4LF9L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9L00
4YWKA 2UUCL 1PH8A 1I50H 1FL0A 4B3RL 4BA2I 4LF5Q 3F1ZA 3NELA 1QZGA 2JEAI 3F2CA 1HH2P 3DLLA 2NN6I 3PCOB 5LMNQ 4LUVA 1N34Q 1HNZQ 1VQ7A 1Q1BA 4DR6Q 3DM3A 1JE5A 4DV1Q 4QL5A 3CCUA 4DR1L 3L0OA 5HY6A 3S17H 1KC8C 3F2BA 4GN3B 3IRBA 2Q2HA 4P73A 1JJ2A 2E5LL 2IT1A 1YHQA 1B7YB 4JI7L 1LYLA 4HIOA 4JG2A 3GTPH 1E24A 4TQUS 2PNHA 4JC0A 4B3SQ 2I0QA 3K80C 1Q7YC 4X66L 3UDXA 4NB3A 2XTIA 2D0OA 2YYZA 4O2DA 4GOPC 3HOYG 4NXML 4DKAC 1PH4A 4A3KG 1VQ8A 1D7QA 3D31A 2WFWA 4PG3A 4KHPQ 4LF9L 2JQOA 2MQHA 4AYBE 4LFCQ 4LW1A 3J81j 1HZAA 4DR5Q 2D62A 3GD7A 4X65L 5C4XG 2ATWA 2MFIA 3LGJA 1QVCA 5IYBG 4X6AH 1VQBA 3H15A 1L1OB 1DGSA 2PI2A 4DAMA 5K36G 3K0XA 2Y0SE 2VQEQ 1KAWA 1V9PA 2UXBQ 1VQMA 1GVPA 1NY4A 4JI5L 3MEFA 3M85A 1YJWA 1YEZA 1L0WA 3S24A 5IT9c 3BZKA 3ICEA 3S1NH 4IFDI 1UEBA 3EN2A 1QUQB 3BZCA 5C3EG 1UWVA 1OXSC 1N32Q 4C3JH 2QA4A 1BBWA 2B63G 1HNXL 1XPUA 4DV4Q 2R7FA 1NJIC 4TVAB 4AQYL 4PZ8A 4X62Q 4ALPA 1IBLQ 2I5MX 3HKSA 4P72A 2V1CC 2OWOA 1SR3A 3D0FA 3UE0A 4DV3L 5GROA 3KOJA 3KLWA 3ERSX 2LXKA 3HOYH 1W3SA 3OTOQ 2QEXA 2C35B 4A3KH 2UUAL 4LF6Q 4B3TL 1SMXA 4JBMA 2E2JH 4YHHL 2KCTA 5HGQA 4DV6L 1IYJB 5JEAJ 4RMFA 3CCSA 3F8TA 1IL2A 5C4XH 5IYBH 4JOIC 4PZ6A 3F2DA 4OX9L 2AWOA 2ES2A 1CKMA 3A0JA 1CUKA 3GTMH 4IPCA 2ZTDA 4P75A 4PMWA 1I94Q 1N36L 1VQ9A 3JAMc 3KF6B 4A3DG 3J80c 1RIPA 4JYAQ 4XTCS 3U4ZA 1SFOH 1V1QA 5C3EH 3KF6A 1X3FA 2B63H 4DR7L 4DR4Q 1S40A 1AE2A 2IHFA 1X9NA 1UE1A 4JBKA 1N33L 2F4VL 3CC4A 1V43A 1D8LA 2H5XA 4JI0L 3GTOH 3H3VI 4A3EG 2PMZE 4C2MH 1Q8KA 3OYYA 4IJHA 2ALYB 4KHZA 2RCNA 1CKNA 1S72A 2JEBI 5M3FG 4QQBX 5IY0A 1IBKQ 2R92G 3NEMA 1A62A 3CCVA 3L7ZC 4A3MG 1VQKA 4HIMA 2GVAA 4HJ9A 2Q2UA 1P8LA 4B3MQ 4JI6Q 2WAQE 3M4PA 2VQFQ 4JI8L 4BXXG 3A5UA 1LTLA 2VUMG 1TXYA 1TWHH 2YV5A 3ULLA 3S1RH 1SN8A 3JAMi 3J80i 1XNQL 1K83H 1FGUA 2FXQA 3PUXA 4O0AA 4DV7Q 1R9TH 1PV4A 2HHHQ 4A3DH 3HOUG 4EQ5A 4GKJQ 2GVBA 4OO1G 4JV5L 1VQ4A 1NE3A 3HOXG 4Y7NH 4GLXA 2R7ZG 4IOCA 4JI2L 1G291 1HZ9A 1YZ6A 3M9BA 1OTCA 1XTDA 2R7DA 2IX1A 4BY7G 1J5EL 1SE8A 4DV0Q 1O7IA 1XJVA 3S2DH 1B70B 3A5ZB 3Q8DA 4DR3L 1PH2A 1HR0Q 3AFPA 4A3EH 1VQ6A 2B3GA 1XMQL 4HJ8A 4JI4Q 3CP0A 1VQDA 4X64Q 4R4CA 4LF7L 4DV5Q 1CKOA 4J15A 5M3FH 3L2PA 1PH1A 2UUBL 2R92H 1E3PA 3H0GG 2K50A 3I2ZA 4OWWB 4A3MH 2UXCL 1ASZA 4NXNQ 4BY1G 1YJNA 1YVCA 4GLVB 5IYCG 3AEVA 2A1AA 3CCLA 2VY3A 4BXXH 2VUMH 3KFUA 2N3SA 2OTJA 5IP7G 2WP8J 2UXDQ 5LMNL 4YCUA 1PHJA 1N34L 2YTYA 1HNZL 4JBJA 2Q2TA 5C0XG 2UU9Q 4DV1L 1SRUA 2EXDA 1VQJA 3M4QA 4GNXB 3J7A5 4YWMA 2RHQB 4FDBA 3HOUH 2Z6KA 5J3BA 3HOXH 2R7ZH 2VW9A 2Y0SG 1VQPA 3PGZA 2E2IH 4B3SL 4LF8L 4BY7H 3RLNA 4EX5A 2HIVA 1CSQA 3GO5A 1Q1EA 4L5SA 4IOAA 4KHPL 4LFCL 4LF4L 3ULJA 1VQEA 2VNUD 1X65A 2DGYA 4DR5L 1M90C 1IBML 3J81c 3GTJH 2ZM6L 1VQNA 3H0GH 2I5HA 1L1OA 4ME3A 4JCVE 3S15H 4DV2Q 1A8VA 1VQHA 4BY1H 3HOWH 5IE8A 5IYCH 4A75A 1YIJA 4P74A 1K8AC 3NBHB 1XNRQ 3CCRA 4A93G 3RR5A 3TS0A 5DLQE 3AYHB 1QUQA 1BBUA 1YITA 5IP7H 1FVIA 1MJCA 3I4MG 2JA7G 4IPHA 2WB1E 1BVSA 3I4OA 4JI3Q 4DV4L 3G6EA 4PZ7A 2R6GA 1P16A 4X62L 3CW2C 1E1OA 1IBLL 3A74A 4LNQA 1VQAA 1EYGA 3PUYA 3MXNB 1AH9A 3VDYA 2D0PA 4MNOA 1NMFA 5H1SE 1SROA 3CQZH 4KI0A 3PUZA 4UP9A 2MO0A 2QGQA 2JJQA 4YCWA 3OTOL 2YU9H 3U58A 4R4IA 2ZJPA 3M3YH 2F52A 4LF6L 3PUVA 4AH6A 1UE6A 2OQKA 3J81i 2HIXA 4BBSG 2YTVA 3SGIA 3H3VH 3NENA 4YY3Q 2OQ0A 2N78A 4IO9A 1JT8A 2E8GA 4LUZA 4QY7A 4UP7A 4LFBL 2JA8G 3W5OA 3GTGH 4OWTB 4DUZL 1HNWQ 2CWPA 1E1TA 4DUYQ 5M5YH 4YHHQ 1EWIA 1I94L 1QVGA 2K5VA 5E7NA 1FJGQ 1N9WA 1XMOQ 4DNIA 4A93H 3UE1A 3U50C 4JYAL 3BU2A 3PIOA 3UDGA 1Z47A 1PH5A 3RN5A 3U4VA 2BA0A 2KHJA 3HKZG 3I4MH 2NN6G 3G4SA 2NZHA 2JA7H 2ID0A 1PH9A 3PSIA 1EOVA 2WAQG 3CC7A 1OXXK 3EBEA 2ZTCA 2KHIA 1N8RC 1VQIA 4LFAL 3KYHC 2A19A 2LSSA 2JK8A 3KF8B 3PUWA 1PH6A 2AWNA 1GM5A 4A3LG 1W2BA 1IBKL 3K8AA 1N33Q 3I4NG 2N8NA 4MZ9A 2CCZA 3RNUA 3GTQH 1VQCA 2NVYH 1EQRA 1OXUA 2F4VQ 4DR2Q 5JJIA 1C0AA 2KENA 4KLKA 3GTKH 1A63A 2NVTH 1T9HA 4B3ML 3T1HQ 4DAYB 4WJ3M 2CKZB 5AJ3L 2K52A 2Q2IA 3G48A 2VQFL 4HIKA 4BBSH 2PQAB 2OCEA 5M5WH 3FP9A 2ZJRA 1WJJA 3S1QH 2Z0SA 1YNXA 2JA8H 1M1KC 4HJAA 1VQGA 1BKBA 3PO2H 4GS3A 1WYDA 2EQSA 2IX0A 4DV7L 3S14H 3PF4A 2HHHL 4IFDG 5LMNW 3OW2A 2OTLA 4GKJL 1KXLA 5BR8L 1MIUA 5IWAQ 1HZCA 1PH7A 4H02A 1X3EA 1KRSA 1EIYB 4UPAA 4JI1Q 1KIXA 4GKKQ 1KQSA 1U5KA 2PI2E 1CSPA 4DV0L 1SLJA 4GN4B 3RLOA 3RN2A 2EIFA 1HR0L 4JI4L 3CCMA 4A3CG 4R1JA 5LMUQ 1PYBA 3T1YQ 3S16H 4JI2Q 4A3LH 5M3MG 4DV5L 1XPOA 3HOWG 2NZOA 4A3FG 4C3HH 1QVFA 3I4NH 4DR6L 3KJOA 1Q82C 2N49A 2AHOB 5JJKA 3HOZH 2R93G 4NXNL 3K7UC 3WWVA 4LF5L 2ASBA 1YHAA 4BBRG 5GQOA 2Z6KC 5GAGC 1WI5A 2GN5A 2JA9A 3ULPA 1TWAH 3AQQA 2K14A 3KDFB 1Q81C 3CCJA 4AYBG 1PA6A 4UY8C 3M4OH 2IHEA 3CD6A 4A76A 1WFQA 2KCMA 3KDFA 3UDFA 2UUCQ 4YWLA 4B3RQ 1KHIA 2UXDL 1GKHA 2MO1A 4IPDA 4LUOA 4BA1I 4NPSA 1I3QH 2RF4A 4GNXA 3CPFA 2UU9L 1QZHA 1VQLA 3S1MH 1WCMG 1I5FA 3PV0A 4DR1Q 3I56A 1Q46A 1L1OC 1PH3A 2E5LQ 4DK6C 1OXTA 3GTLH 1KD1C 4JI7Q 4DPGA 4RG1A 3G71A 1C7YA 4X66Q 1YJ9A 1EFWA 4GLAC 4A3CH 4NXMQ 1KL9A 2WB1G 4LF8Q 2KBNA 2JA5G 3I55A 4IPGA 5M3MH 5C0XJ 2CFMA 2VQEL 4LF9Q 1E7ZA 4HJ7A 4A3FH 2K5NA 4POGA 1GO3E 3RZOH 3E9IA 1OXVA 3CMEA 1NTGA 4QIWE 2UXBL 1Z9FA 3PIPA 2R93H 4DV2L 4X65Q 1GD7A 4GOPB 4BBRH 3RLFA 3S2HH 3FKIG 4LF4Q 4R4QA 1XNRL 1N32L 4GN5A 1IBMQ 3TRZA 2ZM6Q 5ELOA 4GOPA 4IJLA 3CCEA 2CQOA 1K3RA 2VL6A 1LUZA 3E0EA 3TEHB 3PF5A 1MJEA 4JI5Q 4OO1I 3E9HA 3PO2G 2I5LX 3TREA 2A8VA 4JI3L 2VZAA 3J7ZC 4A3BG 5ELNA 1UE7A 1HNXQ 3ZJYC 3CPWA 4A3IG 4A3GG 1WCMH 4A3JG 5JEAG 4L5TA 4AQYQ 1VQOA 3CC2A 1S3OA 3RZDH 1TWCH 1EQQA 2RHSB 4LWCA 4WJ4A 3B6YA 4DV3Q 4MTNA 2BA1A 3W1GA 1YBYA 4QGUA 4OXPA 3HOVG 2HQLA 4HIDA 4L5RC 3TQYA 2NVQH 2HT1A 3KJPA 2UUAQ 2JA5H 4B3TQ 2BH2A 5IYDG 1JJCB 3K7AH 1AE3A 4YY3L 1XPRA 4DV6Q 1A0IA 5FLMG 5C44G 1I6HH 1UE5A 2YTXA 5JJLA 3FKIH 1HNWL 1EUJA 1LM0A 2XGTA 4DUYL 4OX9Q 2JA6G 1Y1VG 1FJGL 1XMOL 4DR4L 4R4TA 1X54A 5C0XI 1N36Q 2LXJA 1RL2A 4LFBQ 2JE6I 2K5HA 1IZ6A 2BH8A 1C9OA 1Y14B 1J6QA 4DK3C 4DUZQ 4OONA 1KRTA 1JMCA 4A3BH 5IP9G 4K0KL 4DR7Q 5EAYA 4A3IH 4A3GH 4JOIA 4A3JH 4P71A 4Y52H 1PFSA 3CF5A 5GADC 3GDEA 2K75A 1MKHA 4JI0Q 3HOZG 4POFA 3CAMA 1NBWA 2ZTEA 2DUDA 5GAHC 3EIVA 5M5XH 3FHWA 1HR0W 4JI6L 1YI2A 5FJ8G 3CCQA 4DR2L 1CKNB 1K73C 4LFAQ 3BJUA 1H95A 3STBC 3HFZB 2E2HH 3JC66 2K4KA 4AIMA 4R4OA 1ASYA 3HOVH 3PO3G 3T1HL 4L5QA 2PQAA 3AFQA 4XIGS 1PVOA 5IYDH 3STBD 3CXCA 1Y1WG 4UP8A 1PYSB 5FLMH 4HJ5A 1G6PA 5C44H 4JI8Q 1EIFA 3HKZE 4A4IA 5GAEC 1K9MC 1VQ5A 5C4JH 3TS2A 1NMGA 2JA6H 5AJ3Q 3CMAA 1Y1VH 3M7NA 1HJPA 1TWGH 2VS1A 1U0LA 1G51A 1L2FA 4JBWA 5FLXc 1XNQQ 1YHBA 1WOCA 1X55A 2AMCB 3ER0A 5IWAL 4K0KQ 1B8AA 2IY5B 1TWFH 1X3GA 4JV5Q 4GKKL 4JI1L 1JB7A 5IP9H 1HZBA 1X6OA 4X64L 1VQFA 2B29A 1E22A 4QJFA 3W1BA 1K0RA 5BR8Q 1J5EQ 2F3IA 3T1YL 5LMUL 4OWXB 2ZJQA 4DR3Q 1VCIA 1JJGA 2L15A 1XMQQ 2NVXH 2AKWB 3UDIA 2CWAA 4GNXC 3K81C 5FJ8H 4LF7Q 2UUBQ 4IFDJ 2MNAA 4C3IH 3PO3H 1K8GA 4YCVA 1Q86C 2UXCQ 1VS0A 1IXRA 4APVA 1Y1WH 1Q12A 3I7FA 1X56A
chains in the Genus database with same CATH superfamily
4YWKA 1M8AA 1TS4A 1EQTA 4B3RL 1GHKA 3DLLA 2FFKB 1HNZQ 1R9TB 1KC8C 3F2BA 1B44D 2F0HA 1JJ2A 1IKLA 4FF2A 4RH6A 3MEHA 4TQUS 2PNHA 2I0QA 3K80C 1XYIA 4X66L 3UDXA 2XTIA 3S2DB 1IYVA 4PNYA 1KAAA 4DKAC 1VQ8A 2PQEA 1LT5D 5KIXA 2WFWA 4PG3A 4LF9L 4K5VA 4M1UB 3NXWA 3DMUA 2LKVA 1ESFA 3N52A 3GD7A 5C4XG 1BNZA 4E6IA 2MFIA 3H15A 5K36G 4FP5D 3K0XA 3OPOA 2VQEQ 1V9PA 1VQMA 5EPJA 2RSNA 2Q8RE 3S9WA 2VUMB 1L0WA 3S24A 1UEBA 3EN2A 3VYUA 4C3JH 2QA4A 1XPUA 1HNXL 1NJIC 2MHVA 4TVAB 3CU7A 4AQYL 4ALPA 3O13A 3HKSA 2F0TA 4RWSC 2V1CC 5BN3A 2OWOA 3NQTA 2OF1A 1CTMA 1TQOA 1SR3A 1UAPA 2O4XA 3LX0A 2NB0A 4DV3L 2K01A 3KOJA 5C3WA 5IT9E 3HOYH 4OIKA 2UUAL 3OIPA 3J80L 4JBMA 5EJWA 4RMFA 1H9SB 3DEPA 4JOIC 3F2UA 3F2DA 1PZJD 2Z1CA 3HOWB 1CUKA 5DEHA 4PMWA 2NYZD 4F8MA 3MWYW 1DYQA 2R61A 2R93B 2A68C 4JYAQ 1B50A 4M8AA 1V1QA 3KF6A 4KMUC 2B63H 3A56A 4H0LC 1S40A 4JBKA 1N33L 1TT2A 3CC4A 1V43A 3H3VI 3EJIA 2XNAC 2D9UA 5FLXL 2Y0SB 4KHZA 2RCNA 1CKNA 1FR3A 3CRLC 5M3FG 5IY0A 3NUCA 3NEMA 4OEMB 1NCVA 2YU9B 4HR7B 3CCVA 4CDFC 2KA7A 4PQXA 4CJ2C 2WAQE 4JI8L 5M5YB 1DJRD 3J80i 1K83H 4K0KL 4A3DH 4GKJQ 4EQ5A 4JV5L 4S3SA 1WD0A 3I4MB 3HOXG 4Y7NH 4FF3A 3MXUA 4JI2L 2IX1A 3M9BA 1OTCA 1XTDA 2R7DA 1C48A 4DV0Q 1Y8PB 1XJVA 1V1PA 1PH2A 2M00A 3AFPA 5C5LA 2B3GA 3LWUA 4HJ8A 1TKWB 4R4CA 4LF7L 3FMCA 4J15A 4DV5Q 3L2PA 4IQZA 1RJTA 1SJHD 2OT2A 2K50A 2NVYB 3GTKB 3SK5A 3CCLA 2QW7A 2K5DA 5M5WB 2F0JA 2EYHA 1F9RA 2L12A 2PMZB 1IW7C 3W2DA 2UXDQ 1HNZL 4CJ0B 4MTKA 3ND8A 3PO2B 2UU9Q 5C0XG 3S14B 4F87A 2RHQB 4OO1H 3HOUH 2Z6KA 2LY7A 3D8GA 1WTPA 4EQNA 2R7ZH 1QG7A 5JVG3 1B4OA 3NQIA 2ZXOA 4RGTA 3HRZC 1EY9A 1Q1EA 4IOAA 2ENBA 4K8JA 3GTJH 1J8IA 1PTOB 1SNMA 3H0GH 5ELCA 3I4NB 4X3KA 3HOZB 3A8KE 3NP8A 1VQHA 4DV2Q 4A75A 4P74A 1XNRQ 3CCRA 4A93G 3BZDB 3TS0A 5DLQE 1K3BC 2P5ZX 1BBUA 1PZKD 5IP7H 1BO0A 4IPHA 2IPKD 1C4QA 2B8GA 1BUVT 1RTNA 3J81E 3G6EA 1WTWA 1AZQA 3A74A 3S1MB 4ABNA 1EYGA 4XT1B 4KN7C 3MZ5A 3I4LA 1IYUA 3GTLB 3MXNA 1SMYD 3CQZH 2QGQA 1ML0D 3U58A 2ZJPA 1HPCA 1SAPA 4WORA 4G7ZC 1MI2A 2HIXA 3SGIA 2OQ0A 5FO7B 4UP7A 4QY7A 1GUGA 3CRKC 3W5OA 4DUZL 4YHHQ 2K5VA 3H6MA 5E7NA 1FJGQ 4KK7A 1F2LA 2H1EA 4K14A 4JYAL 2K1BA 5CMDA 3UDGA 1PH5A 3MXGA 3U4VA 2JA7H 3VYRA 1PH9A 4G7HC 2WAQG 3CC7A 4LJZC 5C5MA 1BQQT 1VQIA 4LFAL 3PUWA 5I6WA 1PH6A 3IAYA 2KJXA 1HFNA 1W2BA 3K8AA 4CBVA 2N8NA 5M9OA 3GTQH 2F4VQ 1EQRA 2K04A 2KENA 3U9SA 2NVTH 4DAYB 5AJ3L 3G48A 2KQ3A 4XQJA 5CC4A 2OCEA 3K6OA 1KNAA 3VR6A 1YNXA 1PRTD 3PMFA 1IKMA 2F4IA 1WYDA 2EQSA 4GKJL 4IFDG 5LMNW 1PLFA 2NWGA 2NN6H 2A69C 1H9MA 3FEWX 3MFYA 1KQSA 4DV0L 4Q0FA 2F0FA 5LMUQ 4A3LH 4DV5L 2FHTA 4PMBA 3HOWG 1F77A 1GUOA 4K2LA 1Q82C 3A8IE 2K5WA 2N49A 2AHOB 3NWTA 4F7XA 2R93G 3K7UC 4LF5L 2E2HB 4BBRG 5GQOA 5GAGC 1WI5A 2FINB 2NUCA 3TSSA 1PFBA 3MFGA 1Q81C 1CA6A 3M4OH 3NWSA 4A76A 1WFQA 2UUCQ 3KDFA 1L0XB 3TDQA 2UXDL 3DEOA 3X3MA 4IPDA 4GNXA 1I3QH 3NTIA 2UU9L 1Y1VB 3CPFA 2Z6BA 1A3VA 3T16A 1WCMG 2DJFC 2EE1A 1KD1C 4JI7Q 1QJOA 3G71A 1SE4A 1YJ9A 1PTOD 1EFWA 5CV6A 4IUTA 2KBNA 4NP5A 4HJ7A 4A3FH 5A35A 4IN3A 2TMPA 1GO3E 4POGA 3RZOH 4QIWE 1Z9FA 4DV2L 4X65Q 4QF4A 3RLFA 3FKIG 4LF4Q 1XNRL 3TRZA 4GOPA 4N9TA 2I5LX 3QWNA 3EA6A 1SMYC 2VZAA 5KYLA 4XYOA 3J7ZC 1D1IA 1MSGA 1UE7A 3BDOA 3CPWA 4A3GG 5CV8A 4A3JG 5CYUA 2B2YC 1JC7A 1TWCH 2D2CC 3C1EA 1FYCA 4WJ4A 1NSNS 2QF7A 1TS3A 5C4ZA 2BA1A 3W1GA 4HIDA 2HT1A 2JA5H 1EWCA 3K7AH 3QG1A 1A0IA 2EYLA 2OEOA 2LS01 1I6HH 2K03A 2EY2A 3OWEB 1DONA 2BE5D 1EIGA 1EY0A 2ZXRA 4ZUIA 1LM0A 1D6EC 3VR2A 1FJGL 4IUNA 5C0XI 2LXJA 1RL2A 1I4GA 4LFBQ 2JE6I 1SJED 1IZ6A 2BH8A 1C9OA 1MGSA 4A3BH 1BOSA 1GUNA 5EAYA 5DAUA 1SE3A 3AU7A 3KF8A 3I3CA 4LAAA 5I4DA 5HGTA 4JI0Q 3HOZG 4POFA 1NBWA 5GAHC 1DOLA 3EIVA 5M5XH 5FJ8G 3EFXD 1K73C 1VDZA 3BJUA 3STBC 1KNEA 2B2UA 2K4KA 3PO3G 1X3QA 4RCNA 3V05A 1PMRA 1JICA 2RQXA 4XIGS 5A2QE 1PVOA 3CXCA 1FNVA 4UP8A 2V4DA 1PYSB 4RHRA 5FLMH 3TZUA 1EIFA 5C4XB 4GZYC 2F0DA 5C4JH 5D3DA 1TWGH 2VS1A 3TP5A 1L2FA 4K6LA 1WOCA 3WDNA 2AMCB 2IY5B 1TWFH 1SFOB 2E75C 1B3AA 4C56C 4X64L 2O5IC 3K57A 4QJFA 4TKOB 1J5EQ 1K0RA 2F3IA 5LMUL 4DR3Q 1VCIA 2L15A 1F9PA 3G6JB 2AKWB 5COYA 5FLXE 1EYCA 5IGCA 3K81C 1GXDC 4FXKC 4ULLA 2MNAA 3CHBD 1LTTD 1YNNC 2B2WC 1Q86C 3IFDA 1IXRA 3TBIB 5DM63 1Y1WH 1PZID 1Q12A 4DR6Q 4ZCKA 2UUCL 1SDFA 3T13A 1FL0A 3EVQA 3NELA 1EY7A 1TWHB 2MPMA 4C3JG 3S1RB 1Q1BA 5KEEA 4QL5A 5HY6A 3S17H 4GN3B 4P73A 1YHQA 4JI7L 1LYLA 1E24A 1Q7YC 4NB3A 3HOYG 4EGVA 5CV4A 3FRPB 2JQOA 4LFCQ 4AYBE 1CA5A 2HD3A 4DR5Q 5M3FB 1CQVA 1Q8IA 2RBMA 4X65L 2ATWA 3LGJA 1QVCA 2KCNA 1L1OB 1BCPB 1LT3D 3Q24A 2UXBQ 3I8ZA 4IFDI 1B9NA 2HCIA 1QUQB 3BZCA 4CDCC 2B63G 1BBWA 5BN4A 1EY8A 1QCBD 1U4PA 1W6JA 1JQYD 1I3QB 2EY1A 2B39A 1J9OA 4RCOA 3HOXB 1B9MA 3UE0A 1AFPA 3KLWA 4ME5A 4K2KA 3ERSX 1W3SA 3JAML 4A3KH 2ICEC 1SMXA 3R3OA 4K5XA 5E4WC 1Y69U 3F8TA 3MC0B 2QDLA 1E2VA 4HCSA 5IYBH 3I90A 3S15B 1O80A 4L6TB 5LL6S 1WTXA 1H9SA 2ES2A 1DD2A 3A0JA 3GTMH 2B2YA 1RKNA 2CH4A 2ZTDA 4G4KA 1I94Q 4A3DG 1Q90A 3J80c 3U4ZA 2EYPA 1ICFB 2IHFA 1UE1A 1XTCD 4JI0L 1K8MA 5K5PA 4C2MH 1Q8KA 4IJHA 2ALYB 1HRJA 1QNUA 1ICWA 2F0SA 2JEBI 4ID6A 1BDOA 2MGSA 4IUUA 5IGFA 2HCCA 1LT6D 3M3YB 2Q2UA 3NBIA 1P8LA 4JI6Q 3C3LA 3M4PA 3CKIB 2JA5B 2YV5A 1GOZA 4IUVA 3JAMi 4A93B 1FGUA 2FXQA 1NR2A 3PUXA 4B9WA 4OO1G 5EKKA 3HOUG 5IIFA 1VQ4A 3MXPA 2R7ZG 3R8BA 1SYBA 3TN2A 2AQ3B 1J5EL 5KGUA 2RDHA 5CGKA 5EKIA 5ELBA 4DR3L 3NHHA 4CDDC 1HR0Q 1U9RA 4A3EH 4JI4Q 1H9JA 2JP1A 3NK9A 5EPKA 1S5DD 1CKOA 1JB3A 4JW0A 3H0GG 4CKEA 4A3MH 2K05A 2B2VA 4NXNQ 1CQFA 2O2LD 2OXPA 1YJNA 2VB2X 1JOKA 2K28A 1STYA 2A1AA 3A7AB 2PW7A 2VY3A 5ISRA 4DU9A 1GJXA 5IP7G 2WP8J 4YCUA 1KDAA 1PHJA 5I2YA 2YTYA 4KY5A 2WINB 4JBJA 3V2TA 1IW7D 3A55A 1EZ6A 5G3LD 5J3BA 2VW9A 1VQPA 4LF8L 2E2IH 2WAQB 4BY7H 2B2WA 2CW0D 3RLNA 1G91A 2HQEA 3DUZA 3VA7A 1A6XA 4KJNA 4LFCL 3S16B 1M90C 4DR5L 2I5HA 3D4RA 4BY1H 3I91A 5IYCH 1YIJA 3NBHB 3X3NA 1A3UA 2A5HA 1NAPA 4YIJA 1MJCA 1ZYRD 1B2TA 2JA7G 5I9OA 4TRDA 1EU4A 5FOBB 1GUTA 3K0YA 3VDYA 2D0PA 4MNOA 1NMFA 4KI0A 4UP9A 3S17B 4R4IA 3K58A 2F52A 2WKDA 5IODA 3K5LA 4DF7A 3H3VH 3NENA 2F0WA 4YY3Q 2N78A 4IO9A 4XYQA 1G6ZA 2E8GA 4LUZA 4BBRB 3GTGH 3FVQA 2AQ2B 1E1TA 4DUYQ 1I94L 1EWIA 1QVGA 2MP1A 3UE1A 3U50C 5CBEE 1SYDA 1W6KA 3RN5A 2NN6G 2NZHA 1OXXK 4C1NI 1CK1A 1WCMB 2PYKA 4LMQD 3KYHC 3HG9A 1PRTF 4A3LG 1PFNA 2RVLA 3HP3A 1OXUA 1RTOA 1C0AA 1HHVA 1A63A 1T9HA 4WJ3M 2C9OA 3H94A 3MVVA 2CKZB 1PYWD 2K52A 4BBSH 2PQAB 3S1QH 1WJJA 2L9HA 2JA8H 3FKIB 4ZQ3A 1VQGA 1BKBA 5I6YA 3PF4A 5AFWA 1SSOA 3A8JE 1KDBA 5IWAQ 1DXMA 2FMMA 2A6HC 4H02A 1PH7A 4EQPA 2QILA 1Y8OB 3P7JA 1U5KA 3EROA 1CSPA 4A3GB 2A69D 4GN4B 3RLOA 2WACA 4A3JB 1HR0L 4JI4L 1HCZA 4R1JA 2NZOA 4A3FG 4C3HH 1KLUD 3OWFA 4CDEC 5KNCA 2NZ1D 4NXNL 3WWVA 1LO5D 2SNSA 2GN5A 2JA9A 4UHVA 2K32A 1TWAH 5TSSA 2K14A 1BF4A 3CCJA 1PA6A 2IHEA 3UDFA 1R4PB 1KHIA 4DK1A 1GKHA 2CW0C 3QR8A 3URYA 2F0QA 1QZHA 1Z7TA 2Z4HA 1I5FA 3I56A 1L1OC 1K28A 1BCPC 2E5LQ 2R3ZA 4A3CH 5KYIA 5F2DA 4NXMQ 3J7YW 1RHPA 2JA5G 5M3MH 2NVXB 1FNUA 2CFMA 2VQEL 1LACA 1ESRA 1VMCA 1OXVA 1FNWA 1ZYRC 4A3EB 3PO3B 3S2HH 1LABA 2RDFA 5C3XA 1IBMQ 2ZM6Q 1QOHA 1KDCA 3E0EA 4JI5Q 3PF5A 1MJEA 4OO1I 4A3BG 5ELNA 1PXUA 4L5TA 1VQOA 4FNFA 1S3OA 3OHXC 3RZDH 1AP0A 3H91A 2KEEA 1AW7A 2RHSB 5JOBA 2B2TC 1D5ZC 2JSOA 4XQNA 1CFMA 3SXHA 2L1BA 4OXPA 3KJPA 2E2IB 4HN7A 1AE3A 4YY3L 5FLMG 1UE5A 5JJLA 3HS0C 3HGBA 1EUJA 4DUYL 1D2BA 5FO8B 1IL8A 4CKCA 1I4XA 1STBA 4C3JB 4DR7Q 4A3IH 3D3RA 4ODGA 4JOIA 5JEAH 4P71A 1K8OA 5GADC 2K75A 3LWEA 4ZUJA 2BCOA 3SK4A 1HA5A 2K5QA 2VXWA 1CKNB 2CH4W 3HOYB 3LNNA 5KRUA 4R4OA 3IKJA 1LTSD 2Z9HA 3STBD 1O7YA 1Y1WG 1MD2D 4HJ5A 1G6PA 2F0VA 5C44H 2Q8TA 3HKZE 4A4IA 1G51A 1EEFD 2F3VA 2NTSA 3VA5A 1XNQQ 3ER0A 1X55A 2JYOA 5IWAL 3GTGB 1X3GA 4FXDA 1JB7A 2B63B 5IP9H 1HZBA 1X6OA 3QOJA 5NUCA 3I72A 4U673 5BR8Q 4KTAA 1B1ZA 3OOCA 3PIO3 1XMQQ 1V1PB 3KUPA 2CWAA 2UUBQ 3I73A 1K8GA 1EZ8A 4Q5VA 1PH4A 1YNND 2F3WA 1I50H 4BA2I 5D3IB 2J4XA 3AMUA 1QZGA 3F2CA 2DY8A 1T5EA 2NN6I 4JPBW 4RKBA 5LMNQ 1N34Q 3DM3A 1JE5A 4DV1Q 1K83B 3CCUA 3L0OA 4A3DB 1JOOA 2JA8B 3IRBA 2E5LL 1TY0A 1B7YB 1B3QA 2F0LA 4Y7NB 3GTPH 4JC0A 2WKCA 4QB4A 4NXML 1OO9B 1S4ZA 4A3KG 4X3TA 5IT9L 2EDGA 1D7QA 4KHPQ 3E3XA 1VF7A 4LW1A 1SEBD 3J81j 1HZAA 2Z4IA 3A54A 3SK8A 5IYBG 2N88A 1VQBA 1DGSA 2PI2A 3M4YA 1KAWA 2JN4A 1X32A 1S5CD 1NY4A 4JI5L 3MEFA 1YEZA 3S1NH 1TR5A 3GQBA 1N32Q 1OXSC 1TWAB 4OHJA 2EYOA 3WOFA 2X6GA 4PZ8A 4X62Q 3D6WA 4P72A 2KHSA 3HOUB 2R7ZB 3D0FA 4LK1C 5GROA 1SYFA 4J8QA 1LTGD 2QEXA 4JVZA 2C35B 2M2LA 4UAIA 4LF6Q 1V1OA 2E2JH 4N9PA 4YHHL 1O7LA 2K6AA 5HGQA 3GTJB 3TMEA 1IYJB 5JEAJ 1QNKA 4KN4C 3H0GB 4G57A 3CCSA 4KD3A 3Q6SA 2KECA 4RAUC 3KLSX 1CKMA 4IPCA 2HDLA 5JPMC 3JAMc 3S2HB 2SEBD 1GUWA 2F0OA 5C3EH 3PIP3 4DR7L 4AYBB 4DR4Q 1AE2A 4DA2A 2F4VL 3GTOH 2H5XA 4A3EG 1S72A 2IX3A 3CQZB 4QQBX 1IBKQ 1ET9A 4JK1C 2RKSA 2KUMA 5JAVA 3J80E 3RZDB 1EY5A 4QUCA 4A3MG 1VQKA 4HIMA 2GVAA 4BWGB 2VQFQ 3QB3A 1LTLA 5JVH3 2QDBA 1EYDA 3ULLA 1D5MC 1SN8A 1XNQL 4DV7Q 4O0AA 3SE0A 4DNTB 1R9TH 2J0TD 2JA7B 4GLXA 2HDMA 4BY7G 4I7ZC 1SE8A 1O7IA 1MHWC 4DK0A 3S2DH 5D65A 1VQ6A 4K5WA 1XMQL 3VR4A 4O1NA 3TZDA 1HFGA 4XT3B 1ONLA 4QUFA 1RDPD 4ZK9B 1PH1A 2UUBL 2R92H 4K6DA 4HTHA 3GTQB 3ITPA 3I2ZA 4OWWB 1SYEA 2KCCA 1ASZA 1HA6A 1H9KA 4FVMA 4BY1G 2NVTB 5IYCG 3AEVA 4B9XA 4BXXH 2VUMH 3KFUA 4KJOA 2IWHA 2AQ1B 5LMNL 1STNA 1N34L 2Q2TA 3MHBA 4DV1L 4KKTA 1SRUA 4KKUA 5C44B 4GNXB 3J7A5 3H09A 4YWMA 4FDBA 4RFBA 3J81L 4ILWA 3R2TA 2LFNA 3PGZA 2F0UA 2QEJC 4EX5A 3SHLA 2XRQD 5E1FA 3GO5A 4L5SA 4KHPL 4N8X1 4LF4L 1VQEA 1X65A 2DGYA 2DY7A 3M7GA 5CV5A 4HCEA 1CM9A 1A8VA 2I46A 3HOWH 1STHA 5IE8A 1K8AC 1S5FD 4ZKBB 1LLRD 1AZPA 3M4OB 1LTID 1RODA 1CZGA 2J7ZA 2RCFA 1A2UA 2DNCA 1EIHA 2WB1E 4JI3Q 4PZ7A 2R6GA 4ZLTF 4X62L 1E1OA 3PUYA 2PZWA 4NW2A 4KY6A 1II3A 1TS5A 2ZT9C 5LL6X 2YU9H 1STGA 4LF6L 3PUVA 1DOKA 3FPPA 3J81i 1NNXA 4A3FB 4FYDA 4V0BA 4BBSG 3RZOB 2M9VA 3QOLA 2A6ED 3J7AF 1JT8A 1HXYD 4LFBL 1C8CA 2JA8G 2EPBA 4OWTB 2L55A 2XWBB 2WIIB 1HNWQ 5M5YH 1KTKA 1XMOQ 3BU2A 1FD7D 4HSVA 2BA0A 3I4MH 2ID0A 4MHEA 2CVRA 3PSIA 3FPUB 1EOVA 3Q0AA 4FF4A 2FJ2A 3EBEA 3KBXA 2ZTCA 1AEXA 2KHIA 1N8RC 4B08A 3AB9A 2AUKA 2A19A 1TWCB 1JCKB 2LSSA 2PW5A 2JK8A 3KF8B 2G9HD 1IBKL 1X3PA 4C3HG 1N33Q 4MZ9A 2NVYH 5JJIA 4KLKA 3GTKH 2A74C 3ONAB 1ENFA 1I4QA 3K7AB 1VF5C 2VQFL 2ZJRA 5M5WH 3FP9A 2Z0SA 2PCFB 3SEBA 1I6HB 1M1KC 2E2JB 5KNBA 4HJAA 3PO2H 1F2MA 2IX0A 4DV7L 3S14H 2XN9C 4XXEA 1MIUA 1WTVA 1HZCA 1ENAA 1EIYB 4UPAA 1KIXA 4GKKQ 5BN5A 4A3BB 1EFID 2PI2E 3HEJA 2A6HD 1WTOA 3VR3A 3CCMA 4A3CG 1B53A 4RHSA 4JI2Q 1JR0D 5M3MG 1XPOA 2DNEA 4H44C 4DR6L 1PTOH 5M5XB 3I4NH 3KJOA 3HOZH 2ASBA 1TY2A 2Z6KC 3ULPA 3AQQA 3MA2B 4AYBG 2NBFA 3SDZA 2EVBA 4QMGA 3Q22A 5C4JB 4FF1A 4LUOA 4BA1I 1TWGB 5FO9B 1O7ZA 1V8QA 1WVLA 5T1IA 3S1MH 4F88A 4DR1Q 1Q46A 1TWFB 3SR1A 3U9OA 1PH3A 4DK6C 4RGOS 1OXTA 4DGZA 4OL7A 3GTLH 4DPGA 1BCPD 4PV1C 5CR3A 1UUPA 2KVMA 2WB1G 4WJWA 1TVXA 2QKIC 2UXBL 4N8FA 3CMEA 1NTGA 1I4PA 4TSSA 1GD7A 1YNJD 3GP7A 2G5DA 1Y1WB 2ICIA 5ELOA 2R92B 4IJLA 4L63B 3CCEA 2HUGA 2VL6A 2NTTA 3TEHB 4OGQC 5FKAC 3E9HA 4DAVA 1STAA 3TREA 3BYYB 4JI3L 2L11A 1EEID 3R93A 3J7AV 3ZJYC 4A3IG 5JEAG 3TP6A 1VMPA 1LTAD 5IGGA 5C6AA 2A6EC 4Z9CB 1AN8A 4MTNA 4QCLA 4IURA 5EPLA 4QGUA 2NVQH 3TQYA 1EY6A 5J1ZA 4B3TQ 5IGBA 1JJCB 1XPRA 1T5XD 4DV6Q 5A2QL 5C44G 2EYFA 3OSOA 2YTXA 4CJ1B 1HNWL 2EJFC 2XGTA 1EL0A 3A7LA 4OX9Q 1XMOL 4R8IA 3C2PA 3K5OA 4R4TA 1N36Q 4K8IA 1ILQA 4RGNA 4DUZQ 4O42A 4DK3C 1JMCA 2IJ0A 4OONA 1KRTA 3Q23A 5IP9G 4R9WA 1QWYA 1SE2A 3KK7A 1GHJA 1PFSA 2EZVA 3DM1A 4WRDA 2ZTEA 4JI6L 3FHWA 4IUQA 4I7AA 4LFAQ 2EYJA 1H95A 4DAYA 2E2HH 3HOVH 3JC66 4AIMA 4A3KB 4L5QA 3IFTA 3AFQA 5HURA 5IYDH 2L5TA 2ZXPA 5CV9A 1FGBD 2F0GA 1DCZA 4KY7A 1K9MC 1VQ5A 5EBDA 3P75A 3TS2A 1HTLD 2JA6H 5AJ3Q 3CMAA 1Y1VH 3GTMB 1HJPA 2KOLA 1U0LA 4JBWA 5E4XA 2SOBA 1S5ED 5J39A 2FMCA 4GKKL 1WTRA 2EJMA 1PRTB 3W1BA 1E22A 1I4HA 1TU2B 5KNDA 4KD4A 1JJGA 4C2MB 5L37A 4GNXC 1TIID 5I9PA 1HUMA 1CI3M 3BS1A 4C3IH 1EY4A 4U68A 4YCVA 2UXCQ 1VS0A 1PTOF 1DZ1A 3I7FA 1SROA 1G8ZD 4PMCA 3BG3A 1PH8A 3DXJC 4HMJA 4LF5Q 3F1ZA 2JEAI 1HH2P 5JJZA 3PCOB 3P20A 4LUVA 1VQ7A 1SNPA 2JXMB 3L3OC 4HEDA 4DR1L 3NTHA 3IL8A 2Q2HA 2IT1A 1LTBD 3BVGA 2K7VA 4HIOA 4JG2A 3PQIA 2EY5A 4B3SQ 1XX8A 2Z8LA 4OIJA 1YNJC 2D0OA 2PO4A 2YYZA 3HKZB 4O2DA 4GOPC 2XSCA 3BYTB 3D31A 2MQHA 1E2ZA 1BR9A 2D62A 1RF2D 4V190 3QIAA 4X6AH 4A3MB 3D4WA 4DAMA 2Y0SE 1Y8NB 1BBXC 1GVPA 1SYGA 2AUJD 3M85A 1YJWA 3ICEA 5IT9c 3BZKA 4R8NA 5LHY1 5C3EG 1UWVA 3ERQA 3SVMA 4DV4Q 1Q3LA 2R7FA 1IBLQ 1KABA 2I5MX 2L4NA 1I4RA 1ENCA 4C1NK 1JWSD 4BS9A 4BY7B 1SNDA 1A3TA 2LXKA 3OTOQ 4B3TL 3K5MA 1RCVD 2KCTA 4DV6L 1ZEQX 2CQAA 1IL2A 1K0SA 5C4XH 4IALA 2D5DA 5K36H 4PZ6A 4OX9L 2AWOA 1G2SA 4BY1B 4P75A 2A73B 1N36L 1VQ9A 3QO2A 3KF6B 4QIWB 1RIPA 4XTCS 4CGYB 1SFOH 4P2CB 1X3FA 2B2UC 1X9NA 1JOQA 1SBBB 1D8LA 2PMZE 3OYYA 1GUSA 3JAME 4ZYSA 5EGTA 2R92G 2XWJB 2H4OA 4G7OC 1A62A 4X3UA 3L7ZC 1PFMA 4HAEA 2SNMA 4HJ9A 4B3MQ 2Q8IB 4WFN3 4BXXG 4IUPA 3A5UA 2VUMG 4ZAIA 2NVQB 1TXYA 1NUCA 1TWHH 2BOSA 2EOTA 4DXGA 4NKLA 3S1RH 1M4VA 1I6VC 2QCPX 4FO2A 5FK9C 1PV4A 2HHHQ 2GVBA 1KLGD 1NE3A 4IOCA 1G291 1HZ9A 1YZ6A 3QJYA 3KLRA 4H13C 2DJGC 3DWQA 1B70B 3A5ZB 3BDCA 3Q8DA 5ELEA 3V96A 2MJ8A 1IHZA 2LMCB 2N55A 2L0CA 1VQDA 3CP0A 3NPPA 4X64Q 2F03A 3ZYYX 4J1MA 2XVSA 5M3FH 1DOMA 1E3PA 2E2DC 3SK6A 5DNFA 2UXCL 1O78A 3KLSA 4MN3A 1WD1A 1EU3A 3OMGA 1YVCA 4GLVB 3P1HA 4H7BA 4BBSB 3S1QB 5J22A 3HOVB 2KEDA 2N3SA 2OTJA 3T51B 2F0MA 4FXGC 1PDQA 2EXDA 1VQJA 3M4QA 3D6CA 2JA6B 3HOXH 3UI2A 2Y0SG 4B3SL 4MIUA 2HIVA 1CSQA 5CORA 3ULJA 2VNUD 1VQNA 1IBML 3J81c 2ZM6L 5CV7A 4C3HB 2RDGA 2E76C 1L1OA 4ME3A 4KV6A 4RGMA 3RUZA 4JCVE 3S15H 1CHQD 3VR5A 2EXZA 3RR5A 1D1KA 3BVMA 3AYHB 4HSPA 4C3IB 1QUQA 1YITA 3T53B 1FVIA 5T1GA 3I4MG 2F0KA 3E0JA 1BVSA 3I4OA 2EYMA 4DV4L 5C0XH 2DN8A 1P16A 3CW2C 1IBLL 1SNQA 2SDFA 4EQOA 4LNQA 1VQAA 3MXNB 5E3FA 1AH9A 1LT4D 3GV6A 5H1SE 3MTSA 1F2ZA 3ND9A 3PUZA 4UDUC 2MO0A 2JJQA 4YCWA 3OTOL 3M3YH 2I07B 4RKLA 4AH6A 1UE6A 1WTHA 2OQKA 4ZKCB 5M3MB 1QILA 2YTVA 3TP7A 2X6LA 2B2TA 4KKSA 2CWPA 3PO2G 4A93H 3N6RA 1N9WA 2BDOA 2PNRC 4DNIA 1Z6HA 3OW7A 4NDXA 3PIOA 1Z47A 1L0YB 2XRSD 2KHJA 3HKZG 5ELFA 3G4SA 4HMIA 3GV3A 2PPBC 1XWEA 4DAPA 1ZXTA 2AWNA 1GM5A 1ILPA 3I4NG 2CCZA 3MAQA 3RNUA 1VQCA 4DN4M 4DR2Q 3TP8A 2IW3A 2WB1B 4B3ML 3T1HQ 2Q2IA 1A2TA 1PRTC 4HIKA 3FDTA 2F0EA 5D14A 4IZ8A 4GS3A 4XQQA 2HHHL 4CKBA 3OW2A 2F1MA 3KBGA 2OTLA 1KXLA 5BR8L 1SNCA 2BDNA 3OMCA 1X3EA 1KRSA 2F0IA 4JI1Q 3K59A 2B2VC 5CBAE 4A3IB 1SLJA 3RN2A 5EQ0A 2EIFA 1JWMD 1E2WA 2IL8A 3NE5B 3T1YQ 1PYBA 1U4LA 2XIWA 3S16H 1SXTA 5G3LF 3RD4A 2B8FA 1QVFA 3EQLC 5JJKA 5EBCA 1XXGA 1YHAA 1F9QA 2TSSA 3DWAA 3KDFB 4UY8C 3CD6A 2KCMA 1BCPF 4YWLA 1EOTA 1MBYA 4B3RQ 2MO1A 5DM73 4NPSA 1G2TA 2RF4A 3WOEA 3BDLA 5ELDA 1VQLA 4IFDH 3PV0A 3VYTA 1HTPA 3C46A 2RA4A 5EKLA 1PTOC 1HUNA 4RG1A 1C7YA 1CHPD 1U4RA 2WV6D 4X66Q 3K5NA 2E74C 4GLAC 1KL9A 2RSOA 1LTRD 4LF8Q 3I55A 4IPGA 5C0XJ 4CHTB 4LF9Q 1E7ZA 2K5NA 3E9IA 2C5CA 4OELB 3PIPA 2R93H 3RMHA 1QB5D 3NBHA 1EQVA 4NMZA 4BBRH 4GOPB 4R4QA 1N32L 4GN5A 4ZRZA 2CQOA 1K3RA 1I50B 1WTQA 1LUZA 1RD9D 1S5BD 3VYSA 2EY6A 2A8VA 5IOCA 4DNRB 1HNXQ 1WCMH 2PZTA 4AQYQ 3CC2A 1R4QB 1ZKOA 3E6ZX 1EQQA 1JE4A 4DFAA 4LWCA 4XDXA 3GTPB 1CT1D 4RA8A 3B6YA 4DV3Q 3DHQA 4DXFA 1YBYA 3HOVG 2HQLA 4L5RC 5JPNC 2UUAQ 2BH2A 5IYDG 1LV9A 2BE5C 2F0NA 1U4MA 3FKIH 2JA6G 3E5SA 1Y1VG 4DR4L 1X54A 3C1FA 2GA4B 3T56B 2K5HA 1E0BA 2G9DA 3S1NB 3D4DA 1Y14B 1J6QA 3NTKA 1BXTA 3G7LA 1JORA 4L8JA 4A3GH 2EJGC 3BVZA 3H3VC 4A3JH 1QE6A 4I65A 1DM0B 4Y52H 3CF5A 2O5JC 3HZXA 3GDEA 1CZWA 1JWUD 1MKHA 2A68D 1SNOA 3CAMA 1HR0W 2DUDA 1UNSA 1H9RA 1YI2A 1SYCA 3CCQA 4DR2L 4C3IG 3HFZB 1TS2A 1ASYA 3R2IA 3T1HL 2PQAA 1HQMC 2K33A 4JI8Q 1EYAA 5GAEC 1A15A 3OIQA 5IGDA 1ET6A 1NMGA 3M7NA 1NR4A 2PZUA 4KHVA 3L9AX 5FLXc 2MUYA 1YHBA 4K0KQ 3NSWA 1B8AA 4EVOA 2VB3X 3I70A 4JV5Q 4X3SA 4JI1L 5C3EB 1UEAB 3DWPA 3W3AA 1VQFA 2B29A 2CHBD 3T1YL 4OWXB 2ZJQA 3GTOB 2NVXH 2X69A 5C4HA 1F2YA 4J6HA 1STEA 3UDIA 4LF7Q 4IFDJ 1EWHA 5FJ8H 5IGEA 5I2XA 3T4AC 3PO3H 1F9SA 2F0PA 1MSHA 1HQRD 4APVA 1D5XC 1X56A
chains in the Genus database with same CATH topology
4YWKA 2UUCL 1PH8A 1I50H 1FL0A 4B3RL 4BA2I 4LF5Q 3F1ZA 3NELA 1QZGA 2JEAI 3F2CA 1HH2P 3DLLA 2NN6I 3PCOB 5LMNQ 4LUVA 1N34Q 1HNZQ 1VQ7A 1Q1BA 4DR6Q 3DM3A 1JE5A 4DV1Q 4QL5A 3CCUA 4DR1L 3L0OA 5HY6A 3S17H 1KC8C 3F2BA 4GN3B 3IRBA 2Q2HA 4P73A 1JJ2A 2E5LL 2IT1A 1YHQA 1B7YB 4JI7L 1LYLA 4HIOA 4JG2A 3GTPH 1E24A 4TQUS 2PNHA 4JC0A 4B3SQ 2I0QA 3K80C 1Q7YC 4X66L 3UDXA 4NB3A 2XTIA 2D0OA 2YYZA 4O2DA 4GOPC 3HOYG 4NXML 4DKAC 1PH4A 4A3KG 1VQ8A 1D7QA 3D31A 2WFWA 4PG3A 4KHPQ 4LF9L 2JQOA 2MQHA 4AYBE 4LFCQ 4LW1A 3J81j 1HZAA 4DR5Q 2D62A 3GD7A 4X65L 5C4XG 2ATWA 2MFIA 3LGJA 1QVCA 5IYBG 4X6AH 1VQBA 3H15A 1L1OB 1DGSA 2PI2A 4DAMA 5K36G 3K0XA 2Y0SE 2VQEQ 1KAWA 1V9PA 2UXBQ 1VQMA 1GVPA 1NY4A 4JI5L 3MEFA 3M85A 1YJWA 1YEZA 1L0WA 3S24A 5IT9c 3BZKA 3ICEA 3S1NH 4IFDI 1UEBA 3EN2A 1QUQB 3BZCA 5C3EG 1UWVA 1OXSC 1N32Q 4C3JH 2QA4A 1BBWA 2B63G 1HNXL 1XPUA 4DV4Q 2R7FA 1NJIC 4TVAB 4AQYL 4PZ8A 4X62Q 4ALPA 1IBLQ 2I5MX 3HKSA 4P72A 2V1CC 2OWOA 1SR3A 3D0FA 3UE0A 4DV3L 5GROA 3KOJA 3KLWA 3ERSX 2LXKA 3HOYH 1W3SA 3OTOQ 2QEXA 2C35B 4A3KH 2UUAL 4LF6Q 4B3TL 1SMXA 4JBMA 2E2JH 4YHHL 2KCTA 5HGQA 4DV6L 1IYJB 5JEAJ 4RMFA 3CCSA 3F8TA 1IL2A 5C4XH 5IYBH 4JOIC 4PZ6A 3F2DA 4OX9L 2AWOA 2ES2A 1CKMA 3A0JA 1CUKA 3GTMH 4IPCA 2ZTDA 4P75A 4PMWA 1I94Q 1N36L 1VQ9A 3JAMc 3KF6B 4A3DG 3J80c 1RIPA 4JYAQ 4XTCS 3U4ZA 1SFOH 1V1QA 5C3EH 3KF6A 1X3FA 2B63H 4DR7L 4DR4Q 1S40A 1AE2A 2IHFA 1X9NA 1UE1A 4JBKA 1N33L 2F4VL 3CC4A 1V43A 1D8LA 2H5XA 4JI0L 3GTOH 3H3VI 4A3EG 2PMZE 4C2MH 1Q8KA 3OYYA 4IJHA 2ALYB 4KHZA 2RCNA 1CKNA 1S72A 2JEBI 5M3FG 4QQBX 5IY0A 1IBKQ 2R92G 3NEMA 1A62A 3CCVA 3L7ZC 4A3MG 1VQKA 4HIMA 2GVAA 4HJ9A 2Q2UA 1P8LA 4B3MQ 4JI6Q 2WAQE 3M4PA 2VQFQ 4JI8L 4BXXG 3A5UA 1LTLA 2VUMG 1TXYA 1TWHH 2YV5A 3ULLA 3S1RH 1SN8A 3JAMi 3J80i 1XNQL 1K83H 1FGUA 2FXQA 3PUXA 4O0AA 4DV7Q 1R9TH 1PV4A 2HHHQ 4A3DH 3HOUG 4EQ5A 4GKJQ 2GVBA 4OO1G 4JV5L 1VQ4A 1NE3A 3HOXG 4Y7NH 4GLXA 2R7ZG 4IOCA 4JI2L 1G291 1HZ9A 1YZ6A 3M9BA 1OTCA 1XTDA 2R7DA 2IX1A 4BY7G 1J5EL 1SE8A 4DV0Q 1O7IA 1XJVA 3S2DH 1B70B 3A5ZB 3Q8DA 4DR3L 1PH2A 1HR0Q 3AFPA 4A3EH 1VQ6A 2B3GA 1XMQL 4HJ8A 4JI4Q 3CP0A 1VQDA 4X64Q 4R4CA 4LF7L 4DV5Q 1CKOA 4J15A 5M3FH 3L2PA 1PH1A 2UUBL 2R92H 1E3PA 3H0GG 2K50A 3I2ZA 4OWWB 4A3MH 2UXCL 1ASZA 4NXNQ 4BY1G 1YJNA 1YVCA 4GLVB 5IYCG 3AEVA 2A1AA 3CCLA 2VY3A 4BXXH 2VUMH 3KFUA 2N3SA 2OTJA 5IP7G 2WP8J 2UXDQ 5LMNL 4YCUA 1PHJA 1N34L 2YTYA 1HNZL 4JBJA 2Q2TA 5C0XG 2UU9Q 4DV1L 1SRUA 2EXDA 1VQJA 3M4QA 4GNXB 3J7A5 4YWMA 2RHQB 4FDBA 3HOUH 2Z6KA 5J3BA 3HOXH 2R7ZH 2VW9A 2Y0SG 1VQPA 3PGZA 2E2IH 4B3SL 4LF8L 4BY7H 3RLNA 4EX5A 2HIVA 1CSQA 3GO5A 1Q1EA 4L5SA 4IOAA 4KHPL 4LFCL 4LF4L 3ULJA 1VQEA 2VNUD 1X65A 2DGYA 4DR5L 1M90C 1IBML 3J81c 3GTJH 2ZM6L 1VQNA 3H0GH 2I5HA 1L1OA 4ME3A 4JCVE 3S15H 4DV2Q 1A8VA 1VQHA 4BY1H 3HOWH 5IE8A 5IYCH 4A75A 1YIJA 4P74A 1K8AC 3NBHB 1XNRQ 3CCRA 4A93G 3RR5A 3TS0A 5DLQE 3AYHB 1QUQA 1BBUA 1YITA 5IP7H 1FVIA 1MJCA 3I4MG 2JA7G 4IPHA 2WB1E 1BVSA 3I4OA 4JI3Q 4DV4L 3G6EA 4PZ7A 2R6GA 1P16A 4X62L 3CW2C 1E1OA 1IBLL 3A74A 4LNQA 1VQAA 1EYGA 3PUYA 3MXNB 1AH9A 3VDYA 2D0PA 4MNOA 1NMFA 5H1SE 1SROA 3CQZH 4KI0A 3PUZA 4UP9A 2MO0A 2QGQA 2JJQA 4YCWA 3OTOL 2YU9H 3U58A 4R4IA 2ZJPA 3M3YH 2F52A 4LF6L 3PUVA 4AH6A 1UE6A 2OQKA 3J81i 2HIXA 4BBSG 2YTVA 3SGIA 3H3VH 3NENA 4YY3Q 2OQ0A 2N78A 4IO9A 1JT8A 2E8GA 4LUZA 4QY7A 4UP7A 4LFBL 2JA8G 3W5OA 3GTGH 4OWTB 4DUZL 1HNWQ 2CWPA 1E1TA 4DUYQ 5M5YH 4YHHQ 1EWIA 1I94L 1QVGA 2K5VA 5E7NA 1FJGQ 1N9WA 1XMOQ 4DNIA 4A93H 3UE1A 3U50C 4JYAL 3BU2A 3PIOA 3UDGA 1Z47A 1PH5A 3RN5A 3U4VA 2BA0A 2KHJA 3HKZG 3I4MH 2NN6G 3G4SA 2NZHA 2JA7H 2ID0A 1PH9A 3PSIA 1EOVA 2WAQG 3CC7A 1OXXK 3EBEA 2ZTCA 2KHIA 1N8RC 1VQIA 4LFAL 3KYHC 2A19A 2LSSA 2JK8A 3KF8B 3PUWA 1PH6A 2AWNA 1GM5A 4A3LG 1W2BA 1IBKL 3K8AA 1N33Q 3I4NG 2N8NA 4MZ9A 2CCZA 3RNUA 3GTQH 1VQCA 2NVYH 1EQRA 1OXUA 2F4VQ 4DR2Q 5JJIA 1C0AA 2KENA 4KLKA 3GTKH 1A63A 2NVTH 1T9HA 4B3ML 3T1HQ 4DAYB 4WJ3M 2CKZB 5AJ3L 2K52A 2Q2IA 3G48A 2VQFL 4HIKA 4BBSH 2PQAB 2OCEA 5M5WH 3FP9A 2ZJRA 1WJJA 3S1QH 2Z0SA 1YNXA 2JA8H 1M1KC 4HJAA 1VQGA 1BKBA 3PO2H 4GS3A 1WYDA 2EQSA 2IX0A 4DV7L 3S14H 3PF4A 2HHHL 4IFDG 5LMNW 3OW2A 2OTLA 4GKJL 1KXLA 5BR8L 1MIUA 5IWAQ 1HZCA 1PH7A 4H02A 1X3EA 1KRSA 1EIYB 4UPAA 4JI1Q 1KIXA 4GKKQ 1KQSA 1U5KA 2PI2E 1CSPA 4DV0L 1SLJA 4GN4B 3RLOA 3RN2A 2EIFA 1HR0L 4JI4L 3CCMA 4A3CG 4R1JA 5LMUQ 1PYBA 3T1YQ 3S16H 4JI2Q 4A3LH 5M3MG 4DV5L 1XPOA 3HOWG 2NZOA 4A3FG 4C3HH 1QVFA 3I4NH 4DR6L 3KJOA 1Q82C 2N49A 2AHOB 5JJKA 3HOZH 2R93G 4NXNL 3K7UC 3WWVA 4LF5L 2ASBA 1YHAA 4BBRG 5GQOA 2Z6KC 5GAGC 1WI5A 2GN5A 2JA9A 3ULPA 1TWAH 3AQQA 2K14A 3KDFB 1Q81C 3CCJA 4AYBG 1PA6A 4UY8C 3M4OH 2IHEA 3CD6A 4A76A 1WFQA 2KCMA 3KDFA 3UDFA 2UUCQ 4YWLA 4B3RQ 1KHIA 2UXDL 1GKHA 2MO1A 4IPDA 4LUOA 4BA1I 4NPSA 1I3QH 2RF4A 4GNXA 3CPFA 2UU9L 1QZHA 1VQLA 3S1MH 1WCMG 1I5FA 3PV0A 4DR1Q 3I56A 1Q46A 1L1OC 1PH3A 2E5LQ 4DK6C 1OXTA 3GTLH 1KD1C 4JI7Q 4DPGA 4RG1A 3G71A 1C7YA 4X66Q 1YJ9A 1EFWA 4GLAC 4A3CH 4NXMQ 1KL9A 2WB1G 4LF8Q 2KBNA 2JA5G 3I55A 4IPGA 5M3MH 5C0XJ 2CFMA 2VQEL 4LF9Q 1E7ZA 4HJ7A 4A3FH 2K5NA 4POGA 1GO3E 3RZOH 3E9IA 1OXVA 3CMEA 1NTGA 4QIWE 2UXBL 1Z9FA 3PIPA 2R93H 4DV2L 4X65Q 1GD7A 4GOPB 4BBRH 3RLFA 3S2HH 3FKIG 4LF4Q 4R4QA 1XNRL 1N32L 4GN5A 1IBMQ 3TRZA 2ZM6Q 5ELOA 4GOPA 4IJLA 3CCEA 2CQOA 1K3RA 2VL6A 1LUZA 3E0EA 3TEHB 3PF5A 1MJEA 4JI5Q 4OO1I 3E9HA 3PO2G 2I5LX 3TREA 2A8VA 4JI3L 2VZAA 3J7ZC 4A3BG 5ELNA 1UE7A 1HNXQ 3ZJYC 3CPWA 4A3IG 4A3GG 1WCMH 4A3JG 5JEAG 4L5TA 4AQYQ 1VQOA 3CC2A 1S3OA 3RZDH 1TWCH 1EQQA 2RHSB 4LWCA 4WJ4A 3B6YA 4DV3Q 4MTNA 2BA1A 3W1GA 1YBYA 4QGUA 4OXPA 3HOVG 2HQLA 4HIDA 4L5RC 3TQYA 2NVQH 2HT1A 3KJPA 2UUAQ 2JA5H 4B3TQ 2BH2A 5IYDG 1JJCB 3K7AH 1AE3A 4YY3L 1XPRA 4DV6Q 1A0IA 5FLMG 5C44G 1I6HH 1UE5A 2YTXA 5JJLA 3FKIH 1HNWL 1EUJA 1LM0A 2XGTA 4DUYL 4OX9Q 2JA6G 1Y1VG 1FJGL 1XMOL 4DR4L 4R4TA 1X54A 5C0XI 1N36Q 2LXJA 1RL2A 4LFBQ 2JE6I 2K5HA 1IZ6A 2BH8A 1C9OA 1Y14B 1J6QA 4DK3C 4DUZQ 4OONA 1KRTA 1JMCA 4A3BH 5IP9G 4K0KL 4DR7Q 5EAYA 4A3IH 4A3GH 4JOIA 4A3JH 4P71A 4Y52H 1PFSA 3CF5A 5GADC 3GDEA 2K75A 1MKHA 4JI0Q 3HOZG 4POFA 3CAMA 1NBWA 2ZTEA 2DUDA 5GAHC 3EIVA 5M5XH 3FHWA 1HR0W 4JI6L 1YI2A 5FJ8G 3CCQA 4DR2L 1CKNB 1K73C 4LFAQ 3BJUA 1H95A 3STBC 3HFZB 2E2HH 3JC66 2K4KA 4AIMA 4R4OA 1ASYA 3HOVH 3PO3G 3T1HL 4L5QA 2PQAA 3AFQA 4XIGS 1PVOA 5IYDH 3STBD 3CXCA 1Y1WG 4UP8A 1PYSB 5FLMH 4HJ5A 1G6PA 5C44H 4JI8Q 1EIFA 3HKZE 4A4IA 5GAEC 1K9MC 1VQ5A 5C4JH 3TS2A 1NMGA 2JA6H 5AJ3Q 3CMAA 1Y1VH 3M7NA 1HJPA 1TWGH 2VS1A 1U0LA 1G51A 1L2FA 4JBWA 5FLXc 1XNQQ 1YHBA 1WOCA 1X55A 2AMCB 3ER0A 5IWAL 4K0KQ 1B8AA 2IY5B 1TWFH 1X3GA 4JV5Q 4GKKL 4JI1L 1JB7A 5IP9H 1HZBA 1X6OA 4X64L 1VQFA 2B29A 1E22A 4QJFA 3W1BA 1K0RA 5BR8Q 1J5EQ 2F3IA 3T1YL 5LMUL 4OWXB 2ZJQA 4DR3Q 1VCIA 1JJGA 2L15A 1XMQQ 2NVXH 2AKWB 3UDIA 2CWAA 4GNXC 3K81C 5FJ8H 4LF7Q 2UUBQ 4IFDJ 2MNAA 4C3IH 3PO3H 1K8GA 4YCVA 1Q86C 2UXCQ 1VS0A 1IXRA 4APVA 1Y1WH 1Q12A 3I7FA 1X56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YWK A;  2UUC L;  1PH8 A;  1I50 H;  1FL0 A;  4B3R L;  4BA2 I;  4LF5 Q;  3F1Z A;  3NEL A;  1QZG A;  2JEA I;  3F2C A;  1HH2 P;  3DLL A;  2NN6 I;  3PCO B;  5LMN Q;  4LUV A;  1N34 Q;  1HNZ Q;  1VQ7 A;  1Q1B A;  4DR6 Q;  3DM3 A;  1JE5 A;  4DV1 Q;  4QL5 A;  3CCU A;  4DR1 L;  3L0O A;  5HY6 A;  3S17 H;  1KC8 C;  3F2B A;  4GN3 B;  3IRB A;  2Q2H A;  4P73 A;  1JJ2 A;  2E5L L;  2IT1 A;  1YHQ A;  1B7Y B;  4JI7 L;  1LYL A;  4HIO A;  4JG2 A;  3GTP H;  1E24 A;  4TQU S;  2PNH A;  4JC0 A;  4B3S Q;  2I0Q A;  3K80 C;  1Q7Y C;  4X66 L;  3UDX A;  4NB3 A;  2XTI A;  2D0O A;  2YYZ A;  4O2D A;  4GOP C;  3HOY G;  4NXM L;  4DKA C;  1PH4 A;  4A3K G;  1VQ8 A;  1D7Q A;  3D31 A;  2WFW A;  4PG3 A;  4KHP Q;  4LF9 L;  2JQO A;  2MQH A;  4AYB E;  4LFC Q;  4LW1 A;  3J81 j;  1HZA A;  4DR5 Q;  2D62 A;  3GD7 A;  4X65 L;  5C4X G;  2ATW A;  2MFI A;  3LGJ A;  1QVC A;  5IYB G;  4X6A H;  1VQB A;  3H15 A;  1L1O B;  1DGS A;  2PI2 A;  4DAM A;  5K36 G;  3K0X A;  2Y0S E;  2VQE Q;  1KAW A;  1V9P A;  2UXB Q;  1VQM A;  1GVP A;  1NY4 A;  4JI5 L;  3MEF A;  3M85 A;  1YJW A;  1YEZ A;  1L0W A;  3S24 A;  5IT9 c;  3BZK A;  3ICE A;  3S1N H;  4IFD I;  1UEB A;  3EN2 A;  1QUQ B;  3BZC A;  5C3E G;  1UWV A;  1OXS C;  1N32 Q;  4C3J H;  2QA4 A;  1BBW A;  2B63 G;  1HNX L;  1XPU A;  4DV4 Q;  2R7F A;  1NJI C;  4TVA B;  4AQY L;  4PZ8 A;  4X62 Q;  4ALP A;  1IBL Q;  2I5M X;  3HKS A;  4P72 A;  2V1C C;  2OWO A;  1SR3 A;  3D0F A;  3UE0 A;  4DV3 L;  5GRO A;  3KOJ A;  3KLW A;  3ERS X;  2LXK A;  3HOY H;  1W3S A;  3OTO Q;  2QEX A;  2C35 B;  4A3K H;  2UUA L;  4LF6 Q;  4B3T L;  1SMX A;  4JBM A;  2E2J H;  4YHH L;  2KCT A;  5HGQ A;  4DV6 L;  1IYJ B;  5JEA J;  4RMF A;  3CCS A;  3F8T A;  1IL2 A;  5C4X H;  5IYB H;  4JOI C;  4PZ6 A;  3F2D A;  4OX9 L;  2AWO A;  2ES2 A;  1CKM A;  3A0J A;  1CUK A;  3GTM H;  4IPC A;  2ZTD A;  4P75 A;  4PMW A;  1I94 Q;  1N36 L;  1VQ9 A;  3JAM c;  3KF6 B;  4A3D G;  3J80 c;  1RIP A;  4JYA Q;  4XTC S;  3U4Z A;  1SFO H;  1V1Q A;  5C3E H;  3KF6 A;  1X3F A;  2B63 H;  4DR7 L;  4DR4 Q;  1S40 A;  1AE2 A;  2IHF A;  1X9N A;  1UE1 A;  4JBK A;  1N33 L;  2F4V L;  3CC4 A;  1V43 A;  1D8L A;  2H5X A;  4JI0 L;  3GTO H;  3H3V I;  4A3E G;  2PMZ E;  4C2M H;  1Q8K A;  3OYY A;  4IJH A;  2ALY B;  4KHZ A;  2RCN A;  1CKN A;  1S72 A;  2JEB I;  5M3F G;  4QQB X;  5IY0 A;  1IBK Q;  2R92 G;  3NEM A;  1A62 A;  3CCV A;  3L7Z C;  4A3M G;  1VQK A;  4HIM A;  2GVA A;  4HJ9 A;  2Q2U A;  1P8L A;  4B3M Q;  4JI6 Q;  2WAQ E;  3M4P A;  2VQF Q;  4JI8 L;  4BXX G;  3A5U A;  1LTL A;  2VUM G;  1TXY A;  1TWH H;  2YV5 A;  3ULL A;  3S1R H;  1SN8 A;  3JAM i;  3J80 i;  1XNQ L;  1K83 H;  1FGU A;  2FXQ A;  3PUX A;  4O0A A;  4DV7 Q;  1R9T H;  1PV4 A;  2HHH Q;  4A3D H;  3HOU G;  4EQ5 A;  4GKJ Q;  2GVB A;  4OO1 G;  4JV5 L;  1VQ4 A;  1NE3 A;  3HOX G;  4Y7N H;  4GLX A;  2R7Z G;  4IOC A;  4JI2 L;  1G29 1;  1HZ9 A;  1YZ6 A;  3M9B A;  1OTC A;  1XTD A;  2R7D A;  2IX1 A;  4BY7 G;  1J5E L;  1SE8 A;  4DV0 Q;  1O7I A;  1XJV A;  3S2D H;  1B70 B;  3A5Z B;  3Q8D A;  4DR3 L;  1PH2 A;  1HR0 Q;  3AFP A;  4A3E H;  1VQ6 A;  2B3G A;  1XMQ L;  4HJ8 A;  4JI4 Q;  3CP0 A;  1VQD A;  4X64 Q;  4R4C A;  4LF7 L;  4DV5 Q;  1CKO A;  4J15 A;  5M3F H;  3L2P A;  1PH1 A;  2UUB L;  2R92 H;  1E3P A;  3H0G G;  2K50 A;  3I2Z A;  4OWW B;  4A3M H;  2UXC L;  1ASZ A;  4NXN Q;  4BY1 G;  1YJN A;  1YVC A;  4GLV B;  5IYC G;  3AEV A;  2A1A A;  3CCL A;  2VY3 A;  4BXX H;  2VUM H;  3KFU A;  2N3S A;  2OTJ A;  5IP7 G;  2WP8 J;  2UXD Q;  5LMN L;  4YCU A;  1PHJ A;  1N34 L;  2YTY A;  1HNZ L;  4JBJ A;  2Q2T A;  5C0X G;  2UU9 Q;  4DV1 L;  1SRU A;  2EXD A;  1VQJ A;  3M4Q A;  4GNX B;  3J7A 5;  4YWM A;  2RHQ B;  4FDB A;  3HOU H;  2Z6K A;  5J3B A;  3HOX H;  2R7Z H;  2VW9 A;  2Y0S G;  1VQP A;  3PGZ A;  2E2I H;  4B3S L;  4LF8 L;  4BY7 H;  3RLN A;  4EX5 A;  2HIV A;  1CSQ A;  3GO5 A;  1Q1E A;  4L5S A;  4IOA A;  4KHP L;  4LFC L;  4LF4 L;  3ULJ A;  1VQE A;  2VNU D;  1X65 A;  2DGY A;  4DR5 L;  1M90 C;  1IBM L;  3J81 c;  3GTJ H;  2ZM6 L;  1VQN A;  3H0G H;  2I5H A;  1L1O A;  4ME3 A;  4JCV E;  3S15 H;  4DV2 Q;  1A8V A;  1VQH A;  4BY1 H;  3HOW H;  5IE8 A;  5IYC H;  4A75 A;  1YIJ A;  4P74 A;  1K8A C;  3NBH B;  1XNR Q;  3CCR A;  4A93 G;  3RR5 A;  3TS0 A;  5DLQ E;  3AYH B;  1QUQ A;  1BBU A;  1YIT A;  5IP7 H;  1FVI A;  1MJC A;  3I4M G;  2JA7 G;  4IPH A;  2WB1 E;  1BVS A;  3I4O A;  4JI3 Q;  4DV4 L;  3G6E A;  4PZ7 A;  2R6G A;  1P16 A;  4X62 L;  3CW2 C;  1E1O A;  1IBL L;  3A74 A;  4LNQ A;  1VQA A;  1EYG A;  3PUY A;  3MXN B;  1AH9 A;  3VDY A;  2D0P A;  4MNO A;  1NMF A;  5H1S E;  1SRO A;  3CQZ H;  4KI0 A;  3PUZ A;  4UP9 A;  2MO0 A;  2QGQ A;  2JJQ A;  4YCW A;  3OTO L;  2YU9 H;  3U58 A;  4R4I A;  2ZJP A;  3M3Y H;  2F52 A;  4LF6 L;  3PUV A;  4AH6 A;  1UE6 A;  2OQK A;  3J81 i;  2HIX A;  4BBS G;  2YTV A;  3SGI A;  3H3V H;  3NEN A;  4YY3 Q;  2OQ0 A;  2N78 A;  4IO9 A;  1JT8 A;  2E8G A;  4LUZ A;  4QY7 A;  4UP7 A;  4LFB L;  2JA8 G;  3W5O A;  3GTG H;  4OWT B;  4DUZ L;  1HNW Q;  2CWP A;  1E1T A;  4DUY Q;  5M5Y H;  4YHH Q;  1EWI A;  1I94 L;  1QVG A;  2K5V A;  5E7N A;  1FJG Q;  1N9W A;  1XMO Q;  4DNI A;  4A93 H;  3UE1 A;  3U50 C;  4JYA L;  3BU2 A;  3PIO A;  3UDG A;  1Z47 A;  1PH5 A;  3RN5 A;  3U4V A;  2BA0 A;  2KHJ A;  3HKZ G;  3I4M H;  2NN6 G;  3G4S A;  2NZH A;  2JA7 H;  2ID0 A;  1PH9 A;  3PSI A;  1EOV A;  2WAQ G;  3CC7 A;  1OXX K;  3EBE A;  2ZTC A;  2KHI A;  1N8R C;  1VQI A;  4LFA L;  3KYH C;  2A19 A;  2LSS A;  2JK8 A;  3KF8 B;  3PUW A;  1PH6 A;  2AWN A;  1GM5 A;  4A3L G;  1W2B A;  1IBK L;  3K8A A;  1N33 Q;  3I4N G;  2N8N A;  4MZ9 A;  2CCZ A;  3RNU A;  3GTQ H;  1VQC A;  2NVY H;  1EQR A;  1OXU A;  2F4V Q;  4DR2 Q;  5JJI A;  1C0A A;  2KEN A;  4KLK A;  3GTK H;  1A63 A;  2NVT H;  1T9H A;  4B3M L;  3T1H Q;  4DAY B;  4WJ3 M;  2CKZ B;  5AJ3 L;  2K52 A;  2Q2I A;  3G48 A;  2VQF L;  4HIK A;  4BBS H;  2PQA B;  2OCE A;  5M5W H;  3FP9 A;  2ZJR A;  1WJJ A;  3S1Q H;  2Z0S A;  1YNX A;  2JA8 H;  1M1K C;  4HJA A;  1VQG A;  1BKB A;  3PO2 H;  4GS3 A;  1WYD A;  2EQS A;  2IX0 A;  4DV7 L;  3S14 H;  3PF4 A;  2HHH L;  4IFD G;  5LMN W;  3OW2 A;  2OTL A;  4GKJ L;  1KXL A;  5BR8 L;  1MIU A;  5IWA Q;  1HZC A;  1PH7 A;  4H02 A;  1X3E A;  1KRS A;  1EIY B;  4UPA A;  4JI1 Q;  1KIX A;  4GKK Q;  1KQS A;  1U5K A;  2PI2 E;  1CSP A;  4DV0 L;  1SLJ A;  4GN4 B;  3RLO A;  3RN2 A;  2EIF A;  1HR0 L;  4JI4 L;  3CCM A;  4A3C G;  4R1J A;  5LMU Q;  1PYB A;  3T1Y Q;  3S16 H;  4JI2 Q;  4A3L H;  5M3M G;  4DV5 L;  1XPO A;  3HOW G;  2NZO A;  4A3F G;  4C3H H;  1QVF A;  3I4N H;  4DR6 L;  3KJO A;  1Q82 C;  2N49 A;  2AHO B;  5JJK A;  3HOZ H;  2R93 G;  4NXN L;  3K7U C;  3WWV A;  4LF5 L;  2ASB A;  1YHA A;  4BBR G;  5GQO A;  2Z6K C;  5GAG C;  1WI5 A;  2GN5 A;  2JA9 A;  3ULP A;  1TWA H;  3AQQ A;  2K14 A;  3KDF B;  1Q81 C;  3CCJ A;  4AYB G;  1PA6 A;  4UY8 C;  3M4O H;  2IHE A;  3CD6 A;  4A76 A;  1WFQ A;  2KCM A;  3KDF A;  3UDF A;  2UUC Q;  4YWL A;  4B3R Q;  1KHI A;  2UXD L;  1GKH A;  2MO1 A;  4IPD A;  4LUO A;  4BA1 I;  4NPS A;  1I3Q H;  2RF4 A;  4GNX A;  3CPF A;  2UU9 L;  1QZH A;  1VQL A;  3S1M H;  1WCM G;  1I5F A;  3PV0 A;  4DR1 Q;  3I56 A;  1Q46 A;  1L1O C;  1PH3 A;  2E5L Q;  4DK6 C;  1OXT A;  3GTL H;  1KD1 C;  4JI7 Q;  4DPG A;  4RG1 A;  3G71 A;  1C7Y A;  4X66 Q;  1YJ9 A;  1EFW A;  4GLA C;  4A3C H;  4NXM Q;  1KL9 A;  2WB1 G;  4LF8 Q;  2KBN A;  2JA5 G;  3I55 A;  4IPG A;  5M3M H;  5C0X J;  2CFM A;  2VQE L;  4LF9 Q;  1E7Z A;  4HJ7 A;  4A3F H;  2K5N A;  4POG A;  1GO3 E;  3RZO H;  3E9I A;  1OXV A;  3CME A;  1NTG A;  4QIW E;  2UXB L;  1Z9F A;  3PIP A;  2R93 H;  4DV2 L;  4X65 Q;  1GD7 A;  4GOP B;  4BBR H;  3RLF A;  3S2H H;  3FKI G;  4LF4 Q;  4R4Q A;  1XNR L;  1N32 L;  4GN5 A;  1IBM Q;  3TRZ A;  2ZM6 Q;  5ELO A;  4GOP A;  4IJL A;  3CCE A;  2CQO A;  1K3R A;  2VL6 A;  1LUZ A;  3E0E A;  3TEH B;  3PF5 A;  1MJE A;  4JI5 Q;  4OO1 I;  3E9H A;  3PO2 G;  2I5L X;  3TRE A;  2A8V A;  4JI3 L;  2VZA A;  3J7Z C;  4A3B G;  5ELN A;  1UE7 A;  1HNX Q;  3ZJY C;  3CPW A;  4A3I G;  4A3G G;  1WCM H;  4A3J G;  5JEA G;  4L5T A;  4AQY Q;  1VQO A;  3CC2 A;  1S3O A;  3RZD H;  1TWC H;  1EQQ A;  2RHS B;  4LWC A;  4WJ4 A;  3B6Y A;  4DV3 Q;  4MTN A;  2BA1 A;  3W1G A;  1YBY A;  4QGU A;  4OXP A;  3HOV G;  2HQL A;  4HID A;  4L5R C;  3TQY A;  2NVQ H;  2HT1 A;  3KJP A;  2UUA Q;  2JA5 H;  4B3T Q;  2BH2 A;  5IYD G;  1JJC B;  3K7A H;  1AE3 A;  4YY3 L;  1XPR A;  4DV6 Q;  1A0I A;  5FLM G;  5C44 G;  1I6H H;  1UE5 A;  2YTX A;  5JJL A;  3FKI H;  1HNW L;  1EUJ A;  1LM0 A;  2XGT A;  4DUY L;  4OX9 Q;  2JA6 G;  1Y1V G;  1FJG L;  1XMO L;  4DR4 L;  4R4T A;  1X54 A;  5C0X I;  1N36 Q;  2LXJ A;  1RL2 A;  4LFB Q;  2JE6 I;  2K5H A;  1IZ6 A;  2BH8 A;  1C9O A;  1Y14 B;  1J6Q A;  4DK3 C;  4DUZ Q;  4OON A;  1KRT A;  1JMC A;  4A3B H;  5IP9 G;  4K0K L;  4DR7 Q;  5EAY A;  4A3I H;  4A3G H;  4JOI A;  4A3J H;  4P71 A;  4Y52 H;  1PFS A;  3CF5 A;  5GAD C;  3GDE A;  2K75 A;  1MKH A;  4JI0 Q;  3HOZ G;  4POF A;  3CAM A;  1NBW A;  2ZTE A;  2DUD A;  5GAH C;  3EIV A;  5M5X H;  3FHW A;  1HR0 W;  4JI6 L;  1YI2 A;  5FJ8 G;  3CCQ A;  4DR2 L;  1CKN B;  1K73 C;  4LFA Q;  3BJU A;  1H95 A;  3STB C;  3HFZ B;  2E2H H;  3JC6 6;  2K4K A;  4AIM A;  4R4O A;  1ASY A;  3HOV H;  3PO3 G;  3T1H L;  4L5Q A;  2PQA A;  3AFQ A;  4XIG S;  1PVO A;  5IYD H;  3STB D;  3CXC A;  1Y1W G;  4UP8 A;  1PYS B;  5FLM H;  4HJ5 A;  1G6P A;  5C44 H;  4JI8 Q;  1EIF A;  3HKZ E;  4A4I A;  5GAE C;  1K9M C;  1VQ5 A;  5C4J H;  3TS2 A;  1NMG A;  2JA6 H;  5AJ3 Q;  3CMA A;  1Y1V H;  3M7N A;  1HJP A;  1TWG H;  2VS1 A;  1U0L A;  1G51 A;  1L2F A;  4JBW A;  5FLX c;  1XNQ Q;  1YHB A;  1WOC A;  1X55 A;  2AMC B;  3ER0 A;  5IWA L;  4K0K Q;  1B8A A;  2IY5 B;  1TWF H;  1X3G A;  4JV5 Q;  4GKK L;  4JI1 L;  1JB7 A;  5IP9 H;  1HZB A;  1X6O A;  4X64 L;  1VQF A;  2B29 A;  1E22 A;  4QJF A;  3W1B A;  1K0R A;  5BR8 Q;  1J5E Q;  2F3I A;  3T1Y L;  5LMU L;  4OWX B;  2ZJQ A;  4DR3 Q;  1VCI A;  1JJG A;  2L15 A;  1XMQ Q;  2NVX H;  2AKW B;  3UDI A;  2CWA A;  4GNX C;  3K81 C;  5FJ8 H;  4LF7 Q;  2UUB Q;  4IFD J;  2MNA A;  4C3I H;  3PO3 H;  1K8G A;  4YCV A;  1Q86 C;  2UXC Q;  1VS0 A;  1IXR A;  4APV A;  1Y1W H;  1Q12 A;  3I7F A;  1X56 A; 
#chains in the Genus database with same CATH topology
 4YWK A;  1M8A A;  1TS4 A;  1EQT A;  4B3R L;  1GHK A;  3DLL A;  2FFK B;  1HNZ Q;  1R9T B;  1KC8 C;  3F2B A;  1B44 D;  2F0H A;  1JJ2 A;  1IKL A;  4FF2 A;  4RH6 A;  3MEH A;  4TQU S;  2PNH A;  2I0Q A;  3K80 C;  1XYI A;  4X66 L;  3UDX A;  2XTI A;  3S2D B;  1IYV A;  4PNY A;  1KAA A;  4DKA C;  1VQ8 A;  2PQE A;  1LT5 D;  5KIX A;  2WFW A;  4PG3 A;  4LF9 L;  4K5V A;  4M1U B;  3NXW A;  3DMU A;  2LKV A;  1ESF A;  3N52 A;  3GD7 A;  5C4X G;  1BNZ A;  4E6I A;  2MFI A;  3H15 A;  5K36 G;  4FP5 D;  3K0X A;  3OPO A;  2VQE Q;  1V9P A;  1VQM A;  5EPJ A;  2RSN A;  2Q8R E;  3S9W A;  2VUM B;  1L0W A;  3S24 A;  1UEB A;  3EN2 A;  3VYU A;  4C3J H;  2QA4 A;  1XPU A;  1HNX L;  1NJI C;  2MHV A;  4TVA B;  3CU7 A;  4AQY L;  4ALP A;  3O13 A;  3HKS A;  2F0T A;  4RWS C;  2V1C C;  5BN3 A;  2OWO A;  3NQT A;  2OF1 A;  1CTM A;  1TQO A;  1SR3 A;  1UAP A;  2O4X A;  3LX0 A;  2NB0 A;  4DV3 L;  2K01 A;  3KOJ A;  5C3W A;  5IT9 E;  3HOY H;  4OIK A;  2UUA L;  3OIP A;  3J80 L;  4JBM A;  5EJW A;  4RMF A;  1H9S B;  3DEP A;  4JOI C;  3F2U A;  3F2D A;  1PZJ D;  2Z1C A;  3HOW B;  1CUK A;  5DEH A;  4PMW A;  2NYZ D;  4F8M A;  3MWY W;  1DYQ A;  2R61 A;  2R93 B;  2A68 C;  4JYA Q;  1B50 A;  4M8A A;  1V1Q A;  3KF6 A;  4KMU C;  2B63 H;  3A56 A;  4H0L C;  1S40 A;  4JBK A;  1N33 L;  1TT2 A;  3CC4 A;  1V43 A;  3H3V I;  3EJI A;  2XNA C;  2D9U A;  5FLX L;  2Y0S B;  4KHZ A;  2RCN A;  1CKN A;  1FR3 A;  3CRL C;  5M3F G;  5IY0 A;  3NUC A;  3NEM A;  4OEM B;  1NCV A;  2YU9 B;  4HR7 B;  3CCV A;  4CDF C;  2KA7 A;  4PQX A;  4CJ2 C;  2WAQ E;  4JI8 L;  5M5Y B;  1DJR D;  3J80 i;  1K83 H;  4K0K L;  4A3D H;  4GKJ Q;  4EQ5 A;  4JV5 L;  4S3S A;  1WD0 A;  3I4M B;  3HOX G;  4Y7N H;  4FF3 A;  3MXU A;  4JI2 L;  2IX1 A;  3M9B A;  1OTC A;  1XTD A;  2R7D A;  1C48 A;  4DV0 Q;  1Y8P B;  1XJV A;  1V1P A;  1PH2 A;  2M00 A;  3AFP A;  5C5L A;  2B3G A;  3LWU A;  4HJ8 A;  1TKW B;  4R4C A;  4LF7 L;  3FMC A;  4J15 A;  4DV5 Q;  3L2P A;  4IQZ A;  1RJT A;  1SJH D;  2OT2 A;  2K50 A;  2NVY B;  3GTK B;  3SK5 A;  3CCL A;  2QW7 A;  2K5D A;  5M5W B;  2F0J A;  2EYH A;  1F9R A;  2L12 A;  2PMZ B;  1IW7 C;  3W2D A;  2UXD Q;  1HNZ L;  4CJ0 B;  4MTK A;  3ND8 A;  3PO2 B;  2UU9 Q;  5C0X G;  3S14 B;  4F87 A;  2RHQ B;  4OO1 H;  3HOU H;  2Z6K A;  2LY7 A;  3D8G A;  1WTP A;  4EQN A;  2R7Z H;  1QG7 A;  5JVG 3;  1B4O A;  3NQI A;  2ZXO A;  4RGT A;  3HRZ C;  1EY9 A;  1Q1E A;  4IOA A;  2ENB A;  4K8J A;  3GTJ H;  1J8I A;  1PTO B;  1SNM A;  3H0G H;  5ELC A;  3I4N B;  4X3K A;  3HOZ B;  3A8K E;  3NP8 A;  1VQH A;  4DV2 Q;  4A75 A;  4P74 A;  1XNR Q;  3CCR A;  4A93 G;  3BZD B;  3TS0 A;  5DLQ E;  1K3B C;  2P5Z X;  1BBU A;  1PZK D;  5IP7 H;  1BO0 A;  4IPH A;  2IPK D;  1C4Q A;  2B8G A;  1BUV T;  1RTN A;  3J81 E;  3G6E A;  1WTW A;  1AZQ A;  3A74 A;  3S1M B;  4ABN A;  1EYG A;  4XT1 B;  4KN7 C;  3MZ5 A;  3I4L A;  1IYU A;  3GTL B;  3MXN A;  1SMY D;  3CQZ H;  2QGQ A;  1ML0 D;  3U58 A;  2ZJP A;  1HPC A;  1SAP A;  4WOR A;  4G7Z C;  1MI2 A;  2HIX A;  3SGI A;  2OQ0 A;  5FO7 B;  4UP7 A;  4QY7 A;  1GUG A;  3CRK C;  3W5O A;  4DUZ L;  4YHH Q;  2K5V A;  3H6M A;  5E7N A;  1FJG Q;  4KK7 A;  1F2L A;  2H1E A;  4K14 A;  4JYA L;  2K1B A;  5CMD A;  3UDG A;  1PH5 A;  3MXG A;  3U4V A;  2JA7 H;  3VYR A;  1PH9 A;  4G7H C;  2WAQ G;  3CC7 A;  4LJZ C;  5C5M A;  1BQQ T;  1VQI A;  4LFA L;  3PUW A;  5I6W A;  1PH6 A;  3IAY A;  2KJX A;  1HFN A;  1W2B A;  3K8A A;  4CBV A;  2N8N A;  5M9O A;  3GTQ H;  2F4V Q;  1EQR A;  2K04 A;  2KEN A;  3U9S A;  2NVT H;  4DAY B;  5AJ3 L;  3G48 A;  2KQ3 A;  4XQJ A;  5CC4 A;  2OCE A;  3K6O A;  1KNA A;  3VR6 A;  1YNX A;  1PRT D;  3PMF A;  1IKM A;  2F4I A;  1WYD A;  2EQS A;  4GKJ L;  4IFD G;  5LMN W;  1PLF A;  2NWG A;  2NN6 H;  2A69 C;  1H9M A;  3FEW X;  3MFY A;  1KQS A;  4DV0 L;  4Q0F A;  2F0F A;  5LMU Q;  4A3L H;  4DV5 L;  2FHT A;  4PMB A;  3HOW G;  1F77 A;  1GUO A;  4K2L A;  1Q82 C;  3A8I E;  2K5W A;  2N49 A;  2AHO B;  3NWT A;  4F7X A;  2R93 G;  3K7U C;  4LF5 L;  2E2H B;  4BBR G;  5GQO A;  5GAG C;  1WI5 A;  2FIN B;  2NUC A;  3TSS A;  1PFB A;  3MFG A;  1Q81 C;  1CA6 A;  3M4O H;  3NWS A;  4A76 A;  1WFQ A;  2UUC Q;  3KDF A;  1L0X B;  3TDQ A;  2UXD L;  3DEO A;  3X3M A;  4IPD A;  4GNX A;  1I3Q H;  3NTI A;  2UU9 L;  1Y1V B;  3CPF A;  2Z6B A;  1A3V A;  3T16 A;  1WCM G;  2DJF C;  2EE1 A;  1KD1 C;  4JI7 Q;  1QJO A;  3G71 A;  1SE4 A;  1YJ9 A;  1PTO D;  1EFW A;  5CV6 A;  4IUT A;  2KBN A;  4NP5 A;  4HJ7 A;  4A3F H;  5A35 A;  4IN3 A;  2TMP A;  1GO3 E;  4POG A;  3RZO H;  4QIW E;  1Z9F A;  4DV2 L;  4X65 Q;  4QF4 A;  3RLF A;  3FKI G;  4LF4 Q;  1XNR L;  3TRZ A;  4GOP A;  4N9T A;  2I5L X;  3QWN A;  3EA6 A;  1SMY C;  2VZA A;  5KYL A;  4XYO A;  3J7Z C;  1D1I A;  1MSG A;  1UE7 A;  3BDO A;  3CPW A;  4A3G G;  5CV8 A;  4A3J G;  5CYU A;  2B2Y C;  1JC7 A;  1TWC H;  2D2C C;  3C1E A;  1FYC A;  4WJ4 A;  1NSN S;  2QF7 A;  1TS3 A;  5C4Z A;  2BA1 A;  3W1G A;  4HID A;  2HT1 A;  2JA5 H;  1EWC A;  3K7A H;  3QG1 A;  1A0I A;  2EYL A;  2OEO A;  2LS0 1;  1I6H H;  2K03 A;  2EY2 A;  3OWE B;  1DON A;  2BE5 D;  1EIG A;  1EY0 A;  2ZXR A;  4ZUI A;  1LM0 A;  1D6E C;  3VR2 A;  1FJG L;  4IUN A;  5C0X I;  2LXJ A;  1RL2 A;  1I4G A;  4LFB Q;  2JE6 I;  1SJE D;  1IZ6 A;  2BH8 A;  1C9O A;  1MGS A;  4A3B H;  1BOS A;  1GUN A;  5EAY A;  5DAU A;  1SE3 A;  3AU7 A;  3KF8 A;  3I3C A;  4LAA A;  5I4D A;  5HGT A;  4JI0 Q;  3HOZ G;  4POF A;  1NBW A;  5GAH C;  1DOL A;  3EIV A;  5M5X H;  5FJ8 G;  3EFX D;  1K73 C;  1VDZ A;  3BJU A;  3STB C;  1KNE A;  2B2U A;  2K4K A;  3PO3 G;  1X3Q A;  4RCN A;  3V05 A;  1PMR A;  1JIC A;  2RQX A;  4XIG S;  5A2Q E;  1PVO A;  3CXC A;  1FNV A;  4UP8 A;  2V4D A;  1PYS B;  4RHR A;  5FLM H;  3TZU A;  1EIF A;  5C4X B;  4GZY C;  2F0D A;  5C4J H;  5D3D A;  1TWG H;  2VS1 A;  3TP5 A;  1L2F A;  4K6L A;  1WOC A;  3WDN A;  2AMC B;  2IY5 B;  1TWF H;  1SFO B;  2E75 C;  1B3A A;  4C56 C;  4X64 L;  2O5I C;  3K57 A;  4QJF A;  4TKO B;  1J5E Q;  1K0R A;  2F3I A;  5LMU L;  4DR3 Q;  1VCI A;  2L15 A;  1F9P A;  3G6J B;  2AKW B;  5COY A;  5FLX E;  1EYC A;  5IGC A;  3K81 C;  1GXD C;  4FXK C;  4ULL A;  2MNA A;  3CHB D;  1LTT D;  1YNN C;  2B2W C;  1Q86 C;  3IFD A;  1IXR A;  3TBI B;  5DM6 3;  1Y1W H;  1PZI D;  1Q12 A;  4DR6 Q;  4ZCK A;  2UUC L;  1SDF A;  3T13 A;  1FL0 A;  3EVQ A;  3NEL A;  1EY7 A;  1TWH B;  2MPM A;  4C3J G;  3S1R B;  1Q1B A;  5KEE A;  4QL5 A;  5HY6 A;  3S17 H;  4GN3 B;  4P73 A;  1YHQ A;  4JI7 L;  1LYL A;  1E24 A;  1Q7Y C;  4NB3 A;  3HOY G;  4EGV A;  5CV4 A;  3FRP B;  2JQO A;  4LFC Q;  4AYB E;  1CA5 A;  2HD3 A;  4DR5 Q;  5M3F B;  1CQV A;  1Q8I A;  2RBM A;  4X65 L;  2ATW A;  3LGJ A;  1QVC A;  2KCN A;  1L1O B;  1BCP B;  1LT3 D;  3Q24 A;  2UXB Q;  3I8Z A;  4IFD I;  1B9N A;  2HCI A;  1QUQ B;  3BZC A;  4CDC C;  2B63 G;  1BBW A;  5BN4 A;  1EY8 A;  1QCB D;  1U4P A;  1W6J A;  1JQY D;  1I3Q B;  2EY1 A;  2B39 A;  1J9O A;  4RCO A;  3HOX B;  1B9M A;  3UE0 A;  1AFP A;  3KLW A;  4ME5 A;  4K2K A;  3ERS X;  1W3S A;  3JAM L;  4A3K H;  2ICE C;  1SMX A;  3R3O A;  4K5X A;  5E4W C;  1Y69 U;  3F8T A;  3MC0 B;  2QDL A;  1E2V A;  4HCS A;  5IYB H;  3I90 A;  3S15 B;  1O80 A;  4L6T B;  5LL6 S;  1WTX A;  1H9S A;  2ES2 A;  1DD2 A;  3A0J A;  3GTM H;  2B2Y A;  1RKN A;  2CH4 A;  2ZTD A;  4G4K A;  1I94 Q;  4A3D G;  1Q90 A;  3J80 c;  3U4Z A;  2EYP A;  1ICF B;  2IHF A;  1UE1 A;  1XTC D;  4JI0 L;  1K8M A;  5K5P A;  4C2M H;  1Q8K A;  4IJH A;  2ALY B;  1HRJ A;  1QNU A;  1ICW A;  2F0S A;  2JEB I;  4ID6 A;  1BDO A;  2MGS A;  4IUU A;  5IGF A;  2HCC A;  1LT6 D;  3M3Y B;  2Q2U A;  3NBI A;  1P8L A;  4JI6 Q;  3C3L A;  3M4P A;  3CKI B;  2JA5 B;  2YV5 A;  1GOZ A;  4IUV A;  3JAM i;  4A93 B;  1FGU A;  2FXQ A;  1NR2 A;  3PUX A;  4B9W A;  4OO1 G;  5EKK A;  3HOU G;  5IIF A;  1VQ4 A;  3MXP A;  2R7Z G;  3R8B A;  1SYB A;  3TN2 A;  2AQ3 B;  1J5E L;  5KGU A;  2RDH A;  5CGK A;  5EKI A;  5ELB A;  4DR3 L;  3NHH A;  4CDD C;  1HR0 Q;  1U9R A;  4A3E H;  4JI4 Q;  1H9J A;  2JP1 A;  3NK9 A;  5EPK A;  1S5D D;  1CKO A;  1JB3 A;  4JW0 A;  3H0G G;  4CKE A;  4A3M H;  2K05 A;  2B2V A;  4NXN Q;  1CQF A;  2O2L D;  2OXP A;  1YJN A;  2VB2 X;  1JOK A;  2K28 A;  1STY A;  2A1A A;  3A7A B;  2PW7 A;  2VY3 A;  5ISR A;  4DU9 A;  1GJX A;  5IP7 G;  2WP8 J;  4YCU A;  1KDA A;  1PHJ A;  5I2Y A;  2YTY A;  4KY5 A;  2WIN B;  4JBJ A;  3V2T A;  1IW7 D;  3A55 A;  1EZ6 A;  5G3L D;  5J3B A;  2VW9 A;  1VQP A;  4LF8 L;  2E2I H;  2WAQ B;  4BY7 H;  2B2W A;  2CW0 D;  3RLN A;  1G91 A;  2HQE A;  3DUZ A;  3VA7 A;  1A6X A;  4KJN A;  4LFC L;  3S16 B;  1M90 C;  4DR5 L;  2I5H A;  3D4R A;  4BY1 H;  3I91 A;  5IYC H;  1YIJ A;  3NBH B;  3X3N A;  1A3U A;  2A5H A;  1NAP A;  4YIJ A;  1MJC A;  1ZYR D;  1B2T A;  2JA7 G;  5I9O A;  4TRD A;  1EU4 A;  5FOB B;  1GUT A;  3K0Y A;  3VDY A;  2D0P A;  4MNO A;  1NMF A;  4KI0 A;  4UP9 A;  3S17 B;  4R4I A;  3K58 A;  2F52 A;  2WKD A;  5IOD A;  3K5L A;  4DF7 A;  3H3V H;  3NEN A;  2F0W A;  4YY3 Q;  2N78 A;  4IO9 A;  4XYQ A;  1G6Z A;  2E8G A;  4LUZ A;  4BBR B;  3GTG H;  3FVQ A;  2AQ2 B;  1E1T A;  4DUY Q;  1I94 L;  1EWI A;  1QVG A;  2MP1 A;  3UE1 A;  3U50 C;  5CBE E;  1SYD A;  1W6K A;  3RN5 A;  2NN6 G;  2NZH A;  1OXX K;  4C1N I;  1CK1 A;  1WCM B;  2PYK A;  4LMQ D;  3KYH C;  3HG9 A;  1PRT F;  4A3L G;  1PFN A;  2RVL A;  3HP3 A;  1OXU A;  1RTO A;  1C0A A;  1HHV A;  1A63 A;  1T9H A;  4WJ3 M;  2C9O A;  3H94 A;  3MVV A;  2CKZ B;  1PYW D;  2K52 A;  4BBS H;  2PQA B;  3S1Q H;  1WJJ A;  2L9H A;  2JA8 H;  3FKI B;  4ZQ3 A;  1VQG A;  1BKB A;  5I6Y A;  3PF4 A;  5AFW A;  1SSO A;  3A8J E;  1KDB A;  5IWA Q;  1DXM A;  2FMM A;  2A6H C;  4H02 A;  1PH7 A;  4EQP A;  2QIL A;  1Y8O B;  3P7J A;  1U5K A;  3ERO A;  1CSP A;  4A3G B;  2A69 D;  4GN4 B;  3RLO A;  2WAC A;  4A3J B;  1HR0 L;  4JI4 L;  1HCZ A;  4R1J A;  2NZO A;  4A3F G;  4C3H H;  1KLU D;  3OWF A;  4CDE C;  5KNC A;  2NZ1 D;  4NXN L;  3WWV A;  1LO5 D;  2SNS A;  2GN5 A;  2JA9 A;  4UHV A;  2K32 A;  1TWA H;  5TSS A;  2K14 A;  1BF4 A;  3CCJ A;  1PA6 A;  2IHE A;  3UDF A;  1R4P B;  1KHI A;  4DK1 A;  1GKH A;  2CW0 C;  3QR8 A;  3URY A;  2F0Q A;  1QZH A;  1Z7T A;  2Z4H A;  1I5F A;  3I56 A;  1L1O C;  1K28 A;  1BCP C;  2E5L Q;  2R3Z A;  4A3C H;  5KYI A;  5F2D A;  4NXM Q;  3J7Y W;  1RHP A;  2JA5 G;  5M3M H;  2NVX B;  1FNU A;  2CFM A;  2VQE L;  1LAC A;  1ESR A;  1VMC A;  1OXV A;  1FNW A;  1ZYR C;  4A3E B;  3PO3 B;  3S2H H;  1LAB A;  2RDF A;  5C3X A;  1IBM Q;  2ZM6 Q;  1QOH A;  1KDC A;  3E0E A;  4JI5 Q;  3PF5 A;  1MJE A;  4OO1 I;  4A3B G;  5ELN A;  1PXU A;  4L5T A;  1VQO A;  4FNF A;  1S3O A;  3OHX C;  3RZD H;  1AP0 A;  3H91 A;  2KEE A;  1AW7 A;  2RHS B;  5JOB A;  2B2T C;  1D5Z C;  2JSO A;  4XQN A;  1CFM A;  3SXH A;  2L1B A;  4OXP A;  3KJP A;  2E2I B;  4HN7 A;  1AE3 A;  4YY3 L;  5FLM G;  1UE5 A;  5JJL A;  3HS0 C;  3HGB A;  1EUJ A;  4DUY L;  1D2B A;  5FO8 B;  1IL8 A;  4CKC A;  1I4X A;  1STB A;  4C3J B;  4DR7 Q;  4A3I H;  3D3R A;  4ODG A;  4JOI A;  5JEA H;  4P71 A;  1K8O A;  5GAD C;  2K75 A;  3LWE A;  4ZUJ A;  2BCO A;  3SK4 A;  1HA5 A;  2K5Q A;  2VXW A;  1CKN B;  2CH4 W;  3HOY B;  3LNN A;  5KRU A;  4R4O A;  3IKJ A;  1LTS D;  2Z9H A;  3STB D;  1O7Y A;  1Y1W G;  1MD2 D;  4HJ5 A;  1G6P A;  2F0V A;  5C44 H;  2Q8T A;  3HKZ E;  4A4I A;  1G51 A;  1EEF D;  2F3V A;  2NTS A;  3VA5 A;  1XNQ Q;  3ER0 A;  1X55 A;  2JYO A;  5IWA L;  3GTG B;  1X3G A;  4FXD A;  1JB7 A;  2B63 B;  5IP9 H;  1HZB A;  1X6O A;  3QOJ A;  5NUC A;  3I72 A;  4U67 3;  5BR8 Q;  4KTA A;  1B1Z A;  3OOC A;  3PIO 3;  1XMQ Q;  1V1P B;  3KUP A;  2CWA A;  2UUB Q;  3I73 A;  1K8G A;  1EZ8 A;  4Q5V A;  1PH4 A;  1YNN D;  2F3W A;  1I50 H;  4BA2 I;  5D3I B;  2J4X A;  3AMU A;  1QZG A;  3F2C A;  2DY8 A;  1T5E A;  2NN6 I;  4JPB W;  4RKB A;  5LMN Q;  1N34 Q;  3DM3 A;  1JE5 A;  4DV1 Q;  1K83 B;  3CCU A;  3L0O A;  4A3D B;  1JOO A;  2JA8 B;  3IRB A;  2E5L L;  1TY0 A;  1B7Y B;  1B3Q A;  2F0L A;  4Y7N B;  3GTP H;  4JC0 A;  2WKC A;  4QB4 A;  4NXM L;  1OO9 B;  1S4Z A;  4A3K G;  4X3T A;  5IT9 L;  2EDG A;  1D7Q A;  4KHP Q;  3E3X A;  1VF7 A;  4LW1 A;  1SEB D;  3J81 j;  1HZA A;  2Z4I A;  3A54 A;  3SK8 A;  5IYB G;  2N88 A;  1VQB A;  1DGS A;  2PI2 A;  3M4Y A;  1KAW A;  2JN4 A;  1X32 A;  1S5C D;  1NY4 A;  4JI5 L;  3MEF A;  1YEZ A;  3S1N H;  1TR5 A;  3GQB A;  1N32 Q;  1OXS C;  1TWA B;  4OHJ A;  2EYO A;  3WOF A;  2X6G A;  4PZ8 A;  4X62 Q;  3D6W A;  4P72 A;  2KHS A;  3HOU B;  2R7Z B;  3D0F A;  4LK1 C;  5GRO A;  1SYF A;  4J8Q A;  1LTG D;  2QEX A;  4JVZ A;  2C35 B;  2M2L A;  4UAI A;  4LF6 Q;  1V1O A;  2E2J H;  4N9P A;  4YHH L;  1O7L A;  2K6A A;  5HGQ A;  3GTJ B;  3TME A;  1IYJ B;  5JEA J;  1QNK A;  4KN4 C;  3H0G B;  4G57 A;  3CCS A;  4KD3 A;  3Q6S A;  2KEC A;  4RAU C;  3KLS X;  1CKM A;  4IPC A;  2HDL A;  5JPM C;  3JAM c;  3S2H B;  2SEB D;  1GUW A;  2F0O A;  5C3E H;  3PIP 3;  4DR7 L;  4AYB B;  4DR4 Q;  1AE2 A;  4DA2 A;  2F4V L;  3GTO H;  2H5X A;  4A3E G;  1S72 A;  2IX3 A;  3CQZ B;  4QQB X;  1IBK Q;  1ET9 A;  4JK1 C;  2RKS A;  2KUM A;  5JAV A;  3J80 E;  3RZD B;  1EY5 A;  4QUC A;  4A3M G;  1VQK A;  4HIM A;  2GVA A;  4BWG B;  2VQF Q;  3QB3 A;  1LTL A;  5JVH 3;  2QDB A;  1EYD A;  3ULL A;  1D5M C;  1SN8 A;  1XNQ L;  4DV7 Q;  4O0A A;  3SE0 A;  4DNT B;  1R9T H;  2J0T D;  2JA7 B;  4GLX A;  2HDM A;  4BY7 G;  4I7Z C;  1SE8 A;  1O7I A;  1MHW C;  4DK0 A;  3S2D H;  5D65 A;  1VQ6 A;  4K5W A;  1XMQ L;  3VR4 A;  4O1N A;  3TZD A;  1HFG A;  4XT3 B;  1ONL A;  4QUF A;  1RDP D;  4ZK9 B;  1PH1 A;  2UUB L;  2R92 H;  4K6D A;  4HTH A;  3GTQ B;  3ITP A;  3I2Z A;  4OWW B;  1SYE A;  2KCC A;  1ASZ A;  1HA6 A;  1H9K A;  4FVM A;  4BY1 G;  2NVT B;  5IYC G;  3AEV A;  4B9X A;  4BXX H;  2VUM H;  3KFU A;  4KJO A;  2IWH A;  2AQ1 B;  5LMN L;  1STN A;  1N34 L;  2Q2T A;  3MHB A;  4DV1 L;  4KKT A;  1SRU A;  4KKU A;  5C44 B;  4GNX B;  3J7A 5;  3H09 A;  4YWM A;  4FDB A;  4RFB A;  3J81 L;  4ILW A;  3R2T A;  2LFN A;  3PGZ A;  2F0U A;  2QEJ C;  4EX5 A;  3SHL A;  2XRQ D;  5E1F A;  3GO5 A;  4L5S A;  4KHP L;  4N8X 1;  4LF4 L;  1VQE A;  1X65 A;  2DGY A;  2DY7 A;  3M7G A;  5CV5 A;  4HCE A;  1CM9 A;  1A8V A;  2I46 A;  3HOW H;  1STH A;  5IE8 A;  1K8A C;  1S5F D;  4ZKB B;  1LLR D;  1AZP A;  3M4O B;  1LTI D;  1ROD A;  1CZG A;  2J7Z A;  2RCF A;  1A2U A;  2DNC A;  1EIH A;  2WB1 E;  4JI3 Q;  4PZ7 A;  2R6G A;  4ZLT F;  4X62 L;  1E1O A;  3PUY A;  2PZW A;  4NW2 A;  4KY6 A;  1II3 A;  1TS5 A;  2ZT9 C;  5LL6 X;  2YU9 H;  1STG A;  4LF6 L;  3PUV A;  1DOK A;  3FPP A;  3J81 i;  1NNX A;  4A3F B;  4FYD A;  4V0B A;  4BBS G;  3RZO B;  2M9V A;  3QOL A;  2A6E D;  3J7A F;  1JT8 A;  1HXY D;  4LFB L;  1C8C A;  2JA8 G;  2EPB A;  4OWT B;  2L55 A;  2XWB B;  2WII B;  1HNW Q;  5M5Y H;  1KTK A;  1XMO Q;  3BU2 A;  1FD7 D;  4HSV A;  2BA0 A;  3I4M H;  2ID0 A;  4MHE A;  2CVR A;  3PSI A;  3FPU B;  1EOV A;  3Q0A A;  4FF4 A;  2FJ2 A;  3EBE A;  3KBX A;  2ZTC A;  1AEX A;  2KHI A;  1N8R C;  4B08 A;  3AB9 A;  2AUK A;  2A19 A;  1TWC B;  1JCK B;  2LSS A;  2PW5 A;  2JK8 A;  3KF8 B;  2G9H D;  1IBK L;  1X3P A;  4C3H G;  1N33 Q;  4MZ9 A;  2NVY H;  5JJI A;  4KLK A;  3GTK H;  2A74 C;  3ONA B;  1ENF A;  1I4Q A;  3K7A B;  1VF5 C;  2VQF L;  2ZJR A;  5M5W H;  3FP9 A;  2Z0S A;  2PCF B;  3SEB A;  1I6H B;  1M1K C;  2E2J B;  5KNB A;  4HJA A;  3PO2 H;  1F2M A;  2IX0 A;  4DV7 L;  3S14 H;  2XN9 C;  4XXE A;  1MIU A;  1WTV A;  1HZC A;  1ENA A;  1EIY B;  4UPA A;  1KIX A;  4GKK Q;  5BN5 A;  4A3B B;  1EFI D;  2PI2 E;  3HEJ A;  2A6H D;  1WTO A;  3VR3 A;  3CCM A;  4A3C G;  1B53 A;  4RHS A;  4JI2 Q;  1JR0 D;  5M3M G;  1XPO A;  2DNE A;  4H44 C;  4DR6 L;  1PTO H;  5M5X B;  3I4N H;  3KJO A;  3HOZ H;  2ASB A;  1TY2 A;  2Z6K C;  3ULP A;  3AQQ A;  3MA2 B;  4AYB G;  2NBF A;  3SDZ A;  2EVB A;  4QMG A;  3Q22 A;  5C4J B;  4FF1 A;  4LUO A;  4BA1 I;  1TWG B;  5FO9 B;  1O7Z A;  1V8Q A;  1WVL A;  5T1I A;  3S1M H;  4F88 A;  4DR1 Q;  1Q46 A;  1TWF B;  3SR1 A;  3U9O A;  1PH3 A;  4DK6 C;  4RGO S;  1OXT A;  4DGZ A;  4OL7 A;  3GTL H;  4DPG A;  1BCP D;  4PV1 C;  5CR3 A;  1UUP A;  2KVM A;  2WB1 G;  4WJW A;  1TVX A;  2QKI C;  2UXB L;  4N8F A;  3CME A;  1NTG A;  1I4P A;  4TSS A;  1GD7 A;  1YNJ D;  3GP7 A;  2G5D A;  1Y1W B;  2ICI A;  5ELO A;  2R92 B;  4IJL A;  4L63 B;  3CCE A;  2HUG A;  2VL6 A;  2NTT A;  3TEH B;  4OGQ C;  5FKA C;  3E9H A;  4DAV A;  1STA A;  3TRE A;  3BYY B;  4JI3 L;  2L11 A;  1EEI D;  3R93 A;  3J7A V;  3ZJY C;  4A3I G;  5JEA G;  3TP6 A;  1VMP A;  1LTA D;  5IGG A;  5C6A A;  2A6E C;  4Z9C B;  1AN8 A;  4MTN A;  4QCL A;  4IUR A;  5EPL A;  4QGU A;  2NVQ H;  3TQY A;  1EY6 A;  5J1Z A;  4B3T Q;  5IGB A;  1JJC B;  1XPR A;  1T5X D;  4DV6 Q;  5A2Q L;  5C44 G;  2EYF A;  3OSO A;  2YTX A;  4CJ1 B;  1HNW L;  2EJF C;  2XGT A;  1EL0 A;  3A7L A;  4OX9 Q;  1XMO L;  4R8I A;  3C2P A;  3K5O A;  4R4T A;  1N36 Q;  4K8I A;  1ILQ A;  4RGN A;  4DUZ Q;  4O42 A;  4DK3 C;  1JMC A;  2IJ0 A;  4OON A;  1KRT A;  3Q23 A;  5IP9 G;  4R9W A;  1QWY A;  1SE2 A;  3KK7 A;  1GHJ A;  1PFS A;  2EZV A;  3DM1 A;  4WRD A;  2ZTE A;  4JI6 L;  3FHW A;  4IUQ A;  4I7A A;  4LFA Q;  2EYJ A;  1H95 A;  4DAY A;  2E2H H;  3HOV H;  3JC6 6;  4AIM A;  4A3K B;  4L5Q A;  3IFT A;  3AFQ A;  5HUR A;  5IYD H;  2L5T A;  2ZXP A;  5CV9 A;  1FGB D;  2F0G A;  1DCZ A;  4KY7 A;  1K9M C;  1VQ5 A;  5EBD A;  3P75 A;  3TS2 A;  1HTL D;  2JA6 H;  5AJ3 Q;  3CMA A;  1Y1V H;  3GTM B;  1HJP A;  2KOL A;  1U0L A;  4JBW A;  5E4X A;  2SOB A;  1S5E D;  5J39 A;  2FMC A;  4GKK L;  1WTR A;  2EJM A;  1PRT B;  3W1B A;  1E22 A;  1I4H A;  1TU2 B;  5KND A;  4KD4 A;  1JJG A;  4C2M B;  5L37 A;  4GNX C;  1TII D;  5I9P A;  1HUM A;  1CI3 M;  3BS1 A;  4C3I H;  1EY4 A;  4U68 A;  4YCV A;  2UXC Q;  1VS0 A;  1PTO F;  1DZ1 A;  3I7F A;  1SRO A;  1G8Z D;  4PMC A;  3BG3 A;  1PH8 A;  3DXJ C;  4HMJ A;  4LF5 Q;  3F1Z A;  2JEA I;  1HH2 P;  5JJZ A;  3PCO B;  3P20 A;  4LUV A;  1VQ7 A;  1SNP A;  2JXM B;  3L3O C;  4HED A;  4DR1 L;  3NTH A;  3IL8 A;  2Q2H A;  2IT1 A;  1LTB D;  3BVG A;  2K7V A;  4HIO A;  4JG2 A;  3PQI A;  2EY5 A;  4B3S Q;  1XX8 A;  2Z8L A;  4OIJ A;  1YNJ C;  2D0O A;  2PO4 A;  2YYZ A;  3HKZ B;  4O2D A;  4GOP C;  2XSC A;  3BYT B;  3D31 A;  2MQH A;  1E2Z A;  1BR9 A;  2D62 A;  1RF2 D;  4V19 0;  3QIA A;  4X6A H;  4A3M B;  3D4W A;  4DAM A;  2Y0S E;  1Y8N B;  1BBX C;  1GVP A;  1SYG A;  2AUJ D;  3M85 A;  1YJW A;  3ICE A;  5IT9 c;  3BZK A;  4R8N A;  5LHY 1;  5C3E G;  1UWV A;  3ERQ A;  3SVM A;  4DV4 Q;  1Q3L A;  2R7F A;  1IBL Q;  1KAB A;  2I5M X;  2L4N A;  1I4R A;  1ENC A;  4C1N K;  1JWS D;  4BS9 A;  4BY7 B;  1SND A;  1A3T A;  2LXK A;  3OTO Q;  4B3T L;  3K5M A;  1RCV D;  2KCT A;  4DV6 L;  1ZEQ X;  2CQA A;  1IL2 A;  1K0S A;  5C4X H;  4IAL A;  2D5D A;  5K36 H;  4PZ6 A;  4OX9 L;  2AWO A;  1G2S A;  4BY1 B;  4P75 A;  2A73 B;  1N36 L;  1VQ9 A;  3QO2 A;  3KF6 B;  4QIW B;  1RIP A;  4XTC S;  4CGY B;  1SFO H;  4P2C B;  1X3F A;  2B2U C;  1X9N A;  1JOQ A;  1SBB B;  1D8L A;  2PMZ E;  3OYY A;  1GUS A;  3JAM E;  4ZYS A;  5EGT A;  2R92 G;  2XWJ B;  2H4O A;  4G7O C;  1A62 A;  4X3U A;  3L7Z C;  1PFM A;  4HAE A;  2SNM A;  4HJ9 A;  4B3M Q;  2Q8I B;  4WFN 3;  4BXX G;  4IUP A;  3A5U A;  2VUM G;  4ZAI A;  2NVQ B;  1TXY A;  1NUC A;  1TWH H;  2BOS A;  2EOT A;  4DXG A;  4NKL A;  3S1R H;  1M4V A;  1I6V C;  2QCP X;  4FO2 A;  5FK9 C;  1PV4 A;  2HHH Q;  2GVB A;  1KLG D;  1NE3 A;  4IOC A;  1G29 1;  1HZ9 A;  1YZ6 A;  3QJY A;  3KLR A;  4H13 C;  2DJG C;  3DWQ A;  1B70 B;  3A5Z B;  3BDC A;  3Q8D A;  5ELE A;  3V96 A;  2MJ8 A;  1IHZ A;  2LMC B;  2N55 A;  2L0C A;  1VQD A;  3CP0 A;  3NPP A;  4X64 Q;  2F03 A;  3ZYY X;  4J1M A;  2XVS A;  5M3F H;  1DOM A;  1E3P A;  2E2D C;  3SK6 A;  5DNF A;  2UXC L;  1O78 A;  3KLS A;  4MN3 A;  1WD1 A;  1EU3 A;  3OMG A;  1YVC A;  4GLV B;  3P1H A;  4H7B A;  4BBS B;  3S1Q B;  5J22 A;  3HOV B;  2KED A;  2N3S A;  2OTJ A;  3T51 B;  2F0M A;  4FXG C;  1PDQ A;  2EXD A;  1VQJ A;  3M4Q A;  3D6C A;  2JA6 B;  3HOX H;  3UI2 A;  2Y0S G;  4B3S L;  4MIU A;  2HIV A;  1CSQ A;  5COR A;  3ULJ A;  2VNU D;  1VQN A;  1IBM L;  3J81 c;  2ZM6 L;  5CV7 A;  4C3H B;  2RDG A;  2E76 C;  1L1O A;  4ME3 A;  4KV6 A;  4RGM A;  3RUZ A;  4JCV E;  3S15 H;  1CHQ D;  3VR5 A;  2EXZ A;  3RR5 A;  1D1K A;  3BVM A;  3AYH B;  4HSP A;  4C3I B;  1QUQ A;  1YIT A;  3T53 B;  1FVI A;  5T1G A;  3I4M G;  2F0K A;  3E0J A;  1BVS A;  3I4O A;  2EYM A;  4DV4 L;  5C0X H;  2DN8 A;  1P16 A;  3CW2 C;  1IBL L;  1SNQ A;  2SDF A;  4EQO A;  4LNQ A;  1VQA A;  3MXN B;  5E3F A;  1AH9 A;  1LT4 D;  3GV6 A;  5H1S E;  3MTS A;  1F2Z A;  3ND9 A;  3PUZ A;  4UDU C;  2MO0 A;  2JJQ A;  4YCW A;  3OTO L;  3M3Y H;  2I07 B;  4RKL A;  4AH6 A;  1UE6 A;  1WTH A;  2OQK A;  4ZKC B;  5M3M B;  1QIL A;  2YTV A;  3TP7 A;  2X6L A;  2B2T A;  4KKS A;  2CWP A;  3PO2 G;  4A93 H;  3N6R A;  1N9W A;  2BDO A;  2PNR C;  4DNI A;  1Z6H A;  3OW7 A;  4NDX A;  3PIO A;  1Z47 A;  1L0Y B;  2XRS D;  2KHJ A;  3HKZ G;  5ELF A;  3G4S A;  4HMI A;  3GV3 A;  2PPB C;  1XWE A;  4DAP A;  1ZXT A;  2AWN A;  1GM5 A;  1ILP A;  3I4N G;  2CCZ A;  3MAQ A;  3RNU A;  1VQC A;  4DN4 M;  4DR2 Q;  3TP8 A;  2IW3 A;  2WB1 B;  4B3M L;  3T1H Q;  2Q2I A;  1A2T A;  1PRT C;  4HIK A;  3FDT A;  2F0E A;  5D14 A;  4IZ8 A;  4GS3 A;  4XQQ A;  2HHH L;  4CKB A;  3OW2 A;  2F1M A;  3KBG A;  2OTL A;  1KXL A;  5BR8 L;  1SNC A;  2BDN A;  3OMC A;  1X3E A;  1KRS A;  2F0I A;  4JI1 Q;  3K59 A;  2B2V C;  5CBA E;  4A3I B;  1SLJ A;  3RN2 A;  5EQ0 A;  2EIF A;  1JWM D;  1E2W A;  2IL8 A;  3NE5 B;  3T1Y Q;  1PYB A;  1U4L A;  2XIW A;  3S16 H;  1SXT A;  5G3L F;  3RD4 A;  2B8F A;  1QVF A;  3EQL C;  5JJK A;  5EBC A;  1XXG A;  1YHA A;  1F9Q A;  2TSS A;  3DWA A;  3KDF B;  4UY8 C;  3CD6 A;  2KCM A;  1BCP F;  4YWL A;  1EOT A;  1MBY A;  4B3R Q;  2MO1 A;  5DM7 3;  4NPS A;  1G2T A;  2RF4 A;  3WOE A;  3BDL A;  5ELD A;  1VQL A;  4IFD H;  3PV0 A;  3VYT A;  1HTP A;  3C46 A;  2RA4 A;  5EKL A;  1PTO C;  1HUN A;  4RG1 A;  1C7Y A;  1CHP D;  1U4R A;  2WV6 D;  4X66 Q;  3K5N A;  2E74 C;  4GLA C;  1KL9 A;  2RSO A;  1LTR D;  4LF8 Q;  3I55 A;  4IPG A;  5C0X J;  4CHT B;  4LF9 Q;  1E7Z A;  2K5N A;  3E9I A;  2C5C A;  4OEL B;  3PIP A;  2R93 H;  3RMH A;  1QB5 D;  3NBH A;  1EQV A;  4NMZ A;  4BBR H;  4GOP B;  4R4Q A;  1N32 L;  4GN5 A;  4ZRZ A;  2CQO A;  1K3R A;  1I50 B;  1WTQ A;  1LUZ A;  1RD9 D;  1S5B D;  3VYS A;  2EY6 A;  2A8V A;  5IOC A;  4DNR B;  1HNX Q;  1WCM H;  2PZT A;  4AQY Q;  3CC2 A;  1R4Q B;  1ZKO A;  3E6Z X;  1EQQ A;  1JE4 A;  4DFA A;  4LWC A;  4XDX A;  3GTP B;  1CT1 D;  4RA8 A;  3B6Y A;  4DV3 Q;  3DHQ A;  4DXF A;  1YBY A;  3HOV G;  2HQL A;  4L5R C;  5JPN C;  2UUA Q;  2BH2 A;  5IYD G;  1LV9 A;  2BE5 C;  2F0N A;  1U4M A;  3FKI H;  2JA6 G;  3E5S A;  1Y1V G;  4DR4 L;  1X54 A;  3C1F A;  2GA4 B;  3T56 B;  2K5H A;  1E0B A;  2G9D A;  3S1N B;  3D4D A;  1Y14 B;  1J6Q A;  3NTK A;  1BXT A;  3G7L A;  1JOR A;  4L8J A;  4A3G H;  2EJG C;  3BVZ A;  3H3V C;  4A3J H;  1QE6 A;  4I65 A;  1DM0 B;  4Y52 H;  3CF5 A;  2O5J C;  3HZX A;  3GDE A;  1CZW A;  1JWU D;  1MKH A;  2A68 D;  1SNO A;  3CAM A;  1HR0 W;  2DUD A;  1UNS A;  1H9R A;  1YI2 A;  1SYC A;  3CCQ A;  4DR2 L;  4C3I G;  3HFZ B;  1TS2 A;  1ASY A;  3R2I A;  3T1H L;  2PQA A;  1HQM C;  2K33 A;  4JI8 Q;  1EYA A;  5GAE C;  1A15 A;  3OIQ A;  5IGD A;  1ET6 A;  1NMG A;  3M7N A;  1NR4 A;  2PZU A;  4KHV A;  3L9A X;  5FLX c;  2MUY A;  1YHB A;  4K0K Q;  3NSW A;  1B8A A;  4EVO A;  2VB3 X;  3I70 A;  4JV5 Q;  4X3S A;  4JI1 L;  5C3E B;  1UEA B;  3DWP A;  3W3A A;  1VQF A;  2B29 A;  2CHB D;  3T1Y L;  4OWX B;  2ZJQ A;  3GTO B;  2NVX H;  2X69 A;  5C4H A;  1F2Y A;  4J6H A;  1STE A;  3UDI A;  4LF7 Q;  4IFD J;  1EWH A;  5FJ8 H;  5IGE A;  5I2X A;  3T4A C;  3PO3 H;  1F9S A;  2F0P A;  1MSH A;  1HQR D;  4APV A;  1D5X C;  1X56 A; 
#chains in the Genus database with same CATH homology
 4YWK A;  2UUC L;  1PH8 A;  1I50 H;  1FL0 A;  4B3R L;  4BA2 I;  4LF5 Q;  3F1Z A;  3NEL A;  1QZG A;  2JEA I;  3F2C A;  1HH2 P;  3DLL A;  2NN6 I;  3PCO B;  5LMN Q;  4LUV A;  1N34 Q;  1HNZ Q;  1VQ7 A;  1Q1B A;  4DR6 Q;  3DM3 A;  1JE5 A;  4DV1 Q;  4QL5 A;  3CCU A;  4DR1 L;  3L0O A;  5HY6 A;  3S17 H;  1KC8 C;  3F2B A;  4GN3 B;  3IRB A;  2Q2H A;  4P73 A;  1JJ2 A;  2E5L L;  2IT1 A;  1YHQ A;  1B7Y B;  4JI7 L;  1LYL A;  4HIO A;  4JG2 A;  3GTP H;  1E24 A;  4TQU S;  2PNH A;  4JC0 A;  4B3S Q;  2I0Q A;  3K80 C;  1Q7Y C;  4X66 L;  3UDX A;  4NB3 A;  2XTI A;  2D0O A;  2YYZ A;  4O2D A;  4GOP C;  3HOY G;  4NXM L;  4DKA C;  1PH4 A;  4A3K G;  1VQ8 A;  1D7Q A;  3D31 A;  2WFW A;  4PG3 A;  4KHP Q;  4LF9 L;  2JQO A;  2MQH A;  4AYB E;  4LFC Q;  4LW1 A;  3J81 j;  1HZA A;  4DR5 Q;  2D62 A;  3GD7 A;  4X65 L;  5C4X G;  2ATW A;  2MFI A;  3LGJ A;  1QVC A;  5IYB G;  4X6A H;  1VQB A;  3H15 A;  1L1O B;  1DGS A;  2PI2 A;  4DAM A;  5K36 G;  3K0X A;  2Y0S E;  2VQE Q;  1KAW A;  1V9P A;  2UXB Q;  1VQM A;  1GVP A;  1NY4 A;  4JI5 L;  3MEF A;  3M85 A;  1YJW A;  1YEZ A;  1L0W A;  3S24 A;  5IT9 c;  3BZK A;  3ICE A;  3S1N H;  4IFD I;  1UEB A;  3EN2 A;  1QUQ B;  3BZC A;  5C3E G;  1UWV A;  1OXS C;  1N32 Q;  4C3J H;  2QA4 A;  1BBW A;  2B63 G;  1HNX L;  1XPU A;  4DV4 Q;  2R7F A;  1NJI C;  4TVA B;  4AQY L;  4PZ8 A;  4X62 Q;  4ALP A;  1IBL Q;  2I5M X;  3HKS A;  4P72 A;  2V1C C;  2OWO A;  1SR3 A;  3D0F A;  3UE0 A;  4DV3 L;  5GRO A;  3KOJ A;  3KLW A;  3ERS X;  2LXK A;  3HOY H;  1W3S A;  3OTO Q;  2QEX A;  2C35 B;  4A3K H;  2UUA L;  4LF6 Q;  4B3T L;  1SMX A;  4JBM A;  2E2J H;  4YHH L;  2KCT A;  5HGQ A;  4DV6 L;  1IYJ B;  5JEA J;  4RMF A;  3CCS A;  3F8T A;  1IL2 A;  5C4X H;  5IYB H;  4JOI C;  4PZ6 A;  3F2D A;  4OX9 L;  2AWO A;  2ES2 A;  1CKM A;  3A0J A;  1CUK A;  3GTM H;  4IPC A;  2ZTD A;  4P75 A;  4PMW A;  1I94 Q;  1N36 L;  1VQ9 A;  3JAM c;  3KF6 B;  4A3D G;  3J80 c;  1RIP A;  4JYA Q;  4XTC S;  3U4Z A;  1SFO H;  1V1Q A;  5C3E H;  3KF6 A;  1X3F A;  2B63 H;  4DR7 L;  4DR4 Q;  1S40 A;  1AE2 A;  2IHF A;  1X9N A;  1UE1 A;  4JBK A;  1N33 L;  2F4V L;  3CC4 A;  1V43 A;  1D8L A;  2H5X A;  4JI0 L;  3GTO H;  3H3V I;  4A3E G;  2PMZ E;  4C2M H;  1Q8K A;  3OYY A;  4IJH A;  2ALY B;  4KHZ A;  2RCN A;  1CKN A;  1S72 A;  2JEB I;  5M3F G;  4QQB X;  5IY0 A;  1IBK Q;  2R92 G;  3NEM A;  1A62 A;  3CCV A;  3L7Z C;  4A3M G;  1VQK A;  4HIM A;  2GVA A;  4HJ9 A;  2Q2U A;  1P8L A;  4B3M Q;  4JI6 Q;  2WAQ E;  3M4P A;  2VQF Q;  4JI8 L;  4BXX G;  3A5U A;  1LTL A;  2VUM G;  1TXY A;  1TWH H;  2YV5 A;  3ULL A;  3S1R H;  1SN8 A;  3JAM i;  3J80 i;  1XNQ L;  1K83 H;  1FGU A;  2FXQ A;  3PUX A;  4O0A A;  4DV7 Q;  1R9T H;  1PV4 A;  2HHH Q;  4A3D H;  3HOU G;  4EQ5 A;  4GKJ Q;  2GVB A;  4OO1 G;  4JV5 L;  1VQ4 A;  1NE3 A;  3HOX G;  4Y7N H;  4GLX A;  2R7Z G;  4IOC A;  4JI2 L;  1G29 1;  1HZ9 A;  1YZ6 A;  3M9B A;  1OTC A;  1XTD A;  2R7D A;  2IX1 A;  4BY7 G;  1J5E L;  1SE8 A;  4DV0 Q;  1O7I A;  1XJV A;  3S2D H;  1B70 B;  3A5Z B;  3Q8D A;  4DR3 L;  1PH2 A;  1HR0 Q;  3AFP A;  4A3E H;  1VQ6 A;  2B3G A;  1XMQ L;  4HJ8 A;  4JI4 Q;  3CP0 A;  1VQD A;  4X64 Q;  4R4C A;  4LF7 L;  4DV5 Q;  1CKO A;  4J15 A;  5M3F H;  3L2P A;  1PH1 A;  2UUB L;  2R92 H;  1E3P A;  3H0G G;  2K50 A;  3I2Z A;  4OWW B;  4A3M H;  2UXC L;  1ASZ A;  4NXN Q;  4BY1 G;  1YJN A;  1YVC A;  4GLV B;  5IYC G;  3AEV A;  2A1A A;  3CCL A;  2VY3 A;  4BXX H;  2VUM H;  3KFU A;  2N3S A;  2OTJ A;  5IP7 G;  2WP8 J;  2UXD Q;  5LMN L;  4YCU A;  1PHJ A;  1N34 L;  2YTY A;  1HNZ L;  4JBJ A;  2Q2T A;  5C0X G;  2UU9 Q;  4DV1 L;  1SRU A;  2EXD A;  1VQJ A;  3M4Q A;  4GNX B;  3J7A 5;  4YWM A;  2RHQ B;  4FDB A;  3HOU H;  2Z6K A;  5J3B A;  3HOX H;  2R7Z H;  2VW9 A;  2Y0S G;  1VQP A;  3PGZ A;  2E2I H;  4B3S L;  4LF8 L;  4BY7 H;  3RLN A;  4EX5 A;  2HIV A;  1CSQ A;  3GO5 A;  1Q1E A;  4L5S A;  4IOA A;  4KHP L;  4LFC L;  4LF4 L;  3ULJ A;  1VQE A;  2VNU D;  1X65 A;  2DGY A;  4DR5 L;  1M90 C;  1IBM L;  3J81 c;  3GTJ H;  2ZM6 L;  1VQN A;  3H0G H;  2I5H A;  1L1O A;  4ME3 A;  4JCV E;  3S15 H;  4DV2 Q;  1A8V A;  1VQH A;  4BY1 H;  3HOW H;  5IE8 A;  5IYC H;  4A75 A;  1YIJ A;  4P74 A;  1K8A C;  3NBH B;  1XNR Q;  3CCR A;  4A93 G;  3RR5 A;  3TS0 A;  5DLQ E;  3AYH B;  1QUQ A;  1BBU A;  1YIT A;  5IP7 H;  1FVI A;  1MJC A;  3I4M G;  2JA7 G;  4IPH A;  2WB1 E;  1BVS A;  3I4O A;  4JI3 Q;  4DV4 L;  3G6E A;  4PZ7 A;  2R6G A;  1P16 A;  4X62 L;  3CW2 C;  1E1O A;  1IBL L;  3A74 A;  4LNQ A;  1VQA A;  1EYG A;  3PUY A;  3MXN B;  1AH9 A;  3VDY A;  2D0P A;  4MNO A;  1NMF A;  5H1S E;  1SRO A;  3CQZ H;  4KI0 A;  3PUZ A;  4UP9 A;  2MO0 A;  2QGQ A;  2JJQ A;  4YCW A;  3OTO L;  2YU9 H;  3U58 A;  4R4I A;  2ZJP A;  3M3Y H;  2F52 A;  4LF6 L;  3PUV A;  4AH6 A;  1UE6 A;  2OQK A;  3J81 i;  2HIX A;  4BBS G;  2YTV A;  3SGI A;  3H3V H;  3NEN A;  4YY3 Q;  2OQ0 A;  2N78 A;  4IO9 A;  1JT8 A;  2E8G A;  4LUZ A;  4QY7 A;  4UP7 A;  4LFB L;  2JA8 G;  3W5O A;  3GTG H;  4OWT B;  4DUZ L;  1HNW Q;  2CWP A;  1E1T A;  4DUY Q;  5M5Y H;  4YHH Q;  1EWI A;  1I94 L;  1QVG A;  2K5V A;  5E7N A;  1FJG Q;  1N9W A;  1XMO Q;  4DNI A;  4A93 H;  3UE1 A;  3U50 C;  4JYA L;  3BU2 A;  3PIO A;  3UDG A;  1Z47 A;  1PH5 A;  3RN5 A;  3U4V A;  2BA0 A;  2KHJ A;  3HKZ G;  3I4M H;  2NN6 G;  3G4S A;  2NZH A;  2JA7 H;  2ID0 A;  1PH9 A;  3PSI A;  1EOV A;  2WAQ G;  3CC7 A;  1OXX K;  3EBE A;  2ZTC A;  2KHI A;  1N8R C;  1VQI A;  4LFA L;  3KYH C;  2A19 A;  2LSS A;  2JK8 A;  3KF8 B;  3PUW A;  1PH6 A;  2AWN A;  1GM5 A;  4A3L G;  1W2B A;  1IBK L;  3K8A A;  1N33 Q;  3I4N G;  2N8N A;  4MZ9 A;  2CCZ A;  3RNU A;  3GTQ H;  1VQC A;  2NVY H;  1EQR A;  1OXU A;  2F4V Q;  4DR2 Q;  5JJI A;  1C0A A;  2KEN A;  4KLK A;  3GTK H;  1A63 A;  2NVT H;  1T9H A;  4B3M L;  3T1H Q;  4DAY B;  4WJ3 M;  2CKZ B;  5AJ3 L;  2K52 A;  2Q2I A;  3G48 A;  2VQF L;  4HIK A;  4BBS H;  2PQA B;  2OCE A;  5M5W H;  3FP9 A;  2ZJR A;  1WJJ A;  3S1Q H;  2Z0S A;  1YNX A;  2JA8 H;  1M1K C;  4HJA A;  1VQG A;  1BKB A;  3PO2 H;  4GS3 A;  1WYD A;  2EQS A;  2IX0 A;  4DV7 L;  3S14 H;  3PF4 A;  2HHH L;  4IFD G;  5LMN W;  3OW2 A;  2OTL A;  4GKJ L;  1KXL A;  5BR8 L;  1MIU A;  5IWA Q;  1HZC A;  1PH7 A;  4H02 A;  1X3E A;  1KRS A;  1EIY B;  4UPA A;  4JI1 Q;  1KIX A;  4GKK Q;  1KQS A;  1U5K A;  2PI2 E;  1CSP A;  4DV0 L;  1SLJ A;  4GN4 B;  3RLO A;  3RN2 A;  2EIF A;  1HR0 L;  4JI4 L;  3CCM A;  4A3C G;  4R1J A;  5LMU Q;  1PYB A;  3T1Y Q;  3S16 H;  4JI2 Q;  4A3L H;  5M3M G;  4DV5 L;  1XPO A;  3HOW G;  2NZO A;  4A3F G;  4C3H H;  1QVF A;  3I4N H;  4DR6 L;  3KJO A;  1Q82 C;  2N49 A;  2AHO B;  5JJK A;  3HOZ H;  2R93 G;  4NXN L;  3K7U C;  3WWV A;  4LF5 L;  2ASB A;  1YHA A;  4BBR G;  5GQO A;  2Z6K C;  5GAG C;  1WI5 A;  2GN5 A;  2JA9 A;  3ULP A;  1TWA H;  3AQQ A;  2K14 A;  3KDF B;  1Q81 C;  3CCJ A;  4AYB G;  1PA6 A;  4UY8 C;  3M4O H;  2IHE A;  3CD6 A;  4A76 A;  1WFQ A;  2KCM A;  3KDF A;  3UDF A;  2UUC Q;  4YWL A;  4B3R Q;  1KHI A;  2UXD L;  1GKH A;  2MO1 A;  4IPD A;  4LUO A;  4BA1 I;  4NPS A;  1I3Q H;  2RF4 A;  4GNX A;  3CPF A;  2UU9 L;  1QZH A;  1VQL A;  3S1M H;  1WCM G;  1I5F A;  3PV0 A;  4DR1 Q;  3I56 A;  1Q46 A;  1L1O C;  1PH3 A;  2E5L Q;  4DK6 C;  1OXT A;  3GTL H;  1KD1 C;  4JI7 Q;  4DPG A;  4RG1 A;  3G71 A;  1C7Y A;  4X66 Q;  1YJ9 A;  1EFW A;  4GLA C;  4A3C H;  4NXM Q;  1KL9 A;  2WB1 G;  4LF8 Q;  2KBN A;  2JA5 G;  3I55 A;  4IPG A;  5M3M H;  5C0X J;  2CFM A;  2VQE L;  4LF9 Q;  1E7Z A;  4HJ7 A;  4A3F H;  2K5N A;  4POG A;  1GO3 E;  3RZO H;  3E9I A;  1OXV A;  3CME A;  1NTG A;  4QIW E;  2UXB L;  1Z9F A;  3PIP A;  2R93 H;  4DV2 L;  4X65 Q;  1GD7 A;  4GOP B;  4BBR H;  3RLF A;  3S2H H;  3FKI G;  4LF4 Q;  4R4Q A;  1XNR L;  1N32 L;  4GN5 A;  1IBM Q;  3TRZ A;  2ZM6 Q;  5ELO A;  4GOP A;  4IJL A;  3CCE A;  2CQO A;  1K3R A;  2VL6 A;  1LUZ A;  3E0E A;  3TEH B;  3PF5 A;  1MJE A;  4JI5 Q;  4OO1 I;  3E9H A;  3PO2 G;  2I5L X;  3TRE A;  2A8V A;  4JI3 L;  2VZA A;  3J7Z C;  4A3B G;  5ELN A;  1UE7 A;  1HNX Q;  3ZJY C;  3CPW A;  4A3I G;  4A3G G;  1WCM H;  4A3J G;  5JEA G;  4L5T A;  4AQY Q;  1VQO A;  3CC2 A;  1S3O A;  3RZD H;  1TWC H;  1EQQ A;  2RHS B;  4LWC A;  4WJ4 A;  3B6Y A;  4DV3 Q;  4MTN A;  2BA1 A;  3W1G A;  1YBY A;  4QGU A;  4OXP A;  3HOV G;  2HQL A;  4HID A;  4L5R C;  3TQY A;  2NVQ H;  2HT1 A;  3KJP A;  2UUA Q;  2JA5 H;  4B3T Q;  2BH2 A;  5IYD G;  1JJC B;  3K7A H;  1AE3 A;  4YY3 L;  1XPR A;  4DV6 Q;  1A0I A;  5FLM G;  5C44 G;  1I6H H;  1UE5 A;  2YTX A;  5JJL A;  3FKI H;  1HNW L;  1EUJ A;  1LM0 A;  2XGT A;  4DUY L;  4OX9 Q;  2JA6 G;  1Y1V G;  1FJG L;  1XMO L;  4DR4 L;  4R4T A;  1X54 A;  5C0X I;  1N36 Q;  2LXJ A;  1RL2 A;  4LFB Q;  2JE6 I;  2K5H A;  1IZ6 A;  2BH8 A;  1C9O A;  1Y14 B;  1J6Q A;  4DK3 C;  4DUZ Q;  4OON A;  1KRT A;  1JMC A;  4A3B H;  5IP9 G;  4K0K L;  4DR7 Q;  5EAY A;  4A3I H;  4A3G H;  4JOI A;  4A3J H;  4P71 A;  4Y52 H;  1PFS A;  3CF5 A;  5GAD C;  3GDE A;  2K75 A;  1MKH A;  4JI0 Q;  3HOZ G;  4POF A;  3CAM A;  1NBW A;  2ZTE A;  2DUD A;  5GAH C;  3EIV A;  5M5X H;  3FHW A;  1HR0 W;  4JI6 L;  1YI2 A;  5FJ8 G;  3CCQ A;  4DR2 L;  1CKN B;  1K73 C;  4LFA Q;  3BJU A;  1H95 A;  3STB C;  3HFZ B;  2E2H H;  3JC6 6;  2K4K A;  4AIM A;  4R4O A;  1ASY A;  3HOV H;  3PO3 G;  3T1H L;  4L5Q A;  2PQA A;  3AFQ A;  4XIG S;  1PVO A;  5IYD H;  3STB D;  3CXC A;  1Y1W G;  4UP8 A;  1PYS B;  5FLM H;  4HJ5 A;  1G6P A;  5C44 H;  4JI8 Q;  1EIF A;  3HKZ E;  4A4I A;  5GAE C;  1K9M C;  1VQ5 A;  5C4J H;  3TS2 A;  1NMG A;  2JA6 H;  5AJ3 Q;  3CMA A;  1Y1V H;  3M7N A;  1HJP A;  1TWG H;  2VS1 A;  1U0L A;  1G51 A;  1L2F A;  4JBW A;  5FLX c;  1XNQ Q;  1YHB A;  1WOC A;  1X55 A;  2AMC B;  3ER0 A;  5IWA L;  4K0K Q;  1B8A A;  2IY5 B;  1TWF H;  1X3G A;  4JV5 Q;  4GKK L;  4JI1 L;  1JB7 A;  5IP9 H;  1HZB A;  1X6O A;  4X64 L;  1VQF A;  2B29 A;  1E22 A;  4QJF A;  3W1B A;  1K0R A;  5BR8 Q;  1J5E Q;  2F3I A;  3T1Y L;  5LMU L;  4OWX B;  2ZJQ A;  4DR3 Q;  1VCI A;  1JJG A;  2L15 A;  1XMQ Q;  2NVX H;  2AKW B;  3UDI A;  2CWA A;  4GNX C;  3K81 C;  5FJ8 H;  4LF7 Q;  2UUB Q;  4IFD J;  2MNA A;  4C3I H;  3PO3 H;  1K8G A;  4YCV A;  1Q86 C;  2UXC Q;  1VS0 A;  1IXR A;  4APV A;  1Y1W H;  1Q12 A;  3I7F A;  1X56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...