3NSWA

Crystal structure of ancylostoma ceylanicum excretory-secretory protein 2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
106
structure length
106
Chain Sequence
GSHMEYCPKMLSEIRQEDINDVETVAYVTVTGKTARSYNLQYWRLYDVPKTAPSQWPSFGTLRDDCGNIQLTADTDYVLGCKSGNQDCFVKLHDGLSQKEKDLLKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Excretory-secretory protein 2
publication title Ancylostoma ceylanicum Excretory-Secretory Protein 2 Adopts a Netrin-Like Fold and Defines a Novel Family of Nematode Proteins.
pubmed doi rcsb
source organism Ancylostoma ceylanicum
molecule tags Immune system
total genus 28
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2010-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.780 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nswA00
3NSWA
chains in the Genus database with same CATH superfamily
1XXGA 1I94L 3D6WA 1LLRD 5E7NA 2ICEC 3W1GA 2JA8G 4KKTA 1F77A 4RGOS 2D9UA 3FMCA 3EJIA 1QVCA 2F0UA 1HNXQ 3Q6SA 2NVQB 1SE3A 2WINB 4LW1A 4B3MQ 1TS2A 3K8AA 3OMCA 1Q1BA 4C1NK 4B9XA 1S5FD 1FNVA 1Z9FA 1UAPA 4JBWA 3UDGA 3CQZH 4HJ8A 4GOPA 2F0KA 3NENA 4YCUA 3A54A 3T53B 3PGZA 2NZ1D 1P8LA 3X3NA 2Q8TA 5FO7B 2ATWA 2KUMA 2K05A 3U58A 1VQCA 3IFDA 2X6LA 1VQJA 3L7ZC 2B2VA 2PNRC 2ZXPA 3NP8A 1CI3M 1XTDA 1PTOF 4H02A 3NBHB 2HDLA 2R7FA 2NN6H 1K83H 1VQBA 3BYTB 1J5EQ 4JI8Q 1CSQA 4C3IG 1EWIA 3CCRA 1MBYA 1MIUA 2KEEA 2UXCL 2UXBL 2B2YC 2K14A 3KLWA 4KHPQ 4O42A 5M3FH 2EPBA 2XNAC 3LGJA 3A8JE 3H94A 4IPCA 4K2LA 3TEHB 4A3BH 5C3WA 4LF7L 1L1OA 1RHPA 2AWNA 3KJOA 4UDUC 4JI5Q 2AQ3B 2PQAB 4CJ1B 3HOZB 2AUKA 1YNXA 2UUBL 4PMBA 3M7GA 1X32A 2EE1A 1LT6D 2SDFA 2F0NA 4A3FH 1S3OA 3KF6A 3D0FA 3SK8A 3S24A 3BZKA 5FLMG 3OPOA 3ERQA 3QR8A 4YCVA 1WTWA 2K5WA 2LS01 2NN6I 4X62L 3OTOQ 2EY6A 4ME3A 4K8JA 3LX0A 3VA5A 5LMUL 3NXWA 4CJ0B 1EYGA 3CAMA 4CDFC 5IYDG 4DR3Q 2PQEA 1JICA 2JSOA 2I5HA 1NJIC 1LTBD 4P75A 3IRBA 3Q23A 4X3KA 4RGNA 5LHY1 4AH6A 2JE6I 2SNSA 2K32A 1YJWA 1HZAA 1PXUA 1VQNA 3CC4A 3S14H 3M3YB 3SK5A 2GA4B 3IL8A 2IT1A 2WAQG 2JA5G 4A3DH 4RHSA 1JR0D 3KLSX 2F0GA 4P74A 4OIJA 3TP7A 4FYDA 2NUCA 1F2ZA 4PZ8A 5IP7H 1B3AA 3ULPA 3A56A 1H9RA 1RODA 2CQOA 3K80C 1YZ6A 5IE8A 1SNDA 4KMUC 4OWTB 3CF5A 4JI6L 4LF4Q 3K0YA 1PH2A 1KLUD 2NVYH 3L3OC 2OT2A 1KRTA 1EFID 2FJ2A 4H7BA 3NUCA 4DV0L 1GHJA 1LT3D 3K5OA 4I65A 1PZJD 1Q82C 2TMPA 1SROA 1YEZA 4NDXA 4DV1Q 3PUVA 3FKIH 4KKSA 2BDOA 1CQVA 1T5XD 4JG2A 1U4MA 3I4NB 4OIKA 5FO9B 3M4QA 1I6HB 1SE2A 1VQEA 3SHLA 4DV6L 5NUCA 1V1QA 2JA6G 4Y7NH 3TREA 3SXHA 2L9HA 3PO3H 2E2JB 3T4AC 5I4DA 4A93H 5C3EG 4A3IB 1EU3A 1IYUA 2IHEA 1LABA 4LF5L 3M4PA 4HJ7A 4A3EG 1UE6A 3QG1A 3HOXG 4DV3L 1XNQL 4KJOA 4A3GH 2CWAA 2WIIB 3DWQA 2QW7A 3HOVB 2KVMA 4DR2Q 2Q2TA 2ASBA 5CV9A 4CKEA 1DGSA 3PIP3 2BDNA 1WYDA 3NBIA 2PI2E 1Y8OB 2F0LA 1GJXA 3SEBA 3HOWG 1QUQB 3GTPH 1YI2A 1W6JA 2F0DA 5CBEE 3RZDH 3DHQA 3V05A 4LF6L 1EEFD 4CDEC 3AEVA 4DFAA 1NAPA 4UY8C 4DV5Q 1G6ZA 2O5IC 2ES2A 2XIWA 1N9WA 2IPKD 1TWHH 1EQTA 4C3JH 3J81E 1Y69U 1TWFH 1T5EA 1BCPF 4JBJA 4X65Q 2RKSA 4PG3A 4ZCKA 4HTHA 1KNAA 3I73A 1PFBA 2RDGA 3BDCA 1EWCA 2K6AA 1DZ1A 4XQQA 3S1MB 4LJZC 4BXXG 1QOHA 2OEOA 1M4VA 4PMWA 3PIPA 5IT9L 4Y52H 5CC4A 1TVXA 5EKIA 5IGCA 3F2UA 2XRQD 3VYSA 2CKZB 2BA1A 4K2KA 1EIYB 2AHOB 3JAMc 3U4ZA 5LL6S 1M90C 3GTGH 1XMOQ 5E4XA 1VQDA 3I4OA 3W3AA 4LWCA 1V1PA 2BA0A 3E9HA 4QIWB 3I70A 4Q5VA 4LUOA 1A62A 1PZID 3ITPA 1G6PA 3G4SA 3EN2A 3GTKB 4NPSA 4A3CH 5C4XH 2VUMG 1Y1VB 2RDFA 2C9OA 2N8NA 4C2MB 1TS5A 2A19A 4DV4Q 2R7DA 4ABNA 2B63H 4EQNA 3R3OA 1PV4A 2K03A 4RWSC 2NVTB 3GD7A 5C0XI 4YWMA 1GOZA 3H3VC 2PPBC 4AYBE 2F4VQ 4MZ9A 5EPLA 1PZKD 1PH7A 2RHSB 2PO4A 1JWUD 1KRSA 3CKIB 2IL8A 3KK7A 1JB7A 2NTTA 1PYWD 4BY1G 1XPOA 3T1YQ 2Q8IB 1AEXA 4BBRH 1KDCA 3GTOH 2AMCB 3H09A 1LO5D 1NNXA 3HGBA 3S2DB 4AQYQ 2JA7G 3KLRA 4FNFA 1JCKB 3QJYA 3NWSA 1WTVA 1ASYA 4K6DA 2ZXOA 1LTAD 1EQVA 2EYHA 2Z8LA 2K28A 2NVQH 2EYLA 4A76A 4TRDA 2PW5A 3HKZE 1SYGA 3CCEA 4OO1H 4IUQA 4YY3Q 2RHQB 2E2HB 4B3TL 4WORA 5HGTA 1VF7A 1YJNA 1C48A 3N52A 5BN3A 1SYBA 1N33Q 1HNWL 1PFNA 1IYVA 3OW2A 2AWOA 4B3SL 1SMYD 1NR4A 4TSSA 1CFMA 2RCFA 3J80c 1XYIA 3A55A 3VA7A 2TSSA 4NP5A 2R92G 1H9MA 1HZ9A 3MEHA 4L6TB 1AW7A 1LT4D 2ID0A 4EQPA 2HDMA 1QJOA 4EGVA 4OO1I 5IGGA 1M1KC 3HG9A 3BZDB 1N32L 4IUUA 5EPJA 4ALPA 1TWCB 1SEBD 4LFBL 4QY7A 1BUVT 4DA2A 1XMQL 4XIGS 2YU9B 1ZXTA 5JEAG 3HOZH 3ZYYX 1WD1A 2RF4A 2N78A 4KKUA 2FFKB 5D3IB 1F9PA 5JJZA 1JJ2A 4DR4L 4DU9A 1XNRL 1FR3A 2M9VA 2QKIC 4P72A 5CV8A 2EJMA 2WP8J 3K6OA 5CV5A 3BVGA 1Q8KA 4JI0L 4J15A 4AYBB 5JEAJ 5ELNA 4GLAC 1TR5A 1PRTF 1CKMA 5J1ZA 3W2DA 1ESRA 3A0JA 3R93A 4X3SA 4HSPA 4M1UB 1GUOA 2YTVA 3M3YH 3K0XA 2I5LX 5KNDA 5C44B 4N9TA 5I2YA 4B3RQ 1EL0A 2V1CC 2R7ZG 2XRSD 4Q0FA 1DJRD 1D2BA 2F0VA 3I4LA 4GNXC 2N49A 1Y1WG 2K7VA 1QB5D 3A8KE 4X64Q 5GAEC 5F2DA 2BE5D 5IY0A 1GUTA 1I4PA 4XXEA 3PUYA 2LKVA 5C4JB 3DM1A 4ZUJA 3P20A 3GTQB 1HNXL 1PTOD 4K5WA 1X55A 4A3MB 5C4ZA 4DR6Q 2MQHA 1PFSA 4K14A 5IP9G 3H0GG 2DUDA 4DPGA 4R4CA 2OQKA 2ZJRA 2P5ZX 1EIHA 2RDHA 5ELEA 1VQ7A 1BBUA 2GVBA 3GTLB 3KBGA 4DK6C 5HY6A 3I7FA 3X3MA 3HRZC 5IGFA 1H9JA 5M3FG 2K52A 1KAWA 1N36Q 4F7XA 1MJEA 2KCMA 5IYBG 3C2PA 1U5KA 1G291 3I4NH 3UI2A 2AKWB 1J9OA 3PF4A 1HUMA 2Z6KC 1O7IA 1JC7A 5CMDA 4JVZA 4HMIA 4KD4A 1SFOH 5JOBA 3J81j 2F0PA 4DNIA 1LTRD 4XTCS 1BBWA 4J6HA 1R9TB 2E2JH 2MP1A 4JI8L 1B9MA 4KV6A 4LF9Q 4A3IH 3GTMB 3M4YA 3S17B 1KABA 4RGMA 1S5CD 2KCCA 1I4QA 1A0IA 4IOAA 3HZXA 4MNOA 2E76C 4MTKA 4XT3B 2UXDL 2EYOA 3RR5A 1FGBD 4IJHA 5T1GA 3KF8B 3U4VA 3HOVH 3EQLC 5IGDA 2FHTA 1JJCB 2CH4A 2R93G 1B7YB 2MHVA 1XPUA 4OHJA 3C3LA 4IUNA 3GDEA 1QZHA 1E7ZA 2KCNA 4C3IB 1TT2A 3PQIA 5I6YA 1OTCA 4R4TA 3K57A 4OWWB 5M9OA 4JI4Q 2K4KA 3K58A 4G57A 5E1FA 3SGIA 2B8GA 1XWEA 1L2FA 4ZRZA 5FJ8H 1B9NA 2F1MA 2JA9A 4BBSB 5IP7G 2PMZE 1VMCA 1SMXA 2BE5C 4K5XA 1C0AA 3ERSX 5EBDA 1IBKL 1CQFA 1IYJB 3ZJYC 1EYCA 2BH8A 3SDZA 2OXPA 3CCQA 3RZOB 3I72A 1ET6A 3NBHA 1Z47A 1PTOC 4UPAA 3R2IA 3BDLA 1GD7A 4JI1Q 4ZKCB 3MAQA 1MSHA 5ELFA 3E5SA 4BS9A 1CKNB 3JAME 1VQMA 1B53A 1VQAA 4JI7Q 3FPPA 5IYCH 1X54A 5C6AA 2EVBA 1H95A 4HIOA 1B44D 5EPKA 1VCIA 2K04A 2ZJPA 2G9HD 3HKZG 1VQ6A 4QQBX 3FKIG 3P7JA 4U673 4LF4L 4R9WA 5E3FA 1RDPD 4R8IA 2JA5B 2WAQB 1HTPA 1S40A 3H3VH 1F2YA 3S15B 1QZGA 1ILQA 1RCVD 1UE5A 2CW0D 3S1NB 1NTGA 1BNZA 5FLXc 3T1HQ 4PZ6A 1HQRD 3B6YA 1G91A 4DV1L 5E4WC 2B2WC 2OQ0A 2AQ2B 4HAEA 4A3GG 1DOLA 2HHHQ 3QOLA 1H9SA 4N8FA 1RTOA 1PHJA 1DYQA 3K5NA 2IY5B 1TS4A 3H3VI 4DF7A 2OWOA 2PZUA 2CWPA 3CMEA 1BF4A 2UU9Q 3K7AB 1B2TA 5I6WA 2L55A 3S2DH 1FL0A 2XN9C 4E6IA 3JAMi 2IX3A 2Q2UA 2WB1G 4DV7L 4FF3A 4X66Q 4JC0A 2F0HA 3UE0A 4DNRB 3DXJC 3HS0C 2UUAQ 2JA6B 1UE1A 3BZCA 2JYOA 1MD2D 2E2IB 3KLSA 1LTTD 2K5VA 2CCZA 1ML0D 3CP0A 4OELB 1AP0A 1AFPA 1VQIA 3L2PA 3EROA 1Q46A 4QUCA 1BDOA 2B2UC 4DGZA 4A3JG 4HJ5A 1PDQA 4A3EB 3RN5A 4DR5Q 3HOXB 2XTIA 1PH5A 3NELA 3O13A 2KA7A 1KQSA 4ME5A 2CH4W 1ENFA 3J80E 2F52A 1CHQD 1U4RA 1ILPA 1U0LA 4QCLA 5ELCA 1LTGD 3I91A 3CU7A 1SN8A 4JW0A 4NXMQ 1P16A 2B2TA 3ICEA 3D3RA 4KTAA 1OXSC 2VQEQ 2QEJC 3HOWB 1G2TA 4DR7L 4IALA 1WTHA 2R6GA 4QL5A 5J22A 4C3HH 2OTLA 2KCTA 4A3CG 3S2HB 2KHSA 2CW0C 1SSOA 1JJGA 1BR9A 1EY9A 4G7ZC 1TWCH 1DONA 2YU9H 2X69A 1WTOA 1HUNA 1XMOL 3T56B 5G3LF 1L0WA 1BVSA 3KFUA 4JI3Q 2J0TD 2F0MA 2BH2A 1IBMQ 4DV2Q 1SYFA 1YHBA 2IX0A 2PNHA 1L0XB 1QUQA 3T16A 3TSSA 4JI2L 5LMNQ 4GZYC 1Q3LA 2DN8A 5JPMC 1S4ZA 4A3LH 1II3A 2NWGA 4CKCA 5I2XA 2C5CA 3G71A 2E2DC 3DWPA 4DV4L 2D62A 4GOPB 3P75A 1Z7TA 3FHWA 4XDXA 1NBWA 2KHIA 1X3PA 2F4VL 3QWNA 3J80i 2K75A 3PF5A 2JEBI 3I8ZA 4BY7H 1XJVA 1TS3A 1CHPD 2VUMB 1UUPA 1WCMH 3T13A 2H1EA 1G8ZD 5C4HA 4GOPC 3T1YL 3EIVA 4MTNA 1CA6A 1H9KA 1D6EC 5C44H 1I94Q 3CW2C 1ICWA 3SVMA 2K50A 2A6ED 1PFMA 5KRUA 3VR3A 4WJ3M 4NMZA 4AQYL 1YBYA 1RIPA 4MIUA 4NB3A 5A2QL 2I46A 3HOYB 2B2VC 1L1OB 2FXQA 1XPRA 1Z6HA 4A4IA 4RGTA 2ZM6Q 3R8BA 5C4JH 3OMGA 3GTQH 1D5ZC 5J39A 4YHHL 4BY1B 1Q90A 1MHWC 2NVXB 4GKJQ 1HNZL 1KXLA 1S5DD 3KF6B 4IJLA 1AE2A 1KIXA 1J6QA 4POFA 3UE1A 4R1JA 2E8GA 1OXTA 4EQOA 2WFWA 4YY3L 2JA7B 4G4KA 1L1OC 3AYHB 4GS3A 4F8MA 2VY3A 3GTLH 1I3QB 5I9PA 1GVPA 2IX1A 4GLXA 2F0EA 4PMCA 4RFBA 1N33L 3I56A 1A8VA 3G7LA 5KIXA 2GN5A 2HQEA 1KAAA 2VB2X 4JBKA 5LL6X 4RCNA 4EX5A 5KGUA 4X3UA 3I4MG 1E22A 1IW7D 4P2CB 2UXBQ 3NEMA 1K73C 2K33A 1GUWA 4HJAA 1EEID 1HPCA 1U4PA 4JOIA 4DN4M 3L9AX 1HXYD 4JV5Q 2D5DA 1HR0L 4KI0A 1F2LA 3NTHA 2C35B 4FXGC 4ULLA 1ESFA 1PRTD 1NR2A 1I4XA 4GLVB 2R92B 3OIPA 1EIGA 1EQRA 3S9WA 3P1HA 5GROA 5C0XH 3BJUA 1STGA 3Q24A 1YIJA 3Q22A 1SJHD 2Q2IA 4KJNA 4X62Q 3PO2G 1STHA 4BWGB 1Q1EA 2Z1CA 3TRZA 1ZKOA 3KUPA 5LMUQ 1VQ8A 4LFCQ 4BBSH 5M5XB 5A35A 1O7LA 1HHVA 1QE6A 1X56A 3BVZA 4NW2A 2EYMA 1MKHA 5M3MB 4POGA 2MGSA 1ZYRD 2MJ8A 1TXYA 1NY4A 3CCJA 3RZOH 3K81C 3PCOB 2VW9A 1NMFA 1TWGB 4IFDG 1N8RC 3CRKC 3PUZA 3MEFA 1G51A 2QEXA 1JE5A 3UDXA 1PH3A 1C4QA 2DY8A 4HCSA 3JAML 3SK4A 4RA8A 1EZ8A 4HCEA 3EFXD 3J81i 2L1BA 1DCZA 1GKHA 5GADC 4QF4A 5K36G 4IOCA 3CCMA 4JI6Q 1UNSA 3QO2A 3RLOA 5FKAC 5IWAL 1IXRA 1TWAB 2HD3A 1DD2A 4KY7A 4DR6L 4FXDA 2R7ZB 4IFDJ 4A3KB 1BKBA 1Y1WB 5FLXE 1QG7A 1R4PB 2HUGA 3MXPA 3FRPB 1NCVA 1JOOA 4DV0Q 4RH6A 1LTSD 2KBNA 3S1NH 3FDTA 2Y0SE 2Q2HA 4OEMB 1EFWA 4JBMA 4PNYA 1I6VC 2K01A 2DJGC 2EYFA 1EWHA 2K5QA 4HIDA 2F4IA 2XSCA 3H0GB 1B8AA 2A6HD 2JQOA 1U9RA 4K0KQ 2EQSA 2V4DA 1WTQA 5DAUA 1PMRA 1JORA 4JYAQ 1X3QA 4NXNL 5BR8L 3HKSA 3K7AH 3STBD 1PH9A 3AFQA 4DXFA 5M3FB 2F0FA 1X6OA 3KDFA 2BOSA 4CBVA 5CYUA 5CV6A 5FJ8G 2WKCA 3JC66 1IBLQ 4ZAIA 1PYSB 1AE3A 5EKKA 2PYKA 4Z9CB 1EIFA 3MVVA 4DK3C 5HGQA 1A2TA 4DR1L 4H44C 2JA6H 4DAVA 2E75C 4LFAL 1ZYRC 3DM3A 3GTJB 1OXVA 2OTJA 3A7AB 3M4OB 1JT8A 2F03A 2RBMA 1V1OA 2K5NA 1YNJD 2F0QA 3HOUG 3K5MA 4A3EH 1PH8A 1SYCA 4LF6Q 2YYZA 5EBCA 2WV6D 3HOXH 2G9DA 1FJGL 1WVLA 2R3ZA 1QILA 3WOFA 1B70B 3M7NA 1TIID 3J7A5 2R61A 1A3TA 2WB1E 5KEEA 4X6AH 2Z0SA 2R93B 3HFZB 4ZKBB 3J80L 1PYBA 2A68D 5JPNC 3MTSA 2L15A 3HOWH 1G2SA 1KTKA 1F9RA 5LMNW 3IKJA 4FP5D 1EY4A 1MGSA 3Q8DA 1C9OA 4GNXB 1I50B 4O2DA 1EU4A 1SLJA 3E9IA 4DK1A 3S2HH 4JI7L 1D8LA 1STYA 3KOJA 1ENCA 3OWFA 4XYQA 3J7ZC 1HFNA 1HH2P 5FK9C 2VNUD 1NSNS 4DAYA 2A73B 1ASZA 3SK6A 3CD6A 3SR1A 4CDDC 4IUVA 1O78A 2VB3X 3E3XA 1O80A 4QGUA 2Z9HA 4BXXH 2A6HC 2ENBA 1A63A 4BA2I 1JWMD 4IN3A 1X65A 1V8QA 2EY1A 1E24A 3M85A 4DUZQ 1STBA 1V43A 1NMGA 2Q8RE 3AB9A 3STBC 3PUXA 2JP1A 1SNOA 3HKZB 1SMYC 3FKIB 3GV6A 4OWXB 4YWKA 4CGYB 4B3ML 3NWTA 1XTCD 3QOJA 4DNTB 3Q0AA 3ND9A 1TU2B 3VR5A 5JAVA 2HHHL 1HA5A 2LMCB 2NN6G 4O1NA 3I3CA 2IHFA 2JA8B 1JOKA 2L5TA 3MFYA 3CPWA 4OX9Q 2VUMH 3A8IE 1YNND 4HJ9A 2OF1A 1GXDC 2E74C 4QJFA 1CKNA 1YNJC 4A3BG 1SNQA 1CSPA 3TS0A 2J7ZA 2L4NA 2DJFC 3A74A 4GKKQ 1I6HH 3HOYH 1E1OA 2NBFA 3MZ5A 4KN4C 3TBIB 4X66L 3F2CA 1SAPA 2IJ0A 4A3FG 3OHXC 2MFIA 3G6EA 3RD4A 1J5EL 2XWJB 3LWEA 1CKOA 2DGYA 3EBEA 2A68C 2CFMA 2F0TA 4KHPL 1E0BA 1I5FA 1STNA 5COYA 3MC0B 3A5UA 1KHIA 3RZDB 4DUYQ 4JI5L 4DR5L 2NZHA 1SJED 4C3HG 2JA7H 1EY8A 2WB1B 4KHZA 1VQFA 5FOBB 3DWAA 2QGQA 2RSOA 1I3QH 1GM5A 1PVOA 3D31A 5G3LD 1Q81C 2D0PA 2L12A 2YTXA 2O2LD 3K59A 5IIFA 1CTMA 1RTNA 5M5YB 3TP6A 3S16B 4A3DG 1Q7YC 1PTOB 3OTOL 3CCSA 4A3JB 2A8VA 3OSOA 1QVFA 4A75A 4ZUIA 2SOBA 2B2YA 4I7AA 4ZYSA 1SRUA 1BO0A 3MA2B 4DR3L 5C3XA 1WI5A 1N32Q 2HIXA 3MXNB 1LTLA 3J81L 4LFBQ 1XMQQ 1LTID 2AQ1B 4FF4A 2RCNA 4DKAC 4KHVA 4LUZA 2QF7A 1OXXK 2M00A 3G48A 3N6RA 3S1MH 4JI3L 1EYDA 3V2TA 1FNWA 2HQLA 1CK1A 2Y0SG 4BY7G 3MXUA 1ZEQX 2EOTA 5ELOA 1DOMA 2EXDA 4DR4Q 1YNNC 2EDGA 4KY6A 1WCMG 4CKBA 2PQAA 3E0EA 4FF1A 2EJGC 1F9QA 4UP8A 4APVA 5IGBA 4MHEA 2O5JC 4PZ7A 3PSIA 5M5XH 4KY5A 3F2BA 2RA4A 1A3UA 2ICIA 5KYIA 3GTKH 2F3VA 5M3MH 4LNQA 1F2MA 1S5BD 1Y1VH 2EIFA 2B8FA 2GVAA 3PO3G 4OL7A 2L0CA 4C2MH 4M8AA 4A93G 2B29A 2JN4A 1PA6A 4RG1A 2SNMA 5C5LA 1MSGA 3IAYA 1ET9A 4B08A 3WOEA 4UP7A 2NVTH 2KOLA 1A2UA 1TY2A 1X9NA 3HEJA 2PCFB 1TKWB 1N34Q 3VR2A 4H0LC 4TQUS 2K5HA 2IW3A 2ZJQA 4TKOB 5CBAE 1HQMC 1CT1D 1YITA 2ZM6L 4ZLTF 1EY0A 1X3EA 2UUCQ 2E5LQ 3AU7A 1TWAH 1UEAB 4GKJL 2QA4A 1ONLA 2LY7A 3FVQA 1QVGA 2R7ZH 4WRDA 4A3KH 3MXGA 1Y1WH 1HTLD 2KENA 5GQOA 1STEA 4HSVA 1SR3A 3M9BA 5FLXL 1BCPD 4QB4A 4DR2L 2FMCA 4MN3A 1K0RA 3PMFA 4HN7A 3BS1A 4XQJA 4YIJA 1SNCA 4C3JG 1JQYD 1CZGA 3DLLA 2JK8A 4P71A 1B1ZA 2F3WA 5C3EB 1R4QB 1IKMA 1O7ZA 4CDCC 3KJPA 3HP3A 5M5WB 1HZBA 4B9WA 2VQFQ 2E2HH 5IP9H 3TN2A 3H0GH 1QCBD 2PMZB 3E6ZX 4CJ2C 4UHVA 2NB0A 4DV5L 1I4GA 4FO2A 5C0XG 4JPBW 5GAHC 3CCLA 1YJ9A 3D8GA 2ZTEA 1KLGD 1E2ZA 2H4OA 4X65L 3PV0A 2K1BA 2HIVA 3I90A 4JV5L 5IYBH 1K28A 2N3SA 2UXDQ 3KBXA 3WWVA 2F0OA 4BBSG 3TZUA 4L5SA 3F1ZA 3TDQA 2FMMA 1Y8NB 2F0JA 1HR0W 1HA6A 4N8X1 2YV5A 3GTOB 5C4XG 5K5PA 4GN5A 3KYHC 1QWYA 3SE0A 3GTJH 3I4MB 4EQ5A 2F0SA 3NK9A 3M4OH 2A1AA 1WTXA 3S1QB 1VQGA 5C0XJ 4DAMA 1KDBA 2B63G 1IHZA 2I0QA 5AJ3Q 5IOCA 3J7YW 1U4LA 2N55A 2XGTA 3TS2A 2EYJA 3CRLC 4LFCL 3CXCA 3L0OA 4G7HC 1NUCA 2RVLA 2B39A 2WKDA 1KDAA 1SE4A 4HMJA 1GO3E 1UWVA 4OXPA 1S72A 1IBKQ 2R93H 1BCPB 4S3SA 1KC8C 1B50A 4DAPA 3S1RB 1LYLA 2ZTDA 2RSNA 4BBRG 1LUZA 1E1TA 1QNKA 1H9SB 3PO2B 1VDZA 2EZVA 3AQQA 2KEDA 4XT1B 1W2BA 5L37A 1SNPA 1SYDA 3D4WA 1I4HA 1I50H 5CV7A 2HCCA 3NTKA 1E3PA 3ER0A 2AUJD 1BCPC 1F9SA 4LF8Q 4ID6A 5JJKA 3LNNA 5ELBA 3CC2A 3UDIA 1ICFB 1D1IA 1Q8IA 3D4DA 3VYTA 4N9PA 4OO1G 5AFWA 4LK1C 1B4OA 4QIWE 2EJFC 4JCVE 1I4RA 3C1FA 4XYOA 3NTIA 3ULJA 1WJJA 1HFGA 4L5TA 1JWSD 3E0JA 3D4RA 5EJWA 1D5MC 4RMFA 4UAIA 2I5MX 2CVRA 2O4XA 4IZ8A 3K5LA 2M2LA 4A3MH 4FVMA 1ENAA 4J8QA 2Z6BA 2Z4IA 1GUNA 3A5ZB 1OXUA 1EOTA 1SFOB 4PQXA 3VR4A 2JA8H 3GO5A 2JXMB 1B3QA 1BXTA 2ZTCA 4K0KL 5BN4A 2VXWA 4IURA 3IFTA 2VZAA 2LXKA 1EY7A 4R4IA 4FF2A 4JYAL 1WFQA 2DNEA 5H1SE 3T51B 2DNCA 3NSWA 2LFNA 4WJ4A 1NE3A 3RN2A 1TQOA 1IBLL 5IODA 4HIKA 3HOZG 2B2TC 4DV7Q 3NQIA 1EY6A 3J7AV 2J4XA 4L63B 1STAA 4JK1C 1JOQA 1TY0A 5D3DA 1R9TH 2A5HA 2UXCQ 3GTMH 5JJIA 4I7ZC 4WJWA 5IT9c 3S17H 5J3BA 1SNMA 4LF7Q 1EOVA 4J1MA 2PZTA 3NHHA 1EZ6A 1T9HA 2PI2A 5CR3A 2KJXA 3DEPA 1VS0A 5ELDA 2UUBQ 4RKBA 4QUFA 3H91A 4YWLA 1DOKA 3URYA 3DMUA 4C3IH 1K9MC 5D65A 1S5ED 3CMAA 1CA5A 2YTYA 5M5YH 3S16H 4DR7Q 1PTOH 3HOUB 5C5MA 4A3JH 2B3GA 4CHTB 2A6EC 4U68A 2MPMA 3TP5A 2G5DA 3GQBA 3BDOA 1AZQA 3K7UC 3TZDA 3D6CA 1WTPA 4FXKC 3TMEA 1GHKA 3U9OA 3F2DA 5JVH3 1EY5A 5FLMH 2MO0A 1X3FA 4B3RL 2L11A 1HJPA 2XVSA 1CM9A 3OIQA 1OO9B 2NZOA 1GUSA 1FNUA 4ODGA 4L5QA 4H13C 4JI2Q 4X64L 3CC7A 1AZPA 1VQOA 4R8NA 5IYDH 5D14A 4OONA 1PH1A 4DUZL 1E2WA 2JJQA 5DLQE 1VQKA 4O0AA 1KNEA 1Q12A 3I4NG 2JA5H 2N88A 3VR6A 1DM0B 2IWHA 1L0YB 3S15H 1CUKA 2KHJA 5DEHA 3J7AF 2MO1A 1PRTB 3HOYG 3CQZB 4OX9L 1QNUA 1IW7C 3A7LA 4K6LA 4HR7B 2QILA 4A3IG 4GN3B 1VQLA 3BG3A 4GNXA 2NTSA 3W1BA 1N36L 3EVQA 1MJCA 3OYYA 3MWYW 3H6MA 3CHBD 5DM73 5CV4A 5EAYA 4ZQ3A 1PRTC 5JJLA 2D2CC 4GKKL 3DUZA 3HOVG 4DV6Q 1D1KA 1A6XA 2F0WA 4IPGA 3CPFA 1K83B 1LV9A 2OCEA 4HIMA 5EKLA 5HURA 3R2TA 3OWEB 4YHHQ 3RNUA 1XX8A 3VDYA 2HCIA 4LF9L 3NE5B 5EGTA 4LF5Q 3I2ZA 1EQQA 4RAUC 1HNZQ 4IQZA 5KNCA 2BCOA 5CGKA 4DV3Q 4A3BB 4LMQD 1XNQQ 5JVG3 4JOIC 4DXGA 4DUYL 2ZXRA 1WOCA 3RUZA 1RD9D 4QMGA 1K8MA 1Y14B 1BBXC 2JEAI 1V1PB 4R4OA 4GN4B 2A74C 1HRJA 1X3GA 4YCWA 3QB3A 3NPPA 2E2IH 4A3FB 2VL6A 5T1IA 2Z6KA 4IPHA 3UDFA 5C3EH 4JI4L 3EA6A 5M5WH 1FYCA 1VQ9A 4KK7A 4LAAA 4KLKA 4HEDA 5I9OA 2RQXA 1A15A 2LSSA 4C3HB 1FVIA 4UP9A 3PIO3 1YHQA 1SE8A 3G6JB 2QDLA 5IYCG 1BOSA 5KYLA 1VQ5A 1LM0A 2EXZA 4K5VA 1HR0Q 1VF5C 1C8CA 1PH6A 3VYRA 3S14B 1V9PA 4A3DB 3C1EA 4JI1L 5FO8B 1DXMA 2CQAA 2MUYA 3LWUA 4RKLA 4EVOA 5M3MG 1LT5D 4AIMA 4PV1C 1IL2A 1Y1VG 5ISRA 4L5RC 3I4MH 3FP9A 1A3VA 3GV3A 3NQTA 1GUGA 3S1QH 4WFN3 4TVAB 3U50C 5BN5A 1W6KA 3ULLA 3KF8A 4OGQC 4ILWA 1SBBB 1VQ4A 3FEWX 2NVYB 2A69D 2Z4HA 2D0OA 5TSSA 5DNFA 3PIOA 4V0BA 4RCOA 1C7YA 1EYAA 1PLFA 2XWBB 1KD1C 1BQQT 2Y0SB 4BY7B 2EYPA 2ALYB 3S1RH 2QDBA 1WCMB 3T1HL 4BA1I 3PO2H 3OW7A 2EY2A 4K8IA 4IUPA 1YVCA 2LXJA 4LUVA 1EUJA 4A3KG 1CZWA 4X3TA 3MXNA 1AH9A 5A2QE 1N34L 1K8AC 3KDFB 4C1NI 1VMPA 2DY7A 1UEBA 4Y7NB 3AFPA 2QCPX 3W5OA 4KD3A 3PO3B 2CHBD 1K8OA 5IWAQ 3U9SA 3VYUA 4A93B 2X6GA 2UUCL 2E5LL 2UU9L 4IFDH 3BYYB 1IZ6A 3RLNA 1J8IA 3I55A 2WAQE 4A3GB 1FGUA 3AMUA 1JB3A 3C46A 1K3RA 1HCZA 3TP8A 1LACA 4DK0A 4KN7C 2UUAL 2B2WA 3ONAB 1D5XC 1O7YA 4V190 3RMHA 1E2VA 4BY1H 5K36H 1HZCA 4IPDA 1Y8PB 1JE4A 2ZT9C 2NVXH 3GTPB 3WDNA 4B3TQ 2VQFL 1IKLA 3MHBA 5EQ0A 5CORA 4R4QA 4FDBA 2KQ3A 4XQNA 4IFDI 1SYEA 4C56C 1TWHB 2PW7A 5BR8Q 4NXNQ 1HNWQ 1WTRA 2F3IA 4C3JB 1TWFB 4B3SQ 4RHRA 4NXML 3H15A 5DM63 2VQEL 1M8AA 1AN8A 4F88A 2A69C 3J81c 1D7QA 4IUTA 3BU2A 1FD7D 1JMCA 1VQHA 4IO9A 1RL2A 5GAGC 4DR1Q 4DAYB 5IT9E 2K5DA 4LFAQ 1MI2A 3GP7A 3TQYA 3CCUA 4A3LG 2B2UA 1VQPA 2I07B 3PUWA 1Q86C 4P73A 3GTGB 3CCVA 2F0IA 2KECA 1WD0A 4AYBG 5AJ3L 2PZWA 1FJGQ 5KNBA 2SEBD 3V96A 2WACA 2R92H 1IBML 4DV2L 5C4XB 5IGEA 1RF2D 3ND8A 5LMNL 3OOCA 1RKNA 1SDFA 4G7OC 1XNRQ 4ZK9B 1K3BC 3RLFA 2B63B 1RJTA 5C44G 3HOUH 4JI0Q 3F8TA 4NKLA 3BVMA 5JEAH 1K8GA 2HT1A 4F87A 2MNAA 2NYZD 4L8JA 2FINB 1KL9A 3MFGA 2EY5A 3FPUB 3QIAA 1YHAA 3DEOA 4LF8L 1K0SA 1SXTA 2H5XA 1PH4A 1W3SA 1UE7A 1TWGH 4A3MG 4BBRB 1IL8A 2VS1A
chains in the Genus database with same CATH topology
1XXGA 3D6WA 1LLRD 2ICEC 4KKTA 1F77A 4RGOS 2D9UA 3FMCA 3EJIA 2F0UA 3Q6SA 2NVQB 1SE3A 2WINB 1TS2A 3OMCA 1Q1BA 4C1NK 4B9XA 1S5FD 1FNVA 4JBWA 1UAPA 2F0KA 3A54A 3T53B 2NZ1D 3X3NA 2Q8TA 5FO7B 2KUMA 2K05A 3IFDA 2X6LA 3L7ZC 2B2VA 2PNRC 2ZXPA 3NP8A 1CI3M 1PTOF 2HDLA 2NN6H 3BYTB 4C3IG 1MBYA 2KEEA 2B2YC 4O42A 2EPBA 2XNAC 3A8JE 3H94A 4K2LA 5C3WA 1RHPA 2AWNA 4UDUC 2AQ3B 4CJ1B 3HOZB 2AUKA 4PMBA 3M7GA 1X32A 2EE1A 1LT6D 2SDFA 2F0NA 3SK8A 3OPOA 3ERQA 1WTWA 2K5WA 2LS01 2NN6I 2EY6A 4K8JA 3LX0A 3VA5A 3NXWA 4CJ0B 2PQEA 1JICA 2JSOA 1LTBD 3Q23A 4X3KA 4RGNA 5LHY1 2JE6I 2SNSA 2K32A 1PXUA 3M3YB 3SK5A 2GA4B 3IL8A 2IT1A 4RHSA 1JR0D 3KLSX 2F0GA 4OIJA 3TP7A 4FYDA 2NUCA 1F2ZA 1B3AA 3A56A 1H9RA 1RODA 1SNDA 4KMUC 3K0YA 1KLUD 3L3OC 2OT2A 1EFID 2FJ2A 4H7BA 3NUCA 1GHJA 1LT3D 3K5OA 4I65A 1PZJD 2TMPA 4NDXA 3PUVA 4KKSA 2BDOA 1CQVA 1T5XD 1U4MA 3I4NB 4OIKA 5FO9B 1I6HB 1SE2A 3SHLA 5NUCA 3SXHA 2L9HA 2E2JB 3T4AC 5I4DA 4A3IB 1EU3A 1IYUA 1LABA 3QG1A 4KJOA 2WIIB 3DWQA 3HOVB 2KVMA 5CV9A 4CKEA 3PIP3 2BDNA 3NBIA 1Y8OB 2F0LA 1GJXA 3SEBA 1W6JA 2F0DA 5CBEE 3DHQA 3V05A 1EEFD 4DFAA 1NAPA 1G6ZA 2O5IC 2XIWA 2IPKD 1EQTA 3J81E 1Y69U 1T5EA 1BCPF 2RKSA 4HTHA 1KNAA 3I73A 1PFBA 2RDGA 3BDCA 1EWCA 2K6AA 1DZ1A 4XQQA 3S1MB 4LJZC 1QOHA 2OEOA 1M4VA 4PMWA 5IT9L 5CC4A 1TVXA 5EKIA 5IGCA 3F2UA 2XRQD 3VYSA 2BA1A 4K2KA 5LL6S 5E4XA 3W3AA 4QIWB 1V1PA 2BA0A 3I70A 4Q5VA 3ITPA 1PZID 3GTKB 1Y1VB 2RDFA 2C9OA 4C2MB 1TS5A 4ABNA 4EQNA 3R3OA 2K03A 4RWSC 2NVTB 3GD7A 5C0XI 1GOZA 3H3VC 2PPBC 5EPLA 1PZKD 2PO4A 1JWUD 3CKIB 2IL8A 3KK7A 2NTTA 1PYWD 2Q8IB 1AEXA 1KDCA 3H09A 1LO5D 3HGBA 3S2DB 3KLRA 4FNFA 1JCKB 3QJYA 3NWSA 1WTVA 4K6DA 2ZXOA 1LTAD 1EQVA 2EYHA 2K28A 2Z8LA 2EYLA 4TRDA 2PW5A 1SYGA 4OO1H 4IUQA 2E2HB 4WORA 5HGTA 1VF7A 1C48A 3N52A 5BN3A 1SYBA 1PFNA 1IYVA 2AWOA 1SMYD 1NR4A 4TSSA 1CFMA 1XYIA 3A55A 3VA7A 2TSSA 4NP5A 1H9MA 3MEHA 4L6TB 1AW7A 1LT4D 2ID0A 4EQPA 2HDMA 1QJOA 4EGVA 4OO1I 5IGGA 3HG9A 3BZDB 4IUUA 5EPJA 1TWCB 1SEBD 1BUVT 4DA2A 2YU9B 4XIGS 1ZXTA 5JEAG 3ZYYX 1WD1A 4KKUA 2FFKB 5D3IB 1F9PA 5JJZA 4DU9A 1FR3A 2M9VA 2QKIC 5CV8A 2EJMA 2WP8J 3K6OA 5CV5A 3BVGA 4AYBB 5JEAJ 1TR5A 1PRTF 5J1ZA 3W2DA 1ESRA 3R93A 4X3SA 4HSPA 4M1UB 1GUOA 5KNDA 5C44B 4N9TA 5I2YA 1EL0A 2XRSD 4Q0FA 1DJRD 1D2BA 2F0VA 3I4LA 2K7VA 1QB5D 3A8KE 5F2DA 2BE5D 1GUTA 1I4PA 4XXEA 3PUYA 2LKVA 5C4JB 3DM1A 4ZUJA 3P20A 3GTQB 1PTOD 4K5WA 4A3MB 5C4ZA 4K14A 1EIHA 2RDHA 5ELEA 3GTLB 3KBGA 3X3MA 3HRZC 5IGFA 1H9JA 4F7XA 3C2PA 1G291 3UI2A 1J9OA 1HUMA 5CMDA 1JC7A 4HMIA 4KD4A 5JOBA 2F0PA 1LTRD 4XTCS 4J6HA 1R9TB 2MP1A 1B9MA 4KV6A 3GTMB 3M4YA 3S17B 1KABA 4RGMA 1S5CD 2KCCA 1I4QA 3HZXA 2E76C 4XT3B 2EYOA 1FGBD 5T1GA 3EQLC 5IGDA 2FHTA 2MHVA 4OHJA 3C3LA 4IUNA 2KCNA 4C3IB 1TT2A 5I6YA 3K57A 5M9OA 3K58A 4G57A 5E1FA 2B8GA 1XWEA 4ZRZA 1B9NA 2F1MA 4BBSB 1VMCA 2BE5C 4K5XA 5EBDA 1CQFA 1EYCA 3SDZA 2OXPA 3RZOB 3I72A 1ET6A 3NBHA 1Z47A 1PTOC 3R2IA 3BDLA 4ZKCB 3MAQA 1MSHA 5ELFA 3E5SA 4BS9A 3JAME 1B53A 3FPPA 5C6AA 2EVBA 1B44D 5EPKA 1VCIA 2K04A 2G9HD 3P7JA 4U673 4R9WA 5E3FA 1RDPD 4R8IA 2JA5B 2WAQB 1HTPA 1F2YA 3S15B 1ILQA 1RCVD 2CW0D 3S1NB 1BNZA 1HQRD 1G91A 5E4WC 2B2WC 2AQ2B 4HAEA 1DOLA 3QOLA 1H9SA 1RTOA 1DYQA 3K5NA 1TS4A 4DF7A 2PZUA 1BF4A 1B2TA 3K7AB 5I6WA 2L55A 2XN9C 4E6IA 2IX3A 4FF3A 2F0HA 4DNRB 3DXJC 3HS0C 2JA6B 2JYOA 1MD2D 2E2IB 3KLSA 1LTTD 1ML0D 1AP0A 1AFPA 3EROA 4QUCA 4DGZA 1BDOA 2B2UC 4A3EB 1PDQA 3HOXB 3O13A 2KA7A 4ME5A 1ENFA 3J80E 1CHQD 1U4RA 1ILPA 4QCLA 5ELCA 1LTGD 3I91A 3CU7A 2B2TA 3D3RA 4KTAA 1OXSC 2QEJC 3HOWB 1G2TA 4IALA 2R6GA 5J22A 3S2HB 2KHSA 2CW0C 1SSOA 1BR9A 1EY9A 4G7ZC 1DONA 2X69A 1WTOA 1HUNA 3T56B 5G3LF 2J0TD 2F0MA 1SYFA 2IX0A 3TSSA 3T16A 1L0XB 4GZYC 1Q3LA 2DN8A 5JPMC 1S4ZA 1II3A 2NWGA 4CKCA 5I2XA 2C5CA 2E2DC 3DWPA 2D62A 3P75A 1Z7TA 4XDXA 1X3PA 3QWNA 2JEBI 3I8ZA 1TS3A 1CHPD 2VUMB 1UUPA 3T13A 2H1EA 1G8ZD 5C4HA 1CA6A 1H9KA 1D6EC 1ICWA 3SVMA 2A6ED 1PFMA 5KRUA 3VR3A 4NMZA 4MIUA 5A2QL 2I46A 3HOYB 2B2VC 1Z6HA 4RGTA 3R8BA 3OMGA 1D5ZC 5J39A 4BY1B 1Q90A 2NVXB 1S5DD 1OXTA 4EQOA 2JA7B 4G4KA 4F8MA 1I3QB 5I9PA 2IX1A 2F0EA 4PMCA 4RFBA 3G7LA 5KIXA 2HQEA 1KAAA 2VB2X 5LL6X 4RCNA 5KGUA 4X3UA 1IW7D 4P2CB 2K33A 1GUWA 1EEID 1HPCA 1U4PA 4DN4M 3L9AX 1HXYD 2D5DA 4KI0A 1F2LA 3NTHA 4FXGC 4ULLA 1ESFA 1PRTD 1NR2A 1I4XA 2R92B 3OIPA 1EIGA 3S9WA 3P1HA 5C0XH 1STGA 3Q24A 3Q22A 1SJHD 4KJNA 1STHA 4BWGB 1Q1EA 2Z1CA 1ZKOA 3KUPA 5M5XB 5A35A 1O7LA 1HHVA 1QE6A 3BVZA 4NW2A 2EYMA 5M3MB 2MGSA 1ZYRD 2MJ8A 1TWGB 4IFDG 3CRKC 3PUZA 1C4QA 2DY8A 4HCSA 3JAML 3SK4A 1EZ8A 4HCEA 3EFXD 2L1BA 1DCZA 4QF4A 5K36G 1UNSA 3QO2A 5FKAC 1TWAB 1DD2A 4KY7A 4FXDA 2R7ZB 4IFDJ 4A3KB 1Y1WB 5FLXE 1QG7A 1R4PB 2HUGA 3FRPB 3MXPA 1NCVA 1JOOA 4RH6A 1LTSD 3FDTA 4PNYA 1I6VC 2K01A 2EYFA 1EWHA 2K5QA 2F4IA 2XSCA 3H0GB 2A6HD 1U9RA 2V4DA 1WTQA 5DAUA 1PMRA 1JORA 1X3QA 4DXFA 5M3FB 2F0FA 2BOSA 4CBVA 5CYUA 5CV6A 2WKCA 4ZAIA 5EKKA 2PYKA 4Z9CB 3MVVA 1A2TA 4H44C 4DAVA 2E75C 1ZYRC 3GTJB 1OXVA 3A7AB 3M4OB 2F03A 2RBMA 1V1OA 1YNJD 2F0QA 3K5MA 1SYCA 2YYZA 5EBCA 2WV6D 2G9DA 1WVLA 2R3ZA 1QILA 3WOFA 3M7NA 1TIID 2R61A 1A3TA 5KEEA 2R93B 4ZKBB 3J80L 2A68D 5JPNC 3MTSA 1G2SA 1KTKA 1F9RA 3IKJA 4FP5D 1EY4A 1MGSA 1I50B 1EU4A 4DK1A 1STYA 1ENCA 3OWFA 4XYQA 1HFNA 5FK9C 2VNUD 1NSNS 4DAYA 2A73B 3SK6A 3SR1A 4IUVA 1O78A 2VB3X 1O80A 2A6HC 2ENBA 4BA2I 1JWMD 4IN3A 1V8QA 2EY1A 3M85A 1STBA 1V43A 2Q8RE 3AB9A 3PUXA 2JP1A 1SNOA 3HKZB 1SMYC 3FKIB 3GV6A 4CGYB 3NWTA 1XTCD 3QOJA 4DNTB 3Q0AA 3ND9A 1TU2B 3VR5A 5JAVA 1HA5A 2LMCB 2NN6G 4O1NA 3I3CA 2JA8B 1JOKA 2L5TA 3MFYA 3A8IE 1YNND 2OF1A 1GXDC 2E74C 1YNJC 1SNQA 2J7ZA 2L4NA 2NBFA 4KN4C 3MZ5A 3TBIB 1SAPA 2IJ0A 3OHXC 3RD4A 2XWJB 3LWEA 2A68C 2F0TA 1E0BA 1STNA 5COYA 3MC0B 3RZDB 4C3HG 1SJED 1EY8A 2WB1B 4KHZA 5FOBB 3DWAA 2RSOA 3D31A 5G3LD 2L12A 2O2LD 3K59A 5IIFA 1CTMA 1RTNA 5M5YB 3TP6A 3S16B 1PTOB 4A3JB 3OSOA 4ZUIA 2SOBA 2B2YA 4ZYSA 1BO0A 3MA2B 5C3XA 3J81L 1LTID 2AQ1B 4FF4A 4KHVA 2QF7A 1OXXK 2M00A 3N6RA 1EYDA 3V2TA 1FNWA 1CK1A 3MXUA 1ZEQX 2EOTA 1DOMA 1YNNC 2EDGA 4KY6A 4CKBA 4FF1A 2EJGC 1F9QA 5IGBA 4MHEA 2O5JC 4KY5A 2RA4A 1A3UA 2ICIA 5KYIA 2F3VA 1F2MA 1S5BD 2B8FA 4OL7A 2L0CA 4M8AA 2SNMA 5C5LA 1MSGA 3IAYA 1ET9A 4B08A 3WOEA 2KOLA 1A2UA 1TY2A 3HEJA 2PCFB 1TKWB 3VR2A 4H0LC 4TQUS 2IW3A 4TKOB 5CBAE 1HQMC 1CT1D 4ZLTF 1EY0A 3AU7A 1UEAB 1ONLA 2LY7A 3FVQA 4WRDA 3MXGA 1HTLD 1STEA 4HSVA 5FLXL 1BCPD 4QB4A 2FMCA 4MN3A 3PMFA 4HN7A 3BS1A 4XQJA 4YIJA 1SNCA 4C3JG 1JQYD 1CZGA 1B1ZA 2F3WA 5C3EB 1R4QB 1IKMA 1O7ZA 5M5WB 3HP3A 4B9WA 3TN2A 1QCBD 2PMZB 3E6ZX 4CJ2C 2NB0A 1I4GA 4FO2A 5C0XG 3D8GA 1KLGD 1E2ZA 2H4OA 3PV0A 2K1BA 3I90A 3KBXA 2F0OA 3TZUA 3TDQA 2FMMA 1Y8NB 2F0JA 1HA6A 3GTOB 5K5PA 3SE0A 3I4MB 1QWYA 2F0SA 3NK9A 1WTXA 3S1QB 5C0XJ 1KDBA 1IHZA 5IOCA 3J7YW 1U4LA 2N55A 2EYJA 3CRLC 4G7HC 1NUCA 2RVLA 2B39A 2WKDA 1KDAA 1SE4A 4HMJA 1BCPB 4S3SA 1B50A 4DAPA 3S1RB 2RSNA 1QNKA 1H9SB 3PO2B 1VDZA 2EZVA 2KEDA 4XT1B 1SNPA 1SYDA 3D4WA 1I4HA 5CV7A 2HCCA 3NTKA 2AUJD 1BCPC 1F9SA 4ID6A 3LNNA 5ELBA 1D1IA 1Q8IA 3D4DA 3VYTA 4N9PA 4OO1G 5AFWA 4LK1C 1B4OA 2EJFC 1I4RA 3C1FA 4XYOA 3NTIA 1HFGA 1JWSD 3E0JA 3D4RA 5EJWA 1D5MC 4UAIA 2CVRA 2O4XA 4IZ8A 3K5LA 2M2LA 4FVMA 1ENAA 4J8QA 2Z4IA 1GUNA 1OXUA 1EOTA 1SFOB 4PQXA 3VR4A 3GO5A 2JXMB 1BXTA 5BN4A 2VXWA 4IURA 3IFTA 1EY7A 4FF2A 2DNEA 3T51B 2DNCA 3NSWA 2LFNA 1TQOA 5IODA 2B2TC 3NQIA 1EY6A 3J7AV 2J4XA 4L63B 1STAA 4JK1C 1JOQA 1TY0A 5D3DA 2A5HA 4I7ZC 4WJWA 1SNMA 4J1MA 2PZTA 3NHHA 1EZ6A 5CR3A 2KJXA 3DEPA 5ELDA 4RKBA 4QUFA 3H91A 1DOKA 3URYA 3DMUA 5D65A 1S5ED 1CA5A 1PTOH 3HOUB 5C5MA 4CHTB 2A6EC 4U68A 2MPMA 3TP5A 3GQBA 3BDOA 1AZQA 3TZDA 3D6CA 1WTPA 4FXKC 3TMEA 1GHKA 3U9OA 5JVH3 1EY5A 2L11A 2XVSA 1CM9A 3OIQA 1OO9B 1GUSA 1FNUA 4ODGA 4H13C 1AZPA 4R8NA 5D14A 1E2WA 1KNEA 1Q12A 2N88A 3VR6A 1DM0B 2IWHA 1L0YB 5DEHA 3J7AF 1PRTB 3CQZB 1QNUA 1IW7C 3A7LA 4K6LA 4HR7B 2QILA 3BG3A 2NTSA 3EVQA 3MWYW 3H6MA 3CHBD 5DM73 5CV4A 4ZQ3A 1PRTC 2D2CC 3DUZA 1D1KA 1A6XA 2F0WA 1K83B 1LV9A 5EKLA 5HURA 3R2TA 3OWEB 1XX8A 2HCIA 3NE5B 5EGTA 4RAUC 4IQZA 5KNCA 2BCOA 5CGKA 4A3BB 4LMQD 5JVG3 4DXGA 2ZXRA 3RUZA 1RD9D 4QMGA 1K8MA 1BBXC 2JEAI 1V1PB 1HRJA 2A74C 3QB3A 3NPPA 4A3FB 5T1IA 3EA6A 1FYCA 4KK7A 4LAAA 4HEDA 5I9OA 2RQXA 1A15A 4C3HB 3PIO3 3G6JB 1BOSA 5KYLA 2EXZA 4K5VA 1VF5C 1C8CA 3VYRA 3S14B 4A3DB 3C1EA 5FO8B 1DXMA 2CQAA 2MUYA 3LWUA 4RKLA 4EVOA 1LT5D 4PV1C 5ISRA 1A3VA 3GV3A 3NQTA 1GUGA 4WFN3 5BN5A 1W6KA 3KF8A 4OGQC 4ILWA 1SBBB 3FEWX 2NVYB 2A69D 2Z4HA 5TSSA 5DNFA 4V0BA 4RCOA 1EYAA 1PLFA 2XWBB 1BQQT 2Y0SB 4BY7B 2EYPA 2QDBA 1WCMB 4BA1I 3OW7A 2EY2A 4K8IA 4IUPA 1CZWA 4X3TA 3MXNA 5A2QE 4C1NI 1VMPA 2DY7A 4Y7NB 2QCPX 4KD3A 3PO3B 2CHBD 1K8OA 3U9SA 3VYUA 4A93B 2X6GA 4IFDH 3BYYB 1J8IA 4A3GB 3AMUA 1JB3A 3C46A 3TP8A 1HCZA 1LACA 4DK0A 4KN7C 2B2WA 3ONAB 1D5XC 1O7YA 4V190 3RMHA 1E2VA 5K36H 1Y8PB 1JE4A 2ZT9C 3GTPB 3WDNA 1IKLA 3MHBA 5EQ0A 5CORA 2KQ3A 4XQNA 4IFDI 1SYEA 4C56C 1TWHB 2PW7A 1WTRA 4C3JB 1TWFB 4RHRA 5DM63 1M8AA 1AN8A 4F88A 2A69C 4IUTA 1FD7D 5IT9E 2K5DA 1MI2A 3GP7A 2B2UA 2I07B 3PUWA 3GTGB 2F0IA 2KECA 1WD0A 2PZWA 5KNBA 2SEBD 3V96A 2WACA 5C4XB 5IGEA 1RF2D 3ND8A 3OOCA 1RKNA 1SDFA 4G7OC 4ZK9B 3RLFA 2B63B 1RJTA 4NKLA 3BVMA 5JEAH 4F87A 2NYZD 4L8JA 2FINB 3MFGA 2EY5A 3FPUB 3QIAA 3DEOA 1SXTA 4BBRB 1IL8A 4RA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NSW A; 
#chains in the Genus database with same CATH topology
 1XXG A;  1I94 L;  3D6W A;  1LLR D;  5E7N A;  2ICE C;  3W1G A;  2JA8 G;  4KKT A;  1F77 A;  4RGO S;  2D9U A;  3FMC A;  3EJI A;  1QVC A;  2F0U A;  1HNX Q;  3Q6S A;  2NVQ B;  1SE3 A;  2WIN B;  4LW1 A;  4B3M Q;  1TS2 A;  3K8A A;  3OMC A;  1Q1B A;  4C1N K;  4B9X A;  1S5F D;  1FNV A;  1Z9F A;  1UAP A;  4JBW A;  3UDG A;  3CQZ H;  4HJ8 A;  4GOP A;  2F0K A;  3NEN A;  4YCU A;  3A54 A;  3T53 B;  3PGZ A;  2NZ1 D;  1P8L A;  3X3N A;  2Q8T A;  5FO7 B;  2ATW A;  2KUM A;  2K05 A;  3U58 A;  1VQC A;  3IFD A;  2X6L A;  1VQJ A;  3L7Z C;  2B2V A;  2PNR C;  2ZXP A;  3NP8 A;  1CI3 M;  1XTD A;  1PTO F;  4H02 A;  3NBH B;  2HDL A;  2R7F A;  2NN6 H;  1K83 H;  1VQB A;  3BYT B;  1J5E Q;  4JI8 Q;  1CSQ A;  4C3I G;  1EWI A;  3CCR A;  1MBY A;  1MIU A;  2KEE A;  2UXC L;  2UXB L;  2B2Y C;  2K14 A;  3KLW A;  4KHP Q;  4O42 A;  5M3F H;  2EPB A;  2XNA C;  3LGJ A;  3A8J E;  3H94 A;  4IPC A;  4K2L A;  3TEH B;  4A3B H;  5C3W A;  4LF7 L;  1L1O A;  1RHP A;  2AWN A;  3KJO A;  4UDU C;  4JI5 Q;  2AQ3 B;  2PQA B;  4CJ1 B;  3HOZ B;  2AUK A;  1YNX A;  2UUB L;  4PMB A;  3M7G A;  1X32 A;  2EE1 A;  1LT6 D;  2SDF A;  2F0N A;  4A3F H;  1S3O A;  3KF6 A;  3D0F A;  3SK8 A;  3S24 A;  3BZK A;  5FLM G;  3OPO A;  3ERQ A;  3QR8 A;  4YCV A;  1WTW A;  2K5W A;  2LS0 1;  2NN6 I;  4X62 L;  3OTO Q;  2EY6 A;  4ME3 A;  4K8J A;  3LX0 A;  3VA5 A;  5LMU L;  3NXW A;  4CJ0 B;  1EYG A;  3CAM A;  4CDF C;  5IYD G;  4DR3 Q;  2PQE A;  1JIC A;  2JSO A;  2I5H A;  1NJI C;  1LTB D;  4P75 A;  3IRB A;  3Q23 A;  4X3K A;  4RGN A;  5LHY 1;  4AH6 A;  2JE6 I;  2SNS A;  2K32 A;  1YJW A;  1HZA A;  1PXU A;  1VQN A;  3CC4 A;  3S14 H;  3M3Y B;  3SK5 A;  2GA4 B;  3IL8 A;  2IT1 A;  2WAQ G;  2JA5 G;  4A3D H;  4RHS A;  1JR0 D;  3KLS X;  2F0G A;  4P74 A;  4OIJ A;  3TP7 A;  4FYD A;  2NUC A;  1F2Z A;  4PZ8 A;  5IP7 H;  1B3A A;  3ULP A;  3A56 A;  1H9R A;  1ROD A;  2CQO A;  3K80 C;  1YZ6 A;  5IE8 A;  1SND A;  4KMU C;  4OWT B;  3CF5 A;  4JI6 L;  4LF4 Q;  3K0Y A;  1PH2 A;  1KLU D;  2NVY H;  3L3O C;  2OT2 A;  1KRT A;  1EFI D;  2FJ2 A;  4H7B A;  3NUC A;  4DV0 L;  1GHJ A;  1LT3 D;  3K5O A;  4I65 A;  1PZJ D;  1Q82 C;  2TMP A;  1SRO A;  1YEZ A;  4NDX A;  4DV1 Q;  3PUV A;  3FKI H;  4KKS A;  2BDO A;  1CQV A;  1T5X D;  4JG2 A;  1U4M A;  3I4N B;  4OIK A;  5FO9 B;  3M4Q A;  1I6H B;  1SE2 A;  1VQE A;  3SHL A;  4DV6 L;  5NUC A;  1V1Q A;  2JA6 G;  4Y7N H;  3TRE A;  3SXH A;  2L9H A;  3PO3 H;  2E2J B;  3T4A C;  5I4D A;  4A93 H;  5C3E G;  4A3I B;  1EU3 A;  1IYU A;  2IHE A;  1LAB A;  4LF5 L;  3M4P A;  4HJ7 A;  4A3E G;  1UE6 A;  3QG1 A;  3HOX G;  4DV3 L;  1XNQ L;  4KJO A;  4A3G H;  2CWA A;  2WII B;  3DWQ A;  2QW7 A;  3HOV B;  2KVM A;  4DR2 Q;  2Q2T A;  2ASB A;  5CV9 A;  4CKE A;  1DGS A;  3PIP 3;  2BDN A;  1WYD A;  3NBI A;  2PI2 E;  1Y8O B;  2F0L A;  1GJX A;  3SEB A;  3HOW G;  1QUQ B;  3GTP H;  1YI2 A;  1W6J A;  2F0D A;  5CBE E;  3RZD H;  3DHQ A;  3V05 A;  4LF6 L;  1EEF D;  4CDE C;  3AEV A;  4DFA A;  1NAP A;  4UY8 C;  4DV5 Q;  1G6Z A;  2O5I C;  2ES2 A;  2XIW A;  1N9W A;  2IPK D;  1TWH H;  1EQT A;  4C3J H;  3J81 E;  1Y69 U;  1TWF H;  1T5E A;  1BCP F;  4JBJ A;  4X65 Q;  2RKS A;  4PG3 A;  4ZCK A;  4HTH A;  1KNA A;  3I73 A;  1PFB A;  2RDG A;  3BDC A;  1EWC A;  2K6A A;  1DZ1 A;  4XQQ A;  3S1M B;  4LJZ C;  4BXX G;  1QOH A;  2OEO A;  1M4V A;  4PMW A;  3PIP A;  5IT9 L;  4Y52 H;  5CC4 A;  1TVX A;  5EKI A;  5IGC A;  3F2U A;  2XRQ D;  3VYS A;  2CKZ B;  2BA1 A;  4K2K A;  1EIY B;  2AHO B;  3JAM c;  3U4Z A;  5LL6 S;  1M90 C;  3GTG H;  1XMO Q;  5E4X A;  1VQD A;  3I4O A;  3W3A A;  4LWC A;  1V1P A;  2BA0 A;  3E9H A;  4QIW B;  3I70 A;  4Q5V A;  4LUO A;  1A62 A;  1PZI D;  3ITP A;  1G6P A;  3G4S A;  3EN2 A;  3GTK B;  4NPS A;  4A3C H;  5C4X H;  2VUM G;  1Y1V B;  2RDF A;  2C9O A;  2N8N A;  4C2M B;  1TS5 A;  2A19 A;  4DV4 Q;  2R7D A;  4ABN A;  2B63 H;  4EQN A;  3R3O A;  1PV4 A;  2K03 A;  4RWS C;  2NVT B;  3GD7 A;  5C0X I;  4YWM A;  1GOZ A;  3H3V C;  2PPB C;  4AYB E;  2F4V Q;  4MZ9 A;  5EPL A;  1PZK D;  1PH7 A;  2RHS B;  2PO4 A;  1JWU D;  1KRS A;  3CKI B;  2IL8 A;  3KK7 A;  1JB7 A;  2NTT A;  1PYW D;  4BY1 G;  1XPO A;  3T1Y Q;  2Q8I B;  1AEX A;  4BBR H;  1KDC A;  3GTO H;  2AMC B;  3H09 A;  1LO5 D;  1NNX A;  3HGB A;  3S2D B;  4AQY Q;  2JA7 G;  3KLR A;  4FNF A;  1JCK B;  3QJY A;  3NWS A;  1WTV A;  1ASY A;  4K6D A;  2ZXO A;  1LTA D;  1EQV A;  2EYH A;  2Z8L A;  2K28 A;  2NVQ H;  2EYL A;  4A76 A;  4TRD A;  2PW5 A;  3HKZ E;  1SYG A;  3CCE A;  4OO1 H;  4IUQ A;  4YY3 Q;  2RHQ B;  2E2H B;  4B3T L;  4WOR A;  5HGT A;  1VF7 A;  1YJN A;  1C48 A;  3N52 A;  5BN3 A;  1SYB A;  1N33 Q;  1HNW L;  1PFN A;  1IYV A;  3OW2 A;  2AWO A;  4B3S L;  1SMY D;  1NR4 A;  4TSS A;  1CFM A;  2RCF A;  3J80 c;  1XYI A;  3A55 A;  3VA7 A;  2TSS A;  4NP5 A;  2R92 G;  1H9M A;  1HZ9 A;  3MEH A;  4L6T B;  1AW7 A;  1LT4 D;  2ID0 A;  4EQP A;  2HDM A;  1QJO A;  4EGV A;  4OO1 I;  5IGG A;  1M1K C;  3HG9 A;  3BZD B;  1N32 L;  4IUU A;  5EPJ A;  4ALP A;  1TWC B;  1SEB D;  4LFB L;  4QY7 A;  1BUV T;  4DA2 A;  1XMQ L;  4XIG S;  2YU9 B;  1ZXT A;  5JEA G;  3HOZ H;  3ZYY X;  1WD1 A;  2RF4 A;  2N78 A;  4KKU A;  2FFK B;  5D3I B;  1F9P A;  5JJZ A;  1JJ2 A;  4DR4 L;  4DU9 A;  1XNR L;  1FR3 A;  2M9V A;  2QKI C;  4P72 A;  5CV8 A;  2EJM A;  2WP8 J;  3K6O A;  5CV5 A;  3BVG A;  1Q8K A;  4JI0 L;  4J15 A;  4AYB B;  5JEA J;  5ELN A;  4GLA C;  1TR5 A;  1PRT F;  1CKM A;  5J1Z A;  3W2D A;  1ESR A;  3A0J A;  3R93 A;  4X3S A;  4HSP A;  4M1U B;  1GUO A;  2YTV A;  3M3Y H;  3K0X A;  2I5L X;  5KND A;  5C44 B;  4N9T A;  5I2Y A;  4B3R Q;  1EL0 A;  2V1C C;  2R7Z G;  2XRS D;  4Q0F A;  1DJR D;  1D2B A;  2F0V A;  3I4L A;  4GNX C;  2N49 A;  1Y1W G;  2K7V A;  1QB5 D;  3A8K E;  4X64 Q;  5GAE C;  5F2D A;  2BE5 D;  5IY0 A;  1GUT A;  1I4P A;  4XXE A;  3PUY A;  2LKV A;  5C4J B;  3DM1 A;  4ZUJ A;  3P20 A;  3GTQ B;  1HNX L;  1PTO D;  4K5W A;  1X55 A;  4A3M B;  5C4Z A;  4DR6 Q;  2MQH A;  1PFS A;  4K14 A;  5IP9 G;  3H0G G;  2DUD A;  4DPG A;  4R4C A;  2OQK A;  2ZJR A;  2P5Z X;  1EIH A;  2RDH A;  5ELE A;  1VQ7 A;  1BBU A;  2GVB A;  3GTL B;  3KBG A;  4DK6 C;  5HY6 A;  3I7F A;  3X3M A;  3HRZ C;  5IGF A;  1H9J A;  5M3F G;  2K52 A;  1KAW A;  1N36 Q;  4F7X A;  1MJE A;  2KCM A;  5IYB G;  3C2P A;  1U5K A;  1G29 1;  3I4N H;  3UI2 A;  2AKW B;  1J9O A;  3PF4 A;  1HUM A;  2Z6K C;  1O7I A;  1JC7 A;  5CMD A;  4JVZ A;  4HMI A;  4KD4 A;  1SFO H;  5JOB A;  3J81 j;  2F0P A;  4DNI A;  1LTR D;  4XTC S;  1BBW A;  4J6H A;  1R9T B;  2E2J H;  2MP1 A;  4JI8 L;  1B9M A;  4KV6 A;  4LF9 Q;  4A3I H;  3GTM B;  3M4Y A;  3S17 B;  1KAB A;  4RGM A;  1S5C D;  2KCC A;  1I4Q A;  1A0I A;  4IOA A;  3HZX A;  4MNO A;  2E76 C;  4MTK A;  4XT3 B;  2UXD L;  2EYO A;  3RR5 A;  1FGB D;  4IJH A;  5T1G A;  3KF8 B;  3U4V A;  3HOV H;  3EQL C;  5IGD A;  2FHT A;  1JJC B;  2CH4 A;  2R93 G;  1B7Y B;  2MHV A;  1XPU A;  4OHJ A;  3C3L A;  4IUN A;  3GDE A;  1QZH A;  1E7Z A;  2KCN A;  4C3I B;  1TT2 A;  3PQI A;  5I6Y A;  1OTC A;  4R4T A;  3K57 A;  4OWW B;  5M9O A;  4JI4 Q;  2K4K A;  3K58 A;  4G57 A;  5E1F A;  3SGI A;  2B8G A;  1XWE A;  1L2F A;  4ZRZ A;  5FJ8 H;  1B9N A;  2F1M A;  2JA9 A;  4BBS B;  5IP7 G;  2PMZ E;  1VMC A;  1SMX A;  2BE5 C;  4K5X A;  1C0A A;  3ERS X;  5EBD A;  1IBK L;  1CQF A;  1IYJ B;  3ZJY C;  1EYC A;  2BH8 A;  3SDZ A;  2OXP A;  3CCQ A;  3RZO B;  3I72 A;  1ET6 A;  3NBH A;  1Z47 A;  1PTO C;  4UPA A;  3R2I A;  3BDL A;  1GD7 A;  4JI1 Q;  4ZKC B;  3MAQ A;  1MSH A;  5ELF A;  3E5S A;  4BS9 A;  1CKN B;  3JAM E;  1VQM A;  1B53 A;  1VQA A;  4JI7 Q;  3FPP A;  5IYC H;  1X54 A;  5C6A A;  2EVB A;  1H95 A;  4HIO A;  1B44 D;  5EPK A;  1VCI A;  2K04 A;  2ZJP A;  2G9H D;  3HKZ G;  1VQ6 A;  4QQB X;  3FKI G;  3P7J A;  4U67 3;  4LF4 L;  4R9W A;  5E3F A;  1RDP D;  4R8I A;  2JA5 B;  2WAQ B;  1HTP A;  1S40 A;  3H3V H;  1F2Y A;  3S15 B;  1QZG A;  1ILQ A;  1RCV D;  1UE5 A;  2CW0 D;  3S1N B;  1NTG A;  1BNZ A;  5FLX c;  3T1H Q;  4PZ6 A;  1HQR D;  3B6Y A;  1G91 A;  4DV1 L;  5E4W C;  2B2W C;  2OQ0 A;  2AQ2 B;  4HAE A;  4A3G G;  1DOL A;  2HHH Q;  3QOL A;  1H9S A;  4N8F A;  1RTO A;  1PHJ A;  1DYQ A;  3K5N A;  2IY5 B;  1TS4 A;  3H3V I;  4DF7 A;  2OWO A;  2PZU A;  2CWP A;  3CME A;  1BF4 A;  2UU9 Q;  3K7A B;  1B2T A;  5I6W A;  2L55 A;  3S2D H;  1FL0 A;  2XN9 C;  4E6I A;  3JAM i;  2IX3 A;  2Q2U A;  2WB1 G;  4DV7 L;  4FF3 A;  4X66 Q;  4JC0 A;  2F0H A;  3UE0 A;  4DNR B;  3DXJ C;  3HS0 C;  2UUA Q;  2JA6 B;  1UE1 A;  3BZC A;  2JYO A;  1MD2 D;  2E2I B;  3KLS A;  1LTT D;  2K5V A;  2CCZ A;  1ML0 D;  3CP0 A;  4OEL B;  1AP0 A;  1AFP A;  1VQI A;  3L2P A;  3ERO A;  1Q46 A;  4QUC A;  1BDO A;  2B2U C;  4DGZ A;  4A3J G;  4HJ5 A;  1PDQ A;  4A3E B;  3RN5 A;  4DR5 Q;  3HOX B;  2XTI A;  1PH5 A;  3NEL A;  3O13 A;  2KA7 A;  1KQS A;  4ME5 A;  2CH4 W;  1ENF A;  3J80 E;  2F52 A;  1CHQ D;  1U4R A;  1ILP A;  1U0L A;  4QCL A;  5ELC A;  1LTG D;  3I91 A;  3CU7 A;  1SN8 A;  4JW0 A;  4NXM Q;  1P16 A;  2B2T A;  3ICE A;  3D3R A;  4KTA A;  1OXS C;  2VQE Q;  2QEJ C;  3HOW B;  1G2T A;  4DR7 L;  4IAL A;  1WTH A;  2R6G A;  4QL5 A;  5J22 A;  4C3H H;  2OTL A;  2KCT A;  4A3C G;  3S2H B;  2KHS A;  2CW0 C;  1SSO A;  1JJG A;  1BR9 A;  1EY9 A;  4G7Z C;  1TWC H;  1DON A;  2YU9 H;  2X69 A;  1WTO A;  1HUN A;  1XMO L;  3T56 B;  5G3L F;  1L0W A;  1BVS A;  3KFU A;  4JI3 Q;  2J0T D;  2F0M A;  2BH2 A;  1IBM Q;  4DV2 Q;  1SYF A;  1YHB A;  2IX0 A;  2PNH A;  1L0X B;  1QUQ A;  3T16 A;  3TSS A;  4JI2 L;  5LMN Q;  4GZY C;  1Q3L A;  2DN8 A;  5JPM C;  1S4Z A;  4A3L H;  1II3 A;  2NWG A;  4CKC A;  5I2X A;  2C5C A;  3G71 A;  2E2D C;  3DWP A;  4DV4 L;  2D62 A;  4GOP B;  3P75 A;  1Z7T A;  3FHW A;  4XDX A;  1NBW A;  2KHI A;  1X3P A;  2F4V L;  3QWN A;  3J80 i;  2K75 A;  3PF5 A;  2JEB I;  3I8Z A;  4BY7 H;  1XJV A;  1TS3 A;  1CHP D;  2VUM B;  1UUP A;  1WCM H;  3T13 A;  2H1E A;  1G8Z D;  5C4H A;  4GOP C;  3T1Y L;  3EIV A;  4MTN A;  1CA6 A;  1H9K A;  1D6E C;  5C44 H;  1I94 Q;  3CW2 C;  1ICW A;  3SVM A;  2K50 A;  2A6E D;  1PFM A;  5KRU A;  3VR3 A;  4WJ3 M;  4NMZ A;  4AQY L;  1YBY A;  1RIP A;  4MIU A;  4NB3 A;  5A2Q L;  2I46 A;  3HOY B;  2B2V C;  1L1O B;  2FXQ A;  1XPR A;  1Z6H A;  4A4I A;  4RGT A;  2ZM6 Q;  3R8B A;  5C4J H;  3OMG A;  3GTQ H;  1D5Z C;  5J39 A;  4YHH L;  4BY1 B;  1Q90 A;  1MHW C;  2NVX B;  4GKJ Q;  1HNZ L;  1KXL A;  1S5D D;  3KF6 B;  4IJL A;  1AE2 A;  1KIX A;  1J6Q A;  4POF A;  3UE1 A;  4R1J A;  2E8G A;  1OXT A;  4EQO A;  2WFW A;  4YY3 L;  2JA7 B;  4G4K A;  1L1O C;  3AYH B;  4GS3 A;  4F8M A;  2VY3 A;  3GTL H;  1I3Q B;  5I9P A;  1GVP A;  2IX1 A;  4GLX A;  2F0E A;  4PMC A;  4RFB A;  1N33 L;  3I56 A;  1A8V A;  3G7L A;  5KIX A;  2GN5 A;  2HQE A;  1KAA A;  2VB2 X;  4JBK A;  5LL6 X;  4RCN A;  4EX5 A;  5KGU A;  4X3U A;  3I4M G;  1E22 A;  1IW7 D;  4P2C B;  2UXB Q;  3NEM A;  1K73 C;  2K33 A;  1GUW A;  4HJA A;  1EEI D;  1HPC A;  1U4P A;  4JOI A;  4DN4 M;  3L9A X;  1HXY D;  4JV5 Q;  2D5D A;  1HR0 L;  4KI0 A;  1F2L A;  3NTH A;  2C35 B;  4FXG C;  4ULL A;  1ESF A;  1PRT D;  1NR2 A;  1I4X A;  4GLV B;  2R92 B;  3OIP A;  1EIG A;  1EQR A;  3S9W A;  3P1H A;  5GRO A;  5C0X H;  3BJU A;  1STG A;  3Q24 A;  1YIJ A;  3Q22 A;  1SJH D;  2Q2I A;  4KJN A;  4X62 Q;  3PO2 G;  1STH A;  4BWG B;  1Q1E A;  2Z1C A;  3TRZ A;  1ZKO A;  3KUP A;  5LMU Q;  1VQ8 A;  4LFC Q;  4BBS H;  5M5X B;  5A35 A;  1O7L A;  1HHV A;  1QE6 A;  1X56 A;  3BVZ A;  4NW2 A;  2EYM A;  1MKH A;  5M3M B;  4POG A;  2MGS A;  1ZYR D;  2MJ8 A;  1TXY A;  1NY4 A;  3CCJ A;  3RZO H;  3K81 C;  3PCO B;  2VW9 A;  1NMF A;  1TWG B;  4IFD G;  1N8R C;  3CRK C;  3PUZ A;  3MEF A;  1G51 A;  2QEX A;  1JE5 A;  3UDX A;  1PH3 A;  1C4Q A;  2DY8 A;  4HCS A;  3JAM L;  3SK4 A;  4RA8 A;  1EZ8 A;  4HCE A;  3EFX D;  3J81 i;  2L1B A;  1DCZ A;  1GKH A;  5GAD C;  4QF4 A;  5K36 G;  4IOC A;  3CCM A;  4JI6 Q;  1UNS A;  3QO2 A;  3RLO A;  5FKA C;  5IWA L;  1IXR A;  1TWA B;  2HD3 A;  1DD2 A;  4KY7 A;  4DR6 L;  4FXD A;  2R7Z B;  4IFD J;  4A3K B;  1BKB A;  1Y1W B;  5FLX E;  1QG7 A;  1R4P B;  2HUG A;  3MXP A;  3FRP B;  1NCV A;  1JOO A;  4DV0 Q;  4RH6 A;  1LTS D;  2KBN A;  3S1N H;  3FDT A;  2Y0S E;  2Q2H A;  4OEM B;  1EFW A;  4JBM A;  4PNY A;  1I6V C;  2K01 A;  2DJG C;  2EYF A;  1EWH A;  2K5Q A;  4HID A;  2F4I A;  2XSC A;  3H0G B;  1B8A A;  2A6H D;  2JQO A;  1U9R A;  4K0K Q;  2EQS A;  2V4D A;  1WTQ A;  5DAU A;  1PMR A;  1JOR A;  4JYA Q;  1X3Q A;  4NXN L;  5BR8 L;  3HKS A;  3K7A H;  3STB D;  1PH9 A;  3AFQ A;  4DXF A;  5M3F B;  2F0F A;  1X6O A;  3KDF A;  2BOS A;  4CBV A;  5CYU A;  5CV6 A;  5FJ8 G;  2WKC A;  3JC6 6;  1IBL Q;  4ZAI A;  1PYS B;  1AE3 A;  5EKK A;  2PYK A;  4Z9C B;  1EIF A;  3MVV A;  4DK3 C;  5HGQ A;  1A2T A;  4DR1 L;  4H44 C;  2JA6 H;  4DAV A;  2E75 C;  4LFA L;  1ZYR C;  3DM3 A;  3GTJ B;  1OXV A;  2OTJ A;  3A7A B;  3M4O B;  1JT8 A;  2F03 A;  2RBM A;  1V1O A;  2K5N A;  1YNJ D;  2F0Q A;  3HOU G;  3K5M A;  4A3E H;  1PH8 A;  1SYC A;  4LF6 Q;  2YYZ A;  5EBC A;  2WV6 D;  3HOX H;  2G9D A;  1FJG L;  1WVL A;  2R3Z A;  1QIL A;  3WOF A;  1B70 B;  3M7N A;  1TII D;  3J7A 5;  2R61 A;  1A3T A;  2WB1 E;  5KEE A;  4X6A H;  2Z0S A;  2R93 B;  3HFZ B;  4ZKB B;  3J80 L;  1PYB A;  2A68 D;  5JPN C;  3MTS A;  2L15 A;  3HOW H;  1G2S A;  1KTK A;  1F9R A;  5LMN W;  3IKJ A;  4FP5 D;  1EY4 A;  1MGS A;  3Q8D A;  1C9O A;  4GNX B;  1I50 B;  4O2D A;  1EU4 A;  1SLJ A;  3E9I A;  4DK1 A;  3S2H H;  4JI7 L;  1D8L A;  1STY A;  3KOJ A;  1ENC A;  3OWF A;  4XYQ A;  3J7Z C;  1HFN A;  1HH2 P;  5FK9 C;  2VNU D;  1NSN S;  4DAY A;  2A73 B;  1ASZ A;  3SK6 A;  3CD6 A;  3SR1 A;  4CDD C;  4IUV A;  1O78 A;  2VB3 X;  3E3X A;  1O80 A;  4QGU A;  2Z9H A;  4BXX H;  2A6H C;  2ENB A;  1A63 A;  4BA2 I;  1JWM D;  4IN3 A;  1X65 A;  1V8Q A;  2EY1 A;  1E24 A;  3M85 A;  4DUZ Q;  1STB A;  1V43 A;  1NMG A;  2Q8R E;  3AB9 A;  3STB C;  3PUX A;  2JP1 A;  1SNO A;  3HKZ B;  1SMY C;  3FKI B;  3GV6 A;  4OWX B;  4YWK A;  4CGY B;  4B3M L;  3NWT A;  1XTC D;  3QOJ A;  4DNT B;  3Q0A A;  3ND9 A;  1TU2 B;  3VR5 A;  5JAV A;  2HHH L;  1HA5 A;  2LMC B;  2NN6 G;  4O1N A;  3I3C A;  2IHF A;  2JA8 B;  1JOK A;  2L5T A;  3MFY A;  3CPW A;  4OX9 Q;  2VUM H;  3A8I E;  1YNN D;  4HJ9 A;  2OF1 A;  1GXD C;  2E74 C;  4QJF A;  1CKN A;  1YNJ C;  4A3B G;  1SNQ A;  1CSP A;  3TS0 A;  2J7Z A;  2L4N A;  2DJF C;  3A74 A;  4GKK Q;  1I6H H;  3HOY H;  1E1O A;  2NBF A;  3MZ5 A;  4KN4 C;  3TBI B;  4X66 L;  3F2C A;  1SAP A;  2IJ0 A;  4A3F G;  3OHX C;  2MFI A;  3G6E A;  3RD4 A;  1J5E L;  2XWJ B;  3LWE A;  1CKO A;  2DGY A;  3EBE A;  2A68 C;  2CFM A;  2F0T A;  4KHP L;  1E0B A;  1I5F A;  1STN A;  5COY A;  3MC0 B;  3A5U A;  1KHI A;  3RZD B;  4DUY Q;  4JI5 L;  4DR5 L;  2NZH A;  1SJE D;  4C3H G;  2JA7 H;  1EY8 A;  2WB1 B;  4KHZ A;  1VQF A;  5FOB B;  3DWA A;  2QGQ A;  2RSO A;  1I3Q H;  1GM5 A;  1PVO A;  3D31 A;  5G3L D;  1Q81 C;  2D0P A;  2L12 A;  2YTX A;  2O2L D;  3K59 A;  5IIF A;  1CTM A;  1RTN A;  5M5Y B;  3TP6 A;  3S16 B;  4A3D G;  1Q7Y C;  1PTO B;  3OTO L;  3CCS A;  4A3J B;  2A8V A;  3OSO A;  1QVF A;  4A75 A;  4ZUI A;  2SOB A;  2B2Y A;  4I7A A;  4ZYS A;  1SRU A;  1BO0 A;  3MA2 B;  4DR3 L;  5C3X A;  1WI5 A;  1N32 Q;  2HIX A;  3MXN B;  1LTL A;  3J81 L;  4LFB Q;  1XMQ Q;  1LTI D;  2AQ1 B;  4FF4 A;  2RCN A;  4DKA C;  4KHV A;  4LUZ A;  2QF7 A;  1OXX K;  2M00 A;  3G48 A;  3N6R A;  3S1M H;  4JI3 L;  1EYD A;  3V2T A;  1FNW A;  2HQL A;  1CK1 A;  2Y0S G;  4BY7 G;  3MXU A;  1ZEQ X;  2EOT A;  5ELO A;  1DOM A;  2EXD A;  4DR4 Q;  1YNN C;  2EDG A;  4KY6 A;  1WCM G;  4CKB A;  2PQA A;  3E0E A;  4FF1 A;  2EJG C;  1F9Q A;  4UP8 A;  4APV A;  5IGB A;  4MHE A;  2O5J C;  4PZ7 A;  3PSI A;  5M5X H;  4KY5 A;  3F2B A;  2RA4 A;  1A3U A;  2ICI A;  5KYI A;  3GTK H;  2F3V A;  5M3M H;  4LNQ A;  1F2M A;  1S5B D;  1Y1V H;  2EIF A;  2B8F A;  2GVA A;  3PO3 G;  4OL7 A;  2L0C A;  4C2M H;  4M8A A;  4A93 G;  2B29 A;  2JN4 A;  1PA6 A;  4RG1 A;  2SNM A;  5C5L A;  1MSG A;  3IAY A;  1ET9 A;  4B08 A;  3WOE A;  4UP7 A;  2NVT H;  2KOL A;  1A2U A;  1TY2 A;  1X9N A;  3HEJ A;  2PCF B;  1TKW B;  1N34 Q;  3VR2 A;  4H0L C;  4TQU S;  2K5H A;  2IW3 A;  2ZJQ A;  4TKO B;  5CBA E;  1HQM C;  1CT1 D;  1YIT A;  2ZM6 L;  4ZLT F;  1EY0 A;  1X3E A;  2UUC Q;  2E5L Q;  3AU7 A;  1TWA H;  1UEA B;  4GKJ L;  2QA4 A;  1ONL A;  2LY7 A;  3FVQ A;  1QVG A;  2R7Z H;  4WRD A;  4A3K H;  3MXG A;  1Y1W H;  1HTL D;  2KEN A;  5GQO A;  1STE A;  4HSV A;  1SR3 A;  3M9B A;  5FLX L;  1BCP D;  4QB4 A;  4DR2 L;  2FMC A;  4MN3 A;  1K0R A;  3PMF A;  4HN7 A;  3BS1 A;  4XQJ A;  4YIJ A;  1SNC A;  4C3J G;  1JQY D;  1CZG A;  3DLL A;  2JK8 A;  4P71 A;  1B1Z A;  2F3W A;  5C3E B;  1R4Q B;  1IKM A;  1O7Z A;  4CDC C;  3KJP A;  3HP3 A;  5M5W B;  1HZB A;  4B9W A;  2VQF Q;  2E2H H;  5IP9 H;  3TN2 A;  3H0G H;  1QCB D;  2PMZ B;  3E6Z X;  4CJ2 C;  4UHV A;  2NB0 A;  4DV5 L;  1I4G A;  4FO2 A;  5C0X G;  4JPB W;  5GAH C;  3CCL A;  1YJ9 A;  3D8G A;  2ZTE A;  1KLG D;  1E2Z A;  2H4O A;  4X65 L;  3PV0 A;  2K1B A;  2HIV A;  3I90 A;  4JV5 L;  5IYB H;  1K28 A;  2N3S A;  2UXD Q;  3KBX A;  3WWV A;  2F0O A;  4BBS G;  3TZU A;  4L5S A;  3F1Z A;  3TDQ A;  2FMM A;  1Y8N B;  2F0J A;  1HR0 W;  1HA6 A;  4N8X 1;  2YV5 A;  3GTO B;  5C4X G;  5K5P A;  4GN5 A;  3KYH C;  1QWY A;  3SE0 A;  3GTJ H;  3I4M B;  4EQ5 A;  2F0S A;  3NK9 A;  3M4O H;  2A1A A;  1WTX A;  3S1Q B;  1VQG A;  5C0X J;  4DAM A;  1KDB A;  2B63 G;  1IHZ A;  2I0Q A;  5AJ3 Q;  5IOC A;  3J7Y W;  1U4L A;  2N55 A;  2XGT A;  3TS2 A;  2EYJ A;  3CRL C;  4LFC L;  3CXC A;  3L0O A;  4G7H C;  1NUC A;  2RVL A;  2B39 A;  2WKD A;  1KDA A;  1SE4 A;  4HMJ A;  1GO3 E;  1UWV A;  4OXP A;  1S72 A;  1IBK Q;  2R93 H;  1BCP B;  4S3S A;  1KC8 C;  1B50 A;  4DAP A;  3S1R B;  1LYL A;  2ZTD A;  2RSN A;  4BBR G;  1LUZ A;  1E1T A;  1QNK A;  1H9S B;  3PO2 B;  1VDZ A;  2EZV A;  3AQQ A;  2KED A;  4XT1 B;  1W2B A;  5L37 A;  1SNP A;  1SYD A;  3D4W A;  1I4H A;  1I50 H;  5CV7 A;  2HCC A;  3NTK A;  1E3P A;  3ER0 A;  2AUJ D;  1BCP C;  1F9S A;  4LF8 Q;  4ID6 A;  5JJK A;  3LNN A;  5ELB A;  3CC2 A;  3UDI A;  1ICF B;  1D1I A;  1Q8I A;  3D4D A;  3VYT A;  4N9P A;  4OO1 G;  5AFW A;  4LK1 C;  1B4O A;  4QIW E;  2EJF C;  4JCV E;  1I4R A;  3C1F A;  4XYO A;  3NTI A;  3ULJ A;  1WJJ A;  1HFG A;  4L5T A;  1JWS D;  3E0J A;  3D4R A;  5EJW A;  1D5M C;  4RMF A;  4UAI A;  2I5M X;  2CVR A;  2O4X A;  4IZ8 A;  3K5L A;  2M2L A;  4A3M H;  4FVM A;  1ENA A;  4J8Q A;  2Z6B A;  2Z4I A;  1GUN A;  3A5Z B;  1OXU A;  1EOT A;  1SFO B;  4PQX A;  3VR4 A;  2JA8 H;  3GO5 A;  2JXM B;  1B3Q A;  1BXT A;  2ZTC A;  4K0K L;  5BN4 A;  2VXW A;  4IUR A;  3IFT A;  2VZA A;  2LXK A;  1EY7 A;  4R4I A;  4FF2 A;  4JYA L;  1WFQ A;  2DNE A;  5H1S E;  3T51 B;  2DNC A;  3NSW A;  2LFN A;  4WJ4 A;  1NE3 A;  3RN2 A;  1TQO A;  1IBL L;  5IOD A;  4HIK A;  3HOZ G;  2B2T C;  4DV7 Q;  3NQI A;  1EY6 A;  3J7A V;  2J4X A;  4L63 B;  1STA A;  4JK1 C;  1JOQ A;  1TY0 A;  5D3D A;  1R9T H;  2A5H A;  2UXC Q;  3GTM H;  5JJI A;  4I7Z C;  4WJW A;  5IT9 c;  3S17 H;  5J3B A;  1SNM A;  4LF7 Q;  1EOV A;  4J1M A;  2PZT A;  3NHH A;  1EZ6 A;  1T9H A;  2PI2 A;  5CR3 A;  2KJX A;  3DEP A;  1VS0 A;  5ELD A;  2UUB Q;  4RKB A;  4QUF A;  3H91 A;  4YWL A;  1DOK A;  3URY A;  3DMU A;  4C3I H;  1K9M C;  5D65 A;  1S5E D;  3CMA A;  1CA5 A;  2YTY A;  5M5Y H;  3S16 H;  4DR7 Q;  1PTO H;  3HOU B;  5C5M A;  4A3J H;  2B3G A;  4CHT B;  2A6E C;  4U68 A;  2MPM A;  3TP5 A;  2G5D A;  3GQB A;  3BDO A;  1AZQ A;  3K7U C;  3TZD A;  3D6C A;  1WTP A;  4FXK C;  3TME A;  1GHK A;  3U9O A;  3F2D A;  5JVH 3;  1EY5 A;  5FLM H;  2MO0 A;  1X3F A;  4B3R L;  2L11 A;  1HJP A;  2XVS A;  1CM9 A;  3OIQ A;  1OO9 B;  2NZO A;  1GUS A;  1FNU A;  4ODG A;  4L5Q A;  4H13 C;  4JI2 Q;  4X64 L;  3CC7 A;  1AZP A;  1VQO A;  4R8N A;  5IYD H;  5D14 A;  4OON A;  1PH1 A;  4DUZ L;  1E2W A;  2JJQ A;  5DLQ E;  1VQK A;  4O0A A;  1KNE A;  1Q12 A;  3I4N G;  2JA5 H;  2N88 A;  3VR6 A;  1DM0 B;  2IWH A;  1L0Y B;  3S15 H;  1CUK A;  2KHJ A;  5DEH A;  3J7A F;  2MO1 A;  1PRT B;  3HOY G;  3CQZ B;  4OX9 L;  1QNU A;  1IW7 C;  3A7L A;  4K6L A;  4HR7 B;  2QIL A;  4A3I G;  4GN3 B;  1VQL A;  3BG3 A;  4GNX A;  2NTS A;  3W1B A;  1N36 L;  3EVQ A;  1MJC A;  3OYY A;  3MWY W;  3H6M A;  3CHB D;  5DM7 3;  5CV4 A;  5EAY A;  4ZQ3 A;  1PRT C;  5JJL A;  2D2C C;  4GKK L;  3DUZ A;  3HOV G;  4DV6 Q;  1D1K A;  1A6X A;  2F0W A;  4IPG A;  3CPF A;  1K83 B;  1LV9 A;  2OCE A;  4HIM A;  5EKL A;  5HUR A;  3R2T A;  3OWE B;  4YHH Q;  3RNU A;  1XX8 A;  3VDY A;  2HCI A;  4LF9 L;  3NE5 B;  5EGT A;  4LF5 Q;  3I2Z A;  1EQQ A;  4RAU C;  1HNZ Q;  4IQZ A;  5KNC A;  2BCO A;  5CGK A;  4DV3 Q;  4A3B B;  4LMQ D;  1XNQ Q;  5JVG 3;  4JOI C;  4DXG A;  4DUY L;  2ZXR A;  1WOC A;  3RUZ A;  1RD9 D;  4QMG A;  1K8M A;  1Y14 B;  1BBX C;  2JEA I;  1V1P B;  4R4O A;  4GN4 B;  2A74 C;  1HRJ A;  1X3G A;  4YCW A;  3QB3 A;  3NPP A;  2E2I H;  4A3F B;  2VL6 A;  5T1I A;  2Z6K A;  4IPH A;  3UDF A;  5C3E H;  4JI4 L;  3EA6 A;  5M5W H;  1FYC A;  1VQ9 A;  4KK7 A;  4LAA A;  4KLK A;  4HED A;  5I9O A;  2RQX A;  1A15 A;  2LSS A;  4C3H B;  1FVI A;  4UP9 A;  3PIO 3;  1YHQ A;  1SE8 A;  3G6J B;  2QDL A;  5IYC G;  1BOS A;  5KYL A;  1VQ5 A;  1LM0 A;  2EXZ A;  4K5V A;  1HR0 Q;  1VF5 C;  1C8C A;  1PH6 A;  3VYR A;  3S14 B;  1V9P A;  4A3D B;  3C1E A;  4JI1 L;  5FO8 B;  1DXM A;  2CQA A;  2MUY A;  3LWU A;  4RKL A;  4EVO A;  5M3M G;  1LT5 D;  4AIM A;  4PV1 C;  1IL2 A;  1Y1V G;  5ISR A;  4L5R C;  3I4M H;  3FP9 A;  1A3V A;  3GV3 A;  3NQT A;  1GUG A;  3S1Q H;  4WFN 3;  4TVA B;  3U50 C;  5BN5 A;  1W6K A;  3ULL A;  3KF8 A;  4OGQ C;  4ILW A;  1SBB B;  1VQ4 A;  3FEW X;  2NVY B;  2A69 D;  2Z4H A;  2D0O A;  5TSS A;  5DNF A;  3PIO A;  4V0B A;  4RCO A;  1C7Y A;  1EYA A;  1PLF A;  2XWB B;  1KD1 C;  1BQQ T;  2Y0S B;  4BY7 B;  2EYP A;  2ALY B;  3S1R H;  2QDB A;  1WCM B;  3T1H L;  4BA1 I;  3PO2 H;  3OW7 A;  2EY2 A;  4K8I A;  4IUP A;  1YVC A;  2LXJ A;  4LUV A;  1EUJ A;  4A3K G;  1CZW A;  4X3T A;  3MXN A;  1AH9 A;  5A2Q E;  1N34 L;  1K8A C;  3KDF B;  4C1N I;  1VMP A;  2DY7 A;  1UEB A;  4Y7N B;  3AFP A;  2QCP X;  3W5O A;  4KD3 A;  3PO3 B;  2CHB D;  1K8O A;  5IWA Q;  3U9S A;  3VYU A;  4A93 B;  2X6G A;  2UUC L;  2E5L L;  2UU9 L;  4IFD H;  3BYY B;  1IZ6 A;  3RLN A;  1J8I A;  3I55 A;  2WAQ E;  4A3G B;  1FGU A;  3AMU A;  1JB3 A;  3C46 A;  1K3R A;  1HCZ A;  3TP8 A;  1LAC A;  4DK0 A;  4KN7 C;  2UUA L;  2B2W A;  3ONA B;  1D5X C;  1O7Y A;  4V19 0;  3RMH A;  1E2V A;  4BY1 H;  5K36 H;  1HZC A;  4IPD A;  1Y8P B;  1JE4 A;  2ZT9 C;  2NVX H;  3GTP B;  3WDN A;  4B3T Q;  2VQF L;  1IKL A;  3MHB A;  5EQ0 A;  5COR A;  4R4Q A;  4FDB A;  2KQ3 A;  4XQN A;  4IFD I;  1SYE A;  4C56 C;  1TWH B;  2PW7 A;  5BR8 Q;  4NXN Q;  1HNW Q;  1WTR A;  2F3I A;  4C3J B;  1TWF B;  4B3S Q;  4RHR A;  4NXM L;  3H15 A;  5DM6 3;  2VQE L;  1M8A A;  1AN8 A;  4F88 A;  2A69 C;  3J81 c;  1D7Q A;  4IUT A;  3BU2 A;  1FD7 D;  1JMC A;  1VQH A;  4IO9 A;  1RL2 A;  5GAG C;  4DR1 Q;  4DAY B;  5IT9 E;  2K5D A;  4LFA Q;  1MI2 A;  3GP7 A;  3TQY A;  3CCU A;  4A3L G;  2B2U A;  1VQP A;  2I07 B;  3PUW A;  1Q86 C;  4P73 A;  3GTG B;  3CCV A;  2F0I A;  2KEC A;  1WD0 A;  4AYB G;  5AJ3 L;  2PZW A;  1FJG Q;  5KNB A;  2SEB D;  3V96 A;  2WAC A;  2R92 H;  1IBM L;  4DV2 L;  5C4X B;  5IGE A;  1RF2 D;  3ND8 A;  5LMN L;  3OOC A;  1RKN A;  1SDF A;  4G7O C;  1XNR Q;  4ZK9 B;  1K3B C;  3RLF A;  2B63 B;  1RJT A;  5C44 G;  3HOU H;  4JI0 Q;  3F8T A;  4NKL A;  3BVM A;  5JEA H;  1K8G A;  2HT1 A;  4F87 A;  2MNA A;  2NYZ D;  4L8J A;  2FIN B;  1KL9 A;  3MFG A;  2EY5 A;  3FPU B;  3QIA A;  1YHA A;  3DEO A;  4LF8 L;  1K0S A;  1SXT A;  2H5X A;  1PH4 A;  1W3S A;  1UE7 A;  1TWG H;  4A3M G;  4BBR B;  1IL8 A;  2VS1 A; 
#chains in the Genus database with same CATH homology
 1XXG A;  3D6W A;  1LLR D;  2ICE C;  4KKT A;  1F77 A;  4RGO S;  2D9U A;  3FMC A;  3EJI A;  2F0U A;  3Q6S A;  2NVQ B;  1SE3 A;  2WIN B;  1TS2 A;  3OMC A;  1Q1B A;  4C1N K;  4B9X A;  1S5F D;  1FNV A;  4JBW A;  1UAP A;  2F0K A;  3A54 A;  3T53 B;  2NZ1 D;  3X3N A;  2Q8T A;  5FO7 B;  2KUM A;  2K05 A;  3IFD A;  2X6L A;  3L7Z C;  2B2V A;  2PNR C;  2ZXP A;  3NP8 A;  1CI3 M;  1PTO F;  2HDL A;  2NN6 H;  3BYT B;  4C3I G;  1MBY A;  2KEE A;  2B2Y C;  4O42 A;  2EPB A;  2XNA C;  3A8J E;  3H94 A;  4K2L A;  5C3W A;  1RHP A;  2AWN A;  4UDU C;  2AQ3 B;  4CJ1 B;  3HOZ B;  2AUK A;  4PMB A;  3M7G A;  1X32 A;  2EE1 A;  1LT6 D;  2SDF A;  2F0N A;  3SK8 A;  3OPO A;  3ERQ A;  1WTW A;  2K5W A;  2LS0 1;  2NN6 I;  2EY6 A;  4K8J A;  3LX0 A;  3VA5 A;  3NXW A;  4CJ0 B;  2PQE A;  1JIC A;  2JSO A;  1LTB D;  3Q23 A;  4X3K A;  4RGN A;  5LHY 1;  2JE6 I;  2SNS A;  2K32 A;  1PXU A;  3M3Y B;  3SK5 A;  2GA4 B;  3IL8 A;  2IT1 A;  4RHS A;  1JR0 D;  3KLS X;  2F0G A;  4OIJ A;  3TP7 A;  4FYD A;  2NUC A;  1F2Z A;  1B3A A;  3A56 A;  1H9R A;  1ROD A;  1SND A;  4KMU C;  3K0Y A;  1KLU D;  3L3O C;  2OT2 A;  1EFI D;  2FJ2 A;  4H7B A;  3NUC A;  1GHJ A;  1LT3 D;  3K5O A;  4I65 A;  1PZJ D;  2TMP A;  4NDX A;  3PUV A;  4KKS A;  2BDO A;  1CQV A;  1T5X D;  1U4M A;  3I4N B;  4OIK A;  5FO9 B;  1I6H B;  1SE2 A;  3SHL A;  5NUC A;  3SXH A;  2L9H A;  2E2J B;  3T4A C;  5I4D A;  4A3I B;  1EU3 A;  1IYU A;  1LAB A;  3QG1 A;  4KJO A;  2WII B;  3DWQ A;  3HOV B;  2KVM A;  5CV9 A;  4CKE A;  3PIP 3;  2BDN A;  3NBI A;  1Y8O B;  2F0L A;  1GJX A;  3SEB A;  1W6J A;  2F0D A;  5CBE E;  3DHQ A;  3V05 A;  1EEF D;  4DFA A;  1NAP A;  1G6Z A;  2O5I C;  2XIW A;  2IPK D;  1EQT A;  3J81 E;  1Y69 U;  1T5E A;  1BCP F;  2RKS A;  4HTH A;  1KNA A;  3I73 A;  1PFB A;  2RDG A;  3BDC A;  1EWC A;  2K6A A;  1DZ1 A;  4XQQ A;  3S1M B;  4LJZ C;  1QOH A;  2OEO A;  1M4V A;  4PMW A;  5IT9 L;  5CC4 A;  1TVX A;  5EKI A;  5IGC A;  3F2U A;  2XRQ D;  3VYS A;  2BA1 A;  4K2K A;  5LL6 S;  5E4X A;  3W3A A;  4QIW B;  1V1P A;  2BA0 A;  3I70 A;  4Q5V A;  3ITP A;  1PZI D;  3GTK B;  1Y1V B;  2RDF A;  2C9O A;  4C2M B;  1TS5 A;  4ABN A;  4EQN A;  3R3O A;  2K03 A;  4RWS C;  2NVT B;  3GD7 A;  5C0X I;  1GOZ A;  3H3V C;  2PPB C;  5EPL A;  1PZK D;  2PO4 A;  1JWU D;  3CKI B;  2IL8 A;  3KK7 A;  2NTT A;  1PYW D;  2Q8I B;  1AEX A;  1KDC A;  3H09 A;  1LO5 D;  3HGB A;  3S2D B;  3KLR A;  4FNF A;  1JCK B;  3QJY A;  3NWS A;  1WTV A;  4K6D A;  2ZXO A;  1LTA D;  1EQV A;  2EYH A;  2K28 A;  2Z8L A;  2EYL A;  4TRD A;  2PW5 A;  1SYG A;  4OO1 H;  4IUQ A;  2E2H B;  4WOR A;  5HGT A;  1VF7 A;  1C48 A;  3N52 A;  5BN3 A;  1SYB A;  1PFN A;  1IYV A;  2AWO A;  1SMY D;  1NR4 A;  4TSS A;  1CFM A;  1XYI A;  3A55 A;  3VA7 A;  2TSS A;  4NP5 A;  1H9M A;  3MEH A;  4L6T B;  1AW7 A;  1LT4 D;  2ID0 A;  4EQP A;  2HDM A;  1QJO A;  4EGV A;  4OO1 I;  5IGG A;  3HG9 A;  3BZD B;  4IUU A;  5EPJ A;  1TWC B;  1SEB D;  1BUV T;  4DA2 A;  2YU9 B;  4XIG S;  1ZXT A;  5JEA G;  3ZYY X;  1WD1 A;  4KKU A;  2FFK B;  5D3I B;  1F9P A;  5JJZ A;  4DU9 A;  1FR3 A;  2M9V A;  2QKI C;  5CV8 A;  2EJM A;  2WP8 J;  3K6O A;  5CV5 A;  3BVG A;  4AYB B;  5JEA J;  1TR5 A;  1PRT F;  5J1Z A;  3W2D A;  1ESR A;  3R93 A;  4X3S A;  4HSP A;  4M1U B;  1GUO A;  5KND A;  5C44 B;  4N9T A;  5I2Y A;  1EL0 A;  2XRS D;  4Q0F A;  1DJR D;  1D2B A;  2F0V A;  3I4L A;  2K7V A;  1QB5 D;  3A8K E;  5F2D A;  2BE5 D;  1GUT A;  1I4P A;  4XXE A;  3PUY A;  2LKV A;  5C4J B;  3DM1 A;  4ZUJ A;  3P20 A;  3GTQ B;  1PTO D;  4K5W A;  4A3M B;  5C4Z A;  4K14 A;  1EIH A;  2RDH A;  5ELE A;  3GTL B;  3KBG A;  3X3M A;  3HRZ C;  5IGF A;  1H9J A;  4F7X A;  3C2P A;  1G29 1;  3UI2 A;  1J9O A;  1HUM A;  5CMD A;  1JC7 A;  4HMI A;  4KD4 A;  5JOB A;  2F0P A;  1LTR D;  4XTC S;  4J6H A;  1R9T B;  2MP1 A;  1B9M A;  4KV6 A;  3GTM B;  3M4Y A;  3S17 B;  1KAB A;  4RGM A;  1S5C D;  2KCC A;  1I4Q A;  3HZX A;  2E76 C;  4XT3 B;  2EYO A;  1FGB D;  5T1G A;  3EQL C;  5IGD A;  2FHT A;  2MHV A;  4OHJ A;  3C3L A;  4IUN A;  2KCN A;  4C3I B;  1TT2 A;  5I6Y A;  3K57 A;  5M9O A;  3K58 A;  4G57 A;  5E1F A;  2B8G A;  1XWE A;  4ZRZ A;  1B9N A;  2F1M A;  4BBS B;  1VMC A;  2BE5 C;  4K5X A;  5EBD A;  1CQF A;  1EYC A;  3SDZ A;  2OXP A;  3RZO B;  3I72 A;  1ET6 A;  3NBH A;  1Z47 A;  1PTO C;  3R2I A;  3BDL A;  4ZKC B;  3MAQ A;  1MSH A;  5ELF A;  3E5S A;  4BS9 A;  3JAM E;  1B53 A;  3FPP A;  5C6A A;  2EVB A;  1B44 D;  5EPK A;  1VCI A;  2K04 A;  2G9H D;  3P7J A;  4U67 3;  4R9W A;  5E3F A;  1RDP D;  4R8I A;  2JA5 B;  2WAQ B;  1HTP A;  1F2Y A;  3S15 B;  1ILQ A;  1RCV D;  2CW0 D;  3S1N B;  1BNZ A;  1HQR D;  1G91 A;  5E4W C;  2B2W C;  2AQ2 B;  4HAE A;  1DOL A;  3QOL A;  1H9S A;  1RTO A;  1DYQ A;  3K5N A;  1TS4 A;  4DF7 A;  2PZU A;  1BF4 A;  1B2T A;  3K7A B;  5I6W A;  2L55 A;  2XN9 C;  4E6I A;  2IX3 A;  4FF3 A;  2F0H A;  4DNR B;  3DXJ C;  3HS0 C;  2JA6 B;  2JYO A;  1MD2 D;  2E2I B;  3KLS A;  1LTT D;  1ML0 D;  1AP0 A;  1AFP A;  3ERO A;  4QUC A;  4DGZ A;  1BDO A;  2B2U C;  4A3E B;  1PDQ A;  3HOX B;  3O13 A;  2KA7 A;  4ME5 A;  1ENF A;  3J80 E;  1CHQ D;  1U4R A;  1ILP A;  4QCL A;  5ELC A;  1LTG D;  3I91 A;  3CU7 A;  2B2T A;  3D3R A;  4KTA A;  1OXS C;  2QEJ C;  3HOW B;  1G2T A;  4IAL A;  2R6G A;  5J22 A;  3S2H B;  2KHS A;  2CW0 C;  1SSO A;  1BR9 A;  1EY9 A;  4G7Z C;  1DON A;  2X69 A;  1WTO A;  1HUN A;  3T56 B;  5G3L F;  2J0T D;  2F0M A;  1SYF A;  2IX0 A;  3TSS A;  3T16 A;  1L0X B;  4GZY C;  1Q3L A;  2DN8 A;  5JPM C;  1S4Z A;  1II3 A;  2NWG A;  4CKC A;  5I2X A;  2C5C A;  2E2D C;  3DWP A;  2D62 A;  3P75 A;  1Z7T A;  4XDX A;  1X3P A;  3QWN A;  2JEB I;  3I8Z A;  1TS3 A;  1CHP D;  2VUM B;  1UUP A;  3T13 A;  2H1E A;  1G8Z D;  5C4H A;  1CA6 A;  1H9K A;  1D6E C;  1ICW A;  3SVM A;  2A6E D;  1PFM A;  5KRU A;  3VR3 A;  4NMZ A;  4MIU A;  5A2Q L;  2I46 A;  3HOY B;  2B2V C;  1Z6H A;  4RGT A;  3R8B A;  3OMG A;  1D5Z C;  5J39 A;  4BY1 B;  1Q90 A;  2NVX B;  1S5D D;  1OXT A;  4EQO A;  2JA7 B;  4G4K A;  4F8M A;  1I3Q B;  5I9P A;  2IX1 A;  2F0E A;  4PMC A;  4RFB A;  3G7L A;  5KIX A;  2HQE A;  1KAA A;  2VB2 X;  5LL6 X;  4RCN A;  5KGU A;  4X3U A;  1IW7 D;  4P2C B;  2K33 A;  1GUW A;  1EEI D;  1HPC A;  1U4P A;  4DN4 M;  3L9A X;  1HXY D;  2D5D A;  4KI0 A;  1F2L A;  3NTH A;  4FXG C;  4ULL A;  1ESF A;  1PRT D;  1NR2 A;  1I4X A;  2R92 B;  3OIP A;  1EIG A;  3S9W A;  3P1H A;  5C0X H;  1STG A;  3Q24 A;  3Q22 A;  1SJH D;  4KJN A;  1STH A;  4BWG B;  1Q1E A;  2Z1C A;  1ZKO A;  3KUP A;  5M5X B;  5A35 A;  1O7L A;  1HHV A;  1QE6 A;  3BVZ A;  4NW2 A;  2EYM A;  5M3M B;  2MGS A;  1ZYR D;  2MJ8 A;  1TWG B;  4IFD G;  3CRK C;  3PUZ A;  1C4Q A;  2DY8 A;  4HCS A;  3JAM L;  3SK4 A;  1EZ8 A;  4HCE A;  3EFX D;  2L1B A;  1DCZ A;  4QF4 A;  5K36 G;  1UNS A;  3QO2 A;  5FKA C;  1TWA B;  1DD2 A;  4KY7 A;  4FXD A;  2R7Z B;  4IFD J;  4A3K B;  1Y1W B;  5FLX E;  1QG7 A;  1R4P B;  2HUG A;  3FRP B;  3MXP A;  1NCV A;  1JOO A;  4RH6 A;  1LTS D;  3FDT A;  4PNY A;  1I6V C;  2K01 A;  2EYF A;  1EWH A;  2K5Q A;  2F4I A;  2XSC A;  3H0G B;  2A6H D;  1U9R A;  2V4D A;  1WTQ A;  5DAU A;  1PMR A;  1JOR A;  1X3Q A;  4DXF A;  5M3F B;  2F0F A;  2BOS A;  4CBV A;  5CYU A;  5CV6 A;  2WKC A;  4ZAI A;  5EKK A;  2PYK A;  4Z9C B;  3MVV A;  1A2T A;  4H44 C;  4DAV A;  2E75 C;  1ZYR C;  3GTJ B;  1OXV A;  3A7A B;  3M4O B;  2F03 A;  2RBM A;  1V1O A;  1YNJ D;  2F0Q A;  3K5M A;  1SYC A;  2YYZ A;  5EBC A;  2WV6 D;  2G9D A;  1WVL A;  2R3Z A;  1QIL A;  3WOF A;  3M7N A;  1TII D;  2R61 A;  1A3T A;  5KEE A;  2R93 B;  4ZKB B;  3J80 L;  2A68 D;  5JPN C;  3MTS A;  1G2S A;  1KTK A;  1F9R A;  3IKJ A;  4FP5 D;  1EY4 A;  1MGS A;  1I50 B;  1EU4 A;  4DK1 A;  1STY A;  1ENC A;  3OWF A;  4XYQ A;  1HFN A;  5FK9 C;  2VNU D;  1NSN S;  4DAY A;  2A73 B;  3SK6 A;  3SR1 A;  4IUV A;  1O78 A;  2VB3 X;  1O80 A;  2A6H C;  2ENB A;  4BA2 I;  1JWM D;  4IN3 A;  1V8Q A;  2EY1 A;  3M85 A;  1STB A;  1V43 A;  2Q8R E;  3AB9 A;  3PUX A;  2JP1 A;  1SNO A;  3HKZ B;  1SMY C;  3FKI B;  3GV6 A;  4CGY B;  3NWT A;  1XTC D;  3QOJ A;  4DNT B;  3Q0A A;  3ND9 A;  1TU2 B;  3VR5 A;  5JAV A;  1HA5 A;  2LMC B;  2NN6 G;  4O1N A;  3I3C A;  2JA8 B;  1JOK A;  2L5T A;  3MFY A;  3A8I E;  1YNN D;  2OF1 A;  1GXD C;  2E74 C;  1YNJ C;  1SNQ A;  2J7Z A;  2L4N A;  2NBF A;  4KN4 C;  3MZ5 A;  3TBI B;  1SAP A;  2IJ0 A;  3OHX C;  3RD4 A;  2XWJ B;  3LWE A;  2A68 C;  2F0T A;  1E0B A;  1STN A;  5COY A;  3MC0 B;  3RZD B;  4C3H G;  1SJE D;  1EY8 A;  2WB1 B;  4KHZ A;  5FOB B;  3DWA A;  2RSO A;  3D31 A;  5G3L D;  2L12 A;  2O2L D;  3K59 A;  5IIF A;  1CTM A;  1RTN A;  5M5Y B;  3TP6 A;  3S16 B;  1PTO B;  4A3J B;  3OSO A;  4ZUI A;  2SOB A;  2B2Y A;  4ZYS A;  1BO0 A;  3MA2 B;  5C3X A;  3J81 L;  1LTI D;  2AQ1 B;  4FF4 A;  4KHV A;  2QF7 A;  1OXX K;  2M00 A;  3N6R A;  1EYD A;  3V2T A;  1FNW A;  1CK1 A;  3MXU A;  1ZEQ X;  2EOT A;  1DOM A;  1YNN C;  2EDG A;  4KY6 A;  4CKB A;  4FF1 A;  2EJG C;  1F9Q A;  5IGB A;  4MHE A;  2O5J C;  4KY5 A;  2RA4 A;  1A3U A;  2ICI A;  5KYI A;  2F3V A;  1F2M A;  1S5B D;  2B8F A;  4OL7 A;  2L0C A;  4M8A A;  2SNM A;  5C5L A;  1MSG A;  3IAY A;  1ET9 A;  4B08 A;  3WOE A;  2KOL A;  1A2U A;  1TY2 A;  3HEJ A;  2PCF B;  1TKW B;  3VR2 A;  4H0L C;  4TQU S;  2IW3 A;  4TKO B;  5CBA E;  1HQM C;  1CT1 D;  4ZLT F;  1EY0 A;  3AU7 A;  1UEA B;  1ONL A;  2LY7 A;  3FVQ A;  4WRD A;  3MXG A;  1HTL D;  1STE A;  4HSV A;  5FLX L;  1BCP D;  4QB4 A;  2FMC A;  4MN3 A;  3PMF A;  4HN7 A;  3BS1 A;  4XQJ A;  4YIJ A;  1SNC A;  4C3J G;  1JQY D;  1CZG A;  1B1Z A;  2F3W A;  5C3E B;  1R4Q B;  1IKM A;  1O7Z A;  5M5W B;  3HP3 A;  4B9W A;  3TN2 A;  1QCB D;  2PMZ B;  3E6Z X;  4CJ2 C;  2NB0 A;  1I4G A;  4FO2 A;  5C0X G;  3D8G A;  1KLG D;  1E2Z A;  2H4O A;  3PV0 A;  2K1B A;  3I90 A;  3KBX A;  2F0O A;  3TZU A;  3TDQ A;  2FMM A;  1Y8N B;  2F0J A;  1HA6 A;  3GTO B;  5K5P A;  3SE0 A;  3I4M B;  1QWY A;  2F0S A;  3NK9 A;  1WTX A;  3S1Q B;  5C0X J;  1KDB A;  1IHZ A;  5IOC A;  3J7Y W;  1U4L A;  2N55 A;  2EYJ A;  3CRL C;  4G7H C;  1NUC A;  2RVL A;  2B39 A;  2WKD A;  1KDA A;  1SE4 A;  4HMJ A;  1BCP B;  4S3S A;  1B50 A;  4DAP A;  3S1R B;  2RSN A;  1QNK A;  1H9S B;  3PO2 B;  1VDZ A;  2EZV A;  2KED A;  4XT1 B;  1SNP A;  1SYD A;  3D4W A;  1I4H A;  5CV7 A;  2HCC A;  3NTK A;  2AUJ D;  1BCP C;  1F9S A;  4ID6 A;  3LNN A;  5ELB A;  1D1I A;  1Q8I A;  3D4D A;  3VYT A;  4N9P A;  4OO1 G;  5AFW A;  4LK1 C;  1B4O A;  2EJF C;  1I4R A;  3C1F A;  4XYO A;  3NTI A;  1HFG A;  1JWS D;  3E0J A;  3D4R A;  5EJW A;  1D5M C;  4UAI A;  2CVR A;  2O4X A;  4IZ8 A;  3K5L A;  2M2L A;  4FVM A;  1ENA A;  4J8Q A;  2Z4I A;  1GUN A;  1OXU A;  1EOT A;  1SFO B;  4PQX A;  3VR4 A;  3GO5 A;  2JXM B;  1BXT A;  5BN4 A;  2VXW A;  4IUR A;  3IFT A;  1EY7 A;  4FF2 A;  2DNE A;  3T51 B;  2DNC A;  3NSW A;  2LFN A;  1TQO A;  5IOD A;  2B2T C;  3NQI A;  1EY6 A;  3J7A V;  2J4X A;  4L63 B;  1STA A;  4JK1 C;  1JOQ A;  1TY0 A;  5D3D A;  2A5H A;  4I7Z C;  4WJW A;  1SNM A;  4J1M A;  2PZT A;  3NHH A;  1EZ6 A;  5CR3 A;  2KJX A;  3DEP A;  5ELD A;  4RKB A;  4QUF A;  3H91 A;  1DOK A;  3URY A;  3DMU A;  5D65 A;  1S5E D;  1CA5 A;  1PTO H;  3HOU B;  5C5M A;  4CHT B;  2A6E C;  4U68 A;  2MPM A;  3TP5 A;  3GQB A;  3BDO A;  1AZQ A;  3TZD A;  3D6C A;  1WTP A;  4FXK C;  3TME A;  1GHK A;  3U9O A;  5JVH 3;  1EY5 A;  2L11 A;  2XVS A;  1CM9 A;  3OIQ A;  1OO9 B;  1GUS A;  1FNU A;  4ODG A;  4H13 C;  1AZP A;  4R8N A;  5D14 A;  1E2W A;  1KNE A;  1Q12 A;  2N88 A;  3VR6 A;  1DM0 B;  2IWH A;  1L0Y B;  5DEH A;  3J7A F;  1PRT B;  3CQZ B;  1QNU A;  1IW7 C;  3A7L A;  4K6L A;  4HR7 B;  2QIL A;  3BG3 A;  2NTS A;  3EVQ A;  3MWY W;  3H6M A;  3CHB D;  5DM7 3;  5CV4 A;  4ZQ3 A;  1PRT C;  2D2C C;  3DUZ A;  1D1K A;  1A6X A;  2F0W A;  1K83 B;  1LV9 A;  5EKL A;  5HUR A;  3R2T A;  3OWE B;  1XX8 A;  2HCI A;  3NE5 B;  5EGT A;  4RAU C;  4IQZ A;  5KNC A;  2BCO A;  5CGK A;  4A3B B;  4LMQ D;  5JVG 3;  4DXG A;  2ZXR A;  3RUZ A;  1RD9 D;  4QMG A;  1K8M A;  1BBX C;  2JEA I;  1V1P B;  1HRJ A;  2A74 C;  3QB3 A;  3NPP A;  4A3F B;  5T1I A;  3EA6 A;  1FYC A;  4KK7 A;  4LAA A;  4HED A;  5I9O A;  2RQX A;  1A15 A;  4C3H B;  3PIO 3;  3G6J B;  1BOS A;  5KYL A;  2EXZ A;  4K5V A;  1VF5 C;  1C8C A;  3VYR A;  3S14 B;  4A3D B;  3C1E A;  5FO8 B;  1DXM A;  2CQA A;  2MUY A;  3LWU A;  4RKL A;  4EVO A;  1LT5 D;  4PV1 C;  5ISR A;  1A3V A;  3GV3 A;  3NQT A;  1GUG A;  4WFN 3;  5BN5 A;  1W6K A;  3KF8 A;  4OGQ C;  4ILW A;  1SBB B;  3FEW X;  2NVY B;  2A69 D;  2Z4H A;  5TSS A;  5DNF A;  4V0B A;  4RCO A;  1EYA A;  1PLF A;  2XWB B;  1BQQ T;  2Y0S B;  4BY7 B;  2EYP A;  2QDB A;  1WCM B;  4BA1 I;  3OW7 A;  2EY2 A;  4K8I A;  4IUP A;  1CZW A;  4X3T A;  3MXN A;  5A2Q E;  4C1N I;  1VMP A;  2DY7 A;  4Y7N B;  2QCP X;  4KD3 A;  3PO3 B;  2CHB D;  1K8O A;  3U9S A;  3VYU A;  4A93 B;  2X6G A;  4IFD H;  3BYY B;  1J8I A;  4A3G B;  3AMU A;  1JB3 A;  3C46 A;  3TP8 A;  1HCZ A;  1LAC A;  4DK0 A;  4KN7 C;  2B2W A;  3ONA B;  1D5X C;  1O7Y A;  4V19 0;  3RMH A;  1E2V A;  5K36 H;  1Y8P B;  1JE4 A;  2ZT9 C;  3GTP B;  3WDN A;  1IKL A;  3MHB A;  5EQ0 A;  5COR A;  2KQ3 A;  4XQN A;  4IFD I;  1SYE A;  4C56 C;  1TWH B;  2PW7 A;  1WTR A;  4C3J B;  1TWF B;  4RHR A;  5DM6 3;  1M8A A;  1AN8 A;  4F88 A;  2A69 C;  4IUT A;  1FD7 D;  5IT9 E;  2K5D A;  1MI2 A;  3GP7 A;  2B2U A;  2I07 B;  3PUW A;  3GTG B;  2F0I A;  2KEC A;  1WD0 A;  2PZW A;  5KNB A;  2SEB D;  3V96 A;  2WAC A;  5C4X B;  5IGE A;  1RF2 D;  3ND8 A;  3OOC A;  1RKN A;  1SDF A;  4G7O C;  4ZK9 B;  3RLF A;  2B63 B;  1RJT A;  4NKL A;  3BVM A;  5JEA H;  4F87 A;  2NYZ D;  4L8J A;  2FIN B;  3MFG A;  2EY5 A;  3FPU B;  3QIA A;  3DEO A;  1SXT A;  4BBR B;  1IL8 A;  4RA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...