5I2XA

Crystal structure of tpp1 k170del
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenocortical dysplasia protein homolog
publication title Structural and functional consequences of a disease mutation in the telomere protein TPP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i2xA00
2M9VA 5I2XA 5I2YA 2I46A
chains in the Genus database with same CATH superfamily
3M3YH 2NVXH 2ZTCA 1XNQL 1V8QA 1G6PA 3E3XA 5EBCA 5KRUA 2C5CA 2HDLA 2PNHA 3BS1A 3MTSA 4QY7A 2QDLA 4N8FA 3HEJA 2NTTA 4KHZA 2NZ1D 2EYOA 3CRKC 4CKBA 2C9OA 5ELDA 3R93A 2F0DA 3KOJA 2BH2A 4HEDA 1AE3A 3I2ZA 2IWHA 3QG1A 3UDGA 3S1MH 1A3UA 1AW7A 5FJ8H 2F0HA 3H09A 3QWNA 2A68D 2HQEA 3GO5A 4FF4A 1PXUA 4KI0A 1H9RA 3J80E 3S2DH 3S17B 1PH5A 1PRTD 4DK3C 2UXCL 3HP3A 3G4SA 4XYOA 3I55A 3M85A 2JA5H 1OO9B 5C5LA 2Y0SE 3NPPA 1XTDA 4GNXC 3TZDA 1QUQA 1RDPD 1WFQA 1SRUA 4A3DG 1HNZL 1EZ8A 3DMUA 1PFNA 1VQFA 2KECA 2OF1A 4PV1C 3S15B 2OTLA 2NN6G 4WJ3M 1II3A 1CK1A 3I7FA 4Q0FA 4I7AA 5CR3A 5ISRA 3HOUH 1TY2A 1D2BA 3G48A 2Z6KA 5JJKA 1YJ9A 4A93H 4DR1Q 2EQSA 2J4XA 5FLXE 3S9WA 1CZGA 1IZ6A 1LTAD 4B3RL 3DWPA 1EEID 3MXUA 5CV7A 1JT8A 1D5MC 2VQFL 1EQQA 2F0VA 1QZHA 3NENA 3I4MH 4A3LH 1Q8IA 3IFTA 4BA1I 4K14A 2LS01 3LWEA 3CCMA 1YHQA 1SE3A 2EY5A 3VYRA 5JPNC 5CBEE 4QQBX 2ZTEA 3LNNA 5I2XA 4ME5A 4IOAA 4QF4A 4KY6A 4DV0Q 1F77A 2MUYA 1PFSA 3AFPA 3M4OB 3I4LA 2PYKA 1JB7A 1ONLA 2HIXA 3N52A 1S40A 2VQEQ 2PO4A 4IPGA 3BVMA 2PPBC 3TMEA 3A7LA 2I07B 4O2DA 1HFGA 4ZAIA 1SYDA 3OW2A 1HHVA 1BUVT 4GNXA 1FGBD 1STYA 1SLJA 2MFIA 3RNUA 1M1KC 4K0KQ 4EVOA 4DUZQ 1A15A 2VQEL 2B63G 4TKOB 4DKAC 4DV7Q 3U4VA 1SYEA 4JOIC 4K6DA 4AYBG 2A6HC 4NXML 2E2JB 1A2UA 4R4OA 3J7AF 1STHA 4DGZA 5I4DA 3K6OA 3GTJH 2JN4A 2F03A 4A3EB 2F52A 3KLSA 1EIHA 1SXTA 1ICFB 2F0GA 4CDEC 4LK1C 1SSOA 5EKKA 4A76A 4ID6A 1ASYA 1HTLD 2EZVA 3K5LA 1TWAB 3KBGA 1N33Q 3GTGH 3GDEA 1I94Q 5A2QE 5C4HA 4LF4L 4X66Q 1QZGA 2CKZB 2A6HD 2PQAB 4GN3B 2RCFA 2RDGA 1AE2A 3TSSA 5AFWA 4XQNA 4EGVA 3S16H 1TR5A 2TSSA 5A35A 3NEMA 3GTMH 2KCTA 1YZ6A 2OQ0A 4LF5Q 1N33L 5GQOA 1R9TB 2F0QA 1BDOA 3RLOA 2CW0D 1AH9A 2DNEA 5T1GA 3BDOA 3DLLA 3Q6SA 5M3MG 1VQMA 4GN4B 5D14A 2MP1A 3BZDB 2NVQB 1STEA 1E22A 4YWMA 4Q5VA 4A3IB 1IBKL 1S3OA 3PO2G 2YU9B 4RMFA 4B3SQ 3D6WA 4JOIA 4BXXG 2R92B 4XT1B 4IUUA 1B4OA 4QIWB 1C4QA 4IFDH 4JI4Q 1NR2A 5IOCA 5JJZA 3L7ZC 4X65L 1V1OA 4IPCA 1LM0A 2MO0A 1WTWA 1JOOA 5IYDG 1PZKD 2I46A 1STAA 2RSNA 4L5QA 5IP7H 4QJFA 1TY0A 4DV5Q 5M5WB 4WFN3 1LTSD 3T53B 4B3SL 4DR2L 2UXDL 2VUMB 3CW2C 3RLNA 1EU3A 4HMJA 4A3BG 5IY0A 1WCMH 3HRZC 4A3FH 1JMCA 2MHVA 4DA2A 3CCJA 4HJ5A 3DUZA 3EFXD 3I56A 3ERQA 4ZK9B 1E1OA 4CDFC 5C3EG 2SOBA 1LO5D 2RDHA 4S3SA 3MHBA 4DV5L 2R61A 2JA6B 3AYHB 4XXEA 2ENBA 4UAIA 2RKSA 3V96A 2PCFB 4AIMA 4A3JB 3FRPB 1BQQT 1JORA 3TBIB 1EFWA 1DZ1A 4CJ2C 1J9OA 2LY7A 5CGKA 3D31A 3FKIG 2ZXOA 1PTOC 4G7HC 1STGA 3G6EA 1XMOQ 1ZYRC 4XDXA 5LHY1 4HJ9A 1PH9A 3SDZA 3NSWA 1BBWA 4U68A 1MJEA 4F88A 1OXUA 2Q8RE 2OQKA 1HH2P 1CKNA 2B2TC 3AEVA 2F0UA 1QNKA 2EY6A 2L0CA 1KHIA 2CHBD 1EZ6A 1IW7D 4MZ9A 2UUBQ 3RZOH 4H0LC 1XMOL 4IALA 1HNXL 1P16A 1RL2A 3S14B 1VQHA 3CC2A 1IYUA 2R7DA 1XTCD 3S1NH 1SE2A 4BBSB 2XSCA 2AHOB 2F0LA 3CAMA 3OWEB 1XPUA 1N32L 2R7ZB 3GTOB 1NUCA 3PF5A 1PTOD 4G7OC 2Y0SB 1KDAA 3S2HH 2F0IA 5C4XH 3MEFA 3KDFA 2QEXA 3CD6A 1V43A 3JAMc 4IJLA 4KHVA 1MSGA 2NVYH 4N9TA 3BYTB 3J81L 2M2LA 1KRTA 1N36Q 5IODA 1I6HH 2KBNA 2WACA 1N9WA 2VW9A 4DFAA 3HOZB 3JAML 4OEMB 1SJHD 5C44H 3PO3B 2PI2E 4KN7C 4NXNL 1BBXC 4JI3Q 4A3MH 4DAPA 2Q2TA 2K50A 2KCMA 3H3VH 1HQMC 1VMCA 3EQLC 4OX9L 4RKBA 1GHKA 5FO7B 4Y7NH 2F0WA 4FXKC 3S24A 3EJIA 4QUFA 1JWUD 1MGSA 1X6OA 2B2TA 1G91A 3UDIA 5KNDA 1B1ZA 2XIWA 1H9SA 4JI3L 1U0LA 4L6TB 2EJFC 3NTIA 4KHPL 2K5DA 1A3VA 3OIQA 1C48A 1D5XC 3A7AB 5J3BA 3GTKB 3MXPA 4HIKA 1CSPA 3MAQA 1JC7A 3OSOA 1XMQL 3UDFA 2B2WC 1J5EL 1A63A 1QJOA 1F9PA 1QG7A 2ICIA 1ZKOA 4B3TQ 3K7UC 1X3QA 5CV9A 2EE1A 5CBAE 2F3VA 2KVMA 4OO1I 3V05A 2D2CC 4XQJA 2EYHA 1UE5A 4YCWA 4A3EG 1Q81C 2P5ZX 4C3IH 4G7ZC 4N8X1 5G3LF 3HGBA 1YNJD 4V0BA 3H15A 2E74C 3DEPA 2F0MA 4IUNA 3VYUA 3DM1A 4E6IA 3HOXB 1OTCA 4JI0L 4R4CA 4BWGB 5L37A 2GA4B 2K7VA 5M5XB 4JG2A 5JVH3 1VF7A 1SDFA 4LF7L 1L0WA 5JJIA 1OXSC 1K28A 3ITPA 3NWTA 4ZUIA 4DR4Q 1HZ9A 3A74A 4CHTB 4A3KB 1HPCA 1BR9A 5LL6X 1VQLA 1NBWA 1TT2A 3OW7A 4X6AH 1S5DD 1HUMA 3M7NA 1UEBA 1W2BA 1Q1BA 3MFGA 3VR3A 4C3JH 5FOBB 1EY6A 1Q8KA 5DEHA 3D8GA 1E2VA 1TKWB 1GHJA 3CPWA 4A3GB 3KF8A 1EYCA 1FYCA 1VQDA 1TIID 2OT2A 5CV4A 2B2WA 2E75C 2RA4A 4IUPA 4IO9A 1H95A 5C3XA 1GUGA 4EX5A 1QOHA 4A3IG 4JI6Q 1LABA 2CH4A 1L0YB 5FK9C 4JI2L 1B53A 1E24A 2JA8H 1MD2D 1U4PA 4GLAC 2R92G 4U673 1N34Q 1HNWL 5K36G 3Q23A 3R8BA 5IYBG 2B2VC 3LGJA 1E7ZA 4I65A 4KY7A 2LKVA 2EYFA 1VQOA 3T16A 3TZUA 4C3HB 3P1HA 1BKBA 3BG3A 4F7XA 1GUOA 2B2UC 2WKDA 1SYFA 2K04A 3EROA 4P2CB 4OL7A 2WB1B 3H94A 2VUMG 5J39A 2F0OA 2N55A 4DV6Q 4K5VA 3M4QA 3CC7A 1SE4A 2BA1A 2KCNA 1MBYA 5M3FB 2G9HD 3FPPA 3I3CA 3GTPH 3S1RH 4ZQ3A 2JA6G 3ND8A 1EIFA 4JBJA 3GD7A 4A3JG 4AQYQ 3SE0A 2HUGA 5E1FA 3A54A 1NJIC 5M5YB 3A8KE 2G5DA 4C2MB 2IW3A 5DAUA 3U9OA 2RVLA 1KNEA 2RF4A 1JWSD 1N8RC 4JVZA 1FNWA 2KHJA 1C8CA 1BCPF 1BF4A 3ONAB 1TWGB 1IHZA 2VB2X 3NWSA 1JWMD 1LT4D 2AUJD 1PDQA 2FINB 1A6XA 3UI2A 4K2LA 3CMAA 4FXGC 1FD7D 4BBSG 1EYGA 4HN7A 2R7ZG 1EWHA 1E3PA 1Q1EA 1VQGA 1A8VA 2SNSA 3EA6A 1EQRA 2Y0SG 2BE5C 3WOFA 3HOVB 2NTSA 3KLWA 1Q82C 3B6YA 3STBC 3CXCA 2B2UA 1NR4A 4DV1Q 1JJ2A 2XN9C 5GAEC 1R4QB 2C35B 4DV2Q 1SFOH 2Z0SA 1X3PA 1A62A 2Q2HA 1XYIA 3W1GA 2FFKB 3EBEA 4IZ8A 2FMCA 4JC0A 2E2IH 2JA7B 3HOZG 3D4DA 2A69D 1PRTF 3PO3G 1EY7A 2QEJC 2FHTA 4M8AA 5NUCA 1S4ZA 2DUDA 3GTQH 4GOPB 3M4YA 5IGEA 1Y1WB 2A73B 3STBD 4P73A 4IFDJ 1Y1VG 2WIIB 2IT1A 3FP9A 2MGSA 3QO2A 3I4NH 1EEFD 2UXBQ 5IWAQ 4DV4L 3H91A 1XNRQ 4OWXB 1ET9A 2K05A 2A74C 3PIPA 1KLUD 1G291 2ES2A 4B3MQ 3F2UA 3WWVA 1PH4A 5LMNW 2A68C 1F9SA 1CQFA 3A8JE 1PH2A 2NBFA 1V1PB 1JB3A 4YCUA 1O7YA 3KF6B 4LF9Q 3FKIH 1O78A 2HCCA 4NKLA 1PV4A 1XNRL 3K5OA 3OIPA 1B9NA 3J81E 1CA5A 1AZQA 1Y8NB 3HOWB 2DGYA 4IQZA 1I4PA 3NTHA 3IRBA 4JYAL 4L8JA 1CI3M 5I6WA 2A6ED 3JAME 3AMUA 3DWQA 2QILA 4JI5Q 1QB5D 4LF9L 1YI2A 2IPKD 4K8JA 5FLMG 2CQAA 2YTXA 3I8ZA 3M7GA 5EJWA 1D6EC 1FVIA 4CKEA 3BVGA 3M3YB 3CHBD 1MHWC 2ZXRA 4KY5A 2NVXB 3HOXG 2JK8A 1PA6A 3S15H 1T5EA 1LACA 3AB9A 2PNRC 3KLSX 5CMDA 4GKKQ 1RD9D 4X64Q 4KKSA 4A3KG 1KIXA 2OEOA 5IGFA 4CJ0B 4LJZC 1HZAA 2UU9Q 4C56C 3S1MB 2QF7A 3G6JB 3J7YW 4UY8C 1YNXA 3X3NA 1K73C 1Z7TA 1UUPA 5DNFA 3RN5A 3S2DB 1VF5C 3VDYA 1PFMA 4PMBA 4PQXA 4A3GG 1LTLA 2JA5B 4KLKA 2HDMA 4P75A 1TWFH 1HZCA 4HSVA 4DR1L 4RWSC 4BS9A 4ME3A 1SNDA 1I4HA 2PZWA 3K8AA 1X55A 3HOUB 4X3SA 3C3LA 3T1HQ 1J8IA 1GUNA 4HMIA 4A93B 2JP1A 1GUSA 4J8QA 1KQSA 4JCVE 4C3HG 1JE4A 4X3UA 3RMHA 1Y8OB 3W3AA 1YJNA 4DR3Q 2WB1G 3QIAA 3T1HL 4RKLA 1U9RA 1SNOA 1QVGA 1I6VC 5IP9G 1Q90A 3FDTA 4GOPA 4DV0L 1I50H 5M3FG 2E2JH 1GKHA 1EUJA 4XYQA 3VR6A 3E9IA 3NBIA 3PF4A 4LUVA 4IFDI 2HCIA 3VR4A 2G9DA 4LFAQ 1EL0A 5I9PA 4LFBQ 4OO1G 1DM0B 4A3EH 3H0GH 3HOYH 3W1BA 5CV6A 2DN8A 2J7ZA 1TU2B 1FNVA 2XVSA 1SE8A 1QNUA 1F9RA 1KRSA 1V1PA 2CH4W 1KD1C 3TDQA 4K0KL 4DUZL 2CW0C 4K8IA 4DV7L 1TWHH 1SNQA 4LFBL 1SMXA 4DK6C 2VY3A 1YBYA 4LNQA 1HR0Q 1HZBA 2H1EA 4OIJA 3VR2A 1VQ9A 3Q24A 4QMGA 2F0KA 3TP8A 4RGMA 3OWFA 3NELA 1WOCA 4JI1Q 1GVPA 3F1ZA 3OTOQ 1EY4A 4KV6A 2KHIA 2FXQA 3NHHA 4KK7A 1PTOH 5DM73 4NDXA 3HOVG 3A5ZB 3KJOA 4ILWA 4PNYA 1B3QA 3RR5A 3FEWX 1I94L 4FP5D 5K5PA 3NBHB 2K5NA 1SJED 1DGSA 1D1KA 2HD3A 4ZYSA 4FYDA 4X66L 1NMFA 1T9HA 3GTGB 4EQPA 4K5WA 4O42A 2JA7G 3P20A 2O5IC 4LF5L 3BU2A 4KD3A 1K8MA 4K5XA 4HSPA 2N88A 3S16B 4I7ZC 3BDCA 3GTMB 1EWIA 4JBWA 1Y1WG 1M90C 2L11A 5GAHC 4DAYB 4FF3A 4YWKA 2WAQB 5E4XA 1H9MA 2L55A 1PTOF 1QE6A 2HHHQ 3A8IE 1F2YA 1SEBD 3SK4A 1VQEA 2YYZA 4TRDA 5IYCG 2BDNA 4TQUS 1MKHA 4RG1A 2K1BA 4JI4L 1FJGQ 4XIGS 1LV9A 1LT6D 2KENA 2R6GA 4MHEA 2PMZB 5JEAH 2HHHL 1IW7C 3H3VI 3HKSA 1AP0A 1O7ZA 2JQOA 1RJTA 4DV3Q 1F2ZA 1HCZA 2KEDA 1WD1A 2JE6I 5IGCA 5C4JH 2ZXPA 2Z9HA 3CCQA 3HOWG 3CCLA 5C0XH 1Q7YC 3S1QH 3T13A 1K83H 4AYBE 4GN5A 3M9BA 3UE1A 3MWYW 5IGBA 1TVXA 3ND9A 2M00A 5BN3A 1WCMB 1JOQA 4A3FB 2R93H 3RZDB 1EU4A 2EYJA 1EQTA 3S14H 2WV6D 3TP5A 3TS0A 5EBDA 4IUVA 3J7ZC 4JI7Q 2LSSA 1CKOA 1CA6A 4P72A 4RHSA 1UAPA 1PH1A 3KUPA 5ELCA 4L5TA 5IGDA 2SEBD 2WFWA 3K7AH 1EYAA 4ZCKA 1JCKB 1LTGD 4QCLA 3MXNB 3U50C 1XPOA 4X62Q 4KMUC 2AUKA 3SK8A 3J7A5 4PZ7A 5CORA 2UUBL 3O13A 3AQQA 5FJ8G 1K8GA 1RODA 1L2FA 1JOKA 4YHHQ 1AFPA 1I4GA 3U4ZA 3KJPA 4HIOA 4R4IA 4NMZA 3RZOB 2NWGA 1TS3A 2K32A 2PQAA 2JA5G 2ID0A 1O7IA 1HA6A 3S1NB 2XNAC 2VXWA 2K75A 1EIYB 1RF2D 3X3MA 4DXFA 1YITA 1Y1VH 2LFNA 1I3QH 3K5NA 4BY1H 1CT1D 4BY7H 3HOUG 1RCVD 5FKAC 3S2HB 1VMPA 4LFCQ 1N36L 1TWCH 1IKMA 2YV5A 5D3IB 5C4XB 3U58A 4A93G 1O80A 4BBRH 4WJ4A 2NVYB 1B9MA 2ZM6Q 4JI8Q 4Y52H 4DN4M 1WJJA 1B50A 3GTKH 4R4TA 4KD4A 5JOBA 5KYIA 3QR8A 5M9OA 3SK5A 1I6HB 4LF6Q 2F0EA 3PGZA 1BO0A 3N6RA 2BA0A 3PQIA 1SNCA 2IX1A 5C44B 2JA9A 4L5SA 4P74A 4A3LG 1YNJC 1RTNA 1WTXA 2Q2IA 1T5XD 2XGTA 1ESRA 4HIMA 1A2TA 2K33A 1R4PB 4OONA 1UE1A 4DR5Q 1DCZA 1L1OB 2EPBA 4FO2A 4Y7NB 1X3GA 1JQYD 1PH8A 5FLXc 5JVG3 1X3EA 1GJXA 1WTOA 5LMUQ 4B3TL 3NUCA 3I4OA 4RA8A 1X56A 1XXGA 2E5LQ 2A1AA 4WORA 4PG3A 4A3DH 3VYTA 2IX0A 3AU7A 4A3KH 1W6JA 2NN6H 5KEEA 5HGTA 1TXYA 5E7NA 1EYDA 1HA5A 1SNPA 5LMUL 2IJ0A 3CCVA 4QUCA 2BOSA 2NB0A 1X32A 2DJFC 4TSSA 4WJWA 2EXZA 1NMGA 1FGUA 4C3IB 3D3RA 1EY8A 3BZKA 1IXRA 3MA2B 2MO1A 4LUOA 4RGTA 4YCVA 4DR4L 2EDGA 3EN2A 5C5MA 1ML0D 3CRLC 1AZPA 1UE6A 3D0FA 2CCZA 2RSOA 2WINB 2A8VA 1Q3LA 4OIKA 5AJ3Q 3F8TA 2HT1A 2N3SA 1RHPA 1NCVA 2ZJQA 1YHAA 3T1YQ 2PW7A 2E2HH 2NVTH 2WKCA 4C3JB 1PVOA 4IUTA 5ELFA 1FL0A 1K3RA 3C1FA 1GUTA 4NW2A 1S72A 1HQRD 2WAQG 3EVQA 1Q12A 1EQVA 1H9KA 4JI6L 3C46A 2EYLA 4CDCC 1DONA 5EPKA 1YNND 1HUNA 3W2DA 4L5RC 1N34L 2RDFA 3NP8A 2IY5B 5C4ZA 1KLGD 2K5HA 3NE5B 1BOSA 3FMCA 4LWCA 1B44D 2B63H 3I91A 2JA8B 1NTGA 3U9SA 3Q22A 5G3LD 4LF8Q 3TP6A 4OHJA 1OXTA 1H9JA 1E1TA 2F4VQ 4IFDG 4UP9A 5TSSA 3PIOA 4XT3B 1D8LA 1S5BD 4DV6L 1BCPB 2SNMA 1SMYC 5IP7G 1KAWA 3PUZA 4PZ6A 1C7YA 1PYBA 3GV6A 3CCUA 2B2YC 4EQOA 3QOLA 3VA5A 4YY3Q 1E2WA 1PZID 2PQEA 1X3FA 3L2PA 1M8AA 1WCMG 4DUYQ 4A3FG 4B9XA 3C2PA 4DR7Q 4AQYL 4G4KA 4A3CG 3C1EA 3KK7A 2DY7A 1A0IA 2LMCB 4DNTB 3CQZH 1L1OA 2SDFA 3HKZE 4MTKA 3GTPB 1V9PA 1CHQD 3S1RB 4POGA 4JV5Q 2I0QA 2VZAA 3HFZB 3VA7A 2H5XA 1QUQB 4GLVB 4JPBW 1BNZA 2K6AA 1SNMA 5JPMC 2UUAQ 2A69C 2M9VA 5KYLA 4A4IA 4HAEA 1SMYD 3ER0A 1LYLA 4PMWA 2O2LD 2B8GA 4IUQA 1YIJA 5EPJA 4ZUJA 5M3MH 2KA7A 4JV5L 2HIVA 3UE0A 2N78A 1G8ZD 1EY9A 1NSNS 1P8LA 4HTHA 1Y14B 4GKJQ 4ODGA 4J1MA 1I4QA 1EIGA 2CFMA 1PH3A 2J0TD 2DY8A 4ABNA 1XWEA 3PO2H 4H7BA 3TN2A 3P75A 4BXXH 1B70B 2NZOA 4K6LA 3EIVA 1KAAA 2XRSD 5JAVA 1MIUA 4DK0A 4DR6Q 1STNA 4DV1L 1F2LA 4RCOA 3IFDA 5LL6S 4BA2I 3K59A 1Y8PB 2QGQA 2EY1A 5IYDH 1OXVA 4K2KA 1TS5A 4DV2L 2UUCQ 3CKIB 1A3TA 1ZXTA 1KC8C 2VB3X 2B2YA 5IYCH 2AMCB 4A3BH 2KOLA 2YTYA 4XQQA 4QIWE 5EPLA 5J22A 2A6EC 1SFOB 3GTLH 5C3EH 5JJLA 3VR5A 2HQLA 5BR8Q 3SEBA 3NXWA 2E76C 1X54A 3AFQA 2E2IB 3KLRA 4GNXB 2E2DC 3DM3A 5C44G 4OWWB 4HCEA 1STBA 2CQOA 3K80C 3K81C 5ELOA 4G57A 3GTQB 1BCPD 3I73A 2UXBL 5IWAL 5E4WC 1GUWA 1XNQQ 1D1IA 3DXJC 4B3ML 3VYSA 2Q2UA 3DWAA 1WI5A 1AEXA 4O1NA 3CCEA 3I4NB 3MVVA 2XTIA 4DK1A 3S17H 3R3OA 2MPMA 3QJYA 4IPHA 4LAAA 3RLFA 1NY4A 2QDBA 3MEHA 2VNUD 2QW7A 2Z4IA 1U4MA 5DLQE 1HRJA 4IOCA 4GS3A 4EQ5A 2O5JC 1SROA 1OXXK 1XPRA 3FKIB 2UXCQ 1MSHA 2EXDA 5KNBA 2MJ8A 4JI5L 1PH6A 4GOPC 4RAUC 1PMRA 1S5FD 3D4RA 2Z8LA 5COYA 2PZTA 3TEHB 1HNZQ 3J7AV 2L5TA 4HIDA 3G71A 1VQIA 1LTID 4C3IG 3GQBA 4GKKL 4X64L 1PZJD 2DJGC 1W3SA 4QL5A 1B3AA 4B3RQ 1VQCA 2MNAA 1KL9A 5FO8B 2UU9L 4X3TA 1WTHA 4MNOA 2VQFQ 2JJQA 1G51A 1Y69U 4RGOS 3OPOA 1GXDC 3MZ5A 4J15A 1IYVA 1K0RA 1LTTD 5IT9c 3M4OH 3PUWA 4C3JG 3WDNA 3QB3A 1JE5A 2IHEA 3RUZA 3OOCA 2K14A 1VQ8A 3W5OA 2WP8J 1D7QA 5IT9L 2K5VA 2K28A 3T51B 3TP7A 1TWFB 1CUKA 1HJPA 3I4MB 1SAPA 4HJ8A 3E0EA 3PCOB 1DYQA 1LLRD 3PIP3 5EKIA 4TVAB 2N8NA 3V2TA 3FHWA 2JA8G 5HGQA 1WTQA 3Q0AA 1IBLQ 2PI2A 2ATWA 2R3ZA 2TMPA 1UWVA 4V190 3T56B 4OELB 4DR3L 2GVAA 1CSQA 3NTKA 5HURA 4NXMQ 1BVSA 1E0BA 3CF5A 2K5WA 2KJXA 5KIXA 1SBBB 3R2TA 1IBLL 5J1ZA 3HS0C 1CKMA 1CKNB 4C1NI 2L12A 1VQ4A 1TWAH 3KF6A 4LFAL 3A0JA 1UEAB 2OCEA 2ZJRA 2V1CC 1I50B 5T1IA 1QCBD 1WTRA 3K58A 2JSOA 2PZUA 2KEEA 4ZKBB 2AQ3B 3ZJYC 5CC4A 2D0PA 1G6ZA 3ULLA 3K0YA 4H44C 2IHFA 4PMCA 3HKZB 3M4PA 1I5FA 3H0GB 3T4AC 3TRZA 4LF4Q 3HOYB 5C0XI 4KKUA 1SYGA 1R9TH 3QOJA 3SGIA 3GTJB 1HR0L 3IAYA 1QILA 1VQBA 1TQOA 3R2IA 2R7FA 3KDFB 1VQ6A 1SYBA 3TQYA 1NAPA 2JYOA 3PSIA 2XWJB 3A55A 2NVQH 1TWHB 4JI1L 1LTBD 4A3IH 4FF1A 4NP5A 3OTOL 4DF7A 2NUCA 1KDBA 4YWLA 2YU9H 1DXMA 2X6LA 2R92H 4L63B 5K36H 4FXDA 4CGYB 5CV8A 2LXJA 4QB4A 5IYBH 1IBKQ 3UDXA 1X9NA 3I90A 1PTOB 1EWCA 3CU7A 1LUZA 5ELNA 2ICEC 2V4DA 5M5WH 3BVZA 3SVMA 2EJGC 2VUMH 4APVA 4GZYC 4CDDC 4X65Q 3P7JA 3LX0A 5LMNQ 1BBUA 1KXLA 1H9SB 4JK1C 4RHRA 2K4KA 1TS4A 1V1QA 2UXDQ 4DR2Q 3ULPA 1Q86C 2Q8TA 3SR1A 1WVLA 2JA6H 2CWAA 3L9AX 4A3JH 1O7LA 3ICEA 2WB1E 1KDCA 3CC4A 2KUMA 5LMNL 1YVCA 4MTNA 4ALPA 3OMGA 2QA4A 1HFNA 4M1UB 3IL8A 1VDZA 4DPGA 2A5HA 2EVBA 2QKIC 1MI2A 3F2BA 1FNUA 1ENFA 3PMFA 2ASBA 4LMQD 1FJGL 1CQVA 5DM63 3RZDH 1CTMA 5KNCA 1GOZA 4A3CH 1ESFA 3I4NG 4WRDA 4DNIA 4Z9CB 1B8AA 2GVBA 5EQ0A 1EOTA 4DV3L 3OYYA 1YEZA 5I9OA 4N9PA 1PH7A 1U5KA 1PHJA 4BBSH 4DAVA 3PV0A 2R7ZH 3GTOH 4FF2A 5C4JB 1HNXQ 4OGQC 5ELEA 2ZT9C 4ULLA 2FJ2A 2K5QA 1PYWD 1CFMA 5KGUA 3E9HA 3S1QB 4KTAA 1RKNA 1N32Q 1K83B 5IIFA 1ILPA 2L15A 1G2SA 4R9WA 1W6KA 3KYHC 3PUYA 3K5MA 1WYDA 2I5HA 2ZTDA 1B7YB 3RN2A 1D5ZC 4JI7L 1J6QA 2R93B 3L3OC 3KF8B 1GM5A 1QVFA 5C3WA 4JBMA 3HOZH 5ELBA 4X3KA 3PO3H 1NE3A 2NN6I 2EIFA 4X62L 2AWNA 3J81c 3CMEA 1IKLA 5D3DA 1YJWA 1EFID 1IYJB 2D9UA 1ZYRD 4F87A 1BXTA 3NQTA 3K7AB 1K0SA 1S5CD 2KHSA 4NXNQ 2RHSB 2CWPA 4YHHL 1VQAA 1VS0A 1VQ5A 1CM9A 3NBHA 3ERSX 2QCPX 3E6ZX 4OX9Q 4POFA 1B2TA 4IPDA 5FO9B 4LUZA 3J80c 4J6HA 2RCNA 5F2DA 1G2TA 1PYSB 5BN5A 3ULJA 2RHQB 3LWUA 4LFCL 1IL8A 3A56A 1SYCA 5CV5A 2AQ1B 1UE7A 4R1JA 3I4MG 1C9OA 4KHPQ 2O4XA 2GN5A 3J80L 1Y1VB 3D6CA 2ZM6L 5EKLA 1I3QB 3K0XA 4JI8L 4BY1B 4KKTA 4A3MB 2ZJPA 1XMQQ 1J5EQ 4BY7B 1FR3A 3ZYYX 4DAYA 3BZCA 1TWCB 2NZHA 1DOLA 4FNFA 2F3WA 4DNRB 3PUVA 4BBRB 1VQPA 4LF6L 5FLMH 3DHQA 4NPSA 5H1SE 2EY2A 3F2CA 1I4RA 2XWBB 1K9MC 2F0JA 2I5MX 2N49A 2AWOA 2OXPA 4DR5L 3HOXH 4DU9A 2BH8A 4RCNA 1GO3E 2IL8A 3HG9A 4R8IA 2RBMA 3KBXA 5FLXL 2EYPA 5M5XH 4R4QA 2BCOA 1EY5A 5GADC 4MIUA 3MC0B 4H13C 4JI0Q 1KTKA 1U4LA 4CKCA 2Z6BA 4PZ8A 4ZKCB 2NYZD 5IT9E 4LF7Q 1F2MA 3HKZG 3H0GG 5IGGA 4B9WA 2F0PA 3HOYG 1SR3A 4MN3A 3NQIA 3OMCA 2E5LL 3URYA 2XRQD 1VCIA 4ZRZA 4A3GH 3L0OA 4IJHA 1DJRD 3E5SA 2Q8IB 2RQXA 4UPAA 2KCCA 3NK9A 4HJAA 1RTOA 4A3DB 5I2YA 1YNNC 3H6MA 4CBVA 3J81i 5GROA 2PW5A 3H3VC 1JJCB 3CCSA 1X65A 1L1OC 2LXKA 3GP7A 1XJVA 1Z47A 3MXNA 1F9QA 2B39A 3JAMi 4CJ1B 4ZLTF 4QGUA 4H02A 1LT5D 4C3HH 4UP8A 4JI2Q 3CPFA 2OWOA 1MJCA 2D0OA 5HY6A 3J80i 3TREA 3I72A 5AJ3L 1K8AC 4LW1A 1VQKA 1Q46A 1IL2A 5IP9H 3D4WA 3BYYB 3SHLA 3T1YL 5M3FH 1DOKA 2BDOA 5E3FA 4B08A 4OWTB 1DOMA 4GLXA 5I6YA 3F2DA 1HXYD 3K57A 1ZEQX 5BN4A 1SN8A 4OO1H 1L0XB 4AH6A 2NVTB 2E2HB 4KJOA 3SXHA 3FVQA 4OXPA 5M5YH 5EGTA 1U4RA 3RD4A 4C2MH 5A2QL 1RIPA 4F8MA 2D5DA 4FVMA 1NNXA 3HZXA 1M4VA 2MQHA 4UHVA 1E2ZA 3MFYA 1C0AA 4UDUC 1TWGH 1TS2A 4HCSA 2Z1CA 3I70A 2A19A 4LF8L 2F1MA 2K52A 1LT3D 2F0FA 2F4VL 2D62A 1WTPA 1QVCA 2VL6A 2B63B 3G7LA 2JEAI 4JBKA 4AYBB 2F0NA 1WD0A 3WOEA 4KJNA 1VQJA 1ENCA 5EAYA 2KQ3A 5JEAG 1QWYA 4XTCS 2X69A 3JC66 4HR7B 4DAMA 3GV3A 4YY3L 1HTPA 3HOVH 2DNCA 2L9HA 4DUYL 2H4OA 4DR7L 2B3GA 4O0AA 1CHPD 5C0XG 3SK6A 3A5UA 1EY0A 1ENAA 2B8FA 2JEBI 4JW0A 3BDLA 1PLFA 4R8NA 2I5LX 1YHBA 3Q8DA 2Z4HA 2R93G 4IN3A 3BJUA 2UUAL 4KN4C 3CQZB 3OHXC 4IURA 2JA7H 1PRTB 3DEOA 1HR0W 1UNSA 4HJ7A 2B2VA 2K03A 1PFBA 4C1NK 5GAGC 2EJMA 2X6GA 4A75A 2IX3A 1VQ7A 1Z9FA 1VQNA 2AQ2B 3TS2A 2L1BA 3J81j 1JJGA 1EOVA 3IKJA 4P71A 1Y1WH 1IBMQ 1DD2A 3PUXA 4EQNA 4GKJL 4FDBA 5D65A 1BCPC 1I4XA 2F0SA 1KNAA 3E0JA 2FMMA 1K3BC 5M3MB 5C4XG 2VS1A 2EYMA 1K8OA 4DXGA 1CZWA 4DR6L 2K01A 4YIJA 2OTJA 1IBML 1ILQA 3PO2B 1LTRD 1JICA 2UUCL 2WAQE 4DV4Q 2YTVA 3CCRA 2F4IA 2B29A 2E8GA 2BE5D 5IE8A 1KABA 5C6AA 1JR0D 3CP0A 1ASZA 1Z6HA 2F3IA 3HOWH 3KFUA 1HNWQ 4BY1G 5JEAJ 4A3MG 4BY7G 1GD7A 2F0TA 2Z6KC 5CYUA 1ET6A 4RGNA 5BR8L 3FPUB 4UP7A 1S5ED 3MXGA 2EOTA 2JXMB 1ICWA 2ALYB 4NB3A 1AN8A 4A3BB 4RFBA 4BBRG 1WTVA 2L4NA 2PMZE 4RH6A 5C0XJ 1XX8A 3GTLB 4JYAQ 5C3EB 2AKWB 3PIO3 2CVRA 1PRTC
chains in the Genus database with same CATH topology
1V8QA 5EBCA 5KRUA 2C5CA 2HDLA 3BS1A 3MTSA 3HEJA 2NTTA 4KHZA 2NZ1D 2EYOA 3CRKC 4CKBA 2C9OA 5ELDA 3R93A 2F0DA 4HEDA 2IWHA 3QG1A 1A3UA 1AW7A 2F0HA 3H09A 3QWNA 2A68D 2HQEA 3GO5A 4FF4A 1PXUA 4KI0A 1H9RA 3J80E 3S17B 1PRTD 3HP3A 4XYOA 3M85A 1OO9B 5C5LA 3NPPA 3TZDA 1RDPD 1EZ8A 3DMUA 1PFNA 2KECA 2OF1A 4PV1C 3S15B 2NN6G 1II3A 1CK1A 4Q0FA 5CR3A 5ISRA 1TY2A 1D2BA 2J4XA 5FLXE 3S9WA 1CZGA 1LTAD 3DWPA 1EEID 3MXUA 5CV7A 1D5MC 2F0VA 1Q8IA 3IFTA 4BA1I 4K14A 2LS01 3LWEA 1SE3A 2EY5A 3VYRA 5JPNC 5CBEE 3LNNA 5I2XA 4ME5A 4QF4A 4KY6A 1F77A 2MUYA 3M4OB 3I4LA 2PYKA 1ONLA 3N52A 2PO4A 3BVMA 2PPBC 3TMEA 3A7LA 2I07B 1HFGA 4ZAIA 1SYDA 1HHVA 1BUVT 1FGBD 1STYA 4EVOA 1A15A 4TKOB 2E2JB 1SYEA 4K6DA 2A6HC 1A2UA 3J7AF 1STHA 4DGZA 5I4DA 3K6OA 2F03A 4A3EB 3KLSA 1EIHA 1SXTA 2F0GA 4LK1C 1SSOA 5EKKA 4ID6A 1HTLD 2EZVA 3K5LA 1TWAB 3KBGA 5A2QE 5C4HA 2A6HD 2RDGA 3TSSA 5AFWA 4XQNA 4EGVA 1TR5A 2TSSA 5A35A 1R9TB 2F0QA 1BDOA 2CW0D 2DNEA 5T1GA 3BDOA 3Q6SA 5D14A 2MP1A 3BZDB 2NVQB 1STEA 4Q5VA 4A3IB 2YU9B 3D6WA 2R92B 4XT1B 4IUUA 1B4OA 4QIWB 1C4QA 4IFDH 1NR2A 5IOCA 5JJZA 3L7ZC 1V1OA 1WTWA 1JOOA 1PZKD 2I46A 1STAA 2RSNA 1TY0A 5M5WB 4WFN3 1LTSD 3T53B 2VUMB 1EU3A 4HMJA 3HRZC 2MHVA 4DA2A 3DUZA 3EFXD 3ERQA 4ZK9B 2SOBA 1LO5D 2RDHA 4S3SA 3MHBA 2R61A 2JA6B 4XXEA 2ENBA 4UAIA 2RKSA 3V96A 2PCFB 4A3JB 3FRPB 1BQQT 1JORA 3TBIB 1DZ1A 4CJ2C 1J9OA 2LY7A 5CGKA 3D31A 2ZXOA 1PTOC 4G7HC 1STGA 1ZYRC 4XDXA 5LHY1 3SDZA 3NSWA 4U68A 4F88A 1OXUA 2Q8RE 2B2TC 2F0UA 1QNKA 2EY6A 2L0CA 2CHBD 1EZ6A 1IW7D 4H0LC 4IALA 3S14B 1IYUA 1XTCD 4BBSB 1SE2A 2XSCA 2F0LA 2R7ZB 3OWEB 3GTOB 1NUCA 1PTOD 4G7OC 2Y0SB 1KDAA 2F0IA 1V43A 4KHVA 1MSGA 4N9TA 3BYTB 3J81L 2M2LA 5IODA 2WACA 4DFAA 3HOZB 3JAML 1SJHD 3PO3B 4KN7C 1BBXC 4DAPA 1HQMC 1VMCA 3EQLC 4RKBA 1GHKA 5FO7B 2F0WA 4FXKC 3EJIA 4QUFA 1JWUD 1MGSA 2B2TA 1G91A 5KNDA 1B1ZA 2XIWA 1H9SA 4L6TB 2EJFC 3NTIA 2K5DA 1A3VA 3OIQA 1C48A 1D5XC 3A7AB 3GTKB 3MXPA 3MAQA 1JC7A 3OSOA 2B2WC 1QJOA 1F9PA 1QG7A 2ICIA 1ZKOA 1X3QA 5CV9A 2EE1A 5CBAE 2F3VA 2KVMA 4OO1I 3V05A 2D2CC 4XQJA 2EYHA 4G7ZC 5G3LF 3HGBA 1YNJD 4V0BA 2E74C 3DEPA 2F0MA 4IUNA 3VYUA 3DM1A 4E6IA 3HOXB 4BWGB 2GA4B 2K7VA 5M5XB 5JVH3 1VF7A 1SDFA 1OXSC 3ITPA 3NWTA 4ZUIA 4CHTB 4A3KB 1HPCA 1BR9A 5LL6X 1TT2A 3OW7A 1S5DD 1HUMA 3M7NA 1Q1BA 3MFGA 3VR3A 5FOBB 1EY6A 5DEHA 3D8GA 1E2VA 1TKWB 1GHJA 4A3GB 3KF8A 1EYCA 1FYCA 1TIID 2OT2A 5CV4A 2B2WA 2E75C 2RA4A 4IUPA 5C3XA 1GUGA 1QOHA 1LABA 1L0YB 5FK9C 1B53A 1MD2D 1U4PA 4U673 5K36G 3Q23A 3R8BA 2B2VC 4I65A 4KY7A 2LKVA 2EYFA 3T16A 3TZUA 4C3HB 3P1HA 3BG3A 4F7XA 1GUOA 2B2UC 2WKDA 1SYFA 2K04A 3EROA 4P2CB 4OL7A 2WB1B 3H94A 5J39A 2F0OA 2N55A 4K5VA 1SE4A 2BA1A 2KCNA 1MBYA 5M3FB 2G9HD 3FPPA 3I3CA 4ZQ3A 3ND8A 3GD7A 3SE0A 2HUGA 5E1FA 3A54A 5M5YB 3A8KE 4C2MB 2IW3A 5DAUA 3U9OA 2RVLA 1KNEA 1JWSD 1FNWA 1C8CA 1BCPF 1BF4A 3ONAB 1TWGB 1IHZA 2VB2X 3NWSA 1JWMD 1LT4D 2AUJD 1PDQA 2FINB 1A6XA 3UI2A 4K2LA 4FXGC 1FD7D 4HN7A 1EWHA 1Q1EA 2SNSA 3EA6A 3HOVB 2BE5C 3WOFA 2NTSA 2B2UA 1NR4A 2XN9C 1R4QB 1X3PA 1XYIA 2FFKB 4IZ8A 2FMCA 2JA7B 3D4DA 2A69D 1PRTF 1EY7A 2QEJC 2FHTA 4M8AA 5NUCA 1S4ZA 3M4YA 5IGEA 1Y1WB 2A73B 4IFDJ 2WIIB 2IT1A 2MGSA 3QO2A 1EEFD 3H91A 1ET9A 2K05A 2A74C 1KLUD 1G291 3F2UA 2A68C 1F9SA 1CQFA 3A8JE 2NBFA 1V1PB 1JB3A 1O7YA 1O78A 2HCCA 4NKLA 3K5OA 3OIPA 1B9NA 3J81E 1CA5A 1AZQA 1Y8NB 3HOWB 4IQZA 1I4PA 3NTHA 4L8JA 1CI3M 5I6WA 2A6ED 3JAME 3AMUA 3DWQA 2QILA 1QB5D 2IPKD 4K8JA 2CQAA 3I8ZA 3M7GA 5EJWA 1D6EC 4CKEA 3BVGA 3M3YB 3CHBD 2ZXRA 4KY5A 2NVXB 1T5EA 1LACA 3AB9A 2PNRC 3KLSX 5CMDA 1RD9D 4KKSA 2OEOA 5IGFA 4CJ0B 4LJZC 4C56C 3S1MB 2QF7A 3G6JB 3J7YW 3X3NA 1Z7TA 1UUPA 5DNFA 3S2DB 1VF5C 1PFMA 4PMBA 4PQXA 2JA5B 2HDMA 4HSVA 4RWSC 4BS9A 1SNDA 1I4HA 2PZWA 3HOUB 4X3SA 3C3LA 1J8IA 1GUNA 4HMIA 4A93B 2JP1A 1GUSA 4J8QA 4C3HG 1JE4A 4X3UA 3RMHA 1Y8OB 3W3AA 3QIAA 4RKLA 1U9RA 1SNOA 1I6VC 1Q90A 3FDTA 4XYQA 3VR6A 3NBIA 4IFDI 2HCIA 3VR4A 2G9DA 1EL0A 5I9PA 4OO1G 1DM0B 5CV6A 2DN8A 2J7ZA 1TU2B 1FNVA 2XVSA 1QNUA 1F9RA 1V1PA 3TDQA 2CW0C 4K8IA 1SNQA 2H1EA 4OIJA 3VR2A 3Q24A 4QMGA 2F0KA 3TP8A 4RGMA 3OWFA 1EY4A 4KV6A 3NHHA 4KK7A 1PTOH 5DM73 4NDXA 4ILWA 4PNYA 3FEWX 4FP5D 5K5PA 4ZYSA 1SJED 4FYDA 1D1KA 3GTGB 4EQPA 4K5WA 4O42A 3P20A 2O5IC 4KD3A 1K8MA 4K5XA 4HSPA 2N88A 3S16B 4I7ZC 3BDCA 3GTMB 4JBWA 2L11A 4FF3A 2WAQB 5E4XA 1H9MA 2L55A 1PTOF 1QE6A 3A8IE 1F2YA 1SEBD 3SK4A 2YYZA 4TRDA 2BDNA 4TQUS 2K1BA 4XIGS 1LV9A 1LT6D 2R6GA 4MHEA 2PMZB 5JEAH 1IW7C 1AP0A 1O7ZA 1RJTA 1F2ZA 1HCZA 2KEDA 1WD1A 2JE6I 5IGCA 2ZXPA 5C0XH 3T13A 5IGBA 3MWYW 1TVXA 3ND9A 2M00A 5BN3A 1WCMB 1JOQA 4A3FB 3RZDB 1EU4A 2EYJA 1EQTA 2WV6D 3TP5A 5EBDA 4IUVA 1CA6A 4RHSA 1UAPA 3KUPA 5ELCA 5IGDA 2SEBD 1EYAA 1JCKB 1LTGD 4QCLA 4KMUC 2AUKA 3SK8A 5CORA 3O13A 1RODA 1JOKA 1AFPA 1I4GA 4NMZA 3RZOB 2NWGA 1TS3A 2K32A 2ID0A 1HA6A 3S1NB 2XNAC 2VXWA 1RF2D 3X3MA 4DXFA 2LFNA 3K5NA 1CT1D 1RCVD 5FKAC 3S2HB 1VMPA 1IKMA 5D3IB 5C4XB 1O80A 2NVYB 1B9MA 4DN4M 1B50A 4KD4A 5JOBA 5KYIA 5M9OA 3SK5A 1I6HB 2F0EA 1BO0A 3N6RA 2BA0A 2IX1A 1SNCA 5C44B 1YNJC 1RTNA 1WTXA 1T5XD 1ESRA 1A2TA 2K33A 1R4PB 1DCZA 2EPBA 4FO2A 4Y7NB 1JQYD 5JVG3 1GJXA 1WTOA 3NUCA 4RA8A 1XXGA 4WORA 3VYTA 2IX0A 3AU7A 1W6JA 2NN6H 5KEEA 5HGTA 1EYDA 1HA5A 1SNPA 2IJ0A 4QUCA 2BOSA 2NB0A 1X32A 4TSSA 4WJWA 2EXZA 4C3IB 3D3RA 1EY8A 3MA2B 4RGTA 2EDGA 5C5MA 1ML0D 3CRLC 1AZPA 2RSOA 2WINB 1Q3LA 4OIKA 1RHPA 1NCVA 2PW7A 2WKCA 4C3JB 4IUTA 5ELFA 3C1FA 1GUTA 4NW2A 1HQRD 3EVQA 1Q12A 1EQVA 1H9KA 3C46A 2EYLA 1DONA 5EPKA 1YNND 1HUNA 3W2DA 2RDFA 3NP8A 5C4ZA 1KLGD 3NE5B 1BOSA 3FMCA 1B44D 3I91A 2JA8B 3U9SA 3Q22A 5G3LD 3TP6A 4OHJA 1OXTA 1H9JA 4IFDG 5TSSA 4XT3B 1S5BD 1BCPB 2SNMA 1SMYC 3PUZA 3GV6A 2B2YC 4EQOA 3QOLA 3VA5A 1E2WA 1PZID 2PQEA 1M8AA 3C2PA 4B9XA 4G4KA 3C1EA 3KK7A 2DY7A 2LMCB 4DNTB 2SDFA 3GTPB 3S1RB 1CHQD 3VA7A 1BNZA 2K6AA 1SNMA 5JPMC 2A69C 2M9VA 5KYLA 4HAEA 1SMYD 4PMWA 2O2LD 2B8GA 4IUQA 5EPJA 4ZUJA 2KA7A 1G8ZD 1EY9A 1NSNS 4HTHA 4ODGA 4J1MA 1I4QA 1EIGA 2J0TD 2DY8A 4ABNA 1XWEA 4H7BA 3TN2A 3P75A 4K6LA 1KAAA 2XRSD 5JAVA 4DK0A 1STNA 1F2LA 4RCOA 3IFDA 5LL6S 4BA2I 3K59A 1Y8PB 2EY1A 1OXVA 4K2KA 1TS5A 3CKIB 1A3TA 1ZXTA 2VB3X 2B2YA 2KOLA 4XQQA 5J22A 5EPLA 2A6EC 1SFOB 3VR5A 3SEBA 3NXWA 2E76C 2E2IB 3KLRA 2E2DC 4HCEA 1STBA 4G57A 3GTQB 1BCPD 3I73A 5E4WC 1GUWA 1D1IA 3DXJC 3VYSA 3DWAA 1AEXA 4O1NA 3I4NB 3MVVA 4DK1A 3R3OA 2MPMA 3QJYA 4LAAA 3RLFA 2VNUD 2QDBA 3MEHA 2Z4IA 1U4MA 1HRJA 2O5JC 1OXXK 3FKIB 1MSHA 5KNBA 2MJ8A 4RAUC 1PMRA 1S5FD 3D4RA 2Z8LA 5COYA 2PZTA 3J7AV 2L5TA 1LTID 4C3IG 3GQBA 1PZJD 1B3AA 5FO8B 4X3TA 1Y69U 4RGOS 3OPOA 1GXDC 3MZ5A 1IYVA 1LTTD 3PUWA 4C3JG 3WDNA 3QB3A 3RUZA 3OOCA 2WP8J 5IT9L 2K28A 3T51B 3TP7A 1TWFB 3I4MB 1SAPA 1DYQA 1LLRD 3PIP3 5EKIA 3V2TA 1WTQA 3Q0AA 2R3ZA 2TMPA 4V190 3T56B 3NTKA 5HURA 1E0BA 2K5WA 2KJXA 5KIXA 1SBBB 3R2TA 5J1ZA 3HS0C 4C1NI 2L12A 1UEAB 1I50B 5T1IA 1QCBD 1WTRA 3K58A 2JSOA 2PZUA 2KEEA 4ZKBB 2AQ3B 5CC4A 1G6ZA 3K0YA 4H44C 4PMCA 3HKZB 3H0GB 3T4AC 3HOYB 5C0XI 4KKUA 1SYGA 3QOJA 3GTJB 3IAYA 1QILA 1TQOA 3R2IA 1SYBA 1NAPA 2JYOA 2XWJB 3A55A 1TWHB 1LTBD 4FF1A 4NP5A 4DF7A 2NUCA 1KDBA 1DXMA 2X6LA 4L63B 5K36H 4FXDA 4CGYB 5CV8A 4QB4A 3I90A 1PTOB 1EWCA 3CU7A 2ICEC 2V4DA 3BVZA 3SVMA 2EJGC 4GZYC 3P7JA 3LX0A 1H9SB 4JK1C 4RHRA 1TS4A 2Q8TA 3SR1A 1WVLA 3L9AX 1O7LA 1KDCA 2KUMA 3OMGA 1HFNA 4M1UB 3IL8A 1VDZA 2A5HA 2EVBA 2QKIC 1MI2A 1FNUA 1ENFA 3PMFA 4LMQD 1CQVA 5DM63 1CTMA 5KNCA 1GOZA 1ESFA 4WRDA 4Z9CB 5EQ0A 1EOTA 5I9OA 4N9PA 4DAVA 3PV0A 4FF2A 5C4JB 4OGQC 5ELEA 2ZT9C 4ULLA 2FJ2A 2K5QA 1PYWD 1CFMA 5KGUA 3S1QB 4KTAA 1RKNA 1K83B 5IIFA 1ILPA 4R9WA 1G2SA 1W6KA 3K5MA 3PUYA 1D5ZC 2R93B 3L3OC 5C3WA 5ELBA 4X3KA 2NN6I 2AWNA 1IKLA 5D3DA 1EFID 2D9UA 1ZYRD 4F87A 1BXTA 3NQTA 3K7AB 1S5CD 2KHSA 1CM9A 3NBHA 2QCPX 3E6ZX 1B2TA 5FO9B 4J6HA 5F2DA 1G2TA 5BN5A 3LWUA 1IL8A 3A56A 1SYCA 5CV5A 2AQ1B 2O4XA 3J80L 1Y1VB 3D6CA 5EKLA 1I3QB 4BY1B 4KKTA 4A3MB 4BY7B 1FR3A 3ZYYX 4DAYA 1TWCB 1DOLA 4FNFA 2F3WA 4DNRB 3PUVA 4BBRB 3DHQA 2EY2A 1I4RA 2XWBB 2F0JA 2AWOA 2OXPA 4DU9A 4RCNA 2IL8A 3HG9A 4R8IA 2RBMA 3KBXA 5FLXL 2EYPA 2BCOA 1EY5A 4MIUA 3MC0B 4H13C 1KTKA 1U4LA 4CKCA 4ZKCB 2NYZD 5IT9E 1F2MA 5IGGA 4B9WA 2F0PA 4MN3A 3NQIA 3OMCA 3URYA 2XRQD 1VCIA 4ZRZA 1DJRD 3E5SA 2Q8IB 2RQXA 2KCCA 3NK9A 1RTOA 4A3DB 5I2YA 1YNNC 3H6MA 4CBVA 2PW5A 3H3VC 3GP7A 1Z47A 3MXNA 1F9QA 2B39A 4CJ1B 4ZLTF 1LT5D 3I72A 3D4WA 3BYYB 3SHLA 1DOKA 2BDOA 5E3FA 4B08A 1DOMA 5I6YA 1HXYD 3K57A 1ZEQX 5BN4A 4OO1H 1L0XB 2NVTB 2E2HB 4KJOA 3SXHA 3FVQA 5EGTA 1U4RA 3RD4A 5A2QL 4F8MA 2D5DA 4FVMA 3HZXA 1M4VA 1E2ZA 3MFYA 4UDUC 1TS2A 4HCSA 2Z1CA 3I70A 2F1MA 1LT3D 2F0FA 2D62A 1WTPA 2B63B 3G7LA 2JEAI 4AYBB 2F0NA 1WD0A 3WOEA 4KJNA 5JEAG 1ENCA 2KQ3A 1QWYA 4XTCS 2X69A 4HR7B 3GV3A 1HTPA 2DNCA 2L9HA 2H4OA 1CHPD 5C0XG 3SK6A 1EY0A 1ENAA 2B8FA 2JEBI 3BDLA 1PLFA 4R8NA 2Z4HA 4IN3A 4KN4C 3CQZB 3OHXC 4IURA 1PRTB 3DEOA 1UNSA 2B2VA 2K03A 1PFBA 4C1NK 2EJMA 2X6GA 2IX3A 2AQ2B 2L1BA 3IKJA 1DD2A 3PUXA 4EQNA 5D65A 1BCPC 1I4XA 2F0SA 1KNAA 3E0JA 2FMMA 5M3MB 2EYMA 1K8OA 4DXGA 1CZWA 2K01A 4YIJA 1ILQA 3PO2B 1LTRD 1JICA 2F4IA 2BE5D 1KABA 5C6AA 1JR0D 1Z6HA 5JEAJ 2F0TA 5CYUA 1ET6A 4RGNA 3FPUB 1S5ED 3MXGA 2EOTA 2JXMB 1ICWA 1AN8A 4A3BB 4RFBA 1WTVA 2L4NA 4RH6A 5C0XJ 1XX8A 3GTLB 5C3EB 3PIO3 2CVRA 1PRTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9V A;  5I2X A;  5I2Y A;  2I46 A; 
#chains in the Genus database with same CATH topology
 3M3Y H;  2NVX H;  2ZTC A;  1XNQ L;  1V8Q A;  1G6P A;  3E3X A;  5EBC A;  5KRU A;  2C5C A;  2HDL A;  2PNH A;  3BS1 A;  3MTS A;  4QY7 A;  2QDL A;  4N8F A;  3HEJ A;  2NTT A;  4KHZ A;  2NZ1 D;  2EYO A;  3CRK C;  4CKB A;  2C9O A;  5ELD A;  3R93 A;  2F0D A;  3KOJ A;  2BH2 A;  4HED A;  1AE3 A;  3I2Z A;  2IWH A;  3QG1 A;  3UDG A;  3S1M H;  1A3U A;  1AW7 A;  5FJ8 H;  2F0H A;  3H09 A;  3QWN A;  2A68 D;  2HQE A;  3GO5 A;  4FF4 A;  1PXU A;  4KI0 A;  1H9R A;  3J80 E;  3S2D H;  3S17 B;  1PH5 A;  1PRT D;  4DK3 C;  2UXC L;  3HP3 A;  3G4S A;  4XYO A;  3I55 A;  3M85 A;  2JA5 H;  1OO9 B;  5C5L A;  2Y0S E;  3NPP A;  1XTD A;  4GNX C;  3TZD A;  1QUQ A;  1RDP D;  1WFQ A;  1SRU A;  4A3D G;  1HNZ L;  1EZ8 A;  3DMU A;  1PFN A;  1VQF A;  2KEC A;  2OF1 A;  4PV1 C;  3S15 B;  2OTL A;  2NN6 G;  4WJ3 M;  1II3 A;  1CK1 A;  3I7F A;  4Q0F A;  4I7A A;  5CR3 A;  5ISR A;  3HOU H;  1TY2 A;  1D2B A;  3G48 A;  2Z6K A;  5JJK A;  1YJ9 A;  4A93 H;  4DR1 Q;  2EQS A;  2J4X A;  5FLX E;  3S9W A;  1CZG A;  1IZ6 A;  1LTA D;  4B3R L;  3DWP A;  1EEI D;  3MXU A;  5CV7 A;  1JT8 A;  1D5M C;  2VQF L;  1EQQ A;  2F0V A;  1QZH A;  3NEN A;  3I4M H;  4A3L H;  1Q8I A;  3IFT A;  4BA1 I;  4K14 A;  2LS0 1;  3LWE A;  3CCM A;  1YHQ A;  1SE3 A;  2EY5 A;  3VYR A;  5JPN C;  5CBE E;  4QQB X;  2ZTE A;  3LNN A;  5I2X A;  4ME5 A;  4IOA A;  4QF4 A;  4KY6 A;  4DV0 Q;  1F77 A;  2MUY A;  1PFS A;  3AFP A;  3M4O B;  3I4L A;  2PYK A;  1JB7 A;  1ONL A;  2HIX A;  3N52 A;  1S40 A;  2VQE Q;  2PO4 A;  4IPG A;  3BVM A;  2PPB C;  3TME A;  3A7L A;  2I07 B;  4O2D A;  1HFG A;  4ZAI A;  1SYD A;  3OW2 A;  1HHV A;  1BUV T;  4GNX A;  1FGB D;  1STY A;  1SLJ A;  2MFI A;  3RNU A;  1M1K C;  4K0K Q;  4EVO A;  4DUZ Q;  1A15 A;  2VQE L;  2B63 G;  4TKO B;  4DKA C;  4DV7 Q;  3U4V A;  1SYE A;  4JOI C;  4K6D A;  4AYB G;  2A6H C;  4NXM L;  2E2J B;  1A2U A;  4R4O A;  3J7A F;  1STH A;  4DGZ A;  5I4D A;  3K6O A;  3GTJ H;  2JN4 A;  2F03 A;  4A3E B;  2F52 A;  3KLS A;  1EIH A;  1SXT A;  1ICF B;  2F0G A;  4CDE C;  4LK1 C;  1SSO A;  5EKK A;  4A76 A;  4ID6 A;  1ASY A;  1HTL D;  2EZV A;  3K5L A;  1TWA B;  3KBG A;  1N33 Q;  3GTG H;  3GDE A;  1I94 Q;  5A2Q E;  5C4H A;  4LF4 L;  4X66 Q;  1QZG A;  2CKZ B;  2A6H D;  2PQA B;  4GN3 B;  2RCF A;  2RDG A;  1AE2 A;  3TSS A;  5AFW A;  4XQN A;  4EGV A;  3S16 H;  1TR5 A;  2TSS A;  5A35 A;  3NEM A;  3GTM H;  2KCT A;  1YZ6 A;  2OQ0 A;  4LF5 Q;  1N33 L;  5GQO A;  1R9T B;  2F0Q A;  1BDO A;  3RLO A;  2CW0 D;  1AH9 A;  2DNE A;  5T1G A;  3BDO A;  3DLL A;  3Q6S A;  5M3M G;  1VQM A;  4GN4 B;  5D14 A;  2MP1 A;  3BZD B;  2NVQ B;  1STE A;  1E22 A;  4YWM A;  4Q5V A;  4A3I B;  1IBK L;  1S3O A;  3PO2 G;  2YU9 B;  4RMF A;  4B3S Q;  3D6W A;  4JOI A;  4BXX G;  2R92 B;  4XT1 B;  4IUU A;  1B4O A;  4QIW B;  1C4Q A;  4IFD H;  4JI4 Q;  1NR2 A;  5IOC A;  5JJZ A;  3L7Z C;  4X65 L;  1V1O A;  4IPC A;  1LM0 A;  2MO0 A;  1WTW A;  1JOO A;  5IYD G;  1PZK D;  2I46 A;  1STA A;  2RSN A;  4L5Q A;  5IP7 H;  4QJF A;  1TY0 A;  4DV5 Q;  5M5W B;  4WFN 3;  1LTS D;  3T53 B;  4B3S L;  4DR2 L;  2UXD L;  2VUM B;  3CW2 C;  3RLN A;  1EU3 A;  4HMJ A;  4A3B G;  5IY0 A;  1WCM H;  3HRZ C;  4A3F H;  1JMC A;  2MHV A;  4DA2 A;  3CCJ A;  4HJ5 A;  3DUZ A;  3EFX D;  3I56 A;  3ERQ A;  4ZK9 B;  1E1O A;  4CDF C;  5C3E G;  2SOB A;  1LO5 D;  2RDH A;  4S3S A;  3MHB A;  4DV5 L;  2R61 A;  2JA6 B;  3AYH B;  4XXE A;  2ENB A;  4UAI A;  2RKS A;  3V96 A;  2PCF B;  4AIM A;  4A3J B;  3FRP B;  1BQQ T;  1JOR A;  3TBI B;  1EFW A;  1DZ1 A;  4CJ2 C;  1J9O A;  2LY7 A;  5CGK A;  3D31 A;  3FKI G;  2ZXO A;  1PTO C;  4G7H C;  1STG A;  3G6E A;  1XMO Q;  1ZYR C;  4XDX A;  5LHY 1;  4HJ9 A;  1PH9 A;  3SDZ A;  3NSW A;  1BBW A;  4U68 A;  1MJE A;  4F88 A;  1OXU A;  2Q8R E;  2OQK A;  1HH2 P;  1CKN A;  2B2T C;  3AEV A;  2F0U A;  1QNK A;  2EY6 A;  2L0C A;  1KHI A;  2CHB D;  1EZ6 A;  1IW7 D;  4MZ9 A;  2UUB Q;  3RZO H;  4H0L C;  1XMO L;  4IAL A;  1HNX L;  1P16 A;  1RL2 A;  3S14 B;  1VQH A;  3CC2 A;  1IYU A;  2R7D A;  1XTC D;  3S1N H;  1SE2 A;  4BBS B;  2XSC A;  2AHO B;  2F0L A;  3CAM A;  3OWE B;  1XPU A;  1N32 L;  2R7Z B;  3GTO B;  1NUC A;  3PF5 A;  1PTO D;  4G7O C;  2Y0S B;  1KDA A;  3S2H H;  2F0I A;  5C4X H;  3MEF A;  3KDF A;  2QEX A;  3CD6 A;  1V43 A;  3JAM c;  4IJL A;  4KHV A;  1MSG A;  2NVY H;  4N9T A;  3BYT B;  3J81 L;  2M2L A;  1KRT A;  1N36 Q;  5IOD A;  1I6H H;  2KBN A;  2WAC A;  1N9W A;  2VW9 A;  4DFA A;  3HOZ B;  3JAM L;  4OEM B;  1SJH D;  5C44 H;  3PO3 B;  2PI2 E;  4KN7 C;  4NXN L;  1BBX C;  4JI3 Q;  4A3M H;  4DAP A;  2Q2T A;  2K50 A;  2KCM A;  3H3V H;  1HQM C;  1VMC A;  3EQL C;  4OX9 L;  4RKB A;  1GHK A;  5FO7 B;  4Y7N H;  2F0W A;  4FXK C;  3S24 A;  3EJI A;  4QUF A;  1JWU D;  1MGS A;  1X6O A;  2B2T A;  1G91 A;  3UDI A;  5KND A;  1B1Z A;  2XIW A;  1H9S A;  4JI3 L;  1U0L A;  4L6T B;  2EJF C;  3NTI A;  4KHP L;  2K5D A;  1A3V A;  3OIQ A;  1C48 A;  1D5X C;  3A7A B;  5J3B A;  3GTK B;  3MXP A;  4HIK A;  1CSP A;  3MAQ A;  1JC7 A;  3OSO A;  1XMQ L;  3UDF A;  2B2W C;  1J5E L;  1A63 A;  1QJO A;  1F9P A;  1QG7 A;  2ICI A;  1ZKO A;  4B3T Q;  3K7U C;  1X3Q A;  5CV9 A;  2EE1 A;  5CBA E;  2F3V A;  2KVM A;  4OO1 I;  3V05 A;  2D2C C;  4XQJ A;  2EYH A;  1UE5 A;  4YCW A;  4A3E G;  1Q81 C;  2P5Z X;  4C3I H;  4G7Z C;  4N8X 1;  5G3L F;  3HGB A;  1YNJ D;  4V0B A;  3H15 A;  2E74 C;  3DEP A;  2F0M A;  4IUN A;  3VYU A;  3DM1 A;  4E6I A;  3HOX B;  1OTC A;  4JI0 L;  4R4C A;  4BWG B;  5L37 A;  2GA4 B;  2K7V A;  5M5X B;  4JG2 A;  5JVH 3;  1VF7 A;  1SDF A;  4LF7 L;  1L0W A;  5JJI A;  1OXS C;  1K28 A;  3ITP A;  3NWT A;  4ZUI A;  4DR4 Q;  1HZ9 A;  3A74 A;  4CHT B;  4A3K B;  1HPC A;  1BR9 A;  5LL6 X;  1VQL A;  1NBW A;  1TT2 A;  3OW7 A;  4X6A H;  1S5D D;  1HUM A;  3M7N A;  1UEB A;  1W2B A;  1Q1B A;  3MFG A;  3VR3 A;  4C3J H;  5FOB B;  1EY6 A;  1Q8K A;  5DEH A;  3D8G A;  1E2V A;  1TKW B;  1GHJ A;  3CPW A;  4A3G B;  3KF8 A;  1EYC A;  1FYC A;  1VQD A;  1TII D;  2OT2 A;  5CV4 A;  2B2W A;  2E75 C;  2RA4 A;  4IUP A;  4IO9 A;  1H95 A;  5C3X A;  1GUG A;  4EX5 A;  1QOH A;  4A3I G;  4JI6 Q;  1LAB A;  2CH4 A;  1L0Y B;  5FK9 C;  4JI2 L;  1B53 A;  1E24 A;  2JA8 H;  1MD2 D;  1U4P A;  4GLA C;  2R92 G;  4U67 3;  1N34 Q;  1HNW L;  5K36 G;  3Q23 A;  3R8B A;  5IYB G;  2B2V C;  3LGJ A;  1E7Z A;  4I65 A;  4KY7 A;  2LKV A;  2EYF A;  1VQO A;  3T16 A;  3TZU A;  4C3H B;  3P1H A;  1BKB A;  3BG3 A;  4F7X A;  1GUO A;  2B2U C;  2WKD A;  1SYF A;  2K04 A;  3ERO A;  4P2C B;  4OL7 A;  2WB1 B;  3H94 A;  2VUM G;  5J39 A;  2F0O A;  2N55 A;  4DV6 Q;  4K5V A;  3M4Q A;  3CC7 A;  1SE4 A;  2BA1 A;  2KCN A;  1MBY A;  5M3F B;  2G9H D;  3FPP A;  3I3C A;  3GTP H;  3S1R H;  4ZQ3 A;  2JA6 G;  3ND8 A;  1EIF A;  4JBJ A;  3GD7 A;  4A3J G;  4AQY Q;  3SE0 A;  2HUG A;  5E1F A;  3A54 A;  1NJI C;  5M5Y B;  3A8K E;  2G5D A;  4C2M B;  2IW3 A;  5DAU A;  3U9O A;  2RVL A;  1KNE A;  2RF4 A;  1JWS D;  1N8R C;  4JVZ A;  1FNW A;  2KHJ A;  1C8C A;  1BCP F;  1BF4 A;  3ONA B;  1TWG B;  1IHZ A;  2VB2 X;  3NWS A;  1JWM D;  1LT4 D;  2AUJ D;  1PDQ A;  2FIN B;  1A6X A;  3UI2 A;  4K2L A;  3CMA A;  4FXG C;  1FD7 D;  4BBS G;  1EYG A;  4HN7 A;  2R7Z G;  1EWH A;  1E3P A;  1Q1E A;  1VQG A;  1A8V A;  2SNS A;  3EA6 A;  1EQR A;  2Y0S G;  2BE5 C;  3WOF A;  3HOV B;  2NTS A;  3KLW A;  1Q82 C;  3B6Y A;  3STB C;  3CXC A;  2B2U A;  1NR4 A;  4DV1 Q;  1JJ2 A;  2XN9 C;  5GAE C;  1R4Q B;  2C35 B;  4DV2 Q;  1SFO H;  2Z0S A;  1X3P A;  1A62 A;  2Q2H A;  1XYI A;  3W1G A;  2FFK B;  3EBE A;  4IZ8 A;  2FMC A;  4JC0 A;  2E2I H;  2JA7 B;  3HOZ G;  3D4D A;  2A69 D;  1PRT F;  3PO3 G;  1EY7 A;  2QEJ C;  2FHT A;  4M8A A;  5NUC A;  1S4Z A;  2DUD A;  3GTQ H;  4GOP B;  3M4Y A;  5IGE A;  1Y1W B;  2A73 B;  3STB D;  4P73 A;  4IFD J;  1Y1V G;  2WII B;  2IT1 A;  3FP9 A;  2MGS A;  3QO2 A;  3I4N H;  1EEF D;  2UXB Q;  5IWA Q;  4DV4 L;  3H91 A;  1XNR Q;  4OWX B;  1ET9 A;  2K05 A;  2A74 C;  3PIP A;  1KLU D;  1G29 1;  2ES2 A;  4B3M Q;  3F2U A;  3WWV A;  1PH4 A;  5LMN W;  2A68 C;  1F9S A;  1CQF A;  3A8J E;  1PH2 A;  2NBF A;  1V1P B;  1JB3 A;  4YCU A;  1O7Y A;  3KF6 B;  4LF9 Q;  3FKI H;  1O78 A;  2HCC A;  4NKL A;  1PV4 A;  1XNR L;  3K5O A;  3OIP A;  1B9N A;  3J81 E;  1CA5 A;  1AZQ A;  1Y8N B;  3HOW B;  2DGY A;  4IQZ A;  1I4P A;  3NTH A;  3IRB A;  4JYA L;  4L8J A;  1CI3 M;  5I6W A;  2A6E D;  3JAM E;  3AMU A;  3DWQ A;  2QIL A;  4JI5 Q;  1QB5 D;  4LF9 L;  1YI2 A;  2IPK D;  4K8J A;  5FLM G;  2CQA A;  2YTX A;  3I8Z A;  3M7G A;  5EJW A;  1D6E C;  1FVI A;  4CKE A;  3BVG A;  3M3Y B;  3CHB D;  1MHW C;  2ZXR A;  4KY5 A;  2NVX B;  3HOX G;  2JK8 A;  1PA6 A;  3S15 H;  1T5E A;  1LAC A;  3AB9 A;  2PNR C;  3KLS X;  5CMD A;  4GKK Q;  1RD9 D;  4X64 Q;  4KKS A;  4A3K G;  1KIX A;  2OEO A;  5IGF A;  4CJ0 B;  4LJZ C;  1HZA A;  2UU9 Q;  4C56 C;  3S1M B;  2QF7 A;  3G6J B;  3J7Y W;  4UY8 C;  1YNX A;  3X3N A;  1K73 C;  1Z7T A;  1UUP A;  5DNF A;  3RN5 A;  3S2D B;  1VF5 C;  3VDY A;  1PFM A;  4PMB A;  4PQX A;  4A3G G;  1LTL A;  2JA5 B;  4KLK A;  2HDM A;  4P75 A;  1TWF H;  1HZC A;  4HSV A;  4DR1 L;  4RWS C;  4BS9 A;  4ME3 A;  1SND A;  1I4H A;  2PZW A;  3K8A A;  1X55 A;  3HOU B;  4X3S A;  3C3L A;  3T1H Q;  1J8I A;  1GUN A;  4HMI A;  4A93 B;  2JP1 A;  1GUS A;  4J8Q A;  1KQS A;  4JCV E;  4C3H G;  1JE4 A;  4X3U A;  3RMH A;  1Y8O B;  3W3A A;  1YJN A;  4DR3 Q;  2WB1 G;  3QIA A;  3T1H L;  4RKL A;  1U9R A;  1SNO A;  1QVG A;  1I6V C;  5IP9 G;  1Q90 A;  3FDT A;  4GOP A;  4DV0 L;  1I50 H;  5M3F G;  2E2J H;  1GKH A;  1EUJ A;  4XYQ A;  3VR6 A;  3E9I A;  3NBI A;  3PF4 A;  4LUV A;  4IFD I;  2HCI A;  3VR4 A;  2G9D A;  4LFA Q;  1EL0 A;  5I9P A;  4LFB Q;  4OO1 G;  1DM0 B;  4A3E H;  3H0G H;  3HOY H;  3W1B A;  5CV6 A;  2DN8 A;  2J7Z A;  1TU2 B;  1FNV A;  2XVS A;  1SE8 A;  1QNU A;  1F9R A;  1KRS A;  1V1P A;  2CH4 W;  1KD1 C;  3TDQ A;  4K0K L;  4DUZ L;  2CW0 C;  4K8I A;  4DV7 L;  1TWH H;  1SNQ A;  4LFB L;  1SMX A;  4DK6 C;  2VY3 A;  1YBY A;  4LNQ A;  1HR0 Q;  1HZB A;  2H1E A;  4OIJ A;  3VR2 A;  1VQ9 A;  3Q24 A;  4QMG A;  2F0K A;  3TP8 A;  4RGM A;  3OWF A;  3NEL A;  1WOC A;  4JI1 Q;  1GVP A;  3F1Z A;  3OTO Q;  1EY4 A;  4KV6 A;  2KHI A;  2FXQ A;  3NHH A;  4KK7 A;  1PTO H;  5DM7 3;  4NDX A;  3HOV G;  3A5Z B;  3KJO A;  4ILW A;  4PNY A;  1B3Q A;  3RR5 A;  3FEW X;  1I94 L;  4FP5 D;  5K5P A;  3NBH B;  2K5N A;  1SJE D;  1DGS A;  1D1K A;  2HD3 A;  4ZYS A;  4FYD A;  4X66 L;  1NMF A;  1T9H A;  3GTG B;  4EQP A;  4K5W A;  4O42 A;  2JA7 G;  3P20 A;  2O5I C;  4LF5 L;  3BU2 A;  4KD3 A;  1K8M A;  4K5X A;  4HSP A;  2N88 A;  3S16 B;  4I7Z C;  3BDC A;  3GTM B;  1EWI A;  4JBW A;  1Y1W G;  1M90 C;  2L11 A;  5GAH C;  4DAY B;  4FF3 A;  4YWK A;  2WAQ B;  5E4X A;  1H9M A;  2L55 A;  1PTO F;  1QE6 A;  2HHH Q;  3A8I E;  1F2Y A;  1SEB D;  3SK4 A;  1VQE A;  2YYZ A;  4TRD A;  5IYC G;  2BDN A;  4TQU S;  1MKH A;  4RG1 A;  2K1B A;  4JI4 L;  1FJG Q;  4XIG S;  1LV9 A;  1LT6 D;  2KEN A;  2R6G A;  4MHE A;  2PMZ B;  5JEA H;  2HHH L;  1IW7 C;  3H3V I;  3HKS A;  1AP0 A;  1O7Z A;  2JQO A;  1RJT A;  4DV3 Q;  1F2Z A;  1HCZ A;  2KED A;  1WD1 A;  2JE6 I;  5IGC A;  5C4J H;  2ZXP A;  2Z9H A;  3CCQ A;  3HOW G;  3CCL A;  5C0X H;  1Q7Y C;  3S1Q H;  3T13 A;  1K83 H;  4AYB E;  4GN5 A;  3M9B A;  3UE1 A;  3MWY W;  5IGB A;  1TVX A;  3ND9 A;  2M00 A;  5BN3 A;  1WCM B;  1JOQ A;  4A3F B;  2R93 H;  3RZD B;  1EU4 A;  2EYJ A;  1EQT A;  3S14 H;  2WV6 D;  3TP5 A;  3TS0 A;  5EBD A;  4IUV A;  3J7Z C;  4JI7 Q;  2LSS A;  1CKO A;  1CA6 A;  4P72 A;  4RHS A;  1UAP A;  1PH1 A;  3KUP A;  5ELC A;  4L5T A;  5IGD A;  2SEB D;  2WFW A;  3K7A H;  1EYA A;  4ZCK A;  1JCK B;  1LTG D;  4QCL A;  3MXN B;  3U50 C;  1XPO A;  4X62 Q;  4KMU C;  2AUK A;  3SK8 A;  3J7A 5;  4PZ7 A;  5COR A;  2UUB L;  3O13 A;  3AQQ A;  5FJ8 G;  1K8G A;  1ROD A;  1L2F A;  1JOK A;  4YHH Q;  1AFP A;  1I4G A;  3U4Z A;  3KJP A;  4HIO A;  4R4I A;  4NMZ A;  3RZO B;  2NWG A;  1TS3 A;  2K32 A;  2PQA A;  2JA5 G;  2ID0 A;  1O7I A;  1HA6 A;  3S1N B;  2XNA C;  2VXW A;  2K75 A;  1EIY B;  1RF2 D;  3X3M A;  4DXF A;  1YIT A;  1Y1V H;  2LFN A;  1I3Q H;  3K5N A;  4BY1 H;  1CT1 D;  4BY7 H;  3HOU G;  1RCV D;  5FKA C;  3S2H B;  1VMP A;  4LFC Q;  1N36 L;  1TWC H;  1IKM A;  2YV5 A;  5D3I B;  5C4X B;  3U58 A;  4A93 G;  1O80 A;  4BBR H;  4WJ4 A;  2NVY B;  1B9M A;  2ZM6 Q;  4JI8 Q;  4Y52 H;  4DN4 M;  1WJJ A;  1B50 A;  3GTK H;  4R4T A;  4KD4 A;  5JOB A;  5KYI A;  3QR8 A;  5M9O A;  3SK5 A;  1I6H B;  4LF6 Q;  2F0E A;  3PGZ A;  1BO0 A;  3N6R A;  2BA0 A;  3PQI A;  1SNC A;  2IX1 A;  5C44 B;  2JA9 A;  4L5S A;  4P74 A;  4A3L G;  1YNJ C;  1RTN A;  1WTX A;  2Q2I A;  1T5X D;  2XGT A;  1ESR A;  4HIM A;  1A2T A;  2K33 A;  1R4P B;  4OON A;  1UE1 A;  4DR5 Q;  1DCZ A;  1L1O B;  2EPB A;  4FO2 A;  4Y7N B;  1X3G A;  1JQY D;  1PH8 A;  5FLX c;  5JVG 3;  1X3E A;  1GJX A;  1WTO A;  5LMU Q;  4B3T L;  3NUC A;  3I4O A;  4RA8 A;  1X56 A;  1XXG A;  2E5L Q;  2A1A A;  4WOR A;  4PG3 A;  4A3D H;  3VYT A;  2IX0 A;  3AU7 A;  4A3K H;  1W6J A;  2NN6 H;  5KEE A;  5HGT A;  1TXY A;  5E7N A;  1EYD A;  1HA5 A;  1SNP A;  5LMU L;  2IJ0 A;  3CCV A;  4QUC A;  2BOS A;  2NB0 A;  1X32 A;  2DJF C;  4TSS A;  4WJW A;  2EXZ A;  1NMG A;  1FGU A;  4C3I B;  3D3R A;  1EY8 A;  3BZK A;  1IXR A;  3MA2 B;  2MO1 A;  4LUO A;  4RGT A;  4YCV A;  4DR4 L;  2EDG A;  3EN2 A;  5C5M A;  1ML0 D;  3CRL C;  1AZP A;  1UE6 A;  3D0F A;  2CCZ A;  2RSO A;  2WIN B;  2A8V A;  1Q3L A;  4OIK A;  5AJ3 Q;  3F8T A;  2HT1 A;  2N3S A;  1RHP A;  1NCV A;  2ZJQ A;  1YHA A;  3T1Y Q;  2PW7 A;  2E2H H;  2NVT H;  2WKC A;  4C3J B;  1PVO A;  4IUT A;  5ELF A;  1FL0 A;  1K3R A;  3C1F A;  1GUT A;  4NW2 A;  1S72 A;  1HQR D;  2WAQ G;  3EVQ A;  1Q12 A;  1EQV A;  1H9K A;  4JI6 L;  3C46 A;  2EYL A;  4CDC C;  1DON A;  5EPK A;  1YNN D;  1HUN A;  3W2D A;  4L5R C;  1N34 L;  2RDF A;  3NP8 A;  2IY5 B;  5C4Z A;  1KLG D;  2K5H A;  3NE5 B;  1BOS A;  3FMC A;  4LWC A;  1B44 D;  2B63 H;  3I91 A;  2JA8 B;  1NTG A;  3U9S A;  3Q22 A;  5G3L D;  4LF8 Q;  3TP6 A;  4OHJ A;  1OXT A;  1H9J A;  1E1T A;  2F4V Q;  4IFD G;  4UP9 A;  5TSS A;  3PIO A;  4XT3 B;  1D8L A;  1S5B D;  4DV6 L;  1BCP B;  2SNM A;  1SMY C;  5IP7 G;  1KAW A;  3PUZ A;  4PZ6 A;  1C7Y A;  1PYB A;  3GV6 A;  3CCU A;  2B2Y C;  4EQO A;  3QOL A;  3VA5 A;  4YY3 Q;  1E2W A;  1PZI D;  2PQE A;  1X3F A;  3L2P A;  1M8A A;  1WCM G;  4DUY Q;  4A3F G;  4B9X A;  3C2P A;  4DR7 Q;  4AQY L;  4G4K A;  4A3C G;  3C1E A;  3KK7 A;  2DY7 A;  1A0I A;  2LMC B;  4DNT B;  3CQZ H;  1L1O A;  2SDF A;  3HKZ E;  4MTK A;  3GTP B;  1V9P A;  1CHQ D;  3S1R B;  4POG A;  4JV5 Q;  2I0Q A;  2VZA A;  3HFZ B;  3VA7 A;  2H5X A;  1QUQ B;  4GLV B;  4JPB W;  1BNZ A;  2K6A A;  1SNM A;  5JPM C;  2UUA Q;  2A69 C;  2M9V A;  5KYL A;  4A4I A;  4HAE A;  1SMY D;  3ER0 A;  1LYL A;  4PMW A;  2O2L D;  2B8G A;  4IUQ A;  1YIJ A;  5EPJ A;  4ZUJ A;  5M3M H;  2KA7 A;  4JV5 L;  2HIV A;  3UE0 A;  2N78 A;  1G8Z D;  1EY9 A;  1NSN S;  1P8L A;  4HTH A;  1Y14 B;  4GKJ Q;  4ODG A;  4J1M A;  1I4Q A;  1EIG A;  2CFM A;  1PH3 A;  2J0T D;  2DY8 A;  4ABN A;  1XWE A;  3PO2 H;  4H7B A;  3TN2 A;  3P75 A;  4BXX H;  1B70 B;  2NZO A;  4K6L A;  3EIV A;  1KAA A;  2XRS D;  5JAV A;  1MIU A;  4DK0 A;  4DR6 Q;  1STN A;  4DV1 L;  1F2L A;  4RCO A;  3IFD A;  5LL6 S;  4BA2 I;  3K59 A;  1Y8P B;  2QGQ A;  2EY1 A;  5IYD H;  1OXV A;  4K2K A;  1TS5 A;  4DV2 L;  2UUC Q;  3CKI B;  1A3T A;  1ZXT A;  1KC8 C;  2VB3 X;  2B2Y A;  5IYC H;  2AMC B;  4A3B H;  2KOL A;  2YTY A;  4XQQ A;  4QIW E;  5EPL A;  5J22 A;  2A6E C;  1SFO B;  3GTL H;  5C3E H;  5JJL A;  3VR5 A;  2HQL A;  5BR8 Q;  3SEB A;  3NXW A;  2E76 C;  1X54 A;  3AFQ A;  2E2I B;  3KLR A;  4GNX B;  2E2D C;  3DM3 A;  5C44 G;  4OWW B;  4HCE A;  1STB A;  2CQO A;  3K80 C;  3K81 C;  5ELO A;  4G57 A;  3GTQ B;  1BCP D;  3I73 A;  2UXB L;  5IWA L;  5E4W C;  1GUW A;  1XNQ Q;  1D1I A;  3DXJ C;  4B3M L;  3VYS A;  2Q2U A;  3DWA A;  1WI5 A;  1AEX A;  4O1N A;  3CCE A;  3I4N B;  3MVV A;  2XTI A;  4DK1 A;  3S17 H;  3R3O A;  2MPM A;  3QJY A;  4IPH A;  4LAA A;  3RLF A;  1NY4 A;  2QDB A;  3MEH A;  2VNU D;  2QW7 A;  2Z4I A;  1U4M A;  5DLQ E;  1HRJ A;  4IOC A;  4GS3 A;  4EQ5 A;  2O5J C;  1SRO A;  1OXX K;  1XPR A;  3FKI B;  2UXC Q;  1MSH A;  2EXD A;  5KNB A;  2MJ8 A;  4JI5 L;  1PH6 A;  4GOP C;  4RAU C;  1PMR A;  1S5F D;  3D4R A;  2Z8L A;  5COY A;  2PZT A;  3TEH B;  1HNZ Q;  3J7A V;  2L5T A;  4HID A;  3G71 A;  1VQI A;  1LTI D;  4C3I G;  3GQB A;  4GKK L;  4X64 L;  1PZJ D;  2DJG C;  1W3S A;  4QL5 A;  1B3A A;  4B3R Q;  1VQC A;  2MNA A;  1KL9 A;  5FO8 B;  2UU9 L;  4X3T A;  1WTH A;  4MNO A;  2VQF Q;  2JJQ A;  1G51 A;  1Y69 U;  4RGO S;  3OPO A;  1GXD C;  3MZ5 A;  4J15 A;  1IYV A;  1K0R A;  1LTT D;  5IT9 c;  3M4O H;  3PUW A;  4C3J G;  3WDN A;  3QB3 A;  1JE5 A;  2IHE A;  3RUZ A;  3OOC A;  2K14 A;  1VQ8 A;  3W5O A;  2WP8 J;  1D7Q A;  5IT9 L;  2K5V A;  2K28 A;  3T51 B;  3TP7 A;  1TWF B;  1CUK A;  1HJP A;  3I4M B;  1SAP A;  4HJ8 A;  3E0E A;  3PCO B;  1DYQ A;  1LLR D;  3PIP 3;  5EKI A;  4TVA B;  2N8N A;  3V2T A;  3FHW A;  2JA8 G;  5HGQ A;  1WTQ A;  3Q0A A;  1IBL Q;  2PI2 A;  2ATW A;  2R3Z A;  2TMP A;  1UWV A;  4V19 0;  3T56 B;  4OEL B;  4DR3 L;  2GVA A;  1CSQ A;  3NTK A;  5HUR A;  4NXM Q;  1BVS A;  1E0B A;  3CF5 A;  2K5W A;  2KJX A;  5KIX A;  1SBB B;  3R2T A;  1IBL L;  5J1Z A;  3HS0 C;  1CKM A;  1CKN B;  4C1N I;  2L12 A;  1VQ4 A;  1TWA H;  3KF6 A;  4LFA L;  3A0J A;  1UEA B;  2OCE A;  2ZJR A;  2V1C C;  1I50 B;  5T1I A;  1QCB D;  1WTR A;  3K58 A;  2JSO A;  2PZU A;  2KEE A;  4ZKB B;  2AQ3 B;  3ZJY C;  5CC4 A;  2D0P A;  1G6Z A;  3ULL A;  3K0Y A;  4H44 C;  2IHF A;  4PMC A;  3HKZ B;  3M4P A;  1I5F A;  3H0G B;  3T4A C;  3TRZ A;  4LF4 Q;  3HOY B;  5C0X I;  4KKU A;  1SYG A;  1R9T H;  3QOJ A;  3SGI A;  3GTJ B;  1HR0 L;  3IAY A;  1QIL A;  1VQB A;  1TQO A;  3R2I A;  2R7F A;  3KDF B;  1VQ6 A;  1SYB A;  3TQY A;  1NAP A;  2JYO A;  3PSI A;  2XWJ B;  3A55 A;  2NVQ H;  1TWH B;  4JI1 L;  1LTB D;  4A3I H;  4FF1 A;  4NP5 A;  3OTO L;  4DF7 A;  2NUC A;  1KDB A;  4YWL A;  2YU9 H;  1DXM A;  2X6L A;  2R92 H;  4L63 B;  5K36 H;  4FXD A;  4CGY B;  5CV8 A;  2LXJ A;  4QB4 A;  5IYB H;  1IBK Q;  3UDX A;  1X9N A;  3I90 A;  1PTO B;  1EWC A;  3CU7 A;  1LUZ A;  5ELN A;  2ICE C;  2V4D A;  5M5W H;  3BVZ A;  3SVM A;  2EJG C;  2VUM H;  4APV A;  4GZY C;  4CDD C;  4X65 Q;  3P7J A;  3LX0 A;  5LMN Q;  1BBU A;  1KXL A;  1H9S B;  4JK1 C;  4RHR A;  2K4K A;  1TS4 A;  1V1Q A;  2UXD Q;  4DR2 Q;  3ULP A;  1Q86 C;  2Q8T A;  3SR1 A;  1WVL A;  2JA6 H;  2CWA A;  3L9A X;  4A3J H;  1O7L A;  3ICE A;  2WB1 E;  1KDC A;  3CC4 A;  2KUM A;  5LMN L;  1YVC A;  4MTN A;  4ALP A;  3OMG A;  2QA4 A;  1HFN A;  4M1U B;  3IL8 A;  1VDZ A;  4DPG A;  2A5H A;  2EVB A;  2QKI C;  1MI2 A;  3F2B A;  1FNU A;  1ENF A;  3PMF A;  2ASB A;  4LMQ D;  1FJG L;  1CQV A;  5DM6 3;  3RZD H;  1CTM A;  5KNC A;  1GOZ A;  4A3C H;  1ESF A;  3I4N G;  4WRD A;  4DNI A;  4Z9C B;  1B8A A;  2GVB A;  5EQ0 A;  1EOT A;  4DV3 L;  3OYY A;  1YEZ A;  5I9O A;  4N9P A;  1PH7 A;  1U5K A;  1PHJ A;  4BBS H;  4DAV A;  3PV0 A;  2R7Z H;  3GTO H;  4FF2 A;  5C4J B;  1HNX Q;  4OGQ C;  5ELE A;  2ZT9 C;  4ULL A;  2FJ2 A;  2K5Q A;  1PYW D;  1CFM A;  5KGU A;  3E9H A;  3S1Q B;  4KTA A;  1RKN A;  1N32 Q;  1K83 B;  5IIF A;  1ILP A;  2L15 A;  1G2S A;  4R9W A;  1W6K A;  3KYH C;  3PUY A;  3K5M A;  1WYD A;  2I5H A;  2ZTD A;  1B7Y B;  3RN2 A;  1D5Z C;  4JI7 L;  1J6Q A;  2R93 B;  3L3O C;  3KF8 B;  1GM5 A;  1QVF A;  5C3W A;  4JBM A;  3HOZ H;  5ELB A;  4X3K A;  3PO3 H;  1NE3 A;  2NN6 I;  2EIF A;  4X62 L;  2AWN A;  3J81 c;  3CME A;  1IKL A;  5D3D A;  1YJW A;  1EFI D;  1IYJ B;  2D9U A;  1ZYR D;  4F87 A;  1BXT A;  3NQT A;  3K7A B;  1K0S A;  1S5C D;  2KHS A;  4NXN Q;  2RHS B;  2CWP A;  4YHH L;  1VQA A;  1VS0 A;  1VQ5 A;  1CM9 A;  3NBH A;  3ERS X;  2QCP X;  3E6Z X;  4OX9 Q;  4POF A;  1B2T A;  4IPD A;  5FO9 B;  4LUZ A;  3J80 c;  4J6H A;  2RCN A;  5F2D A;  1G2T A;  1PYS B;  5BN5 A;  3ULJ A;  2RHQ B;  3LWU A;  4LFC L;  1IL8 A;  3A56 A;  1SYC A;  5CV5 A;  2AQ1 B;  1UE7 A;  4R1J A;  3I4M G;  1C9O A;  4KHP Q;  2O4X A;  2GN5 A;  3J80 L;  1Y1V B;  3D6C A;  2ZM6 L;  5EKL A;  1I3Q B;  3K0X A;  4JI8 L;  4BY1 B;  4KKT A;  4A3M B;  2ZJP A;  1XMQ Q;  1J5E Q;  4BY7 B;  1FR3 A;  3ZYY X;  4DAY A;  3BZC A;  1TWC B;  2NZH A;  1DOL A;  4FNF A;  2F3W A;  4DNR B;  3PUV A;  4BBR B;  1VQP A;  4LF6 L;  5FLM H;  3DHQ A;  4NPS A;  5H1S E;  2EY2 A;  3F2C A;  1I4R A;  2XWB B;  1K9M C;  2F0J A;  2I5M X;  2N49 A;  2AWO A;  2OXP A;  4DR5 L;  3HOX H;  4DU9 A;  2BH8 A;  4RCN A;  1GO3 E;  2IL8 A;  3HG9 A;  4R8I A;  2RBM A;  3KBX A;  5FLX L;  2EYP A;  5M5X H;  4R4Q A;  2BCO A;  1EY5 A;  5GAD C;  4MIU A;  3MC0 B;  4H13 C;  4JI0 Q;  1KTK A;  1U4L A;  4CKC A;  2Z6B A;  4PZ8 A;  4ZKC B;  2NYZ D;  5IT9 E;  4LF7 Q;  1F2M A;  3HKZ G;  3H0G G;  5IGG A;  4B9W A;  2F0P A;  3HOY G;  1SR3 A;  4MN3 A;  3NQI A;  3OMC A;  2E5L L;  3URY A;  2XRQ D;  1VCI A;  4ZRZ A;  4A3G H;  3L0O A;  4IJH A;  1DJR D;  3E5S A;  2Q8I B;  2RQX A;  4UPA A;  2KCC A;  3NK9 A;  4HJA A;  1RTO A;  4A3D B;  5I2Y A;  1YNN C;  3H6M A;  4CBV A;  3J81 i;  5GRO A;  2PW5 A;  3H3V C;  1JJC B;  3CCS A;  1X65 A;  1L1O C;  2LXK A;  3GP7 A;  1XJV A;  1Z47 A;  3MXN A;  1F9Q A;  2B39 A;  3JAM i;  4CJ1 B;  4ZLT F;  4QGU A;  4H02 A;  1LT5 D;  4C3H H;  4UP8 A;  4JI2 Q;  3CPF A;  2OWO A;  1MJC A;  2D0O A;  5HY6 A;  3J80 i;  3TRE A;  3I72 A;  5AJ3 L;  1K8A C;  4LW1 A;  1VQK A;  1Q46 A;  1IL2 A;  5IP9 H;  3D4W A;  3BYY B;  3SHL A;  3T1Y L;  5M3F H;  1DOK A;  2BDO A;  5E3F A;  4B08 A;  4OWT B;  1DOM A;  4GLX A;  5I6Y A;  3F2D A;  1HXY D;  3K57 A;  1ZEQ X;  5BN4 A;  1SN8 A;  4OO1 H;  1L0X B;  4AH6 A;  2NVT B;  2E2H B;  4KJO A;  3SXH A;  3FVQ A;  4OXP A;  5M5Y H;  5EGT A;  1U4R A;  3RD4 A;  4C2M H;  5A2Q L;  1RIP A;  4F8M A;  2D5D A;  4FVM A;  1NNX A;  3HZX A;  1M4V A;  2MQH A;  4UHV A;  1E2Z A;  3MFY A;  1C0A A;  4UDU C;  1TWG H;  1TS2 A;  4HCS A;  2Z1C A;  3I70 A;  2A19 A;  4LF8 L;  2F1M A;  2K52 A;  1LT3 D;  2F0F A;  2F4V L;  2D62 A;  1WTP A;  1QVC A;  2VL6 A;  2B63 B;  3G7L A;  2JEA I;  4JBK A;  4AYB B;  2F0N A;  1WD0 A;  3WOE A;  4KJN A;  1VQJ A;  1ENC A;  5EAY A;  2KQ3 A;  5JEA G;  1QWY A;  4XTC S;  2X69 A;  3JC6 6;  4HR7 B;  4DAM A;  3GV3 A;  4YY3 L;  1HTP A;  3HOV H;  2DNC A;  2L9H A;  4DUY L;  2H4O A;  4DR7 L;  2B3G A;  4O0A A;  1CHP D;  5C0X G;  3SK6 A;  3A5U A;  1EY0 A;  1ENA A;  2B8F A;  2JEB I;  4JW0 A;  3BDL A;  1PLF A;  4R8N A;  2I5L X;  1YHB A;  3Q8D A;  2Z4H A;  2R93 G;  4IN3 A;  3BJU A;  2UUA L;  4KN4 C;  3CQZ B;  3OHX C;  4IUR A;  2JA7 H;  1PRT B;  3DEO A;  1HR0 W;  1UNS A;  4HJ7 A;  2B2V A;  2K03 A;  1PFB A;  4C1N K;  5GAG C;  2EJM A;  2X6G A;  4A75 A;  2IX3 A;  1VQ7 A;  1Z9F A;  1VQN A;  2AQ2 B;  3TS2 A;  2L1B A;  3J81 j;  1JJG A;  1EOV A;  3IKJ A;  4P71 A;  1Y1W H;  1IBM Q;  1DD2 A;  3PUX A;  4EQN A;  4GKJ L;  4FDB A;  5D65 A;  1BCP C;  1I4X A;  2F0S A;  1KNA A;  3E0J A;  2FMM A;  1K3B C;  5M3M B;  5C4X G;  2VS1 A;  2EYM A;  1K8O A;  4DXG A;  1CZW A;  4DR6 L;  2K01 A;  4YIJ A;  2OTJ A;  1IBM L;  1ILQ A;  3PO2 B;  1LTR D;  1JIC A;  2UUC L;  2WAQ E;  4DV4 Q;  2YTV A;  3CCR A;  2F4I A;  2B29 A;  2E8G A;  2BE5 D;  5IE8 A;  1KAB A;  5C6A A;  1JR0 D;  3CP0 A;  1ASZ A;  1Z6H A;  2F3I A;  3HOW H;  3KFU A;  1HNW Q;  4BY1 G;  5JEA J;  4A3M G;  4BY7 G;  1GD7 A;  2F0T A;  2Z6K C;  5CYU A;  1ET6 A;  4RGN A;  5BR8 L;  3FPU B;  4UP7 A;  1S5E D;  3MXG A;  2EOT A;  2JXM B;  1ICW A;  2ALY B;  4NB3 A;  1AN8 A;  4A3B B;  4RFB A;  4BBR G;  1WTV A;  2L4N A;  2PMZ E;  4RH6 A;  5C0X J;  1XX8 A;  3GTL B;  4JYA Q;  5C3E B;  2AKW B;  3PIO 3;  2CVR A;  1PRT C; 
#chains in the Genus database with same CATH homology
 1V8Q A;  5EBC A;  5KRU A;  2C5C A;  2HDL A;  3BS1 A;  3MTS A;  3HEJ A;  2NTT A;  4KHZ A;  2NZ1 D;  2EYO A;  3CRK C;  4CKB A;  2C9O A;  5ELD A;  3R93 A;  2F0D A;  4HED A;  2IWH A;  3QG1 A;  1A3U A;  1AW7 A;  2F0H A;  3H09 A;  3QWN A;  2A68 D;  2HQE A;  3GO5 A;  4FF4 A;  1PXU A;  4KI0 A;  1H9R A;  3J80 E;  3S17 B;  1PRT D;  3HP3 A;  4XYO A;  3M85 A;  1OO9 B;  5C5L A;  3NPP A;  3TZD A;  1RDP D;  1EZ8 A;  3DMU A;  1PFN A;  2KEC A;  2OF1 A;  4PV1 C;  3S15 B;  2NN6 G;  1II3 A;  1CK1 A;  4Q0F A;  5CR3 A;  5ISR A;  1TY2 A;  1D2B A;  2J4X A;  5FLX E;  3S9W A;  1CZG A;  1LTA D;  3DWP A;  1EEI D;  3MXU A;  5CV7 A;  1D5M C;  2F0V A;  1Q8I A;  3IFT A;  4BA1 I;  4K14 A;  2LS0 1;  3LWE A;  1SE3 A;  2EY5 A;  3VYR A;  5JPN C;  5CBE E;  3LNN A;  5I2X A;  4ME5 A;  4QF4 A;  4KY6 A;  1F77 A;  2MUY A;  3M4O B;  3I4L A;  2PYK A;  1ONL A;  3N52 A;  2PO4 A;  3BVM A;  2PPB C;  3TME A;  3A7L A;  2I07 B;  1HFG A;  4ZAI A;  1SYD A;  1HHV A;  1BUV T;  1FGB D;  1STY A;  4EVO A;  1A15 A;  4TKO B;  2E2J B;  1SYE A;  4K6D A;  2A6H C;  1A2U A;  3J7A F;  1STH A;  4DGZ A;  5I4D A;  3K6O A;  2F03 A;  4A3E B;  3KLS A;  1EIH A;  1SXT A;  2F0G A;  4LK1 C;  1SSO A;  5EKK A;  4ID6 A;  1HTL D;  2EZV A;  3K5L A;  1TWA B;  3KBG A;  5A2Q E;  5C4H A;  2A6H D;  2RDG A;  3TSS A;  5AFW A;  4XQN A;  4EGV A;  1TR5 A;  2TSS A;  5A35 A;  1R9T B;  2F0Q A;  1BDO A;  2CW0 D;  2DNE A;  5T1G A;  3BDO A;  3Q6S A;  5D14 A;  2MP1 A;  3BZD B;  2NVQ B;  1STE A;  4Q5V A;  4A3I B;  2YU9 B;  3D6W A;  2R92 B;  4XT1 B;  4IUU A;  1B4O A;  4QIW B;  1C4Q A;  4IFD H;  1NR2 A;  5IOC A;  5JJZ A;  3L7Z C;  1V1O A;  1WTW A;  1JOO A;  1PZK D;  2I46 A;  1STA A;  2RSN A;  1TY0 A;  5M5W B;  4WFN 3;  1LTS D;  3T53 B;  2VUM B;  1EU3 A;  4HMJ A;  3HRZ C;  2MHV A;  4DA2 A;  3DUZ A;  3EFX D;  3ERQ A;  4ZK9 B;  2SOB A;  1LO5 D;  2RDH A;  4S3S A;  3MHB A;  2R61 A;  2JA6 B;  4XXE A;  2ENB A;  4UAI A;  2RKS A;  3V96 A;  2PCF B;  4A3J B;  3FRP B;  1BQQ T;  1JOR A;  3TBI B;  1DZ1 A;  4CJ2 C;  1J9O A;  2LY7 A;  5CGK A;  3D31 A;  2ZXO A;  1PTO C;  4G7H C;  1STG A;  1ZYR C;  4XDX A;  5LHY 1;  3SDZ A;  3NSW A;  4U68 A;  4F88 A;  1OXU A;  2Q8R E;  2B2T C;  2F0U A;  1QNK A;  2EY6 A;  2L0C A;  2CHB D;  1EZ6 A;  1IW7 D;  4H0L C;  4IAL A;  3S14 B;  1IYU A;  1XTC D;  4BBS B;  1SE2 A;  2XSC A;  2F0L A;  2R7Z B;  3OWE B;  3GTO B;  1NUC A;  1PTO D;  4G7O C;  2Y0S B;  1KDA A;  2F0I A;  1V43 A;  4KHV A;  1MSG A;  4N9T A;  3BYT B;  3J81 L;  2M2L A;  5IOD A;  2WAC A;  4DFA A;  3HOZ B;  3JAM L;  1SJH D;  3PO3 B;  4KN7 C;  1BBX C;  4DAP A;  1HQM C;  1VMC A;  3EQL C;  4RKB A;  1GHK A;  5FO7 B;  2F0W A;  4FXK C;  3EJI A;  4QUF A;  1JWU D;  1MGS A;  2B2T A;  1G91 A;  5KND A;  1B1Z A;  2XIW A;  1H9S A;  4L6T B;  2EJF C;  3NTI A;  2K5D A;  1A3V A;  3OIQ A;  1C48 A;  1D5X C;  3A7A B;  3GTK B;  3MXP A;  3MAQ A;  1JC7 A;  3OSO A;  2B2W C;  1QJO A;  1F9P A;  1QG7 A;  2ICI A;  1ZKO A;  1X3Q A;  5CV9 A;  2EE1 A;  5CBA E;  2F3V A;  2KVM A;  4OO1 I;  3V05 A;  2D2C C;  4XQJ A;  2EYH A;  4G7Z C;  5G3L F;  3HGB A;  1YNJ D;  4V0B A;  2E74 C;  3DEP A;  2F0M A;  4IUN A;  3VYU A;  3DM1 A;  4E6I A;  3HOX B;  4BWG B;  2GA4 B;  2K7V A;  5M5X B;  5JVH 3;  1VF7 A;  1SDF A;  1OXS C;  3ITP A;  3NWT A;  4ZUI A;  4CHT B;  4A3K B;  1HPC A;  1BR9 A;  5LL6 X;  1TT2 A;  3OW7 A;  1S5D D;  1HUM A;  3M7N A;  1Q1B A;  3MFG A;  3VR3 A;  5FOB B;  1EY6 A;  5DEH A;  3D8G A;  1E2V A;  1TKW B;  1GHJ A;  4A3G B;  3KF8 A;  1EYC A;  1FYC A;  1TII D;  2OT2 A;  5CV4 A;  2B2W A;  2E75 C;  2RA4 A;  4IUP A;  5C3X A;  1GUG A;  1QOH A;  1LAB A;  1L0Y B;  5FK9 C;  1B53 A;  1MD2 D;  1U4P A;  4U67 3;  5K36 G;  3Q23 A;  3R8B A;  2B2V C;  4I65 A;  4KY7 A;  2LKV A;  2EYF A;  3T16 A;  3TZU A;  4C3H B;  3P1H A;  3BG3 A;  4F7X A;  1GUO A;  2B2U C;  2WKD A;  1SYF A;  2K04 A;  3ERO A;  4P2C B;  4OL7 A;  2WB1 B;  3H94 A;  5J39 A;  2F0O A;  2N55 A;  4K5V A;  1SE4 A;  2BA1 A;  2KCN A;  1MBY A;  5M3F B;  2G9H D;  3FPP A;  3I3C A;  4ZQ3 A;  3ND8 A;  3GD7 A;  3SE0 A;  2HUG A;  5E1F A;  3A54 A;  5M5Y B;  3A8K E;  4C2M B;  2IW3 A;  5DAU A;  3U9O A;  2RVL A;  1KNE A;  1JWS D;  1FNW A;  1C8C A;  1BCP F;  1BF4 A;  3ONA B;  1TWG B;  1IHZ A;  2VB2 X;  3NWS A;  1JWM D;  1LT4 D;  2AUJ D;  1PDQ A;  2FIN B;  1A6X A;  3UI2 A;  4K2L A;  4FXG C;  1FD7 D;  4HN7 A;  1EWH A;  1Q1E A;  2SNS A;  3EA6 A;  3HOV B;  2BE5 C;  3WOF A;  2NTS A;  2B2U A;  1NR4 A;  2XN9 C;  1R4Q B;  1X3P A;  1XYI A;  2FFK B;  4IZ8 A;  2FMC A;  2JA7 B;  3D4D A;  2A69 D;  1PRT F;  1EY7 A;  2QEJ C;  2FHT A;  4M8A A;  5NUC A;  1S4Z A;  3M4Y A;  5IGE A;  1Y1W B;  2A73 B;  4IFD J;  2WII B;  2IT1 A;  2MGS A;  3QO2 A;  1EEF D;  3H91 A;  1ET9 A;  2K05 A;  2A74 C;  1KLU D;  1G29 1;  3F2U A;  2A68 C;  1F9S A;  1CQF A;  3A8J E;  2NBF A;  1V1P B;  1JB3 A;  1O7Y A;  1O78 A;  2HCC A;  4NKL A;  3K5O A;  3OIP A;  1B9N A;  3J81 E;  1CA5 A;  1AZQ A;  1Y8N B;  3HOW B;  4IQZ A;  1I4P A;  3NTH A;  4L8J A;  1CI3 M;  5I6W A;  2A6E D;  3JAM E;  3AMU A;  3DWQ A;  2QIL A;  1QB5 D;  2IPK D;  4K8J A;  2CQA A;  3I8Z A;  3M7G A;  5EJW A;  1D6E C;  4CKE A;  3BVG A;  3M3Y B;  3CHB D;  2ZXR A;  4KY5 A;  2NVX B;  1T5E A;  1LAC A;  3AB9 A;  2PNR C;  3KLS X;  5CMD A;  1RD9 D;  4KKS A;  2OEO A;  5IGF A;  4CJ0 B;  4LJZ C;  4C56 C;  3S1M B;  2QF7 A;  3G6J B;  3J7Y W;  3X3N A;  1Z7T A;  1UUP A;  5DNF A;  3S2D B;  1VF5 C;  1PFM A;  4PMB A;  4PQX A;  2JA5 B;  2HDM A;  4HSV A;  4RWS C;  4BS9 A;  1SND A;  1I4H A;  2PZW A;  3HOU B;  4X3S A;  3C3L A;  1J8I A;  1GUN A;  4HMI A;  4A93 B;  2JP1 A;  1GUS A;  4J8Q A;  4C3H G;  1JE4 A;  4X3U A;  3RMH A;  1Y8O B;  3W3A A;  3QIA A;  4RKL A;  1U9R A;  1SNO A;  1I6V C;  1Q90 A;  3FDT A;  4XYQ A;  3VR6 A;  3NBI A;  4IFD I;  2HCI A;  3VR4 A;  2G9D A;  1EL0 A;  5I9P A;  4OO1 G;  1DM0 B;  5CV6 A;  2DN8 A;  2J7Z A;  1TU2 B;  1FNV A;  2XVS A;  1QNU A;  1F9R A;  1V1P A;  3TDQ A;  2CW0 C;  4K8I A;  1SNQ A;  2H1E A;  4OIJ A;  3VR2 A;  3Q24 A;  4QMG A;  2F0K A;  3TP8 A;  4RGM A;  3OWF A;  1EY4 A;  4KV6 A;  3NHH A;  4KK7 A;  1PTO H;  5DM7 3;  4NDX A;  4ILW A;  4PNY A;  3FEW X;  4FP5 D;  5K5P A;  4ZYS A;  1SJE D;  4FYD A;  1D1K A;  3GTG B;  4EQP A;  4K5W A;  4O42 A;  3P20 A;  2O5I C;  4KD3 A;  1K8M A;  4K5X A;  4HSP A;  2N88 A;  3S16 B;  4I7Z C;  3BDC A;  3GTM B;  4JBW A;  2L11 A;  4FF3 A;  2WAQ B;  5E4X A;  1H9M A;  2L55 A;  1PTO F;  1QE6 A;  3A8I E;  1F2Y A;  1SEB D;  3SK4 A;  2YYZ A;  4TRD A;  2BDN A;  4TQU S;  2K1B A;  4XIG S;  1LV9 A;  1LT6 D;  2R6G A;  4MHE A;  2PMZ B;  5JEA H;  1IW7 C;  1AP0 A;  1O7Z A;  1RJT A;  1F2Z A;  1HCZ A;  2KED A;  1WD1 A;  2JE6 I;  5IGC A;  2ZXP A;  5C0X H;  3T13 A;  5IGB A;  3MWY W;  1TVX A;  3ND9 A;  2M00 A;  5BN3 A;  1WCM B;  1JOQ A;  4A3F B;  3RZD B;  1EU4 A;  2EYJ A;  1EQT A;  2WV6 D;  3TP5 A;  5EBD A;  4IUV A;  1CA6 A;  4RHS A;  1UAP A;  3KUP A;  5ELC A;  5IGD A;  2SEB D;  1EYA A;  1JCK B;  1LTG D;  4QCL A;  4KMU C;  2AUK A;  3SK8 A;  5COR A;  3O13 A;  1ROD A;  1JOK A;  1AFP A;  1I4G A;  4NMZ A;  3RZO B;  2NWG A;  1TS3 A;  2K32 A;  2ID0 A;  1HA6 A;  3S1N B;  2XNA C;  2VXW A;  1RF2 D;  3X3M A;  4DXF A;  2LFN A;  3K5N A;  1CT1 D;  1RCV D;  5FKA C;  3S2H B;  1VMP A;  1IKM A;  5D3I B;  5C4X B;  1O80 A;  2NVY B;  1B9M A;  4DN4 M;  1B50 A;  4KD4 A;  5JOB A;  5KYI A;  5M9O A;  3SK5 A;  1I6H B;  2F0E A;  1BO0 A;  3N6R A;  2BA0 A;  2IX1 A;  1SNC A;  5C44 B;  1YNJ C;  1RTN A;  1WTX A;  1T5X D;  1ESR A;  1A2T A;  2K33 A;  1R4P B;  1DCZ A;  2EPB A;  4FO2 A;  4Y7N B;  1JQY D;  5JVG 3;  1GJX A;  1WTO A;  3NUC A;  4RA8 A;  1XXG A;  4WOR A;  3VYT A;  2IX0 A;  3AU7 A;  1W6J A;  2NN6 H;  5KEE A;  5HGT A;  1EYD A;  1HA5 A;  1SNP A;  2IJ0 A;  4QUC A;  2BOS A;  2NB0 A;  1X32 A;  4TSS A;  4WJW A;  2EXZ A;  4C3I B;  3D3R A;  1EY8 A;  3MA2 B;  4RGT A;  2EDG A;  5C5M A;  1ML0 D;  3CRL C;  1AZP A;  2RSO A;  2WIN B;  1Q3L A;  4OIK A;  1RHP A;  1NCV A;  2PW7 A;  2WKC A;  4C3J B;  4IUT A;  5ELF A;  3C1F A;  1GUT A;  4NW2 A;  1HQR D;  3EVQ A;  1Q12 A;  1EQV A;  1H9K A;  3C46 A;  2EYL A;  1DON A;  5EPK A;  1YNN D;  1HUN A;  3W2D A;  2RDF A;  3NP8 A;  5C4Z A;  1KLG D;  3NE5 B;  1BOS A;  3FMC A;  1B44 D;  3I91 A;  2JA8 B;  3U9S A;  3Q22 A;  5G3L D;  3TP6 A;  4OHJ A;  1OXT A;  1H9J A;  4IFD G;  5TSS A;  4XT3 B;  1S5B D;  1BCP B;  2SNM A;  1SMY C;  3PUZ A;  3GV6 A;  2B2Y C;  4EQO A;  3QOL A;  3VA5 A;  1E2W A;  1PZI D;  2PQE A;  1M8A A;  3C2P A;  4B9X A;  4G4K A;  3C1E A;  3KK7 A;  2DY7 A;  2LMC B;  4DNT B;  2SDF A;  3GTP B;  3S1R B;  1CHQ D;  3VA7 A;  1BNZ A;  2K6A A;  1SNM A;  5JPM C;  2A69 C;  2M9V A;  5KYL A;  4HAE A;  1SMY D;  4PMW A;  2O2L D;  2B8G A;  4IUQ A;  5EPJ A;  4ZUJ A;  2KA7 A;  1G8Z D;  1EY9 A;  1NSN S;  4HTH A;  4ODG A;  4J1M A;  1I4Q A;  1EIG A;  2J0T D;  2DY8 A;  4ABN A;  1XWE A;  4H7B A;  3TN2 A;  3P75 A;  4K6L A;  1KAA A;  2XRS D;  5JAV A;  4DK0 A;  1STN A;  1F2L A;  4RCO A;  3IFD A;  5LL6 S;  4BA2 I;  3K59 A;  1Y8P B;  2EY1 A;  1OXV A;  4K2K A;  1TS5 A;  3CKI B;  1A3T A;  1ZXT A;  2VB3 X;  2B2Y A;  2KOL A;  4XQQ A;  5J22 A;  5EPL A;  2A6E C;  1SFO B;  3VR5 A;  3SEB A;  3NXW A;  2E76 C;  2E2I B;  3KLR A;  2E2D C;  4HCE A;  1STB A;  4G57 A;  3GTQ B;  1BCP D;  3I73 A;  5E4W C;  1GUW A;  1D1I A;  3DXJ C;  3VYS A;  3DWA A;  1AEX A;  4O1N A;  3I4N B;  3MVV A;  4DK1 A;  3R3O A;  2MPM A;  3QJY A;  4LAA A;  3RLF A;  2VNU D;  2QDB A;  3MEH A;  2Z4I A;  1U4M A;  1HRJ A;  2O5J C;  1OXX K;  3FKI B;  1MSH A;  5KNB A;  2MJ8 A;  4RAU C;  1PMR A;  1S5F D;  3D4R A;  2Z8L A;  5COY A;  2PZT A;  3J7A V;  2L5T A;  1LTI D;  4C3I G;  3GQB A;  1PZJ D;  1B3A A;  5FO8 B;  4X3T A;  1Y69 U;  4RGO S;  3OPO A;  1GXD C;  3MZ5 A;  1IYV A;  1LTT D;  3PUW A;  4C3J G;  3WDN A;  3QB3 A;  3RUZ A;  3OOC A;  2WP8 J;  5IT9 L;  2K28 A;  3T51 B;  3TP7 A;  1TWF B;  3I4M B;  1SAP A;  1DYQ A;  1LLR D;  3PIP 3;  5EKI A;  3V2T A;  1WTQ A;  3Q0A A;  2R3Z A;  2TMP A;  4V19 0;  3T56 B;  3NTK A;  5HUR A;  1E0B A;  2K5W A;  2KJX A;  5KIX A;  1SBB B;  3R2T A;  5J1Z A;  3HS0 C;  4C1N I;  2L12 A;  1UEA B;  1I50 B;  5T1I A;  1QCB D;  1WTR A;  3K58 A;  2JSO A;  2PZU A;  2KEE A;  4ZKB B;  2AQ3 B;  5CC4 A;  1G6Z A;  3K0Y A;  4H44 C;  4PMC A;  3HKZ B;  3H0G B;  3T4A C;  3HOY B;  5C0X I;  4KKU A;  1SYG A;  3QOJ A;  3GTJ B;  3IAY A;  1QIL A;  1TQO A;  3R2I A;  1SYB A;  1NAP A;  2JYO A;  2XWJ B;  3A55 A;  1TWH B;  1LTB D;  4FF1 A;  4NP5 A;  4DF7 A;  2NUC A;  1KDB A;  1DXM A;  2X6L A;  4L63 B;  5K36 H;  4FXD A;  4CGY B;  5CV8 A;  4QB4 A;  3I90 A;  1PTO B;  1EWC A;  3CU7 A;  2ICE C;  2V4D A;  3BVZ A;  3SVM A;  2EJG C;  4GZY C;  3P7J A;  3LX0 A;  1H9S B;  4JK1 C;  4RHR A;  1TS4 A;  2Q8T A;  3SR1 A;  1WVL A;  3L9A X;  1O7L A;  1KDC A;  2KUM A;  3OMG A;  1HFN A;  4M1U B;  3IL8 A;  1VDZ A;  2A5H A;  2EVB A;  2QKI C;  1MI2 A;  1FNU A;  1ENF A;  3PMF A;  4LMQ D;  1CQV A;  5DM6 3;  1CTM A;  5KNC A;  1GOZ A;  1ESF A;  4WRD A;  4Z9C B;  5EQ0 A;  1EOT A;  5I9O A;  4N9P A;  4DAV A;  3PV0 A;  4FF2 A;  5C4J B;  4OGQ C;  5ELE A;  2ZT9 C;  4ULL A;  2FJ2 A;  2K5Q A;  1PYW D;  1CFM A;  5KGU A;  3S1Q B;  4KTA A;  1RKN A;  1K83 B;  5IIF A;  1ILP A;  4R9W A;  1G2S A;  1W6K A;  3K5M A;  3PUY A;  1D5Z C;  2R93 B;  3L3O C;  5C3W A;  5ELB A;  4X3K A;  2NN6 I;  2AWN A;  1IKL A;  5D3D A;  1EFI D;  2D9U A;  1ZYR D;  4F87 A;  1BXT A;  3NQT A;  3K7A B;  1S5C D;  2KHS A;  1CM9 A;  3NBH A;  2QCP X;  3E6Z X;  1B2T A;  5FO9 B;  4J6H A;  5F2D A;  1G2T A;  5BN5 A;  3LWU A;  1IL8 A;  3A56 A;  1SYC A;  5CV5 A;  2AQ1 B;  2O4X A;  3J80 L;  1Y1V B;  3D6C A;  5EKL A;  1I3Q B;  4BY1 B;  4KKT A;  4A3M B;  4BY7 B;  1FR3 A;  3ZYY X;  4DAY A;  1TWC B;  1DOL A;  4FNF A;  2F3W A;  4DNR B;  3PUV A;  4BBR B;  3DHQ A;  2EY2 A;  1I4R A;  2XWB B;  2F0J A;  2AWO A;  2OXP A;  4DU9 A;  4RCN A;  2IL8 A;  3HG9 A;  4R8I A;  2RBM A;  3KBX A;  5FLX L;  2EYP A;  2BCO A;  1EY5 A;  4MIU A;  3MC0 B;  4H13 C;  1KTK A;  1U4L A;  4CKC A;  4ZKC B;  2NYZ D;  5IT9 E;  1F2M A;  5IGG A;  4B9W A;  2F0P A;  4MN3 A;  3NQI A;  3OMC A;  3URY A;  2XRQ D;  1VCI A;  4ZRZ A;  1DJR D;  3E5S A;  2Q8I B;  2RQX A;  2KCC A;  3NK9 A;  1RTO A;  4A3D B;  5I2Y A;  1YNN C;  3H6M A;  4CBV A;  2PW5 A;  3H3V C;  3GP7 A;  1Z47 A;  3MXN A;  1F9Q A;  2B39 A;  4CJ1 B;  4ZLT F;  1LT5 D;  3I72 A;  3D4W A;  3BYY B;  3SHL A;  1DOK A;  2BDO A;  5E3F A;  4B08 A;  1DOM A;  5I6Y A;  1HXY D;  3K57 A;  1ZEQ X;  5BN4 A;  4OO1 H;  1L0X B;  2NVT B;  2E2H B;  4KJO A;  3SXH A;  3FVQ A;  5EGT A;  1U4R A;  3RD4 A;  5A2Q L;  4F8M A;  2D5D A;  4FVM A;  3HZX A;  1M4V A;  1E2Z A;  3MFY A;  4UDU C;  1TS2 A;  4HCS A;  2Z1C A;  3I70 A;  2F1M A;  1LT3 D;  2F0F A;  2D62 A;  1WTP A;  2B63 B;  3G7L A;  2JEA I;  4AYB B;  2F0N A;  1WD0 A;  3WOE A;  4KJN A;  5JEA G;  1ENC A;  2KQ3 A;  1QWY A;  4XTC S;  2X69 A;  4HR7 B;  3GV3 A;  1HTP A;  2DNC A;  2L9H A;  2H4O A;  1CHP D;  5C0X G;  3SK6 A;  1EY0 A;  1ENA A;  2B8F A;  2JEB I;  3BDL A;  1PLF A;  4R8N A;  2Z4H A;  4IN3 A;  4KN4 C;  3CQZ B;  3OHX C;  4IUR A;  1PRT B;  3DEO A;  1UNS A;  2B2V A;  2K03 A;  1PFB A;  4C1N K;  2EJM A;  2X6G A;  2IX3 A;  2AQ2 B;  2L1B A;  3IKJ A;  1DD2 A;  3PUX A;  4EQN A;  5D65 A;  1BCP C;  1I4X A;  2F0S A;  1KNA A;  3E0J A;  2FMM A;  5M3M B;  2EYM A;  1K8O A;  4DXG A;  1CZW A;  2K01 A;  4YIJ A;  1ILQ A;  3PO2 B;  1LTR D;  1JIC A;  2F4I A;  2BE5 D;  1KAB A;  5C6A A;  1JR0 D;  1Z6H A;  5JEA J;  2F0T A;  5CYU A;  1ET6 A;  4RGN A;  3FPU B;  1S5E D;  3MXG A;  2EOT A;  2JXM B;  1ICW A;  1AN8 A;  4A3B B;  4RFB A;  1WTV A;  2L4N A;  4RH6 A;  5C0X J;  1XX8 A;  3GTL B;  5C3E B;  3PIO 3;  2CVR A;  1PRT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...