4LF9L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 12
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf9L00
2D0PA 4JC0A 1I94L 2JA5G 1KRTA 5GAEC 2ZTDA 4PZ7A 1X55A 3K7UC 2I5MX 2JA7H 4A3IG 2VUMH 3DM3A 4XTCS 3PO2G 4JI1L 3S1QH 1X3EA 1YBYA 3I4MG 5C0XJ 4HIDA 1A0IA 4A3CG 1N32L 3HOUG 3KDFA 2R7FA 2WB1E 1SR3A 3H15A 3RN2A 2F3IA 3CAMA 1LYLA 4X64Q 1VQ8A 3F2CA 1L2FA 3G48A 3T1HQ 4NXNQ 2KHJA 5M3FH 3T1YQ 4Y52H 5C3EG 5IP9H 2ZJRA 3GTOH 1JT8A 3ULPA 2UXBQ 2AKWB 2K4KA 5JJLA 2K50A 3I7FA 3ZJYC 4POFA 1SMXA 2R7DA 1UEBA 4JI3L 1HNXL 3PO3G 4IFDG 1LTLA 1Y1WH 4R4IA 1WJJA 2AWNA 1IZ6A 1IBKQ 1H95A 2N8NA 2UXDQ 1TXYA 4QIWE 2E2JH 3TQYA 4NB3A 5GQOA 4UP8A 1CKNA 4ALPA 3CC2A 4JI7Q 2OWOA 4OX9L 3AQQA 4QGUA 5C44H 4DAMA 1S40A 4X66L 2D0OA 1IBLL 4IO9A 1X56A 2UUBQ 4HJ9A 2ASBA 5M5XH 3AFQA 3S17H 3GDEA 1VQ5A 3JC66 4GKJQ 5C4JH 2RF4A 1EIFA 4GKKQ 2EIFA 4C3IH 2E2HH 1TWFH 1J5EQ 4JG2A 4LF7L 2F4VQ 1QZGA 3RLOA 3AYHB 1HJPA 3TEHB 3W1GA 1MIUA 4LFBL 3U58A 1EQQA 2E2IH 1Q46A 2R93G 3I4NG 4K0KL 3KFUA 3CF5A 3S1RH 2RHQB 3CCRA 1HR0L 4LF8Q 4B3RL 1CKMA 4YY3Q 1K8AC 3OTOQ 3CP0A 5GAHC 3L7ZC 4EX5A 4DR2L 1N34Q 4YCUA 2N78A 5LMUQ 1E1OA 4OXPA 5JEAG 2N3SA 4DV7Q 3TS0A 4DV5L 1Q7YC 2R6GA 4UP9A 1L1OB 4A3GG 2RCNA 1X3GA 3PIOA 2UUCQ 3TRZA 2K52A 2I5LX 1YEZA 4AIMA 3K8AA 1XMOL 3NENA 1WYDA 3OYYA 4J15A 1UE7A 1KHIA 2LXKA 2OQKA 2WP8J 4L5SA 5M3MG 5FLMG 4GOPC 4P71A 5M5WH 4DKAC 2PNHA 1NBWA 3CCJA 1VCIA 4C3JH 1SLJA 4HJ7A 1PH9A 3GTKH 1HZAA 4DR3Q 1X3FA 2PQAB 4DR5Q 1J6QA 4AH6A 3HKZG 5IE8A 4HIKA 4AQYQ 1VQBA 2NZHA 2ALYB 3Q8DA 1VQJA 4GNXB 1X9NA 4JV5Q 4KLKA 1U0LA 3B6YA 4IJLA 2JA5H 3CC7A 4GOPB 4R4TA 3UDFA 2ZJPA 4BY7G 4A3IH 3PO2H 3CMEA 3S2HH 1YNXA 2UU9L 3K7AH 4DV3Q 4IPDA 1KD1C 3I4MH 3F2BA 4YHHL 4A4IA 1HNZQ 2EQSA 4A3CH 1OXXK 1X54A 4GN3B 4DV2Q 2AMCB 4B3TL 1I50H 2HT1A 1G6PA 1XMQL 4R4CA 1TWCH 1VQNA 3UDGA 4DV4L 1K8GA 5JJKA 3M7NA 4OONA 5C3EH 1TWAH 1XJVA 1Y1VG 4JI0Q 2BH8A 2QGQA 2NZOA 1PH4A 3RZOH 1K73C 3PO3H 1OXUA 1FJGQ 4JI6L 1KAWA 1Q86C 3J81c 4DUYQ 1M90C 4DV0Q 1PH6A 4IPGA 2XGTA 3KYHC 3I56A 1M1KC 5AJ3L 1PYSB 4B3ML 5GADC 3EIVA 4NPSA 2NVTH 1AH9A 3AFPA 3PCOB 4P72A 1DGSA 1YVCA 4LW1A 3CPWA 1I3QH 2JE6I 1Q1BA 4GLVB 4GN5A 1PH5A 4X64L 1PH3A 4LFAL 1X6OA 1VQGA 2IX1A 1CKOA 3T1HL 1KIXA 3W5OA 2IHFA 4RG1A 5IWAL 1YITA 1XNRL 3KF6A 1N36L 2UXBL 1G51A 1FVIA 2R93H 5IYBG 4BBSG 2YV5A 1EOVA 2HIVA 2PI2E 1SFOH 2Z6KC 3CCUA 4LUZA 3I4NH 1KC8C 2MQHA 4JOIC 3M3YH 1V9PA 4LUVA 2DUDA 1Y14B 4X65Q 4JI8Q 2IX0A 3KJPA 1IBKL 1MJCA 3HOYH 3TREA 3PUWA 2VNUD 2UXDL 2B29A 4OWXB 3CCSA 4DV1Q 5FJ8G 1PHJA 3RZDH 2IT1A 2E5LQ 4JI7L 1VQEA 2WFWA 1V43A 1S3OA 3UE0A 1GKHA 4AYBG 1ASZA 2B63G 5LMNQ 1PH8A 4QY7A 3LGJA 1TWGH 1EUJA 1GD7A 4C2MH 1V1QA 1CSPA 4IOCA 5M3MH 2V1CC 4P73A 1RL2A 2YTVA 5FLMH 2JEAI 2KBNA 2Q2HA 2VS1A 2WAQE 2UUAQ 3G71A 2JA6G 4GKJL 1BBWA 1WOCA 3E9HA 1YHQA 4GKKL 1KRSA 2F4VL 5BR8Q 1BKBA 3K0XA 3M4PA 5HGQA 4DUZL 4DV6Q 3H0GG 4LF4Q 3S15H 4IFDJ 2YYZA 1XPRA 2R7ZG 1N9WA 1SN8A 3E0EA 4KHZA 1GM5A 3RNUA 1OXTA 4PZ6A 2Y0SE 1PH2A 4JYAL 4BY1G 4BY7H 5C4XG 1VQDA 1HH2P 2WB1G 5IP7G 3OTOL 1PVOA 4LF9Q 1PA6A 1N34L 5IYDG 3HOVG 1VQAA 2VQEQ 5LMUL 4A93H 3ULJA 2VQFQ 1HZBA 1I94Q 3S14H 1D7QA 4WJ4A 3SGIA 2Q2IA 3HFZB 1EFWA 2NN6I 3S16H 1OTCA 2LSSA 4A3DG 2UXCL 4DR7L 4OO1I 5JJIA 5C0XI 1L1OC 1VS0A 1Y1VH 1E22A 2H5XA 3NELA 4DR3L 4A3KG 4BXXG 1NE3A 4LF5L 2A8VA 2PI2A 4DR5L 3K80C 1OXSC 4IPCA 4DR6L 2ZM6L 1JMCA 2KENA 4IOAA 4DR7Q 3HOWH 4GN4B 3PGZA 4RMFA 2CCZA 2PMZE 4LFCL 3GTGH 1QUQA 4PG3A 4DR4Q 2CQOA 1PFSA 4O2DA 5JEAJ 1B70B 1VQMA 2HIXA 4NXMQ 3HOYG 4L5RC 4YWMA 5IYCG 4HJ5A 2MO1A 1HR0W 4DK3C 1HNXQ 1HNZL 2OTLA 5H1SE 1X65A 4GNXC 3H3VH 4DV2L 2I5HA 1FGUA 4KHPQ 1XNQQ 5E7NA 4POGA 4IFDI 4LF6L 3WWVA 3W1BA 1VQIA 2NVQH 4GLXA 4OX9Q 4JI2Q 1EYGA 5J3BA 4A3FG 3PUXA 4JI0L 3MXNB 2GVAA 2K5VA 1YIJA 2QA4A 2Z6KA 1HNWQ 3D31A 5IYBH 2ES2A 4JOIA 1L0WA 3HOXG 1IL2A 1XPOA 3CC4A 4BBSH 1A8VA 1SRUA 1FJGL 3PF4A 1VQ7A 1IXRA 4DR1Q 4DUYL 1VQ9A 4JBKA 1E7ZA 2QEXA 1VQ6A 3HOUH 4QQBX 5FJ8H 4B3SL 1AE3A 3UDXA 1EIYB 4LFBQ 1C7YA 3CCLA 2BA1A 3KDFB 2Q2TA 2B63H 1I5FA 1A63A 4PZ8A 3G4SA 1N33L 4X62L 1WCMG 2BA0A 4B3RQ 3J80c 1CUKA 1E1TA 1AE2A 3U4ZA 2JEBI 4R4OA 2B3GA 2E8GA 4A3LG 3F2DA 2JA6H 3M9BA 1W3SA 2HHHQ 3CW2C 2CFMA 1YJ9A 1Z9FA 2FXQA 2MNAA 2VL6A 3H0GH 3S24A 1WI5A 3UDIA 2R7ZH 3GTMH 3S1NH 2A19A 3M4QA 2ATWA 5C4XH 4BY1H 2R92G 5IP7H 4JI4Q 3GO5A 1SE8A 4JI8L 1CKNB 1T9HA 1LUZA 1VQ4A 2ZTCA 2A1AA 1PH7A 3HOVH 2BH2A 5IYDH 2KCMA 2E5LL 4JBMA 3AEVA 4A3EG 3CMAA 3GD7A 4C3HH 3A5UA 4NXNL 5LMNL 2D62A 3T1YL 2Q2UA 3M85A 4DK6C 2GN5A 3BU2A 2UU9Q 1L1OA 2DGYA 5ELOA 4A3DH 3RLNA 3I4OA 1K9MC 4BXXH 4A3KH 1UE1A 3D0FA 3PIPA 1IBMQ 1WFQA 1QVCA 4BBRG 1VQFA 2ID0A 5BR8L 4QL5A 1VQPA 3KJOA 4DV6L 1NJIC 2KHIA 5GAGC 3PUZA 4R1JA 1O7IA 2IHEA 1HZCA 1YZ6A 1VQCA 3VDYA 2PQAA 3J81i 3M4OH 4A3GH 1OXVA 4XIGS 5K36G 1P8LA 4YCWA 1SROA 4MZ9A 3NEMA 5IYCH 4GNXA 1UWVA 2VQEL 4A76A 2UUBL 1YHBA 1I6HH 4GOPA 4GS3A 1YHAA 4X6AH 4A3MG 2VQFL 2NN6G 1XTDA 1QVFA 1PV4A 1NY4A 1VQLA 2YU9H 3ERSX 4MNOA 3JAMi 2CWAA 4OO1G 5C0XG 2KCTA 3ULLA 3KF8B 3NBHB 4JBJA 1JJ2A 1KXLA 1J5EL 3BJUA 2EXDA 2MO0A 2RHSB 3IRBA 5AJ3Q 4B3MQ 4A3FH 4JCVE 4DPGA 4LNQA 3TS2A 1CSQA 2N49A 2OQ0A 1K83H 1YJWA 2LXJA 4YWKA 1NMFA 4H02A 3HOXH 3HKSA 3PV0A 4UP7A 2AHOB 4YY3L 1KQSA 4LF8L 2VZAA 3H3VI 4UPAA 4LFAQ 1RIPA 4LUOA 4JI5L 4R4QA 3CQZH 2IY5B 2JQOA 4DV7L 4DR4L 5IWAQ 1PYBA 1UE5A 4APVA 2NVYH 1XNRQ 1N36Q 3F1ZA 3E9IA 4NXML 3FHWA 2UUCL 1ASYA 2WAQG 3PUYA 3J7ZC 2HQLA 3BZKA 2JJQA 1WCMH 4JBWA 4JI1Q 3K81C 3RLFA 4BA1I 2K5HA 2JA8G 4YWLA 1W2BA 4A3BG 2YTXA 4YCVA 3UE1A 1XNQL 4KHPL 1TWHH 1N8RC 1N32Q 2YTYA 4A3JG 2GVBA 3ER0A 3STBD 4A3LH 5HY6A 3FKIG 4AQYL 1VQOA 4JI2L 1XPUA 2Y0SG 4GLAC 1Q8KA 4JV5L 2NVXH 1IYJB 1HNWL 1K3RA 3PF5A 1C9OA 3HOZG 1R9TH 3FP9A 4DV3L 2R92H 1QZHA 4JI3Q 2OTJA 1LM0A 2K75A 1Q1EA 4DR1L 4WJ3M 1Z47A 4DUZQ 1BBUA 3MEFA 4A3EH 3HKZE 3KOJA 2JA7G 2VUMG 1GVPA 4TQUS 4HJ8A 4JYAQ 4IJHA 1NMGA 1Q82C 4IPHA 2ZJQA 3EBEA 1IBLQ 4X66Q 1C0AA 1JJCB 4FDBA 5DLQE 3KF6B 3RR5A 2HHHL 1EWIA 3DLLA 3U50C 1NTGA 4BBRH 5M3FG 3PUVA 1YJNA 4QJFA 1JJGA 5IP9G 4LF7Q 1PH1A 2UXCQ 4DV0L 1QVGA 4OWTB 1Q81C 2OCEA 3GTLH 5EAYA 1VQKA 4JI4L 3OW2A 4K0KQ 4LF5Q 1YI2A 1HR0Q 2F52A 2JK8A 3BZCA 1Y1WG 3GTJH 4JI5Q 3S1MH 1G291 4P75A 3CCMA 5IY0A 2ZM6Q 4DR6Q 4A3MH 4DR2Q 2AWOA 2K5NA 5GROA 4L5TA 4DAYB 4DV5Q 4LFCQ 4P74A 3GTPH 2C35B 3EN2A 5C44G 5FLXc 1XMOQ 2I0QA 5M5YH 4A93G 4ME3A 4DNIA 1HZ9A 4TVAB 5IT9c 4L5QA 1IBML 2K14A 4LF6Q 2XTIA 4X65L 3J81j 3CCVA 3A5ZB 4HJAA 2CKZB 2L15A 4DV1L 2Z0SA 1FL0A 1JE5A 3CPFA 1B8AA 3L0OA 3CCEA 1K0RA 1B7YB 3STBC 4PMWA 3CCQA 1P16A 4OWWB 2VW9A 3F8TA 1D8LA 3I2ZA 1E3PA 4UY8C 3ICEA 1BVSA 3CD6A 1MKHA 3CXCA 2JA8H 1Q12A 3U4VA 1KL9A 4YHHQ 1JB7A 3HOWG 3J80i 3A74A 4A3BH 3I55A 2UUAL 3RN5A 3S2DH 4A3JH 2VY3A 2MFIA 1S72A 4B3TQ 1UE6A 3KLWA 4B3SQ 1XMQQ 3FKIH 4BA2I 3L2PA 5ELNA 5LMNW 4MTNA 4O0AA 4DV4Q 4LF4L 1N33Q 4EQ5A 3G6EA 3PSIA 4X62Q 4LWCA 1A62A 2CWPA 1GO3E 4KI0A 3JAMc 4HIMA 4AYBE 2JA9A 4HIOA 3J7A5 4Y7NH 1MJEA 3HOZH 1E24A 4A75A 1QUQB 3GTQH 4LF9L 1EQRA 1VQHA 2ZTEA 4JI6Q 1U5KA 3A0JA
chains in the Genus database with same CATH superfamily
2D0PA 4JC0A 1I94L 4PZ7A 1X55A 3K7UC 2JA7H 4A3IG 3I4MG 1LABA 3E3XA 1GUOA 1N32L 2M00A 2L5TA 2VB3X 4A3BB 1D5ZC 4JPBW 3MXPA 4G57A 1ZYRC 4X64Q 3I4LA 4NXNQ 1HA6A 3GTOH 2FJ2A 2K4KA 2K50A 1UEBA 3GTQB 2MPMA 4IFDG 3U9SA 1Y1WH 1ET9A 2WKCA 1HPCA 2N8NA 2UXDQ 1EQTA 3OMCA 1TXYA 4OIJA 2E2JH 4NB3A 1U4PA 3VR5A 4C56C 4FNFA 2ICEC 4IUQA 2D0OA 4ZYSA 4IO9A 4HJ9A 1Y69U 1RF2D 3OMGA 1VQ5A 2PW7A 4P2CB 5EKLA 2RF4A 5ELEA 3SK8A 2Z4HA 4J8QA 4RGTA 2E2HH 5M3FB 2EY5A 1D1KA 3K5LA 4G7HC 1J5EQ 1TWGB 1SMYC 1QZGA 2I46A 3SXHA 1MIUA 2E2IH 1S5ED 1HR0L 4LF8Q 4YY3Q 1K8AC 2K28A 2WACA 3OTOQ 4DR2L 3HOYG 4YCUA 2N78A 3DWAA 5JEAG 3NQTA 2RCNA 2CHBD 3PIOA 2UUCQ 1AFPA 2I5LX 4AIMA 2B2WC 5KNCA 4J15A 5IGGA 2OQKA 2WP8J 4RGNA 3EJIA 5M3MG 1EU3A 1DOLA 2PNHA 3KF8A 4DKAC 2BE5C 1M8AA 1TR5A 2F0LA 1BNZA 4CKCA 2B8FA 3FVQA 2ZT9C 5L37A 1BCPB 2NZHA 2ALYB 4GNXB 1U0LA 3B6YA 4MHEA 1JQYD 1H9KA 4R4TA 3CC7A 3UDFA 2ZJPA 4BY7G 3PO2H 3CMEA 3S2HH 1YNXA 3BVGA 4K14A 1KD1C 1HNZQ 1K3BC 1X54A 4Z9CB 2Q8RE 2HT1A 1STYA 1SNMA 3OPOA 2OF1A 4DV4L 2F0TA 2KVMA 1H9RA 4QF4A 4KV6A 3DM1A 4RGOS 1TWAH 2NWGA 4UAIA 2D5DA 1TS5A 2QGQA 3WOFA 4C3JB 1DD2A 4HMIA 1OXUA 4JI6L 3QOJA 4G7ZC 1Q86C 2K5DA 1MGSA 5M9OA 2JA5B 2RDGA 1DOKA 4IPGA 2XGTA 5ELFA 3MFYA 4PNYA 1I4XA 4B3ML 3K7AB 3HOUB 1O80A 1PH5A 1PZJD 4X64L 1PH3A 4LFAL 1CHQD 1VQGA 2BOSA 2IX1A 4PMBA 4CKEA 5JVG3 5C5MA 1N36L 1G51A 1FVIA 2EJGC 3NXWA 5IGDA 4V190 5FO8B 1U9RA 4BBSG 2PI2E 3NWTA 4LUZA 1G2SA 4KTAA 1A2UA 1Y14B 3PO3B 4JI8Q 2UXDL 1TVXA 3CCSA 2QF7A 4KY7A 5FJ8G 3CRKC 2E5LQ 1S3OA 3UE0A 1GKHA 4AYBG 2L0CA 5LMNQ 4KJOA 4K2KA 1TWGH 4CHTB 4DAYA 1EIGA 4C2MH 2CCZA 3D4DA 2WAQE 2Q2HA 1EIHA 1XXGA 1WOCA 1JWUD 1SYEA 2DNEA 3M4PA 4DUZL 4DV6Q 3DEPA 2R93B 2Y0SE 5I6YA 5C4XG 3I4NB 1O7ZA 3OTOL 1A3UA 3M3YB 1JCKB 1ENFA 2N55A 3DMUA 5IYDG 3HOVG 4EQNA 1LTSD 2XVSA 2C9OA 3VA7A 1JICA 1D7QA 4KKUA 1C48A 4A3GB 2NN6I 1I4RA 2LSSA 1B1ZA 4A3DG 5C0XI 5TSSA 1E22A 1Z7TA 3TDQA 2B2UA 4PV1C 1Y8NB 2IL8A 4DR6L 3K59A 4RMFA 5CBEE 2LMCB 1QUQA 4A3FB 2L55A 2CQOA 4ME5A 2F0VA 5KGUA 4L5RC 4HJ5A 1HR0W 2OTLA 2F0SA 2QDLA 2TSSA 3NTKA 5FK9C 1HNXQ 1HNZL 3D4WA 2AQ3B 3R8BA 4KD4A 1SJHD 2L1BA 3S14B 3W3AA 1EYGA 2B2VC 4J1MA 3Q24A 2K5VA 2Z6BA 2QA4A 1Y1VB 2Z6KA 1IL2A 3I3CA 4JOIA 2KUMA 3CC4A 1T5EA 5IGCA 2WINB 2G9DA 1MHWC 3PF4A 1VQ7A 1VQ9A 5DAUA 3HOUH 1IL8A 4N9PA 1PZKD 1AE3A 3VR3A 1EIYB 2AUJD 3I91A 1C7YA 2BA1A 2MHVA 2B63H 3BZDB 2A68C 2A6HD 2X6GA 4IN3A 3U4ZA 4ZCKA 2JEBI 1LT3D 2NUCA 2KJXA 1D5MC 2B3GA 2JA6H 3M9BA 4E6IA 1GJXA 3CW2C 3SHLA 1Z9FA 2R61A 1NSNS 3H0GH 2F0OA 4L63B 1WI5A 3CU7A 1CZWA 2EY1A 1MSHA 1PTOD 4JI4Q 4JI8L 5G3LD 2O4XA 2QILA 2RBMA 2HDLA 2E5LL 4A3EG 4DU9A 3R3OA 5LMNL 3KK7A 2D62A 4XQQA 2UU9Q 1L1OA 2KHSA 5JOBA 4BXXH 4KKTA 1VQFA 3OIPA 4DV6L 1A15A 4R1JA 1O7IA 2IHEA 1HZCA 5M5YB 4CDFC 1ILQA 3J81i 4A3GH 1OXVA 3PIP3 1KDAA 1SROA 1KTKA 2WB1B 1UWVA 1ICWA 2FINB 4X6AH 4A3MG 2PZTA 4ZAIA 2KCTA 2K04A 3ULLA 3KF8B 4JBJA 4C3HB 2EXDA 5K36G 5AJ3Q 4A3FH 4JCVE 3TS2A 2K1BA 1CSQA 2EYPA 1YJWA 2LXJA 1TS3A 3CKIB 4A3KB 1STBA 2AHOB 4UPAA 4I7ZC 1CQVA 3I72A 2A6ED 5IGEA 5IWAQ 2MGSA 2K33A 1ASYA 2WAQG 1B53A 3KUPA 4DK1A 2HQLA 3BZKA 4JI1Q 1IHZA 5D3DA 2A69C 3C1EA 5ELCA 5J1ZA 3H6MA 3NE5B 3IAYA 1QNKA 5HY6A 3FKIG 4AQYL 1VQOA 1WTOA 2Y0SG 5CBAE 1LTTD 1B9NA 1K3RA 3PF5A 2FMMA 3QR8A 3FP9A 4QUCA 1B50A 2F0PA 1LM0A 1Q1EA 1HRJA 1LTBD 1LV9A 1QB5D 2Z8LA 3FPPA 1FD7D 5IOCA 3D6CA 2F0UA 5EBCA 3HKZE 3KOJA 2VUMG 1EY0A 3NWSA 5C3WA 1WCMB 1IBLQ 3P1HA 2BDNA 5DLQE 1TWHB 3E5SA 3Q22A 3HS0C 3RD4A 2HCCA 3U50C 2KQ3A 4CDEC 3PUVA 4OEMB 1SJED 5J39A 2N88A 3EVQA 3FDTA 1JJGA 4LF7Q 4KY6A 4DV0L 1Q81C 1U4LA 4JI4L 1R9TB 1IYVA 4LF5Q 3BZCA 3CCMA 2ZM6Q 2AWOA 2NN6H 4RCOA 3N52A 4DAYB 4LFCQ 5C0XH 2FFKB 1J8IA 1JWMD 1XMOQ 5M5YH 5FKAC 4ME3A 4DNIA 4K6LA 2B2YC 4GZYC 3V2TA 1BXTA 3J81j 4IUTA 4HJAA 2L15A 1JE5A 3L0OA 4EQPA 1ZKOA 3DHQA 1P16A 3I90A 1E3PA 3J80L 2ENBA 3GTLB 1LTAD 3ICEA 2JA8H 3GTJB 1JB7A 1KL9A 2MJ8A 3HOWG 2F0FA 2UUAL 3RN5A 1STHA 2MFIA 3MVVA 5I9PA 4G4KA 3TP8A 4B3SQ 1XMQQ 1STEA 4K5XA 4BA2I 2L12A 1GUWA 3O13A 5LMNW 4LF4L 2L9HA 4LWCA 1A62A 4L8JA 4HIOA 1JOOA 1E24A 1K8MA 1QUQB 1VQHA 2ZTEA 3MXNA 3J7AV 1KRTA 3AU7A 4F88A 3DM3A 4XTCS 4JI1L 3RZOB 5BN5A 4ULLA 4A3CG 4HCSA 3VYTA 5CV9A 3OSOA 3KDFA 1BBXC 5JPNC 2CW0C 3H15A 3RN2A 4HN7A 4A3JB 3F2CA 1L2FA 3GV3A 5C3EG 1SXTA 2O2LD 5IP9H 1FGBD 2MP1A 3I7FA 3ZJYC 4POFA 3OWEB 1LTLA 1VMCA 4R4IA 1BF4A 1IZ6A 4QIWE 3TQYA 2AQ2B 4ALPA 3BVZA 2OWOA 4B9WA 4OX9L 2JA7B 3DEOA 5I4DA 5C44H 4DAMA 1IBLL 3V05A 1PFMA 1X56A 2ASBA 2B2TC 3HOYB 3S17H 4GKJQ 1KDCA 2PMZB 4XDXA 1WD1A 1RTNA 4C3IH 1TWFH 4LF7L 4M1UB 4FF3A 3W1GA 3TEHB 1NR2A 3BDLA 3U58A 3GTOB 3HZXA 3S1RH 4IALA 3CCRA 4B3RL 5T1GA 1HFNA 1IKLA 2DY7A 2AUKA 3L7ZC 5GAHC 2R3ZA 5LMUQ 4JI5Q 1E1OA 4OXPA 5D3IB 4DV7Q 3TS0A 2R6GA 4UP9A 1L1OB 4ILWA 5LL6X 2E2JB 3TRZA 1SBBB 2F0HA 1XMOL 1YEZA 5BN4A 3K8AA 3NENA 1UE7A 3SE0A 3D8GA 5FLMG 1NUCA 5M5WH 1NBWA 3NBHA 3GTKH 1GUTA 4Q5VA 1HZAA 4AH6A 3A8JE 3HKZG 3QOLA 4H0LC 1VQBA 2O5JC 1X9NA 2Z4IA 1WD0A 4JV5Q 3PQIA 2E2IB 4A3IH 4F8MA 1YNND 5E3FA 4ZUJA 3EQLC 4DV3Q 3SEBA 3I4MH 4A4IA 4S3SA 1OXXK 3OWFA 1XMQL 1B2TA 5KNDA 2KCCA 3M7NA 4OONA 1SNOA 2BH8A 2NZOA 4O1NA 3K58A 1PH4A 3EROA 3RZOH 2EE1A 1K73C 4IFDH 3J81c 4DUYQ 1M90C 1PH6A 5FLXL 4KN7C 3VR2A 3I56A 1SNPA 1BUVT 1PYSB 4NPSA 1H9JA 1AH9A 5IT9L 1IW7C 2RKSA 4P72A 4HCEA 1Q1BA 1CHPD 4K6DA 2KEDA 1X6OA 1G8ZD 1KIXA 1LTRD 1G6ZA 1BCPD 4IQZA 1LTGD 3KLRA 1XNRL 1QE6A 1B4OA 1GUGA 1TWAB 3HEJA 2KOLA 2XWBB 5IYBG 2YV5A 2HIVA 1QG7A 4N9TA 1KC8C 3IKJA 1Z6HA 3ND9A 5IIFA 1MJCA 3HOYH 3PUWA 2B29A 4DV1Q 1PHJA 5KEEA 1VQEA 2WFWA 1ASZA 1PDQA 1PH8A 1HHVA 1EUJA 1GD7A 5M3MH 2V1CC 2JEAI 2YTVA 2KBNA 4GKJL 3G71A 5FO9B 2EDGA 5HGQA 1NR4A 3BYTB 3S15H 1XPRA 2R7ZG 2EY2A 3UI2A 5IGFA 1KABA 4BY1G 4BY7H 1I4GA 4LF9Q 4M8AA 1PA6A 2D2CC 3T4AC 5LMUL 2VQEQ 4FYDA 4RH6A 3DXJC 2E76C 2VQFQ 4K8JA 3A8KE 1MI2A 1EOTA 4EGVA 4U68A 2O5IC 4C2MB 3LNNA 2H5XA 3NELA 1A6XA 1WTQA 2YU9B 1NE3A 2F0NA 3K80C 3AMUA 3BDOA 4XT3B 1J9OA 1T5XD 3L3OC 1C8CA 2KENA 1LT6D 1GUSA 3MZ5A 4IOAA 4HSVA 4GN4B 3GTGH 1EY6A 4DR4Q 4PG3A 4O42A 1ESRA 1KNAA 4O2DA 1VQMA 1B70B 4YWMA 3QJYA 2H1EA 4EQOA 1X65A 1KNEA 1JWSD 3IL8A 2EYMA 1XNQQ 3WOEA 5E7NA 4POGA 2NVYB 4LF6L 1KLGD 4XYQA 4RFBA 2QCPX 5C3XA 1VQIA 1TT2A 2K5QA 3VYRA 3PUXA 1BDOA 3MXNB 1F9RA 2GVAA 4ID6A 1K8OA 4BBSH 3IFTA 2ES2A 3HOXG 1S5BD 1SRUA 2JYOA 3H3VC 2DNCA 2PZUA 4DUYL 3K5MA 4JBKA 1VQ6A 5FJ8H 3UDXA 4I65A 4LFBQ 2Q2TA 3KDFB 1EQVA 4PZ8A 3G4SA 1VF5C 1N33L 1AW7A 3BVMA 1AP0A 3A8IE 5I2XA 4A3LG 3F2DA 1ZEQX 2WKDA 2CFMA 1YJ9A 1X3QA 2MNAA 4ZRZA 2VL6A 3UDIA 2EZVA 3GTMH 2HD3A 3ZYYX 2A19A 3S1NH 3M4QA 5C4XH 2R92G 3C3LA 3HOVH 5IYDH 2A1AA 4X3TA 2KCMA 4TKOB 3QIAA 4JBMA 1F9PA 3NSWA 4NXNL 3A5UA 1M4VA 2B63B 1EZ6A 3M85A 2DGYA 1PRTC 4TSSA 4A3DH 3E0JA 2J0TD 2QEJC 1ET6A 2JA6B 1IBMQ 1WTPA 2PNRC 4BBRG 1VQPA 1EYCA 2ZXPA 3KJOA 3VA5A 5GAGC 1PYWD 3H0GB 4QB4A 3M4OH 5NUCA 4XIGS 1P8LA 2F0JA 2M2LA 4YCWA 1YNJD 4G7OC 2G5DA 2HQEA 2VQEL 3D6WA 4A76A 4OL7A 5KRUA 3JAML 4GOPA 1B44D 2VQFL 3NK9A 2YU9H 1NY4A 3BYYB 1VQLA 3ERSX 4MNOA 5E4XA 3NBHB 3X3NA 2B2VA 1KXLA 4HAEA 4WORA 1J5EL 1TS4A 4K5VA 2MO0A 2EVBA 3IRBA 3VR4A 4DPGA 2IX3A 4BWGB 2OQ0A 1K83H 4I7AA 1D6EC 4YWKA 4H02A 5K5PA 1JOKA 4UP7A 4YY3L 4LF8L 3H3VI 2A6HC 2VZAA 3FKIB 3Q6SA 4DR4L 4APVA 2NVYH 2UUCL 1SYGA 2K5HA 4YWLA 1W2BA 4A3BG 2LY7A 2YTXA 3UE1A 5KYIA 1XNQL 1JC7A 3STBD 1PTOC 4K2LA 1XPUA 2VUMB 4MIUA 3R2TA 3V96A 2EJMA 1Y8OB 2NVXH 1Q90A 3NBIA 4DF7A 2F4IA 4JI3Q 1AZPA 1NAPA 1UEAB 4MTKA 4ODGA 1II3A 4QUFA 4A3EH 3MFGA 4JYAQ 4TQUS 4LAAA 1DONA 3MHBA 1WVLA 2OXPA 1Q82C 1AEXA 1C0AA 1FR3A 2A5HA 1ONLA 3T13A 3RR5A 3DLLA 1BOSA 4KD3A 5M3FG 1YJNA 1S4ZA 2F0EA 3DWPA 1EY9A 2UXCQ 1V1PA 1QVGA 1AN8A 5EAYA 4XYOA 5C4JB 1W6KA 3QO2A 2JK8A 5DEHA 1G291 1STGA 5IY0A 5IODA 4A3MH 4MN3A 1WTHA 4L5TA 1JB3A 1ILPA 2A6EC 5K36H 4FXKC 1SDFA 4FXGC 4L5QA 1IBML 2K14A 2XIWA 3NTHA 1TIID 1A3TA 4DNTB 5CV7A 1B3QA 1FL0A 3CPFA 5HURA 1B8AA 1PFBA 2D9UA 4PMWA 5CC4A 1SYBA 3F8TA 3I2ZA 1LT4D 1DYQA 1G91A 4UY8C 3CD6A 1MKHA 2JSOA 1Q12A 3OHXC 3ONAB 3U4VA 4YHHQ 1CK1A 3J80i 3A74A 1TQOA 2VY3A 4B3TQ 1UE6A 3KLWA 2NB0A 3FKIH 5ELNA 5DM63 5E1FA 3G6EA 3PSIA 4X62Q 3K57A 4HIMA 4CJ1B 1S5FD 4C3JG 2JA9A 3JAMc 4Y7NH 1MJEA 1V1OA 4V0BA 4L6TB 5F2DA 1HXYD 1OO9B 5C4ZA 1U5KA 5ELDA 2BDOA 2JA5G 2ZTDA 1DM0B 5JAVA 3S1QH 2VUMH 3KLSA 5D14A 2F0DA 5C0XJ 3Q0AA 4HIDA 2JA8B 1O7YA 5LL6S 3HOUG 2A74C 2WB1E 1SR3A 5CV6A 2F3IA 1FNVA 1D1IA 3CAMA 3K5OA 1LYLA 3VR6A 3G48A 2KHJA 4FF1A 3T1YQ 4Y52H 3HGBA 1JT8A 3ULPA 2UXBQ 5ELBA 2AKWB 5JJLA 4RA8A 1Q3LA 1SMXA 2R7DA 4JI3L 1HNXL 3PO3G 3G7LA 2I07B 5EJWA 1RTOA 1IBKQ 1TS2A 1GOZA 4XQJA 4U673 1LTID 1EZ8A 4QGUA 2M9VA 2B2YA 2UUBQ 3AFQA 3GDEA 5C4JH 1F9QA 5CGKA 1EIFA 4GKKQ 4RCNA 2EIFA 2F4VQ 3RLOA 1HJPA 2R93G 3I4NG 3W2DA 3CHBD 3KFUA 2BCOA 3CF5A 2RHQB 5KNBA 2F0GA 1CKMA 1D2BA 1N34Q 5EPLA 4UHVA 2N3SA 1XWEA 4X3SA 4A3GG 1X3GA 2IWHA 1FNUA 2DY8A 4CBVA 2K52A 1WYDA 3OYYA 5C44B 4A93B 3CCJA 1VCIA 4HJ7A 3S17B 4DR3Q 3PIO3 4DR5Q 1UUPA 5IE8A 4YIJA 4RKBA 2XRSD 4C3IB 1TWFB 4KLKA 4IJLA 5A2QL 2DJGC 4GOPB 4FP5D 4CJ2C 4H44C 3TZDA 3S1RB 2UU9L 4YHHL 4PMCA 2EQSA 4A3CH 3C1FA 1IYUA 4GN3B 3U9OA 3TBIB 2AMCB 4B3TL 1I50H 4R4CA 1TWCH 1VQNA 2EJFC 2E74C 3UDGA 1I4HA 4IUPA 5JJKA 2WV6D 1F77A 3N6RA 4FVMA 4N8FA 5C3EH 1Y1VG 4JI0Q 5M5WB 3GTKB 1KAAA 2F3VA 1KAWA 4CDDC 2CQAA 2EY6A 1CFMA 1TKWB 2RA4A 4QMGA 1E2VA 2RQXA 4A3IB 5AJ3L 3ITPA 3J81E 5GADC 3I4MB 3S9WA 3AFPA 3PCOB 4DGZA 1RODA 1YVCA 4LW1A 5BN3A 1I3QH 1SNDA 4DA2A 1GHJA 5CV8A 1CKOA 3W5OA 2IHFA 3URYA 5IWAL 1YITA 3KF6A 2UXBL 2EOTA 1RDPD 1VF7A 4ZKCB 1EOVA 4ZK9B 1SFOH 3MC0B 2MQHA 4OIKA 1WTWA 1JORA 1V9PA 4LUVA 2DUDA 5LHY1 4X65Q 2Z9HA 2IX0A 1QILA 2A73B 1IBKL 1JR0D 3TREA 3RZDH 2IT1A 3FMCA 1PFNA 4BY1B 2KEEA 3LGJA 4IOCA 4P73A 5FLMH 1RL2A 4QQBX 4GKKL 4HSPA 1QNUA 1KRSA 1V1PB 4XQNA 2F4VL 5BR8Q 1CA6A 1BKBA 4IFDJ 1K0SA 1N9WA 3DWQA 1GM5A 1OXTA 1VQDA 1HH2P 2WB1G 5IP7G 1QOHA 1N34L 1ESFA 1VQAA 2F0KA 4A93H 2B39A 3ULJA 1I94Q 4KY5A 4WJ4A 3SGIA 2Q2IA 4C3HG 3HFZB 1EFWA 3S16H 1OTCA 5EKIA 3A55A 4WRDA 5CV5A 3H09A 2KECA 1I6HB 1NCVA 5M3MB 1VDZA 4DR3L 4A3KG 4LF5L 2A8VA 2PI2A 4DR5L 5CR3A 4IPCA 2ZM6L 1RD9D 3PGZA 2PMZE 4LFCL 5EGTA 3S15B 3NQIA 4NW2A 1PFSA 5CV4A 5JEAJ 3I8ZA 4CJ0B 3FRPB 4BS9A 1BCPC 5IYCG 4BY7B 3R93A 5H1SE 4K5WA 3SR1A 4GNXC 2I5HA 1DXMA 1CT1D 3WWVA 4LJZC 3W1BA 3TSSA 1LT5D 5J3BA 1CA5A 4JI0L 1EYAA 1HNWQ 3D31A 5IYBH 5EPKA 1UNSA 1I4PA 1XPOA 4DAPA 2CVRA 1E2WA 4DR1Q 2QEXA 3GTGB 4B3SL 2V4DA 1I5FA 1A63A 2R92B 1WCMG 2BA0A 5CORA 3J80c 1CUKA 3K6OA 3OIQA 4R4OA 3TMEA 1UAPA 3KBGA 5FO7B 2OEOA 2RVLA 2FXQA 1HCZA 2NZ1D 4FF2A 2CH4W 2J4XA 3TZUA 3MXGA 2R7ZH 1C4QA 3VYSA 2ATWA 4BBSB 4BY1H 5FLXE 3WDNA 3GO5A 1SE8A 1H9SA 2AQ1B 1T9HA 1LUZA 1H9MA 2ZTCA 1PH7A 2XSCA 2BH2A 5EBDA 3AEVA 4AYBB 2Q2UA 2VXWA 3BU2A 5ELOA 3S1MB 1S5DD 2NYZD 1X3PA 4F87A 1UE1A 3E6ZX 3PIPA 3X3MA 1WFQA 4DAVA 1EY7A 5BR8L 2ID0A 4X3UA 1NJIC 3PUZA 3IFDA 5JEAH 1YZ6A 5JVH3 2DN8A 3J7AF 2PQAA 3GTMB 3S1NB 2B2WA 4MZ9A 5C4XB 5I9OA 1HTLD 4OELB 1YHBA 1I6HH 2E75C 3HOVB 3TP7A 5CMDA 1X32A 2CWAA 1A2TA 4HEDA 3JAMi 4OO1G 4QCLA 1L0YB 3BJUA 1SEBD 4B3MQ 4LNQA 4A3DB 3A56A 3PV0A 4H7BA 3HOXH 1PMRA 2K7VA 1WTRA 4LFAQ 1RIPA 4JI5L 4R4QA 2IY5B 2JQOA 4DV7L 3BDCA 1HQRD 2P5ZX 4DXGA 1UE5A 3P75A 1N36Q 3F1ZA 3E9IA 3FHWA 3OW7A 4HMJA 2F1MA 3M4OB 5CYUA 2QW7A 3PUYA 2FMCA 3GV6A 2JJQA 4JBWA 3K81C 1Q8IA 1L0XB 4YCVA 3BS1A 1N8RC 2YTYA 4A3JG 3F2UA 4A3LH 1TY2A 1BQQT 4H13C 3SK4A 4IUNA 2NTTA 2NBFA 3KBXA 4FO2A 4IUUA 4JV5L 3MEHA 1HNWL 2RCFA 1EY5A 1C9OA 1K83B 3HOZG 3K5NA 4DV3L 2R92H 3HP3A 3MAQA 4DR1L 4DXFA 4DUZQ 1IW7D 2XRQD 2JA7G 1GVPA 4IZ8A 4HJ8A 1CM9A 4IJHA 3G6JB 1D5XC 4X66Q 3M4YA 1JJCB 2LKVA 3KF6B 4IURA 1YNJC 2Q8IB 1EWIA 4BBRH 1NTGA 1HUNA 2IW3A 1EFID 4JVZA 2NVXB 3MTSA 5M5XB 4OWTB 2OCEA 1K28A 1VQKA 4K0KQ 4LMQD 1YI2A 1ZYRD 1Y1WG 3S1MH 4P75A 2RSNA 4DFAA 4DR6Q 1QJOA 2K5NA 3PMFA 1KDBA 4DV5Q 4P74A 3GTPH 2C35B 3EN2A 4A3EB 5FLXc 3M7GA 2I0QA 4J6HA 5EKKA 5IT9c 4TVAB 3VYUA 1DCZA 2XTIA 3CRLC 2FHTA 4DN4M 2CKZB 3A7AB 4NDXA 2Z0SA 2K6AA 4DV1L 3CCEA 4DK0A 4KMUC 5EQ0A 2EYFA 3STBC 2EYJA 1I4QA 2VW9A 2L11A 1DOMA 2LFNA 2X6LA 3Q23A 4A3BH 4B9XA 1LO5D 5C6AA 3I55A 4A3MB 1SMYD 1F9SA 3LWEA 1S72A 1S5CD 2L4NA 3P7JA 2EYLA 4MTNA 4O0AA 4HR7B 4DNRB 3H91A 1WTXA 2CWPA 1GO3E 4KI0A 3J7A5 1PRTF 4CGYB 4A75A 3GTQH 3T56B 4LF9L 2EPBA 2F03A 5EPJA 4C1NI 1STNA 3QG1A 3JAME 3A0JA 2CH4A 1TU2B 2NTSA 3R2IA 4RHSA 2PYKA 5GAEC 2BE5D 2G9HD 2I5MX 2KCNA 3PO2G 3SVMA 2WAQB 1R4QB 1X3EA 3J7YW 1YBYA 1A0IA 1EY4A 1QCBD 2R7FA 4KKSA 2PZWA 1VQ8A 3C46A 3T1HQ 4Q0FA 5M3FH 4TRDA 2Y0SB 2ZJRA 2NVTB 1ENCA 3I73A 4NMZA 2PCFB 2XWJB 4Y7NB 3QB3A 1NNXA 2HUGA 3TP6A 1WJJA 4F7XA 2AWNA 1H95A 5GQOA 4UP8A 1CKNA 3CC2A 4JI7Q 3AQQA 3S1QB 4JK1C 1V8QA 4X66L 1S40A 4LK1C 2EXZA 5I2YA 5M5XH 1CTMA 3JC66 1SAPA 4CKBA 3H94A 5D65A 1PTOF 1F2YA 1EY8A 2F0WA 1SYDA 4JG2A 5G3LF 3AYHB 1H9SB 3I70A 4LFBL 2H4OA 1EQQA 1Q46A 1HUMA 4K0KL 5JJZA 4X3KA 3CP0A 4EX5A 1Q7YC 1PRTD 2HCIA 4DV5L 2K05A 4OGQC 3DUZA 1RCVD 4B08A 1KHIA 2LXKA 4L5SA 4GOPC 4DR7Q 4P71A 4C1NK 4C3JH 1SLJA 1PH9A 4UDUC 5JPMC 1X3FA 2PQAB 1J6QA 4HIKA 4AQYQ 1GXDC 3Q8DA 1VQJA 2JA5H 3L9AX 4CDCC 3K7AH 4IPDA 4KJNA 2KA7A 4WJWA 1BR9A 3F2BA 4DV2Q 3HOWB 1G6PA 1ZXTA 1K8GA 4ZKBB 3HRZC 1CQFA 1SNCA 5ISRA 4XXEA 1DZ1A 4RAUC 1HQMC 1XJVA 2B2UC 1LLRD 3PO3H 1R4PB 1FJGQ 2K32A 2NVQB 3EA6A 3TP5A 4DV0Q 5C4HA 3KYHC 3SK6A 1M1KC 3EIVA 2NVTH 1DGSA 3CPWA 4GN5A 2JE6I 1I50B 4GLVB 1JE4A 2F0MA 3RUZA 3T1HL 1TWCB 4RG1A 2GA4B 2K03A 5C3EB 1BO0A 1EYDA 2R93H 3I4NH 2Z6KC 4RGMA 3CCUA 3M3YH 4JOIC 3KJPA 1RKNA 2VNUD 1O78A 2WIIB 4OWXB 1PRTB 2XNAC 4JI7L 1V43A 2B63G 1W6JA 4QY7A 1AZQA 1EWCA 4RKLA 1V1QA 1CSPA 2HDMA 1MSGA 2VS1A 2UUAQ 2JA6G 1BBWA 3E9HA 4ZUIA 1I3QB 1YHQA 5FOBB 2A68D 3QWNA 3K0XA 4LF4Q 3H0GG 2PW5A 2YYZA 1SN8A 3E0EA 4KHZA 4XT1B 1EU4A 3RNUA 4PZ6A 1I6VC 5DM73 1PH2A 4JYAL 1SFOB 1EWHA 1PVOA 5HGTA 1HZBA 3S14H 3RZDB 1MD2D 2Q8TA 1HTPA 4NKLA 1U4RA 2Z1CA 2UXCL 4DR7L 4OO1I 5JJIA 1L1OC 1VS0A 1VMPA 1Y1VH 3D4RA 4BXXG 4KK7A 1TY0A 1OXSC 1B9MA 1XYIA 1JMCA 3HKZB 1ML0D 2F3WA 1KLUD 3HOWH 2SOBA 4NXMQ 2QDBA 2HIXA 4FF4A 2F0QA 2MO1A 1PTOB 1SYCA 4DK3C 4OHJA 3H3VH 2XN9C 1XTCD 4DV2L 3CQZB 1E2ZA 1FGUA 4KHPQ 1MBYA 4IFDI 3NPPA 1HA5A 2DJFC 2NVQH 3T53B 4GLXA 4OX9Q 3S16B 4JI2Q 1GHKA 4A3FG 4WFN3 1O7LA 1YIJA 5A2QE 1L0WA 1A8VA 1FJGL 1IXRA 3SK5A 2K5WA 1E7ZA 1DJRD 3CCLA 4X62L 4B3RQ 2JN4A 1E1TA 1AE2A 2E2DC 5C5LA 2E8GA 3A54A 4N8X1 2LS01 1W3SA 1CI3M 3J80E 2HHHQ 1STAA 2JP1A 2EYHA 1EEID 2A69D 4JW0A 3S24A 3EFXD 1LACA 5IP7H 1FYCA 1CKNB 2B2TA 1VQ4A 2JXMB 1FNWA 4RHRA 5I6WA 3CMAA 3GD7A 4C3HH 2X69A 3NTIA 3T1YL 5T1IA 4DK6C 2GN5A 2PQEA 4R8NA 1F2MA 3C2PA 3RLNA 2VB2X 3I4OA 1K9MC 4R8IA 4A3KH 3D0FA 1RJTA 1QVCA 4QL5A 3J81L 2KHIA 3NP8A 1VQCA 3MXUA 3VDYA 1F2LA 4R9WA 3T51B 2SNMA 2R7ZB 5IYCH 3NEMA 2RDFA 2RSOA 4GNXA 2J7ZA 3LX0A 2UUBL 4RWSC 4GS3A 1YHAA 2NN6G 1XTDA 1QVFA 1PV4A 5E4WC 5C0XG 5J22A 1YNNC 3RMHA 1JJ2A 1GUNA 2RHSB 2ZXOA 4FXDA 2N49A 1A3VA 3S2DB 1NMFA 2EYOA 1KQSA 3HKSA 3AB9A 1PTOH 4LUOA 1EL0A 4QIWB 3CQZH 1ENAA 1PYBA 1XNRQ 4NXML 1PZID 3HOZB 3ERQA 1CZGA 3J7ZC 1SSOA 4BA1I 1WCMH 3RLFA 4ZQ3A 4ABNA 2JA8G 5KYLA 3MA2B 3D3RA 4KHPL 1EEFD 1TWHH 2K01A 1N32Q 1U4MA 2GVBA 3ER0A 1IKMA 1G2TA 5KIXA 5IGBA 4JI2L 4GLAC 1B3AA 3A7LA 1Q8KA 1IYJB 4KHVA 1Y8PB 1R9TH 1HFGA 3HOXB 1QZHA 3BG3A 2OTJA 4WJ3M 2K75A 1SNQA 1Z47A 2SNSA 1JOQA 4KN4C 5A35A 1BBUA 2PO4A 3MEFA 1SE3A 1NMGA 4IPHA 2ZJQA 2RDHA 3EBEA 1Y1WB 1BCPF 4FDBA 3P20A 2IPKD 2HHHL 1E0BA 3FEWX 2ZXRA 2SEBD 1SE2A 4HTHA 3TN2A 3LWUA 3MWYW 1PLFA 4QJFA 5IP9G 1PH1A 3KLSX 2CW0D 2TMPA 3GTLH 3OW2A 1HR0Q 1SYFA 2F52A 2ICIA 1RHPA 3GTJH 4DR2Q 2E2HB 5GROA 2MUYA 4IUVA 4OO1H 1WTVA 5C44G 4K8IA 4A93G 3OOCA 3GQBA 4PQXA 5DNFA 1HZ9A 3K0YA 4LF6Q 4ZLTF 4X65L 2C5CA 1PXUA 1SE4A 3NHHA 3CCVA 3HG9A 3A5ZB 4BBRB 4C3IG 5IT9E 1XX8A 1K0RA 1B7YB 3CCQA 2SDFA 4OWWB 1D8LA 3GP7A 1BVSA 1QWYA 3CXCA 3S2DH 5COYA 3FPUB 4A3JH 3ND8A 2IJ0A 3GTPB 3L2PA 3PO2B 4DV4Q 3S2HB 3T16A 3SDZA 4EQ5A 1N33Q 2F0IA 2QKIC 3NUCA 4AYBE 5AFWA 3HOZH 4NP5A 2PPBC 1EQRA 1ICFB 4EVOA 2OT2A 1F2ZA 2B8GA 4JI6Q
chains in the Genus database with same CATH topology
2D0PA 4JC0A 1I94L 2JA5G 1KRTA 5GAEC 2ZTDA 4PZ7A 1X55A 3K7UC 2I5MX 2JA7H 4A3IG 2VUMH 3DM3A 4XTCS 3PO2G 4JI1L 3S1QH 1X3EA 1YBYA 3I4MG 5C0XJ 4HIDA 1A0IA 4A3CG 1N32L 3HOUG 3KDFA 2R7FA 2WB1E 1SR3A 3H15A 3RN2A 2F3IA 3CAMA 1LYLA 4X64Q 1VQ8A 3F2CA 1L2FA 3G48A 3T1HQ 4NXNQ 2KHJA 5M3FH 3T1YQ 4Y52H 5C3EG 5IP9H 2ZJRA 3GTOH 1JT8A 3ULPA 2UXBQ 2AKWB 2K4KA 5JJLA 2K50A 3I7FA 3ZJYC 4POFA 1SMXA 2R7DA 1UEBA 4JI3L 1HNXL 3PO3G 4IFDG 1LTLA 1Y1WH 4R4IA 1WJJA 2AWNA 1IZ6A 1IBKQ 1H95A 2N8NA 2UXDQ 1TXYA 4QIWE 2E2JH 3TQYA 4NB3A 5GQOA 4UP8A 1CKNA 4ALPA 3CC2A 4JI7Q 2OWOA 4OX9L 3AQQA 4QGUA 5C44H 4DAMA 1S40A 4X66L 2D0OA 1IBLL 4IO9A 1X56A 2UUBQ 4HJ9A 2ASBA 5M5XH 3AFQA 3S17H 3GDEA 1VQ5A 3JC66 4GKJQ 5C4JH 2RF4A 1EIFA 4GKKQ 2EIFA 4C3IH 2E2HH 1TWFH 1J5EQ 4JG2A 4LF7L 2F4VQ 1QZGA 3RLOA 3AYHB 1HJPA 3TEHB 3W1GA 1MIUA 4LFBL 3U58A 1EQQA 2E2IH 1Q46A 2R93G 3I4NG 4K0KL 3KFUA 3CF5A 3S1RH 2RHQB 3CCRA 1HR0L 4LF8Q 4B3RL 1CKMA 4YY3Q 1K8AC 3OTOQ 3CP0A 5GAHC 3L7ZC 4EX5A 4DR2L 1N34Q 4YCUA 2N78A 5LMUQ 1E1OA 4OXPA 5JEAG 2N3SA 4DV7Q 3TS0A 4DV5L 1Q7YC 2R6GA 4UP9A 1L1OB 4A3GG 2RCNA 1X3GA 3PIOA 2UUCQ 3TRZA 2K52A 2I5LX 1YEZA 4AIMA 3K8AA 1XMOL 3NENA 1WYDA 3OYYA 4J15A 1UE7A 1KHIA 2LXKA 2OQKA 2WP8J 4L5SA 5M3MG 5FLMG 4GOPC 4P71A 5M5WH 4DKAC 2PNHA 1NBWA 3CCJA 1VCIA 4C3JH 1SLJA 4HJ7A 1PH9A 3GTKH 1HZAA 4DR3Q 1X3FA 2PQAB 4DR5Q 1J6QA 4AH6A 3HKZG 5IE8A 4HIKA 4AQYQ 1VQBA 2NZHA 2ALYB 3Q8DA 1VQJA 4GNXB 1X9NA 4JV5Q 4KLKA 1U0LA 3B6YA 4IJLA 2JA5H 3CC7A 4GOPB 4R4TA 3UDFA 2ZJPA 4BY7G 4A3IH 3PO2H 3CMEA 3S2HH 1YNXA 2UU9L 3K7AH 4DV3Q 4IPDA 1KD1C 3I4MH 3F2BA 4YHHL 4A4IA 1HNZQ 2EQSA 4A3CH 1OXXK 1X54A 4GN3B 4DV2Q 2AMCB 4B3TL 1I50H 2HT1A 1G6PA 1XMQL 4R4CA 1TWCH 1VQNA 3UDGA 4DV4L 1K8GA 5JJKA 3M7NA 4OONA 5C3EH 1TWAH 1XJVA 1Y1VG 4JI0Q 2BH8A 2QGQA 2NZOA 1PH4A 3RZOH 1K73C 3PO3H 1OXUA 1FJGQ 4JI6L 1KAWA 1Q86C 3J81c 4DUYQ 1M90C 4DV0Q 1PH6A 4IPGA 2XGTA 3KYHC 3I56A 1M1KC 5AJ3L 1PYSB 4B3ML 5GADC 3EIVA 4NPSA 2NVTH 1AH9A 3AFPA 3PCOB 4P72A 1DGSA 1YVCA 4LW1A 3CPWA 1I3QH 2JE6I 1Q1BA 4GLVB 4GN5A 1PH5A 4X64L 1PH3A 4LFAL 1X6OA 1VQGA 2IX1A 1CKOA 3T1HL 1KIXA 3W5OA 2IHFA 4RG1A 5IWAL 1YITA 1XNRL 3KF6A 1N36L 2UXBL 1G51A 1FVIA 2R93H 5IYBG 4BBSG 2YV5A 1EOVA 2HIVA 2PI2E 1SFOH 2Z6KC 3CCUA 4LUZA 3I4NH 1KC8C 2MQHA 4JOIC 3M3YH 1V9PA 4LUVA 2DUDA 1Y14B 4X65Q 4JI8Q 2IX0A 3KJPA 1IBKL 1MJCA 3HOYH 3TREA 3PUWA 2VNUD 2UXDL 2B29A 4OWXB 3CCSA 4DV1Q 5FJ8G 1PHJA 3RZDH 2IT1A 2E5LQ 4JI7L 1VQEA 2WFWA 1V43A 1S3OA 3UE0A 1GKHA 4AYBG 1ASZA 2B63G 5LMNQ 1PH8A 4QY7A 3LGJA 1TWGH 1EUJA 1GD7A 4C2MH 1V1QA 1CSPA 4IOCA 5M3MH 2V1CC 4P73A 1RL2A 2YTVA 5FLMH 2JEAI 2KBNA 2Q2HA 2VS1A 2WAQE 2UUAQ 3G71A 2JA6G 4GKJL 1BBWA 1WOCA 3E9HA 1YHQA 4GKKL 1KRSA 2F4VL 5BR8Q 1BKBA 3K0XA 3M4PA 5HGQA 4DUZL 4DV6Q 3H0GG 4LF4Q 3S15H 4IFDJ 2YYZA 1XPRA 2R7ZG 1N9WA 1SN8A 3E0EA 4KHZA 1GM5A 3RNUA 1OXTA 4PZ6A 2Y0SE 1PH2A 4JYAL 4BY1G 4BY7H 5C4XG 1VQDA 1HH2P 2WB1G 5IP7G 3OTOL 1PVOA 4LF9Q 1PA6A 1N34L 5IYDG 3HOVG 1VQAA 2VQEQ 5LMUL 4A93H 3ULJA 2VQFQ 1HZBA 1I94Q 3S14H 1D7QA 4WJ4A 3SGIA 2Q2IA 3HFZB 1EFWA 2NN6I 3S16H 1OTCA 2LSSA 4A3DG 2UXCL 4DR7L 4OO1I 5JJIA 5C0XI 1L1OC 1VS0A 1Y1VH 1E22A 2H5XA 3NELA 4DR3L 4A3KG 4BXXG 1NE3A 4LF5L 2A8VA 2PI2A 4DR5L 3K80C 1OXSC 4IPCA 4DR6L 2ZM6L 1JMCA 2KENA 4IOAA 4DR7Q 3HOWH 4GN4B 3PGZA 4RMFA 2CCZA 2PMZE 4LFCL 3GTGH 1QUQA 4PG3A 4DR4Q 2CQOA 1PFSA 4O2DA 5JEAJ 1B70B 1VQMA 2HIXA 4NXMQ 3HOYG 4L5RC 4YWMA 5IYCG 4HJ5A 2MO1A 1HR0W 4DK3C 1HNXQ 1HNZL 2OTLA 5H1SE 1X65A 4GNXC 3H3VH 4DV2L 2I5HA 1FGUA 4KHPQ 1XNQQ 5E7NA 4POGA 4IFDI 4LF6L 3WWVA 3W1BA 1VQIA 2NVQH 4GLXA 4OX9Q 4JI2Q 1EYGA 5J3BA 4A3FG 3PUXA 4JI0L 3MXNB 2GVAA 2K5VA 1YIJA 2QA4A 2Z6KA 1HNWQ 3D31A 5IYBH 2ES2A 4JOIA 1L0WA 3HOXG 1IL2A 1XPOA 3CC4A 4BBSH 1A8VA 1SRUA 1FJGL 3PF4A 1VQ7A 1IXRA 4DR1Q 4DUYL 1VQ9A 4JBKA 1E7ZA 2QEXA 1VQ6A 3HOUH 4QQBX 5FJ8H 4B3SL 1AE3A 3UDXA 1EIYB 4LFBQ 1C7YA 3CCLA 2BA1A 3KDFB 2Q2TA 2B63H 1I5FA 1A63A 4PZ8A 3G4SA 1N33L 4X62L 1WCMG 2BA0A 4B3RQ 3J80c 1CUKA 1E1TA 1AE2A 3U4ZA 2JEBI 4R4OA 2B3GA 2E8GA 4A3LG 3F2DA 2JA6H 3M9BA 1W3SA 2HHHQ 3CW2C 2CFMA 1YJ9A 1Z9FA 2FXQA 2MNAA 2VL6A 3H0GH 3S24A 1WI5A 3UDIA 2R7ZH 3GTMH 3S1NH 2A19A 3M4QA 2ATWA 5C4XH 4BY1H 2R92G 5IP7H 4JI4Q 3GO5A 1SE8A 4JI8L 1CKNB 1T9HA 1LUZA 1VQ4A 2ZTCA 2A1AA 1PH7A 3HOVH 2BH2A 5IYDH 2KCMA 2E5LL 4JBMA 3AEVA 4A3EG 3CMAA 3GD7A 4C3HH 3A5UA 4NXNL 5LMNL 2D62A 3T1YL 2Q2UA 3M85A 4DK6C 2GN5A 3BU2A 2UU9Q 1L1OA 2DGYA 5ELOA 4A3DH 3RLNA 3I4OA 1K9MC 4BXXH 4A3KH 1UE1A 3D0FA 3PIPA 1IBMQ 1WFQA 1QVCA 4BBRG 1VQFA 2ID0A 5BR8L 4QL5A 1VQPA 3KJOA 4DV6L 1NJIC 2KHIA 5GAGC 3PUZA 4R1JA 1O7IA 2IHEA 1HZCA 1YZ6A 1VQCA 3VDYA 2PQAA 3J81i 3M4OH 4A3GH 1OXVA 4XIGS 5K36G 1P8LA 4YCWA 1SROA 4MZ9A 3NEMA 5IYCH 4GNXA 1UWVA 2VQEL 4A76A 2UUBL 1YHBA 1I6HH 4GOPA 4GS3A 1YHAA 4X6AH 4A3MG 2VQFL 2NN6G 1XTDA 1QVFA 1PV4A 1NY4A 1VQLA 2YU9H 3ERSX 4MNOA 3JAMi 2CWAA 4OO1G 5C0XG 2KCTA 3ULLA 3KF8B 3NBHB 4JBJA 1JJ2A 1KXLA 1J5EL 3BJUA 2EXDA 2MO0A 2RHSB 3IRBA 5AJ3Q 4B3MQ 4A3FH 4JCVE 4DPGA 4LNQA 3TS2A 1CSQA 2N49A 2OQ0A 1K83H 1YJWA 2LXJA 4YWKA 1NMFA 4H02A 3HOXH 3HKSA 3PV0A 4UP7A 2AHOB 4YY3L 1KQSA 4LF8L 2VZAA 3H3VI 4UPAA 4LFAQ 1RIPA 4LUOA 4JI5L 4R4QA 3CQZH 2IY5B 2JQOA 4DV7L 4DR4L 5IWAQ 1PYBA 1UE5A 4APVA 2NVYH 1XNRQ 1N36Q 3F1ZA 3E9IA 4NXML 3FHWA 2UUCL 1ASYA 2WAQG 3PUYA 3J7ZC 2HQLA 3BZKA 2JJQA 1WCMH 4JBWA 4JI1Q 3K81C 3RLFA 4BA1I 2K5HA 2JA8G 4YWLA 1W2BA 4A3BG 2YTXA 4YCVA 3UE1A 1XNQL 4KHPL 1TWHH 1N8RC 1N32Q 2YTYA 4A3JG 2GVBA 3ER0A 3STBD 4A3LH 5HY6A 3FKIG 4AQYL 1VQOA 4JI2L 1XPUA 2Y0SG 4GLAC 1Q8KA 4JV5L 2NVXH 1IYJB 1HNWL 1K3RA 3PF5A 1C9OA 3HOZG 1R9TH 3FP9A 4DV3L 2R92H 1QZHA 4JI3Q 2OTJA 1LM0A 2K75A 1Q1EA 4DR1L 4WJ3M 1Z47A 4DUZQ 1BBUA 3MEFA 4A3EH 3HKZE 3KOJA 2JA7G 2VUMG 1GVPA 4TQUS 4HJ8A 4JYAQ 4IJHA 1NMGA 1Q82C 4IPHA 2ZJQA 3EBEA 1IBLQ 4X66Q 1C0AA 1JJCB 4FDBA 5DLQE 3KF6B 3RR5A 2HHHL 1EWIA 3DLLA 3U50C 1NTGA 4BBRH 5M3FG 3PUVA 1YJNA 4QJFA 1JJGA 5IP9G 4LF7Q 1PH1A 2UXCQ 4DV0L 1QVGA 4OWTB 1Q81C 2OCEA 3GTLH 5EAYA 1VQKA 4JI4L 3OW2A 4K0KQ 4LF5Q 1YI2A 1HR0Q 2F52A 2JK8A 3BZCA 1Y1WG 3GTJH 4JI5Q 3S1MH 1G291 4P75A 3CCMA 5IY0A 2ZM6Q 4DR6Q 4A3MH 4DR2Q 2AWOA 2K5NA 5GROA 4L5TA 4DAYB 4DV5Q 4LFCQ 4P74A 3GTPH 2C35B 3EN2A 5C44G 5FLXc 1XMOQ 2I0QA 5M5YH 4A93G 4ME3A 4DNIA 1HZ9A 4TVAB 5IT9c 4L5QA 1IBML 2K14A 4LF6Q 2XTIA 4X65L 3J81j 3CCVA 3A5ZB 4HJAA 2CKZB 2L15A 4DV1L 2Z0SA 1FL0A 1JE5A 3CPFA 1B8AA 3L0OA 3CCEA 1K0RA 1B7YB 3STBC 4PMWA 3CCQA 1P16A 4OWWB 2VW9A 3F8TA 1D8LA 3I2ZA 1E3PA 4UY8C 3ICEA 1BVSA 3CD6A 1MKHA 3CXCA 2JA8H 1Q12A 3U4VA 1KL9A 4YHHQ 1JB7A 3HOWG 3J80i 3A74A 4A3BH 3I55A 2UUAL 3RN5A 3S2DH 4A3JH 2VY3A 2MFIA 1S72A 4B3TQ 1UE6A 3KLWA 4B3SQ 1XMQQ 3FKIH 4BA2I 3L2PA 5ELNA 5LMNW 4MTNA 4O0AA 4DV4Q 4LF4L 1N33Q 4EQ5A 3G6EA 3PSIA 4X62Q 4LWCA 1A62A 2CWPA 1GO3E 4KI0A 3JAMc 4HIMA 4AYBE 2JA9A 4HIOA 3J7A5 4Y7NH 1MJEA 3HOZH 1E24A 4A75A 1QUQB 3GTQH 4LF9L 1EQRA 1VQHA 2ZTEA 4JI6Q 1U5KA 3A0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D0P A;  4JC0 A;  1I94 L;  2JA5 G;  1KRT A;  5GAE C;  2ZTD A;  4PZ7 A;  1X55 A;  3K7U C;  2I5M X;  2JA7 H;  4A3I G;  2VUM H;  3DM3 A;  4XTC S;  3PO2 G;  4JI1 L;  3S1Q H;  1X3E A;  1YBY A;  3I4M G;  5C0X J;  4HID A;  1A0I A;  4A3C G;  1N32 L;  3HOU G;  3KDF A;  2R7F A;  2WB1 E;  1SR3 A;  3H15 A;  3RN2 A;  2F3I A;  3CAM A;  1LYL A;  4X64 Q;  1VQ8 A;  3F2C A;  1L2F A;  3G48 A;  3T1H Q;  4NXN Q;  2KHJ A;  5M3F H;  3T1Y Q;  4Y52 H;  5C3E G;  5IP9 H;  2ZJR A;  3GTO H;  1JT8 A;  3ULP A;  2UXB Q;  2AKW B;  2K4K A;  5JJL A;  2K50 A;  3I7F A;  3ZJY C;  4POF A;  1SMX A;  2R7D A;  1UEB A;  4JI3 L;  1HNX L;  3PO3 G;  4IFD G;  1LTL A;  1Y1W H;  4R4I A;  1WJJ A;  2AWN A;  1IZ6 A;  1IBK Q;  1H95 A;  2N8N A;  2UXD Q;  1TXY A;  4QIW E;  2E2J H;  3TQY A;  4NB3 A;  5GQO A;  4UP8 A;  1CKN A;  4ALP A;  3CC2 A;  4JI7 Q;  2OWO A;  4OX9 L;  3AQQ A;  4QGU A;  5C44 H;  4DAM A;  1S40 A;  4X66 L;  2D0O A;  1IBL L;  4IO9 A;  1X56 A;  2UUB Q;  4HJ9 A;  2ASB A;  5M5X H;  3AFQ A;  3S17 H;  3GDE A;  1VQ5 A;  3JC6 6;  4GKJ Q;  5C4J H;  2RF4 A;  1EIF A;  4GKK Q;  2EIF A;  4C3I H;  2E2H H;  1TWF H;  1J5E Q;  4JG2 A;  4LF7 L;  2F4V Q;  1QZG A;  3RLO A;  3AYH B;  1HJP A;  3TEH B;  3W1G A;  1MIU A;  4LFB L;  3U58 A;  1EQQ A;  2E2I H;  1Q46 A;  2R93 G;  3I4N G;  4K0K L;  3KFU A;  3CF5 A;  3S1R H;  2RHQ B;  3CCR A;  1HR0 L;  4LF8 Q;  4B3R L;  1CKM A;  4YY3 Q;  1K8A C;  3OTO Q;  3CP0 A;  5GAH C;  3L7Z C;  4EX5 A;  4DR2 L;  1N34 Q;  4YCU A;  2N78 A;  5LMU Q;  1E1O A;  4OXP A;  5JEA G;  2N3S A;  4DV7 Q;  3TS0 A;  4DV5 L;  1Q7Y C;  2R6G A;  4UP9 A;  1L1O B;  4A3G G;  2RCN A;  1X3G A;  3PIO A;  2UUC Q;  3TRZ A;  2K52 A;  2I5L X;  1YEZ A;  4AIM A;  3K8A A;  1XMO L;  3NEN A;  1WYD A;  3OYY A;  4J15 A;  1UE7 A;  1KHI A;  2LXK A;  2OQK A;  2WP8 J;  4L5S A;  5M3M G;  5FLM G;  4GOP C;  4P71 A;  5M5W H;  4DKA C;  2PNH A;  1NBW A;  3CCJ A;  1VCI A;  4C3J H;  1SLJ A;  4HJ7 A;  1PH9 A;  3GTK H;  1HZA A;  4DR3 Q;  1X3F A;  2PQA B;  4DR5 Q;  1J6Q A;  4AH6 A;  3HKZ G;  5IE8 A;  4HIK A;  4AQY Q;  1VQB A;  2NZH A;  2ALY B;  3Q8D A;  1VQJ A;  4GNX B;  1X9N A;  4JV5 Q;  4KLK A;  1U0L A;  3B6Y A;  4IJL A;  2JA5 H;  3CC7 A;  4GOP B;  4R4T A;  3UDF A;  2ZJP A;  4BY7 G;  4A3I H;  3PO2 H;  3CME A;  3S2H H;  1YNX A;  2UU9 L;  3K7A H;  4DV3 Q;  4IPD A;  1KD1 C;  3I4M H;  3F2B A;  4YHH L;  4A4I A;  1HNZ Q;  2EQS A;  4A3C H;  1OXX K;  1X54 A;  4GN3 B;  4DV2 Q;  2AMC B;  4B3T L;  1I50 H;  2HT1 A;  1G6P A;  1XMQ L;  4R4C A;  1TWC H;  1VQN A;  3UDG A;  4DV4 L;  1K8G A;  5JJK A;  3M7N A;  4OON A;  5C3E H;  1TWA H;  1XJV A;  1Y1V G;  4JI0 Q;  2BH8 A;  2QGQ A;  2NZO A;  1PH4 A;  3RZO H;  1K73 C;  3PO3 H;  1OXU A;  1FJG Q;  4JI6 L;  1KAW A;  1Q86 C;  3J81 c;  4DUY Q;  1M90 C;  4DV0 Q;  1PH6 A;  4IPG A;  2XGT A;  3KYH C;  3I56 A;  1M1K C;  5AJ3 L;  1PYS B;  4B3M L;  5GAD C;  3EIV A;  4NPS A;  2NVT H;  1AH9 A;  3AFP A;  3PCO B;  4P72 A;  1DGS A;  1YVC A;  4LW1 A;  3CPW A;  1I3Q H;  2JE6 I;  1Q1B A;  4GLV B;  4GN5 A;  1PH5 A;  4X64 L;  1PH3 A;  4LFA L;  1X6O A;  1VQG A;  2IX1 A;  1CKO A;  3T1H L;  1KIX A;  3W5O A;  2IHF A;  4RG1 A;  5IWA L;  1YIT A;  1XNR L;  3KF6 A;  1N36 L;  2UXB L;  1G51 A;  1FVI A;  2R93 H;  5IYB G;  4BBS G;  2YV5 A;  1EOV A;  2HIV A;  2PI2 E;  1SFO H;  2Z6K C;  3CCU A;  4LUZ A;  3I4N H;  1KC8 C;  2MQH A;  4JOI C;  3M3Y H;  1V9P A;  4LUV A;  2DUD A;  1Y14 B;  4X65 Q;  4JI8 Q;  2IX0 A;  3KJP A;  1IBK L;  1MJC A;  3HOY H;  3TRE A;  3PUW A;  2VNU D;  2UXD L;  2B29 A;  4OWX B;  3CCS A;  4DV1 Q;  5FJ8 G;  1PHJ A;  3RZD H;  2IT1 A;  2E5L Q;  4JI7 L;  1VQE A;  2WFW A;  1V43 A;  1S3O A;  3UE0 A;  1GKH A;  4AYB G;  1ASZ A;  2B63 G;  5LMN Q;  1PH8 A;  4QY7 A;  3LGJ A;  1TWG H;  1EUJ A;  1GD7 A;  4C2M H;  1V1Q A;  1CSP A;  4IOC A;  5M3M H;  2V1C C;  4P73 A;  1RL2 A;  2YTV A;  5FLM H;  2JEA I;  2KBN A;  2Q2H A;  2VS1 A;  2WAQ E;  2UUA Q;  3G71 A;  2JA6 G;  4GKJ L;  1BBW A;  1WOC A;  3E9H A;  1YHQ A;  4GKK L;  1KRS A;  2F4V L;  5BR8 Q;  1BKB A;  3K0X A;  3M4P A;  5HGQ A;  4DUZ L;  4DV6 Q;  3H0G G;  4LF4 Q;  3S15 H;  4IFD J;  2YYZ A;  1XPR A;  2R7Z G;  1N9W A;  1SN8 A;  3E0E A;  4KHZ A;  1GM5 A;  3RNU A;  1OXT A;  4PZ6 A;  2Y0S E;  1PH2 A;  4JYA L;  4BY1 G;  4BY7 H;  5C4X G;  1VQD A;  1HH2 P;  2WB1 G;  5IP7 G;  3OTO L;  1PVO A;  4LF9 Q;  1PA6 A;  1N34 L;  5IYD G;  3HOV G;  1VQA A;  2VQE Q;  5LMU L;  4A93 H;  3ULJ A;  2VQF Q;  1HZB A;  1I94 Q;  3S14 H;  1D7Q A;  4WJ4 A;  3SGI A;  2Q2I A;  3HFZ B;  1EFW A;  2NN6 I;  3S16 H;  1OTC A;  2LSS A;  4A3D G;  2UXC L;  4DR7 L;  4OO1 I;  5JJI A;  5C0X I;  1L1O C;  1VS0 A;  1Y1V H;  1E22 A;  2H5X A;  3NEL A;  4DR3 L;  4A3K G;  4BXX G;  1NE3 A;  4LF5 L;  2A8V A;  2PI2 A;  4DR5 L;  3K80 C;  1OXS C;  4IPC A;  4DR6 L;  2ZM6 L;  1JMC A;  2KEN A;  4IOA A;  4DR7 Q;  3HOW H;  4GN4 B;  3PGZ A;  4RMF A;  2CCZ A;  2PMZ E;  4LFC L;  3GTG H;  1QUQ A;  4PG3 A;  4DR4 Q;  2CQO A;  1PFS A;  4O2D A;  5JEA J;  1B70 B;  1VQM A;  2HIX A;  4NXM Q;  3HOY G;  4L5R C;  4YWM A;  5IYC G;  4HJ5 A;  2MO1 A;  1HR0 W;  4DK3 C;  1HNX Q;  1HNZ L;  2OTL A;  5H1S E;  1X65 A;  4GNX C;  3H3V H;  4DV2 L;  2I5H A;  1FGU A;  4KHP Q;  1XNQ Q;  5E7N A;  4POG A;  4IFD I;  4LF6 L;  3WWV A;  3W1B A;  1VQI A;  2NVQ H;  4GLX A;  4OX9 Q;  4JI2 Q;  1EYG A;  5J3B A;  4A3F G;  3PUX A;  4JI0 L;  3MXN B;  2GVA A;  2K5V A;  1YIJ A;  2QA4 A;  2Z6K A;  1HNW Q;  3D31 A;  5IYB H;  2ES2 A;  4JOI A;  1L0W A;  3HOX G;  1IL2 A;  1XPO A;  3CC4 A;  4BBS H;  1A8V A;  1SRU A;  1FJG L;  3PF4 A;  1VQ7 A;  1IXR A;  4DR1 Q;  4DUY L;  1VQ9 A;  4JBK A;  1E7Z A;  2QEX A;  1VQ6 A;  3HOU H;  4QQB X;  5FJ8 H;  4B3S L;  1AE3 A;  3UDX A;  1EIY B;  4LFB Q;  1C7Y A;  3CCL A;  2BA1 A;  3KDF B;  2Q2T A;  2B63 H;  1I5F A;  1A63 A;  4PZ8 A;  3G4S A;  1N33 L;  4X62 L;  1WCM G;  2BA0 A;  4B3R Q;  3J80 c;  1CUK A;  1E1T A;  1AE2 A;  3U4Z A;  2JEB I;  4R4O A;  2B3G A;  2E8G A;  4A3L G;  3F2D A;  2JA6 H;  3M9B A;  1W3S A;  2HHH Q;  3CW2 C;  2CFM A;  1YJ9 A;  1Z9F A;  2FXQ A;  2MNA A;  2VL6 A;  3H0G H;  3S24 A;  1WI5 A;  3UDI A;  2R7Z H;  3GTM H;  3S1N H;  2A19 A;  3M4Q A;  2ATW A;  5C4X H;  4BY1 H;  2R92 G;  5IP7 H;  4JI4 Q;  3GO5 A;  1SE8 A;  4JI8 L;  1CKN B;  1T9H A;  1LUZ A;  1VQ4 A;  2ZTC A;  2A1A A;  1PH7 A;  3HOV H;  2BH2 A;  5IYD H;  2KCM A;  2E5L L;  4JBM A;  3AEV A;  4A3E G;  3CMA A;  3GD7 A;  4C3H H;  3A5U A;  4NXN L;  5LMN L;  2D62 A;  3T1Y L;  2Q2U A;  3M85 A;  4DK6 C;  2GN5 A;  3BU2 A;  2UU9 Q;  1L1O A;  2DGY A;  5ELO A;  4A3D H;  3RLN A;  3I4O A;  1K9M C;  4BXX H;  4A3K H;  1UE1 A;  3D0F A;  3PIP A;  1IBM Q;  1WFQ A;  1QVC A;  4BBR G;  1VQF A;  2ID0 A;  5BR8 L;  4QL5 A;  1VQP A;  3KJO A;  4DV6 L;  1NJI C;  2KHI A;  5GAG C;  3PUZ A;  4R1J A;  1O7I A;  2IHE A;  1HZC A;  1YZ6 A;  1VQC A;  3VDY A;  2PQA A;  3J81 i;  3M4O H;  4A3G H;  1OXV A;  4XIG S;  5K36 G;  1P8L A;  4YCW A;  1SRO A;  4MZ9 A;  3NEM A;  5IYC H;  4GNX A;  1UWV A;  2VQE L;  4A76 A;  2UUB L;  1YHB A;  1I6H H;  4GOP A;  4GS3 A;  1YHA A;  4X6A H;  4A3M G;  2VQF L;  2NN6 G;  1XTD A;  1QVF A;  1PV4 A;  1NY4 A;  1VQL A;  2YU9 H;  3ERS X;  4MNO A;  3JAM i;  2CWA A;  4OO1 G;  5C0X G;  2KCT A;  3ULL A;  3KF8 B;  3NBH B;  4JBJ A;  1JJ2 A;  1KXL A;  1J5E L;  3BJU A;  2EXD A;  2MO0 A;  2RHS B;  3IRB A;  5AJ3 Q;  4B3M Q;  4A3F H;  4JCV E;  4DPG A;  4LNQ A;  3TS2 A;  1CSQ A;  2N49 A;  2OQ0 A;  1K83 H;  1YJW A;  2LXJ A;  4YWK A;  1NMF A;  4H02 A;  3HOX H;  3HKS A;  3PV0 A;  4UP7 A;  2AHO B;  4YY3 L;  1KQS A;  4LF8 L;  2VZA A;  3H3V I;  4UPA A;  4LFA Q;  1RIP A;  4LUO A;  4JI5 L;  4R4Q A;  3CQZ H;  2IY5 B;  2JQO A;  4DV7 L;  4DR4 L;  5IWA Q;  1PYB A;  1UE5 A;  4APV A;  2NVY H;  1XNR Q;  1N36 Q;  3F1Z A;  3E9I A;  4NXM L;  3FHW A;  2UUC L;  1ASY A;  2WAQ G;  3PUY A;  3J7Z C;  2HQL A;  3BZK A;  2JJQ A;  1WCM H;  4JBW A;  4JI1 Q;  3K81 C;  3RLF A;  4BA1 I;  2K5H A;  2JA8 G;  4YWL A;  1W2B A;  4A3B G;  2YTX A;  4YCV A;  3UE1 A;  1XNQ L;  4KHP L;  1TWH H;  1N8R C;  1N32 Q;  2YTY A;  4A3J G;  2GVB A;  3ER0 A;  3STB D;  4A3L H;  5HY6 A;  3FKI G;  4AQY L;  1VQO A;  4JI2 L;  1XPU A;  2Y0S G;  4GLA C;  1Q8K A;  4JV5 L;  2NVX H;  1IYJ B;  1HNW L;  1K3R A;  3PF5 A;  1C9O A;  3HOZ G;  1R9T H;  3FP9 A;  4DV3 L;  2R92 H;  1QZH A;  4JI3 Q;  2OTJ A;  1LM0 A;  2K75 A;  1Q1E A;  4DR1 L;  4WJ3 M;  1Z47 A;  4DUZ Q;  1BBU A;  3MEF A;  4A3E H;  3HKZ E;  3KOJ A;  2JA7 G;  2VUM G;  1GVP A;  4TQU S;  4HJ8 A;  4JYA Q;  4IJH A;  1NMG A;  1Q82 C;  4IPH A;  2ZJQ A;  3EBE A;  1IBL Q;  4X66 Q;  1C0A A;  1JJC B;  4FDB A;  5DLQ E;  3KF6 B;  3RR5 A;  2HHH L;  1EWI A;  3DLL A;  3U50 C;  1NTG A;  4BBR H;  5M3F G;  3PUV A;  1YJN A;  4QJF A;  1JJG A;  5IP9 G;  4LF7 Q;  1PH1 A;  2UXC Q;  4DV0 L;  1QVG A;  4OWT B;  1Q81 C;  2OCE A;  3GTL H;  5EAY A;  1VQK A;  4JI4 L;  3OW2 A;  4K0K Q;  4LF5 Q;  1YI2 A;  1HR0 Q;  2F52 A;  2JK8 A;  3BZC A;  1Y1W G;  3GTJ H;  4JI5 Q;  3S1M H;  1G29 1;  4P75 A;  3CCM A;  5IY0 A;  2ZM6 Q;  4DR6 Q;  4A3M H;  4DR2 Q;  2AWO A;  2K5N A;  5GRO A;  4L5T A;  4DAY B;  4DV5 Q;  4LFC Q;  4P74 A;  3GTP H;  2C35 B;  3EN2 A;  5C44 G;  5FLX c;  1XMO Q;  2I0Q A;  5M5Y H;  4A93 G;  4ME3 A;  4DNI A;  1HZ9 A;  4TVA B;  5IT9 c;  4L5Q A;  1IBM L;  2K14 A;  4LF6 Q;  2XTI A;  4X65 L;  3J81 j;  3CCV A;  3A5Z B;  4HJA A;  2CKZ B;  2L15 A;  4DV1 L;  2Z0S A;  1FL0 A;  1JE5 A;  3CPF A;  1B8A A;  3L0O A;  3CCE A;  1K0R A;  1B7Y B;  3STB C;  4PMW A;  3CCQ A;  1P16 A;  4OWW B;  2VW9 A;  3F8T A;  1D8L A;  3I2Z A;  1E3P A;  4UY8 C;  3ICE A;  1BVS A;  3CD6 A;  1MKH A;  3CXC A;  2JA8 H;  1Q12 A;  3U4V A;  1KL9 A;  4YHH Q;  1JB7 A;  3HOW G;  3J80 i;  3A74 A;  4A3B H;  3I55 A;  2UUA L;  3RN5 A;  3S2D H;  4A3J H;  2VY3 A;  2MFI A;  1S72 A;  4B3T Q;  1UE6 A;  3KLW A;  4B3S Q;  1XMQ Q;  3FKI H;  4BA2 I;  3L2P A;  5ELN A;  5LMN W;  4MTN A;  4O0A A;  4DV4 Q;  4LF4 L;  1N33 Q;  4EQ5 A;  3G6E A;  3PSI A;  4X62 Q;  4LWC A;  1A62 A;  2CWP A;  1GO3 E;  4KI0 A;  3JAM c;  4HIM A;  4AYB E;  2JA9 A;  4HIO A;  3J7A 5;  4Y7N H;  1MJE A;  3HOZ H;  1E24 A;  4A75 A;  1QUQ B;  3GTQ H;  4LF9 L;  1EQR A;  1VQH A;  2ZTE A;  4JI6 Q;  1U5K A;  3A0J A; 
#chains in the Genus database with same CATH topology
 2D0P A;  4JC0 A;  1I94 L;  4PZ7 A;  1X55 A;  3K7U C;  2JA7 H;  4A3I G;  3I4M G;  1LAB A;  3E3X A;  1GUO A;  1N32 L;  2M00 A;  2L5T A;  2VB3 X;  4A3B B;  1D5Z C;  4JPB W;  3MXP A;  4G57 A;  1ZYR C;  4X64 Q;  3I4L A;  4NXN Q;  1HA6 A;  3GTO H;  2FJ2 A;  2K4K A;  2K50 A;  1UEB A;  3GTQ B;  2MPM A;  4IFD G;  3U9S A;  1Y1W H;  1ET9 A;  2WKC A;  1HPC A;  2N8N A;  2UXD Q;  1EQT A;  3OMC A;  1TXY A;  4OIJ A;  2E2J H;  4NB3 A;  1U4P A;  3VR5 A;  4C56 C;  4FNF A;  2ICE C;  4IUQ A;  2D0O A;  4ZYS A;  4IO9 A;  4HJ9 A;  1Y69 U;  1RF2 D;  3OMG A;  1VQ5 A;  2PW7 A;  4P2C B;  5EKL A;  2RF4 A;  5ELE A;  3SK8 A;  2Z4H A;  4J8Q A;  4RGT A;  2E2H H;  5M3F B;  2EY5 A;  1D1K A;  3K5L A;  4G7H C;  1J5E Q;  1TWG B;  1SMY C;  1QZG A;  2I46 A;  3SXH A;  1MIU A;  2E2I H;  1S5E D;  1HR0 L;  4LF8 Q;  4YY3 Q;  1K8A C;  2K28 A;  2WAC A;  3OTO Q;  4DR2 L;  3HOY G;  4YCU A;  2N78 A;  3DWA A;  5JEA G;  3NQT A;  2RCN A;  2CHB D;  3PIO A;  2UUC Q;  1AFP A;  2I5L X;  4AIM A;  2B2W C;  5KNC A;  4J15 A;  5IGG A;  2OQK A;  2WP8 J;  4RGN A;  3EJI A;  5M3M G;  1EU3 A;  1DOL A;  2PNH A;  3KF8 A;  4DKA C;  2BE5 C;  1M8A A;  1TR5 A;  2F0L A;  1BNZ A;  4CKC A;  2B8F A;  3FVQ A;  2ZT9 C;  5L37 A;  1BCP B;  2NZH A;  2ALY B;  4GNX B;  1U0L A;  3B6Y A;  4MHE A;  1JQY D;  1H9K A;  4R4T A;  3CC7 A;  3UDF A;  2ZJP A;  4BY7 G;  3PO2 H;  3CME A;  3S2H H;  1YNX A;  3BVG A;  4K14 A;  1KD1 C;  1HNZ Q;  1K3B C;  1X54 A;  4Z9C B;  2Q8R E;  2HT1 A;  1STY A;  1SNM A;  3OPO A;  2OF1 A;  4DV4 L;  2F0T A;  2KVM A;  1H9R A;  4QF4 A;  4KV6 A;  3DM1 A;  4RGO S;  1TWA H;  2NWG A;  4UAI A;  2D5D A;  1TS5 A;  2QGQ A;  3WOF A;  4C3J B;  1DD2 A;  4HMI A;  1OXU A;  4JI6 L;  3QOJ A;  4G7Z C;  1Q86 C;  2K5D A;  1MGS A;  5M9O A;  2JA5 B;  2RDG A;  1DOK A;  4IPG A;  2XGT A;  5ELF A;  3MFY A;  4PNY A;  1I4X A;  4B3M L;  3K7A B;  3HOU B;  1O80 A;  1PH5 A;  1PZJ D;  4X64 L;  1PH3 A;  4LFA L;  1CHQ D;  1VQG A;  2BOS A;  2IX1 A;  4PMB A;  4CKE A;  5JVG 3;  5C5M A;  1N36 L;  1G51 A;  1FVI A;  2EJG C;  3NXW A;  5IGD A;  4V19 0;  5FO8 B;  1U9R A;  4BBS G;  2PI2 E;  3NWT A;  4LUZ A;  1G2S A;  4KTA A;  1A2U A;  1Y14 B;  3PO3 B;  4JI8 Q;  2UXD L;  1TVX A;  3CCS A;  2QF7 A;  4KY7 A;  5FJ8 G;  3CRK C;  2E5L Q;  1S3O A;  3UE0 A;  1GKH A;  4AYB G;  2L0C A;  5LMN Q;  4KJO A;  4K2K A;  1TWG H;  4CHT B;  4DAY A;  1EIG A;  4C2M H;  2CCZ A;  3D4D A;  2WAQ E;  2Q2H A;  1EIH A;  1XXG A;  1WOC A;  1JWU D;  1SYE A;  2DNE A;  3M4P A;  4DUZ L;  4DV6 Q;  3DEP A;  2R93 B;  2Y0S E;  5I6Y A;  5C4X G;  3I4N B;  1O7Z A;  3OTO L;  1A3U A;  3M3Y B;  1JCK B;  1ENF A;  2N55 A;  3DMU A;  5IYD G;  3HOV G;  4EQN A;  1LTS D;  2XVS A;  2C9O A;  3VA7 A;  1JIC A;  1D7Q A;  4KKU A;  1C48 A;  4A3G B;  2NN6 I;  1I4R A;  2LSS A;  1B1Z A;  4A3D G;  5C0X I;  5TSS A;  1E22 A;  1Z7T A;  3TDQ A;  2B2U A;  4PV1 C;  1Y8N B;  2IL8 A;  4DR6 L;  3K59 A;  4RMF A;  5CBE E;  2LMC B;  1QUQ A;  4A3F B;  2L55 A;  2CQO A;  4ME5 A;  2F0V A;  5KGU A;  4L5R C;  4HJ5 A;  1HR0 W;  2OTL A;  2F0S A;  2QDL A;  2TSS A;  3NTK A;  5FK9 C;  1HNX Q;  1HNZ L;  3D4W A;  2AQ3 B;  3R8B A;  4KD4 A;  1SJH D;  2L1B A;  3S14 B;  3W3A A;  1EYG A;  2B2V C;  4J1M A;  3Q24 A;  2K5V A;  2Z6B A;  2QA4 A;  1Y1V B;  2Z6K A;  1IL2 A;  3I3C A;  4JOI A;  2KUM A;  3CC4 A;  1T5E A;  5IGC A;  2WIN B;  2G9D A;  1MHW C;  3PF4 A;  1VQ7 A;  1VQ9 A;  5DAU A;  3HOU H;  1IL8 A;  4N9P A;  1PZK D;  1AE3 A;  3VR3 A;  1EIY B;  2AUJ D;  3I91 A;  1C7Y A;  2BA1 A;  2MHV A;  2B63 H;  3BZD B;  2A68 C;  2A6H D;  2X6G A;  4IN3 A;  3U4Z A;  4ZCK A;  2JEB I;  1LT3 D;  2NUC A;  2KJX A;  1D5M C;  2B3G A;  2JA6 H;  3M9B A;  4E6I A;  1GJX A;  3CW2 C;  3SHL A;  1Z9F A;  2R61 A;  1NSN S;  3H0G H;  2F0O A;  4L63 B;  1WI5 A;  3CU7 A;  1CZW A;  2EY1 A;  1MSH A;  1PTO D;  4JI4 Q;  4JI8 L;  5G3L D;  2O4X A;  2QIL A;  2RBM A;  2HDL A;  2E5L L;  4A3E G;  4DU9 A;  3R3O A;  5LMN L;  3KK7 A;  2D62 A;  4XQQ A;  2UU9 Q;  1L1O A;  2KHS A;  5JOB A;  4BXX H;  4KKT A;  1VQF A;  3OIP A;  4DV6 L;  1A15 A;  4R1J A;  1O7I A;  2IHE A;  1HZC A;  5M5Y B;  4CDF C;  1ILQ A;  3J81 i;  4A3G H;  1OXV A;  3PIP 3;  1KDA A;  1SRO A;  1KTK A;  2WB1 B;  1UWV A;  1ICW A;  2FIN B;  4X6A H;  4A3M G;  2PZT A;  4ZAI A;  2KCT A;  2K04 A;  3ULL A;  3KF8 B;  4JBJ A;  4C3H B;  2EXD A;  5K36 G;  5AJ3 Q;  4A3F H;  4JCV E;  3TS2 A;  2K1B A;  1CSQ A;  2EYP A;  1YJW A;  2LXJ A;  1TS3 A;  3CKI B;  4A3K B;  1STB A;  2AHO B;  4UPA A;  4I7Z C;  1CQV A;  3I72 A;  2A6E D;  5IGE A;  5IWA Q;  2MGS A;  2K33 A;  1ASY A;  2WAQ G;  1B53 A;  3KUP A;  4DK1 A;  2HQL A;  3BZK A;  4JI1 Q;  1IHZ A;  5D3D A;  2A69 C;  3C1E A;  5ELC A;  5J1Z A;  3H6M A;  3NE5 B;  3IAY A;  1QNK A;  5HY6 A;  3FKI G;  4AQY L;  1VQO A;  1WTO A;  2Y0S G;  5CBA E;  1LTT D;  1B9N A;  1K3R A;  3PF5 A;  2FMM A;  3QR8 A;  3FP9 A;  4QUC A;  1B50 A;  2F0P A;  1LM0 A;  1Q1E A;  1HRJ A;  1LTB D;  1LV9 A;  1QB5 D;  2Z8L A;  3FPP A;  1FD7 D;  5IOC A;  3D6C A;  2F0U A;  5EBC A;  3HKZ E;  3KOJ A;  2VUM G;  1EY0 A;  3NWS A;  5C3W A;  1WCM B;  1IBL Q;  3P1H A;  2BDN A;  5DLQ E;  1TWH B;  3E5S A;  3Q22 A;  3HS0 C;  3RD4 A;  2HCC A;  3U50 C;  2KQ3 A;  4CDE C;  3PUV A;  4OEM B;  1SJE D;  5J39 A;  2N88 A;  3EVQ A;  3FDT A;  1JJG A;  4LF7 Q;  4KY6 A;  4DV0 L;  1Q81 C;  1U4L A;  4JI4 L;  1R9T B;  1IYV A;  4LF5 Q;  3BZC A;  3CCM A;  2ZM6 Q;  2AWO A;  2NN6 H;  4RCO A;  3N52 A;  4DAY B;  4LFC Q;  5C0X H;  2FFK B;  1J8I A;  1JWM D;  1XMO Q;  5M5Y H;  5FKA C;  4ME3 A;  4DNI A;  4K6L A;  2B2Y C;  4GZY C;  3V2T A;  1BXT A;  3J81 j;  4IUT A;  4HJA A;  2L15 A;  1JE5 A;  3L0O A;  4EQP A;  1ZKO A;  3DHQ A;  1P16 A;  3I90 A;  1E3P A;  3J80 L;  2ENB A;  3GTL B;  1LTA D;  3ICE A;  2JA8 H;  3GTJ B;  1JB7 A;  1KL9 A;  2MJ8 A;  3HOW G;  2F0F A;  2UUA L;  3RN5 A;  1STH A;  2MFI A;  3MVV A;  5I9P A;  4G4K A;  3TP8 A;  4B3S Q;  1XMQ Q;  1STE A;  4K5X A;  4BA2 I;  2L12 A;  1GUW A;  3O13 A;  5LMN W;  4LF4 L;  2L9H A;  4LWC A;  1A62 A;  4L8J A;  4HIO A;  1JOO A;  1E24 A;  1K8M A;  1QUQ B;  1VQH A;  2ZTE A;  3MXN A;  3J7A V;  1KRT A;  3AU7 A;  4F88 A;  3DM3 A;  4XTC S;  4JI1 L;  3RZO B;  5BN5 A;  4ULL A;  4A3C G;  4HCS A;  3VYT A;  5CV9 A;  3OSO A;  3KDF A;  1BBX C;  5JPN C;  2CW0 C;  3H15 A;  3RN2 A;  4HN7 A;  4A3J B;  3F2C A;  1L2F A;  3GV3 A;  5C3E G;  1SXT A;  2O2L D;  5IP9 H;  1FGB D;  2MP1 A;  3I7F A;  3ZJY C;  4POF A;  3OWE B;  1LTL A;  1VMC A;  4R4I A;  1BF4 A;  1IZ6 A;  4QIW E;  3TQY A;  2AQ2 B;  4ALP A;  3BVZ A;  2OWO A;  4B9W A;  4OX9 L;  2JA7 B;  3DEO A;  5I4D A;  5C44 H;  4DAM A;  1IBL L;  3V05 A;  1PFM A;  1X56 A;  2ASB A;  2B2T C;  3HOY B;  3S17 H;  4GKJ Q;  1KDC A;  2PMZ B;  4XDX A;  1WD1 A;  1RTN A;  4C3I H;  1TWF H;  4LF7 L;  4M1U B;  4FF3 A;  3W1G A;  3TEH B;  1NR2 A;  3BDL A;  3U58 A;  3GTO B;  3HZX A;  3S1R H;  4IAL A;  3CCR A;  4B3R L;  5T1G A;  1HFN A;  1IKL A;  2DY7 A;  2AUK A;  3L7Z C;  5GAH C;  2R3Z A;  5LMU Q;  4JI5 Q;  1E1O A;  4OXP A;  5D3I B;  4DV7 Q;  3TS0 A;  2R6G A;  4UP9 A;  1L1O B;  4ILW A;  5LL6 X;  2E2J B;  3TRZ A;  1SBB B;  2F0H A;  1XMO L;  1YEZ A;  5BN4 A;  3K8A A;  3NEN A;  1UE7 A;  3SE0 A;  3D8G A;  5FLM G;  1NUC A;  5M5W H;  1NBW A;  3NBH A;  3GTK H;  1GUT A;  4Q5V A;  1HZA A;  4AH6 A;  3A8J E;  3HKZ G;  3QOL A;  4H0L C;  1VQB A;  2O5J C;  1X9N A;  2Z4I A;  1WD0 A;  4JV5 Q;  3PQI A;  2E2I B;  4A3I H;  4F8M A;  1YNN D;  5E3F A;  4ZUJ A;  3EQL C;  4DV3 Q;  3SEB A;  3I4M H;  4A4I A;  4S3S A;  1OXX K;  3OWF A;  1XMQ L;  1B2T A;  5KND A;  2KCC A;  3M7N A;  4OON A;  1SNO A;  2BH8 A;  2NZO A;  4O1N A;  3K58 A;  1PH4 A;  3ERO A;  3RZO H;  2EE1 A;  1K73 C;  4IFD H;  3J81 c;  4DUY Q;  1M90 C;  1PH6 A;  5FLX L;  4KN7 C;  3VR2 A;  3I56 A;  1SNP A;  1BUV T;  1PYS B;  4NPS A;  1H9J A;  1AH9 A;  5IT9 L;  1IW7 C;  2RKS A;  4P72 A;  4HCE A;  1Q1B A;  1CHP D;  4K6D A;  2KED A;  1X6O A;  1G8Z D;  1KIX A;  1LTR D;  1G6Z A;  1BCP D;  4IQZ A;  1LTG D;  3KLR A;  1XNR L;  1QE6 A;  1B4O A;  1GUG A;  1TWA B;  3HEJ A;  2KOL A;  2XWB B;  5IYB G;  2YV5 A;  2HIV A;  1QG7 A;  4N9T A;  1KC8 C;  3IKJ A;  1Z6H A;  3ND9 A;  5IIF A;  1MJC A;  3HOY H;  3PUW A;  2B29 A;  4DV1 Q;  1PHJ A;  5KEE A;  1VQE A;  2WFW A;  1ASZ A;  1PDQ A;  1PH8 A;  1HHV A;  1EUJ A;  1GD7 A;  5M3M H;  2V1C C;  2JEA I;  2YTV A;  2KBN A;  4GKJ L;  3G71 A;  5FO9 B;  2EDG A;  5HGQ A;  1NR4 A;  3BYT B;  3S15 H;  1XPR A;  2R7Z G;  2EY2 A;  3UI2 A;  5IGF A;  1KAB A;  4BY1 G;  4BY7 H;  1I4G A;  4LF9 Q;  4M8A A;  1PA6 A;  2D2C C;  3T4A C;  5LMU L;  2VQE Q;  4FYD A;  4RH6 A;  3DXJ C;  2E76 C;  2VQF Q;  4K8J A;  3A8K E;  1MI2 A;  1EOT A;  4EGV A;  4U68 A;  2O5I C;  4C2M B;  3LNN A;  2H5X A;  3NEL A;  1A6X A;  1WTQ A;  2YU9 B;  1NE3 A;  2F0N A;  3K80 C;  3AMU A;  3BDO A;  4XT3 B;  1J9O A;  1T5X D;  3L3O C;  1C8C A;  2KEN A;  1LT6 D;  1GUS A;  3MZ5 A;  4IOA A;  4HSV A;  4GN4 B;  3GTG H;  1EY6 A;  4DR4 Q;  4PG3 A;  4O42 A;  1ESR A;  1KNA A;  4O2D A;  1VQM A;  1B70 B;  4YWM A;  3QJY A;  2H1E A;  4EQO A;  1X65 A;  1KNE A;  1JWS D;  3IL8 A;  2EYM A;  1XNQ Q;  3WOE A;  5E7N A;  4POG A;  2NVY B;  4LF6 L;  1KLG D;  4XYQ A;  4RFB A;  2QCP X;  5C3X A;  1VQI A;  1TT2 A;  2K5Q A;  3VYR A;  3PUX A;  1BDO A;  3MXN B;  1F9R A;  2GVA A;  4ID6 A;  1K8O A;  4BBS H;  3IFT A;  2ES2 A;  3HOX G;  1S5B D;  1SRU A;  2JYO A;  3H3V C;  2DNC A;  2PZU A;  4DUY L;  3K5M A;  4JBK A;  1VQ6 A;  5FJ8 H;  3UDX A;  4I65 A;  4LFB Q;  2Q2T A;  3KDF B;  1EQV A;  4PZ8 A;  3G4S A;  1VF5 C;  1N33 L;  1AW7 A;  3BVM A;  1AP0 A;  3A8I E;  5I2X A;  4A3L G;  3F2D A;  1ZEQ X;  2WKD A;  2CFM A;  1YJ9 A;  1X3Q A;  2MNA A;  4ZRZ A;  2VL6 A;  3UDI A;  2EZV A;  3GTM H;  2HD3 A;  3ZYY X;  2A19 A;  3S1N H;  3M4Q A;  5C4X H;  2R92 G;  3C3L A;  3HOV H;  5IYD H;  2A1A A;  4X3T A;  2KCM A;  4TKO B;  3QIA A;  4JBM A;  1F9P A;  3NSW A;  4NXN L;  3A5U A;  1M4V A;  2B63 B;  1EZ6 A;  3M85 A;  2DGY A;  1PRT C;  4TSS A;  4A3D H;  3E0J A;  2J0T D;  2QEJ C;  1ET6 A;  2JA6 B;  1IBM Q;  1WTP A;  2PNR C;  4BBR G;  1VQP A;  1EYC A;  2ZXP A;  3KJO A;  3VA5 A;  5GAG C;  1PYW D;  3H0G B;  4QB4 A;  3M4O H;  5NUC A;  4XIG S;  1P8L A;  2F0J A;  2M2L A;  4YCW A;  1YNJ D;  4G7O C;  2G5D A;  2HQE A;  2VQE L;  3D6W A;  4A76 A;  4OL7 A;  5KRU A;  3JAM L;  4GOP A;  1B44 D;  2VQF L;  3NK9 A;  2YU9 H;  1NY4 A;  3BYY B;  1VQL A;  3ERS X;  4MNO A;  5E4X A;  3NBH B;  3X3N A;  2B2V A;  1KXL A;  4HAE A;  4WOR A;  1J5E L;  1TS4 A;  4K5V A;  2MO0 A;  2EVB A;  3IRB A;  3VR4 A;  4DPG A;  2IX3 A;  4BWG B;  2OQ0 A;  1K83 H;  4I7A A;  1D6E C;  4YWK A;  4H02 A;  5K5P A;  1JOK A;  4UP7 A;  4YY3 L;  4LF8 L;  3H3V I;  2A6H C;  2VZA A;  3FKI B;  3Q6S A;  4DR4 L;  4APV A;  2NVY H;  2UUC L;  1SYG A;  2K5H A;  4YWL A;  1W2B A;  4A3B G;  2LY7 A;  2YTX A;  3UE1 A;  5KYI A;  1XNQ L;  1JC7 A;  3STB D;  1PTO C;  4K2L A;  1XPU A;  2VUM B;  4MIU A;  3R2T A;  3V96 A;  2EJM A;  1Y8O B;  2NVX H;  1Q90 A;  3NBI A;  4DF7 A;  2F4I A;  4JI3 Q;  1AZP A;  1NAP A;  1UEA B;  4MTK A;  4ODG A;  1II3 A;  4QUF A;  4A3E H;  3MFG A;  4JYA Q;  4TQU S;  4LAA A;  1DON A;  3MHB A;  1WVL A;  2OXP A;  1Q82 C;  1AEX A;  1C0A A;  1FR3 A;  2A5H A;  1ONL A;  3T13 A;  3RR5 A;  3DLL A;  1BOS A;  4KD3 A;  5M3F G;  1YJN A;  1S4Z A;  2F0E A;  3DWP A;  1EY9 A;  2UXC Q;  1V1P A;  1QVG A;  1AN8 A;  5EAY A;  4XYO A;  5C4J B;  1W6K A;  3QO2 A;  2JK8 A;  5DEH A;  1G29 1;  1STG A;  5IY0 A;  5IOD A;  4A3M H;  4MN3 A;  1WTH A;  4L5T A;  1JB3 A;  1ILP A;  2A6E C;  5K36 H;  4FXK C;  1SDF A;  4FXG C;  4L5Q A;  1IBM L;  2K14 A;  2XIW A;  3NTH A;  1TII D;  1A3T A;  4DNT B;  5CV7 A;  1B3Q A;  1FL0 A;  3CPF A;  5HUR A;  1B8A A;  1PFB A;  2D9U A;  4PMW A;  5CC4 A;  1SYB A;  3F8T A;  3I2Z A;  1LT4 D;  1DYQ A;  1G91 A;  4UY8 C;  3CD6 A;  1MKH A;  2JSO A;  1Q12 A;  3OHX C;  3ONA B;  3U4V A;  4YHH Q;  1CK1 A;  3J80 i;  3A74 A;  1TQO A;  2VY3 A;  4B3T Q;  1UE6 A;  3KLW A;  2NB0 A;  3FKI H;  5ELN A;  5DM6 3;  5E1F A;  3G6E A;  3PSI A;  4X62 Q;  3K57 A;  4HIM A;  4CJ1 B;  1S5F D;  4C3J G;  2JA9 A;  3JAM c;  4Y7N H;  1MJE A;  1V1O A;  4V0B A;  4L6T B;  5F2D A;  1HXY D;  1OO9 B;  5C4Z A;  1U5K A;  5ELD A;  2BDO A;  2JA5 G;  2ZTD A;  1DM0 B;  5JAV A;  3S1Q H;  2VUM H;  3KLS A;  5D14 A;  2F0D A;  5C0X J;  3Q0A A;  4HID A;  2JA8 B;  1O7Y A;  5LL6 S;  3HOU G;  2A74 C;  2WB1 E;  1SR3 A;  5CV6 A;  2F3I A;  1FNV A;  1D1I A;  3CAM A;  3K5O A;  1LYL A;  3VR6 A;  3G48 A;  2KHJ A;  4FF1 A;  3T1Y Q;  4Y52 H;  3HGB A;  1JT8 A;  3ULP A;  2UXB Q;  5ELB A;  2AKW B;  5JJL A;  4RA8 A;  1Q3L A;  1SMX A;  2R7D A;  4JI3 L;  1HNX L;  3PO3 G;  3G7L A;  2I07 B;  5EJW A;  1RTO A;  1IBK Q;  1TS2 A;  1GOZ A;  4XQJ A;  4U67 3;  1LTI D;  1EZ8 A;  4QGU A;  2M9V A;  2B2Y A;  2UUB Q;  3AFQ A;  3GDE A;  5C4J H;  1F9Q A;  5CGK A;  1EIF A;  4GKK Q;  4RCN A;  2EIF A;  2F4V Q;  3RLO A;  1HJP A;  2R93 G;  3I4N G;  3W2D A;  3CHB D;  3KFU A;  2BCO A;  3CF5 A;  2RHQ B;  5KNB A;  2F0G A;  1CKM A;  1D2B A;  1N34 Q;  5EPL A;  4UHV A;  2N3S A;  1XWE A;  4X3S A;  4A3G G;  1X3G A;  2IWH A;  1FNU A;  2DY8 A;  4CBV A;  2K52 A;  1WYD A;  3OYY A;  5C44 B;  4A93 B;  3CCJ A;  1VCI A;  4HJ7 A;  3S17 B;  4DR3 Q;  3PIO 3;  4DR5 Q;  1UUP A;  5IE8 A;  4YIJ A;  4RKB A;  2XRS D;  4C3I B;  1TWF B;  4KLK A;  4IJL A;  5A2Q L;  2DJG C;  4GOP B;  4FP5 D;  4CJ2 C;  4H44 C;  3TZD A;  3S1R B;  2UU9 L;  4YHH L;  4PMC A;  2EQS A;  4A3C H;  3C1F A;  1IYU A;  4GN3 B;  3U9O A;  3TBI B;  2AMC B;  4B3T L;  1I50 H;  4R4C A;  1TWC H;  1VQN A;  2EJF C;  2E74 C;  3UDG A;  1I4H A;  4IUP A;  5JJK A;  2WV6 D;  1F77 A;  3N6R A;  4FVM A;  4N8F A;  5C3E H;  1Y1V G;  4JI0 Q;  5M5W B;  3GTK B;  1KAA A;  2F3V A;  1KAW A;  4CDD C;  2CQA A;  2EY6 A;  1CFM A;  1TKW B;  2RA4 A;  4QMG A;  1E2V A;  2RQX A;  4A3I B;  5AJ3 L;  3ITP A;  3J81 E;  5GAD C;  3I4M B;  3S9W A;  3AFP A;  3PCO B;  4DGZ A;  1ROD A;  1YVC A;  4LW1 A;  5BN3 A;  1I3Q H;  1SND A;  4DA2 A;  1GHJ A;  5CV8 A;  1CKO A;  3W5O A;  2IHF A;  3URY A;  5IWA L;  1YIT A;  3KF6 A;  2UXB L;  2EOT A;  1RDP D;  1VF7 A;  4ZKC B;  1EOV A;  4ZK9 B;  1SFO H;  3MC0 B;  2MQH A;  4OIK A;  1WTW A;  1JOR A;  1V9P A;  4LUV A;  2DUD A;  5LHY 1;  4X65 Q;  2Z9H A;  2IX0 A;  1QIL A;  2A73 B;  1IBK L;  1JR0 D;  3TRE A;  3RZD H;  2IT1 A;  3FMC A;  1PFN A;  4BY1 B;  2KEE A;  3LGJ A;  4IOC A;  4P73 A;  5FLM H;  1RL2 A;  4QQB X;  4GKK L;  4HSP A;  1QNU A;  1KRS A;  1V1P B;  4XQN A;  2F4V L;  5BR8 Q;  1CA6 A;  1BKB A;  4IFD J;  1K0S A;  1N9W A;  3DWQ A;  1GM5 A;  1OXT A;  1VQD A;  1HH2 P;  2WB1 G;  5IP7 G;  1QOH A;  1N34 L;  1ESF A;  1VQA A;  2F0K A;  4A93 H;  2B39 A;  3ULJ A;  1I94 Q;  4KY5 A;  4WJ4 A;  3SGI A;  2Q2I A;  4C3H G;  3HFZ B;  1EFW A;  3S16 H;  1OTC A;  5EKI A;  3A55 A;  4WRD A;  5CV5 A;  3H09 A;  2KEC A;  1I6H B;  1NCV A;  5M3M B;  1VDZ A;  4DR3 L;  4A3K G;  4LF5 L;  2A8V A;  2PI2 A;  4DR5 L;  5CR3 A;  4IPC A;  2ZM6 L;  1RD9 D;  3PGZ A;  2PMZ E;  4LFC L;  5EGT A;  3S15 B;  3NQI A;  4NW2 A;  1PFS A;  5CV4 A;  5JEA J;  3I8Z A;  4CJ0 B;  3FRP B;  4BS9 A;  1BCP C;  5IYC G;  4BY7 B;  3R93 A;  5H1S E;  4K5W A;  3SR1 A;  4GNX C;  2I5H A;  1DXM A;  1CT1 D;  3WWV A;  4LJZ C;  3W1B A;  3TSS A;  1LT5 D;  5J3B A;  1CA5 A;  4JI0 L;  1EYA A;  1HNW Q;  3D31 A;  5IYB H;  5EPK A;  1UNS A;  1I4P A;  1XPO A;  4DAP A;  2CVR A;  1E2W A;  4DR1 Q;  2QEX A;  3GTG B;  4B3S L;  2V4D A;  1I5F A;  1A63 A;  2R92 B;  1WCM G;  2BA0 A;  5COR A;  3J80 c;  1CUK A;  3K6O A;  3OIQ A;  4R4O A;  3TME A;  1UAP A;  3KBG A;  5FO7 B;  2OEO A;  2RVL A;  2FXQ A;  1HCZ A;  2NZ1 D;  4FF2 A;  2CH4 W;  2J4X A;  3TZU A;  3MXG A;  2R7Z H;  1C4Q A;  3VYS A;  2ATW A;  4BBS B;  4BY1 H;  5FLX E;  3WDN A;  3GO5 A;  1SE8 A;  1H9S A;  2AQ1 B;  1T9H A;  1LUZ A;  1H9M A;  2ZTC A;  1PH7 A;  2XSC A;  2BH2 A;  5EBD A;  3AEV A;  4AYB B;  2Q2U A;  2VXW A;  3BU2 A;  5ELO A;  3S1M B;  1S5D D;  2NYZ D;  1X3P A;  4F87 A;  1UE1 A;  3E6Z X;  3PIP A;  3X3M A;  1WFQ A;  4DAV A;  1EY7 A;  5BR8 L;  2ID0 A;  4X3U A;  1NJI C;  3PUZ A;  3IFD A;  5JEA H;  1YZ6 A;  5JVH 3;  2DN8 A;  3J7A F;  2PQA A;  3GTM B;  3S1N B;  2B2W A;  4MZ9 A;  5C4X B;  5I9O A;  1HTL D;  4OEL B;  1YHB A;  1I6H H;  2E75 C;  3HOV B;  3TP7 A;  5CMD A;  1X32 A;  2CWA A;  1A2T A;  4HED A;  3JAM i;  4OO1 G;  4QCL A;  1L0Y B;  3BJU A;  1SEB D;  4B3M Q;  4LNQ A;  4A3D B;  3A56 A;  3PV0 A;  4H7B A;  3HOX H;  1PMR A;  2K7V A;  1WTR A;  4LFA Q;  1RIP A;  4JI5 L;  4R4Q A;  2IY5 B;  2JQO A;  4DV7 L;  3BDC A;  1HQR D;  2P5Z X;  4DXG A;  1UE5 A;  3P75 A;  1N36 Q;  3F1Z A;  3E9I A;  3FHW A;  3OW7 A;  4HMJ A;  2F1M A;  3M4O B;  5CYU A;  2QW7 A;  3PUY A;  2FMC A;  3GV6 A;  2JJQ A;  4JBW A;  3K81 C;  1Q8I A;  1L0X B;  4YCV A;  3BS1 A;  1N8R C;  2YTY A;  4A3J G;  3F2U A;  4A3L H;  1TY2 A;  1BQQ T;  4H13 C;  3SK4 A;  4IUN A;  2NTT A;  2NBF A;  3KBX A;  4FO2 A;  4IUU A;  4JV5 L;  3MEH A;  1HNW L;  2RCF A;  1EY5 A;  1C9O A;  1K83 B;  3HOZ G;  3K5N A;  4DV3 L;  2R92 H;  3HP3 A;  3MAQ A;  4DR1 L;  4DXF A;  4DUZ Q;  1IW7 D;  2XRQ D;  2JA7 G;  1GVP A;  4IZ8 A;  4HJ8 A;  1CM9 A;  4IJH A;  3G6J B;  1D5X C;  4X66 Q;  3M4Y A;  1JJC B;  2LKV A;  3KF6 B;  4IUR A;  1YNJ C;  2Q8I B;  1EWI A;  4BBR H;  1NTG A;  1HUN A;  2IW3 A;  1EFI D;  4JVZ A;  2NVX B;  3MTS A;  5M5X B;  4OWT B;  2OCE A;  1K28 A;  1VQK A;  4K0K Q;  4LMQ D;  1YI2 A;  1ZYR D;  1Y1W G;  3S1M H;  4P75 A;  2RSN A;  4DFA A;  4DR6 Q;  1QJO A;  2K5N A;  3PMF A;  1KDB A;  4DV5 Q;  4P74 A;  3GTP H;  2C35 B;  3EN2 A;  4A3E B;  5FLX c;  3M7G A;  2I0Q A;  4J6H A;  5EKK A;  5IT9 c;  4TVA B;  3VYU A;  1DCZ A;  2XTI A;  3CRL C;  2FHT A;  4DN4 M;  2CKZ B;  3A7A B;  4NDX A;  2Z0S A;  2K6A A;  4DV1 L;  3CCE A;  4DK0 A;  4KMU C;  5EQ0 A;  2EYF A;  3STB C;  2EYJ A;  1I4Q A;  2VW9 A;  2L11 A;  1DOM A;  2LFN A;  2X6L A;  3Q23 A;  4A3B H;  4B9X A;  1LO5 D;  5C6A A;  3I55 A;  4A3M B;  1SMY D;  1F9S A;  3LWE A;  1S72 A;  1S5C D;  2L4N A;  3P7J A;  2EYL A;  4MTN A;  4O0A A;  4HR7 B;  4DNR B;  3H91 A;  1WTX A;  2CWP A;  1GO3 E;  4KI0 A;  3J7A 5;  1PRT F;  4CGY B;  4A75 A;  3GTQ H;  3T56 B;  4LF9 L;  2EPB A;  2F03 A;  5EPJ A;  4C1N I;  1STN A;  3QG1 A;  3JAM E;  3A0J A;  2CH4 A;  1TU2 B;  2NTS A;  3R2I A;  4RHS A;  2PYK A;  5GAE C;  2BE5 D;  2G9H D;  2I5M X;  2KCN A;  3PO2 G;  3SVM A;  2WAQ B;  1R4Q B;  1X3E A;  3J7Y W;  1YBY A;  1A0I A;  1EY4 A;  1QCB D;  2R7F A;  4KKS A;  2PZW A;  1VQ8 A;  3C46 A;  3T1H Q;  4Q0F A;  5M3F H;  4TRD A;  2Y0S B;  2ZJR A;  2NVT B;  1ENC A;  3I73 A;  4NMZ A;  2PCF B;  2XWJ B;  4Y7N B;  3QB3 A;  1NNX A;  2HUG A;  3TP6 A;  1WJJ A;  4F7X A;  2AWN A;  1H95 A;  5GQO A;  4UP8 A;  1CKN A;  3CC2 A;  4JI7 Q;  3AQQ A;  3S1Q B;  4JK1 C;  1V8Q A;  4X66 L;  1S40 A;  4LK1 C;  2EXZ A;  5I2Y A;  5M5X H;  1CTM A;  3JC6 6;  1SAP A;  4CKB A;  3H94 A;  5D65 A;  1PTO F;  1F2Y A;  1EY8 A;  2F0W A;  1SYD A;  4JG2 A;  5G3L F;  3AYH B;  1H9S B;  3I70 A;  4LFB L;  2H4O A;  1EQQ A;  1Q46 A;  1HUM A;  4K0K L;  5JJZ A;  4X3K A;  3CP0 A;  4EX5 A;  1Q7Y C;  1PRT D;  2HCI A;  4DV5 L;  2K05 A;  4OGQ C;  3DUZ A;  1RCV D;  4B08 A;  1KHI A;  2LXK A;  4L5S A;  4GOP C;  4DR7 Q;  4P71 A;  4C1N K;  4C3J H;  1SLJ A;  1PH9 A;  4UDU C;  5JPM C;  1X3F A;  2PQA B;  1J6Q A;  4HIK A;  4AQY Q;  1GXD C;  3Q8D A;  1VQJ A;  2JA5 H;  3L9A X;  4CDC C;  3K7A H;  4IPD A;  4KJN A;  2KA7 A;  4WJW A;  1BR9 A;  3F2B A;  4DV2 Q;  3HOW B;  1G6P A;  1ZXT A;  1K8G A;  4ZKB B;  3HRZ C;  1CQF A;  1SNC A;  5ISR A;  4XXE A;  1DZ1 A;  4RAU C;  1HQM C;  1XJV A;  2B2U C;  1LLR D;  3PO3 H;  1R4P B;  1FJG Q;  2K32 A;  2NVQ B;  3EA6 A;  3TP5 A;  4DV0 Q;  5C4H A;  3KYH C;  3SK6 A;  1M1K C;  3EIV A;  2NVT H;  1DGS A;  3CPW A;  4GN5 A;  2JE6 I;  1I50 B;  4GLV B;  1JE4 A;  2F0M A;  3RUZ A;  3T1H L;  1TWC B;  4RG1 A;  2GA4 B;  2K03 A;  5C3E B;  1BO0 A;  1EYD A;  2R93 H;  3I4N H;  2Z6K C;  4RGM A;  3CCU A;  3M3Y H;  4JOI C;  3KJP A;  1RKN A;  2VNU D;  1O78 A;  2WII B;  4OWX B;  1PRT B;  2XNA C;  4JI7 L;  1V43 A;  2B63 G;  1W6J A;  4QY7 A;  1AZQ A;  1EWC A;  4RKL A;  1V1Q A;  1CSP A;  2HDM A;  1MSG A;  2VS1 A;  2UUA Q;  2JA6 G;  1BBW A;  3E9H A;  4ZUI A;  1I3Q B;  1YHQ A;  5FOB B;  2A68 D;  3QWN A;  3K0X A;  4LF4 Q;  3H0G G;  2PW5 A;  2YYZ A;  1SN8 A;  3E0E A;  4KHZ A;  4XT1 B;  1EU4 A;  3RNU A;  4PZ6 A;  1I6V C;  5DM7 3;  1PH2 A;  4JYA L;  1SFO B;  1EWH A;  1PVO A;  5HGT A;  1HZB A;  3S14 H;  3RZD B;  1MD2 D;  2Q8T A;  1HTP A;  4NKL A;  1U4R A;  2Z1C A;  2UXC L;  4DR7 L;  4OO1 I;  5JJI A;  1L1O C;  1VS0 A;  1VMP A;  1Y1V H;  3D4R A;  4BXX G;  4KK7 A;  1TY0 A;  1OXS C;  1B9M A;  1XYI A;  1JMC A;  3HKZ B;  1ML0 D;  2F3W A;  1KLU D;  3HOW H;  2SOB A;  4NXM Q;  2QDB A;  2HIX A;  4FF4 A;  2F0Q A;  2MO1 A;  1PTO B;  1SYC A;  4DK3 C;  4OHJ A;  3H3V H;  2XN9 C;  1XTC D;  4DV2 L;  3CQZ B;  1E2Z A;  1FGU A;  4KHP Q;  1MBY A;  4IFD I;  3NPP A;  1HA5 A;  2DJF C;  2NVQ H;  3T53 B;  4GLX A;  4OX9 Q;  3S16 B;  4JI2 Q;  1GHK A;  4A3F G;  4WFN 3;  1O7L A;  1YIJ A;  5A2Q E;  1L0W A;  1A8V A;  1FJG L;  1IXR A;  3SK5 A;  2K5W A;  1E7Z A;  1DJR D;  3CCL A;  4X62 L;  4B3R Q;  2JN4 A;  1E1T A;  1AE2 A;  2E2D C;  5C5L A;  2E8G A;  3A54 A;  4N8X 1;  2LS0 1;  1W3S A;  1CI3 M;  3J80 E;  2HHH Q;  1STA A;  2JP1 A;  2EYH A;  1EEI D;  2A69 D;  4JW0 A;  3S24 A;  3EFX D;  1LAC A;  5IP7 H;  1FYC A;  1CKN B;  2B2T A;  1VQ4 A;  2JXM B;  1FNW A;  4RHR A;  5I6W A;  3CMA A;  3GD7 A;  4C3H H;  2X69 A;  3NTI A;  3T1Y L;  5T1I A;  4DK6 C;  2GN5 A;  2PQE A;  4R8N A;  1F2M A;  3C2P A;  3RLN A;  2VB2 X;  3I4O A;  1K9M C;  4R8I A;  4A3K H;  3D0F A;  1RJT A;  1QVC A;  4QL5 A;  3J81 L;  2KHI A;  3NP8 A;  1VQC A;  3MXU A;  3VDY A;  1F2L A;  4R9W A;  3T51 B;  2SNM A;  2R7Z B;  5IYC H;  3NEM A;  2RDF A;  2RSO A;  4GNX A;  2J7Z A;  3LX0 A;  2UUB L;  4RWS C;  4GS3 A;  1YHA A;  2NN6 G;  1XTD A;  1QVF A;  1PV4 A;  5E4W C;  5C0X G;  5J22 A;  1YNN C;  3RMH A;  1JJ2 A;  1GUN A;  2RHS B;  2ZXO A;  4FXD A;  2N49 A;  1A3V A;  3S2D B;  1NMF A;  2EYO A;  1KQS A;  3HKS A;  3AB9 A;  1PTO H;  4LUO A;  1EL0 A;  4QIW B;  3CQZ H;  1ENA A;  1PYB A;  1XNR Q;  4NXM L;  1PZI D;  3HOZ B;  3ERQ A;  1CZG A;  3J7Z C;  1SSO A;  4BA1 I;  1WCM H;  3RLF A;  4ZQ3 A;  4ABN A;  2JA8 G;  5KYL A;  3MA2 B;  3D3R A;  4KHP L;  1EEF D;  1TWH H;  2K01 A;  1N32 Q;  1U4M A;  2GVB A;  3ER0 A;  1IKM A;  1G2T A;  5KIX A;  5IGB A;  4JI2 L;  4GLA C;  1B3A A;  3A7L A;  1Q8K A;  1IYJ B;  4KHV A;  1Y8P B;  1R9T H;  1HFG A;  3HOX B;  1QZH A;  3BG3 A;  2OTJ A;  4WJ3 M;  2K75 A;  1SNQ A;  1Z47 A;  2SNS A;  1JOQ A;  4KN4 C;  5A35 A;  1BBU A;  2PO4 A;  3MEF A;  1SE3 A;  1NMG A;  4IPH A;  2ZJQ A;  2RDH A;  3EBE A;  1Y1W B;  1BCP F;  4FDB A;  3P20 A;  2IPK D;  2HHH L;  1E0B A;  3FEW X;  2ZXR A;  2SEB D;  1SE2 A;  4HTH A;  3TN2 A;  3LWU A;  3MWY W;  1PLF A;  4QJF A;  5IP9 G;  1PH1 A;  3KLS X;  2CW0 D;  2TMP A;  3GTL H;  3OW2 A;  1HR0 Q;  1SYF A;  2F52 A;  2ICI A;  1RHP A;  3GTJ H;  4DR2 Q;  2E2H B;  5GRO A;  2MUY A;  4IUV A;  4OO1 H;  1WTV A;  5C44 G;  4K8I A;  4A93 G;  3OOC A;  3GQB A;  4PQX A;  5DNF A;  1HZ9 A;  3K0Y A;  4LF6 Q;  4ZLT F;  4X65 L;  2C5C A;  1PXU A;  1SE4 A;  3NHH A;  3CCV A;  3HG9 A;  3A5Z B;  4BBR B;  4C3I G;  5IT9 E;  1XX8 A;  1K0R A;  1B7Y B;  3CCQ A;  2SDF A;  4OWW B;  1D8L A;  3GP7 A;  1BVS A;  1QWY A;  3CXC A;  3S2D H;  5COY A;  3FPU B;  4A3J H;  3ND8 A;  2IJ0 A;  3GTP B;  3L2P A;  3PO2 B;  4DV4 Q;  3S2H B;  3T16 A;  3SDZ A;  4EQ5 A;  1N33 Q;  2F0I A;  2QKI C;  3NUC A;  4AYB E;  5AFW A;  3HOZ H;  4NP5 A;  2PPB C;  1EQR A;  1ICF B;  4EVO A;  2OT2 A;  1F2Z A;  2B8G A;  4JI6 Q; 
#chains in the Genus database with same CATH homology
 2D0P A;  4JC0 A;  1I94 L;  2JA5 G;  1KRT A;  5GAE C;  2ZTD A;  4PZ7 A;  1X55 A;  3K7U C;  2I5M X;  2JA7 H;  4A3I G;  2VUM H;  3DM3 A;  4XTC S;  3PO2 G;  4JI1 L;  3S1Q H;  1X3E A;  1YBY A;  3I4M G;  5C0X J;  4HID A;  1A0I A;  4A3C G;  1N32 L;  3HOU G;  3KDF A;  2R7F A;  2WB1 E;  1SR3 A;  3H15 A;  3RN2 A;  2F3I A;  3CAM A;  1LYL A;  4X64 Q;  1VQ8 A;  3F2C A;  1L2F A;  3G48 A;  3T1H Q;  4NXN Q;  2KHJ A;  5M3F H;  3T1Y Q;  4Y52 H;  5C3E G;  5IP9 H;  2ZJR A;  3GTO H;  1JT8 A;  3ULP A;  2UXB Q;  2AKW B;  2K4K A;  5JJL A;  2K50 A;  3I7F A;  3ZJY C;  4POF A;  1SMX A;  2R7D A;  1UEB A;  4JI3 L;  1HNX L;  3PO3 G;  4IFD G;  1LTL A;  1Y1W H;  4R4I A;  1WJJ A;  2AWN A;  1IZ6 A;  1IBK Q;  1H95 A;  2N8N A;  2UXD Q;  1TXY A;  4QIW E;  2E2J H;  3TQY A;  4NB3 A;  5GQO A;  4UP8 A;  1CKN A;  4ALP A;  3CC2 A;  4JI7 Q;  2OWO A;  4OX9 L;  3AQQ A;  4QGU A;  5C44 H;  4DAM A;  1S40 A;  4X66 L;  2D0O A;  1IBL L;  4IO9 A;  1X56 A;  2UUB Q;  4HJ9 A;  2ASB A;  5M5X H;  3AFQ A;  3S17 H;  3GDE A;  1VQ5 A;  3JC6 6;  4GKJ Q;  5C4J H;  2RF4 A;  1EIF A;  4GKK Q;  2EIF A;  4C3I H;  2E2H H;  1TWF H;  1J5E Q;  4JG2 A;  4LF7 L;  2F4V Q;  1QZG A;  3RLO A;  3AYH B;  1HJP A;  3TEH B;  3W1G A;  1MIU A;  4LFB L;  3U58 A;  1EQQ A;  2E2I H;  1Q46 A;  2R93 G;  3I4N G;  4K0K L;  3KFU A;  3CF5 A;  3S1R H;  2RHQ B;  3CCR A;  1HR0 L;  4LF8 Q;  4B3R L;  1CKM A;  4YY3 Q;  1K8A C;  3OTO Q;  3CP0 A;  5GAH C;  3L7Z C;  4EX5 A;  4DR2 L;  1N34 Q;  4YCU A;  2N78 A;  5LMU Q;  1E1O A;  4OXP A;  5JEA G;  2N3S A;  4DV7 Q;  3TS0 A;  4DV5 L;  1Q7Y C;  2R6G A;  4UP9 A;  1L1O B;  4A3G G;  2RCN A;  1X3G A;  3PIO A;  2UUC Q;  3TRZ A;  2K52 A;  2I5L X;  1YEZ A;  4AIM A;  3K8A A;  1XMO L;  3NEN A;  1WYD A;  3OYY A;  4J15 A;  1UE7 A;  1KHI A;  2LXK A;  2OQK A;  2WP8 J;  4L5S A;  5M3M G;  5FLM G;  4GOP C;  4P71 A;  5M5W H;  4DKA C;  2PNH A;  1NBW A;  3CCJ A;  1VCI A;  4C3J H;  1SLJ A;  4HJ7 A;  1PH9 A;  3GTK H;  1HZA A;  4DR3 Q;  1X3F A;  2PQA B;  4DR5 Q;  1J6Q A;  4AH6 A;  3HKZ G;  5IE8 A;  4HIK A;  4AQY Q;  1VQB A;  2NZH A;  2ALY B;  3Q8D A;  1VQJ A;  4GNX B;  1X9N A;  4JV5 Q;  4KLK A;  1U0L A;  3B6Y A;  4IJL A;  2JA5 H;  3CC7 A;  4GOP B;  4R4T A;  3UDF A;  2ZJP A;  4BY7 G;  4A3I H;  3PO2 H;  3CME A;  3S2H H;  1YNX A;  2UU9 L;  3K7A H;  4DV3 Q;  4IPD A;  1KD1 C;  3I4M H;  3F2B A;  4YHH L;  4A4I A;  1HNZ Q;  2EQS A;  4A3C H;  1OXX K;  1X54 A;  4GN3 B;  4DV2 Q;  2AMC B;  4B3T L;  1I50 H;  2HT1 A;  1G6P A;  1XMQ L;  4R4C A;  1TWC H;  1VQN A;  3UDG A;  4DV4 L;  1K8G A;  5JJK A;  3M7N A;  4OON A;  5C3E H;  1TWA H;  1XJV A;  1Y1V G;  4JI0 Q;  2BH8 A;  2QGQ A;  2NZO A;  1PH4 A;  3RZO H;  1K73 C;  3PO3 H;  1OXU A;  1FJG Q;  4JI6 L;  1KAW A;  1Q86 C;  3J81 c;  4DUY Q;  1M90 C;  4DV0 Q;  1PH6 A;  4IPG A;  2XGT A;  3KYH C;  3I56 A;  1M1K C;  5AJ3 L;  1PYS B;  4B3M L;  5GAD C;  3EIV A;  4NPS A;  2NVT H;  1AH9 A;  3AFP A;  3PCO B;  4P72 A;  1DGS A;  1YVC A;  4LW1 A;  3CPW A;  1I3Q H;  2JE6 I;  1Q1B A;  4GLV B;  4GN5 A;  1PH5 A;  4X64 L;  1PH3 A;  4LFA L;  1X6O A;  1VQG A;  2IX1 A;  1CKO A;  3T1H L;  1KIX A;  3W5O A;  2IHF A;  4RG1 A;  5IWA L;  1YIT A;  1XNR L;  3KF6 A;  1N36 L;  2UXB L;  1G51 A;  1FVI A;  2R93 H;  5IYB G;  4BBS G;  2YV5 A;  1EOV A;  2HIV A;  2PI2 E;  1SFO H;  2Z6K C;  3CCU A;  4LUZ A;  3I4N H;  1KC8 C;  2MQH A;  4JOI C;  3M3Y H;  1V9P A;  4LUV A;  2DUD A;  1Y14 B;  4X65 Q;  4JI8 Q;  2IX0 A;  3KJP A;  1IBK L;  1MJC A;  3HOY H;  3TRE A;  3PUW A;  2VNU D;  2UXD L;  2B29 A;  4OWX B;  3CCS A;  4DV1 Q;  5FJ8 G;  1PHJ A;  3RZD H;  2IT1 A;  2E5L Q;  4JI7 L;  1VQE A;  2WFW A;  1V43 A;  1S3O A;  3UE0 A;  1GKH A;  4AYB G;  1ASZ A;  2B63 G;  5LMN Q;  1PH8 A;  4QY7 A;  3LGJ A;  1TWG H;  1EUJ A;  1GD7 A;  4C2M H;  1V1Q A;  1CSP A;  4IOC A;  5M3M H;  2V1C C;  4P73 A;  1RL2 A;  2YTV A;  5FLM H;  2JEA I;  2KBN A;  2Q2H A;  2VS1 A;  2WAQ E;  2UUA Q;  3G71 A;  2JA6 G;  4GKJ L;  1BBW A;  1WOC A;  3E9H A;  1YHQ A;  4GKK L;  1KRS A;  2F4V L;  5BR8 Q;  1BKB A;  3K0X A;  3M4P A;  5HGQ A;  4DUZ L;  4DV6 Q;  3H0G G;  4LF4 Q;  3S15 H;  4IFD J;  2YYZ A;  1XPR A;  2R7Z G;  1N9W A;  1SN8 A;  3E0E A;  4KHZ A;  1GM5 A;  3RNU A;  1OXT A;  4PZ6 A;  2Y0S E;  1PH2 A;  4JYA L;  4BY1 G;  4BY7 H;  5C4X G;  1VQD A;  1HH2 P;  2WB1 G;  5IP7 G;  3OTO L;  1PVO A;  4LF9 Q;  1PA6 A;  1N34 L;  5IYD G;  3HOV G;  1VQA A;  2VQE Q;  5LMU L;  4A93 H;  3ULJ A;  2VQF Q;  1HZB A;  1I94 Q;  3S14 H;  1D7Q A;  4WJ4 A;  3SGI A;  2Q2I A;  3HFZ B;  1EFW A;  2NN6 I;  3S16 H;  1OTC A;  2LSS A;  4A3D G;  2UXC L;  4DR7 L;  4OO1 I;  5JJI A;  5C0X I;  1L1O C;  1VS0 A;  1Y1V H;  1E22 A;  2H5X A;  3NEL A;  4DR3 L;  4A3K G;  4BXX G;  1NE3 A;  4LF5 L;  2A8V A;  2PI2 A;  4DR5 L;  3K80 C;  1OXS C;  4IPC A;  4DR6 L;  2ZM6 L;  1JMC A;  2KEN A;  4IOA A;  4DR7 Q;  3HOW H;  4GN4 B;  3PGZ A;  4RMF A;  2CCZ A;  2PMZ E;  4LFC L;  3GTG H;  1QUQ A;  4PG3 A;  4DR4 Q;  2CQO A;  1PFS A;  4O2D A;  5JEA J;  1B70 B;  1VQM A;  2HIX A;  4NXM Q;  3HOY G;  4L5R C;  4YWM A;  5IYC G;  4HJ5 A;  2MO1 A;  1HR0 W;  4DK3 C;  1HNX Q;  1HNZ L;  2OTL A;  5H1S E;  1X65 A;  4GNX C;  3H3V H;  4DV2 L;  2I5H A;  1FGU A;  4KHP Q;  1XNQ Q;  5E7N A;  4POG A;  4IFD I;  4LF6 L;  3WWV A;  3W1B A;  1VQI A;  2NVQ H;  4GLX A;  4OX9 Q;  4JI2 Q;  1EYG A;  5J3B A;  4A3F G;  3PUX A;  4JI0 L;  3MXN B;  2GVA A;  2K5V A;  1YIJ A;  2QA4 A;  2Z6K A;  1HNW Q;  3D31 A;  5IYB H;  2ES2 A;  4JOI A;  1L0W A;  3HOX G;  1IL2 A;  1XPO A;  3CC4 A;  4BBS H;  1A8V A;  1SRU A;  1FJG L;  3PF4 A;  1VQ7 A;  1IXR A;  4DR1 Q;  4DUY L;  1VQ9 A;  4JBK A;  1E7Z A;  2QEX A;  1VQ6 A;  3HOU H;  4QQB X;  5FJ8 H;  4B3S L;  1AE3 A;  3UDX A;  1EIY B;  4LFB Q;  1C7Y A;  3CCL A;  2BA1 A;  3KDF B;  2Q2T A;  2B63 H;  1I5F A;  1A63 A;  4PZ8 A;  3G4S A;  1N33 L;  4X62 L;  1WCM G;  2BA0 A;  4B3R Q;  3J80 c;  1CUK A;  1E1T A;  1AE2 A;  3U4Z A;  2JEB I;  4R4O A;  2B3G A;  2E8G A;  4A3L G;  3F2D A;  2JA6 H;  3M9B A;  1W3S A;  2HHH Q;  3CW2 C;  2CFM A;  1YJ9 A;  1Z9F A;  2FXQ A;  2MNA A;  2VL6 A;  3H0G H;  3S24 A;  1WI5 A;  3UDI A;  2R7Z H;  3GTM H;  3S1N H;  2A19 A;  3M4Q A;  2ATW A;  5C4X H;  4BY1 H;  2R92 G;  5IP7 H;  4JI4 Q;  3GO5 A;  1SE8 A;  4JI8 L;  1CKN B;  1T9H A;  1LUZ A;  1VQ4 A;  2ZTC A;  2A1A A;  1PH7 A;  3HOV H;  2BH2 A;  5IYD H;  2KCM A;  2E5L L;  4JBM A;  3AEV A;  4A3E G;  3CMA A;  3GD7 A;  4C3H H;  3A5U A;  4NXN L;  5LMN L;  2D62 A;  3T1Y L;  2Q2U A;  3M85 A;  4DK6 C;  2GN5 A;  3BU2 A;  2UU9 Q;  1L1O A;  2DGY A;  5ELO A;  4A3D H;  3RLN A;  3I4O A;  1K9M C;  4BXX H;  4A3K H;  1UE1 A;  3D0F A;  3PIP A;  1IBM Q;  1WFQ A;  1QVC A;  4BBR G;  1VQF A;  2ID0 A;  5BR8 L;  4QL5 A;  1VQP A;  3KJO A;  4DV6 L;  1NJI C;  2KHI A;  5GAG C;  3PUZ A;  4R1J A;  1O7I A;  2IHE A;  1HZC A;  1YZ6 A;  1VQC A;  3VDY A;  2PQA A;  3J81 i;  3M4O H;  4A3G H;  1OXV A;  4XIG S;  5K36 G;  1P8L A;  4YCW A;  1SRO A;  4MZ9 A;  3NEM A;  5IYC H;  4GNX A;  1UWV A;  2VQE L;  4A76 A;  2UUB L;  1YHB A;  1I6H H;  4GOP A;  4GS3 A;  1YHA A;  4X6A H;  4A3M G;  2VQF L;  2NN6 G;  1XTD A;  1QVF A;  1PV4 A;  1NY4 A;  1VQL A;  2YU9 H;  3ERS X;  4MNO A;  3JAM i;  2CWA A;  4OO1 G;  5C0X G;  2KCT A;  3ULL A;  3KF8 B;  3NBH B;  4JBJ A;  1JJ2 A;  1KXL A;  1J5E L;  3BJU A;  2EXD A;  2MO0 A;  2RHS B;  3IRB A;  5AJ3 Q;  4B3M Q;  4A3F H;  4JCV E;  4DPG A;  4LNQ A;  3TS2 A;  1CSQ A;  2N49 A;  2OQ0 A;  1K83 H;  1YJW A;  2LXJ A;  4YWK A;  1NMF A;  4H02 A;  3HOX H;  3HKS A;  3PV0 A;  4UP7 A;  2AHO B;  4YY3 L;  1KQS A;  4LF8 L;  2VZA A;  3H3V I;  4UPA A;  4LFA Q;  1RIP A;  4LUO A;  4JI5 L;  4R4Q A;  3CQZ H;  2IY5 B;  2JQO A;  4DV7 L;  4DR4 L;  5IWA Q;  1PYB A;  1UE5 A;  4APV A;  2NVY H;  1XNR Q;  1N36 Q;  3F1Z A;  3E9I A;  4NXM L;  3FHW A;  2UUC L;  1ASY A;  2WAQ G;  3PUY A;  3J7Z C;  2HQL A;  3BZK A;  2JJQ A;  1WCM H;  4JBW A;  4JI1 Q;  3K81 C;  3RLF A;  4BA1 I;  2K5H A;  2JA8 G;  4YWL A;  1W2B A;  4A3B G;  2YTX A;  4YCV A;  3UE1 A;  1XNQ L;  4KHP L;  1TWH H;  1N8R C;  1N32 Q;  2YTY A;  4A3J G;  2GVB A;  3ER0 A;  3STB D;  4A3L H;  5HY6 A;  3FKI G;  4AQY L;  1VQO A;  4JI2 L;  1XPU A;  2Y0S G;  4GLA C;  1Q8K A;  4JV5 L;  2NVX H;  1IYJ B;  1HNW L;  1K3R A;  3PF5 A;  1C9O A;  3HOZ G;  1R9T H;  3FP9 A;  4DV3 L;  2R92 H;  1QZH A;  4JI3 Q;  2OTJ A;  1LM0 A;  2K75 A;  1Q1E A;  4DR1 L;  4WJ3 M;  1Z47 A;  4DUZ Q;  1BBU A;  3MEF A;  4A3E H;  3HKZ E;  3KOJ A;  2JA7 G;  2VUM G;  1GVP A;  4TQU S;  4HJ8 A;  4JYA Q;  4IJH A;  1NMG A;  1Q82 C;  4IPH A;  2ZJQ A;  3EBE A;  1IBL Q;  4X66 Q;  1C0A A;  1JJC B;  4FDB A;  5DLQ E;  3KF6 B;  3RR5 A;  2HHH L;  1EWI A;  3DLL A;  3U50 C;  1NTG A;  4BBR H;  5M3F G;  3PUV A;  1YJN A;  4QJF A;  1JJG A;  5IP9 G;  4LF7 Q;  1PH1 A;  2UXC Q;  4DV0 L;  1QVG A;  4OWT B;  1Q81 C;  2OCE A;  3GTL H;  5EAY A;  1VQK A;  4JI4 L;  3OW2 A;  4K0K Q;  4LF5 Q;  1YI2 A;  1HR0 Q;  2F52 A;  2JK8 A;  3BZC A;  1Y1W G;  3GTJ H;  4JI5 Q;  3S1M H;  1G29 1;  4P75 A;  3CCM A;  5IY0 A;  2ZM6 Q;  4DR6 Q;  4A3M H;  4DR2 Q;  2AWO A;  2K5N A;  5GRO A;  4L5T A;  4DAY B;  4DV5 Q;  4LFC Q;  4P74 A;  3GTP H;  2C35 B;  3EN2 A;  5C44 G;  5FLX c;  1XMO Q;  2I0Q A;  5M5Y H;  4A93 G;  4ME3 A;  4DNI A;  1HZ9 A;  4TVA B;  5IT9 c;  4L5Q A;  1IBM L;  2K14 A;  4LF6 Q;  2XTI A;  4X65 L;  3J81 j;  3CCV A;  3A5Z B;  4HJA A;  2CKZ B;  2L15 A;  4DV1 L;  2Z0S A;  1FL0 A;  1JE5 A;  3CPF A;  1B8A A;  3L0O A;  3CCE A;  1K0R A;  1B7Y B;  3STB C;  4PMW A;  3CCQ A;  1P16 A;  4OWW B;  2VW9 A;  3F8T A;  1D8L A;  3I2Z A;  1E3P A;  4UY8 C;  3ICE A;  1BVS A;  3CD6 A;  1MKH A;  3CXC A;  2JA8 H;  1Q12 A;  3U4V A;  1KL9 A;  4YHH Q;  1JB7 A;  3HOW G;  3J80 i;  3A74 A;  4A3B H;  3I55 A;  2UUA L;  3RN5 A;  3S2D H;  4A3J H;  2VY3 A;  2MFI A;  1S72 A;  4B3T Q;  1UE6 A;  3KLW A;  4B3S Q;  1XMQ Q;  3FKI H;  4BA2 I;  3L2P A;  5ELN A;  5LMN W;  4MTN A;  4O0A A;  4DV4 Q;  4LF4 L;  1N33 Q;  4EQ5 A;  3G6E A;  3PSI A;  4X62 Q;  4LWC A;  1A62 A;  2CWP A;  1GO3 E;  4KI0 A;  3JAM c;  4HIM A;  4AYB E;  2JA9 A;  4HIO A;  3J7A 5;  4Y7N H;  1MJE A;  3HOZ H;  1E24 A;  4A75 A;  1QUQ B;  3GTQ H;  4LF9 L;  1EQR A;  1VQH A;  2ZTE A;  4JI6 Q;  1U5K A;  3A0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...