3S17H

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s17H00
1WI5A 3AFPA 3CQZH 4HJ7A 4C3IH 1W2BA 2E5LQ 2JA6G 1XNQQ 2B3GA 4GLAC 3LGJA 4GNXC 2CQOA 3PO2H 2UUBQ 1NY4A 3GTQH 4LF6L 4NPSA 4YY3L 2Q2UA 3E9HA 3I56A 3DLLA 4C3HH 3U4ZA 4KHPQ 1TWGH 3RN5A 3HKZG 4R4QA 1EQQA 2L15A 4LF5L 2A19A 2FXQA 3HOZG 3JAMi 4AIMA 2JEBI 3HKSA 2IT1A 4P71A 1XPUA 4A3DH 1FJGQ 2JE6I 2WFWA 5C4XH 1KL9A 1A62A 4IPDA 3CC7A 3GTOH 2UXDQ 4A3KG 2B63G 3CCVA 3CCJA 1OXTA 5J3BA 5GAEC 2I5MX 2HIVA 2WB1G 5HGQA 4JI4Q 2R7FA 1VQMA 4RMFA 2UXBQ 1HZ9A 3D0FA 3M9BA 4DR2Q 1PA6A 2LSSA 1U0LA 3CMEA 4DV2L 3I4NG 4JYAL 1X54A 1GVPA 4IPHA 3GTMH 2JA7G 1YIJA 1X3FA 2MQHA 3K81C 3KDFB 1HNZQ 4FDBA 4OX9Q 1JT8A 2PMZE 4X62Q 3RZOH 3I4MG 4IPGA 4DV6L 1YJ9A 3CF5A 1PVOA 2K50A 1Z9FA 1N34Q 1Q82C 5BR8Q 4UY8C 4LF9L 3AEVA 4BY1G 3S2HH 1UE7A 2H5XA 3RLNA 4B3ML 1CSQA 1CKOA 4DV7Q 5GADC 1VQ4A 1IZ6A 2K5NA 3D31A 1YJWA 1I94Q 5JJIA 2PQAB 3U50C 4GNXB 5IWAQ 4YHHL 4X6AH 4B3TL 2F4VQ 4JI1L 1BVSA 3MEFA 4L5QA 4DV1L 4IJHA 3F8TA 2BA0A 3HOZH 2ZJQA 5E7NA 1AH9A 4X65Q 3GD7A 1JJ2A 3CCMA 1VQHA 4NXML 2UUAL 5IYCH 1VQ9A 2IX1A 1OTCA 4OXPA 2PI2E 1V9PA 1VQFA 2V1CC 3A5UA 4HJ5A 4DV4L 1N36Q 2B63H 4JI3L 3ER0A 1V43A 3AQQA 1PFSA 2OTLA 4HJ8A 4DKAC 4NXNQ 1PH5A 4BBSH 2GVBA 2ZJPA 1FVIA 4JBMA 1WFQA 4B3SL 1N33L 2JQOA 4R1JA 5JEAG 4Y7NH 4A3CH 3EBEA 3CP0A 1GO3E 2JA7H 4DK6C 3HOXG 2VQEL 2IX0A 3ZJYC 4IOAA 3K7UC 2Z6KC 4DV5L 5FLMG 3I55A 1NE3A 1PYBA 4OWTB 2E2HH 3A0JA 1B8AA 3WWVA 1C7YA 3S1NH 5GAHC 4DR5L 4GOPA 2VNUD 1IXRA 4GKJQ 4B3RL 4UP9A 3HOYG 4A4IA 1VQ6A 3CC4A 1L1OA 2R7DA 1QZGA 1E1TA 5M3FG 4GKKL 1G291 1KQSA 3G4SA 2I0QA 3STBD 3OYYA 4JI7L 3M4OH 3PIOA 3KF6B 1L0WA 4GLXA 1VQ7A 1YZ6A 4JOIA 2R7ZG 2BA1A 2ZTCA 3S1RH 1XMQQ 3PF5A 4LFCQ 1PYSB 2GN5A 4JV5L 4DR4L 4TQUS 4JI5Q 4DR7L 5C3EG 2UU9Q 1L2FA 2Z0SA 1WJJA 1A63A 2IHFA 1VQNA 4KHZA 4HIKA 1HR0Q 2OCEA 3CCQA 1XNQL 3G6EA 3T1HL 3L0OA 2HQLA 2NVTH 1PH9A 2A8VA 1D8LA 3J7ZC 1HH2P 3T1YQ 1PH3A 3KFUA 2JA9A 4MTNA 4O2DA 1PH6A 3GTKH 4IFDI 1N8RC 4KHPL 3HOXH 1VQDA 3IRBA 2YYZA 2B29A 5FLMH 2E2IH 2JA8G 1N32L 2YTYA 1S3OA 1IBLL 2D0OA 4PZ6A 4IO9A 2AWOA 4IFDG 2K52A 2R6GA 1SLJA 2KHIA 1YVCA 3E9IA 4AQYQ 2DUDA 4JI8Q 3HOYH 2UXDL 3ULPA 1SN8A 1VQKA 1JMCA 3NELA 4JI6Q 4X66Q 4OONA 1PH2A 4NB3A 3UE1A 2ZM6L 2D0PA 1JJCB 4A3FG 3CD6A 4A3JG 1QUQB 1BKBA 4DAMA 3A74A 1J5EQ 4LF7L 4EX5A 2VUMG 1VS0A 1FGUA 1IYJB 4PMWA 3U4VA 3PSIA 4L5TA 4X62L 3B6YA 3PUXA 5DLQE 3S14H 3KYHC 2UXCL 5K36G 3RN2A 4HIOA 1MIUA 1B70B 1N34L 2WAQE 2D62A 5IY0A 5C44G 3GDEA 3G48A 3HFZB 4A75A 4DV7L 1KAWA 4AYBE 1E1OA 2I5HA 1UE5A 3K7AH 4ME3A 4BY7G 3HOVG 1Q12A 1SROA 3AYHB 2R93G 3OW2A 2ZJRA 4JI2Q 1MJCA 4A93H 3I2ZA 4DR6L 5AJ3L 4QIWE 1Y1WG 1IL2A 1H95A 4LUOA 2VQFL 1HR0W 4LNQA 3FP9A 4IOCA 5M3MH 1CKMA 2KCTA 3AFQA 3BZCA 4PZ7A 1IBKL 1RIPA 1TXYA 3KDFA 1XMOL 1K8GA 1EWIA 3GTJH 4QY7A 1S72A 1LUZA 2N78A 4X64Q 1Q46A 3CMAA 2ASBA 4DPGA 1CSPA 3UDGA 4DR1L 1AE3A 1MKHA 4A3IG 4BBRG 2E2JH 2JA6H 1G6PA 1WOCA 1PV4A 4K0KL 1N36L 2HHHL 1YHQA 4LF6Q 5H1SE 4YY3Q 1JJGA 2Q2IA 4H02A 5FLXc 5LMUQ 1K9MC 2K5HA 3HOUG 2KCMA 4BA2I 2RHSB 3L7ZC 5ELNA 4LF5Q 1K3RA 2ES2A 2RCNA 2PQAA 2PI2A 3RLOA 4DR3L 4A3EG 1PHJA 4QQBX 3I7FA 2C35B 3PGZA 4GNXA 3J7A5 3H15A 1VQBA 4A3FH 3W1GA 1X6OA 1EUJA 3H0GG 3TS0A 4A3JH 1VQ5A 4LFBL 4JC0A 4A3GG 5IT9c 1Z47A 4GLVB 4PG3A 3PUYA 2MO0A 3KF8B 4A3KH 3HOWG 3CPWA 1QVCA 2VS1A 5C44H 2K4KA 4DV2Q 1PH4A 3M85A 2MO1A 1ASZA 1Y14B 4P75A 4BY7H 3MXNB 4GS3A 4ALPA 3HOVH 4A3BG 1VQAA 2QA4A 3I4NH 2CCZA 1XPOA 2OQKA 5IP7G 4DV6Q 5IP9G 4DV0L 3RNUA 4LW1A 1Y1WH 1YEZA 1YI2A 2VW9A 3I4MH 1SRUA 1GM5A 1HNXQ 3PUZA 3DM3A 4B3MQ 1XNRL 3CCRA 2JA5G 4GN4B 1TWFH 3BJUA 3W5OA 4BY1H 2I5LX 4JG2A 4OWXB 3PF4A 5LMNQ 4A3LG 3RLFA 5M5YH 4A3IH 1GKHA 4JI5L 4QGUA 4BBRH 1D7QA 3TS2A 1JE5A 2UU9L 5GQOA 4J15A 4LF4Q 1P16A 1EIFA 3ULJA 3G71A 2EXDA 2Y0SG 4GN3B 1OXXK 4DUYQ 1VQCA 2KBNA 4TVAB 4C2MH 4DV1Q 1I6HH 2YU9H 1K73C 2HT1A 1KRSA 5C0XG 5JEAJ 2E8GA 3T1YL 5IYDG 3KJPA 2UUCQ 1BBUA 3HKZE 2CKZB 1WYDA 1Q1EA 4R4CA 1I5FA 4P73A 3KF6A 3W1BA 4AH6A 3NENA 1EIYB 4DUZQ 3H0GH 3M3YH 2QGQA 3TQYA 4DV3Q 5IYDH 4DV4Q 3JC66 3Q8DA 4YWKA 2CWPA 3KOJA 1R9TH 1EYGA 4OO1G 2YV5A 1YNXA 1C0AA 2YTXA 1SMXA 4LF8Q 4P72A 1TWHH 2LXKA 3HOWH 1J6QA 4IJLA 2ZTEA 1S40A 2WB1E 2OTJA 1EOVA 2Q2HA 2E5LL 2UUAQ 3CCLA 3PO2G 4YWMA 4EQ5A 4AQYL 3GO5A 2N3SA 3KJOA 1W3SA 1RL2A 3CCUA 4O0AA 4YCUA 1X3GA 2UUBL 4A3BH 3H3VI 4PZ8A 3F1ZA 4HJ9A 4JI6L 2A1AA 2VQEQ 1NBWA 3PIPA 5IP7H 4DV5Q 2NVYH 3J80c 1B7YB 4MZ9A 3K8AA 5IE8A 1KHIA 4DR5Q 3EN2A 1K83H 3L2PA 3ERSX 1HZAA 1Q86C 1J5EL 1VQJA 2JA5H 1FJGL 1I3QH 4JI0Q 1KC8C 1X3EA 2R92G 3CW2C 2F52A 4GKKQ 2VZAA 1I50H 2VL6A 2Z6KA 3J81i 1Q81C 4JI4L 1PH7A 4JI7Q 3S17H 5M3FH 2UXBL 1KIXA 1NTGA 3STBC 4JBJA 1QVFA 4DR2L 2AKWB 2ALYB 4YCVA 1YHBA 2ID0A 3EIVA 2NN6G 4BA1I 1E22A 3F2CA 5LMNW 1KD1C 1HNWQ 2EQSA 3TREA 2CWAA 2EIFA 3FHWA 3F2BA 1HZCA 2R7ZH 1Y1VG 4DR4Q 1CKNB 1IBMQ 2NVXH 5GROA 2BH2A 3FKIG 1VQPA 3PUWA 1HNZL 4OX9L 1QUQA 3OTOQ 4JCVE 4KLKA 1N9WA 4IFDJ 1EFWA 2CFMA 5C3EH 5BR8L 4WJ4A 1LYLA 1X55A 1SE8A 4X64L 3T1HQ 4UPAA 5HY6A 5GAGC 3UDFA 1E7ZA 1VQGA 3CXCA 1AE2A 3I4OA 3J80i 1YJNA 1VQLA 4BXXG 1VQEA 1O7IA 3NEMA 5LMUL 1YITA 1K8AC 1I94L 1Q7YC 2AHOB 4JV5Q 4JBKA 4UP8A 2NZHA 5IWAL 4R4TA 2F4VL 1HZBA 3ULLA 2RF4A 1G51A 3VDYA 2RHQB 4LFAQ 1N32Q 3K80C 1T9HA 4C3JH 2K75A 1NMGA 4QJFA 5IYCG 4XIGS 1IBLQ 4POGA 1FL0A 4QL5A 4R4IA 4X65L 4L5SA 3UE0A 2XTIA 2JA8H 4LUVA 3H3VH 1VCIA 2MNAA 3S15H 1UE6A 1C9OA 2R92H 3UDXA 1TWCH 2WP8J 4BBSG 1YBYA 2ZM6Q 2Y0SE 4OWWB 4NXNL 4A3CG 2MFIA 2KENA 4GOPC 4LWCA 4A3MG 1M90C 3CAMA 1JB7A 4LF7Q 4R4OA 3GTGH 1VQ8A 1Y1VH 2UXCQ 4POFA 1L1OC 3S24A 3FKIH 3CCEA 2VUMH 3BU2A 1Q8KA 4IPCA 2K5VA 1WCMG 1HNXL 2OWOA 3PO3G 2XGTA 2N49A 3RR5A 1GD7A 1K0RA 1QZHA 4JOIC 4KI0A 5LMNL 4JBWA 1SFOH 4JYAQ 4GKJL 2ZTDA 4APVA 4DR6Q 4A3DG 2NVQH 2IY5B 3PUVA 1NJIC 2N8NA 5IYBG 5AJ3Q 5M5XH 1M1KC 4LF4L 4BXXH 2R93H 2VQFQ 4DUYL 1UE1A 1A0IA 2GVAA 2VY3A 3TRZA 3M4PA 1IBKQ 4MNOA 1XMOQ 4LF9Q 1UEBA 2UUCL 4YCWA 3SGIA 3GTPH 3GTLH 5JJLA 5FJ8G 4DR1Q 1XMQL 4DUZL 4LFCL 3K0XA 1Q1BA 4K0KQ 4DV3L 4Y52H 2WAQG 2HHHQ 2BH8A 1TWAH 1LTLA 1XTDA 2AWNA 1E24A 5C0XI 1ASYA 3F2DA 4LF8L 3J81j 4AYBG 1OXVA 1X56A 4YHHQ 2QEXA 3ICEA 4P74A 1HR0L 4B3TQ 4JI1Q 3HOUH 4DR3Q 2Q2TA 4WJ3M 3U58A 4OO1I 3BZKA 3J81c 4A3EH 4LFBQ 5C4JH 1E3PA 4NXMQ 4A3MH 2JJQA 1SR3A 1PH1A 4GOPB 4RG1A 4A3GH 1DGSA 2F3IA 4JI3Q 4HIDA 2YTVA 1UWVA 2DGYA 1VQIA 1WCMH 1L1OB 3PO3H 4LUZA 4UP7A 2NZOA 1P8LA 2HIXA 3PV0A 3CCSA 3RZDH 1X65A 3PCOB 3S2DH 1BBWA 4JI0L 5JJKA 5ELOA 2OQ0A 1NMFA 1HJPA 4B3SQ 3E0EA 4JI8L 4GN5A 4A76A 1VQOA 1N33Q 2JEAI 4DV0Q 5IYBH 4DNIA 5C0XJ 1EQRA 4X66L 5IP9H 3KLWA 1XNRQ 1KRTA 4DK3C 1OXSC 1HNWL 3S16H 1QVGA 5C4XG 2LXJA 1X9NA 1V1QA 5FJ8H 3NBHB 5M5WH 1IBML 3JAMc 4B3RQ 3S1QH 2IHEA 1OXUA 2AMCB 3S1MH 4A3LH 4YWLA 3OTOL 3A5ZB 4HJAA 2NN6I 1A8VA 1LM0A 1U5KA 1CUKA 2K14A 3M7NA 4A93G 4DAYB 1PH8A 1YHAA 4HIMA 3CPFA 2KHJA 1XPRA 5EAYA 3TEHB 2JK8A 4JI2L 5M3MG 3UDIA 3CC2A 1KXLA 3M4QA 1MJEA 2ATWA 4DR7Q 4L5RC 2PNHA 4XTCS 1XJVA 4LFAL 1CKNA
chains in the Genus database with same CATH superfamily
3CQZH 1W2BA 2K04A 2E5LQ 1XNQQ 1CT1D 4R8NA 3S16B 2CQOA 1VF7A 2UUBQ 1NY4A 2Q2UA 3ERQA 3T56B 3DLLA 4NKLA 4K5VA 4KHPQ 1TWGH 4R4QA 3HOZG 3HKSA 3O13A 4P71A 2O5JC 2JE6I 5I9PA 3OHXC 5C4XH 4ZKCB 1B3AA 1KTKA 2B63G 1OXTA 5GAEC 2I5MX 2R7FA 1HZ9A 5IGCA 4QMGA 3DUZA 4DR2Q 4WFN3 1HTPA 1PTOF 1GUTA 4C3IB 3I4NG 2K03A 1TS5A 3A8IE 2JA7G 1HNZQ 1JT8A 2E76C 3RZOH 3I4MG 4DV6L 3CF5A 4C3HB 2HDLA 5BR8Q 2B2TA 2I07B 1NAPA 5FKAC 4BY1G 2H5XA 3RLNA 1BDOA 1EIGA 1IZ6A 2K5NA 1I94Q 2Z9HA 4GNXB 4YHHL 1BCPB 2F4VQ 5IGGA 1FR3A 3K0YA 4FP5D 2GA4B 4X65Q 5ELDA 2EYMA 1JJ2A 2EY2A 4C1NI 2IX1A 4IZ8A 1ENAA 1V9PA 3GTMB 5LL6X 3LX0A 3TP6A 3AQQA 1PFSA 1MHWC 4HJ8A 2ZJPA 4JBMA 4B3SL 1VMPA 4Y7NH 3CP0A 4DK6C 3HOXG 4IOAA 2NWGA 5FLMG 3EVQA 3I55A 1SYEA 3WWVA 5GAHC 2VNUD 3HOZB 4KD3A 5C4ZA 4UP9A 3HOYG 4A4IA 5IIFA 2R7DA 4TSSA 1QZGA 5M3FG 3D4DA 1SAPA 4GKKL 1RODA 3E0JA 2B63B 4JI7L 2F0DA 4MIUA 4DXGA 2B2UA 4BBSB 3PF5A 3LWEA 3MEHA 5C3EG 2Z0SA 2JA7B 2FFKB 2RDGA 2IHFA 4KHZA 1GUOA 3D6WA 1HR0Q 3CCQA 4V0BA 1NR4A 1XNQL 3L0OA 3J7ZC 1HH2P 4MTNA 3VYSA 2A6ED 1DXMA 4KHPL 4I7ZC 4OIKA 3IAYA 3OIPA 2EJGC 3M4OB 4ZAIA 1S3OA 4PZ6A 4IFDG 1HUNA 3IFDA 2K52A 1SLJA 1A3VA 2L12A 1SNDA 1CHPD 2JYOA 1VQKA 2PW5A 4NB3A 1RF2D 4H44C 4H13C 1G6ZA 2L4NA 1DZ1A 3CD6A 2Q8IB 5L37A 1VMCA 4A3JG 1BKBA 1ZEQX 4DAMA 5E4XA 5JPMC 3A74A 2RBMA 4PMWA 1EY9A 3PSIA 3J81L 3IKJA 3M7GA 4RKBA 3RN2A 4HIOA 3PQIA 1LABA 3H3VC 3SHLA 3HOXB 3G48A 4A75A 5IT9E 4XXEA 2BDNA 1E1OA 2EYHA 3K7AH 2XRQD 1Q12A 3FMCA 1MJCA 4A93H 3I2ZA 1S5BD 3C2PA 3AMUA 3HOYB 5JVG3 1H95A 4LUOA 4LNQA 5M3MH 4FF4A 3FEWX 1CKMA 3BZCA 1K8GA 1EWIA 1LUZA 2N78A 1E0BA 3CMAA 4DPGA 1CSPA 3UDGA 2E2JH 1SYCA 1PV4A 2O2LD 2HHHL 1YHQA 4NMZA 4YY3Q 5FLXc 4H02A 5DM73 1CQFA 2PZWA 2KCMA 1EEFD 1SMYC 4UDUC 2L9HA 2PQAA 4DR3L 1PHJA 3PGZA 5COYA 4OGQC 1I4XA 4A3GG 1Z47A 4PV1C 4GLVB 1KNAA 3ONAB 3KF8B 4A3KH 3NWSA 3MFYA 2VS1A 4OELB 5C44H 3NWTA 1BCPF 1O7ZA 3GTJB 2RDFA 2MO1A 1S5DD 4GS3A 2L55A 3HOVH 2QA4A 5IGBA 1XPOA 5J1ZA 4J1MA 4L8JA 5IP7G 5IP9G 2PYKA 3RNUA 1LT4D 1YEZA 1H9JA 2B2WA 1GM5A 1DYQA 4QF4A 4CDDC 2F0HA 1XNRL 1EYDA 4ZK9B 1TWFH 1CK1A 2WACA 1Y8PB 1STBA 4A3JB 1GUWA 1HHVA 5D3DA 4LF4Q 4DUYQ 1EIFA 1STEA 2F0VA 3ULJA 4KY5A 3HEJA 1VQCA 3QIAA 1K73C 2TSSA 2EYJA 2UUCQ 1BBUA 2UUAQ 1I5FA 4K5WA 3KF6A 5EPKA 1MBYA 1LTBD 2K5QA 4DUZQ 4DV3Q 1GUGA 4YWKA 3CKIB 1BXTA 1EYGA 2QW7A 4LF8Q 1TWHH 1EOVA 3PO2G 3CCLA 2SOBA 1U4RA 4EQ5A 5A2QE 1OO9B 3CCUA 5M5YB 2NB0A 4K6LA 5EGTA 3Q0AA 3F1ZA 2A1AA 4KKSA 1NBWA 2VQEQ 1GHJA 4ILWA 4DV5Q 2NVYH 3DXJC 3J80c 1KLGD 2EVBA 4K8JA 5IE8A 1KHIA 3EN2A 1ESRA 1HZAA 4F8MA 1I3QH 2XSCA 1U4MA 2EE1A 2VZAA 2DNEA 2VL6A 1RTOA 1Q81C 1TU2B 3D6CA 3S17H 3STBC 3RD4A 4EGVA 2F0IA 4U673 2ID0A 5LMNW 2ZXRA 5C0XH 1TKWB 5FOBB 3NPPA 2N55A 1HZCA 3PUWA 4OX9L 1QUQA 3OTOQ 4JCVE 4IFDJ 5EQ0A 1TQOA 1TS2A 1HCZA 1LYLA 3T1HQ 1H9MA 1E7ZA 4X3TA 1VQGA 1VQLA 3NTKA 3J7YW 4ODGA 4BXXG 1Y8OB 2CQAA 1DJRD 4JBKA 2K7VA 2F1MA 1GHKA 4LFAQ 4KN7C 1IBLQ 1V1PB 1NMGA 5IYCG 1YNJC 4XIGS 1RKNA 4LUVA 1PRTC 5KGUA 2CW0C 5I6WA 1ILQA 1KABA 1C9OA 2C9OA 2G5DA 1TWCH 2ZXPA 1MSGA 4OWWB 1RJTA 1LTRD 4LF7Q 1M90C 2NZ1D 1KDCA 4R4OA 2WIIB 1LLRD 1L1OC 1JR0D 3CCEA 2F4IA 2E2DC 1Q8KA 5BN3A 1EZ6A 3PO3G 1EYCA 1WTPA 1J8IA 2OEOA 2LS01 1GD7A 4C3JB 4KI0A 3NQIA 1L0XB 1SFOH 2E75C 4GKJL 2JA8B 2IY5B 5AJ3Q 4LF4L 4DUYL 2KQ3A 3TRZA 3MXNA 1W6KA 1A6XA 1UEBA 2UUCL 2DY7A 5JJLA 3NQTA 3E5SA 4DUZL 3K0XA 4DV3L 1Q3LA 4DU9A 3BS1A 4LF8L 4AYBG 1X56A 3GQBA 1T5EA 3BDOA 3QR8A 4P74A 3HOUH 2XIWA 3JAME 2Q2TA 3U58A 5ELEA 2F0WA 4DN4M 4A3EH 1E3PA 4NXMQ 4J6HA 4O42A 3T51B 1PH1A 4GOPB 3OWFA 4JI3Q 1UWVA 2DGYA 3GV3A 2WINB 4UP7A 4CDCC 1CHQD 1P8LA 3I91A 3PV0A 1BBWA 5C3XA 3K6OA 4RCNA 1N33Q 1B9NA 1X3QA 1H9RA 3KLWA 1U9RA 3S16H 2LXJA 1V1QA 5J22A 4B3RQ 3MAQA 1L0YB 3TMEA 3OTOL 1NR2A 4IUQA 1DOLA 2MHVA 5IT9L 2O5IC 1WTRA 3PO3B 1D5ZC 3S2DB 3CPFA 3K59A 4ME5A 3I90A 4B9WA 3TEHB 2JK8A 4JI2L 3CC2A 3OW7A 2ATWA 3OPOA 5IOCA 4LFAL 1A15A 4OO1H 3TP8A 3S9WA 4C3IH 2JA6G 1CA5A 2B3GA 4GLAC 5EKKA 4GNXC 5KEEA 1BCPC 5M5WB 1EWCA 4C1NK 1ICWA 4NPSA 1SJHD 1AN8A 3F2UA 4C3HH 4LF5L 4AYBB 4AIMA 3P20A 1JWMD 4ZKBB 1XPUA 5KYLA 1FJGQ 1TS4A 2L1BA 2EYPA 3A7LA 3SXHA 1SYDA 2PMZB 2HIVA 5HGQA 4JI4Q 1EQTA 4RMFA 3D0FA 1PA6A 2LSSA 3CMEA 2SEBD 1JQYD 4IPHA 3GTMH 1TY0A 1YIJA 1X3FA 2MQHA 3KDFB 3SVMA 2PMZE 4IPGA 3A7AB 1Z9FA 4UY8C 3DWAA 4B3ML 2PPBC 1ET9A 1CKOA 1VQ4A 3SK8A 2X69A 3D31A 1UEAB 4DF7A 1WTXA 3GTOB 4X6AH 3L3OC 1SNCA 2A6HC 4L5QA 4DAVA 4DV1L 2XVSA 5C4HA 2BA0A 3OOCA 3A55A 3HOZH 3NBIA 5E4WC 1JC7A 4NXML 3FDTA 1OTCA 4OXPA 2IWHA 1PDQA 2B63H 4JI3L 3CRLC 5ELBA 2VB3X 2OTLA 1JCKB 1PRTB 4CBVA 1FD7D 1WTHA 2BCOA 5FO9B 1I4QA 4BBSH 1PH5A 3S2HB 1FVIA 1PTOD 1A3UA 1WFQA 4KK7A 2Z1CA 1N33L 1TVXA 2PQEA 5JEAG 4KHVA 2JA7H 2DN8A 4XQNA 1T5XD 3X3MA 1Z7TA 2F0FA 1NE3A 3A0JA 1C7YA 4PMCA 2F0PA 1D5MC 2EXZA 5ISRA 4C56C 1IXRA 3VR3A 4B3RL 4L63B 3Q6SA 2K33A 1L1OA 2XN9C 1PYWD 3G4SA 1HFGA 4ZYSA 3STBD 3M4OH 4GLXA 1K3BC 5FO7B 2R7ZG 2BA1A 3NK9A 1PFMA 2CVRA 2MP1A 2ZTCA 1XMQQ 4LFCQ 4O1NA 1QILA 4JV5L 4DR4L 3ZYYX 4E6IA 4RCOA 1LTSD 4KTAA 4FXDA 1A63A 3BDCA 1VQNA 4HSVA 4J8QA 3R8BA 2A8VA 3T1YQ 1WTQA 3KFUA 2EOTA 2B39A 1PH6A 4DAYA 1EY8A 3HOXH 2YYZA 2B29A 5FLMH 1SNMA 2KJXA 4CJ1B 1N32L 2YTYA 4RGNA 3HGBA 4FF3A 2CW0D 2KHIA 3E9IA 4Q0FA 2DUDA 4AQYQ 3HOYH 3OWEB 5D14A 2EY5A 4X66Q 4OONA 4HMIA 2K1BA 3UE1A 2ZM6L 5FLXE 4DNTB 2NVTB 3OMCA 1A3TA 3BVZA 1FGUA 3RMHA 2VUMG 4L5TA 5DLQE 3P1HA 4QIWB 3NTHA 2DJGC 1MIUA 4N8FA 1TIID 5DEHA 4ME3A 1DONA 2RVLA 1SNQA 3AYHB 3D3RA 3GV6A 4ZUIA 2R93G 3OW2A 1F9RA 4QIWE 2VQFL 2JP1A 1DCZA 3T16A 3AFQA 4PZ7A 2H1EA 1RIPA 3N52A 1XMOL 2EDGA 3GTJH 1S72A 1Q46A 1MKHA 1G6PA 2F0OA 4IFDH 3DEPA 2A73B 4LF6Q 1CFMA 5H1SE 2JN4A 3S14B 1JJGA 4BA2I 2R3ZA 1DM0B 1HUMA 5IODA 2RHSB 3L7ZC 2QDLA 2AQ3B 1ENCA 1F9QA 2RCNA 3RLOA 4JPBW 4QQBX 4HR7B 2C35B 4GNXA 3J7A5 5T1IA 3H15A 1VQBA 3P75A 4NDXA 4LFBL 2K6AA 4A3JH 4RGMA 2KA7A 2MJ8A 4G7ZC 4UHVA 2WKDA 4PG3A 1SJED 5BN5A 4HTHA 3CPWA 1QVCA 2F3VA 2ICEC 1B44D 4DV2Q 1PH4A 3T53B 4A3BG 1EY0A 4FF2A 2MUYA 1Z6HA 2OQKA 4DV0L 2EYOA 1EY5A 2VW9A 1ZXTA 2F0JA 3BJUA 2A68C 3HG9A 4OWXB 3J80E 4A3LG 1PRTF 3RLFA 5M5YH 4QGUA 1Y69U 3TS2A 1HXYD 3U9OA 4CDEC 1P16A 1D7QA 4GN3B 1OXXK 2QF7A 3K5LA 5JEAJ 3T1YL 2PW7A 2CKZB 1WYDA 1Q1EA 4AH6A 4P73A 3W1BA 5KNBA 2K32A 3NENA 5C3WA 2QGQA 3TQYA 3I4NB 2B8FA 4DV4Q 4I7AA 3Q8DA 3VA5A 4H0LC 2CWPA 1YNXA 4RFBA 4ABNA 2ZTEA 3I4MB 1RD9D 4R9WA 2Q2HA 2E5LL 1YNNC 1BCPD 4AQYL 3GO5A 4BY1B 3KJOA 3W2DA 1W3SA 2UUBL 4YCUA 3QG1A 1Q8IA 1FNWA 4PZ8A 3NTIA 5IP7H 4MZ9A 1X32A 1ZYRC 1I6HB 1IKLA 4C2MB 4DK0A 2B8GA 3BG3A 4DGZA 4DR5Q 3ERSX 2F0UA 4PNYA 1LTAD 4JI0Q 2R92G 1O78A 3M3YB 1K8OA 3TZDA 2AQ2B 2F3WA 1PH7A 5FO8B 1IW7C 4JBJA 2HUGA 4DR2L 4YCVA 1KD1C 1HNWQ 3F2CA 2ZXOA 1G2TA 3F2BA 1H9SB 1FYCA 1F2MA 1CKNB 1LT6D 2BH2A 1QJOA 3FKIG 1VQPA 1HNZL 1S5CD 3QOJA 4A3BB 4PMBA 5TSSA 1JE4A 2J0TD 1EFWA 2CFMA 5BR8L 1AFPA 1SE8A 3BZDB 5GAGC 2KEDA 3UDFA 1IKMA 3CXCA 1K83B 4FXKC 1YJNA 2BE5C 1SYFA 1O7IA 1K8AC 1D1IA 1I94L 1Q7YC 1JOQA 2X6GA 1IHZA 1I50B 2NZHA 2F4VL 1NCVA 3VDYA 2RHQB 1V1OA 5CV4A 5M3FB 4IQZA 1QNUA 3K80C 4C3JH 1A2TA 5KRUA 4POGA 3H3VH 4X65L 2JA8H 5DM63 2NVXB 2KHSA 3C46A 1JOKA 1YBYA 2LY7A 5M9OA 3EROA 5C6AA 5C3EB 1X3PA 2KENA 3KK7A 4GOPC 4A3MG 2UXCQ 4POFA 4YIJA 4DFAA 2XWJB 2NTSA 3L9AX 3S24A 2F0KA 2NUCA 2K5VA 1TWGB 1WCMG 5K36H 2N49A 5T1GA 4JOIC 3KF8A 4JYAQ 1GJXA 2ZTDA 4A3DG 4DR6Q 1UNSA 3PUVA 1ENFA 3VA7A 5CBAE 5JAVA 4BXXH 2WV6D 2KCCA 3S15B 1UE1A 1A0IA 2R92B 2VY3A 3FPPA 5CORA 1IBKQ 1GUSA 3TP7A 4LF9Q 1QB5D 4DR1Q 5K5PA 4K14A 2EYLA 2FHTA 4F87A 4K0KQ 4Y52H 2WAQG 1I4GA 2BH8A 2HD3A 2AWNA 1E24A 1ASYA 1CZGA 2Z6BA 3F2DA 3FKIB 1OXVA 4GZYC 5HURA 1HR0L 5LL6S 3BZKA 1KDBA 2NVQB 4IUPA 1SR3A 2A5HA 3PIP3 4RG1A 3NSWA 1DGSA 4LJZC 4JK1C 1ICFB 3PO3H 2NZOA 3CCSA 3S2DH 1X65A 4JI0L 3GTLB 1II3A 2F0TA 5ELOA 3N6RA 3E0EA 1VQOA 1B3QA 5FLXL 2IW3A 1KRTA 3H6MA 1HNWL 4LK1C 3NBHB 5M5WH 4A3MB 4YWLA 3TN2A 4X3SA 4CKEA 1QCBD 1Y8NB 2N88A 4A3GB 3A8KE 3MA2B 1WCMB 2AQ1B 4A93G 5LHY1 4X3KA 5M3MG 4A3DB 3M4QA 4XTCS 2E74C 1WI5A 4HSPA 2XRSD 4HJ7A 5ELFA 4YY3L 2B2VC 3J7AF 3I56A 3S1QB 3S1MB 1AW7A 1NUCA 3U4ZA 1B1ZA 3RN5A 5DAUA 3HKZG 5IGEA 4WJWA 2A19A 4XT3B 5CBEE 2JEBI 3JAMi 1K28A 2IT1A 2HCIA 2K01A 1BOSA 2WFWA 4HCEA 2K5WA 1A62A 4IPDA 1AP0A 2Z8LA 3GTOH 1V1PA 4A3KG 3CCJA 5G3LF 2WB1G 2UXBQ 3M9BA 2G9DA 4FNFA 3KBGA 4JYAL 1U0LA 1NSNS 1C8CA 1GVPA 3WOFA 4M8AA 2NN6H 3K81C 3WDNA 3PO2B 2EYFA 4FDBA 3GTQB 4MN3A 4X62Q 3C1FA 1PVOA 1YJ9A 1XXGA 2AUJD 1N34Q 5JJZA 4LF9L 3AEVA 3S2HH 1UE7A 1CSQA 2A68D 3J80L 3WOEA 3DMUA 3MTSA 1HA6A 1MI2A 5IWAQ 1AZPA 3CU7A 2OXPA 3MEFA 1HA5A 4IJHA 3F8TA 5C5MA 4CKCA 2ZJQA 1B53A 5E7NA 5CR3A 5CV9A 4CHTB 4P2CB 1VQHA 2UUAL 1NNXA 2FMCA 5CV5A 2CH4A 2PI2E 2V1CC 4HJ5A 1S5ED 4ID6A 1PZJD 3ER0A 3OIQA 1JICA 1LO5D 2OT2A 2RDHA 3Q23A 4DKAC 1D6EC 4H7BA 4NXNQ 2GVBA 1CI3M 3I70A 2JQOA 4A3CH 3EBEA 5CGKA 1GO3E 2KEEA 3CHBD 2VQEL 1AEXA 2HCCA 3K7UC 2Z6KC 4DV5L 4FO2A 4KKTA 3LNNA 3HKZB 4GOPA 4OIJA 1SE4A 3CC4A 2O4XA 3I8ZA 1E1TA 1JWUD 1L0WA 4RGTA 2LKVA 4JOIA 2RSOA 5CV7A 1PZKD 1PYSB 2NBFA 2QDBA 4TQUS 4F7XA 2UU9Q 1L2FA 1WJJA 3BYYB 4FYDA 4HIKA 2OCEA 3ITPA 2D9UA 2E2HB 3G6EA 3T1HL 3S1NB 2NVTH 3URYA 1D8LA 3SK6A 1BBXC 2JA9A 2F03A 1EQVA 4XYOA 4IUTA 2KECA 4DAPA 5I2XA 4BWGB 4UAIA 1UAPA 1IBLL 2AWOA 3S1RB 2R6GA 1YVCA 4JI8Q 1EU4A 3ULPA 1SEBD 1SN8A 3NELA 4JI6Q 4JVZA 1PH2A 4Q5VA 1SMYD 1KLUD 2P5ZX 2RKSA 2D0PA 3Q22A 3HP3A 4A3FG 1J5EQ 4R8IA 4LF7L 4EX5A 1O80A 1BUVT 1IYJB 3U4VA 4X62L 3S14H 1EWHA 3B6YA 3PUXA 3RUZA 3C3LA 2VB2X 2NVYB 3GTKB 1N34L 4KY7A 2D62A 5IY0A 3GDEA 3HFZB 3AB9A 3I72A 2E2IB 4AYBE 3MHBA 1UE5A 1U4PA 2I5HA 2SDFA 4BY7G 3A54A 1SROA 4HEDA 1EFID 1PTOB 2M00A 3G7LA 5AJ3L 1QE6A 1Y1WG 1IL2A 3I4LA 1HR0W 2ENBA 3FP9A 5EJWA 1TXYA 3KDFA 4LAAA 4WORA 4NW2A 4A3IG 4BBRG 1WVLA 3BVMA 1PFNA 2F0SA 5LMUQ 3HOUG 2K5HA 3DWPA 3SK5A 1SYBA 1TR5A 1K3RA 3D4RA 4KJOA 4CDFC 4RWSC 4A3EG 1KAAA 3I7FA 1BO0A 3W1GA 3TS0A 3H0GG 1VQ5A 2B2VA 3OMGA 2FMMA 4KJNA 1SBBB 3PUYA 2MO0A 2B2YC 3HOWG 4DK1A 5IGFA 3K5MA 2R61A 5A2QL 1ASZA 4S3SA 2JA6B 3I4NH 2CCZA 3I73A 4DV6Q 4XYQA 4ZLTF 1EY7A 3PIO3 1DD2A 3VYTA 3I4MH 4EQOA 3DM3A 2SNSA 3CCRA 2JA5G 3W5OA 4BY1H 3PF4A 3ND8A 5LMNQ 3MVVA 4A3FB 3SE0A 3ND9A 4B9XA 2UU9L 4JW0A 1A2UA 1EY4A 3G71A 2EXDA 2Y0SG 3P7JA 1I6HH 4C2MH 3DM1A 5JPNC 1DOKA 1KRSA 4TRDA 1EEID 5IYDG 3KJPA 3M3YH 4I65A 4BY7B 4TKOB 3KOJA 4OO1G 2EJFC 2YV5A 4IN3A 1Y1WB 4P72A 4ZCKA 2OTJA 2ZT9C 4YWMA 2N3SA 1RL2A 4A3IB 4O0AA 4A3BH 4BBRB 4IUVA 4JI6L 1STGA 3PIPA 3VYRA 2IPKD 3K8AA 1EIHA 2F0MA 2YU9B 1IL8A 1YNJD 1STNA 1K83H 3L2PA 1J5EL 1QNKA 4A3EB 1FJGL 2J7ZA 1PRTD 3CW2C 4DNRB 2F52A 3H0GB 4FXGC 4GKKQ 2Z6KA 1I50H 3EA6A 1HPCA 4JI4L 1FNVA 3R2TA 1XYIA 1TY2A 1GUNA 4DA2A 5M3FH 1R9TB 4JI7Q 1KIXA 2AKWB 3HOWB 2ALYB 3EJIA 3IFTA 1YHBA 3EIVA 1E22A 3FHWA 2CWAA 1Y1VG 1IBMQ 5E1FA 2NVXH 5GROA 5D65A 1MSHA 4KLKA 1N9WA 4RHSA 2K28A 5C3EH 4WJ4A 1X55A 3VR6A 2JA5B 3J80i 1Q90A 3NEMA 5CV6A 5LMUL 2QEJC 2AHOB 5CYUA 3ULLA 2RF4A 1G51A 1CQVA 1T9HA 2Y0SB 4QJFA 2EJMA 2JXMB 1DOMA 1FL0A 1FGBD 4R4IA 4L5SA 2XTIA 1VF5C 2R7ZB 1VCIA 3S15H 1UE6A 3QJYA 1UUPA 4DXFA 2R92H 2WP8J 2DY8A 2F0GA 4BBSG 3JAML 2B2WC 2KVMA 3R93A 2Y0SE 1C4QA 3MWYW 1B50A 3TDQA 4LWCA 3CAMA 1VQ8A 3W3AA 3FKIH 3BU2A 1D1KA 2OWOA 3KUPA 3BYTB 2XGTA 3RR5A 1K0RA 4IUNA 5LMNL 4ZUJA 1AZQA 4APVA 2NVQH 2N8NA 5IYBG 2VXWA 5AFWA 1SDFA 5NUCA 5C5LA 2GVAA 3H09A 1BQQT 3QWNA 3KLRA 3M4PA 3UI2A 3J7AV 1K0SA 1CTMA 4YCWA 3GTLH 5FJ8G 1XMQL 4LFCL 1TS3A 1Q1BA 3K5OA 2HHHQ 3EQLC 3GTGB 1GOZA 1LTLA 3SDZA 1HQMC 1Y1VB 4CJ2C 3A56A 3J81j 2VUMB 2QEXA 4B3TQ 4JI1Q 2NYZD 2A69C 4DR3Q 4WJ3M 1LV9A 4OO1I 3J81c 4A3MH 2XNAC 4RKLA 5M5XB 2PCFB 2R93B 4A3GH 2F3IA 5I2YA 4HIDA 4RH6A 1VQIA 1WCMH 1I4HA 4V190 3GTPB 5JJKA 1VDZA 2OQ0A 1NMFA 2ICIA 4A3DH 2JEAI 4GN5A 4A76A 1O7YA 1TWAB 2B2YA 1JB3A 1EQRA 4X66L 3FRPB 5IP9H 2BOSA 1XNRQ 4DK3C 1OXSC 4BS9A 5C4XG 2FJ2A 1X9NA 1IBML 4K5XA 5C4JB 1J9OA 3S1QH 3S1MH 2EY6A 2DNCA 5EPLA 3TP5A 1A8VA 3E6ZX 1I4RA 1LM0A 1U5KA 3E3XA 2K14A 4QUCA 1D5XC 3KBXA 1PH8A 4K2KA 1WTOA 3RZDB 1XPRA 5EAYA 3UDIA 1KXLA 1MJEA 4DR7Q 4IALA 1HRJA 4L5RC 2PNHA 1XJVA 2C5CA 1H9SA 1FNUA 1CKNA 3AFPA 3SEBA 3LGJA 3PO2H 3H94A 3GTQH 4LF6L 2BDOA 3E9HA 1F9SA 1KDAA 5DNFA 2CHBD 2A6HD 5EKIA 1EQQA 2L15A 4NP5A 2FXQA 1HQRD 1ONLA 4XQJA 1KL9A 2HQEA 2L5TA 3CC7A 2UXDQ 3CCVA 5J3BA 1VQMA 1JOOA 2F0LA 3CQZB 3CRKC 4DV2L 3DWQA 1X54A 1F2LA 4OX9Q 1S4ZA 2L0CA 1CM9A 1LTTD 2K50A 1Q82C 5EBDA 1F2ZA 4KV6A 4MTKA 4DV7Q 5EBCA 5GADC 4N9TA 5C4XB 1YJWA 2PO4A 3R2IA 3VYUA 2PQAB 5JJIA 4G57A 2NTTA 3U50C 1EL0A 5I9OA 1GXDC 2RCFA 4B3TL 4JI1L 1BVSA 4RHRA 5A35A 3HZXA 1AH9A 1B9MA 2EPBA 3GD7A 3CCMA 5IYCH 1VQ9A 1ESFA 1M4VA 5E3FA 3A5UA 2EZVA 1VQFA 1N36Q 4DV4L 3RZOB 5G3LD 1V43A 1JWSD 4R1JA 3QO2A 2IX0A 1QWYA 3ZJYC 3NUCA 2MPMA 1MD2D 1LT3D 1PYBA 1W6JA 4OWTB 2E2HH 1SSOA 1B8AA 3S1NH 1B2TA 2WKCA 4DR5L 2IL8A 3G6JB 2D5DA 4GKJQ 3V05A 3VR4A 1LT5D 4N9PA 2D2CC 3FVQA 3OSOA 1RTNA 1E2WA 1G291 5HGTA 1KQSA 2I0QA 3OYYA 5JVH3 3PIOA 3KF6B 1VQ7A 1YZ6A 1SYGA 1M8AA 2RA4A 3S1RH 1C48A 2GN5A 3NP8A 4JI5Q 4DR7L 1B4OA 4IURA 4PQXA 4Y7NB 3NBHA 3X3NA 4N8X1 3K58A 2HQLA 3MFGA 5F2DA 1PTOC 1PH9A 1PH3A 3KLSA 2JSOA 4O2DA 4B08A 4ULLA 3GTKH 4IFDI 1TT2A 1N8RC 1VQDA 3IRBA 2CH4W 4C3JG 4FF1A 2E2IH 2JA8G 2D0OA 2J4XA 4IO9A 4EQPA 3TSSA 3T13A 2UXDL 1PTOH 5I6YA 3V96A 1E2VA 1JMCA 2WAQB 1SNOA 1JJCB 1EYAA 5KYIA 1QUQB 1LTGD 1VS0A 2PNRC 2UXCL 3KYHC 5K36G 2K5DA 1B70B 4HCSA 2WAQE 5BN4A 1EU3A 5C44G 4XQQA 4DV7L 1KAWA 3HOVG 2ZJRA 4JI2Q 4DR6L 3PMFA 3MZ5A 4EVOA 2M9VA 4IOCA 2KCTA 1IBKL 1LACA 1U4LA 4QY7A 4X64Q 2ASBA 1VQ6A 4DR1L 1AE3A 2JA6H 1WOCA 2MGSA 4K0KL 1N36L 4KN4C 1PLFA 2Q2IA 1K9MC 1R4PB 4CJ0B 5ELNA 2A69D 1WD0A 4LF5Q 2ES2A 2PI2A 2F0NA 5IGDA 4A3FH 3K7AB 2I46A 1X6OA 1EUJA 1EZ8A 4JC0A 5IT9c 3Q24A 4A93B 2V4DA 1CA6A 3TBIB 1SE3A 4KD4A 5M3MB 1STYA 2K4KA 1YNND 3IL8A 3M85A 1PMRA 1Y14B 4P75A 4ZRZA 2L11A 3MXNB 4KY6A 4ALPA 4BY7H 1VQAA 2E2JB 4HMJA 2KUMA 4LW1A 1Y1WH 1XX8A 2IJ0A 1YI2A 1SRUA 1ZYRD 1RCVD 1EY6A 2Q8RE 3PUZA 1HNXQ 4B3MQ 4GN4B 1KNEA 5EKLA 2I5LX 4JG2A 4A3IH 1GKHA 4JI5L 4BBRH 4CGYB 1JE5A 3BDLA 5GQOA 4J15A 3HS0C 3LWUA 3KLSX 2A74C 4DV1Q 2H4OA 2KBNA 3R3OA 4TVAB 4A3KB 2YU9H 1O7LA 1IW7D 2HT1A 5C0XG 2WB1B 2E8GA 5C44B 4QCLA 2G9HD 3HKZE 4R4CA 1EIYB 2PZTA 3H0GH 3HOVB 3JC66 1R9TH 1C0AA 2YTXA 1SMXA 2LXKA 3HOWH 3DHQA 1J6QA 4IJLA 3SR1A 1XTCD 1S40A 1EOTA 2WB1E 3TZUA 1WTVA 2EY1A 1TWFB 4G7HC 2F0EA 2BE5D 1X3GA 3H3VI 4HJ9A 4XT1B 2QCPX 5JEAH 2QKIC 4K8IA 1B7YB 2SNMA 2Z4HA 3D4WA 1STAA 4RAUC 3DEOA 1Q86C 4HN7A 2JA5H 1VQJA 1KC8C 1X3EA 1PXUA 4L6TB 1V8QA 3J81i 1MGSA 1RDPD 4K2LA 2UXBL 1WD1A 1NTGA 1QVFA 1TWHB 3NXWA 2B2TC 4BA1I 2NN6G 1PFBA 5IYDH 2EQSA 2LFNA 4G4KA 2EIFA 3TREA 2R7ZH 4DR4Q 1F9PA 1G8ZD 4JV5Q 1QG7A 2HDMA 2K05A 2DJFC 3A8JE 4X64L 4UPAA 5HY6A 1HFNA 4FVMA 3SK4A 1AE2A 3MXPA 3I4OA 1I3QB 1VQEA 3T4AC 2M2LA 1YITA 2A6EC 4EQNA 4UP8A 5IWAL 4R4TA 4XDXA 1HZBA 4OEMB 3S17B 3HRZC 1N32Q 2K75A 4M1UB 4QL5A 3UE0A 1I4PA 1D2BA 4RGOS 3UDXA 3NE5B 2LMCB 1PZID 4LMQD 5ELCA 2ZM6Q 1G2SA 1ILPA 4NXNL 4A3CG 2MFIA 5EPJA 5D3IB 1RHPA 1JB7A 1R4QB 3GTGH 5CV8A 1ZKOA 2KCNA 1Y1VH 3MXUA 1IYUA 4G7OC 3MXGA 1E2ZA 1BNZA 2VUMH 4IPCA 3K57A 1SXTA 3J81E 2OF1A 4X3UA 3U9SA 1HNXL 1JORA 1QZHA 5FK9C 4JBWA 2B2UC 1XWEA 1NJIC 1S5FD 4KMUC 1M1KC 5M5XH 2R93H 4HAEA 2VQFQ 2AUKA 3NHHA 3V2TA 1TWCB 1SNPA 2Q8TA 4MNOA 3FPUB 4U68A 1XMOQ 2KOLA 3VR2A 3AU7A 3SGIA 2QILA 3GTPH 1I6VC 3MC0B 1K8MA 5KIXA 1BF4A 1WTWA 4KKUA 1F77A 1TWAH 1XTDA 3C1EA 2RSNA 3GP7A 5C0XI 3BVGA 2IX3A 2RQXA 4YHHQ 3ICEA 1G91A 1CZWA 5JOBA 1SE2A 5KNCA 4OHJA 4MHEA 4LFBQ 5C4JH 4QUFA 1SFOB 5KNDA 2JJQA 1STHA 4QB4A 3M4YA 4ZQ3A 4K6DA 1ML0D 1F2YA 2XWBB 2YTVA 4C3IG 2PZUA 1L1OB 4LUZA 1BR9A 2HIXA 3RZDH 3PCOB 1QOHA 3QOLA 3D8GA 1HJPA 4B3SQ 4JI8L 3EFXD 4DV0Q 4C3HG 5IYBH 4DNIA 5C0XJ 2TMPA 1LTID 5J39A 1IYVA 3HOUB 4Z9CB 1QVGA 1H9KA 5CC4A 3QB3A 5FJ8H 5CMDA 4CKBA 2F0QA 3JAMc 4WRDA 1HTLD 2IHEA 1OXUA 2AMCB 4A3LH 1ET6A 3A5ZB 3I3CA 4IUUA 4HJAA 2NN6I 3H91A 4F88A 2X6LA 1CUKA 3M7NA 3VR5A 4DAYB 5I4DA 1YHAA 4HIMA 2KHJA 2Z4IA 2FINB 4RA8A 3K5NA 2MNAA 4OL7A
chains in the Genus database with same CATH topology
1WI5A 3AFPA 3CQZH 4HJ7A 4C3IH 1W2BA 2E5LQ 2JA6G 1XNQQ 2B3GA 4GLAC 3LGJA 4GNXC 2CQOA 3PO2H 2UUBQ 1NY4A 3GTQH 4LF6L 4NPSA 4YY3L 2Q2UA 3E9HA 3I56A 3DLLA 4C3HH 3U4ZA 4KHPQ 1TWGH 3RN5A 3HKZG 4R4QA 1EQQA 2L15A 4LF5L 2A19A 2FXQA 3HOZG 3JAMi 4AIMA 2JEBI 3HKSA 2IT1A 4P71A 1XPUA 4A3DH 1FJGQ 2JE6I 2WFWA 5C4XH 1KL9A 1A62A 4IPDA 3CC7A 3GTOH 2UXDQ 4A3KG 2B63G 3CCVA 3CCJA 1OXTA 5J3BA 5GAEC 2I5MX 2HIVA 2WB1G 5HGQA 4JI4Q 2R7FA 1VQMA 4RMFA 2UXBQ 1HZ9A 3D0FA 3M9BA 4DR2Q 1PA6A 2LSSA 1U0LA 3CMEA 4DV2L 3I4NG 4JYAL 1X54A 1GVPA 4IPHA 3GTMH 2JA7G 1YIJA 1X3FA 2MQHA 3K81C 3KDFB 1HNZQ 4FDBA 4OX9Q 1JT8A 2PMZE 4X62Q 3RZOH 3I4MG 4IPGA 4DV6L 1YJ9A 3CF5A 1PVOA 2K50A 1Z9FA 1N34Q 1Q82C 5BR8Q 4UY8C 4LF9L 3AEVA 4BY1G 3S2HH 1UE7A 2H5XA 3RLNA 4B3ML 1CSQA 1CKOA 4DV7Q 5GADC 1VQ4A 1IZ6A 2K5NA 3D31A 1YJWA 1I94Q 5JJIA 2PQAB 3U50C 4GNXB 5IWAQ 4YHHL 4X6AH 4B3TL 2F4VQ 4JI1L 1BVSA 3MEFA 4L5QA 4DV1L 4IJHA 3F8TA 2BA0A 3HOZH 2ZJQA 5E7NA 1AH9A 4X65Q 3GD7A 1JJ2A 3CCMA 1VQHA 4NXML 2UUAL 5IYCH 1VQ9A 2IX1A 1OTCA 4OXPA 2PI2E 1V9PA 1VQFA 2V1CC 3A5UA 4HJ5A 4DV4L 1N36Q 2B63H 4JI3L 3ER0A 1V43A 3AQQA 1PFSA 2OTLA 4HJ8A 4DKAC 4NXNQ 1PH5A 4BBSH 2GVBA 2ZJPA 1FVIA 4JBMA 1WFQA 4B3SL 1N33L 2JQOA 4R1JA 5JEAG 4Y7NH 4A3CH 3EBEA 3CP0A 1GO3E 2JA7H 4DK6C 3HOXG 2VQEL 2IX0A 3ZJYC 4IOAA 3K7UC 2Z6KC 4DV5L 5FLMG 3I55A 1NE3A 1PYBA 4OWTB 2E2HH 3A0JA 1B8AA 3WWVA 1C7YA 3S1NH 5GAHC 4DR5L 4GOPA 2VNUD 1IXRA 4GKJQ 4B3RL 4UP9A 3HOYG 4A4IA 1VQ6A 3CC4A 1L1OA 2R7DA 1QZGA 1E1TA 5M3FG 4GKKL 1G291 1KQSA 3G4SA 2I0QA 3STBD 3OYYA 4JI7L 3M4OH 3PIOA 3KF6B 1L0WA 4GLXA 1VQ7A 1YZ6A 4JOIA 2R7ZG 2BA1A 2ZTCA 3S1RH 1XMQQ 3PF5A 4LFCQ 1PYSB 2GN5A 4JV5L 4DR4L 4TQUS 4JI5Q 4DR7L 5C3EG 2UU9Q 1L2FA 2Z0SA 1WJJA 1A63A 2IHFA 1VQNA 4KHZA 4HIKA 1HR0Q 2OCEA 3CCQA 1XNQL 3G6EA 3T1HL 3L0OA 2HQLA 2NVTH 1PH9A 2A8VA 1D8LA 3J7ZC 1HH2P 3T1YQ 1PH3A 3KFUA 2JA9A 4MTNA 4O2DA 1PH6A 3GTKH 4IFDI 1N8RC 4KHPL 3HOXH 1VQDA 3IRBA 2YYZA 2B29A 5FLMH 2E2IH 2JA8G 1N32L 2YTYA 1S3OA 1IBLL 2D0OA 4PZ6A 4IO9A 2AWOA 4IFDG 2K52A 2R6GA 1SLJA 2KHIA 1YVCA 3E9IA 4AQYQ 2DUDA 4JI8Q 3HOYH 2UXDL 3ULPA 1SN8A 1VQKA 1JMCA 3NELA 4JI6Q 4X66Q 4OONA 1PH2A 4NB3A 3UE1A 2ZM6L 2D0PA 1JJCB 4A3FG 3CD6A 4A3JG 1QUQB 1BKBA 4DAMA 3A74A 1J5EQ 4LF7L 4EX5A 2VUMG 1VS0A 1FGUA 1IYJB 4PMWA 3U4VA 3PSIA 4L5TA 4X62L 3B6YA 3PUXA 5DLQE 3S14H 3KYHC 2UXCL 5K36G 3RN2A 4HIOA 1MIUA 1B70B 1N34L 2WAQE 2D62A 5IY0A 5C44G 3GDEA 3G48A 3HFZB 4A75A 4DV7L 1KAWA 4AYBE 1E1OA 2I5HA 1UE5A 3K7AH 4ME3A 4BY7G 3HOVG 1Q12A 1SROA 3AYHB 2R93G 3OW2A 2ZJRA 4JI2Q 1MJCA 4A93H 3I2ZA 4DR6L 5AJ3L 4QIWE 1Y1WG 1IL2A 1H95A 4LUOA 2VQFL 1HR0W 4LNQA 3FP9A 4IOCA 5M3MH 1CKMA 2KCTA 3AFQA 3BZCA 4PZ7A 1IBKL 1RIPA 1TXYA 3KDFA 1XMOL 1K8GA 1EWIA 3GTJH 4QY7A 1S72A 1LUZA 2N78A 4X64Q 1Q46A 3CMAA 2ASBA 4DPGA 1CSPA 3UDGA 4DR1L 1AE3A 1MKHA 4A3IG 4BBRG 2E2JH 2JA6H 1G6PA 1WOCA 1PV4A 4K0KL 1N36L 2HHHL 1YHQA 4LF6Q 5H1SE 4YY3Q 1JJGA 2Q2IA 4H02A 5FLXc 5LMUQ 1K9MC 2K5HA 3HOUG 2KCMA 4BA2I 2RHSB 3L7ZC 5ELNA 4LF5Q 1K3RA 2ES2A 2RCNA 2PQAA 2PI2A 3RLOA 4DR3L 4A3EG 1PHJA 4QQBX 3I7FA 2C35B 3PGZA 4GNXA 3J7A5 3H15A 1VQBA 4A3FH 3W1GA 1X6OA 1EUJA 3H0GG 3TS0A 4A3JH 1VQ5A 4LFBL 4JC0A 4A3GG 5IT9c 1Z47A 4GLVB 4PG3A 3PUYA 2MO0A 3KF8B 4A3KH 3HOWG 3CPWA 1QVCA 2VS1A 5C44H 2K4KA 4DV2Q 1PH4A 3M85A 2MO1A 1ASZA 1Y14B 4P75A 4BY7H 3MXNB 4GS3A 4ALPA 3HOVH 4A3BG 1VQAA 2QA4A 3I4NH 2CCZA 1XPOA 2OQKA 5IP7G 4DV6Q 5IP9G 4DV0L 3RNUA 4LW1A 1Y1WH 1YEZA 1YI2A 2VW9A 3I4MH 1SRUA 1GM5A 1HNXQ 3PUZA 3DM3A 4B3MQ 1XNRL 3CCRA 2JA5G 4GN4B 1TWFH 3BJUA 3W5OA 4BY1H 2I5LX 4JG2A 4OWXB 3PF4A 5LMNQ 4A3LG 3RLFA 5M5YH 4A3IH 1GKHA 4JI5L 4QGUA 4BBRH 1D7QA 3TS2A 1JE5A 2UU9L 5GQOA 4J15A 4LF4Q 1P16A 1EIFA 3ULJA 3G71A 2EXDA 2Y0SG 4GN3B 1OXXK 4DUYQ 1VQCA 2KBNA 4TVAB 4C2MH 4DV1Q 1I6HH 2YU9H 1K73C 2HT1A 1KRSA 5C0XG 5JEAJ 2E8GA 3T1YL 5IYDG 3KJPA 2UUCQ 1BBUA 3HKZE 2CKZB 1WYDA 1Q1EA 4R4CA 1I5FA 4P73A 3KF6A 3W1BA 4AH6A 3NENA 1EIYB 4DUZQ 3H0GH 3M3YH 2QGQA 3TQYA 4DV3Q 5IYDH 4DV4Q 3JC66 3Q8DA 4YWKA 2CWPA 3KOJA 1R9TH 1EYGA 4OO1G 2YV5A 1YNXA 1C0AA 2YTXA 1SMXA 4LF8Q 4P72A 1TWHH 2LXKA 3HOWH 1J6QA 4IJLA 2ZTEA 1S40A 2WB1E 2OTJA 1EOVA 2Q2HA 2E5LL 2UUAQ 3CCLA 3PO2G 4YWMA 4EQ5A 4AQYL 3GO5A 2N3SA 3KJOA 1W3SA 1RL2A 3CCUA 4O0AA 4YCUA 1X3GA 2UUBL 4A3BH 3H3VI 4PZ8A 3F1ZA 4HJ9A 4JI6L 2A1AA 2VQEQ 1NBWA 3PIPA 5IP7H 4DV5Q 2NVYH 3J80c 1B7YB 4MZ9A 3K8AA 5IE8A 1KHIA 4DR5Q 3EN2A 1K83H 3L2PA 3ERSX 1HZAA 1Q86C 1J5EL 1VQJA 2JA5H 1FJGL 1I3QH 4JI0Q 1KC8C 1X3EA 2R92G 3CW2C 2F52A 4GKKQ 2VZAA 1I50H 2VL6A 2Z6KA 3J81i 1Q81C 4JI4L 1PH7A 4JI7Q 3S17H 5M3FH 2UXBL 1KIXA 1NTGA 3STBC 4JBJA 1QVFA 4DR2L 2AKWB 2ALYB 4YCVA 1YHBA 2ID0A 3EIVA 2NN6G 4BA1I 1E22A 3F2CA 5LMNW 1KD1C 1HNWQ 2EQSA 3TREA 2CWAA 2EIFA 3FHWA 3F2BA 1HZCA 2R7ZH 1Y1VG 4DR4Q 1CKNB 1IBMQ 2NVXH 5GROA 2BH2A 3FKIG 1VQPA 3PUWA 1HNZL 4OX9L 1QUQA 3OTOQ 4JCVE 4KLKA 1N9WA 4IFDJ 1EFWA 2CFMA 5C3EH 5BR8L 4WJ4A 1LYLA 1X55A 1SE8A 4X64L 3T1HQ 4UPAA 5HY6A 5GAGC 3UDFA 1E7ZA 1VQGA 3CXCA 1AE2A 3I4OA 3J80i 1YJNA 1VQLA 4BXXG 1VQEA 1O7IA 3NEMA 5LMUL 1YITA 1K8AC 1I94L 1Q7YC 2AHOB 4JV5Q 4JBKA 4UP8A 2NZHA 5IWAL 4R4TA 2F4VL 1HZBA 3ULLA 2RF4A 1G51A 3VDYA 2RHQB 4LFAQ 1N32Q 3K80C 1T9HA 4C3JH 2K75A 1NMGA 4QJFA 5IYCG 4XIGS 1IBLQ 4POGA 1FL0A 4QL5A 4R4IA 4X65L 4L5SA 3UE0A 2XTIA 2JA8H 4LUVA 3H3VH 1VCIA 2MNAA 3S15H 1UE6A 1C9OA 2R92H 3UDXA 1TWCH 2WP8J 4BBSG 1YBYA 2ZM6Q 2Y0SE 4OWWB 4NXNL 4A3CG 2MFIA 2KENA 4GOPC 4LWCA 4A3MG 1M90C 3CAMA 1JB7A 4LF7Q 4R4OA 3GTGH 1VQ8A 1Y1VH 2UXCQ 4POFA 1L1OC 3S24A 3FKIH 3CCEA 2VUMH 3BU2A 1Q8KA 4IPCA 2K5VA 1WCMG 1HNXL 2OWOA 3PO3G 2XGTA 2N49A 3RR5A 1GD7A 1K0RA 1QZHA 4JOIC 4KI0A 5LMNL 4JBWA 1SFOH 4JYAQ 4GKJL 2ZTDA 4APVA 4DR6Q 4A3DG 2NVQH 2IY5B 3PUVA 1NJIC 2N8NA 5IYBG 5AJ3Q 5M5XH 1M1KC 4LF4L 4BXXH 2R93H 2VQFQ 4DUYL 1UE1A 1A0IA 2GVAA 2VY3A 3TRZA 3M4PA 1IBKQ 4MNOA 1XMOQ 4LF9Q 1UEBA 2UUCL 4YCWA 3SGIA 3GTPH 3GTLH 5JJLA 5FJ8G 4DR1Q 1XMQL 4DUZL 4LFCL 3K0XA 1Q1BA 4K0KQ 4DV3L 4Y52H 2WAQG 2HHHQ 2BH8A 1TWAH 1LTLA 1XTDA 2AWNA 1E24A 5C0XI 1ASYA 3F2DA 4LF8L 3J81j 4AYBG 1OXVA 1X56A 4YHHQ 2QEXA 3ICEA 4P74A 1HR0L 4B3TQ 4JI1Q 3HOUH 4DR3Q 2Q2TA 4WJ3M 3U58A 4OO1I 3BZKA 3J81c 4A3EH 4LFBQ 5C4JH 1E3PA 4NXMQ 4A3MH 2JJQA 1SR3A 1PH1A 4GOPB 4RG1A 4A3GH 1DGSA 2F3IA 4JI3Q 4HIDA 2YTVA 1UWVA 2DGYA 1VQIA 1WCMH 1L1OB 3PO3H 4LUZA 4UP7A 2NZOA 1P8LA 2HIXA 3PV0A 3CCSA 3RZDH 1X65A 3PCOB 3S2DH 1BBWA 4JI0L 5JJKA 5ELOA 2OQ0A 1NMFA 1HJPA 4B3SQ 3E0EA 4JI8L 4GN5A 4A76A 1VQOA 1N33Q 2JEAI 4DV0Q 5IYBH 4DNIA 5C0XJ 1EQRA 4X66L 5IP9H 3KLWA 1XNRQ 1KRTA 4DK3C 1OXSC 1HNWL 3S16H 1QVGA 5C4XG 2LXJA 1X9NA 1V1QA 5FJ8H 3NBHB 5M5WH 1IBML 3JAMc 4B3RQ 3S1QH 2IHEA 1OXUA 2AMCB 3S1MH 4A3LH 4YWLA 3OTOL 3A5ZB 4HJAA 2NN6I 1A8VA 1LM0A 1U5KA 1CUKA 2K14A 3M7NA 4A93G 4DAYB 1PH8A 1YHAA 4HIMA 3CPFA 2KHJA 1XPRA 5EAYA 3TEHB 2JK8A 4JI2L 5M3MG 3UDIA 3CC2A 1KXLA 3M4QA 1MJEA 2ATWA 4DR7Q 4L5RC 2PNHA 4XTCS 1XJVA 4LFAL 1CKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI5 A;  3AFP A;  3CQZ H;  4HJ7 A;  4C3I H;  1W2B A;  2E5L Q;  2JA6 G;  1XNQ Q;  2B3G A;  4GLA C;  3LGJ A;  4GNX C;  2CQO A;  3PO2 H;  2UUB Q;  1NY4 A;  3GTQ H;  4LF6 L;  4NPS A;  4YY3 L;  2Q2U A;  3E9H A;  3I56 A;  3DLL A;  4C3H H;  3U4Z A;  4KHP Q;  1TWG H;  3RN5 A;  3HKZ G;  4R4Q A;  1EQQ A;  2L15 A;  4LF5 L;  2A19 A;  2FXQ A;  3HOZ G;  3JAM i;  4AIM A;  2JEB I;  3HKS A;  2IT1 A;  4P71 A;  1XPU A;  4A3D H;  1FJG Q;  2JE6 I;  2WFW A;  5C4X H;  1KL9 A;  1A62 A;  4IPD A;  3CC7 A;  3GTO H;  2UXD Q;  4A3K G;  2B63 G;  3CCV A;  3CCJ A;  1OXT A;  5J3B A;  5GAE C;  2I5M X;  2HIV A;  2WB1 G;  5HGQ A;  4JI4 Q;  2R7F A;  1VQM A;  4RMF A;  2UXB Q;  1HZ9 A;  3D0F A;  3M9B A;  4DR2 Q;  1PA6 A;  2LSS A;  1U0L A;  3CME A;  4DV2 L;  3I4N G;  4JYA L;  1X54 A;  1GVP A;  4IPH A;  3GTM H;  2JA7 G;  1YIJ A;  1X3F A;  2MQH A;  3K81 C;  3KDF B;  1HNZ Q;  4FDB A;  4OX9 Q;  1JT8 A;  2PMZ E;  4X62 Q;  3RZO H;  3I4M G;  4IPG A;  4DV6 L;  1YJ9 A;  3CF5 A;  1PVO A;  2K50 A;  1Z9F A;  1N34 Q;  1Q82 C;  5BR8 Q;  4UY8 C;  4LF9 L;  3AEV A;  4BY1 G;  3S2H H;  1UE7 A;  2H5X A;  3RLN A;  4B3M L;  1CSQ A;  1CKO A;  4DV7 Q;  5GAD C;  1VQ4 A;  1IZ6 A;  2K5N A;  3D31 A;  1YJW A;  1I94 Q;  5JJI A;  2PQA B;  3U50 C;  4GNX B;  5IWA Q;  4YHH L;  4X6A H;  4B3T L;  2F4V Q;  4JI1 L;  1BVS A;  3MEF A;  4L5Q A;  4DV1 L;  4IJH A;  3F8T A;  2BA0 A;  3HOZ H;  2ZJQ A;  5E7N A;  1AH9 A;  4X65 Q;  3GD7 A;  1JJ2 A;  3CCM A;  1VQH A;  4NXM L;  2UUA L;  5IYC H;  1VQ9 A;  2IX1 A;  1OTC A;  4OXP A;  2PI2 E;  1V9P A;  1VQF A;  2V1C C;  3A5U A;  4HJ5 A;  4DV4 L;  1N36 Q;  2B63 H;  4JI3 L;  3ER0 A;  1V43 A;  3AQQ A;  1PFS A;  2OTL A;  4HJ8 A;  4DKA C;  4NXN Q;  1PH5 A;  4BBS H;  2GVB A;  2ZJP A;  1FVI A;  4JBM A;  1WFQ A;  4B3S L;  1N33 L;  2JQO A;  4R1J A;  5JEA G;  4Y7N H;  4A3C H;  3EBE A;  3CP0 A;  1GO3 E;  2JA7 H;  4DK6 C;  3HOX G;  2VQE L;  2IX0 A;  3ZJY C;  4IOA A;  3K7U C;  2Z6K C;  4DV5 L;  5FLM G;  3I55 A;  1NE3 A;  1PYB A;  4OWT B;  2E2H H;  3A0J A;  1B8A A;  3WWV A;  1C7Y A;  3S1N H;  5GAH C;  4DR5 L;  4GOP A;  2VNU D;  1IXR A;  4GKJ Q;  4B3R L;  4UP9 A;  3HOY G;  4A4I A;  1VQ6 A;  3CC4 A;  1L1O A;  2R7D A;  1QZG A;  1E1T A;  5M3F G;  4GKK L;  1G29 1;  1KQS A;  3G4S A;  2I0Q A;  3STB D;  3OYY A;  4JI7 L;  3M4O H;  3PIO A;  3KF6 B;  1L0W A;  4GLX A;  1VQ7 A;  1YZ6 A;  4JOI A;  2R7Z G;  2BA1 A;  2ZTC A;  3S1R H;  1XMQ Q;  3PF5 A;  4LFC Q;  1PYS B;  2GN5 A;  4JV5 L;  4DR4 L;  4TQU S;  4JI5 Q;  4DR7 L;  5C3E G;  2UU9 Q;  1L2F A;  2Z0S A;  1WJJ A;  1A63 A;  2IHF A;  1VQN A;  4KHZ A;  4HIK A;  1HR0 Q;  2OCE A;  3CCQ A;  1XNQ L;  3G6E A;  3T1H L;  3L0O A;  2HQL A;  2NVT H;  1PH9 A;  2A8V A;  1D8L A;  3J7Z C;  1HH2 P;  3T1Y Q;  1PH3 A;  3KFU A;  2JA9 A;  4MTN A;  4O2D A;  1PH6 A;  3GTK H;  4IFD I;  1N8R C;  4KHP L;  3HOX H;  1VQD A;  3IRB A;  2YYZ A;  2B29 A;  5FLM H;  2E2I H;  2JA8 G;  1N32 L;  2YTY A;  1S3O A;  1IBL L;  2D0O A;  4PZ6 A;  4IO9 A;  2AWO A;  4IFD G;  2K52 A;  2R6G A;  1SLJ A;  2KHI A;  1YVC A;  3E9I A;  4AQY Q;  2DUD A;  4JI8 Q;  3HOY H;  2UXD L;  3ULP A;  1SN8 A;  1VQK A;  1JMC A;  3NEL A;  4JI6 Q;  4X66 Q;  4OON A;  1PH2 A;  4NB3 A;  3UE1 A;  2ZM6 L;  2D0P A;  1JJC B;  4A3F G;  3CD6 A;  4A3J G;  1QUQ B;  1BKB A;  4DAM A;  3A74 A;  1J5E Q;  4LF7 L;  4EX5 A;  2VUM G;  1VS0 A;  1FGU A;  1IYJ B;  4PMW A;  3U4V A;  3PSI A;  4L5T A;  4X62 L;  3B6Y A;  3PUX A;  5DLQ E;  3S14 H;  3KYH C;  2UXC L;  5K36 G;  3RN2 A;  4HIO A;  1MIU A;  1B70 B;  1N34 L;  2WAQ E;  2D62 A;  5IY0 A;  5C44 G;  3GDE A;  3G48 A;  3HFZ B;  4A75 A;  4DV7 L;  1KAW A;  4AYB E;  1E1O A;  2I5H A;  1UE5 A;  3K7A H;  4ME3 A;  4BY7 G;  3HOV G;  1Q12 A;  1SRO A;  3AYH B;  2R93 G;  3OW2 A;  2ZJR A;  4JI2 Q;  1MJC A;  4A93 H;  3I2Z A;  4DR6 L;  5AJ3 L;  4QIW E;  1Y1W G;  1IL2 A;  1H95 A;  4LUO A;  2VQF L;  1HR0 W;  4LNQ A;  3FP9 A;  4IOC A;  5M3M H;  1CKM A;  2KCT A;  3AFQ A;  3BZC A;  4PZ7 A;  1IBK L;  1RIP A;  1TXY A;  3KDF A;  1XMO L;  1K8G A;  1EWI A;  3GTJ H;  4QY7 A;  1S72 A;  1LUZ A;  2N78 A;  4X64 Q;  1Q46 A;  3CMA A;  2ASB A;  4DPG A;  1CSP A;  3UDG A;  4DR1 L;  1AE3 A;  1MKH A;  4A3I G;  4BBR G;  2E2J H;  2JA6 H;  1G6P A;  1WOC A;  1PV4 A;  4K0K L;  1N36 L;  2HHH L;  1YHQ A;  4LF6 Q;  5H1S E;  4YY3 Q;  1JJG A;  2Q2I A;  4H02 A;  5FLX c;  5LMU Q;  1K9M C;  2K5H A;  3HOU G;  2KCM A;  4BA2 I;  2RHS B;  3L7Z C;  5ELN A;  4LF5 Q;  1K3R A;  2ES2 A;  2RCN A;  2PQA A;  2PI2 A;  3RLO A;  4DR3 L;  4A3E G;  1PHJ A;  4QQB X;  3I7F A;  2C35 B;  3PGZ A;  4GNX A;  3J7A 5;  3H15 A;  1VQB A;  4A3F H;  3W1G A;  1X6O A;  1EUJ A;  3H0G G;  3TS0 A;  4A3J H;  1VQ5 A;  4LFB L;  4JC0 A;  4A3G G;  5IT9 c;  1Z47 A;  4GLV B;  4PG3 A;  3PUY A;  2MO0 A;  3KF8 B;  4A3K H;  3HOW G;  3CPW A;  1QVC A;  2VS1 A;  5C44 H;  2K4K A;  4DV2 Q;  1PH4 A;  3M85 A;  2MO1 A;  1ASZ A;  1Y14 B;  4P75 A;  4BY7 H;  3MXN B;  4GS3 A;  4ALP A;  3HOV H;  4A3B G;  1VQA A;  2QA4 A;  3I4N H;  2CCZ A;  1XPO A;  2OQK A;  5IP7 G;  4DV6 Q;  5IP9 G;  4DV0 L;  3RNU A;  4LW1 A;  1Y1W H;  1YEZ A;  1YI2 A;  2VW9 A;  3I4M H;  1SRU A;  1GM5 A;  1HNX Q;  3PUZ A;  3DM3 A;  4B3M Q;  1XNR L;  3CCR A;  2JA5 G;  4GN4 B;  1TWF H;  3BJU A;  3W5O A;  4BY1 H;  2I5L X;  4JG2 A;  4OWX B;  3PF4 A;  5LMN Q;  4A3L G;  3RLF A;  5M5Y H;  4A3I H;  1GKH A;  4JI5 L;  4QGU A;  4BBR H;  1D7Q A;  3TS2 A;  1JE5 A;  2UU9 L;  5GQO A;  4J15 A;  4LF4 Q;  1P16 A;  1EIF A;  3ULJ A;  3G71 A;  2EXD A;  2Y0S G;  4GN3 B;  1OXX K;  4DUY Q;  1VQC A;  2KBN A;  4TVA B;  4C2M H;  4DV1 Q;  1I6H H;  2YU9 H;  1K73 C;  2HT1 A;  1KRS A;  5C0X G;  5JEA J;  2E8G A;  3T1Y L;  5IYD G;  3KJP A;  2UUC Q;  1BBU A;  3HKZ E;  2CKZ B;  1WYD A;  1Q1E A;  4R4C A;  1I5F A;  4P73 A;  3KF6 A;  3W1B A;  4AH6 A;  3NEN A;  1EIY B;  4DUZ Q;  3H0G H;  3M3Y H;  2QGQ A;  3TQY A;  4DV3 Q;  5IYD H;  4DV4 Q;  3JC6 6;  3Q8D A;  4YWK A;  2CWP A;  3KOJ A;  1R9T H;  1EYG A;  4OO1 G;  2YV5 A;  1YNX A;  1C0A A;  2YTX A;  1SMX A;  4LF8 Q;  4P72 A;  1TWH H;  2LXK A;  3HOW H;  1J6Q A;  4IJL A;  2ZTE A;  1S40 A;  2WB1 E;  2OTJ A;  1EOV A;  2Q2H A;  2E5L L;  2UUA Q;  3CCL A;  3PO2 G;  4YWM A;  4EQ5 A;  4AQY L;  3GO5 A;  2N3S A;  3KJO A;  1W3S A;  1RL2 A;  3CCU A;  4O0A A;  4YCU A;  1X3G A;  2UUB L;  4A3B H;  3H3V I;  4PZ8 A;  3F1Z A;  4HJ9 A;  4JI6 L;  2A1A A;  2VQE Q;  1NBW A;  3PIP A;  5IP7 H;  4DV5 Q;  2NVY H;  3J80 c;  1B7Y B;  4MZ9 A;  3K8A A;  5IE8 A;  1KHI A;  4DR5 Q;  3EN2 A;  1K83 H;  3L2P A;  3ERS X;  1HZA A;  1Q86 C;  1J5E L;  1VQJ A;  2JA5 H;  1FJG L;  1I3Q H;  4JI0 Q;  1KC8 C;  1X3E A;  2R92 G;  3CW2 C;  2F52 A;  4GKK Q;  2VZA A;  1I50 H;  2VL6 A;  2Z6K A;  3J81 i;  1Q81 C;  4JI4 L;  1PH7 A;  4JI7 Q;  3S17 H;  5M3F H;  2UXB L;  1KIX A;  1NTG A;  3STB C;  4JBJ A;  1QVF A;  4DR2 L;  2AKW B;  2ALY B;  4YCV A;  1YHB A;  2ID0 A;  3EIV A;  2NN6 G;  4BA1 I;  1E22 A;  3F2C A;  5LMN W;  1KD1 C;  1HNW Q;  2EQS A;  3TRE A;  2CWA A;  2EIF A;  3FHW A;  3F2B A;  1HZC A;  2R7Z H;  1Y1V G;  4DR4 Q;  1CKN B;  1IBM Q;  2NVX H;  5GRO A;  2BH2 A;  3FKI G;  1VQP A;  3PUW A;  1HNZ L;  4OX9 L;  1QUQ A;  3OTO Q;  4JCV E;  4KLK A;  1N9W A;  4IFD J;  1EFW A;  2CFM A;  5C3E H;  5BR8 L;  4WJ4 A;  1LYL A;  1X55 A;  1SE8 A;  4X64 L;  3T1H Q;  4UPA A;  5HY6 A;  5GAG C;  3UDF A;  1E7Z A;  1VQG A;  3CXC A;  1AE2 A;  3I4O A;  3J80 i;  1YJN A;  1VQL A;  4BXX G;  1VQE A;  1O7I A;  3NEM A;  5LMU L;  1YIT A;  1K8A C;  1I94 L;  1Q7Y C;  2AHO B;  4JV5 Q;  4JBK A;  4UP8 A;  2NZH A;  5IWA L;  4R4T A;  2F4V L;  1HZB A;  3ULL A;  2RF4 A;  1G51 A;  3VDY A;  2RHQ B;  4LFA Q;  1N32 Q;  3K80 C;  1T9H A;  4C3J H;  2K75 A;  1NMG A;  4QJF A;  5IYC G;  4XIG S;  1IBL Q;  4POG A;  1FL0 A;  4QL5 A;  4R4I A;  4X65 L;  4L5S A;  3UE0 A;  2XTI A;  2JA8 H;  4LUV A;  3H3V H;  1VCI A;  2MNA A;  3S15 H;  1UE6 A;  1C9O A;  2R92 H;  3UDX A;  1TWC H;  2WP8 J;  4BBS G;  1YBY A;  2ZM6 Q;  2Y0S E;  4OWW B;  4NXN L;  4A3C G;  2MFI A;  2KEN A;  4GOP C;  4LWC A;  4A3M G;  1M90 C;  3CAM A;  1JB7 A;  4LF7 Q;  4R4O A;  3GTG H;  1VQ8 A;  1Y1V H;  2UXC Q;  4POF A;  1L1O C;  3S24 A;  3FKI H;  3CCE A;  2VUM H;  3BU2 A;  1Q8K A;  4IPC A;  2K5V A;  1WCM G;  1HNX L;  2OWO A;  3PO3 G;  2XGT A;  2N49 A;  3RR5 A;  1GD7 A;  1K0R A;  1QZH A;  4JOI C;  4KI0 A;  5LMN L;  4JBW A;  1SFO H;  4JYA Q;  4GKJ L;  2ZTD A;  4APV A;  4DR6 Q;  4A3D G;  2NVQ H;  2IY5 B;  3PUV A;  1NJI C;  2N8N A;  5IYB G;  5AJ3 Q;  5M5X H;  1M1K C;  4LF4 L;  4BXX H;  2R93 H;  2VQF Q;  4DUY L;  1UE1 A;  1A0I A;  2GVA A;  2VY3 A;  3TRZ A;  3M4P A;  1IBK Q;  4MNO A;  1XMO Q;  4LF9 Q;  1UEB A;  2UUC L;  4YCW A;  3SGI A;  3GTP H;  3GTL H;  5JJL A;  5FJ8 G;  4DR1 Q;  1XMQ L;  4DUZ L;  4LFC L;  3K0X A;  1Q1B A;  4K0K Q;  4DV3 L;  4Y52 H;  2WAQ G;  2HHH Q;  2BH8 A;  1TWA H;  1LTL A;  1XTD A;  2AWN A;  1E24 A;  5C0X I;  1ASY A;  3F2D A;  4LF8 L;  3J81 j;  4AYB G;  1OXV A;  1X56 A;  4YHH Q;  2QEX A;  3ICE A;  4P74 A;  1HR0 L;  4B3T Q;  4JI1 Q;  3HOU H;  4DR3 Q;  2Q2T A;  4WJ3 M;  3U58 A;  4OO1 I;  3BZK A;  3J81 c;  4A3E H;  4LFB Q;  5C4J H;  1E3P A;  4NXM Q;  4A3M H;  2JJQ A;  1SR3 A;  1PH1 A;  4GOP B;  4RG1 A;  4A3G H;  1DGS A;  2F3I A;  4JI3 Q;  4HID A;  2YTV A;  1UWV A;  2DGY A;  1VQI A;  1WCM H;  1L1O B;  3PO3 H;  4LUZ A;  4UP7 A;  2NZO A;  1P8L A;  2HIX A;  3PV0 A;  3CCS A;  3RZD H;  1X65 A;  3PCO B;  3S2D H;  1BBW A;  4JI0 L;  5JJK A;  5ELO A;  2OQ0 A;  1NMF A;  1HJP A;  4B3S Q;  3E0E A;  4JI8 L;  4GN5 A;  4A76 A;  1VQO A;  1N33 Q;  2JEA I;  4DV0 Q;  5IYB H;  4DNI A;  5C0X J;  1EQR A;  4X66 L;  5IP9 H;  3KLW A;  1XNR Q;  1KRT A;  4DK3 C;  1OXS C;  1HNW L;  3S16 H;  1QVG A;  5C4X G;  2LXJ A;  1X9N A;  1V1Q A;  5FJ8 H;  3NBH B;  5M5W H;  1IBM L;  3JAM c;  4B3R Q;  3S1Q H;  2IHE A;  1OXU A;  2AMC B;  3S1M H;  4A3L H;  4YWL A;  3OTO L;  3A5Z B;  4HJA A;  2NN6 I;  1A8V A;  1LM0 A;  1U5K A;  1CUK A;  2K14 A;  3M7N A;  4A93 G;  4DAY B;  1PH8 A;  1YHA A;  4HIM A;  3CPF A;  2KHJ A;  1XPR A;  5EAY A;  3TEH B;  2JK8 A;  4JI2 L;  5M3M G;  3UDI A;  3CC2 A;  1KXL A;  3M4Q A;  1MJE A;  2ATW A;  4DR7 Q;  4L5R C;  2PNH A;  4XTC S;  1XJV A;  4LFA L;  1CKN A; 
#chains in the Genus database with same CATH topology
 3CQZ H;  1W2B A;  2K04 A;  2E5L Q;  1XNQ Q;  1CT1 D;  4R8N A;  3S16 B;  2CQO A;  1VF7 A;  2UUB Q;  1NY4 A;  2Q2U A;  3ERQ A;  3T56 B;  3DLL A;  4NKL A;  4K5V A;  4KHP Q;  1TWG H;  4R4Q A;  3HOZ G;  3HKS A;  3O13 A;  4P71 A;  2O5J C;  2JE6 I;  5I9P A;  3OHX C;  5C4X H;  4ZKC B;  1B3A A;  1KTK A;  2B63 G;  1OXT A;  5GAE C;  2I5M X;  2R7F A;  1HZ9 A;  5IGC A;  4QMG A;  3DUZ A;  4DR2 Q;  4WFN 3;  1HTP A;  1PTO F;  1GUT A;  4C3I B;  3I4N G;  2K03 A;  1TS5 A;  3A8I E;  2JA7 G;  1HNZ Q;  1JT8 A;  2E76 C;  3RZO H;  3I4M G;  4DV6 L;  3CF5 A;  4C3H B;  2HDL A;  5BR8 Q;  2B2T A;  2I07 B;  1NAP A;  5FKA C;  4BY1 G;  2H5X A;  3RLN A;  1BDO A;  1EIG A;  1IZ6 A;  2K5N A;  1I94 Q;  2Z9H A;  4GNX B;  4YHH L;  1BCP B;  2F4V Q;  5IGG A;  1FR3 A;  3K0Y A;  4FP5 D;  2GA4 B;  4X65 Q;  5ELD A;  2EYM A;  1JJ2 A;  2EY2 A;  4C1N I;  2IX1 A;  4IZ8 A;  1ENA A;  1V9P A;  3GTM B;  5LL6 X;  3LX0 A;  3TP6 A;  3AQQ A;  1PFS A;  1MHW C;  4HJ8 A;  2ZJP A;  4JBM A;  4B3S L;  1VMP A;  4Y7N H;  3CP0 A;  4DK6 C;  3HOX G;  4IOA A;  2NWG A;  5FLM G;  3EVQ A;  3I55 A;  1SYE A;  3WWV A;  5GAH C;  2VNU D;  3HOZ B;  4KD3 A;  5C4Z A;  4UP9 A;  3HOY G;  4A4I A;  5IIF A;  2R7D A;  4TSS A;  1QZG A;  5M3F G;  3D4D A;  1SAP A;  4GKK L;  1ROD A;  3E0J A;  2B63 B;  4JI7 L;  2F0D A;  4MIU A;  4DXG A;  2B2U A;  4BBS B;  3PF5 A;  3LWE A;  3MEH A;  5C3E G;  2Z0S A;  2JA7 B;  2FFK B;  2RDG A;  2IHF A;  4KHZ A;  1GUO A;  3D6W A;  1HR0 Q;  3CCQ A;  4V0B A;  1NR4 A;  1XNQ L;  3L0O A;  3J7Z C;  1HH2 P;  4MTN A;  3VYS A;  2A6E D;  1DXM A;  4KHP L;  4I7Z C;  4OIK A;  3IAY A;  3OIP A;  2EJG C;  3M4O B;  4ZAI A;  1S3O A;  4PZ6 A;  4IFD G;  1HUN A;  3IFD A;  2K52 A;  1SLJ A;  1A3V A;  2L12 A;  1SND A;  1CHP D;  2JYO A;  1VQK A;  2PW5 A;  4NB3 A;  1RF2 D;  4H44 C;  4H13 C;  1G6Z A;  2L4N A;  1DZ1 A;  3CD6 A;  2Q8I B;  5L37 A;  1VMC A;  4A3J G;  1BKB A;  1ZEQ X;  4DAM A;  5E4X A;  5JPM C;  3A74 A;  2RBM A;  4PMW A;  1EY9 A;  3PSI A;  3J81 L;  3IKJ A;  3M7G A;  4RKB A;  3RN2 A;  4HIO A;  3PQI A;  1LAB A;  3H3V C;  3SHL A;  3HOX B;  3G48 A;  4A75 A;  5IT9 E;  4XXE A;  2BDN A;  1E1O A;  2EYH A;  3K7A H;  2XRQ D;  1Q12 A;  3FMC A;  1MJC A;  4A93 H;  3I2Z A;  1S5B D;  3C2P A;  3AMU A;  3HOY B;  5JVG 3;  1H95 A;  4LUO A;  4LNQ A;  5M3M H;  4FF4 A;  3FEW X;  1CKM A;  3BZC A;  1K8G A;  1EWI A;  1LUZ A;  2N78 A;  1E0B A;  3CMA A;  4DPG A;  1CSP A;  3UDG A;  2E2J H;  1SYC A;  1PV4 A;  2O2L D;  2HHH L;  1YHQ A;  4NMZ A;  4YY3 Q;  5FLX c;  4H02 A;  5DM7 3;  1CQF A;  2PZW A;  2KCM A;  1EEF D;  1SMY C;  4UDU C;  2L9H A;  2PQA A;  4DR3 L;  1PHJ A;  3PGZ A;  5COY A;  4OGQ C;  1I4X A;  4A3G G;  1Z47 A;  4PV1 C;  4GLV B;  1KNA A;  3ONA B;  3KF8 B;  4A3K H;  3NWS A;  3MFY A;  2VS1 A;  4OEL B;  5C44 H;  3NWT A;  1BCP F;  1O7Z A;  3GTJ B;  2RDF A;  2MO1 A;  1S5D D;  4GS3 A;  2L55 A;  3HOV H;  2QA4 A;  5IGB A;  1XPO A;  5J1Z A;  4J1M A;  4L8J A;  5IP7 G;  5IP9 G;  2PYK A;  3RNU A;  1LT4 D;  1YEZ A;  1H9J A;  2B2W A;  1GM5 A;  1DYQ A;  4QF4 A;  4CDD C;  2F0H A;  1XNR L;  1EYD A;  4ZK9 B;  1TWF H;  1CK1 A;  2WAC A;  1Y8P B;  1STB A;  4A3J B;  1GUW A;  1HHV A;  5D3D A;  4LF4 Q;  4DUY Q;  1EIF A;  1STE A;  2F0V A;  3ULJ A;  4KY5 A;  3HEJ A;  1VQC A;  3QIA A;  1K73 C;  2TSS A;  2EYJ A;  2UUC Q;  1BBU A;  2UUA Q;  1I5F A;  4K5W A;  3KF6 A;  5EPK A;  1MBY A;  1LTB D;  2K5Q A;  4DUZ Q;  4DV3 Q;  1GUG A;  4YWK A;  3CKI B;  1BXT A;  1EYG A;  2QW7 A;  4LF8 Q;  1TWH H;  1EOV A;  3PO2 G;  3CCL A;  2SOB A;  1U4R A;  4EQ5 A;  5A2Q E;  1OO9 B;  3CCU A;  5M5Y B;  2NB0 A;  4K6L A;  5EGT A;  3Q0A A;  3F1Z A;  2A1A A;  4KKS A;  1NBW A;  2VQE Q;  1GHJ A;  4ILW A;  4DV5 Q;  2NVY H;  3DXJ C;  3J80 c;  1KLG D;  2EVB A;  4K8J A;  5IE8 A;  1KHI A;  3EN2 A;  1ESR A;  1HZA A;  4F8M A;  1I3Q H;  2XSC A;  1U4M A;  2EE1 A;  2VZA A;  2DNE A;  2VL6 A;  1RTO A;  1Q81 C;  1TU2 B;  3D6C A;  3S17 H;  3STB C;  3RD4 A;  4EGV A;  2F0I A;  4U67 3;  2ID0 A;  5LMN W;  2ZXR A;  5C0X H;  1TKW B;  5FOB B;  3NPP A;  2N55 A;  1HZC A;  3PUW A;  4OX9 L;  1QUQ A;  3OTO Q;  4JCV E;  4IFD J;  5EQ0 A;  1TQO A;  1TS2 A;  1HCZ A;  1LYL A;  3T1H Q;  1H9M A;  1E7Z A;  4X3T A;  1VQG A;  1VQL A;  3NTK A;  3J7Y W;  4ODG A;  4BXX G;  1Y8O B;  2CQA A;  1DJR D;  4JBK A;  2K7V A;  2F1M A;  1GHK A;  4LFA Q;  4KN7 C;  1IBL Q;  1V1P B;  1NMG A;  5IYC G;  1YNJ C;  4XIG S;  1RKN A;  4LUV A;  1PRT C;  5KGU A;  2CW0 C;  5I6W A;  1ILQ A;  1KAB A;  1C9O A;  2C9O A;  2G5D A;  1TWC H;  2ZXP A;  1MSG A;  4OWW B;  1RJT A;  1LTR D;  4LF7 Q;  1M90 C;  2NZ1 D;  1KDC A;  4R4O A;  2WII B;  1LLR D;  1L1O C;  1JR0 D;  3CCE A;  2F4I A;  2E2D C;  1Q8K A;  5BN3 A;  1EZ6 A;  3PO3 G;  1EYC A;  1WTP A;  1J8I A;  2OEO A;  2LS0 1;  1GD7 A;  4C3J B;  4KI0 A;  3NQI A;  1L0X B;  1SFO H;  2E75 C;  4GKJ L;  2JA8 B;  2IY5 B;  5AJ3 Q;  4LF4 L;  4DUY L;  2KQ3 A;  3TRZ A;  3MXN A;  1W6K A;  1A6X A;  1UEB A;  2UUC L;  2DY7 A;  5JJL A;  3NQT A;  3E5S A;  4DUZ L;  3K0X A;  4DV3 L;  1Q3L A;  4DU9 A;  3BS1 A;  4LF8 L;  4AYB G;  1X56 A;  3GQB A;  1T5E A;  3BDO A;  3QR8 A;  4P74 A;  3HOU H;  2XIW A;  3JAM E;  2Q2T A;  3U58 A;  5ELE A;  2F0W A;  4DN4 M;  4A3E H;  1E3P A;  4NXM Q;  4J6H A;  4O42 A;  3T51 B;  1PH1 A;  4GOP B;  3OWF A;  4JI3 Q;  1UWV A;  2DGY A;  3GV3 A;  2WIN B;  4UP7 A;  4CDC C;  1CHQ D;  1P8L A;  3I91 A;  3PV0 A;  1BBW A;  5C3X A;  3K6O A;  4RCN A;  1N33 Q;  1B9N A;  1X3Q A;  1H9R A;  3KLW A;  1U9R A;  3S16 H;  2LXJ A;  1V1Q A;  5J22 A;  4B3R Q;  3MAQ A;  1L0Y B;  3TME A;  3OTO L;  1NR2 A;  4IUQ A;  1DOL A;  2MHV A;  5IT9 L;  2O5I C;  1WTR A;  3PO3 B;  1D5Z C;  3S2D B;  3CPF A;  3K59 A;  4ME5 A;  3I90 A;  4B9W A;  3TEH B;  2JK8 A;  4JI2 L;  3CC2 A;  3OW7 A;  2ATW A;  3OPO A;  5IOC A;  4LFA L;  1A15 A;  4OO1 H;  3TP8 A;  3S9W A;  4C3I H;  2JA6 G;  1CA5 A;  2B3G A;  4GLA C;  5EKK A;  4GNX C;  5KEE A;  1BCP C;  5M5W B;  1EWC A;  4C1N K;  1ICW A;  4NPS A;  1SJH D;  1AN8 A;  3F2U A;  4C3H H;  4LF5 L;  4AYB B;  4AIM A;  3P20 A;  1JWM D;  4ZKB B;  1XPU A;  5KYL A;  1FJG Q;  1TS4 A;  2L1B A;  2EYP A;  3A7L A;  3SXH A;  1SYD A;  2PMZ B;  2HIV A;  5HGQ A;  4JI4 Q;  1EQT A;  4RMF A;  3D0F A;  1PA6 A;  2LSS A;  3CME A;  2SEB D;  1JQY D;  4IPH A;  3GTM H;  1TY0 A;  1YIJ A;  1X3F A;  2MQH A;  3KDF B;  3SVM A;  2PMZ E;  4IPG A;  3A7A B;  1Z9F A;  4UY8 C;  3DWA A;  4B3M L;  2PPB C;  1ET9 A;  1CKO A;  1VQ4 A;  3SK8 A;  2X69 A;  3D31 A;  1UEA B;  4DF7 A;  1WTX A;  3GTO B;  4X6A H;  3L3O C;  1SNC A;  2A6H C;  4L5Q A;  4DAV A;  4DV1 L;  2XVS A;  5C4H A;  2BA0 A;  3OOC A;  3A55 A;  3HOZ H;  3NBI A;  5E4W C;  1JC7 A;  4NXM L;  3FDT A;  1OTC A;  4OXP A;  2IWH A;  1PDQ A;  2B63 H;  4JI3 L;  3CRL C;  5ELB A;  2VB3 X;  2OTL A;  1JCK B;  1PRT B;  4CBV A;  1FD7 D;  1WTH A;  2BCO A;  5FO9 B;  1I4Q A;  4BBS H;  1PH5 A;  3S2H B;  1FVI A;  1PTO D;  1A3U A;  1WFQ A;  4KK7 A;  2Z1C A;  1N33 L;  1TVX A;  2PQE A;  5JEA G;  4KHV A;  2JA7 H;  2DN8 A;  4XQN A;  1T5X D;  3X3M A;  1Z7T A;  2F0F A;  1NE3 A;  3A0J A;  1C7Y A;  4PMC A;  2F0P A;  1D5M C;  2EXZ A;  5ISR A;  4C56 C;  1IXR A;  3VR3 A;  4B3R L;  4L63 B;  3Q6S A;  2K33 A;  1L1O A;  2XN9 C;  1PYW D;  3G4S A;  1HFG A;  4ZYS A;  3STB D;  3M4O H;  4GLX A;  1K3B C;  5FO7 B;  2R7Z G;  2BA1 A;  3NK9 A;  1PFM A;  2CVR A;  2MP1 A;  2ZTC A;  1XMQ Q;  4LFC Q;  4O1N A;  1QIL A;  4JV5 L;  4DR4 L;  3ZYY X;  4E6I A;  4RCO A;  1LTS D;  4KTA A;  4FXD A;  1A63 A;  3BDC A;  1VQN A;  4HSV A;  4J8Q A;  3R8B A;  2A8V A;  3T1Y Q;  1WTQ A;  3KFU A;  2EOT A;  2B39 A;  1PH6 A;  4DAY A;  1EY8 A;  3HOX H;  2YYZ A;  2B29 A;  5FLM H;  1SNM A;  2KJX A;  4CJ1 B;  1N32 L;  2YTY A;  4RGN A;  3HGB A;  4FF3 A;  2CW0 D;  2KHI A;  3E9I A;  4Q0F A;  2DUD A;  4AQY Q;  3HOY H;  3OWE B;  5D14 A;  2EY5 A;  4X66 Q;  4OON A;  4HMI A;  2K1B A;  3UE1 A;  2ZM6 L;  5FLX E;  4DNT B;  2NVT B;  3OMC A;  1A3T A;  3BVZ A;  1FGU A;  3RMH A;  2VUM G;  4L5T A;  5DLQ E;  3P1H A;  4QIW B;  3NTH A;  2DJG C;  1MIU A;  4N8F A;  1TII D;  5DEH A;  4ME3 A;  1DON A;  2RVL A;  1SNQ A;  3AYH B;  3D3R A;  3GV6 A;  4ZUI A;  2R93 G;  3OW2 A;  1F9R A;  4QIW E;  2VQF L;  2JP1 A;  1DCZ A;  3T16 A;  3AFQ A;  4PZ7 A;  2H1E A;  1RIP A;  3N52 A;  1XMO L;  2EDG A;  3GTJ H;  1S72 A;  1Q46 A;  1MKH A;  1G6P A;  2F0O A;  4IFD H;  3DEP A;  2A73 B;  4LF6 Q;  1CFM A;  5H1S E;  2JN4 A;  3S14 B;  1JJG A;  4BA2 I;  2R3Z A;  1DM0 B;  1HUM A;  5IOD A;  2RHS B;  3L7Z C;  2QDL A;  2AQ3 B;  1ENC A;  1F9Q A;  2RCN A;  3RLO A;  4JPB W;  4QQB X;  4HR7 B;  2C35 B;  4GNX A;  3J7A 5;  5T1I A;  3H15 A;  1VQB A;  3P75 A;  4NDX A;  4LFB L;  2K6A A;  4A3J H;  4RGM A;  2KA7 A;  2MJ8 A;  4G7Z C;  4UHV A;  2WKD A;  4PG3 A;  1SJE D;  5BN5 A;  4HTH A;  3CPW A;  1QVC A;  2F3V A;  2ICE C;  1B44 D;  4DV2 Q;  1PH4 A;  3T53 B;  4A3B G;  1EY0 A;  4FF2 A;  2MUY A;  1Z6H A;  2OQK A;  4DV0 L;  2EYO A;  1EY5 A;  2VW9 A;  1ZXT A;  2F0J A;  3BJU A;  2A68 C;  3HG9 A;  4OWX B;  3J80 E;  4A3L G;  1PRT F;  3RLF A;  5M5Y H;  4QGU A;  1Y69 U;  3TS2 A;  1HXY D;  3U9O A;  4CDE C;  1P16 A;  1D7Q A;  4GN3 B;  1OXX K;  2QF7 A;  3K5L A;  5JEA J;  3T1Y L;  2PW7 A;  2CKZ B;  1WYD A;  1Q1E A;  4AH6 A;  4P73 A;  3W1B A;  5KNB A;  2K32 A;  3NEN A;  5C3W A;  2QGQ A;  3TQY A;  3I4N B;  2B8F A;  4DV4 Q;  4I7A A;  3Q8D A;  3VA5 A;  4H0L C;  2CWP A;  1YNX A;  4RFB A;  4ABN A;  2ZTE A;  3I4M B;  1RD9 D;  4R9W A;  2Q2H A;  2E5L L;  1YNN C;  1BCP D;  4AQY L;  3GO5 A;  4BY1 B;  3KJO A;  3W2D A;  1W3S A;  2UUB L;  4YCU A;  3QG1 A;  1Q8I A;  1FNW A;  4PZ8 A;  3NTI A;  5IP7 H;  4MZ9 A;  1X32 A;  1ZYR C;  1I6H B;  1IKL A;  4C2M B;  4DK0 A;  2B8G A;  3BG3 A;  4DGZ A;  4DR5 Q;  3ERS X;  2F0U A;  4PNY A;  1LTA D;  4JI0 Q;  2R92 G;  1O78 A;  3M3Y B;  1K8O A;  3TZD A;  2AQ2 B;  2F3W A;  1PH7 A;  5FO8 B;  1IW7 C;  4JBJ A;  2HUG A;  4DR2 L;  4YCV A;  1KD1 C;  1HNW Q;  3F2C A;  2ZXO A;  1G2T A;  3F2B A;  1H9S B;  1FYC A;  1F2M A;  1CKN B;  1LT6 D;  2BH2 A;  1QJO A;  3FKI G;  1VQP A;  1HNZ L;  1S5C D;  3QOJ A;  4A3B B;  4PMB A;  5TSS A;  1JE4 A;  2J0T D;  1EFW A;  2CFM A;  5BR8 L;  1AFP A;  1SE8 A;  3BZD B;  5GAG C;  2KED A;  3UDF A;  1IKM A;  3CXC A;  1K83 B;  4FXK C;  1YJN A;  2BE5 C;  1SYF A;  1O7I A;  1K8A C;  1D1I A;  1I94 L;  1Q7Y C;  1JOQ A;  2X6G A;  1IHZ A;  1I50 B;  2NZH A;  2F4V L;  1NCV A;  3VDY A;  2RHQ B;  1V1O A;  5CV4 A;  5M3F B;  4IQZ A;  1QNU A;  3K80 C;  4C3J H;  1A2T A;  5KRU A;  4POG A;  3H3V H;  4X65 L;  2JA8 H;  5DM6 3;  2NVX B;  2KHS A;  3C46 A;  1JOK A;  1YBY A;  2LY7 A;  5M9O A;  3ERO A;  5C6A A;  5C3E B;  1X3P A;  2KEN A;  3KK7 A;  4GOP C;  4A3M G;  2UXC Q;  4POF A;  4YIJ A;  4DFA A;  2XWJ B;  2NTS A;  3L9A X;  3S24 A;  2F0K A;  2NUC A;  2K5V A;  1TWG B;  1WCM G;  5K36 H;  2N49 A;  5T1G A;  4JOI C;  3KF8 A;  4JYA Q;  1GJX A;  2ZTD A;  4A3D G;  4DR6 Q;  1UNS A;  3PUV A;  1ENF A;  3VA7 A;  5CBA E;  5JAV A;  4BXX H;  2WV6 D;  2KCC A;  3S15 B;  1UE1 A;  1A0I A;  2R92 B;  2VY3 A;  3FPP A;  5COR A;  1IBK Q;  1GUS A;  3TP7 A;  4LF9 Q;  1QB5 D;  4DR1 Q;  5K5P A;  4K14 A;  2EYL A;  2FHT A;  4F87 A;  4K0K Q;  4Y52 H;  2WAQ G;  1I4G A;  2BH8 A;  2HD3 A;  2AWN A;  1E24 A;  1ASY A;  1CZG A;  2Z6B A;  3F2D A;  3FKI B;  1OXV A;  4GZY C;  5HUR A;  1HR0 L;  5LL6 S;  3BZK A;  1KDB A;  2NVQ B;  4IUP A;  1SR3 A;  2A5H A;  3PIP 3;  4RG1 A;  3NSW A;  1DGS A;  4LJZ C;  4JK1 C;  1ICF B;  3PO3 H;  2NZO A;  3CCS A;  3S2D H;  1X65 A;  4JI0 L;  3GTL B;  1II3 A;  2F0T A;  5ELO A;  3N6R A;  3E0E A;  1VQO A;  1B3Q A;  5FLX L;  2IW3 A;  1KRT A;  3H6M A;  1HNW L;  4LK1 C;  3NBH B;  5M5W H;  4A3M B;  4YWL A;  3TN2 A;  4X3S A;  4CKE A;  1QCB D;  1Y8N B;  2N88 A;  4A3G B;  3A8K E;  3MA2 B;  1WCM B;  2AQ1 B;  4A93 G;  5LHY 1;  4X3K A;  5M3M G;  4A3D B;  3M4Q A;  4XTC S;  2E74 C;  1WI5 A;  4HSP A;  2XRS D;  4HJ7 A;  5ELF A;  4YY3 L;  2B2V C;  3J7A F;  3I56 A;  3S1Q B;  3S1M B;  1AW7 A;  1NUC A;  3U4Z A;  1B1Z A;  3RN5 A;  5DAU A;  3HKZ G;  5IGE A;  4WJW A;  2A19 A;  4XT3 B;  5CBE E;  2JEB I;  3JAM i;  1K28 A;  2IT1 A;  2HCI A;  2K01 A;  1BOS A;  2WFW A;  4HCE A;  2K5W A;  1A62 A;  4IPD A;  1AP0 A;  2Z8L A;  3GTO H;  1V1P A;  4A3K G;  3CCJ A;  5G3L F;  2WB1 G;  2UXB Q;  3M9B A;  2G9D A;  4FNF A;  3KBG A;  4JYA L;  1U0L A;  1NSN S;  1C8C A;  1GVP A;  3WOF A;  4M8A A;  2NN6 H;  3K81 C;  3WDN A;  3PO2 B;  2EYF A;  4FDB A;  3GTQ B;  4MN3 A;  4X62 Q;  3C1F A;  1PVO A;  1YJ9 A;  1XXG A;  2AUJ D;  1N34 Q;  5JJZ A;  4LF9 L;  3AEV A;  3S2H H;  1UE7 A;  1CSQ A;  2A68 D;  3J80 L;  3WOE A;  3DMU A;  3MTS A;  1HA6 A;  1MI2 A;  5IWA Q;  1AZP A;  3CU7 A;  2OXP A;  3MEF A;  1HA5 A;  4IJH A;  3F8T A;  5C5M A;  4CKC A;  2ZJQ A;  1B53 A;  5E7N A;  5CR3 A;  5CV9 A;  4CHT B;  4P2C B;  1VQH A;  2UUA L;  1NNX A;  2FMC A;  5CV5 A;  2CH4 A;  2PI2 E;  2V1C C;  4HJ5 A;  1S5E D;  4ID6 A;  1PZJ D;  3ER0 A;  3OIQ A;  1JIC A;  1LO5 D;  2OT2 A;  2RDH A;  3Q23 A;  4DKA C;  1D6E C;  4H7B A;  4NXN Q;  2GVB A;  1CI3 M;  3I70 A;  2JQO A;  4A3C H;  3EBE A;  5CGK A;  1GO3 E;  2KEE A;  3CHB D;  2VQE L;  1AEX A;  2HCC A;  3K7U C;  2Z6K C;  4DV5 L;  4FO2 A;  4KKT A;  3LNN A;  3HKZ B;  4GOP A;  4OIJ A;  1SE4 A;  3CC4 A;  2O4X A;  3I8Z A;  1E1T A;  1JWU D;  1L0W A;  4RGT A;  2LKV A;  4JOI A;  2RSO A;  5CV7 A;  1PZK D;  1PYS B;  2NBF A;  2QDB A;  4TQU S;  4F7X A;  2UU9 Q;  1L2F A;  1WJJ A;  3BYY B;  4FYD A;  4HIK A;  2OCE A;  3ITP A;  2D9U A;  2E2H B;  3G6E A;  3T1H L;  3S1N B;  2NVT H;  3URY A;  1D8L A;  3SK6 A;  1BBX C;  2JA9 A;  2F03 A;  1EQV A;  4XYO A;  4IUT A;  2KEC A;  4DAP A;  5I2X A;  4BWG B;  4UAI A;  1UAP A;  1IBL L;  2AWO A;  3S1R B;  2R6G A;  1YVC A;  4JI8 Q;  1EU4 A;  3ULP A;  1SEB D;  1SN8 A;  3NEL A;  4JI6 Q;  4JVZ A;  1PH2 A;  4Q5V A;  1SMY D;  1KLU D;  2P5Z X;  2RKS A;  2D0P A;  3Q22 A;  3HP3 A;  4A3F G;  1J5E Q;  4R8I A;  4LF7 L;  4EX5 A;  1O80 A;  1BUV T;  1IYJ B;  3U4V A;  4X62 L;  3S14 H;  1EWH A;  3B6Y A;  3PUX A;  3RUZ A;  3C3L A;  2VB2 X;  2NVY B;  3GTK B;  1N34 L;  4KY7 A;  2D62 A;  5IY0 A;  3GDE A;  3HFZ B;  3AB9 A;  3I72 A;  2E2I B;  4AYB E;  3MHB A;  1UE5 A;  1U4P A;  2I5H A;  2SDF A;  4BY7 G;  3A54 A;  1SRO A;  4HED A;  1EFI D;  1PTO B;  2M00 A;  3G7L A;  5AJ3 L;  1QE6 A;  1Y1W G;  1IL2 A;  3I4L A;  1HR0 W;  2ENB A;  3FP9 A;  5EJW A;  1TXY A;  3KDF A;  4LAA A;  4WOR A;  4NW2 A;  4A3I G;  4BBR G;  1WVL A;  3BVM A;  1PFN A;  2F0S A;  5LMU Q;  3HOU G;  2K5H A;  3DWP A;  3SK5 A;  1SYB A;  1TR5 A;  1K3R A;  3D4R A;  4KJO A;  4CDF C;  4RWS C;  4A3E G;  1KAA A;  3I7F A;  1BO0 A;  3W1G A;  3TS0 A;  3H0G G;  1VQ5 A;  2B2V A;  3OMG A;  2FMM A;  4KJN A;  1SBB B;  3PUY A;  2MO0 A;  2B2Y C;  3HOW G;  4DK1 A;  5IGF A;  3K5M A;  2R61 A;  5A2Q L;  1ASZ A;  4S3S A;  2JA6 B;  3I4N H;  2CCZ A;  3I73 A;  4DV6 Q;  4XYQ A;  4ZLT F;  1EY7 A;  3PIO 3;  1DD2 A;  3VYT A;  3I4M H;  4EQO A;  3DM3 A;  2SNS A;  3CCR A;  2JA5 G;  3W5O A;  4BY1 H;  3PF4 A;  3ND8 A;  5LMN Q;  3MVV A;  4A3F B;  3SE0 A;  3ND9 A;  4B9X A;  2UU9 L;  4JW0 A;  1A2U A;  1EY4 A;  3G71 A;  2EXD A;  2Y0S G;  3P7J A;  1I6H H;  4C2M H;  3DM1 A;  5JPN C;  1DOK A;  1KRS A;  4TRD A;  1EEI D;  5IYD G;  3KJP A;  3M3Y H;  4I65 A;  4BY7 B;  4TKO B;  3KOJ A;  4OO1 G;  2EJF C;  2YV5 A;  4IN3 A;  1Y1W B;  4P72 A;  4ZCK A;  2OTJ A;  2ZT9 C;  4YWM A;  2N3S A;  1RL2 A;  4A3I B;  4O0A A;  4A3B H;  4BBR B;  4IUV A;  4JI6 L;  1STG A;  3PIP A;  3VYR A;  2IPK D;  3K8A A;  1EIH A;  2F0M A;  2YU9 B;  1IL8 A;  1YNJ D;  1STN A;  1K83 H;  3L2P A;  1J5E L;  1QNK A;  4A3E B;  1FJG L;  2J7Z A;  1PRT D;  3CW2 C;  4DNR B;  2F52 A;  3H0G B;  4FXG C;  4GKK Q;  2Z6K A;  1I50 H;  3EA6 A;  1HPC A;  4JI4 L;  1FNV A;  3R2T A;  1XYI A;  1TY2 A;  1GUN A;  4DA2 A;  5M3F H;  1R9T B;  4JI7 Q;  1KIX A;  2AKW B;  3HOW B;  2ALY B;  3EJI A;  3IFT A;  1YHB A;  3EIV A;  1E22 A;  3FHW A;  2CWA A;  1Y1V G;  1IBM Q;  5E1F A;  2NVX H;  5GRO A;  5D65 A;  1MSH A;  4KLK A;  1N9W A;  4RHS A;  2K28 A;  5C3E H;  4WJ4 A;  1X55 A;  3VR6 A;  2JA5 B;  3J80 i;  1Q90 A;  3NEM A;  5CV6 A;  5LMU L;  2QEJ C;  2AHO B;  5CYU A;  3ULL A;  2RF4 A;  1G51 A;  1CQV A;  1T9H A;  2Y0S B;  4QJF A;  2EJM A;  2JXM B;  1DOM A;  1FL0 A;  1FGB D;  4R4I A;  4L5S A;  2XTI A;  1VF5 C;  2R7Z B;  1VCI A;  3S15 H;  1UE6 A;  3QJY A;  1UUP A;  4DXF A;  2R92 H;  2WP8 J;  2DY8 A;  2F0G A;  4BBS G;  3JAM L;  2B2W C;  2KVM A;  3R93 A;  2Y0S E;  1C4Q A;  3MWY W;  1B50 A;  3TDQ A;  4LWC A;  3CAM A;  1VQ8 A;  3W3A A;  3FKI H;  3BU2 A;  1D1K A;  2OWO A;  3KUP A;  3BYT B;  2XGT A;  3RR5 A;  1K0R A;  4IUN A;  5LMN L;  4ZUJ A;  1AZQ A;  4APV A;  2NVQ H;  2N8N A;  5IYB G;  2VXW A;  5AFW A;  1SDF A;  5NUC A;  5C5L A;  2GVA A;  3H09 A;  1BQQ T;  3QWN A;  3KLR A;  3M4P A;  3UI2 A;  3J7A V;  1K0S A;  1CTM A;  4YCW A;  3GTL H;  5FJ8 G;  1XMQ L;  4LFC L;  1TS3 A;  1Q1B A;  3K5O A;  2HHH Q;  3EQL C;  3GTG B;  1GOZ A;  1LTL A;  3SDZ A;  1HQM C;  1Y1V B;  4CJ2 C;  3A56 A;  3J81 j;  2VUM B;  2QEX A;  4B3T Q;  4JI1 Q;  2NYZ D;  2A69 C;  4DR3 Q;  4WJ3 M;  1LV9 A;  4OO1 I;  3J81 c;  4A3M H;  2XNA C;  4RKL A;  5M5X B;  2PCF B;  2R93 B;  4A3G H;  2F3I A;  5I2Y A;  4HID A;  4RH6 A;  1VQI A;  1WCM H;  1I4H A;  4V19 0;  3GTP B;  5JJK A;  1VDZ A;  2OQ0 A;  1NMF A;  2ICI A;  4A3D H;  2JEA I;  4GN5 A;  4A76 A;  1O7Y A;  1TWA B;  2B2Y A;  1JB3 A;  1EQR A;  4X66 L;  3FRP B;  5IP9 H;  2BOS A;  1XNR Q;  4DK3 C;  1OXS C;  4BS9 A;  5C4X G;  2FJ2 A;  1X9N A;  1IBM L;  4K5X A;  5C4J B;  1J9O A;  3S1Q H;  3S1M H;  2EY6 A;  2DNC A;  5EPL A;  3TP5 A;  1A8V A;  3E6Z X;  1I4R A;  1LM0 A;  1U5K A;  3E3X A;  2K14 A;  4QUC A;  1D5X C;  3KBX A;  1PH8 A;  4K2K A;  1WTO A;  3RZD B;  1XPR A;  5EAY A;  3UDI A;  1KXL A;  1MJE A;  4DR7 Q;  4IAL A;  1HRJ A;  4L5R C;  2PNH A;  1XJV A;  2C5C A;  1H9S A;  1FNU A;  1CKN A;  3AFP A;  3SEB A;  3LGJ A;  3PO2 H;  3H94 A;  3GTQ H;  4LF6 L;  2BDO A;  3E9H A;  1F9S A;  1KDA A;  5DNF A;  2CHB D;  2A6H D;  5EKI A;  1EQQ A;  2L15 A;  4NP5 A;  2FXQ A;  1HQR D;  1ONL A;  4XQJ A;  1KL9 A;  2HQE A;  2L5T A;  3CC7 A;  2UXD Q;  3CCV A;  5J3B A;  1VQM A;  1JOO A;  2F0L A;  3CQZ B;  3CRK C;  4DV2 L;  3DWQ A;  1X54 A;  1F2L A;  4OX9 Q;  1S4Z A;  2L0C A;  1CM9 A;  1LTT D;  2K50 A;  1Q82 C;  5EBD A;  1F2Z A;  4KV6 A;  4MTK A;  4DV7 Q;  5EBC A;  5GAD C;  4N9T A;  5C4X B;  1YJW A;  2PO4 A;  3R2I A;  3VYU A;  2PQA B;  5JJI A;  4G57 A;  2NTT A;  3U50 C;  1EL0 A;  5I9O A;  1GXD C;  2RCF A;  4B3T L;  4JI1 L;  1BVS A;  4RHR A;  5A35 A;  3HZX A;  1AH9 A;  1B9M A;  2EPB A;  3GD7 A;  3CCM A;  5IYC H;  1VQ9 A;  1ESF A;  1M4V A;  5E3F A;  3A5U A;  2EZV A;  1VQF A;  1N36 Q;  4DV4 L;  3RZO B;  5G3L D;  1V43 A;  1JWS D;  4R1J A;  3QO2 A;  2IX0 A;  1QWY A;  3ZJY C;  3NUC A;  2MPM A;  1MD2 D;  1LT3 D;  1PYB A;  1W6J A;  4OWT B;  2E2H H;  1SSO A;  1B8A A;  3S1N H;  1B2T A;  2WKC A;  4DR5 L;  2IL8 A;  3G6J B;  2D5D A;  4GKJ Q;  3V05 A;  3VR4 A;  1LT5 D;  4N9P A;  2D2C C;  3FVQ A;  3OSO A;  1RTN A;  1E2W A;  1G29 1;  5HGT A;  1KQS A;  2I0Q A;  3OYY A;  5JVH 3;  3PIO A;  3KF6 B;  1VQ7 A;  1YZ6 A;  1SYG A;  1M8A A;  2RA4 A;  3S1R H;  1C48 A;  2GN5 A;  3NP8 A;  4JI5 Q;  4DR7 L;  1B4O A;  4IUR A;  4PQX A;  4Y7N B;  3NBH A;  3X3N A;  4N8X 1;  3K58 A;  2HQL A;  3MFG A;  5F2D A;  1PTO C;  1PH9 A;  1PH3 A;  3KLS A;  2JSO A;  4O2D A;  4B08 A;  4ULL A;  3GTK H;  4IFD I;  1TT2 A;  1N8R C;  1VQD A;  3IRB A;  2CH4 W;  4C3J G;  4FF1 A;  2E2I H;  2JA8 G;  2D0O A;  2J4X A;  4IO9 A;  4EQP A;  3TSS A;  3T13 A;  2UXD L;  1PTO H;  5I6Y A;  3V96 A;  1E2V A;  1JMC A;  2WAQ B;  1SNO A;  1JJC B;  1EYA A;  5KYI A;  1QUQ B;  1LTG D;  1VS0 A;  2PNR C;  2UXC L;  3KYH C;  5K36 G;  2K5D A;  1B70 B;  4HCS A;  2WAQ E;  5BN4 A;  1EU3 A;  5C44 G;  4XQQ A;  4DV7 L;  1KAW A;  3HOV G;  2ZJR A;  4JI2 Q;  4DR6 L;  3PMF A;  3MZ5 A;  4EVO A;  2M9V A;  4IOC A;  2KCT A;  1IBK L;  1LAC A;  1U4L A;  4QY7 A;  4X64 Q;  2ASB A;  1VQ6 A;  4DR1 L;  1AE3 A;  2JA6 H;  1WOC A;  2MGS A;  4K0K L;  1N36 L;  4KN4 C;  1PLF A;  2Q2I A;  1K9M C;  1R4P B;  4CJ0 B;  5ELN A;  2A69 D;  1WD0 A;  4LF5 Q;  2ES2 A;  2PI2 A;  2F0N A;  5IGD A;  4A3F H;  3K7A B;  2I46 A;  1X6O A;  1EUJ A;  1EZ8 A;  4JC0 A;  5IT9 c;  3Q24 A;  4A93 B;  2V4D A;  1CA6 A;  3TBI B;  1SE3 A;  4KD4 A;  5M3M B;  1STY A;  2K4K A;  1YNN D;  3IL8 A;  3M85 A;  1PMR A;  1Y14 B;  4P75 A;  4ZRZ A;  2L11 A;  3MXN B;  4KY6 A;  4ALP A;  4BY7 H;  1VQA A;  2E2J B;  4HMJ A;  2KUM A;  4LW1 A;  1Y1W H;  1XX8 A;  2IJ0 A;  1YI2 A;  1SRU A;  1ZYR D;  1RCV D;  1EY6 A;  2Q8R E;  3PUZ A;  1HNX Q;  4B3M Q;  4GN4 B;  1KNE A;  5EKL A;  2I5L X;  4JG2 A;  4A3I H;  1GKH A;  4JI5 L;  4BBR H;  4CGY B;  1JE5 A;  3BDL A;  5GQO A;  4J15 A;  3HS0 C;  3LWU A;  3KLS X;  2A74 C;  4DV1 Q;  2H4O A;  2KBN A;  3R3O A;  4TVA B;  4A3K B;  2YU9 H;  1O7L A;  1IW7 D;  2HT1 A;  5C0X G;  2WB1 B;  2E8G A;  5C44 B;  4QCL A;  2G9H D;  3HKZ E;  4R4C A;  1EIY B;  2PZT A;  3H0G H;  3HOV B;  3JC6 6;  1R9T H;  1C0A A;  2YTX A;  1SMX A;  2LXK A;  3HOW H;  3DHQ A;  1J6Q A;  4IJL A;  3SR1 A;  1XTC D;  1S40 A;  1EOT A;  2WB1 E;  3TZU A;  1WTV A;  2EY1 A;  1TWF B;  4G7H C;  2F0E A;  2BE5 D;  1X3G A;  3H3V I;  4HJ9 A;  4XT1 B;  2QCP X;  5JEA H;  2QKI C;  4K8I A;  1B7Y B;  2SNM A;  2Z4H A;  3D4W A;  1STA A;  4RAU C;  3DEO A;  1Q86 C;  4HN7 A;  2JA5 H;  1VQJ A;  1KC8 C;  1X3E A;  1PXU A;  4L6T B;  1V8Q A;  3J81 i;  1MGS A;  1RDP D;  4K2L A;  2UXB L;  1WD1 A;  1NTG A;  1QVF A;  1TWH B;  3NXW A;  2B2T C;  4BA1 I;  2NN6 G;  1PFB A;  5IYD H;  2EQS A;  2LFN A;  4G4K A;  2EIF A;  3TRE A;  2R7Z H;  4DR4 Q;  1F9P A;  1G8Z D;  4JV5 Q;  1QG7 A;  2HDM A;  2K05 A;  2DJF C;  3A8J E;  4X64 L;  4UPA A;  5HY6 A;  1HFN A;  4FVM A;  3SK4 A;  1AE2 A;  3MXP A;  3I4O A;  1I3Q B;  1VQE A;  3T4A C;  2M2L A;  1YIT A;  2A6E C;  4EQN A;  4UP8 A;  5IWA L;  4R4T A;  4XDX A;  1HZB A;  4OEM B;  3S17 B;  3HRZ C;  1N32 Q;  2K75 A;  4M1U B;  4QL5 A;  3UE0 A;  1I4P A;  1D2B A;  4RGO S;  3UDX A;  3NE5 B;  2LMC B;  1PZI D;  4LMQ D;  5ELC A;  2ZM6 Q;  1G2S A;  1ILP A;  4NXN L;  4A3C G;  2MFI A;  5EPJ A;  5D3I B;  1RHP A;  1JB7 A;  1R4Q B;  3GTG H;  5CV8 A;  1ZKO A;  2KCN A;  1Y1V H;  3MXU A;  1IYU A;  4G7O C;  3MXG A;  1E2Z A;  1BNZ A;  2VUM H;  4IPC A;  3K57 A;  1SXT A;  3J81 E;  2OF1 A;  4X3U A;  3U9S A;  1HNX L;  1JOR A;  1QZH A;  5FK9 C;  4JBW A;  2B2U C;  1XWE A;  1NJI C;  1S5F D;  4KMU C;  1M1K C;  5M5X H;  2R93 H;  4HAE A;  2VQF Q;  2AUK A;  3NHH A;  3V2T A;  1TWC B;  1SNP A;  2Q8T A;  4MNO A;  3FPU B;  4U68 A;  1XMO Q;  2KOL A;  3VR2 A;  3AU7 A;  3SGI A;  2QIL A;  3GTP H;  1I6V C;  3MC0 B;  1K8M A;  5KIX A;  1BF4 A;  1WTW A;  4KKU A;  1F77 A;  1TWA H;  1XTD A;  3C1E A;  2RSN A;  3GP7 A;  5C0X I;  3BVG A;  2IX3 A;  2RQX A;  4YHH Q;  3ICE A;  1G91 A;  1CZW A;  5JOB A;  1SE2 A;  5KNC A;  4OHJ A;  4MHE A;  4LFB Q;  5C4J H;  4QUF A;  1SFO B;  5KND A;  2JJQ A;  1STH A;  4QB4 A;  3M4Y A;  4ZQ3 A;  4K6D A;  1ML0 D;  1F2Y A;  2XWB B;  2YTV A;  4C3I G;  2PZU A;  1L1O B;  4LUZ A;  1BR9 A;  2HIX A;  3RZD H;  3PCO B;  1QOH A;  3QOL A;  3D8G A;  1HJP A;  4B3S Q;  4JI8 L;  3EFX D;  4DV0 Q;  4C3H G;  5IYB H;  4DNI A;  5C0X J;  2TMP A;  1LTI D;  5J39 A;  1IYV A;  3HOU B;  4Z9C B;  1QVG A;  1H9K A;  5CC4 A;  3QB3 A;  5FJ8 H;  5CMD A;  4CKB A;  2F0Q A;  3JAM c;  4WRD A;  1HTL D;  2IHE A;  1OXU A;  2AMC B;  4A3L H;  1ET6 A;  3A5Z B;  3I3C A;  4IUU A;  4HJA A;  2NN6 I;  3H91 A;  4F88 A;  2X6L A;  1CUK A;  3M7N A;  3VR5 A;  4DAY B;  5I4D A;  1YHA A;  4HIM A;  2KHJ A;  2Z4I A;  2FIN B;  4RA8 A;  3K5N A;  2MNA A;  4OL7 A; 
#chains in the Genus database with same CATH homology
 1WI5 A;  3AFP A;  3CQZ H;  4HJ7 A;  4C3I H;  1W2B A;  2E5L Q;  2JA6 G;  1XNQ Q;  2B3G A;  4GLA C;  3LGJ A;  4GNX C;  2CQO A;  3PO2 H;  2UUB Q;  1NY4 A;  3GTQ H;  4LF6 L;  4NPS A;  4YY3 L;  2Q2U A;  3E9H A;  3I56 A;  3DLL A;  4C3H H;  3U4Z A;  4KHP Q;  1TWG H;  3RN5 A;  3HKZ G;  4R4Q A;  1EQQ A;  2L15 A;  4LF5 L;  2A19 A;  2FXQ A;  3HOZ G;  3JAM i;  4AIM A;  2JEB I;  3HKS A;  2IT1 A;  4P71 A;  1XPU A;  4A3D H;  1FJG Q;  2JE6 I;  2WFW A;  5C4X H;  1KL9 A;  1A62 A;  4IPD A;  3CC7 A;  3GTO H;  2UXD Q;  4A3K G;  2B63 G;  3CCV A;  3CCJ A;  1OXT A;  5J3B A;  5GAE C;  2I5M X;  2HIV A;  2WB1 G;  5HGQ A;  4JI4 Q;  2R7F A;  1VQM A;  4RMF A;  2UXB Q;  1HZ9 A;  3D0F A;  3M9B A;  4DR2 Q;  1PA6 A;  2LSS A;  1U0L A;  3CME A;  4DV2 L;  3I4N G;  4JYA L;  1X54 A;  1GVP A;  4IPH A;  3GTM H;  2JA7 G;  1YIJ A;  1X3F A;  2MQH A;  3K81 C;  3KDF B;  1HNZ Q;  4FDB A;  4OX9 Q;  1JT8 A;  2PMZ E;  4X62 Q;  3RZO H;  3I4M G;  4IPG A;  4DV6 L;  1YJ9 A;  3CF5 A;  1PVO A;  2K50 A;  1Z9F A;  1N34 Q;  1Q82 C;  5BR8 Q;  4UY8 C;  4LF9 L;  3AEV A;  4BY1 G;  3S2H H;  1UE7 A;  2H5X A;  3RLN A;  4B3M L;  1CSQ A;  1CKO A;  4DV7 Q;  5GAD C;  1VQ4 A;  1IZ6 A;  2K5N A;  3D31 A;  1YJW A;  1I94 Q;  5JJI A;  2PQA B;  3U50 C;  4GNX B;  5IWA Q;  4YHH L;  4X6A H;  4B3T L;  2F4V Q;  4JI1 L;  1BVS A;  3MEF A;  4L5Q A;  4DV1 L;  4IJH A;  3F8T A;  2BA0 A;  3HOZ H;  2ZJQ A;  5E7N A;  1AH9 A;  4X65 Q;  3GD7 A;  1JJ2 A;  3CCM A;  1VQH A;  4NXM L;  2UUA L;  5IYC H;  1VQ9 A;  2IX1 A;  1OTC A;  4OXP A;  2PI2 E;  1V9P A;  1VQF A;  2V1C C;  3A5U A;  4HJ5 A;  4DV4 L;  1N36 Q;  2B63 H;  4JI3 L;  3ER0 A;  1V43 A;  3AQQ A;  1PFS A;  2OTL A;  4HJ8 A;  4DKA C;  4NXN Q;  1PH5 A;  4BBS H;  2GVB A;  2ZJP A;  1FVI A;  4JBM A;  1WFQ A;  4B3S L;  1N33 L;  2JQO A;  4R1J A;  5JEA G;  4Y7N H;  4A3C H;  3EBE A;  3CP0 A;  1GO3 E;  2JA7 H;  4DK6 C;  3HOX G;  2VQE L;  2IX0 A;  3ZJY C;  4IOA A;  3K7U C;  2Z6K C;  4DV5 L;  5FLM G;  3I55 A;  1NE3 A;  1PYB A;  4OWT B;  2E2H H;  3A0J A;  1B8A A;  3WWV A;  1C7Y A;  3S1N H;  5GAH C;  4DR5 L;  4GOP A;  2VNU D;  1IXR A;  4GKJ Q;  4B3R L;  4UP9 A;  3HOY G;  4A4I A;  1VQ6 A;  3CC4 A;  1L1O A;  2R7D A;  1QZG A;  1E1T A;  5M3F G;  4GKK L;  1G29 1;  1KQS A;  3G4S A;  2I0Q A;  3STB D;  3OYY A;  4JI7 L;  3M4O H;  3PIO A;  3KF6 B;  1L0W A;  4GLX A;  1VQ7 A;  1YZ6 A;  4JOI A;  2R7Z G;  2BA1 A;  2ZTC A;  3S1R H;  1XMQ Q;  3PF5 A;  4LFC Q;  1PYS B;  2GN5 A;  4JV5 L;  4DR4 L;  4TQU S;  4JI5 Q;  4DR7 L;  5C3E G;  2UU9 Q;  1L2F A;  2Z0S A;  1WJJ A;  1A63 A;  2IHF A;  1VQN A;  4KHZ A;  4HIK A;  1HR0 Q;  2OCE A;  3CCQ A;  1XNQ L;  3G6E A;  3T1H L;  3L0O A;  2HQL A;  2NVT H;  1PH9 A;  2A8V A;  1D8L A;  3J7Z C;  1HH2 P;  3T1Y Q;  1PH3 A;  3KFU A;  2JA9 A;  4MTN A;  4O2D A;  1PH6 A;  3GTK H;  4IFD I;  1N8R C;  4KHP L;  3HOX H;  1VQD A;  3IRB A;  2YYZ A;  2B29 A;  5FLM H;  2E2I H;  2JA8 G;  1N32 L;  2YTY A;  1S3O A;  1IBL L;  2D0O A;  4PZ6 A;  4IO9 A;  2AWO A;  4IFD G;  2K52 A;  2R6G A;  1SLJ A;  2KHI A;  1YVC A;  3E9I A;  4AQY Q;  2DUD A;  4JI8 Q;  3HOY H;  2UXD L;  3ULP A;  1SN8 A;  1VQK A;  1JMC A;  3NEL A;  4JI6 Q;  4X66 Q;  4OON A;  1PH2 A;  4NB3 A;  3UE1 A;  2ZM6 L;  2D0P A;  1JJC B;  4A3F G;  3CD6 A;  4A3J G;  1QUQ B;  1BKB A;  4DAM A;  3A74 A;  1J5E Q;  4LF7 L;  4EX5 A;  2VUM G;  1VS0 A;  1FGU A;  1IYJ B;  4PMW A;  3U4V A;  3PSI A;  4L5T A;  4X62 L;  3B6Y A;  3PUX A;  5DLQ E;  3S14 H;  3KYH C;  2UXC L;  5K36 G;  3RN2 A;  4HIO A;  1MIU A;  1B70 B;  1N34 L;  2WAQ E;  2D62 A;  5IY0 A;  5C44 G;  3GDE A;  3G48 A;  3HFZ B;  4A75 A;  4DV7 L;  1KAW A;  4AYB E;  1E1O A;  2I5H A;  1UE5 A;  3K7A H;  4ME3 A;  4BY7 G;  3HOV G;  1Q12 A;  1SRO A;  3AYH B;  2R93 G;  3OW2 A;  2ZJR A;  4JI2 Q;  1MJC A;  4A93 H;  3I2Z A;  4DR6 L;  5AJ3 L;  4QIW E;  1Y1W G;  1IL2 A;  1H95 A;  4LUO A;  2VQF L;  1HR0 W;  4LNQ A;  3FP9 A;  4IOC A;  5M3M H;  1CKM A;  2KCT A;  3AFQ A;  3BZC A;  4PZ7 A;  1IBK L;  1RIP A;  1TXY A;  3KDF A;  1XMO L;  1K8G A;  1EWI A;  3GTJ H;  4QY7 A;  1S72 A;  1LUZ A;  2N78 A;  4X64 Q;  1Q46 A;  3CMA A;  2ASB A;  4DPG A;  1CSP A;  3UDG A;  4DR1 L;  1AE3 A;  1MKH A;  4A3I G;  4BBR G;  2E2J H;  2JA6 H;  1G6P A;  1WOC A;  1PV4 A;  4K0K L;  1N36 L;  2HHH L;  1YHQ A;  4LF6 Q;  5H1S E;  4YY3 Q;  1JJG A;  2Q2I A;  4H02 A;  5FLX c;  5LMU Q;  1K9M C;  2K5H A;  3HOU G;  2KCM A;  4BA2 I;  2RHS B;  3L7Z C;  5ELN A;  4LF5 Q;  1K3R A;  2ES2 A;  2RCN A;  2PQA A;  2PI2 A;  3RLO A;  4DR3 L;  4A3E G;  1PHJ A;  4QQB X;  3I7F A;  2C35 B;  3PGZ A;  4GNX A;  3J7A 5;  3H15 A;  1VQB A;  4A3F H;  3W1G A;  1X6O A;  1EUJ A;  3H0G G;  3TS0 A;  4A3J H;  1VQ5 A;  4LFB L;  4JC0 A;  4A3G G;  5IT9 c;  1Z47 A;  4GLV B;  4PG3 A;  3PUY A;  2MO0 A;  3KF8 B;  4A3K H;  3HOW G;  3CPW A;  1QVC A;  2VS1 A;  5C44 H;  2K4K A;  4DV2 Q;  1PH4 A;  3M85 A;  2MO1 A;  1ASZ A;  1Y14 B;  4P75 A;  4BY7 H;  3MXN B;  4GS3 A;  4ALP A;  3HOV H;  4A3B G;  1VQA A;  2QA4 A;  3I4N H;  2CCZ A;  1XPO A;  2OQK A;  5IP7 G;  4DV6 Q;  5IP9 G;  4DV0 L;  3RNU A;  4LW1 A;  1Y1W H;  1YEZ A;  1YI2 A;  2VW9 A;  3I4M H;  1SRU A;  1GM5 A;  1HNX Q;  3PUZ A;  3DM3 A;  4B3M Q;  1XNR L;  3CCR A;  2JA5 G;  4GN4 B;  1TWF H;  3BJU A;  3W5O A;  4BY1 H;  2I5L X;  4JG2 A;  4OWX B;  3PF4 A;  5LMN Q;  4A3L G;  3RLF A;  5M5Y H;  4A3I H;  1GKH A;  4JI5 L;  4QGU A;  4BBR H;  1D7Q A;  3TS2 A;  1JE5 A;  2UU9 L;  5GQO A;  4J15 A;  4LF4 Q;  1P16 A;  1EIF A;  3ULJ A;  3G71 A;  2EXD A;  2Y0S G;  4GN3 B;  1OXX K;  4DUY Q;  1VQC A;  2KBN A;  4TVA B;  4C2M H;  4DV1 Q;  1I6H H;  2YU9 H;  1K73 C;  2HT1 A;  1KRS A;  5C0X G;  5JEA J;  2E8G A;  3T1Y L;  5IYD G;  3KJP A;  2UUC Q;  1BBU A;  3HKZ E;  2CKZ B;  1WYD A;  1Q1E A;  4R4C A;  1I5F A;  4P73 A;  3KF6 A;  3W1B A;  4AH6 A;  3NEN A;  1EIY B;  4DUZ Q;  3H0G H;  3M3Y H;  2QGQ A;  3TQY A;  4DV3 Q;  5IYD H;  4DV4 Q;  3JC6 6;  3Q8D A;  4YWK A;  2CWP A;  3KOJ A;  1R9T H;  1EYG A;  4OO1 G;  2YV5 A;  1YNX A;  1C0A A;  2YTX A;  1SMX A;  4LF8 Q;  4P72 A;  1TWH H;  2LXK A;  3HOW H;  1J6Q A;  4IJL A;  2ZTE A;  1S40 A;  2WB1 E;  2OTJ A;  1EOV A;  2Q2H A;  2E5L L;  2UUA Q;  3CCL A;  3PO2 G;  4YWM A;  4EQ5 A;  4AQY L;  3GO5 A;  2N3S A;  3KJO A;  1W3S A;  1RL2 A;  3CCU A;  4O0A A;  4YCU A;  1X3G A;  2UUB L;  4A3B H;  3H3V I;  4PZ8 A;  3F1Z A;  4HJ9 A;  4JI6 L;  2A1A A;  2VQE Q;  1NBW A;  3PIP A;  5IP7 H;  4DV5 Q;  2NVY H;  3J80 c;  1B7Y B;  4MZ9 A;  3K8A A;  5IE8 A;  1KHI A;  4DR5 Q;  3EN2 A;  1K83 H;  3L2P A;  3ERS X;  1HZA A;  1Q86 C;  1J5E L;  1VQJ A;  2JA5 H;  1FJG L;  1I3Q H;  4JI0 Q;  1KC8 C;  1X3E A;  2R92 G;  3CW2 C;  2F52 A;  4GKK Q;  2VZA A;  1I50 H;  2VL6 A;  2Z6K A;  3J81 i;  1Q81 C;  4JI4 L;  1PH7 A;  4JI7 Q;  3S17 H;  5M3F H;  2UXB L;  1KIX A;  1NTG A;  3STB C;  4JBJ A;  1QVF A;  4DR2 L;  2AKW B;  2ALY B;  4YCV A;  1YHB A;  2ID0 A;  3EIV A;  2NN6 G;  4BA1 I;  1E22 A;  3F2C A;  5LMN W;  1KD1 C;  1HNW Q;  2EQS A;  3TRE A;  2CWA A;  2EIF A;  3FHW A;  3F2B A;  1HZC A;  2R7Z H;  1Y1V G;  4DR4 Q;  1CKN B;  1IBM Q;  2NVX H;  5GRO A;  2BH2 A;  3FKI G;  1VQP A;  3PUW A;  1HNZ L;  4OX9 L;  1QUQ A;  3OTO Q;  4JCV E;  4KLK A;  1N9W A;  4IFD J;  1EFW A;  2CFM A;  5C3E H;  5BR8 L;  4WJ4 A;  1LYL A;  1X55 A;  1SE8 A;  4X64 L;  3T1H Q;  4UPA A;  5HY6 A;  5GAG C;  3UDF A;  1E7Z A;  1VQG A;  3CXC A;  1AE2 A;  3I4O A;  3J80 i;  1YJN A;  1VQL A;  4BXX G;  1VQE A;  1O7I A;  3NEM A;  5LMU L;  1YIT A;  1K8A C;  1I94 L;  1Q7Y C;  2AHO B;  4JV5 Q;  4JBK A;  4UP8 A;  2NZH A;  5IWA L;  4R4T A;  2F4V L;  1HZB A;  3ULL A;  2RF4 A;  1G51 A;  3VDY A;  2RHQ B;  4LFA Q;  1N32 Q;  3K80 C;  1T9H A;  4C3J H;  2K75 A;  1NMG A;  4QJF A;  5IYC G;  4XIG S;  1IBL Q;  4POG A;  1FL0 A;  4QL5 A;  4R4I A;  4X65 L;  4L5S A;  3UE0 A;  2XTI A;  2JA8 H;  4LUV A;  3H3V H;  1VCI A;  2MNA A;  3S15 H;  1UE6 A;  1C9O A;  2R92 H;  3UDX A;  1TWC H;  2WP8 J;  4BBS G;  1YBY A;  2ZM6 Q;  2Y0S E;  4OWW B;  4NXN L;  4A3C G;  2MFI A;  2KEN A;  4GOP C;  4LWC A;  4A3M G;  1M90 C;  3CAM A;  1JB7 A;  4LF7 Q;  4R4O A;  3GTG H;  1VQ8 A;  1Y1V H;  2UXC Q;  4POF A;  1L1O C;  3S24 A;  3FKI H;  3CCE A;  2VUM H;  3BU2 A;  1Q8K A;  4IPC A;  2K5V A;  1WCM G;  1HNX L;  2OWO A;  3PO3 G;  2XGT A;  2N49 A;  3RR5 A;  1GD7 A;  1K0R A;  1QZH A;  4JOI C;  4KI0 A;  5LMN L;  4JBW A;  1SFO H;  4JYA Q;  4GKJ L;  2ZTD A;  4APV A;  4DR6 Q;  4A3D G;  2NVQ H;  2IY5 B;  3PUV A;  1NJI C;  2N8N A;  5IYB G;  5AJ3 Q;  5M5X H;  1M1K C;  4LF4 L;  4BXX H;  2R93 H;  2VQF Q;  4DUY L;  1UE1 A;  1A0I A;  2GVA A;  2VY3 A;  3TRZ A;  3M4P A;  1IBK Q;  4MNO A;  1XMO Q;  4LF9 Q;  1UEB A;  2UUC L;  4YCW A;  3SGI A;  3GTP H;  3GTL H;  5JJL A;  5FJ8 G;  4DR1 Q;  1XMQ L;  4DUZ L;  4LFC L;  3K0X A;  1Q1B A;  4K0K Q;  4DV3 L;  4Y52 H;  2WAQ G;  2HHH Q;  2BH8 A;  1TWA H;  1LTL A;  1XTD A;  2AWN A;  1E24 A;  5C0X I;  1ASY A;  3F2D A;  4LF8 L;  3J81 j;  4AYB G;  1OXV A;  1X56 A;  4YHH Q;  2QEX A;  3ICE A;  4P74 A;  1HR0 L;  4B3T Q;  4JI1 Q;  3HOU H;  4DR3 Q;  2Q2T A;  4WJ3 M;  3U58 A;  4OO1 I;  3BZK A;  3J81 c;  4A3E H;  4LFB Q;  5C4J H;  1E3P A;  4NXM Q;  4A3M H;  2JJQ A;  1SR3 A;  1PH1 A;  4GOP B;  4RG1 A;  4A3G H;  1DGS A;  2F3I A;  4JI3 Q;  4HID A;  2YTV A;  1UWV A;  2DGY A;  1VQI A;  1WCM H;  1L1O B;  3PO3 H;  4LUZ A;  4UP7 A;  2NZO A;  1P8L A;  2HIX A;  3PV0 A;  3CCS A;  3RZD H;  1X65 A;  3PCO B;  3S2D H;  1BBW A;  4JI0 L;  5JJK A;  5ELO A;  2OQ0 A;  1NMF A;  1HJP A;  4B3S Q;  3E0E A;  4JI8 L;  4GN5 A;  4A76 A;  1VQO A;  1N33 Q;  2JEA I;  4DV0 Q;  5IYB H;  4DNI A;  5C0X J;  1EQR A;  4X66 L;  5IP9 H;  3KLW A;  1XNR Q;  1KRT A;  4DK3 C;  1OXS C;  1HNW L;  3S16 H;  1QVG A;  5C4X G;  2LXJ A;  1X9N A;  1V1Q A;  5FJ8 H;  3NBH B;  5M5W H;  1IBM L;  3JAM c;  4B3R Q;  3S1Q H;  2IHE A;  1OXU A;  2AMC B;  3S1M H;  4A3L H;  4YWL A;  3OTO L;  3A5Z B;  4HJA A;  2NN6 I;  1A8V A;  1LM0 A;  1U5K A;  1CUK A;  2K14 A;  3M7N A;  4A93 G;  4DAY B;  1PH8 A;  1YHA A;  4HIM A;  3CPF A;  2KHJ A;  1XPR A;  5EAY A;  3TEH B;  2JK8 A;  4JI2 L;  5M3M G;  3UDI A;  3CC2 A;  1KXL A;  3M4Q A;  1MJE A;  2ATW A;  4DR7 Q;  4L5R C;  2PNH A;  4XTC S;  1XJV A;  4LFA L;  1CKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...