2ZM6Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zm6Q00
4B3SQ 3TQYA 3FP9A 4A3KH 4R4TA 5IYCH 2N3SA 5BR8L 4DV2Q 4JBWA 4YCVA 4L5RC 1YHBA 3CCRA 4DV1L 1EQQA 4ALPA 1SLJA 2KCTA 4DV1Q 2DUDA 1PH5A 3S2HH 1M90C 2R92H 2RHQB 4UP7A 1JT8A 1GKHA 1N9WA 3DLLA 1OXUA 1PHJA 4IOCA 3E0EA 1XNQQ 1BKBA 3CMAA 2N49A 4AIMA 4A3CG 3L7ZC 3NBHB 5EAYA 3ZJYC 3F2BA 1I50H 1VQFA 5C3EH 4NPSA 1E22A 1E1OA 4AQYL 2ZM6Q 1K0RA 1YHAA 3CCLA 1D8LA 4DR6L 1XMOL 5FLMG 3BZCA 1YZ6A 1NE3A 2KENA 2ZTDA 4UP9A 3KLWA 4TQUS 5LMNQ 3UDGA 2UU9L 3TS0A 1MJEA 2R92G 2ID0A 3S2DH 4GS3A 3I7FA 4L5SA 4GKJQ 1EIFA 2KHIA 4JI2L 1J5EL 2PI2A 4JBJA 4DR1L 1KAWA 4NXNQ 4DV7L 5FJ8G 3KOJA 1U0LA 4X66Q 3J7ZC 5H1SE 1HNWQ 1BBWA 5AJ3L 1OTCA 4JI0Q 1TXYA 3CCVA 4GKKQ 2CCZA 3JAMc 4IPHA 4C2MH 4QIWE 3J81i 1WI5A 3CCQA 3GTOH 2A19A 3S1NH 3E9IA 2YYZA 1S72A 1HZBA 4A3DH 3I4NH 2Q2IA 2RHSB 4GLVB 3HOYH 2CWPA 5M5XH 3PUVA 3T1YQ 1PH9A 4JYAL 3HOZH 2UXDQ 1IBKL 4LW1A 5AJ3Q 4JI0L 4A3BH 1TWHH 1UWVA 1QVFA 4YY3Q 4HIOA 1B7YB 4LF5Q 4YHHQ 4JI4L 4MNOA 4IPGA 5C4XH 3OW2A 3PV0A 1PH7A 3M4PA 4JI6Q 1ASZA 3HOZG 3CPWA 1J6QA 1IYJB 1S3OA 2YTXA 4P75A 4LFAQ 2Q2HA 4X65Q 4X65L 2JA8G 1NBWA 4DR2Q 4WJ4A 1HH2P 1WYDA 4L5TA 3I4NG 1X6OA 4DAYB 1TWAH 1L1OB 3CCUA 4QQBX 3CPFA 2E8GA 1ASYA 4R4OA 4OO1I 4NB3A 4O2DA 3TS2A 3Q8DA 3OYYA 4OWXB 4UP8A 2UXBQ 2YU9H 2E2JH 4A3LG 1WFQA 1W3SA 4A3IH 3U4ZA 1VQDA 1QZGA 1Q12A 4EQ5A 4QL5A 3PUYA 1Y1VG 5IP7G 3W1GA 3T1YL 4DR3L 1Y1WG 1QUQB 4MTNA 4LF8Q 1N33L 4LF4Q 1RL2A 4GNXB 4JI7L 4LF8L 2VUMH 4JI5Q 1SFOH 2BA0A 3CCEA 2XTIA 1K3RA 4JI8L 5GAGC 1HR0Q 2HQLA 4X66L 1HNWL 3W5OA 1XMQL 1KRTA 3I2ZA 1EFWA 1XPRA 3GTQH 4Y52H 5FLMH 2PQAA 4DV5Q 1TWCH 2N78A 2VZAA 4DK6C 4A3FH 4XIGS 3PF4A 4AYBE 2HHHQ 4IFDG 1LYLA 3KYHC 2B63H 3RNUA 3S15H 4YWKA 1PH6A 2D62A 4JI2Q 2WAQE 2OQKA 4IPDA 3GTMH 5HY6A 2ATWA 4LFCL 1N8RC 1I94L 2VUMG 2JA6G 4X62L 4BBSH 1X9NA 2JA7G 3FKIG 5JJIA 4DR6Q 4OXPA 3I4MG 1I5FA 4OX9L 5IT9c 4DV0L 2K52A 2PNHA 4JBMA 4DV6Q 5FLXc 5GROA 3PUXA 1C9OA 2Y0SG 1EWIA 1B8AA 3HKSA 4KI0A 2KCMA 4IJLA 4IO9A 2K5NA 1XNQL 1PH4A 2UXCL 1NJIC 1I94Q 4LFCQ 2R7ZG 1LM0A 1NTGA 1GM5A 4DV2L 1K73C 2N8NA 1XPOA 1VQEA 4B3RQ 4ME3A 1PA6A 1EOVA 4LF5L 2K5VA 5JJLA 3KDFA 5DLQE 1CKNB 2KBNA 2QA4A 4LF7Q 1Z47A 3D0FA 2YTYA 4HJ9A 3GTLH 1PFSA 1VQBA 2PI2E 3PSIA 4P72A 4A4IA 1VQCA 1EUJA 4LUZA 3PO2H 5JJKA 1IZ6A 2JK8A 3MEFA 3S24A 2YV5A 2JQOA 1YJWA 4JI7Q 1X65A 4HIMA 1WOCA 1I3QH 4IFDJ 2B63G 3OTOL 1HZ9A 4DUYQ 2MO0A 2UUCL 1CSQA 1VCIA 2E2HH 4QJFA 1Q86C 2ZM6L 1B70B 4JC0A 2MNAA 1VQNA 2Q2TA 1UE5A 4Y7NH 5C0XG 4DR5L 4DV0Q 1CKNA 3HOXG 4DR5Q 4A3JG 1VQPA 1YITA 4POGA 1A63A 5JEAJ 2AMCB 1N36Q 1G6PA 2L15A 3JC66 2E5LL 2F4VL 1WCMH 1YVCA 2Y0SE 3G6EA 4DV4L 4LF6Q 1SRUA 3KF6B 1PYSB 4AQYQ 4JBKA 3HOVH 3PO3H 3KF8B 3ULLA 4POFA 1OXTA 4RG1A 4DV5L 3CQZH 3EBEA 2JA7H 4OWWB 2EXDA 1Q81C 4LFBL 4LFBQ 1K83H 3BZKA 2JEBI 2K4KA 3HOVG 4L5QA 3LGJA 3F1ZA 4DV3Q 1IL2A 4OO1G 1FJGL 3S1MH 4JCVE 4JI5L 3F2DA 1KHIA 2D0PA 4IJHA 1JMCA 2VQEQ 3HOXH 4A3JH 2QGQA 1PH3A 1SR3A 1XNRQ 2D0OA 3WWVA 1EYGA 4B3RL 1BVSA 1L2FA 1MKHA 4JI3Q 2FXQA 4GN5A 4DR4L 4LF9Q 3BU2A 2B29A 3CP0A 4R1JA 3IRBA 1PH1A 1VQJA 3G71A 5IE8A 4R4IA 2IHEA 3UE1A 5IYBG 4DV6L 2V1CC 3H15A 1VQHA 4A3CH 4FDBA 4XTCS 1V43A 2NN6G 5C0XJ 5IWAQ 4A3DG 2K5HA 1A0IA 1Z9FA 1UEBA 3OTOQ 2UUCQ 3PO3G 3CC7A 3HFZB 4C3IH 3J7A5 1JJGA 2B3GA 2VS1A 4LFAL 4GOPB 1OXXK 3GTKH 4X64Q 4QGUA 4DR7L 1C0AA 3MXNB 4H02A 4BXXH 4KHZA 5E7NA 1HNZL 5M3MG 1E3PA 4P74A 2WP8J 4AYBG 1K8GA 2JA9A 4GN3B 2QEXA 1IBKQ 4EX5A 1K9MC 1L1OA 3GD7A 4A93G 1JE5A 1YEZA 2VW9A 1CUKA 3RN5A 1CKMA 1QUQA 4DAMA 3DM3A 5C4XG 3CCSA 1VQAA 2H5XA 3K81C 1JJCB 1O7IA 2XGTA 1VS0A 2NVXH 1T9HA 1VQ9A 1VQ4A 2E2IH 3NENA 4DUZQ 3PO2G 1D7QA 1Q8KA 2BA1A 1NMFA 4BBRH 2IY5B 4A3GH 2R7FA 3UE0A 3CC2A 3AFQA 3D31A 3G48A 1XTDA 2MFIA 2VNUD 1P8LA 4GLXA 4IOAA 5ELOA 3RLFA 3J80i 2LXJA 4A3IG 1VQ5A 3RLOA 4DNIA 4LF9L 1NY4A 4A76A 1FL0A 1SROA 3CAMA 3NELA 2NZHA 1YNXA 2ZTCA 5M5YH 5C4JH 3CCMA 5LMUL 3CW2C 3AQQA 1VQLA 1IBLL 3HOYG 1L0WA 3RLNA 2AWNA 1PH2A 2UXDL 2ES2A 4K0KL 4R4CA 2VQFQ 2IHFA 5GAHC 2OQ0A 2JA8H 4DPGA 3PUZA 3L0OA 3PIPA 2JEAI 3M3YH 3GTGH 3H3VI 2CWAA 4RMFA 1AE2A 2EIFA 1CKOA 4GN4B 4BBSG 4A3GG 5C3EG 1K8AC 1CSPA 2GVAA 2R6GA 2WB1G 3M9BA 2WFWA 4BA1I 1VQ8A 4NXMQ 3CCJA 1FJGQ 3B6YA 2Z6KA 4P73A 2ZJRA 1G291 3ULPA 3UDIA 3CC4A 4LUOA 1EQRA 4DV7Q 3STBC 2VQFL 1X55A 1X56A 1KL9A 4A3FG 4HIDA 1Q1EA 4PZ7A 4R4QA 1EIYB 4GNXC 4GKKL 1OXSC 4JG2A 4A93H 4BY7G 1N32L 2BH8A 1VQKA 1TWFH 5LMUQ 1YBYA 3TREA 4X64L 1HNXQ 1HNXL 2A8VA 5IYCG 5M3MH 3KDFB 2HIXA 4YCUA 4DR2L 4GLAC 5M5WH 4BXXG 1FVIA 4C3JH 1KC8C 4X6AH 1XMQQ 1SMXA 3M4OH 2OTLA 1DGSA 4JI3L 4DR4Q 1A8VA 4KHPL 5GAEC 2PQAB 4GOPA 5FJ8H 3H3VH 2GVBA 3HKZE 3GDEA 2CQOA 1LTLA 4UY8C 1Q1BA 2VY3A 2OCEA 4JOIC 3ER0A 3UDXA 1KD1C 1TWGH 4B3SL 2UXCQ 1Q46A 1KXLA 1X3EA 1V9PA 2AKWB 1YHQA 2KHJA 4J15A 2I0QA 2UXBL 1WJJA 3W1BA 2K75A 5BR8Q 1LUZA 3I56A 4HJ5A 2LSSA 5GADC 1PVOA 4GOPC 2R93G 2JA6H 3PF5A 4YCWA 1PV4A 4HJ7A 1SE8A 1RIPA 2C35B 4PG3A 2K14A 2ZJPA 4A3MG 1KIXA 5M3FH 3BJUA 4UPAA 1M1KC 2CFMA 1UE1A 3PCOB 5IP7H 1GVPA 2F4VQ 1U5KA 3S17H 1Y14B 2ZTEA 3T1HQ 2EQSA 2UUAL 4DV4Q 1MJCA 4YHHL 3RR5A 4JI4Q 3U50C 3S16H 2VL6A 4YY3L 4A3LH 2OWOA 4OX9Q 2OTJA 2WB1E 1A62A 2AHOB 3GO5A 3HOWG 2A1AA 5ELNA 1E7ZA 2IX0A 3K8AA 1XPUA 1Y1WH 2IX1A 3JAMi 1VQOA 3A5ZB 3STBD 3VDYA 3PGZA 3G4SA 3CD6A 1GO3E 2NZOA 1UE7A 2GN5A 4K0KQ 5JEAG 2NN6I 4OWTB 1UE6A 4C3HH 1VQGA 2I5MX 1S40A 1QVCA 5GQOA 1OXVA 4BBRG 5IP9G 2NVQH 5LMNW 1SN8A 4OONA 4LUVA 4GKJL 4WJ3M 3KJOA 4LNQA 4A3EG 1JJ2A 1HJPA 1HZAA 3SGIA 3KF6A 3PUWA 1H95A 1E1TA 3J81j 5M3FG 1N32Q 3EIVA 2JJQA 1HR0W 1X54A 1YI2A 2JA5H 3M7NA 1IXRA 4B3MQ 4B3ML 3J81c 5C44H 4P71A 2R7ZH 4A3KG 2F3IA 1MIUA 1BBUA 2ALYB 4APVA 3K7UC 4DUZL 3T1HL 4JYAQ 4MZ9A 4JI1L 1XJVA 4DUYL 3F2CA 4BY1H 4HJ8A 3KFUA 2I5LX 2R7DA 4HIKA 2VQEL 4A75A 4PZ8A 4DK3C 5IYBH 3ERSX 3CMEA 4O0AA 1VQ7A 3E9HA 1Q82C 4JI6L 3S1QH 1W2BA 2MQHA 1YJNA 2RF4A 3EN2A 1C7YA 5C0XI 2LXKA 4AH6A 2CKZB 5HGQA 5IYDG 3NEMA 3CF5A 1R9TH 1QVGA 4DR7Q 5IY0A 1IBML 4NXML 1I6HH 3I4OA 4LF4L 4DR3Q 1N33Q 2ASBA 4NXNL 4JI1Q 4DR1Q 1AE3A 2HT1A 5C44G 3M85A 4LF6L 3AEVA 4TVAB 4YWMA 5IWAL 3RZOH 5IYDH 3FKIH 4JV5Q 2JE6I 2IT1A 2R93H 1AH9A 1PYBA 4BA2I 4BY7H 4KHPQ 5LMNL 4PMWA 2UU9Q 2YTVA 4GNXA 3CXCA 3PIOA 1Q7YC 3A74A 1IBLQ 4IPCA 1FGUA 4PZ6A 3A5UA 3ULJA 1E24A 1VQ6A 1GD7A 3HKZG 3TRZA 2DGYA 1XNRL 2Q2UA 2I5HA 3S1RH 1Y1VH 5K36G 1HZCA 1L1OC 1WCMG 3AFPA 3H0GG 1G51A 4KLKA 2HHHL 2F52A 3F8TA 2UUBL 1IBMQ 3S14H 4DV3L 1NMGA 1P16A 3KJPA 2UUBQ 1YIJA 2K50A 1HNZQ 3HOUG 3K0XA 4JI8Q 3UDFA 1HR0L 2Z6KC 4YWLA 4QY7A 3AYHB 4A3MH 2NVTH 2JA5G 1QZHA 3FHWA 2AWOA 3GTJH 4A3BG 1YJ9A 3K7AH 1X3GA 3K80C 4IFDI 2PMZE 3RN2A 2ZJQA 2WAQG 4DKAC 5J3BA 2Z0SA 2RCNA 4A3EH 1JB7A 2E5LQ 1KRSA 2MO1A 2NVYH 4B3TL 1V1QA 1N36L 1J5EQ 1N34Q 3HOUH 2UUAQ 2HIVA 3ICEA 3A0JA 4HJAA 1VQMA 5IP9H 3H0GH 4X62Q 1VQIA 3I55A 3L2PA 3U58A 3RZDH 3HOWH 4JV5L 2BH2A 1X3FA 1PH8A 1XMOQ 3U4VA 1KQSA 3TEHB 3M4QA 3GTPH 4BY1G 4LF7L 3I4MH 4JOIA 4LWCA 1N34L 3J80c 4B3TQ
chains in the Genus database with same CATH superfamily
3MVVA 1O7YA 5T1GA 5IYCH 5BR8L 1YHBA 3GTPB 4KY6A 1STEA 4DV1L 1EQQA 4ALPA 3E6ZX 1T5XD 3S2HH 4RCNA 3MXNA 2B8FA 1PHJA 4G4KA 2XNAC 2N49A 3F2BA 1B50A 1CZWA 1VQFA 3FKIB 4NPSA 2PNRC 1E1OA 3CCLA 4DR6L 2F0GA 5FLMG 2ZTDA 2R92G 3KLWA 3E0JA 3HS0C 1I6HB 1U4RA 4FYDA 4GKJQ 1JQYD 2KHIA 1J5EL 1SYEA 2PI2A 4C3JG 4JBJA 2F0SA 2Z4HA 2XVSA 1LO5D 3KOJA 3SE0A 4X66Q 1HNWQ 4JI0Q 4GKKQ 4DAPA 3JAMc 1F9SA 3NXWA 3EROA 1GOZA 3I4NH 4K5XA 5DM73 2RHSB 3HOYH 2CVRA 3PUVA 3T1YQ 2QEJC 4XT1B 2B2TC 2UXDQ 4A3BH 4JI0L 5M3FB 3CRKC 1ZYRD 4YY3Q 4HIOA 3D3RA 3HOZG 1EWHA 2DNEA 1S3OA 4P75A 4LFAQ 4KD4A 2B2UA 1Y8OB 4WJ4A 1NBWA 1HH2P 4L5TA 1L1OB 1RF2D 1SYCA 3KBXA 3NBIA 3BDCA 3LX0A 2UXBQ 4X3KA 2RDFA 4PQXA 3U4ZA 5EPKA 4DAVA 1PFNA 2OXPA 3M4OB 4DN4M 1Q12A 5ELCA 4EQ5A 5JVG3 1TWHB 5IP7G 1ONLA 4MTNA 2BOSA 4LF4Q 1RL2A 3HZXA 2XTIA 2HDLA 4RWSC 1KRTA 4C3IG 1VDZA 1XPRA 3GTQH 2B63B 5IGEA 2N78A 2CW0D 4IFDG 4XIGS 1W6KA 3KYHC 1F9RA 3TMEA 4C3JB 4YWKA 2D62A 1SNPA 2DNCA 2WAQE 5FKAC 4JI2Q 3GTMH 3F2UA 2ATWA 3A8IE 4BBSH 1X9NA 1F77A 2Q8RE 3I4MG 4FF1A 5IT9c 2EXZA 4X3UA 4DV0L 1OO9B 3HP3A 1MI2A 4UAIA 2PNHA 4BWGB 2BE5D 2HCIA 1XNQL 1ZXTA 2UXCL 2PCFB 4HCEA 2F4IA 4DV2L 5D3IB 2N8NA 1XPOA 1PYWD 4ME3A 2KEEA 1PA6A 1A6XA 1JOKA 1S5DD 1Q90A 1CKNB 2QA4A 2LS01 3K58A 4LF7Q 1UAPA 1GUGA 1Z47A 3D0FA 2L11A 2V4DA 4RAUC 1B9NA 1YJWA 3MEFA 4OHJA 4HIMA 1WOCA 4IFDJ 1XX8A 1HZ9A 5CV4A 3OTOL 1ESFA 5J39A 1Q86C 4JC0A 2MNAA 3IFDA 5A35A 4DV0Q 3HOXG 4DR5L 3FPUB 1A63A 5DEHA 5JPMC 5IOCA 2L15A 2E5LL 2E2IB 1YVCA 1JB3A 4K8JA 2LY7A 3EVQA 5IT9E 2L1BA 4AQYQ 4JBKA 3KF8B 2AQ1B 1OXTA 3H0GB 2B39A 4V190 4UDUC 1KLGD 1Q81C 2FFKB 1K83H 1IL2A 1JC7A 4OO1G 1FJGL 1RJTA 2QGQA 3WWVA 2KA7A 4JI3Q 2FXQA 4RGTA 4LF9Q 4R1JA 1V1OA 1PH1A 3ITPA 2IHEA 2OT2A 3UE1A 3DEPA 5IYBG 4DV6L 3H15A 4ZAIA 2K5DA 1A0IA 2JA7B 2H4OA 3CC7A 1JJGA 2B3GA 4BY7B 2VS1A 4GOPB 4JVZA 3O13A 4ZUIA 2NB0A 4X64Q 2FHTA 5F2DA 3C46A 4BXXH 4KHZA 5E7NA 5M3MG 3VA7A 3K7AB 1TY0A 2JA9A 2QEXA 1FYCA 4EX5A 1PMRA 3RN5A 1QUQA 5C4XG 4DAYA 3C1EA 1VQAA 3NHHA 1Y1WB 2XGTA 3OOCA 3IAYA 1D7QA 4A3GB 1Q8KA 4BBRH 2F0MA 2IY5B 5IGCA 4A3GH 1F2MA 4L6TB 1SJHD 3D31A 1PRTB 1XTDA 3K6OA 2LXJA 2Z6BA 3RLOA 1VQ5A 3DWQA 3CAMA 5LL6S 3NELA 1YNXA 5M5YH 5LMUL 5JEAH 2RA4A 3AQQA 3RMHA 3HOYG 1LTAD 4FF3A 2ES2A 4ULLA 2JA8H 5GAHC 2OQ0A 1AW7A 4DPGA 5CYUA 2K1BA 2EIFA 2IWHA 3R3OA 4BBSG 1EY5A 4RGOS 3W3AA 2WB1G 2K5QA 4BA1I 4K2LA 5BN5A 2Z6KA 2ZJRA 3UDIA 4LUOA 4MHEA 5C4XB 3K5OA 1EIYB 1EWCA 4R4QA 2FMMA 4KN4C 4A93H 2ZT9C 2QF7A 1VQKA 2GA4B 2A8VA 3TREA 2R92B 5M3MB 5KRUA 5IGBA 5IYCG 1F2YA 5M3MH 1PZJD 1X3PA 5EBDA 1GXDC 4RGNA 4XQNA 2RSOA 3VA5A 1WTOA 1XMQQ 4DR4Q 2KQ3A 4F7XA 1A8VA 1A3TA 2FINB 5GAEC 4HCSA 3T53B 1HCZA 1NNXA 2CQOA 1QB5D 1LTLA 2OCEA 1D2BA 3ER0A 3TZUA 1QCBD 1EZ6A 2KHJA 4J15A 3TSSA 4IUPA 4JW0A 1PVOA 1TT2A 3PF5A 1X3QA 1SE8A 4HJ7A 2C35B 4J8QA 5CORA 3BJUA 4H13C 4ZRZA 3PCOB 2EQSA 2Z4IA 4DV4Q 3S16B 4JI4Q 3S16H 1XYIA 4PNYA 2OWOA 2WB1E 1Y8NB 1KNEA 3I8ZA 5ELNA 2KHSA 3LNNA 3Q0AA 4N8FA 3VDYA 1SXTA 5KIXA 3CD6A 3H91A 1ENAA 3FEWX 2GN5A 1KLUD 4OWTB 1UE6A 1EQVA 4C3HH 1VQGA 3GTGB 4A3IB 4WJ3M 3KJOA 1HZAA 3IKJA 1LT3D 3KF6A 3NTKA 3R2TA 3J7AF 2A73B 1PTOB 2JJQA 2JA5H 3I91A 2EJFC 2FMCA 4ZCKA 1HQMC 2WKDA 4A3KG 1JOQA 2F3IA 2EYMA 1BBUA 4QB4A 4APVA 2EY6A 4C56C 3KFUA 4DUYL 1B4OA 4A75A 1BO0A 3E9HA 3KLRA 2JA6B 4CHTB 1W2BA 5CV8A 4CDDC 3EN2A 2LXKA 5IYDG 3NEMA 5HGTA 3Q22A 1QVGA 3VYRA 2KJXA 2L4NA 4FP5D 5I9OA 5C44G 4YWMA 5J1ZA 1I50B 1AH9A 5LMNL 5FLXE 5KEEA 2YTVA 3J81E 1QOHA 1CI3M 4NKLA 1BCPD 4ZUJA 4ME5A 1WTRA 4C1NK 2XWJB 2JN4A 3HOUB 2JSOA 1SJED 1XNRL 1RDPD 1ILQA 1Y1VH 4EQOA 3OSOA 4KKTA 2R3ZA 5K36G 1HZCA 3H0GG 4KLKA 3F8TA 2UUBL 1VMPA 3J80E 1NMGA 3LWUA 1IYVA 1EU3A 1XTCD 3UDFA 1HR0L 4YWLA 1CA6A 2NVTH 3NWTA 1DD2A 4FF2A 2JA5G 1FNUA 4RCOA 3HOXB 1X3GA 3RN2A 2WKCA 1LV9A 2ZJQA 4DKAC 2Z0SA 4CDFC 3M4YA 2NVQB 1DONA 1EIHA 1V1QA 1N34Q 4C3HB 1I4QA 4CGYB 1B9MA 1NCVA 4HJAA 5IP9H 1EY4A 3L2PA 3HOWH 4ZK9B 4Y7NB 4Q5VA 1XMOQ 4Z9CB 1Y8PB 1EOTA 4BY1G 4LF7L 1STBA 4JOIA 3I4MH 2PZTA 4YIJA 3S15B 3TQYA 2N3SA 4L5RC 1B3QA 3R2IA 3NSWA 4EVOA 1PH5A 4UP7A 3V2TA 3L7ZC 4OO1H 3NBHB 1F2LA 1I50H 1F9QA 2ZM6Q 1K0RA 1PRTF 3MAQA 1XMOL 1YZ6A 2KENA 2MUYA 4DK1A 5LMNQ 4TQUS 1G2TA 1CA5A 3I7FA 1KTKA 1QILA 1KAWA 2F0VA 3S1QB 2SOBA 4ILWA 3A8KE 3T13A 3CCVA 5J22A 2K33A 2CCZA 3NK9A 4C2MH 3J81i 1WI5A 3CCQA 5T1IA 3E9IA 4XYOA 2YYZA 2F3WA 1TS2A 4GLVB 1TWFB 5M5XH 4JYAL 3NTIA 5AJ3Q 1TWHH 1UWVA 3I73A 5NUCA 2EE1A 1WTQA 4LF5Q 3OIPA 2O5JC 3PV0A 3X3MA 3S1RB 1ASZA 3J7YW 3CPWA 2YTXA 3TP7A 2YU9B 2Q2HA 4F8MA 1H9SA 3I4NG 1WYDA 3FDTA 1X6OA 5CGKA 1K0SA 2E76C 3TDQA 2L9HA 1FD7D 3CCUA 3CPFA 2E8GA 3QO2A 1I6VC 2MP1A 4HN7A 3FMCA 3P7JA 3OYYA 4OWXB 3OWEB 1Z6HA 3FRPB 4DA2A 2E2JH 3HOVB 4G7OC 1BDOA 3MEHA 3QOLA 1Y1VG 5IGGA 1IW7C 2VUMH 4X3TA 5I6WA 1SFOH 5EPLA 3CCEA 1K3RA 5GAGC 1HR0Q 4X66L 1HNWL 3I90A 3W5OA 4IURA 2J4XA 2SEBD 2PQAA 1TWCH 4DK6C 2VZAA 4K8IA 4AYBE 4I65A 2QW7A 2B63H 4K5VA 1PH6A 2OQKA 4FXDA 2A6HC 4A3DB 4LFCL 1N8RC 1I94L 3OWFA 2HD3A 2JA6G 4X62L 3S1MB 2JA7G 5JJIA 4OXPA 5FO8B 4OX9L 1TKWB 1QWYA 2I46A 3EJIA 1JWSD 4JBMA 3WDNA 3J80L 5FLXc 5GROA 1C9OA 2Y0SG 1B8AA 3HKSA 4KI0A 3NTHA 2K5NA 1NJIC 1I94Q 4LFCQ 1NTGA 1K73C 1EOVA 4LF5L 2K03A 1SMYD 1R9TB 4EGVA 3HOZB 5CV5A 3A54A 4FNFA 3GTLH 1PFSA 1VQBA 3PSIA 4A4IA 3J81L 2JK8A 2YV5A 1CHQD 1I3QH 4DUYQ 1CSQA 2E2HH 4XT3B 1B70B 2A6EC 1A15A 4Y7NH 2Q2TA 4DR5Q 3MWYW 1VQPA 4POGA 4BS9A 3GTOB 3A7AB 1N36Q 1QJOA 1WCMH 3EQLC 5JPNC 2Y0SE 3CHBD 4LF6Q 5C4ZA 1SRUA 1PYSB 5CR3A 3GV3A 4POFA 5K36H 4DV5L 5C4HA 3CQZH 2JA7H 2HUGA 5CV9A 3QOJA 2JEBI 3TBIB 4L5QA 3LGJA 4DV3Q 1E2WA 4JI5L 1JMCA 4ZKCB 1XNRQ 2D0OA 3T16A 5IGFA 4B3RL 1D5ZC 1G8ZD 3AMUA 3PO2B 3BU2A 2B29A 3CP0A 3IRBA 5IE8A 4R4IA 3SDZA 5ISRA 2G9DA 5IODA 4FDBA 1VF7A 4XTCS 2K5HA 1UEBA 4OIKA 3OTOQ 5BN3A 4C3IH 5C6AA 3HRZC 3DHQA 4DR7L 1C0AA 4DU9A 3MXNB 2O2LD 2F0JA 3VR3A 2QILA 1I4XA 1E3PA 2WP8J 1K8GA 3KK7A 1IBKQ 1UUPA 3EFXD 4C1NI 1MHWC 1JE5A 2B2VA 1FGBD 4DAMA 1EQTA 3DM3A 3CCSA 2H5XA 2O4XA 1VQ9A 1VQ4A 2E2IH 3BDOA 4DUZQ 4G7ZC 2BA1A 3FVQA 1JCKB 2WIIB 1K3BC 2EY1A 2R7FA 5G3LF 1LT5D 1SSOA 3CC2A 2OEOA 1LT6D 1HFNA 4GLXA 3HOVG 3S14B 3J80i 4A3IG 4DNIA 4LF9L 1FL0A 2QKIC 4UHVA 1AEXA 1K83B 5EBCA 3A56A 1IBLL 1AZQA 3RLNA 1HA5A 2UXDL 4K0KL 1X32A 4R4CA 3PUZA 3PIPA 2DJGC 3GTGH 1XXGA 1BBXC 4GN4B 5EPJA 2BE5C 4NXMQ 2WFWA 2KCNA 3B6YA 5A2QL 1KDCA 3STBC 1X56A 1LTGD 4K14A 4HIDA 3A55A 3I3CA 3DMUA 3BS1A 4BY7G 1N32L 1GUSA 2BH8A 1A3VA 5LMUQ 1YBYA 1HNXL 3KDFB 4GLAC 5M5WH 2CH4W 3D4RA 1KC8C 2EYHA 1R4QB 4MN3A 4X6AH 3D4DA 2M9VA 2Z8LA 1SMXA 4CKBA 2A6ED 1PZKD 1DGSA 3CQZB 4FXKC 1D1IA 5D65A 5FOBB 1B2TA 4KHPL 2ENBA 1Z7TA 2EDGA 3H3VH 2GVBA 3HKZE 4UY8C 2A68C 1JE4A 2VY3A 4JOIC 3UDXA 1KD1C 4X3SA 2MPMA 1X3EA 1YHQA 5CBAE 5AFWA 1TS3A 1WJJA 1R4PB 2EYOA 2LSSA 2D5DA 2PZWA 2R93G 1CK1A 1RIPA 4PG3A 2K14A 2ZJPA 1KIXA 2RBMA 2XRQD 5IP7H 1U5KA 3S17H 2F0PA 2ZTEA 2UUAL 2VL6A 4R9WA 2XN9C 2E74C 2VXWA 1A62A 3GO5A 3HOWG 2A1AA 1S5ED 1E7ZA 2Q8TA 2IX1A 1Y1VB 3JAMi 3TP8A 1VQOA 3A5ZB 3VYSA 1NR4A 4B9WA 1ENFA 1GO3E 4HR7B 1ML0D 5JEAG 3Q6SA 2A69C 5CC4A 2B2YA 3E5SA 2MGSA 2WACA 1QVCA 3X3NA 2JXMB 1V1PA 2NVQH 4LUVA 1PZID 2IPKD 3LWEA 1KDAA 3NQIA 1E1TA 4L63B 2HQEA 3MTSA 1BCPB 2F0EA 2HDMA 3EIVA 3S2HB 3KLSA 1X54A 4KJOA 1YI2A 1YNJD 4B3ML 2R7ZH 5C44H 2XWBB 3IFTA 3SEBA 1SFOB 3K7UC 4DUZL 2R61A 4JYAQ 5IGDA 1XJVA 3H3VC 5EJWA 2I5LX 4A93B 1TIID 2VQEL 2ICIA 4DK3C 4O0AA 1VQ7A 1GHJA 4JI6L 3S1QH 5EKKA 2MQHA 2RF4A 2QDLA 2ASBA 3S15H 1CHPD 5IY0A 1IBML 5KNDA 4NXML 4OGQC 3MFGA 4LF4L 1STYA 5C3XA 1AE3A 4P2CB 4LF6L 3AEVA 2NWGA 4TVAB 3RZOH 2JE6I 2R93H 1G91A 3PIOA 3DUZA 3A74A 1IBLQ 2L55A 4IPCA 3C3LA 3ULJA 4KD3A 3TRZA 2DGYA 2I5HA 1JR0D 4G57A 4KJNA 2K28A 1G51A 4HTHA 2HHHL 3SK4A 3S14H 2EYFA 4DV3L 1ILPA 1D1KA 1EU4A 1HNZQ 5DM63 1TR5A 4DNRB 3IL8A 3L3OC 3NP8A 2AWOA 4A3BG 1YJ9A 3K7AH 1SNMA 2EPBA 3KBGA 2WAQG 1SYBA 2RCNA 3TP5A 4ZLTF 2E5LQ 3RZDB 1N36L 1GUWA 4PMBA 4J6HA 1BXTA 1VQMA 2K7VA 1VQIA 4GZYC 4N8X1 4CJ2C 5KYIA 2PPBC 1SMYC 4CDEC 3TEHB 3GTPH 2XSCA 1PTOF 3ERQA 3MXGA 1UNSA 3P1HA 4LWCA 3J80c 3H3VI 2KEDA 3OMCA 4LJZC 4A3KH 4R4TA 4OIJA 1LTRD 4DV2Q 2TMPA 3CCRA 1KAAA 3DEOA 1SLJA 2KCTA 4DV1Q 1TY2A 2RHQB 1JT8A 1N9WA 1PFMA 1RCVD 4NP5A 3MZ5A 1OXUA 3KF8A 4ODGA 4IOCA 3E0EA 3SVMA 1BKBA 1HFGA 2G5DA 3ZJYC 5CV7A 1D5XC 4CDCC 4RHSA 1ESRA 1PRTD 1NE3A 4UP9A 3UDGA 3TS0A 4N9PA 1JWUD 3S2DH 2RKSA 3T51B 4JI2L 2WV6D 4DR1L 4NXNQ 4HMIA 5FJ8G 1LABA 1U0LA 5H1SE 3GTKB 1OTCA 3H94A 4A3BB 1WTHA 4IPHA 4QIWE 3S1NH 2WAQB 2A19A 4KKSA 1J9OA 2F03A 4H7BA 1HZBA 2K05A 2X69A 3GQBA 4A3DH 2Q2IA 3GV6A 1I3QB 2EJMA 5COYA 3HOZH 4IUUA 3PQIA 3BVZA 1I4HA 5I2YA 4JI4L 3GTLB 5C4XH 1PH7A 3M4PA 1RD9D 4X65L 1D5MC 2XRSD 4DAYB 3FPPA 1TWAH 4OO1I 1ASYA 2KCCA 4R4OA 4O2DA 3UI2A 3TS2A 3QB3A 1HUNA 1WFQA 2K32A 1W3SA 4A3IH 1VQDA 1EEID 3K5LA 3GTJB 1KDBA 4QL5A 3TN2A 5EKIA 4LF8Q 3W1GA 3MHBA 4GNXB 4JI7L 4LF8L 4JI5Q 1SBBB 1TVXA 5A2QE 3N52A 2ZXPA 1AZPA 2IL8A 3PMFA 1GJXA 4Y52H 5FLMH 2RDGA 4A3FH 4JK1C 1L0YB 1LYLA 2EYLA 4IUTA 1C4QA 2VUMG 3MXUA 3KUPA 2EYJA 4F87A 1SE2A 1M8AA 2K52A 1KABA 3QJYA 1EWIA 5C5LA 5HURA 1V8QA 4IO9A 4IJLA 3OW7A 2R7ZG 3DXJC 1GM5A 1TS4A 3P20A 4B3RQ 4ZYSA 1VQEA 3HGBA 2I07B 4G7HC 5JJLA 3KDFA 5DLQE 3ONAB 2KBNA 1E0BA 1DXMA 2SDFA 1GHKA 2NN6H 4KMUC 2YTYA 1GUOA 2PI2E 4P72A 1VQCA 1EUJA 4BBRB 5JJKA 1IZ6A 4RFBA 3S24A 2JQOA 3A7LA 2B63G 5ELEA 2MO0A 1VCIA 5C3WA 1VQNA 3G7LA 3HOUH 2EJGC 5C0XG 1CKNA 1NUCA 1YITA 2JA5B 2AMCB 1BF4A 1C48A 4RKLA 2LMCB 3OHXC 3G6EA 4DV4L 2J0TD 2KOLA 5TSSA 3VYTA 3KF6B 1LTTD 3PO3H 2A5HA 2CW0C 3EBEA 1CM9A 4OWWB 2EXDA 5KGUA 4LFBQ 1JORA 5C4JB 2K4KA 1SE3A 3F1ZA 2JA8B 4L8JA 2F0HA 4J1MA 3S1MH 3F2DA 1H9JA 2D0PA 2VQEQ 4KN7C 4A3JH 1PH3A 4KHVA 1LACA 3OMGA 1BVSA 1L2FA 4DR4L 4GN5A 3VR2A 1VQJA 3G71A 2Y0SB 1EY6A 4A3CH 2F0KA 1I4GA 2C5CA 2NN6G 5C0XJ 5IWAQ 4A3DG 4ID6A 1Z9FA 2UUCQ 3HFZB 3J7A5 4ZKBB 1BUVT 1SYGA 1MBYA 4OELB 1OXXK 1SNCA 2B2VC 4RH6A 3C1FA 4QGUA 2E75C 1S5CD 2JYOA 1HNZL 4AYBG 4GN3B 1QG7A 1TWGB 1K9MC 3NPPA 4A93G 4BBSB 1YEZA 2VW9A 2OF1A 1CKMA 5LL6X 3K81C 1JJCB 1HHVA 2RVLA 2NVXH 1VS0A 4IQZA 4ABNA 3NENA 1RHPA 5L37A 4NDXA 1NMFA 2A68D 3HG9A 3G48A 5IT9L 2MFIA 4FXGC 2H1EA 1B3AA 2Z1CA 1NSNS 2G9HD 3CRLC 1NY4A 1O80A 4A76A 3NUCA 1JOOA 1SROA 2NZHA 1F2ZA 2KUMA 2A6HD 5D14A 1STGA 2CH4A 1PH2A 2VQFQ 2JEAI 1EY0A 3R93A 2RDHA 3Q23A 3M3YH 1AE2A 1EY8A 4F88A 5JAVA 5C3EG 1ENCA 2J7ZA 3BVGA 1WTPA 2GVAA 1K8AC 1VQ8A 5CBEE 1G291 5EGTA 4DGZA 3ULPA 3AB9A 5FO7B 2VQFL 3PIO3 2N55A 4PZ7A 4GNXC 1RKNA 1DOMA 3QWNA 1RODA 1I4RA 3T4AC 1TWFH 5M5XB 4X64L 1HNXQ 2HIXA 4DR2L 2ICEC 4BXXG 1FVIA 3V05A 3NWSA 1Q3LA 2TSSA 3M4OH 4JI3L 2CHBD 4TKOB 2IX3A 2PQAB 4GOPA 3GDEA 3K59A 2HCCA 3K0YA 1Q1BA 1TWGH 2UXCQ 2I0QA 2UXBL 4HJ5A 4A3EB 2SNMA 1GUTA 3JAME 2X6LA 1STHA 5M3FH 1FNVA 2CFMA 4K6DA 1RTOA 3WOFA 2F4VQ 1L0XB 3T1HQ 3VYUA 3VR6A 1MJCA 4M1UB 4DNTB 2BDNA 2LKVA 3RR5A 3U50C 4YY3L 1AFPA 4A3LH 3SR1A 2F0IA 2OTJA 3MC0B 1XWEA 5ELBA 1W6JA 3K8AA 1Y1WH 4QIWB 3STBD 2CQAA 3PGZA 3G4SA 4CKCA 2F3VA 1HTLD 3NQTA 1Q8IA 1HPCA 2L0CA 2PW5A 2I5MX 1S40A 5G3LD 1OXVA 1SN8A 2RSNA 4GKJL 4LNQA 3U9SA 4A3EG 1JJ2A 3SGIA 1UEAB 3PUWA 5JOBA 3OPOA 1N32Q 4WRDA 1J8IA 1DZ1A 3SK5A 4B3MQ 3J81c 4P71A 2K5WA 2ALYB 2L12A 4DXFA 1BNZA 5FK9C 4HSVA 1NAPA 4MZ9A 4JI1L 3F2CA 4BY1H 4HJ8A 1DOKA 1T5EA 4IALA 1STAA 3ERSX 1SNQA 1YNNC 2PO4A 3OIQA 3CMEA 1Q82C 3D8GA 4HAEA 1YJNA 1G6ZA 5HGQA 4E6IA 1R9TH 1F9PA 2B2TA 1I6HH 4I7ZC 2A74C 5JVH3 4DR3Q 1N33Q 4IFDH 4JI1Q 2PW7A 4R8IA 1EIGA 5IYDH 5IIFA 1II3A 4O1NA 5C3EB 4JV5Q 2IT1A 1PYBA 4BY7H 2B2UC 1C8CA 2UU9Q 4PMWA 2AQ2B 3RD4A 4GNXA 2RQXA 3E3XA 3PIP3 1H9RA 1FGUA 4PZ6A 1SEBD 4DFAA 3M3YB 4FVMA 3ND8A 1VQ6A 1GD7A 3HKZG 3HOYB 1U4PA 4XQJA 3S1RH 4U68A 1HTPA 4C2MB 1PRTC 1L1OC 1WCMG 2F52A 1IBMQ 1M4VA 2MHVA 2P5ZX 2XIWA 3KJPA 2UUBQ 2K50A 1D6EC 3HOUG 4U673 2JP1A 3K0XA 4JI8Q 3I4LA 2Z6KC 4V0BA 4QY7A 1PTOC 4A3MH 1KNAA 4DF7A 1ICWA 4KV6A 1YNJC 3I72A 3D6WA 2NVYB 4IFDI 3EA6A 2PMZE 2EZVA 4A3EH 1JB7A 2MO1A 1H9MA 1J5EQ 4DXGA 3K5NA 1MD2D 1DJRD 4X62Q 3RZDH 1YNND 3N6RA 2BH2A 1X3FA 1EYDA 2D2CC 1KQSA 4LAAA 4XXEA 3T56B 1FNWA 1N34L 2MJ8A 1VMCA 1BOSA 5M9OA 4B3SQ 2LFNA 1LTID 3FP9A 4JBWA 4YCVA 2R7ZB 3DWPA 1I4PA 2DUDA 1PTOH 1M90C 2R92H 1BCPC 1GKHA 3DLLA 1EL0A 3MA2B 1STNA 5KYLA 4HSPA 1XNQQ 3CMAA 2N88A 4AIMA 4A3CG 1TS5A 5EAYA 4K5WA 2A69D 5C3EH 1E22A 4AQYL 3U9OA 1YHAA 1D8LA 4KTAA 1IKLA 3NE5B 3BZCA 3VR5A 2UU9L 1MJEA 3ZYYX 2B2WC 2ID0A 3URYA 4GS3A 4L5SA 1EIFA 1WTVA 4JPBW 4DV7L 5E4WC 3NBHA 3J7ZC 2K04A 2C9OA 1BBWA 5AJ3L 1TXYA 1IKMA 4A3FB 4OL7A 1ET6A 4ZQ3A 3GTOH 2NVTB 1O78A 1S72A 2EYPA 1TQOA 2F0FA 2CWPA 1ET9A 4XDXA 5E1FA 4MIUA 1PH9A 4QCLA 1IBKL 4LW1A 1QVFA 1B7YB 4YHHQ 3M7GA 4IPGA 4MNOA 3OW2A 4JI6Q 4KY7A 4K6LA 3MXPA 1J6QA 1IYJB 4X65Q 2JA8G 4DR2Q 4R8NA 2F0OA 1LTBD 2VB2X 1WCMB 4QQBX 1TU2B 3BZDB 4NB3A 4EQPA 3Q8DA 3D6CA 4UP8A 1EYAA 2YU9H 1HQRD 4A3LG 3DWAA 5C5MA 1QZGA 2B2YC 3QIAA 2DN8A 3PUYA 1V1PB 2BCOA 4S3SA 3T1YL 4DR3L 1Y1WG 1QUQB 1N33L 2F0UA 2F0DA 3Q24A 1JICA 4DK0A 3GTQB 2BA0A 4JI8L 4AYBB 4IUVA 2HQLA 4RGMA 1XMQL 1RTNA 2KECA 3I2ZA 5C44B 1EFWA 1B1ZA 3PF4A 4DV5Q 4K2KA 4B08A 2HHHQ 1DOLA 3RNUA 4IPDA 5HY6A 1U9RA 1MGSA 2D9UA 1PTOD 3FKIG 4DR6Q 1U4LA 1I5FA 4OEMB 2PQEA 4CJ0B 2E2DC 1HUMA 4DV6Q 3PUXA 1PLFA 3WOEA 2F0LA 2KCMA 3R8BA 5KNCA 1PH4A 3RZOB 2PYKA 1LM0A 1IYUA 4NW2A 1A2UA 2K5VA 2EY2A 5FLXL 1SAPA 1A2TA 2SNSA 4HJ9A 2VB3X 3PO2H 4LUZA 4JI7Q 1X65A 1TWCB 1O7LA 2UUCL 4FO2A 4FF4A 4QJFA 2ZM6L 1BQQT 1UE5A 4A3JG 4HMJA 5JEAJ 2NBFA 1G6PA 3JC66 2F4VL 4H0LC 2F0WA 3SHLA 2F0TA 1MSHA 2NYZD 1LLRD 5I4DA 3HOVH 1WVLA 4WORA 3ULLA 5K5PA 4RG1A 2FJ2A 1CFMA 1SDFA 2DY8A 1ICFB 4LK1C 2F0NA 3BZKA 1EY9A 4LFBL 5M5YB 1K8OA 2L5TA 4JCVE 3J7AV 1KHIA 4IJHA 5D3DA 3BVMA 3HOXH 5JJZA 1SR3A 1CT1D 2AUKA 1EYGA 2X6GA 1CQVA 2EVBA 1MKHA 1E2VA 4O42A 3BG3A 3G6JB 2V1CC 5M5WB 1VQHA 3CU7A 2QCPX 2QDBA 3DM1A 5I2XA 2K01A 1V43A 4Q0FA 3V96A 2VUMB 3QG1A 3HEJA 3PO3G 3I4MB 3K57A 4QF4A 4LFAL 3GTKH 1EEFD 5LHY1 2F1MA 4H02A 3SK6A 3W2DA 4P74A 1FR3A 1HRJA 1LTSD 2EOTA 1AP0A 4C3IB 4MTKA 2IW3A 1L1OA 3GD7A 3L9AX 1O7ZA 1CUKA 2PZUA 4KY5A 3GTMB 4RKBA 1O7IA 2AUJD 2DJFC 3MFYA 1T9HA 2NTTA 4A3KB 3PO2G 1LT4D 4IUNA 1Y69U 1GUNA 5KNBA 3UE0A 1NR2A 2ZXOA 4IZ8A 3QR8A 3AFQA 2VNUD 1P8LA 2E2HB 4IOAA 5ELOA 3RLFA 1S5BD 4IUQA 1EFID 4TRDA 1DCZA 5C4JH 2ZTCA 3CCMA 4PV1C 3CW2C 1CZGA 1VQLA 1JWMD 3BYYB 1L0WA 4N9TA 1DYQA 2AWNA 4KK7A 2E2JB 2IHFA 5FO9B 3L0OA 2CWAA 4RMFA 3HOWB 1CKOA 1SNDA 1TWAB 4A3GG 1A3UA 1CSPA 2R6GA 3M9BA 2M2LA 3CCJA 1ZEQX 4M8AA 4P73A 1WD1A 1FJGQ 3CC4A 1EQRA 4DV7Q 1X55A 3JAML 1KL9A 4A3FG 1Q1EA 1CTMA 4GKKL 1OXSC 1IL8A 2EY5A 4JG2A 3I70A 4CBVA 1K8MA 4B9XA 1B53A 3ND9A 1QNUA 4YCUA 3H6MA 1EYCA 1G2SA 4C3JH 2IJ0A 5DAUA 1B44D 5BN4A 3BYTB 2Z9HA 2OTLA 4QUFA 4I7AA 2NVXB 1DM0B 2B8GA 5FJ8H 5EQ0A 3S2DB 1AN8A 4B3SL 1Q46A 1KXLA 1V9PA 3P75A 2AKWB 3BDLA 2RCFA 3W1BA 2K75A 5BR8Q 1LUZA 3I56A 5GADC 5DNFA 1HXYD 3K5MA 4GOPC 2JA6H 4YCWA 1PV4A 3GP7A 4A3MG 4UPAA 1M1KC 4BY1B 1UE1A 2Q8IB 5EKLA 1GVPA 4TSSA 1WTXA 1Y14B 4YHHL 1SYFA 4WFN3 4OX9Q 4C3HG 2NZ1D 3H09A 1S5FD 1H9SB 2AHOB 2O5IC 1EY7A 2ZXRA 2IX0A 1XPUA 3D4WA 5C0XH 3RUZA 2NZOA 1UE7A 4K0KQ 2K6AA 1SE4A 5E4XA 2NN6I 4NMZA 5CV6A 1MSGA 4QMGA 5GQOA 4BBRG 3C2PA 5IP9G 5LMNW 4OONA 5I9PA 2R93B 1K28A 4CJ1B 1CQFA 1HJPA 2AQ3B 1H95A 3HKZB 3J81j 5M3FG 1SNOA 4KKUA 1H9KA 1U4MA 1BCPF 1E2ZA 1HR0W 2F0QA 3M7NA 1IXRA 4IN3A 1MIUA 3KLSX 1IHZA 2NTSA 3T1HL 5CMDA 4RHRA 2R7DA 4HIKA 1ZKOA 4PZ8A 5IYBH 1C7YA 3AU7A 4AH6A 5C0XI 2CKZB 1PDQA 1WTWA 4DR7Q 3CF5A 2WINB 3TP6A 3I4OA 4NXNL 4DR1Q 3PO3B 2HT1A 3M85A 5IWAL 3FKIH 1PFBA 4XQQA 5E3FA 4XYQA 4BA2I 4KHPQ 3TZDA 2M00A 4PMCA 3CXCA 1Q7YC 1QNKA 1S4ZA 3A5UA 1E24A 1PXUA 1HA6A 1EZ8A 3CKIB 1IW7D 4LMQD 3I4NB 5ELDA 2Q2UA 4QUCA 3VR4A 1SYDA 3AFPA 1QE6A 1WD0A 1P16A 1YIJA 3S9WA 1VF5C 3S17B 3AYHB 3S1NB 4HEDA 3SK8A 4WJWA 2B2WA 1QZHA 3FHWA 3GTJH 4A3JB 3K80C 5I6YA 5ELFA 2KVMA 2DY7A 4H44C 5J3BA 2WB1B 1KRSA 2NVYH 3SXHA 4B3TL 4CKEA 4RA8A 2UUAQ 2HIVA 3ICEA 3A0JA 3H0GH 3I55A 4EQNA 2NUCA 3U58A 4A3MB 4JV5L 1ZYRC 1PH8A 3U4VA 2BDOA 3A8JE 3M4QA 1BR9A 4B3TQ 2PMZB
chains in the Genus database with same CATH topology
4B3SQ 3TQYA 3FP9A 4A3KH 4R4TA 5IYCH 2N3SA 5BR8L 4DV2Q 4JBWA 4YCVA 4L5RC 1YHBA 3CCRA 4DV1L 1EQQA 4ALPA 1SLJA 2KCTA 4DV1Q 2DUDA 1PH5A 3S2HH 1M90C 2R92H 2RHQB 4UP7A 1JT8A 1GKHA 1N9WA 3DLLA 1OXUA 1PHJA 4IOCA 3E0EA 1XNQQ 1BKBA 3CMAA 2N49A 4AIMA 4A3CG 3L7ZC 3NBHB 5EAYA 3ZJYC 3F2BA 1I50H 1VQFA 5C3EH 4NPSA 1E22A 1E1OA 4AQYL 2ZM6Q 1K0RA 1YHAA 3CCLA 1D8LA 4DR6L 1XMOL 5FLMG 3BZCA 1YZ6A 1NE3A 2KENA 2ZTDA 4UP9A 3KLWA 4TQUS 5LMNQ 3UDGA 2UU9L 3TS0A 1MJEA 2R92G 2ID0A 3S2DH 4GS3A 3I7FA 4L5SA 4GKJQ 1EIFA 2KHIA 4JI2L 1J5EL 2PI2A 4JBJA 4DR1L 1KAWA 4NXNQ 4DV7L 5FJ8G 3KOJA 1U0LA 4X66Q 3J7ZC 5H1SE 1HNWQ 1BBWA 5AJ3L 1OTCA 4JI0Q 1TXYA 3CCVA 4GKKQ 2CCZA 3JAMc 4IPHA 4C2MH 4QIWE 3J81i 1WI5A 3CCQA 3GTOH 2A19A 3S1NH 3E9IA 2YYZA 1S72A 1HZBA 4A3DH 3I4NH 2Q2IA 2RHSB 4GLVB 3HOYH 2CWPA 5M5XH 3PUVA 3T1YQ 1PH9A 4JYAL 3HOZH 2UXDQ 1IBKL 4LW1A 5AJ3Q 4JI0L 4A3BH 1TWHH 1UWVA 1QVFA 4YY3Q 4HIOA 1B7YB 4LF5Q 4YHHQ 4JI4L 4MNOA 4IPGA 5C4XH 3OW2A 3PV0A 1PH7A 3M4PA 4JI6Q 1ASZA 3HOZG 3CPWA 1J6QA 1IYJB 1S3OA 2YTXA 4P75A 4LFAQ 2Q2HA 4X65Q 4X65L 2JA8G 1NBWA 4DR2Q 4WJ4A 1HH2P 1WYDA 4L5TA 3I4NG 1X6OA 4DAYB 1TWAH 1L1OB 3CCUA 4QQBX 3CPFA 2E8GA 1ASYA 4R4OA 4OO1I 4NB3A 4O2DA 3TS2A 3Q8DA 3OYYA 4OWXB 4UP8A 2UXBQ 2YU9H 2E2JH 4A3LG 1WFQA 1W3SA 4A3IH 3U4ZA 1VQDA 1QZGA 1Q12A 4EQ5A 4QL5A 3PUYA 1Y1VG 5IP7G 3W1GA 3T1YL 4DR3L 1Y1WG 1QUQB 4MTNA 4LF8Q 1N33L 4LF4Q 1RL2A 4GNXB 4JI7L 4LF8L 2VUMH 4JI5Q 1SFOH 2BA0A 3CCEA 2XTIA 1K3RA 4JI8L 5GAGC 1HR0Q 2HQLA 4X66L 1HNWL 3W5OA 1XMQL 1KRTA 3I2ZA 1EFWA 1XPRA 3GTQH 4Y52H 5FLMH 2PQAA 4DV5Q 1TWCH 2N78A 2VZAA 4DK6C 4A3FH 4XIGS 3PF4A 4AYBE 2HHHQ 4IFDG 1LYLA 3KYHC 2B63H 3RNUA 3S15H 4YWKA 1PH6A 2D62A 4JI2Q 2WAQE 2OQKA 4IPDA 3GTMH 5HY6A 2ATWA 4LFCL 1N8RC 1I94L 2VUMG 2JA6G 4X62L 4BBSH 1X9NA 2JA7G 3FKIG 5JJIA 4DR6Q 4OXPA 3I4MG 1I5FA 4OX9L 5IT9c 4DV0L 2K52A 2PNHA 4JBMA 4DV6Q 5FLXc 5GROA 3PUXA 1C9OA 2Y0SG 1EWIA 1B8AA 3HKSA 4KI0A 2KCMA 4IJLA 4IO9A 2K5NA 1XNQL 1PH4A 2UXCL 1NJIC 1I94Q 4LFCQ 2R7ZG 1LM0A 1NTGA 1GM5A 4DV2L 1K73C 2N8NA 1XPOA 1VQEA 4B3RQ 4ME3A 1PA6A 1EOVA 4LF5L 2K5VA 5JJLA 3KDFA 5DLQE 1CKNB 2KBNA 2QA4A 4LF7Q 1Z47A 3D0FA 2YTYA 4HJ9A 3GTLH 1PFSA 1VQBA 2PI2E 3PSIA 4P72A 4A4IA 1VQCA 1EUJA 4LUZA 3PO2H 5JJKA 1IZ6A 2JK8A 3MEFA 3S24A 2YV5A 2JQOA 1YJWA 4JI7Q 1X65A 4HIMA 1WOCA 1I3QH 4IFDJ 2B63G 3OTOL 1HZ9A 4DUYQ 2MO0A 2UUCL 1CSQA 1VCIA 2E2HH 4QJFA 1Q86C 2ZM6L 1B70B 4JC0A 2MNAA 1VQNA 2Q2TA 1UE5A 4Y7NH 5C0XG 4DR5L 4DV0Q 1CKNA 3HOXG 4DR5Q 4A3JG 1VQPA 1YITA 4POGA 1A63A 5JEAJ 2AMCB 1N36Q 1G6PA 2L15A 3JC66 2E5LL 2F4VL 1WCMH 1YVCA 2Y0SE 3G6EA 4DV4L 4LF6Q 1SRUA 3KF6B 1PYSB 4AQYQ 4JBKA 3HOVH 3PO3H 3KF8B 3ULLA 4POFA 1OXTA 4RG1A 4DV5L 3CQZH 3EBEA 2JA7H 4OWWB 2EXDA 1Q81C 4LFBL 4LFBQ 1K83H 3BZKA 2JEBI 2K4KA 3HOVG 4L5QA 3LGJA 3F1ZA 4DV3Q 1IL2A 4OO1G 1FJGL 3S1MH 4JCVE 4JI5L 3F2DA 1KHIA 2D0PA 4IJHA 1JMCA 2VQEQ 3HOXH 4A3JH 2QGQA 1PH3A 1SR3A 1XNRQ 2D0OA 3WWVA 1EYGA 4B3RL 1BVSA 1L2FA 1MKHA 4JI3Q 2FXQA 4GN5A 4DR4L 4LF9Q 3BU2A 2B29A 3CP0A 4R1JA 3IRBA 1PH1A 1VQJA 3G71A 5IE8A 4R4IA 2IHEA 3UE1A 5IYBG 4DV6L 2V1CC 3H15A 1VQHA 4A3CH 4FDBA 4XTCS 1V43A 2NN6G 5C0XJ 5IWAQ 4A3DG 2K5HA 1A0IA 1Z9FA 1UEBA 3OTOQ 2UUCQ 3PO3G 3CC7A 3HFZB 4C3IH 3J7A5 1JJGA 2B3GA 2VS1A 4LFAL 4GOPB 1OXXK 3GTKH 4X64Q 4QGUA 4DR7L 1C0AA 3MXNB 4H02A 4BXXH 4KHZA 5E7NA 1HNZL 5M3MG 1E3PA 4P74A 2WP8J 4AYBG 1K8GA 2JA9A 4GN3B 2QEXA 1IBKQ 4EX5A 1K9MC 1L1OA 3GD7A 4A93G 1JE5A 1YEZA 2VW9A 1CUKA 3RN5A 1CKMA 1QUQA 4DAMA 3DM3A 5C4XG 3CCSA 1VQAA 2H5XA 3K81C 1JJCB 1O7IA 2XGTA 1VS0A 2NVXH 1T9HA 1VQ9A 1VQ4A 2E2IH 3NENA 4DUZQ 3PO2G 1D7QA 1Q8KA 2BA1A 1NMFA 4BBRH 2IY5B 4A3GH 2R7FA 3UE0A 3CC2A 3AFQA 3D31A 3G48A 1XTDA 2MFIA 2VNUD 1P8LA 4GLXA 4IOAA 5ELOA 3RLFA 3J80i 2LXJA 4A3IG 1VQ5A 3RLOA 4DNIA 4LF9L 1NY4A 4A76A 1FL0A 1SROA 3CAMA 3NELA 2NZHA 1YNXA 2ZTCA 5M5YH 5C4JH 3CCMA 5LMUL 3CW2C 3AQQA 1VQLA 1IBLL 3HOYG 1L0WA 3RLNA 2AWNA 1PH2A 2UXDL 2ES2A 4K0KL 4R4CA 2VQFQ 2IHFA 5GAHC 2OQ0A 2JA8H 4DPGA 3PUZA 3L0OA 3PIPA 2JEAI 3M3YH 3GTGH 3H3VI 2CWAA 4RMFA 1AE2A 2EIFA 1CKOA 4GN4B 4BBSG 4A3GG 5C3EG 1K8AC 1CSPA 2GVAA 2R6GA 2WB1G 3M9BA 2WFWA 4BA1I 1VQ8A 4NXMQ 3CCJA 1FJGQ 3B6YA 2Z6KA 4P73A 2ZJRA 1G291 3ULPA 3UDIA 3CC4A 4LUOA 1EQRA 4DV7Q 3STBC 2VQFL 1X55A 1X56A 1KL9A 4A3FG 4HIDA 1Q1EA 4PZ7A 4R4QA 1EIYB 4GNXC 4GKKL 1OXSC 4JG2A 4A93H 4BY7G 1N32L 2BH8A 1VQKA 1TWFH 5LMUQ 1YBYA 3TREA 4X64L 1HNXQ 1HNXL 2A8VA 5IYCG 5M3MH 3KDFB 2HIXA 4YCUA 4DR2L 4GLAC 5M5WH 4BXXG 1FVIA 4C3JH 1KC8C 4X6AH 1XMQQ 1SMXA 3M4OH 2OTLA 1DGSA 4JI3L 4DR4Q 1A8VA 4KHPL 5GAEC 2PQAB 4GOPA 5FJ8H 3H3VH 2GVBA 3HKZE 3GDEA 2CQOA 1LTLA 4UY8C 1Q1BA 2VY3A 2OCEA 4JOIC 3ER0A 3UDXA 1KD1C 1TWGH 4B3SL 2UXCQ 1Q46A 1KXLA 1X3EA 1V9PA 2AKWB 1YHQA 2KHJA 4J15A 2I0QA 2UXBL 1WJJA 3W1BA 2K75A 5BR8Q 1LUZA 3I56A 4HJ5A 2LSSA 5GADC 1PVOA 4GOPC 2R93G 2JA6H 3PF5A 4YCWA 1PV4A 4HJ7A 1SE8A 1RIPA 2C35B 4PG3A 2K14A 2ZJPA 4A3MG 1KIXA 5M3FH 3BJUA 4UPAA 1M1KC 2CFMA 1UE1A 3PCOB 5IP7H 1GVPA 2F4VQ 1U5KA 3S17H 1Y14B 2ZTEA 3T1HQ 2EQSA 2UUAL 4DV4Q 1MJCA 4YHHL 3RR5A 4JI4Q 3U50C 3S16H 2VL6A 4YY3L 4A3LH 2OWOA 4OX9Q 2OTJA 2WB1E 1A62A 2AHOB 3GO5A 3HOWG 2A1AA 5ELNA 1E7ZA 2IX0A 3K8AA 1XPUA 1Y1WH 2IX1A 3JAMi 1VQOA 3A5ZB 3STBD 3VDYA 3PGZA 3G4SA 3CD6A 1GO3E 2NZOA 1UE7A 2GN5A 4K0KQ 5JEAG 2NN6I 4OWTB 1UE6A 4C3HH 1VQGA 2I5MX 1S40A 1QVCA 5GQOA 1OXVA 4BBRG 5IP9G 2NVQH 5LMNW 1SN8A 4OONA 4LUVA 4GKJL 4WJ3M 3KJOA 4LNQA 4A3EG 1JJ2A 1HJPA 1HZAA 3SGIA 3KF6A 3PUWA 1H95A 1E1TA 3J81j 5M3FG 1N32Q 3EIVA 2JJQA 1HR0W 1X54A 1YI2A 2JA5H 3M7NA 1IXRA 4B3MQ 4B3ML 3J81c 5C44H 4P71A 2R7ZH 4A3KG 2F3IA 1MIUA 1BBUA 2ALYB 4APVA 3K7UC 4DUZL 3T1HL 4JYAQ 4MZ9A 4JI1L 1XJVA 4DUYL 3F2CA 4BY1H 4HJ8A 3KFUA 2I5LX 2R7DA 4HIKA 2VQEL 4A75A 4PZ8A 4DK3C 5IYBH 3ERSX 3CMEA 4O0AA 1VQ7A 3E9HA 1Q82C 4JI6L 3S1QH 1W2BA 2MQHA 1YJNA 2RF4A 3EN2A 1C7YA 5C0XI 2LXKA 4AH6A 2CKZB 5HGQA 5IYDG 3NEMA 3CF5A 1R9TH 1QVGA 4DR7Q 5IY0A 1IBML 4NXML 1I6HH 3I4OA 4LF4L 4DR3Q 1N33Q 2ASBA 4NXNL 4JI1Q 4DR1Q 1AE3A 2HT1A 5C44G 3M85A 4LF6L 3AEVA 4TVAB 4YWMA 5IWAL 3RZOH 5IYDH 3FKIH 4JV5Q 2JE6I 2IT1A 2R93H 1AH9A 1PYBA 4BA2I 4BY7H 4KHPQ 5LMNL 4PMWA 2UU9Q 2YTVA 4GNXA 3CXCA 3PIOA 1Q7YC 3A74A 1IBLQ 4IPCA 1FGUA 4PZ6A 3A5UA 3ULJA 1E24A 1VQ6A 1GD7A 3HKZG 3TRZA 2DGYA 1XNRL 2Q2UA 2I5HA 3S1RH 1Y1VH 5K36G 1HZCA 1L1OC 1WCMG 3AFPA 3H0GG 1G51A 4KLKA 2HHHL 2F52A 3F8TA 2UUBL 1IBMQ 3S14H 4DV3L 1NMGA 1P16A 3KJPA 2UUBQ 1YIJA 2K50A 1HNZQ 3HOUG 3K0XA 4JI8Q 3UDFA 1HR0L 2Z6KC 4YWLA 4QY7A 3AYHB 4A3MH 2NVTH 2JA5G 1QZHA 3FHWA 2AWOA 3GTJH 4A3BG 1YJ9A 3K7AH 1X3GA 3K80C 4IFDI 2PMZE 3RN2A 2ZJQA 2WAQG 4DKAC 5J3BA 2Z0SA 2RCNA 4A3EH 1JB7A 2E5LQ 1KRSA 2MO1A 2NVYH 4B3TL 1V1QA 1N36L 1J5EQ 1N34Q 3HOUH 2UUAQ 2HIVA 3ICEA 3A0JA 4HJAA 1VQMA 5IP9H 3H0GH 4X62Q 1VQIA 3I55A 3L2PA 3U58A 3RZDH 3HOWH 4JV5L 2BH2A 1X3FA 1PH8A 1XMOQ 3U4VA 1KQSA 3TEHB 3M4QA 3GTPH 4BY1G 4LF7L 3I4MH 4JOIA 4LWCA 1N34L 3J80c 4B3TQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3S Q;  3TQY A;  3FP9 A;  4A3K H;  4R4T A;  5IYC H;  2N3S A;  5BR8 L;  4DV2 Q;  4JBW A;  4YCV A;  4L5R C;  1YHB A;  3CCR A;  4DV1 L;  1EQQ A;  4ALP A;  1SLJ A;  2KCT A;  4DV1 Q;  2DUD A;  1PH5 A;  3S2H H;  1M90 C;  2R92 H;  2RHQ B;  4UP7 A;  1JT8 A;  1GKH A;  1N9W A;  3DLL A;  1OXU A;  1PHJ A;  4IOC A;  3E0E A;  1XNQ Q;  1BKB A;  3CMA A;  2N49 A;  4AIM A;  4A3C G;  3L7Z C;  3NBH B;  5EAY A;  3ZJY C;  3F2B A;  1I50 H;  1VQF A;  5C3E H;  4NPS A;  1E22 A;  1E1O A;  4AQY L;  2ZM6 Q;  1K0R A;  1YHA A;  3CCL A;  1D8L A;  4DR6 L;  1XMO L;  5FLM G;  3BZC A;  1YZ6 A;  1NE3 A;  2KEN A;  2ZTD A;  4UP9 A;  3KLW A;  4TQU S;  5LMN Q;  3UDG A;  2UU9 L;  3TS0 A;  1MJE A;  2R92 G;  2ID0 A;  3S2D H;  4GS3 A;  3I7F A;  4L5S A;  4GKJ Q;  1EIF A;  2KHI A;  4JI2 L;  1J5E L;  2PI2 A;  4JBJ A;  4DR1 L;  1KAW A;  4NXN Q;  4DV7 L;  5FJ8 G;  3KOJ A;  1U0L A;  4X66 Q;  3J7Z C;  5H1S E;  1HNW Q;  1BBW A;  5AJ3 L;  1OTC A;  4JI0 Q;  1TXY A;  3CCV A;  4GKK Q;  2CCZ A;  3JAM c;  4IPH A;  4C2M H;  4QIW E;  3J81 i;  1WI5 A;  3CCQ A;  3GTO H;  2A19 A;  3S1N H;  3E9I A;  2YYZ A;  1S72 A;  1HZB A;  4A3D H;  3I4N H;  2Q2I A;  2RHS B;  4GLV B;  3HOY H;  2CWP A;  5M5X H;  3PUV A;  3T1Y Q;  1PH9 A;  4JYA L;  3HOZ H;  2UXD Q;  1IBK L;  4LW1 A;  5AJ3 Q;  4JI0 L;  4A3B H;  1TWH H;  1UWV A;  1QVF A;  4YY3 Q;  4HIO A;  1B7Y B;  4LF5 Q;  4YHH Q;  4JI4 L;  4MNO A;  4IPG A;  5C4X H;  3OW2 A;  3PV0 A;  1PH7 A;  3M4P A;  4JI6 Q;  1ASZ A;  3HOZ G;  3CPW A;  1J6Q A;  1IYJ B;  1S3O A;  2YTX A;  4P75 A;  4LFA Q;  2Q2H A;  4X65 Q;  4X65 L;  2JA8 G;  1NBW A;  4DR2 Q;  4WJ4 A;  1HH2 P;  1WYD A;  4L5T A;  3I4N G;  1X6O A;  4DAY B;  1TWA H;  1L1O B;  3CCU A;  4QQB X;  3CPF A;  2E8G A;  1ASY A;  4R4O A;  4OO1 I;  4NB3 A;  4O2D A;  3TS2 A;  3Q8D A;  3OYY A;  4OWX B;  4UP8 A;  2UXB Q;  2YU9 H;  2E2J H;  4A3L G;  1WFQ A;  1W3S A;  4A3I H;  3U4Z A;  1VQD A;  1QZG A;  1Q12 A;  4EQ5 A;  4QL5 A;  3PUY A;  1Y1V G;  5IP7 G;  3W1G A;  3T1Y L;  4DR3 L;  1Y1W G;  1QUQ B;  4MTN A;  4LF8 Q;  1N33 L;  4LF4 Q;  1RL2 A;  4GNX B;  4JI7 L;  4LF8 L;  2VUM H;  4JI5 Q;  1SFO H;  2BA0 A;  3CCE A;  2XTI A;  1K3R A;  4JI8 L;  5GAG C;  1HR0 Q;  2HQL A;  4X66 L;  1HNW L;  3W5O A;  1XMQ L;  1KRT A;  3I2Z A;  1EFW A;  1XPR A;  3GTQ H;  4Y52 H;  5FLM H;  2PQA A;  4DV5 Q;  1TWC H;  2N78 A;  2VZA A;  4DK6 C;  4A3F H;  4XIG S;  3PF4 A;  4AYB E;  2HHH Q;  4IFD G;  1LYL A;  3KYH C;  2B63 H;  3RNU A;  3S15 H;  4YWK A;  1PH6 A;  2D62 A;  4JI2 Q;  2WAQ E;  2OQK A;  4IPD A;  3GTM H;  5HY6 A;  2ATW A;  4LFC L;  1N8R C;  1I94 L;  2VUM G;  2JA6 G;  4X62 L;  4BBS H;  1X9N A;  2JA7 G;  3FKI G;  5JJI A;  4DR6 Q;  4OXP A;  3I4M G;  1I5F A;  4OX9 L;  5IT9 c;  4DV0 L;  2K52 A;  2PNH A;  4JBM A;  4DV6 Q;  5FLX c;  5GRO A;  3PUX A;  1C9O A;  2Y0S G;  1EWI A;  1B8A A;  3HKS A;  4KI0 A;  2KCM A;  4IJL A;  4IO9 A;  2K5N A;  1XNQ L;  1PH4 A;  2UXC L;  1NJI C;  1I94 Q;  4LFC Q;  2R7Z G;  1LM0 A;  1NTG A;  1GM5 A;  4DV2 L;  1K73 C;  2N8N A;  1XPO A;  1VQE A;  4B3R Q;  4ME3 A;  1PA6 A;  1EOV A;  4LF5 L;  2K5V A;  5JJL A;  3KDF A;  5DLQ E;  1CKN B;  2KBN A;  2QA4 A;  4LF7 Q;  1Z47 A;  3D0F A;  2YTY A;  4HJ9 A;  3GTL H;  1PFS A;  1VQB A;  2PI2 E;  3PSI A;  4P72 A;  4A4I A;  1VQC A;  1EUJ A;  4LUZ A;  3PO2 H;  5JJK A;  1IZ6 A;  2JK8 A;  3MEF A;  3S24 A;  2YV5 A;  2JQO A;  1YJW A;  4JI7 Q;  1X65 A;  4HIM A;  1WOC A;  1I3Q H;  4IFD J;  2B63 G;  3OTO L;  1HZ9 A;  4DUY Q;  2MO0 A;  2UUC L;  1CSQ A;  1VCI A;  2E2H H;  4QJF A;  1Q86 C;  2ZM6 L;  1B70 B;  4JC0 A;  2MNA A;  1VQN A;  2Q2T A;  1UE5 A;  4Y7N H;  5C0X G;  4DR5 L;  4DV0 Q;  1CKN A;  3HOX G;  4DR5 Q;  4A3J G;  1VQP A;  1YIT A;  4POG A;  1A63 A;  5JEA J;  2AMC B;  1N36 Q;  1G6P A;  2L15 A;  3JC6 6;  2E5L L;  2F4V L;  1WCM H;  1YVC A;  2Y0S E;  3G6E A;  4DV4 L;  4LF6 Q;  1SRU A;  3KF6 B;  1PYS B;  4AQY Q;  4JBK A;  3HOV H;  3PO3 H;  3KF8 B;  3ULL A;  4POF A;  1OXT A;  4RG1 A;  4DV5 L;  3CQZ H;  3EBE A;  2JA7 H;  4OWW B;  2EXD A;  1Q81 C;  4LFB L;  4LFB Q;  1K83 H;  3BZK A;  2JEB I;  2K4K A;  3HOV G;  4L5Q A;  3LGJ A;  3F1Z A;  4DV3 Q;  1IL2 A;  4OO1 G;  1FJG L;  3S1M H;  4JCV E;  4JI5 L;  3F2D A;  1KHI A;  2D0P A;  4IJH A;  1JMC A;  2VQE Q;  3HOX H;  4A3J H;  2QGQ A;  1PH3 A;  1SR3 A;  1XNR Q;  2D0O A;  3WWV A;  1EYG A;  4B3R L;  1BVS A;  1L2F A;  1MKH A;  4JI3 Q;  2FXQ A;  4GN5 A;  4DR4 L;  4LF9 Q;  3BU2 A;  2B29 A;  3CP0 A;  4R1J A;  3IRB A;  1PH1 A;  1VQJ A;  3G71 A;  5IE8 A;  4R4I A;  2IHE A;  3UE1 A;  5IYB G;  4DV6 L;  2V1C C;  3H15 A;  1VQH A;  4A3C H;  4FDB A;  4XTC S;  1V43 A;  2NN6 G;  5C0X J;  5IWA Q;  4A3D G;  2K5H A;  1A0I A;  1Z9F A;  1UEB A;  3OTO Q;  2UUC Q;  3PO3 G;  3CC7 A;  3HFZ B;  4C3I H;  3J7A 5;  1JJG A;  2B3G A;  2VS1 A;  4LFA L;  4GOP B;  1OXX K;  3GTK H;  4X64 Q;  4QGU A;  4DR7 L;  1C0A A;  3MXN B;  4H02 A;  4BXX H;  4KHZ A;  5E7N A;  1HNZ L;  5M3M G;  1E3P A;  4P74 A;  2WP8 J;  4AYB G;  1K8G A;  2JA9 A;  4GN3 B;  2QEX A;  1IBK Q;  4EX5 A;  1K9M C;  1L1O A;  3GD7 A;  4A93 G;  1JE5 A;  1YEZ A;  2VW9 A;  1CUK A;  3RN5 A;  1CKM A;  1QUQ A;  4DAM A;  3DM3 A;  5C4X G;  3CCS A;  1VQA A;  2H5X A;  3K81 C;  1JJC B;  1O7I A;  2XGT A;  1VS0 A;  2NVX H;  1T9H A;  1VQ9 A;  1VQ4 A;  2E2I H;  3NEN A;  4DUZ Q;  3PO2 G;  1D7Q A;  1Q8K A;  2BA1 A;  1NMF A;  4BBR H;  2IY5 B;  4A3G H;  2R7F A;  3UE0 A;  3CC2 A;  3AFQ A;  3D31 A;  3G48 A;  1XTD A;  2MFI A;  2VNU D;  1P8L A;  4GLX A;  4IOA A;  5ELO A;  3RLF A;  3J80 i;  2LXJ A;  4A3I G;  1VQ5 A;  3RLO A;  4DNI A;  4LF9 L;  1NY4 A;  4A76 A;  1FL0 A;  1SRO A;  3CAM A;  3NEL A;  2NZH A;  1YNX A;  2ZTC A;  5M5Y H;  5C4J H;  3CCM A;  5LMU L;  3CW2 C;  3AQQ A;  1VQL A;  1IBL L;  3HOY G;  1L0W A;  3RLN A;  2AWN A;  1PH2 A;  2UXD L;  2ES2 A;  4K0K L;  4R4C A;  2VQF Q;  2IHF A;  5GAH C;  2OQ0 A;  2JA8 H;  4DPG A;  3PUZ A;  3L0O A;  3PIP A;  2JEA I;  3M3Y H;  3GTG H;  3H3V I;  2CWA A;  4RMF A;  1AE2 A;  2EIF A;  1CKO A;  4GN4 B;  4BBS G;  4A3G G;  5C3E G;  1K8A C;  1CSP A;  2GVA A;  2R6G A;  2WB1 G;  3M9B A;  2WFW A;  4BA1 I;  1VQ8 A;  4NXM Q;  3CCJ A;  1FJG Q;  3B6Y A;  2Z6K A;  4P73 A;  2ZJR A;  1G29 1;  3ULP A;  3UDI A;  3CC4 A;  4LUO A;  1EQR A;  4DV7 Q;  3STB C;  2VQF L;  1X55 A;  1X56 A;  1KL9 A;  4A3F G;  4HID A;  1Q1E A;  4PZ7 A;  4R4Q A;  1EIY B;  4GNX C;  4GKK L;  1OXS C;  4JG2 A;  4A93 H;  4BY7 G;  1N32 L;  2BH8 A;  1VQK A;  1TWF H;  5LMU Q;  1YBY A;  3TRE A;  4X64 L;  1HNX Q;  1HNX L;  2A8V A;  5IYC G;  5M3M H;  3KDF B;  2HIX A;  4YCU A;  4DR2 L;  4GLA C;  5M5W H;  4BXX G;  1FVI A;  4C3J H;  1KC8 C;  4X6A H;  1XMQ Q;  1SMX A;  3M4O H;  2OTL A;  1DGS A;  4JI3 L;  4DR4 Q;  1A8V A;  4KHP L;  5GAE C;  2PQA B;  4GOP A;  5FJ8 H;  3H3V H;  2GVB A;  3HKZ E;  3GDE A;  2CQO A;  1LTL A;  4UY8 C;  1Q1B A;  2VY3 A;  2OCE A;  4JOI C;  3ER0 A;  3UDX A;  1KD1 C;  1TWG H;  4B3S L;  2UXC Q;  1Q46 A;  1KXL A;  1X3E A;  1V9P A;  2AKW B;  1YHQ A;  2KHJ A;  4J15 A;  2I0Q A;  2UXB L;  1WJJ A;  3W1B A;  2K75 A;  5BR8 Q;  1LUZ A;  3I56 A;  4HJ5 A;  2LSS A;  5GAD C;  1PVO A;  4GOP C;  2R93 G;  2JA6 H;  3PF5 A;  4YCW A;  1PV4 A;  4HJ7 A;  1SE8 A;  1RIP A;  2C35 B;  4PG3 A;  2K14 A;  2ZJP A;  4A3M G;  1KIX A;  5M3F H;  3BJU A;  4UPA A;  1M1K C;  2CFM A;  1UE1 A;  3PCO B;  5IP7 H;  1GVP A;  2F4V Q;  1U5K A;  3S17 H;  1Y14 B;  2ZTE A;  3T1H Q;  2EQS A;  2UUA L;  4DV4 Q;  1MJC A;  4YHH L;  3RR5 A;  4JI4 Q;  3U50 C;  3S16 H;  2VL6 A;  4YY3 L;  4A3L H;  2OWO A;  4OX9 Q;  2OTJ A;  2WB1 E;  1A62 A;  2AHO B;  3GO5 A;  3HOW G;  2A1A A;  5ELN A;  1E7Z A;  2IX0 A;  3K8A A;  1XPU A;  1Y1W H;  2IX1 A;  3JAM i;  1VQO A;  3A5Z B;  3STB D;  3VDY A;  3PGZ A;  3G4S A;  3CD6 A;  1GO3 E;  2NZO A;  1UE7 A;  2GN5 A;  4K0K Q;  5JEA G;  2NN6 I;  4OWT B;  1UE6 A;  4C3H H;  1VQG A;  2I5M X;  1S40 A;  1QVC A;  5GQO A;  1OXV A;  4BBR G;  5IP9 G;  2NVQ H;  5LMN W;  1SN8 A;  4OON A;  4LUV A;  4GKJ L;  4WJ3 M;  3KJO A;  4LNQ A;  4A3E G;  1JJ2 A;  1HJP A;  1HZA A;  3SGI A;  3KF6 A;  3PUW A;  1H95 A;  1E1T A;  3J81 j;  5M3F G;  1N32 Q;  3EIV A;  2JJQ A;  1HR0 W;  1X54 A;  1YI2 A;  2JA5 H;  3M7N A;  1IXR A;  4B3M Q;  4B3M L;  3J81 c;  5C44 H;  4P71 A;  2R7Z H;  4A3K G;  2F3I A;  1MIU A;  1BBU A;  2ALY B;  4APV A;  3K7U C;  4DUZ L;  3T1H L;  4JYA Q;  4MZ9 A;  4JI1 L;  1XJV A;  4DUY L;  3F2C A;  4BY1 H;  4HJ8 A;  3KFU A;  2I5L X;  2R7D A;  4HIK A;  2VQE L;  4A75 A;  4PZ8 A;  4DK3 C;  5IYB H;  3ERS X;  3CME A;  4O0A A;  1VQ7 A;  3E9H A;  1Q82 C;  4JI6 L;  3S1Q H;  1W2B A;  2MQH A;  1YJN A;  2RF4 A;  3EN2 A;  1C7Y A;  5C0X I;  2LXK A;  4AH6 A;  2CKZ B;  5HGQ A;  5IYD G;  3NEM A;  3CF5 A;  1R9T H;  1QVG A;  4DR7 Q;  5IY0 A;  1IBM L;  4NXM L;  1I6H H;  3I4O A;  4LF4 L;  4DR3 Q;  1N33 Q;  2ASB A;  4NXN L;  4JI1 Q;  4DR1 Q;  1AE3 A;  2HT1 A;  5C44 G;  3M85 A;  4LF6 L;  3AEV A;  4TVA B;  4YWM A;  5IWA L;  3RZO H;  5IYD H;  3FKI H;  4JV5 Q;  2JE6 I;  2IT1 A;  2R93 H;  1AH9 A;  1PYB A;  4BA2 I;  4BY7 H;  4KHP Q;  5LMN L;  4PMW A;  2UU9 Q;  2YTV A;  4GNX A;  3CXC A;  3PIO A;  1Q7Y C;  3A74 A;  1IBL Q;  4IPC A;  1FGU A;  4PZ6 A;  3A5U A;  3ULJ A;  1E24 A;  1VQ6 A;  1GD7 A;  3HKZ G;  3TRZ A;  2DGY A;  1XNR L;  2Q2U A;  2I5H A;  3S1R H;  1Y1V H;  5K36 G;  1HZC A;  1L1O C;  1WCM G;  3AFP A;  3H0G G;  1G51 A;  4KLK A;  2HHH L;  2F52 A;  3F8T A;  2UUB L;  1IBM Q;  3S14 H;  4DV3 L;  1NMG A;  1P16 A;  3KJP A;  2UUB Q;  1YIJ A;  2K50 A;  1HNZ Q;  3HOU G;  3K0X A;  4JI8 Q;  3UDF A;  1HR0 L;  2Z6K C;  4YWL A;  4QY7 A;  3AYH B;  4A3M H;  2NVT H;  2JA5 G;  1QZH A;  3FHW A;  2AWO A;  3GTJ H;  4A3B G;  1YJ9 A;  3K7A H;  1X3G A;  3K80 C;  4IFD I;  2PMZ E;  3RN2 A;  2ZJQ A;  2WAQ G;  4DKA C;  5J3B A;  2Z0S A;  2RCN A;  4A3E H;  1JB7 A;  2E5L Q;  1KRS A;  2MO1 A;  2NVY H;  4B3T L;  1V1Q A;  1N36 L;  1J5E Q;  1N34 Q;  3HOU H;  2UUA Q;  2HIV A;  3ICE A;  3A0J A;  4HJA A;  1VQM A;  5IP9 H;  3H0G H;  4X62 Q;  1VQI A;  3I55 A;  3L2P A;  3U58 A;  3RZD H;  3HOW H;  4JV5 L;  2BH2 A;  1X3F A;  1PH8 A;  1XMO Q;  3U4V A;  1KQS A;  3TEH B;  3M4Q A;  3GTP H;  4BY1 G;  4LF7 L;  3I4M H;  4JOI A;  4LWC A;  1N34 L;  3J80 c;  4B3T Q; 
#chains in the Genus database with same CATH topology
 3MVV A;  1O7Y A;  5T1G A;  5IYC H;  5BR8 L;  1YHB A;  3GTP B;  4KY6 A;  1STE A;  4DV1 L;  1EQQ A;  4ALP A;  3E6Z X;  1T5X D;  3S2H H;  4RCN A;  3MXN A;  2B8F A;  1PHJ A;  4G4K A;  2XNA C;  2N49 A;  3F2B A;  1B50 A;  1CZW A;  1VQF A;  3FKI B;  4NPS A;  2PNR C;  1E1O A;  3CCL A;  4DR6 L;  2F0G A;  5FLM G;  2ZTD A;  2R92 G;  3KLW A;  3E0J A;  3HS0 C;  1I6H B;  1U4R A;  4FYD A;  4GKJ Q;  1JQY D;  2KHI A;  1J5E L;  1SYE A;  2PI2 A;  4C3J G;  4JBJ A;  2F0S A;  2Z4H A;  2XVS A;  1LO5 D;  3KOJ A;  3SE0 A;  4X66 Q;  1HNW Q;  4JI0 Q;  4GKK Q;  4DAP A;  3JAM c;  1F9S A;  3NXW A;  3ERO A;  1GOZ A;  3I4N H;  4K5X A;  5DM7 3;  2RHS B;  3HOY H;  2CVR A;  3PUV A;  3T1Y Q;  2QEJ C;  4XT1 B;  2B2T C;  2UXD Q;  4A3B H;  4JI0 L;  5M3F B;  3CRK C;  1ZYR D;  4YY3 Q;  4HIO A;  3D3R A;  3HOZ G;  1EWH A;  2DNE A;  1S3O A;  4P75 A;  4LFA Q;  4KD4 A;  2B2U A;  1Y8O B;  4WJ4 A;  1NBW A;  1HH2 P;  4L5T A;  1L1O B;  1RF2 D;  1SYC A;  3KBX A;  3NBI A;  3BDC A;  3LX0 A;  2UXB Q;  4X3K A;  2RDF A;  4PQX A;  3U4Z A;  5EPK A;  4DAV A;  1PFN A;  2OXP A;  3M4O B;  4DN4 M;  1Q12 A;  5ELC A;  4EQ5 A;  5JVG 3;  1TWH B;  5IP7 G;  1ONL A;  4MTN A;  2BOS A;  4LF4 Q;  1RL2 A;  3HZX A;  2XTI A;  2HDL A;  4RWS C;  1KRT A;  4C3I G;  1VDZ A;  1XPR A;  3GTQ H;  2B63 B;  5IGE A;  2N78 A;  2CW0 D;  4IFD G;  4XIG S;  1W6K A;  3KYH C;  1F9R A;  3TME A;  4C3J B;  4YWK A;  2D62 A;  1SNP A;  2DNC A;  2WAQ E;  5FKA C;  4JI2 Q;  3GTM H;  3F2U A;  2ATW A;  3A8I E;  4BBS H;  1X9N A;  1F77 A;  2Q8R E;  3I4M G;  4FF1 A;  5IT9 c;  2EXZ A;  4X3U A;  4DV0 L;  1OO9 B;  3HP3 A;  1MI2 A;  4UAI A;  2PNH A;  4BWG B;  2BE5 D;  2HCI A;  1XNQ L;  1ZXT A;  2UXC L;  2PCF B;  4HCE A;  2F4I A;  4DV2 L;  5D3I B;  2N8N A;  1XPO A;  1PYW D;  4ME3 A;  2KEE A;  1PA6 A;  1A6X A;  1JOK A;  1S5D D;  1Q90 A;  1CKN B;  2QA4 A;  2LS0 1;  3K58 A;  4LF7 Q;  1UAP A;  1GUG A;  1Z47 A;  3D0F A;  2L11 A;  2V4D A;  4RAU C;  1B9N A;  1YJW A;  3MEF A;  4OHJ A;  4HIM A;  1WOC A;  4IFD J;  1XX8 A;  1HZ9 A;  5CV4 A;  3OTO L;  1ESF A;  5J39 A;  1Q86 C;  4JC0 A;  2MNA A;  3IFD A;  5A35 A;  4DV0 Q;  3HOX G;  4DR5 L;  3FPU B;  1A63 A;  5DEH A;  5JPM C;  5IOC A;  2L15 A;  2E5L L;  2E2I B;  1YVC A;  1JB3 A;  4K8J A;  2LY7 A;  3EVQ A;  5IT9 E;  2L1B A;  4AQY Q;  4JBK A;  3KF8 B;  2AQ1 B;  1OXT A;  3H0G B;  2B39 A;  4V19 0;  4UDU C;  1KLG D;  1Q81 C;  2FFK B;  1K83 H;  1IL2 A;  1JC7 A;  4OO1 G;  1FJG L;  1RJT A;  2QGQ A;  3WWV A;  2KA7 A;  4JI3 Q;  2FXQ A;  4RGT A;  4LF9 Q;  4R1J A;  1V1O A;  1PH1 A;  3ITP A;  2IHE A;  2OT2 A;  3UE1 A;  3DEP A;  5IYB G;  4DV6 L;  3H15 A;  4ZAI A;  2K5D A;  1A0I A;  2JA7 B;  2H4O A;  3CC7 A;  1JJG A;  2B3G A;  4BY7 B;  2VS1 A;  4GOP B;  4JVZ A;  3O13 A;  4ZUI A;  2NB0 A;  4X64 Q;  2FHT A;  5F2D A;  3C46 A;  4BXX H;  4KHZ A;  5E7N A;  5M3M G;  3VA7 A;  3K7A B;  1TY0 A;  2JA9 A;  2QEX A;  1FYC A;  4EX5 A;  1PMR A;  3RN5 A;  1QUQ A;  5C4X G;  4DAY A;  3C1E A;  1VQA A;  3NHH A;  1Y1W B;  2XGT A;  3OOC A;  3IAY A;  1D7Q A;  4A3G B;  1Q8K A;  4BBR H;  2F0M A;  2IY5 B;  5IGC A;  4A3G H;  1F2M A;  4L6T B;  1SJH D;  3D31 A;  1PRT B;  1XTD A;  3K6O A;  2LXJ A;  2Z6B A;  3RLO A;  1VQ5 A;  3DWQ A;  3CAM A;  5LL6 S;  3NEL A;  1YNX A;  5M5Y H;  5LMU L;  5JEA H;  2RA4 A;  3AQQ A;  3RMH A;  3HOY G;  1LTA D;  4FF3 A;  2ES2 A;  4ULL A;  2JA8 H;  5GAH C;  2OQ0 A;  1AW7 A;  4DPG A;  5CYU A;  2K1B A;  2EIF A;  2IWH A;  3R3O A;  4BBS G;  1EY5 A;  4RGO S;  3W3A A;  2WB1 G;  2K5Q A;  4BA1 I;  4K2L A;  5BN5 A;  2Z6K A;  2ZJR A;  3UDI A;  4LUO A;  4MHE A;  5C4X B;  3K5O A;  1EIY B;  1EWC A;  4R4Q A;  2FMM A;  4KN4 C;  4A93 H;  2ZT9 C;  2QF7 A;  1VQK A;  2GA4 B;  2A8V A;  3TRE A;  2R92 B;  5M3M B;  5KRU A;  5IGB A;  5IYC G;  1F2Y A;  5M3M H;  1PZJ D;  1X3P A;  5EBD A;  1GXD C;  4RGN A;  4XQN A;  2RSO A;  3VA5 A;  1WTO A;  1XMQ Q;  4DR4 Q;  2KQ3 A;  4F7X A;  1A8V A;  1A3T A;  2FIN B;  5GAE C;  4HCS A;  3T53 B;  1HCZ A;  1NNX A;  2CQO A;  1QB5 D;  1LTL A;  2OCE A;  1D2B A;  3ER0 A;  3TZU A;  1QCB D;  1EZ6 A;  2KHJ A;  4J15 A;  3TSS A;  4IUP A;  4JW0 A;  1PVO A;  1TT2 A;  3PF5 A;  1X3Q A;  1SE8 A;  4HJ7 A;  2C35 B;  4J8Q A;  5COR A;  3BJU A;  4H13 C;  4ZRZ A;  3PCO B;  2EQS A;  2Z4I A;  4DV4 Q;  3S16 B;  4JI4 Q;  3S16 H;  1XYI A;  4PNY A;  2OWO A;  2WB1 E;  1Y8N B;  1KNE A;  3I8Z A;  5ELN A;  2KHS A;  3LNN A;  3Q0A A;  4N8F A;  3VDY A;  1SXT A;  5KIX A;  3CD6 A;  3H91 A;  1ENA A;  3FEW X;  2GN5 A;  1KLU D;  4OWT B;  1UE6 A;  1EQV A;  4C3H H;  1VQG A;  3GTG B;  4A3I B;  4WJ3 M;  3KJO A;  1HZA A;  3IKJ A;  1LT3 D;  3KF6 A;  3NTK A;  3R2T A;  3J7A F;  2A73 B;  1PTO B;  2JJQ A;  2JA5 H;  3I91 A;  2EJF C;  2FMC A;  4ZCK A;  1HQM C;  2WKD A;  4A3K G;  1JOQ A;  2F3I A;  2EYM A;  1BBU A;  4QB4 A;  4APV A;  2EY6 A;  4C56 C;  3KFU A;  4DUY L;  1B4O A;  4A75 A;  1BO0 A;  3E9H A;  3KLR A;  2JA6 B;  4CHT B;  1W2B A;  5CV8 A;  4CDD C;  3EN2 A;  2LXK A;  5IYD G;  3NEM A;  5HGT A;  3Q22 A;  1QVG A;  3VYR A;  2KJX A;  2L4N A;  4FP5 D;  5I9O A;  5C44 G;  4YWM A;  5J1Z A;  1I50 B;  1AH9 A;  5LMN L;  5FLX E;  5KEE A;  2YTV A;  3J81 E;  1QOH A;  1CI3 M;  4NKL A;  1BCP D;  4ZUJ A;  4ME5 A;  1WTR A;  4C1N K;  2XWJ B;  2JN4 A;  3HOU B;  2JSO A;  1SJE D;  1XNR L;  1RDP D;  1ILQ A;  1Y1V H;  4EQO A;  3OSO A;  4KKT A;  2R3Z A;  5K36 G;  1HZC A;  3H0G G;  4KLK A;  3F8T A;  2UUB L;  1VMP A;  3J80 E;  1NMG A;  3LWU A;  1IYV A;  1EU3 A;  1XTC D;  3UDF A;  1HR0 L;  4YWL A;  1CA6 A;  2NVT H;  3NWT A;  1DD2 A;  4FF2 A;  2JA5 G;  1FNU A;  4RCO A;  3HOX B;  1X3G A;  3RN2 A;  2WKC A;  1LV9 A;  2ZJQ A;  4DKA C;  2Z0S A;  4CDF C;  3M4Y A;  2NVQ B;  1DON A;  1EIH A;  1V1Q A;  1N34 Q;  4C3H B;  1I4Q A;  4CGY B;  1B9M A;  1NCV A;  4HJA A;  5IP9 H;  1EY4 A;  3L2P A;  3HOW H;  4ZK9 B;  4Y7N B;  4Q5V A;  1XMO Q;  4Z9C B;  1Y8P B;  1EOT A;  4BY1 G;  4LF7 L;  1STB A;  4JOI A;  3I4M H;  2PZT A;  4YIJ A;  3S15 B;  3TQY A;  2N3S A;  4L5R C;  1B3Q A;  3R2I A;  3NSW A;  4EVO A;  1PH5 A;  4UP7 A;  3V2T A;  3L7Z C;  4OO1 H;  3NBH B;  1F2L A;  1I50 H;  1F9Q A;  2ZM6 Q;  1K0R A;  1PRT F;  3MAQ A;  1XMO L;  1YZ6 A;  2KEN A;  2MUY A;  4DK1 A;  5LMN Q;  4TQU S;  1G2T A;  1CA5 A;  3I7F A;  1KTK A;  1QIL A;  1KAW A;  2F0V A;  3S1Q B;  2SOB A;  4ILW A;  3A8K E;  3T13 A;  3CCV A;  5J22 A;  2K33 A;  2CCZ A;  3NK9 A;  4C2M H;  3J81 i;  1WI5 A;  3CCQ A;  5T1I A;  3E9I A;  4XYO A;  2YYZ A;  2F3W A;  1TS2 A;  4GLV B;  1TWF B;  5M5X H;  4JYA L;  3NTI A;  5AJ3 Q;  1TWH H;  1UWV A;  3I73 A;  5NUC A;  2EE1 A;  1WTQ A;  4LF5 Q;  3OIP A;  2O5J C;  3PV0 A;  3X3M A;  3S1R B;  1ASZ A;  3J7Y W;  3CPW A;  2YTX A;  3TP7 A;  2YU9 B;  2Q2H A;  4F8M A;  1H9S A;  3I4N G;  1WYD A;  3FDT A;  1X6O A;  5CGK A;  1K0S A;  2E76 C;  3TDQ A;  2L9H A;  1FD7 D;  3CCU A;  3CPF A;  2E8G A;  3QO2 A;  1I6V C;  2MP1 A;  4HN7 A;  3FMC A;  3P7J A;  3OYY A;  4OWX B;  3OWE B;  1Z6H A;  3FRP B;  4DA2 A;  2E2J H;  3HOV B;  4G7O C;  1BDO A;  3MEH A;  3QOL A;  1Y1V G;  5IGG A;  1IW7 C;  2VUM H;  4X3T A;  5I6W A;  1SFO H;  5EPL A;  3CCE A;  1K3R A;  5GAG C;  1HR0 Q;  4X66 L;  1HNW L;  3I90 A;  3W5O A;  4IUR A;  2J4X A;  2SEB D;  2PQA A;  1TWC H;  4DK6 C;  2VZA A;  4K8I A;  4AYB E;  4I65 A;  2QW7 A;  2B63 H;  4K5V A;  1PH6 A;  2OQK A;  4FXD A;  2A6H C;  4A3D B;  4LFC L;  1N8R C;  1I94 L;  3OWF A;  2HD3 A;  2JA6 G;  4X62 L;  3S1M B;  2JA7 G;  5JJI A;  4OXP A;  5FO8 B;  4OX9 L;  1TKW B;  1QWY A;  2I46 A;  3EJI A;  1JWS D;  4JBM A;  3WDN A;  3J80 L;  5FLX c;  5GRO A;  1C9O A;  2Y0S G;  1B8A A;  3HKS A;  4KI0 A;  3NTH A;  2K5N A;  1NJI C;  1I94 Q;  4LFC Q;  1NTG A;  1K73 C;  1EOV A;  4LF5 L;  2K03 A;  1SMY D;  1R9T B;  4EGV A;  3HOZ B;  5CV5 A;  3A54 A;  4FNF A;  3GTL H;  1PFS A;  1VQB A;  3PSI A;  4A4I A;  3J81 L;  2JK8 A;  2YV5 A;  1CHQ D;  1I3Q H;  4DUY Q;  1CSQ A;  2E2H H;  4XT3 B;  1B70 B;  2A6E C;  1A15 A;  4Y7N H;  2Q2T A;  4DR5 Q;  3MWY W;  1VQP A;  4POG A;  4BS9 A;  3GTO B;  3A7A B;  1N36 Q;  1QJO A;  1WCM H;  3EQL C;  5JPN C;  2Y0S E;  3CHB D;  4LF6 Q;  5C4Z A;  1SRU A;  1PYS B;  5CR3 A;  3GV3 A;  4POF A;  5K36 H;  4DV5 L;  5C4H A;  3CQZ H;  2JA7 H;  2HUG A;  5CV9 A;  3QOJ A;  2JEB I;  3TBI B;  4L5Q A;  3LGJ A;  4DV3 Q;  1E2W A;  4JI5 L;  1JMC A;  4ZKC B;  1XNR Q;  2D0O A;  3T16 A;  5IGF A;  4B3R L;  1D5Z C;  1G8Z D;  3AMU A;  3PO2 B;  3BU2 A;  2B29 A;  3CP0 A;  3IRB A;  5IE8 A;  4R4I A;  3SDZ A;  5ISR A;  2G9D A;  5IOD A;  4FDB A;  1VF7 A;  4XTC S;  2K5H A;  1UEB A;  4OIK A;  3OTO Q;  5BN3 A;  4C3I H;  5C6A A;  3HRZ C;  3DHQ A;  4DR7 L;  1C0A A;  4DU9 A;  3MXN B;  2O2L D;  2F0J A;  3VR3 A;  2QIL A;  1I4X A;  1E3P A;  2WP8 J;  1K8G A;  3KK7 A;  1IBK Q;  1UUP A;  3EFX D;  4C1N I;  1MHW C;  1JE5 A;  2B2V A;  1FGB D;  4DAM A;  1EQT A;  3DM3 A;  3CCS A;  2H5X A;  2O4X A;  1VQ9 A;  1VQ4 A;  2E2I H;  3BDO A;  4DUZ Q;  4G7Z C;  2BA1 A;  3FVQ A;  1JCK B;  2WII B;  1K3B C;  2EY1 A;  2R7F A;  5G3L F;  1LT5 D;  1SSO A;  3CC2 A;  2OEO A;  1LT6 D;  1HFN A;  4GLX A;  3HOV G;  3S14 B;  3J80 i;  4A3I G;  4DNI A;  4LF9 L;  1FL0 A;  2QKI C;  4UHV A;  1AEX A;  1K83 B;  5EBC A;  3A56 A;  1IBL L;  1AZQ A;  3RLN A;  1HA5 A;  2UXD L;  4K0K L;  1X32 A;  4R4C A;  3PUZ A;  3PIP A;  2DJG C;  3GTG H;  1XXG A;  1BBX C;  4GN4 B;  5EPJ A;  2BE5 C;  4NXM Q;  2WFW A;  2KCN A;  3B6Y A;  5A2Q L;  1KDC A;  3STB C;  1X56 A;  1LTG D;  4K14 A;  4HID A;  3A55 A;  3I3C A;  3DMU A;  3BS1 A;  4BY7 G;  1N32 L;  1GUS A;  2BH8 A;  1A3V A;  5LMU Q;  1YBY A;  1HNX L;  3KDF B;  4GLA C;  5M5W H;  2CH4 W;  3D4R A;  1KC8 C;  2EYH A;  1R4Q B;  4MN3 A;  4X6A H;  3D4D A;  2M9V A;  2Z8L A;  1SMX A;  4CKB A;  2A6E D;  1PZK D;  1DGS A;  3CQZ B;  4FXK C;  1D1I A;  5D65 A;  5FOB B;  1B2T A;  4KHP L;  2ENB A;  1Z7T A;  2EDG A;  3H3V H;  2GVB A;  3HKZ E;  4UY8 C;  2A68 C;  1JE4 A;  2VY3 A;  4JOI C;  3UDX A;  1KD1 C;  4X3S A;  2MPM A;  1X3E A;  1YHQ A;  5CBA E;  5AFW A;  1TS3 A;  1WJJ A;  1R4P B;  2EYO A;  2LSS A;  2D5D A;  2PZW A;  2R93 G;  1CK1 A;  1RIP A;  4PG3 A;  2K14 A;  2ZJP A;  1KIX A;  2RBM A;  2XRQ D;  5IP7 H;  1U5K A;  3S17 H;  2F0P A;  2ZTE A;  2UUA L;  2VL6 A;  4R9W A;  2XN9 C;  2E74 C;  2VXW A;  1A62 A;  3GO5 A;  3HOW G;  2A1A A;  1S5E D;  1E7Z A;  2Q8T A;  2IX1 A;  1Y1V B;  3JAM i;  3TP8 A;  1VQO A;  3A5Z B;  3VYS A;  1NR4 A;  4B9W A;  1ENF A;  1GO3 E;  4HR7 B;  1ML0 D;  5JEA G;  3Q6S A;  2A69 C;  5CC4 A;  2B2Y A;  3E5S A;  2MGS A;  2WAC A;  1QVC A;  3X3N A;  2JXM B;  1V1P A;  2NVQ H;  4LUV A;  1PZI D;  2IPK D;  3LWE A;  1KDA A;  3NQI A;  1E1T A;  4L63 B;  2HQE A;  3MTS A;  1BCP B;  2F0E A;  2HDM A;  3EIV A;  3S2H B;  3KLS A;  1X54 A;  4KJO A;  1YI2 A;  1YNJ D;  4B3M L;  2R7Z H;  5C44 H;  2XWB B;  3IFT A;  3SEB A;  1SFO B;  3K7U C;  4DUZ L;  2R61 A;  4JYA Q;  5IGD A;  1XJV A;  3H3V C;  5EJW A;  2I5L X;  4A93 B;  1TII D;  2VQE L;  2ICI A;  4DK3 C;  4O0A A;  1VQ7 A;  1GHJ A;  4JI6 L;  3S1Q H;  5EKK A;  2MQH A;  2RF4 A;  2QDL A;  2ASB A;  3S15 H;  1CHP D;  5IY0 A;  1IBM L;  5KND A;  4NXM L;  4OGQ C;  3MFG A;  4LF4 L;  1STY A;  5C3X A;  1AE3 A;  4P2C B;  4LF6 L;  3AEV A;  2NWG A;  4TVA B;  3RZO H;  2JE6 I;  2R93 H;  1G91 A;  3PIO A;  3DUZ A;  3A74 A;  1IBL Q;  2L55 A;  4IPC A;  3C3L A;  3ULJ A;  4KD3 A;  3TRZ A;  2DGY A;  2I5H A;  1JR0 D;  4G57 A;  4KJN A;  2K28 A;  1G51 A;  4HTH A;  2HHH L;  3SK4 A;  3S14 H;  2EYF A;  4DV3 L;  1ILP A;  1D1K A;  1EU4 A;  1HNZ Q;  5DM6 3;  1TR5 A;  4DNR B;  3IL8 A;  3L3O C;  3NP8 A;  2AWO A;  4A3B G;  1YJ9 A;  3K7A H;  1SNM A;  2EPB A;  3KBG A;  2WAQ G;  1SYB A;  2RCN A;  3TP5 A;  4ZLT F;  2E5L Q;  3RZD B;  1N36 L;  1GUW A;  4PMB A;  4J6H A;  1BXT A;  1VQM A;  2K7V A;  1VQI A;  4GZY C;  4N8X 1;  4CJ2 C;  5KYI A;  2PPB C;  1SMY C;  4CDE C;  3TEH B;  3GTP H;  2XSC A;  1PTO F;  3ERQ A;  3MXG A;  1UNS A;  3P1H A;  4LWC A;  3J80 c;  3H3V I;  2KED A;  3OMC A;  4LJZ C;  4A3K H;  4R4T A;  4OIJ A;  1LTR D;  4DV2 Q;  2TMP A;  3CCR A;  1KAA A;  3DEO A;  1SLJ A;  2KCT A;  4DV1 Q;  1TY2 A;  2RHQ B;  1JT8 A;  1N9W A;  1PFM A;  1RCV D;  4NP5 A;  3MZ5 A;  1OXU A;  3KF8 A;  4ODG A;  4IOC A;  3E0E A;  3SVM A;  1BKB A;  1HFG A;  2G5D A;  3ZJY C;  5CV7 A;  1D5X C;  4CDC C;  4RHS A;  1ESR A;  1PRT D;  1NE3 A;  4UP9 A;  3UDG A;  3TS0 A;  4N9P A;  1JWU D;  3S2D H;  2RKS A;  3T51 B;  4JI2 L;  2WV6 D;  4DR1 L;  4NXN Q;  4HMI A;  5FJ8 G;  1LAB A;  1U0L A;  5H1S E;  3GTK B;  1OTC A;  3H94 A;  4A3B B;  1WTH A;  4IPH A;  4QIW E;  3S1N H;  2WAQ B;  2A19 A;  4KKS A;  1J9O A;  2F03 A;  4H7B A;  1HZB A;  2K05 A;  2X69 A;  3GQB A;  4A3D H;  2Q2I A;  3GV6 A;  1I3Q B;  2EJM A;  5COY A;  3HOZ H;  4IUU A;  3PQI A;  3BVZ A;  1I4H A;  5I2Y A;  4JI4 L;  3GTL B;  5C4X H;  1PH7 A;  3M4P A;  1RD9 D;  4X65 L;  1D5M C;  2XRS D;  4DAY B;  3FPP A;  1TWA H;  4OO1 I;  1ASY A;  2KCC A;  4R4O A;  4O2D A;  3UI2 A;  3TS2 A;  3QB3 A;  1HUN A;  1WFQ A;  2K32 A;  1W3S A;  4A3I H;  1VQD A;  1EEI D;  3K5L A;  3GTJ B;  1KDB A;  4QL5 A;  3TN2 A;  5EKI A;  4LF8 Q;  3W1G A;  3MHB A;  4GNX B;  4JI7 L;  4LF8 L;  4JI5 Q;  1SBB B;  1TVX A;  5A2Q E;  3N52 A;  2ZXP A;  1AZP A;  2IL8 A;  3PMF A;  1GJX A;  4Y52 H;  5FLM H;  2RDG A;  4A3F H;  4JK1 C;  1L0Y B;  1LYL A;  2EYL A;  4IUT A;  1C4Q A;  2VUM G;  3MXU A;  3KUP A;  2EYJ A;  4F87 A;  1SE2 A;  1M8A A;  2K52 A;  1KAB A;  3QJY A;  1EWI A;  5C5L A;  5HUR A;  1V8Q A;  4IO9 A;  4IJL A;  3OW7 A;  2R7Z G;  3DXJ C;  1GM5 A;  1TS4 A;  3P20 A;  4B3R Q;  4ZYS A;  1VQE A;  3HGB A;  2I07 B;  4G7H C;  5JJL A;  3KDF A;  5DLQ E;  3ONA B;  2KBN A;  1E0B A;  1DXM A;  2SDF A;  1GHK A;  2NN6 H;  4KMU C;  2YTY A;  1GUO A;  2PI2 E;  4P72 A;  1VQC A;  1EUJ A;  4BBR B;  5JJK A;  1IZ6 A;  4RFB A;  3S24 A;  2JQO A;  3A7L A;  2B63 G;  5ELE A;  2MO0 A;  1VCI A;  5C3W A;  1VQN A;  3G7L A;  3HOU H;  2EJG C;  5C0X G;  1CKN A;  1NUC A;  1YIT A;  2JA5 B;  2AMC B;  1BF4 A;  1C48 A;  4RKL A;  2LMC B;  3OHX C;  3G6E A;  4DV4 L;  2J0T D;  2KOL A;  5TSS A;  3VYT A;  3KF6 B;  1LTT D;  3PO3 H;  2A5H A;  2CW0 C;  3EBE A;  1CM9 A;  4OWW B;  2EXD A;  5KGU A;  4LFB Q;  1JOR A;  5C4J B;  2K4K A;  1SE3 A;  3F1Z A;  2JA8 B;  4L8J A;  2F0H A;  4J1M A;  3S1M H;  3F2D A;  1H9J A;  2D0P A;  2VQE Q;  4KN7 C;  4A3J H;  1PH3 A;  4KHV A;  1LAC A;  3OMG A;  1BVS A;  1L2F A;  4DR4 L;  4GN5 A;  3VR2 A;  1VQJ A;  3G71 A;  2Y0S B;  1EY6 A;  4A3C H;  2F0K A;  1I4G A;  2C5C A;  2NN6 G;  5C0X J;  5IWA Q;  4A3D G;  4ID6 A;  1Z9F A;  2UUC Q;  3HFZ B;  3J7A 5;  4ZKB B;  1BUV T;  1SYG A;  1MBY A;  4OEL B;  1OXX K;  1SNC A;  2B2V C;  4RH6 A;  3C1F A;  4QGU A;  2E75 C;  1S5C D;  2JYO A;  1HNZ L;  4AYB G;  4GN3 B;  1QG7 A;  1TWG B;  1K9M C;  3NPP A;  4A93 G;  4BBS B;  1YEZ A;  2VW9 A;  2OF1 A;  1CKM A;  5LL6 X;  3K81 C;  1JJC B;  1HHV A;  2RVL A;  2NVX H;  1VS0 A;  4IQZ A;  4ABN A;  3NEN A;  1RHP A;  5L37 A;  4NDX A;  1NMF A;  2A68 D;  3HG9 A;  3G48 A;  5IT9 L;  2MFI A;  4FXG C;  2H1E A;  1B3A A;  2Z1C A;  1NSN S;  2G9H D;  3CRL C;  1NY4 A;  1O80 A;  4A76 A;  3NUC A;  1JOO A;  1SRO A;  2NZH A;  1F2Z A;  2KUM A;  2A6H D;  5D14 A;  1STG A;  2CH4 A;  1PH2 A;  2VQF Q;  2JEA I;  1EY0 A;  3R93 A;  2RDH A;  3Q23 A;  3M3Y H;  1AE2 A;  1EY8 A;  4F88 A;  5JAV A;  5C3E G;  1ENC A;  2J7Z A;  3BVG A;  1WTP A;  2GVA A;  1K8A C;  1VQ8 A;  5CBE E;  1G29 1;  5EGT A;  4DGZ A;  3ULP A;  3AB9 A;  5FO7 B;  2VQF L;  3PIO 3;  2N55 A;  4PZ7 A;  4GNX C;  1RKN A;  1DOM A;  3QWN A;  1ROD A;  1I4R A;  3T4A C;  1TWF H;  5M5X B;  4X64 L;  1HNX Q;  2HIX A;  4DR2 L;  2ICE C;  4BXX G;  1FVI A;  3V05 A;  3NWS A;  1Q3L A;  2TSS A;  3M4O H;  4JI3 L;  2CHB D;  4TKO B;  2IX3 A;  2PQA B;  4GOP A;  3GDE A;  3K59 A;  2HCC A;  3K0Y A;  1Q1B A;  1TWG H;  2UXC Q;  2I0Q A;  2UXB L;  4HJ5 A;  4A3E B;  2SNM A;  1GUT A;  3JAM E;  2X6L A;  1STH A;  5M3F H;  1FNV A;  2CFM A;  4K6D A;  1RTO A;  3WOF A;  2F4V Q;  1L0X B;  3T1H Q;  3VYU A;  3VR6 A;  1MJC A;  4M1U B;  4DNT B;  2BDN A;  2LKV A;  3RR5 A;  3U50 C;  4YY3 L;  1AFP A;  4A3L H;  3SR1 A;  2F0I A;  2OTJ A;  3MC0 B;  1XWE A;  5ELB A;  1W6J A;  3K8A A;  1Y1W H;  4QIW B;  3STB D;  2CQA A;  3PGZ A;  3G4S A;  4CKC A;  2F3V A;  1HTL D;  3NQT A;  1Q8I A;  1HPC A;  2L0C A;  2PW5 A;  2I5M X;  1S40 A;  5G3L D;  1OXV A;  1SN8 A;  2RSN A;  4GKJ L;  4LNQ A;  3U9S A;  4A3E G;  1JJ2 A;  3SGI A;  1UEA B;  3PUW A;  5JOB A;  3OPO A;  1N32 Q;  4WRD A;  1J8I A;  1DZ1 A;  3SK5 A;  4B3M Q;  3J81 c;  4P71 A;  2K5W A;  2ALY B;  2L12 A;  4DXF A;  1BNZ A;  5FK9 C;  4HSV A;  1NAP A;  4MZ9 A;  4JI1 L;  3F2C A;  4BY1 H;  4HJ8 A;  1DOK A;  1T5E A;  4IAL A;  1STA A;  3ERS X;  1SNQ A;  1YNN C;  2PO4 A;  3OIQ A;  3CME A;  1Q82 C;  3D8G A;  4HAE A;  1YJN A;  1G6Z A;  5HGQ A;  4E6I A;  1R9T H;  1F9P A;  2B2T A;  1I6H H;  4I7Z C;  2A74 C;  5JVH 3;  4DR3 Q;  1N33 Q;  4IFD H;  4JI1 Q;  2PW7 A;  4R8I A;  1EIG A;  5IYD H;  5IIF A;  1II3 A;  4O1N A;  5C3E B;  4JV5 Q;  2IT1 A;  1PYB A;  4BY7 H;  2B2U C;  1C8C A;  2UU9 Q;  4PMW A;  2AQ2 B;  3RD4 A;  4GNX A;  2RQX A;  3E3X A;  3PIP 3;  1H9R A;  1FGU A;  4PZ6 A;  1SEB D;  4DFA A;  3M3Y B;  4FVM A;  3ND8 A;  1VQ6 A;  1GD7 A;  3HKZ G;  3HOY B;  1U4P A;  4XQJ A;  3S1R H;  4U68 A;  1HTP A;  4C2M B;  1PRT C;  1L1O C;  1WCM G;  2F52 A;  1IBM Q;  1M4V A;  2MHV A;  2P5Z X;  2XIW A;  3KJP A;  2UUB Q;  2K50 A;  1D6E C;  3HOU G;  4U67 3;  2JP1 A;  3K0X A;  4JI8 Q;  3I4L A;  2Z6K C;  4V0B A;  4QY7 A;  1PTO C;  4A3M H;  1KNA A;  4DF7 A;  1ICW A;  4KV6 A;  1YNJ C;  3I72 A;  3D6W A;  2NVY B;  4IFD I;  3EA6 A;  2PMZ E;  2EZV A;  4A3E H;  1JB7 A;  2MO1 A;  1H9M A;  1J5E Q;  4DXG A;  3K5N A;  1MD2 D;  1DJR D;  4X62 Q;  3RZD H;  1YNN D;  3N6R A;  2BH2 A;  1X3F A;  1EYD A;  2D2C C;  1KQS A;  4LAA A;  4XXE A;  3T56 B;  1FNW A;  1N34 L;  2MJ8 A;  1VMC A;  1BOS A;  5M9O A;  4B3S Q;  2LFN A;  1LTI D;  3FP9 A;  4JBW A;  4YCV A;  2R7Z B;  3DWP A;  1I4P A;  2DUD A;  1PTO H;  1M90 C;  2R92 H;  1BCP C;  1GKH A;  3DLL A;  1EL0 A;  3MA2 B;  1STN A;  5KYL A;  4HSP A;  1XNQ Q;  3CMA A;  2N88 A;  4AIM A;  4A3C G;  1TS5 A;  5EAY A;  4K5W A;  2A69 D;  5C3E H;  1E22 A;  4AQY L;  3U9O A;  1YHA A;  1D8L A;  4KTA A;  1IKL A;  3NE5 B;  3BZC A;  3VR5 A;  2UU9 L;  1MJE A;  3ZYY X;  2B2W C;  2ID0 A;  3URY A;  4GS3 A;  4L5S A;  1EIF A;  1WTV A;  4JPB W;  4DV7 L;  5E4W C;  3NBH A;  3J7Z C;  2K04 A;  2C9O A;  1BBW A;  5AJ3 L;  1TXY A;  1IKM A;  4A3F B;  4OL7 A;  1ET6 A;  4ZQ3 A;  3GTO H;  2NVT B;  1O78 A;  1S72 A;  2EYP A;  1TQO A;  2F0F A;  2CWP A;  1ET9 A;  4XDX A;  5E1F A;  4MIU A;  1PH9 A;  4QCL A;  1IBK L;  4LW1 A;  1QVF A;  1B7Y B;  4YHH Q;  3M7G A;  4IPG A;  4MNO A;  3OW2 A;  4JI6 Q;  4KY7 A;  4K6L A;  3MXP A;  1J6Q A;  1IYJ B;  4X65 Q;  2JA8 G;  4DR2 Q;  4R8N A;  2F0O A;  1LTB D;  2VB2 X;  1WCM B;  4QQB X;  1TU2 B;  3BZD B;  4NB3 A;  4EQP A;  3Q8D A;  3D6C A;  4UP8 A;  1EYA A;  2YU9 H;  1HQR D;  4A3L G;  3DWA A;  5C5M A;  1QZG A;  2B2Y C;  3QIA A;  2DN8 A;  3PUY A;  1V1P B;  2BCO A;  4S3S A;  3T1Y L;  4DR3 L;  1Y1W G;  1QUQ B;  1N33 L;  2F0U A;  2F0D A;  3Q24 A;  1JIC A;  4DK0 A;  3GTQ B;  2BA0 A;  4JI8 L;  4AYB B;  4IUV A;  2HQL A;  4RGM A;  1XMQ L;  1RTN A;  2KEC A;  3I2Z A;  5C44 B;  1EFW A;  1B1Z A;  3PF4 A;  4DV5 Q;  4K2K A;  4B08 A;  2HHH Q;  1DOL A;  3RNU A;  4IPD A;  5HY6 A;  1U9R A;  1MGS A;  2D9U A;  1PTO D;  3FKI G;  4DR6 Q;  1U4L A;  1I5F A;  4OEM B;  2PQE A;  4CJ0 B;  2E2D C;  1HUM A;  4DV6 Q;  3PUX A;  1PLF A;  3WOE A;  2F0L A;  2KCM A;  3R8B A;  5KNC A;  1PH4 A;  3RZO B;  2PYK A;  1LM0 A;  1IYU A;  4NW2 A;  1A2U A;  2K5V A;  2EY2 A;  5FLX L;  1SAP A;  1A2T A;  2SNS A;  4HJ9 A;  2VB3 X;  3PO2 H;  4LUZ A;  4JI7 Q;  1X65 A;  1TWC B;  1O7L A;  2UUC L;  4FO2 A;  4FF4 A;  4QJF A;  2ZM6 L;  1BQQ T;  1UE5 A;  4A3J G;  4HMJ A;  5JEA J;  2NBF A;  1G6P A;  3JC6 6;  2F4V L;  4H0L C;  2F0W A;  3SHL A;  2F0T A;  1MSH A;  2NYZ D;  1LLR D;  5I4D A;  3HOV H;  1WVL A;  4WOR A;  3ULL A;  5K5P A;  4RG1 A;  2FJ2 A;  1CFM A;  1SDF A;  2DY8 A;  1ICF B;  4LK1 C;  2F0N A;  3BZK A;  1EY9 A;  4LFB L;  5M5Y B;  1K8O A;  2L5T A;  4JCV E;  3J7A V;  1KHI A;  4IJH A;  5D3D A;  3BVM A;  3HOX H;  5JJZ A;  1SR3 A;  1CT1 D;  2AUK A;  1EYG A;  2X6G A;  1CQV A;  2EVB A;  1MKH A;  1E2V A;  4O42 A;  3BG3 A;  3G6J B;  2V1C C;  5M5W B;  1VQH A;  3CU7 A;  2QCP X;  2QDB A;  3DM1 A;  5I2X A;  2K01 A;  1V43 A;  4Q0F A;  3V96 A;  2VUM B;  3QG1 A;  3HEJ A;  3PO3 G;  3I4M B;  3K57 A;  4QF4 A;  4LFA L;  3GTK H;  1EEF D;  5LHY 1;  2F1M A;  4H02 A;  3SK6 A;  3W2D A;  4P74 A;  1FR3 A;  1HRJ A;  1LTS D;  2EOT A;  1AP0 A;  4C3I B;  4MTK A;  2IW3 A;  1L1O A;  3GD7 A;  3L9A X;  1O7Z A;  1CUK A;  2PZU A;  4KY5 A;  3GTM B;  4RKB A;  1O7I A;  2AUJ D;  2DJF C;  3MFY A;  1T9H A;  2NTT A;  4A3K B;  3PO2 G;  1LT4 D;  4IUN A;  1Y69 U;  1GUN A;  5KNB A;  3UE0 A;  1NR2 A;  2ZXO A;  4IZ8 A;  3QR8 A;  3AFQ A;  2VNU D;  1P8L A;  2E2H B;  4IOA A;  5ELO A;  3RLF A;  1S5B D;  4IUQ A;  1EFI D;  4TRD A;  1DCZ A;  5C4J H;  2ZTC A;  3CCM A;  4PV1 C;  3CW2 C;  1CZG A;  1VQL A;  1JWM D;  3BYY B;  1L0W A;  4N9T A;  1DYQ A;  2AWN A;  4KK7 A;  2E2J B;  2IHF A;  5FO9 B;  3L0O A;  2CWA A;  4RMF A;  3HOW B;  1CKO A;  1SND A;  1TWA B;  4A3G G;  1A3U A;  1CSP A;  2R6G A;  3M9B A;  2M2L A;  3CCJ A;  1ZEQ X;  4M8A A;  4P73 A;  1WD1 A;  1FJG Q;  3CC4 A;  1EQR A;  4DV7 Q;  1X55 A;  3JAM L;  1KL9 A;  4A3F G;  1Q1E A;  1CTM A;  4GKK L;  1OXS C;  1IL8 A;  2EY5 A;  4JG2 A;  3I70 A;  4CBV A;  1K8M A;  4B9X A;  1B53 A;  3ND9 A;  1QNU A;  4YCU A;  3H6M A;  1EYC A;  1G2S A;  4C3J H;  2IJ0 A;  5DAU A;  1B44 D;  5BN4 A;  3BYT B;  2Z9H A;  2OTL A;  4QUF A;  4I7A A;  2NVX B;  1DM0 B;  2B8G A;  5FJ8 H;  5EQ0 A;  3S2D B;  1AN8 A;  4B3S L;  1Q46 A;  1KXL A;  1V9P A;  3P75 A;  2AKW B;  3BDL A;  2RCF A;  3W1B A;  2K75 A;  5BR8 Q;  1LUZ A;  3I56 A;  5GAD C;  5DNF A;  1HXY D;  3K5M A;  4GOP C;  2JA6 H;  4YCW A;  1PV4 A;  3GP7 A;  4A3M G;  4UPA A;  1M1K C;  4BY1 B;  1UE1 A;  2Q8I B;  5EKL A;  1GVP A;  4TSS A;  1WTX A;  1Y14 B;  4YHH L;  1SYF A;  4WFN 3;  4OX9 Q;  4C3H G;  2NZ1 D;  3H09 A;  1S5F D;  1H9S B;  2AHO B;  2O5I C;  1EY7 A;  2ZXR A;  2IX0 A;  1XPU A;  3D4W A;  5C0X H;  3RUZ A;  2NZO A;  1UE7 A;  4K0K Q;  2K6A A;  1SE4 A;  5E4X A;  2NN6 I;  4NMZ A;  5CV6 A;  1MSG A;  4QMG A;  5GQO A;  4BBR G;  3C2P A;  5IP9 G;  5LMN W;  4OON A;  5I9P A;  2R93 B;  1K28 A;  4CJ1 B;  1CQF A;  1HJP A;  2AQ3 B;  1H95 A;  3HKZ B;  3J81 j;  5M3F G;  1SNO A;  4KKU A;  1H9K A;  1U4M A;  1BCP F;  1E2Z A;  1HR0 W;  2F0Q A;  3M7N A;  1IXR A;  4IN3 A;  1MIU A;  3KLS X;  1IHZ A;  2NTS A;  3T1H L;  5CMD A;  4RHR A;  2R7D A;  4HIK A;  1ZKO A;  4PZ8 A;  5IYB H;  1C7Y A;  3AU7 A;  4AH6 A;  5C0X I;  2CKZ B;  1PDQ A;  1WTW A;  4DR7 Q;  3CF5 A;  2WIN B;  3TP6 A;  3I4O A;  4NXN L;  4DR1 Q;  3PO3 B;  2HT1 A;  3M85 A;  5IWA L;  3FKI H;  1PFB A;  4XQQ A;  5E3F A;  4XYQ A;  4BA2 I;  4KHP Q;  3TZD A;  2M00 A;  4PMC A;  3CXC A;  1Q7Y C;  1QNK A;  1S4Z A;  3A5U A;  1E24 A;  1PXU A;  1HA6 A;  1EZ8 A;  3CKI B;  1IW7 D;  4LMQ D;  3I4N B;  5ELD A;  2Q2U A;  4QUC A;  3VR4 A;  1SYD A;  3AFP A;  1QE6 A;  1WD0 A;  1P16 A;  1YIJ A;  3S9W A;  1VF5 C;  3S17 B;  3AYH B;  3S1N B;  4HED A;  3SK8 A;  4WJW A;  2B2W A;  1QZH A;  3FHW A;  3GTJ H;  4A3J B;  3K80 C;  5I6Y A;  5ELF A;  2KVM A;  2DY7 A;  4H44 C;  5J3B A;  2WB1 B;  1KRS A;  2NVY H;  3SXH A;  4B3T L;  4CKE A;  4RA8 A;  2UUA Q;  2HIV A;  3ICE A;  3A0J A;  3H0G H;  3I55 A;  4EQN A;  2NUC A;  3U58 A;  4A3M B;  4JV5 L;  1ZYR C;  1PH8 A;  3U4V A;  2BDO A;  3A8J E;  3M4Q A;  1BR9 A;  4B3T Q;  2PMZ B; 
#chains in the Genus database with same CATH homology
 4B3S Q;  3TQY A;  3FP9 A;  4A3K H;  4R4T A;  5IYC H;  2N3S A;  5BR8 L;  4DV2 Q;  4JBW A;  4YCV A;  4L5R C;  1YHB A;  3CCR A;  4DV1 L;  1EQQ A;  4ALP A;  1SLJ A;  2KCT A;  4DV1 Q;  2DUD A;  1PH5 A;  3S2H H;  1M90 C;  2R92 H;  2RHQ B;  4UP7 A;  1JT8 A;  1GKH A;  1N9W A;  3DLL A;  1OXU A;  1PHJ A;  4IOC A;  3E0E A;  1XNQ Q;  1BKB A;  3CMA A;  2N49 A;  4AIM A;  4A3C G;  3L7Z C;  3NBH B;  5EAY A;  3ZJY C;  3F2B A;  1I50 H;  1VQF A;  5C3E H;  4NPS A;  1E22 A;  1E1O A;  4AQY L;  2ZM6 Q;  1K0R A;  1YHA A;  3CCL A;  1D8L A;  4DR6 L;  1XMO L;  5FLM G;  3BZC A;  1YZ6 A;  1NE3 A;  2KEN A;  2ZTD A;  4UP9 A;  3KLW A;  4TQU S;  5LMN Q;  3UDG A;  2UU9 L;  3TS0 A;  1MJE A;  2R92 G;  2ID0 A;  3S2D H;  4GS3 A;  3I7F A;  4L5S A;  4GKJ Q;  1EIF A;  2KHI A;  4JI2 L;  1J5E L;  2PI2 A;  4JBJ A;  4DR1 L;  1KAW A;  4NXN Q;  4DV7 L;  5FJ8 G;  3KOJ A;  1U0L A;  4X66 Q;  3J7Z C;  5H1S E;  1HNW Q;  1BBW A;  5AJ3 L;  1OTC A;  4JI0 Q;  1TXY A;  3CCV A;  4GKK Q;  2CCZ A;  3JAM c;  4IPH A;  4C2M H;  4QIW E;  3J81 i;  1WI5 A;  3CCQ A;  3GTO H;  2A19 A;  3S1N H;  3E9I A;  2YYZ A;  1S72 A;  1HZB A;  4A3D H;  3I4N H;  2Q2I A;  2RHS B;  4GLV B;  3HOY H;  2CWP A;  5M5X H;  3PUV A;  3T1Y Q;  1PH9 A;  4JYA L;  3HOZ H;  2UXD Q;  1IBK L;  4LW1 A;  5AJ3 Q;  4JI0 L;  4A3B H;  1TWH H;  1UWV A;  1QVF A;  4YY3 Q;  4HIO A;  1B7Y B;  4LF5 Q;  4YHH Q;  4JI4 L;  4MNO A;  4IPG A;  5C4X H;  3OW2 A;  3PV0 A;  1PH7 A;  3M4P A;  4JI6 Q;  1ASZ A;  3HOZ G;  3CPW A;  1J6Q A;  1IYJ B;  1S3O A;  2YTX A;  4P75 A;  4LFA Q;  2Q2H A;  4X65 Q;  4X65 L;  2JA8 G;  1NBW A;  4DR2 Q;  4WJ4 A;  1HH2 P;  1WYD A;  4L5T A;  3I4N G;  1X6O A;  4DAY B;  1TWA H;  1L1O B;  3CCU A;  4QQB X;  3CPF A;  2E8G A;  1ASY A;  4R4O A;  4OO1 I;  4NB3 A;  4O2D A;  3TS2 A;  3Q8D A;  3OYY A;  4OWX B;  4UP8 A;  2UXB Q;  2YU9 H;  2E2J H;  4A3L G;  1WFQ A;  1W3S A;  4A3I H;  3U4Z A;  1VQD A;  1QZG A;  1Q12 A;  4EQ5 A;  4QL5 A;  3PUY A;  1Y1V G;  5IP7 G;  3W1G A;  3T1Y L;  4DR3 L;  1Y1W G;  1QUQ B;  4MTN A;  4LF8 Q;  1N33 L;  4LF4 Q;  1RL2 A;  4GNX B;  4JI7 L;  4LF8 L;  2VUM H;  4JI5 Q;  1SFO H;  2BA0 A;  3CCE A;  2XTI A;  1K3R A;  4JI8 L;  5GAG C;  1HR0 Q;  2HQL A;  4X66 L;  1HNW L;  3W5O A;  1XMQ L;  1KRT A;  3I2Z A;  1EFW A;  1XPR A;  3GTQ H;  4Y52 H;  5FLM H;  2PQA A;  4DV5 Q;  1TWC H;  2N78 A;  2VZA A;  4DK6 C;  4A3F H;  4XIG S;  3PF4 A;  4AYB E;  2HHH Q;  4IFD G;  1LYL A;  3KYH C;  2B63 H;  3RNU A;  3S15 H;  4YWK A;  1PH6 A;  2D62 A;  4JI2 Q;  2WAQ E;  2OQK A;  4IPD A;  3GTM H;  5HY6 A;  2ATW A;  4LFC L;  1N8R C;  1I94 L;  2VUM G;  2JA6 G;  4X62 L;  4BBS H;  1X9N A;  2JA7 G;  3FKI G;  5JJI A;  4DR6 Q;  4OXP A;  3I4M G;  1I5F A;  4OX9 L;  5IT9 c;  4DV0 L;  2K52 A;  2PNH A;  4JBM A;  4DV6 Q;  5FLX c;  5GRO A;  3PUX A;  1C9O A;  2Y0S G;  1EWI A;  1B8A A;  3HKS A;  4KI0 A;  2KCM A;  4IJL A;  4IO9 A;  2K5N A;  1XNQ L;  1PH4 A;  2UXC L;  1NJI C;  1I94 Q;  4LFC Q;  2R7Z G;  1LM0 A;  1NTG A;  1GM5 A;  4DV2 L;  1K73 C;  2N8N A;  1XPO A;  1VQE A;  4B3R Q;  4ME3 A;  1PA6 A;  1EOV A;  4LF5 L;  2K5V A;  5JJL A;  3KDF A;  5DLQ E;  1CKN B;  2KBN A;  2QA4 A;  4LF7 Q;  1Z47 A;  3D0F A;  2YTY A;  4HJ9 A;  3GTL H;  1PFS A;  1VQB A;  2PI2 E;  3PSI A;  4P72 A;  4A4I A;  1VQC A;  1EUJ A;  4LUZ A;  3PO2 H;  5JJK A;  1IZ6 A;  2JK8 A;  3MEF A;  3S24 A;  2YV5 A;  2JQO A;  1YJW A;  4JI7 Q;  1X65 A;  4HIM A;  1WOC A;  1I3Q H;  4IFD J;  2B63 G;  3OTO L;  1HZ9 A;  4DUY Q;  2MO0 A;  2UUC L;  1CSQ A;  1VCI A;  2E2H H;  4QJF A;  1Q86 C;  2ZM6 L;  1B70 B;  4JC0 A;  2MNA A;  1VQN A;  2Q2T A;  1UE5 A;  4Y7N H;  5C0X G;  4DR5 L;  4DV0 Q;  1CKN A;  3HOX G;  4DR5 Q;  4A3J G;  1VQP A;  1YIT A;  4POG A;  1A63 A;  5JEA J;  2AMC B;  1N36 Q;  1G6P A;  2L15 A;  3JC6 6;  2E5L L;  2F4V L;  1WCM H;  1YVC A;  2Y0S E;  3G6E A;  4DV4 L;  4LF6 Q;  1SRU A;  3KF6 B;  1PYS B;  4AQY Q;  4JBK A;  3HOV H;  3PO3 H;  3KF8 B;  3ULL A;  4POF A;  1OXT A;  4RG1 A;  4DV5 L;  3CQZ H;  3EBE A;  2JA7 H;  4OWW B;  2EXD A;  1Q81 C;  4LFB L;  4LFB Q;  1K83 H;  3BZK A;  2JEB I;  2K4K A;  3HOV G;  4L5Q A;  3LGJ A;  3F1Z A;  4DV3 Q;  1IL2 A;  4OO1 G;  1FJG L;  3S1M H;  4JCV E;  4JI5 L;  3F2D A;  1KHI A;  2D0P A;  4IJH A;  1JMC A;  2VQE Q;  3HOX H;  4A3J H;  2QGQ A;  1PH3 A;  1SR3 A;  1XNR Q;  2D0O A;  3WWV A;  1EYG A;  4B3R L;  1BVS A;  1L2F A;  1MKH A;  4JI3 Q;  2FXQ A;  4GN5 A;  4DR4 L;  4LF9 Q;  3BU2 A;  2B29 A;  3CP0 A;  4R1J A;  3IRB A;  1PH1 A;  1VQJ A;  3G71 A;  5IE8 A;  4R4I A;  2IHE A;  3UE1 A;  5IYB G;  4DV6 L;  2V1C C;  3H15 A;  1VQH A;  4A3C H;  4FDB A;  4XTC S;  1V43 A;  2NN6 G;  5C0X J;  5IWA Q;  4A3D G;  2K5H A;  1A0I A;  1Z9F A;  1UEB A;  3OTO Q;  2UUC Q;  3PO3 G;  3CC7 A;  3HFZ B;  4C3I H;  3J7A 5;  1JJG A;  2B3G A;  2VS1 A;  4LFA L;  4GOP B;  1OXX K;  3GTK H;  4X64 Q;  4QGU A;  4DR7 L;  1C0A A;  3MXN B;  4H02 A;  4BXX H;  4KHZ A;  5E7N A;  1HNZ L;  5M3M G;  1E3P A;  4P74 A;  2WP8 J;  4AYB G;  1K8G A;  2JA9 A;  4GN3 B;  2QEX A;  1IBK Q;  4EX5 A;  1K9M C;  1L1O A;  3GD7 A;  4A93 G;  1JE5 A;  1YEZ A;  2VW9 A;  1CUK A;  3RN5 A;  1CKM A;  1QUQ A;  4DAM A;  3DM3 A;  5C4X G;  3CCS A;  1VQA A;  2H5X A;  3K81 C;  1JJC B;  1O7I A;  2XGT A;  1VS0 A;  2NVX H;  1T9H A;  1VQ9 A;  1VQ4 A;  2E2I H;  3NEN A;  4DUZ Q;  3PO2 G;  1D7Q A;  1Q8K A;  2BA1 A;  1NMF A;  4BBR H;  2IY5 B;  4A3G H;  2R7F A;  3UE0 A;  3CC2 A;  3AFQ A;  3D31 A;  3G48 A;  1XTD A;  2MFI A;  2VNU D;  1P8L A;  4GLX A;  4IOA A;  5ELO A;  3RLF A;  3J80 i;  2LXJ A;  4A3I G;  1VQ5 A;  3RLO A;  4DNI A;  4LF9 L;  1NY4 A;  4A76 A;  1FL0 A;  1SRO A;  3CAM A;  3NEL A;  2NZH A;  1YNX A;  2ZTC A;  5M5Y H;  5C4J H;  3CCM A;  5LMU L;  3CW2 C;  3AQQ A;  1VQL A;  1IBL L;  3HOY G;  1L0W A;  3RLN A;  2AWN A;  1PH2 A;  2UXD L;  2ES2 A;  4K0K L;  4R4C A;  2VQF Q;  2IHF A;  5GAH C;  2OQ0 A;  2JA8 H;  4DPG A;  3PUZ A;  3L0O A;  3PIP A;  2JEA I;  3M3Y H;  3GTG H;  3H3V I;  2CWA A;  4RMF A;  1AE2 A;  2EIF A;  1CKO A;  4GN4 B;  4BBS G;  4A3G G;  5C3E G;  1K8A C;  1CSP A;  2GVA A;  2R6G A;  2WB1 G;  3M9B A;  2WFW A;  4BA1 I;  1VQ8 A;  4NXM Q;  3CCJ A;  1FJG Q;  3B6Y A;  2Z6K A;  4P73 A;  2ZJR A;  1G29 1;  3ULP A;  3UDI A;  3CC4 A;  4LUO A;  1EQR A;  4DV7 Q;  3STB C;  2VQF L;  1X55 A;  1X56 A;  1KL9 A;  4A3F G;  4HID A;  1Q1E A;  4PZ7 A;  4R4Q A;  1EIY B;  4GNX C;  4GKK L;  1OXS C;  4JG2 A;  4A93 H;  4BY7 G;  1N32 L;  2BH8 A;  1VQK A;  1TWF H;  5LMU Q;  1YBY A;  3TRE A;  4X64 L;  1HNX Q;  1HNX L;  2A8V A;  5IYC G;  5M3M H;  3KDF B;  2HIX A;  4YCU A;  4DR2 L;  4GLA C;  5M5W H;  4BXX G;  1FVI A;  4C3J H;  1KC8 C;  4X6A H;  1XMQ Q;  1SMX A;  3M4O H;  2OTL A;  1DGS A;  4JI3 L;  4DR4 Q;  1A8V A;  4KHP L;  5GAE C;  2PQA B;  4GOP A;  5FJ8 H;  3H3V H;  2GVB A;  3HKZ E;  3GDE A;  2CQO A;  1LTL A;  4UY8 C;  1Q1B A;  2VY3 A;  2OCE A;  4JOI C;  3ER0 A;  3UDX A;  1KD1 C;  1TWG H;  4B3S L;  2UXC Q;  1Q46 A;  1KXL A;  1X3E A;  1V9P A;  2AKW B;  1YHQ A;  2KHJ A;  4J15 A;  2I0Q A;  2UXB L;  1WJJ A;  3W1B A;  2K75 A;  5BR8 Q;  1LUZ A;  3I56 A;  4HJ5 A;  2LSS A;  5GAD C;  1PVO A;  4GOP C;  2R93 G;  2JA6 H;  3PF5 A;  4YCW A;  1PV4 A;  4HJ7 A;  1SE8 A;  1RIP A;  2C35 B;  4PG3 A;  2K14 A;  2ZJP A;  4A3M G;  1KIX A;  5M3F H;  3BJU A;  4UPA A;  1M1K C;  2CFM A;  1UE1 A;  3PCO B;  5IP7 H;  1GVP A;  2F4V Q;  1U5K A;  3S17 H;  1Y14 B;  2ZTE A;  3T1H Q;  2EQS A;  2UUA L;  4DV4 Q;  1MJC A;  4YHH L;  3RR5 A;  4JI4 Q;  3U50 C;  3S16 H;  2VL6 A;  4YY3 L;  4A3L H;  2OWO A;  4OX9 Q;  2OTJ A;  2WB1 E;  1A62 A;  2AHO B;  3GO5 A;  3HOW G;  2A1A A;  5ELN A;  1E7Z A;  2IX0 A;  3K8A A;  1XPU A;  1Y1W H;  2IX1 A;  3JAM i;  1VQO A;  3A5Z B;  3STB D;  3VDY A;  3PGZ A;  3G4S A;  3CD6 A;  1GO3 E;  2NZO A;  1UE7 A;  2GN5 A;  4K0K Q;  5JEA G;  2NN6 I;  4OWT B;  1UE6 A;  4C3H H;  1VQG A;  2I5M X;  1S40 A;  1QVC A;  5GQO A;  1OXV A;  4BBR G;  5IP9 G;  2NVQ H;  5LMN W;  1SN8 A;  4OON A;  4LUV A;  4GKJ L;  4WJ3 M;  3KJO A;  4LNQ A;  4A3E G;  1JJ2 A;  1HJP A;  1HZA A;  3SGI A;  3KF6 A;  3PUW A;  1H95 A;  1E1T A;  3J81 j;  5M3F G;  1N32 Q;  3EIV A;  2JJQ A;  1HR0 W;  1X54 A;  1YI2 A;  2JA5 H;  3M7N A;  1IXR A;  4B3M Q;  4B3M L;  3J81 c;  5C44 H;  4P71 A;  2R7Z H;  4A3K G;  2F3I A;  1MIU A;  1BBU A;  2ALY B;  4APV A;  3K7U C;  4DUZ L;  3T1H L;  4JYA Q;  4MZ9 A;  4JI1 L;  1XJV A;  4DUY L;  3F2C A;  4BY1 H;  4HJ8 A;  3KFU A;  2I5L X;  2R7D A;  4HIK A;  2VQE L;  4A75 A;  4PZ8 A;  4DK3 C;  5IYB H;  3ERS X;  3CME A;  4O0A A;  1VQ7 A;  3E9H A;  1Q82 C;  4JI6 L;  3S1Q H;  1W2B A;  2MQH A;  1YJN A;  2RF4 A;  3EN2 A;  1C7Y A;  5C0X I;  2LXK A;  4AH6 A;  2CKZ B;  5HGQ A;  5IYD G;  3NEM A;  3CF5 A;  1R9T H;  1QVG A;  4DR7 Q;  5IY0 A;  1IBM L;  4NXM L;  1I6H H;  3I4O A;  4LF4 L;  4DR3 Q;  1N33 Q;  2ASB A;  4NXN L;  4JI1 Q;  4DR1 Q;  1AE3 A;  2HT1 A;  5C44 G;  3M85 A;  4LF6 L;  3AEV A;  4TVA B;  4YWM A;  5IWA L;  3RZO H;  5IYD H;  3FKI H;  4JV5 Q;  2JE6 I;  2IT1 A;  2R93 H;  1AH9 A;  1PYB A;  4BA2 I;  4BY7 H;  4KHP Q;  5LMN L;  4PMW A;  2UU9 Q;  2YTV A;  4GNX A;  3CXC A;  3PIO A;  1Q7Y C;  3A74 A;  1IBL Q;  4IPC A;  1FGU A;  4PZ6 A;  3A5U A;  3ULJ A;  1E24 A;  1VQ6 A;  1GD7 A;  3HKZ G;  3TRZ A;  2DGY A;  1XNR L;  2Q2U A;  2I5H A;  3S1R H;  1Y1V H;  5K36 G;  1HZC A;  1L1O C;  1WCM G;  3AFP A;  3H0G G;  1G51 A;  4KLK A;  2HHH L;  2F52 A;  3F8T A;  2UUB L;  1IBM Q;  3S14 H;  4DV3 L;  1NMG A;  1P16 A;  3KJP A;  2UUB Q;  1YIJ A;  2K50 A;  1HNZ Q;  3HOU G;  3K0X A;  4JI8 Q;  3UDF A;  1HR0 L;  2Z6K C;  4YWL A;  4QY7 A;  3AYH B;  4A3M H;  2NVT H;  2JA5 G;  1QZH A;  3FHW A;  2AWO A;  3GTJ H;  4A3B G;  1YJ9 A;  3K7A H;  1X3G A;  3K80 C;  4IFD I;  2PMZ E;  3RN2 A;  2ZJQ A;  2WAQ G;  4DKA C;  5J3B A;  2Z0S A;  2RCN A;  4A3E H;  1JB7 A;  2E5L Q;  1KRS A;  2MO1 A;  2NVY H;  4B3T L;  1V1Q A;  1N36 L;  1J5E Q;  1N34 Q;  3HOU H;  2UUA Q;  2HIV A;  3ICE A;  3A0J A;  4HJA A;  1VQM A;  5IP9 H;  3H0G H;  4X62 Q;  1VQI A;  3I55 A;  3L2P A;  3U58 A;  3RZD H;  3HOW H;  4JV5 L;  2BH2 A;  1X3F A;  1PH8 A;  1XMO Q;  3U4V A;  1KQS A;  3TEH B;  3M4Q A;  3GTP H;  4BY1 G;  4LF7 L;  3I4M H;  4JOI A;  4LWC A;  1N34 L;  3J80 c;  4B3T Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...