5I2XA

Crystal structure of tpp1 k170del
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
b'SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenocortical dysplasia protein homolog
publication title Structural and functional consequences of a disease mutation in the telomere protein TPP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i2xA00
2I46A 2M9VA 5I2YA 5I2XA
chains in the Genus database with same CATH superfamily
4P73A 4BY1G 3J7ZC 4A3BG 1BVSA 3S1RH 3TP8A 1NNXA 4OWTB 4KY5A 4GOPB 1MD2D 3GO5A 2ZTDA 3MAQA 2EZVA 5IGCA 2R93B 2VXWA 3D6WA 4ZK9B 5C3XA 5IYDH 4DKAC 3CMEA 4JI3Q 3S17B 3PIO3 1WD0A 3I90A 2KEDA 1MBYA 4RWSC 4GNXB 4DR1Q 2D9UA 1BCPC 3T13A 3NEMA 2RQXA 3CKIB 1WCMH 1N36L 1BBWA 2XN9C 3GTKH 5CR3A 2WAQG 1SNOA 2JQOA 1EYAA 2ID0A 3RLNA 5IYBH 1KDCA 3GTLH 1I3QH 3T56B 3DWQA 3MXUA 3BVGA 1JB7A 2RDGA 2DN8A 1F9QA 1U4RA 1MJEA 1PMRA 1NTGA 1TS3A 4B3TL 3BZDB 1QVGA 2CFMA 4LF6Q 2F0JA 2K50A 2RA4A 1K73C 4IUQA 2NZ1D 4ILWA 3MEFA 4B08A 4UP7A 4AQYL 1G6ZA 3S14B 4IOAA 2L0CA 3URYA 3VYUA 3RZOH 1U4PA 5C3EB 3QIAA 4XT1B 2P5ZX 5I9PA 3S9WA 4K5WA 1SNCA 1JJ2A 1M1KC 2A69D 1D8LA 1N32Q 5TSSA 2N49A 4DR5L 4AYBE 2JA6G 1KD1C 4FXKC 2B2YA 3GV6A 3Q22A 3VR4A 1N9WA 2LFNA 1BBUA 3KJPA 3CW2C 2VZAA 1NR4A 1BO0A 5FOBB 4AH6A 4Q5VA 4X3UA 1AEXA 1NMGA 2J4XA 5M3MB 3I3CA 2XVSA 3STBD 3FKIH 2OTLA 5D65A 2NUCA 4QMGA 3A0JA 5HY6A 4GOPA 2F0VA 1ILQA 4NXML 2AWNA 4X62L 2QEJC 2JA7G 2K14A 1YNJC 3OW2A 3K5MA 5IODA 3PUYA 3P75A 4GNXA 2JA8G 2F0DA 2ASBA 3K5NA 4K5VA 2I5HA 2BA1A 3C3LA 1JOKA 1TWGH 2I5MX 3LWEA 2ZXPA 1EWHA 3I91A 1SNQA 4POGA 2KJXA 3PO2H 2R3ZA 4IUTA 5E7NA 2BA0A 3S1MH 2MGSA 1U9RA 4DN4M 1ZEQX 5GQOA 4K2KA 1HNXL 2KBNA 2EYLA 1Q7YC 2E2JH 1LTID 1D1IA 2A8VA 1KAAA 5C4JH 2K5QA 5GROA 4GKKL 4JI4L 2JE6I 2EOTA 4HIDA 2CW0D 2X69A 4B3RL 5DM63 1UE1A 1WI5A 4PMCA 4EVOA 1AZQA 4LFAL 2K33A 3EN2A 4RKBA 4K6DA 5C44G 2BCOA 5IWAL 3X3MA 1XTCD 3QR8A 2AMCB 3GD7A 1I4GA 5M5XH 2KECA 1D5ZC 2A73B 2YU9B 3HKZE 2MP1A 4DV1Q 1DM0B 4L5RC 1PH4A 3VR6A 3HP3A 3T1YL 2RHSB 4IOCA 1Y14B 1Y1WG 1B70B 4IUPA 2R92B 4NB3A 1KQSA 3S24A 3HOXB 4M1UB 5IGGA 2QGQA 1A63A 4IFDI 1RJTA 4ME5A 1U5KA 3ONAB 4QIWB 3E9HA 4EQNA 2UUBQ 3STBC 1I50B 1FGUA 1JCKB 2EY2A 2Y0SB 1STYA 3B6YA 3GDEA 3GTPB 5ELEA 2OQ0A 3PO3G 4MNOA 1Q82C 4A3BB 1R9TH 5KIXA 3NBIA 1YZ6A 2E75C 4LF5L 1GHKA 2D62A 3QOLA 2C9OA 1EEID 2ZXOA 1B50A 4DR7L 5E4WC 3FKIG 4DR5Q 3HOVG 1MHWC 3O13A 1VF5C 2VS1A 1R4PB 4Q0FA 4A93H 4DR3L 2ZM6Q 3FMCA 3TEHB 1PH3A 4F7XA 1IKLA 4O0AA 4DUYL 1DGSA 1Y1VB 4Y7NB 2AQ1B 3MXPA 4JI6L 4UAIA 4BS9A 5BN3A 1QNUA 1I6VC 1XNRQ 1XPOA 1S4ZA 4GS3A 3LNNA 2E2DC 5BR8L 1EZ8A 5C0XH 5EKLA 4RFBA 2E76C 4R4QA 5JEAH 2BOSA 2CW0C 4A3CG 4A3DG 2VQEL 1A8VA 3GTQH 4BY7B 1KAWA 3M9BA 1K28A 3DEPA 5EAYA 5KNCA 4J1MA 3PIPA 3H0GG 2XRQD 4UY8C 1Q1EA 4DV4Q 1QUQB 5ELDA 1K8AC 2WB1G 2RSOA 5IT9E 4RGMA 2PO4A 3KYHC 4OGQC 2DJFC 4C2MH 2VQFL 3NTHA 4HN7A 3IFDA 4JI7L 1QILA 4JYAL 2BDOA 4LUOA 4WJWA 5C3WA 2UUAL 3VR5A 4C3IH 4ZCKA 1SJHD 2FJ2A 4K0KQ 3HKZG 2QCPX 1S5DD 3S1NB 1BCPB 2WKCA 3KDFB 4DAPA 4JVZA 1HZ9A 2K32A 2KHSA 2QILA 4LUZA 4K2LA 1W6KA 5I6YA 3K80C 2K4KA 1R4QB 1X3QA 2A74C 2EYFA 4DNTB 2BH2A 1EFWA 1AH9A 3A7LA 1DOLA 3BDCA 3CQZB 2KUMA 5IWAQ 3L7ZC 2F4VQ 1PTOH 1Q12A 1STNA 1WTHA 1I4HA 1IL8A 4AIMA 1PZKD 5K36H 5FKAC 1EWCA 2F1MA 1WTWA 2VY3A 2EXZA 1XWEA 2M00A 3I4NH 2AKWB 1TWAH 2O5JC 2F0SA 1VQ8A 1ENAA 4OO1I 2NVTB 1PYBA 5IGFA 3VR2A 3S14H 3RD4A 1KTKA 2ZTEA 4YY3Q 4LAAA 1FNVA 1BF4A 2EIFA 4J6HA 4LF7L 2NYZD 2A68C 5C4ZA 4A3IG 5JJZA 1S5CD 3M4YA 1STHA 5JVG3 4KKTA 1PYWD 3E0EA 5M3FG 1D5MC 2M9VA 4A3LH 4ME3A 4CDDC 3M4OB 5M3MH 5I9OA 4G57A 4KHZA 1QUQA 4L8JA 2DJGC 5CC4A 1KABA 2KOLA 1Q86C 1OXTA 3V96A 4LWCA 1IHZA 5IP9H 1NCVA 2ICEC 2F0EA 3FEWX 2E2IH 3HOYB 1CUKA 3IL8A 1SMYD 5KNBA 3QJYA 4LF4L 2VB2X 3BZKA 3OW7A 4YCWA 4KY6A 5LHY1 1ASYA 4JI6Q 3BG3A 1KRSA 4RCOA 3GTJB 2CH4W 4Y52H 3LGJA 5K5PA 1HQRD 3D4DA 3KDFA 1TS2A 2K03A 4IURA 2E5LQ 5JJKA 2VQEQ 1HFGA 2KHIA 3T16A 1Y1WB 2JN4A 4RMFA 4BXXH 2B8GA 2PYKA 3U50C 3VA5A 4C3IG 4DV0Q 4ALPA 3H15A 4HIMA 5M5WB 4QCLA 1RDPD 3CC2A 2M2LA 2XGTA 2NB0A 3NELA 1Q90A 2K5HA 4PQXA 4B3ML 4H7BA 1PZJD 3PO3B 1ZYRD 4HJ9A 4C3JB 5BN5A 1LTLA 3PF5A 1IW7D 4YHHL 4O42A 2EJFC 2VW9A 1FNWA 1KL9A 4L5TA 2N78A 5J3BA 5C5LA 4JBMA 3CCSA 4TVAB 1XJVA 3Q24A 1Y8NB 5EBCA 1WTPA 1BBXC 3HOVB 2VL6A 3D4RA 2B3GA 1ET6A 4KKSA 4CDEC 3MZ5A 3HOUG 1DOMA 4MIUA 1SRUA 2YU9H 1HZCA 3I55A 1K83B 3MA2B 4JI3L 5IOCA 2MO1A 5FLMG 3TS2A 3WDNA 3HOZB 2EY6A 1JOQA 4DR1L 4A3GG 1SNDA 2R92H 1V1OA 2Z8LA 3HOXH 2F0UA 2JSOA 2CVRA 1VMPA 2NTSA 3H6MA 5C4XB 4KTAA 4DV7Q 1NUCA 5I2YA 3MFGA 2HDLA 1SE3A 3NWSA 1I50H 3I4MB 3S2HB 3GTPH 5AFWA 2K28A 4QIWE 3IKJA 3J80E 1HH2P 1X3EA 4HMIA 1PTOF 1SMYC 5LMUQ 4I65A 2R7FA 2WB1B 4G7HC 2HUGA 1SJED 4ZQ3A 1HA5A 3NQTA 5CORA 3E3XA 2F0WA 3SVMA 3D6CA 2Q8IB 2WIIB 4LF6L 1SN8A 4WJ4A 2TSSA 3NTKA 1O78A 2WACA 2B2WC 5NUCA 2JA5G 3MHBA 1S40A 2VUMH 3J80i 1XMQQ 2E74C 1YHQA 3I2ZA 4Y7NH 1Y1VH 1DONA 5KGUA 2BH8A 5KNDA 4RCNA 1UUPA 1ICWA 1TWCB 5FK9C 4IPGA 1X3PA 1D1KA 4H44C 4BBRH 1N32L 2K7VA 1O7LA 1MI2A 1PFNA 2RVLA 3OPOA 4H0LC 2N3SA 1GJXA 4EQ5A 2OF1A 1MSGA 3T1HQ 1I4PA 3BZCA 4OONA 4DUZL 3PV0A 1E7ZA 4HR7B 1FR3A 2I5LX 1G51A 2A6HC 4BY7H 3GTMB 4DV3Q 1K9MC 2AUKA 1IW7C 1Q8KA 2YYZA 2WV6D 3QWNA 1OXUA 4XQQA 1JE5A 1OXXK 1PZID 3TZUA 3F2BA 1VQOA 4S3SA 1N33Q 4LW1A 1ICFB 3L9AX 3HEJA 3S1QB 4IUNA 1PFSA 4PZ6A 3TP6A 1LACA 2AQ3B 4LFBQ 2Z4IA 4JI2Q 4X66L 2L15A 1B3AA 4PMWA 1KIXA 2IX1A 1HUMA 2EPBA 1SAPA 4MN3A 5IP7G 4RGTA 4DK3C 4CKBA 2HT1A 1STBA 4JOIA 4XYOA 1PV4A 1SE8A 2PNHA 3S1NH 4YIJA 1JOOA 4A3IB 4KI0A 4A3EG 1FD7D 4YCUA 1EY0A 5ELNA 1HFNA 1AW7A 1FVIA 1XX8A 2LS01 3E0JA 4DV6Q 1FJGQ 5GAGC 5JPMC 3GTOB 2EXDA 3Q6SA 3WOFA 5CV4A 2Z6KA 5HGQA 4KN7C 4CDFC 5CV6A 4KK7A 2PI2A 3JAME 1ESFA 4IFDJ 1D2BA 3SE0A 1ML0D 4GN5A 1H9JA 3NK9A 4ZKCB 1EIYB 2L11A 4A3KG 5IYCH 4KY7A 5E4XA 1A3VA 4CBVA 1HZBA 5CBAE 3UDIA 2DGYA 3CCJA 1EL0A 3R3OA 1EOVA 4K6LA 4DV2Q 4XQNA 4GN4B 1YITA 2EQSA 4WJ3M 4XDXA 1EEFD 1V8QA 4KHPQ 1B7YB 3JAMi 3OWEB 3P20A 3IRBA 2NVTH 1W3SA 1RHPA 5GAEC 1PH6A 5L37A 4A3FB 4RHSA 3BDOA 1LO5D 4J15A 1CFMA 3BDLA 1B4OA 3NHHA 1TS4A 5C6AA 1SYCA 3W3AA 1HPCA 1LT4D 1SROA 4DV1L 1LTRD 4DR6Q 1OXSC 4A3JG 3TS0A 1E2WA 1KDAA 3HG9A 3OIQA 1WVLA 3KOJA 1VQJA 5KEEA 2KVMA 4KLKA 2OEOA 4H02A 2JA9A 1IL2A 3M4OH 4KN4C 1A0IA 2E2HB 1EQTA 4A3MB 2UUBL 3GQBA 4YWLA 4YCVA 2FINB 1ESRA 5DM73 4C1NI 1SE2A 2QEXA 3EBEA 5CMDA 3KK7A 3HOYH 4R4CA 1G8ZD 3SEBA 1JR0D 4NW2A 4WRDA 1ZKOA 5FO8B 2Q2TA 3NTIA 3K7AH 3ULLA 3CHBD 2ZM6L 1NE3A 3H3VI 2I07B 3GV3A 2X6LA 2OQKA 4DUZQ 3RNUA 1YHAA 2GVBA 2Z4HA 1A15A 5CV7A 1QOHA 5T1IA 2NN6I 3KLSA 2OTJA 2ZT9C 3I4LA 3OIPA 5M5WH 4HJ8A 1XNRL 2R7ZH 4C3HG 2AWOA 1HNZQ 4JI5Q 1TT2A 3A7AB 2XWBB 2K01A 3PSIA 1GUNA 4P72A 5EQ0A 4P74A 4K8IA 5EKKA 1WFQA 1P16A 1CKOA 1TWFB 3ICEA 1TR5A 4C3JH 1W2BA 3P1HA 3CCLA 3NE5B 1B8AA 1KLUD 1CK1A 4X66Q 4BBSG 2R61A 4QB4A 3N52A 1B2TA 1E22A 2GA4B 1EY7A 4DV5Q 1DCZA 2O5IC 4N9PA 5CGKA 3U4ZA 3P7JA 4DV4L 3K0YA 2L55A 3PUVA 3I73A 5IYDG 4QQBX 2DY8A 3TP7A 1QG7A 2PW5A 3H91A 4MHEA 1KC8C 1EY5A 1E0BA 1X32A 1BNZA 3PIP3 1BKBA 2AQ2B 3HOWH 1U4LA 1AZPA 1K83H 1WJJA 1LUZA 4HCEA 4KKUA 3HOZH 2EDGA 4K0KL 1WCMG 2B63B 4HIOA 3K59A 1OXVA 1LTGD 2YV5A 4TRDA 3OOCA 3PQIA 5IY0A 3C1EA 1CQVA 3R93A 5IYBG 5ISRA 5C4XH 1V43A 3R8BA 1PH7A 1BUVT 3I4MH 3S2HH 1SMXA 3PIOA 1SYEA 1K3BC 3G6EA 2F4VL 2F0OA 3SK4A 4KJNA 2I0QA 5ELCA 3HRZC 1RTOA 4DA2A 3S2DB 2K52A 4JI1Q 2PI2E 1A3UA 2A69C 1YEZA 4B9WA 2EJMA 1S5FD 4DXGA 1CHQD 3K0XA 1H9SB 4F8MA 3K57A 3DXJC 4NKLA 3NP8A 2HQLA 3NPPA 2EJGC 3ITPA 1SYDA 4AYBG 3SK5A 2J0TD 2R6GA 2XTIA 4PG3A 3SK6A 4LFCQ 3DWAA 3KBXA 2UUCQ 3EVQA 3FPUB 4YY3L 4TQUS 2CWPA 1TWCH 1VS0A 2V4DA 2VNUD 3RUZA 4DAYB 2KQ3A 4JK1C 2H5XA 5FO7B 2SOBA 1EIHA 2SNMA 1F9RA 3U58A 4ULLA 2XNAC 4BY1B 1KLGD 3AFPA 3PCOB 1F9PA 5C4HA 2BDNA 3K5OA 1HJPA 4HJAA 4A3KB 1SBBB 2NVYB 3WOEA 5F2DA 1WTQA 4POFA 2JP1A 1A62A 1CI3M 1J8IA 3J81L 1EU3A 4L63B 2HCIA 5IGDA 1X3FA 2PMZE 1N34L 5CBEE 1KHIA 3ER0A 4ZUJA 4ZYSA 3S1QH 1U0LA 3VYSA 2F52A 4LUVA 1PRTF 1TU2B 3TZDA 1MJCA 2WAQB 5C5MA 3JC66 1V1PB 3PO2G 1IBKQ 3T53B 1I6HH 2E5LL 1SYFA 1RF2D 2RHQB 4HTHA 4RHRA 4CJ2C 2KA7A 3KLRA 2A1AA 2V1CC 2NZOA 2UU9Q 3GTOH 4KD4A 1HR0Q 4DV0L 1U4MA 5KYLA 1X9NA 1EY6A 1HQMC 4FP5D 1F2LA 3IFTA 4IQZA 1WYDA 3HFZB 1D7QA 1PTOD 5M5YB 2IJ0A 2ENBA 1STEA 3GTGB 1Y8PB 5G3LF 1JB3A 4MZ9A 2R93H 4DU9A 1H9SA 3KLSX 3I8ZA 4X65Q 3KUPA 3BVZA 3S17H 1CSPA 1VQ5A 1Z9FA 1ENFA 1TVXA 2AHOB 1TWHB 2PW7A 2JA6B 2K6AA 1J6QA 1F2MA 3FPPA 4KJOA 4QUCA 1L0YB 4EX5A 3KF8B 3KBGA 1S5BD 1VQ9A 1PDQA 3T51B 4DAYA 3NXWA 2G5DA 2B29A 4A3FH 2F0QA 1EOTA 2EYOA 2H1EA 5LL6X 1XMOQ 3J81c 4NXNQ 3CF5A 4APVA 2KCCA 1NSNS 3BU2A 3RLFA 4CDCC 1D6EC 4ABNA 4R4OA 3EJIA 4ZUIA 4OX9Q 2JA7B 1HXYD 1XNQQ 3F2CA 3UDXA 4DV7L 2IY5B 5J1ZA 3CRKC 4A3MH 4DAMA 2JA8B 1HHVA 2A5HA 1JT8A 1MGSA 3ZJYC 3S1RB 4XYQA 2ZJPA 2I46A 2EY5A 3L0OA 4KV6A 2EYMA 4A75A 3H3VH 2K5NA 5LMUL 1DYQA 3G48A 5C3EH 4UP9A 5FJ8H 1H9RA 3K5LA 1I5FA 1EFID 1V1PA 4A93G 1WTXA 2NN6H 4FXGC 3QB3A 4RGOS 3RN2A 2PQAB 2KCNA 3OYYA 3W5OA 1LT5D 5DAUA 2A6ED 3OSOA 4XTCS 2B2UC 4DR2L 1UAPA 3UE0A 2F3WA 1ZXTA 1XMQL 1T5XD 1CM9A 2LMCB 3T4AC 1HNWQ 3MTSA 4N8X1 5C0XG 3HGBA 5JEAG 2CH4A 1BQQT 1V9PA 2SNSA 1I3QB 2L12A 5CYUA 3RR5A 1YI2A 3FVQA 4K5XA 3F8TA 3T1HL 1N34Q 3F2UA 2K5VA 1PTOC 2SEBD 2F3VA 1WTVA 5C44B 4DK6C 2EE1A 4ZLTF 4IN3A 1TWFH 4K14A 4H13C 2KHJA 2SDFA 1PVOA 1O7IA 1EQQA 4DV3L 2F0KA 3PGZA 5EPKA 4UHVA 3F2DA 3ZYYX 2O2LD 4FVMA 2J7ZA 1QVFA 3KF8A 3CPFA 1GO3E 1N33L 4JI0Q 3E6ZX 2JEBI 1CZGA 2MJ8A 2R93G 3A8KE 4LMQD 5CV5A 1UEAB 1KNAA 4QL5A 4JI2L 4LFBL 3OTOQ 1L2FA 1SSOA 1II3A 3M7GA 1PA6A 1LTBD 2EY1A 2B63H 2CQOA 3RZDB 2B8FA 4EGVA 1RL2A 3QO2A 4MTKA 1LTAD 1C0AA 4DV6L 1FJGL 1G91A 4QY7A 2NVXB 2WFWA 2LKVA 3VYRA 1AP0A 4IPDA 2JYOA 1Q8IA 3FKIB 3LX0A 3G4SA 1UNSA 1LABA 4CKEA 4LF9Q 1G6PA 3M3YB 1E2ZA 3UE1A 3X3NA 1A2TA 5K36G 3GP7A 3CMAA 4GKJQ 1YJNA 1F2YA 3JAML 3TMEA 3J7YW 2PQAA 3S2DH 3I4NG 4B9XA 4DV2L 4IFDH 2E8GA 4P71A 1QJOA 5GAHC 4NPSA 1EWIA 4NMZA 1K0RA 3C2PA 4KHPL 4HAEA 1EQRA 1K3RA 5JJIA 4QF4A 3CCUA 2OXPA 1ENCA 3S1MB 4FF2A 4A3DB 2UXDQ 4DK1A 4EQPA 1EYCA 4LK1C 1I94Q 1NMFA 1ONLA 4OWWB 2L9HA 3HZXA 1EYGA 2MFIA 3BYYB 5EJWA 1OTCA 1JORA 4DR6L 2Q8RE 3H0GB 4BY1H 4X64Q 4A3BH 2PQEA 4V190 5M9OA 2Y0SE 4A3LG 5M3MG 2F0PA 3TN2A 1GUTA 3TBIB 4RG1A 1VMCA 4WFN3 4CGYB 5H1SE 2NVYH 3AFQA 5IP9G 3SDZA 1YNND 1SR3A 1O7ZA 1PH1A 3VYTA 3G71A 1SFOB 4DR4Q 1GUWA 1VQIA 2HDMA 3DHQA 4JV5Q 4DR2Q 3DUZA 3Q8DA 3HKZB 4FNFA 1DXMA 5LMNQ 1VQMA 2NBFA 5E3FA 4GLVB 3VDYA 3QOJA 5A2QE 4IUVA 1B44D 1SNMA 5GADC 2C35B 4ZKBB 4OL7A 2F0LA 2ZXRA 1K8GA 1E24A 3AYHB 4BXXG 3G6JB 3JAMc 2WAQE 3KJOA 1ZYRC 2QKIC 3BS1A 2Z6BA 1WOCA 2L5TA 4U68A 2UXBQ 2YTYA 1TKWB 1PFBA 1YIJA 1LT3D 4ODGA 4G4KA 1HNZL 4JI5L 3EFXD 2IPKD 1I4XA 3MVVA 1C8CA 1X55A 2GVAA 1VQPA 3J7AF 3AMUA 2ES2A 3SXHA 5M5YH 1X3GA 2HIVA 3NWTA 1LTSD 3GTGH 1YHBA 4CHTB 4KMUC 4LJZC 1DZ1A 1P8LA 4P2CB 3FDTA 1MIUA 1L0WA 2IHEA 4CJ1B 3V05A 3TQYA 1VQLA 1Q81C 5LL6S 2RDFA 4DV5L 1TWHH 4FO2A 2JA6H 5D3IB 1IBLQ 3NENA 4ID6A 4WORA 1B53A 3FRPB 1IZ6A 2MQHA 3R2TA 4R4TA 2PZTA 4IFDG 2B2VC 4K8JA 5M3FB 1JICA 1RD9D 1QNKA 3V2TA 3OMGA 1M8AA 3L2PA 5EBDA 4U673 2R92G 3HOXG 3CQZH 3VR3A 4OO1H 4HCSA 2D5DA 4X6AH 2HHHQ 4OHJA 1EY8A 3R2IA 1TS5A 1AN8A 5FLXE 2K05A 1UE7A 1YNNC 1VQKA 4RH6A 4RAUC 1VQNA 1J9OA 4IPCA 4DK0A 1CQFA 1EIFA 1HCZA 4C2MB 1YNJD 1C7YA 1AE3A 1NY4A 4O2DA 1VQ4A 3UI2A 1PRTD 1W6JA 3RN5A 2RF4A 4JI1L 1VQ6A 4N9TA 1DOKA 5DEHA 3UDFA 4C3IB 4GLAC 4L5QA 4EQOA 2VUMG 2O4XA 4L6TB 3I70A 3MWYW 1Y1VG 2R7DA 1PLFA 1SNPA 4FDBA 4LFCL 2LXKA 4C56C 3EIVA 1YJ9A 1T5EA 2B39A 4JBWA 2IX3A 2UUCL 4BBRG 1WD1A 1QWYA 2DNEA 2XWJB 3S16B 4JI8Q 1SLJA 2JEAI 1IBMQ 3M85A 1CZWA 2JXMB 5DNFA 3Q23A 1PH5A 3RMHA 4BA1I 1MSHA 1K8OA 4BY7G 3NSWA 1PTOB 2MHVA 1RODA 1TY0A 5C44H 5G3LD 4IJLA 2F0NA 3GTJH 3K81C 1EYDA 1CA5A 3HOUB 4DGZA 5T1GA 4IALA 1NBWA 4L5SA 1K8MA 3W1GA 4JBKA 1HRJA 2F0GA 3ULPA 1LM0A 3I4NB 1UWVA 1TWAB 1Y69U 1YVCA 1GD7A 1XXGA 1G291 1VQAA 3PUZA 2PCFB 3SGIA 3OMCA 4A3GB 4F87A 1H9MA 3EA6A 3CC4A 3CP0A 1A6XA 1Y1WH 2UXCQ 4RA8A 5EPJA 2Q2IA 4KD3A 2FHTA 1L1OC 1H9KA 3F1ZA 3SK8A 1CT1D 1WTRA 5JJLA 1CKMA 3TP5A 2F4IA 1HR0W 4ZRZA 1IBKL 1B1ZA 3CAMA 3RZDH 3PO3H 4JW0A 1EZ6A 2D0OA 1Q1BA 2HIXA 1MKHA 2NVXH 4R1JA 2UU9L 1HR0L 1YBYA 1RIPA 3TRZA 1JWUD 1RTNA 2NTTA 1QCBD 1UE5A 2FXQA 5IYCG 1GKHA 3HOVH 3HKSA 2G9DA 4OO1G 4FF3A 2E2IB 2LSSA 2EYHA 1V1QA 5COYA 5AJ3Q 3C46A 4FF1A 3M3YH 3NQIA 2EYJA 5CV8A 4OIJA 1GUSA 2JA5B 5IIFA 4IO9A 5IE8A 4HMJA 3KFUA 1PRTC 3AU7A 4X65L 5IT9L 5DLQE 1J5EQ 4YWMA 1VQFA 1JJCB 2B2UA 2MNAA 4PZ7A 3A5ZB 1BCPF 1CTMA 3QG1A 1LT6D 1E2VA 1S72A 1S3OA 1SXTA 4HSPA 2K5DA 3U9OA 4B3SQ 3SR1A 4R8IA 4A3CH 4A3DH 4XIGS 4X3KA 1EQVA 1TIID 1IYVA 1XMOL 3I7FA 4NXNL 1C9OA 3K8AA 2Z0SA 3ND9A 5ELFA 1GHJA 2IW3A 3H0GH 3CCEA 3EQLC 1QB5D 3FHWA 4R9WA 1STGA 2XRSD 4DXFA 2D0PA 2OCEA 4OX9L 4GZYC 2CWAA 2PZUA 2QA4A 1XNQL 3W2DA 3BYTB 4IZ8A 3S15B 2WB1E 4M8AA 3HOYG 2ZJQA 2KEEA 1SFOH 2IHFA 4YWKA 3MEHA 2YTXA 5KYIA 5ELBA 1FNUA 5ELOA 2IWHA 1N36Q 2MO0A 3J7AV 3J81j 2RKSA 4A3EB 2WINB 4F88A 4FYDA 1CHPD 1X6OA 3AQQA 1SYGA 2ZJRA 4V0BA 2NVQB 1BXTA 3SHLA 1KNEA 3AEVA 3DM3A 1BR9A 4JOIC 3C1FA 1EY4A 1SYBA 3A5UA 2IL8A 1GM5A 3G7LA 2B2TC 5IT9c 3GTMH 2R7ZG 2Z9HA 4XT3B 4B3TQ 1S5ED 1B3QA 1FYCA 1HNWL 1ASZA 1G2SA 4OIKA 2N55A 3K7UC 4I7AA 2F03A 5HGTA 2Z6KC 4AQYQ 3RLOA 4C3JG 3D8GA 2JK8A 2HQEA 2PNRC 2PZWA 4QJFA 1T9HA 4OEMB 1F9SA 1DJRD 1KRTA 1C4QA 3TDQA 1TQOA 2EYPA 4TSSA 4FXDA 4A3IH 1BDOA 2VUMB 4JI0L 4PNYA 3CRLC 4XQJA 4A3JB 4DNIA 3HOWG 1PXUA 1H95A 2A19A 5M3FH 3HOZG 1SDFA 1VQHA 4BBRB 3OTOL 3CC7A 4I7ZC 2A68D 4LF8L 3MXGA 3D31A 1VQGA 4NXMQ 2D2CC 1A3TA 2K1BA 2RBMA 1JC7A 1PH9A 4X62Q 2CCZA 2RCFA 1C48A 1G2TA 2LY7A 2K75A 5C4XG 2QDBA 1EY9A 1TXYA 4MTNA 5I4DA 3Q0AA 3I4MG 2ICIA 1Y8OB 3L3OC 2B2WA 1EIGA 5CV9A 1XYIA 1GUGA 3M4QA 1IYUA 3A54A 4LF9L 4KHVA 5BN4A 1VQEA 5D3DA 5E1FA 4GN3B 3VA7A 4GKJL 1HNXQ 3NBHB 2JJQA 1I4RA 4HJ7A 4G7OC 4UDUC 4A4IA 1YJWA 4GKKQ 1Q3LA 2BE5D 4JI4Q 4C3HB 3ULJA 2ALYB 4B3RQ 4O1NA 4UP8A 2GN5A 2PPBC 2B2YC 1Z47A 1BOSA 1HTPA 2KCTA 4QUFA 1PFMA 2ZTCA 5D14A 2UXDL 2QF7A 1I94L 2E2HH 3S16H 4BBSB 4LFAQ 4DFAA 3D0FA 4J8QA 3ND8A 3MXNB 4JCVE 1QE6A 3N6RA 4ZAIA 4X64L 3CCRA 3CD6A 4GOPC 5J22A 5HURA 4BA2I 5EKIA 3U9SA 3HOUH 1STAA 1UEBA 3J80L 1X56A 4P75A 5LMNW 4GNXC 4JPBW 3KF6B 1JE4A 2MUYA 3T1YQ 3I4OA 5FLMH 4DR4L 2L1BA 4OXPA 1HA6A 4G7ZC 2RDHA 4JV5L 1TY2A 2B2VA 2CQAA 1WCMB 4A3GH 2HCCA 1LV9A 2N88A 5LMNL 3GTKB 1EUJA 2F0TA 1RKNA 2XSCA 1L1OB 2F0HA 4HSVA 3GTLB 2Q2HA 3H94A 5I2XA 1GVPA 1ET9A 1XPRA 1O80A 5EPLA 5A2QL 5JPNC 4LF5Q 3M4PA 3PF4A 3IAYA 2K04A 2Q2UA 2N8NA 3J81E 4DR7Q 1RCVD 5I6WA 1VQBA 2NWGA 5JOBA 3E5SA 1F77A 2F0FA 1YNXA 2UXBL 1LLRD 1VF7A 3DMUA 2C5CA 4IUUA 4DR3Q 1ILPA 3CCVA 2K5WA 1IYJB 5EGTA 1X65A 2AUJD 2LXJA 4RGNA 5C0XJ 1DD2A 4PMBA 3NBHA 3H3VC 5JEAJ 4PZ8A 4DUYQ 3RZOB 4AYBB 3E9IA 2WP8J 5JVH3 2JA5H 1L0XB 4A76A 2Q8TA 1F2ZA 4N8FA 3J81i 1PRTB 1Z6HA 3K7AB 4LF8Q 5BR8Q 1IXRA 1M4VA 2OWOA 4UPAA 2F3IA 2BE5C 1B9MA 1FL0A 2KCMA 1IKMA 3MC0B 4A3FG 4QGUA 1IBLL 2NZHA 3A8JE 1QZGA 3J80c 2KENA 1AFPA 1JMCA 1NR2A 2ATWA 4OELB 1JJGA 2JA8H 4NDXA 3MXNA 2R7ZB 1E1TA 3M7NA 2IX0A 1VCIA 2YTVA 3H09A 1NJIC 4JBJA 1D5XC 1O7YA 1KDBA 2FMMA 5IGEA 4R8NA 3I72A 4TKOB 4X3TA 2VQFQ 1CKNB 1M90C 2A6HD 4JI7Q 3J7A5 2HHHL 4XXEA 4JYAQ 4A3MG 3KF6A 2UUAQ 2OT2A 3S15H 3TSSA 1TWGB 4Z9CB 2L4NA 1GOZA 1NAPA 5IP7H 5C3EG 3PUXA 2A6EC 3PO2B 3U4VA 5FJ8G 3FP9A 4GLXA 2EVBA 5FLXL 1L1OA 3NUCA 1JQYD 2NN6G 4A3EH 1WTOA 1VDZA 2IT1A 1VQDA 3CCQA 2F0MA 3HOWB 2E2JB 3DLLA 5C4JB 4LNQA 3A8IE 2DNCA 2NVQH 4FF4A 2DUDA 2XIWA 1E3PA 1GUOA 1B9NA 3A56A 3CPWA 2FFKB 5IGBA 3A74A 2RSNA 3A55A 4A3KH 2CKZB 2TMPA 2MPMA 4IJHA 1XPUA 1LYLA 2CHBD 3AB9A 3BJUA 4JI8L 3OWFA 1IBML 2WKDA 2HD3A 5A35A 2G9HD 3BVMA 1I4QA 1JWMD 4HEDA 3K58A 4NP5A 3HS0C 1FGBD 1SEBD 4IPHA 4E6IA 5M5XB 4R4IA 3W1BA 1PYSB 2H4OA 3TREA 4LF7Q 1Z7TA 1SE4A 4OWXB 2VB3X 2RCNA 4JG2A 1OO9B 1BCPD 1LTTD 3DEOA 5JAVA 5FO9B 4JC0A 3K6OA 4C1NK 3CXCA 4A3JH 1PH2A 3PUWA 1JWSD 2UXCL 1K0SA 4DF7A 1HTLD 3D3RA 1QVCA 1N8RC 4CKCA 3CU7A 1CA6A 2QW7A 3ERSX 3ERQA 1HZAA 3DM1A 3OHXC 2B63G 5KRUA 1Q46A 1CKNA 5FLXc 5J39A 4LF4Q 1R9TB 2Z1CA 1QZHA 3CCMA 1UE6A 4HJ5A 4DAVA 4DNRB 2PMZB 4BWGB 4A93B 1PHJA 1GXDC 2F0IA 1VQCA 3MFYA 1KXLA 4RKLA 5AJ3L 1E1OA 1EU4A 3LWUA 3EROA 2X6GA 2FMCA 4X3SA 1VQ7A 2QDLA 4DPGA 3I56A 3WWVA 3PMFA 1A2UA 3UDGA 1J5EL 2DY7A 4C3HH 4B3MQ 1I6HB 1HUNA 1X54A 3DWPA 2B2TA 4PV1C 4HIKA 1AE2A 1PH8A 1CSQA 3GTQB 2JA7H 4B3SL 3D4WA 4YHHQ 2Y0SG 5C0XI 4BBSH 1XTDA 4CJ0B 3KLWA
chains in the Genus database with same CATH topology
3TP8A 4KY5A 1MD2D 3GO5A 3MAQA 2EZVA 5IGCA 2R93B 2VXWA 3D6WA 4ZK9B 5C3XA 3S17B 3PIO3 1WD0A 3I90A 2KEDA 1MBYA 4RWSC 2D9UA 1BCPC 3T13A 2RQXA 3CKIB 2XN9C 5CR3A 1SNOA 1EYAA 2ID0A 1KDCA 3T56B 3DWQA 3MXUA 3BVGA 2RDGA 2DN8A 1F9QA 1U4RA 1PMRA 1TS3A 3BZDB 2F0JA 2RA4A 4IUQA 2NZ1D 4ILWA 4B08A 1G6ZA 3S14B 2L0CA 3URYA 3VYUA 1U4PA 5C3EB 3QIAA 4XT1B 5I9PA 3S9WA 4K5WA 1SNCA 2A69D 5TSSA 4FXKC 2B2YA 3GV6A 3Q22A 3VR4A 2LFNA 1NR4A 1BO0A 5FOBB 4Q5VA 4X3UA 1AEXA 2J4XA 5M3MB 3I3CA 2XVSA 5D65A 2NUCA 4QMGA 2F0VA 1ILQA 2AWNA 2QEJC 1YNJC 3K5MA 5IODA 3PUYA 3P75A 2F0DA 3K5NA 4K5VA 2BA1A 3C3LA 1JOKA 3LWEA 2ZXPA 1EWHA 3I91A 1SNQA 2KJXA 2R3ZA 4IUTA 2BA0A 2MGSA 1U9RA 4DN4M 1ZEQX 4K2KA 2EYLA 1LTID 1D1IA 1KAAA 2K5QA 2JE6I 2EOTA 2CW0D 2X69A 5DM63 4PMCA 4EVOA 1AZQA 2K33A 4RKBA 4K6DA 2BCOA 3X3MA 1XTCD 3GD7A 1I4GA 2KECA 1D5ZC 2A73B 2YU9B 2MP1A 1DM0B 3VR6A 3HP3A 4IUPA 2R92B 3HOXB 4M1UB 5IGGA 4IFDI 1RJTA 4ME5A 3ONAB 4QIWB 4EQNA 1I50B 2EY2A 1JCKB 2Y0SB 3GTPB 1STYA 5ELEA 4A3BB 5KIXA 3NBIA 2E75C 1GHKA 2D62A 3QOLA 2C9OA 1EEID 2ZXOA 1B50A 5E4WC 3O13A 1VF5C 1R4PB 4Q0FA 3FMCA 4F7XA 1IKLA 4Y7NB 1Y1VB 2AQ1B 3MXPA 4UAIA 4BS9A 5BN3A 1QNUA 1I6VC 1S4ZA 3LNNA 2E2DC 1EZ8A 5C0XH 5EKLA 4RFBA 2E76C 5JEAH 2BOSA 2CW0C 4BY7B 3DEPA 5KNCA 4J1MA 2XRQD 1Q1EA 5ELDA 2RSOA 5IT9E 4RGMA 2PO4A 4OGQC 3NTHA 4HN7A 3IFDA 1QILA 2BDOA 4WJWA 5C3WA 3VR5A 1SJHD 2FJ2A 2QCPX 1S5DD 3S1NB 1BCPB 2WKCA 4DAPA 2K32A 2KHSA 2QILA 4K2LA 1W6KA 5I6YA 1R4QB 1X3QA 2A74C 2EYFA 4DNTB 3A7LA 1DOLA 3BDCA 3CQZB 2KUMA 3L7ZC 1PTOH 1Q12A 1STNA 1I4HA 1IL8A 1PZKD 5K36H 5FKAC 1EWCA 2F1MA 1WTWA 2EXZA 1XWEA 2M00A 2O5JC 2F0SA 1ENAA 4OO1I 2NVTB 5IGFA 3VR2A 3RD4A 1KTKA 4LAAA 1FNVA 1BF4A 4J6HA 2NYZD 2A68C 5C4ZA 5JJZA 1S5CD 3M4YA 1STHA 5JVG3 4KKTA 1PYWD 1D5MC 2M9VA 3M4OB 5I9OA 4G57A 4KHZA 4L8JA 5CC4A 1KABA 2KOLA 1OXTA 3V96A 1IHZA 1NCVA 2ICEC 2F0EA 3FEWX 3HOYB 3IL8A 1SMYD 5KNBA 3QJYA 2VB2X 3OW7A 4KY6A 5LHY1 3BG3A 4RCOA 3GTJB 5K5PA 1HQRD 3D4DA 1TS2A 2K03A 4IURA 1HFGA 3T16A 1Y1WB 2B8GA 2PYKA 3VA5A 4C3IG 5M5WB 4QCLA 1RDPD 2M2LA 2NB0A 1Q90A 4PQXA 4H7BA 1PZJD 3PO3B 1ZYRD 4C3JB 5BN5A 1IW7D 4O42A 2EJFC 1FNWA 5C5LA 3Q24A 1Y8NB 5EBCA 1WTPA 1BBXC 3HOVB 3D4RA 1ET6A 4KKSA 3MZ5A 1DOMA 4MIUA 1K83B 3MA2B 5IOCA 3WDNA 3HOZB 2EY6A 1JOQA 1SNDA 1V1OA 2Z8LA 2F0UA 2JSOA 2CVRA 1VMPA 2NTSA 3H6MA 5C4XB 4KTAA 1NUCA 5I2YA 3MFGA 2HDLA 1SE3A 3NWSA 3I4MB 3S2HB 5AFWA 2K28A 3IKJA 3J80E 4HMIA 1PTOF 1SMYC 4I65A 2WB1B 4G7HC 2HUGA 1SJED 4ZQ3A 1HA5A 3NQTA 5CORA 2F0WA 3SVMA 3D6CA 2Q8IB 2WIIB 2TSSA 3NTKA 1O78A 2WACA 2B2WC 5NUCA 3MHBA 2E74C 1DONA 5KGUA 5KNDA 4RCNA 1UUPA 1ICWA 1TWCB 5FK9C 1X3PA 1D1KA 4H44C 2K7VA 1O7LA 1MI2A 1PFNA 2RVLA 3OPOA 4H0LC 1GJXA 2OF1A 1MSGA 1I4PA 3PV0A 4HR7B 1FR3A 2A6HC 3GTMB 2AUKA 1IW7C 2YYZA 2WV6D 3QWNA 1OXUA 4XQQA 1OXXK 1PZID 3TZUA 4S3SA 3L9AX 3HEJA 3S1QB 4IUNA 3TP6A 1LACA 2AQ3B 2Z4IA 1B3AA 4PMWA 2IX1A 1HUMA 2EPBA 1SAPA 4MN3A 4RGTA 4CKBA 1STBA 4XYOA 4YIJA 1JOOA 4A3IB 4KI0A 1FD7D 1EY0A 1HFNA 1AW7A 1XX8A 2LS01 3E0JA 5JPMC 3GTOB 3Q6SA 3WOFA 5CV4A 4KN7C 5CV6A 4KK7A 3JAME 1ESFA 4IFDJ 1D2BA 3SE0A 1ML0D 1H9JA 3NK9A 4ZKCB 2L11A 4KY7A 5E4XA 1A3VA 4CBVA 5CBAE 1EL0A 3R3OA 4K6LA 4XQNA 4XDXA 1EEFD 1V8QA 3OWEB 3P20A 1RHPA 4A3FB 4RHSA 3BDOA 1LO5D 1CFMA 3BDLA 1B4OA 3NHHA 1TS4A 5C6AA 1SYCA 3W3AA 1HPCA 1LT4D 1LTRD 1OXSC 1E2WA 1KDAA 3HG9A 3OIQA 1WVLA 5KEEA 2KVMA 2OEOA 4KN4C 2E2HB 1EQTA 4A3MB 3GQBA 5DM73 2FINB 1ESRA 4C1NI 1SE2A 5CMDA 3KK7A 1G8ZD 3SEBA 1JR0D 4NW2A 4WRDA 1ZKOA 5FO8B 3NTIA 3CHBD 2I07B 3GV3A 2X6LA 2Z4HA 1A15A 5CV7A 5T1IA 1QOHA 2NN6I 3KLSA 2ZT9C 3I4LA 3OIPA 4C3HG 2AWOA 1TT2A 3A7AB 2XWBB 2K01A 1GUNA 5EQ0A 4K8IA 5EKKA 1TWFB 1TR5A 3P1HA 3NE5B 1KLUD 1CK1A 2R61A 4QB4A 3N52A 1B2TA 2GA4B 1EY7A 1DCZA 2O5IC 4N9PA 5CGKA 3P7JA 3K0YA 2L55A 3PUVA 3I73A 2DY8A 3TP7A 1QG7A 2PW5A 3H91A 4MHEA 1EY5A 1E0BA 1X32A 1BNZA 3PIP3 2AQ2B 1U4LA 1AZPA 4HCEA 4KKUA 2EDGA 2B63B 3K59A 1OXVA 1LTGD 4TRDA 3OOCA 3C1EA 1CQVA 3R93A 5ISRA 1V43A 3R8BA 1BUVT 1SYEA 2F0OA 3SK4A 4KJNA 5ELCA 3HRZC 1RTOA 4DA2A 3S2DB 1A3UA 2A69C 4B9WA 2EJMA 1S5FD 4DXGA 1CHQD 1H9SB 4F8MA 3K57A 3DXJC 4NKLA 3NP8A 3NPPA 2EJGC 3ITPA 1SYDA 3SK5A 2J0TD 2R6GA 3SK6A 3DWAA 3KBXA 3EVQA 3FPUB 4TQUS 2V4DA 2VNUD 3RUZA 2KQ3A 4JK1C 5FO7B 2SOBA 1EIHA 2SNMA 1F9RA 4ULLA 2XNAC 4BY1B 1KLGD 1F9PA 5C4HA 2BDNA 3K5OA 4A3KB 1SBBB 2NVYB 3WOEA 5F2DA 1WTQA 2JP1A 1CI3M 1J8IA 3J81L 1EU3A 4L63B 2HCIA 5IGDA 5CBEE 4ZYSA 4ZUJA 3VYSA 1PRTF 1TU2B 3TZDA 2WAQB 5C5MA 1V1PB 3T53B 1SYFA 1RF2D 4HTHA 4RHRA 4CJ2C 2KA7A 3KLRA 4KD4A 1U4MA 5KYLA 1EY6A 1HQMC 4FP5D 1F2LA 3IFTA 4IQZA 1PTOD 5M5YB 2IJ0A 2ENBA 1STEA 3GTGB 1Y8PB 5G3LF 1JB3A 4DU9A 1H9SA 3KLSX 3I8ZA 3KUPA 3BVZA 1ENFA 1TVXA 1TWHB 2PW7A 2JA6B 2K6AA 1F2MA 3FPPA 4QUCA 4KJOA 1L0YB 3KBGA 1S5BD 1PDQA 3T51B 4DAYA 3NXWA 2F0QA 1EOTA 2EYOA 2H1EA 5LL6X 2KCCA 1NSNS 3RLFA 1D6EC 4ABNA 3EJIA 4ZUIA 2JA7B 1HXYD 5J1ZA 3CRKC 2JA8B 1HHVA 2A5HA 1MGSA 3S1RB 4XYQA 2I46A 2EY5A 4KV6A 2EYMA 1DYQA 1H9RA 3K5LA 1EFID 1V1PA 1WTXA 2NN6H 4FXGC 3QB3A 4RGOS 2KCNA 1LT5D 5DAUA 2A6ED 3OSOA 4XTCS 2B2UC 1UAPA 2F3WA 1ZXTA 1T5XD 1CM9A 2LMCB 3T4AC 3MTSA 5C0XG 3HGBA 5JEAG 1BQQT 2SNSA 1I3QB 2L12A 5CYUA 3FVQA 4K5XA 3F2UA 1PTOC 2SEBD 2F3VA 1WTVA 5C44B 2EE1A 4ZLTF 4IN3A 4K14A 4H13C 2SDFA 2F0KA 5EPKA 3ZYYX 2O2LD 4FVMA 2J7ZA 3KF8A 3E6ZX 2JEBI 1CZGA 2MJ8A 3A8KE 4LMQD 5CV5A 1UEAB 1KNAA 1SSOA 1II3A 3M7GA 1LTBD 2EY1A 3RZDB 2B8FA 4EGVA 3QO2A 1LTAD 1G91A 2NVXB 2LKVA 3VYRA 1AP0A 2JYOA 1Q8IA 3FKIB 3LX0A 1UNSA 1LABA 4CKEA 3M3YB 1E2ZA 3X3NA 1A2TA 5K36G 3GP7A 1F2YA 3JAML 3TMEA 3J7YW 4B9XA 4IFDH 1QJOA 4NMZA 3C2PA 4HAEA 4QF4A 2OXPA 1ENCA 3S1MB 4FF2A 4A3DB 4DK1A 4EQPA 1EYCA 4LK1C 1ONLA 2L9HA 3HZXA 3BYYB 5EJWA 1JORA 2Q8RE 3H0GB 2PQEA 4V190 5M9OA 2F0PA 3TN2A 1GUTA 3TBIB 1VMCA 4WFN3 4CGYB 3SDZA 1YNND 1O7ZA 1GUWA 3VYTA 1SFOB 2HDMA 3DHQA 3DUZA 3HKZB 4FNFA 1DXMA 2NBFA 5E3FA 3QOJA 5A2QE 4IUVA 1B44D 1SNMA 4ZKBB 4OL7A 2F0LA 2ZXRA 3G6JB 1ZYRC 2QKIC 3BS1A 2L5TA 4U68A 1TKWB 1PFBA 1LT3D 4ODGA 4G4KA 1C8CA 3EFXD 2IPKD 1I4XA 3MVVA 3J7AF 3AMUA 3SXHA 3NWTA 1LTSD 4CHTB 4KMUC 4LJZC 1DZ1A 4P2CB 3FDTA 4CJ1B 3V05A 5LL6S 2RDFA 4FO2A 5D3IB 4ID6A 4WORA 1B53A 3FRPB 3R2TA 2PZTA 4IFDG 2B2VC 4K8JA 5M3FB 1JICA 1RD9D 1QNKA 3V2TA 3OMGA 1M8AA 5EBDA 4U673 3VR3A 4OO1H 4HCSA 2D5DA 4OHJA 1EY8A 3R2IA 1TS5A 1AN8A 5FLXE 2K05A 1YNNC 4RH6A 4RAUC 1J9OA 4DK0A 1CQFA 1HCZA 4C2MB 1YNJD 3UI2A 1PRTD 1W6JA 4N9TA 1DOKA 5DEHA 4C3IB 4EQOA 2O4XA 4L6TB 3I70A 3MWYW 1PLFA 1SNPA 4C56C 1T5EA 2B39A 4JBWA 2IX3A 1WD1A 1QWYA 2DNEA 2XWJB 3S16B 2JEAI 3M85A 1CZWA 2JXMB 5DNFA 3Q23A 3RMHA 4BA1I 1MSHA 1K8OA 3NSWA 1PTOB 2MHVA 1RODA 1TY0A 5G3LD 2F0NA 1EYDA 1CA5A 3HOUB 4DGZA 5T1GA 4IALA 1K8MA 1HRJA 2F0GA 3I4NB 1TWAB 1Y69U 1XXGA 1G291 3PUZA 2PCFB 3OMCA 4A3GB 4F87A 1H9MA 3EA6A 1A6XA 4RA8A 5EPJA 4KD3A 2FHTA 1H9KA 3SK8A 1CT1D 1WTRA 3TP5A 2F4IA 4ZRZA 1B1ZA 1EZ6A 1Q1BA 1JWUD 1RTNA 2NTTA 1QCBD 2G9DA 4OO1G 4FF3A 2E2IB 2EYHA 5COYA 3C46A 4FF1A 3NQIA 2EYJA 5CV8A 4OIJA 1GUSA 2JA5B 5IIFA 4HMJA 1PRTC 3AU7A 5IT9L 2B2UA 1BCPF 1CTMA 3QG1A 1LT6D 1E2VA 1SXTA 4HSPA 2K5DA 3U9OA 3SR1A 4R8IA 4XIGS 4X3KA 1EQVA 1TIID 1IYVA 3ND9A 5ELFA 1GHJA 2IW3A 3EQLC 1QB5D 4R9WA 1STGA 2XRSD 4DXFA 4GZYC 2PZUA 3W2DA 3BYTB 4IZ8A 3S15B 4M8AA 2KEEA 3MEHA 5KYIA 5ELBA 1FNUA 2IWHA 3J7AV 2RKSA 4A3EB 2WINB 4F88A 4FYDA 1CHPD 1SYGA 4V0BA 2NVQB 1BXTA 3SHLA 1KNEA 1BR9A 3C1FA 1EY4A 1SYBA 2IL8A 3G7LA 2B2TC 4XT3B 1S5ED 1FYCA 1G2SA 4OIKA 2N55A 2F03A 5HGTA 4C3JG 3D8GA 2HQEA 2PNRC 2PZWA 1F9SA 1DJRD 1C4QA 3TDQA 1TQOA 2EYPA 4TSSA 4FXDA 1BDOA 2VUMB 4PNYA 3CRLC 4XQJA 4A3JB 1PXUA 1SDFA 4BBRB 4I7ZC 2A68D 3MXGA 3D31A 2D2CC 1A3TA 2K1BA 2RBMA 1JC7A 1C48A 1G2TA 2LY7A 2QDBA 1EY9A 5I4DA 3Q0AA 2ICIA 1Y8OB 3L3OC 2B2WA 1EIGA 5CV9A 1XYIA 1GUGA 1IYUA 3A54A 4KHVA 5BN4A 5E1FA 5D3DA 3VA7A 1I4RA 4G7OC 4UDUC 1Q3LA 2BE5D 4C3HB 4O1NA 2PPBC 2B2YC 1Z47A 1BOSA 1HTPA 4QUFA 1PFMA 5D14A 2QF7A 4BBSB 4DFAA 4J8QA 3ND8A 4ZAIA 1QE6A 3N6RA 5J22A 5HURA 4BA2I 5EKIA 3U9SA 1STAA 3J80L 1JE4A 2MUYA 2L1BA 1HA6A 4G7ZC 2RDHA 1TY2A 2B2VA 2CQAA 1WCMB 2HCCA 1LV9A 2N88A 3GTKB 2F0TA 1RKNA 2XSCA 2F0HA 4HSVA 3GTLB 5I2XA 3H94A 1ET9A 1O80A 5EPLA 5A2QL 5JPNC 3IAYA 2K04A 3J81E 1RCVD 5I6WA 2NWGA 5JOBA 3E5SA 1F77A 2F0FA 1LLRD 1VF7A 3DMUA 2C5CA 4IUUA 1ILPA 2K5WA 5EGTA 2AUJD 4RGNA 5C0XJ 1DD2A 4PMBA 3NBHA 3H3VC 5JEAJ 3RZOB 4AYBB 2WP8J 5JVH3 1L0XB 2Q8TA 1F2ZA 1PRTB 1Z6HA 3K7AB 1M4VA 2BE5C 1B9MA 1IKMA 3MC0B 3A8JE 1AFPA 1NR2A 4NDXA 3MXNA 2R7ZB 3M7NA 2IX0A 1VCIA 3H09A 1D5XC 1O7YA 1KDBA 2FMMA 5IGEA 4R8NA 3I72A 4TKOB 4X3TA 2A6HD 4XXEA 2OT2A 3TSSA 1TWGB 4Z9CB 2L4NA 1GOZA 1NAPA 3PUXA 2A6EC 3PO2B 2EVBA 5FLXL 3NUCA 1JQYD 2NN6G 1WTOA 1VDZA 2IT1A 2F0MA 3HOWB 2E2JB 5C4JB 3A8IE 2DNCA 4FF4A 2XIWA 1GUOA 1B9NA 3A56A 2FFKB 5IGBA 2RSNA 3A55A 2TMPA 2MPMA 2CHBD 3AB9A 3OWFA 2WKDA 5A35A 2G9HD 3BVMA 1I4QA 1JWMD 4HEDA 3K58A 4NP5A 3HS0C 1FGBD 1SEBD 4E6IA 5M5XB 2H4OA 1Z7TA 1SE4A 2VB3X 1OO9B 1BCPD 1LTTD 3DEOA 5JAVA 5FO9B 3K6OA 4C1NK 3PUWA 1JWSD 4DF7A 1HTLD 3D3RA 4CKCA 3CU7A 1CA6A 3ERQA 3DM1A 3OHXC 5KRUA 5J39A 1R9TB 2Z1CA 4DAVA 4DNRB 2PMZB 4BWGB 4A93B 1GXDC 2F0IA 3MFYA 4RKLA 1EU4A 3LWUA 3EROA 2X6GA 2FMCA 4X3SA 3PMFA 1A2UA 2DY7A 1I6HB 1HUNA 3DWPA 2B2TA 4PV1C 3GTQB 3D4WA 5C0XI 4CJ0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I46 A;  2M9V A;  5I2Y A;  5I2X A; 
#chains in the Genus database with same CATH topology
 4P73 A;  4BY1 G;  3J7Z C;  4A3B G;  1BVS A;  3S1R H;  3TP8 A;  1NNX A;  4OWT B;  4KY5 A;  4GOP B;  1MD2 D;  3GO5 A;  2ZTD A;  3MAQ A;  2EZV A;  5IGC A;  2R93 B;  2VXW A;  3D6W A;  4ZK9 B;  5C3X A;  5IYD H;  4DKA C;  3CME A;  4JI3 Q;  3S17 B;  3PIO 3;  1WD0 A;  3I90 A;  2KED A;  1MBY A;  4RWS C;  4GNX B;  4DR1 Q;  2D9U A;  1BCP C;  3T13 A;  3NEM A;  2RQX A;  3CKI B;  1WCM H;  1N36 L;  1BBW A;  2XN9 C;  3GTK H;  5CR3 A;  2WAQ G;  1SNO A;  2JQO A;  1EYA A;  2ID0 A;  3RLN A;  5IYB H;  1KDC A;  3GTL H;  1I3Q H;  3T56 B;  3DWQ A;  3MXU A;  3BVG A;  1JB7 A;  2RDG A;  2DN8 A;  1F9Q A;  1U4R A;  1MJE A;  1PMR A;  1NTG A;  1TS3 A;  4B3T L;  3BZD B;  1QVG A;  2CFM A;  4LF6 Q;  2F0J A;  2K50 A;  2RA4 A;  1K73 C;  4IUQ A;  2NZ1 D;  4ILW A;  3MEF A;  4B08 A;  4UP7 A;  4AQY L;  1G6Z A;  3S14 B;  4IOA A;  2L0C A;  3URY A;  3VYU A;  3RZO H;  1U4P A;  5C3E B;  3QIA A;  4XT1 B;  2P5Z X;  5I9P A;  3S9W A;  4K5W A;  1SNC A;  1JJ2 A;  1M1K C;  2A69 D;  1D8L A;  1N32 Q;  5TSS A;  2N49 A;  4DR5 L;  4AYB E;  2JA6 G;  1KD1 C;  4FXK C;  2B2Y A;  3GV6 A;  3Q22 A;  3VR4 A;  1N9W A;  2LFN A;  1BBU A;  3KJP A;  3CW2 C;  2VZA A;  1NR4 A;  1BO0 A;  5FOB B;  4AH6 A;  4Q5V A;  4X3U A;  1AEX A;  1NMG A;  2J4X A;  5M3M B;  3I3C A;  2XVS A;  3STB D;  3FKI H;  2OTL A;  5D65 A;  2NUC A;  4QMG A;  3A0J A;  5HY6 A;  4GOP A;  2F0V A;  1ILQ A;  4NXM L;  2AWN A;  4X62 L;  2QEJ C;  2JA7 G;  2K14 A;  1YNJ C;  3OW2 A;  3K5M A;  5IOD A;  3PUY A;  3P75 A;  4GNX A;  2JA8 G;  2F0D A;  2ASB A;  3K5N A;  4K5V A;  2I5H A;  2BA1 A;  3C3L A;  1JOK A;  1TWG H;  2I5M X;  3LWE A;  2ZXP A;  1EWH A;  3I91 A;  1SNQ A;  4POG A;  2KJX A;  3PO2 H;  2R3Z A;  4IUT A;  5E7N A;  2BA0 A;  3S1M H;  2MGS A;  1U9R A;  4DN4 M;  1ZEQ X;  5GQO A;  4K2K A;  1HNX L;  2KBN A;  2EYL A;  1Q7Y C;  2E2J H;  1LTI D;  1D1I A;  2A8V A;  1KAA A;  5C4J H;  2K5Q A;  5GRO A;  4GKK L;  4JI4 L;  2JE6 I;  2EOT A;  4HID A;  2CW0 D;  2X69 A;  4B3R L;  5DM6 3;  1UE1 A;  1WI5 A;  4PMC A;  4EVO A;  1AZQ A;  4LFA L;  2K33 A;  3EN2 A;  4RKB A;  4K6D A;  5C44 G;  2BCO A;  5IWA L;  3X3M A;  1XTC D;  3QR8 A;  2AMC B;  3GD7 A;  1I4G A;  5M5X H;  2KEC A;  1D5Z C;  2A73 B;  2YU9 B;  3HKZ E;  2MP1 A;  4DV1 Q;  1DM0 B;  4L5R C;  1PH4 A;  3VR6 A;  3HP3 A;  3T1Y L;  2RHS B;  4IOC A;  1Y14 B;  1Y1W G;  1B70 B;  4IUP A;  2R92 B;  4NB3 A;  1KQS A;  3S24 A;  3HOX B;  4M1U B;  5IGG A;  2QGQ A;  1A63 A;  4IFD I;  1RJT A;  4ME5 A;  1U5K A;  3ONA B;  4QIW B;  3E9H A;  4EQN A;  2UUB Q;  3STB C;  1I50 B;  1FGU A;  1JCK B;  2EY2 A;  2Y0S B;  1STY A;  3B6Y A;  3GDE A;  3GTP B;  5ELE A;  2OQ0 A;  3PO3 G;  4MNO A;  1Q82 C;  4A3B B;  1R9T H;  5KIX A;  3NBI A;  1YZ6 A;  2E75 C;  4LF5 L;  1GHK A;  2D62 A;  3QOL A;  2C9O A;  1EEI D;  2ZXO A;  1B50 A;  4DR7 L;  5E4W C;  3FKI G;  4DR5 Q;  3HOV G;  1MHW C;  3O13 A;  1VF5 C;  2VS1 A;  1R4P B;  4Q0F A;  4A93 H;  4DR3 L;  2ZM6 Q;  3FMC A;  3TEH B;  1PH3 A;  4F7X A;  1IKL A;  4O0A A;  4DUY L;  1DGS A;  1Y1V B;  4Y7N B;  2AQ1 B;  3MXP A;  4JI6 L;  4UAI A;  4BS9 A;  5BN3 A;  1QNU A;  1I6V C;  1XNR Q;  1XPO A;  1S4Z A;  4GS3 A;  3LNN A;  2E2D C;  5BR8 L;  1EZ8 A;  5C0X H;  5EKL A;  4RFB A;  2E76 C;  4R4Q A;  5JEA H;  2BOS A;  2CW0 C;  4A3C G;  4A3D G;  2VQE L;  1A8V A;  3GTQ H;  4BY7 B;  1KAW A;  3M9B A;  1K28 A;  3DEP A;  5EAY A;  5KNC A;  4J1M A;  3PIP A;  3H0G G;  2XRQ D;  4UY8 C;  1Q1E A;  4DV4 Q;  1QUQ B;  5ELD A;  1K8A C;  2WB1 G;  2RSO A;  5IT9 E;  4RGM A;  2PO4 A;  3KYH C;  4OGQ C;  2DJF C;  4C2M H;  2VQF L;  3NTH A;  4HN7 A;  3IFD A;  4JI7 L;  1QIL A;  4JYA L;  2BDO A;  4LUO A;  4WJW A;  5C3W A;  2UUA L;  3VR5 A;  4C3I H;  4ZCK A;  1SJH D;  2FJ2 A;  4K0K Q;  3HKZ G;  2QCP X;  1S5D D;  3S1N B;  1BCP B;  2WKC A;  3KDF B;  4DAP A;  4JVZ A;  1HZ9 A;  2K32 A;  2KHS A;  2QIL A;  4LUZ A;  4K2L A;  1W6K A;  5I6Y A;  3K80 C;  2K4K A;  1R4Q B;  1X3Q A;  2A74 C;  2EYF A;  4DNT B;  2BH2 A;  1EFW A;  1AH9 A;  3A7L A;  1DOL A;  3BDC A;  3CQZ B;  2KUM A;  5IWA Q;  3L7Z C;  2F4V Q;  1PTO H;  1Q12 A;  1STN A;  1WTH A;  1I4H A;  1IL8 A;  4AIM A;  1PZK D;  5K36 H;  5FKA C;  1EWC A;  2F1M A;  1WTW A;  2VY3 A;  2EXZ A;  1XWE A;  2M00 A;  3I4N H;  2AKW B;  1TWA H;  2O5J C;  2F0S A;  1VQ8 A;  1ENA A;  4OO1 I;  2NVT B;  1PYB A;  5IGF A;  3VR2 A;  3S14 H;  3RD4 A;  1KTK A;  2ZTE A;  4YY3 Q;  4LAA A;  1FNV A;  1BF4 A;  2EIF A;  4J6H A;  4LF7 L;  2NYZ D;  2A68 C;  5C4Z A;  4A3I G;  5JJZ A;  1S5C D;  3M4Y A;  1STH A;  5JVG 3;  4KKT A;  1PYW D;  3E0E A;  5M3F G;  1D5M C;  2M9V A;  4A3L H;  4ME3 A;  4CDD C;  3M4O B;  5M3M H;  5I9O A;  4G57 A;  4KHZ A;  1QUQ A;  4L8J A;  2DJG C;  5CC4 A;  1KAB A;  2KOL A;  1Q86 C;  1OXT A;  3V96 A;  4LWC A;  1IHZ A;  5IP9 H;  1NCV A;  2ICE C;  2F0E A;  3FEW X;  2E2I H;  3HOY B;  1CUK A;  3IL8 A;  1SMY D;  5KNB A;  3QJY A;  4LF4 L;  2VB2 X;  3BZK A;  3OW7 A;  4YCW A;  4KY6 A;  5LHY 1;  1ASY A;  4JI6 Q;  3BG3 A;  1KRS A;  4RCO A;  3GTJ B;  2CH4 W;  4Y52 H;  3LGJ A;  5K5P A;  1HQR D;  3D4D A;  3KDF A;  1TS2 A;  2K03 A;  4IUR A;  2E5L Q;  5JJK A;  2VQE Q;  1HFG A;  2KHI A;  3T16 A;  1Y1W B;  2JN4 A;  4RMF A;  4BXX H;  2B8G A;  2PYK A;  3U50 C;  3VA5 A;  4C3I G;  4DV0 Q;  4ALP A;  3H15 A;  4HIM A;  5M5W B;  4QCL A;  1RDP D;  3CC2 A;  2M2L A;  2XGT A;  2NB0 A;  3NEL A;  1Q90 A;  2K5H A;  4PQX A;  4B3M L;  4H7B A;  1PZJ D;  3PO3 B;  1ZYR D;  4HJ9 A;  4C3J B;  5BN5 A;  1LTL A;  3PF5 A;  1IW7 D;  4YHH L;  4O42 A;  2EJF C;  2VW9 A;  1FNW A;  1KL9 A;  4L5T A;  2N78 A;  5J3B A;  5C5L A;  4JBM A;  3CCS A;  4TVA B;  1XJV A;  3Q24 A;  1Y8N B;  5EBC A;  1WTP A;  1BBX C;  3HOV B;  2VL6 A;  3D4R A;  2B3G A;  1ET6 A;  4KKS A;  4CDE C;  3MZ5 A;  3HOU G;  1DOM A;  4MIU A;  1SRU A;  2YU9 H;  1HZC A;  3I55 A;  1K83 B;  3MA2 B;  4JI3 L;  5IOC A;  2MO1 A;  5FLM G;  3TS2 A;  3WDN A;  3HOZ B;  2EY6 A;  1JOQ A;  4DR1 L;  4A3G G;  1SND A;  2R92 H;  1V1O A;  2Z8L A;  3HOX H;  2F0U A;  2JSO A;  2CVR A;  1VMP A;  2NTS A;  3H6M A;  5C4X B;  4KTA A;  4DV7 Q;  1NUC A;  5I2Y A;  3MFG A;  2HDL A;  1SE3 A;  3NWS A;  1I50 H;  3I4M B;  3S2H B;  3GTP H;  5AFW A;  2K28 A;  4QIW E;  3IKJ A;  3J80 E;  1HH2 P;  1X3E A;  4HMI A;  1PTO F;  1SMY C;  5LMU Q;  4I65 A;  2R7F A;  2WB1 B;  4G7H C;  2HUG A;  1SJE D;  4ZQ3 A;  1HA5 A;  3NQT A;  5COR A;  3E3X A;  2F0W A;  3SVM A;  3D6C A;  2Q8I B;  2WII B;  4LF6 L;  1SN8 A;  4WJ4 A;  2TSS A;  3NTK A;  1O78 A;  2WAC A;  2B2W C;  5NUC A;  2JA5 G;  3MHB A;  1S40 A;  2VUM H;  3J80 i;  1XMQ Q;  2E74 C;  1YHQ A;  3I2Z A;  4Y7N H;  1Y1V H;  1DON A;  5KGU A;  2BH8 A;  5KND A;  4RCN A;  1UUP A;  1ICW A;  1TWC B;  5FK9 C;  4IPG A;  1X3P A;  1D1K A;  4H44 C;  4BBR H;  1N32 L;  2K7V A;  1O7L A;  1MI2 A;  1PFN A;  2RVL A;  3OPO A;  4H0L C;  2N3S A;  1GJX A;  4EQ5 A;  2OF1 A;  1MSG A;  3T1H Q;  1I4P A;  3BZC A;  4OON A;  4DUZ L;  3PV0 A;  1E7Z A;  4HR7 B;  1FR3 A;  2I5L X;  1G51 A;  2A6H C;  4BY7 H;  3GTM B;  4DV3 Q;  1K9M C;  2AUK A;  1IW7 C;  1Q8K A;  2YYZ A;  2WV6 D;  3QWN A;  1OXU A;  4XQQ A;  1JE5 A;  1OXX K;  1PZI D;  3TZU A;  3F2B A;  1VQO A;  4S3S A;  1N33 Q;  4LW1 A;  1ICF B;  3L9A X;  3HEJ A;  3S1Q B;  4IUN A;  1PFS A;  4PZ6 A;  3TP6 A;  1LAC A;  2AQ3 B;  4LFB Q;  2Z4I A;  4JI2 Q;  4X66 L;  2L15 A;  1B3A A;  4PMW A;  1KIX A;  2IX1 A;  1HUM A;  2EPB A;  1SAP A;  4MN3 A;  5IP7 G;  4RGT A;  4DK3 C;  4CKB A;  2HT1 A;  1STB A;  4JOI A;  4XYO A;  1PV4 A;  1SE8 A;  2PNH A;  3S1N H;  4YIJ A;  1JOO A;  4A3I B;  4KI0 A;  4A3E G;  1FD7 D;  4YCU A;  1EY0 A;  5ELN A;  1HFN A;  1AW7 A;  1FVI A;  1XX8 A;  2LS0 1;  3E0J A;  4DV6 Q;  1FJG Q;  5GAG C;  5JPM C;  3GTO B;  2EXD A;  3Q6S A;  3WOF A;  5CV4 A;  2Z6K A;  5HGQ A;  4KN7 C;  4CDF C;  5CV6 A;  4KK7 A;  2PI2 A;  3JAM E;  1ESF A;  4IFD J;  1D2B A;  3SE0 A;  1ML0 D;  4GN5 A;  1H9J A;  3NK9 A;  4ZKC B;  1EIY B;  2L11 A;  4A3K G;  5IYC H;  4KY7 A;  5E4X A;  1A3V A;  4CBV A;  1HZB A;  5CBA E;  3UDI A;  2DGY A;  3CCJ A;  1EL0 A;  3R3O A;  1EOV A;  4K6L A;  4DV2 Q;  4XQN A;  4GN4 B;  1YIT A;  2EQS A;  4WJ3 M;  4XDX A;  1EEF D;  1V8Q A;  4KHP Q;  1B7Y B;  3JAM i;  3OWE B;  3P20 A;  3IRB A;  2NVT H;  1W3S A;  1RHP A;  5GAE C;  1PH6 A;  5L37 A;  4A3F B;  4RHS A;  3BDO A;  1LO5 D;  4J15 A;  1CFM A;  3BDL A;  1B4O A;  3NHH A;  1TS4 A;  5C6A A;  1SYC A;  3W3A A;  1HPC A;  1LT4 D;  1SRO A;  4DV1 L;  1LTR D;  4DR6 Q;  1OXS C;  4A3J G;  3TS0 A;  1E2W A;  1KDA A;  3HG9 A;  3OIQ A;  1WVL A;  3KOJ A;  1VQJ A;  5KEE A;  2KVM A;  4KLK A;  2OEO A;  4H02 A;  2JA9 A;  1IL2 A;  3M4O H;  4KN4 C;  1A0I A;  2E2H B;  1EQT A;  4A3M B;  2UUB L;  3GQB A;  4YWL A;  4YCV A;  2FIN B;  1ESR A;  5DM7 3;  4C1N I;  1SE2 A;  2QEX A;  3EBE A;  5CMD A;  3KK7 A;  3HOY H;  4R4C A;  1G8Z D;  3SEB A;  1JR0 D;  4NW2 A;  4WRD A;  1ZKO A;  5FO8 B;  2Q2T A;  3NTI A;  3K7A H;  3ULL A;  3CHB D;  2ZM6 L;  1NE3 A;  3H3V I;  2I07 B;  3GV3 A;  2X6L A;  2OQK A;  4DUZ Q;  3RNU A;  1YHA A;  2GVB A;  2Z4H A;  1A15 A;  5CV7 A;  1QOH A;  5T1I A;  2NN6 I;  3KLS A;  2OTJ A;  2ZT9 C;  3I4L A;  3OIP A;  5M5W H;  4HJ8 A;  1XNR L;  2R7Z H;  4C3H G;  2AWO A;  1HNZ Q;  4JI5 Q;  1TT2 A;  3A7A B;  2XWB B;  2K01 A;  3PSI A;  1GUN A;  4P72 A;  5EQ0 A;  4P74 A;  4K8I A;  5EKK A;  1WFQ A;  1P16 A;  1CKO A;  1TWF B;  3ICE A;  1TR5 A;  4C3J H;  1W2B A;  3P1H A;  3CCL A;  3NE5 B;  1B8A A;  1KLU D;  1CK1 A;  4X66 Q;  4BBS G;  2R61 A;  4QB4 A;  3N52 A;  1B2T A;  1E22 A;  2GA4 B;  1EY7 A;  4DV5 Q;  1DCZ A;  2O5I C;  4N9P A;  5CGK A;  3U4Z A;  3P7J A;  4DV4 L;  3K0Y A;  2L55 A;  3PUV A;  3I73 A;  5IYD G;  4QQB X;  2DY8 A;  3TP7 A;  1QG7 A;  2PW5 A;  3H91 A;  4MHE A;  1KC8 C;  1EY5 A;  1E0B A;  1X32 A;  1BNZ A;  3PIP 3;  1BKB A;  2AQ2 B;  3HOW H;  1U4L A;  1AZP A;  1K83 H;  1WJJ A;  1LUZ A;  4HCE A;  4KKU A;  3HOZ H;  2EDG A;  4K0K L;  1WCM G;  2B63 B;  4HIO A;  3K59 A;  1OXV A;  1LTG D;  2YV5 A;  4TRD A;  3OOC A;  3PQI A;  5IY0 A;  3C1E A;  1CQV A;  3R93 A;  5IYB G;  5ISR A;  5C4X H;  1V43 A;  3R8B A;  1PH7 A;  1BUV T;  3I4M H;  3S2H H;  1SMX A;  3PIO A;  1SYE A;  1K3B C;  3G6E A;  2F4V L;  2F0O A;  3SK4 A;  4KJN A;  2I0Q A;  5ELC A;  3HRZ C;  1RTO A;  4DA2 A;  3S2D B;  2K52 A;  4JI1 Q;  2PI2 E;  1A3U A;  2A69 C;  1YEZ A;  4B9W A;  2EJM A;  1S5F D;  4DXG A;  1CHQ D;  3K0X A;  1H9S B;  4F8M A;  3K57 A;  3DXJ C;  4NKL A;  3NP8 A;  2HQL A;  3NPP A;  2EJG C;  3ITP A;  1SYD A;  4AYB G;  3SK5 A;  2J0T D;  2R6G A;  2XTI A;  4PG3 A;  3SK6 A;  4LFC Q;  3DWA A;  3KBX A;  2UUC Q;  3EVQ A;  3FPU B;  4YY3 L;  4TQU S;  2CWP A;  1TWC H;  1VS0 A;  2V4D A;  2VNU D;  3RUZ A;  4DAY B;  2KQ3 A;  4JK1 C;  2H5X A;  5FO7 B;  2SOB A;  1EIH A;  2SNM A;  1F9R A;  3U58 A;  4ULL A;  2XNA C;  4BY1 B;  1KLG D;  3AFP A;  3PCO B;  1F9P A;  5C4H A;  2BDN A;  3K5O A;  1HJP A;  4HJA A;  4A3K B;  1SBB B;  2NVY B;  3WOE A;  5F2D A;  1WTQ A;  4POF A;  2JP1 A;  1A62 A;  1CI3 M;  1J8I A;  3J81 L;  1EU3 A;  4L63 B;  2HCI A;  5IGD A;  1X3F A;  2PMZ E;  1N34 L;  5CBE E;  1KHI A;  3ER0 A;  4ZUJ A;  4ZYS A;  3S1Q H;  1U0L A;  3VYS A;  2F52 A;  4LUV A;  1PRT F;  1TU2 B;  3TZD A;  1MJC A;  2WAQ B;  5C5M A;  3JC6 6;  1V1P B;  3PO2 G;  1IBK Q;  3T53 B;  1I6H H;  2E5L L;  1SYF A;  1RF2 D;  2RHQ B;  4HTH A;  4RHR A;  4CJ2 C;  2KA7 A;  3KLR A;  2A1A A;  2V1C C;  2NZO A;  2UU9 Q;  3GTO H;  4KD4 A;  1HR0 Q;  4DV0 L;  1U4M A;  5KYL A;  1X9N A;  1EY6 A;  1HQM C;  4FP5 D;  1F2L A;  3IFT A;  4IQZ A;  1WYD A;  3HFZ B;  1D7Q A;  1PTO D;  5M5Y B;  2IJ0 A;  2ENB A;  1STE A;  3GTG B;  1Y8P B;  5G3L F;  1JB3 A;  4MZ9 A;  2R93 H;  4DU9 A;  1H9S A;  3KLS X;  3I8Z A;  4X65 Q;  3KUP A;  3BVZ A;  3S17 H;  1CSP A;  1VQ5 A;  1Z9F A;  1ENF A;  1TVX A;  2AHO B;  1TWH B;  2PW7 A;  2JA6 B;  2K6A A;  1J6Q A;  1F2M A;  3FPP A;  4KJO A;  4QUC A;  1L0Y B;  4EX5 A;  3KF8 B;  3KBG A;  1S5B D;  1VQ9 A;  1PDQ A;  3T51 B;  4DAY A;  3NXW A;  2G5D A;  2B29 A;  4A3F H;  2F0Q A;  1EOT A;  2EYO A;  2H1E A;  5LL6 X;  1XMO Q;  3J81 c;  4NXN Q;  3CF5 A;  4APV A;  2KCC A;  1NSN S;  3BU2 A;  3RLF A;  4CDC C;  1D6E C;  4ABN A;  4R4O A;  3EJI A;  4ZUI A;  4OX9 Q;  2JA7 B;  1HXY D;  1XNQ Q;  3F2C A;  3UDX A;  4DV7 L;  2IY5 B;  5J1Z A;  3CRK C;  4A3M H;  4DAM A;  2JA8 B;  1HHV A;  2A5H A;  1JT8 A;  1MGS A;  3ZJY C;  3S1R B;  4XYQ A;  2ZJP A;  2I46 A;  2EY5 A;  3L0O A;  4KV6 A;  2EYM A;  4A75 A;  3H3V H;  2K5N A;  5LMU L;  1DYQ A;  3G48 A;  5C3E H;  4UP9 A;  5FJ8 H;  1H9R A;  3K5L A;  1I5F A;  1EFI D;  1V1P A;  4A93 G;  1WTX A;  2NN6 H;  4FXG C;  3QB3 A;  4RGO S;  3RN2 A;  2PQA B;  2KCN A;  3OYY A;  3W5O A;  1LT5 D;  5DAU A;  2A6E D;  3OSO A;  4XTC S;  2B2U C;  4DR2 L;  1UAP A;  3UE0 A;  2F3W A;  1ZXT A;  1XMQ L;  1T5X D;  1CM9 A;  2LMC B;  3T4A C;  1HNW Q;  3MTS A;  4N8X 1;  5C0X G;  3HGB A;  5JEA G;  2CH4 A;  1BQQ T;  1V9P A;  2SNS A;  1I3Q B;  2L12 A;  5CYU A;  3RR5 A;  1YI2 A;  3FVQ A;  4K5X A;  3F8T A;  3T1H L;  1N34 Q;  3F2U A;  2K5V A;  1PTO C;  2SEB D;  2F3V A;  1WTV A;  5C44 B;  4DK6 C;  2EE1 A;  4ZLT F;  4IN3 A;  1TWF H;  4K14 A;  4H13 C;  2KHJ A;  2SDF A;  1PVO A;  1O7I A;  1EQQ A;  4DV3 L;  2F0K A;  3PGZ A;  5EPK A;  4UHV A;  3F2D A;  3ZYY X;  2O2L D;  4FVM A;  2J7Z A;  1QVF A;  3KF8 A;  3CPF A;  1GO3 E;  1N33 L;  4JI0 Q;  3E6Z X;  2JEB I;  1CZG A;  2MJ8 A;  2R93 G;  3A8K E;  4LMQ D;  5CV5 A;  1UEA B;  1KNA A;  4QL5 A;  4JI2 L;  4LFB L;  3OTO Q;  1L2F A;  1SSO A;  1II3 A;  3M7G A;  1PA6 A;  1LTB D;  2EY1 A;  2B63 H;  2CQO A;  3RZD B;  2B8F A;  4EGV A;  1RL2 A;  3QO2 A;  4MTK A;  1LTA D;  1C0A A;  4DV6 L;  1FJG L;  1G91 A;  4QY7 A;  2NVX B;  2WFW A;  2LKV A;  3VYR A;  1AP0 A;  4IPD A;  2JYO A;  1Q8I A;  3FKI B;  3LX0 A;  3G4S A;  1UNS A;  1LAB A;  4CKE A;  4LF9 Q;  1G6P A;  3M3Y B;  1E2Z A;  3UE1 A;  3X3N A;  1A2T A;  5K36 G;  3GP7 A;  3CMA A;  4GKJ Q;  1YJN A;  1F2Y A;  3JAM L;  3TME A;  3J7Y W;  2PQA A;  3S2D H;  3I4N G;  4B9X A;  4DV2 L;  4IFD H;  2E8G A;  4P71 A;  1QJO A;  5GAH C;  4NPS A;  1EWI A;  4NMZ A;  1K0R A;  3C2P A;  4KHP L;  4HAE A;  1EQR A;  1K3R A;  5JJI A;  4QF4 A;  3CCU A;  2OXP A;  1ENC A;  3S1M B;  4FF2 A;  4A3D B;  2UXD Q;  4DK1 A;  4EQP A;  1EYC A;  4LK1 C;  1I94 Q;  1NMF A;  1ONL A;  4OWW B;  2L9H A;  3HZX A;  1EYG A;  2MFI A;  3BYY B;  5EJW A;  1OTC A;  1JOR A;  4DR6 L;  2Q8R E;  3H0G B;  4BY1 H;  4X64 Q;  4A3B H;  2PQE A;  4V19 0;  5M9O A;  2Y0S E;  4A3L G;  5M3M G;  2F0P A;  3TN2 A;  1GUT A;  3TBI B;  4RG1 A;  1VMC A;  4WFN 3;  4CGY B;  5H1S E;  2NVY H;  3AFQ A;  5IP9 G;  3SDZ A;  1YNN D;  1SR3 A;  1O7Z A;  1PH1 A;  3VYT A;  3G71 A;  1SFO B;  4DR4 Q;  1GUW A;  1VQI A;  2HDM A;  3DHQ A;  4JV5 Q;  4DR2 Q;  3DUZ A;  3Q8D A;  3HKZ B;  4FNF A;  1DXM A;  5LMN Q;  1VQM A;  2NBF A;  5E3F A;  4GLV B;  3VDY A;  3QOJ A;  5A2Q E;  4IUV A;  1B44 D;  1SNM A;  5GAD C;  2C35 B;  4ZKB B;  4OL7 A;  2F0L A;  2ZXR A;  1K8G A;  1E24 A;  3AYH B;  4BXX G;  3G6J B;  3JAM c;  2WAQ E;  3KJO A;  1ZYR C;  2QKI C;  3BS1 A;  2Z6B A;  1WOC A;  2L5T A;  4U68 A;  2UXB Q;  2YTY A;  1TKW B;  1PFB A;  1YIJ A;  1LT3 D;  4ODG A;  4G4K A;  1HNZ L;  4JI5 L;  3EFX D;  2IPK D;  1I4X A;  3MVV A;  1C8C A;  1X55 A;  2GVA A;  1VQP A;  3J7A F;  3AMU A;  2ES2 A;  3SXH A;  5M5Y H;  1X3G A;  2HIV A;  3NWT A;  1LTS D;  3GTG H;  1YHB A;  4CHT B;  4KMU C;  4LJZ C;  1DZ1 A;  1P8L A;  4P2C B;  3FDT A;  1MIU A;  1L0W A;  2IHE A;  4CJ1 B;  3V05 A;  3TQY A;  1VQL A;  1Q81 C;  5LL6 S;  2RDF A;  4DV5 L;  1TWH H;  4FO2 A;  2JA6 H;  5D3I B;  1IBL Q;  3NEN A;  4ID6 A;  4WOR A;  1B53 A;  3FRP B;  1IZ6 A;  2MQH A;  3R2T A;  4R4T A;  2PZT A;  4IFD G;  2B2V C;  4K8J A;  5M3F B;  1JIC A;  1RD9 D;  1QNK A;  3V2T A;  3OMG A;  1M8A A;  3L2P A;  5EBD A;  4U67 3;  2R92 G;  3HOX G;  3CQZ H;  3VR3 A;  4OO1 H;  4HCS A;  2D5D A;  4X6A H;  2HHH Q;  4OHJ A;  1EY8 A;  3R2I A;  1TS5 A;  1AN8 A;  5FLX E;  2K05 A;  1UE7 A;  1YNN C;  1VQK A;  4RH6 A;  4RAU C;  1VQN A;  1J9O A;  4IPC A;  4DK0 A;  1CQF A;  1EIF A;  1HCZ A;  4C2M B;  1YNJ D;  1C7Y A;  1AE3 A;  1NY4 A;  4O2D A;  1VQ4 A;  3UI2 A;  1PRT D;  1W6J A;  3RN5 A;  2RF4 A;  4JI1 L;  1VQ6 A;  4N9T A;  1DOK A;  5DEH A;  3UDF A;  4C3I B;  4GLA C;  4L5Q A;  4EQO A;  2VUM G;  2O4X A;  4L6T B;  3I70 A;  3MWY W;  1Y1V G;  2R7D A;  1PLF A;  1SNP A;  4FDB A;  4LFC L;  2LXK A;  4C56 C;  3EIV A;  1YJ9 A;  1T5E A;  2B39 A;  4JBW A;  2IX3 A;  2UUC L;  4BBR G;  1WD1 A;  1QWY A;  2DNE A;  2XWJ B;  3S16 B;  4JI8 Q;  1SLJ A;  2JEA I;  1IBM Q;  3M85 A;  1CZW A;  2JXM B;  5DNF A;  3Q23 A;  1PH5 A;  3RMH A;  4BA1 I;  1MSH A;  1K8O A;  4BY7 G;  3NSW A;  1PTO B;  2MHV A;  1ROD A;  1TY0 A;  5C44 H;  5G3L D;  4IJL A;  2F0N A;  3GTJ H;  3K81 C;  1EYD A;  1CA5 A;  3HOU B;  4DGZ A;  5T1G A;  4IAL A;  1NBW A;  4L5S A;  1K8M A;  3W1G A;  4JBK A;  1HRJ A;  2F0G A;  3ULP A;  1LM0 A;  3I4N B;  1UWV A;  1TWA B;  1Y69 U;  1YVC A;  1GD7 A;  1XXG A;  1G29 1;  1VQA A;  3PUZ A;  2PCF B;  3SGI A;  3OMC A;  4A3G B;  4F87 A;  1H9M A;  3EA6 A;  3CC4 A;  3CP0 A;  1A6X A;  1Y1W H;  2UXC Q;  4RA8 A;  5EPJ A;  2Q2I A;  4KD3 A;  2FHT A;  1L1O C;  1H9K A;  3F1Z A;  3SK8 A;  1CT1 D;  1WTR A;  5JJL A;  1CKM A;  3TP5 A;  2F4I A;  1HR0 W;  4ZRZ A;  1IBK L;  1B1Z A;  3CAM A;  3RZD H;  3PO3 H;  4JW0 A;  1EZ6 A;  2D0O A;  1Q1B A;  2HIX A;  1MKH A;  2NVX H;  4R1J A;  2UU9 L;  1HR0 L;  1YBY A;  1RIP A;  3TRZ A;  1JWU D;  1RTN A;  2NTT A;  1QCB D;  1UE5 A;  2FXQ A;  5IYC G;  1GKH A;  3HOV H;  3HKS A;  2G9D A;  4OO1 G;  4FF3 A;  2E2I B;  2LSS A;  2EYH A;  1V1Q A;  5COY A;  5AJ3 Q;  3C46 A;  4FF1 A;  3M3Y H;  3NQI A;  2EYJ A;  5CV8 A;  4OIJ A;  1GUS A;  2JA5 B;  5IIF A;  4IO9 A;  5IE8 A;  4HMJ A;  3KFU A;  1PRT C;  3AU7 A;  4X65 L;  5IT9 L;  5DLQ E;  1J5E Q;  4YWM A;  1VQF A;  1JJC B;  2B2U A;  2MNA A;  4PZ7 A;  3A5Z B;  1BCP F;  1CTM A;  3QG1 A;  1LT6 D;  1E2V A;  1S72 A;  1S3O A;  1SXT A;  4HSP A;  2K5D A;  3U9O A;  4B3S Q;  3SR1 A;  4R8I A;  4A3C H;  4A3D H;  4XIG S;  4X3K A;  1EQV A;  1TII D;  1IYV A;  1XMO L;  3I7F A;  4NXN L;  1C9O A;  3K8A A;  2Z0S A;  3ND9 A;  5ELF A;  1GHJ A;  2IW3 A;  3H0G H;  3CCE A;  3EQL C;  1QB5 D;  3FHW A;  4R9W A;  1STG A;  2XRS D;  4DXF A;  2D0P A;  2OCE A;  4OX9 L;  4GZY C;  2CWA A;  2PZU A;  2QA4 A;  1XNQ L;  3W2D A;  3BYT B;  4IZ8 A;  3S15 B;  2WB1 E;  4M8A A;  3HOY G;  2ZJQ A;  2KEE A;  1SFO H;  2IHF A;  4YWK A;  3MEH A;  2YTX A;  5KYI A;  5ELB A;  1FNU A;  5ELO A;  2IWH A;  1N36 Q;  2MO0 A;  3J7A V;  3J81 j;  2RKS A;  4A3E B;  2WIN B;  4F88 A;  4FYD A;  1CHP D;  1X6O A;  3AQQ A;  1SYG A;  2ZJR A;  4V0B A;  2NVQ B;  1BXT A;  3SHL A;  1KNE A;  3AEV A;  3DM3 A;  1BR9 A;  4JOI C;  3C1F A;  1EY4 A;  1SYB A;  3A5U A;  2IL8 A;  1GM5 A;  3G7L A;  2B2T C;  5IT9 c;  3GTM H;  2R7Z G;  2Z9H A;  4XT3 B;  4B3T Q;  1S5E D;  1B3Q A;  1FYC A;  1HNW L;  1ASZ A;  1G2S A;  4OIK A;  2N55 A;  3K7U C;  4I7A A;  2F03 A;  5HGT A;  2Z6K C;  4AQY Q;  3RLO A;  4C3J G;  3D8G A;  2JK8 A;  2HQE A;  2PNR C;  2PZW A;  4QJF A;  1T9H A;  4OEM B;  1F9S A;  1DJR D;  1KRT A;  1C4Q A;  3TDQ A;  1TQO A;  2EYP A;  4TSS A;  4FXD A;  4A3I H;  1BDO A;  2VUM B;  4JI0 L;  4PNY A;  3CRL C;  4XQJ A;  4A3J B;  4DNI A;  3HOW G;  1PXU A;  1H95 A;  2A19 A;  5M3F H;  3HOZ G;  1SDF A;  1VQH A;  4BBR B;  3OTO L;  3CC7 A;  4I7Z C;  2A68 D;  4LF8 L;  3MXG A;  3D31 A;  1VQG A;  4NXM Q;  2D2C C;  1A3T A;  2K1B A;  2RBM A;  1JC7 A;  1PH9 A;  4X62 Q;  2CCZ A;  2RCF A;  1C48 A;  1G2T A;  2LY7 A;  2K75 A;  5C4X G;  2QDB A;  1EY9 A;  1TXY A;  4MTN A;  5I4D A;  3Q0A A;  3I4M G;  2ICI A;  1Y8O B;  3L3O C;  2B2W A;  1EIG A;  5CV9 A;  1XYI A;  1GUG A;  3M4Q A;  1IYU A;  3A54 A;  4LF9 L;  4KHV A;  5BN4 A;  1VQE A;  5D3D A;  5E1F A;  4GN3 B;  3VA7 A;  4GKJ L;  1HNX Q;  3NBH B;  2JJQ A;  1I4R A;  4HJ7 A;  4G7O C;  4UDU C;  4A4I A;  1YJW A;  4GKK Q;  1Q3L A;  2BE5 D;  4JI4 Q;  4C3H B;  3ULJ A;  2ALY B;  4B3R Q;  4O1N A;  4UP8 A;  2GN5 A;  2PPB C;  2B2Y C;  1Z47 A;  1BOS A;  1HTP A;  2KCT A;  4QUF A;  1PFM A;  2ZTC A;  5D14 A;  2UXD L;  2QF7 A;  1I94 L;  2E2H H;  3S16 H;  4BBS B;  4LFA Q;  4DFA A;  3D0F A;  4J8Q A;  3ND8 A;  3MXN B;  4JCV E;  1QE6 A;  3N6R A;  4ZAI A;  4X64 L;  3CCR A;  3CD6 A;  4GOP C;  5J22 A;  5HUR A;  4BA2 I;  5EKI A;  3U9S A;  3HOU H;  1STA A;  1UEB A;  3J80 L;  1X56 A;  4P75 A;  5LMN W;  4GNX C;  4JPB W;  3KF6 B;  1JE4 A;  2MUY A;  3T1Y Q;  3I4O A;  5FLM H;  4DR4 L;  2L1B A;  4OXP A;  1HA6 A;  4G7Z C;  2RDH A;  4JV5 L;  1TY2 A;  2B2V A;  2CQA A;  1WCM B;  4A3G H;  2HCC A;  1LV9 A;  2N88 A;  5LMN L;  3GTK B;  1EUJ A;  2F0T A;  1RKN A;  2XSC A;  1L1O B;  2F0H A;  4HSV A;  3GTL B;  2Q2H A;  3H94 A;  5I2X A;  1GVP A;  1ET9 A;  1XPR A;  1O80 A;  5EPL A;  5A2Q L;  5JPN C;  4LF5 Q;  3M4P A;  3PF4 A;  3IAY A;  2K04 A;  2Q2U A;  2N8N A;  3J81 E;  4DR7 Q;  1RCV D;  5I6W A;  1VQB A;  2NWG A;  5JOB A;  3E5S A;  1F77 A;  2F0F A;  1YNX A;  2UXB L;  1LLR D;  1VF7 A;  3DMU A;  2C5C A;  4IUU A;  4DR3 Q;  1ILP A;  3CCV A;  2K5W A;  1IYJ B;  5EGT A;  1X65 A;  2AUJ D;  2LXJ A;  4RGN A;  5C0X J;  1DD2 A;  4PMB A;  3NBH A;  3H3V C;  5JEA J;  4PZ8 A;  4DUY Q;  3RZO B;  4AYB B;  3E9I A;  2WP8 J;  5JVH 3;  2JA5 H;  1L0X B;  4A76 A;  2Q8T A;  1F2Z A;  4N8F A;  3J81 i;  1PRT B;  1Z6H A;  3K7A B;  4LF8 Q;  5BR8 Q;  1IXR A;  1M4V A;  2OWO A;  4UPA A;  2F3I A;  2BE5 C;  1B9M A;  1FL0 A;  2KCM A;  1IKM A;  3MC0 B;  4A3F G;  4QGU A;  1IBL L;  2NZH A;  3A8J E;  1QZG A;  3J80 c;  2KEN A;  1AFP A;  1JMC A;  1NR2 A;  2ATW A;  4OEL B;  1JJG A;  2JA8 H;  4NDX A;  3MXN A;  2R7Z B;  1E1T A;  3M7N A;  2IX0 A;  1VCI A;  2YTV A;  3H09 A;  1NJI C;  4JBJ A;  1D5X C;  1O7Y A;  1KDB A;  2FMM A;  5IGE A;  4R8N A;  3I72 A;  4TKO B;  4X3T A;  2VQF Q;  1CKN B;  1M90 C;  2A6H D;  4JI7 Q;  3J7A 5;  2HHH L;  4XXE A;  4JYA Q;  4A3M G;  3KF6 A;  2UUA Q;  2OT2 A;  3S15 H;  3TSS A;  1TWG B;  4Z9C B;  2L4N A;  1GOZ A;  1NAP A;  5IP7 H;  5C3E G;  3PUX A;  2A6E C;  3PO2 B;  3U4V A;  5FJ8 G;  3FP9 A;  4GLX A;  2EVB A;  5FLX L;  1L1O A;  3NUC A;  1JQY D;  2NN6 G;  4A3E H;  1WTO A;  1VDZ A;  2IT1 A;  1VQD A;  3CCQ A;  2F0M A;  3HOW B;  2E2J B;  3DLL A;  5C4J B;  4LNQ A;  3A8I E;  2DNC A;  2NVQ H;  4FF4 A;  2DUD A;  2XIW A;  1E3P A;  1GUO A;  1B9N A;  3A56 A;  3CPW A;  2FFK B;  5IGB A;  3A74 A;  2RSN A;  3A55 A;  4A3K H;  2CKZ B;  2TMP A;  2MPM A;  4IJH A;  1XPU A;  1LYL A;  2CHB D;  3AB9 A;  3BJU A;  4JI8 L;  3OWF A;  1IBM L;  2WKD A;  2HD3 A;  5A35 A;  2G9H D;  3BVM A;  1I4Q A;  1JWM D;  4HED A;  3K58 A;  4NP5 A;  3HS0 C;  1FGB D;  1SEB D;  4IPH A;  4E6I A;  5M5X B;  4R4I A;  3W1B A;  1PYS B;  2H4O A;  3TRE A;  4LF7 Q;  1Z7T A;  1SE4 A;  4OWX B;  2VB3 X;  2RCN A;  4JG2 A;  1OO9 B;  1BCP D;  1LTT D;  3DEO A;  5JAV A;  5FO9 B;  4JC0 A;  3K6O A;  4C1N K;  3CXC A;  4A3J H;  1PH2 A;  3PUW A;  1JWS D;  2UXC L;  1K0S A;  4DF7 A;  1HTL D;  3D3R A;  1QVC A;  1N8R C;  4CKC A;  3CU7 A;  1CA6 A;  2QW7 A;  3ERS X;  3ERQ A;  1HZA A;  3DM1 A;  3OHX C;  2B63 G;  5KRU A;  1Q46 A;  1CKN A;  5FLX c;  5J39 A;  4LF4 Q;  1R9T B;  2Z1C A;  1QZH A;  3CCM A;  1UE6 A;  4HJ5 A;  4DAV A;  4DNR B;  2PMZ B;  4BWG B;  4A93 B;  1PHJ A;  1GXD C;  2F0I A;  1VQC A;  3MFY A;  1KXL A;  4RKL A;  5AJ3 L;  1E1O A;  1EU4 A;  3LWU A;  3ERO A;  2X6G A;  2FMC A;  4X3S A;  1VQ7 A;  2QDL A;  4DPG A;  3I56 A;  3WWV A;  3PMF A;  1A2U A;  3UDG A;  1J5E L;  2DY7 A;  4C3H H;  4B3M Q;  1I6H B;  1HUN A;  1X54 A;  3DWP A;  2B2T A;  4PV1 C;  4HIK A;  1AE2 A;  1PH8 A;  1CSQ A;  3GTQ B;  2JA7 H;  4B3S L;  3D4W A;  4YHH Q;  2Y0S G;  5C0X I;  4BBS H;  1XTD A;  4CJ0 B;  3KLW A; 
#chains in the Genus database with same CATH homology
 3TP8 A;  4KY5 A;  1MD2 D;  3GO5 A;  3MAQ A;  2EZV A;  5IGC A;  2R93 B;  2VXW A;  3D6W A;  4ZK9 B;  5C3X A;  3S17 B;  3PIO 3;  1WD0 A;  3I90 A;  2KED A;  1MBY A;  4RWS C;  2D9U A;  1BCP C;  3T13 A;  2RQX A;  3CKI B;  2XN9 C;  5CR3 A;  1SNO A;  1EYA A;  2ID0 A;  1KDC A;  3T56 B;  3DWQ A;  3MXU A;  3BVG A;  2RDG A;  2DN8 A;  1F9Q A;  1U4R A;  1PMR A;  1TS3 A;  3BZD B;  2F0J A;  2RA4 A;  4IUQ A;  2NZ1 D;  4ILW A;  4B08 A;  1G6Z A;  3S14 B;  2L0C A;  3URY A;  3VYU A;  1U4P A;  5C3E B;  3QIA A;  4XT1 B;  5I9P A;  3S9W A;  4K5W A;  1SNC A;  2A69 D;  5TSS A;  4FXK C;  2B2Y A;  3GV6 A;  3Q22 A;  3VR4 A;  2LFN A;  1NR4 A;  1BO0 A;  5FOB B;  4Q5V A;  4X3U A;  1AEX A;  2J4X A;  5M3M B;  3I3C A;  2XVS A;  5D65 A;  2NUC A;  4QMG A;  2F0V A;  1ILQ A;  2AWN A;  2QEJ C;  1YNJ C;  3K5M A;  5IOD A;  3PUY A;  3P75 A;  2F0D A;  3K5N A;  4K5V A;  2BA1 A;  3C3L A;  1JOK A;  3LWE A;  2ZXP A;  1EWH A;  3I91 A;  1SNQ A;  2KJX A;  2R3Z A;  4IUT A;  2BA0 A;  2MGS A;  1U9R A;  4DN4 M;  1ZEQ X;  4K2K A;  2EYL A;  1LTI D;  1D1I A;  1KAA A;  2K5Q A;  2JE6 I;  2EOT A;  2CW0 D;  2X69 A;  5DM6 3;  4PMC A;  4EVO A;  1AZQ A;  2K33 A;  4RKB A;  4K6D A;  2BCO A;  3X3M A;  1XTC D;  3GD7 A;  1I4G A;  2KEC A;  1D5Z C;  2A73 B;  2YU9 B;  2MP1 A;  1DM0 B;  3VR6 A;  3HP3 A;  4IUP A;  2R92 B;  3HOX B;  4M1U B;  5IGG A;  4IFD I;  1RJT A;  4ME5 A;  3ONA B;  4QIW B;  4EQN A;  1I50 B;  2EY2 A;  1JCK B;  2Y0S B;  3GTP B;  1STY A;  5ELE A;  4A3B B;  5KIX A;  3NBI A;  2E75 C;  1GHK A;  2D62 A;  3QOL A;  2C9O A;  1EEI D;  2ZXO A;  1B50 A;  5E4W C;  3O13 A;  1VF5 C;  1R4P B;  4Q0F A;  3FMC A;  4F7X A;  1IKL A;  4Y7N B;  1Y1V B;  2AQ1 B;  3MXP A;  4UAI A;  4BS9 A;  5BN3 A;  1QNU A;  1I6V C;  1S4Z A;  3LNN A;  2E2D C;  1EZ8 A;  5C0X H;  5EKL A;  4RFB A;  2E76 C;  5JEA H;  2BOS A;  2CW0 C;  4BY7 B;  3DEP A;  5KNC A;  4J1M A;  2XRQ D;  1Q1E A;  5ELD A;  2RSO A;  5IT9 E;  4RGM A;  2PO4 A;  4OGQ C;  3NTH A;  4HN7 A;  3IFD A;  1QIL A;  2BDO A;  4WJW A;  5C3W A;  3VR5 A;  1SJH D;  2FJ2 A;  2QCP X;  1S5D D;  3S1N B;  1BCP B;  2WKC A;  4DAP A;  2K32 A;  2KHS A;  2QIL A;  4K2L A;  1W6K A;  5I6Y A;  1R4Q B;  1X3Q A;  2A74 C;  2EYF A;  4DNT B;  3A7L A;  1DOL A;  3BDC A;  3CQZ B;  2KUM A;  3L7Z C;  1PTO H;  1Q12 A;  1STN A;  1I4H A;  1IL8 A;  1PZK D;  5K36 H;  5FKA C;  1EWC A;  2F1M A;  1WTW A;  2EXZ A;  1XWE A;  2M00 A;  2O5J C;  2F0S A;  1ENA A;  4OO1 I;  2NVT B;  5IGF A;  3VR2 A;  3RD4 A;  1KTK A;  4LAA A;  1FNV A;  1BF4 A;  4J6H A;  2NYZ D;  2A68 C;  5C4Z A;  5JJZ A;  1S5C D;  3M4Y A;  1STH A;  5JVG 3;  4KKT A;  1PYW D;  1D5M C;  2M9V A;  3M4O B;  5I9O A;  4G57 A;  4KHZ A;  4L8J A;  5CC4 A;  1KAB A;  2KOL A;  1OXT A;  3V96 A;  1IHZ A;  1NCV A;  2ICE C;  2F0E A;  3FEW X;  3HOY B;  3IL8 A;  1SMY D;  5KNB A;  3QJY A;  2VB2 X;  3OW7 A;  4KY6 A;  5LHY 1;  3BG3 A;  4RCO A;  3GTJ B;  5K5P A;  1HQR D;  3D4D A;  1TS2 A;  2K03 A;  4IUR A;  1HFG A;  3T16 A;  1Y1W B;  2B8G A;  2PYK A;  3VA5 A;  4C3I G;  5M5W B;  4QCL A;  1RDP D;  2M2L A;  2NB0 A;  1Q90 A;  4PQX A;  4H7B A;  1PZJ D;  3PO3 B;  1ZYR D;  4C3J B;  5BN5 A;  1IW7 D;  4O42 A;  2EJF C;  1FNW A;  5C5L A;  3Q24 A;  1Y8N B;  5EBC A;  1WTP A;  1BBX C;  3HOV B;  3D4R A;  1ET6 A;  4KKS A;  3MZ5 A;  1DOM A;  4MIU A;  1K83 B;  3MA2 B;  5IOC A;  3WDN A;  3HOZ B;  2EY6 A;  1JOQ A;  1SND A;  1V1O A;  2Z8L A;  2F0U A;  2JSO A;  2CVR A;  1VMP A;  2NTS A;  3H6M A;  5C4X B;  4KTA A;  1NUC A;  5I2Y A;  3MFG A;  2HDL A;  1SE3 A;  3NWS A;  3I4M B;  3S2H B;  5AFW A;  2K28 A;  3IKJ A;  3J80 E;  4HMI A;  1PTO F;  1SMY C;  4I65 A;  2WB1 B;  4G7H C;  2HUG A;  1SJE D;  4ZQ3 A;  1HA5 A;  3NQT A;  5COR A;  2F0W A;  3SVM A;  3D6C A;  2Q8I B;  2WII B;  2TSS A;  3NTK A;  1O78 A;  2WAC A;  2B2W C;  5NUC A;  3MHB A;  2E74 C;  1DON A;  5KGU A;  5KND A;  4RCN A;  1UUP A;  1ICW A;  1TWC B;  5FK9 C;  1X3P A;  1D1K A;  4H44 C;  2K7V A;  1O7L A;  1MI2 A;  1PFN A;  2RVL A;  3OPO A;  4H0L C;  1GJX A;  2OF1 A;  1MSG A;  1I4P A;  3PV0 A;  4HR7 B;  1FR3 A;  2A6H C;  3GTM B;  2AUK A;  1IW7 C;  2YYZ A;  2WV6 D;  3QWN A;  1OXU A;  4XQQ A;  1OXX K;  1PZI D;  3TZU A;  4S3S A;  3L9A X;  3HEJ A;  3S1Q B;  4IUN A;  3TP6 A;  1LAC A;  2AQ3 B;  2Z4I A;  1B3A A;  4PMW A;  2IX1 A;  1HUM A;  2EPB A;  1SAP A;  4MN3 A;  4RGT A;  4CKB A;  1STB A;  4XYO A;  4YIJ A;  1JOO A;  4A3I B;  4KI0 A;  1FD7 D;  1EY0 A;  1HFN A;  1AW7 A;  1XX8 A;  2LS0 1;  3E0J A;  5JPM C;  3GTO B;  3Q6S A;  3WOF A;  5CV4 A;  4KN7 C;  5CV6 A;  4KK7 A;  3JAM E;  1ESF A;  4IFD J;  1D2B A;  3SE0 A;  1ML0 D;  1H9J A;  3NK9 A;  4ZKC B;  2L11 A;  4KY7 A;  5E4X A;  1A3V A;  4CBV A;  5CBA E;  1EL0 A;  3R3O A;  4K6L A;  4XQN A;  4XDX A;  1EEF D;  1V8Q A;  3OWE B;  3P20 A;  1RHP A;  4A3F B;  4RHS A;  3BDO A;  1LO5 D;  1CFM A;  3BDL A;  1B4O A;  3NHH A;  1TS4 A;  5C6A A;  1SYC A;  3W3A A;  1HPC A;  1LT4 D;  1LTR D;  1OXS C;  1E2W A;  1KDA A;  3HG9 A;  3OIQ A;  1WVL A;  5KEE A;  2KVM A;  2OEO A;  4KN4 C;  2E2H B;  1EQT A;  4A3M B;  3GQB A;  5DM7 3;  2FIN B;  1ESR A;  4C1N I;  1SE2 A;  5CMD A;  3KK7 A;  1G8Z D;  3SEB A;  1JR0 D;  4NW2 A;  4WRD A;  1ZKO A;  5FO8 B;  3NTI A;  3CHB D;  2I07 B;  3GV3 A;  2X6L A;  2Z4H A;  1A15 A;  5CV7 A;  5T1I A;  1QOH A;  2NN6 I;  3KLS A;  2ZT9 C;  3I4L A;  3OIP A;  4C3H G;  2AWO A;  1TT2 A;  3A7A B;  2XWB B;  2K01 A;  1GUN A;  5EQ0 A;  4K8I A;  5EKK A;  1TWF B;  1TR5 A;  3P1H A;  3NE5 B;  1KLU D;  1CK1 A;  2R61 A;  4QB4 A;  3N52 A;  1B2T A;  2GA4 B;  1EY7 A;  1DCZ A;  2O5I C;  4N9P A;  5CGK A;  3P7J A;  3K0Y A;  2L55 A;  3PUV A;  3I73 A;  2DY8 A;  3TP7 A;  1QG7 A;  2PW5 A;  3H91 A;  4MHE A;  1EY5 A;  1E0B A;  1X32 A;  1BNZ A;  3PIP 3;  2AQ2 B;  1U4L A;  1AZP A;  4HCE A;  4KKU A;  2EDG A;  2B63 B;  3K59 A;  1OXV A;  1LTG D;  4TRD A;  3OOC A;  3C1E A;  1CQV A;  3R93 A;  5ISR A;  1V43 A;  3R8B A;  1BUV T;  1SYE A;  2F0O A;  3SK4 A;  4KJN A;  5ELC A;  3HRZ C;  1RTO A;  4DA2 A;  3S2D B;  1A3U A;  2A69 C;  4B9W A;  2EJM A;  1S5F D;  4DXG A;  1CHQ D;  1H9S B;  4F8M A;  3K57 A;  3DXJ C;  4NKL A;  3NP8 A;  3NPP A;  2EJG C;  3ITP A;  1SYD A;  3SK5 A;  2J0T D;  2R6G A;  3SK6 A;  3DWA A;  3KBX A;  3EVQ A;  3FPU B;  4TQU S;  2V4D A;  2VNU D;  3RUZ A;  2KQ3 A;  4JK1 C;  5FO7 B;  2SOB A;  1EIH A;  2SNM A;  1F9R A;  4ULL A;  2XNA C;  4BY1 B;  1KLG D;  1F9P A;  5C4H A;  2BDN A;  3K5O A;  4A3K B;  1SBB B;  2NVY B;  3WOE A;  5F2D A;  1WTQ A;  2JP1 A;  1CI3 M;  1J8I A;  3J81 L;  1EU3 A;  4L63 B;  2HCI A;  5IGD A;  5CBE E;  4ZYS A;  4ZUJ A;  3VYS A;  1PRT F;  1TU2 B;  3TZD A;  2WAQ B;  5C5M A;  1V1P B;  3T53 B;  1SYF A;  1RF2 D;  4HTH A;  4RHR A;  4CJ2 C;  2KA7 A;  3KLR A;  4KD4 A;  1U4M A;  5KYL A;  1EY6 A;  1HQM C;  4FP5 D;  1F2L A;  3IFT A;  4IQZ A;  1PTO D;  5M5Y B;  2IJ0 A;  2ENB A;  1STE A;  3GTG B;  1Y8P B;  5G3L F;  1JB3 A;  4DU9 A;  1H9S A;  3KLS X;  3I8Z A;  3KUP A;  3BVZ A;  1ENF A;  1TVX A;  1TWH B;  2PW7 A;  2JA6 B;  2K6A A;  1F2M A;  3FPP A;  4QUC A;  4KJO A;  1L0Y B;  3KBG A;  1S5B D;  1PDQ A;  3T51 B;  4DAY A;  3NXW A;  2F0Q A;  1EOT A;  2EYO A;  2H1E A;  5LL6 X;  2KCC A;  1NSN S;  3RLF A;  1D6E C;  4ABN A;  3EJI A;  4ZUI A;  2JA7 B;  1HXY D;  5J1Z A;  3CRK C;  2JA8 B;  1HHV A;  2A5H A;  1MGS A;  3S1R B;  4XYQ A;  2I46 A;  2EY5 A;  4KV6 A;  2EYM A;  1DYQ A;  1H9R A;  3K5L A;  1EFI D;  1V1P A;  1WTX A;  2NN6 H;  4FXG C;  3QB3 A;  4RGO S;  2KCN A;  1LT5 D;  5DAU A;  2A6E D;  3OSO A;  4XTC S;  2B2U C;  1UAP A;  2F3W A;  1ZXT A;  1T5X D;  1CM9 A;  2LMC B;  3T4A C;  3MTS A;  5C0X G;  3HGB A;  5JEA G;  1BQQ T;  2SNS A;  1I3Q B;  2L12 A;  5CYU A;  3FVQ A;  4K5X A;  3F2U A;  1PTO C;  2SEB D;  2F3V A;  1WTV A;  5C44 B;  2EE1 A;  4ZLT F;  4IN3 A;  4K14 A;  4H13 C;  2SDF A;  2F0K A;  5EPK A;  3ZYY X;  2O2L D;  4FVM A;  2J7Z A;  3KF8 A;  3E6Z X;  2JEB I;  1CZG A;  2MJ8 A;  3A8K E;  4LMQ D;  5CV5 A;  1UEA B;  1KNA A;  1SSO A;  1II3 A;  3M7G A;  1LTB D;  2EY1 A;  3RZD B;  2B8F A;  4EGV A;  3QO2 A;  1LTA D;  1G91 A;  2NVX B;  2LKV A;  3VYR A;  1AP0 A;  2JYO A;  1Q8I A;  3FKI B;  3LX0 A;  1UNS A;  1LAB A;  4CKE A;  3M3Y B;  1E2Z A;  3X3N A;  1A2T A;  5K36 G;  3GP7 A;  1F2Y A;  3JAM L;  3TME A;  3J7Y W;  4B9X A;  4IFD H;  1QJO A;  4NMZ A;  3C2P A;  4HAE A;  4QF4 A;  2OXP A;  1ENC A;  3S1M B;  4FF2 A;  4A3D B;  4DK1 A;  4EQP A;  1EYC A;  4LK1 C;  1ONL A;  2L9H A;  3HZX A;  3BYY B;  5EJW A;  1JOR A;  2Q8R E;  3H0G B;  2PQE A;  4V19 0;  5M9O A;  2F0P A;  3TN2 A;  1GUT A;  3TBI B;  1VMC A;  4WFN 3;  4CGY B;  3SDZ A;  1YNN D;  1O7Z A;  1GUW A;  3VYT A;  1SFO B;  2HDM A;  3DHQ A;  3DUZ A;  3HKZ B;  4FNF A;  1DXM A;  2NBF A;  5E3F A;  3QOJ A;  5A2Q E;  4IUV A;  1B44 D;  1SNM A;  4ZKB B;  4OL7 A;  2F0L A;  2ZXR A;  3G6J B;  1ZYR C;  2QKI C;  3BS1 A;  2L5T A;  4U68 A;  1TKW B;  1PFB A;  1LT3 D;  4ODG A;  4G4K A;  1C8C A;  3EFX D;  2IPK D;  1I4X A;  3MVV A;  3J7A F;  3AMU A;  3SXH A;  3NWT A;  1LTS D;  4CHT B;  4KMU C;  4LJZ C;  1DZ1 A;  4P2C B;  3FDT A;  4CJ1 B;  3V05 A;  5LL6 S;  2RDF A;  4FO2 A;  5D3I B;  4ID6 A;  4WOR A;  1B53 A;  3FRP B;  3R2T A;  2PZT A;  4IFD G;  2B2V C;  4K8J A;  5M3F B;  1JIC A;  1RD9 D;  1QNK A;  3V2T A;  3OMG A;  1M8A A;  5EBD A;  4U67 3;  3VR3 A;  4OO1 H;  4HCS A;  2D5D A;  4OHJ A;  1EY8 A;  3R2I A;  1TS5 A;  1AN8 A;  5FLX E;  2K05 A;  1YNN C;  4RH6 A;  4RAU C;  1J9O A;  4DK0 A;  1CQF A;  1HCZ A;  4C2M B;  1YNJ D;  3UI2 A;  1PRT D;  1W6J A;  4N9T A;  1DOK A;  5DEH A;  4C3I B;  4EQO A;  2O4X A;  4L6T B;  3I70 A;  3MWY W;  1PLF A;  1SNP A;  4C56 C;  1T5E A;  2B39 A;  4JBW A;  2IX3 A;  1WD1 A;  1QWY A;  2DNE A;  2XWJ B;  3S16 B;  2JEA I;  3M85 A;  1CZW A;  2JXM B;  5DNF A;  3Q23 A;  3RMH A;  4BA1 I;  1MSH A;  1K8O A;  3NSW A;  1PTO B;  2MHV A;  1ROD A;  1TY0 A;  5G3L D;  2F0N A;  1EYD A;  1CA5 A;  3HOU B;  4DGZ A;  5T1G A;  4IAL A;  1K8M A;  1HRJ A;  2F0G A;  3I4N B;  1TWA B;  1Y69 U;  1XXG A;  1G29 1;  3PUZ A;  2PCF B;  3OMC A;  4A3G B;  4F87 A;  1H9M A;  3EA6 A;  1A6X A;  4RA8 A;  5EPJ A;  4KD3 A;  2FHT A;  1H9K A;  3SK8 A;  1CT1 D;  1WTR A;  3TP5 A;  2F4I A;  4ZRZ A;  1B1Z A;  1EZ6 A;  1Q1B A;  1JWU D;  1RTN A;  2NTT A;  1QCB D;  2G9D A;  4OO1 G;  4FF3 A;  2E2I B;  2EYH A;  5COY A;  3C46 A;  4FF1 A;  3NQI A;  2EYJ A;  5CV8 A;  4OIJ A;  1GUS A;  2JA5 B;  5IIF A;  4HMJ A;  1PRT C;  3AU7 A;  5IT9 L;  2B2U A;  1BCP F;  1CTM A;  3QG1 A;  1LT6 D;  1E2V A;  1SXT A;  4HSP A;  2K5D A;  3U9O A;  3SR1 A;  4R8I A;  4XIG S;  4X3K A;  1EQV A;  1TII D;  1IYV A;  3ND9 A;  5ELF A;  1GHJ A;  2IW3 A;  3EQL C;  1QB5 D;  4R9W A;  1STG A;  2XRS D;  4DXF A;  4GZY C;  2PZU A;  3W2D A;  3BYT B;  4IZ8 A;  3S15 B;  4M8A A;  2KEE A;  3MEH A;  5KYI A;  5ELB A;  1FNU A;  2IWH A;  3J7A V;  2RKS A;  4A3E B;  2WIN B;  4F88 A;  4FYD A;  1CHP D;  1SYG A;  4V0B A;  2NVQ B;  1BXT A;  3SHL A;  1KNE A;  1BR9 A;  3C1F A;  1EY4 A;  1SYB A;  2IL8 A;  3G7L A;  2B2T C;  4XT3 B;  1S5E D;  1FYC A;  1G2S A;  4OIK A;  2N55 A;  2F03 A;  5HGT A;  4C3J G;  3D8G A;  2HQE A;  2PNR C;  2PZW A;  1F9S A;  1DJR D;  1C4Q A;  3TDQ A;  1TQO A;  2EYP A;  4TSS A;  4FXD A;  1BDO A;  2VUM B;  4PNY A;  3CRL C;  4XQJ A;  4A3J B;  1PXU A;  1SDF A;  4BBR B;  4I7Z C;  2A68 D;  3MXG A;  3D31 A;  2D2C C;  1A3T A;  2K1B A;  2RBM A;  1JC7 A;  1C48 A;  1G2T A;  2LY7 A;  2QDB A;  1EY9 A;  5I4D A;  3Q0A A;  2ICI A;  1Y8O B;  3L3O C;  2B2W A;  1EIG A;  5CV9 A;  1XYI A;  1GUG A;  1IYU A;  3A54 A;  4KHV A;  5BN4 A;  5E1F A;  5D3D A;  3VA7 A;  1I4R A;  4G7O C;  4UDU C;  1Q3L A;  2BE5 D;  4C3H B;  4O1N A;  2PPB C;  2B2Y C;  1Z47 A;  1BOS A;  1HTP A;  4QUF A;  1PFM A;  5D14 A;  2QF7 A;  4BBS B;  4DFA A;  4J8Q A;  3ND8 A;  4ZAI A;  1QE6 A;  3N6R A;  5J22 A;  5HUR A;  4BA2 I;  5EKI A;  3U9S A;  1STA A;  3J80 L;  1JE4 A;  2MUY A;  2L1B A;  1HA6 A;  4G7Z C;  2RDH A;  1TY2 A;  2B2V A;  2CQA A;  1WCM B;  2HCC A;  1LV9 A;  2N88 A;  3GTK B;  2F0T A;  1RKN A;  2XSC A;  2F0H A;  4HSV A;  3GTL B;  5I2X A;  3H94 A;  1ET9 A;  1O80 A;  5EPL A;  5A2Q L;  5JPN C;  3IAY A;  2K04 A;  3J81 E;  1RCV D;  5I6W A;  2NWG A;  5JOB A;  3E5S A;  1F77 A;  2F0F A;  1LLR D;  1VF7 A;  3DMU A;  2C5C A;  4IUU A;  1ILP A;  2K5W A;  5EGT A;  2AUJ D;  4RGN A;  5C0X J;  1DD2 A;  4PMB A;  3NBH A;  3H3V C;  5JEA J;  3RZO B;  4AYB B;  2WP8 J;  5JVH 3;  1L0X B;  2Q8T A;  1F2Z A;  1PRT B;  1Z6H A;  3K7A B;  1M4V A;  2BE5 C;  1B9M A;  1IKM A;  3MC0 B;  3A8J E;  1AFP A;  1NR2 A;  4NDX A;  3MXN A;  2R7Z B;  3M7N A;  2IX0 A;  1VCI A;  3H09 A;  1D5X C;  1O7Y A;  1KDB A;  2FMM A;  5IGE A;  4R8N A;  3I72 A;  4TKO B;  4X3T A;  2A6H D;  4XXE A;  2OT2 A;  3TSS A;  1TWG B;  4Z9C B;  2L4N A;  1GOZ A;  1NAP A;  3PUX A;  2A6E C;  3PO2 B;  2EVB A;  5FLX L;  3NUC A;  1JQY D;  2NN6 G;  1WTO A;  1VDZ A;  2IT1 A;  2F0M A;  3HOW B;  2E2J B;  5C4J B;  3A8I E;  2DNC A;  4FF4 A;  2XIW A;  1GUO A;  1B9N A;  3A56 A;  2FFK B;  5IGB A;  2RSN A;  3A55 A;  2TMP A;  2MPM A;  2CHB D;  3AB9 A;  3OWF A;  2WKD A;  5A35 A;  2G9H D;  3BVM A;  1I4Q A;  1JWM D;  4HED A;  3K58 A;  4NP5 A;  3HS0 C;  1FGB D;  1SEB D;  4E6I A;  5M5X B;  2H4O A;  1Z7T A;  1SE4 A;  2VB3 X;  1OO9 B;  1BCP D;  1LTT D;  3DEO A;  5JAV A;  5FO9 B;  3K6O A;  4C1N K;  3PUW A;  1JWS D;  4DF7 A;  1HTL D;  3D3R A;  4CKC A;  3CU7 A;  1CA6 A;  3ERQ A;  3DM1 A;  3OHX C;  5KRU A;  5J39 A;  1R9T B;  2Z1C A;  4DAV A;  4DNR B;  2PMZ B;  4BWG B;  4A93 B;  1GXD C;  2F0I A;  3MFY A;  4RKL A;  1EU4 A;  3LWU A;  3ERO A;  2X6G A;  2FMC A;  4X3S A;  3PMF A;  1A2U A;  2DY7 A;  1I6H B;  1HUN A;  3DWP A;  2B2T A;  4PV1 C;  3GTQ B;  3D4W A;  5C0X I;  4CJ0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...