5I2XA

Crystal structure of tpp1 k170del
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional consequences of a disease mutation in the telomere protein TPP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Adrenocortical dysplasia protein homolog
total genus 34
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i2xA00
5I2YA 5I2XA 2M9VA 2I46A
chains in the Genus database with same CATH superfamily
4OWXB 2L5TA 2TMPA 3GV6A 3KF6A 4PMCA 1PTOB 1CFMA 1ET6A 2EYHA 2AKWB 1BNZA 4LF5L 1D1KA 4NDXA 1X54A 2RKSA 2YTVA 3K7AB 3HOUG 1PZID 1NAPA 4DAPA 1M8AA 1Q1BA 2K05A 1U5KA 4IALA 1F77A 2EYLA 5GAEC 3TREA 1VQOA 4R4IA 3J7AF 2JA8H 4YWMA 2AQ1B 2CHBD 2G9HD 4V190 4DV6L 3CCUA 1VMCA 4RWSC 3J7A5 3KF6B 1U0LA 1WTXA 2ZXPA 3AQQA 4TSSA 4KLKA 5CV7A 4JW0A 2K28A 5GROA 4CJ2C 5C5LA 4RCNA 5IP9H 3K6OA 5IYCH 1SROA 1QVCA 1A15A 3HFZB 3U9SA 2K14A 2O2LD 1D6EC 1HH2P 4RGTA 5CV5A 4YCUA 4JI8Q 2WFWA 3UDFA 4C2MB 1EY7A 2UUBL 1VQFA 2L12A 3T4AC 5FLXE 4H7BA 2K5QA 1X3GA 1HR0Q 3VYUA 2HCCA 1YEZA 2B63G 1HA5A 4JK1C 5C0XI 2F0KA 3CC7A 2UU9L 1I94L 4CGYB 1M90C 5EPLA 3NHHA 2AQ2B 1CQFA 1LTID 4UPAA 5GADC 4H44C 1SNOA 1VQEA 4L5TA 3K0XA 3RLNA 4DFAA 5LMUQ 4PG3A 1Y1VG 4BA1I 4A3DG 2F0QA 3UE1A 3H6MA 4YY3L 1N32L 3I4NB 1N34Q 2QEJC 3NTKA 4A3BH 5AJ3L 3CP0A 4ZAIA 4X64L 4FXDA 4DV2Q 4OO1G 3FKIG 3NBIA 3TP7A 2A68D 4RHSA 1YHAA 3GD7A 4GN4B 1QWYA 4LUZA 5IGDA 3BDCA 5G3LF 5M5XH 1P8LA 4IFDH 2MNAA 1XMOQ 1WD0A 1UE5A 4P71A 3DUZA 3S17H 2ID0A 3MXUA 5K36H 2JA9A 5NUCA 2HHHL 1JOKA 3I55A 1K83B 2A6ED 1CKNB 1GUOA 1PH7A 3TP8A 4BY7B 2YU9H 2B8FA 2WB1B 1PTOH 3W2DA 5J39A 4K6LA 1HHVA 5BN4A 3J81j 3WOFA 3MHBA 1LT3D 2B2YA 3K7AH 4GLVB 4L63B 4N8X1 2F0JA 2HQEA 4IUTA 3V2TA 5IOCA 1EIHA 3M7GA 4JI2L 2OWOA 4JBKA 1VQLA 3D8GA 5C44B 3OOCA 2FHTA 3TS2A 3OIQA 1HA6A 2FINB 3FVQA 5CV8A 4YWKA 2R93B 2MJ8A 4BY7G 3UDIA 1AE2A 3FHWA 1AP0A 5M9OA 2E74C 1PYBA 4C3IH 1IYJB 4UP7A 4NB3A 4CDFC 3NP8A 4WJ4A 2QDLA 1N36Q 3R93A 3M3YB 3K80C 4DAMA 1E2WA 4FP5D 2B63H 4UAIA 2F0UA 3V05A 3GTLB 4JI8L 3A5UA 2X69A 1RCVD 3HOYB 1STHA 2QW7A 4J1MA 3VA7A 2N78A 5C44G 1OTCA 1TS3A 4CBVA 1JB7A 4BY1H 2FJ2A 3S1RB 4JV5L 4J6HA 4YIJA 2Z6KC 2NVTH 1ONLA 4DV4L 3G48A 4OX9L 1MSHA 5C3EG 5IP9G 1PH4A 2IJ0A 1NUCA 3PO3G 5FLMH 4YHHL 1BDOA 2BDNA 2OXPA 1SJHD 3HEJA 2JYOA 1X3PA 3GTKH 1R9TH 3ZYYX 3QR8A 1RL2A 4DUYQ 1SN8A 4FF2A 2EQSA 4BBSG 2PI2E 1VQKA 1K3RA 1B4OA 5HURA 1STBA 4L5RC 2QDBA 1IL2A 4EQNA 1BF4A 1FYCA 4LFBQ 2C35B 4YWLA 3W3AA 1D8LA 4R8NA 3MA2B 4RGNA 4G57A 1CM9A 1EYCA 1PZJD 1EIFA 2PI2A 3BVGA 4BA2I 1FJGQ 2PZWA 4DPGA 1A3VA 3OHXC 2E76C 3CKIB 3DWAA 2QEXA 1Q82C 1PH5A 4C3HG 2ES2A 4DAYA 1EUJA 2K7VA 4LFCL 2E2HB 1HZCA 2NVTB 1EQTA 2MP1A 4HCSA 3BYTB 3L7ZC 1AE3A 3J81c 3KYHC 3OWEB 5IE8A 2HDMA 5M3FH 1C4QA 5CYUA 2E5LL 2R61A 1N33L 3KLRA 1KABA 4P74A 4B3RL 2X6LA 2Z0SA 5JPMC 3FDTA 2CCZA 4RGMA 1LV9A 2ZJRA 4GKKQ 1KRTA 2RDHA 2E2IH 1RTOA 2XTIA 4QUFA 4K5WA 3VYTA 2LFNA 4RH6A 1EYDA 2ZJPA 2M00A 3CD6A 1YJWA 4H13C 1V1OA 1H9SA 2A1AA 1WTPA 2IY5B 4DV1Q 3QB3A 2VW9A 4GN3B 2WAQB 3F1ZA 4DNRB 5A35A 1EY0A 2F0DA 1SNPA 4LF8Q 1J5EQ 2NVYB 4XT1B 4LFAL 1SE4A 3DHQA 3RMHA 1DM0B 5BR8L 4JI0L 5E4WC 1WJJA 3I73A 4POGA 3NBHA 4U673 3J81E 1RJTA 1UE7A 5JJZA 1EQVA 3PUYA 2I0QA 1SFOB 3T1HQ 1YNNC 3GTQB 1SMYC 4KMUC 1FGBD 1STYA 2NBFA 4APVA 1PRTF 5KYLA 1PLFA 4DK1A 1F9RA 3E9IA 5J1ZA 5M3FB 3SK5A 5KEEA 3HOXG 2Q2TA 3AFPA 4ZUJA 3S1QH 2K4KA 5D65A 4JI6Q 1YJ9A 5IGFA 3ZJYC 3W1GA 4JVZA 1E1TA 3T56B 3CCEA 4GNXB 1F2LA 1STNA 2EYOA 1SEBD 5FO9B 4K8IA 1VQ9A 4JI4L 3EA6A 2EYFA 2Y0SB 4JI0Q 3NWTA 5FK9C 4HMIA 2A69C 4UP8A 3SE0A 4X3SA 4KKSA 3UI2A 2EJGC 4R1JA 3AYHB 2A19A 3SHLA 4DR4L 4A3LH 2NVYH 3C1FA 2UUBQ 1ET9A 1CSPA 4JI7Q 4QCLA 4JC0A 4RHRA 3OPOA 4GKJQ 5IYBG 4A3JH 1Q7YC 3F2BA 4DV7L 2WIIB 4ZRZA 5KNDA 1CKOA 4LUVA 1EY8A 3MWYW 1SR3A 3NEMA 1BBUA 2RBMA 3K5LA 2NN6H 2N55A 4IPGA 3C46A 1BXTA 1MIUA 1EIYB 3KF8B 4NMZA 5ELBA 1HNZQ 1D5MC 1VQ6A 3EFXD 1K0RA 1DGSA 4QQBX 4DR3L 4HSVA 4UDUC 2Q2UA 2M9VA 3Q8DA 1QZHA 4RFBA 3RN2A 4NXNQ 1QG7A 5EBDA 5BN5A 1KHIA 2F0OA 2JA8G 4C3HH 1GKHA 3S2HB 3PUXA 4FXKC 2JA6G 1A2TA 1XPRA 2NN6I 1IBKQ 1IKLA 1KAAA 3HOVH 4OONA 1VF5C 2WACA 3KBGA 3AMUA 5I2YA 3I70A 3I72A 4XXEA 4DNIA 3I4NG 2J4XA 3GTGB 4C3IG 1LTGD 4A3EB 2AHOB 3KK7A 2CWAA 4YCVA 4JV5Q 1A8VA 1QNUA 1II3A 2A68C 2F52A 1Y1VB 2E2JH 1XXGA 4K2LA 1K9MC 1RIPA 3PF5A 2VQFQ 1IYVA 1KTKA 3CMEA 1BKBA 1HCZA 1XX8A 2NWGA 1I4XA 4KY5A 2HIVA 2Z6KA 1IBLL 1XNQQ 1XMQL 3JAMi 3HGBA 1QVFA 3S2DB 1U4RA 1CKNA 2DY8A 3S14B 2WINB 4RKLA 3J80E 5JJKA 2PQAB 4CJ1B 1Z6HA 4ID6A 3I56A 4IURA 2EXDA 2B2UA 2KQ3A 1EZ6A 1KRSA 3RNUA 4Y7NB 2LKVA 3TSSA 3UE0A 1LTSD 3OMGA 2DN8A 1EYAA 3P75A 1BQQT 2B2TC 3I7FA 2HQLA 1MD2D 1WCMB 1FR3A 2QF7A 4ILWA 4DR4Q 4ME5A 1JWMD 1TWHH 3QIAA 3D0FA 2K5DA 1NE3A 1YZ6A 2B2WA 3NSWA 4IFDJ 5C4JH 1IHZA 2K5HA 2BOSA 4A3MG 1HJPA 1I6VC 2DJGC 4KJNA 1LT4D 5J22A 4HJAA 3IAYA 1N32Q 4N8FA 3VYSA 3CRLC 1EU3A 2KEDA 3DM1A 3J80c 4YHHQ 2O5IC 1PFBA 2JP1A 3PO2B 2KCMA 2LSSA 2R3ZA 3S1MH 2XNAC 1A0IA 4P75A 4HAEA 2B2WC 1H9SB 2D9UA 4PNYA 2AMCB 5IT9c 3S14H 1AN8A 1HNZL 2PZUA 4R4QA 3RUZA 4C3HB 3NUCA 3S2HH 2HDLA 4JBWA 3TZDA 5D3DA 5C4XG 5DLQE 2JA6H 5C4XB 3R8BA 1X32A 4U68A 1XJVA 4WJWA 3I4MG 1K8OA 3BYYB 1XPOA 1U4LA 1HZAA 5JVG3 5EKIA 1F2YA 1I6HB 1X3EA 2ENBA 4JI3L 3S15B 1FJGL 1EY9A 3MXGA 5CBAE 4BBRH 1I5FA 5M3FG 3BZCA 1N9WA 1RTNA 4PZ6A 4EQPA 2IL8A 1SE3A 3CU7A 4DR6Q 2LS01 2Q2HA 3LNNA 4KI0A 3WWVA 5FLXL 1LTTD 2JEAI 1LM0A 5IT9E 4HMJA 4OGQC 3T51B 1C48A 5IY0A 1GJXA 1O7LA 5IGCA 1NR2A 3PIPA 3VYRA 5FOBB 2PZTA 1J9OA 4TVAB 3VDYA 3F2CA 4IN3A 3H91A 3K7UC 2C9OA 4BXXG 2CH4W 5ELFA 1NBWA 3L2PA 5JAVA 1W3SA 1MHWC 1SE8A 1WTVA 3I8ZA 5E1FA 3RZOB 2F3WA 1PH1A 4ZCKA 3QG1A 3HKZG 5C3WA 1PRTD 2Z8LA 4FO2A 3I4NH 1UE6A 4QUCA 1LABA 5I2XA 4IPHA 4X65Q 4QMGA 2WP8J 1D5ZC 3G71A 1EY6A 1EQQA 2A74C 1S5DD 1GUSA 4A3KG 1KDBA 1G51A 1S4ZA 3CAMA 3SR1A 2N88A 4OL7A 2UU9Q 4P72A 3HP3A 3PUVA 1Q8KA 4N9PA 1HNXQ 3CMAA 2VB3X 2OTLA 3I4MH 4LF9Q 2EY2A 3SVMA 4FF3A 3P20A 1PH9A 1Q81C 3C2PA 1TKWB 1PH8A 1XNRL 4A3GH 2AUJD 5JVH3 3OW7A 4ME3A 2NVQH 4B3SL 4XQNA 2R6GA 2AUKA 1PFNA 3KLSA 5FLXc 2WAQE 3HKZB 3TEHB 4N9TA 1XPUA 3H09A 1C7YA 2JA6B 4LFBL 1NY4A 3NXWA 3V96A 4B9WA 4DU9A 5J3BA 5GAHC 4DV2L 1EEID 2EJMA 1HTLD 4IO9A 4XQQA 2B2YC 4HJ5A 1IW7D 2B39A 1K3BC 4B3TL 3QO2A 4PQXA 3I91A 3EN2A 3CHBD 1KDCA 2ALYB 3BVZA 1K8AC 1T9HA 5CMDA 4LF5Q 2KOLA 2PO4A 5IIFA 2EXZA 4B3RQ 1HQRD 1PTOC 2KHSA 2KHIA 4DGZA 2VL6A 2IHFA 4KY6A 1Q46A 3GTKB 2VY3A 1SYCA 4LF6Q 3MC0B 1QB5D 4QJFA 2L1BA 1YNJC 4IOCA 2PMZB 1YNND 2KECA 4DAYB 3H3VC 2F0SA 4GNXA 4K8JA 2OEOA 4FXGC 2D62A 2PNRC 3FRPB 3FKIB 1SYBA 2XWJB 1PV4A 4IZ8A 4GN5A 1STGA 1AFPA 3HOZG 1SLJA 3IFDA 1EFID 3J7YW 1H9JA 1NNXA 2CVRA 3GO5A 1HRJA 1UEAB 1ZYRC 1ENAA 2ZXRA 1G6ZA 1E2ZA 1FNWA 1YBYA 2XN9C 2E2HH 3A7AB 2YV5A 1EQRA 3W1BA 3A7LA 4NKLA 4A3DB 1WI5A 3MXNB 1S5FD 1GOZA 2VZAA 4IQZA 4JPBW 4A76A 2OQKA 2E5LQ 2B8GA 1DZ1A 4K5VA 4GKJL 4IUUA 3J81i 1JWUD 2HD3A 3S16B 4L5QA 1HNWQ 4GKKL 1VDZA 5FKAC 5IT9L 1WTQA 2F0EA 4R4OA 5D3IB 4DV0Q 4OEMB 4EQOA 5A2QL 2BA1A 5FLMG 2B2TA 2ZTEA 1RHPA 2VQEL 1N36L 3NTIA 4XTCS 1CT1D 4DV3Q 4LWCA 3MXNA 1LTBD 1AZPA 1T5XD 3TMEA 2PMZE 2XSCA 3SK4A 2K5NA 4LFAQ 1O80A 1V8QA 3BJUA 1TWGB 2RA4A 3KDFB 4RMFA 1LTAD 3S9WA 2B2UC 3STBD 4KHZA 4NXMQ 3RLOA 2H5XA 4DR1L 4OX9Q 4LAAA 2KJXA 3GTPH 1I94Q 1IXRA 1SYGA 3S17B 3HOYG 3O13A 3SK8A 3KDFA 3SXHA 1B2TA 2IPKD 3CCRA 4A3KB 2UUAQ 3IL8A 4L5SA 1O78A 1LYLA 3Q23A 1X65A 1UAPA 4JG2A 1NSNS 2WKCA 4IUVA 3ULPA 1TWCB 3Q0AA 4I7AA 3IFTA 1G2TA 4RCOA 3RLFA 3T53B 3KOJA 4LMQD 2BH8A 1WTRA 1EOTA 4X66L 1M4VA 1W6JA 1DOKA 1R4PB 2L0CA 4G7ZC 1A63A 4DUZQ 1MKHA 2XWBB 5C3EH 1GHKA 3PO3H 2V4DA 4BY1B 4GOPA 3DMUA 1MBYA 1CTMA 1U4PA 4ZK9B 1IBKL 4IFDG 2JA5B 2BCOA 3CXCA 1VF7A 2G9DA 1S5BD 5G3LD 1A6XA 4JOIA 2VS1A 3CCQA 5EBCA 5DM63 1C0AA 3MEFA 1IYUA 2XGTA 4OWTB 1WTOA 2K52A 2B2VC 5E7NA 1W2BA 1EOVA 1UWVA 5I9OA 2QKIC 3DEPA 2WB1G 3UDXA 5M5WH 1TU2B 1HNXL 5M5YH 1WCMG 3PV0A 3K81C 3OTOL 1BBXC 2ZM6Q 4A3BG 4JOIC 5ISRA 3M9BA 1L0YB 3E0EA 3CCVA 1J6QA 1PTOD 4A3GG 4HJ7A 1F9PA 2YTYA 1TT2A 1SSOA 3A8JE 2B29A 1FNVA 5KYIA 3IKJA 2CW0D 3TN2A 2UUCQ 2KA7A 3JC66 4K2KA 1NMFA 4JBJA 3PO2G 4JI4Q 4A3IH 5LMNW 1X3QA 1BOSA 5CV4A 1XTCD 4AH6A 5KNBA 1R9TB 1BBWA 4HIMA 4QL5A 2K32A 2KEEA 3GV3A 1TXYA 3U58A 3ONAB 2F3IA 2JJQA 2D0OA 4A3CG 3GTPB 3D6CA 3TBIB 4A3BB 1FNUA 1VQIA 1VCIA 2Y0SE 2UXDL 2E2JB 3MEHA 4BBSB 1UNSA 2XVSA 1GD7A 5CC4A 4JI6L 4JI3Q 3G6EA 3K59A 4GOPB 1B3AA 3WDNA 1PDQA 5CV9A 1TWCH 3K5OA 1X6OA 3VR5A 4GLAC 1N34L 4A4IA 2A6HC 4M8AA 1CHQD 1O7IA 4BY7H 3R2IA 2EE1A 5JEAJ 4C56C 1K73C 3EQLC 1BO0A 1ICWA 3CQZB 4FF1A 2MHVA 4TRDA 1PA6A 3U9OA 3JAMc 1F2ZA 2RVLA 5COYA 1RF2D 3OW2A 5M3MG 2E75C 3LWEA 3NENA 4HIOA 4GLXA 4A3FH 3HOZB 1B3QA 1PH3A 4KHPL 5ELEA 1CA6A 3M4YA 3CCJA 5HGTA 2B2VA 1Y1WG 1JT8A 2E2IB 2R93G 4MZ9A 2UXBL 3DXJC 4DR7Q 3UDGA 3D6WA 5GQOA 3ULJA 1TWHB 4POFA 3TZUA 2RCFA 4B3TQ 1E22A 1VS0A 1L1OA 2Q8RE 1H9RA 1S5CD 4GOPC 1SMYD 4PMBA 1I4QA 4C1NK 3VR4A 4C3IB 1K0SA 1NR4A 1EY5A 4AYBG 2F0MA 3N52A 5E4XA 1HXYD 1DXMA 3RD4A 1OO9B 4XQJA 1P16A 4GS3A 2B63B 3HOUH 1PRTB 3E3XA 2Z6BA 3OWFA 3GP7A 3BZKA 1G6PA 1OXTA 2I46A 3GTQH 1L1OB 5JJIA 4CDEC 2NZHA 1F9SA 1VQ4A 4IFDI 3EJIA 3VA5A 4LF4Q 4DR2L 1CSQA 2RSNA 1STAA 1X9NA 4OIJA 1LT5D 2PCFB 4B3SQ 3J81L 2EVBA 1U4MA 2WV6D 3BZDB 1JB3A 5K5PA 2QCPX 3S15H 4A3LG 4DNTB 3S1MB 1T5EA 4KD3A 4KN7C 2R92G 1KAWA 2SNMA 1MI2A 4S3SA 1X55A 3S1NB 1SYFA 1EL0A 4BBSH 1B7YB 5HGQA 4A93G 1PRTC 4J15A 2F0VA 1I50B 1EZ8A 3EROA 1BCPD 5EGTA 1Y69U 1KLUD 2EYMA 3P7JA 4JI5Q 2UXDQ 3L3OC 2I07B 1Y8NB 1LO5D 4KN4C 1XYIA 1KC8C 4X6AH 3JAML 2MFIA 1SMXA 3AB9A 4NP5A 2CWPA 2CQOA 1Z47A 4V0BA 4JI1L 5F2DA 3GTOB 1R4QB 3NTHA 4Z9CB 5IODA 5BN3A 4X66Q 4QGUA 4DAVA 1WFQA 1VQGA 3GTGH 5M3MH 1F2MA 3M85A 4XIGS 4IPCA 3L0OA 2EYJA 4XYOA 1JJ2A 4QIWB 3GTJB 1L1OC 3GTMB 4MNOA 1I4GA 1QVGA 3PQIA 4Y52H 4KTAA 2IX0A 4A3EH 3VR2A 5TSSA 2KCNA 4ZLTF 4A3FG 1K8MA 2JA7B 5LMUL 2KVMA 3H0GB 4X3UA 1E3PA 1KL9A 2R7DA 4NXML 3TP5A 4EX5A 1JMCA 1GVPA 5LL6X 1QUQB 3P1HA 4JI1Q 5DEHA 2HT1A 1N33Q 3QOLA 3H94A 3MAQA 3SEBA 3DEOA 2JEBI 4KY7A 3RZOH 4KKTA 4A3MB 4KD4A 4F7XA 3S2DH 3C3LA 2MPMA 1PYWD 2R92B 1EY4A 5KRUA 3F8TA 3KJPA 1FL0A 2FFKB 1F9QA 1EWCA 2EY6A 1WD1A 1ZKOA 3K5NA 1PMRA 5AJ3Q 3HOXH 2ICEC 3B6YA 4WFN3 2F4VQ 2CFMA 2VUMG 1JJCB 4IOAA 2ZTDA 2LXKA 1SNMA 3OSOA 1QILA 1PHJA 3M7NA 1JQYD 1G91A 1KNAA 4DR5L 3PIP3 1DD2A 2N49A 1E1OA 4LK1C 2JQOA 3S1QB 2DUDA 1AEXA 2Z4HA 1WVLA 3LGJA 3HOWB 1IL8A 1VQAA 2SOBA 5C4JB 1SBBB 1OXSC 4OXPA 1C8CA 3STBC 5ELDA 3QOJA 4MIUA 2K33A 1O7ZA 4JI2Q 2UXCL 2HUGA 5M5XB 4OO1I 4J8QA 3PF4A 3CC4A 2SNSA 3RZDB 1ESFA 3M4OH 1B8AA 1EYGA 2DNCA 4K5XA 2HCIA 1XTDA 4DR1Q 3NQIA 4LF7L 4BS9A 4BXXH 4XYQA 1TY2A 1RKNA 1AZQA 3DM3A 1PFMA 5IYDG 4LF6L 2E2DC 4HIKA 1WCMH 2ZM6L 3FEWX 1IBML 2DJFC 3R2TA 4DR5Q 1QUQA 1QOHA 1DOLA 5M3MB 2O4XA 5CORA 1TWFH 5A2QE 5I6YA 4A3IG 2PNHA 1TS2A 2EOTA 1HQMC 1JE4A 2FMCA 1PTOF 1V43A 3E5SA 4OO1H 5D14A 2B3GA 1I6HH 1X56A 3KUPA 1TS5A 1A3UA 2D2CC 2JE6I 5I6WA 4KV6A 4BBRB 2JA7H 2DY7A 3I4OA 1KLGD 5EPKA 2R93H 1B1ZA 3H3VH 3H3VI 4OHJA 2RDGA 4PZ8A 5CV6A 3K57A 1I4PA 1L0WA 4GNXC 4Q5VA 4KHVA 3D31A 3NBHB 5EKLA 2PW5A 4QIWE 4AYBE 1KXLA 3DWQA 3BS1A 4ABNA 1CZWA 3J7AV 2G5DA 1B9NA 3F2DA 4DXFA 1XWEA 3IRBA 3VR6A 2F0NA 2SDFA 2RDFA 1LLRD 4QB4A 1VQ5A 3A56A 4HN7A 4DV0L 1VQHA 4LNQA 1Q1EA 3CPWA 2L9HA 1CK1A 4ULLA 1B70B 3A5ZB 1ENCA 3LWUA 2J7ZA 1WTHA 2MUYA 1WTWA 2F03A 3I3CA 5JJLA 1X3FA 4DV1L 2JA8B 1Q12A 4B3ML 5LMNL 5IWAL 2VUMB 5C6AA 2ASBA 2K5WA 4A3CH 3PCOB 2F0HA 1FVIA 5BR8Q 2NZOA 2AWOA 1HTPA 1PH6A 2JSOA 1ENFA 1JORA 1TWAB 4WORA 4EGVA 2K01A 4C2MH 4A3KH 1CI3M 2PW7A 1SRUA 1Q3LA 5LHY1 4XT3B 2UUAL 1SYEA 2EDGA 4X3KA 2RHSB 4X64Q 1B44D 5IYDH 2NVQB 5FJ8H 1EWIA 2AQ3B 1KIXA 2KHJA 4I65A 1M1KC 4C3JH 1K8GA 1PVOA 1HUMA 1MGSA 2EYPA 2VB2X 2JA5G 4CKEA 1I3QB 4YCWA 2L4NA 4H0LC 1B53A 2A73B 1JOQA 2SEBD 3HS0C 1GUTA 4E6IA 4ALPA 4H02A 1VMPA 3C1EA 2F0LA 4B9XA 4QY7A 4DK6C 4AYBB 5C44H 2V1CC 5E3FA 2YU9B 2H1EA 5K36G 3RN5A 4X65L 3ER0A 3HKSA 1CA5A 1C9OA 2N3SA 4GZYC 2KUMA 3BG3A 2ZT9C 4HSPA 3KLWA 5DM73 4FVMA 2QA4A 2FMMA 1DYQA 1BCPB 1KD1C 2OTJA 4P2CB 1E7ZA 3A8IE 1E2VA 3M3YH 4IJLA 4CDDC 4DKAC 1A3TA 2ZTCA 1B50A 2NZ1D 2K04A 5HY6A 3ULLA 3A0JA 1YIJA 2RSOA 2JXMB 2ATWA 2CW0C 3FKIH 4NW2A 5IGEA 3S1RH 3AU7A 1L0XB 2LMCB 1QE6A 5LL6S 3ICEA 1LTLA 2EY1A 1VQ7A 1ZXTA 1WOCA 1Y8OB 1A2UA 3CC2A 1CKMA 3PSIA 2ZXOA 1YNJD 5JOBA 1IZ6A 1TWAH 5T1GA 4BWGB 1EFWA 4A3DH 1D7QA 1BVSA 1Z9FA 2UXCQ 4L8JA 1G291 3HOVG 1ZEQX 2P5ZX 3D3RA 1JC7A 3S16H 5ELOA 2R7ZG 2ZJQA 3GTLH 1STEA 2EPBA 3GDEA 1K28A 2JA7G 2IX3A 2EY5A 4LJZC 1D1IA 3T1HL 3D4WA 2NYZD 3G6JB 4CJ0B 3I2ZA 1G8ZD 2PQEA 3A54A 3BDOA 3CCSA 3M4QA 2F3VA 3OYYA 5EKKA 5DAUA 1JOOA 4RA8A 3A74A 5ELNA 1EIGA 2K03A 3D4DA 2NB0A 4NXNL 3I90A 1GHJA 4C1NI 4HTHA 1ASYA 2NN6G 1TWGH 2K1BA 1TQOA 3MTSA 3U4ZA 3MFYA 4LUOA 2PQAA 2TSSA 4JYAQ 1L2FA 2L15A 1VQ8A 2QILA 1NJIC 5C0XG 3L9AX 3E9HA 3ND9A 3QWNA 3K58A 1J8IA 1DCZA 4WRDA 3F2UA 5FJ8G 2EZVA 1MJCA 3SK6A 4R4TA 4TKOB 4DA2A 1CUKA 1YHQA 4LFCQ 2N8NA 2XRSD 2L55A 2BH2A 2K50A 4ZKBB 2GA4B 3NPPA 5JEAG 5GAGC 3U50C 1AH9A 2O5JC 1K83H 2J0TD 1FGUA 1OXUA 1V9PA 1IW7C 2GVBA 3URYA 1HZ9A 2F0FA 4UHVA 3ERSX 1CQVA 5CR3A 3G7LA 1KDAA 1DONA 3CF5A 2MGSA 1XNQL 3J80L 2CQAA 2Q8TA 3ERQA 4ZKCB 1SFOH 2DGYA 5KIXA 4DUZL 2WB1E 3DWPA 5IGGA 1QCBD 4FDBA 1JJGA 1ASZA 3H15A 4DF7A 2I5LX 1VQBA 3NQTA 4O0AA 4C3JG 4KKUA 4DN4M 3FPPA 4AIMA 1Q8IA 3NK9A 1QZGA 1B9MA 5IP7G 3FP9A 1OXXK 1D2BA 5M5WB 3M4PA 4F88A 2I5HA 4K6DA 4KJOA 1DJRD 1AW7A 2IW3A 4MTKA 1Z7TA 2NVXH 5ELCA 4MHEA 3EVQA 2JA5H 2D0PA 4LF9L 5L37A 4JBMA 4P73A 3K8AA 4R8IA 1Y1WB 4FNFA 4IUNA 4DV3L 1S40A 1SAPA 2IWHA 2K6AA 3GTOH 5C5MA 4RAUC 3I4LA 3QJYA 4HJ9A 1ICFB 1S3OA 5JPNC 4ZUIA 1N8RC 4CKBA 4HCEA 3Q24A 5C3XA 4A3IB 4ODGA 1W6KA 2F1MA 2A6HD 2IT1A 1E0BA 5M5YB 1D5XC 1IBLQ 4IPDA 5IYCG 3HZXA 2OF1A 5LMNQ 1PZKD 3PIOA 4G7HC 2E8GA 1V1PA 3PO2H 2OQ0A 1U9RA 3NE5B 5EPJA 3Q6SA 1UUPA 1ML0D 3ITPA 2KCCA 5C0XJ 1H9MA 4WJ3M 1VQPA 4DV7Q 3H0GH 2KCTA 4LF8L 3HOYH 3PGZA 1ESRA 1RD9D 4K14A 2D5DA 3A55A 1RDPD 5C0XH 1EU4A 3J7ZC 1ZYRD 4PV1C 2NVXB 2Q8IB 1TS4A 2OCEA 4MTNA 2EIFA 2WAQG 4KK7A 1HFGA 5AFWA 4AQYL 1V1PB 4A3EG 4A3FB 4M1UB 4JI5L 4X62Q 3G4SA 4K0KQ 2R7ZB 4OELB 3WOEA 1UEBA 2Q2IA 4O42A 1SNQA 4CHTB 1BCPF 3J80i 5I4DA 4RKBA 1OXVA 5IYBH 4A3JG 3HOZH 3BU2A 1EEFD 2EJFC 4IJHA 4HIDA 1HR0W 1JCKB 1GO3E 2R7FA 3K5MA 1MSGA 4HR7B 1LT6D 1BCPC 2A6EC 2XIWA 1PH2A 1RODA 2X6GA 1SJED 3AFQA 4LW1A 3HOWH 2BE5C 5JEAH 2CKZB 3S24A 3CQZH 1VQJA 2YTXA 4L6TB 3FPUB 4B3MQ 3HOVB 2IX1A 4BY1G 5IWAQ 4QF4A 3SDZA 3CPFA 3MXPA 4RGOS 3W5OA 3HOXB 2A8VA 2PPBC 3MZ5A 1KNEA 5C3EB 3PO3B 4JCVE 1XNRQ 2NTSA 4I7ZC 3HOUB 3D4RA 1Y1WH 3K0YA 4G4KA 1YNXA 4B08A 1I4RA 1Y1VH 1HNWL 1WYDA 3KF8A 1DOMA 1EWHA 2H4OA 2JN4A 1KQSA 2NUCA 3X3MA 2OT2A 1TWFB 3E6ZX 2CH4A 1O7YA 5EAYA 3TS0A 2F0PA 3CCLA 4F8MA 2KENA 1UE1A 1SYDA 1TVXA 5IP7H 3R3OA 2RCNA 1SDFA 3TQYA 4EVOA 2FXQA 3T13A 4JYAL 1MJEA 1JWSD 2F0GA 4A3GB 3PUZA 4DV4Q 2LXJA 2K5VA 3S1NH 2YYZA 3MFGA 1H95A 3EIVA 5KGUA 4Q0FA 1I50H 2UXBQ 1GUWA 1HUNA 1E24A 2MQHA 2Z9HA 4CKCA 1GUNA 1TY0A 3BDLA 1V1QA 4DR6L 4Y7NH 1JE5A 3KLSX 3PIO3 4ZYSA 2I5MX 1JR0D 1QJOA 2RF4A 1G2SA 1LACA 3Q22A 3BVMA 5C4XH 2LY7A 3FMCA 4YY3Q 3KFUA 1YHBA 2R7ZH 4DV5Q 1GUGA 1TR5A 4EQ5A 1SE2A 3OIPA 2A5HA 4R4CA 3GTMH 5FO8B 4R9WA 4O2DA 4DK0A 1NTGA 4X62L 5CGKA 4K0KL 5CBEE 3SGIA 5H1SE 2F0IA 2HIXA 4G7OC 3GTJH 2KBNA 3A8KE 5T1IA 1FD7D 3TP6A 1YI2A 1VQNA 4DR2Q 3U4VA 2HHHQ 1I4HA 2PYKA 1CHPD 1BR9A 3X3NA 2GVAA 4FF4A 3LX0A 4O1NA 2IHEA 3TRZA 2VNUD 1J5EL 4MN3A 5EQ0A 4F87A 4FYDA 3KBXA 3DLLA 1LTRD 3OMCA 4A3JB 3T1YQ 1BUVT 4LF7Q 4IUPA 1H9KA 1Y8PB 2F0TA 1VQCA 1SNDA 4A3MH 5C4HA 3HKZE 3TDQA 1A62A 1QNKA 2VUMH 1NCVA 3OTOQ 1SNCA 4DK3C 4LF4L 1HZBA 3CCMA 1GXDC 4DUYL 4A93B 3NELA 4C3JB 4UP9A 2M2LA 4PZ7A 2DNEA 1JICA 3E0JA 4A75A 1PXUA 4NPSA 2Y0SG 2A69D 2WKDA 5EJWA 4IUQA 2VQEQ 2MO0A 4OIKA 5IGBA 3MVVA 1LUZA 1HFNA 1Q86C 1HR0L 1Y14B 1SXTA 4UY8C 3GQBA 1Q90A 3T1YL 5C4ZA 3RZDH 4CDCC 4HEDA 3KJOA 2R92H 1TIID 3ND8A 2RQXA 1IKMA 1ILQA 1ILPA 3HG9A 4ZQ3A 3NWSA 1VQDA 2F0WA 4JI7L 2AWNA 2RHQB 4TQUS 2Z4IA 1GM5A 4OWWB 3EBEA 4DR7L 4BBRG 4X3TA 1S72A 1I3QH 2BA0A 1NMGA 2C5CA 1VQMA 2GN5A 1YJNA 2BE5D 1HPCA 3JAME 2QGQA 5FO7B 2VQFL 3PMFA 1PFSA 2L11A 3H0GG 2JK8A 3RR5A 4AQYQ 3CW2C 2K75A 4A93H 4DXGA 2Z1CA 1IBMQ 4HJ8A 3PUWA 3T16A 2MO1A 1XMQQ 4DV5L 2F4IA 3HOWG 1YITA 4RG1A 1XMOL 4DR3Q 1CZGA 2VXWA 4PMWA 2NTTA 1S5ED 3N6RA 5KNCA 3M4OB 5I9PA 3I4MB 2XRQD 1YVCA 4XDXA 4DV6Q 2BDOA 2F4VL 2UUCL 1PYSB 3HRZC 5DNFA 3AEVA 4KHPQ 3CRKC 2ICIA 3VR3A
chains in the Genus database with same CATH topology
2L5TA 2TMPA 3GV6A 4PMCA 1PTOB 1CFMA 1ET6A 2EYHA 1BNZA 1D1KA 4NDXA 2RKSA 3K7AB 1PZID 1NAPA 4DAPA 1M8AA 1Q1BA 2K05A 4IALA 1F77A 2EYLA 3J7AF 2AQ1B 2CHBD 2G9HD 4V190 1VMCA 4RWSC 1WTXA 2ZXPA 4TSSA 5CV7A 2K28A 4CJ2C 5C5LA 4RCNA 3K6OA 1A15A 3U9SA 2O2LD 1D6EC 4RGTA 5CV5A 4C2MB 1EY7A 2L12A 3T4AC 5FLXE 4H7BA 2K5QA 3VYUA 2HCCA 1HA5A 4JK1C 5C0XI 2F0KA 4CGYB 5EPLA 3NHHA 2AQ2B 1CQFA 1LTID 4H44C 1SNOA 4DFAA 4BA1I 2F0QA 3H6MA 3I4NB 2QEJC 3NTKA 4ZAIA 4FXDA 4OO1G 3NBIA 3TP7A 2A68D 4RHSA 3GD7A 1QWYA 5IGDA 3BDCA 5G3LF 4IFDH 1WD0A 3DUZA 2ID0A 3MXUA 5K36H 5NUCA 1JOKA 1K83B 2A6ED 1GUOA 3TP8A 4BY7B 2B8FA 2WB1B 1PTOH 3W2DA 5J39A 4K6LA 1HHVA 5BN4A 3WOFA 3MHBA 1LT3D 2B2YA 4L63B 2F0JA 2HQEA 4IUTA 3V2TA 5IOCA 1EIHA 3M7GA 3D8GA 5C44B 3OOCA 2FHTA 3OIQA 1HA6A 2FINB 3FVQA 5CV8A 2R93B 2MJ8A 1AP0A 5M9OA 2E74C 3NP8A 3R93A 3M3YB 1E2WA 4FP5D 4UAIA 2F0UA 3V05A 3GTLB 2X69A 1RCVD 3HOYB 1STHA 4J1MA 3VA7A 1TS3A 4CBVA 2FJ2A 3S1RB 4J6HA 4YIJA 1ONLA 1MSHA 2IJ0A 1NUCA 1BDOA 2BDNA 2OXPA 1SJHD 3HEJA 2JYOA 1X3PA 3ZYYX 4FF2A 1B4OA 5HURA 1STBA 2QDBA 4EQNA 1BF4A 1FYCA 3W3AA 4R8NA 3MA2B 4RGNA 4G57A 1CM9A 1EYCA 1PZJD 3BVGA 4BA2I 2PZWA 1A3VA 3OHXC 2E76C 3CKIB 3DWAA 4C3HG 4DAYA 2K7VA 2E2HB 2NVTB 1EQTA 2MP1A 4HCSA 3BYTB 3L7ZC 3OWEB 2HDMA 1C4QA 5CYUA 2R61A 3KLRA 1KABA 2X6LA 5JPMC 3FDTA 4RGMA 1LV9A 2RDHA 1RTOA 4QUFA 4K5WA 3VYTA 2LFNA 4RH6A 1EYDA 2M00A 4H13C 1V1OA 1H9SA 1WTPA 3QB3A 2WAQB 4DNRB 5A35A 1EY0A 2F0DA 1SNPA 2NVYB 4XT1B 1SE4A 3DHQA 3RMHA 1DM0B 5E4WC 3I73A 3NBHA 4U673 3J81E 1RJTA 5JJZA 1EQVA 3PUYA 1SFOB 1YNNC 3GTQB 1SMYC 4KMUC 1FGBD 1STYA 2NBFA 1PRTF 5KYLA 1PLFA 4DK1A 1F9RA 5J1ZA 5M3FB 3SK5A 5KEEA 4ZUJA 5D65A 5IGFA 3T56B 1F2LA 1STNA 2EYOA 1SEBD 5FO9B 4K8IA 3EA6A 2EYFA 2Y0SB 3NWTA 5FK9C 4HMIA 2A69C 3SE0A 4X3SA 4KKSA 3UI2A 2EJGC 3SHLA 3C1FA 1ET9A 4QCLA 4RHRA 3OPOA 2WIIB 4ZRZA 5KNDA 1EY8A 3MWYW 2RBMA 3K5LA 2NN6H 2N55A 3C46A 1BXTA 4NMZA 5ELBA 1D5MC 3EFXD 4HSVA 4UDUC 2M9VA 4RFBA 1QG7A 5EBDA 5BN5A 2F0OA 3S2HB 3PUXA 4FXKC 1A2TA 2NN6I 1IKLA 1KAAA 1VF5C 2WACA 3KBGA 3AMUA 5I2YA 3I70A 3I72A 4XXEA 3GTGB 2J4XA 4C3IG 1LTGD 4A3EB 3KK7A 1QNUA 1II3A 2A68C 1Y1VB 1XXGA 4K2LA 1IYVA 1KTKA 1HCZA 1XX8A 2NWGA 1I4XA 4KY5A 3HGBA 3S2DB 1U4RA 2DY8A 3S14B 2WINB 4RKLA 3J80E 4CJ1B 1Z6HA 4ID6A 4IURA 2B2UA 2KQ3A 1EZ6A 4Y7NB 2LKVA 3TSSA 1LTSD 3OMGA 2DN8A 1EYAA 3P75A 1BQQT 2B2TC 1MD2D 1WCMB 1FR3A 2QF7A 4ILWA 4ME5A 1JWMD 3QIAA 2K5DA 3NSWA 2B2WA 4IFDJ 1IHZA 2BOSA 1I6VC 4KJNA 1LT4D 5J22A 3IAYA 3VYSA 3CRLC 1EU3A 2KEDA 3DM1A 2O5IC 1PFBA 2JP1A 3PO2B 2R3ZA 2XNAC 4HAEA 2B2WC 1H9SB 2D9UA 4PNYA 1AN8A 2PZUA 3RUZA 4C3HB 3NUCA 2HDLA 4JBWA 3TZDA 5D3DA 5C4XB 3R8BA 1X32A 4U68A 4WJWA 1K8OA 3BYYB 1U4LA 5JVG3 5EKIA 1F2YA 1I6HB 2ENBA 3S15B 1EY9A 3MXGA 5CBAE 1RTNA 4EQPA 2IL8A 1SE3A 3CU7A 2LS01 3LNNA 4KI0A 5FLXL 1LTTD 2JEAI 5IT9E 4HMJA 4OGQC 3T51B 1C48A 1GJXA 1O7LA 5IGCA 1NR2A 3VYRA 5FOBB 2PZTA 1J9OA 4IN3A 3H91A 2C9OA 5ELFA 5JAVA 1WTVA 3I8ZA 5E1FA 3RZOB 2F3WA 3QG1A 5C3WA 1PRTD 2Z8LA 4FO2A 4QUCA 1LABA 5I2XA 4QMGA 2WP8J 1D5ZC 1EY6A 2A74C 1S5DD 1GUSA 1KDBA 1S4ZA 3SR1A 2N88A 4OL7A 3HP3A 3PUVA 4N9PA 2VB3X 2EY2A 3SVMA 4FF3A 3P20A 3C2PA 1TKWB 2AUJD 5JVH3 3OW7A 4XQNA 2R6GA 2AUKA 1PFNA 3KLSA 3HKZB 4N9TA 3H09A 2JA6B 3NXWA 3V96A 4B9WA 4DU9A 1EEID 2EJMA 1HTLD 4XQQA 2B2YC 1IW7D 2B39A 3QO2A 4PQXA 3I91A 3CHBD 1KDCA 3BVZA 5CMDA 2KOLA 2PO4A 5IIFA 2EXZA 1HQRD 1PTOC 2KHSA 4DGZA 4KY6A 3GTKB 1SYCA 3MC0B 1QB5D 2L1BA 1YNJC 2PMZB 1YNND 2KECA 3H3VC 2F0SA 4K8JA 2OEOA 4FXGC 2D62A 2PNRC 3FRPB 3FKIB 1SYBA 2XWJB 4IZ8A 1AFPA 1STGA 3IFDA 1EFID 3J7YW 1H9JA 2CVRA 3GO5A 1HRJA 1UEAB 1ZYRC 1ENAA 2ZXRA 1G6ZA 1E2ZA 1FNWA 2XN9C 3A7AB 3A7LA 4NKLA 4A3DB 1S5FD 1GOZA 4IQZA 2B8GA 1DZ1A 4K5VA 4IUUA 1JWUD 3S16B 1VDZA 5FKAC 5IT9L 1WTQA 2F0EA 5D3IB 4EQOA 5A2QL 2BA1A 2B2TA 1RHPA 3NTIA 4XTCS 1CT1D 3MXNA 1LTBD 1AZPA 1T5XD 3TMEA 2XSCA 3SK4A 1O80A 1V8QA 1TWGB 2RA4A 1LTAD 3S9WA 2B2UC 4KHZA 4LAAA 2KJXA 1SYGA 3S17B 1B2TA 3O13A 3SK8A 3SXHA 2IPKD 4A3KB 3IL8A 1O78A 3Q23A 1UAPA 1NSNS 2WKCA 4IUVA 1TWCB 3Q0AA 3IFTA 1G2TA 4RCOA 3RLFA 3T53B 4LMQD 1WTRA 1EOTA 1M4VA 1W6JA 1DOKA 1R4PB 2L0CA 4G7ZC 2XWBB 1GHKA 2V4DA 4BY1B 3DMUA 1MBYA 1CTMA 1U4PA 4ZK9B 4IFDG 2JA5B 2BCOA 1VF7A 2G9DA 1S5BD 5G3LD 1A6XA 5EBCA 5DM63 1IYUA 1WTOA 2B2VC 5I9OA 2QKIC 3DEPA 1TU2B 3PV0A 1BBXC 5ISRA 1L0YB 1PTOD 1F9PA 1TT2A 1SSOA 3A8JE 1FNVA 5KYIA 3IKJA 2CW0D 3TN2A 2KA7A 4K2KA 1X3QA 1BOSA 5CV4A 1XTCD 5KNBA 1R9TB 2K32A 2KEEA 3GV3A 3ONAB 3GTPB 3D6CA 3TBIB 4A3BB 1FNUA 1VCIA 2E2JB 3MEHA 4BBSB 1UNSA 2XVSA 5CC4A 3K59A 1B3AA 3WDNA 1PDQA 5CV9A 3VR5A 3K5OA 2A6HC 4M8AA 1CHQD 3R2IA 2EE1A 5JEAJ 4C56C 3EQLC 1BO0A 1ICWA 3CQZB 4FF1A 2MHVA 4TRDA 3U9OA 1F2ZA 2RVLA 5COYA 1RF2D 2E75C 3LWEA 3HOZB 5ELEA 1CA6A 3M4YA 5HGTA 2B2VA 2E2IB 3DXJC 3D6WA 1TWHB 3TZUA 2Q8RE 1H9RA 1S5CD 1SMYD 4PMBA 1I4QA 4C1NK 3VR4A 4C3IB 1NR4A 1EY5A 2F0MA 3N52A 5E4XA 1HXYD 1DXMA 3RD4A 1OO9B 4XQJA 2B63B 1PRTB 3OWFA 3GP7A 1OXTA 2I46A 1F9SA 4IFDI 3EJIA 3VA5A 2RSNA 1STAA 4OIJA 1LT5D 2PCFB 3J81L 2EVBA 1U4MA 2WV6D 3BZDB 1JB3A 5K5PA 2QCPX 4DNTB 3S1MB 1T5EA 4KD3A 4KN7C 2SNMA 1MI2A 4S3SA 3S1NB 1SYFA 1EL0A 1PRTC 2F0VA 1I50B 1EZ8A 3EROA 1BCPD 5EGTA 1Y69U 1KLUD 2EYMA 3P7JA 3L3OC 2I07B 1Y8NB 1LO5D 4KN4C 1XYIA 3JAML 3AB9A 4NP5A 1Z47A 4V0BA 5F2DA 3GTOB 1R4QB 3NTHA 4Z9CB 5IODA 5BN3A 4DAVA 1F2MA 3M85A 4XIGS 4XYOA 2EYJA 4QIWB 3GTJB 3GTMB 1I4GA 4KTAA 2IX0A 3VR2A 5TSSA 2KCNA 4ZLTF 1K8MA 2JA7B 2KVMA 3H0GB 4X3UA 3TP5A 5LL6X 3P1HA 5DEHA 3QOLA 3H94A 3MAQA 3SEBA 3DEOA 2JEBI 4KY7A 4KKTA 4A3MB 4KD4A 4F7XA 3C3LA 2MPMA 1PYWD 2R92B 1EY4A 5KRUA 2FFKB 1F9QA 1EWCA 2EY6A 1WD1A 1ZKOA 3K5NA 1PMRA 2ICEC 4WFN3 3OSOA 1SNMA 1QILA 3M7NA 1JQYD 1G91A 1KNAA 3PIP3 1DD2A 4LK1C 3S1QB 1AEXA 2Z4HA 1WVLA 3HOWB 1IL8A 2SOBA 5C4JB 1SBBB 1OXSC 1C8CA 5ELDA 3QOJA 4MIUA 2K33A 1O7ZA 2HUGA 5M5XB 4OO1I 4J8QA 2SNSA 3RZDB 1ESFA 2DNCA 4K5XA 2HCIA 3NQIA 4BS9A 4XYQA 1TY2A 1RKNA 1AZQA 1PFMA 2E2DC 3FEWX 3R2TA 1QOHA 1DOLA 5M3MB 2O4XA 5CORA 5A2QE 5I6YA 1TS2A 2EOTA 1HQMC 1JE4A 2FMCA 1PTOF 1V43A 3E5SA 4OO1H 5D14A 3KUPA 1TS5A 1A3UA 2D2CC 2JE6I 5I6WA 4KV6A 4BBRB 2DY7A 1KLGD 5EPKA 1B1ZA 4OHJA 2RDGA 5CV6A 3K57A 1I4PA 4Q5VA 4KHVA 3D31A 5EKLA 2PW5A 3DWQA 3BS1A 4ABNA 1CZWA 3J7AV 1B9NA 4DXFA 1XWEA 3VR6A 2F0NA 2SDFA 2RDFA 1LLRD 4QB4A 3A56A 4HN7A 1Q1EA 2L9HA 1CK1A 4ULLA 1ENCA 3LWUA 2J7ZA 2MUYA 1WTWA 2F03A 3I3CA 2JA8B 1Q12A 2VUMB 5C6AA 2K5WA 2F0HA 2AWOA 1HTPA 2JSOA 1ENFA 1JORA 1TWAB 4WORA 4EGVA 2K01A 1CI3M 2PW7A 1Q3LA 5LHY1 4XT3B 1SYEA 2EDGA 4X3KA 1B44D 2NVQB 2AQ3B 4I65A 1HUMA 1MGSA 2EYPA 2VB2X 4CKEA 1I3QB 2L4NA 4H0LC 1B53A 2A73B 1JOQA 2SEBD 3HS0C 1GUTA 4E6IA 1VMPA 3C1EA 2F0LA 4B9XA 4AYBB 5E3FA 2YU9B 2H1EA 5K36G 1CA5A 4GZYC 2KUMA 3BG3A 2ZT9C 4HSPA 5DM73 4FVMA 2FMMA 1DYQA 1BCPB 4P2CB 3A8IE 1E2VA 1A3TA 1B50A 2NZ1D 2K04A 2RSOA 2JXMB 2CW0C 4NW2A 5IGEA 3AU7A 1L0XB 2LMCB 1QE6A 5LL6S 2EY1A 1ZXTA 1Y8OB 1A2UA 2ZXOA 1YNJD 5JOBA 5T1GA 4BWGB 4L8JA 1G291 1ZEQX 3D3RA 1JC7A 1STEA 2EPBA 2IX3A 2EY5A 4LJZC 1D1IA 3D4WA 2NYZD 3G6JB 4CJ0B 1G8ZD 2PQEA 3A54A 3BDOA 2F3VA 5EKKA 5DAUA 1JOOA 4RA8A 1EIGA 2K03A 3D4DA 2NB0A 3I90A 1GHJA 4C1NI 4HTHA 2NN6G 2K1BA 1TQOA 3MTSA 3MFYA 2TSSA 2QILA 5C0XG 3L9AX 3ND9A 3QWNA 3K58A 1J8IA 1DCZA 4WRDA 3F2UA 2EZVA 3SK6A 4TKOB 4DA2A 2XRSD 2L55A 4ZKBB 2GA4B 3NPPA 5JEAG 2O5JC 2J0TD 1OXUA 1IW7C 3URYA 2F0FA 1CQVA 5CR3A 3G7LA 1KDAA 1DONA 2MGSA 3J80L 2CQAA 2Q8TA 3ERQA 4ZKCB 5KIXA 3DWPA 5IGGA 1QCBD 4DF7A 3NQTA 4C3JG 4KKUA 4DN4M 3FPPA 1Q8IA 3NK9A 1B9MA 1OXXK 1D2BA 5M5WB 4F88A 4K6DA 4KJOA 1DJRD 1AW7A 2IW3A 1Z7TA 5ELCA 4MHEA 3EVQA 4R8IA 1Y1WB 4FNFA 4IUNA 1SAPA 2IWHA 2K6AA 5C5MA 4RAUC 3I4LA 3QJYA 5JPNC 4ZUIA 4CKBA 4HCEA 3Q24A 5C3XA 4A3IB 4ODGA 1W6KA 2F1MA 2A6HD 2IT1A 1E0BA 5M5YB 1D5XC 3HZXA 2OF1A 1PZKD 4G7HC 1V1PA 1U9RA 3NE5B 5EPJA 3Q6SA 1UUPA 1ML0D 3ITPA 2KCCA 5C0XJ 1H9MA 1ESRA 1RD9D 4K14A 2D5DA 3A55A 1RDPD 5C0XH 1EU4A 1ZYRD 4PV1C 2NVXB 2Q8IB 1TS4A 4KK7A 1HFGA 5AFWA 1V1PB 4A3FB 4M1UB 2R7ZB 3WOEA 4O42A 1SNQA 4CHTB 1BCPF 5I4DA 4RKBA 1OXVA 1EEFD 2EJFC 1JCKB 3K5MA 1MSGA 4HR7B 1LT6D 1BCPC 2A6EC 2XIWA 1RODA 2X6GA 1SJED 2BE5C 5JEAH 4L6TB 3FPUB 3HOVB 2IX1A 4QF4A 3SDZA 3MXPA 4RGOS 3HOXB 2PPBC 3MZ5A 1KNEA 5C3EB 3PO3B 2NTSA 4I7ZC 3HOUB 3D4RA 3K0YA 4G4KA 4B08A 1I4RA 3KF8A 1DOMA 1EWHA 2H4OA 2NUCA 3X3MA 2OT2A 1TWFB 3E6ZX 1O7YA 2F0PA 4F8MA 1SYDA 1TVXA 3R3OA 1SDFA 4EVOA 3T13A 1JWSD 2F0GA 4A3GB 3PUZA 2YYZA 3MFGA 5KGUA 4Q0FA 1GUWA 1HUNA 4CKCA 1GUNA 1TY0A 3BDLA 3KLSX 3PIO3 4ZYSA 1JR0D 1QJOA 1G2SA 1LACA 3Q22A 3BVMA 2LY7A 3FMCA 1GUGA 1TR5A 1SE2A 3OIPA 2A5HA 5FO8B 4R9WA 4DK0A 5CGKA 5CBEE 2F0IA 4G7OC 3A8KE 5T1IA 1FD7D 3TP6A 1I4HA 2PYKA 1CHPD 1BR9A 3X3NA 4FF4A 3LX0A 4O1NA 2VNUD 4MN3A 5EQ0A 4F87A 4FYDA 3KBXA 1LTRD 3OMCA 4A3JB 1BUVT 4IUPA 1H9KA 1Y8PB 2F0TA 1SNDA 5C4HA 3TDQA 1QNKA 1NCVA 1SNCA 1GXDC 4A93B 4C3JB 2M2LA 2DNEA 1JICA 3E0JA 1PXUA 2A69D 2WKDA 5EJWA 4IUQA 4OIKA 5IGBA 3MVVA 1HFNA 1SXTA 3GQBA 1Q90A 5C4ZA 4HEDA 1TIID 3ND8A 2RQXA 1IKMA 1ILQA 1ILPA 3HG9A 4ZQ3A 3NWSA 2F0WA 2AWNA 4TQUS 2Z4IA 4X3TA 2BA0A 2C5CA 2BE5D 1HPCA 3JAME 5FO7B 3PMFA 2L11A 4DXGA 2Z1CA 3PUWA 3T16A 2F4IA 1CZGA 2VXWA 4PMWA 2NTTA 1S5ED 3N6RA 5KNCA 3M4OB 5I9PA 3I4MB 2XRQD 4XDXA 2BDOA 3HRZC 5DNFA 3CRKC 2ICIA 3VR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2Y A;  5I2X A;  2M9V A;  2I46 A; 
#chains in the Genus database with same CATH topology
 4OWX B;  2L5T A;  2TMP A;  3GV6 A;  3KF6 A;  4PMC A;  1PTO B;  1CFM A;  1ET6 A;  2EYH A;  2AKW B;  1BNZ A;  4LF5 L;  1D1K A;  4NDX A;  1X54 A;  2RKS A;  2YTV A;  3K7A B;  3HOU G;  1PZI D;  1NAP A;  4DAP A;  1M8A A;  1Q1B A;  2K05 A;  1U5K A;  4IAL A;  1F77 A;  2EYL A;  5GAE C;  3TRE A;  1VQO A;  4R4I A;  3J7A F;  2JA8 H;  4YWM A;  2AQ1 B;  2CHB D;  2G9H D;  4V19 0;  4DV6 L;  3CCU A;  1VMC A;  4RWS C;  3J7A 5;  3KF6 B;  1U0L A;  1WTX A;  2ZXP A;  3AQQ A;  4TSS A;  4KLK A;  5CV7 A;  4JW0 A;  2K28 A;  5GRO A;  4CJ2 C;  5C5L A;  4RCN A;  5IP9 H;  3K6O A;  5IYC H;  1SRO A;  1QVC A;  1A15 A;  3HFZ B;  3U9S A;  2K14 A;  2O2L D;  1D6E C;  1HH2 P;  4RGT A;  5CV5 A;  4YCU A;  4JI8 Q;  2WFW A;  3UDF A;  4C2M B;  1EY7 A;  2UUB L;  1VQF A;  2L12 A;  3T4A C;  5FLX E;  4H7B A;  2K5Q A;  1X3G A;  1HR0 Q;  3VYU A;  2HCC A;  1YEZ A;  2B63 G;  1HA5 A;  4JK1 C;  5C0X I;  2F0K A;  3CC7 A;  2UU9 L;  1I94 L;  4CGY B;  1M90 C;  5EPL A;  3NHH A;  2AQ2 B;  1CQF A;  1LTI D;  4UPA A;  5GAD C;  4H44 C;  1SNO A;  1VQE A;  4L5T A;  3K0X A;  3RLN A;  4DFA A;  5LMU Q;  4PG3 A;  1Y1V G;  4BA1 I;  4A3D G;  2F0Q A;  3UE1 A;  3H6M A;  4YY3 L;  1N32 L;  3I4N B;  1N34 Q;  2QEJ C;  3NTK A;  4A3B H;  5AJ3 L;  3CP0 A;  4ZAI A;  4X64 L;  4FXD A;  4DV2 Q;  4OO1 G;  3FKI G;  3NBI A;  3TP7 A;  2A68 D;  4RHS A;  1YHA A;  3GD7 A;  4GN4 B;  1QWY A;  4LUZ A;  5IGD A;  3BDC A;  5G3L F;  5M5X H;  1P8L A;  4IFD H;  2MNA A;  1XMO Q;  1WD0 A;  1UE5 A;  4P71 A;  3DUZ A;  3S17 H;  2ID0 A;  3MXU A;  5K36 H;  2JA9 A;  5NUC A;  2HHH L;  1JOK A;  3I55 A;  1K83 B;  2A6E D;  1CKN B;  1GUO A;  1PH7 A;  3TP8 A;  4BY7 B;  2YU9 H;  2B8F A;  2WB1 B;  1PTO H;  3W2D A;  5J39 A;  4K6L A;  1HHV A;  5BN4 A;  3J81 j;  3WOF A;  3MHB A;  1LT3 D;  2B2Y A;  3K7A H;  4GLV B;  4L63 B;  4N8X 1;  2F0J A;  2HQE A;  4IUT A;  3V2T A;  5IOC A;  1EIH A;  3M7G A;  4JI2 L;  2OWO A;  4JBK A;  1VQL A;  3D8G A;  5C44 B;  3OOC A;  2FHT A;  3TS2 A;  3OIQ A;  1HA6 A;  2FIN B;  3FVQ A;  5CV8 A;  4YWK A;  2R93 B;  2MJ8 A;  4BY7 G;  3UDI A;  1AE2 A;  3FHW A;  1AP0 A;  5M9O A;  2E74 C;  1PYB A;  4C3I H;  1IYJ B;  4UP7 A;  4NB3 A;  4CDF C;  3NP8 A;  4WJ4 A;  2QDL A;  1N36 Q;  3R93 A;  3M3Y B;  3K80 C;  4DAM A;  1E2W A;  4FP5 D;  2B63 H;  4UAI A;  2F0U A;  3V05 A;  3GTL B;  4JI8 L;  3A5U A;  2X69 A;  1RCV D;  3HOY B;  1STH A;  2QW7 A;  4J1M A;  3VA7 A;  2N78 A;  5C44 G;  1OTC A;  1TS3 A;  4CBV A;  1JB7 A;  4BY1 H;  2FJ2 A;  3S1R B;  4JV5 L;  4J6H A;  4YIJ A;  2Z6K C;  2NVT H;  1ONL A;  4DV4 L;  3G48 A;  4OX9 L;  1MSH A;  5C3E G;  5IP9 G;  1PH4 A;  2IJ0 A;  1NUC A;  3PO3 G;  5FLM H;  4YHH L;  1BDO A;  2BDN A;  2OXP A;  1SJH D;  3HEJ A;  2JYO A;  1X3P A;  3GTK H;  1R9T H;  3ZYY X;  3QR8 A;  1RL2 A;  4DUY Q;  1SN8 A;  4FF2 A;  2EQS A;  4BBS G;  2PI2 E;  1VQK A;  1K3R A;  1B4O A;  5HUR A;  1STB A;  4L5R C;  2QDB A;  1IL2 A;  4EQN A;  1BF4 A;  1FYC A;  4LFB Q;  2C35 B;  4YWL A;  3W3A A;  1D8L A;  4R8N A;  3MA2 B;  4RGN A;  4G57 A;  1CM9 A;  1EYC A;  1PZJ D;  1EIF A;  2PI2 A;  3BVG A;  4BA2 I;  1FJG Q;  2PZW A;  4DPG A;  1A3V A;  3OHX C;  2E76 C;  3CKI B;  3DWA A;  2QEX A;  1Q82 C;  1PH5 A;  4C3H G;  2ES2 A;  4DAY A;  1EUJ A;  2K7V A;  4LFC L;  2E2H B;  1HZC A;  2NVT B;  1EQT A;  2MP1 A;  4HCS A;  3BYT B;  3L7Z C;  1AE3 A;  3J81 c;  3KYH C;  3OWE B;  5IE8 A;  2HDM A;  5M3F H;  1C4Q A;  5CYU A;  2E5L L;  2R61 A;  1N33 L;  3KLR A;  1KAB A;  4P74 A;  4B3R L;  2X6L A;  2Z0S A;  5JPM C;  3FDT A;  2CCZ A;  4RGM A;  1LV9 A;  2ZJR A;  4GKK Q;  1KRT A;  2RDH A;  2E2I H;  1RTO A;  2XTI A;  4QUF A;  4K5W A;  3VYT A;  2LFN A;  4RH6 A;  1EYD A;  2ZJP A;  2M00 A;  3CD6 A;  1YJW A;  4H13 C;  1V1O A;  1H9S A;  2A1A A;  1WTP A;  2IY5 B;  4DV1 Q;  3QB3 A;  2VW9 A;  4GN3 B;  2WAQ B;  3F1Z A;  4DNR B;  5A35 A;  1EY0 A;  2F0D A;  1SNP A;  4LF8 Q;  1J5E Q;  2NVY B;  4XT1 B;  4LFA L;  1SE4 A;  3DHQ A;  3RMH A;  1DM0 B;  5BR8 L;  4JI0 L;  5E4W C;  1WJJ A;  3I73 A;  4POG A;  3NBH A;  4U67 3;  3J81 E;  1RJT A;  1UE7 A;  5JJZ A;  1EQV A;  3PUY A;  2I0Q A;  1SFO B;  3T1H Q;  1YNN C;  3GTQ B;  1SMY C;  4KMU C;  1FGB D;  1STY A;  2NBF A;  4APV A;  1PRT F;  5KYL A;  1PLF A;  4DK1 A;  1F9R A;  3E9I A;  5J1Z A;  5M3F B;  3SK5 A;  5KEE A;  3HOX G;  2Q2T A;  3AFP A;  4ZUJ A;  3S1Q H;  2K4K A;  5D65 A;  4JI6 Q;  1YJ9 A;  5IGF A;  3ZJY C;  3W1G A;  4JVZ A;  1E1T A;  3T56 B;  3CCE A;  4GNX B;  1F2L A;  1STN A;  2EYO A;  1SEB D;  5FO9 B;  4K8I A;  1VQ9 A;  4JI4 L;  3EA6 A;  2EYF A;  2Y0S B;  4JI0 Q;  3NWT A;  5FK9 C;  4HMI A;  2A69 C;  4UP8 A;  3SE0 A;  4X3S A;  4KKS A;  3UI2 A;  2EJG C;  4R1J A;  3AYH B;  2A19 A;  3SHL A;  4DR4 L;  4A3L H;  2NVY H;  3C1F A;  2UUB Q;  1ET9 A;  1CSP A;  4JI7 Q;  4QCL A;  4JC0 A;  4RHR A;  3OPO A;  4GKJ Q;  5IYB G;  4A3J H;  1Q7Y C;  3F2B A;  4DV7 L;  2WII B;  4ZRZ A;  5KND A;  1CKO A;  4LUV A;  1EY8 A;  3MWY W;  1SR3 A;  3NEM A;  1BBU A;  2RBM A;  3K5L A;  2NN6 H;  2N55 A;  4IPG A;  3C46 A;  1BXT A;  1MIU A;  1EIY B;  3KF8 B;  4NMZ A;  5ELB A;  1HNZ Q;  1D5M C;  1VQ6 A;  3EFX D;  1K0R A;  1DGS A;  4QQB X;  4DR3 L;  4HSV A;  4UDU C;  2Q2U A;  2M9V A;  3Q8D A;  1QZH A;  4RFB A;  3RN2 A;  4NXN Q;  1QG7 A;  5EBD A;  5BN5 A;  1KHI A;  2F0O A;  2JA8 G;  4C3H H;  1GKH A;  3S2H B;  3PUX A;  4FXK C;  2JA6 G;  1A2T A;  1XPR A;  2NN6 I;  1IBK Q;  1IKL A;  1KAA A;  3HOV H;  4OON A;  1VF5 C;  2WAC A;  3KBG A;  3AMU A;  5I2Y A;  3I70 A;  3I72 A;  4XXE A;  4DNI A;  3I4N G;  2J4X A;  3GTG B;  4C3I G;  1LTG D;  4A3E B;  2AHO B;  3KK7 A;  2CWA A;  4YCV A;  4JV5 Q;  1A8V A;  1QNU A;  1II3 A;  2A68 C;  2F52 A;  1Y1V B;  2E2J H;  1XXG A;  4K2L A;  1K9M C;  1RIP A;  3PF5 A;  2VQF Q;  1IYV A;  1KTK A;  3CME A;  1BKB A;  1HCZ A;  1XX8 A;  2NWG A;  1I4X A;  4KY5 A;  2HIV A;  2Z6K A;  1IBL L;  1XNQ Q;  1XMQ L;  3JAM i;  3HGB A;  1QVF A;  3S2D B;  1U4R A;  1CKN A;  2DY8 A;  3S14 B;  2WIN B;  4RKL A;  3J80 E;  5JJK A;  2PQA B;  4CJ1 B;  1Z6H A;  4ID6 A;  3I56 A;  4IUR A;  2EXD A;  2B2U A;  2KQ3 A;  1EZ6 A;  1KRS A;  3RNU A;  4Y7N B;  2LKV A;  3TSS A;  3UE0 A;  1LTS D;  3OMG A;  2DN8 A;  1EYA A;  3P75 A;  1BQQ T;  2B2T C;  3I7F A;  2HQL A;  1MD2 D;  1WCM B;  1FR3 A;  2QF7 A;  4ILW A;  4DR4 Q;  4ME5 A;  1JWM D;  1TWH H;  3QIA A;  3D0F A;  2K5D A;  1NE3 A;  1YZ6 A;  2B2W A;  3NSW A;  4IFD J;  5C4J H;  1IHZ A;  2K5H A;  2BOS A;  4A3M G;  1HJP A;  1I6V C;  2DJG C;  4KJN A;  1LT4 D;  5J22 A;  4HJA A;  3IAY A;  1N32 Q;  4N8F A;  3VYS A;  3CRL C;  1EU3 A;  2KED A;  3DM1 A;  3J80 c;  4YHH Q;  2O5I C;  1PFB A;  2JP1 A;  3PO2 B;  2KCM A;  2LSS A;  2R3Z A;  3S1M H;  2XNA C;  1A0I A;  4P75 A;  4HAE A;  2B2W C;  1H9S B;  2D9U A;  4PNY A;  2AMC B;  5IT9 c;  3S14 H;  1AN8 A;  1HNZ L;  2PZU A;  4R4Q A;  3RUZ A;  4C3H B;  3NUC A;  3S2H H;  2HDL A;  4JBW A;  3TZD A;  5D3D A;  5C4X G;  5DLQ E;  2JA6 H;  5C4X B;  3R8B A;  1X32 A;  4U68 A;  1XJV A;  4WJW A;  3I4M G;  1K8O A;  3BYY B;  1XPO A;  1U4L A;  1HZA A;  5JVG 3;  5EKI A;  1F2Y A;  1I6H B;  1X3E A;  2ENB A;  4JI3 L;  3S15 B;  1FJG L;  1EY9 A;  3MXG A;  5CBA E;  4BBR H;  1I5F A;  5M3F G;  3BZC A;  1N9W A;  1RTN A;  4PZ6 A;  4EQP A;  2IL8 A;  1SE3 A;  3CU7 A;  4DR6 Q;  2LS0 1;  2Q2H A;  3LNN A;  4KI0 A;  3WWV A;  5FLX L;  1LTT D;  2JEA I;  1LM0 A;  5IT9 E;  4HMJ A;  4OGQ C;  3T51 B;  1C48 A;  5IY0 A;  1GJX A;  1O7L A;  5IGC A;  1NR2 A;  3PIP A;  3VYR A;  5FOB B;  2PZT A;  1J9O A;  4TVA B;  3VDY A;  3F2C A;  4IN3 A;  3H91 A;  3K7U C;  2C9O A;  4BXX G;  2CH4 W;  5ELF A;  1NBW A;  3L2P A;  5JAV A;  1W3S A;  1MHW C;  1SE8 A;  1WTV A;  3I8Z A;  5E1F A;  3RZO B;  2F3W A;  1PH1 A;  4ZCK A;  3QG1 A;  3HKZ G;  5C3W A;  1PRT D;  2Z8L A;  4FO2 A;  3I4N H;  1UE6 A;  4QUC A;  1LAB A;  5I2X A;  4IPH A;  4X65 Q;  4QMG A;  2WP8 J;  1D5Z C;  3G71 A;  1EY6 A;  1EQQ A;  2A74 C;  1S5D D;  1GUS A;  4A3K G;  1KDB A;  1G51 A;  1S4Z A;  3CAM A;  3SR1 A;  2N88 A;  4OL7 A;  2UU9 Q;  4P72 A;  3HP3 A;  3PUV A;  1Q8K A;  4N9P A;  1HNX Q;  3CMA A;  2VB3 X;  2OTL A;  3I4M H;  4LF9 Q;  2EY2 A;  3SVM A;  4FF3 A;  3P20 A;  1PH9 A;  1Q81 C;  3C2P A;  1TKW B;  1PH8 A;  1XNR L;  4A3G H;  2AUJ D;  5JVH 3;  3OW7 A;  4ME3 A;  2NVQ H;  4B3S L;  4XQN A;  2R6G A;  2AUK A;  1PFN A;  3KLS A;  5FLX c;  2WAQ E;  3HKZ B;  3TEH B;  4N9T A;  1XPU A;  3H09 A;  1C7Y A;  2JA6 B;  4LFB L;  1NY4 A;  3NXW A;  3V96 A;  4B9W A;  4DU9 A;  5J3B A;  5GAH C;  4DV2 L;  1EEI D;  2EJM A;  1HTL D;  4IO9 A;  4XQQ A;  2B2Y C;  4HJ5 A;  1IW7 D;  2B39 A;  1K3B C;  4B3T L;  3QO2 A;  4PQX A;  3I91 A;  3EN2 A;  3CHB D;  1KDC A;  2ALY B;  3BVZ A;  1K8A C;  1T9H A;  5CMD A;  4LF5 Q;  2KOL A;  2PO4 A;  5IIF A;  2EXZ A;  4B3R Q;  1HQR D;  1PTO C;  2KHS A;  2KHI A;  4DGZ A;  2VL6 A;  2IHF A;  4KY6 A;  1Q46 A;  3GTK B;  2VY3 A;  1SYC A;  4LF6 Q;  3MC0 B;  1QB5 D;  4QJF A;  2L1B A;  1YNJ C;  4IOC A;  2PMZ B;  1YNN D;  2KEC A;  4DAY B;  3H3V C;  2F0S A;  4GNX A;  4K8J A;  2OEO A;  4FXG C;  2D62 A;  2PNR C;  3FRP B;  3FKI B;  1SYB A;  2XWJ B;  1PV4 A;  4IZ8 A;  4GN5 A;  1STG A;  1AFP A;  3HOZ G;  1SLJ A;  3IFD A;  1EFI D;  3J7Y W;  1H9J A;  1NNX A;  2CVR A;  3GO5 A;  1HRJ A;  1UEA B;  1ZYR C;  1ENA A;  2ZXR A;  1G6Z A;  1E2Z A;  1FNW A;  1YBY A;  2XN9 C;  2E2H H;  3A7A B;  2YV5 A;  1EQR A;  3W1B A;  3A7L A;  4NKL A;  4A3D B;  1WI5 A;  3MXN B;  1S5F D;  1GOZ A;  2VZA A;  4IQZ A;  4JPB W;  4A76 A;  2OQK A;  2E5L Q;  2B8G A;  1DZ1 A;  4K5V A;  4GKJ L;  4IUU A;  3J81 i;  1JWU D;  2HD3 A;  3S16 B;  4L5Q A;  1HNW Q;  4GKK L;  1VDZ A;  5FKA C;  5IT9 L;  1WTQ A;  2F0E A;  4R4O A;  5D3I B;  4DV0 Q;  4OEM B;  4EQO A;  5A2Q L;  2BA1 A;  5FLM G;  2B2T A;  2ZTE A;  1RHP A;  2VQE L;  1N36 L;  3NTI A;  4XTC S;  1CT1 D;  4DV3 Q;  4LWC A;  3MXN A;  1LTB D;  1AZP A;  1T5X D;  3TME A;  2PMZ E;  2XSC A;  3SK4 A;  2K5N A;  4LFA Q;  1O80 A;  1V8Q A;  3BJU A;  1TWG B;  2RA4 A;  3KDF B;  4RMF A;  1LTA D;  3S9W A;  2B2U C;  3STB D;  4KHZ A;  4NXM Q;  3RLO A;  2H5X A;  4DR1 L;  4OX9 Q;  4LAA A;  2KJX A;  3GTP H;  1I94 Q;  1IXR A;  1SYG A;  3S17 B;  3HOY G;  3O13 A;  3SK8 A;  3KDF A;  3SXH A;  1B2T A;  2IPK D;  3CCR A;  4A3K B;  2UUA Q;  3IL8 A;  4L5S A;  1O78 A;  1LYL A;  3Q23 A;  1X65 A;  1UAP A;  4JG2 A;  1NSN S;  2WKC A;  4IUV A;  3ULP A;  1TWC B;  3Q0A A;  4I7A A;  3IFT A;  1G2T A;  4RCO A;  3RLF A;  3T53 B;  3KOJ A;  4LMQ D;  2BH8 A;  1WTR A;  1EOT A;  4X66 L;  1M4V A;  1W6J A;  1DOK A;  1R4P B;  2L0C A;  4G7Z C;  1A63 A;  4DUZ Q;  1MKH A;  2XWB B;  5C3E H;  1GHK A;  3PO3 H;  2V4D A;  4BY1 B;  4GOP A;  3DMU A;  1MBY A;  1CTM A;  1U4P A;  4ZK9 B;  1IBK L;  4IFD G;  2JA5 B;  2BCO A;  3CXC A;  1VF7 A;  2G9D A;  1S5B D;  5G3L D;  1A6X A;  4JOI A;  2VS1 A;  3CCQ A;  5EBC A;  5DM6 3;  1C0A A;  3MEF A;  1IYU A;  2XGT A;  4OWT B;  1WTO A;  2K52 A;  2B2V C;  5E7N A;  1W2B A;  1EOV A;  1UWV A;  5I9O A;  2QKI C;  3DEP A;  2WB1 G;  3UDX A;  5M5W H;  1TU2 B;  1HNX L;  5M5Y H;  1WCM G;  3PV0 A;  3K81 C;  3OTO L;  1BBX C;  2ZM6 Q;  4A3B G;  4JOI C;  5ISR A;  3M9B A;  1L0Y B;  3E0E A;  3CCV A;  1J6Q A;  1PTO D;  4A3G G;  4HJ7 A;  1F9P A;  2YTY A;  1TT2 A;  1SSO A;  3A8J E;  2B29 A;  1FNV A;  5KYI A;  3IKJ A;  2CW0 D;  3TN2 A;  2UUC Q;  2KA7 A;  3JC6 6;  4K2K A;  1NMF A;  4JBJ A;  3PO2 G;  4JI4 Q;  4A3I H;  5LMN W;  1X3Q A;  1BOS A;  5CV4 A;  1XTC D;  4AH6 A;  5KNB A;  1R9T B;  1BBW A;  4HIM A;  4QL5 A;  2K32 A;  2KEE A;  3GV3 A;  1TXY A;  3U58 A;  3ONA B;  2F3I A;  2JJQ A;  2D0O A;  4A3C G;  3GTP B;  3D6C A;  3TBI B;  4A3B B;  1FNU A;  1VQI A;  1VCI A;  2Y0S E;  2UXD L;  2E2J B;  3MEH A;  4BBS B;  1UNS A;  2XVS A;  1GD7 A;  5CC4 A;  4JI6 L;  4JI3 Q;  3G6E A;  3K59 A;  4GOP B;  1B3A A;  3WDN A;  1PDQ A;  5CV9 A;  1TWC H;  3K5O A;  1X6O A;  3VR5 A;  4GLA C;  1N34 L;  4A4I A;  2A6H C;  4M8A A;  1CHQ D;  1O7I A;  4BY7 H;  3R2I A;  2EE1 A;  5JEA J;  4C56 C;  1K73 C;  3EQL C;  1BO0 A;  1ICW A;  3CQZ B;  4FF1 A;  2MHV A;  4TRD A;  1PA6 A;  3U9O A;  3JAM c;  1F2Z A;  2RVL A;  5COY A;  1RF2 D;  3OW2 A;  5M3M G;  2E75 C;  3LWE A;  3NEN A;  4HIO A;  4GLX A;  4A3F H;  3HOZ B;  1B3Q A;  1PH3 A;  4KHP L;  5ELE A;  1CA6 A;  3M4Y A;  3CCJ A;  5HGT A;  2B2V A;  1Y1W G;  1JT8 A;  2E2I B;  2R93 G;  4MZ9 A;  2UXB L;  3DXJ C;  4DR7 Q;  3UDG A;  3D6W A;  5GQO A;  3ULJ A;  1TWH B;  4POF A;  3TZU A;  2RCF A;  4B3T Q;  1E22 A;  1VS0 A;  1L1O A;  2Q8R E;  1H9R A;  1S5C D;  4GOP C;  1SMY D;  4PMB A;  1I4Q A;  4C1N K;  3VR4 A;  4C3I B;  1K0S A;  1NR4 A;  1EY5 A;  4AYB G;  2F0M A;  3N52 A;  5E4X A;  1HXY D;  1DXM A;  3RD4 A;  1OO9 B;  4XQJ A;  1P16 A;  4GS3 A;  2B63 B;  3HOU H;  1PRT B;  3E3X A;  2Z6B A;  3OWF A;  3GP7 A;  3BZK A;  1G6P A;  1OXT A;  2I46 A;  3GTQ H;  1L1O B;  5JJI A;  4CDE C;  2NZH A;  1F9S A;  1VQ4 A;  4IFD I;  3EJI A;  3VA5 A;  4LF4 Q;  4DR2 L;  1CSQ A;  2RSN A;  1STA A;  1X9N A;  4OIJ A;  1LT5 D;  2PCF B;  4B3S Q;  3J81 L;  2EVB A;  1U4M A;  2WV6 D;  3BZD B;  1JB3 A;  5K5P A;  2QCP X;  3S15 H;  4A3L G;  4DNT B;  3S1M B;  1T5E A;  4KD3 A;  4KN7 C;  2R92 G;  1KAW A;  2SNM A;  1MI2 A;  4S3S A;  1X55 A;  3S1N B;  1SYF A;  1EL0 A;  4BBS H;  1B7Y B;  5HGQ A;  4A93 G;  1PRT C;  4J15 A;  2F0V A;  1I50 B;  1EZ8 A;  3ERO A;  1BCP D;  5EGT A;  1Y69 U;  1KLU D;  2EYM A;  3P7J A;  4JI5 Q;  2UXD Q;  3L3O C;  2I07 B;  1Y8N B;  1LO5 D;  4KN4 C;  1XYI A;  1KC8 C;  4X6A H;  3JAM L;  2MFI A;  1SMX A;  3AB9 A;  4NP5 A;  2CWP A;  2CQO A;  1Z47 A;  4V0B A;  4JI1 L;  5F2D A;  3GTO B;  1R4Q B;  3NTH A;  4Z9C B;  5IOD A;  5BN3 A;  4X66 Q;  4QGU A;  4DAV A;  1WFQ A;  1VQG A;  3GTG H;  5M3M H;  1F2M A;  3M85 A;  4XIG S;  4IPC A;  3L0O A;  2EYJ A;  4XYO A;  1JJ2 A;  4QIW B;  3GTJ B;  1L1O C;  3GTM B;  4MNO A;  1I4G A;  1QVG A;  3PQI A;  4Y52 H;  4KTA A;  2IX0 A;  4A3E H;  3VR2 A;  5TSS A;  2KCN A;  4ZLT F;  4A3F G;  1K8M A;  2JA7 B;  5LMU L;  2KVM A;  3H0G B;  4X3U A;  1E3P A;  1KL9 A;  2R7D A;  4NXM L;  3TP5 A;  4EX5 A;  1JMC A;  1GVP A;  5LL6 X;  1QUQ B;  3P1H A;  4JI1 Q;  5DEH A;  2HT1 A;  1N33 Q;  3QOL A;  3H94 A;  3MAQ A;  3SEB A;  3DEO A;  2JEB I;  4KY7 A;  3RZO H;  4KKT A;  4A3M B;  4KD4 A;  4F7X A;  3S2D H;  3C3L A;  2MPM A;  1PYW D;  2R92 B;  1EY4 A;  5KRU A;  3F8T A;  3KJP A;  1FL0 A;  2FFK B;  1F9Q A;  1EWC A;  2EY6 A;  1WD1 A;  1ZKO A;  3K5N A;  1PMR A;  5AJ3 Q;  3HOX H;  2ICE C;  3B6Y A;  4WFN 3;  2F4V Q;  2CFM A;  2VUM G;  1JJC B;  4IOA A;  2ZTD A;  2LXK A;  1SNM A;  3OSO A;  1QIL A;  1PHJ A;  3M7N A;  1JQY D;  1G91 A;  1KNA A;  4DR5 L;  3PIP 3;  1DD2 A;  2N49 A;  1E1O A;  4LK1 C;  2JQO A;  3S1Q B;  2DUD A;  1AEX A;  2Z4H A;  1WVL A;  3LGJ A;  3HOW B;  1IL8 A;  1VQA A;  2SOB A;  5C4J B;  1SBB B;  1OXS C;  4OXP A;  1C8C A;  3STB C;  5ELD A;  3QOJ A;  4MIU A;  2K33 A;  1O7Z A;  4JI2 Q;  2UXC L;  2HUG A;  5M5X B;  4OO1 I;  4J8Q A;  3PF4 A;  3CC4 A;  2SNS A;  3RZD B;  1ESF A;  3M4O H;  1B8A A;  1EYG A;  2DNC A;  4K5X A;  2HCI A;  1XTD A;  4DR1 Q;  3NQI A;  4LF7 L;  4BS9 A;  4BXX H;  4XYQ A;  1TY2 A;  1RKN A;  1AZQ A;  3DM3 A;  1PFM A;  5IYD G;  4LF6 L;  2E2D C;  4HIK A;  1WCM H;  2ZM6 L;  3FEW X;  1IBM L;  2DJF C;  3R2T A;  4DR5 Q;  1QUQ A;  1QOH A;  1DOL A;  5M3M B;  2O4X A;  5COR A;  1TWF H;  5A2Q E;  5I6Y A;  4A3I G;  2PNH A;  1TS2 A;  2EOT A;  1HQM C;  1JE4 A;  2FMC A;  1PTO F;  1V43 A;  3E5S A;  4OO1 H;  5D14 A;  2B3G A;  1I6H H;  1X56 A;  3KUP A;  1TS5 A;  1A3U A;  2D2C C;  2JE6 I;  5I6W A;  4KV6 A;  4BBR B;  2JA7 H;  2DY7 A;  3I4O A;  1KLG D;  5EPK A;  2R93 H;  1B1Z A;  3H3V H;  3H3V I;  4OHJ A;  2RDG A;  4PZ8 A;  5CV6 A;  3K57 A;  1I4P A;  1L0W A;  4GNX C;  4Q5V A;  4KHV A;  3D31 A;  3NBH B;  5EKL A;  2PW5 A;  4QIW E;  4AYB E;  1KXL A;  3DWQ A;  3BS1 A;  4ABN A;  1CZW A;  3J7A V;  2G5D A;  1B9N A;  3F2D A;  4DXF A;  1XWE A;  3IRB A;  3VR6 A;  2F0N A;  2SDF A;  2RDF A;  1LLR D;  4QB4 A;  1VQ5 A;  3A56 A;  4HN7 A;  4DV0 L;  1VQH A;  4LNQ A;  1Q1E A;  3CPW A;  2L9H A;  1CK1 A;  4ULL A;  1B70 B;  3A5Z B;  1ENC A;  3LWU A;  2J7Z A;  1WTH A;  2MUY A;  1WTW A;  2F03 A;  3I3C A;  5JJL A;  1X3F A;  4DV1 L;  2JA8 B;  1Q12 A;  4B3M L;  5LMN L;  5IWA L;  2VUM B;  5C6A A;  2ASB A;  2K5W A;  4A3C H;  3PCO B;  2F0H A;  1FVI A;  5BR8 Q;  2NZO A;  2AWO A;  1HTP A;  1PH6 A;  2JSO A;  1ENF A;  1JOR A;  1TWA B;  4WOR A;  4EGV A;  2K01 A;  4C2M H;  4A3K H;  1CI3 M;  2PW7 A;  1SRU A;  1Q3L A;  5LHY 1;  4XT3 B;  2UUA L;  1SYE A;  2EDG A;  4X3K A;  2RHS B;  4X64 Q;  1B44 D;  5IYD H;  2NVQ B;  5FJ8 H;  1EWI A;  2AQ3 B;  1KIX A;  2KHJ A;  4I65 A;  1M1K C;  4C3J H;  1K8G A;  1PVO A;  1HUM A;  1MGS A;  2EYP A;  2VB2 X;  2JA5 G;  4CKE A;  1I3Q B;  4YCW A;  2L4N A;  4H0L C;  1B53 A;  2A73 B;  1JOQ A;  2SEB D;  3HS0 C;  1GUT A;  4E6I A;  4ALP A;  4H02 A;  1VMP A;  3C1E A;  2F0L A;  4B9X A;  4QY7 A;  4DK6 C;  4AYB B;  5C44 H;  2V1C C;  5E3F A;  2YU9 B;  2H1E A;  5K36 G;  3RN5 A;  4X65 L;  3ER0 A;  3HKS A;  1CA5 A;  1C9O A;  2N3S A;  4GZY C;  2KUM A;  3BG3 A;  2ZT9 C;  4HSP A;  3KLW A;  5DM7 3;  4FVM A;  2QA4 A;  2FMM A;  1DYQ A;  1BCP B;  1KD1 C;  2OTJ A;  4P2C B;  1E7Z A;  3A8I E;  1E2V A;  3M3Y H;  4IJL A;  4CDD C;  4DKA C;  1A3T A;  2ZTC A;  1B50 A;  2NZ1 D;  2K04 A;  5HY6 A;  3ULL A;  3A0J A;  1YIJ A;  2RSO A;  2JXM B;  2ATW A;  2CW0 C;  3FKI H;  4NW2 A;  5IGE A;  3S1R H;  3AU7 A;  1L0X B;  2LMC B;  1QE6 A;  5LL6 S;  3ICE A;  1LTL A;  2EY1 A;  1VQ7 A;  1ZXT A;  1WOC A;  1Y8O B;  1A2U A;  3CC2 A;  1CKM A;  3PSI A;  2ZXO A;  1YNJ D;  5JOB A;  1IZ6 A;  1TWA H;  5T1G A;  4BWG B;  1EFW A;  4A3D H;  1D7Q A;  1BVS A;  1Z9F A;  2UXC Q;  4L8J A;  1G29 1;  3HOV G;  1ZEQ X;  2P5Z X;  3D3R A;  1JC7 A;  3S16 H;  5ELO A;  2R7Z G;  2ZJQ A;  3GTL H;  1STE A;  2EPB A;  3GDE A;  1K28 A;  2JA7 G;  2IX3 A;  2EY5 A;  4LJZ C;  1D1I A;  3T1H L;  3D4W A;  2NYZ D;  3G6J B;  4CJ0 B;  3I2Z A;  1G8Z D;  2PQE A;  3A54 A;  3BDO A;  3CCS A;  3M4Q A;  2F3V A;  3OYY A;  5EKK A;  5DAU A;  1JOO A;  4RA8 A;  3A74 A;  5ELN A;  1EIG A;  2K03 A;  3D4D A;  2NB0 A;  4NXN L;  3I90 A;  1GHJ A;  4C1N I;  4HTH A;  1ASY A;  2NN6 G;  1TWG H;  2K1B A;  1TQO A;  3MTS A;  3U4Z A;  3MFY A;  4LUO A;  2PQA A;  2TSS A;  4JYA Q;  1L2F A;  2L15 A;  1VQ8 A;  2QIL A;  1NJI C;  5C0X G;  3L9A X;  3E9H A;  3ND9 A;  3QWN A;  3K58 A;  1J8I A;  1DCZ A;  4WRD A;  3F2U A;  5FJ8 G;  2EZV A;  1MJC A;  3SK6 A;  4R4T A;  4TKO B;  4DA2 A;  1CUK A;  1YHQ A;  4LFC Q;  2N8N A;  2XRS D;  2L55 A;  2BH2 A;  2K50 A;  4ZKB B;  2GA4 B;  3NPP A;  5JEA G;  5GAG C;  3U50 C;  1AH9 A;  2O5J C;  1K83 H;  2J0T D;  1FGU A;  1OXU A;  1V9P A;  1IW7 C;  2GVB A;  3URY A;  1HZ9 A;  2F0F A;  4UHV A;  3ERS X;  1CQV A;  5CR3 A;  3G7L A;  1KDA A;  1DON A;  3CF5 A;  2MGS A;  1XNQ L;  3J80 L;  2CQA A;  2Q8T A;  3ERQ A;  4ZKC B;  1SFO H;  2DGY A;  5KIX A;  4DUZ L;  2WB1 E;  3DWP A;  5IGG A;  1QCB D;  4FDB A;  1JJG A;  1ASZ A;  3H15 A;  4DF7 A;  2I5L X;  1VQB A;  3NQT A;  4O0A A;  4C3J G;  4KKU A;  4DN4 M;  3FPP A;  4AIM A;  1Q8I A;  3NK9 A;  1QZG A;  1B9M A;  5IP7 G;  3FP9 A;  1OXX K;  1D2B A;  5M5W B;  3M4P A;  4F88 A;  2I5H A;  4K6D A;  4KJO A;  1DJR D;  1AW7 A;  2IW3 A;  4MTK A;  1Z7T A;  2NVX H;  5ELC A;  4MHE A;  3EVQ A;  2JA5 H;  2D0P A;  4LF9 L;  5L37 A;  4JBM A;  4P73 A;  3K8A A;  4R8I A;  1Y1W B;  4FNF A;  4IUN A;  4DV3 L;  1S40 A;  1SAP A;  2IWH A;  2K6A A;  3GTO H;  5C5M A;  4RAU C;  3I4L A;  3QJY A;  4HJ9 A;  1ICF B;  1S3O A;  5JPN C;  4ZUI A;  1N8R C;  4CKB A;  4HCE A;  3Q24 A;  5C3X A;  4A3I B;  4ODG A;  1W6K A;  2F1M A;  2A6H D;  2IT1 A;  1E0B A;  5M5Y B;  1D5X C;  1IBL Q;  4IPD A;  5IYC G;  3HZX A;  2OF1 A;  5LMN Q;  1PZK D;  3PIO A;  4G7H C;  2E8G A;  1V1P A;  3PO2 H;  2OQ0 A;  1U9R A;  3NE5 B;  5EPJ A;  3Q6S A;  1UUP A;  1ML0 D;  3ITP A;  2KCC A;  5C0X J;  1H9M A;  4WJ3 M;  1VQP A;  4DV7 Q;  3H0G H;  2KCT A;  4LF8 L;  3HOY H;  3PGZ A;  1ESR A;  1RD9 D;  4K14 A;  2D5D A;  3A55 A;  1RDP D;  5C0X H;  1EU4 A;  3J7Z C;  1ZYR D;  4PV1 C;  2NVX B;  2Q8I B;  1TS4 A;  2OCE A;  4MTN A;  2EIF A;  2WAQ G;  4KK7 A;  1HFG A;  5AFW A;  4AQY L;  1V1P B;  4A3E G;  4A3F B;  4M1U B;  4JI5 L;  4X62 Q;  3G4S A;  4K0K Q;  2R7Z B;  4OEL B;  3WOE A;  1UEB A;  2Q2I A;  4O42 A;  1SNQ A;  4CHT B;  1BCP F;  3J80 i;  5I4D A;  4RKB A;  1OXV A;  5IYB H;  4A3J G;  3HOZ H;  3BU2 A;  1EEF D;  2EJF C;  4IJH A;  4HID A;  1HR0 W;  1JCK B;  1GO3 E;  2R7F A;  3K5M A;  1MSG A;  4HR7 B;  1LT6 D;  1BCP C;  2A6E C;  2XIW A;  1PH2 A;  1ROD A;  2X6G A;  1SJE D;  3AFQ A;  4LW1 A;  3HOW H;  2BE5 C;  5JEA H;  2CKZ B;  3S24 A;  3CQZ H;  1VQJ A;  2YTX A;  4L6T B;  3FPU B;  4B3M Q;  3HOV B;  2IX1 A;  4BY1 G;  5IWA Q;  4QF4 A;  3SDZ A;  3CPF A;  3MXP A;  4RGO S;  3W5O A;  3HOX B;  2A8V A;  2PPB C;  3MZ5 A;  1KNE A;  5C3E B;  3PO3 B;  4JCV E;  1XNR Q;  2NTS A;  4I7Z C;  3HOU B;  3D4R A;  1Y1W H;  3K0Y A;  4G4K A;  1YNX A;  4B08 A;  1I4R A;  1Y1V H;  1HNW L;  1WYD A;  3KF8 A;  1DOM A;  1EWH A;  2H4O A;  2JN4 A;  1KQS A;  2NUC A;  3X3M A;  2OT2 A;  1TWF B;  3E6Z X;  2CH4 A;  1O7Y A;  5EAY A;  3TS0 A;  2F0P A;  3CCL A;  4F8M A;  2KEN A;  1UE1 A;  1SYD A;  1TVX A;  5IP7 H;  3R3O A;  2RCN A;  1SDF A;  3TQY A;  4EVO A;  2FXQ A;  3T13 A;  4JYA L;  1MJE A;  1JWS D;  2F0G A;  4A3G B;  3PUZ A;  4DV4 Q;  2LXJ A;  2K5V A;  3S1N H;  2YYZ A;  3MFG A;  1H95 A;  3EIV A;  5KGU A;  4Q0F A;  1I50 H;  2UXB Q;  1GUW A;  1HUN A;  1E24 A;  2MQH A;  2Z9H A;  4CKC A;  1GUN A;  1TY0 A;  3BDL A;  1V1Q A;  4DR6 L;  4Y7N H;  1JE5 A;  3KLS X;  3PIO 3;  4ZYS A;  2I5M X;  1JR0 D;  1QJO A;  2RF4 A;  1G2S A;  1LAC A;  3Q22 A;  3BVM A;  5C4X H;  2LY7 A;  3FMC A;  4YY3 Q;  3KFU A;  1YHB A;  2R7Z H;  4DV5 Q;  1GUG A;  1TR5 A;  4EQ5 A;  1SE2 A;  3OIP A;  2A5H A;  4R4C A;  3GTM H;  5FO8 B;  4R9W A;  4O2D A;  4DK0 A;  1NTG A;  4X62 L;  5CGK A;  4K0K L;  5CBE E;  3SGI A;  5H1S E;  2F0I A;  2HIX A;  4G7O C;  3GTJ H;  2KBN A;  3A8K E;  5T1I A;  1FD7 D;  3TP6 A;  1YI2 A;  1VQN A;  4DR2 Q;  3U4V A;  2HHH Q;  1I4H A;  2PYK A;  1CHP D;  1BR9 A;  3X3N A;  2GVA A;  4FF4 A;  3LX0 A;  4O1N A;  2IHE A;  3TRZ A;  2VNU D;  1J5E L;  4MN3 A;  5EQ0 A;  4F87 A;  4FYD A;  3KBX A;  3DLL A;  1LTR D;  3OMC A;  4A3J B;  3T1Y Q;  1BUV T;  4LF7 Q;  4IUP A;  1H9K A;  1Y8P B;  2F0T A;  1VQC A;  1SND A;  4A3M H;  5C4H A;  3HKZ E;  3TDQ A;  1A62 A;  1QNK A;  2VUM H;  1NCV A;  3OTO Q;  1SNC A;  4DK3 C;  4LF4 L;  1HZB A;  3CCM A;  1GXD C;  4DUY L;  4A93 B;  3NEL A;  4C3J B;  4UP9 A;  2M2L A;  4PZ7 A;  2DNE A;  1JIC A;  3E0J A;  4A75 A;  1PXU A;  4NPS A;  2Y0S G;  2A69 D;  2WKD A;  5EJW A;  4IUQ A;  2VQE Q;  2MO0 A;  4OIK A;  5IGB A;  3MVV A;  1LUZ A;  1HFN A;  1Q86 C;  1HR0 L;  1Y14 B;  1SXT A;  4UY8 C;  3GQB A;  1Q90 A;  3T1Y L;  5C4Z A;  3RZD H;  4CDC C;  4HED A;  3KJO A;  2R92 H;  1TII D;  3ND8 A;  2RQX A;  1IKM A;  1ILQ A;  1ILP A;  3HG9 A;  4ZQ3 A;  3NWS A;  1VQD A;  2F0W A;  4JI7 L;  2AWN A;  2RHQ B;  4TQU S;  2Z4I A;  1GM5 A;  4OWW B;  3EBE A;  4DR7 L;  4BBR G;  4X3T A;  1S72 A;  1I3Q H;  2BA0 A;  1NMG A;  2C5C A;  1VQM A;  2GN5 A;  1YJN A;  2BE5 D;  1HPC A;  3JAM E;  2QGQ A;  5FO7 B;  2VQF L;  3PMF A;  1PFS A;  2L11 A;  3H0G G;  2JK8 A;  3RR5 A;  4AQY Q;  3CW2 C;  2K75 A;  4A93 H;  4DXG A;  2Z1C A;  1IBM Q;  4HJ8 A;  3PUW A;  3T16 A;  2MO1 A;  1XMQ Q;  4DV5 L;  2F4I A;  3HOW G;  1YIT A;  4RG1 A;  1XMO L;  4DR3 Q;  1CZG A;  2VXW A;  4PMW A;  2NTT A;  1S5E D;  3N6R A;  5KNC A;  3M4O B;  5I9P A;  3I4M B;  2XRQ D;  1YVC A;  4XDX A;  4DV6 Q;  2BDO A;  2F4V L;  2UUC L;  1PYS B;  3HRZ C;  5DNF A;  3AEV A;  4KHP Q;  3CRK C;  2ICI A;  3VR3 A; 
#chains in the Genus database with same CATH homology
 2L5T A;  2TMP A;  3GV6 A;  4PMC A;  1PTO B;  1CFM A;  1ET6 A;  2EYH A;  1BNZ A;  1D1K A;  4NDX A;  2RKS A;  3K7A B;  1PZI D;  1NAP A;  4DAP A;  1M8A A;  1Q1B A;  2K05 A;  4IAL A;  1F77 A;  2EYL A;  3J7A F;  2AQ1 B;  2CHB D;  2G9H D;  4V19 0;  1VMC A;  4RWS C;  1WTX A;  2ZXP A;  4TSS A;  5CV7 A;  2K28 A;  4CJ2 C;  5C5L A;  4RCN A;  3K6O A;  1A15 A;  3U9S A;  2O2L D;  1D6E C;  4RGT A;  5CV5 A;  4C2M B;  1EY7 A;  2L12 A;  3T4A C;  5FLX E;  4H7B A;  2K5Q A;  3VYU A;  2HCC A;  1HA5 A;  4JK1 C;  5C0X I;  2F0K A;  4CGY B;  5EPL A;  3NHH A;  2AQ2 B;  1CQF A;  1LTI D;  4H44 C;  1SNO A;  4DFA A;  4BA1 I;  2F0Q A;  3H6M A;  3I4N B;  2QEJ C;  3NTK A;  4ZAI A;  4FXD A;  4OO1 G;  3NBI A;  3TP7 A;  2A68 D;  4RHS A;  3GD7 A;  1QWY A;  5IGD A;  3BDC A;  5G3L F;  4IFD H;  1WD0 A;  3DUZ A;  2ID0 A;  3MXU A;  5K36 H;  5NUC A;  1JOK A;  1K83 B;  2A6E D;  1GUO A;  3TP8 A;  4BY7 B;  2B8F A;  2WB1 B;  1PTO H;  3W2D A;  5J39 A;  4K6L A;  1HHV A;  5BN4 A;  3WOF A;  3MHB A;  1LT3 D;  2B2Y A;  4L63 B;  2F0J A;  2HQE A;  4IUT A;  3V2T A;  5IOC A;  1EIH A;  3M7G A;  3D8G A;  5C44 B;  3OOC A;  2FHT A;  3OIQ A;  1HA6 A;  2FIN B;  3FVQ A;  5CV8 A;  2R93 B;  2MJ8 A;  1AP0 A;  5M9O A;  2E74 C;  3NP8 A;  3R93 A;  3M3Y B;  1E2W A;  4FP5 D;  4UAI A;  2F0U A;  3V05 A;  3GTL B;  2X69 A;  1RCV D;  3HOY B;  1STH A;  4J1M A;  3VA7 A;  1TS3 A;  4CBV A;  2FJ2 A;  3S1R B;  4J6H A;  4YIJ A;  1ONL A;  1MSH A;  2IJ0 A;  1NUC A;  1BDO A;  2BDN A;  2OXP A;  1SJH D;  3HEJ A;  2JYO A;  1X3P A;  3ZYY X;  4FF2 A;  1B4O A;  5HUR A;  1STB A;  2QDB A;  4EQN A;  1BF4 A;  1FYC A;  3W3A A;  4R8N A;  3MA2 B;  4RGN A;  4G57 A;  1CM9 A;  1EYC A;  1PZJ D;  3BVG A;  4BA2 I;  2PZW A;  1A3V A;  3OHX C;  2E76 C;  3CKI B;  3DWA A;  4C3H G;  4DAY A;  2K7V A;  2E2H B;  2NVT B;  1EQT A;  2MP1 A;  4HCS A;  3BYT B;  3L7Z C;  3OWE B;  2HDM A;  1C4Q A;  5CYU A;  2R61 A;  3KLR A;  1KAB A;  2X6L A;  5JPM C;  3FDT A;  4RGM A;  1LV9 A;  2RDH A;  1RTO A;  4QUF A;  4K5W A;  3VYT A;  2LFN A;  4RH6 A;  1EYD A;  2M00 A;  4H13 C;  1V1O A;  1H9S A;  1WTP A;  3QB3 A;  2WAQ B;  4DNR B;  5A35 A;  1EY0 A;  2F0D A;  1SNP A;  2NVY B;  4XT1 B;  1SE4 A;  3DHQ A;  3RMH A;  1DM0 B;  5E4W C;  3I73 A;  3NBH A;  4U67 3;  3J81 E;  1RJT A;  5JJZ A;  1EQV A;  3PUY A;  1SFO B;  1YNN C;  3GTQ B;  1SMY C;  4KMU C;  1FGB D;  1STY A;  2NBF A;  1PRT F;  5KYL A;  1PLF A;  4DK1 A;  1F9R A;  5J1Z A;  5M3F B;  3SK5 A;  5KEE A;  4ZUJ A;  5D65 A;  5IGF A;  3T56 B;  1F2L A;  1STN A;  2EYO A;  1SEB D;  5FO9 B;  4K8I A;  3EA6 A;  2EYF A;  2Y0S B;  3NWT A;  5FK9 C;  4HMI A;  2A69 C;  3SE0 A;  4X3S A;  4KKS A;  3UI2 A;  2EJG C;  3SHL A;  3C1F A;  1ET9 A;  4QCL A;  4RHR A;  3OPO A;  2WII B;  4ZRZ A;  5KND A;  1EY8 A;  3MWY W;  2RBM A;  3K5L A;  2NN6 H;  2N55 A;  3C46 A;  1BXT A;  4NMZ A;  5ELB A;  1D5M C;  3EFX D;  4HSV A;  4UDU C;  2M9V A;  4RFB A;  1QG7 A;  5EBD A;  5BN5 A;  2F0O A;  3S2H B;  3PUX A;  4FXK C;  1A2T A;  2NN6 I;  1IKL A;  1KAA A;  1VF5 C;  2WAC A;  3KBG A;  3AMU A;  5I2Y A;  3I70 A;  3I72 A;  4XXE A;  3GTG B;  2J4X A;  4C3I G;  1LTG D;  4A3E B;  3KK7 A;  1QNU A;  1II3 A;  2A68 C;  1Y1V B;  1XXG A;  4K2L A;  1IYV A;  1KTK A;  1HCZ A;  1XX8 A;  2NWG A;  1I4X A;  4KY5 A;  3HGB A;  3S2D B;  1U4R A;  2DY8 A;  3S14 B;  2WIN B;  4RKL A;  3J80 E;  4CJ1 B;  1Z6H A;  4ID6 A;  4IUR A;  2B2U A;  2KQ3 A;  1EZ6 A;  4Y7N B;  2LKV A;  3TSS A;  1LTS D;  3OMG A;  2DN8 A;  1EYA A;  3P75 A;  1BQQ T;  2B2T C;  1MD2 D;  1WCM B;  1FR3 A;  2QF7 A;  4ILW A;  4ME5 A;  1JWM D;  3QIA A;  2K5D A;  3NSW A;  2B2W A;  4IFD J;  1IHZ A;  2BOS A;  1I6V C;  4KJN A;  1LT4 D;  5J22 A;  3IAY A;  3VYS A;  3CRL C;  1EU3 A;  2KED A;  3DM1 A;  2O5I C;  1PFB A;  2JP1 A;  3PO2 B;  2R3Z A;  2XNA C;  4HAE A;  2B2W C;  1H9S B;  2D9U A;  4PNY A;  1AN8 A;  2PZU A;  3RUZ A;  4C3H B;  3NUC A;  2HDL A;  4JBW A;  3TZD A;  5D3D A;  5C4X B;  3R8B A;  1X32 A;  4U68 A;  4WJW A;  1K8O A;  3BYY B;  1U4L A;  5JVG 3;  5EKI A;  1F2Y A;  1I6H B;  2ENB A;  3S15 B;  1EY9 A;  3MXG A;  5CBA E;  1RTN A;  4EQP A;  2IL8 A;  1SE3 A;  3CU7 A;  2LS0 1;  3LNN A;  4KI0 A;  5FLX L;  1LTT D;  2JEA I;  5IT9 E;  4HMJ A;  4OGQ C;  3T51 B;  1C48 A;  1GJX A;  1O7L A;  5IGC A;  1NR2 A;  3VYR A;  5FOB B;  2PZT A;  1J9O A;  4IN3 A;  3H91 A;  2C9O A;  5ELF A;  5JAV A;  1WTV A;  3I8Z A;  5E1F A;  3RZO B;  2F3W A;  3QG1 A;  5C3W A;  1PRT D;  2Z8L A;  4FO2 A;  4QUC A;  1LAB A;  5I2X A;  4QMG A;  2WP8 J;  1D5Z C;  1EY6 A;  2A74 C;  1S5D D;  1GUS A;  1KDB A;  1S4Z A;  3SR1 A;  2N88 A;  4OL7 A;  3HP3 A;  3PUV A;  4N9P A;  2VB3 X;  2EY2 A;  3SVM A;  4FF3 A;  3P20 A;  3C2P A;  1TKW B;  2AUJ D;  5JVH 3;  3OW7 A;  4XQN A;  2R6G A;  2AUK A;  1PFN A;  3KLS A;  3HKZ B;  4N9T A;  3H09 A;  2JA6 B;  3NXW A;  3V96 A;  4B9W A;  4DU9 A;  1EEI D;  2EJM A;  1HTL D;  4XQQ A;  2B2Y C;  1IW7 D;  2B39 A;  3QO2 A;  4PQX A;  3I91 A;  3CHB D;  1KDC A;  3BVZ A;  5CMD A;  2KOL A;  2PO4 A;  5IIF A;  2EXZ A;  1HQR D;  1PTO C;  2KHS A;  4DGZ A;  4KY6 A;  3GTK B;  1SYC A;  3MC0 B;  1QB5 D;  2L1B A;  1YNJ C;  2PMZ B;  1YNN D;  2KEC A;  3H3V C;  2F0S A;  4K8J A;  2OEO A;  4FXG C;  2D62 A;  2PNR C;  3FRP B;  3FKI B;  1SYB A;  2XWJ B;  4IZ8 A;  1AFP A;  1STG A;  3IFD A;  1EFI D;  3J7Y W;  1H9J A;  2CVR A;  3GO5 A;  1HRJ A;  1UEA B;  1ZYR C;  1ENA A;  2ZXR A;  1G6Z A;  1E2Z A;  1FNW A;  2XN9 C;  3A7A B;  3A7L A;  4NKL A;  4A3D B;  1S5F D;  1GOZ A;  4IQZ A;  2B8G A;  1DZ1 A;  4K5V A;  4IUU A;  1JWU D;  3S16 B;  1VDZ A;  5FKA C;  5IT9 L;  1WTQ A;  2F0E A;  5D3I B;  4EQO A;  5A2Q L;  2BA1 A;  2B2T A;  1RHP A;  3NTI A;  4XTC S;  1CT1 D;  3MXN A;  1LTB D;  1AZP A;  1T5X D;  3TME A;  2XSC A;  3SK4 A;  1O80 A;  1V8Q A;  1TWG B;  2RA4 A;  1LTA D;  3S9W A;  2B2U C;  4KHZ A;  4LAA A;  2KJX A;  1SYG A;  3S17 B;  1B2T A;  3O13 A;  3SK8 A;  3SXH A;  2IPK D;  4A3K B;  3IL8 A;  1O78 A;  3Q23 A;  1UAP A;  1NSN S;  2WKC A;  4IUV A;  1TWC B;  3Q0A A;  3IFT A;  1G2T A;  4RCO A;  3RLF A;  3T53 B;  4LMQ D;  1WTR A;  1EOT A;  1M4V A;  1W6J A;  1DOK A;  1R4P B;  2L0C A;  4G7Z C;  2XWB B;  1GHK A;  2V4D A;  4BY1 B;  3DMU A;  1MBY A;  1CTM A;  1U4P A;  4ZK9 B;  4IFD G;  2JA5 B;  2BCO A;  1VF7 A;  2G9D A;  1S5B D;  5G3L D;  1A6X A;  5EBC A;  5DM6 3;  1IYU A;  1WTO A;  2B2V C;  5I9O A;  2QKI C;  3DEP A;  1TU2 B;  3PV0 A;  1BBX C;  5ISR A;  1L0Y B;  1PTO D;  1F9P A;  1TT2 A;  1SSO A;  3A8J E;  1FNV A;  5KYI A;  3IKJ A;  2CW0 D;  3TN2 A;  2KA7 A;  4K2K A;  1X3Q A;  1BOS A;  5CV4 A;  1XTC D;  5KNB A;  1R9T B;  2K32 A;  2KEE A;  3GV3 A;  3ONA B;  3GTP B;  3D6C A;  3TBI B;  4A3B B;  1FNU A;  1VCI A;  2E2J B;  3MEH A;  4BBS B;  1UNS A;  2XVS A;  5CC4 A;  3K59 A;  1B3A A;  3WDN A;  1PDQ A;  5CV9 A;  3VR5 A;  3K5O A;  2A6H C;  4M8A A;  1CHQ D;  3R2I A;  2EE1 A;  5JEA J;  4C56 C;  3EQL C;  1BO0 A;  1ICW A;  3CQZ B;  4FF1 A;  2MHV A;  4TRD A;  3U9O A;  1F2Z A;  2RVL A;  5COY A;  1RF2 D;  2E75 C;  3LWE A;  3HOZ B;  5ELE A;  1CA6 A;  3M4Y A;  5HGT A;  2B2V A;  2E2I B;  3DXJ C;  3D6W A;  1TWH B;  3TZU A;  2Q8R E;  1H9R A;  1S5C D;  1SMY D;  4PMB A;  1I4Q A;  4C1N K;  3VR4 A;  4C3I B;  1NR4 A;  1EY5 A;  2F0M A;  3N52 A;  5E4X A;  1HXY D;  1DXM A;  3RD4 A;  1OO9 B;  4XQJ A;  2B63 B;  1PRT B;  3OWF A;  3GP7 A;  1OXT A;  2I46 A;  1F9S A;  4IFD I;  3EJI A;  3VA5 A;  2RSN A;  1STA A;  4OIJ A;  1LT5 D;  2PCF B;  3J81 L;  2EVB A;  1U4M A;  2WV6 D;  3BZD B;  1JB3 A;  5K5P A;  2QCP X;  4DNT B;  3S1M B;  1T5E A;  4KD3 A;  4KN7 C;  2SNM A;  1MI2 A;  4S3S A;  3S1N B;  1SYF A;  1EL0 A;  1PRT C;  2F0V A;  1I50 B;  1EZ8 A;  3ERO A;  1BCP D;  5EGT A;  1Y69 U;  1KLU D;  2EYM A;  3P7J A;  3L3O C;  2I07 B;  1Y8N B;  1LO5 D;  4KN4 C;  1XYI A;  3JAM L;  3AB9 A;  4NP5 A;  1Z47 A;  4V0B A;  5F2D A;  3GTO B;  1R4Q B;  3NTH A;  4Z9C B;  5IOD A;  5BN3 A;  4DAV A;  1F2M A;  3M85 A;  4XIG S;  4XYO A;  2EYJ A;  4QIW B;  3GTJ B;  3GTM B;  1I4G A;  4KTA A;  2IX0 A;  3VR2 A;  5TSS A;  2KCN A;  4ZLT F;  1K8M A;  2JA7 B;  2KVM A;  3H0G B;  4X3U A;  3TP5 A;  5LL6 X;  3P1H A;  5DEH A;  3QOL A;  3H94 A;  3MAQ A;  3SEB A;  3DEO A;  2JEB I;  4KY7 A;  4KKT A;  4A3M B;  4KD4 A;  4F7X A;  3C3L A;  2MPM A;  1PYW D;  2R92 B;  1EY4 A;  5KRU A;  2FFK B;  1F9Q A;  1EWC A;  2EY6 A;  1WD1 A;  1ZKO A;  3K5N A;  1PMR A;  2ICE C;  4WFN 3;  3OSO A;  1SNM A;  1QIL A;  3M7N A;  1JQY D;  1G91 A;  1KNA A;  3PIP 3;  1DD2 A;  4LK1 C;  3S1Q B;  1AEX A;  2Z4H A;  1WVL A;  3HOW B;  1IL8 A;  2SOB A;  5C4J B;  1SBB B;  1OXS C;  1C8C A;  5ELD A;  3QOJ A;  4MIU A;  2K33 A;  1O7Z A;  2HUG A;  5M5X B;  4OO1 I;  4J8Q A;  2SNS A;  3RZD B;  1ESF A;  2DNC A;  4K5X A;  2HCI A;  3NQI A;  4BS9 A;  4XYQ A;  1TY2 A;  1RKN A;  1AZQ A;  1PFM A;  2E2D C;  3FEW X;  3R2T A;  1QOH A;  1DOL A;  5M3M B;  2O4X A;  5COR A;  5A2Q E;  5I6Y A;  1TS2 A;  2EOT A;  1HQM C;  1JE4 A;  2FMC A;  1PTO F;  1V43 A;  3E5S A;  4OO1 H;  5D14 A;  3KUP A;  1TS5 A;  1A3U A;  2D2C C;  2JE6 I;  5I6W A;  4KV6 A;  4BBR B;  2DY7 A;  1KLG D;  5EPK A;  1B1Z A;  4OHJ A;  2RDG A;  5CV6 A;  3K57 A;  1I4P A;  4Q5V A;  4KHV A;  3D31 A;  5EKL A;  2PW5 A;  3DWQ A;  3BS1 A;  4ABN A;  1CZW A;  3J7A V;  1B9N A;  4DXF A;  1XWE A;  3VR6 A;  2F0N A;  2SDF A;  2RDF A;  1LLR D;  4QB4 A;  3A56 A;  4HN7 A;  1Q1E A;  2L9H A;  1CK1 A;  4ULL A;  1ENC A;  3LWU A;  2J7Z A;  2MUY A;  1WTW A;  2F03 A;  3I3C A;  2JA8 B;  1Q12 A;  2VUM B;  5C6A A;  2K5W A;  2F0H A;  2AWO A;  1HTP A;  2JSO A;  1ENF A;  1JOR A;  1TWA B;  4WOR A;  4EGV A;  2K01 A;  1CI3 M;  2PW7 A;  1Q3L A;  5LHY 1;  4XT3 B;  1SYE A;  2EDG A;  4X3K A;  1B44 D;  2NVQ B;  2AQ3 B;  4I65 A;  1HUM A;  1MGS A;  2EYP A;  2VB2 X;  4CKE A;  1I3Q B;  2L4N A;  4H0L C;  1B53 A;  2A73 B;  1JOQ A;  2SEB D;  3HS0 C;  1GUT A;  4E6I A;  1VMP A;  3C1E A;  2F0L A;  4B9X A;  4AYB B;  5E3F A;  2YU9 B;  2H1E A;  5K36 G;  1CA5 A;  4GZY C;  2KUM A;  3BG3 A;  2ZT9 C;  4HSP A;  5DM7 3;  4FVM A;  2FMM A;  1DYQ A;  1BCP B;  4P2C B;  3A8I E;  1E2V A;  1A3T A;  1B50 A;  2NZ1 D;  2K04 A;  2RSO A;  2JXM B;  2CW0 C;  4NW2 A;  5IGE A;  3AU7 A;  1L0X B;  2LMC B;  1QE6 A;  5LL6 S;  2EY1 A;  1ZXT A;  1Y8O B;  1A2U A;  2ZXO A;  1YNJ D;  5JOB A;  5T1G A;  4BWG B;  4L8J A;  1G29 1;  1ZEQ X;  3D3R A;  1JC7 A;  1STE A;  2EPB A;  2IX3 A;  2EY5 A;  4LJZ C;  1D1I A;  3D4W A;  2NYZ D;  3G6J B;  4CJ0 B;  1G8Z D;  2PQE A;  3A54 A;  3BDO A;  2F3V A;  5EKK A;  5DAU A;  1JOO A;  4RA8 A;  1EIG A;  2K03 A;  3D4D A;  2NB0 A;  3I90 A;  1GHJ A;  4C1N I;  4HTH A;  2NN6 G;  2K1B A;  1TQO A;  3MTS A;  3MFY A;  2TSS A;  2QIL A;  5C0X G;  3L9A X;  3ND9 A;  3QWN A;  3K58 A;  1J8I A;  1DCZ A;  4WRD A;  3F2U A;  2EZV A;  3SK6 A;  4TKO B;  4DA2 A;  2XRS D;  2L55 A;  4ZKB B;  2GA4 B;  3NPP A;  5JEA G;  2O5J C;  2J0T D;  1OXU A;  1IW7 C;  3URY A;  2F0F A;  1CQV A;  5CR3 A;  3G7L A;  1KDA A;  1DON A;  2MGS A;  3J80 L;  2CQA A;  2Q8T A;  3ERQ A;  4ZKC B;  5KIX A;  3DWP A;  5IGG A;  1QCB D;  4DF7 A;  3NQT A;  4C3J G;  4KKU A;  4DN4 M;  3FPP A;  1Q8I A;  3NK9 A;  1B9M A;  1OXX K;  1D2B A;  5M5W B;  4F88 A;  4K6D A;  4KJO A;  1DJR D;  1AW7 A;  2IW3 A;  1Z7T A;  5ELC A;  4MHE A;  3EVQ A;  4R8I A;  1Y1W B;  4FNF A;  4IUN A;  1SAP A;  2IWH A;  2K6A A;  5C5M A;  4RAU C;  3I4L A;  3QJY A;  5JPN C;  4ZUI A;  4CKB A;  4HCE A;  3Q24 A;  5C3X A;  4A3I B;  4ODG A;  1W6K A;  2F1M A;  2A6H D;  2IT1 A;  1E0B A;  5M5Y B;  1D5X C;  3HZX A;  2OF1 A;  1PZK D;  4G7H C;  1V1P A;  1U9R A;  3NE5 B;  5EPJ A;  3Q6S A;  1UUP A;  1ML0 D;  3ITP A;  2KCC A;  5C0X J;  1H9M A;  1ESR A;  1RD9 D;  4K14 A;  2D5D A;  3A55 A;  1RDP D;  5C0X H;  1EU4 A;  1ZYR D;  4PV1 C;  2NVX B;  2Q8I B;  1TS4 A;  4KK7 A;  1HFG A;  5AFW A;  1V1P B;  4A3F B;  4M1U B;  2R7Z B;  3WOE A;  4O42 A;  1SNQ A;  4CHT B;  1BCP F;  5I4D A;  4RKB A;  1OXV A;  1EEF D;  2EJF C;  1JCK B;  3K5M A;  1MSG A;  4HR7 B;  1LT6 D;  1BCP C;  2A6E C;  2XIW A;  1ROD A;  2X6G A;  1SJE D;  2BE5 C;  5JEA H;  4L6T B;  3FPU B;  3HOV B;  2IX1 A;  4QF4 A;  3SDZ A;  3MXP A;  4RGO S;  3HOX B;  2PPB C;  3MZ5 A;  1KNE A;  5C3E B;  3PO3 B;  2NTS A;  4I7Z C;  3HOU B;  3D4R A;  3K0Y A;  4G4K A;  4B08 A;  1I4R A;  3KF8 A;  1DOM A;  1EWH A;  2H4O A;  2NUC A;  3X3M A;  2OT2 A;  1TWF B;  3E6Z X;  1O7Y A;  2F0P A;  4F8M A;  1SYD A;  1TVX A;  3R3O A;  1SDF A;  4EVO A;  3T13 A;  1JWS D;  2F0G A;  4A3G B;  3PUZ A;  2YYZ A;  3MFG A;  5KGU A;  4Q0F A;  1GUW A;  1HUN A;  4CKC A;  1GUN A;  1TY0 A;  3BDL A;  3KLS X;  3PIO 3;  4ZYS A;  1JR0 D;  1QJO A;  1G2S A;  1LAC A;  3Q22 A;  3BVM A;  2LY7 A;  3FMC A;  1GUG A;  1TR5 A;  1SE2 A;  3OIP A;  2A5H A;  5FO8 B;  4R9W A;  4DK0 A;  5CGK A;  5CBE E;  2F0I A;  4G7O C;  3A8K E;  5T1I A;  1FD7 D;  3TP6 A;  1I4H A;  2PYK A;  1CHP D;  1BR9 A;  3X3N A;  4FF4 A;  3LX0 A;  4O1N A;  2VNU D;  4MN3 A;  5EQ0 A;  4F87 A;  4FYD A;  3KBX A;  1LTR D;  3OMC A;  4A3J B;  1BUV T;  4IUP A;  1H9K A;  1Y8P B;  2F0T A;  1SND A;  5C4H A;  3TDQ A;  1QNK A;  1NCV A;  1SNC A;  1GXD C;  4A93 B;  4C3J B;  2M2L A;  2DNE A;  1JIC A;  3E0J A;  1PXU A;  2A69 D;  2WKD A;  5EJW A;  4IUQ A;  4OIK A;  5IGB A;  3MVV A;  1HFN A;  1SXT A;  3GQB A;  1Q90 A;  5C4Z A;  4HED A;  1TII D;  3ND8 A;  2RQX A;  1IKM A;  1ILQ A;  1ILP A;  3HG9 A;  4ZQ3 A;  3NWS A;  2F0W A;  2AWN A;  4TQU S;  2Z4I A;  4X3T A;  2BA0 A;  2C5C A;  2BE5 D;  1HPC A;  3JAM E;  5FO7 B;  3PMF A;  2L11 A;  4DXG A;  2Z1C A;  3PUW A;  3T16 A;  2F4I A;  1CZG A;  2VXW A;  4PMW A;  2NTT A;  1S5E D;  3N6R A;  5KNC A;  3M4O B;  5I9P A;  3I4M B;  2XRQ D;  4XDX A;  2BDO A;  3HRZ C;  5DNF A;  3CRK C;  2ICI A;  3VR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...