4LF9L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9L00
1HZBA 2N3SA 4DR7L 4BXXG 3TEHB 5FLMG 3J80c 3S24A 2WAQE 3S1NH 1EQQA 4DR3L 1Z9FA 2WP8J 3PUYA 3PSIA 3E0EA 2EXDA 4AQYQ 1Z47A 2ES2A 4Y52H 5M3MG 3I4NG 2ZTDA 1PH6A 2MO1A 4DR6Q 4JCVE 4JYAL 2NVYH 3ULJA 1VQ9A 1NTGA 1HNWL 3L0OA 2UXBL 4X62L 4NXNQ 4PMWA 1S40A 4DV5L 3CCLA 1N36L 4C3HH 4KLKA 4JBWA 2BA1A 1XNRL 2OQKA 3A5ZB 5HGQA 2VQFL 2E5LQ 2MNAA 4A3DH 2R93G 1AH9A 1HR0W 1Y1VH 3T1YL 1BKBA 3M3YH 1VQKA 2Q2TA 2K52A 1A63A 2JA9A 1IXRA 1K8AC 4NPSA 1JE5A 5E7NA 1GO3E 3W1BA 1IBLQ 4Y7NH 2JA6H 3UDFA 4YCUA 3I56A 4DV3Q 1PH2A 4OXPA 5HY6A 3CCVA 4DPGA 3HOYH 2WFWA 3CC7A 4LUZA 4JI3Q 4JI4L 1H95A 2LSSA 3M7NA 4JI3L 2NZHA 3PV0A 3CCEA 1HR0Q 2PNHA 4GS3A 1XPOA 1IYJB 1SRUA 1WCMG 1S3OA 2RHQB 5M3FH 1NJIC 4B3SQ 4A93H 3BJUA 1E3PA 1PYBA 4RMFA 3H0GG 4TVAB 4GKKL 4LFCQ 2DGYA 1XTDA 3RN2A 4DR4Q 1PH4A 4OO1G 4APVA 5JEAG 5IYDG 1Q8KA 1MKHA 4X65L 1VQ6A 2XGTA 2JEBI 2ZM6Q 3BZKA 3OW2A 2VQFQ 2E5LL 2UXCQ 4X66Q 4JYAQ 3KF6B 3KOJA 4HIOA 2KBNA 2NZOA 4JOIA 3DLLA 2B63H 5BR8L 3PCOB 4DV5Q 2E2JH 4LF9Q 2IHEA 3MEFA 2C35B 4R4QA 3CQZH 2IY5B 2KCMA 2R6GA 3H0GH 4B3RQ 2R92G 2B63G 4A3JH 4DR3Q 2AMCB 4KHZA 3AFQA 1VQNA 4JI6Q 4UP7A 5GROA 1HNZQ 2ALYB 3PGZA 4UY8C 1N33Q 2HIXA 4A3KH 1HZAA 1OXTA 1X3FA 3HFZB 4NB3A 3I4MH 2UUBQ 2MO0A 4FDBA 3Q8DA 4A4IA 4OO1I 1YHQA 3U58A 1NE3A 1LTLA 3S17H 1Q46A 3STBD 2A19A 4JBMA 1WJJA 2I5LX 4YHHL 4A3LG 1B70B 5AJ3Q 3PIPA 2LXKA 4EX5A 2JA8G 3UE1A 1IBKQ 3G71A 1VQLA 1YHAA 1Q7YC 4LF8Q 4LF6L 3S16H 1I6HH 1C0AA 1W2BA 1Q82C 2OTJA 4JI0Q 4JI2Q 2Z0SA 2ZTCA 4DV7Q 2AWNA 5C4XH 2Z6KC 2QGQA 4IOAA 2UU9Q 3PF4A 1GKHA 3F8TA 3A5UA 4AH6A 3J81j 3AEVA 3VDYA 1SROA 4X6AH 3CW2C 4KHPL 1ASYA 3T1YQ 1KHIA 1Q12A 3GTKH 3OTOQ 2AHOB 2ZM6L 4LFAQ 4AYBG 3CF5A 3CCSA 4DV1Q 4R1JA 1L0WA 2UUCQ 1EQRA 1XNRQ 2FXQA 3PO3G 3F2CA 2NN6G 3ER0A 5C0XJ 1YJ9A 1K73C 1VQ5A 2PI2E 1E22A 3RLOA 2V1CC 4GOPA 1D8LA 1Y1WH 4A3DG 1LYLA 1QUQB 4L5RC 2KENA 3GTPH 3MXNB 2YU9H 3M4OH 1UE1A 1HZCA 4DK3C 4GNXB 2UU9L 3UDIA 2KHIA 4R4CA 4HJ5A 2IHFA 2CCZA 4L5TA 3U4ZA 1DGSA 3M9BA 4UPAA 3RZOH 3CP0A 4A3EH 4DR2L 1LUZA 4A3KG 3JC66 5M3MH 3AQQA 3CC4A 4JG2A 1WI5A 4BBRH 1JT8A 4TQUS 2MFIA 1LM0A 2I0QA 2PMZE 1PH1A 4OWXB 2L15A 5LMUQ 4A3GH 1JB7A 3I55A 1M90C 2R92H 1BBWA 1PHJA 4BXXH 1CSPA 1G6PA 1V43A 2EQSA 2WB1E 3STBC 2CWPA 2Q2IA 2R7ZH 3KDFB 4IFDG 2B29A 1J5EQ 4B3TL 3F2BA 4HIDA 4QGUA 2UUAQ 4A3BG 1V1QA 2PI2A 4UP8A 5ELNA 4OWWB 1SR3A 4GLAC 3CCMA 1J5EL 3PO2G 4R4TA 5LMNL 2F4VL 1J6QA 1JJ2A 4P71A 5C0XI 3CXCA 1X3EA 2D0PA 4O0AA 1K3RA 4DR1L 4DUYQ 4HIKA 4POFA 4DUZQ 1QZGA 1QVGA 3IRBA 5GAGC 2N8NA 5IP9G 4BY1H 4A3CH 1Q1EA 4KHPQ 2QEXA 1B8AA 1N32Q 3J81i 1UE6A 2K4KA 4DKAC 5C44G 4A3IG 5M5WH 1WCMH 1SFOH 5ELOA 2CWAA 4LFBL 3HOXH 5IY0A 2MQHA 1N8RC 4JI5L 4HJ9A 1C9OA 2VL6A 1IBMQ 1VQHA 4DR5Q 4ALPA 3I2ZA 1NMFA 2K75A 2YV5A 3PO3H 5BR8Q 1V9PA 5FJ8H 3A0JA 3KF6A 4DV4Q 2NN6I 2ATWA 5K36G 3KJOA 3HOZH 4BY7H 1NBWA 1QUQA 2GVBA 1R9TH 3H3VI 3D31A 4LF4Q 1MJEA 1T9HA 2F52A 2NVTH 4GNXA 3CMAA 4JI7Q 3ZJYC 4A93G 3HOZG 5C3EG 4QJFA 4A3CG 2OQ0A 2Q2UA 4DR4L 2D0OA 1JMCA 2HHHQ 1HNXQ 2UUCL 2NVQH 3D0FA 2AWOA 3KF8B 4LUOA 2D62A 3W1GA 3CCRA 1XPRA 1AE2A 2HIVA 1AE3A 4UP9A 3RZDH 1PH8A 4A3LH 3BZCA 3HOXG 4RG1A 4B3TQ 1HZ9A 1XPUA 1MIUA 1IZ6A 2JK8A 2RHSB 3JAMi 1X6OA 5C3EH 3CD6A 4GKKQ 3GO5A 4A3BH 3K7UC 4IPGA 2R7DA 3PF5A 1CKOA 4JBJA 3T1HL 1GVPA 1HNZL 2DUDA 3PUZA 3TREA 5IP7G 5JJKA 3EBEA 1P8LA 1EWIA 5AJ3L 2A1AA 1YNXA 1ASZA 1IBLL 1PYSB 4A75A 1PH3A 3HKZG 1GD7A 2VW9A 1U5KA 1B7YB 3J80i 4DAYB 2ZJRA 1PVOA 1RL2A 1HH2P 4JI8Q 5IYBH 3S1QH 2VNUD 4GN3B 4C2MH 4OWTB 4HJAA 2UUBL 2VZAA 3HOVG 2HQLA 4AIMA 1OXSC 2JA5H 4IJLA 2N49A 1TWCH 4BBRG 1N36Q 2IT1A 1UE5A 4PZ7A 4A3FH 4DV2Q 4JOIC 1WYDA 2CQOA 5C0XG 3PUVA 4IFDJ 3OTOL 4DR7Q 1EOVA 4P74A 3U4VA 4WJ4A 5M5XH 1FGUA 2JEAI 2E2IH 1WOCA 4AYBE 2JA5G 4JI2L 1VQMA 3GTJH 3T1HQ 1CKNA 1PFSA 1VQJA 2N78A 3EIVA 4LF9L 1E7ZA 3ICEA 4LWCA 2H5XA 4OX9Q 3G4SA 1N32L 1L1OC 1K9MC 1I50H 1TWGH 4A3MG 3L7ZC 4X64L 4JI0L 4DUYL 1I94L 2JE6I 1EIFA 1G51A 2Y0SG 1XNQQ 4BBSG 2UUAL 4X65Q 2NVXH 1YBYA 4YHHQ 3TQYA 3SGIA 3HOWH 3HOUG 1JJGA 2I5HA 2YTYA 1I94Q 4LF5L 1XNQL 2WB1G 1RIPA 1UEBA 1A8VA 4PZ6A 1X3GA 2I5MX 5LMNQ 3F2DA 4IJHA 1VQIA 2E2HH 5IYCG 5LMUL 2JA8H 1X65A 3H3VH 3H15A 2BH2A 1A62A 4YCWA 1HR0L 5IYBG 2VQEQ 2VY3A 3UE0A 4DR6L 1CSQA 1L2FA 4DR2Q 1X9NA 2JQOA 1X54A 5GAHC 1XJVA 3NEMA 3NELA 4QQBX 1KD1C 4PZ8A 3TS0A 4GN5A 4JI6L 1I5FA 1KRSA 1K0RA 1SN8A 3I4NH 4WJ3M 1VQDA 3I7FA 1KAWA 1VQEA 2OWOA 1VQ7A 4X66L 1KIXA 4LW1A 4DV0Q 1D7QA 5JJIA 2XTIA 2YYZA 5C4JH 4DR1Q 4A3JG 5C4XG 4JC0A 4QIWE 1KRTA 4K0KL 3G48A 3BU2A 4JI8L 2A8VA 1VQFA 2YTXA 2KCTA 3S14H 3GTOH 1WFQA 1S72A 4LFCL 2UXCL 2UXDQ 2UXBQ 4HJ8A 1PH9A 3A74A 4YY3L 2ZJPA 1K8GA 3NBHB 3CCJA 1QVFA 4H02A 1VQ8A 1XMOQ 3B6YA 2Q2HA 1CKNB 4P73A 3CCUA 1VQCA 1FJGQ 3HKZE 2VUMH 1W3SA 4PG3A 2PQAA 3ERSX 4A3FG 3S2HH 1VCIA 1FL0A 1TWHH 2F3IA 3GTQH 4DK6C 5IWAL 3ULLA 4EQ5A 2IX1A 2E8GA 1HJPA 1Q1BA 2KHJA 4IOCA 4LF8L 3CPFA 5J3BA 4HJ7A 1E24A 3K0XA 4LF7Q 4JI1Q 4DV7L 4OONA 1FJGL 4BBSH 4R4IA 1X56A 4GN4B 1G291 3GDEA 3ULPA 4BY1G 5IP9H 1XMQL 3UDGA 2Y0SE 1KC8C 2R7FA 4C3JH 4IO9A 3I4OA 1HNXL 4LF4L 3TS2A 1EUJA 1NY4A 2OCEA 1KL9A 2CFMA 3UDXA 3PUWA 3KJPA 5M3FG 1OXVA 4P72A 2QA4A 2RF4A 5LMNW 1EYGA 3GTLH 2WAQG 3PO2H 4X62Q 4K0KQ 1JJCB 4LNQA 4DV6Q 4DV1L 1HNWQ 4DNIA 5M5YH 4DV4L 4NXNL 5IYDH 4JBKA 1X55A 3AFPA 2JJQA 2R7ZG 4DR5L 1QVCA 1K83H 4NXML 5H1SE 4YWLA 3KFUA 3S15H 4XIGS 2GVAA 1L1OA 4NXMQ 4LFBQ 5JJLA 4B3RL 3S1RH 3EN2A 3AYHB 3E9IA 4HIMA 3G6EA 2ASBA 4A3EG 3GTGH 3F1ZA 3J7A5 1Y14B 1GM5A 1VQ4A 4QY7A 4GKJL 2ZJQA 1MJCA 4MNOA 4YCVA 1M1KC 2JA6G 1OTCA 1XMQQ 3TRZA 1BVSA 1N9WA 4IPCA 2IX0A 2LXJA 3HOVH 4P75A 2PQAB 4JI1L 1UE7A 3CC2A 2YTVA 4L5SA 4B3SL 1Y1VG 3FP9A 1TWFH 3RN5A 5IWAQ 5C44H 4A3IH 1YJNA 2Z6KA 2K5VA 2EIFA 1E1OA 1YVCA 3OYYA 3CCQA 3J81c 5GQOA 1YJWA 4MZ9A 1N34L 1EIYB 3GTMH 4BY7G 3HOYG 4MTNA 4DV3L 3WWVA 3S2DH 3KYHC 4YWKA 1E1TA 5JEAJ 5FJ8G 1VQOA 4A76A 1YI2A 2BA0A 3DM3A 3GD7A 3K81C 4IFDI 3RNUA 3RR5A 1Q86C 1PH7A 3HKSA 3FHWA 5IP7H 1EFWA 4JI4Q 2HT1A 2RCNA 1UWVA 2CKZB 4GNXC 4YY3Q 1YHBA 4GLXA 3K8AA 1TWAH 2K5NA 2K50A 1SLJA 1IL2A 1P16A 4L5QA 3PIOA 1VQPA 4JV5L 4DV2L 1U0LA 4R4OA 2JA7G 1FVIA 1YZ6A 4BA2I 2B3GA 4KI0A 1CUKA 5IYCH 1O7IA 1BBUA 1CKMA 1TXYA 1PV4A 4A3GG 1SE8A 4LFAL 2UXDL 3FKIG 2ID0A 1NMGA 1YEZA 1QZHA 3J7ZC 5FLXc 2K14A 4GOPB 1Q81C 1L1OB 3HOUH 3HOWG 3FKIH 3PUXA 1VQGA 5DLQE 3RLNA 4JV5Q 2VS1A 4DV0L 4A3MH 4QL5A 1PA6A 3I4MG 1VQAA 2JA7H 1N34Q 3CAMA 1A0IA 4O2DA 2VQEL 4GLVB 4AQYL 3U50C 4DUZL 1VS0A 1YIJA 4DV6L 4LF6Q 1PH5A 3RLFA 1IBKL 2OTLA 4IPDA 3S1MH 2R93H 4J15A 4GOPC 2F4VQ 5GAEC 4XTCS 5IT9c 3M85A 3LGJA 4LF5Q 3M4PA 1XMOL 3M4QA 4B3MQ 3KLWA 4YWMA 1I3QH 4B3ML 2VUMG 3KDFA 4X64Q 3K80C 1C7YA 1KXLA 3K7AH 4ME3A 2GN5A 2AKWB 2HHHL 3L2PA 4OX9L 1OXUA 1OXXK 2ZTEA 5GADC 3CMEA 3CPWA 1Y1WG 4GKJQ 1SMXA 4LUVA 5EAYA 1IBML 4JI7L 1YITA 4C3IH 4LF7L 4JI5Q 2K5HA 3NENA 1VQBA 3W5OA 4DAMA 5IE8A 4POGA 1N33L 5FLMH 4BA1I 3JAMc 4IPHA 2BH8A 1KQSA 3E9HA
chains in the Genus database with same CATH superfamily
4DR7L 1RHPA 2IL8A 1ENAA 1PTOD 3H6MA 1SEBD 1Z9FA 2WP8J 4AQYQ 2A6ED 2FHTA 3I4NG 1EZ8A 4DR6Q 1PH6A 4JCVE 4JYAL 3ULJA 1VQ9A 1NTGA 2EYFA 1HNWL 1V8QA 1ZXTA 3SK5A 4C3HH 4K5WA 2BA1A 2WB1B 3D8GA 1EEFD 2MNAA 1WTXA 1HR0W 5D3DA 4JPBW 1VQKA 2Q2TA 1A63A 1EIHA 2A6EC 4Y7NH 3HG9A 3UDFA 4DV3Q 2BE5D 4FVMA 3CCVA 2Z8LA 2WFWA 4HTHA 4JI3Q 3C3LA 4JI3L 2NZHA 2PNHA 4GS3A 4A93H 2LKVA 2RHQB 3IFTA 1GUNA 1NJIC 4B3SQ 1PYBA 4C2MB 4RMFA 1D5MC 4LFCQ 1JB3A 1XTDA 4RCNA 5JEAG 3CHBD 1MKHA 1VQ6A 4C3IG 4MHEA 1I4GA 2L0CA 2E5LL 4E6IA 3KF6B 3KOJA 5DEHA 2NZOA 3R2IA 4HIOA 1KDCA 3N6RA 2E2JH 2Z1CA 3VYRA 2AUKA 2KVMA 3J81E 1LTBD 5J22A 3MEFA 3QO2A 5AFWA 3H0GH 1VQNA 4H0LC 2SEBD 2ALYB 3PGZA 1N33Q 5M5YB 2HQEA 2F0MA 2JXMB 3HOWB 1FNUA 5LL6S 4A3KH 1JE4A 1STAA 1HZAA 1OXTA 1QJOA 1X3FA 3HFZB 1A3TA 1ESFA 2B8GA 2E2HB 1O80A 1PLFA 3IAYA 3Q23A 2A19A 1DJRD 4RGNA 1CA5A 1I6HH 1YHAA 1U4RA 3BYTB 4LF6L 2F0HA 4JI0Q 4N8X1 4JI2Q 3IFDA 2Z0SA 2ZTCA 2K03A 3H94A 1RODA 5C4XH 4V0BA 1SE4A 2KEEA 3A5UA 4AH6A 3WOFA 1CQVA 3VDYA 1LACA 4CDFC 1SAPA 1ZYRC 5JVH3 3GTKH 3A8KE 3CF5A 4LFAQ 1I4QA 2PW5A 5C0XJ 1YJ9A 3R2TA 1TWAB 3PMFA 2V1CC 1Y1WH 2VUMB 1SXTA 3O13A 4L5RC 3MXNB 2YU9H 5JVG3 2KHIA 4HJ5A 2IHFA 2CCZA 1VF5C 5NUCA 3KLRA 3RZOH 4OL7A 3CP0A 4C1NI 4A3EH 1O7YA 2Q8IB 4EQOA 3JC66 2CW0D 3CC4A 4CJ0B 1EY8A 2I0QA 2PMZE 2L15A 2M00A 3A7LA 2WAQB 2NB0A 4H13C 2QEJC 1KLGD 5CV7A 1PHJA 2MGSA 2X6LA 3BVGA 4I7ZC 2UUAQ 4OWWB 4GLAC 4R4TA 1J6QA 4XT3B 2EDGA 5EKLA 1CA6A 1J9OA 5M9OA 4POFA 1ONLA 1Q1EA 5E4WC 3A7AB 5C4ZA 2MQHA 2EE1A 3MVVA 4JI5L 1G8ZD 2FFKB 1PTOB 1IBMQ 2TMPA 3HOYB 3I2ZA 1NMFA 4RH6A 2ATWA 2NN6I 1X3QA 5CR3A 1HHVA 1PRTC 1QUQA 2GVBA 2MUYA 3D31A 3K58A 4S3SA 1X32A 1EYCA 3NSWA 2OQ0A 5EPJA 4A3CG 1JMCA 2HHHQ 3D0FA 2D62A 3ERQA 3CCRA 4C56C 2HIVA 1PH8A 1SBBB 1B3AA 3HOXG 4RG1A 1HZ9A 2JK8A 2RHSB 3JAMi 5C3EH 3GO5A 4CHTB 5C3WA 3K7UC 5KYIA 5KNBA 4IPGA 3VR3A 2F0LA 2DUDA 5JJKA 3EBEA 3BYYB 3NTKA 2SNMA 1EWIA 4MN3A 3SK8A 1IBLL 1NR4A 1PYSB 1PH3A 1QE6A 2VW9A 3TBIB 1B7YB 3J80i 4A93B 1PVOA 1RL2A 1HH2P 3Q0AA 5M3FB 4G7ZC 4HMIA 5C5MA 2UUBL 1I4PA 3HOVG 2BE5C 2XRQD 1EWCA 1N36Q 4ZAIA 2FJ2A 4RKLA 4DV2Q 4JOIC 3PUVA 4KY5A 4P74A 3U4VA 4ID6A 2I07B 2JEAI 2PO4A 1WOCA 2JA5G 1QCBD 3GTJH 5T1GA 1AP0A 2J7ZA 2SDFA 3MWYW 3EIVA 2N78A 2A74C 2H5XA 4OX9Q 2DJFC 1L1OC 4A3MG 4OEMB 1G51A 1LTID 2AUJD 1YBYA 4C3IB 2NVXH 1NCVA 1HQMC 4LF5L 2WB1G 1IKMA 2I5MX 1AZPA 1BXTA 1X65A 5FK9C 4K2KA 3Q22A 1HR0L 3A55A 3EROA 3UE0A 3DWAA 1RD9D 2JYOA 4DR2Q 2PMZB 3DM1A 2EJMA 2HCCA 2F0JA 4V190 1KRSA 3K5NA 4WJ3M 4X66L 3LWUA 5KIXA 4A3DB 1D7QA 3C2PA 3N52A 3AU7A 1B53A 2A8VA 1VQFA 1HUMA 4DXGA 2UXDQ 4G57A 3A74A 4YY3L 3CCJA 5HGTA 1QVFA 1R4PB 2PQEA 3B6YA 2CH4W 2K33A 4PG3A 1QNUA 2PQAA 2CH4A 3URYA 2HDLA 4DK6C 4U673 3R8BA 4LF8L 3V96A 4CJ2C 3K0XA 4MTKA 2EJGC 5C5LA 2RVLA 4BBSH 1X56A 5L37A 2BOSA 2NN6H 5T1IA 3ULPA 3MHBA 4C3JH 2WACA 1EUJA 1KL9A 2LFNA 4G7OC 4PMCA 1OXVA 1PTOF 5FO9B 3GTLH 1EYGA 4A3JB 2CW0C 1B3QA 1JJCB 2J4XA 4LNQA 4DV1L 1HNWQ 4NXNL 2VB3X 5IYDH 4A3KB 2JJQA 4NW2A 1K83H 5EKKA 5H1SE 2AQ1B 1O7LA 4XIGS 3S15H 2GVAA 1STYA 4LFBQ 1E2VA 1ML0D 4B3RL 1KTKA 1K0SA 3HS0C 4DA2A 2X69A 2EY2A 1GM5A 4GKJL 2ZJQA 2O2LD 1MJCA 3BDCA 1M1KC 3J7AV 1CM9A 1XMQQ 1JWUD 1BUVT 3NK9A 2LXJA 3JAML 3HOVH 3HOZB 2HCIA 2YTVA 4B3SL 5FOBB 2HUGA 1YJNA 5BN5A 4BY7G 2G9DA 1E1TA 3DM3A 1S5BD 1WTWA 5LHY1 3RNUA 4KK7A 4GNXC 1TS5A 4YY3Q 1YHBA 4GLXA 3EJIA 2B2YA 2K50A 1K28A 1P16A 4L5QA 1VQPA 4JV5L 3HRZC 1U0LA 5CBEE 1JQYD 3FMCA 4KV6A 2JA7G 2K1BA 2YU9B 1GJXA 4IN3A 2OF1A 1UNSA 1BBUA 4ZLTF 3TSSA 4A3GG 1O7ZA 4LFAL 3AMUA 5CORA 2ID0A 1YEZA 4RHSA 5M3MB 3HOUH 3RLNA 4JV5Q 1SNCA 1SYEA 2KQ3A 4CDCC 1T5EA 3NTIA 4O2DA 1Y8OB 2R7ZB 4A3FB 1CQFA 4DU9A 5IIFA 2EY1A 4DV6L 1H9MA 1MBYA 3SEBA 4DAPA 5GAEC 4GOPC 4LF5Q 3M4QA 2L12A 2OEOA 5CGKA 5KNDA 1HXYD 5CV5A 3KDFA 1AFPA 2DJGC 4BY1B 3L2PA 3TP7A 1OXXK 5GADC 4JI7L 4X3UA 5ELFA 1YITA 2K5HA 3NENA 5C6AA 1PV4A 1KQSA 1HZBA 1HPCA 3J80c 3V05A 4QUCA 2WAQE 4NKLA 5IOCA 4BY7B 2EOTA 3S1NH 4DR3L 2NUCA 2NVTB 1TU2B 2EXDA 2ES2A 2RQXA 5M3MG 2F0KA 1BF4A 2NVYH 2OT2A 4RGOS 3QOLA 1BCPD 5EJWA 4X62L 4NXNQ 4PMWA 4ODGA 3RZDB 3E6ZX 4KLKA 1V1OA 1XNRL 1KDBA 5HGQA 3A5ZB 2VQFL 2R93G 4BWGB 5G3LF 1Y1VH 1RF2D 5J39A 2IX3A 4A3BB 3T1YL 1Q3LA 4KHVA 5ELEA 2E74C 1K8AC 1JE5A 1IW7D 3SK6A 1IBLQ 3UI2A 1STHA 4YCUA 1PH2A 3NXWA 2B2UA 4OXPA 5HY6A 1J8IA 3EA6A 4JI4L 3DWQA 1VMCA 2MP1A 4F87A 2RSNA 1HR0Q 4J6HA 1XPOA 1WCMG 1S3OA 3HGBA 5D14A 4UAIA 2X6GA 3BJUA 5IODA 4TVAB 1TWHB 2DGYA 1ET9A 4FF4A 2N55A 1E2WA 4XQJA 4OO1G 4X65L 3CKIB 1PZKD 4FYDA 1BR9A 2B2TA 4BBSB 4X66Q 1STBA 4JYAQ 3HKZB 4JOIA 5BR8L 3GP7A 2XWJB 1WD0A 3IKJA 3GTLB 2A6HD 2KCMA 3SK4A 3GQBA 2R92G 2B63G 4A3JH 3T51B 4DR3Q 1QB5D 4UY8C 3BVZA 3VR4A 2PZWA 2NVXB 4FF2A 3EVQA 3EQLC 4KN7C 2WIIB 3I4MH 4C3HG 2MO0A 4EQNA 2PNRC 4A4IA 2JA8B 4UDUC 1LTLA 1ILQA 1B2TA 1Q46A 4JBMA 1TVXA 1WJJA 4A3LG 1IBKQ 1C0AA 1Q7YC 1HFNA 4F88A 1Q82C 2OTJA 2K05A 1A2UA 1FR3A 1TWFB 4RAUC 5C44B 4A3IB 2UU9Q 3PF4A 1STNA 4LAAA 1SROA 1EWHA 4KHPL 3S14B 2O5JC 2MJ8A 3T1YQ 1KHIA 4KMUC 3S2DB 3OTOQ 2ZM6L 4AYBG 4JVZA 1XNRQ 3PO3G 3F2CA 2NN6G 2EXZA 3ER0A 1K73C 3C46A 1UEAB 1STEA 1F2ZA 4GOPA 1D8LA 3TDQA 2WINB 1D6EC 4A3DG 5ELDA 3FPPA 3VA5A 3S2HB 3DXJC 5JJZA 3GTPH 1GHJA 2KHSA 2TSSA 4GNXB 3TP5A 4R4CA 3VR5A 4L5TA 2WKCA 3U4ZA 3M9BA 3KLSA 2PPBC 3MXGA 1LUZA 2FMMA 3AQQA 4KJOA 2F0GA 1WTPA 4FXGC 1IW7C 5LMUQ 1BQQT 1M90C 2R92H 1CSPA 4CKBA 1U4PA 2EQSA 2WB1E 1TR5A 1HFGA 2R7ZH 3P1HA 4B3TL 3PO2B 1HRJA 4DK0A 3CCMA 3M4YA 5IGFA 5LMNL 3I3CA 3W2DA 1QILA 1JJ2A 1SYDA 4OIKA 1PRTF 2L1BA 3GV6A 1SYFA 2B2VA 2N8NA 5IP9G 2QEXA 3S1RB 3J80L 5M5WH 3NBHA 2VL6A 4LK1C 5BR8Q 1V9PA 5FJ8H 3HOVB 5K36G 3HOZH 3S1NB 1NBWA 5EPKA 1T9HA 2NVTH 2A68C 1DZ1A 4JI7Q 2F0PA 4A93G 3HOZG 5C3EG 2OXPA 1WTVA 2NVQH 3W1GA 3RZDH 2ZXPA 1KDAA 1X6OA 1QG7A 2HD3A 3T1HL 4XQQA 1EIGA 5ELBA 4WRDA 5I9PA 2E2DC 2A1AA 2NYZD 3OW7A 5TSSA 4WFN3 4DAYB 4JI8Q 5IYBH 3FKIB 1ZYRD 3VYUA 4HJAA 3Q6SA 2A69D 3P20A 1I4HA 4AIMA 2EYOA 3A8JE 1D5XC 2JA5H 4IJLA 2EY5A 4B08A 2F0WA 1WYDA 2MPMA 2F0IA 4HCSA 2CHBD 1FGUA 2A5HA 4O42A 1H9SA 2E2IH 5BN3A 1SNOA 4AYBE 4JI2L 1RCVD 5EBDA 2LY7A 1VQJA 3DWPA 4LF9L 1E7ZA 3R93A 5FO8B 3G4SA 4FO2A 1N32L 3F2UA 4X64L 4JI0L 5COYA 2JE6I 1I94L 1XNQQ 2Y0SG 4ULLA 1GUOA 3HOWH 1NR2A 3TQYA 3SGIA 4F7XA 1JJGA 3FDTA 4RFBA 2I5HA 1RIPA 4IJHA 2E2HH 5LMUL 3FPUB 3MFGA 4DAVA 3JAME 2BH2A 4DR6L 4IZ8A 1I6HB 5K36H 1XJVA 4QQBX 3NELA 1A6XA 1M8AA 1PXUA 4JI6L 1I5FA 3U9OA 1K0RA 3RMHA 1KAWA 2PZUA 1KIXA 4DV0Q 3SXHA 4OIJA 3R3OA 1Y1VB 4XT1B 4DR1Q 4K0KL 4JI8L 1LO5D 3S14H 4WORA 3GTOH 1K8MA 2UXCL 1JOQA 2F0SA 3G7LA 3J81L 1PFBA 1XMOQ 2XVSA 2DNEA 4P73A 1VQCA 5FKAC 3K59A 1EOTA 3ERSX 1VCIA 1FL0A 4IUQA 1GUSA 2F3IA 1PMRA 5A2QE 1HJPA 4LF7Q 2Z4HA 4R4IA 1F2LA 3UDGA 1BNZA 3T16A 1KC8C 2R7FA 1RDPD 1HNXL 3W3AA 1ICWA 1NY4A 2F3VA 4M1UB 3OOCA 3NHHA 5M3FG 5LMNW 1JWSD 1F77A 1LLRD 5JPMC 5IGBA 4JBKA 3AFPA 4FF1A 1L1OA 4J1MA 5JJLA 1BBXC 4K5XA 1IL8A 3G6EA 3VYSA 3OIQA 4A3EG 2ASBA 3HOXB 4HSVA 4RGMA 3GTGH 1W6JA 1YNJD 1DOKA 3J80E 1FGBD 4LFBL 4MNOA 3S16B 3PO3B 3DMUA 1BVSA 3U9SA 4IPCA 1EYAA 2PQAB 4PNYA 1UE7A 4P75A 3CC2A 1Y1VG 4G7HC 3RN5A 5EKIA 5IWAQ 1I6VC 1EIYB 3GTMH 1N34L 3HOYG 4CKEA 5FJ8G 5JEAJ 2KCCA 3A54A 1YI2A 4HSPA 3D4WA 2F03A 3GD7A 4QIWB 1PH7A 1EFWA 3FHWA 2RCNA 3D6WA 4KD4A 4HEDA 1Y8NB 4GZYC 1IL2A 1SLJA 2K5DA 1Y1WB 4DV2L 3A8IE 1FVIA 1YZ6A 2L11A 1CUKA 3M4OB 5IYCH 3QR8A 1CKMA 3FKIG 1A3UA 1U4MA 2Y0SB 3RZOB 1QZHA 2LMCB 2NBFA 1Q81C 3S1QB 3FKIH 5DLQE 1S5ED 3MTSA 4A3MH 1PA6A 3I4MG 2R92B 1NSNS 5DAUA 4IUVA 1H9JA 1HQRD 1S5DD 4I65A 3PIP3 1VS0A 1X3PA 1XX8A 2KOLA 3RLFA 5K5PA 1ZEQX 1IBKL 2EZVA 3ND8A 1PFNA 3M85A 1LT5D 3GTJB 4C1NK 4XYOA 1JCKB 1LV9A 4YWMA 1UUPA 2VUMG 3K80C 3T56B 1C7YA 1KXLA 3H91A 4B9XA 1H9KA 2G9HD 3OHXC 3CMEA 4GKJQ 3QWNA 5EAYA 4M8AA 4LF7L 1WCMB 4C3IH 3HP3A 4JI5Q 1VQBA 3NE5B 4DAMA 3NWTA 3PIO3 5FLMH 1LTSD 4KKTA 1MSGA 3H3VI 2BH8A 3E9HA 4DK1A 4BXXG 1XWEA 5FLMG 4BS9A 3PUYA 5C4HA 3E0EA 4DF7A 1Z47A 4Y52H 1HTPA 1I4RA 2ZTDA 4IURA 3EFXD 2UXBL 2RDHA 1AZQA 4DV5L 3NQTA 4TRDA 1FYCA 3TN2A 3OSOA 2E5LQ 1SE2A 5C3EB 1AH9A 4R8NA 2AQ3B 3M7GA 1YNNC 1BKBA 3NQIA 5LL6X 4L8JA 2EPBA 1LT4D 3KF8A 4OELB 3GTOB 1IXRA 4NPSA 1GUGA 5J1ZA 3BG3A 1S5CD 4DPGA 4ZUJA 1H95A 1FD7D 2LSSA 1LTAD 1SJED 1TQOA 3I90A 3M7NA 4JW0A 3PV0A 3CCEA 1IYJB 5IGEA 1E3PA 2M2LA 3H0GG 4GKKL 3GTQB 2L4NA 5IYDG 1A2TA 3BS1A 1S5FD 2XGTA 1CZWA 3BZKA 3OW2A 1B9MA 3D6CA 1F9RA 2UXCQ 1DM0B 2B63H 2E2IB 3PCOB 4DV5Q 4LF9Q 2IHEA 1E2ZA 3PQIA 4JK1C 3NWSA 3K5MA 1LT3D 3CQZH 1II3A 4EVOA 2IY5B 2QDLA 2F0DA 2K04A 1CZGA 3E5SA 4B3RQ 3QG1A 1TWGB 2AMCB 1G6ZA 4JI6Q 4UP7A 5GROA 5EQ0A 3OWEB 2K5QA 1K83B 1L0YB 4NB3A 1AW7A 3S15B 4FDBA 1C48A 1I4XA 4OO1I 1YHQA 2EYLA 3S17H 3STBD 1EU3A 5I6YA 3SE0A 2I5LX 4YHHL 5AJ3Q 1ET6A 1EU4A 5I6WA 3PIPA 2JA8G 3UE1A 1KLUD 3G71A 4LF8Q 3S16H 5KYLA 1F9PA 1W2BA 1RTNA 3VR2A 4LMQD 2F0UA 4PQXA 3HZXA 3I4NB 2AWNA 4TSSA 1IHZA 5KGUA 1MGSA 2RDFA 2BDOA 1WTQA 1KAAA 2O4XA 1GKHA 5E3FA 1CFMA 1BDOA 1LTTD 1ENFA 1ASYA 2CVRA 2A69C 2AHOB 2UUCQ 1B4OA 3CCSA 4R1JA 4DV1Q 1QWYA 3P7JA 1RTOA 2PI2E 3RLOA 3J7AF 3KBXA 1LYLA 1TY0A 2IWHA 1LTGD 4MIUA 1UE1A 4DK3C 4CKCA 2UU9L 3UDIA 3BZDB 1FNWA 3NUCA 3MXUA 3SDZA 4DR2L 4A3KG 2EVBA 4ZYSA 4JG2A 4BBRH 5HURA 4TQUS 2MFIA 1LM0A 1PH1A 1MD2D 3LWEA 4K14A 1TS4A 1JB7A 3MFYA 1BBWA 1G6PA 1V43A 3STBC 2CWPA 2Q2IA 3KDFB 2B29A 1J5EQ 3F2BA 2XWBB 4HIDA 4QGUA 4A3BG 1V1QA 2NTTA 2PI2A 4UP8A 4X3SA 5ELNA 1SR3A 2R93B 1SSOA 3DHQA 2F4VL 1F2YA 1SE3A 4CDDC 3QOJA 1JORA 1X3EA 4ILWA 4DUYQ 4HIKA 4A3CH 5GAGC 4BY1H 3MAQA 4KHPQ 1B8AA 3J81i 4IQZA 2K4KA 4DKAC 2CWAA 3HOXH 1DD2A 1VQHA 2F0VA 4CBVA 4DR5Q 2K75A 1HCZA 5JEAH 2WKDA 4IUNA 3A0JA 3KF6A 4X3KA 1CTMA 4DV4Q 4IUUA 4BY7H 5F2DA 1MJEA 2F52A 4GNXA 3ZJYC 2F0EA 2RDGA 4QJFA 3GTMB 1HNXQ 5KNCA 2AWOA 1PRTB 1AEXA 2LS01 3CRKC 3QB3A 4LUOA 1XPRA 1NNXA 4UP9A 1HA6A 5DM63 3MA2B 3J7YW 4B3TQ 1PTOC 1XPUA 1MIUA 3NTHA 3CD6A 1WVLA 2F0FA 4XXEA 3M3YB 3FEWX 2R7DA 1HNZL 1LT6D 2K6AA 5E4XA 2K28A 1ILPA 2QILA 5IP7G 1C4QA 1P8LA 3SVMA 5A2QL 1IKLA 3S9WA 4OGQC 1CI3M 1PDQA 1GD7A 4K5VA 1U5KA 5D65A 2VNUD 3S1QH 1DOLA 4OWTB 4A3MB 2Z4IA 4XQNA 2HQLA 1OXSC 2ZT9C 2JA7B 5FLXL 4BBRG 3QJYA 1UE5A 2CQOA 1G2SA 5C0XG 4ABNA 3OTOL 3WOEA 1TY2A 3QIAA 5M5XH 5I9OA 2E2JB 4HCEA 1EL0A 4YIJA 2Q8RE 3K5OA 3I4LA 1CKNA 1PFSA 1EY5A 3I72A 4LWCA 4XDXA 1K9MC 1I50H 4IALA 4OHJA 3L7ZC 4DUYL 3MXNA 1EIFA 2UUAL 1M4VA 4X65Q 4YHHQ 1TIID 1O78A 2Z6BA 1IYUA 2YTYA 1PZJD 1RJTA 4PZ6A 1UEBA 1A8VA 1X3GA 1H9RA 3F2DA 1VQIA 2B2VC 4C3JG 3H15A 2D9UA 2QKIC 4H7BA 3S17B 2RSOA 1E0BA 2XIWA 1CSQA 1L2FA 1X9NA 2JQOA 1X54A 5GAHC 3BVMA 1KD1C 4PZ8A 3TS0A 1S4ZA 4GN5A 2EYHA 1SN8A 4IUTA 3I4NH 3FVQA 4EQPA 1VQEA 4DFAA 1VQ7A 2OWOA 4LW1A 3NBIA 2XTIA 5C4JH 4A3JG 3LX0A 1KRTA 3G48A 3BU2A 1EFID 2KCTA 2Q8TA 4Y7NB 4DGZA 1YNJC 1PZID 3MZ5A 1EZ6A 2ZJPA 1NAPA 2ZXOA 2A68D 2KCNA 4H02A 4ME5A 3KUPA 2NZ1D 1EYDA 3CCUA 1DXMA 1QOHA 2ENBA 3HKZE 3CRLC 2ZXRA 1Y69U 3S2HH 2DY7A 4NDXA 2XNAC 1B1ZA 4CGYB 5ISRA 3GTQH 3ULLA 4EQ5A 2IX1A 4IOCA 3CPFA 2WV6D 3VR6A 4OONA 1FJGL 1Z6HA 4GN4B 2PCFB 5IP9H 2F3WA 2SNSA 3I4OA 3TS2A 1CHQD 2CFMA 4HMJA 4HN7A 3UDXA 3KJPA 4QCLA 3CQZB 2XN9C 3RUZA 1WD1A 1LABA 2WAQG 2D2CC 4B9WA 3PO2H 4K0KQ 4ZKBB 3BDLA 3K6OA 4DV6Q 4DNIA 2K01A 2EYPA 1JR0D 1JOOA 1X55A 1QVCA 3C1FA 4FP5D 5CYUA 4NMZA 4RWSC 3I4MB 4FXDA 5CV4A 4Z9CB 1V1PB 3S1RH 3EN2A 3AYHB 3E9IA 5I4DA 1OO9B 2B2WA 2B39A 1YNND 3F1ZA 1Y14B 1PTOH 3TZUA 4DXFA 4P2CB 1GHKA 1CT1D 4Q0FA 1OTCA 2V4DA 4QB4A 1N9WA 1VMPA 4Q5VA 4DN4M 4L5SA 3FP9A 1TWFH 2EYMA 2E76C 2K5VA 2EIFA 3OYYA 3CCQA 3J81c 5GQOA 3KK7A 4MZ9A 2F0OA 2PW7A 4MTNA 4DV3L 5I2YA 3KYHC 4PMBA 1SNPA 1W6KA 3HKSA 1SNMA 2EJFC 2CKZB 3BDOA 3K8AA 2G5DA 4DAYA 2XSCA 3PIOA 3KLSX 5CC4A 4KD3A 3SR1A 3P75A 4R4OA 3I8ZA 1ZKOA 1JWMD 1STGA 1TXYA 5IGDA 2UXDL 3OPOA 4X3TA 1QNKA 4L6TB 4A3EB 5FLXc 2K14A 2KA7A 1L1OB 3HOWG 2VS1A 1VQAA 4FNFA 2JA5B 1A0IA 2CQAA 1TWCB 2AQ2B 4GLVB 4AQYL 4DUZL 1YIJA 4LF6Q 1VF7A 4KY6A 2OTLA 4IPDA 3S1MH 2R93H 4XTCS 3LGJA 3M4PA 4LJZC 3OWFA 3KLWA 1SMYD 4B3ML 1WTHA 4RA8A 4ME3A 4RKBA 2GN5A 2AKWB 4OX9L 2ZTEA 3CPWA 2A73B 4LUVA 1SFOB 5IE8A 3W5OA 1WTRA 1N33L 1MSHA 2K5WA 4UHVA 4BA1I 4IPHA 4LUZA 3HOYH 4KKUA 2N3SA 4N8FA 1PYWD 5CV6A 4QF4A 3TEHB 1EY0A 3S24A 4CJ1B 1V1PA 1EQQA 5FO7B 2JN4A 3PSIA 4KJNA 3TP6A 1UAPA 2MO1A 2RA4A 1B50A 3L0OA 2NVQB 1Z7TA 2F4IA 1S40A 5IT9E 1N36L 5JAVA 3CCLA 2L55A 2P5ZX 4JBWA 2O5IC 2B2YC 2L9HA 2OQKA 3MC0B 4A3DH 2VB2X 4XYQA 1SYGA 3M3YH 4K6LA 3D3RA 2K52A 2JA9A 5E7NA 3W1BA 1GO3E 5KEEA 2JA6H 3I56A 2MHVA 5D3IB 1SYCA 2B2WC 3CC7A 1BCPC 1EEID 1SNDA 4RGTA 2DY8A 1SRUA 5M3FH 2K32A 2A6HC 2H1EA 4RHRA 3T4AC 3RN2A 4DR4Q 1PH4A 4APVA 1Q8KA 2JEBI 4R8IA 2ZM6Q 2R61A 2VQFQ 5E1FA 2KBNA 5CV8A 5M5XB 3DLLA 3X3NA 2B8FA 2K7VA 1D5ZC 1F2MA 2C35B 4R4QA 3NP8A 2R6GA 1I50B 4KHZA 3AFQA 1Y8PB 1HNZQ 1Q8IA 2HIXA 3FRPB 1CK1A 3MXPA 3TMEA 3H09A 2UUBQ 3Q8DA 3SHLA 3V2TA 2JP1A 3Q24A 3U58A 1NE3A 1EY9A 2KECA 1ESRA 3GTGB 4ZRZA 2L5TA 1B70B 1KNAA 2LXKA 3D4RA 4I7AA 4EX5A 1VQLA 2RCFA 1LTRD 4DV7Q 2Z6KC 2QGQA 4IOAA 2IPKD 1Q90A 5C4JB 3F8TA 2SOBA 3J81j 2B2UC 4PV1C 4X6AH 2IJ0A 3CW2C 1Q12A 1L0WA 1EQRA 1H9SB 1EQTA 2FXQA 2VXWA 4ZCKA 1F9QA 1KABA 1VQ5A 1JICA 1E22A 2XRSD 1QUQB 4FF3A 4KN4C 2KENA 3M4OH 1HZCA 1GXDC 1DGSA 4UPAA 5EBCA 2I46A 5M3MH 1WI5A 1JT8A 4OWXB 1MHWC 4A3GH 5IGGA 3I55A 4C3JB 4BXXH 4G4KA 2D5DA 4IFDG 3ND9A 3VA7A 2R3ZA 3I91A 3S1MB 1J5EL 3PO2G 1ENCA 2QF7A 1SJHD 3NPPA 4KY7A 4P71A 4AYBB 5C0XI 3CXCA 1I3QB 2D0PA 4O0AA 1K3RA 4DR1L 3K7AB 1QZGA 4DUZQ 1QVGA 1VDZA 3IRBA 1N32Q 4N9PA 1UE6A 2F0QA 5C44G 2E75C 4A3IG 1WCMH 1T5XD 5ELOA 2J0TD 1SFOH 1SDFA 5IY0A 1N8RC 4HJ9A 1C9OA 4ALPA 2YV5A 3PO3H 1HTLD 1TKWB 3L9AX 3KJOA 1R9TH 5DM73 4LF4Q 3TZDA 1JOKA 3CMAA 1K3BC 5JOBA 2NVYB 2Q2UA 4DR4L 2D0OA 2UUCL 3KF8B 3K57A 4C3HB 1AE2A 4R9WA 1AE3A 4A3LH 3BZCA 3K0YA 1CHPD 2H4OA 5EPLA 1IZ6A 1XTCD 2FMCA 4GKKQ 1SNQA 2F0NA 1KNEA 4A3BH 3OIPA 5G3LD 2RBMA 1CKOA 4JBJA 3PF5A 1GVPA 1PRTD 4WJWA 2Z9HA 3PUZA 3TREA 2QDBA 3VYTA 1DONA 1DYQA 4RCOA 5AJ3L 5DNFA 1YNXA 4K8IA 4HAEA 1ASZA 3MEHA 4A75A 3HKZG 3ITPA 1B9NA 2HDMA 2EY6A 2ZJRA 2BCOA 3HOUB 4GN3B 3IL8A 4K8JA 4C2MH 2FINB 2VZAA 5CBAE 1BCPB 3C1EA 1DOMA 2N49A 1TWCH 2IT1A 4A3FH 4PZ7A 2KUMA 4IFDJ 1IYVA 3H3VC 2NTSA 4DR7Q 1EOVA 4WJ4A 2B63B 4OO1H 4FXKC 1GOZA 1VQMA 2QW7A 3T1HQ 1D1KA 3ICEA 4DNRB 3GV3A 3E0JA 1TWGH 3K5LA 2B2TC 4BBSG 3RD4A 3HOUG 1BO0A 1I94Q 2ICEC 4N9TA 1XNQL 2C9OA 3TP8A 3ZYYX 5LMNQ 2F1MA 5EGTA 5ELCA 5IYCG 2JA8H 3H3VH 1A62A 4YCWA 5A35A 5IYBG 2VQEQ 2VY3A 4U68A 5I2XA 2M9VA 5IGCA 1NUCA 3LNNA 3NEMA 1F9SA 1XYIA 5C3XA 2KEDA 1BCPF 4O1NA 1VQDA 3I7FA 2DNCA 4IUPA 5JJIA 2YYZA 1G91A 5C4XG 4JC0A 4QIWE 2YTXA 4J8QA 1R4QB 1WFQA 1G2TA 1S72A 3GTKB 4LFCL 1C8CA 2JA6B 2UXBQ 4HJ8A 1PH9A 1A3VA 1K8GA 3NBHB 1VQ8A 2Q2HA 1CKNB 4F8MA 4DNTB 3OMCA 1FJGQ 2RKSA 2VUMH 1W3SA 2KJXA 1SYBA 4A3FG 4ZUIA 3GTPB 1TWHH 3L3OC 5IWAL 2E8GA 1Q1BA 2KHJA 3DEOA 5J3BA 4HJ7A 1E24A 4JI1Q 4DV7L 5KRUA 4BBRB 1G291 3GDEA 4CDEC 4BY1G 1XMQL 2Y0SE 3KBGA 4A3GB 2JSOA 1AN8A 4ZQ3A 4IO9A 4LF4L 2BDNA 2OCEA 1GUTA 3PUWA 3X3MA 4P72A 4KTAA 2RF4A 2QA4A 1MI2A 3H0GB 4X62Q 3G6JB 5M5YH 4DV4L 5JPNC 2QCPX 4ZK9B 1GUWA 3DUZA 4QMGA 2R7ZG 3D4DA 4DR5L 3AB9A 4NXML 3OMGA 4YWLA 3KFUA 4NXMQ 3HEJA 4KKSA 2N88A 4K2LA 2C5CA 4HIMA 3J7A5 1HA5A 1VQ4A 4QY7A 2JA6G 4YCVA 1L0XB 3TRZA 1EY7A 2IX0A 4JI1L 3CU7A 1R9TB 5C4XB 5C44H 4A3IH 2Z6KA 1U4LA 3WDNA 1E1OA 1YVCA 1YJWA 4EGVA 2PYKA 3WWVA 2IW3A 3S2DH 4YWKA 2F0TA 1VQOA 5CV9A 4A76A 2BA0A 4K6DA 3K81C 5CMDA 4IFDI 3RR5A 1Q86C 5IP7H 4JI4Q 2HT1A 2ICIA 1UWVA 1TWAH 2K5NA 5IT9L 4NP5A 1U9RA 4IFDH 4BA2I 2B3GA 4KI0A 4TKOB 1BOSA 1O7IA 2DN8A 2GA4B 1PFMA 1SE8A 1XXGA 4HR7B 1NMGA 2NWGA 4L63B 1ICFB 3J7ZC 4GOPB 1HUNA 3T53B 1SMYC 1JC7A 1K8OA 1FNVA 3PUXA 1EY4A 1VQGA 3E3XA 3DEPA 5C0XH 4DV0L 4QL5A 2JA7H 1N34Q 3CAMA 2VQEL 4H44C 1WTOA 3U50C 1TS3A 1PH5A 3I70A 1TT2A 4J15A 2F4VQ 5IT9c 1A15A 1EQVA 1XMOL 4QUFA 1D2BA 1B44D 1RKNA 3I73A 5BN4A 4B3MQ 1I3QH 2PZTA 4X64Q 3K7AH 3T13A 1DCZA 2HHHL 1TS2A 1OXUA 3ONAB 2EYJA 1Y1WG 3A56A 1SMXA 1EY6A 1IBML 5M5WB 4POGA 5FLXE 4ZKCB 1D1IA 3JAMc 3AEVA
chains in the Genus database with same CATH topology
1HZBA 2N3SA 4DR7L 4BXXG 3TEHB 5FLMG 3J80c 3S24A 2WAQE 3S1NH 1EQQA 4DR3L 1Z9FA 2WP8J 3PUYA 3PSIA 3E0EA 2EXDA 4AQYQ 1Z47A 2ES2A 4Y52H 5M3MG 3I4NG 2ZTDA 1PH6A 2MO1A 4DR6Q 4JCVE 4JYAL 2NVYH 3ULJA 1VQ9A 1NTGA 1HNWL 3L0OA 2UXBL 4X62L 4NXNQ 4PMWA 1S40A 4DV5L 3CCLA 1N36L 4C3HH 4KLKA 4JBWA 2BA1A 1XNRL 2OQKA 3A5ZB 5HGQA 2VQFL 2E5LQ 2MNAA 4A3DH 2R93G 1AH9A 1HR0W 1Y1VH 3T1YL 1BKBA 3M3YH 1VQKA 2Q2TA 2K52A 1A63A 2JA9A 1IXRA 1K8AC 4NPSA 1JE5A 5E7NA 1GO3E 3W1BA 1IBLQ 4Y7NH 2JA6H 3UDFA 4YCUA 3I56A 4DV3Q 1PH2A 4OXPA 5HY6A 3CCVA 4DPGA 3HOYH 2WFWA 3CC7A 4LUZA 4JI3Q 4JI4L 1H95A 2LSSA 3M7NA 4JI3L 2NZHA 3PV0A 3CCEA 1HR0Q 2PNHA 4GS3A 1XPOA 1IYJB 1SRUA 1WCMG 1S3OA 2RHQB 5M3FH 1NJIC 4B3SQ 4A93H 3BJUA 1E3PA 1PYBA 4RMFA 3H0GG 4TVAB 4GKKL 4LFCQ 2DGYA 1XTDA 3RN2A 4DR4Q 1PH4A 4OO1G 4APVA 5JEAG 5IYDG 1Q8KA 1MKHA 4X65L 1VQ6A 2XGTA 2JEBI 2ZM6Q 3BZKA 3OW2A 2VQFQ 2E5LL 2UXCQ 4X66Q 4JYAQ 3KF6B 3KOJA 4HIOA 2KBNA 2NZOA 4JOIA 3DLLA 2B63H 5BR8L 3PCOB 4DV5Q 2E2JH 4LF9Q 2IHEA 3MEFA 2C35B 4R4QA 3CQZH 2IY5B 2KCMA 2R6GA 3H0GH 4B3RQ 2R92G 2B63G 4A3JH 4DR3Q 2AMCB 4KHZA 3AFQA 1VQNA 4JI6Q 4UP7A 5GROA 1HNZQ 2ALYB 3PGZA 4UY8C 1N33Q 2HIXA 4A3KH 1HZAA 1OXTA 1X3FA 3HFZB 4NB3A 3I4MH 2UUBQ 2MO0A 4FDBA 3Q8DA 4A4IA 4OO1I 1YHQA 3U58A 1NE3A 1LTLA 3S17H 1Q46A 3STBD 2A19A 4JBMA 1WJJA 2I5LX 4YHHL 4A3LG 1B70B 5AJ3Q 3PIPA 2LXKA 4EX5A 2JA8G 3UE1A 1IBKQ 3G71A 1VQLA 1YHAA 1Q7YC 4LF8Q 4LF6L 3S16H 1I6HH 1C0AA 1W2BA 1Q82C 2OTJA 4JI0Q 4JI2Q 2Z0SA 2ZTCA 4DV7Q 2AWNA 5C4XH 2Z6KC 2QGQA 4IOAA 2UU9Q 3PF4A 1GKHA 3F8TA 3A5UA 4AH6A 3J81j 3AEVA 3VDYA 1SROA 4X6AH 3CW2C 4KHPL 1ASYA 3T1YQ 1KHIA 1Q12A 3GTKH 3OTOQ 2AHOB 2ZM6L 4LFAQ 4AYBG 3CF5A 3CCSA 4DV1Q 4R1JA 1L0WA 2UUCQ 1EQRA 1XNRQ 2FXQA 3PO3G 3F2CA 2NN6G 3ER0A 5C0XJ 1YJ9A 1K73C 1VQ5A 2PI2E 1E22A 3RLOA 2V1CC 4GOPA 1D8LA 1Y1WH 4A3DG 1LYLA 1QUQB 4L5RC 2KENA 3GTPH 3MXNB 2YU9H 3M4OH 1UE1A 1HZCA 4DK3C 4GNXB 2UU9L 3UDIA 2KHIA 4R4CA 4HJ5A 2IHFA 2CCZA 4L5TA 3U4ZA 1DGSA 3M9BA 4UPAA 3RZOH 3CP0A 4A3EH 4DR2L 1LUZA 4A3KG 3JC66 5M3MH 3AQQA 3CC4A 4JG2A 1WI5A 4BBRH 1JT8A 4TQUS 2MFIA 1LM0A 2I0QA 2PMZE 1PH1A 4OWXB 2L15A 5LMUQ 4A3GH 1JB7A 3I55A 1M90C 2R92H 1BBWA 1PHJA 4BXXH 1CSPA 1G6PA 1V43A 2EQSA 2WB1E 3STBC 2CWPA 2Q2IA 2R7ZH 3KDFB 4IFDG 2B29A 1J5EQ 4B3TL 3F2BA 4HIDA 4QGUA 2UUAQ 4A3BG 1V1QA 2PI2A 4UP8A 5ELNA 4OWWB 1SR3A 4GLAC 3CCMA 1J5EL 3PO2G 4R4TA 5LMNL 2F4VL 1J6QA 1JJ2A 4P71A 5C0XI 3CXCA 1X3EA 2D0PA 4O0AA 1K3RA 4DR1L 4DUYQ 4HIKA 4POFA 4DUZQ 1QZGA 1QVGA 3IRBA 5GAGC 2N8NA 5IP9G 4BY1H 4A3CH 1Q1EA 4KHPQ 2QEXA 1B8AA 1N32Q 3J81i 1UE6A 2K4KA 4DKAC 5C44G 4A3IG 5M5WH 1WCMH 1SFOH 5ELOA 2CWAA 4LFBL 3HOXH 5IY0A 2MQHA 1N8RC 4JI5L 4HJ9A 1C9OA 2VL6A 1IBMQ 1VQHA 4DR5Q 4ALPA 3I2ZA 1NMFA 2K75A 2YV5A 3PO3H 5BR8Q 1V9PA 5FJ8H 3A0JA 3KF6A 4DV4Q 2NN6I 2ATWA 5K36G 3KJOA 3HOZH 4BY7H 1NBWA 1QUQA 2GVBA 1R9TH 3H3VI 3D31A 4LF4Q 1MJEA 1T9HA 2F52A 2NVTH 4GNXA 3CMAA 4JI7Q 3ZJYC 4A93G 3HOZG 5C3EG 4QJFA 4A3CG 2OQ0A 2Q2UA 4DR4L 2D0OA 1JMCA 2HHHQ 1HNXQ 2UUCL 2NVQH 3D0FA 2AWOA 3KF8B 4LUOA 2D62A 3W1GA 3CCRA 1XPRA 1AE2A 2HIVA 1AE3A 4UP9A 3RZDH 1PH8A 4A3LH 3BZCA 3HOXG 4RG1A 4B3TQ 1HZ9A 1XPUA 1MIUA 1IZ6A 2JK8A 2RHSB 3JAMi 1X6OA 5C3EH 3CD6A 4GKKQ 3GO5A 4A3BH 3K7UC 4IPGA 2R7DA 3PF5A 1CKOA 4JBJA 3T1HL 1GVPA 1HNZL 2DUDA 3PUZA 3TREA 5IP7G 5JJKA 3EBEA 1P8LA 1EWIA 5AJ3L 2A1AA 1YNXA 1ASZA 1IBLL 1PYSB 4A75A 1PH3A 3HKZG 1GD7A 2VW9A 1U5KA 1B7YB 3J80i 4DAYB 2ZJRA 1PVOA 1RL2A 1HH2P 4JI8Q 5IYBH 3S1QH 2VNUD 4GN3B 4C2MH 4OWTB 4HJAA 2UUBL 2VZAA 3HOVG 2HQLA 4AIMA 1OXSC 2JA5H 4IJLA 2N49A 1TWCH 4BBRG 1N36Q 2IT1A 1UE5A 4PZ7A 4A3FH 4DV2Q 4JOIC 1WYDA 2CQOA 5C0XG 3PUVA 4IFDJ 3OTOL 4DR7Q 1EOVA 4P74A 3U4VA 4WJ4A 5M5XH 1FGUA 2JEAI 2E2IH 1WOCA 4AYBE 2JA5G 4JI2L 1VQMA 3GTJH 3T1HQ 1CKNA 1PFSA 1VQJA 2N78A 3EIVA 4LF9L 1E7ZA 3ICEA 4LWCA 2H5XA 4OX9Q 3G4SA 1N32L 1L1OC 1K9MC 1I50H 1TWGH 4A3MG 3L7ZC 4X64L 4JI0L 4DUYL 1I94L 2JE6I 1EIFA 1G51A 2Y0SG 1XNQQ 4BBSG 2UUAL 4X65Q 2NVXH 1YBYA 4YHHQ 3TQYA 3SGIA 3HOWH 3HOUG 1JJGA 2I5HA 2YTYA 1I94Q 4LF5L 1XNQL 2WB1G 1RIPA 1UEBA 1A8VA 4PZ6A 1X3GA 2I5MX 5LMNQ 3F2DA 4IJHA 1VQIA 2E2HH 5IYCG 5LMUL 2JA8H 1X65A 3H3VH 3H15A 2BH2A 1A62A 4YCWA 1HR0L 5IYBG 2VQEQ 2VY3A 3UE0A 4DR6L 1CSQA 1L2FA 4DR2Q 1X9NA 2JQOA 1X54A 5GAHC 1XJVA 3NEMA 3NELA 4QQBX 1KD1C 4PZ8A 3TS0A 4GN5A 4JI6L 1I5FA 1KRSA 1K0RA 1SN8A 3I4NH 4WJ3M 1VQDA 3I7FA 1KAWA 1VQEA 2OWOA 1VQ7A 4X66L 1KIXA 4LW1A 4DV0Q 1D7QA 5JJIA 2XTIA 2YYZA 5C4JH 4DR1Q 4A3JG 5C4XG 4JC0A 4QIWE 1KRTA 4K0KL 3G48A 3BU2A 4JI8L 2A8VA 1VQFA 2YTXA 2KCTA 3S14H 3GTOH 1WFQA 1S72A 4LFCL 2UXCL 2UXDQ 2UXBQ 4HJ8A 1PH9A 3A74A 4YY3L 2ZJPA 1K8GA 3NBHB 3CCJA 1QVFA 4H02A 1VQ8A 1XMOQ 3B6YA 2Q2HA 1CKNB 4P73A 3CCUA 1VQCA 1FJGQ 3HKZE 2VUMH 1W3SA 4PG3A 2PQAA 3ERSX 4A3FG 3S2HH 1VCIA 1FL0A 1TWHH 2F3IA 3GTQH 4DK6C 5IWAL 3ULLA 4EQ5A 2IX1A 2E8GA 1HJPA 1Q1BA 2KHJA 4IOCA 4LF8L 3CPFA 5J3BA 4HJ7A 1E24A 3K0XA 4LF7Q 4JI1Q 4DV7L 4OONA 1FJGL 4BBSH 4R4IA 1X56A 4GN4B 1G291 3GDEA 3ULPA 4BY1G 5IP9H 1XMQL 3UDGA 2Y0SE 1KC8C 2R7FA 4C3JH 4IO9A 3I4OA 1HNXL 4LF4L 3TS2A 1EUJA 1NY4A 2OCEA 1KL9A 2CFMA 3UDXA 3PUWA 3KJPA 5M3FG 1OXVA 4P72A 2QA4A 2RF4A 5LMNW 1EYGA 3GTLH 2WAQG 3PO2H 4X62Q 4K0KQ 1JJCB 4LNQA 4DV6Q 4DV1L 1HNWQ 4DNIA 5M5YH 4DV4L 4NXNL 5IYDH 4JBKA 1X55A 3AFPA 2JJQA 2R7ZG 4DR5L 1QVCA 1K83H 4NXML 5H1SE 4YWLA 3KFUA 3S15H 4XIGS 2GVAA 1L1OA 4NXMQ 4LFBQ 5JJLA 4B3RL 3S1RH 3EN2A 3AYHB 3E9IA 4HIMA 3G6EA 2ASBA 4A3EG 3GTGH 3F1ZA 3J7A5 1Y14B 1GM5A 1VQ4A 4QY7A 4GKJL 2ZJQA 1MJCA 4MNOA 4YCVA 1M1KC 2JA6G 1OTCA 1XMQQ 3TRZA 1BVSA 1N9WA 4IPCA 2IX0A 2LXJA 3HOVH 4P75A 2PQAB 4JI1L 1UE7A 3CC2A 2YTVA 4L5SA 4B3SL 1Y1VG 3FP9A 1TWFH 3RN5A 5IWAQ 5C44H 4A3IH 1YJNA 2Z6KA 2K5VA 2EIFA 1E1OA 1YVCA 3OYYA 3CCQA 3J81c 5GQOA 1YJWA 4MZ9A 1N34L 1EIYB 3GTMH 4BY7G 3HOYG 4MTNA 4DV3L 3WWVA 3S2DH 3KYHC 4YWKA 1E1TA 5JEAJ 5FJ8G 1VQOA 4A76A 1YI2A 2BA0A 3DM3A 3GD7A 3K81C 4IFDI 3RNUA 3RR5A 1Q86C 1PH7A 3HKSA 3FHWA 5IP7H 1EFWA 4JI4Q 2HT1A 2RCNA 1UWVA 2CKZB 4GNXC 4YY3Q 1YHBA 4GLXA 3K8AA 1TWAH 2K5NA 2K50A 1SLJA 1IL2A 1P16A 4L5QA 3PIOA 1VQPA 4JV5L 4DV2L 1U0LA 4R4OA 2JA7G 1FVIA 1YZ6A 4BA2I 2B3GA 4KI0A 1CUKA 5IYCH 1O7IA 1BBUA 1CKMA 1TXYA 1PV4A 4A3GG 1SE8A 4LFAL 2UXDL 3FKIG 2ID0A 1NMGA 1YEZA 1QZHA 3J7ZC 5FLXc 2K14A 4GOPB 1Q81C 1L1OB 3HOUH 3HOWG 3FKIH 3PUXA 1VQGA 5DLQE 3RLNA 4JV5Q 2VS1A 4DV0L 4A3MH 4QL5A 1PA6A 3I4MG 1VQAA 2JA7H 1N34Q 3CAMA 1A0IA 4O2DA 2VQEL 4GLVB 4AQYL 3U50C 4DUZL 1VS0A 1YIJA 4DV6L 4LF6Q 1PH5A 3RLFA 1IBKL 2OTLA 4IPDA 3S1MH 2R93H 4J15A 4GOPC 2F4VQ 5GAEC 4XTCS 5IT9c 3M85A 3LGJA 4LF5Q 3M4PA 1XMOL 3M4QA 4B3MQ 3KLWA 4YWMA 1I3QH 4B3ML 2VUMG 3KDFA 4X64Q 3K80C 1C7YA 1KXLA 3K7AH 4ME3A 2GN5A 2AKWB 2HHHL 3L2PA 4OX9L 1OXUA 1OXXK 2ZTEA 5GADC 3CMEA 3CPWA 1Y1WG 4GKJQ 1SMXA 4LUVA 5EAYA 1IBML 4JI7L 1YITA 4C3IH 4LF7L 4JI5Q 2K5HA 3NENA 1VQBA 3W5OA 4DAMA 5IE8A 4POGA 1N33L 5FLMH 4BA1I 3JAMc 4IPHA 2BH8A 1KQSA 3E9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZB A;  2N3S A;  4DR7 L;  4BXX G;  3TEH B;  5FLM G;  3J80 c;  3S24 A;  2WAQ E;  3S1N H;  1EQQ A;  4DR3 L;  1Z9F A;  2WP8 J;  3PUY A;  3PSI A;  3E0E A;  2EXD A;  4AQY Q;  1Z47 A;  2ES2 A;  4Y52 H;  5M3M G;  3I4N G;  2ZTD A;  1PH6 A;  2MO1 A;  4DR6 Q;  4JCV E;  4JYA L;  2NVY H;  3ULJ A;  1VQ9 A;  1NTG A;  1HNW L;  3L0O A;  2UXB L;  4X62 L;  4NXN Q;  4PMW A;  1S40 A;  4DV5 L;  3CCL A;  1N36 L;  4C3H H;  4KLK A;  4JBW A;  2BA1 A;  1XNR L;  2OQK A;  3A5Z B;  5HGQ A;  2VQF L;  2E5L Q;  2MNA A;  4A3D H;  2R93 G;  1AH9 A;  1HR0 W;  1Y1V H;  3T1Y L;  1BKB A;  3M3Y H;  1VQK A;  2Q2T A;  2K52 A;  1A63 A;  2JA9 A;  1IXR A;  1K8A C;  4NPS A;  1JE5 A;  5E7N A;  1GO3 E;  3W1B A;  1IBL Q;  4Y7N H;  2JA6 H;  3UDF A;  4YCU A;  3I56 A;  4DV3 Q;  1PH2 A;  4OXP A;  5HY6 A;  3CCV A;  4DPG A;  3HOY H;  2WFW A;  3CC7 A;  4LUZ A;  4JI3 Q;  4JI4 L;  1H95 A;  2LSS A;  3M7N A;  4JI3 L;  2NZH A;  3PV0 A;  3CCE A;  1HR0 Q;  2PNH A;  4GS3 A;  1XPO A;  1IYJ B;  1SRU A;  1WCM G;  1S3O A;  2RHQ B;  5M3F H;  1NJI C;  4B3S Q;  4A93 H;  3BJU A;  1E3P A;  1PYB A;  4RMF A;  3H0G G;  4TVA B;  4GKK L;  4LFC Q;  2DGY A;  1XTD A;  3RN2 A;  4DR4 Q;  1PH4 A;  4OO1 G;  4APV A;  5JEA G;  5IYD G;  1Q8K A;  1MKH A;  4X65 L;  1VQ6 A;  2XGT A;  2JEB I;  2ZM6 Q;  3BZK A;  3OW2 A;  2VQF Q;  2E5L L;  2UXC Q;  4X66 Q;  4JYA Q;  3KF6 B;  3KOJ A;  4HIO A;  2KBN A;  2NZO A;  4JOI A;  3DLL A;  2B63 H;  5BR8 L;  3PCO B;  4DV5 Q;  2E2J H;  4LF9 Q;  2IHE A;  3MEF A;  2C35 B;  4R4Q A;  3CQZ H;  2IY5 B;  2KCM A;  2R6G A;  3H0G H;  4B3R Q;  2R92 G;  2B63 G;  4A3J H;  4DR3 Q;  2AMC B;  4KHZ A;  3AFQ A;  1VQN A;  4JI6 Q;  4UP7 A;  5GRO A;  1HNZ Q;  2ALY B;  3PGZ A;  4UY8 C;  1N33 Q;  2HIX A;  4A3K H;  1HZA A;  1OXT A;  1X3F A;  3HFZ B;  4NB3 A;  3I4M H;  2UUB Q;  2MO0 A;  4FDB A;  3Q8D A;  4A4I A;  4OO1 I;  1YHQ A;  3U58 A;  1NE3 A;  1LTL A;  3S17 H;  1Q46 A;  3STB D;  2A19 A;  4JBM A;  1WJJ A;  2I5L X;  4YHH L;  4A3L G;  1B70 B;  5AJ3 Q;  3PIP A;  2LXK A;  4EX5 A;  2JA8 G;  3UE1 A;  1IBK Q;  3G71 A;  1VQL A;  1YHA A;  1Q7Y C;  4LF8 Q;  4LF6 L;  3S16 H;  1I6H H;  1C0A A;  1W2B A;  1Q82 C;  2OTJ A;  4JI0 Q;  4JI2 Q;  2Z0S A;  2ZTC A;  4DV7 Q;  2AWN A;  5C4X H;  2Z6K C;  2QGQ A;  4IOA A;  2UU9 Q;  3PF4 A;  1GKH A;  3F8T A;  3A5U A;  4AH6 A;  3J81 j;  3AEV A;  3VDY A;  1SRO A;  4X6A H;  3CW2 C;  4KHP L;  1ASY A;  3T1Y Q;  1KHI A;  1Q12 A;  3GTK H;  3OTO Q;  2AHO B;  2ZM6 L;  4LFA Q;  4AYB G;  3CF5 A;  3CCS A;  4DV1 Q;  4R1J A;  1L0W A;  2UUC Q;  1EQR A;  1XNR Q;  2FXQ A;  3PO3 G;  3F2C A;  2NN6 G;  3ER0 A;  5C0X J;  1YJ9 A;  1K73 C;  1VQ5 A;  2PI2 E;  1E22 A;  3RLO A;  2V1C C;  4GOP A;  1D8L A;  1Y1W H;  4A3D G;  1LYL A;  1QUQ B;  4L5R C;  2KEN A;  3GTP H;  3MXN B;  2YU9 H;  3M4O H;  1UE1 A;  1HZC A;  4DK3 C;  4GNX B;  2UU9 L;  3UDI A;  2KHI A;  4R4C A;  4HJ5 A;  2IHF A;  2CCZ A;  4L5T A;  3U4Z A;  1DGS A;  3M9B A;  4UPA A;  3RZO H;  3CP0 A;  4A3E H;  4DR2 L;  1LUZ A;  4A3K G;  3JC6 6;  5M3M H;  3AQQ A;  3CC4 A;  4JG2 A;  1WI5 A;  4BBR H;  1JT8 A;  4TQU S;  2MFI A;  1LM0 A;  2I0Q A;  2PMZ E;  1PH1 A;  4OWX B;  2L15 A;  5LMU Q;  4A3G H;  1JB7 A;  3I55 A;  1M90 C;  2R92 H;  1BBW A;  1PHJ A;  4BXX H;  1CSP A;  1G6P A;  1V43 A;  2EQS A;  2WB1 E;  3STB C;  2CWP A;  2Q2I A;  2R7Z H;  3KDF B;  4IFD G;  2B29 A;  1J5E Q;  4B3T L;  3F2B A;  4HID A;  4QGU A;  2UUA Q;  4A3B G;  1V1Q A;  2PI2 A;  4UP8 A;  5ELN A;  4OWW B;  1SR3 A;  4GLA C;  3CCM A;  1J5E L;  3PO2 G;  4R4T A;  5LMN L;  2F4V L;  1J6Q A;  1JJ2 A;  4P71 A;  5C0X I;  3CXC A;  1X3E A;  2D0P A;  4O0A A;  1K3R A;  4DR1 L;  4DUY Q;  4HIK A;  4POF A;  4DUZ Q;  1QZG A;  1QVG A;  3IRB A;  5GAG C;  2N8N A;  5IP9 G;  4BY1 H;  4A3C H;  1Q1E A;  4KHP Q;  2QEX A;  1B8A A;  1N32 Q;  3J81 i;  1UE6 A;  2K4K A;  4DKA C;  5C44 G;  4A3I G;  5M5W H;  1WCM H;  1SFO H;  5ELO A;  2CWA A;  4LFB L;  3HOX H;  5IY0 A;  2MQH A;  1N8R C;  4JI5 L;  4HJ9 A;  1C9O A;  2VL6 A;  1IBM Q;  1VQH A;  4DR5 Q;  4ALP A;  3I2Z A;  1NMF A;  2K75 A;  2YV5 A;  3PO3 H;  5BR8 Q;  1V9P A;  5FJ8 H;  3A0J A;  3KF6 A;  4DV4 Q;  2NN6 I;  2ATW A;  5K36 G;  3KJO A;  3HOZ H;  4BY7 H;  1NBW A;  1QUQ A;  2GVB A;  1R9T H;  3H3V I;  3D31 A;  4LF4 Q;  1MJE A;  1T9H A;  2F52 A;  2NVT H;  4GNX A;  3CMA A;  4JI7 Q;  3ZJY C;  4A93 G;  3HOZ G;  5C3E G;  4QJF A;  4A3C G;  2OQ0 A;  2Q2U A;  4DR4 L;  2D0O A;  1JMC A;  2HHH Q;  1HNX Q;  2UUC L;  2NVQ H;  3D0F A;  2AWO A;  3KF8 B;  4LUO A;  2D62 A;  3W1G A;  3CCR A;  1XPR A;  1AE2 A;  2HIV A;  1AE3 A;  4UP9 A;  3RZD H;  1PH8 A;  4A3L H;  3BZC A;  3HOX G;  4RG1 A;  4B3T Q;  1HZ9 A;  1XPU A;  1MIU A;  1IZ6 A;  2JK8 A;  2RHS B;  3JAM i;  1X6O A;  5C3E H;  3CD6 A;  4GKK Q;  3GO5 A;  4A3B H;  3K7U C;  4IPG A;  2R7D A;  3PF5 A;  1CKO A;  4JBJ A;  3T1H L;  1GVP A;  1HNZ L;  2DUD A;  3PUZ A;  3TRE A;  5IP7 G;  5JJK A;  3EBE A;  1P8L A;  1EWI A;  5AJ3 L;  2A1A A;  1YNX A;  1ASZ A;  1IBL L;  1PYS B;  4A75 A;  1PH3 A;  3HKZ G;  1GD7 A;  2VW9 A;  1U5K A;  1B7Y B;  3J80 i;  4DAY B;  2ZJR A;  1PVO A;  1RL2 A;  1HH2 P;  4JI8 Q;  5IYB H;  3S1Q H;  2VNU D;  4GN3 B;  4C2M H;  4OWT B;  4HJA A;  2UUB L;  2VZA A;  3HOV G;  2HQL A;  4AIM A;  1OXS C;  2JA5 H;  4IJL A;  2N49 A;  1TWC H;  4BBR G;  1N36 Q;  2IT1 A;  1UE5 A;  4PZ7 A;  4A3F H;  4DV2 Q;  4JOI C;  1WYD A;  2CQO A;  5C0X G;  3PUV A;  4IFD J;  3OTO L;  4DR7 Q;  1EOV A;  4P74 A;  3U4V A;  4WJ4 A;  5M5X H;  1FGU A;  2JEA I;  2E2I H;  1WOC A;  4AYB E;  2JA5 G;  4JI2 L;  1VQM A;  3GTJ H;  3T1H Q;  1CKN A;  1PFS A;  1VQJ A;  2N78 A;  3EIV A;  4LF9 L;  1E7Z A;  3ICE A;  4LWC A;  2H5X A;  4OX9 Q;  3G4S A;  1N32 L;  1L1O C;  1K9M C;  1I50 H;  1TWG H;  4A3M G;  3L7Z C;  4X64 L;  4JI0 L;  4DUY L;  1I94 L;  2JE6 I;  1EIF A;  1G51 A;  2Y0S G;  1XNQ Q;  4BBS G;  2UUA L;  4X65 Q;  2NVX H;  1YBY A;  4YHH Q;  3TQY A;  3SGI A;  3HOW H;  3HOU G;  1JJG A;  2I5H A;  2YTY A;  1I94 Q;  4LF5 L;  1XNQ L;  2WB1 G;  1RIP A;  1UEB A;  1A8V A;  4PZ6 A;  1X3G A;  2I5M X;  5LMN Q;  3F2D A;  4IJH A;  1VQI A;  2E2H H;  5IYC G;  5LMU L;  2JA8 H;  1X65 A;  3H3V H;  3H15 A;  2BH2 A;  1A62 A;  4YCW A;  1HR0 L;  5IYB G;  2VQE Q;  2VY3 A;  3UE0 A;  4DR6 L;  1CSQ A;  1L2F A;  4DR2 Q;  1X9N A;  2JQO A;  1X54 A;  5GAH C;  1XJV A;  3NEM A;  3NEL A;  4QQB X;  1KD1 C;  4PZ8 A;  3TS0 A;  4GN5 A;  4JI6 L;  1I5F A;  1KRS A;  1K0R A;  1SN8 A;  3I4N H;  4WJ3 M;  1VQD A;  3I7F A;  1KAW A;  1VQE A;  2OWO A;  1VQ7 A;  4X66 L;  1KIX A;  4LW1 A;  4DV0 Q;  1D7Q A;  5JJI A;  2XTI A;  2YYZ A;  5C4J H;  4DR1 Q;  4A3J G;  5C4X G;  4JC0 A;  4QIW E;  1KRT A;  4K0K L;  3G48 A;  3BU2 A;  4JI8 L;  2A8V A;  1VQF A;  2YTX A;  2KCT A;  3S14 H;  3GTO H;  1WFQ A;  1S72 A;  4LFC L;  2UXC L;  2UXD Q;  2UXB Q;  4HJ8 A;  1PH9 A;  3A74 A;  4YY3 L;  2ZJP A;  1K8G A;  3NBH B;  3CCJ A;  1QVF A;  4H02 A;  1VQ8 A;  1XMO Q;  3B6Y A;  2Q2H A;  1CKN B;  4P73 A;  3CCU A;  1VQC A;  1FJG Q;  3HKZ E;  2VUM H;  1W3S A;  4PG3 A;  2PQA A;  3ERS X;  4A3F G;  3S2H H;  1VCI A;  1FL0 A;  1TWH H;  2F3I A;  3GTQ H;  4DK6 C;  5IWA L;  3ULL A;  4EQ5 A;  2IX1 A;  2E8G A;  1HJP A;  1Q1B A;  2KHJ A;  4IOC A;  4LF8 L;  3CPF A;  5J3B A;  4HJ7 A;  1E24 A;  3K0X A;  4LF7 Q;  4JI1 Q;  4DV7 L;  4OON A;  1FJG L;  4BBS H;  4R4I A;  1X56 A;  4GN4 B;  1G29 1;  3GDE A;  3ULP A;  4BY1 G;  5IP9 H;  1XMQ L;  3UDG A;  2Y0S E;  1KC8 C;  2R7F A;  4C3J H;  4IO9 A;  3I4O A;  1HNX L;  4LF4 L;  3TS2 A;  1EUJ A;  1NY4 A;  2OCE A;  1KL9 A;  2CFM A;  3UDX A;  3PUW A;  3KJP A;  5M3F G;  1OXV A;  4P72 A;  2QA4 A;  2RF4 A;  5LMN W;  1EYG A;  3GTL H;  2WAQ G;  3PO2 H;  4X62 Q;  4K0K Q;  1JJC B;  4LNQ A;  4DV6 Q;  4DV1 L;  1HNW Q;  4DNI A;  5M5Y H;  4DV4 L;  4NXN L;  5IYD H;  4JBK A;  1X55 A;  3AFP A;  2JJQ A;  2R7Z G;  4DR5 L;  1QVC A;  1K83 H;  4NXM L;  5H1S E;  4YWL A;  3KFU A;  3S15 H;  4XIG S;  2GVA A;  1L1O A;  4NXM Q;  4LFB Q;  5JJL A;  4B3R L;  3S1R H;  3EN2 A;  3AYH B;  3E9I A;  4HIM A;  3G6E A;  2ASB A;  4A3E G;  3GTG H;  3F1Z A;  3J7A 5;  1Y14 B;  1GM5 A;  1VQ4 A;  4QY7 A;  4GKJ L;  2ZJQ A;  1MJC A;  4MNO A;  4YCV A;  1M1K C;  2JA6 G;  1OTC A;  1XMQ Q;  3TRZ A;  1BVS A;  1N9W A;  4IPC A;  2IX0 A;  2LXJ A;  3HOV H;  4P75 A;  2PQA B;  4JI1 L;  1UE7 A;  3CC2 A;  2YTV A;  4L5S A;  4B3S L;  1Y1V G;  3FP9 A;  1TWF H;  3RN5 A;  5IWA Q;  5C44 H;  4A3I H;  1YJN A;  2Z6K A;  2K5V A;  2EIF A;  1E1O A;  1YVC A;  3OYY A;  3CCQ A;  3J81 c;  5GQO A;  1YJW A;  4MZ9 A;  1N34 L;  1EIY B;  3GTM H;  4BY7 G;  3HOY G;  4MTN A;  4DV3 L;  3WWV A;  3S2D H;  3KYH C;  4YWK A;  1E1T A;  5JEA J;  5FJ8 G;  1VQO A;  4A76 A;  1YI2 A;  2BA0 A;  3DM3 A;  3GD7 A;  3K81 C;  4IFD I;  3RNU A;  3RR5 A;  1Q86 C;  1PH7 A;  3HKS A;  3FHW A;  5IP7 H;  1EFW A;  4JI4 Q;  2HT1 A;  2RCN A;  1UWV A;  2CKZ B;  4GNX C;  4YY3 Q;  1YHB A;  4GLX A;  3K8A A;  1TWA H;  2K5N A;  2K50 A;  1SLJ A;  1IL2 A;  1P16 A;  4L5Q A;  3PIO A;  1VQP A;  4JV5 L;  4DV2 L;  1U0L A;  4R4O A;  2JA7 G;  1FVI A;  1YZ6 A;  4BA2 I;  2B3G A;  4KI0 A;  1CUK A;  5IYC H;  1O7I A;  1BBU A;  1CKM A;  1TXY A;  1PV4 A;  4A3G G;  1SE8 A;  4LFA L;  2UXD L;  3FKI G;  2ID0 A;  1NMG A;  1YEZ A;  1QZH A;  3J7Z C;  5FLX c;  2K14 A;  4GOP B;  1Q81 C;  1L1O B;  3HOU H;  3HOW G;  3FKI H;  3PUX A;  1VQG A;  5DLQ E;  3RLN A;  4JV5 Q;  2VS1 A;  4DV0 L;  4A3M H;  4QL5 A;  1PA6 A;  3I4M G;  1VQA A;  2JA7 H;  1N34 Q;  3CAM A;  1A0I A;  4O2D A;  2VQE L;  4GLV B;  4AQY L;  3U50 C;  4DUZ L;  1VS0 A;  1YIJ A;  4DV6 L;  4LF6 Q;  1PH5 A;  3RLF A;  1IBK L;  2OTL A;  4IPD A;  3S1M H;  2R93 H;  4J15 A;  4GOP C;  2F4V Q;  5GAE C;  4XTC S;  5IT9 c;  3M85 A;  3LGJ A;  4LF5 Q;  3M4P A;  1XMO L;  3M4Q A;  4B3M Q;  3KLW A;  4YWM A;  1I3Q H;  4B3M L;  2VUM G;  3KDF A;  4X64 Q;  3K80 C;  1C7Y A;  1KXL A;  3K7A H;  4ME3 A;  2GN5 A;  2AKW B;  2HHH L;  3L2P A;  4OX9 L;  1OXU A;  1OXX K;  2ZTE A;  5GAD C;  3CME A;  3CPW A;  1Y1W G;  4GKJ Q;  1SMX A;  4LUV A;  5EAY A;  1IBM L;  4JI7 L;  1YIT A;  4C3I H;  4LF7 L;  4JI5 Q;  2K5H A;  3NEN A;  1VQB A;  3W5O A;  4DAM A;  5IE8 A;  4POG A;  1N33 L;  5FLM H;  4BA1 I;  3JAM c;  4IPH A;  2BH8 A;  1KQS A;  3E9H A; 
#chains in the Genus database with same CATH topology
 4DR7 L;  1RHP A;  2IL8 A;  1ENA A;  1PTO D;  3H6M A;  1SEB D;  1Z9F A;  2WP8 J;  4AQY Q;  2A6E D;  2FHT A;  3I4N G;  1EZ8 A;  4DR6 Q;  1PH6 A;  4JCV E;  4JYA L;  3ULJ A;  1VQ9 A;  1NTG A;  2EYF A;  1HNW L;  1V8Q A;  1ZXT A;  3SK5 A;  4C3H H;  4K5W A;  2BA1 A;  2WB1 B;  3D8G A;  1EEF D;  2MNA A;  1WTX A;  1HR0 W;  5D3D A;  4JPB W;  1VQK A;  2Q2T A;  1A63 A;  1EIH A;  2A6E C;  4Y7N H;  3HG9 A;  3UDF A;  4DV3 Q;  2BE5 D;  4FVM A;  3CCV A;  2Z8L A;  2WFW A;  4HTH A;  4JI3 Q;  3C3L A;  4JI3 L;  2NZH A;  2PNH A;  4GS3 A;  4A93 H;  2LKV A;  2RHQ B;  3IFT A;  1GUN A;  1NJI C;  4B3S Q;  1PYB A;  4C2M B;  4RMF A;  1D5M C;  4LFC Q;  1JB3 A;  1XTD A;  4RCN A;  5JEA G;  3CHB D;  1MKH A;  1VQ6 A;  4C3I G;  4MHE A;  1I4G A;  2L0C A;  2E5L L;  4E6I A;  3KF6 B;  3KOJ A;  5DEH A;  2NZO A;  3R2I A;  4HIO A;  1KDC A;  3N6R A;  2E2J H;  2Z1C A;  3VYR A;  2AUK A;  2KVM A;  3J81 E;  1LTB D;  5J22 A;  3MEF A;  3QO2 A;  5AFW A;  3H0G H;  1VQN A;  4H0L C;  2SEB D;  2ALY B;  3PGZ A;  1N33 Q;  5M5Y B;  2HQE A;  2F0M A;  2JXM B;  3HOW B;  1FNU A;  5LL6 S;  4A3K H;  1JE4 A;  1STA A;  1HZA A;  1OXT A;  1QJO A;  1X3F A;  3HFZ B;  1A3T A;  1ESF A;  2B8G A;  2E2H B;  1O80 A;  1PLF A;  3IAY A;  3Q23 A;  2A19 A;  1DJR D;  4RGN A;  1CA5 A;  1I6H H;  1YHA A;  1U4R A;  3BYT B;  4LF6 L;  2F0H A;  4JI0 Q;  4N8X 1;  4JI2 Q;  3IFD A;  2Z0S A;  2ZTC A;  2K03 A;  3H94 A;  1ROD A;  5C4X H;  4V0B A;  1SE4 A;  2KEE A;  3A5U A;  4AH6 A;  3WOF A;  1CQV A;  3VDY A;  1LAC A;  4CDF C;  1SAP A;  1ZYR C;  5JVH 3;  3GTK H;  3A8K E;  3CF5 A;  4LFA Q;  1I4Q A;  2PW5 A;  5C0X J;  1YJ9 A;  3R2T A;  1TWA B;  3PMF A;  2V1C C;  1Y1W H;  2VUM B;  1SXT A;  3O13 A;  4L5R C;  3MXN B;  2YU9 H;  5JVG 3;  2KHI A;  4HJ5 A;  2IHF A;  2CCZ A;  1VF5 C;  5NUC A;  3KLR A;  3RZO H;  4OL7 A;  3CP0 A;  4C1N I;  4A3E H;  1O7Y A;  2Q8I B;  4EQO A;  3JC6 6;  2CW0 D;  3CC4 A;  4CJ0 B;  1EY8 A;  2I0Q A;  2PMZ E;  2L15 A;  2M00 A;  3A7L A;  2WAQ B;  2NB0 A;  4H13 C;  2QEJ C;  1KLG D;  5CV7 A;  1PHJ A;  2MGS A;  2X6L A;  3BVG A;  4I7Z C;  2UUA Q;  4OWW B;  4GLA C;  4R4T A;  1J6Q A;  4XT3 B;  2EDG A;  5EKL A;  1CA6 A;  1J9O A;  5M9O A;  4POF A;  1ONL A;  1Q1E A;  5E4W C;  3A7A B;  5C4Z A;  2MQH A;  2EE1 A;  3MVV A;  4JI5 L;  1G8Z D;  2FFK B;  1PTO B;  1IBM Q;  2TMP A;  3HOY B;  3I2Z A;  1NMF A;  4RH6 A;  2ATW A;  2NN6 I;  1X3Q A;  5CR3 A;  1HHV A;  1PRT C;  1QUQ A;  2GVB A;  2MUY A;  3D31 A;  3K58 A;  4S3S A;  1X32 A;  1EYC A;  3NSW A;  2OQ0 A;  5EPJ A;  4A3C G;  1JMC A;  2HHH Q;  3D0F A;  2D62 A;  3ERQ A;  3CCR A;  4C56 C;  2HIV A;  1PH8 A;  1SBB B;  1B3A A;  3HOX G;  4RG1 A;  1HZ9 A;  2JK8 A;  2RHS B;  3JAM i;  5C3E H;  3GO5 A;  4CHT B;  5C3W A;  3K7U C;  5KYI A;  5KNB A;  4IPG A;  3VR3 A;  2F0L A;  2DUD A;  5JJK A;  3EBE A;  3BYY B;  3NTK A;  2SNM A;  1EWI A;  4MN3 A;  3SK8 A;  1IBL L;  1NR4 A;  1PYS B;  1PH3 A;  1QE6 A;  2VW9 A;  3TBI B;  1B7Y B;  3J80 i;  4A93 B;  1PVO A;  1RL2 A;  1HH2 P;  3Q0A A;  5M3F B;  4G7Z C;  4HMI A;  5C5M A;  2UUB L;  1I4P A;  3HOV G;  2BE5 C;  2XRQ D;  1EWC A;  1N36 Q;  4ZAI A;  2FJ2 A;  4RKL A;  4DV2 Q;  4JOI C;  3PUV A;  4KY5 A;  4P74 A;  3U4V A;  4ID6 A;  2I07 B;  2JEA I;  2PO4 A;  1WOC A;  2JA5 G;  1QCB D;  3GTJ H;  5T1G A;  1AP0 A;  2J7Z A;  2SDF A;  3MWY W;  3EIV A;  2N78 A;  2A74 C;  2H5X A;  4OX9 Q;  2DJF C;  1L1O C;  4A3M G;  4OEM B;  1G51 A;  1LTI D;  2AUJ D;  1YBY A;  4C3I B;  2NVX H;  1NCV A;  1HQM C;  4LF5 L;  2WB1 G;  1IKM A;  2I5M X;  1AZP A;  1BXT A;  1X65 A;  5FK9 C;  4K2K A;  3Q22 A;  1HR0 L;  3A55 A;  3ERO A;  3UE0 A;  3DWA A;  1RD9 D;  2JYO A;  4DR2 Q;  2PMZ B;  3DM1 A;  2EJM A;  2HCC A;  2F0J A;  4V19 0;  1KRS A;  3K5N A;  4WJ3 M;  4X66 L;  3LWU A;  5KIX A;  4A3D B;  1D7Q A;  3C2P A;  3N52 A;  3AU7 A;  1B53 A;  2A8V A;  1VQF A;  1HUM A;  4DXG A;  2UXD Q;  4G57 A;  3A74 A;  4YY3 L;  3CCJ A;  5HGT A;  1QVF A;  1R4P B;  2PQE A;  3B6Y A;  2CH4 W;  2K33 A;  4PG3 A;  1QNU A;  2PQA A;  2CH4 A;  3URY A;  2HDL A;  4DK6 C;  4U67 3;  3R8B A;  4LF8 L;  3V96 A;  4CJ2 C;  3K0X A;  4MTK A;  2EJG C;  5C5L A;  2RVL A;  4BBS H;  1X56 A;  5L37 A;  2BOS A;  2NN6 H;  5T1I A;  3ULP A;  3MHB A;  4C3J H;  2WAC A;  1EUJ A;  1KL9 A;  2LFN A;  4G7O C;  4PMC A;  1OXV A;  1PTO F;  5FO9 B;  3GTL H;  1EYG A;  4A3J B;  2CW0 C;  1B3Q A;  1JJC B;  2J4X A;  4LNQ A;  4DV1 L;  1HNW Q;  4NXN L;  2VB3 X;  5IYD H;  4A3K B;  2JJQ A;  4NW2 A;  1K83 H;  5EKK A;  5H1S E;  2AQ1 B;  1O7L A;  4XIG S;  3S15 H;  2GVA A;  1STY A;  4LFB Q;  1E2V A;  1ML0 D;  4B3R L;  1KTK A;  1K0S A;  3HS0 C;  4DA2 A;  2X69 A;  2EY2 A;  1GM5 A;  4GKJ L;  2ZJQ A;  2O2L D;  1MJC A;  3BDC A;  1M1K C;  3J7A V;  1CM9 A;  1XMQ Q;  1JWU D;  1BUV T;  3NK9 A;  2LXJ A;  3JAM L;  3HOV H;  3HOZ B;  2HCI A;  2YTV A;  4B3S L;  5FOB B;  2HUG A;  1YJN A;  5BN5 A;  4BY7 G;  2G9D A;  1E1T A;  3DM3 A;  1S5B D;  1WTW A;  5LHY 1;  3RNU A;  4KK7 A;  4GNX C;  1TS5 A;  4YY3 Q;  1YHB A;  4GLX A;  3EJI A;  2B2Y A;  2K50 A;  1K28 A;  1P16 A;  4L5Q A;  1VQP A;  4JV5 L;  3HRZ C;  1U0L A;  5CBE E;  1JQY D;  3FMC A;  4KV6 A;  2JA7 G;  2K1B A;  2YU9 B;  1GJX A;  4IN3 A;  2OF1 A;  1UNS A;  1BBU A;  4ZLT F;  3TSS A;  4A3G G;  1O7Z A;  4LFA L;  3AMU A;  5COR A;  2ID0 A;  1YEZ A;  4RHS A;  5M3M B;  3HOU H;  3RLN A;  4JV5 Q;  1SNC A;  1SYE A;  2KQ3 A;  4CDC C;  1T5E A;  3NTI A;  4O2D A;  1Y8O B;  2R7Z B;  4A3F B;  1CQF A;  4DU9 A;  5IIF A;  2EY1 A;  4DV6 L;  1H9M A;  1MBY A;  3SEB A;  4DAP A;  5GAE C;  4GOP C;  4LF5 Q;  3M4Q A;  2L12 A;  2OEO A;  5CGK A;  5KND A;  1HXY D;  5CV5 A;  3KDF A;  1AFP A;  2DJG C;  4BY1 B;  3L2P A;  3TP7 A;  1OXX K;  5GAD C;  4JI7 L;  4X3U A;  5ELF A;  1YIT A;  2K5H A;  3NEN A;  5C6A A;  1PV4 A;  1KQS A;  1HZB A;  1HPC A;  3J80 c;  3V05 A;  4QUC A;  2WAQ E;  4NKL A;  5IOC A;  4BY7 B;  2EOT A;  3S1N H;  4DR3 L;  2NUC A;  2NVT B;  1TU2 B;  2EXD A;  2ES2 A;  2RQX A;  5M3M G;  2F0K A;  1BF4 A;  2NVY H;  2OT2 A;  4RGO S;  3QOL A;  1BCP D;  5EJW A;  4X62 L;  4NXN Q;  4PMW A;  4ODG A;  3RZD B;  3E6Z X;  4KLK A;  1V1O A;  1XNR L;  1KDB A;  5HGQ A;  3A5Z B;  2VQF L;  2R93 G;  4BWG B;  5G3L F;  1Y1V H;  1RF2 D;  5J39 A;  2IX3 A;  4A3B B;  3T1Y L;  1Q3L A;  4KHV A;  5ELE A;  2E74 C;  1K8A C;  1JE5 A;  1IW7 D;  3SK6 A;  1IBL Q;  3UI2 A;  1STH A;  4YCU A;  1PH2 A;  3NXW A;  2B2U A;  4OXP A;  5HY6 A;  1J8I A;  3EA6 A;  4JI4 L;  3DWQ A;  1VMC A;  2MP1 A;  4F87 A;  2RSN A;  1HR0 Q;  4J6H A;  1XPO A;  1WCM G;  1S3O A;  3HGB A;  5D14 A;  4UAI A;  2X6G A;  3BJU A;  5IOD A;  4TVA B;  1TWH B;  2DGY A;  1ET9 A;  4FF4 A;  2N55 A;  1E2W A;  4XQJ A;  4OO1 G;  4X65 L;  3CKI B;  1PZK D;  4FYD A;  1BR9 A;  2B2T A;  4BBS B;  4X66 Q;  1STB A;  4JYA Q;  3HKZ B;  4JOI A;  5BR8 L;  3GP7 A;  2XWJ B;  1WD0 A;  3IKJ A;  3GTL B;  2A6H D;  2KCM A;  3SK4 A;  3GQB A;  2R92 G;  2B63 G;  4A3J H;  3T51 B;  4DR3 Q;  1QB5 D;  4UY8 C;  3BVZ A;  3VR4 A;  2PZW A;  2NVX B;  4FF2 A;  3EVQ A;  3EQL C;  4KN7 C;  2WII B;  3I4M H;  4C3H G;  2MO0 A;  4EQN A;  2PNR C;  4A4I A;  2JA8 B;  4UDU C;  1LTL A;  1ILQ A;  1B2T A;  1Q46 A;  4JBM A;  1TVX A;  1WJJ A;  4A3L G;  1IBK Q;  1C0A A;  1Q7Y C;  1HFN A;  4F88 A;  1Q82 C;  2OTJ A;  2K05 A;  1A2U A;  1FR3 A;  1TWF B;  4RAU C;  5C44 B;  4A3I B;  2UU9 Q;  3PF4 A;  1STN A;  4LAA A;  1SRO A;  1EWH A;  4KHP L;  3S14 B;  2O5J C;  2MJ8 A;  3T1Y Q;  1KHI A;  4KMU C;  3S2D B;  3OTO Q;  2ZM6 L;  4AYB G;  4JVZ A;  1XNR Q;  3PO3 G;  3F2C A;  2NN6 G;  2EXZ A;  3ER0 A;  1K73 C;  3C46 A;  1UEA B;  1STE A;  1F2Z A;  4GOP A;  1D8L A;  3TDQ A;  2WIN B;  1D6E C;  4A3D G;  5ELD A;  3FPP A;  3VA5 A;  3S2H B;  3DXJ C;  5JJZ A;  3GTP H;  1GHJ A;  2KHS A;  2TSS A;  4GNX B;  3TP5 A;  4R4C A;  3VR5 A;  4L5T A;  2WKC A;  3U4Z A;  3M9B A;  3KLS A;  2PPB C;  3MXG A;  1LUZ A;  2FMM A;  3AQQ A;  4KJO A;  2F0G A;  1WTP A;  4FXG C;  1IW7 C;  5LMU Q;  1BQQ T;  1M90 C;  2R92 H;  1CSP A;  4CKB A;  1U4P A;  2EQS A;  2WB1 E;  1TR5 A;  1HFG A;  2R7Z H;  3P1H A;  4B3T L;  3PO2 B;  1HRJ A;  4DK0 A;  3CCM A;  3M4Y A;  5IGF A;  5LMN L;  3I3C A;  3W2D A;  1QIL A;  1JJ2 A;  1SYD A;  4OIK A;  1PRT F;  2L1B A;  3GV6 A;  1SYF A;  2B2V A;  2N8N A;  5IP9 G;  2QEX A;  3S1R B;  3J80 L;  5M5W H;  3NBH A;  2VL6 A;  4LK1 C;  5BR8 Q;  1V9P A;  5FJ8 H;  3HOV B;  5K36 G;  3HOZ H;  3S1N B;  1NBW A;  5EPK A;  1T9H A;  2NVT H;  2A68 C;  1DZ1 A;  4JI7 Q;  2F0P A;  4A93 G;  3HOZ G;  5C3E G;  2OXP A;  1WTV A;  2NVQ H;  3W1G A;  3RZD H;  2ZXP A;  1KDA A;  1X6O A;  1QG7 A;  2HD3 A;  3T1H L;  4XQQ A;  1EIG A;  5ELB A;  4WRD A;  5I9P A;  2E2D C;  2A1A A;  2NYZ D;  3OW7 A;  5TSS A;  4WFN 3;  4DAY B;  4JI8 Q;  5IYB H;  3FKI B;  1ZYR D;  3VYU A;  4HJA A;  3Q6S A;  2A69 D;  3P20 A;  1I4H A;  4AIM A;  2EYO A;  3A8J E;  1D5X C;  2JA5 H;  4IJL A;  2EY5 A;  4B08 A;  2F0W A;  1WYD A;  2MPM A;  2F0I A;  4HCS A;  2CHB D;  1FGU A;  2A5H A;  4O42 A;  1H9S A;  2E2I H;  5BN3 A;  1SNO A;  4AYB E;  4JI2 L;  1RCV D;  5EBD A;  2LY7 A;  1VQJ A;  3DWP A;  4LF9 L;  1E7Z A;  3R93 A;  5FO8 B;  3G4S A;  4FO2 A;  1N32 L;  3F2U A;  4X64 L;  4JI0 L;  5COY A;  2JE6 I;  1I94 L;  1XNQ Q;  2Y0S G;  4ULL A;  1GUO A;  3HOW H;  1NR2 A;  3TQY A;  3SGI A;  4F7X A;  1JJG A;  3FDT A;  4RFB A;  2I5H A;  1RIP A;  4IJH A;  2E2H H;  5LMU L;  3FPU B;  3MFG A;  4DAV A;  3JAM E;  2BH2 A;  4DR6 L;  4IZ8 A;  1I6H B;  5K36 H;  1XJV A;  4QQB X;  3NEL A;  1A6X A;  1M8A A;  1PXU A;  4JI6 L;  1I5F A;  3U9O A;  1K0R A;  3RMH A;  1KAW A;  2PZU A;  1KIX A;  4DV0 Q;  3SXH A;  4OIJ A;  3R3O A;  1Y1V B;  4XT1 B;  4DR1 Q;  4K0K L;  4JI8 L;  1LO5 D;  3S14 H;  4WOR A;  3GTO H;  1K8M A;  2UXC L;  1JOQ A;  2F0S A;  3G7L A;  3J81 L;  1PFB A;  1XMO Q;  2XVS A;  2DNE A;  4P73 A;  1VQC A;  5FKA C;  3K59 A;  1EOT A;  3ERS X;  1VCI A;  1FL0 A;  4IUQ A;  1GUS A;  2F3I A;  1PMR A;  5A2Q E;  1HJP A;  4LF7 Q;  2Z4H A;  4R4I A;  1F2L A;  3UDG A;  1BNZ A;  3T16 A;  1KC8 C;  2R7F A;  1RDP D;  1HNX L;  3W3A A;  1ICW A;  1NY4 A;  2F3V A;  4M1U B;  3OOC A;  3NHH A;  5M3F G;  5LMN W;  1JWS D;  1F77 A;  1LLR D;  5JPM C;  5IGB A;  4JBK A;  3AFP A;  4FF1 A;  1L1O A;  4J1M A;  5JJL A;  1BBX C;  4K5X A;  1IL8 A;  3G6E A;  3VYS A;  3OIQ A;  4A3E G;  2ASB A;  3HOX B;  4HSV A;  4RGM A;  3GTG H;  1W6J A;  1YNJ D;  1DOK A;  3J80 E;  1FGB D;  4LFB L;  4MNO A;  3S16 B;  3PO3 B;  3DMU A;  1BVS A;  3U9S A;  4IPC A;  1EYA A;  2PQA B;  4PNY A;  1UE7 A;  4P75 A;  3CC2 A;  1Y1V G;  4G7H C;  3RN5 A;  5EKI A;  5IWA Q;  1I6V C;  1EIY B;  3GTM H;  1N34 L;  3HOY G;  4CKE A;  5FJ8 G;  5JEA J;  2KCC A;  3A54 A;  1YI2 A;  4HSP A;  3D4W A;  2F03 A;  3GD7 A;  4QIW B;  1PH7 A;  1EFW A;  3FHW A;  2RCN A;  3D6W A;  4KD4 A;  4HED A;  1Y8N B;  4GZY C;  1IL2 A;  1SLJ A;  2K5D A;  1Y1W B;  4DV2 L;  3A8I E;  1FVI A;  1YZ6 A;  2L11 A;  1CUK A;  3M4O B;  5IYC H;  3QR8 A;  1CKM A;  3FKI G;  1A3U A;  1U4M A;  2Y0S B;  3RZO B;  1QZH A;  2LMC B;  2NBF A;  1Q81 C;  3S1Q B;  3FKI H;  5DLQ E;  1S5E D;  3MTS A;  4A3M H;  1PA6 A;  3I4M G;  2R92 B;  1NSN S;  5DAU A;  4IUV A;  1H9J A;  1HQR D;  1S5D D;  4I65 A;  3PIP 3;  1VS0 A;  1X3P A;  1XX8 A;  2KOL A;  3RLF A;  5K5P A;  1ZEQ X;  1IBK L;  2EZV A;  3ND8 A;  1PFN A;  3M85 A;  1LT5 D;  3GTJ B;  4C1N K;  4XYO A;  1JCK B;  1LV9 A;  4YWM A;  1UUP A;  2VUM G;  3K80 C;  3T56 B;  1C7Y A;  1KXL A;  3H91 A;  4B9X A;  1H9K A;  2G9H D;  3OHX C;  3CME A;  4GKJ Q;  3QWN A;  5EAY A;  4M8A A;  4LF7 L;  1WCM B;  4C3I H;  3HP3 A;  4JI5 Q;  1VQB A;  3NE5 B;  4DAM A;  3NWT A;  3PIO 3;  5FLM H;  1LTS D;  4KKT A;  1MSG A;  3H3V I;  2BH8 A;  3E9H A;  4DK1 A;  4BXX G;  1XWE A;  5FLM G;  4BS9 A;  3PUY A;  5C4H A;  3E0E A;  4DF7 A;  1Z47 A;  4Y52 H;  1HTP A;  1I4R A;  2ZTD A;  4IUR A;  3EFX D;  2UXB L;  2RDH A;  1AZQ A;  4DV5 L;  3NQT A;  4TRD A;  1FYC A;  3TN2 A;  3OSO A;  2E5L Q;  1SE2 A;  5C3E B;  1AH9 A;  4R8N A;  2AQ3 B;  3M7G A;  1YNN C;  1BKB A;  3NQI A;  5LL6 X;  4L8J A;  2EPB A;  1LT4 D;  3KF8 A;  4OEL B;  3GTO B;  1IXR A;  4NPS A;  1GUG A;  5J1Z A;  3BG3 A;  1S5C D;  4DPG A;  4ZUJ A;  1H95 A;  1FD7 D;  2LSS A;  1LTA D;  1SJE D;  1TQO A;  3I90 A;  3M7N A;  4JW0 A;  3PV0 A;  3CCE A;  1IYJ B;  5IGE A;  1E3P A;  2M2L A;  3H0G G;  4GKK L;  3GTQ B;  2L4N A;  5IYD G;  1A2T A;  3BS1 A;  1S5F D;  2XGT A;  1CZW A;  3BZK A;  3OW2 A;  1B9M A;  3D6C A;  1F9R A;  2UXC Q;  1DM0 B;  2B63 H;  2E2I B;  3PCO B;  4DV5 Q;  4LF9 Q;  2IHE A;  1E2Z A;  3PQI A;  4JK1 C;  3NWS A;  3K5M A;  1LT3 D;  3CQZ H;  1II3 A;  4EVO A;  2IY5 B;  2QDL A;  2F0D A;  2K04 A;  1CZG A;  3E5S A;  4B3R Q;  3QG1 A;  1TWG B;  2AMC B;  1G6Z A;  4JI6 Q;  4UP7 A;  5GRO A;  5EQ0 A;  3OWE B;  2K5Q A;  1K83 B;  1L0Y B;  4NB3 A;  1AW7 A;  3S15 B;  4FDB A;  1C48 A;  1I4X A;  4OO1 I;  1YHQ A;  2EYL A;  3S17 H;  3STB D;  1EU3 A;  5I6Y A;  3SE0 A;  2I5L X;  4YHH L;  5AJ3 Q;  1ET6 A;  1EU4 A;  5I6W A;  3PIP A;  2JA8 G;  3UE1 A;  1KLU D;  3G71 A;  4LF8 Q;  3S16 H;  5KYL A;  1F9P A;  1W2B A;  1RTN A;  3VR2 A;  4LMQ D;  2F0U A;  4PQX A;  3HZX A;  3I4N B;  2AWN A;  4TSS A;  1IHZ A;  5KGU A;  1MGS A;  2RDF A;  2BDO A;  1WTQ A;  1KAA A;  2O4X A;  1GKH A;  5E3F A;  1CFM A;  1BDO A;  1LTT D;  1ENF A;  1ASY A;  2CVR A;  2A69 C;  2AHO B;  2UUC Q;  1B4O A;  3CCS A;  4R1J A;  4DV1 Q;  1QWY A;  3P7J A;  1RTO A;  2PI2 E;  3RLO A;  3J7A F;  3KBX A;  1LYL A;  1TY0 A;  2IWH A;  1LTG D;  4MIU A;  1UE1 A;  4DK3 C;  4CKC A;  2UU9 L;  3UDI A;  3BZD B;  1FNW A;  3NUC A;  3MXU A;  3SDZ A;  4DR2 L;  4A3K G;  2EVB A;  4ZYS A;  4JG2 A;  4BBR H;  5HUR A;  4TQU S;  2MFI A;  1LM0 A;  1PH1 A;  1MD2 D;  3LWE A;  4K14 A;  1TS4 A;  1JB7 A;  3MFY A;  1BBW A;  1G6P A;  1V43 A;  3STB C;  2CWP A;  2Q2I A;  3KDF B;  2B29 A;  1J5E Q;  3F2B A;  2XWB B;  4HID A;  4QGU A;  4A3B G;  1V1Q A;  2NTT A;  2PI2 A;  4UP8 A;  4X3S A;  5ELN A;  1SR3 A;  2R93 B;  1SSO A;  3DHQ A;  2F4V L;  1F2Y A;  1SE3 A;  4CDD C;  3QOJ A;  1JOR A;  1X3E A;  4ILW A;  4DUY Q;  4HIK A;  4A3C H;  5GAG C;  4BY1 H;  3MAQ A;  4KHP Q;  1B8A A;  3J81 i;  4IQZ A;  2K4K A;  4DKA C;  2CWA A;  3HOX H;  1DD2 A;  1VQH A;  2F0V A;  4CBV A;  4DR5 Q;  2K75 A;  1HCZ A;  5JEA H;  2WKD A;  4IUN A;  3A0J A;  3KF6 A;  4X3K A;  1CTM A;  4DV4 Q;  4IUU A;  4BY7 H;  5F2D A;  1MJE A;  2F52 A;  4GNX A;  3ZJY C;  2F0E A;  2RDG A;  4QJF A;  3GTM B;  1HNX Q;  5KNC A;  2AWO A;  1PRT B;  1AEX A;  2LS0 1;  3CRK C;  3QB3 A;  4LUO A;  1XPR A;  1NNX A;  4UP9 A;  1HA6 A;  5DM6 3;  3MA2 B;  3J7Y W;  4B3T Q;  1PTO C;  1XPU A;  1MIU A;  3NTH A;  3CD6 A;  1WVL A;  2F0F A;  4XXE A;  3M3Y B;  3FEW X;  2R7D A;  1HNZ L;  1LT6 D;  2K6A A;  5E4X A;  2K28 A;  1ILP A;  2QIL A;  5IP7 G;  1C4Q A;  1P8L A;  3SVM A;  5A2Q L;  1IKL A;  3S9W A;  4OGQ C;  1CI3 M;  1PDQ A;  1GD7 A;  4K5V A;  1U5K A;  5D65 A;  2VNU D;  3S1Q H;  1DOL A;  4OWT B;  4A3M B;  2Z4I A;  4XQN A;  2HQL A;  1OXS C;  2ZT9 C;  2JA7 B;  5FLX L;  4BBR G;  3QJY A;  1UE5 A;  2CQO A;  1G2S A;  5C0X G;  4ABN A;  3OTO L;  3WOE A;  1TY2 A;  3QIA A;  5M5X H;  5I9O A;  2E2J B;  4HCE A;  1EL0 A;  4YIJ A;  2Q8R E;  3K5O A;  3I4L A;  1CKN A;  1PFS A;  1EY5 A;  3I72 A;  4LWC A;  4XDX A;  1K9M C;  1I50 H;  4IAL A;  4OHJ A;  3L7Z C;  4DUY L;  3MXN A;  1EIF A;  2UUA L;  1M4V A;  4X65 Q;  4YHH Q;  1TII D;  1O78 A;  2Z6B A;  1IYU A;  2YTY A;  1PZJ D;  1RJT A;  4PZ6 A;  1UEB A;  1A8V A;  1X3G A;  1H9R A;  3F2D A;  1VQI A;  2B2V C;  4C3J G;  3H15 A;  2D9U A;  2QKI C;  4H7B A;  3S17 B;  2RSO A;  1E0B A;  2XIW A;  1CSQ A;  1L2F A;  1X9N A;  2JQO A;  1X54 A;  5GAH C;  3BVM A;  1KD1 C;  4PZ8 A;  3TS0 A;  1S4Z A;  4GN5 A;  2EYH A;  1SN8 A;  4IUT A;  3I4N H;  3FVQ A;  4EQP A;  1VQE A;  4DFA A;  1VQ7 A;  2OWO A;  4LW1 A;  3NBI A;  2XTI A;  5C4J H;  4A3J G;  3LX0 A;  1KRT A;  3G48 A;  3BU2 A;  1EFI D;  2KCT A;  2Q8T A;  4Y7N B;  4DGZ A;  1YNJ C;  1PZI D;  3MZ5 A;  1EZ6 A;  2ZJP A;  1NAP A;  2ZXO A;  2A68 D;  2KCN A;  4H02 A;  4ME5 A;  3KUP A;  2NZ1 D;  1EYD A;  3CCU A;  1DXM A;  1QOH A;  2ENB A;  3HKZ E;  3CRL C;  2ZXR A;  1Y69 U;  3S2H H;  2DY7 A;  4NDX A;  2XNA C;  1B1Z A;  4CGY B;  5ISR A;  3GTQ H;  3ULL A;  4EQ5 A;  2IX1 A;  4IOC A;  3CPF A;  2WV6 D;  3VR6 A;  4OON A;  1FJG L;  1Z6H A;  4GN4 B;  2PCF B;  5IP9 H;  2F3W A;  2SNS A;  3I4O A;  3TS2 A;  1CHQ D;  2CFM A;  4HMJ A;  4HN7 A;  3UDX A;  3KJP A;  4QCL A;  3CQZ B;  2XN9 C;  3RUZ A;  1WD1 A;  1LAB A;  2WAQ G;  2D2C C;  4B9W A;  3PO2 H;  4K0K Q;  4ZKB B;  3BDL A;  3K6O A;  4DV6 Q;  4DNI A;  2K01 A;  2EYP A;  1JR0 D;  1JOO A;  1X55 A;  1QVC A;  3C1F A;  4FP5 D;  5CYU A;  4NMZ A;  4RWS C;  3I4M B;  4FXD A;  5CV4 A;  4Z9C B;  1V1P B;  3S1R H;  3EN2 A;  3AYH B;  3E9I A;  5I4D A;  1OO9 B;  2B2W A;  2B39 A;  1YNN D;  3F1Z A;  1Y14 B;  1PTO H;  3TZU A;  4DXF A;  4P2C B;  1GHK A;  1CT1 D;  4Q0F A;  1OTC A;  2V4D A;  4QB4 A;  1N9W A;  1VMP A;  4Q5V A;  4DN4 M;  4L5S A;  3FP9 A;  1TWF H;  2EYM A;  2E76 C;  2K5V A;  2EIF A;  3OYY A;  3CCQ A;  3J81 c;  5GQO A;  3KK7 A;  4MZ9 A;  2F0O A;  2PW7 A;  4MTN A;  4DV3 L;  5I2Y A;  3KYH C;  4PMB A;  1SNP A;  1W6K A;  3HKS A;  1SNM A;  2EJF C;  2CKZ B;  3BDO A;  3K8A A;  2G5D A;  4DAY A;  2XSC A;  3PIO A;  3KLS X;  5CC4 A;  4KD3 A;  3SR1 A;  3P75 A;  4R4O A;  3I8Z A;  1ZKO A;  1JWM D;  1STG A;  1TXY A;  5IGD A;  2UXD L;  3OPO A;  4X3T A;  1QNK A;  4L6T B;  4A3E B;  5FLX c;  2K14 A;  2KA7 A;  1L1O B;  3HOW G;  2VS1 A;  1VQA A;  4FNF A;  2JA5 B;  1A0I A;  2CQA A;  1TWC B;  2AQ2 B;  4GLV B;  4AQY L;  4DUZ L;  1YIJ A;  4LF6 Q;  1VF7 A;  4KY6 A;  2OTL A;  4IPD A;  3S1M H;  2R93 H;  4XTC S;  3LGJ A;  3M4P A;  4LJZ C;  3OWF A;  3KLW A;  1SMY D;  4B3M L;  1WTH A;  4RA8 A;  4ME3 A;  4RKB A;  2GN5 A;  2AKW B;  4OX9 L;  2ZTE A;  3CPW A;  2A73 B;  4LUV A;  1SFO B;  5IE8 A;  3W5O A;  1WTR A;  1N33 L;  1MSH A;  2K5W A;  4UHV A;  4BA1 I;  4IPH A;  4LUZ A;  3HOY H;  4KKU A;  2N3S A;  4N8F A;  1PYW D;  5CV6 A;  4QF4 A;  3TEH B;  1EY0 A;  3S24 A;  4CJ1 B;  1V1P A;  1EQQ A;  5FO7 B;  2JN4 A;  3PSI A;  4KJN A;  3TP6 A;  1UAP A;  2MO1 A;  2RA4 A;  1B50 A;  3L0O A;  2NVQ B;  1Z7T A;  2F4I A;  1S40 A;  5IT9 E;  1N36 L;  5JAV A;  3CCL A;  2L55 A;  2P5Z X;  4JBW A;  2O5I C;  2B2Y C;  2L9H A;  2OQK A;  3MC0 B;  4A3D H;  2VB2 X;  4XYQ A;  1SYG A;  3M3Y H;  4K6L A;  3D3R A;  2K52 A;  2JA9 A;  5E7N A;  3W1B A;  1GO3 E;  5KEE A;  2JA6 H;  3I56 A;  2MHV A;  5D3I B;  1SYC A;  2B2W C;  3CC7 A;  1BCP C;  1EEI D;  1SND A;  4RGT A;  2DY8 A;  1SRU A;  5M3F H;  2K32 A;  2A6H C;  2H1E A;  4RHR A;  3T4A C;  3RN2 A;  4DR4 Q;  1PH4 A;  4APV A;  1Q8K A;  2JEB I;  4R8I A;  2ZM6 Q;  2R61 A;  2VQF Q;  5E1F A;  2KBN A;  5CV8 A;  5M5X B;  3DLL A;  3X3N A;  2B8F A;  2K7V A;  1D5Z C;  1F2M A;  2C35 B;  4R4Q A;  3NP8 A;  2R6G A;  1I50 B;  4KHZ A;  3AFQ A;  1Y8P B;  1HNZ Q;  1Q8I A;  2HIX A;  3FRP B;  1CK1 A;  3MXP A;  3TME A;  3H09 A;  2UUB Q;  3Q8D A;  3SHL A;  3V2T A;  2JP1 A;  3Q24 A;  3U58 A;  1NE3 A;  1EY9 A;  2KEC A;  1ESR A;  3GTG B;  4ZRZ A;  2L5T A;  1B70 B;  1KNA A;  2LXK A;  3D4R A;  4I7A A;  4EX5 A;  1VQL A;  2RCF A;  1LTR D;  4DV7 Q;  2Z6K C;  2QGQ A;  4IOA A;  2IPK D;  1Q90 A;  5C4J B;  3F8T A;  2SOB A;  3J81 j;  2B2U C;  4PV1 C;  4X6A H;  2IJ0 A;  3CW2 C;  1Q12 A;  1L0W A;  1EQR A;  1H9S B;  1EQT A;  2FXQ A;  2VXW A;  4ZCK A;  1F9Q A;  1KAB A;  1VQ5 A;  1JIC A;  1E22 A;  2XRS D;  1QUQ B;  4FF3 A;  4KN4 C;  2KEN A;  3M4O H;  1HZC A;  1GXD C;  1DGS A;  4UPA A;  5EBC A;  2I46 A;  5M3M H;  1WI5 A;  1JT8 A;  4OWX B;  1MHW C;  4A3G H;  5IGG A;  3I55 A;  4C3J B;  4BXX H;  4G4K A;  2D5D A;  4IFD G;  3ND9 A;  3VA7 A;  2R3Z A;  3I91 A;  3S1M B;  1J5E L;  3PO2 G;  1ENC A;  2QF7 A;  1SJH D;  3NPP A;  4KY7 A;  4P71 A;  4AYB B;  5C0X I;  3CXC A;  1I3Q B;  2D0P A;  4O0A A;  1K3R A;  4DR1 L;  3K7A B;  1QZG A;  4DUZ Q;  1QVG A;  1VDZ A;  3IRB A;  1N32 Q;  4N9P A;  1UE6 A;  2F0Q A;  5C44 G;  2E75 C;  4A3I G;  1WCM H;  1T5X D;  5ELO A;  2J0T D;  1SFO H;  1SDF A;  5IY0 A;  1N8R C;  4HJ9 A;  1C9O A;  4ALP A;  2YV5 A;  3PO3 H;  1HTL D;  1TKW B;  3L9A X;  3KJO A;  1R9T H;  5DM7 3;  4LF4 Q;  3TZD A;  1JOK A;  3CMA A;  1K3B C;  5JOB A;  2NVY B;  2Q2U A;  4DR4 L;  2D0O A;  2UUC L;  3KF8 B;  3K57 A;  4C3H B;  1AE2 A;  4R9W A;  1AE3 A;  4A3L H;  3BZC A;  3K0Y A;  1CHP D;  2H4O A;  5EPL A;  1IZ6 A;  1XTC D;  2FMC A;  4GKK Q;  1SNQ A;  2F0N A;  1KNE A;  4A3B H;  3OIP A;  5G3L D;  2RBM A;  1CKO A;  4JBJ A;  3PF5 A;  1GVP A;  1PRT D;  4WJW A;  2Z9H A;  3PUZ A;  3TRE A;  2QDB A;  3VYT A;  1DON A;  1DYQ A;  4RCO A;  5AJ3 L;  5DNF A;  1YNX A;  4K8I A;  4HAE A;  1ASZ A;  3MEH A;  4A75 A;  3HKZ G;  3ITP A;  1B9N A;  2HDM A;  2EY6 A;  2ZJR A;  2BCO A;  3HOU B;  4GN3 B;  3IL8 A;  4K8J A;  4C2M H;  2FIN B;  2VZA A;  5CBA E;  1BCP B;  3C1E A;  1DOM A;  2N49 A;  1TWC H;  2IT1 A;  4A3F H;  4PZ7 A;  2KUM A;  4IFD J;  1IYV A;  3H3V C;  2NTS A;  4DR7 Q;  1EOV A;  4WJ4 A;  2B63 B;  4OO1 H;  4FXK C;  1GOZ A;  1VQM A;  2QW7 A;  3T1H Q;  1D1K A;  3ICE A;  4DNR B;  3GV3 A;  3E0J A;  1TWG H;  3K5L A;  2B2T C;  4BBS G;  3RD4 A;  3HOU G;  1BO0 A;  1I94 Q;  2ICE C;  4N9T A;  1XNQ L;  2C9O A;  3TP8 A;  3ZYY X;  5LMN Q;  2F1M A;  5EGT A;  5ELC A;  5IYC G;  2JA8 H;  3H3V H;  1A62 A;  4YCW A;  5A35 A;  5IYB G;  2VQE Q;  2VY3 A;  4U68 A;  5I2X A;  2M9V A;  5IGC A;  1NUC A;  3LNN A;  3NEM A;  1F9S A;  1XYI A;  5C3X A;  2KED A;  1BCP F;  4O1N A;  1VQD A;  3I7F A;  2DNC A;  4IUP A;  5JJI A;  2YYZ A;  1G91 A;  5C4X G;  4JC0 A;  4QIW E;  2YTX A;  4J8Q A;  1R4Q B;  1WFQ A;  1G2T A;  1S72 A;  3GTK B;  4LFC L;  1C8C A;  2JA6 B;  2UXB Q;  4HJ8 A;  1PH9 A;  1A3V A;  1K8G A;  3NBH B;  1VQ8 A;  2Q2H A;  1CKN B;  4F8M A;  4DNT B;  3OMC A;  1FJG Q;  2RKS A;  2VUM H;  1W3S A;  2KJX A;  1SYB A;  4A3F G;  4ZUI A;  3GTP B;  1TWH H;  3L3O C;  5IWA L;  2E8G A;  1Q1B A;  2KHJ A;  3DEO A;  5J3B A;  4HJ7 A;  1E24 A;  4JI1 Q;  4DV7 L;  5KRU A;  4BBR B;  1G29 1;  3GDE A;  4CDE C;  4BY1 G;  1XMQ L;  2Y0S E;  3KBG A;  4A3G B;  2JSO A;  1AN8 A;  4ZQ3 A;  4IO9 A;  4LF4 L;  2BDN A;  2OCE A;  1GUT A;  3PUW A;  3X3M A;  4P72 A;  4KTA A;  2RF4 A;  2QA4 A;  1MI2 A;  3H0G B;  4X62 Q;  3G6J B;  5M5Y H;  4DV4 L;  5JPN C;  2QCP X;  4ZK9 B;  1GUW A;  3DUZ A;  4QMG A;  2R7Z G;  3D4D A;  4DR5 L;  3AB9 A;  4NXM L;  3OMG A;  4YWL A;  3KFU A;  4NXM Q;  3HEJ A;  4KKS A;  2N88 A;  4K2L A;  2C5C A;  4HIM A;  3J7A 5;  1HA5 A;  1VQ4 A;  4QY7 A;  2JA6 G;  4YCV A;  1L0X B;  3TRZ A;  1EY7 A;  2IX0 A;  4JI1 L;  3CU7 A;  1R9T B;  5C4X B;  5C44 H;  4A3I H;  2Z6K A;  1U4L A;  3WDN A;  1E1O A;  1YVC A;  1YJW A;  4EGV A;  2PYK A;  3WWV A;  2IW3 A;  3S2D H;  4YWK A;  2F0T A;  1VQO A;  5CV9 A;  4A76 A;  2BA0 A;  4K6D A;  3K81 C;  5CMD A;  4IFD I;  3RR5 A;  1Q86 C;  5IP7 H;  4JI4 Q;  2HT1 A;  2ICI A;  1UWV A;  1TWA H;  2K5N A;  5IT9 L;  4NP5 A;  1U9R A;  4IFD H;  4BA2 I;  2B3G A;  4KI0 A;  4TKO B;  1BOS A;  1O7I A;  2DN8 A;  2GA4 B;  1PFM A;  1SE8 A;  1XXG A;  4HR7 B;  1NMG A;  2NWG A;  4L63 B;  1ICF B;  3J7Z C;  4GOP B;  1HUN A;  3T53 B;  1SMY C;  1JC7 A;  1K8O A;  1FNV A;  3PUX A;  1EY4 A;  1VQG A;  3E3X A;  3DEP A;  5C0X H;  4DV0 L;  4QL5 A;  2JA7 H;  1N34 Q;  3CAM A;  2VQE L;  4H44 C;  1WTO A;  3U50 C;  1TS3 A;  1PH5 A;  3I70 A;  1TT2 A;  4J15 A;  2F4V Q;  5IT9 c;  1A15 A;  1EQV A;  1XMO L;  4QUF A;  1D2B A;  1B44 D;  1RKN A;  3I73 A;  5BN4 A;  4B3M Q;  1I3Q H;  2PZT A;  4X64 Q;  3K7A H;  3T13 A;  1DCZ A;  2HHH L;  1TS2 A;  1OXU A;  3ONA B;  2EYJ A;  1Y1W G;  3A56 A;  1SMX A;  1EY6 A;  1IBM L;  5M5W B;  4POG A;  5FLX E;  4ZKC B;  1D1I A;  3JAM c;  3AEV A; 
#chains in the Genus database with same CATH homology
 1HZB A;  2N3S A;  4DR7 L;  4BXX G;  3TEH B;  5FLM G;  3J80 c;  3S24 A;  2WAQ E;  3S1N H;  1EQQ A;  4DR3 L;  1Z9F A;  2WP8 J;  3PUY A;  3PSI A;  3E0E A;  2EXD A;  4AQY Q;  1Z47 A;  2ES2 A;  4Y52 H;  5M3M G;  3I4N G;  2ZTD A;  1PH6 A;  2MO1 A;  4DR6 Q;  4JCV E;  4JYA L;  2NVY H;  3ULJ A;  1VQ9 A;  1NTG A;  1HNW L;  3L0O A;  2UXB L;  4X62 L;  4NXN Q;  4PMW A;  1S40 A;  4DV5 L;  3CCL A;  1N36 L;  4C3H H;  4KLK A;  4JBW A;  2BA1 A;  1XNR L;  2OQK A;  3A5Z B;  5HGQ A;  2VQF L;  2E5L Q;  2MNA A;  4A3D H;  2R93 G;  1AH9 A;  1HR0 W;  1Y1V H;  3T1Y L;  1BKB A;  3M3Y H;  1VQK A;  2Q2T A;  2K52 A;  1A63 A;  2JA9 A;  1IXR A;  1K8A C;  4NPS A;  1JE5 A;  5E7N A;  1GO3 E;  3W1B A;  1IBL Q;  4Y7N H;  2JA6 H;  3UDF A;  4YCU A;  3I56 A;  4DV3 Q;  1PH2 A;  4OXP A;  5HY6 A;  3CCV A;  4DPG A;  3HOY H;  2WFW A;  3CC7 A;  4LUZ A;  4JI3 Q;  4JI4 L;  1H95 A;  2LSS A;  3M7N A;  4JI3 L;  2NZH A;  3PV0 A;  3CCE A;  1HR0 Q;  2PNH A;  4GS3 A;  1XPO A;  1IYJ B;  1SRU A;  1WCM G;  1S3O A;  2RHQ B;  5M3F H;  1NJI C;  4B3S Q;  4A93 H;  3BJU A;  1E3P A;  1PYB A;  4RMF A;  3H0G G;  4TVA B;  4GKK L;  4LFC Q;  2DGY A;  1XTD A;  3RN2 A;  4DR4 Q;  1PH4 A;  4OO1 G;  4APV A;  5JEA G;  5IYD G;  1Q8K A;  1MKH A;  4X65 L;  1VQ6 A;  2XGT A;  2JEB I;  2ZM6 Q;  3BZK A;  3OW2 A;  2VQF Q;  2E5L L;  2UXC Q;  4X66 Q;  4JYA Q;  3KF6 B;  3KOJ A;  4HIO A;  2KBN A;  2NZO A;  4JOI A;  3DLL A;  2B63 H;  5BR8 L;  3PCO B;  4DV5 Q;  2E2J H;  4LF9 Q;  2IHE A;  3MEF A;  2C35 B;  4R4Q A;  3CQZ H;  2IY5 B;  2KCM A;  2R6G A;  3H0G H;  4B3R Q;  2R92 G;  2B63 G;  4A3J H;  4DR3 Q;  2AMC B;  4KHZ A;  3AFQ A;  1VQN A;  4JI6 Q;  4UP7 A;  5GRO A;  1HNZ Q;  2ALY B;  3PGZ A;  4UY8 C;  1N33 Q;  2HIX A;  4A3K H;  1HZA A;  1OXT A;  1X3F A;  3HFZ B;  4NB3 A;  3I4M H;  2UUB Q;  2MO0 A;  4FDB A;  3Q8D A;  4A4I A;  4OO1 I;  1YHQ A;  3U58 A;  1NE3 A;  1LTL A;  3S17 H;  1Q46 A;  3STB D;  2A19 A;  4JBM A;  1WJJ A;  2I5L X;  4YHH L;  4A3L G;  1B70 B;  5AJ3 Q;  3PIP A;  2LXK A;  4EX5 A;  2JA8 G;  3UE1 A;  1IBK Q;  3G71 A;  1VQL A;  1YHA A;  1Q7Y C;  4LF8 Q;  4LF6 L;  3S16 H;  1I6H H;  1C0A A;  1W2B A;  1Q82 C;  2OTJ A;  4JI0 Q;  4JI2 Q;  2Z0S A;  2ZTC A;  4DV7 Q;  2AWN A;  5C4X H;  2Z6K C;  2QGQ A;  4IOA A;  2UU9 Q;  3PF4 A;  1GKH A;  3F8T A;  3A5U A;  4AH6 A;  3J81 j;  3AEV A;  3VDY A;  1SRO A;  4X6A H;  3CW2 C;  4KHP L;  1ASY A;  3T1Y Q;  1KHI A;  1Q12 A;  3GTK H;  3OTO Q;  2AHO B;  2ZM6 L;  4LFA Q;  4AYB G;  3CF5 A;  3CCS A;  4DV1 Q;  4R1J A;  1L0W A;  2UUC Q;  1EQR A;  1XNR Q;  2FXQ A;  3PO3 G;  3F2C A;  2NN6 G;  3ER0 A;  5C0X J;  1YJ9 A;  1K73 C;  1VQ5 A;  2PI2 E;  1E22 A;  3RLO A;  2V1C C;  4GOP A;  1D8L A;  1Y1W H;  4A3D G;  1LYL A;  1QUQ B;  4L5R C;  2KEN A;  3GTP H;  3MXN B;  2YU9 H;  3M4O H;  1UE1 A;  1HZC A;  4DK3 C;  4GNX B;  2UU9 L;  3UDI A;  2KHI A;  4R4C A;  4HJ5 A;  2IHF A;  2CCZ A;  4L5T A;  3U4Z A;  1DGS A;  3M9B A;  4UPA A;  3RZO H;  3CP0 A;  4A3E H;  4DR2 L;  1LUZ A;  4A3K G;  3JC6 6;  5M3M H;  3AQQ A;  3CC4 A;  4JG2 A;  1WI5 A;  4BBR H;  1JT8 A;  4TQU S;  2MFI A;  1LM0 A;  2I0Q A;  2PMZ E;  1PH1 A;  4OWX B;  2L15 A;  5LMU Q;  4A3G H;  1JB7 A;  3I55 A;  1M90 C;  2R92 H;  1BBW A;  1PHJ A;  4BXX H;  1CSP A;  1G6P A;  1V43 A;  2EQS A;  2WB1 E;  3STB C;  2CWP A;  2Q2I A;  2R7Z H;  3KDF B;  4IFD G;  2B29 A;  1J5E Q;  4B3T L;  3F2B A;  4HID A;  4QGU A;  2UUA Q;  4A3B G;  1V1Q A;  2PI2 A;  4UP8 A;  5ELN A;  4OWW B;  1SR3 A;  4GLA C;  3CCM A;  1J5E L;  3PO2 G;  4R4T A;  5LMN L;  2F4V L;  1J6Q A;  1JJ2 A;  4P71 A;  5C0X I;  3CXC A;  1X3E A;  2D0P A;  4O0A A;  1K3R A;  4DR1 L;  4DUY Q;  4HIK A;  4POF A;  4DUZ Q;  1QZG A;  1QVG A;  3IRB A;  5GAG C;  2N8N A;  5IP9 G;  4BY1 H;  4A3C H;  1Q1E A;  4KHP Q;  2QEX A;  1B8A A;  1N32 Q;  3J81 i;  1UE6 A;  2K4K A;  4DKA C;  5C44 G;  4A3I G;  5M5W H;  1WCM H;  1SFO H;  5ELO A;  2CWA A;  4LFB L;  3HOX H;  5IY0 A;  2MQH A;  1N8R C;  4JI5 L;  4HJ9 A;  1C9O A;  2VL6 A;  1IBM Q;  1VQH A;  4DR5 Q;  4ALP A;  3I2Z A;  1NMF A;  2K75 A;  2YV5 A;  3PO3 H;  5BR8 Q;  1V9P A;  5FJ8 H;  3A0J A;  3KF6 A;  4DV4 Q;  2NN6 I;  2ATW A;  5K36 G;  3KJO A;  3HOZ H;  4BY7 H;  1NBW A;  1QUQ A;  2GVB A;  1R9T H;  3H3V I;  3D31 A;  4LF4 Q;  1MJE A;  1T9H A;  2F52 A;  2NVT H;  4GNX A;  3CMA A;  4JI7 Q;  3ZJY C;  4A93 G;  3HOZ G;  5C3E G;  4QJF A;  4A3C G;  2OQ0 A;  2Q2U A;  4DR4 L;  2D0O A;  1JMC A;  2HHH Q;  1HNX Q;  2UUC L;  2NVQ H;  3D0F A;  2AWO A;  3KF8 B;  4LUO A;  2D62 A;  3W1G A;  3CCR A;  1XPR A;  1AE2 A;  2HIV A;  1AE3 A;  4UP9 A;  3RZD H;  1PH8 A;  4A3L H;  3BZC A;  3HOX G;  4RG1 A;  4B3T Q;  1HZ9 A;  1XPU A;  1MIU A;  1IZ6 A;  2JK8 A;  2RHS B;  3JAM i;  1X6O A;  5C3E H;  3CD6 A;  4GKK Q;  3GO5 A;  4A3B H;  3K7U C;  4IPG A;  2R7D A;  3PF5 A;  1CKO A;  4JBJ A;  3T1H L;  1GVP A;  1HNZ L;  2DUD A;  3PUZ A;  3TRE A;  5IP7 G;  5JJK A;  3EBE A;  1P8L A;  1EWI A;  5AJ3 L;  2A1A A;  1YNX A;  1ASZ A;  1IBL L;  1PYS B;  4A75 A;  1PH3 A;  3HKZ G;  1GD7 A;  2VW9 A;  1U5K A;  1B7Y B;  3J80 i;  4DAY B;  2ZJR A;  1PVO A;  1RL2 A;  1HH2 P;  4JI8 Q;  5IYB H;  3S1Q H;  2VNU D;  4GN3 B;  4C2M H;  4OWT B;  4HJA A;  2UUB L;  2VZA A;  3HOV G;  2HQL A;  4AIM A;  1OXS C;  2JA5 H;  4IJL A;  2N49 A;  1TWC H;  4BBR G;  1N36 Q;  2IT1 A;  1UE5 A;  4PZ7 A;  4A3F H;  4DV2 Q;  4JOI C;  1WYD A;  2CQO A;  5C0X G;  3PUV A;  4IFD J;  3OTO L;  4DR7 Q;  1EOV A;  4P74 A;  3U4V A;  4WJ4 A;  5M5X H;  1FGU A;  2JEA I;  2E2I H;  1WOC A;  4AYB E;  2JA5 G;  4JI2 L;  1VQM A;  3GTJ H;  3T1H Q;  1CKN A;  1PFS A;  1VQJ A;  2N78 A;  3EIV A;  4LF9 L;  1E7Z A;  3ICE A;  4LWC A;  2H5X A;  4OX9 Q;  3G4S A;  1N32 L;  1L1O C;  1K9M C;  1I50 H;  1TWG H;  4A3M G;  3L7Z C;  4X64 L;  4JI0 L;  4DUY L;  1I94 L;  2JE6 I;  1EIF A;  1G51 A;  2Y0S G;  1XNQ Q;  4BBS G;  2UUA L;  4X65 Q;  2NVX H;  1YBY A;  4YHH Q;  3TQY A;  3SGI A;  3HOW H;  3HOU G;  1JJG A;  2I5H A;  2YTY A;  1I94 Q;  4LF5 L;  1XNQ L;  2WB1 G;  1RIP A;  1UEB A;  1A8V A;  4PZ6 A;  1X3G A;  2I5M X;  5LMN Q;  3F2D A;  4IJH A;  1VQI A;  2E2H H;  5IYC G;  5LMU L;  2JA8 H;  1X65 A;  3H3V H;  3H15 A;  2BH2 A;  1A62 A;  4YCW A;  1HR0 L;  5IYB G;  2VQE Q;  2VY3 A;  3UE0 A;  4DR6 L;  1CSQ A;  1L2F A;  4DR2 Q;  1X9N A;  2JQO A;  1X54 A;  5GAH C;  1XJV A;  3NEM A;  3NEL A;  4QQB X;  1KD1 C;  4PZ8 A;  3TS0 A;  4GN5 A;  4JI6 L;  1I5F A;  1KRS A;  1K0R A;  1SN8 A;  3I4N H;  4WJ3 M;  1VQD A;  3I7F A;  1KAW A;  1VQE A;  2OWO A;  1VQ7 A;  4X66 L;  1KIX A;  4LW1 A;  4DV0 Q;  1D7Q A;  5JJI A;  2XTI A;  2YYZ A;  5C4J H;  4DR1 Q;  4A3J G;  5C4X G;  4JC0 A;  4QIW E;  1KRT A;  4K0K L;  3G48 A;  3BU2 A;  4JI8 L;  2A8V A;  1VQF A;  2YTX A;  2KCT A;  3S14 H;  3GTO H;  1WFQ A;  1S72 A;  4LFC L;  2UXC L;  2UXD Q;  2UXB Q;  4HJ8 A;  1PH9 A;  3A74 A;  4YY3 L;  2ZJP A;  1K8G A;  3NBH B;  3CCJ A;  1QVF A;  4H02 A;  1VQ8 A;  1XMO Q;  3B6Y A;  2Q2H A;  1CKN B;  4P73 A;  3CCU A;  1VQC A;  1FJG Q;  3HKZ E;  2VUM H;  1W3S A;  4PG3 A;  2PQA A;  3ERS X;  4A3F G;  3S2H H;  1VCI A;  1FL0 A;  1TWH H;  2F3I A;  3GTQ H;  4DK6 C;  5IWA L;  3ULL A;  4EQ5 A;  2IX1 A;  2E8G A;  1HJP A;  1Q1B A;  2KHJ A;  4IOC A;  4LF8 L;  3CPF A;  5J3B A;  4HJ7 A;  1E24 A;  3K0X A;  4LF7 Q;  4JI1 Q;  4DV7 L;  4OON A;  1FJG L;  4BBS H;  4R4I A;  1X56 A;  4GN4 B;  1G29 1;  3GDE A;  3ULP A;  4BY1 G;  5IP9 H;  1XMQ L;  3UDG A;  2Y0S E;  1KC8 C;  2R7F A;  4C3J H;  4IO9 A;  3I4O A;  1HNX L;  4LF4 L;  3TS2 A;  1EUJ A;  1NY4 A;  2OCE A;  1KL9 A;  2CFM A;  3UDX A;  3PUW A;  3KJP A;  5M3F G;  1OXV A;  4P72 A;  2QA4 A;  2RF4 A;  5LMN W;  1EYG A;  3GTL H;  2WAQ G;  3PO2 H;  4X62 Q;  4K0K Q;  1JJC B;  4LNQ A;  4DV6 Q;  4DV1 L;  1HNW Q;  4DNI A;  5M5Y H;  4DV4 L;  4NXN L;  5IYD H;  4JBK A;  1X55 A;  3AFP A;  2JJQ A;  2R7Z G;  4DR5 L;  1QVC A;  1K83 H;  4NXM L;  5H1S E;  4YWL A;  3KFU A;  3S15 H;  4XIG S;  2GVA A;  1L1O A;  4NXM Q;  4LFB Q;  5JJL A;  4B3R L;  3S1R H;  3EN2 A;  3AYH B;  3E9I A;  4HIM A;  3G6E A;  2ASB A;  4A3E G;  3GTG H;  3F1Z A;  3J7A 5;  1Y14 B;  1GM5 A;  1VQ4 A;  4QY7 A;  4GKJ L;  2ZJQ A;  1MJC A;  4MNO A;  4YCV A;  1M1K C;  2JA6 G;  1OTC A;  1XMQ Q;  3TRZ A;  1BVS A;  1N9W A;  4IPC A;  2IX0 A;  2LXJ A;  3HOV H;  4P75 A;  2PQA B;  4JI1 L;  1UE7 A;  3CC2 A;  2YTV A;  4L5S A;  4B3S L;  1Y1V G;  3FP9 A;  1TWF H;  3RN5 A;  5IWA Q;  5C44 H;  4A3I H;  1YJN A;  2Z6K A;  2K5V A;  2EIF A;  1E1O A;  1YVC A;  3OYY A;  3CCQ A;  3J81 c;  5GQO A;  1YJW A;  4MZ9 A;  1N34 L;  1EIY B;  3GTM H;  4BY7 G;  3HOY G;  4MTN A;  4DV3 L;  3WWV A;  3S2D H;  3KYH C;  4YWK A;  1E1T A;  5JEA J;  5FJ8 G;  1VQO A;  4A76 A;  1YI2 A;  2BA0 A;  3DM3 A;  3GD7 A;  3K81 C;  4IFD I;  3RNU A;  3RR5 A;  1Q86 C;  1PH7 A;  3HKS A;  3FHW A;  5IP7 H;  1EFW A;  4JI4 Q;  2HT1 A;  2RCN A;  1UWV A;  2CKZ B;  4GNX C;  4YY3 Q;  1YHB A;  4GLX A;  3K8A A;  1TWA H;  2K5N A;  2K50 A;  1SLJ A;  1IL2 A;  1P16 A;  4L5Q A;  3PIO A;  1VQP A;  4JV5 L;  4DV2 L;  1U0L A;  4R4O A;  2JA7 G;  1FVI A;  1YZ6 A;  4BA2 I;  2B3G A;  4KI0 A;  1CUK A;  5IYC H;  1O7I A;  1BBU A;  1CKM A;  1TXY A;  1PV4 A;  4A3G G;  1SE8 A;  4LFA L;  2UXD L;  3FKI G;  2ID0 A;  1NMG A;  1YEZ A;  1QZH A;  3J7Z C;  5FLX c;  2K14 A;  4GOP B;  1Q81 C;  1L1O B;  3HOU H;  3HOW G;  3FKI H;  3PUX A;  1VQG A;  5DLQ E;  3RLN A;  4JV5 Q;  2VS1 A;  4DV0 L;  4A3M H;  4QL5 A;  1PA6 A;  3I4M G;  1VQA A;  2JA7 H;  1N34 Q;  3CAM A;  1A0I A;  4O2D A;  2VQE L;  4GLV B;  4AQY L;  3U50 C;  4DUZ L;  1VS0 A;  1YIJ A;  4DV6 L;  4LF6 Q;  1PH5 A;  3RLF A;  1IBK L;  2OTL A;  4IPD A;  3S1M H;  2R93 H;  4J15 A;  4GOP C;  2F4V Q;  5GAE C;  4XTC S;  5IT9 c;  3M85 A;  3LGJ A;  4LF5 Q;  3M4P A;  1XMO L;  3M4Q A;  4B3M Q;  3KLW A;  4YWM A;  1I3Q H;  4B3M L;  2VUM G;  3KDF A;  4X64 Q;  3K80 C;  1C7Y A;  1KXL A;  3K7A H;  4ME3 A;  2GN5 A;  2AKW B;  2HHH L;  3L2P A;  4OX9 L;  1OXU A;  1OXX K;  2ZTE A;  5GAD C;  3CME A;  3CPW A;  1Y1W G;  4GKJ Q;  1SMX A;  4LUV A;  5EAY A;  1IBM L;  4JI7 L;  1YIT A;  4C3I H;  4LF7 L;  4JI5 Q;  2K5H A;  3NEN A;  1VQB A;  3W5O A;  4DAM A;  5IE8 A;  4POG A;  1N33 L;  5FLM H;  4BA1 I;  3JAM c;  4IPH A;  2BH8 A;  1KQS A;  3E9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...