4LF9L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9L00
3E0EA 3J80c 1K83H 3G48A 3RN2A 1IBMQ 3M3YH 4PZ8A 5GADC 1Q8KA 3STBC 3I4NG 1VQEA 2MO0A 4P72A 5IT9c 3L2PA 3CP0A 2EXDA 3BZCA 4B3RL 4L5QA 4Y52H 3CCSA 4B3TL 4JI7L 4A3DH 1H95A 3AYHB 1VQCA 4IPCA 4DR6L 1Q1EA 2F4VL 2YTVA 1P8LA 1X3EA 3A0JA 4DR2L 4JI2L 2IHEA 3PO3G 4A3MH 1GO3E 4TQUS 3I2ZA 1KIXA 4NXML 1N33L 1RL2A 2CQOA 4DUZQ 5C0XI 3SGIA 3CCEA 4NB3A 1VQNA 3FP9A 3GDEA 4X64Q 4JI8L 1VQMA 2JA8H 1HNZL 1G291 5GQOA 4X65Q 4OONA 5IYCG 1V43A 4X65L 2I5MX 4C2MH 1XJVA 4A3GH 1O7IA 3LGJA 1CKMA 5M3MH 4IPHA 1KC8C 1YNXA 3JAMc 2ATWA 2LSSA 1IBML 1Z9FA 3T1HL 1W3SA 2EIFA 2KENA 3OW2A 2DGYA 3A5UA 1P16A 1I50H 1N9WA 3FKIH 3PV0A 1MJCA 2N8NA 5IYDG 4OXPA 3HOWH 3HOXG 2RHQB 4JOIA 4DR5L 2CCZA 3M7NA 3CC2A 4JV5Q 2CFMA 1IL2A 2KBNA 5IWAQ 2JEBI 1HNXL 3NBHB 4JBJA 2QGQA 4KHPQ 1PH7A 1K0RA 1G51A 1D8LA 1UWVA 3E9HA 3JAMi 4KHPL 4OO1G 4JI4L 3S2HH 3M85A 1EIFA 1YIJA 1EIYB 4NXMQ 5JJIA 4GNXA 4R4QA 1UE1A 4UY8C 4GLAC 4IFDG 4LFBQ 3CCQA 5M3FH 2UXDL 4X62Q 2KHJA 1NBWA 1VQOA 2HIVA 1A63A 4AIMA 3GTPH 4K0KL 2K4KA 3S1QH 3EN2A 1I3QH 4L5SA 1XNRL 4JI8Q 3J7A5 4IO9A 1HNWL 5FJ8H 4DUYL 4A3LH 1JJGA 1XMQQ 2JA9A 2R93H 4OX9L 4DV0L 4DV3L 5K36G 3OYYA 2VUMH 2XGTA 3F2DA 3KJPA 1R9TH 1PYBA 1YBYA 1K9MC 4JI6Q 3JC66 3S1RH 3TRZA 1I5FA 1D7QA 2HHHQ 3KF6A 2PQAA 5IWAL 4HJ8A 1VQAA 4DR6Q 5LMNL 3RR5A 5C4XH 3CMAA 4A3FG 4A3EG 4A3EH 4RG1A 3PF5A 4DR2Q 1AH9A 2K14A 1OXVA 2V1CC 3TREA 1EQRA 3M4QA 1N32Q 1OTCA 2UXCQ 1QVFA 2YYZA 4GOPB 1QZGA 1CSQA 3K8AA 1K8GA 2ES2A 2PMZE 1S40A 1FL0A 4YHHL 4DV6L 1Y1WH 3NENA 4DK6C 3RLFA 4DR1L 1VQLA 2UUBL 4IJLA 4H02A 4TVAB 5M5XH 1GVPA 3T1YQ 1U0LA 1YJWA 1CSPA 1HZBA 2JA6H 4A3CG 3RLNA 4DV2Q 1S72A 2NZHA 2ZTEA 1M90C 4LF6Q 1TWCH 3S15H 3S1NH 1C9OA 1N33Q 3CCUA 3CC4A 1XNQL 3KDFA 4P75A 2LXKA 3H3VH 4GOPC 2JEAI 2R92G 4A93G 3HKZG 5GROA 2A8VA 2AHOB 1BBWA 1E24A 1PH3A 2VL6A 1B8AA 4A3BG 4DR3Q 4LWCA 3S2DH 1XMOL 4DR5Q 4B3SL 2E5LQ 3RZOH 4R1JA 3AQQA 4AYBG 4L5TA 4POFA 1IBLL 1RIPA 3A74A 3UE0A 3CCMA 4LF9L 1JT8A 4ALPA 4BY7G 2QA4A 3GTMH 3H3VI 5GAEC 4JBMA 4LFAL 3H15A 2PI2A 3F2CA 1N32L 3RNUA 3PSIA 2K5VA 2VQEL 1UEBA 4DAYB 4DK3C 1E1TA 3EBEA 4DV1L 4IFDI 4C3HH 3CC7A 1LM0A 4Y7NH 1XPUA 2MFIA 1PFSA 4JI3Q 2Z6KC 3STBD 3J80i 4P71A 2JE6I 5FLMH 4XTCS 2R6GA 2PI2E 2R93G 2N49A 1EYGA 3GTGH 2JA7G 3S16H 3D0FA 4BBSH 1NJIC 1X3FA 1WFQA 1EUJA 1YI2A 5LMUQ 2N3SA 2NVTH 4JBWA 3CXCA 1T9HA 4UP8A 4BY7H 3KDFB 1VQBA 4DR4Q 2UXBQ 4K0KQ 1BVSA 4R4TA 2YTYA 4AQYL 4X66L 2Q2UA 5HGQA 2FXQA 1ASYA 4BY1G 3CW2C 3KLWA 4LF9Q 1I94Q 4JCVE 1I94L 2MQHA 2WAQE 1SR3A 4LFAQ 4APVA 5C3EG 5FLMG 4DNIA 5C3EH 3MXNB 1VQ8A 1WOCA 1PH1A 2UUAL 4JI4Q 1X6OA 2N78A 4IOAA 2R7DA 1Q46A 2D0OA 1X55A 5C0XG 1Q7YC 1L1OA 1CKOA 3MEFA 2GVAA 2UU9Q 2OQ0A 4BA2I 1TWHH 3D31A 3PUZA 4JV5L 4JYAL 1I6HH 3ULPA 1Y1WG 3NEMA 1WI5A 4WJ4A 4GLVB 3PCOB 4XIGS 4KHZA 5JJKA 1HH2P 3ER0A 3U4VA 4DV2L 1NMFA 3RZDH 3I4OA 4JI2Q 4DV7Q 1VQPA 4DUYQ 1K8AC 3L7ZC 2ALYB 1KAWA 1VQGA 3ZJYC 4EQ5A 2ZM6L 1YJ9A 2UXCL 3KJOA 3E9IA 4NXNL 4LW1A 1PH8A 4NXNQ 1A0IA 1VQFA 2R7FA 3H0GH 3J7ZC 1N8RC 3W1BA 4DV6Q 1VQHA 2B29A 2NVYH 5FLXc 3J81c 4DPGA 3I55A 1SROA 4BBSG 4BA1I 4X64L 1LYLA 4YCWA 2JA7H 3KOJA 3FKIG 5IYDH 3HKSA 2BA1A 1PYSB 2HIXA 1V9PA 2ID0A 1HR0L 4A3LG 2IY5B 1X54A 2E2HH 3I4MH 4IPDA 4HIKA 1AE3A 1NTGA 1K73C 5IYBH 4IFDJ 4JI1L 1FJGL 2BH8A 1PH5A 1TXYA 3CCJA 1SE8A 4GLXA 3PIPA 4LF8Q 1KHIA 4RMFA 5GAHC 1M1KC 1A8VA 4DR7Q 4BY1H 1SLJA 4JC0A 1PA6A 3G6EA 4X6AH 1E1OA 2EQSA 2NN6G 1Q81C 4A3GG 3AEVA 4JYAQ 3U4ZA 4DKAC 1OXTA 2E2JH 4A3BH 1UE6A 3HOYH 3I7FA 4JI0Q 3TEHB 4OWTB 4GN3B 1YVCA 3K7UC 3TQYA 4B3ML 4LUZA 3T1YL 5IE8A 2R92H 1QVCA 4A3FH 5C4XG 4DAMA 4A75A 4JI5L 1MJEA 1B7YB 3L0OA 1KD1C 1JJCB 5JEAG 3CMEA 2K52A 3PUWA 5H1SE 2JA6G 1ASZA 2LXJA 3GD7A 5J3BA 1L0WA 4HIDA 1JMCA 1V1QA 3GTJH 3TS0A 1XMOQ 1MIUA 4GN4B 1EQQA 1Q82C 2I0QA 5M3MG 4A3CH 2IX1A 1YITA 1Y14B 4QIWE 5HY6A 4A3KG 3W1GA 5IYCH 2NVXH 1SN8A 4O0AA 3CCVA 2BH2A 2ASBA 3S1MH 1VQ7A 4R4IA 4BXXH 2GN5A 4J15A 3BJUA 2PNHA 3BZKA 1NMGA 2VQFQ 4QGUA 3T1HQ 4PMWA 2F3IA 3EIVA 2ZJQA 4HJ7A 5C44G 2AWOA 2KCMA 3HOUH 3FHWA 3PIOA 3VDYA 4B3TQ 5IP7H 1VCIA 4JOIC 4LFCL 1QUQB 3PO3H 1JJ2A 2E2IH 3HKZE 5LMNW 4IOCA 4YWKA 1L1OC 2H5XA 2F4VQ 1QUQA 1XTDA 2OCEA 5AJ3L 3S17H 2NVQH 1DGSA 3B6YA 2VUMG 3M4OH 2ZTDA 1PV4A 4JI5Q 4PZ6A 3M4PA 4AYBE 2ZM6Q 1W2BA 2Z0SA 1HR0W 3K0XA 1IXRA 4X62L 1K3RA 1TWFH 3PUVA 4GKKL 1YZ6A 3W5OA 4LFBL 1VQJA 5BR8L 2OWOA 1GD7A 2UU9L 1SMXA 1X9NA 4LUVA 3HOZG 2F52A 2WB1G 3CCLA 1VQIA 3NELA 3TS2A 2ZTCA 2JJQA 2AMCB 4YWLA 2ZJPA 3I56A 5M5WH 1PH6A 1N34L 1AE2A 2OTLA 2WFWA 1VS0A 4DV3Q 1Q86C 4GNXB 5EAYA 3CD6A 2OTJA 3K80C 2MO1A 4UP9A 1XNQQ 4DV0Q 4YCUA 4JG2A 1YHAA 1J5EL 1WYDA 2UUCQ 5M3FG 2CKZB 3U58A 1E3PA 1EFWA 2UUCL 4A93H 2AKWB 2RF4A 3UDXA 3GTLH 2ZJRA 4YY3L 2YTXA 3IRBA 2R7ZH 1WCMG 4A3IH 4P74A 4B3SQ 1HJPA 4OWWB 3ICEA 2RHSB 1KL9A 3F2BA 2DUDA 3WWVA 3RN5A 2K5HA 1IBLQ 1CKNB 4AH6A 2L15A 4DV4L 4B3MQ 4GKJQ 1E7ZA 4UP7A 1LUZA 3OTOL 2AWNA 1TWAH 2D0PA 2IHFA 5C0XJ 2BA0A 3ERSX 2Z6KA 4LF5Q 1IBKL 4NPSA 1WJJA 3HOVH 1HZAA 3PO2H 2UXDQ 1S3OA 2K75A 1UE7A 4HJ5A 4DR7L 3S24A 4A3JH 4QQBX 1JE5A 1L2FA 3A5ZB 3J81i 1Q12A 1KRTA 4YHHQ 1OXUA 4OWXB 1A62A 3CPWA 1VQ4A 1QVGA 1HNWQ 4KI0A 3BU2A 1U5KA 2JA8G 5JEAJ 4UPAA 3KF6B 4KLKA 2MNAA 1YHQA 2VW9A 1HR0Q 2B3GA 1OXXK 1PH4A 4DV5L 1QZHA 4LF7Q 2JA5G 3AFQA 4DV5Q 5ELOA 4LF7L 2HQLA 1VQ9A 2CWPA 3CAMA 3CQZH 4R4OA 4LUOA 3F8TA 3G4SA 1HZCA 3GTOH 3HOZH 1G6PA 2OQKA 4HIOA 5ELNA 5M5YH 4MZ9A 4BXXG 4YY3Q 1KXLA 1Y1VG 1EOVA 4DR3L 2WP8J 4X66Q 5FJ8G 2JQOA 3HOXH 2E5LL 4C3IH 5JJLA 2E8GA 5LMNQ 1VQKA 1VQDA 2NN6I 3RLOA 4IJHA 3K81C 2IX0A 5E7NA 4MTNA 3S14H 2QEXA 2I5HA 4LF5L 1MKHA 1PH2A 2K5NA 1Q1BA 2VQFL 1C0AA 2Y0SG 1IBKQ 1C7YA 2UUAQ 1VQ5A 3UDGA 4POGA 1FVIA 3I4NH 4LF8L 4DUZL 1YJNA 4O2DA 3G71A 1IYJB 2CWAA 2NZOA 5BR8Q 5C4JH 4GNXC 4A76A 4B3RQ 4JI7Q 3Q8DA 1HNXQ 2PQAB 4DR1Q 2D62A 2JK8A 4P73A 4JI3L 3CF5A 2UUBQ 2I5LX 1GKHA 1CUKA 4BBRG 5AJ3Q 4R4CA 1JB7A 4JBKA 1XNRQ 1OXSC 2KHIA 1NY4A 3KYHC 4LF4Q 3UDFA 1HNZQ 1IZ6A 2IT1A 4LF4L 3HOVG 1X56A 2VZAA 4YWMA 2A1AA 4A4IA 3HOWG 1EWIA 3PUYA 4A3JG 4A3MG 1YEZA 1Y1VH 1L1OB 3UE1A 2HT1A 2Q2HA 1SFOH 1LTLA 5IP9G 2KCTA 2WAQG 1BBUA 2Y0SE 5GAGC 5IP9H 4ME3A 4HJAA 4AQYQ 4JI6L 4DR4L 2VS1A 2UXBL 4FDBA 2XTIA 1PHJA 4PG3A 1E22A 1WCMH 4A3IG 2Q2TA 2HHHL 2B63H 2R7ZG 4HIMA 2VNUD 1X65A 3CPFA 1N36Q 2JA5H 3KFUA 1N34Q 3DM3A 3HFZB 2Q2IA 2C35B 3GTQH 4GS3A 4EX5A 3ULJA 3F1ZA 4JI1Q 2VQEQ 1HZ9A 3DLLA 1XPRA 2GVBA 3M9BA 4DV1Q 4GKKQ 4WJ3M 1PH9A 1BKBA 5DLQE 4LFCQ 3PO2G 3PF4A 3K7AH 5IYBG 4LNQA 4GN5A 4GKJL 3J81j 4JI0L 1SRUA 4YCVA 2WB1E 4L5RC 3I4MG 4A3DG 3CCRA 1GM5A 2B63G 3GO5A 4A3KH 5LMUL 4DV7L 3UDIA 1TWGH 2A19A 4C3JH 2YU9H 1FGUA 1X3GA 4QY7A 1NE3A 3ULLA 4GOPA 1J5EQ 3AFPA 1KQSA 3H0GG 4BBRH 1UE5A 3PGZA 4IPGA 4OO1I 4HJ9A 1VQ6A 3U50C 3KF8B 5IY0A 3HOYG 5C44H 3PUXA 3HOUG 1N36L 4QJFA 4PZ7A 4LF6L 1CKNA 1YHBA 2VY3A 5IP7G 2K50A 1PVOA 1XMQL 4DV4Q 1KRSA 4QL5A 1XPOA 1J6QA 2YV5A 4MNOA 1B70B 4OX9Q 1FJGQ 3GTKH 3OTOQ 1Z47A 2RCNA
chains in the Genus database with same CATH superfamily
2AQ1B 1UAPA 1IBMQ 1K83H 2EY1A 3LWUA 2WB1B 3RN2A 3M3YH 3NWTA 1VQEA 5IGEA 2B2TC 3BZCA 4Y52H 3CCSA 4IUVA 1DCZA 4JK1C 3GV6A 4EGVA 4IPCA 3K5NA 1Q1EA 2F4VL 2YTVA 5JVG3 4NDXA 1P8LA 4DR2L 1JB3A 2EPBA 2B8FA 1DM0B 1GUTA 1JC7A 1GO3E 4DFAA 4NXML 2CQOA 4G4KA 2F4IA 5M5WB 5CR3A 1SSOA 1XWEA 3OOCA 2KEDA 1VQNA 1DOKA 3SHLA 4TRDA 3HOXB 3S1NB 1VQMA 1KNAA 4JPBW 1PTOF 1G291 3GTMB 1V43A 1BCPD 4C2MH 3MFGA 1XJVA 4DU9A 3J81L 1SE4A 3JAMc 1CQVA 2EIFA 2B2UA 2XRQD 1I50H 4OXPA 4DR5L 2RHQB 3KLSA 3EJIA 4JV5Q 2CFMA 4GZYC 4CDFC 5IWAQ 1D8LA 1G51A 3JAMi 3LX0A 4OO1G 3S2HH 1YIJA 1EIYB 4J8QA 3J80E 4GNXA 2LFNA 4IFDG 2NN6H 4CDEC 4X62Q 3ITPA 3SK5A 3HOWB 1NBWA 3GTPH 2K4KA 1I3QH 2JA7B 1XNRL 1LTAD 2AQ2B 4G57A 1B53A 3W3AA 1XMQQ 2JA9A 5K36G 3D4RA 1HA5A 1JWSD 1B9NA 1C48A 2X6GA 4IN3A 1U4MA 1R9TH 1YBYA 2Z8LA 4JI6Q 4EQOA 3TRZA 3DEOA 4B9XA 4H44C 2HHHQ 2XIWA 3CMAA 4A3FG 4A3EH 4RG1A 2EJGC 1RHPA 1WVLA 1RODA 1SYDA 1EQRA 4A3GB 2FFKB 1B4OA 5NUCA 4GOPB 1QZGA 3K8AA 2K5QA 1S40A 5IGCA 1QCBD 2EY6A 2J0TD 4N8X1 4C3HG 2JA6H 3T1YQ 1RKNA 1HZBA 4A3CG 4FP5D 4S3SA 1S72A 2NZHA 2ZTEA 1TWCH 1C9OA 3D3RA 4CJ0B 5IGGA 4P75A 4GOPC 1EYAA 1M8AA 1PYWD 1XYIA 4X3SA 5GROA 4QCLA 4DK1A 2AHOB 1BBWA 1DXMA 1E24A 1HUMA 4KKTA 2M00A 3C1FA 4ZUJA 1LT3D 4HMIA 3IKJA 1IBLL 3HZXA 3UE0A 3CCMA 1QOHA 3QO2A 1A15A 3M4OB 1N32L 1UEBA 3VYTA 4DAYB 5ELBA 1I6VC 4IFDI 4YIJA 4JI3Q 5TSSA 2Z6KC 1PFMA 4CHTB 5IODA 3GTGB 5FLMH 4XTCS 2R6GA 3GTGH 1ZYRD 3D0FA 5E3FA 1TY0A 2EYPA 1WFQA 3CXCA 4FNFA 1OO9B 4DR4Q 3FPPA 4X66L 2Q2UA 4G7HC 1LT6D 2E2IB 1MI2A 3CW2C 1CHPD 3KLWA 1I94Q 1LT4D 4JCVE 1I94L 1DOMA 2K03A 1X6OA 2F0HA 2R7DA 1Q46A 4OELB 1Q7YC 1SNPA 1L1OA 5I2XA 2A73B 1TWHH 3D31A 3DM1A 4JV5L 1I6HH 3ULPA 4WJ4A 4GLVB 3IFTA 4KHZA 1WTPA 3ER0A 4DV2L 2LY7A 4JI2Q 4DV7Q 3H3VC 4DUYQ 2ALYB 1YJ9A 3ZJYC 2ZM6L 2FMCA 4LW1A 3I73A 3H0GH 3J7ZC 3OSOA 2R92B 3FDTA 3W1BA 1UUPA 3HKZB 1VQHA 2B29A 4L6TB 5AFWA 2KA7A 3CKIB 4DPGA 3I55A 1SROA 2B2UC 4YCWA 2JA7H 3FKIG 2HIXA 1HR0L 2ID0A 3OIQA 1JCKB 1S5FD 1HTPA 4JI1L 1FJGL 4RA8A 1J8IA 1WTOA 3K59A 1TXYA 2SDFA 3PIPA 4DR7Q 1JE4A 4BY1H 4JC0A 1EEID 3T13A 3U4ZA 4A3BH 3HOYH 2Z4IA 1IYUA 2OT2A 5IE8A 2A6EC 2JP1A 4JI5L 3VR3A 1O7LA 1KD1C 1JJCB 2NB0A 4OIJA 2X6LA 1XMOQ 1Q82C 2KCCA 1EQQA 5M3MG 1Y14B 4QIWE 3J7YW 3CCVA 3PO2B 2BH2A 3S1MH 3M7GA 1VQ7A 4BXXH 4J15A 3BJUA 1NMGA 3MFYA 4QGUA 2XSCA 4KY7A 2F3IA 3R2IA 3DMUA 3HP3A 2NTTA 5C44G 1RTOA 3VDYA 4LFCL 1X3PA 1WTRA 2VB3X 1JJ2A 5KNDA 2F4VQ 2F0EA 4ZKBB 2OCEA 2EY5A 1ILPA 2F0IA 3K7AB 3Q0AA 1IW7C 3KUPA 1PTOH 2VUMG 2ZTDA 3M4PA 3P75A 3K0XA 1LABA 1K3RA 2RDGA 4CDDC 1ESRA 2PW5A 1CI3M 3KBXA 2UU9L 3OWEB 1EZ8A 2WB1G 4XQJA 4V190 3TS2A 2WINB 3NELA 4YWLA 2ZJPA 1ET6A 5E4WC 3C3LA 3I56A 2ICEC 1PH6A 1N34L 2Q8TA 3OWFA 3EVQA 1BBXC 1L0XB 2V4DA 2F0VA 2MO1A 3R93A 5CGKA 1TU2B 2WAQB 1XNQQ 1RJTA 1TWGB 2PO4A 1TVXA 4M1UB 5ELCA 3BYYB 1EFWA 1Z6HA 4A93H 2AKWB 2RF4A 4C3HB 2ZJRA 4ZLTF 3FMCA 1HJPA 4B3SQ 3ICEA 2RHSB 4C1NI 3RN5A 4AH6A 4DV4L 1G6ZA 4UP7A 1LUZA 4C3JG 4LF5Q 3ERSX 5CV6A 1IBKL 4NPSA 2F0OA 1Y8OB 1JE5A 4JW0A 2HCCA 3L9AX 1KRTA 1OXUA 4YHHQ 3AMUA 3C1EA 5JEAJ 2PZTA 2B3GA 4LF7Q 1LLRD 3AFQA 4LF7L 2HQLA 3I90A 3TN2A 1VQ9A 1K83B 3GTOH 4LUOA 3HS0C 3HOZH 1G6PA 4HIOA 2K1BA 4BXXG 2CVRA 3A55A 1KXLA 1SE3A 1Q3LA 2E5LL 1C4QA 4Q0FA 1VQKA 1VQDA 1Y69U 1B50A 1PTOC 4KV6A 1PRTD 1MKHA 4XDXA 1LTTD 2UUAQ 4POGA 3UDGA 3T4AC 2B2TA 1YJNA 1F9RA 2BDOA 1SBBB 2XNAC 1IYJB 2CWAA 2NZOA 5BR8Q 5K5PA 1HFNA 3SK8A 4ZYSA 1R9TB 2B39A 1HNXQ 1KNEA 2AUKA 3CF5A 4JBKA 2RCFA 2EDGA 1NY4A 4LF4Q 3UDFA 1HNZQ 5IGDA 4LF4L 4CKBA 1LTRD 2EZVA 5KNCA 4YWMA 3HOWG 2A1AA 4A3JG 1U9RA 2Q2HA 1SFOH 3A8JE 2WAQG 1BBUA 4ZKCB 4AQYQ 2UXBL 1IHZA 1PHJA 4PG3A 2B63H 3TP6A 2VNUD 3NPPA 3CPFA 2JA5H 1V8QA 3ND9A 4GS3A 1B2TA 3KLRA 5C6AA 1BF4A 5ELDA 4FF3A 2RDFA 1EY6A 1HZ9A 4N8FA 2GVBA 2F1MA 4GKKQ 1AW7A 1EU3A 4IALA 1TS4A 5DLQE 4LFCQ 1T5XD 5IYBG 4LNQA 3J81j 2O5JC 2WB1E 1R4QB 4NMZA 2B63G 2A68C 3TP7A 3UDIA 1TWGH 1FGUA 4QY7A 3ULLA 4A3JB 2B2WA 1J5EQ 3AFPA 3N52A 1S5CD 2A6HC 2R3ZA 1EY5A 1VQ6A 4K5VA 3HOUG 3PUXA 5D3DA 4KN4C 1A6XA 4LF6L 2F0PA 1CKNA 5IP7G 1TWCB 4XT3B 1RD9D 5T1IA 1J6QA 2YV5A 4OX9Q 1B70B 3GTKH 3TDQA 2RCNA 4QMGA 1SAPA 4RKBA 3J80c 4PZ8A 4RKLA 4O42A 1O7ZA 1B9MA 2KUMA 2MO0A 1EOTA 4P72A 5IT9c 5KNBA 3NQTA 2EXDA 4B3RL 5EKIA 2C5CA 4A3DH 4DR6L 1CQFA 3A0JA 1X3EA 2FHTA 4JI2L 3PO3G 1KIXA 4DUZQ 3SGIA 4DA2A 1D5MC 3ONAB 3FP9A 4CKEA 4RCOA 1D5ZC 2D2CC 3I70A 3S17B 4DF7A 1TT2A 1SNOA 5IYCG 4A3GH 1VF5C 1CKMA 2QILA 4IPHA 1B1ZA 4J6HA 5M3MH 1KC8C 2ATWA 3GTOB 1W3SA 2KENA 2DGYA 3A5UA 1CZWA 1I4GA 2PYKA 1N9WA 3FKIH 2PMZB 2N8NA 5IYDG 3HOWH 4JOIA 2CCZA 1RDPD 3J81E 3OTOQ 2SOBA 2MHVA 5M9OA 5E4XA 1UWVA 4JI4L 3M85A 1EIFA 5JJIA 3HEJA 1MGSA 4IFDH 4GLAC 3NBIA 2KHJA 3CRLC 2HIVA 1A63A 2Q8IB 5EKLA 4KY6A 1U4PA 1D2BA 4L5SA 1JOQA 2HCIA 4JI8Q 2F0WA 1HNWL 3I4LA 2QCPX 4DV0L 4DV3L 3OYYA 2VUMH 3E0JA 3K5LA 2XGTA 4I7AA 1NUCA 5DEHA 4KJOA 2ZXPA 1K9MC 3JC66 3S1RH 2K28A 4TKOB 3IL8A 1I5FA 3FVQA 4XYOA 1KDAA 3TBIB 1VQAA 2HDLA 5LMNL 2IPKD 5EGTA 4A3EG 3L3OC 3PF5A 1PRTB 1SMYC 2K14A 3TREA 1N32Q 1OTCA 2UXCQ 4A3DB 5T1GA 2YYZA 2EE1A 4O1NA 1S5ED 5CMDA 2BDNA 1FL0A 1SYGA 4DV6L 3NENA 3EQLC 1HFGA 4DR1L 1VQLA 2E2JB 2J4XA 1CTMA 3HGBA 1U4RA 1GVPA 3P7JA 3RLNA 2RA4A 2TSSA 3BVZA 1XNQL 4A93G 2R92G 1NCVA 3MA2B 2A8VA 3K5OA 2VL6A 1B8AA 4OGQC 4DR3Q 4B3SL 4FF4A 3KLSX 2R93B 5I6YA 1KABA 2N88A 2OF1A 5CBEE 2NZ1D 2B2VC 1KDBA 4C2MB 1JQYD 3GTMH 1BOSA 1GHJA 3TMEA 4JBMA 3H15A 2PI2A 1MD2D 3TSSA 2NTSA 3RNUA 3MTSA 2K5VA 3MVVA 1CHQD 2Z4HA 3CC7A 1LM0A 4J1MA 4Y7NH 2RSNA 1XPUA 3H6MA 4P71A 2JE6I 4RWSC 1WTXA 5HGTA 2PI2E 3S16H 3JAME 3BS1A 1YI2A 2LKVA 2MUYA 4ZCKA 4UP8A 2Y0SB 5HURA 4R4TA 2YTYA 1STYA 2FXQA 3RUZA 4Y7NB 3M4YA 3RD4A 1HHVA 3QG1A 4LF9Q 1G8ZD 4C56C 1F77A 1WD1A 4LFAQ 4APVA 4DN4M 5C3EH 1WOCA 2UUAL 1VMCA 3Q23A 5G3LD 5C0XG 4RGTA 1ZXTA 1CKOA 3MEFA 2GVAA 4BA2I 1Y1WG 1SJHD 2O2LD 1WI5A 1QB5D 3S9WA 5JJKA 1FNUA 3GV3A 1NMFA 1RTNA 1K8OA 1CZGA 1AEXA 3E9IA 1JOOA 2B2WC 4N9PA 5C3EB 2IX3A 1SFOB 1MBYA 2SNMA 3EROA 3IFDA 2EOTA 3R8BA 4LMQD 3J81c 4IZ8A 4BBSG 4X64L 1LYLA 2PPBC 3K57A 2ICIA 2BA1A 4A3LG 1Z7TA 1X54A 4IPDA 1AE3A 4IFDJ 2Z1CA 2EYLA 2Q8RE 1M1KC 1A8VA 1GJXA 3G6EA 2EQSA 3SVMA 4B3ML 4OWTB 3TQYA 4LUZA 3T1YL 4A3FH 3S1QB 1TR5A 1B7YB 4EVOA 1RCVD 1SNCA 5JPNC 2KVMA 5JEAG 3CMEA 3PUWA 5FLXL 2JA6G 1DJRD 4HIDA 1V1QA 2K04A 2KOLA 2LMCB 5EPLA 1I6HB 2EYFA 3W2DA 2ASBA 4R4IA 1W6KA 2GN5A 3E3XA 3MZ5A 5CV7A 2VQFQ 3MWYW 3T1HQ 4PMWA 3V96A 1SJED 2F0DA 2ZJQA 2AWOA 2KCMA 3FHWA 1SDFA 2B2VA 1DONA 5IP7H 1VCIA 1QUQB 2E2IH 3HKZE 2H5XA 1NAPA 1J9OA 5AJ3L 5DNFA 2A69C 2NVQH 1DGSA 1PRTC 4F8MA 1PMRA 1X3QA 4PZ6A 2BCOA 1VDZA 5I9PA 4X62L 3PUVA 3DEPA 4HN7A 4LFBL 1VQJA 1PXUA 1DOLA 2FJ2A 2F52A 4FVMA 3CRKC 4K8IA 4L63B 2CHBD 2AMCB 1EIGA 1WD0A 2MJ8A 5M5WH 2OTLA 3A8IE 4G7OC 3NSWA 4R8IA 5EAYA 4QF4A 4YCUA 2YU9B 2X69A 1EWHA 2VUMB 2O4XA 3TP5A 1ZKOA 3U58A 1E3PA 3UDXA 5L37A 4DGZA 4HSPA 1KL9A 4K2KA 3GQBA 3WWVA 5JPMC 4HEDA 1GUOA 4GKJQ 2IWHA 3OW7A 1F2ZA 1TWAH 2IHFA 1ILQA 4DK0A 2Z6KA 1JR0D 2A74C 1UE7A 4DR7L 3S24A 4NW2A 4BY1B 2HDMA 3A5ZB 4RGNA 2RSOA 3S1MB 2H1EA 1EYDA 4OWXB 3SR1A 1VQ4A 3TZDA 1BDOA 1EY4A 5I6WA 1HNWQ 4KI0A 4HAEA 4UPAA 1HR0Q 4KLKA 3NTIA 1YHQA 4DV5L 1QZHA 5FO9B 4DV5Q 4KJNA 2EY2A 3CAMA 3G4SA 1HZCA 1IKLA 2CQAA 3H91A 3P20A 4MZ9A 1EOVA 5LL6X 3HOXH 5G3LF 4C3IG 5JJLA 5LMNQ 2L0CA 2NN6I 5E7NA 5COYA 4OEMB 2I5HA 2N55A 3I4NB 2Y0SG 1C7YA 1YNND 1GXDC 2XRSD 1B44D 2ZT9C 2BE5C 4FF1A 1H9SB 2D62A 2G9HD 2JK8A 3Q6SA 4DR1Q 2I5LX 1GKHA 4BBRG 1YNNC 3VYSA 1NNXA 1EY7A 2KHIA 2IT1A 1E2VA 5M3MB 1EWIA 4MIUA 5J1ZA 4A3MG 1Y1VH 2RQXA 2M2LA 5I4DA 2F0QA 3BYTB 3NQIA 1VMPA 4U673 5IT9E 2Y0SE 4FXGC 2XTIA 4A3IG 1HQRD 4I65A 3MXUA 1X65A 1A3TA 3I72A 4HIMA 3KFUA 1N34Q 2CH4W 3PMFA 1NSNS 4C3IB 4EX5A 4KHVA 3I8ZA 3J7AF 4ODGA 1SXTA 2NVYB 3CQZB 4A93B 3LWEA 2F0SA 3UI2A 5FKAC 1CA6A 2F0FA 5I2YA 4GN5A 4KD4A 4IUTA 1SRUA 3HOZB 4A3DG 3SEBA 2KECA 3CCRA 1ENCA 1GM5A 4AYBB 5KRUA 4HMJA 3GTKB 2XN9C 4WFN3 4C3JH 1X3GA 3RZOB 3MXNA 3H0GG 1UE5A 4OO1I 2L55A 5C44H 4DXFA 1N36L 2SNSA 4PZ7A 5A35A 1YHBA 4B9WA 1PVOA 4QUCA 1G91A 4ZAIA 4DV4Q 1KRSA 3A8KE 2QF7A 4MNOA 4QL5A 2RDHA 1XMQL 1FJGQ 2JA6B 3M3YB 3G48A 3H0GB 3MHBA 4CBVA 5GADC 3CP0A 4K5XA 4WORA 4BY7B 5EBDA 4L5QA 4B3TL 4OL7A 4JI7L 4ZK9B 4KN7C 2F0UA 3AYHB 3BG3A 3MAQA 4XQNA 3HOUB 2DNCA 1G2TA 2IHEA 4A3MH 2A69D 3I2ZA 3SDZA 3K58A 1N33L 1PDQA 3NWSA 3NK9A 3C2PA 1BXTA 1SEBD 3CCEA 1NR4A 2JA5B 3NHHA 1H9KA 2L4NA 4NKLA 2FINB 3GDEA 4X64Q 3QOLA 4JI8L 1F2MA 2JA8H 1MSHA 1HNZL 2OXPA 5EPJA 1Y1VB 4OONA 2I5MX 3HG9A 1QG7A 4MHEA 1Z9FA 3D8GA 3PO3B 3HRZC 1PRTF 3D4WA 3BDOA 1P16A 1HTLD 3FRPB 1I4HA 1MJCA 1IW7D 3HOXG 2EVBA 3CC2A 1IL2A 1HNXL 4JBJA 2QGQA 4K6LA 3KK7A 1PH7A 4UDUC 5JEAH 2B8GA 4G7ZC 1BQQT 3F2UA 1UE1A 3R2TA 2UXDL 2NBFA 4K0KL 1HCZA 4IO9A 1DYQA 1HQMC 1LACA 4A3LH 2R93H 5ISRA 4H0LC 3F2DA 3KJPA 2VB2X 3LNNA 1PYBA 1EZ6A 3KF6A 1PZID 3RR5A 5C4XH 1JWMD 2WKDA 4DR2Q 1AH9A 1OXVA 2V1CC 3M4QA 3R3OA 3T56B 1LT5D 2K5DA 4HSVA 3VR6A 3OMGA 2ES2A 4RAUC 4YHHL 1Y1WH 1SNDA 4DK6C 4OO1H 2EYMA 3RZDB 1EIHA 4H02A 4TVAB 1HPCA 1CSPA 3E5SA 4DV2Q 1M90C 4LF6Q 3S15H 3QOJA 3Q24A 3S1NH 3S16B 3VYRA 3CC4A 3H3VH 4XYQA 2JEAI 1BUVT 1KTKA 4K6DA 4K5WA 4BBRB 1CA5A 3EFXD 4DR5Q 2F03A 2E5LQ 4R1JA 1TS2A 4L5TA 1F2LA 1ML0D 4POFA 3A74A 4LF9L 4ALPA 2AUJD 1PFNA 3RMHA 5GAEC 4LFAL 3F2CA 1I4QA 2VQEL 1EQTA 3MXPA 2PQEA 3BVGA 1E1TA 3EBEA 4DV1L 4LJZC 4ZUIA 1JWUD 2MFIA 2R61A 4A3BB 5C4XB 1L0YB 2R93G 4R9WA 2N49A 4RH6A 1SNQA 1Q90A 3VA7A 1EUJA 4JBWA 3KDFB 2UXBQ 1BVSA 3VA5A 1ASYA 4BY1G 5A2QE 2ZXOA 2MQHA 5C3EG 5FLMG 4DNIA 3MXNB 1GOZA 3T53B 1SYCA 4DAYA 4JI4Q 2N78A 4IOAA 1I4RA 1X55A 3NTKA 4ID6A 4TSSA 3NEMA 3PCOB 3C46A 1HH2P 2XWJB 3U4VA 3RZDH 1E2WA 2NVXB 2I46A 3X3NA 4FXKC 1VQGA 4EQ5A 2UXCL 3KJOA 2RVLA 2IW3A 1K0SA 1VQFA 4DV6Q 4IUNA 2WKCA 4RGMA 5IYDH 3KOJA 3HKSA 1V9PA 2NWGA 3VYUA 2IY5B 5CORA 4ZQ3A 1NTGA 2DN8A 4V0BA 5IYBH 4LF8Q 1GUSA 4RMFA 4JYAQ 3FPUB 4DKAC 1OXTA 1UE6A 3I7FA 4GN3B 4MN3A 2R92H 2A6HD 4RHRA 1QILA 1MJEA 1H9MA 3L0OA 1PZKD 1D5XC 4BWGB 1S5BD 5H1SE 1ASZA 3QIAA 1CT1D 1F2YA 1I3QB 1S4ZA 2LXJA 5J3BA 1JMCA 5C3WA 1F9PA 3GTJH 1B3AA 1MIUA 4GN4B 4PV1C 2XVSA 4Q5VA 2IX1A 1YITA 4A3KG 5HY6A 3S2DB 3AU7A 2NVXH 1SN8A 4O0AA 2VXWA 3CU7A 2QDBA 2PNHA 3BZKA 3URYA 5A2QL 2EYOA 5CBAE 3D6CA 4JVZA 2LS01 3PIOA 3V05A 4HTHA 1BO0A 4B3TQ 4JOIC 5KEEA 5CV8A 3PIP3 5LMNW 1QUQA 5FO8B 1Y8NB 4ABNA 3S17H 4KKSA 2E76C 3B6YA 3SXHA 3M4OH 1PV4A 5M3FB 2ZM6Q 1W2BA 1HR0W 1IXRA 1TWFH 3A7AB 1MSGA 1YZ6A 4CGYB 3BDCA 5BR8L 2OWOA 1GD7A 3N6RA 3DWQA 2F0KA 1X9NA 4XQQA 3HOZG 4EQPA 3CCLA 1VQIA 1LTBD 2JJQA 5FK9C 2E74C 1AE2A 5C5LA 2WFWA 1IKMA 4DV3Q 1Q86C 3CD6A 3K80C 1AZQA 3K6OA 4JG2A 4C3JB 4DXGA 2CKZB 1AP0A 2YTXA 2R7ZH 1A3VA 3I91A 4A3IH 1PTOB 1X32A 1XTCD 1V1PB 2K5HA 3U9SA 4CDCC 1E7ZA 3OTOL 2A68D 2D0PA 1IYVA 2WV6D 2BA0A 1I4XA 1WJJA 3PIO3 3HOVH 2UXDQ 1S3OA 3T16A 4HJ5A 2DY8A 4OHJA 1L2FA 5DM73 1QE6A 1VF7A 3J81i 5IGFA 1Q12A 3S1RB 1A62A 3CPWA 4L8JA 1PLFA 2L5TA 2KCNA 1STHA 2JXMB 1U5KA 3BU2A 5KYLA 2JA8G 3KF6B 2MNAA 2VW9A 1OXXK 1STGA 1FNWA 3V2TA 2JA5G 3CQZH 3F8TA 4PMBA 1EY8A 3NTHA 5ELNA 5M5YH 1ZYRC 4YY3Q 1Y1VG 1ONLA 1MHWC 4C3IH 1XX8A 2E8GA 5LHY1 3SK6A 1EY9A 2IX0A 3K81C 5CYUA 3S14H 2QEXA 5EQ0A 5LL6S 1V1PA 2F0MA 2F3WA 2ENBA 1ESFA 2VQFL 1VQ5A 5C4ZA 4LF8L 3O13A 4NP5A 1STEA 2QKIC 2EXZA 4KY5A 5C4JH 4GNXC 4A76A 4B3RQ 4WRDA 4ULLA 3Q8DA 2PQAB 4JI3L 2OTJA 3I4MB 2E2HB 5AJ3Q 1JB7A 3GTPB 3KYHC 1LTID 3G6JB 1XXGA 2F0JA 1X56A 2L12A 2VZAA 3QR8A 5FOBB 3A56A 1YEZA 1L1OB 4CJ1B 1LTLA 2KCTA 5IP9H 5GAGC 4DR4L 2VS1A 1O7YA 2E2DC 1WCMH 3OPOA 4RGOS 5C4JB 2Q2TA 1N36Q 1WCMB 3DM3A 4RHSA 3HFZB 2C35B 3TP8A 1SNMA 3F1ZA 2EYJA 1DD2A 2VQEQ 3A7LA 3DLLA 1XPRA 1GUGA 3OMCA 3M9BA 4DV1Q 3BZDB 3GTLB 4WJ3M 3FKIB 1BKBA 1YNJC 3U9OA 4IUPA 4RCNA 1ICFB 4U68A 1CM9A 4GKJL 3WOFA 4JI0L 4YCVA 4A3IB 3I4MG 2WACA 4HCEA 4DV7L 2A19A 2YU9H 4GOPA 4FF2A 1WTHA 3CHBD 4HJ9A 3U50C 3KF8B 2GA4B 4CJ2C 1Y8PB 5M5YB 3JAML 1Z47A 3E0EA 3J80L 1Q8KA 3STBC 3I4NG 2DY7A 3L2PA 3X3MA 4I7ZC 1H95A 1D1KA 1VQCA 2B2YA 1A2UA 3HOYB 2F0LA 4ZRZA 4BBSB 4TQUS 1RL2A 5KIXA 3HOVB 5C0XI 1S5DD 5EKKA 1TWAB 4NB3A 3WOEA 4X65Q 5GQOA 2R7ZB 3AB9A 4X65L 1O7IA 3LGJA 5DM63 4DAVA 3MXGA 1YNXA 4F7XA 2LSSA 1IBML 3T1HL 4CKCA 4IQZA 1SE2A 2PZWA 3OW2A 3BVMA 1ENAA 1H9RA 3GP7A 4C1NK 2JYOA 3PV0A 3M7NA 5CC4A 5EPKA 1KLGD 2KBNA 4A3EB 2JEBI 4QB4A 3NBHB 4KHPQ 4EQNA 2D5DA 1K0RA 4KHPL 3E9HA 2JN4A 4NXMQ 3OIPA 4R4QA 4UY8C 4LFBQ 3CCQA 2XWBB 5M3FH 3NE5B 2B63B 1ZEQX 1VQOA 4K2LA 4AIMA 5ELFA 3GTJB 2OEOA 3DHQA 4A3FB 3S1QH 3EN2A 4Z9CB 4HCSA 3J7A5 3QB3A 4PNYA 5C0XH 1SYFA 2NUCA 5FJ8H 4DUYL 1JJGA 4OX9L 2F0NA 5CV4A 1STAA 2Z6BA 2PZUA 5KGUA 3GTQB 2DJFC 2KQ3A 3Q22A 5C5MA 1D7QA 4IURA 1EWCA 2PQAA 5IWAL 4HJ8A 2HQEA 4DR6Q 2F3VA 2KHSA 1KDCA 3D6WA 5EBCA 1V1OA 4RFBA 2MGSA 5J39A 3E6ZX 2E75C 1QVFA 2PCFB 1CSQA 1K8GA 2PMZE 3RLFA 2DNEA 2UUBL 4IJLA 5M5XH 5K36H 1DZ1A 1U0LA 1YJWA 1HUNA 1HA6A 1W6JA 3DXJC 1N33Q 2NYZD 3CCUA 3KDFA 2LXKA 4DAPA 3HKZG 1TQOA 3WDNA 1PH3A 2L9HA 4A3BG 2D9UA 4LWCA 3S2DH 1XMOL 3RZOH 3AQQA 4AYBG 4XXEA 4H7BA 2FMMA 1RIPA 3ZYYX 1JT8A 4BY7G 5ELEA 2QA4A 3K0YA 4X3TA 3H3VI 3NXWA 1UEAB 1M4VA 1ICWA 4HR7B 3PSIA 5IT9L 4DK3C 3DWAA 1PTOD 1O80A 4C3HH 1STNA 2IL8A 1PFSA 5IIFA 2PW7A 3STBD 3J80i 1R4PB 2DJGC 1EYGA 2JA7G 4BBSH 1NJIC 1TIID 1X3FA 4FO2A 2NVTB 2CW0C 5LMUQ 2N3SA 2NVTH 5J22A 1T9HA 4P2CB 1FYCA 4BY7H 5JJZA 1VQBA 4K0KQ 3S15B 4AQYL 2A5HA 3EA6A 5HGQA 4XT1B 1Y1WB 4UAIA 1NR2A 2WAQE 1SR3A 1VQ8A 1PFBA 1PH1A 1ET9A 1SYBA 2B2YC 1LV9A 2D0OA 4ME5A 1UNSA 1C8CA 4LAAA 5C4HA 2UU9Q 2OQ0A 1K8MA 1KAAA 3PUZA 1K28A 1E0BA 4JYAL 2QEJC 3ERQA 5FLXE 2K33A 1CFMA 1EU4A 2P5ZX 1JOKA 4XIGS 4BS9A 1ENFA 3S14B 2J7ZA 2QW7A 3I4OA 1SMYD 1VQPA 1K8AC 3L7ZC 1JORA 1KAWA 4PMCA 4MTKA 4NXNL 4DNRB 1PH8A 4QIWB 4NXNQ 1A0IA 2R7FA 2ZXRA 5M5XB 1AN8A 4KD3A 1N8RC 1FNVA 2NVYH 3MC0B 5FLXc 1H9SA 3SK4A 4BA1I 3G7LA 1PYSB 3ND8A 1QJOA 2Z9HA 2RBMA 5IOCA 2E2HH 1QNKA 3I4MH 2BOSA 4K8JA 1PZJD 3I3CA 3KBGA 4HIKA 4FXDA 1K73C 5CV5A 2BH8A 1PH5A 5F2DA 3CCJA 1SE8A 4GLXA 1EEFD 1KHIA 5GAHC 1O78A 4X6AH 1SLJA 1PA6A 1Q8IA 1E1OA 2MP1A 2NN6G 1Q81C 4A3GG 3AEVA 3QWNA 5JAVA 4A3KB 2E2JH 1BNZA 4JI0Q 3TEHB 4QUFA 3P1HA 1YVCA 3K7UC 2M9VA 3H94A 2K01A 3VR4A 1QVCA 5C4XG 1IL8A 4DAMA 4A75A 4KMUC 1A2TA 3FEWX 2K52A 1U4LA 5I9OA 3GD7A 4R8NA 1L0WA 2JA8B 3TS0A 1HRJA 2I0QA 4A3CH 1TS3A 2F0GA 3DWPA 3W1GA 5IYCH 4IUQA 4KK7A 2K6AA 3VR2A 2K7VA 1I50B 4LK1C 3MEHA 1KLUD 1T5EA 4M8AA 3EIVA 3A54A 4HJ7A 3HOUH 2H4OA 2TMPA 1FR3A 1II3A 4IOCA 2G9DA 4YWKA 1L1OC 2MPMA 1SYEA 1XTDA 3BDLA 1EL0A 3NP8A 1FD7D 4JI5Q 4B08A 4AYBE 2Z0SA 5C3XA 4GKKL 3W5OA 3J7AV 2CH4A 4F87A 1SMXA 2L1BA 3K5MA 4LUVA 1TWHB 1HXYD 2ZTCA 2EYHA 3QJYA 2KEEA 1BCPC 5D14A 5EJWA 1I4PA 5IGBA 1VS0A 2F0TA 4GNXB 4UP9A 5DAUA 4DV0Q 1B3QA 1YHAA 1TS5A 1J5EL 1WYDA 1CK1A 2UUCQ 5M3FG 4FYDA 2UUCL 2CW0D 3GTLH 4YY3L 3IRBA 1F9SA 1RF2D 1WCMG 4K14A 3KF8A 4P74A 4OWWB 4KTAA 3F2BA 2DUDA 5KYIA 1LTSD 1IBLQ 1CKNB 4B3MQ 2L15A 1E2ZA 1GUNA 2AWNA 5C0XJ 1FGBD 5JOBA 3PO2H 1HZAA 2K75A 4QQBX 3TZUA 4A3JH 2HUGA 4F88A 1YNJD 3NBHA 1QVGA 1BR9A 4WJWA 1WTWA 2NVQB 1F9QA 1PH4A 3PQIA 2K32A 1G2SA 5ELOA 2EJMA 2C9OA 2CWPA 2RKSA 4R4OA 3PO3H 5D65A 1D1IA 4N9TA 2OQKA 3NUCA 1QNUA 4IUUA 3D4DA 4DR3L 2WP8J 4X66Q 5FJ8G 2JQOA 4X3UA 5C44B 1H9JA 3RLOA 1EYCA 1A3UA 4IJHA 4MTNA 4H13C 4LF5L 4PQXA 4DNTB 1PH2A 2O5IC 2K5NA 1Q1BA 1C0AA 1IBKQ 1FVIA 3I4NH 4DUZL 4O2DA 4A3MB 1EY0A 3G71A 4OIKA 1AFPA 3DUZA 1LTGD 5CV9A 4JI7Q 4P73A 2UUBQ 3OHXC 4KKUA 1CUKA 5D3IB 1XNRQ 4R4CA 4E6IA 1OXSC 1K3BC 1IZ6A 3HOVG 5FO7B 4A4IA 3PUYA 2HD3A 2JSOA 1BCPF 3UE1A 2HT1A 4X3KA 5IP9G 2IJ0A 4ME3A 4HJAA 4JI6L 1QWYA 4FDBA 1E22A 1WTVA 2PNRC 3IAYA 2HHHL 2R7ZG 3H09A 1GUWA 1JICA 1WTQA 1EQVA 2Q2IA 3GTQH 3ULJA 1TY2A 5E1FA 1GHKA 4JI1Q 5BN4A 2A6ED 5JVH3 4ILWA 1PH9A 3PO2G 3PF4A 3T51B 2EJFC 3K7AH 2KJXA 3SE0A 4L5RC 2I07B 3GO5A 3VR5A 4A3KH 5LMUL 3S2HB 2K05A 1TKWB 5BN5A 1NE3A 4UHVA 2SEBD 1STBA 2K5WA 4BBRH 2QDLA 2AQ3B 3PGZA 4IPGA 5BN3A 1KQSA 1AZPA 1TWFB 5IY0A 3HOYG 1LO5D 2L11A 4QJFA 2VY3A 2WIIB 1EFID 1D6EC 2K50A 1XPOA 2G5DA 1BCPB 2BE5D
chains in the Genus database with same CATH topology
3E0EA 3J80c 1K83H 3G48A 3RN2A 1IBMQ 3M3YH 4PZ8A 5GADC 1Q8KA 3STBC 3I4NG 1VQEA 2MO0A 4P72A 5IT9c 3L2PA 3CP0A 2EXDA 3BZCA 4B3RL 4L5QA 4Y52H 3CCSA 4B3TL 4JI7L 4A3DH 1H95A 3AYHB 1VQCA 4IPCA 4DR6L 1Q1EA 2F4VL 2YTVA 1P8LA 1X3EA 3A0JA 4DR2L 4JI2L 2IHEA 3PO3G 4A3MH 1GO3E 4TQUS 3I2ZA 1KIXA 4NXML 1N33L 1RL2A 2CQOA 4DUZQ 5C0XI 3SGIA 3CCEA 4NB3A 1VQNA 3FP9A 3GDEA 4X64Q 4JI8L 1VQMA 2JA8H 1HNZL 1G291 5GQOA 4X65Q 4OONA 5IYCG 1V43A 4X65L 2I5MX 4C2MH 1XJVA 4A3GH 1O7IA 3LGJA 1CKMA 5M3MH 4IPHA 1KC8C 1YNXA 3JAMc 2ATWA 2LSSA 1IBML 1Z9FA 3T1HL 1W3SA 2EIFA 2KENA 3OW2A 2DGYA 3A5UA 1P16A 1I50H 1N9WA 3FKIH 3PV0A 1MJCA 2N8NA 5IYDG 4OXPA 3HOWH 3HOXG 2RHQB 4JOIA 4DR5L 2CCZA 3M7NA 3CC2A 4JV5Q 2CFMA 1IL2A 2KBNA 5IWAQ 2JEBI 1HNXL 3NBHB 4JBJA 2QGQA 4KHPQ 1PH7A 1K0RA 1G51A 1D8LA 1UWVA 3E9HA 3JAMi 4KHPL 4OO1G 4JI4L 3S2HH 3M85A 1EIFA 1YIJA 1EIYB 4NXMQ 5JJIA 4GNXA 4R4QA 1UE1A 4UY8C 4GLAC 4IFDG 4LFBQ 3CCQA 5M3FH 2UXDL 4X62Q 2KHJA 1NBWA 1VQOA 2HIVA 1A63A 4AIMA 3GTPH 4K0KL 2K4KA 3S1QH 3EN2A 1I3QH 4L5SA 1XNRL 4JI8Q 3J7A5 4IO9A 1HNWL 5FJ8H 4DUYL 4A3LH 1JJGA 1XMQQ 2JA9A 2R93H 4OX9L 4DV0L 4DV3L 5K36G 3OYYA 2VUMH 2XGTA 3F2DA 3KJPA 1R9TH 1PYBA 1YBYA 1K9MC 4JI6Q 3JC66 3S1RH 3TRZA 1I5FA 1D7QA 2HHHQ 3KF6A 2PQAA 5IWAL 4HJ8A 1VQAA 4DR6Q 5LMNL 3RR5A 5C4XH 3CMAA 4A3FG 4A3EG 4A3EH 4RG1A 3PF5A 4DR2Q 1AH9A 2K14A 1OXVA 2V1CC 3TREA 1EQRA 3M4QA 1N32Q 1OTCA 2UXCQ 1QVFA 2YYZA 4GOPB 1QZGA 1CSQA 3K8AA 1K8GA 2ES2A 2PMZE 1S40A 1FL0A 4YHHL 4DV6L 1Y1WH 3NENA 4DK6C 3RLFA 4DR1L 1VQLA 2UUBL 4IJLA 4H02A 4TVAB 5M5XH 1GVPA 3T1YQ 1U0LA 1YJWA 1CSPA 1HZBA 2JA6H 4A3CG 3RLNA 4DV2Q 1S72A 2NZHA 2ZTEA 1M90C 4LF6Q 1TWCH 3S15H 3S1NH 1C9OA 1N33Q 3CCUA 3CC4A 1XNQL 3KDFA 4P75A 2LXKA 3H3VH 4GOPC 2JEAI 2R92G 4A93G 3HKZG 5GROA 2A8VA 2AHOB 1BBWA 1E24A 1PH3A 2VL6A 1B8AA 4A3BG 4DR3Q 4LWCA 3S2DH 1XMOL 4DR5Q 4B3SL 2E5LQ 3RZOH 4R1JA 3AQQA 4AYBG 4L5TA 4POFA 1IBLL 1RIPA 3A74A 3UE0A 3CCMA 4LF9L 1JT8A 4ALPA 4BY7G 2QA4A 3GTMH 3H3VI 5GAEC 4JBMA 4LFAL 3H15A 2PI2A 3F2CA 1N32L 3RNUA 3PSIA 2K5VA 2VQEL 1UEBA 4DAYB 4DK3C 1E1TA 3EBEA 4DV1L 4IFDI 4C3HH 3CC7A 1LM0A 4Y7NH 1XPUA 2MFIA 1PFSA 4JI3Q 2Z6KC 3STBD 3J80i 4P71A 2JE6I 5FLMH 4XTCS 2R6GA 2PI2E 2R93G 2N49A 1EYGA 3GTGH 2JA7G 3S16H 3D0FA 4BBSH 1NJIC 1X3FA 1WFQA 1EUJA 1YI2A 5LMUQ 2N3SA 2NVTH 4JBWA 3CXCA 1T9HA 4UP8A 4BY7H 3KDFB 1VQBA 4DR4Q 2UXBQ 4K0KQ 1BVSA 4R4TA 2YTYA 4AQYL 4X66L 2Q2UA 5HGQA 2FXQA 1ASYA 4BY1G 3CW2C 3KLWA 4LF9Q 1I94Q 4JCVE 1I94L 2MQHA 2WAQE 1SR3A 4LFAQ 4APVA 5C3EG 5FLMG 4DNIA 5C3EH 3MXNB 1VQ8A 1WOCA 1PH1A 2UUAL 4JI4Q 1X6OA 2N78A 4IOAA 2R7DA 1Q46A 2D0OA 1X55A 5C0XG 1Q7YC 1L1OA 1CKOA 3MEFA 2GVAA 2UU9Q 2OQ0A 4BA2I 1TWHH 3D31A 3PUZA 4JV5L 4JYAL 1I6HH 3ULPA 1Y1WG 3NEMA 1WI5A 4WJ4A 4GLVB 3PCOB 4XIGS 4KHZA 5JJKA 1HH2P 3ER0A 3U4VA 4DV2L 1NMFA 3RZDH 3I4OA 4JI2Q 4DV7Q 1VQPA 4DUYQ 1K8AC 3L7ZC 2ALYB 1KAWA 1VQGA 3ZJYC 4EQ5A 2ZM6L 1YJ9A 2UXCL 3KJOA 3E9IA 4NXNL 4LW1A 1PH8A 4NXNQ 1A0IA 1VQFA 2R7FA 3H0GH 3J7ZC 1N8RC 3W1BA 4DV6Q 1VQHA 2B29A 2NVYH 5FLXc 3J81c 4DPGA 3I55A 1SROA 4BBSG 4BA1I 4X64L 1LYLA 4YCWA 2JA7H 3KOJA 3FKIG 5IYDH 3HKSA 2BA1A 1PYSB 2HIXA 1V9PA 2ID0A 1HR0L 4A3LG 2IY5B 1X54A 2E2HH 3I4MH 4IPDA 4HIKA 1AE3A 1NTGA 1K73C 5IYBH 4IFDJ 4JI1L 1FJGL 2BH8A 1PH5A 1TXYA 3CCJA 1SE8A 4GLXA 3PIPA 4LF8Q 1KHIA 4RMFA 5GAHC 1M1KC 1A8VA 4DR7Q 4BY1H 1SLJA 4JC0A 1PA6A 3G6EA 4X6AH 1E1OA 2EQSA 2NN6G 1Q81C 4A3GG 3AEVA 4JYAQ 3U4ZA 4DKAC 1OXTA 2E2JH 4A3BH 1UE6A 3HOYH 3I7FA 4JI0Q 3TEHB 4OWTB 4GN3B 1YVCA 3K7UC 3TQYA 4B3ML 4LUZA 3T1YL 5IE8A 2R92H 1QVCA 4A3FH 5C4XG 4DAMA 4A75A 4JI5L 1MJEA 1B7YB 3L0OA 1KD1C 1JJCB 5JEAG 3CMEA 2K52A 3PUWA 5H1SE 2JA6G 1ASZA 2LXJA 3GD7A 5J3BA 1L0WA 4HIDA 1JMCA 1V1QA 3GTJH 3TS0A 1XMOQ 1MIUA 4GN4B 1EQQA 1Q82C 2I0QA 5M3MG 4A3CH 2IX1A 1YITA 1Y14B 4QIWE 5HY6A 4A3KG 3W1GA 5IYCH 2NVXH 1SN8A 4O0AA 3CCVA 2BH2A 2ASBA 3S1MH 1VQ7A 4R4IA 4BXXH 2GN5A 4J15A 3BJUA 2PNHA 3BZKA 1NMGA 2VQFQ 4QGUA 3T1HQ 4PMWA 2F3IA 3EIVA 2ZJQA 4HJ7A 5C44G 2AWOA 2KCMA 3HOUH 3FHWA 3PIOA 3VDYA 4B3TQ 5IP7H 1VCIA 4JOIC 4LFCL 1QUQB 3PO3H 1JJ2A 2E2IH 3HKZE 5LMNW 4IOCA 4YWKA 1L1OC 2H5XA 2F4VQ 1QUQA 1XTDA 2OCEA 5AJ3L 3S17H 2NVQH 1DGSA 3B6YA 2VUMG 3M4OH 2ZTDA 1PV4A 4JI5Q 4PZ6A 3M4PA 4AYBE 2ZM6Q 1W2BA 2Z0SA 1HR0W 3K0XA 1IXRA 4X62L 1K3RA 1TWFH 3PUVA 4GKKL 1YZ6A 3W5OA 4LFBL 1VQJA 5BR8L 2OWOA 1GD7A 2UU9L 1SMXA 1X9NA 4LUVA 3HOZG 2F52A 2WB1G 3CCLA 1VQIA 3NELA 3TS2A 2ZTCA 2JJQA 2AMCB 4YWLA 2ZJPA 3I56A 5M5WH 1PH6A 1N34L 1AE2A 2OTLA 2WFWA 1VS0A 4DV3Q 1Q86C 4GNXB 5EAYA 3CD6A 2OTJA 3K80C 2MO1A 4UP9A 1XNQQ 4DV0Q 4YCUA 4JG2A 1YHAA 1J5EL 1WYDA 2UUCQ 5M3FG 2CKZB 3U58A 1E3PA 1EFWA 2UUCL 4A93H 2AKWB 2RF4A 3UDXA 3GTLH 2ZJRA 4YY3L 2YTXA 3IRBA 2R7ZH 1WCMG 4A3IH 4P74A 4B3SQ 1HJPA 4OWWB 3ICEA 2RHSB 1KL9A 3F2BA 2DUDA 3WWVA 3RN5A 2K5HA 1IBLQ 1CKNB 4AH6A 2L15A 4DV4L 4B3MQ 4GKJQ 1E7ZA 4UP7A 1LUZA 3OTOL 2AWNA 1TWAH 2D0PA 2IHFA 5C0XJ 2BA0A 3ERSX 2Z6KA 4LF5Q 1IBKL 4NPSA 1WJJA 3HOVH 1HZAA 3PO2H 2UXDQ 1S3OA 2K75A 1UE7A 4HJ5A 4DR7L 3S24A 4A3JH 4QQBX 1JE5A 1L2FA 3A5ZB 3J81i 1Q12A 1KRTA 4YHHQ 1OXUA 4OWXB 1A62A 3CPWA 1VQ4A 1QVGA 1HNWQ 4KI0A 3BU2A 1U5KA 2JA8G 5JEAJ 4UPAA 3KF6B 4KLKA 2MNAA 1YHQA 2VW9A 1HR0Q 2B3GA 1OXXK 1PH4A 4DV5L 1QZHA 4LF7Q 2JA5G 3AFQA 4DV5Q 5ELOA 4LF7L 2HQLA 1VQ9A 2CWPA 3CAMA 3CQZH 4R4OA 4LUOA 3F8TA 3G4SA 1HZCA 3GTOH 3HOZH 1G6PA 2OQKA 4HIOA 5ELNA 5M5YH 4MZ9A 4BXXG 4YY3Q 1KXLA 1Y1VG 1EOVA 4DR3L 2WP8J 4X66Q 5FJ8G 2JQOA 3HOXH 2E5LL 4C3IH 5JJLA 2E8GA 5LMNQ 1VQKA 1VQDA 2NN6I 3RLOA 4IJHA 3K81C 2IX0A 5E7NA 4MTNA 3S14H 2QEXA 2I5HA 4LF5L 1MKHA 1PH2A 2K5NA 1Q1BA 2VQFL 1C0AA 2Y0SG 1IBKQ 1C7YA 2UUAQ 1VQ5A 3UDGA 4POGA 1FVIA 3I4NH 4LF8L 4DUZL 1YJNA 4O2DA 3G71A 1IYJB 2CWAA 2NZOA 5BR8Q 5C4JH 4GNXC 4A76A 4B3RQ 4JI7Q 3Q8DA 1HNXQ 2PQAB 4DR1Q 2D62A 2JK8A 4P73A 4JI3L 3CF5A 2UUBQ 2I5LX 1GKHA 1CUKA 4BBRG 5AJ3Q 4R4CA 1JB7A 4JBKA 1XNRQ 1OXSC 2KHIA 1NY4A 3KYHC 4LF4Q 3UDFA 1HNZQ 1IZ6A 2IT1A 4LF4L 3HOVG 1X56A 2VZAA 4YWMA 2A1AA 4A4IA 3HOWG 1EWIA 3PUYA 4A3JG 4A3MG 1YEZA 1Y1VH 1L1OB 3UE1A 2HT1A 2Q2HA 1SFOH 1LTLA 5IP9G 2KCTA 2WAQG 1BBUA 2Y0SE 5GAGC 5IP9H 4ME3A 4HJAA 4AQYQ 4JI6L 4DR4L 2VS1A 2UXBL 4FDBA 2XTIA 1PHJA 4PG3A 1E22A 1WCMH 4A3IG 2Q2TA 2HHHL 2B63H 2R7ZG 4HIMA 2VNUD 1X65A 3CPFA 1N36Q 2JA5H 3KFUA 1N34Q 3DM3A 3HFZB 2Q2IA 2C35B 3GTQH 4GS3A 4EX5A 3ULJA 3F1ZA 4JI1Q 2VQEQ 1HZ9A 3DLLA 1XPRA 2GVBA 3M9BA 4DV1Q 4GKKQ 4WJ3M 1PH9A 1BKBA 5DLQE 4LFCQ 3PO2G 3PF4A 3K7AH 5IYBG 4LNQA 4GN5A 4GKJL 3J81j 4JI0L 1SRUA 4YCVA 2WB1E 4L5RC 3I4MG 4A3DG 3CCRA 1GM5A 2B63G 3GO5A 4A3KH 5LMUL 4DV7L 3UDIA 1TWGH 2A19A 4C3JH 2YU9H 1FGUA 1X3GA 4QY7A 1NE3A 3ULLA 4GOPA 1J5EQ 3AFPA 1KQSA 3H0GG 4BBRH 1UE5A 3PGZA 4IPGA 4OO1I 4HJ9A 1VQ6A 3U50C 3KF8B 5IY0A 3HOYG 5C44H 3PUXA 3HOUG 1N36L 4QJFA 4PZ7A 4LF6L 1CKNA 1YHBA 2VY3A 5IP7G 2K50A 1PVOA 1XMQL 4DV4Q 1KRSA 4QL5A 1XPOA 1J6QA 2YV5A 4MNOA 1B70B 4OX9Q 1FJGQ 3GTKH 3OTOQ 1Z47A 2RCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E0E A;  3J80 c;  1K83 H;  3G48 A;  3RN2 A;  1IBM Q;  3M3Y H;  4PZ8 A;  5GAD C;  1Q8K A;  3STB C;  3I4N G;  1VQE A;  2MO0 A;  4P72 A;  5IT9 c;  3L2P A;  3CP0 A;  2EXD A;  3BZC A;  4B3R L;  4L5Q A;  4Y52 H;  3CCS A;  4B3T L;  4JI7 L;  4A3D H;  1H95 A;  3AYH B;  1VQC A;  4IPC A;  4DR6 L;  1Q1E A;  2F4V L;  2YTV A;  1P8L A;  1X3E A;  3A0J A;  4DR2 L;  4JI2 L;  2IHE A;  3PO3 G;  4A3M H;  1GO3 E;  4TQU S;  3I2Z A;  1KIX A;  4NXM L;  1N33 L;  1RL2 A;  2CQO A;  4DUZ Q;  5C0X I;  3SGI A;  3CCE A;  4NB3 A;  1VQN A;  3FP9 A;  3GDE A;  4X64 Q;  4JI8 L;  1VQM A;  2JA8 H;  1HNZ L;  1G29 1;  5GQO A;  4X65 Q;  4OON A;  5IYC G;  1V43 A;  4X65 L;  2I5M X;  4C2M H;  1XJV A;  4A3G H;  1O7I A;  3LGJ A;  1CKM A;  5M3M H;  4IPH A;  1KC8 C;  1YNX A;  3JAM c;  2ATW A;  2LSS A;  1IBM L;  1Z9F A;  3T1H L;  1W3S A;  2EIF A;  2KEN A;  3OW2 A;  2DGY A;  3A5U A;  1P16 A;  1I50 H;  1N9W A;  3FKI H;  3PV0 A;  1MJC A;  2N8N A;  5IYD G;  4OXP A;  3HOW H;  3HOX G;  2RHQ B;  4JOI A;  4DR5 L;  2CCZ A;  3M7N A;  3CC2 A;  4JV5 Q;  2CFM A;  1IL2 A;  2KBN A;  5IWA Q;  2JEB I;  1HNX L;  3NBH B;  4JBJ A;  2QGQ A;  4KHP Q;  1PH7 A;  1K0R A;  1G51 A;  1D8L A;  1UWV A;  3E9H A;  3JAM i;  4KHP L;  4OO1 G;  4JI4 L;  3S2H H;  3M85 A;  1EIF A;  1YIJ A;  1EIY B;  4NXM Q;  5JJI A;  4GNX A;  4R4Q A;  1UE1 A;  4UY8 C;  4GLA C;  4IFD G;  4LFB Q;  3CCQ A;  5M3F H;  2UXD L;  4X62 Q;  2KHJ A;  1NBW A;  1VQO A;  2HIV A;  1A63 A;  4AIM A;  3GTP H;  4K0K L;  2K4K A;  3S1Q H;  3EN2 A;  1I3Q H;  4L5S A;  1XNR L;  4JI8 Q;  3J7A 5;  4IO9 A;  1HNW L;  5FJ8 H;  4DUY L;  4A3L H;  1JJG A;  1XMQ Q;  2JA9 A;  2R93 H;  4OX9 L;  4DV0 L;  4DV3 L;  5K36 G;  3OYY A;  2VUM H;  2XGT A;  3F2D A;  3KJP A;  1R9T H;  1PYB A;  1YBY A;  1K9M C;  4JI6 Q;  3JC6 6;  3S1R H;  3TRZ A;  1I5F A;  1D7Q A;  2HHH Q;  3KF6 A;  2PQA A;  5IWA L;  4HJ8 A;  1VQA A;  4DR6 Q;  5LMN L;  3RR5 A;  5C4X H;  3CMA A;  4A3F G;  4A3E G;  4A3E H;  4RG1 A;  3PF5 A;  4DR2 Q;  1AH9 A;  2K14 A;  1OXV A;  2V1C C;  3TRE A;  1EQR A;  3M4Q A;  1N32 Q;  1OTC A;  2UXC Q;  1QVF A;  2YYZ A;  4GOP B;  1QZG A;  1CSQ A;  3K8A A;  1K8G A;  2ES2 A;  2PMZ E;  1S40 A;  1FL0 A;  4YHH L;  4DV6 L;  1Y1W H;  3NEN A;  4DK6 C;  3RLF A;  4DR1 L;  1VQL A;  2UUB L;  4IJL A;  4H02 A;  4TVA B;  5M5X H;  1GVP A;  3T1Y Q;  1U0L A;  1YJW A;  1CSP A;  1HZB A;  2JA6 H;  4A3C G;  3RLN A;  4DV2 Q;  1S72 A;  2NZH A;  2ZTE A;  1M90 C;  4LF6 Q;  1TWC H;  3S15 H;  3S1N H;  1C9O A;  1N33 Q;  3CCU A;  3CC4 A;  1XNQ L;  3KDF A;  4P75 A;  2LXK A;  3H3V H;  4GOP C;  2JEA I;  2R92 G;  4A93 G;  3HKZ G;  5GRO A;  2A8V A;  2AHO B;  1BBW A;  1E24 A;  1PH3 A;  2VL6 A;  1B8A A;  4A3B G;  4DR3 Q;  4LWC A;  3S2D H;  1XMO L;  4DR5 Q;  4B3S L;  2E5L Q;  3RZO H;  4R1J A;  3AQQ A;  4AYB G;  4L5T A;  4POF A;  1IBL L;  1RIP A;  3A74 A;  3UE0 A;  3CCM A;  4LF9 L;  1JT8 A;  4ALP A;  4BY7 G;  2QA4 A;  3GTM H;  3H3V I;  5GAE C;  4JBM A;  4LFA L;  3H15 A;  2PI2 A;  3F2C A;  1N32 L;  3RNU A;  3PSI A;  2K5V A;  2VQE L;  1UEB A;  4DAY B;  4DK3 C;  1E1T A;  3EBE A;  4DV1 L;  4IFD I;  4C3H H;  3CC7 A;  1LM0 A;  4Y7N H;  1XPU A;  2MFI A;  1PFS A;  4JI3 Q;  2Z6K C;  3STB D;  3J80 i;  4P71 A;  2JE6 I;  5FLM H;  4XTC S;  2R6G A;  2PI2 E;  2R93 G;  2N49 A;  1EYG A;  3GTG H;  2JA7 G;  3S16 H;  3D0F A;  4BBS H;  1NJI C;  1X3F A;  1WFQ A;  1EUJ A;  1YI2 A;  5LMU Q;  2N3S A;  2NVT H;  4JBW A;  3CXC A;  1T9H A;  4UP8 A;  4BY7 H;  3KDF B;  1VQB A;  4DR4 Q;  2UXB Q;  4K0K Q;  1BVS A;  4R4T A;  2YTY A;  4AQY L;  4X66 L;  2Q2U A;  5HGQ A;  2FXQ A;  1ASY A;  4BY1 G;  3CW2 C;  3KLW A;  4LF9 Q;  1I94 Q;  4JCV E;  1I94 L;  2MQH A;  2WAQ E;  1SR3 A;  4LFA Q;  4APV A;  5C3E G;  5FLM G;  4DNI A;  5C3E H;  3MXN B;  1VQ8 A;  1WOC A;  1PH1 A;  2UUA L;  4JI4 Q;  1X6O A;  2N78 A;  4IOA A;  2R7D A;  1Q46 A;  2D0O A;  1X55 A;  5C0X G;  1Q7Y C;  1L1O A;  1CKO A;  3MEF A;  2GVA A;  2UU9 Q;  2OQ0 A;  4BA2 I;  1TWH H;  3D31 A;  3PUZ A;  4JV5 L;  4JYA L;  1I6H H;  3ULP A;  1Y1W G;  3NEM A;  1WI5 A;  4WJ4 A;  4GLV B;  3PCO B;  4XIG S;  4KHZ A;  5JJK A;  1HH2 P;  3ER0 A;  3U4V A;  4DV2 L;  1NMF A;  3RZD H;  3I4O A;  4JI2 Q;  4DV7 Q;  1VQP A;  4DUY Q;  1K8A C;  3L7Z C;  2ALY B;  1KAW A;  1VQG A;  3ZJY C;  4EQ5 A;  2ZM6 L;  1YJ9 A;  2UXC L;  3KJO A;  3E9I A;  4NXN L;  4LW1 A;  1PH8 A;  4NXN Q;  1A0I A;  1VQF A;  2R7F A;  3H0G H;  3J7Z C;  1N8R C;  3W1B A;  4DV6 Q;  1VQH A;  2B29 A;  2NVY H;  5FLX c;  3J81 c;  4DPG A;  3I55 A;  1SRO A;  4BBS G;  4BA1 I;  4X64 L;  1LYL A;  4YCW A;  2JA7 H;  3KOJ A;  3FKI G;  5IYD H;  3HKS A;  2BA1 A;  1PYS B;  2HIX A;  1V9P A;  2ID0 A;  1HR0 L;  4A3L G;  2IY5 B;  1X54 A;  2E2H H;  3I4M H;  4IPD A;  4HIK A;  1AE3 A;  1NTG A;  1K73 C;  5IYB H;  4IFD J;  4JI1 L;  1FJG L;  2BH8 A;  1PH5 A;  1TXY A;  3CCJ A;  1SE8 A;  4GLX A;  3PIP A;  4LF8 Q;  1KHI A;  4RMF A;  5GAH C;  1M1K C;  1A8V A;  4DR7 Q;  4BY1 H;  1SLJ A;  4JC0 A;  1PA6 A;  3G6E A;  4X6A H;  1E1O A;  2EQS A;  2NN6 G;  1Q81 C;  4A3G G;  3AEV A;  4JYA Q;  3U4Z A;  4DKA C;  1OXT A;  2E2J H;  4A3B H;  1UE6 A;  3HOY H;  3I7F A;  4JI0 Q;  3TEH B;  4OWT B;  4GN3 B;  1YVC A;  3K7U C;  3TQY A;  4B3M L;  4LUZ A;  3T1Y L;  5IE8 A;  2R92 H;  1QVC A;  4A3F H;  5C4X G;  4DAM A;  4A75 A;  4JI5 L;  1MJE A;  1B7Y B;  3L0O A;  1KD1 C;  1JJC B;  5JEA G;  3CME A;  2K52 A;  3PUW A;  5H1S E;  2JA6 G;  1ASZ A;  2LXJ A;  3GD7 A;  5J3B A;  1L0W A;  4HID A;  1JMC A;  1V1Q A;  3GTJ H;  3TS0 A;  1XMO Q;  1MIU A;  4GN4 B;  1EQQ A;  1Q82 C;  2I0Q A;  5M3M G;  4A3C H;  2IX1 A;  1YIT A;  1Y14 B;  4QIW E;  5HY6 A;  4A3K G;  3W1G A;  5IYC H;  2NVX H;  1SN8 A;  4O0A A;  3CCV A;  2BH2 A;  2ASB A;  3S1M H;  1VQ7 A;  4R4I A;  4BXX H;  2GN5 A;  4J15 A;  3BJU A;  2PNH A;  3BZK A;  1NMG A;  2VQF Q;  4QGU A;  3T1H Q;  4PMW A;  2F3I A;  3EIV A;  2ZJQ A;  4HJ7 A;  5C44 G;  2AWO A;  2KCM A;  3HOU H;  3FHW A;  3PIO A;  3VDY A;  4B3T Q;  5IP7 H;  1VCI A;  4JOI C;  4LFC L;  1QUQ B;  3PO3 H;  1JJ2 A;  2E2I H;  3HKZ E;  5LMN W;  4IOC A;  4YWK A;  1L1O C;  2H5X A;  2F4V Q;  1QUQ A;  1XTD A;  2OCE A;  5AJ3 L;  3S17 H;  2NVQ H;  1DGS A;  3B6Y A;  2VUM G;  3M4O H;  2ZTD A;  1PV4 A;  4JI5 Q;  4PZ6 A;  3M4P A;  4AYB E;  2ZM6 Q;  1W2B A;  2Z0S A;  1HR0 W;  3K0X A;  1IXR A;  4X62 L;  1K3R A;  1TWF H;  3PUV A;  4GKK L;  1YZ6 A;  3W5O A;  4LFB L;  1VQJ A;  5BR8 L;  2OWO A;  1GD7 A;  2UU9 L;  1SMX A;  1X9N A;  4LUV A;  3HOZ G;  2F52 A;  2WB1 G;  3CCL A;  1VQI A;  3NEL A;  3TS2 A;  2ZTC A;  2JJQ A;  2AMC B;  4YWL A;  2ZJP A;  3I56 A;  5M5W H;  1PH6 A;  1N34 L;  1AE2 A;  2OTL A;  2WFW A;  1VS0 A;  4DV3 Q;  1Q86 C;  4GNX B;  5EAY A;  3CD6 A;  2OTJ A;  3K80 C;  2MO1 A;  4UP9 A;  1XNQ Q;  4DV0 Q;  4YCU A;  4JG2 A;  1YHA A;  1J5E L;  1WYD A;  2UUC Q;  5M3F G;  2CKZ B;  3U58 A;  1E3P A;  1EFW A;  2UUC L;  4A93 H;  2AKW B;  2RF4 A;  3UDX A;  3GTL H;  2ZJR A;  4YY3 L;  2YTX A;  3IRB A;  2R7Z H;  1WCM G;  4A3I H;  4P74 A;  4B3S Q;  1HJP A;  4OWW B;  3ICE A;  2RHS B;  1KL9 A;  3F2B A;  2DUD A;  3WWV A;  3RN5 A;  2K5H A;  1IBL Q;  1CKN B;  4AH6 A;  2L15 A;  4DV4 L;  4B3M Q;  4GKJ Q;  1E7Z A;  4UP7 A;  1LUZ A;  3OTO L;  2AWN A;  1TWA H;  2D0P A;  2IHF A;  5C0X J;  2BA0 A;  3ERS X;  2Z6K A;  4LF5 Q;  1IBK L;  4NPS A;  1WJJ A;  3HOV H;  1HZA A;  3PO2 H;  2UXD Q;  1S3O A;  2K75 A;  1UE7 A;  4HJ5 A;  4DR7 L;  3S24 A;  4A3J H;  4QQB X;  1JE5 A;  1L2F A;  3A5Z B;  3J81 i;  1Q12 A;  1KRT A;  4YHH Q;  1OXU A;  4OWX B;  1A62 A;  3CPW A;  1VQ4 A;  1QVG A;  1HNW Q;  4KI0 A;  3BU2 A;  1U5K A;  2JA8 G;  5JEA J;  4UPA A;  3KF6 B;  4KLK A;  2MNA A;  1YHQ A;  2VW9 A;  1HR0 Q;  2B3G A;  1OXX K;  1PH4 A;  4DV5 L;  1QZH A;  4LF7 Q;  2JA5 G;  3AFQ A;  4DV5 Q;  5ELO A;  4LF7 L;  2HQL A;  1VQ9 A;  2CWP A;  3CAM A;  3CQZ H;  4R4O A;  4LUO A;  3F8T A;  3G4S A;  1HZC A;  3GTO H;  3HOZ H;  1G6P A;  2OQK A;  4HIO A;  5ELN A;  5M5Y H;  4MZ9 A;  4BXX G;  4YY3 Q;  1KXL A;  1Y1V G;  1EOV A;  4DR3 L;  2WP8 J;  4X66 Q;  5FJ8 G;  2JQO A;  3HOX H;  2E5L L;  4C3I H;  5JJL A;  2E8G A;  5LMN Q;  1VQK A;  1VQD A;  2NN6 I;  3RLO A;  4IJH A;  3K81 C;  2IX0 A;  5E7N A;  4MTN A;  3S14 H;  2QEX A;  2I5H A;  4LF5 L;  1MKH A;  1PH2 A;  2K5N A;  1Q1B A;  2VQF L;  1C0A A;  2Y0S G;  1IBK Q;  1C7Y A;  2UUA Q;  1VQ5 A;  3UDG A;  4POG A;  1FVI A;  3I4N H;  4LF8 L;  4DUZ L;  1YJN A;  4O2D A;  3G71 A;  1IYJ B;  2CWA A;  2NZO A;  5BR8 Q;  5C4J H;  4GNX C;  4A76 A;  4B3R Q;  4JI7 Q;  3Q8D A;  1HNX Q;  2PQA B;  4DR1 Q;  2D62 A;  2JK8 A;  4P73 A;  4JI3 L;  3CF5 A;  2UUB Q;  2I5L X;  1GKH A;  1CUK A;  4BBR G;  5AJ3 Q;  4R4C A;  1JB7 A;  4JBK A;  1XNR Q;  1OXS C;  2KHI A;  1NY4 A;  3KYH C;  4LF4 Q;  3UDF A;  1HNZ Q;  1IZ6 A;  2IT1 A;  4LF4 L;  3HOV G;  1X56 A;  2VZA A;  4YWM A;  2A1A A;  4A4I A;  3HOW G;  1EWI A;  3PUY A;  4A3J G;  4A3M G;  1YEZ A;  1Y1V H;  1L1O B;  3UE1 A;  2HT1 A;  2Q2H A;  1SFO H;  1LTL A;  5IP9 G;  2KCT A;  2WAQ G;  1BBU A;  2Y0S E;  5GAG C;  5IP9 H;  4ME3 A;  4HJA A;  4AQY Q;  4JI6 L;  4DR4 L;  2VS1 A;  2UXB L;  4FDB A;  2XTI A;  1PHJ A;  4PG3 A;  1E22 A;  1WCM H;  4A3I G;  2Q2T A;  2HHH L;  2B63 H;  2R7Z G;  4HIM A;  2VNU D;  1X65 A;  3CPF A;  1N36 Q;  2JA5 H;  3KFU A;  1N34 Q;  3DM3 A;  3HFZ B;  2Q2I A;  2C35 B;  3GTQ H;  4GS3 A;  4EX5 A;  3ULJ A;  3F1Z A;  4JI1 Q;  2VQE Q;  1HZ9 A;  3DLL A;  1XPR A;  2GVB A;  3M9B A;  4DV1 Q;  4GKK Q;  4WJ3 M;  1PH9 A;  1BKB A;  5DLQ E;  4LFC Q;  3PO2 G;  3PF4 A;  3K7A H;  5IYB G;  4LNQ A;  4GN5 A;  4GKJ L;  3J81 j;  4JI0 L;  1SRU A;  4YCV A;  2WB1 E;  4L5R C;  3I4M G;  4A3D G;  3CCR A;  1GM5 A;  2B63 G;  3GO5 A;  4A3K H;  5LMU L;  4DV7 L;  3UDI A;  1TWG H;  2A19 A;  4C3J H;  2YU9 H;  1FGU A;  1X3G A;  4QY7 A;  1NE3 A;  3ULL A;  4GOP A;  1J5E Q;  3AFP A;  1KQS A;  3H0G G;  4BBR H;  1UE5 A;  3PGZ A;  4IPG A;  4OO1 I;  4HJ9 A;  1VQ6 A;  3U50 C;  3KF8 B;  5IY0 A;  3HOY G;  5C44 H;  3PUX A;  3HOU G;  1N36 L;  4QJF A;  4PZ7 A;  4LF6 L;  1CKN A;  1YHB A;  2VY3 A;  5IP7 G;  2K50 A;  1PVO A;  1XMQ L;  4DV4 Q;  1KRS A;  4QL5 A;  1XPO A;  1J6Q A;  2YV5 A;  4MNO A;  1B70 B;  4OX9 Q;  1FJG Q;  3GTK H;  3OTO Q;  1Z47 A;  2RCN A; 
#chains in the Genus database with same CATH topology
 2AQ1 B;  1UAP A;  1IBM Q;  1K83 H;  2EY1 A;  3LWU A;  2WB1 B;  3RN2 A;  3M3Y H;  3NWT A;  1VQE A;  5IGE A;  2B2T C;  3BZC A;  4Y52 H;  3CCS A;  4IUV A;  1DCZ A;  4JK1 C;  3GV6 A;  4EGV A;  4IPC A;  3K5N A;  1Q1E A;  2F4V L;  2YTV A;  5JVG 3;  4NDX A;  1P8L A;  4DR2 L;  1JB3 A;  2EPB A;  2B8F A;  1DM0 B;  1GUT A;  1JC7 A;  1GO3 E;  4DFA A;  4NXM L;  2CQO A;  4G4K A;  2F4I A;  5M5W B;  5CR3 A;  1SSO A;  1XWE A;  3OOC A;  2KED A;  1VQN A;  1DOK A;  3SHL A;  4TRD A;  3HOX B;  3S1N B;  1VQM A;  1KNA A;  4JPB W;  1PTO F;  1G29 1;  3GTM B;  1V43 A;  1BCP D;  4C2M H;  3MFG A;  1XJV A;  4DU9 A;  3J81 L;  1SE4 A;  3JAM c;  1CQV A;  2EIF A;  2B2U A;  2XRQ D;  1I50 H;  4OXP A;  4DR5 L;  2RHQ B;  3KLS A;  3EJI A;  4JV5 Q;  2CFM A;  4GZY C;  4CDF C;  5IWA Q;  1D8L A;  1G51 A;  3JAM i;  3LX0 A;  4OO1 G;  3S2H H;  1YIJ A;  1EIY B;  4J8Q A;  3J80 E;  4GNX A;  2LFN A;  4IFD G;  2NN6 H;  4CDE C;  4X62 Q;  3ITP A;  3SK5 A;  3HOW B;  1NBW A;  3GTP H;  2K4K A;  1I3Q H;  2JA7 B;  1XNR L;  1LTA D;  2AQ2 B;  4G57 A;  1B53 A;  3W3A A;  1XMQ Q;  2JA9 A;  5K36 G;  3D4R A;  1HA5 A;  1JWS D;  1B9N A;  1C48 A;  2X6G A;  4IN3 A;  1U4M A;  1R9T H;  1YBY A;  2Z8L A;  4JI6 Q;  4EQO A;  3TRZ A;  3DEO A;  4B9X A;  4H44 C;  2HHH Q;  2XIW A;  3CMA A;  4A3F G;  4A3E H;  4RG1 A;  2EJG C;  1RHP A;  1WVL A;  1ROD A;  1SYD A;  1EQR A;  4A3G B;  2FFK B;  1B4O A;  5NUC A;  4GOP B;  1QZG A;  3K8A A;  2K5Q A;  1S40 A;  5IGC A;  1QCB D;  2EY6 A;  2J0T D;  4N8X 1;  4C3H G;  2JA6 H;  3T1Y Q;  1RKN A;  1HZB A;  4A3C G;  4FP5 D;  4S3S A;  1S72 A;  2NZH A;  2ZTE A;  1TWC H;  1C9O A;  3D3R A;  4CJ0 B;  5IGG A;  4P75 A;  4GOP C;  1EYA A;  1M8A A;  1PYW D;  1XYI A;  4X3S A;  5GRO A;  4QCL A;  4DK1 A;  2AHO B;  1BBW A;  1DXM A;  1E24 A;  1HUM A;  4KKT A;  2M00 A;  3C1F A;  4ZUJ A;  1LT3 D;  4HMI A;  3IKJ A;  1IBL L;  3HZX A;  3UE0 A;  3CCM A;  1QOH A;  3QO2 A;  1A15 A;  3M4O B;  1N32 L;  1UEB A;  3VYT A;  4DAY B;  5ELB A;  1I6V C;  4IFD I;  4YIJ A;  4JI3 Q;  5TSS A;  2Z6K C;  1PFM A;  4CHT B;  5IOD A;  3GTG B;  5FLM H;  4XTC S;  2R6G A;  3GTG H;  1ZYR D;  3D0F A;  5E3F A;  1TY0 A;  2EYP A;  1WFQ A;  3CXC A;  4FNF A;  1OO9 B;  4DR4 Q;  3FPP A;  4X66 L;  2Q2U A;  4G7H C;  1LT6 D;  2E2I B;  1MI2 A;  3CW2 C;  1CHP D;  3KLW A;  1I94 Q;  1LT4 D;  4JCV E;  1I94 L;  1DOM A;  2K03 A;  1X6O A;  2F0H A;  2R7D A;  1Q46 A;  4OEL B;  1Q7Y C;  1SNP A;  1L1O A;  5I2X A;  2A73 B;  1TWH H;  3D31 A;  3DM1 A;  4JV5 L;  1I6H H;  3ULP A;  4WJ4 A;  4GLV B;  3IFT A;  4KHZ A;  1WTP A;  3ER0 A;  4DV2 L;  2LY7 A;  4JI2 Q;  4DV7 Q;  3H3V C;  4DUY Q;  2ALY B;  1YJ9 A;  3ZJY C;  2ZM6 L;  2FMC A;  4LW1 A;  3I73 A;  3H0G H;  3J7Z C;  3OSO A;  2R92 B;  3FDT A;  3W1B A;  1UUP A;  3HKZ B;  1VQH A;  2B29 A;  4L6T B;  5AFW A;  2KA7 A;  3CKI B;  4DPG A;  3I55 A;  1SRO A;  2B2U C;  4YCW A;  2JA7 H;  3FKI G;  2HIX A;  1HR0 L;  2ID0 A;  3OIQ A;  1JCK B;  1S5F D;  1HTP A;  4JI1 L;  1FJG L;  4RA8 A;  1J8I A;  1WTO A;  3K59 A;  1TXY A;  2SDF A;  3PIP A;  4DR7 Q;  1JE4 A;  4BY1 H;  4JC0 A;  1EEI D;  3T13 A;  3U4Z A;  4A3B H;  3HOY H;  2Z4I A;  1IYU A;  2OT2 A;  5IE8 A;  2A6E C;  2JP1 A;  4JI5 L;  3VR3 A;  1O7L A;  1KD1 C;  1JJC B;  2NB0 A;  4OIJ A;  2X6L A;  1XMO Q;  1Q82 C;  2KCC A;  1EQQ A;  5M3M G;  1Y14 B;  4QIW E;  3J7Y W;  3CCV A;  3PO2 B;  2BH2 A;  3S1M H;  3M7G A;  1VQ7 A;  4BXX H;  4J15 A;  3BJU A;  1NMG A;  3MFY A;  4QGU A;  2XSC A;  4KY7 A;  2F3I A;  3R2I A;  3DMU A;  3HP3 A;  2NTT A;  5C44 G;  1RTO A;  3VDY A;  4LFC L;  1X3P A;  1WTR A;  2VB3 X;  1JJ2 A;  5KND A;  2F4V Q;  2F0E A;  4ZKB B;  2OCE A;  2EY5 A;  1ILP A;  2F0I A;  3K7A B;  3Q0A A;  1IW7 C;  3KUP A;  1PTO H;  2VUM G;  2ZTD A;  3M4P A;  3P75 A;  3K0X A;  1LAB A;  1K3R A;  2RDG A;  4CDD C;  1ESR A;  2PW5 A;  1CI3 M;  3KBX A;  2UU9 L;  3OWE B;  1EZ8 A;  2WB1 G;  4XQJ A;  4V19 0;  3TS2 A;  2WIN B;  3NEL A;  4YWL A;  2ZJP A;  1ET6 A;  5E4W C;  3C3L A;  3I56 A;  2ICE C;  1PH6 A;  1N34 L;  2Q8T A;  3OWF A;  3EVQ A;  1BBX C;  1L0X B;  2V4D A;  2F0V A;  2MO1 A;  3R93 A;  5CGK A;  1TU2 B;  2WAQ B;  1XNQ Q;  1RJT A;  1TWG B;  2PO4 A;  1TVX A;  4M1U B;  5ELC A;  3BYY B;  1EFW A;  1Z6H A;  4A93 H;  2AKW B;  2RF4 A;  4C3H B;  2ZJR A;  4ZLT F;  3FMC A;  1HJP A;  4B3S Q;  3ICE A;  2RHS B;  4C1N I;  3RN5 A;  4AH6 A;  4DV4 L;  1G6Z A;  4UP7 A;  1LUZ A;  4C3J G;  4LF5 Q;  3ERS X;  5CV6 A;  1IBK L;  4NPS A;  2F0O A;  1Y8O B;  1JE5 A;  4JW0 A;  2HCC A;  3L9A X;  1KRT A;  1OXU A;  4YHH Q;  3AMU A;  3C1E A;  5JEA J;  2PZT A;  2B3G A;  4LF7 Q;  1LLR D;  3AFQ A;  4LF7 L;  2HQL A;  3I90 A;  3TN2 A;  1VQ9 A;  1K83 B;  3GTO H;  4LUO A;  3HS0 C;  3HOZ H;  1G6P A;  4HIO A;  2K1B A;  4BXX G;  2CVR A;  3A55 A;  1KXL A;  1SE3 A;  1Q3L A;  2E5L L;  1C4Q A;  4Q0F A;  1VQK A;  1VQD A;  1Y69 U;  1B50 A;  1PTO C;  4KV6 A;  1PRT D;  1MKH A;  4XDX A;  1LTT D;  2UUA Q;  4POG A;  3UDG A;  3T4A C;  2B2T A;  1YJN A;  1F9R A;  2BDO A;  1SBB B;  2XNA C;  1IYJ B;  2CWA A;  2NZO A;  5BR8 Q;  5K5P A;  1HFN A;  3SK8 A;  4ZYS A;  1R9T B;  2B39 A;  1HNX Q;  1KNE A;  2AUK A;  3CF5 A;  4JBK A;  2RCF A;  2EDG A;  1NY4 A;  4LF4 Q;  3UDF A;  1HNZ Q;  5IGD A;  4LF4 L;  4CKB A;  1LTR D;  2EZV A;  5KNC A;  4YWM A;  3HOW G;  2A1A A;  4A3J G;  1U9R A;  2Q2H A;  1SFO H;  3A8J E;  2WAQ G;  1BBU A;  4ZKC B;  4AQY Q;  2UXB L;  1IHZ A;  1PHJ A;  4PG3 A;  2B63 H;  3TP6 A;  2VNU D;  3NPP A;  3CPF A;  2JA5 H;  1V8Q A;  3ND9 A;  4GS3 A;  1B2T A;  3KLR A;  5C6A A;  1BF4 A;  5ELD A;  4FF3 A;  2RDF A;  1EY6 A;  1HZ9 A;  4N8F A;  2GVB A;  2F1M A;  4GKK Q;  1AW7 A;  1EU3 A;  4IAL A;  1TS4 A;  5DLQ E;  4LFC Q;  1T5X D;  5IYB G;  4LNQ A;  3J81 j;  2O5J C;  2WB1 E;  1R4Q B;  4NMZ A;  2B63 G;  2A68 C;  3TP7 A;  3UDI A;  1TWG H;  1FGU A;  4QY7 A;  3ULL A;  4A3J B;  2B2W A;  1J5E Q;  3AFP A;  3N52 A;  1S5C D;  2A6H C;  2R3Z A;  1EY5 A;  1VQ6 A;  4K5V A;  3HOU G;  3PUX A;  5D3D A;  4KN4 C;  1A6X A;  4LF6 L;  2F0P A;  1CKN A;  5IP7 G;  1TWC B;  4XT3 B;  1RD9 D;  5T1I A;  1J6Q A;  2YV5 A;  4OX9 Q;  1B70 B;  3GTK H;  3TDQ A;  2RCN A;  4QMG A;  1SAP A;  4RKB A;  3J80 c;  4PZ8 A;  4RKL A;  4O42 A;  1O7Z A;  1B9M A;  2KUM A;  2MO0 A;  1EOT A;  4P72 A;  5IT9 c;  5KNB A;  3NQT A;  2EXD A;  4B3R L;  5EKI A;  2C5C A;  4A3D H;  4DR6 L;  1CQF A;  3A0J A;  1X3E A;  2FHT A;  4JI2 L;  3PO3 G;  1KIX A;  4DUZ Q;  3SGI A;  4DA2 A;  1D5M C;  3ONA B;  3FP9 A;  4CKE A;  4RCO A;  1D5Z C;  2D2C C;  3I70 A;  3S17 B;  4DF7 A;  1TT2 A;  1SNO A;  5IYC G;  4A3G H;  1VF5 C;  1CKM A;  2QIL A;  4IPH A;  1B1Z A;  4J6H A;  5M3M H;  1KC8 C;  2ATW A;  3GTO B;  1W3S A;  2KEN A;  2DGY A;  3A5U A;  1CZW A;  1I4G A;  2PYK A;  1N9W A;  3FKI H;  2PMZ B;  2N8N A;  5IYD G;  3HOW H;  4JOI A;  2CCZ A;  1RDP D;  3J81 E;  3OTO Q;  2SOB A;  2MHV A;  5M9O A;  5E4X A;  1UWV A;  4JI4 L;  3M85 A;  1EIF A;  5JJI A;  3HEJ A;  1MGS A;  4IFD H;  4GLA C;  3NBI A;  2KHJ A;  3CRL C;  2HIV A;  1A63 A;  2Q8I B;  5EKL A;  4KY6 A;  1U4P A;  1D2B A;  4L5S A;  1JOQ A;  2HCI A;  4JI8 Q;  2F0W A;  1HNW L;  3I4L A;  2QCP X;  4DV0 L;  4DV3 L;  3OYY A;  2VUM H;  3E0J A;  3K5L A;  2XGT A;  4I7A A;  1NUC A;  5DEH A;  4KJO A;  2ZXP A;  1K9M C;  3JC6 6;  3S1R H;  2K28 A;  4TKO B;  3IL8 A;  1I5F A;  3FVQ A;  4XYO A;  1KDA A;  3TBI B;  1VQA A;  2HDL A;  5LMN L;  2IPK D;  5EGT A;  4A3E G;  3L3O C;  3PF5 A;  1PRT B;  1SMY C;  2K14 A;  3TRE A;  1N32 Q;  1OTC A;  2UXC Q;  4A3D B;  5T1G A;  2YYZ A;  2EE1 A;  4O1N A;  1S5E D;  5CMD A;  2BDN A;  1FL0 A;  1SYG A;  4DV6 L;  3NEN A;  3EQL C;  1HFG A;  4DR1 L;  1VQL A;  2E2J B;  2J4X A;  1CTM A;  3HGB A;  1U4R A;  1GVP A;  3P7J A;  3RLN A;  2RA4 A;  2TSS A;  3BVZ A;  1XNQ L;  4A93 G;  2R92 G;  1NCV A;  3MA2 B;  2A8V A;  3K5O A;  2VL6 A;  1B8A A;  4OGQ C;  4DR3 Q;  4B3S L;  4FF4 A;  3KLS X;  2R93 B;  5I6Y A;  1KAB A;  2N88 A;  2OF1 A;  5CBE E;  2NZ1 D;  2B2V C;  1KDB A;  4C2M B;  1JQY D;  3GTM H;  1BOS A;  1GHJ A;  3TME A;  4JBM A;  3H15 A;  2PI2 A;  1MD2 D;  3TSS A;  2NTS A;  3RNU A;  3MTS A;  2K5V A;  3MVV A;  1CHQ D;  2Z4H A;  3CC7 A;  1LM0 A;  4J1M A;  4Y7N H;  2RSN A;  1XPU A;  3H6M A;  4P71 A;  2JE6 I;  4RWS C;  1WTX A;  5HGT A;  2PI2 E;  3S16 H;  3JAM E;  3BS1 A;  1YI2 A;  2LKV A;  2MUY A;  4ZCK A;  4UP8 A;  2Y0S B;  5HUR A;  4R4T A;  2YTY A;  1STY A;  2FXQ A;  3RUZ A;  4Y7N B;  3M4Y A;  3RD4 A;  1HHV A;  3QG1 A;  4LF9 Q;  1G8Z D;  4C56 C;  1F77 A;  1WD1 A;  4LFA Q;  4APV A;  4DN4 M;  5C3E H;  1WOC A;  2UUA L;  1VMC A;  3Q23 A;  5G3L D;  5C0X G;  4RGT A;  1ZXT A;  1CKO A;  3MEF A;  2GVA A;  4BA2 I;  1Y1W G;  1SJH D;  2O2L D;  1WI5 A;  1QB5 D;  3S9W A;  5JJK A;  1FNU A;  3GV3 A;  1NMF A;  1RTN A;  1K8O A;  1CZG A;  1AEX A;  3E9I A;  1JOO A;  2B2W C;  4N9P A;  5C3E B;  2IX3 A;  1SFO B;  1MBY A;  2SNM A;  3ERO A;  3IFD A;  2EOT A;  3R8B A;  4LMQ D;  3J81 c;  4IZ8 A;  4BBS G;  4X64 L;  1LYL A;  2PPB C;  3K57 A;  2ICI A;  2BA1 A;  4A3L G;  1Z7T A;  1X54 A;  4IPD A;  1AE3 A;  4IFD J;  2Z1C A;  2EYL A;  2Q8R E;  1M1K C;  1A8V A;  1GJX A;  3G6E A;  2EQS A;  3SVM A;  4B3M L;  4OWT B;  3TQY A;  4LUZ A;  3T1Y L;  4A3F H;  3S1Q B;  1TR5 A;  1B7Y B;  4EVO A;  1RCV D;  1SNC A;  5JPN C;  2KVM A;  5JEA G;  3CME A;  3PUW A;  5FLX L;  2JA6 G;  1DJR D;  4HID A;  1V1Q A;  2K04 A;  2KOL A;  2LMC B;  5EPL A;  1I6H B;  2EYF A;  3W2D A;  2ASB A;  4R4I A;  1W6K A;  2GN5 A;  3E3X A;  3MZ5 A;  5CV7 A;  2VQF Q;  3MWY W;  3T1H Q;  4PMW A;  3V96 A;  1SJE D;  2F0D A;  2ZJQ A;  2AWO A;  2KCM A;  3FHW A;  1SDF A;  2B2V A;  1DON A;  5IP7 H;  1VCI A;  1QUQ B;  2E2I H;  3HKZ E;  2H5X A;  1NAP A;  1J9O A;  5AJ3 L;  5DNF A;  2A69 C;  2NVQ H;  1DGS A;  1PRT C;  4F8M A;  1PMR A;  1X3Q A;  4PZ6 A;  2BCO A;  1VDZ A;  5I9P A;  4X62 L;  3PUV A;  3DEP A;  4HN7 A;  4LFB L;  1VQJ A;  1PXU A;  1DOL A;  2FJ2 A;  2F52 A;  4FVM A;  3CRK C;  4K8I A;  4L63 B;  2CHB D;  2AMC B;  1EIG A;  1WD0 A;  2MJ8 A;  5M5W H;  2OTL A;  3A8I E;  4G7O C;  3NSW A;  4R8I A;  5EAY A;  4QF4 A;  4YCU A;  2YU9 B;  2X69 A;  1EWH A;  2VUM B;  2O4X A;  3TP5 A;  1ZKO A;  3U58 A;  1E3P A;  3UDX A;  5L37 A;  4DGZ A;  4HSP A;  1KL9 A;  4K2K A;  3GQB A;  3WWV A;  5JPM C;  4HED A;  1GUO A;  4GKJ Q;  2IWH A;  3OW7 A;  1F2Z A;  1TWA H;  2IHF A;  1ILQ A;  4DK0 A;  2Z6K A;  1JR0 D;  2A74 C;  1UE7 A;  4DR7 L;  3S24 A;  4NW2 A;  4BY1 B;  2HDM A;  3A5Z B;  4RGN A;  2RSO A;  3S1M B;  2H1E A;  1EYD A;  4OWX B;  3SR1 A;  1VQ4 A;  3TZD A;  1BDO A;  1EY4 A;  5I6W A;  1HNW Q;  4KI0 A;  4HAE A;  4UPA A;  1HR0 Q;  4KLK A;  3NTI A;  1YHQ A;  4DV5 L;  1QZH A;  5FO9 B;  4DV5 Q;  4KJN A;  2EY2 A;  3CAM A;  3G4S A;  1HZC A;  1IKL A;  2CQA A;  3H91 A;  3P20 A;  4MZ9 A;  1EOV A;  5LL6 X;  3HOX H;  5G3L F;  4C3I G;  5JJL A;  5LMN Q;  2L0C A;  2NN6 I;  5E7N A;  5COY A;  4OEM B;  2I5H A;  2N55 A;  3I4N B;  2Y0S G;  1C7Y A;  1YNN D;  1GXD C;  2XRS D;  1B44 D;  2ZT9 C;  2BE5 C;  4FF1 A;  1H9S B;  2D62 A;  2G9H D;  2JK8 A;  3Q6S A;  4DR1 Q;  2I5L X;  1GKH A;  4BBR G;  1YNN C;  3VYS A;  1NNX A;  1EY7 A;  2KHI A;  2IT1 A;  1E2V A;  5M3M B;  1EWI A;  4MIU A;  5J1Z A;  4A3M G;  1Y1V H;  2RQX A;  2M2L A;  5I4D A;  2F0Q A;  3BYT B;  3NQI A;  1VMP A;  4U67 3;  5IT9 E;  2Y0S E;  4FXG C;  2XTI A;  4A3I G;  1HQR D;  4I65 A;  3MXU A;  1X65 A;  1A3T A;  3I72 A;  4HIM A;  3KFU A;  1N34 Q;  2CH4 W;  3PMF A;  1NSN S;  4C3I B;  4EX5 A;  4KHV A;  3I8Z A;  3J7A F;  4ODG A;  1SXT A;  2NVY B;  3CQZ B;  4A93 B;  3LWE A;  2F0S A;  3UI2 A;  5FKA C;  1CA6 A;  2F0F A;  5I2Y A;  4GN5 A;  4KD4 A;  4IUT A;  1SRU A;  3HOZ B;  4A3D G;  3SEB A;  2KEC A;  3CCR A;  1ENC A;  1GM5 A;  4AYB B;  5KRU A;  4HMJ A;  3GTK B;  2XN9 C;  4WFN 3;  4C3J H;  1X3G A;  3RZO B;  3MXN A;  3H0G G;  1UE5 A;  4OO1 I;  2L55 A;  5C44 H;  4DXF A;  1N36 L;  2SNS A;  4PZ7 A;  5A35 A;  1YHB A;  4B9W A;  1PVO A;  4QUC A;  1G91 A;  4ZAI A;  4DV4 Q;  1KRS A;  3A8K E;  2QF7 A;  4MNO A;  4QL5 A;  2RDH A;  1XMQ L;  1FJG Q;  2JA6 B;  3M3Y B;  3G48 A;  3H0G B;  3MHB A;  4CBV A;  5GAD C;  3CP0 A;  4K5X A;  4WOR A;  4BY7 B;  5EBD A;  4L5Q A;  4B3T L;  4OL7 A;  4JI7 L;  4ZK9 B;  4KN7 C;  2F0U A;  3AYH B;  3BG3 A;  3MAQ A;  4XQN A;  3HOU B;  2DNC A;  1G2T A;  2IHE A;  4A3M H;  2A69 D;  3I2Z A;  3SDZ A;  3K58 A;  1N33 L;  1PDQ A;  3NWS A;  3NK9 A;  3C2P A;  1BXT A;  1SEB D;  3CCE A;  1NR4 A;  2JA5 B;  3NHH A;  1H9K A;  2L4N A;  4NKL A;  2FIN B;  3GDE A;  4X64 Q;  3QOL A;  4JI8 L;  1F2M A;  2JA8 H;  1MSH A;  1HNZ L;  2OXP A;  5EPJ A;  1Y1V B;  4OON A;  2I5M X;  3HG9 A;  1QG7 A;  4MHE A;  1Z9F A;  3D8G A;  3PO3 B;  3HRZ C;  1PRT F;  3D4W A;  3BDO A;  1P16 A;  1HTL D;  3FRP B;  1I4H A;  1MJC A;  1IW7 D;  3HOX G;  2EVB A;  3CC2 A;  1IL2 A;  1HNX L;  4JBJ A;  2QGQ A;  4K6L A;  3KK7 A;  1PH7 A;  4UDU C;  5JEA H;  2B8G A;  4G7Z C;  1BQQ T;  3F2U A;  1UE1 A;  3R2T A;  2UXD L;  2NBF A;  4K0K L;  1HCZ A;  4IO9 A;  1DYQ A;  1HQM C;  1LAC A;  4A3L H;  2R93 H;  5ISR A;  4H0L C;  3F2D A;  3KJP A;  2VB2 X;  3LNN A;  1PYB A;  1EZ6 A;  3KF6 A;  1PZI D;  3RR5 A;  5C4X H;  1JWM D;  2WKD A;  4DR2 Q;  1AH9 A;  1OXV A;  2V1C C;  3M4Q A;  3R3O A;  3T56 B;  1LT5 D;  2K5D A;  4HSV A;  3VR6 A;  3OMG A;  2ES2 A;  4RAU C;  4YHH L;  1Y1W H;  1SND A;  4DK6 C;  4OO1 H;  2EYM A;  3RZD B;  1EIH A;  4H02 A;  4TVA B;  1HPC A;  1CSP A;  3E5S A;  4DV2 Q;  1M90 C;  4LF6 Q;  3S15 H;  3QOJ A;  3Q24 A;  3S1N H;  3S16 B;  3VYR A;  3CC4 A;  3H3V H;  4XYQ A;  2JEA I;  1BUV T;  1KTK A;  4K6D A;  4K5W A;  4BBR B;  1CA5 A;  3EFX D;  4DR5 Q;  2F03 A;  2E5L Q;  4R1J A;  1TS2 A;  4L5T A;  1F2L A;  1ML0 D;  4POF A;  3A74 A;  4LF9 L;  4ALP A;  2AUJ D;  1PFN A;  3RMH A;  5GAE C;  4LFA L;  3F2C A;  1I4Q A;  2VQE L;  1EQT A;  3MXP A;  2PQE A;  3BVG A;  1E1T A;  3EBE A;  4DV1 L;  4LJZ C;  4ZUI A;  1JWU D;  2MFI A;  2R61 A;  4A3B B;  5C4X B;  1L0Y B;  2R93 G;  4R9W A;  2N49 A;  4RH6 A;  1SNQ A;  1Q90 A;  3VA7 A;  1EUJ A;  4JBW A;  3KDF B;  2UXB Q;  1BVS A;  3VA5 A;  1ASY A;  4BY1 G;  5A2Q E;  2ZXO A;  2MQH A;  5C3E G;  5FLM G;  4DNI A;  3MXN B;  1GOZ A;  3T53 B;  1SYC A;  4DAY A;  4JI4 Q;  2N78 A;  4IOA A;  1I4R A;  1X55 A;  3NTK A;  4ID6 A;  4TSS A;  3NEM A;  3PCO B;  3C46 A;  1HH2 P;  2XWJ B;  3U4V A;  3RZD H;  1E2W A;  2NVX B;  2I46 A;  3X3N A;  4FXK C;  1VQG A;  4EQ5 A;  2UXC L;  3KJO A;  2RVL A;  2IW3 A;  1K0S A;  1VQF A;  4DV6 Q;  4IUN A;  2WKC A;  4RGM A;  5IYD H;  3KOJ A;  3HKS A;  1V9P A;  2NWG A;  3VYU A;  2IY5 B;  5COR A;  4ZQ3 A;  1NTG A;  2DN8 A;  4V0B A;  5IYB H;  4LF8 Q;  1GUS A;  4RMF A;  4JYA Q;  3FPU B;  4DKA C;  1OXT A;  1UE6 A;  3I7F A;  4GN3 B;  4MN3 A;  2R92 H;  2A6H D;  4RHR A;  1QIL A;  1MJE A;  1H9M A;  3L0O A;  1PZK D;  1D5X C;  4BWG B;  1S5B D;  5H1S E;  1ASZ A;  3QIA A;  1CT1 D;  1F2Y A;  1I3Q B;  1S4Z A;  2LXJ A;  5J3B A;  1JMC A;  5C3W A;  1F9P A;  3GTJ H;  1B3A A;  1MIU A;  4GN4 B;  4PV1 C;  2XVS A;  4Q5V A;  2IX1 A;  1YIT A;  4A3K G;  5HY6 A;  3S2D B;  3AU7 A;  2NVX H;  1SN8 A;  4O0A A;  2VXW A;  3CU7 A;  2QDB A;  2PNH A;  3BZK A;  3URY A;  5A2Q L;  2EYO A;  5CBA E;  3D6C A;  4JVZ A;  2LS0 1;  3PIO A;  3V05 A;  4HTH A;  1BO0 A;  4B3T Q;  4JOI C;  5KEE A;  5CV8 A;  3PIP 3;  5LMN W;  1QUQ A;  5FO8 B;  1Y8N B;  4ABN A;  3S17 H;  4KKS A;  2E76 C;  3B6Y A;  3SXH A;  3M4O H;  1PV4 A;  5M3F B;  2ZM6 Q;  1W2B A;  1HR0 W;  1IXR A;  1TWF H;  3A7A B;  1MSG A;  1YZ6 A;  4CGY B;  3BDC A;  5BR8 L;  2OWO A;  1GD7 A;  3N6R A;  3DWQ A;  2F0K A;  1X9N A;  4XQQ A;  3HOZ G;  4EQP A;  3CCL A;  1VQI A;  1LTB D;  2JJQ A;  5FK9 C;  2E74 C;  1AE2 A;  5C5L A;  2WFW A;  1IKM A;  4DV3 Q;  1Q86 C;  3CD6 A;  3K80 C;  1AZQ A;  3K6O A;  4JG2 A;  4C3J B;  4DXG A;  2CKZ B;  1AP0 A;  2YTX A;  2R7Z H;  1A3V A;  3I91 A;  4A3I H;  1PTO B;  1X32 A;  1XTC D;  1V1P B;  2K5H A;  3U9S A;  4CDC C;  1E7Z A;  3OTO L;  2A68 D;  2D0P A;  1IYV A;  2WV6 D;  2BA0 A;  1I4X A;  1WJJ A;  3PIO 3;  3HOV H;  2UXD Q;  1S3O A;  3T16 A;  4HJ5 A;  2DY8 A;  4OHJ A;  1L2F A;  5DM7 3;  1QE6 A;  1VF7 A;  3J81 i;  5IGF A;  1Q12 A;  3S1R B;  1A62 A;  3CPW A;  4L8J A;  1PLF A;  2L5T A;  2KCN A;  1STH A;  2JXM B;  1U5K A;  3BU2 A;  5KYL A;  2JA8 G;  3KF6 B;  2MNA A;  2VW9 A;  1OXX K;  1STG A;  1FNW A;  3V2T A;  2JA5 G;  3CQZ H;  3F8T A;  4PMB A;  1EY8 A;  3NTH A;  5ELN A;  5M5Y H;  1ZYR C;  4YY3 Q;  1Y1V G;  1ONL A;  1MHW C;  4C3I H;  1XX8 A;  2E8G A;  5LHY 1;  3SK6 A;  1EY9 A;  2IX0 A;  3K81 C;  5CYU A;  3S14 H;  2QEX A;  5EQ0 A;  5LL6 S;  1V1P A;  2F0M A;  2F3W A;  2ENB A;  1ESF A;  2VQF L;  1VQ5 A;  5C4Z A;  4LF8 L;  3O13 A;  4NP5 A;  1STE A;  2QKI C;  2EXZ A;  4KY5 A;  5C4J H;  4GNX C;  4A76 A;  4B3R Q;  4WRD A;  4ULL A;  3Q8D A;  2PQA B;  4JI3 L;  2OTJ A;  3I4M B;  2E2H B;  5AJ3 Q;  1JB7 A;  3GTP B;  3KYH C;  1LTI D;  3G6J B;  1XXG A;  2F0J A;  1X56 A;  2L12 A;  2VZA A;  3QR8 A;  5FOB B;  3A56 A;  1YEZ A;  1L1O B;  4CJ1 B;  1LTL A;  2KCT A;  5IP9 H;  5GAG C;  4DR4 L;  2VS1 A;  1O7Y A;  2E2D C;  1WCM H;  3OPO A;  4RGO S;  5C4J B;  2Q2T A;  1N36 Q;  1WCM B;  3DM3 A;  4RHS A;  3HFZ B;  2C35 B;  3TP8 A;  1SNM A;  3F1Z A;  2EYJ A;  1DD2 A;  2VQE Q;  3A7L A;  3DLL A;  1XPR A;  1GUG A;  3OMC A;  3M9B A;  4DV1 Q;  3BZD B;  3GTL B;  4WJ3 M;  3FKI B;  1BKB A;  1YNJ C;  3U9O A;  4IUP A;  4RCN A;  1ICF B;  4U68 A;  1CM9 A;  4GKJ L;  3WOF A;  4JI0 L;  4YCV A;  4A3I B;  3I4M G;  2WAC A;  4HCE A;  4DV7 L;  2A19 A;  2YU9 H;  4GOP A;  4FF2 A;  1WTH A;  3CHB D;  4HJ9 A;  3U50 C;  3KF8 B;  2GA4 B;  4CJ2 C;  1Y8P B;  5M5Y B;  3JAM L;  1Z47 A;  3E0E A;  3J80 L;  1Q8K A;  3STB C;  3I4N G;  2DY7 A;  3L2P A;  3X3M A;  4I7Z C;  1H95 A;  1D1K A;  1VQC A;  2B2Y A;  1A2U A;  3HOY B;  2F0L A;  4ZRZ A;  4BBS B;  4TQU S;  1RL2 A;  5KIX A;  3HOV B;  5C0X I;  1S5D D;  5EKK A;  1TWA B;  4NB3 A;  3WOE A;  4X65 Q;  5GQO A;  2R7Z B;  3AB9 A;  4X65 L;  1O7I A;  3LGJ A;  5DM6 3;  4DAV A;  3MXG A;  1YNX A;  4F7X A;  2LSS A;  1IBM L;  3T1H L;  4CKC A;  4IQZ A;  1SE2 A;  2PZW A;  3OW2 A;  3BVM A;  1ENA A;  1H9R A;  3GP7 A;  4C1N K;  2JYO A;  3PV0 A;  3M7N A;  5CC4 A;  5EPK A;  1KLG D;  2KBN A;  4A3E B;  2JEB I;  4QB4 A;  3NBH B;  4KHP Q;  4EQN A;  2D5D A;  1K0R A;  4KHP L;  3E9H A;  2JN4 A;  4NXM Q;  3OIP A;  4R4Q A;  4UY8 C;  4LFB Q;  3CCQ A;  2XWB B;  5M3F H;  3NE5 B;  2B63 B;  1ZEQ X;  1VQO A;  4K2L A;  4AIM A;  5ELF A;  3GTJ B;  2OEO A;  3DHQ A;  4A3F B;  3S1Q H;  3EN2 A;  4Z9C B;  4HCS A;  3J7A 5;  3QB3 A;  4PNY A;  5C0X H;  1SYF A;  2NUC A;  5FJ8 H;  4DUY L;  1JJG A;  4OX9 L;  2F0N A;  5CV4 A;  1STA A;  2Z6B A;  2PZU A;  5KGU A;  3GTQ B;  2DJF C;  2KQ3 A;  3Q22 A;  5C5M A;  1D7Q A;  4IUR A;  1EWC A;  2PQA A;  5IWA L;  4HJ8 A;  2HQE A;  4DR6 Q;  2F3V A;  2KHS A;  1KDC A;  3D6W A;  5EBC A;  1V1O A;  4RFB A;  2MGS A;  5J39 A;  3E6Z X;  2E75 C;  1QVF A;  2PCF B;  1CSQ A;  1K8G A;  2PMZ E;  3RLF A;  2DNE A;  2UUB L;  4IJL A;  5M5X H;  5K36 H;  1DZ1 A;  1U0L A;  1YJW A;  1HUN A;  1HA6 A;  1W6J A;  3DXJ C;  1N33 Q;  2NYZ D;  3CCU A;  3KDF A;  2LXK A;  4DAP A;  3HKZ G;  1TQO A;  3WDN A;  1PH3 A;  2L9H A;  4A3B G;  2D9U A;  4LWC A;  3S2D H;  1XMO L;  3RZO H;  3AQQ A;  4AYB G;  4XXE A;  4H7B A;  2FMM A;  1RIP A;  3ZYY X;  1JT8 A;  4BY7 G;  5ELE A;  2QA4 A;  3K0Y A;  4X3T A;  3H3V I;  3NXW A;  1UEA B;  1M4V A;  1ICW A;  4HR7 B;  3PSI A;  5IT9 L;  4DK3 C;  3DWA A;  1PTO D;  1O80 A;  4C3H H;  1STN A;  2IL8 A;  1PFS A;  5IIF A;  2PW7 A;  3STB D;  3J80 i;  1R4P B;  2DJG C;  1EYG A;  2JA7 G;  4BBS H;  1NJI C;  1TII D;  1X3F A;  4FO2 A;  2NVT B;  2CW0 C;  5LMU Q;  2N3S A;  2NVT H;  5J22 A;  1T9H A;  4P2C B;  1FYC A;  4BY7 H;  5JJZ A;  1VQB A;  4K0K Q;  3S15 B;  4AQY L;  2A5H A;  3EA6 A;  5HGQ A;  4XT1 B;  1Y1W B;  4UAI A;  1NR2 A;  2WAQ E;  1SR3 A;  1VQ8 A;  1PFB A;  1PH1 A;  1ET9 A;  1SYB A;  2B2Y C;  1LV9 A;  2D0O A;  4ME5 A;  1UNS A;  1C8C A;  4LAA A;  5C4H A;  2UU9 Q;  2OQ0 A;  1K8M A;  1KAA A;  3PUZ A;  1K28 A;  1E0B A;  4JYA L;  2QEJ C;  3ERQ A;  5FLX E;  2K33 A;  1CFM A;  1EU4 A;  2P5Z X;  1JOK A;  4XIG S;  4BS9 A;  1ENF A;  3S14 B;  2J7Z A;  2QW7 A;  3I4O A;  1SMY D;  1VQP A;  1K8A C;  3L7Z C;  1JOR A;  1KAW A;  4PMC A;  4MTK A;  4NXN L;  4DNR B;  1PH8 A;  4QIW B;  4NXN Q;  1A0I A;  2R7F A;  2ZXR A;  5M5X B;  1AN8 A;  4KD3 A;  1N8R C;  1FNV A;  2NVY H;  3MC0 B;  5FLX c;  1H9S A;  3SK4 A;  4BA1 I;  3G7L A;  1PYS B;  3ND8 A;  1QJO A;  2Z9H A;  2RBM A;  5IOC A;  2E2H H;  1QNK A;  3I4M H;  2BOS A;  4K8J A;  1PZJ D;  3I3C A;  3KBG A;  4HIK A;  4FXD A;  1K73 C;  5CV5 A;  2BH8 A;  1PH5 A;  5F2D A;  3CCJ A;  1SE8 A;  4GLX A;  1EEF D;  1KHI A;  5GAH C;  1O78 A;  4X6A H;  1SLJ A;  1PA6 A;  1Q8I A;  1E1O A;  2MP1 A;  2NN6 G;  1Q81 C;  4A3G G;  3AEV A;  3QWN A;  5JAV A;  4A3K B;  2E2J H;  1BNZ A;  4JI0 Q;  3TEH B;  4QUF A;  3P1H A;  1YVC A;  3K7U C;  2M9V A;  3H94 A;  2K01 A;  3VR4 A;  1QVC A;  5C4X G;  1IL8 A;  4DAM A;  4A75 A;  4KMU C;  1A2T A;  3FEW X;  2K52 A;  1U4L A;  5I9O A;  3GD7 A;  4R8N A;  1L0W A;  2JA8 B;  3TS0 A;  1HRJ A;  2I0Q A;  4A3C H;  1TS3 A;  2F0G A;  3DWP A;  3W1G A;  5IYC H;  4IUQ A;  4KK7 A;  2K6A A;  3VR2 A;  2K7V A;  1I50 B;  4LK1 C;  3MEH A;  1KLU D;  1T5E A;  4M8A A;  3EIV A;  3A54 A;  4HJ7 A;  3HOU H;  2H4O A;  2TMP A;  1FR3 A;  1II3 A;  4IOC A;  2G9D A;  4YWK A;  1L1O C;  2MPM A;  1SYE A;  1XTD A;  3BDL A;  1EL0 A;  3NP8 A;  1FD7 D;  4JI5 Q;  4B08 A;  4AYB E;  2Z0S A;  5C3X A;  4GKK L;  3W5O A;  3J7A V;  2CH4 A;  4F87 A;  1SMX A;  2L1B A;  3K5M A;  4LUV A;  1TWH B;  1HXY D;  2ZTC A;  2EYH A;  3QJY A;  2KEE A;  1BCP C;  5D14 A;  5EJW A;  1I4P A;  5IGB A;  1VS0 A;  2F0T A;  4GNX B;  4UP9 A;  5DAU A;  4DV0 Q;  1B3Q A;  1YHA A;  1TS5 A;  1J5E L;  1WYD A;  1CK1 A;  2UUC Q;  5M3F G;  4FYD A;  2UUC L;  2CW0 D;  3GTL H;  4YY3 L;  3IRB A;  1F9S A;  1RF2 D;  1WCM G;  4K14 A;  3KF8 A;  4P74 A;  4OWW B;  4KTA A;  3F2B A;  2DUD A;  5KYI A;  1LTS D;  1IBL Q;  1CKN B;  4B3M Q;  2L15 A;  1E2Z A;  1GUN A;  2AWN A;  5C0X J;  1FGB D;  5JOB A;  3PO2 H;  1HZA A;  2K75 A;  4QQB X;  3TZU A;  4A3J H;  2HUG A;  4F88 A;  1YNJ D;  3NBH A;  1QVG A;  1BR9 A;  4WJW A;  1WTW A;  2NVQ B;  1F9Q A;  1PH4 A;  3PQI A;  2K32 A;  1G2S A;  5ELO A;  2EJM A;  2C9O A;  2CWP A;  2RKS A;  4R4O A;  3PO3 H;  5D65 A;  1D1I A;  4N9T A;  2OQK A;  3NUC A;  1QNU A;  4IUU A;  3D4D A;  4DR3 L;  2WP8 J;  4X66 Q;  5FJ8 G;  2JQO A;  4X3U A;  5C44 B;  1H9J A;  3RLO A;  1EYC A;  1A3U A;  4IJH A;  4MTN A;  4H13 C;  4LF5 L;  4PQX A;  4DNT B;  1PH2 A;  2O5I C;  2K5N A;  1Q1B A;  1C0A A;  1IBK Q;  1FVI A;  3I4N H;  4DUZ L;  4O2D A;  4A3M B;  1EY0 A;  3G71 A;  4OIK A;  1AFP A;  3DUZ A;  1LTG D;  5CV9 A;  4JI7 Q;  4P73 A;  2UUB Q;  3OHX C;  4KKU A;  1CUK A;  5D3I B;  1XNR Q;  4R4C A;  4E6I A;  1OXS C;  1K3B C;  1IZ6 A;  3HOV G;  5FO7 B;  4A4I A;  3PUY A;  2HD3 A;  2JSO A;  1BCP F;  3UE1 A;  2HT1 A;  4X3K A;  5IP9 G;  2IJ0 A;  4ME3 A;  4HJA A;  4JI6 L;  1QWY A;  4FDB A;  1E22 A;  1WTV A;  2PNR C;  3IAY A;  2HHH L;  2R7Z G;  3H09 A;  1GUW A;  1JIC A;  1WTQ A;  1EQV A;  2Q2I A;  3GTQ H;  3ULJ A;  1TY2 A;  5E1F A;  1GHK A;  4JI1 Q;  5BN4 A;  2A6E D;  5JVH 3;  4ILW A;  1PH9 A;  3PO2 G;  3PF4 A;  3T51 B;  2EJF C;  3K7A H;  2KJX A;  3SE0 A;  4L5R C;  2I07 B;  3GO5 A;  3VR5 A;  4A3K H;  5LMU L;  3S2H B;  2K05 A;  1TKW B;  5BN5 A;  1NE3 A;  4UHV A;  2SEB D;  1STB A;  2K5W A;  4BBR H;  2QDL A;  2AQ3 B;  3PGZ A;  4IPG A;  5BN3 A;  1KQS A;  1AZP A;  1TWF B;  5IY0 A;  3HOY G;  1LO5 D;  2L11 A;  4QJF A;  2VY3 A;  2WII B;  1EFI D;  1D6E C;  2K50 A;  1XPO A;  2G5D A;  1BCP B;  2BE5 D; 
#chains in the Genus database with same CATH homology
 3E0E A;  3J80 c;  1K83 H;  3G48 A;  3RN2 A;  1IBM Q;  3M3Y H;  4PZ8 A;  5GAD C;  1Q8K A;  3STB C;  3I4N G;  1VQE A;  2MO0 A;  4P72 A;  5IT9 c;  3L2P A;  3CP0 A;  2EXD A;  3BZC A;  4B3R L;  4L5Q A;  4Y52 H;  3CCS A;  4B3T L;  4JI7 L;  4A3D H;  1H95 A;  3AYH B;  1VQC A;  4IPC A;  4DR6 L;  1Q1E A;  2F4V L;  2YTV A;  1P8L A;  1X3E A;  3A0J A;  4DR2 L;  4JI2 L;  2IHE A;  3PO3 G;  4A3M H;  1GO3 E;  4TQU S;  3I2Z A;  1KIX A;  4NXM L;  1N33 L;  1RL2 A;  2CQO A;  4DUZ Q;  5C0X I;  3SGI A;  3CCE A;  4NB3 A;  1VQN A;  3FP9 A;  3GDE A;  4X64 Q;  4JI8 L;  1VQM A;  2JA8 H;  1HNZ L;  1G29 1;  5GQO A;  4X65 Q;  4OON A;  5IYC G;  1V43 A;  4X65 L;  2I5M X;  4C2M H;  1XJV A;  4A3G H;  1O7I A;  3LGJ A;  1CKM A;  5M3M H;  4IPH A;  1KC8 C;  1YNX A;  3JAM c;  2ATW A;  2LSS A;  1IBM L;  1Z9F A;  3T1H L;  1W3S A;  2EIF A;  2KEN A;  3OW2 A;  2DGY A;  3A5U A;  1P16 A;  1I50 H;  1N9W A;  3FKI H;  3PV0 A;  1MJC A;  2N8N A;  5IYD G;  4OXP A;  3HOW H;  3HOX G;  2RHQ B;  4JOI A;  4DR5 L;  2CCZ A;  3M7N A;  3CC2 A;  4JV5 Q;  2CFM A;  1IL2 A;  2KBN A;  5IWA Q;  2JEB I;  1HNX L;  3NBH B;  4JBJ A;  2QGQ A;  4KHP Q;  1PH7 A;  1K0R A;  1G51 A;  1D8L A;  1UWV A;  3E9H A;  3JAM i;  4KHP L;  4OO1 G;  4JI4 L;  3S2H H;  3M85 A;  1EIF A;  1YIJ A;  1EIY B;  4NXM Q;  5JJI A;  4GNX A;  4R4Q A;  1UE1 A;  4UY8 C;  4GLA C;  4IFD G;  4LFB Q;  3CCQ A;  5M3F H;  2UXD L;  4X62 Q;  2KHJ A;  1NBW A;  1VQO A;  2HIV A;  1A63 A;  4AIM A;  3GTP H;  4K0K L;  2K4K A;  3S1Q H;  3EN2 A;  1I3Q H;  4L5S A;  1XNR L;  4JI8 Q;  3J7A 5;  4IO9 A;  1HNW L;  5FJ8 H;  4DUY L;  4A3L H;  1JJG A;  1XMQ Q;  2JA9 A;  2R93 H;  4OX9 L;  4DV0 L;  4DV3 L;  5K36 G;  3OYY A;  2VUM H;  2XGT A;  3F2D A;  3KJP A;  1R9T H;  1PYB A;  1YBY A;  1K9M C;  4JI6 Q;  3JC6 6;  3S1R H;  3TRZ A;  1I5F A;  1D7Q A;  2HHH Q;  3KF6 A;  2PQA A;  5IWA L;  4HJ8 A;  1VQA A;  4DR6 Q;  5LMN L;  3RR5 A;  5C4X H;  3CMA A;  4A3F G;  4A3E G;  4A3E H;  4RG1 A;  3PF5 A;  4DR2 Q;  1AH9 A;  2K14 A;  1OXV A;  2V1C C;  3TRE A;  1EQR A;  3M4Q A;  1N32 Q;  1OTC A;  2UXC Q;  1QVF A;  2YYZ A;  4GOP B;  1QZG A;  1CSQ A;  3K8A A;  1K8G A;  2ES2 A;  2PMZ E;  1S40 A;  1FL0 A;  4YHH L;  4DV6 L;  1Y1W H;  3NEN A;  4DK6 C;  3RLF A;  4DR1 L;  1VQL A;  2UUB L;  4IJL A;  4H02 A;  4TVA B;  5M5X H;  1GVP A;  3T1Y Q;  1U0L A;  1YJW A;  1CSP A;  1HZB A;  2JA6 H;  4A3C G;  3RLN A;  4DV2 Q;  1S72 A;  2NZH A;  2ZTE A;  1M90 C;  4LF6 Q;  1TWC H;  3S15 H;  3S1N H;  1C9O A;  1N33 Q;  3CCU A;  3CC4 A;  1XNQ L;  3KDF A;  4P75 A;  2LXK A;  3H3V H;  4GOP C;  2JEA I;  2R92 G;  4A93 G;  3HKZ G;  5GRO A;  2A8V A;  2AHO B;  1BBW A;  1E24 A;  1PH3 A;  2VL6 A;  1B8A A;  4A3B G;  4DR3 Q;  4LWC A;  3S2D H;  1XMO L;  4DR5 Q;  4B3S L;  2E5L Q;  3RZO H;  4R1J A;  3AQQ A;  4AYB G;  4L5T A;  4POF A;  1IBL L;  1RIP A;  3A74 A;  3UE0 A;  3CCM A;  4LF9 L;  1JT8 A;  4ALP A;  4BY7 G;  2QA4 A;  3GTM H;  3H3V I;  5GAE C;  4JBM A;  4LFA L;  3H15 A;  2PI2 A;  3F2C A;  1N32 L;  3RNU A;  3PSI A;  2K5V A;  2VQE L;  1UEB A;  4DAY B;  4DK3 C;  1E1T A;  3EBE A;  4DV1 L;  4IFD I;  4C3H H;  3CC7 A;  1LM0 A;  4Y7N H;  1XPU A;  2MFI A;  1PFS A;  4JI3 Q;  2Z6K C;  3STB D;  3J80 i;  4P71 A;  2JE6 I;  5FLM H;  4XTC S;  2R6G A;  2PI2 E;  2R93 G;  2N49 A;  1EYG A;  3GTG H;  2JA7 G;  3S16 H;  3D0F A;  4BBS H;  1NJI C;  1X3F A;  1WFQ A;  1EUJ A;  1YI2 A;  5LMU Q;  2N3S A;  2NVT H;  4JBW A;  3CXC A;  1T9H A;  4UP8 A;  4BY7 H;  3KDF B;  1VQB A;  4DR4 Q;  2UXB Q;  4K0K Q;  1BVS A;  4R4T A;  2YTY A;  4AQY L;  4X66 L;  2Q2U A;  5HGQ A;  2FXQ A;  1ASY A;  4BY1 G;  3CW2 C;  3KLW A;  4LF9 Q;  1I94 Q;  4JCV E;  1I94 L;  2MQH A;  2WAQ E;  1SR3 A;  4LFA Q;  4APV A;  5C3E G;  5FLM G;  4DNI A;  5C3E H;  3MXN B;  1VQ8 A;  1WOC A;  1PH1 A;  2UUA L;  4JI4 Q;  1X6O A;  2N78 A;  4IOA A;  2R7D A;  1Q46 A;  2D0O A;  1X55 A;  5C0X G;  1Q7Y C;  1L1O A;  1CKO A;  3MEF A;  2GVA A;  2UU9 Q;  2OQ0 A;  4BA2 I;  1TWH H;  3D31 A;  3PUZ A;  4JV5 L;  4JYA L;  1I6H H;  3ULP A;  1Y1W G;  3NEM A;  1WI5 A;  4WJ4 A;  4GLV B;  3PCO B;  4XIG S;  4KHZ A;  5JJK A;  1HH2 P;  3ER0 A;  3U4V A;  4DV2 L;  1NMF A;  3RZD H;  3I4O A;  4JI2 Q;  4DV7 Q;  1VQP A;  4DUY Q;  1K8A C;  3L7Z C;  2ALY B;  1KAW A;  1VQG A;  3ZJY C;  4EQ5 A;  2ZM6 L;  1YJ9 A;  2UXC L;  3KJO A;  3E9I A;  4NXN L;  4LW1 A;  1PH8 A;  4NXN Q;  1A0I A;  1VQF A;  2R7F A;  3H0G H;  3J7Z C;  1N8R C;  3W1B A;  4DV6 Q;  1VQH A;  2B29 A;  2NVY H;  5FLX c;  3J81 c;  4DPG A;  3I55 A;  1SRO A;  4BBS G;  4BA1 I;  4X64 L;  1LYL A;  4YCW A;  2JA7 H;  3KOJ A;  3FKI G;  5IYD H;  3HKS A;  2BA1 A;  1PYS B;  2HIX A;  1V9P A;  2ID0 A;  1HR0 L;  4A3L G;  2IY5 B;  1X54 A;  2E2H H;  3I4M H;  4IPD A;  4HIK A;  1AE3 A;  1NTG A;  1K73 C;  5IYB H;  4IFD J;  4JI1 L;  1FJG L;  2BH8 A;  1PH5 A;  1TXY A;  3CCJ A;  1SE8 A;  4GLX A;  3PIP A;  4LF8 Q;  1KHI A;  4RMF A;  5GAH C;  1M1K C;  1A8V A;  4DR7 Q;  4BY1 H;  1SLJ A;  4JC0 A;  1PA6 A;  3G6E A;  4X6A H;  1E1O A;  2EQS A;  2NN6 G;  1Q81 C;  4A3G G;  3AEV A;  4JYA Q;  3U4Z A;  4DKA C;  1OXT A;  2E2J H;  4A3B H;  1UE6 A;  3HOY H;  3I7F A;  4JI0 Q;  3TEH B;  4OWT B;  4GN3 B;  1YVC A;  3K7U C;  3TQY A;  4B3M L;  4LUZ A;  3T1Y L;  5IE8 A;  2R92 H;  1QVC A;  4A3F H;  5C4X G;  4DAM A;  4A75 A;  4JI5 L;  1MJE A;  1B7Y B;  3L0O A;  1KD1 C;  1JJC B;  5JEA G;  3CME A;  2K52 A;  3PUW A;  5H1S E;  2JA6 G;  1ASZ A;  2LXJ A;  3GD7 A;  5J3B A;  1L0W A;  4HID A;  1JMC A;  1V1Q A;  3GTJ H;  3TS0 A;  1XMO Q;  1MIU A;  4GN4 B;  1EQQ A;  1Q82 C;  2I0Q A;  5M3M G;  4A3C H;  2IX1 A;  1YIT A;  1Y14 B;  4QIW E;  5HY6 A;  4A3K G;  3W1G A;  5IYC H;  2NVX H;  1SN8 A;  4O0A A;  3CCV A;  2BH2 A;  2ASB A;  3S1M H;  1VQ7 A;  4R4I A;  4BXX H;  2GN5 A;  4J15 A;  3BJU A;  2PNH A;  3BZK A;  1NMG A;  2VQF Q;  4QGU A;  3T1H Q;  4PMW A;  2F3I A;  3EIV A;  2ZJQ A;  4HJ7 A;  5C44 G;  2AWO A;  2KCM A;  3HOU H;  3FHW A;  3PIO A;  3VDY A;  4B3T Q;  5IP7 H;  1VCI A;  4JOI C;  4LFC L;  1QUQ B;  3PO3 H;  1JJ2 A;  2E2I H;  3HKZ E;  5LMN W;  4IOC A;  4YWK A;  1L1O C;  2H5X A;  2F4V Q;  1QUQ A;  1XTD A;  2OCE A;  5AJ3 L;  3S17 H;  2NVQ H;  1DGS A;  3B6Y A;  2VUM G;  3M4O H;  2ZTD A;  1PV4 A;  4JI5 Q;  4PZ6 A;  3M4P A;  4AYB E;  2ZM6 Q;  1W2B A;  2Z0S A;  1HR0 W;  3K0X A;  1IXR A;  4X62 L;  1K3R A;  1TWF H;  3PUV A;  4GKK L;  1YZ6 A;  3W5O A;  4LFB L;  1VQJ A;  5BR8 L;  2OWO A;  1GD7 A;  2UU9 L;  1SMX A;  1X9N A;  4LUV A;  3HOZ G;  2F52 A;  2WB1 G;  3CCL A;  1VQI A;  3NEL A;  3TS2 A;  2ZTC A;  2JJQ A;  2AMC B;  4YWL A;  2ZJP A;  3I56 A;  5M5W H;  1PH6 A;  1N34 L;  1AE2 A;  2OTL A;  2WFW A;  1VS0 A;  4DV3 Q;  1Q86 C;  4GNX B;  5EAY A;  3CD6 A;  2OTJ A;  3K80 C;  2MO1 A;  4UP9 A;  1XNQ Q;  4DV0 Q;  4YCU A;  4JG2 A;  1YHA A;  1J5E L;  1WYD A;  2UUC Q;  5M3F G;  2CKZ B;  3U58 A;  1E3P A;  1EFW A;  2UUC L;  4A93 H;  2AKW B;  2RF4 A;  3UDX A;  3GTL H;  2ZJR A;  4YY3 L;  2YTX A;  3IRB A;  2R7Z H;  1WCM G;  4A3I H;  4P74 A;  4B3S Q;  1HJP A;  4OWW B;  3ICE A;  2RHS B;  1KL9 A;  3F2B A;  2DUD A;  3WWV A;  3RN5 A;  2K5H A;  1IBL Q;  1CKN B;  4AH6 A;  2L15 A;  4DV4 L;  4B3M Q;  4GKJ Q;  1E7Z A;  4UP7 A;  1LUZ A;  3OTO L;  2AWN A;  1TWA H;  2D0P A;  2IHF A;  5C0X J;  2BA0 A;  3ERS X;  2Z6K A;  4LF5 Q;  1IBK L;  4NPS A;  1WJJ A;  3HOV H;  1HZA A;  3PO2 H;  2UXD Q;  1S3O A;  2K75 A;  1UE7 A;  4HJ5 A;  4DR7 L;  3S24 A;  4A3J H;  4QQB X;  1JE5 A;  1L2F A;  3A5Z B;  3J81 i;  1Q12 A;  1KRT A;  4YHH Q;  1OXU A;  4OWX B;  1A62 A;  3CPW A;  1VQ4 A;  1QVG A;  1HNW Q;  4KI0 A;  3BU2 A;  1U5K A;  2JA8 G;  5JEA J;  4UPA A;  3KF6 B;  4KLK A;  2MNA A;  1YHQ A;  2VW9 A;  1HR0 Q;  2B3G A;  1OXX K;  1PH4 A;  4DV5 L;  1QZH A;  4LF7 Q;  2JA5 G;  3AFQ A;  4DV5 Q;  5ELO A;  4LF7 L;  2HQL A;  1VQ9 A;  2CWP A;  3CAM A;  3CQZ H;  4R4O A;  4LUO A;  3F8T A;  3G4S A;  1HZC A;  3GTO H;  3HOZ H;  1G6P A;  2OQK A;  4HIO A;  5ELN A;  5M5Y H;  4MZ9 A;  4BXX G;  4YY3 Q;  1KXL A;  1Y1V G;  1EOV A;  4DR3 L;  2WP8 J;  4X66 Q;  5FJ8 G;  2JQO A;  3HOX H;  2E5L L;  4C3I H;  5JJL A;  2E8G A;  5LMN Q;  1VQK A;  1VQD A;  2NN6 I;  3RLO A;  4IJH A;  3K81 C;  2IX0 A;  5E7N A;  4MTN A;  3S14 H;  2QEX A;  2I5H A;  4LF5 L;  1MKH A;  1PH2 A;  2K5N A;  1Q1B A;  2VQF L;  1C0A A;  2Y0S G;  1IBK Q;  1C7Y A;  2UUA Q;  1VQ5 A;  3UDG A;  4POG A;  1FVI A;  3I4N H;  4LF8 L;  4DUZ L;  1YJN A;  4O2D A;  3G71 A;  1IYJ B;  2CWA A;  2NZO A;  5BR8 Q;  5C4J H;  4GNX C;  4A76 A;  4B3R Q;  4JI7 Q;  3Q8D A;  1HNX Q;  2PQA B;  4DR1 Q;  2D62 A;  2JK8 A;  4P73 A;  4JI3 L;  3CF5 A;  2UUB Q;  2I5L X;  1GKH A;  1CUK A;  4BBR G;  5AJ3 Q;  4R4C A;  1JB7 A;  4JBK A;  1XNR Q;  1OXS C;  2KHI A;  1NY4 A;  3KYH C;  4LF4 Q;  3UDF A;  1HNZ Q;  1IZ6 A;  2IT1 A;  4LF4 L;  3HOV G;  1X56 A;  2VZA A;  4YWM A;  2A1A A;  4A4I A;  3HOW G;  1EWI A;  3PUY A;  4A3J G;  4A3M G;  1YEZ A;  1Y1V H;  1L1O B;  3UE1 A;  2HT1 A;  2Q2H A;  1SFO H;  1LTL A;  5IP9 G;  2KCT A;  2WAQ G;  1BBU A;  2Y0S E;  5GAG C;  5IP9 H;  4ME3 A;  4HJA A;  4AQY Q;  4JI6 L;  4DR4 L;  2VS1 A;  2UXB L;  4FDB A;  2XTI A;  1PHJ A;  4PG3 A;  1E22 A;  1WCM H;  4A3I G;  2Q2T A;  2HHH L;  2B63 H;  2R7Z G;  4HIM A;  2VNU D;  1X65 A;  3CPF A;  1N36 Q;  2JA5 H;  3KFU A;  1N34 Q;  3DM3 A;  3HFZ B;  2Q2I A;  2C35 B;  3GTQ H;  4GS3 A;  4EX5 A;  3ULJ A;  3F1Z A;  4JI1 Q;  2VQE Q;  1HZ9 A;  3DLL A;  1XPR A;  2GVB A;  3M9B A;  4DV1 Q;  4GKK Q;  4WJ3 M;  1PH9 A;  1BKB A;  5DLQ E;  4LFC Q;  3PO2 G;  3PF4 A;  3K7A H;  5IYB G;  4LNQ A;  4GN5 A;  4GKJ L;  3J81 j;  4JI0 L;  1SRU A;  4YCV A;  2WB1 E;  4L5R C;  3I4M G;  4A3D G;  3CCR A;  1GM5 A;  2B63 G;  3GO5 A;  4A3K H;  5LMU L;  4DV7 L;  3UDI A;  1TWG H;  2A19 A;  4C3J H;  2YU9 H;  1FGU A;  1X3G A;  4QY7 A;  1NE3 A;  3ULL A;  4GOP A;  1J5E Q;  3AFP A;  1KQS A;  3H0G G;  4BBR H;  1UE5 A;  3PGZ A;  4IPG A;  4OO1 I;  4HJ9 A;  1VQ6 A;  3U50 C;  3KF8 B;  5IY0 A;  3HOY G;  5C44 H;  3PUX A;  3HOU G;  1N36 L;  4QJF A;  4PZ7 A;  4LF6 L;  1CKN A;  1YHB A;  2VY3 A;  5IP7 G;  2K50 A;  1PVO A;  1XMQ L;  4DV4 Q;  1KRS A;  4QL5 A;  1XPO A;  1J6Q A;  2YV5 A;  4MNO A;  1B70 B;  4OX9 Q;  1FJG Q;  3GTK H;  3OTO Q;  1Z47 A;  2RCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...