4XQNA

Crystal structure of agra lyttr domain in complex with promoters
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna/dna binding protein
molecule keywords DNA (5'-D(*AP*CP*AP*GP*TP*TP*AP*AP*GP*AP*AP*T)-3')
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
total genus 28
structure length 97
sequence length 97
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xqnA00
4XQJA 4G4KA 4XQNA 4CBVA 4XYQA 4XQQA 4XYOA 3BS1A 4XXEA
chains in the Genus database with same CATH superfamily
2CH4A 3OSOA 4LFBQ 2E2IH 4KHPL 1XJVA 1JQYD 5J22A 4NW2A 3ND8A 1SMYC 2FHTA 1SNMA 2EY1A 2H1EA 1KLGD 5JJIA 5HGQA 3NTIA 3NTKA 1ICFB 1HR0L 1QVFA 1SJHD 3O13A 1Q82C 1G2SA 4A93H 5LL6X 2MUYA 1D8LA 1HA5A 5D3IB 2Q8TA 4FP5D 4M1UB 2L5TA 2XN9C 4IFDG 1GM5A 3HOZG 1GO3E 2DN8A 1BBXC 3S1NH 1NMGA 3MC0B 4BBSG 3FPPA 4J6HA 4DAYA 5C3XA 4NXML 3OMCA 1I6VC 3OWFA 3UE0A 4A3LH 1X9NA 1A63A 1SE3A 1U9RA 3IAYA 1Y1VG 4JI1L 3HOYH 4P72A 1F9SA 4FNFA 1HTLD 4DNTB 4X62Q 2KCCA 5D14A 2DJFC 1QNKA 4ULLA 3SE0A 1Y14B 4A3FH 1E7ZA 1K0SA 1Y1WH 4KHZA 5M5XH 3GTPB 1PYWD 1QJOA 3KLSX 3I2ZA 1UE1A 3HEJA 4KHVA 5KIXA 5C0XI 1HNXQ 3BVZA 3CMAA 1MBYA 1RF2D 3HP3A 3H0GB 4DR1Q 4YWMA 1CM9A 3ERSX 4BY7B 3WWVA 4GNXA 4JPBW 1U4MA 2NVTH 4GZYC 2DJGC 1SROA 3HS0C 3HOUG 3BZKA 1E0BA 3AB9A 2F0GA 4J8QA 2IX3A 2CVRA 4A3JH 4HJ5A 1P16A 4DUYQ 3NBHB 2OCEA 5FOBB 1KHIA 2NVYH 1Q7YC 2RSNA 3VYTA 4B9WA 1EQTA 1SE8A 3PUXA 4QIWB 3NUCA 1CA6A 2K52A 1QVCA 3K58A 4KY6A 3DHQA 5LL6S 3B6YA 4C3IH 1SE2A 3MVVA 3K81C 1LTRD 4UY8C 1ONLA 5JJKA 2XWJB 3EQLC 5K5PA 2YTVA 3F2CA 1ILPA 1RHPA 4RA8A 2BH8A 2HT1A 1UE6A 1X56A 4C56C 4A3GG 4X66L 1PFBA 4JV5Q 2ZXRA 4C3HH 2F0FA 3I4LA 1CKNB 2KEDA 2QKIC 1K83B 3W1GA 1HUMA 2DNCA 5EAYA 1WYDA 1HR0W 2FINB 2PQAB 3BYYB 4YY3Q 2IWHA 2JA5B 1VF7A 2EYFA 3T1HL 1W6JA 1STGA 4X64L 2NVQH 4B3SL 4R9WA 3K5NA 5F2DA 3K59A 3RN2A 2EE1A 2JA7H 3GTMH 2F52A 3A8JE 1T5XD 4Z9CB 5I4DA 1Q1EA 1O80A 1U5KA 4A3IG 5M3MG 1B9NA 3UDFA 4KKSA 1BKBA 1CZWA 3OTOQ 1X6OA 2QDBA 1FGUA 5AJ3Q 3GTJH 1P8LA 3TS0A 2HIXA 4IPGA 4DK1A 2L11A 3S17B 4CJ2C 1RCVD 4X6AH 4X65Q 2K4KA 2I46A 2F4IA 2K33A 3A5ZB 1AZPA 1IW7D 1CQVA 1EWIA 2IX0A 5GAEC 1TS4A 1I4XA 1JOKA 1IKMA 3RLNA 1E2VA 1PYSB 3C46A 4JOIC 1PTOF 2L55A 4LUOA 2JA8B 4C3JG 4ODGA 1R4QB 4RKLA 2R7FA 4IFDI 2DNEA 5IT9L 5IP7H 5J3BA 3S2HB 1N32L 1J9OA 1YNND 2GA4B 5BN5A 4RH6A 4XQQA 4IUUA 1UNSA 2PZUA 3R93A 3TP7A 3CF5A 5LMNW 2KHIA 1DD2A 3CRLC 1A8VA 4OWWB 3SK4A 4JI5Q 2C9OA 1HJPA 3D3RA 1JOQA 2NN6G 3J81j 2D9UA 3BDLA 4CDFC 2UUCQ 4FF4A 4ZYSA 1HRJA 4DV5L 1PFMA 3VR3A 5FLMH 1FJGQ 1X55A 4IUNA 5C4XG 2F0LA 4QB4A 2A74C 4RGOS 1NY4A 2HUGA 2OQKA 3S2DH 2XIWA 3CP0A 2NZOA 3H94A 2KCTA 1CZGA 2R92G 5D3DA 4C2MB 4LWCA 5GADC 3LX0A 3M85A 2K1BA 1A3VA 2AHOB 2BCOA 2JEBI 2Y0SE 3T1YQ 3QB3A 3I4MB 2XRSD 3PO3H 2I5LX 3M4PA 5D65A 3W5OA 1VQKA 1FR3A 1TQOA 2F0KA 3LWUA 1A6XA 2WFWA 2K5HA 3MXPA 3BVMA 1BCPB 1BXTA 1FGBD 5FO9B 3BDCA 1CI3M 4DR2L 4JI6L 4DV4Q 1E3PA 2WB1G 2PZWA 4LF6Q 4HAEA 2AUJD 3D4RA 4O1NA 4HIKA 1JR0D 1NR2A 1O7IA 2A5HA 4DR4L 2ZXOA 4A3EH 3L0OA 4DR6Q 1MI2A 2D2CC 4BY1H 1AEXA 1DZ1A 1SEBD 3MZ5A 3V96A 2R93G 2PYKA 1H9SB 3TZUA 2SDFA 4DF7A 3FKIG 1B7YB 3J80c 1ASZA 3S1MH 2RHSB 1YNNC 1FD7D 2CHBD 4P71A 1FNVA 5HGTA 5EPLA 4XXEA 2F0DA 4XTCS 4P73A 4FXKC 4K0KL 3A8IE 1I6HB 5T1IA 1CA5A 4TRDA 3SR1A 3OIQA 1O7YA 1V1PB 4LF5Q 3UDIA 4BXXH 1I3QH 1GHKA 4DR7Q 4BBSB 2EYMA 2WB1E 1EEID 5E1FA 3EBEA 1VQFA 3DEPA 4H02A 1F77A 2F0WA 3S15B 4JI4Q 3PF5A 2KUMA 1UEAB 1TWHH 1Y1VB 3NXWA 4UDUC 1QUQA 2EZVA 2EYLA 3A7LA 3PUZA 1QOHA 3J81L 4KHPQ 4DR3Q 2LFNA 4X3SA 3L3OC 4KMUC 3GP7A 3PUVA 1XMOL 4YCUA 4LF9Q 3Q0AA 1KAWA 1PXUA 1HR0Q 4N9TA 1F2YA 4FF1A 4DAYB 2ES2A 3JC66 2YU9H 2F4VL 1TWAB 2ZJRA 1TS2A 2Z6KA 4UP8A 1SDFA 3K57A 2LKVA 2MJ8A 1VQOA 1YJ9A 4B3MQ 4U673 1HHVA 2PI2A 4N9PA 1EQQA 1VQ6A 1VQBA 1OXXK 1VQMA 1ILQA 2L15A 4X3UA 4R4IA 4AH6A 3EIVA 1LUZA 4B3RQ 1JJCB 4ZUIA 2HIVA 4GKKL 2NN6I 1CQFA 2AQ3B 1J6QA 5BN3A 2YV5A 4HJAA 3WOFA 2YTYA 3NHHA 3CAMA 2Q2IA 4HIOA 3N6RA 4S3SA 4ZLTF 1JCKB 4RCOA 5EKLA 3CC2A 2EJGC 4GNXB 3H0GG 3IFDA 2F0UA 4BY7G 2K75A 1WTQA 2F0JA 1F9PA 2O2LD 1XMQL 1B50A 3GTGH 1SMXA 3VR5A 1EZ8A 3HOVB 2M00A 4A3DH 3UE1A 3E9HA 2E8GA 3GTOH 5C3EH 3GTLH 2G9HD 1VMCA 1Y8OB 4A3KG 1JE5A 3DM3A 3OMGA 1AN8A 4PNYA 2CW0D 3R3OA 5JEAH 4M8AA 4A3MG 2OTJA 5LMNQ 3T13A 4JG2A 4EQOA 3K7AH 4YCVA 4DR5Q 5IGCA 1K8MA 1N34Q 1WJJA 3PUWA 5C44G 2D0OA 2E2DC 1B3QA 5ELDA 1KRTA 3A7AB 1YI2A 1WCMH 5KNDA 2B3GA 1PZJD 1TS5A 4DV1L 5JVH3 3EVQA 3RZDB 1S5FD 2Z9HA 1D5ZC 4DV0L 3P20A 2CWAA 3C1EA 3VA7A 5IP9G 4X66Q 2K04A 1EYDA 1WTWA 2NVXH 4J15A 4CHTB 1ZYRD 1VCIA 5I9PA 2UXDL 1JB3A 5C4JB 5M5YH 1VF5C 3FHWA 1MIUA 1Q90A 4DV6Q 1DCZA 3HOXB 2C5CA 5K36H 4OO1G 4AQYQ 3C3LA 4QIWE 3S1RH 1GUNA 2NBFA 3CCJA 2Q8IB 3VYSA 2E2HH 4QY7A 1L0YB 4AYBB 1WTRA 3ERQA 5EPJA 3MXNA 4OHJA 4QJFA 1XXGA 3S1QB 5CORA 1KXLA 2B39A 2VS1A 4U68A 1DOKA 1XNRL 2B63B 1HXYD 1VQCA 3EA6A 1IYJB 4YHHL 4JI0Q 4LFCQ 4CDEC 3G6EA 2RDGA 4CKEA 2HQEA 3IFTA 2JA8G 3PO2G 4KY5A 1N36L 1QZHA 4R4OA 2A6HD 2RSOA 4HTHA 4QGUA 2CW0C 1EQRA 3W2DA 5C4XB 2CWPA 1IKLA 4LF8L 1S5ED 1JB7A 1EIGA 1E2ZA 1L0WA 1N32Q 3I56A 2EY2A 1HZAA 1CHQD 4IO9A 1TIID 2ENBA 1PFSA 1Q8KA 4JI3L 2AWNA 3GTPH 1PTOB 2VQEQ 3J80E 3NE5B 3ZYYX 3KYHC 2UXCL 2K32A 3U9OA 4K14A 5IY0A 3TQYA 5CV7A 1KNAA 1I50B 3SXHA 5M5WB 4YWKA 3JAML 3D31A 1S5DD 3CCMA 2LSSA 2JA6B 2UU9L 4JW0A 5EQ0A 2BH2A 3OOCA 5LMUL 1JWSD 3X3MA 1U4PA 1TXYA 4ZKCB 2ATWA 2SNSA 1B44D 1HZ9A 5IT9c 1SNPA 1VQHA 3JAME 1NMFA 2DY8A 3I4MG 2K7VA 4ZAIA 1D2BA 1TT2A 3HG9A 3FKIB 1VQPA 3M4YA 2KBNA 1YNJD 4GKJQ 2PMZB 5JJZA 5IYCH 4HMJA 2WAQG 1KDAA 2PO4A 2F0MA 2YYZA 5C4ZA 4PMCA 1EZ6A 3H6MA 1STYA 3NQTA 2B2VC 5DNFA 4KK7A 2K6AA 4H13C 2VUMB 3GTQH 3L7ZC 4OX9L 1KQSA 3R2TA 1PRTD 1STAA 4H44C 3A8KE 2EYOA 2ZM6Q 1IBLQ 1K83H 1PH7A 1BBWA 2A6HC 1KNEA 2JA5H 1EWHA 4NKLA 2KEEA 2K14A 1HTPA 5J39A 4FDBA 1V8QA 2D0PA 2ZTEA 3CCUA 4DV7Q 3S14H 2BA1A 1B2TA 3GV3A 4CGYB 4X3TA 3RZOH 1BUVT 1CUKA 3K0XA 2UXBL 3A74A 4P74A 1WTPA 4OO1I 1SYDA 1VS0A 2E74C 3EROA 1ZEQX 4ZQ3A 1OTCA 4RAUC 3OPOA 3CCEA 1ZKOA 4DV3Q 5CBEE 1DONA 1J5EQ 1QUQB 1RKNA 2AMCB 1UE7A 1U4RA 4V0BA 3RLFA 3ONAB 4A3BG 2R7ZG 2E2JB 5C3WA 4DUZQ 4JYAL 1BCPC 2IT1A 4OL7A 1KTKA 2V4DA 1CKMA 4FXDA 2ZJQA 1Z9FA 4K5WA 2IJ0A 4A75A 2MO0A 4LF7L 3MFYA 4H7BA 2HDMA 5C0XH 1D1KA 2CQAA 4JI7Q 2L4NA 1YNJC 1CFMA 1X3GA 4RKBA 4ABNA 1K73C 1TY0A 2EJMA 1YIJA 1S72A 2A69D 1IBKQ 1CHPD 4IALA 1HFNA 1DOMA 2EVBA 1DM0B 3T16A 5IWAQ 3KUPA 4FYDA 1CKOA 1JWMD 2LMCB 3DLLA 1PVOA 1JJGA 3A5UA 4A3KB 3SHLA 1STNA 2OF1A 1PRTC 2EQSA 4A3MB 1UE5A 1ICWA 2N55A 3J7ZC 5C5MA 5KYIA 2A19A 2Q2UA 2FMCA 4K5VA 1QE6A 1E1TA 1WFQA 3J81c 4LMQD 1G291 2WKCA 3M9BA 5IODA 5FLXL 1EU4A 5CV5A 2XNAC 3M4OB 3NWTA 5C44B 3KLRA 4YCWA 3OHXC 1FL0A 1JOOA 2NZ1D 1VQLA 3T56B 3M3YB 3SEBA 2QF7A 3D6CA 1B70B 5CV8A 1WOCA 3CW2C 3HOVG 1VQAA 4B3TQ 1TR5A 4OONA 1C0AA 4GN5A 4NXNQ 2NB0A 1Y69U 4XYQA 1HNWL 4EGVA 1VQ5A 4I7AA 3K80C 4PMBA 2UUAQ 3ULLA 2RDFA 2R6GA 1UWVA 3RMHA 5M3FB 1EOVA 1MSGA 3X3NA 2ICIA 2N8NA 4WJ3M 1A0IA 2B2WA 5AFWA 3BS1A 3NSWA 4CKBA 1BNZA 1S5BD 2JXMB 1AW7A 2F0IA 5KEEA 1M4VA 1Z6HA 2B2UA 1EYAA 1RL2A 1K0RA 1R9TH 1TWFH 4APVA 1SJED 1QILA 4ME3A 4B08A 3CQZH 3CXCA 2AQ2B 5ELOA 4G7OC 3LNNA 3BU2A 3TBIB 3HOWG 1EU3A 3GTKH 3P75A 2TMPA 4K6LA 3ER0A 2B29A 2P5ZX 1V9PA 1ET9A 1QZGA 2A69C 1YHBA 2A6ED 3MHBA 4A93B 1SAPA 1AZQA 1B53A 2WINB 1GHJA 2B8GA 1S3OA 4GS3A 1ENAA 4GNXC 2NYZD 1OXSC 4YWLA 3RD4A 4MZ9A 3HOXG 2CH4W 3DUZA 3PO2B 1YVCA 4IFDH 2XSCA 1HA6A 1HNZL 3HOZH 3TSSA 1AE2A 4IOCA 1YJNA 4ZCKA 3A55A 1XX8A 3TP5A 1J8IA 3MXNB 2K5NA 3I72A 1SYBA 1JMCA 4UP7A 1Z47A 4AYBG 1BR9A 2Z6BA 3S15H 4HCEA 1CSPA 4L63B 1QVGA 2JSOA 3HOYB 2KCMA 1Y1VH 1NSNS 2Z4IA 1KC8C 2IHFA 4LFAL 5HY6A 4DV2L 4CBVA 2JP1A 5IT9E 1GOZA 3L2PA 5GROA 2MPMA 2B63G 1GUSA 4BBRG 4RG1A 5M5XB 1IBML 4R4CA 3MFGA 3GV6A 5JPNC 2OTLA 1XNRQ 1SXTA 2KOLA 4F88A 5FJ8G 2X6GA 2BE5D 1PV4A 4KKUA 1TWAH 1G6PA 4IJHA 4KLKA 2F0QA 1PTOD 1I4QA 3F8TA 3I55A 2SOBA 1XNQQ 2NVTB 4ZUJA 4GLAC 3QO2A 3CCSA 5FKAC 4AIMA 3HOUH 1H9KA 2LXJA 4G4KA 1STEA 1SYGA 1O78A 1N33L 3E0JA 1XPUA 1LT5D 2NVYB 2B2WC 3PQIA 3F2BA 2VQFQ 4AYBE 2ZJPA 3G4SA 1V1QA 5I2XA 2NZHA 2H4OA 2VB2X 3A0JA 4XT3B 3U4VA 2B2UC 2E5LL 3I4NG 2WAQB 3CMEA 4JI8Q 1RD9D 1VQGA 4JI2L 4HIDA 1RIPA 4HSPA 2JA6G 2F0TA 4OIJA 1X32A 4RHRA 4LAAA 4EQ5A 1G91A 5GQOA 1IW7C 3F2UA 3BJUA 1PH3A 1C7YA 4A3DG 1W3SA 3CRKC 1I94L 4A3GH 4C3HB 1B9MA 2HHHQ 4ALPA 4I7ZC 5LMUQ 2B2YA 3TS2A 2EYPA 1WD0A 4PQXA 5TSSA 2CQOA 4IPHA 2RVLA 3KBGA 2NVQB 4K2LA 2JQOA 3TN2A 4CKCA 2JA7B 1HZCA 3U4ZA 2N49A 2R3ZA 4HEDA 2HQLA 2GN5A 3MEFA 4LFBL 1PRTB 4DPGA 1D5MC 3SDZA 4A3IH 5M3MH 1FNUA 1EYGA 1K3BC 5CV9A 4O42A 1K8GA 2FJ2A 3I90A 1IL8A 5ELBA 3GTJB 2VUMG 2AWOA 3OYYA 1OXTA 3FDTA 3JAMc 3H15A 3HRZC 2NUCA 4OELB 2L9HA 1B8AA 2V1CC 2PNRC 1TWCH 3M7GA 1X54A 4B9XA 1NE3A 1JE4A 4LW1A 1EOTA 1PTOC 2HDLA 1EY6A 3QG1A 1EWCA 1MSHA 1GUGA 1LT6D 1XTCD 4NB3A 5JJLA 4A3BB 2R7ZB 3HKZB 5EBCA 5C4JH 1E1OA 1YZ6A 4WJ4A 3AYHB 4IN3A 5E3FA 3CD6A 1MKHA 4C3JH 3KLWA 2R7DA 4O2DA 4TQUS 1RJTA 2PMZE 2QW7A 3T53B 1MJCA 5ELNA 3V2TA 4CDCC 3AQQA 1D1IA 2FMMA 5IYDG 4E6IA 2WIIB 1PLFA 3J81E 1AH9A 4KY7A 3CHBD 3TP6A 1HZBA 4MIUA 4L5QA 1LTBD 3S1QH 2RDHA 5IYBG 4DK6C 1PHJA 1HNXL 3STBD 4NXMQ 3OWEB 4BA1I 4A3CG 1TKWB 1A2TA 4DR1L 3C2PA 2NN6H 4P2CB 2VZAA 4JI1Q 2PCFB 4V190 2WV6D 1PZID 4PZ6A 2F0SA 1TU2B 5C4XH 1PYBA 3S9WA 1T5EA 2EDGA 4DUYL 2F0OA 3Q6SA 3Q24A 4LF7Q 5FO8B 4QMGA 4DXFA 1EIHA 2R92H 2JA9A 5JPMC 3S16B 3J7AF 5CMDA 1NUCA 4IURA 2N88A 4POFA 4IUQA 3PO3B 2L0CA 2JJQA 1I4GA 5KGUA 5KRUA 4DXGA 4LJZC 3CCLA 2VB3X 1DXMA 1H9RA 3ULPA 2VNUD 4N8X1 2NWGA 2RQXA 4RGNA 4WFN3 4JV5L 2KENA 3ULJA 3QJYA 1QNUA 4A3EB 1BBUA 3A56A 3W3AA 3V05A 4BY1B 1YITA 3OW2A 1XPRA 1K8AC 2R93H 1CKNA 2Z8LA 5KYLA 3S1MB 5E4WC 2PI2E 1MJEA 1A2UA 4FF3A 3KDFA 1VQEA 1U4LA 3HOWB 2RF4A 1CT1D 3T51B 1SFOH 4HSVA 1A3UA 5M3FG 5AJ3L 2Z6KC 1OXUA 1DYQA 2BDNA 3T1HQ 1LTTD 4NMZA 3OW7A 3DXJC 3STBC 1TVXA 4X64Q 4X65L 2QDLA 4B3SQ 4LF4L 4DNIA 5CV6A 3G71A 5H1SE 3AFPA 3LWEA 2XWBB 1O7LA 5FLXc 3K5OA 2QA4A 5ELFA 2ZTCA 3KK7A 1T9HA 1WTXA 2F03A 1BDOA 1Q86C 1CSQA 1VQDA 3H3VC 5I9OA 4XQNA 1SYCA 4A93G 4BBRB 5DEHA 1KLUD 4HN7A 3CCRA 2GVAA 4YIJA 4IUTA 3J7YW 4IOAA 2YU9B 4L5TA 4F87A 1DGSA 3FPUB 1XTDA 1EEFD 4A76A 1AFPA 2F0VA 5BN4A 4JBMA 1EUJA 3D8GA 3HZXA 1B3AA 4XDXA 1KL9A 5CC4A 4JI5L 4A3LG 1GD7A 1JWUD 1KAAA 3TDQA 2UUCL 4OWTB 3HOYG 3Q8DA 5C5LA 1ESRA 1FJGL 3NP8A 3NTHA 1Q46A 3I70A 4HCSA 4A3FG 3VYUA 1Y1WG 1BCPF 2ZT9C 5CR3A 3I4NB 5NUCA 1IBMQ 4HR7B 2BDOA 1SMYD 5GAHC 3T1YL 3R8BA 2HCCA 1PH2A 1TWGB 2I5HA 2F3IA 3H0GH 2DUDA 1SLJA 1EY8A 3GTGB 2E76C 4BY7H 2F3WA 4RGTA 4DV5Q 1E22A 4CJ0B 1F2ZA 4A3DB 1ZYRC 3GTOB 2OQ0A 3TZDA 2CKZB 2XGTA 4A3JG 3PGZA 2Z4HA 3P7JA 3SGIA 1HQMC 2QCPX 4DV4L 4LF6L 4PG3A 4A3KH 4DAVA 4RHSA 1ASYA 1HCZA 2EJFC 5IE8A 1A15A 4LNQA 4L5SA 1Q3LA 3G7LA 4UHVA 3LGJA 4A3MH 4CJ1B 4DR6L 3H3VI 1XWEA 1LT3D 4C3IG 4K8IA 5LHY1 2Q2TA 5EBDA 4FF2A 1II3A 3MEHA 3I8ZA 5C44H 5I2YA 1WCMB 4JVZA 4F8MA 3M3YH 3DWQA 4QCLA 1X3QA 4DR2Q 4JI6Q 4BWGB 4G7ZC 4NDXA 3ZJYC 4C3HG 1H9SA 1I4HA 3E6ZX 4BS9A 1M1KC 4DR4Q 1NAPA 3QIAA 2E75C 4LF5L 2NVXB 1L1OA 5IP9H 3ND9A 3PIPA 4DR7L 1SN8A 3G48A 1VDZA 1KD1C 2JA7G 1JT8A 4RWSC 2QILA 1HPCA 1X3EA 4DNRB 1H9MA 3DMUA 4K5XA 2A1AA 5IGBA 3J80i 2L1BA 1O7ZA 1K9MC 4OO1H 4JI4L 1S40A 1YNXA 3H09A 2IL8A 3Q23A 4C1NI 1RODA 2WAQE 4K0KQ 2JK8A 3NPPA 4GLVB 3TMEA 1QB5D 5DLQE 1STBA 2FXQA 4Y7NB 1Q81C 4DR3L 1XPOA 1DOLA 1EFID 2YTXA 1NNXA 3D0FA 4K6DA 5J1ZA 3S17H 1WTVA 4LF9L 2PPBC 3QR8A 1HUNA 1UEBA 3TRZA 4ID6A 3JAMi 1VMPA 3L9AX 3KJOA 3RUZA 5DM63 1SYFA 2JYOA 3HKSA 3HKZG 1PH6A 4OXPA 4P75A 2JA8H 4B3ML 3PO2H 2IW3A 1D6EC 3C1FA 5IP7G 1PZKD 3KLSA 3DWAA 2J7ZA 3E9IA 1JICA 1A3TA 4EVOA 1LTGD 1WTHA 3S2HH 3K7UC 4B3RL 1XMOQ 1LACA 2VXWA 4KD3A 4HJ9A 3IRBA 2EYHA 4A4IA 1SR3A 3WOEA 2F4VQ 2MQHA 3PIOA 2LS01 2H5XA 5ISRA 1N9WA 4OIKA 3KBXA 4RMFA 2C35B 4ZKBB 1CTMA 2I5MX 3NELA 3E0EA 4ILWA 1KDBA 2KQ3A 5E4XA 5FLMG 1PFNA 4GOPA 3D6WA 1SBBB 2MFIA 2J0TD 1GJXA 3AEVA 3HKZE 4JOIA 4DU9A 4GKKQ 2TSSA 4GN4B 1LABA 1R4PB 3SK6A 1WVLA 2QEJC 1L1OC 5JEAJ 1I5FA 1SRUA 2AKWB 4C2MH 5LMNL 2F0EA 1H9JA 2IPKD 2PW7A 2MGSA 4UAIA 3PO3G 4DR5L 1TS3A 4EQPA 3I4MH 2CFMA 1N34L 5FLXE 3CCVA 1KRSA 1XMQQ 4ME5A 1JORA 4L6TB 1BQQT 3UDXA 5IGGA 2EXZA 2F0NA 1AE3A 3KOJA 1F9QA 4LK1C 4PZ7A 4QF4A 3Q22A 2LY7A 2L12A 1SNOA 4IQZA 1PH8A 1A62A 1EIYB 3BZDB 4A3EG 3GTQB 5A2QL 4DAPA 2F0PA 1LYLA 4BY1G 1SNQA 4XYOA 1VQ9A 3KFUA 1F2MA 3IL8A 1AP0A 2RHQB 1EY0A 1ML0D 2OXPA 4DFAA 1KIXA 1PH9A 1STHA 1UUPA 2AQ1B 2NTTA 2O4XA 3KDFB 1Q8IA 3U9SA 2E2IB 4DV6L 2ALYB 2PZTA 2RBMA 2F1MA 5A2QE 3S14B 4AQYL 3RZOB 4PMWA 1GUTA 4DV1Q 2K50A 1YJWA 5FK9C 2LXKA 3KJPA 4MTNA 1QWYA 2B2TA 4JBJA 3F2DA 3E3XA 4DV0Q 3J7A5 1WI5A 1I6HH 4BXXG 1EY9A 2I0QA 2X69A 3PSIA 4PV1C 4WJWA 4XIGS 2RCFA 1C8CA 4DGZA 3WDNA 1ET6A 5BR8L 1EFWA 3S1NB 2UXDQ 5C6AA 2ID0A 2Q8RE 4BBSH 2QGQA 1ENCA 3GD7A 3RNUA 4LF4Q 1K8OA 4JI0L 2K5WA 4LFCL 3VYRA 1MGSA 2PQEA 3QWNA 2OT2A 3FP9A 1GUOA 4ZK9B 4GOPC 5EKIA 5KNBA 4A3BH 2R7ZH 3A54A 1G2TA 5I6YA 3KF6A 4LUVA 3KF8A 4TVAB 4A3FB 3S24A 1TY2A 1Y1WB 4OWXB 3OIPA 1GXDC 1YHQA 2Y0SG 2QEXA 4FO2A 1V43A 4YHHQ 2EY6A 4R4QA 3N52A 3I7FA 1LTID 3G6JB 1LM0A 2DY7A 1N36Q 1W6KA 1SSOA 2VQEL 2MO1A 2JN4A 2D62A 1ESFA 2EXDA 1MD2D 1KDCA 3DEOA 1BOSA 3P1HA 1VQ8A 1BVSA 4LF8Q 4A3JB 3AMUA 2OEOA 4I65A 3UI2A 4ZRZA 1U0LA 1HH2P 3NENA 1LTLA 2AUKA 1IXRA 1EQVA 4FVMA 5C4HA 4C3IB 4JI3Q 3PIP3 4HJ7A 5DAUA 4JBKA 5CV4A 2UXCQ 3D4DA 2BA0A 1PA6A 1F2LA 3S16H 4JCVE 2A6EC 4GKJL 4DN4M 1OO9B 3HOVH 5KNCA 5C3EG 2B2TC 3I3CA 3E5SA 2UU9Q 1C4QA 1EY7A 2K01A 5JEAG 3CC4A 1GUWA 5CYUA 2UUBL 4L5RC 3FEWX 1Y8NB 1IBLL 2ZM6L 3GTMB 3K8AA 1IZ6A 1PMRA 1LT4D 3MXUA 3EFXD 2XTIA 1VQNA 1XYIA 2MP1A 5HURA 3DWPA 4WRDA 1WCMG 2SNMA 4MNOA 1R9TB 1TWFB 4IPDA 1NBWA 4DV7L 4OGQC 1UAPA 4IPCA 1ZXTA 1V1OA 3CQZB 2A73B 2HCIA 1K28A 3FMCA 3RZDH 1D7QA 3GTKB 3BDOA 1L1OB 3NQIA 3HOWH 2BE5C 3PF4A 4OX9Q 5CGKA 4HMIA 2J4XA 3NEMA 2ASBA 2N3SA 1QCBD 1YHAA 4R8IA 5GAGC 1FVIA 1YEZA 5L37A 1MHWC 3PUYA 3PIO3 4RGMA 5K36G 4DV3L 1SNCA 5COYA 3HOXH 1J5EL 1IYUA 3HOZB 3EN2A 1EL0A 2ZXPA 5M9OA 1E24A 4DUZL 1S5CD 3T4AC 3URYA 2UXBQ 4X62L 1NTGA 2SEBD 4JC0A 1RDPD 2EYJA 2IX1A 3CPWA 1WTOA 4UPAA 3I73A 5C0XJ 2KECA 4JI7L 2B63H 4BBRH 1LV9A 3I4OA 5IGFA 1IBKL 1Z7TA 4Q5VA 4KKTA 2X6LA 3F1ZA 1NR4A 2M9VA 2XVSA 1SE4A 3GQBA 5FJ8H 2Z0SA 5IWAL 1WD1A 4EX5A 4JYAQ 3SVMA 2PW5A 1JJ2A 2B2YC 1EY4A 3FRPB 3S2DB 4DK0A 5EKKA 3NWSA 1M8AA 5JOBA 2Q2HA 3HOUB 2KCNA 4EQNA 2G9DA 4TKOB 2K28A 1GKHA 1IHZA 2JE6I 4R8NA 3K5LA 4KI0A 2OWOA 2R61A 4N8FA 3NBHA 1PTOH 4KN4C 4KTAA 4GOPB 3I4NH 4KJOA 3K0YA 1I50H 1G8ZD 4R4TA 1RTOA 5M5WH 4B3TL 3RR5A 1TWGH 4JK1C 2DGYA 4QL5A 2M2LA 1B4OA 3PMFA 3VA5A 2JA6H 2RKSA 5ELEA 3CCQA 4GN3B 3NBIA 4NXNL 3SK5A 3U58A 2ZTDA 2O5IC 1D5XC 2BOSA 2F3VA 4KN7C 4A3GB 2UUAL 4YY3L 1BO0A 5E7NA 3K5MA 1NCVA 2XRQD 2B8FA 2WP8J 5JVG3 3J81i 2Z1CA 2EPBA 3MTSA 2GVBA 3M7NA 1Q12A 3FKIH 5CBAE 2PQAA 5IYCG 2KA7A 1LLRD 2IHEA 5IOCA 4IUPA 1EIFA 5EJWA 1IL2A 3EJIA 3OTOL 3CPFA 4Y52H 3D4WA 1N8RC 3ITPA 3MAQA 4RFBA 1HNWQ 4A3IB 3VR2A 3UDGA 3QOJA 5M3MB 3K6OA 1LTAD 1X65A 1JC7A 1I3QB 2RA4A 1PDQA 4JBWA 1X3FA 2VUMH 3PCOB 1PH5A 4NP5A 3MWYW 1ENFA 2KJXA 2PNHA 1LTSD 1TWCB 5DM73 2K03A 3DM1A 5IIFA 1HFGA 3CU7A 2JA5G 1EYCA 2MNAA 4H0LC 1G6ZA 1VQ7A 4XQJA 4IFDJ 1TWHB 2K5VA 1VQ4A 4CDDC 4MN3A 2WKDA 3H91A 1FYCA 4FXGC 4MTKA 1L0XB 3TEHB 5FO7B 4C3JB 2G5DA 4QUCA 4BA2I 4MHEA 3BVGA 4G57A 1SNDA 4XT1B 2Y0SB 1K3RA 4DAMA 5A35A 4IZ8A 4TSSA 1W2BA 4K8JA 4DA2A 2D5DA 5IYDH 1Y8PB 3AFQA 4KV6A 4POGA 4Y7NH 1C9OA 2N78A 3GDEA 3BYTB 4X3KA 2B2VA 3PV0A 5BR8Q 2MHVA 5IYBH 1HNZQ 1X3PA 4RCNA 3CKIB 5JAVA 1RTNA 2K5QA 3KF6B 4LUZA 3IKJA 3KF8B 2E2JH 4A3CH 2O5JC 3VR6A 2RCNA 1XNQL 1QG7A 2A68D 4LFAQ 4DV2Q 1B1ZA 1FNWA 3CC7A 4DKAC 5G3LF 5C0XG 3SK8A 3W1BA 5EPKA 5IGEA 2VW9A 3AU7A 4GLXA 1Q1BA 4O0AA 2KHSA 3J80L 4F7XA 3BG3A 2VQFL 2R92B 3NK9A 2FFKB 4DK3C 3I91A 1I4PA 2JEAI 1GVPA 2EOTA 2KVMA 5IGDA 5C3EB 2ICEC 4UP9A 4JI8L 5T1GA 3GTLB 1EY5A 1L2FA 3TP8A 3HGBA 3RLOA 4QUFA 4IUVA 1SYEA 4HJ8A 1G51A 3VDYA 3GO5A 3MA2B 3MXGA 1PH4A 4QQBX 1S4ZA 1H95A 1NJIC 1OXVA 3H3VH 1VQIA 3K7AB 1N33Q 3M4QA 2WB1B 5ELCA 2HHHL 3HFZB 1PRTF 1PH1A 3ICEA 2F0HA 3U50C 2I07B 1BCPD 4IJLA 3FVQA 5EGTA 5G3LD 2E5LQ 3M4OH 1I4RA 2VL6A 4KJNA 2K05A 1BF4A 4JI2Q 4WORA 3J7AV 2R93B 2VY3A 3QOLA 4G7HC 4HIMA 4J1MA 3RN5A 1E2WA 1C48A 4K2KA 3BZCA 1SFOB 4NPSA 2A8VA 4L8JA 1I94Q 3R2IA 2K5DA 5M3FH 1CK1A 4Q0FA 1M90C 4C1NK 1LO5D 2IY5B 2EIFA 4OEMB 5M5YB 1VQJA 1IYVA 1KABA 3TREA 2CCZA 2UUBQ 4KD4A 2NTSA 1V1PA 2HD3A 1YBYA 2WACA 3S1RB 4R1JA 1HQRD 1DJRD 2EY5A 4PZ8A 1F9RA 3VR4A 2A68C 2KHJA 2E2HB 5I6WA
chains in the Genus database with same CATH topology
3OSOA 1JQYD 5J22A 4NW2A 3ND8A 1SMYC 2FHTA 1SNMA 2EY1A 2H1EA 1KLGD 3NTIA 3NTKA 1SJHD 3O13A 1G2SA 5LL6X 2MUYA 1HA5A 5D3IB 2Q8TA 4FP5D 4M1UB 2L5TA 2XN9C 4IFDG 2DN8A 1BBXC 3MC0B 3FPPA 4J6HA 4DAYA 5C3XA 3OMCA 1I6VC 3OWFA 1SE3A 1U9RA 3IAYA 1F9SA 4FNFA 1HTLD 4DNTB 2KCCA 5D14A 1QNKA 4ULLA 3SE0A 4KHZA 3GTPB 1PYWD 1QJOA 3KLSX 4KHVA 5KIXA 3HEJA 5C0XI 3BVZA 1MBYA 1RF2D 3HP3A 3H0GB 1CM9A 4BY7B 1U4MA 4GZYC 3HS0C 1E0BA 3AB9A 2F0GA 4J8QA 2IX3A 2CVRA 5FOBB 2RSNA 3VYTA 4B9WA 1EQTA 4QIWB 3PUXA 3NUCA 1CA6A 3K58A 4KY6A 3DHQA 5LL6S 1SE2A 3MVVA 1LTRD 1ONLA 2XWJB 3EQLC 5K5PA 1ILPA 1RHPA 4RA8A 4C56C 1PFBA 2ZXRA 2F0FA 3I4LA 2KEDA 2QKIC 1K83B 1HUMA 2DNCA 2FINB 3BYYB 2IWHA 2JA5B 1VF7A 2EYFA 1W6JA 1STGA 4R9WA 3K5NA 5F2DA 3K59A 2EE1A 3A8JE 1T5XD 4Z9CB 5I4DA 1Q1EA 1O80A 1B9NA 4KKSA 1CZWA 2QDBA 4DK1A 2L11A 3S17B 4CJ2C 1RCVD 2I46A 2F4IA 2K33A 1AZPA 1IW7D 1CQVA 2IX0A 1TS4A 1I4XA 1JOKA 1IKMA 1E2VA 3C46A 1PTOF 2L55A 2JA8B 4C3JG 4ODGA 1R4QB 4RKLA 4IFDI 2DNEA 5IT9L 3S2HB 1J9OA 1YNND 2GA4B 5BN5A 4RH6A 4XQQA 4IUUA 1UNSA 2PZUA 3R93A 3TP7A 1DD2A 3CRLC 3SK4A 2C9OA 3D3RA 1JOQA 2NN6G 2D9UA 3BDLA 4FF4A 4ZYSA 1HRJA 1PFMA 3VR3A 4IUNA 2F0LA 4QB4A 2A74C 4RGOS 2HUGA 2XIWA 3H94A 1CZGA 5D3DA 4C2MB 3LX0A 3M85A 2K1BA 1A3VA 2BCOA 2JEBI 3QB3A 3I4MB 2XRSD 5D65A 1FR3A 1TQOA 2F0KA 3LWUA 1A6XA 3MXPA 3BVMA 1BCPB 1BXTA 1FGBD 5FO9B 3BDCA 1CI3M 2PZWA 4HAEA 2AUJD 3D4RA 4O1NA 1JR0D 1NR2A 2A5HA 2ZXOA 1MI2A 2D2CC 1AEXA 1DZ1A 1SEBD 3MZ5A 3V96A 2PYKA 1H9SB 3TZUA 2SDFA 4DF7A 1YNNC 1FD7D 2CHBD 1FNVA 5HGTA 5EPLA 4XXEA 4XTCS 2F0DA 4FXKC 3A8IE 1I6HB 5T1IA 1CA5A 4TRDA 3SR1A 3OIQA 1O7YA 1V1PB 1GHKA 4BBSB 2EYMA 1EEID 5E1FA 3DEPA 1F77A 2F0WA 3S15B 2KUMA 1UEAB 1Y1VB 3NXWA 4UDUC 2EZVA 2EYLA 3A7LA 3PUZA 1QOHA 3J81L 2LFNA 4X3SA 3L3OC 4KMUC 3GP7A 3PUVA 3Q0AA 1PXUA 4N9TA 1F2YA 4FF1A 1TWAB 1TS2A 1SDFA 3K57A 2LKVA 2MJ8A 4U673 1HHVA 4N9PA 1OXXK 1ILQA 4X3UA 4ZUIA 2NN6I 1CQFA 2AQ3B 5BN3A 3WOFA 3NHHA 3N6RA 4S3SA 4ZLTF 1JCKB 4RCOA 5EKLA 2EJGC 3IFDA 2F0UA 1WTQA 2F0JA 1F9PA 2O2LD 1B50A 3VR5A 1EZ8A 3HOVB 2M00A 2G9HD 1VMCA 1Y8OB 3OMGA 1AN8A 4PNYA 2CW0D 3R3OA 5JEAH 4M8AA 3T13A 4EQOA 5IGCA 1K8MA 3PUWA 2E2DC 5ELDA 3A7AB 5KNDA 1PZJD 1TS5A 5JVH3 3EVQA 3RZDB 1S5FD 1D5ZC 3P20A 3C1EA 3VA7A 2K04A 1EYDA 1WTWA 4CHTB 1ZYRD 1VCIA 5I9PA 1JB3A 5C4JB 1VF5C 1Q90A 1DCZA 3HOXB 2C5CA 5K36H 4OO1G 3C3LA 1GUNA 2NBFA 2Q8IB 3VYSA 1L0YB 4AYBB 1WTRA 3ERQA 5EPJA 3MXNA 4OHJA 1XXGA 3S1QB 5CORA 2B39A 4U68A 1DOKA 2B63B 1HXYD 3EA6A 2RDGA 4CKEA 2HQEA 3IFTA 4KY5A 2A6HD 2RSOA 4HTHA 2CW0C 3W2DA 5C4XB 1IKLA 1S5ED 1EIGA 1E2ZA 2EY2A 1CHQD 1TIID 2ENBA 2AWNA 1PTOB 3J80E 3NE5B 3ZYYX 2K32A 3U9OA 4K14A 5CV7A 1KNAA 1I50B 3SXHA 5M5WB 3JAML 3D31A 1S5DD 2JA6B 5EQ0A 3OOCA 1JWSD 3X3MA 1U4PA 4ZKCB 2SNSA 1B44D 1SNPA 3JAME 2DY8A 2K7VA 4ZAIA 1D2BA 1TT2A 3HG9A 3FKIB 3M4YA 1YNJD 2PMZB 5JJZA 4HMJA 1KDAA 2PO4A 2F0MA 2YYZA 5C4ZA 4PMCA 1EZ6A 3H6MA 1STYA 3NQTA 2B2VC 5DNFA 4KK7A 2K6AA 4H13C 2VUMB 3L7ZC 3R2TA 1PRTD 1STAA 4H44C 3A8KE 2EYOA 2A6HC 1KNEA 1EWHA 4NKLA 2KEEA 1HTPA 5J39A 1V8QA 2BA1A 1B2TA 3GV3A 4CGYB 4X3TA 1BUVT 1WTPA 4OO1I 1SYDA 2E74C 3EROA 1ZEQX 4ZQ3A 4RAUC 3OPOA 1ZKOA 5CBEE 1DONA 1RKNA 1U4RA 4V0BA 3RLFA 3ONAB 2E2JB 5C3WA 1BCPC 2IT1A 4OL7A 1KTKA 2V4DA 4FXDA 4K5WA 2IJ0A 3MFYA 4H7BA 2HDMA 5C0XH 1D1KA 2CQAA 2L4NA 1YNJC 1CFMA 4RKBA 4ABNA 1TY0A 2EJMA 2A69D 1CHPD 4IALA 1HFNA 1DOMA 2EVBA 1DM0B 3T16A 3KUPA 4FYDA 1JWMD 2LMCB 4A3KB 3SHLA 1STNA 2OF1A 1PRTC 4A3MB 1ICWA 2N55A 5C5MA 5KYIA 2FMCA 4K5VA 1QE6A 4LMQD 1G291 2WKCA 5IODA 5FLXL 1EU4A 5CV5A 2XNAC 3M4OB 3NWTA 5C44B 3KLRA 3OHXC 1JOOA 2NZ1D 3T56B 3M3YB 3SEBA 2QF7A 3D6CA 5CV8A 1TR5A 2NB0A 1Y69U 4XYQA 4EGVA 4PMBA 2RDFA 2R6GA 3RMHA 5M3FB 1MSGA 3X3NA 2ICIA 3BS1A 2B2WA 5AFWA 3NSWA 4CKBA 1BNZA 1S5BD 2JXMB 1AW7A 2F0IA 5KEEA 1M4VA 1Z6HA 2B2UA 1EYAA 1SJED 1QILA 4B08A 2AQ2B 4G7OC 3LNNA 3TBIB 1EU3A 3P75A 2TMPA 4K6LA 1ET9A 2A69C 2A6ED 3MHBA 4A93B 1SAPA 1AZQA 1B53A 2WINB 1GHJA 2B8GA 1ENAA 2NYZD 1OXSC 3RD4A 3DUZA 3PO2B 4IFDH 2XSCA 1HA6A 3TSSA 3A55A 1XX8A 3TP5A 1J8IA 3I72A 1SYBA 1Z47A 1BR9A 4HCEA 4L63B 2JSOA 3HOYB 1NSNS 2Z4IA 4CBVA 2JP1A 5IT9E 1GOZA 2MPMA 1GUSA 5M5XB 3MFGA 3GV6A 5JPNC 1SXTA 2KOLA 4F88A 2X6GA 2BE5D 4KKUA 2F0QA 1PTOD 1I4QA 2SOBA 2NVTB 4ZUJA 3QO2A 5FKAC 1H9KA 4G4KA 1STEA 1SYGA 1O78A 3E0JA 1LT5D 2NVYB 2B2WC 5I2XA 2H4OA 2VB2X 4XT3B 2B2UC 2WAQB 1RD9D 4HSPA 2F0TA 4OIJA 1X32A 4RHRA 4LAAA 1G91A 1IW7C 3F2UA 3CRKC 4C3HB 1B9MA 4I7ZC 2B2YA 2EYPA 1WD0A 4PQXA 5TSSA 2RVLA 3KBGA 2NVQB 4K2LA 3TN2A 4CKCA 2JA7B 2R3ZA 4HEDA 1PRTB 1D5MC 3SDZA 1FNUA 5CV9A 4O42A 2FJ2A 3I90A 1IL8A 5ELBA 3GTJB 2AWOA 1OXTA 3FDTA 3HRZC 2NUCA 2L9HA 2PNRC 3M7GA 4B9XA 1JE4A 1EOTA 1PTOC 2HDLA 1EY6A 3QG1A 1EWCA 1MSHA 1GUGA 1LT6D 1XTCD 4A3BB 2R7ZB 3HKZB 5EBCA 4IN3A 5E3FA 4TQUS 1RJTA 3T53B 3V2TA 1D1IA 2FMMA 4E6IA 2WIIB 1PLFA 3J81E 4KY7A 3CHBD 3TP6A 4MIUA 1LTBD 2RDHA 3OWEB 4BA1I 1TKWB 1A2TA 3C2PA 2NN6H 4P2CB 2PCFB 4V190 2WV6D 1PZID 2F0SA 1TU2B 3S9WA 1T5EA 2EDGA 2F0OA 3Q6SA 3Q24A 5FO8B 4QMGA 4DXFA 1EIHA 5JPMC 3S16B 3J7AF 5CMDA 1NUCA 4IURA 2N88A 4IUQA 3PO3B 2L0CA 1I4GA 5KGUA 5KRUA 4DXGA 4LJZC 2VB3X 1DXMA 1H9RA 2VNUD 2NWGA 2RQXA 4RGNA 4WFN3 3QJYA 1QNUA 4A3EB 3A56A 3W3AA 3V05A 4BY1B 2Z8LA 5KYLA 3S1MB 5E4WC 1A2UA 4FF3A 1U4LA 3HOWB 1CT1D 3T51B 4HSVA 1A3UA 1OXUA 1DYQA 2BDNA 1LTTD 4NMZA 3OW7A 3DXJC 1TVXA 5CV6A 3LWEA 2XWBB 1O7LA 3K5OA 5ELFA 3KK7A 1WTXA 2F03A 1BDOA 3H3VC 5I9OA 4XQNA 1SYCA 4BBRB 5DEHA 1KLUD 4HN7A 4YIJA 4IUTA 3J7YW 2YU9B 4F87A 3FPUB 1EEFD 1AFPA 2F0VA 5BN4A 3D8GA 3HZXA 1B3AA 4XDXA 5CC4A 1JWUD 1KAAA 3TDQA 5C5LA 1ESRA 3NP8A 3NTHA 3I70A 4HCSA 3VYUA 1BCPF 2ZT9C 5CR3A 3I4NB 5NUCA 4HR7B 2BDOA 1SMYD 3R8BA 2HCCA 1TWGB 1EY8A 3GTGB 2E76C 2F3WA 4RGTA 4CJ0B 1F2ZA 4A3DB 1ZYRC 3GTOB 3TZDA 2Z4HA 3P7JA 1HQMC 2QCPX 4DAVA 4RHSA 1HCZA 2EJFC 1A15A 1Q3LA 3G7LA 4CJ1B 1XWEA 1LT3D 4C3IG 4K8IA 5LHY1 5EBDA 4FF2A 1II3A 3MEHA 3I8ZA 5I2YA 1WCMB 4F8MA 3DWQA 4QCLA 1X3QA 4BWGB 4G7ZC 4NDXA 4C3HG 1H9SA 1I4HA 3E6ZX 4BS9A 1NAPA 3QIAA 2E75C 2NVXB 3ND9A 1VDZA 4RWSC 2QILA 1HPCA 4DNRB 1H9MA 3DMUA 4K5XA 5IGBA 2L1BA 1O7ZA 4OO1H 3H09A 2IL8A 3Q23A 4C1NI 1RODA 3NPPA 3TMEA 1QB5D 1STBA 4Y7NB 1DOLA 1EFID 4K6DA 5J1ZA 1WTVA 2PPBC 1HUNA 4ID6A 1VMPA 3L9AX 3RUZA 5DM63 1SYFA 2JYOA 2IW3A 1D6EC 3C1FA 1PZKD 3KLSA 3DWAA 2J7ZA 1JICA 1A3TA 4EVOA 1LTGD 1LACA 2VXWA 4KD3A 2EYHA 3WOEA 2LS01 5ISRA 4OIKA 3KBXA 4ZKBB 1CTMA 4ILWA 1KDBA 2KQ3A 5E4XA 1PFNA 3D6WA 1SBBB 2J0TD 1GJXA 4DU9A 2TSSA 1LABA 1R4PB 3SK6A 1WVLA 2QEJC 5JEAJ 2F0EA 1H9JA 2IPKD 2PW7A 2MGSA 4UAIA 1TS3A 4EQPA 5FLXE 4ME5A 1JORA 4L6TB 1BQQT 5IGGA 2EXZA 2F0NA 1F9QA 4LK1C 4QF4A 3Q22A 2LY7A 2L12A 1SNOA 4IQZA 3BZDB 3GTQB 5A2QL 4DAPA 2F0PA 1SNQA 4XYOA 1F2MA 3IL8A 1AP0A 1EY0A 1ML0D 2OXPA 4DFAA 1STHA 1UUPA 2AQ1B 2NTTA 2O4XA 3U9SA 1Q8IA 2E2IB 2PZTA 2RBMA 2F1MA 5A2QE 3S14B 3RZOB 4PMWA 1GUTA 5FK9C 1QWYA 2B2TA 1EY9A 2X69A 4PV1C 4WJWA 4XIGS 1C8CA 4DGZA 3WDNA 1ET6A 3S1NB 5C6AA 2ID0A 2Q8RE 1ENCA 3GD7A 1K8OA 2K5WA 3VYRA 1MGSA 2PQEA 3QWNA 2OT2A 1GUOA 4ZK9B 5EKIA 5KNBA 3A54A 1G2TA 5I6YA 3KF8A 4A3FB 1TY2A 1Y1WB 3OIPA 1GXDC 4FO2A 1V43A 2EY6A 3N52A 1LTID 3G6JB 2DY7A 1W6KA 1SSOA 2D62A 1ESFA 1MD2D 1KDCA 3DEOA 1BOSA 3P1HA 4A3JB 3AMUA 2OEOA 4I65A 3UI2A 4ZRZA 2AUKA 1EQVA 4FVMA 5C4HA 4C3IB 3PIP3 5DAUA 5CV4A 3D4DA 2BA0A 1F2LA 2A6EC 4DN4M 1OO9B 5KNCA 2B2TC 3I3CA 3E5SA 1C4QA 1EY7A 2K01A 5JEAG 1GUWA 5CYUA 3FEWX 1Y8NB 3GTMB 3MXUA 1PMRA 3EFXD 1LT4D 1XYIA 2MP1A 5HURA 3DWPA 4WRDA 2SNMA 1R9TB 1TWFB 4OGQC 1UAPA 1ZXTA 1V1OA 3CQZB 2A73B 2HCIA 3FMCA 3GTKB 3BDOA 3NQIA 2BE5C 5CGKA 4HMIA 2J4XA 1QCBD 4R8IA 3PUYA 3PIO3 4RGMA 5K36G 1SNCA 5COYA 1IYUA 3HOZB 1EL0A 2ZXPA 5M9OA 1S5CD 3T4AC 3URYA 2SEBD 1RDPD 2EYJA 2IX1A 1WTOA 3I73A 5C0XJ 2KECA 1LV9A 5IGFA 1Z7TA 4Q5VA 4KKTA 2X6LA 1NR4A 2M9VA 2XVSA 1SE4A 3GQBA 1WD1A 3SVMA 2PW5A 2B2YC 1EY4A 3FRPB 3S2DB 4DK0A 5EKKA 3NWSA 1M8AA 5JOBA 3HOUB 2KCNA 4EQNA 2G9DA 4TKOB 2K28A 1IHZA 2JE6I 4R8NA 3K5LA 4KI0A 2R61A 3NBHA 1PTOH 4KN4C 4KTAA 4KJOA 3K0YA 1G8ZD 1RTOA 4JK1C 3VA5A 2M2LA 1B4OA 3PMFA 2RKSA 5ELEA 3NBIA 3SK5A 2O5IC 1D5XC 2BOSA 2F3VA 4KN7C 4A3GB 1BO0A 3K5MA 1NCVA 2XRQD 2B8FA 2WP8J 5JVG3 2Z1CA 2EPBA 3MTSA 3M7NA 1Q12A 5CBAE 2KA7A 1LLRD 5IOCA 4IUPA 5EJWA 3EJIA 3D4WA 3ITPA 3MAQA 4RFBA 4A3IB 3VR2A 3QOJA 5M3MB 3K6OA 1LTAD 4JBWA 1JC7A 1I3QB 1PDQA 2RA4A 4NP5A 3MWYW 1ENFA 2KJXA 1LTSD 5DM73 1TWCB 2K03A 3DM1A 5IIFA 1HFGA 3CU7A 1EYCA 4H0LC 1G6ZA 4XQJA 4IFDJ 1TWHB 4MN3A 2WKDA 3H91A 1FYCA 4FXGC 1L0XB 4C3JB 5FO7B 4QUCA 4BA2I 4MHEA 3BVGA 4G57A 1SNDA 4XT1B 2Y0SB 5A35A 4IZ8A 4TSSA 4K8JA 4DA2A 2D5DA 1Y8PB 4KV6A 3BYTB 4X3KA 2B2VA 3PV0A 2MHVA 1X3PA 4RCNA 3CKIB 5JAVA 1RTNA 2K5QA 3IKJA 2O5JC 3VR6A 1QG7A 2A68D 1B1ZA 1FNWA 5G3LF 5C0XG 3SK8A 5EPKA 5IGEA 3AU7A 1Q1BA 2KHSA 3J80L 4F7XA 3BG3A 2R92B 3NK9A 2FFKB 3I91A 1I4PA 2JEAI 2EOTA 2KVMA 5IGDA 5C3EB 2ICEC 3GTLB 5T1GA 1EY5A 3TP8A 3HGBA 4QUFA 4IUVA 1SYEA 3GO5A 3MA2B 3MXGA 1S4ZA 1OXVA 3K7AB 2WB1B 5ELCA 1PRTF 2F0HA 2I07B 1BCPD 3FVQA 5EGTA 5G3LD 1I4RA 4KJNA 2K05A 1BF4A 4WORA 3J7AV 2R93B 3QOLA 4G7HC 4J1MA 1E2WA 1C48A 4K2KA 1SFOB 4L8JA 3R2IA 2K5DA 1CK1A 4Q0FA 4C1NK 1LO5D 5M5YB 1IYVA 1KABA 4KD4A 2NTSA 1V1PA 2WACA 3S1RB 1HQRD 1DJRD 2EY5A 1F9RA 3VR4A 2A68C 2E2HB 5I6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQJ A;  4G4K A;  4XQN A;  4CBV A;  4XYQ A;  4XQQ A;  4XYO A;  3BS1 A;  4XXE A; 
#chains in the Genus database with same CATH topology
 2CH4 A;  3OSO A;  4LFB Q;  2E2I H;  4KHP L;  1XJV A;  1JQY D;  5J22 A;  4NW2 A;  3ND8 A;  1SMY C;  2FHT A;  1SNM A;  2EY1 A;  2H1E A;  1KLG D;  5JJI A;  5HGQ A;  3NTI A;  3NTK A;  1ICF B;  1HR0 L;  1QVF A;  1SJH D;  3O13 A;  1Q82 C;  1G2S A;  4A93 H;  5LL6 X;  2MUY A;  1D8L A;  1HA5 A;  5D3I B;  2Q8T A;  4FP5 D;  4M1U B;  2L5T A;  2XN9 C;  4IFD G;  1GM5 A;  3HOZ G;  1GO3 E;  2DN8 A;  1BBX C;  3S1N H;  1NMG A;  3MC0 B;  4BBS G;  3FPP A;  4J6H A;  4DAY A;  5C3X A;  4NXM L;  3OMC A;  1I6V C;  3OWF A;  3UE0 A;  4A3L H;  1X9N A;  1A63 A;  1SE3 A;  1U9R A;  3IAY A;  1Y1V G;  4JI1 L;  3HOY H;  4P72 A;  1F9S A;  4FNF A;  1HTL D;  4DNT B;  4X62 Q;  2KCC A;  5D14 A;  2DJF C;  1QNK A;  4ULL A;  3SE0 A;  1Y14 B;  4A3F H;  1E7Z A;  1K0S A;  1Y1W H;  4KHZ A;  5M5X H;  3GTP B;  1PYW D;  1QJO A;  3KLS X;  3I2Z A;  1UE1 A;  3HEJ A;  4KHV A;  5KIX A;  5C0X I;  1HNX Q;  3BVZ A;  3CMA A;  1MBY A;  1RF2 D;  3HP3 A;  3H0G B;  4DR1 Q;  4YWM A;  1CM9 A;  3ERS X;  4BY7 B;  3WWV A;  4GNX A;  4JPB W;  1U4M A;  2NVT H;  4GZY C;  2DJG C;  1SRO A;  3HS0 C;  3HOU G;  3BZK A;  1E0B A;  3AB9 A;  2F0G A;  4J8Q A;  2IX3 A;  2CVR A;  4A3J H;  4HJ5 A;  1P16 A;  4DUY Q;  3NBH B;  2OCE A;  5FOB B;  1KHI A;  2NVY H;  1Q7Y C;  2RSN A;  3VYT A;  4B9W A;  1EQT A;  1SE8 A;  3PUX A;  4QIW B;  3NUC A;  1CA6 A;  2K52 A;  1QVC A;  3K58 A;  4KY6 A;  3DHQ A;  5LL6 S;  3B6Y A;  4C3I H;  1SE2 A;  3MVV A;  3K81 C;  1LTR D;  4UY8 C;  1ONL A;  5JJK A;  2XWJ B;  3EQL C;  5K5P A;  2YTV A;  3F2C A;  1ILP A;  1RHP A;  4RA8 A;  2BH8 A;  2HT1 A;  1UE6 A;  1X56 A;  4C56 C;  4A3G G;  4X66 L;  1PFB A;  4JV5 Q;  2ZXR A;  4C3H H;  2F0F A;  3I4L A;  1CKN B;  2KED A;  2QKI C;  1K83 B;  3W1G A;  1HUM A;  2DNC A;  5EAY A;  1WYD A;  1HR0 W;  2FIN B;  2PQA B;  3BYY B;  4YY3 Q;  2IWH A;  2JA5 B;  1VF7 A;  2EYF A;  3T1H L;  1W6J A;  1STG A;  4X64 L;  2NVQ H;  4B3S L;  4R9W A;  3K5N A;  5F2D A;  3K59 A;  3RN2 A;  2EE1 A;  2JA7 H;  3GTM H;  2F52 A;  3A8J E;  1T5X D;  4Z9C B;  5I4D A;  1Q1E A;  1O80 A;  1U5K A;  4A3I G;  5M3M G;  1B9N A;  3UDF A;  4KKS A;  1BKB A;  1CZW A;  3OTO Q;  1X6O A;  2QDB A;  1FGU A;  5AJ3 Q;  3GTJ H;  1P8L A;  3TS0 A;  2HIX A;  4IPG A;  4DK1 A;  2L11 A;  3S17 B;  4CJ2 C;  1RCV D;  4X6A H;  4X65 Q;  2K4K A;  2I46 A;  2F4I A;  2K33 A;  3A5Z B;  1AZP A;  1IW7 D;  1CQV A;  1EWI A;  2IX0 A;  5GAE C;  1TS4 A;  1I4X A;  1JOK A;  1IKM A;  3RLN A;  1E2V A;  1PYS B;  3C46 A;  4JOI C;  1PTO F;  2L55 A;  4LUO A;  2JA8 B;  4C3J G;  4ODG A;  1R4Q B;  4RKL A;  2R7F A;  4IFD I;  2DNE A;  5IT9 L;  5IP7 H;  5J3B A;  3S2H B;  1N32 L;  1J9O A;  1YNN D;  2GA4 B;  5BN5 A;  4RH6 A;  4XQQ A;  4IUU A;  1UNS A;  2PZU A;  3R93 A;  3TP7 A;  3CF5 A;  5LMN W;  2KHI A;  1DD2 A;  3CRL C;  1A8V A;  4OWW B;  3SK4 A;  4JI5 Q;  2C9O A;  1HJP A;  3D3R A;  1JOQ A;  2NN6 G;  3J81 j;  2D9U A;  3BDL A;  4CDF C;  2UUC Q;  4FF4 A;  4ZYS A;  1HRJ A;  4DV5 L;  1PFM A;  3VR3 A;  5FLM H;  1FJG Q;  1X55 A;  4IUN A;  5C4X G;  2F0L A;  4QB4 A;  2A74 C;  4RGO S;  1NY4 A;  2HUG A;  2OQK A;  3S2D H;  2XIW A;  3CP0 A;  2NZO A;  3H94 A;  2KCT A;  1CZG A;  2R92 G;  5D3D A;  4C2M B;  4LWC A;  5GAD C;  3LX0 A;  3M85 A;  2K1B A;  1A3V A;  2AHO B;  2BCO A;  2JEB I;  2Y0S E;  3T1Y Q;  3QB3 A;  3I4M B;  2XRS D;  3PO3 H;  2I5L X;  3M4P A;  5D65 A;  3W5O A;  1VQK A;  1FR3 A;  1TQO A;  2F0K A;  3LWU A;  1A6X A;  2WFW A;  2K5H A;  3MXP A;  3BVM A;  1BCP B;  1BXT A;  1FGB D;  5FO9 B;  3BDC A;  1CI3 M;  4DR2 L;  4JI6 L;  4DV4 Q;  1E3P A;  2WB1 G;  2PZW A;  4LF6 Q;  4HAE A;  2AUJ D;  3D4R A;  4O1N A;  4HIK A;  1JR0 D;  1NR2 A;  1O7I A;  2A5H A;  4DR4 L;  2ZXO A;  4A3E H;  3L0O A;  4DR6 Q;  1MI2 A;  2D2C C;  4BY1 H;  1AEX A;  1DZ1 A;  1SEB D;  3MZ5 A;  3V96 A;  2R93 G;  2PYK A;  1H9S B;  3TZU A;  2SDF A;  4DF7 A;  3FKI G;  1B7Y B;  3J80 c;  1ASZ A;  3S1M H;  2RHS B;  1YNN C;  1FD7 D;  2CHB D;  4P71 A;  1FNV A;  5HGT A;  5EPL A;  4XXE A;  2F0D A;  4XTC S;  4P73 A;  4FXK C;  4K0K L;  3A8I E;  1I6H B;  5T1I A;  1CA5 A;  4TRD A;  3SR1 A;  3OIQ A;  1O7Y A;  1V1P B;  4LF5 Q;  3UDI A;  4BXX H;  1I3Q H;  1GHK A;  4DR7 Q;  4BBS B;  2EYM A;  2WB1 E;  1EEI D;  5E1F A;  3EBE A;  1VQF A;  3DEP A;  4H02 A;  1F77 A;  2F0W A;  3S15 B;  4JI4 Q;  3PF5 A;  2KUM A;  1UEA B;  1TWH H;  1Y1V B;  3NXW A;  4UDU C;  1QUQ A;  2EZV A;  2EYL A;  3A7L A;  3PUZ A;  1QOH A;  3J81 L;  4KHP Q;  4DR3 Q;  2LFN A;  4X3S A;  3L3O C;  4KMU C;  3GP7 A;  3PUV A;  1XMO L;  4YCU A;  4LF9 Q;  3Q0A A;  1KAW A;  1PXU A;  1HR0 Q;  4N9T A;  1F2Y A;  4FF1 A;  4DAY B;  2ES2 A;  3JC6 6;  2YU9 H;  2F4V L;  1TWA B;  2ZJR A;  1TS2 A;  2Z6K A;  4UP8 A;  1SDF A;  3K57 A;  2LKV A;  2MJ8 A;  1VQO A;  1YJ9 A;  4B3M Q;  4U67 3;  1HHV A;  2PI2 A;  4N9P A;  1EQQ A;  1VQ6 A;  1VQB A;  1OXX K;  1VQM A;  1ILQ A;  2L15 A;  4X3U A;  4R4I A;  4AH6 A;  3EIV A;  1LUZ A;  4B3R Q;  1JJC B;  4ZUI A;  2HIV A;  4GKK L;  2NN6 I;  1CQF A;  2AQ3 B;  1J6Q A;  5BN3 A;  2YV5 A;  4HJA A;  3WOF A;  2YTY A;  3NHH A;  3CAM A;  2Q2I A;  4HIO A;  3N6R A;  4S3S A;  4ZLT F;  1JCK B;  4RCO A;  5EKL A;  3CC2 A;  2EJG C;  4GNX B;  3H0G G;  3IFD A;  2F0U A;  4BY7 G;  2K75 A;  1WTQ A;  2F0J A;  1F9P A;  2O2L D;  1XMQ L;  1B50 A;  3GTG H;  1SMX A;  3VR5 A;  1EZ8 A;  3HOV B;  2M00 A;  4A3D H;  3UE1 A;  3E9H A;  2E8G A;  3GTO H;  5C3E H;  3GTL H;  2G9H D;  1VMC A;  1Y8O B;  4A3K G;  1JE5 A;  3DM3 A;  3OMG A;  1AN8 A;  4PNY A;  2CW0 D;  3R3O A;  5JEA H;  4M8A A;  4A3M G;  2OTJ A;  5LMN Q;  3T13 A;  4JG2 A;  4EQO A;  3K7A H;  4YCV A;  4DR5 Q;  5IGC A;  1K8M A;  1N34 Q;  1WJJ A;  3PUW A;  5C44 G;  2D0O A;  2E2D C;  1B3Q A;  5ELD A;  1KRT A;  3A7A B;  1YI2 A;  1WCM H;  5KND A;  2B3G A;  1PZJ D;  1TS5 A;  4DV1 L;  5JVH 3;  3EVQ A;  3RZD B;  1S5F D;  2Z9H A;  1D5Z C;  4DV0 L;  3P20 A;  2CWA A;  3C1E A;  3VA7 A;  5IP9 G;  4X66 Q;  2K04 A;  1EYD A;  1WTW A;  2NVX H;  4J15 A;  4CHT B;  1ZYR D;  1VCI A;  5I9P A;  2UXD L;  1JB3 A;  5C4J B;  5M5Y H;  1VF5 C;  3FHW A;  1MIU A;  1Q90 A;  4DV6 Q;  1DCZ A;  3HOX B;  2C5C A;  5K36 H;  4OO1 G;  4AQY Q;  3C3L A;  4QIW E;  3S1R H;  1GUN A;  2NBF A;  3CCJ A;  2Q8I B;  3VYS A;  2E2H H;  4QY7 A;  1L0Y B;  4AYB B;  1WTR A;  3ERQ A;  5EPJ A;  3MXN A;  4OHJ A;  4QJF A;  1XXG A;  3S1Q B;  5COR A;  1KXL A;  2B39 A;  2VS1 A;  4U68 A;  1DOK A;  1XNR L;  2B63 B;  1HXY D;  1VQC A;  3EA6 A;  1IYJ B;  4YHH L;  4JI0 Q;  4LFC Q;  4CDE C;  3G6E A;  2RDG A;  4CKE A;  2HQE A;  3IFT A;  2JA8 G;  3PO2 G;  4KY5 A;  1N36 L;  1QZH A;  4R4O A;  2A6H D;  2RSO A;  4HTH A;  4QGU A;  2CW0 C;  1EQR A;  3W2D A;  5C4X B;  2CWP A;  1IKL A;  4LF8 L;  1S5E D;  1JB7 A;  1EIG A;  1E2Z A;  1L0W A;  1N32 Q;  3I56 A;  2EY2 A;  1HZA A;  1CHQ D;  4IO9 A;  1TII D;  2ENB A;  1PFS A;  1Q8K A;  4JI3 L;  2AWN A;  3GTP H;  1PTO B;  2VQE Q;  3J80 E;  3NE5 B;  3ZYY X;  3KYH C;  2UXC L;  2K32 A;  3U9O A;  4K14 A;  5IY0 A;  3TQY A;  5CV7 A;  1KNA A;  1I50 B;  3SXH A;  5M5W B;  4YWK A;  3JAM L;  3D31 A;  1S5D D;  3CCM A;  2LSS A;  2JA6 B;  2UU9 L;  4JW0 A;  5EQ0 A;  2BH2 A;  3OOC A;  5LMU L;  1JWS D;  3X3M A;  1U4P A;  1TXY A;  4ZKC B;  2ATW A;  2SNS A;  1B44 D;  1HZ9 A;  5IT9 c;  1SNP A;  1VQH A;  3JAM E;  1NMF A;  2DY8 A;  3I4M G;  2K7V A;  4ZAI A;  1D2B A;  1TT2 A;  3HG9 A;  3FKI B;  1VQP A;  3M4Y A;  2KBN A;  1YNJ D;  4GKJ Q;  2PMZ B;  5JJZ A;  5IYC H;  4HMJ A;  2WAQ G;  1KDA A;  2PO4 A;  2F0M A;  2YYZ A;  5C4Z A;  4PMC A;  1EZ6 A;  3H6M A;  1STY A;  3NQT A;  2B2V C;  5DNF A;  4KK7 A;  2K6A A;  4H13 C;  2VUM B;  3GTQ H;  3L7Z C;  4OX9 L;  1KQS A;  3R2T A;  1PRT D;  1STA A;  4H44 C;  3A8K E;  2EYO A;  2ZM6 Q;  1IBL Q;  1K83 H;  1PH7 A;  1BBW A;  2A6H C;  1KNE A;  2JA5 H;  1EWH A;  4NKL A;  2KEE A;  2K14 A;  1HTP A;  5J39 A;  4FDB A;  1V8Q A;  2D0P A;  2ZTE A;  3CCU A;  4DV7 Q;  3S14 H;  2BA1 A;  1B2T A;  3GV3 A;  4CGY B;  4X3T A;  3RZO H;  1BUV T;  1CUK A;  3K0X A;  2UXB L;  3A74 A;  4P74 A;  1WTP A;  4OO1 I;  1SYD A;  1VS0 A;  2E74 C;  3ERO A;  1ZEQ X;  4ZQ3 A;  1OTC A;  4RAU C;  3OPO A;  3CCE A;  1ZKO A;  4DV3 Q;  5CBE E;  1DON A;  1J5E Q;  1QUQ B;  1RKN A;  2AMC B;  1UE7 A;  1U4R A;  4V0B A;  3RLF A;  3ONA B;  4A3B G;  2R7Z G;  2E2J B;  5C3W A;  4DUZ Q;  4JYA L;  1BCP C;  2IT1 A;  4OL7 A;  1KTK A;  2V4D A;  1CKM A;  4FXD A;  2ZJQ A;  1Z9F A;  4K5W A;  2IJ0 A;  4A75 A;  2MO0 A;  4LF7 L;  3MFY A;  4H7B A;  2HDM A;  5C0X H;  1D1K A;  2CQA A;  4JI7 Q;  2L4N A;  1YNJ C;  1CFM A;  1X3G A;  4RKB A;  4ABN A;  1K73 C;  1TY0 A;  2EJM A;  1YIJ A;  1S72 A;  2A69 D;  1IBK Q;  1CHP D;  4IAL A;  1HFN A;  1DOM A;  2EVB A;  1DM0 B;  3T16 A;  5IWA Q;  3KUP A;  4FYD A;  1CKO A;  1JWM D;  2LMC B;  3DLL A;  1PVO A;  1JJG A;  3A5U A;  4A3K B;  3SHL A;  1STN A;  2OF1 A;  1PRT C;  2EQS A;  4A3M B;  1UE5 A;  1ICW A;  2N55 A;  3J7Z C;  5C5M A;  5KYI A;  2A19 A;  2Q2U A;  2FMC A;  4K5V A;  1QE6 A;  1E1T A;  1WFQ A;  3J81 c;  4LMQ D;  1G29 1;  2WKC A;  3M9B A;  5IOD A;  5FLX L;  1EU4 A;  5CV5 A;  2XNA C;  3M4O B;  3NWT A;  5C44 B;  3KLR A;  4YCW A;  3OHX C;  1FL0 A;  1JOO A;  2NZ1 D;  1VQL A;  3T56 B;  3M3Y B;  3SEB A;  2QF7 A;  3D6C A;  1B70 B;  5CV8 A;  1WOC A;  3CW2 C;  3HOV G;  1VQA A;  4B3T Q;  1TR5 A;  4OON A;  1C0A A;  4GN5 A;  4NXN Q;  2NB0 A;  1Y69 U;  4XYQ A;  1HNW L;  4EGV A;  1VQ5 A;  4I7A A;  3K80 C;  4PMB A;  2UUA Q;  3ULL A;  2RDF A;  2R6G A;  1UWV A;  3RMH A;  5M3F B;  1EOV A;  1MSG A;  3X3N A;  2ICI A;  2N8N A;  4WJ3 M;  1A0I A;  2B2W A;  5AFW A;  3BS1 A;  3NSW A;  4CKB A;  1BNZ A;  1S5B D;  2JXM B;  1AW7 A;  2F0I A;  5KEE A;  1M4V A;  1Z6H A;  2B2U A;  1EYA A;  1RL2 A;  1K0R A;  1R9T H;  1TWF H;  4APV A;  1SJE D;  1QIL A;  4ME3 A;  4B08 A;  3CQZ H;  3CXC A;  2AQ2 B;  5ELO A;  4G7O C;  3LNN A;  3BU2 A;  3TBI B;  3HOW G;  1EU3 A;  3GTK H;  3P75 A;  2TMP A;  4K6L A;  3ER0 A;  2B29 A;  2P5Z X;  1V9P A;  1ET9 A;  1QZG A;  2A69 C;  1YHB A;  2A6E D;  3MHB A;  4A93 B;  1SAP A;  1AZQ A;  1B53 A;  2WIN B;  1GHJ A;  2B8G A;  1S3O A;  4GS3 A;  1ENA A;  4GNX C;  2NYZ D;  1OXS C;  4YWL A;  3RD4 A;  4MZ9 A;  3HOX G;  2CH4 W;  3DUZ A;  3PO2 B;  1YVC A;  4IFD H;  2XSC A;  1HA6 A;  1HNZ L;  3HOZ H;  3TSS A;  1AE2 A;  4IOC A;  1YJN A;  4ZCK A;  3A55 A;  1XX8 A;  3TP5 A;  1J8I A;  3MXN B;  2K5N A;  3I72 A;  1SYB A;  1JMC A;  4UP7 A;  1Z47 A;  4AYB G;  1BR9 A;  2Z6B A;  3S15 H;  4HCE A;  1CSP A;  4L63 B;  1QVG A;  2JSO A;  3HOY B;  2KCM A;  1Y1V H;  1NSN S;  2Z4I A;  1KC8 C;  2IHF A;  4LFA L;  5HY6 A;  4DV2 L;  4CBV A;  2JP1 A;  5IT9 E;  1GOZ A;  3L2P A;  5GRO A;  2MPM A;  2B63 G;  1GUS A;  4BBR G;  4RG1 A;  5M5X B;  1IBM L;  4R4C A;  3MFG A;  3GV6 A;  5JPN C;  2OTL A;  1XNR Q;  1SXT A;  2KOL A;  4F88 A;  5FJ8 G;  2X6G A;  2BE5 D;  1PV4 A;  4KKU A;  1TWA H;  1G6P A;  4IJH A;  4KLK A;  2F0Q A;  1PTO D;  1I4Q A;  3F8T A;  3I55 A;  2SOB A;  1XNQ Q;  2NVT B;  4ZUJ A;  4GLA C;  3QO2 A;  3CCS A;  5FKA C;  4AIM A;  3HOU H;  1H9K A;  2LXJ A;  4G4K A;  1STE A;  1SYG A;  1O78 A;  1N33 L;  3E0J A;  1XPU A;  1LT5 D;  2NVY B;  2B2W C;  3PQI A;  3F2B A;  2VQF Q;  4AYB E;  2ZJP A;  3G4S A;  1V1Q A;  5I2X A;  2NZH A;  2H4O A;  2VB2 X;  3A0J A;  4XT3 B;  3U4V A;  2B2U C;  2E5L L;  3I4N G;  2WAQ B;  3CME A;  4JI8 Q;  1RD9 D;  1VQG A;  4JI2 L;  4HID A;  1RIP A;  4HSP A;  2JA6 G;  2F0T A;  4OIJ A;  1X32 A;  4RHR A;  4LAA A;  4EQ5 A;  1G91 A;  5GQO A;  1IW7 C;  3F2U A;  3BJU A;  1PH3 A;  1C7Y A;  4A3D G;  1W3S A;  3CRK C;  1I94 L;  4A3G H;  4C3H B;  1B9M A;  2HHH Q;  4ALP A;  4I7Z C;  5LMU Q;  2B2Y A;  3TS2 A;  2EYP A;  1WD0 A;  4PQX A;  5TSS A;  2CQO A;  4IPH A;  2RVL A;  3KBG A;  2NVQ B;  4K2L A;  2JQO A;  3TN2 A;  4CKC A;  2JA7 B;  1HZC A;  3U4Z A;  2N49 A;  2R3Z A;  4HED A;  2HQL A;  2GN5 A;  3MEF A;  4LFB L;  1PRT B;  4DPG A;  1D5M C;  3SDZ A;  4A3I H;  5M3M H;  1FNU A;  1EYG A;  1K3B C;  5CV9 A;  4O42 A;  1K8G A;  2FJ2 A;  3I90 A;  1IL8 A;  5ELB A;  3GTJ B;  2VUM G;  2AWO A;  3OYY A;  1OXT A;  3FDT A;  3JAM c;  3H15 A;  3HRZ C;  2NUC A;  4OEL B;  2L9H A;  1B8A A;  2V1C C;  2PNR C;  1TWC H;  3M7G A;  1X54 A;  4B9X A;  1NE3 A;  1JE4 A;  4LW1 A;  1EOT A;  1PTO C;  2HDL A;  1EY6 A;  3QG1 A;  1EWC A;  1MSH A;  1GUG A;  1LT6 D;  1XTC D;  4NB3 A;  5JJL A;  4A3B B;  2R7Z B;  3HKZ B;  5EBC A;  5C4J H;  1E1O A;  1YZ6 A;  4WJ4 A;  3AYH B;  4IN3 A;  5E3F A;  3CD6 A;  1MKH A;  4C3J H;  3KLW A;  2R7D A;  4O2D A;  4TQU S;  1RJT A;  2PMZ E;  2QW7 A;  3T53 B;  1MJC A;  5ELN A;  3V2T A;  4CDC C;  3AQQ A;  1D1I A;  2FMM A;  5IYD G;  4E6I A;  2WII B;  1PLF A;  3J81 E;  1AH9 A;  4KY7 A;  3CHB D;  3TP6 A;  1HZB A;  4MIU A;  4L5Q A;  1LTB D;  3S1Q H;  2RDH A;  5IYB G;  4DK6 C;  1PHJ A;  1HNX L;  3STB D;  4NXM Q;  3OWE B;  4BA1 I;  4A3C G;  1TKW B;  1A2T A;  4DR1 L;  3C2P A;  2NN6 H;  4P2C B;  2VZA A;  4JI1 Q;  2PCF B;  4V19 0;  2WV6 D;  1PZI D;  4PZ6 A;  2F0S A;  1TU2 B;  5C4X H;  1PYB A;  3S9W A;  1T5E A;  2EDG A;  4DUY L;  2F0O A;  3Q6S A;  3Q24 A;  4LF7 Q;  5FO8 B;  4QMG A;  4DXF A;  1EIH A;  2R92 H;  2JA9 A;  5JPM C;  3S16 B;  3J7A F;  5CMD A;  1NUC A;  4IUR A;  2N88 A;  4POF A;  4IUQ A;  3PO3 B;  2L0C A;  2JJQ A;  1I4G A;  5KGU A;  5KRU A;  4DXG A;  4LJZ C;  3CCL A;  2VB3 X;  1DXM A;  1H9R A;  3ULP A;  2VNU D;  4N8X 1;  2NWG A;  2RQX A;  4RGN A;  4WFN 3;  4JV5 L;  2KEN A;  3ULJ A;  3QJY A;  1QNU A;  4A3E B;  1BBU A;  3A56 A;  3W3A A;  3V05 A;  4BY1 B;  1YIT A;  3OW2 A;  1XPR A;  1K8A C;  2R93 H;  1CKN A;  2Z8L A;  5KYL A;  3S1M B;  5E4W C;  2PI2 E;  1MJE A;  1A2U A;  4FF3 A;  3KDF A;  1VQE A;  1U4L A;  3HOW B;  2RF4 A;  1CT1 D;  3T51 B;  1SFO H;  4HSV A;  1A3U A;  5M3F G;  5AJ3 L;  2Z6K C;  1OXU A;  1DYQ A;  2BDN A;  3T1H Q;  1LTT D;  4NMZ A;  3OW7 A;  3DXJ C;  3STB C;  1TVX A;  4X64 Q;  4X65 L;  2QDL A;  4B3S Q;  4LF4 L;  4DNI A;  5CV6 A;  3G71 A;  5H1S E;  3AFP A;  3LWE A;  2XWB B;  1O7L A;  5FLX c;  3K5O A;  2QA4 A;  5ELF A;  2ZTC A;  3KK7 A;  1T9H A;  1WTX A;  2F03 A;  1BDO A;  1Q86 C;  1CSQ A;  1VQD A;  3H3V C;  5I9O A;  4XQN A;  1SYC A;  4A93 G;  4BBR B;  5DEH A;  1KLU D;  4HN7 A;  3CCR A;  2GVA A;  4YIJ A;  4IUT A;  3J7Y W;  4IOA A;  2YU9 B;  4L5T A;  4F87 A;  1DGS A;  3FPU B;  1XTD A;  1EEF D;  4A76 A;  1AFP A;  2F0V A;  5BN4 A;  4JBM A;  1EUJ A;  3D8G A;  3HZX A;  1B3A A;  4XDX A;  1KL9 A;  5CC4 A;  4JI5 L;  4A3L G;  1GD7 A;  1JWU D;  1KAA A;  3TDQ A;  2UUC L;  4OWT B;  3HOY G;  3Q8D A;  5C5L A;  1ESR A;  1FJG L;  3NP8 A;  3NTH A;  1Q46 A;  3I70 A;  4HCS A;  4A3F G;  3VYU A;  1Y1W G;  1BCP F;  2ZT9 C;  5CR3 A;  3I4N B;  5NUC A;  1IBM Q;  4HR7 B;  2BDO A;  1SMY D;  5GAH C;  3T1Y L;  3R8B A;  2HCC A;  1PH2 A;  1TWG B;  2I5H A;  2F3I A;  3H0G H;  2DUD A;  1SLJ A;  1EY8 A;  3GTG B;  2E76 C;  4BY7 H;  2F3W A;  4RGT A;  4DV5 Q;  1E22 A;  4CJ0 B;  1F2Z A;  4A3D B;  1ZYR C;  3GTO B;  2OQ0 A;  3TZD A;  2CKZ B;  2XGT A;  4A3J G;  3PGZ A;  2Z4H A;  3P7J A;  3SGI A;  1HQM C;  2QCP X;  4DV4 L;  4LF6 L;  4PG3 A;  4A3K H;  4DAV A;  4RHS A;  1ASY A;  1HCZ A;  2EJF C;  5IE8 A;  1A15 A;  4LNQ A;  4L5S A;  1Q3L A;  3G7L A;  4UHV A;  3LGJ A;  4A3M H;  4CJ1 B;  4DR6 L;  3H3V I;  1XWE A;  1LT3 D;  4C3I G;  4K8I A;  5LHY 1;  2Q2T A;  5EBD A;  4FF2 A;  1II3 A;  3MEH A;  3I8Z A;  5C44 H;  5I2Y A;  1WCM B;  4JVZ A;  4F8M A;  3M3Y H;  3DWQ A;  4QCL A;  1X3Q A;  4DR2 Q;  4JI6 Q;  4BWG B;  4G7Z C;  4NDX A;  3ZJY C;  4C3H G;  1H9S A;  1I4H A;  3E6Z X;  4BS9 A;  1M1K C;  4DR4 Q;  1NAP A;  3QIA A;  2E75 C;  4LF5 L;  2NVX B;  1L1O A;  5IP9 H;  3ND9 A;  3PIP A;  4DR7 L;  1SN8 A;  3G48 A;  1VDZ A;  1KD1 C;  2JA7 G;  1JT8 A;  4RWS C;  2QIL A;  1HPC A;  1X3E A;  4DNR B;  1H9M A;  3DMU A;  4K5X A;  2A1A A;  5IGB A;  3J80 i;  2L1B A;  1O7Z A;  1K9M C;  4OO1 H;  4JI4 L;  1S40 A;  1YNX A;  3H09 A;  2IL8 A;  3Q23 A;  4C1N I;  1ROD A;  2WAQ E;  4K0K Q;  2JK8 A;  3NPP A;  4GLV B;  3TME A;  1QB5 D;  5DLQ E;  1STB A;  2FXQ A;  4Y7N B;  1Q81 C;  4DR3 L;  1XPO A;  1DOL A;  1EFI D;  2YTX A;  1NNX A;  3D0F A;  4K6D A;  5J1Z A;  3S17 H;  1WTV A;  4LF9 L;  2PPB C;  3QR8 A;  1HUN A;  1UEB A;  3TRZ A;  4ID6 A;  3JAM i;  1VMP A;  3L9A X;  3KJO A;  3RUZ A;  5DM6 3;  1SYF A;  2JYO A;  3HKS A;  3HKZ G;  1PH6 A;  4OXP A;  4P75 A;  2JA8 H;  4B3M L;  3PO2 H;  2IW3 A;  1D6E C;  3C1F A;  5IP7 G;  1PZK D;  3KLS A;  3DWA A;  2J7Z A;  3E9I A;  1JIC A;  1A3T A;  4EVO A;  1LTG D;  1WTH A;  3S2H H;  3K7U C;  4B3R L;  1XMO Q;  1LAC A;  2VXW A;  4KD3 A;  4HJ9 A;  3IRB A;  2EYH A;  4A4I A;  1SR3 A;  3WOE A;  2F4V Q;  2MQH A;  3PIO A;  2LS0 1;  2H5X A;  5ISR A;  1N9W A;  4OIK A;  3KBX A;  4RMF A;  2C35 B;  4ZKB B;  1CTM A;  2I5M X;  3NEL A;  3E0E A;  4ILW A;  1KDB A;  2KQ3 A;  5E4X A;  5FLM G;  1PFN A;  4GOP A;  3D6W A;  1SBB B;  2MFI A;  2J0T D;  1GJX A;  3AEV A;  3HKZ E;  4JOI A;  4DU9 A;  4GKK Q;  2TSS A;  4GN4 B;  1LAB A;  1R4P B;  3SK6 A;  1WVL A;  2QEJ C;  1L1O C;  5JEA J;  1I5F A;  1SRU A;  2AKW B;  4C2M H;  5LMN L;  2F0E A;  1H9J A;  2IPK D;  2PW7 A;  2MGS A;  4UAI A;  3PO3 G;  4DR5 L;  1TS3 A;  4EQP A;  3I4M H;  2CFM A;  1N34 L;  5FLX E;  3CCV A;  1KRS A;  1XMQ Q;  4ME5 A;  1JOR A;  4L6T B;  1BQQ T;  3UDX A;  5IGG A;  2EXZ A;  2F0N A;  1AE3 A;  3KOJ A;  1F9Q A;  4LK1 C;  4PZ7 A;  4QF4 A;  3Q22 A;  2LY7 A;  2L12 A;  1SNO A;  4IQZ A;  1PH8 A;  1A62 A;  1EIY B;  3BZD B;  4A3E G;  3GTQ B;  5A2Q L;  4DAP A;  2F0P A;  1LYL A;  4BY1 G;  1SNQ A;  4XYO A;  1VQ9 A;  3KFU A;  1F2M A;  3IL8 A;  1AP0 A;  2RHQ B;  1EY0 A;  1ML0 D;  2OXP A;  4DFA A;  1KIX A;  1PH9 A;  1STH A;  1UUP A;  2AQ1 B;  2NTT A;  2O4X A;  3KDF B;  1Q8I A;  3U9S A;  2E2I B;  4DV6 L;  2ALY B;  2PZT A;  2RBM A;  2F1M A;  5A2Q E;  3S14 B;  4AQY L;  3RZO B;  4PMW A;  1GUT A;  4DV1 Q;  2K50 A;  1YJW A;  5FK9 C;  2LXK A;  3KJP A;  4MTN A;  1QWY A;  2B2T A;  4JBJ A;  3F2D A;  3E3X A;  4DV0 Q;  3J7A 5;  1WI5 A;  1I6H H;  4BXX G;  1EY9 A;  2I0Q A;  2X69 A;  3PSI A;  4PV1 C;  4WJW A;  4XIG S;  2RCF A;  1C8C A;  4DGZ A;  3WDN A;  1ET6 A;  5BR8 L;  1EFW A;  3S1N B;  2UXD Q;  5C6A A;  2ID0 A;  2Q8R E;  4BBS H;  2QGQ A;  1ENC A;  3GD7 A;  3RNU A;  4LF4 Q;  1K8O A;  4JI0 L;  2K5W A;  4LFC L;  3VYR A;  1MGS A;  2PQE A;  3QWN A;  2OT2 A;  3FP9 A;  1GUO A;  4ZK9 B;  4GOP C;  5EKI A;  5KNB A;  4A3B H;  2R7Z H;  3A54 A;  1G2T A;  5I6Y A;  3KF6 A;  4LUV A;  3KF8 A;  4TVA B;  4A3F B;  3S24 A;  1TY2 A;  1Y1W B;  4OWX B;  3OIP A;  1GXD C;  1YHQ A;  2Y0S G;  2QEX A;  4FO2 A;  1V43 A;  4YHH Q;  2EY6 A;  4R4Q A;  3N52 A;  3I7F A;  1LTI D;  3G6J B;  1LM0 A;  2DY7 A;  1N36 Q;  1W6K A;  1SSO A;  2VQE L;  2MO1 A;  2JN4 A;  2D62 A;  1ESF A;  2EXD A;  1MD2 D;  1KDC A;  3DEO A;  1BOS A;  3P1H A;  1VQ8 A;  1BVS A;  4LF8 Q;  4A3J B;  3AMU A;  2OEO A;  4I65 A;  3UI2 A;  4ZRZ A;  1U0L A;  1HH2 P;  3NEN A;  1LTL A;  2AUK A;  1IXR A;  1EQV A;  4FVM A;  5C4H A;  4C3I B;  4JI3 Q;  3PIP 3;  4HJ7 A;  5DAU A;  4JBK A;  5CV4 A;  2UXC Q;  3D4D A;  2BA0 A;  1PA6 A;  1F2L A;  3S16 H;  4JCV E;  2A6E C;  4GKJ L;  4DN4 M;  1OO9 B;  3HOV H;  5KNC A;  5C3E G;  2B2T C;  3I3C A;  3E5S A;  2UU9 Q;  1C4Q A;  1EY7 A;  2K01 A;  5JEA G;  3CC4 A;  1GUW A;  5CYU A;  2UUB L;  4L5R C;  3FEW X;  1Y8N B;  1IBL L;  2ZM6 L;  3GTM B;  3K8A A;  1IZ6 A;  1PMR A;  1LT4 D;  3MXU A;  3EFX D;  2XTI A;  1VQN A;  1XYI A;  2MP1 A;  5HUR A;  3DWP A;  4WRD A;  1WCM G;  2SNM A;  4MNO A;  1R9T B;  1TWF B;  4IPD A;  1NBW A;  4DV7 L;  4OGQ C;  1UAP A;  4IPC A;  1ZXT A;  1V1O A;  3CQZ B;  2A73 B;  2HCI A;  1K28 A;  3FMC A;  3RZD H;  1D7Q A;  3GTK B;  3BDO A;  1L1O B;  3NQI A;  3HOW H;  2BE5 C;  3PF4 A;  4OX9 Q;  5CGK A;  4HMI A;  2J4X A;  3NEM A;  2ASB A;  2N3S A;  1QCB D;  1YHA A;  4R8I A;  5GAG C;  1FVI A;  1YEZ A;  5L37 A;  1MHW C;  3PUY A;  3PIO 3;  4RGM A;  5K36 G;  4DV3 L;  1SNC A;  5COY A;  3HOX H;  1J5E L;  1IYU A;  3HOZ B;  3EN2 A;  1EL0 A;  2ZXP A;  5M9O A;  1E24 A;  4DUZ L;  1S5C D;  3T4A C;  3URY A;  2UXB Q;  4X62 L;  1NTG A;  2SEB D;  4JC0 A;  1RDP D;  2EYJ A;  2IX1 A;  3CPW A;  1WTO A;  4UPA A;  3I73 A;  5C0X J;  2KEC A;  4JI7 L;  2B63 H;  4BBR H;  1LV9 A;  3I4O A;  5IGF A;  1IBK L;  1Z7T A;  4Q5V A;  4KKT A;  2X6L A;  3F1Z A;  1NR4 A;  2M9V A;  2XVS A;  1SE4 A;  3GQB A;  5FJ8 H;  2Z0S A;  5IWA L;  1WD1 A;  4EX5 A;  4JYA Q;  3SVM A;  2PW5 A;  1JJ2 A;  2B2Y C;  1EY4 A;  3FRP B;  3S2D B;  4DK0 A;  5EKK A;  3NWS A;  1M8A A;  5JOB A;  2Q2H A;  3HOU B;  2KCN A;  4EQN A;  2G9D A;  4TKO B;  2K28 A;  1GKH A;  1IHZ A;  2JE6 I;  4R8N A;  3K5L A;  4KI0 A;  2OWO A;  2R61 A;  4N8F A;  3NBH A;  1PTO H;  4KN4 C;  4KTA A;  4GOP B;  3I4N H;  4KJO A;  3K0Y A;  1I50 H;  1G8Z D;  4R4T A;  1RTO A;  5M5W H;  4B3T L;  3RR5 A;  1TWG H;  4JK1 C;  2DGY A;  4QL5 A;  2M2L A;  1B4O A;  3PMF A;  3VA5 A;  2JA6 H;  2RKS A;  5ELE A;  3CCQ A;  4GN3 B;  3NBI A;  4NXN L;  3SK5 A;  3U58 A;  2ZTD A;  2O5I C;  1D5X C;  2BOS A;  2F3V A;  4KN7 C;  4A3G B;  2UUA L;  4YY3 L;  1BO0 A;  5E7N A;  3K5M A;  1NCV A;  2XRQ D;  2B8F A;  2WP8 J;  5JVG 3;  3J81 i;  2Z1C A;  2EPB A;  3MTS A;  2GVB A;  3M7N A;  1Q12 A;  3FKI H;  5CBA E;  2PQA A;  5IYC G;  2KA7 A;  1LLR D;  2IHE A;  5IOC A;  4IUP A;  1EIF A;  5EJW A;  1IL2 A;  3EJI A;  3OTO L;  3CPF A;  4Y52 H;  3D4W A;  1N8R C;  3ITP A;  3MAQ A;  4RFB A;  1HNW Q;  4A3I B;  3VR2 A;  3UDG A;  3QOJ A;  5M3M B;  3K6O A;  1LTA D;  1X65 A;  1JC7 A;  1I3Q B;  2RA4 A;  1PDQ A;  4JBW A;  1X3F A;  2VUM H;  3PCO B;  1PH5 A;  4NP5 A;  3MWY W;  1ENF A;  2KJX A;  2PNH A;  1LTS D;  1TWC B;  5DM7 3;  2K03 A;  3DM1 A;  5IIF A;  1HFG A;  3CU7 A;  2JA5 G;  1EYC A;  2MNA A;  4H0L C;  1G6Z A;  1VQ7 A;  4XQJ A;  4IFD J;  1TWH B;  2K5V A;  1VQ4 A;  4CDD C;  4MN3 A;  2WKD A;  3H91 A;  1FYC A;  4FXG C;  4MTK A;  1L0X B;  3TEH B;  5FO7 B;  4C3J B;  2G5D A;  4QUC A;  4BA2 I;  4MHE A;  3BVG A;  4G57 A;  1SND A;  4XT1 B;  2Y0S B;  1K3R A;  4DAM A;  5A35 A;  4IZ8 A;  4TSS A;  1W2B A;  4K8J A;  4DA2 A;  2D5D A;  5IYD H;  1Y8P B;  3AFQ A;  4KV6 A;  4POG A;  4Y7N H;  1C9O A;  2N78 A;  3GDE A;  3BYT B;  4X3K A;  2B2V A;  3PV0 A;  5BR8 Q;  2MHV A;  5IYB H;  1HNZ Q;  1X3P A;  4RCN A;  3CKI B;  5JAV A;  1RTN A;  2K5Q A;  3KF6 B;  4LUZ A;  3IKJ A;  3KF8 B;  2E2J H;  4A3C H;  2O5J C;  3VR6 A;  2RCN A;  1XNQ L;  1QG7 A;  2A68 D;  4LFA Q;  4DV2 Q;  1B1Z A;  1FNW A;  3CC7 A;  4DKA C;  5G3L F;  5C0X G;  3SK8 A;  3W1B A;  5EPK A;  5IGE A;  2VW9 A;  3AU7 A;  4GLX A;  1Q1B A;  4O0A A;  2KHS A;  3J80 L;  4F7X A;  3BG3 A;  2VQF L;  2R92 B;  3NK9 A;  2FFK B;  4DK3 C;  3I91 A;  1I4P A;  2JEA I;  1GVP A;  2EOT A;  2KVM A;  5IGD A;  5C3E B;  2ICE C;  4UP9 A;  4JI8 L;  5T1G A;  3GTL B;  1EY5 A;  1L2F A;  3TP8 A;  3HGB A;  3RLO A;  4QUF A;  4IUV A;  1SYE A;  4HJ8 A;  1G51 A;  3VDY A;  3GO5 A;  3MA2 B;  3MXG A;  1PH4 A;  4QQB X;  1S4Z A;  1H95 A;  1NJI C;  1OXV A;  3H3V H;  1VQI A;  3K7A B;  1N33 Q;  3M4Q A;  2WB1 B;  5ELC A;  2HHH L;  3HFZ B;  1PRT F;  1PH1 A;  3ICE A;  2F0H A;  3U50 C;  2I07 B;  1BCP D;  4IJL A;  3FVQ A;  5EGT A;  5G3L D;  2E5L Q;  3M4O H;  1I4R A;  2VL6 A;  4KJN A;  2K05 A;  1BF4 A;  4JI2 Q;  4WOR A;  3J7A V;  2R93 B;  2VY3 A;  3QOL A;  4G7H C;  4HIM A;  4J1M A;  3RN5 A;  1E2W A;  1C48 A;  4K2K A;  3BZC A;  1SFO B;  4NPS A;  2A8V A;  4L8J A;  1I94 Q;  3R2I A;  2K5D A;  5M3F H;  1CK1 A;  4Q0F A;  1M90 C;  4C1N K;  1LO5 D;  2IY5 B;  2EIF A;  4OEM B;  5M5Y B;  1VQJ A;  1IYV A;  1KAB A;  3TRE A;  2CCZ A;  2UUB Q;  4KD4 A;  2NTS A;  1V1P A;  2HD3 A;  1YBY A;  2WAC A;  3S1R B;  4R1J A;  1HQR D;  1DJR D;  2EY5 A;  4PZ8 A;  1F9R A;  3VR4 A;  2A68 C;  2KHJ A;  2E2H B;  5I6W A; 
#chains in the Genus database with same CATH homology
 3OSO A;  1JQY D;  5J22 A;  4NW2 A;  3ND8 A;  1SMY C;  2FHT A;  1SNM A;  2EY1 A;  2H1E A;  1KLG D;  3NTI A;  3NTK A;  1SJH D;  3O13 A;  1G2S A;  5LL6 X;  2MUY A;  1HA5 A;  5D3I B;  2Q8T A;  4FP5 D;  4M1U B;  2L5T A;  2XN9 C;  4IFD G;  2DN8 A;  1BBX C;  3MC0 B;  3FPP A;  4J6H A;  4DAY A;  5C3X A;  3OMC A;  1I6V C;  3OWF A;  1SE3 A;  1U9R A;  3IAY A;  1F9S A;  4FNF A;  1HTL D;  4DNT B;  2KCC A;  5D14 A;  1QNK A;  4ULL A;  3SE0 A;  4KHZ A;  3GTP B;  1PYW D;  1QJO A;  3KLS X;  4KHV A;  5KIX A;  3HEJ A;  5C0X I;  3BVZ A;  1MBY A;  1RF2 D;  3HP3 A;  3H0G B;  1CM9 A;  4BY7 B;  1U4M A;  4GZY C;  3HS0 C;  1E0B A;  3AB9 A;  2F0G A;  4J8Q A;  2IX3 A;  2CVR A;  5FOB B;  2RSN A;  3VYT A;  4B9W A;  1EQT A;  4QIW B;  3PUX A;  3NUC A;  1CA6 A;  3K58 A;  4KY6 A;  3DHQ A;  5LL6 S;  1SE2 A;  3MVV A;  1LTR D;  1ONL A;  2XWJ B;  3EQL C;  5K5P A;  1ILP A;  1RHP A;  4RA8 A;  4C56 C;  1PFB A;  2ZXR A;  2F0F A;  3I4L A;  2KED A;  2QKI C;  1K83 B;  1HUM A;  2DNC A;  2FIN B;  3BYY B;  2IWH A;  2JA5 B;  1VF7 A;  2EYF A;  1W6J A;  1STG A;  4R9W A;  3K5N A;  5F2D A;  3K59 A;  2EE1 A;  3A8J E;  1T5X D;  4Z9C B;  5I4D A;  1Q1E A;  1O80 A;  1B9N A;  4KKS A;  1CZW A;  2QDB A;  4DK1 A;  2L11 A;  3S17 B;  4CJ2 C;  1RCV D;  2I46 A;  2F4I A;  2K33 A;  1AZP A;  1IW7 D;  1CQV A;  2IX0 A;  1TS4 A;  1I4X A;  1JOK A;  1IKM A;  1E2V A;  3C46 A;  1PTO F;  2L55 A;  2JA8 B;  4C3J G;  4ODG A;  1R4Q B;  4RKL A;  4IFD I;  2DNE A;  5IT9 L;  3S2H B;  1J9O A;  1YNN D;  2GA4 B;  5BN5 A;  4RH6 A;  4XQQ A;  4IUU A;  1UNS A;  2PZU A;  3R93 A;  3TP7 A;  1DD2 A;  3CRL C;  3SK4 A;  2C9O A;  3D3R A;  1JOQ A;  2NN6 G;  2D9U A;  3BDL A;  4FF4 A;  4ZYS A;  1HRJ A;  1PFM A;  3VR3 A;  4IUN A;  2F0L A;  4QB4 A;  2A74 C;  4RGO S;  2HUG A;  2XIW A;  3H94 A;  1CZG A;  5D3D A;  4C2M B;  3LX0 A;  3M85 A;  2K1B A;  1A3V A;  2BCO A;  2JEB I;  3QB3 A;  3I4M B;  2XRS D;  5D65 A;  1FR3 A;  1TQO A;  2F0K A;  3LWU A;  1A6X A;  3MXP A;  3BVM A;  1BCP B;  1BXT A;  1FGB D;  5FO9 B;  3BDC A;  1CI3 M;  2PZW A;  4HAE A;  2AUJ D;  3D4R A;  4O1N A;  1JR0 D;  1NR2 A;  2A5H A;  2ZXO A;  1MI2 A;  2D2C C;  1AEX A;  1DZ1 A;  1SEB D;  3MZ5 A;  3V96 A;  2PYK A;  1H9S B;  3TZU A;  2SDF A;  4DF7 A;  1YNN C;  1FD7 D;  2CHB D;  1FNV A;  5HGT A;  5EPL A;  4XXE A;  4XTC S;  2F0D A;  4FXK C;  3A8I E;  1I6H B;  5T1I A;  1CA5 A;  4TRD A;  3SR1 A;  3OIQ A;  1O7Y A;  1V1P B;  1GHK A;  4BBS B;  2EYM A;  1EEI D;  5E1F A;  3DEP A;  1F77 A;  2F0W A;  3S15 B;  2KUM A;  1UEA B;  1Y1V B;  3NXW A;  4UDU C;  2EZV A;  2EYL A;  3A7L A;  3PUZ A;  1QOH A;  3J81 L;  2LFN A;  4X3S A;  3L3O C;  4KMU C;  3GP7 A;  3PUV A;  3Q0A A;  1PXU A;  4N9T A;  1F2Y A;  4FF1 A;  1TWA B;  1TS2 A;  1SDF A;  3K57 A;  2LKV A;  2MJ8 A;  4U67 3;  1HHV A;  4N9P A;  1OXX K;  1ILQ A;  4X3U A;  4ZUI A;  2NN6 I;  1CQF A;  2AQ3 B;  5BN3 A;  3WOF A;  3NHH A;  3N6R A;  4S3S A;  4ZLT F;  1JCK B;  4RCO A;  5EKL A;  2EJG C;  3IFD A;  2F0U A;  1WTQ A;  2F0J A;  1F9P A;  2O2L D;  1B50 A;  3VR5 A;  1EZ8 A;  3HOV B;  2M00 A;  2G9H D;  1VMC A;  1Y8O B;  3OMG A;  1AN8 A;  4PNY A;  2CW0 D;  3R3O A;  5JEA H;  4M8A A;  3T13 A;  4EQO A;  5IGC A;  1K8M A;  3PUW A;  2E2D C;  5ELD A;  3A7A B;  5KND A;  1PZJ D;  1TS5 A;  5JVH 3;  3EVQ A;  3RZD B;  1S5F D;  1D5Z C;  3P20 A;  3C1E A;  3VA7 A;  2K04 A;  1EYD A;  1WTW A;  4CHT B;  1ZYR D;  1VCI A;  5I9P A;  1JB3 A;  5C4J B;  1VF5 C;  1Q90 A;  1DCZ A;  3HOX B;  2C5C A;  5K36 H;  4OO1 G;  3C3L A;  1GUN A;  2NBF A;  2Q8I B;  3VYS A;  1L0Y B;  4AYB B;  1WTR A;  3ERQ A;  5EPJ A;  3MXN A;  4OHJ A;  1XXG A;  3S1Q B;  5COR A;  2B39 A;  4U68 A;  1DOK A;  2B63 B;  1HXY D;  3EA6 A;  2RDG A;  4CKE A;  2HQE A;  3IFT A;  4KY5 A;  2A6H D;  2RSO A;  4HTH A;  2CW0 C;  3W2D A;  5C4X B;  1IKL A;  1S5E D;  1EIG A;  1E2Z A;  2EY2 A;  1CHQ D;  1TII D;  2ENB A;  2AWN A;  1PTO B;  3J80 E;  3NE5 B;  3ZYY X;  2K32 A;  3U9O A;  4K14 A;  5CV7 A;  1KNA A;  1I50 B;  3SXH A;  5M5W B;  3JAM L;  3D31 A;  1S5D D;  2JA6 B;  5EQ0 A;  3OOC A;  1JWS D;  3X3M A;  1U4P A;  4ZKC B;  2SNS A;  1B44 D;  1SNP A;  3JAM E;  2DY8 A;  2K7V A;  4ZAI A;  1D2B A;  1TT2 A;  3HG9 A;  3FKI B;  3M4Y A;  1YNJ D;  2PMZ B;  5JJZ A;  4HMJ A;  1KDA A;  2PO4 A;  2F0M A;  2YYZ A;  5C4Z A;  4PMC A;  1EZ6 A;  3H6M A;  1STY A;  3NQT A;  2B2V C;  5DNF A;  4KK7 A;  2K6A A;  4H13 C;  2VUM B;  3L7Z C;  3R2T A;  1PRT D;  1STA A;  4H44 C;  3A8K E;  2EYO A;  2A6H C;  1KNE A;  1EWH A;  4NKL A;  2KEE A;  1HTP A;  5J39 A;  1V8Q A;  2BA1 A;  1B2T A;  3GV3 A;  4CGY B;  4X3T A;  1BUV T;  1WTP A;  4OO1 I;  1SYD A;  2E74 C;  3ERO A;  1ZEQ X;  4ZQ3 A;  4RAU C;  3OPO A;  1ZKO A;  5CBE E;  1DON A;  1RKN A;  1U4R A;  4V0B A;  3RLF A;  3ONA B;  2E2J B;  5C3W A;  1BCP C;  2IT1 A;  4OL7 A;  1KTK A;  2V4D A;  4FXD A;  4K5W A;  2IJ0 A;  3MFY A;  4H7B A;  2HDM A;  5C0X H;  1D1K A;  2CQA A;  2L4N A;  1YNJ C;  1CFM A;  4RKB A;  4ABN A;  1TY0 A;  2EJM A;  2A69 D;  1CHP D;  4IAL A;  1HFN A;  1DOM A;  2EVB A;  1DM0 B;  3T16 A;  3KUP A;  4FYD A;  1JWM D;  2LMC B;  4A3K B;  3SHL A;  1STN A;  2OF1 A;  1PRT C;  4A3M B;  1ICW A;  2N55 A;  5C5M A;  5KYI A;  2FMC A;  4K5V A;  1QE6 A;  4LMQ D;  1G29 1;  2WKC A;  5IOD A;  5FLX L;  1EU4 A;  5CV5 A;  2XNA C;  3M4O B;  3NWT A;  5C44 B;  3KLR A;  3OHX C;  1JOO A;  2NZ1 D;  3T56 B;  3M3Y B;  3SEB A;  2QF7 A;  3D6C A;  5CV8 A;  1TR5 A;  2NB0 A;  1Y69 U;  4XYQ A;  4EGV A;  4PMB A;  2RDF A;  2R6G A;  3RMH A;  5M3F B;  1MSG A;  3X3N A;  2ICI A;  3BS1 A;  2B2W A;  5AFW A;  3NSW A;  4CKB A;  1BNZ A;  1S5B D;  2JXM B;  1AW7 A;  2F0I A;  5KEE A;  1M4V A;  1Z6H A;  2B2U A;  1EYA A;  1SJE D;  1QIL A;  4B08 A;  2AQ2 B;  4G7O C;  3LNN A;  3TBI B;  1EU3 A;  3P75 A;  2TMP A;  4K6L A;  1ET9 A;  2A69 C;  2A6E D;  3MHB A;  4A93 B;  1SAP A;  1AZQ A;  1B53 A;  2WIN B;  1GHJ A;  2B8G A;  1ENA A;  2NYZ D;  1OXS C;  3RD4 A;  3DUZ A;  3PO2 B;  4IFD H;  2XSC A;  1HA6 A;  3TSS A;  3A55 A;  1XX8 A;  3TP5 A;  1J8I A;  3I72 A;  1SYB A;  1Z47 A;  1BR9 A;  4HCE A;  4L63 B;  2JSO A;  3HOY B;  1NSN S;  2Z4I A;  4CBV A;  2JP1 A;  5IT9 E;  1GOZ A;  2MPM A;  1GUS A;  5M5X B;  3MFG A;  3GV6 A;  5JPN C;  1SXT A;  2KOL A;  4F88 A;  2X6G A;  2BE5 D;  4KKU A;  2F0Q A;  1PTO D;  1I4Q A;  2SOB A;  2NVT B;  4ZUJ A;  3QO2 A;  5FKA C;  1H9K A;  4G4K A;  1STE A;  1SYG A;  1O78 A;  3E0J A;  1LT5 D;  2NVY B;  2B2W C;  5I2X A;  2H4O A;  2VB2 X;  4XT3 B;  2B2U C;  2WAQ B;  1RD9 D;  4HSP A;  2F0T A;  4OIJ A;  1X32 A;  4RHR A;  4LAA A;  1G91 A;  1IW7 C;  3F2U A;  3CRK C;  4C3H B;  1B9M A;  4I7Z C;  2B2Y A;  2EYP A;  1WD0 A;  4PQX A;  5TSS A;  2RVL A;  3KBG A;  2NVQ B;  4K2L A;  3TN2 A;  4CKC A;  2JA7 B;  2R3Z A;  4HED A;  1PRT B;  1D5M C;  3SDZ A;  1FNU A;  5CV9 A;  4O42 A;  2FJ2 A;  3I90 A;  1IL8 A;  5ELB A;  3GTJ B;  2AWO A;  1OXT A;  3FDT A;  3HRZ C;  2NUC A;  2L9H A;  2PNR C;  3M7G A;  4B9X A;  1JE4 A;  1EOT A;  1PTO C;  2HDL A;  1EY6 A;  3QG1 A;  1EWC A;  1MSH A;  1GUG A;  1LT6 D;  1XTC D;  4A3B B;  2R7Z B;  3HKZ B;  5EBC A;  4IN3 A;  5E3F A;  4TQU S;  1RJT A;  3T53 B;  3V2T A;  1D1I A;  2FMM A;  4E6I A;  2WII B;  1PLF A;  3J81 E;  4KY7 A;  3CHB D;  3TP6 A;  4MIU A;  1LTB D;  2RDH A;  3OWE B;  4BA1 I;  1TKW B;  1A2T A;  3C2P A;  2NN6 H;  4P2C B;  2PCF B;  4V19 0;  2WV6 D;  1PZI D;  2F0S A;  1TU2 B;  3S9W A;  1T5E A;  2EDG A;  2F0O A;  3Q6S A;  3Q24 A;  5FO8 B;  4QMG A;  4DXF A;  1EIH A;  5JPM C;  3S16 B;  3J7A F;  5CMD A;  1NUC A;  4IUR A;  2N88 A;  4IUQ A;  3PO3 B;  2L0C A;  1I4G A;  5KGU A;  5KRU A;  4DXG A;  4LJZ C;  2VB3 X;  1DXM A;  1H9R A;  2VNU D;  2NWG A;  2RQX A;  4RGN A;  4WFN 3;  3QJY A;  1QNU A;  4A3E B;  3A56 A;  3W3A A;  3V05 A;  4BY1 B;  2Z8L A;  5KYL A;  3S1M B;  5E4W C;  1A2U A;  4FF3 A;  1U4L A;  3HOW B;  1CT1 D;  3T51 B;  4HSV A;  1A3U A;  1OXU A;  1DYQ A;  2BDN A;  1LTT D;  4NMZ A;  3OW7 A;  3DXJ C;  1TVX A;  5CV6 A;  3LWE A;  2XWB B;  1O7L A;  3K5O A;  5ELF A;  3KK7 A;  1WTX A;  2F03 A;  1BDO A;  3H3V C;  5I9O A;  4XQN A;  1SYC A;  4BBR B;  5DEH A;  1KLU D;  4HN7 A;  4YIJ A;  4IUT A;  3J7Y W;  2YU9 B;  4F87 A;  3FPU B;  1EEF D;  1AFP A;  2F0V A;  5BN4 A;  3D8G A;  3HZX A;  1B3A A;  4XDX A;  5CC4 A;  1JWU D;  1KAA A;  3TDQ A;  5C5L A;  1ESR A;  3NP8 A;  3NTH A;  3I70 A;  4HCS A;  3VYU A;  1BCP F;  2ZT9 C;  5CR3 A;  3I4N B;  5NUC A;  4HR7 B;  2BDO A;  1SMY D;  3R8B A;  2HCC A;  1TWG B;  1EY8 A;  3GTG B;  2E76 C;  2F3W A;  4RGT A;  4CJ0 B;  1F2Z A;  4A3D B;  1ZYR C;  3GTO B;  3TZD A;  2Z4H A;  3P7J A;  1HQM C;  2QCP X;  4DAV A;  4RHS A;  1HCZ A;  2EJF C;  1A15 A;  1Q3L A;  3G7L A;  4CJ1 B;  1XWE A;  1LT3 D;  4C3I G;  4K8I A;  5LHY 1;  5EBD A;  4FF2 A;  1II3 A;  3MEH A;  3I8Z A;  5I2Y A;  1WCM B;  4F8M A;  3DWQ A;  4QCL A;  1X3Q A;  4BWG B;  4G7Z C;  4NDX A;  4C3H G;  1H9S A;  1I4H A;  3E6Z X;  4BS9 A;  1NAP A;  3QIA A;  2E75 C;  2NVX B;  3ND9 A;  1VDZ A;  4RWS C;  2QIL A;  1HPC A;  4DNR B;  1H9M A;  3DMU A;  4K5X A;  5IGB A;  2L1B A;  1O7Z A;  4OO1 H;  3H09 A;  2IL8 A;  3Q23 A;  4C1N I;  1ROD A;  3NPP A;  3TME A;  1QB5 D;  1STB A;  4Y7N B;  1DOL A;  1EFI D;  4K6D A;  5J1Z A;  1WTV A;  2PPB C;  1HUN A;  4ID6 A;  1VMP A;  3L9A X;  3RUZ A;  5DM6 3;  1SYF A;  2JYO A;  2IW3 A;  1D6E C;  3C1F A;  1PZK D;  3KLS A;  3DWA A;  2J7Z A;  1JIC A;  1A3T A;  4EVO A;  1LTG D;  1LAC A;  2VXW A;  4KD3 A;  2EYH A;  3WOE A;  2LS0 1;  5ISR A;  4OIK A;  3KBX A;  4ZKB B;  1CTM A;  4ILW A;  1KDB A;  2KQ3 A;  5E4X A;  1PFN A;  3D6W A;  1SBB B;  2J0T D;  1GJX A;  4DU9 A;  2TSS A;  1LAB A;  1R4P B;  3SK6 A;  1WVL A;  2QEJ C;  5JEA J;  2F0E A;  1H9J A;  2IPK D;  2PW7 A;  2MGS A;  4UAI A;  1TS3 A;  4EQP A;  5FLX E;  4ME5 A;  1JOR A;  4L6T B;  1BQQ T;  5IGG A;  2EXZ A;  2F0N A;  1F9Q A;  4LK1 C;  4QF4 A;  3Q22 A;  2LY7 A;  2L12 A;  1SNO A;  4IQZ A;  3BZD B;  3GTQ B;  5A2Q L;  4DAP A;  2F0P A;  1SNQ A;  4XYO A;  1F2M A;  3IL8 A;  1AP0 A;  1EY0 A;  1ML0 D;  2OXP A;  4DFA A;  1STH A;  1UUP A;  2AQ1 B;  2NTT A;  2O4X A;  3U9S A;  1Q8I A;  2E2I B;  2PZT A;  2RBM A;  2F1M A;  5A2Q E;  3S14 B;  3RZO B;  4PMW A;  1GUT A;  5FK9 C;  1QWY A;  2B2T A;  1EY9 A;  2X69 A;  4PV1 C;  4WJW A;  4XIG S;  1C8C A;  4DGZ A;  3WDN A;  1ET6 A;  3S1N B;  5C6A A;  2ID0 A;  2Q8R E;  1ENC A;  3GD7 A;  1K8O A;  2K5W A;  3VYR A;  1MGS A;  2PQE A;  3QWN A;  2OT2 A;  1GUO A;  4ZK9 B;  5EKI A;  5KNB A;  3A54 A;  1G2T A;  5I6Y A;  3KF8 A;  4A3F B;  1TY2 A;  1Y1W B;  3OIP A;  1GXD C;  4FO2 A;  1V43 A;  2EY6 A;  3N52 A;  1LTI D;  3G6J B;  2DY7 A;  1W6K A;  1SSO A;  2D62 A;  1ESF A;  1MD2 D;  1KDC A;  3DEO A;  1BOS A;  3P1H A;  4A3J B;  3AMU A;  2OEO A;  4I65 A;  3UI2 A;  4ZRZ A;  2AUK A;  1EQV A;  4FVM A;  5C4H A;  4C3I B;  3PIP 3;  5DAU A;  5CV4 A;  3D4D A;  2BA0 A;  1F2L A;  2A6E C;  4DN4 M;  1OO9 B;  5KNC A;  2B2T C;  3I3C A;  3E5S A;  1C4Q A;  1EY7 A;  2K01 A;  5JEA G;  1GUW A;  5CYU A;  3FEW X;  1Y8N B;  3GTM B;  3MXU A;  1PMR A;  3EFX D;  1LT4 D;  1XYI A;  2MP1 A;  5HUR A;  3DWP A;  4WRD A;  2SNM A;  1R9T B;  1TWF B;  4OGQ C;  1UAP A;  1ZXT A;  1V1O A;  3CQZ B;  2A73 B;  2HCI A;  3FMC A;  3GTK B;  3BDO A;  3NQI A;  2BE5 C;  5CGK A;  4HMI A;  2J4X A;  1QCB D;  4R8I A;  3PUY A;  3PIO 3;  4RGM A;  5K36 G;  1SNC A;  5COY A;  1IYU A;  3HOZ B;  1EL0 A;  2ZXP A;  5M9O A;  1S5C D;  3T4A C;  3URY A;  2SEB D;  1RDP D;  2EYJ A;  2IX1 A;  1WTO A;  3I73 A;  5C0X J;  2KEC A;  1LV9 A;  5IGF A;  1Z7T A;  4Q5V A;  4KKT A;  2X6L A;  1NR4 A;  2M9V A;  2XVS A;  1SE4 A;  3GQB A;  1WD1 A;  3SVM A;  2PW5 A;  2B2Y C;  1EY4 A;  3FRP B;  3S2D B;  4DK0 A;  5EKK A;  3NWS A;  1M8A A;  5JOB A;  3HOU B;  2KCN A;  4EQN A;  2G9D A;  4TKO B;  2K28 A;  1IHZ A;  2JE6 I;  4R8N A;  3K5L A;  4KI0 A;  2R61 A;  3NBH A;  1PTO H;  4KN4 C;  4KTA A;  4KJO A;  3K0Y A;  1G8Z D;  1RTO A;  4JK1 C;  3VA5 A;  2M2L A;  1B4O A;  3PMF A;  2RKS A;  5ELE A;  3NBI A;  3SK5 A;  2O5I C;  1D5X C;  2BOS A;  2F3V A;  4KN7 C;  4A3G B;  1BO0 A;  3K5M A;  1NCV A;  2XRQ D;  2B8F A;  2WP8 J;  5JVG 3;  2Z1C A;  2EPB A;  3MTS A;  3M7N A;  1Q12 A;  5CBA E;  2KA7 A;  1LLR D;  5IOC A;  4IUP A;  5EJW A;  3EJI A;  3D4W A;  3ITP A;  3MAQ A;  4RFB A;  4A3I B;  3VR2 A;  3QOJ A;  5M3M B;  3K6O A;  1LTA D;  4JBW A;  1JC7 A;  1I3Q B;  1PDQ A;  2RA4 A;  4NP5 A;  3MWY W;  1ENF A;  2KJX A;  1LTS D;  5DM7 3;  1TWC B;  2K03 A;  3DM1 A;  5IIF A;  1HFG A;  3CU7 A;  1EYC A;  4H0L C;  1G6Z A;  4XQJ A;  4IFD J;  1TWH B;  4MN3 A;  2WKD A;  3H91 A;  1FYC A;  4FXG C;  1L0X B;  4C3J B;  5FO7 B;  4QUC A;  4BA2 I;  4MHE A;  3BVG A;  4G57 A;  1SND A;  4XT1 B;  2Y0S B;  5A35 A;  4IZ8 A;  4TSS A;  4K8J A;  4DA2 A;  2D5D A;  1Y8P B;  4KV6 A;  3BYT B;  4X3K A;  2B2V A;  3PV0 A;  2MHV A;  1X3P A;  4RCN A;  3CKI B;  5JAV A;  1RTN A;  2K5Q A;  3IKJ A;  2O5J C;  3VR6 A;  1QG7 A;  2A68 D;  1B1Z A;  1FNW A;  5G3L F;  5C0X G;  3SK8 A;  5EPK A;  5IGE A;  3AU7 A;  1Q1B A;  2KHS A;  3J80 L;  4F7X A;  3BG3 A;  2R92 B;  3NK9 A;  2FFK B;  3I91 A;  1I4P A;  2JEA I;  2EOT A;  2KVM A;  5IGD A;  5C3E B;  2ICE C;  3GTL B;  5T1G A;  1EY5 A;  3TP8 A;  3HGB A;  4QUF A;  4IUV A;  1SYE A;  3GO5 A;  3MA2 B;  3MXG A;  1S4Z A;  1OXV A;  3K7A B;  2WB1 B;  5ELC A;  1PRT F;  2F0H A;  2I07 B;  1BCP D;  3FVQ A;  5EGT A;  5G3L D;  1I4R A;  4KJN A;  2K05 A;  1BF4 A;  4WOR A;  3J7A V;  2R93 B;  3QOL A;  4G7H C;  4J1M A;  1E2W A;  1C48 A;  4K2K A;  1SFO B;  4L8J A;  3R2I A;  2K5D A;  1CK1 A;  4Q0F A;  4C1N K;  1LO5 D;  5M5Y B;  1IYV A;  1KAB A;  4KD4 A;  2NTS A;  1V1P A;  2WAC A;  3S1R B;  1HQR D;  1DJR D;  2EY5 A;  1F9R A;  3VR4 A;  2A68 C;  2E2H B;  5I6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...