5I2XA

Crystal structure of tpp1 k170del
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional consequences of a disease mutation in the telomere protein TPP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Adrenocortical dysplasia protein homolog
total genus 34
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i2xA00
5I2XA 5I2YA 2M9VA 2I46A
chains in the Genus database with same CATH superfamily
1NSNS 2JE6I 5E4XA 4A3KG 2IHEA 1B9NA 2R93H 4K6DA 1V9PA 2WINB 4DXGA 3HOWB 4DR6L 3PO3G 2JA9A 1JE4A 4P74A 3A8KE 1Q3LA 1SMYD 1SR3A 1U4PA 4IPHA 2UU9Q 5C3WA 1VF5C 4KMUC 1J8IA 4DV5L 1PFSA 4X64Q 1VQCA 3NXWA 2I07B 3BG3A 4DR4Q 4FXGC 1ONLA 1K83B 4KKSA 4R4IA 4LJZC 2MPMA 4HMIA 2CH4A 5TSSA 2K5NA 1I4RA 2MUYA 2EY6A 1BCPF 2Z6KC 1EY9A 4ID6A 3STBC 1VDZA 3GTPB 2RDHA 1NAPA 2R7ZB 1XPUA 3CD6A 3NENA 3QO2A 4IOCA 3K7AB 4DR1Q 2EXZA 3S14H 2RVLA 3M7GA 2PPBC 4A3IB 1P16A 1SJED 5GADC 2EYLA 2RQXA 5KNDA 2AKWB 3QR8A 4A3FG 1J5EL 3T53B 3OHXC 4F8MA 1LTRD 3SHLA 1JWSD 3LNNA 2K14A 4XDXA 3GTKB 3NP8A 1SBBB 2L5TA 3AMUA 1G8ZD 4DV0L 2NVYH 1PV4A 1I4PA 1K3RA 1SNQA 3M4YA 4DAVA 4C3IG 5J22A 1STBA 3FKIG 4AYBG 3H0GB 1NNXA 3TSSA 2PQEA 4LUOA 1BUVT 1Z7TA 2XWJB 2Z1CA 3HOWG 3ND9A 4A3EG 1HFNA 2IX1A 3M9BA 2ZTCA 1VQOA 1ENAA 1TWFH 4EQPA 3S1MH 2Z6BA 1YNNC 3T1YQ 2KCNA 1HJPA 1D8LA 3RN5A 4HJ5A 2B8GA 4A3KH 1NTGA 2CKZB 1PRTF 2O4XA 1MKHA 2V4DA 5LL6S 1Y14B 2PO4A 4DAMA 3H0GH 1Q1EA 1PZJD 5T1GA 1VQLA 1LT6D 2MO1A 2RBMA 5C44H 1G91A 2B63G 2NZOA 4I7AA 3E0EA 1SN8A 1TWAB 1KDBA 3GDEA 4KD4A 4FYDA 4WJ3M 1F77A 2B2YA 1AN8A 1I4GA 4FP5D 2F3VA 4DAYA 4GN3B 4X3TA 1SROA 4CKCA 2A6EC 1LT3D 3I4NB 2ALYB 2QEJC 3OPOA 3S9WA 4DV4Q 1GKHA 3NBHB 3SGIA 3ZYYX 5IGCA 4OEMB 2L11A 3K7AH 2NBFA 1O7IA 1PFMA 2VUMB 5FO7B 4NMZA 5LMUL 5D3DA 2ASBA 5IOCA 3T56B 2BE5C 2A19A 3S2HB 4IOAA 1U4LA 4J15A 4IUPA 1F2MA 4RH6A 1W3SA 1PZKD 1Y1WB 2OWOA 3FHWA 5C0XH 3I7FA 3MWYW 3K6OA 5KYLA 5I2XA 3H3VI 5CORA 3CPFA 3K80C 3K5NA 3GV6A 4DUYL 1VQBA 5EBDA 5GAGC 2PI2A 4A3FB 1PFBA 1LM0A 1VQFA 2GVBA 4PQXA 1Y1WG 3F2UA 3GTKH 2F4VL 1HUMA 4B08A 1DCZA 3RZOH 1H9SB 3KLSX 3VYRA 4TSSA 1HZ9A 1XXGA 4RHSA 5JEAJ 1A6XA 5FOBB 2YU9H 4A3JB 1WD0A 1KQSA 4GOPC 2VQFQ 1RKNA 4C3IB 3E3XA 3G6JB 4A3DG 3JC66 4IURA 2BDOA 4LF4L 2ZJRA 1EOTA 4P2CB 2F3IA 1PH6A 5BN4A 3HOZH 5IP7H 3GTJB 2IL8A 2FINB 4TRDA 1I94L 1HR0W 2HCCA 3S2HH 2BDNA 4JI0Q 3FMCA 3GTMH 3E0JA 5G3LF 4XQJA 1IYUA 5G3LD 2R92G 1SMYC 3DMUA 3KLRA 3Q23A 1Z6HA 2K1BA 1NR2A 1SXTA 4RGTA 2MO0A 3CMEA 1F2LA 1UUPA 2BOSA 1PTOH 1EFWA 1BOSA 1XWEA 3MTSA 4OHJA 1KAAA 4OX9L 4HR7B 1QVGA 2BCOA 4A3JH 1WTRA 4YHHL 3UE0A 2NUCA 4BBRG 4QY7A 4AYBE 2F0DA 2L9HA 2CH4W 4YIJA 5GROA 5C4JH 2CQOA 3ER0A 3SVMA 3RD4A 3STBD 3IL8A 3EBEA 1I94Q 2QGQA 1IZ6A 1TWCH 5KNCA 2JA7G 2N55A 3W2DA 1M4VA 1Z47A 5I4DA 3ND8A 4KHVA 4ZLTF 2QEXA 2Z4IA 1LT5D 1KRTA 4DR1L 3J7AV 1PH4A 4PNYA 4ZAIA 4AQYL 1ILPA 2RDFA 4X65Q 4K6LA 2QF7A 3I4MH 4GLXA 3TEHB 3E6ZX 4Y7NB 2WB1B 1PHJA 1D1KA 3GTQB 2UXDQ 1K8MA 4QF4A 5CR3A 1S5BD 5EQ0A 5C4XH 1PH7A 3PF5A 3K57A 3K58A 1CK1A 4HJ7A 3M7NA 4KTAA 2KCTA 3I4NH 1I4XA 1E0BA 4TQUS 4DNIA 4HIKA 2NVYB 4MN3A 2OTLA 4EVOA 1GM5A 4ABNA 2JJQA 1GD7A 1FYCA 5IGGA 1C48A 1CZGA 4LK1C 2MQHA 3Q0AA 4RCOA 4AQYQ 1YNND 3C1EA 3WOEA 3NE5B 3PCOB 2X6LA 4DV2Q 3CC4A 3I91A 3J81j 3OMGA 3P20A 1FGUA 3NQTA 3ERQA 5CV5A 5HGQA 1X3FA 4RMFA 2PNHA 3EVQA 1WJJA 1QNUA 3BDLA 3Q22A 1NE3A 1XMOL 3U4ZA 4EGVA 2R7ZH 3K81C 4NP5A 3S1MB 1AW7A 4IJHA 1QUQA 1QILA 1LT4D 4KN7C 1W2BA 2UXBQ 2R92B 3CCQA 1CTMA 1K73C 4HJAA 4X3KA 1YI2A 5DEHA 1B1ZA 4F87A 1WCMH 1VQNA 1K28A 4CDCC 4JI1L 5J1ZA 4B3SL 5JJKA 2PW5A 3J81L 4BWGB 4KHPL 1JOKA 3B6YA 3NPPA 3PO2G 4BBSH 4WFN3 1VQDA 5C4ZA 1YNXA 4DK0A 4UPAA 4L5SA 5JOBA 3HOWH 1EY5A 1KDAA 5IYCG 4X3UA 5ELNA 2J7ZA 1NJIC 3R8BA 1IBMQ 4DN4M 2M00A 1PXUA 2F0HA 4KHZA 4ZRZA 1X56A 2K01A 1V1QA 5FO9B 4A3IH 2K52A 3D4RA 4QL5A 4IUTA 3EIVA 2VZAA 2ENBA 5CV8A 3DWAA 3FP9A 2A68C 1MBYA 3JAMc 2E75C 4XTCS 1N36L 1GO3E 4DUYQ 2D62A 3F8TA 4PZ7A 4KHPQ 2M2LA 5C4XB 5FLXc 2HT1A 5C5MA 3RLFA 1SYEA 4FNFA 4RCNA 4GOPB 2XN9C 4X62L 4QGUA 3CRKC 4NXNL 4JI6Q 4FF2A 1NBWA 3F2BA 1ZYRC 2Q8TA 2R7ZG 1PH8A 3TBIB 5JEAG 1PH9A 3OWFA 4QIWB 1IBLL 2JEAI 3ZJYC 5IWAQ 4YWMA 1CFMA 1A8VA 3S16B 1G6ZA 1MSGA 2VL6A 2ID0A 4JV5L 5I6YA 3S2DB 4CGYB 4POGA 3S2DH 1IKMA 1PLFA 3AB9A 2RDGA 1YJWA 3UDGA 3HOYB 1SNOA 1HFGA 2PMZB 4DR5Q 1HZCA 5BR8Q 4BBSB 4U673 3EFXD 5C4JB 3OTOL 4GKKL 1SYCA 2B2VC 2RHQB 4CKEA 5I9PA 2RA4A 1ASYA 2ES2A 5CMDA 5M3MG 1T9HA 2QCPX 2EXDA 1L0XB 3A5ZB 3PUYA 3OW2A 5K36G 1PTOF 4QB4A 1B44D 4JI6L 2KA7A 5EBCA 3RZDB 3RLOA 4LUZA 3FKIB 1SYGA 4K2KA 1EEID 1KTKA 1S5FD 3MFYA 4BY1H 2ZXPA 1KD1C 1SNDA 4K0KQ 5IY0A 1R9TH 4LF8Q 1RTOA 3UE1A 5M3FG 1HR0Q 2EDGA 3J7A5 1GOZA 1DGSA 5JJLA 3KBXA 3SEBA 3NEMA 1O7YA 1DOKA 4R4OA 1K9MC 3M4OB 1PRTB 5M5WH 2EYPA 4MHEA 3ONAB 4LW1A 2F4IA 1PTOC 4J8QA 1MGSA 1KNEA 4DR5L 1BBWA 4ZKCB 3CXCA 3A8JE 3K0YA 2BH2A 2KCMA 1JE5A 2YU9B 2NVTH 3VYSA 3DHQA 4RKBA 5DM63 4LAAA 4JBKA 3RZOB 1SMXA 3OOCA 3F2CA 4IALA 3QWNA 1IW7D 5IP9G 4JK1C 2CHBD 1A63A 4OONA 4QQBX 2Y0SB 1BNZA 4A3CH 3TRZA 4YCWA 2D0PA 2NN6I 2N8NA 1A62A 2MGSA 4DR6Q 2F0EA 5CV4A 1QNKA 2WAQG 3AU7A 3TP6A 1DYQA 5KEEA 1NMGA 2L55A 4LF9Q 3GTLH 2L15A 3D6WA 1KL9A 1CT1D 1A3TA 4IPDA 4B3TL 2UUAL 1SFOH 2A6HC 5BN3A 4ZCKA 1BXTA 2WACA 4DR4L 4IFDH 1B8AA 3C46A 5C3EB 1WI5A 1AE3A 2G5DA 4A3BB 5AFWA 3TZDA 3HOVB 3PUVA 2JQOA 1RIPA 3CCMA 2F0KA 3D8GA 3NHHA 1F9PA 2I5HA 4BS9A 3S1QH 2VNUD 4O1NA 4OWTB 5IT9L 3K0XA 5AJ3L 1JB7A 1QB5D 2HUGA 2HQEA 1UE1A 1KRSA 2WKCA 1C4QA 1K0RA 2C9OA 3D3RA 5EKLA 3KBGA 1QZHA 1C8CA 4LF9L 1W6KA 1TWAH 5FLMH 3PV0A 4GNXB 1EL0A 1WFQA 1SRUA 3MZ5A 4UY8C 1I3QH 1KXLA 1PFNA 4IUNA 2V1CC 4JOIC 4A93H 4S3SA 3VYTA 4ZK9B 3TS0A 3GTOH 4DK3C 2SNMA 1J5EQ 4QUFA 4A93G 3TREA 2R6GA 4KLKA 4PMBA 2I0QA 4NXMQ 3ULJA 1SFOB 5M5YB 1LTBD 3HOXH 2LFNA 2B63H 1DOLA 2MNAA 1QUQB 1UEAB 2IWHA 1TR5A 3GTJH 2YV5A 1AEXA 5EPJA 5BN5A 4JVZA 4JPBW 3MXNA 1ESRA 1EU3A 5D65A 1B3QA 2XNAC 1MSHA 5KNBA 4UAIA 4EQNA 2K32A 1D5XC 4LFBL 2GN5A 2NB0A 2RCNA 4C1NI 2SDFA 4H0LC 1GUNA 3HOUG 1EY7A 1KNAA 2K04A 1Q1BA 2E2HB 1B70B 1I6VC 2Z6KA 5C0XI 4X66L 1F9RA 2EQSA 2VB2X 2Z8LA 1XPOA 2E2DC 1STNA 2MJ8A 2HIXA 4KV6A 1WTPA 3OMCA 1X54A 3GD7A 3RR5A 3MEHA 1H9MA 4WJ4A 2NVXB 1EOVA 3TZUA 2CW0C 2KVMA 1E2WA 1PH3A 1BQQT 3CCSA 3HOXB 2UXCQ 1ICFB 2OTJA 3J7YW 2ZJQA 3I72A 3NELA 4E6IA 1UE6A 1EU4A 4K14A 3FEWX 1U0LA 3G7LA 5M3FH 1NR4A 1HPCA 2A6ED 1TY2A 1J6QA 1CSQA 1OXUA 3VDYA 1VQIA 4C3JB 2IHFA 4BBRB 2UUCL 3KF6B 3OSOA 1YBYA 1HNZL 1PDQA 1SNCA 4APVA 4B3RQ 2M9VA 1SE8A 2KHSA 1H9SA 4P71A 2F0GA 1KDCA 5IYBG 4BBSG 4N9TA 4DV6L 3UDXA 4HSVA 3S15B 4Z9CB 2A73B 2N49A 2R93B 3CF5A 5DNFA 2O2LD 3T4AC 1E2VA 2JN4A 1EY6A 2EYHA 4HJ8A 3KDFB 1OXTA 3QOJA 3CC2A 2RSNA 1WTHA 4UP7A 4IPGA 1KLUD 4B3MQ 2E74C 3I70A 2B63B 1CI3M 1FR3A 3U9SA 4CDDC 2MFIA 5GAEC 2JA5G 1DD2A 5ELBA 5DLQE 1CKOA 3AYHB 1XNQQ 1S40A 4QUCA 4DR2Q 2WP8J 1QWYA 2EYFA 2F0WA 4A93B 4L5RC 4CJ0B 5HURA 5HGTA 2L1BA 5IGFA 5M5XH 4L6TB 2JA6H 1EY4A 2EIFA 1PZID 2IX0A 1WTQA 2LKVA 4OELB 4G7OC 3LWEA 2HIVA 3DWPA 2KENA 1CA5A 3MEFA 5C44G 1SNPA 1V43A 1VQ8A 2NZ1D 2R7FA 5GAHC 4A3BH 1SDFA 2A5HA 4TKOB 2Z4HA 4OO1I 1Q12A 1XMQQ 3LGJA 3GTGB 3P75A 4A3BG 1X55A 3PF4A 2RF4A 2FMCA 1PA6A 1AP0A 2XVSA 3P1HA 4NB3A 1Y69U 3SXHA 5D3IB 2F0OA 1D5MC 1WVLA 5DM73 4DUZQ 2IY5B 1EQVA 1GUOA 2CCZA 4JI2Q 1B3AA 2KEEA 2PMZE 4IUQA 2BH8A 3BS1A 2X6GA 1ASZA 2SNSA 1MD2D 1RD9D 3KOJA 5L37A 4X6AH 1QCBD 3BVGA 1BCPB 2O5IC 2F0LA 3I3CA 4HMJA 1Q8KA 4I65A 1FNWA 2QA4A 1EYCA 3VR6A 2E5LL 1Y1VG 1SLJA 1QVCA 1XMQL 4JBJA 5E7NA 5GQOA 2JA5H 4DV7L 1PH2A 5JVH3 4A3FH 2GVAA 3PSIA 2F0JA 5ELEA 4GKJL 5FO8B 3HRZC 3L3OC 5IT9c 1II3A 4C56C 1GUWA 4DR7L 4IFDI 4R9WA 2LSSA 2VS1A 2UUBL 1L1OC 4GNXA 5M5WB 5JPMC 4A3CG 2NWGA 5M3MB 1QVFA 1SAPA 3EA6A 2KCCA 5LMNL 5C4XG 4A3MB 1LTSD 1N34Q 4DAYB 4RKLA 1NUCA 3TP5A 3J80L 1AE2A 4A3DH 4XT3B 3SK8A 1K83H 4Y52H 3I56A 5ISRA 4HTHA 1XMOQ 1C9OA 4LMQD 3VR4A 5FLMG 1JJ2A 4HIOA 3HP3A 2A69D 3QG1A 2EJGC 1S5CD 1U4MA 1PMRA 2F0QA 4K8IA 4PMCA 1VCIA 2UXBL 1H9RA 2F0IA 4JW0A 2P5ZX 5I2YA 2VW9A 1I6HH 4YCUA 3S15H 4XYOA 2BE5D 1O7ZA 3I73A 1LTID 1QZGA 4AIMA 1EIHA 4DNTB 2K5WA 1IL8A 4JI5Q 4GOPA 1RCVD 1Y1VH 3S1NB 3E5SA 2EVBA 2F03A 2KHIA 3NWTA 4NXNQ 2KOLA 3CPWA 1N33L 3X3MA 1A2UA 4A3JG 3M4PA 1DXMA 1KIXA 1OO9B 3A55A 3Q8DA 4GN5A 3T51B 2K5DA 1IBKQ 4P72A 1LTAD 2F0VA 2R7DA 3M4QA 3N6RA 4HAEA 3GTMB 4DV1Q 3MA2B 5LHY1 1MIUA 5JVG3 1G2TA 1ZXTA 1TY0A 5FKAC 2A68D 2ICIA 3EJIA 2J0TD 3SK6A 3OTOQ 4GKKQ 1SE4A 2PYKA 1JORA 5EKKA 3VA7A 3PMFA 4X65L 4DAPA 3HGBA 2DY8A 1D6EC 2D9UA 2GA4B 2L0CA 4PMWA 2VQEQ 5LMUQ 5EAYA 1WTXA 2AHOB 4HSPA 2AQ1B 4ILWA 4CKBA 4DFAA 2B2WC 1XNQL 4RHRA 2FJ2A 3VR3A 4DV3Q 1HR0L 4JI7Q 4B9WA 2K03A 3MC0B 2A8VA 3I4MG 4KN4C 3F1ZA 3C2PA 1LLRD 4OGQC 4XT1B 3R93A 2IJ0A 1LTGD 2X69A 4L5TA 2F4VQ 4DV5Q 4DV2L 1EYGA 1PVOA 1VQMA 3HOYG 2XTIA 4XIGS 3GTGH 1L0YB 3HOYH 3J80E 2JA7B 1HQMC 3I4LA 4MTKA 1XTCD 2KHJA 4K0KL 1WOCA 3A56A 4JI7L 5EGTA 5C0XJ 2B3GA 4OIJA 3T1HQ 1AH9A 4HCSA 2PZTA 3HS0C 5CV7A 4IN3A 1LTLA 1UWVA 3TP7A 1JOOA 5EPLA 3I90A 4WJWA 5JJZA 1TIID 4DUZL 4RAUC 3L0OA 5KRUA 2AMCB 2L4NA 3U50C 2FHTA 2I5MX 3DUZA 5JEAH 1L2FA 4BBRH 4HCEA 3S1QB 4RGMA 1A2TA 4A3LH 3VYUA 4EQ5A 5C6AA 2UUAQ 5IYCH 1LABA 1EQTA 4NPSA 4DF7A 2F0MA 4HN7A 4BXXG 3DM3A 1G291 4YHHQ 1DZ1A 3CW2C 3HOVG 4JBMA 4CBVA 4LFCL 3DWQA 4YWKA 4OWWB 2R93G 1FJGQ 3PO2B 1K8AC 1VQ9A 4F88A 1N8RC 4PV1C 5E3FA 3K59A 3BVMA 4PZ6A 3H3VH 1EWCA 1OXVA 3HG9A 4A3IG 4C3IH 3VA5A 4YCVA 4JYAL 2JYOA 2R61A 5ELCA 3QOLA 1ILQA 5IGBA 1H9JA 1BDOA 3ERSX 2EE1A 5LMNQ 2E8GA 4AH6A 4B3SQ 4BY7B 2YTXA 3SK4A 3V2TA 2SEBD 2NN6G 1X3EA 4J6HA 3QJYA 2AQ2B 1EY0A 2HCIA 3C1FA 1M90C 1O80A 1HA6A 4CDEC 1XYIA 1R4QB 4HIMA 1CKNB 3BVZA 1TS3A 1S4ZA 2R92H 3G6EA 1KAWA 4FO2A 3X3NA 4G7HC 3CCLA 4LF7L 3WWVA 2ZXOA 1B53A 3CP0A 4DKAC 1XJVA 1SE3A 5KYIA 4K8JA 1CHPD 4JI3Q 1YITA 3OIQA 4JI5L 5BR8L 1O7LA 1V1PB 4Q5VA 5CC4A 4X3SA 1YJNA 1Q7YC 3W1BA 4A3MG 3RLNA 1UE7A 1S72A 2VXWA 3EQLC 4N9PA 3PGZA 2EPBA 1HA5A 2Q2TA 3BYTB 3OW7A 1VQPA 1E2ZA 1SNMA 3DEPA 4QIWE 1RHPA 5JPNC 3QIAA 4LWCA 5HY6A 3GP7A 4DA2A 5M5XB 2DGYA 4IPCA 3BDOA 4KI0A 3A0JA 4LF7Q 2JA7H 4ZQ3A 3HZXA 4F7XA 4CHTB 5C5LA 1YHAA 2AWNA 3AQQA 3IRBA 5C4HA 3JAME 1T5XD 3H91A 4I7ZC 3GQBA 4J1MA 5FLXL 5K5PA 1PH1A 2E2IH 2UU9L 2K28A 3NUCA 1Q8IA 4X66Q 4R4CA 4DGZA 5FJ8G 1A3VA 1EEFD 3BJUA 1CM9A 2WAQB 3HKSA 4K5VA 4LFAQ 2I46A 4ODGA 2B2TC 4MZ9A 3H3VC 1KHIA 2DNCA 1V1OA 2WKDA 4FXKC 2ATWA 2KQ3A 4QMGA 4R8NA 1AFPA 1RF2D 3DM1A 1F2YA 4FF3A 4P73A 4R4QA 1I50H 2LS01 4K5WA 5IP7G 1UAPA 2E2JH 2ICEC 5IP9H 2WAQE 1RODA 4BXXH 3C3LA 1ZYRD 5I6WA 5IYDG 4YY3Q 1PYSB 5A2QL 4C3JH 1L0WA 5C44B 1STHA 3O13A 5C3EH 3DXJC 3RMHA 4RA8A 4DR2L 2OCEA 2Q2IA 1PTOD 2DUDA 4EQOA 2CVRA 2CWPA 3IFDA 1VQ6A 2IX3A 2F0FA 1ENCA 3N52A 2ZTEA 1WTWA 2YTYA 3E9IA 2E2IB 5E1FA 1NCVA 2F3WA 2FMMA 1Y8PB 5CGKA 3I55A 3GTLB 4QCLA 2YYZA 1X6OA 4IFDJ 2SOBA 2PCFB 3R2TA 2N3SA 4XYQA 1EYAA 1HQRD 2WB1E 1AZQA 2KUMA 3BZCA 1MI2A 3CQZB 1LTTD 5CBEE 4H02A 2EYMA 2K6AA 3CRLC 4EX5A 3RNUA 4CJ2C 4BY7H 1IYJB 2DY7A 2HQLA 3DEOA 1M8AA 2AQ3B 5J39A 2OQKA 1MJCA 3KK7A 1LYLA 4FF4A 1I6HB 2K5VA 1QOHA 4C3HH 4MNOA 4ALPA 2UXDL 2NZHA 1UNSA 1IKLA 4LFCQ 1IXRA 3D31A 3NK9A 2B8FA 3TP8A 3M85A 1SYFA 3D6CA 3G71A 3IFTA 1DONA 3HEJA 2PZWA 2PNRC 2HHHQ 1HUNA 4UDUC 1TWGB 1TT2A 3MXGA 2HD3A 5I9OA 5C3XA 4GLAC 1DM0B 3GTPH 3ICEA 4IJLA 3KJPA 3AFQA 3NQIA 2EYOA 1G51A 1RTNA 1TWHH 3NTHA 4A75A 3QB3A 5LMNW 4YWLA 3TMEA 3OYYA 3J81c 3J80c 1I5FA 3CCUA 2G9DA 3D0FA 3W5OA 1ENFA 1JJGA 5NUCA 4GKJQ 4NXML 3IKJA 2PZUA 2K5QA 3SE0A 1HH2P 4U68A 4ZKBB 2K50A 1SYDA 3LWUA 3MFGA 2NTSA 3CMAA 2JEBI 1B9MA 2A6HD 3K8AA 3ULLA 3W3AA 4G7ZC 4OO1G 1K0SA 3HOVH 1TVXA 3MXNB 5CBAE 2B2WA 3J81i 3OWEB 2QILA 1YHBA 2NVQB 4ME3A 3IAYA 3K5OA 4IFDG 3HFZB 3RUZA 4GLVB 4L63B 1CKNA 4NKLA 1C7YA 2LMCB 1D2BA 2EY2A 1GHJA 3EROA 4KK7A 1YVCA 4A3GG 3Q24A 4DV0Q 3WOFA 3PO3H 1HNXL 1K8GA 3M3YH 5M3MH 3AEVA 4Q0FA 1LUZA 3KLSA 1HXYD 4UP8A 2EJFC 3S17H 1AZPA 2B2TA 2VUMG 2FFKB 1N36Q 4KY6A 1G2SA 1ZEQX 4ZUJA 3FPUB 4C2MH 3KJOA 1QJOA 5ELOA 3T1YL 4C3HB 1JJCB 5IE8A 2EOTA 3H6MA 5KIXA 1UE5A 2N78A 3H0GG 2KJXA 3I2ZA 5JAVA 4X62Q 1HNZQ 5IYBH 4LFAL 1DJRD 3M4OH 3CCVA 1QE6A 3A7LA 4DV6Q 5M9OA 1IBLQ 2B2UA 4BA1I 3PO3B 1U9RA 1R9TB 2N88A 1RJTA 5EPKA 4M8AA 2Q2HA 5IGDA 4BY1B 3ITPA 3ULPA 1E22A 1KABA 1OXXK 1Q82C 4DK1A 1P8LA 2XGTA 4Y7NH 1VQAA 2E76C 5CYUA 2KECA 3URYA 1FNUA 1HRJA 2Z0SA 1IYVA 1ET9A 1WTOA 1VMCA 3U4VA 1S3OA 1YNJD 3JAMi 1IL2A 2VQFL 3CU7A 2LXJA 2ZT9C 2PW7A 3CHBD 4O2DA 4H13C 3A74A 2XRQD 1V8QA 3D4WA 4DV1L 4LF8L 4P75A 4JI0L 1BVSA 1HNWQ 3S24A 3I4OA 1OXSC 3SK5A 4V190 4H44C 1ML0D 4R1JA 2A1AA 1K3BC 1GUTA 3PQIA 1TS5A 5A2QE 5IT9E 1F2ZA 4KY7A 2R3ZA 3A54A 2O5JC 4DR3Q 1CSPA 2UUCQ 5T1IA 1YHQA 3U58A 3PIO3 1WD1A 2VQEL 4X64L 5ELFA 1HZAA 1E3PA 4KJNA 4WORA 1SE2A 4XQQA 2PQAB 1IW7C 3T1HL 4NW2A 2D2CC 4LF4Q 1LACA 2CWAA 5FJ8H 1YEZA 4A3EB 2HHHL 3CCJA 3G48A 3PIPA 1M1KC 1DOMA 5EJWA 5IODA 4JI2L 4JC0A 1YZ6A 1TWCB 2JA8H 1EUJA 1OTCA 2F0UA 4JI1Q 2EJMA 1PYBA 1N34L 1CHQD 4B3ML 5LL6X 4LF6Q 2Q2UA 2HDMA 4FDBA 4DR3L 1Q90A 2E5LQ 1FGBD 5K36H 1ICWA 2K4KA 1MHWC 4M1UB 2Q8RE 2JA6G 3G4SA 2TMPA 2RHSB 1CKMA 1GHKA 3TDQA 2OQ0A 1HZBA 2WFWA 4BY1G 1PTOB 5JJIA 1SYBA 2ZXRA 5AJ3Q 1IBML 1TWHB 3KUPA 1YJ9A 1Q86C 3S14B 1STEA 3FRPB 2J4XA 4FVMA 2H4OA 2TSSA 4A3MH 1EY8A 2OEOA 1TQOA 3A8IE 1E7ZA 3H15A 2VUMH 3CKIB 3H94A 2NVXH 4N8X1 3HOZB 1TWGH 3P7JA 3A5UA 4JG2A 1JQYD 4WRDA 4BY7G 4FF1A 1D5ZC 2VB3X 1TS4A 2Y0SE 3SR1A 3T16A 1EWHA 1QG7A 3HOXG 3TS2A 1EIFA 1N33Q 1EIGA 3J7AF 2QDBA 1FJGL 2E2JB 1EQQA 2JA5B 1EQRA 2F1MA 1JC7A 3HKZG 2K7VA 1HHVA 5H1SE 1D7QA 1HCZA 1D1IA 4DU9A 2BA0A 1U4RA 1VQKA 1EWIA 1JCKB 2AUKA 4ZUIA 1VQHA 1SJHD 1A0IA 4JYAQ 1STGA 1UEBA 1JR0D 2EY5A 5EKIA 1TXYA 2WV6D 4A3GB 4LFBQ 4V0BA 2F0NA 1FNVA 1BBUA 2XWBB 5C3EG 1EIYB 4A4IA 4MTNA 1Y8OB 3GTQH 3BU2A 4XQNA 3NWSA 3HOUB 1XTDA 3PUXA 3I4MB 3VR5A 3HOUH 5A35A 3BYYB 4LF5L 1F9QA 1VF7A 4OWXB 4DV4L 4RWSC 2RSOA 2QW7A 3K7UC 1Z9FA 3S1RH 4OO1H 1X9NA 3FPPA 2IPKD 1PH5A 5IYDH 2DJFC 2EYJA 4RG1A 4DR7Q 1IBKL 4IUVA 2KBNA 2I5LX 1BBXC 2UUBQ 3R3OA 5C0XG 2UXCL 2XSCA 4RGOS 1X65A 2MP1A 4B9XA 3Q6SA 2JA6B 3GO5A 1XPRA 1BKBA 1E1OA 1H95A 3KF8B 1BCPD 4JI8L 1ESFA 1JICA 4OL7A 1Q46A 1ET6A 4JBWA 3SDZA 1JWUD 2K33A 4MIUA 3S1RB 1Q81C 4OXPA 4OX9Q 1WTVA 1X3QA 1JT8A 1GVPA 4A3KB 1RL2A 1VQ5A 3H09A 1STYA 1C0AA 2IT1A 4B3RL 1KC8C 2KEDA 1NMFA 1XNRQ 1B4OA 2K75A 1SEBD 3W1GA 4HEDA 1GUSA 3OIPA 5IGEA 2AWOA 3I4NG 1XX8A 4IUUA 2JK8A 1I4QA 5DAUA 1N9WA 1GUGA 4A3GH 4XXEA 2L12A 4DK6C 1CQFA 4IO9A 1L1OB 2H5XA 2JSOA 4BA2I 4K5XA 4JI8Q 3NTIA 3K5MA 2ZM6L 1BR9A 4B3TQ 1SSOA 3L2PA 1VS0A 3HKZB 1FVIA 2DN8A 4C1NK 2OT2A 4GN4B 3JAML 1S5ED 4RGNA 2D5DA 2WIIB 2QKIC 1IHZA 4A3LG 1NY4A 4C2MB 1WYDA 2ZJPA 3D4DA 4A3EH 3CCRA 1CQVA 1XNRL 4QJFA 4GZYC 5M3FB 2F0SA 2F0PA 2B39A 2Z9HA 3MHBA 1Y1WH 5FK9C 1EFID 2G9HD 1GJXA 3PO2H 4KD3A 3CC7A 4UHVA 2EY1A 4DNRB 3KLWA 1HTPA 3E9HA 3M3YB 4UP9A 5M5YH 2C5CA 5COYA 5KGUA 2ZM6Q 1TU2B 4RFBA 2BA1A 1B7YB 3GTOB 5CV6A 1X3PA 3FKIH 2JP1A 4K2LA 4G4KA 3TN2A 4LF6L 2PQAA 1I3QB 3BDCA 1JMCA 2NN6H 2OF1A 3V05A 1YNJC 4JOIA 3EN2A 3UI2A 1Y1VB 2WB1G 3S1NH 4FXDA 5IIFA 1EZ6A 2E2HH 4L8JA 5F2DA 1ZKOA 4L5QA 2FXQA 1CZWA 2JA8B 4ME5A 1BF4A 1H9KA 3S16H 5J3BA 1VQGA 3HKZE 4TVAB 2LY7A 3UDFA 2PI2E 4HJ9A 4JI3L 4IQZA 1KLGD 3F2DA 1EZ8A 1YIJA 4NDXA 4A76A 3T13A 3MVVA 1GXDC 2Y0SG 5D14A 4DV7Q 1W6JA 1VQEA 1WCMB 1TWFB 2HDLA 2RCFA 4R4TA 3R2IA 2B2YC 3TQYA 3WDNA 3L9AX 2K5HA 1LV9A 4PG3A 2A74C 3UDIA 4O42A 4KY5A 4N8FA 3U9OA 1BO0A 3I8ZA 4DPGA 4O0AA 1R4PB 4IZ8A 1VQ4A 2DJGC 3KYHC 4CDFC 4JCVE 4LNQA 4OIKA 2NTTA 3A7AB 4C3HG 2MHVA 2RKSA 2Q8IB 5FLXE 2B29A 2NVTB 3PUWA 1MJEA 2XRSD 4JI4L 1N32L 3MXUA 4LF5Q 2ZTDA 3HOZG 1PRTC 1V1PA 2F0TA 5CV9A 2H1EA 3NBHA 1EYDA 1HNXQ 1LO5D 2LXKA 2A69C 3MXPA 1CA6A 4DXFA 3CQZH 5IWAL 3FDTA 3VR2A 4KKUA 1JWMD 1PYWD 1A15A 4JV5Q 1FL0A 2OXPA 4GS3A 1STAA 2C35B 3RZDH 2XIWA 4GNXC 2YTVA 1PRTD 2CQAA 1K8OA 2D0OA 1TS2A 3DLLA 3LX0A 1X32A 1VQ7A 3PUZA 2K05A 3KFUA 4KKTA 1B50A 4KJOA 1E1TA 1VMPA 2CFMA 4YY3L 2F52A 2JXMB 4JI4Q 1N32Q 2VY3A 4POFA 3NTKA 1RDPD 2B2VA 2CW0D 3AFPA 3J7ZC 4AYBB 4G57A 2DNEA 1JOQA 1E24A 1U5KA 1O78A 2JA8G 4CJ1B 1X3GA 1JB3A 2IW3A 2QDLA 4C3JG 1J9OA 4ULLA 1BCPC 3J81E 3J80i 1S5DD 1I50B 3NBIA 4H7BA 3GV3A 1CUKA 3KF8A 4R8IA 4LUVA 4ZYSA 1WCMG 3K5LA 3S17B 1HTLD 2AUJD 3PIOA 3KF6A 2NYZD 1I4HA 3FVQA 4A3DB 3MAQA 1B2TA 1FD7D 3CAMA 1G6PA 1F9SA 3RN2A 3L7ZC 5E4WC 2EZVA 3BZDB 3NSWA 4HIDA 4DV3L 2B2UC 3PIP3 1A3UA 3BZKA 2NVQH 4PZ8A 1VQJA 3V96A 3CCEA 1HNWL 1L1OA 5ELDA 1Y8NB 1TKWB 3KDFA 1T5EA
chains in the Genus database with same CATH topology
1NSNS 2JE6I 5E4XA 1B9NA 4K6DA 2WINB 4DXGA 3HOWB 1JE4A 3A8KE 1Q3LA 1SMYD 1U4PA 5C3WA 1VF5C 4KMUC 1J8IA 3NXWA 2I07B 3BG3A 4FXGC 1ONLA 1K83B 4KKSA 4LJZC 2MPMA 4HMIA 5TSSA 1I4RA 2MUYA 2EY6A 1BCPF 1EY9A 4ID6A 1VDZA 3GTPB 2RDHA 1NAPA 2R7ZB 3QO2A 3K7AB 2EXZA 2RVLA 3M7GA 2PPBC 4A3IB 1SJED 2EYLA 2RQXA 5KNDA 3T53B 3OHXC 4F8MA 1LTRD 3SHLA 1JWSD 3LNNA 4XDXA 3GTKB 1SBBB 2L5TA 3NP8A 3AMUA 1G8ZD 1I4PA 1SNQA 3M4YA 4DAVA 4C3IG 5J22A 1STBA 3H0GB 3TSSA 2PQEA 1BUVT 1Z7TA 2XWJB 2Z1CA 1HFNA 3ND9A 2IX1A 1ENAA 4EQPA 1YNNC 2KCNA 2B8GA 5LL6S 1PRTF 2O4XA 2V4DA 2PO4A 1Q1EA 1PZJD 5T1GA 1LT6D 2RBMA 1G91A 1TWAB 1KDBA 4KD4A 4FYDA 1F77A 2B2YA 1AN8A 1I4GA 4FP5D 2F3VA 4DAYA 4X3TA 4CKCA 2A6EC 1LT3D 3I4NB 2QEJC 3OPOA 3S9WA 3ZYYX 5IGCA 2L11A 2NBFA 1PFMA 2VUMB 5FO7B 4NMZA 5D3DA 5IOCA 3T56B 2BE5C 3S2HB 1U4LA 4IUPA 1F2MA 4RH6A 1Y1WB 1PZKD 5C0XH 3MWYW 3K6OA 5KYLA 5I2XA 5CORA 3K5NA 3GV6A 5EBDA 4A3FB 1PFBA 4PQXA 3F2UA 1HUMA 4B08A 1DCZA 1H9SB 3KLSX 3VYRA 4TSSA 1XXGA 4RHSA 5JEAJ 1A6XA 5FOBB 4A3JB 1WD0A 1RKNA 4C3IB 3G6JB 4IURA 2BDOA 1EOTA 4P2CB 5BN4A 3GTJB 2IL8A 2FINB 4TRDA 2HCCA 2BDNA 3FMCA 3E0JA 5G3LF 4XQJA 1IYUA 5G3LD 1SMYC 3DMUA 3KLRA 3Q23A 1Z6HA 2K1BA 1NR2A 1SXTA 4RGTA 1F2LA 1UUPA 2BOSA 1PTOH 1BOSA 1XWEA 3MTSA 4OHJA 1KAAA 4HR7B 2BCOA 1WTRA 2NUCA 2F0DA 2L9HA 4YIJA 3SVMA 3RD4A 3IL8A 5KNCA 2N55A 3W2DA 1M4VA 1Z47A 5I4DA 3ND8A 4KHVA 4ZLTF 2Z4IA 1LT5D 3J7AV 4PNYA 4ZAIA 1ILPA 2RDFA 4K6LA 2QF7A 3E6ZX 4Y7NB 2WB1B 3GTQB 1D1KA 1K8MA 4QF4A 5CR3A 1S5BD 5EQ0A 3K57A 3K58A 1CK1A 3M7NA 4KTAA 1I4XA 1E0BA 4TQUS 2NVYB 4MN3A 4EVOA 4ABNA 1FYCA 5IGGA 1C48A 1CZGA 4LK1C 3Q0AA 4RCOA 1YNND 3C1EA 3WOEA 3NE5B 2X6LA 3I91A 3OMGA 3P20A 3NQTA 3ERQA 5CV5A 3EVQA 3BDLA 1QNUA 3Q22A 4EGVA 4NP5A 3S1MB 1AW7A 1QILA 1LT4D 4KN7C 2R92B 1CTMA 4X3KA 5DEHA 1B1ZA 4F87A 5J1ZA 2PW5A 3J81L 4BWGB 1JOKA 3NPPA 4WFN3 5C4ZA 4DK0A 5JOBA 1EY5A 1KDAA 4X3UA 2J7ZA 3R8BA 4DN4M 2M00A 1PXUA 2F0HA 4KHZA 4ZRZA 2K01A 5FO9B 3D4RA 4IUTA 2ENBA 5CV8A 3DWAA 2A68C 1MBYA 2E75C 4XTCS 2D62A 2M2LA 5C4XB 5C5MA 3RLFA 1SYEA 4FNFA 4RCNA 2XN9C 3CRKC 4FF2A 1ZYRC 2Q8TA 3TBIB 5JEAG 3OWFA 4QIWB 2JEAI 1CFMA 3S16B 1G6ZA 1MSGA 2ID0A 5I6YA 3S2DB 4CGYB 1IKMA 1PLFA 3AB9A 2RDGA 3HOYB 1SNOA 1HFGA 2PMZB 4BBSB 4U673 3EFXD 5C4JB 1SYCA 2B2VC 4CKEA 5I9PA 2RA4A 5CMDA 2QCPX 1L0XB 3PUYA 5K36G 1PTOF 4QB4A 1B44D 2KA7A 5EBCA 3RZDB 3FKIB 1SYGA 4K2KA 1EEID 1KTKA 1S5FD 3MFYA 2ZXPA 1SNDA 1RTOA 2EDGA 1GOZA 3KBXA 3SEBA 1O7YA 1DOKA 3M4OB 1PRTB 2EYPA 4MHEA 3ONAB 2F4IA 1PTOC 4J8QA 1MGSA 1KNEA 4ZKCB 3A8JE 3K0YA 2YU9B 3VYSA 3DHQA 4RKBA 5DM63 4LAAA 3RZOB 3OOCA 4IALA 3QWNA 1IW7D 4JK1C 2CHBD 2Y0SB 1BNZA 2NN6I 2MGSA 2F0EA 5CV4A 1QNKA 3AU7A 3TP6A 1DYQA 5KEEA 2L55A 3D6WA 1CT1D 1A3TA 2A6HC 5BN3A 4IFDH 1BXTA 2WACA 3C46A 5C3EB 4A3BB 5AFWA 3TZDA 3HOVB 3PUVA 2F0KA 3D8GA 3NHHA 1F9PA 4BS9A 2VNUD 4O1NA 5IT9L 1QB5D 2HUGA 2HQEA 2WKCA 1C4QA 5EKLA 2C9OA 3D3RA 3KBGA 1C8CA 1W6KA 3PV0A 1EL0A 3MZ5A 1PFNA 4IUNA 4S3SA 3VYTA 4ZK9B 2SNMA 4QUFA 2R6GA 4PMBA 1SFOB 5M5YB 1LTBD 2LFNA 1DOLA 1UEAB 2IWHA 1TR5A 1AEXA 5EPJA 5BN5A 3MXNA 1ESRA 1EU3A 5D65A 2XNAC 1MSHA 5KNBA 4UAIA 4EQNA 2K32A 1D5XC 2NB0A 4C1NI 2SDFA 4H0LC 1GUNA 1EY7A 1KNAA 2K04A 1Q1BA 2E2HB 1I6VC 5C0XI 1F9RA 2VB2X 2Z8LA 2E2DC 1STNA 2MJ8A 1WTPA 4KV6A 3OMCA 3GD7A 3MEHA 1H9MA 2NVXB 3TZUA 2CW0C 2KVMA 1E2WA 1BQQT 3HOXB 3J7YW 3I72A 4E6IA 1EU4A 4K14A 3FEWX 3G7LA 1NR4A 1HPCA 2A6ED 1TY2A 1OXUA 4C3JB 4BBRB 3OSOA 1PDQA 1SNCA 2M9VA 2KHSA 1H9SA 2F0GA 1KDCA 4N9TA 4HSVA 3S15B 4Z9CB 2A73B 2R93B 5DNFA 2O2LD 3T4AC 1E2VA 1EY6A 2EYHA 1OXTA 3QOJA 2RSNA 1KLUD 2E74C 3I70A 2B63B 1CI3M 1FR3A 3U9SA 1DD2A 5ELBA 4QUCA 2WP8J 1QWYA 2EYFA 2F0WA 4A93B 4CJ0B 5HURA 5HGTA 2L1BA 5IGFA 4L6TB 1EY4A 1PZID 2IX0A 1WTQA 2LKVA 4G7OC 3LWEA 3DWPA 1CA5A 1SNPA 1V43A 2NZ1D 1SDFA 2A5HA 4TKOB 2Z4HA 4OO1I 1Q12A 3GTGB 3P75A 2FMCA 1AP0A 2XVSA 3P1HA 1Y69U 3SXHA 5D3IB 2F0OA 1D5MC 1WVLA 5DM73 1EQVA 1GUOA 1B3AA 2KEEA 4IUQA 3BS1A 2X6GA 2SNSA 1MD2D 1RD9D 1QCBD 3BVGA 1BCPB 2O5IC 2F0LA 3I3CA 4HMJA 4I65A 1FNWA 1EYCA 3VR6A 5JVH3 2F0JA 5ELEA 5FO8B 3HRZC 3L3OC 1II3A 4C56C 1GUWA 4IFDI 4R9WA 5M5WB 5JPMC 2NWGA 5M3MB 1SAPA 3EA6A 2KCCA 4A3MB 1LTSD 4RKLA 1NUCA 3TP5A 3J80L 4XT3B 3SK8A 5ISRA 4HTHA 4LMQD 3VR4A 3HP3A 2A69D 3QG1A 2EJGC 1S5CD 1U4MA 1PMRA 2F0QA 4K8IA 4PMCA 1VCIA 1H9RA 2F0IA 5I2YA 4XYOA 2BE5D 1O7ZA 3I73A 1LTID 1EIHA 4DNTB 2K5WA 1IL8A 1RCVD 3S1NB 3E5SA 2EVBA 2F03A 3NWTA 2KOLA 3X3MA 1A2UA 1DXMA 1OO9B 3A55A 3T51B 2K5DA 1LTAD 2F0VA 3N6RA 4HAEA 3GTMB 3MA2B 5LHY1 5JVG3 1G2TA 1ZXTA 1TY0A 5FKAC 2A68D 2ICIA 3EJIA 2J0TD 3SK6A 1SE4A 2PYKA 1JORA 5EKKA 3VA7A 3PMFA 4DAPA 3HGBA 2DY8A 1D6EC 2D9UA 2GA4B 2L0CA 4PMWA 1WTXA 4HSPA 2AQ1B 4ILWA 4DFAA 4CKBA 2B2WC 4RHRA 2FJ2A 3VR3A 4B9WA 2K03A 3MC0B 4KN4C 3C2PA 1LLRD 4OGQC 4XT1B 3R93A 2IJ0A 1LTGD 2X69A 4XIGS 1L0YB 3J80E 2JA7B 1HQMC 3I4LA 1XTCD 3A56A 5EGTA 5C0XJ 4OIJA 4HCSA 2PZTA 3HS0C 5CV7A 4IN3A 3TP7A 1JOOA 5EPLA 3I90A 4WJWA 5JJZA 1TIID 4RAUC 5KRUA 2L4NA 2FHTA 3DUZA 5JEAH 4HCEA 3S1QB 4RGMA 1A2TA 3VYUA 5C6AA 1LABA 1EQTA 4DF7A 2F0MA 4HN7A 1G291 1DZ1A 4CBVA 3DWQA 3PO2B 4F88A 4PV1C 5E3FA 3K59A 3BVMA 1EWCA 1OXVA 3HG9A 3VA5A 2JYOA 2R61A 5ELCA 3QOLA 1ILQA 5IGBA 1H9JA 1BDOA 2EE1A 4BY7B 3SK4A 3V2TA 2SEBD 2NN6G 4J6HA 3QJYA 2AQ2B 1EY0A 2HCIA 3C1FA 1O80A 1HA6A 1XYIA 1R4QB 3BVZA 1TS3A 1S4ZA 4FO2A 3X3NA 4G7HC 2ZXOA 1B53A 1SE3A 5KYIA 4K8JA 1CHPD 3OIQA 1O7LA 1V1PB 4Q5VA 5CC4A 4X3SA 2VXWA 3EQLC 4N9PA 2EPBA 1HA5A 3BYTB 3OW7A 1E2ZA 1SNMA 3DEPA 1RHPA 5JPNC 3QIAA 4DA2A 5M5XB 3GP7A 3BDOA 4KI0A 4ZQ3A 3HZXA 4F7XA 4CHTB 5C5LA 2AWNA 5C4HA 3JAME 1T5XD 3H91A 4I7ZC 3GQBA 4J1MA 5FLXL 5K5PA 2K28A 3NUCA 1Q8IA 4DGZA 1A3VA 1EEFD 1CM9A 2WAQB 4K5VA 2I46A 4ODGA 2B2TC 3H3VC 2DNCA 1V1OA 2WKDA 4FXKC 2KQ3A 4QMGA 4R8NA 1AFPA 1RF2D 3DM1A 1F2YA 4FF3A 2LS01 4K5WA 1UAPA 2ICEC 1RODA 3C3LA 1ZYRD 5I6WA 5A2QL 5C44B 1STHA 3O13A 3DXJC 3RMHA 4RA8A 1PTOD 4EQOA 2CVRA 3IFDA 2IX3A 2F0FA 1ENCA 3N52A 1WTWA 2E2IB 5E1FA 1NCVA 5CGKA 2F3WA 1Y8PB 2FMMA 3GTLB 4QCLA 2YYZA 4IFDJ 2SOBA 4XYQA 2PCFB 3R2TA 1EYAA 1HQRD 1AZQA 2KUMA 1MI2A 3CQZB 1LTTD 5CBEE 2EYMA 2K6AA 3CRLC 4CJ2C 2DY7A 3DEOA 1M8AA 2AQ3B 5J39A 3KK7A 4FF4A 1I6HB 1QOHA 1UNSA 1IKLA 3D31A 3NK9A 2B8FA 3TP8A 3M85A 1SYFA 3D6CA 3IFTA 1DONA 3HEJA 2PZWA 2PNRC 1HUNA 4UDUC 1TWGB 1TT2A 3MXGA 5I9OA 5C3XA 1DM0B 3NQIA 2EYOA 1RTNA 3NTHA 3QB3A 3TMEA 2G9DA 1ENFA 5NUCA 3IKJA 2PZUA 2K5QA 3SE0A 4U68A 4ZKBB 1SYDA 3LWUA 3MFGA 2NTSA 2JEBI 1B9MA 2A6HD 3W3AA 4G7ZC 4OO1G 1TVXA 5CBAE 2B2WA 3OWEB 2QILA 2NVQB 3IAYA 3K5OA 4IFDG 3RUZA 4L63B 4NKLA 1D2BA 2LMCB 2EY2A 1GHJA 3EROA 4KK7A 3Q24A 3WOFA 4Q0FA 3KLSA 1HXYD 2EJFC 1AZPA 2B2TA 2FFKB 4KY6A 1G2SA 1ZEQX 4ZUJA 3FPUB 1QJOA 4C3HB 2EOTA 3H6MA 5KIXA 2KJXA 5JAVA 1DJRD 1QE6A 3A7LA 5M9OA 2B2UA 4BA1I 3PO3B 1U9RA 1R9TB 2N88A 1RJTA 5EPKA 4M8AA 5IGDA 4BY1B 3ITPA 1KABA 1OXXK 4DK1A 2E76C 5CYUA 2KECA 3URYA 1FNUA 1HRJA 1IYVA 1ET9A 1WTOA 1VMCA 1YNJD 3CU7A 2ZT9C 2PW7A 3CHBD 4H13C 2XRQD 1V8QA 3D4WA 3SK5A 1OXSC 4V190 4H44C 1ML0D 1GUTA 1TS5A 5A2QE 5IT9E 1F2ZA 4KY7A 2R3ZA 3A54A 2O5JC 5T1IA 3PIO3 1WD1A 5ELFA 4KJNA 4WORA 1SE2A 4XQQA 1IW7C 4NW2A 2D2CC 1LACA 4A3EB 1DOMA 5EJWA 5IODA 1TWCB 2F0UA 2EJMA 1CHQD 5LL6X 2HDMA 1Q90A 1FGBD 5K36H 1ICWA 4M1UB 2Q8RE 2TMPA 1GHKA 3TDQA 1PTOB 1SYBA 2ZXRA 1TWHB 3KUPA 3S14B 1STEA 3FRPB 2J4XA 4FVMA 2H4OA 2TSSA 1EY8A 2OEOA 1TQOA 3A8IE 3CKIB 3H94A 3HOZB 3P7JA 1JQYD 4WRDA 4FF1A 1D5ZC 2VB3X 1TS4A 3SR1A 3T16A 1EWHA 1QG7A 1EIGA 3J7AF 2QDBA 2E2JB 2JA5B 2F1MA 1JC7A 2K7VA 1HHVA 1HCZA 1D1IA 4DU9A 2BA0A 1U4RA 1JCKB 2AUKA 4ZUIA 1SJHD 1STGA 1JR0D 2EY5A 5EKIA 2WV6D 4A3GB 4V0BA 2F0NA 1FNVA 2XWBB 1Y8OB 4XQNA 3NWSA 3HOUB 3PUXA 3I4MB 3VR5A 5A35A 3BYYB 1F9QA 1VF7A 4RWSC 2RSOA 4OO1H 3FPPA 2IPKD 2EYJA 4IUVA 1BBXC 3R3OA 5C0XG 2XSCA 4RGOS 2MP1A 4B9XA 3Q6SA 2JA6B 3GO5A 1BCPD 1ESFA 1JICA 4OL7A 1ET6A 4JBWA 3SDZA 1JWUD 2K33A 4MIUA 3S1RB 1WTVA 1X3QA 4A3KB 3H09A 1STYA 2IT1A 2KEDA 1B4OA 1SEBD 4HEDA 1GUSA 3OIPA 5IGEA 2AWOA 1XX8A 4IUUA 1I4QA 5DAUA 1GUGA 4XXEA 2L12A 1CQFA 2JSOA 4BA2I 4K5XA 3NTIA 3K5MA 1BR9A 1SSOA 3HKZB 2DN8A 4C1NK 2OT2A 3JAML 1S5ED 4RGNA 2D5DA 2WIIB 2QKIC 1IHZA 4C2MB 3D4DA 1CQVA 4GZYC 5M3FB 2F0SA 2F0PA 2B39A 3MHBA 5FK9C 1EFID 2G9HD 1GJXA 4KD3A 2EY1A 4DNRB 1HTPA 3M3YB 2C5CA 5COYA 5KGUA 1TU2B 4RFBA 2BA1A 3GTOB 5CV6A 1X3PA 2JP1A 4K2LA 4G4KA 3TN2A 3BDCA 1I3QB 2NN6H 2OF1A 3V05A 1YNJC 3UI2A 1Y1VB 4FXDA 5IIFA 1EZ6A 4L8JA 5F2DA 1ZKOA 1CZWA 2JA8B 4ME5A 1BF4A 1H9KA 2LY7A 1KLGD 4IQZA 1EZ8A 4NDXA 3T13A 3MVVA 1GXDC 5D14A 1W6JA 1WCMB 1TWFB 2HDLA 3R2IA 2B2YC 3WDNA 3L9AX 1LV9A 2A74C 4O42A 4KY5A 3U9OA 1BO0A 3I8ZA 1R4PB 4IZ8A 4OIKA 2NTTA 3A7AB 4C3HG 2MHVA 2RKSA 2Q8IB 5FLXE 2NVTB 3PUWA 2XRSD 3MXUA 1PRTC 1V1PA 2F0TA 5CV9A 2H1EA 3NBHA 1EYDA 1LO5D 2A69C 3MXPA 1CA6A 4DXFA 3FDTA 3VR2A 4KKUA 1JWMD 1PYWD 1A15A 2OXPA 1STAA 2XIWA 1PRTD 2CQAA 1K8OA 1TS2A 3LX0A 1X32A 3PUZA 2K05A 4KKTA 1B50A 4KJOA 1VMPA 2JXMB 3NTKA 1RDPD 2B2VA 2CW0D 4AYBB 4G57A 2DNEA 1JOQA 1O78A 4CJ1B 1JB3A 2IW3A 4C3JG 1J9OA 4ULLA 1BCPC 3J81E 1S5DD 1I50B 3NBIA 4H7BA 3GV3A 4R8IA 3KF8A 4ZYSA 3K5LA 3S17B 1HTLD 2AUJD 2NYZD 1I4HA 3FVQA 4A3DB 3MAQA 1B2TA 1FD7D 1F9SA 3L7ZC 5E4WC 2EZVA 3BZDB 3NSWA 2B2UC 3PIP3 1A3UA 3V96A 5ELDA 1Y8NB 1TKWB 1T5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2X A;  5I2Y A;  2M9V A;  2I46 A; 
#chains in the Genus database with same CATH topology
 1NSN S;  2JE6 I;  5E4X A;  4A3K G;  2IHE A;  1B9N A;  2R93 H;  4K6D A;  1V9P A;  2WIN B;  4DXG A;  3HOW B;  4DR6 L;  3PO3 G;  2JA9 A;  1JE4 A;  4P74 A;  3A8K E;  1Q3L A;  1SMY D;  1SR3 A;  1U4P A;  4IPH A;  2UU9 Q;  5C3W A;  1VF5 C;  4KMU C;  1J8I A;  4DV5 L;  1PFS A;  4X64 Q;  1VQC A;  3NXW A;  2I07 B;  3BG3 A;  4DR4 Q;  4FXG C;  1ONL A;  1K83 B;  4KKS A;  4R4I A;  4LJZ C;  2MPM A;  4HMI A;  2CH4 A;  5TSS A;  2K5N A;  1I4R A;  2MUY A;  2EY6 A;  1BCP F;  2Z6K C;  1EY9 A;  4ID6 A;  3STB C;  1VDZ A;  3GTP B;  2RDH A;  1NAP A;  2R7Z B;  1XPU A;  3CD6 A;  3NEN A;  3QO2 A;  4IOC A;  3K7A B;  4DR1 Q;  2EXZ A;  3S14 H;  2RVL A;  3M7G A;  2PPB C;  4A3I B;  1P16 A;  1SJE D;  5GAD C;  2EYL A;  2RQX A;  5KND A;  2AKW B;  3QR8 A;  4A3F G;  1J5E L;  3T53 B;  3OHX C;  4F8M A;  1LTR D;  3SHL A;  1JWS D;  3LNN A;  2K14 A;  4XDX A;  3GTK B;  3NP8 A;  1SBB B;  2L5T A;  3AMU A;  1G8Z D;  4DV0 L;  2NVY H;  1PV4 A;  1I4P A;  1K3R A;  1SNQ A;  3M4Y A;  4DAV A;  4C3I G;  5J22 A;  1STB A;  3FKI G;  4AYB G;  3H0G B;  1NNX A;  3TSS A;  2PQE A;  4LUO A;  1BUV T;  1Z7T A;  2XWJ B;  2Z1C A;  3HOW G;  3ND9 A;  4A3E G;  1HFN A;  2IX1 A;  3M9B A;  2ZTC A;  1VQO A;  1ENA A;  1TWF H;  4EQP A;  3S1M H;  2Z6B A;  1YNN C;  3T1Y Q;  2KCN A;  1HJP A;  1D8L A;  3RN5 A;  4HJ5 A;  2B8G A;  4A3K H;  1NTG A;  2CKZ B;  1PRT F;  2O4X A;  1MKH A;  2V4D A;  5LL6 S;  1Y14 B;  2PO4 A;  4DAM A;  3H0G H;  1Q1E A;  1PZJ D;  5T1G A;  1VQL A;  1LT6 D;  2MO1 A;  2RBM A;  5C44 H;  1G91 A;  2B63 G;  2NZO A;  4I7A A;  3E0E A;  1SN8 A;  1TWA B;  1KDB A;  3GDE A;  4KD4 A;  4FYD A;  4WJ3 M;  1F77 A;  2B2Y A;  1AN8 A;  1I4G A;  4FP5 D;  2F3V A;  4DAY A;  4GN3 B;  4X3T A;  1SRO A;  4CKC A;  2A6E C;  1LT3 D;  3I4N B;  2ALY B;  2QEJ C;  3OPO A;  3S9W A;  4DV4 Q;  1GKH A;  3NBH B;  3SGI A;  3ZYY X;  5IGC A;  4OEM B;  2L11 A;  3K7A H;  2NBF A;  1O7I A;  1PFM A;  2VUM B;  5FO7 B;  4NMZ A;  5LMU L;  5D3D A;  2ASB A;  5IOC A;  3T56 B;  2BE5 C;  2A19 A;  3S2H B;  4IOA A;  1U4L A;  4J15 A;  4IUP A;  1F2M A;  4RH6 A;  1W3S A;  1PZK D;  1Y1W B;  2OWO A;  3FHW A;  5C0X H;  3I7F A;  3MWY W;  3K6O A;  5KYL A;  5I2X A;  3H3V I;  5COR A;  3CPF A;  3K80 C;  3K5N A;  3GV6 A;  4DUY L;  1VQB A;  5EBD A;  5GAG C;  2PI2 A;  4A3F B;  1PFB A;  1LM0 A;  1VQF A;  2GVB A;  4PQX A;  1Y1W G;  3F2U A;  3GTK H;  2F4V L;  1HUM A;  4B08 A;  1DCZ A;  3RZO H;  1H9S B;  3KLS X;  3VYR A;  4TSS A;  1HZ9 A;  1XXG A;  4RHS A;  5JEA J;  1A6X A;  5FOB B;  2YU9 H;  4A3J B;  1WD0 A;  1KQS A;  4GOP C;  2VQF Q;  1RKN A;  4C3I B;  3E3X A;  3G6J B;  4A3D G;  3JC6 6;  4IUR A;  2BDO A;  4LF4 L;  2ZJR A;  1EOT A;  4P2C B;  2F3I A;  1PH6 A;  5BN4 A;  3HOZ H;  5IP7 H;  3GTJ B;  2IL8 A;  2FIN B;  4TRD A;  1I94 L;  1HR0 W;  2HCC A;  3S2H H;  2BDN A;  4JI0 Q;  3FMC A;  3GTM H;  3E0J A;  5G3L F;  4XQJ A;  1IYU A;  5G3L D;  2R92 G;  1SMY C;  3DMU A;  3KLR A;  3Q23 A;  1Z6H A;  2K1B A;  1NR2 A;  1SXT A;  4RGT A;  2MO0 A;  3CME A;  1F2L A;  1UUP A;  2BOS A;  1PTO H;  1EFW A;  1BOS A;  1XWE A;  3MTS A;  4OHJ A;  1KAA A;  4OX9 L;  4HR7 B;  1QVG A;  2BCO A;  4A3J H;  1WTR A;  4YHH L;  3UE0 A;  2NUC A;  4BBR G;  4QY7 A;  4AYB E;  2F0D A;  2L9H A;  2CH4 W;  4YIJ A;  5GRO A;  5C4J H;  2CQO A;  3ER0 A;  3SVM A;  3RD4 A;  3STB D;  3IL8 A;  3EBE A;  1I94 Q;  2QGQ A;  1IZ6 A;  1TWC H;  5KNC A;  2JA7 G;  2N55 A;  3W2D A;  1M4V A;  1Z47 A;  5I4D A;  3ND8 A;  4KHV A;  4ZLT F;  2QEX A;  2Z4I A;  1LT5 D;  1KRT A;  4DR1 L;  3J7A V;  1PH4 A;  4PNY A;  4ZAI A;  4AQY L;  1ILP A;  2RDF A;  4X65 Q;  4K6L A;  2QF7 A;  3I4M H;  4GLX A;  3TEH B;  3E6Z X;  4Y7N B;  2WB1 B;  1PHJ A;  1D1K A;  3GTQ B;  2UXD Q;  1K8M A;  4QF4 A;  5CR3 A;  1S5B D;  5EQ0 A;  5C4X H;  1PH7 A;  3PF5 A;  3K57 A;  3K58 A;  1CK1 A;  4HJ7 A;  3M7N A;  4KTA A;  2KCT A;  3I4N H;  1I4X A;  1E0B A;  4TQU S;  4DNI A;  4HIK A;  2NVY B;  4MN3 A;  2OTL A;  4EVO A;  1GM5 A;  4ABN A;  2JJQ A;  1GD7 A;  1FYC A;  5IGG A;  1C48 A;  1CZG A;  4LK1 C;  2MQH A;  3Q0A A;  4RCO A;  4AQY Q;  1YNN D;  3C1E A;  3WOE A;  3NE5 B;  3PCO B;  2X6L A;  4DV2 Q;  3CC4 A;  3I91 A;  3J81 j;  3OMG A;  3P20 A;  1FGU A;  3NQT A;  3ERQ A;  5CV5 A;  5HGQ A;  1X3F A;  4RMF A;  2PNH A;  3EVQ A;  1WJJ A;  1QNU A;  3BDL A;  3Q22 A;  1NE3 A;  1XMO L;  3U4Z A;  4EGV A;  2R7Z H;  3K81 C;  4NP5 A;  3S1M B;  1AW7 A;  4IJH A;  1QUQ A;  1QIL A;  1LT4 D;  4KN7 C;  1W2B A;  2UXB Q;  2R92 B;  3CCQ A;  1CTM A;  1K73 C;  4HJA A;  4X3K A;  1YI2 A;  5DEH A;  1B1Z A;  4F87 A;  1WCM H;  1VQN A;  1K28 A;  4CDC C;  4JI1 L;  5J1Z A;  4B3S L;  5JJK A;  2PW5 A;  3J81 L;  4BWG B;  4KHP L;  1JOK A;  3B6Y A;  3NPP A;  3PO2 G;  4BBS H;  4WFN 3;  1VQD A;  5C4Z A;  1YNX A;  4DK0 A;  4UPA A;  4L5S A;  5JOB A;  3HOW H;  1EY5 A;  1KDA A;  5IYC G;  4X3U A;  5ELN A;  2J7Z A;  1NJI C;  3R8B A;  1IBM Q;  4DN4 M;  2M00 A;  1PXU A;  2F0H A;  4KHZ A;  4ZRZ A;  1X56 A;  2K01 A;  1V1Q A;  5FO9 B;  4A3I H;  2K52 A;  3D4R A;  4QL5 A;  4IUT A;  3EIV A;  2VZA A;  2ENB A;  5CV8 A;  3DWA A;  3FP9 A;  2A68 C;  1MBY A;  3JAM c;  2E75 C;  4XTC S;  1N36 L;  1GO3 E;  4DUY Q;  2D62 A;  3F8T A;  4PZ7 A;  4KHP Q;  2M2L A;  5C4X B;  5FLX c;  2HT1 A;  5C5M A;  3RLF A;  1SYE A;  4FNF A;  4RCN A;  4GOP B;  2XN9 C;  4X62 L;  4QGU A;  3CRK C;  4NXN L;  4JI6 Q;  4FF2 A;  1NBW A;  3F2B A;  1ZYR C;  2Q8T A;  2R7Z G;  1PH8 A;  3TBI B;  5JEA G;  1PH9 A;  3OWF A;  4QIW B;  1IBL L;  2JEA I;  3ZJY C;  5IWA Q;  4YWM A;  1CFM A;  1A8V A;  3S16 B;  1G6Z A;  1MSG A;  2VL6 A;  2ID0 A;  4JV5 L;  5I6Y A;  3S2D B;  4CGY B;  4POG A;  3S2D H;  1IKM A;  1PLF A;  3AB9 A;  2RDG A;  1YJW A;  3UDG A;  3HOY B;  1SNO A;  1HFG A;  2PMZ B;  4DR5 Q;  1HZC A;  5BR8 Q;  4BBS B;  4U67 3;  3EFX D;  5C4J B;  3OTO L;  4GKK L;  1SYC A;  2B2V C;  2RHQ B;  4CKE A;  5I9P A;  2RA4 A;  1ASY A;  2ES2 A;  5CMD A;  5M3M G;  1T9H A;  2QCP X;  2EXD A;  1L0X B;  3A5Z B;  3PUY A;  3OW2 A;  5K36 G;  1PTO F;  4QB4 A;  1B44 D;  4JI6 L;  2KA7 A;  5EBC A;  3RZD B;  3RLO A;  4LUZ A;  3FKI B;  1SYG A;  4K2K A;  1EEI D;  1KTK A;  1S5F D;  3MFY A;  4BY1 H;  2ZXP A;  1KD1 C;  1SND A;  4K0K Q;  5IY0 A;  1R9T H;  4LF8 Q;  1RTO A;  3UE1 A;  5M3F G;  1HR0 Q;  2EDG A;  3J7A 5;  1GOZ A;  1DGS A;  5JJL A;  3KBX A;  3SEB A;  3NEM A;  1O7Y A;  1DOK A;  4R4O A;  1K9M C;  3M4O B;  1PRT B;  5M5W H;  2EYP A;  4MHE A;  3ONA B;  4LW1 A;  2F4I A;  1PTO C;  4J8Q A;  1MGS A;  1KNE A;  4DR5 L;  1BBW A;  4ZKC B;  3CXC A;  3A8J E;  3K0Y A;  2BH2 A;  2KCM A;  1JE5 A;  2YU9 B;  2NVT H;  3VYS A;  3DHQ A;  4RKB A;  5DM6 3;  4LAA A;  4JBK A;  3RZO B;  1SMX A;  3OOC A;  3F2C A;  4IAL A;  3QWN A;  1IW7 D;  5IP9 G;  4JK1 C;  2CHB D;  1A63 A;  4OON A;  4QQB X;  2Y0S B;  1BNZ A;  4A3C H;  3TRZ A;  4YCW A;  2D0P A;  2NN6 I;  2N8N A;  1A62 A;  2MGS A;  4DR6 Q;  2F0E A;  5CV4 A;  1QNK A;  2WAQ G;  3AU7 A;  3TP6 A;  1DYQ A;  5KEE A;  1NMG A;  2L55 A;  4LF9 Q;  3GTL H;  2L15 A;  3D6W A;  1KL9 A;  1CT1 D;  1A3T A;  4IPD A;  4B3T L;  2UUA L;  1SFO H;  2A6H C;  5BN3 A;  4ZCK A;  1BXT A;  2WAC A;  4DR4 L;  4IFD H;  1B8A A;  3C46 A;  5C3E B;  1WI5 A;  1AE3 A;  2G5D A;  4A3B B;  5AFW A;  3TZD A;  3HOV B;  3PUV A;  2JQO A;  1RIP A;  3CCM A;  2F0K A;  3D8G A;  3NHH A;  1F9P A;  2I5H A;  4BS9 A;  3S1Q H;  2VNU D;  4O1N A;  4OWT B;  5IT9 L;  3K0X A;  5AJ3 L;  1JB7 A;  1QB5 D;  2HUG A;  2HQE A;  1UE1 A;  1KRS A;  2WKC A;  1C4Q A;  1K0R A;  2C9O A;  3D3R A;  5EKL A;  3KBG A;  1QZH A;  1C8C A;  4LF9 L;  1W6K A;  1TWA H;  5FLM H;  3PV0 A;  4GNX B;  1EL0 A;  1WFQ A;  1SRU A;  3MZ5 A;  4UY8 C;  1I3Q H;  1KXL A;  1PFN A;  4IUN A;  2V1C C;  4JOI C;  4A93 H;  4S3S A;  3VYT A;  4ZK9 B;  3TS0 A;  3GTO H;  4DK3 C;  2SNM A;  1J5E Q;  4QUF A;  4A93 G;  3TRE A;  2R6G A;  4KLK A;  4PMB A;  2I0Q A;  4NXM Q;  3ULJ A;  1SFO B;  5M5Y B;  1LTB D;  3HOX H;  2LFN A;  2B63 H;  1DOL A;  2MNA A;  1QUQ B;  1UEA B;  2IWH A;  1TR5 A;  3GTJ H;  2YV5 A;  1AEX A;  5EPJ A;  5BN5 A;  4JVZ A;  4JPB W;  3MXN A;  1ESR A;  1EU3 A;  5D65 A;  1B3Q A;  2XNA C;  1MSH A;  5KNB A;  4UAI A;  4EQN A;  2K32 A;  1D5X C;  4LFB L;  2GN5 A;  2NB0 A;  2RCN A;  4C1N I;  2SDF A;  4H0L C;  1GUN A;  3HOU G;  1EY7 A;  1KNA A;  2K04 A;  1Q1B A;  2E2H B;  1B70 B;  1I6V C;  2Z6K A;  5C0X I;  4X66 L;  1F9R A;  2EQS A;  2VB2 X;  2Z8L A;  1XPO A;  2E2D C;  1STN A;  2MJ8 A;  2HIX A;  4KV6 A;  1WTP A;  3OMC A;  1X54 A;  3GD7 A;  3RR5 A;  3MEH A;  1H9M A;  4WJ4 A;  2NVX B;  1EOV A;  3TZU A;  2CW0 C;  2KVM A;  1E2W A;  1PH3 A;  1BQQ T;  3CCS A;  3HOX B;  2UXC Q;  1ICF B;  2OTJ A;  3J7Y W;  2ZJQ A;  3I72 A;  3NEL A;  4E6I A;  1UE6 A;  1EU4 A;  4K14 A;  3FEW X;  1U0L A;  3G7L A;  5M3F H;  1NR4 A;  1HPC A;  2A6E D;  1TY2 A;  1J6Q A;  1CSQ A;  1OXU A;  3VDY A;  1VQI A;  4C3J B;  2IHF A;  4BBR B;  2UUC L;  3KF6 B;  3OSO A;  1YBY A;  1HNZ L;  1PDQ A;  1SNC A;  4APV A;  4B3R Q;  2M9V A;  1SE8 A;  2KHS A;  1H9S A;  4P71 A;  2F0G A;  1KDC A;  5IYB G;  4BBS G;  4N9T A;  4DV6 L;  3UDX A;  4HSV A;  3S15 B;  4Z9C B;  2A73 B;  2N49 A;  2R93 B;  3CF5 A;  5DNF A;  2O2L D;  3T4A C;  1E2V A;  2JN4 A;  1EY6 A;  2EYH A;  4HJ8 A;  3KDF B;  1OXT A;  3QOJ A;  3CC2 A;  2RSN A;  1WTH A;  4UP7 A;  4IPG A;  1KLU D;  4B3M Q;  2E74 C;  3I70 A;  2B63 B;  1CI3 M;  1FR3 A;  3U9S A;  4CDD C;  2MFI A;  5GAE C;  2JA5 G;  1DD2 A;  5ELB A;  5DLQ E;  1CKO A;  3AYH B;  1XNQ Q;  1S40 A;  4QUC A;  4DR2 Q;  2WP8 J;  1QWY A;  2EYF A;  2F0W A;  4A93 B;  4L5R C;  4CJ0 B;  5HUR A;  5HGT A;  2L1B A;  5IGF A;  5M5X H;  4L6T B;  2JA6 H;  1EY4 A;  2EIF A;  1PZI D;  2IX0 A;  1WTQ A;  2LKV A;  4OEL B;  4G7O C;  3LWE A;  2HIV A;  3DWP A;  2KEN A;  1CA5 A;  3MEF A;  5C44 G;  1SNP A;  1V43 A;  1VQ8 A;  2NZ1 D;  2R7F A;  5GAH C;  4A3B H;  1SDF A;  2A5H A;  4TKO B;  2Z4H A;  4OO1 I;  1Q12 A;  1XMQ Q;  3LGJ A;  3GTG B;  3P75 A;  4A3B G;  1X55 A;  3PF4 A;  2RF4 A;  2FMC A;  1PA6 A;  1AP0 A;  2XVS A;  3P1H A;  4NB3 A;  1Y69 U;  3SXH A;  5D3I B;  2F0O A;  1D5M C;  1WVL A;  5DM7 3;  4DUZ Q;  2IY5 B;  1EQV A;  1GUO A;  2CCZ A;  4JI2 Q;  1B3A A;  2KEE A;  2PMZ E;  4IUQ A;  2BH8 A;  3BS1 A;  2X6G A;  1ASZ A;  2SNS A;  1MD2 D;  1RD9 D;  3KOJ A;  5L37 A;  4X6A H;  1QCB D;  3BVG A;  1BCP B;  2O5I C;  2F0L A;  3I3C A;  4HMJ A;  1Q8K A;  4I65 A;  1FNW A;  2QA4 A;  1EYC A;  3VR6 A;  2E5L L;  1Y1V G;  1SLJ A;  1QVC A;  1XMQ L;  4JBJ A;  5E7N A;  5GQO A;  2JA5 H;  4DV7 L;  1PH2 A;  5JVH 3;  4A3F H;  2GVA A;  3PSI A;  2F0J A;  5ELE A;  4GKJ L;  5FO8 B;  3HRZ C;  3L3O C;  5IT9 c;  1II3 A;  4C56 C;  1GUW A;  4DR7 L;  4IFD I;  4R9W A;  2LSS A;  2VS1 A;  2UUB L;  1L1O C;  4GNX A;  5M5W B;  5JPM C;  4A3C G;  2NWG A;  5M3M B;  1QVF A;  1SAP A;  3EA6 A;  2KCC A;  5LMN L;  5C4X G;  4A3M B;  1LTS D;  1N34 Q;  4DAY B;  4RKL A;  1NUC A;  3TP5 A;  3J80 L;  1AE2 A;  4A3D H;  4XT3 B;  3SK8 A;  1K83 H;  4Y52 H;  3I56 A;  5ISR A;  4HTH A;  1XMO Q;  1C9O A;  4LMQ D;  3VR4 A;  5FLM G;  1JJ2 A;  4HIO A;  3HP3 A;  2A69 D;  3QG1 A;  2EJG C;  1S5C D;  1U4M A;  1PMR A;  2F0Q A;  4K8I A;  4PMC A;  1VCI A;  2UXB L;  1H9R A;  2F0I A;  4JW0 A;  2P5Z X;  5I2Y A;  2VW9 A;  1I6H H;  4YCU A;  3S15 H;  4XYO A;  2BE5 D;  1O7Z A;  3I73 A;  1LTI D;  1QZG A;  4AIM A;  1EIH A;  4DNT B;  2K5W A;  1IL8 A;  4JI5 Q;  4GOP A;  1RCV D;  1Y1V H;  3S1N B;  3E5S A;  2EVB A;  2F03 A;  2KHI A;  3NWT A;  4NXN Q;  2KOL A;  3CPW A;  1N33 L;  3X3M A;  1A2U A;  4A3J G;  3M4P A;  1DXM A;  1KIX A;  1OO9 B;  3A55 A;  3Q8D A;  4GN5 A;  3T51 B;  2K5D A;  1IBK Q;  4P72 A;  1LTA D;  2F0V A;  2R7D A;  3M4Q A;  3N6R A;  4HAE A;  3GTM B;  4DV1 Q;  3MA2 B;  5LHY 1;  1MIU A;  5JVG 3;  1G2T A;  1ZXT A;  1TY0 A;  5FKA C;  2A68 D;  2ICI A;  3EJI A;  2J0T D;  3SK6 A;  3OTO Q;  4GKK Q;  1SE4 A;  2PYK A;  1JOR A;  5EKK A;  3VA7 A;  3PMF A;  4X65 L;  4DAP A;  3HGB A;  2DY8 A;  1D6E C;  2D9U A;  2GA4 B;  2L0C A;  4PMW A;  2VQE Q;  5LMU Q;  5EAY A;  1WTX A;  2AHO B;  4HSP A;  2AQ1 B;  4ILW A;  4CKB A;  4DFA A;  2B2W C;  1XNQ L;  4RHR A;  2FJ2 A;  3VR3 A;  4DV3 Q;  1HR0 L;  4JI7 Q;  4B9W A;  2K03 A;  3MC0 B;  2A8V A;  3I4M G;  4KN4 C;  3F1Z A;  3C2P A;  1LLR D;  4OGQ C;  4XT1 B;  3R93 A;  2IJ0 A;  1LTG D;  2X69 A;  4L5T A;  2F4V Q;  4DV5 Q;  4DV2 L;  1EYG A;  1PVO A;  1VQM A;  3HOY G;  2XTI A;  4XIG S;  3GTG H;  1L0Y B;  3HOY H;  3J80 E;  2JA7 B;  1HQM C;  3I4L A;  4MTK A;  1XTC D;  2KHJ A;  4K0K L;  1WOC A;  3A56 A;  4JI7 L;  5EGT A;  5C0X J;  2B3G A;  4OIJ A;  3T1H Q;  1AH9 A;  4HCS A;  2PZT A;  3HS0 C;  5CV7 A;  4IN3 A;  1LTL A;  1UWV A;  3TP7 A;  1JOO A;  5EPL A;  3I90 A;  4WJW A;  5JJZ A;  1TII D;  4DUZ L;  4RAU C;  3L0O A;  5KRU A;  2AMC B;  2L4N A;  3U50 C;  2FHT A;  2I5M X;  3DUZ A;  5JEA H;  1L2F A;  4BBR H;  4HCE A;  3S1Q B;  4RGM A;  1A2T A;  4A3L H;  3VYU A;  4EQ5 A;  5C6A A;  2UUA Q;  5IYC H;  1LAB A;  1EQT A;  4NPS A;  4DF7 A;  2F0M A;  4HN7 A;  4BXX G;  3DM3 A;  1G29 1;  4YHH Q;  1DZ1 A;  3CW2 C;  3HOV G;  4JBM A;  4CBV A;  4LFC L;  3DWQ A;  4YWK A;  4OWW B;  2R93 G;  1FJG Q;  3PO2 B;  1K8A C;  1VQ9 A;  4F88 A;  1N8R C;  4PV1 C;  5E3F A;  3K59 A;  3BVM A;  4PZ6 A;  3H3V H;  1EWC A;  1OXV A;  3HG9 A;  4A3I G;  4C3I H;  3VA5 A;  4YCV A;  4JYA L;  2JYO A;  2R61 A;  5ELC A;  3QOL A;  1ILQ A;  5IGB A;  1H9J A;  1BDO A;  3ERS X;  2EE1 A;  5LMN Q;  2E8G A;  4AH6 A;  4B3S Q;  4BY7 B;  2YTX A;  3SK4 A;  3V2T A;  2SEB D;  2NN6 G;  1X3E A;  4J6H A;  3QJY A;  2AQ2 B;  1EY0 A;  2HCI A;  3C1F A;  1M90 C;  1O80 A;  1HA6 A;  4CDE C;  1XYI A;  1R4Q B;  4HIM A;  1CKN B;  3BVZ A;  1TS3 A;  1S4Z A;  2R92 H;  3G6E A;  1KAW A;  4FO2 A;  3X3N A;  4G7H C;  3CCL A;  4LF7 L;  3WWV A;  2ZXO A;  1B53 A;  3CP0 A;  4DKA C;  1XJV A;  1SE3 A;  5KYI A;  4K8J A;  1CHP D;  4JI3 Q;  1YIT A;  3OIQ A;  4JI5 L;  5BR8 L;  1O7L A;  1V1P B;  4Q5V A;  5CC4 A;  4X3S A;  1YJN A;  1Q7Y C;  3W1B A;  4A3M G;  3RLN A;  1UE7 A;  1S72 A;  2VXW A;  3EQL C;  4N9P A;  3PGZ A;  2EPB A;  1HA5 A;  2Q2T A;  3BYT B;  3OW7 A;  1VQP A;  1E2Z A;  1SNM A;  3DEP A;  4QIW E;  1RHP A;  5JPN C;  3QIA A;  4LWC A;  5HY6 A;  3GP7 A;  4DA2 A;  5M5X B;  2DGY A;  4IPC A;  3BDO A;  4KI0 A;  3A0J A;  4LF7 Q;  2JA7 H;  4ZQ3 A;  3HZX A;  4F7X A;  4CHT B;  5C5L A;  1YHA A;  2AWN A;  3AQQ A;  3IRB A;  5C4H A;  3JAM E;  1T5X D;  3H91 A;  4I7Z C;  3GQB A;  4J1M A;  5FLX L;  5K5P A;  1PH1 A;  2E2I H;  2UU9 L;  2K28 A;  3NUC A;  1Q8I A;  4X66 Q;  4R4C A;  4DGZ A;  5FJ8 G;  1A3V A;  1EEF D;  3BJU A;  1CM9 A;  2WAQ B;  3HKS A;  4K5V A;  4LFA Q;  2I46 A;  4ODG A;  2B2T C;  4MZ9 A;  3H3V C;  1KHI A;  2DNC A;  1V1O A;  2WKD A;  4FXK C;  2ATW A;  2KQ3 A;  4QMG A;  4R8N A;  1AFP A;  1RF2 D;  3DM1 A;  1F2Y A;  4FF3 A;  4P73 A;  4R4Q A;  1I50 H;  2LS0 1;  4K5W A;  5IP7 G;  1UAP A;  2E2J H;  2ICE C;  5IP9 H;  2WAQ E;  1ROD A;  4BXX H;  3C3L A;  1ZYR D;  5I6W A;  5IYD G;  4YY3 Q;  1PYS B;  5A2Q L;  4C3J H;  1L0W A;  5C44 B;  1STH A;  3O13 A;  5C3E H;  3DXJ C;  3RMH A;  4RA8 A;  4DR2 L;  2OCE A;  2Q2I A;  1PTO D;  2DUD A;  4EQO A;  2CVR A;  2CWP A;  3IFD A;  1VQ6 A;  2IX3 A;  2F0F A;  1ENC A;  3N52 A;  2ZTE A;  1WTW A;  2YTY A;  3E9I A;  2E2I B;  5E1F A;  1NCV A;  2F3W A;  2FMM A;  1Y8P B;  5CGK A;  3I55 A;  3GTL B;  4QCL A;  2YYZ A;  1X6O A;  4IFD J;  2SOB A;  2PCF B;  3R2T A;  2N3S A;  4XYQ A;  1EYA A;  1HQR D;  2WB1 E;  1AZQ A;  2KUM A;  3BZC A;  1MI2 A;  3CQZ B;  1LTT D;  5CBE E;  4H02 A;  2EYM A;  2K6A A;  3CRL C;  4EX5 A;  3RNU A;  4CJ2 C;  4BY7 H;  1IYJ B;  2DY7 A;  2HQL A;  3DEO A;  1M8A A;  2AQ3 B;  5J39 A;  2OQK A;  1MJC A;  3KK7 A;  1LYL A;  4FF4 A;  1I6H B;  2K5V A;  1QOH A;  4C3H H;  4MNO A;  4ALP A;  2UXD L;  2NZH A;  1UNS A;  1IKL A;  4LFC Q;  1IXR A;  3D31 A;  3NK9 A;  2B8F A;  3TP8 A;  3M85 A;  1SYF A;  3D6C A;  3G71 A;  3IFT A;  1DON A;  3HEJ A;  2PZW A;  2PNR C;  2HHH Q;  1HUN A;  4UDU C;  1TWG B;  1TT2 A;  3MXG A;  2HD3 A;  5I9O A;  5C3X A;  4GLA C;  1DM0 B;  3GTP H;  3ICE A;  4IJL A;  3KJP A;  3AFQ A;  3NQI A;  2EYO A;  1G51 A;  1RTN A;  1TWH H;  3NTH A;  4A75 A;  3QB3 A;  5LMN W;  4YWL A;  3TME A;  3OYY A;  3J81 c;  3J80 c;  1I5F A;  3CCU A;  2G9D A;  3D0F A;  3W5O A;  1ENF A;  1JJG A;  5NUC A;  4GKJ Q;  4NXM L;  3IKJ A;  2PZU A;  2K5Q A;  3SE0 A;  1HH2 P;  4U68 A;  4ZKB B;  2K50 A;  1SYD A;  3LWU A;  3MFG A;  2NTS A;  3CMA A;  2JEB I;  1B9M A;  2A6H D;  3K8A A;  3ULL A;  3W3A A;  4G7Z C;  4OO1 G;  1K0S A;  3HOV H;  1TVX A;  3MXN B;  5CBA E;  2B2W A;  3J81 i;  3OWE B;  2QIL A;  1YHB A;  2NVQ B;  4ME3 A;  3IAY A;  3K5O A;  4IFD G;  3HFZ B;  3RUZ A;  4GLV B;  4L63 B;  1CKN A;  4NKL A;  1C7Y A;  2LMC B;  1D2B A;  2EY2 A;  1GHJ A;  3ERO A;  4KK7 A;  1YVC A;  4A3G G;  3Q24 A;  4DV0 Q;  3WOF A;  3PO3 H;  1HNX L;  1K8G A;  3M3Y H;  5M3M H;  3AEV A;  4Q0F A;  1LUZ A;  3KLS A;  1HXY D;  4UP8 A;  2EJF C;  3S17 H;  1AZP A;  2B2T A;  2VUM G;  2FFK B;  1N36 Q;  4KY6 A;  1G2S A;  1ZEQ X;  4ZUJ A;  3FPU B;  4C2M H;  3KJO A;  1QJO A;  5ELO A;  3T1Y L;  4C3H B;  1JJC B;  5IE8 A;  2EOT A;  3H6M A;  5KIX A;  1UE5 A;  2N78 A;  3H0G G;  2KJX A;  3I2Z A;  5JAV A;  4X62 Q;  1HNZ Q;  5IYB H;  4LFA L;  1DJR D;  3M4O H;  3CCV A;  1QE6 A;  3A7L A;  4DV6 Q;  5M9O A;  1IBL Q;  2B2U A;  4BA1 I;  3PO3 B;  1U9R A;  1R9T B;  2N88 A;  1RJT A;  5EPK A;  4M8A A;  2Q2H A;  5IGD A;  4BY1 B;  3ITP A;  3ULP A;  1E22 A;  1KAB A;  1OXX K;  1Q82 C;  4DK1 A;  1P8L A;  2XGT A;  4Y7N H;  1VQA A;  2E76 C;  5CYU A;  2KEC A;  3URY A;  1FNU A;  1HRJ A;  2Z0S A;  1IYV A;  1ET9 A;  1WTO A;  1VMC A;  3U4V A;  1S3O A;  1YNJ D;  3JAM i;  1IL2 A;  2VQF L;  3CU7 A;  2LXJ A;  2ZT9 C;  2PW7 A;  3CHB D;  4O2D A;  4H13 C;  3A74 A;  2XRQ D;  1V8Q A;  3D4W A;  4DV1 L;  4LF8 L;  4P75 A;  4JI0 L;  1BVS A;  1HNW Q;  3S24 A;  3I4O A;  1OXS C;  3SK5 A;  4V19 0;  4H44 C;  1ML0 D;  4R1J A;  2A1A A;  1K3B C;  1GUT A;  3PQI A;  1TS5 A;  5A2Q E;  5IT9 E;  1F2Z A;  4KY7 A;  2R3Z A;  3A54 A;  2O5J C;  4DR3 Q;  1CSP A;  2UUC Q;  5T1I A;  1YHQ A;  3U58 A;  3PIO 3;  1WD1 A;  2VQE L;  4X64 L;  5ELF A;  1HZA A;  1E3P A;  4KJN A;  4WOR A;  1SE2 A;  4XQQ A;  2PQA B;  1IW7 C;  3T1H L;  4NW2 A;  2D2C C;  4LF4 Q;  1LAC A;  2CWA A;  5FJ8 H;  1YEZ A;  4A3E B;  2HHH L;  3CCJ A;  3G48 A;  3PIP A;  1M1K C;  1DOM A;  5EJW A;  5IOD A;  4JI2 L;  4JC0 A;  1YZ6 A;  1TWC B;  2JA8 H;  1EUJ A;  1OTC A;  2F0U A;  4JI1 Q;  2EJM A;  1PYB A;  1N34 L;  1CHQ D;  4B3M L;  5LL6 X;  4LF6 Q;  2Q2U A;  2HDM A;  4FDB A;  4DR3 L;  1Q90 A;  2E5L Q;  1FGB D;  5K36 H;  1ICW A;  2K4K A;  1MHW C;  4M1U B;  2Q8R E;  2JA6 G;  3G4S A;  2TMP A;  2RHS B;  1CKM A;  1GHK A;  3TDQ A;  2OQ0 A;  1HZB A;  2WFW A;  4BY1 G;  1PTO B;  5JJI A;  1SYB A;  2ZXR A;  5AJ3 Q;  1IBM L;  1TWH B;  3KUP A;  1YJ9 A;  1Q86 C;  3S14 B;  1STE A;  3FRP B;  2J4X A;  4FVM A;  2H4O A;  2TSS A;  4A3M H;  1EY8 A;  2OEO A;  1TQO A;  3A8I E;  1E7Z A;  3H15 A;  2VUM H;  3CKI B;  3H94 A;  2NVX H;  4N8X 1;  3HOZ B;  1TWG H;  3P7J A;  3A5U A;  4JG2 A;  1JQY D;  4WRD A;  4BY7 G;  4FF1 A;  1D5Z C;  2VB3 X;  1TS4 A;  2Y0S E;  3SR1 A;  3T16 A;  1EWH A;  1QG7 A;  3HOX G;  3TS2 A;  1EIF A;  1N33 Q;  1EIG A;  3J7A F;  2QDB A;  1FJG L;  2E2J B;  1EQQ A;  2JA5 B;  1EQR A;  2F1M A;  1JC7 A;  3HKZ G;  2K7V A;  1HHV A;  5H1S E;  1D7Q A;  1HCZ A;  1D1I A;  4DU9 A;  2BA0 A;  1U4R A;  1VQK A;  1EWI A;  1JCK B;  2AUK A;  4ZUI A;  1VQH A;  1SJH D;  1A0I A;  4JYA Q;  1STG A;  1UEB A;  1JR0 D;  2EY5 A;  5EKI A;  1TXY A;  2WV6 D;  4A3G B;  4LFB Q;  4V0B A;  2F0N A;  1FNV A;  1BBU A;  2XWB B;  5C3E G;  1EIY B;  4A4I A;  4MTN A;  1Y8O B;  3GTQ H;  3BU2 A;  4XQN A;  3NWS A;  3HOU B;  1XTD A;  3PUX A;  3I4M B;  3VR5 A;  3HOU H;  5A35 A;  3BYY B;  4LF5 L;  1F9Q A;  1VF7 A;  4OWX B;  4DV4 L;  4RWS C;  2RSO A;  2QW7 A;  3K7U C;  1Z9F A;  3S1R H;  4OO1 H;  1X9N A;  3FPP A;  2IPK D;  1PH5 A;  5IYD H;  2DJF C;  2EYJ A;  4RG1 A;  4DR7 Q;  1IBK L;  4IUV A;  2KBN A;  2I5L X;  1BBX C;  2UUB Q;  3R3O A;  5C0X G;  2UXC L;  2XSC A;  4RGO S;  1X65 A;  2MP1 A;  4B9X A;  3Q6S A;  2JA6 B;  3GO5 A;  1XPR A;  1BKB A;  1E1O A;  1H95 A;  3KF8 B;  1BCP D;  4JI8 L;  1ESF A;  1JIC A;  4OL7 A;  1Q46 A;  1ET6 A;  4JBW A;  3SDZ A;  1JWU D;  2K33 A;  4MIU A;  3S1R B;  1Q81 C;  4OXP A;  4OX9 Q;  1WTV A;  1X3Q A;  1JT8 A;  1GVP A;  4A3K B;  1RL2 A;  1VQ5 A;  3H09 A;  1STY A;  1C0A A;  2IT1 A;  4B3R L;  1KC8 C;  2KED A;  1NMF A;  1XNR Q;  1B4O A;  2K75 A;  1SEB D;  3W1G A;  4HED A;  1GUS A;  3OIP A;  5IGE A;  2AWO A;  3I4N G;  1XX8 A;  4IUU A;  2JK8 A;  1I4Q A;  5DAU A;  1N9W A;  1GUG A;  4A3G H;  4XXE A;  2L12 A;  4DK6 C;  1CQF A;  4IO9 A;  1L1O B;  2H5X A;  2JSO A;  4BA2 I;  4K5X A;  4JI8 Q;  3NTI A;  3K5M A;  2ZM6 L;  1BR9 A;  4B3T Q;  1SSO A;  3L2P A;  1VS0 A;  3HKZ B;  1FVI A;  2DN8 A;  4C1N K;  2OT2 A;  4GN4 B;  3JAM L;  1S5E D;  4RGN A;  2D5D A;  2WII B;  2QKI C;  1IHZ A;  4A3L G;  1NY4 A;  4C2M B;  1WYD A;  2ZJP A;  3D4D A;  4A3E H;  3CCR A;  1CQV A;  1XNR L;  4QJF A;  4GZY C;  5M3F B;  2F0S A;  2F0P A;  2B39 A;  2Z9H A;  3MHB A;  1Y1W H;  5FK9 C;  1EFI D;  2G9H D;  1GJX A;  3PO2 H;  4KD3 A;  3CC7 A;  4UHV A;  2EY1 A;  4DNR B;  3KLW A;  1HTP A;  3E9H A;  3M3Y B;  4UP9 A;  5M5Y H;  2C5C A;  5COY A;  5KGU A;  2ZM6 Q;  1TU2 B;  4RFB A;  2BA1 A;  1B7Y B;  3GTO B;  5CV6 A;  1X3P A;  3FKI H;  2JP1 A;  4K2L A;  4G4K A;  3TN2 A;  4LF6 L;  2PQA A;  1I3Q B;  3BDC A;  1JMC A;  2NN6 H;  2OF1 A;  3V05 A;  1YNJ C;  4JOI A;  3EN2 A;  3UI2 A;  1Y1V B;  2WB1 G;  3S1N H;  4FXD A;  5IIF A;  1EZ6 A;  2E2H H;  4L8J A;  5F2D A;  1ZKO A;  4L5Q A;  2FXQ A;  1CZW A;  2JA8 B;  4ME5 A;  1BF4 A;  1H9K A;  3S16 H;  5J3B A;  1VQG A;  3HKZ E;  4TVA B;  2LY7 A;  3UDF A;  2PI2 E;  4HJ9 A;  4JI3 L;  4IQZ A;  1KLG D;  3F2D A;  1EZ8 A;  1YIJ A;  4NDX A;  4A76 A;  3T13 A;  3MVV A;  1GXD C;  2Y0S G;  5D14 A;  4DV7 Q;  1W6J A;  1VQE A;  1WCM B;  1TWF B;  2HDL A;  2RCF A;  4R4T A;  3R2I A;  2B2Y C;  3TQY A;  3WDN A;  3L9A X;  2K5H A;  1LV9 A;  4PG3 A;  2A74 C;  3UDI A;  4O42 A;  4KY5 A;  4N8F A;  3U9O A;  1BO0 A;  3I8Z A;  4DPG A;  4O0A A;  1R4P B;  4IZ8 A;  1VQ4 A;  2DJG C;  3KYH C;  4CDF C;  4JCV E;  4LNQ A;  4OIK A;  2NTT A;  3A7A B;  4C3H G;  2MHV A;  2RKS A;  2Q8I B;  5FLX E;  2B29 A;  2NVT B;  3PUW A;  1MJE A;  2XRS D;  4JI4 L;  1N32 L;  3MXU A;  4LF5 Q;  2ZTD A;  3HOZ G;  1PRT C;  1V1P A;  2F0T A;  5CV9 A;  2H1E A;  3NBH A;  1EYD A;  1HNX Q;  1LO5 D;  2LXK A;  2A69 C;  3MXP A;  1CA6 A;  4DXF A;  3CQZ H;  5IWA L;  3FDT A;  3VR2 A;  4KKU A;  1JWM D;  1PYW D;  1A15 A;  4JV5 Q;  1FL0 A;  2OXP A;  4GS3 A;  1STA A;  2C35 B;  3RZD H;  2XIW A;  4GNX C;  2YTV A;  1PRT D;  2CQA A;  1K8O A;  2D0O A;  1TS2 A;  3DLL A;  3LX0 A;  1X32 A;  1VQ7 A;  3PUZ A;  2K05 A;  3KFU A;  4KKT A;  1B50 A;  4KJO A;  1E1T A;  1VMP A;  2CFM A;  4YY3 L;  2F52 A;  2JXM B;  4JI4 Q;  1N32 Q;  2VY3 A;  4POF A;  3NTK A;  1RDP D;  2B2V A;  2CW0 D;  3AFP A;  3J7Z C;  4AYB B;  4G57 A;  2DNE A;  1JOQ A;  1E24 A;  1U5K A;  1O78 A;  2JA8 G;  4CJ1 B;  1X3G A;  1JB3 A;  2IW3 A;  2QDL A;  4C3J G;  1J9O A;  4ULL A;  1BCP C;  3J81 E;  3J80 i;  1S5D D;  1I50 B;  3NBI A;  4H7B A;  3GV3 A;  1CUK A;  3KF8 A;  4R8I A;  4LUV A;  4ZYS A;  1WCM G;  3K5L A;  3S17 B;  1HTL D;  2AUJ D;  3PIO A;  3KF6 A;  2NYZ D;  1I4H A;  3FVQ A;  4A3D B;  3MAQ A;  1B2T A;  1FD7 D;  3CAM A;  1G6P A;  1F9S A;  3RN2 A;  3L7Z C;  5E4W C;  2EZV A;  3BZD B;  3NSW A;  4HID A;  4DV3 L;  2B2U C;  3PIP 3;  1A3U A;  3BZK A;  2NVQ H;  4PZ8 A;  1VQJ A;  3V96 A;  3CCE A;  1HNW L;  1L1O A;  5ELD A;  1Y8N B;  1TKW B;  3KDF A;  1T5E A; 
#chains in the Genus database with same CATH homology
 1NSN S;  2JE6 I;  5E4X A;  1B9N A;  4K6D A;  2WIN B;  4DXG A;  3HOW B;  1JE4 A;  3A8K E;  1Q3L A;  1SMY D;  1U4P A;  5C3W A;  1VF5 C;  4KMU C;  1J8I A;  3NXW A;  2I07 B;  3BG3 A;  4FXG C;  1ONL A;  1K83 B;  4KKS A;  4LJZ C;  2MPM A;  4HMI A;  5TSS A;  1I4R A;  2MUY A;  2EY6 A;  1BCP F;  1EY9 A;  4ID6 A;  1VDZ A;  3GTP B;  2RDH A;  1NAP A;  2R7Z B;  3QO2 A;  3K7A B;  2EXZ A;  2RVL A;  3M7G A;  2PPB C;  4A3I B;  1SJE D;  2EYL A;  2RQX A;  5KND A;  3T53 B;  3OHX C;  4F8M A;  1LTR D;  3SHL A;  1JWS D;  3LNN A;  4XDX A;  3GTK B;  1SBB B;  2L5T A;  3NP8 A;  3AMU A;  1G8Z D;  1I4P A;  1SNQ A;  3M4Y A;  4DAV A;  4C3I G;  5J22 A;  1STB A;  3H0G B;  3TSS A;  2PQE A;  1BUV T;  1Z7T A;  2XWJ B;  2Z1C A;  1HFN A;  3ND9 A;  2IX1 A;  1ENA A;  4EQP A;  1YNN C;  2KCN A;  2B8G A;  5LL6 S;  1PRT F;  2O4X A;  2V4D A;  2PO4 A;  1Q1E A;  1PZJ D;  5T1G A;  1LT6 D;  2RBM A;  1G91 A;  1TWA B;  1KDB A;  4KD4 A;  4FYD A;  1F77 A;  2B2Y A;  1AN8 A;  1I4G A;  4FP5 D;  2F3V A;  4DAY A;  4X3T A;  4CKC A;  2A6E C;  1LT3 D;  3I4N B;  2QEJ C;  3OPO A;  3S9W A;  3ZYY X;  5IGC A;  2L11 A;  2NBF A;  1PFM A;  2VUM B;  5FO7 B;  4NMZ A;  5D3D A;  5IOC A;  3T56 B;  2BE5 C;  3S2H B;  1U4L A;  4IUP A;  1F2M A;  4RH6 A;  1Y1W B;  1PZK D;  5C0X H;  3MWY W;  3K6O A;  5KYL A;  5I2X A;  5COR A;  3K5N A;  3GV6 A;  5EBD A;  4A3F B;  1PFB A;  4PQX A;  3F2U A;  1HUM A;  4B08 A;  1DCZ A;  1H9S B;  3KLS X;  3VYR A;  4TSS A;  1XXG A;  4RHS A;  5JEA J;  1A6X A;  5FOB B;  4A3J B;  1WD0 A;  1RKN A;  4C3I B;  3G6J B;  4IUR A;  2BDO A;  1EOT A;  4P2C B;  5BN4 A;  3GTJ B;  2IL8 A;  2FIN B;  4TRD A;  2HCC A;  2BDN A;  3FMC A;  3E0J A;  5G3L F;  4XQJ A;  1IYU A;  5G3L D;  1SMY C;  3DMU A;  3KLR A;  3Q23 A;  1Z6H A;  2K1B A;  1NR2 A;  1SXT A;  4RGT A;  1F2L A;  1UUP A;  2BOS A;  1PTO H;  1BOS A;  1XWE A;  3MTS A;  4OHJ A;  1KAA A;  4HR7 B;  2BCO A;  1WTR A;  2NUC A;  2F0D A;  2L9H A;  4YIJ A;  3SVM A;  3RD4 A;  3IL8 A;  5KNC A;  2N55 A;  3W2D A;  1M4V A;  1Z47 A;  5I4D A;  3ND8 A;  4KHV A;  4ZLT F;  2Z4I A;  1LT5 D;  3J7A V;  4PNY A;  4ZAI A;  1ILP A;  2RDF A;  4K6L A;  2QF7 A;  3E6Z X;  4Y7N B;  2WB1 B;  3GTQ B;  1D1K A;  1K8M A;  4QF4 A;  5CR3 A;  1S5B D;  5EQ0 A;  3K57 A;  3K58 A;  1CK1 A;  3M7N A;  4KTA A;  1I4X A;  1E0B A;  4TQU S;  2NVY B;  4MN3 A;  4EVO A;  4ABN A;  1FYC A;  5IGG A;  1C48 A;  1CZG A;  4LK1 C;  3Q0A A;  4RCO A;  1YNN D;  3C1E A;  3WOE A;  3NE5 B;  2X6L A;  3I91 A;  3OMG A;  3P20 A;  3NQT A;  3ERQ A;  5CV5 A;  3EVQ A;  3BDL A;  1QNU A;  3Q22 A;  4EGV A;  4NP5 A;  3S1M B;  1AW7 A;  1QIL A;  1LT4 D;  4KN7 C;  2R92 B;  1CTM A;  4X3K A;  5DEH A;  1B1Z A;  4F87 A;  5J1Z A;  2PW5 A;  3J81 L;  4BWG B;  1JOK A;  3NPP A;  4WFN 3;  5C4Z A;  4DK0 A;  5JOB A;  1EY5 A;  1KDA A;  4X3U A;  2J7Z A;  3R8B A;  4DN4 M;  2M00 A;  1PXU A;  2F0H A;  4KHZ A;  4ZRZ A;  2K01 A;  5FO9 B;  3D4R A;  4IUT A;  2ENB A;  5CV8 A;  3DWA A;  2A68 C;  1MBY A;  2E75 C;  4XTC S;  2D62 A;  2M2L A;  5C4X B;  5C5M A;  3RLF A;  1SYE A;  4FNF A;  4RCN A;  2XN9 C;  3CRK C;  4FF2 A;  1ZYR C;  2Q8T A;  3TBI B;  5JEA G;  3OWF A;  4QIW B;  2JEA I;  1CFM A;  3S16 B;  1G6Z A;  1MSG A;  2ID0 A;  5I6Y A;  3S2D B;  4CGY B;  1IKM A;  1PLF A;  3AB9 A;  2RDG A;  3HOY B;  1SNO A;  1HFG A;  2PMZ B;  4BBS B;  4U67 3;  3EFX D;  5C4J B;  1SYC A;  2B2V C;  4CKE A;  5I9P A;  2RA4 A;  5CMD A;  2QCP X;  1L0X B;  3PUY A;  5K36 G;  1PTO F;  4QB4 A;  1B44 D;  2KA7 A;  5EBC A;  3RZD B;  3FKI B;  1SYG A;  4K2K A;  1EEI D;  1KTK A;  1S5F D;  3MFY A;  2ZXP A;  1SND A;  1RTO A;  2EDG A;  1GOZ A;  3KBX A;  3SEB A;  1O7Y A;  1DOK A;  3M4O B;  1PRT B;  2EYP A;  4MHE A;  3ONA B;  2F4I A;  1PTO C;  4J8Q A;  1MGS A;  1KNE A;  4ZKC B;  3A8J E;  3K0Y A;  2YU9 B;  3VYS A;  3DHQ A;  4RKB A;  5DM6 3;  4LAA A;  3RZO B;  3OOC A;  4IAL A;  3QWN A;  1IW7 D;  4JK1 C;  2CHB D;  2Y0S B;  1BNZ A;  2NN6 I;  2MGS A;  2F0E A;  5CV4 A;  1QNK A;  3AU7 A;  3TP6 A;  1DYQ A;  5KEE A;  2L55 A;  3D6W A;  1CT1 D;  1A3T A;  2A6H C;  5BN3 A;  4IFD H;  1BXT A;  2WAC A;  3C46 A;  5C3E B;  4A3B B;  5AFW A;  3TZD A;  3HOV B;  3PUV A;  2F0K A;  3D8G A;  3NHH A;  1F9P A;  4BS9 A;  2VNU D;  4O1N A;  5IT9 L;  1QB5 D;  2HUG A;  2HQE A;  2WKC A;  1C4Q A;  5EKL A;  2C9O A;  3D3R A;  3KBG A;  1C8C A;  1W6K A;  3PV0 A;  1EL0 A;  3MZ5 A;  1PFN A;  4IUN A;  4S3S A;  3VYT A;  4ZK9 B;  2SNM A;  4QUF A;  2R6G A;  4PMB A;  1SFO B;  5M5Y B;  1LTB D;  2LFN A;  1DOL A;  1UEA B;  2IWH A;  1TR5 A;  1AEX A;  5EPJ A;  5BN5 A;  3MXN A;  1ESR A;  1EU3 A;  5D65 A;  2XNA C;  1MSH A;  5KNB A;  4UAI A;  4EQN A;  2K32 A;  1D5X C;  2NB0 A;  4C1N I;  2SDF A;  4H0L C;  1GUN A;  1EY7 A;  1KNA A;  2K04 A;  1Q1B A;  2E2H B;  1I6V C;  5C0X I;  1F9R A;  2VB2 X;  2Z8L A;  2E2D C;  1STN A;  2MJ8 A;  1WTP A;  4KV6 A;  3OMC A;  3GD7 A;  3MEH A;  1H9M A;  2NVX B;  3TZU A;  2CW0 C;  2KVM A;  1E2W A;  1BQQ T;  3HOX B;  3J7Y W;  3I72 A;  4E6I A;  1EU4 A;  4K14 A;  3FEW X;  3G7L A;  1NR4 A;  1HPC A;  2A6E D;  1TY2 A;  1OXU A;  4C3J B;  4BBR B;  3OSO A;  1PDQ A;  1SNC A;  2M9V A;  2KHS A;  1H9S A;  2F0G A;  1KDC A;  4N9T A;  4HSV A;  3S15 B;  4Z9C B;  2A73 B;  2R93 B;  5DNF A;  2O2L D;  3T4A C;  1E2V A;  1EY6 A;  2EYH A;  1OXT A;  3QOJ A;  2RSN A;  1KLU D;  2E74 C;  3I70 A;  2B63 B;  1CI3 M;  1FR3 A;  3U9S A;  1DD2 A;  5ELB A;  4QUC A;  2WP8 J;  1QWY A;  2EYF A;  2F0W A;  4A93 B;  4CJ0 B;  5HUR A;  5HGT A;  2L1B A;  5IGF A;  4L6T B;  1EY4 A;  1PZI D;  2IX0 A;  1WTQ A;  2LKV A;  4G7O C;  3LWE A;  3DWP A;  1CA5 A;  1SNP A;  1V43 A;  2NZ1 D;  1SDF A;  2A5H A;  4TKO B;  2Z4H A;  4OO1 I;  1Q12 A;  3GTG B;  3P75 A;  2FMC A;  1AP0 A;  2XVS A;  3P1H A;  1Y69 U;  3SXH A;  5D3I B;  2F0O A;  1D5M C;  1WVL A;  5DM7 3;  1EQV A;  1GUO A;  1B3A A;  2KEE A;  4IUQ A;  3BS1 A;  2X6G A;  2SNS A;  1MD2 D;  1RD9 D;  1QCB D;  3BVG A;  1BCP B;  2O5I C;  2F0L A;  3I3C A;  4HMJ A;  4I65 A;  1FNW A;  1EYC A;  3VR6 A;  5JVH 3;  2F0J A;  5ELE A;  5FO8 B;  3HRZ C;  3L3O C;  1II3 A;  4C56 C;  1GUW A;  4IFD I;  4R9W A;  5M5W B;  5JPM C;  2NWG A;  5M3M B;  1SAP A;  3EA6 A;  2KCC A;  4A3M B;  1LTS D;  4RKL A;  1NUC A;  3TP5 A;  3J80 L;  4XT3 B;  3SK8 A;  5ISR A;  4HTH A;  4LMQ D;  3VR4 A;  3HP3 A;  2A69 D;  3QG1 A;  2EJG C;  1S5C D;  1U4M A;  1PMR A;  2F0Q A;  4K8I A;  4PMC A;  1VCI A;  1H9R A;  2F0I A;  5I2Y A;  4XYO A;  2BE5 D;  1O7Z A;  3I73 A;  1LTI D;  1EIH A;  4DNT B;  2K5W A;  1IL8 A;  1RCV D;  3S1N B;  3E5S A;  2EVB A;  2F03 A;  3NWT A;  2KOL A;  3X3M A;  1A2U A;  1DXM A;  1OO9 B;  3A55 A;  3T51 B;  2K5D A;  1LTA D;  2F0V A;  3N6R A;  4HAE A;  3GTM B;  3MA2 B;  5LHY 1;  5JVG 3;  1G2T A;  1ZXT A;  1TY0 A;  5FKA C;  2A68 D;  2ICI A;  3EJI A;  2J0T D;  3SK6 A;  1SE4 A;  2PYK A;  1JOR A;  5EKK A;  3VA7 A;  3PMF A;  4DAP A;  3HGB A;  2DY8 A;  1D6E C;  2D9U A;  2GA4 B;  2L0C A;  4PMW A;  1WTX A;  4HSP A;  2AQ1 B;  4ILW A;  4DFA A;  4CKB A;  2B2W C;  4RHR A;  2FJ2 A;  3VR3 A;  4B9W A;  2K03 A;  3MC0 B;  4KN4 C;  3C2P A;  1LLR D;  4OGQ C;  4XT1 B;  3R93 A;  2IJ0 A;  1LTG D;  2X69 A;  4XIG S;  1L0Y B;  3J80 E;  2JA7 B;  1HQM C;  3I4L A;  1XTC D;  3A56 A;  5EGT A;  5C0X J;  4OIJ A;  4HCS A;  2PZT A;  3HS0 C;  5CV7 A;  4IN3 A;  3TP7 A;  1JOO A;  5EPL A;  3I90 A;  4WJW A;  5JJZ A;  1TII D;  4RAU C;  5KRU A;  2L4N A;  2FHT A;  3DUZ A;  5JEA H;  4HCE A;  3S1Q B;  4RGM A;  1A2T A;  3VYU A;  5C6A A;  1LAB A;  1EQT A;  4DF7 A;  2F0M A;  4HN7 A;  1G29 1;  1DZ1 A;  4CBV A;  3DWQ A;  3PO2 B;  4F88 A;  4PV1 C;  5E3F A;  3K59 A;  3BVM A;  1EWC A;  1OXV A;  3HG9 A;  3VA5 A;  2JYO A;  2R61 A;  5ELC A;  3QOL A;  1ILQ A;  5IGB A;  1H9J A;  1BDO A;  2EE1 A;  4BY7 B;  3SK4 A;  3V2T A;  2SEB D;  2NN6 G;  4J6H A;  3QJY A;  2AQ2 B;  1EY0 A;  2HCI A;  3C1F A;  1O80 A;  1HA6 A;  1XYI A;  1R4Q B;  3BVZ A;  1TS3 A;  1S4Z A;  4FO2 A;  3X3N A;  4G7H C;  2ZXO A;  1B53 A;  1SE3 A;  5KYI A;  4K8J A;  1CHP D;  3OIQ A;  1O7L A;  1V1P B;  4Q5V A;  5CC4 A;  4X3S A;  2VXW A;  3EQL C;  4N9P A;  2EPB A;  1HA5 A;  3BYT B;  3OW7 A;  1E2Z A;  1SNM A;  3DEP A;  1RHP A;  5JPN C;  3QIA A;  4DA2 A;  5M5X B;  3GP7 A;  3BDO A;  4KI0 A;  4ZQ3 A;  3HZX A;  4F7X A;  4CHT B;  5C5L A;  2AWN A;  5C4H A;  3JAM E;  1T5X D;  3H91 A;  4I7Z C;  3GQB A;  4J1M A;  5FLX L;  5K5P A;  2K28 A;  3NUC A;  1Q8I A;  4DGZ A;  1A3V A;  1EEF D;  1CM9 A;  2WAQ B;  4K5V A;  2I46 A;  4ODG A;  2B2T C;  3H3V C;  2DNC A;  1V1O A;  2WKD A;  4FXK C;  2KQ3 A;  4QMG A;  4R8N A;  1AFP A;  1RF2 D;  3DM1 A;  1F2Y A;  4FF3 A;  2LS0 1;  4K5W A;  1UAP A;  2ICE C;  1ROD A;  3C3L A;  1ZYR D;  5I6W A;  5A2Q L;  5C44 B;  1STH A;  3O13 A;  3DXJ C;  3RMH A;  4RA8 A;  1PTO D;  4EQO A;  2CVR A;  3IFD A;  2IX3 A;  2F0F A;  1ENC A;  3N52 A;  1WTW A;  2E2I B;  5E1F A;  1NCV A;  5CGK A;  2F3W A;  1Y8P B;  2FMM A;  3GTL B;  4QCL A;  2YYZ A;  4IFD J;  2SOB A;  4XYQ A;  2PCF B;  3R2T A;  1EYA A;  1HQR D;  1AZQ A;  2KUM A;  1MI2 A;  3CQZ B;  1LTT D;  5CBE E;  2EYM A;  2K6A A;  3CRL C;  4CJ2 C;  2DY7 A;  3DEO A;  1M8A A;  2AQ3 B;  5J39 A;  3KK7 A;  4FF4 A;  1I6H B;  1QOH A;  1UNS A;  1IKL A;  3D31 A;  3NK9 A;  2B8F A;  3TP8 A;  3M85 A;  1SYF A;  3D6C A;  3IFT A;  1DON A;  3HEJ A;  2PZW A;  2PNR C;  1HUN A;  4UDU C;  1TWG B;  1TT2 A;  3MXG A;  5I9O A;  5C3X A;  1DM0 B;  3NQI A;  2EYO A;  1RTN A;  3NTH A;  3QB3 A;  3TME A;  2G9D A;  1ENF A;  5NUC A;  3IKJ A;  2PZU A;  2K5Q A;  3SE0 A;  4U68 A;  4ZKB B;  1SYD A;  3LWU A;  3MFG A;  2NTS A;  2JEB I;  1B9M A;  2A6H D;  3W3A A;  4G7Z C;  4OO1 G;  1TVX A;  5CBA E;  2B2W A;  3OWE B;  2QIL A;  2NVQ B;  3IAY A;  3K5O A;  4IFD G;  3RUZ A;  4L63 B;  4NKL A;  1D2B A;  2LMC B;  2EY2 A;  1GHJ A;  3ERO A;  4KK7 A;  3Q24 A;  3WOF A;  4Q0F A;  3KLS A;  1HXY D;  2EJF C;  1AZP A;  2B2T A;  2FFK B;  4KY6 A;  1G2S A;  1ZEQ X;  4ZUJ A;  3FPU B;  1QJO A;  4C3H B;  2EOT A;  3H6M A;  5KIX A;  2KJX A;  5JAV A;  1DJR D;  1QE6 A;  3A7L A;  5M9O A;  2B2U A;  4BA1 I;  3PO3 B;  1U9R A;  1R9T B;  2N88 A;  1RJT A;  5EPK A;  4M8A A;  5IGD A;  4BY1 B;  3ITP A;  1KAB A;  1OXX K;  4DK1 A;  2E76 C;  5CYU A;  2KEC A;  3URY A;  1FNU A;  1HRJ A;  1IYV A;  1ET9 A;  1WTO A;  1VMC A;  1YNJ D;  3CU7 A;  2ZT9 C;  2PW7 A;  3CHB D;  4H13 C;  2XRQ D;  1V8Q A;  3D4W A;  3SK5 A;  1OXS C;  4V19 0;  4H44 C;  1ML0 D;  1GUT A;  1TS5 A;  5A2Q E;  5IT9 E;  1F2Z A;  4KY7 A;  2R3Z A;  3A54 A;  2O5J C;  5T1I A;  3PIO 3;  1WD1 A;  5ELF A;  4KJN A;  4WOR A;  1SE2 A;  4XQQ A;  1IW7 C;  4NW2 A;  2D2C C;  1LAC A;  4A3E B;  1DOM A;  5EJW A;  5IOD A;  1TWC B;  2F0U A;  2EJM A;  1CHQ D;  5LL6 X;  2HDM A;  1Q90 A;  1FGB D;  5K36 H;  1ICW A;  4M1U B;  2Q8R E;  2TMP A;  1GHK A;  3TDQ A;  1PTO B;  1SYB A;  2ZXR A;  1TWH B;  3KUP A;  3S14 B;  1STE A;  3FRP B;  2J4X A;  4FVM A;  2H4O A;  2TSS A;  1EY8 A;  2OEO A;  1TQO A;  3A8I E;  3CKI B;  3H94 A;  3HOZ B;  3P7J A;  1JQY D;  4WRD A;  4FF1 A;  1D5Z C;  2VB3 X;  1TS4 A;  3SR1 A;  3T16 A;  1EWH A;  1QG7 A;  1EIG A;  3J7A F;  2QDB A;  2E2J B;  2JA5 B;  2F1M A;  1JC7 A;  2K7V A;  1HHV A;  1HCZ A;  1D1I A;  4DU9 A;  2BA0 A;  1U4R A;  1JCK B;  2AUK A;  4ZUI A;  1SJH D;  1STG A;  1JR0 D;  2EY5 A;  5EKI A;  2WV6 D;  4A3G B;  4V0B A;  2F0N A;  1FNV A;  2XWB B;  1Y8O B;  4XQN A;  3NWS A;  3HOU B;  3PUX A;  3I4M B;  3VR5 A;  5A35 A;  3BYY B;  1F9Q A;  1VF7 A;  4RWS C;  2RSO A;  4OO1 H;  3FPP A;  2IPK D;  2EYJ A;  4IUV A;  1BBX C;  3R3O A;  5C0X G;  2XSC A;  4RGO S;  2MP1 A;  4B9X A;  3Q6S A;  2JA6 B;  3GO5 A;  1BCP D;  1ESF A;  1JIC A;  4OL7 A;  1ET6 A;  4JBW A;  3SDZ A;  1JWU D;  2K33 A;  4MIU A;  3S1R B;  1WTV A;  1X3Q A;  4A3K B;  3H09 A;  1STY A;  2IT1 A;  2KED A;  1B4O A;  1SEB D;  4HED A;  1GUS A;  3OIP A;  5IGE A;  2AWO A;  1XX8 A;  4IUU A;  1I4Q A;  5DAU A;  1GUG A;  4XXE A;  2L12 A;  1CQF A;  2JSO A;  4BA2 I;  4K5X A;  3NTI A;  3K5M A;  1BR9 A;  1SSO A;  3HKZ B;  2DN8 A;  4C1N K;  2OT2 A;  3JAM L;  1S5E D;  4RGN A;  2D5D A;  2WII B;  2QKI C;  1IHZ A;  4C2M B;  3D4D A;  1CQV A;  4GZY C;  5M3F B;  2F0S A;  2F0P A;  2B39 A;  3MHB A;  5FK9 C;  1EFI D;  2G9H D;  1GJX A;  4KD3 A;  2EY1 A;  4DNR B;  1HTP A;  3M3Y B;  2C5C A;  5COY A;  5KGU A;  1TU2 B;  4RFB A;  2BA1 A;  3GTO B;  5CV6 A;  1X3P A;  2JP1 A;  4K2L A;  4G4K A;  3TN2 A;  3BDC A;  1I3Q B;  2NN6 H;  2OF1 A;  3V05 A;  1YNJ C;  3UI2 A;  1Y1V B;  4FXD A;  5IIF A;  1EZ6 A;  4L8J A;  5F2D A;  1ZKO A;  1CZW A;  2JA8 B;  4ME5 A;  1BF4 A;  1H9K A;  2LY7 A;  1KLG D;  4IQZ A;  1EZ8 A;  4NDX A;  3T13 A;  3MVV A;  1GXD C;  5D14 A;  1W6J A;  1WCM B;  1TWF B;  2HDL A;  3R2I A;  2B2Y C;  3WDN A;  3L9A X;  1LV9 A;  2A74 C;  4O42 A;  4KY5 A;  3U9O A;  1BO0 A;  3I8Z A;  1R4P B;  4IZ8 A;  4OIK A;  2NTT A;  3A7A B;  4C3H G;  2MHV A;  2RKS A;  2Q8I B;  5FLX E;  2NVT B;  3PUW A;  2XRS D;  3MXU A;  1PRT C;  1V1P A;  2F0T A;  5CV9 A;  2H1E A;  3NBH A;  1EYD A;  1LO5 D;  2A69 C;  3MXP A;  1CA6 A;  4DXF A;  3FDT A;  3VR2 A;  4KKU A;  1JWM D;  1PYW D;  1A15 A;  2OXP A;  1STA A;  2XIW A;  1PRT D;  2CQA A;  1K8O A;  1TS2 A;  3LX0 A;  1X32 A;  3PUZ A;  2K05 A;  4KKT A;  1B50 A;  4KJO A;  1VMP A;  2JXM B;  3NTK A;  1RDP D;  2B2V A;  2CW0 D;  4AYB B;  4G57 A;  2DNE A;  1JOQ A;  1O78 A;  4CJ1 B;  1JB3 A;  2IW3 A;  4C3J G;  1J9O A;  4ULL A;  1BCP C;  3J81 E;  1S5D D;  1I50 B;  3NBI A;  4H7B A;  3GV3 A;  4R8I A;  3KF8 A;  4ZYS A;  3K5L A;  3S17 B;  1HTL D;  2AUJ D;  2NYZ D;  1I4H A;  3FVQ A;  4A3D B;  3MAQ A;  1B2T A;  1FD7 D;  1F9S A;  3L7Z C;  5E4W C;  2EZV A;  3BZD B;  3NSW A;  2B2U C;  3PIP 3;  1A3U A;  3V96 A;  5ELD A;  1Y8N B;  1TKW B;  1T5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...