCA 2ZM6Q 3PO2H 4DR7Q 4BBSH 1Q1BA 5FLMH 1D7QA 2L15A 1PH2A 4JI4Q 1PH4A 1PH1A 1XTDA 1Z9FA 4JC0A 3RR5A 3J81c 4LF7Q 4JI5L 3KLWA 4AYBE 5IWAL 4NXML 1PVOA 4QJFA 3HOUH 3HOXH 3S1MH 4YWMA 4DKAC 5JJLA 5IP9G 4A3KG 4O2DA 3FKIH 1M1KC 2ZTEA 3PO3H 3OW2A 1QUQA 2IX0A 3OTOL 2GVBA 3CCRA 3T1YQ 2ZJRA 2JE6I 2ZTDA 4DV4Q 4C3HH 3CMEA 4O0AA 4BBRH 2ZM6L 1N34Q 4DR7L 5HGQA 4GKJL 1I94Q 3L2PA 4HJAA 4DV1Q 2IHFA 4HIOA 4QQBX 2GVAA 2F3IA 2UUCQ 3S1RH 3TEHB 3H3VH 4POFA 2VUMG 1B70B 2IY5B 1Q1EA 1Q46A 4LF8L 5JJIA 3PF5A 4A3DG 2JEBI 3W5OA 1OXVA 4GOPC 3KDFB 4A3LG 3PSIA 4GNXC 2VY3A 4HJ5A 3TREA 3T1YL 4DV4L 1KD1C 3ERSX 4YCUA 3U4ZA 3UE1A 1ASZA 2JA7H 4A3GH 1S72A 4Y52H 3PUZA 1K0RA 2K14A 5M3FH 1EUJA 1I94L 5LMNQ 1CUKA 4AYBG 4DV1L 4BY1H 4B3TL 4BY7H 1WCMG 1YNXA 3CQZH 3KF6A 4LUZA 1VQPA 1KIXA 1PYBA 4OWWB 4A3CG 1VQLA 4X62L 4R4OA 1FJGL 3EIVA 4YWLA 2NVXH 3F2DA 4EQ5A 2R6GA 3K81C 3CCUA 2DUDA 1Y1VH 1D8LA 1BBWA 3G71A 4LFBQ 2BH8A 1VQAA 2NZHA 1TWGH 5C44G 1GM5A 3F2BA 1OTCA 3PUYA 1XNRQ 1HNWQ 1XPOA 5K36G 1X6OA 2ALYB 2ID0A 2K50A 1HZCA 1V43A 1E1OA 2EIFA 3CPFA 3E9IA 4TVAB 5LMNL 4JI7Q 1KXLA 3W1BA 1MIUA 5AJ3L 4A3IG 4IPGA 1B8AA 5C4JH 4DUZQ 4BXXG 3I4OA 4A3EG 1UEBA 1SN8A 1VQDA 3PIPA 1XMQQ 1J5EQ 3CCVA 1N33Q 5C4XG 2OTJA 2UXDL 1CSPA 1M90C 2I5HA 1IBKQ 2JA9A 3AEVA 4LWCA 1SFOH 4L5RC 1XNRL 3FP9A 2N78A 4IOAA 4YCVA 4QL5A 2RHSB 2WFWA 4KI0A 3RN2A 3H3VI 2E8GA 5GAHC 3NENA 4DUYQ 3M7NA 1CKNA 2HIVA 3KOJA 3BU2A 3CAMA 2IHEA 3UDFA 4DUZL 1S40A 1NJIC 3F1ZA 1N8RC 5ELOA 3RZDH 3K0XA 3H15A 1E22A 5FLMG 2UUAQ 2PNHA 1IBKL 2E5LQ 4YCWA 1UE7A 5FJ8G 1SLJA 4NXNQ 3F2CA 3J80c 3HOXG 1HR0L 4B3SL 5IYCH 2Z0SA 3E9HA 4JI1Q 2VQFQ 1VQBA 2FXQA 5IYBG 3FKIG 3J81j 4X66Q 3JAMi 4DR4Q 5GADC 2D62A 4DUYL 3ZJYC 3HOWH 3AFPA 2F4VQ 1VQ6A 1TWCH 2LSSA 4BBRG 3GDEA 4HJ7A 3KJOA 1Y14B 4UPAA 1HJPA 4LFCQ 1HNXL 1YVCA 2VW9A 2QA4A 1X9NA 1PV4A 4OONA 3M9BA 2E5LL 2NVTH 3M4QA 1QUQB 4LF9Q 3L7ZC 1VS0A 4NXNL 2YTVA 4JI3Q 2Q2HA 5IE8A 2YTYA 5J3BA 1PH3A 3ULJA 4HIDA 2I5LX 3CXCA 1PH8A 3HOYH 1NMGA 4RG1A 1QVCA 4A3FH 4GLVB 3GTQH 2R7ZG 2JA7G 4DR3Q 1Q86C 1KAWA 1BBUA 4LFAQ 2OQ0A 4JI2Q 5M3FG 1TWHH 3H0GH 4LW1A 4BY1G 1PA6A 4BY7G 4GOPA 5M3MG 3HKZE 3W1GA 2XGTA 4HIMA 1L2FA 1TWFH 4GS3A 4GNXA 4OX9Q 2LXJA 1PYSB 2IT1A 2OQKA 4JBJA 4LUOA 4LUVA 4QY7A 4LF9L 3GTMH 4MZ9A 3K80C 4JI3L 4JYAQ 3KF8B 3GTLH 4IO9A 2LXKA 4X64Q 1Y1VG 3JAMc 3IRBA 3A5UA 2HQLA 1FL0A 1WFQA 4LF5Q 4A93H 1N36Q 5IYDH 4AQYQ 4JI2L 1T9HA 1QZHA 1PH9A 3PUVA 3HOVH 1P8LA 3U4VA 1HH2P 4OX9L 2OWOA 1NBWA 1YITA 1XPRA 1XNQQ 1VQIA 2K75A 1KL9A 3CPWA 2KCMA 1HNZL 4A75A 2CWAA 4NB3A 2KENA 5C0XI 3S2HH 3WWVA 4DV5L 1L0WA 2A8VA 2OTLA 3MEFA 1VQOA 1K83H 4YHHQ 1Q81C 4B3MQ 4LF5L 2KHIA 3HKZG 3GD7A 4AQYL 2JA6H 3J7A5 2C35B 1GKHA 3GO5A 3K7AH 4YY3Q 4A3MH 2A1AA 3PV0A 2MO0A 4DV6Q 1SMXA 1Q8KA 4UP9A 1J6QA 2RCNA 4BA1I 1VQFA 1E1TA 3CP0A 4PMWA 4JI4L 4OWTB 1P16A 1E7ZA 4LF7L 3S15H 4GN5A 2PI2E 2ES2A 2AWNA 1JE5A 1U0LA 1YJ9A 1CKNB 4YHHL 5IYCG 5IP7H 1K8GA 3BZKA 4JI0Q 1AE2A 2YTXA 1A63A 1NTGA 3I4NH 1N34L 2HT1A 3HOWG 3AYHB 1MJCA 4DV6L 1IBMQ 3AFQA 4POGA 1WI5A 2K5VA 5GAEC 1IXRA 1YJWA 4P75A 5IT9c 5C0XG 1Q82C 4C3IH 1KRSA 1YBYA 3STBD 2HHHQ 2UUCL 1A8VA 1KHIA 3S16H 2E2HH 1SE8A 4X65Q 1L1OA 2K4KA 2K52A 3S24A 5FLXc 1KC8C 4P74A 3M3YH 2R93H 4JI0L 3J80i 3B6YA 1LTLA 1X3GA 1W3SA 4A76A 3PF4A 5E7NA 1TXYA 2N49A 3EBEA 1EFWA 4A3JG 2HHHL 2F52A 2NN6I 3H0GG 4HIKA 3LGJA 5JJKA 1EIFA 2JA5G 4LFBL 5M5WH 2MNAA 4J15A 4JYAL 2Z6KA 3NBHB 3UE0A 1HNWL 3U58A 5C0XJ 2E2JH 3CCSA 1WJJA 1MKHA 3KFUA 5C3EH 4LNQA 4GOPB 4JOIA 1XMOQ 1HZAA 4GNXB 4JBMA 4JI7L 4UP8A 3RN5A 3G6EA 1FGUA 2B63H 3A74A 2D0PA 3AQQA 3VDYA 1VQKA 3PO2G 4BBSG 1Q12A 1X65A 1W2BA 1XMQL 1J5EL 1N33L 2UXBQ 1OXSC 4DV7Q 2R7DA 2PQAB 1H95A 5HY6A 4K0KQ 3I56A 3CCLA 3HOUG 4DNIA 1NE3A 1N32Q 1HZBA 1UE5A 4IPHA 4P72A 3HFZB 2QEXA 4A3KH 1PH6A 3PO3G 2WB1G 2NN6G 1JT8A 4ME3A 3UDGA 2JA6G 1ASYA 4JV5Q 4C2MH 1VQ4A 1QZGA 1L1OC 2PI2A 1G51A 4WJ4A 4DR1Q 5DLQE 2JQOA 2UXBL 2UUAL 4IPDA 3FHWA 4DPGA 1LUZA 1EWIA 1JJCB 3E0EA 1IYJB 1YI2A 3UDIA 2VUMH 4A3BH 1KQSA 1N32L 4JI1L 2VQFL 1BKBA 1GVPA 1SROA 4IOCA 3CF5A 4HJ8A 4X66L 4DR4L 2WAQE 5IP7G 4JV5L 1Y1WH 4IJHA 3EN2A 4PZ8A 3UDXA 1VCIA 4PG3A 1EQQA 2Q2UA 2F4VL 3L0OA 3I4NG 4A3GG 3K8AA 1BVSA 2CQOA 1IBLQ 2Z6KC 4L5QA 4PZ6A 3PUXA 3CCEA 1EYGA 4LFCL 3T1HQ 3GTGH 1X56A 3NELA 2IX1A 1C0AA 4JOIC 3ER0A 1VQEA 5GAGC 1JMCA 2E2IH 4EX5A 2MQHA 1CKMA 1R9TH 3G4SA 3PIOA 4DAMA 3J7ZC 2Y0SE 3F8TA 4UY8C 4AH6A 3KF6B 1A62A 4DR3L 1G291 3HOZH 3A5ZB 1QVFA 1IBLL 4LFAL 4DK3C 2I0QA 3G48A 2R92H 3CW2C 1KRTA 5JEAJ 1LM0A 3M4OH 4A3IH 3CC7A 1XPUA 4BXXH 2WAQG 1S3OA 1V1QA 1X55A 4OXPA 2JK8A 4ALPA 4A3EH 1Q7YC 4L5TA 4X64L 2ZJQA 2D0OA 4DV0Q 1PHJA 3TRZA 3D0FA 2VS1A 4OWXB 4OO1I 3Q8DA 4DAYB 1E24A 4APVA 2JJQA 4P71A 1OXTA 4QIWE 5IWAQ 3I2ZA 4NXMQ 4IFDJ 1V9PA 1N36L 3PUWA 3U50C 4A4IA 3HKSA 4GLAC 1RL2A 4MNOA 1WYDA 4JI6Q 1HR0W 2XTIA 1XNQL 3TS2A 3S2DH 4JG2A 2AHOB 3KJPA 4GKJQ 3NEMA 2Y0SG 4IPCA 4DV0L 1SRUA 1X54A 1I50H 2A19A 2CWPA 2RF4A 5ELNA 2ZJPA 3D31A 3GTKH 4BA2I 4PZ7A 3RZOH 3PCOB 1OXUA 5FJ8H 1JJ2A 2YV5A 4B3ML 4LF8Q 3RNUA 2EXDA 1UE6A 3I4MH 1EIYB 4YY3L 1VQCA 5IYBH 1I6HH 3GTJH 1E3PA 4B3RQ 2CKZB 1UE1A 2N8NA 4JI6L 4DR5Q 2VL6A 3M4PA 1FVIA 1VQMA 1K73C 1OXXK 4OO1G 1I3QH 3M85A 2AWOA 1K3RA 1RIPA 1EOVA 2JA8H 1YEZA 5GQOA 5IY0A 4B3TQ 3S17H 1PFSA 2KCTA 2RHQB 4R4QA 3S1QH 2EQSA 1VQ9A 4A3BG 2AKWB 4X62Q 1C9OA 1NMFA 4L5SA 1FJGQ 2NVQH 4WJ3M 3CC4A 3HOYG 4B3RL 1N9WA 1IBML 1Y1WG 4A3FG 4A93G 4DR5L 3DM3A 3TS0A 2R7ZH 4UP7A 3S1NH 2ZTCA 4TQUS 1YJNA 3CCJA 4DR2Q 2NVYH 2WB1E 2CFMA 2R7FA 2OCEA 5M3MH 4DV3Q 4DR6Q 4P73A 5AJ3Q 4X65L 4KLKA 1YHQA 1CKOA 1EQRA 2Q2TA 2MFIA 3PGZA 3JC66 1AE3A 5BR8Q 2UXDQ 3MXNB 1WOCA 5M5XH 5IYDG 2I5MX 2QGQA 4QGUA 3HOVG 5H1SE 4DR2L 1HZ9A 4LF4Q 4HJ9A 1VQHA 2R92G 3S14H 3GTPH 4DR6L 2YYZA 4DV3L 1YZ6A 4YWKA 4IJLA 1IZ6A 4GN3B 2UXCQ 3OYYA 2B3GA 4C3JH 2VQEQ 3HOZG 2ASBA 3ICEA 1VQ8A 3DLLA 4IFDI 4R4TA 1YHAA 5BR8L 2UUBQ 2VNUD 4DK6C 5IP9H 4GKKQ 1XMOL 4B3SQ 1HR0Q 1CSQA 1VQGA 2BA0A 1PH7A 4LF4L 4KHZA 4MTNA 4A3MG 3RLFA 3KDFA 4GLXA 3CD6A 3STBC 2UXCL 1O7IA 4DV7L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE L;  1YIJ A;  3ULP A;  1NY4 A;  4K0K L;  2DGY A;  1VQJ A;  1HNX Q;  4R4I A;  1MJE A;  2UUB L;  5JEA G;  1QVG A;  1C7Y A;  3I55 A;  2ATW A;  4A3D H;  4JBW A;  4GKK L;  4X6A H;  1X3E A;  1UWV A;  1SR3 A;  4NPS A;  4JI8 Q;  4A3L H;  2KBN A;  3I4M G;  2Q2I A;  1VQN A;  4GN4 B;  3CMA A;  4JCV E;  2CCZ A;  4DR1 L;  3RLO A;  2MO1 A;  1I5F A;  3RLN A;  2VZA A;  2GN5 A;  1GD7 A;  4IFD G;  1WCM H;  1AH9 A;  2JA8 G;  1K8A C;  4A3C H;  2WP8 J;  4R1J A;  1B7Y B;  3ULL A;  5LMN W;  2PMZ E;  3CCM A;  1Z47 A;  1U5K A;  1VQ5 A;  3GTO H;  4FDB A;  4AIM A;  1IL2 A;  2JEA I;  4KHP Q;  2N3S A;  4JI8 L;  5C44 H;  3J81 i;  4JBK A;  2AMC B;  2V1C C;  2R93 G;  2UU9 Q;  2KHJ A;  5GRO A;  1DGS A;  4DV2 Q;  2B29 A;  1LYL A;  3SGI A;  3TQY A;  1XJV A;  3CC2 A;  1A0I A;  3A0J A;  4XTC S;  3T1H L;  4LF6 Q;  3K7U C;  2BA1 A;  4A3J H;  1L1O B;  1G6P A;  5LMU Q;  3CCQ A;  1TWA H;  1PH5 A;  5EAY A;  4H02 A;  3I7F A;  4KHP L;  5C4X H;  3BJU A;  2JA5 H;  1VQ7 A;  2K5H A;  1HNZ Q;  2H5X A;  2UU9 L;  4JI5 Q;  4Y7N H;  1GO3 E;  1YHB A;  5C3E G;  4DV2 L;  4DV5 Q;  1JJG A;  2PQA A;  2YU9 H;  2NZO A;  4RMF A;  1K9M C;  2BH2 A;  4LF6 L;  3OTO Q;  1X3F A;  2HIX A;  4R4C A;  2B63 G;  3KYH C;  2K5N A;  4XIG S;  5M5Y H;  5LMU L;  1JB7 A;  3BZC A;  2ZM6 Q;  3PO2 H;  4DR7 Q;  4BBS H;  1Q1B A;  5FLM H;  1D7Q A;  2L15 A;  1PH2 A;  4JI4 Q;  1PH4 A;  1PH1 A;  1XTD A;  1Z9F A;  4JC0 A;  3RR5 A;  3J81 c;  4LF7 Q;  4JI5 L;  3KLW A;  4AYB E;  5IWA L;  4NXM L;  1PVO A;  4QJF A;  3HOU H;  3HOX H;  3S1M H;  4YWM A;  4DKA C;  5JJL A;  5IP9 G;  4A3K G;  4O2D A;  3FKI H;  1M1K C;  2ZTE A;  3PO3 H;  3OW2 A;  1QUQ A;  2IX0 A;  3OTO L;  2GVB A;  3CCR A;  3T1Y Q;  2ZJR A;  2JE6 I;  2ZTD A;  4DV4 Q;  4C3H H;  3CME A;  4O0A A;  4BBR H;  2ZM6 L;  1N34 Q;  4DR7 L;  5HGQ A;  4GKJ L;  1I94 Q;  3L2P A;  4HJA A;  4DV1 Q;  2IHF A;  4HIO A;  4QQB X;  2GVA A;  2F3I A;  2UUC Q;  3S1R H;  3TEH B;  3H3V H;  4POF A;  2VUM G;  1B70 B;  2IY5 B;  1Q1E A;  1Q46 A;  4LF8 L;  5JJI A;  3PF5 A;  4A3D G;  2JEB I;  3W5O A;  1OXV A;  4GOP C;  3KDF B;  4A3L G;  3PSI A;  4GNX C;  2VY3 A;  4HJ5 A;  3TRE A;  3T1Y L;  4DV4 L;  1KD1 C;  3ERS X;  4YCU A;  3U4Z A;  3UE1 A;  1ASZ A;  2JA7 H;  4A3G H;  1S72 A;  4Y52 H;  3PUZ A;  1K0R A;  2K14 A;  5M3F H;  1EUJ A;  1I94 L;  5LMN Q;  1CUK A;  4AYB G;  4DV1 L;  4BY1 H;  4B3T L;  4BY7 H;  1WCM G;  1YNX A;  3CQZ H;  3KF6 A;  4LUZ A;  1VQP A;  1KIX A;  1PYB A;  4OWW B;  4A3C G;  1VQL A;  4X62 L;  4R4O A;  1FJG L;  3EIV A;  4YWL A;  2NVX H;  3F2D A;  4EQ5 A;  2R6G A;  3K81 C;  3CCU A;  2DUD A;  1Y1V H;  1D8L A;  1BBW A;  3G71 A;  4LFB Q;  2BH8 A;  1VQA A;  2NZH A;  1TWG H;  5C44 G;  1GM5 A;  3F2B A;  1OTC A;  3PUY A;  1XNR Q;  1HNW Q;  1XPO A;  5K36 G;  1X6O A;  2ALY B;  2ID0 A;  2K50 A;  1HZC A;  1V43 A;  1E1O A;  2EIF A;  3CPF A;  3E9I A;  4TVA B;  5LMN L;  4JI7 Q;  1KXL A;  3W1B A;  1MIU A;  5AJ3 L;  4A3I G;  4IPG A;  1B8A A;  5C4J H;  4DUZ Q;  4BXX G;  3I4O A;  4A3E G;  1UEB A;  1SN8 A;  1VQD A;  3PIP A;  1XMQ Q;  1J5E Q;  3CCV A;  1N33 Q;  5C4X G;  2OTJ A;  2UXD L;  1CSP A;  1M90 C;  2I5H A;  1IBK Q;  2JA9 A;  3AEV A;  4LWC A;  1SFO H;  4L5R C;  1XNR L;  3FP9 A;  2N78 A;  4IOA A;  4YCV A;  4QL5 A;  2RHS B;  2WFW A;  4KI0 A;  3RN2 A;  3H3V I;  2E8G A;  5GAH C;  3NEN A;  4DUY Q;  3M7N A;  1CKN A;  2HIV A;  3KOJ A;  3BU2 A;  3CAM A;  2IHE A;  3UDF A;  4DUZ L;  1S40 A;  1NJI C;  3F1Z A;  1N8R C;  5ELO A;  3RZD H;  3K0X A;  3H15 A;  1E22 A;  5FLM G;  2UUA Q;  2PNH A;  1IBK L;  2E5L Q;  4YCW A;  1UE7 A;  5FJ8 G;  1SLJ A;  4NXN Q;  3F2C A;  3J80 c;  3HOX G;  1HR0 L;  4B3S L;  5IYC H;  2Z0S A;  3E9H A;  4JI1 Q;  2VQF Q;  1VQB A;  2FXQ A;  5IYB G;  3FKI G;  3J81 j;  4X66 Q;  3JAM i;  4DR4 Q;  5GAD C;  2D62 A;  4DUY L;  3ZJY C;  3HOW H;  3AFP A;  2F4V Q;  1VQ6 A;  1TWC H;  2LSS A;  4BBR G;  3GDE A;  4HJ7 A;  3KJO A;  1Y14 B;  4UPA A;  1HJP A;  4LFC Q;  1HNX L;  1YVC A;  2VW9 A;  2QA4 A;  1X9N A;  1PV4 A;  4OON A;  3M9B A;  2E5L L;  2NVT H;  3M4Q A;  1QUQ B;  4LF9 Q;  3L7Z C;  1VS0 A;  4NXN L;  2YTV A;  4JI3 Q;  2Q2H A;  5IE8 A;  2YTY A;  5J3B A;  1PH3 A;  3ULJ A;  4HID A;  2I5L X;  3CXC A;  1PH8 A;  3HOY H;  1NMG A;  4RG1 A;  1QVC A;  4A3F H;  4GLV B;  3GTQ H;  2R7Z G;  2JA7 G;  4DR3 Q;  1Q86 C;  1KAW A;  1BBU A;  4LFA Q;  2OQ0 A;  4JI2 Q;  5M3F G;  1TWH H;  3H0G H;  4LW1 A;  4BY1 G;  1PA6 A;  4BY7 G;  4GOP A;  5M3M G;  3HKZ E;  3W1G A;  2XGT A;  4HIM A;  1L2F A;  1TWF H;  4GS3 A;  4GNX A;  4OX9 Q;  2LXJ A;  1PYS B;  2IT1 A;  2OQK A;  4JBJ A;  4LUO A;  4LUV A;  4QY7 A;  4LF9 L;  3GTM H;  4MZ9 A;  3K80 C;  4JI3 L;  4JYA Q;  3KF8 B;  3GTL H;  4IO9 A;  2LXK A;  4X64 Q;  1Y1V G;  3JAM c;  3IRB A;  3A5U A;  2HQL A;  1FL0 A;  1WFQ A;  4LF5 Q;  4A93 H;  1N36 Q;  5IYD H;  4AQY Q;  4JI2 L;  1T9H A;  1QZH A;  1PH9 A;  3PUV A;  3HOV H;  1P8L A;  3U4V A;  1HH2 P;  4OX9 L;  2OWO A;  1NBW A;  1YIT A;  1XPR A;  1XNQ Q;  1VQI A;  2K75 A;  1KL9 A;  3CPW A;  2KCM A;  1HNZ L;  4A75 A;  2CWA A;  4NB3 A;  2KEN A;  5C0X I;  3S2H H;  3WWV A;  4DV5 L;  1L0W A;  2A8V A;  2OTL A;  3MEF A;  1VQO A;  1K83 H;  4YHH Q;  1Q81 C;  4B3M Q;  4LF5 L;  2KHI A;  3HKZ G;  3GD7 A;  4AQY L;  2JA6 H;  3J7A 5;  2C35 B;  1GKH A;  3GO5 A;  3K7A H;  4YY3 Q;  4A3M H;  2A1A A;  3PV0 A;  2MO0 A;  4DV6 Q;  1SMX A;  1Q8K A;  4UP9 A;  1J6Q A;  2RCN A;  4BA1 I;  1VQF A;  1E1T A;  3CP0 A;  4PMW A;  4JI4 L;  4OWT B;  1P16 A;  1E7Z A;  4LF7 L;  3S15 H;  4GN5 A;  2PI2 E;  2ES2 A;  2AWN A;  1JE5 A;  1U0L A;  1YJ9 A;  1CKN B;  4YHH L;  5IYC G;  5IP7 H;  1K8G A;  3BZK A;  4JI0 Q;  1AE2 A;  2YTX A;  1A63 A;  1NTG A;  3I4N H;  1N34 L;  2HT1 A;  3HOW G;  3AYH B;  1MJC A;  4DV6 L;  1IBM Q;  3AFQ A;  4POG A;  1WI5 A;  2K5V A;  5GAE C;  1IXR A;  1YJW A;  4P75 A;  5IT9 c;  5C0X G;  1Q82 C;  4C3I H;  1KRS A;  1YBY A;  3STB D;  2HHH Q;  2UUC L;  1A8V A;  1KHI A;  3S16 H;  2E2H H;  1SE8 A;  4X65 Q;  1L1O A;  2K4K A;  2K52 A;  3S24 A;  5FLX c;  1KC8 C;  4P74 A;  3M3Y H;  2R93 H;  4JI0 L;  3J80 i;  3B6Y A;  1LTL A;  1X3G A;  1W3S A;  4A76 A;  3PF4 A;  5E7N A;  1TXY A;  2N49 A;  3EBE A;  1EFW A;  4A3J G;  2HHH L;  2F52 A;  2NN6 I;  3H0G G;  4HIK A;  3LGJ A;  5JJK A;  1EIF A;  2JA5 G;  4LFB L;  5M5W H;  2MNA A;  4J15 A;  4JYA L;  2Z6K A;  3NBH B;  3UE0 A;  1HNW L;  3U58 A;  5C0X J;  2E2J H;  3CCS A;  1WJJ A;  1MKH A;  3KFU A;  5C3E H;  4LNQ A;  4GOP B;  4JOI A;  1XMO Q;  1HZA A;  4GNX B;  4JBM A;  4JI7 L;  4UP8 A;  3RN5 A;  3G6E A;  1FGU A;  2B63 H;  3A74 A;  2D0P A;  3AQQ A;  3VDY A;  1VQK A;  3PO2 G;  4BBS G;  1Q12 A;  1X65 A;  1W2B A;  1XMQ L;  1J5E L;  1N33 L;  2UXB Q;  1OXS C;  4DV7 Q;  2R7D A;  2PQA B;  1H95 A;  5HY6 A;  4K0K Q;  3I56 A;  3CCL A;  3HOU G;  4DNI A;  1NE3 A;  1N32 Q;  1HZB A;  1UE5 A;  4IPH A;  4P72 A;  3HFZ B;  2QEX A;  4A3K H;  1PH6 A;  3PO3 G;  2WB1 G;  2NN6 G;  1JT8 A;  4ME3 A;  3UDG A;  2JA6 G;  1ASY A;  4JV5 Q;  4C2M H;  1VQ4 A;  1QZG A;  1L1O C;  2PI2 A;  1G51 A;  4WJ4 A;  4DR1 Q;  5DLQ E;  2JQO A;  2UXB L;  2UUA L;  4IPD A;  3FHW A;  4DPG A;  1LUZ A;  1EWI A;  1JJC B;  3E0E A;  1IYJ B;  1YI2 A;  3UDI A;  2VUM H;  4A3B H;  1KQS A;  1N32 L;  4JI1 L;  2VQF L;  1BKB A;  1GVP A;  1SRO A;  4IOC A;  3CF5 A;  4HJ8 A;  4X66 L;  4DR4 L;  2WAQ E;  5IP7 G;  4JV5 L;  1Y1W H;  4IJH A;  3EN2 A;  4PZ8 A;  3UDX A;  1VCI A;  4PG3 A;  1EQQ A;  2Q2U A;  2F4V L;  3L0O A;  3I4N G;  4A3G G;  3K8A A;  1BVS A;  2CQO A;  1IBL Q;  2Z6K C;  4L5Q A;  4PZ6 A;  3PUX A;  3CCE A;  1EYG A;  4LFC L;  3T1H Q;  3GTG H;  1X56 A;  3NEL A;  2IX1 A;  1C0A A;  4JOI C;  3ER0 A;  1VQE A;  5GAG C;  1JMC A;  2E2I H;  4EX5 A;  2MQH A;  1CKM A;  1R9T H;  3G4S A;  3PIO A;  4DAM A;  3J7Z C;  2Y0S E;  3F8T A;  4UY8 C;  4AH6 A;  3KF6 B;  1A62 A;  4DR3 L;  1G29 1;  3HOZ H;  3A5Z B;  1QVF A;  1IBL L;  4LFA L;  4DK3 C;  2I0Q A;  3G48 A;  2R92 H;  3CW2 C;  1KRT A;  5JEA J;  1LM0 A;  3M4O H;  4A3I H;  3CC7 A;  1XPU A;  4BXX H;  2WAQ G;  1S3O A;  1V1Q A;  1X55 A;  4OXP A;  2JK8 A;  4ALP A;  4A3E H;  1Q7Y C;  4L5T A;  4X64 L;  2ZJQ A;  2D0O A;  4DV0 Q;  1PHJ A;  3TRZ A;  3D0F A;  2VS1 A;  4OWX B;  4OO1 I;  3Q8D A;  4DAY B;  1E24 A;  4APV A;  2JJQ A;  4P71 A;  1OXT A;  4QIW E;  5IWA Q;  3I2Z A;  4NXM Q;  4IFD J;  1V9P A;  1N36 L;  3PUW A;  3U50 C;  4A4I A;  3HKS A;  4GLA C;  1RL2 A;  4MNO A;  1WYD A;  4JI6 Q;  1HR0 W;  2XTI A;  1XNQ L;  3TS2 A;  3S2D H;  4JG2 A;  2AHO B;  3KJP A;  4GKJ Q;  3NEM A;  2Y0S G;  4IPC A;  4DV0 L;  1SRU A;  1X54 A;  1I50 H;  2A19 A;  2CWP A;  2RF4 A;  5ELN A;  2ZJP A;  3D31 A;  3GTK H;  4BA2 I;  4PZ7 A;  3RZO H;  3PCO B;  1OXU A;  5FJ8 H;  1JJ2 A;  2YV5 A;  4B3M L;  4LF8 Q;  3RNU A;  2EXD A;  1UE6 A;  3I4M H;  1EIY B;  4YY3 L;  1VQC A;  5IYB H;  1I6H H;  3GTJ H;  1E3P A;  4B3R Q;  2CKZ B;  1UE1 A;  2N8N A;  4JI6 L;  4DR5 Q;  2VL6 A;  3M4P A;  1FVI A;  1VQM A;  1K73 C;  1OXX K;  4OO1 G;  1I3Q H;  3M85 A;  2AWO A;  1K3R A;  1RIP A;  1EOV A;  2JA8 H;  1YEZ A;  5GQO A;  5IY0 A;  4B3T Q;  3S17 H;  1PFS A;  2KCT A;  2RHQ B;  4R4Q A;  3S1Q H;  2EQS A;  1VQ9 A;  4A3B G;  2AKW B;  4X62 Q;  1C9O A;  1NMF A;  4L5S A;  1FJG Q;  2NVQ H;  4WJ3 M;  3CC4 A;  3HOY G;  4B3R L;  1N9W A;  1IBM L;  1Y1W G;  4A3F G;  4A93 G;  4DR5 L;  3DM3 A;  3TS0 A;  2R7Z H;  4UP7 A;  3S1N H;  2ZTC A;  4TQU S;  1YJN A;  3CCJ A;  4DR2 Q;  2NVY H;  2WB1 E;  2CFM A;  2R7F A;  2OCE A;  5M3M H;  4DV3 Q;  4DR6 Q;  4P73 A;  5AJ3 Q;  4X65 L;  4KLK A;  1YHQ A;  1CKO A;  1EQR A;  2Q2T A;  2MFI A;  3PGZ A;  3JC6 6;  1AE3 A;  5BR8 Q;  2UXD Q;  3MXN B;  1WOC A;  5M5X H;  5IYD G;  2I5M X;  2QGQ A;  4QGU A;  3HOV G;  5H1S E;  4DR2 L;  1HZ9 A;  4LF4 Q;  4HJ9 A;  1VQH A;  2R92 G;  3S14 H;  3GTP H;  4DR6 L;  2YYZ A;  4DV3 L;  1YZ6 A;  4YWK A;  4IJL A;  1IZ6 A;  4GN3 B;  2UXC Q;  3OYY A;  2B3G A;  4C3J H;  2VQE Q;  3HOZ G;  2ASB A;  3ICE A;  1VQ8 A;  3DLL A;  4IFD I;  4R4T A;  1YHA A;  5BR8 L;  2UUB Q;  2VNU D;  4DK6 C;  5IP9 H;  4GKK Q;  1XMO L;  4B3S Q;  1HR0 Q;  1CSQ A;  1VQG A;  2BA0 A;  1PH7 A;  4LF4 L;  4KHZ A;  4MTN A;  4A3M G;  3RLF A;  3KDF A;  4GLX A;  3CD6 A;  3STB C;  2UXC L;  1O7I A;  4DV7 L; 
#chains in the Genus database with same CATH topology
 2IX3 A;  1VDZ A;  1NY4 A;  5TSS A;  2K28 A;  3K59 A;  2Q8R E;  3OHX C;  5C6A A;  3I55 A;  1F9S A;  4A3D H;  4GKK L;  4X6A H;  5I6W A;  3CQZ B;  3CMA A;  4C56 C;  3PMF A;  3D4W A;  3DM1 A;  1Q90 A;  2DNC A;  2NVX B;  1I5F A;  3EVQ A;  5KIX A;  1SE4 A;  1K8A C;  2WP8 J;  3ULL A;  5LMN W;  2DN8 A;  3CCM A;  1Z47 A;  4PQX A;  5A2Q L;  4FDB A;  4PMB A;  2R93 G;  4JBK A;  2UU9 Q;  4FO2 A;  5IT9 L;  1JCK B;  2NWG A;  4H7B A;  1WTR A;  2BA1 A;  1F9P A;  4OGQ C;  4JVZ A;  1CHP D;  3CCQ A;  1K8O A;  3I7F A;  2E2J B;  3S9W A;  5E1F A;  2XRQ D;  2UU9 L;  4JI5 Q;  4Y7N H;  2F0K A;  5DAU A;  2HDL A;  1TII D;  1S5C D;  1YHB A;  4LK1 C;  1JJG A;  2YU9 H;  3I70 A;  4RMF A;  2BH2 A;  2RA4 A;  1X3F A;  5KRU A;  4R4C A;  2B63 G;  3KYH C;  2K5N A;  5M5Y H;  3BZC A;  4NMZ A;  1DYQ A;  4BBS H;  1Q1B A;  5FLM H;  2BE5 D;  1XTD A;  1Z9F A;  4JI5 L;  4NXM L;  3HOU H;  5I4D A;  4YWM A;  2LY7 A;  1BXT A;  4O2D A;  1M1K C;  1QUQ A;  1PRT F;  2ZJR A;  4QIW B;  3CME A;  5JAV A;  3D3R A;  1N34 Q;  1IHZ A;  4GKJ L;  1VMP A;  3NXW A;  1NSN S;  2GVA A;  1O7Z A;  3N6R A;  1EEF D;  4POF A;  2VUM G;  4R8I A;  2HUG A;  5CV5 A;  3MEH A;  2NTS A;  1TWH B;  2VY3 A;  4HJ5 A;  3I90 A;  1LT5 D;  1STY A;  2MJ8 A;  4FYD A;  1S72 A;  1CI3 M;  2K14 A;  4BY1 H;  4BY7 H;  4AYB G;  4B3T L;  1WCM G;  3CQZ H;  3KF6 A;  3ERQ A;  4OWW B;  2CVR A;  4A3C G;  4X62 L;  1WTP A;  5J22 A;  2NVX H;  4EQ5 A;  2R6G A;  1PRT D;  1IL8 A;  3G71 A;  1GM5 A;  2TMP A;  1LTR D;  2QDB A;  3F2B A;  3PUY A;  1XNR Q;  1HNW Q;  5K36 G;  3F2U A;  4TVA B;  1V43 A;  2A68 C;  1E1O A;  2EIF A;  3CPF A;  1HQR D;  2B2W C;  5FOB B;  1F2L A;  1WTQ A;  1JC7 A;  3OMC A;  4DUZ Q;  1Z6H A;  3I8Z A;  4FF2 A;  1SN8 A;  3CKI B;  2WB1 B;  1XMQ Q;  1G6Z A;  4MIU A;  2I5H A;  4L5R C;  1XNR L;  4CDC C;  3H3V I;  2RHS B;  3FEW X;  1MHW C;  2C5C A;  1F77 A;  5JVH 3;  3S15 B;  4DUY Q;  1FR3 A;  3T13 A;  4DUZ L;  3SK8 A;  1S40 A;  2D9U A;  4KY7 A;  2ZT9 C;  1E22 A;  4O1N A;  3V05 A;  4XQQ A;  2RSO A;  5D65 A;  5FJ8 G;  1HR0 L;  4JI1 Q;  2F0Q A;  3FKI G;  1I3Q B;  3P1H A;  1QB5 D;  4DUY L;  1EZ6 A;  3S16 B;  1HPC A;  3A54 A;  2LMC B;  5C0X H;  2FHT A;  3M3Y B;  4LFC Q;  2R93 B;  4ID6 A;  2VW9 A;  4RH6 A;  1FD7 D;  1QUQ B;  3IKJ A;  5J3B A;  1RKN A;  4HID A;  3CXC A;  1PH8 A;  3NTK A;  2NVY B;  4GLV B;  1GJX A;  3GTQ H;  2JA7 G;  1Q86 C;  1KAW A;  1ZYR D;  5M3F G;  1TWH H;  3H0G H;  2F0W A;  4GOP A;  1KLG D;  4HIM A;  3W1G A;  2XGT A;  4GNX A;  2LXJ A;  1UAP A;  2LXK A;  4RCN A;  3GV3 A;  2B63 B;  2VXW A;  4ZAI A;  1WFQ A;  2B8G A;  5I2Y A;  4R8N A;  3U4V A;  3LWE A;  5D3I B;  2EYF A;  1CQF A;  3PIP 3;  3MVV A;  4OL7 A;  4ZCK A;  3IFT A;  1XNQ Q;  2K75 A;  2RDH A;  4NB3 A;  3I91 A;  4DV5 L;  2LS0 1;  2OTL A;  4X3T A;  1EY6 A;  4YHH Q;  2KHI A;  1HRJ A;  1O80 A;  2PNR C;  2C35 B;  1GKH A;  3GO5 A;  5FO7 B;  3PV0 A;  4DV6 Q;  1XTC D;  2VUM B;  1J6Q A;  3CP0 A;  4PMW A;  3WOF A;  1P16 A;  3S15 H;  2PI2 E;  4A93 B;  1SYG A;  4K6L A;  2R3Z A;  4YHH L;  5IYC G;  1DD2 A;  1BF4 A;  2F0J A;  4AYB B;  1A63 A;  1WCM B;  2HT1 A;  1A2T A;  3Q23 A;  4DV6 L;  2FMM A;  4POG A;  2VB2 X;  2K5V A;  1YJW A;  2OF1 A;  5IT9 c;  2UUC L;  3ND9 A;  3S16 H;  1KHI A;  1RDP D;  1JE4 A;  4X65 Q;  1L1O A;  3M3Y H;  2R93 H;  1KDC A;  3Q0A A;  4ZKC B;  3R8B A;  4E6I A;  4KMU C;  1RD9 D;  3T51 B;  2Z6B A;  3MA2 B;  1B2T A;  4PMC A;  4ZYS A;  2B2T C;  3LGJ A;  5JJK A;  1TS4 A;  4ZK9 B;  5I9O A;  3NPP A;  2Z6K A;  3NBH B;  5K5P A;  1ZXT A;  5C0X J;  1WJJ A;  4KJO A;  3VR3 A;  4GOP B;  4GNX B;  4JBM A;  2B63 H;  3A74 A;  4K2K A;  3H6M A;  2D0P A;  2A5H A;  3D4R A;  4KY5 A;  1N33 L;  2UXB Q;  1H9R A;  1SND A;  1R4P B;  1I6H B;  2PQA B;  3I56 A;  2F3V A;  1N32 Q;  1PTO B;  1DZ1 A;  2MHV A;  5LL6 S;  2NN6 G;  4BS9 A;  4ME3 A;  1ASY A;  3BDO A;  3J80 E;  1PMR A;  1DM0 B;  4P2C B;  3S1Q B;  1G51 A;  1GUO A;  4WJ4 A;  1JR0 D;  1QOH A;  4DR1 Q;  1O7Y A;  5DLQ E;  2UXB L;  2EJM A;  2EYO A;  2B39 A;  3K6O A;  1YI2 A;  1BO0 A;  2VUM H;  4A3B H;  1N32 L;  2JXM B;  1BKB A;  1SRO A;  4IOC A;  2JA7 B;  5DNF A;  5M3F B;  1JWS D;  3VR5 A;  4PZ8 A;  3J7Y W;  3MWY W;  4A93 H;  4QUF A;  3DXJ C;  1JQY D;  4L5Q A;  3PUX A;  3CCE A;  2AQ2 B;  2EJG C;  4QB4 A;  1X56 A;  3NEL A;  2IX1 A;  4JOI C;  4X3S A;  1VQE A;  1ICF B;  3OSO A;  2A74 C;  1D6E C;  4DAM A;  3S14 B;  4UY8 C;  1JOR A;  4FF3 A;  4AH6 A;  2EY2 A;  4KV6 A;  5ISR A;  3JAM E;  1K3B C;  1AEX A;  2Z9H A;  2I0Q A;  1CQV A;  1SYF A;  1LM0 A;  1DOK A;  1U4L A;  3J7A F;  4L5T A;  4X64 L;  3TRZ A;  4DV0 Q;  4APV A;  1SSO A;  2JJQ A;  4QIW E;  3I2Z A;  3PUW A;  2MGS A;  4GLA C;  3BG3 A;  1SAP A;  1RL2 A;  2A68 D;  4JI6 Q;  3LNN A;  4NDX A;  1ICW A;  3QR8 A;  2AHO B;  1S5D D;  1V1P B;  3NEM A;  2Y0S G;  4DV0 L;  1ILQ A;  1X54 A;  2ZJP A;  4BA2 I;  1AP0 A;  4KHV A;  2HQE A;  1OXU A;  1SNO A;  2KHS A;  5FJ8 H;  1JJ2 A;  2YV5 A;  1ESF A;  2QIL A;  1I6H H;  1EIY B;  1VQC A;  1V1O A;  1BDO A;  3DEO A;  3KLS A;  4JI6 L;  2NUC A;  3S1M H;  2C9O A;  4DR5 Q;  3M4P A;  4OO1 G;  3M85 A;  2B8F A;  4OHJ A;  1RTO A;  1RIP A;  2JA8 H;  1YEZ A;  5GQO A;  5IY0 A;  4HED A;  3S17 H;  1A6X A;  3S1Q H;  2Z1C A;  1VQ9 A;  5C4Z A;  1FJG Q;  4KKT A;  4EQP A;  1PFN A;  3CC4 A;  1X3P A;  2KED A;  1O7L A;  4DK1 A;  3OWF A;  3KF8 A;  3L3O C;  4DR5 L;  4FXK C;  4KD4 A;  4DAP A;  2WB1 E;  5IGD A;  2HCC A;  1EYC A;  2K33 A;  2K04 A;  1YHQ A;  1CKO A;  1TR5 A;  3A56 A;  5HUR A;  3JC6 6;  4CBV A;  2EYP A;  1AZQ A;  2UXD Q;  2J0T D;  4KJN A;  3DWQ A;  4DF7 A;  1WOC A;  4B9X A;  4QGU A;  2QGQ A;  3S14 H;  1VQH A;  2PPB C;  3GTP H;  1XXG A;  2UXC Q;  3OIQ A;  2ASB A;  4HN7 A;  3DLL A;  4ZLT F;  5CGK A;  1PZJ D;  1XMO L;  1AFP A;  3ERO A;  2XRS D;  4KY6 A;  3K5L A;  2A69 C;  3HS0 C;  4RWS C;  3S1R B;  3I4L A;  2PQE A;  3CD6 A;  2UXC L;  1JWM D;  4KN7 C;  2DY8 A;  3ULP A;  4C1N I;  1LTI D;  3BVM A;  1YIJ A;  4K0K L;  1ILP A;  1VQJ A;  1JOO A;  1HNX Q;  1MJE A;  2ATW A;  4TRD A;  3HG9 A;  1UWV A;  3D6C A;  4NPS A;  5JPM C;  1LTT D;  3I4M G;  2WAC A;  4GN4 B;  1VQN A;  1CZG A;  3RLO A;  2PO4 A;  3RLN A;  4IFD G;  1WTX A;  1HUM A;  1SJH D;  2B2Y C;  5EBC A;  1B7Y B;  1H9S B;  1U5K A;  1VQ5 A;  5DM7 3;  2JEA I;  1SJE D;  2V4D A;  5KYI A;  5C44 H;  2F0E A;  5C4H A;  3Q6S A;  1XJV A;  3A0J A;  3T1H L;  4LF6 Q;  5ELD A;  2GA4 B;  3RD4 A;  5FLX L;  1PH5 A;  5F2D A;  5EJW A;  1HCZ A;  2K6A A;  2EY6 A;  3W3A A;  1STA A;  1HNZ Q;  1KTK A;  1PDQ A;  4K5W A;  4RGO S;  4LF6 L;  2EYH A;  3OTO Q;  2Y0S B;  1STB A;  1JB7 A;  1D1I A;  2ZM6 Q;  1PH2 A;  4JC0 A;  4F87 A;  4LF7 Q;  3AB9 A;  3KLW A;  2AQ3 B;  4AYB E;  5IWA L;  2B2W A;  4QJF A;  3VR2 A;  1PVO A;  4RKL A;  2NYZ D;  3CCR A;  3MXG A;  2GVB A;  3OTO L;  5KYL A;  3T1Y Q;  2JE6 I;  2ZTD A;  2ZM6 L;  2NVT B;  1E2W A;  3L2P A;  4DV1 Q;  1ENF A;  2F3I A;  3S1R H;  1D5M C;  4LF8 L;  2CH4 A;  4K5V A;  1ONL A;  4A3L G;  5CC4 A;  3T1Y L;  1ZKO A;  2K1B A;  1KD1 C;  1CK1 A;  3WDN A;  4ZUI A;  4XXE A;  4DV1 L;  3TDQ A;  3QG1 A;  1PYB A;  2B2U C;  1W6J A;  2A6H C;  1CT1 D;  3D4D A;  2DUD A;  2FMC A;  1Y1V H;  4LFB Q;  4RGT A;  2G5D A;  1BCP B;  1X6O A;  2ID0 A;  2K50 A;  3E9I A;  2EPB A;  2Q8I B;  1KXL A;  3W1B A;  1MIU A;  3A8K E;  2K03 A;  1IW7 C;  3PIP A;  1J5E Q;  5C4X G;  1M90 C;  4HCS A;  3AEV A;  1GUS A;  3NHH A;  3FP9 A;  1ML0 D;  4YCV A;  2WFW A;  3TN2 A;  3RN2 A;  1SYD A;  2NBF A;  1HFG A;  3NEN A;  1RCV D;  2TSS A;  2N88 A;  1CKN A;  1U4M A;  2FFK B;  3CAM A;  2IHE A;  4X3K A;  4C1N K;  3CRL C;  4JK1 C;  1S5F D;  1AN8 A;  3LX0 A;  2QDL A;  2E5L Q;  1UE7 A;  3F2C A;  3HOX G;  4QUC A;  3E9H A;  4G7H C;  4N8F A;  2CH4 W;  5IYB G;  5GAD C;  3Q22 A;  1SE2 A;  3HOW H;  5CYU A;  3AFP A;  2F4V Q;  2F0S A;  1Q8I A;  4BBR G;  3GDE A;  2O5I C;  2E2H B;  3KJO A;  1Y14 B;  4IUQ A;  1YVC A;  3VYR A;  1GOZ A;  2E5L L;  2NVT H;  3M4Q A;  2YTV A;  4ILW A;  3ULJ A;  5JPN C;  5LL6 X;  1IYV A;  1NMG A;  2R7Z G;  5CBA E;  4JI2 Q;  3MXN A;  2Z4I A;  3T53 B;  3H94 A;  5M3M G;  1OO9 B;  4UHV A;  5CV9 A;  2O5J C;  3A7A B;  2Q8T A;  3K80 C;  1MSG A;  4JYA Q;  2XSC A;  5M5X B;  2CQA A;  2PMZ B;  3P20 A;  4IUU A;  2HQL A;  3UI2 A;  3X3M A;  4HMJ A;  1GXD C;  4WFN 3;  1N36 Q;  4AQY Q;  2BCO A;  4JI2 L;  1PH9 A;  2WKC A;  1HH2 P;  1NBW A;  4C3J G;  3DWA A;  3TP6 A;  2CWA A;  2KEN A;  5C0X I;  1T5E A;  3WWV A;  1L0W A;  2A8V A;  1JWU D;  1VQO A;  3V96 A;  1Q81 C;  4B3M Q;  4AQY L;  3GD7 A;  2JA6 H;  1D2B A;  4YY3 Q;  1R4Q B;  1EQT A;  2MO0 A;  2O2L D;  2F0L A;  2RCN A;  2KCC A;  3VR6 A;  1E7Z A;  1MSH A;  1JE5 A;  1LLR D;  1CKN B;  5IP7 H;  1K8G A;  4JI0 Q;  1AE2 A;  3GTG B;  1NTG A;  1N34 L;  4HCE A;  2A69 D;  1NR2 A;  3AFQ A;  5A2Q E;  1QJO A;  1EU3 A;  2K5Q A;  4P75 A;  4YIJ A;  2HHH Q;  1YBY A;  1GHK A;  2E2H H;  4WOR A;  3S24 A;  5IT9 E;  5FLX c;  1KC8 C;  2RVL A;  4FXG C;  4JI0 L;  3E3X A;  1LTL A;  4ZUJ A;  4TSS A;  4DAY A;  3MFY A;  5E7N A;  4QCL A;  3EBE A;  4DGZ A;  1EFW A;  3E6Z X;  4A3J G;  2HHH L;  5C4X B;  2KA7 A;  1DJR D;  3EFX D;  5D14 A;  2JA5 G;  1F2M A;  5E4X A;  1DXM A;  2SEB D;  2ZXR A;  1HNW L;  4J8Q A;  4FVM A;  5HGT A;  3U58 A;  2E2J H;  3S2D B;  1U4P A;  4JOI A;  1HZA A;  3ITP A;  5LHY 1;  4UP8 A;  3RN5 A;  5BN5 A;  1I50 B;  5T1G A;  1LTB D;  3RZO B;  1EQV A;  1VQK A;  1XMQ L;  5KND A;  2K05 A;  3HOX B;  4IUV A;  4IUP A;  5KNB A;  2R7D A;  4NP5 A;  5HY6 A;  1H95 A;  5CBE E;  3GTJ B;  1GUW A;  4EVO A;  3OW7 A;  1UE5 A;  3PO3 G;  3HFZ B;  5DEH A;  2QEX A;  4C3H G;  3NTI A;  2JYO A;  4G7O C;  2EE1 A;  2NVQ B;  1C4Q A;  3FPU B;  1EIG A;  3FHW A;  1EWI A;  4XT1 B;  1KQS A;  1XWE A;  4JI1 L;  1GVP A;  1KLU D;  2R7Z B;  3CF5 A;  3S1N B;  4HJ8 A;  3EN2 A;  3UDX A;  2Q2U A;  5M3M B;  3I4N G;  2CQO A;  1A15 A;  1EYG A;  4LFC L;  3GTG H;  3BVG A;  3K5O A;  3K57 A;  1JMC A;  2RBM A;  2MQH A;  1CKM A;  5C3X A;  1EEI D;  2PW5 A;  3J7Z C;  2Y0S E;  3F8T A;  3NQT A;  3KF6 B;  1A62 A;  3A5Z B;  2KEC A;  3T4A C;  5IGC A;  4N9T A;  4L8J A;  4ZKB B;  5J39 A;  4C3J B;  5KNC A;  1KRT A;  1I4H A;  1S3O A;  1V1Q A;  4OXP A;  1YNJ C;  1TU2 B;  2A6H D;  1GUN A;  1PHJ A;  2VS1 A;  4DAY B;  2XWB B;  4NW2 A;  3AMU A;  2A6E C;  4IFD J;  1V9P A;  2D5D A;  4TKO B;  1HXY D;  3K5M A;  4M8A A;  1B3A A;  4U68 A;  1WYD A;  2XTI A;  1XNQ L;  3TS2 A;  3S2D H;  4EQN A;  3K0Y A;  3KJP A;  4IPC A;  1QCB D;  2CWP A;  1IW7 D;  1I50 H;  1B4O A;  2RF4 A;  5ELN A;  1PFM A;  3RZO H;  1BR9 A;  1A2U A;  3SK5 A;  1KAA A;  1UE6 A;  4CJ1 B;  1TY2 A;  5IYB H;  4ABN A;  3GTJ H;  1ZEQ X;  1UE1 A;  2N8N A;  2PCF B;  1K73 C;  1I3Q H;  1Z7T A;  2AWO A;  3BYY B;  3O13 A;  4K8J A;  2BOS A;  3FDT A;  4BWG B;  4R4Q A;  2EQS A;  2AKW B;  1NMF A;  3KLS X;  1X3Q A;  3HRZ C;  2NVQ H;  4JPB W;  4WJ3 M;  2E75 C;  4KD3 A;  4QMG A;  1WTH A;  4A3J B;  1N9W A;  1Y1W G;  3DM3 A;  3TS0 A;  2R7Z H;  3S1N H;  1PZK D;  1YJN A;  5NUC A;  3CCJ A;  2JA5 B;  2NVY H;  1SYC A;  5M3M H;  1TY0 A;  5AJ3 Q;  4X65 L;  1KDA A;  3MZ5 A;  2PZU A;  1U4R A;  3MXP A;  1AW7 A;  1LV9 A;  1TKW B;  1H9M A;  2MP1 A;  3OIP A;  5IYD G;  2I5M X;  3HOV G;  3NWT A;  1ENC A;  4HJ9 A;  2R92 G;  1TVX A;  2DNE A;  1YZ6 A;  4YWK A;  4IJL A;  3OYY A;  3VA7 A;  2B3G A;  4C3J H;  2VQE Q;  3HOZ G;  3PO3 B;  3FKI B;  1K83 B;  2ENB A;  3K7A B;  4C3H B;  2VNU D;  4ZQ3 A;  4ODG A;  4B3S Q;  4PV1 C;  1VQG A;  3DMU A;  4CHT B;  1PH7 A;  1B9M A;  4JW0 A;  4KHZ A;  4A3M G;  1CM9 A;  1A3V A;  3STB C;  4M1U B;  2VQE L;  1M4V A;  2DGY A;  5J1Z A;  3R3O A;  2QW7 A;  1S5E D;  5JEA G;  1TS2 A;  3N52 A;  2EYJ A;  3M7G A;  2JP1 A;  2KBN A;  2F0P A;  3ND8 A;  2CCZ A;  4JCV E;  4RHS A;  1QNU A;  1FNW A;  4DR1 L;  1GD7 A;  5I9P A;  1WCM H;  1V8Q A;  4DFA A;  4A3C H;  4R1J A;  2PMZ E;  4CKE A;  4AIM A;  2X69 A;  3J81 i;  4HSP A;  2AMC B;  3RUZ A;  2KHJ A;  4MHE A;  3SK6 A;  3OWE B;  3TBI B;  3C2P A;  5C4J B;  5K36 H;  1X32 A;  3CC2 A;  2XIW A;  4XTC S;  3K7U C;  4A3J H;  1L1O B;  1G6P A;  1SFO B;  1YNN C;  5EGT A;  3BJU A;  2JA5 H;  4RGM A;  1VQ7 A;  1GUT A;  1STH A;  4X3U A;  1PRT B;  4RGN A;  1RHP A;  1GO3 E;  1I4Q A;  2XNA C;  3TP8 A;  4LJZ C;  3G6J B;  2HIX A;  4XIG S;  1NR4 A;  4K2L A;  2F0N A;  5ELC A;  4CDF C;  4JI4 Q;  1PH1 A;  4XYO A;  3J81 c;  2QF7 A;  1NNX A;  3DHQ A;  4DKA C;  5JJL A;  5IP9 G;  4A3K G;  2RQX A;  3FKI H;  3PO3 H;  2ZTE A;  4HR7 B;  3OW2 A;  4IN3 A;  1A3U A;  2PW7 A;  1PTO H;  4C3H H;  2F0D A;  5CMD A;  2XN9 C;  5HGQ A;  1I94 Q;  1EY8 A;  4HJA A;  2EY5 A;  2IHF A;  3GV6 A;  1Q1E A;  1Q46 A;  4K6D A;  4LAA A;  1L0Y B;  1EZ8 A;  1I4P A;  4A3D G;  3W5O A;  2IPK D;  1OXV A;  3C3L A;  1GUG A;  4GOP C;  1WTO A;  2KOL A;  4GNX C;  2L5T A;  1SE3 A;  2X6L A;  3ERS X;  4YCU A;  2G9H D;  3UE1 A;  2JA7 H;  4Y52 H;  3QO2 A;  1K0R A;  3GTM B;  5M3F H;  1I94 L;  3GTL B;  1YNX A;  4LUZ A;  2PYK A;  1KIX A;  1EIH A;  2WKD A;  3R2I A;  1VQL A;  1FJG L;  3EIV A;  3HEJ A;  5CV4 A;  3F2D A;  4G57 A;  3K81 C;  1PTO C;  3CCU A;  1D8L A;  1BBW A;  5KEE A;  3HOV B;  5BN3 A;  2NZH A;  1F2Z A;  2DJG C;  1OTC A;  2X6G A;  1XPO A;  2J4X A;  4RHR A;  2M2L A;  1HZC A;  2QKI C;  1TS5 A;  3HOZ B;  4JI7 Q;  4A3I G;  4Q5V A;  5C4J H;  4BXX G;  3I4O A;  2E76 C;  3S2H B;  1LT4 D;  1LAC A;  1VQD A;  1SNC A;  4IAL A;  3CCV A;  1EL0 A;  2OTJ A;  3VYU A;  2NZ1 D;  1IBK Q;  2UXD L;  2JA9 A;  4A3M B;  1SFO H;  4DU9 A;  4QL5 A;  4CGY B;  4KI0 A;  1IKM A;  2E8G A;  5GAH C;  2HIV A;  5DM6 3;  3KOJ A;  3BU2 A;  4DK0 A;  3F1Z A;  1N8R C;  1CA5 A;  5ELO A;  3K0X A;  3NUC A;  5FLM G;  4DXG A;  2I46 A;  1S4Z A;  4N8X 1;  2Z4H A;  5KGU A;  1YNJ D;  2UUA Q;  1IBK L;  1KNA A;  4YCW A;  4UDU C;  4NXN Q;  3J80 c;  2A73 B;  5IYC H;  2VQF Q;  2A6E D;  5IGB A;  2FXQ A;  3NSW A;  4X66 Q;  3HZX A;  3JAM i;  4DR4 Q;  2D62 A;  3ZJY C;  3VA5 A;  1VQ6 A;  2R61 A;  4HJ7 A;  5ELB A;  1HJP A;  1HNX L;  1X9N A;  3EA6 A;  1Y8O B;  3M9B A;  2SDF A;  4I65 A;  3URY A;  3L7Z C;  1VS0 A;  4NXN L;  4LF9 Q;  4JI3 Q;  2IL8 A;  2Q2H A;  5IE8 A;  2L11 A;  2YTY A;  1PH3 A;  4G7Z C;  2QEJ C;  1B1Z A;  4DR3 Q;  4LFA Q;  1QWY A;  4BY1 G;  4BY7 G;  1L2F A;  4GS3 A;  4QY7 A;  4LF9 L;  3GTM H;  3D8G A;  4MZ9 A;  4JI3 L;  1EY9 A;  1K28 A;  3KF8 B;  3GTL H;  1EY5 A;  4IO9 A;  3SK4 A;  3JAM c;  5FKA C;  1NAP A;  3A5U A;  1ENA A;  1K0S A;  1FL0 A;  3G7L A;  5IYD H;  4V19 0;  1T9H A;  4CJ2 C;  1QZH A;  3HOV H;  3GP7 A;  4B9W A;  1F9R A;  3MHB A;  1XPR A;  1VQI A;  1U9R A;  4DAV A;  4A3K B;  1HNZ L;  4A75 A;  3S2H H;  4I7A A;  2SNM A;  2O4X A;  4OEM B;  2NN6 H;  3HKZ G;  3J7A 5;  2K01 A;  1D1K A;  2DJF C;  5C5L A;  2Z8L A;  1KNE A;  1ESR A;  3H91 A;  4A3M H;  4NKL A;  2A1A A;  1Y69 U;  1HTP A;  1Q8K A;  2HD3 A;  4UP9 A;  1E1T A;  2VB3 X;  4OWT B;  1K8M A;  4LF7 L;  4ME5 A;  4GN5 A;  2RCF A;  2RSN A;  5JEA H;  1U0L A;  1YJ9 A;  3BZK A;  2XVS A;  4RCO A;  1HTL D;  2IJ0 A;  1FNU A;  1IBM Q;  4EQO A;  1WI5 A;  1IXR A;  5E3F A;  5C0X G;  3IFD A;  1KRS A;  3STB D;  2RDF A;  1SE8 A;  2K4K A;  2RKS A;  1S5B D;  4P74 A;  5AFW A;  3QJY A;  3H09 A;  4L63 B;  3M4O B;  2K5W A;  4A3I B;  3OMG A;  4IUN A;  4A76 A;  5FLX E;  2EY1 A;  3OOC A;  3V2T A;  4B08 A;  1STG A;  3H0G G;  3QOL A;  4HIK A;  4XQJ A;  1EIF A;  4F7X A;  1B9N A;  5L37 A;  4LFB L;  3NE5 B;  4UAI A;  2YU9 B;  3NP8 A;  2KCN A;  4J15 A;  1PZI D;  1TT2 A;  1QNK A;  5CV8 A;  1MKH A;  1B44 D;  5A35 A;  3Q24 A;  2EYM A;  2L55 A;  5FK9 C;  3G6E A;  3SR1 A;  4CDE C;  3NQI A;  1FYC A;  4GZY C;  3AQQ A;  3PO2 G;  3VDY A;  1Q12 A;  1X65 A;  1W2B A;  1J5E L;  1BNZ A;  4L6T B;  4CKB A;  4F88 A;  4XT3 B;  4DV7 Q;  3I4M B;  1YNN D;  2L4N A;  3TZD A;  3SVM A;  4RKB A;  1HZB A;  2G9D A;  3BYT B;  1MBY A;  5I6Y A;  4A3K H;  1KDB A;  1PH6 A;  2WB1 G;  1G2S A;  4JV5 Q;  3UDG A;  1VQ4 A;  1QZG A;  3C46 A;  4OO1 H;  1EWC A;  2JQO A;  2L12 A;  1LUZ A;  2F0H A;  3E0E A;  1IYJ B;  4K14 A;  4JV5 L;  4BY1 B;  1GHJ A;  4IJH A;  2F4V L;  4BY7 B;  4CJ0 B;  1LTA D;  1LTG D;  1VCI A;  4PG3 A;  1RJT A;  3E5S A;  2EOT A;  4A3G G;  3K8A A;  1BVS A;  1PTO F;  3R93 A;  3WOE A;  4PZ6 A;  3NWS A;  3A7L A;  1C0A A;  2WII B;  5GAG C;  1VF5 C;  3EQL C;  1I4R A;  3G4S A;  2BDN A;  1F9Q A;  1Y8P B;  1G29 1;  4HSV A;  1BBX C;  1KAB A;  3G48 A;  2MUY A;  5JEA J;  2NB0 A;  3SEB A;  3M4O H;  4A3I H;  1XPU A;  1J9O A;  4BXX H;  1FGB D;  2WAQ G;  1VQ8 A;  1X55 A;  4K5X A;  4ALP A;  2JK8 A;  1Q7Y C;  4JYA L;  2ZJQ A;  4WRD A;  3HKZ B;  1E24 A;  1PTO D;  3LWU A;  4P71 A;  4NXM Q;  2B2T A;  3GQB A;  4K8I A;  1N36 L;  3FPP A;  4A4I A;  2EXZ A;  3MXU A;  4GKJ Q;  1H9K A;  2F3W A;  2A19 A;  3D31 A;  4PZ7 A;  3C1E A;  1BCP C;  4H44 C;  1IKL A;  4B3M L;  3RMH A;  2EYL A;  2EXD A;  3I4M H;  4YY3 L;  3K5N A;  2EJF C;  1XX8 A;  1OXX K;  4IFD H;  3A8J E;  3GTO B;  2IWH A;  5JJZ A;  4B3T Q;  2KCT A;  4A3B G;  4X62 Q;  1C9O A;  2F0F A;  4L5S A;  5G3L F;  3DWP A;  3GTQ B;  2E2D C;  3HOY G;  3DUZ A;  3H0G B;  4A3F G;  4A93 G;  4Q0F A;  1MGS A;  1TWA B;  4UP7 A;  2ZTC A;  1ROD A;  1B53 A;  3I72 A;  4KTA A;  2R7F A;  2OCE A;  4DV3 Q;  4P73 A;  2K32 A;  4DN4 M;  3FRP B;  2Q2T A;  2MFI A;  3TME A;  3PIO 3;  5EPL A;  1JOK A;  2CW0 D;  3PGZ A;  1I6V C;  1AE3 A;  3MXN B;  3SE0 A;  3MAQ A;  3PO2 B;  1G2T A;  1UNS A;  5M5X H;  3QIA A;  1HZ9 A;  4LF4 Q;  5COR A;  4DV3 L;  1E2V A;  1D5Z C;  5G3L D;  1IZ6 A;  4GN3 B;  1II3 A;  1QG7 A;  3KBG A;  2I07 B;  4R4T A;  2UUB Q;  1SNQ A;  4DK6 C;  4BBR B;  5JVG 3;  1HR0 Q;  1A3T A;  1CSQ A;  3U9O A;  2BA0 A;  4LF4 L;  2K7V A;  3RLF A;  4DA2 A;  2ZXO A;  3KDF A;  3J81 L;  4GLX A;  4XQN A;  3SXH A;  1LTS D;  4R4I A;  2UUB L;  1QVG A;  1C7Y A;  4A3G B;  4JBW A;  1X3E A;  1SR3 A;  4JI8 Q;  1RF2 D;  4A3L H;  1SYB A;  2Q2I A;  3E0J A;  5M9O A;  2F0G A;  5IIF A;  2MO1 A;  1B3Q A;  2VZA A;  1CFM A;  2GN5 A;  3IL8 A;  4C3I G;  1AH9 A;  2JA8 G;  4DXF A;  1FNV A;  1TWG B;  3BVZ A;  4KK7 A;  3GTO H;  1IL2 A;  4KHP Q;  2N3S A;  1E2Z A;  4JI8 L;  2JN4 A;  1SXT A;  4S3S A;  2XWJ B;  2V1C C;  5GRO A;  1TS3 A;  3I73 A;  2KQ3 A;  1DGS A;  4DV2 Q;  2B29 A;  1LYL A;  3SGI A;  1DCZ A;  3TQY A;  1WTV A;  4V0B A;  2WAQ B;  1A0I A;  3T56 B;  3NBH A;  1G8Z D;  3M4Y A;  4QF4 A;  4FF1 A;  5LMU Q;  3EJI A;  4EGV A;  1TWA H;  2B2V C;  5EAY A;  4OIK A;  5FO9 B;  4H02 A;  4KHP L;  5C4X H;  3CU7 A;  1DOL A;  2K5H A;  2H5X A;  2N55 A;  2K5D A;  4DV5 Q;  5C3E G;  4DV2 L;  1HQM C;  2PQA A;  2NZO A;  1K9M C;  3RZD B;  5C5M A;  2PZT A;  2F1M A;  2EVB A;  5LMU L;  3PO2 H;  4DR7 Q;  2L15 A;  1PH4 A;  3SHL A;  3RR5 A;  5CR3 A;  3HOX H;  1TWC B;  2KVM A;  3J81 E;  2IX0 A;  1NUC A;  1L0X B;  4IZ8 A;  4DV4 Q;  4O0A A;  4BBR H;  4DR7 L;  1SBB B;  4A3B B;  1WD0 A;  1LAB A;  1WD1 A;  3J80 L;  4HIO A;  4QQB X;  4J6H A;  2KUM A;  2UUC Q;  3TEH B;  3H3V H;  3X3N A;  2RDG A;  1B70 B;  3HOY B;  2IY5 B;  5JJI A;  4A3F B;  3PF5 A;  2JEB I;  3QOJ A;  1EY4 A;  1C8C A;  3KDF B;  3PSI A;  1EFI D;  5IGE A;  3TRE A;  4DV4 L;  3U4Z A;  1ASZ A;  1TWF B;  4A3G H;  1BOS A;  1EYA A;  3PUZ A;  1EUJ A;  1EWH A;  1CUK A;  5LMN Q;  1HHV A;  3BZD B;  1VQP A;  4R4O A;  5JOB A;  4YWL A;  4HAE A;  2OEO A;  2SNS A;  2BH8 A;  1VQA A;  1STE A;  1MI2 A;  1TWG H;  1PYW D;  4R9W A;  5C44 G;  2B2Y A;  2F0M A;  1D7Q A;  2ALY B;  1SMY C;  3H3V C;  4N9P A;  5LMN L;  2AUK A;  5AJ3 L;  2HCI A;  1B8A A;  4IPG A;  3TP5 A;  1H9J A;  3JAM L;  4A3E G;  1UEB A;  1N33 Q;  3P7J A;  3BDL A;  1CSP A;  4LWC A;  1Q3L A;  1V1P A;  4KN4 C;  2N78 A;  4IOA A;  3FMC A;  3M7N A;  1BCP F;  3UDF A;  1NJI C;  1EY0 A;  3MTS A;  3RZD H;  3H15 A;  2M00 A;  2F0O A;  1CA6 A;  2DY7 A;  4OEL B;  2PNH A;  4OIJ A;  5IOC A;  3I4N B;  2AQ1 B;  1SLJ A;  1LT3 D;  4B3S L;  3S1M B;  2MPM A;  2Z0S A;  1DON A;  1WTW A;  1VQB A;  3J81 j;  2EDG A;  1QIL A;  4C3I B;  2JA8 B;  1TWC H;  3S17 B;  1TQO A;  2LSS A;  1LO5 D;  5I2X A;  1XYI A;  3A55 A;  4UPA A;  1EOT A;  1WVL A;  2QA4 A;  1PV4 A;  4OON A;  5D3D A;  1D5X C;  4CKC A;  1EYD A;  3DEP A;  2H4O A;  5E4W C;  1BCP D;  1E0B A;  4ULL A;  2I5L X;  3D6W A;  3ONA B;  3HOY H;  4RG1 A;  1QVC A;  4A3F H;  3J7A V;  1BBU A;  4Z9C B;  2OQ0 A;  4LW1 A;  4XYQ A;  1I4G A;  1PA6 A;  5M5W B;  4OX9 Q;  3HKZ E;  1TWF H;  3NK9 A;  4JBJ A;  1PYS B;  2IT1 A;  2OQK A;  4LUO A;  2F0I A;  4LUV A;  5C3E B;  1Y8N B;  4RFB A;  2QCP X;  4X64 Q;  1Y1V G;  3VR4 A;  4ZRZ A;  5FO8 B;  2OXP A;  2JSO A;  3IRB A;  4DNR B;  2B2U A;  3GTP B;  1PFB A;  4LF5 Q;  2F0U A;  3AU7 A;  3PUV A;  1P8L A;  4OX9 L;  2OWO A;  5IOD A;  1YIT A;  4FXD A;  1IYU A;  2H1E A;  1KL9 A;  3CPW A;  2KCM A;  4C2M B;  1STN A;  5ELE A;  3MEF A;  1K83 H;  4LF5 L;  4WJW A;  3K7A H;  5EBD A;  3SDZ A;  1SMX A;  4BA1 I;  1VQF A;  4JI4 L;  1Y1W B;  2ES2 A;  2AWN A;  4MN3 A;  2F0T A;  2LFN A;  1H9S A;  2IW3 A;  2WV6 D;  2YTX A;  3I4N H;  3HOW G;  3TZU A;  3AYH B;  1MJC A;  2F03 A;  2E2I B;  1RTN A;  5GAE C;  2L1B A;  1R9T B;  1Q82 C;  4C3I H;  1G91 A;  3BS1 A;  1A8V A;  5C44 B;  3L9A X;  5CV6 A;  3QWN A;  3A8I E;  2K52 A;  1JIC A;  2FIN B;  5EPJ A;  2R92 B;  1NCV A;  3J80 i;  3B6Y A;  1UEA B;  1X3G A;  1W3S A;  3PF4 A;  5IGF A;  1EU4 A;  4A3E B;  1CZW A;  1TXY A;  1BQQ T;  2N49 A;  4H13 C;  1SNP A;  2ZXP A;  2F52 A;  2NN6 I;  3CRK C;  2P5Z X;  2BE5 C;  4HTH A;  4FP5 D;  2CHB D;  5M5W H;  2MNA A;  3K58 A;  1PLF A;  4KKU A;  1EY7 A;  4O42 A;  3UE0 A;  3CCS A;  3KFU A;  5C3E H;  4LNQ A;  2FJ2 A;  1UUP A;  2AUJ D;  1XMO Q;  4JI7 L;  1FGU A;  3GTK B;  4FNF A;  4BBS G;  1B50 A;  1OXS C;  5EKK A;  4K0K Q;  3QB3 A;  3CCL A;  1T5X D;  4F8M A;  3HOU G;  4DNI A;  1NE3 A;  4IPH A;  5EKI A;  4P72 A;  4J1M A;  1JT8 A;  1QE6 A;  2JA6 G;  4C2M H;  1HA5 A;  1O78 A;  3KK7 A;  1L1O C;  2PI2 A;  1JOQ A;  2KJX A;  4XDX A;  2UUA L;  3KLR A;  4IPD A;  5T1I A;  3ZYY X;  4DPG A;  1JJC B;  1PRT C;  2CW0 C;  2L0C A;  4LMQ D;  1HUN A;  3UDI A;  2VQF L;  4DR4 L;  4X66 L;  2WAQ E;  5IP7 G;  1Y1W H;  1EQQ A;  3NTH A;  1VF7 A;  3L0O A;  1IBL Q;  1PXU A;  2Z6K C;  3T1H Q;  1Y1V B;  1MD2 D;  2WIN B;  3ER0 A;  3MFG A;  1CHQ D;  2E2I H;  4EX5 A;  1VMC A;  4KKS A;  1R9T H;  1SDF A;  3PIO A;  2HDM A;  4DR3 L;  1LT6 D;  1QVF A;  4IQZ A;  1IBL L;  4LFA L;  3NBI A;  2ICE C;  4IUR A;  3T16 A;  4DK3 C;  2R92 H;  3CW2 C;  3U9S A;  1J8I A;  3CC7 A;  4A3E H;  1AZP A;  3HOZ H;  4G4K A;  2ICI A;  2D2C C;  2D0O A;  4OO1 I;  3D0F A;  4OWX B;  3OPO A;  3Q8D A;  4MTK A;  1OXT A;  5IWA Q;  1DOM A;  3CHB D;  1JB3 A;  1I4X A;  3U50 C;  5ELF A;  3HKS A;  4PNY A;  1SMY D;  4MNO A;  1HR0 W;  3IAY A;  2L9H A;  1SEB D;  4JG2 A;  3I3C A;  1F2Y A;  4A3D B;  3FVQ A;  1SYE A;  1SRU A;  5EPK A;  3GTK H;  2F4I A;  3PCO B;  3HOW B;  1M8A A;  4LF8 Q;  3RNU A;  5CV7 A;  1E3P A;  4B3R Q;  2CKZ B;  5IGG A;  1ZYR C;  5COY A;  2VL6 A;  1FVI A;  1VQM A;  3MC0 B;  3P75 A;  1K3R A;  1EOV A;  1ET9 A;  1PFS A;  2BDO A;  2RHQ B;  5EQ0 A;  3VYS A;  1W6K A;  2LKV A;  2OT2 A;  1HA6 A;  3BDC A;  4HMI A;  4CDD C;  4B3R L;  4FF4 A;  1IBM L;  3HGB A;  2NTT A;  5C3W A;  3C1F A;  4TQU S;  2J7Z A;  4DR2 Q;  3KBX A;  2CFM A;  4DR6 Q;  3TP7 A;  4U67 3;  4Y7N B;  4DNT B;  4KLK A;  1BUV T;  1EQR A;  2EZV A;  5BR8 Q;  5M5Y B;  1CTM A;  3VYT A;  2SOB A;  4BBS B;  2M9V A;  4IUT A;  5H1S E;  4DR2 L;  2PZW A;  2F0V A;  3PQI A;  5EKL A;  4DR6 L;  2YYZ A;  5BN4 A;  4RA8 A;  3HOU B;  3HP3 A;  1HFN A;  4H0L C;  3TSS A;  1SNM A;  3ICE A;  4IFD I;  4I7Z C;  3R2T A;  2JA6 B;  2E74 C;  1C48 A;  1YHA A;  5BR8 L;  5IP9 H;  4GKK Q;  3W2D A;  2B2V A;  2KEE A;  4MTN A;  4RAU C;  1ET6 A;  3KUP A;  1O7I A;  4DV7 L; 
#chains in the Genus database with same CATH homology
 2VQE L;  1YIJ A;  3ULP A;  1NY4 A;  4K0K L;  2DGY A;  1VQJ A;  1HNX Q;  4R4I A;  1MJE A;  2UUB L;  5JEA G;  1QVG A;  1C7Y A;  3I55 A;  2ATW A;  4A3D H;  4JBW A;  4GKK L;  4X6A H;  1X3E A;  1UWV A;  1SR3 A;  4NPS A;  4JI8 Q;  4A3L H;  2KBN A;  3I4M G;  2Q2I A;  1VQN A;  4GN4 B;  3CMA A;  4JCV E;  2CCZ A;  4DR1 L;  3RLO A;  2MO1 A;  1I5F A;  3RLN A;  2VZA A;  2GN5 A;  1GD7 A;  4IFD G;  1WCM H;  1AH9 A;  2JA8 G;  1K8A C;  4A3C H;  2WP8 J;  4R1J A;  1B7Y B;  3ULL A;  5LMN W;  2PMZ E;  3CCM A;  1Z47 A;  1U5K A;  1VQ5 A;  3GTO H;  4FDB A;  4AIM A;  1IL2 A;  2JEA I;  4KHP Q;  2N3S A;  4JI8 L;  5C44 H;  3J81 i;  4JBK A;  2AMC B;  2V1C C;  2R93 G;  2UU9 Q;  2KHJ A;  5GRO A;  1DGS A;  4DV2 Q;  2B29 A;  1LYL A;  3SGI A;  3TQY A;  1XJV A;  3CC2 A;  1A0I A;  3A0J A;  4XTC S;  3T1H L;  4LF6 Q;  3K7U C;  2BA1 A;  4A3J H;  1L1O B;  1G6P A;  5LMU Q;  3CCQ A;  1TWA H;  1PH5 A;  5EAY A;  4H02 A;  3I7F A;  4KHP L;  5C4X H;  3BJU A;  2JA5 H;  1VQ7 A;  2K5H A;  1HNZ Q;  2H5X A;  2UU9 L;  4JI5 Q;  4Y7N H;  1GO3 E;  1YHB A;  5C3E G;  4DV2 L;  4DV5 Q;  1JJG A;  2PQA A;  2YU9 H;  2NZO A;  4RMF A;  1K9M C;  2BH2 A;  4LF6 L;  3OTO Q;  1X3F A;  2HIX A;  4R4C A;  2B63 G;  3KYH C;  2K5N A;  4XIG S;  5M5Y H;  5LMU L;  1JB7 A;  3BZC A;  2ZM6 Q;  3PO2 H;  4DR7 Q;  4BBS H;  1Q1B A;  5FLM H;  1D7Q A;  2L15 A;  1PH2 A;  4JI4 Q;  1PH4 A;  1PH1 A;  1XTD A;  1Z9F A;  4JC0 A;  3RR5 A;  3J81 c;  4LF7 Q;  4JI5 L;  3KLW A;  4AYB E;  5IWA L;  4NXM L;  1PVO A;  4QJF A;  3HOU H;  3HOX H;  3S1M H;  4YWM A;  4DKA C;  5JJL A;  5IP9 G;  4A3K G;  4O2D A;  3FKI H;  1M1K C;  2ZTE A;  3PO3 H;  3OW2 A;  1QUQ A;  2IX0 A;  3OTO L;  2GVB A;  3CCR A;  3T1Y Q;  2ZJR A;  2JE6 I;  2ZTD A;  4DV4 Q;  4C3H H;  3CME A;  4O0A A;  4BBR H;  2ZM6 L;  1N34 Q;  4DR7 L;  5HGQ A;  4GKJ L;  1I94 Q;  3L2P A;  4HJA A;  4DV1 Q;  2IHF A;  4HIO A;  4QQB X;  2GVA A;  2F3I A;  2UUC Q;  3S1R H;  3TEH B;  3H3V H;  4POF A;  2VUM G;  1B70 B;  2IY5 B;  1Q1E A;  1Q46 A;  4LF8 L;  5JJI A;  3PF5 A;  4A3D G;  2JEB I;  3W5O A;  1OXV A;  4GOP C;  3KDF B;  4A3L G;  3PSI A;  4GNX C;  2VY3 A;  4HJ5 A;  3TRE A;  3T1Y L;  4DV4 L;  1KD1 C;  3ERS X;  4YCU A;  3U4Z A;  3UE1 A;  1ASZ A;  2JA7 H;  4A3G H;  1S72 A;  4Y52 H;  3PUZ A;  1K0R A;  2K14 A;  5M3F H;  1EUJ A;  1I94 L;  5LMN Q;  1CUK A;  4AYB G;  4DV1 L;  4BY1 H;  4B3T L;  4BY7 H;  1WCM G;  1YNX A;  3CQZ H;  3KF6 A;  4LUZ A;  1VQP A;  1KIX A;  1PYB A;  4OWW B;  4A3C G;  1VQL A;  4X62 L;  4R4O A;  1FJG L;  3EIV A;  4YWL A;  2NVX H;  3F2D A;  4EQ5 A;  2R6G A;  3K81 C;  3CCU A;  2DUD A;  1Y1V H;  1D8L A;  1BBW A;  3G71 A;  4LFB Q;  2BH8 A;  1VQA A;  2NZH A;  1TWG H;  5C44 G;  1GM5 A;  3F2B A;  1OTC A;  3PUY A;  1XNR Q;  1HNW Q;  1XPO A;  5K36 G;  1X6O A;  2ALY B;  2ID0 A;  2K50 A;  1HZC A;  1V43 A;  1E1O A;  2EIF A;  3CPF A;  3E9I A;  4TVA B;  5LMN L;  4JI7 Q;  1KXL A;  3W1B A;  1MIU A;  5AJ3 L;  4A3I G;  4IPG A;  1B8A A;  5C4J H;  4DUZ Q;  4BXX G;  3I4O A;  4A3E G;  1UEB A;  1SN8 A;  1VQD A;  3PIP A;  1XMQ Q;  1J5E Q;  3CCV A;  1N33 Q;  5C4X G;  2OTJ A;  2UXD L;  1CSP A;  1M90 C;  2I5H A;  1IBK Q;  2JA9 A;  3AEV A;  4LWC A;  1SFO H;  4L5R C;  1XNR L;  3FP9 A;  2N78 A;  4IOA A;  4YCV A;  4QL5 A;  2RHS B;  2WFW A;  4KI0 A;  3RN2 A;  3H3V I;  2E8G A;  5GAH C;  3NEN A;  4DUY Q;  3M7N A;  1CKN A;  2HIV A;  3KOJ A;  3BU2 A;  3CAM A;  2IHE A;  3UDF A;  4DUZ L;  1S40 A;  1NJI C;  3F1Z A;  1N8R C;  5ELO A;  3RZD H;  3K0X A;  3H15 A;  1E22 A;  5FLM G;  2UUA Q;  2PNH A;  1IBK L;  2E5L Q;  4YCW A;  1UE7 A;  5FJ8 G;  1SLJ A;  4NXN Q;  3F2C A;  3J80 c;  3HOX G;  1HR0 L;  4B3S L;  5IYC H;  2Z0S A;  3E9H A;  4JI1 Q;  2VQF Q;  1VQB A;  2FXQ A;  5IYB G;  3FKI G;  3J81 j;  4X66 Q;  3JAM i;  4DR4 Q;  5GAD C;  2D62 A;  4DUY L;  3ZJY C;  3HOW H;  3AFP A;  2F4V Q;  1VQ6 A;  1TWC H;  2LSS A;  4BBR G;  3GDE A;  4HJ7 A;  3KJO A;  1Y14 B;  4UPA A;  1HJP A;  4LFC Q;  1HNX L;  1YVC A;  2VW9 A;  2QA4 A;  1X9N A;  1PV4 A;  4OON A;  3M9B A;  2E5L L;  2NVT H;  3M4Q A;  1QUQ B;  4LF9 Q;  3L7Z C;  1VS0 A;  4NXN L;  2YTV A;  4JI3 Q;  2Q2H A;  5IE8 A;  2YTY A;  5J3B A;  1PH3 A;  3ULJ A;  4HID A;  2I5L X;  3CXC A;  1PH8 A;  3HOY H;  1NMG A;  4RG1 A;  1QVC A;  4A3F H;  4GLV B;  3GTQ H;  2R7Z G;  2JA7 G;  4DR3 Q;  1Q86 C;  1KAW A;  1BBU A;  4LFA Q;  2OQ0 A;  4JI2 Q;  5M3F G;  1TWH H;  3H0G H;  4LW1 A;  4BY1 G;  1PA6 A;  4BY7 G;  4GOP A;  5M3M G;  3HKZ E;  3W1G A;  2XGT A;  4HIM A;  1L2F A;  1TWF H;  4GS3 A;  4GNX A;  4OX9 Q;  2LXJ A;  1PYS B;  2IT1 A;  2OQK A;  4JBJ A;  4LUO A;  4LUV A;  4QY7 A;  4LF9 L;  3GTM H;  4MZ9 A;  3K80 C;  4JI3 L;  4JYA Q;  3KF8 B;  3GTL H;  4IO9 A;  2LXK A;  4X64 Q;  1Y1V G;  3JAM c;  3IRB A;  3A5U A;  2HQL A;  1FL0 A;  1WFQ A;  4LF5 Q;  4A93 H;  1N36 Q;  5IYD H;  4AQY Q;  4JI2 L;  1T9H A;  1QZH A;  1PH9 A;  3PUV A;  3HOV H;  1P8L A;  3U4V A;  1HH2 P;  4OX9 L;  2OWO A;  1NBW A;  1YIT A;  1XPR A;  1XNQ Q;  1VQI A;  2K75 A;  1KL9 A;  3CPW A;  2KCM A;  1HNZ L;  4A75 A;  2CWA A;  4NB3 A;  2KEN A;  5C0X I;  3S2H H;  3WWV A;  4DV5 L;  1L0W A;  2A8V A;  2OTL A;  3MEF A;  1VQO A;  1K83 H;  4YHH Q;  1Q81 C;  4B3M Q;  4LF5 L;  2KHI A;  3HKZ G;  3GD7 A;  4AQY L;  2JA6 H;  3J7A 5;  2C35 B;  1GKH A;  3GO5 A;  3K7A H;  4YY3 Q;  4A3M H;  2A1A A;  3PV0 A;  2MO0 A;  4DV6 Q;  1SMX A;  1Q8K A;  4UP9 A;  1J6Q A;  2RCN A;  4BA1 I;  1VQF A;  1E1T A;  3CP0 A;  4PMW A;  4JI4 L;  4OWT B;  1P16 A;  1E7Z A;  4LF7 L;  3S15 H;  4GN5 A;  2PI2 E;  2ES2 A;  2AWN A;  1JE5 A;  1U0L A;  1YJ9 A;  1CKN B;  4YHH L;  5IYC G;  5IP7 H;  1K8G A;  3BZK A;  4JI0 Q;  1AE2 A;  2YTX A;  1A63 A;  1NTG A;  3I4N H;  1N34 L;  2HT1 A;  3HOW G;  3AYH B;  1MJC A;  4DV6 L;  1IBM Q;  3AFQ A;  4POG A;  1WI5 A;  2K5V A;  5GAE C;  1IXR A;  1YJW A;  4P75 A;  5IT9 c;  5C0X G;  1Q82 C;  4C3I H;  1KRS A;  1YBY A;  3STB D;  2HHH Q;  2UUC L;  1A8V A;  1KHI A;  3S16 H;  2E2H H;  1SE8 A;  4X65 Q;  1L1O A;  2K4K A;  2K52 A;  3S24 A;  5FLX c;  1KC8 C;  4P74 A;  3M3Y H;  2R93 H;  4JI0 L;  3J80 i;  3B6Y A;  1LTL A;  1X3G A;  1W3S A;  4A76 A;  3PF4 A;  5E7N A;  1TXY A;  2N49 A;  3EBE A;  1EFW A;  4A3J G;  2HHH L;  2F52 A;  2NN6 I;  3H0G G;  4HIK A;  3LGJ A;  5JJK A;  1EIF A;  2JA5 G;  4LFB L;  5M5W H;  2MNA A;  4J15 A;  4JYA L;  2Z6K A;  3NBH B;  3UE0 A;  1HNW L;  3U58 A;  5C0X J;  2E2J H;  3CCS A;  1WJJ A;  1MKH A;  3KFU A;  5C3E H;  4LNQ A;  4GOP B;  4JOI A;  1XMO Q;  1HZA A;  4GNX B;  4JBM A;  4JI7 L;  4UP8 A;  3RN5 A;  3G6E A;  1FGU A;  2B63 H;  3A74 A;  2D0P A;  3AQQ A;  3VDY A;  1VQK A;  3PO2 G;  4BBS G;  1Q12 A;  1X65 A;  1W2B A;  1XMQ L;  1J5E L;  1N33 L;  2UXB Q;  1OXS C;  4DV7 Q;  2R7D A;  2PQA B;  1H95 A;  5HY6 A;  4K0K Q;  3I56 A;  3CCL A;  3HOU G;  4DNI A;  1NE3 A;  1N32 Q;  1HZB A;  1UE5 A;  4IPH A;  4P72 A;  3HFZ B;  2QEX A;  4A3K H;  1PH6 A;  3PO3 G;  2WB1 G;  2NN6 G;  1JT8 A;  4ME3 A;  3UDG A;  2JA6 G;  1ASY A;  4JV5 Q;  4C2M H;  1VQ4 A;  1QZG A;  1L1O C;  2PI2 A;  1G51 A;  4WJ4 A;  4DR1 Q;  5DLQ E;  2JQO A;  2UXB L;  2UUA L;  4IPD A;  3FHW A;  4DPG A;  1LUZ A;  1EWI A;  1JJC B;  3E0E A;  1IYJ B;  1YI2 A;  3UDI A;  2VUM H;  4A3B H;  1KQS A;  1N32 L;  4JI1 L;  2VQF L;  1BKB A;  1GVP A;  1SRO A;  4IOC A;  3CF5 A;  4HJ8 A;  4X66 L;  4DR4 L;  2WAQ E;  5IP7 G;  4JV5 L;  1Y1W H;  4IJH A;  3EN2 A;  4PZ8 A;  3UDX A;  1VCI A;  4PG3 A;  1EQQ A;  2Q2U A;  2F4V L;  3L0O A;  3I4N G;  4A3G G;  3K8A A;  1BVS A;  2CQO A;  1IBL Q;  2Z6K C;  4L5Q A;  4PZ6 A;  3PUX A;  3CCE A;  1EYG A;  4LFC L;  3T1H Q;  3GTG H;  1X56 A;  3NEL A;  2IX1 A;  1C0A A;  4JOI C;  3ER0 A;  1VQE A;  5GAG C;  1JMC A;  2E2I H;  4EX5 A;  2MQH A;  1CKM A;  1R9T H;  3G4S A;  3PIO A;  4DAM A;  3J7Z C;  2Y0S E;  3F8T A;  4UY8 C;  4AH6 A;  3KF6 B;  1A62 A;  4DR3 L;  1G29 1;  3HOZ H;  3A5Z B;  1QVF A;  1IBL L;  4LFA L;  4DK3 C;  2I0Q A;  3G48 A;  2R92 H;  3CW2 C;  1KRT A;  5JEA J;  1LM0 A;  3M4O H;  4A3I H;  3CC7 A;  1XPU A;  4BXX H;  2WAQ G;  1S3O A;  1V1Q A;  1X55 A;  4OXP A;  2JK8 A;  4ALP A;  4A3E H;  1Q7Y C;  4L5T A;  4X64 L;  2ZJQ A;  2D0O A;  4DV0 Q;  1PHJ A;  3TRZ A;  3D0F A;  2VS1 A;  4OWX B;  4OO1 I;  3Q8D A;  4DAY B;  1E24 A;  4APV A;  2JJQ A;  4P71 A;  1OXT A;  4QIW E;  5IWA Q;  3I2Z A;  4NXM Q;  4IFD J;  1V9P A;  1N36 L;  3PUW A;  3U50 C;  4A4I A;  3HKS A;  4GLA C;  1RL2 A;  4MNO A;  1WYD A;  4JI6 Q;  1HR0 W;  2XTI A;  1XNQ L;  3TS2 A;  3S2D H;  4JG2 A;  2AHO B;  3KJP A;  4GKJ Q;  3NEM A;  2Y0S G;  4IPC A;  4DV0 L;  1SRU A;  1X54 A;  1I50 H;  2A19 A;  2CWP A;  2RF4 A;  5ELN A;  2ZJP A;  3D31 A;  3GTK H;  4BA2 I;  4PZ7 A;  3RZO H;  3PCO B;  1OXU A;  5FJ8 H;  1JJ2 A;  2YV5 A;  4B3M L;  4LF8 Q;  3RNU A;  2EXD A;  1UE6 A;  3I4M H;  1EIY B;  4YY3 L;  1VQC A;  5IYB H;  1I6H H;  3GTJ H;  1E3P A;  4B3R Q;  2CKZ B;  1UE1 A;  2N8N A;  4JI6 L;  4DR5 Q;  2VL6 A;  3M4P A;  1FVI A;  1VQM A;  1K73 C;  1OXX K;  4OO1 G;  1I3Q H;  3M85 A;  2AWO A;  1K3R A;  1RIP A;  1EOV A;  2JA8 H;  1YEZ A;  5GQO A;  5IY0 A;  4B3T Q;  3S17 H;  1PFS A;  2KCT A;  2RHQ B;  4R4Q A;  3S1Q H;  2EQS A;  1VQ9 A;  4A3B G;  2AKW B;  4X62 Q;  1C9O A;  1NMF A;  4L5S A;  1FJG Q;  2NVQ H;  4WJ3 M;  3CC4 A;  3HOY G;  4B3R L;  1N9W A;  1IBM L;  1Y1W G;  4A3F G;  4A93 G;  4DR5 L;  3DM3 A;  3TS0 A;  2R7Z H;  4UP7 A;  3S1N H;  2ZTC A;  4TQU S;  1YJN A;  3CCJ A;  4DR2 Q;  2NVY H;  2WB1 E;  2CFM A;  2R7F A;  2OCE A;  5M3M H;  4DV3 Q;  4DR6 Q;  4P73 A;  5AJ3 Q;  4X65 L;  4KLK A;  1YHQ A;  1CKO A;  1EQR A;  2Q2T A;  2MFI A;  3PGZ A;  3JC6 6;  1AE3 A;  5BR8 Q;  2UXD Q;  3MXN B;  1WOC A;  5M5X H;  5IYD G;  2I5M X;  2QGQ A;  4QGU A;  3HOV G;  5H1S E;  4DR2 L;  1HZ9 A;  4LF4 Q;  4HJ9 A;  1VQH A;  2R92 G;  3S14 H;  3GTP H;  4DR6 L;  2YYZ A;  4DV3 L;  1YZ6 A;  4YWK A;  4IJL A;  1IZ6 A;  4GN3 B;  2UXC Q;  3OYY A;  2B3G A;  4C3J H;  2VQE Q;  3HOZ G;  2ASB A;  3ICE A;  1VQ8 A;  3DLL A;  4IFD I;  4R4T A;  1YHA A;  5BR8 L;  2UUB Q;  2VNU D;  4DK6 C;  5IP9 H;  4GKK Q;  1XMO L;  4B3S Q;  1HR0 Q;  1CSQ A;  1VQG A;  2BA0 A;  1PH7 A;  4LF4 L;  4KHZ A;  4MTN A;  4A3M G;  3RLF A;  3KDF A;  4GLX A;  3CD6 A;  3STB C;  2UXC L;  1O7I A;  4DV7 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...