2ZM6Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zm6Q00
1W3SA 1D8LA 1PH2A 1MKHA 3GTQH 1XTDA 5GAHC 1K9MC 3CC4A 3UDXA 1X55A 1EQRA 4JV5L 4DUZL 1CUKA 4QY7A 1KL9A 3UDFA 4JI7Q 4B3SL 1S3OA 1X54A 1FVIA 2CKZB 2JEBI 5IY0A 3T1YQ 1TWAH 2PMZE 5M5YH 2CCZA 4LF5L 3B6YA 2VW9A 1VQIA 2ES2A 3CMAA 1EYGA 4JYAL 1RL2A 4DNIA 5C3EG 1UE7A 4BXXH 4UP9A 3CCEA 1VQ4A 1X65A 2HT1A 3S1MH 1G6PA 3OW2A 2CWPA 2WB1G 2F3IA 4K0KQ 4B3ML 5HGQA 1XNRQ 2MO1A 4IO9A 3GTLH 4Y52H 4A3CH 1SROA 3CD6A 4DR6Q 2VQEQ 4B3RL 3D31A 3Q8DA 1HR0W 1ASYA 4EQ5A 3S1NH 4LFBL 4NXNL 2YTXA 4POGA 2H5XA 1HZBA 1I94L 1HZAA 4HJ7A 5IP9G 1IBKQ 1AE2A 4KLKA 5HY6A 4JI2L 1I50H 3FKIG 3ULLA 4MZ9A 3KF6A 3GTOH 1ASZA 4LF4L 5LMUL 3J80c 1Z47A 3PUZA 5ELOA 2L15A 3HFZB 4LF6Q 2OQ0A 3U58A 2K75A 5M3FG 2D62A 4LFAQ 2I5LX 1KRTA 2XGTA 4GN4B 2EQSA 5IP7G 4DV7L 1SFOH 3CCJA 3TRZA 4OWTB 2JA7H 1UE1A 4TQUS 1E3PA 2PNHA 2DUDA 4DV0Q 2HHHQ 3I4NG 3HOXH 2NZHA 4JI8Q 2JE6I 1X9NA 4JI6Q 4IJLA 4AYBG 1IBML 5C0XI 4NB3A 1PH4A 3K8AA 4O0AA 4NXML 3KFUA 4DUZQ 1XJVA 1K83H 3CPWA 1Q1EA 4DUYL 4R4IA 1VQ9A 4GKJL 1HNXL 4BY7H 4JI7L 4LF8L 3M4OH 1I6HH 1BVSA 2I0QA 1KHIA 3M9BA 5IWAQ 4L5SA 3KLWA 3T1HL 1NJIC 2RCNA 4UY8C 1EQQA 1QVGA 4YHHQ 4JOIC 4GS3A 3CCQA 1KC8C 2F4VL 1U0LA 1L0WA 1HJPA 4LNQA 4K0KL 3LGJA 2UXDL 1VQ6A 1SMXA 2IX1A 4DV4Q 2ZTDA 1AE3A 2K5HA 3TQYA 3S24A 4DK3C 1B7YB 4POFA 1VS0A 2K52A 4KI0A 5GAGC 4DR5Q 4JI0L 2Q2TA 3S15H 3G4SA 3EN2A 4X65L 1OXTA 4IPCA 4GN3B 1XMQL 5IYBH 1E7ZA 1VCIA 1V43A 3CP0A 2ZM6Q 1FJGL 3FHWA 2EXDA 2QA4A 2JA9A 1Q46A 2E5LL 4DV1L 3I56A 2ASBA 5IT9c 1NE3A 1WI5A 3L2PA 3PF5A 2UU9L 1K73C 4IFDJ 2JA6G 4JC0A 4YWLA 4OWXB 1I5FA 3S2HH 4WJ4A 5IYCG 5K36G 3OYYA 4YCVA 2R7ZH 3CMEA 3CCRA 4A93H 2R7FA 3BJUA 1OXVA 2YTYA 4DV6L 3JAMi 1YHAA 1AH9A 4YCUA 3PUWA 4HJ9A 4UPAA 4B3SQ 4DV0L 4C3JH 1KRSA 2ZJRA 3G48A 4R4CA 3U4ZA 3RLOA 1HR0Q 4LF5Q 1GO3E 4QJFA 5GROA 1K0RA 4A3LG 3NENA 4YWKA 2WP8J 4BY1H 2JJQA 2ZJQA 1X3GA 2AWNA 1C7YA 1EIYB 2K50A 4B3TQ 5C4XH 1J5EQ 5BR8L 1MJCA 5C0XJ 4MTNA 5E7NA 3HOYH 4GLVB 1PH5A 4LF8Q 4PG3A 1N33L 3GTGH 4NXNQ 1VQCA 2B3GA 2GVBA 2IHEA 3IRBA 3K7AH 4YCWA 3J7A5 5C4JH 1KXLA 2VQFQ 4DV3Q 4A3CG 5M5WH 4IFDI 1XMOQ 3KF8B 4BBRH 2R92H 2AHOB 4HIOA 3J7ZC 2XTIA 3CC7A 2UXDQ 2UUAL 1VQ8A 1Z9FA 4DV4L 1S72A 4DV5L 2CWAA 3DM3A 2ZTEA 4JI0Q 2UUBQ 3A5UA 1YIJA 4X6AH 4DV7Q 1YI2A 4JI4Q 1B8AA 1A8VA 2A19A 2K5NA 4APVA 4GN5A 1IL2A 4A3EH 3EIVA 3S17H 1B70B 3K7UC 4DR7Q 2A8VA 2YU9H 3PO3H 2HQLA 3TEHB 4A3KH 1A0IA 3KF6B 3BZCA 3CCLA 3ULJA 4KHPL 1GVPA 2OTLA 3L0OA 2UXCL 1YEZA 4A3BH 4LFCQ 3W1BA 4BBRG 3FP9A 2NN6I 5AJ3L 3W5OA 1HNZL 3RN2A 1UWVA 1YHBA 4DV2L 2BH2A 3HOYG 1QZHA 4B3RQ 2VQEL 5LMNL 4UP8A 4X62Q 1YITA 1EUJA 1T9HA 2V1CC 3SGIA 3A0JA 1CSPA 1O7IA 4X64L 2Y0SE 1BBWA 4A3GH 1HNWL 4IPGA 1CKOA 3F8TA 4LF4Q 3HOVH 1BBUA 2UUCL 1YZ6A 1P16A 4KHZA 4B3TL 4QL5A 5IP7H 3MEFA 3MXNB 2WAQG 3JAMc 3GDEA 1YVCA 2K5VA 3OTOQ 4P75A 4GOPB 2B63G 4JV5Q 4A93G 3HOUG 4DAMA 3PIPA 1KAWA 4A3JH 3PUXA 3U50C 1XNQQ 3NELA 3CC2A 3PV0A 1XMOL 1TWGH 4IOCA 1LM0A 3T1YL 3F2BA 2CQOA 4JI8L 1WOCA 4XIGS 1R9TH 2FXQA 3HOWH 4DAYB 3HOWG 4EX5A 3G71A 1OXXK 2ALYB 1PA6A 4JBMA 4B3MQ 3AFPA 3K0XA 4GOPA 1G51A 2VS1A 4AIMA 2LXJA 1Q82C 1PH1A 1SRUA 2EIFA 1WJJA 3HKZG 4QIWE 1W2BA 3ZJYC 4PMWA 1N34Q 1TXYA 4LFBQ 3D0FA 4A3DH 3KOJA 2WB1E 4KHPQ 3KYHC 1VQKA 2C35B 4JG2A 2MO0A 1Q7YC 4BA2I 1SR3A 5ELNA 1VQ7A 1X3EA 4JBJA 5FJ8G 2PQAB 4GNXB 3CXCA 4DV2Q 4LF6L 3PIOA 2VZAA 5H1SE 1WCMH 4DR5L 3RZOH 3KJPA 5LMNQ 1JT8A 2YYZA 1JB7A 1IBLL 1TWCH 1VQBA 4LW1A 4PZ7A 2CFMA 2VL6A 2VY3A 1XPOA 4A3BG 4LUZA 4LWCA 4OONA 4DK6C 2ZM6L 5C4XG 4HIKA 2E2JH 3U4VA 2YV5A 4HJAA 3E9IA 1GD7A 2Q2HA 2VUMH 5EAYA 1VQGA 2JA5G 3PO2G 3CQZH 1N8RC 1IBMQ 4OO1G 1C0AA 4DR2L 3A5ZB 1Y1VH 1YBYA 1Q12A 4A3FH 1OTCA 2UUBL 3M7NA 3AYHB 1A63A 1XPRA 1VQLA 3J81i 3S1RH 1HNXQ 4JI3L 4RMFA 1N32L 2DGYA 4IJHA 4MNOA 4JI5Q 4O2DA 3K80C 2IY5B 1QVCA 1VQDA 2R7DA 4IPDA 1SLJA 3I4OA 3S16H 5M3MG 1E1TA 1VQPA 5JJLA 4YHHL 4GLAC 4R1JA 2LSSA 1JJ2A 3STBC 1Y14B 4DR1L 4OX9Q 4RG1A 4DKAC 2A1AA 2K4KA 3UE1A 4OXPA 3M4QA 2QGQA 3WWVA 1FGUA 1V9PA 1N33Q 1JJCB 1YJ9A 1EFWA 4C3HH 3J81c 1HZCA 4X65Q 1YJNA 4C2MH 1L1OB 1V1QA 4H02A 4R4QA 4BY1G 1XMQQ 4A3IH 3F1ZA 4QGUA 1QUQA 3HOXG 1RIPA 3AEVA 3I4NH 4AYBE 2WAQE 2VQFL 4DV3L 1NMFA 4FDBA 3DLLA 1E1OA 2YTVA 2B29A 3NBHB 2ATWA 2R6GA 4BA1I 3G6EA 5C3EH 4BXXG 1PV4A 4A3DG 1M1KC 2NN6G 4A76A 4LF9Q 3HKSA 1KQSA 2IHFA 3KJOA 1E22A 3OTOL 1GM5A 1I94Q 1VQJA 4A3GG 3UDIA 4BY7G 4AQYL 1N36L 1VQMA 4DR4Q 3ER0A 1Q86C 4DR3L 2JA6H 4IPHA 2GN5A 4P71A 2KCTA 3M85A 3HOZG 3PF4A 2I5MX 4DR7L 4GKKQ 1C9OA 4R4TA 2BA0A 3RZDH 1YHQA 4R4OA 4GOPC 3AFQA 1PHJA 3I7FA 1X3FA 1YJWA 3UE0A 4LFAL 4L5TA 1TWFH 2N49A 4TVAB 2HIXA 5AJ3Q 1J5EL 5C44H 3PO3G 3CF5A 1PYBA 3RLFA 1N34L 2JA7G 1NBWA 4Y7NH 3CCSA 1N32Q 3BZKA 3STBD 4X62L 2ZJPA 2HHHL 3I4MH 5IYDH 1SE8A 5FLMH 1NMGA 4OWWB 4L5RC 3ERSX 4JI1Q 3RLNA 2R93H 5FLXc 3L7ZC 2Z6KA 3GTJH 1HNWQ 1PVOA 2N8NA 4L5QA 4WJ3M 3ICEA 1PH8A 1X6OA 5IE8A 4A4IA 1G291 1VQHA 1L2FA 2KHIA 3K81C 1CKMA 1VQNA 2VUMG 2E8GA 2R7ZG 4DUYQ 1NY4A 1Q81C 1PH7A 4QQBX 2PI2A 2KCMA 1IXRA 4LF7Q 2JQOA 4HIDA 1JMCA 4JI4L 4A3MG 3T1HQ 2JA8H 1E24A 4YY3L 2MFIA 2Z0SA 1XNQL 4JI2Q 2AMCB 3H3VI 3AQQA 1CSQA 1WCMG 2AKWB 1EOVA 2D0OA 2NVYH 3J80i 5IYBG 2VNUD 1D7QA 2UXBQ 2LXKA 1VQAA 3TS2A 2RHSB 4A3LH 2E2HH 3CCUA 2B63H 1I3QH 1Q1BA 4A3JG 3EBEA 3H15A 3F2DA 4JBWA 4LFCL 1FL0A 5DLQE 4JBKA 3H3VH 5M3FH 5GAEC 1HNZQ 3CCVA 1FJGQ 4DR4L 1KIXA 1Q8KA 3JC66 4DV1Q 3S14H 3PUYA 4A3FG 1S40A 1P8LA 1Y1VG 4XTCS 1VQEA 3RNUA 4HIMA 5JEAJ 3HOVG 3CAMA 1U5KA 4PZ8A 4X64Q 1LYLA 4ME3A 4JI6L 1QUQB 3TS0A 2D0PA 1LTLA 2UUCQ 1L1OA 1WYDA 2AWOA 3BU2A 4DR1Q 4OX9L 2IX0A 4NXMQ 1QVFA 4IFDG 3FKIH 4P72A 4A75A 2OCEA 2OTJA 3H0GH 4NPSA 3H0GG 3NEMA 4JCVE 1MJEA 2BH8A 1PFSA 1EIFA 1X56A 4YWMA 2Q2UA 1K3RA 5M3MH 5IWAL 1UE5A 3PUVA 3F2CA 1HR0L 2NVTH 4C3IH 2JK8A 4JI1L 5FJ8H 5JEAG 4A3KG 4X66Q 1K8AC 1PH6A 3J81j 3E9HA 2KHJA 1Y1WG 2BA1A 1PYSB 3GTKH 1H95A 2RHQB 1JJGA 4LF9L 5J3BA 3A74A 4IOAA 2R93G 1KD1C 5FLMG 4P74A 4PZ6A 3E0EA 5C0XG 4DR2Q 1BKBA 3S1QH 2WFWA 1J6QA 1EWIA 3HKZE 4HJ8A 5GADC 4ALPA 3RN5A 1L1OC 2ZTCA 3UDGA 2I5HA 1MIUA 2KENA 5C44G 1IYJB 3PCOB 1VQFA 2NZOA 2E5LQ 2MNAA 3KDFA 2E2IH 2NVQH 2N78A 2UXBL 2UU9Q 1JE5A 1HH2P 4J15A 4GKKL 4A3MH 2JA8G 2PI2E 4JYAQ 3RR5A 4DV5Q 2Q2IA 1IZ6A 1YNXA 4HJ5A 5GQOA 3VDYA 3CCMA 1QZGA 2OWOA 3GTMH 2KBNA 1XNRL 4DV6Q 3TREA 1PH3A 2IT1A 1K8GA 1XPUA 2NVXH 3HOZH 1TWHH 4DR6L 4GKJQ 2PQAA 4UP7A 1CKNB 4GNXA 2RF4A 3HOUH 5JJIA 3I2ZA 1IBLQ 2Z6KC 3GD7A 4LUVA 2GVAA 2JEAI 1OXSC 1IBKL 2K14A 5LMNW 4A3EG 1VQ5A 1NTGA 1UE6A 3CPFA 2ID0A 3CW2C 3I55A 3W1GA 4OO1I 2Y0SG 2UXCQ 3M3YH 5LMUQ 1SN8A 1Y1WH 2F4VQ 2HIVA 2JA5H 1UEBA 3PSIA 5IYDG 4JOIA 3I4MG 3PO2H 1DGSA 2OQKA 1CKNA 1N9WA 5BR8Q 4DPGA 1PH9A 4A3IG 4AH6A 2R92G 3GTPH 5JJKA 3ULPA 4LF7L 3GO5A 2N3SA 1WFQA 1GKHA 5IP9H 1M90C 3M4PA 4LUOA 3PGZA 1HZ9A 4YY3Q 5IYCH 2QEXA 4AQYQ 1N36Q 1LUZA 4GLXA 4JI3Q 5M5XH 4DR3Q 1OXUA 3S2DH 4BBSH 4BBSG 4X66L 1A62A 4JI5L 2F52A 4GNXC 1VQOA 4P73A 2MQHA 3KDFB 2UUAQ
chains in the Genus database with same CATH superfamily
2AQ2B 1D8LA 5CGKA 1L0YB 1TWAB 1IHZA 3GV3A 1X55A 1I4QA 4KK7A 4OHJA 1BQQT 4JI7Q 2LKVA 1S3OA 3OWFA 5IY0A 2CKZB 2JEBI 5M5YH 2B2YA 2LY7A 3B6YA 1G2TA 4ZKBB 2ES2A 5C3EG 1UE7A 2A69D 3CCEA 1VQ4A 3S1MH 4N9PA 2CWPA 3BZDB 4K0KQ 1XNRQ 4Q0FA 4IO9A 4HSVA 2FHTA 2RCFA 4DR6Q 1V1PB 4QF4A 4EQ5A 4LFBL 4POGA 2YTXA 1PZJD 5A35A 4Z9CB 1HZAA 4KLKA 5HY6A 3ULLA 3KF6A 2GA4B 1FYCA 1DONA 3J80c 1PTOB 2L15A 1SNCA 1F9QA 4LFAQ 3D4RA 4G4KA 3PMFA 4TQUS 1AZQA 1E3PA 2J4XA 1DM0B 5KNBA 4DV0Q 3HOXH 1B4OA 2NZHA 5EBDA 3GTJB 5FO8B 3HGBA 2JE6I 4JI6Q 4AYBG 1IBML 5C0XI 4NB3A 3K8AA 4O0AA 3J7AF 3KFUA 2X6GA 2M00A 1VQ9A 4R4IA 2XRQD 4JI7L 4FF1A 4BY7H 1I6HH 5TSSA 1KHIA 3M9BA 1B44D 1EWCA 2SNMA 5T1IA 3X3NA 3T1HL 2RCNA 3NHHA 1EQQA 3OIQA 1TR5A 2L0CA 4JOIC 4GS3A 4LNQA 4K0KL 3KLSX 5IIFA 1SMXA 3VYRA 4A3DB 1PRTD 2PQEA 1EYAA 4KI0A 5GAGC 4P2CB 2RBMA 5M3MB 4N8X1 4ZKCB 3OOCA 5IGCA 1XMQL 1U9RA 4GN3B 4K14A 2A69C 3CP0A 4BY1B 3NWSA 2QA4A 1CQFA 2EDGA 3I4LA 1LTAD 4DV1L 4G7HC 4HCEA 4JVZA 4RHSA 3L2PA 2UU9L 1TY2A 1WTXA 3D6WA 2JA6G 4JC0A 4YWLA 4A3JB 1I5FA 4IFDH 1Y69U 1I6VC 1HXYD 3ND9A 1EEID 4BBRB 3CMEA 1BCPD 3CCRA 3S2DB 1DD2A 2R7FA 3F2UA 5J1ZA 1FR3A 4UPAA 4C3JG 4DV0L 1NAPA 3MA2B 1WTVA 1HR0Q 1GO3E 3I91A 5FOBB 2B2UA 3I72A 1X3GA 2AWNA 5BN4A 1ZXTA 1E0BA 5BR8L 5C0XJ 1IW7D 3HOYH 2ZT9C 5C6AA 1N33L 4NXNQ 4PQXA 1JE4A 1S5BD 3IRBA 3J7A5 2F0EA 1EY4A 2M2LA 2YU9B 4IFDI 3GTGB 3SHLA 2CW0D 3CC7A 4RGNA 1VQ8A 4DV5L 5M9OA 2CWAA 1GHKA 2I46A 2ZTEA 2UUBQ 1YIJA 1YI2A 5C44B 4DNRB 4APVA 4FO2A 2A8VA 1GUGA 4KHPL 1KDBA 2PW5A 1GVPA 2OTLA 1YEZA 5I4DA 4LFCQ 1LV9A 5ELCA 1LTID 3RN2A 1MSHA 1TVXA 1VF5C 1EU4A 1EIHA 2VB3X 1PFMA 1ZEQX 2KCCA 3HS0C 1BNZA 4KJOA 4K6LA 2F0MA 2G9DA 3SGIA 3A0JA 1O7IA 5CV5A 3RD4A 4DAPA 3HOVH 1JWMD 2UUCL 1YZ6A 3A7LA 2O5JC 3DUZA 2EYOA 3MEFA 4HR7B 1VF7A 4P75A 4GOPB 1SE3A 1KAWA 4H7BA 2F0TA 4L8JA 3CC2A 4DAYA 3PV0A 2N88A 5KNCA 4XIGS 2B63B 2E2HB 2F0OA 4ZQ3A 2ALYB 1PA6A 3SR1A 3AFPA 2VS1A 4H0LC 4QIWE 3ZJYC 3D0FA 2RSNA 2AUJD 1F9SA 2L9HA 3KOJA 4KHPQ 1LT3D 1BUVT 4JG2A 1Q7YC 4HTHA 4WFN3 3SDZA 4OGQC 2BDOA 3EA6A 5C3WA 2R93B 4GNXB 3IFDA 3CXCA 2VZAA 1JT8A 2BDNA 4ILWA 4PMCA 1LTSD 4RCOA 2JA5B 2CFMA 4LUZA 4LWCA 4OONA 2ZM6L 5C4XG 2DNCA 1C48A 2YV5A 2I07B 2EJMA 3DWAA 4A3FH 1YBYA 1AEXA 1D5MC 4G57A 1A63A 1XPRA 3J81i 3S1RH 1YNNC 1F9RA 2A73B 2NWGA 4DXFA 1TIID 3KUPA 1N32L 4K2KA 3HP3A 4MHEA 5M3MG 1E1TA 3WOFA 1VQPA 3BVMA 1YNND 3STBC 4FF3A 4DKAC 3UE1A 3QIAA 2QGQA 2PZUA 1V9PA 1ICWA 1PMRA 5CORA 3I4NH 3TSSA 1TY0A 2QKIC 2VQFL 2WAQE 4DV3L 4ABNA 3SK4A 2D9UA 2B29A 3G6EA 2BCOA 4A76A 1STAA 2RDGA 4ZLTF 1K8MA 3KJOA 4DA2A 1I94Q 3HOWB 3UDIA 4BY7G 1VQMA 1TWFB 2F0LA 4FXDA 5C5MA 3M85A 1CHQD 3HOZG 3PF4A 4GKKQ 2JA7B 3MFYA 1YHQA 2CHBD 4GOPC 1B1ZA 1YJWA 1BCPC 3FRPB 1J5EL 3GTPB 5C44H 1PYBA 1F77A 2XSCA 1NBWA 5ELBA 1N32Q 3NE5B 4MTKA 3STBD 1EOTA 3H6MA 1H9SB 3RLNA 4CKEA 3L7ZC 2N8NA 5LL6X 4WJ3M 1WD1A 1H9SA 1X6OA 2Z9HA 5KNDA 1PH8A 1HRJA 1G291 4BS9A 3K81C 1L2FA 3AU7A 2R7ZG 3V2TA 1PH7A 3D4WA 4LF7Q 2JQOA 1LT6D 3UI2A 4A3MG 1E24A 5IGEA 2Z0SA 2WKCA 1XNQL 2CQAA 1JB3A 5IYBG 2RHSB 1HUMA 1R9TB 1Q1BA 3EBEA 3N6RA 3F2DA 2SOBA 1FL0A 1FNWA 5DLQE 3LWEA 4QCLA 1S4ZA 3H3VH 5J22A 1HNZQ 5GAEC 3TMEA 1KIXA 3S14H 1ML0D 4XTCS 5JEAJ 2PZWA 4X64Q 1U4MA 2WKDA 2D0PA 5EBCA 1Y8NB 2R61A 1WYDA 2A6HC 1MHWC 3BU2A 5CBAE 4IFDG 4NXMQ 3QOLA 1BCPB 1JICA 4JCVE 1MJEA 2BH8A 1B50A 5EKIA 1JOQA 3IAYA 3ND8A 5IWAL 4I7ZC 3PUVA 5FJ8H 1HHVA 4X66Q 1PH6A 3HOUB 1Y1WG 2WB1B 1JJGA 2K7VA 2R93G 4P74A 3E0EA 3S17B 3S1QH 2WFWA 4KN4C 3HKZE 3OW7A 2FJ2A 5GADC 3RN5A 2I5HA 1MIUA 1IYJB 3DWPA 2NZOA 2MNAA 2K03A 4NP5A 2E2IH 2NVQH 1B9MA 2PI2E 3RR5A 3IFTA 2DY7A 3VYTA 3TREA 2IT1A 2RDHA 3K5MA 4GNXA 2Z1CA 4CBVA 2F0UA 2GVAA 1IBKL 5LMNW 1UE6A 2EY2A 3CPFA 2ID0A 2Y0SG 4FYDA 2UXCQ 5LMUQ 1SN8A 4OELB 3EFXD 1CHPD 1TS2A 3E3XA 3VR3A 1O78A 3BDCA 3NTHA 1PRTC 4A3IG 4AH6A 3GTPH 5ISRA 2VXWA 3ERQA 3PGZA 5K36H 3J7YW 3TP6A 3MEHA 3GTLB 4BBSH 4BBSG 4X66L 2K04A 4GNXC 4N9TA 4R9WA 3OMGA 3GTQH 4A3EB 1A3TA 5GAHC 2E2JB 3UDXA 4JV5L 4DUZL 2EE1A 2LFNA 3NXWA 3UDFA 4KJNA 1WD0A 4RKBA 1TWAH 2PMZE 2VW9A 3NP8A 3CMAA 5D14A 5KGUA 4BXXH 3VR4A 1X65A 3OW2A 4G7ZC 3KK7A 4A3KB 5JJZA 2NYZD 2VQEQ 3S1NH 4NXNL 2H5XA 2A68D 4HMJA 1UAPA 4HJ7A 1IBKQ 1AE2A 5E4WC 2L12A 2MP1A 5LMUL 1Z47A 1GUNA 3HFZB 4LF6Q 2OQ0A 1EY8A 3GTQB 2XGTA 1KLUD 4GN4B 5BN5A 3BS1A 1SFOH 4OWTB 2JA7H 1FD7D 1H9MA 1LABA 1UE1A 4OO1H 2NVXB 2PNHA 4FF2A 4EQPA 4RHRA 2K6AA 3PO3B 3K0YA 2EYHA 2K01A 3BVGA 4IJLA 5KRUA 2X69A 2H1EA 1WCMB 4DUZQ 1JORA 1SDFA 4DUYL 3CPWA 1HNXL 2G5DA 2RSOA 4L5SA 3KLWA 3MWYW 1HA6A 1ZKOA 1KC8C 3Q23A 2F4VL 1L0WA 1HJPA 2UXDL 1STBA 2VUMB 4C3IB 2XN9C 2VQEL 3S24A 4DR5Q 5EPJA 1Q90A 2K52A 1QCBD 3K5OA 4OEMB 1STEA 3M7GA 3EN2A 5CMDA 4X65L 3G4SA 1V43A 2R3ZA 1FJGL 1R4PB 2NVQB 5J39A 3I56A 1O7YA 1ENAA 1T5XD 3I70A 1DJRD 2Z8LA 4IFDJ 1W6KA 4C3JB 2JA8B 3S2HH 3NWTA 4OWXB 4WJ4A 3SK8A 4FXKC 5JPMC 3MVVA 4BBSB 5BN3A 2F0IA 3RMHA 3JAMi 1SE2A 1M8AA 4UAIA 4B3SQ 3BYYB 3U4ZA 4ZRZA 4LF5Q 1S5FD 5GROA 3OWEB 3NENA 3R93A 3CRKC 2WP8J 4YWKA 2JJQA 3KBGA 1C7YA 1MJCA 2DN8A 5JOBA 4PG3A 4DGZA 1VQCA 2EOTA 2JXMB 4XT3B 5C4JH 1KXLA 1X32A 1XMOQ 4HIOA 3J7ZC 4RGMA 3ZYYX 2UXDQ 2UUAL 2L4NA 1S72A 2KJXA 5HURA 3DM3A 1EY0A 2E2IB 4L6TB 3DEOA 4JI4Q 1RDPD 4M8AA 1B8AA 1FNUA 3QB3A 1AFPA 2K5NA 5I2YA 1LTRD 4TSSA 1Y8PB 3FMCA 2Z4IA 4GN5A 2FMCA 1IL2A 4A3EH 3EIVA 3S17H 1ENCA 3K7UC 1FGBD 3PO3H 2HCIA 2HQLA 3DWQA 3TEHB 3KF6B 3BZCA 3ULJA 4C3HB 3MC0B 2F4IA 3FP9A 2KQ3A 3CKIB 1UWVA 2P5ZX 2BH2A 2B39A 4B3RQ 4NKLA 5LMNL 4UP8A 1STYA 4X62Q 1YITA 2QCPX 1B9NA 1AZPA 2F3WA 4LF4Q 5D3DA 1SYCA 1P16A 3MXNB 3GDEA 2K5VA 2KEDA 2L11A 3NBIA 2B63G 4A93G 1SYBA 3HOUG 3MXGA 3J80L 3PUXA 1XMOL 1TWGH 5DNFA 2B2TA 2CQOA 4DU9A 4JI8L 3R8BA 1R9TH 2KEEA 4EX5A 3QR8A 4B9XA 4X3KA 1DOMA 1G51A 1EL0A 1Q82C 5C4ZA 1KNEA 1SRUA 2EIFA 4K5VA 1QNUA 1W2BA 1PLFA 1TXYA 4LFBQ 2K5DA 2K5WA 4A3DH 2A6ED 4IN3A 5K5PA 5CV8A 1I4HA 1VQKA 5IGDA 2PCFB 2HDMA 4BA2I 1SR3A 3TDQA 5JEAH 5FJ8G 2PQAB 3MXUA 5LMNQ 1IBLL 1SYEA 1TWCH 1VQBA 4LW1A 2VY3A 4PZ7A 5I9OA 4FF4A 2PW7A 2B2VA 1TWGB 3X3MA 3A8KE 3S1NB 1PFBA 4JK1C 1FNVA 3VR2A 4HJAA 3E9IA 1GD7A 4IURA 2VUMH 5JAVA 4KN7C 4LMQD 3GTKB 3CQZH 3H94A 1IBMQ 4DR2L 1Y1VH 3M7NA 3AYHB 1QJOA 1VQLA 4K6DA 4U673 4RMFA 2DGYA 4JI5Q 2XWJB 2EVBA 3K80C 1QVCA 1MGSA 4IPDA 1A3VA 5JJLA 2LSSA 2B2VC 3T13A 4RG1A 2R92B 2EYJA 3M4QA 3WWVA 3P1HA 1YJ9A 4C3HH 1JR0D 2LS01 3MTSA 1YJNA 1XMQQ 1V1QA 4H02A 3K7AB 4CDEC 4IUNA 3HOXG 2B2TC 1NMFA 1TKWB 3M4OB 1E1OA 1CK1A 2DJFC 4J6HA 3HKZB 3NBHB 1C8CA 1PV4A 4A3DG 1QWYA 1TT2A 2IHFA 4A3GG 1NUCA 4G7OC 2A68C 5C3EB 4AQYL 4NMZA 4DR3L 2JA6H 4P71A 1J9OA 4DR7L 2ZXOA 1PZKD 3OHXC 1NNXA 1YNJC 2F0DA 1PYWD 3AFQA 4R4OA 4DK1A 1X3FA 1JOKA 1TWFH 2N49A 5AJ3Q 3PO3G 4KY6A 2ZJPA 2HHHL 5IYDH 1SXTA 1QG7A 2B2WA 1EY7A 5FLMH 1NMGA 2R93H 4L5RC 3ERSX 5FLXc 2Z6KA 1HNWQ 5I6WA 3ICEA 1HCZA 5IE8A 2OT2A 1VQHA 2KHIA 2E8GA 4QQBX 2X6LA 2V4DA 2KCMA 4R8NA 3S1MB 4GZYC 1JMCA 2JA8H 4TRDA 5I6YA 2MFIA 3TP7A 3AQQA 3J80i 2AKWB 2D0OA 2F0GA 3TS2A 2E2HH 3KBXA 4CDCC 2B63H 2QDBA 2FMMA 4JBWA 1BCPF 4LFCL 1L0XB 3JC66 3H09A 4A3FB 3OIPA 3T53B 5IGGA 3PIO3 1U5KA 1IW7C 1NR2A 2C9OA 3CHBD 4JI6L 2UUCQ 2NVTB 2AWOA 4DR1Q 4FNFA 4J1MA 5EKKA 4P72A 4A75A 2WV6D 3PIP3 2OCEA 4NPSA 4ODGA 2EPBA 3H0GG 4YWMA 1PFSA 1X56A 1KLGD 2Q2UA 3URYA 1GXDC 1UE5A 3F2CA 5JEAG 5DM73 4DNTB 5CV7A 1JWSD 3J81j 1B3AA 1SJHD 2KHJA 2BA1A 1X3QA 4FP5D 3NTIA 4LF9L 5J3BA 4IOAA 2JYOA 1HA5A 5L37A 5FLMG 2B8GA 1WTQA 1BKBA 4FXGC 5M3FB 2EYPA 4HCSA 5E3FA 4ALPA 1E2VA 1F2YA 2KENA 5LHY1 4IUTA 2UU9Q 1HH2P 4J15A 1I4XA 4A3MH 4JYAQ 4K5XA 1YNXA 1PDQA 2B2YC 3TZDA 1QZGA 2F0QA 4WORA 1XPUA 3HOZH 4UP7A 1CKNB 4KD3A 5EPKA 3S9WA 3I2ZA 5F2DA 2K32A 2HD3A 3GD7A 4KHVA 4LUVA 2JEAI 2K14A 2F0VA 3CW2C 2E74C 2OEOA 4OO1I 1SYGA 3M3YH 2VB2X 2F4VQ 2HIVA 1H9JA 3I4MG 1CFMA 3QJYA 1CKNA 5BR8Q 4DPGA 1G91A 2IL8A 2R92G 3NTKA 3ULPA 4TKOB 3GO5A 1N36Q 5A2QE 1EYDA 2QEXA 3HOXB 1LUZA 5M5XH 3S2DH 3FVQA 2F52A 4P73A 2MQHA 1A3UA 2KCNA 4PNYA 4IUUA 5T1GA 1MKHA 4K8JA 5D3IB 3CC4A 4F7XA 4QY7A 1MBYA 4B3SL 1S5ED 2WIIB 4WJWA 5C0XH 3T1YQ 4LF5L 2CCZA 3DM1A 2E75C 4JYAL 1F2ZA 4DNIA 4UP9A 1XWEA 4DAVA 1WTOA 2HT1A 1G6PA 2WB1G 4B3ML 5HGQA 5M5XB 4Y52H 4A3CH 5JVG3 1KDAA 1SROA 1HR0W 2O5IC 3K58A 4RGTA 1HZBA 1I94L 4ZUJA 5IP9G 2J0TD 4CJ1B 1I3QB 4JI2L 3FKIG 4MZ9A 3GTOH 1ASZA 1LLRD 1LTGD 4KY7A 1O7LA 4QUFA 2RQXA 3U58A 1DYQA 1A15A 5M3FG 5IP7G 1E2ZA 2I5LX 4HMIA 3ITPA 2F0PA 3BDOA 2EY1A 1UEAB 4RH6A 3I4NG 1NCVA 1KAAA 1D5XC 2PO4A 1SNOA 1X9NA 1TQOA 2O4XA 4FVMA 4JW0A 1D1IA 3AB9A 3WDNA 1PH4A 1QE6A 5HGTA 1HFNA 3Q22A 1BVSA 1WTHA 1NJIC 3NQIA 3EQLC 4UY8C 5I2XA 3NK9A 4YHHQ 2XIWA 3CCQA 2EYMA 2F0WA 1XXGA 3LGJA 4EQOA 1NSNS 4C3IG 1AE3A 2K5HA 4POFA 3HOYB 3S15H 3MZ5A 2Q2TA 1OXTA 4IPCA 1EY9A 5IYBH 2K33A 2JN4A 2ZM6Q 3FHWA 2JA9A 1JCKB 1Q46A 2E5LL 2ASBA 3PF5A 3E0JA 4KMUC 4KY5A 5K36G 2C5CA 5DAUA 3P7JA 3QG1A 1OXVA 4DV6L 5CBEE 1YHAA 1ILQA 3SE0A 3PUWA 1Y8OB 4HJ9A 4C3JH 1KRSA 2HCCA 4R4CA 3RLOA 3VA5A 4MIUA 3A8JE 3G7LA 1LACA 4A3LG 1K28A 4EVOA 2F0NA 3D4DA 4BY1H 2NUCA 4ME5A 4E6IA 1ILPA 2K50A 5E7NA 4GLVB 1PH5A 3CRLC 3U9OA 3GTGH 2B3GA 5EPLA 2PYKA 3K7AH 4YCWA 4A3BB 2SDFA 2MPMA 1SNDA 1OO9B 4DN4M 2VQFQ 4DV3Q 5M5WH 3HEJA 3KF8B 2L1BA 2MGSA 2R92H 1STNA 2CH4W 1YNJD 1QB5D 1RKNA 1RF2D 3KLSA 3A5UA 4DV7Q 2F0SA 2IJ0A 1BR9A 1A8VA 2A19A 3QO2A 5KIXA 1LTTD 1B70B 2NTSA 3QWNA 2K28A 1A0IA 1K8OA 3BG3A 3TBIB 4RAUC 2N55A 2UXCL 4KV6A 4A3BH 1CT1D 4CKCA 1DOLA 3H3VC 2NN6I 1YHBA 1PXUA 1LT4D 3D6CA 1SJED 5FO7B 1PTOH 3BVZA 2A6EC 1CSPA 4QMGA 2JP1A 2Y0SE 4QUCA 4A3GH 1EWHA 4IPGA 1CKOA 2NB0A 1EIGA 1IYVA 3VR6A 2ICIA 1ONLA 1QILA 1TU2B 2WAQG 3JAMc 3DXJC 3G6JB 2IW3A 1SE4A 2DJGC 4XDXA 4JV5Q 3NUCA 3PIPA 2Q8IB 2XNAC 3S2HB 2B2WC 3C1EA 3U50C 1XNQQ 4HN7A 2AUKA 1WOCA 3HOWG 1GUWA 3HOWH 3G71A 1I4PA 1TS5A 4JBMA 3K0XA 3FKIB 1PH1A 1EZ8A 3S15B 3HKZG 3O13A 1GHJA 4PMWA 1LO5D 3MXNA 5I9PA 1Y1VB 3I4NB 3JAME 2FFKB 3TN2A 2WB1E 1KNAA 5CC4A 3K6OA 4B08A 1W6JA 4ULLA 1T5EA 1VQ7A 5FK9C 1X3EA 4JBJA 4DF7A 5CYUA 4LF6L 3PIOA 5H1SE 1WCMH 4DK0A 4O42A 3KJPA 2YYZA 1ET6A 1JB7A 4RCNA 2VL6A 1XPOA 4A3BG 4DK6C 2H4OA 4U68A 4HIKA 2E2JH 2QF7A 2EY5A 3U4VA 3FPUB 3GQBA 2Q2HA 1ESFA 2G9HD 5EAYA 3PO2G 3FPPA 5EJWA 1N8RC 2HDLA 4OO1G 3P75A 4UDUC 1Q12A 4RKLA 2XWBB 3K5LA 1U4LA 1HNXQ 4JI3L 4F88A 2J7ZA 2L5TA 4O2DA 1VQDA 2R7DA 2Z6BA 2HQEA 5CV9A 1PTOC 4IZ8A 1VDZA 1SYFA 3E5SA 4R1JA 3W2DA 2F03A 4DR1L 4OIJA 1PRTB 3SVMA 2A1AA 3A56A 4L63B 4I65A 3S1QB 4OXPA 1WTPA 4RGOS 1N33Q 1JQYD 3J81c 4X65Q 1L1OB 4R4QA 4BY1G 4A3IH 4QGUA 1QUQA 5KEEA 3AEVA 4K8IA 3DLLA 2R6GA 1SMYC 4BXXG 2QILA 1M1KC 3VYSA 3HKSA 4LF9Q 3SK6A 1KQSA 5COYA 3K59A 3OTOL 4IPHA 4CKBA 3GP7A 5KYIA 2F0KA 1PHJA 3I7FA 3UE0A 4LFAL 1GUOA 2HIXA 5CV4A 3OMCA 3RLFA 1N34L 1BBXC 3CCSA 3I4MH 2RDFA 3DMUA 3EJIA 1M4VA 2NVYB 4DXGA 3GTJH 2FINB 3IKJA 5IGBA 1CKMA 1Q81C 3HOZB 2F1MA 2KOLA 2F3VA 5D65A 1BOSA 1IXRA 1SNMA 2RVLA 4IUPA 4HIDA 4JI4L 3T1HQ 2AMCB 2Q8RE 1CSQA 1WCMG 1D7QA 1HTLD 2VNUD 2LXKA 1VQAA 1J8IA 4A3LH 1Q3LA 1CZWA 1H9RA 3CCUA 4IUVA 4A3JG 3H15A 5E4XA 4B9WA 3RUZA 3MAQA 4ZAIA 5M3FH 1Q8KA 4ZK9B 4DV1Q 2EYFA 3SK5A 4A3FG 1S40A 4C1NI 1VQEA 3RNUA 2WAQB 3HOVG 3CAMA 4PZ8A 4X3UA 1LYLA 1QUQB 1JOOA 3TS0A 1LTLA 3T16A 1L1OA 4OX9L 1QVFA 2SEBD 3FKIH 1TS3A 3NEMA 3E6ZX 4XT1B 4CDFC 3IL8A 1K3RA 2A74C 1HR0L 2NVTH 4V0BA 4C3IH 2JK8A 1VMCA 1Z6HA 1DXMA 4A3KG 4K2LA 1K8AC 4PMBA 4YIJA 4M1UB 4DFAA 4NDXA 1LTBD 4O1NA 2RHQB 4C2MB 1H95A 3A74A 4N8FA 4NW2A 1KD1C 2L55A 5C0XG 1EWIA 3DEPA 2PNRC 4X3TA 4KKSA 1L1OC 3UDGA 2JSOA 5C44G 1TWCB 1VQFA 2O2LD 1PRTF 3GV6A 3MFGA 2N78A 5IT9L 4MN3A 2EJFC 4LAAA 2EXZA 3I8ZA 4DV5Q 1IZ6A 4HJ5A 5FO9B 2OWOA 3GTMH 4ZCKA 1PH3A 5JVH3 4F87A 1TWHH 2OF1A 1RTNA 3GTMB 1EFID 1EU3A 1IBLQ 2Z6KC 2ENBA 3C3LA 1OXSC 4A3EG 1VQ5A 1I6HB 1EQTA 2JA5H 4RFBA 1UEBA 3H91A 5IYDG 4JOIA 4IALA 1SEBD 2A6HD 1DGSA 3EROA 2OQKA 1AP0A 1N9WA 1PH9A 5CV6A 5ELDA 1PFNA 5IP9H 3M4PA 1A2UA 4LUOA 1HZ9A 4YY3Q 1M90C 5NUCA 3N52A 5M5WB 1ET9A 5LL6S 4CJ2C 1A62A 1SAPA 4JI5L 1BF4A 1D6EC 5FLXL 4HSPA 2UUAQ 1W3SA 1ESRA 1PH2A 3A7AB 5KYLA 2RKSA 1XTDA 1K9MC 2Z4HA 3ONAB 3S16B 1EQRA 1CUKA 2AQ1B 4EQNA 3H0GB 4XQJA 3VYUA 1KL9A 1V1OA 1FVIA 1X54A 4RA8A 2D2CC 3S1RB 1V8QA 1VQIA 1EYGA 1RL2A 3HG9A 2PZTA 4F8MA 4XXEA 1BDOA 2F3IA 1HQRD 1XX8A 2MO1A 3GTLH 2KUMA 4H44C 4S3SA 1SSOA 3CD6A 4B3RL 3D31A 3Q8DA 1ASYA 2MJ8A 3Q6SA 4BY7B 1GOZA 3VR5A 3A8IE 1I50H 1KDCA 3Q0AA 4LF4L 5EGTA 3M3YB 1KTKA 3PUZA 3KLRA 5ELOA 4CGYB 5CR3A 2K75A 3JAML 2D62A 1KRTA 3TRZA 1ENFA 2EQSA 4DV7L 1B53A 3CCJA 2KHSA 1MI2A 1UNSA 2DUDA 3CQZB 2HHHQ 5G3LF 2LMCB 4JI8Q 3KF8A 4QIWB 1F2MA 2BOSA 2E76C 4R8IA 2NTTA 4NXML 1STGA 1XJVA 1K83H 4GKJL 1Q1EA 3NQTA 4LF8L 3M4OH 2QEJC 2I0QA 5IWAQ 2HUGA 1UUPA 4A3IB 1CI3M 1QVGA 1HPCA 1BXTA 1TWHB 1U0LA 1G6ZA 1VQ6A 1D1KA 2WINB 5IT9E 2IX1A 4DV4Q 1WTRA 2ZTDA 5M5YB 5FKAC 3TQYA 4DK3C 1B7YB 1VS0A 4JI0L 2EY6A 3LNNA 3HOVB 4JPBW 1E7ZA 1VCIA 2EXDA 1II3A 3TZUA 1CTMA 1H9KA 3RZOB 2EJGC 5IT9c 1NE3A 1ICFB 3R2TA 1WI5A 1IL8A 1K73C 4HAEA 3LWUA 2IX3A 2F0JA 4OL7A 5IYCG 3V96A 3OYYA 4YCVA 2XRSD 2R7ZH 4A93H 3BJUA 2YTYA 3W3AA 4Q5VA 1AH9A 4YCUA 2JA6B 2ZJRA 3G48A 5C5LA 3I90A 4QJFA 1HUNA 2AQ3B 2B8FA 4XYOA 2K05A 1K0RA 4A3GB 1K3BC 3P20A 1X3PA 2D5DA 5EQ0A 2DY8A 4AYBB 1Y1WB 1PTOF 2TSSA 3L9AX 2ZJQA 1I50B 1EIYB 4B3TQ 5C4XH 1J5EQ 1Z7TA 4MTNA 2ZXRA 4LF8Q 1F2LA 2GVBA 2IHEA 4HEDA 2F0HA 1SMYD 1CZGA 1RD9D 1GUTA 4ID6A 1SNQA 2XVSA 3R2IA 4A3CG 4BBRH 1I4GA 1VMPA 1QOHA 2AHOB 1D5ZC 2XTIA 4KKUA 2OXPA 1Z9FA 4DV4L 1Q8IA 4KTAA 1EYCA 3BYTB 4JI0Q 4X6AH 1U4RA 4X3SA 3A54A 4I7AA 2IPKD 2NBFA 1B3QA 4DR7Q 2YU9H 4A3KH 4CDDC 3CCLA 3J7AV 5DEHA 2E2DC 3L0OA 1K0SA 3W1BA 4BBRG 5C4HA 3L3OC 3TP5A 3W5OA 3NPPA 5ELFA 5AJ3L 4DV2L 1HNZL 1SNPA 3HOYG 1QZHA 1S5CD 1EUJA 1T9HA 2V1CC 4X64L 1BBWA 1HNWL 3A55A 3F8TA 3T4AC 1BBUA 2IWHA 4KHZA 4B3TL 4QL5A 5IP7H 5C3XA 1YVCA 4C3HG 3OTOQ 3RZDB 4DAMA 4A3JH 3LX0A 3NELA 1CQVA 4IOCA 1LM0A 3T1YL 3F2BA 2CVRA 2FXQA 4DAYB 4ZUIA 1OXXK 4B3MQ 4GOPA 3CU7A 4AIMA 2LXJA 2PPBC 1WJJA 2EZVA 4C1NK 1N34Q 1AN8A 1JC7A 3I73A 4BWGB 2QW7A 3KYHC 4A93B 1A2TA 2C35B 1PTOD 2MO0A 3PQIA 2Y0SB 1CA6A 2ICEC 4QB4A 5ELNA 3J81L 4V190 4DV2Q 3D8GA 4DR5L 3RZOH 2EYLA 3K5NA 1CA5A 1I4RA 3PO2B 4XQNA 1LT5D 1EZ6A 5EKLA 2B2UC 1VQGA 2JA5G 2K5QA 1C0AA 3A5ZB 1OTCA 1MSGA 1NR4A 2UUBL 1A6XA 1KABA 4IJHA 4MNOA 2IY5B 4WRDA 1SLJA 3I4OA 1XTCD 3DHQA 3S16H 4YHHL 3J80E 4GLAC 2K1BA 2QDLA 1JJ2A 4OX9Q 1Y14B 3AMUA 4XYQA 3FDTA 5JPNC 1AW7A 2K4KA 1PZID 4OIKA 1FGUA 4IQZA 4ZYSA 1JJCB 1EFWA 3U9SA 1HZCA 4C2MH 3F1ZA 1RIPA 4AYBE 3I3CA 4KD4A 4FDBA 3D3RA 2YTVA 2ATWA 1O80A 4BA1I 5C3EH 1EY5A 2NN6G 1QNKA 3C1FA 3GTOB 2M9VA 1E22A 1GM5A 1VQJA 5IODA 1N36L 4DR4Q 3ER0A 3T51B 1Q86C 2GN5A 1DCZA 2KCTA 2I5MX 3WOEA 1DZ1A 1C9OA 4R4TA 2BA0A 3RZDH 1SFOB 4LK1C 3OSOA 1RCVD 4CHTB 4L5TA 4TVAB 5C4XB 1IYUA 1EY6A 1K83B 3CF5A 2DNEA 2JA7G 1D2BA 4Y7NH 2CW0C 3BZKA 4X62L 1SE8A 4OWWB 4JI1Q 5E1FA 1U4PA 5IOCA 1PVOA 1HFGA 4L5QA 2MUYA 1B2TA 4A4IA 4LJZC 1S5DD 1VQNA 2VUMG 5C4JB 4DUYQ 1NY4A 2PI2A 2MHVA 5IGFA 4C56C 3VA7A 1SBBB 4YY3L 4JI2Q 3H3VI 3OPOA 2NVYH 1EOVA 1WTWA 2Q8TA 1IKLA 2UXBQ 1I3QH 1F9PA 4IUQA 4JBKA 3J81E 4UHVA 3CCVA 1FJGQ 4DR4L 2NN6H 2RA4A 4K5WA 2BE5D 2F0FA 3NSWA 3PUYA 1P8LA 1Y1VG 3NBHA 4HIMA 1CM9A 4ME3A 3C46A 1WVLA 2IX0A 5A2QL 1R4QB 2NZ1D 2OTJA 1V1PA 3H0GH 3M4YA 3FEWX 3QOJA 1EIFA 5M3MH 1RHPA 1DOKA 1G2SA 4J8QA 3HRZC 4PV1C 4JI1L 3SEBA 2KA7A 1EEFD 1E2WA 3E9HA 1BO0A 1TS4A 1PYSB 3GTKH 1EQVA 1SYDA 4RWSC 2R7ZB 1HTPA 4PZ6A 2CH4A 4DR2Q 1J6QA 2KECA 4HJ8A 1XYIA 1IKMA 4H13C 4A3MB 1O7ZA 3V05A 2ZTCA 4XQQA 3PCOB 2SNSA 2E5LQ 3I4MB 3KDFA 2WACA 5AFWA 2UXBL 3SXHA 1JE5A 4GKKL 3C2PA 3HZXA 4CJ0B 2JA8G 1GJXA 1GUSA 2Q2IA 3T56B 2TMPA 3R3OA 5GQOA 1JWUD 3VDYA 3CCMA 1RJTA 1ZYRD 2KBNA 1XNRL 1C4QA 4DV6Q 1K8GA 2NVXH 4GKJQ 3TP8A 4DR6L 2PQAA 2RF4A 3HOUH 1RTOA 5JJIA 5FLXE 4KKTA 1ZYRC 3K57A 1NTGA 2PMZB 3I55A 1RODA 3W1GA 5DM63 3EVQA 3MXPA 1Y1WH 5G3LD 3PO2H 4Y7NB 3PSIA 1G8ZD 1MD2D 2BE5C 2KVMA 2ZXPA 3BDLA 3Q24A 5JJKA 4EGVA 4LF7L 2N3SA 1WFQA 1GKHA 5IYCH 4AQYQ 3MHBA 4GLXA 4JI3Q 4DR3Q 1OXUA 1HQMC 3S14B 5ELEA 1STHA 2A5HA 1VQOA 3KDFB
chains in the Genus database with same CATH topology
1W3SA 1D8LA 1PH2A 1MKHA 3GTQH 1XTDA 5GAHC 1K9MC 3CC4A 3UDXA 1X55A 1EQRA 4JV5L 4DUZL 1CUKA 4QY7A 1KL9A 3UDFA 4JI7Q 4B3SL 1S3OA 1X54A 1FVIA 2CKZB 2JEBI 5IY0A 3T1YQ 1TWAH 2PMZE 5M5YH 2CCZA 4LF5L 3B6YA 2VW9A 1VQIA 2ES2A 3CMAA 1EYGA 4JYAL 1RL2A 4DNIA 5C3EG 1UE7A 4BXXH 4UP9A 3CCEA 1VQ4A 1X65A 2HT1A 3S1MH 1G6PA 3OW2A 2CWPA 2WB1G 2F3IA 4K0KQ 4B3ML 5HGQA 1XNRQ 2MO1A 4IO9A 3GTLH 4Y52H 4A3CH 1SROA 3CD6A 4DR6Q 2VQEQ 4B3RL 3D31A 3Q8DA 1HR0W 1ASYA 4EQ5A 3S1NH 4LFBL 4NXNL 2YTXA 4POGA 2H5XA 1HZBA 1I94L 1HZAA 4HJ7A 5IP9G 1IBKQ 1AE2A 4KLKA 5HY6A 4JI2L 1I50H 3FKIG 3ULLA 4MZ9A 3KF6A 3GTOH 1ASZA 4LF4L 5LMUL 3J80c 1Z47A 3PUZA 5ELOA 2L15A 3HFZB 4LF6Q 2OQ0A 3U58A 2K75A 5M3FG 2D62A 4LFAQ 2I5LX 1KRTA 2XGTA 4GN4B 2EQSA 5IP7G 4DV7L 1SFOH 3CCJA 3TRZA 4OWTB 2JA7H 1UE1A 4TQUS 1E3PA 2PNHA 2DUDA 4DV0Q 2HHHQ 3I4NG 3HOXH 2NZHA 4JI8Q 2JE6I 1X9NA 4JI6Q 4IJLA 4AYBG 1IBML 5C0XI 4NB3A 1PH4A 3K8AA 4O0AA 4NXML 3KFUA 4DUZQ 1XJVA 1K83H 3CPWA 1Q1EA 4DUYL 4R4IA 1VQ9A 4GKJL 1HNXL 4BY7H 4JI7L 4LF8L 3M4OH 1I6HH 1BVSA 2I0QA 1KHIA 3M9BA 5IWAQ 4L5SA 3KLWA 3T1HL 1NJIC 2RCNA 4UY8C 1EQQA 1QVGA 4YHHQ 4JOIC 4GS3A 3CCQA 1KC8C 2F4VL 1U0LA 1L0WA 1HJPA 4LNQA 4K0KL 3LGJA 2UXDL 1VQ6A 1SMXA 2IX1A 4DV4Q 2ZTDA 1AE3A 2K5HA 3TQYA 3S24A 4DK3C 1B7YB 4POFA 1VS0A 2K52A 4KI0A 5GAGC 4DR5Q 4JI0L 2Q2TA 3S15H 3G4SA 3EN2A 4X65L 1OXTA 4IPCA 4GN3B 1XMQL 5IYBH 1E7ZA 1VCIA 1V43A 3CP0A 2ZM6Q 1FJGL 3FHWA 2EXDA 2QA4A 2JA9A 1Q46A 2E5LL 4DV1L 3I56A 2ASBA 5IT9c 1NE3A 1WI5A 3L2PA 3PF5A 2UU9L 1K73C 4IFDJ 2JA6G 4JC0A 4YWLA 4OWXB 1I5FA 3S2HH 4WJ4A 5IYCG 5K36G 3OYYA 4YCVA 2R7ZH 3CMEA 3CCRA 4A93H 2R7FA 3BJUA 1OXVA 2YTYA 4DV6L 3JAMi 1YHAA 1AH9A 4YCUA 3PUWA 4HJ9A 4UPAA 4B3SQ 4DV0L 4C3JH 1KRSA 2ZJRA 3G48A 4R4CA 3U4ZA 3RLOA 1HR0Q 4LF5Q 1GO3E 4QJFA 5GROA 1K0RA 4A3LG 3NENA 4YWKA 2WP8J 4BY1H 2JJQA 2ZJQA 1X3GA 2AWNA 1C7YA 1EIYB 2K50A 4B3TQ 5C4XH 1J5EQ 5BR8L 1MJCA 5C0XJ 4MTNA 5E7NA 3HOYH 4GLVB 1PH5A 4LF8Q 4PG3A 1N33L 3GTGH 4NXNQ 1VQCA 2B3GA 2GVBA 2IHEA 3IRBA 3K7AH 4YCWA 3J7A5 5C4JH 1KXLA 2VQFQ 4DV3Q 4A3CG 5M5WH 4IFDI 1XMOQ 3KF8B 4BBRH 2R92H 2AHOB 4HIOA 3J7ZC 2XTIA 3CC7A 2UXDQ 2UUAL 1VQ8A 1Z9FA 4DV4L 1S72A 4DV5L 2CWAA 3DM3A 2ZTEA 4JI0Q 2UUBQ 3A5UA 1YIJA 4X6AH 4DV7Q 1YI2A 4JI4Q 1B8AA 1A8VA 2A19A 2K5NA 4APVA 4GN5A 1IL2A 4A3EH 3EIVA 3S17H 1B70B 3K7UC 4DR7Q 2A8VA 2YU9H 3PO3H 2HQLA 3TEHB 4A3KH 1A0IA 3KF6B 3BZCA 3CCLA 3ULJA 4KHPL 1GVPA 2OTLA 3L0OA 2UXCL 1YEZA 4A3BH 4LFCQ 3W1BA 4BBRG 3FP9A 2NN6I 5AJ3L 3W5OA 1HNZL 3RN2A 1UWVA 1YHBA 4DV2L 2BH2A 3HOYG 1QZHA 4B3RQ 2VQEL 5LMNL 4UP8A 4X62Q 1YITA 1EUJA 1T9HA 2V1CC 3SGIA 3A0JA 1CSPA 1O7IA 4X64L 2Y0SE 1BBWA 4A3GH 1HNWL 4IPGA 1CKOA 3F8TA 4LF4Q 3HOVH 1BBUA 2UUCL 1YZ6A 1P16A 4KHZA 4B3TL 4QL5A 5IP7H 3MEFA 3MXNB 2WAQG 3JAMc 3GDEA 1YVCA 2K5VA 3OTOQ 4P75A 4GOPB 2B63G 4JV5Q 4A93G 3HOUG 4DAMA 3PIPA 1KAWA 4A3JH 3PUXA 3U50C 1XNQQ 3NELA 3CC2A 3PV0A 1XMOL 1TWGH 4IOCA 1LM0A 3T1YL 3F2BA 2CQOA 4JI8L 1WOCA 4XIGS 1R9TH 2FXQA 3HOWH 4DAYB 3HOWG 4EX5A 3G71A 1OXXK 2ALYB 1PA6A 4JBMA 4B3MQ 3AFPA 3K0XA 4GOPA 1G51A 2VS1A 4AIMA 2LXJA 1Q82C 1PH1A 1SRUA 2EIFA 1WJJA 3HKZG 4QIWE 1W2BA 3ZJYC 4PMWA 1N34Q 1TXYA 4LFBQ 3D0FA 4A3DH 3KOJA 2WB1E 4KHPQ 3KYHC 1VQKA 2C35B 4JG2A 2MO0A 1Q7YC 4BA2I 1SR3A 5ELNA 1VQ7A 1X3EA 4JBJA 5FJ8G 2PQAB 4GNXB 3CXCA 4DV2Q 4LF6L 3PIOA 2VZAA 5H1SE 1WCMH 4DR5L 3RZOH 3KJPA 5LMNQ 1JT8A 2YYZA 1JB7A 1IBLL 1TWCH 1VQBA 4LW1A 4PZ7A 2CFMA 2VL6A 2VY3A 1XPOA 4A3BG 4LUZA 4LWCA 4OONA 4DK6C 2ZM6L 5C4XG 4HIKA 2E2JH 3U4VA 2YV5A 4HJAA 3E9IA 1GD7A 2Q2HA 2VUMH 5EAYA 1VQGA 2JA5G 3PO2G 3CQZH 1N8RC 1IBMQ 4OO1G 1C0AA 4DR2L 3A5ZB 1Y1VH 1YBYA 1Q12A 4A3FH 1OTCA 2UUBL 3M7NA 3AYHB 1A63A 1XPRA 1VQLA 3J81i 3S1RH 1HNXQ 4JI3L 4RMFA 1N32L 2DGYA 4IJHA 4MNOA 4JI5Q 4O2DA 3K80C 2IY5B 1QVCA 1VQDA 2R7DA 4IPDA 1SLJA 3I4OA 3S16H 5M3MG 1E1TA 1VQPA 5JJLA 4YHHL 4GLAC 4R1JA 2LSSA 1JJ2A 3STBC 1Y14B 4DR1L 4OX9Q 4RG1A 4DKAC 2A1AA 2K4KA 3UE1A 4OXPA 3M4QA 2QGQA 3WWVA 1FGUA 1V9PA 1N33Q 1JJCB 1YJ9A 1EFWA 4C3HH 3J81c 1HZCA 4X65Q 1YJNA 4C2MH 1L1OB 1V1QA 4H02A 4R4QA 4BY1G 1XMQQ 4A3IH 3F1ZA 4QGUA 1QUQA 3HOXG 1RIPA 3AEVA 3I4NH 4AYBE 2WAQE 2VQFL 4DV3L 1NMFA 4FDBA 3DLLA 1E1OA 2YTVA 2B29A 3NBHB 2ATWA 2R6GA 4BA1I 3G6EA 5C3EH 4BXXG 1PV4A 4A3DG 1M1KC 2NN6G 4A76A 4LF9Q 3HKSA 1KQSA 2IHFA 3KJOA 1E22A 3OTOL 1GM5A 1I94Q 1VQJA 4A3GG 3UDIA 4BY7G 4AQYL 1N36L 1VQMA 4DR4Q 3ER0A 1Q86C 4DR3L 2JA6H 4IPHA 2GN5A 4P71A 2KCTA 3M85A 3HOZG 3PF4A 2I5MX 4DR7L 4GKKQ 1C9OA 4R4TA 2BA0A 3RZDH 1YHQA 4R4OA 4GOPC 3AFQA 1PHJA 3I7FA 1X3FA 1YJWA 3UE0A 4LFAL 4L5TA 1TWFH 2N49A 4TVAB 2HIXA 5AJ3Q 1J5EL 5C44H 3PO3G 3CF5A 1PYBA 3RLFA 1N34L 2JA7G 1NBWA 4Y7NH 3CCSA 1N32Q 3BZKA 3STBD 4X62L 2ZJPA 2HHHL 3I4MH 5IYDH 1SE8A 5FLMH 1NMGA 4OWWB 4L5RC 3ERSX 4JI1Q 3RLNA 2R93H 5FLXc 3L7ZC 2Z6KA 3GTJH 1HNWQ 1PVOA 2N8NA 4L5QA 4WJ3M 3ICEA 1PH8A 1X6OA 5IE8A 4A4IA 1G291 1VQHA 1L2FA 2KHIA 3K81C 1CKMA 1VQNA 2VUMG 2E8GA 2R7ZG 4DUYQ 1NY4A 1Q81C 1PH7A 4QQBX 2PI2A 2KCMA 1IXRA 4LF7Q 2JQOA 4HIDA 1JMCA 4JI4L 4A3MG 3T1HQ 2JA8H 1E24A 4YY3L 2MFIA 2Z0SA 1XNQL 4JI2Q 2AMCB 3H3VI 3AQQA 1CSQA 1WCMG 2AKWB 1EOVA 2D0OA 2NVYH 3J80i 5IYBG 2VNUD 1D7QA 2UXBQ 2LXKA 1VQAA 3TS2A 2RHSB 4A3LH 2E2HH 3CCUA 2B63H 1I3QH 1Q1BA 4A3JG 3EBEA 3H15A 3F2DA 4JBWA 4LFCL 1FL0A 5DLQE 4JBKA 3H3VH 5M3FH 5GAEC 1HNZQ 3CCVA 1FJGQ 4DR4L 1KIXA 1Q8KA 3JC66 4DV1Q 3S14H 3PUYA 4A3FG 1S40A 1P8LA 1Y1VG 4XTCS 1VQEA 3RNUA 4HIMA 5JEAJ 3HOVG 3CAMA 1U5KA 4PZ8A 4X64Q 1LYLA 4ME3A 4JI6L 1QUQB 3TS0A 2D0PA 1LTLA 2UUCQ 1L1OA 1WYDA 2AWOA 3BU2A 4DR1Q 4OX9L 2IX0A 4NXMQ 1QVFA 4IFDG 3FKIH 4P72A 4A75A 2OCEA 2OTJA 3H0GH 4NPSA 3H0GG 3NEMA 4JCVE 1MJEA 2BH8A 1PFSA 1EIFA 1X56A 4YWMA 2Q2UA 1K3RA 5M3MH 5IWAL 1UE5A 3PUVA 3F2CA 1HR0L 2NVTH 4C3IH 2JK8A 4JI1L 5FJ8H 5JEAG 4A3KG 4X66Q 1K8AC 1PH6A 3J81j 3E9HA 2KHJA 1Y1WG 2BA1A 1PYSB 3GTKH 1H95A 2RHQB 1JJGA 4LF9L 5J3BA 3A74A 4IOAA 2R93G 1KD1C 5FLMG 4P74A 4PZ6A 3E0EA 5C0XG 4DR2Q 1BKBA 3S1QH 2WFWA 1J6QA 1EWIA 3HKZE 4HJ8A 5GADC 4ALPA 3RN5A 1L1OC 2ZTCA 3UDGA 2I5HA 1MIUA 2KENA 5C44G 1IYJB 3PCOB 1VQFA 2NZOA 2E5LQ 2MNAA 3KDFA 2E2IH 2NVQH 2N78A 2UXBL 2UU9Q 1JE5A 1HH2P 4J15A 4GKKL 4A3MH 2JA8G 2PI2E 4JYAQ 3RR5A 4DV5Q 2Q2IA 1IZ6A 1YNXA 4HJ5A 5GQOA 3VDYA 3CCMA 1QZGA 2OWOA 3GTMH 2KBNA 1XNRL 4DV6Q 3TREA 1PH3A 2IT1A 1K8GA 1XPUA 2NVXH 3HOZH 1TWHH 4DR6L 4GKJQ 2PQAA 4UP7A 1CKNB 4GNXA 2RF4A 3HOUH 5JJIA 3I2ZA 1IBLQ 2Z6KC 3GD7A 4LUVA 2GVAA 2JEAI 1OXSC 1IBKL 2K14A 5LMNW 4A3EG 1VQ5A 1NTGA 1UE6A 3CPFA 2ID0A 3CW2C 3I55A 3W1GA 4OO1I 2Y0SG 2UXCQ 3M3YH 5LMUQ 1SN8A 1Y1WH 2F4VQ 2HIVA 2JA5H 1UEBA 3PSIA 5IYDG 4JOIA 3I4MG 3PO2H 1DGSA 2OQKA 1CKNA 1N9WA 5BR8Q 4DPGA 1PH9A 4A3IG 4AH6A 2R92G 3GTPH 5JJKA 3ULPA 4LF7L 3GO5A 2N3SA 1WFQA 1GKHA 5IP9H 1M90C 3M4PA 4LUOA 3PGZA 1HZ9A 4YY3Q 5IYCH 2QEXA 4AQYQ 1N36Q 1LUZA 4GLXA 4JI3Q 5M5XH 4DR3Q 1OXUA 3S2DH 4BBSH 4BBSG 4X66L 1A62A 4JI5L 2F52A 4GNXC 1VQOA 4P73A 2MQHA 3KDFB 2UUAQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3S A;  1D8L A;  1PH2 A;  1MKH A;  3GTQ H;  1XTD A;  5GAH C;  1K9M C;  3CC4 A;  3UDX A;  1X55 A;  1EQR A;  4JV5 L;  4DUZ L;  1CUK A;  4QY7 A;  1KL9 A;  3UDF A;  4JI7 Q;  4B3S L;  1S3O A;  1X54 A;  1FVI A;  2CKZ B;  2JEB I;  5IY0 A;  3T1Y Q;  1TWA H;  2PMZ E;  5M5Y H;  2CCZ A;  4LF5 L;  3B6Y A;  2VW9 A;  1VQI A;  2ES2 A;  3CMA A;  1EYG A;  4JYA L;  1RL2 A;  4DNI A;  5C3E G;  1UE7 A;  4BXX H;  4UP9 A;  3CCE A;  1VQ4 A;  1X65 A;  2HT1 A;  3S1M H;  1G6P A;  3OW2 A;  2CWP A;  2WB1 G;  2F3I A;  4K0K Q;  4B3M L;  5HGQ A;  1XNR Q;  2MO1 A;  4IO9 A;  3GTL H;  4Y52 H;  4A3C H;  1SRO A;  3CD6 A;  4DR6 Q;  2VQE Q;  4B3R L;  3D31 A;  3Q8D A;  1HR0 W;  1ASY A;  4EQ5 A;  3S1N H;  4LFB L;  4NXN L;  2YTX A;  4POG A;  2H5X A;  1HZB A;  1I94 L;  1HZA A;  4HJ7 A;  5IP9 G;  1IBK Q;  1AE2 A;  4KLK A;  5HY6 A;  4JI2 L;  1I50 H;  3FKI G;  3ULL A;  4MZ9 A;  3KF6 A;  3GTO H;  1ASZ A;  4LF4 L;  5LMU L;  3J80 c;  1Z47 A;  3PUZ A;  5ELO A;  2L15 A;  3HFZ B;  4LF6 Q;  2OQ0 A;  3U58 A;  2K75 A;  5M3F G;  2D62 A;  4LFA Q;  2I5L X;  1KRT A;  2XGT A;  4GN4 B;  2EQS A;  5IP7 G;  4DV7 L;  1SFO H;  3CCJ A;  3TRZ A;  4OWT B;  2JA7 H;  1UE1 A;  4TQU S;  1E3P A;  2PNH A;  2DUD A;  4DV0 Q;  2HHH Q;  3I4N G;  3HOX H;  2NZH A;  4JI8 Q;  2JE6 I;  1X9N A;  4JI6 Q;  4IJL A;  4AYB G;  1IBM L;  5C0X I;  4NB3 A;  1PH4 A;  3K8A A;  4O0A A;  4NXM L;  3KFU A;  4DUZ Q;  1XJV A;  1K83 H;  3CPW A;  1Q1E A;  4DUY L;  4R4I A;  1VQ9 A;  4GKJ L;  1HNX L;  4BY7 H;  4JI7 L;  4LF8 L;  3M4O H;  1I6H H;  1BVS A;  2I0Q A;  1KHI A;  3M9B A;  5IWA Q;  4L5S A;  3KLW A;  3T1H L;  1NJI C;  2RCN A;  4UY8 C;  1EQQ A;  1QVG A;  4YHH Q;  4JOI C;  4GS3 A;  3CCQ A;  1KC8 C;  2F4V L;  1U0L A;  1L0W A;  1HJP A;  4LNQ A;  4K0K L;  3LGJ A;  2UXD L;  1VQ6 A;  1SMX A;  2IX1 A;  4DV4 Q;  2ZTD A;  1AE3 A;  2K5H A;  3TQY A;  3S24 A;  4DK3 C;  1B7Y B;  4POF A;  1VS0 A;  2K52 A;  4KI0 A;  5GAG C;  4DR5 Q;  4JI0 L;  2Q2T A;  3S15 H;  3G4S A;  3EN2 A;  4X65 L;  1OXT A;  4IPC A;  4GN3 B;  1XMQ L;  5IYB H;  1E7Z A;  1VCI A;  1V43 A;  3CP0 A;  2ZM6 Q;  1FJG L;  3FHW A;  2EXD A;  2QA4 A;  2JA9 A;  1Q46 A;  2E5L L;  4DV1 L;  3I56 A;  2ASB A;  5IT9 c;  1NE3 A;  1WI5 A;  3L2P A;  3PF5 A;  2UU9 L;  1K73 C;  4IFD J;  2JA6 G;  4JC0 A;  4YWL A;  4OWX B;  1I5F A;  3S2H H;  4WJ4 A;  5IYC G;  5K36 G;  3OYY A;  4YCV A;  2R7Z H;  3CME A;  3CCR A;  4A93 H;  2R7F A;  3BJU A;  1OXV A;  2YTY A;  4DV6 L;  3JAM i;  1YHA A;  1AH9 A;  4YCU A;  3PUW A;  4HJ9 A;  4UPA A;  4B3S Q;  4DV0 L;  4C3J H;  1KRS A;  2ZJR A;  3G48 A;  4R4C A;  3U4Z A;  3RLO A;  1HR0 Q;  4LF5 Q;  1GO3 E;  4QJF A;  5GRO A;  1K0R A;  4A3L G;  3NEN A;  4YWK A;  2WP8 J;  4BY1 H;  2JJQ A;  2ZJQ A;  1X3G A;  2AWN A;  1C7Y A;  1EIY B;  2K50 A;  4B3T Q;  5C4X H;  1J5E Q;  5BR8 L;  1MJC A;  5C0X J;  4MTN A;  5E7N A;  3HOY H;  4GLV B;  1PH5 A;  4LF8 Q;  4PG3 A;  1N33 L;  3GTG H;  4NXN Q;  1VQC A;  2B3G A;  2GVB A;  2IHE A;  3IRB A;  3K7A H;  4YCW A;  3J7A 5;  5C4J H;  1KXL A;  2VQF Q;  4DV3 Q;  4A3C G;  5M5W H;  4IFD I;  1XMO Q;  3KF8 B;  4BBR H;  2R92 H;  2AHO B;  4HIO A;  3J7Z C;  2XTI A;  3CC7 A;  2UXD Q;  2UUA L;  1VQ8 A;  1Z9F A;  4DV4 L;  1S72 A;  4DV5 L;  2CWA A;  3DM3 A;  2ZTE A;  4JI0 Q;  2UUB Q;  3A5U A;  1YIJ A;  4X6A H;  4DV7 Q;  1YI2 A;  4JI4 Q;  1B8A A;  1A8V A;  2A19 A;  2K5N A;  4APV A;  4GN5 A;  1IL2 A;  4A3E H;  3EIV A;  3S17 H;  1B70 B;  3K7U C;  4DR7 Q;  2A8V A;  2YU9 H;  3PO3 H;  2HQL A;  3TEH B;  4A3K H;  1A0I A;  3KF6 B;  3BZC A;  3CCL A;  3ULJ A;  4KHP L;  1GVP A;  2OTL A;  3L0O A;  2UXC L;  1YEZ A;  4A3B H;  4LFC Q;  3W1B A;  4BBR G;  3FP9 A;  2NN6 I;  5AJ3 L;  3W5O A;  1HNZ L;  3RN2 A;  1UWV A;  1YHB A;  4DV2 L;  2BH2 A;  3HOY G;  1QZH A;  4B3R Q;  2VQE L;  5LMN L;  4UP8 A;  4X62 Q;  1YIT A;  1EUJ A;  1T9H A;  2V1C C;  3SGI A;  3A0J A;  1CSP A;  1O7I A;  4X64 L;  2Y0S E;  1BBW A;  4A3G H;  1HNW L;  4IPG A;  1CKO A;  3F8T A;  4LF4 Q;  3HOV H;  1BBU A;  2UUC L;  1YZ6 A;  1P16 A;  4KHZ A;  4B3T L;  4QL5 A;  5IP7 H;  3MEF A;  3MXN B;  2WAQ G;  3JAM c;  3GDE A;  1YVC A;  2K5V A;  3OTO Q;  4P75 A;  4GOP B;  2B63 G;  4JV5 Q;  4A93 G;  3HOU G;  4DAM A;  3PIP A;  1KAW A;  4A3J H;  3PUX A;  3U50 C;  1XNQ Q;  3NEL A;  3CC2 A;  3PV0 A;  1XMO L;  1TWG H;  4IOC A;  1LM0 A;  3T1Y L;  3F2B A;  2CQO A;  4JI8 L;  1WOC A;  4XIG S;  1R9T H;  2FXQ A;  3HOW H;  4DAY B;  3HOW G;  4EX5 A;  3G71 A;  1OXX K;  2ALY B;  1PA6 A;  4JBM A;  4B3M Q;  3AFP A;  3K0X A;  4GOP A;  1G51 A;  2VS1 A;  4AIM A;  2LXJ A;  1Q82 C;  1PH1 A;  1SRU A;  2EIF A;  1WJJ A;  3HKZ G;  4QIW E;  1W2B A;  3ZJY C;  4PMW A;  1N34 Q;  1TXY A;  4LFB Q;  3D0F A;  4A3D H;  3KOJ A;  2WB1 E;  4KHP Q;  3KYH C;  1VQK A;  2C35 B;  4JG2 A;  2MO0 A;  1Q7Y C;  4BA2 I;  1SR3 A;  5ELN A;  1VQ7 A;  1X3E A;  4JBJ A;  5FJ8 G;  2PQA B;  4GNX B;  3CXC A;  4DV2 Q;  4LF6 L;  3PIO A;  2VZA A;  5H1S E;  1WCM H;  4DR5 L;  3RZO H;  3KJP A;  5LMN Q;  1JT8 A;  2YYZ A;  1JB7 A;  1IBL L;  1TWC H;  1VQB A;  4LW1 A;  4PZ7 A;  2CFM A;  2VL6 A;  2VY3 A;  1XPO A;  4A3B G;  4LUZ A;  4LWC A;  4OON A;  4DK6 C;  2ZM6 L;  5C4X G;  4HIK A;  2E2J H;  3U4V A;  2YV5 A;  4HJA A;  3E9I A;  1GD7 A;  2Q2H A;  2VUM H;  5EAY A;  1VQG A;  2JA5 G;  3PO2 G;  3CQZ H;  1N8R C;  1IBM Q;  4OO1 G;  1C0A A;  4DR2 L;  3A5Z B;  1Y1V H;  1YBY A;  1Q12 A;  4A3F H;  1OTC A;  2UUB L;  3M7N A;  3AYH B;  1A63 A;  1XPR A;  1VQL A;  3J81 i;  3S1R H;  1HNX Q;  4JI3 L;  4RMF A;  1N32 L;  2DGY A;  4IJH A;  4MNO A;  4JI5 Q;  4O2D A;  3K80 C;  2IY5 B;  1QVC A;  1VQD A;  2R7D A;  4IPD A;  1SLJ A;  3I4O A;  3S16 H;  5M3M G;  1E1T A;  1VQP A;  5JJL A;  4YHH L;  4GLA C;  4R1J A;  2LSS A;  1JJ2 A;  3STB C;  1Y14 B;  4DR1 L;  4OX9 Q;  4RG1 A;  4DKA C;  2A1A A;  2K4K A;  3UE1 A;  4OXP A;  3M4Q A;  2QGQ A;  3WWV A;  1FGU A;  1V9P A;  1N33 Q;  1JJC B;  1YJ9 A;  1EFW A;  4C3H H;  3J81 c;  1HZC A;  4X65 Q;  1YJN A;  4C2M H;  1L1O B;  1V1Q A;  4H02 A;  4R4Q A;  4BY1 G;  1XMQ Q;  4A3I H;  3F1Z A;  4QGU A;  1QUQ A;  3HOX G;  1RIP A;  3AEV A;  3I4N H;  4AYB E;  2WAQ E;  2VQF L;  4DV3 L;  1NMF A;  4FDB A;  3DLL A;  1E1O A;  2YTV A;  2B29 A;  3NBH B;  2ATW A;  2R6G A;  4BA1 I;  3G6E A;  5C3E H;  4BXX G;  1PV4 A;  4A3D G;  1M1K C;  2NN6 G;  4A76 A;  4LF9 Q;  3HKS A;  1KQS A;  2IHF A;  3KJO A;  1E22 A;  3OTO L;  1GM5 A;  1I94 Q;  1VQJ A;  4A3G G;  3UDI A;  4BY7 G;  4AQY L;  1N36 L;  1VQM A;  4DR4 Q;  3ER0 A;  1Q86 C;  4DR3 L;  2JA6 H;  4IPH A;  2GN5 A;  4P71 A;  2KCT A;  3M85 A;  3HOZ G;  3PF4 A;  2I5M X;  4DR7 L;  4GKK Q;  1C9O A;  4R4T A;  2BA0 A;  3RZD H;  1YHQ A;  4R4O A;  4GOP C;  3AFQ A;  1PHJ A;  3I7F A;  1X3F A;  1YJW A;  3UE0 A;  4LFA L;  4L5T A;  1TWF H;  2N49 A;  4TVA B;  2HIX A;  5AJ3 Q;  1J5E L;  5C44 H;  3PO3 G;  3CF5 A;  1PYB A;  3RLF A;  1N34 L;  2JA7 G;  1NBW A;  4Y7N H;  3CCS A;  1N32 Q;  3BZK A;  3STB D;  4X62 L;  2ZJP A;  2HHH L;  3I4M H;  5IYD H;  1SE8 A;  5FLM H;  1NMG A;  4OWW B;  4L5R C;  3ERS X;  4JI1 Q;  3RLN A;  2R93 H;  5FLX c;  3L7Z C;  2Z6K A;  3GTJ H;  1HNW Q;  1PVO A;  2N8N A;  4L5Q A;  4WJ3 M;  3ICE A;  1PH8 A;  1X6O A;  5IE8 A;  4A4I A;  1G29 1;  1VQH A;  1L2F A;  2KHI A;  3K81 C;  1CKM A;  1VQN A;  2VUM G;  2E8G A;  2R7Z G;  4DUY Q;  1NY4 A;  1Q81 C;  1PH7 A;  4QQB X;  2PI2 A;  2KCM A;  1IXR A;  4LF7 Q;  2JQO A;  4HID A;  1JMC A;  4JI4 L;  4A3M G;  3T1H Q;  2JA8 H;  1E24 A;  4YY3 L;  2MFI A;  2Z0S A;  1XNQ L;  4JI2 Q;  2AMC B;  3H3V I;  3AQQ A;  1CSQ A;  1WCM G;  2AKW B;  1EOV A;  2D0O A;  2NVY H;  3J80 i;  5IYB G;  2VNU D;  1D7Q A;  2UXB Q;  2LXK A;  1VQA A;  3TS2 A;  2RHS B;  4A3L H;  2E2H H;  3CCU A;  2B63 H;  1I3Q H;  1Q1B A;  4A3J G;  3EBE A;  3H15 A;  3F2D A;  4JBW A;  4LFC L;  1FL0 A;  5DLQ E;  4JBK A;  3H3V H;  5M3F H;  5GAE C;  1HNZ Q;  3CCV A;  1FJG Q;  4DR4 L;  1KIX A;  1Q8K A;  3JC6 6;  4DV1 Q;  3S14 H;  3PUY A;  4A3F G;  1S40 A;  1P8L A;  1Y1V G;  4XTC S;  1VQE A;  3RNU A;  4HIM A;  5JEA J;  3HOV G;  3CAM A;  1U5K A;  4PZ8 A;  4X64 Q;  1LYL A;  4ME3 A;  4JI6 L;  1QUQ B;  3TS0 A;  2D0P A;  1LTL A;  2UUC Q;  1L1O A;  1WYD A;  2AWO A;  3BU2 A;  4DR1 Q;  4OX9 L;  2IX0 A;  4NXM Q;  1QVF A;  4IFD G;  3FKI H;  4P72 A;  4A75 A;  2OCE A;  2OTJ A;  3H0G H;  4NPS A;  3H0G G;  3NEM A;  4JCV E;  1MJE A;  2BH8 A;  1PFS A;  1EIF A;  1X56 A;  4YWM A;  2Q2U A;  1K3R A;  5M3M H;  5IWA L;  1UE5 A;  3PUV A;  3F2C A;  1HR0 L;  2NVT H;  4C3I H;  2JK8 A;  4JI1 L;  5FJ8 H;  5JEA G;  4A3K G;  4X66 Q;  1K8A C;  1PH6 A;  3J81 j;  3E9H A;  2KHJ A;  1Y1W G;  2BA1 A;  1PYS B;  3GTK H;  1H95 A;  2RHQ B;  1JJG A;  4LF9 L;  5J3B A;  3A74 A;  4IOA A;  2R93 G;  1KD1 C;  5FLM G;  4P74 A;  4PZ6 A;  3E0E A;  5C0X G;  4DR2 Q;  1BKB A;  3S1Q H;  2WFW A;  1J6Q A;  1EWI A;  3HKZ E;  4HJ8 A;  5GAD C;  4ALP A;  3RN5 A;  1L1O C;  2ZTC A;  3UDG A;  2I5H A;  1MIU A;  2KEN A;  5C44 G;  1IYJ B;  3PCO B;  1VQF A;  2NZO A;  2E5L Q;  2MNA A;  3KDF A;  2E2I H;  2NVQ H;  2N78 A;  2UXB L;  2UU9 Q;  1JE5 A;  1HH2 P;  4J15 A;  4GKK L;  4A3M H;  2JA8 G;  2PI2 E;  4JYA Q;  3RR5 A;  4DV5 Q;  2Q2I A;  1IZ6 A;  1YNX A;  4HJ5 A;  5GQO A;  3VDY A;  3CCM A;  1QZG A;  2OWO A;  3GTM H;  2KBN A;  1XNR L;  4DV6 Q;  3TRE A;  1PH3 A;  2IT1 A;  1K8G A;  1XPU A;  2NVX H;  3HOZ H;  1TWH H;  4DR6 L;  4GKJ Q;  2PQA A;  4UP7 A;  1CKN B;  4GNX A;  2RF4 A;  3HOU H;  5JJI A;  3I2Z A;  1IBL Q;  2Z6K C;  3GD7 A;  4LUV A;  2GVA A;  2JEA I;  1OXS C;  1IBK L;  2K14 A;  5LMN W;  4A3E G;  1VQ5 A;  1NTG A;  1UE6 A;  3CPF A;  2ID0 A;  3CW2 C;  3I55 A;  3W1G A;  4OO1 I;  2Y0S G;  2UXC Q;  3M3Y H;  5LMU Q;  1SN8 A;  1Y1W H;  2F4V Q;  2HIV A;  2JA5 H;  1UEB A;  3PSI A;  5IYD G;  4JOI A;  3I4M G;  3PO2 H;  1DGS A;  2OQK A;  1CKN A;  1N9W A;  5BR8 Q;  4DPG A;  1PH9 A;  4A3I G;  4AH6 A;  2R92 G;  3GTP H;  5JJK A;  3ULP A;  4LF7 L;  3GO5 A;  2N3S A;  1WFQ A;  1GKH A;  5IP9 H;  1M90 C;  3M4P A;  4LUO A;  3PGZ A;  1HZ9 A;  4YY3 Q;  5IYC H;  2QEX A;  4AQY Q;  1N36 Q;  1LUZ A;  4GLX A;  4JI3 Q;  5M5X H;  4DR3 Q;  1OXU A;  3S2D H;  4BBS H;  4BBS G;  4X66 L;  1A62 A;  4JI5 L;  2F52 A;  4GNX C;  1VQO A;  4P73 A;  2MQH A;  3KDF B;  2UUA Q; 
#chains in the Genus database with same CATH topology
 2AQ2 B;  1D8L A;  5CGK A;  1L0Y B;  1TWA B;  1IHZ A;  3GV3 A;  1X55 A;  1I4Q A;  4KK7 A;  4OHJ A;  1BQQ T;  4JI7 Q;  2LKV A;  1S3O A;  3OWF A;  5IY0 A;  2CKZ B;  2JEB I;  5M5Y H;  2B2Y A;  2LY7 A;  3B6Y A;  1G2T A;  4ZKB B;  2ES2 A;  5C3E G;  1UE7 A;  2A69 D;  3CCE A;  1VQ4 A;  3S1M H;  4N9P A;  2CWP A;  3BZD B;  4K0K Q;  1XNR Q;  4Q0F A;  4IO9 A;  4HSV A;  2FHT A;  2RCF A;  4DR6 Q;  1V1P B;  4QF4 A;  4EQ5 A;  4LFB L;  4POG A;  2YTX A;  1PZJ D;  5A35 A;  4Z9C B;  1HZA A;  4KLK A;  5HY6 A;  3ULL A;  3KF6 A;  2GA4 B;  1FYC A;  1DON A;  3J80 c;  1PTO B;  2L15 A;  1SNC A;  1F9Q A;  4LFA Q;  3D4R A;  4G4K A;  3PMF A;  4TQU S;  1AZQ A;  1E3P A;  2J4X A;  1DM0 B;  5KNB A;  4DV0 Q;  3HOX H;  1B4O A;  2NZH A;  5EBD A;  3GTJ B;  5FO8 B;  3HGB A;  2JE6 I;  4JI6 Q;  4AYB G;  1IBM L;  5C0X I;  4NB3 A;  3K8A A;  4O0A A;  3J7A F;  3KFU A;  2X6G A;  2M00 A;  1VQ9 A;  4R4I A;  2XRQ D;  4JI7 L;  4FF1 A;  4BY7 H;  1I6H H;  5TSS A;  1KHI A;  3M9B A;  1B44 D;  1EWC A;  2SNM A;  5T1I A;  3X3N A;  3T1H L;  2RCN A;  3NHH A;  1EQQ A;  3OIQ A;  1TR5 A;  2L0C A;  4JOI C;  4GS3 A;  4LNQ A;  4K0K L;  3KLS X;  5IIF A;  1SMX A;  3VYR A;  4A3D B;  1PRT D;  2PQE A;  1EYA A;  4KI0 A;  5GAG C;  4P2C B;  2RBM A;  5M3M B;  4N8X 1;  4ZKC B;  3OOC A;  5IGC A;  1XMQ L;  1U9R A;  4GN3 B;  4K14 A;  2A69 C;  3CP0 A;  4BY1 B;  3NWS A;  2QA4 A;  1CQF A;  2EDG A;  3I4L A;  1LTA D;  4DV1 L;  4G7H C;  4HCE A;  4JVZ A;  4RHS A;  3L2P A;  2UU9 L;  1TY2 A;  1WTX A;  3D6W A;  2JA6 G;  4JC0 A;  4YWL A;  4A3J B;  1I5F A;  4IFD H;  1Y69 U;  1I6V C;  1HXY D;  3ND9 A;  1EEI D;  4BBR B;  3CME A;  1BCP D;  3CCR A;  3S2D B;  1DD2 A;  2R7F A;  3F2U A;  5J1Z A;  1FR3 A;  4UPA A;  4C3J G;  4DV0 L;  1NAP A;  3MA2 B;  1WTV A;  1HR0 Q;  1GO3 E;  3I91 A;  5FOB B;  2B2U A;  3I72 A;  1X3G A;  2AWN A;  5BN4 A;  1ZXT A;  1E0B A;  5BR8 L;  5C0X J;  1IW7 D;  3HOY H;  2ZT9 C;  5C6A A;  1N33 L;  4NXN Q;  4PQX A;  1JE4 A;  1S5B D;  3IRB A;  3J7A 5;  2F0E A;  1EY4 A;  2M2L A;  2YU9 B;  4IFD I;  3GTG B;  3SHL A;  2CW0 D;  3CC7 A;  4RGN A;  1VQ8 A;  4DV5 L;  5M9O A;  2CWA A;  1GHK A;  2I46 A;  2ZTE A;  2UUB Q;  1YIJ A;  1YI2 A;  5C44 B;  4DNR B;  4APV A;  4FO2 A;  2A8V A;  1GUG A;  4KHP L;  1KDB A;  2PW5 A;  1GVP A;  2OTL A;  1YEZ A;  5I4D A;  4LFC Q;  1LV9 A;  5ELC A;  1LTI D;  3RN2 A;  1MSH A;  1TVX A;  1VF5 C;  1EU4 A;  1EIH A;  2VB3 X;  1PFM A;  1ZEQ X;  2KCC A;  3HS0 C;  1BNZ A;  4KJO A;  4K6L A;  2F0M A;  2G9D A;  3SGI A;  3A0J A;  1O7I A;  5CV5 A;  3RD4 A;  4DAP A;  3HOV H;  1JWM D;  2UUC L;  1YZ6 A;  3A7L A;  2O5J C;  3DUZ A;  2EYO A;  3MEF A;  4HR7 B;  1VF7 A;  4P75 A;  4GOP B;  1SE3 A;  1KAW A;  4H7B A;  2F0T A;  4L8J A;  3CC2 A;  4DAY A;  3PV0 A;  2N88 A;  5KNC A;  4XIG S;  2B63 B;  2E2H B;  2F0O A;  4ZQ3 A;  2ALY B;  1PA6 A;  3SR1 A;  3AFP A;  2VS1 A;  4H0L C;  4QIW E;  3ZJY C;  3D0F A;  2RSN A;  2AUJ D;  1F9S A;  2L9H A;  3KOJ A;  4KHP Q;  1LT3 D;  1BUV T;  4JG2 A;  1Q7Y C;  4HTH A;  4WFN 3;  3SDZ A;  4OGQ C;  2BDO A;  3EA6 A;  5C3W A;  2R93 B;  4GNX B;  3IFD A;  3CXC A;  2VZA A;  1JT8 A;  2BDN A;  4ILW A;  4PMC A;  1LTS D;  4RCO A;  2JA5 B;  2CFM A;  4LUZ A;  4LWC A;  4OON A;  2ZM6 L;  5C4X G;  2DNC A;  1C48 A;  2YV5 A;  2I07 B;  2EJM A;  3DWA A;  4A3F H;  1YBY A;  1AEX A;  1D5M C;  4G57 A;  1A63 A;  1XPR A;  3J81 i;  3S1R H;  1YNN C;  1F9R A;  2A73 B;  2NWG A;  4DXF A;  1TII D;  3KUP A;  1N32 L;  4K2K A;  3HP3 A;  4MHE A;  5M3M G;  1E1T A;  3WOF A;  1VQP A;  3BVM A;  1YNN D;  3STB C;  4FF3 A;  4DKA C;  3UE1 A;  3QIA A;  2QGQ A;  2PZU A;  1V9P A;  1ICW A;  1PMR A;  5COR A;  3I4N H;  3TSS A;  1TY0 A;  2QKI C;  2VQF L;  2WAQ E;  4DV3 L;  4ABN A;  3SK4 A;  2D9U A;  2B29 A;  3G6E A;  2BCO A;  4A76 A;  1STA A;  2RDG A;  4ZLT F;  1K8M A;  3KJO A;  4DA2 A;  1I94 Q;  3HOW B;  3UDI A;  4BY7 G;  1VQM A;  1TWF B;  2F0L A;  4FXD A;  5C5M A;  3M85 A;  1CHQ D;  3HOZ G;  3PF4 A;  4GKK Q;  2JA7 B;  3MFY A;  1YHQ A;  2CHB D;  4GOP C;  1B1Z A;  1YJW A;  1BCP C;  3FRP B;  1J5E L;  3GTP B;  5C44 H;  1PYB A;  1F77 A;  2XSC A;  1NBW A;  5ELB A;  1N32 Q;  3NE5 B;  4MTK A;  3STB D;  1EOT A;  3H6M A;  1H9S B;  3RLN A;  4CKE A;  3L7Z C;  2N8N A;  5LL6 X;  4WJ3 M;  1WD1 A;  1H9S A;  1X6O A;  2Z9H A;  5KND A;  1PH8 A;  1HRJ A;  1G29 1;  4BS9 A;  3K81 C;  1L2F A;  3AU7 A;  2R7Z G;  3V2T A;  1PH7 A;  3D4W A;  4LF7 Q;  2JQO A;  1LT6 D;  3UI2 A;  4A3M G;  1E24 A;  5IGE A;  2Z0S A;  2WKC A;  1XNQ L;  2CQA A;  1JB3 A;  5IYB G;  2RHS B;  1HUM A;  1R9T B;  1Q1B A;  3EBE A;  3N6R A;  3F2D A;  2SOB A;  1FL0 A;  1FNW A;  5DLQ E;  3LWE A;  4QCL A;  1S4Z A;  3H3V H;  5J22 A;  1HNZ Q;  5GAE C;  3TME A;  1KIX A;  3S14 H;  1ML0 D;  4XTC S;  5JEA J;  2PZW A;  4X64 Q;  1U4M A;  2WKD A;  2D0P A;  5EBC A;  1Y8N B;  2R61 A;  1WYD A;  2A6H C;  1MHW C;  3BU2 A;  5CBA E;  4IFD G;  4NXM Q;  3QOL A;  1BCP B;  1JIC A;  4JCV E;  1MJE A;  2BH8 A;  1B50 A;  5EKI A;  1JOQ A;  3IAY A;  3ND8 A;  5IWA L;  4I7Z C;  3PUV A;  5FJ8 H;  1HHV A;  4X66 Q;  1PH6 A;  3HOU B;  1Y1W G;  2WB1 B;  1JJG A;  2K7V A;  2R93 G;  4P74 A;  3E0E A;  3S17 B;  3S1Q H;  2WFW A;  4KN4 C;  3HKZ E;  3OW7 A;  2FJ2 A;  5GAD C;  3RN5 A;  2I5H A;  1MIU A;  1IYJ B;  3DWP A;  2NZO A;  2MNA A;  2K03 A;  4NP5 A;  2E2I H;  2NVQ H;  1B9M A;  2PI2 E;  3RR5 A;  3IFT A;  2DY7 A;  3VYT A;  3TRE A;  2IT1 A;  2RDH A;  3K5M A;  4GNX A;  2Z1C A;  4CBV A;  2F0U A;  2GVA A;  1IBK L;  5LMN W;  1UE6 A;  2EY2 A;  3CPF A;  2ID0 A;  2Y0S G;  4FYD A;  2UXC Q;  5LMU Q;  1SN8 A;  4OEL B;  3EFX D;  1CHP D;  1TS2 A;  3E3X A;  3VR3 A;  1O78 A;  3BDC A;  3NTH A;  1PRT C;  4A3I G;  4AH6 A;  3GTP H;  5ISR A;  2VXW A;  3ERQ A;  3PGZ A;  5K36 H;  3J7Y W;  3TP6 A;  3MEH A;  3GTL B;  4BBS H;  4BBS G;  4X66 L;  2K04 A;  4GNX C;  4N9T A;  4R9W A;  3OMG A;  3GTQ H;  4A3E B;  1A3T A;  5GAH C;  2E2J B;  3UDX A;  4JV5 L;  4DUZ L;  2EE1 A;  2LFN A;  3NXW A;  3UDF A;  4KJN A;  1WD0 A;  4RKB A;  1TWA H;  2PMZ E;  2VW9 A;  3NP8 A;  3CMA A;  5D14 A;  5KGU A;  4BXX H;  3VR4 A;  1X65 A;  3OW2 A;  4G7Z C;  3KK7 A;  4A3K B;  5JJZ A;  2NYZ D;  2VQE Q;  3S1N H;  4NXN L;  2H5X A;  2A68 D;  4HMJ A;  1UAP A;  4HJ7 A;  1IBK Q;  1AE2 A;  5E4W C;  2L12 A;  2MP1 A;  5LMU L;  1Z47 A;  1GUN A;  3HFZ B;  4LF6 Q;  2OQ0 A;  1EY8 A;  3GTQ B;  2XGT A;  1KLU D;  4GN4 B;  5BN5 A;  3BS1 A;  1SFO H;  4OWT B;  2JA7 H;  1FD7 D;  1H9M A;  1LAB A;  1UE1 A;  4OO1 H;  2NVX B;  2PNH A;  4FF2 A;  4EQP A;  4RHR A;  2K6A A;  3PO3 B;  3K0Y A;  2EYH A;  2K01 A;  3BVG A;  4IJL A;  5KRU A;  2X69 A;  2H1E A;  1WCM B;  4DUZ Q;  1JOR A;  1SDF A;  4DUY L;  3CPW A;  1HNX L;  2G5D A;  2RSO A;  4L5S A;  3KLW A;  3MWY W;  1HA6 A;  1ZKO A;  1KC8 C;  3Q23 A;  2F4V L;  1L0W A;  1HJP A;  2UXD L;  1STB A;  2VUM B;  4C3I B;  2XN9 C;  2VQE L;  3S24 A;  4DR5 Q;  5EPJ A;  1Q90 A;  2K52 A;  1QCB D;  3K5O A;  4OEM B;  1STE A;  3M7G A;  3EN2 A;  5CMD A;  4X65 L;  3G4S A;  1V43 A;  2R3Z A;  1FJG L;  1R4P B;  2NVQ B;  5J39 A;  3I56 A;  1O7Y A;  1ENA A;  1T5X D;  3I70 A;  1DJR D;  2Z8L A;  4IFD J;  1W6K A;  4C3J B;  2JA8 B;  3S2H H;  3NWT A;  4OWX B;  4WJ4 A;  3SK8 A;  4FXK C;  5JPM C;  3MVV A;  4BBS B;  5BN3 A;  2F0I A;  3RMH A;  3JAM i;  1SE2 A;  1M8A A;  4UAI A;  4B3S Q;  3BYY B;  3U4Z A;  4ZRZ A;  4LF5 Q;  1S5F D;  5GRO A;  3OWE B;  3NEN A;  3R93 A;  3CRK C;  2WP8 J;  4YWK A;  2JJQ A;  3KBG A;  1C7Y A;  1MJC A;  2DN8 A;  5JOB A;  4PG3 A;  4DGZ A;  1VQC A;  2EOT A;  2JXM B;  4XT3 B;  5C4J H;  1KXL A;  1X32 A;  1XMO Q;  4HIO A;  3J7Z C;  4RGM A;  3ZYY X;  2UXD Q;  2UUA L;  2L4N A;  1S72 A;  2KJX A;  5HUR A;  3DM3 A;  1EY0 A;  2E2I B;  4L6T B;  3DEO A;  4JI4 Q;  1RDP D;  4M8A A;  1B8A A;  1FNU A;  3QB3 A;  1AFP A;  2K5N A;  5I2Y A;  1LTR D;  4TSS A;  1Y8P B;  3FMC A;  2Z4I A;  4GN5 A;  2FMC A;  1IL2 A;  4A3E H;  3EIV A;  3S17 H;  1ENC A;  3K7U C;  1FGB D;  3PO3 H;  2HCI A;  2HQL A;  3DWQ A;  3TEH B;  3KF6 B;  3BZC A;  3ULJ A;  4C3H B;  3MC0 B;  2F4I A;  3FP9 A;  2KQ3 A;  3CKI B;  1UWV A;  2P5Z X;  2BH2 A;  2B39 A;  4B3R Q;  4NKL A;  5LMN L;  4UP8 A;  1STY A;  4X62 Q;  1YIT A;  2QCP X;  1B9N A;  1AZP A;  2F3W A;  4LF4 Q;  5D3D A;  1SYC A;  1P16 A;  3MXN B;  3GDE A;  2K5V A;  2KED A;  2L11 A;  3NBI A;  2B63 G;  4A93 G;  1SYB A;  3HOU G;  3MXG A;  3J80 L;  3PUX A;  1XMO L;  1TWG H;  5DNF A;  2B2T A;  2CQO A;  4DU9 A;  4JI8 L;  3R8B A;  1R9T H;  2KEE A;  4EX5 A;  3QR8 A;  4B9X A;  4X3K A;  1DOM A;  1G51 A;  1EL0 A;  1Q82 C;  5C4Z A;  1KNE A;  1SRU A;  2EIF A;  4K5V A;  1QNU A;  1W2B A;  1PLF A;  1TXY A;  4LFB Q;  2K5D A;  2K5W A;  4A3D H;  2A6E D;  4IN3 A;  5K5P A;  5CV8 A;  1I4H A;  1VQK A;  5IGD A;  2PCF B;  2HDM A;  4BA2 I;  1SR3 A;  3TDQ A;  5JEA H;  5FJ8 G;  2PQA B;  3MXU A;  5LMN Q;  1IBL L;  1SYE A;  1TWC H;  1VQB A;  4LW1 A;  2VY3 A;  4PZ7 A;  5I9O A;  4FF4 A;  2PW7 A;  2B2V A;  1TWG B;  3X3M A;  3A8K E;  3S1N B;  1PFB A;  4JK1 C;  1FNV A;  3VR2 A;  4HJA A;  3E9I A;  1GD7 A;  4IUR A;  2VUM H;  5JAV A;  4KN7 C;  4LMQ D;  3GTK B;  3CQZ H;  3H94 A;  1IBM Q;  4DR2 L;  1Y1V H;  3M7N A;  3AYH B;  1QJO A;  1VQL A;  4K6D A;  4U67 3;  4RMF A;  2DGY A;  4JI5 Q;  2XWJ B;  2EVB A;  3K80 C;  1QVC A;  1MGS A;  4IPD A;  1A3V A;  5JJL A;  2LSS A;  2B2V C;  3T13 A;  4RG1 A;  2R92 B;  2EYJ A;  3M4Q A;  3WWV A;  3P1H A;  1YJ9 A;  4C3H H;  1JR0 D;  2LS0 1;  3MTS A;  1YJN A;  1XMQ Q;  1V1Q A;  4H02 A;  3K7A B;  4CDE C;  4IUN A;  3HOX G;  2B2T C;  1NMF A;  1TKW B;  3M4O B;  1E1O A;  1CK1 A;  2DJF C;  4J6H A;  3HKZ B;  3NBH B;  1C8C A;  1PV4 A;  4A3D G;  1QWY A;  1TT2 A;  2IHF A;  4A3G G;  1NUC A;  4G7O C;  2A68 C;  5C3E B;  4AQY L;  4NMZ A;  4DR3 L;  2JA6 H;  4P71 A;  1J9O A;  4DR7 L;  2ZXO A;  1PZK D;  3OHX C;  1NNX A;  1YNJ C;  2F0D A;  1PYW D;  3AFQ A;  4R4O A;  4DK1 A;  1X3F A;  1JOK A;  1TWF H;  2N49 A;  5AJ3 Q;  3PO3 G;  4KY6 A;  2ZJP A;  2HHH L;  5IYD H;  1SXT A;  1QG7 A;  2B2W A;  1EY7 A;  5FLM H;  1NMG A;  2R93 H;  4L5R C;  3ERS X;  5FLX c;  2Z6K A;  1HNW Q;  5I6W A;  3ICE A;  1HCZ A;  5IE8 A;  2OT2 A;  1VQH A;  2KHI A;  2E8G A;  4QQB X;  2X6L A;  2V4D A;  2KCM A;  4R8N A;  3S1M B;  4GZY C;  1JMC A;  2JA8 H;  4TRD A;  5I6Y A;  2MFI A;  3TP7 A;  3AQQ A;  3J80 i;  2AKW B;  2D0O A;  2F0G A;  3TS2 A;  2E2H H;  3KBX A;  4CDC C;  2B63 H;  2QDB A;  2FMM A;  4JBW A;  1BCP F;  4LFC L;  1L0X B;  3JC6 6;  3H09 A;  4A3F B;  3OIP A;  3T53 B;  5IGG A;  3PIO 3;  1U5K A;  1IW7 C;  1NR2 A;  2C9O A;  3CHB D;  4JI6 L;  2UUC Q;  2NVT B;  2AWO A;  4DR1 Q;  4FNF A;  4J1M A;  5EKK A;  4P72 A;  4A75 A;  2WV6 D;  3PIP 3;  2OCE A;  4NPS A;  4ODG A;  2EPB A;  3H0G G;  4YWM A;  1PFS A;  1X56 A;  1KLG D;  2Q2U A;  3URY A;  1GXD C;  1UE5 A;  3F2C A;  5JEA G;  5DM7 3;  4DNT B;  5CV7 A;  1JWS D;  3J81 j;  1B3A A;  1SJH D;  2KHJ A;  2BA1 A;  1X3Q A;  4FP5 D;  3NTI A;  4LF9 L;  5J3B A;  4IOA A;  2JYO A;  1HA5 A;  5L37 A;  5FLM G;  2B8G A;  1WTQ A;  1BKB A;  4FXG C;  5M3F B;  2EYP A;  4HCS A;  5E3F A;  4ALP A;  1E2V A;  1F2Y A;  2KEN A;  5LHY 1;  4IUT A;  2UU9 Q;  1HH2 P;  4J15 A;  1I4X A;  4A3M H;  4JYA Q;  4K5X A;  1YNX A;  1PDQ A;  2B2Y C;  3TZD A;  1QZG A;  2F0Q A;  4WOR A;  1XPU A;  3HOZ H;  4UP7 A;  1CKN B;  4KD3 A;  5EPK A;  3S9W A;  3I2Z A;  5F2D A;  2K32 A;  2HD3 A;  3GD7 A;  4KHV A;  4LUV A;  2JEA I;  2K14 A;  2F0V A;  3CW2 C;  2E74 C;  2OEO A;  4OO1 I;  1SYG A;  3M3Y H;  2VB2 X;  2F4V Q;  2HIV A;  1H9J A;  3I4M G;  1CFM A;  3QJY A;  1CKN A;  5BR8 Q;  4DPG A;  1G91 A;  2IL8 A;  2R92 G;  3NTK A;  3ULP A;  4TKO B;  3GO5 A;  1N36 Q;  5A2Q E;  1EYD A;  2QEX A;  3HOX B;  1LUZ A;  5M5X H;  3S2D H;  3FVQ A;  2F52 A;  4P73 A;  2MQH A;  1A3U A;  2KCN A;  4PNY A;  4IUU A;  5T1G A;  1MKH A;  4K8J A;  5D3I B;  3CC4 A;  4F7X A;  4QY7 A;  1MBY A;  4B3S L;  1S5E D;  2WII B;  4WJW A;  5C0X H;  3T1Y Q;  4LF5 L;  2CCZ A;  3DM1 A;  2E75 C;  4JYA L;  1F2Z A;  4DNI A;  4UP9 A;  1XWE A;  4DAV A;  1WTO A;  2HT1 A;  1G6P A;  2WB1 G;  4B3M L;  5HGQ A;  5M5X B;  4Y52 H;  4A3C H;  5JVG 3;  1KDA A;  1SRO A;  1HR0 W;  2O5I C;  3K58 A;  4RGT A;  1HZB A;  1I94 L;  4ZUJ A;  5IP9 G;  2J0T D;  4CJ1 B;  1I3Q B;  4JI2 L;  3FKI G;  4MZ9 A;  3GTO H;  1ASZ A;  1LLR D;  1LTG D;  4KY7 A;  1O7L A;  4QUF A;  2RQX A;  3U58 A;  1DYQ A;  1A15 A;  5M3F G;  5IP7 G;  1E2Z A;  2I5L X;  4HMI A;  3ITP A;  2F0P A;  3BDO A;  2EY1 A;  1UEA B;  4RH6 A;  3I4N G;  1NCV A;  1KAA A;  1D5X C;  2PO4 A;  1SNO A;  1X9N A;  1TQO A;  2O4X A;  4FVM A;  4JW0 A;  1D1I A;  3AB9 A;  3WDN A;  1PH4 A;  1QE6 A;  5HGT A;  1HFN A;  3Q22 A;  1BVS A;  1WTH A;  1NJI C;  3NQI A;  3EQL C;  4UY8 C;  5I2X A;  3NK9 A;  4YHH Q;  2XIW A;  3CCQ A;  2EYM A;  2F0W A;  1XXG A;  3LGJ A;  4EQO A;  1NSN S;  4C3I G;  1AE3 A;  2K5H A;  4POF A;  3HOY B;  3S15 H;  3MZ5 A;  2Q2T A;  1OXT A;  4IPC A;  1EY9 A;  5IYB H;  2K33 A;  2JN4 A;  2ZM6 Q;  3FHW A;  2JA9 A;  1JCK B;  1Q46 A;  2E5L L;  2ASB A;  3PF5 A;  3E0J A;  4KMU C;  4KY5 A;  5K36 G;  2C5C A;  5DAU A;  3P7J A;  3QG1 A;  1OXV A;  4DV6 L;  5CBE E;  1YHA A;  1ILQ A;  3SE0 A;  3PUW A;  1Y8O B;  4HJ9 A;  4C3J H;  1KRS A;  2HCC A;  4R4C A;  3RLO A;  3VA5 A;  4MIU A;  3A8J E;  3G7L A;  1LAC A;  4A3L G;  1K28 A;  4EVO A;  2F0N A;  3D4D A;  4BY1 H;  2NUC A;  4ME5 A;  4E6I A;  1ILP A;  2K50 A;  5E7N A;  4GLV B;  1PH5 A;  3CRL C;  3U9O A;  3GTG H;  2B3G A;  5EPL A;  2PYK A;  3K7A H;  4YCW A;  4A3B B;  2SDF A;  2MPM A;  1SND A;  1OO9 B;  4DN4 M;  2VQF Q;  4DV3 Q;  5M5W H;  3HEJ A;  3KF8 B;  2L1B A;  2MGS A;  2R92 H;  1STN A;  2CH4 W;  1YNJ D;  1QB5 D;  1RKN A;  1RF2 D;  3KLS A;  3A5U A;  4DV7 Q;  2F0S A;  2IJ0 A;  1BR9 A;  1A8V A;  2A19 A;  3QO2 A;  5KIX A;  1LTT D;  1B70 B;  2NTS A;  3QWN A;  2K28 A;  1A0I A;  1K8O A;  3BG3 A;  3TBI B;  4RAU C;  2N55 A;  2UXC L;  4KV6 A;  4A3B H;  1CT1 D;  4CKC A;  1DOL A;  3H3V C;  2NN6 I;  1YHB A;  1PXU A;  1LT4 D;  3D6C A;  1SJE D;  5FO7 B;  1PTO H;  3BVZ A;  2A6E C;  1CSP A;  4QMG A;  2JP1 A;  2Y0S E;  4QUC A;  4A3G H;  1EWH A;  4IPG A;  1CKO A;  2NB0 A;  1EIG A;  1IYV A;  3VR6 A;  2ICI A;  1ONL A;  1QIL A;  1TU2 B;  2WAQ G;  3JAM c;  3DXJ C;  3G6J B;  2IW3 A;  1SE4 A;  2DJG C;  4XDX A;  4JV5 Q;  3NUC A;  3PIP A;  2Q8I B;  2XNA C;  3S2H B;  2B2W C;  3C1E A;  3U50 C;  1XNQ Q;  4HN7 A;  2AUK A;  1WOC A;  3HOW G;  1GUW A;  3HOW H;  3G71 A;  1I4P A;  1TS5 A;  4JBM A;  3K0X A;  3FKI B;  1PH1 A;  1EZ8 A;  3S15 B;  3HKZ G;  3O13 A;  1GHJ A;  4PMW A;  1LO5 D;  3MXN A;  5I9P A;  1Y1V B;  3I4N B;  3JAM E;  2FFK B;  3TN2 A;  2WB1 E;  1KNA A;  5CC4 A;  3K6O A;  4B08 A;  1W6J A;  4ULL A;  1T5E A;  1VQ7 A;  5FK9 C;  1X3E A;  4JBJ A;  4DF7 A;  5CYU A;  4LF6 L;  3PIO A;  5H1S E;  1WCM H;  4DK0 A;  4O42 A;  3KJP A;  2YYZ A;  1ET6 A;  1JB7 A;  4RCN A;  2VL6 A;  1XPO A;  4A3B G;  4DK6 C;  2H4O A;  4U68 A;  4HIK A;  2E2J H;  2QF7 A;  2EY5 A;  3U4V A;  3FPU B;  3GQB A;  2Q2H A;  1ESF A;  2G9H D;  5EAY A;  3PO2 G;  3FPP A;  5EJW A;  1N8R C;  2HDL A;  4OO1 G;  3P75 A;  4UDU C;  1Q12 A;  4RKL A;  2XWB B;  3K5L A;  1U4L A;  1HNX Q;  4JI3 L;  4F88 A;  2J7Z A;  2L5T A;  4O2D A;  1VQD A;  2R7D A;  2Z6B A;  2HQE A;  5CV9 A;  1PTO C;  4IZ8 A;  1VDZ A;  1SYF A;  3E5S A;  4R1J A;  3W2D A;  2F03 A;  4DR1 L;  4OIJ A;  1PRT B;  3SVM A;  2A1A A;  3A56 A;  4L63 B;  4I65 A;  3S1Q B;  4OXP A;  1WTP A;  4RGO S;  1N33 Q;  1JQY D;  3J81 c;  4X65 Q;  1L1O B;  4R4Q A;  4BY1 G;  4A3I H;  4QGU A;  1QUQ A;  5KEE A;  3AEV A;  4K8I A;  3DLL A;  2R6G A;  1SMY C;  4BXX G;  2QIL A;  1M1K C;  3VYS A;  3HKS A;  4LF9 Q;  3SK6 A;  1KQS A;  5COY A;  3K59 A;  3OTO L;  4IPH A;  4CKB A;  3GP7 A;  5KYI A;  2F0K A;  1PHJ A;  3I7F A;  3UE0 A;  4LFA L;  1GUO A;  2HIX A;  5CV4 A;  3OMC A;  3RLF A;  1N34 L;  1BBX C;  3CCS A;  3I4M H;  2RDF A;  3DMU A;  3EJI A;  1M4V A;  2NVY B;  4DXG A;  3GTJ H;  2FIN B;  3IKJ A;  5IGB A;  1CKM A;  1Q81 C;  3HOZ B;  2F1M A;  2KOL A;  2F3V A;  5D65 A;  1BOS A;  1IXR A;  1SNM A;  2RVL A;  4IUP A;  4HID A;  4JI4 L;  3T1H Q;  2AMC B;  2Q8R E;  1CSQ A;  1WCM G;  1D7Q A;  1HTL D;  2VNU D;  2LXK A;  1VQA A;  1J8I A;  4A3L H;  1Q3L A;  1CZW A;  1H9R A;  3CCU A;  4IUV A;  4A3J G;  3H15 A;  5E4X A;  4B9W A;  3RUZ A;  3MAQ A;  4ZAI A;  5M3F H;  1Q8K A;  4ZK9 B;  4DV1 Q;  2EYF A;  3SK5 A;  4A3F G;  1S40 A;  4C1N I;  1VQE A;  3RNU A;  2WAQ B;  3HOV G;  3CAM A;  4PZ8 A;  4X3U A;  1LYL A;  1QUQ B;  1JOO A;  3TS0 A;  1LTL A;  3T16 A;  1L1O A;  4OX9 L;  1QVF A;  2SEB D;  3FKI H;  1TS3 A;  3NEM A;  3E6Z X;  4XT1 B;  4CDF C;  3IL8 A;  1K3R A;  2A74 C;  1HR0 L;  2NVT H;  4V0B A;  4C3I H;  2JK8 A;  1VMC A;  1Z6H A;  1DXM A;  4A3K G;  4K2L A;  1K8A C;  4PMB A;  4YIJ A;  4M1U B;  4DFA A;  4NDX A;  1LTB D;  4O1N A;  2RHQ B;  4C2M B;  1H95 A;  3A74 A;  4N8F A;  4NW2 A;  1KD1 C;  2L55 A;  5C0X G;  1EWI A;  3DEP A;  2PNR C;  4X3T A;  4KKS A;  1L1O C;  3UDG A;  2JSO A;  5C44 G;  1TWC B;  1VQF A;  2O2L D;  1PRT F;  3GV6 A;  3MFG A;  2N78 A;  5IT9 L;  4MN3 A;  2EJF C;  4LAA A;  2EXZ A;  3I8Z A;  4DV5 Q;  1IZ6 A;  4HJ5 A;  5FO9 B;  2OWO A;  3GTM H;  4ZCK A;  1PH3 A;  5JVH 3;  4F87 A;  1TWH H;  2OF1 A;  1RTN A;  3GTM B;  1EFI D;  1EU3 A;  1IBL Q;  2Z6K C;  2ENB A;  3C3L A;  1OXS C;  4A3E G;  1VQ5 A;  1I6H B;  1EQT A;  2JA5 H;  4RFB A;  1UEB A;  3H91 A;  5IYD G;  4JOI A;  4IAL A;  1SEB D;  2A6H D;  1DGS A;  3ERO A;  2OQK A;  1AP0 A;  1N9W A;  1PH9 A;  5CV6 A;  5ELD A;  1PFN A;  5IP9 H;  3M4P A;  1A2U A;  4LUO A;  1HZ9 A;  4YY3 Q;  1M90 C;  5NUC A;  3N52 A;  5M5W B;  1ET9 A;  5LL6 S;  4CJ2 C;  1A62 A;  1SAP A;  4JI5 L;  1BF4 A;  1D6E C;  5FLX L;  4HSP A;  2UUA Q;  1W3S A;  1ESR A;  1PH2 A;  3A7A B;  5KYL A;  2RKS A;  1XTD A;  1K9M C;  2Z4H A;  3ONA B;  3S16 B;  1EQR A;  1CUK A;  2AQ1 B;  4EQN A;  3H0G B;  4XQJ A;  3VYU A;  1KL9 A;  1V1O A;  1FVI A;  1X54 A;  4RA8 A;  2D2C C;  3S1R B;  1V8Q A;  1VQI A;  1EYG A;  1RL2 A;  3HG9 A;  2PZT A;  4F8M A;  4XXE A;  1BDO A;  2F3I A;  1HQR D;  1XX8 A;  2MO1 A;  3GTL H;  2KUM A;  4H44 C;  4S3S A;  1SSO A;  3CD6 A;  4B3R L;  3D31 A;  3Q8D A;  1ASY A;  2MJ8 A;  3Q6S A;  4BY7 B;  1GOZ A;  3VR5 A;  3A8I E;  1I50 H;  1KDC A;  3Q0A A;  4LF4 L;  5EGT A;  3M3Y B;  1KTK A;  3PUZ A;  3KLR A;  5ELO A;  4CGY B;  5CR3 A;  2K75 A;  3JAM L;  2D62 A;  1KRT A;  3TRZ A;  1ENF A;  2EQS A;  4DV7 L;  1B53 A;  3CCJ A;  2KHS A;  1MI2 A;  1UNS A;  2DUD A;  3CQZ B;  2HHH Q;  5G3L F;  2LMC B;  4JI8 Q;  3KF8 A;  4QIW B;  1F2M A;  2BOS A;  2E76 C;  4R8I A;  2NTT A;  4NXM L;  1STG A;  1XJV A;  1K83 H;  4GKJ L;  1Q1E A;  3NQT A;  4LF8 L;  3M4O H;  2QEJ C;  2I0Q A;  5IWA Q;  2HUG A;  1UUP A;  4A3I B;  1CI3 M;  1QVG A;  1HPC A;  1BXT A;  1TWH B;  1U0L A;  1G6Z A;  1VQ6 A;  1D1K A;  2WIN B;  5IT9 E;  2IX1 A;  4DV4 Q;  1WTR A;  2ZTD A;  5M5Y B;  5FKA C;  3TQY A;  4DK3 C;  1B7Y B;  1VS0 A;  4JI0 L;  2EY6 A;  3LNN A;  3HOV B;  4JPB W;  1E7Z A;  1VCI A;  2EXD A;  1II3 A;  3TZU A;  1CTM A;  1H9K A;  3RZO B;  2EJG C;  5IT9 c;  1NE3 A;  1ICF B;  3R2T A;  1WI5 A;  1IL8 A;  1K73 C;  4HAE A;  3LWU A;  2IX3 A;  2F0J A;  4OL7 A;  5IYC G;  3V96 A;  3OYY A;  4YCV A;  2XRS D;  2R7Z H;  4A93 H;  3BJU A;  2YTY A;  3W3A A;  4Q5V A;  1AH9 A;  4YCU A;  2JA6 B;  2ZJR A;  3G48 A;  5C5L A;  3I90 A;  4QJF A;  1HUN A;  2AQ3 B;  2B8F A;  4XYO A;  2K05 A;  1K0R A;  4A3G B;  1K3B C;  3P20 A;  1X3P A;  2D5D A;  5EQ0 A;  2DY8 A;  4AYB B;  1Y1W B;  1PTO F;  2TSS A;  3L9A X;  2ZJQ A;  1I50 B;  1EIY B;  4B3T Q;  5C4X H;  1J5E Q;  1Z7T A;  4MTN A;  2ZXR A;  4LF8 Q;  1F2L A;  2GVB A;  2IHE A;  4HED A;  2F0H A;  1SMY D;  1CZG A;  1RD9 D;  1GUT A;  4ID6 A;  1SNQ A;  2XVS A;  3R2I A;  4A3C G;  4BBR H;  1I4G A;  1VMP A;  1QOH A;  2AHO B;  1D5Z C;  2XTI A;  4KKU A;  2OXP A;  1Z9F A;  4DV4 L;  1Q8I A;  4KTA A;  1EYC A;  3BYT B;  4JI0 Q;  4X6A H;  1U4R A;  4X3S A;  3A54 A;  4I7A A;  2IPK D;  2NBF A;  1B3Q A;  4DR7 Q;  2YU9 H;  4A3K H;  4CDD C;  3CCL A;  3J7A V;  5DEH A;  2E2D C;  3L0O A;  1K0S A;  3W1B A;  4BBR G;  5C4H A;  3L3O C;  3TP5 A;  3W5O A;  3NPP A;  5ELF A;  5AJ3 L;  4DV2 L;  1HNZ L;  1SNP A;  3HOY G;  1QZH A;  1S5C D;  1EUJ A;  1T9H A;  2V1C C;  4X64 L;  1BBW A;  1HNW L;  3A55 A;  3F8T A;  3T4A C;  1BBU A;  2IWH A;  4KHZ A;  4B3T L;  4QL5 A;  5IP7 H;  5C3X A;  1YVC A;  4C3H G;  3OTO Q;  3RZD B;  4DAM A;  4A3J H;  3LX0 A;  3NEL A;  1CQV A;  4IOC A;  1LM0 A;  3T1Y L;  3F2B A;  2CVR A;  2FXQ A;  4DAY B;  4ZUI A;  1OXX K;  4B3M Q;  4GOP A;  3CU7 A;  4AIM A;  2LXJ A;  2PPB C;  1WJJ A;  2EZV A;  4C1N K;  1N34 Q;  1AN8 A;  1JC7 A;  3I73 A;  4BWG B;  2QW7 A;  3KYH C;  4A93 B;  1A2T A;  2C35 B;  1PTO D;  2MO0 A;  3PQI A;  2Y0S B;  1CA6 A;  2ICE C;  4QB4 A;  5ELN A;  3J81 L;  4V19 0;  4DV2 Q;  3D8G A;  4DR5 L;  3RZO H;  2EYL A;  3K5N A;  1CA5 A;  1I4R A;  3PO2 B;  4XQN A;  1LT5 D;  1EZ6 A;  5EKL A;  2B2U C;  1VQG A;  2JA5 G;  2K5Q A;  1C0A A;  3A5Z B;  1OTC A;  1MSG A;  1NR4 A;  2UUB L;  1A6X A;  1KAB A;  4IJH A;  4MNO A;  2IY5 B;  4WRD A;  1SLJ A;  3I4O A;  1XTC D;  3DHQ A;  3S16 H;  4YHH L;  3J80 E;  4GLA C;  2K1B A;  2QDL A;  1JJ2 A;  4OX9 Q;  1Y14 B;  3AMU A;  4XYQ A;  3FDT A;  5JPN C;  1AW7 A;  2K4K A;  1PZI D;  4OIK A;  1FGU A;  4IQZ A;  4ZYS A;  1JJC B;  1EFW A;  3U9S A;  1HZC A;  4C2M H;  3F1Z A;  1RIP A;  4AYB E;  3I3C A;  4KD4 A;  4FDB A;  3D3R A;  2YTV A;  2ATW A;  1O80 A;  4BA1 I;  5C3E H;  1EY5 A;  2NN6 G;  1QNK A;  3C1F A;  3GTO B;  2M9V A;  1E22 A;  1GM5 A;  1VQJ A;  5IOD A;  1N36 L;  4DR4 Q;  3ER0 A;  3T51 B;  1Q86 C;  2GN5 A;  1DCZ A;  2KCT A;  2I5M X;  3WOE A;  1DZ1 A;  1C9O A;  4R4T A;  2BA0 A;  3RZD H;  1SFO B;  4LK1 C;  3OSO A;  1RCV D;  4CHT B;  4L5T A;  4TVA B;  5C4X B;  1IYU A;  1EY6 A;  1K83 B;  3CF5 A;  2DNE A;  2JA7 G;  1D2B A;  4Y7N H;  2CW0 C;  3BZK A;  4X62 L;  1SE8 A;  4OWW B;  4JI1 Q;  5E1F A;  1U4P A;  5IOC A;  1PVO A;  1HFG A;  4L5Q A;  2MUY A;  1B2T A;  4A4I A;  4LJZ C;  1S5D D;  1VQN A;  2VUM G;  5C4J B;  4DUY Q;  1NY4 A;  2PI2 A;  2MHV A;  5IGF A;  4C56 C;  3VA7 A;  1SBB B;  4YY3 L;  4JI2 Q;  3H3V I;  3OPO A;  2NVY H;  1EOV A;  1WTW A;  2Q8T A;  1IKL A;  2UXB Q;  1I3Q H;  1F9P A;  4IUQ A;  4JBK A;  3J81 E;  4UHV A;  3CCV A;  1FJG Q;  4DR4 L;  2NN6 H;  2RA4 A;  4K5W A;  2BE5 D;  2F0F A;  3NSW A;  3PUY A;  1P8L A;  1Y1V G;  3NBH A;  4HIM A;  1CM9 A;  4ME3 A;  3C46 A;  1WVL A;  2IX0 A;  5A2Q L;  1R4Q B;  2NZ1 D;  2OTJ A;  1V1P A;  3H0G H;  3M4Y A;  3FEW X;  3QOJ A;  1EIF A;  5M3M H;  1RHP A;  1DOK A;  1G2S A;  4J8Q A;  3HRZ C;  4PV1 C;  4JI1 L;  3SEB A;  2KA7 A;  1EEF D;  1E2W A;  3E9H A;  1BO0 A;  1TS4 A;  1PYS B;  3GTK H;  1EQV A;  1SYD A;  4RWS C;  2R7Z B;  1HTP A;  4PZ6 A;  2CH4 A;  4DR2 Q;  1J6Q A;  2KEC A;  4HJ8 A;  1XYI A;  1IKM A;  4H13 C;  4A3M B;  1O7Z A;  3V05 A;  2ZTC A;  4XQQ A;  3PCO B;  2SNS A;  2E5L Q;  3I4M B;  3KDF A;  2WAC A;  5AFW A;  2UXB L;  3SXH A;  1JE5 A;  4GKK L;  3C2P A;  3HZX A;  4CJ0 B;  2JA8 G;  1GJX A;  1GUS A;  2Q2I A;  3T56 B;  2TMP A;  3R3O A;  5GQO A;  1JWU D;  3VDY A;  3CCM A;  1RJT A;  1ZYR D;  2KBN A;  1XNR L;  1C4Q A;  4DV6 Q;  1K8G A;  2NVX H;  4GKJ Q;  3TP8 A;  4DR6 L;  2PQA A;  2RF4 A;  3HOU H;  1RTO A;  5JJI A;  5FLX E;  4KKT A;  1ZYR C;  3K57 A;  1NTG A;  2PMZ B;  3I55 A;  1ROD A;  3W1G A;  5DM6 3;  3EVQ A;  3MXP A;  1Y1W H;  5G3L D;  3PO2 H;  4Y7N B;  3PSI A;  1G8Z D;  1MD2 D;  2BE5 C;  2KVM A;  2ZXP A;  3BDL A;  3Q24 A;  5JJK A;  4EGV A;  4LF7 L;  2N3S A;  1WFQ A;  1GKH A;  5IYC H;  4AQY Q;  3MHB A;  4GLX A;  4JI3 Q;  4DR3 Q;  1OXU A;  1HQM C;  3S14 B;  5ELE A;  1STH A;  2A5H A;  1VQO A;  3KDF B; 
#chains in the Genus database with same CATH homology
 1W3S A;  1D8L A;  1PH2 A;  1MKH A;  3GTQ H;  1XTD A;  5GAH C;  1K9M C;  3CC4 A;  3UDX A;  1X55 A;  1EQR A;  4JV5 L;  4DUZ L;  1CUK A;  4QY7 A;  1KL9 A;  3UDF A;  4JI7 Q;  4B3S L;  1S3O A;  1X54 A;  1FVI A;  2CKZ B;  2JEB I;  5IY0 A;  3T1Y Q;  1TWA H;  2PMZ E;  5M5Y H;  2CCZ A;  4LF5 L;  3B6Y A;  2VW9 A;  1VQI A;  2ES2 A;  3CMA A;  1EYG A;  4JYA L;  1RL2 A;  4DNI A;  5C3E G;  1UE7 A;  4BXX H;  4UP9 A;  3CCE A;  1VQ4 A;  1X65 A;  2HT1 A;  3S1M H;  1G6P A;  3OW2 A;  2CWP A;  2WB1 G;  2F3I A;  4K0K Q;  4B3M L;  5HGQ A;  1XNR Q;  2MO1 A;  4IO9 A;  3GTL H;  4Y52 H;  4A3C H;  1SRO A;  3CD6 A;  4DR6 Q;  2VQE Q;  4B3R L;  3D31 A;  3Q8D A;  1HR0 W;  1ASY A;  4EQ5 A;  3S1N H;  4LFB L;  4NXN L;  2YTX A;  4POG A;  2H5X A;  1HZB A;  1I94 L;  1HZA A;  4HJ7 A;  5IP9 G;  1IBK Q;  1AE2 A;  4KLK A;  5HY6 A;  4JI2 L;  1I50 H;  3FKI G;  3ULL A;  4MZ9 A;  3KF6 A;  3GTO H;  1ASZ A;  4LF4 L;  5LMU L;  3J80 c;  1Z47 A;  3PUZ A;  5ELO A;  2L15 A;  3HFZ B;  4LF6 Q;  2OQ0 A;  3U58 A;  2K75 A;  5M3F G;  2D62 A;  4LFA Q;  2I5L X;  1KRT A;  2XGT A;  4GN4 B;  2EQS A;  5IP7 G;  4DV7 L;  1SFO H;  3CCJ A;  3TRZ A;  4OWT B;  2JA7 H;  1UE1 A;  4TQU S;  1E3P A;  2PNH A;  2DUD A;  4DV0 Q;  2HHH Q;  3I4N G;  3HOX H;  2NZH A;  4JI8 Q;  2JE6 I;  1X9N A;  4JI6 Q;  4IJL A;  4AYB G;  1IBM L;  5C0X I;  4NB3 A;  1PH4 A;  3K8A A;  4O0A A;  4NXM L;  3KFU A;  4DUZ Q;  1XJV A;  1K83 H;  3CPW A;  1Q1E A;  4DUY L;  4R4I A;  1VQ9 A;  4GKJ L;  1HNX L;  4BY7 H;  4JI7 L;  4LF8 L;  3M4O H;  1I6H H;  1BVS A;  2I0Q A;  1KHI A;  3M9B A;  5IWA Q;  4L5S A;  3KLW A;  3T1H L;  1NJI C;  2RCN A;  4UY8 C;  1EQQ A;  1QVG A;  4YHH Q;  4JOI C;  4GS3 A;  3CCQ A;  1KC8 C;  2F4V L;  1U0L A;  1L0W A;  1HJP A;  4LNQ A;  4K0K L;  3LGJ A;  2UXD L;  1VQ6 A;  1SMX A;  2IX1 A;  4DV4 Q;  2ZTD A;  1AE3 A;  2K5H A;  3TQY A;  3S24 A;  4DK3 C;  1B7Y B;  4POF A;  1VS0 A;  2K52 A;  4KI0 A;  5GAG C;  4DR5 Q;  4JI0 L;  2Q2T A;  3S15 H;  3G4S A;  3EN2 A;  4X65 L;  1OXT A;  4IPC A;  4GN3 B;  1XMQ L;  5IYB H;  1E7Z A;  1VCI A;  1V43 A;  3CP0 A;  2ZM6 Q;  1FJG L;  3FHW A;  2EXD A;  2QA4 A;  2JA9 A;  1Q46 A;  2E5L L;  4DV1 L;  3I56 A;  2ASB A;  5IT9 c;  1NE3 A;  1WI5 A;  3L2P A;  3PF5 A;  2UU9 L;  1K73 C;  4IFD J;  2JA6 G;  4JC0 A;  4YWL A;  4OWX B;  1I5F A;  3S2H H;  4WJ4 A;  5IYC G;  5K36 G;  3OYY A;  4YCV A;  2R7Z H;  3CME A;  3CCR A;  4A93 H;  2R7F A;  3BJU A;  1OXV A;  2YTY A;  4DV6 L;  3JAM i;  1YHA A;  1AH9 A;  4YCU A;  3PUW A;  4HJ9 A;  4UPA A;  4B3S Q;  4DV0 L;  4C3J H;  1KRS A;  2ZJR A;  3G48 A;  4R4C A;  3U4Z A;  3RLO A;  1HR0 Q;  4LF5 Q;  1GO3 E;  4QJF A;  5GRO A;  1K0R A;  4A3L G;  3NEN A;  4YWK A;  2WP8 J;  4BY1 H;  2JJQ A;  2ZJQ A;  1X3G A;  2AWN A;  1C7Y A;  1EIY B;  2K50 A;  4B3T Q;  5C4X H;  1J5E Q;  5BR8 L;  1MJC A;  5C0X J;  4MTN A;  5E7N A;  3HOY H;  4GLV B;  1PH5 A;  4LF8 Q;  4PG3 A;  1N33 L;  3GTG H;  4NXN Q;  1VQC A;  2B3G A;  2GVB A;  2IHE A;  3IRB A;  3K7A H;  4YCW A;  3J7A 5;  5C4J H;  1KXL A;  2VQF Q;  4DV3 Q;  4A3C G;  5M5W H;  4IFD I;  1XMO Q;  3KF8 B;  4BBR H;  2R92 H;  2AHO B;  4HIO A;  3J7Z C;  2XTI A;  3CC7 A;  2UXD Q;  2UUA L;  1VQ8 A;  1Z9F A;  4DV4 L;  1S72 A;  4DV5 L;  2CWA A;  3DM3 A;  2ZTE A;  4JI0 Q;  2UUB Q;  3A5U A;  1YIJ A;  4X6A H;  4DV7 Q;  1YI2 A;  4JI4 Q;  1B8A A;  1A8V A;  2A19 A;  2K5N A;  4APV A;  4GN5 A;  1IL2 A;  4A3E H;  3EIV A;  3S17 H;  1B70 B;  3K7U C;  4DR7 Q;  2A8V A;  2YU9 H;  3PO3 H;  2HQL A;  3TEH B;  4A3K H;  1A0I A;  3KF6 B;  3BZC A;  3CCL A;  3ULJ A;  4KHP L;  1GVP A;  2OTL A;  3L0O A;  2UXC L;  1YEZ A;  4A3B H;  4LFC Q;  3W1B A;  4BBR G;  3FP9 A;  2NN6 I;  5AJ3 L;  3W5O A;  1HNZ L;  3RN2 A;  1UWV A;  1YHB A;  4DV2 L;  2BH2 A;  3HOY G;  1QZH A;  4B3R Q;  2VQE L;  5LMN L;  4UP8 A;  4X62 Q;  1YIT A;  1EUJ A;  1T9H A;  2V1C C;  3SGI A;  3A0J A;  1CSP A;  1O7I A;  4X64 L;  2Y0S E;  1BBW A;  4A3G H;  1HNW L;  4IPG A;  1CKO A;  3F8T A;  4LF4 Q;  3HOV H;  1BBU A;  2UUC L;  1YZ6 A;  1P16 A;  4KHZ A;  4B3T L;  4QL5 A;  5IP7 H;  3MEF A;  3MXN B;  2WAQ G;  3JAM c;  3GDE A;  1YVC A;  2K5V A;  3OTO Q;  4P75 A;  4GOP B;  2B63 G;  4JV5 Q;  4A93 G;  3HOU G;  4DAM A;  3PIP A;  1KAW A;  4A3J H;  3PUX A;  3U50 C;  1XNQ Q;  3NEL A;  3CC2 A;  3PV0 A;  1XMO L;  1TWG H;  4IOC A;  1LM0 A;  3T1Y L;  3F2B A;  2CQO A;  4JI8 L;  1WOC A;  4XIG S;  1R9T H;  2FXQ A;  3HOW H;  4DAY B;  3HOW G;  4EX5 A;  3G71 A;  1OXX K;  2ALY B;  1PA6 A;  4JBM A;  4B3M Q;  3AFP A;  3K0X A;  4GOP A;  1G51 A;  2VS1 A;  4AIM A;  2LXJ A;  1Q82 C;  1PH1 A;  1SRU A;  2EIF A;  1WJJ A;  3HKZ G;  4QIW E;  1W2B A;  3ZJY C;  4PMW A;  1N34 Q;  1TXY A;  4LFB Q;  3D0F A;  4A3D H;  3KOJ A;  2WB1 E;  4KHP Q;  3KYH C;  1VQK A;  2C35 B;  4JG2 A;  2MO0 A;  1Q7Y C;  4BA2 I;  1SR3 A;  5ELN A;  1VQ7 A;  1X3E A;  4JBJ A;  5FJ8 G;  2PQA B;  4GNX B;  3CXC A;  4DV2 Q;  4LF6 L;  3PIO A;  2VZA A;  5H1S E;  1WCM H;  4DR5 L;  3RZO H;  3KJP A;  5LMN Q;  1JT8 A;  2YYZ A;  1JB7 A;  1IBL L;  1TWC H;  1VQB A;  4LW1 A;  4PZ7 A;  2CFM A;  2VL6 A;  2VY3 A;  1XPO A;  4A3B G;  4LUZ A;  4LWC A;  4OON A;  4DK6 C;  2ZM6 L;  5C4X G;  4HIK A;  2E2J H;  3U4V A;  2YV5 A;  4HJA A;  3E9I A;  1GD7 A;  2Q2H A;  2VUM H;  5EAY A;  1VQG A;  2JA5 G;  3PO2 G;  3CQZ H;  1N8R C;  1IBM Q;  4OO1 G;  1C0A A;  4DR2 L;  3A5Z B;  1Y1V H;  1YBY A;  1Q12 A;  4A3F H;  1OTC A;  2UUB L;  3M7N A;  3AYH B;  1A63 A;  1XPR A;  1VQL A;  3J81 i;  3S1R H;  1HNX Q;  4JI3 L;  4RMF A;  1N32 L;  2DGY A;  4IJH A;  4MNO A;  4JI5 Q;  4O2D A;  3K80 C;  2IY5 B;  1QVC A;  1VQD A;  2R7D A;  4IPD A;  1SLJ A;  3I4O A;  3S16 H;  5M3M G;  1E1T A;  1VQP A;  5JJL A;  4YHH L;  4GLA C;  4R1J A;  2LSS A;  1JJ2 A;  3STB C;  1Y14 B;  4DR1 L;  4OX9 Q;  4RG1 A;  4DKA C;  2A1A A;  2K4K A;  3UE1 A;  4OXP A;  3M4Q A;  2QGQ A;  3WWV A;  1FGU A;  1V9P A;  1N33 Q;  1JJC B;  1YJ9 A;  1EFW A;  4C3H H;  3J81 c;  1HZC A;  4X65 Q;  1YJN A;  4C2M H;  1L1O B;  1V1Q A;  4H02 A;  4R4Q A;  4BY1 G;  1XMQ Q;  4A3I H;  3F1Z A;  4QGU A;  1QUQ A;  3HOX G;  1RIP A;  3AEV A;  3I4N H;  4AYB E;  2WAQ E;  2VQF L;  4DV3 L;  1NMF A;  4FDB A;  3DLL A;  1E1O A;  2YTV A;  2B29 A;  3NBH B;  2ATW A;  2R6G A;  4BA1 I;  3G6E A;  5C3E H;  4BXX G;  1PV4 A;  4A3D G;  1M1K C;  2NN6 G;  4A76 A;  4LF9 Q;  3HKS A;  1KQS A;  2IHF A;  3KJO A;  1E22 A;  3OTO L;  1GM5 A;  1I94 Q;  1VQJ A;  4A3G G;  3UDI A;  4BY7 G;  4AQY L;  1N36 L;  1VQM A;  4DR4 Q;  3ER0 A;  1Q86 C;  4DR3 L;  2JA6 H;  4IPH A;  2GN5 A;  4P71 A;  2KCT A;  3M85 A;  3HOZ G;  3PF4 A;  2I5M X;  4DR7 L;  4GKK Q;  1C9O A;  4R4T A;  2BA0 A;  3RZD H;  1YHQ A;  4R4O A;  4GOP C;  3AFQ A;  1PHJ A;  3I7F A;  1X3F A;  1YJW A;  3UE0 A;  4LFA L;  4L5T A;  1TWF H;  2N49 A;  4TVA B;  2HIX A;  5AJ3 Q;  1J5E L;  5C44 H;  3PO3 G;  3CF5 A;  1PYB A;  3RLF A;  1N34 L;  2JA7 G;  1NBW A;  4Y7N H;  3CCS A;  1N32 Q;  3BZK A;  3STB D;  4X62 L;  2ZJP A;  2HHH L;  3I4M H;  5IYD H;  1SE8 A;  5FLM H;  1NMG A;  4OWW B;  4L5R C;  3ERS X;  4JI1 Q;  3RLN A;  2R93 H;  5FLX c;  3L7Z C;  2Z6K A;  3GTJ H;  1HNW Q;  1PVO A;  2N8N A;  4L5Q A;  4WJ3 M;  3ICE A;  1PH8 A;  1X6O A;  5IE8 A;  4A4I A;  1G29 1;  1VQH A;  1L2F A;  2KHI A;  3K81 C;  1CKM A;  1VQN A;  2VUM G;  2E8G A;  2R7Z G;  4DUY Q;  1NY4 A;  1Q81 C;  1PH7 A;  4QQB X;  2PI2 A;  2KCM A;  1IXR A;  4LF7 Q;  2JQO A;  4HID A;  1JMC A;  4JI4 L;  4A3M G;  3T1H Q;  2JA8 H;  1E24 A;  4YY3 L;  2MFI A;  2Z0S A;  1XNQ L;  4JI2 Q;  2AMC B;  3H3V I;  3AQQ A;  1CSQ A;  1WCM G;  2AKW B;  1EOV A;  2D0O A;  2NVY H;  3J80 i;  5IYB G;  2VNU D;  1D7Q A;  2UXB Q;  2LXK A;  1VQA A;  3TS2 A;  2RHS B;  4A3L H;  2E2H H;  3CCU A;  2B63 H;  1I3Q H;  1Q1B A;  4A3J G;  3EBE A;  3H15 A;  3F2D A;  4JBW A;  4LFC L;  1FL0 A;  5DLQ E;  4JBK A;  3H3V H;  5M3F H;  5GAE C;  1HNZ Q;  3CCV A;  1FJG Q;  4DR4 L;  1KIX A;  1Q8K A;  3JC6 6;  4DV1 Q;  3S14 H;  3PUY A;  4A3F G;  1S40 A;  1P8L A;  1Y1V G;  4XTC S;  1VQE A;  3RNU A;  4HIM A;  5JEA J;  3HOV G;  3CAM A;  1U5K A;  4PZ8 A;  4X64 Q;  1LYL A;  4ME3 A;  4JI6 L;  1QUQ B;  3TS0 A;  2D0P A;  1LTL A;  2UUC Q;  1L1O A;  1WYD A;  2AWO A;  3BU2 A;  4DR1 Q;  4OX9 L;  2IX0 A;  4NXM Q;  1QVF A;  4IFD G;  3FKI H;  4P72 A;  4A75 A;  2OCE A;  2OTJ A;  3H0G H;  4NPS A;  3H0G G;  3NEM A;  4JCV E;  1MJE A;  2BH8 A;  1PFS A;  1EIF A;  1X56 A;  4YWM A;  2Q2U A;  1K3R A;  5M3M H;  5IWA L;  1UE5 A;  3PUV A;  3F2C A;  1HR0 L;  2NVT H;  4C3I H;  2JK8 A;  4JI1 L;  5FJ8 H;  5JEA G;  4A3K G;  4X66 Q;  1K8A C;  1PH6 A;  3J81 j;  3E9H A;  2KHJ A;  1Y1W G;  2BA1 A;  1PYS B;  3GTK H;  1H95 A;  2RHQ B;  1JJG A;  4LF9 L;  5J3B A;  3A74 A;  4IOA A;  2R93 G;  1KD1 C;  5FLM G;  4P74 A;  4PZ6 A;  3E0E A;  5C0X G;  4DR2 Q;  1BKB A;  3S1Q H;  2WFW A;  1J6Q A;  1EWI A;  3HKZ E;  4HJ8 A;  5GAD C;  4ALP A;  3RN5 A;  1L1O C;  2ZTC A;  3UDG A;  2I5H A;  1MIU A;  2KEN A;  5C44 G;  1IYJ B;  3PCO B;  1VQF A;  2NZO A;  2E5L Q;  2MNA A;  3KDF A;  2E2I H;  2NVQ H;  2N78 A;  2UXB L;  2UU9 Q;  1JE5 A;  1HH2 P;  4J15 A;  4GKK L;  4A3M H;  2JA8 G;  2PI2 E;  4JYA Q;  3RR5 A;  4DV5 Q;  2Q2I A;  1IZ6 A;  1YNX A;  4HJ5 A;  5GQO A;  3VDY A;  3CCM A;  1QZG A;  2OWO A;  3GTM H;  2KBN A;  1XNR L;  4DV6 Q;  3TRE A;  1PH3 A;  2IT1 A;  1K8G A;  1XPU A;  2NVX H;  3HOZ H;  1TWH H;  4DR6 L;  4GKJ Q;  2PQA A;  4UP7 A;  1CKN B;  4GNX A;  2RF4 A;  3HOU H;  5JJI A;  3I2Z A;  1IBL Q;  2Z6K C;  3GD7 A;  4LUV A;  2GVA A;  2JEA I;  1OXS C;  1IBK L;  2K14 A;  5LMN W;  4A3E G;  1VQ5 A;  1NTG A;  1UE6 A;  3CPF A;  2ID0 A;  3CW2 C;  3I55 A;  3W1G A;  4OO1 I;  2Y0S G;  2UXC Q;  3M3Y H;  5LMU Q;  1SN8 A;  1Y1W H;  2F4V Q;  2HIV A;  2JA5 H;  1UEB A;  3PSI A;  5IYD G;  4JOI A;  3I4M G;  3PO2 H;  1DGS A;  2OQK A;  1CKN A;  1N9W A;  5BR8 Q;  4DPG A;  1PH9 A;  4A3I G;  4AH6 A;  2R92 G;  3GTP H;  5JJK A;  3ULP A;  4LF7 L;  3GO5 A;  2N3S A;  1WFQ A;  1GKH A;  5IP9 H;  1M90 C;  3M4P A;  4LUO A;  3PGZ A;  1HZ9 A;  4YY3 Q;  5IYC H;  2QEX A;  4AQY Q;  1N36 Q;  1LUZ A;  4GLX A;  4JI3 Q;  5M5X H;  4DR3 Q;  1OXU A;  3S2D H;  4BBS H;  4BBS G;  4X66 L;  1A62 A;  4JI5 L;  2F52 A;  4GNX C;  1VQO A;  4P73 A;  2MQH A;  3KDF B;  2UUA Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...