2F0KA

Crystal structure of staphylococcal nuclease mutant v23i/l25i
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0kA00
4K5XA 4B9WA 3C1FA 5IOCA 1STAA 4OL7A 3D6CA 3QOLA 3BDLA 3PMFA 5E3FA 1II3A 5CV5A 1EQVA 2PZWA 4H7BA 2F0PA 4K8IA 5I6YA 5CC4A 3E5SA 1KDBA 4K6DA 2PYKA 2RBMA 4HMJA 4TRDA 3D4WA 4NDXA 5IODA 1SNDA 5CV4A 5KEEA 3T13A 3EVQA 5I9OA 1EY9A 1F2YA 4KY6A 4KD4A 5CGKA 2F0WA 4DU9A 5EKKA 3SK8A 2ENBA 4EQOA 3ITPA 2F0HA 1SNMA 3V2TA 4EQNA 4KHVA 5I9PA 5J1ZA 2F0TA 2PW7A 4K5WA 1SYGA 5J22A 3EJIA 4N9TA 3SXHA 1STBA 3HEJA 4DGZA 1SNOA 3OSOA 5NUCA 2F3WA 2EYHA 2EY1A 5HURA 1SNPA 1TQOA 2EYFA 2EY2A 1A2TA 2EY5A 3OMGA 2F0NA 4J1MA 2M00A 5DAUA 3NP8A 1IHZA 1TR5A 2OEOA 3R3OA 1A3TA 2EYMA 4E6IA 2PZUA 1JOQA 4G57A 3OMCA 4KD3A 4IZ8A 2F0UA 5C5LA 3VA5A 3P1HA 1SYCA 3NHHA 4HTHA 2F0EA 2F0DA 4LAAA 1EYDA 4ZUIA 2SNSA 2EY6A 2NUCA 3LX0A 2F0QA 2EYJA 1KDAA 3S9WA 3D4DA 5HGTA 3H6MA 4S3SA 2LKVA 5EKLA 3T16A 4MIUA 5C4ZA 2WACA 3NXWA 5EGTA 2RDFA 4ME5A 2F0MA 2F0OA 4EVOA 5KYIA 5IGDA 4EQPA 3ERQA 2F0FA 4KTAA 3DHQA 5IGGA 1F2ZA 1ENAA 4F7XA 3MHBA 5J39A 2KHSA 4PMCA 2F0VA 4ODGA 4KV6A 4PNYA 1EZ6A 1EY7A 2EYLA 3EROA 4PMBA 5IGFA 4J6HA 3TP7A 2KQ3A 3SK4A 3SR1A 1TT2A 4RKLA 3BDCA 2HQEA 4IUNA 4NP5A 5CV7A 5IGCA 4KY7A 2OXPA 4IALA 5IIFA 1EZ8A 5KYLA 1SNCA 4F8MA 3NQTA 3MXPA 4YIJA 1EYAA 3MZ5A 1JOOA 5K5PA 3QB3A 4ZUJA 1EY8A 4HMIA 4ID6A 5M9OA 2F0GA 4NKLA 3TP8A 1EY6A 1RKNA 1KDCA 1A3VA 1STGA 4KY5A 3DMUA 3TP5A 1NSNS 2EXZA 2QDBA 1JOKA 4K2LA 4QMGA 5C6AA 3SHLA 4QF4A 5KRUA 5F2DA 5C4HA 3HZXA 3QOJA 5JOBA 2F0SA 2SNMA 1NUCA 5IGEA 5ISRA 3C1EA 5CV9A 2F0JA 1SYFA 5IGBA 5JAVA 1STHA 5CV6A 5CV8A 1F2MA 5C3XA 5C3WA 4DF7A 5E1FA 4R8NA 3TP6A 5KIXA 3NUCA 2SOBA 1A2UA 1SNQA 3MVVA 3P75A 4KJOA 4WORA 1EY0A 5DEHA 4I65A 3TMEA 1SYEA 2PQEA 1JORA 2F0LA 1KABA 1STNA 2F3VA 2OF1A 3MEHA 4B9XA 5CR3A 5KGUA 1SYBA 4K14A 1EYCA 4K5VA 2PZTA 4QB4A 2RKSA 2EYOA 3RUZA 2F0IA 4WRDA 3U9OA 1EY5A 3D8GA 5C5MA 4KJNA 3SK6A 4K2KA 3SK5A 4NMZA 1ENCA 5I6WA 3NK9A 4RKBA 2F0KA 4ZQ3A 4K8JA 1U9RA 2EYPA 1STYA 3OWFA 2O4XA 1A3UA 1KAAA 1SYDA 2PW5A 1AEXA 4N9PA 4DFAA 1EY4A
chains in the Genus database with same CATH superfamily
3L0OA 2Z6KA 4L6TB 1QUQB 4LF8Q 5CMDA 5LHY1 3FDTA 2NN6G 2RBMA 3WOFA 4FDBA 1EOVA 4KY6A 1LTRD 2BDOA 4X64L 2PCFB 1IKMA 1LT5D 2F0HA 1CHPD 1TWCH 5J1ZA 2NYZD 4K5WA 4LW1A 3E0JA 2AWNA 3PO2H 4DV1L 3PUXA 1EQRA 4C56C 3L2PA 4BS9A 1XTDA 3HKZE 3M3YH 4B3MQ 3G6EA 2NVYB 3H91A 2E2DC 1WTRA 3EQLC 1Q1EA 1E2WA 3PIPA 1WTXA 3M4QA 1BQQT 3A0JA 4UHVA 1L2FA 4OGQC 1I4XA 3T16A 4PZ6A 3NXWA 4R4CA 1SE8A 4EVOA 3PUZA 4IFDJ 4C3JG 2LXKA 3M9BA 3K0YA 1YBYA 1I94Q 1F9SA 3PO3H 1EZ6A 3CU7A 2Z9HA 1FGBD 3TEHB 1K9MC 4YY3L 1UUPA 3KBXA 1HTLD 3TS0A 3RLOA 4R9WA 3RLFA 4MTNA 2ZTDA 2NVQH 3MXPA 4LUZA 1AE2A 4NXNL 1U0LA 1QOHA 1EQQA 1K73C 1UWVA 5COYA 2UU9L 1A3VA 4LNQA 4P73A 1HRJA 1TS2A 4BA2I 3TDQA 3S1NH 3L7ZC 4A3MG 1SYFA 2PMZE 1PTOB 2JK8A 4X66L 1Q86C 3VYUA 3R8BA 4JI3L 3BDOA 1EEFD 3GTJH 1I6HH 4K0KL 1JICA 2Y0SG 5KGUA 2PNHA 3CRKC 1PFNA 4ZK9B 3HOVG 1D1KA 1H9MA 3U50C 1V43A 4DR7L 2Q8IB 2H5XA 1D7QA 2VB2X 3RZOB 3TZUA 3TSSA 4N9PA 2O4XA 1A3UA 1HPCA 4ILWA 1DJRD 1EWHA 2KEEA 2MO0A 3S1RB 4QQBX 3I4MH 4M1UB 1GJXA 2KOLA 1I4RA 3GTMH 5C4XH 1LTSD 2PI2A 1HQMC 4YHHL 1VMPA 2MJ8A 1VCIA 4JI1L 1YNJD 4JK1C 2L5TA 2PW7A 5LL6S 2YU9B 4JBWA 1DYQA 3W3AA 4P2CB 1QVFA 4MHEA 2K52A 4R4QA 3UE1A 1JCKB 4RHRA 2EY2A 2OQ0A 1CM9A 4HR7B 3DXJC 3HOUB 1AZPA 2ID0A 1H9JA 2R6GA 3SDZA 4A3JB 4A3KH 1WVLA 1B44D 4C1NI 4OXPA 5EGTA 1Z47A 2RDGA 4EQPA 2JA5B 3DHQA 1ENAA 3J7AF 3CXCA 1WTWA 1PH6A 2UXCL 3K7AB 3EIVA 3UDXA 4J8QA 1CFMA 3OW7A 4B3ML 1PV4A 2WIIB 4DR1L 2K75A 2KQ3A 2D62A 1HZAA 2HQEA 3VR6A 3MAQA 2GA4B 1MSGA 1SAPA 3I4LA 2B2WA 1JJGA 4OIJA 2NVTH 1HZBA 5KYLA 2HUGA 5FLXE 4F8MA 2VUMH 1WJJA 3S14H 1NMGA 4DUZL 4RGOS 4AYBE 3Q6SA 2E2IH 5KRUA 1E3PA 1LLRD 1N32L 4DV5L 1HNWL 4I7AA 4RAUC 4IFDG 3KFUA 5C3XA 2K5NA 3KF8B 4UDUC 3HOYH 2HIXA 1SE2A 1ZYRC 3P75A 4KJOA 4OO1G 2R61A 2M2LA 4JI7Q 3DEPA 3T53B 4JI0L 4LF7Q 4Z9CB 2A69D 4X3KA 4K2KA 1KNAA 4CJ1B 3K5MA 2YV5A 4RKBA 4K8JA 2MPMA 4N8X1 5A2QE 5KNCA 1QCBD 3EN2A 3BS1A 2RVLA 5CV5A 1EQVA 1QZGA 3K5OA 4IUUA 1YIJA 1PH7A 2EJMA 1VQ9A 4JPBW 1U4RA 3DWAA 4H44C 1F2YA 5I9OA 2GVAA 2PI2E 1XPOA 1TVXA 5EKKA 2ENBA 3RD4A 2XRQD 4A3CG 2C9OA 3J7ZC 4A3BH 3I4NH 3NTIA 5IYDH 1LTTD 1TY0A 4N9TA 4DK1A 4X3UA 4A3FH 1BVSA 3R2IA 3H0GB 1F2LA 4A3IB 3HOZB 1IHZA 1TWHH 1MKHA 3U4VA 1V9PA 3NHHA 5TSSA 5DM63 2MO1A 1B2TA 3KLWA 5LL6X 1A62A 4DKAC 3F8TA 2N78A 4ME5A 4GKJQ 2DY7A 4JG2A 2K4KA 2K50A 4KK7A 1F2ZA 4KN7C 4BBRH 3CAMA 4A76A 1G51A 3BZCA 5EAYA 3IKJA 4KV6A 4PNYA 1QJOA 1PH5A 1HHVA 2F1MA 2Q8TA 1A6XA 3ND8A 3PUWA 1YJNA 1WCMH 3NENA 4P75A 5IYBH 3ULPA 1YNND 1PYBA 2GN5A 1NJIC 1J8IA 4FF2A 4C3IH 1KTKA 3HKZB 3QB3A 4DV3L 3HOUG 2F0GA 3PGZA 1Y8PB 1PRTD 5C4JB 4A3JG 2OCEA 5D65A 1R4QB 3QJYA 1DOMA 1K3RA 5FLMH 1HNZL 4DAYB 3A54A 5JOBA 1Y1WB 3T1YQ 3G48A 2F0JA 3D31A 3HOXH 3M7NA 1A15A 1VDZA 2JA5G 2R92H 3HKSA 1F2MA 2XN9C 1PMRA 1S4ZA 2LXJA 3J81c 3CC2A 1CA6A 4DR5Q 1KABA 1STNA 2JA7H 1B8AA 2G5DA 4KKUA 1SYBA 4DUYQ 2RKSA 2CW0D 1L1OC 2F0IA 2EXDA 3A74A 1LV9A 1PYWD 3SK6A 4NMZA 3DWQA 4A93H 3GTQH 4F88A 3JAMc 4LF6Q 3OOCA 3VR5A 2CFMA 4OL7A 1YJ9A 1K0RA 3RZDH 2K14A 3RN2A 1M90C 5EPLA 1CKMA 3DM3A 2B63B 4IQZA 5IT9E 1LTID 2F0WA 4LF7L 1Q46A 3W1GA 4KI0A 1Y14B 3J81j 3S16B 4A3EH 3Q24A 4JBMA 2PMZB 1FJGL 4BBSG 1Z6HA 4OWXB 2E2HH 2NVXH 3NSWA 1SE4A 5K36H 1K8GA 1WTQA 2JA6B 1VQIA 4XT3B 5DAUA 3A8JE 2KJXA 3AFQA 1SFOB 1TWFB 4LK1C 1VQCA 3A8KE 2F0UA 3BYYB 1EU3A 2F0EA 3GTPH 2HCCA 3AYHB 5JVH3 3AEVA 2BA1A 2E2JB 4CDFC 1VQLA 1CKOA 1KAWA 4HJ5A 2XGTA 5KYIA 1SLJA 1PZID 4DV2Q 3I55A 2F0FA 2R7FA 4EGVA 2K5VA 3Q23A 3MHBA 2KHIA 3AQQA 1UE6A 3L3OC 4BA1I 3STBC 1IBML 3EROA 3S2HH 5GAEC 4CJ2C 4GNXA 3H0GG 3NELA 5IGCA 5M3FB 1ESRA 4QCLA 2N88A 4A3IG 4GLXA 3MEFA 4NXMQ 3HOZG 1CSQA 3QIAA 1SNCA 4DR2L 2RSNA 2MQHA 4ZUJA 1HNXQ 5DM73 4B08A 5LMUQ 1HFGA 1UE5A 3DMUA 2A6ED 4QMGA 4QF4A 2F0SA 1AP0A 4IPGA 5IGEA 5ISRA 4XQQA 4JI4Q 3R93A 3OIPA 3UI2A 2K1BA 1GOZA 3J81L 3H15A 4JV5Q 5KIXA 2VQEQ 1S5ED 3MVVA 1CK1A 4POFA 2AHOB 1SMYD 1SYEA 1XNRL 2JE6I 3D3RA 3H3VH 4K14A 4Q0FA 4YCUA 3AU7A 3RUZA 5FOBB 4L5QA 1LT4D 1EY5A 4KJNA 3JAML 3J7AV 1GD7A 1JQYD 2OQKA 1Z7TA 1GM5A 2PW5A 3HKZG 2B2TA 5IGFA 4HIKA 1G291 5IE8A 4LF9Q 3BDLA 5IYCH 4C2MH 1V8QA 1B3QA 1Y1WG 4K6DA 1X65A 4DR4Q 4N8FA 5KEEA 4IOAA 1K83H 2FHTA 4AYBB 4DR5L 3K0XA 1FR3A 3OPOA 4DUYL 4LF5Q 1HCZA 1C7YA 4JVZA 1P16A 4A3DH 4IURA 3F2BA 4RGMA 2Z6BA 2WB1E 1XNQQ 3CD6A 1N34L 4LF6L 4DGZA 1PZJD 2ZM6Q 2K28A 4BXXH 1ICWA 1BCPB 2DJGC 1EEID 4C3HB 1ILPA 3NE5B 2R3ZA 1TR5A 4G57A 4QUCA 4TVAB 2EJFC 1I4HA 3PF4A 5M5XH 4FYDA 2BH8A 2SNSA 4R8IA 1GHJA 2DNCA 2B63G 4G7ZC 4BY1H 1N36L 3CCVA 4MN3A 4YCWA 3AMUA 1K28A 2F0MA 1D6EC 1TXYA 3I8ZA 2IJ0A 1I6VC 4DXGA 4ODGA 4PZ7A 1FYCA 2D5DA 2EJGC 4GOPA 5C3EH 4ALPA 4FO2A 2ATWA 5M3MH 4NPSA 5C0XJ 1AZQA 1NAPA 2KA7A 2ES2A 1BDOA 3PV0A 2JA6G 2WV6D 1G6PA 1BBUA 4TKOB 3EA6A 2K7VA 4DV7L 2TMPA 1D1IA 5FJ8G 1LUZA 4X62L 2I5MX 2MUYA 5M5WB 1HZ9A 1GO3E 1GXDC 1SDFA 2WKDA 3C1EA 4DV6Q 1U4PA 1QNUA 1B50A 1BUVT 2FMMA 2WKCA 3W2DA 3HOVB 4NXML 5CR3A 2EYOA 4O1NA 5M3FG 1MJCA 1ZKOA 4IFDI 1ENCA 3VR3A 1ET9A 1NR2A 2IY5B 3FMCA 5JEAG 4F87A 1EY4A 4JI4L 4JBJA 5AFWA 3UE0A 3VYSA 4OO1I 3QOLA 4JV5L 2VQEL 4ME3A 5IP7H 2E5LQ 5IODA 1TWGB 2R7ZB 4DU9A 4POGA 4KN4C 4A3EG 4LFAQ 1GUGA 1XMQL 4RWSC 2F0TA 1WTPA 1STBA 3HEJA 4Q5VA 1SNOA 2ZTEA 3OWEB 2KHJA 3GTKB 4LF9L 1PFBA 4QL5A 1B7YB 2JN4A 2F0NA 4J1MA 3HRZC 2QCPX 2OEOA 4E6IA 4L63B 1KRTA 4DR4L 5C44H 2IHEA 1G8ZD 1X32A 4LF5L 3T56B 2ALYB 2EY6A 2IW3A 3M4OB 1PHJA 4AYBG 1J5EL 3VR4A 1XNQL 3IFDA 5IGGA 4KTAA 1IYJB 2ZM6L 1ET6A 5J39A 1Q8IA 3GTOH 2X69A 1JWSD 1RODA 2QILA 3S17H 5CYUA 2L4NA 4PG3A 4J6HA 2B8GA 1TT2A 4OWWB 3ERSX 1B53A 4MZ9A 2MHVA 4C3HG 1X3PA 1L0WA 2OXPA 4IALA 2A8VA 4GN4B 3F2DA 3I72A 1JOOA 4JOIC 4BY7B 1HUNA 1XJVA 3MA2B 1VQKA 1DD2A 4KHPQ 4U673 2R93H 1S5DD 1PFSA 2GVBA 2WAQE 4P74A 1H9SA 5IGBA 3RZOH 3I90A 1STHA 3J80E 2CQOA 2JA8H 3NUCA 2HHHQ 1LTLA 4WORA 3URYA 3FKIB 4V190 5J3BA 1BOSA 5C0XG 1EYCA 1EFID 4WRDA 2E75C 4WFN3 3TN2A 2CQAA 3HS0C 2K6AA 4IO9A 3SK8A 3PUYA 1NNXA 4LJZC 2IX0A 4XYQA 1MI2A 3K57A 5G3LF 3SGIA 5I6YA 1O7LA 1TWCB 3NTKA 3GO5A 3GP7A 1IL8A 5FKAC 4DK6C 1MSHA 4LF4Q 4A3DG 1FD7D 5M5YH 3PO2B 4HJAA 4EX5A 4LFBL 2EIFA 1BO0A 3F1ZA 1K8MA 4XYOA 1VQBA 1Q7YC 1OTCA 1YHQA 4JYAL 2CHBD 5NUCA 2F3WA 4FVMA 4HIOA 1X3FA 2EY1A 2HQLA 4GZYC 1E1TA 1BR9A 5E4WC 5LMNW 1VQDA 2PZUA 4FXDA 2E5LL 1RIPA 2A6HC 5C5LA 2NTTA 1SYCA 1XWEA 1RDPD 2FINB 1PFMA 1PH4A 4LFAL 1SJHD 1M8AA 1LACA 2R7ZG 3PO3B 4FXGC 2F0OA 3I73A 3CCSA 1PTOF 2DY8A 4UAIA 3CP0A 3LWUA 1PTOC 4X65Q 2Z8LA 1N8RC 3MXNA 1XYIA 5T1IA 1EY7A 4LF8L 1O7YA 3MC0B 3KJPA 2ZT9C 2J0TD 1EIYB 2WB1B 3F2UA 4CGYB 4XDXA 3PQIA 3NQTA 1HFNA 4CDEC 3S1NB 3CW2C 2A5HA 4K2LA 3HG9A 2JJQA 3G71A 1X56A 5JAVA 1I6HB 1NTGA 2QEJC 1KNEA 2SOBA 3K80C 2HD3A 1IBKQ 2BE5C 4B9XA 3CCQA 2B2YC 3NTHA 3CRLC 3ULLA 4QB4A 3UDIA 4IPHA 1OXXK 4KHPL 2Z4IA 1IXRA 2E74C 4B3TQ 3I4MB 3I7FA 4GNXB 3SR1A 1WTOA 3OWFA 1KAAA 1I94L 4YIJA 4BY7G 1NBWA 2AMCB 1T5EA 2ZJQA 1STAA 2YTVA 3NPPA 5E3FA 4AIMA 1CZWA 4JCVE 5CC4A 2MFIA 4NDXA 1SNDA 3T13A 3HGBA 4BBSB 5A35A 4KD4A 4FF1A 3E0EA 4ZCKA 2C35B 3KLRA 1UNSA 5EPKA 2C5CA 2Q2TA 5J22A 3FKIG 1RTNA 3EJIA 3KJOA 3HOWH 1XMOQ 4ZKCB 1LTBD 1DCZA 1X55A 1H9RA 2B2UC 1Z9FA 1SNPA 1SR3A 1R9TH 4A3LH 5C44G 1X54A 1Y8OB 4PQXA 1Y1VH 4R4TA 1V1QA 3WWVA 2D0PA 3GD7A 3T51B 1ASZA 1KQSA 3KYHC 3DUZA 1E24A 2RDFA 3PO2G 3QR8A 3U58A 5JJIA 2XIWA 4HSPA 2F0VA 2XSCA 2OTLA 1C4QA 3CPWA 2L0CA 2IHFA 2A68C 1S5FD 1RJTA 3TP7A 2VUMB 4EQ5A 4NP5A 4KY7A 4QIWE 3S14B 2DJFC 1EWIA 4QUFA 1YZ6A 2J7ZA 5HGQA 4LFCQ 2E2IB 1B70B 1E0BA 3BJUA 2L55A 4RG1A 2ZXPA 1RKNA 2LY7A 3C46A 3SHLA 3HOYB 3PO3G 1V1OA 1CHQD 4ZYSA 4HIMA 1NY4A 2JA9A 3G4SA 4KKTA 2KEDA 1UE1A 3NBHA 1M1KC 4CKCA 2K01A 4I65A 2PQEA 2RHQB 1U5KA 3X3NA 2F0LA 5I2YA 2I46A 4FNFA 5BN3A 2WB1G 3WDNA 1QVGA 3NWSA 4HSVA 1VQAA 4GOPB 3KK7A 5L37A 3I3CA 1WD1A 5H1SE 1E1OA 1PDQA 5GQOA 1DXMA 1G2TA 2DNEA 3J80i 3ULJA 1FVIA 4A3BB 4KLKA 3I4NB 4HMJA 1IBKL 1VF7A 3X3MA 5DNFA 2N3SA 3GTLH 1TWFH 1JMCA 2YYZA 2BA0A 2O5IC 4JW0A 2AUKA 4A3GH 4B3TL 2CCZA 4P71A 1U4MA 3M85A 1TWHB 3GDEA 2EYHA 1A2TA 5CORA 1Y69U 3FPPA 4TQUS 1BF4A 2M00A 3I4MG 4DPGA 3FPUB 3R3OA 4AQYQ 5FK9C 5C4XG 4IJLA 4KD3A 1B1ZA 2AQ2B 3VA5A 3P1HA 4JI5Q 4JI7L 1CT1D 5EBCA 2VS1A 1VQ6A 4GN3B 4HEDA 2PQAA 3TZDA 1X3EA 4IUPA 3A5ZB 2UXDQ 1FNVA 2OWOA 1LTAD 3F2CA 2B2VC 4ZRZA 4OWTB 4WJ3M 1WCMB 4TSSA 1FNWA 1TS4A 3MWYW 3QO2A 4C3IB 1JWUD 2UUBQ 1MIUA 1YJWA 1RL2A 1PRTB 1YITA 1O7ZA 4CKEA 4A3KG 4RH6A 1YHBA 3FP9A 5GROA 3WOEA 5K5PA 1HA5A 3I91A 5M9OA 2BOSA 4CJ0B 4NKLA 3HOXB 3TQYA 2UXBQ 2R92B 1NSNS 1OXVA 4J15A 1A63A 2KECA 5F2DA 5C4HA 4C1NK 3GTGH 1QILA 2NBFA 1PXUA 2KCMA 3V96A 2WINB 2VW9A 4IUTA 1I3QH 5CV8A 2JA7B 5AJ3Q 2WP8J 1IYVA 4LMQD 2NN6H 1SNQA 1EY0A 1CZGA 1VF5C 4ABNA 1KC8C 2JEAI 3CC4A 3MEHA 2XRSD 4A93B 2VUMG 3GTQB 1WOCA 2PZTA 2MGSA 1JT8A 3U9OA 3OTOQ 4GKJL 2A19A 3RZDB 4PZ8A 2EYPA 4L5TA 1Q3LA 1F9PA 1SYDA 4DFAA 3CCMA 3H3VI 3KLSX 4RA8A 3S1MH 2PZWA 2RCNA 5C0XI 1GUWA 4MTKA 4A3EB 3BU2A 4G7HC 3HOYG 1UAPA 1S3OA 2Z0SA 3FEWX 5CV4A 4RGTA 2Z6KC 2E2HB 4OELB 1N33Q 3FHWA 4LWCA 2NVXB 3KLSA 1SNMA 2OT2A 1H9SB 1TKWB 1SYGA 5ELBA 1GVPA 1SJED 1IYUA 4C3JH 3OSOA 1HA6A 5HURA 3T1YL 2CW0C 3CKIB 3GTPB 1JOQA 1QZHA 2Q2UA 4Y7NH 4X3SA 4RHSA 3J7A5 2F0DA 1ENFA 5JJLA 2JYOA 4A3BG 2XWJB 2RQXA 3CQZH 3I4NG 4XQJA 5IYDG 1XX8A 5C4ZA 3OIQA 4DR3Q 2WAQG 1IBLQ 4A3FG 1JE5A 3S2HB 1UEBA 2A73B 3S1QH 1V1PA 2V4DA 1DM0B 1OO9B 4A3MH 1CSPA 4AQYL 3H09A 1GUSA 4DA2A 3A7LA 1GKHA 1K3BC 1L0XB 1UE7A 4X64Q 4R4IA 3UDGA 3SEBA 4XXEA 3HOVH 1KIXA 5C6AA 4DV1Q 1SRUA 3K5NA 2CH4A 2A74C 4BBRG 4RMFA 1T9HA 1AE3A 3K58A 2F03A 4JI6Q 1HH2P 1NUCA 1BBWA 5EQ0A 4G4KA 1L1OA 2HDMA 3VR2A 1WCMG 1HJPA 5IYBG 3K6OA 4C3IG 4HIDA 1ICFB 4B3SQ 1TWAH 4O42A 3OW2A 1ML0D 1BCPF 3SE0A 4UY8C 2QGQA 1EIHA 4DV2L 1BCPC 4C2MB 4XT1B 2F0KA 2P5ZX 4PMWA 1PH9A 4CBVA 1STYA 5FLMG 3RLNA 3Q0AA 2KVMA 4QIWB 1I50B 1LABA 3ONAB 3HP3A 3C1FA 3HOXG 5AJ3L 2R92G 4IJHA 3S2DH 3MTSA 4A3DB 2A6EC 4JI2Q 1HTPA 4CHTB 1PVOA 3OYYA 1DZ1A 3J81E 2RF4A 2JA7G 2RA4A 1HNXL 2K5DA 2HIVA 1JJCB 5LMUL 1J9OA 2RHSB 1BBXC 4A93G 1E22A 3KDFA 3JAME 2BCOA 1TQOA 2EYFA 3DWPA 5M5XB 1X9NA 1KLUD 2AKWB 4JBKA 4X66Q 2IWHA 1S40A 1RHPA 2N8NA 2QDLA 4JI3Q 4BY1B 4WJ4A 1G6ZA 1VQFA 2B29A 2D0OA 1EFWA 4HTHA 5FLXc 4K0KQ 1KL9A 1D2BA 2NVYH 1IZ6A 3D4DA 5HGTA 2L11A 1X3GA 5IY0A 2ASBA 4HJ9A 2M9VA 2VNUD 5G3LD 4XIGS 5K36G 5M3MB 1GUNA 1YHAA 3IL8A 4BWGB 3NEMA 2EYLA 4YWKA 1CUKA 3TBIB 4IFDH 1AH9A 1VQGA 1Q12A 1VQHA 4IUQA 1B4OA 5CV7A 5LMNQ 2V1CC 2I5HA 5IIFA 5BR8Q 1BNZA 2VL6A 4DV4Q 1ZEQX 4O0AA 2JSOA 1IBLL 3J7YW 2PNRC 1Q8KA 2K32A 3KUPA 3TS2A 3UDFA 4A4IA 1S5CD 1STGA 1OXTA 2QDBA 2A6HD 4R4OA 1Q81C 1G91A 4DN4M 2OTJA 3QOJA 1D8LA 2KBNA 2SDFA 1HR0Q 1F9QA 1J6QA 1VQNA 3FVQA 1JE4A 5E1FA 1RCVD 1VS0A 1TIID 1W6JA 1JB7A 1PTOD 1PTOH 4QJFA 1U4LA 4A3CH 1S72A 2L1BA 5IWAQ 1HZCA 3W5OA 5C5MA 5D3DA 1W3SA 4DK3C 2TSSA 4L5RC 1IW7C 5ELCA 3CCRA 1LT3D 2NB0A 3U9SA 1EU4A 4JI6L 2UXCQ 3E9HA 1N9WA 4RGNA 4DR1Q 2VZAA 1VQJA 1II3A 3H94A 3E6ZX 3S15B 4MNOA 4FXKC 3CCLA 1YI2A 3D4WA 4NW2A 1BXTA 1EY9A 3S1RH 4B3SL 1Y8NB 1B9MA 4A75A 3RN5A 1LT6D 2XNAC 3RNUA 2EOTA 5IP9H 4JI8Q 4DNRB 1VQEA 3BVZA 4DUZQ 2EE1A 3E9IA 2L12A 3NBHB 2MNAA 1A0IA 4DNIA 1P8LA 2BE5D 2H1EA 5C44B 3CC7A 2YU9H 1N32Q 4DV5Q 1C9OA 1HNWQ 3BZDB 4DV6L 5IYCG 3LGJA 3CPFA 3NP8A 3I2ZA 3NWTA 4DAMA 1A3TA 2EYMA 3T1HQ 3RMHA 1EIGA 4JI2L 5FLXL 1E2ZA 1XPRA 4JI0Q 3G7LA 1JR0D 3GTOB 4S3SA 2LKVA 5BN4A 3A55A 4MIUA 2WACA 1SSOA 4L8JA 3HOUH 3K59A 1O80A 5EBDA 4A3JH 3S17B 3NQIA 1YNXA 2AQ1B 5E4XA 3M3YB 3DM1A 4BXXG 1ZYRD 1WYDA 3K81C 1EIFA 1S5BD 1I5FA 2JA5H 3SK4A 5JPNC 4HCSA 3K7AH 2ZJRA 4I7ZC 1A8VA 2KENA 4V0BA 1RD9D 2R93B 1I4GA 1DONA 2G9HD 3AFPA 1G2SA 5ELNA 4BY1G 4B3RQ 4XTCS 4ID6A 2I07B 1TU2B 5A2QL 2NWGA 3TP5A 2JA8B 2I0QA 3O13A 1HR0W 4KHZA 2YTYA 2WFWA 5C3EG 3ER0A 2D9UA 1Q1BA 5M3MG 1CKNA 2XVSA 2PQAB 2IL8A 5LMNL 5IT9c 2NVQB 5BN5A 5E7NA 5BR8L 4H02A 3D0FA 1O78A 2Q2IA 4DV4L 2A68D 4IOCA 4BBSH 3I56A 4DR6Q 5I6WA 3W1BA 2LMCB 1HR0L 1WTHA 3GTJB 2K04A 5M5YB 4K8IA 1X6OA 1KDBA 4TRDA 1CA5A 3C3LA 1ASYA 1RF2D 3Q8DA 4EQOA 3ITPA 5JJKA 1AFPA 1EWCA 1RTOA 5IWAL 4HAEA 4IPCA 4WJWA 3CMAA 4DV3Q 5GAHC 3OHXC 3QWNA 2H4OA 4X3TA 1IKLA 1HNZQ 3GTMB 4QGUA 5C4XB 3KBGA 3BVGA 4G7OC 2EY5A 1PYSB 1DOKA 4P72A 2MP1A 5IP7G 3DEOA 2HHHL 3H0GH 4IZ8A 3J81i 1KHIA 4A3IH 3PCOB 2BH2A 3HOZH 2CVRA 2NUCA 3S9WA 2KCTA 4JI8L 1LYLA 2N55A 1NMFA 4U68A 4APVA 1QWYA 1ESFA 2FMCA 3VDYA 4HN7A 2O2LD 1IL2A 3G6JB 3JAMi 4NB3A 3DLLA 2KHSA 4PMCA 3KF6A 3T1HL 3GV3A 1SROA 1E2VA 5CBAE 5I4DA 4A3KB 1PH2A 4JOIA 3PUVA 1Q82C 2K5QA 3GV6A 2CWPA 2HCIA 2E76C 4KKSA 4RCNA 1B3AA 2ZXRA 5EKIA 1EZ8A 4LF4L 1QUQA 2IX1A 1LO5D 1VQ4A 4GNXC 3C2PA 1EY8A 1FJGQ 3TP8A 1PH1A 3BVMA 2JP1A 5GAGC 1KD1C 4PV1C 1EYGA 2B8FA 5C4JH 1YNJC 4GN5A 5IT9L 3I70A 4DAPA 2NVTB 5C3WA 1PH8A 4OHJA 1QVCA 2FFKB 1Y1WH 4QY7A 1A2UA 2L15A 4AH6A 4HCEA 2F3VA 1PH3A 1W2BA 3JC66 1OXUA 4GS3A 4K5VA 2RCFA 4B3RL 1V1PB 4FF3A 3IAYA 3M7GA 4JC0A 3MXUA 3D6WA 2YTXA 1SE3A 3VYTA 2R93G 1U9RA 4X65L 2JEBI 1AEXA 2K5HA 3CMEA 5IOCA 4OX9Q 3D6CA 3CCJA 3PMFA 1IBMQ 2B3GA 3CCEA 1LM0A 4H7BA 2JA8G 1JJ2A 1KXLA 2B2TC 1CI3M 3E5SA 2PYKA 1HQRD 3EVQA 1PA6A 3HOWB 4UP9A 3BYTB 2QEXA 4DR2Q 4EQNA 3P20A 5IP9G 5I9PA 2E8GA 3P7JA 2B63H 2Y0SE 3STBD 1FNUA 4YWLA 1YEZA 4DR6L 3SXHA 1SN8A 1R9TB 1L1OB 2IT1A 5EPJA 1XXGA 3S16H 3K5LA 3VA7A 1Y1VB 3HFZB 1C0AA 4FP5D 5D3IB 3QG1A 4ULLA 2IPKD 3K7UC 3ICEA 2ICEC 2UUCQ 3KOJA 1VQMA 3EBEA 1QNKA 1XNRQ 2JA6H 1EYDA 2WAQB 3CF5A 3M4YA 3LX0A 4A3FB 1SFOH 2F0QA 2EYJA 4K6LA 2KCCA 4GKKQ 2EDGA 1CTMA 3IRBA 5FJ8H 3S24A 3ERQA 1QG7A 2CWAA 2RDHA 2E2JH 1WTVA 1H95A 1VMCA 1JC7A 2A69C 1EQTA 3L9AX 2RSOA 4RKLA 3ND9A 1GHKA 4OEMB 2G9DA 4GOPC 2F52A 1XTCD 3KDFB 1CQVA 2Q8RE 3MZ5A 3Q22A 2EQSA 2NZOA 4BBRB 4H0LC 4HMIA 5M3FH 1QE6A 1EY6A 1XMOL 1GUOA 1KDCA 1N34Q 4ZKBB 2UUAQ 4DNTB 5JEAH 2K03A 1YVCA 2ZXOA 2R7DA 5CV9A 5DLQE 2B2YA 2HT1A 1H9KA 2L9HA 4FF4A 3TP6A 5JPMC 3BG3A 2F4VQ 1GUTA 1KRSA 2K5WA 5DEHA 2Q2HA 2LFNA 2OF1A 1L0YB 2Z1CA 1VQOA 2VQFQ 3IFTA 1WFQA 1N36Q 1TS5A 3N52A 3NK9A 1MD2D 3PSIA 2NN6I 5ELDA 4IN3A 1VQPA 2VB3X 3GTLB 2B39A 3VYRA 1SXTA 1FGUA 4A3GB 2K33A 4LUVA 5CGKA 4YCVA 3GQBA 1F9RA 5KNBA 3B6YA 1EL0A 4LFCL 2B2UA 3CCUA 3A56A 4DV7Q 1K8AC 1CQFA 4UP8A 4X62Q 1MBYA 1VQ5A 1OXSC 3BZKA 1YNNC 5T1GA 4OX9L 3AB9A 4DV0Q 1NCVA 3OMGA 5JJZA 1PRTF 1O7IA 4IPDA 2PPBC 1PRTC 2VY3A 4OONA 4RCOA 3OMCA 4O2DA 1BCPD 1STEA 5EJWA 1VQ8A 4C3HH 1ONLA 4LAAA 1K0SA 3ZJYC 5JVG3 5JEAJ 3FRPB 5EKLA 3HOWG 3KF8A 3MXGA 2F3IA 2ZTCA 5IGDA 1C48A 1HXYD 3ZYYX 2QA4A 3A8IE 4XQNA 1DGSA 1LTGD 1B9NA 4YWMA 1T5XD 1NR4A 5ELFA 2AQ3B 2Z4HA 2IX3A 3T4AC 2DUDA 3J80c 4A3LG 2QW7A 1MGSA 5CBEE 3LNNA 1Y1VG 2J4XA 2UUCL 2AWOA 4X6AH 1KLGD 2QKIC 2QF7A 2XWBB 2NZ1D 1WI5A 1Q90A 5C0XH 1EUJA 1XMQQ 1AW7A 3EFXD 4H13C 4GKKL 3GTGB 3PIO3 2HDLA 3A7AB 3MFGA 1I3QB 1NE3A 4KY5A 1DOLA 2JXMB 1F77A 2EXZA 1JOKA 1I4QA 3V05A 5CV6A 1C8CA 4KMUC 4CDCC 5M5WH 4DAVA 4CKBA 2LS01 4LUOA 4R8NA 3TREA 4GLAC 2EPBA 1I50H 4JI5L 1JORA 2VXWA 4ZAIA 2CH4W 3RR5A 2N49A 1J5EQ 2SEBD 1QB5D 5FO9B 2UUAL 3S1MB 2JQOA 2NZHA 1W6KA 2UXDL 1VQ7A 1PZKD 3NBIA 4K5XA 4B9WA 2AUJD 2LSSA 5KNDA 2F4VL 2F0PA 1AN8A 2UUBL 1I4PA 5ELOA 2CKZB 4HJ8A 4C3JB 2VQFL 4L5SA 3V2TA 4GLVB 3MXNB 4KHVA 1TY2A 1TWGH 1ILQA 3N6RA 2R7ZH 4ZLTF 4DXFA 4CDDC 1CKNB 2UXBL 1UEAB 2D2CC 3PIOA 5GADC 1R4PB 3E3XA 4Y7NB 2KCNA 1JWMD 1K83B 2X6LA 1M4VA 5D14A 1D5MC 4YY3Q 3CQZB 4UPAA 4HJ7A 3GTKH 1IW7D 1SMXA 2X6GA 1K8OA 4DAYA 4M8AA 3M4PA 4ZUIA 2I5LX 1KDAA 3H6MA 2ICIA 2B2VA 2FJ2A 1TS3A 3A5UA 4A3GG 3S1QB 4NXNQ 3OTOL 4A3MB 2UU9Q 1ZXTA 1SMYC 4F7XA 4DK0A 3H3VC 3J80L 3SVMA 4DV0L 3M4OH 3I4OA 2PO4A 1MHWC 4PMBA 3PF5A 1D5ZC 1X3QA 2Y0SB 4UP7A 1MJEA 1BKBA 3BDCA 5HY6A 4IUNA 5ELEA 2DGYA 5FO7B 2BDNA 1N33L 2XTIA 3MFYA 1FL0A 2ZJPA 1EYAA 4LFBQ 1E7ZA 2KUMA 3R2TA 4RFBA 2FXQA 4DR7Q 4JYAQ 5C3EB 3K8AA 4BY7H 3HZXA 1SEBD 2SNMA 1PLFA 1JB3A 4DF7A 1TWAB 2A1AA 2NTSA 1EOTA 3PIP3 1WD0A 2DN8A 3D4RA 3TMEA 2K05A 3S15H 4OO1H 4YHHQ 2O5JC 3U4ZA 2EZVA 1XPUA 3LWEA 4JI1Q 3D8GA 3KF6B 1D5XC 4IUVA 3FKIH 4R1JA 3SK5A 4DR3L 3TRZA 2EVBA 4OIKA 5I2XA 3CHBD 1SBBB 4Y52H 2B2WC 4ZQ3A 5FO8B 3S2DB 2F4IA 1HUMA
chains in the Genus database with same CATH topology
4L6TB 5CMDA 5LHY1 3FDTA 2NN6G 2RBMA 3WOFA 4KY6A 1LTRD 2BDOA 2PCFB 1IKMA 1LT5D 2F0HA 1CHPD 5J1ZA 2NYZD 4K5WA 3E0JA 2AWNA 3PUXA 4C56C 4BS9A 2NVYB 3H91A 2E2DC 1WTRA 3EQLC 1Q1EA 1E2WA 1WTXA 1BQQT 4OGQC 1I4XA 3T16A 3NXWA 4EVOA 3PUZA 4IFDJ 4C3JG 3K0YA 1F9SA 1EZ6A 3CU7A 1FGBD 1UUPA 3KBXA 1HTLD 4R9WA 3RLFA 3MXPA 1QOHA 5COYA 1A3VA 1HRJA 1TS2A 4BA2I 3TDQA 3L7ZC 1SYFA 1PTOB 3VYUA 3R8BA 3BDOA 1EEFD 1JICA 5KGUA 3CRKC 1PFNA 4ZK9B 1D1KA 1H9MA 1V43A 2Q8IB 2VB2X 3RZOB 3TZUA 3TSSA 4N9PA 2O4XA 1A3UA 1HPCA 4ILWA 1DJRD 1EWHA 2KEEA 3S1RB 4M1UB 1GJXA 2KOLA 1I4RA 1LTSD 1HQMC 1VMPA 2MJ8A 1VCIA 1YNJD 4JK1C 2L5TA 2PW7A 5LL6S 2YU9B 4JBWA 1DYQA 3W3AA 4P2CB 4MHEA 1JCKB 4RHRA 2EY2A 1CM9A 4HR7B 3DXJC 3HOUB 1AZPA 2ID0A 1H9JA 2R6GA 3SDZA 4A3JB 1WVLA 1B44D 4C1NI 5EGTA 1Z47A 2RDGA 4EQPA 2JA5B 3DHQA 1ENAA 3J7AF 1WTWA 3K7AB 4J8QA 1CFMA 3OW7A 2WIIB 2KQ3A 2D62A 3VR6A 2HQEA 3MAQA 2GA4B 1MSGA 1SAPA 3I4LA 2B2WA 4OIJA 5KYLA 2HUGA 5FLXE 4F8MA 4RGOS 3Q6SA 5KRUA 1LLRD 4RAUC 4IFDG 5C3XA 4UDUC 3P75A 1SE2A 1ZYRC 4KJOA 4OO1G 2R61A 2M2LA 3DEPA 3T53B 4Z9CB 2A69D 4X3KA 4K2KA 1KNAA 4CJ1B 3K5MA 4RKBA 4K8JA 2MPMA 5A2QE 5KNCA 1QCBD 3BS1A 2RVLA 5CV5A 1EQVA 3K5OA 4IUUA 2EJMA 1U4RA 3DWAA 4H44C 1F2YA 5I9OA 1TVXA 5EKKA 2ENBA 3RD4A 2XRQD 2C9OA 3NTIA 1LTTD 1TY0A 4N9TA 4DK1A 4X3UA 3R2IA 3H0GB 1F2LA 4A3IB 3HOZB 1IHZA 3NHHA 5TSSA 5DM63 1B2TA 5LL6X 4ME5A 2DY7A 4KK7A 1F2ZA 4KN7C 3IKJA 4KV6A 4PNYA 1QJOA 1HHVA 2F1MA 2Q8TA 1A6XA 3ND8A 3PUWA 1YNND 1J8IA 4FF2A 1KTKA 3HKZB 3QB3A 2F0GA 1Y8PB 1PRTD 5C4JB 5D65A 1R4QB 3QJYA 1DOMA 1Y1WB 3A54A 5JOBA 2F0JA 3D31A 3M7NA 1A15A 1VDZA 1F2MA 1PMRA 1S4ZA 2XN9C 1CA6A 1KABA 1STNA 4KKUA 1SYBA 2RKSA 2CW0D 2F0IA 1LV9A 1PYWD 3SK6A 4NMZA 3DWQA 4F88A 3OOCA 3VR5A 4OL7A 5EPLA 2B63B 4IQZA 5IT9E 1LTID 2F0WA 4KI0A 3S16B 3Q24A 2PMZB 1Z6HA 3NSWA 1SE4A 5K36H 1WTQA 2JA6B 4XT3B 5DAUA 3A8JE 2KJXA 1SFOB 1TWFB 4LK1C 3A8KE 2F0UA 3BYYB 1EU3A 2F0EA 2HCCA 5JVH3 2BA1A 2E2JB 5KYIA 1PZID 2F0FA 4EGVA 3Q23A 3MHBA 3L3OC 4BA1I 3EROA 4CJ2C 5IGCA 5M3FB 4QCLA 1ESRA 2N88A 1SNCA 3QIAA 2RSNA 4ZUJA 5DM73 4B08A 1HFGA 3DMUA 2A6ED 4QMGA 4QF4A 2F0SA 1AP0A 5IGEA 5ISRA 4XQQA 3R93A 3OIPA 3UI2A 2K1BA 1GOZA 3J81L 5KIXA 1S5ED 3MVVA 1CK1A 1SMYD 1SYEA 2JE6I 3D3RA 4K14A 4Q0FA 3AU7A 5FOBB 3RUZA 1LT4D 1EY5A 4KJNA 3JAML 3J7AV 1JQYD 1Z7TA 2PW5A 5IGFA 2B2TA 1G291 3BDLA 1V8QA 4K6DA 5KEEA 2FHTA 4AYBB 1FR3A 3OPOA 1HCZA 4IURA 4RGMA 4DGZA 1PZJD 2K28A 1ICWA 1BCPB 1EEID 4C3HB 1ILPA 3NE5B 2R3ZA 1TR5A 4G57A 4QUCA 2EJFC 1I4HA 4FYDA 2SNSA 4R8IA 1GHJA 2DNCA 4G7ZC 4MN3A 3AMUA 2F0MA 1D6EC 3I8ZA 2IJ0A 1I6VC 4DXGA 4ODGA 1FYCA 2D5DA 2EJGC 4FO2A 5C0XJ 1AZQA 1NAPA 2KA7A 1BDOA 3PV0A 2WV6D 4TKOB 3EA6A 2K7VA 2TMPA 1D1IA 2MUYA 5M5WB 1GXDC 1SDFA 2WKDA 3C1EA 1U4PA 1QNUA 1B50A 1BUVT 2FMMA 2WKCA 3W2DA 3HOVB 5CR3A 2EYOA 4O1NA 1ZKOA 4IFDI 1ENCA 3VR3A 1ET9A 1NR2A 3FMCA 5JEAG 4F87A 1EY4A 5AFWA 3VYSA 4OO1I 3QOLA 5IODA 1TWGB 2R7ZB 4DU9A 4KN4C 1GUGA 4RWSC 2F0TA 1WTPA 1STBA 3HEJA 4Q5VA 1SNOA 3OWEB 3GTKB 1PFBA 2F0NA 4J1MA 3HRZC 2QCPX 2OEOA 4E6IA 4L63B 1G8ZD 1X32A 3T56B 2EY6A 2IW3A 3M4OB 3VR4A 3IFDA 5IGGA 4KTAA 1ET6A 5J39A 1Q8IA 2X69A 1JWSD 1RODA 2QILA 5CYUA 2L4NA 4J6HA 2B8GA 1TT2A 1B53A 2MHVA 4C3HG 1X3PA 2OXPA 4IALA 3I72A 1JOOA 4BY7B 1HUNA 3MA2B 1DD2A 4U673 1S5DD 1H9SA 5IGBA 3I90A 1STHA 3J80E 3NUCA 4WORA 3URYA 3FKIB 4V190 1BOSA 5C0XG 1EYCA 1EFID 4WRDA 2E75C 4WFN3 3TN2A 2CQAA 3HS0C 2K6AA 3SK8A 3PUYA 4LJZC 2IX0A 4XYQA 1MI2A 3K57A 5G3LF 5I6YA 1O7LA 1TWCB 3NTKA 3GO5A 3GP7A 1IL8A 5FKAC 1MSHA 3PO2B 1FD7D 1BO0A 4XYOA 1K8MA 2CHBD 5NUCA 2F3WA 4FVMA 2EY1A 4GZYC 1BR9A 5E4WC 2PZUA 4FXDA 2A6HC 5C5LA 2NTTA 1SYCA 1XWEA 1RDPD 2FINB 1PFMA 1SJHD 1M8AA 1LACA 3PO3B 4FXGC 2F0OA 3I73A 1PTOF 2DY8A 4UAIA 3LWUA 1PTOC 2Z8LA 3MXNA 1XYIA 5T1IA 1EY7A 1O7YA 3MC0B 2ZT9C 2J0TD 2WB1B 3F2UA 4CGYB 4XDXA 3NQTA 1HFNA 3S1NB 2A5HA 4K2LA 3HG9A 5JAVA 1I6HB 2QEJC 1KNEA 2SOBA 2BE5C 4B9XA 2B2YC 3NTHA 3CRLC 4QB4A 1OXXK 2Z4IA 2E74C 3I4MB 3SR1A 1WTOA 3OWFA 1KAAA 4YIJA 1T5EA 1STAA 3NPPA 5E3FA 1CZWA 5CC4A 4NDXA 1SNDA 3T13A 3HGBA 4BBSB 5A35A 4KD4A 4FF1A 3KLRA 1UNSA 5EPKA 2C5CA 5J22A 1RTNA 3EJIA 4ZKCB 1LTBD 1DCZA 1H9RA 2B2UC 1SNPA 1Y8OB 4PQXA 3GD7A 3T51B 3DUZA 2RDFA 2XIWA 4HSPA 2F0VA 2XSCA 1C4QA 2L0CA 2A68C 1S5FD 1RJTA 3TP7A 2VUMB 4NP5A 4KY7A 3S14B 4QUFA 2J7ZA 2E2IB 1E0BA 2L55A 2ZXPA 1RKNA 2LY7A 3C46A 3SHLA 3HOYB 1V1OA 1CHQD 4ZYSA 4KKTA 2KEDA 3NBHA 4CKCA 2K01A 4I65A 2PQEA 3X3NA 2F0LA 5I2YA 2I46A 4FNFA 5BN3A 3WDNA 3NWSA 4HSVA 3KK7A 3I3CA 1WD1A 1PDQA 1DXMA 1G2TA 2DNEA 4A3BB 3I4NB 4HMJA 1VF7A 3X3MA 5DNFA 2YYZA 2BA0A 2O5IC 2AUKA 1U4MA 3M85A 1TWHB 2EYHA 1A2TA 5CORA 1Y69U 3FPPA 4TQUS 1BF4A 2M00A 3FPUB 3R3OA 5FK9C 4KD3A 1B1ZA 2AQ2B 3VA5A 3P1HA 1CT1D 5EBCA 4HEDA 3TZDA 4IUPA 1FNVA 1LTAD 2B2VC 4ZRZA 1WCMB 4TSSA 1FNWA 1TS4A 3MWYW 3QO2A 4C3IB 1JWUD 1PRTB 1O7ZA 4CKEA 4RH6A 3WOEA 5K5PA 1HA5A 3I91A 5M9OA 2BOSA 4CJ0B 4NKLA 3HOXB 2R92B 1NSNS 1OXVA 2KECA 5F2DA 5C4HA 4C1NK 1QILA 2NBFA 1PXUA 3V96A 2WINB 4IUTA 5CV8A 2JA7B 2WP8J 1IYVA 4LMQD 2NN6H 1SNQA 1EY0A 1CZGA 1VF5C 4ABNA 2JEAI 3MEHA 2XRSD 4A93B 3GTQB 2PZTA 2MGSA 3U9OA 3RZDB 2EYPA 1Q3LA 1F9PA 1SYDA 4DFAA 3KLSX 4RA8A 2PZWA 5C0XI 1GUWA 4A3EB 4G7HC 1UAPA 3FEWX 5CV4A 4RGTA 2E2HB 2NVXB 3KLSA 1SNMA 2OT2A 1H9SB 1TKWB 1SYGA 5ELBA 1SJED 1IYUA 3OSOA 1HA6A 5HURA 2CW0C 3CKIB 3GTPB 1JOQA 4X3SA 4RHSA 2F0DA 1ENFA 2JYOA 2XWJB 2RQXA 4XQJA 1XX8A 5C4ZA 3OIQA 3S2HB 2A73B 1V1PA 2V4DA 1DM0B 1OO9B 3H09A 1GUSA 4DA2A 3A7LA 1L0XB 3SEBA 4XXEA 5C6AA 3K5NA 2A74C 3K58A 2F03A 1NUCA 5EQ0A 4G4KA 2HDMA 3VR2A 3K6OA 4C3IG 4O42A 1ML0D 1BCPF 3SE0A 1EIHA 1BCPC 4C2MB 4XT1B 2F0KA 4PMWA 4CBVA 1STYA 3Q0AA 2KVMA 4QIWB 1I50B 1LABA 3ONAB 3HP3A 3C1FA 3MTSA 4A3DB 2A6EC 1HTPA 4CHTB 1DZ1A 3J81E 2RA4A 2K5DA 1J9OA 1BBXC 3JAME 2BCOA 1TQOA 2EYFA 3DWPA 5M5XB 1KLUD 2IWHA 1RHPA 4BY1B 1G6ZA 4HTHA 1D2BA 3D4DA 5HGTA 2L11A 2M9VA 2VNUD 5G3LD 4XIGS 5K36G 5M3MB 1GUNA 3IL8A 4BWGB 3TBIB 2EYLA 4IFDH 1Q12A 4IUQA 1B4OA 5CV7A 5IIFA 1BNZA 1ZEQX 2JSOA 3J7YW 2PNRC 2K32A 3KUPA 1STGA 1S5CD 1OXTA 2QDBA 2A6HD 1G91A 4DN4M 3QOJA 2SDFA 1F9QA 3FVQA 1JE4A 5E1FA 1RCVD 1TIID 1W6JA 1PTOD 1PTOH 1U4LA 2L1BA 5C5MA 5D3DA 2TSSA 1IW7C 5ELCA 1LT3D 2NB0A 3U9SA 1EU4A 4RGNA 1II3A 3H94A 3E6ZX 3S15B 4FXKC 3D4WA 4NW2A 1BXTA 1EY9A 1Y8NB 1B9MA 1LT6D 2XNAC 2EOTA 4DNRB 3BVZA 2EE1A 2L12A 2BE5D 2H1EA 5C44B 3BZDB 3NP8A 3NWTA 1A3TA 2EYMA 3RMHA 1EIGA 5FLXL 1E2ZA 1JR0D 3G7LA 3GTOB 4S3SA 2LKVA 5BN4A 3A55A 4MIUA 2WACA 1SSOA 4L8JA 3K59A 1O80A 5EBDA 3S17B 3NQIA 3M3YB 2AQ1B 5E4XA 3DM1A 1ZYRD 1S5BD 3SK4A 5JPNC 4HCSA 4I7ZC 4V0BA 1RD9D 2R93B 1I4GA 1DONA 2G9HD 1G2SA 4XTCS 4ID6A 2I07B 1TU2B 5A2QL 2NWGA 3TP5A 2JA8B 3O13A 4KHZA 2D9UA 1Q1BA 2XVSA 2IL8A 2NVQB 5BN5A 1O78A 2A68D 5I6WA 2LMCB 3GTJB 2K04A 5M5YB 4K8IA 1KDBA 4TRDA 1CA5A 3C3LA 1RF2D 4EQOA 3ITPA 1AFPA 1EWCA 1RTOA 4HAEA 4WJWA 3OHXC 3QWNA 2H4OA 4X3TA 1IKLA 3GTMB 5C4XB 3KBGA 3BVGA 4G7OC 2EY5A 1DOKA 2MP1A 3DEOA 4IZ8A 2CVRA 2NUCA 3S9WA 2N55A 4U68A 1QWYA 1ESFA 2FMCA 4HN7A 2O2LD 3G6JB 2KHSA 4PMCA 3GV3A 1E2VA 5CBAE 5I4DA 4A3KB 3PUVA 2K5QA 3GV6A 2HCIA 4KKSA 2E76C 4RCNA 1B3AA 2ZXRA 5EKIA 1EZ8A 2IX1A 1LO5D 3C2PA 1EY8A 3TP8A 3BVMA 2JP1A 4PV1C 2B8FA 1YNJC 5IT9L 3I70A 4DAPA 2NVTB 5C3WA 4OHJA 2FFKB 1A2UA 4HCEA 2F3VA 1OXUA 4K5VA 1V1PB 4FF3A 3IAYA 3M7GA 3MXUA 3D6WA 1SE3A 3VYTA 1U9RA 2JEBI 1AEXA 5IOCA 3D6CA 3PMFA 4H7BA 2B2TC 1CI3M 3E5SA 2PYKA 1HQRD 3EVQA 3HOWB 3BYTB 4EQNA 3P20A 5I9PA 3P7JA 1FNUA 3SXHA 1R9TB 2IT1A 5EPJA 1XXGA 3K5LA 3VA7A 1Y1VB 4FP5D 5D3IB 3QG1A 4ULLA 2IPKD 2ICEC 1QNKA 1EYDA 2WAQB 3M4YA 3LX0A 4A3FB 2F0QA 2EYJA 4K6LA 2KCCA 2EDGA 1CTMA 3ERQA 1QG7A 2RDHA 1WTVA 1VMCA 1JC7A 2A69C 1EQTA 3L9AX 2RSOA 4RKLA 3ND9A 1GHKA 2G9DA 1XTCD 1CQVA 2Q8RE 3MZ5A 3Q22A 4BBRB 4H0LC 4HMIA 1QE6A 1EY6A 1GUOA 1KDCA 4ZKBB 4DNTB 5JEAH 2K03A 2ZXOA 5CV9A 2B2YA 1H9KA 2L9HA 4FF4A 3TP6A 5JPMC 3BG3A 1GUTA 2K5WA 5DEHA 2LFNA 2OF1A 1L0YB 2Z1CA 3IFTA 1TS5A 3N52A 3NK9A 1MD2D 2NN6I 5ELDA 4IN3A 2VB3X 3GTLB 2B39A 3VYRA 1SXTA 4A3GB 2K33A 5CGKA 3GQBA 1F9RA 5KNBA 1EL0A 2B2UA 3A56A 1CQFA 1MBYA 1OXSC 1YNNC 5T1GA 3AB9A 1NCVA 3OMGA 5JJZA 1PRTF 2PPBC 1PRTC 4RCOA 3OMCA 1BCPD 1STEA 5EJWA 1ONLA 4LAAA 5JVG3 5JEAJ 3FRPB 5EKLA 3KF8A 3MXGA 5IGDA 1C48A 1HXYD 3ZYYX 3A8IE 4XQNA 1LTGD 1B9NA 1T5XD 1NR4A 5ELFA 2AQ3B 2Z4HA 2IX3A 3T4AC 1MGSA 5CBEE 3LNNA 2J4XA 2AWOA 1KLGD 2QKIC 2QF7A 2XWBB 2NZ1D 1Q90A 5C0XH 1AW7A 3EFXD 4H13C 3GTGB 3PIO3 2HDLA 3A7AB 3MFGA 1I3QB 4KY5A 1DOLA 2JXMB 1F77A 2EXZA 1JOKA 1I4QA 3V05A 5CV6A 1C8CA 4KMUC 4DAVA 4CKBA 2LS01 4R8NA 2EPBA 1JORA 2VXWA 4ZAIA 2SEBD 1QB5D 5FO9B 3S1MB 1W6KA 1PZKD 3NBIA 4K5XA 4B9WA 2AUJD 5KNDA 2F0PA 1AN8A 1I4PA 4C3JB 3V2TA 4KHVA 1TY2A 1ILQA 3N6RA 4ZLTF 4DXFA 1UEAB 2D2CC 1R4PB 4Y7NB 2KCNA 1JWMD 1K83B 2X6LA 1M4VA 5D14A 1D5MC 3CQZB 1IW7D 1K8OA 2X6GA 4DAYA 4M8AA 4ZUIA 1KDAA 3H6MA 2ICIA 2B2VA 2FJ2A 1TS3A 3S1QB 4A3MB 1ZXTA 1SMYC 4F7XA 4DK0A 3H3VC 3J80L 3SVMA 2PO4A 4PMBA 1D5ZC 1X3QA 2Y0SB 3BDCA 4IUNA 5ELEA 5FO7B 2BDNA 3MFYA 1EYAA 2KUMA 3R2TA 4RFBA 5C3EB 3HZXA 1SEBD 2SNMA 1PLFA 1JB3A 4DF7A 1TWAB 2NTSA 1EOTA 3PIP3 1WD0A 2DN8A 3D4RA 3TMEA 2K05A 4OO1H 2O5JC 2EZVA 3LWEA 3D8GA 1D5XC 4IUVA 3SK5A 2EVBA 4OIKA 5I2XA 3CHBD 1SBBB 2B2WC 4ZQ3A 5FO8B 3S2DB 2F4IA 1HUMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K5X A;  4B9W A;  3C1F A;  5IOC A;  1STA A;  4OL7 A;  3D6C A;  3QOL A;  3BDL A;  3PMF A;  5E3F A;  1II3 A;  5CV5 A;  1EQV A;  2PZW A;  4H7B A;  2F0P A;  4K8I A;  5I6Y A;  5CC4 A;  3E5S A;  1KDB A;  4K6D A;  2PYK A;  2RBM A;  4HMJ A;  4TRD A;  3D4W A;  4NDX A;  5IOD A;  1SND A;  5CV4 A;  5KEE A;  3T13 A;  3EVQ A;  5I9O A;  1EY9 A;  1F2Y A;  4KY6 A;  4KD4 A;  5CGK A;  2F0W A;  4DU9 A;  5EKK A;  3SK8 A;  2ENB A;  4EQO A;  3ITP A;  2F0H A;  1SNM A;  3V2T A;  4EQN A;  4KHV A;  5I9P A;  5J1Z A;  2F0T A;  2PW7 A;  4K5W A;  1SYG A;  5J22 A;  3EJI A;  4N9T A;  3SXH A;  1STB A;  3HEJ A;  4DGZ A;  1SNO A;  3OSO A;  5NUC A;  2F3W A;  2EYH A;  2EY1 A;  5HUR A;  1SNP A;  1TQO A;  2EYF A;  2EY2 A;  1A2T A;  2EY5 A;  3OMG A;  2F0N A;  4J1M A;  2M00 A;  5DAU A;  3NP8 A;  1IHZ A;  1TR5 A;  2OEO A;  3R3O A;  1A3T A;  2EYM A;  4E6I A;  2PZU A;  1JOQ A;  4G57 A;  3OMC A;  4KD3 A;  4IZ8 A;  2F0U A;  5C5L A;  3VA5 A;  3P1H A;  1SYC A;  3NHH A;  4HTH A;  2F0E A;  2F0D A;  4LAA A;  1EYD A;  4ZUI A;  2SNS A;  2EY6 A;  2NUC A;  3LX0 A;  2F0Q A;  2EYJ A;  1KDA A;  3S9W A;  3D4D A;  5HGT A;  3H6M A;  4S3S A;  2LKV A;  5EKL A;  3T16 A;  4MIU A;  5C4Z A;  2WAC A;  3NXW A;  5EGT A;  2RDF A;  4ME5 A;  2F0M A;  2F0O A;  4EVO A;  5KYI A;  5IGD A;  4EQP A;  3ERQ A;  2F0F A;  4KTA A;  3DHQ A;  5IGG A;  1F2Z A;  1ENA A;  4F7X A;  3MHB A;  5J39 A;  2KHS A;  4PMC A;  2F0V A;  4ODG A;  4KV6 A;  4PNY A;  1EZ6 A;  1EY7 A;  2EYL A;  3ERO A;  4PMB A;  5IGF A;  4J6H A;  3TP7 A;  2KQ3 A;  3SK4 A;  3SR1 A;  1TT2 A;  4RKL A;  3BDC A;  2HQE A;  4IUN A;  4NP5 A;  5CV7 A;  5IGC A;  4KY7 A;  2OXP A;  4IAL A;  5IIF A;  1EZ8 A;  5KYL A;  1SNC A;  4F8M A;  3NQT A;  3MXP A;  4YIJ A;  1EYA A;  3MZ5 A;  1JOO A;  5K5P A;  3QB3 A;  4ZUJ A;  1EY8 A;  4HMI A;  4ID6 A;  5M9O A;  2F0G A;  4NKL A;  3TP8 A;  1EY6 A;  1RKN A;  1KDC A;  1A3V A;  1STG A;  4KY5 A;  3DMU A;  3TP5 A;  1NSN S;  2EXZ A;  2QDB A;  1JOK A;  4K2L A;  4QMG A;  5C6A A;  3SHL A;  4QF4 A;  5KRU A;  5F2D A;  5C4H A;  3HZX A;  3QOJ A;  5JOB A;  2F0S A;  2SNM A;  1NUC A;  5IGE A;  5ISR A;  3C1E A;  5CV9 A;  2F0J A;  1SYF A;  5IGB A;  5JAV A;  1STH A;  5CV6 A;  5CV8 A;  1F2M A;  5C3X A;  5C3W A;  4DF7 A;  5E1F A;  4R8N A;  3TP6 A;  5KIX A;  3NUC A;  2SOB A;  1A2U A;  1SNQ A;  3MVV A;  3P75 A;  4KJO A;  4WOR A;  1EY0 A;  5DEH A;  4I65 A;  3TME A;  1SYE A;  2PQE A;  1JOR A;  2F0L A;  1KAB A;  1STN A;  2F3V A;  2OF1 A;  3MEH A;  4B9X A;  5CR3 A;  5KGU A;  1SYB A;  4K14 A;  1EYC A;  4K5V A;  2PZT A;  4QB4 A;  2RKS A;  2EYO A;  3RUZ A;  2F0I A;  4WRD A;  3U9O A;  1EY5 A;  3D8G A;  5C5M A;  4KJN A;  3SK6 A;  4K2K A;  3SK5 A;  4NMZ A;  1ENC A;  5I6W A;  3NK9 A;  4RKB A;  2F0K A;  4ZQ3 A;  4K8J A;  1U9R A;  2EYP A;  1STY A;  3OWF A;  2O4X A;  1A3U A;  1KAA A;  1SYD A;  2PW5 A;  1AEX A;  4N9P A;  4DFA A;  1EY4 A; 
#chains in the Genus database with same CATH topology
 3L0O A;  2Z6K A;  4L6T B;  1QUQ B;  4LF8 Q;  5CMD A;  5LHY 1;  3FDT A;  2NN6 G;  2RBM A;  3WOF A;  4FDB A;  1EOV A;  4KY6 A;  1LTR D;  2BDO A;  4X64 L;  2PCF B;  1IKM A;  1LT5 D;  2F0H A;  1CHP D;  1TWC H;  5J1Z A;  2NYZ D;  4K5W A;  4LW1 A;  3E0J A;  2AWN A;  3PO2 H;  4DV1 L;  3PUX A;  1EQR A;  4C56 C;  3L2P A;  4BS9 A;  1XTD A;  3HKZ E;  3M3Y H;  4B3M Q;  3G6E A;  2NVY B;  3H91 A;  2E2D C;  1WTR A;  3EQL C;  1Q1E A;  1E2W A;  3PIP A;  1WTX A;  3M4Q A;  1BQQ T;  3A0J A;  4UHV A;  1L2F A;  4OGQ C;  1I4X A;  3T16 A;  4PZ6 A;  3NXW A;  4R4C A;  1SE8 A;  4EVO A;  3PUZ A;  4IFD J;  4C3J G;  2LXK A;  3M9B A;  3K0Y A;  1YBY A;  1I94 Q;  1F9S A;  3PO3 H;  1EZ6 A;  3CU7 A;  2Z9H A;  1FGB D;  3TEH B;  1K9M C;  4YY3 L;  1UUP A;  3KBX A;  1HTL D;  3TS0 A;  3RLO A;  4R9W A;  3RLF A;  4MTN A;  2ZTD A;  2NVQ H;  3MXP A;  4LUZ A;  1AE2 A;  4NXN L;  1U0L A;  1QOH A;  1EQQ A;  1K73 C;  1UWV A;  5COY A;  2UU9 L;  1A3V A;  4LNQ A;  4P73 A;  1HRJ A;  1TS2 A;  4BA2 I;  3TDQ A;  3S1N H;  3L7Z C;  4A3M G;  1SYF A;  2PMZ E;  1PTO B;  2JK8 A;  4X66 L;  1Q86 C;  3VYU A;  3R8B A;  4JI3 L;  3BDO A;  1EEF D;  3GTJ H;  1I6H H;  4K0K L;  1JIC A;  2Y0S G;  5KGU A;  2PNH A;  3CRK C;  1PFN A;  4ZK9 B;  3HOV G;  1D1K A;  1H9M A;  3U50 C;  1V43 A;  4DR7 L;  2Q8I B;  2H5X A;  1D7Q A;  2VB2 X;  3RZO B;  3TZU A;  3TSS A;  4N9P A;  2O4X A;  1A3U A;  1HPC A;  4ILW A;  1DJR D;  1EWH A;  2KEE A;  2MO0 A;  3S1R B;  4QQB X;  3I4M H;  4M1U B;  1GJX A;  2KOL A;  1I4R A;  3GTM H;  5C4X H;  1LTS D;  2PI2 A;  1HQM C;  4YHH L;  1VMP A;  2MJ8 A;  1VCI A;  4JI1 L;  1YNJ D;  4JK1 C;  2L5T A;  2PW7 A;  5LL6 S;  2YU9 B;  4JBW A;  1DYQ A;  3W3A A;  4P2C B;  1QVF A;  4MHE A;  2K52 A;  4R4Q A;  3UE1 A;  1JCK B;  4RHR A;  2EY2 A;  2OQ0 A;  1CM9 A;  4HR7 B;  3DXJ C;  3HOU B;  1AZP A;  2ID0 A;  1H9J A;  2R6G A;  3SDZ A;  4A3J B;  4A3K H;  1WVL A;  1B44 D;  4C1N I;  4OXP A;  5EGT A;  1Z47 A;  2RDG A;  4EQP A;  2JA5 B;  3DHQ A;  1ENA A;  3J7A F;  3CXC A;  1WTW A;  1PH6 A;  2UXC L;  3K7A B;  3EIV A;  3UDX A;  4J8Q A;  1CFM A;  3OW7 A;  4B3M L;  1PV4 A;  2WII B;  4DR1 L;  2K75 A;  2KQ3 A;  2D62 A;  1HZA A;  2HQE A;  3VR6 A;  3MAQ A;  2GA4 B;  1MSG A;  1SAP A;  3I4L A;  2B2W A;  1JJG A;  4OIJ A;  2NVT H;  1HZB A;  5KYL A;  2HUG A;  5FLX E;  4F8M A;  2VUM H;  1WJJ A;  3S14 H;  1NMG A;  4DUZ L;  4RGO S;  4AYB E;  3Q6S A;  2E2I H;  5KRU A;  1E3P A;  1LLR D;  1N32 L;  4DV5 L;  1HNW L;  4I7A A;  4RAU C;  4IFD G;  3KFU A;  5C3X A;  2K5N A;  3KF8 B;  4UDU C;  3HOY H;  2HIX A;  1SE2 A;  1ZYR C;  3P75 A;  4KJO A;  4OO1 G;  2R61 A;  2M2L A;  4JI7 Q;  3DEP A;  3T53 B;  4JI0 L;  4LF7 Q;  4Z9C B;  2A69 D;  4X3K A;  4K2K A;  1KNA A;  4CJ1 B;  3K5M A;  2YV5 A;  4RKB A;  4K8J A;  2MPM A;  4N8X 1;  5A2Q E;  5KNC A;  1QCB D;  3EN2 A;  3BS1 A;  2RVL A;  5CV5 A;  1EQV A;  1QZG A;  3K5O A;  4IUU A;  1YIJ A;  1PH7 A;  2EJM A;  1VQ9 A;  4JPB W;  1U4R A;  3DWA A;  4H44 C;  1F2Y A;  5I9O A;  2GVA A;  2PI2 E;  1XPO A;  1TVX A;  5EKK A;  2ENB A;  3RD4 A;  2XRQ D;  4A3C G;  2C9O A;  3J7Z C;  4A3B H;  3I4N H;  3NTI A;  5IYD H;  1LTT D;  1TY0 A;  4N9T A;  4DK1 A;  4X3U A;  4A3F H;  1BVS A;  3R2I A;  3H0G B;  1F2L A;  4A3I B;  3HOZ B;  1IHZ A;  1TWH H;  1MKH A;  3U4V A;  1V9P A;  3NHH A;  5TSS A;  5DM6 3;  2MO1 A;  1B2T A;  3KLW A;  5LL6 X;  1A62 A;  4DKA C;  3F8T A;  2N78 A;  4ME5 A;  4GKJ Q;  2DY7 A;  4JG2 A;  2K4K A;  2K50 A;  4KK7 A;  1F2Z A;  4KN7 C;  4BBR H;  3CAM A;  4A76 A;  1G51 A;  3BZC A;  5EAY A;  3IKJ A;  4KV6 A;  4PNY A;  1QJO A;  1PH5 A;  1HHV A;  2F1M A;  2Q8T A;  1A6X A;  3ND8 A;  3PUW A;  1YJN A;  1WCM H;  3NEN A;  4P75 A;  5IYB H;  3ULP A;  1YNN D;  1PYB A;  2GN5 A;  1NJI C;  1J8I A;  4FF2 A;  4C3I H;  1KTK A;  3HKZ B;  3QB3 A;  4DV3 L;  3HOU G;  2F0G A;  3PGZ A;  1Y8P B;  1PRT D;  5C4J B;  4A3J G;  2OCE A;  5D65 A;  1R4Q B;  3QJY A;  1DOM A;  1K3R A;  5FLM H;  1HNZ L;  4DAY B;  3A54 A;  5JOB A;  1Y1W B;  3T1Y Q;  3G48 A;  2F0J A;  3D31 A;  3HOX H;  3M7N A;  1A15 A;  1VDZ A;  2JA5 G;  2R92 H;  3HKS A;  1F2M A;  2XN9 C;  1PMR A;  1S4Z A;  2LXJ A;  3J81 c;  3CC2 A;  1CA6 A;  4DR5 Q;  1KAB A;  1STN A;  2JA7 H;  1B8A A;  2G5D A;  4KKU A;  1SYB A;  4DUY Q;  2RKS A;  2CW0 D;  1L1O C;  2F0I A;  2EXD A;  3A74 A;  1LV9 A;  1PYW D;  3SK6 A;  4NMZ A;  3DWQ A;  4A93 H;  3GTQ H;  4F88 A;  3JAM c;  4LF6 Q;  3OOC A;  3VR5 A;  2CFM A;  4OL7 A;  1YJ9 A;  1K0R A;  3RZD H;  2K14 A;  3RN2 A;  1M90 C;  5EPL A;  1CKM A;  3DM3 A;  2B63 B;  4IQZ A;  5IT9 E;  1LTI D;  2F0W A;  4LF7 L;  1Q46 A;  3W1G A;  4KI0 A;  1Y14 B;  3J81 j;  3S16 B;  4A3E H;  3Q24 A;  4JBM A;  2PMZ B;  1FJG L;  4BBS G;  1Z6H A;  4OWX B;  2E2H H;  2NVX H;  3NSW A;  1SE4 A;  5K36 H;  1K8G A;  1WTQ A;  2JA6 B;  1VQI A;  4XT3 B;  5DAU A;  3A8J E;  2KJX A;  3AFQ A;  1SFO B;  1TWF B;  4LK1 C;  1VQC A;  3A8K E;  2F0U A;  3BYY B;  1EU3 A;  2F0E A;  3GTP H;  2HCC A;  3AYH B;  5JVH 3;  3AEV A;  2BA1 A;  2E2J B;  4CDF C;  1VQL A;  1CKO A;  1KAW A;  4HJ5 A;  2XGT A;  5KYI A;  1SLJ A;  1PZI D;  4DV2 Q;  3I55 A;  2F0F A;  2R7F A;  4EGV A;  2K5V A;  3Q23 A;  3MHB A;  2KHI A;  3AQQ A;  1UE6 A;  3L3O C;  4BA1 I;  3STB C;  1IBM L;  3ERO A;  3S2H H;  5GAE C;  4CJ2 C;  4GNX A;  3H0G G;  3NEL A;  5IGC A;  5M3F B;  1ESR A;  4QCL A;  2N88 A;  4A3I G;  4GLX A;  3MEF A;  4NXM Q;  3HOZ G;  1CSQ A;  3QIA A;  1SNC A;  4DR2 L;  2RSN A;  2MQH A;  4ZUJ A;  1HNX Q;  5DM7 3;  4B08 A;  5LMU Q;  1HFG A;  1UE5 A;  3DMU A;  2A6E D;  4QMG A;  4QF4 A;  2F0S A;  1AP0 A;  4IPG A;  5IGE A;  5ISR A;  4XQQ A;  4JI4 Q;  3R93 A;  3OIP A;  3UI2 A;  2K1B A;  1GOZ A;  3J81 L;  3H15 A;  4JV5 Q;  5KIX A;  2VQE Q;  1S5E D;  3MVV A;  1CK1 A;  4POF A;  2AHO B;  1SMY D;  1SYE A;  1XNR L;  2JE6 I;  3D3R A;  3H3V H;  4K14 A;  4Q0F A;  4YCU A;  3AU7 A;  3RUZ A;  5FOB B;  4L5Q A;  1LT4 D;  1EY5 A;  4KJN A;  3JAM L;  3J7A V;  1GD7 A;  1JQY D;  2OQK A;  1Z7T A;  1GM5 A;  2PW5 A;  3HKZ G;  2B2T A;  5IGF A;  4HIK A;  1G29 1;  5IE8 A;  4LF9 Q;  3BDL A;  5IYC H;  4C2M H;  1V8Q A;  1B3Q A;  1Y1W G;  4K6D A;  1X65 A;  4DR4 Q;  4N8F A;  5KEE A;  4IOA A;  1K83 H;  2FHT A;  4AYB B;  4DR5 L;  3K0X A;  1FR3 A;  3OPO A;  4DUY L;  4LF5 Q;  1HCZ A;  1C7Y A;  4JVZ A;  1P16 A;  4A3D H;  4IUR A;  3F2B A;  4RGM A;  2Z6B A;  2WB1 E;  1XNQ Q;  3CD6 A;  1N34 L;  4LF6 L;  4DGZ A;  1PZJ D;  2ZM6 Q;  2K28 A;  4BXX H;  1ICW A;  1BCP B;  2DJG C;  1EEI D;  4C3H B;  1ILP A;  3NE5 B;  2R3Z A;  1TR5 A;  4G57 A;  4QUC A;  4TVA B;  2EJF C;  1I4H A;  3PF4 A;  5M5X H;  4FYD A;  2BH8 A;  2SNS A;  4R8I A;  1GHJ A;  2DNC A;  2B63 G;  4G7Z C;  4BY1 H;  1N36 L;  3CCV A;  4MN3 A;  4YCW A;  3AMU A;  1K28 A;  2F0M A;  1D6E C;  1TXY A;  3I8Z A;  2IJ0 A;  1I6V C;  4DXG A;  4ODG A;  4PZ7 A;  1FYC A;  2D5D A;  2EJG C;  4GOP A;  5C3E H;  4ALP A;  4FO2 A;  2ATW A;  5M3M H;  4NPS A;  5C0X J;  1AZQ A;  1NAP A;  2KA7 A;  2ES2 A;  1BDO A;  3PV0 A;  2JA6 G;  2WV6 D;  1G6P A;  1BBU A;  4TKO B;  3EA6 A;  2K7V A;  4DV7 L;  2TMP A;  1D1I A;  5FJ8 G;  1LUZ A;  4X62 L;  2I5M X;  2MUY A;  5M5W B;  1HZ9 A;  1GO3 E;  1GXD C;  1SDF A;  2WKD A;  3C1E A;  4DV6 Q;  1U4P A;  1QNU A;  1B50 A;  1BUV T;  2FMM A;  2WKC A;  3W2D A;  3HOV B;  4NXM L;  5CR3 A;  2EYO A;  4O1N A;  5M3F G;  1MJC A;  1ZKO A;  4IFD I;  1ENC A;  3VR3 A;  1ET9 A;  1NR2 A;  2IY5 B;  3FMC A;  5JEA G;  4F87 A;  1EY4 A;  4JI4 L;  4JBJ A;  5AFW A;  3UE0 A;  3VYS A;  4OO1 I;  3QOL A;  4JV5 L;  2VQE L;  4ME3 A;  5IP7 H;  2E5L Q;  5IOD A;  1TWG B;  2R7Z B;  4DU9 A;  4POG A;  4KN4 C;  4A3E G;  4LFA Q;  1GUG A;  1XMQ L;  4RWS C;  2F0T A;  1WTP A;  1STB A;  3HEJ A;  4Q5V A;  1SNO A;  2ZTE A;  3OWE B;  2KHJ A;  3GTK B;  4LF9 L;  1PFB A;  4QL5 A;  1B7Y B;  2JN4 A;  2F0N A;  4J1M A;  3HRZ C;  2QCP X;  2OEO A;  4E6I A;  4L63 B;  1KRT A;  4DR4 L;  5C44 H;  2IHE A;  1G8Z D;  1X32 A;  4LF5 L;  3T56 B;  2ALY B;  2EY6 A;  2IW3 A;  3M4O B;  1PHJ A;  4AYB G;  1J5E L;  3VR4 A;  1XNQ L;  3IFD A;  5IGG A;  4KTA A;  1IYJ B;  2ZM6 L;  1ET6 A;  5J39 A;  1Q8I A;  3GTO H;  2X69 A;  1JWS D;  1ROD A;  2QIL A;  3S17 H;  5CYU A;  2L4N A;  4PG3 A;  4J6H A;  2B8G A;  1TT2 A;  4OWW B;  3ERS X;  1B53 A;  4MZ9 A;  2MHV A;  4C3H G;  1X3P A;  1L0W A;  2OXP A;  4IAL A;  2A8V A;  4GN4 B;  3F2D A;  3I72 A;  1JOO A;  4JOI C;  4BY7 B;  1HUN A;  1XJV A;  3MA2 B;  1VQK A;  1DD2 A;  4KHP Q;  4U67 3;  2R93 H;  1S5D D;  1PFS A;  2GVB A;  2WAQ E;  4P74 A;  1H9S A;  5IGB A;  3RZO H;  3I90 A;  1STH A;  3J80 E;  2CQO A;  2JA8 H;  3NUC A;  2HHH Q;  1LTL A;  4WOR A;  3URY A;  3FKI B;  4V19 0;  5J3B A;  1BOS A;  5C0X G;  1EYC A;  1EFI D;  4WRD A;  2E75 C;  4WFN 3;  3TN2 A;  2CQA A;  3HS0 C;  2K6A A;  4IO9 A;  3SK8 A;  3PUY A;  1NNX A;  4LJZ C;  2IX0 A;  4XYQ A;  1MI2 A;  3K57 A;  5G3L F;  3SGI A;  5I6Y A;  1O7L A;  1TWC B;  3NTK A;  3GO5 A;  3GP7 A;  1IL8 A;  5FKA C;  4DK6 C;  1MSH A;  4LF4 Q;  4A3D G;  1FD7 D;  5M5Y H;  3PO2 B;  4HJA A;  4EX5 A;  4LFB L;  2EIF A;  1BO0 A;  3F1Z A;  1K8M A;  4XYO A;  1VQB A;  1Q7Y C;  1OTC A;  1YHQ A;  4JYA L;  2CHB D;  5NUC A;  2F3W A;  4FVM A;  4HIO A;  1X3F A;  2EY1 A;  2HQL A;  4GZY C;  1E1T A;  1BR9 A;  5E4W C;  5LMN W;  1VQD A;  2PZU A;  4FXD A;  2E5L L;  1RIP A;  2A6H C;  5C5L A;  2NTT A;  1SYC A;  1XWE A;  1RDP D;  2FIN B;  1PFM A;  1PH4 A;  4LFA L;  1SJH D;  1M8A A;  1LAC A;  2R7Z G;  3PO3 B;  4FXG C;  2F0O A;  3I73 A;  3CCS A;  1PTO F;  2DY8 A;  4UAI A;  3CP0 A;  3LWU A;  1PTO C;  4X65 Q;  2Z8L A;  1N8R C;  3MXN A;  1XYI A;  5T1I A;  1EY7 A;  4LF8 L;  1O7Y A;  3MC0 B;  3KJP A;  2ZT9 C;  2J0T D;  1EIY B;  2WB1 B;  3F2U A;  4CGY B;  4XDX A;  3PQI A;  3NQT A;  1HFN A;  4CDE C;  3S1N B;  3CW2 C;  2A5H A;  4K2L A;  3HG9 A;  2JJQ A;  3G71 A;  1X56 A;  5JAV A;  1I6H B;  1NTG A;  2QEJ C;  1KNE A;  2SOB A;  3K80 C;  2HD3 A;  1IBK Q;  2BE5 C;  4B9X A;  3CCQ A;  2B2Y C;  3NTH A;  3CRL C;  3ULL A;  4QB4 A;  3UDI A;  4IPH A;  1OXX K;  4KHP L;  2Z4I A;  1IXR A;  2E74 C;  4B3T Q;  3I4M B;  3I7F A;  4GNX B;  3SR1 A;  1WTO A;  3OWF A;  1KAA A;  1I94 L;  4YIJ A;  4BY7 G;  1NBW A;  2AMC B;  1T5E A;  2ZJQ A;  1STA A;  2YTV A;  3NPP A;  5E3F A;  4AIM A;  1CZW A;  4JCV E;  5CC4 A;  2MFI A;  4NDX A;  1SND A;  3T13 A;  3HGB A;  4BBS B;  5A35 A;  4KD4 A;  4FF1 A;  3E0E A;  4ZCK A;  2C35 B;  3KLR A;  1UNS A;  5EPK A;  2C5C A;  2Q2T A;  5J22 A;  3FKI G;  1RTN A;  3EJI A;  3KJO A;  3HOW H;  1XMO Q;  4ZKC B;  1LTB D;  1DCZ A;  1X55 A;  1H9R A;  2B2U C;  1Z9F A;  1SNP A;  1SR3 A;  1R9T H;  4A3L H;  5C44 G;  1X54 A;  1Y8O B;  4PQX A;  1Y1V H;  4R4T A;  1V1Q A;  3WWV A;  2D0P A;  3GD7 A;  3T51 B;  1ASZ A;  1KQS A;  3KYH C;  3DUZ A;  1E24 A;  2RDF A;  3PO2 G;  3QR8 A;  3U58 A;  5JJI A;  2XIW A;  4HSP A;  2F0V A;  2XSC A;  2OTL A;  1C4Q A;  3CPW A;  2L0C A;  2IHF A;  2A68 C;  1S5F D;  1RJT A;  3TP7 A;  2VUM B;  4EQ5 A;  4NP5 A;  4KY7 A;  4QIW E;  3S14 B;  2DJF C;  1EWI A;  4QUF A;  1YZ6 A;  2J7Z A;  5HGQ A;  4LFC Q;  2E2I B;  1B70 B;  1E0B A;  3BJU A;  2L55 A;  4RG1 A;  2ZXP A;  1RKN A;  2LY7 A;  3C46 A;  3SHL A;  3HOY B;  3PO3 G;  1V1O A;  1CHQ D;  4ZYS A;  4HIM A;  1NY4 A;  2JA9 A;  3G4S A;  4KKT A;  2KED A;  1UE1 A;  3NBH A;  1M1K C;  4CKC A;  2K01 A;  4I65 A;  2PQE A;  2RHQ B;  1U5K A;  3X3N A;  2F0L A;  5I2Y A;  2I46 A;  4FNF A;  5BN3 A;  2WB1 G;  3WDN A;  1QVG A;  3NWS A;  4HSV A;  1VQA A;  4GOP B;  3KK7 A;  5L37 A;  3I3C A;  1WD1 A;  5H1S E;  1E1O A;  1PDQ A;  5GQO A;  1DXM A;  1G2T A;  2DNE A;  3J80 i;  3ULJ A;  1FVI A;  4A3B B;  4KLK A;  3I4N B;  4HMJ A;  1IBK L;  1VF7 A;  3X3M A;  5DNF A;  2N3S A;  3GTL H;  1TWF H;  1JMC A;  2YYZ A;  2BA0 A;  2O5I C;  4JW0 A;  2AUK A;  4A3G H;  4B3T L;  2CCZ A;  4P71 A;  1U4M A;  3M85 A;  1TWH B;  3GDE A;  2EYH A;  1A2T A;  5COR A;  1Y69 U;  3FPP A;  4TQU S;  1BF4 A;  2M00 A;  3I4M G;  4DPG A;  3FPU B;  3R3O A;  4AQY Q;  5FK9 C;  5C4X G;  4IJL A;  4KD3 A;  1B1Z A;  2AQ2 B;  3VA5 A;  3P1H A;  4JI5 Q;  4JI7 L;  1CT1 D;  5EBC A;  2VS1 A;  1VQ6 A;  4GN3 B;  4HED A;  2PQA A;  3TZD A;  1X3E A;  4IUP A;  3A5Z B;  2UXD Q;  1FNV A;  2OWO A;  1LTA D;  3F2C A;  2B2V C;  4ZRZ A;  4OWT B;  4WJ3 M;  1WCM B;  4TSS A;  1FNW A;  1TS4 A;  3MWY W;  3QO2 A;  4C3I B;  1JWU D;  2UUB Q;  1MIU A;  1YJW A;  1RL2 A;  1PRT B;  1YIT A;  1O7Z A;  4CKE A;  4A3K G;  4RH6 A;  1YHB A;  3FP9 A;  5GRO A;  3WOE A;  5K5P A;  1HA5 A;  3I91 A;  5M9O A;  2BOS A;  4CJ0 B;  4NKL A;  3HOX B;  3TQY A;  2UXB Q;  2R92 B;  1NSN S;  1OXV A;  4J15 A;  1A63 A;  2KEC A;  5F2D A;  5C4H A;  4C1N K;  3GTG H;  1QIL A;  2NBF A;  1PXU A;  2KCM A;  3V96 A;  2WIN B;  2VW9 A;  4IUT A;  1I3Q H;  5CV8 A;  2JA7 B;  5AJ3 Q;  2WP8 J;  1IYV A;  4LMQ D;  2NN6 H;  1SNQ A;  1EY0 A;  1CZG A;  1VF5 C;  4ABN A;  1KC8 C;  2JEA I;  3CC4 A;  3MEH A;  2XRS D;  4A93 B;  2VUM G;  3GTQ B;  1WOC A;  2PZT A;  2MGS A;  1JT8 A;  3U9O A;  3OTO Q;  4GKJ L;  2A19 A;  3RZD B;  4PZ8 A;  2EYP A;  4L5T A;  1Q3L A;  1F9P A;  1SYD A;  4DFA A;  3CCM A;  3H3V I;  3KLS X;  4RA8 A;  3S1M H;  2PZW A;  2RCN A;  5C0X I;  1GUW A;  4MTK A;  4A3E B;  3BU2 A;  4G7H C;  3HOY G;  1UAP A;  1S3O A;  2Z0S A;  3FEW X;  5CV4 A;  4RGT A;  2Z6K C;  2E2H B;  4OEL B;  1N33 Q;  3FHW A;  4LWC A;  2NVX B;  3KLS A;  1SNM A;  2OT2 A;  1H9S B;  1TKW B;  1SYG A;  5ELB A;  1GVP A;  1SJE D;  1IYU A;  4C3J H;  3OSO A;  1HA6 A;  5HUR A;  3T1Y L;  2CW0 C;  3CKI B;  3GTP B;  1JOQ A;  1QZH A;  2Q2U A;  4Y7N H;  4X3S A;  4RHS A;  3J7A 5;  2F0D A;  1ENF A;  5JJL A;  2JYO A;  4A3B G;  2XWJ B;  2RQX A;  3CQZ H;  3I4N G;  4XQJ A;  5IYD G;  1XX8 A;  5C4Z A;  3OIQ A;  4DR3 Q;  2WAQ G;  1IBL Q;  4A3F G;  1JE5 A;  3S2H B;  1UEB A;  2A73 B;  3S1Q H;  1V1P A;  2V4D A;  1DM0 B;  1OO9 B;  4A3M H;  1CSP A;  4AQY L;  3H09 A;  1GUS A;  4DA2 A;  3A7L A;  1GKH A;  1K3B C;  1L0X B;  1UE7 A;  4X64 Q;  4R4I A;  3UDG A;  3SEB A;  4XXE A;  3HOV H;  1KIX A;  5C6A A;  4DV1 Q;  1SRU A;  3K5N A;  2CH4 A;  2A74 C;  4BBR G;  4RMF A;  1T9H A;  1AE3 A;  3K58 A;  2F03 A;  4JI6 Q;  1HH2 P;  1NUC A;  1BBW A;  5EQ0 A;  4G4K A;  1L1O A;  2HDM A;  3VR2 A;  1WCM G;  1HJP A;  5IYB G;  3K6O A;  4C3I G;  4HID A;  1ICF B;  4B3S Q;  1TWA H;  4O42 A;  3OW2 A;  1ML0 D;  1BCP F;  3SE0 A;  4UY8 C;  2QGQ A;  1EIH A;  4DV2 L;  1BCP C;  4C2M B;  4XT1 B;  2F0K A;  2P5Z X;  4PMW A;  1PH9 A;  4CBV A;  1STY A;  5FLM G;  3RLN A;  3Q0A A;  2KVM A;  4QIW B;  1I50 B;  1LAB A;  3ONA B;  3HP3 A;  3C1F A;  3HOX G;  5AJ3 L;  2R92 G;  4IJH A;  3S2D H;  3MTS A;  4A3D B;  2A6E C;  4JI2 Q;  1HTP A;  4CHT B;  1PVO A;  3OYY A;  1DZ1 A;  3J81 E;  2RF4 A;  2JA7 G;  2RA4 A;  1HNX L;  2K5D A;  2HIV A;  1JJC B;  5LMU L;  1J9O A;  2RHS B;  1BBX C;  4A93 G;  1E22 A;  3KDF A;  3JAM E;  2BCO A;  1TQO A;  2EYF A;  3DWP A;  5M5X B;  1X9N A;  1KLU D;  2AKW B;  4JBK A;  4X66 Q;  2IWH A;  1S40 A;  1RHP A;  2N8N A;  2QDL A;  4JI3 Q;  4BY1 B;  4WJ4 A;  1G6Z A;  1VQF A;  2B29 A;  2D0O A;  1EFW A;  4HTH A;  5FLX c;  4K0K Q;  1KL9 A;  1D2B A;  2NVY H;  1IZ6 A;  3D4D A;  5HGT A;  2L11 A;  1X3G A;  5IY0 A;  2ASB A;  4HJ9 A;  2M9V A;  2VNU D;  5G3L D;  4XIG S;  5K36 G;  5M3M B;  1GUN A;  1YHA A;  3IL8 A;  4BWG B;  3NEM A;  2EYL A;  4YWK A;  1CUK A;  3TBI B;  4IFD H;  1AH9 A;  1VQG A;  1Q12 A;  1VQH A;  4IUQ A;  1B4O A;  5CV7 A;  5LMN Q;  2V1C C;  2I5H A;  5IIF A;  5BR8 Q;  1BNZ A;  2VL6 A;  4DV4 Q;  1ZEQ X;  4O0A A;  2JSO A;  1IBL L;  3J7Y W;  2PNR C;  1Q8K A;  2K32 A;  3KUP A;  3TS2 A;  3UDF A;  4A4I A;  1S5C D;  1STG A;  1OXT A;  2QDB A;  2A6H D;  4R4O A;  1Q81 C;  1G91 A;  4DN4 M;  2OTJ A;  3QOJ A;  1D8L A;  2KBN A;  2SDF A;  1HR0 Q;  1F9Q A;  1J6Q A;  1VQN A;  3FVQ A;  1JE4 A;  5E1F A;  1RCV D;  1VS0 A;  1TII D;  1W6J A;  1JB7 A;  1PTO D;  1PTO H;  4QJF A;  1U4L A;  4A3C H;  1S72 A;  2L1B A;  5IWA Q;  1HZC A;  3W5O A;  5C5M A;  5D3D A;  1W3S A;  4DK3 C;  2TSS A;  4L5R C;  1IW7 C;  5ELC A;  3CCR A;  1LT3 D;  2NB0 A;  3U9S A;  1EU4 A;  4JI6 L;  2UXC Q;  3E9H A;  1N9W A;  4RGN A;  4DR1 Q;  2VZA A;  1VQJ A;  1II3 A;  3H94 A;  3E6Z X;  3S15 B;  4MNO A;  4FXK C;  3CCL A;  1YI2 A;  3D4W A;  4NW2 A;  1BXT A;  1EY9 A;  3S1R H;  4B3S L;  1Y8N B;  1B9M A;  4A75 A;  3RN5 A;  1LT6 D;  2XNA C;  3RNU A;  2EOT A;  5IP9 H;  4JI8 Q;  4DNR B;  1VQE A;  3BVZ A;  4DUZ Q;  2EE1 A;  3E9I A;  2L12 A;  3NBH B;  2MNA A;  1A0I A;  4DNI A;  1P8L A;  2BE5 D;  2H1E A;  5C44 B;  3CC7 A;  2YU9 H;  1N32 Q;  4DV5 Q;  1C9O A;  1HNW Q;  3BZD B;  4DV6 L;  5IYC G;  3LGJ A;  3CPF A;  3NP8 A;  3I2Z A;  3NWT A;  4DAM A;  1A3T A;  2EYM A;  3T1H Q;  3RMH A;  1EIG A;  4JI2 L;  5FLX L;  1E2Z A;  1XPR A;  4JI0 Q;  3G7L A;  1JR0 D;  3GTO B;  4S3S A;  2LKV A;  5BN4 A;  3A55 A;  4MIU A;  2WAC A;  1SSO A;  4L8J A;  3HOU H;  3K59 A;  1O80 A;  5EBD A;  4A3J H;  3S17 B;  3NQI A;  1YNX A;  2AQ1 B;  5E4X A;  3M3Y B;  3DM1 A;  4BXX G;  1ZYR D;  1WYD A;  3K81 C;  1EIF A;  1S5B D;  1I5F A;  2JA5 H;  3SK4 A;  5JPN C;  4HCS A;  3K7A H;  2ZJR A;  4I7Z C;  1A8V A;  2KEN A;  4V0B A;  1RD9 D;  2R93 B;  1I4G A;  1DON A;  2G9H D;  3AFP A;  1G2S A;  5ELN A;  4BY1 G;  4B3R Q;  4XTC S;  4ID6 A;  2I07 B;  1TU2 B;  5A2Q L;  2NWG A;  3TP5 A;  2JA8 B;  2I0Q A;  3O13 A;  1HR0 W;  4KHZ A;  2YTY A;  2WFW A;  5C3E G;  3ER0 A;  2D9U A;  1Q1B A;  5M3M G;  1CKN A;  2XVS A;  2PQA B;  2IL8 A;  5LMN L;  5IT9 c;  2NVQ B;  5BN5 A;  5E7N A;  5BR8 L;  4H02 A;  3D0F A;  1O78 A;  2Q2I A;  4DV4 L;  2A68 D;  4IOC A;  4BBS H;  3I56 A;  4DR6 Q;  5I6W A;  3W1B A;  2LMC B;  1HR0 L;  1WTH A;  3GTJ B;  2K04 A;  5M5Y B;  4K8I A;  1X6O A;  1KDB A;  4TRD A;  1CA5 A;  3C3L A;  1ASY A;  1RF2 D;  3Q8D A;  4EQO A;  3ITP A;  5JJK A;  1AFP A;  1EWC A;  1RTO A;  5IWA L;  4HAE A;  4IPC A;  4WJW A;  3CMA A;  4DV3 Q;  5GAH C;  3OHX C;  3QWN A;  2H4O A;  4X3T A;  1IKL A;  1HNZ Q;  3GTM B;  4QGU A;  5C4X B;  3KBG A;  3BVG A;  4G7O C;  2EY5 A;  1PYS B;  1DOK A;  4P72 A;  2MP1 A;  5IP7 G;  3DEO A;  2HHH L;  3H0G H;  4IZ8 A;  3J81 i;  1KHI A;  4A3I H;  3PCO B;  2BH2 A;  3HOZ H;  2CVR A;  2NUC A;  3S9W A;  2KCT A;  4JI8 L;  1LYL A;  2N55 A;  1NMF A;  4U68 A;  4APV A;  1QWY A;  1ESF A;  2FMC A;  3VDY A;  4HN7 A;  2O2L D;  1IL2 A;  3G6J B;  3JAM i;  4NB3 A;  3DLL A;  2KHS A;  4PMC A;  3KF6 A;  3T1H L;  3GV3 A;  1SRO A;  1E2V A;  5CBA E;  5I4D A;  4A3K B;  1PH2 A;  4JOI A;  3PUV A;  1Q82 C;  2K5Q A;  3GV6 A;  2CWP A;  2HCI A;  2E76 C;  4KKS A;  4RCN A;  1B3A A;  2ZXR A;  5EKI A;  1EZ8 A;  4LF4 L;  1QUQ A;  2IX1 A;  1LO5 D;  1VQ4 A;  4GNX C;  3C2P A;  1EY8 A;  1FJG Q;  3TP8 A;  1PH1 A;  3BVM A;  2JP1 A;  5GAG C;  1KD1 C;  4PV1 C;  1EYG A;  2B8F A;  5C4J H;  1YNJ C;  4GN5 A;  5IT9 L;  3I70 A;  4DAP A;  2NVT B;  5C3W A;  1PH8 A;  4OHJ A;  1QVC A;  2FFK B;  1Y1W H;  4QY7 A;  1A2U A;  2L15 A;  4AH6 A;  4HCE A;  2F3V A;  1PH3 A;  1W2B A;  3JC6 6;  1OXU A;  4GS3 A;  4K5V A;  2RCF A;  4B3R L;  1V1P B;  4FF3 A;  3IAY A;  3M7G A;  4JC0 A;  3MXU A;  3D6W A;  2YTX A;  1SE3 A;  3VYT A;  2R93 G;  1U9R A;  4X65 L;  2JEB I;  1AEX A;  2K5H A;  3CME A;  5IOC A;  4OX9 Q;  3D6C A;  3CCJ A;  3PMF A;  1IBM Q;  2B3G A;  3CCE A;  1LM0 A;  4H7B A;  2JA8 G;  1JJ2 A;  1KXL A;  2B2T C;  1CI3 M;  3E5S A;  2PYK A;  1HQR D;  3EVQ A;  1PA6 A;  3HOW B;  4UP9 A;  3BYT B;  2QEX A;  4DR2 Q;  4EQN A;  3P20 A;  5IP9 G;  5I9P A;  2E8G A;  3P7J A;  2B63 H;  2Y0S E;  3STB D;  1FNU A;  4YWL A;  1YEZ A;  4DR6 L;  3SXH A;  1SN8 A;  1R9T B;  1L1O B;  2IT1 A;  5EPJ A;  1XXG A;  3S16 H;  3K5L A;  3VA7 A;  1Y1V B;  3HFZ B;  1C0A A;  4FP5 D;  5D3I B;  3QG1 A;  4ULL A;  2IPK D;  3K7U C;  3ICE A;  2ICE C;  2UUC Q;  3KOJ A;  1VQM A;  3EBE A;  1QNK A;  1XNR Q;  2JA6 H;  1EYD A;  2WAQ B;  3CF5 A;  3M4Y A;  3LX0 A;  4A3F B;  1SFO H;  2F0Q A;  2EYJ A;  4K6L A;  2KCC A;  4GKK Q;  2EDG A;  1CTM A;  3IRB A;  5FJ8 H;  3S24 A;  3ERQ A;  1QG7 A;  2CWA A;  2RDH A;  2E2J H;  1WTV A;  1H95 A;  1VMC A;  1JC7 A;  2A69 C;  1EQT A;  3L9A X;  2RSO A;  4RKL A;  3ND9 A;  1GHK A;  4OEM B;  2G9D A;  4GOP C;  2F52 A;  1XTC D;  3KDF B;  1CQV A;  2Q8R E;  3MZ5 A;  3Q22 A;  2EQS A;  2NZO A;  4BBR B;  4H0L C;  4HMI A;  5M3F H;  1QE6 A;  1EY6 A;  1XMO L;  1GUO A;  1KDC A;  1N34 Q;  4ZKB B;  2UUA Q;  4DNT B;  5JEA H;  2K03 A;  1YVC A;  2ZXO A;  2R7D A;  5CV9 A;  5DLQ E;  2B2Y A;  2HT1 A;  1H9K A;  2L9H A;  4FF4 A;  3TP6 A;  5JPM C;  3BG3 A;  2F4V Q;  1GUT A;  1KRS A;  2K5W A;  5DEH A;  2Q2H A;  2LFN A;  2OF1 A;  1L0Y B;  2Z1C A;  1VQO A;  2VQF Q;  3IFT A;  1WFQ A;  1N36 Q;  1TS5 A;  3N52 A;  3NK9 A;  1MD2 D;  3PSI A;  2NN6 I;  5ELD A;  4IN3 A;  1VQP A;  2VB3 X;  3GTL B;  2B39 A;  3VYR A;  1SXT A;  1FGU A;  4A3G B;  2K33 A;  4LUV A;  5CGK A;  4YCV A;  3GQB A;  1F9R A;  5KNB A;  3B6Y A;  1EL0 A;  4LFC L;  2B2U A;  3CCU A;  3A56 A;  4DV7 Q;  1K8A C;  1CQF A;  4UP8 A;  4X62 Q;  1MBY A;  1VQ5 A;  1OXS C;  3BZK A;  1YNN C;  5T1G A;  4OX9 L;  3AB9 A;  4DV0 Q;  1NCV A;  3OMG A;  5JJZ A;  1PRT F;  1O7I A;  4IPD A;  2PPB C;  1PRT C;  2VY3 A;  4OON A;  4RCO A;  3OMC A;  4O2D A;  1BCP D;  1STE A;  5EJW A;  1VQ8 A;  4C3H H;  1ONL A;  4LAA A;  1K0S A;  3ZJY C;  5JVG 3;  5JEA J;  3FRP B;  5EKL A;  3HOW G;  3KF8 A;  3MXG A;  2F3I A;  2ZTC A;  5IGD A;  1C48 A;  1HXY D;  3ZYY X;  2QA4 A;  3A8I E;  4XQN A;  1DGS A;  1LTG D;  1B9N A;  4YWM A;  1T5X D;  1NR4 A;  5ELF A;  2AQ3 B;  2Z4H A;  2IX3 A;  3T4A C;  2DUD A;  3J80 c;  4A3L G;  2QW7 A;  1MGS A;  5CBE E;  3LNN A;  1Y1V G;  2J4X A;  2UUC L;  2AWO A;  4X6A H;  1KLG D;  2QKI C;  2QF7 A;  2XWB B;  2NZ1 D;  1WI5 A;  1Q90 A;  5C0X H;  1EUJ A;  1XMQ Q;  1AW7 A;  3EFX D;  4H13 C;  4GKK L;  3GTG B;  3PIO 3;  2HDL A;  3A7A B;  3MFG A;  1I3Q B;  1NE3 A;  4KY5 A;  1DOL A;  2JXM B;  1F77 A;  2EXZ A;  1JOK A;  1I4Q A;  3V05 A;  5CV6 A;  1C8C A;  4KMU C;  4CDC C;  5M5W H;  4DAV A;  4CKB A;  2LS0 1;  4LUO A;  4R8N A;  3TRE A;  4GLA C;  2EPB A;  1I50 H;  4JI5 L;  1JOR A;  2VXW A;  4ZAI A;  2CH4 W;  3RR5 A;  2N49 A;  1J5E Q;  2SEB D;  1QB5 D;  5FO9 B;  2UUA L;  3S1M B;  2JQO A;  2NZH A;  1W6K A;  2UXD L;  1VQ7 A;  1PZK D;  3NBI A;  4K5X A;  4B9W A;  2AUJ D;  2LSS A;  5KND A;  2F4V L;  2F0P A;  1AN8 A;  2UUB L;  1I4P A;  5ELO A;  2CKZ B;  4HJ8 A;  4C3J B;  2VQF L;  4L5S A;  3V2T A;  4GLV B;  3MXN B;  4KHV A;  1TY2 A;  1TWG H;  1ILQ A;  3N6R A;  2R7Z H;  4ZLT F;  4DXF A;  4CDD C;  1CKN B;  2UXB L;  1UEA B;  2D2C C;  3PIO A;  5GAD C;  1R4P B;  3E3X A;  4Y7N B;  2KCN A;  1JWM D;  1K83 B;  2X6L A;  1M4V A;  5D14 A;  1D5M C;  4YY3 Q;  3CQZ B;  4UPA A;  4HJ7 A;  3GTK H;  1IW7 D;  1SMX A;  2X6G A;  1K8O A;  4DAY A;  4M8A A;  3M4P A;  4ZUI A;  2I5L X;  1KDA A;  3H6M A;  2ICI A;  2B2V A;  2FJ2 A;  1TS3 A;  3A5U A;  4A3G G;  3S1Q B;  4NXN Q;  3OTO L;  4A3M B;  2UU9 Q;  1ZXT A;  1SMY C;  4F7X A;  4DK0 A;  3H3V C;  3J80 L;  3SVM A;  4DV0 L;  3M4O H;  3I4O A;  2PO4 A;  1MHW C;  4PMB A;  3PF5 A;  1D5Z C;  1X3Q A;  2Y0S B;  4UP7 A;  1MJE A;  1BKB A;  3BDC A;  5HY6 A;  4IUN A;  5ELE A;  2DGY A;  5FO7 B;  2BDN A;  1N33 L;  2XTI A;  3MFY A;  1FL0 A;  2ZJP A;  1EYA A;  4LFB Q;  1E7Z A;  2KUM A;  3R2T A;  4RFB A;  2FXQ A;  4DR7 Q;  4JYA Q;  5C3E B;  3K8A A;  4BY7 H;  3HZX A;  1SEB D;  2SNM A;  1PLF A;  1JB3 A;  4DF7 A;  1TWA B;  2A1A A;  2NTS A;  1EOT A;  3PIP 3;  1WD0 A;  2DN8 A;  3D4R A;  3TME A;  2K05 A;  3S15 H;  4OO1 H;  4YHH Q;  2O5J C;  3U4Z A;  2EZV A;  1XPU A;  3LWE A;  4JI1 Q;  3D8G A;  3KF6 B;  1D5X C;  4IUV A;  3FKI H;  4R1J A;  3SK5 A;  4DR3 L;  3TRZ A;  2EVB A;  4OIK A;  5I2X A;  3CHB D;  1SBB B;  4Y52 H;  2B2W C;  4ZQ3 A;  5FO8 B;  3S2D B;  2F4I A;  1HUM A; 
#chains in the Genus database with same CATH homology
 4L6T B;  5CMD A;  5LHY 1;  3FDT A;  2NN6 G;  2RBM A;  3WOF A;  4KY6 A;  1LTR D;  2BDO A;  2PCF B;  1IKM A;  1LT5 D;  2F0H A;  1CHP D;  5J1Z A;  2NYZ D;  4K5W A;  3E0J A;  2AWN A;  3PUX A;  4C56 C;  4BS9 A;  2NVY B;  3H91 A;  2E2D C;  1WTR A;  3EQL C;  1Q1E A;  1E2W A;  1WTX A;  1BQQ T;  4OGQ C;  1I4X A;  3T16 A;  3NXW A;  4EVO A;  3PUZ A;  4IFD J;  4C3J G;  3K0Y A;  1F9S A;  1EZ6 A;  3CU7 A;  1FGB D;  1UUP A;  3KBX A;  1HTL D;  4R9W A;  3RLF A;  3MXP A;  1QOH A;  5COY A;  1A3V A;  1HRJ A;  1TS2 A;  4BA2 I;  3TDQ A;  3L7Z C;  1SYF A;  1PTO B;  3VYU A;  3R8B A;  3BDO A;  1EEF D;  1JIC A;  5KGU A;  3CRK C;  1PFN A;  4ZK9 B;  1D1K A;  1H9M A;  1V43 A;  2Q8I B;  2VB2 X;  3RZO B;  3TZU A;  3TSS A;  4N9P A;  2O4X A;  1A3U A;  1HPC A;  4ILW A;  1DJR D;  1EWH A;  2KEE A;  3S1R B;  4M1U B;  1GJX A;  2KOL A;  1I4R A;  1LTS D;  1HQM C;  1VMP A;  2MJ8 A;  1VCI A;  1YNJ D;  4JK1 C;  2L5T A;  2PW7 A;  5LL6 S;  2YU9 B;  4JBW A;  1DYQ A;  3W3A A;  4P2C B;  4MHE A;  1JCK B;  4RHR A;  2EY2 A;  1CM9 A;  4HR7 B;  3DXJ C;  3HOU B;  1AZP A;  2ID0 A;  1H9J A;  2R6G A;  3SDZ A;  4A3J B;  1WVL A;  1B44 D;  4C1N I;  5EGT A;  1Z47 A;  2RDG A;  4EQP A;  2JA5 B;  3DHQ A;  1ENA A;  3J7A F;  1WTW A;  3K7A B;  4J8Q A;  1CFM A;  3OW7 A;  2WII B;  2KQ3 A;  2D62 A;  3VR6 A;  2HQE A;  3MAQ A;  2GA4 B;  1MSG A;  1SAP A;  3I4L A;  2B2W A;  4OIJ A;  5KYL A;  2HUG A;  5FLX E;  4F8M A;  4RGO S;  3Q6S A;  5KRU A;  1LLR D;  4RAU C;  4IFD G;  5C3X A;  4UDU C;  3P75 A;  1SE2 A;  1ZYR C;  4KJO A;  4OO1 G;  2R61 A;  2M2L A;  3DEP A;  3T53 B;  4Z9C B;  2A69 D;  4X3K A;  4K2K A;  1KNA A;  4CJ1 B;  3K5M A;  4RKB A;  4K8J A;  2MPM A;  5A2Q E;  5KNC A;  1QCB D;  3BS1 A;  2RVL A;  5CV5 A;  1EQV A;  3K5O A;  4IUU A;  2EJM A;  1U4R A;  3DWA A;  4H44 C;  1F2Y A;  5I9O A;  1TVX A;  5EKK A;  2ENB A;  3RD4 A;  2XRQ D;  2C9O A;  3NTI A;  1LTT D;  1TY0 A;  4N9T A;  4DK1 A;  4X3U A;  3R2I A;  3H0G B;  1F2L A;  4A3I B;  3HOZ B;  1IHZ A;  3NHH A;  5TSS A;  5DM6 3;  1B2T A;  5LL6 X;  4ME5 A;  2DY7 A;  4KK7 A;  1F2Z A;  4KN7 C;  3IKJ A;  4KV6 A;  4PNY A;  1QJO A;  1HHV A;  2F1M A;  2Q8T A;  1A6X A;  3ND8 A;  3PUW A;  1YNN D;  1J8I A;  4FF2 A;  1KTK A;  3HKZ B;  3QB3 A;  2F0G A;  1Y8P B;  1PRT D;  5C4J B;  5D65 A;  1R4Q B;  3QJY A;  1DOM A;  1Y1W B;  3A54 A;  5JOB A;  2F0J A;  3D31 A;  3M7N A;  1A15 A;  1VDZ A;  1F2M A;  1PMR A;  1S4Z A;  2XN9 C;  1CA6 A;  1KAB A;  1STN A;  4KKU A;  1SYB A;  2RKS A;  2CW0 D;  2F0I A;  1LV9 A;  1PYW D;  3SK6 A;  4NMZ A;  3DWQ A;  4F88 A;  3OOC A;  3VR5 A;  4OL7 A;  5EPL A;  2B63 B;  4IQZ A;  5IT9 E;  1LTI D;  2F0W A;  4KI0 A;  3S16 B;  3Q24 A;  2PMZ B;  1Z6H A;  3NSW A;  1SE4 A;  5K36 H;  1WTQ A;  2JA6 B;  4XT3 B;  5DAU A;  3A8J E;  2KJX A;  1SFO B;  1TWF B;  4LK1 C;  3A8K E;  2F0U A;  3BYY B;  1EU3 A;  2F0E A;  2HCC A;  5JVH 3;  2BA1 A;  2E2J B;  5KYI A;  1PZI D;  2F0F A;  4EGV A;  3Q23 A;  3MHB A;  3L3O C;  4BA1 I;  3ERO A;  4CJ2 C;  5IGC A;  5M3F B;  4QCL A;  1ESR A;  2N88 A;  1SNC A;  3QIA A;  2RSN A;  4ZUJ A;  5DM7 3;  4B08 A;  1HFG A;  3DMU A;  2A6E D;  4QMG A;  4QF4 A;  2F0S A;  1AP0 A;  5IGE A;  5ISR A;  4XQQ A;  3R93 A;  3OIP A;  3UI2 A;  2K1B A;  1GOZ A;  3J81 L;  5KIX A;  1S5E D;  3MVV A;  1CK1 A;  1SMY D;  1SYE A;  2JE6 I;  3D3R A;  4K14 A;  4Q0F A;  3AU7 A;  5FOB B;  3RUZ A;  1LT4 D;  1EY5 A;  4KJN A;  3JAM L;  3J7A V;  1JQY D;  1Z7T A;  2PW5 A;  5IGF A;  2B2T A;  1G29 1;  3BDL A;  1V8Q A;  4K6D A;  5KEE A;  2FHT A;  4AYB B;  1FR3 A;  3OPO A;  1HCZ A;  4IUR A;  4RGM A;  4DGZ A;  1PZJ D;  2K28 A;  1ICW A;  1BCP B;  1EEI D;  4C3H B;  1ILP A;  3NE5 B;  2R3Z A;  1TR5 A;  4G57 A;  4QUC A;  2EJF C;  1I4H A;  4FYD A;  2SNS A;  4R8I A;  1GHJ A;  2DNC A;  4G7Z C;  4MN3 A;  3AMU A;  2F0M A;  1D6E C;  3I8Z A;  2IJ0 A;  1I6V C;  4DXG A;  4ODG A;  1FYC A;  2D5D A;  2EJG C;  4FO2 A;  5C0X J;  1AZQ A;  1NAP A;  2KA7 A;  1BDO A;  3PV0 A;  2WV6 D;  4TKO B;  3EA6 A;  2K7V A;  2TMP A;  1D1I A;  2MUY A;  5M5W B;  1GXD C;  1SDF A;  2WKD A;  3C1E A;  1U4P A;  1QNU A;  1B50 A;  1BUV T;  2FMM A;  2WKC A;  3W2D A;  3HOV B;  5CR3 A;  2EYO A;  4O1N A;  1ZKO A;  4IFD I;  1ENC A;  3VR3 A;  1ET9 A;  1NR2 A;  3FMC A;  5JEA G;  4F87 A;  1EY4 A;  5AFW A;  3VYS A;  4OO1 I;  3QOL A;  5IOD A;  1TWG B;  2R7Z B;  4DU9 A;  4KN4 C;  1GUG A;  4RWS C;  2F0T A;  1WTP A;  1STB A;  3HEJ A;  4Q5V A;  1SNO A;  3OWE B;  3GTK B;  1PFB A;  2F0N A;  4J1M A;  3HRZ C;  2QCP X;  2OEO A;  4E6I A;  4L63 B;  1G8Z D;  1X32 A;  3T56 B;  2EY6 A;  2IW3 A;  3M4O B;  3VR4 A;  3IFD A;  5IGG A;  4KTA A;  1ET6 A;  5J39 A;  1Q8I A;  2X69 A;  1JWS D;  1ROD A;  2QIL A;  5CYU A;  2L4N A;  4J6H A;  2B8G A;  1TT2 A;  1B53 A;  2MHV A;  4C3H G;  1X3P A;  2OXP A;  4IAL A;  3I72 A;  1JOO A;  4BY7 B;  1HUN A;  3MA2 B;  1DD2 A;  4U67 3;  1S5D D;  1H9S A;  5IGB A;  3I90 A;  1STH A;  3J80 E;  3NUC A;  4WOR A;  3URY A;  3FKI B;  4V19 0;  1BOS A;  5C0X G;  1EYC A;  1EFI D;  4WRD A;  2E75 C;  4WFN 3;  3TN2 A;  2CQA A;  3HS0 C;  2K6A A;  3SK8 A;  3PUY A;  4LJZ C;  2IX0 A;  4XYQ A;  1MI2 A;  3K57 A;  5G3L F;  5I6Y A;  1O7L A;  1TWC B;  3NTK A;  3GO5 A;  3GP7 A;  1IL8 A;  5FKA C;  1MSH A;  3PO2 B;  1FD7 D;  1BO0 A;  4XYO A;  1K8M A;  2CHB D;  5NUC A;  2F3W A;  4FVM A;  2EY1 A;  4GZY C;  1BR9 A;  5E4W C;  2PZU A;  4FXD A;  2A6H C;  5C5L A;  2NTT A;  1SYC A;  1XWE A;  1RDP D;  2FIN B;  1PFM A;  1SJH D;  1M8A A;  1LAC A;  3PO3 B;  4FXG C;  2F0O A;  3I73 A;  1PTO F;  2DY8 A;  4UAI A;  3LWU A;  1PTO C;  2Z8L A;  3MXN A;  1XYI A;  5T1I A;  1EY7 A;  1O7Y A;  3MC0 B;  2ZT9 C;  2J0T D;  2WB1 B;  3F2U A;  4CGY B;  4XDX A;  3NQT A;  1HFN A;  3S1N B;  2A5H A;  4K2L A;  3HG9 A;  5JAV A;  1I6H B;  2QEJ C;  1KNE A;  2SOB A;  2BE5 C;  4B9X A;  2B2Y C;  3NTH A;  3CRL C;  4QB4 A;  1OXX K;  2Z4I A;  2E74 C;  3I4M B;  3SR1 A;  1WTO A;  3OWF A;  1KAA A;  4YIJ A;  1T5E A;  1STA A;  3NPP A;  5E3F A;  1CZW A;  5CC4 A;  4NDX A;  1SND A;  3T13 A;  3HGB A;  4BBS B;  5A35 A;  4KD4 A;  4FF1 A;  3KLR A;  1UNS A;  5EPK A;  2C5C A;  5J22 A;  1RTN A;  3EJI A;  4ZKC B;  1LTB D;  1DCZ A;  1H9R A;  2B2U C;  1SNP A;  1Y8O B;  4PQX A;  3GD7 A;  3T51 B;  3DUZ A;  2RDF A;  2XIW A;  4HSP A;  2F0V A;  2XSC A;  1C4Q A;  2L0C A;  2A68 C;  1S5F D;  1RJT A;  3TP7 A;  2VUM B;  4NP5 A;  4KY7 A;  3S14 B;  4QUF A;  2J7Z A;  2E2I B;  1E0B A;  2L55 A;  2ZXP A;  1RKN A;  2LY7 A;  3C46 A;  3SHL A;  3HOY B;  1V1O A;  1CHQ D;  4ZYS A;  4KKT A;  2KED A;  3NBH A;  4CKC A;  2K01 A;  4I65 A;  2PQE A;  3X3N A;  2F0L A;  5I2Y A;  2I46 A;  4FNF A;  5BN3 A;  3WDN A;  3NWS A;  4HSV A;  3KK7 A;  3I3C A;  1WD1 A;  1PDQ A;  1DXM A;  1G2T A;  2DNE A;  4A3B B;  3I4N B;  4HMJ A;  1VF7 A;  3X3M A;  5DNF A;  2YYZ A;  2BA0 A;  2O5I C;  2AUK A;  1U4M A;  3M85 A;  1TWH B;  2EYH A;  1A2T A;  5COR A;  1Y69 U;  3FPP A;  4TQU S;  1BF4 A;  2M00 A;  3FPU B;  3R3O A;  5FK9 C;  4KD3 A;  1B1Z A;  2AQ2 B;  3VA5 A;  3P1H A;  1CT1 D;  5EBC A;  4HED A;  3TZD A;  4IUP A;  1FNV A;  1LTA D;  2B2V C;  4ZRZ A;  1WCM B;  4TSS A;  1FNW A;  1TS4 A;  3MWY W;  3QO2 A;  4C3I B;  1JWU D;  1PRT B;  1O7Z A;  4CKE A;  4RH6 A;  3WOE A;  5K5P A;  1HA5 A;  3I91 A;  5M9O A;  2BOS A;  4CJ0 B;  4NKL A;  3HOX B;  2R92 B;  1NSN S;  1OXV A;  2KEC A;  5F2D A;  5C4H A;  4C1N K;  1QIL A;  2NBF A;  1PXU A;  3V96 A;  2WIN B;  4IUT A;  5CV8 A;  2JA7 B;  2WP8 J;  1IYV A;  4LMQ D;  2NN6 H;  1SNQ A;  1EY0 A;  1CZG A;  1VF5 C;  4ABN A;  2JEA I;  3MEH A;  2XRS D;  4A93 B;  3GTQ B;  2PZT A;  2MGS A;  3U9O A;  3RZD B;  2EYP A;  1Q3L A;  1F9P A;  1SYD A;  4DFA A;  3KLS X;  4RA8 A;  2PZW A;  5C0X I;  1GUW A;  4A3E B;  4G7H C;  1UAP A;  3FEW X;  5CV4 A;  4RGT A;  2E2H B;  2NVX B;  3KLS A;  1SNM A;  2OT2 A;  1H9S B;  1TKW B;  1SYG A;  5ELB A;  1SJE D;  1IYU A;  3OSO A;  1HA6 A;  5HUR A;  2CW0 C;  3CKI B;  3GTP B;  1JOQ A;  4X3S A;  4RHS A;  2F0D A;  1ENF A;  2JYO A;  2XWJ B;  2RQX A;  4XQJ A;  1XX8 A;  5C4Z A;  3OIQ A;  3S2H B;  2A73 B;  1V1P A;  2V4D A;  1DM0 B;  1OO9 B;  3H09 A;  1GUS A;  4DA2 A;  3A7L A;  1L0X B;  3SEB A;  4XXE A;  5C6A A;  3K5N A;  2A74 C;  3K58 A;  2F03 A;  1NUC A;  5EQ0 A;  4G4K A;  2HDM A;  3VR2 A;  3K6O A;  4C3I G;  4O42 A;  1ML0 D;  1BCP F;  3SE0 A;  1EIH A;  1BCP C;  4C2M B;  4XT1 B;  2F0K A;  4PMW A;  4CBV A;  1STY A;  3Q0A A;  2KVM A;  4QIW B;  1I50 B;  1LAB A;  3ONA B;  3HP3 A;  3C1F A;  3MTS A;  4A3D B;  2A6E C;  1HTP A;  4CHT B;  1DZ1 A;  3J81 E;  2RA4 A;  2K5D A;  1J9O A;  1BBX C;  3JAM E;  2BCO A;  1TQO A;  2EYF A;  3DWP A;  5M5X B;  1KLU D;  2IWH A;  1RHP A;  4BY1 B;  1G6Z A;  4HTH A;  1D2B A;  3D4D A;  5HGT A;  2L11 A;  2M9V A;  2VNU D;  5G3L D;  4XIG S;  5K36 G;  5M3M B;  1GUN A;  3IL8 A;  4BWG B;  3TBI B;  2EYL A;  4IFD H;  1Q12 A;  4IUQ A;  1B4O A;  5CV7 A;  5IIF A;  1BNZ A;  1ZEQ X;  2JSO A;  3J7Y W;  2PNR C;  2K32 A;  3KUP A;  1STG A;  1S5C D;  1OXT A;  2QDB A;  2A6H D;  1G91 A;  4DN4 M;  3QOJ A;  2SDF A;  1F9Q A;  3FVQ A;  1JE4 A;  5E1F A;  1RCV D;  1TII D;  1W6J A;  1PTO D;  1PTO H;  1U4L A;  2L1B A;  5C5M A;  5D3D A;  2TSS A;  1IW7 C;  5ELC A;  1LT3 D;  2NB0 A;  3U9S A;  1EU4 A;  4RGN A;  1II3 A;  3H94 A;  3E6Z X;  3S15 B;  4FXK C;  3D4W A;  4NW2 A;  1BXT A;  1EY9 A;  1Y8N B;  1B9M A;  1LT6 D;  2XNA C;  2EOT A;  4DNR B;  3BVZ A;  2EE1 A;  2L12 A;  2BE5 D;  2H1E A;  5C44 B;  3BZD B;  3NP8 A;  3NWT A;  1A3T A;  2EYM A;  3RMH A;  1EIG A;  5FLX L;  1E2Z A;  1JR0 D;  3G7L A;  3GTO B;  4S3S A;  2LKV A;  5BN4 A;  3A55 A;  4MIU A;  2WAC A;  1SSO A;  4L8J A;  3K59 A;  1O80 A;  5EBD A;  3S17 B;  3NQI A;  3M3Y B;  2AQ1 B;  5E4X A;  3DM1 A;  1ZYR D;  1S5B D;  3SK4 A;  5JPN C;  4HCS A;  4I7Z C;  4V0B A;  1RD9 D;  2R93 B;  1I4G A;  1DON A;  2G9H D;  1G2S A;  4XTC S;  4ID6 A;  2I07 B;  1TU2 B;  5A2Q L;  2NWG A;  3TP5 A;  2JA8 B;  3O13 A;  4KHZ A;  2D9U A;  1Q1B A;  2XVS A;  2IL8 A;  2NVQ B;  5BN5 A;  1O78 A;  2A68 D;  5I6W A;  2LMC B;  3GTJ B;  2K04 A;  5M5Y B;  4K8I A;  1KDB A;  4TRD A;  1CA5 A;  3C3L A;  1RF2 D;  4EQO A;  3ITP A;  1AFP A;  1EWC A;  1RTO A;  4HAE A;  4WJW A;  3OHX C;  3QWN A;  2H4O A;  4X3T A;  1IKL A;  3GTM B;  5C4X B;  3KBG A;  3BVG A;  4G7O C;  2EY5 A;  1DOK A;  2MP1 A;  3DEO A;  4IZ8 A;  2CVR A;  2NUC A;  3S9W A;  2N55 A;  4U68 A;  1QWY A;  1ESF A;  2FMC A;  4HN7 A;  2O2L D;  3G6J B;  2KHS A;  4PMC A;  3GV3 A;  1E2V A;  5CBA E;  5I4D A;  4A3K B;  3PUV A;  2K5Q A;  3GV6 A;  2HCI A;  4KKS A;  2E76 C;  4RCN A;  1B3A A;  2ZXR A;  5EKI A;  1EZ8 A;  2IX1 A;  1LO5 D;  3C2P A;  1EY8 A;  3TP8 A;  3BVM A;  2JP1 A;  4PV1 C;  2B8F A;  1YNJ C;  5IT9 L;  3I70 A;  4DAP A;  2NVT B;  5C3W A;  4OHJ A;  2FFK B;  1A2U A;  4HCE A;  2F3V A;  1OXU A;  4K5V A;  1V1P B;  4FF3 A;  3IAY A;  3M7G A;  3MXU A;  3D6W A;  1SE3 A;  3VYT A;  1U9R A;  2JEB I;  1AEX A;  5IOC A;  3D6C A;  3PMF A;  4H7B A;  2B2T C;  1CI3 M;  3E5S A;  2PYK A;  1HQR D;  3EVQ A;  3HOW B;  3BYT B;  4EQN A;  3P20 A;  5I9P A;  3P7J A;  1FNU A;  3SXH A;  1R9T B;  2IT1 A;  5EPJ A;  1XXG A;  3K5L A;  3VA7 A;  1Y1V B;  4FP5 D;  5D3I B;  3QG1 A;  4ULL A;  2IPK D;  2ICE C;  1QNK A;  1EYD A;  2WAQ B;  3M4Y A;  3LX0 A;  4A3F B;  2F0Q A;  2EYJ A;  4K6L A;  2KCC A;  2EDG A;  1CTM A;  3ERQ A;  1QG7 A;  2RDH A;  1WTV A;  1VMC A;  1JC7 A;  2A69 C;  1EQT A;  3L9A X;  2RSO A;  4RKL A;  3ND9 A;  1GHK A;  2G9D A;  1XTC D;  1CQV A;  2Q8R E;  3MZ5 A;  3Q22 A;  4BBR B;  4H0L C;  4HMI A;  1QE6 A;  1EY6 A;  1GUO A;  1KDC A;  4ZKB B;  4DNT B;  5JEA H;  2K03 A;  2ZXO A;  5CV9 A;  2B2Y A;  1H9K A;  2L9H A;  4FF4 A;  3TP6 A;  5JPM C;  3BG3 A;  1GUT A;  2K5W A;  5DEH A;  2LFN A;  2OF1 A;  1L0Y B;  2Z1C A;  3IFT A;  1TS5 A;  3N52 A;  3NK9 A;  1MD2 D;  2NN6 I;  5ELD A;  4IN3 A;  2VB3 X;  3GTL B;  2B39 A;  3VYR A;  1SXT A;  4A3G B;  2K33 A;  5CGK A;  3GQB A;  1F9R A;  5KNB A;  1EL0 A;  2B2U A;  3A56 A;  1CQF A;  1MBY A;  1OXS C;  1YNN C;  5T1G A;  3AB9 A;  1NCV A;  3OMG A;  5JJZ A;  1PRT F;  2PPB C;  1PRT C;  4RCO A;  3OMC A;  1BCP D;  1STE A;  5EJW A;  1ONL A;  4LAA A;  5JVG 3;  5JEA J;  3FRP B;  5EKL A;  3KF8 A;  3MXG A;  5IGD A;  1C48 A;  1HXY D;  3ZYY X;  3A8I E;  4XQN A;  1LTG D;  1B9N A;  1T5X D;  1NR4 A;  5ELF A;  2AQ3 B;  2Z4H A;  2IX3 A;  3T4A C;  1MGS A;  5CBE E;  3LNN A;  2J4X A;  2AWO A;  1KLG D;  2QKI C;  2QF7 A;  2XWB B;  2NZ1 D;  1Q90 A;  5C0X H;  1AW7 A;  3EFX D;  4H13 C;  3GTG B;  3PIO 3;  2HDL A;  3A7A B;  3MFG A;  1I3Q B;  4KY5 A;  1DOL A;  2JXM B;  1F77 A;  2EXZ A;  1JOK A;  1I4Q A;  3V05 A;  5CV6 A;  1C8C A;  4KMU C;  4DAV A;  4CKB A;  2LS0 1;  4R8N A;  2EPB A;  1JOR A;  2VXW A;  4ZAI A;  2SEB D;  1QB5 D;  5FO9 B;  3S1M B;  1W6K A;  1PZK D;  3NBI A;  4K5X A;  4B9W A;  2AUJ D;  5KND A;  2F0P A;  1AN8 A;  1I4P A;  4C3J B;  3V2T A;  4KHV A;  1TY2 A;  1ILQ A;  3N6R A;  4ZLT F;  4DXF A;  1UEA B;  2D2C C;  1R4P B;  4Y7N B;  2KCN A;  1JWM D;  1K83 B;  2X6L A;  1M4V A;  5D14 A;  1D5M C;  3CQZ B;  1IW7 D;  1K8O A;  2X6G A;  4DAY A;  4M8A A;  4ZUI A;  1KDA A;  3H6M A;  2ICI A;  2B2V A;  2FJ2 A;  1TS3 A;  3S1Q B;  4A3M B;  1ZXT A;  1SMY C;  4F7X A;  4DK0 A;  3H3V C;  3J80 L;  3SVM A;  2PO4 A;  4PMB A;  1D5Z C;  1X3Q A;  2Y0S B;  3BDC A;  4IUN A;  5ELE A;  5FO7 B;  2BDN A;  3MFY A;  1EYA A;  2KUM A;  3R2T A;  4RFB A;  5C3E B;  3HZX A;  1SEB D;  2SNM A;  1PLF A;  1JB3 A;  4DF7 A;  1TWA B;  2NTS A;  1EOT A;  3PIP 3;  1WD0 A;  2DN8 A;  3D4R A;  3TME A;  2K05 A;  4OO1 H;  2O5J C;  2EZV A;  3LWE A;  3D8G A;  1D5X C;  4IUV A;  3SK5 A;  2EVB A;  4OIK A;  5I2X A;  3CHB D;  1SBB B;  2B2W C;  4ZQ3 A;  5FO8 B;  3S2D B;  2F4I A;  1HUM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...