2NVYH

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvyH00
4A3FG 2R6GA 3I56A 3HOVG 4A3DG 1Q1EA 3KJOA 1JT8A 2LXJA 2AWOA 3KF6B 3CCJA 4A3BG 3K8AA 4BBSG 3M7NA 4DV6L 1UEBA 3LGJA 1QVCA 3FKIH 4OWTB 1N36L 3PO3G 4A3GH 2IY5B 1PH6A 5IY0A 2UUCQ 4JOIC 4A3JG 1ASYA 1IBLL 1MJEA 2CQOA 2QA4A 1S40A 4L5TA 4JI7L 4OO1G 4X66L 2OTJA 2AHOB 5C0XI 4K0KQ 1IBKQ 1PH8A 1E7ZA 3HOYH 3RZOH 1VCIA 4R4CA 2LXKA 3K80C 5IE8A 1UE7A 3U4ZA 1Y1WG 3JAMi 1FGUA 1I3QH 4R4IA 3STBC 4MZ9A 3M85A 1VQCA 2I0QA 1VQAA 4GNXB 1EYGA 1U0LA 4GKKQ 3ERSX 2NVXH 3D0FA 3G6EA 4KHPQ 2UXCQ 2ASBA 1JJCB 1VQBA 1YHAA 1XNQQ 3OTOL 1CSPA 1WYDA 1FJGL 4HIMA 4JV5L 3CCQA 4JYAQ 1YHBA 4LWCA 1HZ9A 3GTQH 3PF4A 1P16A 2WFWA 4JI5L 2YU9H 2UXDQ 3VDYA 3ULJA 3S2DH 3GTJH 1YBYA 3KDFA 2VS1A 1CUKA 2IX1A 3PSIA 1RL2A 4DV5L 2I5LX 2Q2HA 4DAMA 1R9TH 4LFBQ 3E9HA 1UE5A 1X56A 1QZHA 2JA7G 4OX9Q 1N36Q 2F4VL 3TQYA 1Z47A 1X54A 1TWHH 4DR4Q 4JBKA 1XMQQ 3CMEA 3TS0A 1NBWA 3G71A 1W3SA 2UUAL 2Z6KA 5JJLA 1WJJA 4JOIA 4NXMQ 3NELA 3I4MH 2E5LQ 3PO3H 1EQRA 1QUQB 4YY3L 2JEAI 1Y1WH 2K14A 1X6OA 4A3KG 4DV7Q 1Q7YC 3HOVH 4GLXA 2OQKA 1PH3A 4JI2L 2YYZA 1ASZA 3HOUH 2LSSA 2ZJQA 4R4OA 2VQFL 2N78A 4YY3Q 4B3ML 4JC0A 4BA2I 1XPOA 4YCWA 1OXVA 4POFA 2JA8H 3RLOA 3GTGH 1NMFA 3M4QA 1MJCA 4LUOA 4C2MH 5GAGC 4DR6L 3J81c 3AQQA 3CCSA 1N34Q 1VQKA 2PQAA 4A3MG 3CAMA 5K36G 3H3VH 4C3HH 4DK3C 4DR5L 4JCVE 4JBJA 5FLMH 1VQDA 1HZCA 4A3FH 1IBLQ 1KAWA 4DV0L 4HJ9A 4OX9L 3BZCA 4UY8C 2XTIA 4YHHQ 1YZ6A 3STBD 4DV3L 1AE3A 1G291 4LF4Q 4AQYL 1PV4A 4LF7Q 4LF6L 1PH9A 1JB7A 2MO0A 4GKJQ 4DK6C 3CCMA 3T1YL 1IXRA 2K52A 1K9MC 1GKHA 1G51A 2ZM6L 3IRBA 1B8AA 1I94Q 4X65L 1WCMG 4NXML 4NXNQ 3J7A5 2E5LL 4O0AA 4AYBG 2VL6A 4LF4L 1VQ7A 1C9OA 2K5VA 1DGSA 3E0EA 4RG1A 1OXXK 4LF8L 4DR1L 1V9PA 5C0XJ 4MNOA 4B3RQ 5IYCH 3CP0A 3TREA 2DUDA 5IP7G 4DV1Q 1UE6A 1VQFA 4X65Q 2VY3A 3PIOA 2K4KA 1JJ2A 3TS2A 1AH9A 1MIUA 4P74A 5IP7H 1XPRA 1L1OA 4GOPA 4A3KH 3OW2A 1EFWA 4LFBL 2PQAB 1S72A 3UDXA 2B63H 4QL5A 1SE8A 1X55A 3M9BA 5M3MG 4LF5Q 3ZJYC 2AMCB 4AH6A 3A5UA 3HOZG 4EQ5A 4B3SQ 2R93G 3HOZH 4ME3A 5BR8Q 4YCUA 4C3IH 2HHHQ 1N33L 2Y0SG 1XNRL 4A3CH 4A3EG 4GNXA 1KC8C 3F2BA 1PHJA 3CD6A 5JJIA 3NENA 3CPWA 5AJ3Q 2JA6H 4IJHA 1HR0Q 3M3YH 4A3LG 4GKJL 2JQOA 1G6PA 1Q82C 2IHFA 2CWAA 1HZAA 1YNXA 2E8GA 2OQ0A 1I94L 1PH7A 3MXNB 4A3MH 1HJPA 1K8AC 2NVTH 3W1GA 2RHSB 4DPGA 2VUMH 4X66Q 1B70B 1YVCA 1HNXL 1IL2A 1CKNB 4ALPA 3HOWH 4WJ3M 1HNZL 2AKWB 3NEMA 1X3GA 2JJQA 3TRZA 4P71A 3I7FA 3U4VA 1D8LA 1WCMH 1PYSB 3EIVA 4DV2L 2B3GA 1XMQL 3H0GG 1CKMA 1AE2A 1VQHA 2OCEA 3G48A 5C44H 3CCUA 4LFCQ 3AEVA 4PZ7A 3S1QH 4DR6Q 4PZ8A 1HNZQ 4IPHA 3OTOQ 1PVOA 2MFIA 4PG3A 2IT1A 4DKAC 2HT1A 4DV6Q 2ALYB 2ATWA 5C3EH 3HOYG 2ZTEA 4QGUA 2UXDL 2E2IH 1PYBA 1C7YA 4A3EH 3CC4A 1QUQA 4JI6L 4JI3L 1J5EQ 1EWIA 3TEHB 2UU9Q 2VNUD 1KD1C 1IZ6A 3GO5A 1N9WA 1UWVA 2YTVA 3S2HH 1HNWL 1VQJA 4J15A 1NE3A 3HOXH 3F2CA 4NXNL 1EQQA 2B63G 4A3BH 2YTYA 1CKNA 4KI0A 2JA5H 3KJPA 1Q86C 3CXCA 4A3DH 3JC66 2NZHA 1GO3E 1XMOL 2IX0A 2R7ZH 2EQSA 1NY4A 4DR5Q 4GN4B 2Z0SA 2RCNA 4Y52H 1VQ5A 1SMXA 3BU2A 3PV0A 4UP7A 2CFMA 1KL9A 4C3JH 1N8RC 3HKZG 1T9HA 1EIFA 4JI2Q 4DNIA 1KHIA 3HKSA 4FDBA 2VQFQ 1LTLA 5IP9G 1VQ4A 3NBHB 5LMNL 4B3MQ 2HIXA 4MTNA 3PO2H 4LF9Q 1I6HH 3H15A 1K0RA 1Q12A 1EOVA 3E9IA 3PCOB 4IPCA 2JEBI 5IWAQ 1K3RA 4IJLA 2F52A 3KLWA 1BKBA 1VQIA 3K0XA 1J5EL 5AJ3L 1S3OA 2UU9L 2Q2UA 4BY7G 3J80c 3PUWA 5HY6A 2BH8A 4OO1I 1YEZA 1HNWQ 4LW1A 4OXPA 1D7QA 3KDFB 3B6YA 5GADC 1TWFH 5IYDH 1EIYB 3J81i 3MEFA 4YCVA 4YHHL 1W2BA 2Z6KC 4DV3Q 4A3GG 4UP8A 2AWNA 5FLXc 1E1OA 1YJ9A 3A0JA 2C35B 2CKZB 4LFAQ 4PMWA 2UUCL 1CKOA 5C4JH 1I5FA 4BXXH 3DM3A 4JYAL 2R92G 2Y0SE 5FLMG 4A4IA 3S14H 2JE6I 3CCLA 1WFQA 1VS0A 2JA9A 3KYHC 1UE1A 2QEXA 4A93G 4HJ8A 2BA0A 2OWOA 2UXBL 5DLQE 2MNAA 1QVGA 1LM0A 2UUBQ 4AYBE 3RN2A 2VQEQ 3UDGA 3S1MH 2GVBA 5GROA 1VQMA 3F1ZA 1SRUA 4PZ6A 2GN5A 3I2ZA 3RLFA 3EN2A 2ZTDA 3UE0A 2I5MX 3T1HQ 3CCVA 1PH1A 4LF7L 2VUMG 3S15H 1HH2P 1EUJA 4DR3Q 2NN6G 1IBMQ 3RLNA 3KOJA 3HKZE 4B3SL 1VQOA 2EXDA 5BR8L 1VQNA 1Q46A 1XNRQ 1XPUA 1X9NA 2PNHA 4GN5A 3GTPH 5H1SE 2MO1A 3L0OA 3S1NH 3GD7A 1XMOQ 1OXSC 3Q8DA 1SLJA 3FHWA 1KRSA 3CCRA 2WB1E 1IBML 1XJVA 4A75A 3BJUA 4GS3A 1Y14B 5GAHC 4DV1L 1V1QA 1VQGA 4DR2L 3ULPA 4DV4L 5LMUL 1KQSA 1YI2A 1TWCH 2L15A 1L1OC 5J3BA 4GOPC 3SGIA 5IYBG 3G4SA 1OTCA 2JA7H 4GKKL 4QY7A 4DR7Q 1XNQL 2VZAA 1FJGQ 3S16H 3PUXA 4P73A 4R1JA 1BBUA 3M4PA 5IYBH 4LF9L 3M4OH 2N8NA 3H0GH 1TWAH 1J6QA 3K7AH 5M3FH 5IYCG 5JJKA 4LF6Q 4AIMA 3RNUA 1N33Q 4RMFA 5C4XH 1A63A 4DV7L 4JI7Q 2BH2A 5C4XG 4NB3A 2ZM6Q 2B29A 1L1OB 4BBRG 4GOPB 1IBKL 4IFDG 4Y7NH 4JI0L 3GTOH 4BBSH 1PA6A 4A93H 2A19A 4YWKA 4JI4L 2V1CC 2E2JH 2ZTCA 4HIOA 3ER0A 3RZDH 4QIWE 1SROA 1YJWA 1V43A 1P8LA 1HZBA 2K75A 2K5HA 4GLVB 1A62A 5FJ8G 2UXCL 1Q1BA 1CSQA 1XTDA 4A3CG 4JG2A 5IT9c 4BA1I 3CQZH 4BBRH 4IFDI 1VQ9A 2F3IA 3I4NG 2D0PA 3UDFA 5M5YH 3PUYA 1Q81C 4X62L 4DUYL 4TVAB 4HIKA 1PH2A 3KFUA 5M3FG 1GVPA 4BXXG 3D31A 2HHHL 3UDIA 1B7YB 1Y1VH 2NVYH 3RN5A 2OTLA 4JI6Q 2R7DA 3A5ZB 3L2PA 4JI3Q 1I50H 2UUAQ 1RIPA 4JI1Q 2PI2A 3PUZA 1O7IA 1Q8KA 1VQLA 1X3FA 1X3EA 4DUZQ 4GNXC 1GD7A 1NJIC 1X65A 2Q2TA 4LFAL 2R7FA 5ELNA 2WAQE 3DLLA 2K5NA 1NTGA 1VQ8A 4JI4Q 4IOAA 4R4TA 4POGA 4JI1L 1KXLA 3I4OA 2KCMA 3AFQA 2D62A 3PIPA 5FJ8H 1JMCA 4LUZA 4H02A 5C3EG 4JI5Q 1GM5A 2HQLA 4X64Q 2VQEL 3PUVA 3PO2G 4KHZA 4O2DA 1L0WA 2N3SA 4A3IG 2NN6I 4DR1Q 4DR7L 5M5WH 4TQUS 4A3JH 2KCTA 5JEAJ 2DGYA 1LUZA 4YWMA 1HR0L 1YITA 4X64L 5LMNW 2JK8A 2ES2A 4NPSA 3F8TA 5IYDG 3HOWG 4XIGS 1VQEA 3KF6A 4UPAA 4BY1H 1SR3A 4IFDJ 1L2FA 3S24A 1YJNA 3W1BA 3GTLH 2WP8J 1TXYA 3J80i 2WB1G 4JI0Q 2H5XA 4A3IH 1IYJB 4DUZL 2PMZE 1E3PA 4A3LH 3K7UC 3S1RH 2E2HH 2I5HA 1JE5A 3OYYA 1FVIA 3T1HL 3I4MG 1PH4A 4B3RL 4IO9A 4HJ5A 1YIJA 4DV5Q 1PFSA 1SFOH 3UE1A 2CWPA 3AYHB 3J81j 2KHJA 1HR0W 2ID0A 2FXQA 1BVSA 2N49A 3FKIG 4DAYB 2QGQA 2ZJPA 3CC7A 1VQPA 3WWVA 1SN8A 3CCEA 4GLAC 4P72A 3CC2A 1Z9FA 3JAMc 2VW9A 4IOCA 4BY7H 1A8VA 5E7NA 1E1TA 4X6AH 5LMNQ 3BZKA 4OWXB 2JA5G 4B3TQ 1YHQA 4YWLA 4EX5A 4DV0Q 4IPGA 4L5QA 4QQBX 4UP9A 3CMAA 4DV2Q 5LMUQ 4BY1G 1KIXA 5EAYA 4LFCL 3U58A 4AQYQ 5IP9H 1NMGA 1K8GA 2WAQG 4APVA 1PH5A 4R4QA 3I4NH 4B3TL 2A8VA 3L7ZC 5M3MH 4IPDA 3KF8B 1VQ6A 2KBNA 2YV5A 3RR5A 4DR4L 1MKHA 3HFZB 4WJ4A 3W5OA 4LF8Q 2R92H 2MQHA 2NZOA 3U50C 4HIDA 3CPFA 3EBEA 4JBWA 1M1KC 2JA6G 4JI8Q 2KHIA 4HJAA 2IHEA 4LUVA 4KHPL 3GTKH 1N32Q 2NVQH 4X62Q 4DUYQ 4JV5Q 1A0IA 1TWGH 1WI5A 1LYLA 4P75A 2A1AA 3S17H 5ELOA 1WOCA 2HIVA 3HOXG 5HGQA 4DV4Q 3GDEA 5IWAL 4GN3B 1OXUA 1E22A 4JBMA 3J7ZC 1KRTA 4LF5L 2JA8G 1N32L 1OXTA 2D0OA 3CW2C 2ZJRA 3GTMH 2YTXA 1U5KA 3F2DA 1JJGA 2Q2IA 4OONA 2F4VQ 3I55A 2KENA 3FP9A 3HOUG 3K81C 1C0AA 2RHQB 4K0KL 5M5XH 2XGTA 1N34L 4DR3L 4L5SA 1BBWA 1K83H 2BA1A 3ULLA 5C44G 4HJ7A 1E24A 2R93H 3ICEA 4XTCS 3AFPA 5GQOA 3A74A 2K50A 3PF5A 4QJFA 1K73C 2EIFA 1HNXQ 1QVFA 4L5RC 2RF4A 5GAEC 3CF5A 3T1YQ 4A76A 1M90C 4OWWB 4KLKA 1QZGA 2R7ZG 4JI8L 2UXBQ 2GVAA 4DR2Q 1FL0A 2PI2E 3PGZA 2CCZA 2UUBL 1Y1VG 4LNQA 1H95A 5JEAG 5C0XG 3H3VI
chains in the Genus database with same CATH superfamily
3HOVG 3I56A 4A3DG 2VUMB 2NVTB 3NBIA 4RHSA 3DEOA 3K8AA 1EU3A 3M7NA 1UEBA 3LGJA 5DM73 4A3GH 5C6AA 5IY0A 4G7ZC 4XXEA 1MJEA 1II3A 2QA4A 1LT6D 5IGFA 4L5TA 1CA6A 2R92B 1E7ZA 3HOYH 3PO2B 2D2CC 3M3YB 2Z4HA 1Y1WG 3JAMi 3GTKB 1I3QH 4N9PA 2I0QA 4DXFA 2SDFA 2R61A 5KNDA 3M7GA 1U0LA 4IUTA 4KHPQ 2ASBA 1PTOD 1YHAA 1CSPA 4HIMA 3CCQA 1PDQA 1B50A 4H7BA 4JI5L 1JICA 3DWPA 2YU9H 2UXDQ 3ULJA 3S2DH 3GTJH 1UUPA 3KDFA 5KIXA 1K8MA 4ZRZA 2EYMA 1RL2A 4DAMA 1R9TH 1I50B 1UE5A 1SNPA 1N36Q 2F4VL 5T1GA 3VR2A 3S14B 2E2IB 2KCCA 4OO1H 3H6MA 2O5JC 1KLUD 4WJWA 1I4PA 1D6EC 3I4MH 3N52A 3PO3H 2B39A 5KEEA 4YY3L 4A3KG 3R2TA 4U68A 1Q7YC 4GLXA 3TBIB 1JORA 3J80L 2HCIA 4BA2I 1PFMA 4JC0A 1XPOA 1OXVA 3J80E 3R93A 2JA8H 2ENBA 1PLFA 3GTPB 3FDTA 4LUOA 4RAUC 5GAGC 1S5DD 1PTOC 3H3VH 5D3DA 3QOJA 5CV9A 5FLMH 3PIP3 4A3FH 3BZCA 3MFGA 2DN8A 1I4HA 1YZ6A 3ONAB 4QUCA 4DV3L 1G291 4K6DA 2DY8A 4K2KA 3TDQA 1PH9A 2MO0A 1ONLA 4GKJQ 5LL6X 1IW7C 3D4DA 1IXRA 1K9MC 2KQ3A 3NBHA 2ZM6L 1B8AA 3VR6A 4X65L 2WKDA 3QB3A 5CORA 1XX8A 2VL6A 4RG1A 2A6ED 3IAYA 1B53A 5IYCH 4DNTB 5IP7G 3E3XA 2HQEA 5EPJA 3PIOA 1JJ2A 2RQXA 1MIUA 4P74A 1AEXA 1XPRA 2N88A 1EFWA 3PIO3 2F3WA 2K32A 2L1BA 3VYSA 3VYUA 2B63H 4QL5A 1U9RA 1SE8A 1J8IA 4RKBA 2EJFC 3ZJYC 3KLRA 4B3SQ 1F9QA 5C4HA 5BR8Q 2Y0SG 1XNRL 4OHJA 2G9HD 2I07B 4HEDA 5JVH3 1HZAA 1YNXA 5JEAH 1L0YB 1I94L 1GOZA 4R9WA 3E0JA 5CR3A 4QMGA 4A3GB 2K1BA 2JJQA 3T56B 3VYRA 5M9OA 1WCMH 3DXJC 3SK5A 1JJGA 4JYAQ 4H13C 3T13A 4ZUJA 4R8NA 4RHRA 2IT1A 4J1MA 2ALYB 2RA4A 2K04A 4QGUA 2E2IH 4JI6L 1QCBD 4JI3L 4CJ0B 1E2ZA 1EWIA 1KAAA 1EYDA 2CQAA 3GO5A 2PNRC 1MI2A 3J7AF 3S2HH 1VQJA 4J15A 4NXNL 2B63G 1LTSD 3NSWA 1LABA 1CKNA 3KJPA 2NUCA 3CXCA 4FF3A 2EY2A 4FNFA 2NZHA 5JJZA 2E76C 3I3CA 2EQSA 2Z0SA 4DN4M 1VDZA 5I4DA 1BUVT 1CFMA 4UP7A 2PW7A 1IW7D 1N8RC 3HKZG 5EPKA 1EIFA 4DNIA 4P2CB 1KHIA 1B9NA 1WD1A 2BE5D 3T53B 1TWCB 3FPPA 3H15A 1K0RA 1EOVA 3R8BA 1K3RA 3KBXA 4ILWA 1S3OA 3MAQA 3J80c 1LTGD 2BH8A 5ELEA 4LW1A 1K28A 3J81i 3SK6A 4YCVA 4DV3Q 1VMCA 3GTQB 1A6XA 3S2DB 1AN8A 3J7AV 2AWNA 5FLXc 1HHVA 1E1OA 2EOTA 3W2DA 1MGSA 4BS9A 2EJGC 2CKZB 4LFAQ 4IZ8A 4PMWA 5C4JH 5FLMG 4RA8A 1LTID 1CM9A 4MIUA 4HJ8A 2UXBL 2MNAA 4A3JB 1IYUA 1LM0A 1T5EA 3K5MA 1F9SA 1VQMA 1X32A 4QB4A 3RLFA 3UE0A 2I5MX 3T1HQ 1B3QA 3CCVA 1PH1A 3S15H 3I4LA 1HH2P 2P5ZX 3OMCA 2NN6G 4DR3Q 2EY6A 1BNZA 4OIKA 5IGEA 1I4QA 1X9NA 4GN5A 3GTPH 3L0OA 2EDGA 3GD7A 3WOEA 1XMOQ 4WFN3 1SLJA 2F0DA 5CV6A 4DV1L 5GAHC 4DR2L 4HN7A 3SR1A 3ULPA 3FVQA 4XQNA 4DV4L 5J3BA 3G4SA 4QY7A 4DR7Q 1F77A 4R1JA 4KY7A 4KTAA 4CDCC 2E74C 4IUUA 1N33Q 2BH2A 1JWSD 1NUCA 2QCPX 4JI0L 4G4KA 4IUVA 2A6HD 1KDBA 3ER0A 5C4JB 1SROA 1YJWA 1EL0A 1V43A 5EBCA 1CSQA 4QIWB 4A3CG 1PFNA 3CQZH 1VQ9A 3D4RA 2F3IA 2WAQB 3UDFA 4KJOA 2AUKA 4X62L 4DUYL 4TVAB 2WINB 1DCZA 4ZUIA 4BXXG 3D31A 4LK1C 3S9WA 1B7YB 3I70A 3RN5A 4JI6Q 2F0PA 2R7DA 3L2PA 4JI3Q 1I50H 2SNSA 1RIPA 4IUQA 1Q8KA 1X3EA 4XQQA 1GD7A 2KEEA 1BCPF 4JI4Q 4IOAA 4R4TA 3DMUA 3N6RA 1KXLA 2ZT9C 5EQ0A 3I4OA 2D62A 5FJ8H 2KA7A 4LUZA 1LTTD 2HQLA 2HUGA 4RFBA 5G3LD 5J39A 2VQEL 3S16B 2WB1B 4DAYA 4DR1Q 2F0HA 2DGYA 4YWMA 1EY4A 2F03A 1CHPD 5IYDG 4KKSA 3H3VC 2VB2X 4BY1H 4DAPA 1YJNA 3W1BA 1TS2A 2WP8J 1EWCA 2DNEA 4A3FB 4V190 1IYJB 2QDLA 5D65A 1E3PA 2XWJB 3K58A 2I5HA 3MVVA 4EVOA 4K6LA 1PFSA 1SFOH 3J81j 3FKIG 4DAYB 1B44D 2ZJPA 1JOOA 4KV6A 1SN8A 1F2LA 4P72A 4BY7H 1G8ZD 2F0OA 4X6AH 5LMNQ 1BF4A 4B3TQ 1SMYD 4EX5A 4DV0Q 3GP7A 3K0YA 4L5QA 4UP9A 4DV2Q 3U58A 1K8GA 4APVA 5JPNC 2KBNA 2YV5A 3RR5A 3RUZA 1MKHA 1HTPA 1VF7A 3W5OA 2JA6B 1CT1D 2JA6G 5I2XA 1M1KC 2NB0A 2IJ0A 4UAIA 1QG7A 5M5WB 1JWMD 1RD9D 1A0IA 4BBRB 1LT5D 1F9PA 1EYCA 1LT4D 1LYLA 1TWGH 3S17H 5ELOA 2HIVA 3HOXG 5HGQA 4DV4Q 5C4XB 4GN3B 5E4WC 1KRTA 2JA8G 1OXTA 4BY1B 3E5SA 1L0XB 2XWBB 4MN3A 3GTLB 1XWEA 3F2DA 4OONA 2FMCA 5C3XA 5ELBA 3FP9A 1QNKA 4FVMA 2FJ2A 2K7VA 2RHQB 2XGTA 1ICWA 4DR3L 4L5SA 3T51B 4FF4A 1QB5D 4EQNA 5C44G 2IL8A 1E24A 1IKLA 2R93H 1XTCD 4XTCS 1O78A 1DOKA 5GQOA 3X3MA 3PF5A 3S2HB 1HNXQ 2RF4A 5GAEC 1BOSA 5A2QL 3T1YQ 5DAUA 1M90C 2UXBQ 1UEAB 2GVAA 4DR2Q 3PGZA 1MSHA 1Y1VG 5LMNW 2ICEC 4ULLA 1T5XD 2IPKD 4Z9CB 2MHVA 4N8FA 4R8IA 4A3BG 5FO9B 4BBSG 4DV6L 1FR3A 3PO3G 5BN3A 1PH6A 1ENAA 2Z1CA 2OF1A 2X6GA 2UUCQ 1QNUA 4ZQ3A 1ASYA 1S40A 2B8FA 4A93B 4CGYB 4X66L 3S1QB 2AHOB 5K5PA 2C5CA 1SYEA 3NHHA 4KY5A 5HGTA 2LXKA 5IE8A 2J0TD 2RSOA 3EFXD 3M85A 1VQCA 1VQAA 4GKKQ 3ERSX 3URYA 1TWFB 2UXCQ 1XNQQ 1STYA 1FJGL 1YHBA 4E6IA 3GTQH 2O4XA 3PF4A 3VDYA 3VR5A 2RCFA 2IX1A 3LNNA 1Q90A 3DHQA 2KECA 4QCLA 1STAA 4LFBQ 2KJXA 3NTIA 1QZHA 4OX9Q 1Z47A 3PMFA 4DR4Q 2E2HB 3TS0A 3TP6A 1X3PA 1HXYD 1EQVA 1Y8PB 2Q8RE 1Z7TA 2G5DA 1SYGA 3EJIA 1WJJA 1CZWA 4C3IB 2E5LQ 1QUQB 4F8MA 2FMMA 1RTNA 5J1ZA 4CKCA 3C1EA 4CJ1B 5DM63 4DV7Q 3S15B 2OQKA 3DUZA 3HOUH 1ASZA 2LSSA 4R4OA 3V96A 2NWGA 4YY3Q 4YCWA 4ME5A 3M4QA 1EQTA 3NUCA 1VF5C 3AQQA 3CCSA 1VQKA 5K36G 4DR5L 1IBLQ 2EE1A 1D5XC 3D6WA 3KLSX 4YHHQ 4DA2A 1AE3A 4NW2A 3TZUA 4LF4Q 4AQYL 4LF7Q 2CVRA 3SEBA 1GKHA 3T4AC 3IRBA 1WCMG 4NXML 1S5FD 4O0AA 4AYBG 1VQ7A 1C9OA 2K5VA 1DGSA 3E0EA 1OXXK 1V9PA 5C0XJ 3NXWA 4N9TA 2A5HA 2F3VA 5J22A 3TREA 4X65Q 2VY3A 3TS2A 1A2TA 5JOBA 4BWGB 1L1OA 3I90A 2PQAB 2QF7A 3BDLA 4OIJA 3UDXA 1GUWA 2SOBA 1EZ6A 5M3MG 2AMCB 1SJED 1DJRD 4JPBW 1KDCA 2EVBA 2V4DA 5M3MB 1M4VA 4ME3A 1PXUA 4YCUA 4A3CH 3F2BA 1SNCA 2KVMA 1EOTA 2JA6H 5AJ3Q 1MBYA 4IJHA 1HR0Q 3M3YH 4A3LG 1EY5A 4GKJL 1G6PA 1Q82C 1KDAA 2CWAA 2PZUA 2E8GA 3MXNB 1K8AC 1HJPA 2KCNA 1CI3M 2RHSB 3BDCA 3RMHA 3W1GA 4X66Q 1HNXL 1TWGB 1IL2A 3IFDA 1ENFA 4ALPA 3HOWH 3P7JA 5JAVA 3TRZA 4HSPA 4OGQC 3TP5A 3U4VA 2A73B 1LO5D 4OEMB 1U4MA 3EIVA 5CV4A 2B3GA 5KRUA 1VQHA 3G48A 2PW5A 5C44H 3CCUA 3S1QH 4PZ7A 2EYFA 4DKAC 3CC4A 1CQFA 2B2TA 1DONA 1J5EQ 1AZPA 1X3QA 1I4XA 1HUNA 5JPMC 3BDOA 1NE3A 2IWHA 4ID6A 3MFYA 1B3AA 3MXNA 2Q8TA 3FPUB 2JA5H 2Z6BA 3LWEA 5E1FA 1JC7A 3NTKA 2E75C 2F0WA 1O80A 2RCNA 1VQ5A 2OEOA 4IN3A 2CFMA 1TIID 3K57A 1T9HA 4JI2Q 1EU4A 4HSVA 5EBDA 1IL8A 1NAPA 1DYQA 1ZYRC 3OOCA 3HKSA 1VQ4A 5LMNL 2HIXA 4MTNA 4F87A 1I6HH 3PCOB 3MHBA 5IWAQ 3MC0B 2F52A 1BKBA 2KEDA 2RDHA 2Q2UA 4BY7G 3PUWA 4OO1I 4OXPA 3B6YA 5IYDH 3DWQA 2VXWA 3BYYB 4YHHL 2Z6KC 4A3GG 2NTSA 5C5MA 2F0KA 2JN4A 4I65A 3KF8A 4LAAA 3SVMA 3J81E 4FXGC 2UUCL 1HCZA 1CKOA 4BXXH 3DM3A 4ZCKA 4JYAL 2PZWA 2Y0SE 2Z4IA 3P20A 4A4IA 3GQBA 2JE6I 3BVZA 4X3SA 3S14H 1EEID 3KYHC 3OIQA 4XT1B 4AYBE 3RN2A 4KJNA 5EGTA 3UDGA 2F0EA 2B2YA 3F1ZA 2R3ZA 1C4QA 4PZ6A 3I2ZA 4ZAIA 3EN2A 4A3BB 5IGCA 5CV5A 1SAPA 1BBXC 4LF7L 3VR3A 2LFNA 1GHJA 1Y1VB 3KOJA 4KD4A 5COYA 1Q3LA 1TY0A 2E2DC 2PYKA 2MO1A 5L37A 3A7LA 1GXDC 4AYBB 1QE6A 1E2VA 1XJVA 4A75A 1WCMB 3EQLC 1V1QA 1VQGA 1KQSA 1HA6A 1YI2A 3Q22A 4GOPC 1CTMA 3SGIA 5A2QE 4WORA 2F0UA 3S16H 4XYOA 5IYBH 1WVLA 3M4OH 3D3RA 2A6HC 5IYCG 1D2BA 3K5OA 1CZGA 3RNUA 4RMFA 5C4XH 1HPCA 3HOXB 4NB3A 1SYBA 1L1OB 4KN7C 3GTOH 2B2TC 1PA6A 3H91A 2A19A 2QKIC 2AQ2B 4YWKA 2V1CC 2E2JH 2K01A 3C46A 2ZTCA 4HIOA 5AFWA 4QIWE 4A3KB 1HZBA 1H9SB 2NBFA 1EIHA 1A62A 2ICIA 2XRSD 2K5WA 2UXCL 4C3IG 4JG2A 4BBRH 4IFDI 5I6YA 4NMZA 4HCEA 3MXGA 1I6HB 3A7AB 1XYIA 1Y1VH 1YNNC 4IALA 1CA5A 2I46A 4JI1Q 1WTRA 1VQLA 1X3FA 3FKIB 4GNXC 1NJIC 1X65A 3HEJA 2Q2TA 5CGKA 2CH4W 4LFAL 1PTOF 5ELNA 2H4OA 1DXMA 2K5NA 4C3JG 1NTGA 4X3KA 2EY5A 2JYOA 4JI1L 1Y1WB 1SEBD 3TN2A 1S5CD 1L0WA 1D5MC 1I3QB 2XVSA 4C1NI 2NN6I 4DR7L 3I8ZA 2KCTA 4L8JA 4EQOA 5JEAJ 1HR0L 3MWYW 1SE4A 1YITA 3QG1A 5BN4A 2JK8A 3P1HA 4NPSA 1SMYC 5CBAE 1QWYA 1VQEA 2D5DA 4BBSB 3I72A 4B08A 1WTWA 2D9UA 2WB1G 3DM1A 1AP0A 2F0FA 2X69A 2WKCA 4DUZL 2PMZE 2Z8LA 2MP1A 4A3LH 3K7UC 3LWUA 2E2HH 3C3LA 4DAVA 3S1NB 2N55A 2BOSA 4B3RL 4IO9A 2C9OA 4HJ5A 4C3JB 1WD0A 2BE5C 4CDFC 2CWPA 2KHJA 2FXQA 3CC7A 2N49A 1G6ZA 2QGQA 1M8AA 1PTOB 3BVMA 3GTJB 1Z9FA 1NR4A 4IOCA 5CC4A 1RTOA 4XDXA 1E1TA 1JOQA 2NN6H 2EYHA 1TWAB 3NWTA 1U4RA 4BY1G 3A56A 4LFCL 1KIXA 2JA8B 5IP9H 1F9RA 2WAQG 1HQRD 4B3TL 3IL8A 5M3MH 2AQ3B 3KF8B 1DM0B 5FOBB 5C3WA 4LF8Q 4ZKCB 2MQHA 1A3TA 2NZOA 4HIDA 3CPFA 3EBEA 1F2YA 4JI8Q 4HJAA 2IHEA 4KHPL 1N32Q 5DEHA 1SJHD 4HMIA 2B2VA 4JV5Q 2NVXB 2A1AA 3KUPA 1WOCA 1D1IA 2EXZA 5IWAL 3J7ZC 4LF5L 1S5BD 5D3IB 1N32L 2D0OA 3GTMH 1PRTC 2Q2IA 3E6ZX 1ZKOA 2KENA 4K0KL 3EVQA 2BA1A 4S3SA 4HJ7A 2HD3A 4ZKBB 2K50A 1JWUD 1K73C 2F0TA 2LMCB 4L5RC 4UHVA 1QZGA 2EYJA 4G7HC 2IX3A 4LNQA 5JEAG 4A3FG 3CU7A 3KJOA 3CCJA 1QVCA 3C2PA 4A3JG 2F0NA 2CQOA 2H1EA 4JI7L 4K5VA 5IIFA 4A3IB 1PH8A 5BN5A 3IFTA 1VCIA 1UE7A 1FGUA 4R4IA 1ICFB 4MZ9A 3STBC 2SEBD 4GNXB 1EYGA 2NVXH 1E0BA 3D0FA 3MA2B 5IGDA 1WYDA 2JP1A 3EROA 4LWCA 1HZ9A 5IGGA 1P16A 2WFWA 3FMCA 3RD4A 1YBYA 2VS1A 1CUKA 4BY7B 3PSIA 2I5LX 1SNMA 2L11A 3E9HA 1X56A 2L0CA 4ZK9B 3TQYA 1X54A 1PFBA 4JBKA 1XMQQ 3CMEA 4M8AA 3F2UA 2Z6KA 4Q0FA 4YIJA 5JJLA 2XSCA 2PPBC 1JOKA 5HURA 3SE0A 2A68D 1EQRA 2BCOA 1NNXA 3HZXA 1Y1WH 2K14A 2X6LA 1X6OA 1ILPA 3K6OA 4JI2L 2YYZA 4CHTB 2NVQB 3BS1A 4PMCA 3Q6SA 2VQFL 1VMPA 4B3ML 5FO8B 2F0VA 3GTGH 2J4XA 1NMFA 1MJCA 1EEFD 4C2MH 1G91A 4DR6L 4RGNA 1BXTA 1N34Q 4A3MG 3CAMA 1U4PA 4C3HH 4DK3C 1F2MA 4RWSC 1VQDA 4OX9L 1YNJD 3HOVH 4DV0L 4UY8C 3RZOB 2FINB 4TRDA 1C48A 3STBD 1PV4A 2CHBD 4DK6C 3CCMA 3T1YL 5LL6S 1G51A 3MZ5A 5EKKA 4NXNQ 2ZXOA 4L6TB 4DU9A 3S1MB 4LF4L 2WACA 4B3RQ 2K05A 2PMZB 4DR1L 3T16A 4JW0A 1LACA 3P75A 1UE6A 1VQFA 3M4YA 1XXGA 1WTXA 4A3KH 2KOLA 1PZID 1S72A 2L4NA 3M9BA 3KLSA 4LF5Q 3MEHA 3HOZG 4J8QA 4C3IH 1KC8C 5FKAC 1PHJA 2WV6D 5JJIA 1ESFA 3CPWA 1D1KA 1ET9A 1B4OA 2JQOA 1TR5A 2IHFA 2RVLA 1UNSA 4C56C 1PH7A 2WIIB 2K6AA 3VA5A 3I91A 4DPGA 1OO9B 1B70B 1YVCA 4X3UA 1CKNB 3NQIA 3SHLA 1HA5A 4HTHA 5IODA 4KKUA 4P71A 4M1UB 1LLRD 1D8LA 4DV2L 4RCOA 3K5NA 1CKMA 2E2JB 2DNCA 1Y8NB 4NP5A 3AEVA 3BYTB 4PZ8A 1K8OA 1TS5A 4I7ZC 3DWAA 2MFIA 4PG3A 4DV6Q 3HOYG 3FRPB 1SBBB 2ZTEA 1GJXA 1PYBA 1QUQA 3U9SA 3OWFA 2UU9Q 5K36H 1G2TA 1N9WA 5IT9L 4K8IA 3HKZB 1HNWL 3D6CA 3LX0A 1TQOA 2MPMA 3F2CA 2XRQD 1EQQA 4Q5VA 4A3BH 2YTYA 4KI0A 1Q86C 4HR7B 2EYOA 3JC66 4PMBA 2XNAC 2SNMA 2IX0A 2HCCA 3Q0AA 4FF2A 1IKMA 2B63B 2PQEA 2A69C 5ISRA 3BU2A 3L3OC 2BDOA 1H9RA 1KL9A 1Q8IA 3PQIA 4DK1A 2VQFQ 2G9DA 5IP9G 4B3MQ 1PTOH 4LF9Q 3E9IA 4IPCA 1TT2A 2JEBI 3KLWA 2OXPA 3K0XA 1RKNA 1YEZA 3Q24A 1D7QA 3KDFB 3NWSA 5GADC 3A54A 1EIYB 1HFGA 1W2BA 2NZ1D 4UP8A 2A6EC 4J6HA 5DNFA 1HRJA 1EY0A 3GTOB 1SNOA 4LJZC 1YJ9A 1WTHA 4K14A 1R9TB 2C35B 2M9VA 3QOLA 1TS4A 1HFNA 1I5FA 2R92G 3TMEA 1WFQA 1SE2A 1WTOA 4A93G 2BA0A 5I9OA 1SYDA 1YNJC 5DLQE 4TSSA 5EPLA 1AW7A 4U673 3S1MH 5GROA 3PO3B 5M5YB 4HAEA 2VUMG 4ODGA 2O5IC 3TZDA 1XPUA 2PNHA 3A8JE 5KNCA 3S1NH 4GZYC 4JVZA 1OXSC 2TSSA 1AFPA 3CRLC 2A68C 3OIPA 1I4RA 2F0MA 3BJUA 4GS3A 1Y14B 1SYCA 5C44B 2L15A 2L9HA 1OTCA 5IYBG 1PRTB 2VZAA 3PUXA 4P73A 1W6KA 1TVXA 2N8NA 3H0GH 1DD2A 3A55A 1PZJD 1S5ED 3K7AH 3KBGA 3TP7A 5M3FH 5JJKA 4CBVA 2PZTA 4LF6Q 4AIMA 1A63A 3FEWX 4DV7L 4JI7Q 4K8JA 1BO0A 4RGMA 5C4XG 1JQYD 1PZKD 3CRKC 4BBRG 1A2UA 4ZLTF 2F0IA 4A93H 2EJMA 1EZ8A 1FNWA 2B2UA 5FK9C 4JI4L 3VYTA 2JSOA 3RZDH 1A3VA 5TSSA 1GUTA 2MGSA 4CKEA 1Q1BA 1O7LA 4KD3A 1XTDA 2F0LA 4RGTA 2K33A 2K28A 1HQMC 2D0PA 4PQXA 1Q81C 4HIKA 1PH2A 1I4GA 1BCPD 3R3OA 1EIGA 4H44C 5C0XH 3HS0C 1H9MA 3A5ZB 2UUAQ 3QR8A 1EY6A 1EY8A 3OW7A 3QJYA 3PUZA 3ERQA 4PNYA 2AUJD 2Q8IB 1K83B 2B2WA 2M00A 1STEA 2R7FA 2WAQE 2L55A 2M2LA 3TSSA 3PIPA 2OT2A 2L12A 2F0QA 3W3AA 2EPBA 1BDOA 3PO2G 4KHZA 4O2DA 2N3SA 4WRDA 5M5WH 3H94A 4TQUS 2TMPA 4KKTA 2GA4B 3SK4A 3A8KE 2ES2A 1RHPA 1V1PB 4QF4A 1SDFA 3S24A 4IFDJ 1TXYA 3J80i 3VR4A 4CKBA 3HOVB 2RDFA 4JI0Q 1PMRA 2H5XA 5C5LA 1Y69U 1STNA 3L9AX 2R7ZB 1ET6A 2MUYA 3C1FA 1JE5A 3OYYA 1YIJA 4DV5Q 4OL7A 4LMQD 1ZXTA 3UE1A 3AYHB 1HR0W 1R4PB 1VQPA 4G7OC 3WWVA 3ZYYX 3NK9A 3SK8A 4GLAC 3CC2A 2VW9A 1KABA 2O2LD 3HOUB 5E7NA 2JA5G 4YWLA 1MHWC 4QQBX 2F0GA 1V1PA 5EAYA 1TWHB 4B9WA 5JVG3 4R4QA 5FLXE 2A8VA 2ZXRA 4IPDA 1ZEQX 1H9SA 3SDZA 1HTLD 4XQJA 3R2IA 2R92H 1RF2D 2PO4A 1BCPB 5FO7B 4IURA 4JBWA 2KHIA 4LUVA 3GTKH 3D4WA 4X62Q 4DUYQ 2NVQH 3OWEB 1FNVA 3G6JB 1WI5A 3BVGA 3GDEA 3MXPA 5A35A 4IQZA 4JBMA 1GHKA 1YNND 1HUMA 1UAPA 3CW2C 1LV9A 2ZJRA 5CV7A 2F4VQ 2EY1A 5EKLA 1C0AA 1TU2B 1BBWA 5CMDA 1ESRA 2QDBA 1A3UA 3CKIB 3AFPA 1QILA 1QVFA 3EA6A 3I4MB 3V2TA 3CF5A 4A76A 4K5WA 2QILA 2CW0C 4KLKA 3V05A 2R7ZG 1LT3D 4DF7A 4ZYSA 4KK7A 1EY7A 2R6GA 4OELB 1Q1EA 1G2SA 1JT8A 2LXJA 1GUGA 2AWOA 3KF6B 3AMUA 4IFDH 2VB3X 2IY5B 3FKIH 1N36L 4OWTB 3HOWB 1AZQA 2PCFB 4JOIC 1W6JA 1IBLL 4Y7NB 2HDMA 1GUOA 4OO1G 2OTJA 4C3HB 5C0XI 4K0KQ 1EY9A 1IBKQ 1WTPA 2HDLA 3RZOH 4R4CA 1MSGA 3K80C 5C3EB 3U4ZA 4KN4C 1NCVA 3G6EA 1JJCB 1VQBA 3OTOL 4JV5L 2DJGC 3BG3A 4L63B 5CV8A 1CK1A 1ENCA 3TP8A 4DV5L 2Q2HA 1I6VC 5KYLA 3HP3A 1IYVA 1JCKB 3I73A 2JA7G 4DGZA 1H9KA 1TWHH 1V8QA 1NBWA 1SNDA 1PRTF 2K5QA 1W3SA 3G71A 2UUAL 3I4NB 3OMGA 4JOIA 4NXMQ 3NELA 3UI2A 2NTTA 2JEAI 5I9PA 1NSNS 1PRTD 1U4LA 1C8CA 1DOMA 1PH3A 1TS3A 3MTSA 3U9OA 2ZJQA 4IUNA 1S4ZA 2N78A 1CQVA 4POFA 3RLOA 5G3LF 1RCVD 1WTQA 1E2WA 4RCNA 1JE4A 3J81c 2PQAA 3J81L 1STBA 4JCVE 4JBJA 5ELCA 1HZCA 1KAWA 2K5DA 1RODA 4HJ9A 2XTIA 2LKVA 3MXUA 5M5XB 1ZYRD 4LF6L 1JB7A 4EQPA 2EZVA 1B1ZA 2K52A 1I94Q 3J7A5 3A8IE 2E5LL 5D14A 4LF8L 1EWHA 4MNOA 3OSOA 5KYIA 3IKJA 3CP0A 2DUDA 4DV1Q 2LS01 2K4KA 3SXHA 1FD7D 3WOFA 1AH9A 5IP7H 4UDUC 4GOPA 4FP5D 4DFAA 3J7YW 3OW2A 4LFBL 4V0BA 2Y0SB 5E4XA 3BZDB 1X55A 1STGA 2R93B 4AH6A 3A5UA 2XN9C 4EQ5A 2R93G 3HOZH 1F2ZA 1N33L 2HHHQ 2EYPA 4A3EG 4GNXA 3CD6A 1QJOA 3NENA 2B2UC 4PV1C 1SXTA 1WTVA 2OQ0A 2B8GA 1KTKA 5I6WA 2NVTH 4A3MH 2VUMH 3AB9A 2RSNA 1FGBD 1GUNA 4IUPA 1FNUA 5IOCA 1HNZL 4WJ3M 2AKWB 3NEMA 1QOHA 1X3GA 2MJ8A 3I7FA 3HG9A 1PYSB 1XMQL 4LFCQ 2OCEA 3H0GG 1AE2A 1MD2D 4DR6Q 1ML0D 1CHQD 1HNZQ 4IPHA 3OTOQ 1PVOA 4RGOS 2HT1A 4MTKA 2ATWA 2F0JA 5C3EH 1Z6HA 2IW3A 2UXDL 1C7YA 4A3EH 4TKOB 3TEHB 2VNUD 1A15A 1KD1C 1IZ6A 1UWVA 2YTVA 1KNEA 1K0SA 2B2WC 5KGUA 2CH4A 3KK7A 4B9XA 1IHZA 4HCSA 3HOXH 4H0LC 4K2LA 2Z9HA 3H09A 4A3DH 1BQQT 1JR0D 1GO3E 4G57A 1XMOL 2R7ZH 1Y8OB 1NY4A 1O7YA 4DR5Q 2FHTA 4GN4B 4Y52H 1SMXA 3PV0A 3AU7A 4CJ2C 4C2MB 4C3JH 3CQZB 4FO2A 4FDBA 1LTLA 3NBHB 3PO2H 3HOYB 2JA7B 1Q12A 1O7ZA 5LHY1 2KUMA 4IJLA 1VQIA 4DNRB 1EFID 3NTHA 5AJ3L 1J5EL 5IT9E 2UU9L 3M4OB 5HY6A 3H0GB 4C1NK 2BDNA 1HNWQ 1TWFH 3OPOA 3MEFA 4ABNA 5E3FA 3ND8A 1ILQA 5FLXL 1SSOA 2B2VC 3A0JA 1H9JA 3S1RB 4X3TA 3NQTA 3CCLA 4O1NA 1VS0A 4A3EB 2JA9A 2QEXA 1UE1A 4JK1C 1DZ1A 2OWOA 3JAME 3ITPA 1QVGA 2UUBQ 3HOZB 4EGVA 2VQEQ 2GVBA 1RDPD 4N8X1 1SRUA 1DOLA 2GN5A 2ZTDA 1PYWD 1BR9A 3GTMB 4A3DB 1EUJA 1IBMQ 3GV6A 2NVYB 3RLNA 3HKZE 1FYCA 4B3SL 1VQOA 2EXDA 5BR8L 1VQNA 1Q46A 1XNRQ 2DJFC 2F0SA 5H1SE 3GTGB 3Q8DA 3OHXC 3FHWA 1KRSA 3CCRA 2WB1E 1IBML 1GUSA 5LMUL 5I2YA 1TWCH 1L1OC 4GKKL 2JA7H 1XNQL 1FJGQ 1TY2A 1BBUA 3M4PA 2AQ1B 2K03A 4LF9L 1TWAH 4A3MB 1J6QA 4XYQA 5NUCA 2QW7A 3K59A 1LTBD 2ZM6Q 2B29A 2J7ZA 4XT3B 3ND9A 4GOPB 1IBKL 4IFDG 4Y7NH 2L5TA 4BBSH 4KHVA 2CW0D 5T1IA 2RDGA 1LTAD 1P8LA 2K75A 4GLVB 2K5HA 5FJ8G 4DXGA 5IT9c 4BA1I 1SFOB 5C4ZA 1D5ZC 3QWNA 4CDDC 3S17B 4FYDA 3I4NG 3NP8A 5M5YH 3PUYA 3KFUA 5M3FG 1GVPA 2HHHL 3UDIA 4K5XA 4HMJA 2JA5B 2NVYH 2OTLA 1KLGD 2XIWA 2F1MA 2PI2A 1O7IA 5ELDA 4DUZQ 4O42A 1SYFA 3X3NA 4MHEA 2B2YC 3DLLA 1VQ8A 4POGA 3HGBA 2JXMB 3GV3A 2KCMA 3AFQA 1JMCA 1NR2A 3NPPA 4H02A 5C3EG 4JI5Q 1GM5A 4X64Q 2EYLA 3WDNA 5KNBA 3PUVA 4DK0A 4A3IG 3O13A 4C3HG 4A3JH 2F4IA 3HRZC 4QUFA 1LUZA 1EYAA 4X64L 1B9MA 3F8TA 3HOWG 4XIGS 2YU9B 3KF6A 4UPAA 1SR3A 5F2DA 1L2FA 3GTLH 1SNQA 2LY7A 4A3IH 1STHA 4KMUC 3K5LA 3S1RH 1K3BC 1FVIA 3T1HL 3I4MG 1PH4A 3VA7A 1R4QB 2ID0A 5EKIA 1BVSA 2A74C 3CCEA 2A69D 3JAML 1SE3A 3JAMc 1A8VA 1V1OA 3BZKA 4OWXB 1YHQA 3K7AB 4IPGA 5M3FB 4FF1A 4F7XA 3CMAA 5LMUQ 4AQYQ 1NMGA 5CBEE 5IGBA 1PH5A 3NE5B 3I4NH 3L7ZC 1VQ6A 4DR4L 3HFZB 1KNAA 3CHBD 4WJ4A 3RZDB 1JB3A 5EJWA 2RKSA 1LTRD 3U50C 5ELFA 2FFKB 2RBMA 4RKLA 2ZXPA 4CDEC 4P75A 2QEJC 4I7AA 3QO2A 1OXUA 1E22A 2DY7A 4F88A 1B2TA 4NKLA 2NYZD 3DEPA 4RH6A 2YTXA 1BCPC 1U5KA 3D8GA 3QIAA 4FXKC 3I55A 3HOUG 2KHSA 3K81C 3G7LA 5M5XH 1N34L 5CYUA 1K83H 3ULLA 4FXDA 4NDXA 3ICEA 3A74A 4QJFA 2EIFA 1RJTA 3Q23A 4OWWB 1TKWB 4JI8L 1FL0A 2PI2E 2CCZA 2UUBL 1H95A 4KY6A 1J9OA 5C0XG 3H3VI
chains in the Genus database with same CATH topology
4A3FG 2R6GA 3I56A 3HOVG 4A3DG 1Q1EA 3KJOA 1JT8A 2LXJA 2AWOA 3KF6B 3CCJA 4A3BG 3K8AA 4BBSG 3M7NA 4DV6L 1UEBA 3LGJA 1QVCA 3FKIH 4OWTB 1N36L 3PO3G 4A3GH 2IY5B 1PH6A 5IY0A 2UUCQ 4JOIC 4A3JG 1ASYA 1IBLL 1MJEA 2CQOA 2QA4A 1S40A 4L5TA 4JI7L 4OO1G 4X66L 2OTJA 2AHOB 5C0XI 4K0KQ 1IBKQ 1PH8A 1E7ZA 3HOYH 3RZOH 1VCIA 4R4CA 2LXKA 3K80C 5IE8A 1UE7A 3U4ZA 1Y1WG 3JAMi 1FGUA 1I3QH 4R4IA 3STBC 4MZ9A 3M85A 1VQCA 2I0QA 1VQAA 4GNXB 1EYGA 1U0LA 4GKKQ 3ERSX 2NVXH 3D0FA 3G6EA 4KHPQ 2UXCQ 2ASBA 1JJCB 1VQBA 1YHAA 1XNQQ 3OTOL 1CSPA 1WYDA 1FJGL 4HIMA 4JV5L 3CCQA 4JYAQ 1YHBA 4LWCA 1HZ9A 3GTQH 3PF4A 1P16A 2WFWA 4JI5L 2YU9H 2UXDQ 3VDYA 3ULJA 3S2DH 3GTJH 1YBYA 3KDFA 2VS1A 1CUKA 2IX1A 3PSIA 1RL2A 4DV5L 2I5LX 2Q2HA 4DAMA 1R9TH 4LFBQ 3E9HA 1UE5A 1X56A 1QZHA 2JA7G 4OX9Q 1N36Q 2F4VL 3TQYA 1Z47A 1X54A 1TWHH 4DR4Q 4JBKA 1XMQQ 3CMEA 3TS0A 1NBWA 3G71A 1W3SA 2UUAL 2Z6KA 5JJLA 1WJJA 4JOIA 4NXMQ 3NELA 3I4MH 2E5LQ 3PO3H 1EQRA 1QUQB 4YY3L 2JEAI 1Y1WH 2K14A 1X6OA 4A3KG 4DV7Q 1Q7YC 3HOVH 4GLXA 2OQKA 1PH3A 4JI2L 2YYZA 1ASZA 3HOUH 2LSSA 2ZJQA 4R4OA 2VQFL 2N78A 4YY3Q 4B3ML 4JC0A 4BA2I 1XPOA 4YCWA 1OXVA 4POFA 2JA8H 3RLOA 3GTGH 1NMFA 3M4QA 1MJCA 4LUOA 4C2MH 5GAGC 4DR6L 3J81c 3AQQA 3CCSA 1N34Q 1VQKA 2PQAA 4A3MG 3CAMA 5K36G 3H3VH 4C3HH 4DK3C 4DR5L 4JCVE 4JBJA 5FLMH 1VQDA 1HZCA 4A3FH 1IBLQ 1KAWA 4DV0L 4HJ9A 4OX9L 3BZCA 4UY8C 2XTIA 4YHHQ 1YZ6A 3STBD 4DV3L 1AE3A 1G291 4LF4Q 4AQYL 1PV4A 4LF7Q 4LF6L 1PH9A 1JB7A 2MO0A 4GKJQ 4DK6C 3CCMA 3T1YL 1IXRA 2K52A 1K9MC 1GKHA 1G51A 2ZM6L 3IRBA 1B8AA 1I94Q 4X65L 1WCMG 4NXML 4NXNQ 3J7A5 2E5LL 4O0AA 4AYBG 2VL6A 4LF4L 1VQ7A 1C9OA 2K5VA 1DGSA 3E0EA 4RG1A 1OXXK 4LF8L 4DR1L 1V9PA 5C0XJ 4MNOA 4B3RQ 5IYCH 3CP0A 3TREA 2DUDA 5IP7G 4DV1Q 1UE6A 1VQFA 4X65Q 2VY3A 3PIOA 2K4KA 1JJ2A 3TS2A 1AH9A 1MIUA 4P74A 5IP7H 1XPRA 1L1OA 4GOPA 4A3KH 3OW2A 1EFWA 4LFBL 2PQAB 1S72A 3UDXA 2B63H 4QL5A 1SE8A 1X55A 3M9BA 5M3MG 4LF5Q 3ZJYC 2AMCB 4AH6A 3A5UA 3HOZG 4EQ5A 4B3SQ 2R93G 3HOZH 4ME3A 5BR8Q 4YCUA 4C3IH 2HHHQ 1N33L 2Y0SG 1XNRL 4A3CH 4A3EG 4GNXA 1KC8C 3F2BA 1PHJA 3CD6A 5JJIA 3NENA 3CPWA 5AJ3Q 2JA6H 4IJHA 1HR0Q 3M3YH 4A3LG 4GKJL 2JQOA 1G6PA 1Q82C 2IHFA 2CWAA 1HZAA 1YNXA 2E8GA 2OQ0A 1I94L 1PH7A 3MXNB 4A3MH 1HJPA 1K8AC 2NVTH 3W1GA 2RHSB 4DPGA 2VUMH 4X66Q 1B70B 1YVCA 1HNXL 1IL2A 1CKNB 4ALPA 3HOWH 4WJ3M 1HNZL 2AKWB 3NEMA 1X3GA 2JJQA 3TRZA 4P71A 3I7FA 3U4VA 1D8LA 1WCMH 1PYSB 3EIVA 4DV2L 2B3GA 1XMQL 3H0GG 1CKMA 1AE2A 1VQHA 2OCEA 3G48A 5C44H 3CCUA 4LFCQ 3AEVA 4PZ7A 3S1QH 4DR6Q 4PZ8A 1HNZQ 4IPHA 3OTOQ 1PVOA 2MFIA 4PG3A 2IT1A 4DKAC 2HT1A 4DV6Q 2ALYB 2ATWA 5C3EH 3HOYG 2ZTEA 4QGUA 2UXDL 2E2IH 1PYBA 1C7YA 4A3EH 3CC4A 1QUQA 4JI6L 4JI3L 1J5EQ 1EWIA 3TEHB 2UU9Q 2VNUD 1KD1C 1IZ6A 3GO5A 1N9WA 1UWVA 2YTVA 3S2HH 1HNWL 1VQJA 4J15A 1NE3A 3HOXH 3F2CA 4NXNL 1EQQA 2B63G 4A3BH 2YTYA 1CKNA 4KI0A 2JA5H 3KJPA 1Q86C 3CXCA 4A3DH 3JC66 2NZHA 1GO3E 1XMOL 2IX0A 2R7ZH 2EQSA 1NY4A 4DR5Q 4GN4B 2Z0SA 2RCNA 4Y52H 1VQ5A 1SMXA 3BU2A 3PV0A 4UP7A 2CFMA 1KL9A 4C3JH 1N8RC 3HKZG 1T9HA 1EIFA 4JI2Q 4DNIA 1KHIA 3HKSA 4FDBA 2VQFQ 1LTLA 5IP9G 1VQ4A 3NBHB 5LMNL 4B3MQ 2HIXA 4MTNA 3PO2H 4LF9Q 1I6HH 3H15A 1K0RA 1Q12A 1EOVA 3E9IA 3PCOB 4IPCA 2JEBI 5IWAQ 1K3RA 4IJLA 2F52A 3KLWA 1BKBA 1VQIA 3K0XA 1J5EL 5AJ3L 1S3OA 2UU9L 2Q2UA 4BY7G 3J80c 3PUWA 5HY6A 2BH8A 4OO1I 1YEZA 1HNWQ 4LW1A 4OXPA 1D7QA 3KDFB 3B6YA 5GADC 1TWFH 5IYDH 1EIYB 3J81i 3MEFA 4YCVA 4YHHL 1W2BA 2Z6KC 4DV3Q 4A3GG 4UP8A 2AWNA 5FLXc 1E1OA 1YJ9A 3A0JA 2C35B 2CKZB 4LFAQ 4PMWA 2UUCL 1CKOA 5C4JH 1I5FA 4BXXH 3DM3A 4JYAL 2R92G 2Y0SE 5FLMG 4A4IA 3S14H 2JE6I 3CCLA 1WFQA 1VS0A 2JA9A 3KYHC 1UE1A 2QEXA 4A93G 4HJ8A 2BA0A 2OWOA 2UXBL 5DLQE 2MNAA 1QVGA 1LM0A 2UUBQ 4AYBE 3RN2A 2VQEQ 3UDGA 3S1MH 2GVBA 5GROA 1VQMA 3F1ZA 1SRUA 4PZ6A 2GN5A 3I2ZA 3RLFA 3EN2A 2ZTDA 3UE0A 2I5MX 3T1HQ 3CCVA 1PH1A 4LF7L 2VUMG 3S15H 1HH2P 1EUJA 4DR3Q 2NN6G 1IBMQ 3RLNA 3KOJA 3HKZE 4B3SL 1VQOA 2EXDA 5BR8L 1VQNA 1Q46A 1XNRQ 1XPUA 1X9NA 2PNHA 4GN5A 3GTPH 5H1SE 2MO1A 3L0OA 3S1NH 3GD7A 1XMOQ 1OXSC 3Q8DA 1SLJA 3FHWA 1KRSA 3CCRA 2WB1E 1IBML 1XJVA 4A75A 3BJUA 4GS3A 1Y14B 5GAHC 4DV1L 1V1QA 1VQGA 4DR2L 3ULPA 4DV4L 5LMUL 1KQSA 1YI2A 1TWCH 2L15A 1L1OC 5J3BA 4GOPC 3SGIA 5IYBG 3G4SA 1OTCA 2JA7H 4GKKL 4QY7A 4DR7Q 1XNQL 2VZAA 1FJGQ 3S16H 3PUXA 4P73A 4R1JA 1BBUA 3M4PA 5IYBH 4LF9L 3M4OH 2N8NA 3H0GH 1TWAH 1J6QA 3K7AH 5M3FH 5IYCG 5JJKA 4LF6Q 4AIMA 3RNUA 1N33Q 4RMFA 5C4XH 1A63A 4DV7L 4JI7Q 2BH2A 5C4XG 4NB3A 2ZM6Q 2B29A 1L1OB 4BBRG 4GOPB 1IBKL 4IFDG 4Y7NH 4JI0L 3GTOH 4BBSH 1PA6A 4A93H 2A19A 4YWKA 4JI4L 2V1CC 2E2JH 2ZTCA 4HIOA 3ER0A 3RZDH 4QIWE 1SROA 1YJWA 1V43A 1P8LA 1HZBA 2K75A 2K5HA 4GLVB 1A62A 5FJ8G 2UXCL 1Q1BA 1CSQA 1XTDA 4A3CG 4JG2A 5IT9c 4BA1I 3CQZH 4BBRH 4IFDI 1VQ9A 2F3IA 3I4NG 2D0PA 3UDFA 5M5YH 3PUYA 1Q81C 4X62L 4DUYL 4TVAB 4HIKA 1PH2A 3KFUA 5M3FG 1GVPA 4BXXG 3D31A 2HHHL 3UDIA 1B7YB 1Y1VH 2NVYH 3RN5A 2OTLA 4JI6Q 2R7DA 3A5ZB 3L2PA 4JI3Q 1I50H 2UUAQ 1RIPA 4JI1Q 2PI2A 3PUZA 1O7IA 1Q8KA 1VQLA 1X3FA 1X3EA 4DUZQ 4GNXC 1GD7A 1NJIC 1X65A 2Q2TA 4LFAL 2R7FA 5ELNA 2WAQE 3DLLA 2K5NA 1NTGA 1VQ8A 4JI4Q 4IOAA 4R4TA 4POGA 4JI1L 1KXLA 3I4OA 2KCMA 3AFQA 2D62A 3PIPA 5FJ8H 1JMCA 4LUZA 4H02A 5C3EG 4JI5Q 1GM5A 2HQLA 4X64Q 2VQEL 3PUVA 3PO2G 4KHZA 4O2DA 1L0WA 2N3SA 4A3IG 2NN6I 4DR1Q 4DR7L 5M5WH 4TQUS 4A3JH 2KCTA 5JEAJ 2DGYA 1LUZA 4YWMA 1HR0L 1YITA 4X64L 5LMNW 2JK8A 2ES2A 4NPSA 3F8TA 5IYDG 3HOWG 4XIGS 1VQEA 3KF6A 4UPAA 4BY1H 1SR3A 4IFDJ 1L2FA 3S24A 1YJNA 3W1BA 3GTLH 2WP8J 1TXYA 3J80i 2WB1G 4JI0Q 2H5XA 4A3IH 1IYJB 4DUZL 2PMZE 1E3PA 4A3LH 3K7UC 3S1RH 2E2HH 2I5HA 1JE5A 3OYYA 1FVIA 3T1HL 3I4MG 1PH4A 4B3RL 4IO9A 4HJ5A 1YIJA 4DV5Q 1PFSA 1SFOH 3UE1A 2CWPA 3AYHB 3J81j 2KHJA 1HR0W 2ID0A 2FXQA 1BVSA 2N49A 3FKIG 4DAYB 2QGQA 2ZJPA 3CC7A 1VQPA 3WWVA 1SN8A 3CCEA 4GLAC 4P72A 3CC2A 1Z9FA 3JAMc 2VW9A 4IOCA 4BY7H 1A8VA 5E7NA 1E1TA 4X6AH 5LMNQ 3BZKA 4OWXB 2JA5G 4B3TQ 1YHQA 4YWLA 4EX5A 4DV0Q 4IPGA 4L5QA 4QQBX 4UP9A 3CMAA 4DV2Q 5LMUQ 4BY1G 1KIXA 5EAYA 4LFCL 3U58A 4AQYQ 5IP9H 1NMGA 1K8GA 2WAQG 4APVA 1PH5A 4R4QA 3I4NH 4B3TL 2A8VA 3L7ZC 5M3MH 4IPDA 3KF8B 1VQ6A 2KBNA 2YV5A 3RR5A 4DR4L 1MKHA 3HFZB 4WJ4A 3W5OA 4LF8Q 2R92H 2MQHA 2NZOA 3U50C 4HIDA 3CPFA 3EBEA 4JBWA 1M1KC 2JA6G 4JI8Q 2KHIA 4HJAA 2IHEA 4LUVA 4KHPL 3GTKH 1N32Q 2NVQH 4X62Q 4DUYQ 4JV5Q 1A0IA 1TWGH 1WI5A 1LYLA 4P75A 2A1AA 3S17H 5ELOA 1WOCA 2HIVA 3HOXG 5HGQA 4DV4Q 3GDEA 5IWAL 4GN3B 1OXUA 1E22A 4JBMA 3J7ZC 1KRTA 4LF5L 2JA8G 1N32L 1OXTA 2D0OA 3CW2C 2ZJRA 3GTMH 2YTXA 1U5KA 3F2DA 1JJGA 2Q2IA 4OONA 2F4VQ 3I55A 2KENA 3FP9A 3HOUG 3K81C 1C0AA 2RHQB 4K0KL 5M5XH 2XGTA 1N34L 4DR3L 4L5SA 1BBWA 1K83H 2BA1A 3ULLA 5C44G 4HJ7A 1E24A 2R93H 3ICEA 4XTCS 3AFPA 5GQOA 3A74A 2K50A 3PF5A 4QJFA 1K73C 2EIFA 1HNXQ 1QVFA 4L5RC 2RF4A 5GAEC 3CF5A 3T1YQ 4A76A 1M90C 4OWWB 4KLKA 1QZGA 2R7ZG 4JI8L 2UXBQ 2GVAA 4DR2Q 1FL0A 2PI2E 3PGZA 2CCZA 2UUBL 1Y1VG 4LNQA 1H95A 5JEAG 5C0XG 3H3VI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F G;  2R6G A;  3I56 A;  3HOV G;  4A3D G;  1Q1E A;  3KJO A;  1JT8 A;  2LXJ A;  2AWO A;  3KF6 B;  3CCJ A;  4A3B G;  3K8A A;  4BBS G;  3M7N A;  4DV6 L;  1UEB A;  3LGJ A;  1QVC A;  3FKI H;  4OWT B;  1N36 L;  3PO3 G;  4A3G H;  2IY5 B;  1PH6 A;  5IY0 A;  2UUC Q;  4JOI C;  4A3J G;  1ASY A;  1IBL L;  1MJE A;  2CQO A;  2QA4 A;  1S40 A;  4L5T A;  4JI7 L;  4OO1 G;  4X66 L;  2OTJ A;  2AHO B;  5C0X I;  4K0K Q;  1IBK Q;  1PH8 A;  1E7Z A;  3HOY H;  3RZO H;  1VCI A;  4R4C A;  2LXK A;  3K80 C;  5IE8 A;  1UE7 A;  3U4Z A;  1Y1W G;  3JAM i;  1FGU A;  1I3Q H;  4R4I A;  3STB C;  4MZ9 A;  3M85 A;  1VQC A;  2I0Q A;  1VQA A;  4GNX B;  1EYG A;  1U0L A;  4GKK Q;  3ERS X;  2NVX H;  3D0F A;  3G6E A;  4KHP Q;  2UXC Q;  2ASB A;  1JJC B;  1VQB A;  1YHA A;  1XNQ Q;  3OTO L;  1CSP A;  1WYD A;  1FJG L;  4HIM A;  4JV5 L;  3CCQ A;  4JYA Q;  1YHB A;  4LWC A;  1HZ9 A;  3GTQ H;  3PF4 A;  1P16 A;  2WFW A;  4JI5 L;  2YU9 H;  2UXD Q;  3VDY A;  3ULJ A;  3S2D H;  3GTJ H;  1YBY A;  3KDF A;  2VS1 A;  1CUK A;  2IX1 A;  3PSI A;  1RL2 A;  4DV5 L;  2I5L X;  2Q2H A;  4DAM A;  1R9T H;  4LFB Q;  3E9H A;  1UE5 A;  1X56 A;  1QZH A;  2JA7 G;  4OX9 Q;  1N36 Q;  2F4V L;  3TQY A;  1Z47 A;  1X54 A;  1TWH H;  4DR4 Q;  4JBK A;  1XMQ Q;  3CME A;  3TS0 A;  1NBW A;  3G71 A;  1W3S A;  2UUA L;  2Z6K A;  5JJL A;  1WJJ A;  4JOI A;  4NXM Q;  3NEL A;  3I4M H;  2E5L Q;  3PO3 H;  1EQR A;  1QUQ B;  4YY3 L;  2JEA I;  1Y1W H;  2K14 A;  1X6O A;  4A3K G;  4DV7 Q;  1Q7Y C;  3HOV H;  4GLX A;  2OQK A;  1PH3 A;  4JI2 L;  2YYZ A;  1ASZ A;  3HOU H;  2LSS A;  2ZJQ A;  4R4O A;  2VQF L;  2N78 A;  4YY3 Q;  4B3M L;  4JC0 A;  4BA2 I;  1XPO A;  4YCW A;  1OXV A;  4POF A;  2JA8 H;  3RLO A;  3GTG H;  1NMF A;  3M4Q A;  1MJC A;  4LUO A;  4C2M H;  5GAG C;  4DR6 L;  3J81 c;  3AQQ A;  3CCS A;  1N34 Q;  1VQK A;  2PQA A;  4A3M G;  3CAM A;  5K36 G;  3H3V H;  4C3H H;  4DK3 C;  4DR5 L;  4JCV E;  4JBJ A;  5FLM H;  1VQD A;  1HZC A;  4A3F H;  1IBL Q;  1KAW A;  4DV0 L;  4HJ9 A;  4OX9 L;  3BZC A;  4UY8 C;  2XTI A;  4YHH Q;  1YZ6 A;  3STB D;  4DV3 L;  1AE3 A;  1G29 1;  4LF4 Q;  4AQY L;  1PV4 A;  4LF7 Q;  4LF6 L;  1PH9 A;  1JB7 A;  2MO0 A;  4GKJ Q;  4DK6 C;  3CCM A;  3T1Y L;  1IXR A;  2K52 A;  1K9M C;  1GKH A;  1G51 A;  2ZM6 L;  3IRB A;  1B8A A;  1I94 Q;  4X65 L;  1WCM G;  4NXM L;  4NXN Q;  3J7A 5;  2E5L L;  4O0A A;  4AYB G;  2VL6 A;  4LF4 L;  1VQ7 A;  1C9O A;  2K5V A;  1DGS A;  3E0E A;  4RG1 A;  1OXX K;  4LF8 L;  4DR1 L;  1V9P A;  5C0X J;  4MNO A;  4B3R Q;  5IYC H;  3CP0 A;  3TRE A;  2DUD A;  5IP7 G;  4DV1 Q;  1UE6 A;  1VQF A;  4X65 Q;  2VY3 A;  3PIO A;  2K4K A;  1JJ2 A;  3TS2 A;  1AH9 A;  1MIU A;  4P74 A;  5IP7 H;  1XPR A;  1L1O A;  4GOP A;  4A3K H;  3OW2 A;  1EFW A;  4LFB L;  2PQA B;  1S72 A;  3UDX A;  2B63 H;  4QL5 A;  1SE8 A;  1X55 A;  3M9B A;  5M3M G;  4LF5 Q;  3ZJY C;  2AMC B;  4AH6 A;  3A5U A;  3HOZ G;  4EQ5 A;  4B3S Q;  2R93 G;  3HOZ H;  4ME3 A;  5BR8 Q;  4YCU A;  4C3I H;  2HHH Q;  1N33 L;  2Y0S G;  1XNR L;  4A3C H;  4A3E G;  4GNX A;  1KC8 C;  3F2B A;  1PHJ A;  3CD6 A;  5JJI A;  3NEN A;  3CPW A;  5AJ3 Q;  2JA6 H;  4IJH A;  1HR0 Q;  3M3Y H;  4A3L G;  4GKJ L;  2JQO A;  1G6P A;  1Q82 C;  2IHF A;  2CWA A;  1HZA A;  1YNX A;  2E8G A;  2OQ0 A;  1I94 L;  1PH7 A;  3MXN B;  4A3M H;  1HJP A;  1K8A C;  2NVT H;  3W1G A;  2RHS B;  4DPG A;  2VUM H;  4X66 Q;  1B70 B;  1YVC A;  1HNX L;  1IL2 A;  1CKN B;  4ALP A;  3HOW H;  4WJ3 M;  1HNZ L;  2AKW B;  3NEM A;  1X3G A;  2JJQ A;  3TRZ A;  4P71 A;  3I7F A;  3U4V A;  1D8L A;  1WCM H;  1PYS B;  3EIV A;  4DV2 L;  2B3G A;  1XMQ L;  3H0G G;  1CKM A;  1AE2 A;  1VQH A;  2OCE A;  3G48 A;  5C44 H;  3CCU A;  4LFC Q;  3AEV A;  4PZ7 A;  3S1Q H;  4DR6 Q;  4PZ8 A;  1HNZ Q;  4IPH A;  3OTO Q;  1PVO A;  2MFI A;  4PG3 A;  2IT1 A;  4DKA C;  2HT1 A;  4DV6 Q;  2ALY B;  2ATW A;  5C3E H;  3HOY G;  2ZTE A;  4QGU A;  2UXD L;  2E2I H;  1PYB A;  1C7Y A;  4A3E H;  3CC4 A;  1QUQ A;  4JI6 L;  4JI3 L;  1J5E Q;  1EWI A;  3TEH B;  2UU9 Q;  2VNU D;  1KD1 C;  1IZ6 A;  3GO5 A;  1N9W A;  1UWV A;  2YTV A;  3S2H H;  1HNW L;  1VQJ A;  4J15 A;  1NE3 A;  3HOX H;  3F2C A;  4NXN L;  1EQQ A;  2B63 G;  4A3B H;  2YTY A;  1CKN A;  4KI0 A;  2JA5 H;  3KJP A;  1Q86 C;  3CXC A;  4A3D H;  3JC6 6;  2NZH A;  1GO3 E;  1XMO L;  2IX0 A;  2R7Z H;  2EQS A;  1NY4 A;  4DR5 Q;  4GN4 B;  2Z0S A;  2RCN A;  4Y52 H;  1VQ5 A;  1SMX A;  3BU2 A;  3PV0 A;  4UP7 A;  2CFM A;  1KL9 A;  4C3J H;  1N8R C;  3HKZ G;  1T9H A;  1EIF A;  4JI2 Q;  4DNI A;  1KHI A;  3HKS A;  4FDB A;  2VQF Q;  1LTL A;  5IP9 G;  1VQ4 A;  3NBH B;  5LMN L;  4B3M Q;  2HIX A;  4MTN A;  3PO2 H;  4LF9 Q;  1I6H H;  3H15 A;  1K0R A;  1Q12 A;  1EOV A;  3E9I A;  3PCO B;  4IPC A;  2JEB I;  5IWA Q;  1K3R A;  4IJL A;  2F52 A;  3KLW A;  1BKB A;  1VQI A;  3K0X A;  1J5E L;  5AJ3 L;  1S3O A;  2UU9 L;  2Q2U A;  4BY7 G;  3J80 c;  3PUW A;  5HY6 A;  2BH8 A;  4OO1 I;  1YEZ A;  1HNW Q;  4LW1 A;  4OXP A;  1D7Q A;  3KDF B;  3B6Y A;  5GAD C;  1TWF H;  5IYD H;  1EIY B;  3J81 i;  3MEF A;  4YCV A;  4YHH L;  1W2B A;  2Z6K C;  4DV3 Q;  4A3G G;  4UP8 A;  2AWN A;  5FLX c;  1E1O A;  1YJ9 A;  3A0J A;  2C35 B;  2CKZ B;  4LFA Q;  4PMW A;  2UUC L;  1CKO A;  5C4J H;  1I5F A;  4BXX H;  3DM3 A;  4JYA L;  2R92 G;  2Y0S E;  5FLM G;  4A4I A;  3S14 H;  2JE6 I;  3CCL A;  1WFQ A;  1VS0 A;  2JA9 A;  3KYH C;  1UE1 A;  2QEX A;  4A93 G;  4HJ8 A;  2BA0 A;  2OWO A;  2UXB L;  5DLQ E;  2MNA A;  1QVG A;  1LM0 A;  2UUB Q;  4AYB E;  3RN2 A;  2VQE Q;  3UDG A;  3S1M H;  2GVB A;  5GRO A;  1VQM A;  3F1Z A;  1SRU A;  4PZ6 A;  2GN5 A;  3I2Z A;  3RLF A;  3EN2 A;  2ZTD A;  3UE0 A;  2I5M X;  3T1H Q;  3CCV A;  1PH1 A;  4LF7 L;  2VUM G;  3S15 H;  1HH2 P;  1EUJ A;  4DR3 Q;  2NN6 G;  1IBM Q;  3RLN A;  3KOJ A;  3HKZ E;  4B3S L;  1VQO A;  2EXD A;  5BR8 L;  1VQN A;  1Q46 A;  1XNR Q;  1XPU A;  1X9N A;  2PNH A;  4GN5 A;  3GTP H;  5H1S E;  2MO1 A;  3L0O A;  3S1N H;  3GD7 A;  1XMO Q;  1OXS C;  3Q8D A;  1SLJ A;  3FHW A;  1KRS A;  3CCR A;  2WB1 E;  1IBM L;  1XJV A;  4A75 A;  3BJU A;  4GS3 A;  1Y14 B;  5GAH C;  4DV1 L;  1V1Q A;  1VQG A;  4DR2 L;  3ULP A;  4DV4 L;  5LMU L;  1KQS A;  1YI2 A;  1TWC H;  2L15 A;  1L1O C;  5J3B A;  4GOP C;  3SGI A;  5IYB G;  3G4S A;  1OTC A;  2JA7 H;  4GKK L;  4QY7 A;  4DR7 Q;  1XNQ L;  2VZA A;  1FJG Q;  3S16 H;  3PUX A;  4P73 A;  4R1J A;  1BBU A;  3M4P A;  5IYB H;  4LF9 L;  3M4O H;  2N8N A;  3H0G H;  1TWA H;  1J6Q A;  3K7A H;  5M3F H;  5IYC G;  5JJK A;  4LF6 Q;  4AIM A;  3RNU A;  1N33 Q;  4RMF A;  5C4X H;  1A63 A;  4DV7 L;  4JI7 Q;  2BH2 A;  5C4X G;  4NB3 A;  2ZM6 Q;  2B29 A;  1L1O B;  4BBR G;  4GOP B;  1IBK L;  4IFD G;  4Y7N H;  4JI0 L;  3GTO H;  4BBS H;  1PA6 A;  4A93 H;  2A19 A;  4YWK A;  4JI4 L;  2V1C C;  2E2J H;  2ZTC A;  4HIO A;  3ER0 A;  3RZD H;  4QIW E;  1SRO A;  1YJW A;  1V43 A;  1P8L A;  1HZB A;  2K75 A;  2K5H A;  4GLV B;  1A62 A;  5FJ8 G;  2UXC L;  1Q1B A;  1CSQ A;  1XTD A;  4A3C G;  4JG2 A;  5IT9 c;  4BA1 I;  3CQZ H;  4BBR H;  4IFD I;  1VQ9 A;  2F3I A;  3I4N G;  2D0P A;  3UDF A;  5M5Y H;  3PUY A;  1Q81 C;  4X62 L;  4DUY L;  4TVA B;  4HIK A;  1PH2 A;  3KFU A;  5M3F G;  1GVP A;  4BXX G;  3D31 A;  2HHH L;  3UDI A;  1B7Y B;  1Y1V H;  2NVY H;  3RN5 A;  2OTL A;  4JI6 Q;  2R7D A;  3A5Z B;  3L2P A;  4JI3 Q;  1I50 H;  2UUA Q;  1RIP A;  4JI1 Q;  2PI2 A;  3PUZ A;  1O7I A;  1Q8K A;  1VQL A;  1X3F A;  1X3E A;  4DUZ Q;  4GNX C;  1GD7 A;  1NJI C;  1X65 A;  2Q2T A;  4LFA L;  2R7F A;  5ELN A;  2WAQ E;  3DLL A;  2K5N A;  1NTG A;  1VQ8 A;  4JI4 Q;  4IOA A;  4R4T A;  4POG A;  4JI1 L;  1KXL A;  3I4O A;  2KCM A;  3AFQ A;  2D62 A;  3PIP A;  5FJ8 H;  1JMC A;  4LUZ A;  4H02 A;  5C3E G;  4JI5 Q;  1GM5 A;  2HQL A;  4X64 Q;  2VQE L;  3PUV A;  3PO2 G;  4KHZ A;  4O2D A;  1L0W A;  2N3S A;  4A3I G;  2NN6 I;  4DR1 Q;  4DR7 L;  5M5W H;  4TQU S;  4A3J H;  2KCT A;  5JEA J;  2DGY A;  1LUZ A;  4YWM A;  1HR0 L;  1YIT A;  4X64 L;  5LMN W;  2JK8 A;  2ES2 A;  4NPS A;  3F8T A;  5IYD G;  3HOW G;  4XIG S;  1VQE A;  3KF6 A;  4UPA A;  4BY1 H;  1SR3 A;  4IFD J;  1L2F A;  3S24 A;  1YJN A;  3W1B A;  3GTL H;  2WP8 J;  1TXY A;  3J80 i;  2WB1 G;  4JI0 Q;  2H5X A;  4A3I H;  1IYJ B;  4DUZ L;  2PMZ E;  1E3P A;  4A3L H;  3K7U C;  3S1R H;  2E2H H;  2I5H A;  1JE5 A;  3OYY A;  1FVI A;  3T1H L;  3I4M G;  1PH4 A;  4B3R L;  4IO9 A;  4HJ5 A;  1YIJ A;  4DV5 Q;  1PFS A;  1SFO H;  3UE1 A;  2CWP A;  3AYH B;  3J81 j;  2KHJ A;  1HR0 W;  2ID0 A;  2FXQ A;  1BVS A;  2N49 A;  3FKI G;  4DAY B;  2QGQ A;  2ZJP A;  3CC7 A;  1VQP A;  3WWV A;  1SN8 A;  3CCE A;  4GLA C;  4P72 A;  3CC2 A;  1Z9F A;  3JAM c;  2VW9 A;  4IOC A;  4BY7 H;  1A8V A;  5E7N A;  1E1T A;  4X6A H;  5LMN Q;  3BZK A;  4OWX B;  2JA5 G;  4B3T Q;  1YHQ A;  4YWL A;  4EX5 A;  4DV0 Q;  4IPG A;  4L5Q A;  4QQB X;  4UP9 A;  3CMA A;  4DV2 Q;  5LMU Q;  4BY1 G;  1KIX A;  5EAY A;  4LFC L;  3U58 A;  4AQY Q;  5IP9 H;  1NMG A;  1K8G A;  2WAQ G;  4APV A;  1PH5 A;  4R4Q A;  3I4N H;  4B3T L;  2A8V A;  3L7Z C;  5M3M H;  4IPD A;  3KF8 B;  1VQ6 A;  2KBN A;  2YV5 A;  3RR5 A;  4DR4 L;  1MKH A;  3HFZ B;  4WJ4 A;  3W5O A;  4LF8 Q;  2R92 H;  2MQH A;  2NZO A;  3U50 C;  4HID A;  3CPF A;  3EBE A;  4JBW A;  1M1K C;  2JA6 G;  4JI8 Q;  2KHI A;  4HJA A;  2IHE A;  4LUV A;  4KHP L;  3GTK H;  1N32 Q;  2NVQ H;  4X62 Q;  4DUY Q;  4JV5 Q;  1A0I A;  1TWG H;  1WI5 A;  1LYL A;  4P75 A;  2A1A A;  3S17 H;  5ELO A;  1WOC A;  2HIV A;  3HOX G;  5HGQ A;  4DV4 Q;  3GDE A;  5IWA L;  4GN3 B;  1OXU A;  1E22 A;  4JBM A;  3J7Z C;  1KRT A;  4LF5 L;  2JA8 G;  1N32 L;  1OXT A;  2D0O A;  3CW2 C;  2ZJR A;  3GTM H;  2YTX A;  1U5K A;  3F2D A;  1JJG A;  2Q2I A;  4OON A;  2F4V Q;  3I55 A;  2KEN A;  3FP9 A;  3HOU G;  3K81 C;  1C0A A;  2RHQ B;  4K0K L;  5M5X H;  2XGT A;  1N34 L;  4DR3 L;  4L5S A;  1BBW A;  1K83 H;  2BA1 A;  3ULL A;  5C44 G;  4HJ7 A;  1E24 A;  2R93 H;  3ICE A;  4XTC S;  3AFP A;  5GQO A;  3A74 A;  2K50 A;  3PF5 A;  4QJF A;  1K73 C;  2EIF A;  1HNX Q;  1QVF A;  4L5R C;  2RF4 A;  5GAE C;  3CF5 A;  3T1Y Q;  4A76 A;  1M90 C;  4OWW B;  4KLK A;  1QZG A;  2R7Z G;  4JI8 L;  2UXB Q;  2GVA A;  4DR2 Q;  1FL0 A;  2PI2 E;  3PGZ A;  2CCZ A;  2UUB L;  1Y1V G;  4LNQ A;  1H95 A;  5JEA G;  5C0X G;  3H3V I; 
#chains in the Genus database with same CATH topology
 3HOV G;  3I56 A;  4A3D G;  2VUM B;  2NVT B;  3NBI A;  4RHS A;  3DEO A;  3K8A A;  1EU3 A;  3M7N A;  1UEB A;  3LGJ A;  5DM7 3;  4A3G H;  5C6A A;  5IY0 A;  4G7Z C;  4XXE A;  1MJE A;  1II3 A;  2QA4 A;  1LT6 D;  5IGF A;  4L5T A;  1CA6 A;  2R92 B;  1E7Z A;  3HOY H;  3PO2 B;  2D2C C;  3M3Y B;  2Z4H A;  1Y1W G;  3JAM i;  3GTK B;  1I3Q H;  4N9P A;  2I0Q A;  4DXF A;  2SDF A;  2R61 A;  5KND A;  3M7G A;  1U0L A;  4IUT A;  4KHP Q;  2ASB A;  1PTO D;  1YHA A;  1CSP A;  4HIM A;  3CCQ A;  1PDQ A;  1B50 A;  4H7B A;  4JI5 L;  1JIC A;  3DWP A;  2YU9 H;  2UXD Q;  3ULJ A;  3S2D H;  3GTJ H;  1UUP A;  3KDF A;  5KIX A;  1K8M A;  4ZRZ A;  2EYM A;  1RL2 A;  4DAM A;  1R9T H;  1I50 B;  1UE5 A;  1SNP A;  1N36 Q;  2F4V L;  5T1G A;  3VR2 A;  3S14 B;  2E2I B;  2KCC A;  4OO1 H;  3H6M A;  2O5J C;  1KLU D;  4WJW A;  1I4P A;  1D6E C;  3I4M H;  3N52 A;  3PO3 H;  2B39 A;  5KEE A;  4YY3 L;  4A3K G;  3R2T A;  4U68 A;  1Q7Y C;  4GLX A;  3TBI B;  1JOR A;  3J80 L;  2HCI A;  4BA2 I;  1PFM A;  4JC0 A;  1XPO A;  1OXV A;  3J80 E;  3R93 A;  2JA8 H;  2ENB A;  1PLF A;  3GTP B;  3FDT A;  4LUO A;  4RAU C;  5GAG C;  1S5D D;  1PTO C;  3H3V H;  5D3D A;  3QOJ A;  5CV9 A;  5FLM H;  3PIP 3;  4A3F H;  3BZC A;  3MFG A;  2DN8 A;  1I4H A;  1YZ6 A;  3ONA B;  4QUC A;  4DV3 L;  1G29 1;  4K6D A;  2DY8 A;  4K2K A;  3TDQ A;  1PH9 A;  2MO0 A;  1ONL A;  4GKJ Q;  5LL6 X;  1IW7 C;  3D4D A;  1IXR A;  1K9M C;  2KQ3 A;  3NBH A;  2ZM6 L;  1B8A A;  3VR6 A;  4X65 L;  2WKD A;  3QB3 A;  5COR A;  1XX8 A;  2VL6 A;  4RG1 A;  2A6E D;  3IAY A;  1B53 A;  5IYC H;  4DNT B;  5IP7 G;  3E3X A;  2HQE A;  5EPJ A;  3PIO A;  1JJ2 A;  2RQX A;  1MIU A;  4P74 A;  1AEX A;  1XPR A;  2N88 A;  1EFW A;  3PIO 3;  2F3W A;  2K32 A;  2L1B A;  3VYS A;  3VYU A;  2B63 H;  4QL5 A;  1U9R A;  1SE8 A;  1J8I A;  4RKB A;  2EJF C;  3ZJY C;  3KLR A;  4B3S Q;  1F9Q A;  5C4H A;  5BR8 Q;  2Y0S G;  1XNR L;  4OHJ A;  2G9H D;  2I07 B;  4HED A;  5JVH 3;  1HZA A;  1YNX A;  5JEA H;  1L0Y B;  1I94 L;  1GOZ A;  4R9W A;  3E0J A;  5CR3 A;  4QMG A;  4A3G B;  2K1B A;  2JJQ A;  3T56 B;  3VYR A;  5M9O A;  1WCM H;  3DXJ C;  3SK5 A;  1JJG A;  4JYA Q;  4H13 C;  3T13 A;  4ZUJ A;  4R8N A;  4RHR A;  2IT1 A;  4J1M A;  2ALY B;  2RA4 A;  2K04 A;  4QGU A;  2E2I H;  4JI6 L;  1QCB D;  4JI3 L;  4CJ0 B;  1E2Z A;  1EWI A;  1KAA A;  1EYD A;  2CQA A;  3GO5 A;  2PNR C;  1MI2 A;  3J7A F;  3S2H H;  1VQJ A;  4J15 A;  4NXN L;  2B63 G;  1LTS D;  3NSW A;  1LAB A;  1CKN A;  3KJP A;  2NUC A;  3CXC A;  4FF3 A;  2EY2 A;  4FNF A;  2NZH A;  5JJZ A;  2E76 C;  3I3C A;  2EQS A;  2Z0S A;  4DN4 M;  1VDZ A;  5I4D A;  1BUV T;  1CFM A;  4UP7 A;  2PW7 A;  1IW7 D;  1N8R C;  3HKZ G;  5EPK A;  1EIF A;  4DNI A;  4P2C B;  1KHI A;  1B9N A;  1WD1 A;  2BE5 D;  3T53 B;  1TWC B;  3FPP A;  3H15 A;  1K0R A;  1EOV A;  3R8B A;  1K3R A;  3KBX A;  4ILW A;  1S3O A;  3MAQ A;  3J80 c;  1LTG D;  2BH8 A;  5ELE A;  4LW1 A;  1K28 A;  3J81 i;  3SK6 A;  4YCV A;  4DV3 Q;  1VMC A;  3GTQ B;  1A6X A;  3S2D B;  1AN8 A;  3J7A V;  2AWN A;  5FLX c;  1HHV A;  1E1O A;  2EOT A;  3W2D A;  1MGS A;  4BS9 A;  2EJG C;  2CKZ B;  4LFA Q;  4IZ8 A;  4PMW A;  5C4J H;  5FLM G;  4RA8 A;  1LTI D;  1CM9 A;  4MIU A;  4HJ8 A;  2UXB L;  2MNA A;  4A3J B;  1IYU A;  1LM0 A;  1T5E A;  3K5M A;  1F9S A;  1VQM A;  1X32 A;  4QB4 A;  3RLF A;  3UE0 A;  2I5M X;  3T1H Q;  1B3Q A;  3CCV A;  1PH1 A;  3S15 H;  3I4L A;  1HH2 P;  2P5Z X;  3OMC A;  2NN6 G;  4DR3 Q;  2EY6 A;  1BNZ A;  4OIK A;  5IGE A;  1I4Q A;  1X9N A;  4GN5 A;  3GTP H;  3L0O A;  2EDG A;  3GD7 A;  3WOE A;  1XMO Q;  4WFN 3;  1SLJ A;  2F0D A;  5CV6 A;  4DV1 L;  5GAH C;  4DR2 L;  4HN7 A;  3SR1 A;  3ULP A;  3FVQ A;  4XQN A;  4DV4 L;  5J3B A;  3G4S A;  4QY7 A;  4DR7 Q;  1F77 A;  4R1J A;  4KY7 A;  4KTA A;  4CDC C;  2E74 C;  4IUU A;  1N33 Q;  2BH2 A;  1JWS D;  1NUC A;  2QCP X;  4JI0 L;  4G4K A;  4IUV A;  2A6H D;  1KDB A;  3ER0 A;  5C4J B;  1SRO A;  1YJW A;  1EL0 A;  1V43 A;  5EBC A;  1CSQ A;  4QIW B;  4A3C G;  1PFN A;  3CQZ H;  1VQ9 A;  3D4R A;  2F3I A;  2WAQ B;  3UDF A;  4KJO A;  2AUK A;  4X62 L;  4DUY L;  4TVA B;  2WIN B;  1DCZ A;  4ZUI A;  4BXX G;  3D31 A;  4LK1 C;  3S9W A;  1B7Y B;  3I70 A;  3RN5 A;  4JI6 Q;  2F0P A;  2R7D A;  3L2P A;  4JI3 Q;  1I50 H;  2SNS A;  1RIP A;  4IUQ A;  1Q8K A;  1X3E A;  4XQQ A;  1GD7 A;  2KEE A;  1BCP F;  4JI4 Q;  4IOA A;  4R4T A;  3DMU A;  3N6R A;  1KXL A;  2ZT9 C;  5EQ0 A;  3I4O A;  2D62 A;  5FJ8 H;  2KA7 A;  4LUZ A;  1LTT D;  2HQL A;  2HUG A;  4RFB A;  5G3L D;  5J39 A;  2VQE L;  3S16 B;  2WB1 B;  4DAY A;  4DR1 Q;  2F0H A;  2DGY A;  4YWM A;  1EY4 A;  2F03 A;  1CHP D;  5IYD G;  4KKS A;  3H3V C;  2VB2 X;  4BY1 H;  4DAP A;  1YJN A;  3W1B A;  1TS2 A;  2WP8 J;  1EWC A;  2DNE A;  4A3F B;  4V19 0;  1IYJ B;  2QDL A;  5D65 A;  1E3P A;  2XWJ B;  3K58 A;  2I5H A;  3MVV A;  4EVO A;  4K6L A;  1PFS A;  1SFO H;  3J81 j;  3FKI G;  4DAY B;  1B44 D;  2ZJP A;  1JOO A;  4KV6 A;  1SN8 A;  1F2L A;  4P72 A;  4BY7 H;  1G8Z D;  2F0O A;  4X6A H;  5LMN Q;  1BF4 A;  4B3T Q;  1SMY D;  4EX5 A;  4DV0 Q;  3GP7 A;  3K0Y A;  4L5Q A;  4UP9 A;  4DV2 Q;  3U58 A;  1K8G A;  4APV A;  5JPN C;  2KBN A;  2YV5 A;  3RR5 A;  3RUZ A;  1MKH A;  1HTP A;  1VF7 A;  3W5O A;  2JA6 B;  1CT1 D;  2JA6 G;  5I2X A;  1M1K C;  2NB0 A;  2IJ0 A;  4UAI A;  1QG7 A;  5M5W B;  1JWM D;  1RD9 D;  1A0I A;  4BBR B;  1LT5 D;  1F9P A;  1EYC A;  1LT4 D;  1LYL A;  1TWG H;  3S17 H;  5ELO A;  2HIV A;  3HOX G;  5HGQ A;  4DV4 Q;  5C4X B;  4GN3 B;  5E4W C;  1KRT A;  2JA8 G;  1OXT A;  4BY1 B;  3E5S A;  1L0X B;  2XWB B;  4MN3 A;  3GTL B;  1XWE A;  3F2D A;  4OON A;  2FMC A;  5C3X A;  5ELB A;  3FP9 A;  1QNK A;  4FVM A;  2FJ2 A;  2K7V A;  2RHQ B;  2XGT A;  1ICW A;  4DR3 L;  4L5S A;  3T51 B;  4FF4 A;  1QB5 D;  4EQN A;  5C44 G;  2IL8 A;  1E24 A;  1IKL A;  2R93 H;  1XTC D;  4XTC S;  1O78 A;  1DOK A;  5GQO A;  3X3M A;  3PF5 A;  3S2H B;  1HNX Q;  2RF4 A;  5GAE C;  1BOS A;  5A2Q L;  3T1Y Q;  5DAU A;  1M90 C;  2UXB Q;  1UEA B;  2GVA A;  4DR2 Q;  3PGZ A;  1MSH A;  1Y1V G;  5LMN W;  2ICE C;  4ULL A;  1T5X D;  2IPK D;  4Z9C B;  2MHV A;  4N8F A;  4R8I A;  4A3B G;  5FO9 B;  4BBS G;  4DV6 L;  1FR3 A;  3PO3 G;  5BN3 A;  1PH6 A;  1ENA A;  2Z1C A;  2OF1 A;  2X6G A;  2UUC Q;  1QNU A;  4ZQ3 A;  1ASY A;  1S40 A;  2B8F A;  4A93 B;  4CGY B;  4X66 L;  3S1Q B;  2AHO B;  5K5P A;  2C5C A;  1SYE A;  3NHH A;  4KY5 A;  5HGT A;  2LXK A;  5IE8 A;  2J0T D;  2RSO A;  3EFX D;  3M85 A;  1VQC A;  1VQA A;  4GKK Q;  3ERS X;  3URY A;  1TWF B;  2UXC Q;  1XNQ Q;  1STY A;  1FJG L;  1YHB A;  4E6I A;  3GTQ H;  2O4X A;  3PF4 A;  3VDY A;  3VR5 A;  2RCF A;  2IX1 A;  3LNN A;  1Q90 A;  3DHQ A;  2KEC A;  4QCL A;  1STA A;  4LFB Q;  2KJX A;  3NTI A;  1QZH A;  4OX9 Q;  1Z47 A;  3PMF A;  4DR4 Q;  2E2H B;  3TS0 A;  3TP6 A;  1X3P A;  1HXY D;  1EQV A;  1Y8P B;  2Q8R E;  1Z7T A;  2G5D A;  1SYG A;  3EJI A;  1WJJ A;  1CZW A;  4C3I B;  2E5L Q;  1QUQ B;  4F8M A;  2FMM A;  1RTN A;  5J1Z A;  4CKC A;  3C1E A;  4CJ1 B;  5DM6 3;  4DV7 Q;  3S15 B;  2OQK A;  3DUZ A;  3HOU H;  1ASZ A;  2LSS A;  4R4O A;  3V96 A;  2NWG A;  4YY3 Q;  4YCW A;  4ME5 A;  3M4Q A;  1EQT A;  3NUC A;  1VF5 C;  3AQQ A;  3CCS A;  1VQK A;  5K36 G;  4DR5 L;  1IBL Q;  2EE1 A;  1D5X C;  3D6W A;  3KLS X;  4YHH Q;  4DA2 A;  1AE3 A;  4NW2 A;  3TZU A;  4LF4 Q;  4AQY L;  4LF7 Q;  2CVR A;  3SEB A;  1GKH A;  3T4A C;  3IRB A;  1WCM G;  4NXM L;  1S5F D;  4O0A A;  4AYB G;  1VQ7 A;  1C9O A;  2K5V A;  1DGS A;  3E0E A;  1OXX K;  1V9P A;  5C0X J;  3NXW A;  4N9T A;  2A5H A;  2F3V A;  5J22 A;  3TRE A;  4X65 Q;  2VY3 A;  3TS2 A;  1A2T A;  5JOB A;  4BWG B;  1L1O A;  3I90 A;  2PQA B;  2QF7 A;  3BDL A;  4OIJ A;  3UDX A;  1GUW A;  2SOB A;  1EZ6 A;  5M3M G;  2AMC B;  1SJE D;  1DJR D;  4JPB W;  1KDC A;  2EVB A;  2V4D A;  5M3M B;  1M4V A;  4ME3 A;  1PXU A;  4YCU A;  4A3C H;  3F2B A;  1SNC A;  2KVM A;  1EOT A;  2JA6 H;  5AJ3 Q;  1MBY A;  4IJH A;  1HR0 Q;  3M3Y H;  4A3L G;  1EY5 A;  4GKJ L;  1G6P A;  1Q82 C;  1KDA A;  2CWA A;  2PZU A;  2E8G A;  3MXN B;  1K8A C;  1HJP A;  2KCN A;  1CI3 M;  2RHS B;  3BDC A;  3RMH A;  3W1G A;  4X66 Q;  1HNX L;  1TWG B;  1IL2 A;  3IFD A;  1ENF A;  4ALP A;  3HOW H;  3P7J A;  5JAV A;  3TRZ A;  4HSP A;  4OGQ C;  3TP5 A;  3U4V A;  2A73 B;  1LO5 D;  4OEM B;  1U4M A;  3EIV A;  5CV4 A;  2B3G A;  5KRU A;  1VQH A;  3G48 A;  2PW5 A;  5C44 H;  3CCU A;  3S1Q H;  4PZ7 A;  2EYF A;  4DKA C;  3CC4 A;  1CQF A;  2B2T A;  1DON A;  1J5E Q;  1AZP A;  1X3Q A;  1I4X A;  1HUN A;  5JPM C;  3BDO A;  1NE3 A;  2IWH A;  4ID6 A;  3MFY A;  1B3A A;  3MXN A;  2Q8T A;  3FPU B;  2JA5 H;  2Z6B A;  3LWE A;  5E1F A;  1JC7 A;  3NTK A;  2E75 C;  2F0W A;  1O80 A;  2RCN A;  1VQ5 A;  2OEO A;  4IN3 A;  2CFM A;  1TII D;  3K57 A;  1T9H A;  4JI2 Q;  1EU4 A;  4HSV A;  5EBD A;  1IL8 A;  1NAP A;  1DYQ A;  1ZYR C;  3OOC A;  3HKS A;  1VQ4 A;  5LMN L;  2HIX A;  4MTN A;  4F87 A;  1I6H H;  3PCO B;  3MHB A;  5IWA Q;  3MC0 B;  2F52 A;  1BKB A;  2KED A;  2RDH A;  2Q2U A;  4BY7 G;  3PUW A;  4OO1 I;  4OXP A;  3B6Y A;  5IYD H;  3DWQ A;  2VXW A;  3BYY B;  4YHH L;  2Z6K C;  4A3G G;  2NTS A;  5C5M A;  2F0K A;  2JN4 A;  4I65 A;  3KF8 A;  4LAA A;  3SVM A;  3J81 E;  4FXG C;  2UUC L;  1HCZ A;  1CKO A;  4BXX H;  3DM3 A;  4ZCK A;  4JYA L;  2PZW A;  2Y0S E;  2Z4I A;  3P20 A;  4A4I A;  3GQB A;  2JE6 I;  3BVZ A;  4X3S A;  3S14 H;  1EEI D;  3KYH C;  3OIQ A;  4XT1 B;  4AYB E;  3RN2 A;  4KJN A;  5EGT A;  3UDG A;  2F0E A;  2B2Y A;  3F1Z A;  2R3Z A;  1C4Q A;  4PZ6 A;  3I2Z A;  4ZAI A;  3EN2 A;  4A3B B;  5IGC A;  5CV5 A;  1SAP A;  1BBX C;  4LF7 L;  3VR3 A;  2LFN A;  1GHJ A;  1Y1V B;  3KOJ A;  4KD4 A;  5COY A;  1Q3L A;  1TY0 A;  2E2D C;  2PYK A;  2MO1 A;  5L37 A;  3A7L A;  1GXD C;  4AYB B;  1QE6 A;  1E2V A;  1XJV A;  4A75 A;  1WCM B;  3EQL C;  1V1Q A;  1VQG A;  1KQS A;  1HA6 A;  1YI2 A;  3Q22 A;  4GOP C;  1CTM A;  3SGI A;  5A2Q E;  4WOR A;  2F0U A;  3S16 H;  4XYO A;  5IYB H;  1WVL A;  3M4O H;  3D3R A;  2A6H C;  5IYC G;  1D2B A;  3K5O A;  1CZG A;  3RNU A;  4RMF A;  5C4X H;  1HPC A;  3HOX B;  4NB3 A;  1SYB A;  1L1O B;  4KN7 C;  3GTO H;  2B2T C;  1PA6 A;  3H91 A;  2A19 A;  2QKI C;  2AQ2 B;  4YWK A;  2V1C C;  2E2J H;  2K01 A;  3C46 A;  2ZTC A;  4HIO A;  5AFW A;  4QIW E;  4A3K B;  1HZB A;  1H9S B;  2NBF A;  1EIH A;  1A62 A;  2ICI A;  2XRS D;  2K5W A;  2UXC L;  4C3I G;  4JG2 A;  4BBR H;  4IFD I;  5I6Y A;  4NMZ A;  4HCE A;  3MXG A;  1I6H B;  3A7A B;  1XYI A;  1Y1V H;  1YNN C;  4IAL A;  1CA5 A;  2I46 A;  4JI1 Q;  1WTR A;  1VQL A;  1X3F A;  3FKI B;  4GNX C;  1NJI C;  1X65 A;  3HEJ A;  2Q2T A;  5CGK A;  2CH4 W;  4LFA L;  1PTO F;  5ELN A;  2H4O A;  1DXM A;  2K5N A;  4C3J G;  1NTG A;  4X3K A;  2EY5 A;  2JYO A;  4JI1 L;  1Y1W B;  1SEB D;  3TN2 A;  1S5C D;  1L0W A;  1D5M C;  1I3Q B;  2XVS A;  4C1N I;  2NN6 I;  4DR7 L;  3I8Z A;  2KCT A;  4L8J A;  4EQO A;  5JEA J;  1HR0 L;  3MWY W;  1SE4 A;  1YIT A;  3QG1 A;  5BN4 A;  2JK8 A;  3P1H A;  4NPS A;  1SMY C;  5CBA E;  1QWY A;  1VQE A;  2D5D A;  4BBS B;  3I72 A;  4B08 A;  1WTW A;  2D9U A;  2WB1 G;  3DM1 A;  1AP0 A;  2F0F A;  2X69 A;  2WKC A;  4DUZ L;  2PMZ E;  2Z8L A;  2MP1 A;  4A3L H;  3K7U C;  3LWU A;  2E2H H;  3C3L A;  4DAV A;  3S1N B;  2N55 A;  2BOS A;  4B3R L;  4IO9 A;  2C9O A;  4HJ5 A;  4C3J B;  1WD0 A;  2BE5 C;  4CDF C;  2CWP A;  2KHJ A;  2FXQ A;  3CC7 A;  2N49 A;  1G6Z A;  2QGQ A;  1M8A A;  1PTO B;  3BVM A;  3GTJ B;  1Z9F A;  1NR4 A;  4IOC A;  5CC4 A;  1RTO A;  4XDX A;  1E1T A;  1JOQ A;  2NN6 H;  2EYH A;  1TWA B;  3NWT A;  1U4R A;  4BY1 G;  3A56 A;  4LFC L;  1KIX A;  2JA8 B;  5IP9 H;  1F9R A;  2WAQ G;  1HQR D;  4B3T L;  3IL8 A;  5M3M H;  2AQ3 B;  3KF8 B;  1DM0 B;  5FOB B;  5C3W A;  4LF8 Q;  4ZKC B;  2MQH A;  1A3T A;  2NZO A;  4HID A;  3CPF A;  3EBE A;  1F2Y A;  4JI8 Q;  4HJA A;  2IHE A;  4KHP L;  1N32 Q;  5DEH A;  1SJH D;  4HMI A;  2B2V A;  4JV5 Q;  2NVX B;  2A1A A;  3KUP A;  1WOC A;  1D1I A;  2EXZ A;  5IWA L;  3J7Z C;  4LF5 L;  1S5B D;  5D3I B;  1N32 L;  2D0O A;  3GTM H;  1PRT C;  2Q2I A;  3E6Z X;  1ZKO A;  2KEN A;  4K0K L;  3EVQ A;  2BA1 A;  4S3S A;  4HJ7 A;  2HD3 A;  4ZKB B;  2K50 A;  1JWU D;  1K73 C;  2F0T A;  2LMC B;  4L5R C;  4UHV A;  1QZG A;  2EYJ A;  4G7H C;  2IX3 A;  4LNQ A;  5JEA G;  4A3F G;  3CU7 A;  3KJO A;  3CCJ A;  1QVC A;  3C2P A;  4A3J G;  2F0N A;  2CQO A;  2H1E A;  4JI7 L;  4K5V A;  5IIF A;  4A3I B;  1PH8 A;  5BN5 A;  3IFT A;  1VCI A;  1UE7 A;  1FGU A;  4R4I A;  1ICF B;  4MZ9 A;  3STB C;  2SEB D;  4GNX B;  1EYG A;  2NVX H;  1E0B A;  3D0F A;  3MA2 B;  5IGD A;  1WYD A;  2JP1 A;  3ERO A;  4LWC A;  1HZ9 A;  5IGG A;  1P16 A;  2WFW A;  3FMC A;  3RD4 A;  1YBY A;  2VS1 A;  1CUK A;  4BY7 B;  3PSI A;  2I5L X;  1SNM A;  2L11 A;  3E9H A;  1X56 A;  2L0C A;  4ZK9 B;  3TQY A;  1X54 A;  1PFB A;  4JBK A;  1XMQ Q;  3CME A;  4M8A A;  3F2U A;  2Z6K A;  4Q0F A;  4YIJ A;  5JJL A;  2XSC A;  2PPB C;  1JOK A;  5HUR A;  3SE0 A;  2A68 D;  1EQR A;  2BCO A;  1NNX A;  3HZX A;  1Y1W H;  2K14 A;  2X6L A;  1X6O A;  1ILP A;  3K6O A;  4JI2 L;  2YYZ A;  4CHT B;  2NVQ B;  3BS1 A;  4PMC A;  3Q6S A;  2VQF L;  1VMP A;  4B3M L;  5FO8 B;  2F0V A;  3GTG H;  2J4X A;  1NMF A;  1MJC A;  1EEF D;  4C2M H;  1G91 A;  4DR6 L;  4RGN A;  1BXT A;  1N34 Q;  4A3M G;  3CAM A;  1U4P A;  4C3H H;  4DK3 C;  1F2M A;  4RWS C;  1VQD A;  4OX9 L;  1YNJ D;  3HOV H;  4DV0 L;  4UY8 C;  3RZO B;  2FIN B;  4TRD A;  1C48 A;  3STB D;  1PV4 A;  2CHB D;  4DK6 C;  3CCM A;  3T1Y L;  5LL6 S;  1G51 A;  3MZ5 A;  5EKK A;  4NXN Q;  2ZXO A;  4L6T B;  4DU9 A;  3S1M B;  4LF4 L;  2WAC A;  4B3R Q;  2K05 A;  2PMZ B;  4DR1 L;  3T16 A;  4JW0 A;  1LAC A;  3P75 A;  1UE6 A;  1VQF A;  3M4Y A;  1XXG A;  1WTX A;  4A3K H;  2KOL A;  1PZI D;  1S72 A;  2L4N A;  3M9B A;  3KLS A;  4LF5 Q;  3MEH A;  3HOZ G;  4J8Q A;  4C3I H;  1KC8 C;  5FKA C;  1PHJ A;  2WV6 D;  5JJI A;  1ESF A;  3CPW A;  1D1K A;  1ET9 A;  1B4O A;  2JQO A;  1TR5 A;  2IHF A;  2RVL A;  1UNS A;  4C56 C;  1PH7 A;  2WII B;  2K6A A;  3VA5 A;  3I91 A;  4DPG A;  1OO9 B;  1B70 B;  1YVC A;  4X3U A;  1CKN B;  3NQI A;  3SHL A;  1HA5 A;  4HTH A;  5IOD A;  4KKU A;  4P71 A;  4M1U B;  1LLR D;  1D8L A;  4DV2 L;  4RCO A;  3K5N A;  1CKM A;  2E2J B;  2DNC A;  1Y8N B;  4NP5 A;  3AEV A;  3BYT B;  4PZ8 A;  1K8O A;  1TS5 A;  4I7Z C;  3DWA A;  2MFI A;  4PG3 A;  4DV6 Q;  3HOY G;  3FRP B;  1SBB B;  2ZTE A;  1GJX A;  1PYB A;  1QUQ A;  3U9S A;  3OWF A;  2UU9 Q;  5K36 H;  1G2T A;  1N9W A;  5IT9 L;  4K8I A;  3HKZ B;  1HNW L;  3D6C A;  3LX0 A;  1TQO A;  2MPM A;  3F2C A;  2XRQ D;  1EQQ A;  4Q5V A;  4A3B H;  2YTY A;  4KI0 A;  1Q86 C;  4HR7 B;  2EYO A;  3JC6 6;  4PMB A;  2XNA C;  2SNM A;  2IX0 A;  2HCC A;  3Q0A A;  4FF2 A;  1IKM A;  2B63 B;  2PQE A;  2A69 C;  5ISR A;  3BU2 A;  3L3O C;  2BDO A;  1H9R A;  1KL9 A;  1Q8I A;  3PQI A;  4DK1 A;  2VQF Q;  2G9D A;  5IP9 G;  4B3M Q;  1PTO H;  4LF9 Q;  3E9I A;  4IPC A;  1TT2 A;  2JEB I;  3KLW A;  2OXP A;  3K0X A;  1RKN A;  1YEZ A;  3Q24 A;  1D7Q A;  3KDF B;  3NWS A;  5GAD C;  3A54 A;  1EIY B;  1HFG A;  1W2B A;  2NZ1 D;  4UP8 A;  2A6E C;  4J6H A;  5DNF A;  1HRJ A;  1EY0 A;  3GTO B;  1SNO A;  4LJZ C;  1YJ9 A;  1WTH A;  4K14 A;  1R9T B;  2C35 B;  2M9V A;  3QOL A;  1TS4 A;  1HFN A;  1I5F A;  2R92 G;  3TME A;  1WFQ A;  1SE2 A;  1WTO A;  4A93 G;  2BA0 A;  5I9O A;  1SYD A;  1YNJ C;  5DLQ E;  4TSS A;  5EPL A;  1AW7 A;  4U67 3;  3S1M H;  5GRO A;  3PO3 B;  5M5Y B;  4HAE A;  2VUM G;  4ODG A;  2O5I C;  3TZD A;  1XPU A;  2PNH A;  3A8J E;  5KNC A;  3S1N H;  4GZY C;  4JVZ A;  1OXS C;  2TSS A;  1AFP A;  3CRL C;  2A68 C;  3OIP A;  1I4R A;  2F0M A;  3BJU A;  4GS3 A;  1Y14 B;  1SYC A;  5C44 B;  2L15 A;  2L9H A;  1OTC A;  5IYB G;  1PRT B;  2VZA A;  3PUX A;  4P73 A;  1W6K A;  1TVX A;  2N8N A;  3H0G H;  1DD2 A;  3A55 A;  1PZJ D;  1S5E D;  3K7A H;  3KBG A;  3TP7 A;  5M3F H;  5JJK A;  4CBV A;  2PZT A;  4LF6 Q;  4AIM A;  1A63 A;  3FEW X;  4DV7 L;  4JI7 Q;  4K8J A;  1BO0 A;  4RGM A;  5C4X G;  1JQY D;  1PZK D;  3CRK C;  4BBR G;  1A2U A;  4ZLT F;  2F0I A;  4A93 H;  2EJM A;  1EZ8 A;  1FNW A;  2B2U A;  5FK9 C;  4JI4 L;  3VYT A;  2JSO A;  3RZD H;  1A3V A;  5TSS A;  1GUT A;  2MGS A;  4CKE A;  1Q1B A;  1O7L A;  4KD3 A;  1XTD A;  2F0L A;  4RGT A;  2K33 A;  2K28 A;  1HQM C;  2D0P A;  4PQX A;  1Q81 C;  4HIK A;  1PH2 A;  1I4G A;  1BCP D;  3R3O A;  1EIG A;  4H44 C;  5C0X H;  3HS0 C;  1H9M A;  3A5Z B;  2UUA Q;  3QR8 A;  1EY6 A;  1EY8 A;  3OW7 A;  3QJY A;  3PUZ A;  3ERQ A;  4PNY A;  2AUJ D;  2Q8I B;  1K83 B;  2B2W A;  2M00 A;  1STE A;  2R7F A;  2WAQ E;  2L55 A;  2M2L A;  3TSS A;  3PIP A;  2OT2 A;  2L12 A;  2F0Q A;  3W3A A;  2EPB A;  1BDO A;  3PO2 G;  4KHZ A;  4O2D A;  2N3S A;  4WRD A;  5M5W H;  3H94 A;  4TQU S;  2TMP A;  4KKT A;  2GA4 B;  3SK4 A;  3A8K E;  2ES2 A;  1RHP A;  1V1P B;  4QF4 A;  1SDF A;  3S24 A;  4IFD J;  1TXY A;  3J80 i;  3VR4 A;  4CKB A;  3HOV B;  2RDF A;  4JI0 Q;  1PMR A;  2H5X A;  5C5L A;  1Y69 U;  1STN A;  3L9A X;  2R7Z B;  1ET6 A;  2MUY A;  3C1F A;  1JE5 A;  3OYY A;  1YIJ A;  4DV5 Q;  4OL7 A;  4LMQ D;  1ZXT A;  3UE1 A;  3AYH B;  1HR0 W;  1R4P B;  1VQP A;  4G7O C;  3WWV A;  3ZYY X;  3NK9 A;  3SK8 A;  4GLA C;  3CC2 A;  2VW9 A;  1KAB A;  2O2L D;  3HOU B;  5E7N A;  2JA5 G;  4YWL A;  1MHW C;  4QQB X;  2F0G A;  1V1P A;  5EAY A;  1TWH B;  4B9W A;  5JVG 3;  4R4Q A;  5FLX E;  2A8V A;  2ZXR A;  4IPD A;  1ZEQ X;  1H9S A;  3SDZ A;  1HTL D;  4XQJ A;  3R2I A;  2R92 H;  1RF2 D;  2PO4 A;  1BCP B;  5FO7 B;  4IUR A;  4JBW A;  2KHI A;  4LUV A;  3GTK H;  3D4W A;  4X62 Q;  4DUY Q;  2NVQ H;  3OWE B;  1FNV A;  3G6J B;  1WI5 A;  3BVG A;  3GDE A;  3MXP A;  5A35 A;  4IQZ A;  4JBM A;  1GHK A;  1YNN D;  1HUM A;  1UAP A;  3CW2 C;  1LV9 A;  2ZJR A;  5CV7 A;  2F4V Q;  2EY1 A;  5EKL A;  1C0A A;  1TU2 B;  1BBW A;  5CMD A;  1ESR A;  2QDB A;  1A3U A;  3CKI B;  3AFP A;  1QIL A;  1QVF A;  3EA6 A;  3I4M B;  3V2T A;  3CF5 A;  4A76 A;  4K5W A;  2QIL A;  2CW0 C;  4KLK A;  3V05 A;  2R7Z G;  1LT3 D;  4DF7 A;  4ZYS A;  4KK7 A;  1EY7 A;  2R6G A;  4OEL B;  1Q1E A;  1G2S A;  1JT8 A;  2LXJ A;  1GUG A;  2AWO A;  3KF6 B;  3AMU A;  4IFD H;  2VB3 X;  2IY5 B;  3FKI H;  1N36 L;  4OWT B;  3HOW B;  1AZQ A;  2PCF B;  4JOI C;  1W6J A;  1IBL L;  4Y7N B;  2HDM A;  1GUO A;  4OO1 G;  2OTJ A;  4C3H B;  5C0X I;  4K0K Q;  1EY9 A;  1IBK Q;  1WTP A;  2HDL A;  3RZO H;  4R4C A;  1MSG A;  3K80 C;  5C3E B;  3U4Z A;  4KN4 C;  1NCV A;  3G6E A;  1JJC B;  1VQB A;  3OTO L;  4JV5 L;  2DJG C;  3BG3 A;  4L63 B;  5CV8 A;  1CK1 A;  1ENC A;  3TP8 A;  4DV5 L;  2Q2H A;  1I6V C;  5KYL A;  3HP3 A;  1IYV A;  1JCK B;  3I73 A;  2JA7 G;  4DGZ A;  1H9K A;  1TWH H;  1V8Q A;  1NBW A;  1SND A;  1PRT F;  2K5Q A;  1W3S A;  3G71 A;  2UUA L;  3I4N B;  3OMG A;  4JOI A;  4NXM Q;  3NEL A;  3UI2 A;  2NTT A;  2JEA I;  5I9P A;  1NSN S;  1PRT D;  1U4L A;  1C8C A;  1DOM A;  1PH3 A;  1TS3 A;  3MTS A;  3U9O A;  2ZJQ A;  4IUN A;  1S4Z A;  2N78 A;  1CQV A;  4POF A;  3RLO A;  5G3L F;  1RCV D;  1WTQ A;  1E2W A;  4RCN A;  1JE4 A;  3J81 c;  2PQA A;  3J81 L;  1STB A;  4JCV E;  4JBJ A;  5ELC A;  1HZC A;  1KAW A;  2K5D A;  1ROD A;  4HJ9 A;  2XTI A;  2LKV A;  3MXU A;  5M5X B;  1ZYR D;  4LF6 L;  1JB7 A;  4EQP A;  2EZV A;  1B1Z A;  2K52 A;  1I94 Q;  3J7A 5;  3A8I E;  2E5L L;  5D14 A;  4LF8 L;  1EWH A;  4MNO A;  3OSO A;  5KYI A;  3IKJ A;  3CP0 A;  2DUD A;  4DV1 Q;  2LS0 1;  2K4K A;  3SXH A;  1FD7 D;  3WOF A;  1AH9 A;  5IP7 H;  4UDU C;  4GOP A;  4FP5 D;  4DFA A;  3J7Y W;  3OW2 A;  4LFB L;  4V0B A;  2Y0S B;  5E4X A;  3BZD B;  1X55 A;  1STG A;  2R93 B;  4AH6 A;  3A5U A;  2XN9 C;  4EQ5 A;  2R93 G;  3HOZ H;  1F2Z A;  1N33 L;  2HHH Q;  2EYP A;  4A3E G;  4GNX A;  3CD6 A;  1QJO A;  3NEN A;  2B2U C;  4PV1 C;  1SXT A;  1WTV A;  2OQ0 A;  2B8G A;  1KTK A;  5I6W A;  2NVT H;  4A3M H;  2VUM H;  3AB9 A;  2RSN A;  1FGB D;  1GUN A;  4IUP A;  1FNU A;  5IOC A;  1HNZ L;  4WJ3 M;  2AKW B;  3NEM A;  1QOH A;  1X3G A;  2MJ8 A;  3I7F A;  3HG9 A;  1PYS B;  1XMQ L;  4LFC Q;  2OCE A;  3H0G G;  1AE2 A;  1MD2 D;  4DR6 Q;  1ML0 D;  1CHQ D;  1HNZ Q;  4IPH A;  3OTO Q;  1PVO A;  4RGO S;  2HT1 A;  4MTK A;  2ATW A;  2F0J A;  5C3E H;  1Z6H A;  2IW3 A;  2UXD L;  1C7Y A;  4A3E H;  4TKO B;  3TEH B;  2VNU D;  1A15 A;  1KD1 C;  1IZ6 A;  1UWV A;  2YTV A;  1KNE A;  1K0S A;  2B2W C;  5KGU A;  2CH4 A;  3KK7 A;  4B9X A;  1IHZ A;  4HCS A;  3HOX H;  4H0L C;  4K2L A;  2Z9H A;  3H09 A;  4A3D H;  1BQQ T;  1JR0 D;  1GO3 E;  4G57 A;  1XMO L;  2R7Z H;  1Y8O B;  1NY4 A;  1O7Y A;  4DR5 Q;  2FHT A;  4GN4 B;  4Y52 H;  1SMX A;  3PV0 A;  3AU7 A;  4CJ2 C;  4C2M B;  4C3J H;  3CQZ B;  4FO2 A;  4FDB A;  1LTL A;  3NBH B;  3PO2 H;  3HOY B;  2JA7 B;  1Q12 A;  1O7Z A;  5LHY 1;  2KUM A;  4IJL A;  1VQI A;  4DNR B;  1EFI D;  3NTH A;  5AJ3 L;  1J5E L;  5IT9 E;  2UU9 L;  3M4O B;  5HY6 A;  3H0G B;  4C1N K;  2BDN A;  1HNW Q;  1TWF H;  3OPO A;  3MEF A;  4ABN A;  5E3F A;  3ND8 A;  1ILQ A;  5FLX L;  1SSO A;  2B2V C;  3A0J A;  1H9J A;  3S1R B;  4X3T A;  3NQT A;  3CCL A;  4O1N A;  1VS0 A;  4A3E B;  2JA9 A;  2QEX A;  1UE1 A;  4JK1 C;  1DZ1 A;  2OWO A;  3JAM E;  3ITP A;  1QVG A;  2UUB Q;  3HOZ B;  4EGV A;  2VQE Q;  2GVB A;  1RDP D;  4N8X 1;  1SRU A;  1DOL A;  2GN5 A;  2ZTD A;  1PYW D;  1BR9 A;  3GTM B;  4A3D B;  1EUJ A;  1IBM Q;  3GV6 A;  2NVY B;  3RLN A;  3HKZ E;  1FYC A;  4B3S L;  1VQO A;  2EXD A;  5BR8 L;  1VQN A;  1Q46 A;  1XNR Q;  2DJF C;  2F0S A;  5H1S E;  3GTG B;  3Q8D A;  3OHX C;  3FHW A;  1KRS A;  3CCR A;  2WB1 E;  1IBM L;  1GUS A;  5LMU L;  5I2Y A;  1TWC H;  1L1O C;  4GKK L;  2JA7 H;  1XNQ L;  1FJG Q;  1TY2 A;  1BBU A;  3M4P A;  2AQ1 B;  2K03 A;  4LF9 L;  1TWA H;  4A3M B;  1J6Q A;  4XYQ A;  5NUC A;  2QW7 A;  3K59 A;  1LTB D;  2ZM6 Q;  2B29 A;  2J7Z A;  4XT3 B;  3ND9 A;  4GOP B;  1IBK L;  4IFD G;  4Y7N H;  2L5T A;  4BBS H;  4KHV A;  2CW0 D;  5T1I A;  2RDG A;  1LTA D;  1P8L A;  2K75 A;  4GLV B;  2K5H A;  5FJ8 G;  4DXG A;  5IT9 c;  4BA1 I;  1SFO B;  5C4Z A;  1D5Z C;  3QWN A;  4CDD C;  3S17 B;  4FYD A;  3I4N G;  3NP8 A;  5M5Y H;  3PUY A;  3KFU A;  5M3F G;  1GVP A;  2HHH L;  3UDI A;  4K5X A;  4HMJ A;  2JA5 B;  2NVY H;  2OTL A;  1KLG D;  2XIW A;  2F1M A;  2PI2 A;  1O7I A;  5ELD A;  4DUZ Q;  4O42 A;  1SYF A;  3X3N A;  4MHE A;  2B2Y C;  3DLL A;  1VQ8 A;  4POG A;  3HGB A;  2JXM B;  3GV3 A;  2KCM A;  3AFQ A;  1JMC A;  1NR2 A;  3NPP A;  4H02 A;  5C3E G;  4JI5 Q;  1GM5 A;  4X64 Q;  2EYL A;  3WDN A;  5KNB A;  3PUV A;  4DK0 A;  4A3I G;  3O13 A;  4C3H G;  4A3J H;  2F4I A;  3HRZ C;  4QUF A;  1LUZ A;  1EYA A;  4X64 L;  1B9M A;  3F8T A;  3HOW G;  4XIG S;  2YU9 B;  3KF6 A;  4UPA A;  1SR3 A;  5F2D A;  1L2F A;  3GTL H;  1SNQ A;  2LY7 A;  4A3I H;  1STH A;  4KMU C;  3K5L A;  3S1R H;  1K3B C;  1FVI A;  3T1H L;  3I4M G;  1PH4 A;  3VA7 A;  1R4Q B;  2ID0 A;  5EKI A;  1BVS A;  2A74 C;  3CCE A;  2A69 D;  3JAM L;  1SE3 A;  3JAM c;  1A8V A;  1V1O A;  3BZK A;  4OWX B;  1YHQ A;  3K7A B;  4IPG A;  5M3F B;  4FF1 A;  4F7X A;  3CMA A;  5LMU Q;  4AQY Q;  1NMG A;  5CBE E;  5IGB A;  1PH5 A;  3NE5 B;  3I4N H;  3L7Z C;  1VQ6 A;  4DR4 L;  3HFZ B;  1KNA A;  3CHB D;  4WJ4 A;  3RZD B;  1JB3 A;  5EJW A;  2RKS A;  1LTR D;  3U50 C;  5ELF A;  2FFK B;  2RBM A;  4RKL A;  2ZXP A;  4CDE C;  4P75 A;  2QEJ C;  4I7A A;  3QO2 A;  1OXU A;  1E22 A;  2DY7 A;  4F88 A;  1B2T A;  4NKL A;  2NYZ D;  3DEP A;  4RH6 A;  2YTX A;  1BCP C;  1U5K A;  3D8G A;  3QIA A;  4FXK C;  3I55 A;  3HOU G;  2KHS A;  3K81 C;  3G7L A;  5M5X H;  1N34 L;  5CYU A;  1K83 H;  3ULL A;  4FXD A;  4NDX A;  3ICE A;  3A74 A;  4QJF A;  2EIF A;  1RJT A;  3Q23 A;  4OWW B;  1TKW B;  4JI8 L;  1FL0 A;  2PI2 E;  2CCZ A;  2UUB L;  1H95 A;  4KY6 A;  1J9O A;  5C0X G;  3H3V I; 
#chains in the Genus database with same CATH homology
 4A3F G;  2R6G A;  3I56 A;  3HOV G;  4A3D G;  1Q1E A;  3KJO A;  1JT8 A;  2LXJ A;  2AWO A;  3KF6 B;  3CCJ A;  4A3B G;  3K8A A;  4BBS G;  3M7N A;  4DV6 L;  1UEB A;  3LGJ A;  1QVC A;  3FKI H;  4OWT B;  1N36 L;  3PO3 G;  4A3G H;  2IY5 B;  1PH6 A;  5IY0 A;  2UUC Q;  4JOI C;  4A3J G;  1ASY A;  1IBL L;  1MJE A;  2CQO A;  2QA4 A;  1S40 A;  4L5T A;  4JI7 L;  4OO1 G;  4X66 L;  2OTJ A;  2AHO B;  5C0X I;  4K0K Q;  1IBK Q;  1PH8 A;  1E7Z A;  3HOY H;  3RZO H;  1VCI A;  4R4C A;  2LXK A;  3K80 C;  5IE8 A;  1UE7 A;  3U4Z A;  1Y1W G;  3JAM i;  1FGU A;  1I3Q H;  4R4I A;  3STB C;  4MZ9 A;  3M85 A;  1VQC A;  2I0Q A;  1VQA A;  4GNX B;  1EYG A;  1U0L A;  4GKK Q;  3ERS X;  2NVX H;  3D0F A;  3G6E A;  4KHP Q;  2UXC Q;  2ASB A;  1JJC B;  1VQB A;  1YHA A;  1XNQ Q;  3OTO L;  1CSP A;  1WYD A;  1FJG L;  4HIM A;  4JV5 L;  3CCQ A;  4JYA Q;  1YHB A;  4LWC A;  1HZ9 A;  3GTQ H;  3PF4 A;  1P16 A;  2WFW A;  4JI5 L;  2YU9 H;  2UXD Q;  3VDY A;  3ULJ A;  3S2D H;  3GTJ H;  1YBY A;  3KDF A;  2VS1 A;  1CUK A;  2IX1 A;  3PSI A;  1RL2 A;  4DV5 L;  2I5L X;  2Q2H A;  4DAM A;  1R9T H;  4LFB Q;  3E9H A;  1UE5 A;  1X56 A;  1QZH A;  2JA7 G;  4OX9 Q;  1N36 Q;  2F4V L;  3TQY A;  1Z47 A;  1X54 A;  1TWH H;  4DR4 Q;  4JBK A;  1XMQ Q;  3CME A;  3TS0 A;  1NBW A;  3G71 A;  1W3S A;  2UUA L;  2Z6K A;  5JJL A;  1WJJ A;  4JOI A;  4NXM Q;  3NEL A;  3I4M H;  2E5L Q;  3PO3 H;  1EQR A;  1QUQ B;  4YY3 L;  2JEA I;  1Y1W H;  2K14 A;  1X6O A;  4A3K G;  4DV7 Q;  1Q7Y C;  3HOV H;  4GLX A;  2OQK A;  1PH3 A;  4JI2 L;  2YYZ A;  1ASZ A;  3HOU H;  2LSS A;  2ZJQ A;  4R4O A;  2VQF L;  2N78 A;  4YY3 Q;  4B3M L;  4JC0 A;  4BA2 I;  1XPO A;  4YCW A;  1OXV A;  4POF A;  2JA8 H;  3RLO A;  3GTG H;  1NMF A;  3M4Q A;  1MJC A;  4LUO A;  4C2M H;  5GAG C;  4DR6 L;  3J81 c;  3AQQ A;  3CCS A;  1N34 Q;  1VQK A;  2PQA A;  4A3M G;  3CAM A;  5K36 G;  3H3V H;  4C3H H;  4DK3 C;  4DR5 L;  4JCV E;  4JBJ A;  5FLM H;  1VQD A;  1HZC A;  4A3F H;  1IBL Q;  1KAW A;  4DV0 L;  4HJ9 A;  4OX9 L;  3BZC A;  4UY8 C;  2XTI A;  4YHH Q;  1YZ6 A;  3STB D;  4DV3 L;  1AE3 A;  1G29 1;  4LF4 Q;  4AQY L;  1PV4 A;  4LF7 Q;  4LF6 L;  1PH9 A;  1JB7 A;  2MO0 A;  4GKJ Q;  4DK6 C;  3CCM A;  3T1Y L;  1IXR A;  2K52 A;  1K9M C;  1GKH A;  1G51 A;  2ZM6 L;  3IRB A;  1B8A A;  1I94 Q;  4X65 L;  1WCM G;  4NXM L;  4NXN Q;  3J7A 5;  2E5L L;  4O0A A;  4AYB G;  2VL6 A;  4LF4 L;  1VQ7 A;  1C9O A;  2K5V A;  1DGS A;  3E0E A;  4RG1 A;  1OXX K;  4LF8 L;  4DR1 L;  1V9P A;  5C0X J;  4MNO A;  4B3R Q;  5IYC H;  3CP0 A;  3TRE A;  2DUD A;  5IP7 G;  4DV1 Q;  1UE6 A;  1VQF A;  4X65 Q;  2VY3 A;  3PIO A;  2K4K A;  1JJ2 A;  3TS2 A;  1AH9 A;  1MIU A;  4P74 A;  5IP7 H;  1XPR A;  1L1O A;  4GOP A;  4A3K H;  3OW2 A;  1EFW A;  4LFB L;  2PQA B;  1S72 A;  3UDX A;  2B63 H;  4QL5 A;  1SE8 A;  1X55 A;  3M9B A;  5M3M G;  4LF5 Q;  3ZJY C;  2AMC B;  4AH6 A;  3A5U A;  3HOZ G;  4EQ5 A;  4B3S Q;  2R93 G;  3HOZ H;  4ME3 A;  5BR8 Q;  4YCU A;  4C3I H;  2HHH Q;  1N33 L;  2Y0S G;  1XNR L;  4A3C H;  4A3E G;  4GNX A;  1KC8 C;  3F2B A;  1PHJ A;  3CD6 A;  5JJI A;  3NEN A;  3CPW A;  5AJ3 Q;  2JA6 H;  4IJH A;  1HR0 Q;  3M3Y H;  4A3L G;  4GKJ L;  2JQO A;  1G6P A;  1Q82 C;  2IHF A;  2CWA A;  1HZA A;  1YNX A;  2E8G A;  2OQ0 A;  1I94 L;  1PH7 A;  3MXN B;  4A3M H;  1HJP A;  1K8A C;  2NVT H;  3W1G A;  2RHS B;  4DPG A;  2VUM H;  4X66 Q;  1B70 B;  1YVC A;  1HNX L;  1IL2 A;  1CKN B;  4ALP A;  3HOW H;  4WJ3 M;  1HNZ L;  2AKW B;  3NEM A;  1X3G A;  2JJQ A;  3TRZ A;  4P71 A;  3I7F A;  3U4V A;  1D8L A;  1WCM H;  1PYS B;  3EIV A;  4DV2 L;  2B3G A;  1XMQ L;  3H0G G;  1CKM A;  1AE2 A;  1VQH A;  2OCE A;  3G48 A;  5C44 H;  3CCU A;  4LFC Q;  3AEV A;  4PZ7 A;  3S1Q H;  4DR6 Q;  4PZ8 A;  1HNZ Q;  4IPH A;  3OTO Q;  1PVO A;  2MFI A;  4PG3 A;  2IT1 A;  4DKA C;  2HT1 A;  4DV6 Q;  2ALY B;  2ATW A;  5C3E H;  3HOY G;  2ZTE A;  4QGU A;  2UXD L;  2E2I H;  1PYB A;  1C7Y A;  4A3E H;  3CC4 A;  1QUQ A;  4JI6 L;  4JI3 L;  1J5E Q;  1EWI A;  3TEH B;  2UU9 Q;  2VNU D;  1KD1 C;  1IZ6 A;  3GO5 A;  1N9W A;  1UWV A;  2YTV A;  3S2H H;  1HNW L;  1VQJ A;  4J15 A;  1NE3 A;  3HOX H;  3F2C A;  4NXN L;  1EQQ A;  2B63 G;  4A3B H;  2YTY A;  1CKN A;  4KI0 A;  2JA5 H;  3KJP A;  1Q86 C;  3CXC A;  4A3D H;  3JC6 6;  2NZH A;  1GO3 E;  1XMO L;  2IX0 A;  2R7Z H;  2EQS A;  1NY4 A;  4DR5 Q;  4GN4 B;  2Z0S A;  2RCN A;  4Y52 H;  1VQ5 A;  1SMX A;  3BU2 A;  3PV0 A;  4UP7 A;  2CFM A;  1KL9 A;  4C3J H;  1N8R C;  3HKZ G;  1T9H A;  1EIF A;  4JI2 Q;  4DNI A;  1KHI A;  3HKS A;  4FDB A;  2VQF Q;  1LTL A;  5IP9 G;  1VQ4 A;  3NBH B;  5LMN L;  4B3M Q;  2HIX A;  4MTN A;  3PO2 H;  4LF9 Q;  1I6H H;  3H15 A;  1K0R A;  1Q12 A;  1EOV A;  3E9I A;  3PCO B;  4IPC A;  2JEB I;  5IWA Q;  1K3R A;  4IJL A;  2F52 A;  3KLW A;  1BKB A;  1VQI A;  3K0X A;  1J5E L;  5AJ3 L;  1S3O A;  2UU9 L;  2Q2U A;  4BY7 G;  3J80 c;  3PUW A;  5HY6 A;  2BH8 A;  4OO1 I;  1YEZ A;  1HNW Q;  4LW1 A;  4OXP A;  1D7Q A;  3KDF B;  3B6Y A;  5GAD C;  1TWF H;  5IYD H;  1EIY B;  3J81 i;  3MEF A;  4YCV A;  4YHH L;  1W2B A;  2Z6K C;  4DV3 Q;  4A3G G;  4UP8 A;  2AWN A;  5FLX c;  1E1O A;  1YJ9 A;  3A0J A;  2C35 B;  2CKZ B;  4LFA Q;  4PMW A;  2UUC L;  1CKO A;  5C4J H;  1I5F A;  4BXX H;  3DM3 A;  4JYA L;  2R92 G;  2Y0S E;  5FLM G;  4A4I A;  3S14 H;  2JE6 I;  3CCL A;  1WFQ A;  1VS0 A;  2JA9 A;  3KYH C;  1UE1 A;  2QEX A;  4A93 G;  4HJ8 A;  2BA0 A;  2OWO A;  2UXB L;  5DLQ E;  2MNA A;  1QVG A;  1LM0 A;  2UUB Q;  4AYB E;  3RN2 A;  2VQE Q;  3UDG A;  3S1M H;  2GVB A;  5GRO A;  1VQM A;  3F1Z A;  1SRU A;  4PZ6 A;  2GN5 A;  3I2Z A;  3RLF A;  3EN2 A;  2ZTD A;  3UE0 A;  2I5M X;  3T1H Q;  3CCV A;  1PH1 A;  4LF7 L;  2VUM G;  3S15 H;  1HH2 P;  1EUJ A;  4DR3 Q;  2NN6 G;  1IBM Q;  3RLN A;  3KOJ A;  3HKZ E;  4B3S L;  1VQO A;  2EXD A;  5BR8 L;  1VQN A;  1Q46 A;  1XNR Q;  1XPU A;  1X9N A;  2PNH A;  4GN5 A;  3GTP H;  5H1S E;  2MO1 A;  3L0O A;  3S1N H;  3GD7 A;  1XMO Q;  1OXS C;  3Q8D A;  1SLJ A;  3FHW A;  1KRS A;  3CCR A;  2WB1 E;  1IBM L;  1XJV A;  4A75 A;  3BJU A;  4GS3 A;  1Y14 B;  5GAH C;  4DV1 L;  1V1Q A;  1VQG A;  4DR2 L;  3ULP A;  4DV4 L;  5LMU L;  1KQS A;  1YI2 A;  1TWC H;  2L15 A;  1L1O C;  5J3B A;  4GOP C;  3SGI A;  5IYB G;  3G4S A;  1OTC A;  2JA7 H;  4GKK L;  4QY7 A;  4DR7 Q;  1XNQ L;  2VZA A;  1FJG Q;  3S16 H;  3PUX A;  4P73 A;  4R1J A;  1BBU A;  3M4P A;  5IYB H;  4LF9 L;  3M4O H;  2N8N A;  3H0G H;  1TWA H;  1J6Q A;  3K7A H;  5M3F H;  5IYC G;  5JJK A;  4LF6 Q;  4AIM A;  3RNU A;  1N33 Q;  4RMF A;  5C4X H;  1A63 A;  4DV7 L;  4JI7 Q;  2BH2 A;  5C4X G;  4NB3 A;  2ZM6 Q;  2B29 A;  1L1O B;  4BBR G;  4GOP B;  1IBK L;  4IFD G;  4Y7N H;  4JI0 L;  3GTO H;  4BBS H;  1PA6 A;  4A93 H;  2A19 A;  4YWK A;  4JI4 L;  2V1C C;  2E2J H;  2ZTC A;  4HIO A;  3ER0 A;  3RZD H;  4QIW E;  1SRO A;  1YJW A;  1V43 A;  1P8L A;  1HZB A;  2K75 A;  2K5H A;  4GLV B;  1A62 A;  5FJ8 G;  2UXC L;  1Q1B A;  1CSQ A;  1XTD A;  4A3C G;  4JG2 A;  5IT9 c;  4BA1 I;  3CQZ H;  4BBR H;  4IFD I;  1VQ9 A;  2F3I A;  3I4N G;  2D0P A;  3UDF A;  5M5Y H;  3PUY A;  1Q81 C;  4X62 L;  4DUY L;  4TVA B;  4HIK A;  1PH2 A;  3KFU A;  5M3F G;  1GVP A;  4BXX G;  3D31 A;  2HHH L;  3UDI A;  1B7Y B;  1Y1V H;  2NVY H;  3RN5 A;  2OTL A;  4JI6 Q;  2R7D A;  3A5Z B;  3L2P A;  4JI3 Q;  1I50 H;  2UUA Q;  1RIP A;  4JI1 Q;  2PI2 A;  3PUZ A;  1O7I A;  1Q8K A;  1VQL A;  1X3F A;  1X3E A;  4DUZ Q;  4GNX C;  1GD7 A;  1NJI C;  1X65 A;  2Q2T A;  4LFA L;  2R7F A;  5ELN A;  2WAQ E;  3DLL A;  2K5N A;  1NTG A;  1VQ8 A;  4JI4 Q;  4IOA A;  4R4T A;  4POG A;  4JI1 L;  1KXL A;  3I4O A;  2KCM A;  3AFQ A;  2D62 A;  3PIP A;  5FJ8 H;  1JMC A;  4LUZ A;  4H02 A;  5C3E G;  4JI5 Q;  1GM5 A;  2HQL A;  4X64 Q;  2VQE L;  3PUV A;  3PO2 G;  4KHZ A;  4O2D A;  1L0W A;  2N3S A;  4A3I G;  2NN6 I;  4DR1 Q;  4DR7 L;  5M5W H;  4TQU S;  4A3J H;  2KCT A;  5JEA J;  2DGY A;  1LUZ A;  4YWM A;  1HR0 L;  1YIT A;  4X64 L;  5LMN W;  2JK8 A;  2ES2 A;  4NPS A;  3F8T A;  5IYD G;  3HOW G;  4XIG S;  1VQE A;  3KF6 A;  4UPA A;  4BY1 H;  1SR3 A;  4IFD J;  1L2F A;  3S24 A;  1YJN A;  3W1B A;  3GTL H;  2WP8 J;  1TXY A;  3J80 i;  2WB1 G;  4JI0 Q;  2H5X A;  4A3I H;  1IYJ B;  4DUZ L;  2PMZ E;  1E3P A;  4A3L H;  3K7U C;  3S1R H;  2E2H H;  2I5H A;  1JE5 A;  3OYY A;  1FVI A;  3T1H L;  3I4M G;  1PH4 A;  4B3R L;  4IO9 A;  4HJ5 A;  1YIJ A;  4DV5 Q;  1PFS A;  1SFO H;  3UE1 A;  2CWP A;  3AYH B;  3J81 j;  2KHJ A;  1HR0 W;  2ID0 A;  2FXQ A;  1BVS A;  2N49 A;  3FKI G;  4DAY B;  2QGQ A;  2ZJP A;  3CC7 A;  1VQP A;  3WWV A;  1SN8 A;  3CCE A;  4GLA C;  4P72 A;  3CC2 A;  1Z9F A;  3JAM c;  2VW9 A;  4IOC A;  4BY7 H;  1A8V A;  5E7N A;  1E1T A;  4X6A H;  5LMN Q;  3BZK A;  4OWX B;  2JA5 G;  4B3T Q;  1YHQ A;  4YWL A;  4EX5 A;  4DV0 Q;  4IPG A;  4L5Q A;  4QQB X;  4UP9 A;  3CMA A;  4DV2 Q;  5LMU Q;  4BY1 G;  1KIX A;  5EAY A;  4LFC L;  3U58 A;  4AQY Q;  5IP9 H;  1NMG A;  1K8G A;  2WAQ G;  4APV A;  1PH5 A;  4R4Q A;  3I4N H;  4B3T L;  2A8V A;  3L7Z C;  5M3M H;  4IPD A;  3KF8 B;  1VQ6 A;  2KBN A;  2YV5 A;  3RR5 A;  4DR4 L;  1MKH A;  3HFZ B;  4WJ4 A;  3W5O A;  4LF8 Q;  2R92 H;  2MQH A;  2NZO A;  3U50 C;  4HID A;  3CPF A;  3EBE A;  4JBW A;  1M1K C;  2JA6 G;  4JI8 Q;  2KHI A;  4HJA A;  2IHE A;  4LUV A;  4KHP L;  3GTK H;  1N32 Q;  2NVQ H;  4X62 Q;  4DUY Q;  4JV5 Q;  1A0I A;  1TWG H;  1WI5 A;  1LYL A;  4P75 A;  2A1A A;  3S17 H;  5ELO A;  1WOC A;  2HIV A;  3HOX G;  5HGQ A;  4DV4 Q;  3GDE A;  5IWA L;  4GN3 B;  1OXU A;  1E22 A;  4JBM A;  3J7Z C;  1KRT A;  4LF5 L;  2JA8 G;  1N32 L;  1OXT A;  2D0O A;  3CW2 C;  2ZJR A;  3GTM H;  2YTX A;  1U5K A;  3F2D A;  1JJG A;  2Q2I A;  4OON A;  2F4V Q;  3I55 A;  2KEN A;  3FP9 A;  3HOU G;  3K81 C;  1C0A A;  2RHQ B;  4K0K L;  5M5X H;  2XGT A;  1N34 L;  4DR3 L;  4L5S A;  1BBW A;  1K83 H;  2BA1 A;  3ULL A;  5C44 G;  4HJ7 A;  1E24 A;  2R93 H;  3ICE A;  4XTC S;  3AFP A;  5GQO A;  3A74 A;  2K50 A;  3PF5 A;  4QJF A;  1K73 C;  2EIF A;  1HNX Q;  1QVF A;  4L5R C;  2RF4 A;  5GAE C;  3CF5 A;  3T1Y Q;  4A76 A;  1M90 C;  4OWW B;  4KLK A;  1QZG A;  2R7Z G;  4JI8 L;  2UXB Q;  2GVA A;  4DR2 Q;  1FL0 A;  2PI2 E;  3PGZ A;  2CCZ A;  2UUB L;  1Y1V G;  4LNQ A;  1H95 A;  5JEA G;  5C0X G;  3H3V I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...