5I2XA

Crystal structure of tpp1 k170del
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Adrenocortical dysplasia protein homolog
publication title Structural and functional consequences of a disease mutation in the telomere protein TPP1.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i2xA00
2M9VA 2I46A 5I2YA 5I2XA
chains in the Genus database with same CATH superfamily
4X66L 2Q8RE 3CQZH 2EDGA 3H0GG 1XTDA 4B3MQ 2PQAA 1KC8C 1L0YB 1YJ9A 3TZUA 1A2TA 5GAEC 1OXUA 5CMDA 4DV1L 4GNXC 4L63B 2AQ3B 1TWCB 2L11A 3A55A 2ZT9C 1LTSD 2PW7A 4LFAQ 3GTLH 3A8KE 4JC0A 5A35A 4EGVA 1STYA 2UU9L 3KLWA 1SROA 2HCCA 3K0YA 4V190 4BY7H 1EL0A 2HIVA 4UP8A 1U4RA 4Y7NB 1X3EA 4GLVB 3IAYA 5C44B 1VQGA 3VR4A 1BNZA 3CD6A 1DCZA 1UE7A 4X62L 1YVCA 5M5XB 3S14B 1BBWA 3CCQA 5C4HA 3KJPA 2FMCA 4DK6C 3FEWX 4A3EB 1J5EQ 2UXBL 3Q6SA 1SEBD 4A3BH 1ICFB 3NUCA 5C3EG 4DV5L 1RJTA 4WJ4A 1XNRQ 1EUJA 5H1SE 3M3YH 4OX9L 2F4VL 5FLXc 3QIAA 3ZJYC 1PZKD 4C3HB 1OXXK 5JJIA 5BN5A 2FINB 1PLFA 2NB0A 2F0KA 3I4MH 3EVQA 3FKIH 1E3PA 2NZ1D 3DUZA 4HTHA 5ELFA 2F0IA 1HRJA 5IGEA 5T1GA 2PQAB 3DWPA 1NR4A 4A3FB 2F0NA 4KN4C 2IT1A 1C7YA 5EBDA 2J0TD 2C5CA 2NVXB 1N9WA 1QUQA 3S15H 2KEEA 1R9TB 3K5OA 2ZTDA 1L0XB 5IGFA 2JP1A 5BR8Q 3RZDB 2Y0SB 1WCMB 2KHIA 1ILQA 4H02A 3W5OA 1N34Q 4BY1H 3X3MA 5IYDG 3K57A 4UDUC 3S2DH 3MEHA 1OXSC 1EIYB 2YV5A 4X65L 3C46A 1WTXA 4UP9A 4GKKL 2WINB 5C4ZA 4QCLA 1UWVA 2EYMA 3A7AB 5C44G 1SSOA 1QZGA 3PO3H 2B2YC 3MTSA 3P20A 4P75A 4KKSA 5EGTA 2VQFL 3PGZA 3T56B 1S5BD 3HFZB 4G7HC 4C1NI 4XDXA 4A3EG 4LF5L 5LMUL 3M7NA 1VQEA 2NVTH 1R4PB 3T4AC 1F9RA 1B9MA 5FK9C 5IT9c 4HN7A 3PIPA 1B2TA 1B7YB 1B70B 3K7AB 3W1BA 4IPDA 2Q8IB 4C3HG 5IY0A 5E1FA 5IT9E 1K0SA 4MTKA 4GOPA 4MN3A 3GTGB 4JI5Q 2JK8A 4A93B 1KDCA 1X55A 2EZVA 4I7AA 2BA0A 2DY7A 5CV9A 1RODA 4IUPA 1RTOA 1BXTA 3MA2B 4YCVA 1PH8A 4DR5L 3HOUH 1D8LA 4A3FG 1LTGD 4A3IB 2UUAL 3LWEA 1U0LA 1M90C 4QF4A 1KXLA 4LF8Q 5HGTA 1G2TA 1K8AC 4GNXA 3HOVB 1MSGA 3G71A 1GUNA 4PZ8A 4JI8L 2QGQA 4R8IA 1QNKA 1WCMG 5LHY1 1UUPA 4R4IA 5M5WB 3VR2A 4PNYA 4LMQD 4C3JH 1WTWA 4LFBL 4AQYL 3M4QA 2RQXA 3IRBA 4K5WA 2NVQB 2MHVA 5I2XA 2LS01 3ERSX 2M2LA 4JV5L 4HIOA 1KNEA 3S2HH 1O80A 2IX1A 1YNJC 5M3MH 4K5VA 5FJ8G 4ZAIA 3I4NH 2E8GA 4DK1A 2L15A 5T1IA 1Q82C 2MQHA 4DV7L 2R3ZA 3C1EA 3VYSA 1GUWA 2N88A 4KK7A 3PUVA 5TSSA 2SDFA 3D4RA 2AKWB 2HD3A 3KF6A 4CDEC 4GOPB 1DXMA 4GN3B 1Z9FA 2KEDA 5L37A 4IO9A 4HJ9A 2B2UC 5CC4A 3G7LA 3SEBA 4GKJL 4RHRA 1IBMQ 1JMCA 3QOJA 3PO2B 4IALA 4A93G 2K5HA 1EFID 3TQYA 2JSOA 4DR2Q 1N8RC 2EY1A 2F0FA 2N55A 3MAQA 4A3IG 4IFDI 4B3SQ 4HAEA 1K3RA 4FYDA 1XTCD 5AJ3L 1KQSA 1C9OA 5C4JH 4ULLA 5C0XJ 4JYAL 2WP8J 2YYZA 4X66Q 1FNVA 1D5XC 4A76A 1YNJD 4XQNA 1CA6A 1V43A 1JWMD 1LV9A 3NQTA 1EZ6A 4EQOA 1E2ZA 1XX8A 2F0TA 1QOHA 2B2YA 4KD4A 4L6TB 1UNSA 2F52A 2UU9Q 4HCSA 2A73B 4OO1I 5GROA 1VQOA 3CPFA 1CKNA 3ND8A 4JI7L 4NPSA 4LF6L 2UUCL 1PTOH 4J6HA 3VYUA 3JAMi 4BA1I 5LMNL 4R1JA 4XXEA 1Y1VH 3H91A 4KY7A 4X62Q 1D1IA 3CC2A 3N6RA 4C3IB 4QL5A 2UXBQ 1ESFA 1NTGA 1Q8IA 2B2WC 4DV5Q 1YBYA 2F0DA 3R93A 1NY4A 3PO2G 1HPCA 4OX9Q 2F4VQ 4YWKA 5KGUA 1QG7A 2F0PA 1FYCA 1U4LA 2V1CC 1M4VA 4DK3C 1SE8A 3I90A 2PW5A 3A8JE 1KRTA 1GHKA 1VQDA 4G7ZC 4PZ6A 3FP9A 2PZWA 4BA2I 3C2PA 4DGZA 1EWIA 2JN4A 3C1FA 1Q86C 5KNCA 4A3GH 3NELA 1WOCA 3PSIA 1MHWC 1ET9A 4X3UA 3GTQH 4XYQA 2K04A 5DM73 1NSNS 2F0MA 1M1KC 1ZEQX 2R6GA 1EIGA 1NAPA 5LMNW 4YIJA 3D4WA 2K50A 5ELNA 2EE1A 4DUYL 2JXMB 4B08A 5CV4A 1VQLA 1TWFH 3T1HL 1S40A 1ONLA 3OSOA 1ESRA 1HUMA 2FJ2A 1CKNB 4LUZA 1EWHA 3OW2A 4N8FA 2Y0SE 4FVMA 1PTOC 2FFKB 4AIMA 1K8GA 4X65Q 2UUBL 3U4VA 5FLXL 3L2PA 3CCUA 1CZWA 4XT3B 1B8AA 4KTAA 1GUSA 4JPBW 4P74A 1TWGH 3DEPA 1GO3E 1YNXA 3NWTA 3L9AX 1XPUA 2B2UA 4IUTA 3GTJH 4LF5Q 1FNWA 3BVGA 5LMUQ 4EQ5A 2RDHA 3BZKA 3HOZH 2ALYB 5CBAE 3HS0C 1WFQA 5JVG3 1F2LA 2TMPA 2BA1A 4J1MA 4BBSB 1SBBB 2M9VA 2O4XA 3VA5A 5FKAC 4IUUA 5FO9B 1HZAA 3PIP3 3QWNA 4HIKA 1SE3A 2IPKD 5ELEA 3MHBA 4OGQC 1B53A 1EOVA 4MIUA 2RDFA 2JA6B 2AWOA 2QF7A 5EQ0A 2ZJPA 1VQ6A 1G6ZA 4DV3L 3SHLA 4QIWE 1LACA 1Y8NB 1Q81C 3KUPA 2CQAA 5IGGA 2B3GA 2UUAQ 1DYQA 1PTOD 1HZCA 1VF7A 2XNAC 1EY4A 2PZTA 2KENA 1VDZA 3I91A 3UI2A 2H1EA 2RVLA 5JPNC 1SNMA 5FO8B 2IL8A 4HJ5A 4AYBE 1EZ8A 1CHQD 1EY7A 3FHWA 3G6EA 1F9QA 2ID0A 2BCOA 2F0HA 4DR6L 4ZRZA 1S5CD 4P72A 1TS4A 1K0RA 3CRLC 1JT8A 5CBEE 5IT9L 1YHAA 1V9PA 4AQYQ 2M00A 2AQ1B 1D5ZC 1YIJA 1C0AA 1PTOF 1JOQA 1QILA 2OTLA 1Z47A 3RR5A 2RDGA 4JV5Q 3DM3A 1QWYA 5KYLA 1G2SA 4A3CG 1J6QA 4YY3L 2SNSA 4UP7A 2B2WA 2K75A 1ENAA 4DUZL 3SGIA 3A8IE 4ODGA 3PIOA 3DEOA 4RWSC 4DV7Q 1YZ6A 3EQLC 4KI0A 1TWAB 1HTPA 1KDAA 3GTPB 2RHQB 4HJ7A 1EY8A 4A3MB 2H4OA 2L5TA 3TREA 1EY6A 4BBRH 4ZKBB 4BBSG 2RBMA 1JB7A 3ERQA 3U9OA 4IURA 3M4YA 3T16A 1CT1D 4GZYC 2VUMH 4HR7B 4GKJQ 1SYFA 2A5HA 4KJOA 5CORA 3HGBA 1QVCA 4XT1B 1IL8A 2JA6G 4X3KA 3U58A 4O0AA 5JEAJ 4JI3L 4C3JB 1G291 3H09A 2O5JC 1KHIA 1HTLD 2D9UA 4GLAC 4EX5A 3K5LA 1LTTD 4DAVA 5IGBA 3S2HB 1II3A 2K5DA 4DR1L 3HOWB 2VL6A 3VR3A 3CCMA 2EY6A 1TIID 5AJ3Q 4PMWA 3F2BA 1MJCA 1ILPA 1GOZA 3CRKC 1AE2A 4K2LA 3WOEA 1LTAD 3F8TA 4C1NK 4CJ0B 1Y1WH 1EU3A 4KMUC 2KA7A 4KHVA 3K80C 5EPJA 5ELOA 1RF2D 2G5DA 5FLMH 1Z6HA 2N3SA 3GTKB 2CWPA 2A69C 4NP5A 1JC7A 4GS3A 5NUCA 3NENA 3P7JA 4FNFA 1K83B 3RUZA 4JI7Q 4LF6Q 3TP8A 1QNUA 2K01A 1NR2A 3QO2A 2CH4W 2RCFA 4RKLA 4LF9L 1UAPA 3M7GA 2F0SA 5LMNQ 1HZBA 1N32L 2K14A 1HFGA 3I8ZA 1O7ZA 3A54A 1TQOA 3BU2A 3CHBD 1Q12A 4A3MG 3TDQA 3E9HA 4M1UB 4R4CA 1XYIA 3W3AA 2HCIA 2LY7A 3E0EA 1IXRA 2R7DA 2R93H 1AE3A 4QB4A 1HR0Q 3MFGA 2BE5C 2CVRA 4V0BA 1CKMA 4GN5A 1JE5A 4CDDC 4WRDA 1VQ9A 3JAML 1I50H 4OO1H 1N33L 3S24A 2IHEA 2JJQA 3AU7A 4DA2A 3BZDB 3HOWG 4DR3L 2RCNA 1VQJA 4LW1A 5JEAH 2ASBA 1QCBD 1AP0A 1PTOB 4A3KB 1I4RA 3HKZB 2A69D 1C4QA 1PH5A 2JA7H 2EY5A 5CGKA 4QUCA 1Y1VB 4QJFA 2BDOA 2MP1A 3EA6A 3Q24A 1I3QH 2F1MA 1SNCA 3HOYH 4DUYQ 3CCVA 5IYBH 3J7A5 1RTNA 3T1HQ 5EKIA 1K3BC 2FMMA 4YCWA 4A3LH 1IBLL 1I6VC 4DV6Q 4CJ1B 1PFNA 3TS0A 1AH9A 2UUBQ 3MXNB 4DU9A 2NZOA 3K0XA 1MKHA 5M5YB 2BE5D 3E6ZX 1XJVA 2HDLA 3BYYB 1X32A 3I4OA 1U9RA 3SDZA 2B2TC 5IP9H 4NW2A 2SNMA 2CKZB 1PYWD 3HKSA 2DJFC 3KDFA 3HOXB 2F3IA 1HXYD 3A56A 3BDOA 1JICA 1KLGD 3FVQA 1Q90A 1LLRD 2E75C 2L4NA 4ZK9B 1PFBA 2X69A 2SOBA 1X54A 3UE1A 2EYHA 4CHTB 3AEVA 4N9PA 2QDBA 4IZ8A 4AH6A 5C0XI 1HA5A 1T5EA 3ULLA 2R61A 3E3XA 2YU9H 2G9HD 1H95A 4DKAC 1EU4A 2F3WA 3J81E 3K58A 1HH2P 4DV3Q 1E7ZA 2Q8TA 4A3KG 4WORA 2R7ZB 1C48A 2ICEC 4XIGS 2NTSA 3P1HA 4L5RC 4ZUJA 4JVZA 5JJLA 1GUOA 4IN3A 1L1OC 4ZCKA 1JJ2A 3M85A 1VQKA 1KRSA 2XSCA 3S1QH 1C8CA 1A3UA 4NXMQ 1BO0A 1LT4D 4KHPL 2AQ2B 3PUWA 3GTMH 2ATWA 5JJKA 3NQIA 4B3TL 2F3VA 5A2QE 1VQPA 1ML0D 4PMCA 1FR3A 2OQ0A 3S1RH 5DNFA 1SYBA 4HCEA 1V1OA 1H9SA 3KDFB 1F77A 4DV4Q 3KBGA 1G51A 2XRSD 1PZJD 4YY3Q 4KY6A 2NN6H 3TRZA 1Y8PB 4YWLA 3HOXG 1NBWA 3BJUA 1LTRD 4DUZQ 3D6CA 4G57A 5C5MA 3L0OA 2B63H 4RMFA 5I6WA 2E2JB 3PIO3 4MTNA 3H3VI 3TMEA 2WB1B 3CCSA 5K36H 4CKCA 1STAA 2QW7A 1H9KA 1V1PA 1HCZA 4OEMB 1PMRA 1PZID 4JW0A 2OQKA 1TWHH 4ME3A 4JBMA 4I65A 1KD1C 2KCCA 3S1MB 2CW0C 2B39A 5D3IB 2K6AA 3D6WA 3FDTA 1PYBA 5EBCA 3U50C 4DN4M 1XWEA 2HQEA 4QIWB 3TZDA 1E24A 2R7ZG 4NXNL 3AB9A 3BZCA 1P16A 4HMIA 3AMUA 4IPGA 3S16B 3AFQA 2B8GA 4GLXA 4ZLTF 1D5MC 4DR1Q 4JI0L 2QEXA 3SXHA 1QUQB 1HNZQ 4XYOA 1E1TA 5C4XB 4DAMA 2F0GA 4AYBB 1IYVA 2R92B 4H7BA 3HZXA 4FDBA 5IYCH 4UHVA 4EVOA 1X65A 2NTTA 1Q7YC 2Y0SG 5CV8A 4TVAB 1H9SB 4OONA 1NE3A 4CKBA 5JJZA 5IWAL 1IYUA 2B2TA 4IUQA 2JA5B 4J8QA 5EPLA 1SE4A 4RH6A 3D0FA 4LUVA 4JI4L 2F0VA 2MO0A 4JOIC 3FPPA 1DM0B 4C2MH 4LF9Q 1JJGA 1A0IA 4DV2L 1CI3M 2CW0D 3ULJA 1WTPA 3G6JB 3NE5B 1V1PB 2NYZD 1FJGL 1EYGA 1HJPA 3OOCA 1LTLA 1Q8KA 2WB1G 3Q0AA 1XMOL 1PHJA 2KOLA 4K6LA 5CV6A 1O7IA 2J4XA 2E76C 1ICWA 2E2IB 1B44D 2X6LA 4MNOA 3S9WA 1SFOH 2JE6I 1HNXL 4A3DH 4RFBA 3RZOB 3RNUA 2LKVA 1K28A 3AQQA 5D3DA 1N33Q 3MC0B 4MZ9A 1L1OA 1U4PA 1UE5A 1XMQL 4Q0FA 1E2WA 4DR3Q 2K28A 3GV6A 3K6OA 2DUDA 4U68A 1AEXA 1MIUA 2F0UA 4YHHQ 1TY0A 4GNXB 4X3TA 5C4XG 4AYBG 2R92G 1PRTC 1VQ7A 3H0GH 1NCVA 1CUKA 3HOVG 3HKZE 3T1YL 1HHVA 1Q1BA 3FMCA 3IKJA 1QE6A 3PMFA 5HY6A 3I7FA 1STHA 4O42A 3S17H 1WTVA 2KJXA 2Z6KC 1RDPD 2TSSA 3GDEA 5GAGC 2JA5G 1FGUA 2E2DC 2LSSA 4LAAA 4P2CB 1YHQA 1IBLQ 3J81j 2RF4A 4DV1Q 3CCRA 4RGNA 4X64L 1BF4A 2VW9A 2EQSA 1FL0A 1RKNA 3LWUA 2BDNA 1H9JA 3PF5A 1TS2A 1HFNA 2OCEA 2KCTA 1SR3A 3J80E 5DEHA 2MGSA 2VS1A 3BDCA 1JWUD 3X3NA 2N8NA 3KF6B 1LTID 3SK6A 4DNRB 3IFTA 4KD3A 1EYCA 3M4OB 5C3EH 2FXQA 2LXJA 4RAUC 3CQZB 1CSQA 3VYTA 1PH6A 4DV0L 2E2HH 3S1NH 1PH3A 1JWSD 3PUZA 3MXUA 3D8GA 1X3GA 1EYAA 1I6HH 4X3SA 3GTLB 3BDLA 1R4QB 4IFDG 2UXCL 3M4PA 2GVBA 1J9OA 3MVVA 1NJIC 1CSPA 4BY7B 1SYCA 4K8IA 1PRTF 1Q3LA 1YEZA 1CFMA 2FHTA 3Q23A 1BUVT 3OMCA 5ELBA 2WACA 1TWCH 5EKKA 5IYDH 4JBWA 1VQBA 1AZPA 1PVOA 4B3TQ 4JOIA 4DAYA 5C0XH 1X3QA 4A3BB 4RKBA 3V96A 2K5NA 4CBVA 1UEBA 2A74C 3M3YB 2NVYH 4Y7NH 4OO1G 5IP7G 5C44H 4WFN3 4C56C 3IL8A 4GKKQ 2PYKA 3RN2A 1IBKL 1VQ8A 3W1GA 5M5XH 3S14H 1AFPA 4NMZA 3QR8A 1PFMA 1TKWB 3I4MB 1SNOA 3FKIB 5D14A 4F87A 4A3EH 4BXXG 2IHFA 5COYA 2VQFQ 1E2VA 3SK8A 3Q22A 4JG2A 4C3IG 2YTYA 3WDNA 5GQOA 1VQ4A 1JOKA 2KCNA 4O1NA 2PPBC 1I4GA 3OMGA 3D4DA 4C3HH 3I70A 1YJNA 3S15B 2CCZA 2Z8LA 5A2QL 4IUNA 2WB1E 2OTJA 3BYTB 4XQQA 2EXZA 4BY1B 1Q46A 2XIWA 3SVMA 4IUVA 1W6KA 3S2DB 2DGYA 3OHXC 4A3FH 4B9WA 4NXNQ 4FF2A 2I5MX 5KYIA 2Z0SA 1PH7A 3I3CA 2NVXH 4BY7G 3J7YW 1R9TH 4DR5Q 2Z6KA 2NN6I 1EY5A 2D5DA 3QG1A 1J5EL 3RZDH 3PO3B 2JQOA 1X56A 1WCMH 3TSSA 1NMFA 4DAYB 3PUYA 1WI5A 1X6OA 1XNRL 3H3VH 4K0KL 4LNQA 3RMHA 2F0EA 4JI2L 4JI8Q 4A3BG 1WD0A 4FO2A 2Z1CA 1I94L 5IWAQ 2NVTB 4MHEA 2ZTEA 2EYOA 5LL6S 2K5QA 2GVAA 3KF8A 2MNAA 1WTRA 3PF4A 2GA4B 3NPPA 4ZUIA 4LFBQ 2HDMA 1U5KA 5FJ8H 4JI4Q 4APVA 1A8VA 1SJHD 1HA6A 1B3QA 3QJYA 1BVSA 5G3LD 4OWWB 3I4MG 3FKIG 2EYPA 3PCOB 2PQEA 4OL7A 2N49A 4OIJA 4ABNA 4DAPA 5I2YA 1FJGQ 3HOUB 1EEID 3BVMA 4DR7L 2JA9A 3K7AH 5BR8L 1XMOQ 5CR3A 4JCVE 1V1QA 1X3PA 2RKSA 3U4ZA 1BDOA 1B50A 4OXPA 1SYDA 4OWTB 4A93H 5CYUA 3OTOL 2I46A 2G9DA 3D3RA 2IY5B 2H5XA 5HGQA 4BY1G 5G3LF 1A2UA 1EIFA 1HNXQ 1XXGA 2Q2IA 3R2IA 2AHOB 2CH4A 3Q8DA 1F2YA 1TT2A 5IOCA 2QA4A 4A3IH 3CXCA 1A15A 1XMQQ 3KBXA 1EYDA 2PI2A 2F0WA 1O7YA 1DOMA 3EROA 1IHZA 3H3VC 2DNEA 3PO3G 3MZ5A 5M3MB 5M5WH 2EYJA 3L3OC 4R4TA 3I4NB 4JYAQ 2RHSB 3NBIA 4L5SA 1EY9A 3NTIA 3K7UC 3OYYA 2GN5A 1BKBA 5E7NA 2NVQH 5GADC 1AW7A 4A4IA 3CKIB 3DWAA 5IGDA 4IJLA 3TP7A 4F7XA 3MWYW 1DGSA 1K8OA 2AUJD 4X64Q 1B9NA 2I0QA 2MO1A 3BS1A 4OHJA 1AZQA 4IQZA 1PXUA 3A74A 3EIVA 2UUCQ 1LABA 3HOUG 4UY8C 2D0OA 4CGYB 3GTOH 1D6EC 1LTBD 2RSOA 5M9OA 5C4JB 3PO2H 1ASZA 2O2LD 1GM5A 4HEDA 4DV0Q 2C35B 3STBC 1OXVA 4YCUA 2A1AA 3IFDA 1Y69U 4F8MA 5JVH3 1CQFA 1PV4A 1KNAA 4C3JG 2B2VC 5EKLA 2IWHA 1SNPA 2UXCQ 3ZYYX 4RGOS 2AMCB 4KLKA 4FXDA 1T5XD 5I6YA 3NBHA 2IW3A 3TS2A 1BR9A 2EJMA 5M3MG 4FF1A 2WIIB 3K8AA 3KJOA 3CCEA 3I4NG 4KKUA 1KLUD 4RHSA 4NKLA 2PNHA 2BOSA 2XRQD 3I4LA 1CA5A 2RA4A 3VA7A 2BH8A 4CKEA 1W6JA 5C5LA 3OIPA 2VY3A 2F0JA 1DONA 3E5SA 1YITA 1BQQT 3S1NB 2K5VA 3FRPB 1STEA 4JI1L 2ZXRA 1GUTA 3J7ZC 1FNUA 3NK9A 2Z4IA 2V4DA 3WWVA 3CC4A 5KNDA 4QGUA 3STBD 1IBKQ 5E4XA 1V8QA 4DF7A 4LUOA 1O7LA 4K6DA 1PH9A 1UE6A 4S3SA 4H44C 1QVFA 4HMJA 4A3GB 1S5FD 3GTQB 1S5DD 3I73A 1QVGA 1P8LA 1HQRD 1I5FA 1KL9A 2L1BA 1BBXC 1SAPA 3F2DA 3J81c 5IE8A 1TWFB 2WAQB 4R4QA 2E5LL 1LM0A 3I72A 3UDFA 3T51B 1MD2D 3NBHB 1E1OA 3TBIB 2NVYB 1SE2A 2Z6BA 1HZ9A 1CHPD 1JB3A 1UEAB 5JAVA 1QZHA 3H6MA 5IODA 2K32A 1JJCB 4ALPA 3H15A 2F4IA 1GXDC 2HIXA 5I4DA 3UDXA 2X6GA 3HKZG 2K1BA 1SNQA 3J81i 3CC7A 3CMAA 2SEBD 3CP0A 3F2CA 1BOSA 1TWGB 3TP6A 1Y1VG 3AFPA 1YI2A 3KLRA 2VXWA 4K0KQ 2QDLA 2PMZE 3V05A 1TVXA 4JI2Q 3URYA 3KLSX 5IGCA 3GTJB 3RD4A 1VS0A 4IOCA 3HOZB 1JCKB 1I94Q 1I4HA 4O2DA 3J7AV 1VQAA 4P71A 4DR6Q 1A6XA 5FLXE 2KUMA 3J7AF 2MFIA 3KFUA 4QMGA 4A3CH 4QQBX 5DAUA 4LJZC 1GVPA 2Q2UA 2QILA 1EY0A 4G4KA 1XNQL 1CKOA 1WD1A 3CU7A 3NHHA 2MPMA 4ZYSA 4HIMA 5DM63 4A3GG 1YHBA 2EVBA 1WYDA 2QCPX 4DR7Q 4BBSH 4DXFA 3HEJA 5BN3A 4K14A 2B2VA 2I5HA 1VCIA 2L0CA 2JA6H 3D31A 3SE0A 3OTOQ 5C0XG 3DXJC 5EJWA 3K59A 2WAQG 5BN4A 4A75A 4KKTA 2LMCB 5C6AA 1WTQA 3GO5A 4X6AH 1PH2A 4FF3A 4JI3Q 3UE0A 3ULPA 2MJ8A 1I4QA 1JQYD 1B3AA 2EY2A 3DWQA 3PUXA 2A19A 5M3FH 1EQRA 3KLSA 2NUCA 3O13A 3R8BA 4POGA 1BCPC 4OWXB 3OW7A 2Z4HA 4CDFC 4BS9A 3HOZG 4HIDA 1HUNA 1IW7C 4BBRB 4KHZA 2ZXPA 3KK7A 4TKOB 1S5ED 2VUMB 2Q2HA 1GUGA 1HNWL 3CW2C 1KAAA 1WJJA 1D7QA 2K5WA 2JYOA 4OIKA 4PQXA 1TWAH 4PZ7A 3GTPH 4Q5VA 1MSHA 2KQ3A 3F1ZA 4A3MH 4B9XA 3TP5A 1ENCA 2ZJRA 4R8NA 1VF5C 1T9HA 4PMBA 1N32Q 5I9OA 2HUGA 4CJ2C 4R9WA 4LFCL 2KHJA 4N9TA 2K4KA 1SNDA 3NSWA 2ZJQA 2CQOA 2ENBA 3HG9A 4Z9CB 4DXGA 4RG1A 1SXTA 1Y1WB 1BCPD 1SMXA 1B1ZA 1SJED 3GP7A 1SDFA 1OTCA 1Z7TA 2R7FA 1DZ1A 4N8X1 1OO9B 3BG3A 3HOWH 1CZGA 3MFYA 4G7OC 1IW7D 1GKHA 4IJHA 2PI2E 4A3JH 3G4SA 3WOFA 2QKIC 2JA8H 1LT6D 2YTVA 1WTOA 4L8JA 2K52A 1PH4A 1NUCA 2EJGC 3OPOA 3MEFA 2K03A 1G6PA 2RSNA 5E4WC 1SRUA 1EQVA 2UXDL 3SR1A 1TR5A 1KABA 1LT3D 5FOBB 2HT1A 4LF7L 3DM1A 1BCPF 2K05A 2JEAI 2IX3A 3G48A 3GTOB 3GTKH 3UDGA 4BBRG 4L5TA 1K83H 4DNTB 3SK4A 1XPRA 3I2ZA 2ZTCA 3PQIA 5JPMC 2VNUD 4KN7C 4JI1Q 2R93B 2VUMG 1MJEA 4XTCS 1ENFA 1ZKOA 4JI6L 3VR6A 3ER0A 1NNXA 5LL6X 3QOLA 2EIFA 3J80c 2F0OA 4NB3A 1I50B 1M8AA 1X3FA 2L9HA 2ZM6L 1MBYA 2K7VA 3VR5A 1G8ZD 1G91A 3A0JA 2D2CC 2QEJC 4GN4B 3HRZC 1PA6A 1FVIA 3JAMc 1VQNA 2JA7B 4DFAA 1JR0D 3J80i 1MGSA 1A63A 1H9MA 1Y1WG 2PCFB 1I3QB 4JK1C 1RHPA 2DN8A 3JAME 2PO4A 3HOYB 1RIPA 5CV5A 1AN8A 1U4MA 3RLFA 3TEHB 2OT2A 2BH2A 3EFXD 1PRTD 1L1OB 2E5LQ 2XWBB 1SN8A 3ITPA 3QB3A 4EQPA 1VQMA 5FLMG 1CQVA 3EBEA 3R3OA 4A3KH 2WFWA 1A62A 1K8MA 2NWGA 2WAQE 1QB5D 2HHHL 2OF1A 1SYEA 3I55A 4HSPA 3NEMA 1PDQA 3TN2A 2A8VA 1YNNC 2WKDA 4HSVA 1HR0L 4FP5D 5HURA 4IPCA 5I9PA 2Z9HA 1TU2B 2AWNA 3N52A 2A68C 4IPHA 2A6EC 4B3RL 4DR4L 1GHJA 4KHPQ 2R93G 2PNRC 3DLLA 1ASYA 1STNA 3M9BA 1X9NA 1D2BA 1I4PA 5M5YH 1N36L 1F9PA 5KIXA 1JE4A 4R4OA 3LNNA 4TRDA 2OEOA 4LF4L 1FD7D 3LGJA 3J81L 4BWGB 3HOXH 1KTKA 1K9MC 2YU9B 2VQEL 1XNQQ 2LXKA 1Y14B 5JEAG 1EOTA 5EPKA 3OWEB 2JA7G 4CDCC 5J1ZA 3SK5A 1VQCA 5DLQE 4B3ML 5C3WA 1TXYA 1S72A 3MXPA 1KDBA 3W2DA 1DOLA 3GV3A 3L7ZC 5KRUA 3HOYG 1VQIA 4DV6L 1IL2A 3S1QB 1HR0W 1EEFD 5IYBG 1BCPB 5KNBA 4JBJA 1YNND 4LFAL 2CWAA 4PG3A 1L0WA 1KIXA 3GTMB 1HQMC 1LT5D 4A3LG 3CCJA 2R7ZH 4FXKC 3I56A 2A68D 2N78A 2PZUA 2EYFA 2A6ED 3T13A 4J15A 3S1RB 3ICEA 1A3TA 1SLJA 2I5LX 3NTHA 1VQHA 1GD7A 4HJAA 2LFNA 4KJNA 4NDXA 3HP3A 2HQLA 1CK1A 5FO7B 5IP9G 4JI0Q 4ME5A 5J22A 4PV1C 1YJWA 2EPBA 3RN5A 2PMZB 1VQ5A 4OELB 1XPOA 3CPWA 1EQQA 3NP8A 2DY8A 2B63B 2E74C 3GQBA 1Q1EA 5K5PA 4Y52H 2IJ0A 4FXGC 1JORA 4E6IA 4U673 3K5MA 2F03A 3CF5A 2AUKA 4DPGA 2DJGC 3FPUB 4POFA 2ZXOA 3MXGA 1TWHB 3NTKA 2KHSA 3RLOA 1HNWQ 1Y8OB 4LK1C 2EJFC 3U9SA 2P5ZX 3GD7A 1L2FA 3JC66 3R2TA 1F2MA 2E2JH 1IYJB 3RLNA 4DK0A 2KVMA 5M3FB 2L12A 4WJWA 4ZQ3A 4UAIA 1BBUA 4YWMA 4DV2Q 4RA8A 1IKMA 5AFWA 1GJXA 4NXML 1B4OA 1LYLA 2F0QA 3UDIA 2B29A 4LFCQ 1TS5A 1H9RA 1RD9D 2C9OA 3BVZA 3S1MH 1TY2A 4IFDJ 3DHQA 1N34L 1RCVD 1DJRD 3KOJA 3GTGH 2YTXA 1PRTB 2F0LA 2XWJB 4ID6A 4XQJA 4DV4L 2ES2A 3NXWA 1JOOA 1ET6A 2EXDA 3ONAB 3S16H 1CTMA 1ZYRC 3ND9A 1EWCA 2J7ZA 3OIQA 1F9SA 3F2UA 5C4XH 4K5XA 2OWOA 1NMGA 2R92H 2KCMA 5IIFA 2XN9C 5J3BA 1STGA 3HOVH 2NN6G 3CCLA 2VZAA 4TSSA 4C2MB 2A6HC 2UXDQ 2NZHA 4IOAA 3CMEA 3V2TA 4LF7Q 1LO5D 3E9IA 1K73C 2B63G 1PFSA 4K8JA 1STBA 3T1YQ 2JA5H 2KECA 2B8FA 1CM9A 1I4XA 4RGMA 1D1KA 5K36G 4KV6A 1EQTA 2WV6D 3KF8B 1VMPA 4TQUS 1F2ZA 2XTIA 3KYHC 1LUZA 1DOKA 1VMCA 3A5ZB 4JI6Q 1A3VA 4JI5L 1SMYC 2WKCA 1UE1A 4DNIA 1SFOB 2VB3X 3VDYA 5F2DA 5C3XA 4A3DB 5GAHC 2ZM6Q 1IZ6A 2DNCA 4H0LC 1HNZL 1TS3A 5M3FG 4A3JB 5KEEA 2JA8B 1O78A 4QY7A 4LF8L 3E0JA 1ZYRD 2EYLA 2CHBD 4M8AA 1PYSB 2OXPA 2E2IH 3B6YA 4FF4A 1PH1A 4I7ZC 1WTHA 5D65A 3EJIA 5E3FA 3H0GB 2KBNA 2XGTA 2K33A 5JOBA 3A7LA 1QJOA 3EN2A 4RCOA 5IYCG 3RZOH 2D62A 3H94A 4ZKCB 2A6HD 5ISRA 4P73A 5CV7A 3S17B 4EQNA 1W2BA 4JBKA 2L55A 4IFDH 4RCNA 2Q2TA 3LX0A 4K2KA 2D0PA 2XVSA 2VB2X 3MXNA 3AYHB 1J8IA 2HHHQ 3P75A 1EIHA 4F88A 3K5NA 3C3LA 3PV0A 2I07B 3K81C 3DMUA 4QUFA 1SMYD 3J80L 1RL2A 2JEBI 1SYGA 5J39A 2IX0A 5EAYA 1EFWA 4UPAA 2ICIA 4HJ8A 1DD2A 4B3RQ 5ELDA 5C3EB 1S3OA 3CAMA 4DR4Q 1ZXTA 4RGTA 5ELCA 2EOTA 1IBML 5IP7H 1KAWA 1FGBD 1N36Q 2O5IC 2E2HB 4DR2L 4H13C 3NWSA 4LF4Q 4A3DG 1E22A 1S4ZA 4YHHL 4A3JG 1E0BA 1VQFA 4L5QA 2VQEQ 1IKLA 2JA8G 4LWCA 4BXXH 3VYRA 1W3SA 3M4OH 1I6HB 3T53B 3A5UA 4GOPC 4B3SL 3OWFA 2CFMA 2NBFA 4WJ3M 1WVLA 1OXTA 4ILWA 2MUYA 1MI2A 4C3IH 4KY5A
chains in the Genus database with same CATH topology
2Q8RE 2EDGA 1L0YB 3TZUA 1A2TA 1OXUA 5CMDA 4L63B 2AQ3B 1TWCB 2L11A 3A55A 2ZT9C 1LTSD 2PW7A 3A8KE 5A35A 4EGVA 1STYA 2HCCA 3K0YA 4V190 1EL0A 1U4RA 4Y7NB 3IAYA 5C44B 3VR4A 1BNZA 1DCZA 5M5XB 3S14B 5C4HA 2FMCA 3FEWX 4A3EB 3Q6SA 1SEBD 3NUCA 1RJTA 3QIAA 1PZKD 4C3HB 1OXXK 5BN5A 2FINB 1PLFA 2NB0A 2F0KA 3EVQA 2NZ1D 3DUZA 4HTHA 5ELFA 2F0IA 1HRJA 5IGEA 5T1GA 3DWPA 1NR4A 4A3FB 2F0NA 4KN4C 2IT1A 5EBDA 2J0TD 2C5CA 2NVXB 2KEEA 1R9TB 3K5OA 1L0XB 5IGFA 2JP1A 3RZDB 2Y0SB 1WCMB 1ILQA 3X3MA 3K57A 4UDUC 3MEHA 1OXSC 3C46A 1WTXA 2WINB 5C4ZA 4QCLA 2EYMA 3A7AB 1SSOA 2B2YC 3MTSA 3P20A 4KKSA 5EGTA 3T56B 1S5BD 4G7HC 4C1NI 4XDXA 3M7NA 1R4PB 3T4AC 1F9RA 1B9MA 5FK9C 4HN7A 1B2TA 3K7AB 2Q8IB 4C3HG 5E1FA 5IT9E 4MN3A 3GTGB 4A93B 1KDCA 2EZVA 2BA0A 2DY7A 5CV9A 1RODA 4IUPA 1RTOA 1BXTA 3MA2B 4A3IB 1LTGD 3LWEA 4QF4A 1G2TA 5HGTA 3HOVB 1MSGA 1GUNA 4R8IA 1QNKA 5LHY1 1UUPA 5M5WB 3VR2A 4PNYA 4LMQD 1WTWA 2RQXA 4K5WA 2NVQB 2MHVA 5I2XA 2LS01 2M2LA 1KNEA 1O80A 2IX1A 1YNJC 4K5VA 4ZAIA 4DK1A 5T1IA 2R3ZA 3C1EA 3VYSA 1GUWA 2N88A 4KK7A 3PUVA 5TSSA 2SDFA 3D4RA 1DXMA 2KEDA 2B2UC 5CC4A 3G7LA 3SEBA 4RHRA 3QOJA 3PO2B 4IALA 1EFID 2JSOA 2EY1A 2F0FA 2N55A 3MAQA 4IFDI 4HAEA 4FYDA 1XTCD 4ULLA 5C0XJ 2WP8J 2YYZA 1FNVA 1D5XC 1YNJD 4XQNA 1CA6A 1V43A 1JWMD 1LV9A 3NQTA 1EZ6A 4EQOA 1E2ZA 1XX8A 2F0TA 1QOHA 2B2YA 4KD4A 4L6TB 1UNSA 4HCSA 2A73B 4OO1I 3ND8A 1PTOH 4J6HA 3VYUA 4BA1I 4XXEA 3H91A 4KY7A 1D1IA 3N6RA 4C3IB 1ESFA 1Q8IA 2B2WC 2F0DA 3R93A 1HPCA 5KGUA 1QG7A 2F0PA 1FYCA 1U4LA 1M4VA 3I90A 2PW5A 3A8JE 1GHKA 4G7ZC 2PZWA 4BA2I 3C2PA 4DGZA 3C1FA 5KNCA 1ET9A 4X3UA 4XYQA 2K04A 5DM73 1NSNS 2F0MA 1ZEQX 2R6GA 1EIGA 1NAPA 4YIJA 3D4WA 2EE1A 2JXMB 4B08A 5CV4A 1ONLA 3OSOA 1ESRA 1HUMA 2FJ2A 1EWHA 4FVMA 1PTOC 2FFKB 5FLXL 1CZWA 4XT3B 4KTAA 1GUSA 3DEPA 3NWTA 3L9AX 2B2UA 4IUTA 1FNWA 3BVGA 2RDHA 5CBAE 3HS0C 5JVG3 1F2LA 2TMPA 2BA1A 4J1MA 4BBSB 1SBBB 2M9VA 2O4XA 3VA5A 5FKAC 4IUUA 5FO9B 3PIP3 3QWNA 1SE3A 2IPKD 5ELEA 3MHBA 4OGQC 1B53A 4MIUA 2RDFA 2JA6B 2AWOA 2QF7A 5EQ0A 1G6ZA 3SHLA 1LACA 1Y8NB 3KUPA 2CQAA 5IGGA 1DYQA 1PTOD 2XNAC 1VF7A 1EY4A 2PZTA 3UI2A 1VDZA 3I91A 2H1EA 2RVLA 5JPNC 1SNMA 5FO8B 2IL8A 1EZ8A 1CHQD 1EY7A 1F9QA 2ID0A 2BCOA 2F0HA 4ZRZA 1S5CD 1TS4A 3CRLC 5CBEE 5IT9L 2M00A 2AQ1B 1D5ZC 1JOQA 1PTOF 1QILA 1Z47A 2RDGA 1QWYA 5KYLA 1G2SA 2SNSA 2B2WA 1ENAA 3A8IE 4ODGA 3DEOA 4RWSC 3EQLC 4KI0A 1TWAB 1HTPA 1KDAA 3GTPB 1EY8A 4A3MB 2H4OA 2L5TA 1EY6A 4ZKBB 2RBMA 3ERQA 3U9OA 4IURA 3M4YA 3T16A 1CT1D 4GZYC 4HR7B 1SYFA 2A5HA 4KJOA 5CORA 3HGBA 4XT1B 1IL8A 4X3KA 5JEAJ 4C3JB 1G291 3H09A 2O5JC 1HTLD 2D9UA 3K5LA 1LTTD 4DAVA 5IGBA 3S2HB 1II3A 2K5DA 3HOWB 3VR3A 2EY6A 1TIID 4PMWA 1ILPA 1GOZA 3CRKC 4K2LA 3WOEA 1LTAD 4C1NK 4CJ0B 1EU3A 4KMUC 2KA7A 4KHVA 5EPJA 1RF2D 1Z6HA 3GTKB 2A69C 4NP5A 1JC7A 5NUCA 3P7JA 4FNFA 1K83B 3RUZA 3TP8A 1QNUA 2K01A 1NR2A 3QO2A 4RKLA 1UAPA 3M7GA 2F0SA 1HFGA 3I8ZA 1O7ZA 3A54A 1TQOA 3CHBD 1Q12A 3TDQA 4M1UB 1XYIA 3W3AA 2HCIA 2LY7A 4QB4A 3MFGA 2BE5C 2CVRA 4V0BA 4WRDA 3JAML 4OO1H 3AU7A 4DA2A 3BZDB 5JEAH 1QCBD 1AP0A 1PTOB 4A3KB 1I4RA 3HKZB 2A69D 1C4QA 2EY5A 5CGKA 4QUCA 1Y1VB 2BDOA 2MP1A 3EA6A 3Q24A 2F1MA 1SNCA 1RTNA 5EKIA 2FMMA 1I6VC 4CJ1B 1PFNA 4DU9A 5M5YB 2BE5D 3E6ZX 2HDLA 3BYYB 1X32A 1U9RA 3SDZA 2B2TC 4NW2A 2SNMA 1PYWD 3HOXB 3A56A 1HXYD 3BDOA 1JICA 1KLGD 3FVQA 1Q90A 1LLRD 2E75C 2L4NA 4ZK9B 1PFBA 2X69A 2SOBA 2EYHA 4CHTB 4N9PA 2QDBA 4IZ8A 5C0XI 1HA5A 1T5EA 2R61A 2G9HD 1EU4A 2F3WA 3J81E 3K58A 2Q8TA 4WORA 2R7ZB 1C48A 2ICEC 4XIGS 2NTSA 3P1HA 4ZUJA 1GUOA 4IN3A 3M85A 2XSCA 1C8CA 1A3UA 1BO0A 1LT4D 2AQ2B 3PUWA 3NQIA 2F3VA 5A2QE 1ML0D 4PMCA 1FR3A 5DNFA 1SYBA 4HCEA 1V1OA 1H9SA 1F77A 3KBGA 2XRSD 1PZJD 4KY6A 2NN6H 1Y8PB 1LTRD 3D6CA 4G57A 5C5MA 5I6WA 2E2JB 3PIO3 3TMEA 2WB1B 5K36H 4CKCA 1STAA 1H9KA 1V1PA 1HCZA 1PMRA 1PZID 4I65A 2KCCA 3S1MB 2CW0C 2B39A 5D3IB 2K6AA 3D6WA 3FDTA 5EBCA 4DN4M 1XWEA 2HQEA 4QIWB 3TZDA 3AB9A 3AMUA 4HMIA 3S16B 2B8GA 4ZLTF 1D5MC 3SXHA 4XYOA 5C4XB 2F0GA 4AYBB 1IYVA 2R92B 4H7BA 3HZXA 4EVOA 2NTTA 5CV8A 1H9SB 5JJZA 4CKBA 1IYUA 2B2TA 4IUQA 2JA5B 4J8QA 5EPLA 1SE4A 4RH6A 2F0VA 3FPPA 1DM0B 1CI3M 2CW0D 1WTPA 3G6JB 3NE5B 1V1PB 2NYZD 3OOCA 3Q0AA 2KOLA 4K6LA 5CV6A 2J4XA 2E76C 1ICWA 2E2IB 1B44D 2X6LA 3S9WA 2JE6I 4RFBA 3RZOB 2LKVA 5D3DA 3MC0B 1U4PA 4Q0FA 1E2WA 2K28A 3GV6A 3K6OA 4U68A 1AEXA 2F0UA 1TY0A 4X3TA 1PRTC 1NCVA 1HHVA 1Q1BA 3FMCA 3IKJA 1QE6A 3PMFA 1STHA 4O42A 1WTVA 2KJXA 1RDPD 2TSSA 2E2DC 4LAAA 4P2CB 4RGNA 1BF4A 1RKNA 3LWUA 2BDNA 1H9JA 1TS2A 1HFNA 3J80E 5DEHA 2MGSA 3BDCA 1JWUD 3X3NA 1LTID 3SK6A 4DNRB 3IFTA 4KD3A 1EYCA 3M4OB 4RAUC 3CQZB 3VYTA 1JWSD 3PUZA 3MXUA 3D8GA 1EYAA 4X3SA 3GTLB 3BDLA 1R4QB 4IFDG 1J9OA 3MVVA 4BY7B 1SYCA 4K8IA 1PRTF 1Q3LA 1CFMA 2FHTA 3Q23A 1BUVT 3OMCA 5ELBA 2WACA 5EKKA 4JBWA 1AZPA 4DAYA 5C0XH 1X3QA 4A3BB 4RKBA 3V96A 4CBVA 2A74C 3M3YB 4OO1G 4WFN3 4C56C 3IL8A 2PYKA 1AFPA 4NMZA 1PFMA 1TKWB 3I4MB 1SNOA 3FKIB 5D14A 4F87A 5COYA 1E2VA 3SK8A 3Q22A 4C3IG 3WDNA 1JOKA 2KCNA 4O1NA 2PPBC 1I4GA 3OMGA 3D4DA 3I70A 3S15B 2Z8LA 5A2QL 4IUNA 3BYTB 4XQQA 2EXZA 4BY1B 2XIWA 3SVMA 4IUVA 1W6KA 3S2DB 3OHXC 4B9WA 4FF2A 5KYIA 3I3CA 3J7YW 2NN6I 1EY5A 2D5DA 3QG1A 3PO3B 3TSSA 3PUYA 3RMHA 2F0EA 1WD0A 4FO2A 2Z1CA 2NVTB 4MHEA 2EYOA 5LL6S 2K5QA 3KF8A 1WTRA 2GA4B 3NPPA 4ZUIA 2HDMA 1SJHD 1HA6A 3QJYA 5G3LD 2EYPA 4OL7A 2PQEA 4OIJA 4ABNA 4DAPA 5I2YA 3HOUB 1EEID 3BVMA 5CR3A 1X3PA 2RKSA 1BDOA 1B50A 1SYDA 5CYUA 2I46A 2G9DA 3D3RA 5G3LF 1A2UA 1XXGA 3R2IA 1F2YA 1TT2A 5IOCA 1A15A 3KBXA 1EYDA 2F0WA 1O7YA 1DOMA 3EROA 1IHZA 3H3VC 2DNEA 3MZ5A 5M3MB 2EYJA 3L3OC 3I4NB 3NBIA 1EY9A 3NTIA 1AW7A 3CKIB 3DWAA 5IGDA 3TP7A 4F7XA 3MWYW 1K8OA 2AUJD 1B9NA 3BS1A 4OHJA 1AZQA 4IQZA 1PXUA 1LABA 4CGYB 1D6EC 1LTBD 2RSOA 5M9OA 5C4JB 2O2LD 4HEDA 1OXVA 3IFDA 1Y69U 4F8MA 5JVH3 1CQFA 1KNAA 4C3JG 2B2VC 5EKLA 2IWHA 1SNPA 3ZYYX 4RGOS 4FXDA 1T5XD 5I6YA 3NBHA 2IW3A 1BR9A 2EJMA 4FF1A 2WIIB 4KKUA 1KLUD 4RHSA 4NKLA 2BOSA 2XRQD 3I4LA 1CA5A 2RA4A 3VA7A 4CKEA 1W6JA 5C5LA 3OIPA 2F0JA 1DONA 3E5SA 1BQQT 3S1NB 3FRPB 1STEA 2ZXRA 1GUTA 1FNUA 3NK9A 2Z4IA 2V4DA 5KNDA 5E4XA 1V8QA 4DF7A 1O7LA 4K6DA 4S3SA 4H44C 4HMJA 4A3GB 1S5FD 3GTQB 1S5DD 3I73A 1HQRD 2L1BA 1BBXC 1SAPA 1TWFB 2WAQB 3I72A 3T51B 1MD2D 3TBIB 2NVYB 1SE2A 1CHPD 1JB3A 1UEAB 5JAVA 3H6MA 5IODA 2K32A 2F4IA 1GXDC 5I4DA 2X6GA 2K1BA 1SNQA 2SEBD 1BOSA 1TWGB 3TP6A 3KLRA 2VXWA 3V05A 1TVXA 3URYA 3KLSX 5IGCA 3GTJB 3RD4A 3HOZB 1JCKB 1I4HA 3J7AV 1A6XA 5FLXE 2KUMA 3J7AF 4QMGA 5DAUA 4LJZC 2QILA 1EY0A 4G4KA 1WD1A 3CU7A 3NHHA 2MPMA 4ZYSA 5DM63 2EVBA 2QCPX 4DXFA 3HEJA 5BN3A 4K14A 2B2VA 1VCIA 2L0CA 3D31A 3SE0A 5C0XG 3DXJC 5EJWA 3K59A 5BN4A 4KKTA 2LMCB 5C6AA 1WTQA 3GO5A 4FF3A 2MJ8A 1I4QA 1JQYD 1B3AA 2EY2A 3DWQA 3PUXA 3KLSA 2NUCA 3O13A 3R8BA 1BCPC 3OW7A 2Z4HA 4BS9A 1HUNA 1IW7C 4BBRB 4KHZA 2ZXPA 3KK7A 4TKOB 1S5ED 2VUMB 1GUGA 1KAAA 2K5WA 2JYOA 4OIKA 4PQXA 4Q5VA 1MSHA 2KQ3A 4B9XA 3TP5A 1ENCA 4R8NA 1VF5C 4PMBA 5I9OA 2HUGA 4CJ2C 4R9WA 4N9TA 1SNDA 3NSWA 2ENBA 3HG9A 4Z9CB 4DXGA 1SXTA 1Y1WB 1BCPD 3GP7A 1B1ZA 1SJED 1SDFA 1Z7TA 1DZ1A 1OO9B 3BG3A 1CZGA 3MFYA 4G7OC 1IW7D 3WOFA 2QKIC 1LT6D 1WTOA 4L8JA 1NUCA 2EJGC 3OPOA 2K03A 2RSNA 5E4WC 1EQVA 3SR1A 1TR5A 1KABA 1LT3D 5FOBB 3DM1A 1BCPF 2K05A 2JEAI 2IX3A 3GTOB 4DNTB 3SK4A 5JPMC 2VNUD 4KN7C 2R93B 4XTCS 1ENFA 1ZKOA 3VR6A 5LL6X 3QOLA 2F0OA 1I50B 1M8AA 2L9HA 1MBYA 2K7VA 3VR5A 1G8ZD 1G91A 2D2CC 2QEJC 3HRZC 2JA7B 4DFAA 1JR0D 1MGSA 1H9MA 2PCFB 1I3QB 4JK1C 1RHPA 2DN8A 3JAME 2PO4A 3HOYB 5CV5A 1AN8A 1U4MA 3RLFA 2OT2A 3EFXD 1PRTD 2XWBB 3QB3A 3ITPA 4EQPA 1CQVA 3R3OA 1K8MA 2NWGA 1QB5D 2OF1A 1SYEA 4HSPA 1PDQA 3TN2A 1YNNC 2WKDA 4HSVA 4FP5D 5HURA 5I9PA 1TU2B 2AWNA 3N52A 2A68C 2A6EC 1GHJA 2PNRC 1STNA 1D2BA 1I4PA 1F9PA 5KIXA 1JE4A 3LNNA 4TRDA 2OEOA 1FD7D 3J81L 4BWGB 2YU9B 1KTKA 5JEAG 1EOTA 5EPKA 3OWEB 5J1ZA 3SK5A 5C3WA 3MXPA 1KDBA 3W2DA 1DOLA 3GV3A 3L7ZC 5KRUA 3S1QB 1EEFD 1BCPB 5KNBA 1YNND 3GTMB 1HQMC 1LT5D 4FXKC 2A68D 2PZUA 2EYFA 2A6ED 3T13A 3S1RB 1A3TA 3NTHA 2LFNA 4KJNA 4NDXA 3HP3A 1CK1A 5FO7B 4ME5A 5J22A 4PV1C 2EPBA 2PMZB 3NP8A 2DY8A 2B63B 2E74C 3GQBA 1Q1EA 5K5PA 2IJ0A 4FXGC 1JORA 4E6IA 4U673 3K5MA 2F03A 2AUKA 3FPUB 2ZXOA 3MXGA 1TWHB 3NTKA 2KHSA 1Y8OB 4LK1C 2EJFC 3U9SA 3GD7A 3R2TA 1F2MA 4DK0A 2KVMA 5M3FB 2L12A 4WJWA 4ZQ3A 4UAIA 1GJXA 1IKMA 4RA8A 5AFWA 1B4OA 2F0QA 1TS5A 1H9RA 1RD9D 2C9OA 3BVZA 1TY2A 4IFDJ 3DHQA 1RCVD 1DJRD 1PRTB 2F0LA 2XWJB 4ID6A 4XQJA 3NXWA 1JOOA 1ET6A 3ONAB 1CTMA 1ZYRC 3ND9A 1EWCA 2J7ZA 3OIQA 1F9SA 3F2UA 4K5XA 5IIFA 2XN9C 1STGA 2NN6G 4TSSA 4C2MB 2A6HC 3V2TA 1LO5D 4K8JA 1STBA 2KECA 2B8FA 1CM9A 4RGMA 1I4XA 1D1KA 5K36G 4KV6A 1EQTA 2WV6D 4TQUS 1VMPA 1F2ZA 1DOKA 1VMCA 1A3VA 1SMYC 2WKCA 1SFOB 2VB3X 5F2DA 5C3XA 4A3DB 2DNCA 4H0LC 1TS3A 4A3JB 5KEEA 2JA8B 1O78A 3E0JA 1ZYRD 2EYLA 2CHBD 4M8AA 2OXPA 4FF4A 4I7ZC 5D65A 3EJIA 5E3FA 3H0GB 2K33A 5JOBA 3A7LA 1QJOA 4RCOA 2D62A 3H94A 4ZKCB 2A6HD 5ISRA 5CV7A 3S17B 4EQNA 2L55A 4IFDH 4RCNA 3LX0A 4K2KA 2XVSA 2VB2X 3MXNA 1J8IA 3P75A 1EIHA 4F88A 3K5NA 3C3LA 3PV0A 2I07B 3DMUA 4QUFA 1SMYD 3J80L 2JEBI 1SYGA 5J39A 2IX0A 2ICIA 1DD2A 5ELDA 5C3EB 1ZXTA 4RGTA 5ELCA 2EOTA 1FGBD 2O5IC 2E2HB 4H13C 3NWSA 1S4ZA 1E0BA 1IKLA 3VYRA 1I6HB 3T53B 3OWFA 2NBFA 1WVLA 1OXTA 4ILWA 2MUYA 1MI2A 4KY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9V A;  2I46 A;  5I2Y A;  5I2X A; 
#chains in the Genus database with same CATH topology
 4X66 L;  2Q8R E;  3CQZ H;  2EDG A;  3H0G G;  1XTD A;  4B3M Q;  2PQA A;  1KC8 C;  1L0Y B;  1YJ9 A;  3TZU A;  1A2T A;  5GAE C;  1OXU A;  5CMD A;  4DV1 L;  4GNX C;  4L63 B;  2AQ3 B;  1TWC B;  2L11 A;  3A55 A;  2ZT9 C;  1LTS D;  2PW7 A;  4LFA Q;  3GTL H;  3A8K E;  4JC0 A;  5A35 A;  4EGV A;  1STY A;  2UU9 L;  3KLW A;  1SRO A;  2HCC A;  3K0Y A;  4V19 0;  4BY7 H;  1EL0 A;  2HIV A;  4UP8 A;  1U4R A;  4Y7N B;  1X3E A;  4GLV B;  3IAY A;  5C44 B;  1VQG A;  3VR4 A;  1BNZ A;  3CD6 A;  1DCZ A;  1UE7 A;  4X62 L;  1YVC A;  5M5X B;  3S14 B;  1BBW A;  3CCQ A;  5C4H A;  3KJP A;  2FMC A;  4DK6 C;  3FEW X;  4A3E B;  1J5E Q;  2UXB L;  3Q6S A;  1SEB D;  4A3B H;  1ICF B;  3NUC A;  5C3E G;  4DV5 L;  1RJT A;  4WJ4 A;  1XNR Q;  1EUJ A;  5H1S E;  3M3Y H;  4OX9 L;  2F4V L;  5FLX c;  3QIA A;  3ZJY C;  1PZK D;  4C3H B;  1OXX K;  5JJI A;  5BN5 A;  2FIN B;  1PLF A;  2NB0 A;  2F0K A;  3I4M H;  3EVQ A;  3FKI H;  1E3P A;  2NZ1 D;  3DUZ A;  4HTH A;  5ELF A;  2F0I A;  1HRJ A;  5IGE A;  5T1G A;  2PQA B;  3DWP A;  1NR4 A;  4A3F B;  2F0N A;  4KN4 C;  2IT1 A;  1C7Y A;  5EBD A;  2J0T D;  2C5C A;  2NVX B;  1N9W A;  1QUQ A;  3S15 H;  2KEE A;  1R9T B;  3K5O A;  2ZTD A;  1L0X B;  5IGF A;  2JP1 A;  5BR8 Q;  3RZD B;  2Y0S B;  1WCM B;  2KHI A;  1ILQ A;  4H02 A;  3W5O A;  1N34 Q;  4BY1 H;  3X3M A;  5IYD G;  3K57 A;  4UDU C;  3S2D H;  3MEH A;  1OXS C;  1EIY B;  2YV5 A;  4X65 L;  3C46 A;  1WTX A;  4UP9 A;  4GKK L;  2WIN B;  5C4Z A;  4QCL A;  1UWV A;  2EYM A;  3A7A B;  5C44 G;  1SSO A;  1QZG A;  3PO3 H;  2B2Y C;  3MTS A;  3P20 A;  4P75 A;  4KKS A;  5EGT A;  2VQF L;  3PGZ A;  3T56 B;  1S5B D;  3HFZ B;  4G7H C;  4C1N I;  4XDX A;  4A3E G;  4LF5 L;  5LMU L;  3M7N A;  1VQE A;  2NVT H;  1R4P B;  3T4A C;  1F9R A;  1B9M A;  5FK9 C;  5IT9 c;  4HN7 A;  3PIP A;  1B2T A;  1B7Y B;  1B70 B;  3K7A B;  3W1B A;  4IPD A;  2Q8I B;  4C3H G;  5IY0 A;  5E1F A;  5IT9 E;  1K0S A;  4MTK A;  4GOP A;  4MN3 A;  3GTG B;  4JI5 Q;  2JK8 A;  4A93 B;  1KDC A;  1X55 A;  2EZV A;  4I7A A;  2BA0 A;  2DY7 A;  5CV9 A;  1ROD A;  4IUP A;  1RTO A;  1BXT A;  3MA2 B;  4YCV A;  1PH8 A;  4DR5 L;  3HOU H;  1D8L A;  4A3F G;  1LTG D;  4A3I B;  2UUA L;  3LWE A;  1U0L A;  1M90 C;  4QF4 A;  1KXL A;  4LF8 Q;  5HGT A;  1G2T A;  1K8A C;  4GNX A;  3HOV B;  1MSG A;  3G71 A;  1GUN A;  4PZ8 A;  4JI8 L;  2QGQ A;  4R8I A;  1QNK A;  1WCM G;  5LHY 1;  1UUP A;  4R4I A;  5M5W B;  3VR2 A;  4PNY A;  4LMQ D;  4C3J H;  1WTW A;  4LFB L;  4AQY L;  3M4Q A;  2RQX A;  3IRB A;  4K5W A;  2NVQ B;  2MHV A;  5I2X A;  2LS0 1;  3ERS X;  2M2L A;  4JV5 L;  4HIO A;  1KNE A;  3S2H H;  1O80 A;  2IX1 A;  1YNJ C;  5M3M H;  4K5V A;  5FJ8 G;  4ZAI A;  3I4N H;  2E8G A;  4DK1 A;  2L15 A;  5T1I A;  1Q82 C;  2MQH A;  4DV7 L;  2R3Z A;  3C1E A;  3VYS A;  1GUW A;  2N88 A;  4KK7 A;  3PUV A;  5TSS A;  2SDF A;  3D4R A;  2AKW B;  2HD3 A;  3KF6 A;  4CDE C;  4GOP B;  1DXM A;  4GN3 B;  1Z9F A;  2KED A;  5L37 A;  4IO9 A;  4HJ9 A;  2B2U C;  5CC4 A;  3G7L A;  3SEB A;  4GKJ L;  4RHR A;  1IBM Q;  1JMC A;  3QOJ A;  3PO2 B;  4IAL A;  4A93 G;  2K5H A;  1EFI D;  3TQY A;  2JSO A;  4DR2 Q;  1N8R C;  2EY1 A;  2F0F A;  2N55 A;  3MAQ A;  4A3I G;  4IFD I;  4B3S Q;  4HAE A;  1K3R A;  4FYD A;  1XTC D;  5AJ3 L;  1KQS A;  1C9O A;  5C4J H;  4ULL A;  5C0X J;  4JYA L;  2WP8 J;  2YYZ A;  4X66 Q;  1FNV A;  1D5X C;  4A76 A;  1YNJ D;  4XQN A;  1CA6 A;  1V43 A;  1JWM D;  1LV9 A;  3NQT A;  1EZ6 A;  4EQO A;  1E2Z A;  1XX8 A;  2F0T A;  1QOH A;  2B2Y A;  4KD4 A;  4L6T B;  1UNS A;  2F52 A;  2UU9 Q;  4HCS A;  2A73 B;  4OO1 I;  5GRO A;  1VQO A;  3CPF A;  1CKN A;  3ND8 A;  4JI7 L;  4NPS A;  4LF6 L;  2UUC L;  1PTO H;  4J6H A;  3VYU A;  3JAM i;  4BA1 I;  5LMN L;  4R1J A;  4XXE A;  1Y1V H;  3H91 A;  4KY7 A;  4X62 Q;  1D1I A;  3CC2 A;  3N6R A;  4C3I B;  4QL5 A;  2UXB Q;  1ESF A;  1NTG A;  1Q8I A;  2B2W C;  4DV5 Q;  1YBY A;  2F0D A;  3R93 A;  1NY4 A;  3PO2 G;  1HPC A;  4OX9 Q;  2F4V Q;  4YWK A;  5KGU A;  1QG7 A;  2F0P A;  1FYC A;  1U4L A;  2V1C C;  1M4V A;  4DK3 C;  1SE8 A;  3I90 A;  2PW5 A;  3A8J E;  1KRT A;  1GHK A;  1VQD A;  4G7Z C;  4PZ6 A;  3FP9 A;  2PZW A;  4BA2 I;  3C2P A;  4DGZ A;  1EWI A;  2JN4 A;  3C1F A;  1Q86 C;  5KNC A;  4A3G H;  3NEL A;  1WOC A;  3PSI A;  1MHW C;  1ET9 A;  4X3U A;  3GTQ H;  4XYQ A;  2K04 A;  5DM7 3;  1NSN S;  2F0M A;  1M1K C;  1ZEQ X;  2R6G A;  1EIG A;  1NAP A;  5LMN W;  4YIJ A;  3D4W A;  2K50 A;  5ELN A;  2EE1 A;  4DUY L;  2JXM B;  4B08 A;  5CV4 A;  1VQL A;  1TWF H;  3T1H L;  1S40 A;  1ONL A;  3OSO A;  1ESR A;  1HUM A;  2FJ2 A;  1CKN B;  4LUZ A;  1EWH A;  3OW2 A;  4N8F A;  2Y0S E;  4FVM A;  1PTO C;  2FFK B;  4AIM A;  1K8G A;  4X65 Q;  2UUB L;  3U4V A;  5FLX L;  3L2P A;  3CCU A;  1CZW A;  4XT3 B;  1B8A A;  4KTA A;  1GUS A;  4JPB W;  4P74 A;  1TWG H;  3DEP A;  1GO3 E;  1YNX A;  3NWT A;  3L9A X;  1XPU A;  2B2U A;  4IUT A;  3GTJ H;  4LF5 Q;  1FNW A;  3BVG A;  5LMU Q;  4EQ5 A;  2RDH A;  3BZK A;  3HOZ H;  2ALY B;  5CBA E;  3HS0 C;  1WFQ A;  5JVG 3;  1F2L A;  2TMP A;  2BA1 A;  4J1M A;  4BBS B;  1SBB B;  2M9V A;  2O4X A;  3VA5 A;  5FKA C;  4IUU A;  5FO9 B;  1HZA A;  3PIP 3;  3QWN A;  4HIK A;  1SE3 A;  2IPK D;  5ELE A;  3MHB A;  4OGQ C;  1B53 A;  1EOV A;  4MIU A;  2RDF A;  2JA6 B;  2AWO A;  2QF7 A;  5EQ0 A;  2ZJP A;  1VQ6 A;  1G6Z A;  4DV3 L;  3SHL A;  4QIW E;  1LAC A;  1Y8N B;  1Q81 C;  3KUP A;  2CQA A;  5IGG A;  2B3G A;  2UUA Q;  1DYQ A;  1PTO D;  1HZC A;  1VF7 A;  2XNA C;  1EY4 A;  2PZT A;  2KEN A;  1VDZ A;  3I91 A;  3UI2 A;  2H1E A;  2RVL A;  5JPN C;  1SNM A;  5FO8 B;  2IL8 A;  4HJ5 A;  4AYB E;  1EZ8 A;  1CHQ D;  1EY7 A;  3FHW A;  3G6E A;  1F9Q A;  2ID0 A;  2BCO A;  2F0H A;  4DR6 L;  4ZRZ A;  1S5C D;  4P72 A;  1TS4 A;  1K0R A;  3CRL C;  1JT8 A;  5CBE E;  5IT9 L;  1YHA A;  1V9P A;  4AQY Q;  2M00 A;  2AQ1 B;  1D5Z C;  1YIJ A;  1C0A A;  1PTO F;  1JOQ A;  1QIL A;  2OTL A;  1Z47 A;  3RR5 A;  2RDG A;  4JV5 Q;  3DM3 A;  1QWY A;  5KYL A;  1G2S A;  4A3C G;  1J6Q A;  4YY3 L;  2SNS A;  4UP7 A;  2B2W A;  2K75 A;  1ENA A;  4DUZ L;  3SGI A;  3A8I E;  4ODG A;  3PIO A;  3DEO A;  4RWS C;  4DV7 Q;  1YZ6 A;  3EQL C;  4KI0 A;  1TWA B;  1HTP A;  1KDA A;  3GTP B;  2RHQ B;  4HJ7 A;  1EY8 A;  4A3M B;  2H4O A;  2L5T A;  3TRE A;  1EY6 A;  4BBR H;  4ZKB B;  4BBS G;  2RBM A;  1JB7 A;  3ERQ A;  3U9O A;  4IUR A;  3M4Y A;  3T16 A;  1CT1 D;  4GZY C;  2VUM H;  4HR7 B;  4GKJ Q;  1SYF A;  2A5H A;  4KJO A;  5COR A;  3HGB A;  1QVC A;  4XT1 B;  1IL8 A;  2JA6 G;  4X3K A;  3U58 A;  4O0A A;  5JEA J;  4JI3 L;  4C3J B;  1G29 1;  3H09 A;  2O5J C;  1KHI A;  1HTL D;  2D9U A;  4GLA C;  4EX5 A;  3K5L A;  1LTT D;  4DAV A;  5IGB A;  3S2H B;  1II3 A;  2K5D A;  4DR1 L;  3HOW B;  2VL6 A;  3VR3 A;  3CCM A;  2EY6 A;  1TII D;  5AJ3 Q;  4PMW A;  3F2B A;  1MJC A;  1ILP A;  1GOZ A;  3CRK C;  1AE2 A;  4K2L A;  3WOE A;  1LTA D;  3F8T A;  4C1N K;  4CJ0 B;  1Y1W H;  1EU3 A;  4KMU C;  2KA7 A;  4KHV A;  3K80 C;  5EPJ A;  5ELO A;  1RF2 D;  2G5D A;  5FLM H;  1Z6H A;  2N3S A;  3GTK B;  2CWP A;  2A69 C;  4NP5 A;  1JC7 A;  4GS3 A;  5NUC A;  3NEN A;  3P7J A;  4FNF A;  1K83 B;  3RUZ A;  4JI7 Q;  4LF6 Q;  3TP8 A;  1QNU A;  2K01 A;  1NR2 A;  3QO2 A;  2CH4 W;  2RCF A;  4RKL A;  4LF9 L;  1UAP A;  3M7G A;  2F0S A;  5LMN Q;  1HZB A;  1N32 L;  2K14 A;  1HFG A;  3I8Z A;  1O7Z A;  3A54 A;  1TQO A;  3BU2 A;  3CHB D;  1Q12 A;  4A3M G;  3TDQ A;  3E9H A;  4M1U B;  4R4C A;  1XYI A;  3W3A A;  2HCI A;  2LY7 A;  3E0E A;  1IXR A;  2R7D A;  2R93 H;  1AE3 A;  4QB4 A;  1HR0 Q;  3MFG A;  2BE5 C;  2CVR A;  4V0B A;  1CKM A;  4GN5 A;  1JE5 A;  4CDD C;  4WRD A;  1VQ9 A;  3JAM L;  1I50 H;  4OO1 H;  1N33 L;  3S24 A;  2IHE A;  2JJQ A;  3AU7 A;  4DA2 A;  3BZD B;  3HOW G;  4DR3 L;  2RCN A;  1VQJ A;  4LW1 A;  5JEA H;  2ASB A;  1QCB D;  1AP0 A;  1PTO B;  4A3K B;  1I4R A;  3HKZ B;  2A69 D;  1C4Q A;  1PH5 A;  2JA7 H;  2EY5 A;  5CGK A;  4QUC A;  1Y1V B;  4QJF A;  2BDO A;  2MP1 A;  3EA6 A;  3Q24 A;  1I3Q H;  2F1M A;  1SNC A;  3HOY H;  4DUY Q;  3CCV A;  5IYB H;  3J7A 5;  1RTN A;  3T1H Q;  5EKI A;  1K3B C;  2FMM A;  4YCW A;  4A3L H;  1IBL L;  1I6V C;  4DV6 Q;  4CJ1 B;  1PFN A;  3TS0 A;  1AH9 A;  2UUB Q;  3MXN B;  4DU9 A;  2NZO A;  3K0X A;  1MKH A;  5M5Y B;  2BE5 D;  3E6Z X;  1XJV A;  2HDL A;  3BYY B;  1X32 A;  3I4O A;  1U9R A;  3SDZ A;  2B2T C;  5IP9 H;  4NW2 A;  2SNM A;  2CKZ B;  1PYW D;  3HKS A;  2DJF C;  3KDF A;  3HOX B;  2F3I A;  1HXY D;  3A56 A;  3BDO A;  1JIC A;  1KLG D;  3FVQ A;  1Q90 A;  1LLR D;  2E75 C;  2L4N A;  4ZK9 B;  1PFB A;  2X69 A;  2SOB A;  1X54 A;  3UE1 A;  2EYH A;  4CHT B;  3AEV A;  4N9P A;  2QDB A;  4IZ8 A;  4AH6 A;  5C0X I;  1HA5 A;  1T5E A;  3ULL A;  2R61 A;  3E3X A;  2YU9 H;  2G9H D;  1H95 A;  4DKA C;  1EU4 A;  2F3W A;  3J81 E;  3K58 A;  1HH2 P;  4DV3 Q;  1E7Z A;  2Q8T A;  4A3K G;  4WOR A;  2R7Z B;  1C48 A;  2ICE C;  4XIG S;  2NTS A;  3P1H A;  4L5R C;  4ZUJ A;  4JVZ A;  5JJL A;  1GUO A;  4IN3 A;  1L1O C;  4ZCK A;  1JJ2 A;  3M85 A;  1VQK A;  1KRS A;  2XSC A;  3S1Q H;  1C8C A;  1A3U A;  4NXM Q;  1BO0 A;  1LT4 D;  4KHP L;  2AQ2 B;  3PUW A;  3GTM H;  2ATW A;  5JJK A;  3NQI A;  4B3T L;  2F3V A;  5A2Q E;  1VQP A;  1ML0 D;  4PMC A;  1FR3 A;  2OQ0 A;  3S1R H;  5DNF A;  1SYB A;  4HCE A;  1V1O A;  1H9S A;  3KDF B;  1F77 A;  4DV4 Q;  3KBG A;  1G51 A;  2XRS D;  1PZJ D;  4YY3 Q;  4KY6 A;  2NN6 H;  3TRZ A;  1Y8P B;  4YWL A;  3HOX G;  1NBW A;  3BJU A;  1LTR D;  4DUZ Q;  3D6C A;  4G57 A;  5C5M A;  3L0O A;  2B63 H;  4RMF A;  5I6W A;  2E2J B;  3PIO 3;  4MTN A;  3H3V I;  3TME A;  2WB1 B;  3CCS A;  5K36 H;  4CKC A;  1STA A;  2QW7 A;  1H9K A;  1V1P A;  1HCZ A;  4OEM B;  1PMR A;  1PZI D;  4JW0 A;  2OQK A;  1TWH H;  4ME3 A;  4JBM A;  4I65 A;  1KD1 C;  2KCC A;  3S1M B;  2CW0 C;  2B39 A;  5D3I B;  2K6A A;  3D6W A;  3FDT A;  1PYB A;  5EBC A;  3U50 C;  4DN4 M;  1XWE A;  2HQE A;  4QIW B;  3TZD A;  1E24 A;  2R7Z G;  4NXN L;  3AB9 A;  3BZC A;  1P16 A;  4HMI A;  3AMU A;  4IPG A;  3S16 B;  3AFQ A;  2B8G A;  4GLX A;  4ZLT F;  1D5M C;  4DR1 Q;  4JI0 L;  2QEX A;  3SXH A;  1QUQ B;  1HNZ Q;  4XYO A;  1E1T A;  5C4X B;  4DAM A;  2F0G A;  4AYB B;  1IYV A;  2R92 B;  4H7B A;  3HZX A;  4FDB A;  5IYC H;  4UHV A;  4EVO A;  1X65 A;  2NTT A;  1Q7Y C;  2Y0S G;  5CV8 A;  4TVA B;  1H9S B;  4OON A;  1NE3 A;  4CKB A;  5JJZ A;  5IWA L;  1IYU A;  2B2T A;  4IUQ A;  2JA5 B;  4J8Q A;  5EPL A;  1SE4 A;  4RH6 A;  3D0F A;  4LUV A;  4JI4 L;  2F0V A;  2MO0 A;  4JOI C;  3FPP A;  1DM0 B;  4C2M H;  4LF9 Q;  1JJG A;  1A0I A;  4DV2 L;  1CI3 M;  2CW0 D;  3ULJ A;  1WTP A;  3G6J B;  3NE5 B;  1V1P B;  2NYZ D;  1FJG L;  1EYG A;  1HJP A;  3OOC A;  1LTL A;  1Q8K A;  2WB1 G;  3Q0A A;  1XMO L;  1PHJ A;  2KOL A;  4K6L A;  5CV6 A;  1O7I A;  2J4X A;  2E76 C;  1ICW A;  2E2I B;  1B44 D;  2X6L A;  4MNO A;  3S9W A;  1SFO H;  2JE6 I;  1HNX L;  4A3D H;  4RFB A;  3RZO B;  3RNU A;  2LKV A;  1K28 A;  3AQQ A;  5D3D A;  1N33 Q;  3MC0 B;  4MZ9 A;  1L1O A;  1U4P A;  1UE5 A;  1XMQ L;  4Q0F A;  1E2W A;  4DR3 Q;  2K28 A;  3GV6 A;  3K6O A;  2DUD A;  4U68 A;  1AEX A;  1MIU A;  2F0U A;  4YHH Q;  1TY0 A;  4GNX B;  4X3T A;  5C4X G;  4AYB G;  2R92 G;  1PRT C;  1VQ7 A;  3H0G H;  1NCV A;  1CUK A;  3HOV G;  3HKZ E;  3T1Y L;  1HHV A;  1Q1B A;  3FMC A;  3IKJ A;  1QE6 A;  3PMF A;  5HY6 A;  3I7F A;  1STH A;  4O42 A;  3S17 H;  1WTV A;  2KJX A;  2Z6K C;  1RDP D;  2TSS A;  3GDE A;  5GAG C;  2JA5 G;  1FGU A;  2E2D C;  2LSS A;  4LAA A;  4P2C B;  1YHQ A;  1IBL Q;  3J81 j;  2RF4 A;  4DV1 Q;  3CCR A;  4RGN A;  4X64 L;  1BF4 A;  2VW9 A;  2EQS A;  1FL0 A;  1RKN A;  3LWU A;  2BDN A;  1H9J A;  3PF5 A;  1TS2 A;  1HFN A;  2OCE A;  2KCT A;  1SR3 A;  3J80 E;  5DEH A;  2MGS A;  2VS1 A;  3BDC A;  1JWU D;  3X3N A;  2N8N A;  3KF6 B;  1LTI D;  3SK6 A;  4DNR B;  3IFT A;  4KD3 A;  1EYC A;  3M4O B;  5C3E H;  2FXQ A;  2LXJ A;  4RAU C;  3CQZ B;  1CSQ A;  3VYT A;  1PH6 A;  4DV0 L;  2E2H H;  3S1N H;  1PH3 A;  1JWS D;  3PUZ A;  3MXU A;  3D8G A;  1X3G A;  1EYA A;  1I6H H;  4X3S A;  3GTL B;  3BDL A;  1R4Q B;  4IFD G;  2UXC L;  3M4P A;  2GVB A;  1J9O A;  3MVV A;  1NJI C;  1CSP A;  4BY7 B;  1SYC A;  4K8I A;  1PRT F;  1Q3L A;  1YEZ A;  1CFM A;  2FHT A;  3Q23 A;  1BUV T;  3OMC A;  5ELB A;  2WAC A;  1TWC H;  5EKK A;  5IYD H;  4JBW A;  1VQB A;  1AZP A;  1PVO A;  4B3T Q;  4JOI A;  4DAY A;  5C0X H;  1X3Q A;  4A3B B;  4RKB A;  3V96 A;  2K5N A;  4CBV A;  1UEB A;  2A74 C;  3M3Y B;  2NVY H;  4Y7N H;  4OO1 G;  5IP7 G;  5C44 H;  4WFN 3;  4C56 C;  3IL8 A;  4GKK Q;  2PYK A;  3RN2 A;  1IBK L;  1VQ8 A;  3W1G A;  5M5X H;  3S14 H;  1AFP A;  4NMZ A;  3QR8 A;  1PFM A;  1TKW B;  3I4M B;  1SNO A;  3FKI B;  5D14 A;  4F87 A;  4A3E H;  4BXX G;  2IHF A;  5COY A;  2VQF Q;  1E2V A;  3SK8 A;  3Q22 A;  4JG2 A;  4C3I G;  2YTY A;  3WDN A;  5GQO A;  1VQ4 A;  1JOK A;  2KCN A;  4O1N A;  2PPB C;  1I4G A;  3OMG A;  3D4D A;  4C3H H;  3I70 A;  1YJN A;  3S15 B;  2CCZ A;  2Z8L A;  5A2Q L;  4IUN A;  2WB1 E;  2OTJ A;  3BYT B;  4XQQ A;  2EXZ A;  4BY1 B;  1Q46 A;  2XIW A;  3SVM A;  4IUV A;  1W6K A;  3S2D B;  2DGY A;  3OHX C;  4A3F H;  4B9W A;  4NXN Q;  4FF2 A;  2I5M X;  5KYI A;  2Z0S A;  1PH7 A;  3I3C A;  2NVX H;  4BY7 G;  3J7Y W;  1R9T H;  4DR5 Q;  2Z6K A;  2NN6 I;  1EY5 A;  2D5D A;  3QG1 A;  1J5E L;  3RZD H;  3PO3 B;  2JQO A;  1X56 A;  1WCM H;  3TSS A;  1NMF A;  4DAY B;  3PUY A;  1WI5 A;  1X6O A;  1XNR L;  3H3V H;  4K0K L;  4LNQ A;  3RMH A;  2F0E A;  4JI2 L;  4JI8 Q;  4A3B G;  1WD0 A;  4FO2 A;  2Z1C A;  1I94 L;  5IWA Q;  2NVT B;  4MHE A;  2ZTE A;  2EYO A;  5LL6 S;  2K5Q A;  2GVA A;  3KF8 A;  2MNA A;  1WTR A;  3PF4 A;  2GA4 B;  3NPP A;  4ZUI A;  4LFB Q;  2HDM A;  1U5K A;  5FJ8 H;  4JI4 Q;  4APV A;  1A8V A;  1SJH D;  1HA6 A;  1B3Q A;  3QJY A;  1BVS A;  5G3L D;  4OWW B;  3I4M G;  3FKI G;  2EYP A;  3PCO B;  2PQE A;  4OL7 A;  2N49 A;  4OIJ A;  4ABN A;  4DAP A;  5I2Y A;  1FJG Q;  3HOU B;  1EEI D;  3BVM A;  4DR7 L;  2JA9 A;  3K7A H;  5BR8 L;  1XMO Q;  5CR3 A;  4JCV E;  1V1Q A;  1X3P A;  2RKS A;  3U4Z A;  1BDO A;  1B50 A;  4OXP A;  1SYD A;  4OWT B;  4A93 H;  5CYU A;  3OTO L;  2I46 A;  2G9D A;  3D3R A;  2IY5 B;  2H5X A;  5HGQ A;  4BY1 G;  5G3L F;  1A2U A;  1EIF A;  1HNX Q;  1XXG A;  2Q2I A;  3R2I A;  2AHO B;  2CH4 A;  3Q8D A;  1F2Y A;  1TT2 A;  5IOC A;  2QA4 A;  4A3I H;  3CXC A;  1A15 A;  1XMQ Q;  3KBX A;  1EYD A;  2PI2 A;  2F0W A;  1O7Y A;  1DOM A;  3ERO A;  1IHZ A;  3H3V C;  2DNE A;  3PO3 G;  3MZ5 A;  5M3M B;  5M5W H;  2EYJ A;  3L3O C;  4R4T A;  3I4N B;  4JYA Q;  2RHS B;  3NBI A;  4L5S A;  1EY9 A;  3NTI A;  3K7U C;  3OYY A;  2GN5 A;  1BKB A;  5E7N A;  2NVQ H;  5GAD C;  1AW7 A;  4A4I A;  3CKI B;  3DWA A;  5IGD A;  4IJL A;  3TP7 A;  4F7X A;  3MWY W;  1DGS A;  1K8O A;  2AUJ D;  4X64 Q;  1B9N A;  2I0Q A;  2MO1 A;  3BS1 A;  4OHJ A;  1AZQ A;  4IQZ A;  1PXU A;  3A74 A;  3EIV A;  2UUC Q;  1LAB A;  3HOU G;  4UY8 C;  2D0O A;  4CGY B;  3GTO H;  1D6E C;  1LTB D;  2RSO A;  5M9O A;  5C4J B;  3PO2 H;  1ASZ A;  2O2L D;  1GM5 A;  4HED A;  4DV0 Q;  2C35 B;  3STB C;  1OXV A;  4YCU A;  2A1A A;  3IFD A;  1Y69 U;  4F8M A;  5JVH 3;  1CQF A;  1PV4 A;  1KNA A;  4C3J G;  2B2V C;  5EKL A;  2IWH A;  1SNP A;  2UXC Q;  3ZYY X;  4RGO S;  2AMC B;  4KLK A;  4FXD A;  1T5X D;  5I6Y A;  3NBH A;  2IW3 A;  3TS2 A;  1BR9 A;  2EJM A;  5M3M G;  4FF1 A;  2WII B;  3K8A A;  3KJO A;  3CCE A;  3I4N G;  4KKU A;  1KLU D;  4RHS A;  4NKL A;  2PNH A;  2BOS A;  2XRQ D;  3I4L A;  1CA5 A;  2RA4 A;  3VA7 A;  2BH8 A;  4CKE A;  1W6J A;  5C5L A;  3OIP A;  2VY3 A;  2F0J A;  1DON A;  3E5S A;  1YIT A;  1BQQ T;  3S1N B;  2K5V A;  3FRP B;  1STE A;  4JI1 L;  2ZXR A;  1GUT A;  3J7Z C;  1FNU A;  3NK9 A;  2Z4I A;  2V4D A;  3WWV A;  3CC4 A;  5KND A;  4QGU A;  3STB D;  1IBK Q;  5E4X A;  1V8Q A;  4DF7 A;  4LUO A;  1O7L A;  4K6D A;  1PH9 A;  1UE6 A;  4S3S A;  4H44 C;  1QVF A;  4HMJ A;  4A3G B;  1S5F D;  3GTQ B;  1S5D D;  3I73 A;  1QVG A;  1P8L A;  1HQR D;  1I5F A;  1KL9 A;  2L1B A;  1BBX C;  1SAP A;  3F2D A;  3J81 c;  5IE8 A;  1TWF B;  2WAQ B;  4R4Q A;  2E5L L;  1LM0 A;  3I72 A;  3UDF A;  3T51 B;  1MD2 D;  3NBH B;  1E1O A;  3TBI B;  2NVY B;  1SE2 A;  2Z6B A;  1HZ9 A;  1CHP D;  1JB3 A;  1UEA B;  5JAV A;  1QZH A;  3H6M A;  5IOD A;  2K32 A;  1JJC B;  4ALP A;  3H15 A;  2F4I A;  1GXD C;  2HIX A;  5I4D A;  3UDX A;  2X6G A;  3HKZ G;  2K1B A;  1SNQ A;  3J81 i;  3CC7 A;  3CMA A;  2SEB D;  3CP0 A;  3F2C A;  1BOS A;  1TWG B;  3TP6 A;  1Y1V G;  3AFP A;  1YI2 A;  3KLR A;  2VXW A;  4K0K Q;  2QDL A;  2PMZ E;  3V05 A;  1TVX A;  4JI2 Q;  3URY A;  3KLS X;  5IGC A;  3GTJ B;  3RD4 A;  1VS0 A;  4IOC A;  3HOZ B;  1JCK B;  1I94 Q;  1I4H A;  4O2D A;  3J7A V;  1VQA A;  4P71 A;  4DR6 Q;  1A6X A;  5FLX E;  2KUM A;  3J7A F;  2MFI A;  3KFU A;  4QMG A;  4A3C H;  4QQB X;  5DAU A;  4LJZ C;  1GVP A;  2Q2U A;  2QIL A;  1EY0 A;  4G4K A;  1XNQ L;  1CKO A;  1WD1 A;  3CU7 A;  3NHH A;  2MPM A;  4ZYS A;  4HIM A;  5DM6 3;  4A3G G;  1YHB A;  2EVB A;  1WYD A;  2QCP X;  4DR7 Q;  4BBS H;  4DXF A;  3HEJ A;  5BN3 A;  4K14 A;  2B2V A;  2I5H A;  1VCI A;  2L0C A;  2JA6 H;  3D31 A;  3SE0 A;  3OTO Q;  5C0X G;  3DXJ C;  5EJW A;  3K59 A;  2WAQ G;  5BN4 A;  4A75 A;  4KKT A;  2LMC B;  5C6A A;  1WTQ A;  3GO5 A;  4X6A H;  1PH2 A;  4FF3 A;  4JI3 Q;  3UE0 A;  3ULP A;  2MJ8 A;  1I4Q A;  1JQY D;  1B3A A;  2EY2 A;  3DWQ A;  3PUX A;  2A19 A;  5M3F H;  1EQR A;  3KLS A;  2NUC A;  3O13 A;  3R8B A;  4POG A;  1BCP C;  4OWX B;  3OW7 A;  2Z4H A;  4CDF C;  4BS9 A;  3HOZ G;  4HID A;  1HUN A;  1IW7 C;  4BBR B;  4KHZ A;  2ZXP A;  3KK7 A;  4TKO B;  1S5E D;  2VUM B;  2Q2H A;  1GUG A;  1HNW L;  3CW2 C;  1KAA A;  1WJJ A;  1D7Q A;  2K5W A;  2JYO A;  4OIK A;  4PQX A;  1TWA H;  4PZ7 A;  3GTP H;  4Q5V A;  1MSH A;  2KQ3 A;  3F1Z A;  4A3M H;  4B9X A;  3TP5 A;  1ENC A;  2ZJR A;  4R8N A;  1VF5 C;  1T9H A;  4PMB A;  1N32 Q;  5I9O A;  2HUG A;  4CJ2 C;  4R9W A;  4LFC L;  2KHJ A;  4N9T A;  2K4K A;  1SND A;  3NSW A;  2ZJQ A;  2CQO A;  2ENB A;  3HG9 A;  4Z9C B;  4DXG A;  4RG1 A;  1SXT A;  1Y1W B;  1BCP D;  1SMX A;  1B1Z A;  1SJE D;  3GP7 A;  1SDF A;  1OTC A;  1Z7T A;  2R7F A;  1DZ1 A;  4N8X 1;  1OO9 B;  3BG3 A;  3HOW H;  1CZG A;  3MFY A;  4G7O C;  1IW7 D;  1GKH A;  4IJH A;  2PI2 E;  4A3J H;  3G4S A;  3WOF A;  2QKI C;  2JA8 H;  1LT6 D;  2YTV A;  1WTO A;  4L8J A;  2K52 A;  1PH4 A;  1NUC A;  2EJG C;  3OPO A;  3MEF A;  2K03 A;  1G6P A;  2RSN A;  5E4W C;  1SRU A;  1EQV A;  2UXD L;  3SR1 A;  1TR5 A;  1KAB A;  1LT3 D;  5FOB B;  2HT1 A;  4LF7 L;  3DM1 A;  1BCP F;  2K05 A;  2JEA I;  2IX3 A;  3G48 A;  3GTO B;  3GTK H;  3UDG A;  4BBR G;  4L5T A;  1K83 H;  4DNT B;  3SK4 A;  1XPR A;  3I2Z A;  2ZTC A;  3PQI A;  5JPM C;  2VNU D;  4KN7 C;  4JI1 Q;  2R93 B;  2VUM G;  1MJE A;  4XTC S;  1ENF A;  1ZKO A;  4JI6 L;  3VR6 A;  3ER0 A;  1NNX A;  5LL6 X;  3QOL A;  2EIF A;  3J80 c;  2F0O A;  4NB3 A;  1I50 B;  1M8A A;  1X3F A;  2L9H A;  2ZM6 L;  1MBY A;  2K7V A;  3VR5 A;  1G8Z D;  1G91 A;  3A0J A;  2D2C C;  2QEJ C;  4GN4 B;  3HRZ C;  1PA6 A;  1FVI A;  3JAM c;  1VQN A;  2JA7 B;  4DFA A;  1JR0 D;  3J80 i;  1MGS A;  1A63 A;  1H9M A;  1Y1W G;  2PCF B;  1I3Q B;  4JK1 C;  1RHP A;  2DN8 A;  3JAM E;  2PO4 A;  3HOY B;  1RIP A;  5CV5 A;  1AN8 A;  1U4M A;  3RLF A;  3TEH B;  2OT2 A;  2BH2 A;  3EFX D;  1PRT D;  1L1O B;  2E5L Q;  2XWB B;  1SN8 A;  3ITP A;  3QB3 A;  4EQP A;  1VQM A;  5FLM G;  1CQV A;  3EBE A;  3R3O A;  4A3K H;  2WFW A;  1A62 A;  1K8M A;  2NWG A;  2WAQ E;  1QB5 D;  2HHH L;  2OF1 A;  1SYE A;  3I55 A;  4HSP A;  3NEM A;  1PDQ A;  3TN2 A;  2A8V A;  1YNN C;  2WKD A;  4HSV A;  1HR0 L;  4FP5 D;  5HUR A;  4IPC A;  5I9P A;  2Z9H A;  1TU2 B;  2AWN A;  3N52 A;  2A68 C;  4IPH A;  2A6E C;  4B3R L;  4DR4 L;  1GHJ A;  4KHP Q;  2R93 G;  2PNR C;  3DLL A;  1ASY A;  1STN A;  3M9B A;  1X9N A;  1D2B A;  1I4P A;  5M5Y H;  1N36 L;  1F9P A;  5KIX A;  1JE4 A;  4R4O A;  3LNN A;  4TRD A;  2OEO A;  4LF4 L;  1FD7 D;  3LGJ A;  3J81 L;  4BWG B;  3HOX H;  1KTK A;  1K9M C;  2YU9 B;  2VQE L;  1XNQ Q;  2LXK A;  1Y14 B;  5JEA G;  1EOT A;  5EPK A;  3OWE B;  2JA7 G;  4CDC C;  5J1Z A;  3SK5 A;  1VQC A;  5DLQ E;  4B3M L;  5C3W A;  1TXY A;  1S72 A;  3MXP A;  1KDB A;  3W2D A;  1DOL A;  3GV3 A;  3L7Z C;  5KRU A;  3HOY G;  1VQI A;  4DV6 L;  1IL2 A;  3S1Q B;  1HR0 W;  1EEF D;  5IYB G;  1BCP B;  5KNB A;  4JBJ A;  1YNN D;  4LFA L;  2CWA A;  4PG3 A;  1L0W A;  1KIX A;  3GTM B;  1HQM C;  1LT5 D;  4A3L G;  3CCJ A;  2R7Z H;  4FXK C;  3I56 A;  2A68 D;  2N78 A;  2PZU A;  2EYF A;  2A6E D;  3T13 A;  4J15 A;  3S1R B;  3ICE A;  1A3T A;  1SLJ A;  2I5L X;  3NTH A;  1VQH A;  1GD7 A;  4HJA A;  2LFN A;  4KJN A;  4NDX A;  3HP3 A;  2HQL A;  1CK1 A;  5FO7 B;  5IP9 G;  4JI0 Q;  4ME5 A;  5J22 A;  4PV1 C;  1YJW A;  2EPB A;  3RN5 A;  2PMZ B;  1VQ5 A;  4OEL B;  1XPO A;  3CPW A;  1EQQ A;  3NP8 A;  2DY8 A;  2B63 B;  2E74 C;  3GQB A;  1Q1E A;  5K5P A;  4Y52 H;  2IJ0 A;  4FXG C;  1JOR A;  4E6I A;  4U67 3;  3K5M A;  2F03 A;  3CF5 A;  2AUK A;  4DPG A;  2DJG C;  3FPU B;  4POF A;  2ZXO A;  3MXG A;  1TWH B;  3NTK A;  2KHS A;  3RLO A;  1HNW Q;  1Y8O B;  4LK1 C;  2EJF C;  3U9S A;  2P5Z X;  3GD7 A;  1L2F A;  3JC6 6;  3R2T A;  1F2M A;  2E2J H;  1IYJ B;  3RLN A;  4DK0 A;  2KVM A;  5M3F B;  2L12 A;  4WJW A;  4ZQ3 A;  4UAI A;  1BBU A;  4YWM A;  4DV2 Q;  4RA8 A;  1IKM A;  5AFW A;  1GJX A;  4NXM L;  1B4O A;  1LYL A;  2F0Q A;  3UDI A;  2B29 A;  4LFC Q;  1TS5 A;  1H9R A;  1RD9 D;  2C9O A;  3BVZ A;  3S1M H;  1TY2 A;  4IFD J;  3DHQ A;  1N34 L;  1RCV D;  1DJR D;  3KOJ A;  3GTG H;  2YTX A;  1PRT B;  2F0L A;  2XWJ B;  4ID6 A;  4XQJ A;  4DV4 L;  2ES2 A;  3NXW A;  1JOO A;  1ET6 A;  2EXD A;  3ONA B;  3S16 H;  1CTM A;  1ZYR C;  3ND9 A;  1EWC A;  2J7Z A;  3OIQ A;  1F9S A;  3F2U A;  5C4X H;  4K5X A;  2OWO A;  1NMG A;  2R92 H;  2KCM A;  5IIF A;  2XN9 C;  5J3B A;  1STG A;  3HOV H;  2NN6 G;  3CCL A;  2VZA A;  4TSS A;  4C2M B;  2A6H C;  2UXD Q;  2NZH A;  4IOA A;  3CME A;  3V2T A;  4LF7 Q;  1LO5 D;  3E9I A;  1K73 C;  2B63 G;  1PFS A;  4K8J A;  1STB A;  3T1Y Q;  2JA5 H;  2KEC A;  2B8F A;  1CM9 A;  1I4X A;  4RGM A;  1D1K A;  5K36 G;  4KV6 A;  1EQT A;  2WV6 D;  3KF8 B;  1VMP A;  4TQU S;  1F2Z A;  2XTI A;  3KYH C;  1LUZ A;  1DOK A;  1VMC A;  3A5Z B;  4JI6 Q;  1A3V A;  4JI5 L;  1SMY C;  2WKC A;  1UE1 A;  4DNI A;  1SFO B;  2VB3 X;  3VDY A;  5F2D A;  5C3X A;  4A3D B;  5GAH C;  2ZM6 Q;  1IZ6 A;  2DNC A;  4H0L C;  1HNZ L;  1TS3 A;  5M3F G;  4A3J B;  5KEE A;  2JA8 B;  1O78 A;  4QY7 A;  4LF8 L;  3E0J A;  1ZYR D;  2EYL A;  2CHB D;  4M8A A;  1PYS B;  2OXP A;  2E2I H;  3B6Y A;  4FF4 A;  1PH1 A;  4I7Z C;  1WTH A;  5D65 A;  3EJI A;  5E3F A;  3H0G B;  2KBN A;  2XGT A;  2K33 A;  5JOB A;  3A7L A;  1QJO A;  3EN2 A;  4RCO A;  5IYC G;  3RZO H;  2D62 A;  3H94 A;  4ZKC B;  2A6H D;  5ISR A;  4P73 A;  5CV7 A;  3S17 B;  4EQN A;  1W2B A;  4JBK A;  2L55 A;  4IFD H;  4RCN A;  2Q2T A;  3LX0 A;  4K2K A;  2D0P A;  2XVS A;  2VB2 X;  3MXN A;  3AYH B;  1J8I A;  2HHH Q;  3P75 A;  1EIH A;  4F88 A;  3K5N A;  3C3L A;  3PV0 A;  2I07 B;  3K81 C;  3DMU A;  4QUF A;  1SMY D;  3J80 L;  1RL2 A;  2JEB I;  1SYG A;  5J39 A;  2IX0 A;  5EAY A;  1EFW A;  4UPA A;  2ICI A;  4HJ8 A;  1DD2 A;  4B3R Q;  5ELD A;  5C3E B;  1S3O A;  3CAM A;  4DR4 Q;  1ZXT A;  4RGT A;  5ELC A;  2EOT A;  1IBM L;  5IP7 H;  1KAW A;  1FGB D;  1N36 Q;  2O5I C;  2E2H B;  4DR2 L;  4H13 C;  3NWS A;  4LF4 Q;  4A3D G;  1E22 A;  1S4Z A;  4YHH L;  4A3J G;  1E0B A;  1VQF A;  4L5Q A;  2VQE Q;  1IKL A;  2JA8 G;  4LWC A;  4BXX H;  3VYR A;  1W3S A;  3M4O H;  1I6H B;  3T53 B;  3A5U A;  4GOP C;  4B3S L;  3OWF A;  2CFM A;  2NBF A;  4WJ3 M;  1WVL A;  1OXT A;  4ILW A;  2MUY A;  1MI2 A;  4C3I H;  4KY5 A; 
#chains in the Genus database with same CATH homology
 2Q8R E;  2EDG A;  1L0Y B;  3TZU A;  1A2T A;  1OXU A;  5CMD A;  4L63 B;  2AQ3 B;  1TWC B;  2L11 A;  3A55 A;  2ZT9 C;  1LTS D;  2PW7 A;  3A8K E;  5A35 A;  4EGV A;  1STY A;  2HCC A;  3K0Y A;  4V19 0;  1EL0 A;  1U4R A;  4Y7N B;  3IAY A;  5C44 B;  3VR4 A;  1BNZ A;  1DCZ A;  5M5X B;  3S14 B;  5C4H A;  2FMC A;  3FEW X;  4A3E B;  3Q6S A;  1SEB D;  3NUC A;  1RJT A;  3QIA A;  1PZK D;  4C3H B;  1OXX K;  5BN5 A;  2FIN B;  1PLF A;  2NB0 A;  2F0K A;  3EVQ A;  2NZ1 D;  3DUZ A;  4HTH A;  5ELF A;  2F0I A;  1HRJ A;  5IGE A;  5T1G A;  3DWP A;  1NR4 A;  4A3F B;  2F0N A;  4KN4 C;  2IT1 A;  5EBD A;  2J0T D;  2C5C A;  2NVX B;  2KEE A;  1R9T B;  3K5O A;  1L0X B;  5IGF A;  2JP1 A;  3RZD B;  2Y0S B;  1WCM B;  1ILQ A;  3X3M A;  3K57 A;  4UDU C;  3MEH A;  1OXS C;  3C46 A;  1WTX A;  2WIN B;  5C4Z A;  4QCL A;  2EYM A;  3A7A B;  1SSO A;  2B2Y C;  3MTS A;  3P20 A;  4KKS A;  5EGT A;  3T56 B;  1S5B D;  4G7H C;  4C1N I;  4XDX A;  3M7N A;  1R4P B;  3T4A C;  1F9R A;  1B9M A;  5FK9 C;  4HN7 A;  1B2T A;  3K7A B;  2Q8I B;  4C3H G;  5E1F A;  5IT9 E;  4MN3 A;  3GTG B;  4A93 B;  1KDC A;  2EZV A;  2BA0 A;  2DY7 A;  5CV9 A;  1ROD A;  4IUP A;  1RTO A;  1BXT A;  3MA2 B;  4A3I B;  1LTG D;  3LWE A;  4QF4 A;  1G2T A;  5HGT A;  3HOV B;  1MSG A;  1GUN A;  4R8I A;  1QNK A;  5LHY 1;  1UUP A;  5M5W B;  3VR2 A;  4PNY A;  4LMQ D;  1WTW A;  2RQX A;  4K5W A;  2NVQ B;  2MHV A;  5I2X A;  2LS0 1;  2M2L A;  1KNE A;  1O80 A;  2IX1 A;  1YNJ C;  4K5V A;  4ZAI A;  4DK1 A;  5T1I A;  2R3Z A;  3C1E A;  3VYS A;  1GUW A;  2N88 A;  4KK7 A;  3PUV A;  5TSS A;  2SDF A;  3D4R A;  1DXM A;  2KED A;  2B2U C;  5CC4 A;  3G7L A;  3SEB A;  4RHR A;  3QOJ A;  3PO2 B;  4IAL A;  1EFI D;  2JSO A;  2EY1 A;  2F0F A;  2N55 A;  3MAQ A;  4IFD I;  4HAE A;  4FYD A;  1XTC D;  4ULL A;  5C0X J;  2WP8 J;  2YYZ A;  1FNV A;  1D5X C;  1YNJ D;  4XQN A;  1CA6 A;  1V43 A;  1JWM D;  1LV9 A;  3NQT A;  1EZ6 A;  4EQO A;  1E2Z A;  1XX8 A;  2F0T A;  1QOH A;  2B2Y A;  4KD4 A;  4L6T B;  1UNS A;  4HCS A;  2A73 B;  4OO1 I;  3ND8 A;  1PTO H;  4J6H A;  3VYU A;  4BA1 I;  4XXE A;  3H91 A;  4KY7 A;  1D1I A;  3N6R A;  4C3I B;  1ESF A;  1Q8I A;  2B2W C;  2F0D A;  3R93 A;  1HPC A;  5KGU A;  1QG7 A;  2F0P A;  1FYC A;  1U4L A;  1M4V A;  3I90 A;  2PW5 A;  3A8J E;  1GHK A;  4G7Z C;  2PZW A;  4BA2 I;  3C2P A;  4DGZ A;  3C1F A;  5KNC A;  1ET9 A;  4X3U A;  4XYQ A;  2K04 A;  5DM7 3;  1NSN S;  2F0M A;  1ZEQ X;  2R6G A;  1EIG A;  1NAP A;  4YIJ A;  3D4W A;  2EE1 A;  2JXM B;  4B08 A;  5CV4 A;  1ONL A;  3OSO A;  1ESR A;  1HUM A;  2FJ2 A;  1EWH A;  4FVM A;  1PTO C;  2FFK B;  5FLX L;  1CZW A;  4XT3 B;  4KTA A;  1GUS A;  3DEP A;  3NWT A;  3L9A X;  2B2U A;  4IUT A;  1FNW A;  3BVG A;  2RDH A;  5CBA E;  3HS0 C;  5JVG 3;  1F2L A;  2TMP A;  2BA1 A;  4J1M A;  4BBS B;  1SBB B;  2M9V A;  2O4X A;  3VA5 A;  5FKA C;  4IUU A;  5FO9 B;  3PIP 3;  3QWN A;  1SE3 A;  2IPK D;  5ELE A;  3MHB A;  4OGQ C;  1B53 A;  4MIU A;  2RDF A;  2JA6 B;  2AWO A;  2QF7 A;  5EQ0 A;  1G6Z A;  3SHL A;  1LAC A;  1Y8N B;  3KUP A;  2CQA A;  5IGG A;  1DYQ A;  1PTO D;  2XNA C;  1VF7 A;  1EY4 A;  2PZT A;  3UI2 A;  1VDZ A;  3I91 A;  2H1E A;  2RVL A;  5JPN C;  1SNM A;  5FO8 B;  2IL8 A;  1EZ8 A;  1CHQ D;  1EY7 A;  1F9Q A;  2ID0 A;  2BCO A;  2F0H A;  4ZRZ A;  1S5C D;  1TS4 A;  3CRL C;  5CBE E;  5IT9 L;  2M00 A;  2AQ1 B;  1D5Z C;  1JOQ A;  1PTO F;  1QIL A;  1Z47 A;  2RDG A;  1QWY A;  5KYL A;  1G2S A;  2SNS A;  2B2W A;  1ENA A;  3A8I E;  4ODG A;  3DEO A;  4RWS C;  3EQL C;  4KI0 A;  1TWA B;  1HTP A;  1KDA A;  3GTP B;  1EY8 A;  4A3M B;  2H4O A;  2L5T A;  1EY6 A;  4ZKB B;  2RBM A;  3ERQ A;  3U9O A;  4IUR A;  3M4Y A;  3T16 A;  1CT1 D;  4GZY C;  4HR7 B;  1SYF A;  2A5H A;  4KJO A;  5COR A;  3HGB A;  4XT1 B;  1IL8 A;  4X3K A;  5JEA J;  4C3J B;  1G29 1;  3H09 A;  2O5J C;  1HTL D;  2D9U A;  3K5L A;  1LTT D;  4DAV A;  5IGB A;  3S2H B;  1II3 A;  2K5D A;  3HOW B;  3VR3 A;  2EY6 A;  1TII D;  4PMW A;  1ILP A;  1GOZ A;  3CRK C;  4K2L A;  3WOE A;  1LTA D;  4C1N K;  4CJ0 B;  1EU3 A;  4KMU C;  2KA7 A;  4KHV A;  5EPJ A;  1RF2 D;  1Z6H A;  3GTK B;  2A69 C;  4NP5 A;  1JC7 A;  5NUC A;  3P7J A;  4FNF A;  1K83 B;  3RUZ A;  3TP8 A;  1QNU A;  2K01 A;  1NR2 A;  3QO2 A;  4RKL A;  1UAP A;  3M7G A;  2F0S A;  1HFG A;  3I8Z A;  1O7Z A;  3A54 A;  1TQO A;  3CHB D;  1Q12 A;  3TDQ A;  4M1U B;  1XYI A;  3W3A A;  2HCI A;  2LY7 A;  4QB4 A;  3MFG A;  2BE5 C;  2CVR A;  4V0B A;  4WRD A;  3JAM L;  4OO1 H;  3AU7 A;  4DA2 A;  3BZD B;  5JEA H;  1QCB D;  1AP0 A;  1PTO B;  4A3K B;  1I4R A;  3HKZ B;  2A69 D;  1C4Q A;  2EY5 A;  5CGK A;  4QUC A;  1Y1V B;  2BDO A;  2MP1 A;  3EA6 A;  3Q24 A;  2F1M A;  1SNC A;  1RTN A;  5EKI A;  2FMM A;  1I6V C;  4CJ1 B;  1PFN A;  4DU9 A;  5M5Y B;  2BE5 D;  3E6Z X;  2HDL A;  3BYY B;  1X32 A;  1U9R A;  3SDZ A;  2B2T C;  4NW2 A;  2SNM A;  1PYW D;  3HOX B;  3A56 A;  1HXY D;  3BDO A;  1JIC A;  1KLG D;  3FVQ A;  1Q90 A;  1LLR D;  2E75 C;  2L4N A;  4ZK9 B;  1PFB A;  2X69 A;  2SOB A;  2EYH A;  4CHT B;  4N9P A;  2QDB A;  4IZ8 A;  5C0X I;  1HA5 A;  1T5E A;  2R61 A;  2G9H D;  1EU4 A;  2F3W A;  3J81 E;  3K58 A;  2Q8T A;  4WOR A;  2R7Z B;  1C48 A;  2ICE C;  4XIG S;  2NTS A;  3P1H A;  4ZUJ A;  1GUO A;  4IN3 A;  3M85 A;  2XSC A;  1C8C A;  1A3U A;  1BO0 A;  1LT4 D;  2AQ2 B;  3PUW A;  3NQI A;  2F3V A;  5A2Q E;  1ML0 D;  4PMC A;  1FR3 A;  5DNF A;  1SYB A;  4HCE A;  1V1O A;  1H9S A;  1F77 A;  3KBG A;  2XRS D;  1PZJ D;  4KY6 A;  2NN6 H;  1Y8P B;  1LTR D;  3D6C A;  4G57 A;  5C5M A;  5I6W A;  2E2J B;  3PIO 3;  3TME A;  2WB1 B;  5K36 H;  4CKC A;  1STA A;  1H9K A;  1V1P A;  1HCZ A;  1PMR A;  1PZI D;  4I65 A;  2KCC A;  3S1M B;  2CW0 C;  2B39 A;  5D3I B;  2K6A A;  3D6W A;  3FDT A;  5EBC A;  4DN4 M;  1XWE A;  2HQE A;  4QIW B;  3TZD A;  3AB9 A;  3AMU A;  4HMI A;  3S16 B;  2B8G A;  4ZLT F;  1D5M C;  3SXH A;  4XYO A;  5C4X B;  2F0G A;  4AYB B;  1IYV A;  2R92 B;  4H7B A;  3HZX A;  4EVO A;  2NTT A;  5CV8 A;  1H9S B;  5JJZ A;  4CKB A;  1IYU A;  2B2T A;  4IUQ A;  2JA5 B;  4J8Q A;  5EPL A;  1SE4 A;  4RH6 A;  2F0V A;  3FPP A;  1DM0 B;  1CI3 M;  2CW0 D;  1WTP A;  3G6J B;  3NE5 B;  1V1P B;  2NYZ D;  3OOC A;  3Q0A A;  2KOL A;  4K6L A;  5CV6 A;  2J4X A;  2E76 C;  1ICW A;  2E2I B;  1B44 D;  2X6L A;  3S9W A;  2JE6 I;  4RFB A;  3RZO B;  2LKV A;  5D3D A;  3MC0 B;  1U4P A;  4Q0F A;  1E2W A;  2K28 A;  3GV6 A;  3K6O A;  4U68 A;  1AEX A;  2F0U A;  1TY0 A;  4X3T A;  1PRT C;  1NCV A;  1HHV A;  1Q1B A;  3FMC A;  3IKJ A;  1QE6 A;  3PMF A;  1STH A;  4O42 A;  1WTV A;  2KJX A;  1RDP D;  2TSS A;  2E2D C;  4LAA A;  4P2C B;  4RGN A;  1BF4 A;  1RKN A;  3LWU A;  2BDN A;  1H9J A;  1TS2 A;  1HFN A;  3J80 E;  5DEH A;  2MGS A;  3BDC A;  1JWU D;  3X3N A;  1LTI D;  3SK6 A;  4DNR B;  3IFT A;  4KD3 A;  1EYC A;  3M4O B;  4RAU C;  3CQZ B;  3VYT A;  1JWS D;  3PUZ A;  3MXU A;  3D8G A;  1EYA A;  4X3S A;  3GTL B;  3BDL A;  1R4Q B;  4IFD G;  1J9O A;  3MVV A;  4BY7 B;  1SYC A;  4K8I A;  1PRT F;  1Q3L A;  1CFM A;  2FHT A;  3Q23 A;  1BUV T;  3OMC A;  5ELB A;  2WAC A;  5EKK A;  4JBW A;  1AZP A;  4DAY A;  5C0X H;  1X3Q A;  4A3B B;  4RKB A;  3V96 A;  4CBV A;  2A74 C;  3M3Y B;  4OO1 G;  4WFN 3;  4C56 C;  3IL8 A;  2PYK A;  1AFP A;  4NMZ A;  1PFM A;  1TKW B;  3I4M B;  1SNO A;  3FKI B;  5D14 A;  4F87 A;  5COY A;  1E2V A;  3SK8 A;  3Q22 A;  4C3I G;  3WDN A;  1JOK A;  2KCN A;  4O1N A;  2PPB C;  1I4G A;  3OMG A;  3D4D A;  3I70 A;  3S15 B;  2Z8L A;  5A2Q L;  4IUN A;  3BYT B;  4XQQ A;  2EXZ A;  4BY1 B;  2XIW A;  3SVM A;  4IUV A;  1W6K A;  3S2D B;  3OHX C;  4B9W A;  4FF2 A;  5KYI A;  3I3C A;  3J7Y W;  2NN6 I;  1EY5 A;  2D5D A;  3QG1 A;  3PO3 B;  3TSS A;  3PUY A;  3RMH A;  2F0E A;  1WD0 A;  4FO2 A;  2Z1C A;  2NVT B;  4MHE A;  2EYO A;  5LL6 S;  2K5Q A;  3KF8 A;  1WTR A;  2GA4 B;  3NPP A;  4ZUI A;  2HDM A;  1SJH D;  1HA6 A;  3QJY A;  5G3L D;  2EYP A;  4OL7 A;  2PQE A;  4OIJ A;  4ABN A;  4DAP A;  5I2Y A;  3HOU B;  1EEI D;  3BVM A;  5CR3 A;  1X3P A;  2RKS A;  1BDO A;  1B50 A;  1SYD A;  5CYU A;  2I46 A;  2G9D A;  3D3R A;  5G3L F;  1A2U A;  1XXG A;  3R2I A;  1F2Y A;  1TT2 A;  5IOC A;  1A15 A;  3KBX A;  1EYD A;  2F0W A;  1O7Y A;  1DOM A;  3ERO A;  1IHZ A;  3H3V C;  2DNE A;  3MZ5 A;  5M3M B;  2EYJ A;  3L3O C;  3I4N B;  3NBI A;  1EY9 A;  3NTI A;  1AW7 A;  3CKI B;  3DWA A;  5IGD A;  3TP7 A;  4F7X A;  3MWY W;  1K8O A;  2AUJ D;  1B9N A;  3BS1 A;  4OHJ A;  1AZQ A;  4IQZ A;  1PXU A;  1LAB A;  4CGY B;  1D6E C;  1LTB D;  2RSO A;  5M9O A;  5C4J B;  2O2L D;  4HED A;  1OXV A;  3IFD A;  1Y69 U;  4F8M A;  5JVH 3;  1CQF A;  1KNA A;  4C3J G;  2B2V C;  5EKL A;  2IWH A;  1SNP A;  3ZYY X;  4RGO S;  4FXD A;  1T5X D;  5I6Y A;  3NBH A;  2IW3 A;  1BR9 A;  2EJM A;  4FF1 A;  2WII B;  4KKU A;  1KLU D;  4RHS A;  4NKL A;  2BOS A;  2XRQ D;  3I4L A;  1CA5 A;  2RA4 A;  3VA7 A;  4CKE A;  1W6J A;  5C5L A;  3OIP A;  2F0J A;  1DON A;  3E5S A;  1BQQ T;  3S1N B;  3FRP B;  1STE A;  2ZXR A;  1GUT A;  1FNU A;  3NK9 A;  2Z4I A;  2V4D A;  5KND A;  5E4X A;  1V8Q A;  4DF7 A;  1O7L A;  4K6D A;  4S3S A;  4H44 C;  4HMJ A;  4A3G B;  1S5F D;  3GTQ B;  1S5D D;  3I73 A;  1HQR D;  2L1B A;  1BBX C;  1SAP A;  1TWF B;  2WAQ B;  3I72 A;  3T51 B;  1MD2 D;  3TBI B;  2NVY B;  1SE2 A;  1CHP D;  1JB3 A;  1UEA B;  5JAV A;  3H6M A;  5IOD A;  2K32 A;  2F4I A;  1GXD C;  5I4D A;  2X6G A;  2K1B A;  1SNQ A;  2SEB D;  1BOS A;  1TWG B;  3TP6 A;  3KLR A;  2VXW A;  3V05 A;  1TVX A;  3URY A;  3KLS X;  5IGC A;  3GTJ B;  3RD4 A;  3HOZ B;  1JCK B;  1I4H A;  3J7A V;  1A6X A;  5FLX E;  2KUM A;  3J7A F;  4QMG A;  5DAU A;  4LJZ C;  2QIL A;  1EY0 A;  4G4K A;  1WD1 A;  3CU7 A;  3NHH A;  2MPM A;  4ZYS A;  5DM6 3;  2EVB A;  2QCP X;  4DXF A;  3HEJ A;  5BN3 A;  4K14 A;  2B2V A;  1VCI A;  2L0C A;  3D31 A;  3SE0 A;  5C0X G;  3DXJ C;  5EJW A;  3K59 A;  5BN4 A;  4KKT A;  2LMC B;  5C6A A;  1WTQ A;  3GO5 A;  4FF3 A;  2MJ8 A;  1I4Q A;  1JQY D;  1B3A A;  2EY2 A;  3DWQ A;  3PUX A;  3KLS A;  2NUC A;  3O13 A;  3R8B A;  1BCP C;  3OW7 A;  2Z4H A;  4BS9 A;  1HUN A;  1IW7 C;  4BBR B;  4KHZ A;  2ZXP A;  3KK7 A;  4TKO B;  1S5E D;  2VUM B;  1GUG A;  1KAA A;  2K5W A;  2JYO A;  4OIK A;  4PQX A;  4Q5V A;  1MSH A;  2KQ3 A;  4B9X A;  3TP5 A;  1ENC A;  4R8N A;  1VF5 C;  4PMB A;  5I9O A;  2HUG A;  4CJ2 C;  4R9W A;  4N9T A;  1SND A;  3NSW A;  2ENB A;  3HG9 A;  4Z9C B;  4DXG A;  1SXT A;  1Y1W B;  1BCP D;  3GP7 A;  1B1Z A;  1SJE D;  1SDF A;  1Z7T A;  1DZ1 A;  1OO9 B;  3BG3 A;  1CZG A;  3MFY A;  4G7O C;  1IW7 D;  3WOF A;  2QKI C;  1LT6 D;  1WTO A;  4L8J A;  1NUC A;  2EJG C;  3OPO A;  2K03 A;  2RSN A;  5E4W C;  1EQV A;  3SR1 A;  1TR5 A;  1KAB A;  1LT3 D;  5FOB B;  3DM1 A;  1BCP F;  2K05 A;  2JEA I;  2IX3 A;  3GTO B;  4DNT B;  3SK4 A;  5JPM C;  2VNU D;  4KN7 C;  2R93 B;  4XTC S;  1ENF A;  1ZKO A;  3VR6 A;  5LL6 X;  3QOL A;  2F0O A;  1I50 B;  1M8A A;  2L9H A;  1MBY A;  2K7V A;  3VR5 A;  1G8Z D;  1G91 A;  2D2C C;  2QEJ C;  3HRZ C;  2JA7 B;  4DFA A;  1JR0 D;  1MGS A;  1H9M A;  2PCF B;  1I3Q B;  4JK1 C;  1RHP A;  2DN8 A;  3JAM E;  2PO4 A;  3HOY B;  5CV5 A;  1AN8 A;  1U4M A;  3RLF A;  2OT2 A;  3EFX D;  1PRT D;  2XWB B;  3QB3 A;  3ITP A;  4EQP A;  1CQV A;  3R3O A;  1K8M A;  2NWG A;  1QB5 D;  2OF1 A;  1SYE A;  4HSP A;  1PDQ A;  3TN2 A;  1YNN C;  2WKD A;  4HSV A;  4FP5 D;  5HUR A;  5I9P A;  1TU2 B;  2AWN A;  3N52 A;  2A68 C;  2A6E C;  1GHJ A;  2PNR C;  1STN A;  1D2B A;  1I4P A;  1F9P A;  5KIX A;  1JE4 A;  3LNN A;  4TRD A;  2OEO A;  1FD7 D;  3J81 L;  4BWG B;  2YU9 B;  1KTK A;  5JEA G;  1EOT A;  5EPK A;  3OWE B;  5J1Z A;  3SK5 A;  5C3W A;  3MXP A;  1KDB A;  3W2D A;  1DOL A;  3GV3 A;  3L7Z C;  5KRU A;  3S1Q B;  1EEF D;  1BCP B;  5KNB A;  1YNN D;  3GTM B;  1HQM C;  1LT5 D;  4FXK C;  2A68 D;  2PZU A;  2EYF A;  2A6E D;  3T13 A;  3S1R B;  1A3T A;  3NTH A;  2LFN A;  4KJN A;  4NDX A;  3HP3 A;  1CK1 A;  5FO7 B;  4ME5 A;  5J22 A;  4PV1 C;  2EPB A;  2PMZ B;  3NP8 A;  2DY8 A;  2B63 B;  2E74 C;  3GQB A;  1Q1E A;  5K5P A;  2IJ0 A;  4FXG C;  1JOR A;  4E6I A;  4U67 3;  3K5M A;  2F03 A;  2AUK A;  3FPU B;  2ZXO A;  3MXG A;  1TWH B;  3NTK A;  2KHS A;  1Y8O B;  4LK1 C;  2EJF C;  3U9S A;  3GD7 A;  3R2T A;  1F2M A;  4DK0 A;  2KVM A;  5M3F B;  2L12 A;  4WJW A;  4ZQ3 A;  4UAI A;  1GJX A;  1IKM A;  4RA8 A;  5AFW A;  1B4O A;  2F0Q A;  1TS5 A;  1H9R A;  1RD9 D;  2C9O A;  3BVZ A;  1TY2 A;  4IFD J;  3DHQ A;  1RCV D;  1DJR D;  1PRT B;  2F0L A;  2XWJ B;  4ID6 A;  4XQJ A;  3NXW A;  1JOO A;  1ET6 A;  3ONA B;  1CTM A;  1ZYR C;  3ND9 A;  1EWC A;  2J7Z A;  3OIQ A;  1F9S A;  3F2U A;  4K5X A;  5IIF A;  2XN9 C;  1STG A;  2NN6 G;  4TSS A;  4C2M B;  2A6H C;  3V2T A;  1LO5 D;  4K8J A;  1STB A;  2KEC A;  2B8F A;  1CM9 A;  4RGM A;  1I4X A;  1D1K A;  5K36 G;  4KV6 A;  1EQT A;  2WV6 D;  4TQU S;  1VMP A;  1F2Z A;  1DOK A;  1VMC A;  1A3V A;  1SMY C;  2WKC A;  1SFO B;  2VB3 X;  5F2D A;  5C3X A;  4A3D B;  2DNC A;  4H0L C;  1TS3 A;  4A3J B;  5KEE A;  2JA8 B;  1O78 A;  3E0J A;  1ZYR D;  2EYL A;  2CHB D;  4M8A A;  2OXP A;  4FF4 A;  4I7Z C;  5D65 A;  3EJI A;  5E3F A;  3H0G B;  2K33 A;  5JOB A;  3A7L A;  1QJO A;  4RCO A;  2D62 A;  3H94 A;  4ZKC B;  2A6H D;  5ISR A;  5CV7 A;  3S17 B;  4EQN A;  2L55 A;  4IFD H;  4RCN A;  3LX0 A;  4K2K A;  2XVS A;  2VB2 X;  3MXN A;  1J8I A;  3P75 A;  1EIH A;  4F88 A;  3K5N A;  3C3L A;  3PV0 A;  2I07 B;  3DMU A;  4QUF A;  1SMY D;  3J80 L;  2JEB I;  1SYG A;  5J39 A;  2IX0 A;  2ICI A;  1DD2 A;  5ELD A;  5C3E B;  1ZXT A;  4RGT A;  5ELC A;  2EOT A;  1FGB D;  2O5I C;  2E2H B;  4H13 C;  3NWS A;  1S4Z A;  1E0B A;  1IKL A;  3VYR A;  1I6H B;  3T53 B;  3OWF A;  2NBF A;  1WVL A;  1OXT A;  4ILW A;  2MUY A;  1MI2 A;  4KY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...