3S17H

Rna polymerase ii initiation complex with a 9-nt rna
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s17H00
1L1OB 4A93H 2RHQB 1TWFH 5FJ8H 3RR5A 4LF7L 3W5OA 4YY3Q 2Z6KC 1CUKA 2GVAA 4GLXA 3CPFA 1PH9A 1HNWL 4DR3Q 3JAMi 4JI1L 5C4XH 1C0AA 5M3MG 3ZJYC 1C9OA 1B8AA 3E0EA 1CSPA 5GAGC 4BXXH 2GVBA 3A5ZB 2ATWA 1OXSC 1E1OA 4A3LG 1HZCA 4X65Q 3TS0A 1QVCA 3STBD 3CCSA 1PH1A 1NE3A 2EIFA 3KOJA 1C7YA 4GKKQ 4DV0L 1JJCB 4LUVA 2VNUD 4X64L 1DGSA 2R93G 1NY4A 4HIMA 2VY3A 4DR6L 2KCMA 3PUXA 4A3FH 4JI6L 3LGJA 4XIGS 2NZHA 3S2HH 4DR2L 1SRUA 4B3RL 4JI8Q 1WJJA 1KD1C 1RL2A 1W2BA 4NXML 2NVQH 1SFOH 4DV7L 4QL5A 5HY6A 3CQZH 4L5QA 3HOZG 1VQ4A 1X55A 4POFA 1KIXA 4YCWA 1N32L 2WB1G 1MIUA 1HNZL 4B3TL 2B63G 1CKOA 3FKIH 1X65A 1O7IA 4JI4Q 5FLXc 4A3CG 1L1OC 1YEZA 3CCMA 3I56A 1VQ7A 4C3IH 5FJ8G 5GAHC 4JCVE 4DAMA 2L15A 2JA6H 3ULJA 1TWCH 1Z47A 3PSIA 3MXNB 3RLFA 4JI0L 2N3SA 4EX5A 5IT9c 1I50H 1EIFA 1XNRQ 2F4VQ 2ZJRA 2WP8J 4H02A 5C4XG 2YYZA 1FJGQ 3RNUA 2IHEA 3PF4A 4C2MH 3S15H 1LUZA 1PH5A 4BXXG 4DUZQ 3AFQA 2Y0SG 3GTJH 1V1QA 1IYJB 2MO1A 3A5UA 4R4IA 3STBC 1VQ6A 2A8VA 4X6AH 2N49A 2K4KA 1IBMQ 1J5EQ 2MNAA 1IZ6A 1XTDA 1M90C 2ZTDA 4DR1Q 3W1BA 4P75A 2DUDA 4K0KL 4OONA 3K7AH 1G6PA 1TWGH 2UUCQ 3KJOA 1N8RC 4WJ3M 3PUYA 4DR5L 4NXNQ 4JV5Q 3CCQA 1KL9A 4A3FG 1P8LA 4LFAL 4DV2Q 4LF9Q 2NVTH 2UXDQ 2JEBI 4TVAB 5JEAJ 2IHFA 5LMUL 4BY1H 1N33L 2R7ZH 4P71A 3F1ZA 4BA2I 1IBKL 4A3IH 1JT8A 3PIOA 2Q2TA 3CC2A 4C3HH 5IWAL 4HJ9A 1N36Q 1UEBA 3TRZA 3KLWA 2D0PA 4L5TA 1IL2A 4DR4L 4YCVA 3S16H 3OTOL 4GKJQ 4JI7L 4POGA 1I3QH 1Y1VH 1Z9FA 1QZHA 2RHSB 2NZOA 3UDIA 4DV4Q 2JA6G 4JOIA 4LF6L 4QIWE 3KDFA 5IP9H 3CMEA 1PYSB 1VQ5A 4DV1Q 1B70B 2DGYA 2VZAA 3D31A 3G48A 4YWMA 4GNXA 4X66Q 4LW1A 4AQYL 1OXUA 3S1RH 1ASZA 2ZJQA 2UUBL 2VQEL 1QUQA 4KHPQ 1H95A 3RLNA 1HR0L 3CMAA 1Q81C 4WJ4A 3ER0A 1D8LA 3S1QH 3D0FA 2UXBL 2UXCL 1SE8A 4DV5Q 1L2FA 2VW9A 5GADC 1GM5A 3F2DA 2Z6KA 5GQOA 3CW2C 4P73A 2WAQG 1NMFA 1IBLL 4OO1G 4L5RC 4B3SQ 1YIJA 4A3JH 2ZTEA 4YWLA 3PF5A 4LF4Q 2HIVA 1S3OA 2CWPA 3ERSX 2NVXH 3A0JA 2HQLA 2JK8A 2OCEA 1UE6A 1YBYA 3FP9A 4A3EG 4GOPB 1X9NA 4LUZA 3RZOH 2CWAA 3PO2H 2YV5A 4IOAA 4PMWA 2R7ZG 5C3EH 4BY1G 2D62A 2UU9Q 3S17H 3EN2A 5J3BA 1PH3A 4A3IG 3KF6B 4JC0A 4DV6L 2B29A 4TQUS 2IX1A 3L2PA 1XPRA 3MEFA 3HOWH 2QA4A 4IFDG 3U58A 3CP0A 5HGQA 1JE5A 3F2CA 4DV3L 4IO9A 1YJWA 1GVPA 1MKHA 3AEVA 5IYCH 3L7ZC 2LSSA 1YHQA 1MJEA 1Y1VG 3T1YL 2VQFL 1V9PA 2HT1A 2JA8H 4BBSH 4OO1I 3NEMA 5IP9G 1BBWA 1XJVA 4A3DH 3HFZB 3M7NA 3F8TA 1UE1A 1PA6A 5JJKA 5FLMH 4GS3A 4PG3A 1Y1WH 3HOUH 2KENA 2PI2E 1FVIA 1A62A 4GN4B 3PO3H 2MFIA 1S40A 1EQQA 1N34L 1JB7A 3HOYH 1VS0A 2CQOA 1I94L 4A3GH 4A3CH 2YTXA 5IYDH 1L1OA 3Q8DA 1OTCA 2K75A 4X62Q 1FGUA 1UWVA 1CSQA 3J81j 4DUYL 1K8GA 1HZ9A 3HOVH 2LXJA 1J6QA 4A3JG 4A3KH 4IFDI 1I6HH 2OQ0A 1AH9A 2VL6A 4LFAQ 4MTNA 3TREA 4IPCA 1OXXK 1JMCA 3H15A 4B3MQ 3RZDH 4GOPC 4GN3B 1X6OA 1IBKQ 3JAMc 3PO2G 5BR8L 1VQAA 1ASYA 3GTMH 1QVFA 3I4NH 5C3EG 2ZJPA 1WCMH 3B6YA 3K80C 4LFCQ 2XTIA 1PH4A 2B3GA 1HNXQ 4QJFA 4LF8Q 2VS1A 2BH2A 3H3VH 4HJ5A 4HIDA 1K3RA 1X3FA 2GN5A 2MO0A 3OW2A 3U50C 4LNQA 3HOWG 1IXRA 5C0XG 2HHHL 2YU9H 1X56A 4LF6Q 2ZM6L 2MQHA 3PUWA 4XTCS 4DPGA 1A0IA 5IYCG 3G71A 3T1HL 1Y14B 3CC4A 1SR3A 4J15A 4OXPA 1XNQQ 3UE1A 4BBSG 2OQKA 4JYAL 4LF5Q 1K83H 5GAEC 1R9TH 4A3DG 5AJ3L 4YHHL 5FLMG 2JQOA 1Y1WG 1VQBA 2Q2HA 3OYYA 3HOUG 3CCLA 2AKWB 3CCVA 5LMNL 2JEAI 3PO3G 4PZ6A 4DKAC 2R92H 2OWOA 5H1SE 3BU2A 4JI3Q 2E5LQ 4RG1A 5IYDG 4A3GG 4YY3L 3ICEA 5M5YH 2I0QA 2VUMH 3M4OH 1E24A 4BA1I 4ME3A 1TWHH 3M85A 2KHIA 4MZ9A 4UY8C 3I4MH 3F2BA 1BBUA 3HOVG 3I7FA 1E1TA 3J81c 4A3KG 4OX9Q 5C0XI 1W3SA 4JI2Q 1V43A 2ASBA 4R4TA 1Q1BA 3J7ZC 1LTLA 2UUAQ 1K0RA 1KAWA 2WB1E 1I5FA 3NBHB 3G4SA 3CCEA 4X65L 1T9HA 1YITA 1QZGA 4UP9A 1JJ2A 1WCMG 4LF7Q 4JI5L 1YHBA 4C3JH 1KRSA 4GKKL 1CKMA 4DNIA 2QEXA 4A93G 3FKIG 1SLJA 1HNWQ 4A3MH 1CKNB 5IYBH 1YI2A 4JI1Q 4UP8A 4GLAC 3KDFB 4AYBG 3J80c 1OXVA 2D0OA 2NN6G 1PH2A 1QUQB 4JBKA 5E7NA 2K14A 1X3GA 2Y0SE 4R4OA 1WFQA 3GD7A 2N8NA 2AMCB 3TQYA 3ULLA 1N34Q 4QY7A 1X54A 1I94Q 4Y7NH 4DV0Q 3GO5A 3KYHC 1KXLA 1SROA 1SN8A 4X64Q 2E2HH 3JC66 4JI4L 2R92G 1NJIC 3S2DH 3K7UC 2ZTCA 2KHJA 4HJ7A 2QGQA 2PQAB 4R1JA 1A8VA 4DR6Q 4JI6Q 2VUMG 4PZ8A 1HZBA 1L0WA 4DR2Q 2JA9A 1XMQL 1X3EA 1XNRL 3I4OA 3H3VI 4NXMQ 4B3RQ 3I4MG 3M4QA 1FJGL 4DV7Q 4BY7H 2F52A 3HKZG 1Q12A 4OWWB 5LMNW 2NN6I 1N32Q 1VQLA 1YNXA 3DM3A 3K0XA 1HNZQ 5ELNA 4B3TQ 1Q7YC 3HKSA 1OXTA 3K81C 1J5EL 1LM0A 2V1CC 5M3FH 3CC7A 3IRBA 4LUOA 3AFPA 3GTKH 2JE6I 2K5VA 3G6EA 4OWXB 4IJLA 3WWVA 4DK3C 4AYBE 4JI0Q 4A3BH 4A3MG 5IYBG 3T1HQ 1YZ6A 4NXNL 3S1MH 4JV5L 2Z0SA 4JG2A 5C44H 1E22A 2BA0A 4LF9L 2UXDL 1JJGA 4DV2L 5AJ3Q 2BA1A 4GOPA 5IE8A 4YHHQ 4JBMA 1S72A 3PUVA 5EAYA 2KCTA 2B63H 4APVA 2BH8A 4NPSA 1E3PA 1N36L 3H0GH 5LMNQ 2Q2IA 1WI5A 2R7FA 5ELOA 1VQNA 4DR7L 2NVYH 1UE5A 1G291 4R4CA 1EIYB 1Q82C 2HIXA 4GKJL 4K0KQ 1VQGA 2WAQE 3RN5A 3AQQA 1AE2A 4HJ8A 2F3IA 4DR5Q 4GLVB 4DV4L 1HZAA 4P72A 3GTOH 1VQHA 3BZKA 3W1GA 4LF5L 1B7YB 1HR0W 1PYBA 3U4ZA 3I55A 4DV1L 4LFBL 5LMUQ 4X66L 3HKZE 1N33Q 3BZCA 4KHPL 4QQBX 3UDXA 4AH6A 2AHOB 3UE0A 1KQSA 4BY7G 4IFDJ 5DLQE 5IWAQ 3K8AA 2JA7H 1U0LA 4P74A 1VQ8A 1VQKA 4DR4Q 3ULPA 3CCJA 1VQMA 3OTOQ 4JI5Q 4DV5L 4JI7Q 1VQPA 2I5HA 3CXCA 1PH8A 3I2ZA 2ES2A 4RMFA 4BBRH 4IPGA 1YVCA 4Y52H 5M3FG 1MJCA 1VQCA 2WFWA 1Q8KA 1VCIA 1PH6A 1K9MC 4B3SL 1Q1EA 4JBJA 1XMOL 4ALPA 1XPOA 4LF4L 1XPUA 2H5XA 4A3BG 3HOXH 4DR7Q 1U5KA 4AQYQ 2EXDA 3CCUA 5M5WH 2UUBQ 2VQEQ 2RCNA 2JA8G 2N78A 3PIPA 4KHZA 2CFMA 5C44G 2I5LX 1HR0Q 3CF5A 4DAYB 3TEHB 1BVSA 1E7ZA 4A76A 4JBWA 5IY0A 3GTLH 4OWTB 1VQ9A 3U4VA 1Q86C 4AIMA 2UU9L 2UXCQ 2UXBQ 3CPWA 2PMZE 2JJQA 5JEAG 5C4JH 3H0GG 3SGIA 3J81i 4LWCA 3GTGH 1K73C 3HOYG 1N9WA 2AWOA 1FL0A 4O0AA 1QVGA 1IBLQ 1VQDA 3A74A 1EOVA 1Q46A 4IOCA 4DR3L 1YJNA 1UE7A 1EFWA 1XMQQ 1PHJA 1BKBA 2K5NA 2CKZB 2E2JH 1A63A 4DK6C 3BJUA 1G51A 4UPAA 2JA5H 1EWIA 1WOCA 4DV6Q 3I4NG 3J80i 1YHAA 5C0XJ 3S1NH 3KJPA 1PVOA 3GDEA 2JA7G 1YJ9A 3S14H 5IP7H 3EIVA 3KF8B 4DV3Q 4FDBA 1VQFA 4X62L 4BBRG 3CCRA 3EBEA 4A75A 3T1YQ 4HJAA 4KLKA 1VQEA 3CAMA 3M9BA 4PZ7A 3UDFA 2VQFQ 1KC8C 4A3EH 4GNXB 5M5XH 3GTPH 3M3YH 3HOXG 3E9IA 3L0OA 3PCOB 4JI8L 3RLOA 4B3ML 2LXKA 2R6GA 3VDYA 5K36G 1EUJA 1WYDA 1PV4A 4MNOA 3UDGA 1KHIA 2PI2A 3PV0A 1PH7A 1EYGA 1D7QA 2AWNA 4L5SA 1RIPA 2YTYA 2XGTA 3GTQH 1HH2P 4LFCL 4A4IA 4YWKA 1HJPA 3M4PA 3NENA 3PUZA 1HNXL 4R4QA 4LF8L 1TXYA 2Q2UA 3KFUA 1NBWA 4DUYQ 1PFSA 2ID0A 4KI0A 5M3MH 1CKNA 2IY5B 4EQ5A 2R7DA 1LYLA 2I5MX 2F4VL 4LFBQ 5JJLA 2IT1A 2K50A 2RF4A 2K5HA 1XNQL 4A3LH 3PGZA 4IPDA 5BR8Q 4DUZL 2C35B 2ALYB 1TWAH 3S24A 2JA5G 1VQJA 1K8AC 2A19A 1VQOA 5JJIA 3DLLA 4IPHA 1IBML 2CCZA 3FHWA 5GROA 4JI3L 3NELA 1NTGA 2R93H 1NMGA 5IP7G 4DR1L 2E2IH 2E5LL 2HHHQ 3CD6A 3TS2A 4IJHA 3J7A5 2IX0A 2YTVA 2K52A 2ZM6Q 1XMOQ 2OTLA 1GD7A 2PQAA 2UUCL 4JOIC 4O2DA 2OTJA 4UP7A 1M1KC 2A1AA 1VQIA 1AE3A 4GNXC 1GO3E 1EQRA 4OX9L 3HOZH 4JYAQ 4GN5A 4NB3A 4JI2L 2FXQA 2EQSA 4HIKA 2E8GA 3E9HA 4YCUA 1SMXA 1P16A 2KBNA 4HIOA 3RN2A 3AYHB 4QGUA 2UUAL 1GKHA 2PNHA 1KRTA 3KF6A
chains in the Genus database with same CATH superfamily
4A93H 4RH6A 3BVMA 5FJ8H 3D4WA 3W5OA 5C5MA 2F0IA 2Z6KC 3I4LA 4KJNA 3CPFA 1VMPA 5KEEA 3H94A 5C4XH 1B53A 1C9OA 1HTLD 2JA8B 5GAGC 4BXXH 2GVBA 5F2DA 2ATWA 3A8JE 1M4VA 1OXSC 2EY5A 4A3DB 2L9HA 2NBFA 3HOUB 1D1KA 3MTSA 1HZCA 2P5ZX 4K2KA 5EKIA 3TS0A 1NE3A 1EIHA 3KOJA 1C7YA 3BDCA 2ZXPA 4LUVA 3QOLA 2M00A 1SNOA 3ERQA 4ODGA 4HIMA 4NW2A 2O5IC 4DR6L 3HOVB 4A3KB 4FVMA 5I6YA 4LK1C 3SXHA 3FEWX 4DR2L 1CHPD 1RL2A 2DNCA 3LWEA 2A6HD 4KTAA 4L5QA 1XWEA 1B4OA 1VQ4A 1TT2A 1X55A 5ISRA 2WB1G 4K2LA 3FKIH 1X65A 5CV5A 1RJTA 3CCMA 1VQ7A 4C3IH 4DAMA 3DHQA 3PSIA 5AFWA 4EX5A 5IT9c 1HRJA 5J1ZA 4KY5A 2IHEA 2F0JA 1JWSD 4HN7A 5M5WB 3FMCA 1PH5A 3PIP3 4R4IA 4PMCA 1ENCA 3CRLC 1WTVA 4X6AH 1O7ZA 3I73A 1CZWA 3RUZA 2WINB 1S5DD 1J5EQ 4G57A 4ID6A 2R92B 3U9OA 4DR1Q 2LMCB 2DUDA 5M5YB 4ZLTF 4WJ3M 4NXNQ 4DR5L 2F3WA 3URYA 4A3FG 1P8LA 4LF9Q 3HKZB 4RAUC 5CC4A 4TVAB 5JEAJ 3TZUA 2R7ZH 4BY1H 3DWPA 3F1ZA 3DXJC 4A3IH 3AMUA 1GOZA 3QIAA 5IWAL 3TRZA 1S5CD 1SYCA 4V0BA 5FLXL 1C48A 5IIFA 1EIGA 2HDLA 1BCPB 4C3JB 3FRPB 5D3DA 3N6RA 2NTTA 1Y1VH 3V96A 1QZHA 4DV4Q 2HUGA 4JOIA 1PYSB 3S17H 4DR7L 1B70B 3OIPA 4AQYL 1OXUA 2ZJQA 2UUBL 5IGCA 3RLNA 1QE6A 3OHXC 1L2FA 5GADC 4O42A 2KECA 2E2HB 3CW2C 1EWCA 4OO1G 1Z6HA 4YWLA 2EYPA 1DM0B 2KHSA 5IGEA 3MFGA 4LUZA 4ZK9B 3PO2H 1XTCD 5E4XA 4PMBA 3BS1A 4K6DA 2UU9Q 4UHVA 1PH3A 4K5VA 4DV6L 4TQUS 4C3HG 1DCZA 3L2PA 2OEOA 3SVMA 1XPRA 2XWJB 4YIJA 3HOWH 1GHJA 1PXUA 3OIQA 2LSSA 4OL7A 1DOLA 3H91A 1SMYD 4R8NA 4OO1I 3EJIA 3NEMA 5IP9G 1XJVA 5JJKA 1SYGA 1KNAA 2SOBA 4PG3A 3J81E 1A15A 2RA4A 5C4ZA 4GN4B 1FVIA 5LHY1 5JEAH 1EQQA 4TRDA 1N34L 1JB7A 1VS0A 2CQOA 3OWFA 3PMFA 1TS2A 4IUNA 1FGUA 5DM73 3J81j 3C3LA 1I6HH 2OQ0A 4LFAQ 1WTWA 4KN4C 3J80E 1X6OA 1ASYA 3I4NH 1QVFA 2ZJPA 2JA7B 2L1BA 1STGA 4LFCQ 3WOFA 2VS1A 3VYRA 3D4DA 4BBRB 2MO0A 1RODA 4KKTA 1F2MA 5C0XG 1O7YA 4LF6Q 5EJWA 2MQHA 4NP5A 2A5HA 1ML0D 4DU9A 3T1HL 4EQNA 1SR3A 4OXPA 3UE1A 4JYAL 1G8ZD 1K83H 1R9TH 4A3DG 5AJ3L 3GTLB 2JQOA 4X3UA 2B2YA 3HOUG 4F88A 3CCLA 1NNXA 4WORA 3CCVA 1BF4A 3VR6A 1J8IA 2CHBD 3I90A 1CTMA 5EKLA 1MBYA 5C3XA 2E5LQ 4JI3Q 1EY6A 1O80A 4B08A 2JA6B 2DN8A 4BA1I 3MXNA 1TWHH 3I4MH 3HOVG 4A3KG 2E2JB 1TIID 5C0XI 1Y8PB 4I7ZC 4JI2Q 4C2MB 2K7VA 2ASBA 1SNQA 3V2TA 4NMZA 2JA5B 1K0RA 2Q8TA 1QZGA 3G4SA 3K5MA 4RGMA 4UP9A 2BCOA 4LF7Q 4JI5L 3S14B 3FKIG 1SLJA 2K33A 1HNWQ 5IYBH 5FKAC 1WD1A 5A2QE 3FPUB 2NN6G 1PH2A 3GTPB 2K14A 1X3GA 3W2DA 1WFQA 3GD7A 1L0XB 2N8NA 3TQYA 1EEID 2B2TA 2A6EC 1X54A 2KJXA 3NBIA 4Y7NH 1I94Q 3GTQB 1H9SB 3KYHC 4U68A 2IWHA 1V1OA 1SN8A 2R92G 1I3QB 3K7UC 3A7LA 1L0WA 4CJ2C 3H3VI 3K58A 1E2VA 3S1RB 3HKZG 1RTNA 1Q12A 4ZUJA 2D9UA 5LL6S 2NN6I 1PTOH 1TWAB 3P7JA 1VQLA 1HNZQ 3EVQA 1Y8OB 1OXTA 3K81C 1J5EL 1PTOD 1K3BC 3IRBA 1BCPC 3AFPA 4C3JG 5CORA 2JSOA 3G6EA 4JI0Q 2KUMA 5CR3A 4M1UB 4NXNL 2NVXB 2F0GA 1U4RA 1HQMC 4LF9L 1S4ZA 3HOZB 4GOPA 3RZOB 2F0TA 3QOJA 1S72A 3PUVA 4OELB 2B63H 4APVA 4LJZC 3NP8A 5ELOA 1WI5A 2NVYH 1G291 4K0KQ 4KKUA 1CI3M 3DM1A 2F0MA 4PV1C 2K05A 2PQEA 5ELFA 4DV4L 4XDXA 1GJXA 3BZKA 3V05A 2EYFA 2AQ1B 2Y0SB 3HKZE 4F8MA 4QQBX 4RFBA 2AHOB 1KQSA 4BY7G 4IFDJ 3K8AA 4RCNA 3PO3B 4DR4Q 5FO7B 4DAVA 1VQMA 2EYOA 3OTOQ 1LO5D 3I2ZA 2ES2A 2B2UA 2EOTA 1CQFA 4RGTA 1VQCA 3NTHA 1BXTA 4ALPA 1XPUA 4F87A 3S2HB 2RCNA 3PIPA 4KHZA 5C44G 1G2TA 3CF5A 2FHTA 5I9PA 1SFOB 1BVSA 5BN5A 1BOSA 1VQ9A 1Q86C 2UU9L 2UXBQ 3OW7A 1WCMB 1D5XC 2D2CC 5JEAG 3H0GG 3FDTA 3SGIA 3GTGH 1K73C 2QKIC 4O0AA 4CKBA 1VQDA 2J7ZA 3A74A 1FR3A 4OHJA 1YJNA 1EFWA 1PHJA 1CA6A 2K5NA 2CKZB 1SNCA 4DK6C 3TN2A 1EOTA 1EQTA 2AUJD 3H6MA 3K5NA 3I4NG 3IL8A 3KJPA 2JA7G 1EY0A 2FJ2A 3GV6A 5IGDA 3KF8B 2CW0D 1VQFA 3HS0C 1BR9A 3K7AB 4BBRG 3KBGA 1ZYRC 3EBEA 4A75A 1EYCA 4P2CB 3CAMA 1HPCA 2VQFQ 3K0YA 3A56A 1PFMA 2Z1CA 2DY8A 3DEPA 3RLOA 2R6GA 5LL6X 4NDXA 1A6XA 2KVMA 2PYKA 4RGNA 2XGTA 1HH2P 1EEFD 1EYDA 1V1PB 2B2WC 4LFCL 1HJPA 3S16B 3I72A 3O13A 3SE0A 4A3MB 1PFSA 1GXDC 2K28A 4EQ5A 1D6EC 1TY2A 1QCBD 1JORA 2RF4A 2K5HA 2EYHA 2ALYB 3S24A 3I70A 2B39A 2JA5G 1VQJA 1IYUA 2A19A 5JJIA 4IPHA 3NE5B 3OSOA 1D5MC 4JI3L 3NELA 1NTGA 3VR2A 2E5LL 1R4PB 3TS2A 2YTVA 1ICFB 2K52A 1XMOQ 1UEAB 2OTLA 5EQ0A 2F1MA 3RMHA 1GO3E 5HURA 4GN5A 4JI2L 3J7AF 2FXQA 2KBNA 3E5SA 4RA8A 5C3EB 4K14A 3AYHB 3F2UA 4QGUA 3T4AC 2PNHA 1SXTA 1TWFH 1STNA 3RR5A 4LF7L 2SEBD 2BDNA 4GLXA 1HNWL 5A35A 1I4PA 3JAMi 4A3BB 1QNUA 1GUWA 1Y1WB 4BWGB 4A3LG 3KK7A 2QDBA 1JE4A 1AW7A 1QVCA 4IURA 4DNTB 1PH1A 2EIFA 2BOSA 3T53B 2XIWA 4N9PA 1BCPF 1NY4A 4XXEA 3MXGA 1JR0D 1QOHA 1LTGD 2KCMA 3PUXA 4A3FH 3GTOB 2NZHA 1F9PA 1SRUA 4HEDA 3SK6A 4JI8Q 2NVQH 2EE1A 3VR4A 3HOZG 2RKSA 3NQIA 1DZ1A 3ND8A 5E3FA 1MIUA 1HNZL 2B63G 4KMUC 4JI4Q 4FF4A 1L1OC 3ULJA 2DY7A 1TWCH 5CGKA 4JI0L 4PQXA 1HFNA 1I50H 2F4VQ 1TR5A 4XYOA 4H02A 1H9MA 3HOXB 2YYZA 2VB2X 3RNUA 3PF4A 3GTJH 2Y0SG 3Q24A 1IYJB 3A5UA 1VQ6A 3C1EA 3BYYB 1XTDA 4DA2A 1M90C 4OO1H 4P75A 3KUPA 4K0KL 4OONA 1G6PA 3R2TA 3M4OB 3MHBA 3PUYA 1ENAA 4UDUC 3MEHA 2EYMA 2UXDQ 4X3TA 4DV2Q 2PPBC 2NVTH 1E0BA 1I6VC 1IW7C 3IKJA 1JT8A 3KLSX 3CC2A 4C3HH 5CBAE 4HJ9A 1UEBA 2D0PA 4DR4L 2IW3A 1DXMA 1SNPA 2LKVA 3OTOL 4GKJQ 3T56B 5IT9L 5J22A 4Q5VA 4J1MA 4C1NK 3QWNA 2IJ0A 5IP9H 3CMEA 1PZID 4LF5Q 2DGYA 3D31A 3G48A 4GNXA 4X66Q 4LW1A 1WTPA 4KHPQ 3TDQA 1JWUD 4WJ4A 3ER0A 1D8LA 1MSGA 3S1QH 1SNDA 2UXBL 3S2DB 4P73A 3HG9A 1CZGA 2ZTEA 3ERSX 2E74C 3A0JA 3FP9A 3TBIB 3K6OA 1YBYA 1X9NA 1STBA 4CJ1B 2J0TD 4PMWA 1HQRD 1LTTD 3KF6B 4EGVA 3MFYA 4IQZA 4CHTB 2IX1A 1I4HA 4IFDG 5M3FB 3U58A 5C0XH 4CKEA 3AB9A 1LTAD 1EYAA 1GVPA 3GTKB 1MKHA 3AEVA 5ELCA 3L7ZC 4NKLA 1MJEA 4BS9A 2VQFL 2JA8H 3S1MB 5I2XA 4J8QA 5G3LF 4A3DH 3HFZB 1UE1A 1LT4D 1SE4A 4GS3A 3HOUH 4IZ8A 3NQTA 4FYDA 2KENA 2OT2A 5FO8B 1A62A 3BG3A 1M8AA 2EY6A 2G9DA 3UI2A 3GQBA 2YTXA 5T1IA 4A3CH 2I07B 2FFKB 4CKCA 1EZ8A 4X62Q 1HUMA 1Z7TA 5KIXA 1CSQA 1TQOA 3T16A 1K8GA 3HOVH 4QIWB 2LXJA 1J6QA 4A3KH 4IFDI 5KRUA 2VL6A 5ELDA 3EQLC 4CDDC 3TREA 1OXXK 4B3MQ 2Q8IB 4CGYB 3DEOA 1IBKQ 3L9AX 5C3EG 3B6YA 2XTIA 1Q8IA 1PH4A 1ET9A 1LACA 1HNXQ 4QJFA 4LF8Q 4FF1A 3H3VH 1TS5A 1EQVA 1K3RA 3OW2A 3U50C 1X56A 1DOMA 2NN6H 2B8FA 3PUWA 4DPGA 1IL8A 4J15A 1PRTB 1DYQA 5FLMG 1Y1WG 3KLSA 1CHQD 3K59A 2JEAI 1B2TA 4DKAC 2R92H 1PFBA 2OWOA 1KABA 5IYDG 4ME5A 3QO2A 4XT1B 5M5YH 4IALA 1E24A 4ME3A 4UY8C 3M85A 2KHIA 4MZ9A 2RDHA 4B9WA 1RDPD 3J7ZC 2WB1E 3CCEA 1T9HA 3S1NB 4C3JH 4R8IA 1KRSA 1CKMA 3VR5A 2QEXA 2PCFB 1H9RA 2HDMA 3C46A 1CKNB 4UP8A 1KLUD 1BCPD 4GLAC 3NK9A 1HXYD 4XT3B 1KAAA 2QDLA 2D0OA 4A3EB 3KLRA 2V4DA 3Q23A 5M5XB 3I3CA 1KTKA 2RBMA 1AN8A 5T1GA 2TSSA 2AMCB 3ULLA 2F0NA 3JAME 4DV0Q 3GO5A 2E2HH 4JI4L 2EJFC 3JC66 3DUZA 1II3A 4HJ7A 2PQAB 4KJOA 5M3MB 2F0HA 2K01A 3QB3A 3S17B 3I4OA 4B3RQ 1NR2A 4BY7H 4OWWB 3VYUA 5LMNW 2EY1A 1Q3LA 1N32Q 4C1NI 1YNXA 2A69D 3K0XA 3SHLA 2K03A 3NUCA 4QUCA 2F0UA 5HGTA 4U673 4IJLA 4DK3C 4WJWA 1X32A 4Z9CB 1YZ6A 1STAA 2Z0SA 5C44H 1E22A 2DNEA 2RDFA 4DK0A 2UXDL 4DV2L 5IE8A 3PO2B 4YHHQ 5EKKA 2KCTA 4G7ZC 4NPSA 1A63A 3H0GH 3D6CA 2Q2IA 5LMNQ 1VQNA 4G4KA 4DNRB 1EIYB 1I4QA 1Q82C 2HIXA 3ZYYX 3HOWB 4GKJL 1VQGA 3R8BA 3L3OC 3RN5A 2O4XA 3T51B 2F0EA 5CV6A 2N88A 4LF5L 4EQOA 1HR0W 3I55A 1X3QA 4X66L 5C3WA 4KHPL 3HRZC 1G6ZA 1X3PA 4HSPA 5DLQE 1ZXTA 2JA7H 4ZRZA 1DD2A 5EPKA 3M4YA 1VQPA 1STYA 4BBRH 1YVCA 4Y52H 5M3FG 2WFWA 1Q8KA 2EJMA 4ULLA 1U5KA 2EXDA 1EWHA 3A8IE 2VQEQ 2FINB 5CV4A 1BBXC 2JA8G 2CFMA 2I5LX 1HR0Q 1TY0A 4DAYB 2JP1A 3GTLH 3CQZB 3AU7A 4XQQA 5JOBA 2EXZA 4OWTB 5E4WC 3U4VA 4AIMA 2UXCQ 2XN9C 3HZXA 2PMZE 1AP0A 2B2VA 1JC7A 1IHZA 1TVXA 4AYBB 1EOVA 1O78A 1VDZA 1XMQQ 2E2JH 2EZVA 2L12A 3S15B 1JOKA 1F2ZA 3NWSA 1AZQA 2JA5H 1EWIA 3SR1A 1PLFA 1HA5A 2L55A 1PVOA 2LFNA 1YHAA 4R9WA 1HCZA 1EY5A 2NB0A 1YJ9A 2WV6D 3S14H 1K8OA 2CH4A 2WAQB 3TP6A 4FDBA 1JQYD 5BN3A 4X62L 3CCRA 1TWGB 3T1YQ 4HJAA 4KLKA 1VQEA 3M9BA 3UDFA 2L4NA 3GTPH 2QILA 3L0OA 1FNWA 1PRTC 4B3ML 5K36G 4X3SA 3A54A 1EY9A 1PV4A 3Q6SA 4MNOA 1PH7A 3PV0A 4L6TB 1QILA 3D3RA 2L0CA 4L5SA 3GTQH 3M4PA 3NENA 3PUZA 1HNXL 4LF8L 1DOKA 3W3AA 2ZT9C 2HCIA 1NBWA 2G9HD 4OIJA 1ESRA 2WKCA 2I5MX 5I6WA 4LFBQ 4A3LH 4CBVA 1TWAH 3SK4A 1EY8A 1K8AC 5ELEA 2CCZA 3FHWA 5GROA 1FD7D 5IP7G 4DR1L 3CD6A 4CDFC 4A3JB 1BUVT 1VF7A 4JOIC 4OGQC 2A1AA 5KGUA 1KDAA 3HOZH 2A68D 2F0LA 2EQSA 3E9HA 4YCUA 1SMXA 1SYDA 2CQAA 3RN2A 1DONA 2BE5C 2XSCA 1A2UA 3Q0AA 2CVRA 1L1OB 1IYVA 4JPBW 1SYFA 2DJFC 2A73B 1CUKA 4DR3Q 2KEEA 2H1EA 4XQNA 1C0AA 5M3MG 3ZJYC 3C1FA 5C6AA 1CSPA 4BBSB 3A5ZB 2K32A 1E1OA 1J9OA 4IUPA 1CFMA 2I46A 4X65Q 3MAQA 1JOQA 3HOYB 4GKKQ 4QUFA 4A3GB 1BQQT 4DV0L 1JJCB 3VR3A 1NSNS 4IUVA 2JXMB 1DGSA 3HGBA 3SK8A 4FXKC 3S2HH 1U4LA 5FO9B 2IX3A 4FXGC 4B3RL 1KD1C 1W2BA 3G7LA 3RZDB 1SFOH 1IW7D 1Y8NB 3GTMB 4OEMB 1KIXA 4YCWA 1N32L 2XWBB 1F9SA 3I91A 5I2YA 4DGZA 1YEZA 3I56A 1G91A 4JCVE 1SMYC 2F0SA 1EIFA 2SNSA 2F0DA 2ZJRA 1FJGQ 5DAUA 2Z8LA 4DUZQ 1V1QA 3STBC 1ILPA 2A8VA 1CK1A 2N49A 2K4KA 1IBMQ 5CYUA 1WTXA 2MNAA 1IZ6A 1GUTA 2ZTDA 3GTGB 3IFTA 3K7AH 5DEHA 1LT5D 1SBBB 2F4IA 3KJOA 2UUCQ 2VUMB 4G7OC 3GP7A 1BO0A 3CCQA 2E75C 1DJRD 3BDOA 1KL9A 1FYCA 2NTSA 4LFAL 2JEBI 1Q90A 2IHFA 4H13C 4P71A 4IUTA 2HD3A 4BA2I 1RF2D 2B2YC 4L5TA 1IL2A 4IFDH 3S16H 2G5DA 4POGA 1S5BD 1A2TA 2RHSB 2JA6G 4LF6L 3KDFA 4DN4M 1EU4A 3T13A 4DV1Q 2VZAA 4N8X1 4YWMA 1GUGA 1ASZA 2VQEL 1QUQA 1YNJC 1HR0L 3CMAA 2X6GA 2UXCL 4DV5Q 1FGBD 3E0JA 3FPPA 1GM5A 4RWSC 1V1PA 2RVLA 2Z6KA 5GQOA 2WAQG 4CDCC 4L5RC 2NZ1D 2J4XA 3J81L 1YIJA 5FLXE 3PF5A 2HIVA 5JPNC 4KD3A 2HQLA 2OCEA 1UE6A 2F0KA 3IFDA 1LTID 4O1NA 1SEBD 1OO9B 2YV5A 3TP7A 2EPBA 1CA5A 1PRTF 3TZDA 5C3EH 2D62A 4HAEA 5J3BA 1JCKB 5EGTA 1U4MA 2B2TC 5COYA 2MJ8A 2F03A 4DAPA 2IL8A 3MEFA 1XYIA 3CP0A 3F2CA 1YJWA 4J6HA 3LNNA 2R3ZA 5J39A 1B50A 1YHQA 3T1YL 2F0PA 2HT1A 1V9PA 1SAPA 4JVZA 3M7NA 3F8TA 5JPMC 5FLMH 1Y1WH 1HUNA 1I94L 5IYDH 1TU2B 3Q8DA 2LS01 1OTCA 2K5DA 3N52A 4DXFA 4A3JG 3BVZA 5IGBA 1EFID 4MTNA 4IPCA 4EVOA 1JMCA 3H15A 1ONLA 4GOPC 3S9WA 2Z4IA 3JAMc 1VQAA 1RD9D 1EY4A 4K5WA 5KNBA 4LAAA 3K80C 1F2YA 1PTOC 2PW7A 1B3QA 3QG1A 5FOBB 4HJ5A 5JAVA 1X3FA 1WD0A 2YU9H 5IYCG 1A0IA 4A3FB 3CC4A 4BBSG 4FF3A 4ZUIA 1HFGA 3X3NA 1HTPA 5KNDA 2EVBA 2Q2HA 5EPLA 3R3OA 5A2QL 3PO3G 5C4JB 5H1SE 3BU2A 4A3GG 2B2UC 1W6KA 3P1HA 1GUOA 3C2PA 2L5TA 4RHSA 5KNCA 2O5JC 2I0QA 3M4OH 3MA2B 1SE2A 1F9QA 1BDOA 1G2SA 3I7FA 3J81c 4OX9Q 1V43A 1UAPA 1LTLA 5EBCA 2UUAQ 1KAWA 1I5FA 3NBHB 4X65L 1JJ2A 1T5EA 1WCMG 3SDZA 4GKKL 1C4QA 1UUPA 1YI2A 1JB3A 4JI1Q 3J80c 2OXPA 2N55A 3M3YB 2EY2A 4JBKA 2NVTB 2Y0SE 3MZ5A 1KLGD 4C3HB 3PIO3 1N34Q 4IUUA 3PQIA 1MSHA 4X64Q 3S2DH 2QW7A 4E6IA 2ZTCA 5CV9A 4R1JA 1A8VA 4HMIA 3OOCA 2ENBA 4JI6Q 1AFPA 2VUMG 1HZBA 3LWUA 1X3EA 1ZKOA 3CHBD 3J7YW 4NXMQ 3M4QA 1FJGL 2Z4HA 4I7AA 4DV7Q 1L0YB 4HMJA 3H09A 4L63B 1W6JA 1EU3A 3DM3A 4K8IA 4B3TQ 3S1QB 5ELNA 2A74C 2PZTA 3HKSA 1LM0A 5M3FH 3P75A 1B3AA 1BNZA 4LUOA 3GTKH 2R93B 2E2IB 4OWXB 2E2DC 1TS3A 4A3MG 3T1HQ 1EL0A 3S1MH 3MC0B 5AJ3Q 2F0OA 5EAYA 1D1IA 4QMGA 4S3SA 2R7FA 1UE5A 4R4CA 1PYWD 4A93B 4WFN3 4HJ8A 5JJZA 4GLVB 2MUYA 5C4XB 5K5PA 4P72A 3DWAA 1B7YB 1PYBA 3U4ZA 3K5OA 4DV1L 4N9TA 5LMUQ 1I4RA 3BZCA 4FNFA 1N33Q 4AH6A 1JICA 1U4PA 3M7GA 1U0LA 3QR8A 4P74A 2RSNA 1VF5C 3CCJA 1H9KA 4JI5Q 1TKWB 4DV5L 3DMUA 3OPOA 5EPJA 1R4QB 3CXCA 3NSWA 1PH8A 4JI7Q 2XRQD 3ITPA 2XVSA 1YNNC 1VCIA 1PH6A 1K9MC 1Q1EA 1XMOL 1XPOA 4A3BG 1IKMA 5M5WH 2N78A 1QWYA 2BDOA 3X3MA 5K36H 3TEHB 4A76A 5IY0A 1PRTD 4MIUA 1RHPA 3D8GA 2HCCA 3FKIB 2A6ED 2AWOA 1QVGA 1IBLQ 4C3IB 1NAPA 4IOCA 1AZPA 5E1FA 1QJOA 1UE7A 3BJUA 3CKIB 2TMPA 5CV8A 3BVGA 1IKLA 4IUQA 1D2BA 1ZEQX 1F9RA 3S1NH 2MGSA 3GDEA 2VB3X 1CQVA 5D3IB 5IGGA 1PTOF 5IP7H 1MHWC 4DV3Q 1RTOA 1RCVD 1A3UA 3NHHA 2H4OA 1KC8C 1QB5D 4QF4A 1D5ZC 4A3EH 2AQ2B 5L37A 5M5XH 1XX8A 3HOXG 4JI8L 2R7ZB 4BY1B 1HA6A 1WYDA 3FVQA 1EYGA 1KHIA 2PI2A 4A3IB 3R93A 1D7QA 2YTYA 4ZKCB 1GUNA 2BE5D 2EYLA 2EYJA 4R4QA 1SYEA 1TXYA 1WVLA 2PNRC 3KFUA 1SJED 4DUYQ 1Y1VB 2WACA 5M3MH 1CKNA 2R7DA 1LYLA 1WTQA 3GV3A 1E2ZA 1JOOA 2F4VL 5JJLA 3K57A 1TS4A 3E3XA 3PGZA 2KEDA 5BR8Q 1NR4A 5EBDA 2C35B 1XXGA 2PO4A 2KQ3A 1VQOA 3DLLA 2KA7A 4TSSA 1NMGA 4K8JA 2VXWA 2HHHQ 1K8MA 3J7A5 1LTRD 2IX0A 2ZM6Q 2PQAA 3NTIA 1VQIA 4GNXC 4OX9L 1EQRA 3MVVA 4K6LA 4NB3A 4BY7B 2F0VA 1SJHD 2E8GA 1C8CA 2UUAL 2RQXA 2RHQB 3VA7A 4YY3Q 3TP5A 2Z9HA 2GVAA 3J7AV 1PH9A 3TSSA 2RSOA 4JI1L 5DNFA 1B8AA 3E0EA 2C5CA 2NWGA 5C44B 2QEJC 4KY7A 1QG7A 5TSSA 3U9SA 3STBD 3H0GB 3CCSA 4HSVA 2D5DA 2VNUD 4X64L 2R93G 2VY3A 1GHKA 1ZYRD 4ZYSA 1I4XA 3LGJA 4ZCKA 4JI6L 4XIGS 1I6HB 1WJJA 2NYZD 4FO2A 4NXML 3HP3A 3CU7A 4QL5A 4DV7L 5HY6A 3CQZH 2OF1A 3I4NB 4POFA 4FF2A 3NWTA 2AUKA 5CBEE 4B3TL 1SSOA 1CKOA 1O7IA 1ICWA 5FLXc 4A3CG 4KKSA 4A93G 1MGSA 5FJ8G 5GAHC 2JA6H 2L15A 1STHA 1RKNA 1Z47A 3MXNB 3RLFA 2N3SA 1XNRQ 2C9OA 5C4XG 2WP8J 4C2MH 3S15H 5G3LD 1LUZA 4BXXG 1K83B 3AFQA 4UAIA 4QB4A 1R9TB 1LTBD 2MO1A 4DAYA 1YNJD 1K0SA 2B2WA 2E76C 3W1BA 1TWGH 4K5XA 1N8RC 4HTHA 5C5LA 1EY7A 4JV5Q 1TWHB 3I4MB 2A6HC 2FMCA 2QF7A 5LMUL 4RGOS 4DXGA 1WTOA 1N33L 4I65A 1PMRA 1IBKL 3R2IA 1F77A 1PZJD 3PIOA 2F3VA 1N36Q 2ICIA 3KLWA 4HCSA 4M8AA 4YCVA 2KCCA 4JI7L 1I3QH 4KD4A 3H3VC 1Z9FA 3A8KE 5FK9C 4C3IG 2NZOA 3UDIA 4KN7C 4QIWE 1VQ5A 3S1RH 1H95A 5C4HA 1Q81C 2F0WA 2Q8RE 3D0FA 1SE8A 4N8FA 2VW9A 4Y7NB 3F2DA 1H9SA 1PZKD 1NMFA 4G7HC 1IBLL 2F0FA 4HCEA 4A3JH 4B3SQ 5CV7A 4LF4Q 1S3OA 2CWPA 2GA4B 2NVXH 2JK8A 4A3EG 4GOPB 4FXDA 4Q0FA 5IT9E 3RZOH 2MPMA 2B8GA 2CWAA 2O2LD 4F7XA 4IOAA 1H9JA 2R7ZG 1S5FD 4BY1G 1I4GA 4X3KA 1T5XD 3EN2A 4RKBA 1PTOB 4A3IG 4JC0A 2B29A 4ZQ3A 1NCVA 2QA4A 5HGQA 1JE5A 4DV3L 5KYIA 4IO9A 2PW5A 5IYCH 1Y1VG 2RCFA 1CM9A 4H7BA 4BBSH 4RCOA 1BBWA 1AEXA 1PA6A 3OMGA 5ELBA 2Z6BA 2PI2E 2WKDA 1O7LA 3PO3H 2MFIA 3IAYA 2B63B 1S40A 1U9RA 3HOYH 5JVG3 2NVYB 4A3GH 4DFAA 1L1OA 2K75A 1PDQA 1UWVA 4ZAIA 1LABA 4DUYL 4HR7B 3NTKA 1HZ9A 4IN3A 4FP5D 5JVH3 3EROA 1AH9A 4KV6A 3RZDH 1SNMA 2SDFA 2XNAC 4GN3B 2A69C 5BN4A 3PO2G 5BR8L 3GTMH 1WCMH 4DF7A 2B3GA 4TKOB 3MWYW 2BH2A 4HIDA 2GN5A 4LNQA 3HOWG 4EQPA 1IXRA 2HHHL 2ZM6L 1CT1D 4XTCS 2M9VA 4LMQD 3G71A 3BZDB 1Y14B 3CRKC 1XNQQ 5I9OA 2OQKA 5D14A 5GAEC 4H0LC 1EZ6A 2NUCA 4YHHL 1VQBA 3OYYA 2AKWB 4KHVA 5LMNL 4PZ6A 3ONAB 4RG1A 1K28A 2AQ3B 4JW0A 4QCLA 3E6ZX 4YY3L 3ICEA 2EJGC 1GUSA 2VUMH 5IGFA 2RDGA 3F2BA 1BBUA 1LT3D 1E1TA 3JAML 3BDLA 1W3SA 3VYSA 3RD4A 2K5WA 4R4TA 1Q1BA 4MTKA 1A3VA 4OIKA 2Q2TA 3Q22A 1YITA 2B2VC 1YHBA 3LX0A 4DNIA 3A7AB 3KF8A 1NUCA 3MXPA 3OMCA 4A3MH 1B9MA 3KDFB 4AYBG 1OXVA 4XQJA 3SK5A 1B9NA 1QUQB 2K5QA 5E7NA 3WDNA 4R4OA 2MHVA 5DM63 2K1BA 4MHEA 1SYBA 1ET6A 1UNSA 4QY7A 1LLRD 3D6WA 4V190 1KXLA 2DJGC 1SROA 1NJIC 2KHJA 4H44C 1FNVA 2QGQA 4DR6Q 3BYTB 3TMEA 4PZ8A 2ZXRA 1XNRL 4DR2Q 2JA9A 1XMQL 3I4MG 2X6LA 1WTHA 4CJ0B 2EDGA 1LTSD 2F52A 2ZXOA 5D65A 1Q7YC 1SDFA 1SE3A 1STEA 4KK7A 2V1CC 5NUCA 1ILQA 3J80L 2X69A 3CC7A 2JE6I 2K5VA 5IODA 3WWVA 4AYBE 4A3BH 5IYBG 1YNND 1FNUA 4JV5L 3NXWA 4JG2A 2BA0A 1JJGA 2FMMA 3TP8A 3P20A 2BA1A 3K5LA 4JBMA 3VYTA 2WB1B 1F2LA 2BH8A 1E3PA 1N36L 1TWFB 5CMDA 2JN4A 2WAQE 4ILWA 4XYQA 3AQQA 1AE2A 4C56C 4ABNA 2F3IA 4DR5Q 1HZAA 2CH4W 3GTOH 1VQHA 3W1GA 2ICEC 4LFBL 1E2WA 2PZUA 3UDXA 1B44D 3UE0A 1V8QA 4CDEC 5IWAQ 1PFNA 2WIIB 1VQ8A 1VQKA 3ULPA 1KNEA 2I5HA 5IOCA 4RMFA 4IPGA 4PNYA 1MJCA 3WOEA 4B3SL 4JBJA 2R61A 5M9OA 4LF4L 4DR7Q 2H5XA 3HOXH 4AQYQ 3CCUA 2M2LA 2A68C 2UUBQ 4GZYC 1MD2D 5KYLA 2NVQB 1E7ZA 4JBWA 3DWQA 3NPPA 4RKLA 3CPWA 2JJQA 3VA5A 5C4JH 2KOLA 2L11A 4LWCA 3J81i 3HOYG 1N9WA 1FL0A 2KCNA 2JYOA 3QJYA 4MN3A 1B1ZA 1LV9A 1Q46A 1TWCB 2YU9B 4DR3L 1I50B 1BKBA 2F0QA 1G51A 4UPAA 3GTJB 2K6AA 1Y69U 1WOCA 4DV6Q 3A55A 3J80i 5C0XJ 3OWEB 1VMCA 2PZWA 2QCPX 3EIVA 4RHRA 4DK1A 2SNMA 2HQEA 4PZ7A 2K04A 4GNXB 1QNKA 2LY7A 3M3YH 3E9IA 1MI2A 3PCOB 2LXKA 3EA6A 3VDYA 1EUJA 3UDGA 2MP1A 2AWNA 1RIPA 3NBHA 4A4IA 4YWKA 4KY6A 1A3TA 3KBXA 4ZKBB 2Q2UA 1ESFA 1HHVA 1KDCA 2ID0A 3I8ZA 3HEJA 4KI0A 3SEBA 2IY5B 4L8JA 2IT1A 2K50A 1XNQL 5I4DA 1WTRA 4JK1C 4IPDA 4DUZL 4B9XA 2PMZB 3ND9A 3D4RA 1JWMD 1LT6D 2CW0C 1IBML 2XRSD 2R93H 2E2IH 4IJHA 3EFXD 2IPKD 1GD7A 4WRDA 2UUCL 4O2DA 2OTJA 4UP7A 1M1KC 1AE3A 3MXUA 4JYAQ 1KDBA 1S5ED 4HIKA 1P16A 4HIOA 1GKHA 1ENFA 3G6JB 1KRTA 3KF6A
chains in the Genus database with same CATH topology
1L1OB 4A93H 2RHQB 1TWFH 5FJ8H 3RR5A 4LF7L 3W5OA 4YY3Q 2Z6KC 1CUKA 2GVAA 4GLXA 3CPFA 1PH9A 1HNWL 4DR3Q 3JAMi 4JI1L 5C4XH 1C0AA 5M3MG 3ZJYC 1C9OA 1B8AA 3E0EA 1CSPA 5GAGC 4BXXH 2GVBA 3A5ZB 2ATWA 1OXSC 1E1OA 4A3LG 1HZCA 4X65Q 3TS0A 1QVCA 3STBD 3CCSA 1PH1A 1NE3A 2EIFA 3KOJA 1C7YA 4GKKQ 4DV0L 1JJCB 4LUVA 2VNUD 4X64L 1DGSA 2R93G 1NY4A 4HIMA 2VY3A 4DR6L 2KCMA 3PUXA 4A3FH 4JI6L 3LGJA 4XIGS 2NZHA 3S2HH 4DR2L 1SRUA 4B3RL 4JI8Q 1WJJA 1KD1C 1RL2A 1W2BA 4NXML 2NVQH 1SFOH 4DV7L 4QL5A 5HY6A 3CQZH 4L5QA 3HOZG 1VQ4A 1X55A 4POFA 1KIXA 4YCWA 1N32L 2WB1G 1MIUA 1HNZL 4B3TL 2B63G 1CKOA 3FKIH 1X65A 1O7IA 4JI4Q 5FLXc 4A3CG 1L1OC 1YEZA 3CCMA 3I56A 1VQ7A 4C3IH 5FJ8G 5GAHC 4JCVE 4DAMA 2L15A 2JA6H 3ULJA 1TWCH 1Z47A 3PSIA 3MXNB 3RLFA 4JI0L 2N3SA 4EX5A 5IT9c 1I50H 1EIFA 1XNRQ 2F4VQ 2ZJRA 2WP8J 4H02A 5C4XG 2YYZA 1FJGQ 3RNUA 2IHEA 3PF4A 4C2MH 3S15H 1LUZA 1PH5A 4BXXG 4DUZQ 3AFQA 2Y0SG 3GTJH 1V1QA 1IYJB 2MO1A 3A5UA 4R4IA 3STBC 1VQ6A 2A8VA 4X6AH 2N49A 2K4KA 1IBMQ 1J5EQ 2MNAA 1IZ6A 1XTDA 1M90C 2ZTDA 4DR1Q 3W1BA 4P75A 2DUDA 4K0KL 4OONA 3K7AH 1G6PA 1TWGH 2UUCQ 3KJOA 1N8RC 4WJ3M 3PUYA 4DR5L 4NXNQ 4JV5Q 3CCQA 1KL9A 4A3FG 1P8LA 4LFAL 4DV2Q 4LF9Q 2NVTH 2UXDQ 2JEBI 4TVAB 5JEAJ 2IHFA 5LMUL 4BY1H 1N33L 2R7ZH 4P71A 3F1ZA 4BA2I 1IBKL 4A3IH 1JT8A 3PIOA 2Q2TA 3CC2A 4C3HH 5IWAL 4HJ9A 1N36Q 1UEBA 3TRZA 3KLWA 2D0PA 4L5TA 1IL2A 4DR4L 4YCVA 3S16H 3OTOL 4GKJQ 4JI7L 4POGA 1I3QH 1Y1VH 1Z9FA 1QZHA 2RHSB 2NZOA 3UDIA 4DV4Q 2JA6G 4JOIA 4LF6L 4QIWE 3KDFA 5IP9H 3CMEA 1PYSB 1VQ5A 4DV1Q 1B70B 2DGYA 2VZAA 3D31A 3G48A 4YWMA 4GNXA 4X66Q 4LW1A 4AQYL 1OXUA 3S1RH 1ASZA 2ZJQA 2UUBL 2VQEL 1QUQA 4KHPQ 1H95A 3RLNA 1HR0L 3CMAA 1Q81C 4WJ4A 3ER0A 1D8LA 3S1QH 3D0FA 2UXBL 2UXCL 1SE8A 4DV5Q 1L2FA 2VW9A 5GADC 1GM5A 3F2DA 2Z6KA 5GQOA 3CW2C 4P73A 2WAQG 1NMFA 1IBLL 4OO1G 4L5RC 4B3SQ 1YIJA 4A3JH 2ZTEA 4YWLA 3PF5A 4LF4Q 2HIVA 1S3OA 2CWPA 3ERSX 2NVXH 3A0JA 2HQLA 2JK8A 2OCEA 1UE6A 1YBYA 3FP9A 4A3EG 4GOPB 1X9NA 4LUZA 3RZOH 2CWAA 3PO2H 2YV5A 4IOAA 4PMWA 2R7ZG 5C3EH 4BY1G 2D62A 2UU9Q 3S17H 3EN2A 5J3BA 1PH3A 4A3IG 3KF6B 4JC0A 4DV6L 2B29A 4TQUS 2IX1A 3L2PA 1XPRA 3MEFA 3HOWH 2QA4A 4IFDG 3U58A 3CP0A 5HGQA 1JE5A 3F2CA 4DV3L 4IO9A 1YJWA 1GVPA 1MKHA 3AEVA 5IYCH 3L7ZC 2LSSA 1YHQA 1MJEA 1Y1VG 3T1YL 2VQFL 1V9PA 2HT1A 2JA8H 4BBSH 4OO1I 3NEMA 5IP9G 1BBWA 1XJVA 4A3DH 3HFZB 3M7NA 3F8TA 1UE1A 1PA6A 5JJKA 5FLMH 4GS3A 4PG3A 1Y1WH 3HOUH 2KENA 2PI2E 1FVIA 1A62A 4GN4B 3PO3H 2MFIA 1S40A 1EQQA 1N34L 1JB7A 3HOYH 1VS0A 2CQOA 1I94L 4A3GH 4A3CH 2YTXA 5IYDH 1L1OA 3Q8DA 1OTCA 2K75A 4X62Q 1FGUA 1UWVA 1CSQA 3J81j 4DUYL 1K8GA 1HZ9A 3HOVH 2LXJA 1J6QA 4A3JG 4A3KH 4IFDI 1I6HH 2OQ0A 1AH9A 2VL6A 4LFAQ 4MTNA 3TREA 4IPCA 1OXXK 1JMCA 3H15A 4B3MQ 3RZDH 4GOPC 4GN3B 1X6OA 1IBKQ 3JAMc 3PO2G 5BR8L 1VQAA 1ASYA 3GTMH 1QVFA 3I4NH 5C3EG 2ZJPA 1WCMH 3B6YA 3K80C 4LFCQ 2XTIA 1PH4A 2B3GA 1HNXQ 4QJFA 4LF8Q 2VS1A 2BH2A 3H3VH 4HJ5A 4HIDA 1K3RA 1X3FA 2GN5A 2MO0A 3OW2A 3U50C 4LNQA 3HOWG 1IXRA 5C0XG 2HHHL 2YU9H 1X56A 4LF6Q 2ZM6L 2MQHA 3PUWA 4XTCS 4DPGA 1A0IA 5IYCG 3G71A 3T1HL 1Y14B 3CC4A 1SR3A 4J15A 4OXPA 1XNQQ 3UE1A 4BBSG 2OQKA 4JYAL 4LF5Q 1K83H 5GAEC 1R9TH 4A3DG 5AJ3L 4YHHL 5FLMG 2JQOA 1Y1WG 1VQBA 2Q2HA 3OYYA 3HOUG 3CCLA 2AKWB 3CCVA 5LMNL 2JEAI 3PO3G 4PZ6A 4DKAC 2R92H 2OWOA 5H1SE 3BU2A 4JI3Q 2E5LQ 4RG1A 5IYDG 4A3GG 4YY3L 3ICEA 5M5YH 2I0QA 2VUMH 3M4OH 1E24A 4BA1I 4ME3A 1TWHH 3M85A 2KHIA 4MZ9A 4UY8C 3I4MH 3F2BA 1BBUA 3HOVG 3I7FA 1E1TA 3J81c 4A3KG 4OX9Q 5C0XI 1W3SA 4JI2Q 1V43A 2ASBA 4R4TA 1Q1BA 3J7ZC 1LTLA 2UUAQ 1K0RA 1KAWA 2WB1E 1I5FA 3NBHB 3G4SA 3CCEA 4X65L 1T9HA 1YITA 1QZGA 4UP9A 1JJ2A 1WCMG 4LF7Q 4JI5L 1YHBA 4C3JH 1KRSA 4GKKL 1CKMA 4DNIA 2QEXA 4A93G 3FKIG 1SLJA 1HNWQ 4A3MH 1CKNB 5IYBH 1YI2A 4JI1Q 4UP8A 4GLAC 3KDFB 4AYBG 3J80c 1OXVA 2D0OA 2NN6G 1PH2A 1QUQB 4JBKA 5E7NA 2K14A 1X3GA 2Y0SE 4R4OA 1WFQA 3GD7A 2N8NA 2AMCB 3TQYA 3ULLA 1N34Q 4QY7A 1X54A 1I94Q 4Y7NH 4DV0Q 3GO5A 3KYHC 1KXLA 1SROA 1SN8A 4X64Q 2E2HH 3JC66 4JI4L 2R92G 1NJIC 3S2DH 3K7UC 2ZTCA 2KHJA 4HJ7A 2QGQA 2PQAB 4R1JA 1A8VA 4DR6Q 4JI6Q 2VUMG 4PZ8A 1HZBA 1L0WA 4DR2Q 2JA9A 1XMQL 1X3EA 1XNRL 3I4OA 3H3VI 4NXMQ 4B3RQ 3I4MG 3M4QA 1FJGL 4DV7Q 4BY7H 2F52A 3HKZG 1Q12A 4OWWB 5LMNW 2NN6I 1N32Q 1VQLA 1YNXA 3DM3A 3K0XA 1HNZQ 5ELNA 4B3TQ 1Q7YC 3HKSA 1OXTA 3K81C 1J5EL 1LM0A 2V1CC 5M3FH 3CC7A 3IRBA 4LUOA 3AFPA 3GTKH 2JE6I 2K5VA 3G6EA 4OWXB 4IJLA 3WWVA 4DK3C 4AYBE 4JI0Q 4A3BH 4A3MG 5IYBG 3T1HQ 1YZ6A 4NXNL 3S1MH 4JV5L 2Z0SA 4JG2A 5C44H 1E22A 2BA0A 4LF9L 2UXDL 1JJGA 4DV2L 5AJ3Q 2BA1A 4GOPA 5IE8A 4YHHQ 4JBMA 1S72A 3PUVA 5EAYA 2KCTA 2B63H 4APVA 2BH8A 4NPSA 1E3PA 1N36L 3H0GH 5LMNQ 2Q2IA 1WI5A 2R7FA 5ELOA 1VQNA 4DR7L 2NVYH 1UE5A 1G291 4R4CA 1EIYB 1Q82C 2HIXA 4GKJL 4K0KQ 1VQGA 2WAQE 3RN5A 3AQQA 1AE2A 4HJ8A 2F3IA 4DR5Q 4GLVB 4DV4L 1HZAA 4P72A 3GTOH 1VQHA 3BZKA 3W1GA 4LF5L 1B7YB 1HR0W 1PYBA 3U4ZA 3I55A 4DV1L 4LFBL 5LMUQ 4X66L 3HKZE 1N33Q 3BZCA 4KHPL 4QQBX 3UDXA 4AH6A 2AHOB 3UE0A 1KQSA 4BY7G 4IFDJ 5DLQE 5IWAQ 3K8AA 2JA7H 1U0LA 4P74A 1VQ8A 1VQKA 4DR4Q 3ULPA 3CCJA 1VQMA 3OTOQ 4JI5Q 4DV5L 4JI7Q 1VQPA 2I5HA 3CXCA 1PH8A 3I2ZA 2ES2A 4RMFA 4BBRH 4IPGA 1YVCA 4Y52H 5M3FG 1MJCA 1VQCA 2WFWA 1Q8KA 1VCIA 1PH6A 1K9MC 4B3SL 1Q1EA 4JBJA 1XMOL 4ALPA 1XPOA 4LF4L 1XPUA 2H5XA 4A3BG 3HOXH 4DR7Q 1U5KA 4AQYQ 2EXDA 3CCUA 5M5WH 2UUBQ 2VQEQ 2RCNA 2JA8G 2N78A 3PIPA 4KHZA 2CFMA 5C44G 2I5LX 1HR0Q 3CF5A 4DAYB 3TEHB 1BVSA 1E7ZA 4A76A 4JBWA 5IY0A 3GTLH 4OWTB 1VQ9A 3U4VA 1Q86C 4AIMA 2UU9L 2UXCQ 2UXBQ 3CPWA 2PMZE 2JJQA 5JEAG 5C4JH 3H0GG 3SGIA 3J81i 4LWCA 3GTGH 1K73C 3HOYG 1N9WA 2AWOA 1FL0A 4O0AA 1QVGA 1IBLQ 1VQDA 3A74A 1EOVA 1Q46A 4IOCA 4DR3L 1YJNA 1UE7A 1EFWA 1XMQQ 1PHJA 1BKBA 2K5NA 2CKZB 2E2JH 1A63A 4DK6C 3BJUA 1G51A 4UPAA 2JA5H 1EWIA 1WOCA 4DV6Q 3I4NG 3J80i 1YHAA 5C0XJ 3S1NH 3KJPA 1PVOA 3GDEA 2JA7G 1YJ9A 3S14H 5IP7H 3EIVA 3KF8B 4DV3Q 4FDBA 1VQFA 4X62L 4BBRG 3CCRA 3EBEA 4A75A 3T1YQ 4HJAA 4KLKA 1VQEA 3CAMA 3M9BA 4PZ7A 3UDFA 2VQFQ 1KC8C 4A3EH 4GNXB 5M5XH 3GTPH 3M3YH 3HOXG 3E9IA 3L0OA 3PCOB 4JI8L 3RLOA 4B3ML 2LXKA 2R6GA 3VDYA 5K36G 1EUJA 1WYDA 1PV4A 4MNOA 3UDGA 1KHIA 2PI2A 3PV0A 1PH7A 1EYGA 1D7QA 2AWNA 4L5SA 1RIPA 2YTYA 2XGTA 3GTQH 1HH2P 4LFCL 4A4IA 4YWKA 1HJPA 3M4PA 3NENA 3PUZA 1HNXL 4R4QA 4LF8L 1TXYA 2Q2UA 3KFUA 1NBWA 4DUYQ 1PFSA 2ID0A 4KI0A 5M3MH 1CKNA 2IY5B 4EQ5A 2R7DA 1LYLA 2I5MX 2F4VL 4LFBQ 5JJLA 2IT1A 2K50A 2RF4A 2K5HA 1XNQL 4A3LH 3PGZA 4IPDA 5BR8Q 4DUZL 2C35B 2ALYB 1TWAH 3S24A 2JA5G 1VQJA 1K8AC 2A19A 1VQOA 5JJIA 3DLLA 4IPHA 1IBML 2CCZA 3FHWA 5GROA 4JI3L 3NELA 1NTGA 2R93H 1NMGA 5IP7G 4DR1L 2E2IH 2E5LL 2HHHQ 3CD6A 3TS2A 4IJHA 3J7A5 2IX0A 2YTVA 2K52A 2ZM6Q 1XMOQ 2OTLA 1GD7A 2PQAA 2UUCL 4JOIC 4O2DA 2OTJA 4UP7A 1M1KC 2A1AA 1VQIA 1AE3A 4GNXC 1GO3E 1EQRA 4OX9L 3HOZH 4JYAQ 4GN5A 4NB3A 4JI2L 2FXQA 2EQSA 4HIKA 2E8GA 3E9HA 4YCUA 1SMXA 1P16A 2KBNA 4HIOA 3RN2A 3AYHB 4QGUA 2UUAL 1GKHA 2PNHA 1KRTA 3KF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1O B;  4A93 H;  2RHQ B;  1TWF H;  5FJ8 H;  3RR5 A;  4LF7 L;  3W5O A;  4YY3 Q;  2Z6K C;  1CUK A;  2GVA A;  4GLX A;  3CPF A;  1PH9 A;  1HNW L;  4DR3 Q;  3JAM i;  4JI1 L;  5C4X H;  1C0A A;  5M3M G;  3ZJY C;  1C9O A;  1B8A A;  3E0E A;  1CSP A;  5GAG C;  4BXX H;  2GVB A;  3A5Z B;  2ATW A;  1OXS C;  1E1O A;  4A3L G;  1HZC A;  4X65 Q;  3TS0 A;  1QVC A;  3STB D;  3CCS A;  1PH1 A;  1NE3 A;  2EIF A;  3KOJ A;  1C7Y A;  4GKK Q;  4DV0 L;  1JJC B;  4LUV A;  2VNU D;  4X64 L;  1DGS A;  2R93 G;  1NY4 A;  4HIM A;  2VY3 A;  4DR6 L;  2KCM A;  3PUX A;  4A3F H;  4JI6 L;  3LGJ A;  4XIG S;  2NZH A;  3S2H H;  4DR2 L;  1SRU A;  4B3R L;  4JI8 Q;  1WJJ A;  1KD1 C;  1RL2 A;  1W2B A;  4NXM L;  2NVQ H;  1SFO H;  4DV7 L;  4QL5 A;  5HY6 A;  3CQZ H;  4L5Q A;  3HOZ G;  1VQ4 A;  1X55 A;  4POF A;  1KIX A;  4YCW A;  1N32 L;  2WB1 G;  1MIU A;  1HNZ L;  4B3T L;  2B63 G;  1CKO A;  3FKI H;  1X65 A;  1O7I A;  4JI4 Q;  5FLX c;  4A3C G;  1L1O C;  1YEZ A;  3CCM A;  3I56 A;  1VQ7 A;  4C3I H;  5FJ8 G;  5GAH C;  4JCV E;  4DAM A;  2L15 A;  2JA6 H;  3ULJ A;  1TWC H;  1Z47 A;  3PSI A;  3MXN B;  3RLF A;  4JI0 L;  2N3S A;  4EX5 A;  5IT9 c;  1I50 H;  1EIF A;  1XNR Q;  2F4V Q;  2ZJR A;  2WP8 J;  4H02 A;  5C4X G;  2YYZ A;  1FJG Q;  3RNU A;  2IHE A;  3PF4 A;  4C2M H;  3S15 H;  1LUZ A;  1PH5 A;  4BXX G;  4DUZ Q;  3AFQ A;  2Y0S G;  3GTJ H;  1V1Q A;  1IYJ B;  2MO1 A;  3A5U A;  4R4I A;  3STB C;  1VQ6 A;  2A8V A;  4X6A H;  2N49 A;  2K4K A;  1IBM Q;  1J5E Q;  2MNA A;  1IZ6 A;  1XTD A;  1M90 C;  2ZTD A;  4DR1 Q;  3W1B A;  4P75 A;  2DUD A;  4K0K L;  4OON A;  3K7A H;  1G6P A;  1TWG H;  2UUC Q;  3KJO A;  1N8R C;  4WJ3 M;  3PUY A;  4DR5 L;  4NXN Q;  4JV5 Q;  3CCQ A;  1KL9 A;  4A3F G;  1P8L A;  4LFA L;  4DV2 Q;  4LF9 Q;  2NVT H;  2UXD Q;  2JEB I;  4TVA B;  5JEA J;  2IHF A;  5LMU L;  4BY1 H;  1N33 L;  2R7Z H;  4P71 A;  3F1Z A;  4BA2 I;  1IBK L;  4A3I H;  1JT8 A;  3PIO A;  2Q2T A;  3CC2 A;  4C3H H;  5IWA L;  4HJ9 A;  1N36 Q;  1UEB A;  3TRZ A;  3KLW A;  2D0P A;  4L5T A;  1IL2 A;  4DR4 L;  4YCV A;  3S16 H;  3OTO L;  4GKJ Q;  4JI7 L;  4POG A;  1I3Q H;  1Y1V H;  1Z9F A;  1QZH A;  2RHS B;  2NZO A;  3UDI A;  4DV4 Q;  2JA6 G;  4JOI A;  4LF6 L;  4QIW E;  3KDF A;  5IP9 H;  3CME A;  1PYS B;  1VQ5 A;  4DV1 Q;  1B70 B;  2DGY A;  2VZA A;  3D31 A;  3G48 A;  4YWM A;  4GNX A;  4X66 Q;  4LW1 A;  4AQY L;  1OXU A;  3S1R H;  1ASZ A;  2ZJQ A;  2UUB L;  2VQE L;  1QUQ A;  4KHP Q;  1H95 A;  3RLN A;  1HR0 L;  3CMA A;  1Q81 C;  4WJ4 A;  3ER0 A;  1D8L A;  3S1Q H;  3D0F A;  2UXB L;  2UXC L;  1SE8 A;  4DV5 Q;  1L2F A;  2VW9 A;  5GAD C;  1GM5 A;  3F2D A;  2Z6K A;  5GQO A;  3CW2 C;  4P73 A;  2WAQ G;  1NMF A;  1IBL L;  4OO1 G;  4L5R C;  4B3S Q;  1YIJ A;  4A3J H;  2ZTE A;  4YWL A;  3PF5 A;  4LF4 Q;  2HIV A;  1S3O A;  2CWP A;  3ERS X;  2NVX H;  3A0J A;  2HQL A;  2JK8 A;  2OCE A;  1UE6 A;  1YBY A;  3FP9 A;  4A3E G;  4GOP B;  1X9N A;  4LUZ A;  3RZO H;  2CWA A;  3PO2 H;  2YV5 A;  4IOA A;  4PMW A;  2R7Z G;  5C3E H;  4BY1 G;  2D62 A;  2UU9 Q;  3S17 H;  3EN2 A;  5J3B A;  1PH3 A;  4A3I G;  3KF6 B;  4JC0 A;  4DV6 L;  2B29 A;  4TQU S;  2IX1 A;  3L2P A;  1XPR A;  3MEF A;  3HOW H;  2QA4 A;  4IFD G;  3U58 A;  3CP0 A;  5HGQ A;  1JE5 A;  3F2C A;  4DV3 L;  4IO9 A;  1YJW A;  1GVP A;  1MKH A;  3AEV A;  5IYC H;  3L7Z C;  2LSS A;  1YHQ A;  1MJE A;  1Y1V G;  3T1Y L;  2VQF L;  1V9P A;  2HT1 A;  2JA8 H;  4BBS H;  4OO1 I;  3NEM A;  5IP9 G;  1BBW A;  1XJV A;  4A3D H;  3HFZ B;  3M7N A;  3F8T A;  1UE1 A;  1PA6 A;  5JJK A;  5FLM H;  4GS3 A;  4PG3 A;  1Y1W H;  3HOU H;  2KEN A;  2PI2 E;  1FVI A;  1A62 A;  4GN4 B;  3PO3 H;  2MFI A;  1S40 A;  1EQQ A;  1N34 L;  1JB7 A;  3HOY H;  1VS0 A;  2CQO A;  1I94 L;  4A3G H;  4A3C H;  2YTX A;  5IYD H;  1L1O A;  3Q8D A;  1OTC A;  2K75 A;  4X62 Q;  1FGU A;  1UWV A;  1CSQ A;  3J81 j;  4DUY L;  1K8G A;  1HZ9 A;  3HOV H;  2LXJ A;  1J6Q A;  4A3J G;  4A3K H;  4IFD I;  1I6H H;  2OQ0 A;  1AH9 A;  2VL6 A;  4LFA Q;  4MTN A;  3TRE A;  4IPC A;  1OXX K;  1JMC A;  3H15 A;  4B3M Q;  3RZD H;  4GOP C;  4GN3 B;  1X6O A;  1IBK Q;  3JAM c;  3PO2 G;  5BR8 L;  1VQA A;  1ASY A;  3GTM H;  1QVF A;  3I4N H;  5C3E G;  2ZJP A;  1WCM H;  3B6Y A;  3K80 C;  4LFC Q;  2XTI A;  1PH4 A;  2B3G A;  1HNX Q;  4QJF A;  4LF8 Q;  2VS1 A;  2BH2 A;  3H3V H;  4HJ5 A;  4HID A;  1K3R A;  1X3F A;  2GN5 A;  2MO0 A;  3OW2 A;  3U50 C;  4LNQ A;  3HOW G;  1IXR A;  5C0X G;  2HHH L;  2YU9 H;  1X56 A;  4LF6 Q;  2ZM6 L;  2MQH A;  3PUW A;  4XTC S;  4DPG A;  1A0I A;  5IYC G;  3G71 A;  3T1H L;  1Y14 B;  3CC4 A;  1SR3 A;  4J15 A;  4OXP A;  1XNQ Q;  3UE1 A;  4BBS G;  2OQK A;  4JYA L;  4LF5 Q;  1K83 H;  5GAE C;  1R9T H;  4A3D G;  5AJ3 L;  4YHH L;  5FLM G;  2JQO A;  1Y1W G;  1VQB A;  2Q2H A;  3OYY A;  3HOU G;  3CCL A;  2AKW B;  3CCV A;  5LMN L;  2JEA I;  3PO3 G;  4PZ6 A;  4DKA C;  2R92 H;  2OWO A;  5H1S E;  3BU2 A;  4JI3 Q;  2E5L Q;  4RG1 A;  5IYD G;  4A3G G;  4YY3 L;  3ICE A;  5M5Y H;  2I0Q A;  2VUM H;  3M4O H;  1E24 A;  4BA1 I;  4ME3 A;  1TWH H;  3M85 A;  2KHI A;  4MZ9 A;  4UY8 C;  3I4M H;  3F2B A;  1BBU A;  3HOV G;  3I7F A;  1E1T A;  3J81 c;  4A3K G;  4OX9 Q;  5C0X I;  1W3S A;  4JI2 Q;  1V43 A;  2ASB A;  4R4T A;  1Q1B A;  3J7Z C;  1LTL A;  2UUA Q;  1K0R A;  1KAW A;  2WB1 E;  1I5F A;  3NBH B;  3G4S A;  3CCE A;  4X65 L;  1T9H A;  1YIT A;  1QZG A;  4UP9 A;  1JJ2 A;  1WCM G;  4LF7 Q;  4JI5 L;  1YHB A;  4C3J H;  1KRS A;  4GKK L;  1CKM A;  4DNI A;  2QEX A;  4A93 G;  3FKI G;  1SLJ A;  1HNW Q;  4A3M H;  1CKN B;  5IYB H;  1YI2 A;  4JI1 Q;  4UP8 A;  4GLA C;  3KDF B;  4AYB G;  3J80 c;  1OXV A;  2D0O A;  2NN6 G;  1PH2 A;  1QUQ B;  4JBK A;  5E7N A;  2K14 A;  1X3G A;  2Y0S E;  4R4O A;  1WFQ A;  3GD7 A;  2N8N A;  2AMC B;  3TQY A;  3ULL A;  1N34 Q;  4QY7 A;  1X54 A;  1I94 Q;  4Y7N H;  4DV0 Q;  3GO5 A;  3KYH C;  1KXL A;  1SRO A;  1SN8 A;  4X64 Q;  2E2H H;  3JC6 6;  4JI4 L;  2R92 G;  1NJI C;  3S2D H;  3K7U C;  2ZTC A;  2KHJ A;  4HJ7 A;  2QGQ A;  2PQA B;  4R1J A;  1A8V A;  4DR6 Q;  4JI6 Q;  2VUM G;  4PZ8 A;  1HZB A;  1L0W A;  4DR2 Q;  2JA9 A;  1XMQ L;  1X3E A;  1XNR L;  3I4O A;  3H3V I;  4NXM Q;  4B3R Q;  3I4M G;  3M4Q A;  1FJG L;  4DV7 Q;  4BY7 H;  2F52 A;  3HKZ G;  1Q12 A;  4OWW B;  5LMN W;  2NN6 I;  1N32 Q;  1VQL A;  1YNX A;  3DM3 A;  3K0X A;  1HNZ Q;  5ELN A;  4B3T Q;  1Q7Y C;  3HKS A;  1OXT A;  3K81 C;  1J5E L;  1LM0 A;  2V1C C;  5M3F H;  3CC7 A;  3IRB A;  4LUO A;  3AFP A;  3GTK H;  2JE6 I;  2K5V A;  3G6E A;  4OWX B;  4IJL A;  3WWV A;  4DK3 C;  4AYB E;  4JI0 Q;  4A3B H;  4A3M G;  5IYB G;  3T1H Q;  1YZ6 A;  4NXN L;  3S1M H;  4JV5 L;  2Z0S A;  4JG2 A;  5C44 H;  1E22 A;  2BA0 A;  4LF9 L;  2UXD L;  1JJG A;  4DV2 L;  5AJ3 Q;  2BA1 A;  4GOP A;  5IE8 A;  4YHH Q;  4JBM A;  1S72 A;  3PUV A;  5EAY A;  2KCT A;  2B63 H;  4APV A;  2BH8 A;  4NPS A;  1E3P A;  1N36 L;  3H0G H;  5LMN Q;  2Q2I A;  1WI5 A;  2R7F A;  5ELO A;  1VQN A;  4DR7 L;  2NVY H;  1UE5 A;  1G29 1;  4R4C A;  1EIY B;  1Q82 C;  2HIX A;  4GKJ L;  4K0K Q;  1VQG A;  2WAQ E;  3RN5 A;  3AQQ A;  1AE2 A;  4HJ8 A;  2F3I A;  4DR5 Q;  4GLV B;  4DV4 L;  1HZA A;  4P72 A;  3GTO H;  1VQH A;  3BZK A;  3W1G A;  4LF5 L;  1B7Y B;  1HR0 W;  1PYB A;  3U4Z A;  3I55 A;  4DV1 L;  4LFB L;  5LMU Q;  4X66 L;  3HKZ E;  1N33 Q;  3BZC A;  4KHP L;  4QQB X;  3UDX A;  4AH6 A;  2AHO B;  3UE0 A;  1KQS A;  4BY7 G;  4IFD J;  5DLQ E;  5IWA Q;  3K8A A;  2JA7 H;  1U0L A;  4P74 A;  1VQ8 A;  1VQK A;  4DR4 Q;  3ULP A;  3CCJ A;  1VQM A;  3OTO Q;  4JI5 Q;  4DV5 L;  4JI7 Q;  1VQP A;  2I5H A;  3CXC A;  1PH8 A;  3I2Z A;  2ES2 A;  4RMF A;  4BBR H;  4IPG A;  1YVC A;  4Y52 H;  5M3F G;  1MJC A;  1VQC A;  2WFW A;  1Q8K A;  1VCI A;  1PH6 A;  1K9M C;  4B3S L;  1Q1E A;  4JBJ A;  1XMO L;  4ALP A;  1XPO A;  4LF4 L;  1XPU A;  2H5X A;  4A3B G;  3HOX H;  4DR7 Q;  1U5K A;  4AQY Q;  2EXD A;  3CCU A;  5M5W H;  2UUB Q;  2VQE Q;  2RCN A;  2JA8 G;  2N78 A;  3PIP A;  4KHZ A;  2CFM A;  5C44 G;  2I5L X;  1HR0 Q;  3CF5 A;  4DAY B;  3TEH B;  1BVS A;  1E7Z A;  4A76 A;  4JBW A;  5IY0 A;  3GTL H;  4OWT B;  1VQ9 A;  3U4V A;  1Q86 C;  4AIM A;  2UU9 L;  2UXC Q;  2UXB Q;  3CPW A;  2PMZ E;  2JJQ A;  5JEA G;  5C4J H;  3H0G G;  3SGI A;  3J81 i;  4LWC A;  3GTG H;  1K73 C;  3HOY G;  1N9W A;  2AWO A;  1FL0 A;  4O0A A;  1QVG A;  1IBL Q;  1VQD A;  3A74 A;  1EOV A;  1Q46 A;  4IOC A;  4DR3 L;  1YJN A;  1UE7 A;  1EFW A;  1XMQ Q;  1PHJ A;  1BKB A;  2K5N A;  2CKZ B;  2E2J H;  1A63 A;  4DK6 C;  3BJU A;  1G51 A;  4UPA A;  2JA5 H;  1EWI A;  1WOC A;  4DV6 Q;  3I4N G;  3J80 i;  1YHA A;  5C0X J;  3S1N H;  3KJP A;  1PVO A;  3GDE A;  2JA7 G;  1YJ9 A;  3S14 H;  5IP7 H;  3EIV A;  3KF8 B;  4DV3 Q;  4FDB A;  1VQF A;  4X62 L;  4BBR G;  3CCR A;  3EBE A;  4A75 A;  3T1Y Q;  4HJA A;  4KLK A;  1VQE A;  3CAM A;  3M9B A;  4PZ7 A;  3UDF A;  2VQF Q;  1KC8 C;  4A3E H;  4GNX B;  5M5X H;  3GTP H;  3M3Y H;  3HOX G;  3E9I A;  3L0O A;  3PCO B;  4JI8 L;  3RLO A;  4B3M L;  2LXK A;  2R6G A;  3VDY A;  5K36 G;  1EUJ A;  1WYD A;  1PV4 A;  4MNO A;  3UDG A;  1KHI A;  2PI2 A;  3PV0 A;  1PH7 A;  1EYG A;  1D7Q A;  2AWN A;  4L5S A;  1RIP A;  2YTY A;  2XGT A;  3GTQ H;  1HH2 P;  4LFC L;  4A4I A;  4YWK A;  1HJP A;  3M4P A;  3NEN A;  3PUZ A;  1HNX L;  4R4Q A;  4LF8 L;  1TXY A;  2Q2U A;  3KFU A;  1NBW A;  4DUY Q;  1PFS A;  2ID0 A;  4KI0 A;  5M3M H;  1CKN A;  2IY5 B;  4EQ5 A;  2R7D A;  1LYL A;  2I5M X;  2F4V L;  4LFB Q;  5JJL A;  2IT1 A;  2K50 A;  2RF4 A;  2K5H A;  1XNQ L;  4A3L H;  3PGZ A;  4IPD A;  5BR8 Q;  4DUZ L;  2C35 B;  2ALY B;  1TWA H;  3S24 A;  2JA5 G;  1VQJ A;  1K8A C;  2A19 A;  1VQO A;  5JJI A;  3DLL A;  4IPH A;  1IBM L;  2CCZ A;  3FHW A;  5GRO A;  4JI3 L;  3NEL A;  1NTG A;  2R93 H;  1NMG A;  5IP7 G;  4DR1 L;  2E2I H;  2E5L L;  2HHH Q;  3CD6 A;  3TS2 A;  4IJH A;  3J7A 5;  2IX0 A;  2YTV A;  2K52 A;  2ZM6 Q;  1XMO Q;  2OTL A;  1GD7 A;  2PQA A;  2UUC L;  4JOI C;  4O2D A;  2OTJ A;  4UP7 A;  1M1K C;  2A1A A;  1VQI A;  1AE3 A;  4GNX C;  1GO3 E;  1EQR A;  4OX9 L;  3HOZ H;  4JYA Q;  4GN5 A;  4NB3 A;  4JI2 L;  2FXQ A;  2EQS A;  4HIK A;  2E8G A;  3E9H A;  4YCU A;  1SMX A;  1P16 A;  2KBN A;  4HIO A;  3RN2 A;  3AYH B;  4QGU A;  2UUA L;  1GKH A;  2PNH A;  1KRT A;  3KF6 A; 
#chains in the Genus database with same CATH topology
 4A93 H;  4RH6 A;  3BVM A;  5FJ8 H;  3D4W A;  3W5O A;  5C5M A;  2F0I A;  2Z6K C;  3I4L A;  4KJN A;  3CPF A;  1VMP A;  5KEE A;  3H94 A;  5C4X H;  1B53 A;  1C9O A;  1HTL D;  2JA8 B;  5GAG C;  4BXX H;  2GVB A;  5F2D A;  2ATW A;  3A8J E;  1M4V A;  1OXS C;  2EY5 A;  4A3D B;  2L9H A;  2NBF A;  3HOU B;  1D1K A;  3MTS A;  1HZC A;  2P5Z X;  4K2K A;  5EKI A;  3TS0 A;  1NE3 A;  1EIH A;  3KOJ A;  1C7Y A;  3BDC A;  2ZXP A;  4LUV A;  3QOL A;  2M00 A;  1SNO A;  3ERQ A;  4ODG A;  4HIM A;  4NW2 A;  2O5I C;  4DR6 L;  3HOV B;  4A3K B;  4FVM A;  5I6Y A;  4LK1 C;  3SXH A;  3FEW X;  4DR2 L;  1CHP D;  1RL2 A;  2DNC A;  3LWE A;  2A6H D;  4KTA A;  4L5Q A;  1XWE A;  1B4O A;  1VQ4 A;  1TT2 A;  1X55 A;  5ISR A;  2WB1 G;  4K2L A;  3FKI H;  1X65 A;  5CV5 A;  1RJT A;  3CCM A;  1VQ7 A;  4C3I H;  4DAM A;  3DHQ A;  3PSI A;  5AFW A;  4EX5 A;  5IT9 c;  1HRJ A;  5J1Z A;  4KY5 A;  2IHE A;  2F0J A;  1JWS D;  4HN7 A;  5M5W B;  3FMC A;  1PH5 A;  3PIP 3;  4R4I A;  4PMC A;  1ENC A;  3CRL C;  1WTV A;  4X6A H;  1O7Z A;  3I73 A;  1CZW A;  3RUZ A;  2WIN B;  1S5D D;  1J5E Q;  4G57 A;  4ID6 A;  2R92 B;  3U9O A;  4DR1 Q;  2LMC B;  2DUD A;  5M5Y B;  4ZLT F;  4WJ3 M;  4NXN Q;  4DR5 L;  2F3W A;  3URY A;  4A3F G;  1P8L A;  4LF9 Q;  3HKZ B;  4RAU C;  5CC4 A;  4TVA B;  5JEA J;  3TZU A;  2R7Z H;  4BY1 H;  3DWP A;  3F1Z A;  3DXJ C;  4A3I H;  3AMU A;  1GOZ A;  3QIA A;  5IWA L;  3TRZ A;  1S5C D;  1SYC A;  4V0B A;  5FLX L;  1C48 A;  5IIF A;  1EIG A;  2HDL A;  1BCP B;  4C3J B;  3FRP B;  5D3D A;  3N6R A;  2NTT A;  1Y1V H;  3V96 A;  1QZH A;  4DV4 Q;  2HUG A;  4JOI A;  1PYS B;  3S17 H;  4DR7 L;  1B70 B;  3OIP A;  4AQY L;  1OXU A;  2ZJQ A;  2UUB L;  5IGC A;  3RLN A;  1QE6 A;  3OHX C;  1L2F A;  5GAD C;  4O42 A;  2KEC A;  2E2H B;  3CW2 C;  1EWC A;  4OO1 G;  1Z6H A;  4YWL A;  2EYP A;  1DM0 B;  2KHS A;  5IGE A;  3MFG A;  4LUZ A;  4ZK9 B;  3PO2 H;  1XTC D;  5E4X A;  4PMB A;  3BS1 A;  4K6D A;  2UU9 Q;  4UHV A;  1PH3 A;  4K5V A;  4DV6 L;  4TQU S;  4C3H G;  1DCZ A;  3L2P A;  2OEO A;  3SVM A;  1XPR A;  2XWJ B;  4YIJ A;  3HOW H;  1GHJ A;  1PXU A;  3OIQ A;  2LSS A;  4OL7 A;  1DOL A;  3H91 A;  1SMY D;  4R8N A;  4OO1 I;  3EJI A;  3NEM A;  5IP9 G;  1XJV A;  5JJK A;  1SYG A;  1KNA A;  2SOB A;  4PG3 A;  3J81 E;  1A15 A;  2RA4 A;  5C4Z A;  4GN4 B;  1FVI A;  5LHY 1;  5JEA H;  1EQQ A;  4TRD A;  1N34 L;  1JB7 A;  1VS0 A;  2CQO A;  3OWF A;  3PMF A;  1TS2 A;  4IUN A;  1FGU A;  5DM7 3;  3J81 j;  3C3L A;  1I6H H;  2OQ0 A;  4LFA Q;  1WTW A;  4KN4 C;  3J80 E;  1X6O A;  1ASY A;  3I4N H;  1QVF A;  2ZJP A;  2JA7 B;  2L1B A;  1STG A;  4LFC Q;  3WOF A;  2VS1 A;  3VYR A;  3D4D A;  4BBR B;  2MO0 A;  1ROD A;  4KKT A;  1F2M A;  5C0X G;  1O7Y A;  4LF6 Q;  5EJW A;  2MQH A;  4NP5 A;  2A5H A;  1ML0 D;  4DU9 A;  3T1H L;  4EQN A;  1SR3 A;  4OXP A;  3UE1 A;  4JYA L;  1G8Z D;  1K83 H;  1R9T H;  4A3D G;  5AJ3 L;  3GTL B;  2JQO A;  4X3U A;  2B2Y A;  3HOU G;  4F88 A;  3CCL A;  1NNX A;  4WOR A;  3CCV A;  1BF4 A;  3VR6 A;  1J8I A;  2CHB D;  3I90 A;  1CTM A;  5EKL A;  1MBY A;  5C3X A;  2E5L Q;  4JI3 Q;  1EY6 A;  1O80 A;  4B08 A;  2JA6 B;  2DN8 A;  4BA1 I;  3MXN A;  1TWH H;  3I4M H;  3HOV G;  4A3K G;  2E2J B;  1TII D;  5C0X I;  1Y8P B;  4I7Z C;  4JI2 Q;  4C2M B;  2K7V A;  2ASB A;  1SNQ A;  3V2T A;  4NMZ A;  2JA5 B;  1K0R A;  2Q8T A;  1QZG A;  3G4S A;  3K5M A;  4RGM A;  4UP9 A;  2BCO A;  4LF7 Q;  4JI5 L;  3S14 B;  3FKI G;  1SLJ A;  2K33 A;  1HNW Q;  5IYB H;  5FKA C;  1WD1 A;  5A2Q E;  3FPU B;  2NN6 G;  1PH2 A;  3GTP B;  2K14 A;  1X3G A;  3W2D A;  1WFQ A;  3GD7 A;  1L0X B;  2N8N A;  3TQY A;  1EEI D;  2B2T A;  2A6E C;  1X54 A;  2KJX A;  3NBI A;  4Y7N H;  1I94 Q;  3GTQ B;  1H9S B;  3KYH C;  4U68 A;  2IWH A;  1V1O A;  1SN8 A;  2R92 G;  1I3Q B;  3K7U C;  3A7L A;  1L0W A;  4CJ2 C;  3H3V I;  3K58 A;  1E2V A;  3S1R B;  3HKZ G;  1RTN A;  1Q12 A;  4ZUJ A;  2D9U A;  5LL6 S;  2NN6 I;  1PTO H;  1TWA B;  3P7J A;  1VQL A;  1HNZ Q;  3EVQ A;  1Y8O B;  1OXT A;  3K81 C;  1J5E L;  1PTO D;  1K3B C;  3IRB A;  1BCP C;  3AFP A;  4C3J G;  5COR A;  2JSO A;  3G6E A;  4JI0 Q;  2KUM A;  5CR3 A;  4M1U B;  4NXN L;  2NVX B;  2F0G A;  1U4R A;  1HQM C;  4LF9 L;  1S4Z A;  3HOZ B;  4GOP A;  3RZO B;  2F0T A;  3QOJ A;  1S72 A;  3PUV A;  4OEL B;  2B63 H;  4APV A;  4LJZ C;  3NP8 A;  5ELO A;  1WI5 A;  2NVY H;  1G29 1;  4K0K Q;  4KKU A;  1CI3 M;  3DM1 A;  2F0M A;  4PV1 C;  2K05 A;  2PQE A;  5ELF A;  4DV4 L;  4XDX A;  1GJX A;  3BZK A;  3V05 A;  2EYF A;  2AQ1 B;  2Y0S B;  3HKZ E;  4F8M A;  4QQB X;  4RFB A;  2AHO B;  1KQS A;  4BY7 G;  4IFD J;  3K8A A;  4RCN A;  3PO3 B;  4DR4 Q;  5FO7 B;  4DAV A;  1VQM A;  2EYO A;  3OTO Q;  1LO5 D;  3I2Z A;  2ES2 A;  2B2U A;  2EOT A;  1CQF A;  4RGT A;  1VQC A;  3NTH A;  1BXT A;  4ALP A;  1XPU A;  4F87 A;  3S2H B;  2RCN A;  3PIP A;  4KHZ A;  5C44 G;  1G2T A;  3CF5 A;  2FHT A;  5I9P A;  1SFO B;  1BVS A;  5BN5 A;  1BOS A;  1VQ9 A;  1Q86 C;  2UU9 L;  2UXB Q;  3OW7 A;  1WCM B;  1D5X C;  2D2C C;  5JEA G;  3H0G G;  3FDT A;  3SGI A;  3GTG H;  1K73 C;  2QKI C;  4O0A A;  4CKB A;  1VQD A;  2J7Z A;  3A74 A;  1FR3 A;  4OHJ A;  1YJN A;  1EFW A;  1PHJ A;  1CA6 A;  2K5N A;  2CKZ B;  1SNC A;  4DK6 C;  3TN2 A;  1EOT A;  1EQT A;  2AUJ D;  3H6M A;  3K5N A;  3I4N G;  3IL8 A;  3KJP A;  2JA7 G;  1EY0 A;  2FJ2 A;  3GV6 A;  5IGD A;  3KF8 B;  2CW0 D;  1VQF A;  3HS0 C;  1BR9 A;  3K7A B;  4BBR G;  3KBG A;  1ZYR C;  3EBE A;  4A75 A;  1EYC A;  4P2C B;  3CAM A;  1HPC A;  2VQF Q;  3K0Y A;  3A56 A;  1PFM A;  2Z1C A;  2DY8 A;  3DEP A;  3RLO A;  2R6G A;  5LL6 X;  4NDX A;  1A6X A;  2KVM A;  2PYK A;  4RGN A;  2XGT A;  1HH2 P;  1EEF D;  1EYD A;  1V1P B;  2B2W C;  4LFC L;  1HJP A;  3S16 B;  3I72 A;  3O13 A;  3SE0 A;  4A3M B;  1PFS A;  1GXD C;  2K28 A;  4EQ5 A;  1D6E C;  1TY2 A;  1QCB D;  1JOR A;  2RF4 A;  2K5H A;  2EYH A;  2ALY B;  3S24 A;  3I70 A;  2B39 A;  2JA5 G;  1VQJ A;  1IYU A;  2A19 A;  5JJI A;  4IPH A;  3NE5 B;  3OSO A;  1D5M C;  4JI3 L;  3NEL A;  1NTG A;  3VR2 A;  2E5L L;  1R4P B;  3TS2 A;  2YTV A;  1ICF B;  2K52 A;  1XMO Q;  1UEA B;  2OTL A;  5EQ0 A;  2F1M A;  3RMH A;  1GO3 E;  5HUR A;  4GN5 A;  4JI2 L;  3J7A F;  2FXQ A;  2KBN A;  3E5S A;  4RA8 A;  5C3E B;  4K14 A;  3AYH B;  3F2U A;  4QGU A;  3T4A C;  2PNH A;  1SXT A;  1TWF H;  1STN A;  3RR5 A;  4LF7 L;  2SEB D;  2BDN A;  4GLX A;  1HNW L;  5A35 A;  1I4P A;  3JAM i;  4A3B B;  1QNU A;  1GUW A;  1Y1W B;  4BWG B;  4A3L G;  3KK7 A;  2QDB A;  1JE4 A;  1AW7 A;  1QVC A;  4IUR A;  4DNT B;  1PH1 A;  2EIF A;  2BOS A;  3T53 B;  2XIW A;  4N9P A;  1BCP F;  1NY4 A;  4XXE A;  3MXG A;  1JR0 D;  1QOH A;  1LTG D;  2KCM A;  3PUX A;  4A3F H;  3GTO B;  2NZH A;  1F9P A;  1SRU A;  4HED A;  3SK6 A;  4JI8 Q;  2NVQ H;  2EE1 A;  3VR4 A;  3HOZ G;  2RKS A;  3NQI A;  1DZ1 A;  3ND8 A;  5E3F A;  1MIU A;  1HNZ L;  2B63 G;  4KMU C;  4JI4 Q;  4FF4 A;  1L1O C;  3ULJ A;  2DY7 A;  1TWC H;  5CGK A;  4JI0 L;  4PQX A;  1HFN A;  1I50 H;  2F4V Q;  1TR5 A;  4XYO A;  4H02 A;  1H9M A;  3HOX B;  2YYZ A;  2VB2 X;  3RNU A;  3PF4 A;  3GTJ H;  2Y0S G;  3Q24 A;  1IYJ B;  3A5U A;  1VQ6 A;  3C1E A;  3BYY B;  1XTD A;  4DA2 A;  1M90 C;  4OO1 H;  4P75 A;  3KUP A;  4K0K L;  4OON A;  1G6P A;  3R2T A;  3M4O B;  3MHB A;  3PUY A;  1ENA A;  4UDU C;  3MEH A;  2EYM A;  2UXD Q;  4X3T A;  4DV2 Q;  2PPB C;  2NVT H;  1E0B A;  1I6V C;  1IW7 C;  3IKJ A;  1JT8 A;  3KLS X;  3CC2 A;  4C3H H;  5CBA E;  4HJ9 A;  1UEB A;  2D0P A;  4DR4 L;  2IW3 A;  1DXM A;  1SNP A;  2LKV A;  3OTO L;  4GKJ Q;  3T56 B;  5IT9 L;  5J22 A;  4Q5V A;  4J1M A;  4C1N K;  3QWN A;  2IJ0 A;  5IP9 H;  3CME A;  1PZI D;  4LF5 Q;  2DGY A;  3D31 A;  3G48 A;  4GNX A;  4X66 Q;  4LW1 A;  1WTP A;  4KHP Q;  3TDQ A;  1JWU D;  4WJ4 A;  3ER0 A;  1D8L A;  1MSG A;  3S1Q H;  1SND A;  2UXB L;  3S2D B;  4P73 A;  3HG9 A;  1CZG A;  2ZTE A;  3ERS X;  2E74 C;  3A0J A;  3FP9 A;  3TBI B;  3K6O A;  1YBY A;  1X9N A;  1STB A;  4CJ1 B;  2J0T D;  4PMW A;  1HQR D;  1LTT D;  3KF6 B;  4EGV A;  3MFY A;  4IQZ A;  4CHT B;  2IX1 A;  1I4H A;  4IFD G;  5M3F B;  3U58 A;  5C0X H;  4CKE A;  3AB9 A;  1LTA D;  1EYA A;  1GVP A;  3GTK B;  1MKH A;  3AEV A;  5ELC A;  3L7Z C;  4NKL A;  1MJE A;  4BS9 A;  2VQF L;  2JA8 H;  3S1M B;  5I2X A;  4J8Q A;  5G3L F;  4A3D H;  3HFZ B;  1UE1 A;  1LT4 D;  1SE4 A;  4GS3 A;  3HOU H;  4IZ8 A;  3NQT A;  4FYD A;  2KEN A;  2OT2 A;  5FO8 B;  1A62 A;  3BG3 A;  1M8A A;  2EY6 A;  2G9D A;  3UI2 A;  3GQB A;  2YTX A;  5T1I A;  4A3C H;  2I07 B;  2FFK B;  4CKC A;  1EZ8 A;  4X62 Q;  1HUM A;  1Z7T A;  5KIX A;  1CSQ A;  1TQO A;  3T16 A;  1K8G A;  3HOV H;  4QIW B;  2LXJ A;  1J6Q A;  4A3K H;  4IFD I;  5KRU A;  2VL6 A;  5ELD A;  3EQL C;  4CDD C;  3TRE A;  1OXX K;  4B3M Q;  2Q8I B;  4CGY B;  3DEO A;  1IBK Q;  3L9A X;  5C3E G;  3B6Y A;  2XTI A;  1Q8I A;  1PH4 A;  1ET9 A;  1LAC A;  1HNX Q;  4QJF A;  4LF8 Q;  4FF1 A;  3H3V H;  1TS5 A;  1EQV A;  1K3R A;  3OW2 A;  3U50 C;  1X56 A;  1DOM A;  2NN6 H;  2B8F A;  3PUW A;  4DPG A;  1IL8 A;  4J15 A;  1PRT B;  1DYQ A;  5FLM G;  1Y1W G;  3KLS A;  1CHQ D;  3K59 A;  2JEA I;  1B2T A;  4DKA C;  2R92 H;  1PFB A;  2OWO A;  1KAB A;  5IYD G;  4ME5 A;  3QO2 A;  4XT1 B;  5M5Y H;  4IAL A;  1E24 A;  4ME3 A;  4UY8 C;  3M85 A;  2KHI A;  4MZ9 A;  2RDH A;  4B9W A;  1RDP D;  3J7Z C;  2WB1 E;  3CCE A;  1T9H A;  3S1N B;  4C3J H;  4R8I A;  1KRS A;  1CKM A;  3VR5 A;  2QEX A;  2PCF B;  1H9R A;  2HDM A;  3C46 A;  1CKN B;  4UP8 A;  1KLU D;  1BCP D;  4GLA C;  3NK9 A;  1HXY D;  4XT3 B;  1KAA A;  2QDL A;  2D0O A;  4A3E B;  3KLR A;  2V4D A;  3Q23 A;  5M5X B;  3I3C A;  1KTK A;  2RBM A;  1AN8 A;  5T1G A;  2TSS A;  2AMC B;  3ULL A;  2F0N A;  3JAM E;  4DV0 Q;  3GO5 A;  2E2H H;  4JI4 L;  2EJF C;  3JC6 6;  3DUZ A;  1II3 A;  4HJ7 A;  2PQA B;  4KJO A;  5M3M B;  2F0H A;  2K01 A;  3QB3 A;  3S17 B;  3I4O A;  4B3R Q;  1NR2 A;  4BY7 H;  4OWW B;  3VYU A;  5LMN W;  2EY1 A;  1Q3L A;  1N32 Q;  4C1N I;  1YNX A;  2A69 D;  3K0X A;  3SHL A;  2K03 A;  3NUC A;  4QUC A;  2F0U A;  5HGT A;  4U67 3;  4IJL A;  4DK3 C;  4WJW A;  1X32 A;  4Z9C B;  1YZ6 A;  1STA A;  2Z0S A;  5C44 H;  1E22 A;  2DNE A;  2RDF A;  4DK0 A;  2UXD L;  4DV2 L;  5IE8 A;  3PO2 B;  4YHH Q;  5EKK A;  2KCT A;  4G7Z C;  4NPS A;  1A63 A;  3H0G H;  3D6C A;  2Q2I A;  5LMN Q;  1VQN A;  4G4K A;  4DNR B;  1EIY B;  1I4Q A;  1Q82 C;  2HIX A;  3ZYY X;  3HOW B;  4GKJ L;  1VQG A;  3R8B A;  3L3O C;  3RN5 A;  2O4X A;  3T51 B;  2F0E A;  5CV6 A;  2N88 A;  4LF5 L;  4EQO A;  1HR0 W;  3I55 A;  1X3Q A;  4X66 L;  5C3W A;  4KHP L;  3HRZ C;  1G6Z A;  1X3P A;  4HSP A;  5DLQ E;  1ZXT A;  2JA7 H;  4ZRZ A;  1DD2 A;  5EPK A;  3M4Y A;  1VQP A;  1STY A;  4BBR H;  1YVC A;  4Y52 H;  5M3F G;  2WFW A;  1Q8K A;  2EJM A;  4ULL A;  1U5K A;  2EXD A;  1EWH A;  3A8I E;  2VQE Q;  2FIN B;  5CV4 A;  1BBX C;  2JA8 G;  2CFM A;  2I5L X;  1HR0 Q;  1TY0 A;  4DAY B;  2JP1 A;  3GTL H;  3CQZ B;  3AU7 A;  4XQQ A;  5JOB A;  2EXZ A;  4OWT B;  5E4W C;  3U4V A;  4AIM A;  2UXC Q;  2XN9 C;  3HZX A;  2PMZ E;  1AP0 A;  2B2V A;  1JC7 A;  1IHZ A;  1TVX A;  4AYB B;  1EOV A;  1O78 A;  1VDZ A;  1XMQ Q;  2E2J H;  2EZV A;  2L12 A;  3S15 B;  1JOK A;  1F2Z A;  3NWS A;  1AZQ A;  2JA5 H;  1EWI A;  3SR1 A;  1PLF A;  1HA5 A;  2L55 A;  1PVO A;  2LFN A;  1YHA A;  4R9W A;  1HCZ A;  1EY5 A;  2NB0 A;  1YJ9 A;  2WV6 D;  3S14 H;  1K8O A;  2CH4 A;  2WAQ B;  3TP6 A;  4FDB A;  1JQY D;  5BN3 A;  4X62 L;  3CCR A;  1TWG B;  3T1Y Q;  4HJA A;  4KLK A;  1VQE A;  3M9B A;  3UDF A;  2L4N A;  3GTP H;  2QIL A;  3L0O A;  1FNW A;  1PRT C;  4B3M L;  5K36 G;  4X3S A;  3A54 A;  1EY9 A;  1PV4 A;  3Q6S A;  4MNO A;  1PH7 A;  3PV0 A;  4L6T B;  1QIL A;  3D3R A;  2L0C A;  4L5S A;  3GTQ H;  3M4P A;  3NEN A;  3PUZ A;  1HNX L;  4LF8 L;  1DOK A;  3W3A A;  2ZT9 C;  2HCI A;  1NBW A;  2G9H D;  4OIJ A;  1ESR A;  2WKC A;  2I5M X;  5I6W A;  4LFB Q;  4A3L H;  4CBV A;  1TWA H;  3SK4 A;  1EY8 A;  1K8A C;  5ELE A;  2CCZ A;  3FHW A;  5GRO A;  1FD7 D;  5IP7 G;  4DR1 L;  3CD6 A;  4CDF C;  4A3J B;  1BUV T;  1VF7 A;  4JOI C;  4OGQ C;  2A1A A;  5KGU A;  1KDA A;  3HOZ H;  2A68 D;  2F0L A;  2EQS A;  3E9H A;  4YCU A;  1SMX A;  1SYD A;  2CQA A;  3RN2 A;  1DON A;  2BE5 C;  2XSC A;  1A2U A;  3Q0A A;  2CVR A;  1L1O B;  1IYV A;  4JPB W;  1SYF A;  2DJF C;  2A73 B;  1CUK A;  4DR3 Q;  2KEE A;  2H1E A;  4XQN A;  1C0A A;  5M3M G;  3ZJY C;  3C1F A;  5C6A A;  1CSP A;  4BBS B;  3A5Z B;  2K32 A;  1E1O A;  1J9O A;  4IUP A;  1CFM A;  2I46 A;  4X65 Q;  3MAQ A;  1JOQ A;  3HOY B;  4GKK Q;  4QUF A;  4A3G B;  1BQQ T;  4DV0 L;  1JJC B;  3VR3 A;  1NSN S;  4IUV A;  2JXM B;  1DGS A;  3HGB A;  3SK8 A;  4FXK C;  3S2H H;  1U4L A;  5FO9 B;  2IX3 A;  4FXG C;  4B3R L;  1KD1 C;  1W2B A;  3G7L A;  3RZD B;  1SFO H;  1IW7 D;  1Y8N B;  3GTM B;  4OEM B;  1KIX A;  4YCW A;  1N32 L;  2XWB B;  1F9S A;  3I91 A;  5I2Y A;  4DGZ A;  1YEZ A;  3I56 A;  1G91 A;  4JCV E;  1SMY C;  2F0S A;  1EIF A;  2SNS A;  2F0D A;  2ZJR A;  1FJG Q;  5DAU A;  2Z8L A;  4DUZ Q;  1V1Q A;  3STB C;  1ILP A;  2A8V A;  1CK1 A;  2N49 A;  2K4K A;  1IBM Q;  5CYU A;  1WTX A;  2MNA A;  1IZ6 A;  1GUT A;  2ZTD A;  3GTG B;  3IFT A;  3K7A H;  5DEH A;  1LT5 D;  1SBB B;  2F4I A;  3KJO A;  2UUC Q;  2VUM B;  4G7O C;  3GP7 A;  1BO0 A;  3CCQ A;  2E75 C;  1DJR D;  3BDO A;  1KL9 A;  1FYC A;  2NTS A;  4LFA L;  2JEB I;  1Q90 A;  2IHF A;  4H13 C;  4P71 A;  4IUT A;  2HD3 A;  4BA2 I;  1RF2 D;  2B2Y C;  4L5T A;  1IL2 A;  4IFD H;  3S16 H;  2G5D A;  4POG A;  1S5B D;  1A2T A;  2RHS B;  2JA6 G;  4LF6 L;  3KDF A;  4DN4 M;  1EU4 A;  3T13 A;  4DV1 Q;  2VZA A;  4N8X 1;  4YWM A;  1GUG A;  1ASZ A;  2VQE L;  1QUQ A;  1YNJ C;  1HR0 L;  3CMA A;  2X6G A;  2UXC L;  4DV5 Q;  1FGB D;  3E0J A;  3FPP A;  1GM5 A;  4RWS C;  1V1P A;  2RVL A;  2Z6K A;  5GQO A;  2WAQ G;  4CDC C;  4L5R C;  2NZ1 D;  2J4X A;  3J81 L;  1YIJ A;  5FLX E;  3PF5 A;  2HIV A;  5JPN C;  4KD3 A;  2HQL A;  2OCE A;  1UE6 A;  2F0K A;  3IFD A;  1LTI D;  4O1N A;  1SEB D;  1OO9 B;  2YV5 A;  3TP7 A;  2EPB A;  1CA5 A;  1PRT F;  3TZD A;  5C3E H;  2D62 A;  4HAE A;  5J3B A;  1JCK B;  5EGT A;  1U4M A;  2B2T C;  5COY A;  2MJ8 A;  2F03 A;  4DAP A;  2IL8 A;  3MEF A;  1XYI A;  3CP0 A;  3F2C A;  1YJW A;  4J6H A;  3LNN A;  2R3Z A;  5J39 A;  1B50 A;  1YHQ A;  3T1Y L;  2F0P A;  2HT1 A;  1V9P A;  1SAP A;  4JVZ A;  3M7N A;  3F8T A;  5JPM C;  5FLM H;  1Y1W H;  1HUN A;  1I94 L;  5IYD H;  1TU2 B;  3Q8D A;  2LS0 1;  1OTC A;  2K5D A;  3N52 A;  4DXF A;  4A3J G;  3BVZ A;  5IGB A;  1EFI D;  4MTN A;  4IPC A;  4EVO A;  1JMC A;  3H15 A;  1ONL A;  4GOP C;  3S9W A;  2Z4I A;  3JAM c;  1VQA A;  1RD9 D;  1EY4 A;  4K5W A;  5KNB A;  4LAA A;  3K80 C;  1F2Y A;  1PTO C;  2PW7 A;  1B3Q A;  3QG1 A;  5FOB B;  4HJ5 A;  5JAV A;  1X3F A;  1WD0 A;  2YU9 H;  5IYC G;  1A0I A;  4A3F B;  3CC4 A;  4BBS G;  4FF3 A;  4ZUI A;  1HFG A;  3X3N A;  1HTP A;  5KND A;  2EVB A;  2Q2H A;  5EPL A;  3R3O A;  5A2Q L;  3PO3 G;  5C4J B;  5H1S E;  3BU2 A;  4A3G G;  2B2U C;  1W6K A;  3P1H A;  1GUO A;  3C2P A;  2L5T A;  4RHS A;  5KNC A;  2O5J C;  2I0Q A;  3M4O H;  3MA2 B;  1SE2 A;  1F9Q A;  1BDO A;  1G2S A;  3I7F A;  3J81 c;  4OX9 Q;  1V43 A;  1UAP A;  1LTL A;  5EBC A;  2UUA Q;  1KAW A;  1I5F A;  3NBH B;  4X65 L;  1JJ2 A;  1T5E A;  1WCM G;  3SDZ A;  4GKK L;  1C4Q A;  1UUP A;  1YI2 A;  1JB3 A;  4JI1 Q;  3J80 c;  2OXP A;  2N55 A;  3M3Y B;  2EY2 A;  4JBK A;  2NVT B;  2Y0S E;  3MZ5 A;  1KLG D;  4C3H B;  3PIO 3;  1N34 Q;  4IUU A;  3PQI A;  1MSH A;  4X64 Q;  3S2D H;  2QW7 A;  4E6I A;  2ZTC A;  5CV9 A;  4R1J A;  1A8V A;  4HMI A;  3OOC A;  2ENB A;  4JI6 Q;  1AFP A;  2VUM G;  1HZB A;  3LWU A;  1X3E A;  1ZKO A;  3CHB D;  3J7Y W;  4NXM Q;  3M4Q A;  1FJG L;  2Z4H A;  4I7A A;  4DV7 Q;  1L0Y B;  4HMJ A;  3H09 A;  4L63 B;  1W6J A;  1EU3 A;  3DM3 A;  4K8I A;  4B3T Q;  3S1Q B;  5ELN A;  2A74 C;  2PZT A;  3HKS A;  1LM0 A;  5M3F H;  3P75 A;  1B3A A;  1BNZ A;  4LUO A;  3GTK H;  2R93 B;  2E2I B;  4OWX B;  2E2D C;  1TS3 A;  4A3M G;  3T1H Q;  1EL0 A;  3S1M H;  3MC0 B;  5AJ3 Q;  2F0O A;  5EAY A;  1D1I A;  4QMG A;  4S3S A;  2R7F A;  1UE5 A;  4R4C A;  1PYW D;  4A93 B;  4WFN 3;  4HJ8 A;  5JJZ A;  4GLV B;  2MUY A;  5C4X B;  5K5P A;  4P72 A;  3DWA A;  1B7Y B;  1PYB A;  3U4Z A;  3K5O A;  4DV1 L;  4N9T A;  5LMU Q;  1I4R A;  3BZC A;  4FNF A;  1N33 Q;  4AH6 A;  1JIC A;  1U4P A;  3M7G A;  1U0L A;  3QR8 A;  4P74 A;  2RSN A;  1VF5 C;  3CCJ A;  1H9K A;  4JI5 Q;  1TKW B;  4DV5 L;  3DMU A;  3OPO A;  5EPJ A;  1R4Q B;  3CXC A;  3NSW A;  1PH8 A;  4JI7 Q;  2XRQ D;  3ITP A;  2XVS A;  1YNN C;  1VCI A;  1PH6 A;  1K9M C;  1Q1E A;  1XMO L;  1XPO A;  4A3B G;  1IKM A;  5M5W H;  2N78 A;  1QWY A;  2BDO A;  3X3M A;  5K36 H;  3TEH B;  4A76 A;  5IY0 A;  1PRT D;  4MIU A;  1RHP A;  3D8G A;  2HCC A;  3FKI B;  2A6E D;  2AWO A;  1QVG A;  1IBL Q;  4C3I B;  1NAP A;  4IOC A;  1AZP A;  5E1F A;  1QJO A;  1UE7 A;  3BJU A;  3CKI B;  2TMP A;  5CV8 A;  3BVG A;  1IKL A;  4IUQ A;  1D2B A;  1ZEQ X;  1F9R A;  3S1N H;  2MGS A;  3GDE A;  2VB3 X;  1CQV A;  5D3I B;  5IGG A;  1PTO F;  5IP7 H;  1MHW C;  4DV3 Q;  1RTO A;  1RCV D;  1A3U A;  3NHH A;  2H4O A;  1KC8 C;  1QB5 D;  4QF4 A;  1D5Z C;  4A3E H;  2AQ2 B;  5L37 A;  5M5X H;  1XX8 A;  3HOX G;  4JI8 L;  2R7Z B;  4BY1 B;  1HA6 A;  1WYD A;  3FVQ A;  1EYG A;  1KHI A;  2PI2 A;  4A3I B;  3R93 A;  1D7Q A;  2YTY A;  4ZKC B;  1GUN A;  2BE5 D;  2EYL A;  2EYJ A;  4R4Q A;  1SYE A;  1TXY A;  1WVL A;  2PNR C;  3KFU A;  1SJE D;  4DUY Q;  1Y1V B;  2WAC A;  5M3M H;  1CKN A;  2R7D A;  1LYL A;  1WTQ A;  3GV3 A;  1E2Z A;  1JOO A;  2F4V L;  5JJL A;  3K57 A;  1TS4 A;  3E3X A;  3PGZ A;  2KED A;  5BR8 Q;  1NR4 A;  5EBD A;  2C35 B;  1XXG A;  2PO4 A;  2KQ3 A;  1VQO A;  3DLL A;  2KA7 A;  4TSS A;  1NMG A;  4K8J A;  2VXW A;  2HHH Q;  1K8M A;  3J7A 5;  1LTR D;  2IX0 A;  2ZM6 Q;  2PQA A;  3NTI A;  1VQI A;  4GNX C;  4OX9 L;  1EQR A;  3MVV A;  4K6L A;  4NB3 A;  4BY7 B;  2F0V A;  1SJH D;  2E8G A;  1C8C A;  2UUA L;  2RQX A;  2RHQ B;  3VA7 A;  4YY3 Q;  3TP5 A;  2Z9H A;  2GVA A;  3J7A V;  1PH9 A;  3TSS A;  2RSO A;  4JI1 L;  5DNF A;  1B8A A;  3E0E A;  2C5C A;  2NWG A;  5C44 B;  2QEJ C;  4KY7 A;  1QG7 A;  5TSS A;  3U9S A;  3STB D;  3H0G B;  3CCS A;  4HSV A;  2D5D A;  2VNU D;  4X64 L;  2R93 G;  2VY3 A;  1GHK A;  1ZYR D;  4ZYS A;  1I4X A;  3LGJ A;  4ZCK A;  4JI6 L;  4XIG S;  1I6H B;  1WJJ A;  2NYZ D;  4FO2 A;  4NXM L;  3HP3 A;  3CU7 A;  4QL5 A;  4DV7 L;  5HY6 A;  3CQZ H;  2OF1 A;  3I4N B;  4POF A;  4FF2 A;  3NWT A;  2AUK A;  5CBE E;  4B3T L;  1SSO A;  1CKO A;  1O7I A;  1ICW A;  5FLX c;  4A3C G;  4KKS A;  4A93 G;  1MGS A;  5FJ8 G;  5GAH C;  2JA6 H;  2L15 A;  1STH A;  1RKN A;  1Z47 A;  3MXN B;  3RLF A;  2N3S A;  1XNR Q;  2C9O A;  5C4X G;  2WP8 J;  4C2M H;  3S15 H;  5G3L D;  1LUZ A;  4BXX G;  1K83 B;  3AFQ A;  4UAI A;  4QB4 A;  1R9T B;  1LTB D;  2MO1 A;  4DAY A;  1YNJ D;  1K0S A;  2B2W A;  2E76 C;  3W1B A;  1TWG H;  4K5X A;  1N8R C;  4HTH A;  5C5L A;  1EY7 A;  4JV5 Q;  1TWH B;  3I4M B;  2A6H C;  2FMC A;  2QF7 A;  5LMU L;  4RGO S;  4DXG A;  1WTO A;  1N33 L;  4I65 A;  1PMR A;  1IBK L;  3R2I A;  1F77 A;  1PZJ D;  3PIO A;  2F3V A;  1N36 Q;  2ICI A;  3KLW A;  4HCS A;  4M8A A;  4YCV A;  2KCC A;  4JI7 L;  1I3Q H;  4KD4 A;  3H3V C;  1Z9F A;  3A8K E;  5FK9 C;  4C3I G;  2NZO A;  3UDI A;  4KN7 C;  4QIW E;  1VQ5 A;  3S1R H;  1H95 A;  5C4H A;  1Q81 C;  2F0W A;  2Q8R E;  3D0F A;  1SE8 A;  4N8F A;  2VW9 A;  4Y7N B;  3F2D A;  1H9S A;  1PZK D;  1NMF A;  4G7H C;  1IBL L;  2F0F A;  4HCE A;  4A3J H;  4B3S Q;  5CV7 A;  4LF4 Q;  1S3O A;  2CWP A;  2GA4 B;  2NVX H;  2JK8 A;  4A3E G;  4GOP B;  4FXD A;  4Q0F A;  5IT9 E;  3RZO H;  2MPM A;  2B8G A;  2CWA A;  2O2L D;  4F7X A;  4IOA A;  1H9J A;  2R7Z G;  1S5F D;  4BY1 G;  1I4G A;  4X3K A;  1T5X D;  3EN2 A;  4RKB A;  1PTO B;  4A3I G;  4JC0 A;  2B29 A;  4ZQ3 A;  1NCV A;  2QA4 A;  5HGQ A;  1JE5 A;  4DV3 L;  5KYI A;  4IO9 A;  2PW5 A;  5IYC H;  1Y1V G;  2RCF A;  1CM9 A;  4H7B A;  4BBS H;  4RCO A;  1BBW A;  1AEX A;  1PA6 A;  3OMG A;  5ELB A;  2Z6B A;  2PI2 E;  2WKD A;  1O7L A;  3PO3 H;  2MFI A;  3IAY A;  2B63 B;  1S40 A;  1U9R A;  3HOY H;  5JVG 3;  2NVY B;  4A3G H;  4DFA A;  1L1O A;  2K75 A;  1PDQ A;  1UWV A;  4ZAI A;  1LAB A;  4DUY L;  4HR7 B;  3NTK A;  1HZ9 A;  4IN3 A;  4FP5 D;  5JVH 3;  3ERO A;  1AH9 A;  4KV6 A;  3RZD H;  1SNM A;  2SDF A;  2XNA C;  4GN3 B;  2A69 C;  5BN4 A;  3PO2 G;  5BR8 L;  3GTM H;  1WCM H;  4DF7 A;  2B3G A;  4TKO B;  3MWY W;  2BH2 A;  4HID A;  2GN5 A;  4LNQ A;  3HOW G;  4EQP A;  1IXR A;  2HHH L;  2ZM6 L;  1CT1 D;  4XTC S;  2M9V A;  4LMQ D;  3G71 A;  3BZD B;  1Y14 B;  3CRK C;  1XNQ Q;  5I9O A;  2OQK A;  5D14 A;  5GAE C;  4H0L C;  1EZ6 A;  2NUC A;  4YHH L;  1VQB A;  3OYY A;  2AKW B;  4KHV A;  5LMN L;  4PZ6 A;  3ONA B;  4RG1 A;  1K28 A;  2AQ3 B;  4JW0 A;  4QCL A;  3E6Z X;  4YY3 L;  3ICE A;  2EJG C;  1GUS A;  2VUM H;  5IGF A;  2RDG A;  3F2B A;  1BBU A;  1LT3 D;  1E1T A;  3JAM L;  3BDL A;  1W3S A;  3VYS A;  3RD4 A;  2K5W A;  4R4T A;  1Q1B A;  4MTK A;  1A3V A;  4OIK A;  2Q2T A;  3Q22 A;  1YIT A;  2B2V C;  1YHB A;  3LX0 A;  4DNI A;  3A7A B;  3KF8 A;  1NUC A;  3MXP A;  3OMC A;  4A3M H;  1B9M A;  3KDF B;  4AYB G;  1OXV A;  4XQJ A;  3SK5 A;  1B9N A;  1QUQ B;  2K5Q A;  5E7N A;  3WDN A;  4R4O A;  2MHV A;  5DM6 3;  2K1B A;  4MHE A;  1SYB A;  1ET6 A;  1UNS A;  4QY7 A;  1LLR D;  3D6W A;  4V19 0;  1KXL A;  2DJG C;  1SRO A;  1NJI C;  2KHJ A;  4H44 C;  1FNV A;  2QGQ A;  4DR6 Q;  3BYT B;  3TME A;  4PZ8 A;  2ZXR A;  1XNR L;  4DR2 Q;  2JA9 A;  1XMQ L;  3I4M G;  2X6L A;  1WTH A;  4CJ0 B;  2EDG A;  1LTS D;  2F52 A;  2ZXO A;  5D65 A;  1Q7Y C;  1SDF A;  1SE3 A;  1STE A;  4KK7 A;  2V1C C;  5NUC A;  1ILQ A;  3J80 L;  2X69 A;  3CC7 A;  2JE6 I;  2K5V A;  5IOD A;  3WWV A;  4AYB E;  4A3B H;  5IYB G;  1YNN D;  1FNU A;  4JV5 L;  3NXW A;  4JG2 A;  2BA0 A;  1JJG A;  2FMM A;  3TP8 A;  3P20 A;  2BA1 A;  3K5L A;  4JBM A;  3VYT A;  2WB1 B;  1F2L A;  2BH8 A;  1E3P A;  1N36 L;  1TWF B;  5CMD A;  2JN4 A;  2WAQ E;  4ILW A;  4XYQ A;  3AQQ A;  1AE2 A;  4C56 C;  4ABN A;  2F3I A;  4DR5 Q;  1HZA A;  2CH4 W;  3GTO H;  1VQH A;  3W1G A;  2ICE C;  4LFB L;  1E2W A;  2PZU A;  3UDX A;  1B44 D;  3UE0 A;  1V8Q A;  4CDE C;  5IWA Q;  1PFN A;  2WII B;  1VQ8 A;  1VQK A;  3ULP A;  1KNE A;  2I5H A;  5IOC A;  4RMF A;  4IPG A;  4PNY A;  1MJC A;  3WOE A;  4B3S L;  4JBJ A;  2R61 A;  5M9O A;  4LF4 L;  4DR7 Q;  2H5X A;  3HOX H;  4AQY Q;  3CCU A;  2M2L A;  2A68 C;  2UUB Q;  4GZY C;  1MD2 D;  5KYL A;  2NVQ B;  1E7Z A;  4JBW A;  3DWQ A;  3NPP A;  4RKL A;  3CPW A;  2JJQ A;  3VA5 A;  5C4J H;  2KOL A;  2L11 A;  4LWC A;  3J81 i;  3HOY G;  1N9W A;  1FL0 A;  2KCN A;  2JYO A;  3QJY A;  4MN3 A;  1B1Z A;  1LV9 A;  1Q46 A;  1TWC B;  2YU9 B;  4DR3 L;  1I50 B;  1BKB A;  2F0Q A;  1G51 A;  4UPA A;  3GTJ B;  2K6A A;  1Y69 U;  1WOC A;  4DV6 Q;  3A55 A;  3J80 i;  5C0X J;  3OWE B;  1VMC A;  2PZW A;  2QCP X;  3EIV A;  4RHR A;  4DK1 A;  2SNM A;  2HQE A;  4PZ7 A;  2K04 A;  4GNX B;  1QNK A;  2LY7 A;  3M3Y H;  3E9I A;  1MI2 A;  3PCO B;  2LXK A;  3EA6 A;  3VDY A;  1EUJ A;  3UDG A;  2MP1 A;  2AWN A;  1RIP A;  3NBH A;  4A4I A;  4YWK A;  4KY6 A;  1A3T A;  3KBX A;  4ZKB B;  2Q2U A;  1ESF A;  1HHV A;  1KDC A;  2ID0 A;  3I8Z A;  3HEJ A;  4KI0 A;  3SEB A;  2IY5 B;  4L8J A;  2IT1 A;  2K50 A;  1XNQ L;  5I4D A;  1WTR A;  4JK1 C;  4IPD A;  4DUZ L;  4B9X A;  2PMZ B;  3ND9 A;  3D4R A;  1JWM D;  1LT6 D;  2CW0 C;  1IBM L;  2XRS D;  2R93 H;  2E2I H;  4IJH A;  3EFX D;  2IPK D;  1GD7 A;  4WRD A;  2UUC L;  4O2D A;  2OTJ A;  4UP7 A;  1M1K C;  1AE3 A;  3MXU A;  4JYA Q;  1KDB A;  1S5E D;  4HIK A;  1P16 A;  4HIO A;  1GKH A;  1ENF A;  3G6J B;  1KRT A;  3KF6 A; 
#chains in the Genus database with same CATH homology
 1L1O B;  4A93 H;  2RHQ B;  1TWF H;  5FJ8 H;  3RR5 A;  4LF7 L;  3W5O A;  4YY3 Q;  2Z6K C;  1CUK A;  2GVA A;  4GLX A;  3CPF A;  1PH9 A;  1HNW L;  4DR3 Q;  3JAM i;  4JI1 L;  5C4X H;  1C0A A;  5M3M G;  3ZJY C;  1C9O A;  1B8A A;  3E0E A;  1CSP A;  5GAG C;  4BXX H;  2GVB A;  3A5Z B;  2ATW A;  1OXS C;  1E1O A;  4A3L G;  1HZC A;  4X65 Q;  3TS0 A;  1QVC A;  3STB D;  3CCS A;  1PH1 A;  1NE3 A;  2EIF A;  3KOJ A;  1C7Y A;  4GKK Q;  4DV0 L;  1JJC B;  4LUV A;  2VNU D;  4X64 L;  1DGS A;  2R93 G;  1NY4 A;  4HIM A;  2VY3 A;  4DR6 L;  2KCM A;  3PUX A;  4A3F H;  4JI6 L;  3LGJ A;  4XIG S;  2NZH A;  3S2H H;  4DR2 L;  1SRU A;  4B3R L;  4JI8 Q;  1WJJ A;  1KD1 C;  1RL2 A;  1W2B A;  4NXM L;  2NVQ H;  1SFO H;  4DV7 L;  4QL5 A;  5HY6 A;  3CQZ H;  4L5Q A;  3HOZ G;  1VQ4 A;  1X55 A;  4POF A;  1KIX A;  4YCW A;  1N32 L;  2WB1 G;  1MIU A;  1HNZ L;  4B3T L;  2B63 G;  1CKO A;  3FKI H;  1X65 A;  1O7I A;  4JI4 Q;  5FLX c;  4A3C G;  1L1O C;  1YEZ A;  3CCM A;  3I56 A;  1VQ7 A;  4C3I H;  5FJ8 G;  5GAH C;  4JCV E;  4DAM A;  2L15 A;  2JA6 H;  3ULJ A;  1TWC H;  1Z47 A;  3PSI A;  3MXN B;  3RLF A;  4JI0 L;  2N3S A;  4EX5 A;  5IT9 c;  1I50 H;  1EIF A;  1XNR Q;  2F4V Q;  2ZJR A;  2WP8 J;  4H02 A;  5C4X G;  2YYZ A;  1FJG Q;  3RNU A;  2IHE A;  3PF4 A;  4C2M H;  3S15 H;  1LUZ A;  1PH5 A;  4BXX G;  4DUZ Q;  3AFQ A;  2Y0S G;  3GTJ H;  1V1Q A;  1IYJ B;  2MO1 A;  3A5U A;  4R4I A;  3STB C;  1VQ6 A;  2A8V A;  4X6A H;  2N49 A;  2K4K A;  1IBM Q;  1J5E Q;  2MNA A;  1IZ6 A;  1XTD A;  1M90 C;  2ZTD A;  4DR1 Q;  3W1B A;  4P75 A;  2DUD A;  4K0K L;  4OON A;  3K7A H;  1G6P A;  1TWG H;  2UUC Q;  3KJO A;  1N8R C;  4WJ3 M;  3PUY A;  4DR5 L;  4NXN Q;  4JV5 Q;  3CCQ A;  1KL9 A;  4A3F G;  1P8L A;  4LFA L;  4DV2 Q;  4LF9 Q;  2NVT H;  2UXD Q;  2JEB I;  4TVA B;  5JEA J;  2IHF A;  5LMU L;  4BY1 H;  1N33 L;  2R7Z H;  4P71 A;  3F1Z A;  4BA2 I;  1IBK L;  4A3I H;  1JT8 A;  3PIO A;  2Q2T A;  3CC2 A;  4C3H H;  5IWA L;  4HJ9 A;  1N36 Q;  1UEB A;  3TRZ A;  3KLW A;  2D0P A;  4L5T A;  1IL2 A;  4DR4 L;  4YCV A;  3S16 H;  3OTO L;  4GKJ Q;  4JI7 L;  4POG A;  1I3Q H;  1Y1V H;  1Z9F A;  1QZH A;  2RHS B;  2NZO A;  3UDI A;  4DV4 Q;  2JA6 G;  4JOI A;  4LF6 L;  4QIW E;  3KDF A;  5IP9 H;  3CME A;  1PYS B;  1VQ5 A;  4DV1 Q;  1B70 B;  2DGY A;  2VZA A;  3D31 A;  3G48 A;  4YWM A;  4GNX A;  4X66 Q;  4LW1 A;  4AQY L;  1OXU A;  3S1R H;  1ASZ A;  2ZJQ A;  2UUB L;  2VQE L;  1QUQ A;  4KHP Q;  1H95 A;  3RLN A;  1HR0 L;  3CMA A;  1Q81 C;  4WJ4 A;  3ER0 A;  1D8L A;  3S1Q H;  3D0F A;  2UXB L;  2UXC L;  1SE8 A;  4DV5 Q;  1L2F A;  2VW9 A;  5GAD C;  1GM5 A;  3F2D A;  2Z6K A;  5GQO A;  3CW2 C;  4P73 A;  2WAQ G;  1NMF A;  1IBL L;  4OO1 G;  4L5R C;  4B3S Q;  1YIJ A;  4A3J H;  2ZTE A;  4YWL A;  3PF5 A;  4LF4 Q;  2HIV A;  1S3O A;  2CWP A;  3ERS X;  2NVX H;  3A0J A;  2HQL A;  2JK8 A;  2OCE A;  1UE6 A;  1YBY A;  3FP9 A;  4A3E G;  4GOP B;  1X9N A;  4LUZ A;  3RZO H;  2CWA A;  3PO2 H;  2YV5 A;  4IOA A;  4PMW A;  2R7Z G;  5C3E H;  4BY1 G;  2D62 A;  2UU9 Q;  3S17 H;  3EN2 A;  5J3B A;  1PH3 A;  4A3I G;  3KF6 B;  4JC0 A;  4DV6 L;  2B29 A;  4TQU S;  2IX1 A;  3L2P A;  1XPR A;  3MEF A;  3HOW H;  2QA4 A;  4IFD G;  3U58 A;  3CP0 A;  5HGQ A;  1JE5 A;  3F2C A;  4DV3 L;  4IO9 A;  1YJW A;  1GVP A;  1MKH A;  3AEV A;  5IYC H;  3L7Z C;  2LSS A;  1YHQ A;  1MJE A;  1Y1V G;  3T1Y L;  2VQF L;  1V9P A;  2HT1 A;  2JA8 H;  4BBS H;  4OO1 I;  3NEM A;  5IP9 G;  1BBW A;  1XJV A;  4A3D H;  3HFZ B;  3M7N A;  3F8T A;  1UE1 A;  1PA6 A;  5JJK A;  5FLM H;  4GS3 A;  4PG3 A;  1Y1W H;  3HOU H;  2KEN A;  2PI2 E;  1FVI A;  1A62 A;  4GN4 B;  3PO3 H;  2MFI A;  1S40 A;  1EQQ A;  1N34 L;  1JB7 A;  3HOY H;  1VS0 A;  2CQO A;  1I94 L;  4A3G H;  4A3C H;  2YTX A;  5IYD H;  1L1O A;  3Q8D A;  1OTC A;  2K75 A;  4X62 Q;  1FGU A;  1UWV A;  1CSQ A;  3J81 j;  4DUY L;  1K8G A;  1HZ9 A;  3HOV H;  2LXJ A;  1J6Q A;  4A3J G;  4A3K H;  4IFD I;  1I6H H;  2OQ0 A;  1AH9 A;  2VL6 A;  4LFA Q;  4MTN A;  3TRE A;  4IPC A;  1OXX K;  1JMC A;  3H15 A;  4B3M Q;  3RZD H;  4GOP C;  4GN3 B;  1X6O A;  1IBK Q;  3JAM c;  3PO2 G;  5BR8 L;  1VQA A;  1ASY A;  3GTM H;  1QVF A;  3I4N H;  5C3E G;  2ZJP A;  1WCM H;  3B6Y A;  3K80 C;  4LFC Q;  2XTI A;  1PH4 A;  2B3G A;  1HNX Q;  4QJF A;  4LF8 Q;  2VS1 A;  2BH2 A;  3H3V H;  4HJ5 A;  4HID A;  1K3R A;  1X3F A;  2GN5 A;  2MO0 A;  3OW2 A;  3U50 C;  4LNQ A;  3HOW G;  1IXR A;  5C0X G;  2HHH L;  2YU9 H;  1X56 A;  4LF6 Q;  2ZM6 L;  2MQH A;  3PUW A;  4XTC S;  4DPG A;  1A0I A;  5IYC G;  3G71 A;  3T1H L;  1Y14 B;  3CC4 A;  1SR3 A;  4J15 A;  4OXP A;  1XNQ Q;  3UE1 A;  4BBS G;  2OQK A;  4JYA L;  4LF5 Q;  1K83 H;  5GAE C;  1R9T H;  4A3D G;  5AJ3 L;  4YHH L;  5FLM G;  2JQO A;  1Y1W G;  1VQB A;  2Q2H A;  3OYY A;  3HOU G;  3CCL A;  2AKW B;  3CCV A;  5LMN L;  2JEA I;  3PO3 G;  4PZ6 A;  4DKA C;  2R92 H;  2OWO A;  5H1S E;  3BU2 A;  4JI3 Q;  2E5L Q;  4RG1 A;  5IYD G;  4A3G G;  4YY3 L;  3ICE A;  5M5Y H;  2I0Q A;  2VUM H;  3M4O H;  1E24 A;  4BA1 I;  4ME3 A;  1TWH H;  3M85 A;  2KHI A;  4MZ9 A;  4UY8 C;  3I4M H;  3F2B A;  1BBU A;  3HOV G;  3I7F A;  1E1T A;  3J81 c;  4A3K G;  4OX9 Q;  5C0X I;  1W3S A;  4JI2 Q;  1V43 A;  2ASB A;  4R4T A;  1Q1B A;  3J7Z C;  1LTL A;  2UUA Q;  1K0R A;  1KAW A;  2WB1 E;  1I5F A;  3NBH B;  3G4S A;  3CCE A;  4X65 L;  1T9H A;  1YIT A;  1QZG A;  4UP9 A;  1JJ2 A;  1WCM G;  4LF7 Q;  4JI5 L;  1YHB A;  4C3J H;  1KRS A;  4GKK L;  1CKM A;  4DNI A;  2QEX A;  4A93 G;  3FKI G;  1SLJ A;  1HNW Q;  4A3M H;  1CKN B;  5IYB H;  1YI2 A;  4JI1 Q;  4UP8 A;  4GLA C;  3KDF B;  4AYB G;  3J80 c;  1OXV A;  2D0O A;  2NN6 G;  1PH2 A;  1QUQ B;  4JBK A;  5E7N A;  2K14 A;  1X3G A;  2Y0S E;  4R4O A;  1WFQ A;  3GD7 A;  2N8N A;  2AMC B;  3TQY A;  3ULL A;  1N34 Q;  4QY7 A;  1X54 A;  1I94 Q;  4Y7N H;  4DV0 Q;  3GO5 A;  3KYH C;  1KXL A;  1SRO A;  1SN8 A;  4X64 Q;  2E2H H;  3JC6 6;  4JI4 L;  2R92 G;  1NJI C;  3S2D H;  3K7U C;  2ZTC A;  2KHJ A;  4HJ7 A;  2QGQ A;  2PQA B;  4R1J A;  1A8V A;  4DR6 Q;  4JI6 Q;  2VUM G;  4PZ8 A;  1HZB A;  1L0W A;  4DR2 Q;  2JA9 A;  1XMQ L;  1X3E A;  1XNR L;  3I4O A;  3H3V I;  4NXM Q;  4B3R Q;  3I4M G;  3M4Q A;  1FJG L;  4DV7 Q;  4BY7 H;  2F52 A;  3HKZ G;  1Q12 A;  4OWW B;  5LMN W;  2NN6 I;  1N32 Q;  1VQL A;  1YNX A;  3DM3 A;  3K0X A;  1HNZ Q;  5ELN A;  4B3T Q;  1Q7Y C;  3HKS A;  1OXT A;  3K81 C;  1J5E L;  1LM0 A;  2V1C C;  5M3F H;  3CC7 A;  3IRB A;  4LUO A;  3AFP A;  3GTK H;  2JE6 I;  2K5V A;  3G6E A;  4OWX B;  4IJL A;  3WWV A;  4DK3 C;  4AYB E;  4JI0 Q;  4A3B H;  4A3M G;  5IYB G;  3T1H Q;  1YZ6 A;  4NXN L;  3S1M H;  4JV5 L;  2Z0S A;  4JG2 A;  5C44 H;  1E22 A;  2BA0 A;  4LF9 L;  2UXD L;  1JJG A;  4DV2 L;  5AJ3 Q;  2BA1 A;  4GOP A;  5IE8 A;  4YHH Q;  4JBM A;  1S72 A;  3PUV A;  5EAY A;  2KCT A;  2B63 H;  4APV A;  2BH8 A;  4NPS A;  1E3P A;  1N36 L;  3H0G H;  5LMN Q;  2Q2I A;  1WI5 A;  2R7F A;  5ELO A;  1VQN A;  4DR7 L;  2NVY H;  1UE5 A;  1G29 1;  4R4C A;  1EIY B;  1Q82 C;  2HIX A;  4GKJ L;  4K0K Q;  1VQG A;  2WAQ E;  3RN5 A;  3AQQ A;  1AE2 A;  4HJ8 A;  2F3I A;  4DR5 Q;  4GLV B;  4DV4 L;  1HZA A;  4P72 A;  3GTO H;  1VQH A;  3BZK A;  3W1G A;  4LF5 L;  1B7Y B;  1HR0 W;  1PYB A;  3U4Z A;  3I55 A;  4DV1 L;  4LFB L;  5LMU Q;  4X66 L;  3HKZ E;  1N33 Q;  3BZC A;  4KHP L;  4QQB X;  3UDX A;  4AH6 A;  2AHO B;  3UE0 A;  1KQS A;  4BY7 G;  4IFD J;  5DLQ E;  5IWA Q;  3K8A A;  2JA7 H;  1U0L A;  4P74 A;  1VQ8 A;  1VQK A;  4DR4 Q;  3ULP A;  3CCJ A;  1VQM A;  3OTO Q;  4JI5 Q;  4DV5 L;  4JI7 Q;  1VQP A;  2I5H A;  3CXC A;  1PH8 A;  3I2Z A;  2ES2 A;  4RMF A;  4BBR H;  4IPG A;  1YVC A;  4Y52 H;  5M3F G;  1MJC A;  1VQC A;  2WFW A;  1Q8K A;  1VCI A;  1PH6 A;  1K9M C;  4B3S L;  1Q1E A;  4JBJ A;  1XMO L;  4ALP A;  1XPO A;  4LF4 L;  1XPU A;  2H5X A;  4A3B G;  3HOX H;  4DR7 Q;  1U5K A;  4AQY Q;  2EXD A;  3CCU A;  5M5W H;  2UUB Q;  2VQE Q;  2RCN A;  2JA8 G;  2N78 A;  3PIP A;  4KHZ A;  2CFM A;  5C44 G;  2I5L X;  1HR0 Q;  3CF5 A;  4DAY B;  3TEH B;  1BVS A;  1E7Z A;  4A76 A;  4JBW A;  5IY0 A;  3GTL H;  4OWT B;  1VQ9 A;  3U4V A;  1Q86 C;  4AIM A;  2UU9 L;  2UXC Q;  2UXB Q;  3CPW A;  2PMZ E;  2JJQ A;  5JEA G;  5C4J H;  3H0G G;  3SGI A;  3J81 i;  4LWC A;  3GTG H;  1K73 C;  3HOY G;  1N9W A;  2AWO A;  1FL0 A;  4O0A A;  1QVG A;  1IBL Q;  1VQD A;  3A74 A;  1EOV A;  1Q46 A;  4IOC A;  4DR3 L;  1YJN A;  1UE7 A;  1EFW A;  1XMQ Q;  1PHJ A;  1BKB A;  2K5N A;  2CKZ B;  2E2J H;  1A63 A;  4DK6 C;  3BJU A;  1G51 A;  4UPA A;  2JA5 H;  1EWI A;  1WOC A;  4DV6 Q;  3I4N G;  3J80 i;  1YHA A;  5C0X J;  3S1N H;  3KJP A;  1PVO A;  3GDE A;  2JA7 G;  1YJ9 A;  3S14 H;  5IP7 H;  3EIV A;  3KF8 B;  4DV3 Q;  4FDB A;  1VQF A;  4X62 L;  4BBR G;  3CCR A;  3EBE A;  4A75 A;  3T1Y Q;  4HJA A;  4KLK A;  1VQE A;  3CAM A;  3M9B A;  4PZ7 A;  3UDF A;  2VQF Q;  1KC8 C;  4A3E H;  4GNX B;  5M5X H;  3GTP H;  3M3Y H;  3HOX G;  3E9I A;  3L0O A;  3PCO B;  4JI8 L;  3RLO A;  4B3M L;  2LXK A;  2R6G A;  3VDY A;  5K36 G;  1EUJ A;  1WYD A;  1PV4 A;  4MNO A;  3UDG A;  1KHI A;  2PI2 A;  3PV0 A;  1PH7 A;  1EYG A;  1D7Q A;  2AWN A;  4L5S A;  1RIP A;  2YTY A;  2XGT A;  3GTQ H;  1HH2 P;  4LFC L;  4A4I A;  4YWK A;  1HJP A;  3M4P A;  3NEN A;  3PUZ A;  1HNX L;  4R4Q A;  4LF8 L;  1TXY A;  2Q2U A;  3KFU A;  1NBW A;  4DUY Q;  1PFS A;  2ID0 A;  4KI0 A;  5M3M H;  1CKN A;  2IY5 B;  4EQ5 A;  2R7D A;  1LYL A;  2I5M X;  2F4V L;  4LFB Q;  5JJL A;  2IT1 A;  2K50 A;  2RF4 A;  2K5H A;  1XNQ L;  4A3L H;  3PGZ A;  4IPD A;  5BR8 Q;  4DUZ L;  2C35 B;  2ALY B;  1TWA H;  3S24 A;  2JA5 G;  1VQJ A;  1K8A C;  2A19 A;  1VQO A;  5JJI A;  3DLL A;  4IPH A;  1IBM L;  2CCZ A;  3FHW A;  5GRO A;  4JI3 L;  3NEL A;  1NTG A;  2R93 H;  1NMG A;  5IP7 G;  4DR1 L;  2E2I H;  2E5L L;  2HHH Q;  3CD6 A;  3TS2 A;  4IJH A;  3J7A 5;  2IX0 A;  2YTV A;  2K52 A;  2ZM6 Q;  1XMO Q;  2OTL A;  1GD7 A;  2PQA A;  2UUC L;  4JOI C;  4O2D A;  2OTJ A;  4UP7 A;  1M1K C;  2A1A A;  1VQI A;  1AE3 A;  4GNX C;  1GO3 E;  1EQR A;  4OX9 L;  3HOZ H;  4JYA Q;  4GN5 A;  4NB3 A;  4JI2 L;  2FXQ A;  2EQS A;  4HIK A;  2E8G A;  3E9H A;  4YCU A;  1SMX A;  1P16 A;  2KBN A;  4HIO A;  3RN2 A;  3AYH B;  4QGU A;  2UUA L;  1GKH A;  2PNH A;  1KRT A;  3KF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...