2ZM6Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
total genus 17
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zm6Q00
4A3FG 2PI2A 1IZ6A 1HR0L 1E22A 4AQYQ 4POGA 2CCZA 4BY7G 1J6QA 1HR0Q 2YTVA 3L0OA 3ZJYC 5IYDG 5IP9H 4BXXG 4GOPA 4GLVB 1L0WA 2I5LX 4DR5L 1Y1WG 5C44H 1HZBA 1PH3A 1E1TA 1CKNA 4EQ5A 3FKIH 1W2BA 5E7NA 4DR5Q 1HNWL 1VQ6A 1Z9FA 1FGUA 1P16A 1Q8KA 1MIUA 1PYBA 2NZOA 3GD7A 3HKSA 5BR8L 3L2PA 1KRSA 1NBWA 1HNWQ 1UWVA 3PGZA 3TREA 3G71A 3PSIA 5K36G 5BR8Q 1B8AA 2NVXH 2WB1E 5FLXc 2K4KA 2K52A 2GVAA 5FLMH 5JJLA 1K8GA 2RHQB 3A5ZB 4C2MH 4PZ8A 3S1MH 4A3FH 1XPOA 3KF6A 2VQEL 3U4ZA 1CUKA 1VCIA 1A63A 5M3FG 1VQLA 3PUYA 4AH6A 1E24A 2VQEQ 2F4VL 1UEBA 2MQHA 3PV0A 3HKZE 3H15A 4BXXH 1WCMH 1L1OA 3KJOA 4R4IA 3RZDH 2F4VQ 2CWAA 4PZ7A 4L5RC 1WJJA 2KENA 5ELNA 3J7ZC 3T1HL 1CKMA 3LGJA 1Y1WH 2R7FA 2E2HH 2JA5G 3A5UA 2NVTH 4DR6L 5C4JH 4A93H 3NBHB 1SE8A 3T1HQ 3RZOH 4QJFA 3BJUA 3M4QA 2PMZE 5GQOA 4DKAC 4DV4L 4OO1G 4DR6Q 1AH9A 2OTJA 1TWCH 5JEAG 1BVSA 2CQOA 2DGYA 3CP0A 3CCSA 4DV4Q 1PH5A 2R92G 2LXKA 2ZTEA 4DV2L 2ID0A 4UPAA 3S1QH 1Y14B 1EFWA 3K8AA 4DV2Q 2OWOA 5JJIA 4B3RL 4HIOA 3GTJH 3S2DH 1SRUA 3K7UC 2IX1A 4B3RQ 5C0XG 2E5LL 1Q12A 3HOUG 1IXRA 3FP9A 4P71A 4K0KL 1L1OB 3I56A 5M3FH 4A3CH 2A19A 2ZTDA 4A3BG 4QQBX 2E5LQ 3PUZA 4L5TA 2V1CC 4K0KQ 3S14H 4DK6C 3A74A 3G48A 5IWAL 4PZ6A 1Q81C 3J81c 5IWAQ 3CCMA 3CPWA 4YCUA 5LMUL 4XIGS 3CCVA 2PNHA 3M7NA 4IOAA 4POFA 1I5FA 5LMUQ 1X3FA 1X6OA 4H02A 2JK8A 4DK3C 2R92H 4DUZL 2NVYH 2N78A 4DUZQ 4IFDG 4GN3B 4A3DG 3UDFA 1EOVA 4C3HH 5IYBG 2IX0A 4BBSG 1XNRL 2AMCB 2D0PA 2WAQG 3STBC 3IRBA 1XNRQ 3OW2A 1PFSA 2UU9L 3HOUH 1T9HA 4Y52H 3CCUA 3S17H 1VQEA 2VQFL 2UU9Q 3Q8DA 4C3JH 1O7IA 2RF4A 3CCQA 4DV7L 5DLQE 2EXDA 1NY4A 2VQFQ 4JI7L 2AKWB 4HJAA 4DV7Q 1Q7YC 1PV4A 1VQ5A 2VS1A 2JJQA 3S24A 3CCRA 5M5YH 4IJLA 1EYGA 1JMCA 2WP8J 4JI7Q 5LMNW 2UXCL 4AYBG 3I4NH 1UE7A 2QGQA 3E9HA 1A8VA 1KHIA 4KI0A 4A75A 4A3LG 2UXCQ 5H1SE 1IBKL 3PO2H 4HIKA 3MXNB 3GTQH 4HJ9A 1N32L 4R4TA 4NPSA 1IBKQ 1YIJA 1PYSB 2VNUD 4JOIA 1N36L 1N32Q 3GO5A 5IP9G 3CMEA 4BBSH 1NTGA 4YHHL 1FVIA 4GN4B 1N36Q 1KC8C 4DR1L 1HNZL 4YHHQ 3S15H 5IY0A 4DR1Q 3FKIG 2A1AA 1HNZQ 4LFBL 1VQ8A 1SLJA 4DV3L 1GD7A 1UE5A 3J81i 3AYHB 4LFBQ 1BBWA 4DV3Q 4PMWA 3KDFB 4O0AA 1VQNA 1Q1BA 2JA7H 1CSQA 2NN6I 2OQ0A 4P74A 3W1BA 3S1RH 1QVGA 1VQIA 3RLOA 3CXCA 1LTLA 5FLMG 1HZAA 3T1YL 2NVQH 3TS2A 2UUBQ 1PH2A 2JE6I 4BY1H 4JV5Q 3T1YQ 4A3LH 1YVCA 2MFIA 4BBRH 3J81j 3E9IA 4JI8L 3ULPA 1HZ9A 3PIPA 2LXJA 3S2HH 1VQCA 1B70B 5IP7G 4DV6L 1NE3A 3UDXA 4JI8Q 1WCMG 1Q46A 1I3QH 2MO0A 4DV6Q 3NEMA 3HOZH 2N8NA 2PI2E 1E7ZA 1TXYA 2ZTCA 4GNXB 4A93G 1R9TH 4OWXB 1SFOH 2UUCL 3E0EA 2ALYB 1YITA 4L5SA 4HJ5A 4LF8L 1DGSA 2UUCQ 4X6AH 2KHJA 4QIWE 1N9WA 4LF8Q 1QVCA 1XNQQ 2ASBA 4LUVA 1OXVA 2HT1A 2R7ZG 4DNIA 1EWIA 4IPDA 4HIDA 2WAQE 2Y0SE 3ERSX 1C0AA 2EQSA 2H5XA 2RCNA 2KBNA 4AIMA 1C9OA 2BH2A 1JJGA 1JT8A 1KD1C 4A3CG 4GOPB 2VY3A 4A3IH 5IP7H 2YTYA 3K7AH 2D0OA 2F52A 1VQBA 2PQAA 4QY7A 2ZM6L 2EIFA 1U5KA 2HQLA 4IPGA 1CKNB 5GADC 2UXDL 4JC0A 3K0XA 2CKZB 1UE1A 2ZM6Q 1X56A 2UXDQ 4A3GH 1XPRA 2N3SA 3I55A 3STBD 4AYBE 4IPCA 3UDGA 5M5WH 1PVOA 2XTIA 4Y7NH 2K75A 4HIMA 4FDBA 1RIPA 3BU2A 3PUWA 4UP9A 1KRTA 2QA4A 2HHHL 4QGUA 4JYAL 1WYDA 1YHAA 4RG1A 3WWVA 2HHHQ 3HOYH 3UDIA 1VQPA 1PHJA 2R7ZH 3KF6B 4JYAQ 4GLXA 3DM3A 1EQRA 2BA0A 4LF7L 4OWTB 4OX9L 2A8VA 1V43A 1ASZA 4LF7Q 2QEXA 4OX9Q 1MJCA 4YWKA 4QL5A 3HOXH 1AE2A 4OONA 1QUQA 4A3MG 4OO1I 3ER0A 3AQQA 2I5MX 2R6GA 3PIOA 1VQFA 4DR2L 1V9PA 2Q2HA 2GN5A 3H3VI 1NMFA 4DR2Q 1PH8A 3I4NG 1Q1EA 2B3GA 1XJVA 3I7FA 4P75A 1JE5A 2YU9H 3GTPH 3PO2G 3OYYA 3UE0A 2CWPA 1EQQA 3F1ZA 5LMNL 3S16H 5C0XI 4NB3A 4EX5A 4IPHA 5IE8A 2K50A 4R4CA 5LMNQ 3I4MG 2F3IA 5HY6A 4BA1I 2Y0SG 4YWLA 3JC66 1KIXA 3BZCA 4NXNL 4A3EG 1PH7A 4LNQA 1XMQL 4R1JA 4APVA 3L7ZC 4NXNQ 1TWAH 1YI2A 1XMQQ 2BA1A 4A3MH 1UE6A 4R4QA 2YTXA 4L5QA 4X65L 1GM5A 4B3TL 2IT1A 3GTKH 3M9BA 1BBUA 2JA7G 4JBKA 4X65Q 4B3TQ 3A0JA 1I50H 3F2DA 4BY1G 1Y1VG 2IHEA 3NENA 2CFMA 3VDYA 4DR4L 2ZJRA 1BKBA 4BBRG 5EAYA 1PH9A 4UP8A 1H95A 1X65A 2YYZA 3CW2C 3KJPA 4DV5L 4DR4Q 1A0IA 1LYLA 4JI3L 3CCJA 2DUDA 2B63H 3I4MH 3TEHB 1N8RC 3CCEA 2JEBI 4DV5Q 1XMOL 3M4PA 4DAMA 4JBMA 2VUMH 3EBEA 4JI3Q 3HOZG 3HOWG 1VQOA 1CKOA 2NZHA 1XMOQ 4B3SL 3AEVA 1YBYA 4A3EH 1YJ9A 1KXLA 4LF6L 1LM0A 1OTCA 4B3SQ 1TWFH 2D62A 2KCMA 1OXTA 2E8GA 4LF6Q 2K5HA 1VQMA 4ALPA 4LF5L 2OCEA 2N49A 2VZAA 3EIVA 2NN6G 1S40A 2KHIA 1GVPA 4A76A 4LF5Q 4LWCA 3G6EA 1Y1VH 2KCTA 2FXQA 1E3PA 2LSSA 4RMFA 5GAEC 3PF4A 1YHBA 2GVBA 1K0RA 1N34L 1VQ7A 4XTCS 2K5VA 4C3IH 4A3IG 3H0GH 2K5NA 1WFQA 1X54A 4IJHA 1N34Q 2UXBL 1JJ2A 3KOJA 3CD6A 3HOWH 3HOVG 1IBLL 1K73C 4UY8C 2ES2A 1U0LA 4A3GG 2BH8A 1Z47A 1K9MC 4GS3A 2UXBQ 1IBLQ 2HIXA 4GKJL 4X64L 5JEAJ 1VQ4A 1L1OC 4X64Q 3W5OA 1A62A 4GKJQ 2OTLA 1Q86C 1RL2A 2ZJQA 4GN5A 5HGQA 5JJKA 5IYCH 3CC2A 1X3GA 2YV5A 1VS0A 3KLWA 4LW1A 4X66L 3U58A 2ATWA 3HOYG 2Z6KC 4YY3L 4GLAC 4X66Q 5C4XH 5C0XJ 4KLKA 1SN8A 4MZ9A 4YY3Q 4PG3A 4WJ4A 1HH2P 3GTOH 5FJ8H 3PF5A 1HJPA 4LUOA 2JA9A 4TVAB 4LF9L 4P72A 4UP7A 4LFAL 3RLNA 2R93G 3HOXG 3GTLH 1C7YA 2JEAI 3PO3H 4LF4L 1QVFA 1PH4A 4LF9Q 4LFAQ 1KQSA 1E1OA 4JCVE 4JG2A 3ICEA 3KF8B 1PA6A 1W3SA 4LF4Q 3HOVH 2WFWA 1XTDA 3JAMc 2HIVA 2AHOB 4WJ3M 1HZCA 4A3KH 1HR0W 1CSPA 5M3MH 1EIFA 1I6HH 3RN2A 3D31A 4JI0L 1P8LA 1S3OA 4JV5L 4IFDJ 2JA6H 4JI0Q 1NMGA 1VQ9A 4J15A 1EIYB 3TRZA 4DV1L 1LUZA 4YCWA 4BY7H 5J3BA 3S1NH 4GKKL 1D7QA 3J80c 4DR3L 4HJ8A 4DV1Q 2L15A 4GKKQ 5GAGC 5IYDH 3U50C 4DAYB 5C3EG 1V1QA 3M3YH 4DR3Q 2PQAB 3PUVA 1IBML 4NXML 3AFPA 3CF5A 1WI5A 1PH1A 2R93H 1WOCA 3I4OA 1IBMQ 4NXMQ 2Z6KA 2OQKA 4LUZA 3OTOL 3AFQA 5ELOA 2VW9A 1S72A 3GDEA 3OTOQ 2Z0SA 3G4SA 1I94L 2JA8G 3PUXA 2IY5B 1I94Q 4JBWA 1SR3A 4JI5L 4A4IA 2RHSB 2AWNA 3CMAA 3K81C 4X62L 4JI5Q 3F2BA 1IYJB 1VQGA 4X62Q 1K8AC 1K83H 2ZJPA 3M85A 2B63G 4YCVA 1QZGA 4TQUS 1M1KC 2XGTA 1D8LA 1J5EL 2VUMG 1XNQL 3SGIA 4KHZA 4DPGA 4ME3A 5C3EH 1J5EQ 1G51A 1L2FA 1QUQB 1TWHH 1OXSC 1TWGH 1QZHA 1YJNA 1M90C 4JI6L 2JA5H 2B29A 4MNOA 1PH6A 4KHPL 3I2ZA 4JOIC 3CC7A 4JI6Q 4OXPA 3K80C 3JAMi 5M5XH 3DLLA 1HNXL 3CAMA 4KHPQ 1FL0A 3CPFA 1HNXQ 2UUBL 1X9NA 1VQDA 1OXUA 1VQJA 2JA8H 2MO1A 1FJGL 1KAWA 2Q2TA 2UUAL 2K14A 3H3VH 1MJEA 1YZ6A 4HJ7A 4P73A 3RR5A 2WB1G 4IFDI 4GNXC 1FJGQ 2UUAQ 1N33L 1JJCB 3D0FA 1K3RA 1X3EA 3RLFA 1XPUA 1Q82C 3J80i 1N33Q 1KL9A 1YEZA 3H0GG 3RN5A 4O2DA 4BA2I 2I5HA 2VL6A 1ASYA 2AWOA 3ULJA 4A3BH 3RNUA 2R7DA 1IL2A 3HKZG 5GAHC 1AE3A 4MTNA 5IT9c 1YJWA 3CCLA 2Q2UA 5AJ3L 3U4VA 3CQZH 3ULLA 1SMXA 5GROA 4A3JG 4DV0L 1YHQA 1NJIC 3TQYA 1VQHA 3GTMH 5AJ3Q 3M4OH 4GOPC 3KDFA 4IO9A 4DV0Q 1GO3E 3HFZB 5IYCG 3NELA 3PCOB 3GTGH 1VQAA 2I0QA 3EN2A 1SROA 4DR7L 5C4XG 1G6PA 4B3ML 1YNXA 3KYHC 4A3DH 5IYBH 3KFUA 4DR7Q 2IHFA 5FJ8G 2Q2IA 2E2IH 4B3MQ 1GKHA 4JI2L 4DUYL 3FHWA 4JI4L 1MKHA 1JB7A 2E2JH 3F2CA 4IOCA 3PO3G 2C35B 1B7YB 4JI2Q 5C44G 4YWMA 4DUYQ 4JI4Q 3F8TA 3J7A5 3UE1A 4JI1L 3B6YA 1VQKA 4LFCL 4GNXA 3TS0A 4JI1Q 1EUJA 2MNAA 4A3KG 2JQOA 4JBJA 4LFCQ 5M3MG 4A3JH 1G291 3MEFA 4R4OA 3CC4A 3W1GA 1OXXK 3BZKA 4AQYL 4OWWB 2JA6G 1X55A
chains in the Genus database with same CATH superfamily
3P1HA 2MGSA 2CW0C 1NUCA 2JA8B 2F0NA 3L0OA 3ZJYC 2WKDA 1TU2B 4BXXG 3IKJA 1V8QA 4GOPA 1G91A 2KEEA 3NSWA 4GLVB 3Q24A 2I5LX 4WORA 1ZEQX 3NTKA 1QJOA 2B63B 5E7NA 1VQ6A 1Z9FA 2NZOA 2VUMB 1LTBD 4KY6A 1BUVT 3PSIA 2JSOA 5BR8Q 2J7ZA 5C6AA 2NVXH 2D2CC 2K4KA 2IW3A 1K8GA 3A5ZB 1HA6A 4A3FH 3EFXD 1CUKA 4X3KA 1A63A 5M3FG 3PUYA 1TR5A 2B2WC 4AH6A 2VQEQ 2F4VL 3HKZE 5HGTA 4RGOS 3A7LA 1WJJA 4RHSA 3T1HL 4F88A 1Y1WH 2R7FA 4DR6L 5CV9A 3M4QA 1GHJA 2PMZE 1ILQA 1II3A 1AH9A 1BVSA 1PH5A 1O78A 4XT1B 3ND8A 5CGKA 4KN4C 2EY2A 3GTJH 3S2DH 5FO8B 2EYLA 2A19A 1JWSD 5C4XB 3G48A 1Q81C 3GTOB 1TIID 1K3BC 2PNRC 1SMYD 4XXEA 3NK9A 3DXJC 5LMUL 3CCVA 3EA6A 1IYVA 1EU4A 4DUZL 2NVYH 2N78A 1L0YB 4A3KB 2MP1A 5M3MB 4IFDG 1EY0A 4GN3B 1XNRL 2AMCB 3STBC 2QF7A 3P75A 3SK5A 1EWCA 1T9HA 3SK4A 2CW0D 1VQEA 1EFID 4HMIA 2VQFL 4C3JH 1O7IA 3K5LA 5DLQE 2AKWB 2RDHA 3TZUA 1Q7YC 2VS1A 2JJQA 4PNYA 1EEID 5C4JB 3I4NH 2QGQA 1OO9B 1B9NA 1KHIA 4KI0A 4KKSA 5H1SE 1LLRD 3MXNB 2N88A 4QCLA 1N36L 1YNJC 5IP9G 3CMEA 1U4LA 4UDUC 4WRDA 1FVIA 1J9OA 3BDCA 5IGBA 2EY6A 4YHHQ 3S15H 5IY0A 2E74C 5JPNC 3DHQA 3NUCA 4DR1Q 1LTGD 2HUGA 3FEWX 1PZKD 1VQ8A 1GD7A 2PZTA 3J81i 2Z4HA 3AYHB 3D6WA 5C3EB 4DV3Q 3VR5A 1Q1BA 5EKIA 2OQ0A 4DAPA 2PPBC 2JA7H 2JA5B 4X3TA 1JOKA 1EYCA 2EYFA 1HZAA 2XWJB 2JE6I 2FJ2A 3I3CA 3T1YQ 5IOCA 4BBRH 1A3VA 5FKAC 2QKIC 1I3QH 1GUGA 2PI2E 3Q0AA 1E7ZA 4IUVA 4Q0FA 5E4XA 3K58A 2UUCL 1ENAA 4OWXB 2ALYB 2SDFA 4HJ5A 4LF8L 4U68A 5D3IB 1OXVA 1B2TA 3SR1A 2Y0SE 1C0AA 4H0LC 3LWUA 2XIWA 4A3CG 3GTQB 3EROA 1VF7A 1BCPF 4CJ1B 2F52A 1VQBA 2PQAA 4BBSB 3AU7A 1X56A 2UXDQ 1MI2A 2N3SA 2A73B 3STBD 4AYBE 4IPCA 1SBBB 1PVOA 3J7AF 1H9SB 3BU2A 4XQNA 4UHVA 4QGUA 3U9SA 2A68D 3S1RB 2Q8TA 4JYAQ 4C3HG 4UAIA 2NVQB 3DM3A 4OX9L 4AYBB 1V43A 2F0DA 2QEXA 1MJCA 3HOXH 1WTVA 3FVQA 1PFBA 4OONA 3MWYW 1YNJD 3QG1A 4DR2L 1HPCA 5CV8A 4HSVA 2F0JA 1Q1EA 2B3GA 4RH6A 2YU9H 1E0BA 2NZ1D 3S16H 3DWPA 4EX5A 4IPHA 1RODA 4DAVA 2F3IA 4BA1I 1BXTA 2D9UA 2RDGA 3JC66 2F0SA 2LMCB 4A3FB 4NXNL 2NWGA 3KBGA 3NHHA 1YI2A 3DEPA 4CGYB 1UE6A 3LWEA 1GM5A 5BN3A 4B3TL 4HEDA 3W2DA 2EZVA 1NNXA 4X65Q 1I50H 2LY7A 1BNZA 3V2TA 3TP6A 3U9OA 3E3XA 4UP8A 2K32A 2DUDA 2IL8A 3TEHB 2R7ZB 4DV5Q 4JBMA 1S5DD 3GTJB 3HOZG 4OIJA 3HOWG 1Y8PB 1VQOA 1CKOA 3S2DB 1XMOQ 4B3SL 4MHEA 4K2LA 4A3EH 1KXLA 2LKVA 1TWFH 2KCMA 1G8ZD 4LF6Q 1JWUD 1LABA 2K5HA 4ALPA 4LF5L 1CTMA 2OCEA 2NN6G 1SYFA 2FINB 3AB9A 4A76A 4H7BA 2F0KA 1Y1VH 4CDFC 1HQMC 5CC4A 2GVBA 5EKLA 1K0RA 1VQ7A 4C3IH 2F0VA 2IJ0A 3OMGA 1X54A 1N34Q 3MA2B 4K6DA 2UXBL 3KOJA 3CD6A 3KK7A 4L6TB 2ES2A 3D3RA 1Q3LA 3D8GA 1Z47A 4A3GG 4GS3A 4K2KA 2HIXA 4GKJL 3TMEA 1GHKA 3QO2A 4KY5A 3K5MA 4C3JB 4X64Q 5JJKA 1E2ZA 1RL2A 4GN5A 5HGQA 1H9KA 1S4ZA 3HOYG 5JPMC 2Z6KC 1SN8A 3I73A 3I4NB 1CA5A 4PG3A 4RA8A 1HJPA 1RCVD 4LF9L 4LFAL 3RLNA 2R93G 2JEAI 3PMFA 2QW7A 1PH4A 4DF7A 3RUZA 1ET6A 3URYA 4LF4Q 3D6CA 1EQVA 3JAMc 4F87A 3S15B 4FYDA 1TQOA 1HR0W 1CSPA 3RN2A 1IKLA 1P8LA 2F0TA 4KY7A 5ELCA 2JA7B 4CKCA 1EIHA 1D7QA 1LTRD 4DV1Q 4K8JA 4NW2A 5IYDH 3M3YH 4DAYB 5L37A 5C3EG 3ND9A 4DR3Q 3CF5A 2B2TA 4BBRB 1AFPA 2Z6KA 2F03A 4C56C 4LUZA 3VR4A 1I3QB 1S72A 1SR3A 4JI5L 4A4IA 1F9QA 2RSOA 3MFYA 3F2BA 2F0FA 4KK7A 2L5TA 4V0BA 1K8AC 4TQUS 2XGTA 4KHZA 1LT5D 1J5EQ 4WFN3 1STEA 2WACA 1L2FA 1FD7D 1XNQQ 1OXSC 1TWGH 3VYUA 1EEFD 3MFGA 4MNOA 3DUZA 4KHPL 4JI6Q 1ENFA 1IL8A 3K80C 4OXPA 3DLLA 1HNXL 3OWFA 4ZUJA 1G6ZA 5JEAH 1VQJA 2EXZA 2JA8H 1KAWA 2UUAL 4KD3A 4HJ7A 2K05A 2MUYA 3RR5A 1FJGQ 3MXNA 1N33L 3VR2A 3D0FA 3OWEB 4CJ2C 1Q82C 1KL9A 1YEZA 4BA2I 2L12A 4R8NA 1Z6HA 2R7DA 2F1MA 3K5OA 2KOLA 1AW7A 2KCNA 5AJ3L 1SE4A 5EPLA 1YHQA 1SMXA 4DV0L 3HOXB 2NTTA 4O42A 1HUNA 3E5SA 3HFZB 2NYZD 1ML0D 1HTLD 2I0QA 4ZK9B 5FJ8G 2Q2IA 4B3MQ 1EYDA 5A2QL 3FHWA 1K8OA 3S16B 2C35B 1B7YB 1STBA 4DUYQ 3E6ZX 1HFNA 3J7A5 1O7ZA 1VQKA 4LFCL 3NTIA 4QF4A 4JI1Q 1ESFA 3FPUB 2HDLA 1G291 4R4OA 4KMUC 5CORA 1OXXK 3DEOA 3J81E 3BZKA 4OWWB 2JA6G 2EDGA 1X55A 5J22A 4A3FG 2PI2A 4G57A 3OIPA 4AQYQ 4BY7G 1EZ8A 5T1IA 3DMUA 3MTSA 1HR0Q 2YTVA 1I50B 2IX3A 1D1IA 1K0SA 1UAPA 5EGTA 3KBXA 1Y1WG 1JORA 1HZBA 1PH3A 3FKIH 2RVLA 1HNWL 4DR5Q 4WJWA 1FGUA 2MPMA 2TSSA 3J80L 2B2YA 3NBHA 1KRSA 1NBWA 4R9WA 1UWVA 3TREA 1B9MA 3BYTB 5K36G 1B8AA 1H9SA 5FLXc 3GTMB 1TWFB 2GVAA 5FLMH 2RHQB 4C2MH 1XPOA 4RGNA 5I2YA 1VCIA 5FOBB 3MXUA 1MGSA 3H15A 3SXHA 1L1OA 3KJOA 4R4IA 3RZDH 4PZ7A 4L5RC 3H6MA 1CKMA 2PW5A 4KHVA 3T13A 4C3IB 5C4JH 4A93H 1SE8A 4OO1G 3BJUA 2I07B 1KAAA 3CCSA 3CP0A 4DV4Q 2LXKA 2ID0A 1HFGA 2RCFA 1TS2A 3BS1A 2F3VA 3K8AA 4DV2Q 4HIOA 4B9WA 3NXWA 2IX1A 4B3RQ 3NBIA 5C0XG 3BG3A 2O2LD 3I56A 2ZTDA 5CV7A 4A3BG 4NP5A 1YNNC 2E5LQ 4QQBX 4K0KQ 1W6JA 4KV6A 1PTOB 4DK6C 5ELFA 3A74A 4ZUIA 5IWAL 4PZ6A 5KIXA 1PMRA 3A7AB 3J81c 4QUCA 3CPWA 5C44B 4YCUA 4N9PA 2PNHA 4IOAA 4OEMB 2B2VA 2R92H 1I4HA 4ZRZA 4GZYC 4A3DG 3T51B 5IYBG 2D0PA 3R8BA 4QUFA 3S1MB 1PFSA 2B8GA 2RBMA 2UU9L 1ILPA 4RCNA 2RF4A 3T4AC 1KDAA 3M3YB 1BF4A 2EXDA 4JI7L 4HJAA 4DV7Q 3NPPA 1JMCA 5M5YH 1EYGA 2WP8J 5LMNW 2UXCL 4ZKBB 3NWTA 1PLFA 2EVBA 3E9HA 4A75A 1KTKA 1IBKL 3GTQH 4XQQA 5M9OA 2KA7A 4R4TA 2IPKD 1N32Q 1GUOA 4BBSH 1CT1D 2BOSA 3F2UA 1HNZL 3TP7A 1AN8A 2A1AA 1UE5A 3L3OC 2J0TD 5I9OA 1WTQA 4LFBQ 1B3QA 4PMWA 4O0AA 1TS4A 1CSQA 3S1RH 4K6LA 2NVQH 1VQIA 3RLOA 3TS2A 1VDZA 2UUBQ 4JV5Q 2DJGC 1NR2A 4DFAA 1EY5A 1BCPC 4JI8L 5C5MA 1HZ9A 2LXJA 1VQCA 2G5DA 1PRTF 3H91A 1NE3A 1QE6A 1C48A 1SDFA 1WCMG 1Q46A 4DV6Q 4NDXA 3NEMA 2KVMA 1TXYA 2ZTCA 4GNXB 1HRJA 1F9RA 5FO9B 1WD1A 3E0EA 4X3SA 3NP8A 2OT2A 2SEBD 3VR3A 4X6AH 1YNND 3I91A 4OELB 2ASBA 5F2DA 2R3ZA 1LTTD 3D4RA 2WAQE 3ERSX 2H5XA 2RCNA 5I6WA 2KBNA 1JJGA 4JW0A 1WTPA 1G2SA 4DAYA 1BDOA 2YTYA 3K7AH 1RF2D 4A3IH 1RTOA 4QY7A 1EQTA 2EIFA 1U5KA 1CKNB 3K0XA 2CKZB 1UE1A 2ZM6Q 2WAQB 1MSHA 1NCVA 1GUTA 1XPRA 3I55A 1QILA 1PZID 4ODGA 2V4DA 4FDBA 3HKZB 3PUWA 4UP9A 2HCCA 3HG9A 1YHAA 2HHHQ 1VQPA 2R7ZH 3KF6B 4LF7L 1WTOA 2PMZB 1ASZA 4KKTA 4FF1A 4YWKA 2NUCA 4CHTB 2R6GA 1VQFA 1V9PA 5ELEA 3H3VI 1NMFA 1SFOB 2B2WA 3FKIB 4ZYSA 4ABNA 3SK6A 3PO2G 1SE3A 4U673 2K03A 2CWPA 3F1ZA 4K5WA 3ITPA 4HTHA 2K50A 3QOLA 4O1NA 5LMNQ 3VYSA 1B50A 1I4QA 4C2MB 3DWQA 1MD2D 1SNDA 2OXPA 3FDTA 4A3EG 4LNQA 1XMQL 4APVA 3KLRA 1BCPD 2G9HD 2A68C 3DWAA 4L5QA 2IWHA 3RZDB 2K5DA 4A93B 4BY1G 4IZ8A 1Y1VG 2IHEA 3QR8A 3NENA 4P2CB 4DR4L 1HCZA 1PH9A 1H95A 5J1ZA 3FRPB 3KJPA 1S5BD 1A0IA 4JI3L 2HDMA 2N55A 2JEBI 4MTKA 5AFWA 2NZHA 2EYJA 1YBYA 2ZXPA 1IHZA 2WIIB 3G6JB 1SNQA 2E8GA 1VQMA 2N49A 4IUUA 1S40A 1GVPA 1Y8NB 3MAQA 4XYQA 4CDEC 4OGQC 2KCTA 2PYKA 4RMFA 5GAEC 2R92B 4CKBA 4C1NK 3H0GH 4N9TA 2F0HA 1H9JA 1IBLL 1PZJD 5I2XA 2BH8A 1K9MC 3KF8A 5JEAJ 4DU9A 4G7ZC 2AQ2B 3QB3A 1A62A 2OTLA 2K01A 2ZJQA 4A3MB 5KNCA 5IYCH 1L0XB 2YV5A 1TS5A 3TN2A 1O80A 1PTOC 3U58A 5M5YB 3JAML 4GLAC 4X66Q 2EJMA 1D6EC 1WVLA 4YY3Q 3G7LA 3GV6A 1HH2P 3PF5A 4TVAB 1LTSD 2L1BA 4XQJA 3PO3H 3I4MB 1PA6A 3NE5B 1XTDA 2C5CA 2M00A 2Y0SB 4CBVA 2AHOB 5C5LA 4WJ3M 2X6LA 1LT3D 1CQVA 4ZAIA 4JI0L 3D31A 4LK1C 4LJZC 4K8IA 2A6HC 2KJXA 1NAPA 4HAEA 1DD2A 3TDQA 1EIYB 3CU7A 4GKKL 2CH4W 4IUQA 4HJ8A 1F9SA 4HCEA 1M8AA 4BS9A 1WI5A 4DK0A 1WOCA 3I4OA 5C3WA 4DXFA 1IBMQ 4NXMQ 5KNDA 2RKSA 3OTOQ 2JA8G 1I94Q 4JBWA 2RHSB 3K59A 3CMAA 4H13C 3K81C 2F0EA 5J39A 4OIKA 1C4QA 4X62Q 1JWMD 1K83H 2QCPX 2B63G 4YCVA 1D8LA 2VUMG 4FF4A 1D2BA 1DZ1A 2NTSA 3MEHA 1QUQB 5NUCA 1M90C 2B29A 1PH6A 4JOIC 3CC7A 3GTLB 4A3IB 3K7AB 1V1PA 4ILWA 4G7HC 3CAMA 3TP5A 1FL0A 4B9XA 3HOVB 1OXUA 5CV4A 2MO1A 3S9WA 3H3VH 5FO7B 4P73A 4GNXC 3C46A 2EJFC 1X3EA 3CRLC 5IODA 2EYHA 3J80i 3RN5A 3IL8A 2Q8IB 3L9AX 3KUPA 2AWOA 3ULJA 1PTOD 3BVMA 2JP1A 3RNUA 3HKZG 4MTNA 1YJWA 4ZLTF 3CCLA 4DA2A 1LTAD 3C1FA 3U4VA 4M8AA 3GTMH 3M4OH 4KJOA 5EPJA 4IO9A 1GO3E 1H9MA 1VQAA 1SROA 2E76C 4DR7L 5C4XG 1G6PA 1YNXA 4IFDH 3T53B 3KYHC 2EPBA 2IHFA 4M1UB 2E2IH 4JI2L 4JI4L 4EVOA 3MXPA 2HCIA 2A6HD 2L11A 5LL6S 4YWMA 5BN5A 4N8FA 4J1MA 2JXMB 2F0LA 3UE1A 1I4GA 2K1BA 5EQ0A 3B6YA 2RSNA 4GNXA 1M4VA 3TS0A 2EY1A 1RD9D 1EUJA 3VA7A 4S3SA 4A3KG 5JAVA 5M3MG 1CA6A 2PZUA 1I4PA 4FVMA 3OSOA 2KCCA 3OIQA 4HIMA 2XNAC 1IZ6A 4TRDA 2CCZA 1DJRD 4FF3A 3BDLA 1PTOH 5IP9H 2AQ3B 3X3NA 5FLXL 3LNNA 1ZYRC 2XWBB 1I6VC 1L0WA 1DOMA 5C44H 1QB5D 1E1TA 1CKNA 1W2BA 1I4XA 1Q8KA 1MIUA 1PYBA 3GD7A 5BR8L 3L2PA 2XRQD 1GJXA 3PGZA 3VYRA 1QWYA 1A6XA 2Z6BA 2WB1E 4FP5D 1D1KA 2K52A 1SXTA 5JJLA 1T5XD 4DXGA 3S1MH 3KF6A 2VQEL 3U4ZA 1VQLA 1STAA 2HD3A 2XSCA 1UEBA 2MQHA 3PV0A 2PCFB 1UEAB 2WB1B 3DM1A 2F4VQ 2KENA 5ELNA 3J7ZC 2JA5G 5DNFA 2E2HH 3A5UA 4CDCC 3H0GB 3NTHA 3T1HQ 3RZOH 5GQOA 1BCPB 2E75C 4DR6Q 3Q22A 1GOZA 1TWCH 2DGYA 2R92G 4XYOA 4RGMA 1IYUA 4UPAA 3OHXC 1Y14B 1EFWA 3K6OA 3OPOA 1IXRA 4P71A 4A3CH 3WOEA 2QDLA 2V1CC 4L5TA 3S14H 4HR7B 5EJWA 3FMCA 5E3FA 3PO3B 3N6RA 4K14A 1KABA 3W3AA 4POFA 1I5FA 5LMUQ 1X6OA 4H02A 5JOBA 2JK8A 1XTCD 4IUNA 1TVXA 3J7AV 5IT9L 1TS3A 4DUZQ 2VB3X 3BVGA 4C3HH 2IX0A 4BBSG 5HURA 1XNRQ 1X3PA 1EYAA 3HOUH 4Y52H 3CCUA 4RWSC 2LFNA 1WTRA 2JYOA 2VQFQ 1VQ5A 5COYA 2TMPA 2F0UA 3CCRA 2OTJA 4XT3B 4IJLA 1ZYRD 4AYBG 4PV1C 1A8VA 3K57A 3TBIB 4IN3A 3TP8A 4I65A 4NPSA 3EVQA 1RJTA 2VNUD 1EY7A 2D5DA 3S1QB 4YHHL 1N36Q 2O5JC 4LMQD 4DR1L 3O13A 1STHA 2DNCA 5DAUA 1K83B 5M3FB 4DV3L 1LT6D 1KLUD 3KDFB 3W1BA 1QVGA 4FXDA 1SYCA 3T1YL 4DN4M 1D5XC 1PH2A 5ELDA 4A3LH 2MFIA 3ULPA 1SYEA 3PIPA 3S2HH 3UDXA 1RHPA 2F0OA 1VF5C 2GA4B 3K0YA 1SYDA 4H44C 1JOQA 5IGFA 1WD0A 3HOZH 3ERQA 4RHRA 2N8NA 1KNAA 1SNPA 1XXGA 1SFOH 4L5SA 2UUCQ 2KHJA 4QIWE 1N9WA 4LF8Q 5KYLA 1QVCA 2NN6H 3C2PA 2R7ZG 2KUMA 3SE0A 3M4OB 4DNIA 2F0IA 4HIDA 1EWHA 1JOOA 3QOJA 3Q6SA 1DOKA 2DY7A 2DY8A 1JT8A 2QILA 1HUMA 1KD1C 1LV9A 3TSSA 5IP7H 1WTWA 1T5EA 4YIJA 2E2DC 4IPGA 2UXDL 1JE4A 2E2IB 3M4YA 2SNSA 1TKWB 1F9PA 4A3GH 1U4PA 3PQIA 5IT9E 4MIUA 3UDGA 5G3LF 2LS01 2XTIA 1KRTA 3GQBA 1F2MA 1I4RA 3QWNA 3H94A 4JYAL 2FHTA 3HOYH 1PHJA 1GUSA 1SJED 4GLXA 5EKKA 2A8VA 3SDZA 1F2LA 3A8KE 4OX9Q 2AUKA 1STNA 3TZDA 3A55A 4KKUA 2SOBA 1A2UA 4C3JG 1QUQA 4OO1I 5C4HA 2I5MX 1S5FD 3A8JE 1HA5A 3PIOA 4KD4A 4ULLA 2Q2HA 3SVMA 4DR2Q 1PH8A 1R9TB 3I4NG 3A56A 3I7FA 4P75A 1JE5A 5KYIA 3QJYA 3OYYA 5A2QE 2EYPA 5C0XI 1PYWD 4NB3A 5IE8A 4R4CA 5HY6A 3NQTA 1DM0B 1EZ6A 3RMHA 4YWLA 1KIXA 4JVZA 3BZCA 1PH7A 1BOSA 1XWEA 4NXNQ 4FF2A 4A3MH 4R4QA 1IKMA 1IW7C 4X65L 3GTKH 1Y69U 2JA7G 2PQEA 4QMGA 4R8IA 3V96A 4B3TQ 2E2HB 4RKLA 3A0JA 2VB2X 1DYQA 1CZWA 3RZOB 4ZKCB 2B39A 2F0WA 3VDYA 2CFMA 5DM73 1BKBA 1TWCB 4BBRG 5EAYA 2H1EA 1RTNA 3CW2C 2K6AA 5LL6X 4DV5L 1LYLA 3CCJA 2ZT9C 3KLSA 3UI2A 3I4MH 1N8RC 3CCEA 1XMOL 1ZXTA 4DAMA 1R4PB 3EBEA 5BN4A 3J80E 4OHJA 1MSGA 1YJ9A 4LF6L 1LM0A 1V1OA 1OTCA 4B3SQ 1O7YA 2D62A 4RCOA 3S14B 1JC7A 2VZAA 2KHIA 3K5NA 4LF5Q 4LWCA 4IURA 2L4NA 1PFNA 2BE5D 4Z9CB 4BWGB 1EIGA 2FXQA 2LSSA 1CFMA 2K33A 1YHBA 1N34L 4V190 4XTCS 2K5VA 3FPPA 2K5NA 4IJHA 3BZDB 4C3HB 3NWSA 1JJ2A 1U0LA 3PIP3 4DNTB 2UXBQ 1G2TA 3HOUB 4X64L 1S5ED 1HHVA 1GUWA 1VQ4A 4GKJQ 2K7VA 3IFDA 1Q86C 4K5VA 3CC2A 2A6EC 1VS0A 3KLWA 4CKEA 2MHVA 2BCOA 5FJ8H 4LUOA 2JA9A 4P72A 4UP7A 3HOXG 3E0JA 2F3WA 3GTLH 1ONLA 4LF4L 1QVFA 4LF9Q 4LFAQ 1KQSA 1E1OA 1AZPA 3OOCA 3ICEA 1SNMA 3HOVH 2WFWA 2KHSA 5ISRA 1DCZA 1HZCA 1PXUA 1H9RA 2P5ZX 1EIFA 1S3OA 1VMPA 2F0QA 2PW7A 4IFDJ 2JA6H 5CBEE 1SNOA 1VQ9A 3TRZA 4DV1L 1IW7D 4EQPA 4BY7H 3S1NH 5EBDA 3J80c 4DR3L 2KQ3A 3U50C 5I4DA 1V1QA 3PUVA 3AFPA 1Z7TA 3ZYYX 1PH1A 3S2HB 1PFMA 2OQKA 1Q8IA 5DM63 3AFQA 5ELOA 2VW9A 3HOWB 3HOZB 3GDEA 2QEJC 5LHY1 3PUXA 5K36H 2IY5B 5KGUA 1EOTA 2AWNA 3R3OA 3PIO3 4JI5Q 5D14A 1QZGA 1J5EL 1XNQL 1B4OA 4ME3A 3D4DA 1TY0A 4JI6L 3NQIA 2L55A 2EYMA 1LT4D 4OO1H 4KHPQ 3H3VC 3CPFA 1HNXQ 1VQDA 2DNEA 1SNCA 1FJGL 2Q2TA 4A3GB 2MJ8A 4TKOB 1YZ6A 1MJEA 4L63B 4IFDI 1JB3A 2UUAQ 1K3RA 3R93A 3RLFA 1XPUA 3HEJA 1N33Q 4C3IG 5C0XH 2Z8LA 2VL6A 3HOYB 2A6ED 2EYOA 4A3BH 1IL2A 1AEXA 2BDNA 3I8ZA 5GAHC 1AE3A 4RAUC 2Q2UA 3M7NA 5GROA 1NJIC 3TQYA 1VQHA 2R93B 5AJ3Q 4ZCKA 1B44D 3KDFA 4DV0Q 1KNEA 1WTHA 3P20A 1LTID 4DGZA 3V05A 3SEBA 3OMCA 3EN2A 1GXDC 1A15A 1UNSA 4B3ML 2ZXRA 2AQ1B 4A3DH 5IYBH 4RFBA 3KFUA 3D4WA 1GKHA 4DUYL 1MKHA 3P7JA 2E2JH 3F2CA 5C44G 1HXYD 4K5XA 3A8IE 1EY8A 2RDFA 4JI1L 2A69C 2OEOA 1X32A 5JVG3 2JQOA 1TWHB 2L0CA 3EQLC 5JVH3 4LFCQ 4A3JH 3CC4A 3W1GA 2R61A 5M5XB 4L8JA 4AQYL 1RDPD 2O4XA 4I7AA 3I4LA 3GTKB 1HR0L 1E22A 4POGA 1QNUA 1J6QA 5IYDG 5TSSA 1CI3M 1X3QA 2ENBA 3EJIA 4N8X1 4DR5L 5KRUA 2EY5A 3BYYB 1SE2A 4EQ5A 1PRTB 5CR3A 1P16A 3HKSA 1HNWQ 3G71A 2O5IC 2K5WA 3CQZB 2M2LA 3WDNA 2WKCA 4PZ8A 4G4KA 1J8IA 2CQAA 4IUPA 4NKLA 3CKIB 3GTGB 1STGA 1WTXA 1E24A 4BXXH 1WCMH 5DEHA 2CWAA 4HCSA 1RKNA 3GP7A 3LGJA 2NVTH 1EL0A 3NBHB 5D65A 1I6HH 4QJFA 4DKAC 2A74C 4DV4L 5T1GA 2I46A 1BR9A 5JEAG 2CQOA 4DV2L 2ZTEA 2QDBA 3S1QH 2OWOA 5JJIA 4B3RL 4LAAA 5I6YA 1SRUA 3K7UC 3KLSX 2E5LL 1Q12A 3HOUG 3FP9A 5FK9C 4K0KL 1L1OB 1TT2A 5M3FH 1C8CA 4ID6A 3PUZA 2XVSA 1F2ZA 1ENCA 2X6GA 2PZWA 5IWAQ 3J7YW 3CCMA 1JCKB 4XIGS 1XX8A 2Z9HA 5ELBA 1X3FA 4DK3C 2A69D 2Z1CA 4KJNA 1BBXC 3UDFA 1EOVA 2NVXB 4Q5VA 2NBFA 4FO2A 2WAQG 3HGBA 2JA6B 3IRBA 3OW2A 1F2YA 4BY7B 3S1NB 2RA4A 3S17H 2UU9Q 3Q8DA 3CCQA 4DV7L 1NY4A 1PV4A 1O7LA 3S24A 4JI7Q 1Y1WB 1KLGD 3JAME 1ZKOA 1UE7A 3X3MA 1MBYA 2UXCQ 4A3LG 3PO2H 4HIKA 4IALA 4HJ9A 1N32L 2JN4A 1XYIA 1JR0D 1TY2A 1ICWA 1IBKQ 1YIJA 1PYSB 4JOIA 4RGTA 3GO5A 2F0GA 1NTGA 4GN4B 1KC8C 5IIFA 4FNFA 2B8FA 2WINB 3FKIG 4LFBL 1HNZQ 1SLJA 4FXKC 1CHQD 1BBWA 5EBCA 2KECA 4RKBA 1VQNA 2UUBL 2NN6I 4P74A 4PMBA 4JV5L 2XN9C 2M9VA 1LTLA 1FNUA 5FLMG 3CXCA 1K28A 1CZGA 4BY1H 5A35A 1YVCA 2VXWA 1CQFA 1B53A 4DK1A 4G7OC 3J81j 3E9IA 3HP3A 2NVYB 2A5HA 1B70B 5IP7G 4DV6L 2CHBD 4NMZA 5CYUA 4JI8Q 4KTAA 2MO0A 5IGDA 3R2IA 2B2UC 1LACA 1JICA 4A93G 1R9TH 1DONA 1Y8OB 1YITA 1HTPA 2HQEA 4A3BB 1DGSA 2XRSD 4F7XA 2B2TC 3MC0B 4LUVA 1QCBD 2HT1A 1R4QB 1EWIA 4IPDA 3MXGA 4J8QA 3VA5A 3MZ5A 1U4MA 2EQSA 4CDDC 4AIMA 1C9OA 2BH2A 5CMDA 4GOPB 2VY3A 2FMMA 2D0OA 2ZM6L 4A3DB 5GADC 2HQLA 1FR3A 5I9PA 4JC0A 3QIAA 1EY6A 2E2JB 4IQZA 2K04A 5M5WH 4Y7NH 2EJGC 2K75A 1RIPA 2QA4A 2HHHL 3VYTA 1WYDA 2B2UA 1DXMA 4RG1A 4FXGC 3WWVA 3UDIA 4A3JB 1EQRA 2BA0A 1LO5D 4OWTB 3J81L 2EOTA 1PTOF 2L9HA 4LF7Q 1E2VA 4QL5A 1AE2A 4PQXA 2F0MA 4A3MG 2K28A 3ER0A 3HRZC 3AQQA 4KN7C 2DN8A 5CV5A 1PDQA 2GN5A 1XJVA 1FYCA 1W6KA 3GTPH 3UE0A 1EQQA 5LMNL 4ME5A 1BO0A 3I4MG 1A3UA 1VMCA 2Y0SG 3A54A 4R1JA 3L7ZC 1TWAH 1XMQQ 2BA1A 1NR4A 2YTXA 5E1FA 1WCMB 4ZQ3A 2IT1A 5CBAE 2EE1A 2CH4A 3M9BA 2ZXOA 1BBUA 4JBKA 3R2TA 2NVTB 4C1NI 1FNVA 5G3LD 3F2DA 1I6HB 1U4RA 1CK1A 1D5MC 2F0PA 1PRTC 2ZJRA 4HMJA 5FLXE 1AZQA 1X65A 2YYZA 4DR4Q 2K5QA 2B63H 1SJHD 3H09A 1STYA 1ESRA 3M4PA 3BDOA 2VUMH 4JI3Q 1CM9A 2Z4IA 3AEVA 1Q90A 4J6HA 1OXTA 3IAYA 2ICEC 1D5ZC 3SK8A 3WOFA 1SYBA 1ICFB 3EIVA 3OW7A 5KEEA 1B3AA 3G6EA 4HSPA 1DOLA 4HN7A 1AP0A 1K8MA 2B2YC 1E3PA 3MVVA 2YU9B 3PF4A 3RD4A 1SSOA 4A3IG 4JPBW 2KEDA 1WFQA 1S5CD 1E2WA 3HOWH 4CJ0B 3HOVG 1F77A 1K73C 4UY8C 1IBLQ 1KDBA 4I7ZC 2ICIA 5E4WC 3S17B 1L1OC 3W5OA 2CVRA 3HZXA 2FFKB 1X3GA 4LW1A 4X66L 2ATWA 5C4ZA 1ET9A 1EY9A 4YY3L 5C4XH 5C0XJ 4KLKA 4MZ9A 4WJ4A 5CV6A 3GTOH 1QG7A 4EQNA 3MHBA 3PO2B 4QIWB 1C7YA 2AUJD 4JCVE 4JG2A 3KF8B 1W3SA 1FNWA 2HIVA 2BE5C 2F4IA 2SNMA 4A3KH 4A3EB 5M3MH 3ONAB 2FMCA 4JK1C 2WV6D 4JI0Q 1NMGA 4J15A 1A2TA 1LUZA 4YCWA 5J3BA 1SEBD 2L15A 4GKKQ 5GAGC 3VR6A 4BY1B 2B2VC 1Y1VB 1JQYD 5JJZA 4OL7A 2PQAB 1IBML 4NXML 1PRTD 2R93H 4QB4A 3T56B 4F8MA 3OTOL 5EPKA 1A3TA 1UUPA 4E6IA 1I94L 3G4SA 2Z0SA 2J4XA 4X3UA 1GUNA 2G9DA 4X62L 1IYJB 1VQGA 2ZJPA 3M85A 1KDCA 1M1KC 3SGIA 4DPGA 5C3EH 3IFTA 3LX0A 1G51A 1TWHH 4DNRB 1QZHA 1YJNA 4EQOA 2JA5H 3C3LA 3I2ZA 1EY4A 1HQRD 3JAMi 2X69A 4EGVA 5M5XH 2NB0A 1EU3A 4B08A 5IGGA 1X9NA 4IUTA 2K14A 4PMCA 2WB1G 3CHBD 5M5WB 1JJCB 4Y7NB 3BVZA 3CRKC 1B1ZA 3H0GG 2C9OA 4O2DA 2DJFC 4XDXA 2I5HA 1ASYA 1NSNS 3HS0C 1CHPD 5IT9c 2H4OA 1V1PB 2Q8RE 5KNBA 3CQZH 3ULLA 4A3JG 1BQQT 2BDOA 3I90A 2OF1A 4GOPC 1MHWC 3C1EA 5IYCG 3NELA 3I70A 3PCOB 3GTGH 5D3DA 3N52A 5IGEA 1FGBD 1QNKA 5IGCA 2PO4A 3GV3A 1SMYC 4MN3A 4TSSA 4DR7Q 3SHLA 2RQXA 1U9RA 3GTPB 1JB7A 4IOCA 1SYGA 3PO3G 1SAPA 4JI2Q 4JI4Q 3I72A 5C3XA 3F8TA 3M7GA 3Q23A 2MNAA 4JBJA 1TWGB 3T16A 3MEFA 3AMUA 1TWAB 5K5PA 1QOHA
chains in the Genus database with same CATH topology
4A3FG 2PI2A 1IZ6A 1HR0L 1E22A 4AQYQ 4POGA 2CCZA 4BY7G 1J6QA 1HR0Q 2YTVA 3L0OA 3ZJYC 5IYDG 5IP9H 4BXXG 4GOPA 4GLVB 1L0WA 2I5LX 4DR5L 1Y1WG 5C44H 1HZBA 1PH3A 1E1TA 1CKNA 4EQ5A 3FKIH 1W2BA 5E7NA 4DR5Q 1HNWL 1VQ6A 1Z9FA 1FGUA 1P16A 1Q8KA 1MIUA 1PYBA 2NZOA 3GD7A 3HKSA 5BR8L 3L2PA 1KRSA 1NBWA 1HNWQ 1UWVA 3PGZA 3TREA 3G71A 3PSIA 5K36G 5BR8Q 1B8AA 2NVXH 2WB1E 5FLXc 2K4KA 2K52A 2GVAA 5FLMH 5JJLA 1K8GA 2RHQB 3A5ZB 4C2MH 4PZ8A 3S1MH 4A3FH 1XPOA 3KF6A 2VQEL 3U4ZA 1CUKA 1VCIA 1A63A 5M3FG 1VQLA 3PUYA 4AH6A 1E24A 2VQEQ 2F4VL 1UEBA 2MQHA 3PV0A 3HKZE 3H15A 4BXXH 1WCMH 1L1OA 3KJOA 4R4IA 3RZDH 2F4VQ 2CWAA 4PZ7A 4L5RC 1WJJA 2KENA 5ELNA 3J7ZC 3T1HL 1CKMA 3LGJA 1Y1WH 2R7FA 2E2HH 2JA5G 3A5UA 2NVTH 4DR6L 5C4JH 4A93H 3NBHB 1SE8A 3T1HQ 3RZOH 4QJFA 3BJUA 3M4QA 2PMZE 5GQOA 4DKAC 4DV4L 4OO1G 4DR6Q 1AH9A 2OTJA 1TWCH 5JEAG 1BVSA 2CQOA 2DGYA 3CP0A 3CCSA 4DV4Q 1PH5A 2R92G 2LXKA 2ZTEA 4DV2L 2ID0A 4UPAA 3S1QH 1Y14B 1EFWA 3K8AA 4DV2Q 2OWOA 5JJIA 4B3RL 4HIOA 3GTJH 3S2DH 1SRUA 3K7UC 2IX1A 4B3RQ 5C0XG 2E5LL 1Q12A 3HOUG 1IXRA 3FP9A 4P71A 4K0KL 1L1OB 3I56A 5M3FH 4A3CH 2A19A 2ZTDA 4A3BG 4QQBX 2E5LQ 3PUZA 4L5TA 2V1CC 4K0KQ 3S14H 4DK6C 3A74A 3G48A 5IWAL 4PZ6A 1Q81C 3J81c 5IWAQ 3CCMA 3CPWA 4YCUA 5LMUL 4XIGS 3CCVA 2PNHA 3M7NA 4IOAA 4POFA 1I5FA 5LMUQ 1X3FA 1X6OA 4H02A 2JK8A 4DK3C 2R92H 4DUZL 2NVYH 2N78A 4DUZQ 4IFDG 4GN3B 4A3DG 3UDFA 1EOVA 4C3HH 5IYBG 2IX0A 4BBSG 1XNRL 2AMCB 2D0PA 2WAQG 3STBC 3IRBA 1XNRQ 3OW2A 1PFSA 2UU9L 3HOUH 1T9HA 4Y52H 3CCUA 3S17H 1VQEA 2VQFL 2UU9Q 3Q8DA 4C3JH 1O7IA 2RF4A 3CCQA 4DV7L 5DLQE 2EXDA 1NY4A 2VQFQ 4JI7L 2AKWB 4HJAA 4DV7Q 1Q7YC 1PV4A 1VQ5A 2VS1A 2JJQA 3S24A 3CCRA 5M5YH 4IJLA 1EYGA 1JMCA 2WP8J 4JI7Q 5LMNW 2UXCL 4AYBG 3I4NH 1UE7A 2QGQA 3E9HA 1A8VA 1KHIA 4KI0A 4A75A 4A3LG 2UXCQ 5H1SE 1IBKL 3PO2H 4HIKA 3MXNB 3GTQH 4HJ9A 1N32L 4R4TA 4NPSA 1IBKQ 1YIJA 1PYSB 2VNUD 4JOIA 1N36L 1N32Q 3GO5A 5IP9G 3CMEA 4BBSH 1NTGA 4YHHL 1FVIA 4GN4B 1N36Q 1KC8C 4DR1L 1HNZL 4YHHQ 3S15H 5IY0A 4DR1Q 3FKIG 2A1AA 1HNZQ 4LFBL 1VQ8A 1SLJA 4DV3L 1GD7A 1UE5A 3J81i 3AYHB 4LFBQ 1BBWA 4DV3Q 4PMWA 3KDFB 4O0AA 1VQNA 1Q1BA 2JA7H 1CSQA 2NN6I 2OQ0A 4P74A 3W1BA 3S1RH 1QVGA 1VQIA 3RLOA 3CXCA 1LTLA 5FLMG 1HZAA 3T1YL 2NVQH 3TS2A 2UUBQ 1PH2A 2JE6I 4BY1H 4JV5Q 3T1YQ 4A3LH 1YVCA 2MFIA 4BBRH 3J81j 3E9IA 4JI8L 3ULPA 1HZ9A 3PIPA 2LXJA 3S2HH 1VQCA 1B70B 5IP7G 4DV6L 1NE3A 3UDXA 4JI8Q 1WCMG 1Q46A 1I3QH 2MO0A 4DV6Q 3NEMA 3HOZH 2N8NA 2PI2E 1E7ZA 1TXYA 2ZTCA 4GNXB 4A93G 1R9TH 4OWXB 1SFOH 2UUCL 3E0EA 2ALYB 1YITA 4L5SA 4HJ5A 4LF8L 1DGSA 2UUCQ 4X6AH 2KHJA 4QIWE 1N9WA 4LF8Q 1QVCA 1XNQQ 2ASBA 4LUVA 1OXVA 2HT1A 2R7ZG 4DNIA 1EWIA 4IPDA 4HIDA 2WAQE 2Y0SE 3ERSX 1C0AA 2EQSA 2H5XA 2RCNA 2KBNA 4AIMA 1C9OA 2BH2A 1JJGA 1JT8A 1KD1C 4A3CG 4GOPB 2VY3A 4A3IH 5IP7H 2YTYA 3K7AH 2D0OA 2F52A 1VQBA 2PQAA 4QY7A 2ZM6L 2EIFA 1U5KA 2HQLA 4IPGA 1CKNB 5GADC 2UXDL 4JC0A 3K0XA 2CKZB 1UE1A 2ZM6Q 1X56A 2UXDQ 4A3GH 1XPRA 2N3SA 3I55A 3STBD 4AYBE 4IPCA 3UDGA 5M5WH 1PVOA 2XTIA 4Y7NH 2K75A 4HIMA 4FDBA 1RIPA 3BU2A 3PUWA 4UP9A 1KRTA 2QA4A 2HHHL 4QGUA 4JYAL 1WYDA 1YHAA 4RG1A 3WWVA 2HHHQ 3HOYH 3UDIA 1VQPA 1PHJA 2R7ZH 3KF6B 4JYAQ 4GLXA 3DM3A 1EQRA 2BA0A 4LF7L 4OWTB 4OX9L 2A8VA 1V43A 1ASZA 4LF7Q 2QEXA 4OX9Q 1MJCA 4YWKA 4QL5A 3HOXH 1AE2A 4OONA 1QUQA 4A3MG 4OO1I 3ER0A 3AQQA 2I5MX 2R6GA 3PIOA 1VQFA 4DR2L 1V9PA 2Q2HA 2GN5A 3H3VI 1NMFA 4DR2Q 1PH8A 3I4NG 1Q1EA 2B3GA 1XJVA 3I7FA 4P75A 1JE5A 2YU9H 3GTPH 3PO2G 3OYYA 3UE0A 2CWPA 1EQQA 3F1ZA 5LMNL 3S16H 5C0XI 4NB3A 4EX5A 4IPHA 5IE8A 2K50A 4R4CA 5LMNQ 3I4MG 2F3IA 5HY6A 4BA1I 2Y0SG 4YWLA 3JC66 1KIXA 3BZCA 4NXNL 4A3EG 1PH7A 4LNQA 1XMQL 4R1JA 4APVA 3L7ZC 4NXNQ 1TWAH 1YI2A 1XMQQ 2BA1A 4A3MH 1UE6A 4R4QA 2YTXA 4L5QA 4X65L 1GM5A 4B3TL 2IT1A 3GTKH 3M9BA 1BBUA 2JA7G 4JBKA 4X65Q 4B3TQ 3A0JA 1I50H 3F2DA 4BY1G 1Y1VG 2IHEA 3NENA 2CFMA 3VDYA 4DR4L 2ZJRA 1BKBA 4BBRG 5EAYA 1PH9A 4UP8A 1H95A 1X65A 2YYZA 3CW2C 3KJPA 4DV5L 4DR4Q 1A0IA 1LYLA 4JI3L 3CCJA 2DUDA 2B63H 3I4MH 3TEHB 1N8RC 3CCEA 2JEBI 4DV5Q 1XMOL 3M4PA 4DAMA 4JBMA 2VUMH 3EBEA 4JI3Q 3HOZG 3HOWG 1VQOA 1CKOA 2NZHA 1XMOQ 4B3SL 3AEVA 1YBYA 4A3EH 1YJ9A 1KXLA 4LF6L 1LM0A 1OTCA 4B3SQ 1TWFH 2D62A 2KCMA 1OXTA 2E8GA 4LF6Q 2K5HA 1VQMA 4ALPA 4LF5L 2OCEA 2N49A 2VZAA 3EIVA 2NN6G 1S40A 2KHIA 1GVPA 4A76A 4LF5Q 4LWCA 3G6EA 1Y1VH 2KCTA 2FXQA 1E3PA 2LSSA 4RMFA 5GAEC 3PF4A 1YHBA 2GVBA 1K0RA 1N34L 1VQ7A 4XTCS 2K5VA 4C3IH 4A3IG 3H0GH 2K5NA 1WFQA 1X54A 4IJHA 1N34Q 2UXBL 1JJ2A 3KOJA 3CD6A 3HOWH 3HOVG 1IBLL 1K73C 4UY8C 2ES2A 1U0LA 4A3GG 2BH8A 1Z47A 1K9MC 4GS3A 2UXBQ 1IBLQ 2HIXA 4GKJL 4X64L 5JEAJ 1VQ4A 1L1OC 4X64Q 3W5OA 1A62A 4GKJQ 2OTLA 1Q86C 1RL2A 2ZJQA 4GN5A 5HGQA 5JJKA 5IYCH 3CC2A 1X3GA 2YV5A 1VS0A 3KLWA 4LW1A 4X66L 3U58A 2ATWA 3HOYG 2Z6KC 4YY3L 4GLAC 4X66Q 5C4XH 5C0XJ 4KLKA 1SN8A 4MZ9A 4YY3Q 4PG3A 4WJ4A 1HH2P 3GTOH 5FJ8H 3PF5A 1HJPA 4LUOA 2JA9A 4TVAB 4LF9L 4P72A 4UP7A 4LFAL 3RLNA 2R93G 3HOXG 3GTLH 1C7YA 2JEAI 3PO3H 4LF4L 1QVFA 1PH4A 4LF9Q 4LFAQ 1KQSA 1E1OA 4JCVE 4JG2A 3ICEA 3KF8B 1PA6A 1W3SA 4LF4Q 3HOVH 2WFWA 1XTDA 3JAMc 2HIVA 2AHOB 4WJ3M 1HZCA 4A3KH 1HR0W 1CSPA 5M3MH 1EIFA 1I6HH 3RN2A 3D31A 4JI0L 1P8LA 1S3OA 4JV5L 4IFDJ 2JA6H 4JI0Q 1NMGA 1VQ9A 4J15A 1EIYB 3TRZA 4DV1L 1LUZA 4YCWA 4BY7H 5J3BA 3S1NH 4GKKL 1D7QA 3J80c 4DR3L 4HJ8A 4DV1Q 2L15A 4GKKQ 5GAGC 5IYDH 3U50C 4DAYB 5C3EG 1V1QA 3M3YH 4DR3Q 2PQAB 3PUVA 1IBML 4NXML 3AFPA 3CF5A 1WI5A 1PH1A 2R93H 1WOCA 3I4OA 1IBMQ 4NXMQ 2Z6KA 2OQKA 4LUZA 3OTOL 3AFQA 5ELOA 2VW9A 1S72A 3GDEA 3OTOQ 2Z0SA 3G4SA 1I94L 2JA8G 3PUXA 2IY5B 1I94Q 4JBWA 1SR3A 4JI5L 4A4IA 2RHSB 2AWNA 3CMAA 3K81C 4X62L 4JI5Q 3F2BA 1IYJB 1VQGA 4X62Q 1K8AC 1K83H 2ZJPA 3M85A 2B63G 4YCVA 1QZGA 4TQUS 1M1KC 2XGTA 1D8LA 1J5EL 2VUMG 1XNQL 3SGIA 4KHZA 4DPGA 4ME3A 5C3EH 1J5EQ 1G51A 1L2FA 1QUQB 1TWHH 1OXSC 1TWGH 1QZHA 1YJNA 1M90C 4JI6L 2JA5H 2B29A 4MNOA 1PH6A 4KHPL 3I2ZA 4JOIC 3CC7A 4JI6Q 4OXPA 3K80C 3JAMi 5M5XH 3DLLA 1HNXL 3CAMA 4KHPQ 1FL0A 3CPFA 1HNXQ 2UUBL 1X9NA 1VQDA 1OXUA 1VQJA 2JA8H 2MO1A 1FJGL 1KAWA 2Q2TA 2UUAL 2K14A 3H3VH 1MJEA 1YZ6A 4HJ7A 4P73A 3RR5A 2WB1G 4IFDI 4GNXC 1FJGQ 2UUAQ 1N33L 1JJCB 3D0FA 1K3RA 1X3EA 3RLFA 1XPUA 1Q82C 3J80i 1N33Q 1KL9A 1YEZA 3H0GG 3RN5A 4O2DA 4BA2I 2I5HA 2VL6A 1ASYA 2AWOA 3ULJA 4A3BH 3RNUA 2R7DA 1IL2A 3HKZG 5GAHC 1AE3A 4MTNA 5IT9c 1YJWA 3CCLA 2Q2UA 5AJ3L 3U4VA 3CQZH 3ULLA 1SMXA 5GROA 4A3JG 4DV0L 1YHQA 1NJIC 3TQYA 1VQHA 3GTMH 5AJ3Q 3M4OH 4GOPC 3KDFA 4IO9A 4DV0Q 1GO3E 3HFZB 5IYCG 3NELA 3PCOB 3GTGH 1VQAA 2I0QA 3EN2A 1SROA 4DR7L 5C4XG 1G6PA 4B3ML 1YNXA 3KYHC 4A3DH 5IYBH 3KFUA 4DR7Q 2IHFA 5FJ8G 2Q2IA 2E2IH 4B3MQ 1GKHA 4JI2L 4DUYL 3FHWA 4JI4L 1MKHA 1JB7A 2E2JH 3F2CA 4IOCA 3PO3G 2C35B 1B7YB 4JI2Q 5C44G 4YWMA 4DUYQ 4JI4Q 3F8TA 3J7A5 3UE1A 4JI1L 3B6YA 1VQKA 4LFCL 4GNXA 3TS0A 4JI1Q 1EUJA 2MNAA 4A3KG 2JQOA 4JBJA 4LFCQ 5M3MG 4A3JH 1G291 3MEFA 4R4OA 3CC4A 3W1GA 1OXXK 3BZKA 4AQYL 4OWWB 2JA6G 1X55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F G;  2PI2 A;  1IZ6 A;  1HR0 L;  1E22 A;  4AQY Q;  4POG A;  2CCZ A;  4BY7 G;  1J6Q A;  1HR0 Q;  2YTV A;  3L0O A;  3ZJY C;  5IYD G;  5IP9 H;  4BXX G;  4GOP A;  4GLV B;  1L0W A;  2I5L X;  4DR5 L;  1Y1W G;  5C44 H;  1HZB A;  1PH3 A;  1E1T A;  1CKN A;  4EQ5 A;  3FKI H;  1W2B A;  5E7N A;  4DR5 Q;  1HNW L;  1VQ6 A;  1Z9F A;  1FGU A;  1P16 A;  1Q8K A;  1MIU A;  1PYB A;  2NZO A;  3GD7 A;  3HKS A;  5BR8 L;  3L2P A;  1KRS A;  1NBW A;  1HNW Q;  1UWV A;  3PGZ A;  3TRE A;  3G71 A;  3PSI A;  5K36 G;  5BR8 Q;  1B8A A;  2NVX H;  2WB1 E;  5FLX c;  2K4K A;  2K52 A;  2GVA A;  5FLM H;  5JJL A;  1K8G A;  2RHQ B;  3A5Z B;  4C2M H;  4PZ8 A;  3S1M H;  4A3F H;  1XPO A;  3KF6 A;  2VQE L;  3U4Z A;  1CUK A;  1VCI A;  1A63 A;  5M3F G;  1VQL A;  3PUY A;  4AH6 A;  1E24 A;  2VQE Q;  2F4V L;  1UEB A;  2MQH A;  3PV0 A;  3HKZ E;  3H15 A;  4BXX H;  1WCM H;  1L1O A;  3KJO A;  4R4I A;  3RZD H;  2F4V Q;  2CWA A;  4PZ7 A;  4L5R C;  1WJJ A;  2KEN A;  5ELN A;  3J7Z C;  3T1H L;  1CKM A;  3LGJ A;  1Y1W H;  2R7F A;  2E2H H;  2JA5 G;  3A5U A;  2NVT H;  4DR6 L;  5C4J H;  4A93 H;  3NBH B;  1SE8 A;  3T1H Q;  3RZO H;  4QJF A;  3BJU A;  3M4Q A;  2PMZ E;  5GQO A;  4DKA C;  4DV4 L;  4OO1 G;  4DR6 Q;  1AH9 A;  2OTJ A;  1TWC H;  5JEA G;  1BVS A;  2CQO A;  2DGY A;  3CP0 A;  3CCS A;  4DV4 Q;  1PH5 A;  2R92 G;  2LXK A;  2ZTE A;  4DV2 L;  2ID0 A;  4UPA A;  3S1Q H;  1Y14 B;  1EFW A;  3K8A A;  4DV2 Q;  2OWO A;  5JJI A;  4B3R L;  4HIO A;  3GTJ H;  3S2D H;  1SRU A;  3K7U C;  2IX1 A;  4B3R Q;  5C0X G;  2E5L L;  1Q12 A;  3HOU G;  1IXR A;  3FP9 A;  4P71 A;  4K0K L;  1L1O B;  3I56 A;  5M3F H;  4A3C H;  2A19 A;  2ZTD A;  4A3B G;  4QQB X;  2E5L Q;  3PUZ A;  4L5T A;  2V1C C;  4K0K Q;  3S14 H;  4DK6 C;  3A74 A;  3G48 A;  5IWA L;  4PZ6 A;  1Q81 C;  3J81 c;  5IWA Q;  3CCM A;  3CPW A;  4YCU A;  5LMU L;  4XIG S;  3CCV A;  2PNH A;  3M7N A;  4IOA A;  4POF A;  1I5F A;  5LMU Q;  1X3F A;  1X6O A;  4H02 A;  2JK8 A;  4DK3 C;  2R92 H;  4DUZ L;  2NVY H;  2N78 A;  4DUZ Q;  4IFD G;  4GN3 B;  4A3D G;  3UDF A;  1EOV A;  4C3H H;  5IYB G;  2IX0 A;  4BBS G;  1XNR L;  2AMC B;  2D0P A;  2WAQ G;  3STB C;  3IRB A;  1XNR Q;  3OW2 A;  1PFS A;  2UU9 L;  3HOU H;  1T9H A;  4Y52 H;  3CCU A;  3S17 H;  1VQE A;  2VQF L;  2UU9 Q;  3Q8D A;  4C3J H;  1O7I A;  2RF4 A;  3CCQ A;  4DV7 L;  5DLQ E;  2EXD A;  1NY4 A;  2VQF Q;  4JI7 L;  2AKW B;  4HJA A;  4DV7 Q;  1Q7Y C;  1PV4 A;  1VQ5 A;  2VS1 A;  2JJQ A;  3S24 A;  3CCR A;  5M5Y H;  4IJL A;  1EYG A;  1JMC A;  2WP8 J;  4JI7 Q;  5LMN W;  2UXC L;  4AYB G;  3I4N H;  1UE7 A;  2QGQ A;  3E9H A;  1A8V A;  1KHI A;  4KI0 A;  4A75 A;  4A3L G;  2UXC Q;  5H1S E;  1IBK L;  3PO2 H;  4HIK A;  3MXN B;  3GTQ H;  4HJ9 A;  1N32 L;  4R4T A;  4NPS A;  1IBK Q;  1YIJ A;  1PYS B;  2VNU D;  4JOI A;  1N36 L;  1N32 Q;  3GO5 A;  5IP9 G;  3CME A;  4BBS H;  1NTG A;  4YHH L;  1FVI A;  4GN4 B;  1N36 Q;  1KC8 C;  4DR1 L;  1HNZ L;  4YHH Q;  3S15 H;  5IY0 A;  4DR1 Q;  3FKI G;  2A1A A;  1HNZ Q;  4LFB L;  1VQ8 A;  1SLJ A;  4DV3 L;  1GD7 A;  1UE5 A;  3J81 i;  3AYH B;  4LFB Q;  1BBW A;  4DV3 Q;  4PMW A;  3KDF B;  4O0A A;  1VQN A;  1Q1B A;  2JA7 H;  1CSQ A;  2NN6 I;  2OQ0 A;  4P74 A;  3W1B A;  3S1R H;  1QVG A;  1VQI A;  3RLO A;  3CXC A;  1LTL A;  5FLM G;  1HZA A;  3T1Y L;  2NVQ H;  3TS2 A;  2UUB Q;  1PH2 A;  2JE6 I;  4BY1 H;  4JV5 Q;  3T1Y Q;  4A3L H;  1YVC A;  2MFI A;  4BBR H;  3J81 j;  3E9I A;  4JI8 L;  3ULP A;  1HZ9 A;  3PIP A;  2LXJ A;  3S2H H;  1VQC A;  1B70 B;  5IP7 G;  4DV6 L;  1NE3 A;  3UDX A;  4JI8 Q;  1WCM G;  1Q46 A;  1I3Q H;  2MO0 A;  4DV6 Q;  3NEM A;  3HOZ H;  2N8N A;  2PI2 E;  1E7Z A;  1TXY A;  2ZTC A;  4GNX B;  4A93 G;  1R9T H;  4OWX B;  1SFO H;  2UUC L;  3E0E A;  2ALY B;  1YIT A;  4L5S A;  4HJ5 A;  4LF8 L;  1DGS A;  2UUC Q;  4X6A H;  2KHJ A;  4QIW E;  1N9W A;  4LF8 Q;  1QVC A;  1XNQ Q;  2ASB A;  4LUV A;  1OXV A;  2HT1 A;  2R7Z G;  4DNI A;  1EWI A;  4IPD A;  4HID A;  2WAQ E;  2Y0S E;  3ERS X;  1C0A A;  2EQS A;  2H5X A;  2RCN A;  2KBN A;  4AIM A;  1C9O A;  2BH2 A;  1JJG A;  1JT8 A;  1KD1 C;  4A3C G;  4GOP B;  2VY3 A;  4A3I H;  5IP7 H;  2YTY A;  3K7A H;  2D0O A;  2F52 A;  1VQB A;  2PQA A;  4QY7 A;  2ZM6 L;  2EIF A;  1U5K A;  2HQL A;  4IPG A;  1CKN B;  5GAD C;  2UXD L;  4JC0 A;  3K0X A;  2CKZ B;  1UE1 A;  2ZM6 Q;  1X56 A;  2UXD Q;  4A3G H;  1XPR A;  2N3S A;  3I55 A;  3STB D;  4AYB E;  4IPC A;  3UDG A;  5M5W H;  1PVO A;  2XTI A;  4Y7N H;  2K75 A;  4HIM A;  4FDB A;  1RIP A;  3BU2 A;  3PUW A;  4UP9 A;  1KRT A;  2QA4 A;  2HHH L;  4QGU A;  4JYA L;  1WYD A;  1YHA A;  4RG1 A;  3WWV A;  2HHH Q;  3HOY H;  3UDI A;  1VQP A;  1PHJ A;  2R7Z H;  3KF6 B;  4JYA Q;  4GLX A;  3DM3 A;  1EQR A;  2BA0 A;  4LF7 L;  4OWT B;  4OX9 L;  2A8V A;  1V43 A;  1ASZ A;  4LF7 Q;  2QEX A;  4OX9 Q;  1MJC A;  4YWK A;  4QL5 A;  3HOX H;  1AE2 A;  4OON A;  1QUQ A;  4A3M G;  4OO1 I;  3ER0 A;  3AQQ A;  2I5M X;  2R6G A;  3PIO A;  1VQF A;  4DR2 L;  1V9P A;  2Q2H A;  2GN5 A;  3H3V I;  1NMF A;  4DR2 Q;  1PH8 A;  3I4N G;  1Q1E A;  2B3G A;  1XJV A;  3I7F A;  4P75 A;  1JE5 A;  2YU9 H;  3GTP H;  3PO2 G;  3OYY A;  3UE0 A;  2CWP A;  1EQQ A;  3F1Z A;  5LMN L;  3S16 H;  5C0X I;  4NB3 A;  4EX5 A;  4IPH A;  5IE8 A;  2K50 A;  4R4C A;  5LMN Q;  3I4M G;  2F3I A;  5HY6 A;  4BA1 I;  2Y0S G;  4YWL A;  3JC6 6;  1KIX A;  3BZC A;  4NXN L;  4A3E G;  1PH7 A;  4LNQ A;  1XMQ L;  4R1J A;  4APV A;  3L7Z C;  4NXN Q;  1TWA H;  1YI2 A;  1XMQ Q;  2BA1 A;  4A3M H;  1UE6 A;  4R4Q A;  2YTX A;  4L5Q A;  4X65 L;  1GM5 A;  4B3T L;  2IT1 A;  3GTK H;  3M9B A;  1BBU A;  2JA7 G;  4JBK A;  4X65 Q;  4B3T Q;  3A0J A;  1I50 H;  3F2D A;  4BY1 G;  1Y1V G;  2IHE A;  3NEN A;  2CFM A;  3VDY A;  4DR4 L;  2ZJR A;  1BKB A;  4BBR G;  5EAY A;  1PH9 A;  4UP8 A;  1H95 A;  1X65 A;  2YYZ A;  3CW2 C;  3KJP A;  4DV5 L;  4DR4 Q;  1A0I A;  1LYL A;  4JI3 L;  3CCJ A;  2DUD A;  2B63 H;  3I4M H;  3TEH B;  1N8R C;  3CCE A;  2JEB I;  4DV5 Q;  1XMO L;  3M4P A;  4DAM A;  4JBM A;  2VUM H;  3EBE A;  4JI3 Q;  3HOZ G;  3HOW G;  1VQO A;  1CKO A;  2NZH A;  1XMO Q;  4B3S L;  3AEV A;  1YBY A;  4A3E H;  1YJ9 A;  1KXL A;  4LF6 L;  1LM0 A;  1OTC A;  4B3S Q;  1TWF H;  2D62 A;  2KCM A;  1OXT A;  2E8G A;  4LF6 Q;  2K5H A;  1VQM A;  4ALP A;  4LF5 L;  2OCE A;  2N49 A;  2VZA A;  3EIV A;  2NN6 G;  1S40 A;  2KHI A;  1GVP A;  4A76 A;  4LF5 Q;  4LWC A;  3G6E A;  1Y1V H;  2KCT A;  2FXQ A;  1E3P A;  2LSS A;  4RMF A;  5GAE C;  3PF4 A;  1YHB A;  2GVB A;  1K0R A;  1N34 L;  1VQ7 A;  4XTC S;  2K5V A;  4C3I H;  4A3I G;  3H0G H;  2K5N A;  1WFQ A;  1X54 A;  4IJH A;  1N34 Q;  2UXB L;  1JJ2 A;  3KOJ A;  3CD6 A;  3HOW H;  3HOV G;  1IBL L;  1K73 C;  4UY8 C;  2ES2 A;  1U0L A;  4A3G G;  2BH8 A;  1Z47 A;  1K9M C;  4GS3 A;  2UXB Q;  1IBL Q;  2HIX A;  4GKJ L;  4X64 L;  5JEA J;  1VQ4 A;  1L1O C;  4X64 Q;  3W5O A;  1A62 A;  4GKJ Q;  2OTL A;  1Q86 C;  1RL2 A;  2ZJQ A;  4GN5 A;  5HGQ A;  5JJK A;  5IYC H;  3CC2 A;  1X3G A;  2YV5 A;  1VS0 A;  3KLW A;  4LW1 A;  4X66 L;  3U58 A;  2ATW A;  3HOY G;  2Z6K C;  4YY3 L;  4GLA C;  4X66 Q;  5C4X H;  5C0X J;  4KLK A;  1SN8 A;  4MZ9 A;  4YY3 Q;  4PG3 A;  4WJ4 A;  1HH2 P;  3GTO H;  5FJ8 H;  3PF5 A;  1HJP A;  4LUO A;  2JA9 A;  4TVA B;  4LF9 L;  4P72 A;  4UP7 A;  4LFA L;  3RLN A;  2R93 G;  3HOX G;  3GTL H;  1C7Y A;  2JEA I;  3PO3 H;  4LF4 L;  1QVF A;  1PH4 A;  4LF9 Q;  4LFA Q;  1KQS A;  1E1O A;  4JCV E;  4JG2 A;  3ICE A;  3KF8 B;  1PA6 A;  1W3S A;  4LF4 Q;  3HOV H;  2WFW A;  1XTD A;  3JAM c;  2HIV A;  2AHO B;  4WJ3 M;  1HZC A;  4A3K H;  1HR0 W;  1CSP A;  5M3M H;  1EIF A;  1I6H H;  3RN2 A;  3D31 A;  4JI0 L;  1P8L A;  1S3O A;  4JV5 L;  4IFD J;  2JA6 H;  4JI0 Q;  1NMG A;  1VQ9 A;  4J15 A;  1EIY B;  3TRZ A;  4DV1 L;  1LUZ A;  4YCW A;  4BY7 H;  5J3B A;  3S1N H;  4GKK L;  1D7Q A;  3J80 c;  4DR3 L;  4HJ8 A;  4DV1 Q;  2L15 A;  4GKK Q;  5GAG C;  5IYD H;  3U50 C;  4DAY B;  5C3E G;  1V1Q A;  3M3Y H;  4DR3 Q;  2PQA B;  3PUV A;  1IBM L;  4NXM L;  3AFP A;  3CF5 A;  1WI5 A;  1PH1 A;  2R93 H;  1WOC A;  3I4O A;  1IBM Q;  4NXM Q;  2Z6K A;  2OQK A;  4LUZ A;  3OTO L;  3AFQ A;  5ELO A;  2VW9 A;  1S72 A;  3GDE A;  3OTO Q;  2Z0S A;  3G4S A;  1I94 L;  2JA8 G;  3PUX A;  2IY5 B;  1I94 Q;  4JBW A;  1SR3 A;  4JI5 L;  4A4I A;  2RHS B;  2AWN A;  3CMA A;  3K81 C;  4X62 L;  4JI5 Q;  3F2B A;  1IYJ B;  1VQG A;  4X62 Q;  1K8A C;  1K83 H;  2ZJP A;  3M85 A;  2B63 G;  4YCV A;  1QZG A;  4TQU S;  1M1K C;  2XGT A;  1D8L A;  1J5E L;  2VUM G;  1XNQ L;  3SGI A;  4KHZ A;  4DPG A;  4ME3 A;  5C3E H;  1J5E Q;  1G51 A;  1L2F A;  1QUQ B;  1TWH H;  1OXS C;  1TWG H;  1QZH A;  1YJN A;  1M90 C;  4JI6 L;  2JA5 H;  2B29 A;  4MNO A;  1PH6 A;  4KHP L;  3I2Z A;  4JOI C;  3CC7 A;  4JI6 Q;  4OXP A;  3K80 C;  3JAM i;  5M5X H;  3DLL A;  1HNX L;  3CAM A;  4KHP Q;  1FL0 A;  3CPF A;  1HNX Q;  2UUB L;  1X9N A;  1VQD A;  1OXU A;  1VQJ A;  2JA8 H;  2MO1 A;  1FJG L;  1KAW A;  2Q2T A;  2UUA L;  2K14 A;  3H3V H;  1MJE A;  1YZ6 A;  4HJ7 A;  4P73 A;  3RR5 A;  2WB1 G;  4IFD I;  4GNX C;  1FJG Q;  2UUA Q;  1N33 L;  1JJC B;  3D0F A;  1K3R A;  1X3E A;  3RLF A;  1XPU A;  1Q82 C;  3J80 i;  1N33 Q;  1KL9 A;  1YEZ A;  3H0G G;  3RN5 A;  4O2D A;  4BA2 I;  2I5H A;  2VL6 A;  1ASY A;  2AWO A;  3ULJ A;  4A3B H;  3RNU A;  2R7D A;  1IL2 A;  3HKZ G;  5GAH C;  1AE3 A;  4MTN A;  5IT9 c;  1YJW A;  3CCL A;  2Q2U A;  5AJ3 L;  3U4V A;  3CQZ H;  3ULL A;  1SMX A;  5GRO A;  4A3J G;  4DV0 L;  1YHQ A;  1NJI C;  3TQY A;  1VQH A;  3GTM H;  5AJ3 Q;  3M4O H;  4GOP C;  3KDF A;  4IO9 A;  4DV0 Q;  1GO3 E;  3HFZ B;  5IYC G;  3NEL A;  3PCO B;  3GTG H;  1VQA A;  2I0Q A;  3EN2 A;  1SRO A;  4DR7 L;  5C4X G;  1G6P A;  4B3M L;  1YNX A;  3KYH C;  4A3D H;  5IYB H;  3KFU A;  4DR7 Q;  2IHF A;  5FJ8 G;  2Q2I A;  2E2I H;  4B3M Q;  1GKH A;  4JI2 L;  4DUY L;  3FHW A;  4JI4 L;  1MKH A;  1JB7 A;  2E2J H;  3F2C A;  4IOC A;  3PO3 G;  2C35 B;  1B7Y B;  4JI2 Q;  5C44 G;  4YWM A;  4DUY Q;  4JI4 Q;  3F8T A;  3J7A 5;  3UE1 A;  4JI1 L;  3B6Y A;  1VQK A;  4LFC L;  4GNX A;  3TS0 A;  4JI1 Q;  1EUJ A;  2MNA A;  4A3K G;  2JQO A;  4JBJ A;  4LFC Q;  5M3M G;  4A3J H;  1G29 1;  3MEF A;  4R4O A;  3CC4 A;  3W1G A;  1OXX K;  3BZK A;  4AQY L;  4OWW B;  2JA6 G;  1X55 A; 
#chains in the Genus database with same CATH topology
 3P1H A;  2MGS A;  2CW0 C;  1NUC A;  2JA8 B;  2F0N A;  3L0O A;  3ZJY C;  2WKD A;  1TU2 B;  4BXX G;  3IKJ A;  1V8Q A;  4GOP A;  1G91 A;  2KEE A;  3NSW A;  4GLV B;  3Q24 A;  2I5L X;  4WOR A;  1ZEQ X;  3NTK A;  1QJO A;  2B63 B;  5E7N A;  1VQ6 A;  1Z9F A;  2NZO A;  2VUM B;  1LTB D;  4KY6 A;  1BUV T;  3PSI A;  2JSO A;  5BR8 Q;  2J7Z A;  5C6A A;  2NVX H;  2D2C C;  2K4K A;  2IW3 A;  1K8G A;  3A5Z B;  1HA6 A;  4A3F H;  3EFX D;  1CUK A;  4X3K A;  1A63 A;  5M3F G;  3PUY A;  1TR5 A;  2B2W C;  4AH6 A;  2VQE Q;  2F4V L;  3HKZ E;  5HGT A;  4RGO S;  3A7L A;  1WJJ A;  4RHS A;  3T1H L;  4F88 A;  1Y1W H;  2R7F A;  4DR6 L;  5CV9 A;  3M4Q A;  1GHJ A;  2PMZ E;  1ILQ A;  1II3 A;  1AH9 A;  1BVS A;  1PH5 A;  1O78 A;  4XT1 B;  3ND8 A;  5CGK A;  4KN4 C;  2EY2 A;  3GTJ H;  3S2D H;  5FO8 B;  2EYL A;  2A19 A;  1JWS D;  5C4X B;  3G48 A;  1Q81 C;  3GTO B;  1TII D;  1K3B C;  2PNR C;  1SMY D;  4XXE A;  3NK9 A;  3DXJ C;  5LMU L;  3CCV A;  3EA6 A;  1IYV A;  1EU4 A;  4DUZ L;  2NVY H;  2N78 A;  1L0Y B;  4A3K B;  2MP1 A;  5M3M B;  4IFD G;  1EY0 A;  4GN3 B;  1XNR L;  2AMC B;  3STB C;  2QF7 A;  3P75 A;  3SK5 A;  1EWC A;  1T9H A;  3SK4 A;  2CW0 D;  1VQE A;  1EFI D;  4HMI A;  2VQF L;  4C3J H;  1O7I A;  3K5L A;  5DLQ E;  2AKW B;  2RDH A;  3TZU A;  1Q7Y C;  2VS1 A;  2JJQ A;  4PNY A;  1EEI D;  5C4J B;  3I4N H;  2QGQ A;  1OO9 B;  1B9N A;  1KHI A;  4KI0 A;  4KKS A;  5H1S E;  1LLR D;  3MXN B;  2N88 A;  4QCL A;  1N36 L;  1YNJ C;  5IP9 G;  3CME A;  1U4L A;  4UDU C;  4WRD A;  1FVI A;  1J9O A;  3BDC A;  5IGB A;  2EY6 A;  4YHH Q;  3S15 H;  5IY0 A;  2E74 C;  5JPN C;  3DHQ A;  3NUC A;  4DR1 Q;  1LTG D;  2HUG A;  3FEW X;  1PZK D;  1VQ8 A;  1GD7 A;  2PZT A;  3J81 i;  2Z4H A;  3AYH B;  3D6W A;  5C3E B;  4DV3 Q;  3VR5 A;  1Q1B A;  5EKI A;  2OQ0 A;  4DAP A;  2PPB C;  2JA7 H;  2JA5 B;  4X3T A;  1JOK A;  1EYC A;  2EYF A;  1HZA A;  2XWJ B;  2JE6 I;  2FJ2 A;  3I3C A;  3T1Y Q;  5IOC A;  4BBR H;  1A3V A;  5FKA C;  2QKI C;  1I3Q H;  1GUG A;  2PI2 E;  3Q0A A;  1E7Z A;  4IUV A;  4Q0F A;  5E4X A;  3K58 A;  2UUC L;  1ENA A;  4OWX B;  2ALY B;  2SDF A;  4HJ5 A;  4LF8 L;  4U68 A;  5D3I B;  1OXV A;  1B2T A;  3SR1 A;  2Y0S E;  1C0A A;  4H0L C;  3LWU A;  2XIW A;  4A3C G;  3GTQ B;  3ERO A;  1VF7 A;  1BCP F;  4CJ1 B;  2F52 A;  1VQB A;  2PQA A;  4BBS B;  3AU7 A;  1X56 A;  2UXD Q;  1MI2 A;  2N3S A;  2A73 B;  3STB D;  4AYB E;  4IPC A;  1SBB B;  1PVO A;  3J7A F;  1H9S B;  3BU2 A;  4XQN A;  4UHV A;  4QGU A;  3U9S A;  2A68 D;  3S1R B;  2Q8T A;  4JYA Q;  4C3H G;  4UAI A;  2NVQ B;  3DM3 A;  4OX9 L;  4AYB B;  1V43 A;  2F0D A;  2QEX A;  1MJC A;  3HOX H;  1WTV A;  3FVQ A;  1PFB A;  4OON A;  3MWY W;  1YNJ D;  3QG1 A;  4DR2 L;  1HPC A;  5CV8 A;  4HSV A;  2F0J A;  1Q1E A;  2B3G A;  4RH6 A;  2YU9 H;  1E0B A;  2NZ1 D;  3S16 H;  3DWP A;  4EX5 A;  4IPH A;  1ROD A;  4DAV A;  2F3I A;  4BA1 I;  1BXT A;  2D9U A;  2RDG A;  3JC6 6;  2F0S A;  2LMC B;  4A3F B;  4NXN L;  2NWG A;  3KBG A;  3NHH A;  1YI2 A;  3DEP A;  4CGY B;  1UE6 A;  3LWE A;  1GM5 A;  5BN3 A;  4B3T L;  4HED A;  3W2D A;  2EZV A;  1NNX A;  4X65 Q;  1I50 H;  2LY7 A;  1BNZ A;  3V2T A;  3TP6 A;  3U9O A;  3E3X A;  4UP8 A;  2K32 A;  2DUD A;  2IL8 A;  3TEH B;  2R7Z B;  4DV5 Q;  4JBM A;  1S5D D;  3GTJ B;  3HOZ G;  4OIJ A;  3HOW G;  1Y8P B;  1VQO A;  1CKO A;  3S2D B;  1XMO Q;  4B3S L;  4MHE A;  4K2L A;  4A3E H;  1KXL A;  2LKV A;  1TWF H;  2KCM A;  1G8Z D;  4LF6 Q;  1JWU D;  1LAB A;  2K5H A;  4ALP A;  4LF5 L;  1CTM A;  2OCE A;  2NN6 G;  1SYF A;  2FIN B;  3AB9 A;  4A76 A;  4H7B A;  2F0K A;  1Y1V H;  4CDF C;  1HQM C;  5CC4 A;  2GVB A;  5EKL A;  1K0R A;  1VQ7 A;  4C3I H;  2F0V A;  2IJ0 A;  3OMG A;  1X54 A;  1N34 Q;  3MA2 B;  4K6D A;  2UXB L;  3KOJ A;  3CD6 A;  3KK7 A;  4L6T B;  2ES2 A;  3D3R A;  1Q3L A;  3D8G A;  1Z47 A;  4A3G G;  4GS3 A;  4K2K A;  2HIX A;  4GKJ L;  3TME A;  1GHK A;  3QO2 A;  4KY5 A;  3K5M A;  4C3J B;  4X64 Q;  5JJK A;  1E2Z A;  1RL2 A;  4GN5 A;  5HGQ A;  1H9K A;  1S4Z A;  3HOY G;  5JPM C;  2Z6K C;  1SN8 A;  3I73 A;  3I4N B;  1CA5 A;  4PG3 A;  4RA8 A;  1HJP A;  1RCV D;  4LF9 L;  4LFA L;  3RLN A;  2R93 G;  2JEA I;  3PMF A;  2QW7 A;  1PH4 A;  4DF7 A;  3RUZ A;  1ET6 A;  3URY A;  4LF4 Q;  3D6C A;  1EQV A;  3JAM c;  4F87 A;  3S15 B;  4FYD A;  1TQO A;  1HR0 W;  1CSP A;  3RN2 A;  1IKL A;  1P8L A;  2F0T A;  4KY7 A;  5ELC A;  2JA7 B;  4CKC A;  1EIH A;  1D7Q A;  1LTR D;  4DV1 Q;  4K8J A;  4NW2 A;  5IYD H;  3M3Y H;  4DAY B;  5L37 A;  5C3E G;  3ND9 A;  4DR3 Q;  3CF5 A;  2B2T A;  4BBR B;  1AFP A;  2Z6K A;  2F03 A;  4C56 C;  4LUZ A;  3VR4 A;  1I3Q B;  1S72 A;  1SR3 A;  4JI5 L;  4A4I A;  1F9Q A;  2RSO A;  3MFY A;  3F2B A;  2F0F A;  4KK7 A;  2L5T A;  4V0B A;  1K8A C;  4TQU S;  2XGT A;  4KHZ A;  1LT5 D;  1J5E Q;  4WFN 3;  1STE A;  2WAC A;  1L2F A;  1FD7 D;  1XNQ Q;  1OXS C;  1TWG H;  3VYU A;  1EEF D;  3MFG A;  4MNO A;  3DUZ A;  4KHP L;  4JI6 Q;  1ENF A;  1IL8 A;  3K80 C;  4OXP A;  3DLL A;  1HNX L;  3OWF A;  4ZUJ A;  1G6Z A;  5JEA H;  1VQJ A;  2EXZ A;  2JA8 H;  1KAW A;  2UUA L;  4KD3 A;  4HJ7 A;  2K05 A;  2MUY A;  3RR5 A;  1FJG Q;  3MXN A;  1N33 L;  3VR2 A;  3D0F A;  3OWE B;  4CJ2 C;  1Q82 C;  1KL9 A;  1YEZ A;  4BA2 I;  2L12 A;  4R8N A;  1Z6H A;  2R7D A;  2F1M A;  3K5O A;  2KOL A;  1AW7 A;  2KCN A;  5AJ3 L;  1SE4 A;  5EPL A;  1YHQ A;  1SMX A;  4DV0 L;  3HOX B;  2NTT A;  4O42 A;  1HUN A;  3E5S A;  3HFZ B;  2NYZ D;  1ML0 D;  1HTL D;  2I0Q A;  4ZK9 B;  5FJ8 G;  2Q2I A;  4B3M Q;  1EYD A;  5A2Q L;  3FHW A;  1K8O A;  3S16 B;  2C35 B;  1B7Y B;  1STB A;  4DUY Q;  3E6Z X;  1HFN A;  3J7A 5;  1O7Z A;  1VQK A;  4LFC L;  3NTI A;  4QF4 A;  4JI1 Q;  1ESF A;  3FPU B;  2HDL A;  1G29 1;  4R4O A;  4KMU C;  5COR A;  1OXX K;  3DEO A;  3J81 E;  3BZK A;  4OWW B;  2JA6 G;  2EDG A;  1X55 A;  5J22 A;  4A3F G;  2PI2 A;  4G57 A;  3OIP A;  4AQY Q;  4BY7 G;  1EZ8 A;  5T1I A;  3DMU A;  3MTS A;  1HR0 Q;  2YTV A;  1I50 B;  2IX3 A;  1D1I A;  1K0S A;  1UAP A;  5EGT A;  3KBX A;  1Y1W G;  1JOR A;  1HZB A;  1PH3 A;  3FKI H;  2RVL A;  1HNW L;  4DR5 Q;  4WJW A;  1FGU A;  2MPM A;  2TSS A;  3J80 L;  2B2Y A;  3NBH A;  1KRS A;  1NBW A;  4R9W A;  1UWV A;  3TRE A;  1B9M A;  3BYT B;  5K36 G;  1B8A A;  1H9S A;  5FLX c;  3GTM B;  1TWF B;  2GVA A;  5FLM H;  2RHQ B;  4C2M H;  1XPO A;  4RGN A;  5I2Y A;  1VCI A;  5FOB B;  3MXU A;  1MGS A;  3H15 A;  3SXH A;  1L1O A;  3KJO A;  4R4I A;  3RZD H;  4PZ7 A;  4L5R C;  3H6M A;  1CKM A;  2PW5 A;  4KHV A;  3T13 A;  4C3I B;  5C4J H;  4A93 H;  1SE8 A;  4OO1 G;  3BJU A;  2I07 B;  1KAA A;  3CCS A;  3CP0 A;  4DV4 Q;  2LXK A;  2ID0 A;  1HFG A;  2RCF A;  1TS2 A;  3BS1 A;  2F3V A;  3K8A A;  4DV2 Q;  4HIO A;  4B9W A;  3NXW A;  2IX1 A;  4B3R Q;  3NBI A;  5C0X G;  3BG3 A;  2O2L D;  3I56 A;  2ZTD A;  5CV7 A;  4A3B G;  4NP5 A;  1YNN C;  2E5L Q;  4QQB X;  4K0K Q;  1W6J A;  4KV6 A;  1PTO B;  4DK6 C;  5ELF A;  3A74 A;  4ZUI A;  5IWA L;  4PZ6 A;  5KIX A;  1PMR A;  3A7A B;  3J81 c;  4QUC A;  3CPW A;  5C44 B;  4YCU A;  4N9P A;  2PNH A;  4IOA A;  4OEM B;  2B2V A;  2R92 H;  1I4H A;  4ZRZ A;  4GZY C;  4A3D G;  3T51 B;  5IYB G;  2D0P A;  3R8B A;  4QUF A;  3S1M B;  1PFS A;  2B8G A;  2RBM A;  2UU9 L;  1ILP A;  4RCN A;  2RF4 A;  3T4A C;  1KDA A;  3M3Y B;  1BF4 A;  2EXD A;  4JI7 L;  4HJA A;  4DV7 Q;  3NPP A;  1JMC A;  5M5Y H;  1EYG A;  2WP8 J;  5LMN W;  2UXC L;  4ZKB B;  3NWT A;  1PLF A;  2EVB A;  3E9H A;  4A75 A;  1KTK A;  1IBK L;  3GTQ H;  4XQQ A;  5M9O A;  2KA7 A;  4R4T A;  2IPK D;  1N32 Q;  1GUO A;  4BBS H;  1CT1 D;  2BOS A;  3F2U A;  1HNZ L;  3TP7 A;  1AN8 A;  2A1A A;  1UE5 A;  3L3O C;  2J0T D;  5I9O A;  1WTQ A;  4LFB Q;  1B3Q A;  4PMW A;  4O0A A;  1TS4 A;  1CSQ A;  3S1R H;  4K6L A;  2NVQ H;  1VQI A;  3RLO A;  3TS2 A;  1VDZ A;  2UUB Q;  4JV5 Q;  2DJG C;  1NR2 A;  4DFA A;  1EY5 A;  1BCP C;  4JI8 L;  5C5M A;  1HZ9 A;  2LXJ A;  1VQC A;  2G5D A;  1PRT F;  3H91 A;  1NE3 A;  1QE6 A;  1C48 A;  1SDF A;  1WCM G;  1Q46 A;  4DV6 Q;  4NDX A;  3NEM A;  2KVM A;  1TXY A;  2ZTC A;  4GNX B;  1HRJ A;  1F9R A;  5FO9 B;  1WD1 A;  3E0E A;  4X3S A;  3NP8 A;  2OT2 A;  2SEB D;  3VR3 A;  4X6A H;  1YNN D;  3I91 A;  4OEL B;  2ASB A;  5F2D A;  2R3Z A;  1LTT D;  3D4R A;  2WAQ E;  3ERS X;  2H5X A;  2RCN A;  5I6W A;  2KBN A;  1JJG A;  4JW0 A;  1WTP A;  1G2S A;  4DAY A;  1BDO A;  2YTY A;  3K7A H;  1RF2 D;  4A3I H;  1RTO A;  4QY7 A;  1EQT A;  2EIF A;  1U5K A;  1CKN B;  3K0X A;  2CKZ B;  1UE1 A;  2ZM6 Q;  2WAQ B;  1MSH A;  1NCV A;  1GUT A;  1XPR A;  3I55 A;  1QIL A;  1PZI D;  4ODG A;  2V4D A;  4FDB A;  3HKZ B;  3PUW A;  4UP9 A;  2HCC A;  3HG9 A;  1YHA A;  2HHH Q;  1VQP A;  2R7Z H;  3KF6 B;  4LF7 L;  1WTO A;  2PMZ B;  1ASZ A;  4KKT A;  4FF1 A;  4YWK A;  2NUC A;  4CHT B;  2R6G A;  1VQF A;  1V9P A;  5ELE A;  3H3V I;  1NMF A;  1SFO B;  2B2W A;  3FKI B;  4ZYS A;  4ABN A;  3SK6 A;  3PO2 G;  1SE3 A;  4U67 3;  2K03 A;  2CWP A;  3F1Z A;  4K5W A;  3ITP A;  4HTH A;  2K50 A;  3QOL A;  4O1N A;  5LMN Q;  3VYS A;  1B50 A;  1I4Q A;  4C2M B;  3DWQ A;  1MD2 D;  1SND A;  2OXP A;  3FDT A;  4A3E G;  4LNQ A;  1XMQ L;  4APV A;  3KLR A;  1BCP D;  2G9H D;  2A68 C;  3DWA A;  4L5Q A;  2IWH A;  3RZD B;  2K5D A;  4A93 B;  4BY1 G;  4IZ8 A;  1Y1V G;  2IHE A;  3QR8 A;  3NEN A;  4P2C B;  4DR4 L;  1HCZ A;  1PH9 A;  1H95 A;  5J1Z A;  3FRP B;  3KJP A;  1S5B D;  1A0I A;  4JI3 L;  2HDM A;  2N55 A;  2JEB I;  4MTK A;  5AFW A;  2NZH A;  2EYJ A;  1YBY A;  2ZXP A;  1IHZ A;  2WII B;  3G6J B;  1SNQ A;  2E8G A;  1VQM A;  2N49 A;  4IUU A;  1S40 A;  1GVP A;  1Y8N B;  3MAQ A;  4XYQ A;  4CDE C;  4OGQ C;  2KCT A;  2PYK A;  4RMF A;  5GAE C;  2R92 B;  4CKB A;  4C1N K;  3H0G H;  4N9T A;  2F0H A;  1H9J A;  1IBL L;  1PZJ D;  5I2X A;  2BH8 A;  1K9M C;  3KF8 A;  5JEA J;  4DU9 A;  4G7Z C;  2AQ2 B;  3QB3 A;  1A62 A;  2OTL A;  2K01 A;  2ZJQ A;  4A3M B;  5KNC A;  5IYC H;  1L0X B;  2YV5 A;  1TS5 A;  3TN2 A;  1O80 A;  1PTO C;  3U58 A;  5M5Y B;  3JAM L;  4GLA C;  4X66 Q;  2EJM A;  1D6E C;  1WVL A;  4YY3 Q;  3G7L A;  3GV6 A;  1HH2 P;  3PF5 A;  4TVA B;  1LTS D;  2L1B A;  4XQJ A;  3PO3 H;  3I4M B;  1PA6 A;  3NE5 B;  1XTD A;  2C5C A;  2M00 A;  2Y0S B;  4CBV A;  2AHO B;  5C5L A;  4WJ3 M;  2X6L A;  1LT3 D;  1CQV A;  4ZAI A;  4JI0 L;  3D31 A;  4LK1 C;  4LJZ C;  4K8I A;  2A6H C;  2KJX A;  1NAP A;  4HAE A;  1DD2 A;  3TDQ A;  1EIY B;  3CU7 A;  4GKK L;  2CH4 W;  4IUQ A;  4HJ8 A;  1F9S A;  4HCE A;  1M8A A;  4BS9 A;  1WI5 A;  4DK0 A;  1WOC A;  3I4O A;  5C3W A;  4DXF A;  1IBM Q;  4NXM Q;  5KND A;  2RKS A;  3OTO Q;  2JA8 G;  1I94 Q;  4JBW A;  2RHS B;  3K59 A;  3CMA A;  4H13 C;  3K81 C;  2F0E A;  5J39 A;  4OIK A;  1C4Q A;  4X62 Q;  1JWM D;  1K83 H;  2QCP X;  2B63 G;  4YCV A;  1D8L A;  2VUM G;  4FF4 A;  1D2B A;  1DZ1 A;  2NTS A;  3MEH A;  1QUQ B;  5NUC A;  1M90 C;  2B29 A;  1PH6 A;  4JOI C;  3CC7 A;  3GTL B;  4A3I B;  3K7A B;  1V1P A;  4ILW A;  4G7H C;  3CAM A;  3TP5 A;  1FL0 A;  4B9X A;  3HOV B;  1OXU A;  5CV4 A;  2MO1 A;  3S9W A;  3H3V H;  5FO7 B;  4P73 A;  4GNX C;  3C46 A;  2EJF C;  1X3E A;  3CRL C;  5IOD A;  2EYH A;  3J80 i;  3RN5 A;  3IL8 A;  2Q8I B;  3L9A X;  3KUP A;  2AWO A;  3ULJ A;  1PTO D;  3BVM A;  2JP1 A;  3RNU A;  3HKZ G;  4MTN A;  1YJW A;  4ZLT F;  3CCL A;  4DA2 A;  1LTA D;  3C1F A;  3U4V A;  4M8A A;  3GTM H;  3M4O H;  4KJO A;  5EPJ A;  4IO9 A;  1GO3 E;  1H9M A;  1VQA A;  1SRO A;  2E76 C;  4DR7 L;  5C4X G;  1G6P A;  1YNX A;  4IFD H;  3T53 B;  3KYH C;  2EPB A;  2IHF A;  4M1U B;  2E2I H;  4JI2 L;  4JI4 L;  4EVO A;  3MXP A;  2HCI A;  2A6H D;  2L11 A;  5LL6 S;  4YWM A;  5BN5 A;  4N8F A;  4J1M A;  2JXM B;  2F0L A;  3UE1 A;  1I4G A;  2K1B A;  5EQ0 A;  3B6Y A;  2RSN A;  4GNX A;  1M4V A;  3TS0 A;  2EY1 A;  1RD9 D;  1EUJ A;  3VA7 A;  4S3S A;  4A3K G;  5JAV A;  5M3M G;  1CA6 A;  2PZU A;  1I4P A;  4FVM A;  3OSO A;  2KCC A;  3OIQ A;  4HIM A;  2XNA C;  1IZ6 A;  4TRD A;  2CCZ A;  1DJR D;  4FF3 A;  3BDL A;  1PTO H;  5IP9 H;  2AQ3 B;  3X3N A;  5FLX L;  3LNN A;  1ZYR C;  2XWB B;  1I6V C;  1L0W A;  1DOM A;  5C44 H;  1QB5 D;  1E1T A;  1CKN A;  1W2B A;  1I4X A;  1Q8K A;  1MIU A;  1PYB A;  3GD7 A;  5BR8 L;  3L2P A;  2XRQ D;  1GJX A;  3PGZ A;  3VYR A;  1QWY A;  1A6X A;  2Z6B A;  2WB1 E;  4FP5 D;  1D1K A;  2K52 A;  1SXT A;  5JJL A;  1T5X D;  4DXG A;  3S1M H;  3KF6 A;  2VQE L;  3U4Z A;  1VQL A;  1STA A;  2HD3 A;  2XSC A;  1UEB A;  2MQH A;  3PV0 A;  2PCF B;  1UEA B;  2WB1 B;  3DM1 A;  2F4V Q;  2KEN A;  5ELN A;  3J7Z C;  2JA5 G;  5DNF A;  2E2H H;  3A5U A;  4CDC C;  3H0G B;  3NTH A;  3T1H Q;  3RZO H;  5GQO A;  1BCP B;  2E75 C;  4DR6 Q;  3Q22 A;  1GOZ A;  1TWC H;  2DGY A;  2R92 G;  4XYO A;  4RGM A;  1IYU A;  4UPA A;  3OHX C;  1Y14 B;  1EFW A;  3K6O A;  3OPO A;  1IXR A;  4P71 A;  4A3C H;  3WOE A;  2QDL A;  2V1C C;  4L5T A;  3S14 H;  4HR7 B;  5EJW A;  3FMC A;  5E3F A;  3PO3 B;  3N6R A;  4K14 A;  1KAB A;  3W3A A;  4POF A;  1I5F A;  5LMU Q;  1X6O A;  4H02 A;  5JOB A;  2JK8 A;  1XTC D;  4IUN A;  1TVX A;  3J7A V;  5IT9 L;  1TS3 A;  4DUZ Q;  2VB3 X;  3BVG A;  4C3H H;  2IX0 A;  4BBS G;  5HUR A;  1XNR Q;  1X3P A;  1EYA A;  3HOU H;  4Y52 H;  3CCU A;  4RWS C;  2LFN A;  1WTR A;  2JYO A;  2VQF Q;  1VQ5 A;  5COY A;  2TMP A;  2F0U A;  3CCR A;  2OTJ A;  4XT3 B;  4IJL A;  1ZYR D;  4AYB G;  4PV1 C;  1A8V A;  3K57 A;  3TBI B;  4IN3 A;  3TP8 A;  4I65 A;  4NPS A;  3EVQ A;  1RJT A;  2VNU D;  1EY7 A;  2D5D A;  3S1Q B;  4YHH L;  1N36 Q;  2O5J C;  4LMQ D;  4DR1 L;  3O13 A;  1STH A;  2DNC A;  5DAU A;  1K83 B;  5M3F B;  4DV3 L;  1LT6 D;  1KLU D;  3KDF B;  3W1B A;  1QVG A;  4FXD A;  1SYC A;  3T1Y L;  4DN4 M;  1D5X C;  1PH2 A;  5ELD A;  4A3L H;  2MFI A;  3ULP A;  1SYE A;  3PIP A;  3S2H H;  3UDX A;  1RHP A;  2F0O A;  1VF5 C;  2GA4 B;  3K0Y A;  1SYD A;  4H44 C;  1JOQ A;  5IGF A;  1WD0 A;  3HOZ H;  3ERQ A;  4RHR A;  2N8N A;  1KNA A;  1SNP A;  1XXG A;  1SFO H;  4L5S A;  2UUC Q;  2KHJ A;  4QIW E;  1N9W A;  4LF8 Q;  5KYL A;  1QVC A;  2NN6 H;  3C2P A;  2R7Z G;  2KUM A;  3SE0 A;  3M4O B;  4DNI A;  2F0I A;  4HID A;  1EWH A;  1JOO A;  3QOJ A;  3Q6S A;  1DOK A;  2DY7 A;  2DY8 A;  1JT8 A;  2QIL A;  1HUM A;  1KD1 C;  1LV9 A;  3TSS A;  5IP7 H;  1WTW A;  1T5E A;  4YIJ A;  2E2D C;  4IPG A;  2UXD L;  1JE4 A;  2E2I B;  3M4Y A;  2SNS A;  1TKW B;  1F9P A;  4A3G H;  1U4P A;  3PQI A;  5IT9 E;  4MIU A;  3UDG A;  5G3L F;  2LS0 1;  2XTI A;  1KRT A;  3GQB A;  1F2M A;  1I4R A;  3QWN A;  3H94 A;  4JYA L;  2FHT A;  3HOY H;  1PHJ A;  1GUS A;  1SJE D;  4GLX A;  5EKK A;  2A8V A;  3SDZ A;  1F2L A;  3A8K E;  4OX9 Q;  2AUK A;  1STN A;  3TZD A;  3A55 A;  4KKU A;  2SOB A;  1A2U A;  4C3J G;  1QUQ A;  4OO1 I;  5C4H A;  2I5M X;  1S5F D;  3A8J E;  1HA5 A;  3PIO A;  4KD4 A;  4ULL A;  2Q2H A;  3SVM A;  4DR2 Q;  1PH8 A;  1R9T B;  3I4N G;  3A56 A;  3I7F A;  4P75 A;  1JE5 A;  5KYI A;  3QJY A;  3OYY A;  5A2Q E;  2EYP A;  5C0X I;  1PYW D;  4NB3 A;  5IE8 A;  4R4C A;  5HY6 A;  3NQT A;  1DM0 B;  1EZ6 A;  3RMH A;  4YWL A;  1KIX A;  4JVZ A;  3BZC A;  1PH7 A;  1BOS A;  1XWE A;  4NXN Q;  4FF2 A;  4A3M H;  4R4Q A;  1IKM A;  1IW7 C;  4X65 L;  3GTK H;  1Y69 U;  2JA7 G;  2PQE A;  4QMG A;  4R8I A;  3V96 A;  4B3T Q;  2E2H B;  4RKL A;  3A0J A;  2VB2 X;  1DYQ A;  1CZW A;  3RZO B;  4ZKC B;  2B39 A;  2F0W A;  3VDY A;  2CFM A;  5DM7 3;  1BKB A;  1TWC B;  4BBR G;  5EAY A;  2H1E A;  1RTN A;  3CW2 C;  2K6A A;  5LL6 X;  4DV5 L;  1LYL A;  3CCJ A;  2ZT9 C;  3KLS A;  3UI2 A;  3I4M H;  1N8R C;  3CCE A;  1XMO L;  1ZXT A;  4DAM A;  1R4P B;  3EBE A;  5BN4 A;  3J80 E;  4OHJ A;  1MSG A;  1YJ9 A;  4LF6 L;  1LM0 A;  1V1O A;  1OTC A;  4B3S Q;  1O7Y A;  2D62 A;  4RCO A;  3S14 B;  1JC7 A;  2VZA A;  2KHI A;  3K5N A;  4LF5 Q;  4LWC A;  4IUR A;  2L4N A;  1PFN A;  2BE5 D;  4Z9C B;  4BWG B;  1EIG A;  2FXQ A;  2LSS A;  1CFM A;  2K33 A;  1YHB A;  1N34 L;  4V19 0;  4XTC S;  2K5V A;  3FPP A;  2K5N A;  4IJH A;  3BZD B;  4C3H B;  3NWS A;  1JJ2 A;  1U0L A;  3PIP 3;  4DNT B;  2UXB Q;  1G2T A;  3HOU B;  4X64 L;  1S5E D;  1HHV A;  1GUW A;  1VQ4 A;  4GKJ Q;  2K7V A;  3IFD A;  1Q86 C;  4K5V A;  3CC2 A;  2A6E C;  1VS0 A;  3KLW A;  4CKE A;  2MHV A;  2BCO A;  5FJ8 H;  4LUO A;  2JA9 A;  4P72 A;  4UP7 A;  3HOX G;  3E0J A;  2F3W A;  3GTL H;  1ONL A;  4LF4 L;  1QVF A;  4LF9 Q;  4LFA Q;  1KQS A;  1E1O A;  1AZP A;  3OOC A;  3ICE A;  1SNM A;  3HOV H;  2WFW A;  2KHS A;  5ISR A;  1DCZ A;  1HZC A;  1PXU A;  1H9R A;  2P5Z X;  1EIF A;  1S3O A;  1VMP A;  2F0Q A;  2PW7 A;  4IFD J;  2JA6 H;  5CBE E;  1SNO A;  1VQ9 A;  3TRZ A;  4DV1 L;  1IW7 D;  4EQP A;  4BY7 H;  3S1N H;  5EBD A;  3J80 c;  4DR3 L;  2KQ3 A;  3U50 C;  5I4D A;  1V1Q A;  3PUV A;  3AFP A;  1Z7T A;  3ZYY X;  1PH1 A;  3S2H B;  1PFM A;  2OQK A;  1Q8I A;  5DM6 3;  3AFQ A;  5ELO A;  2VW9 A;  3HOW B;  3HOZ B;  3GDE A;  2QEJ C;  5LHY 1;  3PUX A;  5K36 H;  2IY5 B;  5KGU A;  1EOT A;  2AWN A;  3R3O A;  3PIO 3;  4JI5 Q;  5D14 A;  1QZG A;  1J5E L;  1XNQ L;  1B4O A;  4ME3 A;  3D4D A;  1TY0 A;  4JI6 L;  3NQI A;  2L55 A;  2EYM A;  1LT4 D;  4OO1 H;  4KHP Q;  3H3V C;  3CPF A;  1HNX Q;  1VQD A;  2DNE A;  1SNC A;  1FJG L;  2Q2T A;  4A3G B;  2MJ8 A;  4TKO B;  1YZ6 A;  1MJE A;  4L63 B;  4IFD I;  1JB3 A;  2UUA Q;  1K3R A;  3R93 A;  3RLF A;  1XPU A;  3HEJ A;  1N33 Q;  4C3I G;  5C0X H;  2Z8L A;  2VL6 A;  3HOY B;  2A6E D;  2EYO A;  4A3B H;  1IL2 A;  1AEX A;  2BDN A;  3I8Z A;  5GAH C;  1AE3 A;  4RAU C;  2Q2U A;  3M7N A;  5GRO A;  1NJI C;  3TQY A;  1VQH A;  2R93 B;  5AJ3 Q;  4ZCK A;  1B44 D;  3KDF A;  4DV0 Q;  1KNE A;  1WTH A;  3P20 A;  1LTI D;  4DGZ A;  3V05 A;  3SEB A;  3OMC A;  3EN2 A;  1GXD C;  1A15 A;  1UNS A;  4B3M L;  2ZXR A;  2AQ1 B;  4A3D H;  5IYB H;  4RFB A;  3KFU A;  3D4W A;  1GKH A;  4DUY L;  1MKH A;  3P7J A;  2E2J H;  3F2C A;  5C44 G;  1HXY D;  4K5X A;  3A8I E;  1EY8 A;  2RDF A;  4JI1 L;  2A69 C;  2OEO A;  1X32 A;  5JVG 3;  2JQO A;  1TWH B;  2L0C A;  3EQL C;  5JVH 3;  4LFC Q;  4A3J H;  3CC4 A;  3W1G A;  2R61 A;  5M5X B;  4L8J A;  4AQY L;  1RDP D;  2O4X A;  4I7A A;  3I4L A;  3GTK B;  1HR0 L;  1E22 A;  4POG A;  1QNU A;  1J6Q A;  5IYD G;  5TSS A;  1CI3 M;  1X3Q A;  2ENB A;  3EJI A;  4N8X 1;  4DR5 L;  5KRU A;  2EY5 A;  3BYY B;  1SE2 A;  4EQ5 A;  1PRT B;  5CR3 A;  1P16 A;  3HKS A;  1HNW Q;  3G71 A;  2O5I C;  2K5W A;  3CQZ B;  2M2L A;  3WDN A;  2WKC A;  4PZ8 A;  4G4K A;  1J8I A;  2CQA A;  4IUP A;  4NKL A;  3CKI B;  3GTG B;  1STG A;  1WTX A;  1E24 A;  4BXX H;  1WCM H;  5DEH A;  2CWA A;  4HCS A;  1RKN A;  3GP7 A;  3LGJ A;  2NVT H;  1EL0 A;  3NBH B;  5D65 A;  1I6H H;  4QJF A;  4DKA C;  2A74 C;  4DV4 L;  5T1G A;  2I46 A;  1BR9 A;  5JEA G;  2CQO A;  4DV2 L;  2ZTE A;  2QDB A;  3S1Q H;  2OWO A;  5JJI A;  4B3R L;  4LAA A;  5I6Y A;  1SRU A;  3K7U C;  3KLS X;  2E5L L;  1Q12 A;  3HOU G;  3FP9 A;  5FK9 C;  4K0K L;  1L1O B;  1TT2 A;  5M3F H;  1C8C A;  4ID6 A;  3PUZ A;  2XVS A;  1F2Z A;  1ENC A;  2X6G A;  2PZW A;  5IWA Q;  3J7Y W;  3CCM A;  1JCK B;  4XIG S;  1XX8 A;  2Z9H A;  5ELB A;  1X3F A;  4DK3 C;  2A69 D;  2Z1C A;  4KJN A;  1BBX C;  3UDF A;  1EOV A;  2NVX B;  4Q5V A;  2NBF A;  4FO2 A;  2WAQ G;  3HGB A;  2JA6 B;  3IRB A;  3OW2 A;  1F2Y A;  4BY7 B;  3S1N B;  2RA4 A;  3S17 H;  2UU9 Q;  3Q8D A;  3CCQ A;  4DV7 L;  1NY4 A;  1PV4 A;  1O7L A;  3S24 A;  4JI7 Q;  1Y1W B;  1KLG D;  3JAM E;  1ZKO A;  1UE7 A;  3X3M A;  1MBY A;  2UXC Q;  4A3L G;  3PO2 H;  4HIK A;  4IAL A;  4HJ9 A;  1N32 L;  2JN4 A;  1XYI A;  1JR0 D;  1TY2 A;  1ICW A;  1IBK Q;  1YIJ A;  1PYS B;  4JOI A;  4RGT A;  3GO5 A;  2F0G A;  1NTG A;  4GN4 B;  1KC8 C;  5IIF A;  4FNF A;  2B8F A;  2WIN B;  3FKI G;  4LFB L;  1HNZ Q;  1SLJ A;  4FXK C;  1CHQ D;  1BBW A;  5EBC A;  2KEC A;  4RKB A;  1VQN A;  2UUB L;  2NN6 I;  4P74 A;  4PMB A;  4JV5 L;  2XN9 C;  2M9V A;  1LTL A;  1FNU A;  5FLM G;  3CXC A;  1K28 A;  1CZG A;  4BY1 H;  5A35 A;  1YVC A;  2VXW A;  1CQF A;  1B53 A;  4DK1 A;  4G7O C;  3J81 j;  3E9I A;  3HP3 A;  2NVY B;  2A5H A;  1B70 B;  5IP7 G;  4DV6 L;  2CHB D;  4NMZ A;  5CYU A;  4JI8 Q;  4KTA A;  2MO0 A;  5IGD A;  3R2I A;  2B2U C;  1LAC A;  1JIC A;  4A93 G;  1R9T H;  1DON A;  1Y8O B;  1YIT A;  1HTP A;  2HQE A;  4A3B B;  1DGS A;  2XRS D;  4F7X A;  2B2T C;  3MC0 B;  4LUV A;  1QCB D;  2HT1 A;  1R4Q B;  1EWI A;  4IPD A;  3MXG A;  4J8Q A;  3VA5 A;  3MZ5 A;  1U4M A;  2EQS A;  4CDD C;  4AIM A;  1C9O A;  2BH2 A;  5CMD A;  4GOP B;  2VY3 A;  2FMM A;  2D0O A;  2ZM6 L;  4A3D B;  5GAD C;  2HQL A;  1FR3 A;  5I9P A;  4JC0 A;  3QIA A;  1EY6 A;  2E2J B;  4IQZ A;  2K04 A;  5M5W H;  4Y7N H;  2EJG C;  2K75 A;  1RIP A;  2QA4 A;  2HHH L;  3VYT A;  1WYD A;  2B2U A;  1DXM A;  4RG1 A;  4FXG C;  3WWV A;  3UDI A;  4A3J B;  1EQR A;  2BA0 A;  1LO5 D;  4OWT B;  3J81 L;  2EOT A;  1PTO F;  2L9H A;  4LF7 Q;  1E2V A;  4QL5 A;  1AE2 A;  4PQX A;  2F0M A;  4A3M G;  2K28 A;  3ER0 A;  3HRZ C;  3AQQ A;  4KN7 C;  2DN8 A;  5CV5 A;  1PDQ A;  2GN5 A;  1XJV A;  1FYC A;  1W6K A;  3GTP H;  3UE0 A;  1EQQ A;  5LMN L;  4ME5 A;  1BO0 A;  3I4M G;  1A3U A;  1VMC A;  2Y0S G;  3A54 A;  4R1J A;  3L7Z C;  1TWA H;  1XMQ Q;  2BA1 A;  1NR4 A;  2YTX A;  5E1F A;  1WCM B;  4ZQ3 A;  2IT1 A;  5CBA E;  2EE1 A;  2CH4 A;  3M9B A;  2ZXO A;  1BBU A;  4JBK A;  3R2T A;  2NVT B;  4C1N I;  1FNV A;  5G3L D;  3F2D A;  1I6H B;  1U4R A;  1CK1 A;  1D5M C;  2F0P A;  1PRT C;  2ZJR A;  4HMJ A;  5FLX E;  1AZQ A;  1X65 A;  2YYZ A;  4DR4 Q;  2K5Q A;  2B63 H;  1SJH D;  3H09 A;  1STY A;  1ESR A;  3M4P A;  3BDO A;  2VUM H;  4JI3 Q;  1CM9 A;  2Z4I A;  3AEV A;  1Q90 A;  4J6H A;  1OXT A;  3IAY A;  2ICE C;  1D5Z C;  3SK8 A;  3WOF A;  1SYB A;  1ICF B;  3EIV A;  3OW7 A;  5KEE A;  1B3A A;  3G6E A;  4HSP A;  1DOL A;  4HN7 A;  1AP0 A;  1K8M A;  2B2Y C;  1E3P A;  3MVV A;  2YU9 B;  3PF4 A;  3RD4 A;  1SSO A;  4A3I G;  4JPB W;  2KED A;  1WFQ A;  1S5C D;  1E2W A;  3HOW H;  4CJ0 B;  3HOV G;  1F77 A;  1K73 C;  4UY8 C;  1IBL Q;  1KDB A;  4I7Z C;  2ICI A;  5E4W C;  3S17 B;  1L1O C;  3W5O A;  2CVR A;  3HZX A;  2FFK B;  1X3G A;  4LW1 A;  4X66 L;  2ATW A;  5C4Z A;  1ET9 A;  1EY9 A;  4YY3 L;  5C4X H;  5C0X J;  4KLK A;  4MZ9 A;  4WJ4 A;  5CV6 A;  3GTO H;  1QG7 A;  4EQN A;  3MHB A;  3PO2 B;  4QIW B;  1C7Y A;  2AUJ D;  4JCV E;  4JG2 A;  3KF8 B;  1W3S A;  1FNW A;  2HIV A;  2BE5 C;  2F4I A;  2SNM A;  4A3K H;  4A3E B;  5M3M H;  3ONA B;  2FMC A;  4JK1 C;  2WV6 D;  4JI0 Q;  1NMG A;  4J15 A;  1A2T A;  1LUZ A;  4YCW A;  5J3B A;  1SEB D;  2L15 A;  4GKK Q;  5GAG C;  3VR6 A;  4BY1 B;  2B2V C;  1Y1V B;  1JQY D;  5JJZ A;  4OL7 A;  2PQA B;  1IBM L;  4NXM L;  1PRT D;  2R93 H;  4QB4 A;  3T56 B;  4F8M A;  3OTO L;  5EPK A;  1A3T A;  1UUP A;  4E6I A;  1I94 L;  3G4S A;  2Z0S A;  2J4X A;  4X3U A;  1GUN A;  2G9D A;  4X62 L;  1IYJ B;  1VQG A;  2ZJP A;  3M85 A;  1KDC A;  1M1K C;  3SGI A;  4DPG A;  5C3E H;  3IFT A;  3LX0 A;  1G51 A;  1TWH H;  4DNR B;  1QZH A;  1YJN A;  4EQO A;  2JA5 H;  3C3L A;  3I2Z A;  1EY4 A;  1HQR D;  3JAM i;  2X69 A;  4EGV A;  5M5X H;  2NB0 A;  1EU3 A;  4B08 A;  5IGG A;  1X9N A;  4IUT A;  2K14 A;  4PMC A;  2WB1 G;  3CHB D;  5M5W B;  1JJC B;  4Y7N B;  3BVZ A;  3CRK C;  1B1Z A;  3H0G G;  2C9O A;  4O2D A;  2DJF C;  4XDX A;  2I5H A;  1ASY A;  1NSN S;  3HS0 C;  1CHP D;  5IT9 c;  2H4O A;  1V1P B;  2Q8R E;  5KNB A;  3CQZ H;  3ULL A;  4A3J G;  1BQQ T;  2BDO A;  3I90 A;  2OF1 A;  4GOP C;  1MHW C;  3C1E A;  5IYC G;  3NEL A;  3I70 A;  3PCO B;  3GTG H;  5D3D A;  3N52 A;  5IGE A;  1FGB D;  1QNK A;  5IGC A;  2PO4 A;  3GV3 A;  1SMY C;  4MN3 A;  4TSS A;  4DR7 Q;  3SHL A;  2RQX A;  1U9R A;  3GTP B;  1JB7 A;  4IOC A;  1SYG A;  3PO3 G;  1SAP A;  4JI2 Q;  4JI4 Q;  3I72 A;  5C3X A;  3F8T A;  3M7G A;  3Q23 A;  2MNA A;  4JBJ A;  1TWG B;  3T16 A;  3MEF A;  3AMU A;  1TWA B;  5K5P A;  1QOH A; 
#chains in the Genus database with same CATH homology
 4A3F G;  2PI2 A;  1IZ6 A;  1HR0 L;  1E22 A;  4AQY Q;  4POG A;  2CCZ A;  4BY7 G;  1J6Q A;  1HR0 Q;  2YTV A;  3L0O A;  3ZJY C;  5IYD G;  5IP9 H;  4BXX G;  4GOP A;  4GLV B;  1L0W A;  2I5L X;  4DR5 L;  1Y1W G;  5C44 H;  1HZB A;  1PH3 A;  1E1T A;  1CKN A;  4EQ5 A;  3FKI H;  1W2B A;  5E7N A;  4DR5 Q;  1HNW L;  1VQ6 A;  1Z9F A;  1FGU A;  1P16 A;  1Q8K A;  1MIU A;  1PYB A;  2NZO A;  3GD7 A;  3HKS A;  5BR8 L;  3L2P A;  1KRS A;  1NBW A;  1HNW Q;  1UWV A;  3PGZ A;  3TRE A;  3G71 A;  3PSI A;  5K36 G;  5BR8 Q;  1B8A A;  2NVX H;  2WB1 E;  5FLX c;  2K4K A;  2K52 A;  2GVA A;  5FLM H;  5JJL A;  1K8G A;  2RHQ B;  3A5Z B;  4C2M H;  4PZ8 A;  3S1M H;  4A3F H;  1XPO A;  3KF6 A;  2VQE L;  3U4Z A;  1CUK A;  1VCI A;  1A63 A;  5M3F G;  1VQL A;  3PUY A;  4AH6 A;  1E24 A;  2VQE Q;  2F4V L;  1UEB A;  2MQH A;  3PV0 A;  3HKZ E;  3H15 A;  4BXX H;  1WCM H;  1L1O A;  3KJO A;  4R4I A;  3RZD H;  2F4V Q;  2CWA A;  4PZ7 A;  4L5R C;  1WJJ A;  2KEN A;  5ELN A;  3J7Z C;  3T1H L;  1CKM A;  3LGJ A;  1Y1W H;  2R7F A;  2E2H H;  2JA5 G;  3A5U A;  2NVT H;  4DR6 L;  5C4J H;  4A93 H;  3NBH B;  1SE8 A;  3T1H Q;  3RZO H;  4QJF A;  3BJU A;  3M4Q A;  2PMZ E;  5GQO A;  4DKA C;  4DV4 L;  4OO1 G;  4DR6 Q;  1AH9 A;  2OTJ A;  1TWC H;  5JEA G;  1BVS A;  2CQO A;  2DGY A;  3CP0 A;  3CCS A;  4DV4 Q;  1PH5 A;  2R92 G;  2LXK A;  2ZTE A;  4DV2 L;  2ID0 A;  4UPA A;  3S1Q H;  1Y14 B;  1EFW A;  3K8A A;  4DV2 Q;  2OWO A;  5JJI A;  4B3R L;  4HIO A;  3GTJ H;  3S2D H;  1SRU A;  3K7U C;  2IX1 A;  4B3R Q;  5C0X G;  2E5L L;  1Q12 A;  3HOU G;  1IXR A;  3FP9 A;  4P71 A;  4K0K L;  1L1O B;  3I56 A;  5M3F H;  4A3C H;  2A19 A;  2ZTD A;  4A3B G;  4QQB X;  2E5L Q;  3PUZ A;  4L5T A;  2V1C C;  4K0K Q;  3S14 H;  4DK6 C;  3A74 A;  3G48 A;  5IWA L;  4PZ6 A;  1Q81 C;  3J81 c;  5IWA Q;  3CCM A;  3CPW A;  4YCU A;  5LMU L;  4XIG S;  3CCV A;  2PNH A;  3M7N A;  4IOA A;  4POF A;  1I5F A;  5LMU Q;  1X3F A;  1X6O A;  4H02 A;  2JK8 A;  4DK3 C;  2R92 H;  4DUZ L;  2NVY H;  2N78 A;  4DUZ Q;  4IFD G;  4GN3 B;  4A3D G;  3UDF A;  1EOV A;  4C3H H;  5IYB G;  2IX0 A;  4BBS G;  1XNR L;  2AMC B;  2D0P A;  2WAQ G;  3STB C;  3IRB A;  1XNR Q;  3OW2 A;  1PFS A;  2UU9 L;  3HOU H;  1T9H A;  4Y52 H;  3CCU A;  3S17 H;  1VQE A;  2VQF L;  2UU9 Q;  3Q8D A;  4C3J H;  1O7I A;  2RF4 A;  3CCQ A;  4DV7 L;  5DLQ E;  2EXD A;  1NY4 A;  2VQF Q;  4JI7 L;  2AKW B;  4HJA A;  4DV7 Q;  1Q7Y C;  1PV4 A;  1VQ5 A;  2VS1 A;  2JJQ A;  3S24 A;  3CCR A;  5M5Y H;  4IJL A;  1EYG A;  1JMC A;  2WP8 J;  4JI7 Q;  5LMN W;  2UXC L;  4AYB G;  3I4N H;  1UE7 A;  2QGQ A;  3E9H A;  1A8V A;  1KHI A;  4KI0 A;  4A75 A;  4A3L G;  2UXC Q;  5H1S E;  1IBK L;  3PO2 H;  4HIK A;  3MXN B;  3GTQ H;  4HJ9 A;  1N32 L;  4R4T A;  4NPS A;  1IBK Q;  1YIJ A;  1PYS B;  2VNU D;  4JOI A;  1N36 L;  1N32 Q;  3GO5 A;  5IP9 G;  3CME A;  4BBS H;  1NTG A;  4YHH L;  1FVI A;  4GN4 B;  1N36 Q;  1KC8 C;  4DR1 L;  1HNZ L;  4YHH Q;  3S15 H;  5IY0 A;  4DR1 Q;  3FKI G;  2A1A A;  1HNZ Q;  4LFB L;  1VQ8 A;  1SLJ A;  4DV3 L;  1GD7 A;  1UE5 A;  3J81 i;  3AYH B;  4LFB Q;  1BBW A;  4DV3 Q;  4PMW A;  3KDF B;  4O0A A;  1VQN A;  1Q1B A;  2JA7 H;  1CSQ A;  2NN6 I;  2OQ0 A;  4P74 A;  3W1B A;  3S1R H;  1QVG A;  1VQI A;  3RLO A;  3CXC A;  1LTL A;  5FLM G;  1HZA A;  3T1Y L;  2NVQ H;  3TS2 A;  2UUB Q;  1PH2 A;  2JE6 I;  4BY1 H;  4JV5 Q;  3T1Y Q;  4A3L H;  1YVC A;  2MFI A;  4BBR H;  3J81 j;  3E9I A;  4JI8 L;  3ULP A;  1HZ9 A;  3PIP A;  2LXJ A;  3S2H H;  1VQC A;  1B70 B;  5IP7 G;  4DV6 L;  1NE3 A;  3UDX A;  4JI8 Q;  1WCM G;  1Q46 A;  1I3Q H;  2MO0 A;  4DV6 Q;  3NEM A;  3HOZ H;  2N8N A;  2PI2 E;  1E7Z A;  1TXY A;  2ZTC A;  4GNX B;  4A93 G;  1R9T H;  4OWX B;  1SFO H;  2UUC L;  3E0E A;  2ALY B;  1YIT A;  4L5S A;  4HJ5 A;  4LF8 L;  1DGS A;  2UUC Q;  4X6A H;  2KHJ A;  4QIW E;  1N9W A;  4LF8 Q;  1QVC A;  1XNQ Q;  2ASB A;  4LUV A;  1OXV A;  2HT1 A;  2R7Z G;  4DNI A;  1EWI A;  4IPD A;  4HID A;  2WAQ E;  2Y0S E;  3ERS X;  1C0A A;  2EQS A;  2H5X A;  2RCN A;  2KBN A;  4AIM A;  1C9O A;  2BH2 A;  1JJG A;  1JT8 A;  1KD1 C;  4A3C G;  4GOP B;  2VY3 A;  4A3I H;  5IP7 H;  2YTY A;  3K7A H;  2D0O A;  2F52 A;  1VQB A;  2PQA A;  4QY7 A;  2ZM6 L;  2EIF A;  1U5K A;  2HQL A;  4IPG A;  1CKN B;  5GAD C;  2UXD L;  4JC0 A;  3K0X A;  2CKZ B;  1UE1 A;  2ZM6 Q;  1X56 A;  2UXD Q;  4A3G H;  1XPR A;  2N3S A;  3I55 A;  3STB D;  4AYB E;  4IPC A;  3UDG A;  5M5W H;  1PVO A;  2XTI A;  4Y7N H;  2K75 A;  4HIM A;  4FDB A;  1RIP A;  3BU2 A;  3PUW A;  4UP9 A;  1KRT A;  2QA4 A;  2HHH L;  4QGU A;  4JYA L;  1WYD A;  1YHA A;  4RG1 A;  3WWV A;  2HHH Q;  3HOY H;  3UDI A;  1VQP A;  1PHJ A;  2R7Z H;  3KF6 B;  4JYA Q;  4GLX A;  3DM3 A;  1EQR A;  2BA0 A;  4LF7 L;  4OWT B;  4OX9 L;  2A8V A;  1V43 A;  1ASZ A;  4LF7 Q;  2QEX A;  4OX9 Q;  1MJC A;  4YWK A;  4QL5 A;  3HOX H;  1AE2 A;  4OON A;  1QUQ A;  4A3M G;  4OO1 I;  3ER0 A;  3AQQ A;  2I5M X;  2R6G A;  3PIO A;  1VQF A;  4DR2 L;  1V9P A;  2Q2H A;  2GN5 A;  3H3V I;  1NMF A;  4DR2 Q;  1PH8 A;  3I4N G;  1Q1E A;  2B3G A;  1XJV A;  3I7F A;  4P75 A;  1JE5 A;  2YU9 H;  3GTP H;  3PO2 G;  3OYY A;  3UE0 A;  2CWP A;  1EQQ A;  3F1Z A;  5LMN L;  3S16 H;  5C0X I;  4NB3 A;  4EX5 A;  4IPH A;  5IE8 A;  2K50 A;  4R4C A;  5LMN Q;  3I4M G;  2F3I A;  5HY6 A;  4BA1 I;  2Y0S G;  4YWL A;  3JC6 6;  1KIX A;  3BZC A;  4NXN L;  4A3E G;  1PH7 A;  4LNQ A;  1XMQ L;  4R1J A;  4APV A;  3L7Z C;  4NXN Q;  1TWA H;  1YI2 A;  1XMQ Q;  2BA1 A;  4A3M H;  1UE6 A;  4R4Q A;  2YTX A;  4L5Q A;  4X65 L;  1GM5 A;  4B3T L;  2IT1 A;  3GTK H;  3M9B A;  1BBU A;  2JA7 G;  4JBK A;  4X65 Q;  4B3T Q;  3A0J A;  1I50 H;  3F2D A;  4BY1 G;  1Y1V G;  2IHE A;  3NEN A;  2CFM A;  3VDY A;  4DR4 L;  2ZJR A;  1BKB A;  4BBR G;  5EAY A;  1PH9 A;  4UP8 A;  1H95 A;  1X65 A;  2YYZ A;  3CW2 C;  3KJP A;  4DV5 L;  4DR4 Q;  1A0I A;  1LYL A;  4JI3 L;  3CCJ A;  2DUD A;  2B63 H;  3I4M H;  3TEH B;  1N8R C;  3CCE A;  2JEB I;  4DV5 Q;  1XMO L;  3M4P A;  4DAM A;  4JBM A;  2VUM H;  3EBE A;  4JI3 Q;  3HOZ G;  3HOW G;  1VQO A;  1CKO A;  2NZH A;  1XMO Q;  4B3S L;  3AEV A;  1YBY A;  4A3E H;  1YJ9 A;  1KXL A;  4LF6 L;  1LM0 A;  1OTC A;  4B3S Q;  1TWF H;  2D62 A;  2KCM A;  1OXT A;  2E8G A;  4LF6 Q;  2K5H A;  1VQM A;  4ALP A;  4LF5 L;  2OCE A;  2N49 A;  2VZA A;  3EIV A;  2NN6 G;  1S40 A;  2KHI A;  1GVP A;  4A76 A;  4LF5 Q;  4LWC A;  3G6E A;  1Y1V H;  2KCT A;  2FXQ A;  1E3P A;  2LSS A;  4RMF A;  5GAE C;  3PF4 A;  1YHB A;  2GVB A;  1K0R A;  1N34 L;  1VQ7 A;  4XTC S;  2K5V A;  4C3I H;  4A3I G;  3H0G H;  2K5N A;  1WFQ A;  1X54 A;  4IJH A;  1N34 Q;  2UXB L;  1JJ2 A;  3KOJ A;  3CD6 A;  3HOW H;  3HOV G;  1IBL L;  1K73 C;  4UY8 C;  2ES2 A;  1U0L A;  4A3G G;  2BH8 A;  1Z47 A;  1K9M C;  4GS3 A;  2UXB Q;  1IBL Q;  2HIX A;  4GKJ L;  4X64 L;  5JEA J;  1VQ4 A;  1L1O C;  4X64 Q;  3W5O A;  1A62 A;  4GKJ Q;  2OTL A;  1Q86 C;  1RL2 A;  2ZJQ A;  4GN5 A;  5HGQ A;  5JJK A;  5IYC H;  3CC2 A;  1X3G A;  2YV5 A;  1VS0 A;  3KLW A;  4LW1 A;  4X66 L;  3U58 A;  2ATW A;  3HOY G;  2Z6K C;  4YY3 L;  4GLA C;  4X66 Q;  5C4X H;  5C0X J;  4KLK A;  1SN8 A;  4MZ9 A;  4YY3 Q;  4PG3 A;  4WJ4 A;  1HH2 P;  3GTO H;  5FJ8 H;  3PF5 A;  1HJP A;  4LUO A;  2JA9 A;  4TVA B;  4LF9 L;  4P72 A;  4UP7 A;  4LFA L;  3RLN A;  2R93 G;  3HOX G;  3GTL H;  1C7Y A;  2JEA I;  3PO3 H;  4LF4 L;  1QVF A;  1PH4 A;  4LF9 Q;  4LFA Q;  1KQS A;  1E1O A;  4JCV E;  4JG2 A;  3ICE A;  3KF8 B;  1PA6 A;  1W3S A;  4LF4 Q;  3HOV H;  2WFW A;  1XTD A;  3JAM c;  2HIV A;  2AHO B;  4WJ3 M;  1HZC A;  4A3K H;  1HR0 W;  1CSP A;  5M3M H;  1EIF A;  1I6H H;  3RN2 A;  3D31 A;  4JI0 L;  1P8L A;  1S3O A;  4JV5 L;  4IFD J;  2JA6 H;  4JI0 Q;  1NMG A;  1VQ9 A;  4J15 A;  1EIY B;  3TRZ A;  4DV1 L;  1LUZ A;  4YCW A;  4BY7 H;  5J3B A;  3S1N H;  4GKK L;  1D7Q A;  3J80 c;  4DR3 L;  4HJ8 A;  4DV1 Q;  2L15 A;  4GKK Q;  5GAG C;  5IYD H;  3U50 C;  4DAY B;  5C3E G;  1V1Q A;  3M3Y H;  4DR3 Q;  2PQA B;  3PUV A;  1IBM L;  4NXM L;  3AFP A;  3CF5 A;  1WI5 A;  1PH1 A;  2R93 H;  1WOC A;  3I4O A;  1IBM Q;  4NXM Q;  2Z6K A;  2OQK A;  4LUZ A;  3OTO L;  3AFQ A;  5ELO A;  2VW9 A;  1S72 A;  3GDE A;  3OTO Q;  2Z0S A;  3G4S A;  1I94 L;  2JA8 G;  3PUX A;  2IY5 B;  1I94 Q;  4JBW A;  1SR3 A;  4JI5 L;  4A4I A;  2RHS B;  2AWN A;  3CMA A;  3K81 C;  4X62 L;  4JI5 Q;  3F2B A;  1IYJ B;  1VQG A;  4X62 Q;  1K8A C;  1K83 H;  2ZJP A;  3M85 A;  2B63 G;  4YCV A;  1QZG A;  4TQU S;  1M1K C;  2XGT A;  1D8L A;  1J5E L;  2VUM G;  1XNQ L;  3SGI A;  4KHZ A;  4DPG A;  4ME3 A;  5C3E H;  1J5E Q;  1G51 A;  1L2F A;  1QUQ B;  1TWH H;  1OXS C;  1TWG H;  1QZH A;  1YJN A;  1M90 C;  4JI6 L;  2JA5 H;  2B29 A;  4MNO A;  1PH6 A;  4KHP L;  3I2Z A;  4JOI C;  3CC7 A;  4JI6 Q;  4OXP A;  3K80 C;  3JAM i;  5M5X H;  3DLL A;  1HNX L;  3CAM A;  4KHP Q;  1FL0 A;  3CPF A;  1HNX Q;  2UUB L;  1X9N A;  1VQD A;  1OXU A;  1VQJ A;  2JA8 H;  2MO1 A;  1FJG L;  1KAW A;  2Q2T A;  2UUA L;  2K14 A;  3H3V H;  1MJE A;  1YZ6 A;  4HJ7 A;  4P73 A;  3RR5 A;  2WB1 G;  4IFD I;  4GNX C;  1FJG Q;  2UUA Q;  1N33 L;  1JJC B;  3D0F A;  1K3R A;  1X3E A;  3RLF A;  1XPU A;  1Q82 C;  3J80 i;  1N33 Q;  1KL9 A;  1YEZ A;  3H0G G;  3RN5 A;  4O2D A;  4BA2 I;  2I5H A;  2VL6 A;  1ASY A;  2AWO A;  3ULJ A;  4A3B H;  3RNU A;  2R7D A;  1IL2 A;  3HKZ G;  5GAH C;  1AE3 A;  4MTN A;  5IT9 c;  1YJW A;  3CCL A;  2Q2U A;  5AJ3 L;  3U4V A;  3CQZ H;  3ULL A;  1SMX A;  5GRO A;  4A3J G;  4DV0 L;  1YHQ A;  1NJI C;  3TQY A;  1VQH A;  3GTM H;  5AJ3 Q;  3M4O H;  4GOP C;  3KDF A;  4IO9 A;  4DV0 Q;  1GO3 E;  3HFZ B;  5IYC G;  3NEL A;  3PCO B;  3GTG H;  1VQA A;  2I0Q A;  3EN2 A;  1SRO A;  4DR7 L;  5C4X G;  1G6P A;  4B3M L;  1YNX A;  3KYH C;  4A3D H;  5IYB H;  3KFU A;  4DR7 Q;  2IHF A;  5FJ8 G;  2Q2I A;  2E2I H;  4B3M Q;  1GKH A;  4JI2 L;  4DUY L;  3FHW A;  4JI4 L;  1MKH A;  1JB7 A;  2E2J H;  3F2C A;  4IOC A;  3PO3 G;  2C35 B;  1B7Y B;  4JI2 Q;  5C44 G;  4YWM A;  4DUY Q;  4JI4 Q;  3F8T A;  3J7A 5;  3UE1 A;  4JI1 L;  3B6Y A;  1VQK A;  4LFC L;  4GNX A;  3TS0 A;  4JI1 Q;  1EUJ A;  2MNA A;  4A3K G;  2JQO A;  4JBJ A;  4LFC Q;  5M3M G;  4A3J H;  1G29 1;  3MEF A;  4R4O A;  3CC4 A;  3W1G A;  1OXX K;  3BZK A;  4AQY L;  4OWW B;  2JA6 G;  1X55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...