2NVYH

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvyH00
3S16H 2K75A 2ID0A 3A5ZB 4GS3A 5M5XH 2UUBL 2MFIA 1PH2A 1N32Q 1BBWA 2AHOB 2KENA 4X62L 3PO3H 3CCRA 3F2DA 4DUYQ 4DR5Q 1Y1WH 2B63G 4HIDA 1EQQA 2N3SA 2HIXA 4NB3A 4DNIA 2MO1A 1Q7YC 3CPFA 4DV7Q 2QEXA 4YCUA 1VQMA 4UY8C 1CKNA 1YI2A 1XMOQ 3MEFA 1V43A 3F8TA 1TWFH 1TWCH 3Q8DA 1IBLL 4B3TQ 1XPRA 1GVPA 3PUVA 1NMGA 3J81c 4LF7L 4DR1L 3J81j 4C3HH 3EN2A 2DUDA 3PO2G 2GVBA 2B29A 3RLNA 4YY3Q 1FJGQ 1YBYA 1VQ6A 5J3BA 2IY5B 3CAMA 3I4OA 4QL5A 4JOIC 3BZKA 1NY4A 4DPGA 4KHPQ 3CF5A 1YITA 1J6QA 4BXXH 4A3EG 1W2BA 4WJ3M 4GOPA 1KAWA 3VDYA 2A1AA 2BH2A 4JBMA 4GN5A 2IX1A 4A3LG 1D8LA 4DV0Q 1HJPA 2R7ZG 2UXBL 1SRUA 1PH9A 5IT9c 2F4VL 1WOCA 4X66L 4PMWA 3D31A 4RG1A 1HNXQ 1NE3A 4DV5L 4A3IG 4DAMA 4DV6L 2ES2A 5LMNQ 4JI6L 4BBRH 1QUQA 3IRBA 5C44H 1X3GA 1HZBA 3M85A 4NXNQ 3PF5A 1XNQQ 2UXCQ 3EIVA 4JCVE 4A3EH 3A0JA 2ZJRA 1VQHA 1HNZL 4B3ML 4PG3A 3K0XA 4GKJL 3CW2C 3I7FA 1QZGA 3LGJA 4BY7G 1YNXA 1N34Q 1VQGA 1N8RC 1VQ9A 1E1OA 4A75A 1A63A 1GD7A 3ZJYC 2VQFQ 4LF6Q 4JI4Q 1R9TH 2UUCQ 1L1OA 4LUOA 4OWXB 3KYHC 5C0XI 2F3IA 2B3GA 1XJVA 1CKOA 4JI1Q 3U4VA 1YJ9A 4WJ4A 4TQUS 4A3FG 2K50A 3I4NG 4HJ8A 1JT8A 2RHSB 1JE5A 4R4OA 2NZHA 4A3KH 4IOAA 2Z0SA 4A93H 2C35B 2CFMA 1AE2A 1YHQA 3HOUG 1FGUA 5JJIA 1PH5A 1EFWA 3CXCA 4POGA 3FP9A 3M9BA 3U50C 5LMUL 4A3FH 2WP8J 2JJQA 5FJ8H 2CKZB 1M1KC 2VQEQ 4BA1I 4J15A 4X64L 3HOYG 2F52A 2R93G 1I50H 3S2DH 5GROA 1X65A 2ZM6Q 3PUYA 4LFCL 5C0XJ 5M5WH 3PIPA 1UE5A 4DV4L 1YJNA 3HOUH 4IJLA 1J5EL 1YZ6A 2OCEA 2MNAA 4AQYL 1CSPA 1KC8C 2FXQA 2NVXH 1U0LA 4GN4B 4JI3Q 4BBSH 3CCSA 4DR4L 1S72A 2ZTCA 2GVAA 1XPOA 2R92H 5C0XG 4OONA 3PIOA 1WFQA 5HY6A 2RHQB 1MJCA 3E9HA 2AWOA 1AE3A 1BBUA 4IJHA 2Y0SG 3J7ZC 3TQYA 4LW1A 4NXMQ 4JI5Q 3ICEA 4X65Q 4B3RL 1VQDA 1OXSC 3STBD 1CSQA 2VZAA 2UU9L 3CC7A 1B7YB 2A19A 3GO5A 2UUAQ 5HGQA 1PA6A 3U58A 3RZDH 4LUVA 3HOVH 3HOZH 2EIFA 2UXDL 4JYAQ 1IBMQ 4XTCS 3F2CA 4DK3C 3NELA 1Q82C 4P74A 1P8LA 1SMXA 5GADC 3NBHB 4H02A 3M4OH 1VCIA 3FKIH 5M3FG 2JA6G 1PFSA 1CUKA 3I2ZA 3KF6A 1HR0L 1VQJA 4HIKA 4LFBL 1EWIA 2QGQA 4AIMA 1CKMA 3RLOA 3PO3G 1VQ7A 1WCMH 4DR6Q 3L7ZC 3S17H 1Y1WG 1PH6A 4DV1L 1VQFA 3NEMA 1G291 4QIWE 1I94L 2HHHL 4K0KQ 2D62A 1VQ8A 1TXYA 1X3FA 2PQAA 2JEBI 4QGUA 1K8AC 2LXJA 2YV5A 4DV3Q 2I5HA 1XNRQ 4P75A 5E7NA 4EX5A 3KF8B 1N33Q 3CCQA 1CKNB 4UP9A 3GTLH 4GKKL 2XGTA 3KLWA 4P72A 1JB7A 3I4MH 1YHBA 2OQKA 4DR7Q 1T9HA 1O7IA 4X62Q 3CP0A 2E2HH 2ZTDA 1ASYA 1VQCA 3RR5A 4BXXG 1A8VA 2K5HA 3L0OA 4AH6A 1SFOH 3HOWG 3FHWA 2OQ0A 1HNWL 4MZ9A 3GDEA 1Y1VH 4GOPB 1VQ4A 1LTLA 4DR3Q 1QVCA 5ELOA 3UE0A 4A3JH 1OXTA 1UE7A 4GLVB 1I6HH 1N32L 3GTKH 4BBRG 5JEAJ 3K81C 1V1QA 2AMCB 3EBEA 5C44G 4L5SA 4DR5L 1KHIA 1QUQB 3OTOQ 4B3SL 4GNXB 3HOWH 5IYCH 3HOXH 4JI7L 3A5UA 4OWTB 2EQSA 1EYGA 3TS0A 4JBJA 5JEAG 1XMOL 1OTCA 3S24A 3CMAA 4B3TL 1UE1A 1RIPA 2CQOA 3E9IA 4FDBA 2R7FA 4UP7A 1PHJA 4X66Q 2VUMH 4DUZL 1MJEA 3S1NH 3RN5A 3HKZG 1L1OB 1BVSA 4Y52H 4OXPA 5GAHC 4YY3L 3DM3A 4GNXA 1FJGL 4A4IA 1UWVA 4JBWA 2I0QA 1Y14B 4DR2L 3RNUA 5IWAL 3CQZH 1HZCA 2YTXA 4AYBE 2NVQH 4JOIA 1C7YA 4GKJQ 1XPUA 2RCNA 4A3KG 4A93G 1EOVA 3M4PA 2YTYA 1UEBA 1FL0A 2OTLA 5AJ3Q 2ZJPA 2Y0SE 3H3VH 2R7DA 5EAYA 1FVIA 1KRTA 1IL2A 5FJ8G 2KCTA 2XTIA 4KHZA 4NXNL 1HR0W 4IPGA 1XNQL 3GTOH 4R4TA 3M3YH 1G6PA 1K0RA 2ATWA 4O2DA 2NVYH 3M7NA 1I3QH 3GTQH 4P73A 1N34L 4A3GH 3KJOA 1S40A 2VQFL 1C9OA 4JBKA 4JI4L 1V9PA 2Z6KC 2I5MX 2LXKA 2QA4A 2UUCL 4BBSG 3OYYA 4Y7NH 3UDXA 2K52A 4LF5Q 3AEVA 1HH2P 1X54A 4JI1L 5LMUQ 1JJGA 2R92G 1KIXA 3D0FA 2JA5H 1K73C 4OX9Q 1U5KA 3H15A 2K4KA 4JI0L 2JK8A 2Q2IA 1NMFA 5C3EH 1LYLA 4DV2L 4DV4Q 4X6AH 4A3DH 2E5LL 4AYBG 1J5EQ 1PYSB 4KI0A 4R1JA 2CCZA 3BJUA 1SR3A 1D7QA 1Q1BA 2YYZA 2CWAA 1VQAA 1QVGA 3HOVG 3HOZG 5C4JH 4GLAC 4LF4Q 4DR4Q 4LUZA 1VS0A 3F1ZA 2DGYA 3PUXA 1NTGA 1TWHH 4TVAB 2V1CC 2VQEL 1L0WA 1IBKQ 4IPDA 1L2FA 5BR8L 4LF8Q 3TREA 2ZM6L 2PI2E 3FKIG 2E8GA 1VQLA 1JJCB 1OXVA 1XMQQ 1KRSA 1KD1C 4B3RQ 4JV5L 3T1HQ 2UU9Q 1K9MC 4HJ7A 4LFAL 1DGSA 3KF6B 4R4CA 1Q8KA 3RLFA 3G48A 4POFA 5IE8A 5M3MH 3S1RH 2WB1G 2KHJA 4GN3B 4JI3L 1WCMG 3B6YA 4YWKA 1E3PA 3GD7A 1N36Q 2OWOA 1X3EA 1SLJA 4L5TA 3GTPH 4YHHL 3S1QH 3OW2A 3PUWA 2E2JH 3KDFA 2HT1A 2GN5A 3KJPA 2PQAB 4NXML 4GLXA 2JA7H 1S3OA 4JI5L 4X65L 3CCEA 2K5VA 2JE6I 1VQPA 3I4MG 4LFBQ 4A76A 2Q2UA 2UUAL 3W5OA 2VW9A 4LF9L 1SN8A 4IPHA 3ULPA 4JI8L 1E22A 3AQQA 1X56A 4DV1Q 4JYAL 1EUJA 5H1SE 3K8AA 1I94Q 1E24A 4JG2A 3CCUA 4IPCA 4UP8A 4L5QA 3HKZE 3M4QA 5IYDG 3T1YQ 1QVFA 1VQNA 1Y1VG 3WWVA 3GTGH 3JAMi 2JA8H 1PVOA 3J80i 2A8VA 2UUBQ 5IYDH 4A3JG 2BA0A 3STBC 1PH8A 3H3VI 2JQOA 1SE8A 1A0IA 3W1BA 1E1TA 2IT1A 5IP7H 5JJLA 4KLKA 2N49A 3K7UC 4L5RC 1N9WA 4YWMA 3PSIA 3SGIA 1MKHA 3CC2A 3CCLA 2NVTH 2IX0A 1WYDA 1VQIA 3W1GA 1OXXK 5IYCG 3HOXG 4HIMA 1Q86C 4JI2L 4LNQA 2K14A 1X9NA 4ME3A 1IBLQ 2N78A 2AWNA 1YVCA 4EQ5A 3KFUA 4LF7Q 4K0KL 4DR1Q 2KHIA 3UDFA 2VL6A 3KOJA 4DAYB 2Q2TA 2VUMG 4A3CG 3CD6A 4DR7L 4DUYL 5FLMH 2MO0A 1Z9FA 4P71A 2WAQG 1EQRA 3G4SA 4GOPC 2E2IH 4NPSA 1SROA 4B3SQ 5JJKA 4DV7L 4MTNA 4JI7Q 1A62A 3S14H 3CMEA 2JEAI 2L15A 3I55A 4A3MG 4IFDI 2UXBQ 3MXNB 2PNHA 3PV0A 3GTJH 3CCVA 4DR3L 4PZ7A 1I5FA 1YIJA 2F4VQ 4A3CH 4DV5Q 4DV6Q 4JI6Q 5IY0A 1WJJA 4DUZQ 1GM5A 4GNXC 2CWPA 2B63H 3UDIA 3OTOL 4KHPL 3K7AH 1C0AA 4DR2Q 2ALYB 1HNZQ 4B3MQ 4QQBX 5M5YH 5IWAQ 4A3MH 1HZ9A 2H5XA 4DV0L 1AH9A 4A3GG 1L1OC 3ERSX 1W3SA 4RMFA 3HFZB 2YU9H 3PCOB 1K83H 4A3BG 1HNXL 1ASZA 3AYHB 5LMNL 2Q2HA 3A74A 3PO2H 1H95A 4HIOA 1VQ5A 2NN6I 2AKWB 4C2MH 2R6GA 2VS1A 2UXCL 2JA5G 2YTVA 4IFDJ 3RZOH 1Z47A 2BH8A 3G71A 1X55A 2WB1E 5C3EG 4HJAA 4A3LH 4JC0A 1GKHA 3J81i 2R7ZH 4LF6L 4A3BH 1EIYB 3PUZA 4IFDG 4UPAA 1IXRA 2D0OA 3PGZA 4A3IH 1EIFA 3S1MH 1B8AA 1NBWA 1PYBA 3AFPA 5AJ3L 3J7A5 2ASBA 1Q12A 3H0GG 3L2PA 1VQOA 1YJWA 1Q46A 4X64Q 3UE1A 1JMCA 2HIVA 2WFWA 4JI0Q 2PMZE 1RL2A 4LFCQ 1TWGH 1GO3E 4BY7H 5GAGC 4DV2Q 3GTMH 4AQYQ 1UE6A 2E5LQ 5M3MG 1MIUA 2D0PA 1HZAA 2JA9A 3H0GH 2Z6KA 1PH3A 4LF5L 5ELNA 4C3JH 3U4ZA 4QJFA 1YHAA 4C3IH 3F2BA 3CPWA 1OXUA 4HJ9A 2NN6G 3ULJA 4OX9L 2ZTEA 5DLQE 3I4NH 4MNOA 3ULLA 4BA2I 3G6EA 1B70B 1YEZA 5BR8Q 2RF4A 3KDFB 3CCJA 2JA7G 2N8NA 3NENA 1VQEA 3I56A 1X6OA 3JAMc 1JJ2A 4JV5Q 3J80c 1PH1A 1E7ZA 4PZ6A 4LFAQ 2KCMA 4OO1I 1K8GA 4HJ5A 2VY3A 4IO9A 2UXDQ 3UDGA 4YWLA 3S15H 4LF4L 1NJIC 1KXLA 4IOCA 3CC4A 5C4XG 2PI2A 1WI5A 3TEHB 1Q1EA 2BA1A 3HOYH 2I5LX 4YHHQ 4ALPA 2R93H 1PH7A 1K3RA 3BZCA 1BKBA 4PZ8A 3CCMA 1KQSA 1IBKL 4LF8L 4A3DG 1IZ6A 2VNUD 3S2HH 3E0EA 2JA8G 2MQHA 2WAQE 4YCWA 1XMQL 1LUZA 1HR0Q 5GAEC 3PF4A 3T1HL 3TS2A 1KL9A 4DKAC 1TWAH 4LF9Q 5IP7G 4JI8Q 5C4XH 5IP9G 5IYBG 1Q81C 1N36L 2NZOA 1IBML 2HHHQ 2EXDA 3JC66 3K80C 2IHEA 4YCVA 4LWCA 4DK6C 2IHFA 4O0AA 5LMNW 1QZHA 1PV4A 2KBNA 5GQOA 4BY1G 4APVA 3RN2A 5FLXc 3HKSA 4GKKQ 1M90C 2OTJA 1VQBA 3DLLA 3AFQA 4R4IA 5FLMG 1P16A 2HQLA 2K5NA 5IP9H 3BU2A 5IYBH 1VQKA 4DR6L 1G51A 5K36G 1XTDA 4R4QA 4OO1G 4QY7A 4OWWB 1XNRL 3TRZA 4DV3L 2LSSA 4JI2Q 3ER0A 4XIGS 2ZJQA 4BY1H 1PH4A 1HNWQ 3T1YL 1N33L 5M3FH 2JA6H 1LM0A 1IYJB
chains in the Genus database with same CATH superfamily
3S16H 2K75A 2UUBL 3A5ZB 2WINB 3H6MA 2B63G 2O5IC 5E3FA 3DXJC 3T53B 2HIXA 2WKCA 1GXDC 3CPFA 1EL0A 2QEXA 4G57A 4UY8C 1CKNA 1YI2A 3MEFA 1EEFD 4B3TQ 1GVPA 1NMGA 1WTHA 5J39A 3EN2A 3J81L 4YY3Q 2RDHA 1FJGQ 1PTOC 2IY5B 3CAMA 4AYBB 1NNXA 5EPJA 4DPGA 1B3QA 3H91A 4KHPQ 1ILQA 3HOZB 4JBMA 4A3LG 1HJPA 4HN7A 5TSSA 3D31A 4HSPA 4A3IG 4DV5L 4DV6L 3FKIB 5HURA 4NXNQ 2UXCQ 1KNEA 4PNYA 4DU9A 2A69D 3K0XA 3I7FA 4RCOA 1QZGA 1ML0D 1VQGA 5K5PA 1PTOF 1SE2A 1O7LA 1SYBA 2XN9C 4JI4Q 4JI1Q 1H9RA 3U4VA 4RHRA 1DCZA 5CV8A 2K33A 5EPLA 3W3AA 1JT8A 1JE5A 2RHSB 3BYYB 4R4OA 5COYA 2NZHA 4A3KH 4IOAA 4A93H 1ZYRD 5IGGA 5JJIA 1GUTA 1PH5A 1GHJA 4POGA 4DFAA 5FJ8H 2FJ2A 5JVH3 2VQEQ 1I6HB 5GROA 1BF4A 2G9DA 3U9SA 3SEBA 1GUNA 3G6JB 1UE5A 5CORA 1YJNA 2MNAA 2OCEA 4Q5VA 5CV9A 3CCSA 2B8FA 2F0KA 2GVAA 1KABA 5C0XG 3PIOA 1B3AA 1MJCA 3DUZA 2AWOA 5IGEA 4R9WA 4KK7A 3J7ZC 3TQYA 2M2LA 3ICEA 4JI5Q 1OXSC 1TKWB 3STBD 4ABNA 1CT1D 2A19A 3GO5A 1G2SA 1PA6A 3VYUA 4LUVA 3HOZH 4A3MB 3PMFA 4RH6A 1EYAA 4KTAA 4JYAQ 4DK3C 4PMBA 1SMXA 4H02A 1VCIA 2WIIB 3FKIH 1SJED 3OSOA 1BNZA 3I2ZA 4UAIA 1VQJA 1PFNA 3C1EA 3C46A 1ZEQX 1VMCA 1CKMA 1SNDA 3PO3G 2NVYB 3R2TA 1VQ7A 4DR6Q 1Y1WG 3MTSA 2L4NA 1TR5A 1CI3M 3NEMA 1G291 4K0KQ 4XQJA 4K6LA 1TXYA 4QGUA 1XNRQ 4DV3Q 1EWHA 2I5HA 3C2PA 4EX5A 1IL8A 5I6YA 1N33Q 4UP9A 3KLSX 4DK0A 1JB3A 3NTHA 4KJNA 3KLWA 1PRTC 4C3HG 4KKUA 1T9HA 1O7IA 5C3EB 2QKIC 3CP0A 3HG9A 1G2TA 1RF2D 3CHBD 5A35A 4BXXG 2PZTA 5C4ZA 5D14A 1U4RA 5ELOA 3SK5A 1OXTA 4CJ2C 1WTQA 1I6HH 2B2UA 3EFXD 1NCVA 5C44G 3K58A 1U4MA 1IKLA 4K5VA 3A5UA 4OWTB 1LT3D 1EYGA 3TS0A 4JBJA 3S15B 1UE1A 3E9IA 5EKKA 5C3WA 1PHJA 4X66Q 4DUZL 1L1OB 3D6CA 5T1GA 3DM3A 1F2LA 1VDZA 2B2WC 3SVMA 2CHBD 3RNUA 1R4QB 2BE5D 1HZCA 1E0BA 4CBVA 3QB3A 4OHJA 3MXNA 3DWAA 1QOHA 1FD7D 3M4PA 2YTYA 5IODA 1NR4A 1XYIA 3WOFA 5JPMC 5EAYA 1IL2A 2AQ1B 2EZVA 3D8GA 2K03A 1F9QA 1HR0W 4R4TA 1S5CD 2ATWA 1QNUA 4TKOB 2A6HD 2NVYH 3KJOA 2NVTB 1K0SA 4JBKA 2QA4A 5E4XA 5T1IA 2RSNA 2DNCA 2K52A 2QDLA 5LMUQ 3MC0B 4K2LA 1STEA 1F9PA 3I3CA 2R61A 1GHKA 4K8JA 3Q6SA 5E4WC 1RCVD 5C3EH 2XRQD 3VR3A 2NTTA 2Q8IB 2F0OA 2H1EA 2E5LL 3Q22A 2RDGA 4KI0A 3BZDB 1Q1BA 4I65A 1VQAA 3HOVG 3S14B 4LUZA 1VS0A 3JAME 3I90A 3J80E 1U9RA 5BR8L 1KLUD 4DA2A 1ILPA 1OXVA 1XMQQ 3BVMA 2L0CA 1ZYRC 3RLFA 4X3UA 5M5YB 5I9OA 1ONLA 1QG7A 2E75C 1WCMG 2F0DA 5A2QL 1WTVA 2DJFC 4QCLA 1K83B 1D5MC 1EY7A 1PFBA 3CU7A 3O13A 3D6WA 5E1FA 2GN5A 3KJPA 4C2MB 2PQAB 1S3OA 4BS9A 3SK4A 4DAPA 1EYCA 1SE3A 4LF9L 2R7ZB 4A3BB 1X3PA 1X56A 5H1SE 3HGBA 4IURA 1E24A 1D5ZC 4IPCA 1QVFA 1VQNA 3OHXC 3JAMi 3J80i 5BN3A 2UUBQ 4A3JG 3STBC 2B2VA 2EJGC 2JQOA 4BY7B 5JJLA 3ONAB 2KJXA 5CYUA 4L5RC 2NVTH 1MKHA 3DWQA 3HOXG 1OXXK 4LNQA 1HHVA 1X9NA 2AWNA 3BDOA 3UDFA 2VUMG 1D2BA 3CD6A 4DR7L 1I4PA 4RHSA 4ZKCB 1ENAA 2WAQG 4ZQ3A 2RA4A 1EQRA 3MHBA 4FXKC 3G4SA 3J81E 4GOPC 1A6XA 1M8AA 4MTNA 4JI7Q 5KEEA 3S14H 3BS1A 1HFGA 2L15A 3I55A 4NDXA 4WRDA 1WVLA 2R93B 1I5FA 1MSGA 1O80A 4DV5Q 4DV6Q 5IY0A 1GM5A 4GNXC 3A8JE 2CWPA 4KKSA 4R8NA 4KHPL 3OW7A 1TWAB 5M5YH 4JK1C 2KECA 1XXGA 1B2TA 1AZQA 4RMFA 2E74C 1K83H 2AUKA 4A3BG 3MZ5A 1H95A 2Y0SB 2NN6I 4C2MH 2UXCL 2HDMA 2MPMA 2B2WA 2B39A 1PXUA 4EQNA 2EJFC 2WB1E 4HJAA 4JC0A 2R7ZH 3J81i 4A3BH 1EIYB 2F0PA 1JOQA 2L5TA 1BR9A 1IXRA 1EIFA 1PYBA 1NBWA 3NQIA 3L2PA 5M5XB 1YJWA 2RBMA 2H4OA 1JMCA 4JI0Q 2BE5C 2M9VA 1S4ZA 4BY7H 4DV2Q 1HPCA 5LL6X 5M3MG 1EY0A 4G7HC 2JA9A 3NPPA 2SNMA 1PH3A 4LF5L 5C5LA 1TWCB 3U4ZA 4XQNA 1CZGA 3OIQA 1EOTA 4B9XA 3H94A 4MNOA 1YEZA 4Q0FA 2RF4A 3CCJA 1ET6A 2A6HC 4ZKBB 2EPBA 1BO0A 2XNAC 3SDZA 4LFAQ 1O7YA 1LTSD 4CDFC 1K8GA 3WDNA 5CV7A 1GJXA 4IOCA 2PI2A 1A3UA 2F0GA 2R93H 1K3RA 1BKBA 3CCMA 1ESFA 4A3DG 3S1NB 1IZ6A 5FO8B 1DJRD 3E0EA 1MGSA 1EQVA 3NXWA 5GAEC 4CHTB 1TWAH 4QUFA 1EZ6A 1N36L 1Q81C 3WOEA 5C6AA 1TS3A 1EQTA 4LWCA 1F9RA 2KBNA 1Y8OB 2BCOA 4KY6A 3RN2A 1JOOA 1SYCA 3HKSA 5CV4A 4U68A 2F0HA 4MN3A 3DLLA 3AFQA 4R4IA 4DR6L 4KN7C 2IL8A 3DEOA 1W6JA 1XTDA 4OO1G 3A54A 3E3XA 4JW0A 1XNRL 1Q3LA 3TRZA 4DV3L 4JI2Q 1B4OA 3T1YL 1N33L 4WJ4A 3J7AF 4H44C 2NYZD 5M5XH 2CQAA 4IUTA 1H9MA 1H9SA 2KENA 3IL8A 2G5DA 3CCRA 3F2DA 5ELCA 1SYGA 5M5WB 3HOUB 5KIXA 3FVQA 1EQQA 4DNIA 1E2WA 2MO1A 4BBSB 3KF8A 4E6IA 4HEDA 2RCFA 3F8TA 3Q8DA 1TWCH 3A7LA 3M7NA 4H13C 1I4GA 3NUCA 1SE4A 4GZYC 3PO2G 2GVBA 1FNVA 2HCIA 2L1BA 4RCNA 2SOBA 3I4OA 4QL5A 1NY4A 1J6QA 1SNCA 3VR2A 3RZDB 4GOPA 1KAWA 1QNKA 5ELBA 4GN5A 1D8LA 4DV0Q 5IGFA 1SRUA 1PH9A 5IT9c 1WOCA 4X66L 3E6ZX 4RG1A 3M4OB 5EBCA 2X6LA 1QUQA 4ODGA 2CW0C 3EIVA 4JCVE 1VQHA 4CDCC 2WACA 1O78A 1HNZL 4B3ML 2EY1A 1G8ZD 1B9MA 3CW2C 3LGJA 1AP0A 1N8RC 2BDOA 5JEAH 4A75A 1VQ9A 3ZJYC 4LF6Q 4LUOA 3R93A 1I4QA 5C0XI 1XJVA 1WD0A 2Z9HA 4Z9CB 2C9OA 4C3IG 3SR1A 3I4NG 5I2YA 1TY2A 2E2HB 4J8QA 3HOUG 2F0JA 2EYMA 2F0WA 1Y1VB 3CRKC 3M9BA 5LMUL 4N8X1 2WP8J 4FXGC 1M1KC 2DJGC 4DN4M 4BA1I 1LTTD 2X69A 4P2CB 1X65A 2KUMA 3PUYA 4LFCL 5C0XJ 5M5WH 3PIPA 3HOUH 3R2IA 3HOWB 1KC8C 2FXQA 4BBSH 1U0LA 4GN4B 3KK7A 1TT2A 1HCZA 2D5DA 1S72A 2ZTCA 5A2QE 4N8FA 3E9HA 1S5ED 1SEBD 1PRTD 4OELB 2VZAA 4ME5A 4RGMA 2NVQB 3U58A 3RZDH 1B44D 5JVG3 2EIFA 2UXDL 1FNWA 1GUGA 1CHPD 4XTCS 3G7LA 1Q82C 4P74A 3M4OH 5GADC 3NBHB 3Q24A 1PFSA 1PFMA 1SNOA 3SK8A 4HIKA 1EWIA 2QGQA 4AIMA 1QE6A 3RLOA 3TP8A 3GTQB 1PH6A 1Z7TA 1VQFA 2PPBC 2HHHL 4ZUIA 1VQ8A 4RFBA 4Y7NB 1X3FA 2JEBI 4HCSA 2YV5A 1SMYC 2JA5B 1CKNB 2O5JC 2Z4IA 4LAAA 2XGTA 3URYA 2OQKA 3K5NA 4DR7Q 4X62Q 4LJZC 5IGCA 1HA5A 2E2HH 4QB4A 4I7AA 5J22A 1RKNA 1A8VA 3L0OA 4AH6A 3N6RA 1EU3A 3HOWG 2OQ0A 5BN5A 1HNWL 3GDEA 1Y1VH 1VQ4A 1LTRD 1A2UA 1QVCA 4L5SA 3EBEA 3QIAA 3OWFA 3NK9A 3OOCA 4ZYSA 1H9JA 1STAA 3BVZA 4JI7L 3HOWH 2EY6A 1XMOL 2A73B 5KNBA 1EU4A 1OTCA 3S1QB 2R7FA 2NB0A 1WD1A 3HKZG 4I7ZC 1BVSA 5GAHC 2LS01 4A4IA 4JBWA 5BN4A 4AYBE 2NVQH 3D4RA 1DOLA 1C7YA 1XPUA 2RCNA 4A3KG 4A93G 1IHZA 4ID6A 1UEBA 2OTLA 3GTGB 1PYWD 2ZJPA 1LT4D 2JA8B 2R7DA 4ZK9B 1FVIA 3T16A 5FJ8G 2KCTA 4KKTA 1BBXC 2PMZB 1G6PA 4IPGA 3E5SA 4O2DA 1VF7A 3GTQH 3I72A 1C9OA 1QJOA 1V9PA 2UUCL 3OYYA 4XYQA 4Y7NH 4LF5Q 4ZAIA 5LL6S 2JA5H 3C3LA 3H15A 4JI0L 1Y8PB 5ELFA 2Q2IA 1NMFA 1UUPA 4DV2L 1LYLA 4DV4Q 1K8OA 2E2IB 3QJYA 4AYBG 2NBFA 1SR3A 4IFDH 2YYZA 3HOZG 2F0QA 4DR4Q 2QF7A 1QWYA 4RA8A 1V1PA 2DGYA 1NTGA 1VMPA 5FK9C 2FHTA 2ZM6L 1LTBD 3FKIG 4HCEA 1VQLA 4KY7A 2UU9Q 4OIJA 1K9MC 1LABA 2WV6D 1DGSA 5IE8A 4POFA 4LFAL 2ICEC 4GN3B 1E3PA 1N36Q 1BCPD 1RHPA 1SLJA 3S1QH 3OW2A 3KDFA 4CKBA 3NWSA 4NXML 3CKIB 4X65L 3CCEA 2JE6I 2L55A 3RZOB 1DOMA 2Q8TA 4LFBQ 3GV3A 2UUAL 1SSOA 2JP1A 3IFDA 5DNFA 3IKJA 1E22A 3AQQA 5KNCA 3NHHA 3H3VC 4RKBA 4DV1Q 1I94Q 1CA6A 1R9TB 3CCUA 5IYDG 4L5QA 3M4QA 3T1YQ 3GTGH 3WWVA 2JA8H 2A68D 5C3XA 1YNND 1TS5A 3H3VI 1C48A 4MHEA 3W1BA 1E1TA 2IT1A 5D65A 5IP7H 3J7YW 4PV1C 2DY8A 4CKCA 3P75A 2N49A 3K7UC 3OPOA 3CCLA 2Z1CA 3PSIA 4YWMA 1LTID 5IYDH 1VQIA 2Z4HA 1SJHD 4JI2L 5M9OA 4C3JB 4CDDC 3L3OC 2VL6A 2Q2TA 5DM73 5K36H 5KYLA 2E2IH 1PRTF 2Q8RE 1PTOB 3CMEA 1PLFA 4A3MG 3MXNB 1YIJA 1NSNS 3HOYB 5KNDA 3S2HB 4B9WA 2EYPA 4CJ1B 1WTXA 1S5DD 3NBIA 3MXPA 4NKLA 1KDCA 2K5DA 3K59A 2K1BA 1HNZQ 4B3MQ 5IWAQ 4QQBX 2F4IA 4A3MH 4DV0L 1UAPA 2EE1A 2XRSD 3K5OA 3HFZB 3Q0AA 4RGOS 3VA7A 1STGA 2F0MA 2M00A 5IT9L 4LMQD 5CMDA 3H09A 1CQVA 1LO5D 3RZOH 4CKEA 1Z47A 3ND8A 1DM0B 3DWPA 1IKMA 1X55A 5JAVA 5C3EG 1D1IA 1KLGD 1WTPA 4LF6L 4BY1B 5M3FB 2JA6B 3AFPA 3J7A5 1EY4A 1VQOA 2PNRC 2XWBB 2OEOA 2HIVA 5ELEA 1A3VA 1JQYD 1HTLD 1HQRD 4IUNA 3VYRA 4LFCQ 4X3KA 1MIUA 2D0PA 1HZAA 3M7GA 3KLRA 1TWFB 4C3JH 4QJFA 2KEDA 5NUCA 4HJ9A 4OX9L 2C5CA 4BA2I 1B70B 4JVZA 3A8KE 2N8NA 1VQEA 3LWEA 4FXDA 2XIWA 3JAMc 3TZDA 1JJ2A 3J80c 4PZ6A 3SHLA 4J1MA 1LT5D 4OO1I 1PTOH 2SEBD 4IO9A 2UXDQ 3UDGA 4K5WA 3S15H 4LF4L 1WI5A 2BA1A 3HOYH 2I5LX 4FVMA 3BZCA 3EROA 4PZ8A 5L37A 4BBRB 1KQSA 1W6KA 4LF8L 2VNUD 4FF4A 3S2HH 2WAQE 3PF4A 1KL9A 3NE5B 4DKAC 1UEAB 1C4QA 4QIWB 3AMUA 5IP9G 5IYBG 2QCPX 3NWTA 2EY2A 4X3SA 3JC66 3K80C 2HHHQ 2IHEA 2FMCA 4RGNA 1KAAA 4O0AA 1QZHA 3ERQA 1S5BD 1CQFA 1JWUD 3HP3A 4BY1G 4L8JA 5FLXL 3HEJA 3VA5A 1MSHA 2IWHA 5IP9H 4RKLA 5IYBH 1SNMA 3QOJA 2F03A 4G7OC 1PRTB 1SAPA 4R4QA 1BCPC 5CR3A 1GOZA 2LSSA 1HNWQ 4BY1H 4A3FB 5IOCA 1PH4A 5M3FH 2JA6H 1PZID 4GS3A 2MFIA 1PH2A 5F2DA 3S2DB 2AHOB 5EQ0A 4X62L 1SYFA 4DUYQ 2CW0D 4U673 3MVVA 4HIDA 2N3SA 4CJ0B 1JR0D 2NVXB 4DV7Q 2NUCA 4YCUA 5C4JB 2E76C 1XMOQ 2R92B 1IBLL 1TWFH 2A68C 3PUVA 3J81c 1YNNC 4LF7L 3MA2B 3MWYW 3J81j 1BCPF 3FMCA 2KVMA 2DUDA 3RLNA 2LMCB 2KCNA 4ZRZA 5J3BA 4JOIC 3BZKA 3CF5A 1YITA 4WJ3M 1W2BA 3N52A 2BH2A 1JWSD 1QB5D 3KLSA 2R7ZG 2QW7A 2EJMA 4N9TA 1NE3A 4DAMA 4KMUC 3GV6A 5LMNQ 4JI6L 4BBRH 3IRBA 3PF5A 2ZJRA 2LFNA 5J1ZA 4BY7G 3GQBA 1GD7A 1F77A 2UUCQ 2L11A 3KYHC 2F3IA 2CVRA 2ZXPA 3I73A 4QUCA 1YJ9A 3GTLB 4TQUS 4A3FG 3I4MB 5DM63 1ET9A 4KD3A 3Q23A 1ENFA 2CFMA 1D1KA 1YHQA 1FGUA 1RD9D 4RGTA 1SFOB 1JCKB 5EGTA 4A3FH 3U50C 2RDFA 2KHSA 2R93G 3D3RA 3S2DH 2ZM6Q 2IW3A 1KDAA 4DV4L 4L6TB 2DNEA 4IJLA 4K6DA 1RTNA 1TVXA 3I8ZA 2NVXH 3VYTA 4DR4L 3TP5A 2HCCA 1XPOA 2R92H 4OONA 1WFQA 2RHQB 1EIHA 3TDQA 1AE3A 1BBUA 4IJHA 1SMYD 3GP7A 2Y0SG 4NXMQ 4LW1A 4X65Q 1CSQA 3NTKA 1ICFB 2UU9L 5IGDA 2X6GA 3CC7A 2UUAQ 3MFYA 3T4AC 1JICA 4H0LC 2QEJC 1IBMQ 3F2CA 3ND9A 1P8LA 1FGBD 1CUKA 2IPKD 3KF6A 3GTOB 4LFBL 3M3YB 3RMHA 4F8MA 1H9SB 1I3QB 3R3OA 4A3GB 3L7ZC 4DV1L 1IW7D 1I94L 1TQOA 3U9OA 2F0LA 1K8AC 1L0XB 4J6HA 2LXJA 2LY7A 4HMIA 5E7NA 3KF8B 2ICIA 2XVSA 3GTLH 2JXMB 4P72A 1JB7A 3I4MH 4FNFA 1YHBA 5G3LD 2ZXRA 4TRDA 1YNJC 4OL7A 2F0EA 4F87A 1VQCA 3OMGA 2CH4W 1RTOA 1AW7A 1SFOH 2A6EC 4FF1A 4GOPB 1DZ1A 1CFMA 1LTLA 1TWHB 4HAEA 1UNSA 4WORA 1N32L 3KBGA 1B9NA 3K81C 1V1QA 2NWGA 2PO4A 2EYJA 3QG1A 1KHIA 4DR5L 1QUQB 3S1RB 4GNXB 5IYCH 1Y69U 1H9KA 5EJWA 1STNA 3J7AV 1AEXA 3BDLA 5JPNC 5CC4A 5JEAG 1CA5A 3GTPB 3CMAA 1DOKA 5FOBB 1RIPA 4DAYA 4UP7A 3S1NH 1NAPA 1MJEA 5FO9B 3BG3A 4OGQC 2JA7B 3A8IE 1MBYA 4Y52H 3DMUA 4GNXA 2MUYA 3UI2A 3K5LA 1Y14B 5ISRA 1IYUA 5IWAL 1II3A 4JOIA 4GKJQ 2GA4B 2NZ1D 5LHY1 2VB3X 2WKDA 1HTPA 2XTIA 1XNQL 3GTOH 3R8BA 3M3YH 3T51B 1HA6A 1I3QH 4A3GH 4P73A 1N34L 1LTGD 1S40A 1J9OA 1EEID 2VQFL 2I5MX 2LXKA 4BBSG 1SYDA 3UDXA 1HH2P 1X54A 1LLRD 2HDLA 2MGSA 1KIXA 1STYA 3D0FA 1CHQD 2MP1A 1K73C 4OX9Q 1U5KA 1U4LA 1CZWA 1K28A 2F3WA 2K01A 4JPBW 3TP7A 1J5EQ 1PYSB 3BJUA 4HTHA 4K8IA 2CWAA 1CK1A 3MAQA 5D3DA 4LF4Q 4ZUJA 1JOKA 1TWHH 2F0TA 4TVAB 2V1CC 1L0WA 5CGKA 4IPDA 1L2FA 4LF8Q 1LTAD 2B63B 2E8GA 4B3RQ 1KRSA 3K7AB 1A2TA 2ENBA 4R4CA 3S1RH 1F2YA 4OIKA 4FO2A 4JI3L 2KHJA 2N55A 4YWKA 3GD7A 2YU9B 5CBEE 4ILWA 3GTPH 4G4KA 2NN6H 2R3ZA 3PQIA 1DD2A 4IALA 2HT1A 1QCBD 1ENCA 4GLXA 2JA7H 4XXEA 2K32A 2K5VA 3PIO3 4A76A 2Q2UA 3K0YA 1SNQA 2VW9A 4K14A 2K05A 2PYKA 4YIJA 4F88A 1B53A 3K6OA 5FLXE 5EBDA 2EOTA 3K8AA 4A3IB 1F2MA 4JG2A 3S1MB 3HKZE 3QOLA 5KGUA 1Y1VG 1PVOA 1T5EA 2A8VA 4DF7A 3FDTA 2BA0A 1PH8A 1A0IA 4CDEC 2MHVA 4KLKA 3GTMB 1TS4A 2B2TC 2PCFB 4F7XA 1N9WA 1NUCA 3SGIA 3CC2A 1PZJD 3W1GA 4HIMA 1AZPA 1EY5A 4C56C 3K5MA 2RQXA 1B1ZA 1IBLQ 2N78A 2Z8LA 4EQ5A 4LF7Q 4MTKA 1AFPA 2AQ3B 4A3CG 4DUYL 5FLMH 2FFKB 4P71A 3EVQA 1IW7C 2FMMA 4NPSA 4B3SQ 5JJKA 1SYEA 4DV7L 1A62A 1ESRA 2JEAI 3PV0A 1Q8IA 2PNHA 4WFN3 4DR3L 4A3CH 4N9PA 4JI6Q 1WJJA 4FF3A 4ZLTF 5C4HA 1PMRA 2B63H 1EIGA 1DXMA 1SBBB 3UDIA 3OTOL 2AUJD 3K7AH 4KV6A 2LKVA 2PW7A 3D4DA 4DR2Q 1K3BC 1QILA 2KCCA 3QWNA 1HZ9A 2H5XA 1NR2A 1L1OC 3ERSX 1W3SA 2YU9H 3C1FA 1SXTA 2XSCA 4G7ZC 2RVLA 3BDCA 3AYHB 5LMNL 3A74A 4HIOA 1VQ5A 1E2VA 5CV6A 3AU7A 3VYSA 2R6GA 2JA5G 2YTVA 1STHA 2BH8A 4H7BA 4FYDA 4A3LH 4DXGA 2L9HA 1GKHA 5G3LF 2J7ZA 1MI2A 4IFDG 4A3IH 2D0OA 4FF2A 3S1MH 2K5QA 5AJ3L 2IJ0A 1Q46A 1V1PB 3PO3B 1EY6A 2PMZE 1RL2A 1JORA 1Y1WB 1GO3E 3GTMH 1UE6A 5DAUA 3RUZA 3LNNA 3OWEB 5ELNA 3MXGA 1PZKD 1YHAA 4PMCA 1I6VC 4ULLA 3F2BA 1V8QA 1KDBA 1IYVA 4C3HB 5DLQE 4R8IA 3ULLA 3G6EA 3KDFB 1I4HA 1X6OA 4K5XA 4PQXA 4JV5Q 1BUVT 1PH1A 1E7ZA 1EFID 2KCMA 3NSWA 2VY3A 2D9UA 4YWLA 4O42A 2KA7A 3V05A 3CC4A 3TEHB 1EZ8A 4IUUA 4YHHQ 1PH7A 1IBKL 1JC7A 3F2UA 5C44B 5EPKA 2JA8G 2MQHA 1S5FD 1LUZA 3T1HL 4A3EB 1OO9B 1D5XC 5IP7G 4JI8Q 1IBML 2DN8A 5C0XH 2EXDA 4S3SA 5I9PA 2PZUA 4KN4C 1SNPA 1LACA 2B2VC 2B8GA 2OTJA 3A7AB 1VQBA 1HFNA 1VQKA 2HQLA 2K5NA 4KJOA 5K36G 4NW2A 3TBIB 4QY7A 4TSSA 2ZJQA 3ER0A 1K8MA 1LM0A 2ID0A 1I50B 1N32Q 1BBWA 1JWMD 4UDUC 3PO3H 2RSOA 4DR5Q 1Y1WH 5I2XA 2L12A 4ZCKA 4NB3A 2V4DA 1G91A 4XYOA 1Q7YC 1T5XD 2B2TA 1VQMA 3QR8A 1FR3A 2ZT9C 4XDXA 1V43A 1XPRA 4DR1L 4C3HH 2PW5A 3M4YA 2B29A 2A74C 1YBYA 1VQ6A 3RD4A 3A55A 4BXXH 4A3EG 3HOVB 3TSSA 1FYCA 2O4XA 2A1AA 3VDYA 2IX1A 2UXBL 5DEHA 2F4VL 4PMWA 1HNXQ 1BDOA 2ES2A 4MIUA 5C44H 1X3GA 1HZBA 3M85A 1BXTA 1XNQQ 4A3EH 3A0JA 2JN4A 4PG3A 3SE0A 4GKJL 3X3NA 1WCMB 3EA6A 3S17B 1YNXA 1N34Q 1A63A 1E1OA 2VQFQ 2P5ZX 1R9TH 1L1OA 4V0BA 4OWXB 2A5HA 1XX8A 2B3GA 1CKOA 1X32A 4C3JG 4C1NI 2K50A 4HJ8A 5AFWA 2Z0SA 2CH4A 2C35B 1AE2A 5FO7B 1VF5C 4IQZA 1A3TA 1EFWA 3CXCA 3FP9A 4OEMB 4HMJA 2F0UA 2JJQA 4HR7B 4A3JB 2CKZB 2I07B 2SNSA 1F2ZA 4HSVA 4J15A 4X64L 3HOYG 2F52A 5JJZA 1I50H 3GTKB 1HQMC 2A69C 1J5EL 1YZ6A 4AQYL 1O7ZA 3HOXB 2DY7A 1CSPA 1XWEA 4JI3Q 4L63B 1DONA 1KNAA 4UHVA 1V1OA 1HUNA 5HY6A 2VUMB 2WAQB 4B3RL 1VQDA 1GUSA 1B7YB 3CQZB 1YNJD 5HGQA 3HOVH 1DYQA 2F1MA 1BOSA 3DHQA 4NMZA 5HGTA 4XQQA 2A6ED 4DGZA 3NELA 5M3FG 2JA6G 5IIFA 4RWSC 3T56B 1HR0L 1GUOA 1WCMH 3S17H 2JSOA 3AB9A 4FP5D 4KD4A 2PQEA 5I6WA 4QIWE 2D62A 2J4XA 1TS2A 2F0FA 2PQAA 5EKLA 2F0IA 3EQLC 4P75A 3OMCA 3CCQA 3I91A 4GKKL 4EQOA 5ELDA 4CGYB 3QO2A 4IUQA 2EXZA 2VXWA 2ZTDA 2D2CC 1ASYA 5EKIA 3RR5A 4IUVA 2K5HA 2OT2A 3FHWA 1LV9A 4MZ9A 2SDFA 4DR3Q 1I4XA 3UE0A 5IGBA 4A3JH 1UE7A 4GLVB 2HD3A 3GTKH 4DNTB 4BBRG 5JEAJ 3I4LA 1CM9A 2AMCB 2K5WA 2EYOA 3OTOQ 3VR4A 4B3SL 3W2DA 1U4PA 5M3MB 3HOXH 2KEEA 4WJWA 2EQSA 3X3MA 3S24A 4B3TL 2CQOA 4FDBA 2E2JB 2VUMH 3RN5A 4OXPA 4YY3L 2K04A 2KQ3A 1FJGL 1UWVA 3MEHA 4M8AA 3TZUA 2I0QA 4DR2L 2WB1B 3CQZH 2YTXA 1TIID 2F3VA 3CRLC 1EOVA 4O1NA 3P1HA 1HUMA 1FL0A 4A3DB 4X3TA 2OF1A 5AJ3Q 2Y0SE 3H3VH 1KRTA 3FPPA 4KHZA 4NXNL 4EGVA 3I70A 2Z6BA 1K0RA 2K6AA 2KOLA 1CTMA 3HRZC 5KYIA 2BDNA 4DNRB 4JI4L 2Z6KC 2BOSA 3AEVA 3BVGA 4BWGB 4JI1L 1JJGA 4KHVA 2R92G 2K4KA 2EYFA 2JK8A 1HRJA 1I4RA 3ITPA 4X6AH 2AQ2B 2CCZA 1JE4A 4R1JA 3DEPA 1D7QA 1QVGA 5FKAC 1G6ZA 5C4JH 4GLAC 2B2YC 1AN8A 3GTJB 3KBXA 3F1ZA 3PUXA 2VQEL 1IBKQ 2TMPA 3TREA 1PDQA 2EYLA 2PI2E 3SK6A 1JJCB 4XT3B 1KD1C 4QMGA 4JV5L 3T1HQ 2IX3A 4HJ7A 3KF6B 3FEWX 1Q8KA 5M3MH 2TSSA 3G48A 4LK1C 4V190 2WB1G 3B6YA 4DK1A 3PIP3 2OWOA 1X3EA 2K28A 4L5TA 4YHHL 5CBAE 3P20A 3PUWA 1RODA 2E2JH 3PO2B 3OIPA 4IN3A 3V96A 3V2TA 1ZKOA 4JI5L 2F0SA 1Z6HA 1VQPA 3I4MG 4K2KA 3W5OA 1SN8A 4IPHA 3ULPA 4JI8L 2XWJB 3D4WA 1EUJA 4JYAL 1GUWA 4A3DH 4UP8A 3TP6A 1BCPB 1Q90A 4EVOA 2EYHA 1SE8A 1BQQT 2F0NA 1TWGB 1PTOD 3MFGA 5C5MA 1B50A 4K0KL 2IX0A 1WYDA 5IYCG 1Q86C 4DXFA 2K14A 3BYTB 3H0GB 4ME3A 1D6EC 1YVCA 3VR5A 4IZ8A 4C3IB 3KFUA 1EYDA 4DR1Q 2KHIA 3I4NB 1FNUA 1SDFA 3KOJA 3TN2A 3LX0A 4DAYB 5I4DA 2MO0A 1Z9FA 4C1NK 4OO1H 1SROA 2I46A 4RAUC 1E2ZA 3IAYA 2HUGA 3L9AX 4IFDI 2E2DC 2UXBQ 1L0YB 2F4VQ 3CCVA 3GTJH 3DM1A 4PZ7A 4DUZQ 1LT6D 4EQPA 1ICWA 2OXPA 5IT9E 3ZYYX 1C0AA 2ALYB 4IUPA 1F9SA 1C8CA 1EY9A 5C4XB 1AH9A 3FRPB 4A3GG 2F0VA 3PCOB 2G9HD 1HNXL 1ASZA 2Q2HA 3KUPA 1A15A 3PO2H 4XT1B 3NP8A 2AKWB 1RDPD 1HXYD 2VS1A 4IFDJ 3MXUA 1MHWC 1KTKA 3T13A 2O2LD 3SXHA 5KRUA 3G71A 3E0JA 1WTOA 3HZXA 3PUZA 4UPAA 3PGZA 1B8AA 1EY8A 2ASBA 1Q12A 2K7VA 3S16B 3H0GG 4X64Q 3VR6A 1EWCA 3UE1A 2WFWA 1TWGH 2EDGA 5GAGC 3IFTA 3P7JA 4AQYQ 2E5LQ 1STBA 1WTRA 3H0GH 2Z6KA 5JOBA 1MD2D 3FPUB 4NP5A 4C3IH 3TMEA 1OXUA 1R4PB 2NN6G 3CPWA 3ULJA 3I4NH 2ZTEA 2RKSA 4M1UB 5BR8Q 4QF4A 2JA7G 3I56A 3NENA 4KY5A 2J0TD 3JAML 3J80L 4B08A 4HJ5A 1NJIC 1KXLA 5C4XG 1Q1EA 2B2YA 4ALPA 1TY0A 3K57A 1RJTA 2QILA 4YCWA 1XMQL 2HQEA 1HR0Q 2ZXOA 3TS2A 1X3QA 2QDBA 4DAVA 2EY5A 1TU2B 4LF9Q 2PZWA 3HS0C 3S9WA 5C4XH 2NZOA 4YCVA 5CV5A 3A56A 3HKZB 4DK6C 2IHFA 5LMNW 1PV4A 3EJIA 5GQOA 1WTWA 4APVA 3NTIA 5FLXc 3LWUA 4GKKQ 1M90C 1XTCD 5D3IB 1J8IA 5FLMG 2EVBA 1P16A 4A3KB 3BU2A 4A93B 2NTSA 3NQTA 1G51A 1ZXTA 2MJ8A 2VB2X 4OWWB 3NBHA 2FINB 1M4VA 1Y8NB 4XIGS 2N88A 2JYOA 2B2UC 1IYJB
chains in the Genus database with same CATH topology
3S16H 2K75A 2ID0A 3A5ZB 4GS3A 5M5XH 2UUBL 2MFIA 1PH2A 1N32Q 1BBWA 2AHOB 2KENA 4X62L 3PO3H 3CCRA 3F2DA 4DUYQ 4DR5Q 1Y1WH 2B63G 4HIDA 1EQQA 2N3SA 2HIXA 4NB3A 4DNIA 2MO1A 1Q7YC 3CPFA 4DV7Q 2QEXA 4YCUA 1VQMA 4UY8C 1CKNA 1YI2A 1XMOQ 3MEFA 1V43A 3F8TA 1TWFH 1TWCH 3Q8DA 1IBLL 4B3TQ 1XPRA 1GVPA 3PUVA 1NMGA 3J81c 4LF7L 4DR1L 3J81j 4C3HH 3EN2A 2DUDA 3PO2G 2GVBA 2B29A 3RLNA 4YY3Q 1FJGQ 1YBYA 1VQ6A 5J3BA 2IY5B 3CAMA 3I4OA 4QL5A 4JOIC 3BZKA 1NY4A 4DPGA 4KHPQ 3CF5A 1YITA 1J6QA 4BXXH 4A3EG 1W2BA 4WJ3M 4GOPA 1KAWA 3VDYA 2A1AA 2BH2A 4JBMA 4GN5A 2IX1A 4A3LG 1D8LA 4DV0Q 1HJPA 2R7ZG 2UXBL 1SRUA 1PH9A 5IT9c 2F4VL 1WOCA 4X66L 4PMWA 3D31A 4RG1A 1HNXQ 1NE3A 4DV5L 4A3IG 4DAMA 4DV6L 2ES2A 5LMNQ 4JI6L 4BBRH 1QUQA 3IRBA 5C44H 1X3GA 1HZBA 3M85A 4NXNQ 3PF5A 1XNQQ 2UXCQ 3EIVA 4JCVE 4A3EH 3A0JA 2ZJRA 1VQHA 1HNZL 4B3ML 4PG3A 3K0XA 4GKJL 3CW2C 3I7FA 1QZGA 3LGJA 4BY7G 1YNXA 1N34Q 1VQGA 1N8RC 1VQ9A 1E1OA 4A75A 1A63A 1GD7A 3ZJYC 2VQFQ 4LF6Q 4JI4Q 1R9TH 2UUCQ 1L1OA 4LUOA 4OWXB 3KYHC 5C0XI 2F3IA 2B3GA 1XJVA 1CKOA 4JI1Q 3U4VA 1YJ9A 4WJ4A 4TQUS 4A3FG 2K50A 3I4NG 4HJ8A 1JT8A 2RHSB 1JE5A 4R4OA 2NZHA 4A3KH 4IOAA 2Z0SA 4A93H 2C35B 2CFMA 1AE2A 1YHQA 3HOUG 1FGUA 5JJIA 1PH5A 1EFWA 3CXCA 4POGA 3FP9A 3M9BA 3U50C 5LMUL 4A3FH 2WP8J 2JJQA 5FJ8H 2CKZB 1M1KC 2VQEQ 4BA1I 4J15A 4X64L 3HOYG 2F52A 2R93G 1I50H 3S2DH 5GROA 1X65A 2ZM6Q 3PUYA 4LFCL 5C0XJ 5M5WH 3PIPA 1UE5A 4DV4L 1YJNA 3HOUH 4IJLA 1J5EL 1YZ6A 2OCEA 2MNAA 4AQYL 1CSPA 1KC8C 2FXQA 2NVXH 1U0LA 4GN4B 4JI3Q 4BBSH 3CCSA 4DR4L 1S72A 2ZTCA 2GVAA 1XPOA 2R92H 5C0XG 4OONA 3PIOA 1WFQA 5HY6A 2RHQB 1MJCA 3E9HA 2AWOA 1AE3A 1BBUA 4IJHA 2Y0SG 3J7ZC 3TQYA 4LW1A 4NXMQ 4JI5Q 3ICEA 4X65Q 4B3RL 1VQDA 1OXSC 3STBD 1CSQA 2VZAA 2UU9L 3CC7A 1B7YB 2A19A 3GO5A 2UUAQ 5HGQA 1PA6A 3U58A 3RZDH 4LUVA 3HOVH 3HOZH 2EIFA 2UXDL 4JYAQ 1IBMQ 4XTCS 3F2CA 4DK3C 3NELA 1Q82C 4P74A 1P8LA 1SMXA 5GADC 3NBHB 4H02A 3M4OH 1VCIA 3FKIH 5M3FG 2JA6G 1PFSA 1CUKA 3I2ZA 3KF6A 1HR0L 1VQJA 4HIKA 4LFBL 1EWIA 2QGQA 4AIMA 1CKMA 3RLOA 3PO3G 1VQ7A 1WCMH 4DR6Q 3L7ZC 3S17H 1Y1WG 1PH6A 4DV1L 1VQFA 3NEMA 1G291 4QIWE 1I94L 2HHHL 4K0KQ 2D62A 1VQ8A 1TXYA 1X3FA 2PQAA 2JEBI 4QGUA 1K8AC 2LXJA 2YV5A 4DV3Q 2I5HA 1XNRQ 4P75A 5E7NA 4EX5A 3KF8B 1N33Q 3CCQA 1CKNB 4UP9A 3GTLH 4GKKL 2XGTA 3KLWA 4P72A 1JB7A 3I4MH 1YHBA 2OQKA 4DR7Q 1T9HA 1O7IA 4X62Q 3CP0A 2E2HH 2ZTDA 1ASYA 1VQCA 3RR5A 4BXXG 1A8VA 2K5HA 3L0OA 4AH6A 1SFOH 3HOWG 3FHWA 2OQ0A 1HNWL 4MZ9A 3GDEA 1Y1VH 4GOPB 1VQ4A 1LTLA 4DR3Q 1QVCA 5ELOA 3UE0A 4A3JH 1OXTA 1UE7A 4GLVB 1I6HH 1N32L 3GTKH 4BBRG 5JEAJ 3K81C 1V1QA 2AMCB 3EBEA 5C44G 4L5SA 4DR5L 1KHIA 1QUQB 3OTOQ 4B3SL 4GNXB 3HOWH 5IYCH 3HOXH 4JI7L 3A5UA 4OWTB 2EQSA 1EYGA 3TS0A 4JBJA 5JEAG 1XMOL 1OTCA 3S24A 3CMAA 4B3TL 1UE1A 1RIPA 2CQOA 3E9IA 4FDBA 2R7FA 4UP7A 1PHJA 4X66Q 2VUMH 4DUZL 1MJEA 3S1NH 3RN5A 3HKZG 1L1OB 1BVSA 4Y52H 4OXPA 5GAHC 4YY3L 3DM3A 4GNXA 1FJGL 4A4IA 1UWVA 4JBWA 2I0QA 1Y14B 4DR2L 3RNUA 5IWAL 3CQZH 1HZCA 2YTXA 4AYBE 2NVQH 4JOIA 1C7YA 4GKJQ 1XPUA 2RCNA 4A3KG 4A93G 1EOVA 3M4PA 2YTYA 1UEBA 1FL0A 2OTLA 5AJ3Q 2ZJPA 2Y0SE 3H3VH 2R7DA 5EAYA 1FVIA 1KRTA 1IL2A 5FJ8G 2KCTA 2XTIA 4KHZA 4NXNL 1HR0W 4IPGA 1XNQL 3GTOH 4R4TA 3M3YH 1G6PA 1K0RA 2ATWA 4O2DA 2NVYH 3M7NA 1I3QH 3GTQH 4P73A 1N34L 4A3GH 3KJOA 1S40A 2VQFL 1C9OA 4JBKA 4JI4L 1V9PA 2Z6KC 2I5MX 2LXKA 2QA4A 2UUCL 4BBSG 3OYYA 4Y7NH 3UDXA 2K52A 4LF5Q 3AEVA 1HH2P 1X54A 4JI1L 5LMUQ 1JJGA 2R92G 1KIXA 3D0FA 2JA5H 1K73C 4OX9Q 1U5KA 3H15A 2K4KA 4JI0L 2JK8A 2Q2IA 1NMFA 5C3EH 1LYLA 4DV2L 4DV4Q 4X6AH 4A3DH 2E5LL 4AYBG 1J5EQ 1PYSB 4KI0A 4R1JA 2CCZA 3BJUA 1SR3A 1D7QA 1Q1BA 2YYZA 2CWAA 1VQAA 1QVGA 3HOVG 3HOZG 5C4JH 4GLAC 4LF4Q 4DR4Q 4LUZA 1VS0A 3F1ZA 2DGYA 3PUXA 1NTGA 1TWHH 4TVAB 2V1CC 2VQEL 1L0WA 1IBKQ 4IPDA 1L2FA 5BR8L 4LF8Q 3TREA 2ZM6L 2PI2E 3FKIG 2E8GA 1VQLA 1JJCB 1OXVA 1XMQQ 1KRSA 1KD1C 4B3RQ 4JV5L 3T1HQ 2UU9Q 1K9MC 4HJ7A 4LFAL 1DGSA 3KF6B 4R4CA 1Q8KA 3RLFA 3G48A 4POFA 5IE8A 5M3MH 3S1RH 2WB1G 2KHJA 4GN3B 4JI3L 1WCMG 3B6YA 4YWKA 1E3PA 3GD7A 1N36Q 2OWOA 1X3EA 1SLJA 4L5TA 3GTPH 4YHHL 3S1QH 3OW2A 3PUWA 2E2JH 3KDFA 2HT1A 2GN5A 3KJPA 2PQAB 4NXML 4GLXA 2JA7H 1S3OA 4JI5L 4X65L 3CCEA 2K5VA 2JE6I 1VQPA 3I4MG 4LFBQ 4A76A 2Q2UA 2UUAL 3W5OA 2VW9A 4LF9L 1SN8A 4IPHA 3ULPA 4JI8L 1E22A 3AQQA 1X56A 4DV1Q 4JYAL 1EUJA 5H1SE 3K8AA 1I94Q 1E24A 4JG2A 3CCUA 4IPCA 4UP8A 4L5QA 3HKZE 3M4QA 5IYDG 3T1YQ 1QVFA 1VQNA 1Y1VG 3WWVA 3GTGH 3JAMi 2JA8H 1PVOA 3J80i 2A8VA 2UUBQ 5IYDH 4A3JG 2BA0A 3STBC 1PH8A 3H3VI 2JQOA 1SE8A 1A0IA 3W1BA 1E1TA 2IT1A 5IP7H 5JJLA 4KLKA 2N49A 3K7UC 4L5RC 1N9WA 4YWMA 3PSIA 3SGIA 1MKHA 3CC2A 3CCLA 2NVTH 2IX0A 1WYDA 1VQIA 3W1GA 1OXXK 5IYCG 3HOXG 4HIMA 1Q86C 4JI2L 4LNQA 2K14A 1X9NA 4ME3A 1IBLQ 2N78A 2AWNA 1YVCA 4EQ5A 3KFUA 4LF7Q 4K0KL 4DR1Q 2KHIA 3UDFA 2VL6A 3KOJA 4DAYB 2Q2TA 2VUMG 4A3CG 3CD6A 4DR7L 4DUYL 5FLMH 2MO0A 1Z9FA 4P71A 2WAQG 1EQRA 3G4SA 4GOPC 2E2IH 4NPSA 1SROA 4B3SQ 5JJKA 4DV7L 4MTNA 4JI7Q 1A62A 3S14H 3CMEA 2JEAI 2L15A 3I55A 4A3MG 4IFDI 2UXBQ 3MXNB 2PNHA 3PV0A 3GTJH 3CCVA 4DR3L 4PZ7A 1I5FA 1YIJA 2F4VQ 4A3CH 4DV5Q 4DV6Q 4JI6Q 5IY0A 1WJJA 4DUZQ 1GM5A 4GNXC 2CWPA 2B63H 3UDIA 3OTOL 4KHPL 3K7AH 1C0AA 4DR2Q 2ALYB 1HNZQ 4B3MQ 4QQBX 5M5YH 5IWAQ 4A3MH 1HZ9A 2H5XA 4DV0L 1AH9A 4A3GG 1L1OC 3ERSX 1W3SA 4RMFA 3HFZB 2YU9H 3PCOB 1K83H 4A3BG 1HNXL 1ASZA 3AYHB 5LMNL 2Q2HA 3A74A 3PO2H 1H95A 4HIOA 1VQ5A 2NN6I 2AKWB 4C2MH 2R6GA 2VS1A 2UXCL 2JA5G 2YTVA 4IFDJ 3RZOH 1Z47A 2BH8A 3G71A 1X55A 2WB1E 5C3EG 4HJAA 4A3LH 4JC0A 1GKHA 3J81i 2R7ZH 4LF6L 4A3BH 1EIYB 3PUZA 4IFDG 4UPAA 1IXRA 2D0OA 3PGZA 4A3IH 1EIFA 3S1MH 1B8AA 1NBWA 1PYBA 3AFPA 5AJ3L 3J7A5 2ASBA 1Q12A 3H0GG 3L2PA 1VQOA 1YJWA 1Q46A 4X64Q 3UE1A 1JMCA 2HIVA 2WFWA 4JI0Q 2PMZE 1RL2A 4LFCQ 1TWGH 1GO3E 4BY7H 5GAGC 4DV2Q 3GTMH 4AQYQ 1UE6A 2E5LQ 5M3MG 1MIUA 2D0PA 1HZAA 2JA9A 3H0GH 2Z6KA 1PH3A 4LF5L 5ELNA 4C3JH 3U4ZA 4QJFA 1YHAA 4C3IH 3F2BA 3CPWA 1OXUA 4HJ9A 2NN6G 3ULJA 4OX9L 2ZTEA 5DLQE 3I4NH 4MNOA 3ULLA 4BA2I 3G6EA 1B70B 1YEZA 5BR8Q 2RF4A 3KDFB 3CCJA 2JA7G 2N8NA 3NENA 1VQEA 3I56A 1X6OA 3JAMc 1JJ2A 4JV5Q 3J80c 1PH1A 1E7ZA 4PZ6A 4LFAQ 2KCMA 4OO1I 1K8GA 4HJ5A 2VY3A 4IO9A 2UXDQ 3UDGA 4YWLA 3S15H 4LF4L 1NJIC 1KXLA 4IOCA 3CC4A 5C4XG 2PI2A 1WI5A 3TEHB 1Q1EA 2BA1A 3HOYH 2I5LX 4YHHQ 4ALPA 2R93H 1PH7A 1K3RA 3BZCA 1BKBA 4PZ8A 3CCMA 1KQSA 1IBKL 4LF8L 4A3DG 1IZ6A 2VNUD 3S2HH 3E0EA 2JA8G 2MQHA 2WAQE 4YCWA 1XMQL 1LUZA 1HR0Q 5GAEC 3PF4A 3T1HL 3TS2A 1KL9A 4DKAC 1TWAH 4LF9Q 5IP7G 4JI8Q 5C4XH 5IP9G 5IYBG 1Q81C 1N36L 2NZOA 1IBML 2HHHQ 2EXDA 3JC66 3K80C 2IHEA 4YCVA 4LWCA 4DK6C 2IHFA 4O0AA 5LMNW 1QZHA 1PV4A 2KBNA 5GQOA 4BY1G 4APVA 3RN2A 5FLXc 3HKSA 4GKKQ 1M90C 2OTJA 1VQBA 3DLLA 3AFQA 4R4IA 5FLMG 1P16A 2HQLA 2K5NA 5IP9H 3BU2A 5IYBH 1VQKA 4DR6L 1G51A 5K36G 1XTDA 4R4QA 4OO1G 4QY7A 4OWWB 1XNRL 3TRZA 4DV3L 2LSSA 4JI2Q 3ER0A 4XIGS 2ZJQA 4BY1H 1PH4A 1HNWQ 3T1YL 1N33L 5M3FH 2JA6H 1LM0A 1IYJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S16 H;  2K75 A;  2ID0 A;  3A5Z B;  4GS3 A;  5M5X H;  2UUB L;  2MFI A;  1PH2 A;  1N32 Q;  1BBW A;  2AHO B;  2KEN A;  4X62 L;  3PO3 H;  3CCR A;  3F2D A;  4DUY Q;  4DR5 Q;  1Y1W H;  2B63 G;  4HID A;  1EQQ A;  2N3S A;  2HIX A;  4NB3 A;  4DNI A;  2MO1 A;  1Q7Y C;  3CPF A;  4DV7 Q;  2QEX A;  4YCU A;  1VQM A;  4UY8 C;  1CKN A;  1YI2 A;  1XMO Q;  3MEF A;  1V43 A;  3F8T A;  1TWF H;  1TWC H;  3Q8D A;  1IBL L;  4B3T Q;  1XPR A;  1GVP A;  3PUV A;  1NMG A;  3J81 c;  4LF7 L;  4DR1 L;  3J81 j;  4C3H H;  3EN2 A;  2DUD A;  3PO2 G;  2GVB A;  2B29 A;  3RLN A;  4YY3 Q;  1FJG Q;  1YBY A;  1VQ6 A;  5J3B A;  2IY5 B;  3CAM A;  3I4O A;  4QL5 A;  4JOI C;  3BZK A;  1NY4 A;  4DPG A;  4KHP Q;  3CF5 A;  1YIT A;  1J6Q A;  4BXX H;  4A3E G;  1W2B A;  4WJ3 M;  4GOP A;  1KAW A;  3VDY A;  2A1A A;  2BH2 A;  4JBM A;  4GN5 A;  2IX1 A;  4A3L G;  1D8L A;  4DV0 Q;  1HJP A;  2R7Z G;  2UXB L;  1SRU A;  1PH9 A;  5IT9 c;  2F4V L;  1WOC A;  4X66 L;  4PMW A;  3D31 A;  4RG1 A;  1HNX Q;  1NE3 A;  4DV5 L;  4A3I G;  4DAM A;  4DV6 L;  2ES2 A;  5LMN Q;  4JI6 L;  4BBR H;  1QUQ A;  3IRB A;  5C44 H;  1X3G A;  1HZB A;  3M85 A;  4NXN Q;  3PF5 A;  1XNQ Q;  2UXC Q;  3EIV A;  4JCV E;  4A3E H;  3A0J A;  2ZJR A;  1VQH A;  1HNZ L;  4B3M L;  4PG3 A;  3K0X A;  4GKJ L;  3CW2 C;  3I7F A;  1QZG A;  3LGJ A;  4BY7 G;  1YNX A;  1N34 Q;  1VQG A;  1N8R C;  1VQ9 A;  1E1O A;  4A75 A;  1A63 A;  1GD7 A;  3ZJY C;  2VQF Q;  4LF6 Q;  4JI4 Q;  1R9T H;  2UUC Q;  1L1O A;  4LUO A;  4OWX B;  3KYH C;  5C0X I;  2F3I A;  2B3G A;  1XJV A;  1CKO A;  4JI1 Q;  3U4V A;  1YJ9 A;  4WJ4 A;  4TQU S;  4A3F G;  2K50 A;  3I4N G;  4HJ8 A;  1JT8 A;  2RHS B;  1JE5 A;  4R4O A;  2NZH A;  4A3K H;  4IOA A;  2Z0S A;  4A93 H;  2C35 B;  2CFM A;  1AE2 A;  1YHQ A;  3HOU G;  1FGU A;  5JJI A;  1PH5 A;  1EFW A;  3CXC A;  4POG A;  3FP9 A;  3M9B A;  3U50 C;  5LMU L;  4A3F H;  2WP8 J;  2JJQ A;  5FJ8 H;  2CKZ B;  1M1K C;  2VQE Q;  4BA1 I;  4J15 A;  4X64 L;  3HOY G;  2F52 A;  2R93 G;  1I50 H;  3S2D H;  5GRO A;  1X65 A;  2ZM6 Q;  3PUY A;  4LFC L;  5C0X J;  5M5W H;  3PIP A;  1UE5 A;  4DV4 L;  1YJN A;  3HOU H;  4IJL A;  1J5E L;  1YZ6 A;  2OCE A;  2MNA A;  4AQY L;  1CSP A;  1KC8 C;  2FXQ A;  2NVX H;  1U0L A;  4GN4 B;  4JI3 Q;  4BBS H;  3CCS A;  4DR4 L;  1S72 A;  2ZTC A;  2GVA A;  1XPO A;  2R92 H;  5C0X G;  4OON A;  3PIO A;  1WFQ A;  5HY6 A;  2RHQ B;  1MJC A;  3E9H A;  2AWO A;  1AE3 A;  1BBU A;  4IJH A;  2Y0S G;  3J7Z C;  3TQY A;  4LW1 A;  4NXM Q;  4JI5 Q;  3ICE A;  4X65 Q;  4B3R L;  1VQD A;  1OXS C;  3STB D;  1CSQ A;  2VZA A;  2UU9 L;  3CC7 A;  1B7Y B;  2A19 A;  3GO5 A;  2UUA Q;  5HGQ A;  1PA6 A;  3U58 A;  3RZD H;  4LUV A;  3HOV H;  3HOZ H;  2EIF A;  2UXD L;  4JYA Q;  1IBM Q;  4XTC S;  3F2C A;  4DK3 C;  3NEL A;  1Q82 C;  4P74 A;  1P8L A;  1SMX A;  5GAD C;  3NBH B;  4H02 A;  3M4O H;  1VCI A;  3FKI H;  5M3F G;  2JA6 G;  1PFS A;  1CUK A;  3I2Z A;  3KF6 A;  1HR0 L;  1VQJ A;  4HIK A;  4LFB L;  1EWI A;  2QGQ A;  4AIM A;  1CKM A;  3RLO A;  3PO3 G;  1VQ7 A;  1WCM H;  4DR6 Q;  3L7Z C;  3S17 H;  1Y1W G;  1PH6 A;  4DV1 L;  1VQF A;  3NEM A;  1G29 1;  4QIW E;  1I94 L;  2HHH L;  4K0K Q;  2D62 A;  1VQ8 A;  1TXY A;  1X3F A;  2PQA A;  2JEB I;  4QGU A;  1K8A C;  2LXJ A;  2YV5 A;  4DV3 Q;  2I5H A;  1XNR Q;  4P75 A;  5E7N A;  4EX5 A;  3KF8 B;  1N33 Q;  3CCQ A;  1CKN B;  4UP9 A;  3GTL H;  4GKK L;  2XGT A;  3KLW A;  4P72 A;  1JB7 A;  3I4M H;  1YHB A;  2OQK A;  4DR7 Q;  1T9H A;  1O7I A;  4X62 Q;  3CP0 A;  2E2H H;  2ZTD A;  1ASY A;  1VQC A;  3RR5 A;  4BXX G;  1A8V A;  2K5H A;  3L0O A;  4AH6 A;  1SFO H;  3HOW G;  3FHW A;  2OQ0 A;  1HNW L;  4MZ9 A;  3GDE A;  1Y1V H;  4GOP B;  1VQ4 A;  1LTL A;  4DR3 Q;  1QVC A;  5ELO A;  3UE0 A;  4A3J H;  1OXT A;  1UE7 A;  4GLV B;  1I6H H;  1N32 L;  3GTK H;  4BBR G;  5JEA J;  3K81 C;  1V1Q A;  2AMC B;  3EBE A;  5C44 G;  4L5S A;  4DR5 L;  1KHI A;  1QUQ B;  3OTO Q;  4B3S L;  4GNX B;  3HOW H;  5IYC H;  3HOX H;  4JI7 L;  3A5U A;  4OWT B;  2EQS A;  1EYG A;  3TS0 A;  4JBJ A;  5JEA G;  1XMO L;  1OTC A;  3S24 A;  3CMA A;  4B3T L;  1UE1 A;  1RIP A;  2CQO A;  3E9I A;  4FDB A;  2R7F A;  4UP7 A;  1PHJ A;  4X66 Q;  2VUM H;  4DUZ L;  1MJE A;  3S1N H;  3RN5 A;  3HKZ G;  1L1O B;  1BVS A;  4Y52 H;  4OXP A;  5GAH C;  4YY3 L;  3DM3 A;  4GNX A;  1FJG L;  4A4I A;  1UWV A;  4JBW A;  2I0Q A;  1Y14 B;  4DR2 L;  3RNU A;  5IWA L;  3CQZ H;  1HZC A;  2YTX A;  4AYB E;  2NVQ H;  4JOI A;  1C7Y A;  4GKJ Q;  1XPU A;  2RCN A;  4A3K G;  4A93 G;  1EOV A;  3M4P A;  2YTY A;  1UEB A;  1FL0 A;  2OTL A;  5AJ3 Q;  2ZJP A;  2Y0S E;  3H3V H;  2R7D A;  5EAY A;  1FVI A;  1KRT A;  1IL2 A;  5FJ8 G;  2KCT A;  2XTI A;  4KHZ A;  4NXN L;  1HR0 W;  4IPG A;  1XNQ L;  3GTO H;  4R4T A;  3M3Y H;  1G6P A;  1K0R A;  2ATW A;  4O2D A;  2NVY H;  3M7N A;  1I3Q H;  3GTQ H;  4P73 A;  1N34 L;  4A3G H;  3KJO A;  1S40 A;  2VQF L;  1C9O A;  4JBK A;  4JI4 L;  1V9P A;  2Z6K C;  2I5M X;  2LXK A;  2QA4 A;  2UUC L;  4BBS G;  3OYY A;  4Y7N H;  3UDX A;  2K52 A;  4LF5 Q;  3AEV A;  1HH2 P;  1X54 A;  4JI1 L;  5LMU Q;  1JJG A;  2R92 G;  1KIX A;  3D0F A;  2JA5 H;  1K73 C;  4OX9 Q;  1U5K A;  3H15 A;  2K4K A;  4JI0 L;  2JK8 A;  2Q2I A;  1NMF A;  5C3E H;  1LYL A;  4DV2 L;  4DV4 Q;  4X6A H;  4A3D H;  2E5L L;  4AYB G;  1J5E Q;  1PYS B;  4KI0 A;  4R1J A;  2CCZ A;  3BJU A;  1SR3 A;  1D7Q A;  1Q1B A;  2YYZ A;  2CWA A;  1VQA A;  1QVG A;  3HOV G;  3HOZ G;  5C4J H;  4GLA C;  4LF4 Q;  4DR4 Q;  4LUZ A;  1VS0 A;  3F1Z A;  2DGY A;  3PUX A;  1NTG A;  1TWH H;  4TVA B;  2V1C C;  2VQE L;  1L0W A;  1IBK Q;  4IPD A;  1L2F A;  5BR8 L;  4LF8 Q;  3TRE A;  2ZM6 L;  2PI2 E;  3FKI G;  2E8G A;  1VQL A;  1JJC B;  1OXV A;  1XMQ Q;  1KRS A;  1KD1 C;  4B3R Q;  4JV5 L;  3T1H Q;  2UU9 Q;  1K9M C;  4HJ7 A;  4LFA L;  1DGS A;  3KF6 B;  4R4C A;  1Q8K A;  3RLF A;  3G48 A;  4POF A;  5IE8 A;  5M3M H;  3S1R H;  2WB1 G;  2KHJ A;  4GN3 B;  4JI3 L;  1WCM G;  3B6Y A;  4YWK A;  1E3P A;  3GD7 A;  1N36 Q;  2OWO A;  1X3E A;  1SLJ A;  4L5T A;  3GTP H;  4YHH L;  3S1Q H;  3OW2 A;  3PUW A;  2E2J H;  3KDF A;  2HT1 A;  2GN5 A;  3KJP A;  2PQA B;  4NXM L;  4GLX A;  2JA7 H;  1S3O A;  4JI5 L;  4X65 L;  3CCE A;  2K5V A;  2JE6 I;  1VQP A;  3I4M G;  4LFB Q;  4A76 A;  2Q2U A;  2UUA L;  3W5O A;  2VW9 A;  4LF9 L;  1SN8 A;  4IPH A;  3ULP A;  4JI8 L;  1E22 A;  3AQQ A;  1X56 A;  4DV1 Q;  4JYA L;  1EUJ A;  5H1S E;  3K8A A;  1I94 Q;  1E24 A;  4JG2 A;  3CCU A;  4IPC A;  4UP8 A;  4L5Q A;  3HKZ E;  3M4Q A;  5IYD G;  3T1Y Q;  1QVF A;  1VQN A;  1Y1V G;  3WWV A;  3GTG H;  3JAM i;  2JA8 H;  1PVO A;  3J80 i;  2A8V A;  2UUB Q;  5IYD H;  4A3J G;  2BA0 A;  3STB C;  1PH8 A;  3H3V I;  2JQO A;  1SE8 A;  1A0I A;  3W1B A;  1E1T A;  2IT1 A;  5IP7 H;  5JJL A;  4KLK A;  2N49 A;  3K7U C;  4L5R C;  1N9W A;  4YWM A;  3PSI A;  3SGI A;  1MKH A;  3CC2 A;  3CCL A;  2NVT H;  2IX0 A;  1WYD A;  1VQI A;  3W1G A;  1OXX K;  5IYC G;  3HOX G;  4HIM A;  1Q86 C;  4JI2 L;  4LNQ A;  2K14 A;  1X9N A;  4ME3 A;  1IBL Q;  2N78 A;  2AWN A;  1YVC A;  4EQ5 A;  3KFU A;  4LF7 Q;  4K0K L;  4DR1 Q;  2KHI A;  3UDF A;  2VL6 A;  3KOJ A;  4DAY B;  2Q2T A;  2VUM G;  4A3C G;  3CD6 A;  4DR7 L;  4DUY L;  5FLM H;  2MO0 A;  1Z9F A;  4P71 A;  2WAQ G;  1EQR A;  3G4S A;  4GOP C;  2E2I H;  4NPS A;  1SRO A;  4B3S Q;  5JJK A;  4DV7 L;  4MTN A;  4JI7 Q;  1A62 A;  3S14 H;  3CME A;  2JEA I;  2L15 A;  3I55 A;  4A3M G;  4IFD I;  2UXB Q;  3MXN B;  2PNH A;  3PV0 A;  3GTJ H;  3CCV A;  4DR3 L;  4PZ7 A;  1I5F A;  1YIJ A;  2F4V Q;  4A3C H;  4DV5 Q;  4DV6 Q;  4JI6 Q;  5IY0 A;  1WJJ A;  4DUZ Q;  1GM5 A;  4GNX C;  2CWP A;  2B63 H;  3UDI A;  3OTO L;  4KHP L;  3K7A H;  1C0A A;  4DR2 Q;  2ALY B;  1HNZ Q;  4B3M Q;  4QQB X;  5M5Y H;  5IWA Q;  4A3M H;  1HZ9 A;  2H5X A;  4DV0 L;  1AH9 A;  4A3G G;  1L1O C;  3ERS X;  1W3S A;  4RMF A;  3HFZ B;  2YU9 H;  3PCO B;  1K83 H;  4A3B G;  1HNX L;  1ASZ A;  3AYH B;  5LMN L;  2Q2H A;  3A74 A;  3PO2 H;  1H95 A;  4HIO A;  1VQ5 A;  2NN6 I;  2AKW B;  4C2M H;  2R6G A;  2VS1 A;  2UXC L;  2JA5 G;  2YTV A;  4IFD J;  3RZO H;  1Z47 A;  2BH8 A;  3G71 A;  1X55 A;  2WB1 E;  5C3E G;  4HJA A;  4A3L H;  4JC0 A;  1GKH A;  3J81 i;  2R7Z H;  4LF6 L;  4A3B H;  1EIY B;  3PUZ A;  4IFD G;  4UPA A;  1IXR A;  2D0O A;  3PGZ A;  4A3I H;  1EIF A;  3S1M H;  1B8A A;  1NBW A;  1PYB A;  3AFP A;  5AJ3 L;  3J7A 5;  2ASB A;  1Q12 A;  3H0G G;  3L2P A;  1VQO A;  1YJW A;  1Q46 A;  4X64 Q;  3UE1 A;  1JMC A;  2HIV A;  2WFW A;  4JI0 Q;  2PMZ E;  1RL2 A;  4LFC Q;  1TWG H;  1GO3 E;  4BY7 H;  5GAG C;  4DV2 Q;  3GTM H;  4AQY Q;  1UE6 A;  2E5L Q;  5M3M G;  1MIU A;  2D0P A;  1HZA A;  2JA9 A;  3H0G H;  2Z6K A;  1PH3 A;  4LF5 L;  5ELN A;  4C3J H;  3U4Z A;  4QJF A;  1YHA A;  4C3I H;  3F2B A;  3CPW A;  1OXU A;  4HJ9 A;  2NN6 G;  3ULJ A;  4OX9 L;  2ZTE A;  5DLQ E;  3I4N H;  4MNO A;  3ULL A;  4BA2 I;  3G6E A;  1B70 B;  1YEZ A;  5BR8 Q;  2RF4 A;  3KDF B;  3CCJ A;  2JA7 G;  2N8N A;  3NEN A;  1VQE A;  3I56 A;  1X6O A;  3JAM c;  1JJ2 A;  4JV5 Q;  3J80 c;  1PH1 A;  1E7Z A;  4PZ6 A;  4LFA Q;  2KCM A;  4OO1 I;  1K8G A;  4HJ5 A;  2VY3 A;  4IO9 A;  2UXD Q;  3UDG A;  4YWL A;  3S15 H;  4LF4 L;  1NJI C;  1KXL A;  4IOC A;  3CC4 A;  5C4X G;  2PI2 A;  1WI5 A;  3TEH B;  1Q1E A;  2BA1 A;  3HOY H;  2I5L X;  4YHH Q;  4ALP A;  2R93 H;  1PH7 A;  1K3R A;  3BZC A;  1BKB A;  4PZ8 A;  3CCM A;  1KQS A;  1IBK L;  4LF8 L;  4A3D G;  1IZ6 A;  2VNU D;  3S2H H;  3E0E A;  2JA8 G;  2MQH A;  2WAQ E;  4YCW A;  1XMQ L;  1LUZ A;  1HR0 Q;  5GAE C;  3PF4 A;  3T1H L;  3TS2 A;  1KL9 A;  4DKA C;  1TWA H;  4LF9 Q;  5IP7 G;  4JI8 Q;  5C4X H;  5IP9 G;  5IYB G;  1Q81 C;  1N36 L;  2NZO A;  1IBM L;  2HHH Q;  2EXD A;  3JC6 6;  3K80 C;  2IHE A;  4YCV A;  4LWC A;  4DK6 C;  2IHF A;  4O0A A;  5LMN W;  1QZH A;  1PV4 A;  2KBN A;  5GQO A;  4BY1 G;  4APV A;  3RN2 A;  5FLX c;  3HKS A;  4GKK Q;  1M90 C;  2OTJ A;  1VQB A;  3DLL A;  3AFQ A;  4R4I A;  5FLM G;  1P16 A;  2HQL A;  2K5N A;  5IP9 H;  3BU2 A;  5IYB H;  1VQK A;  4DR6 L;  1G51 A;  5K36 G;  1XTD A;  4R4Q A;  4OO1 G;  4QY7 A;  4OWW B;  1XNR L;  3TRZ A;  4DV3 L;  2LSS A;  4JI2 Q;  3ER0 A;  4XIG S;  2ZJQ A;  4BY1 H;  1PH4 A;  1HNW Q;  3T1Y L;  1N33 L;  5M3F H;  2JA6 H;  1LM0 A;  1IYJ B; 
#chains in the Genus database with same CATH topology
 3S16 H;  2K75 A;  2UUB L;  3A5Z B;  2WIN B;  3H6M A;  2B63 G;  2O5I C;  5E3F A;  3DXJ C;  3T53 B;  2HIX A;  2WKC A;  1GXD C;  3CPF A;  1EL0 A;  2QEX A;  4G57 A;  4UY8 C;  1CKN A;  1YI2 A;  3MEF A;  1EEF D;  4B3T Q;  1GVP A;  1NMG A;  1WTH A;  5J39 A;  3EN2 A;  3J81 L;  4YY3 Q;  2RDH A;  1FJG Q;  1PTO C;  2IY5 B;  3CAM A;  4AYB B;  1NNX A;  5EPJ A;  4DPG A;  1B3Q A;  3H91 A;  4KHP Q;  1ILQ A;  3HOZ B;  4JBM A;  4A3L G;  1HJP A;  4HN7 A;  5TSS A;  3D31 A;  4HSP A;  4A3I G;  4DV5 L;  4DV6 L;  3FKI B;  5HUR A;  4NXN Q;  2UXC Q;  1KNE A;  4PNY A;  4DU9 A;  2A69 D;  3K0X A;  3I7F A;  4RCO A;  1QZG A;  1ML0 D;  1VQG A;  5K5P A;  1PTO F;  1SE2 A;  1O7L A;  1SYB A;  2XN9 C;  4JI4 Q;  4JI1 Q;  1H9R A;  3U4V A;  4RHR A;  1DCZ A;  5CV8 A;  2K33 A;  5EPL A;  3W3A A;  1JT8 A;  1JE5 A;  2RHS B;  3BYY B;  4R4O A;  5COY A;  2NZH A;  4A3K H;  4IOA A;  4A93 H;  1ZYR D;  5IGG A;  5JJI A;  1GUT A;  1PH5 A;  1GHJ A;  4POG A;  4DFA A;  5FJ8 H;  2FJ2 A;  5JVH 3;  2VQE Q;  1I6H B;  5GRO A;  1BF4 A;  2G9D A;  3U9S A;  3SEB A;  1GUN A;  3G6J B;  1UE5 A;  5COR A;  1YJN A;  2MNA A;  2OCE A;  4Q5V A;  5CV9 A;  3CCS A;  2B8F A;  2F0K A;  2GVA A;  1KAB A;  5C0X G;  3PIO A;  1B3A A;  1MJC A;  3DUZ A;  2AWO A;  5IGE A;  4R9W A;  4KK7 A;  3J7Z C;  3TQY A;  2M2L A;  3ICE A;  4JI5 Q;  1OXS C;  1TKW B;  3STB D;  4ABN A;  1CT1 D;  2A19 A;  3GO5 A;  1G2S A;  1PA6 A;  3VYU A;  4LUV A;  3HOZ H;  4A3M B;  3PMF A;  4RH6 A;  1EYA A;  4KTA A;  4JYA Q;  4DK3 C;  4PMB A;  1SMX A;  4H02 A;  1VCI A;  2WII B;  3FKI H;  1SJE D;  3OSO A;  1BNZ A;  3I2Z A;  4UAI A;  1VQJ A;  1PFN A;  3C1E A;  3C46 A;  1ZEQ X;  1VMC A;  1CKM A;  1SND A;  3PO3 G;  2NVY B;  3R2T A;  1VQ7 A;  4DR6 Q;  1Y1W G;  3MTS A;  2L4N A;  1TR5 A;  1CI3 M;  3NEM A;  1G29 1;  4K0K Q;  4XQJ A;  4K6L A;  1TXY A;  4QGU A;  1XNR Q;  4DV3 Q;  1EWH A;  2I5H A;  3C2P A;  4EX5 A;  1IL8 A;  5I6Y A;  1N33 Q;  4UP9 A;  3KLS X;  4DK0 A;  1JB3 A;  3NTH A;  4KJN A;  3KLW A;  1PRT C;  4C3H G;  4KKU A;  1T9H A;  1O7I A;  5C3E B;  2QKI C;  3CP0 A;  3HG9 A;  1G2T A;  1RF2 D;  3CHB D;  5A35 A;  4BXX G;  2PZT A;  5C4Z A;  5D14 A;  1U4R A;  5ELO A;  3SK5 A;  1OXT A;  4CJ2 C;  1WTQ A;  1I6H H;  2B2U A;  3EFX D;  1NCV A;  5C44 G;  3K58 A;  1U4M A;  1IKL A;  4K5V A;  3A5U A;  4OWT B;  1LT3 D;  1EYG A;  3TS0 A;  4JBJ A;  3S15 B;  1UE1 A;  3E9I A;  5EKK A;  5C3W A;  1PHJ A;  4X66 Q;  4DUZ L;  1L1O B;  3D6C A;  5T1G A;  3DM3 A;  1F2L A;  1VDZ A;  2B2W C;  3SVM A;  2CHB D;  3RNU A;  1R4Q B;  2BE5 D;  1HZC A;  1E0B A;  4CBV A;  3QB3 A;  4OHJ A;  3MXN A;  3DWA A;  1QOH A;  1FD7 D;  3M4P A;  2YTY A;  5IOD A;  1NR4 A;  1XYI A;  3WOF A;  5JPM C;  5EAY A;  1IL2 A;  2AQ1 B;  2EZV A;  3D8G A;  2K03 A;  1F9Q A;  1HR0 W;  4R4T A;  1S5C D;  2ATW A;  1QNU A;  4TKO B;  2A6H D;  2NVY H;  3KJO A;  2NVT B;  1K0S A;  4JBK A;  2QA4 A;  5E4X A;  5T1I A;  2RSN A;  2DNC A;  2K52 A;  2QDL A;  5LMU Q;  3MC0 B;  4K2L A;  1STE A;  1F9P A;  3I3C A;  2R61 A;  1GHK A;  4K8J A;  3Q6S A;  5E4W C;  1RCV D;  5C3E H;  2XRQ D;  3VR3 A;  2NTT A;  2Q8I B;  2F0O A;  2H1E A;  2E5L L;  3Q22 A;  2RDG A;  4KI0 A;  3BZD B;  1Q1B A;  4I65 A;  1VQA A;  3HOV G;  3S14 B;  4LUZ A;  1VS0 A;  3JAM E;  3I90 A;  3J80 E;  1U9R A;  5BR8 L;  1KLU D;  4DA2 A;  1ILP A;  1OXV A;  1XMQ Q;  3BVM A;  2L0C A;  1ZYR C;  3RLF A;  4X3U A;  5M5Y B;  5I9O A;  1ONL A;  1QG7 A;  2E75 C;  1WCM G;  2F0D A;  5A2Q L;  1WTV A;  2DJF C;  4QCL A;  1K83 B;  1D5M C;  1EY7 A;  1PFB A;  3CU7 A;  3O13 A;  3D6W A;  5E1F A;  2GN5 A;  3KJP A;  4C2M B;  2PQA B;  1S3O A;  4BS9 A;  3SK4 A;  4DAP A;  1EYC A;  1SE3 A;  4LF9 L;  2R7Z B;  4A3B B;  1X3P A;  1X56 A;  5H1S E;  3HGB A;  4IUR A;  1E24 A;  1D5Z C;  4IPC A;  1QVF A;  1VQN A;  3OHX C;  3JAM i;  3J80 i;  5BN3 A;  2UUB Q;  4A3J G;  3STB C;  2B2V A;  2EJG C;  2JQO A;  4BY7 B;  5JJL A;  3ONA B;  2KJX A;  5CYU A;  4L5R C;  2NVT H;  1MKH A;  3DWQ A;  3HOX G;  1OXX K;  4LNQ A;  1HHV A;  1X9N A;  2AWN A;  3BDO A;  3UDF A;  2VUM G;  1D2B A;  3CD6 A;  4DR7 L;  1I4P A;  4RHS A;  4ZKC B;  1ENA A;  2WAQ G;  4ZQ3 A;  2RA4 A;  1EQR A;  3MHB A;  4FXK C;  3G4S A;  3J81 E;  4GOP C;  1A6X A;  1M8A A;  4MTN A;  4JI7 Q;  5KEE A;  3S14 H;  3BS1 A;  1HFG A;  2L15 A;  3I55 A;  4NDX A;  4WRD A;  1WVL A;  2R93 B;  1I5F A;  1MSG A;  1O80 A;  4DV5 Q;  4DV6 Q;  5IY0 A;  1GM5 A;  4GNX C;  3A8J E;  2CWP A;  4KKS A;  4R8N A;  4KHP L;  3OW7 A;  1TWA B;  5M5Y H;  4JK1 C;  2KEC A;  1XXG A;  1B2T A;  1AZQ A;  4RMF A;  2E74 C;  1K83 H;  2AUK A;  4A3B G;  3MZ5 A;  1H95 A;  2Y0S B;  2NN6 I;  4C2M H;  2UXC L;  2HDM A;  2MPM A;  2B2W A;  2B39 A;  1PXU A;  4EQN A;  2EJF C;  2WB1 E;  4HJA A;  4JC0 A;  2R7Z H;  3J81 i;  4A3B H;  1EIY B;  2F0P A;  1JOQ A;  2L5T A;  1BR9 A;  1IXR A;  1EIF A;  1PYB A;  1NBW A;  3NQI A;  3L2P A;  5M5X B;  1YJW A;  2RBM A;  2H4O A;  1JMC A;  4JI0 Q;  2BE5 C;  2M9V A;  1S4Z A;  4BY7 H;  4DV2 Q;  1HPC A;  5LL6 X;  5M3M G;  1EY0 A;  4G7H C;  2JA9 A;  3NPP A;  2SNM A;  1PH3 A;  4LF5 L;  5C5L A;  1TWC B;  3U4Z A;  4XQN A;  1CZG A;  3OIQ A;  1EOT A;  4B9X A;  3H94 A;  4MNO A;  1YEZ A;  4Q0F A;  2RF4 A;  3CCJ A;  1ET6 A;  2A6H C;  4ZKB B;  2EPB A;  1BO0 A;  2XNA C;  3SDZ A;  4LFA Q;  1O7Y A;  1LTS D;  4CDF C;  1K8G A;  3WDN A;  5CV7 A;  1GJX A;  4IOC A;  2PI2 A;  1A3U A;  2F0G A;  2R93 H;  1K3R A;  1BKB A;  3CCM A;  1ESF A;  4A3D G;  3S1N B;  1IZ6 A;  5FO8 B;  1DJR D;  3E0E A;  1MGS A;  1EQV A;  3NXW A;  5GAE C;  4CHT B;  1TWA H;  4QUF A;  1EZ6 A;  1N36 L;  1Q81 C;  3WOE A;  5C6A A;  1TS3 A;  1EQT A;  4LWC A;  1F9R A;  2KBN A;  1Y8O B;  2BCO A;  4KY6 A;  3RN2 A;  1JOO A;  1SYC A;  3HKS A;  5CV4 A;  4U68 A;  2F0H A;  4MN3 A;  3DLL A;  3AFQ A;  4R4I A;  4DR6 L;  4KN7 C;  2IL8 A;  3DEO A;  1W6J A;  1XTD A;  4OO1 G;  3A54 A;  3E3X A;  4JW0 A;  1XNR L;  1Q3L A;  3TRZ A;  4DV3 L;  4JI2 Q;  1B4O A;  3T1Y L;  1N33 L;  4WJ4 A;  3J7A F;  4H44 C;  2NYZ D;  5M5X H;  2CQA A;  4IUT A;  1H9M A;  1H9S A;  2KEN A;  3IL8 A;  2G5D A;  3CCR A;  3F2D A;  5ELC A;  1SYG A;  5M5W B;  3HOU B;  5KIX A;  3FVQ A;  1EQQ A;  4DNI A;  1E2W A;  2MO1 A;  4BBS B;  3KF8 A;  4E6I A;  4HED A;  2RCF A;  3F8T A;  3Q8D A;  1TWC H;  3A7L A;  3M7N A;  4H13 C;  1I4G A;  3NUC A;  1SE4 A;  4GZY C;  3PO2 G;  2GVB A;  1FNV A;  2HCI A;  2L1B A;  4RCN A;  2SOB A;  3I4O A;  4QL5 A;  1NY4 A;  1J6Q A;  1SNC A;  3VR2 A;  3RZD B;  4GOP A;  1KAW A;  1QNK A;  5ELB A;  4GN5 A;  1D8L A;  4DV0 Q;  5IGF A;  1SRU A;  1PH9 A;  5IT9 c;  1WOC A;  4X66 L;  3E6Z X;  4RG1 A;  3M4O B;  5EBC A;  2X6L A;  1QUQ A;  4ODG A;  2CW0 C;  3EIV A;  4JCV E;  1VQH A;  4CDC C;  2WAC A;  1O78 A;  1HNZ L;  4B3M L;  2EY1 A;  1G8Z D;  1B9M A;  3CW2 C;  3LGJ A;  1AP0 A;  1N8R C;  2BDO A;  5JEA H;  4A75 A;  1VQ9 A;  3ZJY C;  4LF6 Q;  4LUO A;  3R93 A;  1I4Q A;  5C0X I;  1XJV A;  1WD0 A;  2Z9H A;  4Z9C B;  2C9O A;  4C3I G;  3SR1 A;  3I4N G;  5I2Y A;  1TY2 A;  2E2H B;  4J8Q A;  3HOU G;  2F0J A;  2EYM A;  2F0W A;  1Y1V B;  3CRK C;  3M9B A;  5LMU L;  4N8X 1;  2WP8 J;  4FXG C;  1M1K C;  2DJG C;  4DN4 M;  4BA1 I;  1LTT D;  2X69 A;  4P2C B;  1X65 A;  2KUM A;  3PUY A;  4LFC L;  5C0X J;  5M5W H;  3PIP A;  3HOU H;  3R2I A;  3HOW B;  1KC8 C;  2FXQ A;  4BBS H;  1U0L A;  4GN4 B;  3KK7 A;  1TT2 A;  1HCZ A;  2D5D A;  1S72 A;  2ZTC A;  5A2Q E;  4N8F A;  3E9H A;  1S5E D;  1SEB D;  1PRT D;  4OEL B;  2VZA A;  4ME5 A;  4RGM A;  2NVQ B;  3U58 A;  3RZD H;  1B44 D;  5JVG 3;  2EIF A;  2UXD L;  1FNW A;  1GUG A;  1CHP D;  4XTC S;  3G7L A;  1Q82 C;  4P74 A;  3M4O H;  5GAD C;  3NBH B;  3Q24 A;  1PFS A;  1PFM A;  1SNO A;  3SK8 A;  4HIK A;  1EWI A;  2QGQ A;  4AIM A;  1QE6 A;  3RLO A;  3TP8 A;  3GTQ B;  1PH6 A;  1Z7T A;  1VQF A;  2PPB C;  2HHH L;  4ZUI A;  1VQ8 A;  4RFB A;  4Y7N B;  1X3F A;  2JEB I;  4HCS A;  2YV5 A;  1SMY C;  2JA5 B;  1CKN B;  2O5J C;  2Z4I A;  4LAA A;  2XGT A;  3URY A;  2OQK A;  3K5N A;  4DR7 Q;  4X62 Q;  4LJZ C;  5IGC A;  1HA5 A;  2E2H H;  4QB4 A;  4I7A A;  5J22 A;  1RKN A;  1A8V A;  3L0O A;  4AH6 A;  3N6R A;  1EU3 A;  3HOW G;  2OQ0 A;  5BN5 A;  1HNW L;  3GDE A;  1Y1V H;  1VQ4 A;  1LTR D;  1A2U A;  1QVC A;  4L5S A;  3EBE A;  3QIA A;  3OWF A;  3NK9 A;  3OOC A;  4ZYS A;  1H9J A;  1STA A;  3BVZ A;  4JI7 L;  3HOW H;  2EY6 A;  1XMO L;  2A73 B;  5KNB A;  1EU4 A;  1OTC A;  3S1Q B;  2R7F A;  2NB0 A;  1WD1 A;  3HKZ G;  4I7Z C;  1BVS A;  5GAH C;  2LS0 1;  4A4I A;  4JBW A;  5BN4 A;  4AYB E;  2NVQ H;  3D4R A;  1DOL A;  1C7Y A;  1XPU A;  2RCN A;  4A3K G;  4A93 G;  1IHZ A;  4ID6 A;  1UEB A;  2OTL A;  3GTG B;  1PYW D;  2ZJP A;  1LT4 D;  2JA8 B;  2R7D A;  4ZK9 B;  1FVI A;  3T16 A;  5FJ8 G;  2KCT A;  4KKT A;  1BBX C;  2PMZ B;  1G6P A;  4IPG A;  3E5S A;  4O2D A;  1VF7 A;  3GTQ H;  3I72 A;  1C9O A;  1QJO A;  1V9P A;  2UUC L;  3OYY A;  4XYQ A;  4Y7N H;  4LF5 Q;  4ZAI A;  5LL6 S;  2JA5 H;  3C3L A;  3H15 A;  4JI0 L;  1Y8P B;  5ELF A;  2Q2I A;  1NMF A;  1UUP A;  4DV2 L;  1LYL A;  4DV4 Q;  1K8O A;  2E2I B;  3QJY A;  4AYB G;  2NBF A;  1SR3 A;  4IFD H;  2YYZ A;  3HOZ G;  2F0Q A;  4DR4 Q;  2QF7 A;  1QWY A;  4RA8 A;  1V1P A;  2DGY A;  1NTG A;  1VMP A;  5FK9 C;  2FHT A;  2ZM6 L;  1LTB D;  3FKI G;  4HCE A;  1VQL A;  4KY7 A;  2UU9 Q;  4OIJ A;  1K9M C;  1LAB A;  2WV6 D;  1DGS A;  5IE8 A;  4POF A;  4LFA L;  2ICE C;  4GN3 B;  1E3P A;  1N36 Q;  1BCP D;  1RHP A;  1SLJ A;  3S1Q H;  3OW2 A;  3KDF A;  4CKB A;  3NWS A;  4NXM L;  3CKI B;  4X65 L;  3CCE A;  2JE6 I;  2L55 A;  3RZO B;  1DOM A;  2Q8T A;  4LFB Q;  3GV3 A;  2UUA L;  1SSO A;  2JP1 A;  3IFD A;  5DNF A;  3IKJ A;  1E22 A;  3AQQ A;  5KNC A;  3NHH A;  3H3V C;  4RKB A;  4DV1 Q;  1I94 Q;  1CA6 A;  1R9T B;  3CCU A;  5IYD G;  4L5Q A;  3M4Q A;  3T1Y Q;  3GTG H;  3WWV A;  2JA8 H;  2A68 D;  5C3X A;  1YNN D;  1TS5 A;  3H3V I;  1C48 A;  4MHE A;  3W1B A;  1E1T A;  2IT1 A;  5D65 A;  5IP7 H;  3J7Y W;  4PV1 C;  2DY8 A;  4CKC A;  3P75 A;  2N49 A;  3K7U C;  3OPO A;  3CCL A;  2Z1C A;  3PSI A;  4YWM A;  1LTI D;  5IYD H;  1VQI A;  2Z4H A;  1SJH D;  4JI2 L;  5M9O A;  4C3J B;  4CDD C;  3L3O C;  2VL6 A;  2Q2T A;  5DM7 3;  5K36 H;  5KYL A;  2E2I H;  1PRT F;  2Q8R E;  1PTO B;  3CME A;  1PLF A;  4A3M G;  3MXN B;  1YIJ A;  1NSN S;  3HOY B;  5KND A;  3S2H B;  4B9W A;  2EYP A;  4CJ1 B;  1WTX A;  1S5D D;  3NBI A;  3MXP A;  4NKL A;  1KDC A;  2K5D A;  3K59 A;  2K1B A;  1HNZ Q;  4B3M Q;  5IWA Q;  4QQB X;  2F4I A;  4A3M H;  4DV0 L;  1UAP A;  2EE1 A;  2XRS D;  3K5O A;  3HFZ B;  3Q0A A;  4RGO S;  3VA7 A;  1STG A;  2F0M A;  2M00 A;  5IT9 L;  4LMQ D;  5CMD A;  3H09 A;  1CQV A;  1LO5 D;  3RZO H;  4CKE A;  1Z47 A;  3ND8 A;  1DM0 B;  3DWP A;  1IKM A;  1X55 A;  5JAV A;  5C3E G;  1D1I A;  1KLG D;  1WTP A;  4LF6 L;  4BY1 B;  5M3F B;  2JA6 B;  3AFP A;  3J7A 5;  1EY4 A;  1VQO A;  2PNR C;  2XWB B;  2OEO A;  2HIV A;  5ELE A;  1A3V A;  1JQY D;  1HTL D;  1HQR D;  4IUN A;  3VYR A;  4LFC Q;  4X3K A;  1MIU A;  2D0P A;  1HZA A;  3M7G A;  3KLR A;  1TWF B;  4C3J H;  4QJF A;  2KED A;  5NUC A;  4HJ9 A;  4OX9 L;  2C5C A;  4BA2 I;  1B70 B;  4JVZ A;  3A8K E;  2N8N A;  1VQE A;  3LWE A;  4FXD A;  2XIW A;  3JAM c;  3TZD A;  1JJ2 A;  3J80 c;  4PZ6 A;  3SHL A;  4J1M A;  1LT5 D;  4OO1 I;  1PTO H;  2SEB D;  4IO9 A;  2UXD Q;  3UDG A;  4K5W A;  3S15 H;  4LF4 L;  1WI5 A;  2BA1 A;  3HOY H;  2I5L X;  4FVM A;  3BZC A;  3ERO A;  4PZ8 A;  5L37 A;  4BBR B;  1KQS A;  1W6K A;  4LF8 L;  2VNU D;  4FF4 A;  3S2H H;  2WAQ E;  3PF4 A;  1KL9 A;  3NE5 B;  4DKA C;  1UEA B;  1C4Q A;  4QIW B;  3AMU A;  5IP9 G;  5IYB G;  2QCP X;  3NWT A;  2EY2 A;  4X3S A;  3JC6 6;  3K80 C;  2HHH Q;  2IHE A;  2FMC A;  4RGN A;  1KAA A;  4O0A A;  1QZH A;  3ERQ A;  1S5B D;  1CQF A;  1JWU D;  3HP3 A;  4BY1 G;  4L8J A;  5FLX L;  3HEJ A;  3VA5 A;  1MSH A;  2IWH A;  5IP9 H;  4RKL A;  5IYB H;  1SNM A;  3QOJ A;  2F03 A;  4G7O C;  1PRT B;  1SAP A;  4R4Q A;  1BCP C;  5CR3 A;  1GOZ A;  2LSS A;  1HNW Q;  4BY1 H;  4A3F B;  5IOC A;  1PH4 A;  5M3F H;  2JA6 H;  1PZI D;  4GS3 A;  2MFI A;  1PH2 A;  5F2D A;  3S2D B;  2AHO B;  5EQ0 A;  4X62 L;  1SYF A;  4DUY Q;  2CW0 D;  4U67 3;  3MVV A;  4HID A;  2N3S A;  4CJ0 B;  1JR0 D;  2NVX B;  4DV7 Q;  2NUC A;  4YCU A;  5C4J B;  2E76 C;  1XMO Q;  2R92 B;  1IBL L;  1TWF H;  2A68 C;  3PUV A;  3J81 c;  1YNN C;  4LF7 L;  3MA2 B;  3MWY W;  3J81 j;  1BCP F;  3FMC A;  2KVM A;  2DUD A;  3RLN A;  2LMC B;  2KCN A;  4ZRZ A;  5J3B A;  4JOI C;  3BZK A;  3CF5 A;  1YIT A;  4WJ3 M;  1W2B A;  3N52 A;  2BH2 A;  1JWS D;  1QB5 D;  3KLS A;  2R7Z G;  2QW7 A;  2EJM A;  4N9T A;  1NE3 A;  4DAM A;  4KMU C;  3GV6 A;  5LMN Q;  4JI6 L;  4BBR H;  3IRB A;  3PF5 A;  2ZJR A;  2LFN A;  5J1Z A;  4BY7 G;  3GQB A;  1GD7 A;  1F77 A;  2UUC Q;  2L11 A;  3KYH C;  2F3I A;  2CVR A;  2ZXP A;  3I73 A;  4QUC A;  1YJ9 A;  3GTL B;  4TQU S;  4A3F G;  3I4M B;  5DM6 3;  1ET9 A;  4KD3 A;  3Q23 A;  1ENF A;  2CFM A;  1D1K A;  1YHQ A;  1FGU A;  1RD9 D;  4RGT A;  1SFO B;  1JCK B;  5EGT A;  4A3F H;  3U50 C;  2RDF A;  2KHS A;  2R93 G;  3D3R A;  3S2D H;  2ZM6 Q;  2IW3 A;  1KDA A;  4DV4 L;  4L6T B;  2DNE A;  4IJL A;  4K6D A;  1RTN A;  1TVX A;  3I8Z A;  2NVX H;  3VYT A;  4DR4 L;  3TP5 A;  2HCC A;  1XPO A;  2R92 H;  4OON A;  1WFQ A;  2RHQ B;  1EIH A;  3TDQ A;  1AE3 A;  1BBU A;  4IJH A;  1SMY D;  3GP7 A;  2Y0S G;  4NXM Q;  4LW1 A;  4X65 Q;  1CSQ A;  3NTK A;  1ICF B;  2UU9 L;  5IGD A;  2X6G A;  3CC7 A;  2UUA Q;  3MFY A;  3T4A C;  1JIC A;  4H0L C;  2QEJ C;  1IBM Q;  3F2C A;  3ND9 A;  1P8L A;  1FGB D;  1CUK A;  2IPK D;  3KF6 A;  3GTO B;  4LFB L;  3M3Y B;  3RMH A;  4F8M A;  1H9S B;  1I3Q B;  3R3O A;  4A3G B;  3L7Z C;  4DV1 L;  1IW7 D;  1I94 L;  1TQO A;  3U9O A;  2F0L A;  1K8A C;  1L0X B;  4J6H A;  2LXJ A;  2LY7 A;  4HMI A;  5E7N A;  3KF8 B;  2ICI A;  2XVS A;  3GTL H;  2JXM B;  4P72 A;  1JB7 A;  3I4M H;  4FNF A;  1YHB A;  5G3L D;  2ZXR A;  4TRD A;  1YNJ C;  4OL7 A;  2F0E A;  4F87 A;  1VQC A;  3OMG A;  2CH4 W;  1RTO A;  1AW7 A;  1SFO H;  2A6E C;  4FF1 A;  4GOP B;  1DZ1 A;  1CFM A;  1LTL A;  1TWH B;  4HAE A;  1UNS A;  4WOR A;  1N32 L;  3KBG A;  1B9N A;  3K81 C;  1V1Q A;  2NWG A;  2PO4 A;  2EYJ A;  3QG1 A;  1KHI A;  4DR5 L;  1QUQ B;  3S1R B;  4GNX B;  5IYC H;  1Y69 U;  1H9K A;  5EJW A;  1STN A;  3J7A V;  1AEX A;  3BDL A;  5JPN C;  5CC4 A;  5JEA G;  1CA5 A;  3GTP B;  3CMA A;  1DOK A;  5FOB B;  1RIP A;  4DAY A;  4UP7 A;  3S1N H;  1NAP A;  1MJE A;  5FO9 B;  3BG3 A;  4OGQ C;  2JA7 B;  3A8I E;  1MBY A;  4Y52 H;  3DMU A;  4GNX A;  2MUY A;  3UI2 A;  3K5L A;  1Y14 B;  5ISR A;  1IYU A;  5IWA L;  1II3 A;  4JOI A;  4GKJ Q;  2GA4 B;  2NZ1 D;  5LHY 1;  2VB3 X;  2WKD A;  1HTP A;  2XTI A;  1XNQ L;  3GTO H;  3R8B A;  3M3Y H;  3T51 B;  1HA6 A;  1I3Q H;  4A3G H;  4P73 A;  1N34 L;  1LTG D;  1S40 A;  1J9O A;  1EEI D;  2VQF L;  2I5M X;  2LXK A;  4BBS G;  1SYD A;  3UDX A;  1HH2 P;  1X54 A;  1LLR D;  2HDL A;  2MGS A;  1KIX A;  1STY A;  3D0F A;  1CHQ D;  2MP1 A;  1K73 C;  4OX9 Q;  1U5K A;  1U4L A;  1CZW A;  1K28 A;  2F3W A;  2K01 A;  4JPB W;  3TP7 A;  1J5E Q;  1PYS B;  3BJU A;  4HTH A;  4K8I A;  2CWA A;  1CK1 A;  3MAQ A;  5D3D A;  4LF4 Q;  4ZUJ A;  1JOK A;  1TWH H;  2F0T A;  4TVA B;  2V1C C;  1L0W A;  5CGK A;  4IPD A;  1L2F A;  4LF8 Q;  1LTA D;  2B63 B;  2E8G A;  4B3R Q;  1KRS A;  3K7A B;  1A2T A;  2ENB A;  4R4C A;  3S1R H;  1F2Y A;  4OIK A;  4FO2 A;  4JI3 L;  2KHJ A;  2N55 A;  4YWK A;  3GD7 A;  2YU9 B;  5CBE E;  4ILW A;  3GTP H;  4G4K A;  2NN6 H;  2R3Z A;  3PQI A;  1DD2 A;  4IAL A;  2HT1 A;  1QCB D;  1ENC A;  4GLX A;  2JA7 H;  4XXE A;  2K32 A;  2K5V A;  3PIO 3;  4A76 A;  2Q2U A;  3K0Y A;  1SNQ A;  2VW9 A;  4K14 A;  2K05 A;  2PYK A;  4YIJ A;  4F88 A;  1B53 A;  3K6O A;  5FLX E;  5EBD A;  2EOT A;  3K8A A;  4A3I B;  1F2M A;  4JG2 A;  3S1M B;  3HKZ E;  3QOL A;  5KGU A;  1Y1V G;  1PVO A;  1T5E A;  2A8V A;  4DF7 A;  3FDT A;  2BA0 A;  1PH8 A;  1A0I A;  4CDE C;  2MHV A;  4KLK A;  3GTM B;  1TS4 A;  2B2T C;  2PCF B;  4F7X A;  1N9W A;  1NUC A;  3SGI A;  3CC2 A;  1PZJ D;  3W1G A;  4HIM A;  1AZP A;  1EY5 A;  4C56 C;  3K5M A;  2RQX A;  1B1Z A;  1IBL Q;  2N78 A;  2Z8L A;  4EQ5 A;  4LF7 Q;  4MTK A;  1AFP A;  2AQ3 B;  4A3C G;  4DUY L;  5FLM H;  2FFK B;  4P71 A;  3EVQ A;  1IW7 C;  2FMM A;  4NPS A;  4B3S Q;  5JJK A;  1SYE A;  4DV7 L;  1A62 A;  1ESR A;  2JEA I;  3PV0 A;  1Q8I A;  2PNH A;  4WFN 3;  4DR3 L;  4A3C H;  4N9P A;  4JI6 Q;  1WJJ A;  4FF3 A;  4ZLT F;  5C4H A;  1PMR A;  2B63 H;  1EIG A;  1DXM A;  1SBB B;  3UDI A;  3OTO L;  2AUJ D;  3K7A H;  4KV6 A;  2LKV A;  2PW7 A;  3D4D A;  4DR2 Q;  1K3B C;  1QIL A;  2KCC A;  3QWN A;  1HZ9 A;  2H5X A;  1NR2 A;  1L1O C;  3ERS X;  1W3S A;  2YU9 H;  3C1F A;  1SXT A;  2XSC A;  4G7Z C;  2RVL A;  3BDC A;  3AYH B;  5LMN L;  3A74 A;  4HIO A;  1VQ5 A;  1E2V A;  5CV6 A;  3AU7 A;  3VYS A;  2R6G A;  2JA5 G;  2YTV A;  1STH A;  2BH8 A;  4H7B A;  4FYD A;  4A3L H;  4DXG A;  2L9H A;  1GKH A;  5G3L F;  2J7Z A;  1MI2 A;  4IFD G;  4A3I H;  2D0O A;  4FF2 A;  3S1M H;  2K5Q A;  5AJ3 L;  2IJ0 A;  1Q46 A;  1V1P B;  3PO3 B;  1EY6 A;  2PMZ E;  1RL2 A;  1JOR A;  1Y1W B;  1GO3 E;  3GTM H;  1UE6 A;  5DAU A;  3RUZ A;  3LNN A;  3OWE B;  5ELN A;  3MXG A;  1PZK D;  1YHA A;  4PMC A;  1I6V C;  4ULL A;  3F2B A;  1V8Q A;  1KDB A;  1IYV A;  4C3H B;  5DLQ E;  4R8I A;  3ULL A;  3G6E A;  3KDF B;  1I4H A;  1X6O A;  4K5X A;  4PQX A;  4JV5 Q;  1BUV T;  1PH1 A;  1E7Z A;  1EFI D;  2KCM A;  3NSW A;  2VY3 A;  2D9U A;  4YWL A;  4O42 A;  2KA7 A;  3V05 A;  3CC4 A;  3TEH B;  1EZ8 A;  4IUU A;  4YHH Q;  1PH7 A;  1IBK L;  1JC7 A;  3F2U A;  5C44 B;  5EPK A;  2JA8 G;  2MQH A;  1S5F D;  1LUZ A;  3T1H L;  4A3E B;  1OO9 B;  1D5X C;  5IP7 G;  4JI8 Q;  1IBM L;  2DN8 A;  5C0X H;  2EXD A;  4S3S A;  5I9P A;  2PZU A;  4KN4 C;  1SNP A;  1LAC A;  2B2V C;  2B8G A;  2OTJ A;  3A7A B;  1VQB A;  1HFN A;  1VQK A;  2HQL A;  2K5N A;  4KJO A;  5K36 G;  4NW2 A;  3TBI B;  4QY7 A;  4TSS A;  2ZJQ A;  3ER0 A;  1K8M A;  1LM0 A;  2ID0 A;  1I50 B;  1N32 Q;  1BBW A;  1JWM D;  4UDU C;  3PO3 H;  2RSO A;  4DR5 Q;  1Y1W H;  5I2X A;  2L12 A;  4ZCK A;  4NB3 A;  2V4D A;  1G91 A;  4XYO A;  1Q7Y C;  1T5X D;  2B2T A;  1VQM A;  3QR8 A;  1FR3 A;  2ZT9 C;  4XDX A;  1V43 A;  1XPR A;  4DR1 L;  4C3H H;  2PW5 A;  3M4Y A;  2B29 A;  2A74 C;  1YBY A;  1VQ6 A;  3RD4 A;  3A55 A;  4BXX H;  4A3E G;  3HOV B;  3TSS A;  1FYC A;  2O4X A;  2A1A A;  3VDY A;  2IX1 A;  2UXB L;  5DEH A;  2F4V L;  4PMW A;  1HNX Q;  1BDO A;  2ES2 A;  4MIU A;  5C44 H;  1X3G A;  1HZB A;  3M85 A;  1BXT A;  1XNQ Q;  4A3E H;  3A0J A;  2JN4 A;  4PG3 A;  3SE0 A;  4GKJ L;  3X3N A;  1WCM B;  3EA6 A;  3S17 B;  1YNX A;  1N34 Q;  1A63 A;  1E1O A;  2VQF Q;  2P5Z X;  1R9T H;  1L1O A;  4V0B A;  4OWX B;  2A5H A;  1XX8 A;  2B3G A;  1CKO A;  1X32 A;  4C3J G;  4C1N I;  2K50 A;  4HJ8 A;  5AFW A;  2Z0S A;  2CH4 A;  2C35 B;  1AE2 A;  5FO7 B;  1VF5 C;  4IQZ A;  1A3T A;  1EFW A;  3CXC A;  3FP9 A;  4OEM B;  4HMJ A;  2F0U A;  2JJQ A;  4HR7 B;  4A3J B;  2CKZ B;  2I07 B;  2SNS A;  1F2Z A;  4HSV A;  4J15 A;  4X64 L;  3HOY G;  2F52 A;  5JJZ A;  1I50 H;  3GTK B;  1HQM C;  2A69 C;  1J5E L;  1YZ6 A;  4AQY L;  1O7Z A;  3HOX B;  2DY7 A;  1CSP A;  1XWE A;  4JI3 Q;  4L63 B;  1DON A;  1KNA A;  4UHV A;  1V1O A;  1HUN A;  5HY6 A;  2VUM B;  2WAQ B;  4B3R L;  1VQD A;  1GUS A;  1B7Y B;  3CQZ B;  1YNJ D;  5HGQ A;  3HOV H;  1DYQ A;  2F1M A;  1BOS A;  3DHQ A;  4NMZ A;  5HGT A;  4XQQ A;  2A6E D;  4DGZ A;  3NEL A;  5M3F G;  2JA6 G;  5IIF A;  4RWS C;  3T56 B;  1HR0 L;  1GUO A;  1WCM H;  3S17 H;  2JSO A;  3AB9 A;  4FP5 D;  4KD4 A;  2PQE A;  5I6W A;  4QIW E;  2D62 A;  2J4X A;  1TS2 A;  2F0F A;  2PQA A;  5EKL A;  2F0I A;  3EQL C;  4P75 A;  3OMC A;  3CCQ A;  3I91 A;  4GKK L;  4EQO A;  5ELD A;  4CGY B;  3QO2 A;  4IUQ A;  2EXZ A;  2VXW A;  2ZTD A;  2D2C C;  1ASY A;  5EKI A;  3RR5 A;  4IUV A;  2K5H A;  2OT2 A;  3FHW A;  1LV9 A;  4MZ9 A;  2SDF A;  4DR3 Q;  1I4X A;  3UE0 A;  5IGB A;  4A3J H;  1UE7 A;  4GLV B;  2HD3 A;  3GTK H;  4DNT B;  4BBR G;  5JEA J;  3I4L A;  1CM9 A;  2AMC B;  2K5W A;  2EYO A;  3OTO Q;  3VR4 A;  4B3S L;  3W2D A;  1U4P A;  5M3M B;  3HOX H;  2KEE A;  4WJW A;  2EQS A;  3X3M A;  3S24 A;  4B3T L;  2CQO A;  4FDB A;  2E2J B;  2VUM H;  3RN5 A;  4OXP A;  4YY3 L;  2K04 A;  2KQ3 A;  1FJG L;  1UWV A;  3MEH A;  4M8A A;  3TZU A;  2I0Q A;  4DR2 L;  2WB1 B;  3CQZ H;  2YTX A;  1TII D;  2F3V A;  3CRL C;  1EOV A;  4O1N A;  3P1H A;  1HUM A;  1FL0 A;  4A3D B;  4X3T A;  2OF1 A;  5AJ3 Q;  2Y0S E;  3H3V H;  1KRT A;  3FPP A;  4KHZ A;  4NXN L;  4EGV A;  3I70 A;  2Z6B A;  1K0R A;  2K6A A;  2KOL A;  1CTM A;  3HRZ C;  5KYI A;  2BDN A;  4DNR B;  4JI4 L;  2Z6K C;  2BOS A;  3AEV A;  3BVG A;  4BWG B;  4JI1 L;  1JJG A;  4KHV A;  2R92 G;  2K4K A;  2EYF A;  2JK8 A;  1HRJ A;  1I4R A;  3ITP A;  4X6A H;  2AQ2 B;  2CCZ A;  1JE4 A;  4R1J A;  3DEP A;  1D7Q A;  1QVG A;  5FKA C;  1G6Z A;  5C4J H;  4GLA C;  2B2Y C;  1AN8 A;  3GTJ B;  3KBX A;  3F1Z A;  3PUX A;  2VQE L;  1IBK Q;  2TMP A;  3TRE A;  1PDQ A;  2EYL A;  2PI2 E;  3SK6 A;  1JJC B;  4XT3 B;  1KD1 C;  4QMG A;  4JV5 L;  3T1H Q;  2IX3 A;  4HJ7 A;  3KF6 B;  3FEW X;  1Q8K A;  5M3M H;  2TSS A;  3G48 A;  4LK1 C;  4V19 0;  2WB1 G;  3B6Y A;  4DK1 A;  3PIP 3;  2OWO A;  1X3E A;  2K28 A;  4L5T A;  4YHH L;  5CBA E;  3P20 A;  3PUW A;  1ROD A;  2E2J H;  3PO2 B;  3OIP A;  4IN3 A;  3V96 A;  3V2T A;  1ZKO A;  4JI5 L;  2F0S A;  1Z6H A;  1VQP A;  3I4M G;  4K2K A;  3W5O A;  1SN8 A;  4IPH A;  3ULP A;  4JI8 L;  2XWJ B;  3D4W A;  1EUJ A;  4JYA L;  1GUW A;  4A3D H;  4UP8 A;  3TP6 A;  1BCP B;  1Q90 A;  4EVO A;  2EYH A;  1SE8 A;  1BQQ T;  2F0N A;  1TWG B;  1PTO D;  3MFG A;  5C5M A;  1B50 A;  4K0K L;  2IX0 A;  1WYD A;  5IYC G;  1Q86 C;  4DXF A;  2K14 A;  3BYT B;  3H0G B;  4ME3 A;  1D6E C;  1YVC A;  3VR5 A;  4IZ8 A;  4C3I B;  3KFU A;  1EYD A;  4DR1 Q;  2KHI A;  3I4N B;  1FNU A;  1SDF A;  3KOJ A;  3TN2 A;  3LX0 A;  4DAY B;  5I4D A;  2MO0 A;  1Z9F A;  4C1N K;  4OO1 H;  1SRO A;  2I46 A;  4RAU C;  1E2Z A;  3IAY A;  2HUG A;  3L9A X;  4IFD I;  2E2D C;  2UXB Q;  1L0Y B;  2F4V Q;  3CCV A;  3GTJ H;  3DM1 A;  4PZ7 A;  4DUZ Q;  1LT6 D;  4EQP A;  1ICW A;  2OXP A;  5IT9 E;  3ZYY X;  1C0A A;  2ALY B;  4IUP A;  1F9S A;  1C8C A;  1EY9 A;  5C4X B;  1AH9 A;  3FRP B;  4A3G G;  2F0V A;  3PCO B;  2G9H D;  1HNX L;  1ASZ A;  2Q2H A;  3KUP A;  1A15 A;  3PO2 H;  4XT1 B;  3NP8 A;  2AKW B;  1RDP D;  1HXY D;  2VS1 A;  4IFD J;  3MXU A;  1MHW C;  1KTK A;  3T13 A;  2O2L D;  3SXH A;  5KRU A;  3G71 A;  3E0J A;  1WTO A;  3HZX A;  3PUZ A;  4UPA A;  3PGZ A;  1B8A A;  1EY8 A;  2ASB A;  1Q12 A;  2K7V A;  3S16 B;  3H0G G;  4X64 Q;  3VR6 A;  1EWC A;  3UE1 A;  2WFW A;  1TWG H;  2EDG A;  5GAG C;  3IFT A;  3P7J A;  4AQY Q;  2E5L Q;  1STB A;  1WTR A;  3H0G H;  2Z6K A;  5JOB A;  1MD2 D;  3FPU B;  4NP5 A;  4C3I H;  3TME A;  1OXU A;  1R4P B;  2NN6 G;  3CPW A;  3ULJ A;  3I4N H;  2ZTE A;  2RKS A;  4M1U B;  5BR8 Q;  4QF4 A;  2JA7 G;  3I56 A;  3NEN A;  4KY5 A;  2J0T D;  3JAM L;  3J80 L;  4B08 A;  4HJ5 A;  1NJI C;  1KXL A;  5C4X G;  1Q1E A;  2B2Y A;  4ALP A;  1TY0 A;  3K57 A;  1RJT A;  2QIL A;  4YCW A;  1XMQ L;  2HQE A;  1HR0 Q;  2ZXO A;  3TS2 A;  1X3Q A;  2QDB A;  4DAV A;  2EY5 A;  1TU2 B;  4LF9 Q;  2PZW A;  3HS0 C;  3S9W A;  5C4X H;  2NZO A;  4YCV A;  5CV5 A;  3A56 A;  3HKZ B;  4DK6 C;  2IHF A;  5LMN W;  1PV4 A;  3EJI A;  5GQO A;  1WTW A;  4APV A;  3NTI A;  5FLX c;  3LWU A;  4GKK Q;  1M90 C;  1XTC D;  5D3I B;  1J8I A;  5FLM G;  2EVB A;  1P16 A;  4A3K B;  3BU2 A;  4A93 B;  2NTS A;  3NQT A;  1G51 A;  1ZXT A;  2MJ8 A;  2VB2 X;  4OWW B;  3NBH A;  2FIN B;  1M4V A;  1Y8N B;  4XIG S;  2N88 A;  2JYO A;  2B2U C;  1IYJ B; 
#chains in the Genus database with same CATH homology
 3S16 H;  2K75 A;  2ID0 A;  3A5Z B;  4GS3 A;  5M5X H;  2UUB L;  2MFI A;  1PH2 A;  1N32 Q;  1BBW A;  2AHO B;  2KEN A;  4X62 L;  3PO3 H;  3CCR A;  3F2D A;  4DUY Q;  4DR5 Q;  1Y1W H;  2B63 G;  4HID A;  1EQQ A;  2N3S A;  2HIX A;  4NB3 A;  4DNI A;  2MO1 A;  1Q7Y C;  3CPF A;  4DV7 Q;  2QEX A;  4YCU A;  1VQM A;  4UY8 C;  1CKN A;  1YI2 A;  1XMO Q;  3MEF A;  1V43 A;  3F8T A;  1TWF H;  1TWC H;  3Q8D A;  1IBL L;  4B3T Q;  1XPR A;  1GVP A;  3PUV A;  1NMG A;  3J81 c;  4LF7 L;  4DR1 L;  3J81 j;  4C3H H;  3EN2 A;  2DUD A;  3PO2 G;  2GVB A;  2B29 A;  3RLN A;  4YY3 Q;  1FJG Q;  1YBY A;  1VQ6 A;  5J3B A;  2IY5 B;  3CAM A;  3I4O A;  4QL5 A;  4JOI C;  3BZK A;  1NY4 A;  4DPG A;  4KHP Q;  3CF5 A;  1YIT A;  1J6Q A;  4BXX H;  4A3E G;  1W2B A;  4WJ3 M;  4GOP A;  1KAW A;  3VDY A;  2A1A A;  2BH2 A;  4JBM A;  4GN5 A;  2IX1 A;  4A3L G;  1D8L A;  4DV0 Q;  1HJP A;  2R7Z G;  2UXB L;  1SRU A;  1PH9 A;  5IT9 c;  2F4V L;  1WOC A;  4X66 L;  4PMW A;  3D31 A;  4RG1 A;  1HNX Q;  1NE3 A;  4DV5 L;  4A3I G;  4DAM A;  4DV6 L;  2ES2 A;  5LMN Q;  4JI6 L;  4BBR H;  1QUQ A;  3IRB A;  5C44 H;  1X3G A;  1HZB A;  3M85 A;  4NXN Q;  3PF5 A;  1XNQ Q;  2UXC Q;  3EIV A;  4JCV E;  4A3E H;  3A0J A;  2ZJR A;  1VQH A;  1HNZ L;  4B3M L;  4PG3 A;  3K0X A;  4GKJ L;  3CW2 C;  3I7F A;  1QZG A;  3LGJ A;  4BY7 G;  1YNX A;  1N34 Q;  1VQG A;  1N8R C;  1VQ9 A;  1E1O A;  4A75 A;  1A63 A;  1GD7 A;  3ZJY C;  2VQF Q;  4LF6 Q;  4JI4 Q;  1R9T H;  2UUC Q;  1L1O A;  4LUO A;  4OWX B;  3KYH C;  5C0X I;  2F3I A;  2B3G A;  1XJV A;  1CKO A;  4JI1 Q;  3U4V A;  1YJ9 A;  4WJ4 A;  4TQU S;  4A3F G;  2K50 A;  3I4N G;  4HJ8 A;  1JT8 A;  2RHS B;  1JE5 A;  4R4O A;  2NZH A;  4A3K H;  4IOA A;  2Z0S A;  4A93 H;  2C35 B;  2CFM A;  1AE2 A;  1YHQ A;  3HOU G;  1FGU A;  5JJI A;  1PH5 A;  1EFW A;  3CXC A;  4POG A;  3FP9 A;  3M9B A;  3U50 C;  5LMU L;  4A3F H;  2WP8 J;  2JJQ A;  5FJ8 H;  2CKZ B;  1M1K C;  2VQE Q;  4BA1 I;  4J15 A;  4X64 L;  3HOY G;  2F52 A;  2R93 G;  1I50 H;  3S2D H;  5GRO A;  1X65 A;  2ZM6 Q;  3PUY A;  4LFC L;  5C0X J;  5M5W H;  3PIP A;  1UE5 A;  4DV4 L;  1YJN A;  3HOU H;  4IJL A;  1J5E L;  1YZ6 A;  2OCE A;  2MNA A;  4AQY L;  1CSP A;  1KC8 C;  2FXQ A;  2NVX H;  1U0L A;  4GN4 B;  4JI3 Q;  4BBS H;  3CCS A;  4DR4 L;  1S72 A;  2ZTC A;  2GVA A;  1XPO A;  2R92 H;  5C0X G;  4OON A;  3PIO A;  1WFQ A;  5HY6 A;  2RHQ B;  1MJC A;  3E9H A;  2AWO A;  1AE3 A;  1BBU A;  4IJH A;  2Y0S G;  3J7Z C;  3TQY A;  4LW1 A;  4NXM Q;  4JI5 Q;  3ICE A;  4X65 Q;  4B3R L;  1VQD A;  1OXS C;  3STB D;  1CSQ A;  2VZA A;  2UU9 L;  3CC7 A;  1B7Y B;  2A19 A;  3GO5 A;  2UUA Q;  5HGQ A;  1PA6 A;  3U58 A;  3RZD H;  4LUV A;  3HOV H;  3HOZ H;  2EIF A;  2UXD L;  4JYA Q;  1IBM Q;  4XTC S;  3F2C A;  4DK3 C;  3NEL A;  1Q82 C;  4P74 A;  1P8L A;  1SMX A;  5GAD C;  3NBH B;  4H02 A;  3M4O H;  1VCI A;  3FKI H;  5M3F G;  2JA6 G;  1PFS A;  1CUK A;  3I2Z A;  3KF6 A;  1HR0 L;  1VQJ A;  4HIK A;  4LFB L;  1EWI A;  2QGQ A;  4AIM A;  1CKM A;  3RLO A;  3PO3 G;  1VQ7 A;  1WCM H;  4DR6 Q;  3L7Z C;  3S17 H;  1Y1W G;  1PH6 A;  4DV1 L;  1VQF A;  3NEM A;  1G29 1;  4QIW E;  1I94 L;  2HHH L;  4K0K Q;  2D62 A;  1VQ8 A;  1TXY A;  1X3F A;  2PQA A;  2JEB I;  4QGU A;  1K8A C;  2LXJ A;  2YV5 A;  4DV3 Q;  2I5H A;  1XNR Q;  4P75 A;  5E7N A;  4EX5 A;  3KF8 B;  1N33 Q;  3CCQ A;  1CKN B;  4UP9 A;  3GTL H;  4GKK L;  2XGT A;  3KLW A;  4P72 A;  1JB7 A;  3I4M H;  1YHB A;  2OQK A;  4DR7 Q;  1T9H A;  1O7I A;  4X62 Q;  3CP0 A;  2E2H H;  2ZTD A;  1ASY A;  1VQC A;  3RR5 A;  4BXX G;  1A8V A;  2K5H A;  3L0O A;  4AH6 A;  1SFO H;  3HOW G;  3FHW A;  2OQ0 A;  1HNW L;  4MZ9 A;  3GDE A;  1Y1V H;  4GOP B;  1VQ4 A;  1LTL A;  4DR3 Q;  1QVC A;  5ELO A;  3UE0 A;  4A3J H;  1OXT A;  1UE7 A;  4GLV B;  1I6H H;  1N32 L;  3GTK H;  4BBR G;  5JEA J;  3K81 C;  1V1Q A;  2AMC B;  3EBE A;  5C44 G;  4L5S A;  4DR5 L;  1KHI A;  1QUQ B;  3OTO Q;  4B3S L;  4GNX B;  3HOW H;  5IYC H;  3HOX H;  4JI7 L;  3A5U A;  4OWT B;  2EQS A;  1EYG A;  3TS0 A;  4JBJ A;  5JEA G;  1XMO L;  1OTC A;  3S24 A;  3CMA A;  4B3T L;  1UE1 A;  1RIP A;  2CQO A;  3E9I A;  4FDB A;  2R7F A;  4UP7 A;  1PHJ A;  4X66 Q;  2VUM H;  4DUZ L;  1MJE A;  3S1N H;  3RN5 A;  3HKZ G;  1L1O B;  1BVS A;  4Y52 H;  4OXP A;  5GAH C;  4YY3 L;  3DM3 A;  4GNX A;  1FJG L;  4A4I A;  1UWV A;  4JBW A;  2I0Q A;  1Y14 B;  4DR2 L;  3RNU A;  5IWA L;  3CQZ H;  1HZC A;  2YTX A;  4AYB E;  2NVQ H;  4JOI A;  1C7Y A;  4GKJ Q;  1XPU A;  2RCN A;  4A3K G;  4A93 G;  1EOV A;  3M4P A;  2YTY A;  1UEB A;  1FL0 A;  2OTL A;  5AJ3 Q;  2ZJP A;  2Y0S E;  3H3V H;  2R7D A;  5EAY A;  1FVI A;  1KRT A;  1IL2 A;  5FJ8 G;  2KCT A;  2XTI A;  4KHZ A;  4NXN L;  1HR0 W;  4IPG A;  1XNQ L;  3GTO H;  4R4T A;  3M3Y H;  1G6P A;  1K0R A;  2ATW A;  4O2D A;  2NVY H;  3M7N A;  1I3Q H;  3GTQ H;  4P73 A;  1N34 L;  4A3G H;  3KJO A;  1S40 A;  2VQF L;  1C9O A;  4JBK A;  4JI4 L;  1V9P A;  2Z6K C;  2I5M X;  2LXK A;  2QA4 A;  2UUC L;  4BBS G;  3OYY A;  4Y7N H;  3UDX A;  2K52 A;  4LF5 Q;  3AEV A;  1HH2 P;  1X54 A;  4JI1 L;  5LMU Q;  1JJG A;  2R92 G;  1KIX A;  3D0F A;  2JA5 H;  1K73 C;  4OX9 Q;  1U5K A;  3H15 A;  2K4K A;  4JI0 L;  2JK8 A;  2Q2I A;  1NMF A;  5C3E H;  1LYL A;  4DV2 L;  4DV4 Q;  4X6A H;  4A3D H;  2E5L L;  4AYB G;  1J5E Q;  1PYS B;  4KI0 A;  4R1J A;  2CCZ A;  3BJU A;  1SR3 A;  1D7Q A;  1Q1B A;  2YYZ A;  2CWA A;  1VQA A;  1QVG A;  3HOV G;  3HOZ G;  5C4J H;  4GLA C;  4LF4 Q;  4DR4 Q;  4LUZ A;  1VS0 A;  3F1Z A;  2DGY A;  3PUX A;  1NTG A;  1TWH H;  4TVA B;  2V1C C;  2VQE L;  1L0W A;  1IBK Q;  4IPD A;  1L2F A;  5BR8 L;  4LF8 Q;  3TRE A;  2ZM6 L;  2PI2 E;  3FKI G;  2E8G A;  1VQL A;  1JJC B;  1OXV A;  1XMQ Q;  1KRS A;  1KD1 C;  4B3R Q;  4JV5 L;  3T1H Q;  2UU9 Q;  1K9M C;  4HJ7 A;  4LFA L;  1DGS A;  3KF6 B;  4R4C A;  1Q8K A;  3RLF A;  3G48 A;  4POF A;  5IE8 A;  5M3M H;  3S1R H;  2WB1 G;  2KHJ A;  4GN3 B;  4JI3 L;  1WCM G;  3B6Y A;  4YWK A;  1E3P A;  3GD7 A;  1N36 Q;  2OWO A;  1X3E A;  1SLJ A;  4L5T A;  3GTP H;  4YHH L;  3S1Q H;  3OW2 A;  3PUW A;  2E2J H;  3KDF A;  2HT1 A;  2GN5 A;  3KJP A;  2PQA B;  4NXM L;  4GLX A;  2JA7 H;  1S3O A;  4JI5 L;  4X65 L;  3CCE A;  2K5V A;  2JE6 I;  1VQP A;  3I4M G;  4LFB Q;  4A76 A;  2Q2U A;  2UUA L;  3W5O A;  2VW9 A;  4LF9 L;  1SN8 A;  4IPH A;  3ULP A;  4JI8 L;  1E22 A;  3AQQ A;  1X56 A;  4DV1 Q;  4JYA L;  1EUJ A;  5H1S E;  3K8A A;  1I94 Q;  1E24 A;  4JG2 A;  3CCU A;  4IPC A;  4UP8 A;  4L5Q A;  3HKZ E;  3M4Q A;  5IYD G;  3T1Y Q;  1QVF A;  1VQN A;  1Y1V G;  3WWV A;  3GTG H;  3JAM i;  2JA8 H;  1PVO A;  3J80 i;  2A8V A;  2UUB Q;  5IYD H;  4A3J G;  2BA0 A;  3STB C;  1PH8 A;  3H3V I;  2JQO A;  1SE8 A;  1A0I A;  3W1B A;  1E1T A;  2IT1 A;  5IP7 H;  5JJL A;  4KLK A;  2N49 A;  3K7U C;  4L5R C;  1N9W A;  4YWM A;  3PSI A;  3SGI A;  1MKH A;  3CC2 A;  3CCL A;  2NVT H;  2IX0 A;  1WYD A;  1VQI A;  3W1G A;  1OXX K;  5IYC G;  3HOX G;  4HIM A;  1Q86 C;  4JI2 L;  4LNQ A;  2K14 A;  1X9N A;  4ME3 A;  1IBL Q;  2N78 A;  2AWN A;  1YVC A;  4EQ5 A;  3KFU A;  4LF7 Q;  4K0K L;  4DR1 Q;  2KHI A;  3UDF A;  2VL6 A;  3KOJ A;  4DAY B;  2Q2T A;  2VUM G;  4A3C G;  3CD6 A;  4DR7 L;  4DUY L;  5FLM H;  2MO0 A;  1Z9F A;  4P71 A;  2WAQ G;  1EQR A;  3G4S A;  4GOP C;  2E2I H;  4NPS A;  1SRO A;  4B3S Q;  5JJK A;  4DV7 L;  4MTN A;  4JI7 Q;  1A62 A;  3S14 H;  3CME A;  2JEA I;  2L15 A;  3I55 A;  4A3M G;  4IFD I;  2UXB Q;  3MXN B;  2PNH A;  3PV0 A;  3GTJ H;  3CCV A;  4DR3 L;  4PZ7 A;  1I5F A;  1YIJ A;  2F4V Q;  4A3C H;  4DV5 Q;  4DV6 Q;  4JI6 Q;  5IY0 A;  1WJJ A;  4DUZ Q;  1GM5 A;  4GNX C;  2CWP A;  2B63 H;  3UDI A;  3OTO L;  4KHP L;  3K7A H;  1C0A A;  4DR2 Q;  2ALY B;  1HNZ Q;  4B3M Q;  4QQB X;  5M5Y H;  5IWA Q;  4A3M H;  1HZ9 A;  2H5X A;  4DV0 L;  1AH9 A;  4A3G G;  1L1O C;  3ERS X;  1W3S A;  4RMF A;  3HFZ B;  2YU9 H;  3PCO B;  1K83 H;  4A3B G;  1HNX L;  1ASZ A;  3AYH B;  5LMN L;  2Q2H A;  3A74 A;  3PO2 H;  1H95 A;  4HIO A;  1VQ5 A;  2NN6 I;  2AKW B;  4C2M H;  2R6G A;  2VS1 A;  2UXC L;  2JA5 G;  2YTV A;  4IFD J;  3RZO H;  1Z47 A;  2BH8 A;  3G71 A;  1X55 A;  2WB1 E;  5C3E G;  4HJA A;  4A3L H;  4JC0 A;  1GKH A;  3J81 i;  2R7Z H;  4LF6 L;  4A3B H;  1EIY B;  3PUZ A;  4IFD G;  4UPA A;  1IXR A;  2D0O A;  3PGZ A;  4A3I H;  1EIF A;  3S1M H;  1B8A A;  1NBW A;  1PYB A;  3AFP A;  5AJ3 L;  3J7A 5;  2ASB A;  1Q12 A;  3H0G G;  3L2P A;  1VQO A;  1YJW A;  1Q46 A;  4X64 Q;  3UE1 A;  1JMC A;  2HIV A;  2WFW A;  4JI0 Q;  2PMZ E;  1RL2 A;  4LFC Q;  1TWG H;  1GO3 E;  4BY7 H;  5GAG C;  4DV2 Q;  3GTM H;  4AQY Q;  1UE6 A;  2E5L Q;  5M3M G;  1MIU A;  2D0P A;  1HZA A;  2JA9 A;  3H0G H;  2Z6K A;  1PH3 A;  4LF5 L;  5ELN A;  4C3J H;  3U4Z A;  4QJF A;  1YHA A;  4C3I H;  3F2B A;  3CPW A;  1OXU A;  4HJ9 A;  2NN6 G;  3ULJ A;  4OX9 L;  2ZTE A;  5DLQ E;  3I4N H;  4MNO A;  3ULL A;  4BA2 I;  3G6E A;  1B70 B;  1YEZ A;  5BR8 Q;  2RF4 A;  3KDF B;  3CCJ A;  2JA7 G;  2N8N A;  3NEN A;  1VQE A;  3I56 A;  1X6O A;  3JAM c;  1JJ2 A;  4JV5 Q;  3J80 c;  1PH1 A;  1E7Z A;  4PZ6 A;  4LFA Q;  2KCM A;  4OO1 I;  1K8G A;  4HJ5 A;  2VY3 A;  4IO9 A;  2UXD Q;  3UDG A;  4YWL A;  3S15 H;  4LF4 L;  1NJI C;  1KXL A;  4IOC A;  3CC4 A;  5C4X G;  2PI2 A;  1WI5 A;  3TEH B;  1Q1E A;  2BA1 A;  3HOY H;  2I5L X;  4YHH Q;  4ALP A;  2R93 H;  1PH7 A;  1K3R A;  3BZC A;  1BKB A;  4PZ8 A;  3CCM A;  1KQS A;  1IBK L;  4LF8 L;  4A3D G;  1IZ6 A;  2VNU D;  3S2H H;  3E0E A;  2JA8 G;  2MQH A;  2WAQ E;  4YCW A;  1XMQ L;  1LUZ A;  1HR0 Q;  5GAE C;  3PF4 A;  3T1H L;  3TS2 A;  1KL9 A;  4DKA C;  1TWA H;  4LF9 Q;  5IP7 G;  4JI8 Q;  5C4X H;  5IP9 G;  5IYB G;  1Q81 C;  1N36 L;  2NZO A;  1IBM L;  2HHH Q;  2EXD A;  3JC6 6;  3K80 C;  2IHE A;  4YCV A;  4LWC A;  4DK6 C;  2IHF A;  4O0A A;  5LMN W;  1QZH A;  1PV4 A;  2KBN A;  5GQO A;  4BY1 G;  4APV A;  3RN2 A;  5FLX c;  3HKS A;  4GKK Q;  1M90 C;  2OTJ A;  1VQB A;  3DLL A;  3AFQ A;  4R4I A;  5FLM G;  1P16 A;  2HQL A;  2K5N A;  5IP9 H;  3BU2 A;  5IYB H;  1VQK A;  4DR6 L;  1G51 A;  5K36 G;  1XTD A;  4R4Q A;  4OO1 G;  4QY7 A;  4OWW B;  1XNR L;  3TRZ A;  4DV3 L;  2LSS A;  4JI2 Q;  3ER0 A;  4XIG S;  2ZJQ A;  4BY1 H;  1PH4 A;  1HNW Q;  3T1Y L;  1N33 L;  5M3F H;  2JA6 H;  1LM0 A;  1IYJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...