4LF9L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9L00
2JE6I 3AFQA 2E2JH 4JOIA 4JI0L 2VQEL 1EWIA 2AHOB 2UUBL 5DLQE 3W5OA 4AQYL 4C2MH 3J81c 1VQDA 3H3VI 4UP8A 3NENA 4GLAC 1VQEA 1VQPA 3ULLA 5M5WH 3CCJA 5BR8L 1E7ZA 3K80C 4RG1A 2VUMG 2K4KA 1K0RA 4KI0A 3JAMc 4YCWA 3M85A 3PUXA 5GADC 3HKSA 4DR1Q 2YV5A 3PUYA 4UP7A 3TEHB 3ZJYC 2R7ZG 4EX5A 3K7AH 1BBUA 2GN5A 1XMQQ 4R4CA 4NXMQ 3H0GH 1HR0L 1X3GA 2R92G 1L2FA 5IP7G 3AYHB 2BH2A 1EQRA 2CKZB 3J81i 3M7NA 2I5LX 3PO2G 3NEMA 2UXDQ 1TXYA 2D62A 4DV4L 3S1RH 1XPUA 3TRZA 4OO1G 3EBEA 3RLOA 3CC4A 1KQSA 5GQOA 2JA8G 1MIUA 4JI3Q 3ICEA 2NVYH 4X6AH 1PA6A 1NMGA 2RHQB 1N36Q 2NZOA 4LFBL 3U58A 5IT9c 3VDYA 2OQ0A 1BKBA 1TWAH 1YHBA 1SE8A 4X66L 1XNRL 2VUMH 2HHHL 3GTKH 4IPCA 4PZ7A 2JA5G 2MO1A 5LMNW 4J15A 3CF5A 2R7ZH 2NVQH 2Y0SE 2Y0SG 2R6GA 4A3EH 1TWFH 5BR8Q 4RMFA 2R92H 5IYCG 4YHHL 4JV5L 2JA6G 4PZ6A 2DGYA 2GVBA 3TS0A 3PO2H 4AIMA 3PUVA 4KHPL 1YBYA 4GNXA 3J81j 1HR0Q 2KCTA 4X62L 2JA8H 2K5NA 2YU9H 4A4IA 1C0AA 3A5UA 2JEAI 1M1KC 4GNXB 1J6QA 1YJ9A 1NJIC 4LF6L 3WWVA 1HJPA 3KF8B 4JBWA 4H02A 3PF4A 3CD6A 1YZ6A 1I94L 1EYGA 4X65L 2UUAQ 4DV0L 4OX9Q 2A8VA 3CC2A 2UUCL 4LFAL 1SFOH 4K0KL 2JA5H 4GN5A 1KC8C 1RIPA 4A3KG 1X6OA 4DPGA 2K14A 2PQAB 3CW2C 3KOJA 3S17H 1N33Q 1VQFA 1PV4A 4LUZA 4LFBQ 2D0OA 2HQLA 1AE3A 4A3DG 1W3SA 3PV0A 4IPDA 2VW9A 1XNRQ 5IYCH 2HHHQ 1PH4A 2B3GA 3F2BA 2JA6H 5H1SE 2OWOA 1IBLL 2JK8A 3KFUA 1OXUA 3HOZG 1TWGH 2WFWA 4A3DH 4DR3L 2K5VA 4ME3A 4DV3L 2WAQE 4Y7NH 1U0LA 5LMNL 1X65A 3BZCA 2HIVA 1E3PA 3TQYA 3GDEA 4B3RL 5IY0A 1EUJA 4LF8Q 4P74A 4YWLA 3L2PA 1JB7A 1KRSA 4KHPQ 1SN8A 1VQKA 1VQ6A 4JI5L 3F2DA 3I7FA 4HJ5A 3TS2A 4JG2A 1ASYA 3PIPA 4X62Q 4OXPA 4YCUA 4A3KH 3G6EA 1UWVA 4QIWE 3HOVH 1X3EA 2YTVA 4L5QA 3AFPA 4MZ9A 1Z9FA 1L1OA 3BZKA 3STBD 1GD7A 5GAGC 2I5MX 4DV5L 1YVCA 1FGUA 1K83H 4JOIC 4KHZA 3FHWA 1KRTA 4X65Q 3G71A 4DV0Q 3T1HL 1I94Q 2UUCQ 4JI4L 4K0KQ 4EQ5A 2RCNA 1QVFA 4PMWA 1VQGA 2ZJPA 4LF5Q 4OWTB 1S3OA 3HKZG 1VCIA 2GVAA 2MO0A 2QGQA 2VL6A 2Z0SA 3W1BA 1K9MC 4LF7Q 1C7YA 1XTDA 3UDIA 1W2BA 1QZHA 1IBLQ 4DV2L 2E2IH 2CWAA 3B6YA 3OW2A 1KD1C 4GKKL 3CPWA 3H15A 2EXDA 1IXRA 4NXNL 4DK6C 3CC7A 1QVGA 4B3RQ 1AH9A 3BU2A 3CCSA 1Q82C 1N32L 5C3EG 1X55A 3EN2A 2HT1A 5FJ8H 4LFCL 4ALPA 2ES2A 4B3SL 2B63H 3H3VH 3MEFA 3L0OA 1FVIA 1KHIA 1PH5A 1E22A 3J80i 2Q2IA 4YWMA 5GAHC 1CSPA 3NELA 1PFSA 2EQSA 5E7NA 1PH8A 1VQAA 2I5HA 2VY3A 4DUYL 1FJGL 1WI5A 3BJUA 5C44G 1XJVA 1UE7A 3PCOB 1PHJA 3IRBA 3M9BA 4DV5Q 1YIJA 2LXJA 2XTIA 1O7IA 1Q86C 2ALYB 1IYJB 1KAWA 3T1HQ 2JA7G 2KBNA 1OXXK 5ELOA 3AEVA 1RL2A 3UDGA 4JI4Q 3GTPH 3M3YH 3ERSX 4A3BG 5GROA 4JI1L 1E24A 1YNXA 1WYDA 4HJAA 2VQFL 1SRUA 1K8GA 4FDBA 4HIDA 1XNQQ 1HZCA 4L5SA 4A93G 2NN6I 3U4ZA 2PI2E 5ELNA 1MKHA 2E8GA 2VS1A 3UE0A 5GAEC 5C3EH 1I5FA 3I56A 4DV2Q 4BY1G 2IX1A 4LF9L 1J5EL 4GKKQ 5M3MG 4X64L 3GO5A 4LUVA 5M3FG 2LXKA 1M90C 4GNXC 1YJWA 3PIOA 3CCUA 4LF4L 5IYDG 3HOYG 3G48A 1N8RC 1HNZQ 3OTOQ 1N32Q 1JJCB 2N8NA 2JJQA 4LFCQ 4B3SQ 1OXSC 3I2ZA 4DV7L 1Y1WG 2JA7H 4DR7L 1HNWL 3UDXA 5IYBG 4JI0Q 2VQEQ 1WCMG 5K36G 2DUDA 4GKJL 2UUBQ 3PUWA 4DUYQ 1Q46A 1VS0A 4A3BH 2OCEA 1SR3A 2AKWB 4R4TA 1VQIA 4AQYQ 4IPHA 3PSIA 4JBKA 4DR4L 3AQQA 4GN3B 1SMXA 1YI2A 4JI7L 4DV1L 4LNQA 3U50C 4C3IH 4A93H 3CMEA 3OYYA 4QQBX 5IP7H 1N9WA 4JI1Q 1KXLA 5HGQA 4BY1H 3S2DH 3E9IA 1GO3E 5M3MH 4A3LG 2PI2A 3MXNB 2OTLA 4HIKA 2VQFQ 2NZHA 3ULJA 2ZTCA 4JYAL 1QZGA 3HOYH 5IYDH 3U4VA 1TWHH 3E0EA 3K81C 4DR6L 1Q1EA 4AH6A 1IBKL 4LF9Q 1B7YB 1UE5A 1Y1WH 1MJCA 1B70B 3JC66 4DV4Q 1P16A 5IYBH 1Y14B 3ER0A 2OQKA 4YY3L 1AE2A 1WCMH 1IBML 4IO9A 3RZDH 4LF4Q 3FP9A 3GTGH 4POGA 1TWCH 5JEAG 3NBHB 4DKAC 4R4QA 4BBRG 4DV7Q 1VQ4A 1EQQA 3GTQH 4JI6L 1L1OC 2MQHA 3GTOH 3A5ZB 1WFQA 3T1YL 1Y1VG 4X66Q 1K73C 5JJLA 5LMUL 1A63A 1CKNA 1S40A 1UE1A 4DR4Q 3F2CA 4A3LH 2A19A 4JI8L 3UDFA 3DLLA 4DUZL 3RN2A 1NY4A 2V1CC 3KF6A 4JI2L 4JI7Q 4A76A 4IJLA 2KHIA 3CXCA 4IOAA 1K3RA 3S1NH 5FLXc 3CQZH 4YHHQ 5JEAJ 3KF6B 4A3IG 4JV5Q 2Q2UA 4MNOA 2EIFA 1HNXL 3D31A 3S16H 2VNUD 2HIXA 1LM0A 5J3BA 3W1GA 4LW1A 1PVOA 2N78A 1IBKQ 2IHFA 4BBRH 3TREA 3STBC 2IX0A 4LF6Q 2E2HH 2ZTDA 4UPAA 1Q8KA 4IJHA 4P72A 4LFAQ 1YITA 3I4MG 1L1OB 1N34L 2Z6KA 4DAYB 3KYHC 1C9OA 4JI6Q 3HOZH 3HKZE 3CCRA 1V1QA 1EFWA 1L0WA 3PF5A 3J80c 1VQNA 3T1YQ 1K8AC 2CWPA 4IPGA 1OTCA 5LMUQ 3PGZA 3I4OA 4A3MG 2NN6G 4A3IH 2H5XA 2AMCB 4A3GG 1WJJA 4JI8Q 3FKIG 1VQLA 4B3TL 3D0FA 4JI2Q 4IFDI 4DR3Q 2JEBI 3PUZA 3GTJH 4P73A 4DV3Q 1PH3A 4UY8C 3F8TA 5LMNQ 1G6PA 1D8LA 4OWXB 1HNXQ 1PH9A 5JJKA 1JJGA 3L7ZC 1XPRA 1BBWA 2BA0A 3CPFA 3RLNA 1HR0W 4JI5Q 4A3JG 3KDFA 4POFA 1A8VA 4DR1L 2R7DA 1NTGA 1P8LA 1SROA 3E9HA 1VQMA 1EIFA 2YTXA 3I4MH 4QY7A 2CQOA 1PH2A 1E1OA 2FXQA 5IWAL 5FLMG 4B3ML 4KLKA 3CCMA 4DV6L 3HOUG 2PNHA 4A3MH 2ZM6L 4BY7G 4A3GH 1LUZA 2R7FA 3RNUA 1NE3A 3CCVA 3M4OH 3RR5A 5AJ3L 3FKIH 3KJPA 3HFZB 5HY6A 1OXVA 4R1JA 4HIOA 4HJ7A 1JE5A 2YTYA 4TQUS 1E1TA 4IOCA 1S72A 5M5YH 3RN5A 3UE1A 1N36L 1B8AA 4B3TQ 1PH1A 2OTJA 1VQ7A 2R93G 4TVAB 4NXNQ 4A3JH 2Q2TA 4XTCS 1G291 1NBWA 1PYSB 4WJ3M 3GTMH 4PG3A 3I4NG 1V9PA 2ASBA 4GOPA 1NMFA 4BBSG 2UXCL 4JCVE 5C44H 2QEXA 1EIYB 2RHSB 5FLMH 2IT1A 3HOUH 5C0XI 4GOPB 4BY7H 4LUOA 2F3IA 2YYZA 3S1QH 1FJGQ 1XPOA 4YCVA 2UXBL 4A3EG 4GLXA 2N3SA 1MJEA 1JMCA 3CCLA 5IWAQ 4B3MQ 4DV6Q 3S2HH 1YJNA 2CCZA 3S14H 2ZM6Q 4O2DA 5JJIA 4HIMA 1JJ2A 5AJ3Q 1X54A 3HOWG 1PH6A 2CFMA 2JA9A 2UUAL 2UU9L 4A75A 4OX9L 5M3FH 2ZTEA 2R93H 2QA4A 1DGSA 1H95A 3JAMi 4C3JH 4A3FG 4DR5L 1R9TH 1N33L 2NVXH 3I4NH 1D7QA 4BBSH 2IY5B 2JQOA 3S1MH 5IE8A 1GVPA 3J7A5 4APVA 2RF4A 1J5EQ 4GN4B 4X64Q 4DK3C 1HZBA 3CAMA 1VQ5A 2KHJA 1U5KA 1VQJA 2F4VL 1A62A 2UXCQ 3A74A 4R4IA 1PH7A 4BA2I 2I0QA 3M4QA 3KLWA 4DR7Q 3Q8DA 1HNWQ 2B29A 4L5RC 4AYBE 4LF8L 4AYBG 4O0AA 4GKJQ 4PZ8A 1YHAA 3HOWH 2BA1A 3F1ZA 3DM3A 3LGJA 2ZJQA 2Z6KC 1YHQA 2UXBQ 1GKHA 1Q7YC 3EIVA 4HJ8A 4IFDG 4A3FH 4WJ4A 1CKNB 3CCEA 4DV1Q 2ATWA 4MTNA 1G51A 2KENA 2IHEA 3K7UC 4HJ9A 4BXXH 4OO1I 1CKOA 2PQAA 3K8AA 2XGTA 2UU9Q 4YWKA 4L5TA 1IZ6A 2A1AA 1WOCA 1QUQA 4GS3A 4DR5Q 1I6HH 4JC0A 1KIXA 1X3FA 3HOVG 4BA1I 3KJOA 4LF5L 4JYAQ 1HH2P 2LSSA 2E5LL 4DAMA 4LF7L 4DR6Q 4DR2L 1QUQB 1OXTA 4P71A 1I3QH 3HOXG 3S15H 1VQCA 3J7ZC 1EOVA 1UE6A 3SGIA 5IP9G 4IFDJ 1I50H 2PMZE 4YY3Q 2MFIA 2WB1E 4R4OA 1IBMQ 2WB1G 1SLJA 1Y1VH 1Z47A 1V43A 2N49A 2F4VQ 4A3CG 1Q12A 5EAYA 2WAQG 4P75A 2K50A 1VQ8A 1CSQA 2MNAA 4NB3A 1FL0A 5C4XG 4QJFA 2B63G 1QVCA 1VQBA 1X56A 3ULPA 2VZAA 1XMOL 2WP8J 2NVTH 1LYLA 2BH8A 1CKMA 3G4SA 2ID0A 3PO3G 1VQ9A 2C35B 4DUZQ 5C0XJ 3I55A 1X9NA 3K0XA 4JBMA 3S24A 5FJ8G 4BXXG 4C3HH 1JT8A 1T9HA 2K52A 1A0IA 5M5XH 3HOXH 1BVSA 1KL9A 5IP9H 1VQOA 3RLFA 4QGUA 2K5HA 1Q1BA 3M4PA 5C0XG 2E5LQ 4A3CH 3CCQA 4QL5A 5C4JH 2AWOA 4OONA 4DR2Q 1ASZA 4GOPC 1LTLA 1UEBA 1XMQL 3GTLH 4NXML 1XNQL 3GD7A 3RZOH 4Y52H 3KDFB 5C4XH 2ZJRA 1HZ9A 1IL2A 1CUKA 4OWWB 3CMAA 4NPSA 1YEZA 4DNIA 2L15A 2F52A 4JBJA 2UXDL 1Q81C 1N34Q 3A0JA 3CP0A 3PO3H 1VQHA 3H0GG 1PYBA 4UP9A 2Q2HA 2AWNA 2KCMA 4GLVB 1HNZL 3OTOL 1GM5A 1HZAA 4JI3L 1XMOQ 2D0PA 4LWCA 2K75A 4XIGS
chains in the Genus database with same CATH superfamily
3VYUA 2PCFB 3M4OB 1EFID 4JI0L 2VQEL 1EWIA 1S5FD 2AHOB 5DLQE 3W5OA 4C2MH 2P5ZX 1KAAA 4UP8A 1V1PA 5M5YB 1VQPA 3ULLA 1KDCA 1ILPA 4G7HC 5BR8L 2VUMG 1EY6A 1F2LA 1K0RA 3PUYA 4UP7A 3S9WA 3ZJYC 4EX5A 3K7AH 3SXHA 4DNRB 3HOUB 2BH2A 4BY7B 1EQTA 3S1QB 1LT6D 1XPUA 3RLOA 1EY8A 1WTRA 4R8NA 1Q8IA 3R8BA 2B2WC 5E4WC 4LFBL 4CJ2C 1XNRL 2HHHL 3QWNA 3NXWA 2MO1A 5LMNW 2BDOA 2NVXB 2R7ZH 4BBSB 1HTPA 1B9MA 1EYAA 5BR8Q 2LKVA 5IYCG 4X3TA 3OIPA 5HURA 3TS0A 2GVBA 3PO2H 3GV6A 3PUVA 4NW2A 4OO1H 1YBYA 2ZXRA 2PO4A 5I6YA 1SBBB 2KCTA 2K5NA 1C0AA 1J6QA 1YJ9A 1Q90A 4JBWA 3HOWB 3PF4A 3CD6A 1B50A 1D5XC 2UUAQ 1K8OA 2JA5H 3CW2C 2PNRC 2AQ2B 2SNSA 4LFBQ 3P75A 1T5XD 2VW9A 1XNRQ 2HHHQ 1PH4A 3F2BA 2JA6H 3X3NA 4LAAA 3KFUA 5CORA 4XXEA 3HOZG 3C2PA 1CTMA 2K5VA 4DR3L 2WAQE 2CHBD 1X65A 1E3PA 1DONA 4B3RL 5IY0A 1TQOA 4LF8Q 1PRTD 1Y1VB 2M00A 2B39A 1VQ6A 4HJ5A 3VR3A 3TS2A 1K0SA 3PIPA 1STGA 2X6GA 2YTVA 5GAGC 4MZ9A 3BZKA 3STBD 1YVCA 4KHZA 3U9SA 1NR4A 2SOBA 2RCNA 5CV6A 4C3HB 2Z0SA 2WKCA 2VL6A 3U9OA 5M5XB 4G7ZC 2NB0A 1GUNA 3Q0AA 2E2IH 2CWAA 3B6YA 1GJXA 2ICIA 4GKKL 3CPWA 5C4JB 3H15A 1IXRA 2RSOA 1EWCA 3CC7A 5C4XB 1QVGA 1B3QA 4B3RQ 1AH9A 2F0SA 3CCSA 1Q82C 1N32L 1PFBA 5D3DA 4LFCL 4ALPA 3N6RA 4KN7C 3NQIA 3C3LA 3MEFA 2B63H 1G2SA 1IW7D 2Q2IA 3DWQA 3QG1A 4PMCA 5E7NA 1VQAA 4DUYL 1FJGL 3K5LA 3BJUA 1PHJA 3PCOB 4F7XA 2LXJA 2IW3A 2E2JB 1NUCA 2KBNA 1OXXK 3M3YH 2Z4IA 1BXTA 1HQRD 1WYDA 4HJAA 2XNAC 4NDXA 2JP1A 5D3IB 4ZAIA 1ONLA 5GAEC 1UEAB 1S4ZA 5CV9A 1JJGA 1F2ZA 1I5FA 1CK1A 1LTRD 3OOCA 1J5EL 4GKKQ 4X64L 4H44C 4IZ8A 4GNXC 3PIOA 3HOYG 4ID6A 1HNZQ 4G57A 1N32Q 2PZTA 2JJQA 1BF4A 4LFCQ 1M4VA 1OXSC 2SEBD 1HNWL 1ENCA 1L0YB 1LTSD 4GKJL 4DUYQ 3BVZA 2E75C 4A3BH 4R4TA 4AQYQ 4IPHA 4C56C 3PSIA 3AQQA 3J80E 1MSHA 3I4NB 1YI2A 4JI7L 4FXKC 1VF5C 3MXNA 3HRZC 2EPBA 3GTKB 5IIFA 1PLFA 1WD1A 2IX3A 2OTLA 1NR2A 5KNCA 4NMZA 2NZHA 3L9AX 2NTTA 4A3EB 1QZGA 2R92B 1SYCA 5A2QE 3KLRA 1IBKL 1W6JA 1B2TA 5IGDA 1D1KA 3JC66 4K6DA 3NBHA 4DV4Q 1P16A 5IYBH 2NWGA 2OQKA 3ER0A 1WCMH 3RZDH 3Q6SA 2YU9B 2KEEA 2ZXPA 1VQ4A 2WACA 3VA5A 2JSOA 3A5ZB 1A63A 1K73C 3OMGA 1SFOB 2L11A 3F2CA 4A3LH 3UDFA 4X3UA 1NY4A 2V1CC 4JI2L 2Y0SB 4JI7Q 4A76A 1JOOA 2L4NA 2F0WA 3CXCA 2B2TA 2HCIA 5JEAJ 4A3IG 4JV5Q 2O5JC 1HNXL 1TWGB 4Y7NB 5CR3A 4LW1A 5C6AA 1STHA 5JEAH 1PZKD 1KNEA 3T51B 1IBKQ 2CQAA 2F0NA 2IHFA 1PFNA 3TREA 2ZTDA 2NVTB 1NNXA 4ZUIA 5KNBA 4IJHA 1SNDA 4FXGC 4A3KB 4N9TA 1N34L 1C9OA 3HOZH 3HKZE 5CYUA 1V1QA 2F0VA 4A3DB 1K83B 3E5SA 3OSOA 1OTCA 2JN4A 5AFWA 2NN6G 3LNNA 4IN3A 4A3GG 3SVMA 3FKIG 4ULLA 5HGTA 2MJ8A 2BE5C 4JI2Q 3ERQA 1HUMA 3F8TA 4KY7A 4ZCKA 1G6PA 2H4OA 1HFNA 4RHSA 5E4XA 1HNXQ 5JJKA 5I9PA 3SK5A 4JI5Q 2TMPA 4A3JG 2N88A 2R7DA 1DJRD 4N8X1 3NPPA 2NZ1D 2H1EA 2FXQA 4B3ML 4Z9CB 2SDFA 1NE3A 3CCVA 2Z6BA 2EY5A 1UUPA 1AZPA 3BVGA 5DEHA 4HIOA 3BYTB 1RTOA 3R2IA 4EGVA 1SNMA 2HCCA 3UE1A 1N36L 1U9RA 4JPBW 2OTJA 2R93G 5ELCA 4K2LA 2Q2TA 4CJ0B 3H6MA 4WJ3M 5G3LD 4PG3A 3BDOA 2ASBA 4GOPA 1V1OA 1SNPA 2FMCA 2G9DA 5G3LF 1LT5D 4EVOA 4OL7A 1XPOA 2N3SA 2JA7B 3CCLA 3Q24A 4B3MQ 5ELDA 3S2HH 2CCZA 4KKSA 3NTHA 1X54A 3IFDA 1PH6A 2CFMA 1ESRA 1G8ZD 4A75A 2C5CA 1DGSA 1H95A 4A3FG 4C3JH 4DR5L 1H9SB 4A93B 3SE0A 3I4NH 1X3QA 2Z1CA 2F3VA 1SYBA 2JXMB 4APVA 2A68D 4GN4B 1HZBA 4KJNA 2KHJA 2HD3A 2JA8B 1GUTA 3A74A 3DM1A 3M4QA 4IUTA 4MTKA 4QF4A 3OWEB 3Q8DA 2KA7A 2NBFA 4L5RC 3GTGB 4AYBG 3OWFA 1SE4A 3DM3A 2ZJQA 1YHQA 1GKHA 4HJ8A 3GTOB 4RGMA 4MTNA 2IHEA 1BR9A 2B2WA 2WIIB 3DWPA 1CKOA 1MD2D 3WDNA 1J8IA 3K8AA 3NHHA 3E0JA 4YWKA 2Z8LA 4DR5Q 1ENAA 3HOVG 3KJOA 4LF5L 3S1NB 1SJHD 3CQZB 4LF7L 1D6EC 2F0IA 5IP9G 1I50H 4YY3Q 3H3VC 2K6AA 2WB1G 4A3CG 1A2UA 1V43A 1Q12A 2WAQG 4P75A 2A69D 4BBRB 3JAML 1VQ8A 2I07B 2E2HB 1PXUA 1CI3M 2HDMA 3V2TA 1VQBA 3ULPA 2VB2X 2NVTH 1BOSA 2BH8A 4MIUA 3WOEA 4RAUC 3PO3G 1VQ9A 3GP7A 1PTOC 4BXXG 1JT8A 3D6CA 3S24A 5FJ8G 5FOBB 5LL6X 1I4QA 3NTKA 4KK7A 3HOXH 1KL9A 5IGEA 4ABNA 1GHJA 4K2KA 3CCQA 2EXZA 2F0EA 1UEBA 1XMQL 2K5WA 2K5QA 1XNQL 3GD7A 3KDFB 3MC0B 5EPKA 1HZ9A 1CQFA 1ZEQX 4NPSA 1YNNC 2K04A 1D5MC 1Q81C 4RH6A 1PRTB 4XQJA 3A0JA 1EQVA 2AWNA 1GUGA 1A3TA 1C48A 1T5EA 5J1ZA 1GM5A 5EPJA 2KCNA 3MFGA 4J6HA 3AFQA 1TU2B 4FXDA 2K03A 4JVZA 5E3FA 2UUBL 5JPNC 3J81c 3H3VI 2K5DA 3NENA 3MXPA 4DAVA 5M5WH 1QWYA 2FMMA 4RG1A 2K4KA 2VXWA 4CGYB 1O7ZA 1TS2A 2NYZD 4DR1Q 2YV5A 3GTMB 2R7ZG 1BBUA 5C4ZA 1XMQQ 5C44B 3E6ZX 1L2FA 5IP7G 1STNA 4IUUA 4LK1C 4HSPA 1XX8A 1SYDA 3PO2G 3VYTA 3TRZA 4OO1G 2LS01 1QCBD 2EJGC 1CFMA 2NVYH 1HHVA 5IT9c 3VDYA 4DNTB 1TWAH 1YHBA 3CRLC 4FF1A 2J4XA 2JA5G 3FPUB 1K28A 3DHQA 2Y0SE 4HCSA 1MBYA 2F0FA 1ET9A 2KOLA 4RMFA 2JA6G 5CBAE 2DY7A 3TP7A 1WTPA 1JWMD 4KHPL 4O42A 2SNMA 4GNXA 1G6ZA 2R61A 4L63B 4DAPA 2JA8H 4RCNA 1M1KC 1HJPA 3KF8B 4H02A 3A8IE 4DV0L 4OX9Q 3CC2A 3J81E 3HS0C 1KC8C 1X6OA 4DPGA 2PQAB 3V05A 3KOJA 3S17H 4CKCA 1PV4A 3I73A 2D0OA 2Q8IB 1AP0A 4IPDA 3PV0A 3O13A 1VDZA 2B3GA 2MPMA 5H1SE 2JK8A 1SDFA 1M8AA 2WFWA 4ME3A 4DV3L 2MUYA 1I3QB 1U0LA 5LMNL 3TZDA 3VR6A 5ELFA 1EUJA 3IL8A 1ENFA 3NTIA 3L2PA 1JB7A 1PZID 4KHPQ 4CHTB 3F2DA 1E0BA 2F0PA 1E2ZA 3I4LA 4YCUA 4QIWE 3HOVH 4L5QA 4I7ZC 2B63G 4DV5L 1GD7A 4ME5A 3S16H 1FGUA 1TVXA 4NP5A 1KRTA 4R8IA 4DV0Q 5I6WA 4NKLA 4DA2A 4TKOB 1VQGA 5EBDA 4FVMA 1WTXA 3HKZG 1TY2A 1VCIA 1WTWA 2QGQA 5CBEE 1K9MC 3SEBA 3M4YA 3UDIA 1W2BA 2RQXA 3OW2A 1IHZA 2ZT9C 1TR5A 2CW0C 1SE2A 3EN2A 4BXXH 1YNJC 3VR4A 1TS3A 5FJ8H 3H3VH 1KHIA 1PH5A 1E22A 3DWAA 3J80i 5GAHC 1CSPA 1KTKA 3NELA 1PFSA 3DUZA 1AFPA 1SYEA 3M9BA 2L9HA 4DV5Q 2XTIA 2O2LD 3AEVA 2X69A 3D8GA 3UDGA 3GTPH 1BDOA 4A3BG 5GROA 1PTOH 1SYFA 2F0KA 2RA4A 1BCPB 1RHPA 3U4ZA 2E8GA 2RVLA 3I56A 5C3EH 4HAEA 1IL8A 4HEDA 1SYGA 2QW7A 1H9KA 4ZYSA 2K1BA 5FLXL 1PYWD 3H0GB 4RA8A 3OTOQ 3D4WA 5IOCA 3I2ZA 4DR7L 3S1RB 1WTOA 4OEMB 5IYBG 4JI0Q 2VQEQ 4HCEA 1WCMG 1SAPA 3PUWA 1QNUA 1SNCA 1VS0A 3QB3A 1A6XA 4HMJA 2MHVA 4ILWA 3TP5A 4JBKA 4DR4L 4GN3B 1SMXA 4DV1L 4K8JA 5F2DA 4C3IH 2VUMB 4F88A 4QQBX 5IP7H 1N9WA 1H9SA 5HGQA 4BY1H 1JICA 3S2DH 5M3MH 4A3LG 2NVQB 4KN4C 1QJOA 3ULJA 1TWFB 2ZTCA 4HTHA 1H9MA 1WVLA 1TWHH 1Q1EA 1VMPA 1HRJA 1XTCD 1UE5A 1Y1WH 1MJCA 1IBML 5K36H 3FP9A 5BN5A 5JEAG 1EY0A 4DKAC 4FP5D 1EQQA 1WD0A 2MQHA 2QDLA 4KKUA 5JJLA 1Y1VG 2EDGA 4JW0A 1S40A 3OPOA 4DR4Q 2A19A 4JI8L 4DUZL 1II3A 3KF6A 3CHBD 2BOSA 1K3RA 2RDHA 4P2CB 1AN8A 2PZWA 3I91A 4MNOA 2EIFA 5BN3A 3D31A 5J3BA 1O80A 3K59A 2BDNA 1BUVT 4OIJA 1ET6A 2N78A 2F0OA 4UPAA 1Q8KA 1YITA 1SE3A 5KEEA 1XWEA 2XRSD 1EFWA 4K14A 3J80c 1HTLD 4QUFA 2EYHA 4JI8Q 1VQLA 2GA4B 4CJ1B 3D0FA 3LWEA 4DR3Q 4XDXA 5JAVA 2JEBI 3T53B 3GTJH 2L55A 4UY8C 3VR2A 4HR7B 1D8LA 1PTOF 2XIWA 2EY2A 3KDFA 4POFA 1P8LA 4PMBA 1EIFA 3I4MH 2A6HC 1KDBA 3P1HA 4JK1C 1PH2A 5I2YA 3TBIB 1LACA 5IWAL 5DM63 4EQPA 5JPMC 4RKLA 4A3MH 3M4OH 5ISRA 5AJ3L 1MI2A 1QILA 4C1NK 4H7BA 1OXVA 2CH4A 3AB9A 4WJWA 4XQQA 2N55A 3I70A 1UAPA 4IOCA 5M5YH 4DXGA 2B2UC 1EU3A 1PH1A 1VQ7A 1DZ1A 1CQVA 4XTCS 4C3JG 1G291 1NBWA 1PYSB 5IGFA 3I4NG 1V9PA 2UXCL 5TSSA 1HCZA 3R93A 3ITPA 4X3KA 1KLGD 3HOUH 5C0XI 4BY7H 3S1QH 1FJGQ 4L6TB 4IQZA 1STYA 4M1UB 2EE1A 4YCVA 4A3EG 1MJEA 1JMCA 5FO9B 5IWAQ 2XRQD 1DCZA 3ND9A 4O2DA 5AJ3Q 1E2WA 2ZTEA 2L0CA 3ONAB 1N33L 1A2TA 2NVXH 4BBSH 1ICFB 2ICEC 5IE8A 1GVPA 4XT3B 1J5EQ 4X64Q 3HZXA 5EKLA 1VQ5A 5COYA 4I7AA 5J22A 2F4VL 3HOYB 1EIGA 5I9OA 2UXCQ 2AUKA 4BA2I 1STEA 1Z7TA 3MHBA 1HNWQ 2B29A 1SSOA 4GKJQ 2HUGA 1TWCB 5FO7B 3NWSA 3HOWH 2BA1A 3F1ZA 3GTQB 3EIVA 5CV7A 1VF7A 1CKNB 5EKKA 3CCEA 1SEBD 3K7UC 1NSNS 4HJ9A 4KD4A 2PQAA 2XSCA 3J7AV 2JYOA 4PNYA 1PMRA 3HGBA 4JC0A 4F87A 1HH2P 2LSSA 4DAMA 1QUQB 3HOXG 1UE6A 1TT2A 2EYJA 3SGIA 4R4OA 1CZWA 1Z47A 1Y1VH 1Z6HA 2F4VQ 3NUCA 3MZ5A 1X3PA 4NB3A 2RSNA 2VZAA 5KYLA 1XMOL 1GXDC 2WP8J 3G4SA 5FO8B 2ID0A 2RCFA 3BZDB 2PZUA 4TRDA 3I55A 1ICWA 1X9NA 2A74C 4C3HH 2K52A 3H09A 4UDUC 4A3IB 5M5XH 4CDCC 1SMYD 1H9RA 1VQOA 3M4PA 4MHEA 5C4JH 1ASZA 1A3VA 4NXML 4Y52H 1HQMC 3E3XA 4L8JA 5C4XH 5M9OA 3W3AA 1CUKA 4OWWB 4DNIA 2F52A 2UXDL 1N34Q 3NE5B 1LTID 1PYBA 4UP9A 2Q2HA 2KCMA 1F2MA 1KDAA 4XT1B 4ODGA 1XMOQ 2D0PA 4LWCA 5C0XJ 4A3GB 1BNZA 2E2JH 3FKIB 3T16A 4F8MA 3Q23A 1HA6A 1JOKA 4GLAC 1VQEA 1V8QA 3MFYA 4RGOS 1ZYRC 4IUNA 3K80C 3FEWX 3C46A 1U4PA 2OT2A 4KI0A 4A3JB 3M85A 5GADC 3HKSA 3RD4A 4R4CA 4NXMQ 1HR0L 1EWHA 3DEOA 3G7LA 3OIQA 2O5IC 1X3GA 2DJFC 3KK7A 2EYOA 3AYHB 1IKMA 1TS5A 1ESFA 2CKZB 2XN9C 2I5LX 3J81i 2F3WA 3NEMA 2UXDQ 3EBEA 1RCVD 5ELBA 5GQOA 2JA8G 4WFN3 1MIUA 1RF2D 4IUQA 3ICEA 3S14B 1PA6A 1NMGA 2RHQB 1N36Q 2NZOA 5JJZA 3U58A 2E76C 1U4LA 4X66L 2R93B 5M3FB 3GTKH 4PZ7A 3PQIA 4J15A 1R9TB 2MP1A 3R2TA 4M8AA 3S1MB 2R6GA 4CDFC 4A3EH 1R4PB 2R92H 4YHHL 1O7YA 4AIMA 1EL0A 3TMEA 2DJGC 1HR0Q 4DF7A 4FYDA 2YU9H 3A5UA 4LF6L 4OELB 3WWVA 2DY8A 1EYGA 3BG3A 2A8VA 4LFAL 1SFOH 1JB3A 1RIPA 2IL8A 2K05A 1AE3A 3V96A 5T1GA 3D3RA 3SK4A 5KGUA 3MEHA 1PDQA 1LT3D 2OWOA 1I6HB 2CH4W 3K57A 1TWGH 2CVRA 3CKIB 4Y7NH 5D65A 3S15B 3BZCA 2HIVA 3TQYA 1PRTC 1K3BC 1WTVA 4AYBB 3EVQA 4YWLA 2F0DA 1SN8A 1VQKA 4JG2A 4OXPA 2XVSA 3WOFA 4A3KH 3G6EA 1UWVA 1X3EA 1UNSA 2I0QA 1LT4D 2I5MX 4TSSA 3G71A 1K83H 2F0UA 3KBXA 4JOIC 3FHWA 3T1HL 4A3DH 3L3OC 4PMWA 1NAPA 3IFTA 1Y69U 4QB4A 4OWTB 1S3OA 4U673 4LF5Q 2GVAA 2MO0A 3W1BA 4LF7Q 3QIAA 3FMCA 4QMGA 1C7YA 1XTDA 3EQLC 1QZHA 2PMZB 2WB1B 4DV2L 3GTLB 2WAQB 4OHJA 4NXNL 3RZOB 3FPPA 2RDGA 2LY7A 2F0JA 1A15A 5C3EG 1X55A 1IW7C 4UAIA 1FVIA 3FDTA 2F0GA 3PO3B 1JWUD 2EQSA 4J1MA 2VY3A 5C44G 1XJVA 1UE7A 2DN8A 2ALYB 3T1HQ 4CKEA 1A3UA 5ELOA 4DFAA 4ZLTF 1I4GA 1E24A 4JI1L 1I4XA 2EYMA 4ZRZA 2EYLA 1G2TA 3Q22A 2VQFL 1SRUA 2PW7A 5FLXE 5JOBA 1XNQQ 2B8FA 4L5SA 4C3IG 3MAQA 1QE6A 2ENBA 2VS1A 4DV2Q 4BY1G 4LF9L 5M3MG 4LUVA 3K7AB 4K8IA 2LXKA 5JVG3 1M90C 2WV6D 1YJWA 3SR1A 4LF4L 1N8RC 4PV1C 1Y1WG 2JA7H 4RGNA 4XYQA 1LTTD 5K36G 2DUDA 3VYSA 2UUBQ 4ZK9B 3I8ZA 1Q46A 4K5XA 1SR3A 2AKWB 1VQIA 2EJFC 3TZUA 4LNQA 3U50C 1DD2A 4A93H 2Z9HA 5J39A 3OYYA 4JI1Q 2B2UA 1GO3E 2HQEA 3MXNB 1C8CA 2R7ZB 1Q3LA 4HIKA 2VQFQ 1EYDA 3OW7A 3URYA 4JYAL 5IYDH 1EYCA 3P20A 4DR6L 4AH6A 4LF9Q 4G4KA 1B7YB 3PO2B 2AQ1B 1BBXC 1Y14B 4R9WA 3GTGH 4IO9A 4HN7A 4LF4Q 4POGA 5KNDA 3NBHB 1L1OC 3BS1A 3T56B 3GTOH 4FO2A 5C4HA 1CKNA 3G6JB 2JA5B 1F2YA 5DM73 1IKLA 1UE1A 4RCOA 3DLLA 2JEAI 1HUNA 1VMCA 3RN2A 1S5ED 1SJED 1STBA 3QOJA 4IJLA 5FK9C 2KHIA 1ILQA 5EKIA 4IOAA 3S1NH 3CQZH 2JA6B 1JQYD 3T4AC 4K5WA 2VNUD 2QILA 1W6KA 2QF7A 3W1GA 1JC7A 2IPKD 1O7LA 4BBRH 3A56A 3P7JA 3VA7A 2E2HH 3DEPA 3A8KE 2L1BA 2HDLA 4P72A 3VYRA 3I4MG 1L1OB 4DAYB 1EY5A 4H0LC 3TP6A 1WTQA 1L0WA 3TP8A 3PF5A 2CWPA 4A3MG 1BCPC 3MA2B 4DK1A 1WJJA 4B3TL 4IFDI 4DV3Q 2BE5D 4P73A 1PH3A 2Z4HA 5LMNQ 2E2IB 3L7ZC 1XPRA 2XWJB 3J7YW 3CPFA 2BA0A 3RLNA 1VQMA 1SROA 1XYIA 1F77A 2YTXA 1SNOA 2F4IA 2MGSA 4QY7A 2CQOA 1E1OA 2B63B 1MSGA 2LMCB 3HOUG 4DV6L 1O78A 2PNHA 4BY7G 2R7FA 3RNUA 3RR5A 2KECA 2F1MA 3KJPA 3HKZB 2V4DA 3SDZA 4ZKCB 2FINB 5IGBA 2YTYA 3M3YB 1E1TA 1S72A 3RN5A 2F0HA 4B3TQ 3KLSA 4TVAB 4V190 1LTAD 3GTMH 4BBSG 4CBVA 2D9UA 5C44H 1B53A 3TDQA 1ZYRD 1FNVA 2RHSB 5FLMH 3KBGA 4GOPB 1DOMA 5C5LA 2DNEA 1J9OA 1STAA 4GLXA 4DV6Q 3TN2A 2FJ2A 5KYIA 4MN3A 4A3BB 3HOWG 2UUAL 2UU9L 4HMIA 3NP8A 2QA4A 3JAMi 1RJTA 1LLRD 3AMUA 2IY5B 2A68C 2EOTA 3J7A5 2RF4A 2I46A 4DK3C 3CAMA 1I4PA 1U5KA 1B1ZA 3CU7A 4R4IA 1PH7A 2K7VA 3KLWA 4DR7Q 4Q5VA 3OMCA 3BYYB 3F2UA 4AYBE 1WCMB 4LF8L 3RZDB 5ELEA 4DU9A 1YHAA 3LGJA 2Z6KC 1Q7YC 3BVMA 4WJ4A 4DV1Q 2K28A 2ATWA 1G51A 2KENA 1CT1D 4DK0A 5CC4A 4QUCA 2UU9Q 2A1AA 4ZKBB 1KIXA 4BA1I 2EY6A 3KLSX 2E5LL 4C3HG 3SHLA 2RKSA 4P71A 1I3QH 1VQCA 2AUJD 3J81L 1EOVA 4IFDJ 1KNAA 2PMZE 1IBMQ 2MFIA 2WB1E 5KIXA 4WORA 2A69C 5EAYA 1GUOA 1EOTA 5A35A 4IFDH 1FL0A 5C4XG 1QVCA 1X56A 1CM9A 1CKMA 5EGTA 1PZJD 2C35B 4DUZQ 3HOZB 2A6EC 1PRTF 2C9OA 1HPCA 1G91A 4JBMA 1PTOD 1F9QA 1Y8NB 1T9HA 2NUCA 5CV8A 1MHWC 3RLFA 5CMDA 4QGUA 5C0XG 2E5LQ 5IT9L 3EA6A 2AWOA 4OONA 1SNQA 2ZJRA 1DM0B 3D6WA 3PIP3 1YEZA 1JR0D 1YNND 4JBJA 4DXFA 1Y8PB 4H13C 5I2XA 1DXMA 1HNZL 1HZAA 4JI3L 4XIGS 2JE6I 4JOIA 4FF4A 2EVBA 3IKJA 2Q8TA 4LMQD 3K5OA 4AQYL 3D4DA 1VQDA 5D14A 2M2LA 1QG7A 3GV3A 3CCJA 3W2DA 4N8FA 1E7ZA 3JAMc 4YCWA 3PUXA 4E6IA 3TEHB 2Q8RE 5DNFA 1EY4A 3K6OA 2GN5A 3H91A 5I4DA 3HG9A 3H0GH 3J7AF 2KEDA 4S3SA 1B9NA 2R92G 1EQRA 3M7NA 4RGTA 1TXYA 2D62A 4DV4L 3S1RH 3CC4A 4FNFA 1KQSA 1DOKA 4JI3Q 1EZ8A 3S2HB 4X6AH 3X3MA 4KMUC 4XYOA 2OQ0A 1BKBA 2VUMH 1SE8A 5C3XA 4IPCA 4C3JB 1QNKA 2B2YC 3CF5A 2IWHA 2NVQH 2Y0SG 1TWFH 4RWSC 2E74C 4JV5L 2K01A 5C3WA 4PZ6A 2DGYA 2DNCA 3PIO3 3LWUA 3J81j 4KV6A 4X62L 3KF8A 4X3SA 4A4IA 1IYVA 4GNXB 1NJIC 1F9RA 3FVQA 3IAYA 1YZ6A 1I94L 2J7ZA 4X65L 4K0KL 2UUCL 2TSSA 4GN5A 4A3KG 2K14A 3UI2A 3H94A 2B2VC 4IURA 1N33Q 1VQFA 3N52A 4LUZA 2HQLA 4A3DG 1W3SA 3DXJC 3JAME 5IYCH 4GZYC 2R3ZA 3I90A 1IBLL 3GQBA 1OXUA 1B3AA 3SK6A 2D2CC 1KLUD 4KD3A 1I50B 3GDEA 4P74A 1KRSA 1FNWA 4RKBA 4JI5L 3I7FA 1LV9A 2OEOA 1ASYA 1DYQA 2F0TA 1S5DD 2OF1A 4X62Q 1I4HA 1EY7A 3BDLA 4KHVA 3AFPA 1L1OA 1Z9FA 4DAYA 1I94Q 4X65Q 4K0KQ 1FD7D 3ZYYX 1JWSD 2UUCQ 4EQ5A 4JI4L 1QVFA 5EPLA 2ZJPA 4FF3A 1E2VA 2A5HA 2EJMA 3HOXB 1U4RA 3A7AB 1BCPD 1IBLQ 1X32A 2A73B 1AEXA 1KD1C 2K33A 1B4OA 2EXDA 4DK6C 1BCPF 3M7GA 3EFXD 2CW0D 3BU2A 3PMFA 3NK9A 2HT1A 2ES2A 4B3SL 3L0OA 1EEID 1YNJD 1NCVA 4K6LA 4YWMA 2WKDA 1KABA 3MXGA 1ZXTA 1PH8A 1JE4A 2I5HA 4QIWB 1WI5A 1HA5A 2FFKB 5C0XH 3IRBA 1H9JA 1YIJA 2JA7G 1Q86C 1O7IA 1IYJB 1KAWA 1FGBD 2G5DA 3NBIA 2WINB 4U68A 1RL2A 4JI4Q 3ERSX 5LL6S 1V1PB 1YNXA 1C4QA 4N9PA 2BCOA 1GHKA 1D5ZC 5FKAC 5M5WB 1K8GA 4FDBA 4HIDA 5EQ0A 1HZCA 4A93G 2NN6I 3HEJA 2PI2E 5ELNA 1MKHA 3I72A 3UE0A 2IX1A 1I4RA 1QOHA 4G7OC 3I3CA 2B8GA 3GO5A 5M3FG 1QB5D 5L37A 3CCUA 5IYDG 2VB3X 3G48A 4Q0FA 1JJCB 2N8NA 4B3SQ 4DV7L 4LJZC 3UDXA 1S5BD 1ZKOA 2XWBB 1TY0A 3NSWA 2OCEA 1HFGA 2NVYB 3T13A 4J8QA 3MWYW 2K32A 1TWAB 3CMEA 1KXLA 2RDFA 3TSSA 2OXPA 3E9IA 1IYUA 3J80L 1DOLA 2PI2A 3HOYH 3K0YA 1CZGA 3E0EA 3A55A 3K81C 2F0QA 2QKIC 3U4VA 4UHVA 4OIKA 4B08A 3A54A 5T1IA 1B70B 5E1FA 5NUCA 4YY3L 2F0MA 1AE2A 3BDCA 4CDEC 1TKWB 2KQ3A 3MTSA 2EZVA 1TWCH 5A2QL 4A3FB 4R4QA 4BBRG 4DV7Q 5CGKA 3GTQH 4JI6L 1ML0D 4YIJA 3SK8A 1WFQA 3T1YL 4X66Q 5LMUL 3R3OA 1F9SA 1TS4A 3A7LA 3S17B 5KRUA 3KUPA 3A8JE 2IJ0A 1K8MA 3RUZA 1RTNA 5FLXc 4YHHQ 3KF6B 2Q2UA 1L0XB 2HIXA 1LM0A 1SXTA 5IODA 4ZUJA 1PVOA 2F0LA 1LTBD 5CV4A 1JCKB 3STBC 2IX0A 4LF6Q 5C5MA 1EZ6A 1U4MA 2EYFA 3MVVA 4ZQ3A 3DMUA 5EJWA 3K5MA 4LFAQ 2NTSA 3HOVB 2Z6KA 3KYHC 4QCLA 4JI6Q 3CCRA 2RBMA 3QJYA 3S16B 1LTGD 1VQNA 3T1YQ 1K8AC 4IPGA 5LMUQ 3PGZA 3I4OA 4A3IH 2H5XA 1TIID 2AMCB 2KJXA 2QCPX 2L5TA 3QR8A 2A6ED 3PUZA 4KY6A 1B44D 1FYCA 4V0BA 2KCCA 4KY5A 2D5DA 4OWXB 1PH9A 1LO5D 4CKBA 1BBWA 1HR0W 5K5PA 1A8VA 4DR1L 1NTGA 3E9HA 5CV5A 2A6HD 1HXYD 1GUWA 2EY1A 5FLMG 4KLKA 3CCMA 2M9VA 2NN6H 2ZM6L 4A3GH 1LUZA 3FKIH 4C2MB 3HFZB 1RODA 4XQNA 5HY6A 3EJIA 4R1JA 4HJ7A 4IUPA 5IGGA 1JE5A 3GTPB 4TQUS 1LABA 1F9PA 2PYKA 4C1NI 1B8AA 1PTOB 4NXNQ 4A3JH 1BQQT 1GUSA 4BS9A 1EIHA 4DGZA 5C3EB 1NMFA 2O4XA 4JCVE 2QEXA 2KUMA 1EIYB 4RFBA 2IT1A 4LUOA 2F3IA 2YYZA 2UXBL 3ND8A 4KTAA 2AQ3B 5EBCA 2PPBC 3D4RA 1YJNA 3S14H 1EY9A 2ZM6Q 2QEJC 5JJIA 4HIMA 4DN4M 1JJ2A 3HP3A 4HSVA 2JA9A 4OX9L 2R93H 2G9HD 5M3FH 1R9TH 4C3IB 1RKNA 1D7QA 1PFMA 2B2TC 2JQOA 1BO0A 4BY1B 3S1MH 3S2DB 5M3MB 1EEFD 3LX0A 4O1NA 3C1FA 2EYPA 4CDDC 2F03A 1AZQA 1VQJA 2PW5A 1TWHB 2QDBA 1A62A 1Y1WB 3FRPB 4IUVA 4KKTA 4KJOA 4O0AA 4OGQC 4PZ8A 2E2DC 3RMHA 4PQXA 2UXBQ 2ZXOA 1MGSA 4EQOA 4IFDG 4A3FH 1I6VC 1RD9D 4B9XA 4OO1I 5LHY1 3VR5A 2XGTA 4L5TA 1IZ6A 1WOCA 1QUQA 4GS3A 1I6HH 1Y8OB 1R4QB 1X3FA 2X6LA 2B2YA 4JYAQ 1RDPD 3C1EA 2FHTA 4DR6Q 4IALA 4DR2L 1OXTA 3AU7A 1XXGA 3S15H 3J7ZC 1CA5A 1SLJA 2N49A 5BN4A 2LFNA 5IGCA 1JOQA 2KHSA 2K50A 1CSQA 2MNAA 4FF2A 3MXUA 4QJFA 4B9WA 2PQEA 1LYLA 1CHQD 4RHRA 3CRKC 3K58A 1GOZA 3QO2A 3K0XA 2KVMA 2B2VA 5IT9E 1A0IA 1SMYC 4K5VA 3NWTA 4WRDA 1BVSA 1CHPD 5IP9H 4I65A 1OO9B 5JVH3 1JORA 1FR3A 3GTJB 4A3CH 2K5HA 1Q1BA 1CA6A 4BWGB 1D2BA 3NQTA 4QL5A 1WTHA 4EQNA 3GTLH 4DR2Q 4GOPC 1LTLA 3RZOH 2J0TD 3K5NA 1FNUA 1IL2A 3QOLA 3CMAA 2L15A 1AW7A 3I4MB 5DAUA 1EU4A 2L12A 3PO3H 3CP0A 1VQHA 3H0GG 1D1IA 1S5CD 3EROA 4GLVB 3OHXC 3OTOL 2K75A 4A3MB
chains in the Genus database with same CATH topology
2JE6I 3AFQA 2E2JH 4JOIA 4JI0L 2VQEL 1EWIA 2AHOB 2UUBL 5DLQE 3W5OA 4AQYL 4C2MH 3J81c 1VQDA 3H3VI 4UP8A 3NENA 4GLAC 1VQEA 1VQPA 3ULLA 5M5WH 3CCJA 5BR8L 1E7ZA 3K80C 4RG1A 2VUMG 2K4KA 1K0RA 4KI0A 3JAMc 4YCWA 3M85A 3PUXA 5GADC 3HKSA 4DR1Q 2YV5A 3PUYA 4UP7A 3TEHB 3ZJYC 2R7ZG 4EX5A 3K7AH 1BBUA 2GN5A 1XMQQ 4R4CA 4NXMQ 3H0GH 1HR0L 1X3GA 2R92G 1L2FA 5IP7G 3AYHB 2BH2A 1EQRA 2CKZB 3J81i 3M7NA 2I5LX 3PO2G 3NEMA 2UXDQ 1TXYA 2D62A 4DV4L 3S1RH 1XPUA 3TRZA 4OO1G 3EBEA 3RLOA 3CC4A 1KQSA 5GQOA 2JA8G 1MIUA 4JI3Q 3ICEA 2NVYH 4X6AH 1PA6A 1NMGA 2RHQB 1N36Q 2NZOA 4LFBL 3U58A 5IT9c 3VDYA 2OQ0A 1BKBA 1TWAH 1YHBA 1SE8A 4X66L 1XNRL 2VUMH 2HHHL 3GTKH 4IPCA 4PZ7A 2JA5G 2MO1A 5LMNW 4J15A 3CF5A 2R7ZH 2NVQH 2Y0SE 2Y0SG 2R6GA 4A3EH 1TWFH 5BR8Q 4RMFA 2R92H 5IYCG 4YHHL 4JV5L 2JA6G 4PZ6A 2DGYA 2GVBA 3TS0A 3PO2H 4AIMA 3PUVA 4KHPL 1YBYA 4GNXA 3J81j 1HR0Q 2KCTA 4X62L 2JA8H 2K5NA 2YU9H 4A4IA 1C0AA 3A5UA 2JEAI 1M1KC 4GNXB 1J6QA 1YJ9A 1NJIC 4LF6L 3WWVA 1HJPA 3KF8B 4JBWA 4H02A 3PF4A 3CD6A 1YZ6A 1I94L 1EYGA 4X65L 2UUAQ 4DV0L 4OX9Q 2A8VA 3CC2A 2UUCL 4LFAL 1SFOH 4K0KL 2JA5H 4GN5A 1KC8C 1RIPA 4A3KG 1X6OA 4DPGA 2K14A 2PQAB 3CW2C 3KOJA 3S17H 1N33Q 1VQFA 1PV4A 4LUZA 4LFBQ 2D0OA 2HQLA 1AE3A 4A3DG 1W3SA 3PV0A 4IPDA 2VW9A 1XNRQ 5IYCH 2HHHQ 1PH4A 2B3GA 3F2BA 2JA6H 5H1SE 2OWOA 1IBLL 2JK8A 3KFUA 1OXUA 3HOZG 1TWGH 2WFWA 4A3DH 4DR3L 2K5VA 4ME3A 4DV3L 2WAQE 4Y7NH 1U0LA 5LMNL 1X65A 3BZCA 2HIVA 1E3PA 3TQYA 3GDEA 4B3RL 5IY0A 1EUJA 4LF8Q 4P74A 4YWLA 3L2PA 1JB7A 1KRSA 4KHPQ 1SN8A 1VQKA 1VQ6A 4JI5L 3F2DA 3I7FA 4HJ5A 3TS2A 4JG2A 1ASYA 3PIPA 4X62Q 4OXPA 4YCUA 4A3KH 3G6EA 1UWVA 4QIWE 3HOVH 1X3EA 2YTVA 4L5QA 3AFPA 4MZ9A 1Z9FA 1L1OA 3BZKA 3STBD 1GD7A 5GAGC 2I5MX 4DV5L 1YVCA 1FGUA 1K83H 4JOIC 4KHZA 3FHWA 1KRTA 4X65Q 3G71A 4DV0Q 3T1HL 1I94Q 2UUCQ 4JI4L 4K0KQ 4EQ5A 2RCNA 1QVFA 4PMWA 1VQGA 2ZJPA 4LF5Q 4OWTB 1S3OA 3HKZG 1VCIA 2GVAA 2MO0A 2QGQA 2VL6A 2Z0SA 3W1BA 1K9MC 4LF7Q 1C7YA 1XTDA 3UDIA 1W2BA 1QZHA 1IBLQ 4DV2L 2E2IH 2CWAA 3B6YA 3OW2A 1KD1C 4GKKL 3CPWA 3H15A 2EXDA 1IXRA 4NXNL 4DK6C 3CC7A 1QVGA 4B3RQ 1AH9A 3BU2A 3CCSA 1Q82C 1N32L 5C3EG 1X55A 3EN2A 2HT1A 5FJ8H 4LFCL 4ALPA 2ES2A 4B3SL 2B63H 3H3VH 3MEFA 3L0OA 1FVIA 1KHIA 1PH5A 1E22A 3J80i 2Q2IA 4YWMA 5GAHC 1CSPA 3NELA 1PFSA 2EQSA 5E7NA 1PH8A 1VQAA 2I5HA 2VY3A 4DUYL 1FJGL 1WI5A 3BJUA 5C44G 1XJVA 1UE7A 3PCOB 1PHJA 3IRBA 3M9BA 4DV5Q 1YIJA 2LXJA 2XTIA 1O7IA 1Q86C 2ALYB 1IYJB 1KAWA 3T1HQ 2JA7G 2KBNA 1OXXK 5ELOA 3AEVA 1RL2A 3UDGA 4JI4Q 3GTPH 3M3YH 3ERSX 4A3BG 5GROA 4JI1L 1E24A 1YNXA 1WYDA 4HJAA 2VQFL 1SRUA 1K8GA 4FDBA 4HIDA 1XNQQ 1HZCA 4L5SA 4A93G 2NN6I 3U4ZA 2PI2E 5ELNA 1MKHA 2E8GA 2VS1A 3UE0A 5GAEC 5C3EH 1I5FA 3I56A 4DV2Q 4BY1G 2IX1A 4LF9L 1J5EL 4GKKQ 5M3MG 4X64L 3GO5A 4LUVA 5M3FG 2LXKA 1M90C 4GNXC 1YJWA 3PIOA 3CCUA 4LF4L 5IYDG 3HOYG 3G48A 1N8RC 1HNZQ 3OTOQ 1N32Q 1JJCB 2N8NA 2JJQA 4LFCQ 4B3SQ 1OXSC 3I2ZA 4DV7L 1Y1WG 2JA7H 4DR7L 1HNWL 3UDXA 5IYBG 4JI0Q 2VQEQ 1WCMG 5K36G 2DUDA 4GKJL 2UUBQ 3PUWA 4DUYQ 1Q46A 1VS0A 4A3BH 2OCEA 1SR3A 2AKWB 4R4TA 1VQIA 4AQYQ 4IPHA 3PSIA 4JBKA 4DR4L 3AQQA 4GN3B 1SMXA 1YI2A 4JI7L 4DV1L 4LNQA 3U50C 4C3IH 4A93H 3CMEA 3OYYA 4QQBX 5IP7H 1N9WA 4JI1Q 1KXLA 5HGQA 4BY1H 3S2DH 3E9IA 1GO3E 5M3MH 4A3LG 2PI2A 3MXNB 2OTLA 4HIKA 2VQFQ 2NZHA 3ULJA 2ZTCA 4JYAL 1QZGA 3HOYH 5IYDH 3U4VA 1TWHH 3E0EA 3K81C 4DR6L 1Q1EA 4AH6A 1IBKL 4LF9Q 1B7YB 1UE5A 1Y1WH 1MJCA 1B70B 3JC66 4DV4Q 1P16A 5IYBH 1Y14B 3ER0A 2OQKA 4YY3L 1AE2A 1WCMH 1IBML 4IO9A 3RZDH 4LF4Q 3FP9A 3GTGH 4POGA 1TWCH 5JEAG 3NBHB 4DKAC 4R4QA 4BBRG 4DV7Q 1VQ4A 1EQQA 3GTQH 4JI6L 1L1OC 2MQHA 3GTOH 3A5ZB 1WFQA 3T1YL 1Y1VG 4X66Q 1K73C 5JJLA 5LMUL 1A63A 1CKNA 1S40A 1UE1A 4DR4Q 3F2CA 4A3LH 2A19A 4JI8L 3UDFA 3DLLA 4DUZL 3RN2A 1NY4A 2V1CC 3KF6A 4JI2L 4JI7Q 4A76A 4IJLA 2KHIA 3CXCA 4IOAA 1K3RA 3S1NH 5FLXc 3CQZH 4YHHQ 5JEAJ 3KF6B 4A3IG 4JV5Q 2Q2UA 4MNOA 2EIFA 1HNXL 3D31A 3S16H 2VNUD 2HIXA 1LM0A 5J3BA 3W1GA 4LW1A 1PVOA 2N78A 1IBKQ 2IHFA 4BBRH 3TREA 3STBC 2IX0A 4LF6Q 2E2HH 2ZTDA 4UPAA 1Q8KA 4IJHA 4P72A 4LFAQ 1YITA 3I4MG 1L1OB 1N34L 2Z6KA 4DAYB 3KYHC 1C9OA 4JI6Q 3HOZH 3HKZE 3CCRA 1V1QA 1EFWA 1L0WA 3PF5A 3J80c 1VQNA 3T1YQ 1K8AC 2CWPA 4IPGA 1OTCA 5LMUQ 3PGZA 3I4OA 4A3MG 2NN6G 4A3IH 2H5XA 2AMCB 4A3GG 1WJJA 4JI8Q 3FKIG 1VQLA 4B3TL 3D0FA 4JI2Q 4IFDI 4DR3Q 2JEBI 3PUZA 3GTJH 4P73A 4DV3Q 1PH3A 4UY8C 3F8TA 5LMNQ 1G6PA 1D8LA 4OWXB 1HNXQ 1PH9A 5JJKA 1JJGA 3L7ZC 1XPRA 1BBWA 2BA0A 3CPFA 3RLNA 1HR0W 4JI5Q 4A3JG 3KDFA 4POFA 1A8VA 4DR1L 2R7DA 1NTGA 1P8LA 1SROA 3E9HA 1VQMA 1EIFA 2YTXA 3I4MH 4QY7A 2CQOA 1PH2A 1E1OA 2FXQA 5IWAL 5FLMG 4B3ML 4KLKA 3CCMA 4DV6L 3HOUG 2PNHA 4A3MH 2ZM6L 4BY7G 4A3GH 1LUZA 2R7FA 3RNUA 1NE3A 3CCVA 3M4OH 3RR5A 5AJ3L 3FKIH 3KJPA 3HFZB 5HY6A 1OXVA 4R1JA 4HIOA 4HJ7A 1JE5A 2YTYA 4TQUS 1E1TA 4IOCA 1S72A 5M5YH 3RN5A 3UE1A 1N36L 1B8AA 4B3TQ 1PH1A 2OTJA 1VQ7A 2R93G 4TVAB 4NXNQ 4A3JH 2Q2TA 4XTCS 1G291 1NBWA 1PYSB 4WJ3M 3GTMH 4PG3A 3I4NG 1V9PA 2ASBA 4GOPA 1NMFA 4BBSG 2UXCL 4JCVE 5C44H 2QEXA 1EIYB 2RHSB 5FLMH 2IT1A 3HOUH 5C0XI 4GOPB 4BY7H 4LUOA 2F3IA 2YYZA 3S1QH 1FJGQ 1XPOA 4YCVA 2UXBL 4A3EG 4GLXA 2N3SA 1MJEA 1JMCA 3CCLA 5IWAQ 4B3MQ 4DV6Q 3S2HH 1YJNA 2CCZA 3S14H 2ZM6Q 4O2DA 5JJIA 4HIMA 1JJ2A 5AJ3Q 1X54A 3HOWG 1PH6A 2CFMA 2JA9A 2UUAL 2UU9L 4A75A 4OX9L 5M3FH 2ZTEA 2R93H 2QA4A 1DGSA 1H95A 3JAMi 4C3JH 4A3FG 4DR5L 1R9TH 1N33L 2NVXH 3I4NH 1D7QA 4BBSH 2IY5B 2JQOA 3S1MH 5IE8A 1GVPA 3J7A5 4APVA 2RF4A 1J5EQ 4GN4B 4X64Q 4DK3C 1HZBA 3CAMA 1VQ5A 2KHJA 1U5KA 1VQJA 2F4VL 1A62A 2UXCQ 3A74A 4R4IA 1PH7A 4BA2I 2I0QA 3M4QA 3KLWA 4DR7Q 3Q8DA 1HNWQ 2B29A 4L5RC 4AYBE 4LF8L 4AYBG 4O0AA 4GKJQ 4PZ8A 1YHAA 3HOWH 2BA1A 3F1ZA 3DM3A 3LGJA 2ZJQA 2Z6KC 1YHQA 2UXBQ 1GKHA 1Q7YC 3EIVA 4HJ8A 4IFDG 4A3FH 4WJ4A 1CKNB 3CCEA 4DV1Q 2ATWA 4MTNA 1G51A 2KENA 2IHEA 3K7UC 4HJ9A 4BXXH 4OO1I 1CKOA 2PQAA 3K8AA 2XGTA 2UU9Q 4YWKA 4L5TA 1IZ6A 2A1AA 1WOCA 1QUQA 4GS3A 4DR5Q 1I6HH 4JC0A 1KIXA 1X3FA 3HOVG 4BA1I 3KJOA 4LF5L 4JYAQ 1HH2P 2LSSA 2E5LL 4DAMA 4LF7L 4DR6Q 4DR2L 1QUQB 1OXTA 4P71A 1I3QH 3HOXG 3S15H 1VQCA 3J7ZC 1EOVA 1UE6A 3SGIA 5IP9G 4IFDJ 1I50H 2PMZE 4YY3Q 2MFIA 2WB1E 4R4OA 1IBMQ 2WB1G 1SLJA 1Y1VH 1Z47A 1V43A 2N49A 2F4VQ 4A3CG 1Q12A 5EAYA 2WAQG 4P75A 2K50A 1VQ8A 1CSQA 2MNAA 4NB3A 1FL0A 5C4XG 4QJFA 2B63G 1QVCA 1VQBA 1X56A 3ULPA 2VZAA 1XMOL 2WP8J 2NVTH 1LYLA 2BH8A 1CKMA 3G4SA 2ID0A 3PO3G 1VQ9A 2C35B 4DUZQ 5C0XJ 3I55A 1X9NA 3K0XA 4JBMA 3S24A 5FJ8G 4BXXG 4C3HH 1JT8A 1T9HA 2K52A 1A0IA 5M5XH 3HOXH 1BVSA 1KL9A 5IP9H 1VQOA 3RLFA 4QGUA 2K5HA 1Q1BA 3M4PA 5C0XG 2E5LQ 4A3CH 3CCQA 4QL5A 5C4JH 2AWOA 4OONA 4DR2Q 1ASZA 4GOPC 1LTLA 1UEBA 1XMQL 3GTLH 4NXML 1XNQL 3GD7A 3RZOH 4Y52H 3KDFB 5C4XH 2ZJRA 1HZ9A 1IL2A 1CUKA 4OWWB 3CMAA 4NPSA 1YEZA 4DNIA 2L15A 2F52A 4JBJA 2UXDL 1Q81C 1N34Q 3A0JA 3CP0A 3PO3H 1VQHA 3H0GG 1PYBA 4UP9A 2Q2HA 2AWNA 2KCMA 4GLVB 1HNZL 3OTOL 1GM5A 1HZAA 4JI3L 1XMOQ 2D0PA 4LWCA 2K75A 4XIGS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE6 I;  3AFQ A;  2E2J H;  4JOI A;  4JI0 L;  2VQE L;  1EWI A;  2AHO B;  2UUB L;  5DLQ E;  3W5O A;  4AQY L;  4C2M H;  3J81 c;  1VQD A;  3H3V I;  4UP8 A;  3NEN A;  4GLA C;  1VQE A;  1VQP A;  3ULL A;  5M5W H;  3CCJ A;  5BR8 L;  1E7Z A;  3K80 C;  4RG1 A;  2VUM G;  2K4K A;  1K0R A;  4KI0 A;  3JAM c;  4YCW A;  3M85 A;  3PUX A;  5GAD C;  3HKS A;  4DR1 Q;  2YV5 A;  3PUY A;  4UP7 A;  3TEH B;  3ZJY C;  2R7Z G;  4EX5 A;  3K7A H;  1BBU A;  2GN5 A;  1XMQ Q;  4R4C A;  4NXM Q;  3H0G H;  1HR0 L;  1X3G A;  2R92 G;  1L2F A;  5IP7 G;  3AYH B;  2BH2 A;  1EQR A;  2CKZ B;  3J81 i;  3M7N A;  2I5L X;  3PO2 G;  3NEM A;  2UXD Q;  1TXY A;  2D62 A;  4DV4 L;  3S1R H;  1XPU A;  3TRZ A;  4OO1 G;  3EBE A;  3RLO A;  3CC4 A;  1KQS A;  5GQO A;  2JA8 G;  1MIU A;  4JI3 Q;  3ICE A;  2NVY H;  4X6A H;  1PA6 A;  1NMG A;  2RHQ B;  1N36 Q;  2NZO A;  4LFB L;  3U58 A;  5IT9 c;  3VDY A;  2OQ0 A;  1BKB A;  1TWA H;  1YHB A;  1SE8 A;  4X66 L;  1XNR L;  2VUM H;  2HHH L;  3GTK H;  4IPC A;  4PZ7 A;  2JA5 G;  2MO1 A;  5LMN W;  4J15 A;  3CF5 A;  2R7Z H;  2NVQ H;  2Y0S E;  2Y0S G;  2R6G A;  4A3E H;  1TWF H;  5BR8 Q;  4RMF A;  2R92 H;  5IYC G;  4YHH L;  4JV5 L;  2JA6 G;  4PZ6 A;  2DGY A;  2GVB A;  3TS0 A;  3PO2 H;  4AIM A;  3PUV A;  4KHP L;  1YBY A;  4GNX A;  3J81 j;  1HR0 Q;  2KCT A;  4X62 L;  2JA8 H;  2K5N A;  2YU9 H;  4A4I A;  1C0A A;  3A5U A;  2JEA I;  1M1K C;  4GNX B;  1J6Q A;  1YJ9 A;  1NJI C;  4LF6 L;  3WWV A;  1HJP A;  3KF8 B;  4JBW A;  4H02 A;  3PF4 A;  3CD6 A;  1YZ6 A;  1I94 L;  1EYG A;  4X65 L;  2UUA Q;  4DV0 L;  4OX9 Q;  2A8V A;  3CC2 A;  2UUC L;  4LFA L;  1SFO H;  4K0K L;  2JA5 H;  4GN5 A;  1KC8 C;  1RIP A;  4A3K G;  1X6O A;  4DPG A;  2K14 A;  2PQA B;  3CW2 C;  3KOJ A;  3S17 H;  1N33 Q;  1VQF A;  1PV4 A;  4LUZ A;  4LFB Q;  2D0O A;  2HQL A;  1AE3 A;  4A3D G;  1W3S A;  3PV0 A;  4IPD A;  2VW9 A;  1XNR Q;  5IYC H;  2HHH Q;  1PH4 A;  2B3G A;  3F2B A;  2JA6 H;  5H1S E;  2OWO A;  1IBL L;  2JK8 A;  3KFU A;  1OXU A;  3HOZ G;  1TWG H;  2WFW A;  4A3D H;  4DR3 L;  2K5V A;  4ME3 A;  4DV3 L;  2WAQ E;  4Y7N H;  1U0L A;  5LMN L;  1X65 A;  3BZC A;  2HIV A;  1E3P A;  3TQY A;  3GDE A;  4B3R L;  5IY0 A;  1EUJ A;  4LF8 Q;  4P74 A;  4YWL A;  3L2P A;  1JB7 A;  1KRS A;  4KHP Q;  1SN8 A;  1VQK A;  1VQ6 A;  4JI5 L;  3F2D A;  3I7F A;  4HJ5 A;  3TS2 A;  4JG2 A;  1ASY A;  3PIP A;  4X62 Q;  4OXP A;  4YCU A;  4A3K H;  3G6E A;  1UWV A;  4QIW E;  3HOV H;  1X3E A;  2YTV A;  4L5Q A;  3AFP A;  4MZ9 A;  1Z9F A;  1L1O A;  3BZK A;  3STB D;  1GD7 A;  5GAG C;  2I5M X;  4DV5 L;  1YVC A;  1FGU A;  1K83 H;  4JOI C;  4KHZ A;  3FHW A;  1KRT A;  4X65 Q;  3G71 A;  4DV0 Q;  3T1H L;  1I94 Q;  2UUC Q;  4JI4 L;  4K0K Q;  4EQ5 A;  2RCN A;  1QVF A;  4PMW A;  1VQG A;  2ZJP A;  4LF5 Q;  4OWT B;  1S3O A;  3HKZ G;  1VCI A;  2GVA A;  2MO0 A;  2QGQ A;  2VL6 A;  2Z0S A;  3W1B A;  1K9M C;  4LF7 Q;  1C7Y A;  1XTD A;  3UDI A;  1W2B A;  1QZH A;  1IBL Q;  4DV2 L;  2E2I H;  2CWA A;  3B6Y A;  3OW2 A;  1KD1 C;  4GKK L;  3CPW A;  3H15 A;  2EXD A;  1IXR A;  4NXN L;  4DK6 C;  3CC7 A;  1QVG A;  4B3R Q;  1AH9 A;  3BU2 A;  3CCS A;  1Q82 C;  1N32 L;  5C3E G;  1X55 A;  3EN2 A;  2HT1 A;  5FJ8 H;  4LFC L;  4ALP A;  2ES2 A;  4B3S L;  2B63 H;  3H3V H;  3MEF A;  3L0O A;  1FVI A;  1KHI A;  1PH5 A;  1E22 A;  3J80 i;  2Q2I A;  4YWM A;  5GAH C;  1CSP A;  3NEL A;  1PFS A;  2EQS A;  5E7N A;  1PH8 A;  1VQA A;  2I5H A;  2VY3 A;  4DUY L;  1FJG L;  1WI5 A;  3BJU A;  5C44 G;  1XJV A;  1UE7 A;  3PCO B;  1PHJ A;  3IRB A;  3M9B A;  4DV5 Q;  1YIJ A;  2LXJ A;  2XTI A;  1O7I A;  1Q86 C;  2ALY B;  1IYJ B;  1KAW A;  3T1H Q;  2JA7 G;  2KBN A;  1OXX K;  5ELO A;  3AEV A;  1RL2 A;  3UDG A;  4JI4 Q;  3GTP H;  3M3Y H;  3ERS X;  4A3B G;  5GRO A;  4JI1 L;  1E24 A;  1YNX A;  1WYD A;  4HJA A;  2VQF L;  1SRU A;  1K8G A;  4FDB A;  4HID A;  1XNQ Q;  1HZC A;  4L5S A;  4A93 G;  2NN6 I;  3U4Z A;  2PI2 E;  5ELN A;  1MKH A;  2E8G A;  2VS1 A;  3UE0 A;  5GAE C;  5C3E H;  1I5F A;  3I56 A;  4DV2 Q;  4BY1 G;  2IX1 A;  4LF9 L;  1J5E L;  4GKK Q;  5M3M G;  4X64 L;  3GO5 A;  4LUV A;  5M3F G;  2LXK A;  1M90 C;  4GNX C;  1YJW A;  3PIO A;  3CCU A;  4LF4 L;  5IYD G;  3HOY G;  3G48 A;  1N8R C;  1HNZ Q;  3OTO Q;  1N32 Q;  1JJC B;  2N8N A;  2JJQ A;  4LFC Q;  4B3S Q;  1OXS C;  3I2Z A;  4DV7 L;  1Y1W G;  2JA7 H;  4DR7 L;  1HNW L;  3UDX A;  5IYB G;  4JI0 Q;  2VQE Q;  1WCM G;  5K36 G;  2DUD A;  4GKJ L;  2UUB Q;  3PUW A;  4DUY Q;  1Q46 A;  1VS0 A;  4A3B H;  2OCE A;  1SR3 A;  2AKW B;  4R4T A;  1VQI A;  4AQY Q;  4IPH A;  3PSI A;  4JBK A;  4DR4 L;  3AQQ A;  4GN3 B;  1SMX A;  1YI2 A;  4JI7 L;  4DV1 L;  4LNQ A;  3U50 C;  4C3I H;  4A93 H;  3CME A;  3OYY A;  4QQB X;  5IP7 H;  1N9W A;  4JI1 Q;  1KXL A;  5HGQ A;  4BY1 H;  3S2D H;  3E9I A;  1GO3 E;  5M3M H;  4A3L G;  2PI2 A;  3MXN B;  2OTL A;  4HIK A;  2VQF Q;  2NZH A;  3ULJ A;  2ZTC A;  4JYA L;  1QZG A;  3HOY H;  5IYD H;  3U4V A;  1TWH H;  3E0E A;  3K81 C;  4DR6 L;  1Q1E A;  4AH6 A;  1IBK L;  4LF9 Q;  1B7Y B;  1UE5 A;  1Y1W H;  1MJC A;  1B70 B;  3JC6 6;  4DV4 Q;  1P16 A;  5IYB H;  1Y14 B;  3ER0 A;  2OQK A;  4YY3 L;  1AE2 A;  1WCM H;  1IBM L;  4IO9 A;  3RZD H;  4LF4 Q;  3FP9 A;  3GTG H;  4POG A;  1TWC H;  5JEA G;  3NBH B;  4DKA C;  4R4Q A;  4BBR G;  4DV7 Q;  1VQ4 A;  1EQQ A;  3GTQ H;  4JI6 L;  1L1O C;  2MQH A;  3GTO H;  3A5Z B;  1WFQ A;  3T1Y L;  1Y1V G;  4X66 Q;  1K73 C;  5JJL A;  5LMU L;  1A63 A;  1CKN A;  1S40 A;  1UE1 A;  4DR4 Q;  3F2C A;  4A3L H;  2A19 A;  4JI8 L;  3UDF A;  3DLL A;  4DUZ L;  3RN2 A;  1NY4 A;  2V1C C;  3KF6 A;  4JI2 L;  4JI7 Q;  4A76 A;  4IJL A;  2KHI A;  3CXC A;  4IOA A;  1K3R A;  3S1N H;  5FLX c;  3CQZ H;  4YHH Q;  5JEA J;  3KF6 B;  4A3I G;  4JV5 Q;  2Q2U A;  4MNO A;  2EIF A;  1HNX L;  3D31 A;  3S16 H;  2VNU D;  2HIX A;  1LM0 A;  5J3B A;  3W1G A;  4LW1 A;  1PVO A;  2N78 A;  1IBK Q;  2IHF A;  4BBR H;  3TRE A;  3STB C;  2IX0 A;  4LF6 Q;  2E2H H;  2ZTD A;  4UPA A;  1Q8K A;  4IJH A;  4P72 A;  4LFA Q;  1YIT A;  3I4M G;  1L1O B;  1N34 L;  2Z6K A;  4DAY B;  3KYH C;  1C9O A;  4JI6 Q;  3HOZ H;  3HKZ E;  3CCR A;  1V1Q A;  1EFW A;  1L0W A;  3PF5 A;  3J80 c;  1VQN A;  3T1Y Q;  1K8A C;  2CWP A;  4IPG A;  1OTC A;  5LMU Q;  3PGZ A;  3I4O A;  4A3M G;  2NN6 G;  4A3I H;  2H5X A;  2AMC B;  4A3G G;  1WJJ A;  4JI8 Q;  3FKI G;  1VQL A;  4B3T L;  3D0F A;  4JI2 Q;  4IFD I;  4DR3 Q;  2JEB I;  3PUZ A;  3GTJ H;  4P73 A;  4DV3 Q;  1PH3 A;  4UY8 C;  3F8T A;  5LMN Q;  1G6P A;  1D8L A;  4OWX B;  1HNX Q;  1PH9 A;  5JJK A;  1JJG A;  3L7Z C;  1XPR A;  1BBW A;  2BA0 A;  3CPF A;  3RLN A;  1HR0 W;  4JI5 Q;  4A3J G;  3KDF A;  4POF A;  1A8V A;  4DR1 L;  2R7D A;  1NTG A;  1P8L A;  1SRO A;  3E9H A;  1VQM A;  1EIF A;  2YTX A;  3I4M H;  4QY7 A;  2CQO A;  1PH2 A;  1E1O A;  2FXQ A;  5IWA L;  5FLM G;  4B3M L;  4KLK A;  3CCM A;  4DV6 L;  3HOU G;  2PNH A;  4A3M H;  2ZM6 L;  4BY7 G;  4A3G H;  1LUZ A;  2R7F A;  3RNU A;  1NE3 A;  3CCV A;  3M4O H;  3RR5 A;  5AJ3 L;  3FKI H;  3KJP A;  3HFZ B;  5HY6 A;  1OXV A;  4R1J A;  4HIO A;  4HJ7 A;  1JE5 A;  2YTY A;  4TQU S;  1E1T A;  4IOC A;  1S72 A;  5M5Y H;  3RN5 A;  3UE1 A;  1N36 L;  1B8A A;  4B3T Q;  1PH1 A;  2OTJ A;  1VQ7 A;  2R93 G;  4TVA B;  4NXN Q;  4A3J H;  2Q2T A;  4XTC S;  1G29 1;  1NBW A;  1PYS B;  4WJ3 M;  3GTM H;  4PG3 A;  3I4N G;  1V9P A;  2ASB A;  4GOP A;  1NMF A;  4BBS G;  2UXC L;  4JCV E;  5C44 H;  2QEX A;  1EIY B;  2RHS B;  5FLM H;  2IT1 A;  3HOU H;  5C0X I;  4GOP B;  4BY7 H;  4LUO A;  2F3I A;  2YYZ A;  3S1Q H;  1FJG Q;  1XPO A;  4YCV A;  2UXB L;  4A3E G;  4GLX A;  2N3S A;  1MJE A;  1JMC A;  3CCL A;  5IWA Q;  4B3M Q;  4DV6 Q;  3S2H H;  1YJN A;  2CCZ A;  3S14 H;  2ZM6 Q;  4O2D A;  5JJI A;  4HIM A;  1JJ2 A;  5AJ3 Q;  1X54 A;  3HOW G;  1PH6 A;  2CFM A;  2JA9 A;  2UUA L;  2UU9 L;  4A75 A;  4OX9 L;  5M3F H;  2ZTE A;  2R93 H;  2QA4 A;  1DGS A;  1H95 A;  3JAM i;  4C3J H;  4A3F G;  4DR5 L;  1R9T H;  1N33 L;  2NVX H;  3I4N H;  1D7Q A;  4BBS H;  2IY5 B;  2JQO A;  3S1M H;  5IE8 A;  1GVP A;  3J7A 5;  4APV A;  2RF4 A;  1J5E Q;  4GN4 B;  4X64 Q;  4DK3 C;  1HZB A;  3CAM A;  1VQ5 A;  2KHJ A;  1U5K A;  1VQJ A;  2F4V L;  1A62 A;  2UXC Q;  3A74 A;  4R4I A;  1PH7 A;  4BA2 I;  2I0Q A;  3M4Q A;  3KLW A;  4DR7 Q;  3Q8D A;  1HNW Q;  2B29 A;  4L5R C;  4AYB E;  4LF8 L;  4AYB G;  4O0A A;  4GKJ Q;  4PZ8 A;  1YHA A;  3HOW H;  2BA1 A;  3F1Z A;  3DM3 A;  3LGJ A;  2ZJQ A;  2Z6K C;  1YHQ A;  2UXB Q;  1GKH A;  1Q7Y C;  3EIV A;  4HJ8 A;  4IFD G;  4A3F H;  4WJ4 A;  1CKN B;  3CCE A;  4DV1 Q;  2ATW A;  4MTN A;  1G51 A;  2KEN A;  2IHE A;  3K7U C;  4HJ9 A;  4BXX H;  4OO1 I;  1CKO A;  2PQA A;  3K8A A;  2XGT A;  2UU9 Q;  4YWK A;  4L5T A;  1IZ6 A;  2A1A A;  1WOC A;  1QUQ A;  4GS3 A;  4DR5 Q;  1I6H H;  4JC0 A;  1KIX A;  1X3F A;  3HOV G;  4BA1 I;  3KJO A;  4LF5 L;  4JYA Q;  1HH2 P;  2LSS A;  2E5L L;  4DAM A;  4LF7 L;  4DR6 Q;  4DR2 L;  1QUQ B;  1OXT A;  4P71 A;  1I3Q H;  3HOX G;  3S15 H;  1VQC A;  3J7Z C;  1EOV A;  1UE6 A;  3SGI A;  5IP9 G;  4IFD J;  1I50 H;  2PMZ E;  4YY3 Q;  2MFI A;  2WB1 E;  4R4O A;  1IBM Q;  2WB1 G;  1SLJ A;  1Y1V H;  1Z47 A;  1V43 A;  2N49 A;  2F4V Q;  4A3C G;  1Q12 A;  5EAY A;  2WAQ G;  4P75 A;  2K50 A;  1VQ8 A;  1CSQ A;  2MNA A;  4NB3 A;  1FL0 A;  5C4X G;  4QJF A;  2B63 G;  1QVC A;  1VQB A;  1X56 A;  3ULP A;  2VZA A;  1XMO L;  2WP8 J;  2NVT H;  1LYL A;  2BH8 A;  1CKM A;  3G4S A;  2ID0 A;  3PO3 G;  1VQ9 A;  2C35 B;  4DUZ Q;  5C0X J;  3I55 A;  1X9N A;  3K0X A;  4JBM A;  3S24 A;  5FJ8 G;  4BXX G;  4C3H H;  1JT8 A;  1T9H A;  2K52 A;  1A0I A;  5M5X H;  3HOX H;  1BVS A;  1KL9 A;  5IP9 H;  1VQO A;  3RLF A;  4QGU A;  2K5H A;  1Q1B A;  3M4P A;  5C0X G;  2E5L Q;  4A3C H;  3CCQ A;  4QL5 A;  5C4J H;  2AWO A;  4OON A;  4DR2 Q;  1ASZ A;  4GOP C;  1LTL A;  1UEB A;  1XMQ L;  3GTL H;  4NXM L;  1XNQ L;  3GD7 A;  3RZO H;  4Y52 H;  3KDF B;  5C4X H;  2ZJR A;  1HZ9 A;  1IL2 A;  1CUK A;  4OWW B;  3CMA A;  4NPS A;  1YEZ A;  4DNI A;  2L15 A;  2F52 A;  4JBJ A;  2UXD L;  1Q81 C;  1N34 Q;  3A0J A;  3CP0 A;  3PO3 H;  1VQH A;  3H0G G;  1PYB A;  4UP9 A;  2Q2H A;  2AWN A;  2KCM A;  4GLV B;  1HNZ L;  3OTO L;  1GM5 A;  1HZA A;  4JI3 L;  1XMO Q;  2D0P A;  4LWC A;  2K75 A;  4XIG S; 
#chains in the Genus database with same CATH topology
 3VYU A;  2PCF B;  3M4O B;  1EFI D;  4JI0 L;  2VQE L;  1EWI A;  1S5F D;  2AHO B;  5DLQ E;  3W5O A;  4C2M H;  2P5Z X;  1KAA A;  4UP8 A;  1V1P A;  5M5Y B;  1VQP A;  3ULL A;  1KDC A;  1ILP A;  4G7H C;  5BR8 L;  2VUM G;  1EY6 A;  1F2L A;  1K0R A;  3PUY A;  4UP7 A;  3S9W A;  3ZJY C;  4EX5 A;  3K7A H;  3SXH A;  4DNR B;  3HOU B;  2BH2 A;  4BY7 B;  1EQT A;  3S1Q B;  1LT6 D;  1XPU A;  3RLO A;  1EY8 A;  1WTR A;  4R8N A;  1Q8I A;  3R8B A;  2B2W C;  5E4W C;  4LFB L;  4CJ2 C;  1XNR L;  2HHH L;  3QWN A;  3NXW A;  2MO1 A;  5LMN W;  2BDO A;  2NVX B;  2R7Z H;  4BBS B;  1HTP A;  1B9M A;  1EYA A;  5BR8 Q;  2LKV A;  5IYC G;  4X3T A;  3OIP A;  5HUR A;  3TS0 A;  2GVB A;  3PO2 H;  3GV6 A;  3PUV A;  4NW2 A;  4OO1 H;  1YBY A;  2ZXR A;  2PO4 A;  5I6Y A;  1SBB B;  2KCT A;  2K5N A;  1C0A A;  1J6Q A;  1YJ9 A;  1Q90 A;  4JBW A;  3HOW B;  3PF4 A;  3CD6 A;  1B50 A;  1D5X C;  2UUA Q;  1K8O A;  2JA5 H;  3CW2 C;  2PNR C;  2AQ2 B;  2SNS A;  4LFB Q;  3P75 A;  1T5X D;  2VW9 A;  1XNR Q;  2HHH Q;  1PH4 A;  3F2B A;  2JA6 H;  3X3N A;  4LAA A;  3KFU A;  5COR A;  4XXE A;  3HOZ G;  3C2P A;  1CTM A;  2K5V A;  4DR3 L;  2WAQ E;  2CHB D;  1X65 A;  1E3P A;  1DON A;  4B3R L;  5IY0 A;  1TQO A;  4LF8 Q;  1PRT D;  1Y1V B;  2M00 A;  2B39 A;  1VQ6 A;  4HJ5 A;  3VR3 A;  3TS2 A;  1K0S A;  3PIP A;  1STG A;  2X6G A;  2YTV A;  5GAG C;  4MZ9 A;  3BZK A;  3STB D;  1YVC A;  4KHZ A;  3U9S A;  1NR4 A;  2SOB A;  2RCN A;  5CV6 A;  4C3H B;  2Z0S A;  2WKC A;  2VL6 A;  3U9O A;  5M5X B;  4G7Z C;  2NB0 A;  1GUN A;  3Q0A A;  2E2I H;  2CWA A;  3B6Y A;  1GJX A;  2ICI A;  4GKK L;  3CPW A;  5C4J B;  3H15 A;  1IXR A;  2RSO A;  1EWC A;  3CC7 A;  5C4X B;  1QVG A;  1B3Q A;  4B3R Q;  1AH9 A;  2F0S A;  3CCS A;  1Q82 C;  1N32 L;  1PFB A;  5D3D A;  4LFC L;  4ALP A;  3N6R A;  4KN7 C;  3NQI A;  3C3L A;  3MEF A;  2B63 H;  1G2S A;  1IW7 D;  2Q2I A;  3DWQ A;  3QG1 A;  4PMC A;  5E7N A;  1VQA A;  4DUY L;  1FJG L;  3K5L A;  3BJU A;  1PHJ A;  3PCO B;  4F7X A;  2LXJ A;  2IW3 A;  2E2J B;  1NUC A;  2KBN A;  1OXX K;  3M3Y H;  2Z4I A;  1BXT A;  1HQR D;  1WYD A;  4HJA A;  2XNA C;  4NDX A;  2JP1 A;  5D3I B;  4ZAI A;  1ONL A;  5GAE C;  1UEA B;  1S4Z A;  5CV9 A;  1JJG A;  1F2Z A;  1I5F A;  1CK1 A;  1LTR D;  3OOC A;  1J5E L;  4GKK Q;  4X64 L;  4H44 C;  4IZ8 A;  4GNX C;  3PIO A;  3HOY G;  4ID6 A;  1HNZ Q;  4G57 A;  1N32 Q;  2PZT A;  2JJQ A;  1BF4 A;  4LFC Q;  1M4V A;  1OXS C;  2SEB D;  1HNW L;  1ENC A;  1L0Y B;  1LTS D;  4GKJ L;  4DUY Q;  3BVZ A;  2E75 C;  4A3B H;  4R4T A;  4AQY Q;  4IPH A;  4C56 C;  3PSI A;  3AQQ A;  3J80 E;  1MSH A;  3I4N B;  1YI2 A;  4JI7 L;  4FXK C;  1VF5 C;  3MXN A;  3HRZ C;  2EPB A;  3GTK B;  5IIF A;  1PLF A;  1WD1 A;  2IX3 A;  2OTL A;  1NR2 A;  5KNC A;  4NMZ A;  2NZH A;  3L9A X;  2NTT A;  4A3E B;  1QZG A;  2R92 B;  1SYC A;  5A2Q E;  3KLR A;  1IBK L;  1W6J A;  1B2T A;  5IGD A;  1D1K A;  3JC6 6;  4K6D A;  3NBH A;  4DV4 Q;  1P16 A;  5IYB H;  2NWG A;  2OQK A;  3ER0 A;  1WCM H;  3RZD H;  3Q6S A;  2YU9 B;  2KEE A;  2ZXP A;  1VQ4 A;  2WAC A;  3VA5 A;  2JSO A;  3A5Z B;  1A63 A;  1K73 C;  3OMG A;  1SFO B;  2L11 A;  3F2C A;  4A3L H;  3UDF A;  4X3U A;  1NY4 A;  2V1C C;  4JI2 L;  2Y0S B;  4JI7 Q;  4A76 A;  1JOO A;  2L4N A;  2F0W A;  3CXC A;  2B2T A;  2HCI A;  5JEA J;  4A3I G;  4JV5 Q;  2O5J C;  1HNX L;  1TWG B;  4Y7N B;  5CR3 A;  4LW1 A;  5C6A A;  1STH A;  5JEA H;  1PZK D;  1KNE A;  3T51 B;  1IBK Q;  2CQA A;  2F0N A;  2IHF A;  1PFN A;  3TRE A;  2ZTD A;  2NVT B;  1NNX A;  4ZUI A;  5KNB A;  4IJH A;  1SND A;  4FXG C;  4A3K B;  4N9T A;  1N34 L;  1C9O A;  3HOZ H;  3HKZ E;  5CYU A;  1V1Q A;  2F0V A;  4A3D B;  1K83 B;  3E5S A;  3OSO A;  1OTC A;  2JN4 A;  5AFW A;  2NN6 G;  3LNN A;  4IN3 A;  4A3G G;  3SVM A;  3FKI G;  4ULL A;  5HGT A;  2MJ8 A;  2BE5 C;  4JI2 Q;  3ERQ A;  1HUM A;  3F8T A;  4KY7 A;  4ZCK A;  1G6P A;  2H4O A;  1HFN A;  4RHS A;  5E4X A;  1HNX Q;  5JJK A;  5I9P A;  3SK5 A;  4JI5 Q;  2TMP A;  4A3J G;  2N88 A;  2R7D A;  1DJR D;  4N8X 1;  3NPP A;  2NZ1 D;  2H1E A;  2FXQ A;  4B3M L;  4Z9C B;  2SDF A;  1NE3 A;  3CCV A;  2Z6B A;  2EY5 A;  1UUP A;  1AZP A;  3BVG A;  5DEH A;  4HIO A;  3BYT B;  1RTO A;  3R2I A;  4EGV A;  1SNM A;  2HCC A;  3UE1 A;  1N36 L;  1U9R A;  4JPB W;  2OTJ A;  2R93 G;  5ELC A;  4K2L A;  2Q2T A;  4CJ0 B;  3H6M A;  4WJ3 M;  5G3L D;  4PG3 A;  3BDO A;  2ASB A;  4GOP A;  1V1O A;  1SNP A;  2FMC A;  2G9D A;  5G3L F;  1LT5 D;  4EVO A;  4OL7 A;  1XPO A;  2N3S A;  2JA7 B;  3CCL A;  3Q24 A;  4B3M Q;  5ELD A;  3S2H H;  2CCZ A;  4KKS A;  3NTH A;  1X54 A;  3IFD A;  1PH6 A;  2CFM A;  1ESR A;  1G8Z D;  4A75 A;  2C5C A;  1DGS A;  1H95 A;  4A3F G;  4C3J H;  4DR5 L;  1H9S B;  4A93 B;  3SE0 A;  3I4N H;  1X3Q A;  2Z1C A;  2F3V A;  1SYB A;  2JXM B;  4APV A;  2A68 D;  4GN4 B;  1HZB A;  4KJN A;  2KHJ A;  2HD3 A;  2JA8 B;  1GUT A;  3A74 A;  3DM1 A;  3M4Q A;  4IUT A;  4MTK A;  4QF4 A;  3OWE B;  3Q8D A;  2KA7 A;  2NBF A;  4L5R C;  3GTG B;  4AYB G;  3OWF A;  1SE4 A;  3DM3 A;  2ZJQ A;  1YHQ A;  1GKH A;  4HJ8 A;  3GTO B;  4RGM A;  4MTN A;  2IHE A;  1BR9 A;  2B2W A;  2WII B;  3DWP A;  1CKO A;  1MD2 D;  3WDN A;  1J8I A;  3K8A A;  3NHH A;  3E0J A;  4YWK A;  2Z8L A;  4DR5 Q;  1ENA A;  3HOV G;  3KJO A;  4LF5 L;  3S1N B;  1SJH D;  3CQZ B;  4LF7 L;  1D6E C;  2F0I A;  5IP9 G;  1I50 H;  4YY3 Q;  3H3V C;  2K6A A;  2WB1 G;  4A3C G;  1A2U A;  1V43 A;  1Q12 A;  2WAQ G;  4P75 A;  2A69 D;  4BBR B;  3JAM L;  1VQ8 A;  2I07 B;  2E2H B;  1PXU A;  1CI3 M;  2HDM A;  3V2T A;  1VQB A;  3ULP A;  2VB2 X;  2NVT H;  1BOS A;  2BH8 A;  4MIU A;  3WOE A;  4RAU C;  3PO3 G;  1VQ9 A;  3GP7 A;  1PTO C;  4BXX G;  1JT8 A;  3D6C A;  3S24 A;  5FJ8 G;  5FOB B;  5LL6 X;  1I4Q A;  3NTK A;  4KK7 A;  3HOX H;  1KL9 A;  5IGE A;  4ABN A;  1GHJ A;  4K2K A;  3CCQ A;  2EXZ A;  2F0E A;  1UEB A;  1XMQ L;  2K5W A;  2K5Q A;  1XNQ L;  3GD7 A;  3KDF B;  3MC0 B;  5EPK A;  1HZ9 A;  1CQF A;  1ZEQ X;  4NPS A;  1YNN C;  2K04 A;  1D5M C;  1Q81 C;  4RH6 A;  1PRT B;  4XQJ A;  3A0J A;  1EQV A;  2AWN A;  1GUG A;  1A3T A;  1C48 A;  1T5E A;  5J1Z A;  1GM5 A;  5EPJ A;  2KCN A;  3MFG A;  4J6H A;  3AFQ A;  1TU2 B;  4FXD A;  2K03 A;  4JVZ A;  5E3F A;  2UUB L;  5JPN C;  3J81 c;  3H3V I;  2K5D A;  3NEN A;  3MXP A;  4DAV A;  5M5W H;  1QWY A;  2FMM A;  4RG1 A;  2K4K A;  2VXW A;  4CGY B;  1O7Z A;  1TS2 A;  2NYZ D;  4DR1 Q;  2YV5 A;  3GTM B;  2R7Z G;  1BBU A;  5C4Z A;  1XMQ Q;  5C44 B;  3E6Z X;  1L2F A;  5IP7 G;  1STN A;  4IUU A;  4LK1 C;  4HSP A;  1XX8 A;  1SYD A;  3PO2 G;  3VYT A;  3TRZ A;  4OO1 G;  2LS0 1;  1QCB D;  2EJG C;  1CFM A;  2NVY H;  1HHV A;  5IT9 c;  3VDY A;  4DNT B;  1TWA H;  1YHB A;  3CRL C;  4FF1 A;  2J4X A;  2JA5 G;  3FPU B;  1K28 A;  3DHQ A;  2Y0S E;  4HCS A;  1MBY A;  2F0F A;  1ET9 A;  2KOL A;  4RMF A;  2JA6 G;  5CBA E;  2DY7 A;  3TP7 A;  1WTP A;  1JWM D;  4KHP L;  4O42 A;  2SNM A;  4GNX A;  1G6Z A;  2R61 A;  4L63 B;  4DAP A;  2JA8 H;  4RCN A;  1M1K C;  1HJP A;  3KF8 B;  4H02 A;  3A8I E;  4DV0 L;  4OX9 Q;  3CC2 A;  3J81 E;  3HS0 C;  1KC8 C;  1X6O A;  4DPG A;  2PQA B;  3V05 A;  3KOJ A;  3S17 H;  4CKC A;  1PV4 A;  3I73 A;  2D0O A;  2Q8I B;  1AP0 A;  4IPD A;  3PV0 A;  3O13 A;  1VDZ A;  2B3G A;  2MPM A;  5H1S E;  2JK8 A;  1SDF A;  1M8A A;  2WFW A;  4ME3 A;  4DV3 L;  2MUY A;  1I3Q B;  1U0L A;  5LMN L;  3TZD A;  3VR6 A;  5ELF A;  1EUJ A;  3IL8 A;  1ENF A;  3NTI A;  3L2P A;  1JB7 A;  1PZI D;  4KHP Q;  4CHT B;  3F2D A;  1E0B A;  2F0P A;  1E2Z A;  3I4L A;  4YCU A;  4QIW E;  3HOV H;  4L5Q A;  4I7Z C;  2B63 G;  4DV5 L;  1GD7 A;  4ME5 A;  3S16 H;  1FGU A;  1TVX A;  4NP5 A;  1KRT A;  4R8I A;  4DV0 Q;  5I6W A;  4NKL A;  4DA2 A;  4TKO B;  1VQG A;  5EBD A;  4FVM A;  1WTX A;  3HKZ G;  1TY2 A;  1VCI A;  1WTW A;  2QGQ A;  5CBE E;  1K9M C;  3SEB A;  3M4Y A;  3UDI A;  1W2B A;  2RQX A;  3OW2 A;  1IHZ A;  2ZT9 C;  1TR5 A;  2CW0 C;  1SE2 A;  3EN2 A;  4BXX H;  1YNJ C;  3VR4 A;  1TS3 A;  5FJ8 H;  3H3V H;  1KHI A;  1PH5 A;  1E22 A;  3DWA A;  3J80 i;  5GAH C;  1CSP A;  1KTK A;  3NEL A;  1PFS A;  3DUZ A;  1AFP A;  1SYE A;  3M9B A;  2L9H A;  4DV5 Q;  2XTI A;  2O2L D;  3AEV A;  2X69 A;  3D8G A;  3UDG A;  3GTP H;  1BDO A;  4A3B G;  5GRO A;  1PTO H;  1SYF A;  2F0K A;  2RA4 A;  1BCP B;  1RHP A;  3U4Z A;  2E8G A;  2RVL A;  3I56 A;  5C3E H;  4HAE A;  1IL8 A;  4HED A;  1SYG A;  2QW7 A;  1H9K A;  4ZYS A;  2K1B A;  5FLX L;  1PYW D;  3H0G B;  4RA8 A;  3OTO Q;  3D4W A;  5IOC A;  3I2Z A;  4DR7 L;  3S1R B;  1WTO A;  4OEM B;  5IYB G;  4JI0 Q;  2VQE Q;  4HCE A;  1WCM G;  1SAP A;  3PUW A;  1QNU A;  1SNC A;  1VS0 A;  3QB3 A;  1A6X A;  4HMJ A;  2MHV A;  4ILW A;  3TP5 A;  4JBK A;  4DR4 L;  4GN3 B;  1SMX A;  4DV1 L;  4K8J A;  5F2D A;  4C3I H;  2VUM B;  4F88 A;  4QQB X;  5IP7 H;  1N9W A;  1H9S A;  5HGQ A;  4BY1 H;  1JIC A;  3S2D H;  5M3M H;  4A3L G;  2NVQ B;  4KN4 C;  1QJO A;  3ULJ A;  1TWF B;  2ZTC A;  4HTH A;  1H9M A;  1WVL A;  1TWH H;  1Q1E A;  1VMP A;  1HRJ A;  1XTC D;  1UE5 A;  1Y1W H;  1MJC A;  1IBM L;  5K36 H;  3FP9 A;  5BN5 A;  5JEA G;  1EY0 A;  4DKA C;  4FP5 D;  1EQQ A;  1WD0 A;  2MQH A;  2QDL A;  4KKU A;  5JJL A;  1Y1V G;  2EDG A;  4JW0 A;  1S40 A;  3OPO A;  4DR4 Q;  2A19 A;  4JI8 L;  4DUZ L;  1II3 A;  3KF6 A;  3CHB D;  2BOS A;  1K3R A;  2RDH A;  4P2C B;  1AN8 A;  2PZW A;  3I91 A;  4MNO A;  2EIF A;  5BN3 A;  3D31 A;  5J3B A;  1O80 A;  3K59 A;  2BDN A;  1BUV T;  4OIJ A;  1ET6 A;  2N78 A;  2F0O A;  4UPA A;  1Q8K A;  1YIT A;  1SE3 A;  5KEE A;  1XWE A;  2XRS D;  1EFW A;  4K14 A;  3J80 c;  1HTL D;  4QUF A;  2EYH A;  4JI8 Q;  1VQL A;  2GA4 B;  4CJ1 B;  3D0F A;  3LWE A;  4DR3 Q;  4XDX A;  5JAV A;  2JEB I;  3T53 B;  3GTJ H;  2L55 A;  4UY8 C;  3VR2 A;  4HR7 B;  1D8L A;  1PTO F;  2XIW A;  2EY2 A;  3KDF A;  4POF A;  1P8L A;  4PMB A;  1EIF A;  3I4M H;  2A6H C;  1KDB A;  3P1H A;  4JK1 C;  1PH2 A;  5I2Y A;  3TBI B;  1LAC A;  5IWA L;  5DM6 3;  4EQP A;  5JPM C;  4RKL A;  4A3M H;  3M4O H;  5ISR A;  5AJ3 L;  1MI2 A;  1QIL A;  4C1N K;  4H7B A;  1OXV A;  2CH4 A;  3AB9 A;  4WJW A;  4XQQ A;  2N55 A;  3I70 A;  1UAP A;  4IOC A;  5M5Y H;  4DXG A;  2B2U C;  1EU3 A;  1PH1 A;  1VQ7 A;  1DZ1 A;  1CQV A;  4XTC S;  4C3J G;  1G29 1;  1NBW A;  1PYS B;  5IGF A;  3I4N G;  1V9P A;  2UXC L;  5TSS A;  1HCZ A;  3R93 A;  3ITP A;  4X3K A;  1KLG D;  3HOU H;  5C0X I;  4BY7 H;  3S1Q H;  1FJG Q;  4L6T B;  4IQZ A;  1STY A;  4M1U B;  2EE1 A;  4YCV A;  4A3E G;  1MJE A;  1JMC A;  5FO9 B;  5IWA Q;  2XRQ D;  1DCZ A;  3ND9 A;  4O2D A;  5AJ3 Q;  1E2W A;  2ZTE A;  2L0C A;  3ONA B;  1N33 L;  1A2T A;  2NVX H;  4BBS H;  1ICF B;  2ICE C;  5IE8 A;  1GVP A;  4XT3 B;  1J5E Q;  4X64 Q;  3HZX A;  5EKL A;  1VQ5 A;  5COY A;  4I7A A;  5J22 A;  2F4V L;  3HOY B;  1EIG A;  5I9O A;  2UXC Q;  2AUK A;  4BA2 I;  1STE A;  1Z7T A;  3MHB A;  1HNW Q;  2B29 A;  1SSO A;  4GKJ Q;  2HUG A;  1TWC B;  5FO7 B;  3NWS A;  3HOW H;  2BA1 A;  3F1Z A;  3GTQ B;  3EIV A;  5CV7 A;  1VF7 A;  1CKN B;  5EKK A;  3CCE A;  1SEB D;  3K7U C;  1NSN S;  4HJ9 A;  4KD4 A;  2PQA A;  2XSC A;  3J7A V;  2JYO A;  4PNY A;  1PMR A;  3HGB A;  4JC0 A;  4F87 A;  1HH2 P;  2LSS A;  4DAM A;  1QUQ B;  3HOX G;  1UE6 A;  1TT2 A;  2EYJ A;  3SGI A;  4R4O A;  1CZW A;  1Z47 A;  1Y1V H;  1Z6H A;  2F4V Q;  3NUC A;  3MZ5 A;  1X3P A;  4NB3 A;  2RSN A;  2VZA A;  5KYL A;  1XMO L;  1GXD C;  2WP8 J;  3G4S A;  5FO8 B;  2ID0 A;  2RCF A;  3BZD B;  2PZU A;  4TRD A;  3I55 A;  1ICW A;  1X9N A;  2A74 C;  4C3H H;  2K52 A;  3H09 A;  4UDU C;  4A3I B;  5M5X H;  4CDC C;  1SMY D;  1H9R A;  1VQO A;  3M4P A;  4MHE A;  5C4J H;  1ASZ A;  1A3V A;  4NXM L;  4Y52 H;  1HQM C;  3E3X A;  4L8J A;  5C4X H;  5M9O A;  3W3A A;  1CUK A;  4OWW B;  4DNI A;  2F52 A;  2UXD L;  1N34 Q;  3NE5 B;  1LTI D;  1PYB A;  4UP9 A;  2Q2H A;  2KCM A;  1F2M A;  1KDA A;  4XT1 B;  4ODG A;  1XMO Q;  2D0P A;  4LWC A;  5C0X J;  4A3G B;  1BNZ A;  2E2J H;  3FKI B;  3T16 A;  4F8M A;  3Q23 A;  1HA6 A;  1JOK A;  4GLA C;  1VQE A;  1V8Q A;  3MFY A;  4RGO S;  1ZYR C;  4IUN A;  3K80 C;  3FEW X;  3C46 A;  1U4P A;  2OT2 A;  4KI0 A;  4A3J B;  3M85 A;  5GAD C;  3HKS A;  3RD4 A;  4R4C A;  4NXM Q;  1HR0 L;  1EWH A;  3DEO A;  3G7L A;  3OIQ A;  2O5I C;  1X3G A;  2DJF C;  3KK7 A;  2EYO A;  3AYH B;  1IKM A;  1TS5 A;  1ESF A;  2CKZ B;  2XN9 C;  2I5L X;  3J81 i;  2F3W A;  3NEM A;  2UXD Q;  3EBE A;  1RCV D;  5ELB A;  5GQO A;  2JA8 G;  4WFN 3;  1MIU A;  1RF2 D;  4IUQ A;  3ICE A;  3S14 B;  1PA6 A;  1NMG A;  2RHQ B;  1N36 Q;  2NZO A;  5JJZ A;  3U58 A;  2E76 C;  1U4L A;  4X66 L;  2R93 B;  5M3F B;  3GTK H;  4PZ7 A;  3PQI A;  4J15 A;  1R9T B;  2MP1 A;  3R2T A;  4M8A A;  3S1M B;  2R6G A;  4CDF C;  4A3E H;  1R4P B;  2R92 H;  4YHH L;  1O7Y A;  4AIM A;  1EL0 A;  3TME A;  2DJG C;  1HR0 Q;  4DF7 A;  4FYD A;  2YU9 H;  3A5U A;  4LF6 L;  4OEL B;  3WWV A;  2DY8 A;  1EYG A;  3BG3 A;  2A8V A;  4LFA L;  1SFO H;  1JB3 A;  1RIP A;  2IL8 A;  2K05 A;  1AE3 A;  3V96 A;  5T1G A;  3D3R A;  3SK4 A;  5KGU A;  3MEH A;  1PDQ A;  1LT3 D;  2OWO A;  1I6H B;  2CH4 W;  3K57 A;  1TWG H;  2CVR A;  3CKI B;  4Y7N H;  5D65 A;  3S15 B;  3BZC A;  2HIV A;  3TQY A;  1PRT C;  1K3B C;  1WTV A;  4AYB B;  3EVQ A;  4YWL A;  2F0D A;  1SN8 A;  1VQK A;  4JG2 A;  4OXP A;  2XVS A;  3WOF A;  4A3K H;  3G6E A;  1UWV A;  1X3E A;  1UNS A;  2I0Q A;  1LT4 D;  2I5M X;  4TSS A;  3G71 A;  1K83 H;  2F0U A;  3KBX A;  4JOI C;  3FHW A;  3T1H L;  4A3D H;  3L3O C;  4PMW A;  1NAP A;  3IFT A;  1Y69 U;  4QB4 A;  4OWT B;  1S3O A;  4U67 3;  4LF5 Q;  2GVA A;  2MO0 A;  3W1B A;  4LF7 Q;  3QIA A;  3FMC A;  4QMG A;  1C7Y A;  1XTD A;  3EQL C;  1QZH A;  2PMZ B;  2WB1 B;  4DV2 L;  3GTL B;  2WAQ B;  4OHJ A;  4NXN L;  3RZO B;  3FPP A;  2RDG A;  2LY7 A;  2F0J A;  1A15 A;  5C3E G;  1X55 A;  1IW7 C;  4UAI A;  1FVI A;  3FDT A;  2F0G A;  3PO3 B;  1JWU D;  2EQS A;  4J1M A;  2VY3 A;  5C44 G;  1XJV A;  1UE7 A;  2DN8 A;  2ALY B;  3T1H Q;  4CKE A;  1A3U A;  5ELO A;  4DFA A;  4ZLT F;  1I4G A;  1E24 A;  4JI1 L;  1I4X A;  2EYM A;  4ZRZ A;  2EYL A;  1G2T A;  3Q22 A;  2VQF L;  1SRU A;  2PW7 A;  5FLX E;  5JOB A;  1XNQ Q;  2B8F A;  4L5S A;  4C3I G;  3MAQ A;  1QE6 A;  2ENB A;  2VS1 A;  4DV2 Q;  4BY1 G;  4LF9 L;  5M3M G;  4LUV A;  3K7A B;  4K8I A;  2LXK A;  5JVG 3;  1M90 C;  2WV6 D;  1YJW A;  3SR1 A;  4LF4 L;  1N8R C;  4PV1 C;  1Y1W G;  2JA7 H;  4RGN A;  4XYQ A;  1LTT D;  5K36 G;  2DUD A;  3VYS A;  2UUB Q;  4ZK9 B;  3I8Z A;  1Q46 A;  4K5X A;  1SR3 A;  2AKW B;  1VQI A;  2EJF C;  3TZU A;  4LNQ A;  3U50 C;  1DD2 A;  4A93 H;  2Z9H A;  5J39 A;  3OYY A;  4JI1 Q;  2B2U A;  1GO3 E;  2HQE A;  3MXN B;  1C8C A;  2R7Z B;  1Q3L A;  4HIK A;  2VQF Q;  1EYD A;  3OW7 A;  3URY A;  4JYA L;  5IYD H;  1EYC A;  3P20 A;  4DR6 L;  4AH6 A;  4LF9 Q;  4G4K A;  1B7Y B;  3PO2 B;  2AQ1 B;  1BBX C;  1Y14 B;  4R9W A;  3GTG H;  4IO9 A;  4HN7 A;  4LF4 Q;  4POG A;  5KND A;  3NBH B;  1L1O C;  3BS1 A;  3T56 B;  3GTO H;  4FO2 A;  5C4H A;  1CKN A;  3G6J B;  2JA5 B;  1F2Y A;  5DM7 3;  1IKL A;  1UE1 A;  4RCO A;  3DLL A;  2JEA I;  1HUN A;  1VMC A;  3RN2 A;  1S5E D;  1SJE D;  1STB A;  3QOJ A;  4IJL A;  5FK9 C;  2KHI A;  1ILQ A;  5EKI A;  4IOA A;  3S1N H;  3CQZ H;  2JA6 B;  1JQY D;  3T4A C;  4K5W A;  2VNU D;  2QIL A;  1W6K A;  2QF7 A;  3W1G A;  1JC7 A;  2IPK D;  1O7L A;  4BBR H;  3A56 A;  3P7J A;  3VA7 A;  2E2H H;  3DEP A;  3A8K E;  2L1B A;  2HDL A;  4P72 A;  3VYR A;  3I4M G;  1L1O B;  4DAY B;  1EY5 A;  4H0L C;  3TP6 A;  1WTQ A;  1L0W A;  3TP8 A;  3PF5 A;  2CWP A;  4A3M G;  1BCP C;  3MA2 B;  4DK1 A;  1WJJ A;  4B3T L;  4IFD I;  4DV3 Q;  2BE5 D;  4P73 A;  1PH3 A;  2Z4H A;  5LMN Q;  2E2I B;  3L7Z C;  1XPR A;  2XWJ B;  3J7Y W;  3CPF A;  2BA0 A;  3RLN A;  1VQM A;  1SRO A;  1XYI A;  1F77 A;  2YTX A;  1SNO A;  2F4I A;  2MGS A;  4QY7 A;  2CQO A;  1E1O A;  2B63 B;  1MSG A;  2LMC B;  3HOU G;  4DV6 L;  1O78 A;  2PNH A;  4BY7 G;  2R7F A;  3RNU A;  3RR5 A;  2KEC A;  2F1M A;  3KJP A;  3HKZ B;  2V4D A;  3SDZ A;  4ZKC B;  2FIN B;  5IGB A;  2YTY A;  3M3Y B;  1E1T A;  1S72 A;  3RN5 A;  2F0H A;  4B3T Q;  3KLS A;  4TVA B;  4V19 0;  1LTA D;  3GTM H;  4BBS G;  4CBV A;  2D9U A;  5C44 H;  1B53 A;  3TDQ A;  1ZYR D;  1FNV A;  2RHS B;  5FLM H;  3KBG A;  4GOP B;  1DOM A;  5C5L A;  2DNE A;  1J9O A;  1STA A;  4GLX A;  4DV6 Q;  3TN2 A;  2FJ2 A;  5KYI A;  4MN3 A;  4A3B B;  3HOW G;  2UUA L;  2UU9 L;  4HMI A;  3NP8 A;  2QA4 A;  3JAM i;  1RJT A;  1LLR D;  3AMU A;  2IY5 B;  2A68 C;  2EOT A;  3J7A 5;  2RF4 A;  2I46 A;  4DK3 C;  3CAM A;  1I4P A;  1U5K A;  1B1Z A;  3CU7 A;  4R4I A;  1PH7 A;  2K7V A;  3KLW A;  4DR7 Q;  4Q5V A;  3OMC A;  3BYY B;  3F2U A;  4AYB E;  1WCM B;  4LF8 L;  3RZD B;  5ELE A;  4DU9 A;  1YHA A;  3LGJ A;  2Z6K C;  1Q7Y C;  3BVM A;  4WJ4 A;  4DV1 Q;  2K28 A;  2ATW A;  1G51 A;  2KEN A;  1CT1 D;  4DK0 A;  5CC4 A;  4QUC A;  2UU9 Q;  2A1A A;  4ZKB B;  1KIX A;  4BA1 I;  2EY6 A;  3KLS X;  2E5L L;  4C3H G;  3SHL A;  2RKS A;  4P71 A;  1I3Q H;  1VQC A;  2AUJ D;  3J81 L;  1EOV A;  4IFD J;  1KNA A;  2PMZ E;  1IBM Q;  2MFI A;  2WB1 E;  5KIX A;  4WOR A;  2A69 C;  5EAY A;  1GUO A;  1EOT A;  5A35 A;  4IFD H;  1FL0 A;  5C4X G;  1QVC A;  1X56 A;  1CM9 A;  1CKM A;  5EGT A;  1PZJ D;  2C35 B;  4DUZ Q;  3HOZ B;  2A6E C;  1PRT F;  2C9O A;  1HPC A;  1G91 A;  4JBM A;  1PTO D;  1F9Q A;  1Y8N B;  1T9H A;  2NUC A;  5CV8 A;  1MHW C;  3RLF A;  5CMD A;  4QGU A;  5C0X G;  2E5L Q;  5IT9 L;  3EA6 A;  2AWO A;  4OON A;  1SNQ A;  2ZJR A;  1DM0 B;  3D6W A;  3PIP 3;  1YEZ A;  1JR0 D;  1YNN D;  4JBJ A;  4DXF A;  1Y8P B;  4H13 C;  5I2X A;  1DXM A;  1HNZ L;  1HZA A;  4JI3 L;  4XIG S;  2JE6 I;  4JOI A;  4FF4 A;  2EVB A;  3IKJ A;  2Q8T A;  4LMQ D;  3K5O A;  4AQY L;  3D4D A;  1VQD A;  5D14 A;  2M2L A;  1QG7 A;  3GV3 A;  3CCJ A;  3W2D A;  4N8F A;  1E7Z A;  3JAM c;  4YCW A;  3PUX A;  4E6I A;  3TEH B;  2Q8R E;  5DNF A;  1EY4 A;  3K6O A;  2GN5 A;  3H91 A;  5I4D A;  3HG9 A;  3H0G H;  3J7A F;  2KED A;  4S3S A;  1B9N A;  2R92 G;  1EQR A;  3M7N A;  4RGT A;  1TXY A;  2D62 A;  4DV4 L;  3S1R H;  3CC4 A;  4FNF A;  1KQS A;  1DOK A;  4JI3 Q;  1EZ8 A;  3S2H B;  4X6A H;  3X3M A;  4KMU C;  4XYO A;  2OQ0 A;  1BKB A;  2VUM H;  1SE8 A;  5C3X A;  4IPC A;  4C3J B;  1QNK A;  2B2Y C;  3CF5 A;  2IWH A;  2NVQ H;  2Y0S G;  1TWF H;  4RWS C;  2E74 C;  4JV5 L;  2K01 A;  5C3W A;  4PZ6 A;  2DGY A;  2DNC A;  3PIO 3;  3LWU A;  3J81 j;  4KV6 A;  4X62 L;  3KF8 A;  4X3S A;  4A4I A;  1IYV A;  4GNX B;  1NJI C;  1F9R A;  3FVQ A;  3IAY A;  1YZ6 A;  1I94 L;  2J7Z A;  4X65 L;  4K0K L;  2UUC L;  2TSS A;  4GN5 A;  4A3K G;  2K14 A;  3UI2 A;  3H94 A;  2B2V C;  4IUR A;  1N33 Q;  1VQF A;  3N52 A;  4LUZ A;  2HQL A;  4A3D G;  1W3S A;  3DXJ C;  3JAM E;  5IYC H;  4GZY C;  2R3Z A;  3I90 A;  1IBL L;  3GQB A;  1OXU A;  1B3A A;  3SK6 A;  2D2C C;  1KLU D;  4KD3 A;  1I50 B;  3GDE A;  4P74 A;  1KRS A;  1FNW A;  4RKB A;  4JI5 L;  3I7F A;  1LV9 A;  2OEO A;  1ASY A;  1DYQ A;  2F0T A;  1S5D D;  2OF1 A;  4X62 Q;  1I4H A;  1EY7 A;  3BDL A;  4KHV A;  3AFP A;  1L1O A;  1Z9F A;  4DAY A;  1I94 Q;  4X65 Q;  4K0K Q;  1FD7 D;  3ZYY X;  1JWS D;  2UUC Q;  4EQ5 A;  4JI4 L;  1QVF A;  5EPL A;  2ZJP A;  4FF3 A;  1E2V A;  2A5H A;  2EJM A;  3HOX B;  1U4R A;  3A7A B;  1BCP D;  1IBL Q;  1X32 A;  2A73 B;  1AEX A;  1KD1 C;  2K33 A;  1B4O A;  2EXD A;  4DK6 C;  1BCP F;  3M7G A;  3EFX D;  2CW0 D;  3BU2 A;  3PMF A;  3NK9 A;  2HT1 A;  2ES2 A;  4B3S L;  3L0O A;  1EEI D;  1YNJ D;  1NCV A;  4K6L A;  4YWM A;  2WKD A;  1KAB A;  3MXG A;  1ZXT A;  1PH8 A;  1JE4 A;  2I5H A;  4QIW B;  1WI5 A;  1HA5 A;  2FFK B;  5C0X H;  3IRB A;  1H9J A;  1YIJ A;  2JA7 G;  1Q86 C;  1O7I A;  1IYJ B;  1KAW A;  1FGB D;  2G5D A;  3NBI A;  2WIN B;  4U68 A;  1RL2 A;  4JI4 Q;  3ERS X;  5LL6 S;  1V1P B;  1YNX A;  1C4Q A;  4N9P A;  2BCO A;  1GHK A;  1D5Z C;  5FKA C;  5M5W B;  1K8G A;  4FDB A;  4HID A;  5EQ0 A;  1HZC A;  4A93 G;  2NN6 I;  3HEJ A;  2PI2 E;  5ELN A;  1MKH A;  3I72 A;  3UE0 A;  2IX1 A;  1I4R A;  1QOH A;  4G7O C;  3I3C A;  2B8G A;  3GO5 A;  5M3F G;  1QB5 D;  5L37 A;  3CCU A;  5IYD G;  2VB3 X;  3G48 A;  4Q0F A;  1JJC B;  2N8N A;  4B3S Q;  4DV7 L;  4LJZ C;  3UDX A;  1S5B D;  1ZKO A;  2XWB B;  1TY0 A;  3NSW A;  2OCE A;  1HFG A;  2NVY B;  3T13 A;  4J8Q A;  3MWY W;  2K32 A;  1TWA B;  3CME A;  1KXL A;  2RDF A;  3TSS A;  2OXP A;  3E9I A;  1IYU A;  3J80 L;  1DOL A;  2PI2 A;  3HOY H;  3K0Y A;  1CZG A;  3E0E A;  3A55 A;  3K81 C;  2F0Q A;  2QKI C;  3U4V A;  4UHV A;  4OIK A;  4B08 A;  3A54 A;  5T1I A;  1B70 B;  5E1F A;  5NUC A;  4YY3 L;  2F0M A;  1AE2 A;  3BDC A;  4CDE C;  1TKW B;  2KQ3 A;  3MTS A;  2EZV A;  1TWC H;  5A2Q L;  4A3F B;  4R4Q A;  4BBR G;  4DV7 Q;  5CGK A;  3GTQ H;  4JI6 L;  1ML0 D;  4YIJ A;  3SK8 A;  1WFQ A;  3T1Y L;  4X66 Q;  5LMU L;  3R3O A;  1F9S A;  1TS4 A;  3A7L A;  3S17 B;  5KRU A;  3KUP A;  3A8J E;  2IJ0 A;  1K8M A;  3RUZ A;  1RTN A;  5FLX c;  4YHH Q;  3KF6 B;  2Q2U A;  1L0X B;  2HIX A;  1LM0 A;  1SXT A;  5IOD A;  4ZUJ A;  1PVO A;  2F0L A;  1LTB D;  5CV4 A;  1JCK B;  3STB C;  2IX0 A;  4LF6 Q;  5C5M A;  1EZ6 A;  1U4M A;  2EYF A;  3MVV A;  4ZQ3 A;  3DMU A;  5EJW A;  3K5M A;  4LFA Q;  2NTS A;  3HOV B;  2Z6K A;  3KYH C;  4QCL A;  4JI6 Q;  3CCR A;  2RBM A;  3QJY A;  3S16 B;  1LTG D;  1VQN A;  3T1Y Q;  1K8A C;  4IPG A;  5LMU Q;  3PGZ A;  3I4O A;  4A3I H;  2H5X A;  1TII D;  2AMC B;  2KJX A;  2QCP X;  2L5T A;  3QR8 A;  2A6E D;  3PUZ A;  4KY6 A;  1B44 D;  1FYC A;  4V0B A;  2KCC A;  4KY5 A;  2D5D A;  4OWX B;  1PH9 A;  1LO5 D;  4CKB A;  1BBW A;  1HR0 W;  5K5P A;  1A8V A;  4DR1 L;  1NTG A;  3E9H A;  5CV5 A;  2A6H D;  1HXY D;  1GUW A;  2EY1 A;  5FLM G;  4KLK A;  3CCM A;  2M9V A;  2NN6 H;  2ZM6 L;  4A3G H;  1LUZ A;  3FKI H;  4C2M B;  3HFZ B;  1ROD A;  4XQN A;  5HY6 A;  3EJI A;  4R1J A;  4HJ7 A;  4IUP A;  5IGG A;  1JE5 A;  3GTP B;  4TQU S;  1LAB A;  1F9P A;  2PYK A;  4C1N I;  1B8A A;  1PTO B;  4NXN Q;  4A3J H;  1BQQ T;  1GUS A;  4BS9 A;  1EIH A;  4DGZ A;  5C3E B;  1NMF A;  2O4X A;  4JCV E;  2QEX A;  2KUM A;  1EIY B;  4RFB A;  2IT1 A;  4LUO A;  2F3I A;  2YYZ A;  2UXB L;  3ND8 A;  4KTA A;  2AQ3 B;  5EBC A;  2PPB C;  3D4R A;  1YJN A;  3S14 H;  1EY9 A;  2ZM6 Q;  2QEJ C;  5JJI A;  4HIM A;  4DN4 M;  1JJ2 A;  3HP3 A;  4HSV A;  2JA9 A;  4OX9 L;  2R93 H;  2G9H D;  5M3F H;  1R9T H;  4C3I B;  1RKN A;  1D7Q A;  1PFM A;  2B2T C;  2JQO A;  1BO0 A;  4BY1 B;  3S1M H;  3S2D B;  5M3M B;  1EEF D;  3LX0 A;  4O1N A;  3C1F A;  2EYP A;  4CDD C;  2F03 A;  1AZQ A;  1VQJ A;  2PW5 A;  1TWH B;  2QDB A;  1A62 A;  1Y1W B;  3FRP B;  4IUV A;  4KKT A;  4KJO A;  4O0A A;  4OGQ C;  4PZ8 A;  2E2D C;  3RMH A;  4PQX A;  2UXB Q;  2ZXO A;  1MGS A;  4EQO A;  4IFD G;  4A3F H;  1I6V C;  1RD9 D;  4B9X A;  4OO1 I;  5LHY 1;  3VR5 A;  2XGT A;  4L5T A;  1IZ6 A;  1WOC A;  1QUQ A;  4GS3 A;  1I6H H;  1Y8O B;  1R4Q B;  1X3F A;  2X6L A;  2B2Y A;  4JYA Q;  1RDP D;  3C1E A;  2FHT A;  4DR6 Q;  4IAL A;  4DR2 L;  1OXT A;  3AU7 A;  1XXG A;  3S15 H;  3J7Z C;  1CA5 A;  1SLJ A;  2N49 A;  5BN4 A;  2LFN A;  5IGC A;  1JOQ A;  2KHS A;  2K50 A;  1CSQ A;  2MNA A;  4FF2 A;  3MXU A;  4QJF A;  4B9W A;  2PQE A;  1LYL A;  1CHQ D;  4RHR A;  3CRK C;  3K58 A;  1GOZ A;  3QO2 A;  3K0X A;  2KVM A;  2B2V A;  5IT9 E;  1A0I A;  1SMY C;  4K5V A;  3NWT A;  4WRD A;  1BVS A;  1CHP D;  5IP9 H;  4I65 A;  1OO9 B;  5JVH 3;  1JOR A;  1FR3 A;  3GTJ B;  4A3C H;  2K5H A;  1Q1B A;  1CA6 A;  4BWG B;  1D2B A;  3NQT A;  4QL5 A;  1WTH A;  4EQN A;  3GTL H;  4DR2 Q;  4GOP C;  1LTL A;  3RZO H;  2J0T D;  3K5N A;  1FNU A;  1IL2 A;  3QOL A;  3CMA A;  2L15 A;  1AW7 A;  3I4M B;  5DAU A;  1EU4 A;  2L12 A;  3PO3 H;  3CP0 A;  1VQH A;  3H0G G;  1D1I A;  1S5C D;  3ERO A;  4GLV B;  3OHX C;  3OTO L;  2K75 A;  4A3M B; 
#chains in the Genus database with same CATH homology
 2JE6 I;  3AFQ A;  2E2J H;  4JOI A;  4JI0 L;  2VQE L;  1EWI A;  2AHO B;  2UUB L;  5DLQ E;  3W5O A;  4AQY L;  4C2M H;  3J81 c;  1VQD A;  3H3V I;  4UP8 A;  3NEN A;  4GLA C;  1VQE A;  1VQP A;  3ULL A;  5M5W H;  3CCJ A;  5BR8 L;  1E7Z A;  3K80 C;  4RG1 A;  2VUM G;  2K4K A;  1K0R A;  4KI0 A;  3JAM c;  4YCW A;  3M85 A;  3PUX A;  5GAD C;  3HKS A;  4DR1 Q;  2YV5 A;  3PUY A;  4UP7 A;  3TEH B;  3ZJY C;  2R7Z G;  4EX5 A;  3K7A H;  1BBU A;  2GN5 A;  1XMQ Q;  4R4C A;  4NXM Q;  3H0G H;  1HR0 L;  1X3G A;  2R92 G;  1L2F A;  5IP7 G;  3AYH B;  2BH2 A;  1EQR A;  2CKZ B;  3J81 i;  3M7N A;  2I5L X;  3PO2 G;  3NEM A;  2UXD Q;  1TXY A;  2D62 A;  4DV4 L;  3S1R H;  1XPU A;  3TRZ A;  4OO1 G;  3EBE A;  3RLO A;  3CC4 A;  1KQS A;  5GQO A;  2JA8 G;  1MIU A;  4JI3 Q;  3ICE A;  2NVY H;  4X6A H;  1PA6 A;  1NMG A;  2RHQ B;  1N36 Q;  2NZO A;  4LFB L;  3U58 A;  5IT9 c;  3VDY A;  2OQ0 A;  1BKB A;  1TWA H;  1YHB A;  1SE8 A;  4X66 L;  1XNR L;  2VUM H;  2HHH L;  3GTK H;  4IPC A;  4PZ7 A;  2JA5 G;  2MO1 A;  5LMN W;  4J15 A;  3CF5 A;  2R7Z H;  2NVQ H;  2Y0S E;  2Y0S G;  2R6G A;  4A3E H;  1TWF H;  5BR8 Q;  4RMF A;  2R92 H;  5IYC G;  4YHH L;  4JV5 L;  2JA6 G;  4PZ6 A;  2DGY A;  2GVB A;  3TS0 A;  3PO2 H;  4AIM A;  3PUV A;  4KHP L;  1YBY A;  4GNX A;  3J81 j;  1HR0 Q;  2KCT A;  4X62 L;  2JA8 H;  2K5N A;  2YU9 H;  4A4I A;  1C0A A;  3A5U A;  2JEA I;  1M1K C;  4GNX B;  1J6Q A;  1YJ9 A;  1NJI C;  4LF6 L;  3WWV A;  1HJP A;  3KF8 B;  4JBW A;  4H02 A;  3PF4 A;  3CD6 A;  1YZ6 A;  1I94 L;  1EYG A;  4X65 L;  2UUA Q;  4DV0 L;  4OX9 Q;  2A8V A;  3CC2 A;  2UUC L;  4LFA L;  1SFO H;  4K0K L;  2JA5 H;  4GN5 A;  1KC8 C;  1RIP A;  4A3K G;  1X6O A;  4DPG A;  2K14 A;  2PQA B;  3CW2 C;  3KOJ A;  3S17 H;  1N33 Q;  1VQF A;  1PV4 A;  4LUZ A;  4LFB Q;  2D0O A;  2HQL A;  1AE3 A;  4A3D G;  1W3S A;  3PV0 A;  4IPD A;  2VW9 A;  1XNR Q;  5IYC H;  2HHH Q;  1PH4 A;  2B3G A;  3F2B A;  2JA6 H;  5H1S E;  2OWO A;  1IBL L;  2JK8 A;  3KFU A;  1OXU A;  3HOZ G;  1TWG H;  2WFW A;  4A3D H;  4DR3 L;  2K5V A;  4ME3 A;  4DV3 L;  2WAQ E;  4Y7N H;  1U0L A;  5LMN L;  1X65 A;  3BZC A;  2HIV A;  1E3P A;  3TQY A;  3GDE A;  4B3R L;  5IY0 A;  1EUJ A;  4LF8 Q;  4P74 A;  4YWL A;  3L2P A;  1JB7 A;  1KRS A;  4KHP Q;  1SN8 A;  1VQK A;  1VQ6 A;  4JI5 L;  3F2D A;  3I7F A;  4HJ5 A;  3TS2 A;  4JG2 A;  1ASY A;  3PIP A;  4X62 Q;  4OXP A;  4YCU A;  4A3K H;  3G6E A;  1UWV A;  4QIW E;  3HOV H;  1X3E A;  2YTV A;  4L5Q A;  3AFP A;  4MZ9 A;  1Z9F A;  1L1O A;  3BZK A;  3STB D;  1GD7 A;  5GAG C;  2I5M X;  4DV5 L;  1YVC A;  1FGU A;  1K83 H;  4JOI C;  4KHZ A;  3FHW A;  1KRT A;  4X65 Q;  3G71 A;  4DV0 Q;  3T1H L;  1I94 Q;  2UUC Q;  4JI4 L;  4K0K Q;  4EQ5 A;  2RCN A;  1QVF A;  4PMW A;  1VQG A;  2ZJP A;  4LF5 Q;  4OWT B;  1S3O A;  3HKZ G;  1VCI A;  2GVA A;  2MO0 A;  2QGQ A;  2VL6 A;  2Z0S A;  3W1B A;  1K9M C;  4LF7 Q;  1C7Y A;  1XTD A;  3UDI A;  1W2B A;  1QZH A;  1IBL Q;  4DV2 L;  2E2I H;  2CWA A;  3B6Y A;  3OW2 A;  1KD1 C;  4GKK L;  3CPW A;  3H15 A;  2EXD A;  1IXR A;  4NXN L;  4DK6 C;  3CC7 A;  1QVG A;  4B3R Q;  1AH9 A;  3BU2 A;  3CCS A;  1Q82 C;  1N32 L;  5C3E G;  1X55 A;  3EN2 A;  2HT1 A;  5FJ8 H;  4LFC L;  4ALP A;  2ES2 A;  4B3S L;  2B63 H;  3H3V H;  3MEF A;  3L0O A;  1FVI A;  1KHI A;  1PH5 A;  1E22 A;  3J80 i;  2Q2I A;  4YWM A;  5GAH C;  1CSP A;  3NEL A;  1PFS A;  2EQS A;  5E7N A;  1PH8 A;  1VQA A;  2I5H A;  2VY3 A;  4DUY L;  1FJG L;  1WI5 A;  3BJU A;  5C44 G;  1XJV A;  1UE7 A;  3PCO B;  1PHJ A;  3IRB A;  3M9B A;  4DV5 Q;  1YIJ A;  2LXJ A;  2XTI A;  1O7I A;  1Q86 C;  2ALY B;  1IYJ B;  1KAW A;  3T1H Q;  2JA7 G;  2KBN A;  1OXX K;  5ELO A;  3AEV A;  1RL2 A;  3UDG A;  4JI4 Q;  3GTP H;  3M3Y H;  3ERS X;  4A3B G;  5GRO A;  4JI1 L;  1E24 A;  1YNX A;  1WYD A;  4HJA A;  2VQF L;  1SRU A;  1K8G A;  4FDB A;  4HID A;  1XNQ Q;  1HZC A;  4L5S A;  4A93 G;  2NN6 I;  3U4Z A;  2PI2 E;  5ELN A;  1MKH A;  2E8G A;  2VS1 A;  3UE0 A;  5GAE C;  5C3E H;  1I5F A;  3I56 A;  4DV2 Q;  4BY1 G;  2IX1 A;  4LF9 L;  1J5E L;  4GKK Q;  5M3M G;  4X64 L;  3GO5 A;  4LUV A;  5M3F G;  2LXK A;  1M90 C;  4GNX C;  1YJW A;  3PIO A;  3CCU A;  4LF4 L;  5IYD G;  3HOY G;  3G48 A;  1N8R C;  1HNZ Q;  3OTO Q;  1N32 Q;  1JJC B;  2N8N A;  2JJQ A;  4LFC Q;  4B3S Q;  1OXS C;  3I2Z A;  4DV7 L;  1Y1W G;  2JA7 H;  4DR7 L;  1HNW L;  3UDX A;  5IYB G;  4JI0 Q;  2VQE Q;  1WCM G;  5K36 G;  2DUD A;  4GKJ L;  2UUB Q;  3PUW A;  4DUY Q;  1Q46 A;  1VS0 A;  4A3B H;  2OCE A;  1SR3 A;  2AKW B;  4R4T A;  1VQI A;  4AQY Q;  4IPH A;  3PSI A;  4JBK A;  4DR4 L;  3AQQ A;  4GN3 B;  1SMX A;  1YI2 A;  4JI7 L;  4DV1 L;  4LNQ A;  3U50 C;  4C3I H;  4A93 H;  3CME A;  3OYY A;  4QQB X;  5IP7 H;  1N9W A;  4JI1 Q;  1KXL A;  5HGQ A;  4BY1 H;  3S2D H;  3E9I A;  1GO3 E;  5M3M H;  4A3L G;  2PI2 A;  3MXN B;  2OTL A;  4HIK A;  2VQF Q;  2NZH A;  3ULJ A;  2ZTC A;  4JYA L;  1QZG A;  3HOY H;  5IYD H;  3U4V A;  1TWH H;  3E0E A;  3K81 C;  4DR6 L;  1Q1E A;  4AH6 A;  1IBK L;  4LF9 Q;  1B7Y B;  1UE5 A;  1Y1W H;  1MJC A;  1B70 B;  3JC6 6;  4DV4 Q;  1P16 A;  5IYB H;  1Y14 B;  3ER0 A;  2OQK A;  4YY3 L;  1AE2 A;  1WCM H;  1IBM L;  4IO9 A;  3RZD H;  4LF4 Q;  3FP9 A;  3GTG H;  4POG A;  1TWC H;  5JEA G;  3NBH B;  4DKA C;  4R4Q A;  4BBR G;  4DV7 Q;  1VQ4 A;  1EQQ A;  3GTQ H;  4JI6 L;  1L1O C;  2MQH A;  3GTO H;  3A5Z B;  1WFQ A;  3T1Y L;  1Y1V G;  4X66 Q;  1K73 C;  5JJL A;  5LMU L;  1A63 A;  1CKN A;  1S40 A;  1UE1 A;  4DR4 Q;  3F2C A;  4A3L H;  2A19 A;  4JI8 L;  3UDF A;  3DLL A;  4DUZ L;  3RN2 A;  1NY4 A;  2V1C C;  3KF6 A;  4JI2 L;  4JI7 Q;  4A76 A;  4IJL A;  2KHI A;  3CXC A;  4IOA A;  1K3R A;  3S1N H;  5FLX c;  3CQZ H;  4YHH Q;  5JEA J;  3KF6 B;  4A3I G;  4JV5 Q;  2Q2U A;  4MNO A;  2EIF A;  1HNX L;  3D31 A;  3S16 H;  2VNU D;  2HIX A;  1LM0 A;  5J3B A;  3W1G A;  4LW1 A;  1PVO A;  2N78 A;  1IBK Q;  2IHF A;  4BBR H;  3TRE A;  3STB C;  2IX0 A;  4LF6 Q;  2E2H H;  2ZTD A;  4UPA A;  1Q8K A;  4IJH A;  4P72 A;  4LFA Q;  1YIT A;  3I4M G;  1L1O B;  1N34 L;  2Z6K A;  4DAY B;  3KYH C;  1C9O A;  4JI6 Q;  3HOZ H;  3HKZ E;  3CCR A;  1V1Q A;  1EFW A;  1L0W A;  3PF5 A;  3J80 c;  1VQN A;  3T1Y Q;  1K8A C;  2CWP A;  4IPG A;  1OTC A;  5LMU Q;  3PGZ A;  3I4O A;  4A3M G;  2NN6 G;  4A3I H;  2H5X A;  2AMC B;  4A3G G;  1WJJ A;  4JI8 Q;  3FKI G;  1VQL A;  4B3T L;  3D0F A;  4JI2 Q;  4IFD I;  4DR3 Q;  2JEB I;  3PUZ A;  3GTJ H;  4P73 A;  4DV3 Q;  1PH3 A;  4UY8 C;  3F8T A;  5LMN Q;  1G6P A;  1D8L A;  4OWX B;  1HNX Q;  1PH9 A;  5JJK A;  1JJG A;  3L7Z C;  1XPR A;  1BBW A;  2BA0 A;  3CPF A;  3RLN A;  1HR0 W;  4JI5 Q;  4A3J G;  3KDF A;  4POF A;  1A8V A;  4DR1 L;  2R7D A;  1NTG A;  1P8L A;  1SRO A;  3E9H A;  1VQM A;  1EIF A;  2YTX A;  3I4M H;  4QY7 A;  2CQO A;  1PH2 A;  1E1O A;  2FXQ A;  5IWA L;  5FLM G;  4B3M L;  4KLK A;  3CCM A;  4DV6 L;  3HOU G;  2PNH A;  4A3M H;  2ZM6 L;  4BY7 G;  4A3G H;  1LUZ A;  2R7F A;  3RNU A;  1NE3 A;  3CCV A;  3M4O H;  3RR5 A;  5AJ3 L;  3FKI H;  3KJP A;  3HFZ B;  5HY6 A;  1OXV A;  4R1J A;  4HIO A;  4HJ7 A;  1JE5 A;  2YTY A;  4TQU S;  1E1T A;  4IOC A;  1S72 A;  5M5Y H;  3RN5 A;  3UE1 A;  1N36 L;  1B8A A;  4B3T Q;  1PH1 A;  2OTJ A;  1VQ7 A;  2R93 G;  4TVA B;  4NXN Q;  4A3J H;  2Q2T A;  4XTC S;  1G29 1;  1NBW A;  1PYS B;  4WJ3 M;  3GTM H;  4PG3 A;  3I4N G;  1V9P A;  2ASB A;  4GOP A;  1NMF A;  4BBS G;  2UXC L;  4JCV E;  5C44 H;  2QEX A;  1EIY B;  2RHS B;  5FLM H;  2IT1 A;  3HOU H;  5C0X I;  4GOP B;  4BY7 H;  4LUO A;  2F3I A;  2YYZ A;  3S1Q H;  1FJG Q;  1XPO A;  4YCV A;  2UXB L;  4A3E G;  4GLX A;  2N3S A;  1MJE A;  1JMC A;  3CCL A;  5IWA Q;  4B3M Q;  4DV6 Q;  3S2H H;  1YJN A;  2CCZ A;  3S14 H;  2ZM6 Q;  4O2D A;  5JJI A;  4HIM A;  1JJ2 A;  5AJ3 Q;  1X54 A;  3HOW G;  1PH6 A;  2CFM A;  2JA9 A;  2UUA L;  2UU9 L;  4A75 A;  4OX9 L;  5M3F H;  2ZTE A;  2R93 H;  2QA4 A;  1DGS A;  1H95 A;  3JAM i;  4C3J H;  4A3F G;  4DR5 L;  1R9T H;  1N33 L;  2NVX H;  3I4N H;  1D7Q A;  4BBS H;  2IY5 B;  2JQO A;  3S1M H;  5IE8 A;  1GVP A;  3J7A 5;  4APV A;  2RF4 A;  1J5E Q;  4GN4 B;  4X64 Q;  4DK3 C;  1HZB A;  3CAM A;  1VQ5 A;  2KHJ A;  1U5K A;  1VQJ A;  2F4V L;  1A62 A;  2UXC Q;  3A74 A;  4R4I A;  1PH7 A;  4BA2 I;  2I0Q A;  3M4Q A;  3KLW A;  4DR7 Q;  3Q8D A;  1HNW Q;  2B29 A;  4L5R C;  4AYB E;  4LF8 L;  4AYB G;  4O0A A;  4GKJ Q;  4PZ8 A;  1YHA A;  3HOW H;  2BA1 A;  3F1Z A;  3DM3 A;  3LGJ A;  2ZJQ A;  2Z6K C;  1YHQ A;  2UXB Q;  1GKH A;  1Q7Y C;  3EIV A;  4HJ8 A;  4IFD G;  4A3F H;  4WJ4 A;  1CKN B;  3CCE A;  4DV1 Q;  2ATW A;  4MTN A;  1G51 A;  2KEN A;  2IHE A;  3K7U C;  4HJ9 A;  4BXX H;  4OO1 I;  1CKO A;  2PQA A;  3K8A A;  2XGT A;  2UU9 Q;  4YWK A;  4L5T A;  1IZ6 A;  2A1A A;  1WOC A;  1QUQ A;  4GS3 A;  4DR5 Q;  1I6H H;  4JC0 A;  1KIX A;  1X3F A;  3HOV G;  4BA1 I;  3KJO A;  4LF5 L;  4JYA Q;  1HH2 P;  2LSS A;  2E5L L;  4DAM A;  4LF7 L;  4DR6 Q;  4DR2 L;  1QUQ B;  1OXT A;  4P71 A;  1I3Q H;  3HOX G;  3S15 H;  1VQC A;  3J7Z C;  1EOV A;  1UE6 A;  3SGI A;  5IP9 G;  4IFD J;  1I50 H;  2PMZ E;  4YY3 Q;  2MFI A;  2WB1 E;  4R4O A;  1IBM Q;  2WB1 G;  1SLJ A;  1Y1V H;  1Z47 A;  1V43 A;  2N49 A;  2F4V Q;  4A3C G;  1Q12 A;  5EAY A;  2WAQ G;  4P75 A;  2K50 A;  1VQ8 A;  1CSQ A;  2MNA A;  4NB3 A;  1FL0 A;  5C4X G;  4QJF A;  2B63 G;  1QVC A;  1VQB A;  1X56 A;  3ULP A;  2VZA A;  1XMO L;  2WP8 J;  2NVT H;  1LYL A;  2BH8 A;  1CKM A;  3G4S A;  2ID0 A;  3PO3 G;  1VQ9 A;  2C35 B;  4DUZ Q;  5C0X J;  3I55 A;  1X9N A;  3K0X A;  4JBM A;  3S24 A;  5FJ8 G;  4BXX G;  4C3H H;  1JT8 A;  1T9H A;  2K52 A;  1A0I A;  5M5X H;  3HOX H;  1BVS A;  1KL9 A;  5IP9 H;  1VQO A;  3RLF A;  4QGU A;  2K5H A;  1Q1B A;  3M4P A;  5C0X G;  2E5L Q;  4A3C H;  3CCQ A;  4QL5 A;  5C4J H;  2AWO A;  4OON A;  4DR2 Q;  1ASZ A;  4GOP C;  1LTL A;  1UEB A;  1XMQ L;  3GTL H;  4NXM L;  1XNQ L;  3GD7 A;  3RZO H;  4Y52 H;  3KDF B;  5C4X H;  2ZJR A;  1HZ9 A;  1IL2 A;  1CUK A;  4OWW B;  3CMA A;  4NPS A;  1YEZ A;  4DNI A;  2L15 A;  2F52 A;  4JBJ A;  2UXD L;  1Q81 C;  1N34 Q;  3A0J A;  3CP0 A;  3PO3 H;  1VQH A;  3H0G G;  1PYB A;  4UP9 A;  2Q2H A;  2AWN A;  2KCM A;  4GLV B;  1HNZ L;  3OTO L;  1GM5 A;  1HZA A;  4JI3 L;  1XMO Q;  2D0P A;  4LWC A;  2K75 A;  4XIG S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...