2ZM6Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zm6Q00
3PUYA 4DKAC 4UY8C 4DUZL 1UE7A 4JYAL 4DV3Q 2WAQE 4LFCL 4DR4Q 1E22A 4GN4B 1EUJA 2VQFL 1VQHA 1Z9FA 2UUCL 3ICEA 3RNUA 4JI5Q 2OCEA 3A5ZB 3S1NH 3TREA 4JV5Q 4PMWA 1N34L 3CW2C 1Y1WG 5EAYA 3NBHB 1UWVA 2MQHA 1S72A 2JK8A 4C3HH 3BJUA 4IPGA 1NMGA 2NZHA 5J3BA 5C0XG 4X65L 1BVSA 3A74A 1UEBA 1VQCA 3IRBA 2RHSB 3RLNA 4DK3C 2YV5A 5IT9c 3PO2G 2UXCQ 1LUZA 2NN6I 1Q86C 5IWAL 3K7UC 3PO3G 2DGYA 1XMQL 3K0XA 4APVA 3S17H 5ELNA 3CCQA 1Y1WH 1PH8A 2ID0A 3S1RH 3K81C 1HNZL 2AKWB 3D31A 4YCUA 4JI2Q 3U4VA 1E24A 2YTYA 1HR0W 4YWMA 1PYBA 1C7YA 1HZBA 1HNXL 2QA4A 1J5EL 2R92H 4DR6Q 4GKJQ 2B3GA 3PO3H 3KF6A 1MJCA 1Q1EA 4UPAA 5AJ3L 3PIPA 3STBD 4DR3L 3F1ZA 1C9OA 2D0OA 2ZTEA 2IT1A 1QUQB 4OWTB 4A75A 1N36Q 1CKOA 4JI1L 1VQ7A 3HOYG 5JJIA 2MFIA 5LMNW 1XTDA 4DPGA 5H1SE 3CF5A 1XPOA 3MXNB 2YYZA 3AFPA 4HJAA 2R6GA 1YBYA 1X6OA 1L1OC 1L2FA 3H3VH 3M85A 4LF7L 1XNRQ 1T9HA 2EIFA 3L0OA 3NENA 2MO0A 1V43A 4LUZA 2KCTA 1A8VA 1BBUA 2K14A 2CQOA 5GROA 5HGQA 3KDFA 2VY3A 5LMUQ 4A3FG 4JI6L 2K5NA 4R4TA 4JBKA 2RF4A 4B3TQ 2D62A 4X62Q 2I5LX 3HOVG 4BY7H 2QEXA 3K8AA 1IBMQ 2E5LQ 2RHQB 1CKNB 1I3QH 4HJ9A 1FVIA 4P71A 4GNXB 4KLKA 4LF6L 1WFQA 2JEBI 3CC4A 2VQEL 3HOZH 1IBLL 3HOUH 3CCJA 1PYSB 1X56A 3TS2A 3KF8B 2BH8A 1G291 3HKZE 4A3FH 2JA9A 4DV4Q 2N8NA 3KOJA 3PUWA 4DV5Q 1XMOL 4YHHL 1Q46A 4J15A 1PH6A 4LUOA 3L7ZC 2JE6I 3CCSA 4Y52H 4JOIA 4DV0L 1FGUA 4NB3A 4B3RL 5C44H 4HJ5A 4OWWB 2VW9A 1TWGH 3ULLA 1HH2P 1NTGA 4NPSA 3RR5A 5M3FG 2PMZE 3U4ZA 1EYGA 4JI7L 3KYHC 3S2HH 2E8GA 4XIGS 3AYHB 5IYBG 4GKKL 2EQSA 4K0KL 1JJGA 1YITA 2Q2HA 4KHPQ 1CSQA 4BBRG 1UE1A 3GD7A 3PUVA 1MKHA 3G6EA 5C4XH 2ES2A 4IFDJ 3ER0A 4R1JA 2Z6KC 4AQYQ 4JI8Q 1V9PA 4ME3A 4LF9Q 2B63G 2VNUD 3CCVA 3EIVA 1Q82C 1PH7A 1XNQL 4LUVA 4BA2I 2LXJA 2WP8J 4PZ6A 2JA5H 1KRSA 2JA6G 2OWOA 4OXPA 2N3SA 3CMEA 3M3YH 5IYCG 5E7NA 2K50A 4DV2Q 4LFBQ 4A3LG 1IYJB 4BBRH 4AH6A 4C3IH 2E2HH 3GTOH 4MTNA 4YY3L 1M1KC 3AEVA 2PQAB 1HNWL 5JEAG 3JAMi 3CXCA 3I7FA 4GLXA 4WJ4A 4DUZQ 3G48A 5K36G 3H15A 2C35B 2JA6H 4LFAQ 4JYAQ 1BKBA 4IJHA 1LM0A 4LF8Q 1EIYB 1B70B 4BY1H 4QJFA 4BBSG 4A3LH 1K8GA 3ZJYC 1P8LA 1U5KA 1KIXA 1AH9A 4B3MQ 3S1QH 1YJ9A 4A3MG 4DR5L 3F8TA 3G71A 3LGJA 1HZCA 5IY0A 3CPWA 3RZDH 1N34Q 2AHOB 4A3KG 1KQSA 4DV6Q 1JT8A 3EBEA 2R7DA 1SFOH 3CD6A 3GTQH 1Y1VH 2XGTA 4UP7A 4BBSH 1YHQA 2K52A 4MNOA 2Y0SG 1VQMA 1NJIC 2NVYH 3UDIA 4EX5A 1NY4A 4GLVB 5IWAQ 1EQQA 4NXMQ 1U0LA 1XMQQ 2HHHQ 4A3MH 1KD1C 4P72A 5M5YH 2UU9L 4IJLA 4A3KH 4HJ8A 3KLWA 2WB1E 4MZ9A 1IZ6A 4DV7L 1HNZQ 2JA8G 3HOWG 1YJWA 1LTLA 4YCVA 2WFWA 1X9NA 2YTVA 4A76A 4DK6C 4LF4Q 1YHBA 1HZAA 4A4IA 3A0JA 4A3IG 1MIUA 3PGZA 1IBKL 2OQKA 3J81j 3TEHB 4L5QA 1XPRA 1KC8C 3I4OA 4JI1Q 2UUBL 1I6HH 2JA8H 1E3PA 4DV1L 4NXNQ 1VQDA 2KENA 4H02A 2JA7G 4GN5A 1N32L 3PIOA 2IY5B 2GN5A 2GVAA 4XTCS 2YTXA 2R7ZG 1YHAA 3PO2H 3CCMA 4A3IH 2E2JH 4JI6Q 1GO3E 4JI4L 2WAQG 3S14H 3ULPA 1HZ9A 1E1OA 5IP9G 3DM3A 4IPHA 2ZM6L 4A3GG 1VQJA 4JG2A 1NMFA 5FJ8G 5IYDG 1G51A 4DR1Q 2JA7H 1BBWA 5IE8A 4FDBA 3OTOQ 4GOPA 4LF6Q 1RIPA 1PFSA 1FL0A 2YU9H 1YJNA 3CQZH 3ULJA 5M3MG 1K9MC 1VQNA 2UXBL 2R7FA 4DR2Q 3E9HA 3KFUA 1XMOQ 4GLAC 5IP9H 3S16H 1OXXK 3HKSA 4A3GH 4HIKA 5IP7H 3OYYA 4GS3A 4P74A 4C3JH 1ASYA 4B3SL 4POGA 3HOYH 3ERSX 3I2ZA 4DAYB 5M5XH 4PZ8A 4X66L 5IYDH 2Z0SA 5GAEC 1PH4A 2ASBA 3S24A 3KF6B 2HT1A 3HOUG 1W3SA 1VQOA 5M3MH 4LF5L 4X64L 2Q2UA 1AE3A 1TXYA 2K75A 2KHJA 3BU2A 4JI0Q 2ZJRA 4GKKQ 4K0KQ 2UXDL 4JI2L 1EWIA 4IOAA 1HR0Q 5BR8L 2VUMG 1YI2A 1LYLA 2F4VQ 3M4OH 3HOVH 4BXXG 4GKJL 1XJVA 5M5WH 4R4QA 4GOPB 3JC66 4A3JG 4DNIA 4A3DG 3G4SA 1PA6A 3T1YL 2QGQA 2NZOA 3CPFA 1KHIA 3NELA 3RN2A 3PUXA 1EFWA 3J80c 1N36L 2HIVA 4A3CG 3KDFB 2JQOA 5LMNQ 5C0XJ 1SROA 1WCMG 4JI3Q 1VS0A 2CCZA 3E0EA 1PH9A 4BXXH 2AWNA 1IL2A 4QGUA 1VQEA 1GKHA 4HIDA 1E1TA 3SGIA 4A3JH 4YY3Q 1XNRL 2I5HA 2OTLA 2R93G 4R4IA 1QVGA 3J7ZC 4OX9L 4DR7L 3VDYA 1HNWQ 5LMUL 2ZJQA 1FJGQ 1WI5A 2OQ0A 1GVPA 2AWOA 4O2DA 5M3FH 4X62L 4A3CH 4DUYL 5IYBH 4C2MH 1IBML 1WCMH 3T1HQ 3RZOH 1I5FA 1A63A 1TWCH 1VQIA 1JMCA 1VQGA 2K5HA 2VZAA 3CC7A 3S2DH 4RMFA 2OTJA 4P73A 1P16A 1W2BA 5HY6A 1OXVA 4KI0A 4OWXB 2F52A 1D7QA 1X55A 2R93H 4OONA 2B63H 4L5TA 2JJQA 4YCWA 2GVBA 1I50H 4DV5L 1MJEA 1VQLA 4JCVE 1VCIA 3STBC 3I4MG 4JBJA 1L1OA 1X65A 2UUAL 1N33L 3J81c 1DGSA 4LFCQ 2K4KA 1KXLA 2MO1A 5IYCH 2VQFQ 1QVCA 1YNXA 2Y0SE 3GO5A 3W1GA 2UUCQ 3CC2A 2JEAI 3PSIA 4RG1A 1VQ6A 3H0GG 2UU9Q 2XTIA 3M7NA 2AMCB 2N78A 1K73C 3I4MH 4PG3A 3UDFA 1S40A 3PCOB 1CKMA 2CKZB 4GNXC 1C0AA 1QZHA 4AQYL 4JI8L 4X65Q 1Q12A 4LNQA 2D0PA 1K3RA 3GTLH 3NEMA 1CUKA 4A3BG 2CWPA 1IBKQ 2ZJPA 1NBWA 3MEFA 2PNHA 2LXKA 2A1AA 2IHEA 4P75A 4POFA 4QY7A 4DV2L 2K5VA 4DV1Q 2CWAA 1I94L 3TQYA 2ALYB 1HJPA 1YVCA 3I4NG 1N32Q 3HOXG 5ELOA 1K0RA 3OW2A 1HNXQ 1SR3A 1J5EQ 1SMXA 3PF5A 1QVFA 1KRTA 2BH2A 1YIJA 4TQUS 2Z6KA 4EQ5A 5AJ3Q 4JI4Q 4LFAL 4AYBG 4HJ7A 2E2IH 4LF8L 3GTPH 4DR3Q 1KL9A 2ZTCA 3FKIG 2ZM6Q 1S3OA 3HOWH 1CSPA 3GTJH 2HIXA 4AIMA 4DAMA 3I4NH 2IHFA 1GD7A 3HOXH 4B3ML 4A3BH 2RCNA 1NE3A 2VS1A 1VQPA 3B6YA 3M9BA 5JJKA 3CAMA 1X54A 4HIMA 2BA1A 1QZGA 1EOVA 3I55A 4LF7Q 4YWKA 4DV6L 1TWFH 2UXBQ 1X3EA 1VQ5A 3FP9A 2KBNA 1QUQA 1Q1BA 4JOIC 3GTMH 5GQOA 3AFQA 4DV3L 2L15A 4DR4L 4OO1I 3FKIH 3HFZB 1Y14B 2R92G 4R4CA 2FXQA 4B3SQ 2PI2E 1VQBA 2BA0A 4JI5L 4IFDG 4NXML 4X66Q 3Q8DA 1K8AC 2HHHL 1VQAA 3KJPA 1OXUA 1IXRA 2LSSA 5GAGC 4YWLA 5JEAJ 4LF5Q 4X64Q 2VQEQ 2R7ZH 4JV5L 1PVOA 1IBLQ 2UXDQ 1J6QA 1UE5A 2VL6A 3GTGH 2WB1G 3S15H 1SRUA 5BR8Q 3M4PA 4KHZA 3PUZA 3UDGA 1CKNA 1EQRA 4YHHQ 2A8VA 4GNXA 1TWHH 4LF4L 3S1MH 2NVXH 2UXCL 1Q7YC 5FJ8H 4IOCA 1SLJA 4DV0Q 4B3RQ 3T1YQ 1WOCA 5IP7G 5JJLA 4IPCA 1KAWA 3HOZG 3BZCA 4ALPA 1E7ZA 1L0WA 1VQ9A 2I5MX 1VQ4A 3W1BA 3CCRA 4JI7Q 1A62A 1XPUA 4BY7G 2IX1A 1H95A 4TVAB 1YZ6A 4NXNL 3UE0A 1PH5A 3FHWA 3CP0A 3J80i 3RLOA 3CCLA 4DR6L 2F3IA 4UP9A 2A19A 3WWVA 1JB7A 4OX9Q 2ATWA 1XNQQ 4GN3B 4BA1I 4DR7Q 1VQ8A 1G6PA 5FLMG 3U50C 3BZKA 1YEZA 2CFMA 4DUYQ 2B29A 2ZTDA 4R4OA 5C44G 4DR1L 2VUMH 3OTOL 1UE6A 1ASZA 3U58A 4A3DH 2IX0A 3EN2A 1VQFA 4LW1A 3F2CA 3E9IA 3F2DA 4DR2L 5FLMH 1PHJA 1GM5A 3TS0A 1RL2A 1OXTA 2UUAQ 1X3FA 1O7IA 1A0IA 3UDXA 3RN5A 4B3TL 1N33Q 5C4XG 3AQQA 4JBWA 4O0AA 2KCMA 2E5LL 2DUDA 1JJCB 1PV4A 3J81i 4WJ3M 5C0XI 4OO1G 3UE1A 4UP8A 1Q8KA 2PQAA 4JI0L 1JE5A 5GADC 4A93G 2NN6G 5C4JH 1OXSC 4HIOA 1SN8A 1WJJA 4DR5Q 4LWCA 3K80C 1JJ2A 1HR0L 3HKZG 1AE2A 1EIFA 4DV4L 2PI2A 3CCEA 2I0QA 1K83H 2F4VL 4IFDI 3L2PA 1N8RC 3CCUA 1R9TH 3PV0A 4QL5A 1SE8A 1Q81C 1B8AA 1OTCA 5GAHC 4QIWE 4JBMA 3GDEA 4L5SA 5FLXc 4A93H 5LMNL 3PF4A 3RLFA 4BY1G 4JI3L 2NVTH 3GTKH 1Z47A 3H3VI 2N49A 4DV7Q 4Y7NH 4KHPL 1I94Q 1WYDA 2H5XA 1PH1A 2EXDA 1X3GA 4IO9A 4LF9L 4JC0A 4A3EG 3F2BA 1FJGL 5C3EG 1VQKA 3K7AH 3A5UA 4PZ7A 3TRZA 3M4QA 4AYBE 2V1CC 1Y1VG 3J7A5 1N9WA 1PH3A 3H0GH 1TWAH 1L1OB 3T1HL 4X6AH 4GOPC 1B7YB 3DLLA 1M90C 2JA5G 2Q2TA 2UUBQ 4LFBL 4L5RC 2HQLA 3JAMc 2Q2IA 2NVQH 3W5OA 1PH2A 1V1QA 3KJOA 3D0FA 4A3EH 5DLQE 1D8LA 3CMAA 4IPDA 4QQBX 5C3EH 2MNAA 3I56A 2KHIA
chains in the Genus database with same CATH superfamily
4JYAL 4XT1B 1E22A 3D6CA 1EUJA 5DM73 1LTRD 4TSSA 3C1FA 3KBGA 3CW2C 5I9PA 3S2DB 1G91A 1MD2D 2JK8A 4H44C 1NMGA 2NZHA 4OIJA 5C0XG 1WVLA 2B63B 2L4NA 1VQCA 3IRBA 1MI2A 3SK4A 5DM63 4QF4A 1XMQL 5D65A 2O5IC 5IODA 3K81C 2AKWB 2DNEA 3R3OA 4KTAA 1LABA 1RODA 2EY5A 1J5EL 3PO3H 3KF6A 1MJCA 1Q1EA 4UPAA 5AJ3L 3PIPA 4A75A 1V1PB 2IT1A 4OWTB 1EIGA 1N36Q 1CKOA 5JJIA 2TSSA 3LX0A 5H1SE 1K0SA 2FHTA 2YYZA 3X3MA 2R6GA 1L2FA 3Q24A 3H3VH 3M85A 4LF7L 2EIFA 1JORA 3NENA 4LUZA 3VA7A 3A8IE 3D8GA 5DAUA 3HOVG 1KDAA 4RHSA 1EU4A 1ENCA 4DNRB 2TMPA 4KLKA 1F2YA 5JPNC 1WFQA 1IBLL 4HCEA 1PYSB 3I4NB 3M4OH 2JA9A 4DV4Q 3PUWA 4E6IA 2QF7A 1KAAA 1SNOA 1Q46A 2SOBA 1FGUA 2VW9A 4DA2A 3RR5A 2PMZE 1YNJD 1FD7D 3U4ZA 3S2HH 5EPLA 4DK1A 2EQSA 2VB3X 4S3SA 5CV5A 4FF1A 1SE4A 5C5LA 1EYCA 2L55A 3GD7A 2ES2A 1MKHA 4PQXA 3BS1A 2B63G 4ZQ3A 3URYA 3F2UA 1Q82C 3E0JA 4U673 1PH7A 3T4AC 3PIP3 4PV1C 1JOKA 2NVXB 4IUTA 3M3YH 2NN6H 3CMEA 2NB0A 2K50A 5IGDA 4A3LG 1QG7A 1D2BA 4C3IH 3GTOH 4X3SA 4IN3A 4MTNA 4HAEA 1HNWL 3I70A 3T56B 3I7FA 4HR7B 3G48A 2A73B 4JYAQ 2E76C 4QJFA 5G3LD 4IUNA 2KEDA 1K8GA 1SNMA 5A2QL 5CMDA 4JVZA 4K8JA 1GUSA 2A6HC 3G71A 3LGJA 1HZCA 5IY0A 2F3WA 1ET9A 1JT8A 3EBEA 3GTQH 3CD6A 3V96A 4A3DB 2OT2A 3GQBA 1JQYD 1WTQA 1BO0A 4EX5A 1NY4A 1XMQQ 4A3MH 1ML0D 4P72A 4L63B 4CKCA 1JWUD 4DV7L 1IZ6A 5CGKA 1TT2A 1YJWA 2SEBD 1RHPA 5EPJA 1WD0A 4ID6A 1EY0A 2JP1A 2XRQD 5IGEA 3A0JA 1PDQA 3PGZA 1IBKL 2OQKA 2QDLA 1XPRA 3TEHB 1KC8C 2F1MA 1LT6D 2UUBL 3DEPA 1E3PA 4G57A 5COYA 1SJED 1STGA 1VQDA 4GN5A 3PIOA 2JXMB 3HKZB 1A3UA 5IGCA 4A3IH 5EBDA 1UNSA 1EFID 4JI4L 4FF2A 5IP9G 3DWAA 4K6DA 3K7AB 5IYDG 1G51A 3ZYYX 2JA7H 4OHJA 5IE8A 3OTOQ 1RIPA 2QILA 4Q0FA 2RDHA 1PFSA 1FL0A 1U4MA 2YU9H 1YJNA 3CQZH 3ULJA 1U4RA 2NBFA 1BQQT 4XDXA 4DR2Q 3E9HA 3S9WA 4OEMB 3S16H 3IL8A 3HKSA 5E1FA 4ZRZA 2MHVA 3OYYA 4K5XA 3CKIB 1ASYA 4XXEA 1PH4A 3NQIA 4LF5L 2KHJA 3BU2A 5C3WA 4DF7A 1LYLA 3S1NB 2CW0C 5L37A 3HOVH 4GKJL 2IWHA 4KKSA 4A3DG 1PA6A 3CPFA 2KHSA 3NELA 1RKNA 1QILA 1X32A 3KDFB 2JQOA 5C0XJ 4H0LC 1STHA 1SROA 1WCMG 3NQTA 1PRTD 1VS0A 3PIO3 2CCZA 2O5JC 1XXGA 2AWNA 1E1TA 4CDCC 4IZ8A 2R93G 1QVGA 4RA8A 2PW5A 1HNWQ 5LMUL 1FJGQ 1GVPA 5EPKA 1PTOF 3T1HQ 1ZEQX 1VQGA 3J7AF 3S2DH 4P73A 1W2BA 1EQTA 1OXVA 4OWXB 1X55A 1LTSD 1HQMC 1LTBD 4YCWA 1KNAA 2B63H 5ELDA 4HMIA 1VQLA 1VCIA 3STBC 1EEFD 3EJIA 5J39A 2PW7A 2UUAL 5C4HA 2EE1A 3KLSX 3J81c 2VQFQ 1YNXA 3W1GA 1WTRA 2UUCQ 4X3KA 1F2MA 4RG1A 3HP3A 1LTGD 2F0GA 1G6ZA 1C0AA 3HOUB 2CQAA 4JI8L 3T16A 4A3FB 1TIID 3NEMA 1CUKA 1MHWC 1WTPA 4K2LA 1I4GA 2CWPA 1IBKQ 1NBWA 5C44B 4POFA 2F0FA 4UHVA 1YVCA 2J4XA 1DM0B 3OIPA 2B8FA 3I73A 3Q22A 2ENBA 2Q8TA 2BH2A 1B9MA 1MGSA 4JI4Q 4LF8L 2F0EA 4DR3Q 2K04A 3FKIG 2PYKA 3C3LA 1SXTA 2HIXA 3I4NH 3SVMA 2IHFA 4B3ML 1YNND 2RCNA 3NSWA 5A35A 1NE3A 4F88A 2EYOA 3M9BA 4OELB 2BA1A 4DV6L 1X3EA 5GQOA 2X69A 3OMCA 3D4DA 2G5DA 1GOZA 1K8AC 1VQAA 1IXRA 4BY1B 4YWLA 4C1NK 4LF5Q 3VR6A 3S1QB 3OOCA 5IGBA 2K01A 4YHHQ 1VMCA 3IFDA 5C3EB 2AQ1B 2NVXH 4K8IA 4IOCA 4DV0Q 5IP7G 1Y1VB 2HQEA 2WIIB 1VF7A 4IPCA 4QB4A 3Q6SA 4ALPA 1ICFB 2I5MX 3E3XA 3IFTA 3W1BA 3CCRA 2NVYB 4JI7Q 1H95A 2IX1A 3OHXC 1AFPA 3U9OA 4A3KB 2ZXPA 3VR5A 1JB7A 2ATWA 4BA1I 2NYZD 2F0WA 1G6PA 1CT1D 3JAME 3U50C 3BZKA 3FRPB 1JC7A 1B53A 5C44G 4ULLA 2PZWA 1II3A 2KOLA 2K03A 2JA8B 2EJFC 3U58A 2IX0A 4A3DH 2A68D 1PHJA 3J81L 2UUAQ 1O7IA 2XVSA 4Q5VA 3PO2B 5KYIA 4JBWA 2KCMA 2E2JB 1JJCB 4R8IA 4WJ3M 4OO1G 1Q8KA 4A93G 1JJ2A 1WJJA 3W2DA 3D3RA 1Q3LA 2I0QA 4OIKA 5C4ZA 2F4VL 1TY2A 3L2PA 1PFMA 2XWBB 1JE4A 2XWJB 4QL5A 1H9JA 2EJMA 3H6MA 3MXUA 2F0NA 3V2TA 4A3GB 3GDEA 3HOYB 2Z4HA 4RH6A 3RLFA 5M5XB 3NTKA 4BY1G 4JI3L 2Z6BA 3SR1A 1GHJA 4ME5A 4KHPL 1WYDA 4RCOA 1S5CD 2F0PA 4IO9A 1VF5C 5C3EG 3K7AH 3A5UA 2B8GA 1Y1VG 3J7A5 1PH3A 4O1NA 4GOPC 1M90C 4EVOA 2OF1A 3JAMc 4N8X1 4WJWA 1PH2A 3KJOA 3QIAA 1SNPA 2CH4W 3P75A 5DLQE 3SXHA 1JB3A 2BDOA 3PUYA 1UE7A 2BCOA 2WAQE 1KDBA 4LFCL 2K5DA 1SAPA 3R2IA 4ZAIA 3RZOB 5ELFA 1SNDA 2DN8A 3TMEA 3S1NH 3MXGA 3K5LA 1AZQA 4N9TA 5EAYA 1RTOA 4IPGA 3N6RA 3NBIA 1BVSA 1F9PA 2RHSB 2YV5A 3PO2G 1SEBD 1G8ZD 5IWAL 3K7UC 3PO3G 2DGYA 4ZUIA 5DNFA 1JWMD 2F0QA 1EWHA 1M8AA 1I4XA 3CCQA 1PH8A 1EY7A 3D31A 3NK9A 4JI2Q 1STEA 3TDQA 3VYSA 3X3NA 2YTYA 1HNXL 2QA4A 3I4MB 1MBYA 3VR2A 3O13A 4KK7A 3NXWA 2SNSA 5FKAC 2D0OA 1Y8NB 2KVMA 1QUQB 2A6ED 4PMBA 3K5NA 3HOYG 4N9PA 2F0UA 2PZUA 4RKLA 2B2VC 1IYVA 1HUNA 1YBYA 4BS9A 2B2YC 5K5PA 1XNRQ 2V4DA 1L0YB 1V43A 5GROA 5IP7H 2K14A 2MP1A 3QR8A 3KDFA 2VY3A 4JBKA 4R4TA 4ZCKA 3NTHA 1TVXA 1CKNB 2KUMA 2E2IB 4I7AA 4IQZA 1D6EC 4LF6L 2F0KA 3CC4A 2A69D 5ISRA 2VQEL 3HOUH 3TS2A 1G291 4A3FH 2F0VA 1DJRD 2N8NA 1C4QA 1V8QA 1XMOL 4J15A 4CKEA 2WKCA 3L7ZC 4A3IB 4B3RL 4NB3A 5C44H 3H91A 2F0IA 3BVGA 4DU9A 1HPCA 1B9NA 2E8GA 3HEJA 4XIGS 3AYHB 5IYBG 3K58A 4GKKL 2KEEA 1JJGA 1YITA 2Q2HA 4KHPQ 1CSQA 1TU2B 2BE5D 3RD4A 1K8MA 1UE1A 3PUVA 1HFGA 3J7AV 3GTGB 1ESRA 4C3IG 3S15B 3ER0A 2VNUD 2Z6KC 3E5SA 3CCVA 3EIVA 3KLSA 1XNQL 2AUKA 4LUVA 4DNTB 2WP8J 4KY5A 1A15A 1O7YA 1S5FD 3S1MB 4OXPA 2N3SA 5IYCG 3I91A 3RUZA 5I6YA 1PZID 2A5HA 1BBXC 1UAPA 1ILQA 1SE3A 1M1KC 4KKUA 3HZXA 4KN4C 3CXCA 3D4WA 4F87A 3TP8A 4LFAQ 2E74C 4TKOB 1B70B 3R2TA 4BY1H 2VB2X 1ICWA 3ZJYC 1P8LA 2HCIA 1AH9A 2EVBA 3S1QH 4A3MG 4DR5L 1FNUA 3CPWA 2VUMB 1BCPF 4PMCA 1V1OA 1Y1VH 2EY6A 1QOHA 2K52A 3DXJC 2Y0SG 4QUFA 2NVYH 3A8JE 5IWAQ 1EQQA 1A2TA 1IHZA 3E6ZX 4RGTA 2UU9L 4IJLA 1FNVA 3BVZA 4A3KH 3EQLC 1J8IA 1Z7TA 5KNCA 2RSNA 2B2WC 3J80E 1A3TA 1X9NA 4LF4Q 1HZAA 3KLRA 4A3IG 1MIUA 4LAAA 1HXYD 1DD2A 1SE2A 1QJOA 2JA8H 1JOOA 4H02A 2JA7G 2GVAA 3PO2H 2FMMA 5KNDA 2E2JH 1GO3E 1H9KA 1EQVA 1EIHA 3OSOA 3DM3A 2O4XA 4JG2A 4FF3A 1I4HA 1ZYRD 4GOPA 4LF6Q 4KJNA 2F0JA 2R7FA 5NUCA 1W6JA 4A3EB 1XMOQ 4A3GH 3HOYH 4GS3A 4B3SL 5BN4A 4DAYB 1HTLD 1TS4A 5M5XH 4X66L 2Z0SA 5GAEC 2PNRC 2ASBA 3S24A 3J7YW 2HT1A 4X64L 1AE3A 2K75A 4JI0Q 4GKKQ 2UXDL 3IKJA 1EWIA 4IOAA 5CV6A 5BR8L 2VUMG 2J7ZA 5JJZA 5LL6S 1TS3A 2LS01 2G9DA 4DNIA 4CDFC 4C3HB 2QGQA 2NZOA 2N88A 4MTKA 1NSNS 3P20A 1EFWA 3J80c 3C46A 2HIVA 1FYCA 3MXPA 1ONLA 4G4KA 1QNKA 4JPBW 3M7GA 4BXXH 4DFAA 1IL2A 1VQEA 1GKHA 1H9SB 1PRTB 1Y1WB 1QNUA 1CA6A 1SNCA 4DR7L 1DONA 1NR2A 1Z6HA 3NWSA 4RGOS 2ZJQA 4G7OC 4O2DA 1SBBB 3Q0AA 4X62L 1IBML 5IYBH 3ERQA 3ITPA 3RZOH 1VQIA 1JMCA 2D9UA 4C56C 5D3IB 1S5DD 4RMFA 4DGZA 2ZT9C 5HY6A 4KI0A 1D7QA 2HCCA 2WB1B 5JVH3 4OONA 5FOBB 2WACA 2B2VA 4M8AA 1LACA 4DV5L 2XSCA 4JCVE 3R8BA 4JBJA 2B2YA 1X65A 2EZVA 1DGSA 1C8CA 5IOCA 5IYCH 1BDOA 2Y0SE 4CJ1B 1DOMA 1SYDA 4KHVA 1EWCA 3C1EA 2JEAI 4BY7B 1SMYD 3T53B 5LHY1 1LV9A 3TBIB 4DAVA 1I3QB 2UU9Q 5IIFA 2AMCB 3I4MH 1S40A 2CKZB 2F0TA 1CZWA 1GUOA 4AQYL 1Q12A 2X6GA 2D0PA 1D5MC 1Y69U 2ZJPA 3MEFA 2PO4A 5M9OA 5ELEA 4P75A 3SHLA 2IHEA 2HDLA 1RDPD 4HN7A 4DV2L 1CFMA 2ALYB 4JW0A 4IALA 3I4NG 1LTAD 1K0RA 1J5EQ 3SK5A 3PF5A 1YIJA 4TQUS 1SYBA 2MGSA 2Z6KA 4EQ5A 5AJ3Q 4NP5A 2E2IH 2QKIC 1RF2D 1KL9A 3HS0C 2QDBA 1GD7A 1SDFA 1CHQD 3P7JA 4CHTB 3CAMA 5KEEA 1X54A 4BBRB 4HIMA 1EOVA 3I55A 1CHPD 1DXMA 4YWKA 4LF7Q 2RDFA 1EY8A 1QUQA 4DV3L 2L15A 4IUPA 4R4CA 2FXQA 4B3SQ 4NXML 2JA6B 2DJFC 3Q8DA 4X66Q 2HHHL 5I4DA 4UAIA 2LSSA 5GAGC 1PVOA 1TS2A 4X64Q 1IBLQ 2L0CA 1J6QA 3GTGH 2VL6A 3S15H 2WB1G 2UXDQ 5BR8Q 3M4PA 3MWYW 1CKNA 1EQRA 3RZDB 5FLXE 2A8VA 3S1MH 2J0TD 1Q7YC 3VA5A 2KQ3A 1SLJA 1SFOB 5I9OA 4ILWA 3BZCA 5E3FA 1L0WA 4K5VA 1VQ9A 4BBSB 4BY7G 1XPUA 4ZYSA 1YZ6A 5I2XA 1J9OA 4NXNL 1BNZA 1BUVT 1DZ1A 3CP0A 5M5YB 3RLOA 2M9VA 4FP5D 4DR6L 2F3IA 4ODGA 2A6HD 4DR7Q 2B2WA 3MFGA 4K6LA 1VQ8A 3H94A 1YEZA 3I90A 3UI2A 5CV8A 2X6LA 4R4OA 4DR1L 2VUMH 1KLUD 2QCPX 2FFKB 2C9OA 2SDFA 5EJWA 1VQFA 4LW1A 3GP7A 3E9IA 3F2DA 3OPOA 1GUTA 4F8MA 3TS0A 4B3TL 3AQQA 4O0AA 1B3QA 2DUDA 1YNNC 3S14B 3CHBD 1PV4A 3J81i 1KDCA 5BN5A 5C0XI 4EQOA 3A54A 1JE5A 4LWCA 3K80C 1HR0L 1D1KA 1PTOD 1EIFA 3HKZG 4CJ2C 4IFDI 4V0BA 1N8RC 2LFNA 3CCUA 3PV0A 2EYPA 2Z1CA 1Q81C 1B8AA 3BDLA 4LJZC 2EY2A 4FF4A 4C3JB 5FLXc 5LMNL 1AZPA 2RVLA 4EQNA 4DV7Q 5M3MB 1F77A 1X3GA 3BYTB 4JC0A 3SK6A 3FPPA 1EY6A 3F2BA 1VQKA 1HCZA 1ZKOA 3EROA 4J6HA 3M4QA 2V1CC 1N9WA 1B7YB 3DLLA 1FGBD 2Q2TA 5KYLA 4KY6A 5CV4A 3VYTA 2UUBQ 4LFBL 2HQLA 3A8KE 4F7XA 3W5OA 1U4PA 1STNA 3I4LA 3D0FA 4A3EH 5F2DA 4QQBX 3FMCA 1S5ED 1ET6A 2MNAA 3I56A 2KECA 1SYGA 4DUZL 1F9SA 4A3JB 4DV3Q 4GN4B 1IW7C 2CW0D 1VQHA 1Z9FA 3A56A 4L6TB 3RNUA 2IPKD 5M3FB 4G7ZC 2K05A 2B2TC 2ICIA 4C2MB 2A68C 1TWCB 1B3AA 4PMWA 1JICA 3NBHB 1UWVA 3D4RA 4C3HH 1V1PA 4X65L 1UEBA 4DK3C 3RLNA 3OWFA 1Q86C 2IW3A 3K0XA 4APVA 1Y1WH 4M1UB 2WV6D 1HNZL 4KKTA 4YCUA 3U4VA 1E24A 1HR0W 4RHRA 1C7YA 4DAYA 4DR6Q 4GKJQ 4CDDC 1GUGA 1PMRA 2B3GA 2PPBC 2QW7A 3QO2A 3STBD 3F1ZA 1C9OA 2ZTEA 3NUCA 1EEID 1PFBA 4C3JG 5LMNW 1XTDA 3CF5A 3MXNB 3ONAB 5EKLA 1I4PA 5C5MA 1X6OA 3HOUG 2RKSA 2H1EA 1EY4A 4A3FG 4H13C 5LMUQ 1AN8A 3WOEA 2K5NA 2IX3A 4B3TQ 2I5LX 4BY7H 2QEXA 3K8AA 1PZKD 4QIWB 1L0XB 5KNBA 1I3QH 4HJ9A 1H9SA 1BXTA 4P71A 4GNXB 3GTPB 4HSVA 2JEBI 3HOWB 3GTJB 3TN2A 3KF8B 3HOXB 1K8OA 3HKZE 1PH6A 3CCSA 2JE6I 1TWFB 2NTTA 4AYBB 4HJ5A 4OWWB 2Z8LA 5IGGA 3ULLA 5FLXL 5M3FG 2KCNA 3KYHC 1JCKB 3WOFA 2D5DA 2F0MA 2SNMA 1AP0A 2JSOA 4R1JA 4JI8Q 1V9PA 5J22A 5CBAE 1TS5A 3K5MA 4WRDA 2Z9HA 3SEBA 1TWHB 4ZLTF 2OWOA 1LTID 4R9WA 4OGQC 1I4QA 5CV7A 4LFBQ 4BBRH 4NDXA 5CV9A 3T51B 4HSPA 2L1BA 5JPMC 3JAMi 4GLXA 5K36G 4DUZQ 3FVQA 2JA6H 1BKBA 1CTMA 1G2SA 1LM0A 4LF8Q 2Q8IB 1EIYB 1QWYA 3TP7A 4B3MQ 1YJ9A 1UUPA 3RZDH 5JEAH 4A3KG 1KQSA 2EJGC 4DV6Q 1SFOH 2R7DA 4X3UA 5D3DA 4BBSH 1NJIC 2L11A 4GLVB 3Q23A 5EKIA 5M5YH 1W6KA 1QE6A 2RA4A 4MZ9A 1HNZQ 3HOWG 2JA8G 2IJ0A 1KLGD 3FEWX 2WFWA 2B2UC 3QG1A 4A76A 4DK6C 1YHBA 1K83B 4DAPA 3BZDB 2RCFA 4KJOA 4B9XA 3DWPA 3FDTA 2K5WA 2JYOA 1ZXTA 4NKLA 2KENA 4EGVA 1I4RA 2IY5B 2GN5A 4XTCS 2NVTB 2YTXA 3GTKB 1YHAA 4Y7NB 4QCLA 2Q8RE 4DK0A 4HEDA 3S14H 1F2ZA 1HFNA 1E1OA 2AQ3B 4A3GG 2FINB 5FJ8G 4K5WA 1BBWA 2I46A 3H0GB 3MFYA 1XYIA 1K9MC 5EKKA 3MAQA 2NVQB 1KABA 3AMUA 3SK8A 3DM1A 4HIKA 4P74A 2WKDA 4C3JH 4POGA 4A3BB 1GUNA 2EPBA 4PZ8A 3MEHA 1SYEA 1W3SA 1VQOA 2K7VA 5M3MH 2Q2UA 4MIUA 1TXYA 2B2TA 1STBA 2ZJRA 3NTIA 4RCNA 1YI2A 2F4VQ 4BXXG 1R4QB 1XX8A 3JC66 4O42A 3G4SA 3C2PA 3NE5B 1KHIA 3P1HA 3RN2A 3PUXA 2F0OA 1ENFA 1N36L 3K0YA 1U9RA 2XNAC 3D6WA 4JI3Q 3S17B 3E0EA 3U9SA 4QGUA 1T5EA 4HIDA 3S1RB 3SGIA 4A3JH 3NPPA 3J7ZC 4OX9L 3I3CA 3VDYA 1RJTA 1WI5A 5M3FH 2AWOA 4A3CH 2R92B 5A2QE 3CU7A 4C2MH 2F03A 1I5FA 1TWCH 2K5HA 2VZAA 3JAML 5DEHA 1E2ZA 1P16A 3N52A 2GA4B 4L5TA 1SJHD 5CORA 4GZYC 4YIJA 2BDNA 4B9WA 1MJEA 3I4MG 1TQOA 1PXUA 4LFCQ 2K4KA 2MO1A 4DN4M 5FO8B 2FJ2A 3HOZB 3GV6A 1PFNA 4V190 1EU3A 3NP8A 3VYRA 1VQ6A 3H0GG 5EBCA 2XTIA 3M7NA 3UDFA 4ABNA 3PCOB 1CKMA 5K36H 4IUQA 2DJGC 3MA2B 1PLFA 2WINB 1D5XC 2EYLA 3EA6A 4A3BG 1PYWD 2F0HA 1U4LA 3NBHA 2PNHA 2LXKA 1BCPD 3OW7A 4QY7A 1TWGB 2CWAA 1VMPA 4JK1C 1I94L 4RKBA 3OW2A 1NNXA 4RGMA 1HNXQ 5D14A 5KRUA 1YNJC 3K5OA 5C4XB 4IUUA 1EYAA 3GTPH 2CVRA 1CZGA 1F9QA 2K1BA 2ZTCA 1WTWA 1S3OA 3HOWH 1CSPA 3GTJH 4AIMA 1SYFA 3A55A 3HOXH 5FO7B 2VS1A 1VQPA 3B6YA 5JJKA 1NAPA 1QZGA 1TWFH 1VQ5A 2E2HB 3FP9A 4JOIC 3AFQA 5I2YA 4DR4L 4OO1I 3HFZB 1Y14B 1ILPA 2R92G 5CC4A 1STYA 2PI2E 3MXNA 4JI5L 2P5ZX 4IFDG 1JOQA 4K14A 4KMUC 4I65A 1HUMA 1KNEA 1EZ8A 1T5XD 2K6AA 2VQEQ 3I8ZA 4JV5L 1UE5A 3SE0A 3TZDA 1M4VA 1SRUA 4KHZA 2HDMA 3UDGA 4GNXA 1TWHH 2UXCL 3QOLA 5FJ8H 1SMYC 4B3RQ 1WOCA 1DYQA 3HOZG 1E7ZA 2JA5B 3KF8A 1VQ4A 4TVAB 2K33A 1PH5A 3G6JB 3FHWA 4N8FA 3J80i 4ZK9B 2BOSA 3CCLA 2PZTA 4UP9A 2A19A 4OX9Q 4RGNA 1XNQQ 2B2UA 2I07B 5EGTA 1E2WA 4XQNA 3A7LA 3EFXD 4UDUC 3OTOL 2PCFB 5E4WC 4XYOA 1SNQA 1UE6A 3H09A 4XYQA 1ASZA 1I6HB 2XIWA 1EY5A 3EN2A 4DR2L 5FLMH 2MPMA 1RL2A 1OXTA 1X3FA 3RN5A 1A0IA 5C4XG 1AW7A 2E5LL 2MJ8A 4I7ZC 5IGFA 3T13A 2E2DC 2H4OA 4CBVA 4FXGC 1ENAA 4X3TA 4DR5Q 5IT9E 1SN8A 1AE2A 1HHVA 3L3OC 1LT5D 2PI2A 1K83H 5HURA 1WTVA 4LK1C 4Z9CB 5HGTA 1PTOB 2NUCA 4FXDA 1O7ZA 2DY7A 5GAHC 1F9RA 3VR3A 5KIXA 4LMQD 3PF4A 2NVTH 1LTTD 3GTKH 1B50A 3H3VI 3QB3A 4Y7NH 1DOKA 5G3LF 1I94Q 2H5XA 1PH1A 1I6VC 2KCCA 1HTPA 4LF9L 4A3EG 1HA6A 1FJGL 2AQ2B 5M5WB 3HRZC 2F0DA 5CR3A 5LL6X 3H0GH 3T1HL 1NR4A 1L1OB 4X6AH 2JA5G 2NVQH 3DEOA 1DCZA 1D8LA 3CMAA 1EOTA 5ELBA 4A3BH 2KHIA 4DKAC 4UY8C 1Q8IA 3BYYB 4C3HG 4DR4Q 1PRTC 2VQFL 3ICEA 2UUCL 4JI5Q 4KN7C 2OCEA 1WCMB 3A5ZB 3K59A 1NCVA 3OIQA 3TREA 4JV5Q 2CHBD 3OWEB 2MUYA 1N34L 1Y1WG 1CM9A 2MQHA 1S72A 3BJUA 5J3BA 2R93B 2EYJA 2K32A 1FR3A 3A74A 1I50B 5IT9c 2UXCQ 1LUZA 2NN6I 2RSOA 1WTHA 4TRDA 1B4OA 3S17H 1PTOC 5ELNA 2ID0A 3S1RH 5C0XH 4YWMA 1PYBA 2F0LA 1HZBA 2R92H 2HUGA 2Z4IA 4IFDH 3QJYA 2JN4A 5JOBA 3J80L 4DR3L 2LMCB 3LWUA 3GTLB 1VQ7A 4JI1L 2MFIA 4DPGA 1XPOA 3GV3A 3AFPA 3J81E 4HJAA 1L1OC 1T9HA 3L0OA 2MO0A 5HGQA 2KCTA 1A8VA 1BBUA 4JI6L 2CQOA 3HOZH 3BG3A 4J8QA 2RF4A 1B2TA 2D62A 3CRLC 4X62Q 1MSHA 2EOTA 1D5ZC 1IBMQ 2E5LQ 2RHQB 4J1MA 1LLRD 1FVIA 3MVVA 1RCVD 1A3VA 1JWSD 4G7HC 3CCJA 1K28A 4FNFA 4NW2A 1X56A 2EDGA 2BH8A 3KOJA 4DV5Q 5CBEE 1PRTF 4YHHL 2LKVA 4LUOA 4C1NI 4Y52H 1HA5A 4JOIA 5T1IA 4DV0L 4ZKBB 1S4ZA 3GTMB 1NUCA 1TWGH 4CKBA 2KA7A 1HH2P 1NTGA 3FKIB 3EVQA 3W3AA 2ZXRA 4NPSA 4QMGA 4WFN3 1EYGA 4JI7L 2VXWA 4K0KL 1B1ZA 4BBRG 2R7ZB 1GXDC 3G6EA 4IFDJ 5C4XH 4AQYQ 4ME3A 4LF9Q 2CH4A 3PMFA 2WAQB 4RWSC 4BA2I 2LXJA 4PZ6A 1GHKA 1FNWA 1KRSA 1LO5D 3DHQA 2JA6G 2ZXOA 1G2TA 2LY7A 1E0BA 5E7NA 4DV2Q 5FO9B 1IYJB 4AH6A 2E2HH 1OO9B 4YY3L 2EYHA 4KY7A 2EY1A 3AEVA 2PQAB 1RTNA 3G7LA 5JEAG 4WJ4A 4ZUJA 3H15A 2C35B 1HRJA 4IJHA 3QWNA 1KTKA 4BBSG 4A3LH 1U5KA 4RAUC 1PZJD 1KIXA 2XRSD 3QOJA 4OL7A 3RMHA 3F8TA 1N34Q 2AHOB 5JAVA 4K2KA 5IT9L 2XGTA 2O2LD 3KBXA 4UP7A 2HD3A 1YHQA 1VQMA 4MNOA 2JA5H 3UDIA 1IKLA 4NXMQ 3BDOA 3DMUA 1U0LA 2HHHQ 2M2LA 1KD1C 2R3ZA 4FVMA 3ND8A 1Q90A 3LNNA 4HJ8A 3K57A 3KLWA 2WB1E 1R4PB 1LTLA 1X3QA 4YCVA 5C4JB 4RFBA 2YTVA 5CYUA 3MHBA 4A4IA 3R93A 1R9TB 3J81j 4L5QA 3VR4A 2RDGA 3TZUA 3I4OA 4JI1Q 4R8NA 2EYFA 1I6HH 5AFWA 1A6XA 4DV1L 4NXNQ 1EYDA 4A93B 5C6AA 1N32L 2R7ZG 1TY0A 3CCMA 3TSSA 4JI6Q 2WAQG 3ULPA 1HZ9A 1CQFA 4IPHA 2ZM6L 1VQJA 1NMFA 3HG9A 4DR1Q 4FDBA 1TWAB 4L8JA 2DNCA 2NWGA 1C48A 4BWGB 5M3MG 1VQNA 1PTOH 2UXBL 4KD3A 3KFUA 4FYDA 1XWEA 1GUWA 4GLAC 5IP9H 1OXXK 2PQEA 5IYDH 3ERSX 3I2ZA 1EZ6A 3KF6B 2F0SA 1H9MA 4XT3B 4K0KQ 2FMCA 4JI2L 4KV6A 1HR0Q 2C5CA 2KJXA 5E4XA 1QCBD 1XJVA 5M5WH 3DWQA 4R4QA 3V05A 4GOPB 4A3JG 2QEJC 2B39A 4HCSA 3T1YL 1BR9A 1UEAB 1ESFA 4A3CG 4FO2A 5LMNQ 1IW7D 3IAYA 3CRKC 2D2CC 1PH9A 1EY9A 3MTSA 4YY3Q 1JR0D 1XNRL 2I5HA 2OTLA 4R4IA 1O7LA 2OQ0A 1LT4D 3LWEA 3PO3B 4DUYL 1A63A 1WCMH 3CC7A 1MSGA 2F3VA 2OTJA 2F52A 2R93H 2JJQA 1Y8OB 1I50H 2GVBA 4EQPA 1L1OA 2A6EC 1N33L 1H9RA 1KXLA 3OMGA 1QVCA 3GO5A 4CDEC 3CC2A 1WTOA 3PSIA 3ND9A 1BF4A 1K73C 2N78A 4PG3A 1Y8PB 4GNXC 1QZHA 2DY8A 4X65Q 5BN3A 3M4OB 4LNQA 3I72A 1K3RA 3SDZA 3GTLH 2A69C 3HGBA 2RQXA 4DXFA 2A1AA 3FPUB 2L9HA 2K5VA 4DV1Q 3TQYA 1S5BD 1BCPB 1HJPA 2EYMA 5ELCA 3S2HB 1N32Q 3HOXG 5ELOA 3MZ5A 1SR3A 1SMXA 2L12A 4QUCA 3MC0B 1F2LA 1KRTA 1QVFA 4XQQA 4LFAL 5FK9C 4AYBG 4HJ7A 1E2VA 3AU7A 2NTSA 1CK1A 2ZM6Q 1WTXA 2K5QA 2BE5C 1HQRD 4DAMA 3M3YB 1SSOA 2E75C 4P2CB 2UXBQ 3DUZA 3AB9A 4C3IB 3GTOB 1TR5A 2KBNA 1Q1BA 3GTMH 2F4IA 1A2UA 3FKIH 1SYCA 2L5TA 2OXPA 4IUVA 4XQJA 1VQBA 2BA0A 2PMZB 1DOLA 3BVMA 3KJPA 1OXUA 5JEAJ 3H3VC 2R7ZH 1CQVA 2EXZA 2G9HD 4U68A 1RD9D 2XN9C 3WDNA 1BOSA 2NZ1D 3PUZA 1AEXA 4LF4L 4IURA 1X3PA 4MHEA 3GTQB 5JJLA 3T1YQ 4CGYB 1KAWA 1XTCD 3VYUA 1O78A 4DXGA 1A62A 5JVG3 4PNYA 4NMZA 2IL8A 2AUJD 3UE0A 4A3MB 1EL0A 2N55A 3NHHA 5J1ZA 2R61A 1D1IA 1IYUA 3WWVA 1IL8A 2M00A 1CI3M 4GN3B 5EQ0A 5FLMG 1BCPC 1K3BC 2Y0SB 2CFMA 4DUYQ 2B29A 1VDZA 2ZTDA 4ZKCB 2OEOA 5KGUA 3TP6A 3F2CA 5TSSA 1GM5A 3A7AB 5C3XA 1WD1A 1GJXA 1N33Q 3UDXA 2K28A 3PQIA 4KD4A 1IKMA 4WORA 1O80A 3UE1A 4UP8A 1LT3D 5I6WA 2PQAA 3M4YA 5GADC 4JI0L 2NN6G 5C4JH 1OXSC 4HIOA 2JA7B 4DV4L 1B44D 3CCEA 2YU9B 3CQZB 4H7BA 4B08A 1R9TH 1STAA 4FXKC 1SE8A 1ZYRC 1OTCA 2A74C 4QIWE 3S16B 4OO1H 4JBMA 4L5SA 4A93H 3K6OA 2ICEC 1TKWB 4CJ0B 1Z47A 2N49A 1QB5D 2EXDA 4HMJA 3BDCA 3KUPA 4HTHA 3L9AX 3HOVB 1CA5A 4PZ7A 3TRZA 4AYBE 1TWAH 4MN3A 4L5RC 3NWTA 2Q2IA 5T1GA 1V1QA 3KK7A 3TP5A 4IPDA 5C3EH 2RBMA
chains in the Genus database with same CATH topology
3PUYA 4DKAC 4UY8C 4DUZL 1UE7A 4JYAL 4DV3Q 2WAQE 4LFCL 4DR4Q 1E22A 4GN4B 1EUJA 2VQFL 1VQHA 1Z9FA 2UUCL 3ICEA 3RNUA 4JI5Q 2OCEA 3A5ZB 3S1NH 3TREA 4JV5Q 4PMWA 1N34L 3CW2C 1Y1WG 5EAYA 3NBHB 1UWVA 2MQHA 1S72A 2JK8A 4C3HH 3BJUA 4IPGA 1NMGA 2NZHA 5J3BA 5C0XG 4X65L 1BVSA 3A74A 1UEBA 1VQCA 3IRBA 2RHSB 3RLNA 4DK3C 2YV5A 5IT9c 3PO2G 2UXCQ 1LUZA 2NN6I 1Q86C 5IWAL 3K7UC 3PO3G 2DGYA 1XMQL 3K0XA 4APVA 3S17H 5ELNA 3CCQA 1Y1WH 1PH8A 2ID0A 3S1RH 3K81C 1HNZL 2AKWB 3D31A 4YCUA 4JI2Q 3U4VA 1E24A 2YTYA 1HR0W 4YWMA 1PYBA 1C7YA 1HZBA 1HNXL 2QA4A 1J5EL 2R92H 4DR6Q 4GKJQ 2B3GA 3PO3H 3KF6A 1MJCA 1Q1EA 4UPAA 5AJ3L 3PIPA 3STBD 4DR3L 3F1ZA 1C9OA 2D0OA 2ZTEA 2IT1A 1QUQB 4OWTB 4A75A 1N36Q 1CKOA 4JI1L 1VQ7A 3HOYG 5JJIA 2MFIA 5LMNW 1XTDA 4DPGA 5H1SE 3CF5A 1XPOA 3MXNB 2YYZA 3AFPA 4HJAA 2R6GA 1YBYA 1X6OA 1L1OC 1L2FA 3H3VH 3M85A 4LF7L 1XNRQ 1T9HA 2EIFA 3L0OA 3NENA 2MO0A 1V43A 4LUZA 2KCTA 1A8VA 1BBUA 2K14A 2CQOA 5GROA 5HGQA 3KDFA 2VY3A 5LMUQ 4A3FG 4JI6L 2K5NA 4R4TA 4JBKA 2RF4A 4B3TQ 2D62A 4X62Q 2I5LX 3HOVG 4BY7H 2QEXA 3K8AA 1IBMQ 2E5LQ 2RHQB 1CKNB 1I3QH 4HJ9A 1FVIA 4P71A 4GNXB 4KLKA 4LF6L 1WFQA 2JEBI 3CC4A 2VQEL 3HOZH 1IBLL 3HOUH 3CCJA 1PYSB 1X56A 3TS2A 3KF8B 2BH8A 1G291 3HKZE 4A3FH 2JA9A 4DV4Q 2N8NA 3KOJA 3PUWA 4DV5Q 1XMOL 4YHHL 1Q46A 4J15A 1PH6A 4LUOA 3L7ZC 2JE6I 3CCSA 4Y52H 4JOIA 4DV0L 1FGUA 4NB3A 4B3RL 5C44H 4HJ5A 4OWWB 2VW9A 1TWGH 3ULLA 1HH2P 1NTGA 4NPSA 3RR5A 5M3FG 2PMZE 3U4ZA 1EYGA 4JI7L 3KYHC 3S2HH 2E8GA 4XIGS 3AYHB 5IYBG 4GKKL 2EQSA 4K0KL 1JJGA 1YITA 2Q2HA 4KHPQ 1CSQA 4BBRG 1UE1A 3GD7A 3PUVA 1MKHA 3G6EA 5C4XH 2ES2A 4IFDJ 3ER0A 4R1JA 2Z6KC 4AQYQ 4JI8Q 1V9PA 4ME3A 4LF9Q 2B63G 2VNUD 3CCVA 3EIVA 1Q82C 1PH7A 1XNQL 4LUVA 4BA2I 2LXJA 2WP8J 4PZ6A 2JA5H 1KRSA 2JA6G 2OWOA 4OXPA 2N3SA 3CMEA 3M3YH 5IYCG 5E7NA 2K50A 4DV2Q 4LFBQ 4A3LG 1IYJB 4BBRH 4AH6A 4C3IH 2E2HH 3GTOH 4MTNA 4YY3L 1M1KC 3AEVA 2PQAB 1HNWL 5JEAG 3JAMi 3CXCA 3I7FA 4GLXA 4WJ4A 4DUZQ 3G48A 5K36G 3H15A 2C35B 2JA6H 4LFAQ 4JYAQ 1BKBA 4IJHA 1LM0A 4LF8Q 1EIYB 1B70B 4BY1H 4QJFA 4BBSG 4A3LH 1K8GA 3ZJYC 1P8LA 1U5KA 1KIXA 1AH9A 4B3MQ 3S1QH 1YJ9A 4A3MG 4DR5L 3F8TA 3G71A 3LGJA 1HZCA 5IY0A 3CPWA 3RZDH 1N34Q 2AHOB 4A3KG 1KQSA 4DV6Q 1JT8A 3EBEA 2R7DA 1SFOH 3CD6A 3GTQH 1Y1VH 2XGTA 4UP7A 4BBSH 1YHQA 2K52A 4MNOA 2Y0SG 1VQMA 1NJIC 2NVYH 3UDIA 4EX5A 1NY4A 4GLVB 5IWAQ 1EQQA 4NXMQ 1U0LA 1XMQQ 2HHHQ 4A3MH 1KD1C 4P72A 5M5YH 2UU9L 4IJLA 4A3KH 4HJ8A 3KLWA 2WB1E 4MZ9A 1IZ6A 4DV7L 1HNZQ 2JA8G 3HOWG 1YJWA 1LTLA 4YCVA 2WFWA 1X9NA 2YTVA 4A76A 4DK6C 4LF4Q 1YHBA 1HZAA 4A4IA 3A0JA 4A3IG 1MIUA 3PGZA 1IBKL 2OQKA 3J81j 3TEHB 4L5QA 1XPRA 1KC8C 3I4OA 4JI1Q 2UUBL 1I6HH 2JA8H 1E3PA 4DV1L 4NXNQ 1VQDA 2KENA 4H02A 2JA7G 4GN5A 1N32L 3PIOA 2IY5B 2GN5A 2GVAA 4XTCS 2YTXA 2R7ZG 1YHAA 3PO2H 3CCMA 4A3IH 2E2JH 4JI6Q 1GO3E 4JI4L 2WAQG 3S14H 3ULPA 1HZ9A 1E1OA 5IP9G 3DM3A 4IPHA 2ZM6L 4A3GG 1VQJA 4JG2A 1NMFA 5FJ8G 5IYDG 1G51A 4DR1Q 2JA7H 1BBWA 5IE8A 4FDBA 3OTOQ 4GOPA 4LF6Q 1RIPA 1PFSA 1FL0A 2YU9H 1YJNA 3CQZH 3ULJA 5M3MG 1K9MC 1VQNA 2UXBL 2R7FA 4DR2Q 3E9HA 3KFUA 1XMOQ 4GLAC 5IP9H 3S16H 1OXXK 3HKSA 4A3GH 4HIKA 5IP7H 3OYYA 4GS3A 4P74A 4C3JH 1ASYA 4B3SL 4POGA 3HOYH 3ERSX 3I2ZA 4DAYB 5M5XH 4PZ8A 4X66L 5IYDH 2Z0SA 5GAEC 1PH4A 2ASBA 3S24A 3KF6B 2HT1A 3HOUG 1W3SA 1VQOA 5M3MH 4LF5L 4X64L 2Q2UA 1AE3A 1TXYA 2K75A 2KHJA 3BU2A 4JI0Q 2ZJRA 4GKKQ 4K0KQ 2UXDL 4JI2L 1EWIA 4IOAA 1HR0Q 5BR8L 2VUMG 1YI2A 1LYLA 2F4VQ 3M4OH 3HOVH 4BXXG 4GKJL 1XJVA 5M5WH 4R4QA 4GOPB 3JC66 4A3JG 4DNIA 4A3DG 3G4SA 1PA6A 3T1YL 2QGQA 2NZOA 3CPFA 1KHIA 3NELA 3RN2A 3PUXA 1EFWA 3J80c 1N36L 2HIVA 4A3CG 3KDFB 2JQOA 5LMNQ 5C0XJ 1SROA 1WCMG 4JI3Q 1VS0A 2CCZA 3E0EA 1PH9A 4BXXH 2AWNA 1IL2A 4QGUA 1VQEA 1GKHA 4HIDA 1E1TA 3SGIA 4A3JH 4YY3Q 1XNRL 2I5HA 2OTLA 2R93G 4R4IA 1QVGA 3J7ZC 4OX9L 4DR7L 3VDYA 1HNWQ 5LMUL 2ZJQA 1FJGQ 1WI5A 2OQ0A 1GVPA 2AWOA 4O2DA 5M3FH 4X62L 4A3CH 4DUYL 5IYBH 4C2MH 1IBML 1WCMH 3T1HQ 3RZOH 1I5FA 1A63A 1TWCH 1VQIA 1JMCA 1VQGA 2K5HA 2VZAA 3CC7A 3S2DH 4RMFA 2OTJA 4P73A 1P16A 1W2BA 5HY6A 1OXVA 4KI0A 4OWXB 2F52A 1D7QA 1X55A 2R93H 4OONA 2B63H 4L5TA 2JJQA 4YCWA 2GVBA 1I50H 4DV5L 1MJEA 1VQLA 4JCVE 1VCIA 3STBC 3I4MG 4JBJA 1L1OA 1X65A 2UUAL 1N33L 3J81c 1DGSA 4LFCQ 2K4KA 1KXLA 2MO1A 5IYCH 2VQFQ 1QVCA 1YNXA 2Y0SE 3GO5A 3W1GA 2UUCQ 3CC2A 2JEAI 3PSIA 4RG1A 1VQ6A 3H0GG 2UU9Q 2XTIA 3M7NA 2AMCB 2N78A 1K73C 3I4MH 4PG3A 3UDFA 1S40A 3PCOB 1CKMA 2CKZB 4GNXC 1C0AA 1QZHA 4AQYL 4JI8L 4X65Q 1Q12A 4LNQA 2D0PA 1K3RA 3GTLH 3NEMA 1CUKA 4A3BG 2CWPA 1IBKQ 2ZJPA 1NBWA 3MEFA 2PNHA 2LXKA 2A1AA 2IHEA 4P75A 4POFA 4QY7A 4DV2L 2K5VA 4DV1Q 2CWAA 1I94L 3TQYA 2ALYB 1HJPA 1YVCA 3I4NG 1N32Q 3HOXG 5ELOA 1K0RA 3OW2A 1HNXQ 1SR3A 1J5EQ 1SMXA 3PF5A 1QVFA 1KRTA 2BH2A 1YIJA 4TQUS 2Z6KA 4EQ5A 5AJ3Q 4JI4Q 4LFAL 4AYBG 4HJ7A 2E2IH 4LF8L 3GTPH 4DR3Q 1KL9A 2ZTCA 3FKIG 2ZM6Q 1S3OA 3HOWH 1CSPA 3GTJH 2HIXA 4AIMA 4DAMA 3I4NH 2IHFA 1GD7A 3HOXH 4B3ML 4A3BH 2RCNA 1NE3A 2VS1A 1VQPA 3B6YA 3M9BA 5JJKA 3CAMA 1X54A 4HIMA 2BA1A 1QZGA 1EOVA 3I55A 4LF7Q 4YWKA 4DV6L 1TWFH 2UXBQ 1X3EA 1VQ5A 3FP9A 2KBNA 1QUQA 1Q1BA 4JOIC 3GTMH 5GQOA 3AFQA 4DV3L 2L15A 4DR4L 4OO1I 3FKIH 3HFZB 1Y14B 2R92G 4R4CA 2FXQA 4B3SQ 2PI2E 1VQBA 2BA0A 4JI5L 4IFDG 4NXML 4X66Q 3Q8DA 1K8AC 2HHHL 1VQAA 3KJPA 1OXUA 1IXRA 2LSSA 5GAGC 4YWLA 5JEAJ 4LF5Q 4X64Q 2VQEQ 2R7ZH 4JV5L 1PVOA 1IBLQ 2UXDQ 1J6QA 1UE5A 2VL6A 3GTGH 2WB1G 3S15H 1SRUA 5BR8Q 3M4PA 4KHZA 3PUZA 3UDGA 1CKNA 1EQRA 4YHHQ 2A8VA 4GNXA 1TWHH 4LF4L 3S1MH 2NVXH 2UXCL 1Q7YC 5FJ8H 4IOCA 1SLJA 4DV0Q 4B3RQ 3T1YQ 1WOCA 5IP7G 5JJLA 4IPCA 1KAWA 3HOZG 3BZCA 4ALPA 1E7ZA 1L0WA 1VQ9A 2I5MX 1VQ4A 3W1BA 3CCRA 4JI7Q 1A62A 1XPUA 4BY7G 2IX1A 1H95A 4TVAB 1YZ6A 4NXNL 3UE0A 1PH5A 3FHWA 3CP0A 3J80i 3RLOA 3CCLA 4DR6L 2F3IA 4UP9A 2A19A 3WWVA 1JB7A 4OX9Q 2ATWA 1XNQQ 4GN3B 4BA1I 4DR7Q 1VQ8A 1G6PA 5FLMG 3U50C 3BZKA 1YEZA 2CFMA 4DUYQ 2B29A 2ZTDA 4R4OA 5C44G 4DR1L 2VUMH 3OTOL 1UE6A 1ASZA 3U58A 4A3DH 2IX0A 3EN2A 1VQFA 4LW1A 3F2CA 3E9IA 3F2DA 4DR2L 5FLMH 1PHJA 1GM5A 3TS0A 1RL2A 1OXTA 2UUAQ 1X3FA 1O7IA 1A0IA 3UDXA 3RN5A 4B3TL 1N33Q 5C4XG 3AQQA 4JBWA 4O0AA 2KCMA 2E5LL 2DUDA 1JJCB 1PV4A 3J81i 4WJ3M 5C0XI 4OO1G 3UE1A 4UP8A 1Q8KA 2PQAA 4JI0L 1JE5A 5GADC 4A93G 2NN6G 5C4JH 1OXSC 4HIOA 1SN8A 1WJJA 4DR5Q 4LWCA 3K80C 1JJ2A 1HR0L 3HKZG 1AE2A 1EIFA 4DV4L 2PI2A 3CCEA 2I0QA 1K83H 2F4VL 4IFDI 3L2PA 1N8RC 3CCUA 1R9TH 3PV0A 4QL5A 1SE8A 1Q81C 1B8AA 1OTCA 5GAHC 4QIWE 4JBMA 3GDEA 4L5SA 5FLXc 4A93H 5LMNL 3PF4A 3RLFA 4BY1G 4JI3L 2NVTH 3GTKH 1Z47A 3H3VI 2N49A 4DV7Q 4Y7NH 4KHPL 1I94Q 1WYDA 2H5XA 1PH1A 2EXDA 1X3GA 4IO9A 4LF9L 4JC0A 4A3EG 3F2BA 1FJGL 5C3EG 1VQKA 3K7AH 3A5UA 4PZ7A 3TRZA 3M4QA 4AYBE 2V1CC 1Y1VG 3J7A5 1N9WA 1PH3A 3H0GH 1TWAH 1L1OB 3T1HL 4X6AH 4GOPC 1B7YB 3DLLA 1M90C 2JA5G 2Q2TA 2UUBQ 4LFBL 4L5RC 2HQLA 3JAMc 2Q2IA 2NVQH 3W5OA 1PH2A 1V1QA 3KJOA 3D0FA 4A3EH 5DLQE 1D8LA 3CMAA 4IPDA 4QQBX 5C3EH 2MNAA 3I56A 2KHIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUY A;  4DKA C;  4UY8 C;  4DUZ L;  1UE7 A;  4JYA L;  4DV3 Q;  2WAQ E;  4LFC L;  4DR4 Q;  1E22 A;  4GN4 B;  1EUJ A;  2VQF L;  1VQH A;  1Z9F A;  2UUC L;  3ICE A;  3RNU A;  4JI5 Q;  2OCE A;  3A5Z B;  3S1N H;  3TRE A;  4JV5 Q;  4PMW A;  1N34 L;  3CW2 C;  1Y1W G;  5EAY A;  3NBH B;  1UWV A;  2MQH A;  1S72 A;  2JK8 A;  4C3H H;  3BJU A;  4IPG A;  1NMG A;  2NZH A;  5J3B A;  5C0X G;  4X65 L;  1BVS A;  3A74 A;  1UEB A;  1VQC A;  3IRB A;  2RHS B;  3RLN A;  4DK3 C;  2YV5 A;  5IT9 c;  3PO2 G;  2UXC Q;  1LUZ A;  2NN6 I;  1Q86 C;  5IWA L;  3K7U C;  3PO3 G;  2DGY A;  1XMQ L;  3K0X A;  4APV A;  3S17 H;  5ELN A;  3CCQ A;  1Y1W H;  1PH8 A;  2ID0 A;  3S1R H;  3K81 C;  1HNZ L;  2AKW B;  3D31 A;  4YCU A;  4JI2 Q;  3U4V A;  1E24 A;  2YTY A;  1HR0 W;  4YWM A;  1PYB A;  1C7Y A;  1HZB A;  1HNX L;  2QA4 A;  1J5E L;  2R92 H;  4DR6 Q;  4GKJ Q;  2B3G A;  3PO3 H;  3KF6 A;  1MJC A;  1Q1E A;  4UPA A;  5AJ3 L;  3PIP A;  3STB D;  4DR3 L;  3F1Z A;  1C9O A;  2D0O A;  2ZTE A;  2IT1 A;  1QUQ B;  4OWT B;  4A75 A;  1N36 Q;  1CKO A;  4JI1 L;  1VQ7 A;  3HOY G;  5JJI A;  2MFI A;  5LMN W;  1XTD A;  4DPG A;  5H1S E;  3CF5 A;  1XPO A;  3MXN B;  2YYZ A;  3AFP A;  4HJA A;  2R6G A;  1YBY A;  1X6O A;  1L1O C;  1L2F A;  3H3V H;  3M85 A;  4LF7 L;  1XNR Q;  1T9H A;  2EIF A;  3L0O A;  3NEN A;  2MO0 A;  1V43 A;  4LUZ A;  2KCT A;  1A8V A;  1BBU A;  2K14 A;  2CQO A;  5GRO A;  5HGQ A;  3KDF A;  2VY3 A;  5LMU Q;  4A3F G;  4JI6 L;  2K5N A;  4R4T A;  4JBK A;  2RF4 A;  4B3T Q;  2D62 A;  4X62 Q;  2I5L X;  3HOV G;  4BY7 H;  2QEX A;  3K8A A;  1IBM Q;  2E5L Q;  2RHQ B;  1CKN B;  1I3Q H;  4HJ9 A;  1FVI A;  4P71 A;  4GNX B;  4KLK A;  4LF6 L;  1WFQ A;  2JEB I;  3CC4 A;  2VQE L;  3HOZ H;  1IBL L;  3HOU H;  3CCJ A;  1PYS B;  1X56 A;  3TS2 A;  3KF8 B;  2BH8 A;  1G29 1;  3HKZ E;  4A3F H;  2JA9 A;  4DV4 Q;  2N8N A;  3KOJ A;  3PUW A;  4DV5 Q;  1XMO L;  4YHH L;  1Q46 A;  4J15 A;  1PH6 A;  4LUO A;  3L7Z C;  2JE6 I;  3CCS A;  4Y52 H;  4JOI A;  4DV0 L;  1FGU A;  4NB3 A;  4B3R L;  5C44 H;  4HJ5 A;  4OWW B;  2VW9 A;  1TWG H;  3ULL A;  1HH2 P;  1NTG A;  4NPS A;  3RR5 A;  5M3F G;  2PMZ E;  3U4Z A;  1EYG A;  4JI7 L;  3KYH C;  3S2H H;  2E8G A;  4XIG S;  3AYH B;  5IYB G;  4GKK L;  2EQS A;  4K0K L;  1JJG A;  1YIT A;  2Q2H A;  4KHP Q;  1CSQ A;  4BBR G;  1UE1 A;  3GD7 A;  3PUV A;  1MKH A;  3G6E A;  5C4X H;  2ES2 A;  4IFD J;  3ER0 A;  4R1J A;  2Z6K C;  4AQY Q;  4JI8 Q;  1V9P A;  4ME3 A;  4LF9 Q;  2B63 G;  2VNU D;  3CCV A;  3EIV A;  1Q82 C;  1PH7 A;  1XNQ L;  4LUV A;  4BA2 I;  2LXJ A;  2WP8 J;  4PZ6 A;  2JA5 H;  1KRS A;  2JA6 G;  2OWO A;  4OXP A;  2N3S A;  3CME A;  3M3Y H;  5IYC G;  5E7N A;  2K50 A;  4DV2 Q;  4LFB Q;  4A3L G;  1IYJ B;  4BBR H;  4AH6 A;  4C3I H;  2E2H H;  3GTO H;  4MTN A;  4YY3 L;  1M1K C;  3AEV A;  2PQA B;  1HNW L;  5JEA G;  3JAM i;  3CXC A;  3I7F A;  4GLX A;  4WJ4 A;  4DUZ Q;  3G48 A;  5K36 G;  3H15 A;  2C35 B;  2JA6 H;  4LFA Q;  4JYA Q;  1BKB A;  4IJH A;  1LM0 A;  4LF8 Q;  1EIY B;  1B70 B;  4BY1 H;  4QJF A;  4BBS G;  4A3L H;  1K8G A;  3ZJY C;  1P8L A;  1U5K A;  1KIX A;  1AH9 A;  4B3M Q;  3S1Q H;  1YJ9 A;  4A3M G;  4DR5 L;  3F8T A;  3G71 A;  3LGJ A;  1HZC A;  5IY0 A;  3CPW A;  3RZD H;  1N34 Q;  2AHO B;  4A3K G;  1KQS A;  4DV6 Q;  1JT8 A;  3EBE A;  2R7D A;  1SFO H;  3CD6 A;  3GTQ H;  1Y1V H;  2XGT A;  4UP7 A;  4BBS H;  1YHQ A;  2K52 A;  4MNO A;  2Y0S G;  1VQM A;  1NJI C;  2NVY H;  3UDI A;  4EX5 A;  1NY4 A;  4GLV B;  5IWA Q;  1EQQ A;  4NXM Q;  1U0L A;  1XMQ Q;  2HHH Q;  4A3M H;  1KD1 C;  4P72 A;  5M5Y H;  2UU9 L;  4IJL A;  4A3K H;  4HJ8 A;  3KLW A;  2WB1 E;  4MZ9 A;  1IZ6 A;  4DV7 L;  1HNZ Q;  2JA8 G;  3HOW G;  1YJW A;  1LTL A;  4YCV A;  2WFW A;  1X9N A;  2YTV A;  4A76 A;  4DK6 C;  4LF4 Q;  1YHB A;  1HZA A;  4A4I A;  3A0J A;  4A3I G;  1MIU A;  3PGZ A;  1IBK L;  2OQK A;  3J81 j;  3TEH B;  4L5Q A;  1XPR A;  1KC8 C;  3I4O A;  4JI1 Q;  2UUB L;  1I6H H;  2JA8 H;  1E3P A;  4DV1 L;  4NXN Q;  1VQD A;  2KEN A;  4H02 A;  2JA7 G;  4GN5 A;  1N32 L;  3PIO A;  2IY5 B;  2GN5 A;  2GVA A;  4XTC S;  2YTX A;  2R7Z G;  1YHA A;  3PO2 H;  3CCM A;  4A3I H;  2E2J H;  4JI6 Q;  1GO3 E;  4JI4 L;  2WAQ G;  3S14 H;  3ULP A;  1HZ9 A;  1E1O A;  5IP9 G;  3DM3 A;  4IPH A;  2ZM6 L;  4A3G G;  1VQJ A;  4JG2 A;  1NMF A;  5FJ8 G;  5IYD G;  1G51 A;  4DR1 Q;  2JA7 H;  1BBW A;  5IE8 A;  4FDB A;  3OTO Q;  4GOP A;  4LF6 Q;  1RIP A;  1PFS A;  1FL0 A;  2YU9 H;  1YJN A;  3CQZ H;  3ULJ A;  5M3M G;  1K9M C;  1VQN A;  2UXB L;  2R7F A;  4DR2 Q;  3E9H A;  3KFU A;  1XMO Q;  4GLA C;  5IP9 H;  3S16 H;  1OXX K;  3HKS A;  4A3G H;  4HIK A;  5IP7 H;  3OYY A;  4GS3 A;  4P74 A;  4C3J H;  1ASY A;  4B3S L;  4POG A;  3HOY H;  3ERS X;  3I2Z A;  4DAY B;  5M5X H;  4PZ8 A;  4X66 L;  5IYD H;  2Z0S A;  5GAE C;  1PH4 A;  2ASB A;  3S24 A;  3KF6 B;  2HT1 A;  3HOU G;  1W3S A;  1VQO A;  5M3M H;  4LF5 L;  4X64 L;  2Q2U A;  1AE3 A;  1TXY A;  2K75 A;  2KHJ A;  3BU2 A;  4JI0 Q;  2ZJR A;  4GKK Q;  4K0K Q;  2UXD L;  4JI2 L;  1EWI A;  4IOA A;  1HR0 Q;  5BR8 L;  2VUM G;  1YI2 A;  1LYL A;  2F4V Q;  3M4O H;  3HOV H;  4BXX G;  4GKJ L;  1XJV A;  5M5W H;  4R4Q A;  4GOP B;  3JC6 6;  4A3J G;  4DNI A;  4A3D G;  3G4S A;  1PA6 A;  3T1Y L;  2QGQ A;  2NZO A;  3CPF A;  1KHI A;  3NEL A;  3RN2 A;  3PUX A;  1EFW A;  3J80 c;  1N36 L;  2HIV A;  4A3C G;  3KDF B;  2JQO A;  5LMN Q;  5C0X J;  1SRO A;  1WCM G;  4JI3 Q;  1VS0 A;  2CCZ A;  3E0E A;  1PH9 A;  4BXX H;  2AWN A;  1IL2 A;  4QGU A;  1VQE A;  1GKH A;  4HID A;  1E1T A;  3SGI A;  4A3J H;  4YY3 Q;  1XNR L;  2I5H A;  2OTL A;  2R93 G;  4R4I A;  1QVG A;  3J7Z C;  4OX9 L;  4DR7 L;  3VDY A;  1HNW Q;  5LMU L;  2ZJQ A;  1FJG Q;  1WI5 A;  2OQ0 A;  1GVP A;  2AWO A;  4O2D A;  5M3F H;  4X62 L;  4A3C H;  4DUY L;  5IYB H;  4C2M H;  1IBM L;  1WCM H;  3T1H Q;  3RZO H;  1I5F A;  1A63 A;  1TWC H;  1VQI A;  1JMC A;  1VQG A;  2K5H A;  2VZA A;  3CC7 A;  3S2D H;  4RMF A;  2OTJ A;  4P73 A;  1P16 A;  1W2B A;  5HY6 A;  1OXV A;  4KI0 A;  4OWX B;  2F52 A;  1D7Q A;  1X55 A;  2R93 H;  4OON A;  2B63 H;  4L5T A;  2JJQ A;  4YCW A;  2GVB A;  1I50 H;  4DV5 L;  1MJE A;  1VQL A;  4JCV E;  1VCI A;  3STB C;  3I4M G;  4JBJ A;  1L1O A;  1X65 A;  2UUA L;  1N33 L;  3J81 c;  1DGS A;  4LFC Q;  2K4K A;  1KXL A;  2MO1 A;  5IYC H;  2VQF Q;  1QVC A;  1YNX A;  2Y0S E;  3GO5 A;  3W1G A;  2UUC Q;  3CC2 A;  2JEA I;  3PSI A;  4RG1 A;  1VQ6 A;  3H0G G;  2UU9 Q;  2XTI A;  3M7N A;  2AMC B;  2N78 A;  1K73 C;  3I4M H;  4PG3 A;  3UDF A;  1S40 A;  3PCO B;  1CKM A;  2CKZ B;  4GNX C;  1C0A A;  1QZH A;  4AQY L;  4JI8 L;  4X65 Q;  1Q12 A;  4LNQ A;  2D0P A;  1K3R A;  3GTL H;  3NEM A;  1CUK A;  4A3B G;  2CWP A;  1IBK Q;  2ZJP A;  1NBW A;  3MEF A;  2PNH A;  2LXK A;  2A1A A;  2IHE A;  4P75 A;  4POF A;  4QY7 A;  4DV2 L;  2K5V A;  4DV1 Q;  2CWA A;  1I94 L;  3TQY A;  2ALY B;  1HJP A;  1YVC A;  3I4N G;  1N32 Q;  3HOX G;  5ELO A;  1K0R A;  3OW2 A;  1HNX Q;  1SR3 A;  1J5E Q;  1SMX A;  3PF5 A;  1QVF A;  1KRT A;  2BH2 A;  1YIJ A;  4TQU S;  2Z6K A;  4EQ5 A;  5AJ3 Q;  4JI4 Q;  4LFA L;  4AYB G;  4HJ7 A;  2E2I H;  4LF8 L;  3GTP H;  4DR3 Q;  1KL9 A;  2ZTC A;  3FKI G;  2ZM6 Q;  1S3O A;  3HOW H;  1CSP A;  3GTJ H;  2HIX A;  4AIM A;  4DAM A;  3I4N H;  2IHF A;  1GD7 A;  3HOX H;  4B3M L;  4A3B H;  2RCN A;  1NE3 A;  2VS1 A;  1VQP A;  3B6Y A;  3M9B A;  5JJK A;  3CAM A;  1X54 A;  4HIM A;  2BA1 A;  1QZG A;  1EOV A;  3I55 A;  4LF7 Q;  4YWK A;  4DV6 L;  1TWF H;  2UXB Q;  1X3E A;  1VQ5 A;  3FP9 A;  2KBN A;  1QUQ A;  1Q1B A;  4JOI C;  3GTM H;  5GQO A;  3AFQ A;  4DV3 L;  2L15 A;  4DR4 L;  4OO1 I;  3FKI H;  3HFZ B;  1Y14 B;  2R92 G;  4R4C A;  2FXQ A;  4B3S Q;  2PI2 E;  1VQB A;  2BA0 A;  4JI5 L;  4IFD G;  4NXM L;  4X66 Q;  3Q8D A;  1K8A C;  2HHH L;  1VQA A;  3KJP A;  1OXU A;  1IXR A;  2LSS A;  5GAG C;  4YWL A;  5JEA J;  4LF5 Q;  4X64 Q;  2VQE Q;  2R7Z H;  4JV5 L;  1PVO A;  1IBL Q;  2UXD Q;  1J6Q A;  1UE5 A;  2VL6 A;  3GTG H;  2WB1 G;  3S15 H;  1SRU A;  5BR8 Q;  3M4P A;  4KHZ A;  3PUZ A;  3UDG A;  1CKN A;  1EQR A;  4YHH Q;  2A8V A;  4GNX A;  1TWH H;  4LF4 L;  3S1M H;  2NVX H;  2UXC L;  1Q7Y C;  5FJ8 H;  4IOC A;  1SLJ A;  4DV0 Q;  4B3R Q;  3T1Y Q;  1WOC A;  5IP7 G;  5JJL A;  4IPC A;  1KAW A;  3HOZ G;  3BZC A;  4ALP A;  1E7Z A;  1L0W A;  1VQ9 A;  2I5M X;  1VQ4 A;  3W1B A;  3CCR A;  4JI7 Q;  1A62 A;  1XPU A;  4BY7 G;  2IX1 A;  1H95 A;  4TVA B;  1YZ6 A;  4NXN L;  3UE0 A;  1PH5 A;  3FHW A;  3CP0 A;  3J80 i;  3RLO A;  3CCL A;  4DR6 L;  2F3I A;  4UP9 A;  2A19 A;  3WWV A;  1JB7 A;  4OX9 Q;  2ATW A;  1XNQ Q;  4GN3 B;  4BA1 I;  4DR7 Q;  1VQ8 A;  1G6P A;  5FLM G;  3U50 C;  3BZK A;  1YEZ A;  2CFM A;  4DUY Q;  2B29 A;  2ZTD A;  4R4O A;  5C44 G;  4DR1 L;  2VUM H;  3OTO L;  1UE6 A;  1ASZ A;  3U58 A;  4A3D H;  2IX0 A;  3EN2 A;  1VQF A;  4LW1 A;  3F2C A;  3E9I A;  3F2D A;  4DR2 L;  5FLM H;  1PHJ A;  1GM5 A;  3TS0 A;  1RL2 A;  1OXT A;  2UUA Q;  1X3F A;  1O7I A;  1A0I A;  3UDX A;  3RN5 A;  4B3T L;  1N33 Q;  5C4X G;  3AQQ A;  4JBW A;  4O0A A;  2KCM A;  2E5L L;  2DUD A;  1JJC B;  1PV4 A;  3J81 i;  4WJ3 M;  5C0X I;  4OO1 G;  3UE1 A;  4UP8 A;  1Q8K A;  2PQA A;  4JI0 L;  1JE5 A;  5GAD C;  4A93 G;  2NN6 G;  5C4J H;  1OXS C;  4HIO A;  1SN8 A;  1WJJ A;  4DR5 Q;  4LWC A;  3K80 C;  1JJ2 A;  1HR0 L;  3HKZ G;  1AE2 A;  1EIF A;  4DV4 L;  2PI2 A;  3CCE A;  2I0Q A;  1K83 H;  2F4V L;  4IFD I;  3L2P A;  1N8R C;  3CCU A;  1R9T H;  3PV0 A;  4QL5 A;  1SE8 A;  1Q81 C;  1B8A A;  1OTC A;  5GAH C;  4QIW E;  4JBM A;  3GDE A;  4L5S A;  5FLX c;  4A93 H;  5LMN L;  3PF4 A;  3RLF A;  4BY1 G;  4JI3 L;  2NVT H;  3GTK H;  1Z47 A;  3H3V I;  2N49 A;  4DV7 Q;  4Y7N H;  4KHP L;  1I94 Q;  1WYD A;  2H5X A;  1PH1 A;  2EXD A;  1X3G A;  4IO9 A;  4LF9 L;  4JC0 A;  4A3E G;  3F2B A;  1FJG L;  5C3E G;  1VQK A;  3K7A H;  3A5U A;  4PZ7 A;  3TRZ A;  3M4Q A;  4AYB E;  2V1C C;  1Y1V G;  3J7A 5;  1N9W A;  1PH3 A;  3H0G H;  1TWA H;  1L1O B;  3T1H L;  4X6A H;  4GOP C;  1B7Y B;  3DLL A;  1M90 C;  2JA5 G;  2Q2T A;  2UUB Q;  4LFB L;  4L5R C;  2HQL A;  3JAM c;  2Q2I A;  2NVQ H;  3W5O A;  1PH2 A;  1V1Q A;  3KJO A;  3D0F A;  4A3E H;  5DLQ E;  1D8L A;  3CMA A;  4IPD A;  4QQB X;  5C3E H;  2MNA A;  3I56 A;  2KHI A; 
#chains in the Genus database with same CATH topology
 4JYA L;  4XT1 B;  1E22 A;  3D6C A;  1EUJ A;  5DM7 3;  1LTR D;  4TSS A;  3C1F A;  3KBG A;  3CW2 C;  5I9P A;  3S2D B;  1G91 A;  1MD2 D;  2JK8 A;  4H44 C;  1NMG A;  2NZH A;  4OIJ A;  5C0X G;  1WVL A;  2B63 B;  2L4N A;  1VQC A;  3IRB A;  1MI2 A;  3SK4 A;  5DM6 3;  4QF4 A;  1XMQ L;  5D65 A;  2O5I C;  5IOD A;  3K81 C;  2AKW B;  2DNE A;  3R3O A;  4KTA A;  1LAB A;  1ROD A;  2EY5 A;  1J5E L;  3PO3 H;  3KF6 A;  1MJC A;  1Q1E A;  4UPA A;  5AJ3 L;  3PIP A;  4A75 A;  1V1P B;  2IT1 A;  4OWT B;  1EIG A;  1N36 Q;  1CKO A;  5JJI A;  2TSS A;  3LX0 A;  5H1S E;  1K0S A;  2FHT A;  2YYZ A;  3X3M A;  2R6G A;  1L2F A;  3Q24 A;  3H3V H;  3M85 A;  4LF7 L;  2EIF A;  1JOR A;  3NEN A;  4LUZ A;  3VA7 A;  3A8I E;  3D8G A;  5DAU A;  3HOV G;  1KDA A;  4RHS A;  1EU4 A;  1ENC A;  4DNR B;  2TMP A;  4KLK A;  1F2Y A;  5JPN C;  1WFQ A;  1IBL L;  4HCE A;  1PYS B;  3I4N B;  3M4O H;  2JA9 A;  4DV4 Q;  3PUW A;  4E6I A;  2QF7 A;  1KAA A;  1SNO A;  1Q46 A;  2SOB A;  1FGU A;  2VW9 A;  4DA2 A;  3RR5 A;  2PMZ E;  1YNJ D;  1FD7 D;  3U4Z A;  3S2H H;  5EPL A;  4DK1 A;  2EQS A;  2VB3 X;  4S3S A;  5CV5 A;  4FF1 A;  1SE4 A;  5C5L A;  1EYC A;  2L55 A;  3GD7 A;  2ES2 A;  1MKH A;  4PQX A;  3BS1 A;  2B63 G;  4ZQ3 A;  3URY A;  3F2U A;  1Q82 C;  3E0J A;  4U67 3;  1PH7 A;  3T4A C;  3PIP 3;  4PV1 C;  1JOK A;  2NVX B;  4IUT A;  3M3Y H;  2NN6 H;  3CME A;  2NB0 A;  2K50 A;  5IGD A;  4A3L G;  1QG7 A;  1D2B A;  4C3I H;  3GTO H;  4X3S A;  4IN3 A;  4MTN A;  4HAE A;  1HNW L;  3I70 A;  3T56 B;  3I7F A;  4HR7 B;  3G48 A;  2A73 B;  4JYA Q;  2E76 C;  4QJF A;  5G3L D;  4IUN A;  2KED A;  1K8G A;  1SNM A;  5A2Q L;  5CMD A;  4JVZ A;  4K8J A;  1GUS A;  2A6H C;  3G71 A;  3LGJ A;  1HZC A;  5IY0 A;  2F3W A;  1ET9 A;  1JT8 A;  3EBE A;  3GTQ H;  3CD6 A;  3V96 A;  4A3D B;  2OT2 A;  3GQB A;  1JQY D;  1WTQ A;  1BO0 A;  4EX5 A;  1NY4 A;  1XMQ Q;  4A3M H;  1ML0 D;  4P72 A;  4L63 B;  4CKC A;  1JWU D;  4DV7 L;  1IZ6 A;  5CGK A;  1TT2 A;  1YJW A;  2SEB D;  1RHP A;  5EPJ A;  1WD0 A;  4ID6 A;  1EY0 A;  2JP1 A;  2XRQ D;  5IGE A;  3A0J A;  1PDQ A;  3PGZ A;  1IBK L;  2OQK A;  2QDL A;  1XPR A;  3TEH B;  1KC8 C;  2F1M A;  1LT6 D;  2UUB L;  3DEP A;  1E3P A;  4G57 A;  5COY A;  1SJE D;  1STG A;  1VQD A;  4GN5 A;  3PIO A;  2JXM B;  3HKZ B;  1A3U A;  5IGC A;  4A3I H;  5EBD A;  1UNS A;  1EFI D;  4JI4 L;  4FF2 A;  5IP9 G;  3DWA A;  4K6D A;  3K7A B;  5IYD G;  1G51 A;  3ZYY X;  2JA7 H;  4OHJ A;  5IE8 A;  3OTO Q;  1RIP A;  2QIL A;  4Q0F A;  2RDH A;  1PFS A;  1FL0 A;  1U4M A;  2YU9 H;  1YJN A;  3CQZ H;  3ULJ A;  1U4R A;  2NBF A;  1BQQ T;  4XDX A;  4DR2 Q;  3E9H A;  3S9W A;  4OEM B;  3S16 H;  3IL8 A;  3HKS A;  5E1F A;  4ZRZ A;  2MHV A;  3OYY A;  4K5X A;  3CKI B;  1ASY A;  4XXE A;  1PH4 A;  3NQI A;  4LF5 L;  2KHJ A;  3BU2 A;  5C3W A;  4DF7 A;  1LYL A;  3S1N B;  2CW0 C;  5L37 A;  3HOV H;  4GKJ L;  2IWH A;  4KKS A;  4A3D G;  1PA6 A;  3CPF A;  2KHS A;  3NEL A;  1RKN A;  1QIL A;  1X32 A;  3KDF B;  2JQO A;  5C0X J;  4H0L C;  1STH A;  1SRO A;  1WCM G;  3NQT A;  1PRT D;  1VS0 A;  3PIO 3;  2CCZ A;  2O5J C;  1XXG A;  2AWN A;  1E1T A;  4CDC C;  4IZ8 A;  2R93 G;  1QVG A;  4RA8 A;  2PW5 A;  1HNW Q;  5LMU L;  1FJG Q;  1GVP A;  5EPK A;  1PTO F;  3T1H Q;  1ZEQ X;  1VQG A;  3J7A F;  3S2D H;  4P73 A;  1W2B A;  1EQT A;  1OXV A;  4OWX B;  1X55 A;  1LTS D;  1HQM C;  1LTB D;  4YCW A;  1KNA A;  2B63 H;  5ELD A;  4HMI A;  1VQL A;  1VCI A;  3STB C;  1EEF D;  3EJI A;  5J39 A;  2PW7 A;  2UUA L;  5C4H A;  2EE1 A;  3KLS X;  3J81 c;  2VQF Q;  1YNX A;  3W1G A;  1WTR A;  2UUC Q;  4X3K A;  1F2M A;  4RG1 A;  3HP3 A;  1LTG D;  2F0G A;  1G6Z A;  1C0A A;  3HOU B;  2CQA A;  4JI8 L;  3T16 A;  4A3F B;  1TII D;  3NEM A;  1CUK A;  1MHW C;  1WTP A;  4K2L A;  1I4G A;  2CWP A;  1IBK Q;  1NBW A;  5C44 B;  4POF A;  2F0F A;  4UHV A;  1YVC A;  2J4X A;  1DM0 B;  3OIP A;  2B8F A;  3I73 A;  3Q22 A;  2ENB A;  2Q8T A;  2BH2 A;  1B9M A;  1MGS A;  4JI4 Q;  4LF8 L;  2F0E A;  4DR3 Q;  2K04 A;  3FKI G;  2PYK A;  3C3L A;  1SXT A;  2HIX A;  3I4N H;  3SVM A;  2IHF A;  4B3M L;  1YNN D;  2RCN A;  3NSW A;  5A35 A;  1NE3 A;  4F88 A;  2EYO A;  3M9B A;  4OEL B;  2BA1 A;  4DV6 L;  1X3E A;  5GQO A;  2X69 A;  3OMC A;  3D4D A;  2G5D A;  1GOZ A;  1K8A C;  1VQA A;  1IXR A;  4BY1 B;  4YWL A;  4C1N K;  4LF5 Q;  3VR6 A;  3S1Q B;  3OOC A;  5IGB A;  2K01 A;  4YHH Q;  1VMC A;  3IFD A;  5C3E B;  2AQ1 B;  2NVX H;  4K8I A;  4IOC A;  4DV0 Q;  5IP7 G;  1Y1V B;  2HQE A;  2WII B;  1VF7 A;  4IPC A;  4QB4 A;  3Q6S A;  4ALP A;  1ICF B;  2I5M X;  3E3X A;  3IFT A;  3W1B A;  3CCR A;  2NVY B;  4JI7 Q;  1H95 A;  2IX1 A;  3OHX C;  1AFP A;  3U9O A;  4A3K B;  2ZXP A;  3VR5 A;  1JB7 A;  2ATW A;  4BA1 I;  2NYZ D;  2F0W A;  1G6P A;  1CT1 D;  3JAM E;  3U50 C;  3BZK A;  3FRP B;  1JC7 A;  1B53 A;  5C44 G;  4ULL A;  2PZW A;  1II3 A;  2KOL A;  2K03 A;  2JA8 B;  2EJF C;  3U58 A;  2IX0 A;  4A3D H;  2A68 D;  1PHJ A;  3J81 L;  2UUA Q;  1O7I A;  2XVS A;  4Q5V A;  3PO2 B;  5KYI A;  4JBW A;  2KCM A;  2E2J B;  1JJC B;  4R8I A;  4WJ3 M;  4OO1 G;  1Q8K A;  4A93 G;  1JJ2 A;  1WJJ A;  3W2D A;  3D3R A;  1Q3L A;  2I0Q A;  4OIK A;  5C4Z A;  2F4V L;  1TY2 A;  3L2P A;  1PFM A;  2XWB B;  1JE4 A;  2XWJ B;  4QL5 A;  1H9J A;  2EJM A;  3H6M A;  3MXU A;  2F0N A;  3V2T A;  4A3G B;  3GDE A;  3HOY B;  2Z4H A;  4RH6 A;  3RLF A;  5M5X B;  3NTK A;  4BY1 G;  4JI3 L;  2Z6B A;  3SR1 A;  1GHJ A;  4ME5 A;  4KHP L;  1WYD A;  4RCO A;  1S5C D;  2F0P A;  4IO9 A;  1VF5 C;  5C3E G;  3K7A H;  3A5U A;  2B8G A;  1Y1V G;  3J7A 5;  1PH3 A;  4O1N A;  4GOP C;  1M90 C;  4EVO A;  2OF1 A;  3JAM c;  4N8X 1;  4WJW A;  1PH2 A;  3KJO A;  3QIA A;  1SNP A;  2CH4 W;  3P75 A;  5DLQ E;  3SXH A;  1JB3 A;  2BDO A;  3PUY A;  1UE7 A;  2BCO A;  2WAQ E;  1KDB A;  4LFC L;  2K5D A;  1SAP A;  3R2I A;  4ZAI A;  3RZO B;  5ELF A;  1SND A;  2DN8 A;  3TME A;  3S1N H;  3MXG A;  3K5L A;  1AZQ A;  4N9T A;  5EAY A;  1RTO A;  4IPG A;  3N6R A;  3NBI A;  1BVS A;  1F9P A;  2RHS B;  2YV5 A;  3PO2 G;  1SEB D;  1G8Z D;  5IWA L;  3K7U C;  3PO3 G;  2DGY A;  4ZUI A;  5DNF A;  1JWM D;  2F0Q A;  1EWH A;  1M8A A;  1I4X A;  3CCQ A;  1PH8 A;  1EY7 A;  3D31 A;  3NK9 A;  4JI2 Q;  1STE A;  3TDQ A;  3VYS A;  3X3N A;  2YTY A;  1HNX L;  2QA4 A;  3I4M B;  1MBY A;  3VR2 A;  3O13 A;  4KK7 A;  3NXW A;  2SNS A;  5FKA C;  2D0O A;  1Y8N B;  2KVM A;  1QUQ B;  2A6E D;  4PMB A;  3K5N A;  3HOY G;  4N9P A;  2F0U A;  2PZU A;  4RKL A;  2B2V C;  1IYV A;  1HUN A;  1YBY A;  4BS9 A;  2B2Y C;  5K5P A;  1XNR Q;  2V4D A;  1L0Y B;  1V43 A;  5GRO A;  5IP7 H;  2K14 A;  2MP1 A;  3QR8 A;  3KDF A;  2VY3 A;  4JBK A;  4R4T A;  4ZCK A;  3NTH A;  1TVX A;  1CKN B;  2KUM A;  2E2I B;  4I7A A;  4IQZ A;  1D6E C;  4LF6 L;  2F0K A;  3CC4 A;  2A69 D;  5ISR A;  2VQE L;  3HOU H;  3TS2 A;  1G29 1;  4A3F H;  2F0V A;  1DJR D;  2N8N A;  1C4Q A;  1V8Q A;  1XMO L;  4J15 A;  4CKE A;  2WKC A;  3L7Z C;  4A3I B;  4B3R L;  4NB3 A;  5C44 H;  3H91 A;  2F0I A;  3BVG A;  4DU9 A;  1HPC A;  1B9N A;  2E8G A;  3HEJ A;  4XIG S;  3AYH B;  5IYB G;  3K58 A;  4GKK L;  2KEE A;  1JJG A;  1YIT A;  2Q2H A;  4KHP Q;  1CSQ A;  1TU2 B;  2BE5 D;  3RD4 A;  1K8M A;  1UE1 A;  3PUV A;  1HFG A;  3J7A V;  3GTG B;  1ESR A;  4C3I G;  3S15 B;  3ER0 A;  2VNU D;  2Z6K C;  3E5S A;  3CCV A;  3EIV A;  3KLS A;  1XNQ L;  2AUK A;  4LUV A;  4DNT B;  2WP8 J;  4KY5 A;  1A15 A;  1O7Y A;  1S5F D;  3S1M B;  4OXP A;  2N3S A;  5IYC G;  3I91 A;  3RUZ A;  5I6Y A;  1PZI D;  2A5H A;  1BBX C;  1UAP A;  1ILQ A;  1SE3 A;  1M1K C;  4KKU A;  3HZX A;  4KN4 C;  3CXC A;  3D4W A;  4F87 A;  3TP8 A;  4LFA Q;  2E74 C;  4TKO B;  1B70 B;  3R2T A;  4BY1 H;  2VB2 X;  1ICW A;  3ZJY C;  1P8L A;  2HCI A;  1AH9 A;  2EVB A;  3S1Q H;  4A3M G;  4DR5 L;  1FNU A;  3CPW A;  2VUM B;  1BCP F;  4PMC A;  1V1O A;  1Y1V H;  2EY6 A;  1QOH A;  2K52 A;  3DXJ C;  2Y0S G;  4QUF A;  2NVY H;  3A8J E;  5IWA Q;  1EQQ A;  1A2T A;  1IHZ A;  3E6Z X;  4RGT A;  2UU9 L;  4IJL A;  1FNV A;  3BVZ A;  4A3K H;  3EQL C;  1J8I A;  1Z7T A;  5KNC A;  2RSN A;  2B2W C;  3J80 E;  1A3T A;  1X9N A;  4LF4 Q;  1HZA A;  3KLR A;  4A3I G;  1MIU A;  4LAA A;  1HXY D;  1DD2 A;  1SE2 A;  1QJO A;  2JA8 H;  1JOO A;  4H02 A;  2JA7 G;  2GVA A;  3PO2 H;  2FMM A;  5KND A;  2E2J H;  1GO3 E;  1H9K A;  1EQV A;  1EIH A;  3OSO A;  3DM3 A;  2O4X A;  4JG2 A;  4FF3 A;  1I4H A;  1ZYR D;  4GOP A;  4LF6 Q;  4KJN A;  2F0J A;  2R7F A;  5NUC A;  1W6J A;  4A3E B;  1XMO Q;  4A3G H;  3HOY H;  4GS3 A;  4B3S L;  5BN4 A;  4DAY B;  1HTL D;  1TS4 A;  5M5X H;  4X66 L;  2Z0S A;  5GAE C;  2PNR C;  2ASB A;  3S24 A;  3J7Y W;  2HT1 A;  4X64 L;  1AE3 A;  2K75 A;  4JI0 Q;  4GKK Q;  2UXD L;  3IKJ A;  1EWI A;  4IOA A;  5CV6 A;  5BR8 L;  2VUM G;  2J7Z A;  5JJZ A;  5LL6 S;  1TS3 A;  2LS0 1;  2G9D A;  4DNI A;  4CDF C;  4C3H B;  2QGQ A;  2NZO A;  2N88 A;  4MTK A;  1NSN S;  3P20 A;  1EFW A;  3J80 c;  3C46 A;  2HIV A;  1FYC A;  3MXP A;  1ONL A;  4G4K A;  1QNK A;  4JPB W;  3M7G A;  4BXX H;  4DFA A;  1IL2 A;  1VQE A;  1GKH A;  1H9S B;  1PRT B;  1Y1W B;  1QNU A;  1CA6 A;  1SNC A;  4DR7 L;  1DON A;  1NR2 A;  1Z6H A;  3NWS A;  4RGO S;  2ZJQ A;  4G7O C;  4O2D A;  1SBB B;  3Q0A A;  4X62 L;  1IBM L;  5IYB H;  3ERQ A;  3ITP A;  3RZO H;  1VQI A;  1JMC A;  2D9U A;  4C56 C;  5D3I B;  1S5D D;  4RMF A;  4DGZ A;  2ZT9 C;  5HY6 A;  4KI0 A;  1D7Q A;  2HCC A;  2WB1 B;  5JVH 3;  4OON A;  5FOB B;  2WAC A;  2B2V A;  4M8A A;  1LAC A;  4DV5 L;  2XSC A;  4JCV E;  3R8B A;  4JBJ A;  2B2Y A;  1X65 A;  2EZV A;  1DGS A;  1C8C A;  5IOC A;  5IYC H;  1BDO A;  2Y0S E;  4CJ1 B;  1DOM A;  1SYD A;  4KHV A;  1EWC A;  3C1E A;  2JEA I;  4BY7 B;  1SMY D;  3T53 B;  5LHY 1;  1LV9 A;  3TBI B;  4DAV A;  1I3Q B;  2UU9 Q;  5IIF A;  2AMC B;  3I4M H;  1S40 A;  2CKZ B;  2F0T A;  1CZW A;  1GUO A;  4AQY L;  1Q12 A;  2X6G A;  2D0P A;  1D5M C;  1Y69 U;  2ZJP A;  3MEF A;  2PO4 A;  5M9O A;  5ELE A;  4P75 A;  3SHL A;  2IHE A;  2HDL A;  1RDP D;  4HN7 A;  4DV2 L;  1CFM A;  2ALY B;  4JW0 A;  4IAL A;  3I4N G;  1LTA D;  1K0R A;  1J5E Q;  3SK5 A;  3PF5 A;  1YIJ A;  4TQU S;  1SYB A;  2MGS A;  2Z6K A;  4EQ5 A;  5AJ3 Q;  4NP5 A;  2E2I H;  2QKI C;  1RF2 D;  1KL9 A;  3HS0 C;  2QDB A;  1GD7 A;  1SDF A;  1CHQ D;  3P7J A;  4CHT B;  3CAM A;  5KEE A;  1X54 A;  4BBR B;  4HIM A;  1EOV A;  3I55 A;  1CHP D;  1DXM A;  4YWK A;  4LF7 Q;  2RDF A;  1EY8 A;  1QUQ A;  4DV3 L;  2L15 A;  4IUP A;  4R4C A;  2FXQ A;  4B3S Q;  4NXM L;  2JA6 B;  2DJF C;  3Q8D A;  4X66 Q;  2HHH L;  5I4D A;  4UAI A;  2LSS A;  5GAG C;  1PVO A;  1TS2 A;  4X64 Q;  1IBL Q;  2L0C A;  1J6Q A;  3GTG H;  2VL6 A;  3S15 H;  2WB1 G;  2UXD Q;  5BR8 Q;  3M4P A;  3MWY W;  1CKN A;  1EQR A;  3RZD B;  5FLX E;  2A8V A;  3S1M H;  2J0T D;  1Q7Y C;  3VA5 A;  2KQ3 A;  1SLJ A;  1SFO B;  5I9O A;  4ILW A;  3BZC A;  5E3F A;  1L0W A;  4K5V A;  1VQ9 A;  4BBS B;  4BY7 G;  1XPU A;  4ZYS A;  1YZ6 A;  5I2X A;  1J9O A;  4NXN L;  1BNZ A;  1BUV T;  1DZ1 A;  3CP0 A;  5M5Y B;  3RLO A;  2M9V A;  4FP5 D;  4DR6 L;  2F3I A;  4ODG A;  2A6H D;  4DR7 Q;  2B2W A;  3MFG A;  4K6L A;  1VQ8 A;  3H94 A;  1YEZ A;  3I90 A;  3UI2 A;  5CV8 A;  2X6L A;  4R4O A;  4DR1 L;  2VUM H;  1KLU D;  2QCP X;  2FFK B;  2C9O A;  2SDF A;  5EJW A;  1VQF A;  4LW1 A;  3GP7 A;  3E9I A;  3F2D A;  3OPO A;  1GUT A;  4F8M A;  3TS0 A;  4B3T L;  3AQQ A;  4O0A A;  1B3Q A;  2DUD A;  1YNN C;  3S14 B;  3CHB D;  1PV4 A;  3J81 i;  1KDC A;  5BN5 A;  5C0X I;  4EQO A;  3A54 A;  1JE5 A;  4LWC A;  3K80 C;  1HR0 L;  1D1K A;  1PTO D;  1EIF A;  3HKZ G;  4CJ2 C;  4IFD I;  4V0B A;  1N8R C;  2LFN A;  3CCU A;  3PV0 A;  2EYP A;  2Z1C A;  1Q81 C;  1B8A A;  3BDL A;  4LJZ C;  2EY2 A;  4FF4 A;  4C3J B;  5FLX c;  5LMN L;  1AZP A;  2RVL A;  4EQN A;  4DV7 Q;  5M3M B;  1F77 A;  1X3G A;  3BYT B;  4JC0 A;  3SK6 A;  3FPP A;  1EY6 A;  3F2B A;  1VQK A;  1HCZ A;  1ZKO A;  3ERO A;  4J6H A;  3M4Q A;  2V1C C;  1N9W A;  1B7Y B;  3DLL A;  1FGB D;  2Q2T A;  5KYL A;  4KY6 A;  5CV4 A;  3VYT A;  2UUB Q;  4LFB L;  2HQL A;  3A8K E;  4F7X A;  3W5O A;  1U4P A;  1STN A;  3I4L A;  3D0F A;  4A3E H;  5F2D A;  4QQB X;  3FMC A;  1S5E D;  1ET6 A;  2MNA A;  3I56 A;  2KEC A;  1SYG A;  4DUZ L;  1F9S A;  4A3J B;  4DV3 Q;  4GN4 B;  1IW7 C;  2CW0 D;  1VQH A;  1Z9F A;  3A56 A;  4L6T B;  3RNU A;  2IPK D;  5M3F B;  4G7Z C;  2K05 A;  2B2T C;  2ICI A;  4C2M B;  2A68 C;  1TWC B;  1B3A A;  4PMW A;  1JIC A;  3NBH B;  1UWV A;  3D4R A;  4C3H H;  1V1P A;  4X65 L;  1UEB A;  4DK3 C;  3RLN A;  3OWF A;  1Q86 C;  2IW3 A;  3K0X A;  4APV A;  1Y1W H;  4M1U B;  2WV6 D;  1HNZ L;  4KKT A;  4YCU A;  3U4V A;  1E24 A;  1HR0 W;  4RHR A;  1C7Y A;  4DAY A;  4DR6 Q;  4GKJ Q;  4CDD C;  1GUG A;  1PMR A;  2B3G A;  2PPB C;  2QW7 A;  3QO2 A;  3STB D;  3F1Z A;  1C9O A;  2ZTE A;  3NUC A;  1EEI D;  1PFB A;  4C3J G;  5LMN W;  1XTD A;  3CF5 A;  3MXN B;  3ONA B;  5EKL A;  1I4P A;  5C5M A;  1X6O A;  3HOU G;  2RKS A;  2H1E A;  1EY4 A;  4A3F G;  4H13 C;  5LMU Q;  1AN8 A;  3WOE A;  2K5N A;  2IX3 A;  4B3T Q;  2I5L X;  4BY7 H;  2QEX A;  3K8A A;  1PZK D;  4QIW B;  1L0X B;  5KNB A;  1I3Q H;  4HJ9 A;  1H9S A;  1BXT A;  4P71 A;  4GNX B;  3GTP B;  4HSV A;  2JEB I;  3HOW B;  3GTJ B;  3TN2 A;  3KF8 B;  3HOX B;  1K8O A;  3HKZ E;  1PH6 A;  3CCS A;  2JE6 I;  1TWF B;  2NTT A;  4AYB B;  4HJ5 A;  4OWW B;  2Z8L A;  5IGG A;  3ULL A;  5FLX L;  5M3F G;  2KCN A;  3KYH C;  1JCK B;  3WOF A;  2D5D A;  2F0M A;  2SNM A;  1AP0 A;  2JSO A;  4R1J A;  4JI8 Q;  1V9P A;  5J22 A;  5CBA E;  1TS5 A;  3K5M A;  4WRD A;  2Z9H A;  3SEB A;  1TWH B;  4ZLT F;  2OWO A;  1LTI D;  4R9W A;  4OGQ C;  1I4Q A;  5CV7 A;  4LFB Q;  4BBR H;  4NDX A;  5CV9 A;  3T51 B;  4HSP A;  2L1B A;  5JPM C;  3JAM i;  4GLX A;  5K36 G;  4DUZ Q;  3FVQ A;  2JA6 H;  1BKB A;  1CTM A;  1G2S A;  1LM0 A;  4LF8 Q;  2Q8I B;  1EIY B;  1QWY A;  3TP7 A;  4B3M Q;  1YJ9 A;  1UUP A;  3RZD H;  5JEA H;  4A3K G;  1KQS A;  2EJG C;  4DV6 Q;  1SFO H;  2R7D A;  4X3U A;  5D3D A;  4BBS H;  1NJI C;  2L11 A;  4GLV B;  3Q23 A;  5EKI A;  5M5Y H;  1W6K A;  1QE6 A;  2RA4 A;  4MZ9 A;  1HNZ Q;  3HOW G;  2JA8 G;  2IJ0 A;  1KLG D;  3FEW X;  2WFW A;  2B2U C;  3QG1 A;  4A76 A;  4DK6 C;  1YHB A;  1K83 B;  4DAP A;  3BZD B;  2RCF A;  4KJO A;  4B9X A;  3DWP A;  3FDT A;  2K5W A;  2JYO A;  1ZXT A;  4NKL A;  2KEN A;  4EGV A;  1I4R A;  2IY5 B;  2GN5 A;  4XTC S;  2NVT B;  2YTX A;  3GTK B;  1YHA A;  4Y7N B;  4QCL A;  2Q8R E;  4DK0 A;  4HED A;  3S14 H;  1F2Z A;  1HFN A;  1E1O A;  2AQ3 B;  4A3G G;  2FIN B;  5FJ8 G;  4K5W A;  1BBW A;  2I46 A;  3H0G B;  3MFY A;  1XYI A;  1K9M C;  5EKK A;  3MAQ A;  2NVQ B;  1KAB A;  3AMU A;  3SK8 A;  3DM1 A;  4HIK A;  4P74 A;  2WKD A;  4C3J H;  4POG A;  4A3B B;  1GUN A;  2EPB A;  4PZ8 A;  3MEH A;  1SYE A;  1W3S A;  1VQO A;  2K7V A;  5M3M H;  2Q2U A;  4MIU A;  1TXY A;  2B2T A;  1STB A;  2ZJR A;  3NTI A;  4RCN A;  1YI2 A;  2F4V Q;  4BXX G;  1R4Q B;  1XX8 A;  3JC6 6;  4O42 A;  3G4S A;  3C2P A;  3NE5 B;  1KHI A;  3P1H A;  3RN2 A;  3PUX A;  2F0O A;  1ENF A;  1N36 L;  3K0Y A;  1U9R A;  2XNA C;  3D6W A;  4JI3 Q;  3S17 B;  3E0E A;  3U9S A;  4QGU A;  1T5E A;  4HID A;  3S1R B;  3SGI A;  4A3J H;  3NPP A;  3J7Z C;  4OX9 L;  3I3C A;  3VDY A;  1RJT A;  1WI5 A;  5M3F H;  2AWO A;  4A3C H;  2R92 B;  5A2Q E;  3CU7 A;  4C2M H;  2F03 A;  1I5F A;  1TWC H;  2K5H A;  2VZA A;  3JAM L;  5DEH A;  1E2Z A;  1P16 A;  3N52 A;  2GA4 B;  4L5T A;  1SJH D;  5COR A;  4GZY C;  4YIJ A;  2BDN A;  4B9W A;  1MJE A;  3I4M G;  1TQO A;  1PXU A;  4LFC Q;  2K4K A;  2MO1 A;  4DN4 M;  5FO8 B;  2FJ2 A;  3HOZ B;  3GV6 A;  1PFN A;  4V19 0;  1EU3 A;  3NP8 A;  3VYR A;  1VQ6 A;  3H0G G;  5EBC A;  2XTI A;  3M7N A;  3UDF A;  4ABN A;  3PCO B;  1CKM A;  5K36 H;  4IUQ A;  2DJG C;  3MA2 B;  1PLF A;  2WIN B;  1D5X C;  2EYL A;  3EA6 A;  4A3B G;  1PYW D;  2F0H A;  1U4L A;  3NBH A;  2PNH A;  2LXK A;  1BCP D;  3OW7 A;  4QY7 A;  1TWG B;  2CWA A;  1VMP A;  4JK1 C;  1I94 L;  4RKB A;  3OW2 A;  1NNX A;  4RGM A;  1HNX Q;  5D14 A;  5KRU A;  1YNJ C;  3K5O A;  5C4X B;  4IUU A;  1EYA A;  3GTP H;  2CVR A;  1CZG A;  1F9Q A;  2K1B A;  2ZTC A;  1WTW A;  1S3O A;  3HOW H;  1CSP A;  3GTJ H;  4AIM A;  1SYF A;  3A55 A;  3HOX H;  5FO7 B;  2VS1 A;  1VQP A;  3B6Y A;  5JJK A;  1NAP A;  1QZG A;  1TWF H;  1VQ5 A;  2E2H B;  3FP9 A;  4JOI C;  3AFQ A;  5I2Y A;  4DR4 L;  4OO1 I;  3HFZ B;  1Y14 B;  1ILP A;  2R92 G;  5CC4 A;  1STY A;  2PI2 E;  3MXN A;  4JI5 L;  2P5Z X;  4IFD G;  1JOQ A;  4K14 A;  4KMU C;  4I65 A;  1HUM A;  1KNE A;  1EZ8 A;  1T5X D;  2K6A A;  2VQE Q;  3I8Z A;  4JV5 L;  1UE5 A;  3SE0 A;  3TZD A;  1M4V A;  1SRU A;  4KHZ A;  2HDM A;  3UDG A;  4GNX A;  1TWH H;  2UXC L;  3QOL A;  5FJ8 H;  1SMY C;  4B3R Q;  1WOC A;  1DYQ A;  3HOZ G;  1E7Z A;  2JA5 B;  3KF8 A;  1VQ4 A;  4TVA B;  2K33 A;  1PH5 A;  3G6J B;  3FHW A;  4N8F A;  3J80 i;  4ZK9 B;  2BOS A;  3CCL A;  2PZT A;  4UP9 A;  2A19 A;  4OX9 Q;  4RGN A;  1XNQ Q;  2B2U A;  2I07 B;  5EGT A;  1E2W A;  4XQN A;  3A7L A;  3EFX D;  4UDU C;  3OTO L;  2PCF B;  5E4W C;  4XYO A;  1SNQ A;  1UE6 A;  3H09 A;  4XYQ A;  1ASZ A;  1I6H B;  2XIW A;  1EY5 A;  3EN2 A;  4DR2 L;  5FLM H;  2MPM A;  1RL2 A;  1OXT A;  1X3F A;  3RN5 A;  1A0I A;  5C4X G;  1AW7 A;  2E5L L;  2MJ8 A;  4I7Z C;  5IGF A;  3T13 A;  2E2D C;  2H4O A;  4CBV A;  4FXG C;  1ENA A;  4X3T A;  4DR5 Q;  5IT9 E;  1SN8 A;  1AE2 A;  1HHV A;  3L3O C;  1LT5 D;  2PI2 A;  1K83 H;  5HUR A;  1WTV A;  4LK1 C;  4Z9C B;  5HGT A;  1PTO B;  2NUC A;  4FXD A;  1O7Z A;  2DY7 A;  5GAH C;  1F9R A;  3VR3 A;  5KIX A;  4LMQ D;  3PF4 A;  2NVT H;  1LTT D;  3GTK H;  1B50 A;  3H3V I;  3QB3 A;  4Y7N H;  1DOK A;  5G3L F;  1I94 Q;  2H5X A;  1PH1 A;  1I6V C;  2KCC A;  1HTP A;  4LF9 L;  4A3E G;  1HA6 A;  1FJG L;  2AQ2 B;  5M5W B;  3HRZ C;  2F0D A;  5CR3 A;  5LL6 X;  3H0G H;  3T1H L;  1NR4 A;  1L1O B;  4X6A H;  2JA5 G;  2NVQ H;  3DEO A;  1DCZ A;  1D8L A;  3CMA A;  1EOT A;  5ELB A;  4A3B H;  2KHI A;  4DKA C;  4UY8 C;  1Q8I A;  3BYY B;  4C3H G;  4DR4 Q;  1PRT C;  2VQF L;  3ICE A;  2UUC L;  4JI5 Q;  4KN7 C;  2OCE A;  1WCM B;  3A5Z B;  3K59 A;  1NCV A;  3OIQ A;  3TRE A;  4JV5 Q;  2CHB D;  3OWE B;  2MUY A;  1N34 L;  1Y1W G;  1CM9 A;  2MQH A;  1S72 A;  3BJU A;  5J3B A;  2R93 B;  2EYJ A;  2K32 A;  1FR3 A;  3A74 A;  1I50 B;  5IT9 c;  2UXC Q;  1LUZ A;  2NN6 I;  2RSO A;  1WTH A;  4TRD A;  1B4O A;  3S17 H;  1PTO C;  5ELN A;  2ID0 A;  3S1R H;  5C0X H;  4YWM A;  1PYB A;  2F0L A;  1HZB A;  2R92 H;  2HUG A;  2Z4I A;  4IFD H;  3QJY A;  2JN4 A;  5JOB A;  3J80 L;  4DR3 L;  2LMC B;  3LWU A;  3GTL B;  1VQ7 A;  4JI1 L;  2MFI A;  4DPG A;  1XPO A;  3GV3 A;  3AFP A;  3J81 E;  4HJA A;  1L1O C;  1T9H A;  3L0O A;  2MO0 A;  5HGQ A;  2KCT A;  1A8V A;  1BBU A;  4JI6 L;  2CQO A;  3HOZ H;  3BG3 A;  4J8Q A;  2RF4 A;  1B2T A;  2D62 A;  3CRL C;  4X62 Q;  1MSH A;  2EOT A;  1D5Z C;  1IBM Q;  2E5L Q;  2RHQ B;  4J1M A;  1LLR D;  1FVI A;  3MVV A;  1RCV D;  1A3V A;  1JWS D;  4G7H C;  3CCJ A;  1K28 A;  4FNF A;  4NW2 A;  1X56 A;  2EDG A;  2BH8 A;  3KOJ A;  4DV5 Q;  5CBE E;  1PRT F;  4YHH L;  2LKV A;  4LUO A;  4C1N I;  4Y52 H;  1HA5 A;  4JOI A;  5T1I A;  4DV0 L;  4ZKB B;  1S4Z A;  3GTM B;  1NUC A;  1TWG H;  4CKB A;  2KA7 A;  1HH2 P;  1NTG A;  3FKI B;  3EVQ A;  3W3A A;  2ZXR A;  4NPS A;  4QMG A;  4WFN 3;  1EYG A;  4JI7 L;  2VXW A;  4K0K L;  1B1Z A;  4BBR G;  2R7Z B;  1GXD C;  3G6E A;  4IFD J;  5C4X H;  4AQY Q;  4ME3 A;  4LF9 Q;  2CH4 A;  3PMF A;  2WAQ B;  4RWS C;  4BA2 I;  2LXJ A;  4PZ6 A;  1GHK A;  1FNW A;  1KRS A;  1LO5 D;  3DHQ A;  2JA6 G;  2ZXO A;  1G2T A;  2LY7 A;  1E0B A;  5E7N A;  4DV2 Q;  5FO9 B;  1IYJ B;  4AH6 A;  2E2H H;  1OO9 B;  4YY3 L;  2EYH A;  4KY7 A;  2EY1 A;  3AEV A;  2PQA B;  1RTN A;  3G7L A;  5JEA G;  4WJ4 A;  4ZUJ A;  3H15 A;  2C35 B;  1HRJ A;  4IJH A;  3QWN A;  1KTK A;  4BBS G;  4A3L H;  1U5K A;  4RAU C;  1PZJ D;  1KIX A;  2XRS D;  3QOJ A;  4OL7 A;  3RMH A;  3F8T A;  1N34 Q;  2AHO B;  5JAV A;  4K2K A;  5IT9 L;  2XGT A;  2O2L D;  3KBX A;  4UP7 A;  2HD3 A;  1YHQ A;  1VQM A;  4MNO A;  2JA5 H;  3UDI A;  1IKL A;  4NXM Q;  3BDO A;  3DMU A;  1U0L A;  2HHH Q;  2M2L A;  1KD1 C;  2R3Z A;  4FVM A;  3ND8 A;  1Q90 A;  3LNN A;  4HJ8 A;  3K57 A;  3KLW A;  2WB1 E;  1R4P B;  1LTL A;  1X3Q A;  4YCV A;  5C4J B;  4RFB A;  2YTV A;  5CYU A;  3MHB A;  4A4I A;  3R93 A;  1R9T B;  3J81 j;  4L5Q A;  3VR4 A;  2RDG A;  3TZU A;  3I4O A;  4JI1 Q;  4R8N A;  2EYF A;  1I6H H;  5AFW A;  1A6X A;  4DV1 L;  4NXN Q;  1EYD A;  4A93 B;  5C6A A;  1N32 L;  2R7Z G;  1TY0 A;  3CCM A;  3TSS A;  4JI6 Q;  2WAQ G;  3ULP A;  1HZ9 A;  1CQF A;  4IPH A;  2ZM6 L;  1VQJ A;  1NMF A;  3HG9 A;  4DR1 Q;  4FDB A;  1TWA B;  4L8J A;  2DNC A;  2NWG A;  1C48 A;  4BWG B;  5M3M G;  1VQN A;  1PTO H;  2UXB L;  4KD3 A;  3KFU A;  4FYD A;  1XWE A;  1GUW A;  4GLA C;  5IP9 H;  1OXX K;  2PQE A;  5IYD H;  3ERS X;  3I2Z A;  1EZ6 A;  3KF6 B;  2F0S A;  1H9M A;  4XT3 B;  4K0K Q;  2FMC A;  4JI2 L;  4KV6 A;  1HR0 Q;  2C5C A;  2KJX A;  5E4X A;  1QCB D;  1XJV A;  5M5W H;  3DWQ A;  4R4Q A;  3V05 A;  4GOP B;  4A3J G;  2QEJ C;  2B39 A;  4HCS A;  3T1Y L;  1BR9 A;  1UEA B;  1ESF A;  4A3C G;  4FO2 A;  5LMN Q;  1IW7 D;  3IAY A;  3CRK C;  2D2C C;  1PH9 A;  1EY9 A;  3MTS A;  4YY3 Q;  1JR0 D;  1XNR L;  2I5H A;  2OTL A;  4R4I A;  1O7L A;  2OQ0 A;  1LT4 D;  3LWE A;  3PO3 B;  4DUY L;  1A63 A;  1WCM H;  3CC7 A;  1MSG A;  2F3V A;  2OTJ A;  2F52 A;  2R93 H;  2JJQ A;  1Y8O B;  1I50 H;  2GVB A;  4EQP A;  1L1O A;  2A6E C;  1N33 L;  1H9R A;  1KXL A;  3OMG A;  1QVC A;  3GO5 A;  4CDE C;  3CC2 A;  1WTO A;  3PSI A;  3ND9 A;  1BF4 A;  1K73 C;  2N78 A;  4PG3 A;  1Y8P B;  4GNX C;  1QZH A;  2DY8 A;  4X65 Q;  5BN3 A;  3M4O B;  4LNQ A;  3I72 A;  1K3R A;  3SDZ A;  3GTL H;  2A69 C;  3HGB A;  2RQX A;  4DXF A;  2A1A A;  3FPU B;  2L9H A;  2K5V A;  4DV1 Q;  3TQY A;  1S5B D;  1BCP B;  1HJP A;  2EYM A;  5ELC A;  3S2H B;  1N32 Q;  3HOX G;  5ELO A;  3MZ5 A;  1SR3 A;  1SMX A;  2L12 A;  4QUC A;  3MC0 B;  1F2L A;  1KRT A;  1QVF A;  4XQQ A;  4LFA L;  5FK9 C;  4AYB G;  4HJ7 A;  1E2V A;  3AU7 A;  2NTS A;  1CK1 A;  2ZM6 Q;  1WTX A;  2K5Q A;  2BE5 C;  1HQR D;  4DAM A;  3M3Y B;  1SSO A;  2E75 C;  4P2C B;  2UXB Q;  3DUZ A;  3AB9 A;  4C3I B;  3GTO B;  1TR5 A;  2KBN A;  1Q1B A;  3GTM H;  2F4I A;  1A2U A;  3FKI H;  1SYC A;  2L5T A;  2OXP A;  4IUV A;  4XQJ A;  1VQB A;  2BA0 A;  2PMZ B;  1DOL A;  3BVM A;  3KJP A;  1OXU A;  5JEA J;  3H3V C;  2R7Z H;  1CQV A;  2EXZ A;  2G9H D;  4U68 A;  1RD9 D;  2XN9 C;  3WDN A;  1BOS A;  2NZ1 D;  3PUZ A;  1AEX A;  4LF4 L;  4IUR A;  1X3P A;  4MHE A;  3GTQ B;  5JJL A;  3T1Y Q;  4CGY B;  1KAW A;  1XTC D;  3VYU A;  1O78 A;  4DXG A;  1A62 A;  5JVG 3;  4PNY A;  4NMZ A;  2IL8 A;  2AUJ D;  3UE0 A;  4A3M B;  1EL0 A;  2N55 A;  3NHH A;  5J1Z A;  2R61 A;  1D1I A;  1IYU A;  3WWV A;  1IL8 A;  2M00 A;  1CI3 M;  4GN3 B;  5EQ0 A;  5FLM G;  1BCP C;  1K3B C;  2Y0S B;  2CFM A;  4DUY Q;  2B29 A;  1VDZ A;  2ZTD A;  4ZKC B;  2OEO A;  5KGU A;  3TP6 A;  3F2C A;  5TSS A;  1GM5 A;  3A7A B;  5C3X A;  1WD1 A;  1GJX A;  1N33 Q;  3UDX A;  2K28 A;  3PQI A;  4KD4 A;  1IKM A;  4WOR A;  1O80 A;  3UE1 A;  4UP8 A;  1LT3 D;  5I6W A;  2PQA A;  3M4Y A;  5GAD C;  4JI0 L;  2NN6 G;  5C4J H;  1OXS C;  4HIO A;  2JA7 B;  4DV4 L;  1B44 D;  3CCE A;  2YU9 B;  3CQZ B;  4H7B A;  4B08 A;  1R9T H;  1STA A;  4FXK C;  1SE8 A;  1ZYR C;  1OTC A;  2A74 C;  4QIW E;  3S16 B;  4OO1 H;  4JBM A;  4L5S A;  4A93 H;  3K6O A;  2ICE C;  1TKW B;  4CJ0 B;  1Z47 A;  2N49 A;  1QB5 D;  2EXD A;  4HMJ A;  3BDC A;  3KUP A;  4HTH A;  3L9A X;  3HOV B;  1CA5 A;  4PZ7 A;  3TRZ A;  4AYB E;  1TWA H;  4MN3 A;  4L5R C;  3NWT A;  2Q2I A;  5T1G A;  1V1Q A;  3KK7 A;  3TP5 A;  4IPD A;  5C3E H;  2RBM A; 
#chains in the Genus database with same CATH homology
 3PUY A;  4DKA C;  4UY8 C;  4DUZ L;  1UE7 A;  4JYA L;  4DV3 Q;  2WAQ E;  4LFC L;  4DR4 Q;  1E22 A;  4GN4 B;  1EUJ A;  2VQF L;  1VQH A;  1Z9F A;  2UUC L;  3ICE A;  3RNU A;  4JI5 Q;  2OCE A;  3A5Z B;  3S1N H;  3TRE A;  4JV5 Q;  4PMW A;  1N34 L;  3CW2 C;  1Y1W G;  5EAY A;  3NBH B;  1UWV A;  2MQH A;  1S72 A;  2JK8 A;  4C3H H;  3BJU A;  4IPG A;  1NMG A;  2NZH A;  5J3B A;  5C0X G;  4X65 L;  1BVS A;  3A74 A;  1UEB A;  1VQC A;  3IRB A;  2RHS B;  3RLN A;  4DK3 C;  2YV5 A;  5IT9 c;  3PO2 G;  2UXC Q;  1LUZ A;  2NN6 I;  1Q86 C;  5IWA L;  3K7U C;  3PO3 G;  2DGY A;  1XMQ L;  3K0X A;  4APV A;  3S17 H;  5ELN A;  3CCQ A;  1Y1W H;  1PH8 A;  2ID0 A;  3S1R H;  3K81 C;  1HNZ L;  2AKW B;  3D31 A;  4YCU A;  4JI2 Q;  3U4V A;  1E24 A;  2YTY A;  1HR0 W;  4YWM A;  1PYB A;  1C7Y A;  1HZB A;  1HNX L;  2QA4 A;  1J5E L;  2R92 H;  4DR6 Q;  4GKJ Q;  2B3G A;  3PO3 H;  3KF6 A;  1MJC A;  1Q1E A;  4UPA A;  5AJ3 L;  3PIP A;  3STB D;  4DR3 L;  3F1Z A;  1C9O A;  2D0O A;  2ZTE A;  2IT1 A;  1QUQ B;  4OWT B;  4A75 A;  1N36 Q;  1CKO A;  4JI1 L;  1VQ7 A;  3HOY G;  5JJI A;  2MFI A;  5LMN W;  1XTD A;  4DPG A;  5H1S E;  3CF5 A;  1XPO A;  3MXN B;  2YYZ A;  3AFP A;  4HJA A;  2R6G A;  1YBY A;  1X6O A;  1L1O C;  1L2F A;  3H3V H;  3M85 A;  4LF7 L;  1XNR Q;  1T9H A;  2EIF A;  3L0O A;  3NEN A;  2MO0 A;  1V43 A;  4LUZ A;  2KCT A;  1A8V A;  1BBU A;  2K14 A;  2CQO A;  5GRO A;  5HGQ A;  3KDF A;  2VY3 A;  5LMU Q;  4A3F G;  4JI6 L;  2K5N A;  4R4T A;  4JBK A;  2RF4 A;  4B3T Q;  2D62 A;  4X62 Q;  2I5L X;  3HOV G;  4BY7 H;  2QEX A;  3K8A A;  1IBM Q;  2E5L Q;  2RHQ B;  1CKN B;  1I3Q H;  4HJ9 A;  1FVI A;  4P71 A;  4GNX B;  4KLK A;  4LF6 L;  1WFQ A;  2JEB I;  3CC4 A;  2VQE L;  3HOZ H;  1IBL L;  3HOU H;  3CCJ A;  1PYS B;  1X56 A;  3TS2 A;  3KF8 B;  2BH8 A;  1G29 1;  3HKZ E;  4A3F H;  2JA9 A;  4DV4 Q;  2N8N A;  3KOJ A;  3PUW A;  4DV5 Q;  1XMO L;  4YHH L;  1Q46 A;  4J15 A;  1PH6 A;  4LUO A;  3L7Z C;  2JE6 I;  3CCS A;  4Y52 H;  4JOI A;  4DV0 L;  1FGU A;  4NB3 A;  4B3R L;  5C44 H;  4HJ5 A;  4OWW B;  2VW9 A;  1TWG H;  3ULL A;  1HH2 P;  1NTG A;  4NPS A;  3RR5 A;  5M3F G;  2PMZ E;  3U4Z A;  1EYG A;  4JI7 L;  3KYH C;  3S2H H;  2E8G A;  4XIG S;  3AYH B;  5IYB G;  4GKK L;  2EQS A;  4K0K L;  1JJG A;  1YIT A;  2Q2H A;  4KHP Q;  1CSQ A;  4BBR G;  1UE1 A;  3GD7 A;  3PUV A;  1MKH A;  3G6E A;  5C4X H;  2ES2 A;  4IFD J;  3ER0 A;  4R1J A;  2Z6K C;  4AQY Q;  4JI8 Q;  1V9P A;  4ME3 A;  4LF9 Q;  2B63 G;  2VNU D;  3CCV A;  3EIV A;  1Q82 C;  1PH7 A;  1XNQ L;  4LUV A;  4BA2 I;  2LXJ A;  2WP8 J;  4PZ6 A;  2JA5 H;  1KRS A;  2JA6 G;  2OWO A;  4OXP A;  2N3S A;  3CME A;  3M3Y H;  5IYC G;  5E7N A;  2K50 A;  4DV2 Q;  4LFB Q;  4A3L G;  1IYJ B;  4BBR H;  4AH6 A;  4C3I H;  2E2H H;  3GTO H;  4MTN A;  4YY3 L;  1M1K C;  3AEV A;  2PQA B;  1HNW L;  5JEA G;  3JAM i;  3CXC A;  3I7F A;  4GLX A;  4WJ4 A;  4DUZ Q;  3G48 A;  5K36 G;  3H15 A;  2C35 B;  2JA6 H;  4LFA Q;  4JYA Q;  1BKB A;  4IJH A;  1LM0 A;  4LF8 Q;  1EIY B;  1B70 B;  4BY1 H;  4QJF A;  4BBS G;  4A3L H;  1K8G A;  3ZJY C;  1P8L A;  1U5K A;  1KIX A;  1AH9 A;  4B3M Q;  3S1Q H;  1YJ9 A;  4A3M G;  4DR5 L;  3F8T A;  3G71 A;  3LGJ A;  1HZC A;  5IY0 A;  3CPW A;  3RZD H;  1N34 Q;  2AHO B;  4A3K G;  1KQS A;  4DV6 Q;  1JT8 A;  3EBE A;  2R7D A;  1SFO H;  3CD6 A;  3GTQ H;  1Y1V H;  2XGT A;  4UP7 A;  4BBS H;  1YHQ A;  2K52 A;  4MNO A;  2Y0S G;  1VQM A;  1NJI C;  2NVY H;  3UDI A;  4EX5 A;  1NY4 A;  4GLV B;  5IWA Q;  1EQQ A;  4NXM Q;  1U0L A;  1XMQ Q;  2HHH Q;  4A3M H;  1KD1 C;  4P72 A;  5M5Y H;  2UU9 L;  4IJL A;  4A3K H;  4HJ8 A;  3KLW A;  2WB1 E;  4MZ9 A;  1IZ6 A;  4DV7 L;  1HNZ Q;  2JA8 G;  3HOW G;  1YJW A;  1LTL A;  4YCV A;  2WFW A;  1X9N A;  2YTV A;  4A76 A;  4DK6 C;  4LF4 Q;  1YHB A;  1HZA A;  4A4I A;  3A0J A;  4A3I G;  1MIU A;  3PGZ A;  1IBK L;  2OQK A;  3J81 j;  3TEH B;  4L5Q A;  1XPR A;  1KC8 C;  3I4O A;  4JI1 Q;  2UUB L;  1I6H H;  2JA8 H;  1E3P A;  4DV1 L;  4NXN Q;  1VQD A;  2KEN A;  4H02 A;  2JA7 G;  4GN5 A;  1N32 L;  3PIO A;  2IY5 B;  2GN5 A;  2GVA A;  4XTC S;  2YTX A;  2R7Z G;  1YHA A;  3PO2 H;  3CCM A;  4A3I H;  2E2J H;  4JI6 Q;  1GO3 E;  4JI4 L;  2WAQ G;  3S14 H;  3ULP A;  1HZ9 A;  1E1O A;  5IP9 G;  3DM3 A;  4IPH A;  2ZM6 L;  4A3G G;  1VQJ A;  4JG2 A;  1NMF A;  5FJ8 G;  5IYD G;  1G51 A;  4DR1 Q;  2JA7 H;  1BBW A;  5IE8 A;  4FDB A;  3OTO Q;  4GOP A;  4LF6 Q;  1RIP A;  1PFS A;  1FL0 A;  2YU9 H;  1YJN A;  3CQZ H;  3ULJ A;  5M3M G;  1K9M C;  1VQN A;  2UXB L;  2R7F A;  4DR2 Q;  3E9H A;  3KFU A;  1XMO Q;  4GLA C;  5IP9 H;  3S16 H;  1OXX K;  3HKS A;  4A3G H;  4HIK A;  5IP7 H;  3OYY A;  4GS3 A;  4P74 A;  4C3J H;  1ASY A;  4B3S L;  4POG A;  3HOY H;  3ERS X;  3I2Z A;  4DAY B;  5M5X H;  4PZ8 A;  4X66 L;  5IYD H;  2Z0S A;  5GAE C;  1PH4 A;  2ASB A;  3S24 A;  3KF6 B;  2HT1 A;  3HOU G;  1W3S A;  1VQO A;  5M3M H;  4LF5 L;  4X64 L;  2Q2U A;  1AE3 A;  1TXY A;  2K75 A;  2KHJ A;  3BU2 A;  4JI0 Q;  2ZJR A;  4GKK Q;  4K0K Q;  2UXD L;  4JI2 L;  1EWI A;  4IOA A;  1HR0 Q;  5BR8 L;  2VUM G;  1YI2 A;  1LYL A;  2F4V Q;  3M4O H;  3HOV H;  4BXX G;  4GKJ L;  1XJV A;  5M5W H;  4R4Q A;  4GOP B;  3JC6 6;  4A3J G;  4DNI A;  4A3D G;  3G4S A;  1PA6 A;  3T1Y L;  2QGQ A;  2NZO A;  3CPF A;  1KHI A;  3NEL A;  3RN2 A;  3PUX A;  1EFW A;  3J80 c;  1N36 L;  2HIV A;  4A3C G;  3KDF B;  2JQO A;  5LMN Q;  5C0X J;  1SRO A;  1WCM G;  4JI3 Q;  1VS0 A;  2CCZ A;  3E0E A;  1PH9 A;  4BXX H;  2AWN A;  1IL2 A;  4QGU A;  1VQE A;  1GKH A;  4HID A;  1E1T A;  3SGI A;  4A3J H;  4YY3 Q;  1XNR L;  2I5H A;  2OTL A;  2R93 G;  4R4I A;  1QVG A;  3J7Z C;  4OX9 L;  4DR7 L;  3VDY A;  1HNW Q;  5LMU L;  2ZJQ A;  1FJG Q;  1WI5 A;  2OQ0 A;  1GVP A;  2AWO A;  4O2D A;  5M3F H;  4X62 L;  4A3C H;  4DUY L;  5IYB H;  4C2M H;  1IBM L;  1WCM H;  3T1H Q;  3RZO H;  1I5F A;  1A63 A;  1TWC H;  1VQI A;  1JMC A;  1VQG A;  2K5H A;  2VZA A;  3CC7 A;  3S2D H;  4RMF A;  2OTJ A;  4P73 A;  1P16 A;  1W2B A;  5HY6 A;  1OXV A;  4KI0 A;  4OWX B;  2F52 A;  1D7Q A;  1X55 A;  2R93 H;  4OON A;  2B63 H;  4L5T A;  2JJQ A;  4YCW A;  2GVB A;  1I50 H;  4DV5 L;  1MJE A;  1VQL A;  4JCV E;  1VCI A;  3STB C;  3I4M G;  4JBJ A;  1L1O A;  1X65 A;  2UUA L;  1N33 L;  3J81 c;  1DGS A;  4LFC Q;  2K4K A;  1KXL A;  2MO1 A;  5IYC H;  2VQF Q;  1QVC A;  1YNX A;  2Y0S E;  3GO5 A;  3W1G A;  2UUC Q;  3CC2 A;  2JEA I;  3PSI A;  4RG1 A;  1VQ6 A;  3H0G G;  2UU9 Q;  2XTI A;  3M7N A;  2AMC B;  2N78 A;  1K73 C;  3I4M H;  4PG3 A;  3UDF A;  1S40 A;  3PCO B;  1CKM A;  2CKZ B;  4GNX C;  1C0A A;  1QZH A;  4AQY L;  4JI8 L;  4X65 Q;  1Q12 A;  4LNQ A;  2D0P A;  1K3R A;  3GTL H;  3NEM A;  1CUK A;  4A3B G;  2CWP A;  1IBK Q;  2ZJP A;  1NBW A;  3MEF A;  2PNH A;  2LXK A;  2A1A A;  2IHE A;  4P75 A;  4POF A;  4QY7 A;  4DV2 L;  2K5V A;  4DV1 Q;  2CWA A;  1I94 L;  3TQY A;  2ALY B;  1HJP A;  1YVC A;  3I4N G;  1N32 Q;  3HOX G;  5ELO A;  1K0R A;  3OW2 A;  1HNX Q;  1SR3 A;  1J5E Q;  1SMX A;  3PF5 A;  1QVF A;  1KRT A;  2BH2 A;  1YIJ A;  4TQU S;  2Z6K A;  4EQ5 A;  5AJ3 Q;  4JI4 Q;  4LFA L;  4AYB G;  4HJ7 A;  2E2I H;  4LF8 L;  3GTP H;  4DR3 Q;  1KL9 A;  2ZTC A;  3FKI G;  2ZM6 Q;  1S3O A;  3HOW H;  1CSP A;  3GTJ H;  2HIX A;  4AIM A;  4DAM A;  3I4N H;  2IHF A;  1GD7 A;  3HOX H;  4B3M L;  4A3B H;  2RCN A;  1NE3 A;  2VS1 A;  1VQP A;  3B6Y A;  3M9B A;  5JJK A;  3CAM A;  1X54 A;  4HIM A;  2BA1 A;  1QZG A;  1EOV A;  3I55 A;  4LF7 Q;  4YWK A;  4DV6 L;  1TWF H;  2UXB Q;  1X3E A;  1VQ5 A;  3FP9 A;  2KBN A;  1QUQ A;  1Q1B A;  4JOI C;  3GTM H;  5GQO A;  3AFQ A;  4DV3 L;  2L15 A;  4DR4 L;  4OO1 I;  3FKI H;  3HFZ B;  1Y14 B;  2R92 G;  4R4C A;  2FXQ A;  4B3S Q;  2PI2 E;  1VQB A;  2BA0 A;  4JI5 L;  4IFD G;  4NXM L;  4X66 Q;  3Q8D A;  1K8A C;  2HHH L;  1VQA A;  3KJP A;  1OXU A;  1IXR A;  2LSS A;  5GAG C;  4YWL A;  5JEA J;  4LF5 Q;  4X64 Q;  2VQE Q;  2R7Z H;  4JV5 L;  1PVO A;  1IBL Q;  2UXD Q;  1J6Q A;  1UE5 A;  2VL6 A;  3GTG H;  2WB1 G;  3S15 H;  1SRU A;  5BR8 Q;  3M4P A;  4KHZ A;  3PUZ A;  3UDG A;  1CKN A;  1EQR A;  4YHH Q;  2A8V A;  4GNX A;  1TWH H;  4LF4 L;  3S1M H;  2NVX H;  2UXC L;  1Q7Y C;  5FJ8 H;  4IOC A;  1SLJ A;  4DV0 Q;  4B3R Q;  3T1Y Q;  1WOC A;  5IP7 G;  5JJL A;  4IPC A;  1KAW A;  3HOZ G;  3BZC A;  4ALP A;  1E7Z A;  1L0W A;  1VQ9 A;  2I5M X;  1VQ4 A;  3W1B A;  3CCR A;  4JI7 Q;  1A62 A;  1XPU A;  4BY7 G;  2IX1 A;  1H95 A;  4TVA B;  1YZ6 A;  4NXN L;  3UE0 A;  1PH5 A;  3FHW A;  3CP0 A;  3J80 i;  3RLO A;  3CCL A;  4DR6 L;  2F3I A;  4UP9 A;  2A19 A;  3WWV A;  1JB7 A;  4OX9 Q;  2ATW A;  1XNQ Q;  4GN3 B;  4BA1 I;  4DR7 Q;  1VQ8 A;  1G6P A;  5FLM G;  3U50 C;  3BZK A;  1YEZ A;  2CFM A;  4DUY Q;  2B29 A;  2ZTD A;  4R4O A;  5C44 G;  4DR1 L;  2VUM H;  3OTO L;  1UE6 A;  1ASZ A;  3U58 A;  4A3D H;  2IX0 A;  3EN2 A;  1VQF A;  4LW1 A;  3F2C A;  3E9I A;  3F2D A;  4DR2 L;  5FLM H;  1PHJ A;  1GM5 A;  3TS0 A;  1RL2 A;  1OXT A;  2UUA Q;  1X3F A;  1O7I A;  1A0I A;  3UDX A;  3RN5 A;  4B3T L;  1N33 Q;  5C4X G;  3AQQ A;  4JBW A;  4O0A A;  2KCM A;  2E5L L;  2DUD A;  1JJC B;  1PV4 A;  3J81 i;  4WJ3 M;  5C0X I;  4OO1 G;  3UE1 A;  4UP8 A;  1Q8K A;  2PQA A;  4JI0 L;  1JE5 A;  5GAD C;  4A93 G;  2NN6 G;  5C4J H;  1OXS C;  4HIO A;  1SN8 A;  1WJJ A;  4DR5 Q;  4LWC A;  3K80 C;  1JJ2 A;  1HR0 L;  3HKZ G;  1AE2 A;  1EIF A;  4DV4 L;  2PI2 A;  3CCE A;  2I0Q A;  1K83 H;  2F4V L;  4IFD I;  3L2P A;  1N8R C;  3CCU A;  1R9T H;  3PV0 A;  4QL5 A;  1SE8 A;  1Q81 C;  1B8A A;  1OTC A;  5GAH C;  4QIW E;  4JBM A;  3GDE A;  4L5S A;  5FLX c;  4A93 H;  5LMN L;  3PF4 A;  3RLF A;  4BY1 G;  4JI3 L;  2NVT H;  3GTK H;  1Z47 A;  3H3V I;  2N49 A;  4DV7 Q;  4Y7N H;  4KHP L;  1I94 Q;  1WYD A;  2H5X A;  1PH1 A;  2EXD A;  1X3G A;  4IO9 A;  4LF9 L;  4JC0 A;  4A3E G;  3F2B A;  1FJG L;  5C3E G;  1VQK A;  3K7A H;  3A5U A;  4PZ7 A;  3TRZ A;  3M4Q A;  4AYB E;  2V1C C;  1Y1V G;  3J7A 5;  1N9W A;  1PH3 A;  3H0G H;  1TWA H;  1L1O B;  3T1H L;  4X6A H;  4GOP C;  1B7Y B;  3DLL A;  1M90 C;  2JA5 G;  2Q2T A;  2UUB Q;  4LFB L;  4L5R C;  2HQL A;  3JAM c;  2Q2I A;  2NVQ H;  3W5O A;  1PH2 A;  1V1Q A;  3KJO A;  3D0F A;  4A3E H;  5DLQ E;  1D8L A;  3CMA A;  4IPD A;  4QQB X;  5C3E H;  2MNA A;  3I56 A;  2KHI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...