4XQNA

Crystal structure of agra lyttr domain in complex with promoters
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
b'ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*AP*CP*AP*GP*TP*TP*AP*AP*GP*AP*AP*T)-3')
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Dna/dna binding protein
total genus 28
structure length 97
sequence length 97
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xqnA00
4G4KA 4XYQA 4XXEA 4CBVA 4XQNA 4XQJA 4XQQA 3BS1A 4XYOA
chains in the Genus database with same CATH superfamily
1QNKA 4UPAA 4DV0L 1I6VC 4UAIA 4X3UA 2NVTB 3PIP3 1PTOF 2R7FA 3NWSA 2V4DA 4HAEA 4DV4L 1EFID 3S15H 3CCLA 1MSHA 4TRDA 2E2DC 2PMZE 4JYAL 1GM5A 5C0XI 3PO2H 2PI2A 1K0SA 3IKJA 2H1EA 1NNXA 3H0GH 1QZHA 3FEWX 2E2HB 1ASYA 2K05A 1M8AA 3U50C 1ESFA 3QOLA 4A3CH 4BWGB 3RZDH 3T53B 1E2VA 1L1OA 1UE1A 4JK1C 2LFNA 2Q2IA 1HNZL 3TMEA 4LMQD 5IWAL 4LFCQ 1XTCD 4Q5VA 1CK1A 3KLSX 5LMUQ 3OWEB 1LTLA 1VQBA 5IYDG 4R8IA 4LWCA 1C7YA 5EPKA 3HOUH 3OOCA 4IUNA 4ZCKA 5HGTA 2ALYB 2JSOA 3HOVH 1A0IA 3MXUA 4JI2L 4V190 2M00A 3A5ZB 2NVQH 3NSWA 1AE2A 1EY5A 5F2DA 5LMNW 3K8AA 1QVCA 1QVGA 5C3EG 4L5SA 2SNSA 3GQBA 4P73A 4OL7A 4XTCS 1TY2A 1S5ED 4HIOA 4EGVA 3VR5A 4GKJL 5KYIA 1I94L 5IE8A 2JA6H 5KEEA 1G91A 4WJ4A 1LV9A 1Q8IA 4CDDC 4G7ZC 5JPNC 3W2DA 5E7NA 2ZM6Q 1UEAB 2VS1A 4YWLA 1WOCA 2N88A 4G7HC 1KTKA 2BDOA 4DV1L 1QB5D 1EIYB 1F77A 2YU9H 4LF9Q 2K1BA 4X66Q 1HFNA 4J6HA 1ET6A 1HPCA 4L5RC 3PUZA 5T1GA 4RGMA 4JI8Q 1YHAA 4A3LH 2E5LL 2VXWA 5I9PA 4YIJA 5I2YA 1ZEQX 4DAVA 1IKLA 1XWEA 2GA4B 5EAYA 4A3BB 3T56B 3S1RH 4BBRH 4GN4B 2EXZA 1T9HA 4LFAQ 3NWTA 1GO3E 1YJWA 2B8GA 1QJOA 3ZYYX 1Y8PB 4DV7Q 2OQKA 1G2SA 4F8MA 2EY5A 4JI1Q 4HEDA 4IUVA 4EQ5A 1D5MC 2WV6D 5M5XB 1E2ZA 1H9MA 4JI7L 4BY7H 4FO2A 2WIIB 3ICEA 3CC7A 4YHHQ 1WTHA 4DNRB 4A93H 4K5VA 2QCPX 1UE6A 3C3LA 1CT1D 1Q86C 3SVMA 3VR6A 2EYPA 4LJZC 2GN5A 2PQEA 4WJ3M 1JB3A 1E24A 1LTBD 3VR2A 2EQSA 2CKZB 3GTGH 3CW2C 1KRTA 3EA6A 2F4VL 4QCLA 4QIWE 3G71A 4NPSA 2A5HA 4IN3A 4IFDH 5M3MG 2NZOA 2HUGA 2XWJB 4ZUJA 4A3IH 1HTPA 4KI0A 3JC66 3JAML 1II3A 1SXTA 4IZ8A 2I0QA 1X54A 4FNFA 2QGQA 4BS9A 1I4HA 2JA8G 2C35B 3LNNA 2NTTA 3H91A 3I4MG 5FOBB 1F9QA 3QB3A 1B9NA 4LF4Q 2L9HA 1EWCA 3HEJA 1SRUA 1TWFB 4JBJA 3T1HL 2X69A 4LF6Q 1SMYC 5C5LA 1VMPA 1D2BA 3TZUA 3I70A 1DOMA 1EEID 2AQ2B 4LF8Q 2BDNA 2ZXRA 3K5LA 3GTPB 3ULLA 2B2VA 2HIVA 2E74C 3IFTA 4DV3Q 3FMCA 3VR3A 2EJFC 2F0TA 3CCRA 4GN5A 1K83H 2N55A 4DV5L 4RH6A 2R93H 5CMDA 1SNDA 2E8GA 2UUAQ 3AMUA 2L15A 2VUMH 1SFOH 3TP8A 1BBUA 2DNCA 3HOZG 2G9DA 4O2DA 3M4OB 1ICFB 4RAUC 3TP6A 2AUKA 5IYBH 1X3GA 2XIWA 3WOEA 3P20A 2NN6H 3ER0A 1XNRL 4FP5D 1XYIA 3MXNB 3PUWA 1IYUA 1A2TA 5M5YB 2EYMA 2F0WA 2K5WA 3KF8B 4OIKA 5CBEE 5COYA 3FRPB 1EOTA 4DR6L 2WAQE 2EYFA 3RD4A 4MTNA 3M7GA 4GLXA 5EJWA 3X3NA 1HTLD 1ILQA 5JJLA 5FLXL 4DR4Q 3NBHA 4K5WA 4CKEA 4K0KL 4RA8A 5KYLA 4CKCA 3J80i 4LAAA 2ASBA 1QUQA 3SK8A 2F3WA 1D7QA 4A3DG 5C3EB 3G48A 4J15A 1SJED 1W3SA 5G3LF 3AEVA 1CA6A 4IUTA 5H1SE 3CPFA 2MNAA 4MN3A 1STAA 1NJIC 5DM73 5IP9G 3GTMB 2K03A 4YWKA 4PNYA 1IBLQ 1YIJA 1Y1WG 2R92H 4KD4A 1SNMA 4P74A 1Y8NB 4DV0Q 3H3VC 1SNOA 1S5DD 3T4AC 1OXVA 5IOCA 1CQFA 4K2KA 2XWBB 1EY0A 4NDXA 4IALA 1LYLA 4DV4Q 4QB4A 5EPJA 5IGBA 4HMJA 1HZBA 1KC8C 4JCVE 4C3IH 5C3WA 4LW1A 2IX1A 1WTPA 4NXNL 4JYAQ 2K52A 2VL6A 2YTYA 4HSVA 4JPBW 2O2LD 1JOKA 2B2UA 1EZ6A 2WAQB 3C1FA 1EEFD 5EBCA 4KN4C 5ELFA 5C4XG 3NBIA 4C3JG 2MGSA 1VMCA 3CRKC 1JJ2A 1HR0W 3KF6B 1OTCA 1IL2A 3VYRA 1HNZQ 5IWAQ 3R93A 5IP7G 1HHVA 3LGJA 1KAAA 4ILWA 1MJEA 2BA1A 1K8OA 3KJOA 1N34L 1K0RA 3NTIA 2B2YA 4DR7Q 4IUPA 3CCUA 3K57A 3K59A 2JYOA 2EZVA 3GTJB 4JI2Q 5C4JB 5I9OA 3MC0B 1CQVA 3AU7A 1NTGA 2F4IA 3NXWA 4ME3A 1Q82C 1E3PA 2EOTA 1GKHA 3A56A 4PQXA 4KKTA 4RMFA 3D4WA 2KHJA 3OW7A 1VQFA 3BU2A 1C4QA 5L37A 4GKJQ 1I94Q 1EYDA 1IW7D 1SSOA 1JWUD 4PMWA 5IODA 3OPOA 3LWUA 1TWAB 3CC2A 2VQFL 3SE0A 5M3MB 3IRBA 3OSOA 4JOIC 2OT2A 4DV1Q 2F0OA 2JA8B 5CYUA 3KDFA 3KLRA 4RKBA 3I4MB 4CDFC 1KAWA 1KXLA 1PZKD 1HZ9A 2A69C 2EYJA 1VQJA 2JA7H 1B7YB 5K36H 2E5LQ 1OXUA 4JW0A 4JBMA 4DA2A 2KBNA 2BE5D 1BXTA 2WB1G 1L0XB 1LUZA 4B08A 2RKSA 3U4ZA 4C2MH 2PNRC 3CCSA 1EY4A 1LACA 4M8AA 4OWXB 3UDXA 2NZ1D 3BZDB 1PZJD 2CFMA 3PSIA 2MUYA 1Y1VG 2MFIA 2XN9C 5DNFA 3Q0AA 3D0FA 2K6AA 3HOZB 4R4OA 3S1MB 1BDOA 1WD1A 1WTXA 4JI7Q 4KHPL 2NTSA 3I4NG 1HCZA 1TS3A 4B3SL 4LF7L 1ASZA 2OQ0A 1R9TB 3KLWA 3HKSA 4DR3L 2RSNA 1KNAA 2RSOA 1WTVA 3MWYW 2EE1A 1JE4A 2F4VQ 5BN5A 1X3FA 5FLMG 3J7A5 4FF2A 3CD6A 4IFDJ 4KLKA 3OYYA 1XJVA 1TWGB 1WCMG 4NKLA 4R8NA 4DK6C 1CKOA 4Q0FA 4R4QA 1PA6A 1EIGA 3HGBA 1L1OC 1GUWA 4LFBL 3EQLC 4A3DB 1FGUA 2EYLA 1CA5A 3TEHB 4ZAIA 1B70B 3PIPA 4HSPA 4RCOA 3A8JE 5C0XG 1VDZA 1TWCH 1DXMA 3SXHA 2HQLA 4OELB 1HQMC 2AQ1B 3T1HQ 1NR4A 3T1YL 4FYDA 2PQAB 4G57A 2F0EA 1XX8A 3G4SA 2UXCL 4A3JG 2XNAC 2QILA 1Y1WB 1SROA 4KV6A 3CCJA 1PFNA 5CV9A 4R1JA 1X3QA 2HHHL 2D62A 1CI3M 2JXMB 1PMRA 4XXEA 2N78A 3K5OA 3L0OA 4DV5Q 4C3HH 1KIXA 1EQTA 1AH9A 3H3VH 1LT6D 1U9RA 2QA4A 3IL8A 1K3RA 4X3KA 3PF4A 1AN8A 3MAQA 2MP1A 1CSPA 3PO2G 4YCVA 3DLLA 5C4XB 2I5HA 2KHSA 3HOYH 4C3JB 2L1BA 3J81i 1EL0A 4L6TB 1GJXA 4A3CG 1PHJA 2F0PA 2V1CC 1HA5A 1P16A 1BCPC 3R2IA 5IGCA 2NVTH 2WACA 5ELNA 4JI5L 5ISRA 2B63G 5C44H 4DR6Q 3DWPA 3QO2A 1LABA 4AYBE 2GVAA 3OHXC 2KEEA 1SYBA 3MXGA 5E3FA 4HMIA 3PO3H 2KUMA 4KD3A 3HOVG 3S1QB 3S14B 3D31A 4DF7A 1XMQL 2E2JB 4TSSA 5D3IB 1PTOC 4X3TA 4KY7A 5BN4A 2N8NA 2AHOB 1PFBA 4I7ZC 3HOXG 1YNND 2H5XA 5C4ZA 4L8JA 4ZQ3A 1A3TA 1DYQA 4GN3B 4X6AH 1IYVA 3MXPA 2DY7A 2EIFA 3QG1A 2PZUA 3GTOH 1BCPF 1RF2D 2K01A 4KK7A 1PH9A 1Y69U 3NELA 2VQEL 1Q12A 4N8X1 1S5CD 2KCMA 2MO0A 3TN2A 4NXNQ 3I90A 3TSSA 5EQ0A 1FVIA 4PZ6A 2RF4A 1A15A 5CV7A 3EJIA 3M4YA 1CUKA 3QIAA 1FNVA 3HS0C 1YVCA 3D4DA 4H44C 2CWPA 2UUCL 1CM9A 1DZ1A 1H9SA 2WB1B 5FJ8H 5JJIA 2KCCA 5CGKA 3TQYA 1LT4D 2WKCA 3GD7A 2NUCA 3FKIG 4WJWA 1CKNB 4R4TA 1LTRD 4HN7A 4DV2L 4X62L 1Z7TA 1Y1VB 2HDLA 1K8AC 1KDAA 1PRTB 4BXXH 3I72A 2KCNA 1BBWA 2LSSA 4BY1G 3VDYA 4HTHA 4K8IA 2RVLA 3Q6SA 4UP7A 2G9HD 1U4RA 2B2VC 3QJYA 3F8TA 3RLOA 1PH3A 2Q2UA 3I4NB 4BY7G 3AQQA 3PIOA 1BUVT 3ULPA 1JE5A 3NE5B 4A93G 3K7AB 5EPLA 5KGUA 3TS0A 1X6OA 3OWFA 4OHJA 1YEZA 1C9OA 3TDQA 2BCOA 1PFSA 5CR3A 2N49A 3C46A 3GTLB 3J7ZC 2F03A 1HR0Q 2RHSB 3O13A 2L4NA 4DN4M 1VQ9A 2Q8RE 4DPGA 2J7ZA 3SEBA 2NVXB 3SK4A 2RCFA 2VQFQ 1WCMB 2DY8A 2QW7A 1V1PB 1X3EA 4IFDG 5BN3A 1EY7A 1SE4A 3S1NB 5AJ3L 1B2TA 4A3IG 5C6AA 1H9RA 3NENA 2R3ZA 1ZKOA 5M5XH 1YBYA 3DXJC 2KA7A 1A62A 1SE8A 4CBVA 4XT3B 1RD9D 3H15A 2R7DA 3TP7A 3L7ZC 4LNQA 4RWSC 3RMHA 2PMZB 4RCNA 1S40A 1EYGA 1AW7A 2EXDA 1O78A 1J6QA 1P8LA 4CHTB 2R7ZH 3GV6A 4A3JB 2F0UA 1XPUA 4LUZA 3RR5A 1Q7YC 4JBKA 3VYSA 1RCVD 1O80A 2PI2E 1OXSC 1G6PA 1JC7A 2K14A 1SMXA 2L55A 1DGSA 4OWTB 5LL6X 2Z8LA 2R93G 3S15B 3JAMc 2L12A 4BBSH 3MVVA 1PYBA 5A2QL 1WTOA 4C56C 3BZCA 4L5QA 2WAQG 1RTNA 2KECA 4A3EH 2KHIA 3GDEA 3MZ5A 4KMUC 1GUNA 1N9WA 2ES2A 4B3ML 1KRSA 3PO2B 2YYZA 3X3MA 4QJFA 3CF5A 4PV1C 5IGEA 3MXNA 4CJ1B 1QZGA 4KHPQ 3P7JA 1H9SB 1STGA 3K0XA 4K6LA 4KKSA 3KF8A 2LMCB 4LUOA 4N8FA 5K5PA 2IX0A 1CHQD 3RZDB 1VQDA 2IT1A 5CV4A 4LF7Q 3BVGA 3GTPH 4DR3Q 2B63B 4Y7NB 1UAPA 4HIMA 1N33Q 2FINB 1PXUA 2QEJC 2B2UC 3CKIB 3R2TA 3KYHC 2QDBA 4YCUA 4K5XA 3I55A 3HOVB 2KEDA 3TS2A 4G4KA 4ABNA 1HJPA 2IPKD 4RG1A 1IBKL 4A3KH 2FFKB 5M3FH 4LFBQ 5I6YA 1K28A 4PG3A 4EQNA 1S3OA 5ELBA 3OTOL 1F2LA 2UUBL 1JOQA 3KOJA 3HOXB 4R4CA 3S2HH 1SYGA 1SYDA 1STNA 4IOAA 2B2YC 2BA0A 1KABA 2NB0A 2Z0SA 1PTOH 5TSSA 2JA5G 3VA5A 5A2QE 1RODA 4EQOA 2JA6B 4QQBX 2UXCQ 1HA6A 2K28A 2R92G 1SE2A 2A74C 5E4WC 2D2CC 3UE1A 2HHHQ 1ILPA 3L3OC 1VS0A 5HURA 3S2DH 1K3BC 3DWAA 1W2BA 5FLXc 1U4MA 2A6ED 2YU9B 4EQPA 4CDCC 4C3IG 1C0AA 4E6IA 4JI6L 1HH2P 5JOBA 1LTAD 5C3EH 4G7OC 1IZ6A 1TS5A 2RBMA 4QUCA 4NB3A 1G2TA 2X6LA 5D65A 4XQJA 2PO4A 1X32A 1VQAA 1QOHA 2WFWA 3KF6A 3Q23A 3GTMH 4IFDI 3S1RB 2WP8J 1Z47A 1GXDC 1EWHA 3FKIB 1YITA 3K5NA 1O7YA 3TREA 3BYTB 2Y0SE 4J8QA 4C1NI 4JI5Q 1VCIA 3J7AV 1HUNA 2Q2HA 4BY1B 1QILA 2B29A 4QIWB 4JC0A 1X9NA 1BQQT 3RN5A 3G7LA 2CCZA 4BY7B 2KOLA 4CJ0B 1BNZA 2IHFA 4JG2A 3JAME 1XMQQ 2UXBQ 3KLSA 1HNWL 3KBGA 2XSCA 4A93B 1T5XD 1O7LA 4JI0L 1U4LA 4JV5L 1NY4A 3DEOA 3KK7A 1UE7A 2OF1A 3BZKA 1I6HH 3PF5A 3W1GA 1HNXL 1QNUA 2N3SA 4H13C 3GO5A 2L5TA 3GTGB 1A3VA 2WINB 1I4QA 1L0WA 1F9SA 2MHVA 2B3GA 5GAEC 3W3AA 5EBDA 3E0JA 2YTXA 3SDZA 2MJ8A 4A3IB 3QOJA 2NN6I 4M1UB 4DK3C 1GD7A 4N9TA 3GTJH 4ID6A 2A68D 2KENA 4ULLA 1ESRA 1JWMD 2VQEQ 4JVZA 2CH4W 1YZ6A 1MIUA 2I5LX 1Q3LA 3AB9A 4CGYB 3HKZE 1S72A 1LT3D 4EX5A 2AKWB 2JA7G 5ELOA 4DGZA 1I4PA 4GOPB 1RTOA 2UUCQ 3J7AF 1GUSA 2XTIA 5DAUA 1IBML 1AFPA 3E5SA 1TWAH 1ZXTA 2A8VA 2O4XA 1HQRD 1LTID 1KNEA 5M3MH 4ZK9B 3SHLA 1K83B 3CRLC 3GTKB 2R93B 4DV2Q 4X62Q 1NAPA 4DFAA 2RCNA 1STEA 3T16A 4NMZA 4FXDA 1X65A 4GZYC 1A6XA 4OWWB 4OO1G 5FLXE 4IPDA 3CAMA 4A3GG 1GUOA 2ID0A 2Z9HA 4MNOA 2HQEA 3S16H 3NTKA 4DXGA 3T51B 5CV8A 5GQOA 1HZCA 1IXRA 1G51A 1HRJA 1M4VA 2EPBA 4DAYA 1I50H 3GP7A 4I65A 1QE6A 2NBFA 5LL6S 1X3PA 1PH8A 3BDLA 2ZTCA 4DK1A 3Q8DA 1VQ8A 1IW7C 1PRTD 3CCMA 1MKHA 3CQZB 5AJ3Q 1SE3A 3S1MH 4H0LC 5GAGC 1XMOL 4K6DA 1OXTA 4DKAC 3I73A 2JEAI 4DXFA 5JPMC 1KHIA 2PYKA 2PQAA 4I7AA 5M5WB 2JA5B 2D5DA 1F2YA 4A3FH 3MEFA 1WTQA 3E3XA 2G5DA 1GUTA 1TKWB 3W1BA 3RZOH 2MQHA 2R92B 5IYCH 4WFN3 3NQIA 4HCSA 1W6JA 1SBBB 1VQMA 4JI4L 1PRTF 2BE5C 3S17H 2E76C 4A3MG 1JOOA 1YNJD 2KCTA 1S4ZA 5KRUA 1PLFA 4C3HG 5JEAH 4C3IB 5EGTA 5FO8B 2XVSA 2IWHA 4A3DH 5C4HA 2NVYB 2OCEA 2D0PA 4AYBG 1PDQA 3M4QA 4X64L 3NTHA 4B3MQ 2VW9A 3Q22A 2QEXA 4HCEA 1D5XC 3FDTA 3BS1A 1AZPA 3HOYG 1O7ZA 4POFA 4OONA 3BG3A 5EKLA 1B3AA 2CW0D 5IY0A 1A3UA 1C48A 3TBIB 2Z6KA 4WORA 3HOWH 1BR9A 5KNBA 1JT8A 4KJNA 4IJHA 2YTVA 1EYCA 2RHQB 1ICWA 4YWMA 4NP5A 2Z1CA 4F7XA 4OIJA 2A69D 4LK1C 1ENAA 2PPBC 3NK9A 1EQRA 4JBWA 3K0YA 3P1HA 3PO3G 4KJOA 4JI8L 1PH6A 3K81C 4FF4A 1IBKQ 1RKNA 1EQQA 5JAVA 1E7ZA 3M9BA 3OTOQ 1I4RA 2UUBQ 4HJ5A 4TKOB 4C3JH 4L5TA 4DAYB 3OMGA 2DN8A 3A74A 4RGTA 2LY7A 2NYZD 1RDPD 3T13A 1XNQL 4LFAL 3DM1A 5E1FA 1PVOA 1TWHB 2DJFC 4OO1I 1V1QA 5CBAE 1PZID 2K33A 4DV7L 4IURA 1K73C 1B8AA 2IW3A 4JI1L 3GV3A 1CZGA 5CC4A 1LTGD 1I4GA 2E2JH 2J4XA 4ZKCB 1E1TA 3URYA 2RDGA 4JI6Q 4HJ9A 3BDCA 2E2IH 2JEBI 4OGQC 1NMFA 1K8GA 1N32L 3J80c 1SAPA 1VQKA 5IT9c 1XXGA 2EY1A 2JA7B 2K50A 5KNDA 1VQ6A 2LXJA 4CJ2C 2MPMA 2VNUD 1WFQA 1A63A 5FJ8G 2R6GA 1CKNA 3JAMi 1PFMA 4GKKL 1JJGA 4OXPA 2B2WA 4NXML 1VQNA 3GTQB 2LXKA 5CV6A 4B9WA 1TT2A 1GVPA 5T1IA 1CHPD 3E9IA 3F2DA 1EQVA 2ICEC 3H0GG 2AWOA 1YHBA 3SK6A 1XNRQ 2ZJRA 4A3GB 4ZUIA 1TU2B 1JORA 5DLQE 3A8IE 1HNWQ 1NCVA 1R4PB 2HCCA 4XQQA 1VQ4A 4JI0Q 1F9PA 4HJ8A 1I3QB 1QCBD 4FF3A 4JV5Q 5CV5A 1E2WA 1A2UA 1HNXQ 1UWVA 1E1OA 3OIPA 3HOUG 4A75A 3QWNA 1R4QB 1V43A 2M2LA 1YNNC 3H3VI 4K0KQ 1V1PA 1S5BD 2JA9A 3MFGA 2UUAL 1SYFA 4A4IA 1DD2A 4N9PA 2RA4A 1V8QA 4ZLTF 1UUPA 3STBD 4BA2I 1SLJA 2RQXA 3J80L 2E2HH 5IT9L 4IJLA 1J8IA 2A6HD 2HCIA 3VR4A 3I4NH 1FL0A 1TVXA 3PV0A 3CU7A 3CMEA 1C8CA 1U5KA 2L11A 1ZYRD 2TMPA 2JA6G 1WTWA 5A35A 4GLVB 3U9OA 4FF1A 2OXPA 4UP9A 2XRSD 2JN4A 3F2CA 3GTLH 2R7ZG 2LS01 2K7VA 1G8ZD 2ZTDA 4RHSA 3H94A 3FP9A 2SNMA 3DHQA 1IBMQ 2PZTA 2F0KA 3V96A 1Q8KA 3NEMA 4A3MB 4Z9CB 4U68A 1EWIA 2ICIA 4C3HB 3S1NH 4KY6A 3BDOA 3S9WA 5ELDA 3MHBA 1E22A 3EROA 1CKMA 4QL5A 2ZJQA 4A3EG 4A3LG 3M3YB 1YI2A 4AYBB 4KY5A 3OW2A 5C0XH 2CWAA 2F0NA 3TRZA 1VQ5A 1T5EA 4DNTB 3G6JB 4RHRA 5D14A 1EUJA 1D1IA 2F0QA 2DJGC 3HOYB 4BBRG 2Z4IA 3AYHB 1QVFA 2BOSA 4A3JH 4PZ7A 2A19A 2SEBD 1N34Q 1M1KC 3J80E 5JVG3 1YHQA 3NQTA 1D1KA 2F52A 3RUZA 1UEBA 5C44B 1XPOA 4XYQA 5JJZA 4CDEC 2A73B 1OXXK 5DM63 1B44D 4B3TL 3D8GA 3S24A 2FXQA 3PO3B 1ONLA 2RDHA 2B39A 3DMUA 5I6WA 5JJKA 5EKKA 1EY8A 4A3KG 5I4DA 4OEMB 5M3FG 4JI3L 1U4PA 1XMOQ 4A3BH 3CHBD 4XDXA 2TSSA 4MZ9A 1WVLA 4LF5L 2EYOA 2I46A 1PYSB 5IGDA 3KFUA 1DOKA 3M7NA 3I7FA 5GROA 3RLFA 4DUZL 2H4OA 2B63H 4Y7NH 1Q46A 2JP1A 5IGFA 1GUGA 1VQGA 4GNXB 1EY9A 4RGNA 4K14A 1B53A 3A8KE 3SK5A 1DONA 4DR7L 3GTOB 3UDFA 3K80C 4JI4Q 1KLGD 4FXKC 4PZ8A 4AQYL 3LX0A 1Q1EA 3E0EA 5JEAJ 1WTRA 2B2TA 1MJCA 1PV4A 5BR8L 2PNHA 2Y0SG 2LKVA 4O0AA 3M85A 3HZXA 2O5JC 1X55A 4AIMA 4X64Q 2UU9L 2F0SA 3WWVA 3HOXH 4IUUA 2KQ3A 2A1AA 1LT5D 5HY6A 5FK9C 1KQSA 4DAPA 5ELEA 4DR5L 5FO7B 1Y14B 3A55A 2CQAA 2IL8A 2EVBA 2VUMG 3HFZB 2PW7A 2QDLA 3N6RA 1SNCA 3FVQA 3SR1A 1WYDA 3G6EA 2F0DA 3NUCA 1TWFH 4IQZA 1QG7A 3H0GB 4AH6A 2SOBA 5IYBG 1FJGL 2CHBD 4KTAA 5LMNL 1IKMA 2NN6G 4DK0A 4B3SQ 1XPRA 4B3RL 2AQ3B 1EOVA 3D4RA 2CQOA 2JJQA 4RGOS 1JQYD 1BOSA 3DUZA 2IY5B 5HGQA 3K7UC 3J81j 2Z4HA 5C5MA 1AP0A 4GLAC 3PUXA 4X65L 2VB3X 3HOUB 2HD3A 1LTTD 3FKIH 1XNQQ 3HKZG 4YY3L 1FGBD 3J81c 2OTJA 3CCEA 3FPPA 3M4OH 1VQOA 1HXYD 1SJHD 2VZAA 2Q8TA 2NVQB 4BY1H 3KUPA 2OEOA 1UE5A 2JE6I 1JMCA 4PMBA 2ZXPA 3T1YQ 3PGZA 5M5YH 3I4OA 2A6EC 1EYAA 5GAHC 2QKIC 1AZQA 1L1OB 4XYOA 1RJTA 5AFWA 3WOFA 4ZKBB 5NUCA 4GOPA 2HIXA 2UXDL 4F88A 1N32Q 1MHWC 2D9UA 5IYDH 1GHKA 2AWNA 2K5NA 2R7ZB 1VQCA 3IAYA 5J22A 3UDIA 1X56A 1KLUD 2FJ2A 2I07B 4GKKQ 3PIO3 3EN2A 5KNCA 4NXMQ 1VQEA 1FD7D 4BBSB 4QF4A 1ENCA 5FO9B 4A3EB 4QUFA 2GVBA 4FDBA 1TIID 3TZDA 3N52A 2B8FA 3B6YA 3EBEA 4HIKA 1DM0B 1WJJA 3CPWA 1STYA 2MO1A 4BBRB 3FPUB 3D3RA 4QGUA 1STBA 2KVMA 4KHZA 3BJUA 3J81L 1JB7A 4LUVA 4DAMA 4DR2L 1MI2A 1V1OA 5M9OA 4DUYL 2PZWA 1MGSA 3PQIA 1SMYD 2QF7A 3K58A 3CCQA 3CXCA 1QWYA 4KN7C 3KJPA 2JK8A 2XRQD 3GTKH 3K6OA 1TQOA 4IPHA 3F2BA 2ZT9C 1BCPB 3ND8A 3PUYA 2XGTA 4IO9A 4DNIA 3CC4A 4PMCA 2PW5A 4UY8C 1NMGA 4ZRZA 4A3KB 1JICA 3H09A 4XT1B 5M3FB 2Z6KC 5JVH3 4UDUC 4IPGA 3TP5A 4DR1L 5G3LD 3S2HB 3VYTA 4U673 2F0VA 4KHVA 2A68C 2K5HA 1PTOB 4A3FG 1TY0A 5IGGA 1EY6A 1CFMA 1Q1BA 1M90C 5IYCG 2EJMA 3S2DB 3A7LA 2L0CA 5C4JH 4X3SA 4RFBA 3WDNA 1RIPA 3J81E 2HT1A 3CQZH 1TS4A 1CZWA 3HG9A 1DJRD 4H7BA 3D6WA 1BKBA 5JEAG 2Y0SB 2BH8A 5K36G 5C0XJ 1FNUA 2F3VA 2K4KA 3M4PA 2F0MA 3A7AB 4TVAB 1CSQA 3QR8A 1HZAA 5M5WH 2JA5H 1VQLA 4IUQA 4UP8A 3U4VA 3U9SA 3SGIA 4ZYSA 1AE3A 1F2ZA 1EU3A 1VF5C 1PH2A 4HR7B 2F3IA 2D0OA 5KIXA 4DV6L 2JA8H 4OX9L 2VUMB 1L0YB 3PCOB 1SFOB 3HOWG 1WI5A 1D5ZC 3I4MH 1J5EL 2FHTA 2OWOA 2PCFB 2ENBA 2KJXA 5C3XA 4B3TQ 3OMCA 1SNPA 3AFQA 4POGA 1Y8OB 5LHY1 2CH4A 2NVYH 1B1ZA 1F2MA 1UNSA 1TR5A 1PRTC 3DEPA 1D6EC 2B2WC 1H95A 3CCVA 1N36L 4JI3Q 2E75C 1F9RA 3ZJYC 3BVMA 4LF5Q 3LWEA 1MD2D 2F0HA 4XIGS 1E0BA 1I6HB 3A54A 1YJNA 4QY7A 3HKZB 1JWSD 1YJ9A 4P71A 1EU4A 4DUZQ 1Z6HA 3HOZH 1ENFA 1H9JA 4QMGA 4IOCA 2HDMA 4UHVA 5J3BA 3MTSA 2YV5A 3HP3A 4H02A 4AQYQ 3KBXA 1B9MA 2BH2A 1R9TH 4DU9A 4LFCL 1BO0A 1BVSA 5BR8Q 1W6KA 1YNJC 3C1EA 5LMUL 3ITPA 1VQIA 1DOLA 4R9WA 1KDBA 2UU9Q 3NHHA 2C5CA 2NZHA 1HR0L 4GNXC 3K5MA 2F0FA 1TWGH 1NBWA 4V0BA 4DR5Q 1BBXC 1TWHH 3A0JA 3NBHB 1B4OA 3NP8A 2VB2X 1VQHA 4APVA 2CW0C 2F0GA 1XTDA 2K5VA 1QUQB 3CP0A 3R3OA 3RN2A 1L2FA 4B9XA 5ELCA 5J39A 1HUMA 5IP9H 1ET9A 1FJGQ 3FHWA 5LMNQ 1PH1A 2AUJD 1B3QA 1DCZA 4HJAA 1MBYA 1SDFA 1H9KA 2Q2TA 4B3RQ 1Y1WH 2DGYA 2AMCB 3PUVA 2ZM6L 3CMAA 3S16B 5E4XA 1JCKB 2IJ0A 2K5DA 3E9HA 4R4IA 2RDFA 4A76A 5C44G 1LLRD 2F1MA 4LF9L 3VA7A 4X66L 4X65Q 4L63B 3RNUA 2K32A 1I50B 1VQ7A 2ZTEA 4J1MA 4P2CB 2Z6BA 3NPPA 4YY3Q 1IL8A 3GTQH 1RL2A 2K75A 1N8RC 1TS2A 3IFDA 4MIUA 4Y52H 4OO1H 1CTMA 2ZXOA 5C4XH 1PH4A 1EZ8A 3UDGA 4FVMA 2R61A 1B50A 1SEBD 1LO5D 4A3GH 1WD0A 1JJCB 3ERQA 3MA2B 1SYCA 2ZJPA 4EVOA 2F0IA 2OTLA 3AFPA 1LM0A 5IP7H 5CORA 3L9AX 2IX3A 1VQPA 2FMMA 4TQUS 1A8VA 4A3FB 1I3QH 2UXDQ 3ULJA 1SR3A 1HFGA 3RZOB 1N33L 4XQNA 1LTSD 2Q8IB 2VY3A 4IPCA 4P72A 1SN8A 3I56A 3BYYB 3S1QH 4K2LA 5I2XA 3S14H 1J9OA 4YHHL 3S17B 4BA1I 4NW2A 3MEHA 3L2PA 2EJGC 2ATWA 4FXGC 1Q81C 2JQOA 3ND9A 1EFWA 2NWGA 3RLNA 4HJ7A 3F1ZA 1FR3A 1SNQA 1STHA 1EIFA 3W5OA 1S5FD 4C2MB 1U0LA 1PYWD 3HRZC 4WRDA 1I5FA 1AEXA 3DM3A 1TXYA 1SYEA 1KL9A 2B2TC 4RKLA 4BXXG 4DR2Q 3J7YW 3UE0A 3HOWB 1NE3A 2F0LA 5J1ZA 1OO9B 4YCWA 4DUYQ 3I8ZA 5DEHA 4LF4L 4A3MH 3KDFB 4C1NK 1FNWA 2P5ZX 5FKAC 4LF6L 2CVRA 3F2UA 1GOZA 1JR0D 3I91A 4LF8L 3M3YH 3R8BA 3BVZA 5GADC 3VYUA 3DWQA 2M9VA 3I2ZA 4A3BG 3STBC 1NUCA 4DV3L 1MSGA 2EYHA 1VF7A 2K04A 3P75A 2SDFA 4DR1Q 1KD1C 2A6HC 3C2PA 1Y1VH 5IIFA 1KDCA 2F0JA 3E6ZX 5D3DA 1ZYRC 3PMFA 2X6GA 4O1NA 4GNXA 1PH5A 1EIHA 3UI2A 1IHZA 2WB1E 1Z9FA 4ODGA 3ONAB 1TWCB 1BCPD 1G291 3OIQA 3K7AH 4JOIA 4ALPA 2UXBL 2J0TD 4MTKA 3V2TA 3I4LA 1Q90A 4S3SA 3U58A 2E2IB 2EY2A 3V05A 1NR2A 1RHPA 4P75A 5FLMH 4O42A 2NVXH 4GS3A 2EY6A 4HIDA 4DR4L 1WCMH 2DNEA 1PTOD 1NSNS 4ME5A 1ML0D 4CKBA 1K8MA 1BF4A 3D6CA 2C9OA 1O7IA 2WKDA 2EDGA 5EKIA 1YNXA 3I3CA 4MHEA 1FYCA 4DV6Q 4BBSG 4OX9Q 1GHJA 2I5MX 4GOPC 1J5EQ 1I4XA 2O5IC 1IYJB 3ERSX 1PH7A 3EVQA 3H6MA 1G6ZA 3EIVA 4K8JA 2DUDA 2K5QA 1IBLL 3Q24A 1V9PA 4KKUA 2IHEA 1D8LA 1K9MC 2FMCA 5IT9E 3MFYA 3A5UA 3EFXD 4F87A 1N36Q
chains in the Genus database with same CATH topology
1QNKA 1I6VC 4UAIA 4X3UA 2NVTB 3PIP3 1PTOF 3NWSA 2V4DA 4HAEA 1EFID 1MSHA 4TRDA 2E2DC 5C0XI 3IKJA 2H1EA 3FEWX 2E2HB 2K05A 1M8AA 1ESFA 3QOLA 4BWGB 3T53B 1E2VA 4JK1C 2LFNA 3TMEA 4LMQD 1XTCD 4Q5VA 1CK1A 3KLSX 3OWEB 4R8IA 5EPKA 3OOCA 4IUNA 5HGTA 2JSOA 3MXUA 4V190 2M00A 3NSWA 1EY5A 5F2DA 2SNSA 3GQBA 4OL7A 4XTCS 1TY2A 1S5ED 4EGVA 3VR5A 5KYIA 5KEEA 1G91A 1LV9A 1Q8IA 4G7ZC 5JPNC 3W2DA 1UEAB 2N88A 4G7HC 1KTKA 2BDOA 1QB5D 1F77A 2K1BA 1HFNA 4J6HA 1ET6A 1HPCA 3PUZA 5T1GA 4RGMA 2VXWA 5I9PA 4YIJA 5I2YA 1ZEQX 4DAVA 1IKLA 1XWEA 2GA4B 4A3BB 3T56B 2EXZA 3NWTA 2B8GA 1QJOA 3ZYYX 1Y8PB 1G2SA 4F8MA 2EY5A 4HEDA 4IUVA 1D5MC 2WV6D 5M5XB 1E2ZA 1H9MA 4FO2A 2WIIB 4DNRB 4K5VA 2QCPX 3C3LA 1CT1D 3SVMA 3VR6A 2EYPA 4LJZC 2PQEA 1JB3A 1LTBD 3VR2A 3EA6A 4QCLA 2A5HA 4IN3A 4IFDH 2HUGA 2XWJB 4ZUJA 1HTPA 4KI0A 3JAML 4IZ8A 1II3A 1SXTA 4BS9A 4FNFA 1I4HA 3LNNA 2NTTA 3H91A 5FOBB 1F9QA 3QB3A 1B9NA 2L9HA 1EWCA 3HEJA 1TWFB 2X69A 1SMYC 5C5LA 1VMPA 1D2BA 3TZUA 3I70A 1DOMA 1EEID 2AQ2B 2BDNA 2ZXRA 3K5LA 3GTPB 2B2VA 2E74C 3IFTA 3FMCA 3VR3A 2EJFC 2F0TA 2N55A 4RH6A 5CMDA 1SNDA 3AMUA 3TP8A 2DNCA 2G9DA 3M4OB 4RAUC 3TP6A 2AUKA 2XIWA 3WOEA 3P20A 2NN6H 4FP5D 1XYIA 3PUWA 1IYUA 1A2TA 5M5YB 2EYMA 2F0WA 2K5WA 4OIKA 5CBEE 5COYA 3FRPB 1EOTA 2EYFA 3RD4A 3M7GA 5EJWA 3X3NA 1HTLD 1ILQA 5FLXL 3NBHA 4K5WA 4CKEA 4RA8A 5KYLA 4CKCA 4LAAA 3SK8A 2F3WA 5C3EB 1SJED 5G3LF 1CA6A 4IUTA 4MN3A 1STAA 5DM73 3GTMB 2K03A 4PNYA 4KD4A 1SNMA 1Y8NB 3H3VC 1SNOA 1S5DD 3T4AC 1OXVA 5IOCA 1CQFA 4K2KA 2XWBB 1EY0A 4NDXA 4IALA 4QB4A 5EPJA 5IGBA 4HMJA 5C3WA 2IX1A 1WTPA 4HSVA 2O2LD 1JOKA 2B2UA 1EZ6A 2WAQB 3C1FA 1EEFD 5EBCA 4KN4C 5ELFA 3NBIA 4C3JG 2MGSA 1VMCA 3CRKC 3VYRA 3R93A 1HHVA 1KAAA 4ILWA 2BA1A 1K8OA 3NTIA 2B2YA 4IUPA 3K57A 3K59A 2JYOA 2EZVA 3GTJB 5C4JB 5I9OA 3MC0B 1CQVA 3AU7A 2F4IA 3NXWA 2EOTA 3A56A 4PQXA 4KKTA 3D4WA 3OW7A 1C4QA 1EYDA 1IW7D 1SSOA 1JWUD 4PMWA 5IODA 3OPOA 3LWUA 1TWAB 3SE0A 5M3MB 3OSOA 2OT2A 2F0OA 2JA8B 5CYUA 3KLRA 4RKBA 3I4MB 1PZKD 2A69C 2EYJA 5K36H 1OXUA 4DA2A 2BE5D 1BXTA 1L0XB 4B08A 2RKSA 2PNRC 1EY4A 1LACA 4M8AA 2NZ1D 1PZJD 3BZDB 2MUYA 2XN9C 5DNFA 3Q0AA 3HOZB 2K6AA 3S1MB 1BDOA 1WD1A 1WTXA 2NTSA 1HCZA 1TS3A 1R9TB 2RSNA 1KNAA 2RSOA 1WTVA 3MWYW 2EE1A 1JE4A 5BN5A 4FF2A 4IFDJ 1TWGB 4NKLA 4R8NA 4Q0FA 1EIGA 3HGBA 1GUWA 3EQLC 4A3DB 2EYLA 1CA5A 4ZAIA 4HSPA 4RCOA 3A8JE 5C0XG 1VDZA 1DXMA 3SXHA 1HQMC 2AQ1B 1NR4A 4FYDA 4G57A 2F0EA 1XX8A 1Y1WB 2XNAC 2QILA 4KV6A 1PFNA 5CV9A 1X3QA 2D62A 1CI3M 2JXMB 1PMRA 4XXEA 3K5OA 1EQTA 1LT6D 1U9RA 3IL8A 4X3KA 1AN8A 3MAQA 2MP1A 5C4XB 2KHSA 4C3JB 2L1BA 1EL0A 4L6TB 1GJXA 2F0PA 1HA5A 1BCPC 3R2IA 5IGCA 2WACA 5ISRA 3DWPA 3QO2A 1LABA 3OHXC 2KEEA 1SYBA 3MXGA 5E3FA 4HMIA 2KUMA 4KD3A 3S1QB 3S14B 3D31A 4DF7A 2E2JB 4TSSA 5D3IB 1PTOC 4X3TA 4KY7A 5BN4A 1PFBA 4I7ZC 1YNND 5C4ZA 4L8JA 4ZQ3A 1A3TA 1DYQA 1IYVA 3MXPA 2DY7A 3QG1A 2PZUA 1BCPF 1RF2D 2K01A 4KK7A 1Y69U 1Q12A 1S5CD 3TN2A 3I90A 3TSSA 5EQ0A 1A15A 5CV7A 3EJIA 3M4YA 3QIAA 1FNVA 3HS0C 3D4DA 4H44C 1CM9A 1DZ1A 1H9SA 2WB1B 2KCCA 5CGKA 1LT4D 2WKCA 3GD7A 2NUCA 4WJWA 1LTRD 4HN7A 1Z7TA 1Y1VB 2HDLA 1KDAA 1PRTB 3I72A 2KCNA 4HTHA 4K8IA 2RVLA 3Q6SA 2G9HD 1U4RA 2B2VC 3QJYA 3I4NB 1BUVT 3NE5B 3K7AB 5EPLA 5KGUA 3OWFA 4OHJA 3TDQA 2BCOA 5CR3A 3GTLB 3C46A 2F03A 3O13A 2L4NA 4DN4M 2Q8RE 2J7ZA 3SEBA 2NVXB 3SK4A 1WCMB 2DY8A 1V1PB 4IFDG 5BN3A 1EY7A 1SE4A 3S1NB 1B2TA 5C6AA 1H9RA 2R3ZA 1ZKOA 3DXJC 2KA7A 4CBVA 4XT3B 1RD9D 3TP7A 3L7ZC 4RWSC 3RMHA 2PMZB 4RCNA 1AW7A 1O78A 4CHTB 3GV6A 4A3JB 2F0UA 3VYSA 1RCVD 1O80A 1OXSC 1JC7A 2L55A 5LL6X 2Z8LA 3S15B 2L12A 3MVVA 5A2QL 1WTOA 4C56C 1RTNA 2KECA 3MZ5A 4KMUC 1GUNA 3PO2B 2YYZA 3X3MA 4PV1C 5IGEA 3MXNA 4CJ1B 3P7JA 1H9SB 1STGA 4K6LA 4KKSA 3KF8A 2LMCB 5K5PA 2IX0A 1CHQD 3RZDB 5CV4A 2IT1A 3BVGA 2B63B 4Y7NB 1UAPA 2FINB 1PXUA 2QEJC 2B2UC 3CKIB 3R2TA 2QDBA 4K5XA 3HOVB 2KEDA 4G4KA 4ABNA 2IPKD 2FFKB 5I6YA 4EQNA 5ELBA 1F2LA 1JOQA 3HOXB 1SYGA 1SYDA 1STNA 2B2YC 2BA0A 1KABA 2NB0A 5TSSA 1PTOH 3VA5A 5A2QE 1RODA 4EQOA 2JA6B 1HA6A 2K28A 1SE2A 2A74C 5E4WC 2D2CC 1ILPA 3L3OC 5HURA 3DWAA 1U4MA 2A6ED 2YU9B 4EQPA 4C3IG 4E6IA 5JOBA 1LTAD 4G7OC 4QUCA 1TS5A 2RBMA 1G2TA 2X6LA 5D65A 4XQJA 2PO4A 1X32A 1QOHA 3Q23A 4IFDI 3S1RB 2WP8J 1Z47A 1GXDC 1EWHA 3FKIB 3K5NA 1O7YA 3BYTB 4J8QA 4C1NI 1VCIA 3J7AV 1HUNA 4BY1B 1QILA 4QIWB 1BQQT 3G7LA 4BY7B 2KOLA 4CJ0B 1BNZA 3JAME 3KLSA 3KBGA 2XSCA 4A93B 1T5XD 1O7LA 1U4LA 3DEOA 3KK7A 2OF1A 1QNUA 4H13C 3GO5A 2L5TA 3GTGB 1A3VA 2WINB 1I4QA 1F9SA 2MHVA 3W3AA 5EBDA 3E0JA 3SDZA 2MJ8A 4A3IB 3QOJA 2NN6I 4M1UB 4N9TA 4ID6A 2A68D 4ULLA 1ESRA 1JWMD 1Q3LA 3AB9A 4CGYB 1LT3D 4DGZA 1I4PA 1RTOA 3J7AF 1GUSA 5DAUA 1AFPA 3E5SA 1ZXTA 2O4XA 1HQRD 1LTID 1KNEA 4ZK9B 3SHLA 1K83B 3CRLC 3GTKB 2R93B 1NAPA 4DFAA 1STEA 3T16A 4NMZA 4FXDA 4GZYC 1A6XA 4OO1G 5FLXE 1GUOA 2ID0A 2HQEA 3NTKA 4DXGA 3T51B 5CV8A 1HRJA 1M4VA 2EPBA 4DAYA 3GP7A 4I65A 1QE6A 2NBFA 5LL6S 1X3PA 3BDLA 4DK1A 1IW7C 1PRTD 3CQZB 1SE3A 4H0LC 4K6DA 1OXTA 2JEAI 3I73A 4DXFA 5JPMC 2PYKA 5M5WB 2JA5B 2D5DA 1F2YA 1WTQA 1GUTA 1TKWB 2R92B 4WFN3 3NQIA 4HCSA 1W6JA 1SBBB 1PRTF 2BE5C 2E76C 1JOOA 1YNJD 1S4ZA 5KRUA 1PLFA 4C3HG 5JEAH 4C3IB 5EGTA 5FO8B 2XVSA 2IWHA 5C4HA 2NVYB 1PDQA 3NTHA 3Q22A 4HCEA 1D5XC 3FDTA 3BS1A 1AZPA 1O7ZA 3BG3A 5EKLA 1B3AA 2CW0D 1A3UA 1C48A 3TBIB 4WORA 1BR9A 5KNBA 4KJNA 1EYCA 1ICWA 4NP5A 2Z1CA 4F7XA 4OIJA 2A69D 4LK1C 1ENAA 2PPBC 3NK9A 4JBWA 3K0YA 3P1HA 4KJOA 4FF4A 1RKNA 5JAVA 1I4RA 4TKOB 3OMGA 2DN8A 4RGTA 2LY7A 2NYZD 1RDPD 3T13A 3DM1A 5E1FA 1TWHB 4OO1I 5CBAE 1PZID 2K33A 4IURA 2IW3A 3GV3A 1CZGA 5CC4A 1LTGD 1I4GA 2J4XA 4ZKCB 3URYA 2RDGA 3BDCA 2JEBI 4OGQC 1SAPA 2JA7B 1XXGA 2EY1A 5KNDA 4CJ2C 2MPMA 2VNUD 2R6GA 1PFMA 2B2WA 3GTQB 5CV6A 4B9WA 1TT2A 5T1IA 1CHPD 1EQVA 2ICEC 2AWOA 3SK6A 4A3GB 4ZUIA 1TU2B 1JORA 3A8IE 1NCVA 1R4PB 2HCCA 4XQQA 1F9PA 1I3QB 1QCBD 4FF3A 5CV5A 1E2WA 1A2UA 3OIPA 3QWNA 1R4QB 1V43A 2M2LA 1YNNC 1V1PA 1S5BD 3MFGA 1SYFA 1DD2A 4N9PA 2RA4A 1V8QA 4ZLTF 1UUPA 4BA2I 2RQXA 3J80L 5IT9L 1J8IA 2A6HD 2HCIA 3VR4A 1TVXA 3PV0A 3CU7A 1C8CA 2L11A 1ZYRD 2TMPA 1WTWA 5A35A 3U9OA 4FF1A 2OXPA 2XRSD 2LS01 2K7VA 1G8ZD 4RHSA 3H94A 2SNMA 3DHQA 2PZTA 2F0KA 3V96A 4A3MB 4Z9CB 4U68A 2ICIA 4C3HB 4KY6A 3BDOA 3S9WA 5ELDA 3MHBA 3M3YB 3EROA 4AYBB 4KY5A 5C0XH 2F0NA 1T5EA 4DNTB 3G6JB 4RHRA 5D14A 1D1IA 2F0QA 3HOYB 2Z4IA 2BOSA 2SEBD 3J80E 5JVG3 3NQTA 1D1KA 3RUZA 5C44B 4XYQA 5JJZA 2A73B 1OXXK 5DM63 1B44D 3D8GA 3PO3B 1ONLA 2RDHA 2B39A 3DMUA 5I6WA 5EKKA 1EY8A 5I4DA 1U4PA 3CHBD 4XDXA 2TSSA 1WVLA 2EYOA 2I46A 5IGDA 1DOKA 3M7NA 3RLFA 2H4OA 5IGFA 2JP1A 1GUGA 1EY9A 4RGNA 4K14A 1B53A 3A8KE 3SK5A 1DONA 3GTOB 1KLGD 4FXKC 3LX0A 1Q1EA 5JEAJ 1WTRA 2B2TA 2LKVA 3M85A 3HZXA 2O5JC 2F0SA 4IUUA 2KQ3A 1LT5D 5FK9C 4DAPA 5ELEA 5FO7B 3A55A 2CQAA 2IL8A 2EVBA 2PW7A 3N6RA 1SNCA 3FVQA 3SR1A 2F0DA 3NUCA 4IQZA 1QG7A 3H0GB 2SOBA 2CHBD 4KTAA 1IKMA 2NN6G 4DK0A 2AQ3B 3D4RA 4RGOS 1JQYD 1BOSA 3DUZA 2Z4HA 5C5MA 1AP0A 3PUXA 2VB3X 3HOUB 1LTTD 1FGBD 3FPPA 1HXYD 1SJHD 2Q8TA 2NVQB 3KUPA 2OEOA 2JE6I 4PMBA 2ZXPA 2A6EC 1EYAA 2QKIC 1AZQA 3WOFA 4XYOA 1RJTA 5AFWA 4ZKBB 5NUCA 4F88A 2D9UA 1GHKA 2AWNA 2R7ZB 3IAYA 5J22A 1KLUD 2FJ2A 2I07B 3PIO3 5KNCA 1FD7D 4BBSB 4QF4A 1ENCA 5FO9B 4A3EB 4QUFA 1TIID 3TZDA 3N52A 2B8FA 1DM0B 1STYA 4BBRB 3FPUB 3D3RA 1STBA 2KVMA 4KHZA 3J81L 1MI2A 1V1OA 5M9OA 2PZWA 1MGSA 1SMYD 2QF7A 3K58A 1QWYA 4KN7C 2XRQD 3K6OA 1TQOA 2ZT9C 1BCPB 3ND8A 3PUYA 4PMCA 2PW5A 4ZRZA 4A3KB 1JICA 3H09A 4XT1B 5M3FB 5JVH3 4UDUC 3TP5A 5G3LD 3S2HB 3VYTA 4U673 2F0VA 4KHVA 2A68C 1PTOB 1TY0A 5IGGA 1EY6A 1CFMA 1Q1BA 2EJMA 3S2DB 3A7LA 2L0CA 4X3SA 4RFBA 3WDNA 3J81E 1TS4A 1CZWA 3HG9A 1DJRD 4H7BA 3D6WA 5JEAG 2Y0SB 5K36G 5C0XJ 1FNUA 2F3VA 2F0MA 3A7AB 4IUQA 3U9SA 4ZYSA 1F2ZA 1EU3A 1VF5C 4HR7B 5KIXA 2VUMB 1L0YB 1SFOB 1D5ZC 2FHTA 2PCFB 2ENBA 2KJXA 5C3XA 3OMCA 1SNPA 1Y8OB 5LHY1 1B1ZA 1F2MA 1UNSA 1TR5A 1PRTC 3DEPA 1D6EC 2B2WC 2E75C 1F9RA 3BVMA 3LWEA 1MD2D 2F0HA 4XIGS 1E0BA 1I6HB 3A54A 3HKZB 1JWSD 1EU4A 1Z6HA 1ENFA 1H9JA 4QMGA 2HDMA 3MTSA 3HP3A 3KBXA 1B9MA 4DU9A 1BO0A 1W6KA 1YNJC 3C1EA 3ITPA 1DOLA 4R9WA 1KDBA 3NHHA 2C5CA 3K5MA 2F0FA 4V0BA 1BBXC 1B4OA 3NP8A 2VB2X 2CW0C 2F0GA 3R3OA 4B9XA 5ELCA 5J39A 1HUMA 1ET9A 2AUJD 1DCZA 1MBYA 1SDFA 1H9KA 3PUVA 3S16B 5E4XA 1JCKB 2IJ0A 2K5DA 2RDFA 1LLRD 2F1MA 3VA7A 4L63B 2K32A 1I50B 4J1MA 4P2CB 3NPPA 1IL8A 1TS2A 3IFDA 4MIUA 4OO1H 1CTMA 2ZXOA 1EZ8A 4FVMA 2R61A 1B50A 1SEBD 1LO5D 1WD0A 3ERQA 3MA2B 1SYCA 4EVOA 2F0IA 5CORA 3L9AX 2IX3A 2FMMA 4TQUS 4A3FB 1HFGA 3RZOB 4XQNA 1LTSD 2Q8IB 3BYYB 4K2LA 5I2XA 1J9OA 3S17B 4BA1I 4NW2A 3MEHA 2EJGC 4FXGC 3ND9A 2NWGA 1FR3A 1SNQA 1STHA 1S5FD 4C2MB 1PYWD 3HRZC 4WRDA 1AEXA 1SYEA 2B2TC 4RKLA 3J7YW 3HOWB 2F0LA 5J1ZA 1OO9B 3I8ZA 5DEHA 4C1NK 1FNWA 5FKAC 2CVRA 3F2UA 1GOZA 1JR0D 3I91A 3R8BA 3BVZA 3VYUA 3DWQA 2M9VA 1NUCA 1MSGA 2EYHA 1VF7A 2K04A 3P75A 2SDFA 2A6HC 3C2PA 5IIFA 1KDCA 2F0JA 3E6ZX 5D3DA 1ZYRC 3PMFA 2X6GA 4O1NA 1EIHA 3UI2A 1IHZA 4ODGA 3ONAB 1TWCB 1BCPD 1G291 3OIQA 2J0TD 3V2TA 3I4LA 1Q90A 4S3SA 2E2IB 2EY2A 3V05A 1NR2A 1RHPA 4O42A 2EY6A 2DNEA 1PTOD 1NSNS 4ME5A 1ML0D 4CKBA 1K8MA 1BF4A 3D6CA 2C9OA 2WKDA 2EDGA 5EKIA 3I3CA 4MHEA 1FYCA 1GHJA 1I4XA 2O5IC 3EVQA 3H6MA 1G6ZA 4K8JA 2K5QA 3Q24A 4KKUA 2FMCA 5IT9E 3MFYA 3EFXD 4F87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4K A;  4XYQ A;  4XXE A;  4CBV A;  4XQN A;  4XQJ A;  4XQQ A;  3BS1 A;  4XYO A; 
#chains in the Genus database with same CATH topology
 1QNK A;  4UPA A;  4DV0 L;  1I6V C;  4UAI A;  4X3U A;  2NVT B;  3PIP 3;  1PTO F;  2R7F A;  3NWS A;  2V4D A;  4HAE A;  4DV4 L;  1EFI D;  3S15 H;  3CCL A;  1MSH A;  4TRD A;  2E2D C;  2PMZ E;  4JYA L;  1GM5 A;  5C0X I;  3PO2 H;  2PI2 A;  1K0S A;  3IKJ A;  2H1E A;  1NNX A;  3H0G H;  1QZH A;  3FEW X;  2E2H B;  1ASY A;  2K05 A;  1M8A A;  3U50 C;  1ESF A;  3QOL A;  4A3C H;  4BWG B;  3RZD H;  3T53 B;  1E2V A;  1L1O A;  1UE1 A;  4JK1 C;  2LFN A;  2Q2I A;  1HNZ L;  3TME A;  4LMQ D;  5IWA L;  4LFC Q;  1XTC D;  4Q5V A;  1CK1 A;  3KLS X;  5LMU Q;  3OWE B;  1LTL A;  1VQB A;  5IYD G;  4R8I A;  4LWC A;  1C7Y A;  5EPK A;  3HOU H;  3OOC A;  4IUN A;  4ZCK A;  5HGT A;  2ALY B;  2JSO A;  3HOV H;  1A0I A;  3MXU A;  4JI2 L;  4V19 0;  2M00 A;  3A5Z B;  2NVQ H;  3NSW A;  1AE2 A;  1EY5 A;  5F2D A;  5LMN W;  3K8A A;  1QVC A;  1QVG A;  5C3E G;  4L5S A;  2SNS A;  3GQB A;  4P73 A;  4OL7 A;  4XTC S;  1TY2 A;  1S5E D;  4HIO A;  4EGV A;  3VR5 A;  4GKJ L;  5KYI A;  1I94 L;  5IE8 A;  2JA6 H;  5KEE A;  1G91 A;  4WJ4 A;  1LV9 A;  1Q8I A;  4CDD C;  4G7Z C;  5JPN C;  3W2D A;  5E7N A;  2ZM6 Q;  1UEA B;  2VS1 A;  4YWL A;  1WOC A;  2N88 A;  4G7H C;  1KTK A;  2BDO A;  4DV1 L;  1QB5 D;  1EIY B;  1F77 A;  2YU9 H;  4LF9 Q;  2K1B A;  4X66 Q;  1HFN A;  4J6H A;  1ET6 A;  1HPC A;  4L5R C;  3PUZ A;  5T1G A;  4RGM A;  4JI8 Q;  1YHA A;  4A3L H;  2E5L L;  2VXW A;  5I9P A;  4YIJ A;  5I2Y A;  1ZEQ X;  4DAV A;  1IKL A;  1XWE A;  2GA4 B;  5EAY A;  4A3B B;  3T56 B;  3S1R H;  4BBR H;  4GN4 B;  2EXZ A;  1T9H A;  4LFA Q;  3NWT A;  1GO3 E;  1YJW A;  2B8G A;  1QJO A;  3ZYY X;  1Y8P B;  4DV7 Q;  2OQK A;  1G2S A;  4F8M A;  2EY5 A;  4JI1 Q;  4HED A;  4IUV A;  4EQ5 A;  1D5M C;  2WV6 D;  5M5X B;  1E2Z A;  1H9M A;  4JI7 L;  4BY7 H;  4FO2 A;  2WII B;  3ICE A;  3CC7 A;  4YHH Q;  1WTH A;  4DNR B;  4A93 H;  4K5V A;  2QCP X;  1UE6 A;  3C3L A;  1CT1 D;  1Q86 C;  3SVM A;  3VR6 A;  2EYP A;  4LJZ C;  2GN5 A;  2PQE A;  4WJ3 M;  1JB3 A;  1E24 A;  1LTB D;  3VR2 A;  2EQS A;  2CKZ B;  3GTG H;  3CW2 C;  1KRT A;  3EA6 A;  2F4V L;  4QCL A;  4QIW E;  3G71 A;  4NPS A;  2A5H A;  4IN3 A;  4IFD H;  5M3M G;  2NZO A;  2HUG A;  2XWJ B;  4ZUJ A;  4A3I H;  1HTP A;  4KI0 A;  3JC6 6;  3JAM L;  1II3 A;  1SXT A;  4IZ8 A;  2I0Q A;  1X54 A;  4FNF A;  2QGQ A;  4BS9 A;  1I4H A;  2JA8 G;  2C35 B;  3LNN A;  2NTT A;  3H91 A;  3I4M G;  5FOB B;  1F9Q A;  3QB3 A;  1B9N A;  4LF4 Q;  2L9H A;  1EWC A;  3HEJ A;  1SRU A;  1TWF B;  4JBJ A;  3T1H L;  2X69 A;  4LF6 Q;  1SMY C;  5C5L A;  1VMP A;  1D2B A;  3TZU A;  3I70 A;  1DOM A;  1EEI D;  2AQ2 B;  4LF8 Q;  2BDN A;  2ZXR A;  3K5L A;  3GTP B;  3ULL A;  2B2V A;  2HIV A;  2E74 C;  3IFT A;  4DV3 Q;  3FMC A;  3VR3 A;  2EJF C;  2F0T A;  3CCR A;  4GN5 A;  1K83 H;  2N55 A;  4DV5 L;  4RH6 A;  2R93 H;  5CMD A;  1SND A;  2E8G A;  2UUA Q;  3AMU A;  2L15 A;  2VUM H;  1SFO H;  3TP8 A;  1BBU A;  2DNC A;  3HOZ G;  2G9D A;  4O2D A;  3M4O B;  1ICF B;  4RAU C;  3TP6 A;  2AUK A;  5IYB H;  1X3G A;  2XIW A;  3WOE A;  3P20 A;  2NN6 H;  3ER0 A;  1XNR L;  4FP5 D;  1XYI A;  3MXN B;  3PUW A;  1IYU A;  1A2T A;  5M5Y B;  2EYM A;  2F0W A;  2K5W A;  3KF8 B;  4OIK A;  5CBE E;  5COY A;  3FRP B;  1EOT A;  4DR6 L;  2WAQ E;  2EYF A;  3RD4 A;  4MTN A;  3M7G A;  4GLX A;  5EJW A;  3X3N A;  1HTL D;  1ILQ A;  5JJL A;  5FLX L;  4DR4 Q;  3NBH A;  4K5W A;  4CKE A;  4K0K L;  4RA8 A;  5KYL A;  4CKC A;  3J80 i;  4LAA A;  2ASB A;  1QUQ A;  3SK8 A;  2F3W A;  1D7Q A;  4A3D G;  5C3E B;  3G48 A;  4J15 A;  1SJE D;  1W3S A;  5G3L F;  3AEV A;  1CA6 A;  4IUT A;  5H1S E;  3CPF A;  2MNA A;  4MN3 A;  1STA A;  1NJI C;  5DM7 3;  5IP9 G;  3GTM B;  2K03 A;  4YWK A;  4PNY A;  1IBL Q;  1YIJ A;  1Y1W G;  2R92 H;  4KD4 A;  1SNM A;  4P74 A;  1Y8N B;  4DV0 Q;  3H3V C;  1SNO A;  1S5D D;  3T4A C;  1OXV A;  5IOC A;  1CQF A;  4K2K A;  2XWB B;  1EY0 A;  4NDX A;  4IAL A;  1LYL A;  4DV4 Q;  4QB4 A;  5EPJ A;  5IGB A;  4HMJ A;  1HZB A;  1KC8 C;  4JCV E;  4C3I H;  5C3W A;  4LW1 A;  2IX1 A;  1WTP A;  4NXN L;  4JYA Q;  2K52 A;  2VL6 A;  2YTY A;  4HSV A;  4JPB W;  2O2L D;  1JOK A;  2B2U A;  1EZ6 A;  2WAQ B;  3C1F A;  1EEF D;  5EBC A;  4KN4 C;  5ELF A;  5C4X G;  3NBI A;  4C3J G;  2MGS A;  1VMC A;  3CRK C;  1JJ2 A;  1HR0 W;  3KF6 B;  1OTC A;  1IL2 A;  3VYR A;  1HNZ Q;  5IWA Q;  3R93 A;  5IP7 G;  1HHV A;  3LGJ A;  1KAA A;  4ILW A;  1MJE A;  2BA1 A;  1K8O A;  3KJO A;  1N34 L;  1K0R A;  3NTI A;  2B2Y A;  4DR7 Q;  4IUP A;  3CCU A;  3K57 A;  3K59 A;  2JYO A;  2EZV A;  3GTJ B;  4JI2 Q;  5C4J B;  5I9O A;  3MC0 B;  1CQV A;  3AU7 A;  1NTG A;  2F4I A;  3NXW A;  4ME3 A;  1Q82 C;  1E3P A;  2EOT A;  1GKH A;  3A56 A;  4PQX A;  4KKT A;  4RMF A;  3D4W A;  2KHJ A;  3OW7 A;  1VQF A;  3BU2 A;  1C4Q A;  5L37 A;  4GKJ Q;  1I94 Q;  1EYD A;  1IW7 D;  1SSO A;  1JWU D;  4PMW A;  5IOD A;  3OPO A;  3LWU A;  1TWA B;  3CC2 A;  2VQF L;  3SE0 A;  5M3M B;  3IRB A;  3OSO A;  4JOI C;  2OT2 A;  4DV1 Q;  2F0O A;  2JA8 B;  5CYU A;  3KDF A;  3KLR A;  4RKB A;  3I4M B;  4CDF C;  1KAW A;  1KXL A;  1PZK D;  1HZ9 A;  2A69 C;  2EYJ A;  1VQJ A;  2JA7 H;  1B7Y B;  5K36 H;  2E5L Q;  1OXU A;  4JW0 A;  4JBM A;  4DA2 A;  2KBN A;  2BE5 D;  1BXT A;  2WB1 G;  1L0X B;  1LUZ A;  4B08 A;  2RKS A;  3U4Z A;  4C2M H;  2PNR C;  3CCS A;  1EY4 A;  1LAC A;  4M8A A;  4OWX B;  3UDX A;  2NZ1 D;  3BZD B;  1PZJ D;  2CFM A;  3PSI A;  2MUY A;  1Y1V G;  2MFI A;  2XN9 C;  5DNF A;  3Q0A A;  3D0F A;  2K6A A;  3HOZ B;  4R4O A;  3S1M B;  1BDO A;  1WD1 A;  1WTX A;  4JI7 Q;  4KHP L;  2NTS A;  3I4N G;  1HCZ A;  1TS3 A;  4B3S L;  4LF7 L;  1ASZ A;  2OQ0 A;  1R9T B;  3KLW A;  3HKS A;  4DR3 L;  2RSN A;  1KNA A;  2RSO A;  1WTV A;  3MWY W;  2EE1 A;  1JE4 A;  2F4V Q;  5BN5 A;  1X3F A;  5FLM G;  3J7A 5;  4FF2 A;  3CD6 A;  4IFD J;  4KLK A;  3OYY A;  1XJV A;  1TWG B;  1WCM G;  4NKL A;  4R8N A;  4DK6 C;  1CKO A;  4Q0F A;  4R4Q A;  1PA6 A;  1EIG A;  3HGB A;  1L1O C;  1GUW A;  4LFB L;  3EQL C;  4A3D B;  1FGU A;  2EYL A;  1CA5 A;  3TEH B;  4ZAI A;  1B70 B;  3PIP A;  4HSP A;  4RCO A;  3A8J E;  5C0X G;  1VDZ A;  1TWC H;  1DXM A;  3SXH A;  2HQL A;  4OEL B;  1HQM C;  2AQ1 B;  3T1H Q;  1NR4 A;  3T1Y L;  4FYD A;  2PQA B;  4G57 A;  2F0E A;  1XX8 A;  3G4S A;  2UXC L;  4A3J G;  2XNA C;  2QIL A;  1Y1W B;  1SRO A;  4KV6 A;  3CCJ A;  1PFN A;  5CV9 A;  4R1J A;  1X3Q A;  2HHH L;  2D62 A;  1CI3 M;  2JXM B;  1PMR A;  4XXE A;  2N78 A;  3K5O A;  3L0O A;  4DV5 Q;  4C3H H;  1KIX A;  1EQT A;  1AH9 A;  3H3V H;  1LT6 D;  1U9R A;  2QA4 A;  3IL8 A;  1K3R A;  4X3K A;  3PF4 A;  1AN8 A;  3MAQ A;  2MP1 A;  1CSP A;  3PO2 G;  4YCV A;  3DLL A;  5C4X B;  2I5H A;  2KHS A;  3HOY H;  4C3J B;  2L1B A;  3J81 i;  1EL0 A;  4L6T B;  1GJX A;  4A3C G;  1PHJ A;  2F0P A;  2V1C C;  1HA5 A;  1P16 A;  1BCP C;  3R2I A;  5IGC A;  2NVT H;  2WAC A;  5ELN A;  4JI5 L;  5ISR A;  2B63 G;  5C44 H;  4DR6 Q;  3DWP A;  3QO2 A;  1LAB A;  4AYB E;  2GVA A;  3OHX C;  2KEE A;  1SYB A;  3MXG A;  5E3F A;  4HMI A;  3PO3 H;  2KUM A;  4KD3 A;  3HOV G;  3S1Q B;  3S14 B;  3D31 A;  4DF7 A;  1XMQ L;  2E2J B;  4TSS A;  5D3I B;  1PTO C;  4X3T A;  4KY7 A;  5BN4 A;  2N8N A;  2AHO B;  1PFB A;  4I7Z C;  3HOX G;  1YNN D;  2H5X A;  5C4Z A;  4L8J A;  4ZQ3 A;  1A3T A;  1DYQ A;  4GN3 B;  4X6A H;  1IYV A;  3MXP A;  2DY7 A;  2EIF A;  3QG1 A;  2PZU A;  3GTO H;  1BCP F;  1RF2 D;  2K01 A;  4KK7 A;  1PH9 A;  1Y69 U;  3NEL A;  2VQE L;  1Q12 A;  4N8X 1;  1S5C D;  2KCM A;  2MO0 A;  3TN2 A;  4NXN Q;  3I90 A;  3TSS A;  5EQ0 A;  1FVI A;  4PZ6 A;  2RF4 A;  1A15 A;  5CV7 A;  3EJI A;  3M4Y A;  1CUK A;  3QIA A;  1FNV A;  3HS0 C;  1YVC A;  3D4D A;  4H44 C;  2CWP A;  2UUC L;  1CM9 A;  1DZ1 A;  1H9S A;  2WB1 B;  5FJ8 H;  5JJI A;  2KCC A;  5CGK A;  3TQY A;  1LT4 D;  2WKC A;  3GD7 A;  2NUC A;  3FKI G;  4WJW A;  1CKN B;  4R4T A;  1LTR D;  4HN7 A;  4DV2 L;  4X62 L;  1Z7T A;  1Y1V B;  2HDL A;  1K8A C;  1KDA A;  1PRT B;  4BXX H;  3I72 A;  2KCN A;  1BBW A;  2LSS A;  4BY1 G;  3VDY A;  4HTH A;  4K8I A;  2RVL A;  3Q6S A;  4UP7 A;  2G9H D;  1U4R A;  2B2V C;  3QJY A;  3F8T A;  3RLO A;  1PH3 A;  2Q2U A;  3I4N B;  4BY7 G;  3AQQ A;  3PIO A;  1BUV T;  3ULP A;  1JE5 A;  3NE5 B;  4A93 G;  3K7A B;  5EPL A;  5KGU A;  3TS0 A;  1X6O A;  3OWF A;  4OHJ A;  1YEZ A;  1C9O A;  3TDQ A;  2BCO A;  1PFS A;  5CR3 A;  2N49 A;  3C46 A;  3GTL B;  3J7Z C;  2F03 A;  1HR0 Q;  2RHS B;  3O13 A;  2L4N A;  4DN4 M;  1VQ9 A;  2Q8R E;  4DPG A;  2J7Z A;  3SEB A;  2NVX B;  3SK4 A;  2RCF A;  2VQF Q;  1WCM B;  2DY8 A;  2QW7 A;  1V1P B;  1X3E A;  4IFD G;  5BN3 A;  1EY7 A;  1SE4 A;  3S1N B;  5AJ3 L;  1B2T A;  4A3I G;  5C6A A;  1H9R A;  3NEN A;  2R3Z A;  1ZKO A;  5M5X H;  1YBY A;  3DXJ C;  2KA7 A;  1A62 A;  1SE8 A;  4CBV A;  4XT3 B;  1RD9 D;  3H15 A;  2R7D A;  3TP7 A;  3L7Z C;  4LNQ A;  4RWS C;  3RMH A;  2PMZ B;  4RCN A;  1S40 A;  1EYG A;  1AW7 A;  2EXD A;  1O78 A;  1J6Q A;  1P8L A;  4CHT B;  2R7Z H;  3GV6 A;  4A3J B;  2F0U A;  1XPU A;  4LUZ A;  3RR5 A;  1Q7Y C;  4JBK A;  3VYS A;  1RCV D;  1O80 A;  2PI2 E;  1OXS C;  1G6P A;  1JC7 A;  2K14 A;  1SMX A;  2L55 A;  1DGS A;  4OWT B;  5LL6 X;  2Z8L A;  2R93 G;  3S15 B;  3JAM c;  2L12 A;  4BBS H;  3MVV A;  1PYB A;  5A2Q L;  1WTO A;  4C56 C;  3BZC A;  4L5Q A;  2WAQ G;  1RTN A;  2KEC A;  4A3E H;  2KHI A;  3GDE A;  3MZ5 A;  4KMU C;  1GUN A;  1N9W A;  2ES2 A;  4B3M L;  1KRS A;  3PO2 B;  2YYZ A;  3X3M A;  4QJF A;  3CF5 A;  4PV1 C;  5IGE A;  3MXN A;  4CJ1 B;  1QZG A;  4KHP Q;  3P7J A;  1H9S B;  1STG A;  3K0X A;  4K6L A;  4KKS A;  3KF8 A;  2LMC B;  4LUO A;  4N8F A;  5K5P A;  2IX0 A;  1CHQ D;  3RZD B;  1VQD A;  2IT1 A;  5CV4 A;  4LF7 Q;  3BVG A;  3GTP H;  4DR3 Q;  2B63 B;  4Y7N B;  1UAP A;  4HIM A;  1N33 Q;  2FIN B;  1PXU A;  2QEJ C;  2B2U C;  3CKI B;  3R2T A;  3KYH C;  2QDB A;  4YCU A;  4K5X A;  3I55 A;  3HOV B;  2KED A;  3TS2 A;  4G4K A;  4ABN A;  1HJP A;  2IPK D;  4RG1 A;  1IBK L;  4A3K H;  2FFK B;  5M3F H;  4LFB Q;  5I6Y A;  1K28 A;  4PG3 A;  4EQN A;  1S3O A;  5ELB A;  3OTO L;  1F2L A;  2UUB L;  1JOQ A;  3KOJ A;  3HOX B;  4R4C A;  3S2H H;  1SYG A;  1SYD A;  1STN A;  4IOA A;  2B2Y C;  2BA0 A;  1KAB A;  2NB0 A;  2Z0S A;  1PTO H;  5TSS A;  2JA5 G;  3VA5 A;  5A2Q E;  1ROD A;  4EQO A;  2JA6 B;  4QQB X;  2UXC Q;  1HA6 A;  2K28 A;  2R92 G;  1SE2 A;  2A74 C;  5E4W C;  2D2C C;  3UE1 A;  2HHH Q;  1ILP A;  3L3O C;  1VS0 A;  5HUR A;  3S2D H;  1K3B C;  3DWA A;  1W2B A;  5FLX c;  1U4M A;  2A6E D;  2YU9 B;  4EQP A;  4CDC C;  4C3I G;  1C0A A;  4E6I A;  4JI6 L;  1HH2 P;  5JOB A;  1LTA D;  5C3E H;  4G7O C;  1IZ6 A;  1TS5 A;  2RBM A;  4QUC A;  4NB3 A;  1G2T A;  2X6L A;  5D65 A;  4XQJ A;  2PO4 A;  1X32 A;  1VQA A;  1QOH A;  2WFW A;  3KF6 A;  3Q23 A;  3GTM H;  4IFD I;  3S1R B;  2WP8 J;  1Z47 A;  1GXD C;  1EWH A;  3FKI B;  1YIT A;  3K5N A;  1O7Y A;  3TRE A;  3BYT B;  2Y0S E;  4J8Q A;  4C1N I;  4JI5 Q;  1VCI A;  3J7A V;  1HUN A;  2Q2H A;  4BY1 B;  1QIL A;  2B29 A;  4QIW B;  4JC0 A;  1X9N A;  1BQQ T;  3RN5 A;  3G7L A;  2CCZ A;  4BY7 B;  2KOL A;  4CJ0 B;  1BNZ A;  2IHF A;  4JG2 A;  3JAM E;  1XMQ Q;  2UXB Q;  3KLS A;  1HNW L;  3KBG A;  2XSC A;  4A93 B;  1T5X D;  1O7L A;  4JI0 L;  1U4L A;  4JV5 L;  1NY4 A;  3DEO A;  3KK7 A;  1UE7 A;  2OF1 A;  3BZK A;  1I6H H;  3PF5 A;  3W1G A;  1HNX L;  1QNU A;  2N3S A;  4H13 C;  3GO5 A;  2L5T A;  3GTG B;  1A3V A;  2WIN B;  1I4Q A;  1L0W A;  1F9S A;  2MHV A;  2B3G A;  5GAE C;  3W3A A;  5EBD A;  3E0J A;  2YTX A;  3SDZ A;  2MJ8 A;  4A3I B;  3QOJ A;  2NN6 I;  4M1U B;  4DK3 C;  1GD7 A;  4N9T A;  3GTJ H;  4ID6 A;  2A68 D;  2KEN A;  4ULL A;  1ESR A;  1JWM D;  2VQE Q;  4JVZ A;  2CH4 W;  1YZ6 A;  1MIU A;  2I5L X;  1Q3L A;  3AB9 A;  4CGY B;  3HKZ E;  1S72 A;  1LT3 D;  4EX5 A;  2AKW B;  2JA7 G;  5ELO A;  4DGZ A;  1I4P A;  4GOP B;  1RTO A;  2UUC Q;  3J7A F;  1GUS A;  2XTI A;  5DAU A;  1IBM L;  1AFP A;  3E5S A;  1TWA H;  1ZXT A;  2A8V A;  2O4X A;  1HQR D;  1LTI D;  1KNE A;  5M3M H;  4ZK9 B;  3SHL A;  1K83 B;  3CRL C;  3GTK B;  2R93 B;  4DV2 Q;  4X62 Q;  1NAP A;  4DFA A;  2RCN A;  1STE A;  3T16 A;  4NMZ A;  4FXD A;  1X65 A;  4GZY C;  1A6X A;  4OWW B;  4OO1 G;  5FLX E;  4IPD A;  3CAM A;  4A3G G;  1GUO A;  2ID0 A;  2Z9H A;  4MNO A;  2HQE A;  3S16 H;  3NTK A;  4DXG A;  3T51 B;  5CV8 A;  5GQO A;  1HZC A;  1IXR A;  1G51 A;  1HRJ A;  1M4V A;  2EPB A;  4DAY A;  1I50 H;  3GP7 A;  4I65 A;  1QE6 A;  2NBF A;  5LL6 S;  1X3P A;  1PH8 A;  3BDL A;  2ZTC A;  4DK1 A;  3Q8D A;  1VQ8 A;  1IW7 C;  1PRT D;  3CCM A;  1MKH A;  3CQZ B;  5AJ3 Q;  1SE3 A;  3S1M H;  4H0L C;  5GAG C;  1XMO L;  4K6D A;  1OXT A;  4DKA C;  3I73 A;  2JEA I;  4DXF A;  5JPM C;  1KHI A;  2PYK A;  2PQA A;  4I7A A;  5M5W B;  2JA5 B;  2D5D A;  1F2Y A;  4A3F H;  3MEF A;  1WTQ A;  3E3X A;  2G5D A;  1GUT A;  1TKW B;  3W1B A;  3RZO H;  2MQH A;  2R92 B;  5IYC H;  4WFN 3;  3NQI A;  4HCS A;  1W6J A;  1SBB B;  1VQM A;  4JI4 L;  1PRT F;  2BE5 C;  3S17 H;  2E76 C;  4A3M G;  1JOO A;  1YNJ D;  2KCT A;  1S4Z A;  5KRU A;  1PLF A;  4C3H G;  5JEA H;  4C3I B;  5EGT A;  5FO8 B;  2XVS A;  2IWH A;  4A3D H;  5C4H A;  2NVY B;  2OCE A;  2D0P A;  4AYB G;  1PDQ A;  3M4Q A;  4X64 L;  3NTH A;  4B3M Q;  2VW9 A;  3Q22 A;  2QEX A;  4HCE A;  1D5X C;  3FDT A;  3BS1 A;  1AZP A;  3HOY G;  1O7Z A;  4POF A;  4OON A;  3BG3 A;  5EKL A;  1B3A A;  2CW0 D;  5IY0 A;  1A3U A;  1C48 A;  3TBI B;  2Z6K A;  4WOR A;  3HOW H;  1BR9 A;  5KNB A;  1JT8 A;  4KJN A;  4IJH A;  2YTV A;  1EYC A;  2RHQ B;  1ICW A;  4YWM A;  4NP5 A;  2Z1C A;  4F7X A;  4OIJ A;  2A69 D;  4LK1 C;  1ENA A;  2PPB C;  3NK9 A;  1EQR A;  4JBW A;  3K0Y A;  3P1H A;  3PO3 G;  4KJO A;  4JI8 L;  1PH6 A;  3K81 C;  4FF4 A;  1IBK Q;  1RKN A;  1EQQ A;  5JAV A;  1E7Z A;  3M9B A;  3OTO Q;  1I4R A;  2UUB Q;  4HJ5 A;  4TKO B;  4C3J H;  4L5T A;  4DAY B;  3OMG A;  2DN8 A;  3A74 A;  4RGT A;  2LY7 A;  2NYZ D;  1RDP D;  3T13 A;  1XNQ L;  4LFA L;  3DM1 A;  5E1F A;  1PVO A;  1TWH B;  2DJF C;  4OO1 I;  1V1Q A;  5CBA E;  1PZI D;  2K33 A;  4DV7 L;  4IUR A;  1K73 C;  1B8A A;  2IW3 A;  4JI1 L;  3GV3 A;  1CZG A;  5CC4 A;  1LTG D;  1I4G A;  2E2J H;  2J4X A;  4ZKC B;  1E1T A;  3URY A;  2RDG A;  4JI6 Q;  4HJ9 A;  3BDC A;  2E2I H;  2JEB I;  4OGQ C;  1NMF A;  1K8G A;  1N32 L;  3J80 c;  1SAP A;  1VQK A;  5IT9 c;  1XXG A;  2EY1 A;  2JA7 B;  2K50 A;  5KND A;  1VQ6 A;  2LXJ A;  4CJ2 C;  2MPM A;  2VNU D;  1WFQ A;  1A63 A;  5FJ8 G;  2R6G A;  1CKN A;  3JAM i;  1PFM A;  4GKK L;  1JJG A;  4OXP A;  2B2W A;  4NXM L;  1VQN A;  3GTQ B;  2LXK A;  5CV6 A;  4B9W A;  1TT2 A;  1GVP A;  5T1I A;  1CHP D;  3E9I A;  3F2D A;  1EQV A;  2ICE C;  3H0G G;  2AWO A;  1YHB A;  3SK6 A;  1XNR Q;  2ZJR A;  4A3G B;  4ZUI A;  1TU2 B;  1JOR A;  5DLQ E;  3A8I E;  1HNW Q;  1NCV A;  1R4P B;  2HCC A;  4XQQ A;  1VQ4 A;  4JI0 Q;  1F9P A;  4HJ8 A;  1I3Q B;  1QCB D;  4FF3 A;  4JV5 Q;  5CV5 A;  1E2W A;  1A2U A;  1HNX Q;  1UWV A;  1E1O A;  3OIP A;  3HOU G;  4A75 A;  3QWN A;  1R4Q B;  1V43 A;  2M2L A;  1YNN C;  3H3V I;  4K0K Q;  1V1P A;  1S5B D;  2JA9 A;  3MFG A;  2UUA L;  1SYF A;  4A4I A;  1DD2 A;  4N9P A;  2RA4 A;  1V8Q A;  4ZLT F;  1UUP A;  3STB D;  4BA2 I;  1SLJ A;  2RQX A;  3J80 L;  2E2H H;  5IT9 L;  4IJL A;  1J8I A;  2A6H D;  2HCI A;  3VR4 A;  3I4N H;  1FL0 A;  1TVX A;  3PV0 A;  3CU7 A;  3CME A;  1C8C A;  1U5K A;  2L11 A;  1ZYR D;  2TMP A;  2JA6 G;  1WTW A;  5A35 A;  4GLV B;  3U9O A;  4FF1 A;  2OXP A;  4UP9 A;  2XRS D;  2JN4 A;  3F2C A;  3GTL H;  2R7Z G;  2LS0 1;  2K7V A;  1G8Z D;  2ZTD A;  4RHS A;  3H94 A;  3FP9 A;  2SNM A;  3DHQ A;  1IBM Q;  2PZT A;  2F0K A;  3V96 A;  1Q8K A;  3NEM A;  4A3M B;  4Z9C B;  4U68 A;  1EWI A;  2ICI A;  4C3H B;  3S1N H;  4KY6 A;  3BDO A;  3S9W A;  5ELD A;  3MHB A;  1E22 A;  3ERO A;  1CKM A;  4QL5 A;  2ZJQ A;  4A3E G;  4A3L G;  3M3Y B;  1YI2 A;  4AYB B;  4KY5 A;  3OW2 A;  5C0X H;  2CWA A;  2F0N A;  3TRZ A;  1VQ5 A;  1T5E A;  4DNT B;  3G6J B;  4RHR A;  5D14 A;  1EUJ A;  1D1I A;  2F0Q A;  2DJG C;  3HOY B;  4BBR G;  2Z4I A;  3AYH B;  1QVF A;  2BOS A;  4A3J H;  4PZ7 A;  2A19 A;  2SEB D;  1N34 Q;  1M1K C;  3J80 E;  5JVG 3;  1YHQ A;  3NQT A;  1D1K A;  2F52 A;  3RUZ A;  1UEB A;  5C44 B;  1XPO A;  4XYQ A;  5JJZ A;  4CDE C;  2A73 B;  1OXX K;  5DM6 3;  1B44 D;  4B3T L;  3D8G A;  3S24 A;  2FXQ A;  3PO3 B;  1ONL A;  2RDH A;  2B39 A;  3DMU A;  5I6W A;  5JJK A;  5EKK A;  1EY8 A;  4A3K G;  5I4D A;  4OEM B;  5M3F G;  4JI3 L;  1U4P A;  1XMO Q;  4A3B H;  3CHB D;  4XDX A;  2TSS A;  4MZ9 A;  1WVL A;  4LF5 L;  2EYO A;  2I46 A;  1PYS B;  5IGD A;  3KFU A;  1DOK A;  3M7N A;  3I7F A;  5GRO A;  3RLF A;  4DUZ L;  2H4O A;  2B63 H;  4Y7N H;  1Q46 A;  2JP1 A;  5IGF A;  1GUG A;  1VQG A;  4GNX B;  1EY9 A;  4RGN A;  4K14 A;  1B53 A;  3A8K E;  3SK5 A;  1DON A;  4DR7 L;  3GTO B;  3UDF A;  3K80 C;  4JI4 Q;  1KLG D;  4FXK C;  4PZ8 A;  4AQY L;  3LX0 A;  1Q1E A;  3E0E A;  5JEA J;  1WTR A;  2B2T A;  1MJC A;  1PV4 A;  5BR8 L;  2PNH A;  2Y0S G;  2LKV A;  4O0A A;  3M85 A;  3HZX A;  2O5J C;  1X55 A;  4AIM A;  4X64 Q;  2UU9 L;  2F0S A;  3WWV A;  3HOX H;  4IUU A;  2KQ3 A;  2A1A A;  1LT5 D;  5HY6 A;  5FK9 C;  1KQS A;  4DAP A;  5ELE A;  4DR5 L;  5FO7 B;  1Y14 B;  3A55 A;  2CQA A;  2IL8 A;  2EVB A;  2VUM G;  3HFZ B;  2PW7 A;  2QDL A;  3N6R A;  1SNC A;  3FVQ A;  3SR1 A;  1WYD A;  3G6E A;  2F0D A;  3NUC A;  1TWF H;  4IQZ A;  1QG7 A;  3H0G B;  4AH6 A;  2SOB A;  5IYB G;  1FJG L;  2CHB D;  4KTA A;  5LMN L;  1IKM A;  2NN6 G;  4DK0 A;  4B3S Q;  1XPR A;  4B3R L;  2AQ3 B;  1EOV A;  3D4R A;  2CQO A;  2JJQ A;  4RGO S;  1JQY D;  1BOS A;  3DUZ A;  2IY5 B;  5HGQ A;  3K7U C;  3J81 j;  2Z4H A;  5C5M A;  1AP0 A;  4GLA C;  3PUX A;  4X65 L;  2VB3 X;  3HOU B;  2HD3 A;  1LTT D;  3FKI H;  1XNQ Q;  3HKZ G;  4YY3 L;  1FGB D;  3J81 c;  2OTJ A;  3CCE A;  3FPP A;  3M4O H;  1VQO A;  1HXY D;  1SJH D;  2VZA A;  2Q8T A;  2NVQ B;  4BY1 H;  3KUP A;  2OEO A;  1UE5 A;  2JE6 I;  1JMC A;  4PMB A;  2ZXP A;  3T1Y Q;  3PGZ A;  5M5Y H;  3I4O A;  2A6E C;  1EYA A;  5GAH C;  2QKI C;  1AZQ A;  1L1O B;  4XYO A;  1RJT A;  5AFW A;  3WOF A;  4ZKB B;  5NUC A;  4GOP A;  2HIX A;  2UXD L;  4F88 A;  1N32 Q;  1MHW C;  2D9U A;  5IYD H;  1GHK A;  2AWN A;  2K5N A;  2R7Z B;  1VQC A;  3IAY A;  5J22 A;  3UDI A;  1X56 A;  1KLU D;  2FJ2 A;  2I07 B;  4GKK Q;  3PIO 3;  3EN2 A;  5KNC A;  4NXM Q;  1VQE A;  1FD7 D;  4BBS B;  4QF4 A;  1ENC A;  5FO9 B;  4A3E B;  4QUF A;  2GVB A;  4FDB A;  1TII D;  3TZD A;  3N52 A;  2B8F A;  3B6Y A;  3EBE A;  4HIK A;  1DM0 B;  1WJJ A;  3CPW A;  1STY A;  2MO1 A;  4BBR B;  3FPU B;  3D3R A;  4QGU A;  1STB A;  2KVM A;  4KHZ A;  3BJU A;  3J81 L;  1JB7 A;  4LUV A;  4DAM A;  4DR2 L;  1MI2 A;  1V1O A;  5M9O A;  4DUY L;  2PZW A;  1MGS A;  3PQI A;  1SMY D;  2QF7 A;  3K58 A;  3CCQ A;  3CXC A;  1QWY A;  4KN7 C;  3KJP A;  2JK8 A;  2XRQ D;  3GTK H;  3K6O A;  1TQO A;  4IPH A;  3F2B A;  2ZT9 C;  1BCP B;  3ND8 A;  3PUY A;  2XGT A;  4IO9 A;  4DNI A;  3CC4 A;  4PMC A;  2PW5 A;  4UY8 C;  1NMG A;  4ZRZ A;  4A3K B;  1JIC A;  3H09 A;  4XT1 B;  5M3F B;  2Z6K C;  5JVH 3;  4UDU C;  4IPG A;  3TP5 A;  4DR1 L;  5G3L D;  3S2H B;  3VYT A;  4U67 3;  2F0V A;  4KHV A;  2A68 C;  2K5H A;  1PTO B;  4A3F G;  1TY0 A;  5IGG A;  1EY6 A;  1CFM A;  1Q1B A;  1M90 C;  5IYC G;  2EJM A;  3S2D B;  3A7L A;  2L0C A;  5C4J H;  4X3S A;  4RFB A;  3WDN A;  1RIP A;  3J81 E;  2HT1 A;  3CQZ H;  1TS4 A;  1CZW A;  3HG9 A;  1DJR D;  4H7B A;  3D6W A;  1BKB A;  5JEA G;  2Y0S B;  2BH8 A;  5K36 G;  5C0X J;  1FNU A;  2F3V A;  2K4K A;  3M4P A;  2F0M A;  3A7A B;  4TVA B;  1CSQ A;  3QR8 A;  1HZA A;  5M5W H;  2JA5 H;  1VQL A;  4IUQ A;  4UP8 A;  3U4V A;  3U9S A;  3SGI A;  4ZYS A;  1AE3 A;  1F2Z A;  1EU3 A;  1VF5 C;  1PH2 A;  4HR7 B;  2F3I A;  2D0O A;  5KIX A;  4DV6 L;  2JA8 H;  4OX9 L;  2VUM B;  1L0Y B;  3PCO B;  1SFO B;  3HOW G;  1WI5 A;  1D5Z C;  3I4M H;  1J5E L;  2FHT A;  2OWO A;  2PCF B;  2ENB A;  2KJX A;  5C3X A;  4B3T Q;  3OMC A;  1SNP A;  3AFQ A;  4POG A;  1Y8O B;  5LHY 1;  2CH4 A;  2NVY H;  1B1Z A;  1F2M A;  1UNS A;  1TR5 A;  1PRT C;  3DEP A;  1D6E C;  2B2W C;  1H95 A;  3CCV A;  1N36 L;  4JI3 Q;  2E75 C;  1F9R A;  3ZJY C;  3BVM A;  4LF5 Q;  3LWE A;  1MD2 D;  2F0H A;  4XIG S;  1E0B A;  1I6H B;  3A54 A;  1YJN A;  4QY7 A;  3HKZ B;  1JWS D;  1YJ9 A;  4P71 A;  1EU4 A;  4DUZ Q;  1Z6H A;  3HOZ H;  1ENF A;  1H9J A;  4QMG A;  4IOC A;  2HDM A;  4UHV A;  5J3B A;  3MTS A;  2YV5 A;  3HP3 A;  4H02 A;  4AQY Q;  3KBX A;  1B9M A;  2BH2 A;  1R9T H;  4DU9 A;  4LFC L;  1BO0 A;  1BVS A;  5BR8 Q;  1W6K A;  1YNJ C;  3C1E A;  5LMU L;  3ITP A;  1VQI A;  1DOL A;  4R9W A;  1KDB A;  2UU9 Q;  3NHH A;  2C5C A;  2NZH A;  1HR0 L;  4GNX C;  3K5M A;  2F0F A;  1TWG H;  1NBW A;  4V0B A;  4DR5 Q;  1BBX C;  1TWH H;  3A0J A;  3NBH B;  1B4O A;  3NP8 A;  2VB2 X;  1VQH A;  4APV A;  2CW0 C;  2F0G A;  1XTD A;  2K5V A;  1QUQ B;  3CP0 A;  3R3O A;  3RN2 A;  1L2F A;  4B9X A;  5ELC A;  5J39 A;  1HUM A;  5IP9 H;  1ET9 A;  1FJG Q;  3FHW A;  5LMN Q;  1PH1 A;  2AUJ D;  1B3Q A;  1DCZ A;  4HJA A;  1MBY A;  1SDF A;  1H9K A;  2Q2T A;  4B3R Q;  1Y1W H;  2DGY A;  2AMC B;  3PUV A;  2ZM6 L;  3CMA A;  3S16 B;  5E4X A;  1JCK B;  2IJ0 A;  2K5D A;  3E9H A;  4R4I A;  2RDF A;  4A76 A;  5C44 G;  1LLR D;  2F1M A;  4LF9 L;  3VA7 A;  4X66 L;  4X65 Q;  4L63 B;  3RNU A;  2K32 A;  1I50 B;  1VQ7 A;  2ZTE A;  4J1M A;  4P2C B;  2Z6B A;  3NPP A;  4YY3 Q;  1IL8 A;  3GTQ H;  1RL2 A;  2K75 A;  1N8R C;  1TS2 A;  3IFD A;  4MIU A;  4Y52 H;  4OO1 H;  1CTM A;  2ZXO A;  5C4X H;  1PH4 A;  1EZ8 A;  3UDG A;  4FVM A;  2R61 A;  1B50 A;  1SEB D;  1LO5 D;  4A3G H;  1WD0 A;  1JJC B;  3ERQ A;  3MA2 B;  1SYC A;  2ZJP A;  4EVO A;  2F0I A;  2OTL A;  3AFP A;  1LM0 A;  5IP7 H;  5COR A;  3L9A X;  2IX3 A;  1VQP A;  2FMM A;  4TQU S;  1A8V A;  4A3F B;  1I3Q H;  2UXD Q;  3ULJ A;  1SR3 A;  1HFG A;  3RZO B;  1N33 L;  4XQN A;  1LTS D;  2Q8I B;  2VY3 A;  4IPC A;  4P72 A;  1SN8 A;  3I56 A;  3BYY B;  3S1Q H;  4K2L A;  5I2X A;  3S14 H;  1J9O A;  4YHH L;  3S17 B;  4BA1 I;  4NW2 A;  3MEH A;  3L2P A;  2EJG C;  2ATW A;  4FXG C;  1Q81 C;  2JQO A;  3ND9 A;  1EFW A;  2NWG A;  3RLN A;  4HJ7 A;  3F1Z A;  1FR3 A;  1SNQ A;  1STH A;  1EIF A;  3W5O A;  1S5F D;  4C2M B;  1U0L A;  1PYW D;  3HRZ C;  4WRD A;  1I5F A;  1AEX A;  3DM3 A;  1TXY A;  1SYE A;  1KL9 A;  2B2T C;  4RKL A;  4BXX G;  4DR2 Q;  3J7Y W;  3UE0 A;  3HOW B;  1NE3 A;  2F0L A;  5J1Z A;  1OO9 B;  4YCW A;  4DUY Q;  3I8Z A;  5DEH A;  4LF4 L;  4A3M H;  3KDF B;  4C1N K;  1FNW A;  2P5Z X;  5FKA C;  4LF6 L;  2CVR A;  3F2U A;  1GOZ A;  1JR0 D;  3I91 A;  4LF8 L;  3M3Y H;  3R8B A;  3BVZ A;  5GAD C;  3VYU A;  3DWQ A;  2M9V A;  3I2Z A;  4A3B G;  3STB C;  1NUC A;  4DV3 L;  1MSG A;  2EYH A;  1VF7 A;  2K04 A;  3P75 A;  2SDF A;  4DR1 Q;  1KD1 C;  2A6H C;  3C2P A;  1Y1V H;  5IIF A;  1KDC A;  2F0J A;  3E6Z X;  5D3D A;  1ZYR C;  3PMF A;  2X6G A;  4O1N A;  4GNX A;  1PH5 A;  1EIH A;  3UI2 A;  1IHZ A;  2WB1 E;  1Z9F A;  4ODG A;  3ONA B;  1TWC B;  1BCP D;  1G29 1;  3OIQ A;  3K7A H;  4JOI A;  4ALP A;  2UXB L;  2J0T D;  4MTK A;  3V2T A;  3I4L A;  1Q90 A;  4S3S A;  3U58 A;  2E2I B;  2EY2 A;  3V05 A;  1NR2 A;  1RHP A;  4P75 A;  5FLM H;  4O42 A;  2NVX H;  4GS3 A;  2EY6 A;  4HID A;  4DR4 L;  1WCM H;  2DNE A;  1PTO D;  1NSN S;  4ME5 A;  1ML0 D;  4CKB A;  1K8M A;  1BF4 A;  3D6C A;  2C9O A;  1O7I A;  2WKD A;  2EDG A;  5EKI A;  1YNX A;  3I3C A;  4MHE A;  1FYC A;  4DV6 Q;  4BBS G;  4OX9 Q;  1GHJ A;  2I5M X;  4GOP C;  1J5E Q;  1I4X A;  2O5I C;  1IYJ B;  3ERS X;  1PH7 A;  3EVQ A;  3H6M A;  1G6Z A;  3EIV A;  4K8J A;  2DUD A;  2K5Q A;  1IBL L;  3Q24 A;  1V9P A;  4KKU A;  2IHE A;  1D8L A;  1K9M C;  2FMC A;  5IT9 E;  3MFY A;  3A5U A;  3EFX D;  4F87 A;  1N36 Q; 
#chains in the Genus database with same CATH homology
 1QNK A;  1I6V C;  4UAI A;  4X3U A;  2NVT B;  3PIP 3;  1PTO F;  3NWS A;  2V4D A;  4HAE A;  1EFI D;  1MSH A;  4TRD A;  2E2D C;  5C0X I;  3IKJ A;  2H1E A;  3FEW X;  2E2H B;  2K05 A;  1M8A A;  1ESF A;  3QOL A;  4BWG B;  3T53 B;  1E2V A;  4JK1 C;  2LFN A;  3TME A;  4LMQ D;  1XTC D;  4Q5V A;  1CK1 A;  3KLS X;  3OWE B;  4R8I A;  5EPK A;  3OOC A;  4IUN A;  5HGT A;  2JSO A;  3MXU A;  4V19 0;  2M00 A;  3NSW A;  1EY5 A;  5F2D A;  2SNS A;  3GQB A;  4OL7 A;  4XTC S;  1TY2 A;  1S5E D;  4EGV A;  3VR5 A;  5KYI A;  5KEE A;  1G91 A;  1LV9 A;  1Q8I A;  4G7Z C;  5JPN C;  3W2D A;  1UEA B;  2N88 A;  4G7H C;  1KTK A;  2BDO A;  1QB5 D;  1F77 A;  2K1B A;  1HFN A;  4J6H A;  1ET6 A;  1HPC A;  3PUZ A;  5T1G A;  4RGM A;  2VXW A;  5I9P A;  4YIJ A;  5I2Y A;  1ZEQ X;  4DAV A;  1IKL A;  1XWE A;  2GA4 B;  4A3B B;  3T56 B;  2EXZ A;  3NWT A;  2B8G A;  1QJO A;  3ZYY X;  1Y8P B;  1G2S A;  4F8M A;  2EY5 A;  4HED A;  4IUV A;  1D5M C;  2WV6 D;  5M5X B;  1E2Z A;  1H9M A;  4FO2 A;  2WII B;  4DNR B;  4K5V A;  2QCP X;  3C3L A;  1CT1 D;  3SVM A;  3VR6 A;  2EYP A;  4LJZ C;  2PQE A;  1JB3 A;  1LTB D;  3VR2 A;  3EA6 A;  4QCL A;  2A5H A;  4IN3 A;  4IFD H;  2HUG A;  2XWJ B;  4ZUJ A;  1HTP A;  4KI0 A;  3JAM L;  4IZ8 A;  1II3 A;  1SXT A;  4BS9 A;  4FNF A;  1I4H A;  3LNN A;  2NTT A;  3H91 A;  5FOB B;  1F9Q A;  3QB3 A;  1B9N A;  2L9H A;  1EWC A;  3HEJ A;  1TWF B;  2X69 A;  1SMY C;  5C5L A;  1VMP A;  1D2B A;  3TZU A;  3I70 A;  1DOM A;  1EEI D;  2AQ2 B;  2BDN A;  2ZXR A;  3K5L A;  3GTP B;  2B2V A;  2E74 C;  3IFT A;  3FMC A;  3VR3 A;  2EJF C;  2F0T A;  2N55 A;  4RH6 A;  5CMD A;  1SND A;  3AMU A;  3TP8 A;  2DNC A;  2G9D A;  3M4O B;  4RAU C;  3TP6 A;  2AUK A;  2XIW A;  3WOE A;  3P20 A;  2NN6 H;  4FP5 D;  1XYI A;  3PUW A;  1IYU A;  1A2T A;  5M5Y B;  2EYM A;  2F0W A;  2K5W A;  4OIK A;  5CBE E;  5COY A;  3FRP B;  1EOT A;  2EYF A;  3RD4 A;  3M7G A;  5EJW A;  3X3N A;  1HTL D;  1ILQ A;  5FLX L;  3NBH A;  4K5W A;  4CKE A;  4RA8 A;  5KYL A;  4CKC A;  4LAA A;  3SK8 A;  2F3W A;  5C3E B;  1SJE D;  5G3L F;  1CA6 A;  4IUT A;  4MN3 A;  1STA A;  5DM7 3;  3GTM B;  2K03 A;  4PNY A;  4KD4 A;  1SNM A;  1Y8N B;  3H3V C;  1SNO A;  1S5D D;  3T4A C;  1OXV A;  5IOC A;  1CQF A;  4K2K A;  2XWB B;  1EY0 A;  4NDX A;  4IAL A;  4QB4 A;  5EPJ A;  5IGB A;  4HMJ A;  5C3W A;  2IX1 A;  1WTP A;  4HSV A;  2O2L D;  1JOK A;  2B2U A;  1EZ6 A;  2WAQ B;  3C1F A;  1EEF D;  5EBC A;  4KN4 C;  5ELF A;  3NBI A;  4C3J G;  2MGS A;  1VMC A;  3CRK C;  3VYR A;  3R93 A;  1HHV A;  1KAA A;  4ILW A;  2BA1 A;  1K8O A;  3NTI A;  2B2Y A;  4IUP A;  3K57 A;  3K59 A;  2JYO A;  2EZV A;  3GTJ B;  5C4J B;  5I9O A;  3MC0 B;  1CQV A;  3AU7 A;  2F4I A;  3NXW A;  2EOT A;  3A56 A;  4PQX A;  4KKT A;  3D4W A;  3OW7 A;  1C4Q A;  1EYD A;  1IW7 D;  1SSO A;  1JWU D;  4PMW A;  5IOD A;  3OPO A;  3LWU A;  1TWA B;  3SE0 A;  5M3M B;  3OSO A;  2OT2 A;  2F0O A;  2JA8 B;  5CYU A;  3KLR A;  4RKB A;  3I4M B;  1PZK D;  2A69 C;  2EYJ A;  5K36 H;  1OXU A;  4DA2 A;  2BE5 D;  1BXT A;  1L0X B;  4B08 A;  2RKS A;  2PNR C;  1EY4 A;  1LAC A;  4M8A A;  2NZ1 D;  1PZJ D;  3BZD B;  2MUY A;  2XN9 C;  5DNF A;  3Q0A A;  3HOZ B;  2K6A A;  3S1M B;  1BDO A;  1WD1 A;  1WTX A;  2NTS A;  1HCZ A;  1TS3 A;  1R9T B;  2RSN A;  1KNA A;  2RSO A;  1WTV A;  3MWY W;  2EE1 A;  1JE4 A;  5BN5 A;  4FF2 A;  4IFD J;  1TWG B;  4NKL A;  4R8N A;  4Q0F A;  1EIG A;  3HGB A;  1GUW A;  3EQL C;  4A3D B;  2EYL A;  1CA5 A;  4ZAI A;  4HSP A;  4RCO A;  3A8J E;  5C0X G;  1VDZ A;  1DXM A;  3SXH A;  1HQM C;  2AQ1 B;  1NR4 A;  4FYD A;  4G57 A;  2F0E A;  1XX8 A;  1Y1W B;  2XNA C;  2QIL A;  4KV6 A;  1PFN A;  5CV9 A;  1X3Q A;  2D62 A;  1CI3 M;  2JXM B;  1PMR A;  4XXE A;  3K5O A;  1EQT A;  1LT6 D;  1U9R A;  3IL8 A;  4X3K A;  1AN8 A;  3MAQ A;  2MP1 A;  5C4X B;  2KHS A;  4C3J B;  2L1B A;  1EL0 A;  4L6T B;  1GJX A;  2F0P A;  1HA5 A;  1BCP C;  3R2I A;  5IGC A;  2WAC A;  5ISR A;  3DWP A;  3QO2 A;  1LAB A;  3OHX C;  2KEE A;  1SYB A;  3MXG A;  5E3F A;  4HMI A;  2KUM A;  4KD3 A;  3S1Q B;  3S14 B;  3D31 A;  4DF7 A;  2E2J B;  4TSS A;  5D3I B;  1PTO C;  4X3T A;  4KY7 A;  5BN4 A;  1PFB A;  4I7Z C;  1YNN D;  5C4Z A;  4L8J A;  4ZQ3 A;  1A3T A;  1DYQ A;  1IYV A;  3MXP A;  2DY7 A;  3QG1 A;  2PZU A;  1BCP F;  1RF2 D;  2K01 A;  4KK7 A;  1Y69 U;  1Q12 A;  1S5C D;  3TN2 A;  3I90 A;  3TSS A;  5EQ0 A;  1A15 A;  5CV7 A;  3EJI A;  3M4Y A;  3QIA A;  1FNV A;  3HS0 C;  3D4D A;  4H44 C;  1CM9 A;  1DZ1 A;  1H9S A;  2WB1 B;  2KCC A;  5CGK A;  1LT4 D;  2WKC A;  3GD7 A;  2NUC A;  4WJW A;  1LTR D;  4HN7 A;  1Z7T A;  1Y1V B;  2HDL A;  1KDA A;  1PRT B;  3I72 A;  2KCN A;  4HTH A;  4K8I A;  2RVL A;  3Q6S A;  2G9H D;  1U4R A;  2B2V C;  3QJY A;  3I4N B;  1BUV T;  3NE5 B;  3K7A B;  5EPL A;  5KGU A;  3OWF A;  4OHJ A;  3TDQ A;  2BCO A;  5CR3 A;  3GTL B;  3C46 A;  2F03 A;  3O13 A;  2L4N A;  4DN4 M;  2Q8R E;  2J7Z A;  3SEB A;  2NVX B;  3SK4 A;  1WCM B;  2DY8 A;  1V1P B;  4IFD G;  5BN3 A;  1EY7 A;  1SE4 A;  3S1N B;  1B2T A;  5C6A A;  1H9R A;  2R3Z A;  1ZKO A;  3DXJ C;  2KA7 A;  4CBV A;  4XT3 B;  1RD9 D;  3TP7 A;  3L7Z C;  4RWS C;  3RMH A;  2PMZ B;  4RCN A;  1AW7 A;  1O78 A;  4CHT B;  3GV6 A;  4A3J B;  2F0U A;  3VYS A;  1RCV D;  1O80 A;  1OXS C;  1JC7 A;  2L55 A;  5LL6 X;  2Z8L A;  3S15 B;  2L12 A;  3MVV A;  5A2Q L;  1WTO A;  4C56 C;  1RTN A;  2KEC A;  3MZ5 A;  4KMU C;  1GUN A;  3PO2 B;  2YYZ A;  3X3M A;  4PV1 C;  5IGE A;  3MXN A;  4CJ1 B;  3P7J A;  1H9S B;  1STG A;  4K6L A;  4KKS A;  3KF8 A;  2LMC B;  5K5P A;  2IX0 A;  1CHQ D;  3RZD B;  5CV4 A;  2IT1 A;  3BVG A;  2B63 B;  4Y7N B;  1UAP A;  2FIN B;  1PXU A;  2QEJ C;  2B2U C;  3CKI B;  3R2T A;  2QDB A;  4K5X A;  3HOV B;  2KED A;  4G4K A;  4ABN A;  2IPK D;  2FFK B;  5I6Y A;  4EQN A;  5ELB A;  1F2L A;  1JOQ A;  3HOX B;  1SYG A;  1SYD A;  1STN A;  2B2Y C;  2BA0 A;  1KAB A;  2NB0 A;  5TSS A;  1PTO H;  3VA5 A;  5A2Q E;  1ROD A;  4EQO A;  2JA6 B;  1HA6 A;  2K28 A;  1SE2 A;  2A74 C;  5E4W C;  2D2C C;  1ILP A;  3L3O C;  5HUR A;  3DWA A;  1U4M A;  2A6E D;  2YU9 B;  4EQP A;  4C3I G;  4E6I A;  5JOB A;  1LTA D;  4G7O C;  4QUC A;  1TS5 A;  2RBM A;  1G2T A;  2X6L A;  5D65 A;  4XQJ A;  2PO4 A;  1X32 A;  1QOH A;  3Q23 A;  4IFD I;  3S1R B;  2WP8 J;  1Z47 A;  1GXD C;  1EWH A;  3FKI B;  3K5N A;  1O7Y A;  3BYT B;  4J8Q A;  4C1N I;  1VCI A;  3J7A V;  1HUN A;  4BY1 B;  1QIL A;  4QIW B;  1BQQ T;  3G7L A;  4BY7 B;  2KOL A;  4CJ0 B;  1BNZ A;  3JAM E;  3KLS A;  3KBG A;  2XSC A;  4A93 B;  1T5X D;  1O7L A;  1U4L A;  3DEO A;  3KK7 A;  2OF1 A;  1QNU A;  4H13 C;  3GO5 A;  2L5T A;  3GTG B;  1A3V A;  2WIN B;  1I4Q A;  1F9S A;  2MHV A;  3W3A A;  5EBD A;  3E0J A;  3SDZ A;  2MJ8 A;  4A3I B;  3QOJ A;  2NN6 I;  4M1U B;  4N9T A;  4ID6 A;  2A68 D;  4ULL A;  1ESR A;  1JWM D;  1Q3L A;  3AB9 A;  4CGY B;  1LT3 D;  4DGZ A;  1I4P A;  1RTO A;  3J7A F;  1GUS A;  5DAU A;  1AFP A;  3E5S A;  1ZXT A;  2O4X A;  1HQR D;  1LTI D;  1KNE A;  4ZK9 B;  3SHL A;  1K83 B;  3CRL C;  3GTK B;  2R93 B;  1NAP A;  4DFA A;  1STE A;  3T16 A;  4NMZ A;  4FXD A;  4GZY C;  1A6X A;  4OO1 G;  5FLX E;  1GUO A;  2ID0 A;  2HQE A;  3NTK A;  4DXG A;  3T51 B;  5CV8 A;  1HRJ A;  1M4V A;  2EPB A;  4DAY A;  3GP7 A;  4I65 A;  1QE6 A;  2NBF A;  5LL6 S;  1X3P A;  3BDL A;  4DK1 A;  1IW7 C;  1PRT D;  3CQZ B;  1SE3 A;  4H0L C;  4K6D A;  1OXT A;  2JEA I;  3I73 A;  4DXF A;  5JPM C;  2PYK A;  5M5W B;  2JA5 B;  2D5D A;  1F2Y A;  1WTQ A;  1GUT A;  1TKW B;  2R92 B;  4WFN 3;  3NQI A;  4HCS A;  1W6J A;  1SBB B;  1PRT F;  2BE5 C;  2E76 C;  1JOO A;  1YNJ D;  1S4Z A;  5KRU A;  1PLF A;  4C3H G;  5JEA H;  4C3I B;  5EGT A;  5FO8 B;  2XVS A;  2IWH A;  5C4H A;  2NVY B;  1PDQ A;  3NTH A;  3Q22 A;  4HCE A;  1D5X C;  3FDT A;  3BS1 A;  1AZP A;  1O7Z A;  3BG3 A;  5EKL A;  1B3A A;  2CW0 D;  1A3U A;  1C48 A;  3TBI B;  4WOR A;  1BR9 A;  5KNB A;  4KJN A;  1EYC A;  1ICW A;  4NP5 A;  2Z1C A;  4F7X A;  4OIJ A;  2A69 D;  4LK1 C;  1ENA A;  2PPB C;  3NK9 A;  4JBW A;  3K0Y A;  3P1H A;  4KJO A;  4FF4 A;  1RKN A;  5JAV A;  1I4R A;  4TKO B;  3OMG A;  2DN8 A;  4RGT A;  2LY7 A;  2NYZ D;  1RDP D;  3T13 A;  3DM1 A;  5E1F A;  1TWH B;  4OO1 I;  5CBA E;  1PZI D;  2K33 A;  4IUR A;  2IW3 A;  3GV3 A;  1CZG A;  5CC4 A;  1LTG D;  1I4G A;  2J4X A;  4ZKC B;  3URY A;  2RDG A;  3BDC A;  2JEB I;  4OGQ C;  1SAP A;  2JA7 B;  1XXG A;  2EY1 A;  5KND A;  4CJ2 C;  2MPM A;  2VNU D;  2R6G A;  1PFM A;  2B2W A;  3GTQ B;  5CV6 A;  4B9W A;  1TT2 A;  5T1I A;  1CHP D;  1EQV A;  2ICE C;  2AWO A;  3SK6 A;  4A3G B;  4ZUI A;  1TU2 B;  1JOR A;  3A8I E;  1NCV A;  1R4P B;  2HCC A;  4XQQ A;  1F9P A;  1I3Q B;  1QCB D;  4FF3 A;  5CV5 A;  1E2W A;  1A2U A;  3OIP A;  3QWN A;  1R4Q B;  1V43 A;  2M2L A;  1YNN C;  1V1P A;  1S5B D;  3MFG A;  1SYF A;  1DD2 A;  4N9P A;  2RA4 A;  1V8Q A;  4ZLT F;  1UUP A;  4BA2 I;  2RQX A;  3J80 L;  5IT9 L;  1J8I A;  2A6H D;  2HCI A;  3VR4 A;  1TVX A;  3PV0 A;  3CU7 A;  1C8C A;  2L11 A;  1ZYR D;  2TMP A;  1WTW A;  5A35 A;  3U9O A;  4FF1 A;  2OXP A;  2XRS D;  2LS0 1;  2K7V A;  1G8Z D;  4RHS A;  3H94 A;  2SNM A;  3DHQ A;  2PZT A;  2F0K A;  3V96 A;  4A3M B;  4Z9C B;  4U68 A;  2ICI A;  4C3H B;  4KY6 A;  3BDO A;  3S9W A;  5ELD A;  3MHB A;  3M3Y B;  3ERO A;  4AYB B;  4KY5 A;  5C0X H;  2F0N A;  1T5E A;  4DNT B;  3G6J B;  4RHR A;  5D14 A;  1D1I A;  2F0Q A;  3HOY B;  2Z4I A;  2BOS A;  2SEB D;  3J80 E;  5JVG 3;  3NQT A;  1D1K A;  3RUZ A;  5C44 B;  4XYQ A;  5JJZ A;  2A73 B;  1OXX K;  5DM6 3;  1B44 D;  3D8G A;  3PO3 B;  1ONL A;  2RDH A;  2B39 A;  3DMU A;  5I6W A;  5EKK A;  1EY8 A;  5I4D A;  1U4P A;  3CHB D;  4XDX A;  2TSS A;  1WVL A;  2EYO A;  2I46 A;  5IGD A;  1DOK A;  3M7N A;  3RLF A;  2H4O A;  5IGF A;  2JP1 A;  1GUG A;  1EY9 A;  4RGN A;  4K14 A;  1B53 A;  3A8K E;  3SK5 A;  1DON A;  3GTO B;  1KLG D;  4FXK C;  3LX0 A;  1Q1E A;  5JEA J;  1WTR A;  2B2T A;  2LKV A;  3M85 A;  3HZX A;  2O5J C;  2F0S A;  4IUU A;  2KQ3 A;  1LT5 D;  5FK9 C;  4DAP A;  5ELE A;  5FO7 B;  3A55 A;  2CQA A;  2IL8 A;  2EVB A;  2PW7 A;  3N6R A;  1SNC A;  3FVQ A;  3SR1 A;  2F0D A;  3NUC A;  4IQZ A;  1QG7 A;  3H0G B;  2SOB A;  2CHB D;  4KTA A;  1IKM A;  2NN6 G;  4DK0 A;  2AQ3 B;  3D4R A;  4RGO S;  1JQY D;  1BOS A;  3DUZ A;  2Z4H A;  5C5M A;  1AP0 A;  3PUX A;  2VB3 X;  3HOU B;  1LTT D;  1FGB D;  3FPP A;  1HXY D;  1SJH D;  2Q8T A;  2NVQ B;  3KUP A;  2OEO A;  2JE6 I;  4PMB A;  2ZXP A;  2A6E C;  1EYA A;  2QKI C;  1AZQ A;  3WOF A;  4XYO A;  1RJT A;  5AFW A;  4ZKB B;  5NUC A;  4F88 A;  2D9U A;  1GHK A;  2AWN A;  2R7Z B;  3IAY A;  5J22 A;  1KLU D;  2FJ2 A;  2I07 B;  3PIO 3;  5KNC A;  1FD7 D;  4BBS B;  4QF4 A;  1ENC A;  5FO9 B;  4A3E B;  4QUF A;  1TII D;  3TZD A;  3N52 A;  2B8F A;  1DM0 B;  1STY A;  4BBR B;  3FPU B;  3D3R A;  1STB A;  2KVM A;  4KHZ A;  3J81 L;  1MI2 A;  1V1O A;  5M9O A;  2PZW A;  1MGS A;  1SMY D;  2QF7 A;  3K58 A;  1QWY A;  4KN7 C;  2XRQ D;  3K6O A;  1TQO A;  2ZT9 C;  1BCP B;  3ND8 A;  3PUY A;  4PMC A;  2PW5 A;  4ZRZ A;  4A3K B;  1JIC A;  3H09 A;  4XT1 B;  5M3F B;  5JVH 3;  4UDU C;  3TP5 A;  5G3L D;  3S2H B;  3VYT A;  4U67 3;  2F0V A;  4KHV A;  2A68 C;  1PTO B;  1TY0 A;  5IGG A;  1EY6 A;  1CFM A;  1Q1B A;  2EJM A;  3S2D B;  3A7L A;  2L0C A;  4X3S A;  4RFB A;  3WDN A;  3J81 E;  1TS4 A;  1CZW A;  3HG9 A;  1DJR D;  4H7B A;  3D6W A;  5JEA G;  2Y0S B;  5K36 G;  5C0X J;  1FNU A;  2F3V A;  2F0M A;  3A7A B;  4IUQ A;  3U9S A;  4ZYS A;  1F2Z A;  1EU3 A;  1VF5 C;  4HR7 B;  5KIX A;  2VUM B;  1L0Y B;  1SFO B;  1D5Z C;  2FHT A;  2PCF B;  2ENB A;  2KJX A;  5C3X A;  3OMC A;  1SNP A;  1Y8O B;  5LHY 1;  1B1Z A;  1F2M A;  1UNS A;  1TR5 A;  1PRT C;  3DEP A;  1D6E C;  2B2W C;  2E75 C;  1F9R A;  3BVM A;  3LWE A;  1MD2 D;  2F0H A;  4XIG S;  1E0B A;  1I6H B;  3A54 A;  3HKZ B;  1JWS D;  1EU4 A;  1Z6H A;  1ENF A;  1H9J A;  4QMG A;  2HDM A;  3MTS A;  3HP3 A;  3KBX A;  1B9M A;  4DU9 A;  1BO0 A;  1W6K A;  1YNJ C;  3C1E A;  3ITP A;  1DOL A;  4R9W A;  1KDB A;  3NHH A;  2C5C A;  3K5M A;  2F0F A;  4V0B A;  1BBX C;  1B4O A;  3NP8 A;  2VB2 X;  2CW0 C;  2F0G A;  3R3O A;  4B9X A;  5ELC A;  5J39 A;  1HUM A;  1ET9 A;  2AUJ D;  1DCZ A;  1MBY A;  1SDF A;  1H9K A;  3PUV A;  3S16 B;  5E4X A;  1JCK B;  2IJ0 A;  2K5D A;  2RDF A;  1LLR D;  2F1M A;  3VA7 A;  4L63 B;  2K32 A;  1I50 B;  4J1M A;  4P2C B;  3NPP A;  1IL8 A;  1TS2 A;  3IFD A;  4MIU A;  4OO1 H;  1CTM A;  2ZXO A;  1EZ8 A;  4FVM A;  2R61 A;  1B50 A;  1SEB D;  1LO5 D;  1WD0 A;  3ERQ A;  3MA2 B;  1SYC A;  4EVO A;  2F0I A;  5COR A;  3L9A X;  2IX3 A;  2FMM A;  4TQU S;  4A3F B;  1HFG A;  3RZO B;  4XQN A;  1LTS D;  2Q8I B;  3BYY B;  4K2L A;  5I2X A;  1J9O A;  3S17 B;  4BA1 I;  4NW2 A;  3MEH A;  2EJG C;  4FXG C;  3ND9 A;  2NWG A;  1FR3 A;  1SNQ A;  1STH A;  1S5F D;  4C2M B;  1PYW D;  3HRZ C;  4WRD A;  1AEX A;  1SYE A;  2B2T C;  4RKL A;  3J7Y W;  3HOW B;  2F0L A;  5J1Z A;  1OO9 B;  3I8Z A;  5DEH A;  4C1N K;  1FNW A;  5FKA C;  2CVR A;  3F2U A;  1GOZ A;  1JR0 D;  3I91 A;  3R8B A;  3BVZ A;  3VYU A;  3DWQ A;  2M9V A;  1NUC A;  1MSG A;  2EYH A;  1VF7 A;  2K04 A;  3P75 A;  2SDF A;  2A6H C;  3C2P A;  5IIF A;  1KDC A;  2F0J A;  3E6Z X;  5D3D A;  1ZYR C;  3PMF A;  2X6G A;  4O1N A;  1EIH A;  3UI2 A;  1IHZ A;  4ODG A;  3ONA B;  1TWC B;  1BCP D;  1G29 1;  3OIQ A;  2J0T D;  3V2T A;  3I4L A;  1Q90 A;  4S3S A;  2E2I B;  2EY2 A;  3V05 A;  1NR2 A;  1RHP A;  4O42 A;  2EY6 A;  2DNE A;  1PTO D;  1NSN S;  4ME5 A;  1ML0 D;  4CKB A;  1K8M A;  1BF4 A;  3D6C A;  2C9O A;  2WKD A;  2EDG A;  5EKI A;  3I3C A;  4MHE A;  1FYC A;  1GHJ A;  1I4X A;  2O5I C;  3EVQ A;  3H6M A;  1G6Z A;  4K8J A;  2K5Q A;  3Q24 A;  4KKU A;  2FMC A;  5IT9 E;  3MFY A;  3EFX D;  4F87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...