3NSWA

Crystal structure of ancylostoma ceylanicum excretory-secretory protein 2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
GSHMEYCPKMLSEIRQEDINDVETVAYVTVTGKTARSYNLQYWRLYDVPKTAPSQWPSFGTLRDDCGNIQLTADTDYVLGCKSGNQDCFVKLHDGLSQKEKDLLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Excretory-secretory protein 2
publication title Ancylostoma ceylanicum Excretory-Secretory Protein 2 Adopts a Netrin-Like Fold and Defines a Novel Family of Nematode Proteins.
pubmed doi rcsb
source organism Ancylostoma ceylanicum
total genus 28
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2010-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.780 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nswA00
3NSWA
chains in the Genus database with same CATH superfamily
3Q23A 4WRDA 3M3YH 4Q0FA 2E75C 2B63G 4A93H 4KHZA 3MEFA 1VMPA 4DR3Q 2QEXA 1N33L 2BH2A 2UUCQ 2HUGA 1P8LA 1VQNA 3G7LA 4CGYB 4R8NA 5IE8A 3W2DA 5M5YB 2B29A 1H9SA 3OOCA 4IFDH 2XVSA 4RH6A 4YWLA 4K5WA 1NE3A 2Z0SA 1UWVA 2IY5B 2NTTA 4R4QA 4JI0L 4C3HG 2IHFA 5I9PA 5IP9H 1I94Q 3N6RA 1ZYRD 3HOXG 1EIGA 2CQAA 1EZ6A 1HPCA 3OTOQ 3ITPA 4X3SA 1IL2A 1EY4A 4L5QA 4EQOA 4DV2Q 2A74C 4B3SQ 1QB5D 4DXFA 2EXDA 4YHHL 2A1AA 4UP8A 4RHRA 1CA6A 4FO2A 2K5WA 4EVOA 5JAVA 4JI8Q 4A3EH 1F9SA 2A69D 5D3DA 1NY4A 3RZOH 1X9NA 2C5CA 5NUCA 2JA8G 2VQEL 4DV4Q 2IT1A 4GOPB 1YI2A 3C1EA 2IHEA 2XIWA 4LF4L 1UE1A 3QB3A 4ZCKA 3NBIA 2JP1A 4KLKA 4OL7A 1C7YA 4DNTB 2RHSB 4RCNA 3UDXA 1SMXA 2FINB 1VF7A 3CHBD 4UP9A 3SK6A 2SNMA 4DNIA 2OTLA 1SXTA 4JOIA 3X3NA 3S15H 1M4VA 3EBEA 2RDFA 5G3LF 1B8AA 4FF4A 5GQOA 4UHVA 2MGSA 4DK6C 1N34L 2PMZE 4KJNA 1SMYC 1I6HB 2VB3X 4IPGA 2ZXRA 1D5XC 5CV7A 3VR6A 4LMQD 4C2MB 4A3BH 3A54A 3I7FA 1C0AA 2KQ3A 2FJ2A 1PH4A 3BVGA 5BN5A 4PMBA 3MXGA 1E2ZA 4IFDG 3A55A 3KJOA 2BH8A 4H0LC 2MFIA 1EWHA 1BDOA 1EOTA 1EY7A 4LF6Q 1QVCA 1GJXA 5C0XH 4JK1C 1YZ6A 3Q0AA 1F2ZA 3MEHA 1ET9A 2B2TC 4K5XA 1HNWQ 4ZKCB 1QILA 3S2HB 1KHIA 1Y14B 2RDGA 4GN5A 2NVQB 4RGTA 1WTHA 4N8FA 2VNUD 3J81i 4MNOA 4L6TB 3EROA 5I6YA 1X3FA 4RHSA 1CSQA 2E5LL 2XGTA 4KN7C 2JA6G 1WI5A 3SK4A 3MXUA 2E76C 1QVGA 2JA5G 2Z8LA 1K8MA 1SMYD 1R9TH 2F03A 4A3LH 2AHOB 3I4OA 4BBSG 2XTIA 4A3EG 5CV5A 1Q1BA 2ZM6Q 5C4ZA 2WB1B 4XQJA 3D6CA 1HZCA 2HHHQ 2E8GA 3KF6A 4RCOA 2D0OA 1GVPA 3EIVA 5EBDA 1NAPA 1IBKQ 2Y0SE 3BU2A 2R3ZA 2KOLA 4A3IG 3JAMi 3CAMA 4KN4C 1KTKA 4HJ8A 4IN3A 1IKMA 3H0GH 3I4NH 4QB4A 2MO1A 4IPCA 1DOLA 5DNFA 4BY1G 1KD1C 1N36Q 5CORA 4CJ1B 5BN3A 4Y52H 4KD4A 3BDCA 3VR4A 4A3KG 1TY2A 1A63A 3MXPA 3NHHA 1SYCA 1HHVA 5KYIA 1V1PB 2NN6I 2F0EA 2H4OA 3AFPA 2R93H 3RZDB 1QVFA 1TS2A 1N8RC 5JJZA 3CD6A 2UUBQ 4ME3A 4A3FH 3MC0B 2K5DA 2UXBL 1SYEA 1G6PA 1ZXTA 3PSIA 4XXEA 1HTPA 5C4XB 4AYBE 1KDAA 1GD7A 1EU3A 4JYAL 4QQBX 2LY7A 1LLRD 3ULJA 4XYQA 3CC2A 1HUNA 2B2YC 3T1HQ 1Y8OB 1LTBD 4I65A 1BBWA 2B8FA 1GKHA 2SNSA 3M4PA 1HA6A 1RDPD 2N55A 1HXYD 2ZTCA 1VQHA 3A0JA 4BY7H 4I7ZC 1RHPA 2BA0A 3CMEA 3SE0A 1LT4D 1ICWA 1V1OA 4DR1L 2M00A 4YCVA 2KJXA 2B63B 4DV6L 1JMCA 3DEPA 2NYZD 3RN2A 3IFDA 4LFAL 1U4RA 2CW0D 3D4WA 4GOPC 2M9VA 2JXMB 2PW5A 1Y1VH 1YNJC 2HQEA 5IY0A 4IURA 5ELDA 5A35A 2ZXOA 2DY8A 1SYDA 4FYDA 4DR5Q 3VR2A 2R7ZH 2K75A 3L9AX 4GKKQ 1PDQA 2B39A 2K03A 4JI3Q 1RCVD 3EFXD 3J80i 1VQ5A 2IX3A 3H0GG 3HOXB 3OMCA 1E22A 2ZJRA 5KNCA 5IP7H 1HNZQ 2ES2A 5ELFA 4G7ZC 5JEAH 1S5ED 5AJ3L 3MHBA 2J7ZA 3D8GA 4IFDI 3D6WA 1D1IA 1KNEA 3OIQA 3SEBA 1CQFA 4IJHA 4JG2A 3U9SA 4OEMB 1XTCD 2R93G 5FOBB 2K04A 4QCLA 4N9TA 5C44B 3CCMA 4L5RC 3DWQA 4DR4Q 3IL8A 1IBLL 2F3WA 1Q81C 5JJKA 1I5FA 1PFSA 1PH3A 3G6JB 4C3IH 1F2YA 2HIVA 1PV4A 2FMCA 1CM9A 4JI5Q 2ZTDA 4V190 3S1QH 5FLMG 3G6EA 1ILQA 2OWOA 3DHQA 3GTJB 4X3TA 2UU9Q 1RTNA 5CV4A 1VQIA 2N8NA 4LF5L 1FNVA 1Q8KA 1BO0A 1YHQA 2O5JC 4FF3A 4Q5VA 2R92H 1MIUA 1LTGD 3S16H 3FKIH 2DN8A 5DEHA 3WDNA 4B9XA 4J6HA 3CXCA 1HNXL 3M3YB 2EYLA 4CJ0B 3UDGA 3ONAB 4A93B 2GA4B 4FF2A 4DAMA 3MXNA 1RJTA 3LWUA 1JWUD 1Y1VG 1LTTD 2JA9A 2TSSA 4DGZA 3KLSX 3GD7A 1FNWA 4DPGA 3P20A 1K28A 4GKJL 1EEID 1ENFA 3FP9A 1X56A 1KLGD 3VR3A 2K5QA 5C0XJ 1HR0W 3A5ZB 1XNRQ 3ULLA 3M4OH 1CSPA 5T1IA 3T51B 4K2LA 3BYYB 2CKZB 3GV3A 1HTLD 4X66Q 2UXDL 2CH4A 1CQVA 2R6GA 4QF4A 5M5WH 5IP7G 3AQQA 1K3BC 3L3OC 2L4NA 1CKMA 5JEAG 4P72A 4KJOA 3OSOA 3VYRA 1LTID 1KDBA 1N32L 1I4GA 1YVCA 1TXYA 3PIPA 3F2BA 2B3GA 2Q8IB 1SNMA 1FGBD 1SYGA 1EWCA 3FPPA 4KTAA 3QIAA 3HKSA 1VQGA 1B50A 1D5ZC 1VQAA 4JI2L 2B8GA 5C0XI 3DWPA 2F0HA 4RGNA 3S1NH 1STBA 1S5DD 1XX8A 3P7JA 4A3EB 1HA5A 4YIJA 1G8ZD 1WTWA 1K8AC 3RZOB 4OWWB 1VQ6A 4OELB 5FO8B 3DXJC 4C3IG 4PG3A 5K5PA 3KF8A 1WD1A 4GLAC 5I6WA 3CKIB 4OONA 4IUVA 1IL8A 4M1UB 3DEOA 1I4QA 4PZ6A 2PCFB 4DV5Q 1T5XD 1YNND 4XT1B 2ASBA 1SBBB 3L2PA 1L0YB 1F9RA 4NXMQ 1HUMA 1KABA 2IL8A 4POGA 2YYZA 4LFBL 1AE3A 4X64Q 3HEJA 1GUTA 4PQXA 2KHIA 1PFBA 2DNCA 3FVQA 3G48A 1ESFA 3K7AB 4JI4L 3V2TA 1SFOH 5JOBA 5EAYA 4A3BB 4LUZA 1ET6A 5ELNA 2HDMA 1XMOL 5ELEA 1EY8A 4BA2I 5HGTA 4DFAA 4QMGA 3HOWH 1DCZA 1HRJA 3TBIB 4RG1A 1STEA 3K59A 4IO9A 4CBVA 1CI3M 1UAPA 1X3PA 4LF5Q 1QJOA 3W5OA 1CFMA 4L8JA 5DAUA 4JI1Q 3ND9A 3W3AA 1KRTA 2WAQG 3G4SA 2R61A 4HEDA 4F8MA 1CK1A 4UDUC 2OQ0A 4ZAIA 4DV7Q 2AQ1B 2JSOA 4LF9L 3Q24A 2I0QA 3J81L 1NMGA 2EJFC 1HZ9A 2O4XA 3FEWX 3DM3A 3NTHA 1CKNB 5I2XA 1PH6A 1GUWA 2NUCA 1MSHA 2N78A 1NNXA 1R9TB 2F0JA 4LF7Q 3LWEA 1TWHH 1Q7YC 2EDGA 3NK9A 1YJWA 3T4AC 2QGQA 2OCEA 1OXVA 4Z9CB 5J39A 1QNKA 1DM0B 4BWGB 4NW2A 4B3TL 1QUQA 1SE8A 1NBWA 1IBMQ 2IWHA 3VA7A 3CPFA 1SNPA 1ASYA 1RTOA 1QCBD 3T1YQ 4KY7A 1O7IA 1K0SA 5FK9C 4P2CB 3JAML 2BOSA 2WFWA 3H0GB 5JJIA 5FJ8H 1RIPA 3I4NB 5LMUL 1LABA 1UE7A 2AUJD 2F0IA 2F0UA 4DV0Q 1EY9A 4HR7B 5BN4A 4TSSA 3H3VH 2SOBA 2JYOA 1PFNA 5COYA 1YBYA 4B3RQ 4ZQ3A 2IX1A 3W1BA 4BA1I 4K0KL 1SAPA 1FJGL 1K0RA 5BR8Q 5E7NA 4KK7A 1VQJA 1WFQA 5FKAC 4RGMA 2B2VA 4O2DA 1PH1A 2R93B 2FFKB 2QCPX 2B2UC 3URYA 4YCUA 4LAAA 1JB7A 4A3FB 4MN3A 5C4XG 4R8IA 1EYAA 1Q86C 2F0LA 3K80C 3KJPA 1PLFA 2EYFA 1RKNA 4LWCA 3JC66 2SEBD 1ZYRC 5CV9A 3A7AB 1S5CD 4C1NK 2K7VA 3SHLA 4EQNA 2CWAA 3TP5A 2EY5A 3D31A 4YY3L 1KDCA 1HH2P 3TN2A 4I7AA 5GADC 4LFCQ 1M8AA 4DNRB 2DY7A 3T56B 4IALA 2FHTA 4HJ7A 4DR6Q 2J0TD 3M4YA 3ULPA 1NR2A 1LTSD 2RSOA 4KHPQ 3AFQA 4OX9Q 1VQMA 2PZTA 3PMFA 3AB9A 5D14A 4BY7B 1LV9A 4KD3A 1OXSC 3ND8A 3R3OA 1JQYD 2F1MA 2YU9H 2F52A 2A69C 3ERQA 3SGIA 1GUGA 5KNDA 1TS5A 1Y1VB 3R93A 4HTHA 1V1QA 3A8KE 2AQ2B 1SLJA 4K14A 2MHVA 2NN6G 1H9JA 2R7ZB 4WJ3M 1R4PB 4C1NI 1AE2A 2OXPA 3C1FA 5IIFA 5GAEC 1OXTA 4YWMA 3TP7A 1WCMH 3CC4A 1AN8A 3HOUG 5FJ8G 2Z6KC 3OW7A 3J80L 3F1ZA 2UXCQ 4XT3B 1I50H 2WP8J 2KVMA 1W2BA 4CDFC 1WOCA 1PH9A 3NE5B 1QZGA 2A6ED 1CA5A 4G57A 3ERSX 1DONA 3KLRA 5CBEE 2RDHA 5C44G 3QO2A 3K58A 2RF4A 1EWIA 2PQAA 4FNFA 3BDLA 2A68D 3HKZB 1O78A 2G5DA 1V8QA 5IGBA 1EEFD 3H6MA 3HOZG 1TS4A 5LMNQ 4HSVA 1FYCA 1HZBA 4UP7A 3UDFA 2UUAL 5KYLA 4C3IB 5EQ0A 3SR1A 1L1OB 2VXWA 4FXGC 3E0JA 5C3EH 1XMQQ 1K73C 1BKBA 4POFA 3K5MA 3RLNA 2I5MX 2H1EA 4DV3Q 2R92B 1G91A 3I72A 5FLXE 2EZVA 3S16B 3FKIB 4NXNL 4K0KQ 2YTYA 1B4OA 1U4MA 4A93G 1LUZA 3S17H 3CP0A 3T53B 4J1MA 1NUCA 3GTMH 4L5SA 2F0DA 3BYTB 1JWMD 1IHZA 4XDXA 4X62Q 1BF4A 3HP3A 2V4DA 2JQOA 2L11A 3U4ZA 1GM5A 2VZAA 2LSSA 4DR2L 1SYFA 5IYCH 5FLXc 5GAHC 4DAVA 2BCOA 3S14H 4H7BA 5C3WA 1Z47A 5IP9G 3GV6A 1JCKB 1BOSA 1IYUA 4JI7Q 3M4OB 3CCVA 2O5IC 2RKSA 1WCMG 1VF5C 2Q8TA 4DR7L 3TQYA 1TWFH 3CRKC 1TKWB 3D4DA 1UUPA 2WAQB 4RWSC 3AYHB 4LNQA 5M5WB 4H02A 1HR0L 1T5EA 4AYBB 1F2LA 1N33Q 4HIKA 2EIFA 4TRDA 4ZRZA 4GNXA 4LF8L 3MZ5A 2F0NA 1SE2A 3OWEB 4HJ9A 5IWAL 1JORA 2RA4A 1Y1WH 2VQFL 4A3GH 1S72A 1KL9A 2C9OA 4JI0Q 4ZLTF 1H9RA 1L0WA 4DAYB 4LUOA 4HIDA 1XNQL 4K6DA 4C3JH 5C3XA 1HQMC 3NTIA 5EKLA 2B2WC 1A8VA 3CCEA 4A3DH 3GTPH 3KUPA 3C46A 5LMNW 3WOEA 2KCMA 3RN5A 3P1HA 3GTQH 2F0MA 1HZAA 4GLXA 4IOAA 1T9HA 2AWNA 2IPKD 4YHHQ 4R4CA 2PYKA 4N9PA 4XQNA 3M4QA 1KIXA 4APVA 1K8OA 4L5TA 1S5FD 1QNUA 3EQLC 4A75A 2CVRA 2EXZA 3DUZA 1NJIC 5IT9L 2Q2UA 2XSCA 2CW0C 3RD4A 3TP6A 3H94A 2F0KA 3NWSA 4NB3A 2WV6D 4A3BG 2NVTB 1SROA 3O13A 1SFOB 2VQEQ 1ML0D 3R2IA 2MNAA 4LF4Q 3K7UC 2NVXH 1DJRD 1OXXK 4A3CH 4DUYL 2KHSA 3CC7A 3H3VI 1XWEA 2CFMA 3TEHB 3GP7A 2FXQA 4AQYL 3M9BA 3LGJA 1VQBA 3E9IA 2Z4HA 5C0XG 3HOWB 4FXDA 1A2UA 2VL6A 2K14A 1EIHA 1H9SB 4JC0A 1PH2A 3B6YA 3CW2C 4ABNA 2L5TA 2YV5A 1KC8C 1J5EL 1EL0A 2X69A 3QWNA 4BXXH 3KK7A 3LX0A 3F8TA 1N34Q 2E2IH 2A73B 5EPJA 1VQKA 2EYJA 1X3QA 2D9UA 3GTGH 1BBXC 3Q8DA 2F3IA 5ELOA 4V0BA 2EOTA 4KKTA 4YCWA 4B3ML 4DU9A 1XPOA 3IAYA 1EY6A 3NBHB 4ME5A 4A3LG 3E9HA 3I2ZA 1LYLA 1STNA 1D8LA 2WB1E 4CKBA 1Z6HA 5IGCA 1CZWA 1UNSA 1L1OC 5A2QL 1PTOD 3FMCA 1Y1WG 3NXWA 4GN4B 2BE5D 4A3GG 3RR5A 1MGSA 1TWHB 1E1OA 3CPWA 3PO3H 1BVSA 1PTOH 5EJWA 1NSNS 1HCZA 2Z9HA 2NZHA 1Q12A 2X6GA 2C35B 4HMIA 2ENBA 3VDYA 4GS3A 1SNCA 1LTAD 4HCSA 5E1FA 4A3DG 3TP8A 3I56A 3I4NG 4OIKA 3RLOA 2G9HD 1IZ6A 1C4QA 5D65A 3HOUB 3JAME 1DOKA 2XRQD 4PV1C 3X3MA 3KDFA 2Z6BA 2E5LQ 3A74A 1J6QA 3K5LA 2F4VL 3OIPA 1O7LA 1SE3A 4X65L 5M3FH 1X65A 1EZ8A 5LL6X 4O0AA 4DK3C 1B70B 3STBD 1A2TA 3HG9A 1F2MA 4JW0A 5E3FA 1E3PA 5KNBA 4A3FG 2AQ3B 1EIFA 2K33A 2N49A 1WTRA 5CV8A 1VQFA 4IQZA 3JAMc 1B2TA 3HOZB 3EVQA 1UEAB 5DM63 4ODGA 4JBWA 3AU7A 1VQ4A 1EQQA 1WVLA 4JBMA 3NQTA 2YTXA 3RUZA 2KHJA 2K6AA 4HAEA 5JPNC 3NUCA 4HMJA 1X3EA 1ILPA 2K50A 1PYSB 2IJ0A 4A3JH 1SJHD 3KOJA 1GUOA 4BY7G 3PUVA 3OWFA 3QG1A 2B2TA 4NPSA 3I8ZA 2AWOA 4JCVE 1X54A 5EPKA 5CC4A 3PIOA 3R8BA 1RL2A 1IYJB 2KENA 2YU9B 2UXBQ 1Y8NB 3VA5A 1AH9A 1QZHA 1FGUA 4X3UA 3SXHA 2G9DA 1VQ9A 1M90C 1JICA 2R7ZG 4JYAQ 1VQLA 1I6HH 4TKOB 3IRBA 1LT5D 1SSOA 2K05A 3IFTA 2HQLA 3KFUA 3HFZB 1GUNA 1W3SA 4OXPA 1EFID 3A8IE 2K01A 1YNNC 5IYBH 1SRUA 3D4RA 5EBCA 1TWCH 1WCMB 1NR4A 3KF6B 4RKLA 2EYPA 3W1GA 5GAGC 3MFGA 2LFNA 3KBXA 4ID6A 1I50B 4OWTB 3MWYW 1SNOA 3J80E 4DR1Q 5JVH3 3Q6SA 2Z4IA 4G4KA 4DV6Q 2LS01 4LFAQ 4P71A 3D3RA 3BVZA 4CDCC 1SNQA 5J1ZA 1B9NA 1VDZA 4JV5L 4DV1L 2KCCA 2JA7H 2DUDA 1WTVA 3HKZG 4E6IA 1KQSA 2ZJQA 1K83H 1MI2A 1JE5A 2X6LA 4K8IA 4L63B 5L37A 4R4IA 4JI6L 5CV6A 3J80c 2OEOA 2A8VA 2PW7A 2VUMH 1JT8A 1LTRD 1W6JA 1U9RA 4TVAB 1PRTD 5M5XH 2ZT9C 1TQOA 2OF1A 1X3GA 2EY2A 3BVMA 1CHQD 1EY5A 2VW9A 3M7NA 5C3EB 3GTOH 1GHKA 3HOYH 2R92G 2HCCA 5AJ3Q 1JR0D 3S15B 2OTJA 3FKIG 4QUCA 1SE4A 2B2YA 4KKUA 1LTLA 1XPUA 1BR9A 3S17B 3NWTA 3J81j 1XXGA 1I4HA 3GTMB 3CCRA 3CF5A 2PZWA 1IBLQ 2P5ZX 5I9OA 3BDOA 3A56A 4B9WA 2CQOA 4G7OC 3NQIA 2PNHA 4RA8A 4GOPA 5C6AA 1VQOA 2L1BA 1TT2A 1V9PA 4DR3L 2MO0A 3A7LA 3S14B 3SK8A 3J7AV 2KEDA 5JJLA 3TS2A 2UUCL 4OWXB 2I46A 1BCPD 1MHWC 3H3VC 2F4IA 2IW3A 4EX5A 2F0QA 1K8GA 4RKBA 5IODA 2A6HD 2E2JH 3NELA 1TS3A 4JOIC 1TWFB 5CBAE 4AYBG 1HNXQ 1STAA 3PGZA 2F0WA 1IYVA 4QIWB 1I94L 1MKHA 1XPRA 1II3A 1W6KA 1Q8IA 5ISRA 4O1NA 2JA7G 3R2TA 1ESRA 3OTOL 2VS1A 1YJ9A 2ATWA 1G6ZA 4GKJQ 2HCIA 3MVVA 1WD0A 4DV2L 4B3SL 1Y1WB 2RQXA 2K52A 5DM73 5CMDA 4A3GB 1HFGA 4P73A 3I91A 3TRZA 3VYSA 4C3JB 1NTGA 1VQDA 4JI8L 2ICEC 2QDBA 3GTLH 4A3DB 4A3MH 1QOHA 2UXDQ 4HN7A 5AFWA 3S1MH 1A0IA 3GTQB 3S24A 2DNEA 1QWYA 3PUZA 4C3HH 4F7XA 2ALYB 4DV4L 4A76A 1PHJA 2QF7A 1BQQT 1N32Q 4QJFA 4UAIA 3I4MH 2PNRC 5IGFA 1C9OA 5HGQA 2I5HA 1WTOA 2L9HA 4UY8C 1BXTA 4JI2Q 2PQEA 5IT9E 1JB3A 1E7ZA 1WYDA 1DOMA 3H15A 2L55A 3K8AA 3NEMA 1I3QH 3VYUA 4DN4M 2WINB 4CJ2C 1YIJA 1JJ2A 1G51A 1EYCA 3E6ZX 1X32A 1O7ZA 1O7YA 1BUVT 4U68A 2NVXB 4DXGA 3MXNB 2CH4W 2JN4A 1EOVA 5IGEA 3HOWG 2PI2E 1Q46A 3GO5A 3J7ZC 4CKCA 5IT9c 4DA2A 5TSSA 1FVIA 1TIID 4Y7NH 1SJED 5IYDH 2JA8H 2XNAC 4KKSA 1D2BA 4LFBQ 2DJGC 4H13C 5KIXA 3GTKH 1H9KA 2D2CC 2KBNA 2KCNA 1EQRA 2A6EC 3BG3A 2E2IB 4LF6L 1V1PA 5KEEA 1MSGA 1ASZA 4JI4Q 1ZKOA 1UEBA 4R4OA 4ALPA 3GTGB 3PUWA 4S3SA 4IUPA 2A68C 3UDIA 1HNWL 4KI0A 3I90A 1TWAH 1XMOQ 3EJIA 2KECA 5A2QE 4N8X1 2MUYA 4OHJA 5EPLA 3PF4A 3PO3B 1PTOB 3HGBA 4WFN3 1WTQA 2QILA 1YHBA 4X3KA 2PMZB 5C4JH 1FL0A 1GUSA 2E74C 3F2DA 4IPHA 4A3MG 4DKAC 3HOVH 1CHPD 3K0YA 5G3LD 4O42A 1U0LA 2H5XA 3K0XA 2ZM6L 4BBRH 1IW7D 2LXJA 3KF8B 2HHHL 2F0FA 3EN2A 3KLWA 5KRUA 2ZJPA 4DK0A 4LF9Q 2WACA 3FRPB 3NPPA 1A62A 3I4MG 1IBKL 1E2WA 2MP1A 2KEEA 5M3FB 1J8IA 4GLVB 1VQ8A 3PIO3 2ICIA 5ELCA 4MIUA 1B3AA 3NBHA 2RHQB 1U5KA 1VMCA 1XYIA 1BBUA 3PUXA 5I2YA 1N36L 1JWSD 1MJEA 5CR3A 4QY7A 2PZUA 4MZ9A 1STHA 4B3TQ 2K32A 2JE6I 5FO7B 2JA6H 4IUTA 3S1RH 3LNNA 2JA5H 1STGA 4ZYSA 3CRLC 3TSSA 4IOCA 1TY0A 3WWVA 3CCUA 3K5NA 2WKCA 1EQVA 1VQEA 4BBSH 3PV0A 3S1QB 5E4WC 2QDLA 5LMUQ 3S2DH 2UUBL 1JOKA 3TZDA 1PA6A 1AZPA 3J7YW 1C8CA 3AEVA 5IYDG 2QA4A 3DWAA 3CCQA 4WJ4A 1GXDC 2R7DA 4AIMA 4DF7A 2MQHA 4A3IH 2NTSA 4A3JB 1FJGQ 1B1ZA 4OO1I 1SN8A 3PIP3 2Y0SB 2E2DC 3TMEA 2EYHA 2V1CC 4IPDA 3OPOA 4JBKA 1GOZA 4NMZA 3T1HL 1VCIA 1E2VA 3QJYA 4P74A 4BY1H 4OGQC 3E3XA 2K4KA 3SDZA 3N52A 4A3KH 1HFNA 1AFPA 2F0OA 3D0FA 1QE6A 2L0CA 3K7AH 2EYMA 3U4VA 2XRSD 5ELBA 1LT6D 1PYBA 2NZOA 2XWJB 3I70A 2K1BA 2NWGA 4WJWA 4PNYA 4YY3Q 5KGUA 3K57A 1TR5A 1A3TA 4F87A 2LMCB 1PH5A 3NSWA 4EGVA 2NVYH 1D6EC 4J15A 2RCNA 3HOVG 4BS9A 4BBRG 2LXKA 1TWCB 1QUQB 1DD2A 2D5DA 4DR5L 1LM0A 4GKKL 5J3BA 1PXUA 4P75A 2NZ1D 3DM1A 4B08A 3PCOB 4JI3L 3HKZE 3V96A 3QOJA 2JEAI 1UE5A 2Q2TA 1JC7A 2JA7B 4HSPA 4H44C 1HNZL 3WOFA 3S1NB 3CQZH 4HCEA 1K83B 2F0GA 2EJMA 4ZK9B 1JJGA 2J4XA 3CCSA 4ILWA 1SYBA 2B2UA 2VUMB 4G7HC 5M5XB 5C3EG 1YHAA 3PO2H 2JK8A 3E5SA 2VY3A 1EYGA 4DR4L 5T1GA 2TMPA 1PRTB 3GTOB 1MJCA 1WTXA 5M9OA 5IOCA 1MBYA 3HOYB 2DGYA 3KYHC 4HIMA 1CZGA 2ZXPA 4A4IA 1Y69U 1YNXA 4JI5L 2N3SA 2CCZA 3TDQA 2FMMA 1RD9D 5M3MH 5H1SE 1AW7A 1GO3E 4M8AA 5GROA 3VR5A 1PVOA 4K6LA 1K3RA 1PTOC 2UU9L 1NMFA 1B3QA 2BE5C 1HQRD 2GVBA 4K5VA 1P16A 2UUAQ 1S5BD 1LACA 2AUKA 2KA7A 1FD7D 5IYCG 1VQ7A 2K5VA 4MTNA 3F2UA 3T16A 2YTVA 3UE1A 4IUNA 1X55A 2QEJC 5E4XA 3RLFA 2WAQE 5HURA 4QL5A 3TZUA 4QUFA 2HT1A 1S3OA 2GVAA 2EY6A 4CHTB 1Q82C 1BCPB 4NXNQ 2KCTA 2E2JB 5K36H 4OIJA 1E1TA 2VB2X 1Q1EA 4KY6A 3BZDB 5FLMH 1JOOA 3STBC 3OYYA 1TWGH 3UE0A 1ZEQX 2Z6KA 1XNRL 1RF2D 4PMWA 2WIIB 3FHWA 2PO4A 3J81E 3CMAA 2E2HH 3S9WA 2K5NA 1HJPA 5EKKA 1NCVA 4X66L 3ZYYX 4K2KA 2NBFA 4DR2Q 2R7FA 4XTCS 3A5UA 1I6VC 2Q2HA 4KY5A 1PZJD 1IXRA 4CKEA 3L7ZC 4KMUC 4K8JA 4MHEA 4C3JG 3U9OA 1JJCB 3C2PA 2MJ8A 3DLLA 2PQAB 1E24A 5M5YH 1B53A 3J81c 1B9MA 4DR7Q 3PO2G 3GTLB 4IFDJ 4A3MB 2PI2A 4FXKC 3S1MB 3DMUA 1HR0Q 3QR8A 1XTDA 3SK5A 4XYOA 4C3HB 1KRSA 5C5LA 1DYQA 3I4MB 1PH8A 1CKOA 1Z7TA 4DUZL 4LF8Q 5M3MG 5J22A 4CDEC 2QKIC 1I4RA 5IWAQ 1CKNA 2VQFQ 5HY6A 5CGKA 4YWKA 1K9MC 4DV5L 1LO5D 2HIXA 4IZ8A 4FDBA 1I3QB 2ID0A 4X6AH 4NXML 3NP8A 2F0TA 2KUMA 1XNQQ 1KAWA 4RFBA 4NDXA 4FVMA 4X64L 4A3CG 4ULLA 3V05A 3TS0A 3J7AF 1O80A 1R4QB 2IX0A 3CCLA 4JPBW 3K81C 3GQBA 1YNJD 4HIOA 3NTKA 1G2SA 2L15A 5LL6S 4C56C 4GN3B 1PTOF 2F0PA 4NP5A 4BXXG 4Y7NB 2A5HA 4NKLA 2JA8B 1CTMA 1I4PA 5K36G 3GTKB 1H95A 4LUVA 1D1KA 1UE6A 3K5OA 5EGTA 2F0SA 3I73A 4JBJA 4KV6A 2JJQA 1EQTA 2CWPA 2K5HA 3ZJYC 3MA2B 4XIGS 2BDNA 1IKLA 3BS1A 1EY0A 4EQ5A 5FLXL 3HRZC 4JI1L 5FO9B 2B2VC 2NB0A 2I07B 3M7GA 2JEBI 1TWAB 4DUYQ 3Q22A 3PO3G 1G2TA 4DV7L 1PRTC 2EJGC 4AQYQ 5C5MA 4GNXB 1SEBD 1TVXA 4CDDC 1PH7A 4C2MH 3OHXC 1Q3LA 2F3VA 3F2CA 5C4JB 1DZ1A 1J5EQ 3HZXA 5EKIA 1J9OA 1AZQA 4LF7L 1L0XB 3HOVB 2B2WA 4BBRB 1KLUD 1Q90A 4IUUA 2A19A 3OW2A 1B7YB 1QG7A 1VQCA 5M3FG 1IBML 3G71A 4B3MQ 4DK1A 3S2HH 1YJNA 2GN5A 3T1YL 1X6OA 1ICFB 2NVQH 1E0BA 2DJFC 2I5LX 1EFWA 1A15A 4R9WA 4EQPA 4DV0L 3C3LA 4OO1H 3FPUB 2HD3A 1N9WA 2D62A 1B44D 1U4LA 4B3RL 3I3CA 3CCJA 1WJJA 2JA6B 2EPBA 3S1RB 5F2DA 3H09A 2JA5B 1BCPC 5BR8L 4RAUC 4JVZA 2HDLA 4U673 1I4XA 1CT1D 3I55A 2A6HC 2M2LA 4BBSB 1PYWD 2EYOA 1OXUA 3S2DB 1S4ZA 1BNZA 3FDTA 3A8JE 1F9PA 4A3JG 2F4VQ 5JVG3 4X65Q 5I4DA 2XN9C 2Y0SG 4DUZQ 4QGUA 4A3IB 1EIYB 1JOQA 5LHY1 2RSNA 3UI2A 1ENAA 3U58A 2RVLA 2AKWB 2BDOA 2RCFA 3ICEA 1L2FA 5IGGA 1AP0A 4MTKA 3EA6A 4LFCL 3TREA 4BY1B 2WKDA 4ZUIA 2F0VA 4DR6L 1YITA 5D3IB 2Z1CA 3CU7A 2N88A 4A3KB 4KHPL 3RZDH 4OX9L 4F88A 2SDFA 4AH6A 3KLSA 1D5MC 1L1OA 2NVTH 3PQIA 1JE4A 3ER0A 5C4XH 5IYBG 4PZ8A 1DGSA 2EE1A 2NVYB 4UPAA 3J7A5 1FNUA 1ONLA 1F77A 2L12A 1KAAA 3IKJA 3AMUA 4LK1C 3SVMA 1PRTF 1VS0A 1U4PA 1A3VA 3NENA 3PF5A 5CYUA 3P75A 2EVBA 2PPBC 4R1JA 1C48A 1G291 1VQPA 1WTPA 2RBMA 1OTCA 2O2LD 1EUJA 3KDFB 2UXCL 1TU2B 2LKVA 3RMHA 3MAQA 2B63H 1OO9B 4OO1G 3CQZB 1S40A 1MD2D 2Q8RE 4GZYC 1CUKA 1PZID 2VUMG 1XJVA 1STYA 3T13A 1F9QA 1GHJA 5DLQE 4XQQA 3GTPB 1KXLA 2D0PA 2CHBD 1Z9FA 2WB1G 3MFYA 1M1KC 1AEXA 3U50C 3PO2B 4IUQA 3BJUA 2AMCB 3OMGA 3HOYG 3M85A 3BZCA 2NN6H 1D7QA 2BA1A 3H91A 4HJ5A 5LMNL 2XWBB 1RODA 3L0OA 1KNAA 2OT2A 2Q2IA 3HOXH 3I4LA 4JV5Q 4DV1Q 1V43A 1LT3D 4DAPA 5M3MB 1BCPF 1XMQL 3HOUH 4TQUS 4HJAA 4PZ7A 4RMFA 3VYTA 4GNXC 4PMCA 1DXMA 5JEAJ 1SNDA 3KBGA 4JI6Q 3QOLA 1PMRA 1Y8PB 4DV3L 3E0EA 1SDFA 3RNUA 4DAYA 1EU4A 4RGOS 1H9MA 5C44H 4WORA 1PZKD 4ZKBB 2ZTEA 4KHVA 2EQSA 3HS0C 4X62L 4FP5D 1SR3A 1IW7C 1EYDA 3HOZH 2QW7A 4LJZC 5C4HA 4QIWE 3MTSA 1ENCA 1FR3A 1A6XA 4LW1A 2OQKA 3BZKA 4R4TA 5JPMC 2EY1A 3GTJH 3GDEA 4IJLA 5IGDA 2K28A 1TWGB 1PFMA 1YEZA 4JI7L 4FF1A 1A3UA 4ZUJA 3PUYA 3K6OA 4J8QA 2E2HB 2MPMA
chains in the Genus database with same CATH topology
3Q23A 4WRDA 4Q0FA 2E75C 4KHZA 1VMPA 2HUGA 3G7LA 4CGYB 4R8NA 3W2DA 5M5YB 1H9SA 3OOCA 4IFDH 2XVSA 4RH6A 4K5WA 2NTTA 4C3HG 5I9PA 3N6RA 1ZYRD 1EIGA 2CQAA 1EZ6A 1HPCA 3ITPA 4X3SA 1EY4A 4EQOA 2A74C 1QB5D 4DXFA 4RHRA 1CA6A 4FO2A 2K5WA 4EVOA 5JAVA 1F9SA 2A69D 5D3DA 2C5CA 5NUCA 2IT1A 3C1EA 2XIWA 3QB3A 3NBIA 2JP1A 4OL7A 4DNTB 4RCNA 2FINB 1VF7A 3CHBD 3SK6A 2SNMA 1SXTA 3X3NA 1M4VA 2RDFA 5G3LF 4FF4A 2MGSA 4KJNA 1SMYC 1I6HB 2VB3X 2ZXRA 1D5XC 5CV7A 3VR6A 4LMQD 4C2MB 3A54A 2KQ3A 2FJ2A 3BVGA 5BN5A 4PMBA 3MXGA 1E2ZA 4IFDG 3A55A 4H0LC 1EWHA 1BDOA 1EOTA 1EY7A 1GJXA 5C0XH 4JK1C 3Q0AA 1F2ZA 3MEHA 1ET9A 2B2TC 4K5XA 4ZKCB 1QILA 3S2HB 2RDGA 2NVQB 4RGTA 2VNUD 4L6TB 3EROA 5I6YA 4RHSA 4KN7C 3SK4A 3MXUA 2E76C 2Z8LA 1K8MA 1SMYD 2F03A 5CV5A 1Q1BA 5C4ZA 2WB1B 4XQJA 3D6CA 4RCOA 5EBDA 1NAPA 2R3ZA 2KOLA 4KN4C 1KTKA 1IKMA 4IN3A 4QB4A 1DOLA 5DNFA 5CORA 4CJ1B 5BN3A 4KD4A 3BDCA 3VR4A 1TY2A 3MXPA 3NHHA 1SYCA 1HHVA 5KYIA 1V1PB 2NN6I 2F0EA 2H4OA 3RZDB 1TS2A 5JJZA 3MC0B 2K5DA 1SYEA 1ZXTA 4XXEA 1HTPA 5C4XB 1KDAA 1EU3A 2LY7A 1LLRD 4XYQA 1HUNA 2B2YC 1Y8OB 1LTBD 4I65A 2B8FA 2SNSA 1HA6A 1RDPD 2N55A 1HXYD 4I7ZC 1RHPA 2BA0A 3SE0A 1LT4D 1ICWA 1V1OA 2M00A 2B63B 2KJXA 3DEPA 2NYZD 3IFDA 1U4RA 2CW0D 3D4WA 2M9VA 2JXMB 2PW5A 1YNJC 2HQEA 4IURA 5ELDA 5A35A 2ZXOA 2DY8A 1SYDA 4FYDA 3VR2A 3L9AX 1PDQA 2B39A 2K03A 1RCVD 3EFXD 2IX3A 3HOXB 3OMCA 5KNCA 5ELFA 4G7ZC 5JEAH 1S5ED 3MHBA 2J7ZA 3D8GA 4IFDI 3D6WA 1D1IA 1KNEA 3OIQA 3SEBA 1CQFA 3U9SA 1XTCD 5FOBB 2K04A 4QCLA 4N9TA 5C44B 3DWQA 3IL8A 2F3WA 3G6JB 1F2YA 2FMCA 1CM9A 4V190 1ILQA 3DHQA 3GTJB 4X3TA 1RTNA 5CV4A 1FNVA 1BO0A 2O5JC 4FF3A 4Q5VA 1LTGD 2DN8A 5DEHA 3WDNA 4B9XA 4J6HA 3M3YB 2EYLA 4CJ0B 3ONAB 4A93B 2GA4B 4FF2A 3MXNA 1RJTA 3LWUA 1JWUD 1LTTD 2TSSA 4DGZA 3KLSX 3GD7A 1FNWA 3P20A 1EEID 1ENFA 1KLGD 3VR3A 2K5QA 5C0XJ 5T1IA 3T51B 4K2LA 3BYYB 3GV3A 1HTLD 1CQVA 2R6GA 4QF4A 3L3OC 2L4NA 5JEAG 4KJOA 3OSOA 3VYRA 1LTID 1KDBA 1I4GA 2Q8IB 1SNMA 1FGBD 1SYGA 1EWCA 3FPPA 4KTAA 3QIAA 1B50A 1D5ZC 2B8GA 5C0XI 3DWPA 2F0HA 4RGNA 1STBA 1S5DD 1XX8A 3P7JA 4A3EB 1HA5A 4YIJA 1G8ZD 1WTWA 3RZOB 5FO8B 3DXJC 4C3IG 5K5PA 3KF8A 1WD1A 5I6WA 3CKIB 4IUVA 1IL8A 4M1UB 3DEOA 1I4QA 2PCFB 1T5XD 1YNND 4XT1B 1SBBB 1L0YB 1F9RA 1HUMA 1KABA 2IL8A 2YYZA 3HEJA 1GUTA 4PQXA 1PFBA 2DNCA 3FVQA 1ESFA 3K7AB 3V2TA 5JOBA 4A3BB 1ET6A 2HDMA 5ELEA 1EY8A 4BA2I 5HGTA 4DFAA 4QMGA 1DCZA 1HRJA 3TBIB 1STEA 3K59A 4CBVA 1CI3M 1UAPA 1X3PA 1QJOA 1CFMA 4L8JA 5DAUA 3ND9A 3W3AA 2R61A 4HEDA 4F8MA 1CK1A 4UDUC 4ZAIA 2AQ1B 2JSOA 3Q24A 3J81L 2EJFC 2O4XA 3FEWX 3NTHA 5I2XA 1GUWA 2NUCA 1MSHA 1R9TB 2F0JA 3LWEA 2EDGA 3NK9A 3T4AC 1OXVA 4Z9CB 5J39A 1QNKA 1DM0B 4BWGB 4NW2A 2IWHA 3VA7A 1SNPA 1RTOA 1QCBD 4KY7A 5FK9C 4P2CB 3JAML 2BOSA 3H0GB 3I4NB 1LABA 2AUJD 2F0IA 2F0UA 1EY9A 4HR7B 5BN4A 4TSSA 2SOBA 2JYOA 1PFNA 5COYA 4ZQ3A 2IX1A 4BA1I 1SAPA 4KK7A 5FKAC 4RGMA 2B2VA 2R93B 2FFKB 2QCPX 2B2UC 3URYA 4LAAA 4A3FB 4MN3A 4R8IA 1EYAA 2F0LA 1PLFA 2EYFA 1RKNA 2SEBD 1ZYRC 5CV9A 3A7AB 1S5CD 4C1NK 2K7VA 3SHLA 4EQNA 3TP5A 2EY5A 3D31A 1KDCA 3TN2A 1M8AA 4DNRB 2DY7A 3T56B 4IALA 2FHTA 2J0TD 3M4YA 1NR2A 1LTSD 2RSOA 2PZTA 3PMFA 3AB9A 5D14A 4BY7B 1LV9A 4KD3A 1OXSC 3ND8A 3R3OA 1JQYD 2F1MA 2A69C 3ERQA 1GUGA 5KNDA 1TS5A 1Y1VB 3R93A 4HTHA 3A8KE 2AQ2B 4K14A 2MHVA 2NN6G 1H9JA 2R7ZB 1R4PB 4C1NI 2OXPA 3C1FA 5IIFA 1OXTA 3TP7A 1AN8A 3OW7A 3J80L 4XT3B 2WP8J 2KVMA 3NE5B 2A6ED 1CA5A 4G57A 1DONA 3KLRA 5CBEE 2RDHA 3QO2A 3K58A 4FNFA 3BDLA 2A68D 3HKZB 1O78A 1V8QA 5IGBA 1EEFD 3H6MA 1TS4A 4HSVA 1FYCA 5KYLA 4C3IB 5EQ0A 3SR1A 2VXWA 4FXGC 3E0JA 3K5MA 2H1EA 2R92B 1G91A 3I72A 5FLXE 2EZVA 3S16B 3FKIB 1B4OA 1U4MA 3T53B 4J1MA 1NUCA 2F0DA 3BYTB 1JWMD 1IHZA 4XDXA 1BF4A 3HP3A 2V4DA 2L11A 1SYFA 4DAVA 2BCOA 4H7BA 5C3WA 1Z47A 3GV6A 1JCKB 1BOSA 1IYUA 3M4OB 2O5IC 2RKSA 1VF5C 2Q8TA 3CRKC 1TKWB 3D4DA 1UUPA 2WAQB 4RWSC 5M5WB 1T5EA 4AYBB 1F2LA 4TRDA 4ZRZA 3MZ5A 2F0NA 1SE2A 3OWEB 1JORA 2RA4A 2C9OA 4ZLTF 1H9RA 4K6DA 5C3XA 1HQMC 3NTIA 5EKLA 2B2WC 3KUPA 3C46A 3WOEA 3P1HA 2F0MA 2AWNA 2IPKD 2PYKA 4N9PA 4XQNA 1K8OA 1S5FD 1QNUA 3EQLC 2CVRA 2EXZA 3DUZA 5IT9L 2XSCA 2CW0C 3RD4A 3TP6A 3H94A 2F0KA 3NWSA 2WV6D 2NVTB 3O13A 1SFOB 1ML0D 3R2IA 1DJRD 1OXXK 2KHSA 1XWEA 3GP7A 5C0XG 2Z4HA 3HOWB 4FXDA 1A2UA 1EIHA 1H9SB 4ABNA 2L5TA 1EL0A 2X69A 3QWNA 3KK7A 3LX0A 2A73B 5EPJA 2EYJA 1X3QA 2D9UA 1BBXC 4V0BA 2EOTA 4KKTA 4DU9A 3IAYA 1EY6A 4ME5A 1STNA 5IGCA 4CKBA 1Z6HA 1CZWA 1UNSA 5A2QL 1PTOD 3FMCA 3NXWA 2BE5D 1MGSA 1TWHB 1PTOH 5EJWA 1NSNS 1HCZA 1Q12A 2X6GA 4HMIA 2ENBA 1SNCA 1LTAD 4HCSA 5E1FA 3TP8A 4OIKA 2G9HD 1C4QA 5D65A 3HOUB 3JAME 1DOKA 2XRQD 4PV1C 3X3MA 3K5LA 3OIPA 1O7LA 1SE3A 1EZ8A 5LL6X 1A2TA 3HG9A 1F2MA 5E3FA 5KNBA 2AQ3B 2K33A 1WTRA 5CV8A 4IQZA 1B2TA 3HOZB 3EVQA 1UEAB 5DM63 4ODGA 4JBWA 3AU7A 1WVLA 3NQTA 3RUZA 2K6AA 4HAEA 5JPNC 3NUCA 4HMJA 1ILPA 2IJ0A 1SJHD 1GUOA 3PUVA 3OWFA 3QG1A 2B2TA 3I8ZA 2AWOA 5EPKA 5CC4A 3R8BA 2YU9B 1Y8NB 3VA5A 4X3UA 3SXHA 2G9DA 1JICA 4TKOB 1LT5D 1SSOA 2K05A 3IFTA 1GUNA 1EFID 3A8IE 2K01A 1YNNC 3D4RA 5EBCA 1WCMB 1NR4A 4RKLA 2EYPA 2LFNA 3MFGA 3KBXA 4ID6A 1I50B 3J80E 3MWYW 1SNOA 5JVH3 3Q6SA 2Z4IA 4G4KA 2LS01 3D3RA 3BVZA 1SNQA 5J1ZA 1B9NA 1VDZA 2KCCA 1WTVA 4E6IA 1MI2A 2X6LA 4K8IA 4L63B 5CV6A 2OEOA 2PW7A 1LTRD 1W6JA 1U9RA 1PRTD 2ZT9C 1TQOA 2OF1A 2EY2A 3BVMA 1CHQD 1EY5A 3M7NA 5C3EB 1GHKA 2HCCA 1JR0D 3S15B 4QUCA 1SE4A 2B2YA 4KKUA 1BR9A 3S17B 3NWTA 1XXGA 1I4HA 3GTMB 2PZWA 5I9OA 3BDOA 3A56A 4B9WA 4G7OC 3NQIA 4RA8A 5C6AA 2L1BA 1TT2A 3A7LA 3S14B 3SK8A 3J7AV 2KEDA 2I46A 1BCPD 3H3VC 2F4IA 2IW3A 2F0QA 4RKBA 5IODA 2A6HD 1TS3A 5CBAE 1TWFB 1STAA 2F0WA 1IYVA 4QIWB 1II3A 1W6KA 1Q8IA 5ISRA 4O1NA 3R2TA 1ESRA 1G6ZA 2HCIA 3MVVA 1WD0A 1Y1WB 2RQXA 5DM73 5CMDA 4A3GB 1HFGA 3I91A 3VYSA 4C3JB 2ICEC 2QDBA 4A3DB 1QOHA 4HN7A 5AFWA 3GTQB 2DNEA 1QWYA 3PUZA 4F7XA 2QF7A 1BQQT 4UAIA 2PNRC 5IGFA 1WTOA 2L9HA 1BXTA 2PQEA 5IT9E 1JB3A 1DOMA 2L55A 3VYUA 4DN4M 2WINB 4CJ2C 1EYCA 3E6ZX 1X32A 1O7ZA 1O7YA 1BUVT 4U68A 2NVXB 4DXGA 5IGEA 3GO5A 4CKCA 4DA2A 5TSSA 1TIID 1SJED 2XNAC 4KKSA 1D2BA 4H13C 5KIXA 1H9KA 2D2CC 2KCNA 2A6EC 3BG3A 2E2IB 1V1PA 5KEEA 1MSGA 1ZKOA 3GTGB 3PUWA 4S3SA 4IUPA 2A68C 4KI0A 3I90A 3EJIA 2KECA 5A2QE 2MUYA 4OHJA 5EPLA 3PO3B 1PTOB 3HGBA 4WFN3 1WTQA 2QILA 4X3KA 2PMZB 1GUSA 2E74C 1CHPD 3K0YA 5G3LD 4O42A 1IW7D 2F0FA 5KRUA 4DK0A 2WACA 3FRPB 3NPPA 1E2WA 2MP1A 2KEEA 5M3FB 1J8IA 3PIO3 2ICIA 5ELCA 4MIUA 1B3AA 3NBHA 1VMCA 1XYIA 3PUXA 5I2YA 1JWSD 5CR3A 2PZUA 1STHA 2K32A 2JE6I 5FO7B 4IUTA 3LNNA 1STGA 4ZYSA 3CRLC 3TSSA 1TY0A 3K5NA 2WKCA 1EQVA 3PV0A 3S1QB 5E4WC 1JOKA 3TZDA 1AZPA 3J7YW 1C8CA 3DWAA 1GXDC 4DF7A 2NTSA 4A3JB 1B1ZA 4OO1I 3PIP3 2Y0SB 2E2DC 3TMEA 2EYHA 3OPOA 1GOZA 4NMZA 1VCIA 1E2VA 3QJYA 4OGQC 3SDZA 3N52A 1HFNA 1AFPA 2F0OA 1QE6A 2L0CA 2EYMA 2XRSD 5ELBA 1LT6D 2XWJB 3I70A 2K1BA 2NWGA 4WJWA 4PNYA 5KGUA 3K57A 1TR5A 1A3TA 4F87A 2LMCB 3NSWA 4EGVA 1D6EC 4BS9A 1TWCB 1DD2A 2D5DA 1PXUA 2NZ1D 3DM1A 4B08A 3V96A 3QOJA 2JEAI 1JC7A 2JA7B 4HSPA 4H44C 3WOFA 3S1NB 4HCEA 1K83B 2F0GA 2EJMA 4ZK9B 2J4XA 4ILWA 1SYBA 2B2UA 2VUMB 4G7HC 5M5XB 3E5SA 5T1GA 2TMPA 1PRTB 3GTOB 1WTXA 5M9OA 5IOCA 1MBYA 3HOYB 1CZGA 2ZXPA 1Y69U 3TDQA 2FMMA 1RD9D 1AW7A 4M8AA 3VR5A 4K6LA 1PTOC 2BE5C 1HQRD 4K5VA 1S5BD 1LACA 2AUKA 2KA7A 1FD7D 3F2UA 3T16A 4IUNA 2QEJC 5E4XA 3RLFA 5HURA 3TZUA 4QUFA 2EY6A 4CHTB 1BCPB 2E2JB 5K36H 4OIJA 2VB2X 1Q1EA 4KY6A 3BZDB 1JOOA 1ZEQX 1RF2D 4PMWA 2WIIB 2PO4A 3J81E 3S9WA 5EKKA 1NCVA 3ZYYX 4K2KA 2NBFA 4XTCS 1I6VC 4KY5A 1PZJD 4CKEA 3L7ZC 4KMUC 4K8JA 4MHEA 4C3JG 3U9OA 3C2PA 2MJ8A 1B53A 1B9MA 3GTLB 4IFDJ 4A3MB 4FXKC 3S1MB 3DMUA 3SK5A 4C3HB 4XYOA 5C5LA 1DYQA 3I4MB 1Z7TA 5J22A 2QKIC 1I4RA 5CGKA 1LO5D 4IZ8A 1I3QB 2ID0A 3NP8A 2F0TA 2KUMA 4RFBA 4NDXA 4FVMA 4ULLA 3V05A 3J7AF 1O80A 1R4QB 2IX0A 3GQBA 1YNJD 3NTKA 1G2SA 5LL6S 4C56C 1PTOF 2F0PA 4NP5A 4Y7NB 2A5HA 4NKLA 2JA8B 1CTMA 1I4PA 5K36G 3GTKB 1D1KA 5EGTA 3K5OA 2F0SA 3I73A 4KV6A 1EQTA 3MA2B 4XIGS 2BDNA 1IKLA 3BS1A 1EY0A 5FLXL 3HRZC 5FO9B 2B2VC 2NB0A 2I07B 3M7GA 2JEBI 1TWAB 3Q22A 1G2TA 1PRTC 2EJGC 5C5MA 1SEBD 1TVXA 3OHXC 1Q3LA 2F3VA 5C4JB 1DZ1A 3HZXA 5EKIA 1J9OA 1AZQA 1L0XB 3HOVB 2B2WA 4BBRB 1KLUD 1Q90A 4IUUA 1QG7A 4DK1A 1E0BA 1A15A 4R9WA 4EQPA 3C3LA 4OO1H 3FPUB 2D62A 1B44D 1U4LA 3I3CA 2JA6B 2EPBA 3S1RB 5F2DA 3H09A 2JA5B 1BCPC 4U673 4RAUC 2HDLA 1I4XA 1CT1D 2A6HC 2M2LA 4BBSB 1PYWD 2EYOA 1OXUA 3S2DB 1S4ZA 1BNZA 3FDTA 3A8JE 1F9PA 5JVG3 5I4DA 2XN9C 4A3IB 1JOQA 5LHY1 2RSNA 3UI2A 1ENAA 2RVLA 2BDOA 1AP0A 5IGGA 3EA6A 4BY1B 2WKDA 4ZUIA 2F0VA 5D3IB 2Z1CA 3CU7A 2N88A 4A3KB 4F88A 2SDFA 3KLSA 1D5MC 1JE4A 2EE1A 2NVYB 1FNUA 1ONLA 1F77A 2L12A 1KAAA 3IKJA 3AMUA 4LK1C 3SVMA 1PRTF 1U4PA 1A3VA 5CYUA 3P75A 2EVBA 2PPBC 1C48A 1G291 1WTPA 2RBMA 2O2LD 1TU2B 2LKVA 3RMHA 3MAQA 1OO9B 4OO1G 3CQZB 1MD2D 2Q8RE 4GZYC 1PZID 1STYA 3T13A 1F9QA 1GHJA 4XQQA 3GTPB 2CHBD 3MFYA 1AEXA 3PO2B 4IUQA 3OMGA 3M85A 2NN6H 2BA1A 3H91A 2XWBB 1RODA 1KNAA 2OT2A 3I4LA 1V43A 1LT3D 4DAPA 5M3MB 1BCPF 4TQUS 3VYTA 4PMCA 1DXMA 5JEAJ 1SNDA 3KBGA 3QOLA 1PMRA 1Y8PB 1SDFA 4DAYA 1EU4A 4RGOS 1H9MA 4WORA 1PZKD 4ZKBB 4KHVA 3HS0C 4FP5D 1IW7C 1EYDA 4LJZC 5C4HA 3MTSA 1ENCA 1FR3A 1A6XA 5JPMC 2EY1A 5IGDA 2K28A 1TWGB 1PFMA 4FF1A 1A3UA 4ZUJA 3PUYA 3K6OA 4J8QA 2E2HB 2MPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSW A; 
#chains in the Genus database with same CATH topology
 3Q23 A;  4WRD A;  3M3Y H;  4Q0F A;  2E75 C;  2B63 G;  4A93 H;  4KHZ A;  3MEF A;  1VMP A;  4DR3 Q;  2QEX A;  1N33 L;  2BH2 A;  2UUC Q;  2HUG A;  1P8L A;  1VQN A;  3G7L A;  4CGY B;  4R8N A;  5IE8 A;  3W2D A;  5M5Y B;  2B29 A;  1H9S A;  3OOC A;  4IFD H;  2XVS A;  4RH6 A;  4YWL A;  4K5W A;  1NE3 A;  2Z0S A;  1UWV A;  2IY5 B;  2NTT A;  4R4Q A;  4JI0 L;  4C3H G;  2IHF A;  5I9P A;  5IP9 H;  1I94 Q;  3N6R A;  1ZYR D;  3HOX G;  1EIG A;  2CQA A;  1EZ6 A;  1HPC A;  3OTO Q;  3ITP A;  4X3S A;  1IL2 A;  1EY4 A;  4L5Q A;  4EQO A;  4DV2 Q;  2A74 C;  4B3S Q;  1QB5 D;  4DXF A;  2EXD A;  4YHH L;  2A1A A;  4UP8 A;  4RHR A;  1CA6 A;  4FO2 A;  2K5W A;  4EVO A;  5JAV A;  4JI8 Q;  4A3E H;  1F9S A;  2A69 D;  5D3D A;  1NY4 A;  3RZO H;  1X9N A;  2C5C A;  5NUC A;  2JA8 G;  2VQE L;  4DV4 Q;  2IT1 A;  4GOP B;  1YI2 A;  3C1E A;  2IHE A;  2XIW A;  4LF4 L;  1UE1 A;  3QB3 A;  4ZCK A;  3NBI A;  2JP1 A;  4KLK A;  4OL7 A;  1C7Y A;  4DNT B;  2RHS B;  4RCN A;  3UDX A;  1SMX A;  2FIN B;  1VF7 A;  3CHB D;  4UP9 A;  3SK6 A;  2SNM A;  4DNI A;  2OTL A;  1SXT A;  4JOI A;  3X3N A;  3S15 H;  1M4V A;  3EBE A;  2RDF A;  5G3L F;  1B8A A;  4FF4 A;  5GQO A;  4UHV A;  2MGS A;  4DK6 C;  1N34 L;  2PMZ E;  4KJN A;  1SMY C;  1I6H B;  2VB3 X;  4IPG A;  2ZXR A;  1D5X C;  5CV7 A;  3VR6 A;  4LMQ D;  4C2M B;  4A3B H;  3A54 A;  3I7F A;  1C0A A;  2KQ3 A;  2FJ2 A;  1PH4 A;  3BVG A;  5BN5 A;  4PMB A;  3MXG A;  1E2Z A;  4IFD G;  3A55 A;  3KJO A;  2BH8 A;  4H0L C;  2MFI A;  1EWH A;  1BDO A;  1EOT A;  1EY7 A;  4LF6 Q;  1QVC A;  1GJX A;  5C0X H;  4JK1 C;  1YZ6 A;  3Q0A A;  1F2Z A;  3MEH A;  1ET9 A;  2B2T C;  4K5X A;  1HNW Q;  4ZKC B;  1QIL A;  3S2H B;  1KHI A;  1Y14 B;  2RDG A;  4GN5 A;  2NVQ B;  4RGT A;  1WTH A;  4N8F A;  2VNU D;  3J81 i;  4MNO A;  4L6T B;  3ERO A;  5I6Y A;  1X3F A;  4RHS A;  1CSQ A;  2E5L L;  2XGT A;  4KN7 C;  2JA6 G;  1WI5 A;  3SK4 A;  3MXU A;  2E76 C;  1QVG A;  2JA5 G;  2Z8L A;  1K8M A;  1SMY D;  1R9T H;  2F03 A;  4A3L H;  2AHO B;  3I4O A;  4BBS G;  2XTI A;  4A3E G;  5CV5 A;  1Q1B A;  2ZM6 Q;  5C4Z A;  2WB1 B;  4XQJ A;  3D6C A;  1HZC A;  2HHH Q;  2E8G A;  3KF6 A;  4RCO A;  2D0O A;  1GVP A;  3EIV A;  5EBD A;  1NAP A;  1IBK Q;  2Y0S E;  3BU2 A;  2R3Z A;  2KOL A;  4A3I G;  3JAM i;  3CAM A;  4KN4 C;  1KTK A;  4HJ8 A;  4IN3 A;  1IKM A;  3H0G H;  3I4N H;  4QB4 A;  2MO1 A;  4IPC A;  1DOL A;  5DNF A;  4BY1 G;  1KD1 C;  1N36 Q;  5COR A;  4CJ1 B;  5BN3 A;  4Y52 H;  4KD4 A;  3BDC A;  3VR4 A;  4A3K G;  1TY2 A;  1A63 A;  3MXP A;  3NHH A;  1SYC A;  1HHV A;  5KYI A;  1V1P B;  2NN6 I;  2F0E A;  2H4O A;  3AFP A;  2R93 H;  3RZD B;  1QVF A;  1TS2 A;  1N8R C;  5JJZ A;  3CD6 A;  2UUB Q;  4ME3 A;  4A3F H;  3MC0 B;  2K5D A;  2UXB L;  1SYE A;  1G6P A;  1ZXT A;  3PSI A;  4XXE A;  1HTP A;  5C4X B;  4AYB E;  1KDA A;  1GD7 A;  1EU3 A;  4JYA L;  4QQB X;  2LY7 A;  1LLR D;  3ULJ A;  4XYQ A;  3CC2 A;  1HUN A;  2B2Y C;  3T1H Q;  1Y8O B;  1LTB D;  4I65 A;  1BBW A;  2B8F A;  1GKH A;  2SNS A;  3M4P A;  1HA6 A;  1RDP D;  2N55 A;  1HXY D;  2ZTC A;  1VQH A;  3A0J A;  4BY7 H;  4I7Z C;  1RHP A;  2BA0 A;  3CME A;  3SE0 A;  1LT4 D;  1ICW A;  1V1O A;  4DR1 L;  2M00 A;  4YCV A;  2KJX A;  2B63 B;  4DV6 L;  1JMC A;  3DEP A;  2NYZ D;  3RN2 A;  3IFD A;  4LFA L;  1U4R A;  2CW0 D;  3D4W A;  4GOP C;  2M9V A;  2JXM B;  2PW5 A;  1Y1V H;  1YNJ C;  2HQE A;  5IY0 A;  4IUR A;  5ELD A;  5A35 A;  2ZXO A;  2DY8 A;  1SYD A;  4FYD A;  4DR5 Q;  3VR2 A;  2R7Z H;  2K75 A;  3L9A X;  4GKK Q;  1PDQ A;  2B39 A;  2K03 A;  4JI3 Q;  1RCV D;  3EFX D;  3J80 i;  1VQ5 A;  2IX3 A;  3H0G G;  3HOX B;  3OMC A;  1E22 A;  2ZJR A;  5KNC A;  5IP7 H;  1HNZ Q;  2ES2 A;  5ELF A;  4G7Z C;  5JEA H;  1S5E D;  5AJ3 L;  3MHB A;  2J7Z A;  3D8G A;  4IFD I;  3D6W A;  1D1I A;  1KNE A;  3OIQ A;  3SEB A;  1CQF A;  4IJH A;  4JG2 A;  3U9S A;  4OEM B;  1XTC D;  2R93 G;  5FOB B;  2K04 A;  4QCL A;  4N9T A;  5C44 B;  3CCM A;  4L5R C;  3DWQ A;  4DR4 Q;  3IL8 A;  1IBL L;  2F3W A;  1Q81 C;  5JJK A;  1I5F A;  1PFS A;  1PH3 A;  3G6J B;  4C3I H;  1F2Y A;  2HIV A;  1PV4 A;  2FMC A;  1CM9 A;  4JI5 Q;  2ZTD A;  4V19 0;  3S1Q H;  5FLM G;  3G6E A;  1ILQ A;  2OWO A;  3DHQ A;  3GTJ B;  4X3T A;  2UU9 Q;  1RTN A;  5CV4 A;  1VQI A;  2N8N A;  4LF5 L;  1FNV A;  1Q8K A;  1BO0 A;  1YHQ A;  2O5J C;  4FF3 A;  4Q5V A;  2R92 H;  1MIU A;  1LTG D;  3S16 H;  3FKI H;  2DN8 A;  5DEH A;  3WDN A;  4B9X A;  4J6H A;  3CXC A;  1HNX L;  3M3Y B;  2EYL A;  4CJ0 B;  3UDG A;  3ONA B;  4A93 B;  2GA4 B;  4FF2 A;  4DAM A;  3MXN A;  1RJT A;  3LWU A;  1JWU D;  1Y1V G;  1LTT D;  2JA9 A;  2TSS A;  4DGZ A;  3KLS X;  3GD7 A;  1FNW A;  4DPG A;  3P20 A;  1K28 A;  4GKJ L;  1EEI D;  1ENF A;  3FP9 A;  1X56 A;  1KLG D;  3VR3 A;  2K5Q A;  5C0X J;  1HR0 W;  3A5Z B;  1XNR Q;  3ULL A;  3M4O H;  1CSP A;  5T1I A;  3T51 B;  4K2L A;  3BYY B;  2CKZ B;  3GV3 A;  1HTL D;  4X66 Q;  2UXD L;  2CH4 A;  1CQV A;  2R6G A;  4QF4 A;  5M5W H;  5IP7 G;  3AQQ A;  1K3B C;  3L3O C;  2L4N A;  1CKM A;  5JEA G;  4P72 A;  4KJO A;  3OSO A;  3VYR A;  1LTI D;  1KDB A;  1N32 L;  1I4G A;  1YVC A;  1TXY A;  3PIP A;  3F2B A;  2B3G A;  2Q8I B;  1SNM A;  1FGB D;  1SYG A;  1EWC A;  3FPP A;  4KTA A;  3QIA A;  3HKS A;  1VQG A;  1B50 A;  1D5Z C;  1VQA A;  4JI2 L;  2B8G A;  5C0X I;  3DWP A;  2F0H A;  4RGN A;  3S1N H;  1STB A;  1S5D D;  1XX8 A;  3P7J A;  4A3E B;  1HA5 A;  4YIJ A;  1G8Z D;  1WTW A;  1K8A C;  3RZO B;  4OWW B;  1VQ6 A;  4OEL B;  5FO8 B;  3DXJ C;  4C3I G;  4PG3 A;  5K5P A;  3KF8 A;  1WD1 A;  4GLA C;  5I6W A;  3CKI B;  4OON A;  4IUV A;  1IL8 A;  4M1U B;  3DEO A;  1I4Q A;  4PZ6 A;  2PCF B;  4DV5 Q;  1T5X D;  1YNN D;  4XT1 B;  2ASB A;  1SBB B;  3L2P A;  1L0Y B;  1F9R A;  4NXM Q;  1HUM A;  1KAB A;  2IL8 A;  4POG A;  2YYZ A;  4LFB L;  1AE3 A;  4X64 Q;  3HEJ A;  1GUT A;  4PQX A;  2KHI A;  1PFB A;  2DNC A;  3FVQ A;  3G48 A;  1ESF A;  3K7A B;  4JI4 L;  3V2T A;  1SFO H;  5JOB A;  5EAY A;  4A3B B;  4LUZ A;  1ET6 A;  5ELN A;  2HDM A;  1XMO L;  5ELE A;  1EY8 A;  4BA2 I;  5HGT A;  4DFA A;  4QMG A;  3HOW H;  1DCZ A;  1HRJ A;  3TBI B;  4RG1 A;  1STE A;  3K59 A;  4IO9 A;  4CBV A;  1CI3 M;  1UAP A;  1X3P A;  4LF5 Q;  1QJO A;  3W5O A;  1CFM A;  4L8J A;  5DAU A;  4JI1 Q;  3ND9 A;  3W3A A;  1KRT A;  2WAQ G;  3G4S A;  2R61 A;  4HED A;  4F8M A;  1CK1 A;  4UDU C;  2OQ0 A;  4ZAI A;  4DV7 Q;  2AQ1 B;  2JSO A;  4LF9 L;  3Q24 A;  2I0Q A;  3J81 L;  1NMG A;  2EJF C;  1HZ9 A;  2O4X A;  3FEW X;  3DM3 A;  3NTH A;  1CKN B;  5I2X A;  1PH6 A;  1GUW A;  2NUC A;  1MSH A;  2N78 A;  1NNX A;  1R9T B;  2F0J A;  4LF7 Q;  3LWE A;  1TWH H;  1Q7Y C;  2EDG A;  3NK9 A;  1YJW A;  3T4A C;  2QGQ A;  2OCE A;  1OXV A;  4Z9C B;  5J39 A;  1QNK A;  1DM0 B;  4BWG B;  4NW2 A;  4B3T L;  1QUQ A;  1SE8 A;  1NBW A;  1IBM Q;  2IWH A;  3VA7 A;  3CPF A;  1SNP A;  1ASY A;  1RTO A;  1QCB D;  3T1Y Q;  4KY7 A;  1O7I A;  1K0S A;  5FK9 C;  4P2C B;  3JAM L;  2BOS A;  2WFW A;  3H0G B;  5JJI A;  5FJ8 H;  1RIP A;  3I4N B;  5LMU L;  1LAB A;  1UE7 A;  2AUJ D;  2F0I A;  2F0U A;  4DV0 Q;  1EY9 A;  4HR7 B;  5BN4 A;  4TSS A;  3H3V H;  2SOB A;  2JYO A;  1PFN A;  5COY A;  1YBY A;  4B3R Q;  4ZQ3 A;  2IX1 A;  3W1B A;  4BA1 I;  4K0K L;  1SAP A;  1FJG L;  1K0R A;  5BR8 Q;  5E7N A;  4KK7 A;  1VQJ A;  1WFQ A;  5FKA C;  4RGM A;  2B2V A;  4O2D A;  1PH1 A;  2R93 B;  2FFK B;  2QCP X;  2B2U C;  3URY A;  4YCU A;  4LAA A;  1JB7 A;  4A3F B;  4MN3 A;  5C4X G;  4R8I A;  1EYA A;  1Q86 C;  2F0L A;  3K80 C;  3KJP A;  1PLF A;  2EYF A;  1RKN A;  4LWC A;  3JC6 6;  2SEB D;  1ZYR C;  5CV9 A;  3A7A B;  1S5C D;  4C1N K;  2K7V A;  3SHL A;  4EQN A;  2CWA A;  3TP5 A;  2EY5 A;  3D31 A;  4YY3 L;  1KDC A;  1HH2 P;  3TN2 A;  4I7A A;  5GAD C;  4LFC Q;  1M8A A;  4DNR B;  2DY7 A;  3T56 B;  4IAL A;  2FHT A;  4HJ7 A;  4DR6 Q;  2J0T D;  3M4Y A;  3ULP A;  1NR2 A;  1LTS D;  2RSO A;  4KHP Q;  3AFQ A;  4OX9 Q;  1VQM A;  2PZT A;  3PMF A;  3AB9 A;  5D14 A;  4BY7 B;  1LV9 A;  4KD3 A;  1OXS C;  3ND8 A;  3R3O A;  1JQY D;  2F1M A;  2YU9 H;  2F52 A;  2A69 C;  3ERQ A;  3SGI A;  1GUG A;  5KND A;  1TS5 A;  1Y1V B;  3R93 A;  4HTH A;  1V1Q A;  3A8K E;  2AQ2 B;  1SLJ A;  4K14 A;  2MHV A;  2NN6 G;  1H9J A;  2R7Z B;  4WJ3 M;  1R4P B;  4C1N I;  1AE2 A;  2OXP A;  3C1F A;  5IIF A;  5GAE C;  1OXT A;  4YWM A;  3TP7 A;  1WCM H;  3CC4 A;  1AN8 A;  3HOU G;  5FJ8 G;  2Z6K C;  3OW7 A;  3J80 L;  3F1Z A;  2UXC Q;  4XT3 B;  1I50 H;  2WP8 J;  2KVM A;  1W2B A;  4CDF C;  1WOC A;  1PH9 A;  3NE5 B;  1QZG A;  2A6E D;  1CA5 A;  4G57 A;  3ERS X;  1DON A;  3KLR A;  5CBE E;  2RDH A;  5C44 G;  3QO2 A;  3K58 A;  2RF4 A;  1EWI A;  2PQA A;  4FNF A;  3BDL A;  2A68 D;  3HKZ B;  1O78 A;  2G5D A;  1V8Q A;  5IGB A;  1EEF D;  3H6M A;  3HOZ G;  1TS4 A;  5LMN Q;  4HSV A;  1FYC A;  1HZB A;  4UP7 A;  3UDF A;  2UUA L;  5KYL A;  4C3I B;  5EQ0 A;  3SR1 A;  1L1O B;  2VXW A;  4FXG C;  3E0J A;  5C3E H;  1XMQ Q;  1K73 C;  1BKB A;  4POF A;  3K5M A;  3RLN A;  2I5M X;  2H1E A;  4DV3 Q;  2R92 B;  1G91 A;  3I72 A;  5FLX E;  2EZV A;  3S16 B;  3FKI B;  4NXN L;  4K0K Q;  2YTY A;  1B4O A;  1U4M A;  4A93 G;  1LUZ A;  3S17 H;  3CP0 A;  3T53 B;  4J1M A;  1NUC A;  3GTM H;  4L5S A;  2F0D A;  3BYT B;  1JWM D;  1IHZ A;  4XDX A;  4X62 Q;  1BF4 A;  3HP3 A;  2V4D A;  2JQO A;  2L11 A;  3U4Z A;  1GM5 A;  2VZA A;  2LSS A;  4DR2 L;  1SYF A;  5IYC H;  5FLX c;  5GAH C;  4DAV A;  2BCO A;  3S14 H;  4H7B A;  5C3W A;  1Z47 A;  5IP9 G;  3GV6 A;  1JCK B;  1BOS A;  1IYU A;  4JI7 Q;  3M4O B;  3CCV A;  2O5I C;  2RKS A;  1WCM G;  1VF5 C;  2Q8T A;  4DR7 L;  3TQY A;  1TWF H;  3CRK C;  1TKW B;  3D4D A;  1UUP A;  2WAQ B;  4RWS C;  3AYH B;  4LNQ A;  5M5W B;  4H02 A;  1HR0 L;  1T5E A;  4AYB B;  1F2L A;  1N33 Q;  4HIK A;  2EIF A;  4TRD A;  4ZRZ A;  4GNX A;  4LF8 L;  3MZ5 A;  2F0N A;  1SE2 A;  3OWE B;  4HJ9 A;  5IWA L;  1JOR A;  2RA4 A;  1Y1W H;  2VQF L;  4A3G H;  1S72 A;  1KL9 A;  2C9O A;  4JI0 Q;  4ZLT F;  1H9R A;  1L0W A;  4DAY B;  4LUO A;  4HID A;  1XNQ L;  4K6D A;  4C3J H;  5C3X A;  1HQM C;  3NTI A;  5EKL A;  2B2W C;  1A8V A;  3CCE A;  4A3D H;  3GTP H;  3KUP A;  3C46 A;  5LMN W;  3WOE A;  2KCM A;  3RN5 A;  3P1H A;  3GTQ H;  2F0M A;  1HZA A;  4GLX A;  4IOA A;  1T9H A;  2AWN A;  2IPK D;  4YHH Q;  4R4C A;  2PYK A;  4N9P A;  4XQN A;  3M4Q A;  1KIX A;  4APV A;  1K8O A;  4L5T A;  1S5F D;  1QNU A;  3EQL C;  4A75 A;  2CVR A;  2EXZ A;  3DUZ A;  1NJI C;  5IT9 L;  2Q2U A;  2XSC A;  2CW0 C;  3RD4 A;  3TP6 A;  3H94 A;  2F0K A;  3NWS A;  4NB3 A;  2WV6 D;  4A3B G;  2NVT B;  1SRO A;  3O13 A;  1SFO B;  2VQE Q;  1ML0 D;  3R2I A;  2MNA A;  4LF4 Q;  3K7U C;  2NVX H;  1DJR D;  1OXX K;  4A3C H;  4DUY L;  2KHS A;  3CC7 A;  3H3V I;  1XWE A;  2CFM A;  3TEH B;  3GP7 A;  2FXQ A;  4AQY L;  3M9B A;  3LGJ A;  1VQB A;  3E9I A;  2Z4H A;  5C0X G;  3HOW B;  4FXD A;  1A2U A;  2VL6 A;  2K14 A;  1EIH A;  1H9S B;  4JC0 A;  1PH2 A;  3B6Y A;  3CW2 C;  4ABN A;  2L5T A;  2YV5 A;  1KC8 C;  1J5E L;  1EL0 A;  2X69 A;  3QWN A;  4BXX H;  3KK7 A;  3LX0 A;  3F8T A;  1N34 Q;  2E2I H;  2A73 B;  5EPJ A;  1VQK A;  2EYJ A;  1X3Q A;  2D9U A;  3GTG H;  1BBX C;  3Q8D A;  2F3I A;  5ELO A;  4V0B A;  2EOT A;  4KKT A;  4YCW A;  4B3M L;  4DU9 A;  1XPO A;  3IAY A;  1EY6 A;  3NBH B;  4ME5 A;  4A3L G;  3E9H A;  3I2Z A;  1LYL A;  1STN A;  1D8L A;  2WB1 E;  4CKB A;  1Z6H A;  5IGC A;  1CZW A;  1UNS A;  1L1O C;  5A2Q L;  1PTO D;  3FMC A;  1Y1W G;  3NXW A;  4GN4 B;  2BE5 D;  4A3G G;  3RR5 A;  1MGS A;  1TWH B;  1E1O A;  3CPW A;  3PO3 H;  1BVS A;  1PTO H;  5EJW A;  1NSN S;  1HCZ A;  2Z9H A;  2NZH A;  1Q12 A;  2X6G A;  2C35 B;  4HMI A;  2ENB A;  3VDY A;  4GS3 A;  1SNC A;  1LTA D;  4HCS A;  5E1F A;  4A3D G;  3TP8 A;  3I56 A;  3I4N G;  4OIK A;  3RLO A;  2G9H D;  1IZ6 A;  1C4Q A;  5D65 A;  3HOU B;  3JAM E;  1DOK A;  2XRQ D;  4PV1 C;  3X3M A;  3KDF A;  2Z6B A;  2E5L Q;  3A74 A;  1J6Q A;  3K5L A;  2F4V L;  3OIP A;  1O7L A;  1SE3 A;  4X65 L;  5M3F H;  1X65 A;  1EZ8 A;  5LL6 X;  4O0A A;  4DK3 C;  1B70 B;  3STB D;  1A2T A;  3HG9 A;  1F2M A;  4JW0 A;  5E3F A;  1E3P A;  5KNB A;  4A3F G;  2AQ3 B;  1EIF A;  2K33 A;  2N49 A;  1WTR A;  5CV8 A;  1VQF A;  4IQZ A;  3JAM c;  1B2T A;  3HOZ B;  3EVQ A;  1UEA B;  5DM6 3;  4ODG A;  4JBW A;  3AU7 A;  1VQ4 A;  1EQQ A;  1WVL A;  4JBM A;  3NQT A;  2YTX A;  3RUZ A;  2KHJ A;  2K6A A;  4HAE A;  5JPN C;  3NUC A;  4HMJ A;  1X3E A;  1ILP A;  2K50 A;  1PYS B;  2IJ0 A;  4A3J H;  1SJH D;  3KOJ A;  1GUO A;  4BY7 G;  3PUV A;  3OWF A;  3QG1 A;  2B2T A;  4NPS A;  3I8Z A;  2AWO A;  4JCV E;  1X54 A;  5EPK A;  5CC4 A;  3PIO A;  3R8B A;  1RL2 A;  1IYJ B;  2KEN A;  2YU9 B;  2UXB Q;  1Y8N B;  3VA5 A;  1AH9 A;  1QZH A;  1FGU A;  4X3U A;  3SXH A;  2G9D A;  1VQ9 A;  1M90 C;  1JIC A;  2R7Z G;  4JYA Q;  1VQL A;  1I6H H;  4TKO B;  3IRB A;  1LT5 D;  1SSO A;  2K05 A;  3IFT A;  2HQL A;  3KFU A;  3HFZ B;  1GUN A;  1W3S A;  4OXP A;  1EFI D;  3A8I E;  2K01 A;  1YNN C;  5IYB H;  1SRU A;  3D4R A;  5EBC A;  1TWC H;  1WCM B;  1NR4 A;  3KF6 B;  4RKL A;  2EYP A;  3W1G A;  5GAG C;  3MFG A;  2LFN A;  3KBX A;  4ID6 A;  1I50 B;  4OWT B;  3MWY W;  1SNO A;  3J80 E;  4DR1 Q;  5JVH 3;  3Q6S A;  2Z4I A;  4G4K A;  4DV6 Q;  2LS0 1;  4LFA Q;  4P71 A;  3D3R A;  3BVZ A;  4CDC C;  1SNQ A;  5J1Z A;  1B9N A;  1VDZ A;  4JV5 L;  4DV1 L;  2KCC A;  2JA7 H;  2DUD A;  1WTV A;  3HKZ G;  4E6I A;  1KQS A;  2ZJQ A;  1K83 H;  1MI2 A;  1JE5 A;  2X6L A;  4K8I A;  4L63 B;  5L37 A;  4R4I A;  4JI6 L;  5CV6 A;  3J80 c;  2OEO A;  2A8V A;  2PW7 A;  2VUM H;  1JT8 A;  1LTR D;  1W6J A;  1U9R A;  4TVA B;  1PRT D;  5M5X H;  2ZT9 C;  1TQO A;  2OF1 A;  1X3G A;  2EY2 A;  3BVM A;  1CHQ D;  1EY5 A;  2VW9 A;  3M7N A;  5C3E B;  3GTO H;  1GHK A;  3HOY H;  2R92 G;  2HCC A;  5AJ3 Q;  1JR0 D;  3S15 B;  2OTJ A;  3FKI G;  4QUC A;  1SE4 A;  2B2Y A;  4KKU A;  1LTL A;  1XPU A;  1BR9 A;  3S17 B;  3NWT A;  3J81 j;  1XXG A;  1I4H A;  3GTM B;  3CCR A;  3CF5 A;  2PZW A;  1IBL Q;  2P5Z X;  5I9O A;  3BDO A;  3A56 A;  4B9W A;  2CQO A;  4G7O C;  3NQI A;  2PNH A;  4RA8 A;  4GOP A;  5C6A A;  1VQO A;  2L1B A;  1TT2 A;  1V9P A;  4DR3 L;  2MO0 A;  3A7L A;  3S14 B;  3SK8 A;  3J7A V;  2KED A;  5JJL A;  3TS2 A;  2UUC L;  4OWX B;  2I46 A;  1BCP D;  1MHW C;  3H3V C;  2F4I A;  2IW3 A;  4EX5 A;  2F0Q A;  1K8G A;  4RKB A;  5IOD A;  2A6H D;  2E2J H;  3NEL A;  1TS3 A;  4JOI C;  1TWF B;  5CBA E;  4AYB G;  1HNX Q;  1STA A;  3PGZ A;  2F0W A;  1IYV A;  4QIW B;  1I94 L;  1MKH A;  1XPR A;  1II3 A;  1W6K A;  1Q8I A;  5ISR A;  4O1N A;  2JA7 G;  3R2T A;  1ESR A;  3OTO L;  2VS1 A;  1YJ9 A;  2ATW A;  1G6Z A;  4GKJ Q;  2HCI A;  3MVV A;  1WD0 A;  4DV2 L;  4B3S L;  1Y1W B;  2RQX A;  2K52 A;  5DM7 3;  5CMD A;  4A3G B;  1HFG A;  4P73 A;  3I91 A;  3TRZ A;  3VYS A;  4C3J B;  1NTG A;  1VQD A;  4JI8 L;  2ICE C;  2QDB A;  3GTL H;  4A3D B;  4A3M H;  1QOH A;  2UXD Q;  4HN7 A;  5AFW A;  3S1M H;  1A0I A;  3GTQ B;  3S24 A;  2DNE A;  1QWY A;  3PUZ A;  4C3H H;  4F7X A;  2ALY B;  4DV4 L;  4A76 A;  1PHJ A;  2QF7 A;  1BQQ T;  1N32 Q;  4QJF A;  4UAI A;  3I4M H;  2PNR C;  5IGF A;  1C9O A;  5HGQ A;  2I5H A;  1WTO A;  2L9H A;  4UY8 C;  1BXT A;  4JI2 Q;  2PQE A;  5IT9 E;  1JB3 A;  1E7Z A;  1WYD A;  1DOM A;  3H15 A;  2L55 A;  3K8A A;  3NEM A;  1I3Q H;  3VYU A;  4DN4 M;  2WIN B;  4CJ2 C;  1YIJ A;  1JJ2 A;  1G51 A;  1EYC A;  3E6Z X;  1X32 A;  1O7Z A;  1O7Y A;  1BUV T;  4U68 A;  2NVX B;  4DXG A;  3MXN B;  2CH4 W;  2JN4 A;  1EOV A;  5IGE A;  3HOW G;  2PI2 E;  1Q46 A;  3GO5 A;  3J7Z C;  4CKC A;  5IT9 c;  4DA2 A;  5TSS A;  1FVI A;  1TII D;  4Y7N H;  1SJE D;  5IYD H;  2JA8 H;  2XNA C;  4KKS A;  1D2B A;  4LFB Q;  2DJG C;  4H13 C;  5KIX A;  3GTK H;  1H9K A;  2D2C C;  2KBN A;  2KCN A;  1EQR A;  2A6E C;  3BG3 A;  2E2I B;  4LF6 L;  1V1P A;  5KEE A;  1MSG A;  1ASZ A;  4JI4 Q;  1ZKO A;  1UEB A;  4R4O A;  4ALP A;  3GTG B;  3PUW A;  4S3S A;  4IUP A;  2A68 C;  3UDI A;  1HNW L;  4KI0 A;  3I90 A;  1TWA H;  1XMO Q;  3EJI A;  2KEC A;  5A2Q E;  4N8X 1;  2MUY A;  4OHJ A;  5EPL A;  3PF4 A;  3PO3 B;  1PTO B;  3HGB A;  4WFN 3;  1WTQ A;  2QIL A;  1YHB A;  4X3K A;  2PMZ B;  5C4J H;  1FL0 A;  1GUS A;  2E74 C;  3F2D A;  4IPH A;  4A3M G;  4DKA C;  3HOV H;  1CHP D;  3K0Y A;  5G3L D;  4O42 A;  1U0L A;  2H5X A;  3K0X A;  2ZM6 L;  4BBR H;  1IW7 D;  2LXJ A;  3KF8 B;  2HHH L;  2F0F A;  3EN2 A;  3KLW A;  5KRU A;  2ZJP A;  4DK0 A;  4LF9 Q;  2WAC A;  3FRP B;  3NPP A;  1A62 A;  3I4M G;  1IBK L;  1E2W A;  2MP1 A;  2KEE A;  5M3F B;  1J8I A;  4GLV B;  1VQ8 A;  3PIO 3;  2ICI A;  5ELC A;  4MIU A;  1B3A A;  3NBH A;  2RHQ B;  1U5K A;  1VMC A;  1XYI A;  1BBU A;  3PUX A;  5I2Y A;  1N36 L;  1JWS D;  1MJE A;  5CR3 A;  4QY7 A;  2PZU A;  4MZ9 A;  1STH A;  4B3T Q;  2K32 A;  2JE6 I;  5FO7 B;  2JA6 H;  4IUT A;  3S1R H;  3LNN A;  2JA5 H;  1STG A;  4ZYS A;  3CRL C;  3TSS A;  4IOC A;  1TY0 A;  3WWV A;  3CCU A;  3K5N A;  2WKC A;  1EQV A;  1VQE A;  4BBS H;  3PV0 A;  3S1Q B;  5E4W C;  2QDL A;  5LMU Q;  3S2D H;  2UUB L;  1JOK A;  3TZD A;  1PA6 A;  1AZP A;  3J7Y W;  1C8C A;  3AEV A;  5IYD G;  2QA4 A;  3DWA A;  3CCQ A;  4WJ4 A;  1GXD C;  2R7D A;  4AIM A;  4DF7 A;  2MQH A;  4A3I H;  2NTS A;  4A3J B;  1FJG Q;  1B1Z A;  4OO1 I;  1SN8 A;  3PIP 3;  2Y0S B;  2E2D C;  3TME A;  2EYH A;  2V1C C;  4IPD A;  3OPO A;  4JBK A;  1GOZ A;  4NMZ A;  3T1H L;  1VCI A;  1E2V A;  3QJY A;  4P74 A;  4BY1 H;  4OGQ C;  3E3X A;  2K4K A;  3SDZ A;  3N52 A;  4A3K H;  1HFN A;  1AFP A;  2F0O A;  3D0F A;  1QE6 A;  2L0C A;  3K7A H;  2EYM A;  3U4V A;  2XRS D;  5ELB A;  1LT6 D;  1PYB A;  2NZO A;  2XWJ B;  3I70 A;  2K1B A;  2NWG A;  4WJW A;  4PNY A;  4YY3 Q;  5KGU A;  3K57 A;  1TR5 A;  1A3T A;  4F87 A;  2LMC B;  1PH5 A;  3NSW A;  4EGV A;  2NVY H;  1D6E C;  4J15 A;  2RCN A;  3HOV G;  4BS9 A;  4BBR G;  2LXK A;  1TWC B;  1QUQ B;  1DD2 A;  2D5D A;  4DR5 L;  1LM0 A;  4GKK L;  5J3B A;  1PXU A;  4P75 A;  2NZ1 D;  3DM1 A;  4B08 A;  3PCO B;  4JI3 L;  3HKZ E;  3V96 A;  3QOJ A;  2JEA I;  1UE5 A;  2Q2T A;  1JC7 A;  2JA7 B;  4HSP A;  4H44 C;  1HNZ L;  3WOF A;  3S1N B;  3CQZ H;  4HCE A;  1K83 B;  2F0G A;  2EJM A;  4ZK9 B;  1JJG A;  2J4X A;  3CCS A;  4ILW A;  1SYB A;  2B2U A;  2VUM B;  4G7H C;  5M5X B;  5C3E G;  1YHA A;  3PO2 H;  2JK8 A;  3E5S A;  2VY3 A;  1EYG A;  4DR4 L;  5T1G A;  2TMP A;  1PRT B;  3GTO B;  1MJC A;  1WTX A;  5M9O A;  5IOC A;  1MBY A;  3HOY B;  2DGY A;  3KYH C;  4HIM A;  1CZG A;  2ZXP A;  4A4I A;  1Y69 U;  1YNX A;  4JI5 L;  2N3S A;  2CCZ A;  3TDQ A;  2FMM A;  1RD9 D;  5M3M H;  5H1S E;  1AW7 A;  1GO3 E;  4M8A A;  5GRO A;  3VR5 A;  1PVO A;  4K6L A;  1K3R A;  1PTO C;  2UU9 L;  1NMF A;  1B3Q A;  2BE5 C;  1HQR D;  2GVB A;  4K5V A;  1P16 A;  2UUA Q;  1S5B D;  1LAC A;  2AUK A;  2KA7 A;  1FD7 D;  5IYC G;  1VQ7 A;  2K5V A;  4MTN A;  3F2U A;  3T16 A;  2YTV A;  3UE1 A;  4IUN A;  1X55 A;  2QEJ C;  5E4X A;  3RLF A;  2WAQ E;  5HUR A;  4QL5 A;  3TZU A;  4QUF A;  2HT1 A;  1S3O A;  2GVA A;  2EY6 A;  4CHT B;  1Q82 C;  1BCP B;  4NXN Q;  2KCT A;  2E2J B;  5K36 H;  4OIJ A;  1E1T A;  2VB2 X;  1Q1E A;  4KY6 A;  3BZD B;  5FLM H;  1JOO A;  3STB C;  3OYY A;  1TWG H;  3UE0 A;  1ZEQ X;  2Z6K A;  1XNR L;  1RF2 D;  4PMW A;  2WII B;  3FHW A;  2PO4 A;  3J81 E;  3CMA A;  2E2H H;  3S9W A;  2K5N A;  1HJP A;  5EKK A;  1NCV A;  4X66 L;  3ZYY X;  4K2K A;  2NBF A;  4DR2 Q;  2R7F A;  4XTC S;  3A5U A;  1I6V C;  2Q2H A;  4KY5 A;  1PZJ D;  1IXR A;  4CKE A;  3L7Z C;  4KMU C;  4K8J A;  4MHE A;  4C3J G;  3U9O A;  1JJC B;  3C2P A;  2MJ8 A;  3DLL A;  2PQA B;  1E24 A;  5M5Y H;  1B53 A;  3J81 c;  1B9M A;  4DR7 Q;  3PO2 G;  3GTL B;  4IFD J;  4A3M B;  2PI2 A;  4FXK C;  3S1M B;  3DMU A;  1HR0 Q;  3QR8 A;  1XTD A;  3SK5 A;  4XYO A;  4C3H B;  1KRS A;  5C5L A;  1DYQ A;  3I4M B;  1PH8 A;  1CKO A;  1Z7T A;  4DUZ L;  4LF8 Q;  5M3M G;  5J22 A;  4CDE C;  2QKI C;  1I4R A;  5IWA Q;  1CKN A;  2VQF Q;  5HY6 A;  5CGK A;  4YWK A;  1K9M C;  4DV5 L;  1LO5 D;  2HIX A;  4IZ8 A;  4FDB A;  1I3Q B;  2ID0 A;  4X6A H;  4NXM L;  3NP8 A;  2F0T A;  2KUM A;  1XNQ Q;  1KAW A;  4RFB A;  4NDX A;  4FVM A;  4X64 L;  4A3C G;  4ULL A;  3V05 A;  3TS0 A;  3J7A F;  1O80 A;  1R4Q B;  2IX0 A;  3CCL A;  4JPB W;  3K81 C;  3GQB A;  1YNJ D;  4HIO A;  3NTK A;  1G2S A;  2L15 A;  5LL6 S;  4C56 C;  4GN3 B;  1PTO F;  2F0P A;  4NP5 A;  4BXX G;  4Y7N B;  2A5H A;  4NKL A;  2JA8 B;  1CTM A;  1I4P A;  5K36 G;  3GTK B;  1H95 A;  4LUV A;  1D1K A;  1UE6 A;  3K5O A;  5EGT A;  2F0S A;  3I73 A;  4JBJ A;  4KV6 A;  2JJQ A;  1EQT A;  2CWP A;  2K5H A;  3ZJY C;  3MA2 B;  4XIG S;  2BDN A;  1IKL A;  3BS1 A;  1EY0 A;  4EQ5 A;  5FLX L;  3HRZ C;  4JI1 L;  5FO9 B;  2B2V C;  2NB0 A;  2I07 B;  3M7G A;  2JEB I;  1TWA B;  4DUY Q;  3Q22 A;  3PO3 G;  1G2T A;  4DV7 L;  1PRT C;  2EJG C;  4AQY Q;  5C5M A;  4GNX B;  1SEB D;  1TVX A;  4CDD C;  1PH7 A;  4C2M H;  3OHX C;  1Q3L A;  2F3V A;  3F2C A;  5C4J B;  1DZ1 A;  1J5E Q;  3HZX A;  5EKI A;  1J9O A;  1AZQ A;  4LF7 L;  1L0X B;  3HOV B;  2B2W A;  4BBR B;  1KLU D;  1Q90 A;  4IUU A;  2A19 A;  3OW2 A;  1B7Y B;  1QG7 A;  1VQC A;  5M3F G;  1IBM L;  3G71 A;  4B3M Q;  4DK1 A;  3S2H H;  1YJN A;  2GN5 A;  3T1Y L;  1X6O A;  1ICF B;  2NVQ H;  1E0B A;  2DJF C;  2I5L X;  1EFW A;  1A15 A;  4R9W A;  4EQP A;  4DV0 L;  3C3L A;  4OO1 H;  3FPU B;  2HD3 A;  1N9W A;  2D62 A;  1B44 D;  1U4L A;  4B3R L;  3I3C A;  3CCJ A;  1WJJ A;  2JA6 B;  2EPB A;  3S1R B;  5F2D A;  3H09 A;  2JA5 B;  1BCP C;  5BR8 L;  4RAU C;  4JVZ A;  2HDL A;  4U67 3;  1I4X A;  1CT1 D;  3I55 A;  2A6H C;  2M2L A;  4BBS B;  1PYW D;  2EYO A;  1OXU A;  3S2D B;  1S4Z A;  1BNZ A;  3FDT A;  3A8J E;  1F9P A;  4A3J G;  2F4V Q;  5JVG 3;  4X65 Q;  5I4D A;  2XN9 C;  2Y0S G;  4DUZ Q;  4QGU A;  4A3I B;  1EIY B;  1JOQ A;  5LHY 1;  2RSN A;  3UI2 A;  1ENA A;  3U58 A;  2RVL A;  2AKW B;  2BDO A;  2RCF A;  3ICE A;  1L2F A;  5IGG A;  1AP0 A;  4MTK A;  3EA6 A;  4LFC L;  3TRE A;  4BY1 B;  2WKD A;  4ZUI A;  2F0V A;  4DR6 L;  1YIT A;  5D3I B;  2Z1C A;  3CU7 A;  2N88 A;  4A3K B;  4KHP L;  3RZD H;  4OX9 L;  4F88 A;  2SDF A;  4AH6 A;  3KLS A;  1D5M C;  1L1O A;  2NVT H;  3PQI A;  1JE4 A;  3ER0 A;  5C4X H;  5IYB G;  4PZ8 A;  1DGS A;  2EE1 A;  2NVY B;  4UPA A;  3J7A 5;  1FNU A;  1ONL A;  1F77 A;  2L12 A;  1KAA A;  3IKJ A;  3AMU A;  4LK1 C;  3SVM A;  1PRT F;  1VS0 A;  1U4P A;  1A3V A;  3NEN A;  3PF5 A;  5CYU A;  3P75 A;  2EVB A;  2PPB C;  4R1J A;  1C48 A;  1G29 1;  1VQP A;  1WTP A;  2RBM A;  1OTC A;  2O2L D;  1EUJ A;  3KDF B;  2UXC L;  1TU2 B;  2LKV A;  3RMH A;  3MAQ A;  2B63 H;  1OO9 B;  4OO1 G;  3CQZ B;  1S40 A;  1MD2 D;  2Q8R E;  4GZY C;  1CUK A;  1PZI D;  2VUM G;  1XJV A;  1STY A;  3T13 A;  1F9Q A;  1GHJ A;  5DLQ E;  4XQQ A;  3GTP B;  1KXL A;  2D0P A;  2CHB D;  1Z9F A;  2WB1 G;  3MFY A;  1M1K C;  1AEX A;  3U50 C;  3PO2 B;  4IUQ A;  3BJU A;  2AMC B;  3OMG A;  3HOY G;  3M85 A;  3BZC A;  2NN6 H;  1D7Q A;  2BA1 A;  3H91 A;  4HJ5 A;  5LMN L;  2XWB B;  1ROD A;  3L0O A;  1KNA A;  2OT2 A;  2Q2I A;  3HOX H;  3I4L A;  4JV5 Q;  4DV1 Q;  1V43 A;  1LT3 D;  4DAP A;  5M3M B;  1BCP F;  1XMQ L;  3HOU H;  4TQU S;  4HJA A;  4PZ7 A;  4RMF A;  3VYT A;  4GNX C;  4PMC A;  1DXM A;  5JEA J;  1SND A;  3KBG A;  4JI6 Q;  3QOL A;  1PMR A;  1Y8P B;  4DV3 L;  3E0E A;  1SDF A;  3RNU A;  4DAY A;  1EU4 A;  4RGO S;  1H9M A;  5C44 H;  4WOR A;  1PZK D;  4ZKB B;  2ZTE A;  4KHV A;  2EQS A;  3HS0 C;  4X62 L;  4FP5 D;  1SR3 A;  1IW7 C;  1EYD A;  3HOZ H;  2QW7 A;  4LJZ C;  5C4H A;  4QIW E;  3MTS A;  1ENC A;  1FR3 A;  1A6X A;  4LW1 A;  2OQK A;  3BZK A;  4R4T A;  5JPM C;  2EY1 A;  3GTJ H;  3GDE A;  4IJL A;  5IGD A;  2K28 A;  1TWG B;  1PFM A;  1YEZ A;  4JI7 L;  4FF1 A;  1A3U A;  4ZUJ A;  3PUY A;  3K6O A;  4J8Q A;  2E2H B;  2MPM A; 
#chains in the Genus database with same CATH homology
 3Q23 A;  4WRD A;  4Q0F A;  2E75 C;  4KHZ A;  1VMP A;  2HUG A;  3G7L A;  4CGY B;  4R8N A;  3W2D A;  5M5Y B;  1H9S A;  3OOC A;  4IFD H;  2XVS A;  4RH6 A;  4K5W A;  2NTT A;  4C3H G;  5I9P A;  3N6R A;  1ZYR D;  1EIG A;  2CQA A;  1EZ6 A;  1HPC A;  3ITP A;  4X3S A;  1EY4 A;  4EQO A;  2A74 C;  1QB5 D;  4DXF A;  4RHR A;  1CA6 A;  4FO2 A;  2K5W A;  4EVO A;  5JAV A;  1F9S A;  2A69 D;  5D3D A;  2C5C A;  5NUC A;  2IT1 A;  3C1E A;  2XIW A;  3QB3 A;  3NBI A;  2JP1 A;  4OL7 A;  4DNT B;  4RCN A;  2FIN B;  1VF7 A;  3CHB D;  3SK6 A;  2SNM A;  1SXT A;  3X3N A;  1M4V A;  2RDF A;  5G3L F;  4FF4 A;  2MGS A;  4KJN A;  1SMY C;  1I6H B;  2VB3 X;  2ZXR A;  1D5X C;  5CV7 A;  3VR6 A;  4LMQ D;  4C2M B;  3A54 A;  2KQ3 A;  2FJ2 A;  3BVG A;  5BN5 A;  4PMB A;  3MXG A;  1E2Z A;  4IFD G;  3A55 A;  4H0L C;  1EWH A;  1BDO A;  1EOT A;  1EY7 A;  1GJX A;  5C0X H;  4JK1 C;  3Q0A A;  1F2Z A;  3MEH A;  1ET9 A;  2B2T C;  4K5X A;  4ZKC B;  1QIL A;  3S2H B;  2RDG A;  2NVQ B;  4RGT A;  2VNU D;  4L6T B;  3ERO A;  5I6Y A;  4RHS A;  4KN7 C;  3SK4 A;  3MXU A;  2E76 C;  2Z8L A;  1K8M A;  1SMY D;  2F03 A;  5CV5 A;  1Q1B A;  5C4Z A;  2WB1 B;  4XQJ A;  3D6C A;  4RCO A;  5EBD A;  1NAP A;  2R3Z A;  2KOL A;  4KN4 C;  1KTK A;  1IKM A;  4IN3 A;  4QB4 A;  1DOL A;  5DNF A;  5COR A;  4CJ1 B;  5BN3 A;  4KD4 A;  3BDC A;  3VR4 A;  1TY2 A;  3MXP A;  3NHH A;  1SYC A;  1HHV A;  5KYI A;  1V1P B;  2NN6 I;  2F0E A;  2H4O A;  3RZD B;  1TS2 A;  5JJZ A;  3MC0 B;  2K5D A;  1SYE A;  1ZXT A;  4XXE A;  1HTP A;  5C4X B;  1KDA A;  1EU3 A;  2LY7 A;  1LLR D;  4XYQ A;  1HUN A;  2B2Y C;  1Y8O B;  1LTB D;  4I65 A;  2B8F A;  2SNS A;  1HA6 A;  1RDP D;  2N55 A;  1HXY D;  4I7Z C;  1RHP A;  2BA0 A;  3SE0 A;  1LT4 D;  1ICW A;  1V1O A;  2M00 A;  2B63 B;  2KJX A;  3DEP A;  2NYZ D;  3IFD A;  1U4R A;  2CW0 D;  3D4W A;  2M9V A;  2JXM B;  2PW5 A;  1YNJ C;  2HQE A;  4IUR A;  5ELD A;  5A35 A;  2ZXO A;  2DY8 A;  1SYD A;  4FYD A;  3VR2 A;  3L9A X;  1PDQ A;  2B39 A;  2K03 A;  1RCV D;  3EFX D;  2IX3 A;  3HOX B;  3OMC A;  5KNC A;  5ELF A;  4G7Z C;  5JEA H;  1S5E D;  3MHB A;  2J7Z A;  3D8G A;  4IFD I;  3D6W A;  1D1I A;  1KNE A;  3OIQ A;  3SEB A;  1CQF A;  3U9S A;  1XTC D;  5FOB B;  2K04 A;  4QCL A;  4N9T A;  5C44 B;  3DWQ A;  3IL8 A;  2F3W A;  3G6J B;  1F2Y A;  2FMC A;  1CM9 A;  4V19 0;  1ILQ A;  3DHQ A;  3GTJ B;  4X3T A;  1RTN A;  5CV4 A;  1FNV A;  1BO0 A;  2O5J C;  4FF3 A;  4Q5V A;  1LTG D;  2DN8 A;  5DEH A;  3WDN A;  4B9X A;  4J6H A;  3M3Y B;  2EYL A;  4CJ0 B;  3ONA B;  4A93 B;  2GA4 B;  4FF2 A;  3MXN A;  1RJT A;  3LWU A;  1JWU D;  1LTT D;  2TSS A;  4DGZ A;  3KLS X;  3GD7 A;  1FNW A;  3P20 A;  1EEI D;  1ENF A;  1KLG D;  3VR3 A;  2K5Q A;  5C0X J;  5T1I A;  3T51 B;  4K2L A;  3BYY B;  3GV3 A;  1HTL D;  1CQV A;  2R6G A;  4QF4 A;  3L3O C;  2L4N A;  5JEA G;  4KJO A;  3OSO A;  3VYR A;  1LTI D;  1KDB A;  1I4G A;  2Q8I B;  1SNM A;  1FGB D;  1SYG A;  1EWC A;  3FPP A;  4KTA A;  3QIA A;  1B50 A;  1D5Z C;  2B8G A;  5C0X I;  3DWP A;  2F0H A;  4RGN A;  1STB A;  1S5D D;  1XX8 A;  3P7J A;  4A3E B;  1HA5 A;  4YIJ A;  1G8Z D;  1WTW A;  3RZO B;  5FO8 B;  3DXJ C;  4C3I G;  5K5P A;  3KF8 A;  1WD1 A;  5I6W A;  3CKI B;  4IUV A;  1IL8 A;  4M1U B;  3DEO A;  1I4Q A;  2PCF B;  1T5X D;  1YNN D;  4XT1 B;  1SBB B;  1L0Y B;  1F9R A;  1HUM A;  1KAB A;  2IL8 A;  2YYZ A;  3HEJ A;  1GUT A;  4PQX A;  1PFB A;  2DNC A;  3FVQ A;  1ESF A;  3K7A B;  3V2T A;  5JOB A;  4A3B B;  1ET6 A;  2HDM A;  5ELE A;  1EY8 A;  4BA2 I;  5HGT A;  4DFA A;  4QMG A;  1DCZ A;  1HRJ A;  3TBI B;  1STE A;  3K59 A;  4CBV A;  1CI3 M;  1UAP A;  1X3P A;  1QJO A;  1CFM A;  4L8J A;  5DAU A;  3ND9 A;  3W3A A;  2R61 A;  4HED A;  4F8M A;  1CK1 A;  4UDU C;  4ZAI A;  2AQ1 B;  2JSO A;  3Q24 A;  3J81 L;  2EJF C;  2O4X A;  3FEW X;  3NTH A;  5I2X A;  1GUW A;  2NUC A;  1MSH A;  1R9T B;  2F0J A;  3LWE A;  2EDG A;  3NK9 A;  3T4A C;  1OXV A;  4Z9C B;  5J39 A;  1QNK A;  1DM0 B;  4BWG B;  4NW2 A;  2IWH A;  3VA7 A;  1SNP A;  1RTO A;  1QCB D;  4KY7 A;  5FK9 C;  4P2C B;  3JAM L;  2BOS A;  3H0G B;  3I4N B;  1LAB A;  2AUJ D;  2F0I A;  2F0U A;  1EY9 A;  4HR7 B;  5BN4 A;  4TSS A;  2SOB A;  2JYO A;  1PFN A;  5COY A;  4ZQ3 A;  2IX1 A;  4BA1 I;  1SAP A;  4KK7 A;  5FKA C;  4RGM A;  2B2V A;  2R93 B;  2FFK B;  2QCP X;  2B2U C;  3URY A;  4LAA A;  4A3F B;  4MN3 A;  4R8I A;  1EYA A;  2F0L A;  1PLF A;  2EYF A;  1RKN A;  2SEB D;  1ZYR C;  5CV9 A;  3A7A B;  1S5C D;  4C1N K;  2K7V A;  3SHL A;  4EQN A;  3TP5 A;  2EY5 A;  3D31 A;  1KDC A;  3TN2 A;  1M8A A;  4DNR B;  2DY7 A;  3T56 B;  4IAL A;  2FHT A;  2J0T D;  3M4Y A;  1NR2 A;  1LTS D;  2RSO A;  2PZT A;  3PMF A;  3AB9 A;  5D14 A;  4BY7 B;  1LV9 A;  4KD3 A;  1OXS C;  3ND8 A;  3R3O A;  1JQY D;  2F1M A;  2A69 C;  3ERQ A;  1GUG A;  5KND A;  1TS5 A;  1Y1V B;  3R93 A;  4HTH A;  3A8K E;  2AQ2 B;  4K14 A;  2MHV A;  2NN6 G;  1H9J A;  2R7Z B;  1R4P B;  4C1N I;  2OXP A;  3C1F A;  5IIF A;  1OXT A;  3TP7 A;  1AN8 A;  3OW7 A;  3J80 L;  4XT3 B;  2WP8 J;  2KVM A;  3NE5 B;  2A6E D;  1CA5 A;  4G57 A;  1DON A;  3KLR A;  5CBE E;  2RDH A;  3QO2 A;  3K58 A;  4FNF A;  3BDL A;  2A68 D;  3HKZ B;  1O78 A;  1V8Q A;  5IGB A;  1EEF D;  3H6M A;  1TS4 A;  4HSV A;  1FYC A;  5KYL A;  4C3I B;  5EQ0 A;  3SR1 A;  2VXW A;  4FXG C;  3E0J A;  3K5M A;  2H1E A;  2R92 B;  1G91 A;  3I72 A;  5FLX E;  2EZV A;  3S16 B;  3FKI B;  1B4O A;  1U4M A;  3T53 B;  4J1M A;  1NUC A;  2F0D A;  3BYT B;  1JWM D;  1IHZ A;  4XDX A;  1BF4 A;  3HP3 A;  2V4D A;  2L11 A;  1SYF A;  4DAV A;  2BCO A;  4H7B A;  5C3W A;  1Z47 A;  3GV6 A;  1JCK B;  1BOS A;  1IYU A;  3M4O B;  2O5I C;  2RKS A;  1VF5 C;  2Q8T A;  3CRK C;  1TKW B;  3D4D A;  1UUP A;  2WAQ B;  4RWS C;  5M5W B;  1T5E A;  4AYB B;  1F2L A;  4TRD A;  4ZRZ A;  3MZ5 A;  2F0N A;  1SE2 A;  3OWE B;  1JOR A;  2RA4 A;  2C9O A;  4ZLT F;  1H9R A;  4K6D A;  5C3X A;  1HQM C;  3NTI A;  5EKL A;  2B2W C;  3KUP A;  3C46 A;  3WOE A;  3P1H A;  2F0M A;  2AWN A;  2IPK D;  2PYK A;  4N9P A;  4XQN A;  1K8O A;  1S5F D;  1QNU A;  3EQL C;  2CVR A;  2EXZ A;  3DUZ A;  5IT9 L;  2XSC A;  2CW0 C;  3RD4 A;  3TP6 A;  3H94 A;  2F0K A;  3NWS A;  2WV6 D;  2NVT B;  3O13 A;  1SFO B;  1ML0 D;  3R2I A;  1DJR D;  1OXX K;  2KHS A;  1XWE A;  3GP7 A;  5C0X G;  2Z4H A;  3HOW B;  4FXD A;  1A2U A;  1EIH A;  1H9S B;  4ABN A;  2L5T A;  1EL0 A;  2X69 A;  3QWN A;  3KK7 A;  3LX0 A;  2A73 B;  5EPJ A;  2EYJ A;  1X3Q A;  2D9U A;  1BBX C;  4V0B A;  2EOT A;  4KKT A;  4DU9 A;  3IAY A;  1EY6 A;  4ME5 A;  1STN A;  5IGC A;  4CKB A;  1Z6H A;  1CZW A;  1UNS A;  5A2Q L;  1PTO D;  3FMC A;  3NXW A;  2BE5 D;  1MGS A;  1TWH B;  1PTO H;  5EJW A;  1NSN S;  1HCZ A;  1Q12 A;  2X6G A;  4HMI A;  2ENB A;  1SNC A;  1LTA D;  4HCS A;  5E1F A;  3TP8 A;  4OIK A;  2G9H D;  1C4Q A;  5D65 A;  3HOU B;  3JAM E;  1DOK A;  2XRQ D;  4PV1 C;  3X3M A;  3K5L A;  3OIP A;  1O7L A;  1SE3 A;  1EZ8 A;  5LL6 X;  1A2T A;  3HG9 A;  1F2M A;  5E3F A;  5KNB A;  2AQ3 B;  2K33 A;  1WTR A;  5CV8 A;  4IQZ A;  1B2T A;  3HOZ B;  3EVQ A;  1UEA B;  5DM6 3;  4ODG A;  4JBW A;  3AU7 A;  1WVL A;  3NQT A;  3RUZ A;  2K6A A;  4HAE A;  5JPN C;  3NUC A;  4HMJ A;  1ILP A;  2IJ0 A;  1SJH D;  1GUO A;  3PUV A;  3OWF A;  3QG1 A;  2B2T A;  3I8Z A;  2AWO A;  5EPK A;  5CC4 A;  3R8B A;  2YU9 B;  1Y8N B;  3VA5 A;  4X3U A;  3SXH A;  2G9D A;  1JIC A;  4TKO B;  1LT5 D;  1SSO A;  2K05 A;  3IFT A;  1GUN A;  1EFI D;  3A8I E;  2K01 A;  1YNN C;  3D4R A;  5EBC A;  1WCM B;  1NR4 A;  4RKL A;  2EYP A;  2LFN A;  3MFG A;  3KBX A;  4ID6 A;  1I50 B;  3J80 E;  3MWY W;  1SNO A;  5JVH 3;  3Q6S A;  2Z4I A;  4G4K A;  2LS0 1;  3D3R A;  3BVZ A;  1SNQ A;  5J1Z A;  1B9N A;  1VDZ A;  2KCC A;  1WTV A;  4E6I A;  1MI2 A;  2X6L A;  4K8I A;  4L63 B;  5CV6 A;  2OEO A;  2PW7 A;  1LTR D;  1W6J A;  1U9R A;  1PRT D;  2ZT9 C;  1TQO A;  2OF1 A;  2EY2 A;  3BVM A;  1CHQ D;  1EY5 A;  3M7N A;  5C3E B;  1GHK A;  2HCC A;  1JR0 D;  3S15 B;  4QUC A;  1SE4 A;  2B2Y A;  4KKU A;  1BR9 A;  3S17 B;  3NWT A;  1XXG A;  1I4H A;  3GTM B;  2PZW A;  5I9O A;  3BDO A;  3A56 A;  4B9W A;  4G7O C;  3NQI A;  4RA8 A;  5C6A A;  2L1B A;  1TT2 A;  3A7L A;  3S14 B;  3SK8 A;  3J7A V;  2KED A;  2I46 A;  1BCP D;  3H3V C;  2F4I A;  2IW3 A;  2F0Q A;  4RKB A;  5IOD A;  2A6H D;  1TS3 A;  5CBA E;  1TWF B;  1STA A;  2F0W A;  1IYV A;  4QIW B;  1II3 A;  1W6K A;  1Q8I A;  5ISR A;  4O1N A;  3R2T A;  1ESR A;  1G6Z A;  2HCI A;  3MVV A;  1WD0 A;  1Y1W B;  2RQX A;  5DM7 3;  5CMD A;  4A3G B;  1HFG A;  3I91 A;  3VYS A;  4C3J B;  2ICE C;  2QDB A;  4A3D B;  1QOH A;  4HN7 A;  5AFW A;  3GTQ B;  2DNE A;  1QWY A;  3PUZ A;  4F7X A;  2QF7 A;  1BQQ T;  4UAI A;  2PNR C;  5IGF A;  1WTO A;  2L9H A;  1BXT A;  2PQE A;  5IT9 E;  1JB3 A;  1DOM A;  2L55 A;  3VYU A;  4DN4 M;  2WIN B;  4CJ2 C;  1EYC A;  3E6Z X;  1X32 A;  1O7Z A;  1O7Y A;  1BUV T;  4U68 A;  2NVX B;  4DXG A;  5IGE A;  3GO5 A;  4CKC A;  4DA2 A;  5TSS A;  1TII D;  1SJE D;  2XNA C;  4KKS A;  1D2B A;  4H13 C;  5KIX A;  1H9K A;  2D2C C;  2KCN A;  2A6E C;  3BG3 A;  2E2I B;  1V1P A;  5KEE A;  1MSG A;  1ZKO A;  3GTG B;  3PUW A;  4S3S A;  4IUP A;  2A68 C;  4KI0 A;  3I90 A;  3EJI A;  2KEC A;  5A2Q E;  2MUY A;  4OHJ A;  5EPL A;  3PO3 B;  1PTO B;  3HGB A;  4WFN 3;  1WTQ A;  2QIL A;  4X3K A;  2PMZ B;  1GUS A;  2E74 C;  1CHP D;  3K0Y A;  5G3L D;  4O42 A;  1IW7 D;  2F0F A;  5KRU A;  4DK0 A;  2WAC A;  3FRP B;  3NPP A;  1E2W A;  2MP1 A;  2KEE A;  5M3F B;  1J8I A;  3PIO 3;  2ICI A;  5ELC A;  4MIU A;  1B3A A;  3NBH A;  1VMC A;  1XYI A;  3PUX A;  5I2Y A;  1JWS D;  5CR3 A;  2PZU A;  1STH A;  2K32 A;  2JE6 I;  5FO7 B;  4IUT A;  3LNN A;  1STG A;  4ZYS A;  3CRL C;  3TSS A;  1TY0 A;  3K5N A;  2WKC A;  1EQV A;  3PV0 A;  3S1Q B;  5E4W C;  1JOK A;  3TZD A;  1AZP A;  3J7Y W;  1C8C A;  3DWA A;  1GXD C;  4DF7 A;  2NTS A;  4A3J B;  1B1Z A;  4OO1 I;  3PIP 3;  2Y0S B;  2E2D C;  3TME A;  2EYH A;  3OPO A;  1GOZ A;  4NMZ A;  1VCI A;  1E2V A;  3QJY A;  4OGQ C;  3SDZ A;  3N52 A;  1HFN A;  1AFP A;  2F0O A;  1QE6 A;  2L0C A;  2EYM A;  2XRS D;  5ELB A;  1LT6 D;  2XWJ B;  3I70 A;  2K1B A;  2NWG A;  4WJW A;  4PNY A;  5KGU A;  3K57 A;  1TR5 A;  1A3T A;  4F87 A;  2LMC B;  3NSW A;  4EGV A;  1D6E C;  4BS9 A;  1TWC B;  1DD2 A;  2D5D A;  1PXU A;  2NZ1 D;  3DM1 A;  4B08 A;  3V96 A;  3QOJ A;  2JEA I;  1JC7 A;  2JA7 B;  4HSP A;  4H44 C;  3WOF A;  3S1N B;  4HCE A;  1K83 B;  2F0G A;  2EJM A;  4ZK9 B;  2J4X A;  4ILW A;  1SYB A;  2B2U A;  2VUM B;  4G7H C;  5M5X B;  3E5S A;  5T1G A;  2TMP A;  1PRT B;  3GTO B;  1WTX A;  5M9O A;  5IOC A;  1MBY A;  3HOY B;  1CZG A;  2ZXP A;  1Y69 U;  3TDQ A;  2FMM A;  1RD9 D;  1AW7 A;  4M8A A;  3VR5 A;  4K6L A;  1PTO C;  2BE5 C;  1HQR D;  4K5V A;  1S5B D;  1LAC A;  2AUK A;  2KA7 A;  1FD7 D;  3F2U A;  3T16 A;  4IUN A;  2QEJ C;  5E4X A;  3RLF A;  5HUR A;  3TZU A;  4QUF A;  2EY6 A;  4CHT B;  1BCP B;  2E2J B;  5K36 H;  4OIJ A;  2VB2 X;  1Q1E A;  4KY6 A;  3BZD B;  1JOO A;  1ZEQ X;  1RF2 D;  4PMW A;  2WII B;  2PO4 A;  3J81 E;  3S9W A;  5EKK A;  1NCV A;  3ZYY X;  4K2K A;  2NBF A;  4XTC S;  1I6V C;  4KY5 A;  1PZJ D;  4CKE A;  3L7Z C;  4KMU C;  4K8J A;  4MHE A;  4C3J G;  3U9O A;  3C2P A;  2MJ8 A;  1B53 A;  1B9M A;  3GTL B;  4IFD J;  4A3M B;  4FXK C;  3S1M B;  3DMU A;  3SK5 A;  4C3H B;  4XYO A;  5C5L A;  1DYQ A;  3I4M B;  1Z7T A;  5J22 A;  2QKI C;  1I4R A;  5CGK A;  1LO5 D;  4IZ8 A;  1I3Q B;  2ID0 A;  3NP8 A;  2F0T A;  2KUM A;  4RFB A;  4NDX A;  4FVM A;  4ULL A;  3V05 A;  3J7A F;  1O80 A;  1R4Q B;  2IX0 A;  3GQB A;  1YNJ D;  3NTK A;  1G2S A;  5LL6 S;  4C56 C;  1PTO F;  2F0P A;  4NP5 A;  4Y7N B;  2A5H A;  4NKL A;  2JA8 B;  1CTM A;  1I4P A;  5K36 G;  3GTK B;  1D1K A;  5EGT A;  3K5O A;  2F0S A;  3I73 A;  4KV6 A;  1EQT A;  3MA2 B;  4XIG S;  2BDN A;  1IKL A;  3BS1 A;  1EY0 A;  5FLX L;  3HRZ C;  5FO9 B;  2B2V C;  2NB0 A;  2I07 B;  3M7G A;  2JEB I;  1TWA B;  3Q22 A;  1G2T A;  1PRT C;  2EJG C;  5C5M A;  1SEB D;  1TVX A;  3OHX C;  1Q3L A;  2F3V A;  5C4J B;  1DZ1 A;  3HZX A;  5EKI A;  1J9O A;  1AZQ A;  1L0X B;  3HOV B;  2B2W A;  4BBR B;  1KLU D;  1Q90 A;  4IUU A;  1QG7 A;  4DK1 A;  1E0B A;  1A15 A;  4R9W A;  4EQP A;  3C3L A;  4OO1 H;  3FPU B;  2D62 A;  1B44 D;  1U4L A;  3I3C A;  2JA6 B;  2EPB A;  3S1R B;  5F2D A;  3H09 A;  2JA5 B;  1BCP C;  4U67 3;  4RAU C;  2HDL A;  1I4X A;  1CT1 D;  2A6H C;  2M2L A;  4BBS B;  1PYW D;  2EYO A;  1OXU A;  3S2D B;  1S4Z A;  1BNZ A;  3FDT A;  3A8J E;  1F9P A;  5JVG 3;  5I4D A;  2XN9 C;  4A3I B;  1JOQ A;  5LHY 1;  2RSN A;  3UI2 A;  1ENA A;  2RVL A;  2BDO A;  1AP0 A;  5IGG A;  3EA6 A;  4BY1 B;  2WKD A;  4ZUI A;  2F0V A;  5D3I B;  2Z1C A;  3CU7 A;  2N88 A;  4A3K B;  4F88 A;  2SDF A;  3KLS A;  1D5M C;  1JE4 A;  2EE1 A;  2NVY B;  1FNU A;  1ONL A;  1F77 A;  2L12 A;  1KAA A;  3IKJ A;  3AMU A;  4LK1 C;  3SVM A;  1PRT F;  1U4P A;  1A3V A;  5CYU A;  3P75 A;  2EVB A;  2PPB C;  1C48 A;  1G29 1;  1WTP A;  2RBM A;  2O2L D;  1TU2 B;  2LKV A;  3RMH A;  3MAQ A;  1OO9 B;  4OO1 G;  3CQZ B;  1MD2 D;  2Q8R E;  4GZY C;  1PZI D;  1STY A;  3T13 A;  1F9Q A;  1GHJ A;  4XQQ A;  3GTP B;  2CHB D;  3MFY A;  1AEX A;  3PO2 B;  4IUQ A;  3OMG A;  3M85 A;  2NN6 H;  2BA1 A;  3H91 A;  2XWB B;  1ROD A;  1KNA A;  2OT2 A;  3I4L A;  1V43 A;  1LT3 D;  4DAP A;  5M3M B;  1BCP F;  4TQU S;  3VYT A;  4PMC A;  1DXM A;  5JEA J;  1SND A;  3KBG A;  3QOL A;  1PMR A;  1Y8P B;  1SDF A;  4DAY A;  1EU4 A;  4RGO S;  1H9M A;  4WOR A;  1PZK D;  4ZKB B;  4KHV A;  3HS0 C;  4FP5 D;  1IW7 C;  1EYD A;  4LJZ C;  5C4H A;  3MTS A;  1ENC A;  1FR3 A;  1A6X A;  5JPM C;  2EY1 A;  5IGD A;  2K28 A;  1TWG B;  1PFM A;  4FF1 A;  1A3U A;  4ZUJ A;  3PUY A;  3K6O A;  4J8Q A;  2E2H B;  2MPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...