2NVYH

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvyH00
4R1JA 2D0PA 2NN6G 3PUYA 2UXBQ 4UP9A 1KL9A 3L2PA 2UUBL 1K73C 4GN5A 3J7ZC 2VUMG 4GN4B 4QQBX 3K7UC 4A3KG 1WJJA 4RG1A 1E1TA 1KXLA 1BBWA 4UP7A 2CFMA 2RCNA 3T1YQ 3KF8B 4HJ5A 1UEBA 4GKJL 3CCRA 5IYDG 3K7AH 2OWOA 3KDFB 3GDEA 1RIPA 4EX5A 5IYCG 2IX0A 5M3FG 2UXCQ 1U5KA 4KLKA 5JJIA 5DLQE 1Q1BA 2JJQA 1J5EL 3CC4A 2DGYA 2N3SA 4LF9L 1B7YB 4JI1Q 1HNWL 4OONA 3KJOA 3T1HL 4JI0Q 4A3GH 3HOYG 4YHHL 1FVIA 1PV4A 3PO3H 4JI5L 5JJKA 3SGIA 3E9IA 2ZJRA 4UPAA 1PH3A 3M7NA 1HZ9A 1JT8A 1PH4A 3JC66 2K50A 2A8VA 1N32Q 2JA6H 4GLVB 2UUAL 1NMFA 2D62A 2K5NA 2Q2IA 2WB1E 1PH8A 2EXDA 4LFAQ 3PO2H 2UUCQ 4LUZA 4NB3A 4DKAC 4LF8L 3HOZH 5BR8Q 3K8AA 4A3FG 4A93G 2UXDQ 2I0QA 3FKIG 4B3RL 2L15A 3M4QA 5C44G 1X6OA 1YJNA 1EQQA 4P74A 2IHEA 4TVAB 4BY1G 1KAWA 1TWAH 1LTLA 4B3TL 4LNQA 2PNHA 3ICEA 4DR6Q 4IOCA 1AH9A 1A0IA 1GO3E 2JEBI 4DV1L 1PH7A 4DAMA 1SMXA 4A3EG 1FGUA 3D31A 4JI8L 4AQYQ 2AWOA 2R92G 4B3MQ 3I55A 4GNXA 5LMUL 2PQAA 4UP8A 4BA1I 4A3JG 2RF4A 1ASYA 3AEVA 1X54A 1KQSA 3RZOH 3CMAA 3J81i 1PFSA 4K0KL 3ULPA 1SLJA 2NZHA 3PSIA 1P16A 1IBML 2YYZA 5GAGC 1XNQL 4JI3L 3I7FA 4QJFA 3U58A 3HKZG 3J80c 1L1OC 2GN5A 2HHHL 3MXNB 3PCOB 5C4XG 3NEMA 3AYHB 1BKBA 1HH2P 1HZBA 4YCUA 4YWLA 5M5YH 1I5FA 4L5TA 4MNOA 1VQ8A 2N49A 1PYBA 1L1OB 2NZOA 3GTQH 2E8GA 2R93H 4NPSA 1LM0A 4JBWA 1PH6A 4DR1Q 1VQEA 4HIOA 4OWTB 1YEZA 3ER0A 3TQYA 5J3BA 3PIPA 3KDFA 3NBHB 5IY0A 1J5EQ 4R4OA 4LF9Q 1HNWQ 1YNXA 1X55A 4YHHQ 2WAQE 4R4CA 3JAMc 1YI2A 3VDYA 1WCMG 4P75A 4O0AA 4BBSH 4IOAA 1KRTA 2VW9A 4L5RC 1SR3A 4UY8C 4HJ9A 2JA5H 4AYBE 4JI0L 1K3RA 3HOXG 4LFBQ 4JCVE 1OXXK 1HNXL 1YBYA 4DV5L 1G6PA 4HIDA 4B3RQ 1IZ6A 2ATWA 4C3IH 5M3MG 1YIJA 4HIMA 1N32L 1GVPA 1VQAA 2A1AA 3UDFA 3GTOH 3H3VH 3KLWA 2VZAA 1DGSA 5K36G 2K5VA 3HOVG 1HZCA 2UXDL 4LF4Q 3EBEA 5IP7G 1EIYB 4LF5L 2B3GA 4DV1Q 3UE1A 3RZDH 1R9TH 2YU9H 3H0GG 2WP8J 3MEFA 3CCMA 3RR5A 4JI8Q 5JEAJ 5LMUQ 4KI0A 3S24A 1IL2A 1WOCA 3G4SA 4A3BG 1Y1VH 3I4OA 2E2JH 3RLOA 3IRBA 1VQPA 1IBMQ 4GN3B 2VQEL 3FP9A 1Q12A 4DAYB 4HJAA 3OW2A 4A3MG 2ZJQA 2HHHQ 1N9WA 4GKKL 1X3FA 2MO1A 4TQUS 5H1SE 1Y1WH 1CUKA 1YZ6A 2VS1A 2Y0SG 2ZTEA 1EOVA 5IYBH 3CCEA 3HKSA 2E2IH 2VUMH 1JJ2A 1AE2A 4A3KH 1UE6A 1V9PA 4DPGA 3RNUA 3ZJYC 3E0EA 1L1OA 4A3CG 1HR0L 1X56A 1Q86C 3I2ZA 3GTLH 2NVYH 5IYDH 1V1QA 2JA9A 3G6EA 4RMFA 5IYCH 2AKWB 1QVGA 3A74A 1X9NA 2ALYB 4XIGS 4DUZQ 3S2DH 4DR1L 1QVCA 1P8LA 3W1GA 3HOUG 1J6QA 1JJCB 1VQIA 4JOIC 1YITA 2XTIA 4BXXG 3HOYH 4H02A 2PI2A 2WB1G 1K83H 1NE3A 4HIKA 1N36L 2IX1A 3WWVA 3GTJH 5C0XG 1C9OA 4X64L 4DV7L 4DK6C 4OX9L 1I6HH 4QY7A 1HNXQ 5FLXc 4JG2A 4DV5Q 4BY7H 3H3VI 1AE3A 2N8NA 1Q8KA 3PUVA 5C0XJ 4X6AH 3KF6B 4A3LG 1M1KC 1T9HA 2LXKA 4A3FH 3EN2A 4A93H 4JV5L 3FKIH 1HR0W 2R7DA 3AFQA 2MFIA 1N8RC 4LFBL 2XGTA 1XMQQ 1UE1A 1YHQA 4DUYL 4BY1H 3S1QH 1WFQA 4C3JH 2AHOB 4DV2L 2KBNA 2KCMA 1ASZA 3L0OA 4LF5Q 3STBD 1VQNA 1KD1C 4IFDG 2K52A 3I4NH 4IPCA 3CMEA 3PUXA 4R4IA 4JI4L 2HIXA 5HY6A 1SN8A 1L2FA 2Z0SA 3UDGA 4A3EH 2IY5B 1Z47A 2R92H 4PZ7A 2KHJA 1HNZL 1CKOA 2CWAA 4BBRG 1IBLL 4LF4L 4A3JH 1Q81C 2NN6I 4JC0A 3M3YH 1EUJA 4HJ7A 5M5WH 2VQEQ 1XJVA 1U0LA 1SROA 2LSSA 4GKKQ 1A63A 1W2BA 2JA7G 3PIOA 1GKHA 4JYAL 5GROA 3I4MG 3DLLA 2CQOA 3J7A5 3CCSA 5C4XH 4NXML 5ELOA 2NVQH 2YV5A 4P72A 2YTVA 1VQOA 1SFOH 1K0RA 4QGUA 3HOWG 1XNRQ 1HR0Q 2UU9L 5M5XH 3GTMH 3K0XA 3S1MH 1X3GA 1VQ7A 3GD7A 4IPGA 1E24A 2ZM6Q 2HIVA 3J81c 3OYYA 2MO0A 2WAQG 4OWWB 2EIFA 1Q46A 5AJ3Q 1NY4A 2LXJA 4IJLA 2R7FA 4R4TA 2AWNA 3ERSX 4A3DG 1NTGA 2CWPA 2K14A 3TS0A 1I94L 3GTGH 1CSPA 3UDIA 2JE6I 4IPHA 2MNAA 1OXTA 1FL0A 3OTOL 3CC2A 1B8AA 3BU2A 4JBKA 4AYBG 4JBMA 4JI2L 4AH6A 1C7YA 1I50H 1QZGA 1N36Q 1NMGA 2Z6KC 1FJGL 1WCMH 3TS2A 3DM3A 4DUZL 4X64Q 3CPWA 4DV7Q 4HJ8A 4DR5Q 1X3EA 4OX9Q 4JOIA 1Z9FA 3GO5A 3CXCA 4LWCA 3HOXH 3S14H 1CKNB 3H15A 4JV5Q 1KHIA 3KF6A 5JJLA 5IP9H 1PVOA 2BH8A 3L7ZC 2BA0A 1TWHH 5M3MH 5EAYA 1Y14B 4DUYQ 4L5SA 1YJ9A 1PHJA 4DV0L 1HZAA 1NBWA 4DV2Q 3AQQA 3RLNA 3NELA 3S2HH 1E22A 3F2CA 1UWVA 1SE8A 1E7ZA 2OQ0A 3A0JA 3CC7A 5IP7H 1X65A 3S15H 3F8TA 4ALPA 1RL2A 4YCVA 1I3QH 2R6GA 1EWIA 4FDBA 4A3IG 4R4QA 3H0GH 1XMQL 1L0WA 1PH2A 1E1OA 2KENA 2MQHA 2PMZE 3M85A 2KHIA 3UE0A 2QA4A 1HNZQ 5C4JH 1IBLQ 1D8LA 2FXQA 2I5MX 2JA8G 3PUZA 2YTXA 2VQFL 1OXSC 3B6YA 2JK8A 4OO1I 4LF7Q 5GAEC 4A3BH 4GOPC 1GM5A 3E9HA 1WI5A 3I56A 1VCIA 3G71A 4IO9A 4DR2Q 4A3MH 2B63G 4JYAQ 3CCVA 4BA2I 1TXYA 2OCEA 4ME3A 1PH9A 4NXMQ 4C2MH 1B70B 1G291 4NXNL 5GAHC 4GOPB 1OXUA 2KCTA 1VQLA 4JI7L 2UU9Q 3BJUA 4LUVA 4X66Q 4A3CH 1S40A 1C0AA 3NENA 2OTLA 3KJPA 1QVFA 3PF5A 1VQCA 4DV4L 3GTPH 3W1BA 2R7ZG 4JI6Q 1MKHA 1YJWA 1XNRL 3S1RH 2H5XA 4DV6Q 1JE5A 3CPFA 4L5QA 5C3EG 2ZJPA 1VS0A 4X62Q 5FJ8G 3OTOQ 3RLFA 3KYHC 2ZM6L 4DR3L 1MIUA 2F52A 3Q8DA 4JI2Q 5M3FH 2HT1A 3HOUH 5FLMG 4MTNA 1BVSA 4J15A 5AJ3L 3J81j 1VQ6A 4BXXH 1Q1EA 4OWXB 3GTKH 1VQGA 3RN5A 3KOJA 1VQ4A 3F1ZA 1V43A 2JQOA 4DR7L 2Z6KA 1CKNA 5IWAL 1KC8C 3ULLA 3CW2C 1K8GA 3BZKA 4A3LH 2C35B 3F2BA 4GS3A 4DR5L 1Y1WG 1IXRA 2I5HA 3PUWA 4WJ4A 5IYBG 4DV0Q 2NVTH 1XPUA 1VQMA 3CCUA 1PYSB 2F4VQ 4LF6L 4DR4L 2K4KA 1A8VA 4P71A 3CQZH 5C44H 1I94Q 2DUDA 2Y0SE 1H95A 1FJGQ 4WJ3M 1VQ9A 1PH1A 2ZTDA 1CSQA 1XTDA 2B29A 3CF5A 1E3PA 2VQFQ 2IT1A 4X65Q 4BBRH 4KHPL 1PA6A 1EIFA 2QGQA 4APVA 4IFDJ 1S72A 1BBUA 4AIMA 1JB7A 3M9BA 1K8AC 3A5ZB 2AMCB 1XPOA 2JA7H 4NXNQ 3I4MH 4A3GG 4DK3C 4C3HH 1QUQB 3F2DA 4O2DA 5LMNL 4GOPA 2HQLA 4LF7L 3S17H 4JI7Q 3PO3G 4BY7G 4DR2L 3HOWH 3A5UA 2Q2TA 2RHQB 1PH5A 2JA6G 2N78A 2RHSB 1IBKL 1K9MC 1M90C 2GVAA 5GADC 4LUOA 4DV4Q 3KFUA 3PO2G 3K80C 1KRSA 2NVXH 2OQKA 3HOZG 3CD6A 2E2HH 4X66L 2ID0A 1YHBA 1N34L 1N33Q 4A3DH 2PI2E 4DR3Q 4B3SQ 2I5LX 3U4ZA 3I4NG 1VQDA 4YCWA 5C0XI 4LFCL 4JI6L 4JBJA 4PZ6A 4DV6L 4DNIA 4YY3Q 3J80i 1UE7A 4X62L 1MJCA 1S3OA 1VQHA 2Q2HA 4OXPA 3D0FA 4PMWA 3CCJA 4DR7Q 3BZCA 1KIXA 5IWAQ 4DV3L 5LMNW 3PV0A 5ELNA 3LGJA 1XMOQ 4A4IA 2K5HA 3G48A 3HFZB 3U50C 2ZTCA 4A75A 4QIWE 1MJEA 4OO1G 2UUBQ 4PZ8A 3M4PA 3UDXA 2QEXA 1G51A 2E5LL 3U4VA 4IFDI 4DR4Q 4LF6Q 5GQOA 4Y52H 1TWGH 4JI4Q 2VNUD 4GLXA 4GKJQ 1YVCA 3CP0A 2UXBL 5IE8A 5HGQA 4A76A 1VQJA 2WFWA 3JAMi 4POGA 2CKZB 2A19A 4A3IH 3S1NH 2F4VL 3HKZE 2R93G 1VQKA 3HOVH 4GLAC 1XPRA 4PG3A 3T1YL 1LYLA 4KHPQ 2VL6A 2JA8H 2CCZA 3T1HQ 2V1CC 4EQ5A 2UXCL 4QL5A 1HJPA 4JI5Q 1QZHA 2B63H 1EYGA 2IHFA 4X65L 3FHWA 4YWKA 1OTCA 5LMNQ 2VY3A 2BH2A 1QUQA 4JI1L 2OTJA 1SRUA 2UUAQ 1LUZA 3TEHB 1EQRA 4KHZA 1Q7YC 3ULJA 4BBSG 4LF8Q 1EFWA 2ES2A 2Q2UA 3K81C 1O7IA 3CAMA 1IYJB 1TWFH 4IJHA 5IP9G 2BA1A 1OXVA 1IBKQ 3RN2A 2JA5G 1D7QA 4YWMA 1WYDA 4P73A 2F3IA 4B3TQ 1VQBA 2R7ZH 4LFAL 2UUCL 3W5OA 3EIVA 5E7NA 1N34Q 2K75A 5BR8L 5C3EH 2JEAI 5JEAG 4Y7NH 1JMCA 3PGZA 3PF4A 5FJ8H 3TRZA 2YTYA 4LFCQ 1JJGA 5IT9c 3AFPA 3CCQA 3S16H 5FLMH 1CKMA 4DR6L 4GNXC 1N33L 1GD7A 4MZ9A 4B3SL 1YHAA 2GVBA 1TWCH 1A62A 1VQ5A 2EQSA 1NJIC 4K0KQ 4DV3Q 3STBC 4LW1A 4XTCS 4POFA 3TREA 1Q82C 1XNQQ 4GNXB 4AQYL 1W3SA 2PQAB 4JI3Q 4IPDA 4YY3L 3CCLA 4B3ML 1VQFA 2ASBA 1Y1VG 2D0OA 1UE5A 2E5LQ 3M4OH 1XMOL
chains in the Genus database with same CATH superfamily
1TS2A 5DEHA 2UUBL 1K73C 4GN5A 3J7ZC 4GN4B 4QQBX 4G7OC 1HUNA 1WTHA 4FXDA 1E0BA 3KF8B 3K6OA 5EBDA 2F0WA 1I4XA 5JPMC 1JB3A 1M8AA 1B3AA 4WORA 4KLKA 4JI1Q 3TDQA 4FF2A 2EY1A 3HOYG 1DOLA 3MEHA 1B1ZA 3M7NA 3MFGA 1HZ9A 1AFPA 1X3QA 2K50A 2A8VA 4K6DA 4HCSA 4ZUJA 1NMFA 3TS2A 2K5NA 2UUCQ 4NB3A 2QDLA 2UXDQ 1EIHA 2L15A 3M4QA 3SHLA 1YJNA 5FO7B 2IHEA 3RZDB 2K01A 4B3TL 4OL7A 3ICEA 1SAPA 1C4QA 1GO3E 5KNBA 1HRJA 2DJFC 1EYDA 4DV1L 4C2MB 1MBYA 1Y1VB 1GUTA 4Q0FA 3D31A 3T53B 2Y0SB 1F77A 1K8MA 1ZYRC 2B2UC 1II3A 4KY6A 2KEDA 1PFSA 1X32A 2XWJB 2EYHA 1IBML 1CQVA 1PFNA 1EWHA 2K05A 3J80c 1L1OC 4QCLA 3W2DA 1HH2P 1I4HA 2N49A 2WIIB 1PYBA 1L1OB 2NZOA 4DNRB 1PH6A 4HIOA 2WB1B 4OWTB 4CDCC 3PIPA 2BCOA 5IY0A 1B9NA 2B39A 1J5EQ 3TZUA 1KDCA 4HMIA 1K83B 4KMUC 1SYCA 3IFTA 3BDOA 5L37A 4ID6A 4YHHQ 1TIID 2L11A 2HDMA 4O0AA 3HG9A 5C5LA 4HJ9A 2F0UA 1K3RA 3D8GA 4DV5L 1SSOA 1HHVA 2SEBD 2ATWA 4C3IH 4HIMA 3UDFA 1U4RA 2VZAA 4HAEA 1I4QA 4A3EB 5IP7G 1EIYB 3NWTA 1O78A 4DXGA 5ELEA 4JI8Q 2EDGA 4G4KA 5M5WB 4KI0A 3L3OC 5KNCA 1IL2A 1G91A 5IOCA 1WTXA 4A3BG 3I4OA 1XX8A 3RLOA 5C4XB 3FP9A 4DAYB 4KV6A 3OPOA 3R2TA 2ZJQA 4IURA 1X3FA 2NN6H 3MXNA 5H1SE 3GTMB 2E2HB 3MVVA 1EWCA 1EOVA 1W6KA 3H94A 3HKSA 2A6HC 1JJ2A 4DPGA 1JR0D 5IYDH 3G6EA 1LT3D 2ALYB 4DUZQ 3BYYB 1QVCA 3HOUG 1J6QA 1JJCB 1STYA 4H02A 3A55A 3HOXB 5CGKA 2IX1A 1STAA 4QY7A 5M3MB 2N8NA 1Q8KA 3NTHA 4A93H 3FKIH 4F88A 3HOVB 4RHSA 3S1QH 3NK9A 1G8ZD 1S5BD 3TP8A 3L0OA 2IW3A 1ASZA 2PZUA 4FP5D 4R4IA 5CBAE 5HY6A 2IY5B 2Z0SA 3UDGA 2L1BA 1HQRD 4PZ7A 5I4DA 4FO2A 1Z7TA 2XN9C 3M3YH 2NN6I 1JC7A 4XDXA 2VQEQ 1XJVA 1SROA 2LSSA 1W2BA 1TR5A 3DLLA 4C3HG 4J8QA 2PW5A 3CCSA 2YV5A 1SFOH 1B9MA 1XNRQ 2UU9L 3DWPA 2K1BA 2A6EC 4O42A 5CBEE 3GD7A 4QUFA 4IPGA 2PNRC 3P75A 4PMBA 2MO0A 2WAQG 3SXHA 4OWWB 5LL6X 2J4XA 4IJLA 2AUKA 2R7FA 3MHBA 4A3DG 1NTGA 3GTGH 3GTKB 3RUZA 2JE6I 4FF4A 3I72A 4IPHA 3OTOL 4JI2L 1WCMH 1VMCA 4X64Q 4HJ8A 4DR5Q 2CQAA 1SNQA 4JOIA 1BF4A 1K3BC 4ME5A 2MJ8A 2SOBA 1CKNB 3H15A 4Q5VA 3KF6A 1HPCA 5IP9H 5EAYA 3T4AC 1V1PB 4DUYQ 1JWSD 1YJ9A 1F2LA 1HZAA 1NBWA 1F9PA 1CA5A 1AW7A 3CHBD 3NP8A 3A0JA 1QCBD 3I90A 4JI4Q 1XMQL 3M85A 2F0SA 4A3GB 1HNZQ 1O7YA 1HUMA 1IBLQ 1ET9A 2FXQA 2I5MX 2C5CA 3PUZA 2YTXA 2JA7B 1OXSC 3A8KE 2JK8A 4OO1I 4PV1C 1WI5A 4EVOA 1A2TA 3G71A 4DR2Q 4A3MH 3CCVA 4RAUC 3MXUA 2QF7A 3HOZB 4NXNL 2KCTA 3T56B 3X3NA 5IGDA 4A3CH 1KDAA 1C0AA 2OTLA 4B08A 1QVFA 3VR2A 1JWMD 1VQCA 4DV4L 4JI6Q 1JICA 2PCFB 4AYBB 1CK1A 2RVLA 4CGYB 2A69C 2E75C 2ZM6L 3Q8DA 4O1NA 5FLMG 4MTNA 4J15A 5EPLA 4BXXH 3RN5A 5E4XA 1WTVA 5C0XH 3F1ZA 2JQOA 4PMCA 4EQNA 1EU3A 4DR7L 2Z6KA 5M5YB 2OXPA 2MP1A 3ULLA 1K8GA 3BZKA 4KHVA 1Y1WG 1IXRA 2I5HA 2J7ZA 2NTTA 1XPUA 3CCUA 4LF6L 2N55A 3S1NB 4P71A 4IFDH 1I94Q 2Y0SE 5COYA 1FJGQ 2JA8B 1KDBA 1VQ9A 1H9SA 1DM0B 5FLXL 2JN4A 1E3PA 2IT1A 4X65Q 4BBRH 4BBSB 1A6XA 4KJNA 1PA6A 4IFDJ 1S72A 2JA5B 3V96A 4R8NA 3H3VC 1XPOA 3I4MH 4DK3C 3F2DA 5LMNL 3S17H 4JI7Q 4HEDA 1LACA 3VR5A 2R7ZB 5CV6A 4N8FA 2N78A 5C3EB 2GVAA 5GADC 1EY4A 4LUOA 4X3TA 2IPKD 2V4DA 1U4MA 2YU9B 5E4WC 5FO8B 3J7AF 1D1KA 3U4ZA 1L0YB 1VQDA 5C0XI 5CV7A 5CV5A 4RGTA 4YY3Q 4ZKBB 4X62L 1VQHA 5IGBA 1PRTD 2Q2HA 3NSWA 3D0FA 3EA6A 1E2VA 3DM1A 5LMNW 5CORA 4QF4A 5T1IA 4A75A 3Q6SA 4KKSA 4QIWE 1HFNA 2AQ3B 3UDXA 2QEXA 4IFDI 2E5LL 3Q23A 3GTLB 1EYCA 5GQOA 1WTRA 3CP0A 5IE8A 1J8IA 1VQJA 4NDXA 1JQYD 3S2DB 1LTAD 2CKZB 5J22A 4POGA 2RSOA 3QB3A 2NWGA 3HOYB 1XPRA 1LYLA 3MC0B 3EJIA 4TSSA 3GTJB 4JI5Q 3F2UA 1QZHA 4KY5A 3A7LA 4BY7B 4YWKA 2OTJA 2BH2A 4JI1L 2UUAQ 3TN2A 1EQRA 1GHJA 2EYFA 1EFWA 3K81C 3KLSA 3HGBA 1NNXA 4YWMA 2K03A 3I4NB 3EQLC 2UUCL 4C3IG 4QB4A 2X6GA 5JOBA 1GUGA 3M4OB 3KLRA 2F03A 2EYMA 2EJGC 1JJGA 1HA6A 1EOTA 1KABA 3SK6A 2ZXPA 4GNXC 4IUQA 1YHAA 2GVBA 1HTPA 1A62A 2A68C 1RJTA 3BDCA 4DV3Q 3STBC 3S9WA 3TREA 4GNXB 4JI3Q 1W3SA 4JPBW 1Q90A 3CCLA 5G3LF 3S1MB 4V0BA 2XWBB 3OWFA 5LHY1 1QE6A 2NN6G 4UP9A 1KL9A 2VB3X 1KLUD 1TKWB 4XQJA 4RG1A 1BBWA 2RCNA 4CJ2C 4HJ5A 1UEBA 2F0NA 3K7AH 5IYDG 4N8X1 3EROA 4WFN3 4CHTB 1SE3A 4EX5A 1A2UA 1JOKA 2WKDA 1QNUA 1Q1BA 5DLQE 3K57A 1J5EL 3CC4A 1B7YB 5J39A 4OONA 4YHHL 1FVIA 1TWHB 4CKBA 5JJKA 1CI3M 1PH3A 3VYUA 1JT8A 3JC66 3S2HB 5I9OA 2Q2IA 1PYWD 3S15B 1Z6HA 2EXDA 4LFAQ 3PO2H 5KEEA 1EQVA 1LTTD 5BR8Q 4A93G 2I0QA 3FKIG 2BE5D 1X6OA 4JVZA 1EQQA 2WV6D 1R4PB 1KAWA 1TWAH 1LTLA 1R9TB 2PNHA 4DR6Q 1A0IA 1U9RA 2NB0A 2F0EA 4DAMA 1SMXA 2Z6BA 4JI8L 1ENFA 2PQAA 1OO9B 1KQSA 3RZOH 1SMYC 4K0KL 2NZHA 1P16A 2OT2A 2O5IC 4A3KB 1XNQL 4QJFA 3U58A 3S1RB 1BUVT 3AYHB 2GA4B 2RKSA 1S5ED 2DNCA 1UNSA 1VQ8A 2F0OA 5BN4A 5IGFA 2HCIA 5M3FB 1LM0A 1VF5C 1VQEA 1YEZA 3TQYA 2RDHA 3IAYA 1SJHD 2L4NA 1TU2B 4B9XA 3QJYA 4LF9Q 1HNWQ 1NUCA 4X3KA 5JVG3 1X55A 2IJ0A 5I9PA 1LABA 1YI2A 1SE2A 1XTCD 1WCMG 1D2BA 4DXFA 1U4LA 4AYBE 4DK0A 4JI0L 5C44B 4LFBQ 1YBYA 2B2WC 1STEA 4B3RQ 4C3JB 1IZ6A 2L0CA 1EIGA 4ZKCB 1YIJA 1N32L 1Q3LA 1GVPA 1W6JA 2EOTA 1VQAA 1DGSA 3IL8A 1ZKOA 5DM73 1HZCA 5A2QE 2RA4A 3RZDH 2AQ1B 2WP8J 3CCMA 1EEFD 1EEID 3NE5B 3RR5A 5JEAJ 4M8AA 5LMUQ 2SNSA 1PZID 1WTOA 5JJZA 4NP5A 3HKZB 1Y1VH 2E2JH 1SDFA 2VQEL 2NVQB 4A3MG 4HJAA 2B8FA 1SNMA 2B2UA 5IT9L 4HMJA 3X3MA 3OW2A 3DWAA 1BCPD 2OEOA 4M1UB 2N88A 3DXJC 4UHVA 1Y1WH 5JVH3 3RD4A 1V9PA 3ZJYC 3E0EA 1L1OA 4A3CG 5C4HA 3H09A 2JA9A 4JK1C 1HCZA 1EQTA 1DD2A 2AKWB 1QVGA 1X9NA 4XIGS 3G6JB 1BNZA 4DR1L 1TQOA 2E2DC 3W1GA 2X69A 4BXXG 2PZTA 1K83H 1NE3A 1O7ZA 2EXZA 4PQXA 5C0XG 1C9OA 4X64L 4DK6C 1GUSA 2F0HA 4WRDA 1HNXQ 5FLXc 1A3UA 4ZYSA 3TZDA 1MGSA 1UE1A 4DUYL 4BY1H 1PTOC 2OF1A 1WFQA 3H0GB 4J6HA 2KBNA 4LF5Q 1KD1C 4IFDG 2K52A 5C4JB 2JYOA 4IUVA 1JORA 3D6CA 1PTOB 4IPCA 1E2ZA 3J7YW 4JI4L 2HIXA 4A3EH 2CW0C 1Z47A 2R92H 1HNZL 4LF4L 1DXMA 1CKOA 2CWAA 4BBRG 1IBLL 1T5XD 4RGOS 5HURA 1EUJA 2KCNA 3HEJA 5M5WH 1BBXC 1U0LA 4DAYA 5EKIA 1H9RA 1WTQA 1EFID 3I4MG 2CQOA 5ELFA 3ITPA 5C4XH 3NQTA 5ELOA 2Z8LA 2YTVA 1TT2A 1EZ8A 4QGUA 1IKLA 3GTPB 2K7VA 1HR0Q 5M5XH 4U68A 2F3VA 3GTMH 3OOCA 1GUOA 3OYYA 1IKMA 1TWCB 2EIFA 2F0DA 1B2TA 1NY4A 2LXJA 5IGGA 4R4TA 2AWNA 2CWPA 2K14A 1XWEA 1OXTA 3CC2A 1RHPA 4JBKA 2KVMA 1N36Q 1LT4D 2G5DA 3V05A 4DV7Q 1O7LA 4XXEA 4OX9Q 3GO5A 4LWCA 3HOXH 4UAIA 2MGSA 3SK8A 1KHIA 2EJMA 2KA7A 4FYDA 2BH8A 1PMRA 3V2TA 5FKAC 5M3MH 1KAAA 2F0KA 4N9TA 5BN3A 3JAML 3AQQA 3CRLC 1E22A 1UWVA 1ZXTA 3CC7A 4ALPA 4YCVA 1I3QH 1ZYRD 1EWIA 2R6GA 1I94L 1PH2A 1FJGL 2MQHA 2KENA 1I6VC 2PMZE 3MA2B 2KHIA 3UE0A 2QA4A 1RD9D 1BR9A 3Q0AA 2EE1A 4GOPC 3E9HA 5EJWA 4RKBA 4IO9A 4JYAQ 3RMHA 1VMPA 3OWEB 4NXMQ 3BZDB 1G291 4GOPB 1OXUA 5EQ0A 4XQQA 4JI7L 4LUVA 4X66Q 3WDNA 1DOKA 3R2IA 4I7ZC 2F0TA 3KJPA 5T1GA 2NTSA 1CHPD 2H5XA 1JE5A 2K5QA 2JSOA 3MTSA 3J80E 4C1NK 1MIUA 2HT1A 1VQ6A 5AJ3L 3J81j 1Q1EA 3GTKH 3M4YA 1VQGA 5LL6S 2QDBA 1SYEA 2F0FA 1CKNA 4N9PA 4RCNA 4A3LH 2Q8IB 3F2BA 2QW7A 3PUWA 1C48A 1SBBB 1V1PA 2LKVA 4DV0Q 2NVTH 4DFAA 1VQMA 4OELB 4DU9A 2F4VQ 4LMQD 4A3IB 3CQZH 2DUDA 1H95A 1BO0A 4FXGC 4WJ3M 1PH1A 4ZLTF 1LV9A 3W3AA 2B63B 2TMPA 2QGQA 2F0PA 2HD3A 4OIKA 3VYSA 3M9BA 2JA7H 2AMCB 1QUQB 2B2YC 2G9DA 2HQLA 4C3IB 4LF7L 3P1HA 3HOWH 2RHQB 2RHSB 4ZAIA 1ML0D 4H0LC 4LJZC 3PO2G 3P7JA 1QB5D 1KRSA 4CDFC 2OQKA 2NVXH 3CD6A 4OGQC 4X3UA 1IYUA 1YHBA 2I5LX 2DNEA 1CT1D 3NWSA 4JBJA 4DV6L 1B44D 4FNFA 2QCPX 4PMWA 1TS4A 2ZXRA 3J81L 1KIXA 4DV3L 1Q8IA 2QKIC 5ELNA 1RTNA 1HFGA 2K5HA 3HFZB 2ZTCA 2UUBQ 2B2VC 2BOSA 1STGA 4DF7A 4DR4Q 3OMCA 4Y52H 1EZ6A 1TWGH 2VNUD 1DJRD 2K32A 3JAMi 4UDUC 3S1NH 4RGMA 3HKZE 4K5VA 4DAPA 1VQKA 4PG3A 1CTMA 4KHPQ 2JA8H 2CCZA 3SDZA 3AU7A 3PO3B 5G3LD 3QR8A 2IHFA 1PZKD 1OTCA 4HSPA 4K2KA 1A3TA 1FR3A 1LUZA 1JCKB 2RSNA 3TEHB 2JA6B 4IQZA 4KHZA 1L0XB 5FOBB 2Q2UA 4F8MA 1TWFH 4IJHA 2BA1A 4TRDA 1PTOF 5EGTA 3AMUA 1G6ZA 1WYDA 1NAPA 4P73A 2M00A 4B3TQ 4H13C 2R7ZH 4LFAL 3EIVA 5E7NA 5BR8L 5C3EH 5JEAG 4Y7NH 1B53A 3A54A 2B2TC 2WKCA 1WVLA 4LFCQ 3M3YB 5IT9c 3S16H 4DR6L 1RDPD 1LTSD 3PQIA 1N33L 2M2LA 1GD7A 4B3SL 2EQSA 2Z4HA 2H4OA 3OIPA 4POFA 1SFOB 5D65A 3K58A 2H1EA 3DEPA 1IW7C 4HCEA 1Y1VG 2D0OA 1UE5A 2XVSA 2ZXOA 5TSSA 1XMOL 5JJIA 2UXBQ 3L2PA 3GTQB 1SJED 3KLSX 2R93B 2L9HA 1KXLA 4UP7A 1S5DD 3T1YQ 1SXTA 4GKJL 1WCMB 4EQOA 2OWOA 3KDFB 1RIPA 2EY5A 2IX0A 1LO5D 1PLFA 2DGYA 2HQEA 4LF9L 1HNWL 3KJOA 3O13A 3T1HL 3OHXC 2BDOA 3E9IA 2AQ2B 4UPAA 2LMCB 1PH4A 1NCVA 2A5HA 4E6IA 1PH8A 2WB1E 1A3VA 1B50A 3GTOB 2K5DA 4LF8L 2F0QA 4B3RL 2CH4A 2P5ZX 4OEMB 4PNYA 4P74A 4TVAB 1HQMC 4BY1G 1EY8A 3GP7A 1A15A 1XXGA 1AH9A 5ELDA 2CVRA 2F1MA 5D14A 4A3EG 1TY0A 1FGUA 3QOLA 2R92G 4GNXA 5LMUL 4UP8A 3AEVA 1CQFA 5IGEA 1ASYA 1NR2A 4I7AA 3J81i 3ULPA 1SLJA 3N52A 3PSIA 3URYA 1SYFA 5E1FA 4F87A 4QUCA 1SNPA 4DAVA 2GN5A 3PCOB 5C4XG 1HZBA 2I46A 3WOFA 1EYAA 4ILWA 1YNJC 1I5FA 3P20A 2E8GA 1EY6A 2FHTA 4NPSA 5CYUA 4JBWA 3NBIA 3NBHB 2RDFA 1B3QA 4I65A 1PZJD 3QIAA 1YNXA 4R4CA 1CM9A 3JAMc 2KCCA 4KKUA 4IOAA 2RBMA 1IYVA 4UY8C 3LWUA 3L9AX 3HOXG 2KEEA 4JCVE 1HNXL 2EVBA 4IUNA 3SK4A 2MHVA 5M3MG 2A73B 1R4QB 2A1AA 2HCCA 4BBRB 3DWQA 2K5VA 1QNKA 1DZ1A 3HOVG 5KGUA 2UXDL 4LF5L 2B3GA 3UE1A 1R9TH 4XT1B 1HXYD 1PXUA 2K5WA 2SNMA 3S17B 1RTOA 1WOCA 3QWNA 2FMMA 5NUCA 1SE4A 2FMCA 1VQPA 3MXGA 1Q12A 2HHHQ 1N9WA 2MO1A 1ICWA 1FNUA 1CUKA 1PFBA 2VS1A 2ZTEA 1FNVA 2D9UA 3CCEA 2VUMH 2E2IH 1AE2A 4A3KH 3MXPA 2F0JA 5DNFA 1HR0L 1X56A 2NVYH 5EKLA 1V1QA 4RMFA 5IYCH 1AZQA 1SNDA 2LY7A 1ICFB 1I50B 2DY7A 4HR7B 1VQIA 4ZCKA 2XTIA 2LS01 5F2DA 2Q8RE 3S14B 4HIKA 1N36L 3WWVA 4DV7L 3ND9A 4OX9L 1I6HH 4JG2A 4A3LG 1M1KC 1T9HA 4A3FH 1RODA 3EN2A 1ENCA 1HR0W 5CV4A 2J0TD 3SK5A 3AFQA 2MFIA 2HUGA 2XGTA 1XMQQ 2E76C 2B2WA 5BN5A 3HS0C 4C3JH 5KYIA 2KCMA 2SDFA 3STBD 1VQNA 1NR4A 1KNEA 2M9VA 3CMEA 3PUXA 4A3BB 1STHA 1SN8A 1TY2A 1EY7A 1MSGA 3BG3A 1ILPA 1C8CA 4A3JH 4FVMA 4JC0A 1Q81C 4L8JA 4IUUA 4GKKQ 2JA7G 1GKHA 5M9OA 1SNOA 4JYAL 3J7A5 4NXML 3GQBA 2NVQH 3NTKA 3HOWG 1ILQA 3A56A 4MTKA 1VQ7A 4H7BA 3FDTA 1E24A 4OHJA 2ZM6Q 4C1NI 3J81c 1CA6A 2QILA 4TKOB 3HOUB 3KF8A 4DA2A 3TS0A 1CSPA 3UDIA 1FL0A 1K28A 3BU2A 4AYBG 4DN4M 4JBMA 3DM3A 4QMGA 3CPWA 4KN4C 4DUZL 1X3EA 5I2YA 4HSVA 3CXCA 4RFBA 4RH6A 4JV5Q 5JPNC 2BA0A 1Y14B 3M7GA 4L5SA 3E5SA 5K36H 4DV0L 4DV2Q 1BCPC 1YNND 3F2CA 2OQ0A 5JEAH 5C3XA 2K28A 1QG7A 2D5DA 5E3FA 3H0GH 1BCPB 1L0WA 1E1OA 1V8QA 5C4JH 1SMYD 1D8LA 2JA8G 3EVQA 1PTOH 3TSSA 4C3HB 1GM5A 2FFKB 5C3WA 4IUPA 3PO2B 1PH9A 2OCEA 4C2MH 1B70B 5GAHC 4CBVA 4DNTB 3BJUA 2WAQB 1TWAB 1S40A 3NENA 4NMZA 1CHQD 4A3DB 3GTPH 3W1BA 2R7ZG 2EPBA 1MKHA 3MWYW 1XNRL 5C3EG 2Z4IA 5C4ZA 1GOZA 4X62Q 3RLFA 5KRUA 3I8ZA 2F52A 3RZOB 2K6AA 1BVSA 2RQXA 4MN3A 3KOJA 1D6EC 3H91A 2ICIA 1AN8A 1B4OA 1STBA 3BVZA 1VF7A 4BWGB 1E2WA 3CW2C 3NHHA 2C35B 4DR5L 4GS3A 1S5FD 4WJ4A 5IYBG 1PFMA 3U9SA 1PYSB 4DR4L 2K4KA 3OMGA 2B8GA 2PW7A 3FVQA 3R3OA 2ZTDA 3PIP3 1CSQA 1XTDA 3CF5A 2VQFQ 1ONLA 4V190 4OIJA 4KHPL 3IFDA 1EIFA 4APVA 1BBUA 1JB7A 3TBIB 4O2DA 4GOPA 4K5XA 3LWEA 4BY7G 4DR2L 2K33A 4K2LA 4RCOA 1PH5A 1K9MC 3KFUA 2AUJD 1TS3A 3K80C 4K8JA 3I91A 4JW0A 3K59A 1Y69U 5C6AA 2E2HH 2ID0A 2L55A 2MUYA 1UAPA 4KY7A 2PI2E 3Q24A 4DR3Q 3I4NG 1LTGD 4YCWA 4K8IA 4LFCL 4JI6L 2E2JB 1GUNA 4PZ6A 1UE7A 5J1ZA 1MJCA 1S3OA 4B9WA 3CCJA 1BQQT 1Y1WB 1DONA 5IWAQ 5CV9A 3WOEA 1M4VA 4A4IA 3G48A 2FJ2A 3H6MA 2WINB 1PTOD 4CDEC 1ZEQX 4IALA 2R3ZA 5CV8A 2EY2A 2UXBL 5HGQA 4A76A 4R9WA 3C2PA 2WFWA 2CW0D 2PZWA 2NUCA 4A3IH 5FLXE 3HOVH 4F7XA 1AZPA 1K8OA 2XIWA 3T1YL 2VL6A 2V1CC 5CMDA 5IODA 2PPBC 4J1MA 1LT5D 4QL5A 4GZYC 1F9QA 2B63H 1LLRD 2O4XA 4X65L 4ZRZA 2XSCA 2VY3A 3ONAB 1QUQA 1RCVD 1SRUA 4FF1A 4R8IA 1V1OA 1EY9A 5K5PA 4BY1B 1Y8NB 1O7IA 1IYJB 1IBKQ 1OXVA 1RKNA 2B2YA 3RN2A 1D7QA 3CKIB 2F3IA 2F0VA 4QIWB 3W5OA 1N34Q 2K75A 3A7AB 4FXKC 3PGZA 1JMCA 3VR3A 3E3XA 2PQEA 3FMCA 5FJ8H 1WTWA 2R92B 2YTYA 1CFMA 3C1EA 3CCQA 1CKMA 5KNDA 1VQ5A 5FO9B 4K0KQ 1LT6D 4LK1C 3D6WA 4ODGA 4ZUIA 1XNQQ 4YY3L 4CKCA 3I70A 5M5XB 1EY0A 2JXMB 3FRPB 4R1JA 2D0PA 3PUYA 3SE0A 1ESFA 4NKLA 4ULLA 2B2VA 2VUMG 1FGBD 2O5JC 3K7UC 4A3KG 1WJJA 3IKJA 3VYRA 1E1TA 4ABNA 3LX0A 3A8JE 2CFMA 3CRKC 3D4WA 4ZQ3A 4X3SA 3CCRA 4FF3A 3D3RA 1HA5A 4XYQA 1K0SA 2UXCQ 3GDEA 5M3FG 5IYCG 1DYQA 1U5KA 2A74C 4K5WA 3J7AV 5CC4A 2JJQA 2N3SA 3OW7A 2Q8TA 4A3GH 4JI0Q 1PV4A 1LTID 3PO3H 4JI5L 2F4IA 3SGIA 3U9OA 2A6HD 3UI2A 2ZJRA 1N32Q 1BCPF 2JA6H 3D4RA 4GLVB 2UUAL 2D62A 4LUZA 4C56C 1I3QB 4DKAC 3HOZH 3K8AA 4A3FG 4IUTA 5C44G 1F2YA 2KHSA 4C3JG 5IGCA 4LNQA 3K5MA 2EYJA 5A2QL 4IOCA 2JEBI 1LTBD 2B2TA 1PH7A 4AQYQ 2AWOA 4B3MQ 3I55A 4BA1I 1JOQA 4A3JG 2RF4A 4OO1H 1X54A 3CMAA 3NTIA 3D4DA 4KD4A 3I4LA 2YYZA 5GAGC 2E74C 4JI3L 3I7FA 3HKZG 2HHHL 3MXNB 1QILA 3NEMA 1F9RA 1BKBA 4YCUA 4YWLA 3T16A 5M5YH 4L5TA 4MNOA 3R8BA 1XYIA 2ICEC 3BVMA 3GTQH 3TMEA 2R93H 4KJOA 4DR1Q 3ER0A 1GHKA 5J3BA 1SEBD 3KDFA 1D5XC 3C1FA 4R4OA 1SYDA 4CDDC 3VYTA 4L63B 2WAQE 1I4RA 3VDYA 4LAAA 4RA8A 4P75A 1GUWA 2NVTB 4BBSH 4CJ0B 1KRTA 5I6WA 2VW9A 4L5RC 1SR3A 4A93B 3C3LA 2JA5H 2A6ED 3CQZB 3FKIB 5AFWA 3NXWA 1OXXK 3SVMA 3Q22A 3HRZC 1G6PA 3S1QB 4HIDA 3MFYA 3HZXA 1JWUD 4XYOA 3GTOH 5DM63 3H3VH 5K36G 3KLWA 1AP0A 3ZYYX 4CKEA 5EPKA 2I07B 4LF4Q 3EBEA 4G7ZC 4DV1Q 2YU9H 1WD0A 4RKLA 3H0GG 3MEFA 4G7HC 3S24A 2EYOA 3EFXD 2G9HD 1S5CD 2EY6A 1T5EA 3HOWB 3G4SA 2LFNA 2EYPA 3IRBA 1IBMQ 4GN3B 3GV3A 1RF2D 4GKKL 3PIO3 1MD2D 2NVXB 2WACA 4TQUS 1I4PA 4KN7C 4ZK9B 1YZ6A 2Y0SG 4NW2A 5IYBH 2F0IA 1ET6A 3TP6A 1UE6A 3RNUA 1Q86C 3I2ZA 4IN3A 3GTLH 3MAQA 3GTGB 1J9OA 3NBHA 1D5MC 2EJFC 2KECA 3QOJA 3A74A 2L12A 3OIQA 3S2DH 4KKTA 1P8LA 5I6YA 1KTKA 1Y8PB 4JOIC 1YITA 1BDOA 3HOYH 2PI2A 2WB1G 3A8IE 2HDLA 3GTJH 1TWGB 2O2LD 5ELCA 1EL0A 1PDQA 4DV5Q 3KUPA 4BY7H 2ENBA 3H3VI 1AE3A 1PRTC 3PUVA 2Z1CA 5I2XA 2DJGC 3KF6B 5C0XJ 4X6AH 2LXKA 4JV5L 3K0YA 2R7DA 4MHEA 2XRQD 3K5NA 3QG1A 5C5MA 1N8RC 4LFBL 1YHQA 2A69D 1PRTB 2AHOB 3CU7A 4DV2L 3ND8A 3VR6A 5IIFA 1KNAA 3I4NH 5ISRA 2RDGA 4G57A 4U673 4P2CB 1IW7D 2Z9HA 1L2FA 3M4OH 2KHJA 4A3MB 1EY5A 5CR3A 4HJ7A 1TWFB 2KQ3A 5FK9C 2CH4W 1A63A 5IT9E 3PIOA 1LTRD 3KBXA 5GROA 1ENAA 4P72A 4IZ8A 4Y7NB 1VQOA 1EU4A 1K0RA 3S1MH 1JE4A 3K0XA 4XQNA 3S16B 1X3GA 4XT3B 2HIVA 1SYBA 1Q46A 5AJ3Q 3TP5A 3ERSX 1FD7D 1DCZA 3J80L 3FPUB 1G2TA 2MNAA 2PYKA 4K6LA 1D1IA 1B8AA 1SYGA 4AH6A 1C7YA 1I50H 1QZGA 1NMGA 2Z6KC 4HTHA 1X3PA 5EKKA 2XRSD 1Z9FA 2QEJC 4DGZA 3S14H 2X6LA 3N6RA 1F2MA 3T51B 1UUPA 1PVOA 5JJLA 3L7ZC 2NZ1D 1TWHH 3BDLA 1PHJA 1IHZA 5KIXA 3RLNA 3NELA 3S2HH 3K5OA 3BVGA 1SE8A 1E7ZA 5IP7H 1X65A 3S15H 2F3WA 3F8TA 1RL2A 1JOOA 4FDBA 4BS9A 4A3IG 4R4QA 1H9SB 4DK1A 3TRZA 1GXDC 4K14A 2VQFL 1MI2A 3B6YA 5JAVA 3I4MB 4LF7Q 5GAEC 4A3BH 4YIJA 3I56A 2F0GA 1VCIA 1Y8OB 2B63G 4BA2I 1O80A 1TXYA 4ME3A 1YNJD 3DHQA 2BDNA 1VQLA 2UU9Q 4MIUA 1H9JA 1H9MA 2ZT9C 2JP1A 2IX3A 3PF5A 2EYLA 2DY8A 3E6ZX 5D3IB 1YJWA 3S1RH 3VR4A 2KOLA 4DV6Q 3CPFA 4L5QA 2ZJPA 1VS0A 5FJ8G 3OTOQ 4EQPA 3KYHC 2D2CC 4DR3L 4H44C 4WJWA 4JI2Q 1TVXA 5M3FH 3HOUH 2BE5C 3C46A 4OWXB 2C9OA 1BXTA 1VQ4A 2PMZB 2F0LA 1V43A 3K5LA 2DN8A 3AB9A 5IWAL 1KC8C 5A35A 3QO2A 1FYCA 1HTLD 3DEOA 1NSNS 2VB2X 3T13A 3JAME 1AEXA 1S4ZA 1A8VA 5C44H 2KUMA 1G2SA 1I4GA 2A68D 1H9KA 2B29A 1KLGD 2EZVA 3PMFA 4AIMA 3E0JA 1K8AC 1QJOA 3A5ZB 1F9SA 4NXNQ 4A3GG 4C3HH 1TS5A 3PO3G 3VA7A 4RWSC 4KD3A 2F0MA 3FPPA 3A5UA 2Q2TA 1U4PA 1QOHA 2JA6G 1IBKL 1M90C 2KJXA 4DV4Q 1VDZA 1GJXA 3HOZG 2TSSA 5DAUA 5EBCA 4X66L 2NYZD 1N34L 1N33Q 4A3DH 4B3SQ 3GV6A 3MZ5A 3OSOA 1YNNC 5D3DA 2XNAC 3HP3A 4DNIA 4CJ1B 3J80i 5HGTA 2R61A 4OXPA 4DR7Q 3BZCA 3NUCA 1BOSA 1XMOQ 3PV0A 2FINB 3LGJA 2VUMB 4Z9CB 2E2IB 3U50C 1MJEA 4OO1G 3BYTB 4PZ8A 3M4PA 1G51A 3I73A 3U4VA 4L6TB 2IWHA 4LF6Q 2NVYB 3ERQA 4GLXA 4GKJQ 1YVCA 4EGVA 3K7AB 3G7LA 2A19A 3LNNA 2F4VL 2R93G 1STNA 4GLAC 3SR1A 3NQIA 2NBFA 3T1HQ 4EQ5A 3NPPA 2UXCL 1I6HB 1DOMA 1HJPA 3DMUA 1EYGA 3FHWA 5LMNQ 1PRTF 3KBGA 4A3FB 1Q7YC 3ULJA 5ELBA 4BBSG 4LF8Q 2ES2A 1CZGA 1UEAB 3CAMA 5IP9G 2IL8A 3TP7A 2JA5G 3SEBA 3FEWX 3I3CA 1MHWC 1F2ZA 1CZWA 1ESRA 4KK7A 1VQBA 1MSHA 2RCFA 1D5ZC 2JEAI 3VA5A 3PF4A 4RHRA 2K04A 3KK7A 4KTAA 4A3JB 3AFPA 1WD1A 2CHBD 5EPJA 5FLMH 1IL8A 4MZ9A 3BS1A 1TWCH 1NJIC 3DUZA 4LW1A 4XTCS 3J81E 4HN7A 4RGNA 1Q82C 4AQYL 2PQAB 1SNCA 4IPDA 4S3SA 3R93A 4B3ML 2L5TA 2VXWA 1VQFA 2ASBA 1WTPA 1QWYA 5KYLA 2E5LQ 2MPMA 2PO4A 1FNWA
chains in the Genus database with same CATH topology
4R1JA 2D0PA 2NN6G 3PUYA 2UXBQ 4UP9A 1KL9A 3L2PA 2UUBL 1K73C 4GN5A 3J7ZC 2VUMG 4GN4B 4QQBX 3K7UC 4A3KG 1WJJA 4RG1A 1E1TA 1KXLA 1BBWA 4UP7A 2CFMA 2RCNA 3T1YQ 3KF8B 4HJ5A 1UEBA 4GKJL 3CCRA 5IYDG 3K7AH 2OWOA 3KDFB 3GDEA 1RIPA 4EX5A 5IYCG 2IX0A 5M3FG 2UXCQ 1U5KA 4KLKA 5JJIA 5DLQE 1Q1BA 2JJQA 1J5EL 3CC4A 2DGYA 2N3SA 4LF9L 1B7YB 4JI1Q 1HNWL 4OONA 3KJOA 3T1HL 4JI0Q 4A3GH 3HOYG 4YHHL 1FVIA 1PV4A 3PO3H 4JI5L 5JJKA 3SGIA 3E9IA 2ZJRA 4UPAA 1PH3A 3M7NA 1HZ9A 1JT8A 1PH4A 3JC66 2K50A 2A8VA 1N32Q 2JA6H 4GLVB 2UUAL 1NMFA 2D62A 2K5NA 2Q2IA 2WB1E 1PH8A 2EXDA 4LFAQ 3PO2H 2UUCQ 4LUZA 4NB3A 4DKAC 4LF8L 3HOZH 5BR8Q 3K8AA 4A3FG 4A93G 2UXDQ 2I0QA 3FKIG 4B3RL 2L15A 3M4QA 5C44G 1X6OA 1YJNA 1EQQA 4P74A 2IHEA 4TVAB 4BY1G 1KAWA 1TWAH 1LTLA 4B3TL 4LNQA 2PNHA 3ICEA 4DR6Q 4IOCA 1AH9A 1A0IA 1GO3E 2JEBI 4DV1L 1PH7A 4DAMA 1SMXA 4A3EG 1FGUA 3D31A 4JI8L 4AQYQ 2AWOA 2R92G 4B3MQ 3I55A 4GNXA 5LMUL 2PQAA 4UP8A 4BA1I 4A3JG 2RF4A 1ASYA 3AEVA 1X54A 1KQSA 3RZOH 3CMAA 3J81i 1PFSA 4K0KL 3ULPA 1SLJA 2NZHA 3PSIA 1P16A 1IBML 2YYZA 5GAGC 1XNQL 4JI3L 3I7FA 4QJFA 3U58A 3HKZG 3J80c 1L1OC 2GN5A 2HHHL 3MXNB 3PCOB 5C4XG 3NEMA 3AYHB 1BKBA 1HH2P 1HZBA 4YCUA 4YWLA 5M5YH 1I5FA 4L5TA 4MNOA 1VQ8A 2N49A 1PYBA 1L1OB 2NZOA 3GTQH 2E8GA 2R93H 4NPSA 1LM0A 4JBWA 1PH6A 4DR1Q 1VQEA 4HIOA 4OWTB 1YEZA 3ER0A 3TQYA 5J3BA 3PIPA 3KDFA 3NBHB 5IY0A 1J5EQ 4R4OA 4LF9Q 1HNWQ 1YNXA 1X55A 4YHHQ 2WAQE 4R4CA 3JAMc 1YI2A 3VDYA 1WCMG 4P75A 4O0AA 4BBSH 4IOAA 1KRTA 2VW9A 4L5RC 1SR3A 4UY8C 4HJ9A 2JA5H 4AYBE 4JI0L 1K3RA 3HOXG 4LFBQ 4JCVE 1OXXK 1HNXL 1YBYA 4DV5L 1G6PA 4HIDA 4B3RQ 1IZ6A 2ATWA 4C3IH 5M3MG 1YIJA 4HIMA 1N32L 1GVPA 1VQAA 2A1AA 3UDFA 3GTOH 3H3VH 3KLWA 2VZAA 1DGSA 5K36G 2K5VA 3HOVG 1HZCA 2UXDL 4LF4Q 3EBEA 5IP7G 1EIYB 4LF5L 2B3GA 4DV1Q 3UE1A 3RZDH 1R9TH 2YU9H 3H0GG 2WP8J 3MEFA 3CCMA 3RR5A 4JI8Q 5JEAJ 5LMUQ 4KI0A 3S24A 1IL2A 1WOCA 3G4SA 4A3BG 1Y1VH 3I4OA 2E2JH 3RLOA 3IRBA 1VQPA 1IBMQ 4GN3B 2VQEL 3FP9A 1Q12A 4DAYB 4HJAA 3OW2A 4A3MG 2ZJQA 2HHHQ 1N9WA 4GKKL 1X3FA 2MO1A 4TQUS 5H1SE 1Y1WH 1CUKA 1YZ6A 2VS1A 2Y0SG 2ZTEA 1EOVA 5IYBH 3CCEA 3HKSA 2E2IH 2VUMH 1JJ2A 1AE2A 4A3KH 1UE6A 1V9PA 4DPGA 3RNUA 3ZJYC 3E0EA 1L1OA 4A3CG 1HR0L 1X56A 1Q86C 3I2ZA 3GTLH 2NVYH 5IYDH 1V1QA 2JA9A 3G6EA 4RMFA 5IYCH 2AKWB 1QVGA 3A74A 1X9NA 2ALYB 4XIGS 4DUZQ 3S2DH 4DR1L 1QVCA 1P8LA 3W1GA 3HOUG 1J6QA 1JJCB 1VQIA 4JOIC 1YITA 2XTIA 4BXXG 3HOYH 4H02A 2PI2A 2WB1G 1K83H 1NE3A 4HIKA 1N36L 2IX1A 3WWVA 3GTJH 5C0XG 1C9OA 4X64L 4DV7L 4DK6C 4OX9L 1I6HH 4QY7A 1HNXQ 5FLXc 4JG2A 4DV5Q 4BY7H 3H3VI 1AE3A 2N8NA 1Q8KA 3PUVA 5C0XJ 4X6AH 3KF6B 4A3LG 1M1KC 1T9HA 2LXKA 4A3FH 3EN2A 4A93H 4JV5L 3FKIH 1HR0W 2R7DA 3AFQA 2MFIA 1N8RC 4LFBL 2XGTA 1XMQQ 1UE1A 1YHQA 4DUYL 4BY1H 3S1QH 1WFQA 4C3JH 2AHOB 4DV2L 2KBNA 2KCMA 1ASZA 3L0OA 4LF5Q 3STBD 1VQNA 1KD1C 4IFDG 2K52A 3I4NH 4IPCA 3CMEA 3PUXA 4R4IA 4JI4L 2HIXA 5HY6A 1SN8A 1L2FA 2Z0SA 3UDGA 4A3EH 2IY5B 1Z47A 2R92H 4PZ7A 2KHJA 1HNZL 1CKOA 2CWAA 4BBRG 1IBLL 4LF4L 4A3JH 1Q81C 2NN6I 4JC0A 3M3YH 1EUJA 4HJ7A 5M5WH 2VQEQ 1XJVA 1U0LA 1SROA 2LSSA 4GKKQ 1A63A 1W2BA 2JA7G 3PIOA 1GKHA 4JYAL 5GROA 3I4MG 3DLLA 2CQOA 3J7A5 3CCSA 5C4XH 4NXML 5ELOA 2NVQH 2YV5A 4P72A 2YTVA 1VQOA 1SFOH 1K0RA 4QGUA 3HOWG 1XNRQ 1HR0Q 2UU9L 5M5XH 3GTMH 3K0XA 3S1MH 1X3GA 1VQ7A 3GD7A 4IPGA 1E24A 2ZM6Q 2HIVA 3J81c 3OYYA 2MO0A 2WAQG 4OWWB 2EIFA 1Q46A 5AJ3Q 1NY4A 2LXJA 4IJLA 2R7FA 4R4TA 2AWNA 3ERSX 4A3DG 1NTGA 2CWPA 2K14A 3TS0A 1I94L 3GTGH 1CSPA 3UDIA 2JE6I 4IPHA 2MNAA 1OXTA 1FL0A 3OTOL 3CC2A 1B8AA 3BU2A 4JBKA 4AYBG 4JBMA 4JI2L 4AH6A 1C7YA 1I50H 1QZGA 1N36Q 1NMGA 2Z6KC 1FJGL 1WCMH 3TS2A 3DM3A 4DUZL 4X64Q 3CPWA 4DV7Q 4HJ8A 4DR5Q 1X3EA 4OX9Q 4JOIA 1Z9FA 3GO5A 3CXCA 4LWCA 3HOXH 3S14H 1CKNB 3H15A 4JV5Q 1KHIA 3KF6A 5JJLA 5IP9H 1PVOA 2BH8A 3L7ZC 2BA0A 1TWHH 5M3MH 5EAYA 1Y14B 4DUYQ 4L5SA 1YJ9A 1PHJA 4DV0L 1HZAA 1NBWA 4DV2Q 3AQQA 3RLNA 3NELA 3S2HH 1E22A 3F2CA 1UWVA 1SE8A 1E7ZA 2OQ0A 3A0JA 3CC7A 5IP7H 1X65A 3S15H 3F8TA 4ALPA 1RL2A 4YCVA 1I3QH 2R6GA 1EWIA 4FDBA 4A3IG 4R4QA 3H0GH 1XMQL 1L0WA 1PH2A 1E1OA 2KENA 2MQHA 2PMZE 3M85A 2KHIA 3UE0A 2QA4A 1HNZQ 5C4JH 1IBLQ 1D8LA 2FXQA 2I5MX 2JA8G 3PUZA 2YTXA 2VQFL 1OXSC 3B6YA 2JK8A 4OO1I 4LF7Q 5GAEC 4A3BH 4GOPC 1GM5A 3E9HA 1WI5A 3I56A 1VCIA 3G71A 4IO9A 4DR2Q 4A3MH 2B63G 4JYAQ 3CCVA 4BA2I 1TXYA 2OCEA 4ME3A 1PH9A 4NXMQ 4C2MH 1B70B 1G291 4NXNL 5GAHC 4GOPB 1OXUA 2KCTA 1VQLA 4JI7L 2UU9Q 3BJUA 4LUVA 4X66Q 4A3CH 1S40A 1C0AA 3NENA 2OTLA 3KJPA 1QVFA 3PF5A 1VQCA 4DV4L 3GTPH 3W1BA 2R7ZG 4JI6Q 1MKHA 1YJWA 1XNRL 3S1RH 2H5XA 4DV6Q 1JE5A 3CPFA 4L5QA 5C3EG 2ZJPA 1VS0A 4X62Q 5FJ8G 3OTOQ 3RLFA 3KYHC 2ZM6L 4DR3L 1MIUA 2F52A 3Q8DA 4JI2Q 5M3FH 2HT1A 3HOUH 5FLMG 4MTNA 1BVSA 4J15A 5AJ3L 3J81j 1VQ6A 4BXXH 1Q1EA 4OWXB 3GTKH 1VQGA 3RN5A 3KOJA 1VQ4A 3F1ZA 1V43A 2JQOA 4DR7L 2Z6KA 1CKNA 5IWAL 1KC8C 3ULLA 3CW2C 1K8GA 3BZKA 4A3LH 2C35B 3F2BA 4GS3A 4DR5L 1Y1WG 1IXRA 2I5HA 3PUWA 4WJ4A 5IYBG 4DV0Q 2NVTH 1XPUA 1VQMA 3CCUA 1PYSB 2F4VQ 4LF6L 4DR4L 2K4KA 1A8VA 4P71A 3CQZH 5C44H 1I94Q 2DUDA 2Y0SE 1H95A 1FJGQ 4WJ3M 1VQ9A 1PH1A 2ZTDA 1CSQA 1XTDA 2B29A 3CF5A 1E3PA 2VQFQ 2IT1A 4X65Q 4BBRH 4KHPL 1PA6A 1EIFA 2QGQA 4APVA 4IFDJ 1S72A 1BBUA 4AIMA 1JB7A 3M9BA 1K8AC 3A5ZB 2AMCB 1XPOA 2JA7H 4NXNQ 3I4MH 4A3GG 4DK3C 4C3HH 1QUQB 3F2DA 4O2DA 5LMNL 4GOPA 2HQLA 4LF7L 3S17H 4JI7Q 3PO3G 4BY7G 4DR2L 3HOWH 3A5UA 2Q2TA 2RHQB 1PH5A 2JA6G 2N78A 2RHSB 1IBKL 1K9MC 1M90C 2GVAA 5GADC 4LUOA 4DV4Q 3KFUA 3PO2G 3K80C 1KRSA 2NVXH 2OQKA 3HOZG 3CD6A 2E2HH 4X66L 2ID0A 1YHBA 1N34L 1N33Q 4A3DH 2PI2E 4DR3Q 4B3SQ 2I5LX 3U4ZA 3I4NG 1VQDA 4YCWA 5C0XI 4LFCL 4JI6L 4JBJA 4PZ6A 4DV6L 4DNIA 4YY3Q 3J80i 1UE7A 4X62L 1MJCA 1S3OA 1VQHA 2Q2HA 4OXPA 3D0FA 4PMWA 3CCJA 4DR7Q 3BZCA 1KIXA 5IWAQ 4DV3L 5LMNW 3PV0A 5ELNA 3LGJA 1XMOQ 4A4IA 2K5HA 3G48A 3HFZB 3U50C 2ZTCA 4A75A 4QIWE 1MJEA 4OO1G 2UUBQ 4PZ8A 3M4PA 3UDXA 2QEXA 1G51A 2E5LL 3U4VA 4IFDI 4DR4Q 4LF6Q 5GQOA 4Y52H 1TWGH 4JI4Q 2VNUD 4GLXA 4GKJQ 1YVCA 3CP0A 2UXBL 5IE8A 5HGQA 4A76A 1VQJA 2WFWA 3JAMi 4POGA 2CKZB 2A19A 4A3IH 3S1NH 2F4VL 3HKZE 2R93G 1VQKA 3HOVH 4GLAC 1XPRA 4PG3A 3T1YL 1LYLA 4KHPQ 2VL6A 2JA8H 2CCZA 3T1HQ 2V1CC 4EQ5A 2UXCL 4QL5A 1HJPA 4JI5Q 1QZHA 2B63H 1EYGA 2IHFA 4X65L 3FHWA 4YWKA 1OTCA 5LMNQ 2VY3A 2BH2A 1QUQA 4JI1L 2OTJA 1SRUA 2UUAQ 1LUZA 3TEHB 1EQRA 4KHZA 1Q7YC 3ULJA 4BBSG 4LF8Q 1EFWA 2ES2A 2Q2UA 3K81C 1O7IA 3CAMA 1IYJB 1TWFH 4IJHA 5IP9G 2BA1A 1OXVA 1IBKQ 3RN2A 2JA5G 1D7QA 4YWMA 1WYDA 4P73A 2F3IA 4B3TQ 1VQBA 2R7ZH 4LFAL 2UUCL 3W5OA 3EIVA 5E7NA 1N34Q 2K75A 5BR8L 5C3EH 2JEAI 5JEAG 4Y7NH 1JMCA 3PGZA 3PF4A 5FJ8H 3TRZA 2YTYA 4LFCQ 1JJGA 5IT9c 3AFPA 3CCQA 3S16H 5FLMH 1CKMA 4DR6L 4GNXC 1N33L 1GD7A 4MZ9A 4B3SL 1YHAA 2GVBA 1TWCH 1A62A 1VQ5A 2EQSA 1NJIC 4K0KQ 4DV3Q 3STBC 4LW1A 4XTCS 4POFA 3TREA 1Q82C 1XNQQ 4GNXB 4AQYL 1W3SA 2PQAB 4JI3Q 4IPDA 4YY3L 3CCLA 4B3ML 1VQFA 2ASBA 1Y1VG 2D0OA 1UE5A 2E5LQ 3M4OH 1XMOL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1J A;  2D0P A;  2NN6 G;  3PUY A;  2UXB Q;  4UP9 A;  1KL9 A;  3L2P A;  2UUB L;  1K73 C;  4GN5 A;  3J7Z C;  2VUM G;  4GN4 B;  4QQB X;  3K7U C;  4A3K G;  1WJJ A;  4RG1 A;  1E1T A;  1KXL A;  1BBW A;  4UP7 A;  2CFM A;  2RCN A;  3T1Y Q;  3KF8 B;  4HJ5 A;  1UEB A;  4GKJ L;  3CCR A;  5IYD G;  3K7A H;  2OWO A;  3KDF B;  3GDE A;  1RIP A;  4EX5 A;  5IYC G;  2IX0 A;  5M3F G;  2UXC Q;  1U5K A;  4KLK A;  5JJI A;  5DLQ E;  1Q1B A;  2JJQ A;  1J5E L;  3CC4 A;  2DGY A;  2N3S A;  4LF9 L;  1B7Y B;  4JI1 Q;  1HNW L;  4OON A;  3KJO A;  3T1H L;  4JI0 Q;  4A3G H;  3HOY G;  4YHH L;  1FVI A;  1PV4 A;  3PO3 H;  4JI5 L;  5JJK A;  3SGI A;  3E9I A;  2ZJR A;  4UPA A;  1PH3 A;  3M7N A;  1HZ9 A;  1JT8 A;  1PH4 A;  3JC6 6;  2K50 A;  2A8V A;  1N32 Q;  2JA6 H;  4GLV B;  2UUA L;  1NMF A;  2D62 A;  2K5N A;  2Q2I A;  2WB1 E;  1PH8 A;  2EXD A;  4LFA Q;  3PO2 H;  2UUC Q;  4LUZ A;  4NB3 A;  4DKA C;  4LF8 L;  3HOZ H;  5BR8 Q;  3K8A A;  4A3F G;  4A93 G;  2UXD Q;  2I0Q A;  3FKI G;  4B3R L;  2L15 A;  3M4Q A;  5C44 G;  1X6O A;  1YJN A;  1EQQ A;  4P74 A;  2IHE A;  4TVA B;  4BY1 G;  1KAW A;  1TWA H;  1LTL A;  4B3T L;  4LNQ A;  2PNH A;  3ICE A;  4DR6 Q;  4IOC A;  1AH9 A;  1A0I A;  1GO3 E;  2JEB I;  4DV1 L;  1PH7 A;  4DAM A;  1SMX A;  4A3E G;  1FGU A;  3D31 A;  4JI8 L;  4AQY Q;  2AWO A;  2R92 G;  4B3M Q;  3I55 A;  4GNX A;  5LMU L;  2PQA A;  4UP8 A;  4BA1 I;  4A3J G;  2RF4 A;  1ASY A;  3AEV A;  1X54 A;  1KQS A;  3RZO H;  3CMA A;  3J81 i;  1PFS A;  4K0K L;  3ULP A;  1SLJ A;  2NZH A;  3PSI A;  1P16 A;  1IBM L;  2YYZ A;  5GAG C;  1XNQ L;  4JI3 L;  3I7F A;  4QJF A;  3U58 A;  3HKZ G;  3J80 c;  1L1O C;  2GN5 A;  2HHH L;  3MXN B;  3PCO B;  5C4X G;  3NEM A;  3AYH B;  1BKB A;  1HH2 P;  1HZB A;  4YCU A;  4YWL A;  5M5Y H;  1I5F A;  4L5T A;  4MNO A;  1VQ8 A;  2N49 A;  1PYB A;  1L1O B;  2NZO A;  3GTQ H;  2E8G A;  2R93 H;  4NPS A;  1LM0 A;  4JBW A;  1PH6 A;  4DR1 Q;  1VQE A;  4HIO A;  4OWT B;  1YEZ A;  3ER0 A;  3TQY A;  5J3B A;  3PIP A;  3KDF A;  3NBH B;  5IY0 A;  1J5E Q;  4R4O A;  4LF9 Q;  1HNW Q;  1YNX A;  1X55 A;  4YHH Q;  2WAQ E;  4R4C A;  3JAM c;  1YI2 A;  3VDY A;  1WCM G;  4P75 A;  4O0A A;  4BBS H;  4IOA A;  1KRT A;  2VW9 A;  4L5R C;  1SR3 A;  4UY8 C;  4HJ9 A;  2JA5 H;  4AYB E;  4JI0 L;  1K3R A;  3HOX G;  4LFB Q;  4JCV E;  1OXX K;  1HNX L;  1YBY A;  4DV5 L;  1G6P A;  4HID A;  4B3R Q;  1IZ6 A;  2ATW A;  4C3I H;  5M3M G;  1YIJ A;  4HIM A;  1N32 L;  1GVP A;  1VQA A;  2A1A A;  3UDF A;  3GTO H;  3H3V H;  3KLW A;  2VZA A;  1DGS A;  5K36 G;  2K5V A;  3HOV G;  1HZC A;  2UXD L;  4LF4 Q;  3EBE A;  5IP7 G;  1EIY B;  4LF5 L;  2B3G A;  4DV1 Q;  3UE1 A;  3RZD H;  1R9T H;  2YU9 H;  3H0G G;  2WP8 J;  3MEF A;  3CCM A;  3RR5 A;  4JI8 Q;  5JEA J;  5LMU Q;  4KI0 A;  3S24 A;  1IL2 A;  1WOC A;  3G4S A;  4A3B G;  1Y1V H;  3I4O A;  2E2J H;  3RLO A;  3IRB A;  1VQP A;  1IBM Q;  4GN3 B;  2VQE L;  3FP9 A;  1Q12 A;  4DAY B;  4HJA A;  3OW2 A;  4A3M G;  2ZJQ A;  2HHH Q;  1N9W A;  4GKK L;  1X3F A;  2MO1 A;  4TQU S;  5H1S E;  1Y1W H;  1CUK A;  1YZ6 A;  2VS1 A;  2Y0S G;  2ZTE A;  1EOV A;  5IYB H;  3CCE A;  3HKS A;  2E2I H;  2VUM H;  1JJ2 A;  1AE2 A;  4A3K H;  1UE6 A;  1V9P A;  4DPG A;  3RNU A;  3ZJY C;  3E0E A;  1L1O A;  4A3C G;  1HR0 L;  1X56 A;  1Q86 C;  3I2Z A;  3GTL H;  2NVY H;  5IYD H;  1V1Q A;  2JA9 A;  3G6E A;  4RMF A;  5IYC H;  2AKW B;  1QVG A;  3A74 A;  1X9N A;  2ALY B;  4XIG S;  4DUZ Q;  3S2D H;  4DR1 L;  1QVC A;  1P8L A;  3W1G A;  3HOU G;  1J6Q A;  1JJC B;  1VQI A;  4JOI C;  1YIT A;  2XTI A;  4BXX G;  3HOY H;  4H02 A;  2PI2 A;  2WB1 G;  1K83 H;  1NE3 A;  4HIK A;  1N36 L;  2IX1 A;  3WWV A;  3GTJ H;  5C0X G;  1C9O A;  4X64 L;  4DV7 L;  4DK6 C;  4OX9 L;  1I6H H;  4QY7 A;  1HNX Q;  5FLX c;  4JG2 A;  4DV5 Q;  4BY7 H;  3H3V I;  1AE3 A;  2N8N A;  1Q8K A;  3PUV A;  5C0X J;  4X6A H;  3KF6 B;  4A3L G;  1M1K C;  1T9H A;  2LXK A;  4A3F H;  3EN2 A;  4A93 H;  4JV5 L;  3FKI H;  1HR0 W;  2R7D A;  3AFQ A;  2MFI A;  1N8R C;  4LFB L;  2XGT A;  1XMQ Q;  1UE1 A;  1YHQ A;  4DUY L;  4BY1 H;  3S1Q H;  1WFQ A;  4C3J H;  2AHO B;  4DV2 L;  2KBN A;  2KCM A;  1ASZ A;  3L0O A;  4LF5 Q;  3STB D;  1VQN A;  1KD1 C;  4IFD G;  2K52 A;  3I4N H;  4IPC A;  3CME A;  3PUX A;  4R4I A;  4JI4 L;  2HIX A;  5HY6 A;  1SN8 A;  1L2F A;  2Z0S A;  3UDG A;  4A3E H;  2IY5 B;  1Z47 A;  2R92 H;  4PZ7 A;  2KHJ A;  1HNZ L;  1CKO A;  2CWA A;  4BBR G;  1IBL L;  4LF4 L;  4A3J H;  1Q81 C;  2NN6 I;  4JC0 A;  3M3Y H;  1EUJ A;  4HJ7 A;  5M5W H;  2VQE Q;  1XJV A;  1U0L A;  1SRO A;  2LSS A;  4GKK Q;  1A63 A;  1W2B A;  2JA7 G;  3PIO A;  1GKH A;  4JYA L;  5GRO A;  3I4M G;  3DLL A;  2CQO A;  3J7A 5;  3CCS A;  5C4X H;  4NXM L;  5ELO A;  2NVQ H;  2YV5 A;  4P72 A;  2YTV A;  1VQO A;  1SFO H;  1K0R A;  4QGU A;  3HOW G;  1XNR Q;  1HR0 Q;  2UU9 L;  5M5X H;  3GTM H;  3K0X A;  3S1M H;  1X3G A;  1VQ7 A;  3GD7 A;  4IPG A;  1E24 A;  2ZM6 Q;  2HIV A;  3J81 c;  3OYY A;  2MO0 A;  2WAQ G;  4OWW B;  2EIF A;  1Q46 A;  5AJ3 Q;  1NY4 A;  2LXJ A;  4IJL A;  2R7F A;  4R4T A;  2AWN A;  3ERS X;  4A3D G;  1NTG A;  2CWP A;  2K14 A;  3TS0 A;  1I94 L;  3GTG H;  1CSP A;  3UDI A;  2JE6 I;  4IPH A;  2MNA A;  1OXT A;  1FL0 A;  3OTO L;  3CC2 A;  1B8A A;  3BU2 A;  4JBK A;  4AYB G;  4JBM A;  4JI2 L;  4AH6 A;  1C7Y A;  1I50 H;  1QZG A;  1N36 Q;  1NMG A;  2Z6K C;  1FJG L;  1WCM H;  3TS2 A;  3DM3 A;  4DUZ L;  4X64 Q;  3CPW A;  4DV7 Q;  4HJ8 A;  4DR5 Q;  1X3E A;  4OX9 Q;  4JOI A;  1Z9F A;  3GO5 A;  3CXC A;  4LWC A;  3HOX H;  3S14 H;  1CKN B;  3H15 A;  4JV5 Q;  1KHI A;  3KF6 A;  5JJL A;  5IP9 H;  1PVO A;  2BH8 A;  3L7Z C;  2BA0 A;  1TWH H;  5M3M H;  5EAY A;  1Y14 B;  4DUY Q;  4L5S A;  1YJ9 A;  1PHJ A;  4DV0 L;  1HZA A;  1NBW A;  4DV2 Q;  3AQQ A;  3RLN A;  3NEL A;  3S2H H;  1E22 A;  3F2C A;  1UWV A;  1SE8 A;  1E7Z A;  2OQ0 A;  3A0J A;  3CC7 A;  5IP7 H;  1X65 A;  3S15 H;  3F8T A;  4ALP A;  1RL2 A;  4YCV A;  1I3Q H;  2R6G A;  1EWI A;  4FDB A;  4A3I G;  4R4Q A;  3H0G H;  1XMQ L;  1L0W A;  1PH2 A;  1E1O A;  2KEN A;  2MQH A;  2PMZ E;  3M85 A;  2KHI A;  3UE0 A;  2QA4 A;  1HNZ Q;  5C4J H;  1IBL Q;  1D8L A;  2FXQ A;  2I5M X;  2JA8 G;  3PUZ A;  2YTX A;  2VQF L;  1OXS C;  3B6Y A;  2JK8 A;  4OO1 I;  4LF7 Q;  5GAE C;  4A3B H;  4GOP C;  1GM5 A;  3E9H A;  1WI5 A;  3I56 A;  1VCI A;  3G71 A;  4IO9 A;  4DR2 Q;  4A3M H;  2B63 G;  4JYA Q;  3CCV A;  4BA2 I;  1TXY A;  2OCE A;  4ME3 A;  1PH9 A;  4NXM Q;  4C2M H;  1B70 B;  1G29 1;  4NXN L;  5GAH C;  4GOP B;  1OXU A;  2KCT A;  1VQL A;  4JI7 L;  2UU9 Q;  3BJU A;  4LUV A;  4X66 Q;  4A3C H;  1S40 A;  1C0A A;  3NEN A;  2OTL A;  3KJP A;  1QVF A;  3PF5 A;  1VQC A;  4DV4 L;  3GTP H;  3W1B A;  2R7Z G;  4JI6 Q;  1MKH A;  1YJW A;  1XNR L;  3S1R H;  2H5X A;  4DV6 Q;  1JE5 A;  3CPF A;  4L5Q A;  5C3E G;  2ZJP A;  1VS0 A;  4X62 Q;  5FJ8 G;  3OTO Q;  3RLF A;  3KYH C;  2ZM6 L;  4DR3 L;  1MIU A;  2F52 A;  3Q8D A;  4JI2 Q;  5M3F H;  2HT1 A;  3HOU H;  5FLM G;  4MTN A;  1BVS A;  4J15 A;  5AJ3 L;  3J81 j;  1VQ6 A;  4BXX H;  1Q1E A;  4OWX B;  3GTK H;  1VQG A;  3RN5 A;  3KOJ A;  1VQ4 A;  3F1Z A;  1V43 A;  2JQO A;  4DR7 L;  2Z6K A;  1CKN A;  5IWA L;  1KC8 C;  3ULL A;  3CW2 C;  1K8G A;  3BZK A;  4A3L H;  2C35 B;  3F2B A;  4GS3 A;  4DR5 L;  1Y1W G;  1IXR A;  2I5H A;  3PUW A;  4WJ4 A;  5IYB G;  4DV0 Q;  2NVT H;  1XPU A;  1VQM A;  3CCU A;  1PYS B;  2F4V Q;  4LF6 L;  4DR4 L;  2K4K A;  1A8V A;  4P71 A;  3CQZ H;  5C44 H;  1I94 Q;  2DUD A;  2Y0S E;  1H95 A;  1FJG Q;  4WJ3 M;  1VQ9 A;  1PH1 A;  2ZTD A;  1CSQ A;  1XTD A;  2B29 A;  3CF5 A;  1E3P A;  2VQF Q;  2IT1 A;  4X65 Q;  4BBR H;  4KHP L;  1PA6 A;  1EIF A;  2QGQ A;  4APV A;  4IFD J;  1S72 A;  1BBU A;  4AIM A;  1JB7 A;  3M9B A;  1K8A C;  3A5Z B;  2AMC B;  1XPO A;  2JA7 H;  4NXN Q;  3I4M H;  4A3G G;  4DK3 C;  4C3H H;  1QUQ B;  3F2D A;  4O2D A;  5LMN L;  4GOP A;  2HQL A;  4LF7 L;  3S17 H;  4JI7 Q;  3PO3 G;  4BY7 G;  4DR2 L;  3HOW H;  3A5U A;  2Q2T A;  2RHQ B;  1PH5 A;  2JA6 G;  2N78 A;  2RHS B;  1IBK L;  1K9M C;  1M90 C;  2GVA A;  5GAD C;  4LUO A;  4DV4 Q;  3KFU A;  3PO2 G;  3K80 C;  1KRS A;  2NVX H;  2OQK A;  3HOZ G;  3CD6 A;  2E2H H;  4X66 L;  2ID0 A;  1YHB A;  1N34 L;  1N33 Q;  4A3D H;  2PI2 E;  4DR3 Q;  4B3S Q;  2I5L X;  3U4Z A;  3I4N G;  1VQD A;  4YCW A;  5C0X I;  4LFC L;  4JI6 L;  4JBJ A;  4PZ6 A;  4DV6 L;  4DNI A;  4YY3 Q;  3J80 i;  1UE7 A;  4X62 L;  1MJC A;  1S3O A;  1VQH A;  2Q2H A;  4OXP A;  3D0F A;  4PMW A;  3CCJ A;  4DR7 Q;  3BZC A;  1KIX A;  5IWA Q;  4DV3 L;  5LMN W;  3PV0 A;  5ELN A;  3LGJ A;  1XMO Q;  4A4I A;  2K5H A;  3G48 A;  3HFZ B;  3U50 C;  2ZTC A;  4A75 A;  4QIW E;  1MJE A;  4OO1 G;  2UUB Q;  4PZ8 A;  3M4P A;  3UDX A;  2QEX A;  1G51 A;  2E5L L;  3U4V A;  4IFD I;  4DR4 Q;  4LF6 Q;  5GQO A;  4Y52 H;  1TWG H;  4JI4 Q;  2VNU D;  4GLX A;  4GKJ Q;  1YVC A;  3CP0 A;  2UXB L;  5IE8 A;  5HGQ A;  4A76 A;  1VQJ A;  2WFW A;  3JAM i;  4POG A;  2CKZ B;  2A19 A;  4A3I H;  3S1N H;  2F4V L;  3HKZ E;  2R93 G;  1VQK A;  3HOV H;  4GLA C;  1XPR A;  4PG3 A;  3T1Y L;  1LYL A;  4KHP Q;  2VL6 A;  2JA8 H;  2CCZ A;  3T1H Q;  2V1C C;  4EQ5 A;  2UXC L;  4QL5 A;  1HJP A;  4JI5 Q;  1QZH A;  2B63 H;  1EYG A;  2IHF A;  4X65 L;  3FHW A;  4YWK A;  1OTC A;  5LMN Q;  2VY3 A;  2BH2 A;  1QUQ A;  4JI1 L;  2OTJ A;  1SRU A;  2UUA Q;  1LUZ A;  3TEH B;  1EQR A;  4KHZ A;  1Q7Y C;  3ULJ A;  4BBS G;  4LF8 Q;  1EFW A;  2ES2 A;  2Q2U A;  3K81 C;  1O7I A;  3CAM A;  1IYJ B;  1TWF H;  4IJH A;  5IP9 G;  2BA1 A;  1OXV A;  1IBK Q;  3RN2 A;  2JA5 G;  1D7Q A;  4YWM A;  1WYD A;  4P73 A;  2F3I A;  4B3T Q;  1VQB A;  2R7Z H;  4LFA L;  2UUC L;  3W5O A;  3EIV A;  5E7N A;  1N34 Q;  2K75 A;  5BR8 L;  5C3E H;  2JEA I;  5JEA G;  4Y7N H;  1JMC A;  3PGZ A;  3PF4 A;  5FJ8 H;  3TRZ A;  2YTY A;  4LFC Q;  1JJG A;  5IT9 c;  3AFP A;  3CCQ A;  3S16 H;  5FLM H;  1CKM A;  4DR6 L;  4GNX C;  1N33 L;  1GD7 A;  4MZ9 A;  4B3S L;  1YHA A;  2GVB A;  1TWC H;  1A62 A;  1VQ5 A;  2EQS A;  1NJI C;  4K0K Q;  4DV3 Q;  3STB C;  4LW1 A;  4XTC S;  4POF A;  3TRE A;  1Q82 C;  1XNQ Q;  4GNX B;  4AQY L;  1W3S A;  2PQA B;  4JI3 Q;  4IPD A;  4YY3 L;  3CCL A;  4B3M L;  1VQF A;  2ASB A;  1Y1V G;  2D0O A;  1UE5 A;  2E5L Q;  3M4O H;  1XMO L; 
#chains in the Genus database with same CATH topology
 1TS2 A;  5DEH A;  2UUB L;  1K73 C;  4GN5 A;  3J7Z C;  4GN4 B;  4QQB X;  4G7O C;  1HUN A;  1WTH A;  4FXD A;  1E0B A;  3KF8 B;  3K6O A;  5EBD A;  2F0W A;  1I4X A;  5JPM C;  1JB3 A;  1M8A A;  1B3A A;  4WOR A;  4KLK A;  4JI1 Q;  3TDQ A;  4FF2 A;  2EY1 A;  3HOY G;  1DOL A;  3MEH A;  1B1Z A;  3M7N A;  3MFG A;  1HZ9 A;  1AFP A;  1X3Q A;  2K50 A;  2A8V A;  4K6D A;  4HCS A;  4ZUJ A;  1NMF A;  3TS2 A;  2K5N A;  2UUC Q;  4NB3 A;  2QDL A;  2UXD Q;  1EIH A;  2L15 A;  3M4Q A;  3SHL A;  1YJN A;  5FO7 B;  2IHE A;  3RZD B;  2K01 A;  4B3T L;  4OL7 A;  3ICE A;  1SAP A;  1C4Q A;  1GO3 E;  5KNB A;  1HRJ A;  2DJF C;  1EYD A;  4DV1 L;  4C2M B;  1MBY A;  1Y1V B;  1GUT A;  4Q0F A;  3D31 A;  3T53 B;  2Y0S B;  1F77 A;  1K8M A;  1ZYR C;  2B2U C;  1II3 A;  4KY6 A;  2KED A;  1PFS A;  1X32 A;  2XWJ B;  2EYH A;  1IBM L;  1CQV A;  1PFN A;  1EWH A;  2K05 A;  3J80 c;  1L1O C;  4QCL A;  3W2D A;  1HH2 P;  1I4H A;  2N49 A;  2WII B;  1PYB A;  1L1O B;  2NZO A;  4DNR B;  1PH6 A;  4HIO A;  2WB1 B;  4OWT B;  4CDC C;  3PIP A;  2BCO A;  5IY0 A;  1B9N A;  2B39 A;  1J5E Q;  3TZU A;  1KDC A;  4HMI A;  1K83 B;  4KMU C;  1SYC A;  3IFT A;  3BDO A;  5L37 A;  4ID6 A;  4YHH Q;  1TII D;  2L11 A;  2HDM A;  4O0A A;  3HG9 A;  5C5L A;  4HJ9 A;  2F0U A;  1K3R A;  3D8G A;  4DV5 L;  1SSO A;  1HHV A;  2SEB D;  2ATW A;  4C3I H;  4HIM A;  3UDF A;  1U4R A;  2VZA A;  4HAE A;  1I4Q A;  4A3E B;  5IP7 G;  1EIY B;  3NWT A;  1O78 A;  4DXG A;  5ELE A;  4JI8 Q;  2EDG A;  4G4K A;  5M5W B;  4KI0 A;  3L3O C;  5KNC A;  1IL2 A;  1G91 A;  5IOC A;  1WTX A;  4A3B G;  3I4O A;  1XX8 A;  3RLO A;  5C4X B;  3FP9 A;  4DAY B;  4KV6 A;  3OPO A;  3R2T A;  2ZJQ A;  4IUR A;  1X3F A;  2NN6 H;  3MXN A;  5H1S E;  3GTM B;  2E2H B;  3MVV A;  1EWC A;  1EOV A;  1W6K A;  3H94 A;  3HKS A;  2A6H C;  1JJ2 A;  4DPG A;  1JR0 D;  5IYD H;  3G6E A;  1LT3 D;  2ALY B;  4DUZ Q;  3BYY B;  1QVC A;  3HOU G;  1J6Q A;  1JJC B;  1STY A;  4H02 A;  3A55 A;  3HOX B;  5CGK A;  2IX1 A;  1STA A;  4QY7 A;  5M3M B;  2N8N A;  1Q8K A;  3NTH A;  4A93 H;  3FKI H;  4F88 A;  3HOV B;  4RHS A;  3S1Q H;  3NK9 A;  1G8Z D;  1S5B D;  3TP8 A;  3L0O A;  2IW3 A;  1ASZ A;  2PZU A;  4FP5 D;  4R4I A;  5CBA E;  5HY6 A;  2IY5 B;  2Z0S A;  3UDG A;  2L1B A;  1HQR D;  4PZ7 A;  5I4D A;  4FO2 A;  1Z7T A;  2XN9 C;  3M3Y H;  2NN6 I;  1JC7 A;  4XDX A;  2VQE Q;  1XJV A;  1SRO A;  2LSS A;  1W2B A;  1TR5 A;  3DLL A;  4C3H G;  4J8Q A;  2PW5 A;  3CCS A;  2YV5 A;  1SFO H;  1B9M A;  1XNR Q;  2UU9 L;  3DWP A;  2K1B A;  2A6E C;  4O42 A;  5CBE E;  3GD7 A;  4QUF A;  4IPG A;  2PNR C;  3P75 A;  4PMB A;  2MO0 A;  2WAQ G;  3SXH A;  4OWW B;  5LL6 X;  2J4X A;  4IJL A;  2AUK A;  2R7F A;  3MHB A;  4A3D G;  1NTG A;  3GTG H;  3GTK B;  3RUZ A;  2JE6 I;  4FF4 A;  3I72 A;  4IPH A;  3OTO L;  4JI2 L;  1WCM H;  1VMC A;  4X64 Q;  4HJ8 A;  4DR5 Q;  2CQA A;  1SNQ A;  4JOI A;  1BF4 A;  1K3B C;  4ME5 A;  2MJ8 A;  2SOB A;  1CKN B;  3H15 A;  4Q5V A;  3KF6 A;  1HPC A;  5IP9 H;  5EAY A;  3T4A C;  1V1P B;  4DUY Q;  1JWS D;  1YJ9 A;  1F2L A;  1HZA A;  1NBW A;  1F9P A;  1CA5 A;  1AW7 A;  3CHB D;  3NP8 A;  3A0J A;  1QCB D;  3I90 A;  4JI4 Q;  1XMQ L;  3M85 A;  2F0S A;  4A3G B;  1HNZ Q;  1O7Y A;  1HUM A;  1IBL Q;  1ET9 A;  2FXQ A;  2I5M X;  2C5C A;  3PUZ A;  2YTX A;  2JA7 B;  1OXS C;  3A8K E;  2JK8 A;  4OO1 I;  4PV1 C;  1WI5 A;  4EVO A;  1A2T A;  3G71 A;  4DR2 Q;  4A3M H;  3CCV A;  4RAU C;  3MXU A;  2QF7 A;  3HOZ B;  4NXN L;  2KCT A;  3T56 B;  3X3N A;  5IGD A;  4A3C H;  1KDA A;  1C0A A;  2OTL A;  4B08 A;  1QVF A;  3VR2 A;  1JWM D;  1VQC A;  4DV4 L;  4JI6 Q;  1JIC A;  2PCF B;  4AYB B;  1CK1 A;  2RVL A;  4CGY B;  2A69 C;  2E75 C;  2ZM6 L;  3Q8D A;  4O1N A;  5FLM G;  4MTN A;  4J15 A;  5EPL A;  4BXX H;  3RN5 A;  5E4X A;  1WTV A;  5C0X H;  3F1Z A;  2JQO A;  4PMC A;  4EQN A;  1EU3 A;  4DR7 L;  2Z6K A;  5M5Y B;  2OXP A;  2MP1 A;  3ULL A;  1K8G A;  3BZK A;  4KHV A;  1Y1W G;  1IXR A;  2I5H A;  2J7Z A;  2NTT A;  1XPU A;  3CCU A;  4LF6 L;  2N55 A;  3S1N B;  4P71 A;  4IFD H;  1I94 Q;  2Y0S E;  5COY A;  1FJG Q;  2JA8 B;  1KDB A;  1VQ9 A;  1H9S A;  1DM0 B;  5FLX L;  2JN4 A;  1E3P A;  2IT1 A;  4X65 Q;  4BBR H;  4BBS B;  1A6X A;  4KJN A;  1PA6 A;  4IFD J;  1S72 A;  2JA5 B;  3V96 A;  4R8N A;  3H3V C;  1XPO A;  3I4M H;  4DK3 C;  3F2D A;  5LMN L;  3S17 H;  4JI7 Q;  4HED A;  1LAC A;  3VR5 A;  2R7Z B;  5CV6 A;  4N8F A;  2N78 A;  5C3E B;  2GVA A;  5GAD C;  1EY4 A;  4LUO A;  4X3T A;  2IPK D;  2V4D A;  1U4M A;  2YU9 B;  5E4W C;  5FO8 B;  3J7A F;  1D1K A;  3U4Z A;  1L0Y B;  1VQD A;  5C0X I;  5CV7 A;  5CV5 A;  4RGT A;  4YY3 Q;  4ZKB B;  4X62 L;  1VQH A;  5IGB A;  1PRT D;  2Q2H A;  3NSW A;  3D0F A;  3EA6 A;  1E2V A;  3DM1 A;  5LMN W;  5COR A;  4QF4 A;  5T1I A;  4A75 A;  3Q6S A;  4KKS A;  4QIW E;  1HFN A;  2AQ3 B;  3UDX A;  2QEX A;  4IFD I;  2E5L L;  3Q23 A;  3GTL B;  1EYC A;  5GQO A;  1WTR A;  3CP0 A;  5IE8 A;  1J8I A;  1VQJ A;  4NDX A;  1JQY D;  3S2D B;  1LTA D;  2CKZ B;  5J22 A;  4POG A;  2RSO A;  3QB3 A;  2NWG A;  3HOY B;  1XPR A;  1LYL A;  3MC0 B;  3EJI A;  4TSS A;  3GTJ B;  4JI5 Q;  3F2U A;  1QZH A;  4KY5 A;  3A7L A;  4BY7 B;  4YWK A;  2OTJ A;  2BH2 A;  4JI1 L;  2UUA Q;  3TN2 A;  1EQR A;  1GHJ A;  2EYF A;  1EFW A;  3K81 C;  3KLS A;  3HGB A;  1NNX A;  4YWM A;  2K03 A;  3I4N B;  3EQL C;  2UUC L;  4C3I G;  4QB4 A;  2X6G A;  5JOB A;  1GUG A;  3M4O B;  3KLR A;  2F03 A;  2EYM A;  2EJG C;  1JJG A;  1HA6 A;  1EOT A;  1KAB A;  3SK6 A;  2ZXP A;  4GNX C;  4IUQ A;  1YHA A;  2GVB A;  1HTP A;  1A62 A;  2A68 C;  1RJT A;  3BDC A;  4DV3 Q;  3STB C;  3S9W A;  3TRE A;  4GNX B;  4JI3 Q;  1W3S A;  4JPB W;  1Q90 A;  3CCL A;  5G3L F;  3S1M B;  4V0B A;  2XWB B;  3OWF A;  5LHY 1;  1QE6 A;  2NN6 G;  4UP9 A;  1KL9 A;  2VB3 X;  1KLU D;  1TKW B;  4XQJ A;  4RG1 A;  1BBW A;  2RCN A;  4CJ2 C;  4HJ5 A;  1UEB A;  2F0N A;  3K7A H;  5IYD G;  4N8X 1;  3ERO A;  4WFN 3;  4CHT B;  1SE3 A;  4EX5 A;  1A2U A;  1JOK A;  2WKD A;  1QNU A;  1Q1B A;  5DLQ E;  3K57 A;  1J5E L;  3CC4 A;  1B7Y B;  5J39 A;  4OON A;  4YHH L;  1FVI A;  1TWH B;  4CKB A;  5JJK A;  1CI3 M;  1PH3 A;  3VYU A;  1JT8 A;  3JC6 6;  3S2H B;  5I9O A;  2Q2I A;  1PYW D;  3S15 B;  1Z6H A;  2EXD A;  4LFA Q;  3PO2 H;  5KEE A;  1EQV A;  1LTT D;  5BR8 Q;  4A93 G;  2I0Q A;  3FKI G;  2BE5 D;  1X6O A;  4JVZ A;  1EQQ A;  2WV6 D;  1R4P B;  1KAW A;  1TWA H;  1LTL A;  1R9T B;  2PNH A;  4DR6 Q;  1A0I A;  1U9R A;  2NB0 A;  2F0E A;  4DAM A;  1SMX A;  2Z6B A;  4JI8 L;  1ENF A;  2PQA A;  1OO9 B;  1KQS A;  3RZO H;  1SMY C;  4K0K L;  2NZH A;  1P16 A;  2OT2 A;  2O5I C;  4A3K B;  1XNQ L;  4QJF A;  3U58 A;  3S1R B;  1BUV T;  3AYH B;  2GA4 B;  2RKS A;  1S5E D;  2DNC A;  1UNS A;  1VQ8 A;  2F0O A;  5BN4 A;  5IGF A;  2HCI A;  5M3F B;  1LM0 A;  1VF5 C;  1VQE A;  1YEZ A;  3TQY A;  2RDH A;  3IAY A;  1SJH D;  2L4N A;  1TU2 B;  4B9X A;  3QJY A;  4LF9 Q;  1HNW Q;  1NUC A;  4X3K A;  5JVG 3;  1X55 A;  2IJ0 A;  5I9P A;  1LAB A;  1YI2 A;  1SE2 A;  1XTC D;  1WCM G;  1D2B A;  4DXF A;  1U4L A;  4AYB E;  4DK0 A;  4JI0 L;  5C44 B;  4LFB Q;  1YBY A;  2B2W C;  1STE A;  4B3R Q;  4C3J B;  1IZ6 A;  2L0C A;  1EIG A;  4ZKC B;  1YIJ A;  1N32 L;  1Q3L A;  1GVP A;  1W6J A;  2EOT A;  1VQA A;  1DGS A;  3IL8 A;  1ZKO A;  5DM7 3;  1HZC A;  5A2Q E;  2RA4 A;  3RZD H;  2AQ1 B;  2WP8 J;  3CCM A;  1EEF D;  1EEI D;  3NE5 B;  3RR5 A;  5JEA J;  4M8A A;  5LMU Q;  2SNS A;  1PZI D;  1WTO A;  5JJZ A;  4NP5 A;  3HKZ B;  1Y1V H;  2E2J H;  1SDF A;  2VQE L;  2NVQ B;  4A3M G;  4HJA A;  2B8F A;  1SNM A;  2B2U A;  5IT9 L;  4HMJ A;  3X3M A;  3OW2 A;  3DWA A;  1BCP D;  2OEO A;  4M1U B;  2N88 A;  3DXJ C;  4UHV A;  1Y1W H;  5JVH 3;  3RD4 A;  1V9P A;  3ZJY C;  3E0E A;  1L1O A;  4A3C G;  5C4H A;  3H09 A;  2JA9 A;  4JK1 C;  1HCZ A;  1EQT A;  1DD2 A;  2AKW B;  1QVG A;  1X9N A;  4XIG S;  3G6J B;  1BNZ A;  4DR1 L;  1TQO A;  2E2D C;  3W1G A;  2X69 A;  4BXX G;  2PZT A;  1K83 H;  1NE3 A;  1O7Z A;  2EXZ A;  4PQX A;  5C0X G;  1C9O A;  4X64 L;  4DK6 C;  1GUS A;  2F0H A;  4WRD A;  1HNX Q;  5FLX c;  1A3U A;  4ZYS A;  3TZD A;  1MGS A;  1UE1 A;  4DUY L;  4BY1 H;  1PTO C;  2OF1 A;  1WFQ A;  3H0G B;  4J6H A;  2KBN A;  4LF5 Q;  1KD1 C;  4IFD G;  2K52 A;  5C4J B;  2JYO A;  4IUV A;  1JOR A;  3D6C A;  1PTO B;  4IPC A;  1E2Z A;  3J7Y W;  4JI4 L;  2HIX A;  4A3E H;  2CW0 C;  1Z47 A;  2R92 H;  1HNZ L;  4LF4 L;  1DXM A;  1CKO A;  2CWA A;  4BBR G;  1IBL L;  1T5X D;  4RGO S;  5HUR A;  1EUJ A;  2KCN A;  3HEJ A;  5M5W H;  1BBX C;  1U0L A;  4DAY A;  5EKI A;  1H9R A;  1WTQ A;  1EFI D;  3I4M G;  2CQO A;  5ELF A;  3ITP A;  5C4X H;  3NQT A;  5ELO A;  2Z8L A;  2YTV A;  1TT2 A;  1EZ8 A;  4QGU A;  1IKL A;  3GTP B;  2K7V A;  1HR0 Q;  5M5X H;  4U68 A;  2F3V A;  3GTM H;  3OOC A;  1GUO A;  3OYY A;  1IKM A;  1TWC B;  2EIF A;  2F0D A;  1B2T A;  1NY4 A;  2LXJ A;  5IGG A;  4R4T A;  2AWN A;  2CWP A;  2K14 A;  1XWE A;  1OXT A;  3CC2 A;  1RHP A;  4JBK A;  2KVM A;  1N36 Q;  1LT4 D;  2G5D A;  3V05 A;  4DV7 Q;  1O7L A;  4XXE A;  4OX9 Q;  3GO5 A;  4LWC A;  3HOX H;  4UAI A;  2MGS A;  3SK8 A;  1KHI A;  2EJM A;  2KA7 A;  4FYD A;  2BH8 A;  1PMR A;  3V2T A;  5FKA C;  5M3M H;  1KAA A;  2F0K A;  4N9T A;  5BN3 A;  3JAM L;  3AQQ A;  3CRL C;  1E22 A;  1UWV A;  1ZXT A;  3CC7 A;  4ALP A;  4YCV A;  1I3Q H;  1ZYR D;  1EWI A;  2R6G A;  1I94 L;  1PH2 A;  1FJG L;  2MQH A;  2KEN A;  1I6V C;  2PMZ E;  3MA2 B;  2KHI A;  3UE0 A;  2QA4 A;  1RD9 D;  1BR9 A;  3Q0A A;  2EE1 A;  4GOP C;  3E9H A;  5EJW A;  4RKB A;  4IO9 A;  4JYA Q;  3RMH A;  1VMP A;  3OWE B;  4NXM Q;  3BZD B;  1G29 1;  4GOP B;  1OXU A;  5EQ0 A;  4XQQ A;  4JI7 L;  4LUV A;  4X66 Q;  3WDN A;  1DOK A;  3R2I A;  4I7Z C;  2F0T A;  3KJP A;  5T1G A;  2NTS A;  1CHP D;  2H5X A;  1JE5 A;  2K5Q A;  2JSO A;  3MTS A;  3J80 E;  4C1N K;  1MIU A;  2HT1 A;  1VQ6 A;  5AJ3 L;  3J81 j;  1Q1E A;  3GTK H;  3M4Y A;  1VQG A;  5LL6 S;  2QDB A;  1SYE A;  2F0F A;  1CKN A;  4N9P A;  4RCN A;  4A3L H;  2Q8I B;  3F2B A;  2QW7 A;  3PUW A;  1C48 A;  1SBB B;  1V1P A;  2LKV A;  4DV0 Q;  2NVT H;  4DFA A;  1VQM A;  4OEL B;  4DU9 A;  2F4V Q;  4LMQ D;  4A3I B;  3CQZ H;  2DUD A;  1H95 A;  1BO0 A;  4FXG C;  4WJ3 M;  1PH1 A;  4ZLT F;  1LV9 A;  3W3A A;  2B63 B;  2TMP A;  2QGQ A;  2F0P A;  2HD3 A;  4OIK A;  3VYS A;  3M9B A;  2JA7 H;  2AMC B;  1QUQ B;  2B2Y C;  2G9D A;  2HQL A;  4C3I B;  4LF7 L;  3P1H A;  3HOW H;  2RHQ B;  2RHS B;  4ZAI A;  1ML0 D;  4H0L C;  4LJZ C;  3PO2 G;  3P7J A;  1QB5 D;  1KRS A;  4CDF C;  2OQK A;  2NVX H;  3CD6 A;  4OGQ C;  4X3U A;  1IYU A;  1YHB A;  2I5L X;  2DNE A;  1CT1 D;  3NWS A;  4JBJ A;  4DV6 L;  1B44 D;  4FNF A;  2QCP X;  4PMW A;  1TS4 A;  2ZXR A;  3J81 L;  1KIX A;  4DV3 L;  1Q8I A;  2QKI C;  5ELN A;  1RTN A;  1HFG A;  2K5H A;  3HFZ B;  2ZTC A;  2UUB Q;  2B2V C;  2BOS A;  1STG A;  4DF7 A;  4DR4 Q;  3OMC A;  4Y52 H;  1EZ6 A;  1TWG H;  2VNU D;  1DJR D;  2K32 A;  3JAM i;  4UDU C;  3S1N H;  4RGM A;  3HKZ E;  4K5V A;  4DAP A;  1VQK A;  4PG3 A;  1CTM A;  4KHP Q;  2JA8 H;  2CCZ A;  3SDZ A;  3AU7 A;  3PO3 B;  5G3L D;  3QR8 A;  2IHF A;  1PZK D;  1OTC A;  4HSP A;  4K2K A;  1A3T A;  1FR3 A;  1LUZ A;  1JCK B;  2RSN A;  3TEH B;  2JA6 B;  4IQZ A;  4KHZ A;  1L0X B;  5FOB B;  2Q2U A;  4F8M A;  1TWF H;  4IJH A;  2BA1 A;  4TRD A;  1PTO F;  5EGT A;  3AMU A;  1G6Z A;  1WYD A;  1NAP A;  4P73 A;  2M00 A;  4B3T Q;  4H13 C;  2R7Z H;  4LFA L;  3EIV A;  5E7N A;  5BR8 L;  5C3E H;  5JEA G;  4Y7N H;  1B53 A;  3A54 A;  2B2T C;  2WKC A;  1WVL A;  4LFC Q;  3M3Y B;  5IT9 c;  3S16 H;  4DR6 L;  1RDP D;  1LTS D;  3PQI A;  1N33 L;  2M2L A;  1GD7 A;  4B3S L;  2EQS A;  2Z4H A;  2H4O A;  3OIP A;  4POF A;  1SFO B;  5D65 A;  3K58 A;  2H1E A;  3DEP A;  1IW7 C;  4HCE A;  1Y1V G;  2D0O A;  1UE5 A;  2XVS A;  2ZXO A;  5TSS A;  1XMO L;  5JJI A;  2UXB Q;  3L2P A;  3GTQ B;  1SJE D;  3KLS X;  2R93 B;  2L9H A;  1KXL A;  4UP7 A;  1S5D D;  3T1Y Q;  1SXT A;  4GKJ L;  1WCM B;  4EQO A;  2OWO A;  3KDF B;  1RIP A;  2EY5 A;  2IX0 A;  1LO5 D;  1PLF A;  2DGY A;  2HQE A;  4LF9 L;  1HNW L;  3KJO A;  3O13 A;  3T1H L;  3OHX C;  2BDO A;  3E9I A;  2AQ2 B;  4UPA A;  2LMC B;  1PH4 A;  1NCV A;  2A5H A;  4E6I A;  1PH8 A;  2WB1 E;  1A3V A;  1B50 A;  3GTO B;  2K5D A;  4LF8 L;  2F0Q A;  4B3R L;  2CH4 A;  2P5Z X;  4OEM B;  4PNY A;  4P74 A;  4TVA B;  1HQM C;  4BY1 G;  1EY8 A;  3GP7 A;  1A15 A;  1XXG A;  1AH9 A;  5ELD A;  2CVR A;  2F1M A;  5D14 A;  4A3E G;  1TY0 A;  1FGU A;  3QOL A;  2R92 G;  4GNX A;  5LMU L;  4UP8 A;  3AEV A;  1CQF A;  5IGE A;  1ASY A;  1NR2 A;  4I7A A;  3J81 i;  3ULP A;  1SLJ A;  3N52 A;  3PSI A;  3URY A;  1SYF A;  5E1F A;  4F87 A;  4QUC A;  1SNP A;  4DAV A;  2GN5 A;  3PCO B;  5C4X G;  1HZB A;  2I46 A;  3WOF A;  1EYA A;  4ILW A;  1YNJ C;  1I5F A;  3P20 A;  2E8G A;  1EY6 A;  2FHT A;  4NPS A;  5CYU A;  4JBW A;  3NBI A;  3NBH B;  2RDF A;  1B3Q A;  4I65 A;  1PZJ D;  3QIA A;  1YNX A;  4R4C A;  1CM9 A;  3JAM c;  2KCC A;  4KKU A;  4IOA A;  2RBM A;  1IYV A;  4UY8 C;  3LWU A;  3L9A X;  3HOX G;  2KEE A;  4JCV E;  1HNX L;  2EVB A;  4IUN A;  3SK4 A;  2MHV A;  5M3M G;  2A73 B;  1R4Q B;  2A1A A;  2HCC A;  4BBR B;  3DWQ A;  2K5V A;  1QNK A;  1DZ1 A;  3HOV G;  5KGU A;  2UXD L;  4LF5 L;  2B3G A;  3UE1 A;  1R9T H;  4XT1 B;  1HXY D;  1PXU A;  2K5W A;  2SNM A;  3S17 B;  1RTO A;  1WOC A;  3QWN A;  2FMM A;  5NUC A;  1SE4 A;  2FMC A;  1VQP A;  3MXG A;  1Q12 A;  2HHH Q;  1N9W A;  2MO1 A;  1ICW A;  1FNU A;  1CUK A;  1PFB A;  2VS1 A;  2ZTE A;  1FNV A;  2D9U A;  3CCE A;  2VUM H;  2E2I H;  1AE2 A;  4A3K H;  3MXP A;  2F0J A;  5DNF A;  1HR0 L;  1X56 A;  2NVY H;  5EKL A;  1V1Q A;  4RMF A;  5IYC H;  1AZQ A;  1SND A;  2LY7 A;  1ICF B;  1I50 B;  2DY7 A;  4HR7 B;  1VQI A;  4ZCK A;  2XTI A;  2LS0 1;  5F2D A;  2Q8R E;  3S14 B;  4HIK A;  1N36 L;  3WWV A;  4DV7 L;  3ND9 A;  4OX9 L;  1I6H H;  4JG2 A;  4A3L G;  1M1K C;  1T9H A;  4A3F H;  1ROD A;  3EN2 A;  1ENC A;  1HR0 W;  5CV4 A;  2J0T D;  3SK5 A;  3AFQ A;  2MFI A;  2HUG A;  2XGT A;  1XMQ Q;  2E76 C;  2B2W A;  5BN5 A;  3HS0 C;  4C3J H;  5KYI A;  2KCM A;  2SDF A;  3STB D;  1VQN A;  1NR4 A;  1KNE A;  2M9V A;  3CME A;  3PUX A;  4A3B B;  1STH A;  1SN8 A;  1TY2 A;  1EY7 A;  1MSG A;  3BG3 A;  1ILP A;  1C8C A;  4A3J H;  4FVM A;  4JC0 A;  1Q81 C;  4L8J A;  4IUU A;  4GKK Q;  2JA7 G;  1GKH A;  5M9O A;  1SNO A;  4JYA L;  3J7A 5;  4NXM L;  3GQB A;  2NVQ H;  3NTK A;  3HOW G;  1ILQ A;  3A56 A;  4MTK A;  1VQ7 A;  4H7B A;  3FDT A;  1E24 A;  4OHJ A;  2ZM6 Q;  4C1N I;  3J81 c;  1CA6 A;  2QIL A;  4TKO B;  3HOU B;  3KF8 A;  4DA2 A;  3TS0 A;  1CSP A;  3UDI A;  1FL0 A;  1K28 A;  3BU2 A;  4AYB G;  4DN4 M;  4JBM A;  3DM3 A;  4QMG A;  3CPW A;  4KN4 C;  4DUZ L;  1X3E A;  5I2Y A;  4HSV A;  3CXC A;  4RFB A;  4RH6 A;  4JV5 Q;  5JPN C;  2BA0 A;  1Y14 B;  3M7G A;  4L5S A;  3E5S A;  5K36 H;  4DV0 L;  4DV2 Q;  1BCP C;  1YNN D;  3F2C A;  2OQ0 A;  5JEA H;  5C3X A;  2K28 A;  1QG7 A;  2D5D A;  5E3F A;  3H0G H;  1BCP B;  1L0W A;  1E1O A;  1V8Q A;  5C4J H;  1SMY D;  1D8L A;  2JA8 G;  3EVQ A;  1PTO H;  3TSS A;  4C3H B;  1GM5 A;  2FFK B;  5C3W A;  4IUP A;  3PO2 B;  1PH9 A;  2OCE A;  4C2M H;  1B70 B;  5GAH C;  4CBV A;  4DNT B;  3BJU A;  2WAQ B;  1TWA B;  1S40 A;  3NEN A;  4NMZ A;  1CHQ D;  4A3D B;  3GTP H;  3W1B A;  2R7Z G;  2EPB A;  1MKH A;  3MWY W;  1XNR L;  5C3E G;  2Z4I A;  5C4Z A;  1GOZ A;  4X62 Q;  3RLF A;  5KRU A;  3I8Z A;  2F52 A;  3RZO B;  2K6A A;  1BVS A;  2RQX A;  4MN3 A;  3KOJ A;  1D6E C;  3H91 A;  2ICI A;  1AN8 A;  1B4O A;  1STB A;  3BVZ A;  1VF7 A;  4BWG B;  1E2W A;  3CW2 C;  3NHH A;  2C35 B;  4DR5 L;  4GS3 A;  1S5F D;  4WJ4 A;  5IYB G;  1PFM A;  3U9S A;  1PYS B;  4DR4 L;  2K4K A;  3OMG A;  2B8G A;  2PW7 A;  3FVQ A;  3R3O A;  2ZTD A;  3PIP 3;  1CSQ A;  1XTD A;  3CF5 A;  2VQF Q;  1ONL A;  4V19 0;  4OIJ A;  4KHP L;  3IFD A;  1EIF A;  4APV A;  1BBU A;  1JB7 A;  3TBI B;  4O2D A;  4GOP A;  4K5X A;  3LWE A;  4BY7 G;  4DR2 L;  2K33 A;  4K2L A;  4RCO A;  1PH5 A;  1K9M C;  3KFU A;  2AUJ D;  1TS3 A;  3K80 C;  4K8J A;  3I91 A;  4JW0 A;  3K59 A;  1Y69 U;  5C6A A;  2E2H H;  2ID0 A;  2L55 A;  2MUY A;  1UAP A;  4KY7 A;  2PI2 E;  3Q24 A;  4DR3 Q;  3I4N G;  1LTG D;  4YCW A;  4K8I A;  4LFC L;  4JI6 L;  2E2J B;  1GUN A;  4PZ6 A;  1UE7 A;  5J1Z A;  1MJC A;  1S3O A;  4B9W A;  3CCJ A;  1BQQ T;  1Y1W B;  1DON A;  5IWA Q;  5CV9 A;  3WOE A;  1M4V A;  4A4I A;  3G48 A;  2FJ2 A;  3H6M A;  2WIN B;  1PTO D;  4CDE C;  1ZEQ X;  4IAL A;  2R3Z A;  5CV8 A;  2EY2 A;  2UXB L;  5HGQ A;  4A76 A;  4R9W A;  3C2P A;  2WFW A;  2CW0 D;  2PZW A;  2NUC A;  4A3I H;  5FLX E;  3HOV H;  4F7X A;  1AZP A;  1K8O A;  2XIW A;  3T1Y L;  2VL6 A;  2V1C C;  5CMD A;  5IOD A;  2PPB C;  4J1M A;  1LT5 D;  4QL5 A;  4GZY C;  1F9Q A;  2B63 H;  1LLR D;  2O4X A;  4X65 L;  4ZRZ A;  2XSC A;  2VY3 A;  3ONA B;  1QUQ A;  1RCV D;  1SRU A;  4FF1 A;  4R8I A;  1V1O A;  1EY9 A;  5K5P A;  4BY1 B;  1Y8N B;  1O7I A;  1IYJ B;  1IBK Q;  1OXV A;  1RKN A;  2B2Y A;  3RN2 A;  1D7Q A;  3CKI B;  2F3I A;  2F0V A;  4QIW B;  3W5O A;  1N34 Q;  2K75 A;  3A7A B;  4FXK C;  3PGZ A;  1JMC A;  3VR3 A;  3E3X A;  2PQE A;  3FMC A;  5FJ8 H;  1WTW A;  2R92 B;  2YTY A;  1CFM A;  3C1E A;  3CCQ A;  1CKM A;  5KND A;  1VQ5 A;  5FO9 B;  4K0K Q;  1LT6 D;  4LK1 C;  3D6W A;  4ODG A;  4ZUI A;  1XNQ Q;  4YY3 L;  4CKC A;  3I70 A;  5M5X B;  1EY0 A;  2JXM B;  3FRP B;  4R1J A;  2D0P A;  3PUY A;  3SE0 A;  1ESF A;  4NKL A;  4ULL A;  2B2V A;  2VUM G;  1FGB D;  2O5J C;  3K7U C;  4A3K G;  1WJJ A;  3IKJ A;  3VYR A;  1E1T A;  4ABN A;  3LX0 A;  3A8J E;  2CFM A;  3CRK C;  3D4W A;  4ZQ3 A;  4X3S A;  3CCR A;  4FF3 A;  3D3R A;  1HA5 A;  4XYQ A;  1K0S A;  2UXC Q;  3GDE A;  5M3F G;  5IYC G;  1DYQ A;  1U5K A;  2A74 C;  4K5W A;  3J7A V;  5CC4 A;  2JJQ A;  2N3S A;  3OW7 A;  2Q8T A;  4A3G H;  4JI0 Q;  1PV4 A;  1LTI D;  3PO3 H;  4JI5 L;  2F4I A;  3SGI A;  3U9O A;  2A6H D;  3UI2 A;  2ZJR A;  1N32 Q;  1BCP F;  2JA6 H;  3D4R A;  4GLV B;  2UUA L;  2D62 A;  4LUZ A;  4C56 C;  1I3Q B;  4DKA C;  3HOZ H;  3K8A A;  4A3F G;  4IUT A;  5C44 G;  1F2Y A;  2KHS A;  4C3J G;  5IGC A;  4LNQ A;  3K5M A;  2EYJ A;  5A2Q L;  4IOC A;  2JEB I;  1LTB D;  2B2T A;  1PH7 A;  4AQY Q;  2AWO A;  4B3M Q;  3I55 A;  4BA1 I;  1JOQ A;  4A3J G;  2RF4 A;  4OO1 H;  1X54 A;  3CMA A;  3NTI A;  3D4D A;  4KD4 A;  3I4L A;  2YYZ A;  5GAG C;  2E74 C;  4JI3 L;  3I7F A;  3HKZ G;  2HHH L;  3MXN B;  1QIL A;  3NEM A;  1F9R A;  1BKB A;  4YCU A;  4YWL A;  3T16 A;  5M5Y H;  4L5T A;  4MNO A;  3R8B A;  1XYI A;  2ICE C;  3BVM A;  3GTQ H;  3TME A;  2R93 H;  4KJO A;  4DR1 Q;  3ER0 A;  1GHK A;  5J3B A;  1SEB D;  3KDF A;  1D5X C;  3C1F A;  4R4O A;  1SYD A;  4CDD C;  3VYT A;  4L63 B;  2WAQ E;  1I4R A;  3VDY A;  4LAA A;  4RA8 A;  4P75 A;  1GUW A;  2NVT B;  4BBS H;  4CJ0 B;  1KRT A;  5I6W A;  2VW9 A;  4L5R C;  1SR3 A;  4A93 B;  3C3L A;  2JA5 H;  2A6E D;  3CQZ B;  3FKI B;  5AFW A;  3NXW A;  1OXX K;  3SVM A;  3Q22 A;  3HRZ C;  1G6P A;  3S1Q B;  4HID A;  3MFY A;  3HZX A;  1JWU D;  4XYO A;  3GTO H;  5DM6 3;  3H3V H;  5K36 G;  3KLW A;  1AP0 A;  3ZYY X;  4CKE A;  5EPK A;  2I07 B;  4LF4 Q;  3EBE A;  4G7Z C;  4DV1 Q;  2YU9 H;  1WD0 A;  4RKL A;  3H0G G;  3MEF A;  4G7H C;  3S24 A;  2EYO A;  3EFX D;  2G9H D;  1S5C D;  2EY6 A;  1T5E A;  3HOW B;  3G4S A;  2LFN A;  2EYP A;  3IRB A;  1IBM Q;  4GN3 B;  3GV3 A;  1RF2 D;  4GKK L;  3PIO 3;  1MD2 D;  2NVX B;  2WAC A;  4TQU S;  1I4P A;  4KN7 C;  4ZK9 B;  1YZ6 A;  2Y0S G;  4NW2 A;  5IYB H;  2F0I A;  1ET6 A;  3TP6 A;  1UE6 A;  3RNU A;  1Q86 C;  3I2Z A;  4IN3 A;  3GTL H;  3MAQ A;  3GTG B;  1J9O A;  3NBH A;  1D5M C;  2EJF C;  2KEC A;  3QOJ A;  3A74 A;  2L12 A;  3OIQ A;  3S2D H;  4KKT A;  1P8L A;  5I6Y A;  1KTK A;  1Y8P B;  4JOI C;  1YIT A;  1BDO A;  3HOY H;  2PI2 A;  2WB1 G;  3A8I E;  2HDL A;  3GTJ H;  1TWG B;  2O2L D;  5ELC A;  1EL0 A;  1PDQ A;  4DV5 Q;  3KUP A;  4BY7 H;  2ENB A;  3H3V I;  1AE3 A;  1PRT C;  3PUV A;  2Z1C A;  5I2X A;  2DJG C;  3KF6 B;  5C0X J;  4X6A H;  2LXK A;  4JV5 L;  3K0Y A;  2R7D A;  4MHE A;  2XRQ D;  3K5N A;  3QG1 A;  5C5M A;  1N8R C;  4LFB L;  1YHQ A;  2A69 D;  1PRT B;  2AHO B;  3CU7 A;  4DV2 L;  3ND8 A;  3VR6 A;  5IIF A;  1KNA A;  3I4N H;  5ISR A;  2RDG A;  4G57 A;  4U67 3;  4P2C B;  1IW7 D;  2Z9H A;  1L2F A;  3M4O H;  2KHJ A;  4A3M B;  1EY5 A;  5CR3 A;  4HJ7 A;  1TWF B;  2KQ3 A;  5FK9 C;  2CH4 W;  1A63 A;  5IT9 E;  3PIO A;  1LTR D;  3KBX A;  5GRO A;  1ENA A;  4P72 A;  4IZ8 A;  4Y7N B;  1VQO A;  1EU4 A;  1K0R A;  3S1M H;  1JE4 A;  3K0X A;  4XQN A;  3S16 B;  1X3G A;  4XT3 B;  2HIV A;  1SYB A;  1Q46 A;  5AJ3 Q;  3TP5 A;  3ERS X;  1FD7 D;  1DCZ A;  3J80 L;  3FPU B;  1G2T A;  2MNA A;  2PYK A;  4K6L A;  1D1I A;  1B8A A;  1SYG A;  4AH6 A;  1C7Y A;  1I50 H;  1QZG A;  1NMG A;  2Z6K C;  4HTH A;  1X3P A;  5EKK A;  2XRS D;  1Z9F A;  2QEJ C;  4DGZ A;  3S14 H;  2X6L A;  3N6R A;  1F2M A;  3T51 B;  1UUP A;  1PVO A;  5JJL A;  3L7Z C;  2NZ1 D;  1TWH H;  3BDL A;  1PHJ A;  1IHZ A;  5KIX A;  3RLN A;  3NEL A;  3S2H H;  3K5O A;  3BVG A;  1SE8 A;  1E7Z A;  5IP7 H;  1X65 A;  3S15 H;  2F3W A;  3F8T A;  1RL2 A;  1JOO A;  4FDB A;  4BS9 A;  4A3I G;  4R4Q A;  1H9S B;  4DK1 A;  3TRZ A;  1GXD C;  4K14 A;  2VQF L;  1MI2 A;  3B6Y A;  5JAV A;  3I4M B;  4LF7 Q;  5GAE C;  4A3B H;  4YIJ A;  3I56 A;  2F0G A;  1VCI A;  1Y8O B;  2B63 G;  4BA2 I;  1O80 A;  1TXY A;  4ME3 A;  1YNJ D;  3DHQ A;  2BDN A;  1VQL A;  2UU9 Q;  4MIU A;  1H9J A;  1H9M A;  2ZT9 C;  2JP1 A;  2IX3 A;  3PF5 A;  2EYL A;  2DY8 A;  3E6Z X;  5D3I B;  1YJW A;  3S1R H;  3VR4 A;  2KOL A;  4DV6 Q;  3CPF A;  4L5Q A;  2ZJP A;  1VS0 A;  5FJ8 G;  3OTO Q;  4EQP A;  3KYH C;  2D2C C;  4DR3 L;  4H44 C;  4WJW A;  4JI2 Q;  1TVX A;  5M3F H;  3HOU H;  2BE5 C;  3C46 A;  4OWX B;  2C9O A;  1BXT A;  1VQ4 A;  2PMZ B;  2F0L A;  1V43 A;  3K5L A;  2DN8 A;  3AB9 A;  5IWA L;  1KC8 C;  5A35 A;  3QO2 A;  1FYC A;  1HTL D;  3DEO A;  1NSN S;  2VB2 X;  3T13 A;  3JAM E;  1AEX A;  1S4Z A;  1A8V A;  5C44 H;  2KUM A;  1G2S A;  1I4G A;  2A68 D;  1H9K A;  2B29 A;  1KLG D;  2EZV A;  3PMF A;  4AIM A;  3E0J A;  1K8A C;  1QJO A;  3A5Z B;  1F9S A;  4NXN Q;  4A3G G;  4C3H H;  1TS5 A;  3PO3 G;  3VA7 A;  4RWS C;  4KD3 A;  2F0M A;  3FPP A;  3A5U A;  2Q2T A;  1U4P A;  1QOH A;  2JA6 G;  1IBK L;  1M90 C;  2KJX A;  4DV4 Q;  1VDZ A;  1GJX A;  3HOZ G;  2TSS A;  5DAU A;  5EBC A;  4X66 L;  2NYZ D;  1N34 L;  1N33 Q;  4A3D H;  4B3S Q;  3GV6 A;  3MZ5 A;  3OSO A;  1YNN C;  5D3D A;  2XNA C;  3HP3 A;  4DNI A;  4CJ1 B;  3J80 i;  5HGT A;  2R61 A;  4OXP A;  4DR7 Q;  3BZC A;  3NUC A;  1BOS A;  1XMO Q;  3PV0 A;  2FIN B;  3LGJ A;  2VUM B;  4Z9C B;  2E2I B;  3U50 C;  1MJE A;  4OO1 G;  3BYT B;  4PZ8 A;  3M4P A;  1G51 A;  3I73 A;  3U4V A;  4L6T B;  2IWH A;  4LF6 Q;  2NVY B;  3ERQ A;  4GLX A;  4GKJ Q;  1YVC A;  4EGV A;  3K7A B;  3G7L A;  2A19 A;  3LNN A;  2F4V L;  2R93 G;  1STN A;  4GLA C;  3SR1 A;  3NQI A;  2NBF A;  3T1H Q;  4EQ5 A;  3NPP A;  2UXC L;  1I6H B;  1DOM A;  1HJP A;  3DMU A;  1EYG A;  3FHW A;  5LMN Q;  1PRT F;  3KBG A;  4A3F B;  1Q7Y C;  3ULJ A;  5ELB A;  4BBS G;  4LF8 Q;  2ES2 A;  1CZG A;  1UEA B;  3CAM A;  5IP9 G;  2IL8 A;  3TP7 A;  2JA5 G;  3SEB A;  3FEW X;  3I3C A;  1MHW C;  1F2Z A;  1CZW A;  1ESR A;  4KK7 A;  1VQB A;  1MSH A;  2RCF A;  1D5Z C;  2JEA I;  3VA5 A;  3PF4 A;  4RHR A;  2K04 A;  3KK7 A;  4KTA A;  4A3J B;  3AFP A;  1WD1 A;  2CHB D;  5EPJ A;  5FLM H;  1IL8 A;  4MZ9 A;  3BS1 A;  1TWC H;  1NJI C;  3DUZ A;  4LW1 A;  4XTC S;  3J81 E;  4HN7 A;  4RGN A;  1Q82 C;  4AQY L;  2PQA B;  1SNC A;  4IPD A;  4S3S A;  3R93 A;  4B3M L;  2L5T A;  2VXW A;  1VQF A;  2ASB A;  1WTP A;  1QWY A;  5KYL A;  2E5L Q;  2MPM A;  2PO4 A;  1FNW A; 
#chains in the Genus database with same CATH homology
 4R1J A;  2D0P A;  2NN6 G;  3PUY A;  2UXB Q;  4UP9 A;  1KL9 A;  3L2P A;  2UUB L;  1K73 C;  4GN5 A;  3J7Z C;  2VUM G;  4GN4 B;  4QQB X;  3K7U C;  4A3K G;  1WJJ A;  4RG1 A;  1E1T A;  1KXL A;  1BBW A;  4UP7 A;  2CFM A;  2RCN A;  3T1Y Q;  3KF8 B;  4HJ5 A;  1UEB A;  4GKJ L;  3CCR A;  5IYD G;  3K7A H;  2OWO A;  3KDF B;  3GDE A;  1RIP A;  4EX5 A;  5IYC G;  2IX0 A;  5M3F G;  2UXC Q;  1U5K A;  4KLK A;  5JJI A;  5DLQ E;  1Q1B A;  2JJQ A;  1J5E L;  3CC4 A;  2DGY A;  2N3S A;  4LF9 L;  1B7Y B;  4JI1 Q;  1HNW L;  4OON A;  3KJO A;  3T1H L;  4JI0 Q;  4A3G H;  3HOY G;  4YHH L;  1FVI A;  1PV4 A;  3PO3 H;  4JI5 L;  5JJK A;  3SGI A;  3E9I A;  2ZJR A;  4UPA A;  1PH3 A;  3M7N A;  1HZ9 A;  1JT8 A;  1PH4 A;  3JC6 6;  2K50 A;  2A8V A;  1N32 Q;  2JA6 H;  4GLV B;  2UUA L;  1NMF A;  2D62 A;  2K5N A;  2Q2I A;  2WB1 E;  1PH8 A;  2EXD A;  4LFA Q;  3PO2 H;  2UUC Q;  4LUZ A;  4NB3 A;  4DKA C;  4LF8 L;  3HOZ H;  5BR8 Q;  3K8A A;  4A3F G;  4A93 G;  2UXD Q;  2I0Q A;  3FKI G;  4B3R L;  2L15 A;  3M4Q A;  5C44 G;  1X6O A;  1YJN A;  1EQQ A;  4P74 A;  2IHE A;  4TVA B;  4BY1 G;  1KAW A;  1TWA H;  1LTL A;  4B3T L;  4LNQ A;  2PNH A;  3ICE A;  4DR6 Q;  4IOC A;  1AH9 A;  1A0I A;  1GO3 E;  2JEB I;  4DV1 L;  1PH7 A;  4DAM A;  1SMX A;  4A3E G;  1FGU A;  3D31 A;  4JI8 L;  4AQY Q;  2AWO A;  2R92 G;  4B3M Q;  3I55 A;  4GNX A;  5LMU L;  2PQA A;  4UP8 A;  4BA1 I;  4A3J G;  2RF4 A;  1ASY A;  3AEV A;  1X54 A;  1KQS A;  3RZO H;  3CMA A;  3J81 i;  1PFS A;  4K0K L;  3ULP A;  1SLJ A;  2NZH A;  3PSI A;  1P16 A;  1IBM L;  2YYZ A;  5GAG C;  1XNQ L;  4JI3 L;  3I7F A;  4QJF A;  3U58 A;  3HKZ G;  3J80 c;  1L1O C;  2GN5 A;  2HHH L;  3MXN B;  3PCO B;  5C4X G;  3NEM A;  3AYH B;  1BKB A;  1HH2 P;  1HZB A;  4YCU A;  4YWL A;  5M5Y H;  1I5F A;  4L5T A;  4MNO A;  1VQ8 A;  2N49 A;  1PYB A;  1L1O B;  2NZO A;  3GTQ H;  2E8G A;  2R93 H;  4NPS A;  1LM0 A;  4JBW A;  1PH6 A;  4DR1 Q;  1VQE A;  4HIO A;  4OWT B;  1YEZ A;  3ER0 A;  3TQY A;  5J3B A;  3PIP A;  3KDF A;  3NBH B;  5IY0 A;  1J5E Q;  4R4O A;  4LF9 Q;  1HNW Q;  1YNX A;  1X55 A;  4YHH Q;  2WAQ E;  4R4C A;  3JAM c;  1YI2 A;  3VDY A;  1WCM G;  4P75 A;  4O0A A;  4BBS H;  4IOA A;  1KRT A;  2VW9 A;  4L5R C;  1SR3 A;  4UY8 C;  4HJ9 A;  2JA5 H;  4AYB E;  4JI0 L;  1K3R A;  3HOX G;  4LFB Q;  4JCV E;  1OXX K;  1HNX L;  1YBY A;  4DV5 L;  1G6P A;  4HID A;  4B3R Q;  1IZ6 A;  2ATW A;  4C3I H;  5M3M G;  1YIJ A;  4HIM A;  1N32 L;  1GVP A;  1VQA A;  2A1A A;  3UDF A;  3GTO H;  3H3V H;  3KLW A;  2VZA A;  1DGS A;  5K36 G;  2K5V A;  3HOV G;  1HZC A;  2UXD L;  4LF4 Q;  3EBE A;  5IP7 G;  1EIY B;  4LF5 L;  2B3G A;  4DV1 Q;  3UE1 A;  3RZD H;  1R9T H;  2YU9 H;  3H0G G;  2WP8 J;  3MEF A;  3CCM A;  3RR5 A;  4JI8 Q;  5JEA J;  5LMU Q;  4KI0 A;  3S24 A;  1IL2 A;  1WOC A;  3G4S A;  4A3B G;  1Y1V H;  3I4O A;  2E2J H;  3RLO A;  3IRB A;  1VQP A;  1IBM Q;  4GN3 B;  2VQE L;  3FP9 A;  1Q12 A;  4DAY B;  4HJA A;  3OW2 A;  4A3M G;  2ZJQ A;  2HHH Q;  1N9W A;  4GKK L;  1X3F A;  2MO1 A;  4TQU S;  5H1S E;  1Y1W H;  1CUK A;  1YZ6 A;  2VS1 A;  2Y0S G;  2ZTE A;  1EOV A;  5IYB H;  3CCE A;  3HKS A;  2E2I H;  2VUM H;  1JJ2 A;  1AE2 A;  4A3K H;  1UE6 A;  1V9P A;  4DPG A;  3RNU A;  3ZJY C;  3E0E A;  1L1O A;  4A3C G;  1HR0 L;  1X56 A;  1Q86 C;  3I2Z A;  3GTL H;  2NVY H;  5IYD H;  1V1Q A;  2JA9 A;  3G6E A;  4RMF A;  5IYC H;  2AKW B;  1QVG A;  3A74 A;  1X9N A;  2ALY B;  4XIG S;  4DUZ Q;  3S2D H;  4DR1 L;  1QVC A;  1P8L A;  3W1G A;  3HOU G;  1J6Q A;  1JJC B;  1VQI A;  4JOI C;  1YIT A;  2XTI A;  4BXX G;  3HOY H;  4H02 A;  2PI2 A;  2WB1 G;  1K83 H;  1NE3 A;  4HIK A;  1N36 L;  2IX1 A;  3WWV A;  3GTJ H;  5C0X G;  1C9O A;  4X64 L;  4DV7 L;  4DK6 C;  4OX9 L;  1I6H H;  4QY7 A;  1HNX Q;  5FLX c;  4JG2 A;  4DV5 Q;  4BY7 H;  3H3V I;  1AE3 A;  2N8N A;  1Q8K A;  3PUV A;  5C0X J;  4X6A H;  3KF6 B;  4A3L G;  1M1K C;  1T9H A;  2LXK A;  4A3F H;  3EN2 A;  4A93 H;  4JV5 L;  3FKI H;  1HR0 W;  2R7D A;  3AFQ A;  2MFI A;  1N8R C;  4LFB L;  2XGT A;  1XMQ Q;  1UE1 A;  1YHQ A;  4DUY L;  4BY1 H;  3S1Q H;  1WFQ A;  4C3J H;  2AHO B;  4DV2 L;  2KBN A;  2KCM A;  1ASZ A;  3L0O A;  4LF5 Q;  3STB D;  1VQN A;  1KD1 C;  4IFD G;  2K52 A;  3I4N H;  4IPC A;  3CME A;  3PUX A;  4R4I A;  4JI4 L;  2HIX A;  5HY6 A;  1SN8 A;  1L2F A;  2Z0S A;  3UDG A;  4A3E H;  2IY5 B;  1Z47 A;  2R92 H;  4PZ7 A;  2KHJ A;  1HNZ L;  1CKO A;  2CWA A;  4BBR G;  1IBL L;  4LF4 L;  4A3J H;  1Q81 C;  2NN6 I;  4JC0 A;  3M3Y H;  1EUJ A;  4HJ7 A;  5M5W H;  2VQE Q;  1XJV A;  1U0L A;  1SRO A;  2LSS A;  4GKK Q;  1A63 A;  1W2B A;  2JA7 G;  3PIO A;  1GKH A;  4JYA L;  5GRO A;  3I4M G;  3DLL A;  2CQO A;  3J7A 5;  3CCS A;  5C4X H;  4NXM L;  5ELO A;  2NVQ H;  2YV5 A;  4P72 A;  2YTV A;  1VQO A;  1SFO H;  1K0R A;  4QGU A;  3HOW G;  1XNR Q;  1HR0 Q;  2UU9 L;  5M5X H;  3GTM H;  3K0X A;  3S1M H;  1X3G A;  1VQ7 A;  3GD7 A;  4IPG A;  1E24 A;  2ZM6 Q;  2HIV A;  3J81 c;  3OYY A;  2MO0 A;  2WAQ G;  4OWW B;  2EIF A;  1Q46 A;  5AJ3 Q;  1NY4 A;  2LXJ A;  4IJL A;  2R7F A;  4R4T A;  2AWN A;  3ERS X;  4A3D G;  1NTG A;  2CWP A;  2K14 A;  3TS0 A;  1I94 L;  3GTG H;  1CSP A;  3UDI A;  2JE6 I;  4IPH A;  2MNA A;  1OXT A;  1FL0 A;  3OTO L;  3CC2 A;  1B8A A;  3BU2 A;  4JBK A;  4AYB G;  4JBM A;  4JI2 L;  4AH6 A;  1C7Y A;  1I50 H;  1QZG A;  1N36 Q;  1NMG A;  2Z6K C;  1FJG L;  1WCM H;  3TS2 A;  3DM3 A;  4DUZ L;  4X64 Q;  3CPW A;  4DV7 Q;  4HJ8 A;  4DR5 Q;  1X3E A;  4OX9 Q;  4JOI A;  1Z9F A;  3GO5 A;  3CXC A;  4LWC A;  3HOX H;  3S14 H;  1CKN B;  3H15 A;  4JV5 Q;  1KHI A;  3KF6 A;  5JJL A;  5IP9 H;  1PVO A;  2BH8 A;  3L7Z C;  2BA0 A;  1TWH H;  5M3M H;  5EAY A;  1Y14 B;  4DUY Q;  4L5S A;  1YJ9 A;  1PHJ A;  4DV0 L;  1HZA A;  1NBW A;  4DV2 Q;  3AQQ A;  3RLN A;  3NEL A;  3S2H H;  1E22 A;  3F2C A;  1UWV A;  1SE8 A;  1E7Z A;  2OQ0 A;  3A0J A;  3CC7 A;  5IP7 H;  1X65 A;  3S15 H;  3F8T A;  4ALP A;  1RL2 A;  4YCV A;  1I3Q H;  2R6G A;  1EWI A;  4FDB A;  4A3I G;  4R4Q A;  3H0G H;  1XMQ L;  1L0W A;  1PH2 A;  1E1O A;  2KEN A;  2MQH A;  2PMZ E;  3M85 A;  2KHI A;  3UE0 A;  2QA4 A;  1HNZ Q;  5C4J H;  1IBL Q;  1D8L A;  2FXQ A;  2I5M X;  2JA8 G;  3PUZ A;  2YTX A;  2VQF L;  1OXS C;  3B6Y A;  2JK8 A;  4OO1 I;  4LF7 Q;  5GAE C;  4A3B H;  4GOP C;  1GM5 A;  3E9H A;  1WI5 A;  3I56 A;  1VCI A;  3G71 A;  4IO9 A;  4DR2 Q;  4A3M H;  2B63 G;  4JYA Q;  3CCV A;  4BA2 I;  1TXY A;  2OCE A;  4ME3 A;  1PH9 A;  4NXM Q;  4C2M H;  1B70 B;  1G29 1;  4NXN L;  5GAH C;  4GOP B;  1OXU A;  2KCT A;  1VQL A;  4JI7 L;  2UU9 Q;  3BJU A;  4LUV A;  4X66 Q;  4A3C H;  1S40 A;  1C0A A;  3NEN A;  2OTL A;  3KJP A;  1QVF A;  3PF5 A;  1VQC A;  4DV4 L;  3GTP H;  3W1B A;  2R7Z G;  4JI6 Q;  1MKH A;  1YJW A;  1XNR L;  3S1R H;  2H5X A;  4DV6 Q;  1JE5 A;  3CPF A;  4L5Q A;  5C3E G;  2ZJP A;  1VS0 A;  4X62 Q;  5FJ8 G;  3OTO Q;  3RLF A;  3KYH C;  2ZM6 L;  4DR3 L;  1MIU A;  2F52 A;  3Q8D A;  4JI2 Q;  5M3F H;  2HT1 A;  3HOU H;  5FLM G;  4MTN A;  1BVS A;  4J15 A;  5AJ3 L;  3J81 j;  1VQ6 A;  4BXX H;  1Q1E A;  4OWX B;  3GTK H;  1VQG A;  3RN5 A;  3KOJ A;  1VQ4 A;  3F1Z A;  1V43 A;  2JQO A;  4DR7 L;  2Z6K A;  1CKN A;  5IWA L;  1KC8 C;  3ULL A;  3CW2 C;  1K8G A;  3BZK A;  4A3L H;  2C35 B;  3F2B A;  4GS3 A;  4DR5 L;  1Y1W G;  1IXR A;  2I5H A;  3PUW A;  4WJ4 A;  5IYB G;  4DV0 Q;  2NVT H;  1XPU A;  1VQM A;  3CCU A;  1PYS B;  2F4V Q;  4LF6 L;  4DR4 L;  2K4K A;  1A8V A;  4P71 A;  3CQZ H;  5C44 H;  1I94 Q;  2DUD A;  2Y0S E;  1H95 A;  1FJG Q;  4WJ3 M;  1VQ9 A;  1PH1 A;  2ZTD A;  1CSQ A;  1XTD A;  2B29 A;  3CF5 A;  1E3P A;  2VQF Q;  2IT1 A;  4X65 Q;  4BBR H;  4KHP L;  1PA6 A;  1EIF A;  2QGQ A;  4APV A;  4IFD J;  1S72 A;  1BBU A;  4AIM A;  1JB7 A;  3M9B A;  1K8A C;  3A5Z B;  2AMC B;  1XPO A;  2JA7 H;  4NXN Q;  3I4M H;  4A3G G;  4DK3 C;  4C3H H;  1QUQ B;  3F2D A;  4O2D A;  5LMN L;  4GOP A;  2HQL A;  4LF7 L;  3S17 H;  4JI7 Q;  3PO3 G;  4BY7 G;  4DR2 L;  3HOW H;  3A5U A;  2Q2T A;  2RHQ B;  1PH5 A;  2JA6 G;  2N78 A;  2RHS B;  1IBK L;  1K9M C;  1M90 C;  2GVA A;  5GAD C;  4LUO A;  4DV4 Q;  3KFU A;  3PO2 G;  3K80 C;  1KRS A;  2NVX H;  2OQK A;  3HOZ G;  3CD6 A;  2E2H H;  4X66 L;  2ID0 A;  1YHB A;  1N34 L;  1N33 Q;  4A3D H;  2PI2 E;  4DR3 Q;  4B3S Q;  2I5L X;  3U4Z A;  3I4N G;  1VQD A;  4YCW A;  5C0X I;  4LFC L;  4JI6 L;  4JBJ A;  4PZ6 A;  4DV6 L;  4DNI A;  4YY3 Q;  3J80 i;  1UE7 A;  4X62 L;  1MJC A;  1S3O A;  1VQH A;  2Q2H A;  4OXP A;  3D0F A;  4PMW A;  3CCJ A;  4DR7 Q;  3BZC A;  1KIX A;  5IWA Q;  4DV3 L;  5LMN W;  3PV0 A;  5ELN A;  3LGJ A;  1XMO Q;  4A4I A;  2K5H A;  3G48 A;  3HFZ B;  3U50 C;  2ZTC A;  4A75 A;  4QIW E;  1MJE A;  4OO1 G;  2UUB Q;  4PZ8 A;  3M4P A;  3UDX A;  2QEX A;  1G51 A;  2E5L L;  3U4V A;  4IFD I;  4DR4 Q;  4LF6 Q;  5GQO A;  4Y52 H;  1TWG H;  4JI4 Q;  2VNU D;  4GLX A;  4GKJ Q;  1YVC A;  3CP0 A;  2UXB L;  5IE8 A;  5HGQ A;  4A76 A;  1VQJ A;  2WFW A;  3JAM i;  4POG A;  2CKZ B;  2A19 A;  4A3I H;  3S1N H;  2F4V L;  3HKZ E;  2R93 G;  1VQK A;  3HOV H;  4GLA C;  1XPR A;  4PG3 A;  3T1Y L;  1LYL A;  4KHP Q;  2VL6 A;  2JA8 H;  2CCZ A;  3T1H Q;  2V1C C;  4EQ5 A;  2UXC L;  4QL5 A;  1HJP A;  4JI5 Q;  1QZH A;  2B63 H;  1EYG A;  2IHF A;  4X65 L;  3FHW A;  4YWK A;  1OTC A;  5LMN Q;  2VY3 A;  2BH2 A;  1QUQ A;  4JI1 L;  2OTJ A;  1SRU A;  2UUA Q;  1LUZ A;  3TEH B;  1EQR A;  4KHZ A;  1Q7Y C;  3ULJ A;  4BBS G;  4LF8 Q;  1EFW A;  2ES2 A;  2Q2U A;  3K81 C;  1O7I A;  3CAM A;  1IYJ B;  1TWF H;  4IJH A;  5IP9 G;  2BA1 A;  1OXV A;  1IBK Q;  3RN2 A;  2JA5 G;  1D7Q A;  4YWM A;  1WYD A;  4P73 A;  2F3I A;  4B3T Q;  1VQB A;  2R7Z H;  4LFA L;  2UUC L;  3W5O A;  3EIV A;  5E7N A;  1N34 Q;  2K75 A;  5BR8 L;  5C3E H;  2JEA I;  5JEA G;  4Y7N H;  1JMC A;  3PGZ A;  3PF4 A;  5FJ8 H;  3TRZ A;  2YTY A;  4LFC Q;  1JJG A;  5IT9 c;  3AFP A;  3CCQ A;  3S16 H;  5FLM H;  1CKM A;  4DR6 L;  4GNX C;  1N33 L;  1GD7 A;  4MZ9 A;  4B3S L;  1YHA A;  2GVB A;  1TWC H;  1A62 A;  1VQ5 A;  2EQS A;  1NJI C;  4K0K Q;  4DV3 Q;  3STB C;  4LW1 A;  4XTC S;  4POF A;  3TRE A;  1Q82 C;  1XNQ Q;  4GNX B;  4AQY L;  1W3S A;  2PQA B;  4JI3 Q;  4IPD A;  4YY3 L;  3CCL A;  4B3M L;  1VQF A;  2ASB A;  1Y1V G;  2D0O A;  1UE5 A;  2E5L Q;  3M4O H;  1XMO L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...