5I2XA

Crystal structure of tpp1 k170del
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
150
structure length
150
Chain Sequence
SGRLVLRPWIRELILGSETPSSPRAGQLLEVLQDAEAAVAGPSHAPDTSDVGATLLVSDGTHSVRCLVTREALDTSDWEEEFGFRGTEGRLLLLQDCGVHVQVAEGGAPAEFYLQVDRFSLLPTEQPRLRVPGCNQDLDVQKKLYDCLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenocortical dysplasia protein homolog
publication title Structural and functional consequences of a disease mutation in the telomere protein TPP1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 34
structure length 150
sequence length 150
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10341 TPP1 Shelterin complex subunit, TPP1/ACD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.960 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i2xA00
5I2XA 2I46A 5I2YA 2M9VA
chains in the Genus database with same CATH superfamily
1PFSA 1YITA 5D14A 4X64L 4HN7A 3HOZH 2ZM6Q 1CKOA 2XNAC 4L5QA 1F2ZA 1PRTD 4HSVA 1SE4A 1Q1EA 3W1BA 3D4DA 1ZYRD 4DXGA 1BBUA 1GVPA 3OTOQ 2VQFL 5NUCA 5FJ8H 1UNSA 2MJ8A 3J80E 3BZDB 1YHAA 4Q5VA 1EUJA 2EYOA 1H95A 2Z0SA 3DMUA 5JVH3 2R61A 4QCLA 3S1QH 1IBKL 4OIJA 1EWHA 2V4DA 1HCZA 4HEDA 3HOWG 3BDLA 5LMNQ 2F0WA 4G4KA 4BS9A 3CRLC 4X3TA 3T4AC 1VQFA 3CCUA 4LFAL 3S1RH 1TWGB 5G3LD 2DGYA 5FO9B 3I72A 2ALYB 1PTOH 2KEEA 4LUVA 4IJLA 1GUSA 1BF4A 2QGQA 4BXXH 1XYIA 5C3EH 4UPAA 3K57A 2BA0A 4CJ1B 1PVOA 1YEZA 2HHHQ 3GD7A 5KNDA 3FDTA 3HFZB 3VYUA 1KRSA 2IHEA 3G7LA 5FKAC 1AFPA 1GHJA 3ULJA 1CSPA 1EYCA 4BY7H 1BVSA 2BDNA 4L6TB 4CDFC 3HOXG 1EOTA 3CKIB 5C4JB 2KECA 5IWAQ 1D5MC 3BVGA 4JI8L 4H02A 5M5WH 2EDGA 1SMXA 3DEPA 3KJPA 2F0TA 5JJIA 3DUZA 3LWUA 4L63B 4OWXB 1IL2A 3RLOA 4KHZA 5KRUA 1KHIA 1RKNA 4QIWE 4C3HG 2JA7B 1NMFA 5IP7G 4KHPQ 3NWSA 4EVOA 2CWPA 2KHJA 2E5LQ 4QJFA 3HOUB 1GD7A 1TXYA 1F9SA 2D5DA 1T5XD 1IHZA 3CQZH 1F2LA 1HFGA 3N6RA 1JB3A 4OIKA 2E2JH 3BYYB 4GS3A 1ASZA 1NCVA 2WFWA 4P74A 2NVXH 1GKHA 4A3DG 4UP8A 4Y7NH 2NN6G 2EYPA 1K73C 2A73B 3MC0B 5LHY1 4O1NA 3T51B 1XMOL 2QEXA 3VDYA 2SDFA 2NTTA 3MXUA 4M8AA 2MNAA 2L5TA 1R9TH 1YNJD 4IPHA 2CQAA 2PQAA 2RSOA 4IQZA 1TS3A 4P2CB 3FKIB 1SDFA 3GTPB 2B2WC 2E2IB 1G8ZD 3S2HB 3BS1A 2NZOA 3EFXD 5C3XA 5AJ3L 2JA5B 3M3YH 2EYFA 3C1EA 4A3CG 1E7ZA 4KJNA 5CV4A 2E2HB 2B2VC 3BVMA 4FNFA 1AEXA 1Y8NB 4PQXA 2A68C 4R8IA 1HTLD 5M5YB 1LYLA 4QQBX 1LABA 3N52A 3T13A 2O4XA 3I90A 4GNXC 1JB7A 3T1HQ 4LWCA 1S3OA 2VXWA 4DR2Q 4WRDA 1PHJA 4DUZL 1LTRD 4JI6Q 4ME5A 3CMEA 2CVRA 1OXSC 4GOPC 3GTOB 1H9JA 3T1YQ 4CDEC 1EL0A 3DXJC 2AWNA 4KK7A 2RKSA 3NENA 2F0KA 4DV5Q 2R93G 5E3FA 1BCPB 1Q82C 2CH4A 1G6ZA 1JWUD 3I2ZA 1W2BA 1EIGA 4DR6Q 1FGUA 1BBXC 2J4XA 4R4CA 4XYQA 3NTKA 4X66L 4JYAQ 2QW7A 2I46A 3DWAA 4A3DH 1A63A 2NN6H 4UP9A 1WCMH 4A3GH 1PZID 2F4IA 2DN8A 1F2YA 4A3FB 3A8IE 5ELDA 1T5EA 4LF5Q 1PZJD 4DV7Q 4A75A 4M1UB 2WAQG 1CFMA 2KCCA 2MUYA 3LWEA 1XPRA 2RSNA 2HUGA 4IUPA 3Q22A 3KUPA 1PH6A 1VQLA 3NE5B 1CSQA 1Q8IA 4DR5Q 2UXCQ 4X62Q 2UU9L 3FPUB 3NP8A 2JA8G 1X55A 4DK6C 4A93H 2NUCA 4F8MA 4JBWA 1K9MC 3J7AV 2QCPX 2FMMA 1A3UA 4GN4B 3TQYA 1SE2A 4A3CH 4HR7B 1PFMA 2NBFA 3CXCA 1U9RA 1YNXA 3HOUG 1AH9A 5IGDA 4A3JB 4DAYA 3S16H 3F2DA 2K5WA 4RAUC 3I7FA 1JCKB 1HH2P 4FF4A 3RR5A 5GQOA 2X6GA 3CCMA 1Y1WH 3TDQA 3CRKC 3C3LA 4CHTB 1UE6A 5FLXc 2KVMA 2PPBC 3H3VH 3E6ZX 3J81c 3R8BA 3K7AH 3U58A 2CW0D 1XNQQ 1I4QA 2L4NA 3A55A 5EJWA 3F8TA 4DNTB 3CCLA 3S15B 1PMRA 4OEMB 2AWOA 3ULLA 2DUDA 4DR3Q 1BR9A 2F0HA 2ZJQA 4FF3A 4DR4L 2R93H 1LO5D 4NW2A 2Z6BA 4DV0L 3NQTA 1TKWB 4C3IB 2CHBD 4KI0A 4WFN3 1H9MA 2K5DA 2B29A 1JWMD 3MEHA 1EEFD 3Q8DA 4A3MH 3I4NB 1N33L 3U50C 1EY9A 1TWHH 2JXMB 1TWAB 1VQCA 3W1GA 1I6HB 4A3KH 4G7OC 3MHBA 2P5ZX 1RL2A 1DCZA 3UE0A 5IT9L 2F4VQ 4C2MB 5ELOA 2N3SA 5C44B 4L8JA 1KNAA 5EBDA 5GAHC 3CCQA 2L15A 3F2BA 1HTPA 3U4ZA 3DEOA 5K36G 2JA8H 1XJVA 3GTKH 2BDOA 4PZ7A 4DN4M 3D3RA 3J7A5 3MXNA 5EKKA 4LF4Q 3TS0A 3M9BA 1EQTA 1IYVA 2XWJB 1QZGA 3OYYA 1KIXA 5C4XH 3NBIA 1WTWA 1SMYC 3CHBD 2KQ3A 1EQRA 3I8ZA 4K0KL 2FFKB 2FHTA 3TS2A 3K5NA 1GUOA 1AW7A 1VQMA 1U5KA 2B63B 3I91A 1EIHA 2RQXA 3LGJA 1QB5D 4NXNL 3K81C 1QVFA 4LFCQ 2WB1B 5C0XG 3M4YA 1B7YB 3FEWX 2CQOA 2DY8A 2A8VA 1TWCH 1S4ZA 1A0IA 2IWHA 1AZQA 1MBYA 5BR8L 3KDFB 4LF7L 1KDCA 3NPPA 1ZKOA 1SNOA 2CKZB 4HCSA 4LFBL 1JWSD 4GKKL 2A19A 4OELB 1YVCA 4AYBE 2EIFA 2ZTCA 1DYQA 4JV5Q 2ATWA 5IYDH 1CKNB 4GKJL 1IYUA 1NSNS 3A5ZB 3AB9A 4HIOA 3S1RB 4NPSA 3QIAA 1PTOB 4DR7Q 1O80A 4J15A 4BBSH 3OW2A 2EYJA 2UUBQ 1G2SA 3C46A 4DK1A 3NTHA 1S5FD 2BH2A 3IKJA 1GM5A 1IBML 3BYTB 4A3JG 2JA6B 4ID6A 4DUYL 2KUMA 5C4ZA 4XIGS 5IGCA 1B53A 4PMWA 1MJEA 1AN8A 1K83H 1ML0D 1WI5A 1VQNA 4J1MA 3AYHB 3SE0A 1CKMA 4B3RL 3A56A 1BCPF 4ZCKA 3UDIA 2DNCA 1JICA 4YWLA 1HA6A 1N32L 2K52A 2K7VA 2ZXPA 4ALPA 2KJXA 1DGSA 3BJUA 4DV6L 3PUYA 2HQLA 4PNYA 1I4PA 4C3JB 2NN6I 1SNDA 1K0RA 2AQ1B 4Z9CB 4X3UA 1PXUA 4JI5L 2HIXA 2EZVA 4IO9A 1SN8A 1PRTB 4LF9Q 2G9DA 3GV6A 4PZ8A 4K14A 1Z47A 4RH6A 2UUCL 4X3KA 4FO2A 3S17B 4KY6A 4IJHA 4POFA 4IURA 5HGQA 2LXKA 1A3VA 1SYDA 2JJQA 3QO2A 5I6YA 2N88A 1FR3A 3I4NG 4N8X1 4MTNA 4A3EB 1EQVA 1O7YA 3PO2H 3E3XA 3GV3A 3OIQA 1RD9D 1GJXA 5C44G 4FVMA 3T53B 5A2QL 4Y7NB 5M5XH 1X56A 3VR4A 4TKOB 1K3BC 1N34Q 3F1ZA 2K33A 4ZUIA 2LXJA 2Q8RE 1XNRL 1X54A 5JEAG 5M3FG 2I5MX 1C7YA 1JE4A 5A35A 4A4IA 3HEJA 4KV6A 1Z9FA 1B1ZA 4HJ7A 4RGTA 1FL0A 4EQNA 2F0EA 4I7AA 1ASYA 3H0GB 4HAEA 4DV4Q 1LM0A 1JMCA 4IPGA 3FVQA 1E24A 1WJJA 1SAPA 1ET6A 1IBLQ 5JOBA 3NSWA 5EKIA 3QOJA 2VUMH 2MFIA 2YU9B 1L0YB 3A54A 3D8GA 2B39A 1HNWL 1L0XB 1VDZA 4DV2Q 1PLFA 2UXDQ 1J9OA 1SNMA 2WB1G 3OSOA 2AHOB 4LJZC 1MSGA 1NUCA 4YCWA 5CV7A 2NWGA 2YTYA 2EXZA 4HMJA 1B8AA 4X65Q 2J0TD 1I3QB 4K6LA 1RHPA 3A7LA 2MGSA 1YIJA 1G91A 2KCMA 4JI2L 4P72A 4KKTA 1KAAA 3NWTA 4MTKA 5C5LA 2NVQB 1P16A 3M7GA 2AMCB 1Q12A 3CF5A 1GUWA 3I70A 4C56C 5EAYA 1X3EA 1S5DD 1V1PB 2B8GA 2EY1A 3MA2B 1SNCA 1PH5A 2OF1A 1EZ6A 3D4RA 3CCSA 5BN4A 3VR5A 1HZCA 1IYJB 1N36Q 4JI7Q 3UDXA 4RKBA 3R2IA 2Z6KC 1U4LA 1X3GA 3ZYYX 3HOYB 4QIWB 2JA6G 4HTHA 4A3BB 4HMIA 1NTGA 4A3GB 1ENFA 1EYDA 4AH6A 2QF7A 3DLLA 1XPOA 1UEBA 4TQUS 1VQIA 5ELBA 4X6AH 3EQLC 2L0CA 4XTCS 2ES2A 1RDPD 1IL8A 2JA9A 1F2MA 2JE6I 2C35B 2Q2TA 2B2TC 1CZWA 3I3CA 4YY3L 3IFDA 1DOLA 2PQAB 3QG1A 3KK7A 2HIVA 3KF6A 1U0LA 3UI2A 5M3MG 1S40A 1KAWA 1MGSA 4NXML 2F0MA 1EWCA 4JW0A 2NYZD 1GOZA 3K7UC 3PQIA 4OONA 3KF8A 4YIJA 1O78A 2XVSA 5KIXA 4IUNA 3PO3B 1FD7D 3RN5A 4BBRH 1EY8A 1VQ4A 4UP7A 3S16B 4G57A 2F0UA 4A3EG 3GTLB 1I6VC 1QVCA 4R4OA 1TS2A 4B3SL 1HQRD 1WTRA 1PTOF 1Y1WB 4LF8Q 3VYRA 1QZHA 2ZT9C 4K5WA 3HKZB 1MSHA 4ILWA 3J7ZC 4EQOA 2XWBB 4Y52H 1STBA 4CDCC 5JJZA 1DONA 2B8FA 1A2UA 3BVZA 3D0FA 4EQ5A 4QUFA 4C1NK 1YZ6A 4E6IA 3GTGB 1Y1VH 2D0PA 3GTQB 1RJTA 4LW1A 3PUZA 2FINB 4JVZA 2E75C 3S1MB 3D6WA 1E1OA 1TIID 2SEBD 4DNRB 2WIIB 4K8JA 2CFMA 1I4XA 4YCUA 4LF6Q 3CC7A 3A5UA 4ZAIA 4B3ML 4A3IB 1Q7YC 4QMGA 1EY7A 2E74C 3EJIA 4B08A 4R8NA 2RVLA 1F9PA 1NY4A 3OMGA 1HR0W 1VCIA 1B9NA 3G6JB 3D31A 4IPDA 4JI1Q 1PRTF 2RF4A 4I65A 5M9OA 1Q90A 2R7ZB 1U4PA 1KABA 2WP8J 4YHHL 2G5DA 3HGBA 2BOSA 1D5ZC 2ENBA 4RGMA 4IOCA 1I94L 1QNUA 2LMCB 3AQQA 2WV6D 1VQHA 2Y0SG 2NVYB 3AFQA 3BU2A 3K58A 4CBVA 1KLGD 3IL8A 4IZ8A 1RTNA 3CCJA 1WOCA 5C0XI 3EBEA 4AQYL 1VQJA 3K0YA 1XTDA 5GROA 1BCPC 2K1BA 1PH7A 1M4VA 2B2UA 5EQ0A 3S1NH 3HOWH 3H94A 2R92B 3T16A 4S3SA 5D3IB 4QF4A 3TZUA 3I4MB 1DM0B 1JJ2A 4MZ9A 5I9PA 1ENAA 2O5JC 1A2TA 3ER0A 4CKBA 4R1JA 3VR2A 4FF2A 4CGYB 4DV1L 2VB3X 4NP5A 4DAYB 3HOYG 1EWIA 2B2YC 1IZ6A 3CCVA 1EEID 2Z4HA 4A3BG 4UY8C 5AFWA 1X65A 3E0EA 4HSPA 1PH4A 1TWCB 3OIPA 5T1IA 3H6MA 5IOCA 1PH9A 1PYWD 5EPLA 5LL6X 3EIVA 3MFGA 1H9SA 2UUAL 1JJCB 3P1HA 1HR0L 5ISRA 4KKUA 2KOLA 2ICIA 1QG7A 2K5HA 2ZJRA 4LMQD 3PIP3 2RBMA 2PO4A 1SFOB 1O7LA 3RZDB 4APVA 3GTMH 1FJGL 4OXPA 1ZEQX 3HOXH 4KLKA 3E9IA 1IXRA 5C4HA 1J5EL 1TT2A 1VQDA 4IALA 4NB3A 4OHJA 3TSSA 1M90C 5C0XJ 1YNNC 3J7YW 1LTLA 4DV3Q 1HNXL 2F0JA 4LUOA 4PMBA 5KNCA 1FNWA 2QEJC 2Z8LA 1D1IA 3AFPA 4C3HH 3JAMc 1KDBA 4CKCA 3PO3G 4Q0FA 5IP7H 5LMNW 1Q1BA 3NELA 3TN2A 2VQEQ 2PI2E 4DR1L 1BDOA 1X3PA 4JI4Q 1A8VA 5COYA 2WAQE 2IW3A 1HNZQ 3J7AF 4OGQC 4V0BA 1STEA 2KHIA 5TSSA 2WKCA 4B9XA 1YBYA 3W3AA 3HKZG 5IGGA 4G7HC 3WOFA 3GTJB 5IIFA 5LMUL 1N9WA 4MNOA 4DUYQ 3MXNB 5ELNA 1L1OB 1SE3A 2Z6KA 2SNSA 4DPGA 1E3PA 2I5HA 1CTMA 2F0IA 4RHSA 4POGA 5DM63 1Q8KA 3U9OA 1Y8OB 3K59A 2OTJA 2D9UA 4OL7A 1M1KC 1QNKA 2L55A 4A3IG 1LLRD 3SK4A 1XMQQ 1MKHA 3S2DH 1E2VA 2XSCA 4WJWA 3OTOL 4JBKA 1U4MA 1STAA 3IRBA 2F0DA 1EU3A 2HQEA 4JI0L 1LTID 4BY1B 2IX3A 1ESFA 3PV0A 4V190 3M4OB 1CQVA 1WTHA 2JA7G 2B2TA 1XPUA 3K6OA 2LY7A 1E2WA 4QUCA 1C48A 3NUCA 2YTVA 4DNIA 4B3TQ 2VNUD 5LMNL 5EKLA 3KLRA 1STYA 4C1NI 1LT3D 1EFID 5E4WC 1AZPA 4KTAA 5CR3A 2IY5B 3DWQA 2JYOA 1PH8A 1NR2A 1ILPA 2VL6A 3QB3A 2V1CC 5BN3A 4XXEA 2R92G 3I4MG 1HHVA 1XNRQ 2HDMA 3OWFA 1TWFB 3LX0A 2HHHL 4TSSA 3K5MA 5KGUA 3HOVB 1QE6A 4OX9Q 1TWGH 1IKLA 4EGVA 2PW5A 4ZKBB 2AUKA 3RD4A 3X3MA 4A3LG 1ENCA 4RGOS 2A6EC 5JEAJ 3I4OA 2UXBQ 3FKIG 3BZKA 3RZOB 1E22A 2BCOA 5IWAL 4OO1G 2JA5G 1I50B 1SYEA 3Q6SA 3ND9A 5T1GA 1S5CD 1WTOA 3MFYA 2R3ZA 1F9QA 4KHPL 1WYDA 2MO0A 3CPWA 2E5LL 4XQQA 3CC4A 4EQPA 3J80c 3S14B 1V1QA 2IX1A 4FP5D 1D2BA 3HG9A 1X32A 1Y14B 2F1MA 2WINB 3AMUA 1YHBA 1UEAB 1SNPA 2RA4A 1TS5A 3EN2A 3HOUH 4XYOA 3NBHB 4JI3Q 4N9PA 1EZ8A 2O5IC 1BXTA 1JE5A 2ZTEA 1U4RA 4P73A 1PRTC 2X6LA 3HOZB 3B6YA 1OXVA 3EVQA 5ELEA 1HPCA 1YJNA 3CCEA 2KCTA 4GN3B 4EX5A 1ZYRC 2IX0A 2L11A 1CUKA 4DAMA 2XRSD 4KHVA 3E0JA 1VMCA 3NXWA 4I7ZC 4IUUA 1HUNA 4A3FG 1KD1C 4DK0A 3G4SA 5HURA 1OXUA 4X64Q 3ZJYC 1HZ9A 2B2WA 3S1QB 1VQ9A 3RUZA 2I0QA 5IGEA 3HP3A 4IFDG 2PZTA 2VQFQ 2YYZA 3FKIH 5EGTA 1VF5C 1QUQA 2MO1A 5IGFA 2E2IH 3GTPH 1ICWA 3S2HH 2L9HA 2B2VA 4CJ0B 2Z1CA 3GP7A 3NHHA 4BY1G 4RHRA 5FLXL 3ONAB 3T1HL 4DR2L 1IBKQ 4JI6L 4FXDA 2WKDA 2E2HH 3J81L 4FXGC 4GNXA 1C9OA 2EY2A 3KBGA 1W6KA 5C3EB 3VA5A 1C4QA 2A68D 5K36H 4JCVE 2PZUA 4DA2A 2D62A 4LFAQ 3MZ5A 4UDUC 5E1FA 4GOPA 3PMFA 2K28A 4DV5L 2PMZE 4N9TA 3WOEA 2Q2IA 2VS1A 5CC4A 4BY7B 4A76A 1D5XC 3P20A 2XTIA 2AQ3B 4DR6L 4JYAL 2HD3A 3GTOH 1KLUD 2KHSA 4DU9A 5M5WB 4CJ2C 1BBWA 2F3VA 3HOVG 2EQSA 1LT5D 3VR3A 2L12A 4DV7L 1SYFA 3PSIA 1EY4A 3C1FA 5IE8A 2X69A 3MVVA 1ONLA 4C3IG 1PH3A 4DR5L 4JC0A 2UXCL 4RFBA 4X62L 2QILA 3J80L 2K5QA 2NVTH 2A69C 5C0XH 2OQ0A 1PV4A 2OTLA 4JI8Q 3L3OC 3PGZA 4A3FH 5KEEA 1KQSA 3CQZB 4QGUA 1BQQT 2E2JB 1GO3E 2N49A 2NVXB 5GAGC 2EY6A 2TMPA 5DM73 5IT9E 3OPOA 2AKWB 2LSSA 3PF4A 1G6PA 1KRTA 2D2CC 4JK1C 2EE1A 2PCFB 5EBCA 5J1ZA 3KF8B 2GN5A 4JG2A 2XGTA 5F2DA 3A8JE 2EYHA 1KTKA 3V96A 1SYGA 2WB1E 3LNNA 4K5XA 1R9TB 3RLFA 1B9MA 2F52A 5CV6A 1YJ9A 2O2LD 1G291 5HY6A 2L1BA 4A3JH 1XMOQ 1XNQL 2B63G 1K0SA 2F0FA 1HJPA 4ZKCB 3M3YB 1CQFA 3HOZG 1ZXTA 4ZRZA 3H91A 1Q81C 2QDLA 1KL9A 4FDBA 4DR3L 1Y8PB 3TZDA 1EIFA 1I5FA 3UDFA 1I4RA 2MQHA 3BG3A 5FJ8G 3PIPA 5GADC 2F03A 2UUAQ 1W6JA 1S5BD 5AJ3Q 3KLSX 5FO7B 3AU7A 4PV1C 2JK8A 3S24A 2LS01 2GVBA 4IUVA 5JAVA 1HQMC 2N55A 3S15H 2RHSB 4DXFA 2ASBA 4GN5A 3A8KE 3NEMA 1YI2A 1CKNA 1X9NA 2F4VL 3JC66 1EFWA 1MJCA 4L5SA 4H0LC 2TSSA 3SXHA 4K6DA 1QOHA 5C3WA 4RWSC 3I73A 1PDQA 3C2PA 3QWNA 2Q8IB 3I4NH 1LTGD 5ELCA 2M9VA 4CKEA 4DUZQ 1TWAH 2Z9HA 3SVMA 1I6HH 2CH4W 3STBC 4LF4L 5FLXE 3CW2C 4H13C 4RCOA 1VQOA 1D8LA 4C2MH 3DHQA 4BXXG 5C44H 3QOLA 4K2LA 2EJFC 4K2KA 5C3EG 4A3DB 1WCMB 2NZ1D 3E5SA 3MEFA 3SHLA 3U4VA 3KLSA 2DJGC 2MP1A 5FLMG 2R7DA 4DFAA 1H9RA 3HRZC 3SEBA 4ZK9B 1HA5A 2KCNA 1WD1A 5I9OA 5JEAH 5M3FH 2PZWA 5FO8B 2GA4B 4RG1A 4BA2I 4BY7G 4TRDA 4O2DA 3FRPB 4X66Q 2A74C 4LFCL 1MI2A 3VYSA 3MWYW 3D4WA 4A93B 3RN2A 4C3JG 2EPBA 2YTXA 3PUVA 3I55A 1SMYD 3F2CA 1UE7A 4UAIA 4JBMA 1NMGA 3OMCA 1RIPA 1GUGA 1A3TA 1JQYD 1EQQA 3R93A 3CC2A 3HS0C 1IW7C 1RODA 1Q86C 1L0WA 2JQOA 2VZAA 5CV8A 2UU9Q 1NNXA 1V8QA 1H9SB 4KJOA 3NTIA 4KMUC 2QDBA 3UE1A 2Z4IA 2K50A 2VB2X 5K5PA 1VQBA 1LTTD 1WVLA 5CORA 4JV5L 4DF7A 4PZ6A 3OHXC 2FXQA 4JI0Q 1JJGA 1LTBD 3CCRA 4ZQ3A 2JP1A 2K6AA 3DWPA 1SBBB 2JEBI 1VQKA 4MIUA 3AEVA 4DR7L 4OO1I 2D0OA 5E7NA 1VQEA 1JOOA 3U9SA 2UUBL 2CW0C 3KBXA 3K7AB 5J22A 5KNBA 5A2QE 1M8AA 1SJHD 1I4HA 2K01A 2OEOA 1HUMA 2EXDA 1DJRD 3WDNA 4QB4A 2IJ0A 4HJ9A 4L5RC 1OO9B 2F0QA 3J81i 2OXPA 4RA8A 1BNZA 4RCNA 1XXGA 1TQOA 4YWMA 2R93B 3H0GG 2Y0SE 1C0AA 1B50A 4RMFA 1D1KA 1TS4A 5FK9C 2JA6H 3M4PA 3TRZA 4A3MB 1WTXA 4LAAA 5FLMH 2C5CA 3RNUA 1K8AC 1TWHB 1PH2A 2WAQB 4RKLA 4A3KB 4DR4Q 4MHEA 4DV0Q 4LF9L 2M2LA 4IOAA 4G7ZC 4N8FA 2RCFA 4X3SA 3UDGA 1X3FA 2JA8B 4C3JH 3GTKB 1N33Q 4KY7A 3NK9A 2K75A 4HJ5A 4IN3A 4F87A 2Q2HA 5M3MH 2EJGC 2A5HA 1KDAA 1ESRA 3J80i 3K5OA 4GZYC 1R4PB 1GUTA 1LV9A 1V1PA 3S17H 2R7FA 5C4XB 5IYBG 1DZ1A 4RGNA 2EJMA 3FPPA 1SYBA 1L1OC 1N34L 3VR6A 3QJYA 5G3LF 3IAYA 2EVBA 2A69D 4IFDI 4KD4A 4R9WA 4O42A 2A1AA 4A3EH 2XN9C 2OCEA 3EROA 1WTPA 4OWTB 3SK8A 3ULPA 2FJ2A 1F9RA 1VQGA 4LNQA 3G6EA 4J8QA 1OXTA 2F3WA 1JOKA 1WCMG 4JOIC 5JJKA 1K3RA 2DNEA 1VQ5A 4K0KQ 3HKSA 5GAEC 1LUZA 3PIO3 4DV4L 4A3GG 1SJED 4L5TA 3ND8A 5CYUA 5FOBB 1R4QB 4GLAC 1IBLL 4NDXA 1JR0D 1J8IA 4NXNQ 3TEHB 4DV2L 2RHQB 2UXDL 1HRJA 3T56B 1VMPA 3H0GH 4R4IA 4A93G 4NMZA 4XQJA 3CAMA 1MD2D 2H1EA 2PYKA 4B9WA 3P75A 1A62A 1BO0A 5BR8Q 3L7ZC 2YU9H 4X65L 3HKZE 4LF7Q 2JEAI 3KLWA 4K5VA 4XT1B 5JPNC 5J3BA 3L2PA 1VQPA 4BBSB 3OWEB 2DY7A 2EYMA 1STGA 2K14A 1TR5A 4WJ3M 5DLQE 4LFBQ 4GKKQ 3GQBA 2RDHA 5D3DA 2JSOA 4GLVB 1EYAA 1XWEA 2EOTA 4GKJQ 1NE3A 1K83B 3G71A 1Y1WG 4IFDJ 3KYHC 1C8CA 1I3QH 3HZXA 4XDXA 1II3A 5KYIA 1VQ7A 4JI7L 1N36L 1E0BA 2I07B 2PI2A 5IY0A 2MPMA 1G51A 5IT9c 1IBMQ 1T9HA 2K03A 5IYBH 2K5VA 2NVQH 1CA6A 4KKSA 2HT1A 1QILA 2WACA 3PCOB 1BUVT 4XT3B 3TP7A 1AE2A 1IKMA 4IUQA 1L2FA 3K8AA 1ILQA 4B3RQ 5C5MA 2GVAA 2H5XA 4HJ8A 2K05A 2KBNA 1N32Q 1AP0A 2ZM6L 3HOYH 3Q0AA 5ELFA 3X3NA 2BH8A 5IP9G 3STBD 4FF1A 4DV6Q 2YV5A 4A3BH 4DKAC 3A7AB 2NVTB 5DEHA 2SOBA 1X3QA 2ZXRA 5I4DA 4A3MG 1QVGA 2NZHA 2N8NA 3QR8A 4JI5Q 3PO2B 1E2ZA 3TP5A 1K8MA 5DNFA 4AIMA 1S72A 4A3KG 3D6CA 4O0AA 2R7ZG 2UUCQ 2PNHA 1GXDC 4NKLA 2BE5C 1TY0A 2A6HC 1K8OA 1W3SA 3SK5A 5M5XB 3TP8A 1CHPD 3L0OA 3S9WA 1YJWA 2I5LX 2N78A 1DOMA 4DAVA 1TVXA 1AE3A 1P8LA 1Q3LA 2OQKA 4HIDA 1QUQB 4LF8L 3ICEA 1SE8A 3E9HA 1IW7D 5C4XG 1Z7TA 2JN4A 3J81j 3PO3H 2C9OA 4BWGB 3BZCA 3K5LA 1CI3M 5CV9A 4AYBB 1JT8A 1MHWC 3V2TA 3GTLH 2RDGA 1LTSD 3ERQA 1HZBA 4GNXB 3OW7A 2VUMB 2VW9A 1JOQA 2NB0A 3I4LA 3R3OA 4UHVA 3WWVA 4QL5A 2KA7A 1EY6A 4P75A 4GOPB 4LF6L 1EY5A 1OTCA 3FP9A 3SR1A 2EY5A 5CV5A 2ZTDA 3DM3A 3GTGH 1PZKD 4LK1C 3GTQH 4JBJA 3FHWA 1HNWQ 3BDCA 4JI1L 3S1MH 1PTOC 3JAML 1EY0A 1Z6HA 1B44D 2R6GA 1A15A 1PYSB 1Q46A 2PMZB 2E2DC 4ABNA 5IP9H 4A3IH 1DXMA 5C4JH 3M85A 5IYDG 1CHQD 3H15A 1BOSA 2HDLA 2IHFA 1SRUA 1EU4A 5LL6S 1S5ED 1NAPA 2F3IA 4BBSG 4PMCA 3KOJA 4JI2Q 2R7ZH 1CM9A 4BA1I 2JA7H 1UAPA 1B3QA 4DAPA 1WD0A 3H09A 2PW7A 2NVYH 4F7XA 2ZJPA 3NQIA 4U68A 1EIYB 3M7NA 1B4OA 5M3FB 4PG3A 1L1OA 1XX8A 1SR3A 2MHVA 1CK1A 3MXGA 1QJOA 1V9PA 3W2DA 3W5OA 1VS0A 4QY7A 2B3GA 1NJIC 2SNMA 2G9HD 3F2UA 4GLXA 1BCPD 1I4GA 2KENA 2RCNA 3K80C 2R92H 5CBAE 3I4MH 2B2YA 2F0OA 5D65A 4ZUJA 1D7QA 4HIKA 3A0JA 3A74A 4JOIA 1VQ6A 2XIWA 1LACA 1FVIA 2K5NA 1VF7A 4R4TA 2QA4A 3TBIB 4CDDC 4A3LH 3ITPA 4YWKA 4BBRB 2K32A 1X6OA 2Q2UA 2VY3A 4FYDA 3KFUA 4XQNA 2PNRC 4YY3Q 1LT4D 1QWYA 3PO2G 2AQ2B 1O7ZA 1QCBD 1SROA 2FMCA 2JA5H 4OO1H 1K28A 2K04A 4KN7C 5I2YA 4NXMQ 1B2TA 4ODGA 3K0XA 1STNA 1WTQA 3EA6A 1UUPA 4DV3L 4KN4C 4J6HA 1TY2A 2BA1A 2F0VA 1SFOH 3RZDH 3CD6A 5C6AA 1WTVA 5M5YH 1JORA 1GHKA 1PYBA 2QKIC 2VQEL 3T1YL 1B70B 1UWVA 5EPJA 1Y1VB 4B3SQ 1BKBA 4JI4L 1HNZL 1SEBD 1ET9A 2Q8TA 1YNND 2J7ZA 4JPBW 1UE1A 1PH1A 2K4KA 1UE5A 1VQAA 1PFBA 5HGTA 5IODA 4AYBG 2HCCA 1FGBD 1LTAD 1LT6D 4ZYSA 1B3AA 1RTOA 4ME3A 2VUMG 4ZLTF 1RF2D 1NR4A 5CBEE 5DAUA 4LF5L 5L37A 1CT1D 1HZAA 2E8GA 4F88A 4IUTA 1V43A 1XTCD 2DJFC 3GTJH 2ID0A 3PUWA 3SDZA 4U673 4B3MQ 1Y69U 3RLNA 3IFTA 5KYLA 5IYCG 1ICFB 4HCEA 1XMQL 5JPMC 4H44C 3FMCA 4KY5A 1KXLA 4DGZA 1VQ8A 1PFNA 1SNQA 1WFQA 5M3MB 4YHHQ 3MAQA 1I94Q 2XRQD 3JAME 1A6XA 4YCVA 3HOWB 1J6QA 3S1NB 1CZGA 4TVAB 3KF6B 4B3TL 4IFDH 3RMHA 1TU2B 2PQEA 1NBWA 1GUNA 4AQYQ 2B2UC 2KEDA 2F0LA 4H7BA 2OT2A 1DOKA 1KC8C 4BY1H 1YNJC 3M4OH 3KJOA 4IPCA 3NBHA 3CPFA 1O7IA 3PUXA 5CGKA 5I6WA 4DK3C 3M4QA 2F0PA 3VA7A 2BE5D 4KD3A 4ULLA 1MIUA 2A6HD 4LUZA 3MXPA 2OWOA 4P71A 4HJAA 3CU7A 5JVG3 1HFNA 3TREA 3PIOA 5I2XA 3OOCA 4DV1Q 2ZXOA 3PF5A 3R2TA 5EPKA 4OX9L 1G2TA 2AUJD 5CMDA 2CCZA 1EOVA 3V05A 3GTMB 2H4OA 3MTSA 2UXBL 3HOXB 2M00A 2RDFA 2LFNA 2IL8A 3KDFA 3GDEA 3VYTA 3H3VI 1N8RC 3GO5A 1HR0Q 1TWFH 1PA6A 3BDOA 4MN3A 1FNUA 1EYGA 1OXXK 1SXTA 3Q23A 3HOVH 1DD2A 3TMEA 3TP6A 1E1TA 1HXYD 4C3HB 1K8GA 1FNVA 1FJGQ 4C3IH 3H3VC 4BBRG 2A6ED 1H9KA 4WJ4A 1JC7A 2Y0SB 5IYCH 1J5EQ 3RZOH 3DM1A 1D6EC 3CMAA 1I50H 1SLJA 3JAMi 3SK6A 4OWWB 1V1OA 5JJLA 2ICEC 1HNXQ 1FYCA 1YHQA 3URYA 1STHA 2F0SA 1PTOD 2IT1A 2LKVA 3CP0A 5BN5A 3O13A 5IGBA 4DR1Q 1CA5A 3J81E 1SSOA 3G48A 1Y1VG 3P7JA 3S14H 3Q24A 4JI3L 4FXKC 2F0NA 5J39A 1SYCA 4WORA 2EYLA 2IPKD 4R4QA 1F77A 4HIMA 4K8IA 5LMUQ 3ERSX 3S2DB 1KNEA 5E4XA 2NTSA 2HCIA 3L9AX 2CWAA 2E76C 2F0GA 3SGIA 3I56A 1RCVD 5H1SE 2B63H
chains in the Genus database with same CATH topology
5D14A 4HN7A 2XNAC 1F2ZA 1PRTD 4HSVA 1SE4A 1Q1EA 3D4DA 1ZYRD 4DXGA 5NUCA 1UNSA 2MJ8A 3J80E 3BZDB 4Q5VA 2EYOA 3DMUA 5JVH3 2R61A 4QCLA 4OIJA 1EWHA 2V4DA 1HCZA 4HEDA 3BDLA 2F0WA 4G4KA 4BS9A 3CRLC 4X3TA 3T4AC 1TWGB 5G3LD 5FO9B 3I72A 1PTOH 2KEEA 1GUSA 1BF4A 1XYIA 3K57A 2BA0A 4CJ1B 3GD7A 5KNDA 3FDTA 3VYUA 5FKAC 3G7LA 1AFPA 1GHJA 1EYCA 2BDNA 4L6TB 1EOTA 3CKIB 5C4JB 2KECA 1D5MC 3BVGA 2EDGA 3DEPA 2F0TA 3DUZA 3LWUA 4L63B 5KRUA 4KHZA 4C3HG 1RKNA 2JA7B 3NWSA 4EVOA 3HOUB 1F9SA 2D5DA 1T5XD 1IHZA 1F2LA 1HFGA 3N6RA 1JB3A 4OIKA 3BYYB 1NCVA 2NN6G 2EYPA 2A73B 3MC0B 5LHY1 4O1NA 3T51B 2SDFA 2NTTA 3MXUA 4M8AA 2L5TA 1YNJD 2CQAA 2RSOA 4IQZA 1TS3A 4P2CB 3FKIB 1SDFA 3GTPB 2B2WC 2E2IB 1G8ZD 3S2HB 3BS1A 3EFXD 5C3XA 2JA5B 2EYFA 3C1EA 4KJNA 5CV4A 2E2HB 2B2VC 3BVMA 4FNFA 1AEXA 1Y8NB 4PQXA 2A68C 4R8IA 1HTLD 5M5YB 1LABA 3N52A 3T13A 2O4XA 3I90A 2VXWA 4WRDA 1LTRD 4ME5A 2CVRA 1OXSC 3GTOB 1H9JA 1EL0A 3DXJC 2AWNA 4KK7A 2RKSA 2F0KA 5E3FA 1BCPB 1G6ZA 1JWUD 1EIGA 1BBXC 2J4XA 4XYQA 3NTKA 2I46A 3DWAA 2NN6H 1PZID 2F4IA 2DN8A 1F2YA 4A3FB 3A8IE 5ELDA 1T5EA 1PZJD 4M1UB 1CFMA 2KCCA 2MUYA 3LWEA 2RSNA 2HUGA 4IUPA 3Q22A 3KUPA 3NE5B 1Q8IA 3FPUB 3NP8A 2NUCA 4F8MA 4JBWA 3J7AV 2QCPX 2FMMA 1A3UA 1SE2A 4HR7B 1PFMA 2NBFA 1U9RA 5IGDA 4A3JB 4DAYA 2K5WA 4RAUC 1JCKB 4FF4A 2X6GA 3C3LA 3TDQA 3CRKC 4CHTB 2KVMA 2PPBC 3E6ZX 3R8BA 2CW0D 1I4QA 2L4NA 3A55A 5EJWA 4DNTB 3S15B 1PMRA 2AWOA 1BR9A 2F0HA 4FF3A 1LO5D 4NW2A 3NQTA 1TKWB 4C3IB 2CHBD 4KI0A 4WFN3 1H9MA 2K5DA 1JWMD 3MEHA 1EEFD 3I4NB 1EY9A 2JXMB 1TWAB 1I6HB 4G7OC 3MHBA 5IT9L 1DCZA 4C2MB 5C44B 4L8JA 1KNAA 5EBDA 1HTPA 3DEOA 5K36G 2BDOA 4DN4M 3D3RA 3MXNA 5EKKA 1EQTA 1IYVA 2XWJB 3NBIA 1WTWA 1SMYC 3CHBD 2KQ3A 3I8ZA 2FFKB 2FHTA 3K5NA 1GUOA 1AW7A 2B63B 3I91A 1EIHA 2RQXA 1QB5D 2WB1B 5C0XG 3M4YA 3FEWX 2DY8A 1S4ZA 2IWHA 1AZQA 1MBYA 1KDCA 3NPPA 1ZKOA 1SNOA 4HCSA 1JWSD 1DYQA 1IYUA 1NSNS 3AB9A 3S1RB 3QIAA 1PTOB 1O80A 2EYJA 3C46A 1G2SA 4DK1A 3NTHA 1S5FD 3IKJA 3BYTB 2JA6B 4ID6A 2KUMA 5C4ZA 4XIGS 5IGCA 1B53A 4PMWA 1AN8A 1ML0D 4J1MA 3SE0A 3A56A 1BCPF 2DNCA 1JICA 1HA6A 2K7VA 2ZXPA 2KJXA 3PUYA 4PNYA 1I4PA 4C3JB 2NN6I 1SNDA 2AQ1B 4Z9CB 4X3UA 1PXUA 2EZVA 1PRTB 2G9DA 3GV6A 4K14A 1Z47A 4RH6A 4X3KA 4FO2A 3S17B 4KY6A 4IURA 1A3VA 1SYDA 3QO2A 5I6YA 2N88A 1FR3A 4A3EB 1EQVA 1O7YA 3GV3A 3OIQA 1RD9D 1GJXA 4FVMA 3T53B 5A2QL 4Y7NB 3VR4A 4TKOB 2K33A 4ZUIA 2Q8RE 5JEAG 1JE4A 5A35A 3HEJA 4KV6A 1B1ZA 4RGTA 4EQNA 2F0EA 3H0GB 4HAEA 3FVQA 1SAPA 1ET6A 5JOBA 3NSWA 5EKIA 3QOJA 2YU9B 1L0YB 3A54A 3D8GA 2B39A 1L0XB 1VDZA 1PLFA 1J9OA 1SNMA 3OSOA 4LJZC 1MSGA 1NUCA 5CV7A 2NWGA 2EXZA 4HMJA 2J0TD 1I3QB 4K6LA 1RHPA 3A7LA 2MGSA 1G91A 4KKTA 1KAAA 3NWTA 5C5LA 2NVQB 3M7GA 1Q12A 1GUWA 3I70A 4C56C 1S5DD 1V1PB 2B8GA 2EY1A 3MA2B 1SNCA 2OF1A 1EZ6A 3D4RA 5BN4A 3VR5A 4RKBA 3R2IA 1U4LA 3HOYB 3ZYYX 4QIWB 4A3BB 4HTHA 4HMIA 4A3GB 1ENFA 1EYDA 2QF7A 4TQUS 5ELBA 3EQLC 2L0CA 4XTCS 1RDPD 1IL8A 1F2MA 2JE6I 2B2TC 1CZWA 3I3CA 3IFDA 1DOLA 3QG1A 3KK7A 3UI2A 1MGSA 2F0MA 1EWCA 2NYZD 1GOZA 3KF8A 4YIJA 1O78A 2XVSA 5KIXA 4IUNA 3PO3B 1FD7D 1EY8A 3S16B 4G57A 2F0UA 3GTLB 1I6VC 1TS2A 1HQRD 1WTRA 1PTOF 1Y1WB 3VYRA 2ZT9C 4K5WA 3HKZB 1MSHA 4ILWA 4EQOA 2XWBB 1STBA 5JJZA 1DONA 2B8FA 1A2UA 3BVZA 4QUFA 4C1NK 4E6IA 3GTGB 3GTQB 1RJTA 3PUZA 2FINB 2E75C 3S1MB 3D6WA 1TIID 2SEBD 4DNRB 2WIIB 4K8JA 1I4XA 4ZAIA 4A3IB 4QMGA 1EY7A 2E74C 3EJIA 4B08A 4R8NA 2RVLA 1F9PA 3OMGA 1VCIA 1B9NA 3G6JB 3D31A 1PRTF 4I65A 5M9OA 1Q90A 2R7ZB 1U4PA 1KABA 2WP8J 3HGBA 2BOSA 1D5ZC 2ENBA 4RGMA 1QNUA 2LMCB 2WV6D 2NVYB 3K58A 4CBVA 1KLGD 3IL8A 4IZ8A 1RTNA 5C0XI 3K0YA 1BCPC 2K1BA 1M4VA 2B2UA 5EQ0A 3H94A 2R92B 3T16A 4S3SA 5D3IB 4QF4A 3TZUA 3I4MB 1DM0B 5I9PA 1ENAA 2O5JC 1A2TA 4CKBA 3VR2A 4FF2A 4CGYB 2VB3X 4NP5A 2B2YC 1EEID 2Z4HA 5AFWA 4HSPA 1TWCB 3OIPA 5T1IA 3H6MA 5IOCA 1PYWD 5EPLA 5LL6X 3MFGA 1H9SA 3P1HA 5ISRA 4KKUA 2KOLA 2ICIA 1QG7A 4LMQD 3PIP3 2RBMA 2PO4A 1SFOB 1O7LA 3RZDB 1ZEQX 5C4HA 1TT2A 4IALA 4OHJA 3TSSA 5C0XJ 1YNNC 3J7YW 2F0JA 4PMBA 5KNCA 1FNWA 2QEJC 2Z8LA 1D1IA 1KDBA 4CKCA 4Q0FA 1Q1BA 3TN2A 1BDOA 1X3PA 5COYA 2IW3A 3J7AF 4OGQC 4V0BA 1STEA 5TSSA 2WKCA 4B9XA 3W3AA 5IGGA 4G7HC 3WOFA 3GTJB 5IIFA 1SE3A 2SNSA 1CTMA 2F0IA 4RHSA 5DM63 3U9OA 1Y8OB 3K59A 2D9UA 4OL7A 1QNKA 2L55A 1LLRD 3SK4A 1E2VA 2XSCA 4WJWA 1U4MA 1STAA 2F0DA 1EU3A 2HQEA 1LTID 4BY1B 2IX3A 1ESFA 3PV0A 4V190 3M4OB 1CQVA 2B2TA 3K6OA 2LY7A 1E2WA 4QUCA 1C48A 3NUCA 2VNUD 5EKLA 3KLRA 1STYA 4C1NI 1LT3D 1EFID 5E4WC 1AZPA 4KTAA 5CR3A 3DWQA 2JYOA 1NR2A 1ILPA 3QB3A 5BN3A 4XXEA 1HHVA 2HDMA 3OWFA 1TWFB 3LX0A 4TSSA 3K5MA 5KGUA 3HOVB 1QE6A 1IKLA 4EGVA 2PW5A 4ZKBB 2AUKA 3RD4A 3X3MA 1ENCA 4RGOS 2A6EC 5JEAJ 3RZOB 2BCOA 4OO1G 1I50B 1SYEA 3Q6SA 3ND9A 5T1GA 1S5CD 1WTOA 3MFYA 2R3ZA 1F9QA 4XQQA 4EQPA 3S14B 2IX1A 4FP5D 1D2BA 3HG9A 1X32A 2F1MA 2WINB 3AMUA 1UEAB 1SNPA 2RA4A 1TS5A 4XYOA 4N9PA 1EZ8A 2O5IC 1BXTA 1U4RA 1PRTC 2X6LA 3HOZB 1OXVA 3EVQA 5ELEA 1HPCA 1ZYRC 2IX0A 2L11A 2XRSD 4KHVA 3E0JA 1VMCA 3NXWA 4I7ZC 4IUUA 1HUNA 4DK0A 5HURA 1OXUA 2B2WA 3S1QB 3RUZA 5IGEA 3HP3A 4IFDG 2PZTA 2YYZA 5EGTA 1VF5C 5IGFA 1ICWA 2L9HA 2B2VA 4CJ0B 2Z1CA 3GP7A 3NHHA 4RHRA 5FLXL 3ONAB 4FXDA 2WKDA 3J81L 4FXGC 2EY2A 3KBGA 1W6KA 5C3EB 3VA5A 1C4QA 2A68D 5K36H 2PZUA 4DA2A 2D62A 3MZ5A 4UDUC 5E1FA 3PMFA 2K28A 4N9TA 3WOEA 5CC4A 4BY7B 1D5XC 3P20A 2AQ3B 1KLUD 2KHSA 4DU9A 5M5WB 4CJ2C 2F3VA 1LT5D 3VR3A 2L12A 1SYFA 1EY4A 3C1FA 2X69A 3MVVA 1ONLA 4C3IG 4RFBA 2QILA 3J80L 2K5QA 2A69C 5C0XH 3L3OC 5KEEA 3CQZB 2E2JB 1BQQT 2NVXB 2EY6A 2TMPA 5DM73 5IT9E 3OPOA 2D2CC 4JK1C 2EE1A 2PCFB 5EBCA 5J1ZA 5F2DA 3A8JE 2EYHA 1KTKA 3V96A 1SYGA 3LNNA 4K5XA 1R9TB 3RLFA 1B9MA 5CV6A 2O2LD 1G291 2L1BA 2F0FA 4ZKCB 3M3YB 1CQFA 1ZXTA 4ZRZA 3H91A 3TZDA 1Y8PB 1I4RA 3BG3A 2F03A 1W6JA 1S5BD 3KLSX 5FO7B 3AU7A 4PV1C 2LS01 4IUVA 5JAVA 1HQMC 2N55A 4DXFA 3A8KE 4H0LC 2TSSA 3SXHA 4K6DA 1QOHA 5C3WA 4RWSC 3I73A 1PDQA 3C2PA 3QWNA 2Q8IB 1LTGD 5ELCA 2M9VA 4CKEA 3SVMA 5FLXE 4H13C 4RCOA 3DHQA 3QOLA 4K2LA 2EJFC 4K2KA 4A3DB 1WCMB 2NZ1D 3E5SA 3SHLA 3KLSA 2MP1A 4DFAA 1H9RA 3HRZC 3SEBA 4ZK9B 1HA5A 2KCNA 1WD1A 5I9OA 5JEAH 2PZWA 5FO8B 2GA4B 4BA2I 4TRDA 3FRPB 2A74C 1MI2A 3VYSA 3MWYW 3D4WA 4A93B 4C3JG 2EPBA 3PUVA 1SMYD 4UAIA 3OMCA 1GUGA 1A3TA 1JQYD 3R93A 3HS0C 1IW7C 1RODA 5CV8A 1V8QA 1H9SB 4KJOA 3NTIA 4KMUC 2QDBA 2Z4IA 2VB2X 5K5PA 1LTTD 1WVLA 5CORA 4DF7A 3OHXC 1LTBD 4ZQ3A 2JP1A 2K6AA 3DWPA 1SBBB 2JEBI 4MIUA 4OO1I 1JOOA 3U9SA 2CW0C 3KBXA 3K7AB 5J22A 5KNBA 5A2QE 1M8AA 1SJHD 1I4HA 2K01A 2OEOA 1HUMA 1DJRD 3WDNA 4QB4A 2IJ0A 1OO9B 2F0QA 2OXPA 4RA8A 1BNZA 4RCNA 1XXGA 1TQOA 2R93B 1B50A 1D1KA 1TS4A 5FK9C 4A3MB 1WTXA 4LAAA 2C5CA 1TWHB 2WAQB 4RKLA 4A3KB 4MHEA 2M2LA 4G7ZC 4X3SA 2JA8B 3GTKB 4KY7A 3NK9A 4IN3A 4F87A 2EJGC 2A5HA 1KDAA 1ESRA 3K5OA 4GZYC 1R4PB 1GUTA 1LV9A 1V1PA 5C4XB 1DZ1A 4RGNA 2EJMA 3FPPA 1SYBA 3VR6A 3QJYA 5G3LF 3IAYA 2EVBA 2A69D 4IFDI 4KD4A 4R9WA 4O42A 2XN9C 3EROA 1WTPA 3SK8A 2FJ2A 1F9RA 4J8QA 1OXTA 2F3WA 1JOKA 2DNEA 3PIO3 1SJED 3ND8A 5CYUA 5FOBB 1R4QB 4NDXA 1JR0D 1J8IA 1HRJA 3T56B 1VMPA 4NMZA 4XQJA 1MD2D 2H1EA 2PYKA 4B9WA 3P75A 1BO0A 3L7ZC 2JEAI 4K5VA 4XT1B 5JPNC 4BBSB 3OWEB 2DY7A 2EYMA 1STGA 1TR5A 3GQBA 2RDHA 5D3DA 2JSOA 1EYAA 1XWEA 2EOTA 1K83B 4IFDJ 1C8CA 3HZXA 4XDXA 1II3A 5KYIA 1E0BA 2I07B 2MPMA 2K03A 1CA6A 4KKSA 1QILA 2WACA 1BUVT 4XT3B 3TP7A 1IKMA 4IUQA 1ILQA 5C5MA 2K05A 1AP0A 3Q0AA 5ELFA 3X3NA 4FF1A 2NVTB 3A7AB 5DEHA 2SOBA 1X3QA 2ZXRA 5I4DA 3PO2B 1E2ZA 3TP5A 1K8MA 5DNFA 3D6CA 1GXDC 4NKLA 2BE5C 1TY0A 2A6HC 1K8OA 3SK5A 5M5XB 3TP8A 1CHPD 3S9WA 1DOMA 4DAVA 1TVXA 1Q3LA 1IW7D 1Z7TA 2C9OA 4BWGB 3K5LA 1CI3M 5CV9A 4AYBB 3V2TA 2RDGA 1LTSD 3ERQA 2VUMB 3OW7A 1JOQA 2NB0A 3I4LA 3R3OA 2KA7A 1EY6A 1EY5A 3SR1A 2EY5A 5CV5A 1PZKD 4LK1C 3BDCA 1PTOC 3JAML 1EY0A 1Z6HA 1B44D 2R6GA 1A15A 2PMZB 2E2DC 4ABNA 1DXMA 3M85A 1CHQD 1BOSA 2HDLA 1EU4A 5LL6S 1S5ED 1NAPA 4PMCA 1CM9A 4BA1I 1UAPA 4DAPA 1WD0A 3H09A 2PW7A 4F7XA 3NQIA 4U68A 3M7NA 1B4OA 5M3FB 1XX8A 2MHVA 1CK1A 3MXGA 1QJOA 3W2DA 2SNMA 2G9HD 3F2UA 1BCPD 1I4GA 5CBAE 2B2YA 2F0OA 5D65A 4ZUJA 2XIWA 1LACA 1VF7A 3TBIB 3ITPA 4BBRB 2K32A 4FYDA 4XQNA 2PNRC 1LT4D 1QWYA 2AQ2B 1O7ZA 1QCBD 2FMCA 4OO1H 2K04A 4KN7C 5I2YA 1B2TA 4ODGA 1STNA 1WTQA 3EA6A 1UUPA 4KN4C 4J6HA 1TY2A 2BA1A 2F0VA 5C6AA 1WTVA 1JORA 1GHKA 2QKIC 5EPJA 1Y1VB 1SEBD 1ET9A 2Q8TA 1YNND 2J7ZA 5HGTA 1PFBA 5IODA 2HCCA 1FGBD 1LTAD 1LT6D 4ZYSA 1B3AA 1RTOA 4ZLTF 1RF2D 1NR4A 5CBEE 5DAUA 1CT1D 4F88A 4IUTA 1V43A 1XTCD 2ID0A 3PUWA 3SDZA 4U673 1Y69U 3IFTA 5KYLA 4HCEA 5JPMC 4H44C 3FMCA 4KY5A 4DGZA 1PFNA 1SNQA 5M3MB 3MAQA 2XRQD 3JAME 1A6XA 3S1NB 3HOWB 1CZGA 4IFDH 3RMHA 1TU2B 2PQEA 1GUNA 2B2UC 2KEDA 2F0LA 4H7BA 2OT2A 1DOKA 1YNJC 3NBHA 3PUXA 5CGKA 5I6WA 2F0PA 3VA7A 2BE5D 4KD3A 4ULLA 2A6HD 3MXPA 3CU7A 5JVG3 1HFNA 5I2XA 3OOCA 2ZXOA 3R2TA 5EPKA 1G2TA 2AUJD 5CMDA 3V05A 3GTMB 2H4OA 3MTSA 3HOXB 2M00A 2RDFA 2LFNA 2IL8A 3VYTA 3GO5A 3BDOA 4MN3A 1FNUA 1OXXK 1SXTA 3Q23A 1DD2A 3TMEA 3TP6A 1HXYD 4C3HB 1FNVA 3H3VC 2A6ED 1H9KA 1JC7A 2Y0SB 3DM1A 1D6EC 3SK6A 1V1OA 2ICEC 1FYCA 3URYA 1STHA 2F0SA 1PTOD 2IT1A 2LKVA 5BN5A 3O13A 5IGBA 1CA5A 3J81E 1SSOA 3P7JA 3Q24A 4FXKC 2F0NA 5J39A 1SYCA 4WORA 2EYLA 2IPKD 1F77A 4K8IA 3S2DB 1KNEA 5E4XA 2NTSA 2HCIA 3L9AX 2E76C 2F0GA 1RCVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2X A;  2I46 A;  5I2Y A;  2M9V A; 
#chains in the Genus database with same CATH topology
 1PFS A;  1YIT A;  5D14 A;  4X64 L;  4HN7 A;  3HOZ H;  2ZM6 Q;  1CKO A;  2XNA C;  4L5Q A;  1F2Z A;  1PRT D;  4HSV A;  1SE4 A;  1Q1E A;  3W1B A;  3D4D A;  1ZYR D;  4DXG A;  1BBU A;  1GVP A;  3OTO Q;  2VQF L;  5NUC A;  5FJ8 H;  1UNS A;  2MJ8 A;  3J80 E;  3BZD B;  1YHA A;  4Q5V A;  1EUJ A;  2EYO A;  1H95 A;  2Z0S A;  3DMU A;  5JVH 3;  2R61 A;  4QCL A;  3S1Q H;  1IBK L;  4OIJ A;  1EWH A;  2V4D A;  1HCZ A;  4HED A;  3HOW G;  3BDL A;  5LMN Q;  2F0W A;  4G4K A;  4BS9 A;  3CRL C;  4X3T A;  3T4A C;  1VQF A;  3CCU A;  4LFA L;  3S1R H;  1TWG B;  5G3L D;  2DGY A;  5FO9 B;  3I72 A;  2ALY B;  1PTO H;  2KEE A;  4LUV A;  4IJL A;  1GUS A;  1BF4 A;  2QGQ A;  4BXX H;  1XYI A;  5C3E H;  4UPA A;  3K57 A;  2BA0 A;  4CJ1 B;  1PVO A;  1YEZ A;  2HHH Q;  3GD7 A;  5KND A;  3FDT A;  3HFZ B;  3VYU A;  1KRS A;  2IHE A;  3G7L A;  5FKA C;  1AFP A;  1GHJ A;  3ULJ A;  1CSP A;  1EYC A;  4BY7 H;  1BVS A;  2BDN A;  4L6T B;  4CDF C;  3HOX G;  1EOT A;  3CKI B;  5C4J B;  2KEC A;  5IWA Q;  1D5M C;  3BVG A;  4JI8 L;  4H02 A;  5M5W H;  2EDG A;  1SMX A;  3DEP A;  3KJP A;  2F0T A;  5JJI A;  3DUZ A;  3LWU A;  4L63 B;  4OWX B;  1IL2 A;  3RLO A;  4KHZ A;  5KRU A;  1KHI A;  1RKN A;  4QIW E;  4C3H G;  2JA7 B;  1NMF A;  5IP7 G;  4KHP Q;  3NWS A;  4EVO A;  2CWP A;  2KHJ A;  2E5L Q;  4QJF A;  3HOU B;  1GD7 A;  1TXY A;  1F9S A;  2D5D A;  1T5X D;  1IHZ A;  3CQZ H;  1F2L A;  1HFG A;  3N6R A;  1JB3 A;  4OIK A;  2E2J H;  3BYY B;  4GS3 A;  1ASZ A;  1NCV A;  2WFW A;  4P74 A;  2NVX H;  1GKH A;  4A3D G;  4UP8 A;  4Y7N H;  2NN6 G;  2EYP A;  1K73 C;  2A73 B;  3MC0 B;  5LHY 1;  4O1N A;  3T51 B;  1XMO L;  2QEX A;  3VDY A;  2SDF A;  2NTT A;  3MXU A;  4M8A A;  2MNA A;  2L5T A;  1R9T H;  1YNJ D;  4IPH A;  2CQA A;  2PQA A;  2RSO A;  4IQZ A;  1TS3 A;  4P2C B;  3FKI B;  1SDF A;  3GTP B;  2B2W C;  2E2I B;  1G8Z D;  3S2H B;  3BS1 A;  2NZO A;  3EFX D;  5C3X A;  5AJ3 L;  2JA5 B;  3M3Y H;  2EYF A;  3C1E A;  4A3C G;  1E7Z A;  4KJN A;  5CV4 A;  2E2H B;  2B2V C;  3BVM A;  4FNF A;  1AEX A;  1Y8N B;  4PQX A;  2A68 C;  4R8I A;  1HTL D;  5M5Y B;  1LYL A;  4QQB X;  1LAB A;  3N52 A;  3T13 A;  2O4X A;  3I90 A;  4GNX C;  1JB7 A;  3T1H Q;  4LWC A;  1S3O A;  2VXW A;  4DR2 Q;  4WRD A;  1PHJ A;  4DUZ L;  1LTR D;  4JI6 Q;  4ME5 A;  3CME A;  2CVR A;  1OXS C;  4GOP C;  3GTO B;  1H9J A;  3T1Y Q;  4CDE C;  1EL0 A;  3DXJ C;  2AWN A;  4KK7 A;  2RKS A;  3NEN A;  2F0K A;  4DV5 Q;  2R93 G;  5E3F A;  1BCP B;  1Q82 C;  2CH4 A;  1G6Z A;  1JWU D;  3I2Z A;  1W2B A;  1EIG A;  4DR6 Q;  1FGU A;  1BBX C;  2J4X A;  4R4C A;  4XYQ A;  3NTK A;  4X66 L;  4JYA Q;  2QW7 A;  2I46 A;  3DWA A;  4A3D H;  1A63 A;  2NN6 H;  4UP9 A;  1WCM H;  4A3G H;  1PZI D;  2F4I A;  2DN8 A;  1F2Y A;  4A3F B;  3A8I E;  5ELD A;  1T5E A;  4LF5 Q;  1PZJ D;  4DV7 Q;  4A75 A;  4M1U B;  2WAQ G;  1CFM A;  2KCC A;  2MUY A;  3LWE A;  1XPR A;  2RSN A;  2HUG A;  4IUP A;  3Q22 A;  3KUP A;  1PH6 A;  1VQL A;  3NE5 B;  1CSQ A;  1Q8I A;  4DR5 Q;  2UXC Q;  4X62 Q;  2UU9 L;  3FPU B;  3NP8 A;  2JA8 G;  1X55 A;  4DK6 C;  4A93 H;  2NUC A;  4F8M A;  4JBW A;  1K9M C;  3J7A V;  2QCP X;  2FMM A;  1A3U A;  4GN4 B;  3TQY A;  1SE2 A;  4A3C H;  4HR7 B;  1PFM A;  2NBF A;  3CXC A;  1U9R A;  1YNX A;  3HOU G;  1AH9 A;  5IGD A;  4A3J B;  4DAY A;  3S16 H;  3F2D A;  2K5W A;  4RAU C;  3I7F A;  1JCK B;  1HH2 P;  4FF4 A;  3RR5 A;  5GQO A;  2X6G A;  3CCM A;  1Y1W H;  3TDQ A;  3CRK C;  3C3L A;  4CHT B;  1UE6 A;  5FLX c;  2KVM A;  2PPB C;  3H3V H;  3E6Z X;  3J81 c;  3R8B A;  3K7A H;  3U58 A;  2CW0 D;  1XNQ Q;  1I4Q A;  2L4N A;  3A55 A;  5EJW A;  3F8T A;  4DNT B;  3CCL A;  3S15 B;  1PMR A;  4OEM B;  2AWO A;  3ULL A;  2DUD A;  4DR3 Q;  1BR9 A;  2F0H A;  2ZJQ A;  4FF3 A;  4DR4 L;  2R93 H;  1LO5 D;  4NW2 A;  2Z6B A;  4DV0 L;  3NQT A;  1TKW B;  4C3I B;  2CHB D;  4KI0 A;  4WFN 3;  1H9M A;  2K5D A;  2B29 A;  1JWM D;  3MEH A;  1EEF D;  3Q8D A;  4A3M H;  3I4N B;  1N33 L;  3U50 C;  1EY9 A;  1TWH H;  2JXM B;  1TWA B;  1VQC A;  3W1G A;  1I6H B;  4A3K H;  4G7O C;  3MHB A;  2P5Z X;  1RL2 A;  1DCZ A;  3UE0 A;  5IT9 L;  2F4V Q;  4C2M B;  5ELO A;  2N3S A;  5C44 B;  4L8J A;  1KNA A;  5EBD A;  5GAH C;  3CCQ A;  2L15 A;  3F2B A;  1HTP A;  3U4Z A;  3DEO A;  5K36 G;  2JA8 H;  1XJV A;  3GTK H;  2BDO A;  4PZ7 A;  4DN4 M;  3D3R A;  3J7A 5;  3MXN A;  5EKK A;  4LF4 Q;  3TS0 A;  3M9B A;  1EQT A;  1IYV A;  2XWJ B;  1QZG A;  3OYY A;  1KIX A;  5C4X H;  3NBI A;  1WTW A;  1SMY C;  3CHB D;  2KQ3 A;  1EQR A;  3I8Z A;  4K0K L;  2FFK B;  2FHT A;  3TS2 A;  3K5N A;  1GUO A;  1AW7 A;  1VQM A;  1U5K A;  2B63 B;  3I91 A;  1EIH A;  2RQX A;  3LGJ A;  1QB5 D;  4NXN L;  3K81 C;  1QVF A;  4LFC Q;  2WB1 B;  5C0X G;  3M4Y A;  1B7Y B;  3FEW X;  2CQO A;  2DY8 A;  2A8V A;  1TWC H;  1S4Z A;  1A0I A;  2IWH A;  1AZQ A;  1MBY A;  5BR8 L;  3KDF B;  4LF7 L;  1KDC A;  3NPP A;  1ZKO A;  1SNO A;  2CKZ B;  4HCS A;  4LFB L;  1JWS D;  4GKK L;  2A19 A;  4OEL B;  1YVC A;  4AYB E;  2EIF A;  2ZTC A;  1DYQ A;  4JV5 Q;  2ATW A;  5IYD H;  1CKN B;  4GKJ L;  1IYU A;  1NSN S;  3A5Z B;  3AB9 A;  4HIO A;  3S1R B;  4NPS A;  3QIA A;  1PTO B;  4DR7 Q;  1O80 A;  4J15 A;  4BBS H;  3OW2 A;  2EYJ A;  2UUB Q;  1G2S A;  3C46 A;  4DK1 A;  3NTH A;  1S5F D;  2BH2 A;  3IKJ A;  1GM5 A;  1IBM L;  3BYT B;  4A3J G;  2JA6 B;  4ID6 A;  4DUY L;  2KUM A;  5C4Z A;  4XIG S;  5IGC A;  1B53 A;  4PMW A;  1MJE A;  1AN8 A;  1K83 H;  1ML0 D;  1WI5 A;  1VQN A;  4J1M A;  3AYH B;  3SE0 A;  1CKM A;  4B3R L;  3A56 A;  1BCP F;  4ZCK A;  3UDI A;  2DNC A;  1JIC A;  4YWL A;  1HA6 A;  1N32 L;  2K52 A;  2K7V A;  2ZXP A;  4ALP A;  2KJX A;  1DGS A;  3BJU A;  4DV6 L;  3PUY A;  2HQL A;  4PNY A;  1I4P A;  4C3J B;  2NN6 I;  1SND A;  1K0R A;  2AQ1 B;  4Z9C B;  4X3U A;  1PXU A;  4JI5 L;  2HIX A;  2EZV A;  4IO9 A;  1SN8 A;  1PRT B;  4LF9 Q;  2G9D A;  3GV6 A;  4PZ8 A;  4K14 A;  1Z47 A;  4RH6 A;  2UUC L;  4X3K A;  4FO2 A;  3S17 B;  4KY6 A;  4IJH A;  4POF A;  4IUR A;  5HGQ A;  2LXK A;  1A3V A;  1SYD A;  2JJQ A;  3QO2 A;  5I6Y A;  2N88 A;  1FR3 A;  3I4N G;  4N8X 1;  4MTN A;  4A3E B;  1EQV A;  1O7Y A;  3PO2 H;  3E3X A;  3GV3 A;  3OIQ A;  1RD9 D;  1GJX A;  5C44 G;  4FVM A;  3T53 B;  5A2Q L;  4Y7N B;  5M5X H;  1X56 A;  3VR4 A;  4TKO B;  1K3B C;  1N34 Q;  3F1Z A;  2K33 A;  4ZUI A;  2LXJ A;  2Q8R E;  1XNR L;  1X54 A;  5JEA G;  5M3F G;  2I5M X;  1C7Y A;  1JE4 A;  5A35 A;  4A4I A;  3HEJ A;  4KV6 A;  1Z9F A;  1B1Z A;  4HJ7 A;  4RGT A;  1FL0 A;  4EQN A;  2F0E A;  4I7A A;  1ASY A;  3H0G B;  4HAE A;  4DV4 Q;  1LM0 A;  1JMC A;  4IPG A;  3FVQ A;  1E24 A;  1WJJ A;  1SAP A;  1ET6 A;  1IBL Q;  5JOB A;  3NSW A;  5EKI A;  3QOJ A;  2VUM H;  2MFI A;  2YU9 B;  1L0Y B;  3A54 A;  3D8G A;  2B39 A;  1HNW L;  1L0X B;  1VDZ A;  4DV2 Q;  1PLF A;  2UXD Q;  1J9O A;  1SNM A;  2WB1 G;  3OSO A;  2AHO B;  4LJZ C;  1MSG A;  1NUC A;  4YCW A;  5CV7 A;  2NWG A;  2YTY A;  2EXZ A;  4HMJ A;  1B8A A;  4X65 Q;  2J0T D;  1I3Q B;  4K6L A;  1RHP A;  3A7L A;  2MGS A;  1YIJ A;  1G91 A;  2KCM A;  4JI2 L;  4P72 A;  4KKT A;  1KAA A;  3NWT A;  4MTK A;  5C5L A;  2NVQ B;  1P16 A;  3M7G A;  2AMC B;  1Q12 A;  3CF5 A;  1GUW A;  3I70 A;  4C56 C;  5EAY A;  1X3E A;  1S5D D;  1V1P B;  2B8G A;  2EY1 A;  3MA2 B;  1SNC A;  1PH5 A;  2OF1 A;  1EZ6 A;  3D4R A;  3CCS A;  5BN4 A;  3VR5 A;  1HZC A;  1IYJ B;  1N36 Q;  4JI7 Q;  3UDX A;  4RKB A;  3R2I A;  2Z6K C;  1U4L A;  1X3G A;  3ZYY X;  3HOY B;  4QIW B;  2JA6 G;  4HTH A;  4A3B B;  4HMI A;  1NTG A;  4A3G B;  1ENF A;  1EYD A;  4AH6 A;  2QF7 A;  3DLL A;  1XPO A;  1UEB A;  4TQU S;  1VQI A;  5ELB A;  4X6A H;  3EQL C;  2L0C A;  4XTC S;  2ES2 A;  1RDP D;  1IL8 A;  2JA9 A;  1F2M A;  2JE6 I;  2C35 B;  2Q2T A;  2B2T C;  1CZW A;  3I3C A;  4YY3 L;  3IFD A;  1DOL A;  2PQA B;  3QG1 A;  3KK7 A;  2HIV A;  3KF6 A;  1U0L A;  3UI2 A;  5M3M G;  1S40 A;  1KAW A;  1MGS A;  4NXM L;  2F0M A;  1EWC A;  4JW0 A;  2NYZ D;  1GOZ A;  3K7U C;  3PQI A;  4OON A;  3KF8 A;  4YIJ A;  1O78 A;  2XVS A;  5KIX A;  4IUN A;  3PO3 B;  1FD7 D;  3RN5 A;  4BBR H;  1EY8 A;  1VQ4 A;  4UP7 A;  3S16 B;  4G57 A;  2F0U A;  4A3E G;  3GTL B;  1I6V C;  1QVC A;  4R4O A;  1TS2 A;  4B3S L;  1HQR D;  1WTR A;  1PTO F;  1Y1W B;  4LF8 Q;  3VYR A;  1QZH A;  2ZT9 C;  4K5W A;  3HKZ B;  1MSH A;  4ILW A;  3J7Z C;  4EQO A;  2XWB B;  4Y52 H;  1STB A;  4CDC C;  5JJZ A;  1DON A;  2B8F A;  1A2U A;  3BVZ A;  3D0F A;  4EQ5 A;  4QUF A;  4C1N K;  1YZ6 A;  4E6I A;  3GTG B;  1Y1V H;  2D0P A;  3GTQ B;  1RJT A;  4LW1 A;  3PUZ A;  2FIN B;  4JVZ A;  2E75 C;  3S1M B;  3D6W A;  1E1O A;  1TII D;  2SEB D;  4DNR B;  2WII B;  4K8J A;  2CFM A;  1I4X A;  4YCU A;  4LF6 Q;  3CC7 A;  3A5U A;  4ZAI A;  4B3M L;  4A3I B;  1Q7Y C;  4QMG A;  1EY7 A;  2E74 C;  3EJI A;  4B08 A;  4R8N A;  2RVL A;  1F9P A;  1NY4 A;  3OMG A;  1HR0 W;  1VCI A;  1B9N A;  3G6J B;  3D31 A;  4IPD A;  4JI1 Q;  1PRT F;  2RF4 A;  4I65 A;  5M9O A;  1Q90 A;  2R7Z B;  1U4P A;  1KAB A;  2WP8 J;  4YHH L;  2G5D A;  3HGB A;  2BOS A;  1D5Z C;  2ENB A;  4RGM A;  4IOC A;  1I94 L;  1QNU A;  2LMC B;  3AQQ A;  2WV6 D;  1VQH A;  2Y0S G;  2NVY B;  3AFQ A;  3BU2 A;  3K58 A;  4CBV A;  1KLG D;  3IL8 A;  4IZ8 A;  1RTN A;  3CCJ A;  1WOC A;  5C0X I;  3EBE A;  4AQY L;  1VQJ A;  3K0Y A;  1XTD A;  5GRO A;  1BCP C;  2K1B A;  1PH7 A;  1M4V A;  2B2U A;  5EQ0 A;  3S1N H;  3HOW H;  3H94 A;  2R92 B;  3T16 A;  4S3S A;  5D3I B;  4QF4 A;  3TZU A;  3I4M B;  1DM0 B;  1JJ2 A;  4MZ9 A;  5I9P A;  1ENA A;  2O5J C;  1A2T A;  3ER0 A;  4CKB A;  4R1J A;  3VR2 A;  4FF2 A;  4CGY B;  4DV1 L;  2VB3 X;  4NP5 A;  4DAY B;  3HOY G;  1EWI A;  2B2Y C;  1IZ6 A;  3CCV A;  1EEI D;  2Z4H A;  4A3B G;  4UY8 C;  5AFW A;  1X65 A;  3E0E A;  4HSP A;  1PH4 A;  1TWC B;  3OIP A;  5T1I A;  3H6M A;  5IOC A;  1PH9 A;  1PYW D;  5EPL A;  5LL6 X;  3EIV A;  3MFG A;  1H9S A;  2UUA L;  1JJC B;  3P1H A;  1HR0 L;  5ISR A;  4KKU A;  2KOL A;  2ICI A;  1QG7 A;  2K5H A;  2ZJR A;  4LMQ D;  3PIP 3;  2RBM A;  2PO4 A;  1SFO B;  1O7L A;  3RZD B;  4APV A;  3GTM H;  1FJG L;  4OXP A;  1ZEQ X;  3HOX H;  4KLK A;  3E9I A;  1IXR A;  5C4H A;  1J5E L;  1TT2 A;  1VQD A;  4IAL A;  4NB3 A;  4OHJ A;  3TSS A;  1M90 C;  5C0X J;  1YNN C;  3J7Y W;  1LTL A;  4DV3 Q;  1HNX L;  2F0J A;  4LUO A;  4PMB A;  5KNC A;  1FNW A;  2QEJ C;  2Z8L A;  1D1I A;  3AFP A;  4C3H H;  3JAM c;  1KDB A;  4CKC A;  3PO3 G;  4Q0F A;  5IP7 H;  5LMN W;  1Q1B A;  3NEL A;  3TN2 A;  2VQE Q;  2PI2 E;  4DR1 L;  1BDO A;  1X3P A;  4JI4 Q;  1A8V A;  5COY A;  2WAQ E;  2IW3 A;  1HNZ Q;  3J7A F;  4OGQ C;  4V0B A;  1STE A;  2KHI A;  5TSS A;  2WKC A;  4B9X A;  1YBY A;  3W3A A;  3HKZ G;  5IGG A;  4G7H C;  3WOF A;  3GTJ B;  5IIF A;  5LMU L;  1N9W A;  4MNO A;  4DUY Q;  3MXN B;  5ELN A;  1L1O B;  1SE3 A;  2Z6K A;  2SNS A;  4DPG A;  1E3P A;  2I5H A;  1CTM A;  2F0I A;  4RHS A;  4POG A;  5DM6 3;  1Q8K A;  3U9O A;  1Y8O B;  3K59 A;  2OTJ A;  2D9U A;  4OL7 A;  1M1K C;  1QNK A;  2L55 A;  4A3I G;  1LLR D;  3SK4 A;  1XMQ Q;  1MKH A;  3S2D H;  1E2V A;  2XSC A;  4WJW A;  3OTO L;  4JBK A;  1U4M A;  1STA A;  3IRB A;  2F0D A;  1EU3 A;  2HQE A;  4JI0 L;  1LTI D;  4BY1 B;  2IX3 A;  1ESF A;  3PV0 A;  4V19 0;  3M4O B;  1CQV A;  1WTH A;  2JA7 G;  2B2T A;  1XPU A;  3K6O A;  2LY7 A;  1E2W A;  4QUC A;  1C48 A;  3NUC A;  2YTV A;  4DNI A;  4B3T Q;  2VNU D;  5LMN L;  5EKL A;  3KLR A;  1STY A;  4C1N I;  1LT3 D;  1EFI D;  5E4W C;  1AZP A;  4KTA A;  5CR3 A;  2IY5 B;  3DWQ A;  2JYO A;  1PH8 A;  1NR2 A;  1ILP A;  2VL6 A;  3QB3 A;  2V1C C;  5BN3 A;  4XXE A;  2R92 G;  3I4M G;  1HHV A;  1XNR Q;  2HDM A;  3OWF A;  1TWF B;  3LX0 A;  2HHH L;  4TSS A;  3K5M A;  5KGU A;  3HOV B;  1QE6 A;  4OX9 Q;  1TWG H;  1IKL A;  4EGV A;  2PW5 A;  4ZKB B;  2AUK A;  3RD4 A;  3X3M A;  4A3L G;  1ENC A;  4RGO S;  2A6E C;  5JEA J;  3I4O A;  2UXB Q;  3FKI G;  3BZK A;  3RZO B;  1E22 A;  2BCO A;  5IWA L;  4OO1 G;  2JA5 G;  1I50 B;  1SYE A;  3Q6S A;  3ND9 A;  5T1G A;  1S5C D;  1WTO A;  3MFY A;  2R3Z A;  1F9Q A;  4KHP L;  1WYD A;  2MO0 A;  3CPW A;  2E5L L;  4XQQ A;  3CC4 A;  4EQP A;  3J80 c;  3S14 B;  1V1Q A;  2IX1 A;  4FP5 D;  1D2B A;  3HG9 A;  1X32 A;  1Y14 B;  2F1M A;  2WIN B;  3AMU A;  1YHB A;  1UEA B;  1SNP A;  2RA4 A;  1TS5 A;  3EN2 A;  3HOU H;  4XYO A;  3NBH B;  4JI3 Q;  4N9P A;  1EZ8 A;  2O5I C;  1BXT A;  1JE5 A;  2ZTE A;  1U4R A;  4P73 A;  1PRT C;  2X6L A;  3HOZ B;  3B6Y A;  1OXV A;  3EVQ A;  5ELE A;  1HPC A;  1YJN A;  3CCE A;  2KCT A;  4GN3 B;  4EX5 A;  1ZYR C;  2IX0 A;  2L11 A;  1CUK A;  4DAM A;  2XRS D;  4KHV A;  3E0J A;  1VMC A;  3NXW A;  4I7Z C;  4IUU A;  1HUN A;  4A3F G;  1KD1 C;  4DK0 A;  3G4S A;  5HUR A;  1OXU A;  4X64 Q;  3ZJY C;  1HZ9 A;  2B2W A;  3S1Q B;  1VQ9 A;  3RUZ A;  2I0Q A;  5IGE A;  3HP3 A;  4IFD G;  2PZT A;  2VQF Q;  2YYZ A;  3FKI H;  5EGT A;  1VF5 C;  1QUQ A;  2MO1 A;  5IGF A;  2E2I H;  3GTP H;  1ICW A;  3S2H H;  2L9H A;  2B2V A;  4CJ0 B;  2Z1C A;  3GP7 A;  3NHH A;  4BY1 G;  4RHR A;  5FLX L;  3ONA B;  3T1H L;  4DR2 L;  1IBK Q;  4JI6 L;  4FXD A;  2WKD A;  2E2H H;  3J81 L;  4FXG C;  4GNX A;  1C9O A;  2EY2 A;  3KBG A;  1W6K A;  5C3E B;  3VA5 A;  1C4Q A;  2A68 D;  5K36 H;  4JCV E;  2PZU A;  4DA2 A;  2D62 A;  4LFA Q;  3MZ5 A;  4UDU C;  5E1F A;  4GOP A;  3PMF A;  2K28 A;  4DV5 L;  2PMZ E;  4N9T A;  3WOE A;  2Q2I A;  2VS1 A;  5CC4 A;  4BY7 B;  4A76 A;  1D5X C;  3P20 A;  2XTI A;  2AQ3 B;  4DR6 L;  4JYA L;  2HD3 A;  3GTO H;  1KLU D;  2KHS A;  4DU9 A;  5M5W B;  4CJ2 C;  1BBW A;  2F3V A;  3HOV G;  2EQS A;  1LT5 D;  3VR3 A;  2L12 A;  4DV7 L;  1SYF A;  3PSI A;  1EY4 A;  3C1F A;  5IE8 A;  2X69 A;  3MVV A;  1ONL A;  4C3I G;  1PH3 A;  4DR5 L;  4JC0 A;  2UXC L;  4RFB A;  4X62 L;  2QIL A;  3J80 L;  2K5Q A;  2NVT H;  2A69 C;  5C0X H;  2OQ0 A;  1PV4 A;  2OTL A;  4JI8 Q;  3L3O C;  3PGZ A;  4A3F H;  5KEE A;  1KQS A;  3CQZ B;  4QGU A;  1BQQ T;  2E2J B;  1GO3 E;  2N49 A;  2NVX B;  5GAG C;  2EY6 A;  2TMP A;  5DM7 3;  5IT9 E;  3OPO A;  2AKW B;  2LSS A;  3PF4 A;  1G6P A;  1KRT A;  2D2C C;  4JK1 C;  2EE1 A;  2PCF B;  5EBC A;  5J1Z A;  3KF8 B;  2GN5 A;  4JG2 A;  2XGT A;  5F2D A;  3A8J E;  2EYH A;  1KTK A;  3V96 A;  1SYG A;  2WB1 E;  3LNN A;  4K5X A;  1R9T B;  3RLF A;  1B9M A;  2F52 A;  5CV6 A;  1YJ9 A;  2O2L D;  1G29 1;  5HY6 A;  2L1B A;  4A3J H;  1XMO Q;  1XNQ L;  2B63 G;  1K0S A;  2F0F A;  1HJP A;  4ZKC B;  3M3Y B;  1CQF A;  3HOZ G;  1ZXT A;  4ZRZ A;  3H91 A;  1Q81 C;  2QDL A;  1KL9 A;  4FDB A;  4DR3 L;  1Y8P B;  3TZD A;  1EIF A;  1I5F A;  3UDF A;  1I4R A;  2MQH A;  3BG3 A;  5FJ8 G;  3PIP A;  5GAD C;  2F03 A;  2UUA Q;  1W6J A;  1S5B D;  5AJ3 Q;  3KLS X;  5FO7 B;  3AU7 A;  4PV1 C;  2JK8 A;  3S24 A;  2LS0 1;  2GVB A;  4IUV A;  5JAV A;  1HQM C;  2N55 A;  3S15 H;  2RHS B;  4DXF A;  2ASB A;  4GN5 A;  3A8K E;  3NEM A;  1YI2 A;  1CKN A;  1X9N A;  2F4V L;  3JC6 6;  1EFW A;  1MJC A;  4L5S A;  4H0L C;  2TSS A;  3SXH A;  4K6D A;  1QOH A;  5C3W A;  4RWS C;  3I73 A;  1PDQ A;  3C2P A;  3QWN A;  2Q8I B;  3I4N H;  1LTG D;  5ELC A;  2M9V A;  4CKE A;  4DUZ Q;  1TWA H;  2Z9H A;  3SVM A;  1I6H H;  2CH4 W;  3STB C;  4LF4 L;  5FLX E;  3CW2 C;  4H13 C;  4RCO A;  1VQO A;  1D8L A;  4C2M H;  3DHQ A;  4BXX G;  5C44 H;  3QOL A;  4K2L A;  2EJF C;  4K2K A;  5C3E G;  4A3D B;  1WCM B;  2NZ1 D;  3E5S A;  3MEF A;  3SHL A;  3U4V A;  3KLS A;  2DJG C;  2MP1 A;  5FLM G;  2R7D A;  4DFA A;  1H9R A;  3HRZ C;  3SEB A;  4ZK9 B;  1HA5 A;  2KCN A;  1WD1 A;  5I9O A;  5JEA H;  5M3F H;  2PZW A;  5FO8 B;  2GA4 B;  4RG1 A;  4BA2 I;  4BY7 G;  4TRD A;  4O2D A;  3FRP B;  4X66 Q;  2A74 C;  4LFC L;  1MI2 A;  3VYS A;  3MWY W;  3D4W A;  4A93 B;  3RN2 A;  4C3J G;  2EPB A;  2YTX A;  3PUV A;  3I55 A;  1SMY D;  3F2C A;  1UE7 A;  4UAI A;  4JBM A;  1NMG A;  3OMC A;  1RIP A;  1GUG A;  1A3T A;  1JQY D;  1EQQ A;  3R93 A;  3CC2 A;  3HS0 C;  1IW7 C;  1ROD A;  1Q86 C;  1L0W A;  2JQO A;  2VZA A;  5CV8 A;  2UU9 Q;  1NNX A;  1V8Q A;  1H9S B;  4KJO A;  3NTI A;  4KMU C;  2QDB A;  3UE1 A;  2Z4I A;  2K50 A;  2VB2 X;  5K5P A;  1VQB A;  1LTT D;  1WVL A;  5COR A;  4JV5 L;  4DF7 A;  4PZ6 A;  3OHX C;  2FXQ A;  4JI0 Q;  1JJG A;  1LTB D;  3CCR A;  4ZQ3 A;  2JP1 A;  2K6A A;  3DWP A;  1SBB B;  2JEB I;  1VQK A;  4MIU A;  3AEV A;  4DR7 L;  4OO1 I;  2D0O A;  5E7N A;  1VQE A;  1JOO A;  3U9S A;  2UUB L;  2CW0 C;  3KBX A;  3K7A B;  5J22 A;  5KNB A;  5A2Q E;  1M8A A;  1SJH D;  1I4H A;  2K01 A;  2OEO A;  1HUM A;  2EXD A;  1DJR D;  3WDN A;  4QB4 A;  2IJ0 A;  4HJ9 A;  4L5R C;  1OO9 B;  2F0Q A;  3J81 i;  2OXP A;  4RA8 A;  1BNZ A;  4RCN A;  1XXG A;  1TQO A;  4YWM A;  2R93 B;  3H0G G;  2Y0S E;  1C0A A;  1B50 A;  4RMF A;  1D1K A;  1TS4 A;  5FK9 C;  2JA6 H;  3M4P A;  3TRZ A;  4A3M B;  1WTX A;  4LAA A;  5FLM H;  2C5C A;  3RNU A;  1K8A C;  1TWH B;  1PH2 A;  2WAQ B;  4RKL A;  4A3K B;  4DR4 Q;  4MHE A;  4DV0 Q;  4LF9 L;  2M2L A;  4IOA A;  4G7Z C;  4N8F A;  2RCF A;  4X3S A;  3UDG A;  1X3F A;  2JA8 B;  4C3J H;  3GTK B;  1N33 Q;  4KY7 A;  3NK9 A;  2K75 A;  4HJ5 A;  4IN3 A;  4F87 A;  2Q2H A;  5M3M H;  2EJG C;  2A5H A;  1KDA A;  1ESR A;  3J80 i;  3K5O A;  4GZY C;  1R4P B;  1GUT A;  1LV9 A;  1V1P A;  3S17 H;  2R7F A;  5C4X B;  5IYB G;  1DZ1 A;  4RGN A;  2EJM A;  3FPP A;  1SYB A;  1L1O C;  1N34 L;  3VR6 A;  3QJY A;  5G3L F;  3IAY A;  2EVB A;  2A69 D;  4IFD I;  4KD4 A;  4R9W A;  4O42 A;  2A1A A;  4A3E H;  2XN9 C;  2OCE A;  3ERO A;  1WTP A;  4OWT B;  3SK8 A;  3ULP A;  2FJ2 A;  1F9R A;  1VQG A;  4LNQ A;  3G6E A;  4J8Q A;  1OXT A;  2F3W A;  1JOK A;  1WCM G;  4JOI C;  5JJK A;  1K3R A;  2DNE A;  1VQ5 A;  4K0K Q;  3HKS A;  5GAE C;  1LUZ A;  3PIO 3;  4DV4 L;  4A3G G;  1SJE D;  4L5T A;  3ND8 A;  5CYU A;  5FOB B;  1R4Q B;  4GLA C;  1IBL L;  4NDX A;  1JR0 D;  1J8I A;  4NXN Q;  3TEH B;  4DV2 L;  2RHQ B;  2UXD L;  1HRJ A;  3T56 B;  1VMP A;  3H0G H;  4R4I A;  4A93 G;  4NMZ A;  4XQJ A;  3CAM A;  1MD2 D;  2H1E A;  2PYK A;  4B9W A;  3P75 A;  1A62 A;  1BO0 A;  5BR8 Q;  3L7Z C;  2YU9 H;  4X65 L;  3HKZ E;  4LF7 Q;  2JEA I;  3KLW A;  4K5V A;  4XT1 B;  5JPN C;  5J3B A;  3L2P A;  1VQP A;  4BBS B;  3OWE B;  2DY7 A;  2EYM A;  1STG A;  2K14 A;  1TR5 A;  4WJ3 M;  5DLQ E;  4LFB Q;  4GKK Q;  3GQB A;  2RDH A;  5D3D A;  2JSO A;  4GLV B;  1EYA A;  1XWE A;  2EOT A;  4GKJ Q;  1NE3 A;  1K83 B;  3G71 A;  1Y1W G;  4IFD J;  3KYH C;  1C8C A;  1I3Q H;  3HZX A;  4XDX A;  1II3 A;  5KYI A;  1VQ7 A;  4JI7 L;  1N36 L;  1E0B A;  2I07 B;  2PI2 A;  5IY0 A;  2MPM A;  1G51 A;  5IT9 c;  1IBM Q;  1T9H A;  2K03 A;  5IYB H;  2K5V A;  2NVQ H;  1CA6 A;  4KKS A;  2HT1 A;  1QIL A;  2WAC A;  3PCO B;  1BUV T;  4XT3 B;  3TP7 A;  1AE2 A;  1IKM A;  4IUQ A;  1L2F A;  3K8A A;  1ILQ A;  4B3R Q;  5C5M A;  2GVA A;  2H5X A;  4HJ8 A;  2K05 A;  2KBN A;  1N32 Q;  1AP0 A;  2ZM6 L;  3HOY H;  3Q0A A;  5ELF A;  3X3N A;  2BH8 A;  5IP9 G;  3STB D;  4FF1 A;  4DV6 Q;  2YV5 A;  4A3B H;  4DKA C;  3A7A B;  2NVT B;  5DEH A;  2SOB A;  1X3Q A;  2ZXR A;  5I4D A;  4A3M G;  1QVG A;  2NZH A;  2N8N A;  3QR8 A;  4JI5 Q;  3PO2 B;  1E2Z A;  3TP5 A;  1K8M A;  5DNF A;  4AIM A;  1S72 A;  4A3K G;  3D6C A;  4O0A A;  2R7Z G;  2UUC Q;  2PNH A;  1GXD C;  4NKL A;  2BE5 C;  1TY0 A;  2A6H C;  1K8O A;  1W3S A;  3SK5 A;  5M5X B;  3TP8 A;  1CHP D;  3L0O A;  3S9W A;  1YJW A;  2I5L X;  2N78 A;  1DOM A;  4DAV A;  1TVX A;  1AE3 A;  1P8L A;  1Q3L A;  2OQK A;  4HID A;  1QUQ B;  4LF8 L;  3ICE A;  1SE8 A;  3E9H A;  1IW7 D;  5C4X G;  1Z7T A;  2JN4 A;  3J81 j;  3PO3 H;  2C9O A;  4BWG B;  3BZC A;  3K5L A;  1CI3 M;  5CV9 A;  4AYB B;  1JT8 A;  1MHW C;  3V2T A;  3GTL H;  2RDG A;  1LTS D;  3ERQ A;  1HZB A;  4GNX B;  3OW7 A;  2VUM B;  2VW9 A;  1JOQ A;  2NB0 A;  3I4L A;  3R3O A;  4UHV A;  3WWV A;  4QL5 A;  2KA7 A;  1EY6 A;  4P75 A;  4GOP B;  4LF6 L;  1EY5 A;  1OTC A;  3FP9 A;  3SR1 A;  2EY5 A;  5CV5 A;  2ZTD A;  3DM3 A;  3GTG H;  1PZK D;  4LK1 C;  3GTQ H;  4JBJ A;  3FHW A;  1HNW Q;  3BDC A;  4JI1 L;  3S1M H;  1PTO C;  3JAM L;  1EY0 A;  1Z6H A;  1B44 D;  2R6G A;  1A15 A;  1PYS B;  1Q46 A;  2PMZ B;  2E2D C;  4ABN A;  5IP9 H;  4A3I H;  1DXM A;  5C4J H;  3M85 A;  5IYD G;  1CHQ D;  3H15 A;  1BOS A;  2HDL A;  2IHF A;  1SRU A;  1EU4 A;  5LL6 S;  1S5E D;  1NAP A;  2F3I A;  4BBS G;  4PMC A;  3KOJ A;  4JI2 Q;  2R7Z H;  1CM9 A;  4BA1 I;  2JA7 H;  1UAP A;  1B3Q A;  4DAP A;  1WD0 A;  3H09 A;  2PW7 A;  2NVY H;  4F7X A;  2ZJP A;  3NQI A;  4U68 A;  1EIY B;  3M7N A;  1B4O A;  5M3F B;  4PG3 A;  1L1O A;  1XX8 A;  1SR3 A;  2MHV A;  1CK1 A;  3MXG A;  1QJO A;  1V9P A;  3W2D A;  3W5O A;  1VS0 A;  4QY7 A;  2B3G A;  1NJI C;  2SNM A;  2G9H D;  3F2U A;  4GLX A;  1BCP D;  1I4G A;  2KEN A;  2RCN A;  3K80 C;  2R92 H;  5CBA E;  3I4M H;  2B2Y A;  2F0O A;  5D65 A;  4ZUJ A;  1D7Q A;  4HIK A;  3A0J A;  3A74 A;  4JOI A;  1VQ6 A;  2XIW A;  1LAC A;  1FVI A;  2K5N A;  1VF7 A;  4R4T A;  2QA4 A;  3TBI B;  4CDD C;  4A3L H;  3ITP A;  4YWK A;  4BBR B;  2K32 A;  1X6O A;  2Q2U A;  2VY3 A;  4FYD A;  3KFU A;  4XQN A;  2PNR C;  4YY3 Q;  1LT4 D;  1QWY A;  3PO2 G;  2AQ2 B;  1O7Z A;  1QCB D;  1SRO A;  2FMC A;  2JA5 H;  4OO1 H;  1K28 A;  2K04 A;  4KN7 C;  5I2Y A;  4NXM Q;  1B2T A;  4ODG A;  3K0X A;  1STN A;  1WTQ A;  3EA6 A;  1UUP A;  4DV3 L;  4KN4 C;  4J6H A;  1TY2 A;  2BA1 A;  2F0V A;  1SFO H;  3RZD H;  3CD6 A;  5C6A A;  1WTV A;  5M5Y H;  1JOR A;  1GHK A;  1PYB A;  2QKI C;  2VQE L;  3T1Y L;  1B70 B;  1UWV A;  5EPJ A;  1Y1V B;  4B3S Q;  1BKB A;  4JI4 L;  1HNZ L;  1SEB D;  1ET9 A;  2Q8T A;  1YNN D;  2J7Z A;  4JPB W;  1UE1 A;  1PH1 A;  2K4K A;  1UE5 A;  1VQA A;  1PFB A;  5HGT A;  5IOD A;  4AYB G;  2HCC A;  1FGB D;  1LTA D;  1LT6 D;  4ZYS A;  1B3A A;  1RTO A;  4ME3 A;  2VUM G;  4ZLT F;  1RF2 D;  1NR4 A;  5CBE E;  5DAU A;  4LF5 L;  5L37 A;  1CT1 D;  1HZA A;  2E8G A;  4F88 A;  4IUT A;  1V43 A;  1XTC D;  2DJF C;  3GTJ H;  2ID0 A;  3PUW A;  3SDZ A;  4U67 3;  4B3M Q;  1Y69 U;  3RLN A;  3IFT A;  5KYL A;  5IYC G;  1ICF B;  4HCE A;  1XMQ L;  5JPM C;  4H44 C;  3FMC A;  4KY5 A;  1KXL A;  4DGZ A;  1VQ8 A;  1PFN A;  1SNQ A;  1WFQ A;  5M3M B;  4YHH Q;  3MAQ A;  1I94 Q;  2XRQ D;  3JAM E;  1A6X A;  4YCV A;  3HOW B;  1J6Q A;  3S1N B;  1CZG A;  4TVA B;  3KF6 B;  4B3T L;  4IFD H;  3RMH A;  1TU2 B;  2PQE A;  1NBW A;  1GUN A;  4AQY Q;  2B2U C;  2KED A;  2F0L A;  4H7B A;  2OT2 A;  1DOK A;  1KC8 C;  4BY1 H;  1YNJ C;  3M4O H;  3KJO A;  4IPC A;  3NBH A;  3CPF A;  1O7I A;  3PUX A;  5CGK A;  5I6W A;  4DK3 C;  3M4Q A;  2F0P A;  3VA7 A;  2BE5 D;  4KD3 A;  4ULL A;  1MIU A;  2A6H D;  4LUZ A;  3MXP A;  2OWO A;  4P71 A;  4HJA A;  3CU7 A;  5JVG 3;  1HFN A;  3TRE A;  3PIO A;  5I2X A;  3OOC A;  4DV1 Q;  2ZXO A;  3PF5 A;  3R2T A;  5EPK A;  4OX9 L;  1G2T A;  2AUJ D;  5CMD A;  2CCZ A;  1EOV A;  3V05 A;  3GTM B;  2H4O A;  3MTS A;  2UXB L;  3HOX B;  2M00 A;  2RDF A;  2LFN A;  2IL8 A;  3KDF A;  3GDE A;  3VYT A;  3H3V I;  1N8R C;  3GO5 A;  1HR0 Q;  1TWF H;  1PA6 A;  3BDO A;  4MN3 A;  1FNU A;  1EYG A;  1OXX K;  1SXT A;  3Q23 A;  3HOV H;  1DD2 A;  3TME A;  3TP6 A;  1E1T A;  1HXY D;  4C3H B;  1K8G A;  1FNV A;  1FJG Q;  4C3I H;  3H3V C;  4BBR G;  2A6E D;  1H9K A;  4WJ4 A;  1JC7 A;  2Y0S B;  5IYC H;  1J5E Q;  3RZO H;  3DM1 A;  1D6E C;  3CMA A;  1I50 H;  1SLJ A;  3JAM i;  3SK6 A;  4OWW B;  1V1O A;  5JJL A;  2ICE C;  1HNX Q;  1FYC A;  1YHQ A;  3URY A;  1STH A;  2F0S A;  1PTO D;  2IT1 A;  2LKV A;  3CP0 A;  5BN5 A;  3O13 A;  5IGB A;  4DR1 Q;  1CA5 A;  3J81 E;  1SSO A;  3G48 A;  1Y1V G;  3P7J A;  3S14 H;  3Q24 A;  4JI3 L;  4FXK C;  2F0N A;  5J39 A;  1SYC A;  4WOR A;  2EYL A;  2IPK D;  4R4Q A;  1F77 A;  4HIM A;  4K8I A;  5LMU Q;  3ERS X;  3S2D B;  1KNE A;  5E4X A;  2NTS A;  2HCI A;  3L9A X;  2CWA A;  2E76 C;  2F0G A;  3SGI A;  3I56 A;  1RCV D;  5H1S E;  2B63 H; 
#chains in the Genus database with same CATH homology
 5D14 A;  4HN7 A;  2XNA C;  1F2Z A;  1PRT D;  4HSV A;  1SE4 A;  1Q1E A;  3D4D A;  1ZYR D;  4DXG A;  5NUC A;  1UNS A;  2MJ8 A;  3J80 E;  3BZD B;  4Q5V A;  2EYO A;  3DMU A;  5JVH 3;  2R61 A;  4QCL A;  4OIJ A;  1EWH A;  2V4D A;  1HCZ A;  4HED A;  3BDL A;  2F0W A;  4G4K A;  4BS9 A;  3CRL C;  4X3T A;  3T4A C;  1TWG B;  5G3L D;  5FO9 B;  3I72 A;  1PTO H;  2KEE A;  1GUS A;  1BF4 A;  1XYI A;  3K57 A;  2BA0 A;  4CJ1 B;  3GD7 A;  5KND A;  3FDT A;  3VYU A;  5FKA C;  3G7L A;  1AFP A;  1GHJ A;  1EYC A;  2BDN A;  4L6T B;  1EOT A;  3CKI B;  5C4J B;  2KEC A;  1D5M C;  3BVG A;  2EDG A;  3DEP A;  2F0T A;  3DUZ A;  3LWU A;  4L63 B;  5KRU A;  4KHZ A;  4C3H G;  1RKN A;  2JA7 B;  3NWS A;  4EVO A;  3HOU B;  1F9S A;  2D5D A;  1T5X D;  1IHZ A;  1F2L A;  1HFG A;  3N6R A;  1JB3 A;  4OIK A;  3BYY B;  1NCV A;  2NN6 G;  2EYP A;  2A73 B;  3MC0 B;  5LHY 1;  4O1N A;  3T51 B;  2SDF A;  2NTT A;  3MXU A;  4M8A A;  2L5T A;  1YNJ D;  2CQA A;  2RSO A;  4IQZ A;  1TS3 A;  4P2C B;  3FKI B;  1SDF A;  3GTP B;  2B2W C;  2E2I B;  1G8Z D;  3S2H B;  3BS1 A;  3EFX D;  5C3X A;  2JA5 B;  2EYF A;  3C1E A;  4KJN A;  5CV4 A;  2E2H B;  2B2V C;  3BVM A;  4FNF A;  1AEX A;  1Y8N B;  4PQX A;  2A68 C;  4R8I A;  1HTL D;  5M5Y B;  1LAB A;  3N52 A;  3T13 A;  2O4X A;  3I90 A;  2VXW A;  4WRD A;  1LTR D;  4ME5 A;  2CVR A;  1OXS C;  3GTO B;  1H9J A;  1EL0 A;  3DXJ C;  2AWN A;  4KK7 A;  2RKS A;  2F0K A;  5E3F A;  1BCP B;  1G6Z A;  1JWU D;  1EIG A;  1BBX C;  2J4X A;  4XYQ A;  3NTK A;  2I46 A;  3DWA A;  2NN6 H;  1PZI D;  2F4I A;  2DN8 A;  1F2Y A;  4A3F B;  3A8I E;  5ELD A;  1T5E A;  1PZJ D;  4M1U B;  1CFM A;  2KCC A;  2MUY A;  3LWE A;  2RSN A;  2HUG A;  4IUP A;  3Q22 A;  3KUP A;  3NE5 B;  1Q8I A;  3FPU B;  3NP8 A;  2NUC A;  4F8M A;  4JBW A;  3J7A V;  2QCP X;  2FMM A;  1A3U A;  1SE2 A;  4HR7 B;  1PFM A;  2NBF A;  1U9R A;  5IGD A;  4A3J B;  4DAY A;  2K5W A;  4RAU C;  1JCK B;  4FF4 A;  2X6G A;  3C3L A;  3TDQ A;  3CRK C;  4CHT B;  2KVM A;  2PPB C;  3E6Z X;  3R8B A;  2CW0 D;  1I4Q A;  2L4N A;  3A55 A;  5EJW A;  4DNT B;  3S15 B;  1PMR A;  2AWO A;  1BR9 A;  2F0H A;  4FF3 A;  1LO5 D;  4NW2 A;  3NQT A;  1TKW B;  4C3I B;  2CHB D;  4KI0 A;  4WFN 3;  1H9M A;  2K5D A;  1JWM D;  3MEH A;  1EEF D;  3I4N B;  1EY9 A;  2JXM B;  1TWA B;  1I6H B;  4G7O C;  3MHB A;  5IT9 L;  1DCZ A;  4C2M B;  5C44 B;  4L8J A;  1KNA A;  5EBD A;  1HTP A;  3DEO A;  5K36 G;  2BDO A;  4DN4 M;  3D3R A;  3MXN A;  5EKK A;  1EQT A;  1IYV A;  2XWJ B;  3NBI A;  1WTW A;  1SMY C;  3CHB D;  2KQ3 A;  3I8Z A;  2FFK B;  2FHT A;  3K5N A;  1GUO A;  1AW7 A;  2B63 B;  3I91 A;  1EIH A;  2RQX A;  1QB5 D;  2WB1 B;  5C0X G;  3M4Y A;  3FEW X;  2DY8 A;  1S4Z A;  2IWH A;  1AZQ A;  1MBY A;  1KDC A;  3NPP A;  1ZKO A;  1SNO A;  4HCS A;  1JWS D;  1DYQ A;  1IYU A;  1NSN S;  3AB9 A;  3S1R B;  3QIA A;  1PTO B;  1O80 A;  2EYJ A;  3C46 A;  1G2S A;  4DK1 A;  3NTH A;  1S5F D;  3IKJ A;  3BYT B;  2JA6 B;  4ID6 A;  2KUM A;  5C4Z A;  4XIG S;  5IGC A;  1B53 A;  4PMW A;  1AN8 A;  1ML0 D;  4J1M A;  3SE0 A;  3A56 A;  1BCP F;  2DNC A;  1JIC A;  1HA6 A;  2K7V A;  2ZXP A;  2KJX A;  3PUY A;  4PNY A;  1I4P A;  4C3J B;  2NN6 I;  1SND A;  2AQ1 B;  4Z9C B;  4X3U A;  1PXU A;  2EZV A;  1PRT B;  2G9D A;  3GV6 A;  4K14 A;  1Z47 A;  4RH6 A;  4X3K A;  4FO2 A;  3S17 B;  4KY6 A;  4IUR A;  1A3V A;  1SYD A;  3QO2 A;  5I6Y A;  2N88 A;  1FR3 A;  4A3E B;  1EQV A;  1O7Y A;  3GV3 A;  3OIQ A;  1RD9 D;  1GJX A;  4FVM A;  3T53 B;  5A2Q L;  4Y7N B;  3VR4 A;  4TKO B;  2K33 A;  4ZUI A;  2Q8R E;  5JEA G;  1JE4 A;  5A35 A;  3HEJ A;  4KV6 A;  1B1Z A;  4RGT A;  4EQN A;  2F0E A;  3H0G B;  4HAE A;  3FVQ A;  1SAP A;  1ET6 A;  5JOB A;  3NSW A;  5EKI A;  3QOJ A;  2YU9 B;  1L0Y B;  3A54 A;  3D8G A;  2B39 A;  1L0X B;  1VDZ A;  1PLF A;  1J9O A;  1SNM A;  3OSO A;  4LJZ C;  1MSG A;  1NUC A;  5CV7 A;  2NWG A;  2EXZ A;  4HMJ A;  2J0T D;  1I3Q B;  4K6L A;  1RHP A;  3A7L A;  2MGS A;  1G91 A;  4KKT A;  1KAA A;  3NWT A;  5C5L A;  2NVQ B;  3M7G A;  1Q12 A;  1GUW A;  3I70 A;  4C56 C;  1S5D D;  1V1P B;  2B8G A;  2EY1 A;  3MA2 B;  1SNC A;  2OF1 A;  1EZ6 A;  3D4R A;  5BN4 A;  3VR5 A;  4RKB A;  3R2I A;  1U4L A;  3HOY B;  3ZYY X;  4QIW B;  4A3B B;  4HTH A;  4HMI A;  4A3G B;  1ENF A;  1EYD A;  2QF7 A;  4TQU S;  5ELB A;  3EQL C;  2L0C A;  4XTC S;  1RDP D;  1IL8 A;  1F2M A;  2JE6 I;  2B2T C;  1CZW A;  3I3C A;  3IFD A;  1DOL A;  3QG1 A;  3KK7 A;  3UI2 A;  1MGS A;  2F0M A;  1EWC A;  2NYZ D;  1GOZ A;  3KF8 A;  4YIJ A;  1O78 A;  2XVS A;  5KIX A;  4IUN A;  3PO3 B;  1FD7 D;  1EY8 A;  3S16 B;  4G57 A;  2F0U A;  3GTL B;  1I6V C;  1TS2 A;  1HQR D;  1WTR A;  1PTO F;  1Y1W B;  3VYR A;  2ZT9 C;  4K5W A;  3HKZ B;  1MSH A;  4ILW A;  4EQO A;  2XWB B;  1STB A;  5JJZ A;  1DON A;  2B8F A;  1A2U A;  3BVZ A;  4QUF A;  4C1N K;  4E6I A;  3GTG B;  3GTQ B;  1RJT A;  3PUZ A;  2FIN B;  2E75 C;  3S1M B;  3D6W A;  1TII D;  2SEB D;  4DNR B;  2WII B;  4K8J A;  1I4X A;  4ZAI A;  4A3I B;  4QMG A;  1EY7 A;  2E74 C;  3EJI A;  4B08 A;  4R8N A;  2RVL A;  1F9P A;  3OMG A;  1VCI A;  1B9N A;  3G6J B;  3D31 A;  1PRT F;  4I65 A;  5M9O A;  1Q90 A;  2R7Z B;  1U4P A;  1KAB A;  2WP8 J;  3HGB A;  2BOS A;  1D5Z C;  2ENB A;  4RGM A;  1QNU A;  2LMC B;  2WV6 D;  2NVY B;  3K58 A;  4CBV A;  1KLG D;  3IL8 A;  4IZ8 A;  1RTN A;  5C0X I;  3K0Y A;  1BCP C;  2K1B A;  1M4V A;  2B2U A;  5EQ0 A;  3H94 A;  2R92 B;  3T16 A;  4S3S A;  5D3I B;  4QF4 A;  3TZU A;  3I4M B;  1DM0 B;  5I9P A;  1ENA A;  2O5J C;  1A2T A;  4CKB A;  3VR2 A;  4FF2 A;  4CGY B;  2VB3 X;  4NP5 A;  2B2Y C;  1EEI D;  2Z4H A;  5AFW A;  4HSP A;  1TWC B;  3OIP A;  5T1I A;  3H6M A;  5IOC A;  1PYW D;  5EPL A;  5LL6 X;  3MFG A;  1H9S A;  3P1H A;  5ISR A;  4KKU A;  2KOL A;  2ICI A;  1QG7 A;  4LMQ D;  3PIP 3;  2RBM A;  2PO4 A;  1SFO B;  1O7L A;  3RZD B;  1ZEQ X;  5C4H A;  1TT2 A;  4IAL A;  4OHJ A;  3TSS A;  5C0X J;  1YNN C;  3J7Y W;  2F0J A;  4PMB A;  5KNC A;  1FNW A;  2QEJ C;  2Z8L A;  1D1I A;  1KDB A;  4CKC A;  4Q0F A;  1Q1B A;  3TN2 A;  1BDO A;  1X3P A;  5COY A;  2IW3 A;  3J7A F;  4OGQ C;  4V0B A;  1STE A;  5TSS A;  2WKC A;  4B9X A;  3W3A A;  5IGG A;  4G7H C;  3WOF A;  3GTJ B;  5IIF A;  1SE3 A;  2SNS A;  1CTM A;  2F0I A;  4RHS A;  5DM6 3;  3U9O A;  1Y8O B;  3K59 A;  2D9U A;  4OL7 A;  1QNK A;  2L55 A;  1LLR D;  3SK4 A;  1E2V A;  2XSC A;  4WJW A;  1U4M A;  1STA A;  2F0D A;  1EU3 A;  2HQE A;  1LTI D;  4BY1 B;  2IX3 A;  1ESF A;  3PV0 A;  4V19 0;  3M4O B;  1CQV A;  2B2T A;  3K6O A;  2LY7 A;  1E2W A;  4QUC A;  1C48 A;  3NUC A;  2VNU D;  5EKL A;  3KLR A;  1STY A;  4C1N I;  1LT3 D;  1EFI D;  5E4W C;  1AZP A;  4KTA A;  5CR3 A;  3DWQ A;  2JYO A;  1NR2 A;  1ILP A;  3QB3 A;  5BN3 A;  4XXE A;  1HHV A;  2HDM A;  3OWF A;  1TWF B;  3LX0 A;  4TSS A;  3K5M A;  5KGU A;  3HOV B;  1QE6 A;  1IKL A;  4EGV A;  2PW5 A;  4ZKB B;  2AUK A;  3RD4 A;  3X3M A;  1ENC A;  4RGO S;  2A6E C;  5JEA J;  3RZO B;  2BCO A;  4OO1 G;  1I50 B;  1SYE A;  3Q6S A;  3ND9 A;  5T1G A;  1S5C D;  1WTO A;  3MFY A;  2R3Z A;  1F9Q A;  4XQQ A;  4EQP A;  3S14 B;  2IX1 A;  4FP5 D;  1D2B A;  3HG9 A;  1X32 A;  2F1M A;  2WIN B;  3AMU A;  1UEA B;  1SNP A;  2RA4 A;  1TS5 A;  4XYO A;  4N9P A;  1EZ8 A;  2O5I C;  1BXT A;  1U4R A;  1PRT C;  2X6L A;  3HOZ B;  1OXV A;  3EVQ A;  5ELE A;  1HPC A;  1ZYR C;  2IX0 A;  2L11 A;  2XRS D;  4KHV A;  3E0J A;  1VMC A;  3NXW A;  4I7Z C;  4IUU A;  1HUN A;  4DK0 A;  5HUR A;  1OXU A;  2B2W A;  3S1Q B;  3RUZ A;  5IGE A;  3HP3 A;  4IFD G;  2PZT A;  2YYZ A;  5EGT A;  1VF5 C;  5IGF A;  1ICW A;  2L9H A;  2B2V A;  4CJ0 B;  2Z1C A;  3GP7 A;  3NHH A;  4RHR A;  5FLX L;  3ONA B;  4FXD A;  2WKD A;  3J81 L;  4FXG C;  2EY2 A;  3KBG A;  1W6K A;  5C3E B;  3VA5 A;  1C4Q A;  2A68 D;  5K36 H;  2PZU A;  4DA2 A;  2D62 A;  3MZ5 A;  4UDU C;  5E1F A;  3PMF A;  2K28 A;  4N9T A;  3WOE A;  5CC4 A;  4BY7 B;  1D5X C;  3P20 A;  2AQ3 B;  1KLU D;  2KHS A;  4DU9 A;  5M5W B;  4CJ2 C;  2F3V A;  1LT5 D;  3VR3 A;  2L12 A;  1SYF A;  1EY4 A;  3C1F A;  2X69 A;  3MVV A;  1ONL A;  4C3I G;  4RFB A;  2QIL A;  3J80 L;  2K5Q A;  2A69 C;  5C0X H;  3L3O C;  5KEE A;  3CQZ B;  2E2J B;  1BQQ T;  2NVX B;  2EY6 A;  2TMP A;  5DM7 3;  5IT9 E;  3OPO A;  2D2C C;  4JK1 C;  2EE1 A;  2PCF B;  5EBC A;  5J1Z A;  5F2D A;  3A8J E;  2EYH A;  1KTK A;  3V96 A;  1SYG A;  3LNN A;  4K5X A;  1R9T B;  3RLF A;  1B9M A;  5CV6 A;  2O2L D;  1G29 1;  2L1B A;  2F0F A;  4ZKC B;  3M3Y B;  1CQF A;  1ZXT A;  4ZRZ A;  3H91 A;  3TZD A;  1Y8P B;  1I4R A;  3BG3 A;  2F03 A;  1W6J A;  1S5B D;  3KLS X;  5FO7 B;  3AU7 A;  4PV1 C;  2LS0 1;  4IUV A;  5JAV A;  1HQM C;  2N55 A;  4DXF A;  3A8K E;  4H0L C;  2TSS A;  3SXH A;  4K6D A;  1QOH A;  5C3W A;  4RWS C;  3I73 A;  1PDQ A;  3C2P A;  3QWN A;  2Q8I B;  1LTG D;  5ELC A;  2M9V A;  4CKE A;  3SVM A;  5FLX E;  4H13 C;  4RCO A;  3DHQ A;  3QOL A;  4K2L A;  2EJF C;  4K2K A;  4A3D B;  1WCM B;  2NZ1 D;  3E5S A;  3SHL A;  3KLS A;  2MP1 A;  4DFA A;  1H9R A;  3HRZ C;  3SEB A;  4ZK9 B;  1HA5 A;  2KCN A;  1WD1 A;  5I9O A;  5JEA H;  2PZW A;  5FO8 B;  2GA4 B;  4BA2 I;  4TRD A;  3FRP B;  2A74 C;  1MI2 A;  3VYS A;  3MWY W;  3D4W A;  4A93 B;  4C3J G;  2EPB A;  3PUV A;  1SMY D;  4UAI A;  3OMC A;  1GUG A;  1A3T A;  1JQY D;  3R93 A;  3HS0 C;  1IW7 C;  1ROD A;  5CV8 A;  1V8Q A;  1H9S B;  4KJO A;  3NTI A;  4KMU C;  2QDB A;  2Z4I A;  2VB2 X;  5K5P A;  1LTT D;  1WVL A;  5COR A;  4DF7 A;  3OHX C;  1LTB D;  4ZQ3 A;  2JP1 A;  2K6A A;  3DWP A;  1SBB B;  2JEB I;  4MIU A;  4OO1 I;  1JOO A;  3U9S A;  2CW0 C;  3KBX A;  3K7A B;  5J22 A;  5KNB A;  5A2Q E;  1M8A A;  1SJH D;  1I4H A;  2K01 A;  2OEO A;  1HUM A;  1DJR D;  3WDN A;  4QB4 A;  2IJ0 A;  1OO9 B;  2F0Q A;  2OXP A;  4RA8 A;  1BNZ A;  4RCN A;  1XXG A;  1TQO A;  2R93 B;  1B50 A;  1D1K A;  1TS4 A;  5FK9 C;  4A3M B;  1WTX A;  4LAA A;  2C5C A;  1TWH B;  2WAQ B;  4RKL A;  4A3K B;  4MHE A;  2M2L A;  4G7Z C;  4X3S A;  2JA8 B;  3GTK B;  4KY7 A;  3NK9 A;  4IN3 A;  4F87 A;  2EJG C;  2A5H A;  1KDA A;  1ESR A;  3K5O A;  4GZY C;  1R4P B;  1GUT A;  1LV9 A;  1V1P A;  5C4X B;  1DZ1 A;  4RGN A;  2EJM A;  3FPP A;  1SYB A;  3VR6 A;  3QJY A;  5G3L F;  3IAY A;  2EVB A;  2A69 D;  4IFD I;  4KD4 A;  4R9W A;  4O42 A;  2XN9 C;  3ERO A;  1WTP A;  3SK8 A;  2FJ2 A;  1F9R A;  4J8Q A;  1OXT A;  2F3W A;  1JOK A;  2DNE A;  3PIO 3;  1SJE D;  3ND8 A;  5CYU A;  5FOB B;  1R4Q B;  4NDX A;  1JR0 D;  1J8I A;  1HRJ A;  3T56 B;  1VMP A;  4NMZ A;  4XQJ A;  1MD2 D;  2H1E A;  2PYK A;  4B9W A;  3P75 A;  1BO0 A;  3L7Z C;  2JEA I;  4K5V A;  4XT1 B;  5JPN C;  4BBS B;  3OWE B;  2DY7 A;  2EYM A;  1STG A;  1TR5 A;  3GQB A;  2RDH A;  5D3D A;  2JSO A;  1EYA A;  1XWE A;  2EOT A;  1K83 B;  4IFD J;  1C8C A;  3HZX A;  4XDX A;  1II3 A;  5KYI A;  1E0B A;  2I07 B;  2MPM A;  2K03 A;  1CA6 A;  4KKS A;  1QIL A;  2WAC A;  1BUV T;  4XT3 B;  3TP7 A;  1IKM A;  4IUQ A;  1ILQ A;  5C5M A;  2K05 A;  1AP0 A;  3Q0A A;  5ELF A;  3X3N A;  4FF1 A;  2NVT B;  3A7A B;  5DEH A;  2SOB A;  1X3Q A;  2ZXR A;  5I4D A;  3PO2 B;  1E2Z A;  3TP5 A;  1K8M A;  5DNF A;  3D6C A;  1GXD C;  4NKL A;  2BE5 C;  1TY0 A;  2A6H C;  1K8O A;  3SK5 A;  5M5X B;  3TP8 A;  1CHP D;  3S9W A;  1DOM A;  4DAV A;  1TVX A;  1Q3L A;  1IW7 D;  1Z7T A;  2C9O A;  4BWG B;  3K5L A;  1CI3 M;  5CV9 A;  4AYB B;  3V2T A;  2RDG A;  1LTS D;  3ERQ A;  2VUM B;  3OW7 A;  1JOQ A;  2NB0 A;  3I4L A;  3R3O A;  2KA7 A;  1EY6 A;  1EY5 A;  3SR1 A;  2EY5 A;  5CV5 A;  1PZK D;  4LK1 C;  3BDC A;  1PTO C;  3JAM L;  1EY0 A;  1Z6H A;  1B44 D;  2R6G A;  1A15 A;  2PMZ B;  2E2D C;  4ABN A;  1DXM A;  3M85 A;  1CHQ D;  1BOS A;  2HDL A;  1EU4 A;  5LL6 S;  1S5E D;  1NAP A;  4PMC A;  1CM9 A;  4BA1 I;  1UAP A;  4DAP A;  1WD0 A;  3H09 A;  2PW7 A;  4F7X A;  3NQI A;  4U68 A;  3M7N A;  1B4O A;  5M3F B;  1XX8 A;  2MHV A;  1CK1 A;  3MXG A;  1QJO A;  3W2D A;  2SNM A;  2G9H D;  3F2U A;  1BCP D;  1I4G A;  5CBA E;  2B2Y A;  2F0O A;  5D65 A;  4ZUJ A;  2XIW A;  1LAC A;  1VF7 A;  3TBI B;  3ITP A;  4BBR B;  2K32 A;  4FYD A;  4XQN A;  2PNR C;  1LT4 D;  1QWY A;  2AQ2 B;  1O7Z A;  1QCB D;  2FMC A;  4OO1 H;  2K04 A;  4KN7 C;  5I2Y A;  1B2T A;  4ODG A;  1STN A;  1WTQ A;  3EA6 A;  1UUP A;  4KN4 C;  4J6H A;  1TY2 A;  2BA1 A;  2F0V A;  5C6A A;  1WTV A;  1JOR A;  1GHK A;  2QKI C;  5EPJ A;  1Y1V B;  1SEB D;  1ET9 A;  2Q8T A;  1YNN D;  2J7Z A;  5HGT A;  1PFB A;  5IOD A;  2HCC A;  1FGB D;  1LTA D;  1LT6 D;  4ZYS A;  1B3A A;  1RTO A;  4ZLT F;  1RF2 D;  1NR4 A;  5CBE E;  5DAU A;  1CT1 D;  4F88 A;  4IUT A;  1V43 A;  1XTC D;  2ID0 A;  3PUW A;  3SDZ A;  4U67 3;  1Y69 U;  3IFT A;  5KYL A;  4HCE A;  5JPM C;  4H44 C;  3FMC A;  4KY5 A;  4DGZ A;  1PFN A;  1SNQ A;  5M3M B;  3MAQ A;  2XRQ D;  3JAM E;  1A6X A;  3S1N B;  3HOW B;  1CZG A;  4IFD H;  3RMH A;  1TU2 B;  2PQE A;  1GUN A;  2B2U C;  2KED A;  2F0L A;  4H7B A;  2OT2 A;  1DOK A;  1YNJ C;  3NBH A;  3PUX A;  5CGK A;  5I6W A;  2F0P A;  3VA7 A;  2BE5 D;  4KD3 A;  4ULL A;  2A6H D;  3MXP A;  3CU7 A;  5JVG 3;  1HFN A;  5I2X A;  3OOC A;  2ZXO A;  3R2T A;  5EPK A;  1G2T A;  2AUJ D;  5CMD A;  3V05 A;  3GTM B;  2H4O A;  3MTS A;  3HOX B;  2M00 A;  2RDF A;  2LFN A;  2IL8 A;  3VYT A;  3GO5 A;  3BDO A;  4MN3 A;  1FNU A;  1OXX K;  1SXT A;  3Q23 A;  1DD2 A;  3TME A;  3TP6 A;  1HXY D;  4C3H B;  1FNV A;  3H3V C;  2A6E D;  1H9K A;  1JC7 A;  2Y0S B;  3DM1 A;  1D6E C;  3SK6 A;  1V1O A;  2ICE C;  1FYC A;  3URY A;  1STH A;  2F0S A;  1PTO D;  2IT1 A;  2LKV A;  5BN5 A;  3O13 A;  5IGB A;  1CA5 A;  3J81 E;  1SSO A;  3P7J A;  3Q24 A;  4FXK C;  2F0N A;  5J39 A;  1SYC A;  4WOR A;  2EYL A;  2IPK D;  1F77 A;  4K8I A;  3S2D B;  1KNE A;  5E4X A;  2NTS A;  2HCI A;  3L9A X;  2E76 C;  2F0G A;  1RCV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...