4LF9L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9L00
3K0XA 1EUJA 3OTOQ 2E8GA 1BKBA 3PUXA 4JI2L 1SRUA 4JI6L 2B63G 1L2FA 2UXBL 4B3ML 1J5EL 3UE1A 1Q86C 3STBC 2ALYB 2YU9H 3ICEA 1VQOA 2A8VA 4PZ8A 1E24A 3M4PA 4DV5Q 1HNWQ 2A19A 2NZHA 4JI4L 1SR3A 3K80C 3KF6A 2NZOA 3CCLA 2E2IH 1S72A 3FKIH 3NEMA 1Q1EA 3G4SA 1EIFA 2WFWA 2BA0A 3GO5A 4RMFA 1WCMG 4YCVA 4LFAQ 4BY1G 2JA5H 3RZOH 1TWAH 2HQLA 1ASYA 2F4VL 3E0EA 1YIJA 4DR3Q 4GS3A 3T1YQ 2K5VA 3AFPA 4YCUA 2N3SA 4AH6A 3RLOA 3ZJYC 5C0XG 2ES2A 2R7ZG 3CQZH 2ZM6L 1VQ4A 4DV0Q 1IBLQ 3UDGA 2EIFA 3TREA 3PO3H 2ZJPA 2WP8J 4X65Q 2UUBQ 4PZ7A 1L0WA 4X6AH 1YJ9A 2BA1A 2IY5B 4DR1L 1MJEA 4LF8L 1PH5A 1VQBA 1X3GA 3AFQA 4YWLA 5C0XI 2CCZA 5DLQE 2R92G 2NVQH 1I5FA 3HKZE 1EFWA 3H3VI 2A1AA 4DUZQ 2MNAA 2WAQE 1D8LA 2DUDA 3TS2A 3M85A 4JI7Q 4GLXA 4AYBE 1NBWA 2E5LL 1E3PA 1YZ6A 3I56A 1HZAA 1UE6A 3A0JA 4DV5L 3TRZA 1HNWL 2YTYA 3RLFA 2DGYA 3RN5A 2AWNA 3M3YH 1MJCA 4OO1G 4UY8C 2JEAI 4LF9Q 1X3EA 3FKIG 3STBD 1FJGQ 1IL2A 4GOPB 5AJ3Q 2JA5G 1HNZQ 3S15H 2WB1E 5HGQA 5C4JH 1VQNA 1R9TH 1PVOA 3CC2A 1C0AA 4DR3L 3T1YL 1EWIA 1OXXK 3PUWA 1SLJA 4BBRG 5J3BA 4A3MG 5GAGC 1MIUA 1JJGA 4P73A 1VQIA 2OQKA 2K50A 5IP7H 1IBKQ 1IBLL 4DV0L 4IFDJ 2ZTCA 4A3GG 1A63A 4JV5L 2CQOA 3PO3G 4X65L 1O7IA 3U4ZA 2Y0SG 1WOCA 3KOJA 2JA7G 3NELA 1L1OB 2VZAA 2OTLA 3TS0A 1PH8A 1VQJA 4YHHQ 1VQPA 4L5SA 4DR6L 1VQ5A 3J7ZC 1SN8A 1KHIA 4QL5A 4HIDA 2UU9Q 3DM3A 1VQLA 4NB3A 3FP9A 1VQAA 2OTJA 1EOVA 4DUZL 3GTLH 5LMNW 1KRTA 5ELOA 5M5WH 4JI7L 1XNQL 1VQDA 2ZTEA 3KF6B 2B29A 2KHIA 3SGIA 2N78A 4A4IA 4B3TQ 1ASZA 4LF9L 1FJGL 1WJJA 1E22A 2D0PA 3KLWA 2NVYH 5AJ3L 1C9OA 4JG2A 4A3KH 1YHAA 4LUVA 3RN2A 1PH9A 1HNZL 5IYDH 1Q46A 3BZCA 4O2DA 1TWCH 2R92H 1IYJB 1Q81C 3UDXA 1JMCA 1LYLA 4JI1Q 3I7FA 1IBKL 3S16H 1U5KA 4MNOA 1LTLA 4JI8Q 3KYHC 1PH3A 2Q2TA 1KIXA 2QEXA 5JJKA 5GAEC 3S1NH 2RHSB 4O0AA 1J6QA 3G48A 3S24A 2L15A 1VQ7A 3HOUG 1X56A 1PA6A 2MO0A 3PUYA 2UXDL 3CMAA 2F52A 4YHHL 4XIGS 1XPOA 1GM5A 5E7NA 1AE3A 1HZ9A 1Y1VH 4IJHA 2JK8A 4POGA 1I6HH 1XTDA 2JA6H 4FDBA 3UE0A 4JBMA 2HIXA 4LF5Q 1QVCA 5FLMH 2I5HA 3PF4A 3K7UC 1JB7A 1IBMQ 4BA1I 4R4OA 3BU2A 2E2JH 1X6OA 2MFIA 2OCEA 1I94Q 5LMUQ 3J80i 1HR0L 1X65A 3PV0A 4A3EG 1VQ8A 3CCJA 2Z6KA 1Q12A 1XPUA 3JAMi 1Z47A 3GTPH 4L5QA 1Z9FA 3CAMA 5C4XH 4A3KG 3ULJA 1VQGA 4HIOA 3GDEA 3K7AH 3CD6A 2D62A 1N32Q 1NJIC 2VQFL 3J81j 4TQUS 4KI0A 1YITA 3J7A5 1JJCB 3M4OH 1W2BA 3I4OA 4LUOA 1QZHA 4LUZA 1EQQA 2IHFA 4NPSA 1XJVA 1KL9A 5JEAJ 4JI8L 5K36G 2IHEA 4IPDA 4DV3Q 3CCSA 2CWPA 3RNUA 2KENA 3CW2C 4X64Q 4BBSH 4BXXH 5IP9G 2JJQA 1PFSA 4XTCS 4R4CA 1YVCA 2PQAB 1Y1VG 5IYBH 2VUMH 4IO9A 1E1OA 3TEHB 4OWXB 2AMCB 3I55A 1XPRA 2JA6G 1VQEA 2YYZA 4LF5L 4GKJQ 4IFDG 5FLMG 2KBNA 1K8AC 3J80c 1GKHA 1IBML 1N8RC 5LMUL 3OYYA 2D0OA 2Q2IA 3JAMc 1Q7YC 4NXNQ 1G6PA 4C3IH 3T1HQ 3M7NA 1D7QA 3HOZG 1OXTA 4YY3Q 5HY6A 1CKMA 1EQRA 4IFDI 2XGTA 5C4XG 3EIVA 4DV7Q 3OTOL 1N32L 4PG3A 1P8LA 4LFCQ 2KCMA 4OX9Q 5BR8Q 1PH6A 1NMGA 1NY4A 3GTMH 3U58A 2Z0SA 2ID0A 3S1QH 3G71A 3EN2A 3RLNA 4DV4Q 2CFMA 2JEBI 3D0FA 4JI0Q 3I4MH 2R93H 1C7YA 2PNHA 2NVXH 2KCTA 1VQMA 4YCWA 4QGUA 1Q8KA 4X64L 4BXXG 2CWAA 2RF4A 4LFAL 4A3CH 4WJ3M 3K8AA 2F3IA 4TVAB 4OXPA 3CCVA 1YI2A 1JJ2A 5IE8A 3PIPA 4LW1A 2I5MX 2VW9A 1Y14B 1Y1WH 5IYBG 2EXDA 2VUMG 4JI3Q 1XNRQ 4GN3B 2VNUD 1WYDA 5C44H 4GKJL 1LM0A 5LMNQ 4WJ4A 2K5HA 1B70B 3KJOA 5M3FH 2UUBL 3HOZH 1HZBA 2V1CC 5IY0A 3AQQA 3U4VA 3HFZB 4R4QA 3WWVA 3DLLA 1B8AA 4X66Q 3T1HL 1XMQQ 3MEFA 4DUYQ 4DV7L 4L5TA 1FVIA 3I4NH 3BJUA 4HJ7A 1YEZA 4IPCA 4AQYQ 4LFCL 4A3JH 3HOYH 3HOXH 2PQAA 1V9PA 3JC66 4KLKA 4R4IA 4DV2Q 3PF5A 2YV5A 5BR8L 3H15A 3F1ZA 4A3DH 4HJ9A 2ZJQA 1OXUA 2IT1A 3H0GH 4H02A 3CCMA 4DV4L 2HHHQ 2UUCQ 1E7ZA 3CP0A 4X62Q 3OW2A 4JI0L 3GTOH 3I4MG 3W1BA 4ALPA 4HIMA 2R93G 1PYBA 1QUQA 1CKNB 1BBUA 4C2MH 3HOVH 2LXKA 4IJLA 2OQ0A 2ZJRA 4A3CG 2AKWB 3MXNB 3RZDH 1PH2A 1HNXQ 4DPGA 1IXRA 5IYCH 3PSIA 4LNQA 1DGSA 1YBYA 1PH1A 4A3LH 4AIMA 4JI3L 4OONA 5IT9c 3S1RH 2YTXA 1XNRL 1CSPA 4HJAA 2RHQB 1A62A 2K52A 4EQ5A 5IP7G 5C44G 1X54A 5LMNL 4GN5A 4JYAQ 2KHJA 1CSQA 1KXLA 1H95A 2UUAQ 3S17H 1KD1C 1G51A 4A75A 1HJPA 4LF4Q 1JE5A 5IWAQ 4LFBQ 5GAHC 4X66L 1BVSA 2K14A 4A3IH 1XMQL 4ME3A 1X3FA 4DAYB 3CF5A 1W3SA 4JOIC 3NBHB 2ZTDA 5C3EH 2UXCQ 1AH9A 4DUYL 2UU9L 3EBEA 3CC4A 2YTVA 4UP8A 3J81c 4DR5Q 4NXMQ 1K3RA 1OXSC 4AQYL 3I4NG 3CCQA 2B63H 2OWOA 4JI6Q 2VY3A 1QVGA 3A5UA 4JBKA 1MKHA 4JCVE 4P72A 4C3HH 3GTJH 3GTGH 4A3DG 3NENA 4PMWA 2GVBA 4DNIA 2HHHL 3H0GG 2UUCL 4GKKL 1GD7A 3HKZG 4X62L 2N49A 2WAQG 1K8GA 4B3TL 4JI4Q 1V43A 1VQ9A 1M1KC 1RL2A 3PUVA 1KC8C 4AYBG 2Q2UA 3GTQH 1V1QA 2VQEQ 5IYDG 1HNXL 4GNXC 1N36L 5IYCG 1VCIA 5GROA 4A3LG 1OTCA 2F4VQ 4LF7Q 2Y0SE 1X9NA 1KRSA 2E2HH 3A5ZB 3F2CA 4JI1L 3W5OA 4JYAL 4J15A 4MZ9A 3W1GA 1SE8A 2WB1G 1TWGH 1PV4A 2VS1A 1YJWA 3S1MH 3B6YA 1QVFA 2UUAL 5FJ8H 5H1SE 4LF4L 5JJLA 3CCEA 1HZCA 4DR2Q 3F2DA 5EAYA 1N9WA 1A8VA 5M5XH 4HJ8A 4R4TA 1CKNA 2UXCL 5C3EG 1VS0A 1X55A 2EQSA 4LFBL 4DR5L 2I5LX 3BZKA 4NXML 2MQHA 4JC0A 1CKOA 3KJPA 3CCRA 3D31A 2K75A 4A3BH 4DAMA 4A76A 3KDFA 2K4KA 1TWHH 4LF6Q 4A3FH 1I94L 2E5LQ 2H5XA 1QUQB 2BH2A 4QJFA 2IX0A 1CUKA 2AWOA 4OWTB 2JE6I 3CPFA 4BA2I 2GN5A 1NTGA 2VQEL 1M90C 4B3RQ 2ATWA 2PI2E 2C35B 4LF7L 2ASBA 3CXCA 1IZ6A 1GO3E 4BBRH 3I2ZA 4A3MH 4Y52H 3CPWA 4BY7H 1TXYA 3PCOB 4KHZA 4P74A 3ULLA 2JA8H 4MTNA 2XTIA 3L2PA 4A3GH 4JOIA 4JV5Q 1EYGA 4KHPQ 5FJ8G 4DV3L 3HKSA 2JA7H 4DR2L 4IOCA 1N34Q 1E1TA 4BBSG 3ER0A 4B3SQ 2LSSA 4RG1A 3ERSX 2BH8A 1NMFA 2RCNA 3PGZA 3RR5A 4LWCA 4DR6Q 3CC7A 2R7FA 3TQYA 1WI5A 4R1JA 4YWKA 4Y7NH 5M3MH 1PYSB 4P75A 3CCUA 4A3BG 2K5NA 2PI2A 4POFA 4LF6L 1XNQQ 4GOPC 4L5RC 2AHOB 4A3FG 1U0LA 4UPAA 1UE7A 1XMOQ 4GNXA 4NXNL 1I3QH 4UP9A 1FGUA 1YJNA 2VL6A 1WFQA 1YHBA 3L0OA 4DR4Q 4YY3L 2LXJA 1UWVA 4B3RL 4PZ6A 1UE5A 2I0QA 5GQOA 1UE1A 2HT1A 4C3JH 4OX9L 3J81i 3HOWG 1PH4A 1N33Q 2N8NA 2Z6KC 3PUZA 2CKZB 4DKAC 1L1OC 2NN6G 5C0XJ 4BY7G 3PO2H 1VQ6A 1QZGA 2JA8G 1RIPA 3M4QA 4QIWE 2IX1A 3K81C 4KHPL 3AEVA 4GN4B 1B7YB 2B3GA 1Q82C 1LUZA 2R7DA 4K0KQ 1N34L 1YHQA 4IPHA 3HOUH 3VDYA 4GKKQ 4B3SL 1JT8A 4A93H 2NN6I 4DK6C 1K73C 2UXDQ 1Y1WG 2QA4A 3AYHB 2R6GA 1T9HA 1TWFH 4DV1Q 3KFUA 4DV6Q 3KDFB 4HJ5A 2GVAA 5M3MG 3KF8B 1VQFA 1PHJA 4JI5Q 5JEAG 1GVPA 5M3FG 3UDIA 4JBJA 1NE3A 4DK3C 3A74A 3E9HA 4APVA 1XMOL 1OXVA 1Q1BA 1SROA 1HR0Q 3S14H 4A3EH 3UDFA 4DR7Q 4DR4L 5JJIA 4GLAC 1SFOH 3HOWH 1K0RA 5M5YH 1N36Q 3FHWA 1BBWA 4A3JG 2MO1A 4JI2Q 3HOXG 2VQFQ 1N33L 3HOYG 4DV2L 2NVTH 2UXBQ 4B3MQ 1P16A 1J5EQ 1KQSA 1VQHA 1HH2P 3PO2G 1S3OA 4QQBX 3LGJA 1I50H 1FL0A 1AE2A 2JA9A 1SMXA 4OO1I 2JQOA 1HR0W 4K0KL 3U50C 4YWMA 1K83H 3IRBA 4IPGA 4QY7A 4HIKA 1UEBA 3G6EA 3HOVG 3S2HH 4BY1H 5IP9H 3PIOA 4A93G 1WCMH 1EIYB 3E9IA 1K9MC 5ELNA 4UP7A 3Q8DA 4GOPA 2QGQA 4GLVB 3GTKH 4DV1L 3CMEA 4DV6L 1VQKA 1KAWA 2R7ZH 4IOAA 5GADC 2ZM6Q 2PMZE 4JI5L 4JBWA 1A0IA 3F2BA 4GNXB 3F8TA 1S40A 3H3VH 1PH7A 3ULPA 5IWAL 2FXQA 3S2DH 4DR1Q 1G291 3L7ZC 1YNXA 4A3IG 3M9BA 4LF8Q 4P71A 2HIVA 3GD7A 1VQCA 4EX5A 5FLXc 4DR7L 1L1OA 2Q2HA 4OWWB
chains in the Genus database with same CATH superfamily
1BKBA 5E1FA 1SRUA 2HQEA 5M5WB 2EY5A 4CKEA 3A8KE 3KF8A 4RH6A 4CJ1B 1VQOA 2A8VA 3J81L 1E24A 2A19A 4RGMA 2XNAC 3CCLA 2TSSA 3FMCA 4N9TA 4BY1G 2JA5H 1VF5C 1WCMG 1B3QA 1TWAH 1ASYA 5A2QE 1YIJA 3HG9A 1FD7D 3GV6A 2N3SA 1EU4A 2ZM6L 3NTKA 3EA6A 2XWBB 4E6IA 3S1NB 2KECA 2ZJPA 2A69C 1GXDC 5DM63 4IZ8A 4DR1L 3NQTA 1X3GA 4KTAA 4DF7A 2AQ2B 3A56A 2L55A 1DZ1A 1EFWA 5TSSA 4DUZQ 2DUDA 5CV9A 5ELBA 3TS2A 2E2JB 1LTRD 1S5FD 2E5LL 1V1PB 1YZ6A 1UE6A 4ZUIA 1HNWL 3L3OC 2YTYA 3DMUA 2DGYA 1MJCA 4XXEA 3FKIG 2F3VA 2B2UA 5AJ3Q 1HNZQ 2F0QA 2WB1E 5HGQA 3MTSA 1R9TH 1G2TA 1C0AA 4DR3L 1EWIA 1LV9A 1SLJA 5GAGC 1PFBA 5IP7H 1IBLL 2DNCA 4DV0L 3QOLA 5M9OA 4IFDJ 4JV5L 2TMPA 2F0OA 3U4ZA 2Y0SG 2E2IB 2LY7A 3FPPA 3VYUA 2SEBD 4DR6L 1MSHA 1CTMA 2PZUA 4QL5A 4HIDA 4I7ZC 3FP9A 1VQAA 1SSOA 1EEFD 4LAAA 1S5DD 2L9HA 4Z9CB 5LHY1 1Q3LA 1Z7TA 1DD2A 1TQOA 5J39A 3SK5A 3BS1A 3NUCA 2KHIA 3FPUB 2XVSA 4G7ZC 2RA4A 1WJJA 5IOCA 1LT3D 4OO1G 3KBXA 3LX0A 5IYDH 3RN2A 1TS4A 1Q46A 3BZCA 5C3WA 1Q81C 1LYLA 1GUGA 4JI1Q 2F0UA 3K57A 4EGVA 3S16H 2K28A 4MNOA 4IUQA 3KYHC 1PH3A 2Q2TA 1KIXA 2QEXA 5JJKA 5CC4A 4O0AA 1J6QA 2L15A 1VQ7A 1EQVA 3HOUG 5IGBA 4ZQ3A 2UXDL 3TP7A 2F52A 5BN3A 4YHHL 2A6EC 1XPOA 1AE3A 1HZ9A 5C44B 2JA6H 1EEID 1BDOA 1WTWA 3UE0A 4JBMA 4H13C 5C4HA 3PF4A 3K7UC 2PYKA 1X6OA 5DM73 5LMUQ 1I94Q 4DXFA 1WTVA 4A3EG 3MXGA 1RCVD 2C9OA 1Q12A 1XPUA 5HGTA 4L5QA 4IUNA 1Z9FA 4A3KG 3GDEA 3HOYB 1N32Q 2C5CA 2FFKB 1D2BA 4G7HC 3I4OA 1S5BD 3QOJA 1ICFB 2IHFA 2MPMA 4TSSA 4K6DA 5KEEA 4HMIA 2KENA 3GTPB 1BOSA 4X64Q 4BXXH 1DJRD 2K05A 4JW0A 4R4CA 3S1RB 5CV5A 3IFDA 1Y1VG 3MFGA 3J81E 4FF1A 4LJZC 2F0HA 4IFDG 2KBNA 1K8AC 3OYYA 2Q2IA 5JPNC 4K6LA 4DAVA 4C3IH 4H44C 5HY6A 3X3NA 1EQRA 4OL7A 5C4XG 4DAYA 1TVXA 1P8LA 1QJOA 2KCMA 4OX9Q 1JOOA 3V05A 1PH6A 1MD2D 1I4XA 1NMGA 4HTHA 1IYUA 1HPCA 3S1QH 3HGBA 2CFMA 2JEBI 2QKIC 3D0FA 2PNHA 2KCTA 1VQMA 1RDPD 4YCWA 2IWHA 1VDZA 2E75C 3IKJA 1JJ2A 2HD3A 4DAPA 3PIPA 4DK1A 3TN2A 3DWPA 5IYBG 1CA6A 1WTHA 1KLGD 1FNUA 1UUPA 5JEAH 2IX3A 4X3TA 2V1CC 3AQQA 3DLLA 1AEXA 3T1HL 4RKLA 4DV7L 4IPCA 3JC66 2OT2A 2O2LD 1FR3A 3EFXD 1TWHB 4A3FB 1O80A 1A3TA 3H0GH 2HHHQ 4DV4L 1E7ZA 4JI0L 3I4MG 2R93G 1EIHA 3W1BA 4PNYA 2LXKA 2AKWB 5IYCH 5EBDA 1YBYA 2PQEA 1PH1A 4BY7B 4JI3L 3MHBA 1XNRL 2YTXA 3I4LA 1A62A 2DJFC 4ZAIA 1CZWA 4EQ5A 5LMNL 2EJFC 4JYAQ 4A3GB 2KHJA 1CSQA 1ET9A 3VR6A 2UUAQ 4DU9A 1KD1C 5IWAQ 2NTSA 4FF2A 4X66L 2EY2A 3CF5A 5E4WC 1M8AA 1W3SA 2RDGA 5JVH3 4ZYSA 2YTVA 3I4NG 1A15A 5CMDA 3A5UA 1QVGA 4JBKA 5M3FB 4A3DG 3GTJH 3K5LA 3NENA 2J4XA 1GD7A 1OO9B 1EQTA 3HKZG 2EJGC 1ZEQX 2WAQG 1K8GA 2EY1A 4JI4Q 1RL2A 2JXMB 3PUVA 2Q2UA 3C46A 3P7JA 3DHQA 3HOXB 4FYDA 1ML0D 1OTCA 2F4VQ 4LF7Q 5E3FA 1X9NA 1KRSA 3PO2B 3A5ZB 3NTIA 1SXTA 4JI1L 3W5OA 4PMCA 3W1GA 4L8JA 1PV4A 2VS1A 5FJ8H 3BZDB 2R3ZA 4LF4L 3CCEA 3QWNA 3G7LA 1RD9D 1N9WA 1A8VA 4HJ8A 1SJED 5IIFA 4CGYB 1SNDA 1D5XC 5C3EG 2EQSA 1H9SA 3BZKA 1W6JA 2MQHA 2OF1A 4ZKCB 1H9MA 2DJGC 3E5SA 4EQNA 5IGFA 4B9XA 2F0NA 3VA7A 3PIP3 4KJNA 2XN9C 1I94L 1A2TA 1QUQB 4A3IB 3I73A 5M5YB 2AWOA 2M2LA 2JE6I 2F0KA 1CQFA 2GN5A 1NTGA 5ELEA 2VQEL 3EJIA 5ISRA 1WTXA 2ATWA 3VA5A 1SE2A 3RMHA 4HSVA 4KN4C 4A3MH 3BG3A 1TXYA 1B53A 3PCOB 4KHZA 5CGKA 2JA8H 3R93A 3L2PA 5FOBB 1U4LA 1V1OA 2ZXRA 4BY1B 1WCMB 1E1TA 1SEBD 3GV3A 1Y69U 1PTOB 5FLXE 2BDNA 3GTKB 2LS01 2JN4A 5M3MH 1PYSB 4P75A 3OIPA 3TP8A 1XNQQ 4L5RC 2AHOB 4UPAA 1EYAA 2SNSA 1FGUA 3W3AA 1YJNA 3T53B 1YHBA 3ND9A 4B3RL 4KMUC 1UE1A 4OX9L 1LT6D 1PH4A 1ONLA 2Z6KC 2CKZB 5KYLA 1L1OC 5C0XJ 4PQXA 1VQ6A 1B7YB 2B3GA 4K0KQ 2R7DA 1N34L 3FKIB 3VDYA 1TR5A 3RZOB 4B3SL 1B9MA 1JT8A 2NN6I 2RQXA 4ZCKA 1Y1WG 4K2KA 2QEJC 3CQZB 2GVAA 3KF8B 1PHJA 2Y0SB 4F88A 1GVPA 4GZYC 2NUCA 1LABA 4RWSC 4F8MA 4RCOA 2F0IA 3KLRA 1HR0Q 1EU3A 2NVQB 2Z4IA 1QE6A 2PPBC 1O7ZA 3J7YW 1RODA 3LWUA 2VQFQ 3V96A 3HOYG 3D4DA 1P16A 1KQSA 4ABNA 4OO1I 3U50C 3IRBA 2WV6D 2EE1A 4IPGA 3DXJC 4QY7A 2KUMA 2NTTA 4HIKA 3HOVG 3S15B 1EYDA 5IP9H 4A93G 5C5MA 1K9MC 3Q8DA 4CKCA 4DV1L 3CMEA 2DY7A 4DV6L 5GADC 2QDLA 2ZM6Q 4JBWA 1DONA 1AN8A 3HOUB 1W6KA 5IWAL 2FXQA 3S2DH 3KK7A 4DR1Q 1YNXA 4DR7L 1Q8IA 1L1OA 1N36L 2A6HD 1EUJA 2DNEA 1HFNA 2CVRA 3OTOQ 1EY4A 3PUXA 3NE5B 4DXGA 2Z4HA 4B3ML 1J5EL 3DEPA 3STBC 5A2QL 2ALYB 4CKBA 2L11A 4KK7A 1ICWA 4A3EB 1HNWQ 4JI4L 1SR3A 3K80C 3K6OA 1QB5D 4A3KB 2E2IH 3G4SA 2WFWA 4YCVA 2K5QA 5IODA 4HR7B 1J8IA 2F4VL 4K5VA 4DR3Q 4GS3A 3OPOA 5IGDA 1QILA 3CRLC 1EZ8A 3ZJYC 5C0XG 2ES2A 1PRTC 1IBLQ 5G3LF 4O1NA 4DV0Q 2P5ZX 2EIFA 3TREA 2WP8J 1L0WA 4QIWB 1ILPA 4LF8L 1L0YB 1PH5A 3NXWA 4YWLA 2CCZA 5DLQE 2R92G 1A3UA 1Y1VB 1I5FA 1D1KA 2ZT9C 5FO9B 3I91A 5ELDA 1D8LA 1BUVT 1KDAA 3M85A 2EYLA 4X3UA 4AYBE 2DN8A 1E3PA 3CHBD 5CV4A 4KKSA 3MWYW 4UY8C 5C4XB 4EQPA 1X3EA 1IL2A 5G3LD 4GOPB 2JA5G 3D4WA 1VQNA 1HUNA 1C8CA 1OXXK 2EPBA 1R4PB 3PUWA 1MIUA 1JJGA 2XIWA 1VQIA 4P73A 1ENCA 2K50A 2OQKA 3TDQA 2ZTCA 4A3GG 1QWYA 4IUVA 4X65L 4UHVA 3KOJA 4V190 3NELA 4BBSB 5CV7A 2VZAA 3TZUA 2QCPX 1U4MA 3WOEA 1VQJA 4YHHQ 1VQPA 2A69D 1KHIA 2CH4A 3E0JA 3DM3A 4NB3A 1R4QB 3GTLH 4N8FA 1KRTA 5ELOA 4RGTA 3OMGA 1XNQL 1SE3A 4G57A 3KF6B 2PMZB 3Q0AA 3SGIA 2WIIB 2K04A 1GUSA 3KLWA 3QG1A 2NVYH 3OWFA 1YHAA 3VYTA 2QILA 4C3JG 1TWCH 1I4PA 1IYJB 3GTMB 3UDXA 1JMCA 1U5KA 3I4MB 2R93B 1LTLA 1BQQT 2NBFA 4N9PA 1BNZA 1STBA 3G48A 3S24A 1IHZA 1YNJC 2MO0A 2MP1A 2D2CC 5E7NA 2LFNA 4IJHA 4POGA 1QNKA 4I65A 2HIXA 1AW7A 5FLMH 5IGCA 2KCNA 4BA1I 3BU2A 1KDBA 3J80i 1HR0L 1BR9A 3PV0A 1VQ8A 3VR4A 1MHWC 3JAMi 1Z47A 1II3A 2BE5D 3FEWX 4HEDA 2E76C 3I4NB 1VQGA 3A54A 3K7AH 2SOBA 4OIJA 2VQFL 2F0GA 1NJIC 4TQUS 4RHSA 4A3DB 5FO7B 1JB3A 1YITA 3M4OH 3HKZB 3GTOB 1KL9A 5JEAJ 1SE4A 2WAQB 2IHEA 4DV3Q 1MBYA 4MTKA 3RZDB 4QB4A 4N8X1 2IL8A 1YVCA 2VUMH 1E1OA 3TEHB 2JA6G 2AMCB 2YYZA 4LK1C 4LF5L 3S17B 1EY9A 4QUCA 3J80c 1GKHA 1IBML 1V8QA 4Q0FA 2EYPA 2AUKA 3A7AB 1YNNC 1B4OA 3JAMc 2F0WA 5C3EB 3WOFA 3X3MA 3T1HQ 1OXTA 1I6HB 2EOTA 4DV7Q 3OTOL 3K59A 2B63B 3NBHA 4PG3A 2A68D 4WFN3 3GTGB 1NY4A 3T4AC 4G4KA 1SYDA 3EN2A 3RLNA 4DV4Q 4JI0Q 1C7YA 1CA5A 2NVXH 4OELB 5ELFA 4F7XA 3ZYYX 1UEAB 4RAUC 2I07B 4BXXG 4FXKC 4A3CH 4TVAB 4OXPA 4EQOA 5IE8A 4FNFA 1DOMA 2F0DA 2KVMA 4JI3Q 1FYCA 1XNRQ 2VNUD 2QW7A 3E6ZX 5LMNQ 3NK9A 5M3FH 3T13A 5M5XB 1SDFA 3HFZB 4R4QA 3PMFA 4C3IG 1F9RA 4X66Q 3MEFA 4MHEA 1T5XD 3HOXH 2PQAA 4R4IA 3PF5A 4DV2Q 5EKLA 3H15A 1ILQA 4HJ9A 2ZJQA 4RGNA 1LT4D 1OXUA 3CP0A 3LNNA 1HRJA 1TT2A 4J1MA 4ALPA 3K5NA 5ELCA 1I4GA 4C2MH 4IJLA 2OQ0A 3MXNB 4LNQA 2H4OA 3PSIA 4AIMA 4OONA 1H9JA 1CSPA 4HJAA 2RHQB 4GN5A 3SVMA 1G51A 4LF4Q 4M8AA 1STNA 2K14A 4A3IH 1Y1WB 4JOIC 3EBEA 4WORA 4Y7NB 4UP8A 1K0SA 2O5JC 1OXSC 2NZ1D 1ZXTA 3CCQA 2OWOA 1F2YA 3C1FA 5BN4A 1EFID 4JCVE 4P72A 4C3HH 1HCZA 4DNIA 1PZJD 3H0GG 2UUCL 1I3QB 4OEMB 4XT3B 2WKDA 1M1KC 1KC8C 3GTQH 4KD4A 2VQEQ 4GNXC 5IYCG 1CHQD 1CQVA 1PTOH 2E2HH 1SNQA 3VR2A 3K5MA 1LTGD 2LKVA 4J15A 2WB1G 1YJWA 3S1MH 3B6YA 3KLSX 1EZ6A 1H9RA 5JJLA 3HOVB 1HQMC 4A93B 1VS0A 1TWFB 4DR5L 2I5LX 4NXML 3D31A 2K75A 4A3BH 4DAMA 2KQ3A 1F9PA 1L0XB 2NYZD 1VF7A 2IX0A 1AZQA 4B3RQ 2ICIA 2K32A 2PI2E 2C35B 2Q8RE 2G9DA 2L0CA 5FLXL 2NN6H 5KNDA 4MTNA 2ZXOA 4JOIA 3VYRA 1EYGA 4DGZA 5FJ8G 1STYA 4DV3L 3HKSA 1N34Q 4R8NA 5KYIA 1KABA 4BBSG 3ER0A 1JWSD 4B3SQ 3EVQA 5A35A 1NMFA 2RCNA 3PGZA 5JOBA 4LWCA 3TQYA 5HURA 3NSWA 4YWKA 2SDFA 1HQRD 1HTPA 3M7GA 4XQQA 1TWGB 1K8MA 5CYUA 3CCUA 2K5NA 2PI2A 4POFA 4IUPA 4KN7C 1XX8A 4FP5D 2M9VA 4GNXA 3Q23A 1WTPA 2R92B 1IKLA 4EVOA 1CM9A 1B50A 4OO1H 3D6CA 3ND8A 2HT1A 1XTCD 2F0JA 3OIQA 1A6XA 2N8NA 3C3LA 2JA8G 1CI3M 2IX1A 1JICA 1LUZA 3J80E 1YHQA 4IPHA 3HOUH 2JA5B 1Y8PB 3JAME 1TWAB 1B2TA 5CBAE 2N88A 5J22A 1T9HA 4DV1Q 3KFUA 4DV6Q 1ZKOA 3KDFB 4ZKBB 5M3MG 4NKLA 2K6AA 1JC7A 3OMCA 4C56C 2F0LA 4JBJA 4DK3C 1XMOL 4APVA 1Q1BA 4U673 2FINB 4A3EH 3MEHA 5D65A 2B2WC 3UDFA 4DR4L 4DR7Q 3HOWH 4RFBA 1N36Q 4P2CB 3HS0C 4A3JG 2MO1A 1B3AA 1N33L 3SK6A 3A8IE 4DV2L 1BCPB 2NVTH 4B3MQ 1J5EQ 3OHXC 5JPMC 2EZVA 3LGJA 4CDCC 1E2ZA 3I3CA 4XQNA 2FJ2A 1V1PA 3A55A 4RGOS 1BCPF 2F0PA 4ID6A 3S2HH 4L6TB 5C4ZA 3PQIA 2HCCA 4C3JB 1SNOA 3E9IA 2Q8IB 3FRPB 1MI2A 4MN3A 5D14A 5KIXA 2VXWA 2R7ZH 3F8TA 5EGTA 2G5DA 2FMMA 1CK1A 4LF8Q 3M9BA 1PFNA 3GD7A 2KHSA 4DA2A 2Q2HA 2E8GA 3SXHA 2B63G 4UAIA 1IW7D 1BCPD 1NNXA 1LTAD 2UXBL 2EYFA 3UE1A 5DAUA 4DN4M 2YU9H 3ICEA 2QDBA 3M4PA 2D5DA 2NZHA 3D6WA 3CKIB 2KCCA 2I46A 2BA0A 4LFAQ 1GOZA 5EKKA 2HQLA 4YCUA 4R8IA 2KEEA 4AH6A 5LL6X 1I50B 3RLOA 1JWMD 2XSCA 3UDGA 3ERQA 2XWJB 3PO3H 1K83B 4X65Q 2GA4B 1YJ9A 2BA1A 1MJEA 4BWGB 2BDOA 2RSOA 3AFQA 2B2YC 3T56B 5T1GA 3K58A 2JA6B 3H3VI 4IQZA 1SYBA 2A1AA 4RA8A 4NDXA 2KOLA 1DOKA 1HZAA 3A0JA 4DV5L 2AWNA 1TS3A 3M3YH 1RJTA 3NP8A 3STBD 5IGEA 1S5CD 2EYJA 1PVOA 3CC2A 2B39A 3N6RA 3T1YL 4BBRG 5J3BA 3TZDA 3Q22A 1CT1D 2XRQD 5EKIA 1E2VA 1D5MC 1O7IA 2CQAA 2JA7G 1F2ZA 2OTLA 1QNUA 1LACA 1VQ5A 3J7ZC 2PNRC 2OXPA 2OTJA 5LMNW 1JORA 5J1ZA 5M5WH 4JI7L 2SNMA 1VQDA 4RHRA 2ZTEA 4C3IB 2B29A 1ASZA 2PZTA 5EJWA 4LF9L 1FJGL 1E22A 2D0PA 1C9OA 3SHLA 3H94A 4O2DA 2R92H 2AUJD 4ZRZA 1STGA 3S1QB 3I7FA 1IBKL 5E4XA 2DY8A 3A7LA 2B2YA 5T1IA 5K36H 1G2SA 5GAEC 3S1NH 2RHSB 4QMGA 1ENAA 1X56A 1PA6A 1QG7A 5C4JB 2CW0C 4B9WA 3CMAA 4XIGS 1I6HH 3BDOA 1XTDA 3AB9A 4FDBA 4LF5Q 5FKAC 2I5HA 1JB7A 3C2PA 1IBMQ 2E2JH 2OCEA 2MFIA 3U9SA 2KA7A 1X65A 1U4PA 2Z6KA 3IL8A 3MFYA 1KTKA 2RDFA 3CAMA 3ULJA 4FF3A 1F9SA 2WINB 1PFMA 4KI0A 3J7A5 3H91A 2E74C 3H0GB 1QZHA 1D1IA 3W2DA 1XJVA 4JI8L 5I2YA 1XXGA 5C3XA 2ENBA 2CWPA 3RNUA 1AZPA 1EIGA 2JJQA 1PFSA 3RD4A 1HA6A 1VMPA 1SAPA 4XTCS 4DFAA 2PQAB 4IO9A 1TKWB 2WB1B 4OWXB 5KRUA 1XPRA 5FLMG 1SYGA 5KNCA 3QIAA 1I6VC 2F3WA 2D0OA 3OOCA 1Q7YC 1NR4A 1D6EC 3CU7A 4MIUA 3M7NA 2B8GA 3HOZG 2EVBA 1CKMA 4IFDI 3O13A 2RBMA 3GTJB 2HCIA 4U68A 4KKUA 1CHPD 3TMEA 3U58A 4J8QA 2ID0A 2MGSA 2Z0SA 1PTOC 3BYYB 3G71A 1B9NA 1MSGA 1Q8KA 2CWAA 4LFAL 1G8ZD 2F3IA 3CCVA 1YI2A 1EY7A 1Y1WH 2VW9A 2JYOA 2VUMG 1IL8A 4C1NI 1H9KA 1JWUD 4GN3B 2IPKD 5C44H 4GKJL 3Q6SA 1HZBA 5IY0A 3WWVA 3QO2A 4FO2A 1RTNA 3I8ZA 1FVIA 1KLUD 1LTID 1YEZA 4HCEA 1JQYD 4LFCL 3HOYH 4K8JA 4KLKA 1V9PA 4ILWA 1G91A 5BR8L 1PMRA 3VR5A 5EBCA 1H95A 2UUCQ 1RKNA 2F03A 4WJWA 1PYBA 1QUQA 1BBUA 3HOVH 4YIJA 4A3CG 1SYEA 3GTPH 5EQ0A 3IFTA 4DPGA 1IXRA 2MJ8A 1PH2A 4G7OC 4A3LH 5IT9c 3S1RH 2JA8B 4BS9A 1I4QA 5IP7G 1X54A 1KXLA 4X3SA 2A6HC 4K5WA 3ONAB 1T5EA 1HJPA 4A75A 3BYTB 1BVSA 1XMQL 1X3FA 1ZYRC 4DAYB 5JAVA 1HFGA 1AH9A 4DUYL 4O42A 4DR5Q 5CV6A 3J81c 5FO8B 4NXMQ 5M3MB 4AQYL 1XWEA 4JI6Q 1F77A 2VY3A 2JP1A 3R2IA 1MKHA 1CZGA 4PMWA 2GVBA 4GKKL 1NCVA 4X62L 2N49A 4DK0A 3U9OA 4AYBG 5IYDG 1HNXL 4A3JB 3Q24A 3J7AF 2NB0A 1EWHA 1TS2A 2Y0SE 1DCZA 3NTHA 4XQJA 3F2CA 3MXUA 4R9WA 5CBEE 1LTTD 3R2TA 1SE8A 3SR1A 1TWGH 5LL6S 4V0BA 1EY8A 5EAYA 3AMUA 1CKNA 1QCBD 2UXCL 2K01A 1X55A 4LFBL 5KGUA 2NWGA 4JC0A 1CKOA 3CCRA 3DUZA 1PZKD 2A6ED 4C3HG 3R3OA 1TWHH 2Z8LA 2M00A 4A3FH 2L4NA 2L12A 1PDQA 2V4DA 1CUKA 3C1EA 2R61A 5I4DA 4NP5A 3CPFA 4BA2I 5NUCA 4XYQA 3QB3A 3DM1A 2PZWA 1RHPA 1C48A 3I2ZA 4Y52H 4BY7H 4P74A 2B8FA 4A3GH 3QJYA 4DR2L 3K5OA 3FVQA 4QCLA 4RG1A 1X32A 3ERSX 1U4RA 2K03A 2R7FA 4A3BG 5CR3A 4LF6L 4GOPC 2G9HD 5FK9C 3S2DB 1U0LA 2A73B 2D9UA 3GP7A 1XMOQ 1KAAA 2F0TA 1NUCA 3FDTA 5JJZA 2VL6A 4DR4Q 3T16A 4CHTB 1BXTA 1UWVA 3J80L 4JPBW 3TP5A 1SNMA 1UE5A 2I0QA 5GQOA 4C3JH 3JAML 1N33Q 3KLSA 3PUZA 4DKAC 1SBBB 2NN6G 4JK1C 5DNFA 5C6AA 3PO2H 1RIPA 4QIWE 1SMYC 4KHPL 4QF4A 3AEVA 1Q82C 2K5DA 1Y8OB 1GHJA 1H9SB 1K73C 3EQLC 2AQ1B 1JCKB 4BBRB 2Q8TA 3SK8A 4DNRB 5I2XA 4HJ5A 5COYA 2BE5C 5JEAG 5KNBA 1DXMA 1TS5A 2IW3A 2JA7B 2K5WA 3A74A 1K3BC 1OXVA 3HRZC 1SROA 4S3SA 4HAEA 1EY6A 4KV6A 1ET6A 1A2UA 5M5YH 1KNEA 1RTOA 1GUWA 3S9WA 2ZXPA 1KDCA 2E2DC 4NMZA 2PW5A 2UXBQ 1S3OA 4CDDC 4JVZA 4QQBX 1I50H 1FL0A 1AE2A 2JA9A 1SMXA 5C5LA 2JQOA 3NQIA 5I6YA 1HR0W 1DOLA 4YWMA 1K83H 3D4RA 2OEOA 1UEBA 1BO0A 4H7BA 3ITPA 4IUUA 4BY1H 1X3QA 3PIOA 1WCMH 4ZUJA 1EIYB 3DEOA 4UP7A 5IGGA 4GOPA 3GTKH 1X3PA 1HHVA 5I6WA 2PMZE 4KHVA 3BVMA 1I4HA 4JI5L 3H3VH 1PH7A 3TBIB 1PLFA 2A68C 3L7ZC 1WVLA 2HIVA 5FLXc 3HOWG 4OWWB 2X6GA 2EXZA 3K0XA 5CORA 3GTLB 4JI2L 4JI6L 1L2FA 5IT9E 1Q86C 1EWCA 1LTBD 3S14B 4PZ8A 4DV5Q 1SFOB 1HUMA 3E3XA 1GUOA 3KF6A 2BOSA 2NZOA 3RUZA 2NVYB 5BN5A 1S72A 2MUYA 3FKIH 1Q1EA 3NEMA 1EIFA 4K5XA 3GO5A 4RMFA 1JR0D 3RZOH 1TWCB 1XYIA 3E0EA 3T1YQ 2K5VA 3AFPA 3MXPA 2R7ZG 3CQZH 1VQ4A 2B2VC 1A3VA 2UUBQ 4PZ7A 4UDUC 4X6AH 4PMBA 2IY5B 3VYSA 4ZK9B 2EY6A 1VQBA 4I7AA 3MC0B 5C0XI 1JOKA 4KY5A 3I70A 2NVQH 3TSSA 3HKZE 1ENFA 3UI2A 2MNAA 2WAQE 3CRKC 4KY7A 4C1NK 4OIKA 4JI7Q 4GLXA 1NBWA 3I56A 2RVLA 3TRZA 3IAYA 3RLFA 3RN5A 3HOZB 1I4RA 3T51B 2JEAI 4LF9Q 3K7AB 1FJGQ 1BF4A 3S15H 3D3RA 2X69A 4FXGC 5C4JH 1J9OA 1TY2A 3M4OB 5K5PA 4A3MG 3N52A 1FNVA 1IBKQ 1A63A 1SYFA 2CQOA 3PO3G 1WOCA 3BVZA 1L1OB 3TS0A 1O7YA 1PH8A 4L5SA 5EPKA 2VUMB 1SN8A 2UU9Q 2EJMA 1VQLA 1EOVA 5F2DA 4DUZL 1LT5D 1E0BA 3PIO3 2HUGA 4HCSA 2RCFA 2FHTA 3V2TA 1QOHA 1C4QA 1UAPA 2LMCB 3NWTA 2PCFB 2N78A 4A4IA 4B3TQ 3MVVA 5AJ3L 4A3KH 1PH9A 4JG2A 1HNZL 4LUVA 1EY0A 2FMCA 1B44D 2B2VA 2F0VA 2VB2X 4IN3A 2Z9HA 2A5HA 2NVXB 4JI8Q 1GHKA 2F0MA 2K7VA 4PV1C 3PUYA 1R9TB 1WD0A 1GM5A 4K8IA 1EL0A 1ESFA 1Y1VH 2JK8A 1B1ZA 3M4YA 1QVCA 4IFDH 2X6LA 4R4OA 1AFPA 3CCJA 3GQBA 3DWQA 5C4XH 4HIOA 3CD6A 4TRDA 2D62A 2AQ3B 3J81j 4ODGA 1SYCA 1JJCB 2QF7A 1W2BA 4LUOA 4LUZA 1EQQA 4NPSA 3HP3A 1HA5A 5K36G 4KY6A 4IPDA 4C2MB 4AYBB 1DM0B 3CCSA 3CW2C 2VB3X 4BBSH 5IP9G 3NBIA 1IYVA 4RCNA 3MXNA 5IYBH 5JVG3 3S16B 3OW7A 3I55A 2CW0D 1VQEA 1FNWA 2B2WA 4GKJQ 3MZ5A 4B08A 3G6JB 1N8RC 1PYWD 5LMUL 2HDLA 3LWEA 1G6PA 4NXNQ 1LLRD 2CHBD 4F87A 1PRTB 1D7QA 2L1BA 4YY3Q 1WTQA 4FF4A 2XGTA 3EIVA 1N32L 1O78A 3L9AX 4LFCQ 4XYOA 2F0EA 3KBGA 4C3HB 1PRTF 5BR8Q 3BDCA 2F4IA 1GJXA 3AU7A 3GTMH 4M1UB 4IURA 3I4MH 2R93H 3GTQB 1O7LA 4QGUA 4X64L 2RF4A 4WJ3M 3K8AA 4HMJA 2E2HB 4LW1A 2I5MX 1Y14B 2EXDA 1HXYD 1NAPA 4J6HA 1WYDA 3S1MB 4CDFC 1LM0A 3D8GA 4WJ4A 1PTOF 2K5HA 1B70B 1RF2D 3I90A 3MA2B 3KJOA 2UUBL 1PZID 2J0TD 1F2LA 5CV8A 3U4VA 2A74C 1TU2B 1PRTD 1B8AA 1XMQQ 4XT1B 4DUYQ 4L5TA 5L37A 3BJUA 4HJ7A 3I4NH 4AQYQ 4A3JH 4A3BB 1EYCA 3SK4A 2XRSD 2YV5A 4A3DH 3F1ZA 2IT1A 4H02A 3CCMA 4GKKQ 3GTOH 4X62Q 3OW2A 4HIMA 1CKNB 1CFMA 5D3DA 2ZJRA 2JSOA 3WDNA 3NWSA 1GUNA 1PTOD 5I9PA 3RZDH 1HNXQ 1DGSA 2EDGA 3P75A 5C44G 2K52A 3URYA 3SE0A 4ZLTF 3S17H 4FVMA 1JE5A 2PO4A 2MHVA 5GAHC 1IW7C 1BCPC 4ME3A 3NBHB 1E2WA 2ZTDA 5C3EH 2UXCQ 1SNPA 1JOQA 4IUTA 2UU9L 4RKBA 3CC4A 4LFBQ 4ULLA 1K3RA 2B63H 2WACA 4HN7A 5AFWA 3GTGH 4DNTB 2HHHL 1K8OA 1IKMA 2IJ0A 2RDHA 4OGQC 4B3TL 1V43A 1VQ9A 1GUTA 2L5TA 3K0YA 5D3IB 1V1QA 3NHHA 1ESRA 1VCIA 5GROA 2K1BA 4A3LG 2RSNA 4CDEC 4HSPA 1FGBD 4JYAL 4MZ9A 2K33A 2F0SA 1QVFA 2KEDA 2UUAL 5H1SE 1HZCA 4DR2Q 2EYOA 2ICEC 3F2DA 5M5XH 4K14A 1TY0A 4R4TA 4CJ0B 1M4VA 1Z6HA 2EYHA 2H1EA 3TP6A 3KJPA 1Q90A 1PXUA 1YNJD 1ZYRD 4A76A 3KDFA 2K4KA 4LF6Q 2RKSA 2E5LQ 1LTSD 3BDLA 3KUPA 2H5XA 2BH2A 3BVGA 4QJFA 1WTOA 3R8BA 3HOWB 4OWTB 2CH4W 1M90C 2Z6BA 1F9QA 4FXDA 2NVTB 4LF7L 2ASBA 3CXCA 1IZ6A 1GO3E 1HTLD 2PW7A 4BBRH 1JE4A 3CPWA 3ULLA 2BCOA 2XTIA 3SEBA 4QUFA 4JV5Q 2Z1CA 4KHPQ 1NR2A 2WKCA 2JA7H 4IOCA 3S2HB 3A8JE 4KD3A 3P20A 1Y8NB 2LSSA 3H3VC 2BH8A 2B2TC 3RR5A 4OHJA 4DR6Q 3CC7A 2N55A 1WI5A 1TIID 4R1JA 2R7ZB 4Y7NH 1SNCA 3H09A 3I72A 1NSNS 3EROA 4A3FG 1VMCA 1UE7A 4K2LA 1WD1A 4L63B 4NXNL 1I3QH 1EOTA 4UP9A 1STEA 1WFQA 3L0OA 4YY3L 2LXJA 1SJHD 5EPLA 4PZ6A 4CJ2C 5DEHA 1YNND 2F0FA 3J81i 3P1HA 2YU9B 4H0LC 4BY7G 1QZGA 3M4QA 4WRDA 3K81C 1AP0A 3DWAA 4GN4B 2O4XA 1LO5D 1U9RA 4A93H 4DK6C 2UXDQ 1KNAA 4A3MB 2QA4A 3AYHB 1F2MA 2R6GA 1TWFH 3OWEB 1VQFA 3PO3B 4JI5Q 3F2UA 5M3FG 3UDIA 4IALA 1NE3A 1UNSA 3E9HA 2F1MA 2O5IC 3S14H 1DYQA 1S5ED 5JJIA 4GLAC 1SFOH 1K0RA 3SDZA 3FHWA 2EYMA 1BBWA 1K28A 1S4ZA 3VR3A 3OSOA 4LMQD 4JI2Q 3HOXG 1STAA 1WTRA 3MAQA 2J7ZA 3HEJA 4NW2A 1VQHA 1HH2P 3H6MA 3PO2G 3QR8A 1STHA 5I9OA 2B2TA 4K0KL 3M3YB 4CBVA 2KJXA 3G6EA 1G6ZA 5EPJA 1SMYD 3NPPA 4KKTA 5ELNA 1BBXC 2QGQA 4GLVB 4KJOA 4Q5VA 4ME5A 1EY5A 2HDMA 5C0XH 1VQKA 1KAWA 2B2UC 4IOAA 3J7AV 1A0IA 3F2BA 4GNXB 1S40A 1MGSA 3ULPA 5IT9L 1D5ZC 1G291 4A3IG 4P71A 4EX5A 1VQCA 3HOZH 3HZXA 4XDXA 4X3KA 4TKOB
chains in the Genus database with same CATH topology
3K0XA 1EUJA 3OTOQ 2E8GA 1BKBA 3PUXA 4JI2L 1SRUA 4JI6L 2B63G 1L2FA 2UXBL 4B3ML 1J5EL 3UE1A 1Q86C 3STBC 2ALYB 2YU9H 3ICEA 1VQOA 2A8VA 4PZ8A 1E24A 3M4PA 4DV5Q 1HNWQ 2A19A 2NZHA 4JI4L 1SR3A 3K80C 3KF6A 2NZOA 3CCLA 2E2IH 1S72A 3FKIH 3NEMA 1Q1EA 3G4SA 1EIFA 2WFWA 2BA0A 3GO5A 4RMFA 1WCMG 4YCVA 4LFAQ 4BY1G 2JA5H 3RZOH 1TWAH 2HQLA 1ASYA 2F4VL 3E0EA 1YIJA 4DR3Q 4GS3A 3T1YQ 2K5VA 3AFPA 4YCUA 2N3SA 4AH6A 3RLOA 3ZJYC 5C0XG 2ES2A 2R7ZG 3CQZH 2ZM6L 1VQ4A 4DV0Q 1IBLQ 3UDGA 2EIFA 3TREA 3PO3H 2ZJPA 2WP8J 4X65Q 2UUBQ 4PZ7A 1L0WA 4X6AH 1YJ9A 2BA1A 2IY5B 4DR1L 1MJEA 4LF8L 1PH5A 1VQBA 1X3GA 3AFQA 4YWLA 5C0XI 2CCZA 5DLQE 2R92G 2NVQH 1I5FA 3HKZE 1EFWA 3H3VI 2A1AA 4DUZQ 2MNAA 2WAQE 1D8LA 2DUDA 3TS2A 3M85A 4JI7Q 4GLXA 4AYBE 1NBWA 2E5LL 1E3PA 1YZ6A 3I56A 1HZAA 1UE6A 3A0JA 4DV5L 3TRZA 1HNWL 2YTYA 3RLFA 2DGYA 3RN5A 2AWNA 3M3YH 1MJCA 4OO1G 4UY8C 2JEAI 4LF9Q 1X3EA 3FKIG 3STBD 1FJGQ 1IL2A 4GOPB 5AJ3Q 2JA5G 1HNZQ 3S15H 2WB1E 5HGQA 5C4JH 1VQNA 1R9TH 1PVOA 3CC2A 1C0AA 4DR3L 3T1YL 1EWIA 1OXXK 3PUWA 1SLJA 4BBRG 5J3BA 4A3MG 5GAGC 1MIUA 1JJGA 4P73A 1VQIA 2OQKA 2K50A 5IP7H 1IBKQ 1IBLL 4DV0L 4IFDJ 2ZTCA 4A3GG 1A63A 4JV5L 2CQOA 3PO3G 4X65L 1O7IA 3U4ZA 2Y0SG 1WOCA 3KOJA 2JA7G 3NELA 1L1OB 2VZAA 2OTLA 3TS0A 1PH8A 1VQJA 4YHHQ 1VQPA 4L5SA 4DR6L 1VQ5A 3J7ZC 1SN8A 1KHIA 4QL5A 4HIDA 2UU9Q 3DM3A 1VQLA 4NB3A 3FP9A 1VQAA 2OTJA 1EOVA 4DUZL 3GTLH 5LMNW 1KRTA 5ELOA 5M5WH 4JI7L 1XNQL 1VQDA 2ZTEA 3KF6B 2B29A 2KHIA 3SGIA 2N78A 4A4IA 4B3TQ 1ASZA 4LF9L 1FJGL 1WJJA 1E22A 2D0PA 3KLWA 2NVYH 5AJ3L 1C9OA 4JG2A 4A3KH 1YHAA 4LUVA 3RN2A 1PH9A 1HNZL 5IYDH 1Q46A 3BZCA 4O2DA 1TWCH 2R92H 1IYJB 1Q81C 3UDXA 1JMCA 1LYLA 4JI1Q 3I7FA 1IBKL 3S16H 1U5KA 4MNOA 1LTLA 4JI8Q 3KYHC 1PH3A 2Q2TA 1KIXA 2QEXA 5JJKA 5GAEC 3S1NH 2RHSB 4O0AA 1J6QA 3G48A 3S24A 2L15A 1VQ7A 3HOUG 1X56A 1PA6A 2MO0A 3PUYA 2UXDL 3CMAA 2F52A 4YHHL 4XIGS 1XPOA 1GM5A 5E7NA 1AE3A 1HZ9A 1Y1VH 4IJHA 2JK8A 4POGA 1I6HH 1XTDA 2JA6H 4FDBA 3UE0A 4JBMA 2HIXA 4LF5Q 1QVCA 5FLMH 2I5HA 3PF4A 3K7UC 1JB7A 1IBMQ 4BA1I 4R4OA 3BU2A 2E2JH 1X6OA 2MFIA 2OCEA 1I94Q 5LMUQ 3J80i 1HR0L 1X65A 3PV0A 4A3EG 1VQ8A 3CCJA 2Z6KA 1Q12A 1XPUA 3JAMi 1Z47A 3GTPH 4L5QA 1Z9FA 3CAMA 5C4XH 4A3KG 3ULJA 1VQGA 4HIOA 3GDEA 3K7AH 3CD6A 2D62A 1N32Q 1NJIC 2VQFL 3J81j 4TQUS 4KI0A 1YITA 3J7A5 1JJCB 3M4OH 1W2BA 3I4OA 4LUOA 1QZHA 4LUZA 1EQQA 2IHFA 4NPSA 1XJVA 1KL9A 5JEAJ 4JI8L 5K36G 2IHEA 4IPDA 4DV3Q 3CCSA 2CWPA 3RNUA 2KENA 3CW2C 4X64Q 4BBSH 4BXXH 5IP9G 2JJQA 1PFSA 4XTCS 4R4CA 1YVCA 2PQAB 1Y1VG 5IYBH 2VUMH 4IO9A 1E1OA 3TEHB 4OWXB 2AMCB 3I55A 1XPRA 2JA6G 1VQEA 2YYZA 4LF5L 4GKJQ 4IFDG 5FLMG 2KBNA 1K8AC 3J80c 1GKHA 1IBML 1N8RC 5LMUL 3OYYA 2D0OA 2Q2IA 3JAMc 1Q7YC 4NXNQ 1G6PA 4C3IH 3T1HQ 3M7NA 1D7QA 3HOZG 1OXTA 4YY3Q 5HY6A 1CKMA 1EQRA 4IFDI 2XGTA 5C4XG 3EIVA 4DV7Q 3OTOL 1N32L 4PG3A 1P8LA 4LFCQ 2KCMA 4OX9Q 5BR8Q 1PH6A 1NMGA 1NY4A 3GTMH 3U58A 2Z0SA 2ID0A 3S1QH 3G71A 3EN2A 3RLNA 4DV4Q 2CFMA 2JEBI 3D0FA 4JI0Q 3I4MH 2R93H 1C7YA 2PNHA 2NVXH 2KCTA 1VQMA 4YCWA 4QGUA 1Q8KA 4X64L 4BXXG 2CWAA 2RF4A 4LFAL 4A3CH 4WJ3M 3K8AA 2F3IA 4TVAB 4OXPA 3CCVA 1YI2A 1JJ2A 5IE8A 3PIPA 4LW1A 2I5MX 2VW9A 1Y14B 1Y1WH 5IYBG 2EXDA 2VUMG 4JI3Q 1XNRQ 4GN3B 2VNUD 1WYDA 5C44H 4GKJL 1LM0A 5LMNQ 4WJ4A 2K5HA 1B70B 3KJOA 5M3FH 2UUBL 3HOZH 1HZBA 2V1CC 5IY0A 3AQQA 3U4VA 3HFZB 4R4QA 3WWVA 3DLLA 1B8AA 4X66Q 3T1HL 1XMQQ 3MEFA 4DUYQ 4DV7L 4L5TA 1FVIA 3I4NH 3BJUA 4HJ7A 1YEZA 4IPCA 4AQYQ 4LFCL 4A3JH 3HOYH 3HOXH 2PQAA 1V9PA 3JC66 4KLKA 4R4IA 4DV2Q 3PF5A 2YV5A 5BR8L 3H15A 3F1ZA 4A3DH 4HJ9A 2ZJQA 1OXUA 2IT1A 3H0GH 4H02A 3CCMA 4DV4L 2HHHQ 2UUCQ 1E7ZA 3CP0A 4X62Q 3OW2A 4JI0L 3GTOH 3I4MG 3W1BA 4ALPA 4HIMA 2R93G 1PYBA 1QUQA 1CKNB 1BBUA 4C2MH 3HOVH 2LXKA 4IJLA 2OQ0A 2ZJRA 4A3CG 2AKWB 3MXNB 3RZDH 1PH2A 1HNXQ 4DPGA 1IXRA 5IYCH 3PSIA 4LNQA 1DGSA 1YBYA 1PH1A 4A3LH 4AIMA 4JI3L 4OONA 5IT9c 3S1RH 2YTXA 1XNRL 1CSPA 4HJAA 2RHQB 1A62A 2K52A 4EQ5A 5IP7G 5C44G 1X54A 5LMNL 4GN5A 4JYAQ 2KHJA 1CSQA 1KXLA 1H95A 2UUAQ 3S17H 1KD1C 1G51A 4A75A 1HJPA 4LF4Q 1JE5A 5IWAQ 4LFBQ 5GAHC 4X66L 1BVSA 2K14A 4A3IH 1XMQL 4ME3A 1X3FA 4DAYB 3CF5A 1W3SA 4JOIC 3NBHB 2ZTDA 5C3EH 2UXCQ 1AH9A 4DUYL 2UU9L 3EBEA 3CC4A 2YTVA 4UP8A 3J81c 4DR5Q 4NXMQ 1K3RA 1OXSC 4AQYL 3I4NG 3CCQA 2B63H 2OWOA 4JI6Q 2VY3A 1QVGA 3A5UA 4JBKA 1MKHA 4JCVE 4P72A 4C3HH 3GTJH 3GTGH 4A3DG 3NENA 4PMWA 2GVBA 4DNIA 2HHHL 3H0GG 2UUCL 4GKKL 1GD7A 3HKZG 4X62L 2N49A 2WAQG 1K8GA 4B3TL 4JI4Q 1V43A 1VQ9A 1M1KC 1RL2A 3PUVA 1KC8C 4AYBG 2Q2UA 3GTQH 1V1QA 2VQEQ 5IYDG 1HNXL 4GNXC 1N36L 5IYCG 1VCIA 5GROA 4A3LG 1OTCA 2F4VQ 4LF7Q 2Y0SE 1X9NA 1KRSA 2E2HH 3A5ZB 3F2CA 4JI1L 3W5OA 4JYAL 4J15A 4MZ9A 3W1GA 1SE8A 2WB1G 1TWGH 1PV4A 2VS1A 1YJWA 3S1MH 3B6YA 1QVFA 2UUAL 5FJ8H 5H1SE 4LF4L 5JJLA 3CCEA 1HZCA 4DR2Q 3F2DA 5EAYA 1N9WA 1A8VA 5M5XH 4HJ8A 4R4TA 1CKNA 2UXCL 5C3EG 1VS0A 1X55A 2EQSA 4LFBL 4DR5L 2I5LX 3BZKA 4NXML 2MQHA 4JC0A 1CKOA 3KJPA 3CCRA 3D31A 2K75A 4A3BH 4DAMA 4A76A 3KDFA 2K4KA 1TWHH 4LF6Q 4A3FH 1I94L 2E5LQ 2H5XA 1QUQB 2BH2A 4QJFA 2IX0A 1CUKA 2AWOA 4OWTB 2JE6I 3CPFA 4BA2I 2GN5A 1NTGA 2VQEL 1M90C 4B3RQ 2ATWA 2PI2E 2C35B 4LF7L 2ASBA 3CXCA 1IZ6A 1GO3E 4BBRH 3I2ZA 4A3MH 4Y52H 3CPWA 4BY7H 1TXYA 3PCOB 4KHZA 4P74A 3ULLA 2JA8H 4MTNA 2XTIA 3L2PA 4A3GH 4JOIA 4JV5Q 1EYGA 4KHPQ 5FJ8G 4DV3L 3HKSA 2JA7H 4DR2L 4IOCA 1N34Q 1E1TA 4BBSG 3ER0A 4B3SQ 2LSSA 4RG1A 3ERSX 2BH8A 1NMFA 2RCNA 3PGZA 3RR5A 4LWCA 4DR6Q 3CC7A 2R7FA 3TQYA 1WI5A 4R1JA 4YWKA 4Y7NH 5M3MH 1PYSB 4P75A 3CCUA 4A3BG 2K5NA 2PI2A 4POFA 4LF6L 1XNQQ 4GOPC 4L5RC 2AHOB 4A3FG 1U0LA 4UPAA 1UE7A 1XMOQ 4GNXA 4NXNL 1I3QH 4UP9A 1FGUA 1YJNA 2VL6A 1WFQA 1YHBA 3L0OA 4DR4Q 4YY3L 2LXJA 1UWVA 4B3RL 4PZ6A 1UE5A 2I0QA 5GQOA 1UE1A 2HT1A 4C3JH 4OX9L 3J81i 3HOWG 1PH4A 1N33Q 2N8NA 2Z6KC 3PUZA 2CKZB 4DKAC 1L1OC 2NN6G 5C0XJ 4BY7G 3PO2H 1VQ6A 1QZGA 2JA8G 1RIPA 3M4QA 4QIWE 2IX1A 3K81C 4KHPL 3AEVA 4GN4B 1B7YB 2B3GA 1Q82C 1LUZA 2R7DA 4K0KQ 1N34L 1YHQA 4IPHA 3HOUH 3VDYA 4GKKQ 4B3SL 1JT8A 4A93H 2NN6I 4DK6C 1K73C 2UXDQ 1Y1WG 2QA4A 3AYHB 2R6GA 1T9HA 1TWFH 4DV1Q 3KFUA 4DV6Q 3KDFB 4HJ5A 2GVAA 5M3MG 3KF8B 1VQFA 1PHJA 4JI5Q 5JEAG 1GVPA 5M3FG 3UDIA 4JBJA 1NE3A 4DK3C 3A74A 3E9HA 4APVA 1XMOL 1OXVA 1Q1BA 1SROA 1HR0Q 3S14H 4A3EH 3UDFA 4DR7Q 4DR4L 5JJIA 4GLAC 1SFOH 3HOWH 1K0RA 5M5YH 1N36Q 3FHWA 1BBWA 4A3JG 2MO1A 4JI2Q 3HOXG 2VQFQ 1N33L 3HOYG 4DV2L 2NVTH 2UXBQ 4B3MQ 1P16A 1J5EQ 1KQSA 1VQHA 1HH2P 3PO2G 1S3OA 4QQBX 3LGJA 1I50H 1FL0A 1AE2A 2JA9A 1SMXA 4OO1I 2JQOA 1HR0W 4K0KL 3U50C 4YWMA 1K83H 3IRBA 4IPGA 4QY7A 4HIKA 1UEBA 3G6EA 3HOVG 3S2HH 4BY1H 5IP9H 3PIOA 4A93G 1WCMH 1EIYB 3E9IA 1K9MC 5ELNA 4UP7A 3Q8DA 4GOPA 2QGQA 4GLVB 3GTKH 4DV1L 3CMEA 4DV6L 1VQKA 1KAWA 2R7ZH 4IOAA 5GADC 2ZM6Q 2PMZE 4JI5L 4JBWA 1A0IA 3F2BA 4GNXB 3F8TA 1S40A 3H3VH 1PH7A 3ULPA 5IWAL 2FXQA 3S2DH 4DR1Q 1G291 3L7ZC 1YNXA 4A3IG 3M9BA 4LF8Q 4P71A 2HIVA 3GD7A 1VQCA 4EX5A 5FLXc 4DR7L 1L1OA 2Q2HA 4OWWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K0X A;  1EUJ A;  3OTO Q;  2E8G A;  1BKB A;  3PUX A;  4JI2 L;  1SRU A;  4JI6 L;  2B63 G;  1L2F A;  2UXB L;  4B3M L;  1J5E L;  3UE1 A;  1Q86 C;  3STB C;  2ALY B;  2YU9 H;  3ICE A;  1VQO A;  2A8V A;  4PZ8 A;  1E24 A;  3M4P A;  4DV5 Q;  1HNW Q;  2A19 A;  2NZH A;  4JI4 L;  1SR3 A;  3K80 C;  3KF6 A;  2NZO A;  3CCL A;  2E2I H;  1S72 A;  3FKI H;  3NEM A;  1Q1E A;  3G4S A;  1EIF A;  2WFW A;  2BA0 A;  3GO5 A;  4RMF A;  1WCM G;  4YCV A;  4LFA Q;  4BY1 G;  2JA5 H;  3RZO H;  1TWA H;  2HQL A;  1ASY A;  2F4V L;  3E0E A;  1YIJ A;  4DR3 Q;  4GS3 A;  3T1Y Q;  2K5V A;  3AFP A;  4YCU A;  2N3S A;  4AH6 A;  3RLO A;  3ZJY C;  5C0X G;  2ES2 A;  2R7Z G;  3CQZ H;  2ZM6 L;  1VQ4 A;  4DV0 Q;  1IBL Q;  3UDG A;  2EIF A;  3TRE A;  3PO3 H;  2ZJP A;  2WP8 J;  4X65 Q;  2UUB Q;  4PZ7 A;  1L0W A;  4X6A H;  1YJ9 A;  2BA1 A;  2IY5 B;  4DR1 L;  1MJE A;  4LF8 L;  1PH5 A;  1VQB A;  1X3G A;  3AFQ A;  4YWL A;  5C0X I;  2CCZ A;  5DLQ E;  2R92 G;  2NVQ H;  1I5F A;  3HKZ E;  1EFW A;  3H3V I;  2A1A A;  4DUZ Q;  2MNA A;  2WAQ E;  1D8L A;  2DUD A;  3TS2 A;  3M85 A;  4JI7 Q;  4GLX A;  4AYB E;  1NBW A;  2E5L L;  1E3P A;  1YZ6 A;  3I56 A;  1HZA A;  1UE6 A;  3A0J A;  4DV5 L;  3TRZ A;  1HNW L;  2YTY A;  3RLF A;  2DGY A;  3RN5 A;  2AWN A;  3M3Y H;  1MJC A;  4OO1 G;  4UY8 C;  2JEA I;  4LF9 Q;  1X3E A;  3FKI G;  3STB D;  1FJG Q;  1IL2 A;  4GOP B;  5AJ3 Q;  2JA5 G;  1HNZ Q;  3S15 H;  2WB1 E;  5HGQ A;  5C4J H;  1VQN A;  1R9T H;  1PVO A;  3CC2 A;  1C0A A;  4DR3 L;  3T1Y L;  1EWI A;  1OXX K;  3PUW A;  1SLJ A;  4BBR G;  5J3B A;  4A3M G;  5GAG C;  1MIU A;  1JJG A;  4P73 A;  1VQI A;  2OQK A;  2K50 A;  5IP7 H;  1IBK Q;  1IBL L;  4DV0 L;  4IFD J;  2ZTC A;  4A3G G;  1A63 A;  4JV5 L;  2CQO A;  3PO3 G;  4X65 L;  1O7I A;  3U4Z A;  2Y0S G;  1WOC A;  3KOJ A;  2JA7 G;  3NEL A;  1L1O B;  2VZA A;  2OTL A;  3TS0 A;  1PH8 A;  1VQJ A;  4YHH Q;  1VQP A;  4L5S A;  4DR6 L;  1VQ5 A;  3J7Z C;  1SN8 A;  1KHI A;  4QL5 A;  4HID A;  2UU9 Q;  3DM3 A;  1VQL A;  4NB3 A;  3FP9 A;  1VQA A;  2OTJ A;  1EOV A;  4DUZ L;  3GTL H;  5LMN W;  1KRT A;  5ELO A;  5M5W H;  4JI7 L;  1XNQ L;  1VQD A;  2ZTE A;  3KF6 B;  2B29 A;  2KHI A;  3SGI A;  2N78 A;  4A4I A;  4B3T Q;  1ASZ A;  4LF9 L;  1FJG L;  1WJJ A;  1E22 A;  2D0P A;  3KLW A;  2NVY H;  5AJ3 L;  1C9O A;  4JG2 A;  4A3K H;  1YHA A;  4LUV A;  3RN2 A;  1PH9 A;  1HNZ L;  5IYD H;  1Q46 A;  3BZC A;  4O2D A;  1TWC H;  2R92 H;  1IYJ B;  1Q81 C;  3UDX A;  1JMC A;  1LYL A;  4JI1 Q;  3I7F A;  1IBK L;  3S16 H;  1U5K A;  4MNO A;  1LTL A;  4JI8 Q;  3KYH C;  1PH3 A;  2Q2T A;  1KIX A;  2QEX A;  5JJK A;  5GAE C;  3S1N H;  2RHS B;  4O0A A;  1J6Q A;  3G48 A;  3S24 A;  2L15 A;  1VQ7 A;  3HOU G;  1X56 A;  1PA6 A;  2MO0 A;  3PUY A;  2UXD L;  3CMA A;  2F52 A;  4YHH L;  4XIG S;  1XPO A;  1GM5 A;  5E7N A;  1AE3 A;  1HZ9 A;  1Y1V H;  4IJH A;  2JK8 A;  4POG A;  1I6H H;  1XTD A;  2JA6 H;  4FDB A;  3UE0 A;  4JBM A;  2HIX A;  4LF5 Q;  1QVC A;  5FLM H;  2I5H A;  3PF4 A;  3K7U C;  1JB7 A;  1IBM Q;  4BA1 I;  4R4O A;  3BU2 A;  2E2J H;  1X6O A;  2MFI A;  2OCE A;  1I94 Q;  5LMU Q;  3J80 i;  1HR0 L;  1X65 A;  3PV0 A;  4A3E G;  1VQ8 A;  3CCJ A;  2Z6K A;  1Q12 A;  1XPU A;  3JAM i;  1Z47 A;  3GTP H;  4L5Q A;  1Z9F A;  3CAM A;  5C4X H;  4A3K G;  3ULJ A;  1VQG A;  4HIO A;  3GDE A;  3K7A H;  3CD6 A;  2D62 A;  1N32 Q;  1NJI C;  2VQF L;  3J81 j;  4TQU S;  4KI0 A;  1YIT A;  3J7A 5;  1JJC B;  3M4O H;  1W2B A;  3I4O A;  4LUO A;  1QZH A;  4LUZ A;  1EQQ A;  2IHF A;  4NPS A;  1XJV A;  1KL9 A;  5JEA J;  4JI8 L;  5K36 G;  2IHE A;  4IPD A;  4DV3 Q;  3CCS A;  2CWP A;  3RNU A;  2KEN A;  3CW2 C;  4X64 Q;  4BBS H;  4BXX H;  5IP9 G;  2JJQ A;  1PFS A;  4XTC S;  4R4C A;  1YVC A;  2PQA B;  1Y1V G;  5IYB H;  2VUM H;  4IO9 A;  1E1O A;  3TEH B;  4OWX B;  2AMC B;  3I55 A;  1XPR A;  2JA6 G;  1VQE A;  2YYZ A;  4LF5 L;  4GKJ Q;  4IFD G;  5FLM G;  2KBN A;  1K8A C;  3J80 c;  1GKH A;  1IBM L;  1N8R C;  5LMU L;  3OYY A;  2D0O A;  2Q2I A;  3JAM c;  1Q7Y C;  4NXN Q;  1G6P A;  4C3I H;  3T1H Q;  3M7N A;  1D7Q A;  3HOZ G;  1OXT A;  4YY3 Q;  5HY6 A;  1CKM A;  1EQR A;  4IFD I;  2XGT A;  5C4X G;  3EIV A;  4DV7 Q;  3OTO L;  1N32 L;  4PG3 A;  1P8L A;  4LFC Q;  2KCM A;  4OX9 Q;  5BR8 Q;  1PH6 A;  1NMG A;  1NY4 A;  3GTM H;  3U58 A;  2Z0S A;  2ID0 A;  3S1Q H;  3G71 A;  3EN2 A;  3RLN A;  4DV4 Q;  2CFM A;  2JEB I;  3D0F A;  4JI0 Q;  3I4M H;  2R93 H;  1C7Y A;  2PNH A;  2NVX H;  2KCT A;  1VQM A;  4YCW A;  4QGU A;  1Q8K A;  4X64 L;  4BXX G;  2CWA A;  2RF4 A;  4LFA L;  4A3C H;  4WJ3 M;  3K8A A;  2F3I A;  4TVA B;  4OXP A;  3CCV A;  1YI2 A;  1JJ2 A;  5IE8 A;  3PIP A;  4LW1 A;  2I5M X;  2VW9 A;  1Y14 B;  1Y1W H;  5IYB G;  2EXD A;  2VUM G;  4JI3 Q;  1XNR Q;  4GN3 B;  2VNU D;  1WYD A;  5C44 H;  4GKJ L;  1LM0 A;  5LMN Q;  4WJ4 A;  2K5H A;  1B70 B;  3KJO A;  5M3F H;  2UUB L;  3HOZ H;  1HZB A;  2V1C C;  5IY0 A;  3AQQ A;  3U4V A;  3HFZ B;  4R4Q A;  3WWV A;  3DLL A;  1B8A A;  4X66 Q;  3T1H L;  1XMQ Q;  3MEF A;  4DUY Q;  4DV7 L;  4L5T A;  1FVI A;  3I4N H;  3BJU A;  4HJ7 A;  1YEZ A;  4IPC A;  4AQY Q;  4LFC L;  4A3J H;  3HOY H;  3HOX H;  2PQA A;  1V9P A;  3JC6 6;  4KLK A;  4R4I A;  4DV2 Q;  3PF5 A;  2YV5 A;  5BR8 L;  3H15 A;  3F1Z A;  4A3D H;  4HJ9 A;  2ZJQ A;  1OXU A;  2IT1 A;  3H0G H;  4H02 A;  3CCM A;  4DV4 L;  2HHH Q;  2UUC Q;  1E7Z A;  3CP0 A;  4X62 Q;  3OW2 A;  4JI0 L;  3GTO H;  3I4M G;  3W1B A;  4ALP A;  4HIM A;  2R93 G;  1PYB A;  1QUQ A;  1CKN B;  1BBU A;  4C2M H;  3HOV H;  2LXK A;  4IJL A;  2OQ0 A;  2ZJR A;  4A3C G;  2AKW B;  3MXN B;  3RZD H;  1PH2 A;  1HNX Q;  4DPG A;  1IXR A;  5IYC H;  3PSI A;  4LNQ A;  1DGS A;  1YBY A;  1PH1 A;  4A3L H;  4AIM A;  4JI3 L;  4OON A;  5IT9 c;  3S1R H;  2YTX A;  1XNR L;  1CSP A;  4HJA A;  2RHQ B;  1A62 A;  2K52 A;  4EQ5 A;  5IP7 G;  5C44 G;  1X54 A;  5LMN L;  4GN5 A;  4JYA Q;  2KHJ A;  1CSQ A;  1KXL A;  1H95 A;  2UUA Q;  3S17 H;  1KD1 C;  1G51 A;  4A75 A;  1HJP A;  4LF4 Q;  1JE5 A;  5IWA Q;  4LFB Q;  5GAH C;  4X66 L;  1BVS A;  2K14 A;  4A3I H;  1XMQ L;  4ME3 A;  1X3F A;  4DAY B;  3CF5 A;  1W3S A;  4JOI C;  3NBH B;  2ZTD A;  5C3E H;  2UXC Q;  1AH9 A;  4DUY L;  2UU9 L;  3EBE A;  3CC4 A;  2YTV A;  4UP8 A;  3J81 c;  4DR5 Q;  4NXM Q;  1K3R A;  1OXS C;  4AQY L;  3I4N G;  3CCQ A;  2B63 H;  2OWO A;  4JI6 Q;  2VY3 A;  1QVG A;  3A5U A;  4JBK A;  1MKH A;  4JCV E;  4P72 A;  4C3H H;  3GTJ H;  3GTG H;  4A3D G;  3NEN A;  4PMW A;  2GVB A;  4DNI A;  2HHH L;  3H0G G;  2UUC L;  4GKK L;  1GD7 A;  3HKZ G;  4X62 L;  2N49 A;  2WAQ G;  1K8G A;  4B3T L;  4JI4 Q;  1V43 A;  1VQ9 A;  1M1K C;  1RL2 A;  3PUV A;  1KC8 C;  4AYB G;  2Q2U A;  3GTQ H;  1V1Q A;  2VQE Q;  5IYD G;  1HNX L;  4GNX C;  1N36 L;  5IYC G;  1VCI A;  5GRO A;  4A3L G;  1OTC A;  2F4V Q;  4LF7 Q;  2Y0S E;  1X9N A;  1KRS A;  2E2H H;  3A5Z B;  3F2C A;  4JI1 L;  3W5O A;  4JYA L;  4J15 A;  4MZ9 A;  3W1G A;  1SE8 A;  2WB1 G;  1TWG H;  1PV4 A;  2VS1 A;  1YJW A;  3S1M H;  3B6Y A;  1QVF A;  2UUA L;  5FJ8 H;  5H1S E;  4LF4 L;  5JJL A;  3CCE A;  1HZC A;  4DR2 Q;  3F2D A;  5EAY A;  1N9W A;  1A8V A;  5M5X H;  4HJ8 A;  4R4T A;  1CKN A;  2UXC L;  5C3E G;  1VS0 A;  1X55 A;  2EQS A;  4LFB L;  4DR5 L;  2I5L X;  3BZK A;  4NXM L;  2MQH A;  4JC0 A;  1CKO A;  3KJP A;  3CCR A;  3D31 A;  2K75 A;  4A3B H;  4DAM A;  4A76 A;  3KDF A;  2K4K A;  1TWH H;  4LF6 Q;  4A3F H;  1I94 L;  2E5L Q;  2H5X A;  1QUQ B;  2BH2 A;  4QJF A;  2IX0 A;  1CUK A;  2AWO A;  4OWT B;  2JE6 I;  3CPF A;  4BA2 I;  2GN5 A;  1NTG A;  2VQE L;  1M90 C;  4B3R Q;  2ATW A;  2PI2 E;  2C35 B;  4LF7 L;  2ASB A;  3CXC A;  1IZ6 A;  1GO3 E;  4BBR H;  3I2Z A;  4A3M H;  4Y52 H;  3CPW A;  4BY7 H;  1TXY A;  3PCO B;  4KHZ A;  4P74 A;  3ULL A;  2JA8 H;  4MTN A;  2XTI A;  3L2P A;  4A3G H;  4JOI A;  4JV5 Q;  1EYG A;  4KHP Q;  5FJ8 G;  4DV3 L;  3HKS A;  2JA7 H;  4DR2 L;  4IOC A;  1N34 Q;  1E1T A;  4BBS G;  3ER0 A;  4B3S Q;  2LSS A;  4RG1 A;  3ERS X;  2BH8 A;  1NMF A;  2RCN A;  3PGZ A;  3RR5 A;  4LWC A;  4DR6 Q;  3CC7 A;  2R7F A;  3TQY A;  1WI5 A;  4R1J A;  4YWK A;  4Y7N H;  5M3M H;  1PYS B;  4P75 A;  3CCU A;  4A3B G;  2K5N A;  2PI2 A;  4POF A;  4LF6 L;  1XNQ Q;  4GOP C;  4L5R C;  2AHO B;  4A3F G;  1U0L A;  4UPA A;  1UE7 A;  1XMO Q;  4GNX A;  4NXN L;  1I3Q H;  4UP9 A;  1FGU A;  1YJN A;  2VL6 A;  1WFQ A;  1YHB A;  3L0O A;  4DR4 Q;  4YY3 L;  2LXJ A;  1UWV A;  4B3R L;  4PZ6 A;  1UE5 A;  2I0Q A;  5GQO A;  1UE1 A;  2HT1 A;  4C3J H;  4OX9 L;  3J81 i;  3HOW G;  1PH4 A;  1N33 Q;  2N8N A;  2Z6K C;  3PUZ A;  2CKZ B;  4DKA C;  1L1O C;  2NN6 G;  5C0X J;  4BY7 G;  3PO2 H;  1VQ6 A;  1QZG A;  2JA8 G;  1RIP A;  3M4Q A;  4QIW E;  2IX1 A;  3K81 C;  4KHP L;  3AEV A;  4GN4 B;  1B7Y B;  2B3G A;  1Q82 C;  1LUZ A;  2R7D A;  4K0K Q;  1N34 L;  1YHQ A;  4IPH A;  3HOU H;  3VDY A;  4GKK Q;  4B3S L;  1JT8 A;  4A93 H;  2NN6 I;  4DK6 C;  1K73 C;  2UXD Q;  1Y1W G;  2QA4 A;  3AYH B;  2R6G A;  1T9H A;  1TWF H;  4DV1 Q;  3KFU A;  4DV6 Q;  3KDF B;  4HJ5 A;  2GVA A;  5M3M G;  3KF8 B;  1VQF A;  1PHJ A;  4JI5 Q;  5JEA G;  1GVP A;  5M3F G;  3UDI A;  4JBJ A;  1NE3 A;  4DK3 C;  3A74 A;  3E9H A;  4APV A;  1XMO L;  1OXV A;  1Q1B A;  1SRO A;  1HR0 Q;  3S14 H;  4A3E H;  3UDF A;  4DR7 Q;  4DR4 L;  5JJI A;  4GLA C;  1SFO H;  3HOW H;  1K0R A;  5M5Y H;  1N36 Q;  3FHW A;  1BBW A;  4A3J G;  2MO1 A;  4JI2 Q;  3HOX G;  2VQF Q;  1N33 L;  3HOY G;  4DV2 L;  2NVT H;  2UXB Q;  4B3M Q;  1P16 A;  1J5E Q;  1KQS A;  1VQH A;  1HH2 P;  3PO2 G;  1S3O A;  4QQB X;  3LGJ A;  1I50 H;  1FL0 A;  1AE2 A;  2JA9 A;  1SMX A;  4OO1 I;  2JQO A;  1HR0 W;  4K0K L;  3U50 C;  4YWM A;  1K83 H;  3IRB A;  4IPG A;  4QY7 A;  4HIK A;  1UEB A;  3G6E A;  3HOV G;  3S2H H;  4BY1 H;  5IP9 H;  3PIO A;  4A93 G;  1WCM H;  1EIY B;  3E9I A;  1K9M C;  5ELN A;  4UP7 A;  3Q8D A;  4GOP A;  2QGQ A;  4GLV B;  3GTK H;  4DV1 L;  3CME A;  4DV6 L;  1VQK A;  1KAW A;  2R7Z H;  4IOA A;  5GAD C;  2ZM6 Q;  2PMZ E;  4JI5 L;  4JBW A;  1A0I A;  3F2B A;  4GNX B;  3F8T A;  1S40 A;  3H3V H;  1PH7 A;  3ULP A;  5IWA L;  2FXQ A;  3S2D H;  4DR1 Q;  1G29 1;  3L7Z C;  1YNX A;  4A3I G;  3M9B A;  4LF8 Q;  4P71 A;  2HIV A;  3GD7 A;  1VQC A;  4EX5 A;  5FLX c;  4DR7 L;  1L1O A;  2Q2H A;  4OWW B; 
#chains in the Genus database with same CATH topology
 1BKB A;  5E1F A;  1SRU A;  2HQE A;  5M5W B;  2EY5 A;  4CKE A;  3A8K E;  3KF8 A;  4RH6 A;  4CJ1 B;  1VQO A;  2A8V A;  3J81 L;  1E24 A;  2A19 A;  4RGM A;  2XNA C;  3CCL A;  2TSS A;  3FMC A;  4N9T A;  4BY1 G;  2JA5 H;  1VF5 C;  1WCM G;  1B3Q A;  1TWA H;  1ASY A;  5A2Q E;  1YIJ A;  3HG9 A;  1FD7 D;  3GV6 A;  2N3S A;  1EU4 A;  2ZM6 L;  3NTK A;  3EA6 A;  2XWB B;  4E6I A;  3S1N B;  2KEC A;  2ZJP A;  2A69 C;  1GXD C;  5DM6 3;  4IZ8 A;  4DR1 L;  3NQT A;  1X3G A;  4KTA A;  4DF7 A;  2AQ2 B;  3A56 A;  2L55 A;  1DZ1 A;  1EFW A;  5TSS A;  4DUZ Q;  2DUD A;  5CV9 A;  5ELB A;  3TS2 A;  2E2J B;  1LTR D;  1S5F D;  2E5L L;  1V1P B;  1YZ6 A;  1UE6 A;  4ZUI A;  1HNW L;  3L3O C;  2YTY A;  3DMU A;  2DGY A;  1MJC A;  4XXE A;  3FKI G;  2F3V A;  2B2U A;  5AJ3 Q;  1HNZ Q;  2F0Q A;  2WB1 E;  5HGQ A;  3MTS A;  1R9T H;  1G2T A;  1C0A A;  4DR3 L;  1EWI A;  1LV9 A;  1SLJ A;  5GAG C;  1PFB A;  5IP7 H;  1IBL L;  2DNC A;  4DV0 L;  3QOL A;  5M9O A;  4IFD J;  4JV5 L;  2TMP A;  2F0O A;  3U4Z A;  2Y0S G;  2E2I B;  2LY7 A;  3FPP A;  3VYU A;  2SEB D;  4DR6 L;  1MSH A;  1CTM A;  2PZU A;  4QL5 A;  4HID A;  4I7Z C;  3FP9 A;  1VQA A;  1SSO A;  1EEF D;  4LAA A;  1S5D D;  2L9H A;  4Z9C B;  5LHY 1;  1Q3L A;  1Z7T A;  1DD2 A;  1TQO A;  5J39 A;  3SK5 A;  3BS1 A;  3NUC A;  2KHI A;  3FPU B;  2XVS A;  4G7Z C;  2RA4 A;  1WJJ A;  5IOC A;  1LT3 D;  4OO1 G;  3KBX A;  3LX0 A;  5IYD H;  3RN2 A;  1TS4 A;  1Q46 A;  3BZC A;  5C3W A;  1Q81 C;  1LYL A;  1GUG A;  4JI1 Q;  2F0U A;  3K57 A;  4EGV A;  3S16 H;  2K28 A;  4MNO A;  4IUQ A;  3KYH C;  1PH3 A;  2Q2T A;  1KIX A;  2QEX A;  5JJK A;  5CC4 A;  4O0A A;  1J6Q A;  2L15 A;  1VQ7 A;  1EQV A;  3HOU G;  5IGB A;  4ZQ3 A;  2UXD L;  3TP7 A;  2F52 A;  5BN3 A;  4YHH L;  2A6E C;  1XPO A;  1AE3 A;  1HZ9 A;  5C44 B;  2JA6 H;  1EEI D;  1BDO A;  1WTW A;  3UE0 A;  4JBM A;  4H13 C;  5C4H A;  3PF4 A;  3K7U C;  2PYK A;  1X6O A;  5DM7 3;  5LMU Q;  1I94 Q;  4DXF A;  1WTV A;  4A3E G;  3MXG A;  1RCV D;  2C9O A;  1Q12 A;  1XPU A;  5HGT A;  4L5Q A;  4IUN A;  1Z9F A;  4A3K G;  3GDE A;  3HOY B;  1N32 Q;  2C5C A;  2FFK B;  1D2B A;  4G7H C;  3I4O A;  1S5B D;  3QOJ A;  1ICF B;  2IHF A;  2MPM A;  4TSS A;  4K6D A;  5KEE A;  4HMI A;  2KEN A;  3GTP B;  1BOS A;  4X64 Q;  4BXX H;  1DJR D;  2K05 A;  4JW0 A;  4R4C A;  3S1R B;  5CV5 A;  3IFD A;  1Y1V G;  3MFG A;  3J81 E;  4FF1 A;  4LJZ C;  2F0H A;  4IFD G;  2KBN A;  1K8A C;  3OYY A;  2Q2I A;  5JPN C;  4K6L A;  4DAV A;  4C3I H;  4H44 C;  5HY6 A;  3X3N A;  1EQR A;  4OL7 A;  5C4X G;  4DAY A;  1TVX A;  1P8L A;  1QJO A;  2KCM A;  4OX9 Q;  1JOO A;  3V05 A;  1PH6 A;  1MD2 D;  1I4X A;  1NMG A;  4HTH A;  1IYU A;  1HPC A;  3S1Q H;  3HGB A;  2CFM A;  2JEB I;  2QKI C;  3D0F A;  2PNH A;  2KCT A;  1VQM A;  1RDP D;  4YCW A;  2IWH A;  1VDZ A;  2E75 C;  3IKJ A;  1JJ2 A;  2HD3 A;  4DAP A;  3PIP A;  4DK1 A;  3TN2 A;  3DWP A;  5IYB G;  1CA6 A;  1WTH A;  1KLG D;  1FNU A;  1UUP A;  5JEA H;  2IX3 A;  4X3T A;  2V1C C;  3AQQ A;  3DLL A;  1AEX A;  3T1H L;  4RKL A;  4DV7 L;  4IPC A;  3JC6 6;  2OT2 A;  2O2L D;  1FR3 A;  3EFX D;  1TWH B;  4A3F B;  1O80 A;  1A3T A;  3H0G H;  2HHH Q;  4DV4 L;  1E7Z A;  4JI0 L;  3I4M G;  2R93 G;  1EIH A;  3W1B A;  4PNY A;  2LXK A;  2AKW B;  5IYC H;  5EBD A;  1YBY A;  2PQE A;  1PH1 A;  4BY7 B;  4JI3 L;  3MHB A;  1XNR L;  2YTX A;  3I4L A;  1A62 A;  2DJF C;  4ZAI A;  1CZW A;  4EQ5 A;  5LMN L;  2EJF C;  4JYA Q;  4A3G B;  2KHJ A;  1CSQ A;  1ET9 A;  3VR6 A;  2UUA Q;  4DU9 A;  1KD1 C;  5IWA Q;  2NTS A;  4FF2 A;  4X66 L;  2EY2 A;  3CF5 A;  5E4W C;  1M8A A;  1W3S A;  2RDG A;  5JVH 3;  4ZYS A;  2YTV A;  3I4N G;  1A15 A;  5CMD A;  3A5U A;  1QVG A;  4JBK A;  5M3F B;  4A3D G;  3GTJ H;  3K5L A;  3NEN A;  2J4X A;  1GD7 A;  1OO9 B;  1EQT A;  3HKZ G;  2EJG C;  1ZEQ X;  2WAQ G;  1K8G A;  2EY1 A;  4JI4 Q;  1RL2 A;  2JXM B;  3PUV A;  2Q2U A;  3C46 A;  3P7J A;  3DHQ A;  3HOX B;  4FYD A;  1ML0 D;  1OTC A;  2F4V Q;  4LF7 Q;  5E3F A;  1X9N A;  1KRS A;  3PO2 B;  3A5Z B;  3NTI A;  1SXT A;  4JI1 L;  3W5O A;  4PMC A;  3W1G A;  4L8J A;  1PV4 A;  2VS1 A;  5FJ8 H;  3BZD B;  2R3Z A;  4LF4 L;  3CCE A;  3QWN A;  3G7L A;  1RD9 D;  1N9W A;  1A8V A;  4HJ8 A;  1SJE D;  5IIF A;  4CGY B;  1SND A;  1D5X C;  5C3E G;  2EQS A;  1H9S A;  3BZK A;  1W6J A;  2MQH A;  2OF1 A;  4ZKC B;  1H9M A;  2DJG C;  3E5S A;  4EQN A;  5IGF A;  4B9X A;  2F0N A;  3VA7 A;  3PIP 3;  4KJN A;  2XN9 C;  1I94 L;  1A2T A;  1QUQ B;  4A3I B;  3I73 A;  5M5Y B;  2AWO A;  2M2L A;  2JE6 I;  2F0K A;  1CQF A;  2GN5 A;  1NTG A;  5ELE A;  2VQE L;  3EJI A;  5ISR A;  1WTX A;  2ATW A;  3VA5 A;  1SE2 A;  3RMH A;  4HSV A;  4KN4 C;  4A3M H;  3BG3 A;  1TXY A;  1B53 A;  3PCO B;  4KHZ A;  5CGK A;  2JA8 H;  3R93 A;  3L2P A;  5FOB B;  1U4L A;  1V1O A;  2ZXR A;  4BY1 B;  1WCM B;  1E1T A;  1SEB D;  3GV3 A;  1Y69 U;  1PTO B;  5FLX E;  2BDN A;  3GTK B;  2LS0 1;  2JN4 A;  5M3M H;  1PYS B;  4P75 A;  3OIP A;  3TP8 A;  1XNQ Q;  4L5R C;  2AHO B;  4UPA A;  1EYA A;  2SNS A;  1FGU A;  3W3A A;  1YJN A;  3T53 B;  1YHB A;  3ND9 A;  4B3R L;  4KMU C;  1UE1 A;  4OX9 L;  1LT6 D;  1PH4 A;  1ONL A;  2Z6K C;  2CKZ B;  5KYL A;  1L1O C;  5C0X J;  4PQX A;  1VQ6 A;  1B7Y B;  2B3G A;  4K0K Q;  2R7D A;  1N34 L;  3FKI B;  3VDY A;  1TR5 A;  3RZO B;  4B3S L;  1B9M A;  1JT8 A;  2NN6 I;  2RQX A;  4ZCK A;  1Y1W G;  4K2K A;  2QEJ C;  3CQZ B;  2GVA A;  3KF8 B;  1PHJ A;  2Y0S B;  4F88 A;  1GVP A;  4GZY C;  2NUC A;  1LAB A;  4RWS C;  4F8M A;  4RCO A;  2F0I A;  3KLR A;  1HR0 Q;  1EU3 A;  2NVQ B;  2Z4I A;  1QE6 A;  2PPB C;  1O7Z A;  3J7Y W;  1ROD A;  3LWU A;  2VQF Q;  3V96 A;  3HOY G;  3D4D A;  1P16 A;  1KQS A;  4ABN A;  4OO1 I;  3U50 C;  3IRB A;  2WV6 D;  2EE1 A;  4IPG A;  3DXJ C;  4QY7 A;  2KUM A;  2NTT A;  4HIK A;  3HOV G;  3S15 B;  1EYD A;  5IP9 H;  4A93 G;  5C5M A;  1K9M C;  3Q8D A;  4CKC A;  4DV1 L;  3CME A;  2DY7 A;  4DV6 L;  5GAD C;  2QDL A;  2ZM6 Q;  4JBW A;  1DON A;  1AN8 A;  3HOU B;  1W6K A;  5IWA L;  2FXQ A;  3S2D H;  3KK7 A;  4DR1 Q;  1YNX A;  4DR7 L;  1Q8I A;  1L1O A;  1N36 L;  2A6H D;  1EUJ A;  2DNE A;  1HFN A;  2CVR A;  3OTO Q;  1EY4 A;  3PUX A;  3NE5 B;  4DXG A;  2Z4H A;  4B3M L;  1J5E L;  3DEP A;  3STB C;  5A2Q L;  2ALY B;  4CKB A;  2L11 A;  4KK7 A;  1ICW A;  4A3E B;  1HNW Q;  4JI4 L;  1SR3 A;  3K80 C;  3K6O A;  1QB5 D;  4A3K B;  2E2I H;  3G4S A;  2WFW A;  4YCV A;  2K5Q A;  5IOD A;  4HR7 B;  1J8I A;  2F4V L;  4K5V A;  4DR3 Q;  4GS3 A;  3OPO A;  5IGD A;  1QIL A;  3CRL C;  1EZ8 A;  3ZJY C;  5C0X G;  2ES2 A;  1PRT C;  1IBL Q;  5G3L F;  4O1N A;  4DV0 Q;  2P5Z X;  2EIF A;  3TRE A;  2WP8 J;  1L0W A;  4QIW B;  1ILP A;  4LF8 L;  1L0Y B;  1PH5 A;  3NXW A;  4YWL A;  2CCZ A;  5DLQ E;  2R92 G;  1A3U A;  1Y1V B;  1I5F A;  1D1K A;  2ZT9 C;  5FO9 B;  3I91 A;  5ELD A;  1D8L A;  1BUV T;  1KDA A;  3M85 A;  2EYL A;  4X3U A;  4AYB E;  2DN8 A;  1E3P A;  3CHB D;  5CV4 A;  4KKS A;  3MWY W;  4UY8 C;  5C4X B;  4EQP A;  1X3E A;  1IL2 A;  5G3L D;  4GOP B;  2JA5 G;  3D4W A;  1VQN A;  1HUN A;  1C8C A;  1OXX K;  2EPB A;  1R4P B;  3PUW A;  1MIU A;  1JJG A;  2XIW A;  1VQI A;  4P73 A;  1ENC A;  2K50 A;  2OQK A;  3TDQ A;  2ZTC A;  4A3G G;  1QWY A;  4IUV A;  4X65 L;  4UHV A;  3KOJ A;  4V19 0;  3NEL A;  4BBS B;  5CV7 A;  2VZA A;  3TZU A;  2QCP X;  1U4M A;  3WOE A;  1VQJ A;  4YHH Q;  1VQP A;  2A69 D;  1KHI A;  2CH4 A;  3E0J A;  3DM3 A;  4NB3 A;  1R4Q B;  3GTL H;  4N8F A;  1KRT A;  5ELO A;  4RGT A;  3OMG A;  1XNQ L;  1SE3 A;  4G57 A;  3KF6 B;  2PMZ B;  3Q0A A;  3SGI A;  2WII B;  2K04 A;  1GUS A;  3KLW A;  3QG1 A;  2NVY H;  3OWF A;  1YHA A;  3VYT A;  2QIL A;  4C3J G;  1TWC H;  1I4P A;  1IYJ B;  3GTM B;  3UDX A;  1JMC A;  1U5K A;  3I4M B;  2R93 B;  1LTL A;  1BQQ T;  2NBF A;  4N9P A;  1BNZ A;  1STB A;  3G48 A;  3S24 A;  1IHZ A;  1YNJ C;  2MO0 A;  2MP1 A;  2D2C C;  5E7N A;  2LFN A;  4IJH A;  4POG A;  1QNK A;  4I65 A;  2HIX A;  1AW7 A;  5FLM H;  5IGC A;  2KCN A;  4BA1 I;  3BU2 A;  1KDB A;  3J80 i;  1HR0 L;  1BR9 A;  3PV0 A;  1VQ8 A;  3VR4 A;  1MHW C;  3JAM i;  1Z47 A;  1II3 A;  2BE5 D;  3FEW X;  4HED A;  2E76 C;  3I4N B;  1VQG A;  3A54 A;  3K7A H;  2SOB A;  4OIJ A;  2VQF L;  2F0G A;  1NJI C;  4TQU S;  4RHS A;  4A3D B;  5FO7 B;  1JB3 A;  1YIT A;  3M4O H;  3HKZ B;  3GTO B;  1KL9 A;  5JEA J;  1SE4 A;  2WAQ B;  2IHE A;  4DV3 Q;  1MBY A;  4MTK A;  3RZD B;  4QB4 A;  4N8X 1;  2IL8 A;  1YVC A;  2VUM H;  1E1O A;  3TEH B;  2JA6 G;  2AMC B;  2YYZ A;  4LK1 C;  4LF5 L;  3S17 B;  1EY9 A;  4QUC A;  3J80 c;  1GKH A;  1IBM L;  1V8Q A;  4Q0F A;  2EYP A;  2AUK A;  3A7A B;  1YNN C;  1B4O A;  3JAM c;  2F0W A;  5C3E B;  3WOF A;  3X3M A;  3T1H Q;  1OXT A;  1I6H B;  2EOT A;  4DV7 Q;  3OTO L;  3K59 A;  2B63 B;  3NBH A;  4PG3 A;  2A68 D;  4WFN 3;  3GTG B;  1NY4 A;  3T4A C;  4G4K A;  1SYD A;  3EN2 A;  3RLN A;  4DV4 Q;  4JI0 Q;  1C7Y A;  1CA5 A;  2NVX H;  4OEL B;  5ELF A;  4F7X A;  3ZYY X;  1UEA B;  4RAU C;  2I07 B;  4BXX G;  4FXK C;  4A3C H;  4TVA B;  4OXP A;  4EQO A;  5IE8 A;  4FNF A;  1DOM A;  2F0D A;  2KVM A;  4JI3 Q;  1FYC A;  1XNR Q;  2VNU D;  2QW7 A;  3E6Z X;  5LMN Q;  3NK9 A;  5M3F H;  3T13 A;  5M5X B;  1SDF A;  3HFZ B;  4R4Q A;  3PMF A;  4C3I G;  1F9R A;  4X66 Q;  3MEF A;  4MHE A;  1T5X D;  3HOX H;  2PQA A;  4R4I A;  3PF5 A;  4DV2 Q;  5EKL A;  3H15 A;  1ILQ A;  4HJ9 A;  2ZJQ A;  4RGN A;  1LT4 D;  1OXU A;  3CP0 A;  3LNN A;  1HRJ A;  1TT2 A;  4J1M A;  4ALP A;  3K5N A;  5ELC A;  1I4G A;  4C2M H;  4IJL A;  2OQ0 A;  3MXN B;  4LNQ A;  2H4O A;  3PSI A;  4AIM A;  4OON A;  1H9J A;  1CSP A;  4HJA A;  2RHQ B;  4GN5 A;  3SVM A;  1G51 A;  4LF4 Q;  4M8A A;  1STN A;  2K14 A;  4A3I H;  1Y1W B;  4JOI C;  3EBE A;  4WOR A;  4Y7N B;  4UP8 A;  1K0S A;  2O5J C;  1OXS C;  2NZ1 D;  1ZXT A;  3CCQ A;  2OWO A;  1F2Y A;  3C1F A;  5BN4 A;  1EFI D;  4JCV E;  4P72 A;  4C3H H;  1HCZ A;  4DNI A;  1PZJ D;  3H0G G;  2UUC L;  1I3Q B;  4OEM B;  4XT3 B;  2WKD A;  1M1K C;  1KC8 C;  3GTQ H;  4KD4 A;  2VQE Q;  4GNX C;  5IYC G;  1CHQ D;  1CQV A;  1PTO H;  2E2H H;  1SNQ A;  3VR2 A;  3K5M A;  1LTG D;  2LKV A;  4J15 A;  2WB1 G;  1YJW A;  3S1M H;  3B6Y A;  3KLS X;  1EZ6 A;  1H9R A;  5JJL A;  3HOV B;  1HQM C;  4A93 B;  1VS0 A;  1TWF B;  4DR5 L;  2I5L X;  4NXM L;  3D31 A;  2K75 A;  4A3B H;  4DAM A;  2KQ3 A;  1F9P A;  1L0X B;  2NYZ D;  1VF7 A;  2IX0 A;  1AZQ A;  4B3R Q;  2ICI A;  2K32 A;  2PI2 E;  2C35 B;  2Q8R E;  2G9D A;  2L0C A;  5FLX L;  2NN6 H;  5KND A;  4MTN A;  2ZXO A;  4JOI A;  3VYR A;  1EYG A;  4DGZ A;  5FJ8 G;  1STY A;  4DV3 L;  3HKS A;  1N34 Q;  4R8N A;  5KYI A;  1KAB A;  4BBS G;  3ER0 A;  1JWS D;  4B3S Q;  3EVQ A;  5A35 A;  1NMF A;  2RCN A;  3PGZ A;  5JOB A;  4LWC A;  3TQY A;  5HUR A;  3NSW A;  4YWK A;  2SDF A;  1HQR D;  1HTP A;  3M7G A;  4XQQ A;  1TWG B;  1K8M A;  5CYU A;  3CCU A;  2K5N A;  2PI2 A;  4POF A;  4IUP A;  4KN7 C;  1XX8 A;  4FP5 D;  2M9V A;  4GNX A;  3Q23 A;  1WTP A;  2R92 B;  1IKL A;  4EVO A;  1CM9 A;  1B50 A;  4OO1 H;  3D6C A;  3ND8 A;  2HT1 A;  1XTC D;  2F0J A;  3OIQ A;  1A6X A;  2N8N A;  3C3L A;  2JA8 G;  1CI3 M;  2IX1 A;  1JIC A;  1LUZ A;  3J80 E;  1YHQ A;  4IPH A;  3HOU H;  2JA5 B;  1Y8P B;  3JAM E;  1TWA B;  1B2T A;  5CBA E;  2N88 A;  5J22 A;  1T9H A;  4DV1 Q;  3KFU A;  4DV6 Q;  1ZKO A;  3KDF B;  4ZKB B;  5M3M G;  4NKL A;  2K6A A;  1JC7 A;  3OMC A;  4C56 C;  2F0L A;  4JBJ A;  4DK3 C;  1XMO L;  4APV A;  1Q1B A;  4U67 3;  2FIN B;  4A3E H;  3MEH A;  5D65 A;  2B2W C;  3UDF A;  4DR4 L;  4DR7 Q;  3HOW H;  4RFB A;  1N36 Q;  4P2C B;  3HS0 C;  4A3J G;  2MO1 A;  1B3A A;  1N33 L;  3SK6 A;  3A8I E;  4DV2 L;  1BCP B;  2NVT H;  4B3M Q;  1J5E Q;  3OHX C;  5JPM C;  2EZV A;  3LGJ A;  4CDC C;  1E2Z A;  3I3C A;  4XQN A;  2FJ2 A;  1V1P A;  3A55 A;  4RGO S;  1BCP F;  2F0P A;  4ID6 A;  3S2H H;  4L6T B;  5C4Z A;  3PQI A;  2HCC A;  4C3J B;  1SNO A;  3E9I A;  2Q8I B;  3FRP B;  1MI2 A;  4MN3 A;  5D14 A;  5KIX A;  2VXW A;  2R7Z H;  3F8T A;  5EGT A;  2G5D A;  2FMM A;  1CK1 A;  4LF8 Q;  3M9B A;  1PFN A;  3GD7 A;  2KHS A;  4DA2 A;  2Q2H A;  2E8G A;  3SXH A;  2B63 G;  4UAI A;  1IW7 D;  1BCP D;  1NNX A;  1LTA D;  2UXB L;  2EYF A;  3UE1 A;  5DAU A;  4DN4 M;  2YU9 H;  3ICE A;  2QDB A;  3M4P A;  2D5D A;  2NZH A;  3D6W A;  3CKI B;  2KCC A;  2I46 A;  2BA0 A;  4LFA Q;  1GOZ A;  5EKK A;  2HQL A;  4YCU A;  4R8I A;  2KEE A;  4AH6 A;  5LL6 X;  1I50 B;  3RLO A;  1JWM D;  2XSC A;  3UDG A;  3ERQ A;  2XWJ B;  3PO3 H;  1K83 B;  4X65 Q;  2GA4 B;  1YJ9 A;  2BA1 A;  1MJE A;  4BWG B;  2BDO A;  2RSO A;  3AFQ A;  2B2Y C;  3T56 B;  5T1G A;  3K58 A;  2JA6 B;  3H3V I;  4IQZ A;  1SYB A;  2A1A A;  4RA8 A;  4NDX A;  2KOL A;  1DOK A;  1HZA A;  3A0J A;  4DV5 L;  2AWN A;  1TS3 A;  3M3Y H;  1RJT A;  3NP8 A;  3STB D;  5IGE A;  1S5C D;  2EYJ A;  1PVO A;  3CC2 A;  2B39 A;  3N6R A;  3T1Y L;  4BBR G;  5J3B A;  3TZD A;  3Q22 A;  1CT1 D;  2XRQ D;  5EKI A;  1E2V A;  1D5M C;  1O7I A;  2CQA A;  2JA7 G;  1F2Z A;  2OTL A;  1QNU A;  1LAC A;  1VQ5 A;  3J7Z C;  2PNR C;  2OXP A;  2OTJ A;  5LMN W;  1JOR A;  5J1Z A;  5M5W H;  4JI7 L;  2SNM A;  1VQD A;  4RHR A;  2ZTE A;  4C3I B;  2B29 A;  1ASZ A;  2PZT A;  5EJW A;  4LF9 L;  1FJG L;  1E22 A;  2D0P A;  1C9O A;  3SHL A;  3H94 A;  4O2D A;  2R92 H;  2AUJ D;  4ZRZ A;  1STG A;  3S1Q B;  3I7F A;  1IBK L;  5E4X A;  2DY8 A;  3A7L A;  2B2Y A;  5T1I A;  5K36 H;  1G2S A;  5GAE C;  3S1N H;  2RHS B;  4QMG A;  1ENA A;  1X56 A;  1PA6 A;  1QG7 A;  5C4J B;  2CW0 C;  4B9W A;  3CMA A;  4XIG S;  1I6H H;  3BDO A;  1XTD A;  3AB9 A;  4FDB A;  4LF5 Q;  5FKA C;  2I5H A;  1JB7 A;  3C2P A;  1IBM Q;  2E2J H;  2OCE A;  2MFI A;  3U9S A;  2KA7 A;  1X65 A;  1U4P A;  2Z6K A;  3IL8 A;  3MFY A;  1KTK A;  2RDF A;  3CAM A;  3ULJ A;  4FF3 A;  1F9S A;  2WIN B;  1PFM A;  4KI0 A;  3J7A 5;  3H91 A;  2E74 C;  3H0G B;  1QZH A;  1D1I A;  3W2D A;  1XJV A;  4JI8 L;  5I2Y A;  1XXG A;  5C3X A;  2ENB A;  2CWP A;  3RNU A;  1AZP A;  1EIG A;  2JJQ A;  1PFS A;  3RD4 A;  1HA6 A;  1VMP A;  1SAP A;  4XTC S;  4DFA A;  2PQA B;  4IO9 A;  1TKW B;  2WB1 B;  4OWX B;  5KRU A;  1XPR A;  5FLM G;  1SYG A;  5KNC A;  3QIA A;  1I6V C;  2F3W A;  2D0O A;  3OOC A;  1Q7Y C;  1NR4 A;  1D6E C;  3CU7 A;  4MIU A;  3M7N A;  2B8G A;  3HOZ G;  2EVB A;  1CKM A;  4IFD I;  3O13 A;  2RBM A;  3GTJ B;  2HCI A;  4U68 A;  4KKU A;  1CHP D;  3TME A;  3U58 A;  4J8Q A;  2ID0 A;  2MGS A;  2Z0S A;  1PTO C;  3BYY B;  3G71 A;  1B9N A;  1MSG A;  1Q8K A;  2CWA A;  4LFA L;  1G8Z D;  2F3I A;  3CCV A;  1YI2 A;  1EY7 A;  1Y1W H;  2VW9 A;  2JYO A;  2VUM G;  1IL8 A;  4C1N I;  1H9K A;  1JWU D;  4GN3 B;  2IPK D;  5C44 H;  4GKJ L;  3Q6S A;  1HZB A;  5IY0 A;  3WWV A;  3QO2 A;  4FO2 A;  1RTN A;  3I8Z A;  1FVI A;  1KLU D;  1LTI D;  1YEZ A;  4HCE A;  1JQY D;  4LFC L;  3HOY H;  4K8J A;  4KLK A;  1V9P A;  4ILW A;  1G91 A;  5BR8 L;  1PMR A;  3VR5 A;  5EBC A;  1H95 A;  2UUC Q;  1RKN A;  2F03 A;  4WJW A;  1PYB A;  1QUQ A;  1BBU A;  3HOV H;  4YIJ A;  4A3C G;  1SYE A;  3GTP H;  5EQ0 A;  3IFT A;  4DPG A;  1IXR A;  2MJ8 A;  1PH2 A;  4G7O C;  4A3L H;  5IT9 c;  3S1R H;  2JA8 B;  4BS9 A;  1I4Q A;  5IP7 G;  1X54 A;  1KXL A;  4X3S A;  2A6H C;  4K5W A;  3ONA B;  1T5E A;  1HJP A;  4A75 A;  3BYT B;  1BVS A;  1XMQ L;  1X3F A;  1ZYR C;  4DAY B;  5JAV A;  1HFG A;  1AH9 A;  4DUY L;  4O42 A;  4DR5 Q;  5CV6 A;  3J81 c;  5FO8 B;  4NXM Q;  5M3M B;  4AQY L;  1XWE A;  4JI6 Q;  1F77 A;  2VY3 A;  2JP1 A;  3R2I A;  1MKH A;  1CZG A;  4PMW A;  2GVB A;  4GKK L;  1NCV A;  4X62 L;  2N49 A;  4DK0 A;  3U9O A;  4AYB G;  5IYD G;  1HNX L;  4A3J B;  3Q24 A;  3J7A F;  2NB0 A;  1EWH A;  1TS2 A;  2Y0S E;  1DCZ A;  3NTH A;  4XQJ A;  3F2C A;  3MXU A;  4R9W A;  5CBE E;  1LTT D;  3R2T A;  1SE8 A;  3SR1 A;  1TWG H;  5LL6 S;  4V0B A;  1EY8 A;  5EAY A;  3AMU A;  1CKN A;  1QCB D;  2UXC L;  2K01 A;  1X55 A;  4LFB L;  5KGU A;  2NWG A;  4JC0 A;  1CKO A;  3CCR A;  3DUZ A;  1PZK D;  2A6E D;  4C3H G;  3R3O A;  1TWH H;  2Z8L A;  2M00 A;  4A3F H;  2L4N A;  2L12 A;  1PDQ A;  2V4D A;  1CUK A;  3C1E A;  2R61 A;  5I4D A;  4NP5 A;  3CPF A;  4BA2 I;  5NUC A;  4XYQ A;  3QB3 A;  3DM1 A;  2PZW A;  1RHP A;  1C48 A;  3I2Z A;  4Y52 H;  4BY7 H;  4P74 A;  2B8F A;  4A3G H;  3QJY A;  4DR2 L;  3K5O A;  3FVQ A;  4QCL A;  4RG1 A;  1X32 A;  3ERS X;  1U4R A;  2K03 A;  2R7F A;  4A3B G;  5CR3 A;  4LF6 L;  4GOP C;  2G9H D;  5FK9 C;  3S2D B;  1U0L A;  2A73 B;  2D9U A;  3GP7 A;  1XMO Q;  1KAA A;  2F0T A;  1NUC A;  3FDT A;  5JJZ A;  2VL6 A;  4DR4 Q;  3T16 A;  4CHT B;  1BXT A;  1UWV A;  3J80 L;  4JPB W;  3TP5 A;  1SNM A;  1UE5 A;  2I0Q A;  5GQO A;  4C3J H;  3JAM L;  1N33 Q;  3KLS A;  3PUZ A;  4DKA C;  1SBB B;  2NN6 G;  4JK1 C;  5DNF A;  5C6A A;  3PO2 H;  1RIP A;  4QIW E;  1SMY C;  4KHP L;  4QF4 A;  3AEV A;  1Q82 C;  2K5D A;  1Y8O B;  1GHJ A;  1H9S B;  1K73 C;  3EQL C;  2AQ1 B;  1JCK B;  4BBR B;  2Q8T A;  3SK8 A;  4DNR B;  5I2X A;  4HJ5 A;  5COY A;  2BE5 C;  5JEA G;  5KNB A;  1DXM A;  1TS5 A;  2IW3 A;  2JA7 B;  2K5W A;  3A74 A;  1K3B C;  1OXV A;  3HRZ C;  1SRO A;  4S3S A;  4HAE A;  1EY6 A;  4KV6 A;  1ET6 A;  1A2U A;  5M5Y H;  1KNE A;  1RTO A;  1GUW A;  3S9W A;  2ZXP A;  1KDC A;  2E2D C;  4NMZ A;  2PW5 A;  2UXB Q;  1S3O A;  4CDD C;  4JVZ A;  4QQB X;  1I50 H;  1FL0 A;  1AE2 A;  2JA9 A;  1SMX A;  5C5L A;  2JQO A;  3NQI A;  5I6Y A;  1HR0 W;  1DOL A;  4YWM A;  1K83 H;  3D4R A;  2OEO A;  1UEB A;  1BO0 A;  4H7B A;  3ITP A;  4IUU A;  4BY1 H;  1X3Q A;  3PIO A;  1WCM H;  4ZUJ A;  1EIY B;  3DEO A;  4UP7 A;  5IGG A;  4GOP A;  3GTK H;  1X3P A;  1HHV A;  5I6W A;  2PMZ E;  4KHV A;  3BVM A;  1I4H A;  4JI5 L;  3H3V H;  1PH7 A;  3TBI B;  1PLF A;  2A68 C;  3L7Z C;  1WVL A;  2HIV A;  5FLX c;  3HOW G;  4OWW B;  2X6G A;  2EXZ A;  3K0X A;  5COR A;  3GTL B;  4JI2 L;  4JI6 L;  1L2F A;  5IT9 E;  1Q86 C;  1EWC A;  1LTB D;  3S14 B;  4PZ8 A;  4DV5 Q;  1SFO B;  1HUM A;  3E3X A;  1GUO A;  3KF6 A;  2BOS A;  2NZO A;  3RUZ A;  2NVY B;  5BN5 A;  1S72 A;  2MUY A;  3FKI H;  1Q1E A;  3NEM A;  1EIF A;  4K5X A;  3GO5 A;  4RMF A;  1JR0 D;  3RZO H;  1TWC B;  1XYI A;  3E0E A;  3T1Y Q;  2K5V A;  3AFP A;  3MXP A;  2R7Z G;  3CQZ H;  1VQ4 A;  2B2V C;  1A3V A;  2UUB Q;  4PZ7 A;  4UDU C;  4X6A H;  4PMB A;  2IY5 B;  3VYS A;  4ZK9 B;  2EY6 A;  1VQB A;  4I7A A;  3MC0 B;  5C0X I;  1JOK A;  4KY5 A;  3I70 A;  2NVQ H;  3TSS A;  3HKZ E;  1ENF A;  3UI2 A;  2MNA A;  2WAQ E;  3CRK C;  4KY7 A;  4C1N K;  4OIK A;  4JI7 Q;  4GLX A;  1NBW A;  3I56 A;  2RVL A;  3TRZ A;  3IAY A;  3RLF A;  3RN5 A;  3HOZ B;  1I4R A;  3T51 B;  2JEA I;  4LF9 Q;  3K7A B;  1FJG Q;  1BF4 A;  3S15 H;  3D3R A;  2X69 A;  4FXG C;  5C4J H;  1J9O A;  1TY2 A;  3M4O B;  5K5P A;  4A3M G;  3N52 A;  1FNV A;  1IBK Q;  1A63 A;  1SYF A;  2CQO A;  3PO3 G;  1WOC A;  3BVZ A;  1L1O B;  3TS0 A;  1O7Y A;  1PH8 A;  4L5S A;  5EPK A;  2VUM B;  1SN8 A;  2UU9 Q;  2EJM A;  1VQL A;  1EOV A;  5F2D A;  4DUZ L;  1LT5 D;  1E0B A;  3PIO 3;  2HUG A;  4HCS A;  2RCF A;  2FHT A;  3V2T A;  1QOH A;  1C4Q A;  1UAP A;  2LMC B;  3NWT A;  2PCF B;  2N78 A;  4A4I A;  4B3T Q;  3MVV A;  5AJ3 L;  4A3K H;  1PH9 A;  4JG2 A;  1HNZ L;  4LUV A;  1EY0 A;  2FMC A;  1B44 D;  2B2V A;  2F0V A;  2VB2 X;  4IN3 A;  2Z9H A;  2A5H A;  2NVX B;  4JI8 Q;  1GHK A;  2F0M A;  2K7V A;  4PV1 C;  3PUY A;  1R9T B;  1WD0 A;  1GM5 A;  4K8I A;  1EL0 A;  1ESF A;  1Y1V H;  2JK8 A;  1B1Z A;  3M4Y A;  1QVC A;  4IFD H;  2X6L A;  4R4O A;  1AFP A;  3CCJ A;  3GQB A;  3DWQ A;  5C4X H;  4HIO A;  3CD6 A;  4TRD A;  2D62 A;  2AQ3 B;  3J81 j;  4ODG A;  1SYC A;  1JJC B;  2QF7 A;  1W2B A;  4LUO A;  4LUZ A;  1EQQ A;  4NPS A;  3HP3 A;  1HA5 A;  5K36 G;  4KY6 A;  4IPD A;  4C2M B;  4AYB B;  1DM0 B;  3CCS A;  3CW2 C;  2VB3 X;  4BBS H;  5IP9 G;  3NBI A;  1IYV A;  4RCN A;  3MXN A;  5IYB H;  5JVG 3;  3S16 B;  3OW7 A;  3I55 A;  2CW0 D;  1VQE A;  1FNW A;  2B2W A;  4GKJ Q;  3MZ5 A;  4B08 A;  3G6J B;  1N8R C;  1PYW D;  5LMU L;  2HDL A;  3LWE A;  1G6P A;  4NXN Q;  1LLR D;  2CHB D;  4F87 A;  1PRT B;  1D7Q A;  2L1B A;  4YY3 Q;  1WTQ A;  4FF4 A;  2XGT A;  3EIV A;  1N32 L;  1O78 A;  3L9A X;  4LFC Q;  4XYO A;  2F0E A;  3KBG A;  4C3H B;  1PRT F;  5BR8 Q;  3BDC A;  2F4I A;  1GJX A;  3AU7 A;  3GTM H;  4M1U B;  4IUR A;  3I4M H;  2R93 H;  3GTQ B;  1O7L A;  4QGU A;  4X64 L;  2RF4 A;  4WJ3 M;  3K8A A;  4HMJ A;  2E2H B;  4LW1 A;  2I5M X;  1Y14 B;  2EXD A;  1HXY D;  1NAP A;  4J6H A;  1WYD A;  3S1M B;  4CDF C;  1LM0 A;  3D8G A;  4WJ4 A;  1PTO F;  2K5H A;  1B70 B;  1RF2 D;  3I90 A;  3MA2 B;  3KJO A;  2UUB L;  1PZI D;  2J0T D;  1F2L A;  5CV8 A;  3U4V A;  2A74 C;  1TU2 B;  1PRT D;  1B8A A;  1XMQ Q;  4XT1 B;  4DUY Q;  4L5T A;  5L37 A;  3BJU A;  4HJ7 A;  3I4N H;  4AQY Q;  4A3J H;  4A3B B;  1EYC A;  3SK4 A;  2XRS D;  2YV5 A;  4A3D H;  3F1Z A;  2IT1 A;  4H02 A;  3CCM A;  4GKK Q;  3GTO H;  4X62 Q;  3OW2 A;  4HIM A;  1CKN B;  1CFM A;  5D3D A;  2ZJR A;  2JSO A;  3WDN A;  3NWS A;  1GUN A;  1PTO D;  5I9P A;  3RZD H;  1HNX Q;  1DGS A;  2EDG A;  3P75 A;  5C44 G;  2K52 A;  3URY A;  3SE0 A;  4ZLT F;  3S17 H;  4FVM A;  1JE5 A;  2PO4 A;  2MHV A;  5GAH C;  1IW7 C;  1BCP C;  4ME3 A;  3NBH B;  1E2W A;  2ZTD A;  5C3E H;  2UXC Q;  1SNP A;  1JOQ A;  4IUT A;  2UU9 L;  4RKB A;  3CC4 A;  4LFB Q;  4ULL A;  1K3R A;  2B63 H;  2WAC A;  4HN7 A;  5AFW A;  3GTG H;  4DNT B;  2HHH L;  1K8O A;  1IKM A;  2IJ0 A;  2RDH A;  4OGQ C;  4B3T L;  1V43 A;  1VQ9 A;  1GUT A;  2L5T A;  3K0Y A;  5D3I B;  1V1Q A;  3NHH A;  1ESR A;  1VCI A;  5GRO A;  2K1B A;  4A3L G;  2RSN A;  4CDE C;  4HSP A;  1FGB D;  4JYA L;  4MZ9 A;  2K33 A;  2F0S A;  1QVF A;  2KED A;  2UUA L;  5H1S E;  1HZC A;  4DR2 Q;  2EYO A;  2ICE C;  3F2D A;  5M5X H;  4K14 A;  1TY0 A;  4R4T A;  4CJ0 B;  1M4V A;  1Z6H A;  2EYH A;  2H1E A;  3TP6 A;  3KJP A;  1Q90 A;  1PXU A;  1YNJ D;  1ZYR D;  4A76 A;  3KDF A;  2K4K A;  4LF6 Q;  2RKS A;  2E5L Q;  1LTS D;  3BDL A;  3KUP A;  2H5X A;  2BH2 A;  3BVG A;  4QJF A;  1WTO A;  3R8B A;  3HOW B;  4OWT B;  2CH4 W;  1M90 C;  2Z6B A;  1F9Q A;  4FXD A;  2NVT B;  4LF7 L;  2ASB A;  3CXC A;  1IZ6 A;  1GO3 E;  1HTL D;  2PW7 A;  4BBR H;  1JE4 A;  3CPW A;  3ULL A;  2BCO A;  2XTI A;  3SEB A;  4QUF A;  4JV5 Q;  2Z1C A;  4KHP Q;  1NR2 A;  2WKC A;  2JA7 H;  4IOC A;  3S2H B;  3A8J E;  4KD3 A;  3P20 A;  1Y8N B;  2LSS A;  3H3V C;  2BH8 A;  2B2T C;  3RR5 A;  4OHJ A;  4DR6 Q;  3CC7 A;  2N55 A;  1WI5 A;  1TII D;  4R1J A;  2R7Z B;  4Y7N H;  1SNC A;  3H09 A;  3I72 A;  1NSN S;  3ERO A;  4A3F G;  1VMC A;  1UE7 A;  4K2L A;  1WD1 A;  4L63 B;  4NXN L;  1I3Q H;  1EOT A;  4UP9 A;  1STE A;  1WFQ A;  3L0O A;  4YY3 L;  2LXJ A;  1SJH D;  5EPL A;  4PZ6 A;  4CJ2 C;  5DEH A;  1YNN D;  2F0F A;  3J81 i;  3P1H A;  2YU9 B;  4H0L C;  4BY7 G;  1QZG A;  3M4Q A;  4WRD A;  3K81 C;  1AP0 A;  3DWA A;  4GN4 B;  2O4X A;  1LO5 D;  1U9R A;  4A93 H;  4DK6 C;  2UXD Q;  1KNA A;  4A3M B;  2QA4 A;  3AYH B;  1F2M A;  2R6G A;  1TWF H;  3OWE B;  1VQF A;  3PO3 B;  4JI5 Q;  3F2U A;  5M3F G;  3UDI A;  4IAL A;  1NE3 A;  1UNS A;  3E9H A;  2F1M A;  2O5I C;  3S14 H;  1DYQ A;  1S5E D;  5JJI A;  4GLA C;  1SFO H;  1K0R A;  3SDZ A;  3FHW A;  2EYM A;  1BBW A;  1K28 A;  1S4Z A;  3VR3 A;  3OSO A;  4LMQ D;  4JI2 Q;  3HOX G;  1STA A;  1WTR A;  3MAQ A;  2J7Z A;  3HEJ A;  4NW2 A;  1VQH A;  1HH2 P;  3H6M A;  3PO2 G;  3QR8 A;  1STH A;  5I9O A;  2B2T A;  4K0K L;  3M3Y B;  4CBV A;  2KJX A;  3G6E A;  1G6Z A;  5EPJ A;  1SMY D;  3NPP A;  4KKT A;  5ELN A;  1BBX C;  2QGQ A;  4GLV B;  4KJO A;  4Q5V A;  4ME5 A;  1EY5 A;  2HDM A;  5C0X H;  1VQK A;  1KAW A;  2B2U C;  4IOA A;  3J7A V;  1A0I A;  3F2B A;  4GNX B;  1S40 A;  1MGS A;  3ULP A;  5IT9 L;  1D5Z C;  1G29 1;  4A3I G;  4P71 A;  4EX5 A;  1VQC A;  3HOZ H;  3HZX A;  4XDX A;  4X3K A;  4TKO B; 
#chains in the Genus database with same CATH homology
 3K0X A;  1EUJ A;  3OTO Q;  2E8G A;  1BKB A;  3PUX A;  4JI2 L;  1SRU A;  4JI6 L;  2B63 G;  1L2F A;  2UXB L;  4B3M L;  1J5E L;  3UE1 A;  1Q86 C;  3STB C;  2ALY B;  2YU9 H;  3ICE A;  1VQO A;  2A8V A;  4PZ8 A;  1E24 A;  3M4P A;  4DV5 Q;  1HNW Q;  2A19 A;  2NZH A;  4JI4 L;  1SR3 A;  3K80 C;  3KF6 A;  2NZO A;  3CCL A;  2E2I H;  1S72 A;  3FKI H;  3NEM A;  1Q1E A;  3G4S A;  1EIF A;  2WFW A;  2BA0 A;  3GO5 A;  4RMF A;  1WCM G;  4YCV A;  4LFA Q;  4BY1 G;  2JA5 H;  3RZO H;  1TWA H;  2HQL A;  1ASY A;  2F4V L;  3E0E A;  1YIJ A;  4DR3 Q;  4GS3 A;  3T1Y Q;  2K5V A;  3AFP A;  4YCU A;  2N3S A;  4AH6 A;  3RLO A;  3ZJY C;  5C0X G;  2ES2 A;  2R7Z G;  3CQZ H;  2ZM6 L;  1VQ4 A;  4DV0 Q;  1IBL Q;  3UDG A;  2EIF A;  3TRE A;  3PO3 H;  2ZJP A;  2WP8 J;  4X65 Q;  2UUB Q;  4PZ7 A;  1L0W A;  4X6A H;  1YJ9 A;  2BA1 A;  2IY5 B;  4DR1 L;  1MJE A;  4LF8 L;  1PH5 A;  1VQB A;  1X3G A;  3AFQ A;  4YWL A;  5C0X I;  2CCZ A;  5DLQ E;  2R92 G;  2NVQ H;  1I5F A;  3HKZ E;  1EFW A;  3H3V I;  2A1A A;  4DUZ Q;  2MNA A;  2WAQ E;  1D8L A;  2DUD A;  3TS2 A;  3M85 A;  4JI7 Q;  4GLX A;  4AYB E;  1NBW A;  2E5L L;  1E3P A;  1YZ6 A;  3I56 A;  1HZA A;  1UE6 A;  3A0J A;  4DV5 L;  3TRZ A;  1HNW L;  2YTY A;  3RLF A;  2DGY A;  3RN5 A;  2AWN A;  3M3Y H;  1MJC A;  4OO1 G;  4UY8 C;  2JEA I;  4LF9 Q;  1X3E A;  3FKI G;  3STB D;  1FJG Q;  1IL2 A;  4GOP B;  5AJ3 Q;  2JA5 G;  1HNZ Q;  3S15 H;  2WB1 E;  5HGQ A;  5C4J H;  1VQN A;  1R9T H;  1PVO A;  3CC2 A;  1C0A A;  4DR3 L;  3T1Y L;  1EWI A;  1OXX K;  3PUW A;  1SLJ A;  4BBR G;  5J3B A;  4A3M G;  5GAG C;  1MIU A;  1JJG A;  4P73 A;  1VQI A;  2OQK A;  2K50 A;  5IP7 H;  1IBK Q;  1IBL L;  4DV0 L;  4IFD J;  2ZTC A;  4A3G G;  1A63 A;  4JV5 L;  2CQO A;  3PO3 G;  4X65 L;  1O7I A;  3U4Z A;  2Y0S G;  1WOC A;  3KOJ A;  2JA7 G;  3NEL A;  1L1O B;  2VZA A;  2OTL A;  3TS0 A;  1PH8 A;  1VQJ A;  4YHH Q;  1VQP A;  4L5S A;  4DR6 L;  1VQ5 A;  3J7Z C;  1SN8 A;  1KHI A;  4QL5 A;  4HID A;  2UU9 Q;  3DM3 A;  1VQL A;  4NB3 A;  3FP9 A;  1VQA A;  2OTJ A;  1EOV A;  4DUZ L;  3GTL H;  5LMN W;  1KRT A;  5ELO A;  5M5W H;  4JI7 L;  1XNQ L;  1VQD A;  2ZTE A;  3KF6 B;  2B29 A;  2KHI A;  3SGI A;  2N78 A;  4A4I A;  4B3T Q;  1ASZ A;  4LF9 L;  1FJG L;  1WJJ A;  1E22 A;  2D0P A;  3KLW A;  2NVY H;  5AJ3 L;  1C9O A;  4JG2 A;  4A3K H;  1YHA A;  4LUV A;  3RN2 A;  1PH9 A;  1HNZ L;  5IYD H;  1Q46 A;  3BZC A;  4O2D A;  1TWC H;  2R92 H;  1IYJ B;  1Q81 C;  3UDX A;  1JMC A;  1LYL A;  4JI1 Q;  3I7F A;  1IBK L;  3S16 H;  1U5K A;  4MNO A;  1LTL A;  4JI8 Q;  3KYH C;  1PH3 A;  2Q2T A;  1KIX A;  2QEX A;  5JJK A;  5GAE C;  3S1N H;  2RHS B;  4O0A A;  1J6Q A;  3G48 A;  3S24 A;  2L15 A;  1VQ7 A;  3HOU G;  1X56 A;  1PA6 A;  2MO0 A;  3PUY A;  2UXD L;  3CMA A;  2F52 A;  4YHH L;  4XIG S;  1XPO A;  1GM5 A;  5E7N A;  1AE3 A;  1HZ9 A;  1Y1V H;  4IJH A;  2JK8 A;  4POG A;  1I6H H;  1XTD A;  2JA6 H;  4FDB A;  3UE0 A;  4JBM A;  2HIX A;  4LF5 Q;  1QVC A;  5FLM H;  2I5H A;  3PF4 A;  3K7U C;  1JB7 A;  1IBM Q;  4BA1 I;  4R4O A;  3BU2 A;  2E2J H;  1X6O A;  2MFI A;  2OCE A;  1I94 Q;  5LMU Q;  3J80 i;  1HR0 L;  1X65 A;  3PV0 A;  4A3E G;  1VQ8 A;  3CCJ A;  2Z6K A;  1Q12 A;  1XPU A;  3JAM i;  1Z47 A;  3GTP H;  4L5Q A;  1Z9F A;  3CAM A;  5C4X H;  4A3K G;  3ULJ A;  1VQG A;  4HIO A;  3GDE A;  3K7A H;  3CD6 A;  2D62 A;  1N32 Q;  1NJI C;  2VQF L;  3J81 j;  4TQU S;  4KI0 A;  1YIT A;  3J7A 5;  1JJC B;  3M4O H;  1W2B A;  3I4O A;  4LUO A;  1QZH A;  4LUZ A;  1EQQ A;  2IHF A;  4NPS A;  1XJV A;  1KL9 A;  5JEA J;  4JI8 L;  5K36 G;  2IHE A;  4IPD A;  4DV3 Q;  3CCS A;  2CWP A;  3RNU A;  2KEN A;  3CW2 C;  4X64 Q;  4BBS H;  4BXX H;  5IP9 G;  2JJQ A;  1PFS A;  4XTC S;  4R4C A;  1YVC A;  2PQA B;  1Y1V G;  5IYB H;  2VUM H;  4IO9 A;  1E1O A;  3TEH B;  4OWX B;  2AMC B;  3I55 A;  1XPR A;  2JA6 G;  1VQE A;  2YYZ A;  4LF5 L;  4GKJ Q;  4IFD G;  5FLM G;  2KBN A;  1K8A C;  3J80 c;  1GKH A;  1IBM L;  1N8R C;  5LMU L;  3OYY A;  2D0O A;  2Q2I A;  3JAM c;  1Q7Y C;  4NXN Q;  1G6P A;  4C3I H;  3T1H Q;  3M7N A;  1D7Q A;  3HOZ G;  1OXT A;  4YY3 Q;  5HY6 A;  1CKM A;  1EQR A;  4IFD I;  2XGT A;  5C4X G;  3EIV A;  4DV7 Q;  3OTO L;  1N32 L;  4PG3 A;  1P8L A;  4LFC Q;  2KCM A;  4OX9 Q;  5BR8 Q;  1PH6 A;  1NMG A;  1NY4 A;  3GTM H;  3U58 A;  2Z0S A;  2ID0 A;  3S1Q H;  3G71 A;  3EN2 A;  3RLN A;  4DV4 Q;  2CFM A;  2JEB I;  3D0F A;  4JI0 Q;  3I4M H;  2R93 H;  1C7Y A;  2PNH A;  2NVX H;  2KCT A;  1VQM A;  4YCW A;  4QGU A;  1Q8K A;  4X64 L;  4BXX G;  2CWA A;  2RF4 A;  4LFA L;  4A3C H;  4WJ3 M;  3K8A A;  2F3I A;  4TVA B;  4OXP A;  3CCV A;  1YI2 A;  1JJ2 A;  5IE8 A;  3PIP A;  4LW1 A;  2I5M X;  2VW9 A;  1Y14 B;  1Y1W H;  5IYB G;  2EXD A;  2VUM G;  4JI3 Q;  1XNR Q;  4GN3 B;  2VNU D;  1WYD A;  5C44 H;  4GKJ L;  1LM0 A;  5LMN Q;  4WJ4 A;  2K5H A;  1B70 B;  3KJO A;  5M3F H;  2UUB L;  3HOZ H;  1HZB A;  2V1C C;  5IY0 A;  3AQQ A;  3U4V A;  3HFZ B;  4R4Q A;  3WWV A;  3DLL A;  1B8A A;  4X66 Q;  3T1H L;  1XMQ Q;  3MEF A;  4DUY Q;  4DV7 L;  4L5T A;  1FVI A;  3I4N H;  3BJU A;  4HJ7 A;  1YEZ A;  4IPC A;  4AQY Q;  4LFC L;  4A3J H;  3HOY H;  3HOX H;  2PQA A;  1V9P A;  3JC6 6;  4KLK A;  4R4I A;  4DV2 Q;  3PF5 A;  2YV5 A;  5BR8 L;  3H15 A;  3F1Z A;  4A3D H;  4HJ9 A;  2ZJQ A;  1OXU A;  2IT1 A;  3H0G H;  4H02 A;  3CCM A;  4DV4 L;  2HHH Q;  2UUC Q;  1E7Z A;  3CP0 A;  4X62 Q;  3OW2 A;  4JI0 L;  3GTO H;  3I4M G;  3W1B A;  4ALP A;  4HIM A;  2R93 G;  1PYB A;  1QUQ A;  1CKN B;  1BBU A;  4C2M H;  3HOV H;  2LXK A;  4IJL A;  2OQ0 A;  2ZJR A;  4A3C G;  2AKW B;  3MXN B;  3RZD H;  1PH2 A;  1HNX Q;  4DPG A;  1IXR A;  5IYC H;  3PSI A;  4LNQ A;  1DGS A;  1YBY A;  1PH1 A;  4A3L H;  4AIM A;  4JI3 L;  4OON A;  5IT9 c;  3S1R H;  2YTX A;  1XNR L;  1CSP A;  4HJA A;  2RHQ B;  1A62 A;  2K52 A;  4EQ5 A;  5IP7 G;  5C44 G;  1X54 A;  5LMN L;  4GN5 A;  4JYA Q;  2KHJ A;  1CSQ A;  1KXL A;  1H95 A;  2UUA Q;  3S17 H;  1KD1 C;  1G51 A;  4A75 A;  1HJP A;  4LF4 Q;  1JE5 A;  5IWA Q;  4LFB Q;  5GAH C;  4X66 L;  1BVS A;  2K14 A;  4A3I H;  1XMQ L;  4ME3 A;  1X3F A;  4DAY B;  3CF5 A;  1W3S A;  4JOI C;  3NBH B;  2ZTD A;  5C3E H;  2UXC Q;  1AH9 A;  4DUY L;  2UU9 L;  3EBE A;  3CC4 A;  2YTV A;  4UP8 A;  3J81 c;  4DR5 Q;  4NXM Q;  1K3R A;  1OXS C;  4AQY L;  3I4N G;  3CCQ A;  2B63 H;  2OWO A;  4JI6 Q;  2VY3 A;  1QVG A;  3A5U A;  4JBK A;  1MKH A;  4JCV E;  4P72 A;  4C3H H;  3GTJ H;  3GTG H;  4A3D G;  3NEN A;  4PMW A;  2GVB A;  4DNI A;  2HHH L;  3H0G G;  2UUC L;  4GKK L;  1GD7 A;  3HKZ G;  4X62 L;  2N49 A;  2WAQ G;  1K8G A;  4B3T L;  4JI4 Q;  1V43 A;  1VQ9 A;  1M1K C;  1RL2 A;  3PUV A;  1KC8 C;  4AYB G;  2Q2U A;  3GTQ H;  1V1Q A;  2VQE Q;  5IYD G;  1HNX L;  4GNX C;  1N36 L;  5IYC G;  1VCI A;  5GRO A;  4A3L G;  1OTC A;  2F4V Q;  4LF7 Q;  2Y0S E;  1X9N A;  1KRS A;  2E2H H;  3A5Z B;  3F2C A;  4JI1 L;  3W5O A;  4JYA L;  4J15 A;  4MZ9 A;  3W1G A;  1SE8 A;  2WB1 G;  1TWG H;  1PV4 A;  2VS1 A;  1YJW A;  3S1M H;  3B6Y A;  1QVF A;  2UUA L;  5FJ8 H;  5H1S E;  4LF4 L;  5JJL A;  3CCE A;  1HZC A;  4DR2 Q;  3F2D A;  5EAY A;  1N9W A;  1A8V A;  5M5X H;  4HJ8 A;  4R4T A;  1CKN A;  2UXC L;  5C3E G;  1VS0 A;  1X55 A;  2EQS A;  4LFB L;  4DR5 L;  2I5L X;  3BZK A;  4NXM L;  2MQH A;  4JC0 A;  1CKO A;  3KJP A;  3CCR A;  3D31 A;  2K75 A;  4A3B H;  4DAM A;  4A76 A;  3KDF A;  2K4K A;  1TWH H;  4LF6 Q;  4A3F H;  1I94 L;  2E5L Q;  2H5X A;  1QUQ B;  2BH2 A;  4QJF A;  2IX0 A;  1CUK A;  2AWO A;  4OWT B;  2JE6 I;  3CPF A;  4BA2 I;  2GN5 A;  1NTG A;  2VQE L;  1M90 C;  4B3R Q;  2ATW A;  2PI2 E;  2C35 B;  4LF7 L;  2ASB A;  3CXC A;  1IZ6 A;  1GO3 E;  4BBR H;  3I2Z A;  4A3M H;  4Y52 H;  3CPW A;  4BY7 H;  1TXY A;  3PCO B;  4KHZ A;  4P74 A;  3ULL A;  2JA8 H;  4MTN A;  2XTI A;  3L2P A;  4A3G H;  4JOI A;  4JV5 Q;  1EYG A;  4KHP Q;  5FJ8 G;  4DV3 L;  3HKS A;  2JA7 H;  4DR2 L;  4IOC A;  1N34 Q;  1E1T A;  4BBS G;  3ER0 A;  4B3S Q;  2LSS A;  4RG1 A;  3ERS X;  2BH8 A;  1NMF A;  2RCN A;  3PGZ A;  3RR5 A;  4LWC A;  4DR6 Q;  3CC7 A;  2R7F A;  3TQY A;  1WI5 A;  4R1J A;  4YWK A;  4Y7N H;  5M3M H;  1PYS B;  4P75 A;  3CCU A;  4A3B G;  2K5N A;  2PI2 A;  4POF A;  4LF6 L;  1XNQ Q;  4GOP C;  4L5R C;  2AHO B;  4A3F G;  1U0L A;  4UPA A;  1UE7 A;  1XMO Q;  4GNX A;  4NXN L;  1I3Q H;  4UP9 A;  1FGU A;  1YJN A;  2VL6 A;  1WFQ A;  1YHB A;  3L0O A;  4DR4 Q;  4YY3 L;  2LXJ A;  1UWV A;  4B3R L;  4PZ6 A;  1UE5 A;  2I0Q A;  5GQO A;  1UE1 A;  2HT1 A;  4C3J H;  4OX9 L;  3J81 i;  3HOW G;  1PH4 A;  1N33 Q;  2N8N A;  2Z6K C;  3PUZ A;  2CKZ B;  4DKA C;  1L1O C;  2NN6 G;  5C0X J;  4BY7 G;  3PO2 H;  1VQ6 A;  1QZG A;  2JA8 G;  1RIP A;  3M4Q A;  4QIW E;  2IX1 A;  3K81 C;  4KHP L;  3AEV A;  4GN4 B;  1B7Y B;  2B3G A;  1Q82 C;  1LUZ A;  2R7D A;  4K0K Q;  1N34 L;  1YHQ A;  4IPH A;  3HOU H;  3VDY A;  4GKK Q;  4B3S L;  1JT8 A;  4A93 H;  2NN6 I;  4DK6 C;  1K73 C;  2UXD Q;  1Y1W G;  2QA4 A;  3AYH B;  2R6G A;  1T9H A;  1TWF H;  4DV1 Q;  3KFU A;  4DV6 Q;  3KDF B;  4HJ5 A;  2GVA A;  5M3M G;  3KF8 B;  1VQF A;  1PHJ A;  4JI5 Q;  5JEA G;  1GVP A;  5M3F G;  3UDI A;  4JBJ A;  1NE3 A;  4DK3 C;  3A74 A;  3E9H A;  4APV A;  1XMO L;  1OXV A;  1Q1B A;  1SRO A;  1HR0 Q;  3S14 H;  4A3E H;  3UDF A;  4DR7 Q;  4DR4 L;  5JJI A;  4GLA C;  1SFO H;  3HOW H;  1K0R A;  5M5Y H;  1N36 Q;  3FHW A;  1BBW A;  4A3J G;  2MO1 A;  4JI2 Q;  3HOX G;  2VQF Q;  1N33 L;  3HOY G;  4DV2 L;  2NVT H;  2UXB Q;  4B3M Q;  1P16 A;  1J5E Q;  1KQS A;  1VQH A;  1HH2 P;  3PO2 G;  1S3O A;  4QQB X;  3LGJ A;  1I50 H;  1FL0 A;  1AE2 A;  2JA9 A;  1SMX A;  4OO1 I;  2JQO A;  1HR0 W;  4K0K L;  3U50 C;  4YWM A;  1K83 H;  3IRB A;  4IPG A;  4QY7 A;  4HIK A;  1UEB A;  3G6E A;  3HOV G;  3S2H H;  4BY1 H;  5IP9 H;  3PIO A;  4A93 G;  1WCM H;  1EIY B;  3E9I A;  1K9M C;  5ELN A;  4UP7 A;  3Q8D A;  4GOP A;  2QGQ A;  4GLV B;  3GTK H;  4DV1 L;  3CME A;  4DV6 L;  1VQK A;  1KAW A;  2R7Z H;  4IOA A;  5GAD C;  2ZM6 Q;  2PMZ E;  4JI5 L;  4JBW A;  1A0I A;  3F2B A;  4GNX B;  3F8T A;  1S40 A;  3H3V H;  1PH7 A;  3ULP A;  5IWA L;  2FXQ A;  3S2D H;  4DR1 Q;  1G29 1;  3L7Z C;  1YNX A;  4A3I G;  3M9B A;  4LF8 Q;  4P71 A;  2HIV A;  3GD7 A;  1VQC A;  4EX5 A;  5FLX c;  4DR7 L;  1L1O A;  2Q2H A;  4OWW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...