2F0KA

Crystal structure of staphylococcal nuclease mutant v23i/l25i
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTIKIMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0kA00
1SYEA 5ISRA 4KD4A 2KQ3A 2EYOA 3DHQA 1NSNS 4NDXA 3SK4A 2EYJA 5KIXA 4QMGA 5IODA 1EY6A 3OMCA 3TMEA 1EY9A 2F0MA 4WORA 4E6IA 2F0UA 1SNQA 3D8GA 5I6YA 2OXPA 4F8MA 4K5WA 2PZTA 4IALA 5CR3A 3EROA 2EY6A 5C6AA 5IOCA 2F0IA 3S9WA 1AEXA 1SYDA 3U9OA 4ODGA 1ENAA 1SNPA 3OWFA 1SNDA 1F2YA 3NUCA 4ZQ3A 3R3OA 5KYIA 1TR5A 1KDAA 1KDBA 4ID6A 4OL7A 5KYLA 1EY4A 4KY5A 4KJNA 2EXZA 5KRUA 3TP8A 2EYHA 3P1HA 1EY8A 4KY6A 3E5SA 4QB4A 2F0VA 4S3SA 5CV8A 5JOBA 2HQEA 2PZWA 1JORA 5HURA 2EY2A 2F0NA 5CGKA 1F2ZA 1STBA 2RKSA 4DU9A 3SR1A 5C4HA 3SK5A 1EYCA 5EKLA 1A3UA 4RKBA 4EVOA 3MVVA 4ME5A 5DEHA 1EY7A 4RKLA 5DAUA 1II3A 2F0WA 3D6CA 4MIUA 3LX0A 4WRDA 5C4ZA 5C5LA 1EQVA 1F2MA 2NUCA 4K6DA 4PMCA 2OF1A 4KD3A 3T13A 3TP6A 5KEEA 4KV6A 1SNCA 3D4WA 1EZ6A 4DGZA 5KGUA 2M00A 4NP5A 5E1FA 3OMGA 2EYLA 5M9OA 2OEOA 2O4XA 4DF7A 4K14A 2EYMA 3H6MA 3D4DA 4K5VA 2EY1A 4EQPA 5C3WA 3OSOA 5CC4A 2PYKA 3MZ5A 1JOOA 4KTAA 4LAAA 3NXWA 2F0QA 4HMIA 1RKNA 2F0DA 3QB3A 1SYCA 5EKKA 3DMUA 5C5MA 2EY5A 2EYPA 3QOLA 4HMJA 4YIJA 4IZ8A 3RUZA 4K8JA 1SYBA 3NP8A 2SNMA 5IGGA 1SYGA 1NUCA 4PNYA 3TP7A 3NQTA 1EY5A 4TRDA 5IGBA 4KHVA 4DFAA 5J1ZA 3TP5A 3MHBA 3P75A 4KY7A 5J39A 3QOJA 4J1MA 3HZXA 5C3XA 1SNOA 1ENCA 1A2TA 2F0GA 4N9PA 5I9OA 1JOQA 4B9WA 2F0EA 3NK9A 1A3VA 1A3TA 2PQEA 3BDCA 3EJIA 4K2LA 4HTHA 2EYFA 1EZ8A 3T16A 5CV6A 1STAA 2F3VA 2ENBA 5IGFA 1STYA 2RBMA 1TQOA 1U9RA 2F0SA 2F0LA 3SXHA 5IGDA 4K5XA 4G57A 3BDLA 4ZUJA 5J22A 1STNA 1KAAA 4EQOA 2F0OA 2F0PA 3ERQA 2SNSA 5I9PA 5CV5A 2WACA 4H7BA 5CV9A 4B9XA 5JAVA 3C1EA 2PW7A 1A2UA 3PMFA 1EY0A 4KJOA 4QF4A 2F0TA 4IUNA 3C1FA 3VA5A 4NMZA 1SYFA 2F0KA 2KHSA 3V2TA 1SNMA 1STHA 3SK8A 5IGCA 2PZUA 2F3WA 1STGA 4R8NA 1IHZA 4K2KA 4I65A 4NKLA 2F0FA 5E3FA 3SK6A 1KDCA 2F0JA 3MEHA 4J6HA 4K8IA 4N9TA 2SOBA 5I6WA 3NHHA 4F7XA 3HEJA 5F2DA 3SHLA 1EYDA 4ZUIA 5HGTA 4EQNA 2PW5A 2F0HA 3MXPA 5CV4A 2RDFA 5IIFA 5CV7A 5EGTA 1TT2A 5IGEA 1JOKA 5NUCA 5K5PA 1EYAA 1KABA 2LKVA 3ITPA 2QDBA 4PMBA 3EVQA
chains in the Genus database with same CATH superfamily
4CJ2C 2A74C 1V1QA 3W5OA 5C3EH 4CKCA 2JYOA 3OMCA 1D1KA 3UDFA 1DOLA 4DV1L 2Z4HA 3FMCA 5I4DA 3S9WA 4RMFA 4BY1H 4LFAL 2K32A 4DV7Q 1PH4A 1I4PA 2CKZB 2F0VA 1QE6A 1QZGA 1HZBA 5C3EG 1G291 3ER0A 4A3JG 3X3MA 3HFZB 2UUAL 2JA8B 1VF7A 1P16A 4EVOA 3A8JE 4FP5D 2CW0C 1I50B 2D0PA 5ELOA 4CJ1B 4YHHQ 2VQEQ 1VQ9A 2JP1A 1G6PA 2AQ3B 4BY1G 1GKHA 4HJ9A 1BO0A 3OMGA 3E6ZX 1S5ED 3D4DA 3K80C 2NVXH 3PUVA 1TWGB 2B8FA 3PO2H 1K83B 4A3FH 2LSSA 3DMUA 1ET6A 2JEAI 2HDLA 1TWCB 3O13A 4QUFA 3CF5A 4OELB 5IP7H 1PZKD 4KY7A 1PXUA 3FDTA 4R4IA 5C44H 1PA6A 3BZDB 4HCSA 2K01A 3ERSX 5EPLA 5FK9C 4A4IA 5M3MH 1PTOF 2EYFA 1WD1A 1IZ6A 1JJGA 5IWAQ 1V1OA 1VDZA 2LFNA 1SXTA 1Q81C 3PO2G 1H9SA 5J22A 4A3FG 3EBEA 1KLGD 1E2WA 1F9SA 2PNRC 4DV1Q 5IP7G 1VQAA 4LFAQ 3KF8B 3A56A 4B3TQ 5C44G 3HKZB 2R3ZA 2YV5A 4OIKA 3M4OB 4MNOA 3I8ZA 3HOWB 2EPBA 1MSHA 2AUJD 4DNIA 1YBYA 3DM1A 1VQ8A 3NHHA 1JCKB 4X3TA 2RDFA 2UUAQ 1GUWA 2HCIA 1XMQQ 5C4XG 3S14B 4PMBA 3VYRA 3QOLA 4GOPA 3HOXB 2O2LD 2JSOA 4QUCA 1PFMA 1WOCA 5FJ8H 1EY6A 2XGTA 3PGZA 4E6IA 3IFDA 4RHSA 1N36L 2OTJA 3W1BA 3TDQA 3WOEA 1ENAA 1B44D 2EXDA 2A6HD 1XPUA 3J7ZC 5JEAJ 2G5DA 3X3NA 4S3SA 1STEA 1XX8A 2Q8IB 1STBA 1QCBD 5FJ8G 1RIPA 1LTAD 1MJCA 5EKLA 4RKBA 2MJ8A 3GO5A 4MTNA 1R9TH 4CBVA 3KYHC 1L0XB 2R61A 1O80A 3T13A 2NN6I 1B9NA 2F1MA 3D4WA 5FLXc 4DR3L 5E1FA 3QG1A 4DF7A 1YI2A 1LUZA 1O7LA 3J81L 5LMNW 2WB1E 1Z9FA 2I07B 1X55A 4DR2L 3QB3A 1TWFH 2KEDA 4JOIC 4X65L 3PCOB 2VW9A 1M90C 1QUQB 3NQTA 3TSSA 3VR6A 2Q2UA 1CQFA 1DJRD 2I5HA 4C1NI 2OQKA 2K52A 3H3VI 4IUUA 3M3YB 1U4RA 4HJAA 3NE5B 3S15H 2V1CC 4UP7A 1B4OA 1RCVD 2KUMA 2VUMH 4LF5L 2NZ1D 5LHY1 5E4XA 2ZXPA 1XXGA 2PMZE 3V05A 3SDZA 1ZKOA 1VQNA 1CM9A 3E9IA 4EX5A 1N36Q 1UAPA 4KJOA 2UXDL 4IJHA 4IUNA 4UDUC 5LL6X 3G6EA 3CRKC 1QWYA 3QWNA 2F0KA 2KHSA 3TRZA 3GTQB 1WCMB 4G7OC 3KJOA 3L7ZC 1Q82C 1HCZA 2EDGA 3OHXC 4FO2A 1ASZA 4GS3A 1M4VA 1SSOA 5M5WB 4F7XA 5DM73 5A35A 2E2JH 1QVCA 2CWAA 4KK7A 1F9PA 1SMYC 5H1SE 1VQJA 2IPKD 4DA2A 2F4IA 4CGYB 3J80c 3UI2A 5G3LF 2WIIB 2B2YA 4KN4C 4ILWA 4ALPA 2KJXA 4X3KA 1NSNS 1HRJA 4DR3Q 4RFBA 5IODA 4OO1H 1EIYB 4A3BG 2GVBA 1DXMA 4AYBG 3U4ZA 5BN4A 2B2YC 3DXJC 5I6YA 1VQKA 4DAVA 3K7AB 2E5LL 4K6LA 4MHEA 5IYBH 4CKBA 4DR2Q 3TZDA 2RHSB 4ODGA 4X65Q 1V8QA 3LWEA 4R4OA 5C0XH 3PIO3 3PO3B 4XIGS 3R3OA 1EWHA 2AQ2B 3H15A 3R93A 4OEMB 3TQYA 1BCPC 3W3AA 2MFIA 1JORA 2NVYH 5CV8A 5EKIA 1PH5A 1ML0D 4CKEA 4LF8L 3BVGA 5HY6A 4OO1G 1EFID 3RN2A 4LF5Q 1BVSA 3TN2A 3PIP3 5E4WC 4A3EB 4UY8C 5IYBG 4LUOA 4PMCA 4C2MB 3E0EA 5KEEA 1Q1BA 1WTXA 2EYLA 2OEOA 4K14A 2UXDQ 3G48A 2B63H 3FKIH 1JJCB 1JMCA 4IOCA 3CC2A 1KLUD 1LT4D 2BH8A 3DWAA 1VQHA 3C46A 1I6HB 1X54A 1N8RC 4JI4L 3RZOH 4A3MB 3CCEA 3GTGH 2AKWB 1QVFA 1SE2A 2X6LA 3L3OC 1DM0B 4EGVA 4X66L 3KJPA 3S24A 4N9PA 5EJWA 4JI3Q 4XQNA 1VQ4A 1ILPA 4JYAL 4N8FA 2MNAA 2QEJC 2B63G 5JJKA 3FKIG 2F0LA 3DWQA 3GTJH 2UUCL 3CCJA 3ERQA 4A3LH 2PW7A 1H9SB 3MFGA 5D3DA 2RVLA 3ICEA 4OIJA 2E5LQ 3OIPA 3OTOL 1KNAA 2FMMA 1I6VC 1RODA 4DXGA 2RDHA 1TIID 1YJNA 3MEHA 2D2CC 2Z6BA 1SBBB 2Y0SG 3QJYA 1GD7A 3AU7A 4LF8Q 3GTKB 4ZUIA 2PW5A 1A63A 3KBXA 1L1OA 2F52A 3DM3A 3HOVB 4A3LG 4DV4L 1ILQA 2FHTA 4KD4A 2FXQA 1HQRD 4NXNL 1Y1VB 4C3HH 2O5JC 1SJED 1WI5A 4KMUC 1U4MA 1B9MA 1EY9A 1JWMD 2I46A 4WORA 1AH9A 3D8GA 4YWKA 3T51B 4DV2L 3MC0B 4UHVA 1Y8NB 3GTLB 5DNFA 2F0IA 3H0GH 1AE2A 1SYDA 5CBEE 5LL6S 3M7GA 4ZQ3A 4JI4Q 2OWOA 3T1HL 4KY5A 4LFBQ 2Z9HA 4CDFC 3Q8DA 2EYHA 4KY6A 4QB4A 4X66Q 1D5XC 3MTSA 5HURA 3P7JA 4YCUA 4C3HG 1F2ZA 1SROA 1GHKA 1CSPA 2KENA 1G2SA 4JYAQ 1LO5D 3BZCA 4A75A 3RNUA 4RKLA 2UUBL 3J7AF 3LX0A 2CFMA 3H0GG 2UUCQ 1NTGA 2N78A 2OF1A 3AQQA 2B29A 2BE5D 3IRBA 2EY1A 2PYKA 4LAAA 3RZDH 4NB3A 2K6AA 4H44C 4HCEA 3MA2B 3FEWX 3SVMA 1EIGA 3K7UC 3AB9A 3URYA 1CHPD 3TP7A 1Q12A 4X3SA 3TZUA 1IL8A 3LWUA 1NMFA 4L5TA 2IX0A 3K5LA 4HIOA 4J1MA 3TS0A 3BG3A 1D1IA 1CTMA 1S5CD 1F9RA 1PTOC 2F3VA 4A3DH 1SRUA 4NXNQ 2YTVA 4G57A 4DK0A 4GNXA 3J81E 2KHIA 1LTGD 4B9XA 1Z6HA 1B53A 4IUQA 1FNVA 1YHQA 1SE8A 4FDBA 4GLVB 1JJ2A 3KLRA 4U68A 4NMZA 4HJ7A 1ICWA 4QJFA 1VQ7A 2PZUA 4GZYC 2F3WA 4R8NA 1B7YB 1LYLA 1DD2A 2WAQG 3T1HQ 2JA7G 1Y1WH 1YNJC 3HG9A 5I6WA 4A3DG 1EUJA 2LS01 4PG3A 1V9PA 3NENA 3BZKA 4Y7NH 1L0YB 3TBIB 4C3JB 2UXCL 5NUCA 3D3RA 2VS1A 2UUBQ 3S1NB 2E2IB 3PIPA 1DCZA 1K3BC 4P71A 3G6JB 2HUGA 1KXLA 1E24A 2VNUD 4XQQA 4PMWA 4X62L 3PUWA 1SMYD 2AUKA 2ID0A 1Y1WG 2Q2TA 5GROA 3F8TA 2ICEC 4QQBX 2PZTA 3EROA 2EZVA 1HNXL 3B6YA 2E2HB 3NWSA 2LXJA 3I55A 1BCPB 2Z1CA 1PV4A 1T5EA 4A93B 4IN3A 2RHQB 3S1RH 4C3IB 2QGQA 3T4AC 3E5SA 1R4PB 2TMPA 2R93B 5ELDA 1HZAA 3S16B 4GKKL 3PV0A 3KFUA 3V96A 3BYTB 4DAMA 1K73C 4J8QA 3JAML 2ZXOA 4IO9A 3K8AA 1II3A 3L9AX 1BCPD 1Q86C 2MPMA 2R7ZB 1F2MA 1IKMA 5KNCA 1H9KA 1I5FA 4DGZA 5M9OA 3K59A 2JA5B 2B2WA 4FNFA 1SR3A 2EYMA 4ZKCB 4A3CH 2K1BA 4IPHA 3CC7A 3OYYA 2GA4B 1JB7A 1XTCD 5C5MA 2BDNA 4ZLTF 2B2WC 4GN5A 4K8JA 1HH2P 1LT5D 2N8NA 4ZAIA 1YHAA 1WTPA 4PNYA 2ZXRA 4P2CB 2PQAA 2SDFA 3Q22A 5AJ3Q 1Y69U 1VQLA 1Z7TA 5J39A 3PUXA 1GUSA 2UXCQ 3SE0A 3NTHA 1XNRL 2PQEA 5EPKA 1EZ8A 1G8ZD 2P5ZX 4IUPA 4I7ZC 3F2UA 2QA4A 5IP9G 3A7AB 5M5YH 1I50H 4H7BA 1H9RA 4X62Q 3NBHA 4DR6L 1X3EA 1IYUA 3CP0A 4CDEC 3A55A 4O2DA 1HNXQ 2YU9B 2MHVA 2OT2A 5LMNL 3MXGA 4DK3C 3TS2A 4LK1C 3VR5A 1K83H 2C9OA 1YNNC 4Q5VA 2B2UA 5IY0A 1HJPA 3MXPA 5CV4A 1QZHA 2AHOB 5FLMH 4JBMA 1KABA 1LT6D 1KRTA 4LF7Q 1L1OB 1Q7YC 3OIQA 1SE3A 3HOZB 3VR4A 3KK7A 1EQQA 1YJ9A 4B3ML 3LGJA 3JAMi 1BUVT 3J7A5 5HGQA 1VCIA 1W3SA 1HZCA 1PFNA 2XN9C 1QILA 5FLMG 1KDAA 2GVAA 1L2FA 1EY4A 2SEBD 2KA7A 2L11A 1V43A 4LJZC 3Q24A 1GUNA 2EE1A 1PLFA 4TVAB 1LACA 3GV3A 1H9MA 2K03A 4BBRB 1OXSC 4IOAA 1XNRQ 3A54A 4DUZQ 2IT1A 3RR5A 4A3JH 3I91A 2JJQA 3W2DA 4BA2I 4JI6L 4JBKA 1UWVA 3AMUA 2JA6B 1S40A 1TVXA 2BDOA 3VYUA 4POGA 1A15A 4XQJA 1IXRA 4DR6Q 1YIJA 5CBAE 2B39A 1J5EL 4PQXA 1XNQL 1JOOA 3HOUH 4V190 1C48A 2F0QA 4HR7B 5EKKA 5LMNQ 1XYIA 5T1IA 1SYBA 2NYZD 1NUCA 3P20A 4GLXA 1IBKL 5ELEA 2QCPX 1EEID 4JI0Q 3P75A 4LFCL 3HZXA 2WKDA 3S17B 3S1QB 2KEEA 3CXCA 2NVQB 5BR8L 1KNEA 1PTOB 1I3QB 5CV6A 2WKCA 2RBMA 1TQOA 4AYBE 3HOUG 1ICFB 1V1PB 2X6GA 3IFTA 3NPPA 4B3MQ 1UEBA 1SDFA 4GNXB 5M5XH 1DOMA 1PTOD 3BS1A 1SYFA 4OGQC 1STGA 5E3FA 2N49A 2RF4A 1PFSA 3MAQA 3HRZC 4J6HA 3UE1A 3I4MH 4P72A 4UPAA 3GTMB 2PCFB 5IT9L 1GUTA 2RSNA 1R4QB 1PFBA 1E0BA 4HIMA 5K5PA 1LT3D 5M3FB 1EWIA 1RF2D 5IYDG 1YNJD 5ISRA 1NR4A 2ALYB 5C4XH 5A2QL 3W1GA 1VQIA 2XSCA 3CCSA 3S1MB 4BXXH 1FVIA 4QMGA 4DR4L 3TMEA 1VQ6A 1K3RA 1C0AA 2A68C 1SNQA 1D6EC 1IKLA 1XNQQ 3I4MG 2IWHA 1WYDA 4QIWE 2XVSA 4DR5L 1VQGA 4BY7H 1SFOH 1B3QA 4DAYA 1KDBA 4DV3L 5JJLA 2NWGA 1IBKQ 1EU4A 1LTID 1WCMH 2I0QA 3S2HB 2H1EA 1WVLA 1Y14B 2RKSA 5BR8Q 4BXXG 3EFXD 5C4HA 2XIWA 2FINB 5AFWA 4N8X1 5EQ0A 4GOPC 5C3EB 1AE3A 1PH7A 1MJEA 2YTXA 4BY7G 1EZ6A 2K5DA 5KGUA 4NP5A 3VR3A 4GKJL 4RCOA 4K5VA 1RTNA 1I4GA 1WCMG 3MZ5A 1WTWA 3MEFA 4BY1B 1SN8A 2Y0SE 2PI2E 3RUZA 2L9HA 1TU2B 5IGGA 3EQLC 2F3IA 4HJ8A 1OXXK 4O1NA 3CCLA 2BE5C 3CCQA 1X56A 1C8CA 1J9OA 3TP5A 4TKOB 3JAME 2PQAB 1KQSA 3I90A 2F03A 3G71A 5K36H 2K50A 1NE3A 4A3KH 1S5BD 3K5OA 2F0OA 4DR4Q 2KVMA 4X6AH 2NVXB 4XXEA 1HTLD 3Q0AA 4A3FB 3NBHB 3PO3G 2I5MX 2A6EC 1I4HA 3FRPB 3DUZA 4LF9L 1KDCA 4DV3Q 4BA1I 2M2LA 5K36G 3RMHA 1I6HH 5KNBA 3QR8A 4A3KG 5CV7A 4B3RL 1JOKA 4C1NK 2PI2A 2PNHA 5M3MB 2UU9L 3CQZH 1LLRD 4DV5L 1D7QA 2DY8A 1EOVA 1YNND 3STBD 3PUZA 1PZID 4JBJA 4GKJQ 4F8MA 3CCVA 2K5WA 4K5WA 4A3BH 2AWNA 3GTOH 2IX1A 5G3LD 1SNPA 4MTKA 3OWFA 4WJWA 1PRTF 3K0YA 3ZYYX 4KJNA 4DV6L 3P1HA 1E2ZA 5JOBA 2K5HA 1OO9B 2MUYA 3KUPA 3UE0A 4DAPA 4IPCA 1P8LA 4MIUA 5C5LA 3PUYA 1NCVA 2XTIA 1XWEA 2Q8TA 1KAWA 4DKAC 3PF4A 1EOTA 1EL0A 2M00A 1RDPD 3NTIA 2DGYA 2DNCA 4OHJA 2HT1A 2WAQE 3CKIB 2QF7A 4IURA 3VDYA 3J81i 5C4JH 4LF9Q 4CDDC 2KECA 2CH4A 1JICA 3GTLH 1W6KA 1HTPA 4LUVA 4RGOS 3QOJA 3FPPA 3M4PA 4B3RQ 4P75A 3OWEB 1PH2A 2UU9Q 1A3VA 4K2LA 3EJIA 3L0OA 2ZTEA 2EQSA 3T16A 1XPRA 5FLXL 4X64L 2ENBA 2EJGC 4R4TA 1Y8PB 3RD4A 4FYDA 1TWHH 4R4CA 3R2TA 1GUGA 3U4VA 1TY2A 4ZRZA 1TS3A 2JE6I 1LTRD 3PQIA 1D8LA 1Q1EA 2K05A 1TWFB 2QKIC 1NAPA 3AFPA 1MHWC 2F0FA 1A8VA 1J6QA 1JR0D 2B8GA 2NVTH 2XNAC 1NY4A 4GN3B 4DV6Q 1PH1A 1TKWB 4QY7A 1CK1A 4DPGA 2FFKB 4EQNA 3HOYH 2H4OA 4F88A 1TT2A 3A8IE 3WDNA 2VUMB 1HUMA 1UE6A 2RQXA 4G7HC 4NW2A 4K0KL 1FNUA 1VQOA 4G7ZC 2XWBB 1M1KC 1N32L 2PO4A 1E1TA 2N55A 3CC4A 2DY7A 1FD7D 4KHPL 2YYZA 1X9NA 1VMPA 3HOYG 1B8AA 4HJ5A 4FF4A 3A5ZB 4FF2A 4IPGA 4A3GH 5IT9E 1S72A 2A68D 5KRUA 1BR9A 4X3UA 4XT3B 4DAYB 3J80L 2HQEA 2E2JB 2F0NA 5JEAH 5EPJA 3D0FA 4A3IH 4IFDI 1L1OC 1Q8IA 3MVVA 4ME5A 1IW7C 4GOPB 4X64Q 2F0WA 3QO2A 1BBUA 3CHBD 4WRDA 1TS4A 1L0WA 1O7ZA 2ZTDA 1N34L 4BBSB 3GDEA 1TWAH 1U0LA 2N3SA 1ESRA 3K81C 4A3GG 1UNSA 1YEZA 2LY7A 4APVA 3UDGA 1RKNA 4HN7A 5JEAG 4YIJA 2K28A 3NP8A 4A3IG 5JVH3 3K57A 1IBLL 2BA0A 1X3PA 2Z0SA 4C3JG 5L37A 1SNOA 2F0GA 1SE4A 3I4NH 3BVMA 4B9WA 1CSQA 4PZ6A 3EN2A 3J7YW 1STAA 3AEVA 2OQ0A 4K0KQ 3K0XA 2ATWA 4K5XA 1UE5A 3J81j 1VQMA 3CPWA 3OTOQ 2R92H 4OONA 5FO9B 5JAVA 1N32Q 2L0CA 2B63B 2FJ2A 3FKIB 2QDLA 4JI1L 3PF5A 1BBWA 5IGCA 5DM63 2K7VA 2B3GA 2BOSA 4L5RC 1IHZA 2J4XA 3I4NG 3RZOB 3GTGB 5I2XA 2CWPA 1HNZL 4FVMA 4DV4Q 2JA7H 3MXNA 1C4QA 2A6ED 2R92G 4JV5L 3SGIA 2KCCA 2LKVA 1CZWA 1FYCA 4DN4M 1SYEA 5FO8B 3GTJB 4DV2Q 1N34Q 1JE4A 1F9QA 2JA5G 3J80i 3T1YL 4GNXC 1VS0A 3F1ZA 3UDIA 1X3FA 1XMOL 2CQOA 2OXPA 3PIOA 4DXFA 1NR2A 4IALA 2FMCA 1VQEA 5IOCA 1E3PA 2YTYA 3NUCA 3KLSX 2KHJA 2D62A 5D3IB 5FKAC 1TS2A 2NZHA 3VA7A 1FR3A 1IBLQ 3GD7A 2WB1B 1G91A 3S2DH 3A7LA 3K5NA 2ZM6L 4QCLA 1XJVA 3BJUA 5EBCA 4XT1B 4RGNA 4L63B 4JI7L 1B1ZA 3A8KE 3OW2A 1Y8OB 1RL2A 2K75A 2ZJQA 5C4ZA 3KDFA 1GM5A 2D0OA 4OO1I 5T1GA 4NPSA 3T53B 4HSPA 4KN7C 3C3LA 2O4XA 1BOSA 1JWSD 1OXVA 4QGUA 2JN4A 4IUVA 4YWLA 1PHJA 1JE5A 2A69C 3H0GB 1S4ZA 5C0XI 3NQIA 3NBIA 4HMIA 3Q23A 2EYPA 4HMJA 1LV9A 2PMZB 2C35B 1HNZQ 1EY5A 2WINB 1MKHA 4H02A 3MHBA 2E8GA 2IJ0A 3I7FA 5I9OA 4UAIA 1AFPA 4JV5Q 3NK9A 1DGSA 4TQUS 4GN4B 3BDLA 3N6RA 3HKSA 3TEHB 4OWWB 3T1YQ 4JW0A 1KRSA 4RCNA 5CV5A 4FXKC 5CV9A 3C1EA 5IP9H 1XMOQ 1A2UA 2D5DA 2F0TA 3RZDB 5ELFA 4WJ4A 1VQPA 2J0TD 1QG7A 1SNMA 1STHA 2G9HD 5LMUL 1J8IA 4ZCKA 3ZJYC 4I65A 2PPBC 2IHEA 5KNDA 2K5NA 3GTPB 3LNNA 1RJTA 1S3OA 5GAGC 5FLXE 3K5MA 4IPDA 4IFDJ 3ULJA 4JC0A 2WAQB 4RA8A 4JI7Q 4XYOA 4P73A 2JA8H 3ITPA 4A3DB 3U58A 3VA5A 3HS0C 1EIHA 3QIAA 1K8GA 4EQ5A 5EAYA 1B70B 2F0MA 2NN6H 3NEMA 3VYSA 1FJGL 1SJHD 1U5KA 1LABA 5JJZA 2IHFA 1TWGH 1KTKA 4JVZA 1F2YA 3STBC 1HHVA 2A19A 4GKKQ 1HQMC 1PRTC 1TWCH 2JA8G 1QUQA 4H0LC 1PYWD 1EY8A 1GO3E 1N9WA 2NTSA 5IYCH 2Z6KA 5CGKA 2B2UC 1HA5A 2EIFA 4Y7NB 1FGUA 2E76C 4JI8L 1IL2A 3H3VH 1BQQT 3SK5A 1A3UA 2L1BA 2NN6G 4KLKA 5DEHA 4WFN3 2NBFA 3CMAA 3GQBA 5BN3A 4UP8A 2I5LX 3FHWA 4KD3A 1SNCA 1SAPA 2L15A 4KKSA 1N33L 1PYSB 1IW7D 4Y52H 3CU7A 4KTAA 5J3BA 5EBDA 5LMUQ 5IYCG 2RSOA 1PDQA 5I9PA 3U50C 2CHBD 3D31A 3M4OH 3J80E 3HOWH 5FOBB 3S1RB 2JK8A 2RCFA 5C3XA 3OW7A 5M3FG 4MN3A 1UE7A 2E75C 1YNXA 1EFWA 3S2HH 5ELBA 3S14H 3I73A 1U9RA 3HOXH 2L55A 3SXHA 2AQ1B 4EQOA 2SNSA 3Q6SA 1PH9A 2WACA 2HDMA 3HKZG 5IWAL 1ONLA 1CKMA 1DONA 1KL9A 3HOWG 1CT1D 4CJ0B 1FJGQ 3CRLC 1W2BA 4DR1L 1SEBD 1WJJA 1EQRA 2K04A 4JI2L 2A8VA 1G6ZA 2O5IC 2F0JA 4K8IA 2SOBA 3HOXG 4B3TL 4PZ7A 5F2DA 1DZ1A 1WTOA 4JI8Q 2MO0A 2Z4IA 3MXNB 5DLQE 4ABNA 2A5HA 1EIFA 3M4YA 2Q2IA 2KQ3A 2BH2A 2EYOA 4RG1A 2VB2X 5IYDH 1Q90A 2K4KA 4L6TB 5M5YB 1XMQL 1N33Q 4RWSC 2CCZA 4FXDA 3M7NA 5C0XJ 2JA9A 2CVRA 5CR3A 1HPCA 3R8BA 1Q46A 1RHPA 3J81c 1TXYA 1JQYD 1LTBD 3T56B 4ID6A 5KYLA 1KC8C 3I2ZA 1WD0A 3D6WA 1D5ZC 3RLFA 2MP1A 2PZWA 4HSVA 4LF4L 2EY2A 4JI6Q 5GAHC 3M3YH 4DU9A 3IAYA 3C2PA 1F77A 1K0SA 2ZJPA 1GJXA 4JI5L 1A62A 2QW7A 1JT8A 1J5EQ 1EQVA 4B08A 1CKNA 1SMXA 3WWVA 1C7YA 4AQYL 1Z47A 3KDFB 2RDGA 3H6MA 3OSOA 1QNKA 3A0JA 4DR1Q 1HR0W 4L5QA 3GTQH 1SYCA 5JVG3 2DJGC 1AN8A 3EA6A 4JI2Q 4DK1A 4LFCQ 5COYA 2SNMA 3ND9A 3PSIA 1ZYRC 2NTTA 4KHVA 3L2PA 5M5WH 2A69D 5M3MG 1ENCA 1A2TA 2F0EA 4MZ9A 4A3JB 4JK1C 1MIUA 2HIXA 4LMQD 1VQCA 2TSSA 5JPMC 2F0PA 2KBNA 3E9HA 4JPBW 3MWYW 2MQHA 4IFDH 5BN5A 4OXPA 2DN8A 3HOUB 3K7AH 1OXUA 4AH6A 2V4DA 3KOJA 1BKBA 1OXTA 4NKLA 4JG2A 2LXKA 3PO3H 1Q3LA 2N88A 1GOZA 4R8IA 1NMGA 3BYYB 4LF4Q 3D4RA 5ELCA 3SHLA 4P74A 3AYHB 4UP9A 5IIFA 1KD1C 4IFDG 1CKOA 1HFGA 4LW1A 2A1AA 2C5CA 3A74A 1M8AA 4JI5Q 4YY3L 1QJOA 4A3EH 3VYTA 1I4QA 4C2MH 1O7YA 1VQBA 1ZEQX 5KIXA 3WOFA 4DR5Q 1K8AC 3PO2B 4AQYQ 4TSSA 2IL8A 5I2YA 2L5TA 1BNZA 5M5XB 1T5XD 4OX9L 3A5UA 2OTLA 2CH4W 4JOIA 2BA1A 1PRTB 4IUTA 1H9JA 5CORA 5C44B 3CCUA 1B3AA 3I4MB 4A3MH 2EXZA 1VF5C 3DLLA 1RTOA 4OWTB 2VQFL 4A3EG 1NJIC 2UXBL 2VZAA 4HEDA 3HP3A 3SR1A 5IE8A 2AMCB 1PRTD 4NXML 4CHTB 5C4XB 2HD3A 3TP6A 1Q8KA 3CPFA 3CW2C 2ASBA 2OCEA 4M1UB 5C3WA 2ZJRA 4A3MG 3NXWA 5CMDA 3KF6A 4BY7B 1O78A 1PVOA 1SFOB 4IZ8A 1YHBA 1KIXA 4RGMA 1VMCA 4KHZA 1FNWA 4DFAA 5J1ZA 1LTSD 3GTKH 3UDXA 4H13C 2VUMG 1EYGA 1A3TA 3HOVH 4J15A 1BXTA 1MGSA 2F0SA 2IX3A 4YY3Q 1PH6A 3R2IA 4JI3L 1STNA 1Y1VH 1A0IA 1X3GA 4OX9Q 3BU2A 2VY3A 4Q0FA 4BBSH 3RLOA 1F2LA 3CCRA 2E2DC 1TY0A 2DJFC 4G4KA 1T9HA 3HOVG 3CCMA 2VQFQ 4RAUC 4DV5Q 1FGBD 4O42A 3M9BA 2UXBQ 1Y1VG 2RCNA 1R9TB 2ZTCA 1IYVA 1EQTA 1B2TA 4NXMQ 3F2CA 4M8AA 4BBSG 2EOTA 1X3QA 3DEPA 4DNRB 4A3KB 4NDXA 1CA6A 1HFNA 2H5XA 4ZKBB 4POFA 2F0UA 3K58A 5TSSA 5D14A 4LF6L 1WTVA 4R1JA 2X69A 4O0AA 5C6AA 2CQAA 5C0XG 2EY6A 1D2BA 3U9OA 3HGBA 2K5VA 3CMEA 4LNQA 2CW0D 5KYIA 1ESFA 1E1OA 4OL7A 3S15B 3H91A 1UE1A 3NTKA 1GHJA 1X32A 2Q2HA 4DK6C 3DEOA 1AW7A 5GADC 3F2BA 4LFBL 3DWPA 3CQZB 4DUYL 1HNWL 3G4SA 2F4VL 1GVPA 1EU3A 4KV6A 4RHRA 2ICIA 4DR7L 4PZ8A 4A76A 1CKNB 4A3BB 4AYBB 3GTOB 2XRSD 4CDCC 1LTLA 1CUKA 1SYGA 2K33A 3I72A 4FF1A 2HQLA 5IGBA 5A2QE 1IBML 1K9MC 3SEBA 1AZQA 1C9OA 2XWJB 3KLSA 4C3JH 3S1NH 4Z9CB 4XDXA 2E2IH 1STYA 3I4LA 1ZYRD 1BDOA 4ZUJA 4IQZA 1KAAA 3N52A 2K5QA 4LF6Q 2NZOA 1BBXC 3V2TA 5GQOA 1NBWA 1TS5A 3JC66 5C4JB 2NVYB 4XTCS 4ZK9B 2E2HH 1YJWA 2L4NA 1B50A 3SK6A 1QB5D 3AFQA 2WB1G 4A93H 4L8JA 5D65A 4N9TA 1I4XA 5CYUA 4C3IH 4DNTB 4DV0L 4QIWB 2R93H 1W6JA 1VQFA 1EYDA 3S16H 1UEAB 4R9WA 1UUPA 4DUYQ 1PMRA 2EJMA 5FO7B 3GTPH 1HNWQ 1EYAA 3NSWA 2DNEA 2ES2A 1U4LA 4QL5A 3I56A 2F4VQ 1TWHB 1K8OA 2R7ZH 4HAEA 3DHQA 3SK4A 1BF4A 1XTDA 3JAMc 4KHPQ 3FP9A 4DR7Q 2JA5H 1CHQD 1ENFA 3ULLA 4A93G 3RLNA 2QEXA 4YCVA 4C3IG 1D5MC 1GXDC 1MBYA 2R93G 1VQDA 4KI0A 4ZYSA 1E22A 2L12A 2NVTB 1TR5A 1ET9A 2WFWA 1PYBA 1K0RA 3TP8A 1IBMQ 4JBWA 2R7ZG 3HOYB 2Y0SB 1HXYD 4F87A 1WFQA 1JWUD 3NWTA 2R6GA 2HCCA 2VB3X 1FL0A 1LTTD 1EY7A 1K28A 1LM0A 3HKZE 2KOLA 4ULLA 3D6CA 1YZ6A 2WP8J 3GV6A 2GN5A 2NUCA 3IKJA 1V1PA 4BS9A 3VR2A 2HIVA 2EVBA 4EQPA 1PZJD 2QILA 5CC4A 1CZGA 1QVGA 1PH3A 2YU9H 3G7LA 2R7DA 3ND8A 1AZPA 3ONAB 1DYQA 3H94A 1CA5A 4C56C 4A3GB 2WV6D 3KF6B 4DV0Q 1JC7A 1G2TA 2XRQD 3M4QA 4A3IB 3I4OA 4C3HB 2JQOA 3BDCA 5JJIA 3U9SA 2IY5B 3H3VC 5AJ3L 3TREA 5IGDA 1QOHA 4LWCA 3MFYA 1MD2D 5E7NA 3HOZH 4JI1Q 1TWAB 1CFMA 3GP7A 3PMFA 2NB0A 3KF8A 1AP0A 3C1FA 1I94L 4RH6A 3ULPA 3SK8A 1U4PA 4WJ3M 1HR0L 1HZ9A 1JB3A 1HUNA 1MI2A 2RA4A 1H95A 1G51A 1XPOA 2Z8LA 2JEBI 1HA6A 5HGTA 3HOZG 2M9VA 3EIVA 3I4NB 2D9UA 4BBRH 1RD9D 4OWXB 2LMCB 2QDBA 1WTRA 3EVQA 2JA6H 4I7AA 3FPUB 2R92B 2EYJA 5GAEC 2KCNA 1EWCA 2A6HC 1A6XA 4KKUA 4LF7L 2KCTA 2R7FA 1PH8A 1WTQA 3M85A 5JPNC 3CD6A 3KLWA 1AEXA 4BWGB 3OOCA 4B3SL 2BCOA 1SNDA 4BBRG 2ZM6Q 4IJLA 2VXWA 1X65A 1BCPF 2JA7B 2JA6G 4U673 1K8MA 3RN5A 2ZT9C 3S17H 3S1QH 3BVZA 2HHHL 1YVCA 5ELNA 2NVQH 4HIDA 1EYCA 1PTOH 3K6OA 3H09A 1I3QH 1S5DD 1EEFD 1SLJA 1O7IA 2IW3A 5DAUA 1MSGA 2JXMB 4K6DA 1CI3M 4ME3A 4DUZL 4A3CG 2B2TA 4HIKA 2A73B 1KHIA 3I70A 1ASYA 1ZXTA 3NELA 3E0JA 4KKTA 1I94Q 1Y1WB 1S5FD 2B2TC 2F0DA 2AWOA 1GUOA 2EY5A 1HR0Q 4DV7L 4TRDA 2B2VA 2G9DA 2MGSA 4AIMA 3S2DB 2Q8RE 2J7ZA 3E3XA 3GTMH 1IYJB 2Z6KC 3IL8A 1OTCA 2EJFC 1JOQA 4FXGC 2B2VC 3F2DA 2DUDA 4HTHA 4YCWA 4JI0L 5IT9c 5M3FH 4LUZA 5IGFA 4YHHL 2VQEL 4PV1C 1QNUA 2KCMA 1VQ5A 3CAMA 3S1MH 1E7ZA 2VL6A 4JCVE 1CQVA 1EY0A 3J7AV 4QF4A 4FF3A 1WTHA 1X6OA 1DOKA 2E74C 3KBGA 4B3SQ 4K2KA 3BDOA 3I3CA 1I4RA 3FVQA 4YWMA 2K14A 2MO1A 3MXUA 3OPOA 3HEJA 4GLAC 2HHHQ 2F0HA 1YITA 5EGTA 1NNXA 5IGEA 1E2VA 4L5SA 4R4QA 4XYQA 4RGTA 4V0BA
chains in the Genus database with same CATH topology
4CJ2C 2A74C 4CKCA 2JYOA 3OMCA 1D1KA 1DOLA 2Z4HA 3FMCA 5I4DA 3S9WA 2K32A 1I4PA 2F0VA 1QE6A 1G291 3X3MA 2JA8B 1VF7A 4EVOA 3A8JE 4FP5D 2CW0C 1I50B 4CJ1B 2JP1A 2AQ3B 1BO0A 3OMGA 3E6ZX 1S5ED 3D4DA 3PUVA 1TWGB 2B8FA 1K83B 3DMUA 1ET6A 2JEAI 2HDLA 1TWCB 3O13A 4QUFA 1PZKD 4KY7A 1PXUA 3FDTA 3BZDB 4HCSA 2K01A 5EPLA 5FK9C 1PTOF 2EYFA 1WD1A 1V1OA 1VDZA 2LFNA 1SXTA 1H9SA 5J22A 1KLGD 1E2WA 1F9SA 2PNRC 3A56A 3HKZB 2R3ZA 3M4OB 4OIKA 3HOWB 3I8ZA 2EPBA 1MSHA 2AUJD 3DM1A 3NHHA 1JCKB 4X3TA 2RDFA 1GUWA 2HCIA 3S14B 4PMBA 3VYRA 3QOLA 3HOXB 2O2LD 2JSOA 4QUCA 1PFMA 1EY6A 4E6IA 3IFDA 4RHSA 3TDQA 3WOEA 1ENAA 1B44D 2A6HD 5JEAJ 3X3NA 2Q8IB 1STEA 1XX8A 4S3SA 1STBA 1QCBD 1LTAD 5EKLA 4RKBA 2MJ8A 3GO5A 4CBVA 1L0XB 2R61A 1O80A 3T13A 2NN6I 1B9NA 2F1MA 3D4WA 5E1FA 3QG1A 4DF7A 1O7LA 3J81L 2I07B 3QB3A 2KEDA 3NQTA 3TSSA 3VR6A 1CQFA 1DJRD 4C1NI 4IUUA 3M3YB 1U4RA 3NE5B 1B4OA 1RCVD 2KUMA 2NZ1D 5LHY1 5E4XA 2ZXPA 1XXGA 3V05A 3SDZA 1ZKOA 1CM9A 1UAPA 4KJOA 4IUNA 4UDUC 5LL6X 3CRKC 1QWYA 3QWNA 2F0KA 2KHSA 3GTQB 1WCMB 4G7OC 3L7ZC 1HCZA 2EDGA 3OHXC 4FO2A 1M4VA 1SSOA 5M5WB 4F7XA 5DM73 5A35A 4KK7A 1F9PA 1SMYC 2IPKD 4DA2A 2F4IA 4CGYB 3UI2A 5G3LF 2WIIB 2B2YA 4KN4C 4ILWA 1HRJA 2KJXA 4X3KA 1NSNS 4RFBA 5IODA 4OO1H 1DXMA 5I6YA 5BN4A 2B2YC 3DXJC 4DAVA 3K7AB 4K6LA 4MHEA 4CKBA 3TZDA 4ODGA 1V8QA 3LWEA 5C0XH 3PIO3 3PO3B 4XIGS 3R3OA 1EWHA 2AQ2B 3R93A 1BCPC 3W3AA 1JORA 5CV8A 5EKIA 1ML0D 4CKEA 3BVGA 4OO1G 1EFID 3TN2A 3PIP3 5E4WC 4A3EB 4PMCA 4C2MB 5KEEA 1Q1BA 1WTXA 2EYLA 2OEOA 4K14A 1KLUD 1LT4D 3DWAA 3C46A 1I6HB 4A3MB 1SE2A 2X6LA 3L3OC 1DM0B 4EGVA 4N9PA 5EJWA 4XQNA 1ILPA 2QEJC 2F0LA 3DWQA 3ERQA 2PW7A 1H9SB 3MFGA 5D3DA 2RVLA 4OIJA 3OIPA 1KNAA 2FMMA 1I6VC 1RODA 4DXGA 2RDHA 1TIID 3MEHA 2D2CC 1SBBB 3QJYA 3AU7A 3GTKB 4ZUIA 2PW5A 3KBXA 3HOVB 1ILQA 2FHTA 4KD4A 1HQRD 1Y1VB 2O5JC 1SJED 4KMUC 1U4MA 1B9MA 1EY9A 1JWMD 2I46A 4WORA 3D8GA 3T51B 3MC0B 1Y8NB 3GTLB 5DNFA 2F0IA 1SYDA 5CBEE 5LL6S 3M7GA 4ZQ3A 4KY5A 2EYHA 4KY6A 4QB4A 5HURA 1D5XC 3MTSA 3P7JA 4C3HG 1F2ZA 1GHKA 1G2SA 1LO5D 4RKLA 3J7AF 3LX0A 2OF1A 2BE5D 2EY1A 2PYKA 4LAAA 2K6AA 4H44C 4HCEA 3MA2B 3FEWX 3SVMA 1EIGA 3AB9A 3URYA 1CHPD 3TP7A 1Q12A 3TZUA 4X3SA 1IL8A 3LWUA 2IX0A 3K5LA 4J1MA 3BG3A 1D1IA 1CTMA 1S5CD 1F9RA 1PTOC 2F3VA 4G57A 4DK0A 3J81E 1LTGD 4B9XA 1Z6HA 1B53A 4IUQA 1FNVA 3KLRA 4U68A 4NMZA 1ICWA 2PZUA 4GZYC 2F3WA 4R8NA 1DD2A 1YNJC 3HG9A 5I6WA 2LS01 1L0YB 3TBIB 4C3JB 5NUCA 3D3RA 3S1NB 2E2IB 1DCZA 3G6JB 2HUGA 2VNUD 4XQQA 4PMWA 3PUWA 1SMYD 2AUKA 2ID0A 2ICEC 2PZTA 3EROA 2EZVA 2E2HB 3NWSA 1BCPB 2Z1CA 1T5EA 4A93B 4IN3A 4C3IB 3T4AC 3E5SA 1R4PB 2TMPA 2R93B 5ELDA 3S16B 3PV0A 3V96A 3BYTB 4J8QA 3JAML 2ZXOA 1II3A 3L9AX 1BCPD 2MPMA 2R7ZB 1F2MA 1IKMA 5KNCA 1H9KA 4DGZA 5M9OA 3K59A 2JA5B 2B2WA 4FNFA 2EYMA 4ZKCB 2K1BA 2GA4B 1XTCD 5C5MA 2BDNA 4ZLTF 2B2WC 4K8JA 1LT5D 4ZAIA 1WTPA 4PNYA 2ZXRA 4P2CB 2SDFA 3Q22A 1Y69U 1Z7TA 5J39A 3PUXA 1GUSA 3SE0A 3NTHA 2PQEA 5EPKA 1EZ8A 1G8ZD 4IUPA 4I7ZC 3F2UA 3A7AB 4H7BA 1H9RA 3NBHA 1IYUA 3A55A 2YU9B 2MHVA 2OT2A 3MXGA 4LK1C 3VR5A 2C9OA 1YNNC 4Q5VA 2B2UA 3MXPA 5CV4A 1KABA 1LT6D 3OIQA 1SE3A 3HOZB 3VR4A 3KK7A 1BUVT 1VCIA 1PFNA 2XN9C 1QILA 1KDAA 1EY4A 2SEBD 2KA7A 2L11A 1V43A 4LJZC 3Q24A 1GUNA 2EE1A 1PLFA 1LACA 3GV3A 1H9MA 2K03A 4BBRB 1OXSC 3A54A 2IT1A 3I91A 3W2DA 4BA2I 3AMUA 2JA6B 1TVXA 2BDOA 3VYUA 1A15A 4XQJA 5CBAE 2B39A 4PQXA 1JOOA 4V190 1C48A 2F0QA 4HR7B 5EKKA 1XYIA 5T1IA 1SYBA 2NYZD 1NUCA 3P20A 5ELEA 2QCPX 1EEID 3P75A 3HZXA 2WKDA 3S17B 3S1QB 2KEEA 2NVQB 1KNEA 1PTOB 1I3QB 5CV6A 2WKCA 2RBMA 1TQOA 1V1PB 2X6GA 3IFTA 3NPPA 1SDFA 1DOMA 1PTOD 3BS1A 4OGQC 1SYFA 1STGA 5E3FA 3MAQA 3HRZC 4J6HA 3GTMB 2PCFB 5IT9L 1GUTA 2RSNA 1R4QB 1PFBA 1E0BA 5K5PA 1LT3D 5M3FB 1RF2D 1YNJD 5ISRA 1NR4A 5A2QL 2XSCA 3S1MB 4QMGA 3TMEA 2A68C 1SNQA 1D6EC 1IKLA 2IWHA 2XVSA 4DAYA 1KDBA 2NWGA 1EU4A 1LTID 3S2HB 2H1EA 1WVLA 2RKSA 3EFXD 5C4HA 2XIWA 2FINB 5AFWA 5EQ0A 5C3EB 1EZ6A 2K5DA 5KGUA 4NP5A 3VR3A 4RCOA 4K5VA 1RTNA 1I4GA 3MZ5A 1WTWA 4BY1B 3RUZA 2L9HA 1TU2B 5IGGA 3EQLC 1OXXK 4O1NA 2BE5C 1C8CA 1J9OA 3TP5A 4TKOB 3JAME 3I90A 2F03A 5K36H 1S5BD 3K5OA 2F0OA 2KVMA 2NVXB 4XXEA 1HTLD 3Q0AA 4A3FB 2A6EC 1I4HA 3FRPB 3DUZA 1KDCA 4BA1I 2M2LA 5K36G 3RMHA 5KNBA 5CV7A 1JOKA 4C1NK 5M3MB 1LLRD 2DY8A 1YNND 3PUZA 1PZID 4F8MA 2K5WA 4K5WA 2AWNA 2IX1A 5G3LD 1SNPA 3OWFA 4WJWA 1PRTF 3K0YA 3ZYYX 4KJNA 3P1HA 1E2ZA 5JOBA 1OO9B 2MUYA 3KUPA 4DAPA 4MIUA 5C5LA 3PUYA 1NCVA 1XWEA 2Q8TA 1EOTA 1EL0A 2M00A 1RDPD 2DNCA 3NTIA 4OHJA 3CKIB 2QF7A 4IURA 2KECA 1JICA 1W6KA 1HTPA 4RGOS 3QOJA 3FPPA 3OWEB 1A3VA 4K2LA 3EJIA 3T16A 5FLXL 2ENBA 2EJGC 1Y8PB 3RD4A 4FYDA 3R2TA 1GUGA 1TY2A 4ZRZA 1TS3A 2JE6I 1LTRD 1Q1EA 2K05A 1TWFB 2QKIC 1NAPA 2F0FA 2B8GA 1JR0D 2XNAC 1TKWB 1CK1A 2FFKB 4EQNA 2H4OA 4F88A 1TT2A 3A8IE 3WDNA 2VUMB 1HUMA 2RQXA 4G7HC 4NW2A 1FNUA 4G7ZC 2XWBB 2PO4A 2N55A 2DY7A 1FD7D 2YYZA 1VMPA 4FF4A 4FF2A 5IT9E 2A68D 5KRUA 1BR9A 4X3UA 4XT3B 3J80L 2HQEA 2E2JB 2F0NA 5JEAH 5EPJA 4IFDI 1Q8IA 3MVVA 4ME5A 1IW7C 2F0WA 3QO2A 3CHBD 4WRDA 1TS4A 1O7ZA 4BBSB 1ESRA 1UNSA 2LY7A 1RKNA 4HN7A 5JEAG 4YIJA 2K28A 3NP8A 5JVH3 3K57A 2BA0A 1X3PA 4C3JG 1SNOA 2F0GA 1SE4A 3BVMA 4B9WA 3J7YW 1STAA 4K5XA 5FO9B 5JAVA 2L0CA 2B63B 2FJ2A 3FKIB 5IGCA 5DM63 2K7VA 2BOSA 1IHZA 2J4XA 3RZOB 3GTGB 5I2XA 4FVMA 3MXNA 1C4QA 2A6ED 2KCCA 2LKVA 1CZWA 1FYCA 4DN4M 1SYEA 5FO8B 3GTJB 1JE4A 1F9QA 2OXPA 4DXFA 1NR2A 4IALA 2FMCA 5IOCA 3NUCA 3KLSX 2D62A 5D3IB 5FKAC 1TS2A 3VA7A 1FR3A 3GD7A 2WB1B 1G91A 3A7LA 3K5NA 4QCLA 5EBCA 4XT1B 4RGNA 4L63B 1B1ZA 3A8KE 1Y8OB 5C4ZA 4OO1I 5T1GA 3T53B 3C3LA 4HSPA 4KN7C 2O4XA 1BOSA 1JWSD 1OXVA 4IUVA 2A69C 3H0GB 1S4ZA 5C0XI 3NQIA 3NBIA 4HMIA 3Q23A 2EYPA 4HMJA 1LV9A 2PMZB 1EY5A 2WINB 3MHBA 2IJ0A 5I9OA 4UAIA 1AFPA 3NK9A 4TQUS 3BDLA 3N6RA 4RCNA 5CV5A 4FXKC 5CV9A 3C1EA 1A2UA 2D5DA 2F0TA 3RZDB 5ELFA 2J0TD 1QG7A 1SNMA 1STHA 2G9HD 1J8IA 4I65A 2PPBC 5KNDA 3GTPB 3LNNA 1RJTA 5FLXE 3K5MA 4IFDJ 2WAQB 4RA8A 4XYOA 3ITPA 4A3DB 3VA5A 3HS0C 1EIHA 3QIAA 2F0MA 2NN6H 3VYSA 1SJHD 1LABA 5JJZA 1KTKA 1F2YA 1HHVA 1HQMC 1PRTC 4H0LC 1PYWD 1EY8A 2NTSA 5CGKA 2B2UC 1HA5A 4Y7NB 2E76C 1BQQT 3SK5A 1A3UA 2L1BA 2NN6G 5DEHA 4WFN3 2NBFA 3GQBA 5BN3A 4KD3A 1SNCA 1SAPA 4KKSA 1IW7D 3CU7A 4KTAA 5EBDA 2RSOA 1PDQA 5I9PA 2CHBD 3D31A 3J80E 5FOBB 3S1RB 5C3XA 3OW7A 4MN3A 2E75C 5ELBA 3I73A 1U9RA 2L55A 3SXHA 2AQ1B 4EQOA 2SNSA 3Q6SA 2WACA 2HDMA 1ONLA 1DONA 1CT1D 4CJ0B 3CRLC 1SEBD 2K04A 1G6ZA 2O5IC 2F0JA 4K8IA 2SOBA 5F2DA 1DZ1A 1WTOA 2Z4IA 4ABNA 2A5HA 3M4YA 2KQ3A 2EYOA 2VB2X 1Q90A 4L6TB 5M5YB 4RWSC 4FXDA 3M7NA 5C0XJ 2CVRA 5CR3A 1HPCA 3R8BA 1RHPA 1JQYD 1LTBD 3T56B 4ID6A 5KYLA 1WD0A 3D6WA 1D5ZC 3RLFA 2MP1A 2PZWA 4HSVA 2EY2A 4DU9A 3IAYA 3C2PA 1F77A 1GJXA 1EQVA 4B08A 1Z47A 2RDGA 3H6MA 3OSOA 1QNKA 1SYCA 5JVG3 1AN8A 3EA6A 4DK1A 5COYA 2SNMA 3ND9A 1ZYRC 2NTTA 4KHVA 2A69D 1ENCA 1A2TA 2F0EA 4A3JB 4JK1C 4LMQD 2TSSA 5JPMC 2F0PA 4IFDH 3MWYW 5BN5A 2DN8A 3HOUB 1OXUA 2V4DA 1OXTA 4NKLA 1Q3LA 2N88A 1GOZA 4R8IA 3BYYB 3D4RA 5ELCA 3SHLA 5IIFA 4IFDG 1HFGA 2C5CA 1M8AA 1QJOA 3VYTA 1I4QA 1O7YA 5KIXA 1ZEQX 3PO2B 3WOFA 4TSSA 2IL8A 5I2YA 2L5TA 1BNZA 5M5XB 1T5XD 2BA1A 1PRTB 4IUTA 1H9JA 5CORA 5C44B 1B3AA 3I4MB 2EXZA 1VF5C 1RTOA 4HEDA 3HP3A 3SR1A 1PRTD 4CHTB 5C4XB 3TP6A 4M1UB 5C3WA 3NXWA 5CMDA 4BY7B 1O78A 1SFOB 4IZ8A 4RGMA 1VMCA 4KHZA 1FNWA 4DFAA 5J1ZA 1LTSD 4H13C 1A3TA 1BXTA 1MGSA 2F0SA 2IX3A 3R2IA 1STNA 4Q0FA 1F2LA 2E2DC 1TY0A 4G4KA 4RAUC 1FGBD 4O42A 1R9TB 1IYVA 1EQTA 1B2TA 4M8AA 2EOTA 1X3QA 3DEPA 4DNRB 4A3KB 4NDXA 1CA6A 1HFNA 4ZKBB 2F0UA 3K58A 5TSSA 5D14A 1WTVA 2X69A 5C6AA 5C0XG 2CQAA 1D2BA 2EY6A 3U9OA 3HGBA 2CW0D 5KYIA 1ESFA 4OL7A 3S15B 3H91A 3NTKA 1GHJA 1X32A 3DEOA 1AW7A 3DWPA 3CQZB 1EU3A 4KV6A 4RHRA 2ICIA 4A3BB 4AYBB 3GTOB 2XRSD 1SYGA 2K33A 3I72A 4FF1A 5IGBA 5A2QE 3SEBA 1AZQA 2XWJB 3KLSA 4Z9CB 4XDXA 1STYA 3I4LA 1ZYRD 1BDOA 4ZUJA 4IQZA 1KAAA 3N52A 2K5QA 1BBXC 3V2TA 1TS5A 5C4JB 2NVYB 4XTCS 4ZK9B 2L4NA 1B50A 3SK6A 1QB5D 4L8JA 5D65A 4N9TA 1I4XA 5CYUA 4DNTB 4QIWB 1W6JA 1EYDA 1UEAB 4R9WA 1UUPA 1PMRA 2EJMA 5FO7B 1EYAA 3NSWA 2DNEA 1U4LA 1TWHB 1K8OA 4HAEA 3DHQA 3SK4A 1BF4A 1CHQD 1ENFA 4C3IG 1D5MC 1GXDC 1MBYA 4KI0A 4ZYSA 2L12A 2NVTB 1TR5A 1ET9A 3TP8A 4JBWA 3HOYB 2Y0SB 1HXYD 4F87A 1JWUD 3NWTA 2R6GA 2HCCA 2VB3X 1LTTD 4ULLA 1EY7A 2KOLA 3D6CA 2WP8J 3GV6A 2NUCA 3IKJA 1V1PA 4BS9A 3VR2A 2EVBA 4EQPA 1PZJD 2QILA 5CC4A 1CZGA 3G7LA 3ND8A 1AZPA 3ONAB 1DYQA 3H94A 1CA5A 4C56C 4A3GB 2WV6D 1JC7A 1G2TA 2XRQD 4A3IB 4C3HB 3BDCA 3U9SA 3H3VC 5IGDA 1QOHA 3MFYA 1MD2D 1TWAB 1CFMA 3GP7A 3PMFA 2NB0A 3KF8A 1AP0A 3C1FA 4RH6A 3SK8A 1U4PA 1JB3A 1HUNA 1MI2A 2RA4A 2Z8LA 2JEBI 1HA6A 5HGTA 2M9VA 3I4NB 2D9UA 1RD9D 2LMCB 2QDBA 1WTRA 3EVQA 3FPUB 2R92B 2EYJA 2KCNA 1EWCA 2A6HC 1A6XA 4KKUA 1WTQA 3M85A 5JPNC 1AEXA 4BWGB 3OOCA 2BCOA 1SNDA 2VXWA 1BCPF 2JA7B 4U673 1K8MA 2ZT9C 3BVZA 1EYCA 1PTOH 3K6OA 3H09A 5DAUA 1S5DD 1EEFD 2IW3A 1MSGA 2JXMB 4K6DA 1CI3M 2B2TA 2A73B 3I70A 1ZXTA 3E0JA 4KKTA 1Y1WB 1S5FD 2B2TC 2F0DA 2AWOA 1GUOA 2EY5A 4TRDA 2B2VA 2G9DA 2MGSA 3S2DB 2Q8RE 2J7ZA 3IL8A 2EJFC 1JOQA 4FXGC 2B2VC 4HTHA 5IGFA 4PV1C 1QNUA 1CQVA 1EY0A 3J7AV 4QF4A 4FF3A 1DOKA 2E74C 3KBGA 4K2KA 3BDOA 3I3CA 1I4RA 3FVQA 3MXUA 3OPOA 3HEJA 2F0HA 5EGTA 5IGEA 1E2VA 4XYQA 4RGTA 4V0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYE A;  5ISR A;  4KD4 A;  2KQ3 A;  2EYO A;  3DHQ A;  1NSN S;  4NDX A;  3SK4 A;  2EYJ A;  5KIX A;  4QMG A;  5IOD A;  1EY6 A;  3OMC A;  3TME A;  1EY9 A;  2F0M A;  4WOR A;  4E6I A;  2F0U A;  1SNQ A;  3D8G A;  5I6Y A;  2OXP A;  4F8M A;  4K5W A;  2PZT A;  4IAL A;  5CR3 A;  3ERO A;  2EY6 A;  5C6A A;  5IOC A;  2F0I A;  3S9W A;  1AEX A;  1SYD A;  3U9O A;  4ODG A;  1ENA A;  1SNP A;  3OWF A;  1SND A;  1F2Y A;  3NUC A;  4ZQ3 A;  3R3O A;  5KYI A;  1TR5 A;  1KDA A;  1KDB A;  4ID6 A;  4OL7 A;  5KYL A;  1EY4 A;  4KY5 A;  4KJN A;  2EXZ A;  5KRU A;  3TP8 A;  2EYH A;  3P1H A;  1EY8 A;  4KY6 A;  3E5S A;  4QB4 A;  2F0V A;  4S3S A;  5CV8 A;  5JOB A;  2HQE A;  2PZW A;  1JOR A;  5HUR A;  2EY2 A;  2F0N A;  5CGK A;  1F2Z A;  1STB A;  2RKS A;  4DU9 A;  3SR1 A;  5C4H A;  3SK5 A;  1EYC A;  5EKL A;  1A3U A;  4RKB A;  4EVO A;  3MVV A;  4ME5 A;  5DEH A;  1EY7 A;  4RKL A;  5DAU A;  1II3 A;  2F0W A;  3D6C A;  4MIU A;  3LX0 A;  4WRD A;  5C4Z A;  5C5L A;  1EQV A;  1F2M A;  2NUC A;  4K6D A;  4PMC A;  2OF1 A;  4KD3 A;  3T13 A;  3TP6 A;  5KEE A;  4KV6 A;  1SNC A;  3D4W A;  1EZ6 A;  4DGZ A;  5KGU A;  2M00 A;  4NP5 A;  5E1F A;  3OMG A;  2EYL A;  5M9O A;  2OEO A;  2O4X A;  4DF7 A;  4K14 A;  2EYM A;  3H6M A;  3D4D A;  4K5V A;  2EY1 A;  4EQP A;  5C3W A;  3OSO A;  5CC4 A;  2PYK A;  3MZ5 A;  1JOO A;  4KTA A;  4LAA A;  3NXW A;  2F0Q A;  4HMI A;  1RKN A;  2F0D A;  3QB3 A;  1SYC A;  5EKK A;  3DMU A;  5C5M A;  2EY5 A;  2EYP A;  3QOL A;  4HMJ A;  4YIJ A;  4IZ8 A;  3RUZ A;  4K8J A;  1SYB A;  3NP8 A;  2SNM A;  5IGG A;  1SYG A;  1NUC A;  4PNY A;  3TP7 A;  3NQT A;  1EY5 A;  4TRD A;  5IGB A;  4KHV A;  4DFA A;  5J1Z A;  3TP5 A;  3MHB A;  3P75 A;  4KY7 A;  5J39 A;  3QOJ A;  4J1M A;  3HZX A;  5C3X A;  1SNO A;  1ENC A;  1A2T A;  2F0G A;  4N9P A;  5I9O A;  1JOQ A;  4B9W A;  2F0E A;  3NK9 A;  1A3V A;  1A3T A;  2PQE A;  3BDC A;  3EJI A;  4K2L A;  4HTH A;  2EYF A;  1EZ8 A;  3T16 A;  5CV6 A;  1STA A;  2F3V A;  2ENB A;  5IGF A;  1STY A;  2RBM A;  1TQO A;  1U9R A;  2F0S A;  2F0L A;  3SXH A;  5IGD A;  4K5X A;  4G57 A;  3BDL A;  4ZUJ A;  5J22 A;  1STN A;  1KAA A;  4EQO A;  2F0O A;  2F0P A;  3ERQ A;  2SNS A;  5I9P A;  5CV5 A;  2WAC A;  4H7B A;  5CV9 A;  4B9X A;  5JAV A;  3C1E A;  2PW7 A;  1A2U A;  3PMF A;  1EY0 A;  4KJO A;  4QF4 A;  2F0T A;  4IUN A;  3C1F A;  3VA5 A;  4NMZ A;  1SYF A;  2F0K A;  2KHS A;  3V2T A;  1SNM A;  1STH A;  3SK8 A;  5IGC A;  2PZU A;  2F3W A;  1STG A;  4R8N A;  1IHZ A;  4K2K A;  4I65 A;  4NKL A;  2F0F A;  5E3F A;  3SK6 A;  1KDC A;  2F0J A;  3MEH A;  4J6H A;  4K8I A;  4N9T A;  2SOB A;  5I6W A;  3NHH A;  4F7X A;  3HEJ A;  5F2D A;  3SHL A;  1EYD A;  4ZUI A;  5HGT A;  4EQN A;  2PW5 A;  2F0H A;  3MXP A;  5CV4 A;  2RDF A;  5IIF A;  5CV7 A;  5EGT A;  1TT2 A;  5IGE A;  1JOK A;  5NUC A;  5K5P A;  1EYA A;  1KAB A;  2LKV A;  3ITP A;  2QDB A;  4PMB A;  3EVQ A; 
#chains in the Genus database with same CATH topology
 4CJ2 C;  2A74 C;  1V1Q A;  3W5O A;  5C3E H;  4CKC A;  2JYO A;  3OMC A;  1D1K A;  3UDF A;  1DOL A;  4DV1 L;  2Z4H A;  3FMC A;  5I4D A;  3S9W A;  4RMF A;  4BY1 H;  4LFA L;  2K32 A;  4DV7 Q;  1PH4 A;  1I4P A;  2CKZ B;  2F0V A;  1QE6 A;  1QZG A;  1HZB A;  5C3E G;  1G29 1;  3ER0 A;  4A3J G;  3X3M A;  3HFZ B;  2UUA L;  2JA8 B;  1VF7 A;  1P16 A;  4EVO A;  3A8J E;  4FP5 D;  2CW0 C;  1I50 B;  2D0P A;  5ELO A;  4CJ1 B;  4YHH Q;  2VQE Q;  1VQ9 A;  2JP1 A;  1G6P A;  2AQ3 B;  4BY1 G;  1GKH A;  4HJ9 A;  1BO0 A;  3OMG A;  3E6Z X;  1S5E D;  3D4D A;  3K80 C;  2NVX H;  3PUV A;  1TWG B;  2B8F A;  3PO2 H;  1K83 B;  4A3F H;  2LSS A;  3DMU A;  1ET6 A;  2JEA I;  2HDL A;  1TWC B;  3O13 A;  4QUF A;  3CF5 A;  4OEL B;  5IP7 H;  1PZK D;  4KY7 A;  1PXU A;  3FDT A;  4R4I A;  5C44 H;  1PA6 A;  3BZD B;  4HCS A;  2K01 A;  3ERS X;  5EPL A;  5FK9 C;  4A4I A;  5M3M H;  1PTO F;  2EYF A;  1WD1 A;  1IZ6 A;  1JJG A;  5IWA Q;  1V1O A;  1VDZ A;  2LFN A;  1SXT A;  1Q81 C;  3PO2 G;  1H9S A;  5J22 A;  4A3F G;  3EBE A;  1KLG D;  1E2W A;  1F9S A;  2PNR C;  4DV1 Q;  5IP7 G;  1VQA A;  4LFA Q;  3KF8 B;  3A56 A;  4B3T Q;  5C44 G;  3HKZ B;  2R3Z A;  2YV5 A;  4OIK A;  3M4O B;  4MNO A;  3I8Z A;  3HOW B;  2EPB A;  1MSH A;  2AUJ D;  4DNI A;  1YBY A;  3DM1 A;  1VQ8 A;  3NHH A;  1JCK B;  4X3T A;  2RDF A;  2UUA Q;  1GUW A;  2HCI A;  1XMQ Q;  5C4X G;  3S14 B;  4PMB A;  3VYR A;  3QOL A;  4GOP A;  3HOX B;  2O2L D;  2JSO A;  4QUC A;  1PFM A;  1WOC A;  5FJ8 H;  1EY6 A;  2XGT A;  3PGZ A;  4E6I A;  3IFD A;  4RHS A;  1N36 L;  2OTJ A;  3W1B A;  3TDQ A;  3WOE A;  1ENA A;  1B44 D;  2EXD A;  2A6H D;  1XPU A;  3J7Z C;  5JEA J;  2G5D A;  3X3N A;  4S3S A;  1STE A;  1XX8 A;  2Q8I B;  1STB A;  1QCB D;  5FJ8 G;  1RIP A;  1LTA D;  1MJC A;  5EKL A;  4RKB A;  2MJ8 A;  3GO5 A;  4MTN A;  1R9T H;  4CBV A;  3KYH C;  1L0X B;  2R61 A;  1O80 A;  3T13 A;  2NN6 I;  1B9N A;  2F1M A;  3D4W A;  5FLX c;  4DR3 L;  5E1F A;  3QG1 A;  4DF7 A;  1YI2 A;  1LUZ A;  1O7L A;  3J81 L;  5LMN W;  2WB1 E;  1Z9F A;  2I07 B;  1X55 A;  4DR2 L;  3QB3 A;  1TWF H;  2KED A;  4JOI C;  4X65 L;  3PCO B;  2VW9 A;  1M90 C;  1QUQ B;  3NQT A;  3TSS A;  3VR6 A;  2Q2U A;  1CQF A;  1DJR D;  2I5H A;  4C1N I;  2OQK A;  2K52 A;  3H3V I;  4IUU A;  3M3Y B;  1U4R A;  4HJA A;  3NE5 B;  3S15 H;  2V1C C;  4UP7 A;  1B4O A;  1RCV D;  2KUM A;  2VUM H;  4LF5 L;  2NZ1 D;  5LHY 1;  5E4X A;  2ZXP A;  1XXG A;  2PMZ E;  3V05 A;  3SDZ A;  1ZKO A;  1VQN A;  1CM9 A;  3E9I A;  4EX5 A;  1N36 Q;  1UAP A;  4KJO A;  2UXD L;  4IJH A;  4IUN A;  4UDU C;  5LL6 X;  3G6E A;  3CRK C;  1QWY A;  3QWN A;  2F0K A;  2KHS A;  3TRZ A;  3GTQ B;  1WCM B;  4G7O C;  3KJO A;  3L7Z C;  1Q82 C;  1HCZ A;  2EDG A;  3OHX C;  4FO2 A;  1ASZ A;  4GS3 A;  1M4V A;  1SSO A;  5M5W B;  4F7X A;  5DM7 3;  5A35 A;  2E2J H;  1QVC A;  2CWA A;  4KK7 A;  1F9P A;  1SMY C;  5H1S E;  1VQJ A;  2IPK D;  4DA2 A;  2F4I A;  4CGY B;  3J80 c;  3UI2 A;  5G3L F;  2WII B;  2B2Y A;  4KN4 C;  4ILW A;  4ALP A;  2KJX A;  4X3K A;  1NSN S;  1HRJ A;  4DR3 Q;  4RFB A;  5IOD A;  4OO1 H;  1EIY B;  4A3B G;  2GVB A;  1DXM A;  4AYB G;  3U4Z A;  5BN4 A;  2B2Y C;  3DXJ C;  5I6Y A;  1VQK A;  4DAV A;  3K7A B;  2E5L L;  4K6L A;  4MHE A;  5IYB H;  4CKB A;  4DR2 Q;  3TZD A;  2RHS B;  4ODG A;  4X65 Q;  1V8Q A;  3LWE A;  4R4O A;  5C0X H;  3PIO 3;  3PO3 B;  4XIG S;  3R3O A;  1EWH A;  2AQ2 B;  3H15 A;  3R93 A;  4OEM B;  3TQY A;  1BCP C;  3W3A A;  2MFI A;  1JOR A;  2NVY H;  5CV8 A;  5EKI A;  1PH5 A;  1ML0 D;  4CKE A;  4LF8 L;  3BVG A;  5HY6 A;  4OO1 G;  1EFI D;  3RN2 A;  4LF5 Q;  1BVS A;  3TN2 A;  3PIP 3;  5E4W C;  4A3E B;  4UY8 C;  5IYB G;  4LUO A;  4PMC A;  4C2M B;  3E0E A;  5KEE A;  1Q1B A;  1WTX A;  2EYL A;  2OEO A;  4K14 A;  2UXD Q;  3G48 A;  2B63 H;  3FKI H;  1JJC B;  1JMC A;  4IOC A;  3CC2 A;  1KLU D;  1LT4 D;  2BH8 A;  3DWA A;  1VQH A;  3C46 A;  1I6H B;  1X54 A;  1N8R C;  4JI4 L;  3RZO H;  4A3M B;  3CCE A;  3GTG H;  2AKW B;  1QVF A;  1SE2 A;  2X6L A;  3L3O C;  1DM0 B;  4EGV A;  4X66 L;  3KJP A;  3S24 A;  4N9P A;  5EJW A;  4JI3 Q;  4XQN A;  1VQ4 A;  1ILP A;  4JYA L;  4N8F A;  2MNA A;  2QEJ C;  2B63 G;  5JJK A;  3FKI G;  2F0L A;  3DWQ A;  3GTJ H;  2UUC L;  3CCJ A;  3ERQ A;  4A3L H;  2PW7 A;  1H9S B;  3MFG A;  5D3D A;  2RVL A;  3ICE A;  4OIJ A;  2E5L Q;  3OIP A;  3OTO L;  1KNA A;  2FMM A;  1I6V C;  1ROD A;  4DXG A;  2RDH A;  1TII D;  1YJN A;  3MEH A;  2D2C C;  2Z6B A;  1SBB B;  2Y0S G;  3QJY A;  1GD7 A;  3AU7 A;  4LF8 Q;  3GTK B;  4ZUI A;  2PW5 A;  1A63 A;  3KBX A;  1L1O A;  2F52 A;  3DM3 A;  3HOV B;  4A3L G;  4DV4 L;  1ILQ A;  2FHT A;  4KD4 A;  2FXQ A;  1HQR D;  4NXN L;  1Y1V B;  4C3H H;  2O5J C;  1SJE D;  1WI5 A;  4KMU C;  1U4M A;  1B9M A;  1EY9 A;  1JWM D;  2I46 A;  4WOR A;  1AH9 A;  3D8G A;  4YWK A;  3T51 B;  4DV2 L;  3MC0 B;  4UHV A;  1Y8N B;  3GTL B;  5DNF A;  2F0I A;  3H0G H;  1AE2 A;  1SYD A;  5CBE E;  5LL6 S;  3M7G A;  4ZQ3 A;  4JI4 Q;  2OWO A;  3T1H L;  4KY5 A;  4LFB Q;  2Z9H A;  4CDF C;  3Q8D A;  2EYH A;  4KY6 A;  4QB4 A;  4X66 Q;  1D5X C;  3MTS A;  5HUR A;  3P7J A;  4YCU A;  4C3H G;  1F2Z A;  1SRO A;  1GHK A;  1CSP A;  2KEN A;  1G2S A;  4JYA Q;  1LO5 D;  3BZC A;  4A75 A;  3RNU A;  4RKL A;  2UUB L;  3J7A F;  3LX0 A;  2CFM A;  3H0G G;  2UUC Q;  1NTG A;  2N78 A;  2OF1 A;  3AQQ A;  2B29 A;  2BE5 D;  3IRB A;  2EY1 A;  2PYK A;  4LAA A;  3RZD H;  4NB3 A;  2K6A A;  4H44 C;  4HCE A;  3MA2 B;  3FEW X;  3SVM A;  1EIG A;  3K7U C;  3AB9 A;  3URY A;  1CHP D;  3TP7 A;  1Q12 A;  4X3S A;  3TZU A;  1IL8 A;  3LWU A;  1NMF A;  4L5T A;  2IX0 A;  3K5L A;  4HIO A;  4J1M A;  3TS0 A;  3BG3 A;  1D1I A;  1CTM A;  1S5C D;  1F9R A;  1PTO C;  2F3V A;  4A3D H;  1SRU A;  4NXN Q;  2YTV A;  4G57 A;  4DK0 A;  4GNX A;  3J81 E;  2KHI A;  1LTG D;  4B9X A;  1Z6H A;  1B53 A;  4IUQ A;  1FNV A;  1YHQ A;  1SE8 A;  4FDB A;  4GLV B;  1JJ2 A;  3KLR A;  4U68 A;  4NMZ A;  4HJ7 A;  1ICW A;  4QJF A;  1VQ7 A;  2PZU A;  4GZY C;  2F3W A;  4R8N A;  1B7Y B;  1LYL A;  1DD2 A;  2WAQ G;  3T1H Q;  2JA7 G;  1Y1W H;  1YNJ C;  3HG9 A;  5I6W A;  4A3D G;  1EUJ A;  2LS0 1;  4PG3 A;  1V9P A;  3NEN A;  3BZK A;  4Y7N H;  1L0Y B;  3TBI B;  4C3J B;  2UXC L;  5NUC A;  3D3R A;  2VS1 A;  2UUB Q;  3S1N B;  2E2I B;  3PIP A;  1DCZ A;  1K3B C;  4P71 A;  3G6J B;  2HUG A;  1KXL A;  1E24 A;  2VNU D;  4XQQ A;  4PMW A;  4X62 L;  3PUW A;  1SMY D;  2AUK A;  2ID0 A;  1Y1W G;  2Q2T A;  5GRO A;  3F8T A;  2ICE C;  4QQB X;  2PZT A;  3ERO A;  2EZV A;  1HNX L;  3B6Y A;  2E2H B;  3NWS A;  2LXJ A;  3I55 A;  1BCP B;  2Z1C A;  1PV4 A;  1T5E A;  4A93 B;  4IN3 A;  2RHQ B;  3S1R H;  4C3I B;  2QGQ A;  3T4A C;  3E5S A;  1R4P B;  2TMP A;  2R93 B;  5ELD A;  1HZA A;  3S16 B;  4GKK L;  3PV0 A;  3KFU A;  3V96 A;  3BYT B;  4DAM A;  1K73 C;  4J8Q A;  3JAM L;  2ZXO A;  4IO9 A;  3K8A A;  1II3 A;  3L9A X;  1BCP D;  1Q86 C;  2MPM A;  2R7Z B;  1F2M A;  1IKM A;  5KNC A;  1H9K A;  1I5F A;  4DGZ A;  5M9O A;  3K59 A;  2JA5 B;  2B2W A;  4FNF A;  1SR3 A;  2EYM A;  4ZKC B;  4A3C H;  2K1B A;  4IPH A;  3CC7 A;  3OYY A;  2GA4 B;  1JB7 A;  1XTC D;  5C5M A;  2BDN A;  4ZLT F;  2B2W C;  4GN5 A;  4K8J A;  1HH2 P;  1LT5 D;  2N8N A;  4ZAI A;  1YHA A;  1WTP A;  4PNY A;  2ZXR A;  4P2C B;  2PQA A;  2SDF A;  3Q22 A;  5AJ3 Q;  1Y69 U;  1VQL A;  1Z7T A;  5J39 A;  3PUX A;  1GUS A;  2UXC Q;  3SE0 A;  3NTH A;  1XNR L;  2PQE A;  5EPK A;  1EZ8 A;  1G8Z D;  2P5Z X;  4IUP A;  4I7Z C;  3F2U A;  2QA4 A;  5IP9 G;  3A7A B;  5M5Y H;  1I50 H;  4H7B A;  1H9R A;  4X62 Q;  3NBH A;  4DR6 L;  1X3E A;  1IYU A;  3CP0 A;  4CDE C;  3A55 A;  4O2D A;  1HNX Q;  2YU9 B;  2MHV A;  2OT2 A;  5LMN L;  3MXG A;  4DK3 C;  3TS2 A;  4LK1 C;  3VR5 A;  1K83 H;  2C9O A;  1YNN C;  4Q5V A;  2B2U A;  5IY0 A;  1HJP A;  3MXP A;  5CV4 A;  1QZH A;  2AHO B;  5FLM H;  4JBM A;  1KAB A;  1LT6 D;  1KRT A;  4LF7 Q;  1L1O B;  1Q7Y C;  3OIQ A;  1SE3 A;  3HOZ B;  3VR4 A;  3KK7 A;  1EQQ A;  1YJ9 A;  4B3M L;  3LGJ A;  3JAM i;  1BUV T;  3J7A 5;  5HGQ A;  1VCI A;  1W3S A;  1HZC A;  1PFN A;  2XN9 C;  1QIL A;  5FLM G;  1KDA A;  2GVA A;  1L2F A;  1EY4 A;  2SEB D;  2KA7 A;  2L11 A;  1V43 A;  4LJZ C;  3Q24 A;  1GUN A;  2EE1 A;  1PLF A;  4TVA B;  1LAC A;  3GV3 A;  1H9M A;  2K03 A;  4BBR B;  1OXS C;  4IOA A;  1XNR Q;  3A54 A;  4DUZ Q;  2IT1 A;  3RR5 A;  4A3J H;  3I91 A;  2JJQ A;  3W2D A;  4BA2 I;  4JI6 L;  4JBK A;  1UWV A;  3AMU A;  2JA6 B;  1S40 A;  1TVX A;  2BDO A;  3VYU A;  4POG A;  1A15 A;  4XQJ A;  1IXR A;  4DR6 Q;  1YIJ A;  5CBA E;  2B39 A;  1J5E L;  4PQX A;  1XNQ L;  1JOO A;  3HOU H;  4V19 0;  1C48 A;  2F0Q A;  4HR7 B;  5EKK A;  5LMN Q;  1XYI A;  5T1I A;  1SYB A;  2NYZ D;  1NUC A;  3P20 A;  4GLX A;  1IBK L;  5ELE A;  2QCP X;  1EEI D;  4JI0 Q;  3P75 A;  4LFC L;  3HZX A;  2WKD A;  3S17 B;  3S1Q B;  2KEE A;  3CXC A;  2NVQ B;  5BR8 L;  1KNE A;  1PTO B;  1I3Q B;  5CV6 A;  2WKC A;  2RBM A;  1TQO A;  4AYB E;  3HOU G;  1ICF B;  1V1P B;  2X6G A;  3IFT A;  3NPP A;  4B3M Q;  1UEB A;  1SDF A;  4GNX B;  5M5X H;  1DOM A;  1PTO D;  3BS1 A;  1SYF A;  4OGQ C;  1STG A;  5E3F A;  2N49 A;  2RF4 A;  1PFS A;  3MAQ A;  3HRZ C;  4J6H A;  3UE1 A;  3I4M H;  4P72 A;  4UPA A;  3GTM B;  2PCF B;  5IT9 L;  1GUT A;  2RSN A;  1R4Q B;  1PFB A;  1E0B A;  4HIM A;  5K5P A;  1LT3 D;  5M3F B;  1EWI A;  1RF2 D;  5IYD G;  1YNJ D;  5ISR A;  1NR4 A;  2ALY B;  5C4X H;  5A2Q L;  3W1G A;  1VQI A;  2XSC A;  3CCS A;  3S1M B;  4BXX H;  1FVI A;  4QMG A;  4DR4 L;  3TME A;  1VQ6 A;  1K3R A;  1C0A A;  2A68 C;  1SNQ A;  1D6E C;  1IKL A;  1XNQ Q;  3I4M G;  2IWH A;  1WYD A;  4QIW E;  2XVS A;  4DR5 L;  1VQG A;  4BY7 H;  1SFO H;  1B3Q A;  4DAY A;  1KDB A;  4DV3 L;  5JJL A;  2NWG A;  1IBK Q;  1EU4 A;  1LTI D;  1WCM H;  2I0Q A;  3S2H B;  2H1E A;  1WVL A;  1Y14 B;  2RKS A;  5BR8 Q;  4BXX G;  3EFX D;  5C4H A;  2XIW A;  2FIN B;  5AFW A;  4N8X 1;  5EQ0 A;  4GOP C;  5C3E B;  1AE3 A;  1PH7 A;  1MJE A;  2YTX A;  4BY7 G;  1EZ6 A;  2K5D A;  5KGU A;  4NP5 A;  3VR3 A;  4GKJ L;  4RCO A;  4K5V A;  1RTN A;  1I4G A;  1WCM G;  3MZ5 A;  1WTW A;  3MEF A;  4BY1 B;  1SN8 A;  2Y0S E;  2PI2 E;  3RUZ A;  2L9H A;  1TU2 B;  5IGG A;  3EQL C;  2F3I A;  4HJ8 A;  1OXX K;  4O1N A;  3CCL A;  2BE5 C;  3CCQ A;  1X56 A;  1C8C A;  1J9O A;  3TP5 A;  4TKO B;  3JAM E;  2PQA B;  1KQS A;  3I90 A;  2F03 A;  3G71 A;  5K36 H;  2K50 A;  1NE3 A;  4A3K H;  1S5B D;  3K5O A;  2F0O A;  4DR4 Q;  2KVM A;  4X6A H;  2NVX B;  4XXE A;  1HTL D;  3Q0A A;  4A3F B;  3NBH B;  3PO3 G;  2I5M X;  2A6E C;  1I4H A;  3FRP B;  3DUZ A;  4LF9 L;  1KDC A;  4DV3 Q;  4BA1 I;  2M2L A;  5K36 G;  3RMH A;  1I6H H;  5KNB A;  3QR8 A;  4A3K G;  5CV7 A;  4B3R L;  1JOK A;  4C1N K;  2PI2 A;  2PNH A;  5M3M B;  2UU9 L;  3CQZ H;  1LLR D;  4DV5 L;  1D7Q A;  2DY8 A;  1EOV A;  1YNN D;  3STB D;  3PUZ A;  1PZI D;  4JBJ A;  4GKJ Q;  4F8M A;  3CCV A;  2K5W A;  4K5W A;  4A3B H;  2AWN A;  3GTO H;  2IX1 A;  5G3L D;  1SNP A;  4MTK A;  3OWF A;  4WJW A;  1PRT F;  3K0Y A;  3ZYY X;  4KJN A;  4DV6 L;  3P1H A;  1E2Z A;  5JOB A;  2K5H A;  1OO9 B;  2MUY A;  3KUP A;  3UE0 A;  4DAP A;  4IPC A;  1P8L A;  4MIU A;  5C5L A;  3PUY A;  1NCV A;  2XTI A;  1XWE A;  2Q8T A;  1KAW A;  4DKA C;  3PF4 A;  1EOT A;  1EL0 A;  2M00 A;  1RDP D;  3NTI A;  2DGY A;  2DNC A;  4OHJ A;  2HT1 A;  2WAQ E;  3CKI B;  2QF7 A;  4IUR A;  3VDY A;  3J81 i;  5C4J H;  4LF9 Q;  4CDD C;  2KEC A;  2CH4 A;  1JIC A;  3GTL H;  1W6K A;  1HTP A;  4LUV A;  4RGO S;  3QOJ A;  3FPP A;  3M4P A;  4B3R Q;  4P75 A;  3OWE B;  1PH2 A;  2UU9 Q;  1A3V A;  4K2L A;  3EJI A;  3L0O A;  2ZTE A;  2EQS A;  3T16 A;  1XPR A;  5FLX L;  4X64 L;  2ENB A;  2EJG C;  4R4T A;  1Y8P B;  3RD4 A;  4FYD A;  1TWH H;  4R4C A;  3R2T A;  1GUG A;  3U4V A;  1TY2 A;  4ZRZ A;  1TS3 A;  2JE6 I;  1LTR D;  3PQI A;  1D8L A;  1Q1E A;  2K05 A;  1TWF B;  2QKI C;  1NAP A;  3AFP A;  1MHW C;  2F0F A;  1A8V A;  1J6Q A;  1JR0 D;  2B8G A;  2NVT H;  2XNA C;  1NY4 A;  4GN3 B;  4DV6 Q;  1PH1 A;  1TKW B;  4QY7 A;  1CK1 A;  4DPG A;  2FFK B;  4EQN A;  3HOY H;  2H4O A;  4F88 A;  1TT2 A;  3A8I E;  3WDN A;  2VUM B;  1HUM A;  1UE6 A;  2RQX A;  4G7H C;  4NW2 A;  4K0K L;  1FNU A;  1VQO A;  4G7Z C;  2XWB B;  1M1K C;  1N32 L;  2PO4 A;  1E1T A;  2N55 A;  3CC4 A;  2DY7 A;  1FD7 D;  4KHP L;  2YYZ A;  1X9N A;  1VMP A;  3HOY G;  1B8A A;  4HJ5 A;  4FF4 A;  3A5Z B;  4FF2 A;  4IPG A;  4A3G H;  5IT9 E;  1S72 A;  2A68 D;  5KRU A;  1BR9 A;  4X3U A;  4XT3 B;  4DAY B;  3J80 L;  2HQE A;  2E2J B;  2F0N A;  5JEA H;  5EPJ A;  3D0F A;  4A3I H;  4IFD I;  1L1O C;  1Q8I A;  3MVV A;  4ME5 A;  1IW7 C;  4GOP B;  4X64 Q;  2F0W A;  3QO2 A;  1BBU A;  3CHB D;  4WRD A;  1TS4 A;  1L0W A;  1O7Z A;  2ZTD A;  1N34 L;  4BBS B;  3GDE A;  1TWA H;  1U0L A;  2N3S A;  1ESR A;  3K81 C;  4A3G G;  1UNS A;  1YEZ A;  2LY7 A;  4APV A;  3UDG A;  1RKN A;  4HN7 A;  5JEA G;  4YIJ A;  2K28 A;  3NP8 A;  4A3I G;  5JVH 3;  3K57 A;  1IBL L;  2BA0 A;  1X3P A;  2Z0S A;  4C3J G;  5L37 A;  1SNO A;  2F0G A;  1SE4 A;  3I4N H;  3BVM A;  4B9W A;  1CSQ A;  4PZ6 A;  3EN2 A;  3J7Y W;  1STA A;  3AEV A;  2OQ0 A;  4K0K Q;  3K0X A;  2ATW A;  4K5X A;  1UE5 A;  3J81 j;  1VQM A;  3CPW A;  3OTO Q;  2R92 H;  4OON A;  5FO9 B;  5JAV A;  1N32 Q;  2L0C A;  2B63 B;  2FJ2 A;  3FKI B;  2QDL A;  4JI1 L;  3PF5 A;  1BBW A;  5IGC A;  5DM6 3;  2K7V A;  2B3G A;  2BOS A;  4L5R C;  1IHZ A;  2J4X A;  3I4N G;  3RZO B;  3GTG B;  5I2X A;  2CWP A;  1HNZ L;  4FVM A;  4DV4 Q;  2JA7 H;  3MXN A;  1C4Q A;  2A6E D;  2R92 G;  4JV5 L;  3SGI A;  2KCC A;  2LKV A;  1CZW A;  1FYC A;  4DN4 M;  1SYE A;  5FO8 B;  3GTJ B;  4DV2 Q;  1N34 Q;  1JE4 A;  1F9Q A;  2JA5 G;  3J80 i;  3T1Y L;  4GNX C;  1VS0 A;  3F1Z A;  3UDI A;  1X3F A;  1XMO L;  2CQO A;  2OXP A;  3PIO A;  4DXF A;  1NR2 A;  4IAL A;  2FMC A;  1VQE A;  5IOC A;  1E3P A;  2YTY A;  3NUC A;  3KLS X;  2KHJ A;  2D62 A;  5D3I B;  5FKA C;  1TS2 A;  2NZH A;  3VA7 A;  1FR3 A;  1IBL Q;  3GD7 A;  2WB1 B;  1G91 A;  3S2D H;  3A7L A;  3K5N A;  2ZM6 L;  4QCL A;  1XJV A;  3BJU A;  5EBC A;  4XT1 B;  4RGN A;  4L63 B;  4JI7 L;  1B1Z A;  3A8K E;  3OW2 A;  1Y8O B;  1RL2 A;  2K75 A;  2ZJQ A;  5C4Z A;  3KDF A;  1GM5 A;  2D0O A;  4OO1 I;  5T1G A;  4NPS A;  3T53 B;  4HSP A;  4KN7 C;  3C3L A;  2O4X A;  1BOS A;  1JWS D;  1OXV A;  4QGU A;  2JN4 A;  4IUV A;  4YWL A;  1PHJ A;  1JE5 A;  2A69 C;  3H0G B;  1S4Z A;  5C0X I;  3NQI A;  3NBI A;  4HMI A;  3Q23 A;  2EYP A;  4HMJ A;  1LV9 A;  2PMZ B;  2C35 B;  1HNZ Q;  1EY5 A;  2WIN B;  1MKH A;  4H02 A;  3MHB A;  2E8G A;  2IJ0 A;  3I7F A;  5I9O A;  4UAI A;  1AFP A;  4JV5 Q;  3NK9 A;  1DGS A;  4TQU S;  4GN4 B;  3BDL A;  3N6R A;  3HKS A;  3TEH B;  4OWW B;  3T1Y Q;  4JW0 A;  1KRS A;  4RCN A;  5CV5 A;  4FXK C;  5CV9 A;  3C1E A;  5IP9 H;  1XMO Q;  1A2U A;  2D5D A;  2F0T A;  3RZD B;  5ELF A;  4WJ4 A;  1VQP A;  2J0T D;  1QG7 A;  1SNM A;  1STH A;  2G9H D;  5LMU L;  1J8I A;  4ZCK A;  3ZJY C;  4I65 A;  2PPB C;  2IHE A;  5KND A;  2K5N A;  3GTP B;  3LNN A;  1RJT A;  1S3O A;  5GAG C;  5FLX E;  3K5M A;  4IPD A;  4IFD J;  3ULJ A;  4JC0 A;  2WAQ B;  4RA8 A;  4JI7 Q;  4XYO A;  4P73 A;  2JA8 H;  3ITP A;  4A3D B;  3U58 A;  3VA5 A;  3HS0 C;  1EIH A;  3QIA A;  1K8G A;  4EQ5 A;  5EAY A;  1B70 B;  2F0M A;  2NN6 H;  3NEM A;  3VYS A;  1FJG L;  1SJH D;  1U5K A;  1LAB A;  5JJZ A;  2IHF A;  1TWG H;  1KTK A;  4JVZ A;  1F2Y A;  3STB C;  1HHV A;  2A19 A;  4GKK Q;  1HQM C;  1PRT C;  1TWC H;  2JA8 G;  1QUQ A;  4H0L C;  1PYW D;  1EY8 A;  1GO3 E;  1N9W A;  2NTS A;  5IYC H;  2Z6K A;  5CGK A;  2B2U C;  1HA5 A;  2EIF A;  4Y7N B;  1FGU A;  2E76 C;  4JI8 L;  1IL2 A;  3H3V H;  1BQQ T;  3SK5 A;  1A3U A;  2L1B A;  2NN6 G;  4KLK A;  5DEH A;  4WFN 3;  2NBF A;  3CMA A;  3GQB A;  5BN3 A;  4UP8 A;  2I5L X;  3FHW A;  4KD3 A;  1SNC A;  1SAP A;  2L15 A;  4KKS A;  1N33 L;  1PYS B;  1IW7 D;  4Y52 H;  3CU7 A;  4KTA A;  5J3B A;  5EBD A;  5LMU Q;  5IYC G;  2RSO A;  1PDQ A;  5I9P A;  3U50 C;  2CHB D;  3D31 A;  3M4O H;  3J80 E;  3HOW H;  5FOB B;  3S1R B;  2JK8 A;  2RCF A;  5C3X A;  3OW7 A;  5M3F G;  4MN3 A;  1UE7 A;  2E75 C;  1YNX A;  1EFW A;  3S2H H;  5ELB A;  3S14 H;  3I73 A;  1U9R A;  3HOX H;  2L55 A;  3SXH A;  2AQ1 B;  4EQO A;  2SNS A;  3Q6S A;  1PH9 A;  2WAC A;  2HDM A;  3HKZ G;  5IWA L;  1ONL A;  1CKM A;  1DON A;  1KL9 A;  3HOW G;  1CT1 D;  4CJ0 B;  1FJG Q;  3CRL C;  1W2B A;  4DR1 L;  1SEB D;  1WJJ A;  1EQR A;  2K04 A;  4JI2 L;  2A8V A;  1G6Z A;  2O5I C;  2F0J A;  4K8I A;  2SOB A;  3HOX G;  4B3T L;  4PZ7 A;  5F2D A;  1DZ1 A;  1WTO A;  4JI8 Q;  2MO0 A;  2Z4I A;  3MXN B;  5DLQ E;  4ABN A;  2A5H A;  1EIF A;  3M4Y A;  2Q2I A;  2KQ3 A;  2BH2 A;  2EYO A;  4RG1 A;  2VB2 X;  5IYD H;  1Q90 A;  2K4K A;  4L6T B;  5M5Y B;  1XMQ L;  1N33 Q;  4RWS C;  2CCZ A;  4FXD A;  3M7N A;  5C0X J;  2JA9 A;  2CVR A;  5CR3 A;  1HPC A;  3R8B A;  1Q46 A;  1RHP A;  3J81 c;  1TXY A;  1JQY D;  1LTB D;  3T56 B;  4ID6 A;  5KYL A;  1KC8 C;  3I2Z A;  1WD0 A;  3D6W A;  1D5Z C;  3RLF A;  2MP1 A;  2PZW A;  4HSV A;  4LF4 L;  2EY2 A;  4JI6 Q;  5GAH C;  3M3Y H;  4DU9 A;  3IAY A;  3C2P A;  1F77 A;  1K0S A;  2ZJP A;  1GJX A;  4JI5 L;  1A62 A;  2QW7 A;  1JT8 A;  1J5E Q;  1EQV A;  4B08 A;  1CKN A;  1SMX A;  3WWV A;  1C7Y A;  4AQY L;  1Z47 A;  3KDF B;  2RDG A;  3H6M A;  3OSO A;  1QNK A;  3A0J A;  4DR1 Q;  1HR0 W;  4L5Q A;  3GTQ H;  1SYC A;  5JVG 3;  2DJG C;  1AN8 A;  3EA6 A;  4JI2 Q;  4DK1 A;  4LFC Q;  5COY A;  2SNM A;  3ND9 A;  3PSI A;  1ZYR C;  2NTT A;  4KHV A;  3L2P A;  5M5W H;  2A69 D;  5M3M G;  1ENC A;  1A2T A;  2F0E A;  4MZ9 A;  4A3J B;  4JK1 C;  1MIU A;  2HIX A;  4LMQ D;  1VQC A;  2TSS A;  5JPM C;  2F0P A;  2KBN A;  3E9H A;  4JPB W;  3MWY W;  2MQH A;  4IFD H;  5BN5 A;  4OXP A;  2DN8 A;  3HOU B;  3K7A H;  1OXU A;  4AH6 A;  2V4D A;  3KOJ A;  1BKB A;  1OXT A;  4NKL A;  4JG2 A;  2LXK A;  3PO3 H;  1Q3L A;  2N88 A;  1GOZ A;  4R8I A;  1NMG A;  3BYY B;  4LF4 Q;  3D4R A;  5ELC A;  3SHL A;  4P74 A;  3AYH B;  4UP9 A;  5IIF A;  1KD1 C;  4IFD G;  1CKO A;  1HFG A;  4LW1 A;  2A1A A;  2C5C A;  3A74 A;  1M8A A;  4JI5 Q;  4YY3 L;  1QJO A;  4A3E H;  3VYT A;  1I4Q A;  4C2M H;  1O7Y A;  1VQB A;  1ZEQ X;  5KIX A;  3WOF A;  4DR5 Q;  1K8A C;  3PO2 B;  4AQY Q;  4TSS A;  2IL8 A;  5I2Y A;  2L5T A;  1BNZ A;  5M5X B;  1T5X D;  4OX9 L;  3A5U A;  2OTL A;  2CH4 W;  4JOI A;  2BA1 A;  1PRT B;  4IUT A;  1H9J A;  5COR A;  5C44 B;  3CCU A;  1B3A A;  3I4M B;  4A3M H;  2EXZ A;  1VF5 C;  3DLL A;  1RTO A;  4OWT B;  2VQF L;  4A3E G;  1NJI C;  2UXB L;  2VZA A;  4HED A;  3HP3 A;  3SR1 A;  5IE8 A;  2AMC B;  1PRT D;  4NXM L;  4CHT B;  5C4X B;  2HD3 A;  3TP6 A;  1Q8K A;  3CPF A;  3CW2 C;  2ASB A;  2OCE A;  4M1U B;  5C3W A;  2ZJR A;  4A3M G;  3NXW A;  5CMD A;  3KF6 A;  4BY7 B;  1O78 A;  1PVO A;  1SFO B;  4IZ8 A;  1YHB A;  1KIX A;  4RGM A;  1VMC A;  4KHZ A;  1FNW A;  4DFA A;  5J1Z A;  1LTS D;  3GTK H;  3UDX A;  4H13 C;  2VUM G;  1EYG A;  1A3T A;  3HOV H;  4J15 A;  1BXT A;  1MGS A;  2F0S A;  2IX3 A;  4YY3 Q;  1PH6 A;  3R2I A;  4JI3 L;  1STN A;  1Y1V H;  1A0I A;  1X3G A;  4OX9 Q;  3BU2 A;  2VY3 A;  4Q0F A;  4BBS H;  3RLO A;  1F2L A;  3CCR A;  2E2D C;  1TY0 A;  2DJF C;  4G4K A;  1T9H A;  3HOV G;  3CCM A;  2VQF Q;  4RAU C;  4DV5 Q;  1FGB D;  4O42 A;  3M9B A;  2UXB Q;  1Y1V G;  2RCN A;  1R9T B;  2ZTC A;  1IYV A;  1EQT A;  1B2T A;  4NXM Q;  3F2C A;  4M8A A;  4BBS G;  2EOT A;  1X3Q A;  3DEP A;  4DNR B;  4A3K B;  4NDX A;  1CA6 A;  1HFN A;  2H5X A;  4ZKB B;  4POF A;  2F0U A;  3K58 A;  5TSS A;  5D14 A;  4LF6 L;  1WTV A;  4R1J A;  2X69 A;  4O0A A;  5C6A A;  2CQA A;  5C0X G;  2EY6 A;  1D2B A;  3U9O A;  3HGB A;  2K5V A;  3CME A;  4LNQ A;  2CW0 D;  5KYI A;  1ESF A;  1E1O A;  4OL7 A;  3S15 B;  3H91 A;  1UE1 A;  3NTK A;  1GHJ A;  1X32 A;  2Q2H A;  4DK6 C;  3DEO A;  1AW7 A;  5GAD C;  3F2B A;  4LFB L;  3DWP A;  3CQZ B;  4DUY L;  1HNW L;  3G4S A;  2F4V L;  1GVP A;  1EU3 A;  4KV6 A;  4RHR A;  2ICI A;  4DR7 L;  4PZ8 A;  4A76 A;  1CKN B;  4A3B B;  4AYB B;  3GTO B;  2XRS D;  4CDC C;  1LTL A;  1CUK A;  1SYG A;  2K33 A;  3I72 A;  4FF1 A;  2HQL A;  5IGB A;  5A2Q E;  1IBM L;  1K9M C;  3SEB A;  1AZQ A;  1C9O A;  2XWJ B;  3KLS A;  4C3J H;  3S1N H;  4Z9C B;  4XDX A;  2E2I H;  1STY A;  3I4L A;  1ZYR D;  1BDO A;  4ZUJ A;  4IQZ A;  1KAA A;  3N52 A;  2K5Q A;  4LF6 Q;  2NZO A;  1BBX C;  3V2T A;  5GQO A;  1NBW A;  1TS5 A;  3JC6 6;  5C4J B;  2NVY B;  4XTC S;  4ZK9 B;  2E2H H;  1YJW A;  2L4N A;  1B50 A;  3SK6 A;  1QB5 D;  3AFQ A;  2WB1 G;  4A93 H;  4L8J A;  5D65 A;  4N9T A;  1I4X A;  5CYU A;  4C3I H;  4DNT B;  4DV0 L;  4QIW B;  2R93 H;  1W6J A;  1VQF A;  1EYD A;  3S16 H;  1UEA B;  4R9W A;  1UUP A;  4DUY Q;  1PMR A;  2EJM A;  5FO7 B;  3GTP H;  1HNW Q;  1EYA A;  3NSW A;  2DNE A;  2ES2 A;  1U4L A;  4QL5 A;  3I56 A;  2F4V Q;  1TWH B;  1K8O A;  2R7Z H;  4HAE A;  3DHQ A;  3SK4 A;  1BF4 A;  1XTD A;  3JAM c;  4KHP Q;  3FP9 A;  4DR7 Q;  2JA5 H;  1CHQ D;  1ENF A;  3ULL A;  4A93 G;  3RLN A;  2QEX A;  4YCV A;  4C3I G;  1D5M C;  1GXD C;  1MBY A;  2R93 G;  1VQD A;  4KI0 A;  4ZYS A;  1E22 A;  2L12 A;  2NVT B;  1TR5 A;  1ET9 A;  2WFW A;  1PYB A;  1K0R A;  3TP8 A;  1IBM Q;  4JBW A;  2R7Z G;  3HOY B;  2Y0S B;  1HXY D;  4F87 A;  1WFQ A;  1JWU D;  3NWT A;  2R6G A;  2HCC A;  2VB3 X;  1FL0 A;  1LTT D;  1EY7 A;  1K28 A;  1LM0 A;  3HKZ E;  2KOL A;  4ULL A;  3D6C A;  1YZ6 A;  2WP8 J;  3GV6 A;  2GN5 A;  2NUC A;  3IKJ A;  1V1P A;  4BS9 A;  3VR2 A;  2HIV A;  2EVB A;  4EQP A;  1PZJ D;  2QIL A;  5CC4 A;  1CZG A;  1QVG A;  1PH3 A;  2YU9 H;  3G7L A;  2R7D A;  3ND8 A;  1AZP A;  3ONA B;  1DYQ A;  3H94 A;  1CA5 A;  4C56 C;  4A3G B;  2WV6 D;  3KF6 B;  4DV0 Q;  1JC7 A;  1G2T A;  2XRQ D;  3M4Q A;  4A3I B;  3I4O A;  4C3H B;  2JQO A;  3BDC A;  5JJI A;  3U9S A;  2IY5 B;  3H3V C;  5AJ3 L;  3TRE A;  5IGD A;  1QOH A;  4LWC A;  3MFY A;  1MD2 D;  5E7N A;  3HOZ H;  4JI1 Q;  1TWA B;  1CFM A;  3GP7 A;  3PMF A;  2NB0 A;  3KF8 A;  1AP0 A;  3C1F A;  1I94 L;  4RH6 A;  3ULP A;  3SK8 A;  1U4P A;  4WJ3 M;  1HR0 L;  1HZ9 A;  1JB3 A;  1HUN A;  1MI2 A;  2RA4 A;  1H95 A;  1G51 A;  1XPO A;  2Z8L A;  2JEB I;  1HA6 A;  5HGT A;  3HOZ G;  2M9V A;  3EIV A;  3I4N B;  2D9U A;  4BBR H;  1RD9 D;  4OWX B;  2LMC B;  2QDB A;  1WTR A;  3EVQ A;  2JA6 H;  4I7A A;  3FPU B;  2R92 B;  2EYJ A;  5GAE C;  2KCN A;  1EWC A;  2A6H C;  1A6X A;  4KKU A;  4LF7 L;  2KCT A;  2R7F A;  1PH8 A;  1WTQ A;  3M85 A;  5JPN C;  3CD6 A;  3KLW A;  1AEX A;  4BWG B;  3OOC A;  4B3S L;  2BCO A;  1SND A;  4BBR G;  2ZM6 Q;  4IJL A;  2VXW A;  1X65 A;  1BCP F;  2JA7 B;  2JA6 G;  4U67 3;  1K8M A;  3RN5 A;  2ZT9 C;  3S17 H;  3S1Q H;  3BVZ A;  2HHH L;  1YVC A;  5ELN A;  2NVQ H;  4HID A;  1EYC A;  1PTO H;  3K6O A;  3H09 A;  1I3Q H;  1S5D D;  1EEF D;  1SLJ A;  1O7I A;  2IW3 A;  5DAU A;  1MSG A;  2JXM B;  4K6D A;  1CI3 M;  4ME3 A;  4DUZ L;  4A3C G;  2B2T A;  4HIK A;  2A73 B;  1KHI A;  3I70 A;  1ASY A;  1ZXT A;  3NEL A;  3E0J A;  4KKT A;  1I94 Q;  1Y1W B;  1S5F D;  2B2T C;  2F0D A;  2AWO A;  1GUO A;  2EY5 A;  1HR0 Q;  4DV7 L;  4TRD A;  2B2V A;  2G9D A;  2MGS A;  4AIM A;  3S2D B;  2Q8R E;  2J7Z A;  3E3X A;  3GTM H;  1IYJ B;  2Z6K C;  3IL8 A;  1OTC A;  2EJF C;  1JOQ A;  4FXG C;  2B2V C;  3F2D A;  2DUD A;  4HTH A;  4YCW A;  4JI0 L;  5IT9 c;  5M3F H;  4LUZ A;  5IGF A;  4YHH L;  2VQE L;  4PV1 C;  1QNU A;  2KCM A;  1VQ5 A;  3CAM A;  3S1M H;  1E7Z A;  2VL6 A;  4JCV E;  1CQV A;  1EY0 A;  3J7A V;  4QF4 A;  4FF3 A;  1WTH A;  1X6O A;  1DOK A;  2E74 C;  3KBG A;  4B3S Q;  4K2K A;  3BDO A;  3I3C A;  1I4R A;  3FVQ A;  4YWM A;  2K14 A;  2MO1 A;  3MXU A;  3OPO A;  3HEJ A;  4GLA C;  2HHH Q;  2F0H A;  1YIT A;  5EGT A;  1NNX A;  5IGE A;  1E2V A;  4L5S A;  4R4Q A;  4XYQ A;  4RGT A;  4V0B A; 
#chains in the Genus database with same CATH homology
 4CJ2 C;  2A74 C;  4CKC A;  2JYO A;  3OMC A;  1D1K A;  1DOL A;  2Z4H A;  3FMC A;  5I4D A;  3S9W A;  2K32 A;  1I4P A;  2F0V A;  1QE6 A;  1G29 1;  3X3M A;  2JA8 B;  1VF7 A;  4EVO A;  3A8J E;  4FP5 D;  2CW0 C;  1I50 B;  4CJ1 B;  2JP1 A;  2AQ3 B;  1BO0 A;  3OMG A;  3E6Z X;  1S5E D;  3D4D A;  3PUV A;  1TWG B;  2B8F A;  1K83 B;  3DMU A;  1ET6 A;  2JEA I;  2HDL A;  1TWC B;  3O13 A;  4QUF A;  1PZK D;  4KY7 A;  1PXU A;  3FDT A;  3BZD B;  4HCS A;  2K01 A;  5EPL A;  5FK9 C;  1PTO F;  2EYF A;  1WD1 A;  1V1O A;  1VDZ A;  2LFN A;  1SXT A;  1H9S A;  5J22 A;  1KLG D;  1E2W A;  1F9S A;  2PNR C;  3A56 A;  3HKZ B;  2R3Z A;  3M4O B;  4OIK A;  3HOW B;  3I8Z A;  2EPB A;  1MSH A;  2AUJ D;  3DM1 A;  3NHH A;  1JCK B;  4X3T A;  2RDF A;  1GUW A;  2HCI A;  3S14 B;  4PMB A;  3VYR A;  3QOL A;  3HOX B;  2O2L D;  2JSO A;  4QUC A;  1PFM A;  1EY6 A;  4E6I A;  3IFD A;  4RHS A;  3TDQ A;  3WOE A;  1ENA A;  1B44 D;  2A6H D;  5JEA J;  3X3N A;  2Q8I B;  1STE A;  1XX8 A;  4S3S A;  1STB A;  1QCB D;  1LTA D;  5EKL A;  4RKB A;  2MJ8 A;  3GO5 A;  4CBV A;  1L0X B;  2R61 A;  1O80 A;  3T13 A;  2NN6 I;  1B9N A;  2F1M A;  3D4W A;  5E1F A;  3QG1 A;  4DF7 A;  1O7L A;  3J81 L;  2I07 B;  3QB3 A;  2KED A;  3NQT A;  3TSS A;  3VR6 A;  1CQF A;  1DJR D;  4C1N I;  4IUU A;  3M3Y B;  1U4R A;  3NE5 B;  1B4O A;  1RCV D;  2KUM A;  2NZ1 D;  5LHY 1;  5E4X A;  2ZXP A;  1XXG A;  3V05 A;  3SDZ A;  1ZKO A;  1CM9 A;  1UAP A;  4KJO A;  4IUN A;  4UDU C;  5LL6 X;  3CRK C;  1QWY A;  3QWN A;  2F0K A;  2KHS A;  3GTQ B;  1WCM B;  4G7O C;  3L7Z C;  1HCZ A;  2EDG A;  3OHX C;  4FO2 A;  1M4V A;  1SSO A;  5M5W B;  4F7X A;  5DM7 3;  5A35 A;  4KK7 A;  1F9P A;  1SMY C;  2IPK D;  4DA2 A;  2F4I A;  4CGY B;  3UI2 A;  5G3L F;  2WII B;  2B2Y A;  4KN4 C;  4ILW A;  1HRJ A;  2KJX A;  4X3K A;  1NSN S;  4RFB A;  5IOD A;  4OO1 H;  1DXM A;  5I6Y A;  5BN4 A;  2B2Y C;  3DXJ C;  4DAV A;  3K7A B;  4K6L A;  4MHE A;  4CKB A;  3TZD A;  4ODG A;  1V8Q A;  3LWE A;  5C0X H;  3PIO 3;  3PO3 B;  4XIG S;  3R3O A;  1EWH A;  2AQ2 B;  3R93 A;  1BCP C;  3W3A A;  1JOR A;  5CV8 A;  5EKI A;  1ML0 D;  4CKE A;  3BVG A;  4OO1 G;  1EFI D;  3TN2 A;  3PIP 3;  5E4W C;  4A3E B;  4PMC A;  4C2M B;  5KEE A;  1Q1B A;  1WTX A;  2EYL A;  2OEO A;  4K14 A;  1KLU D;  1LT4 D;  3DWA A;  3C46 A;  1I6H B;  4A3M B;  1SE2 A;  2X6L A;  3L3O C;  1DM0 B;  4EGV A;  4N9P A;  5EJW A;  4XQN A;  1ILP A;  2QEJ C;  2F0L A;  3DWQ A;  3ERQ A;  2PW7 A;  1H9S B;  3MFG A;  5D3D A;  2RVL A;  4OIJ A;  3OIP A;  1KNA A;  2FMM A;  1I6V C;  1ROD A;  4DXG A;  2RDH A;  1TII D;  3MEH A;  2D2C C;  1SBB B;  3QJY A;  3AU7 A;  3GTK B;  4ZUI A;  2PW5 A;  3KBX A;  3HOV B;  1ILQ A;  2FHT A;  4KD4 A;  1HQR D;  1Y1V B;  2O5J C;  1SJE D;  4KMU C;  1U4M A;  1B9M A;  1EY9 A;  1JWM D;  2I46 A;  4WOR A;  3D8G A;  3T51 B;  3MC0 B;  1Y8N B;  3GTL B;  5DNF A;  2F0I A;  1SYD A;  5CBE E;  5LL6 S;  3M7G A;  4ZQ3 A;  4KY5 A;  2EYH A;  4KY6 A;  4QB4 A;  5HUR A;  1D5X C;  3MTS A;  3P7J A;  4C3H G;  1F2Z A;  1GHK A;  1G2S A;  1LO5 D;  4RKL A;  3J7A F;  3LX0 A;  2OF1 A;  2BE5 D;  2EY1 A;  2PYK A;  4LAA A;  2K6A A;  4H44 C;  4HCE A;  3MA2 B;  3FEW X;  3SVM A;  1EIG A;  3AB9 A;  3URY A;  1CHP D;  3TP7 A;  1Q12 A;  3TZU A;  4X3S A;  1IL8 A;  3LWU A;  2IX0 A;  3K5L A;  4J1M A;  3BG3 A;  1D1I A;  1CTM A;  1S5C D;  1F9R A;  1PTO C;  2F3V A;  4G57 A;  4DK0 A;  3J81 E;  1LTG D;  4B9X A;  1Z6H A;  1B53 A;  4IUQ A;  1FNV A;  3KLR A;  4U68 A;  4NMZ A;  1ICW A;  2PZU A;  4GZY C;  2F3W A;  4R8N A;  1DD2 A;  1YNJ C;  3HG9 A;  5I6W A;  2LS0 1;  1L0Y B;  3TBI B;  4C3J B;  5NUC A;  3D3R A;  3S1N B;  2E2I B;  1DCZ A;  3G6J B;  2HUG A;  2VNU D;  4XQQ A;  4PMW A;  3PUW A;  1SMY D;  2AUK A;  2ID0 A;  2ICE C;  2PZT A;  3ERO A;  2EZV A;  2E2H B;  3NWS A;  1BCP B;  2Z1C A;  1T5E A;  4A93 B;  4IN3 A;  4C3I B;  3T4A C;  3E5S A;  1R4P B;  2TMP A;  2R93 B;  5ELD A;  3S16 B;  3PV0 A;  3V96 A;  3BYT B;  4J8Q A;  3JAM L;  2ZXO A;  1II3 A;  3L9A X;  1BCP D;  2MPM A;  2R7Z B;  1F2M A;  1IKM A;  5KNC A;  1H9K A;  4DGZ A;  5M9O A;  3K59 A;  2JA5 B;  2B2W A;  4FNF A;  2EYM A;  4ZKC B;  2K1B A;  2GA4 B;  1XTC D;  5C5M A;  2BDN A;  4ZLT F;  2B2W C;  4K8J A;  1LT5 D;  4ZAI A;  1WTP A;  4PNY A;  2ZXR A;  4P2C B;  2SDF A;  3Q22 A;  1Y69 U;  1Z7T A;  5J39 A;  3PUX A;  1GUS A;  3SE0 A;  3NTH A;  2PQE A;  5EPK A;  1EZ8 A;  1G8Z D;  4IUP A;  4I7Z C;  3F2U A;  3A7A B;  4H7B A;  1H9R A;  3NBH A;  1IYU A;  3A55 A;  2YU9 B;  2MHV A;  2OT2 A;  3MXG A;  4LK1 C;  3VR5 A;  2C9O A;  1YNN C;  4Q5V A;  2B2U A;  3MXP A;  5CV4 A;  1KAB A;  1LT6 D;  3OIQ A;  1SE3 A;  3HOZ B;  3VR4 A;  3KK7 A;  1BUV T;  1VCI A;  1PFN A;  2XN9 C;  1QIL A;  1KDA A;  1EY4 A;  2SEB D;  2KA7 A;  2L11 A;  1V43 A;  4LJZ C;  3Q24 A;  1GUN A;  2EE1 A;  1PLF A;  1LAC A;  3GV3 A;  1H9M A;  2K03 A;  4BBR B;  1OXS C;  3A54 A;  2IT1 A;  3I91 A;  3W2D A;  4BA2 I;  3AMU A;  2JA6 B;  1TVX A;  2BDO A;  3VYU A;  1A15 A;  4XQJ A;  5CBA E;  2B39 A;  4PQX A;  1JOO A;  4V19 0;  1C48 A;  2F0Q A;  4HR7 B;  5EKK A;  1XYI A;  5T1I A;  1SYB A;  2NYZ D;  1NUC A;  3P20 A;  5ELE A;  2QCP X;  1EEI D;  3P75 A;  3HZX A;  2WKD A;  3S17 B;  3S1Q B;  2KEE A;  2NVQ B;  1KNE A;  1PTO B;  1I3Q B;  5CV6 A;  2WKC A;  2RBM A;  1TQO A;  1V1P B;  2X6G A;  3IFT A;  3NPP A;  1SDF A;  1DOM A;  1PTO D;  3BS1 A;  4OGQ C;  1SYF A;  1STG A;  5E3F A;  3MAQ A;  3HRZ C;  4J6H A;  3GTM B;  2PCF B;  5IT9 L;  1GUT A;  2RSN A;  1R4Q B;  1PFB A;  1E0B A;  5K5P A;  1LT3 D;  5M3F B;  1RF2 D;  1YNJ D;  5ISR A;  1NR4 A;  5A2Q L;  2XSC A;  3S1M B;  4QMG A;  3TME A;  2A68 C;  1SNQ A;  1D6E C;  1IKL A;  2IWH A;  2XVS A;  4DAY A;  1KDB A;  2NWG A;  1EU4 A;  1LTI D;  3S2H B;  2H1E A;  1WVL A;  2RKS A;  3EFX D;  5C4H A;  2XIW A;  2FIN B;  5AFW A;  5EQ0 A;  5C3E B;  1EZ6 A;  2K5D A;  5KGU A;  4NP5 A;  3VR3 A;  4RCO A;  4K5V A;  1RTN A;  1I4G A;  3MZ5 A;  1WTW A;  4BY1 B;  3RUZ A;  2L9H A;  1TU2 B;  5IGG A;  3EQL C;  1OXX K;  4O1N A;  2BE5 C;  1C8C A;  1J9O A;  3TP5 A;  4TKO B;  3JAM E;  3I90 A;  2F03 A;  5K36 H;  1S5B D;  3K5O A;  2F0O A;  2KVM A;  2NVX B;  4XXE A;  1HTL D;  3Q0A A;  4A3F B;  2A6E C;  1I4H A;  3FRP B;  3DUZ A;  1KDC A;  4BA1 I;  2M2L A;  5K36 G;  3RMH A;  5KNB A;  5CV7 A;  1JOK A;  4C1N K;  5M3M B;  1LLR D;  2DY8 A;  1YNN D;  3PUZ A;  1PZI D;  4F8M A;  2K5W A;  4K5W A;  2AWN A;  2IX1 A;  5G3L D;  1SNP A;  3OWF A;  4WJW A;  1PRT F;  3K0Y A;  3ZYY X;  4KJN A;  3P1H A;  1E2Z A;  5JOB A;  1OO9 B;  2MUY A;  3KUP A;  4DAP A;  4MIU A;  5C5L A;  3PUY A;  1NCV A;  1XWE A;  2Q8T A;  1EOT A;  1EL0 A;  2M00 A;  1RDP D;  2DNC A;  3NTI A;  4OHJ A;  3CKI B;  2QF7 A;  4IUR A;  2KEC A;  1JIC A;  1W6K A;  1HTP A;  4RGO S;  3QOJ A;  3FPP A;  3OWE B;  1A3V A;  4K2L A;  3EJI A;  3T16 A;  5FLX L;  2ENB A;  2EJG C;  1Y8P B;  3RD4 A;  4FYD A;  3R2T A;  1GUG A;  1TY2 A;  4ZRZ A;  1TS3 A;  2JE6 I;  1LTR D;  1Q1E A;  2K05 A;  1TWF B;  2QKI C;  1NAP A;  2F0F A;  2B8G A;  1JR0 D;  2XNA C;  1TKW B;  1CK1 A;  2FFK B;  4EQN A;  2H4O A;  4F88 A;  1TT2 A;  3A8I E;  3WDN A;  2VUM B;  1HUM A;  2RQX A;  4G7H C;  4NW2 A;  1FNU A;  4G7Z C;  2XWB B;  2PO4 A;  2N55 A;  2DY7 A;  1FD7 D;  2YYZ A;  1VMP A;  4FF4 A;  4FF2 A;  5IT9 E;  2A68 D;  5KRU A;  1BR9 A;  4X3U A;  4XT3 B;  3J80 L;  2HQE A;  2E2J B;  2F0N A;  5JEA H;  5EPJ A;  4IFD I;  1Q8I A;  3MVV A;  4ME5 A;  1IW7 C;  2F0W A;  3QO2 A;  3CHB D;  4WRD A;  1TS4 A;  1O7Z A;  4BBS B;  1ESR A;  1UNS A;  2LY7 A;  1RKN A;  4HN7 A;  5JEA G;  4YIJ A;  2K28 A;  3NP8 A;  5JVH 3;  3K57 A;  2BA0 A;  1X3P A;  4C3J G;  1SNO A;  2F0G A;  1SE4 A;  3BVM A;  4B9W A;  3J7Y W;  1STA A;  4K5X A;  5FO9 B;  5JAV A;  2L0C A;  2B63 B;  2FJ2 A;  3FKI B;  5IGC A;  5DM6 3;  2K7V A;  2BOS A;  1IHZ A;  2J4X A;  3RZO B;  3GTG B;  5I2X A;  4FVM A;  3MXN A;  1C4Q A;  2A6E D;  2KCC A;  2LKV A;  1CZW A;  1FYC A;  4DN4 M;  1SYE A;  5FO8 B;  3GTJ B;  1JE4 A;  1F9Q A;  2OXP A;  4DXF A;  1NR2 A;  4IAL A;  2FMC A;  5IOC A;  3NUC A;  3KLS X;  2D62 A;  5D3I B;  5FKA C;  1TS2 A;  3VA7 A;  1FR3 A;  3GD7 A;  2WB1 B;  1G91 A;  3A7L A;  3K5N A;  4QCL A;  5EBC A;  4XT1 B;  4RGN A;  4L63 B;  1B1Z A;  3A8K E;  1Y8O B;  5C4Z A;  4OO1 I;  5T1G A;  3T53 B;  3C3L A;  4HSP A;  4KN7 C;  2O4X A;  1BOS A;  1JWS D;  1OXV A;  4IUV A;  2A69 C;  3H0G B;  1S4Z A;  5C0X I;  3NQI A;  3NBI A;  4HMI A;  3Q23 A;  2EYP A;  4HMJ A;  1LV9 A;  2PMZ B;  1EY5 A;  2WIN B;  3MHB A;  2IJ0 A;  5I9O A;  4UAI A;  1AFP A;  3NK9 A;  4TQU S;  3BDL A;  3N6R A;  4RCN A;  5CV5 A;  4FXK C;  5CV9 A;  3C1E A;  1A2U A;  2D5D A;  2F0T A;  3RZD B;  5ELF A;  2J0T D;  1QG7 A;  1SNM A;  1STH A;  2G9H D;  1J8I A;  4I65 A;  2PPB C;  5KND A;  3GTP B;  3LNN A;  1RJT A;  5FLX E;  3K5M A;  4IFD J;  2WAQ B;  4RA8 A;  4XYO A;  3ITP A;  4A3D B;  3VA5 A;  3HS0 C;  1EIH A;  3QIA A;  2F0M A;  2NN6 H;  3VYS A;  1SJH D;  1LAB A;  5JJZ A;  1KTK A;  1F2Y A;  1HHV A;  1HQM C;  1PRT C;  4H0L C;  1PYW D;  1EY8 A;  2NTS A;  5CGK A;  2B2U C;  1HA5 A;  4Y7N B;  2E76 C;  1BQQ T;  3SK5 A;  1A3U A;  2L1B A;  2NN6 G;  5DEH A;  4WFN 3;  2NBF A;  3GQB A;  5BN3 A;  4KD3 A;  1SNC A;  1SAP A;  4KKS A;  1IW7 D;  3CU7 A;  4KTA A;  5EBD A;  2RSO A;  1PDQ A;  5I9P A;  2CHB D;  3D31 A;  3J80 E;  5FOB B;  3S1R B;  5C3X A;  3OW7 A;  4MN3 A;  2E75 C;  5ELB A;  3I73 A;  1U9R A;  2L55 A;  3SXH A;  2AQ1 B;  4EQO A;  2SNS A;  3Q6S A;  2WAC A;  2HDM A;  1ONL A;  1DON A;  1CT1 D;  4CJ0 B;  3CRL C;  1SEB D;  2K04 A;  1G6Z A;  2O5I C;  2F0J A;  4K8I A;  2SOB A;  5F2D A;  1DZ1 A;  1WTO A;  2Z4I A;  4ABN A;  2A5H A;  3M4Y A;  2KQ3 A;  2EYO A;  2VB2 X;  1Q90 A;  4L6T B;  5M5Y B;  4RWS C;  4FXD A;  3M7N A;  5C0X J;  2CVR A;  5CR3 A;  1HPC A;  3R8B A;  1RHP A;  1JQY D;  1LTB D;  3T56 B;  4ID6 A;  5KYL A;  1WD0 A;  3D6W A;  1D5Z C;  3RLF A;  2MP1 A;  2PZW A;  4HSV A;  2EY2 A;  4DU9 A;  3IAY A;  3C2P A;  1F77 A;  1GJX A;  1EQV A;  4B08 A;  1Z47 A;  2RDG A;  3H6M A;  3OSO A;  1QNK A;  1SYC A;  5JVG 3;  1AN8 A;  3EA6 A;  4DK1 A;  5COY A;  2SNM A;  3ND9 A;  1ZYR C;  2NTT A;  4KHV A;  2A69 D;  1ENC A;  1A2T A;  2F0E A;  4A3J B;  4JK1 C;  4LMQ D;  2TSS A;  5JPM C;  2F0P A;  4IFD H;  3MWY W;  5BN5 A;  2DN8 A;  3HOU B;  1OXU A;  2V4D A;  1OXT A;  4NKL A;  1Q3L A;  2N88 A;  1GOZ A;  4R8I A;  3BYY B;  3D4R A;  5ELC A;  3SHL A;  5IIF A;  4IFD G;  1HFG A;  2C5C A;  1M8A A;  1QJO A;  3VYT A;  1I4Q A;  1O7Y A;  5KIX A;  1ZEQ X;  3PO2 B;  3WOF A;  4TSS A;  2IL8 A;  5I2Y A;  2L5T A;  1BNZ A;  5M5X B;  1T5X D;  2BA1 A;  1PRT B;  4IUT A;  1H9J A;  5COR A;  5C44 B;  1B3A A;  3I4M B;  2EXZ A;  1VF5 C;  1RTO A;  4HED A;  3HP3 A;  3SR1 A;  1PRT D;  4CHT B;  5C4X B;  3TP6 A;  4M1U B;  5C3W A;  3NXW A;  5CMD A;  4BY7 B;  1O78 A;  1SFO B;  4IZ8 A;  4RGM A;  1VMC A;  4KHZ A;  1FNW A;  4DFA A;  5J1Z A;  1LTS D;  4H13 C;  1A3T A;  1BXT A;  1MGS A;  2F0S A;  2IX3 A;  3R2I A;  1STN A;  4Q0F A;  1F2L A;  2E2D C;  1TY0 A;  4G4K A;  4RAU C;  1FGB D;  4O42 A;  1R9T B;  1IYV A;  1EQT A;  1B2T A;  4M8A A;  2EOT A;  1X3Q A;  3DEP A;  4DNR B;  4A3K B;  4NDX A;  1CA6 A;  1HFN A;  4ZKB B;  2F0U A;  3K58 A;  5TSS A;  5D14 A;  1WTV A;  2X69 A;  5C6A A;  5C0X G;  2CQA A;  1D2B A;  2EY6 A;  3U9O A;  3HGB A;  2CW0 D;  5KYI A;  1ESF A;  4OL7 A;  3S15 B;  3H91 A;  3NTK A;  1GHJ A;  1X32 A;  3DEO A;  1AW7 A;  3DWP A;  3CQZ B;  1EU3 A;  4KV6 A;  4RHR A;  2ICI A;  4A3B B;  4AYB B;  3GTO B;  2XRS D;  1SYG A;  2K33 A;  3I72 A;  4FF1 A;  5IGB A;  5A2Q E;  3SEB A;  1AZQ A;  2XWJ B;  3KLS A;  4Z9C B;  4XDX A;  1STY A;  3I4L A;  1ZYR D;  1BDO A;  4ZUJ A;  4IQZ A;  1KAA A;  3N52 A;  2K5Q A;  1BBX C;  3V2T A;  1TS5 A;  5C4J B;  2NVY B;  4XTC S;  4ZK9 B;  2L4N A;  1B50 A;  3SK6 A;  1QB5 D;  4L8J A;  5D65 A;  4N9T A;  1I4X A;  5CYU A;  4DNT B;  4QIW B;  1W6J A;  1EYD A;  1UEA B;  4R9W A;  1UUP A;  1PMR A;  2EJM A;  5FO7 B;  1EYA A;  3NSW A;  2DNE A;  1U4L A;  1TWH B;  1K8O A;  4HAE A;  3DHQ A;  3SK4 A;  1BF4 A;  1CHQ D;  1ENF A;  4C3I G;  1D5M C;  1GXD C;  1MBY A;  4KI0 A;  4ZYS A;  2L12 A;  2NVT B;  1TR5 A;  1ET9 A;  3TP8 A;  4JBW A;  3HOY B;  2Y0S B;  1HXY D;  4F87 A;  1JWU D;  3NWT A;  2R6G A;  2HCC A;  2VB3 X;  1LTT D;  4ULL A;  1EY7 A;  2KOL A;  3D6C A;  2WP8 J;  3GV6 A;  2NUC A;  3IKJ A;  1V1P A;  4BS9 A;  3VR2 A;  2EVB A;  4EQP A;  1PZJ D;  2QIL A;  5CC4 A;  1CZG A;  3G7L A;  3ND8 A;  1AZP A;  3ONA B;  1DYQ A;  3H94 A;  1CA5 A;  4C56 C;  4A3G B;  2WV6 D;  1JC7 A;  1G2T A;  2XRQ D;  4A3I B;  4C3H B;  3BDC A;  3U9S A;  3H3V C;  5IGD A;  1QOH A;  3MFY A;  1MD2 D;  1TWA B;  1CFM A;  3GP7 A;  3PMF A;  2NB0 A;  3KF8 A;  1AP0 A;  3C1F A;  4RH6 A;  3SK8 A;  1U4P A;  1JB3 A;  1HUN A;  1MI2 A;  2RA4 A;  2Z8L A;  2JEB I;  1HA6 A;  5HGT A;  2M9V A;  3I4N B;  2D9U A;  1RD9 D;  2LMC B;  2QDB A;  1WTR A;  3EVQ A;  3FPU B;  2R92 B;  2EYJ A;  2KCN A;  1EWC A;  2A6H C;  1A6X A;  4KKU A;  1WTQ A;  3M85 A;  5JPN C;  1AEX A;  4BWG B;  3OOC A;  2BCO A;  1SND A;  2VXW A;  1BCP F;  2JA7 B;  4U67 3;  1K8M A;  2ZT9 C;  3BVZ A;  1EYC A;  1PTO H;  3K6O A;  3H09 A;  5DAU A;  1S5D D;  1EEF D;  2IW3 A;  1MSG A;  2JXM B;  4K6D A;  1CI3 M;  2B2T A;  2A73 B;  3I70 A;  1ZXT A;  3E0J A;  4KKT A;  1Y1W B;  1S5F D;  2B2T C;  2F0D A;  2AWO A;  1GUO A;  2EY5 A;  4TRD A;  2B2V A;  2G9D A;  2MGS A;  3S2D B;  2Q8R E;  2J7Z A;  3IL8 A;  2EJF C;  1JOQ A;  4FXG C;  2B2V C;  4HTH A;  5IGF A;  4PV1 C;  1QNU A;  1CQV A;  1EY0 A;  3J7A V;  4QF4 A;  4FF3 A;  1DOK A;  2E74 C;  3KBG A;  4K2K A;  3BDO A;  3I3C A;  1I4R A;  3FVQ A;  3MXU A;  3OPO A;  3HEJ A;  2F0H A;  5EGT A;  5IGE A;  1E2V A;  4XYQ A;  4RGT A;  4V0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...