2NVYH

Rna polymerase ii form ii in 150 mm mn+2
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2nvyH00
4X64L 2PNHA 4DV5Q 1WCMH 2VY3A 3AYHB 5FJ8H 4JBMA 3J80c 4A3KG 2R92G 1RL2A 2KHJA 3J80i 4BA1I 2QA4A 4LNQA 1A0IA 1TWCH 4GN5A 5FLMH 4DR2L 1CSQA 1DGSA 4QJFA 3CCRA 1VQDA 4HJ5A 3CF5A 4GNXA 4A3FG 4A3MG 4DV2Q 1BKBA 2BH8A 1QZHA 4LFCQ 3HOYH 2JJQA 1R9TH 4GS3A 1GVPA 5IP9G 4DR4Q 5M5YH 2UUCQ 1P8LA 4JG2A 4O0AA 3VDYA 3DM3A 1W2BA 3K7AH 3IRBA 5LMUL 1VQ7A 1VQGA 4GOPC 4GLVB 4LF7L 2Y0SG 1Y1VG 4R4OA 1QZGA 2ZJQA 3W1GA 1WCMG 1C9OA 1J6QA 1V43A 4UY8C 4PZ7A 3HOVG 4R1JA 1VQCA 2F52A 3PIOA 4R4IA 3KJPA 3UDXA 3PUZA 3S1RH 3L0OA 2WP8J 1KQSA 3PV0A 1HR0Q 4JI4Q 4A3LG 3A74A 3CMAA 2CKZB 1LUZA 1BBWA 3CP0A 3PUWA 1VQFA 4MZ9A 4X62L 3CCSA 2UXCQ 1NE3A 5IP9H 3U58A 3GTLH 1CKMA 3PGZA 2F4VL 3GTMH 4GN4B 5HGQA 1JT8A 4BY7G 2NVYH 4C3IH 4JC0A 4B3TL 2DUDA 1J5EQ 4JCVE 1CSPA 1VS0A 3ER0A 4BXXG 1K3RA 2Q2HA 1G291 3U4VA 5IT9c 4UP7A 2VL6A 4GKJQ 1Q12A 2YTVA 1X56A 4P72A 3GTOH 3M85A 1VQ9A 4POGA 1H95A 4OX9L 1XMQQ 4NXML 3F2DA 1HNZL 3FKIG 4A3EG 2UXBQ 3HKSA 4ME3A 4OO1I 1LYLA 3UE1A 1GM5A 4JI5Q 3UDFA 4IJHA 4X66Q 3I2ZA 3OTOQ 1PH4A 4DR5L 2YV5A 4JI7L 4OONA 2Q2TA 2LXJA 2VZAA 1PH7A 2OTLA 4MNOA 4JI1L 1SMXA 1YHBA 3HFZB 4JI6Q 2NZOA 3RZOH 4JI8L 1IBLL 1KRSA 3GDEA 5J3BA 3ZJYC 4DAMA 4LF4Q 1SE8A 4A3BG 3CW2C 1N33L 4A3JH 1Y1WG 5IYCG 4IPHA 1IBKQ 1EYGA 1Q46A 1CKNB 3D0FA 1YJNA 3I56A 3CQZH 1PFSA 3K7UC 1Q86C 1N34Q 2D0PA 4HJAA 1VQ8A 2R7FA 2UXDL 2UUBL 3HOUG 3H0GG 1M90C 1YVCA 2B29A 1YHAA 4O2DA 2HHHQ 3M4QA 3HOXH 1RIPA 1ASZA 4LF5Q 2IY5B 3PF5A 4UP9A 2R7ZH 4A3BH 5C0XG 1XMOQ 3ICEA 5M3MH 1N8RC 2ATWA 1N36L 1FGUA 1YHQA 1BBUA 4HJ9A 4WJ4A 4MTNA 3MEFA 5FJ8G 3CXCA 1ASYA 4LFBL 4DUYQ 4R4TA 2AHOB 1EFWA 1YZ6A 4YCVA 4AH6A 4R4CA 4BY1G 1UWVA 4OXPA 1PH5A 1HR0W 4LF6Q 4IFDG 1NMFA 4JOIA 4IFDI 4B3MQ 3CC2A 1PV4A 2JA8G 3A0JA 3KLWA 3M4OH 4GNXC 3I4MG 5IE8A 3CCUA 5JEAG 1NJIC 2ZJRA 2LXKA 2EXDA 2N3SA 2PI2A 1HJPA 3PO3G 5C4XG 3KF8B 4PMWA 1OXTA 1VQBA 4LF8L 3FHWA 1VQ5A 1NMGA 3H3VH 4UP8A 4UPAA 4DV3Q 4A3CG 4HIKA 2YU9H 1VQJA 1KAWA 1IL2A 4JV5L 3HOVH 3E9HA 4DNIA 2PMZE 4YCWA 1P16A 5C3EG 1YJWA 2H5XA 5JJIA 4X65Q 3L2PA 2KBNA 3LGJA 1HNWL 4GKKL 5LMNL 1VCIA 1N32Q 3M4PA 2EIFA 1KRTA 1JJCB 1Q82C 1Z47A 3GO5A 3GTGH 4YHHL 1PYBA 4NXNL 2QGQA 2I5MX 2K50A 4HJ8A 2KHIA 2MO1A 3T1HQ 1NY4A 4DV5L 1U5KA 1VQAA 1IBMQ 3KDFA 3UDGA 1MJCA 1MJEA 2WAQE 2ZM6Q 4A3IG 2VW9A 1WFQA 5FLMG 1C7YA 2UU9L 1WOCA 2IHFA 2WB1E 4DR2Q 4DV6Q 2E5LL 3JAMc 4JI3L 2VUMH 2UUAQ 3H15A 2CQOA 4DV2L 4LFCL 1YJ9A 1Z9FA 1V9PA 1A8VA 4B3RL 3CPFA 4L5TA 2ES2A 1AE2A 1N32L 2UUCL 3PUVA 3KF6B 5FLXc 1XPUA 5ELNA 3U4ZA 2JA5G 3F1ZA 1GO3E 1D7QA 4TVAB 5ELOA 1S40A 2E2JH 3J7ZC 1YITA 3I7FA 2RHSB 3STBD 2NZHA 1M1KC 1K83H 3I55A 1PA6A 1JB7A 2JA7H 4YWKA 2VUMG 4BBRG 3NBHB 1FL0A 4KHPL 4TQUS 4A4IA 1XNQL 3EIVA 3M7NA 4A3DG 4PZ6A 2K52A 3K81C 4QIWE 3A5ZB 1E7ZA 2QEXA 4AQYL 1NBWA 4DUZQ 3H3VI 3S15H 2B63H 2JA9A 2GN5A 2N8NA 3NELA 1TWHH 2CWAA 3BZCA 4IJLA 4FDBA 4L5RC 1I94L 3FP9A 4QQBX 3M3YH 5AJ3L 2VQEQ 4LW1A 2BA1A 4X62Q 4OWWB 1XNRQ 2UXCL 3KYHC 5M5WH 4DV4L 1QVGA 4JI2L 4DK3C 4A3DH 3T1YQ 3Q8DA 1VQ6A 5K36G 4DV0L 4LFAL 1KL9A 4DR6L 4DR7L 2IT1A 4IFDJ 4XIGS 3K8AA 3OYYA 2B63G 2CFMA 2OWOA 1EOVA 1X3FA 1XTDA 1J5EL 5H1SE 1SRUA 4B3TQ 3J81c 5IWAL 4P74A 5BR8Q 1EWIA 4C3HH 2JEAI 1K73C 1I50H 2LSSA 4GKJL 4IO9A 4GLAC 3AFQA 1GD7A 3PO2H 4YY3L 4OX9Q 1XMQL 1CKOA 4JBWA 3GD7A 1VQIA 3UDIA 3RNUA 2I0QA 2KCTA 5GAGC 4X66L 3DLLA 2JE6I 2ZTEA 3OTOL 1OXSC 4LUOA 4LF9Q 2RHQB 4IPGA 1EQQA 1E22A 1O7IA 4J15A 3AEVA 3GTQH 2OQKA 4JI1Q 1A62A 1PH2A 2Q2IA 4IPDA 4JI6L 1VQNA 3HOZH 1A63A 1SLJA 4KI0A 3S24A 2R7DA 1HR0L 1EQRA 1X54A 4AYBE 3RR5A 5LMNW 1YIJA 5JJKA 4PG3A 1Q7YC 2I5HA 2HIVA 1XPOA 5HY6A 1L1OA 3G6EA 1N34L 4NB3A 1KD1C 1I6HH 4JI0L 2JA6H 3H0GH 1E24A 1S3OA 3JC66 1L1OC 1Y14B 3PIPA 2F4VQ 1AE3A 4OWTB 1B7YB 5IYBG 4B3SL 2DGYA 2ZTCA 3I4NH 1N9WA 1X65A 1X9NA 4XTCS 1QVFA 5IYDH 5M3FG 2GVBA 1XJVA 1Q1EA 3J81j 4RMFA 3AFPA 1L2FA 4DR1L 1CKNA 1YEZA 2AWNA 2D62A 1HZAA 1WJJA 2BH2A 1EIFA 1PH3A 4LFBQ 2OTJA 3TRZA 4NXMQ 3RLOA 2NVQH 1IXRA 3B6YA 2PQAA 4JYAQ 2K4KA 2MFIA 5IP7G 4LUZA 1HNXQ 5IYDG 3CD6A 2HQLA 4R4QA 3CPWA 3E9IA 4DR5Q 2IX1A 1X6OA 3W5OA 1K8GA 2VS1A 4RG1A 3ULJA 4JI7Q 2NVTH 3S16H 4IOAA 2JA8H 5GROA 1PYSB 4IOCA 2JA7G 4LWCA 1FJGL 4AYBG 4DR3Q 2I5LX 3CCQA 2Y0SE 2E2HH 1PH9A 3BJUA 5M3FH 1KC8C 3KFUA 4WJ3M 1QVCA 4A3FH 2AWOA 4A3MH 4LF8Q 1LTLA 4DV7L 1SN8A 2VQFQ 3CCMA 1KIXA 3ULLA 4EX5A 2Z6KA 4QY7A 3S1NH 4EQ5A 1VQMA 4BY7H 3FKIH 4A3EH 4LF5L 2WAQG 3S2DH 1HZBA 3RLFA 5IP7H 5GAEC 4HIMA 4DPGA 4X65L 3F2CA 1XMOL 3RN2A 1VQLA 4YCUA 2ZJPA 1Y1VH 3HOYG 3K80C 4GNXB 4IPCA 1PH8A 1JE5A 2MQHA 4P73A 3GTPH 1I5FA 1AH9A 4DV1L 4NPSA 1SROA 3STBC 4HJ7A 4NXNQ 2K14A 2E8GA 3S1MH 1K9MC 1HH2P 3CCJA 4K0KL 2ALYB 1B70B 1U0LA 1VQ4A 3I4MH 3HOWH 4L5SA 3JAMi 3TREA 3I4NG 4QL5A 1LM0A 2A1AA 2L15A 4X64Q 5JEAJ 2UU9Q 3W1BA 2AMCB 4DV6L 1X3GA 3ERSX 3SGIA 3PO2G 3S2HH 3A5UA 1Q1BA 4B3RQ 4HIOA 1WYDA 2F3IA 2JQOA 2K5NA 3HKZE 4LUVA 3K0XA 3WWVA 3S17H 3I4OA 5M3MG 1VQKA 3GTKH 5GADC 3RN5A 3PUXA 4BBSH 3GTJH 4X6AH 4JOIC 4DR4L 4JI4L 1VQEA 2CCZA 3U50C 5C3EH 1HNZQ 3E0EA 2UXBL 4Y7NH 5LMUQ 4ALPA 2B3GA 3UE0A 2KENA 3KOJA 4LF7Q 2N49A 3CC4A 4AQYQ 2KCMA 4DUZL 1UEBA 2E2IH 4P71A 1NTGA 5GAHC 2V1CC 4GOPB 5DLQE 1UE5A 1K8AC 4YHHQ 4GLXA 1PH1A 2IX0A 2JA6G 1I94Q 2ZTDA 5AJ3Q 2VQEL 4A3CH 1YNXA 2YTYA 4HIDA 1Q81C 4L5QA 1IBML 5C0XI 3G4SA 1GKHA 1N33Q 1IBKL 2ID0A 1UE7A 2ZM6L 1YI2A 1TWGH 5C4XH 1Y1WH 1OTCA 1EIYB 3PO3H 3TEHB 4DR6Q 4DR7Q 1VQHA 2R6GA 3BZKA 2JK8A 2R93G 2C35B 2E5LQ 2UUBQ 2UUAL 2HHHL 1X3EA 2D0OA 3HOXG 3HOWG 1TXYA 3PCOB 1L0WA 5JJLA 1PHJA 1PVOA 5IYCH 4BA2I 1OXXK 3CCVA 1G6PA 2N78A 2PQAB 1TWFH 3RZDH 2GVAA 1JJ2A 2NN6G 2Z6KC 4H02A 3BU2A 1SFOH 2R93H 4DK6C 2WFWA 5E7NA 5C0XJ 2WB1G 2NVXH 1X55A 3OW2A 1WI5A 1MKHA 2FXQA 1UE6A 4DUYL 4KHPQ 4P75A 4A93H 2CWPA 2XTIA 4A76A 4JI5L 1PH6A 1EUJA 4BY1H 4QGUA 3D31A 5GQOA 1HZ9A 1QUQB 3J7A5 1SR3A 4APVA 1S72A 2HT1A 4BBSG 4B3ML 3S1QH 3G71A 1Q8KA 4JI8Q 1L1OB 1IBLQ 4LF4L 1XNRL 1E3PA 4JI2Q 4DV4Q 1KXLA 4GN3B 4KHZA 4GOPA 5C44H 3T1YL 4DV0Q 1E1OA 1V1QA 4LFAQ 2IHEA 5IYBH 3HKZG 3CCEA 1D8LA 2OQ0A 3KJOA 4B3SQ 2XGTA 4YWMA 3RLNA 2RCNA 4JBKA 2OCEA 2UXDQ 3F2BA 3EN2A 2EQSA 3TS2A 2VNUD 5IWAQ 2A19A 5IY0A 5BR8L 4C3JH 4DKAC 3MXNB 3HOUH 2K75A 2PI2E 4A93G 3KDFB 3S14H 3CAMA 4OWXB 4KLKA 1JMCA 4YY3Q 4GKKQ 2JA5H 4A75A 2Q2UA 3EBEA 1TWAH 2A8VA 1UE1A 2RF4A 1OXVA 3CCLA 1JJGA 4JYAL 1G51A 2NN6I 1N36Q 4OO1G 4POFA 2BA0A 1HNXL 2YTXA 1VQPA 4LF9L 1QUQA 3T1HL 3NENA 4DAYB 3F8TA 1T9HA 3KF6A 4C2MH 5M5XH 1E1TA 2HIXA 5C44G 4Y52H 3TS0A 1B8AA 3HOZG 1MIUA 2AKWB 1VQOA 4A3IH 4DR3L 1IYJB 4LF6L 1FJGQ 1W3SA 2ASBA 3PF4A 1KHIA 4JI3Q 2K5HA 5EAYA 4DV7Q 2VQFL 4YWLA 4JI0Q 1YBYA 3AQQA 3J81i 1K0RA 2MO0A 3PSIA 4JBJA 4DV3L 4A3LH 4A3GH 4A3JG 1XPRA 4JV5Q 3CMEA 4PZ8A 4DR1Q 1FVIA 2JEBI 1XNQQ 1C0AA 3NEMA 1I3QH 4DV1Q 2YYZA 4A3KH 2R92H 1HNWQ 4K0KQ 1IZ6A 4AIMA 1OXUA 3M9BA 1BVSA 2MNAA 1CUKA 3L7ZC 2Z0SA 3PUYA 5LMNQ 3CC7A 3ULPA 3TQYA 1HZCA 2R7ZG 4A3GG 3G48A 2K5VA 4BXXH 4BBRH 5C4JH
chains in the Genus database with same CATH superfamily
4X64L 3R2IA 4FO2A 1O7YA 3J80c 1RL2A 1A0IA 1EQTA 3A8KE 2EJMA 2FMMA 2R92B 1SYDA 4ZLTF 4HJ5A 4GNXA 3HOYH 4ZCKA 1TWGB 1BF4A 1N32Q 1GVPA 2UUCQ 4O0AA 2MUYA 2JA8B 2K33A 4X3TA 1JOOA 5JAVA 4RCOA 4GLVB 1Y1VG 1IL8A 1LACA 1WCMG 4R1JA 1VQCA 3KJPA 3S1RH 4CKEA 4A3LG 2RVLA 4CBVA 4E6IA 4X62L 1VQFA 4HMJA 3U58A 3MC0B 3GTMH 2F4VL 4K8IA 2C5CA 3H3VC 4JCVE 4I7ZC 1VS0A 3ER0A 1K3RA 5F2DA 5EPKA 3QG1A 4OELB 3GTOH 1X56A 1H95A 4POGA 4FXGC 3UDFA 4X66Q 2KHSA 4JI7L 2Y0SB 1GUOA 2EPBA 2EJFC 1PH7A 2OTLA 1SMXA 1YHBA 4BY7B 2NZOA 2JN4A 4LF4Q 1TS4A 1SE8A 2L5TA 3K5LA 1Q46A 1CKNB 1EY0A 1JORA 4DFAA 3D3RA 4TSSA 3HOUG 2HHHQ 1TS3A 3M4QA 2K5QA 1ASZA 3NP8A 4JPBW 3ICEA 4ILWA 4R8NA 2NN6H 3DXJC 4A3JB 5L37A 1FGUA 4N8FA 4XQNA 3CKIB 4PNYA 1WCMB 2AHOB 1WTXA 2A6HC 4R4CA 1B53A 1UWVA 1HFNA 4IFDG 3RD4A 1NMFA 4L8JA 2JA8G 3HOYB 4GNXC 2SDFA 1KNAA 4DF7A 1OO9B 5EBCA 2ZJRA 2EXDA 2N3SA 5C4XG 3KF8B 1I4PA 4H13C 1Q3LA 3FHWA 3W3AA 1NMGA 4UPAA 2YU9H 1IL2A 1KAWA 2A6HD 4KJNA 4JV5L 4DNIA 1HCZA 3Q23A 3QOJA 4X65Q 2KBNA 3LGJA 3HG9A 1EY6A 2Z8LA 1UEAB 2PZTA 1PYBA 4YHHL 2MGSA 2O5JC 5DAUA 3M4YA 1SYEA 2KHIA 3W2DA 1X3PA 3T1HQ 1IBMQ 4DV5L 1U5KA 1ILPA 4C3IG 2ZM6Q 3DWQA 2VW9A 5FLMG 4FF3A 2PQEA 4H0LC 2WB1E 4DR2Q 3D4RA 1QB5D 1H9MA 3GV6A 3SDZA 3VR6A 2CQOA 1Z9FA 2A69C 1SE4A 4B3RL 1N32L 2R3ZA 3J81L 1TWHB 4I65A 4DA2A 3I70A 1XPUA 3GTLB 5ELNA 3U4ZA 1TS2A 2JA5G 3C1FA 3OMCA 1SYBA 5KIXA 3STBD 2NZHA 3I55A 4YWKA 3NBHB 1F77A 2IL8A 2K52A 3K81C 4QIWE 1E7ZA 1NBWA 5IGDA 4L6TB 3S15H 4HCEA 1B9MA 2GN5A 1I50B 4FDBA 5M9OA 4LW1A 4OWWB 1JCKB 3FPPA 4JI2L 4A3DH 1KABA 5CV9A 3CHBD 2JYOA 2L55A 4DR7L 4IFDJ 4XIGS 4IUNA 2CFMA 1RJTA 5IWAL 1VDZA 2B2YC 1WTOA 4RGTA 1I50H 1PFNA 4IO9A 1BUVT 3SEBA 3SK8A 1XMQL 5J22A 4JBWA 3NE5B 3K6OA 3DLLA 2JE6I 3MFGA 4LF9Q 3EJIA 1O7IA 4J15A 2KVMA 1RKNA 3AEVA 3GTQH 1QG7A 1A62A 4JI6L 4IPDA 3HOZH 2Z9HA 4FXKC 4Z9CB 4KD3A 1EQVA 4AYBE 5LMNW 1YIJA 5JJKA 1F2YA 1XPOA 1L1OA 3G6EA 1N34L 4ID6A 5DNFA 3JC66 1L1OC 4G57A 1Y14B 3T53B 4OWTB 2ZTCA 1X65A 4FF4A 4XTCS 1QVFA 2GVBA 3J81j 2IJ0A 1CKNA 1HZAA 2BH2A 3TRZA 3RLOA 4HR7B 2Z4HA 2PQAA 1HPCA 3CD6A 2Z1CA 1K8GA 3W5OA 3S16H 2VS1A 4JI7Q 4HTHA 2F0IA 1G91A 1NR2A 2JA8H 3LWUA 1CQFA 4IOCA 1ICWA 2JA7G 2B2TA 2E2HH 5IT9L 4G7HC 3BJUA 4X3SA 1STAA 1HTLD 4DV7L 2L9HA 2VQFQ 4K14A 2WACA 1Y8NB 2Z6KA 2AUJD 4DNTB 4U68A 4EQ5A 1JB3A 3FKIH 5EKLA 3DUZA 3RLFA 5IP7H 1PRTC 4YCUA 2ZJPA 5LHY1 2E2HB 3K80C 4HEDA 2MQHA 4O1NA 3GTPH 1I5FA 4DV1L 3I4LA 3BVGA 3PIP3 1K9MC 4K0KL 2ALYB 1U0LA 5A2QE 4A3DB 3TP5A 1CT1D 2NTSA 5JEAJ 1EOTA 1GUSA 2ENBA 3ERSX 3ND8A 3S2HH 5TSSA 3BG3A 3RUZA 4DK0A 4HIOA 2CH4A 2F3IA 1PRTF 2K5NA 1L0YB 3WWVA 3S17H 3OOCA 1I3QB 1EEID 4JOIC 5IGGA 1ENCA 5C3WA 4LF7Q 3CC4A 4AQYQ 1UEBA 5GAHC 2B8FA 2EOTA 2ICEC 1J9OA 4YHHQ 4GLXA 2FHTA 1EYAA 1TT2A 4RGNA 3S17B 4R8IA 1QOHA 2ZTDA 1TWCB 4A3CH 2A74C 4HIDA 1NNXA 2K32A 1N33Q 2XN9C 1Y1WH 1YI2A 1TWGH 2J0TD 3J81E 1VQHA 2R6GA 4OO1H 2C35B 5I9OA 2UUAL 3MXPA 1X3EA 2EYLA 3HOWG 1YNND 4ULLA 1GXDC 4IUTA 5IYCH 1OXXK 1SNQA 4ODGA 3CCVA 5CORA 1YNJC 1TWFH 2Z6KC 4H02A 1H9KA 3TDQA 3ERQA 1U4PA 3G6JB 4ZKBB 3S16B 1WI5A 4P75A 2WIIB 2CWPA 4Q0FA 1EUJA 4BY1H 3LNNA 3D31A 3I8ZA 5GQOA 3J7AF 1HZ9A 1QUQB 3C1EA 3T4AC 1SR3A 4APVA 1S72A 4BBSG 2SNSA 1WVLA 4RH6A 3EQLC 4JI8Q 1SBBB 5JEAH 1G2TA 3I73A 5KGUA 2PYKA 4GN3B 3T1YL 3S1NB 4DV0Q 3FKIB 5IYBH 3CCEA 5CV4A 4B3SQ 4YWMA 2RCNA 4JBKA 2UXDQ 4H7BA 1SMYC 3EN2A 2EQSA 2A19A 2PI2E 2DJFC 3VA7A 4QB4A 1JE4A 4P2CB 4JK1C 2I46A 1EY5A 1JJGA 2VUMB 2B2VC 2F03A 4K6LA 3C2PA 3KLSA 4OO1G 1QUQA 3A7LA 3T1HL 3CU7A 3F8TA 3OW7A 3KF6A 1ENFA 2K1BA 1IYUA 3HKZB 1LTBD 3N6RA 1VQOA 4CDCC 3H94A 1W3SA 2KUMA 3PF4A 4TKOB 2K5HA 5EAYA 1D5XC 2VQFL 2A69D 1NSNS 2F1MA 1PMRA 1STGA 3AQQA 2MO0A 5JPMC 1E2ZA 1GUGA 1SDFA 4JV5Q 3HP3A 4KHVA 2XWJB 4QUCA 2JEBI 1XNQQ 3NEMA 2YYZA 1MSGA 2LY7A 1HNWQ 2G5DA 1BVSA 1F9QA 3PUYA 2QW7A 2NB0A 1O80A 2Z0SA 3MZ5A 1HZCA 3CC7A 1BCPC 2R7ZG 1WD0A 1G6ZA 4BXXH 1LTRD 1R9TB 1TY0A 3J7AV 5C4JH 4DN4M 1LTID 3HGBA 1EY9A 2PNHA 3VA5A 2VY3A 3AYHB 5FJ8H 4A3KG 3J80i 2F0LA 4GN5A 2X6LA 4XQQA 1VQDA 5CR3A 4A3FG 2D2CC 2F0FA 3H6MA 1R9TH 4GS3A 3K58A 5M5YH 1P8LA 4JG2A 3DWAA 4XT1B 3DM3A 1W2BA 5LMUL 1PZJD 3NTIA 1VQ7A 1VQGA 4CKCA 3J80L 2K6AA 2O2LD 1Q90A 1FGBD 4R4OA 2ZJQA 2H4OA 4UY8C 3PIOA 4R4IA 2ICIA 3UDXA 1KQSA 2IWHA 3PV0A 3GTGB 2A68C 4ZYSA 5IGCA 2SEBD 1CKMA 4GN4B 4V0BA 4WFN3 2M00A 4JC0A 2DUDA 4M8AA 4TRDA 1J5EQ 3NK9A 3VYUA 2Q2HA 1G291 4UP7A 2VL6A 2RBMA 1Q12A 4P72A 3M85A 3Q0AA 1MBYA 4OX9L 1XMQQ 4NXML 1DOKA 5NUCA 1FYCA 2DNEA 4ME3A 2A73B 2PZWA 3UE1A 2WKCA 4R9WA 1GM5A 1C4QA 1LT6D 4IJHA 3S14B 2EYOA 1H9RA 3I2ZA 3OTOQ 5G3LD 4DR5L 1LO5D 2VZAA 4MNOA 1SEBD 1CHPD 3HFZB 5AFWA 4JI8L 3GDEA 3ZJYC 5C3EB 1S5DD 4QIWB 2QILA 3CW2C 1N33L 3DMUA 1Y1WG 5IYCG 1TIID 5G3LF 1IKMA 1Q86C 1VQ8A 4RKLA 4HJAA 1GJXA 2UXDL 3H0GG 1YVCA 2B29A 4O2DA 3MHBA 4LF5Q 5BN5A 1LV9A 2BCOA 4UP9A 5C0XG 1S5FD 5M3MH 1N8RC 2AQ2B 2F0NA 1ENAA 1BBUA 3MEFA 5FJ8G 3CXCA 2Z4IA 4LFBL 4R4TA 1EFWA 3BDOA 4YCVA 2B39A 3GV3A 1X3QA 4LF6Q 1T5EA 2HDMA 4B3MQ 5JJZA 1PV4A 2CQAA 2F0UA 3QR8A 3KLWA 3M4OH 5CV5A 3CCUA 4BBRB 2EYFA 4A93B 2EVBA 1HJPA 4WORA 3PO3G 4LF8L 1VQ5A 2L0CA 2HD3A 1U9RA 1F9RA 3OWFA 3HOVH 1W6JA 5C3EG 3L2PA 2E2DC 1HNWL 1F2ZA 5LMNL 1VCIA 2EIFA 1KRTA 1HXYD 1BCPD 3SXHA 2EXZA 1ET6A 4KK7A 4K8JA 2F0PA 4LK1C 1VQAA 2NZ1D 3KDFA 3HOVB 3UDGA 2MHVA 3A8IE 4XDXA 1WFQA 1C7YA 2IHFA 4C56C 1RHPA 1SNCA 1ZYRD 2L12A 3E3XA 1KNEA 3H15A 3BS1A 1WTVA 5DM73 3TZDA 1AE2A 5IT9E 5EGTA 2JSOA 1D7QA 1EEFD 1I4XA 4TVAB 5ELOA 3UI2A 1S40A 5IGBA 1YITA 3I7FA 4JI4Q 1M1KC 2VUMG 1MGSA 4BBRG 3NQTA 5BN4A 1FL0A 4RHRA 4TQUS 1SSOA 2XWBB 4PZ6A 1Z7TA 3A5ZB 2LKVA 4AQYL 4DUZQ 3H3VI 3GQBA 4RA8A 4B08A 2N8NA 2Q8RE 4KJOA 1QNUA 1I94L 4QQBX 3M3YH 5AJ3L 3QWNA 3KYHC 2UXCL 3Q8DA 5K36G 4DV0L 1D5MC 3HOXB 1MI2A 1EIGA 2OWOA 1X3FA 4B3TQ 1PFBA 3BZDB 3J81c 4P74A 4KKSA 4C3HH 2LSSA 4GKJL 4OX9Q 1WTWA 1VQIA 2F0JA 4I7AA 4X66L 2ZTEA 5ISRA 3OTOL 1CZWA 5DM63 3NSWA 1STHA 4M1UB 1JOQA 2JP1A 2OQKA 4JI1Q 4C3HB 1D6EC 2Q2IA 1STNA 4O42A 1HR0L 1EQRA 1KAAA 3X3MA 1J8IA 2EE1A 3RR5A 3WDNA 4QUFA 1Q7YC 2I5HA 5HY6A 4NB3A 2NVQB 3H0GH 1S3OA 1B7YB 4RWSC 2DGYA 1EFID 3OPOA 1X9NA 5M3FG 4HMIA 3AFPA 1MD2D 2BDNA 1L2FA 2EY2A 2AWNA 1BOSA 2D62A 3SE0A 4IQZA 3KK7A 1I6HB 1A3VA 1CZGA 4FF2A 4CDDC 4EGVA 5IYDG 4R4QA 3CPWA 1X6OA 2KCNA 3ULJA 4RG1A 2NVTH 4IOAA 4LMQD 3SHLA 4LWCA 1FJGL 4DR3Q 3H91A 3DHQA 5EKKA 2F0TA 4C3JB 3KFUA 3S1QB 4A3MH 2AWOA 1LTLA 1SN8A 3K5OA 1SE3A 3AMUA 3TMEA 3OIPA 2B2WA 4QY7A 2P5ZX 4BY7H 4A3EH 5C5LA 2D5DA 3KLRA 4X65L 2EYHA 1LTAD 3TSSA 3HOYG 1Y1VH 2E75C 2EYJA 1EZ8A 2K7VA 2DN8A 5CBEE 1SROA 2K14A 4HAEA 3VYTA 1B70B 1VQ4A 5ELFA 3I4MH 3A7AB 4L5SA 3JAMi 4NMZA 2NTTA 2O4XA 4UHVA 3W1BA 2G9HD 2B63B 4DV6L 3PO2G 1Y1VB 1PDQA 3S1MB 4A3IB 3BDLA 2B2VA 3HKZE 3WOFA 3K0XA 1M4VA 2KQ3A 3I4OA 1VQKA 3RN5A 4BBSH 3IAYA 1XYIA 4JI4L 4B9XA 2JA7B 2UXBL 5C4XB 1GUWA 2B3GA 4EQOA 4PMBA 2KENA 2E2IH 4P71A 1NTGA 2K04A 1PFMA 1C8CA 5AJ3Q 1YNXA 2YTYA 5A2QL 1IHZA 2XRSD 4FVMA 5C0XI 1JOKA 1LTSD 1QNKA 2ID0A 1EIYB 1OTCA 4DR6Q 4IFDH 3BZKA 3PQIA 2JK8A 2RSOA 2R93G 5M5YB 2UUBQ 2B2TC 3DWPA 4XQJA 3AB9A 5HURA 1UNSA 1V1PA 4KKTA 2K05A 2BE5C 1F9SA 3RZDH 1JJ2A 2KEDA 2NN6G 3A56A 3T56B 4DK6C 2OXPA 2WFWA 1MKHA 2FXQA 3K59A 1DOLA 5CV7A 1FD7D 4ZK9B 5CMDA 3K0YA 3ND9A 5FK9C 4B3ML 1SNDA 3D4WA 2X69A 4GZYC 3IL8A 4LF4L 4DV4Q 4FXDA 1KXLA 1R4QB 1XTCD 4GOPA 5C44H 2QKIC 5K5PA 1KDBA 4LFAQ 1A3UA 2OQ0A 3RMHA 3S9WA 2OEOA 2F3VA 2EY1A 3QIAA 2VNUD 4PV1C 4RFBA 5IY0A 3MXNB 3SK5A 1EZ6A 2K75A 3ONAB 3S14H 4OWXB 4XXEA 5D3IB 4KLKA 3I4MB 4L63B 1Y8OB 1Z6HA 3MEHA 3L9AX 5FLXL 4MIUA 1HNXL 1UAPA 2YTXA 1SJED 2ZT9C 4LF9L 2IW3A 5IGFA 5C44G 4WRDA 3TS0A 1B8AA 1MIUA 3CQZB 4J8QA 4DR3L 2ASBA 4JI3Q 3A8JE 2NBFA 4C3HG 1CI3M 1YBYA 1ZYRC 3FDTA 3SR1A 1ZKOA 4A3GH 4A3JG 2FJ2A 1XPRA 1FR3A 3TP8A 2E2IB 4PZ8A 4K2KA 4DR1Q 1C0AA 1I3QH 4BWGB 1Y8PB 4A3KH 4J6HA 1HQMC 1V1OA 3M9BA 2LS01 3ULPA 3TQYA 4A3GG 2K5VA 1I4HA 1II3A 1RODA 1NCVA 4DV5Q 1PLFA 1K8MA 1WCMH 4JW0A 1DD2A 2KHJA 4BA1I 4LNQA 4J1MA 1TWCH 2PCFB 1CSQA 2HDLA 1BR9A 2E74C 3CCRA 4A3KB 4A3MG 3KLSX 1BKBA 2EJGC 3LWEA 3I3CA 2JJQA 1DXMA 2RCFA 1BNZA 3DEPA 4CDEC 2K03A 3IRBA 4LF7L 2PO4A 1QZGA 3GTMB 2IX3A 3KBXA 1J6QA 1KLGD 2NVYB 2KOLA 4PZ7A 3HOVG 2F52A 3HEJA 3PUZA 1EWCA 2WP8J 4K6DA 1HR0Q 4F88A 5C44B 3CMAA 1LUZA 1BBWA 3CP0A 3CCSA 4BY1B 4MZ9A 4IALA 4C1NK 2KJXA 3PGZA 1PRTB 1CK1A 3VYSA 5HGQA 4F87A 1DZ1A 4BY7G 2NVYH 4C3IH 1AN8A 1DOMA 1K83B 4B3TL 1CSPA 3BDCA 3IFDA 2NVTB 5IT9c 1ZXTA 3WOEA 2PMZB 4GKJQ 2N55A 1U4MA 1VQ9A 1PTOC 5ELDA 1TVXA 5EBDA 4YIJA 4A3EG 3HKSA 3NXWA 4JI5Q 1PH4A 1G8ZD 3IFTA 4KV6A 4OONA 1LTTD 4JI1L 4JI6Q 4A3CG 3BVZA 1KRSA 4DAMA 2AQ3B 3GTOB 4A3BG 3VR2A 4A3JH 1IBKQ 4IPHA 1ICFB 1YJNA 2N88A 1PFSA 3K7UC 1SNPA 1LLRD 2R7FA 2M2LA 3TN2A 4JVZA 5I9PA 3C46A 2QDLA 2K5WA 2IY5B 2R7ZH 5EQ0A 4XYQA 1CM9A 2A6EC 4AYBB 5KEEA 1MSHA 2ATWA 1YHQA 5E4XA 1O78A 4HJ9A 1ASYA 4XYOA 1GUTA 4IURA 1CHQD 1KDCA 1YZ6A 1YNNC 2YU9B 1S4ZA 4OXPA 1PH5A 1HR0W 3OWEB 4JOIA 3CC2A 1LABA 1DJRD 1DYQA 1BQQT 5IE8A 1NJIC 3I4NB 3HOZB 1H9JA 2IPKD 2XIWA 3K57A 2RDFA 4DV3Q 4NP5A 3D4DA 2PMZE 4YCWA 1P16A 1PZKD 1YJWA 3NWSA 3V2TA 1SJHD 2I07B 2WKDA 4HSPA 3S1RB 4GKKL 5C4ZA 3M4PA 1LT3D 1GUNA 1JJCB 1Z47A 2KCCA 4HJ8A 2MO1A 2TSSA 1NY4A 5DEHA 1A2UA 2ZXRA 4DAPA 4N9TA 1SFOB 4C3IB 2AUKA 2L11A 1QJOA 1WOCA 1DM0B 4DV6Q 3JAMc 4JI3L 2B8GA 2VUMH 1YJ9A 2SOBA 4KTAA 1A8VA 2LFNA 3CPFA 1RD9D 2QF7A 2UUCL 3PUVA 3KF6B 5FLXc 4QF4A 5CYUA 1I4GA 5EJWA 3F1ZA 1GO3E 5FLXE 4A3FB 5J1ZA 1JT8A 3J7ZC 1KIXA 3MVVA 4HN7A 4DAYA 1PA6A 3KF8A 2HCIA 4KHPL 1R4PB 3EIVA 4A3DG 2F3WA 4KKUA 4DNRB 3SVMA 4CJ1B 2PZUA 2B63H 1HQRD 2JA9A 4HSVA 3NELA 3MAQA 1KDAA 1TWHH 3FP9A 1HRJA 3SK6A 2BA1A 3E0JA 4RGMA 4IUVA 1XNRQ 4RHSA 4DV4L 1QVGA 4DK3C 1EY4A 2F0HA 4LFAL 1KL9A 4DR6L 2IT1A 2B63G 3A55A 2B2UC 1J5EL 1SRUA 4X3UA 3GTQB 1B9NA 1EWIA 2JEAI 1K73C 5CGKA 1JWSD 3PO2H 1CKOA 3UDIA 4K5WA 3RNUA 1EYDA 2KCTA 1GHKA 4FYDA 1EIHA 4CHTB 4LUOA 1EQQA 1E22A 3MXNA 4DXGA 2EZVA 1TU2B 4HCSA 1PH2A 4EQPA 5KNDA 4KI0A 3S24A 4A3GB 2R7DA 5KRUA 1BBXC 4CJ0B 3VR5A 1YNJD 4PG3A 3T51B 3NBIA 5T1GA 1KD1C 2JA6H 2PNRC 3PIPA 2F4VQ 5C5MA 1Y1WB 1L0XB 1NAPA 5IYBG 4B3SL 4ZRZA 5IYDH 4WJWA 1Q1EA 4RMFA 1YEZA 1WJJA 1EIFA 1PH3A 4H44C 1SE2A 3TP7A 3A54A 1F2MA 3B6YA 3NHHA 1T5XD 2K4KA 5IP7G 4LUZA 3K5NA 3E9IA 1B4OA 1C48A 3J80E 4DR5Q 2IX1A 1CFMA 1TKWB 2F0GA 5GROA 1BXTA 3CCQA 1SAPA 1EU4A 5M3FH 4A3FH 2F0VA 4LF8Q 2RQXA 5CC4A 1BCPB 3CCMA 1D5ZC 4EX5A 1O7ZA 1LT5D 3S1NH 1VQMA 3RZOB 2XRQD 2F0KA 2WAQG 3S2DH 4HIMA 4DPGA 2BDOA 1EY7A 2EYPA 1A3TA 3RN2A 1XMOL 1K28A 2KECA 4GNXB 1CQVA 1JE5A 5M3FB 1AH9A 5IGEA 4NPSA 4HJ7A 4NXNQ 2E8GA 3CCJA 3C3LA 3MTSA 4MHEA 1B50A 2JA5B 3KUPA 3TREA 2WV6D 1LM0A 1HUNA 4A3BB 4ZQ3A 1VMCA 4X64Q 4EQNA 4QMGA 2AMCB 1BDOA 1RTOA 1AZPA 1X3GA 4KY5A 3SGIA 1U4LA 4OIKA 3A5UA 2VXWA 1Q1BA 3PO2B 2EDGA 5ELBA 3T13A 4LUVA 1MHWC 3HS0C 1WTQA 3GTKH 5GADC 4X6AH 1ONLA 2X6GA 1AFPA 5JVH3 5FO7B 1VQEA 2CCZA 3P20A 4LAAA 3E0EA 4ALPA 3PO3B 3SK4A 3QOLA 3QJYA 1WD1A 2N49A 4GOPB 1V8QA 2IX0A 2JA6G 3URYA 4RGOS 2VQEL 3MWYW 1Q81C 4L5QA 3FEWX 2R7ZB 3G4SA 1GKHA 1IBKL 3PO3H 3TEHB 2E5LQ 2HHHL 2HCCA 2WAQB 4XT3B 1TXYA 3PCOB 1G6PA 5JJLA 4BA2I 1AEXA 4EVOA 1AP0A 2GVAA 4OHJA 3BU2A 1V1PB 5E1FA 1JWUD 5J39A 1I4RA 1JQYD 1X55A 3OW2A 1STYA 3BYTB 4KHPQ 2F4IA 4A76A 4CJ2C 4CGYB 3J7A5 3G71A 1IBLQ 3OIQA 1E3PA 1K3BC 4KHZA 1V1QA 1D8LA 2TMPA 3J7YW 4NW2A 3F2BA 1Q8IA 2HQEA 5EPJA 4C3JH 2XSCA 3KDFB 3P1HA 4ZUIA 3H09A 1JMCA 4OIJA 2JA5H 1A6XA 4A75A 2Q2UA 5KYLA 1TWAH 2A8VA 1UE1A 3CCLA 1OXVA 4JYAL 1K0SA 3PMFA 1N36Q 4IUUA 5JPNC 4POFA 1VQPA 3NENA 1T9HA 5M5XH 3NTHA 4C2MH 1E1TA 1FJGQ 3GP7A 4LF6L 3V96A 3R3OA 4F8MA 1KHIA 1EYCA 1TQOA 3NWTA 1EY8A 3EVQA 2A68D 3JAME 1WTPA 4YWLA 1QILA 2NUCA 4CKBA 1HTPA 1K0RA 4BS9A 4C2MB 4IUQA 1D2BA 5FKAC 2ZXPA 3CMEA 3IKJA 3VR3A 2V4DA 1STBA 1FVIA 1I6VC 1KTKA 1PYWD 4KN4C 1B3QA 4N9PA 3O13A 2K28A 4K0KQ 1IZ6A 4AIMA 5E3FA 5LMNQ 4DU9A 2JA7H 3L7ZC 4Y7NB 1ESRA 2B2UA 1M8AA 1VF5C 5JVG3 4IZ8A 5A35A 4JBMA 5FOBB 2R92G 5K36H 2BE5D 5IODA 2QA4A 5FLMH 4DR2L 1DGSA 4QJFA 5HGTA 3I91A 1BO0A 3NUCA 3CF5A 1QZHA 4DV2Q 2BH8A 4LFCQ 4F7XA 2M9VA 1BCPF 4DR4Q 1QE6A 1XWEA 5IP9G 5FO9B 3X3NA 3VDYA 5C3XA 3MA2B 5E4WC 3K7AH 2EY6A 1ILQA 4GOPC 2Y0SG 1KLUD 1AZQA 3W1GA 3RZDB 1C9OA 1V43A 2Q8IB 5CV6A 3L0OA 2DNCA 3A74A 4B9WA 2CKZB 1IW7D 1SXTA 3PUWA 1H9SA 3EA6A 2UXCQ 1NE3A 5IP9H 3HRZC 4MN3A 3GTLH 1S5CD 1ESFA 4G7ZC 3HOWB 3D6WA 1S5BD 1B1ZA 5ELEA 4BXXG 1TWAB 2RSNA 3BVMA 3U4VA 3G7LA 4IN3A 2MJ8A 2YTVA 1DCZA 1LT4D 1QWYA 1G2SA 1AW7A 2F0QA 1HA5A 3F2DA 1HNZL 3NQIA 3FKIG 3HOUB 2UXBQ 2CHBD 4OO1I 4V190 1LYLA 2RKSA 3HZXA 2J4XA 5T1IA 3ZYYX 2YV5A 1SMYD 2Q2TA 4BBSB 2LXJA 1XX8A 1RTNA 5EPLA 1E2WA 1PRTD 3RZOH 1IBLL 3EFXD 5J3BA 3F2UA 4RKBA 1X32A 4Q5VA 1EYGA 3D0FA 3I56A 3CQZH 1N34Q 2D0PA 4ZUJA 2WINB 2F0MA 2UUBL 3PIO3 1M90C 1FNVA 1D1KA 1YHAA 3HOXH 1RIPA 3E6ZX 3PF5A 4A3BH 1XMOQ 2XVSA 4PQXA 1NUCA 3DEOA 1SYGA 2EY5A 1UUPA 1N36L 4KN7C 4WJ4A 5D3DA 1GOZA 4MTNA 4DUYQ 3Q24A 4AH6A 1E2VA 4BY1G 1JWMD 3GTKB 1F9PA 3OMGA 2K01A 2JA6B 4IFDI 5C6AA 1E0BA 4PMCA 5M3MB 5FO8B 3A0JA 3I4MG 2NVXB 5JEAG 5I4DA 2LXKA 4RCNA 2PI2A 3NBHA 3U9OA 3K7AB 4DGZA 4PMWA 1OXTA 1VQBA 3H3VH 4UP8A 1U4RA 2OT2A 4HIKA 1WTHA 1VQJA 4K5XA 3E9HA 4UAIA 1B44D 2F0EA 5LL6X 2H5XA 5JJIA 2VB3X 5ELCA 2L4NA 5D14A 1Q82C 3GTGH 3GO5A 1ET9A 3CRKC 4NXNL 2QGQA 1HFGA 2I5MX 2K50A 4DK1A 1TR5A 4N8X1 2QDBA 4ZKCB 1ZEQX 2CW0D 1MJCA 1MJEA 2WAQE 4A3IG 2UU9L 1CTMA 2E5LL 2UUAQ 4G4KA 4DV2L 4LFCL 4ABNA 3S2DB 1V9PA 2A5HA 2ES2A 4L5TA 5CBAE 4IUPA 4A3MB 3OSOA 1RF2D 2E2JH 5M5WB 2RHSB 1JB7A 1CA6A 1K83H 3LX0A 1B2TA 4A4IA 1XNQL 1ML0D 3M7NA 2NYZD 3EROA 4OEMB 3Q22A 1CA5A 2QEXA 3ITPA 1F2LA 2WB1B 2CWAA 3BZCA 1A2TA 4IJLA 4L5RC 5COYA 2VQEQ 5IIFA 4X62Q 1HUMA 5M5WH 4QCLA 3T1YQ 1VQ6A 3E5SA 2CH4W 3K8AA 3OYYA 1EOVA 1XTDA 3DM1A 5H1SE 4DAVA 4NKLA 3U9SA 5BR8Q 3KBGA 4GLAC 3AFQA 1GD7A 2B2YA 4YY3L 3JAML 2FINB 3GD7A 1PZID 2I0QA 5GAGC 2SNMA 3H0GB 1OXSC 2RHQB 4IPGA 4NDXA 3TZUA 2R61A 3FVQA 2VB2X 3VR4A 1VQNA 2DY7A 1A63A 1SLJA 3NTKA 1PXUA 2HUGA 1X54A 3FMCA 3N52A 5LL6S 2HIVA 1I6HH 2XNAC 4JI0L 1E24A 1SYFA 1TWFB 4OGQC 1AE3A 1HHVA 3I4NH 1FNUA 1N9WA 1SYCA 3K5MA 1A15A 5C4JB 1XJVA 2KEEA 4FF1A 4C3JG 4DR1L 4K2LA 1TY2A 4LFBQ 2BOSA 2OTJA 4NXMQ 2NVQH 5D65A 1IXRA 2EYMA 4JYAQ 2JXMB 1FNWA 1SNOA 2MFIA 1H9SB 1HNXQ 2GA4B 2HQLA 1B3AA 2K5DA 3R8BA 1PYSB 2A6ED 2CVRA 4AYBG 2I5LX 2Y0SE 1PH9A 2F0WA 1KC8C 3D8GA 4WJ3M 1QVCA 1S5ED 2E2JB 2ZXOA 3ULLA 4LF5L 3R2TA 2J7ZA 1HZBA 5GAEC 2KA7A 5C0XH 3F2CA 5KNCA 2C9OA 1VQLA 3R93A 4IPCA 1PH8A 2OF1A 5M5XB 4P73A 3STBC 3S1MH 1HH2P 1WTRA 3HOWH 4KD4A 2FFKB 3I4NG 4QL5A 2MP1A 4OL7A 4UDUC 2RDGA 2A1AA 2L15A 2UU9Q 3S15B 1DONA 2F0DA 4MTKA 4RAUC 3TP6A 2O5IC 4B3RQ 1WYDA 2JQOA 3QB3A 2DY8A 2CW0C 4KY7A 5M3MG 1EU3A 3PUXA 3GTJH 4DR4L 2PW5A 3U50C 5C3EH 1HNZQ 4ME5A 1HA6A 4Y7NH 2RDHA 5LMUQ 5CV8A 3UE0A 2DJGC 3KOJA 3AU7A 1NR4A 2KCMA 4DUZL 1EWHA 2V1CC 3MXGA 1UE5A 5DLQE 1K8AC 2PW7A 1PH1A 1I94Q 5BN3A 2F0SA 2D9UA 3I72A 3GTJB 1IBML 1PTOB 2R93B 2ZM6L 1UE7A 1IYVA 5C4XH 4DR7Q 5KNBA 1TS5A 3L3OC 3P75A 1RDPD 1D1IA 2D0OA 3HOXG 1O7LA 1L0WA 1PHJA 1PVOA 2N78A 2PQAB 5I2XA 2B2WC 3M7GA 1SFOH 2LMCB 1PTOH 2R93H 4U673 4G7OC 2QEJC 5E7NA 4X3KA 5C0XJ 2WB1G 1W6KA 2NVXH 3MFYA 1K8OA 1UE6A 4DUYL 1GHJA 4A93H 2XTIA 2NWGA 5JOBA 4JI5L 1I4QA 1PH6A 2G9DA 4QGUA 1RCVD 2F0OA 3MXUA 2HT1A 5IOCA 3S1QH 1Q8KA 1L1OB 1VF7A 2Z6BA 1XNRL 5C4HA 4K5VA 4JI2Q 5I2YA 3Q6SA 1LTGD 4CDFC 1E1OA 4A3EB 2IHEA 2QCPX 3HKZG 3KJOA 2XGTA 3QO2A 3RLNA 3BYYB 2OCEA 1PTOF 3TS2A 5IWAQ 3HOUH 5BR8L 3OHXC 4DKAC 4KY6A 4A93G 4C1NI 3CAMA 4ZAIA 3FRPB 4YY3Q 4GKKQ 5I6YA 3EBEA 2RF4A 4DXFA 2Q8TA 4FNFA 3VYRA 1G51A 1PTOD 2NN6I 4LJZC 2BA0A 1VMPA 1STEA 2H1EA 4DAYB 1EL0A 4KMUC 2HIXA 3CRLC 3GTPB 4Y52H 4FP5D 3I90A 3HOZG 2AKWB 1JICA 4A3IH 2AQ1B 1IYJB 2RA4A 1SNMA 3V05A 3NPPA 3TBIB 4S3SA 4DV7Q 1IW7C 1QCBD 4JI0Q 1IKLA 3S2HB 3J81i 3PSIA 4JBJA 5I6WA 2PPBC 3FPUB 2E76C 2FMCA 4DV3L 4A3LH 3T16A 3M3YB 3D6CA 1Y69U 4DV1Q 2R92H 1JC7A 1OXUA 2MNAA 1CUKA 3P7JA 5KYIA 1JR0D 5EKIA 1XXGA 2MPMA 3G48A 3M4OB 2L1BA 4BBRH
chains in the Genus database with same CATH topology
4X64L 2PNHA 4DV5Q 1WCMH 2VY3A 3AYHB 5FJ8H 4JBMA 3J80c 4A3KG 2R92G 1RL2A 2KHJA 3J80i 4BA1I 2QA4A 4LNQA 1A0IA 1TWCH 4GN5A 5FLMH 4DR2L 1CSQA 1DGSA 4QJFA 3CCRA 1VQDA 4HJ5A 3CF5A 4GNXA 4A3FG 4A3MG 4DV2Q 1BKBA 2BH8A 1QZHA 4LFCQ 3HOYH 2JJQA 1R9TH 4GS3A 1GVPA 5IP9G 4DR4Q 5M5YH 2UUCQ 1P8LA 4JG2A 4O0AA 3VDYA 3DM3A 1W2BA 3K7AH 3IRBA 5LMUL 1VQ7A 1VQGA 4GOPC 4GLVB 4LF7L 2Y0SG 1Y1VG 4R4OA 1QZGA 2ZJQA 3W1GA 1WCMG 1C9OA 1J6QA 1V43A 4UY8C 4PZ7A 3HOVG 4R1JA 1VQCA 2F52A 3PIOA 4R4IA 3KJPA 3UDXA 3PUZA 3S1RH 3L0OA 2WP8J 1KQSA 3PV0A 1HR0Q 4JI4Q 4A3LG 3A74A 3CMAA 2CKZB 1LUZA 1BBWA 3CP0A 3PUWA 1VQFA 4MZ9A 4X62L 3CCSA 2UXCQ 1NE3A 5IP9H 3U58A 3GTLH 1CKMA 3PGZA 2F4VL 3GTMH 4GN4B 5HGQA 1JT8A 4BY7G 2NVYH 4C3IH 4JC0A 4B3TL 2DUDA 1J5EQ 4JCVE 1CSPA 1VS0A 3ER0A 4BXXG 1K3RA 2Q2HA 1G291 3U4VA 5IT9c 4UP7A 2VL6A 4GKJQ 1Q12A 2YTVA 1X56A 4P72A 3GTOH 3M85A 1VQ9A 4POGA 1H95A 4OX9L 1XMQQ 4NXML 3F2DA 1HNZL 3FKIG 4A3EG 2UXBQ 3HKSA 4ME3A 4OO1I 1LYLA 3UE1A 1GM5A 4JI5Q 3UDFA 4IJHA 4X66Q 3I2ZA 3OTOQ 1PH4A 4DR5L 2YV5A 4JI7L 4OONA 2Q2TA 2LXJA 2VZAA 1PH7A 2OTLA 4MNOA 4JI1L 1SMXA 1YHBA 3HFZB 4JI6Q 2NZOA 3RZOH 4JI8L 1IBLL 1KRSA 3GDEA 5J3BA 3ZJYC 4DAMA 4LF4Q 1SE8A 4A3BG 3CW2C 1N33L 4A3JH 1Y1WG 5IYCG 4IPHA 1IBKQ 1EYGA 1Q46A 1CKNB 3D0FA 1YJNA 3I56A 3CQZH 1PFSA 3K7UC 1Q86C 1N34Q 2D0PA 4HJAA 1VQ8A 2R7FA 2UXDL 2UUBL 3HOUG 3H0GG 1M90C 1YVCA 2B29A 1YHAA 4O2DA 2HHHQ 3M4QA 3HOXH 1RIPA 1ASZA 4LF5Q 2IY5B 3PF5A 4UP9A 2R7ZH 4A3BH 5C0XG 1XMOQ 3ICEA 5M3MH 1N8RC 2ATWA 1N36L 1FGUA 1YHQA 1BBUA 4HJ9A 4WJ4A 4MTNA 3MEFA 5FJ8G 3CXCA 1ASYA 4LFBL 4DUYQ 4R4TA 2AHOB 1EFWA 1YZ6A 4YCVA 4AH6A 4R4CA 4BY1G 1UWVA 4OXPA 1PH5A 1HR0W 4LF6Q 4IFDG 1NMFA 4JOIA 4IFDI 4B3MQ 3CC2A 1PV4A 2JA8G 3A0JA 3KLWA 3M4OH 4GNXC 3I4MG 5IE8A 3CCUA 5JEAG 1NJIC 2ZJRA 2LXKA 2EXDA 2N3SA 2PI2A 1HJPA 3PO3G 5C4XG 3KF8B 4PMWA 1OXTA 1VQBA 4LF8L 3FHWA 1VQ5A 1NMGA 3H3VH 4UP8A 4UPAA 4DV3Q 4A3CG 4HIKA 2YU9H 1VQJA 1KAWA 1IL2A 4JV5L 3HOVH 3E9HA 4DNIA 2PMZE 4YCWA 1P16A 5C3EG 1YJWA 2H5XA 5JJIA 4X65Q 3L2PA 2KBNA 3LGJA 1HNWL 4GKKL 5LMNL 1VCIA 1N32Q 3M4PA 2EIFA 1KRTA 1JJCB 1Q82C 1Z47A 3GO5A 3GTGH 4YHHL 1PYBA 4NXNL 2QGQA 2I5MX 2K50A 4HJ8A 2KHIA 2MO1A 3T1HQ 1NY4A 4DV5L 1U5KA 1VQAA 1IBMQ 3KDFA 3UDGA 1MJCA 1MJEA 2WAQE 2ZM6Q 4A3IG 2VW9A 1WFQA 5FLMG 1C7YA 2UU9L 1WOCA 2IHFA 2WB1E 4DR2Q 4DV6Q 2E5LL 3JAMc 4JI3L 2VUMH 2UUAQ 3H15A 2CQOA 4DV2L 4LFCL 1YJ9A 1Z9FA 1V9PA 1A8VA 4B3RL 3CPFA 4L5TA 2ES2A 1AE2A 1N32L 2UUCL 3PUVA 3KF6B 5FLXc 1XPUA 5ELNA 3U4ZA 2JA5G 3F1ZA 1GO3E 1D7QA 4TVAB 5ELOA 1S40A 2E2JH 3J7ZC 1YITA 3I7FA 2RHSB 3STBD 2NZHA 1M1KC 1K83H 3I55A 1PA6A 1JB7A 2JA7H 4YWKA 2VUMG 4BBRG 3NBHB 1FL0A 4KHPL 4TQUS 4A4IA 1XNQL 3EIVA 3M7NA 4A3DG 4PZ6A 2K52A 3K81C 4QIWE 3A5ZB 1E7ZA 2QEXA 4AQYL 1NBWA 4DUZQ 3H3VI 3S15H 2B63H 2JA9A 2GN5A 2N8NA 3NELA 1TWHH 2CWAA 3BZCA 4IJLA 4FDBA 4L5RC 1I94L 3FP9A 4QQBX 3M3YH 5AJ3L 2VQEQ 4LW1A 2BA1A 4X62Q 4OWWB 1XNRQ 2UXCL 3KYHC 5M5WH 4DV4L 1QVGA 4JI2L 4DK3C 4A3DH 3T1YQ 3Q8DA 1VQ6A 5K36G 4DV0L 4LFAL 1KL9A 4DR6L 4DR7L 2IT1A 4IFDJ 4XIGS 3K8AA 3OYYA 2B63G 2CFMA 2OWOA 1EOVA 1X3FA 1XTDA 1J5EL 5H1SE 1SRUA 4B3TQ 3J81c 5IWAL 4P74A 5BR8Q 1EWIA 4C3HH 2JEAI 1K73C 1I50H 2LSSA 4GKJL 4IO9A 4GLAC 3AFQA 1GD7A 3PO2H 4YY3L 4OX9Q 1XMQL 1CKOA 4JBWA 3GD7A 1VQIA 3UDIA 3RNUA 2I0QA 2KCTA 5GAGC 4X66L 3DLLA 2JE6I 2ZTEA 3OTOL 1OXSC 4LUOA 4LF9Q 2RHQB 4IPGA 1EQQA 1E22A 1O7IA 4J15A 3AEVA 3GTQH 2OQKA 4JI1Q 1A62A 1PH2A 2Q2IA 4IPDA 4JI6L 1VQNA 3HOZH 1A63A 1SLJA 4KI0A 3S24A 2R7DA 1HR0L 1EQRA 1X54A 4AYBE 3RR5A 5LMNW 1YIJA 5JJKA 4PG3A 1Q7YC 2I5HA 2HIVA 1XPOA 5HY6A 1L1OA 3G6EA 1N34L 4NB3A 1KD1C 1I6HH 4JI0L 2JA6H 3H0GH 1E24A 1S3OA 3JC66 1L1OC 1Y14B 3PIPA 2F4VQ 1AE3A 4OWTB 1B7YB 5IYBG 4B3SL 2DGYA 2ZTCA 3I4NH 1N9WA 1X65A 1X9NA 4XTCS 1QVFA 5IYDH 5M3FG 2GVBA 1XJVA 1Q1EA 3J81j 4RMFA 3AFPA 1L2FA 4DR1L 1CKNA 1YEZA 2AWNA 2D62A 1HZAA 1WJJA 2BH2A 1EIFA 1PH3A 4LFBQ 2OTJA 3TRZA 4NXMQ 3RLOA 2NVQH 1IXRA 3B6YA 2PQAA 4JYAQ 2K4KA 2MFIA 5IP7G 4LUZA 1HNXQ 5IYDG 3CD6A 2HQLA 4R4QA 3CPWA 3E9IA 4DR5Q 2IX1A 1X6OA 3W5OA 1K8GA 2VS1A 4RG1A 3ULJA 4JI7Q 2NVTH 3S16H 4IOAA 2JA8H 5GROA 1PYSB 4IOCA 2JA7G 4LWCA 1FJGL 4AYBG 4DR3Q 2I5LX 3CCQA 2Y0SE 2E2HH 1PH9A 3BJUA 5M3FH 1KC8C 3KFUA 4WJ3M 1QVCA 4A3FH 2AWOA 4A3MH 4LF8Q 1LTLA 4DV7L 1SN8A 2VQFQ 3CCMA 1KIXA 3ULLA 4EX5A 2Z6KA 4QY7A 3S1NH 4EQ5A 1VQMA 4BY7H 3FKIH 4A3EH 4LF5L 2WAQG 3S2DH 1HZBA 3RLFA 5IP7H 5GAEC 4HIMA 4DPGA 4X65L 3F2CA 1XMOL 3RN2A 1VQLA 4YCUA 2ZJPA 1Y1VH 3HOYG 3K80C 4GNXB 4IPCA 1PH8A 1JE5A 2MQHA 4P73A 3GTPH 1I5FA 1AH9A 4DV1L 4NPSA 1SROA 3STBC 4HJ7A 4NXNQ 2K14A 2E8GA 3S1MH 1K9MC 1HH2P 3CCJA 4K0KL 2ALYB 1B70B 1U0LA 1VQ4A 3I4MH 3HOWH 4L5SA 3JAMi 3TREA 3I4NG 4QL5A 1LM0A 2A1AA 2L15A 4X64Q 5JEAJ 2UU9Q 3W1BA 2AMCB 4DV6L 1X3GA 3ERSX 3SGIA 3PO2G 3S2HH 3A5UA 1Q1BA 4B3RQ 4HIOA 1WYDA 2F3IA 2JQOA 2K5NA 3HKZE 4LUVA 3K0XA 3WWVA 3S17H 3I4OA 5M3MG 1VQKA 3GTKH 5GADC 3RN5A 3PUXA 4BBSH 3GTJH 4X6AH 4JOIC 4DR4L 4JI4L 1VQEA 2CCZA 3U50C 5C3EH 1HNZQ 3E0EA 2UXBL 4Y7NH 5LMUQ 4ALPA 2B3GA 3UE0A 2KENA 3KOJA 4LF7Q 2N49A 3CC4A 4AQYQ 2KCMA 4DUZL 1UEBA 2E2IH 4P71A 1NTGA 5GAHC 2V1CC 4GOPB 5DLQE 1UE5A 1K8AC 4YHHQ 4GLXA 1PH1A 2IX0A 2JA6G 1I94Q 2ZTDA 5AJ3Q 2VQEL 4A3CH 1YNXA 2YTYA 4HIDA 1Q81C 4L5QA 1IBML 5C0XI 3G4SA 1GKHA 1N33Q 1IBKL 2ID0A 1UE7A 2ZM6L 1YI2A 1TWGH 5C4XH 1Y1WH 1OTCA 1EIYB 3PO3H 3TEHB 4DR6Q 4DR7Q 1VQHA 2R6GA 3BZKA 2JK8A 2R93G 2C35B 2E5LQ 2UUBQ 2UUAL 2HHHL 1X3EA 2D0OA 3HOXG 3HOWG 1TXYA 3PCOB 1L0WA 5JJLA 1PHJA 1PVOA 5IYCH 4BA2I 1OXXK 3CCVA 1G6PA 2N78A 2PQAB 1TWFH 3RZDH 2GVAA 1JJ2A 2NN6G 2Z6KC 4H02A 3BU2A 1SFOH 2R93H 4DK6C 2WFWA 5E7NA 5C0XJ 2WB1G 2NVXH 1X55A 3OW2A 1WI5A 1MKHA 2FXQA 1UE6A 4DUYL 4KHPQ 4P75A 4A93H 2CWPA 2XTIA 4A76A 4JI5L 1PH6A 1EUJA 4BY1H 4QGUA 3D31A 5GQOA 1HZ9A 1QUQB 3J7A5 1SR3A 4APVA 1S72A 2HT1A 4BBSG 4B3ML 3S1QH 3G71A 1Q8KA 4JI8Q 1L1OB 1IBLQ 4LF4L 1XNRL 1E3PA 4JI2Q 4DV4Q 1KXLA 4GN3B 4KHZA 4GOPA 5C44H 3T1YL 4DV0Q 1E1OA 1V1QA 4LFAQ 2IHEA 5IYBH 3HKZG 3CCEA 1D8LA 2OQ0A 3KJOA 4B3SQ 2XGTA 4YWMA 3RLNA 2RCNA 4JBKA 2OCEA 2UXDQ 3F2BA 3EN2A 2EQSA 3TS2A 2VNUD 5IWAQ 2A19A 5IY0A 5BR8L 4C3JH 4DKAC 3MXNB 3HOUH 2K75A 2PI2E 4A93G 3KDFB 3S14H 3CAMA 4OWXB 4KLKA 1JMCA 4YY3Q 4GKKQ 2JA5H 4A75A 2Q2UA 3EBEA 1TWAH 2A8VA 1UE1A 2RF4A 1OXVA 3CCLA 1JJGA 4JYAL 1G51A 2NN6I 1N36Q 4OO1G 4POFA 2BA0A 1HNXL 2YTXA 1VQPA 4LF9L 1QUQA 3T1HL 3NENA 4DAYB 3F8TA 1T9HA 3KF6A 4C2MH 5M5XH 1E1TA 2HIXA 5C44G 4Y52H 3TS0A 1B8AA 3HOZG 1MIUA 2AKWB 1VQOA 4A3IH 4DR3L 1IYJB 4LF6L 1FJGQ 1W3SA 2ASBA 3PF4A 1KHIA 4JI3Q 2K5HA 5EAYA 4DV7Q 2VQFL 4YWLA 4JI0Q 1YBYA 3AQQA 3J81i 1K0RA 2MO0A 3PSIA 4JBJA 4DV3L 4A3LH 4A3GH 4A3JG 1XPRA 4JV5Q 3CMEA 4PZ8A 4DR1Q 1FVIA 2JEBI 1XNQQ 1C0AA 3NEMA 1I3QH 4DV1Q 2YYZA 4A3KH 2R92H 1HNWQ 4K0KQ 1IZ6A 4AIMA 1OXUA 3M9BA 1BVSA 2MNAA 1CUKA 3L7ZC 2Z0SA 3PUYA 5LMNQ 3CC7A 3ULPA 3TQYA 1HZCA 2R7ZG 4A3GG 3G48A 2K5VA 4BXXH 4BBRH 5C4JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X64 L;  2PNH A;  4DV5 Q;  1WCM H;  2VY3 A;  3AYH B;  5FJ8 H;  4JBM A;  3J80 c;  4A3K G;  2R92 G;  1RL2 A;  2KHJ A;  3J80 i;  4BA1 I;  2QA4 A;  4LNQ A;  1A0I A;  1TWC H;  4GN5 A;  5FLM H;  4DR2 L;  1CSQ A;  1DGS A;  4QJF A;  3CCR A;  1VQD A;  4HJ5 A;  3CF5 A;  4GNX A;  4A3F G;  4A3M G;  4DV2 Q;  1BKB A;  2BH8 A;  1QZH A;  4LFC Q;  3HOY H;  2JJQ A;  1R9T H;  4GS3 A;  1GVP A;  5IP9 G;  4DR4 Q;  5M5Y H;  2UUC Q;  1P8L A;  4JG2 A;  4O0A A;  3VDY A;  3DM3 A;  1W2B A;  3K7A H;  3IRB A;  5LMU L;  1VQ7 A;  1VQG A;  4GOP C;  4GLV B;  4LF7 L;  2Y0S G;  1Y1V G;  4R4O A;  1QZG A;  2ZJQ A;  3W1G A;  1WCM G;  1C9O A;  1J6Q A;  1V43 A;  4UY8 C;  4PZ7 A;  3HOV G;  4R1J A;  1VQC A;  2F52 A;  3PIO A;  4R4I A;  3KJP A;  3UDX A;  3PUZ A;  3S1R H;  3L0O A;  2WP8 J;  1KQS A;  3PV0 A;  1HR0 Q;  4JI4 Q;  4A3L G;  3A74 A;  3CMA A;  2CKZ B;  1LUZ A;  1BBW A;  3CP0 A;  3PUW A;  1VQF A;  4MZ9 A;  4X62 L;  3CCS A;  2UXC Q;  1NE3 A;  5IP9 H;  3U58 A;  3GTL H;  1CKM A;  3PGZ A;  2F4V L;  3GTM H;  4GN4 B;  5HGQ A;  1JT8 A;  4BY7 G;  2NVY H;  4C3I H;  4JC0 A;  4B3T L;  2DUD A;  1J5E Q;  4JCV E;  1CSP A;  1VS0 A;  3ER0 A;  4BXX G;  1K3R A;  2Q2H A;  1G29 1;  3U4V A;  5IT9 c;  4UP7 A;  2VL6 A;  4GKJ Q;  1Q12 A;  2YTV A;  1X56 A;  4P72 A;  3GTO H;  3M85 A;  1VQ9 A;  4POG A;  1H95 A;  4OX9 L;  1XMQ Q;  4NXM L;  3F2D A;  1HNZ L;  3FKI G;  4A3E G;  2UXB Q;  3HKS A;  4ME3 A;  4OO1 I;  1LYL A;  3UE1 A;  1GM5 A;  4JI5 Q;  3UDF A;  4IJH A;  4X66 Q;  3I2Z A;  3OTO Q;  1PH4 A;  4DR5 L;  2YV5 A;  4JI7 L;  4OON A;  2Q2T A;  2LXJ A;  2VZA A;  1PH7 A;  2OTL A;  4MNO A;  4JI1 L;  1SMX A;  1YHB A;  3HFZ B;  4JI6 Q;  2NZO A;  3RZO H;  4JI8 L;  1IBL L;  1KRS A;  3GDE A;  5J3B A;  3ZJY C;  4DAM A;  4LF4 Q;  1SE8 A;  4A3B G;  3CW2 C;  1N33 L;  4A3J H;  1Y1W G;  5IYC G;  4IPH A;  1IBK Q;  1EYG A;  1Q46 A;  1CKN B;  3D0F A;  1YJN A;  3I56 A;  3CQZ H;  1PFS A;  3K7U C;  1Q86 C;  1N34 Q;  2D0P A;  4HJA A;  1VQ8 A;  2R7F A;  2UXD L;  2UUB L;  3HOU G;  3H0G G;  1M90 C;  1YVC A;  2B29 A;  1YHA A;  4O2D A;  2HHH Q;  3M4Q A;  3HOX H;  1RIP A;  1ASZ A;  4LF5 Q;  2IY5 B;  3PF5 A;  4UP9 A;  2R7Z H;  4A3B H;  5C0X G;  1XMO Q;  3ICE A;  5M3M H;  1N8R C;  2ATW A;  1N36 L;  1FGU A;  1YHQ A;  1BBU A;  4HJ9 A;  4WJ4 A;  4MTN A;  3MEF A;  5FJ8 G;  3CXC A;  1ASY A;  4LFB L;  4DUY Q;  4R4T A;  2AHO B;  1EFW A;  1YZ6 A;  4YCV A;  4AH6 A;  4R4C A;  4BY1 G;  1UWV A;  4OXP A;  1PH5 A;  1HR0 W;  4LF6 Q;  4IFD G;  1NMF A;  4JOI A;  4IFD I;  4B3M Q;  3CC2 A;  1PV4 A;  2JA8 G;  3A0J A;  3KLW A;  3M4O H;  4GNX C;  3I4M G;  5IE8 A;  3CCU A;  5JEA G;  1NJI C;  2ZJR A;  2LXK A;  2EXD A;  2N3S A;  2PI2 A;  1HJP A;  3PO3 G;  5C4X G;  3KF8 B;  4PMW A;  1OXT A;  1VQB A;  4LF8 L;  3FHW A;  1VQ5 A;  1NMG A;  3H3V H;  4UP8 A;  4UPA A;  4DV3 Q;  4A3C G;  4HIK A;  2YU9 H;  1VQJ A;  1KAW A;  1IL2 A;  4JV5 L;  3HOV H;  3E9H A;  4DNI A;  2PMZ E;  4YCW A;  1P16 A;  5C3E G;  1YJW A;  2H5X A;  5JJI A;  4X65 Q;  3L2P A;  2KBN A;  3LGJ A;  1HNW L;  4GKK L;  5LMN L;  1VCI A;  1N32 Q;  3M4P A;  2EIF A;  1KRT A;  1JJC B;  1Q82 C;  1Z47 A;  3GO5 A;  3GTG H;  4YHH L;  1PYB A;  4NXN L;  2QGQ A;  2I5M X;  2K50 A;  4HJ8 A;  2KHI A;  2MO1 A;  3T1H Q;  1NY4 A;  4DV5 L;  1U5K A;  1VQA A;  1IBM Q;  3KDF A;  3UDG A;  1MJC A;  1MJE A;  2WAQ E;  2ZM6 Q;  4A3I G;  2VW9 A;  1WFQ A;  5FLM G;  1C7Y A;  2UU9 L;  1WOC A;  2IHF A;  2WB1 E;  4DR2 Q;  4DV6 Q;  2E5L L;  3JAM c;  4JI3 L;  2VUM H;  2UUA Q;  3H15 A;  2CQO A;  4DV2 L;  4LFC L;  1YJ9 A;  1Z9F A;  1V9P A;  1A8V A;  4B3R L;  3CPF A;  4L5T A;  2ES2 A;  1AE2 A;  1N32 L;  2UUC L;  3PUV A;  3KF6 B;  5FLX c;  1XPU A;  5ELN A;  3U4Z A;  2JA5 G;  3F1Z A;  1GO3 E;  1D7Q A;  4TVA B;  5ELO A;  1S40 A;  2E2J H;  3J7Z C;  1YIT A;  3I7F A;  2RHS B;  3STB D;  2NZH A;  1M1K C;  1K83 H;  3I55 A;  1PA6 A;  1JB7 A;  2JA7 H;  4YWK A;  2VUM G;  4BBR G;  3NBH B;  1FL0 A;  4KHP L;  4TQU S;  4A4I A;  1XNQ L;  3EIV A;  3M7N A;  4A3D G;  4PZ6 A;  2K52 A;  3K81 C;  4QIW E;  3A5Z B;  1E7Z A;  2QEX A;  4AQY L;  1NBW A;  4DUZ Q;  3H3V I;  3S15 H;  2B63 H;  2JA9 A;  2GN5 A;  2N8N A;  3NEL A;  1TWH H;  2CWA A;  3BZC A;  4IJL A;  4FDB A;  4L5R C;  1I94 L;  3FP9 A;  4QQB X;  3M3Y H;  5AJ3 L;  2VQE Q;  4LW1 A;  2BA1 A;  4X62 Q;  4OWW B;  1XNR Q;  2UXC L;  3KYH C;  5M5W H;  4DV4 L;  1QVG A;  4JI2 L;  4DK3 C;  4A3D H;  3T1Y Q;  3Q8D A;  1VQ6 A;  5K36 G;  4DV0 L;  4LFA L;  1KL9 A;  4DR6 L;  4DR7 L;  2IT1 A;  4IFD J;  4XIG S;  3K8A A;  3OYY A;  2B63 G;  2CFM A;  2OWO A;  1EOV A;  1X3F A;  1XTD A;  1J5E L;  5H1S E;  1SRU A;  4B3T Q;  3J81 c;  5IWA L;  4P74 A;  5BR8 Q;  1EWI A;  4C3H H;  2JEA I;  1K73 C;  1I50 H;  2LSS A;  4GKJ L;  4IO9 A;  4GLA C;  3AFQ A;  1GD7 A;  3PO2 H;  4YY3 L;  4OX9 Q;  1XMQ L;  1CKO A;  4JBW A;  3GD7 A;  1VQI A;  3UDI A;  3RNU A;  2I0Q A;  2KCT A;  5GAG C;  4X66 L;  3DLL A;  2JE6 I;  2ZTE A;  3OTO L;  1OXS C;  4LUO A;  4LF9 Q;  2RHQ B;  4IPG A;  1EQQ A;  1E22 A;  1O7I A;  4J15 A;  3AEV A;  3GTQ H;  2OQK A;  4JI1 Q;  1A62 A;  1PH2 A;  2Q2I A;  4IPD A;  4JI6 L;  1VQN A;  3HOZ H;  1A63 A;  1SLJ A;  4KI0 A;  3S24 A;  2R7D A;  1HR0 L;  1EQR A;  1X54 A;  4AYB E;  3RR5 A;  5LMN W;  1YIJ A;  5JJK A;  4PG3 A;  1Q7Y C;  2I5H A;  2HIV A;  1XPO A;  5HY6 A;  1L1O A;  3G6E A;  1N34 L;  4NB3 A;  1KD1 C;  1I6H H;  4JI0 L;  2JA6 H;  3H0G H;  1E24 A;  1S3O A;  3JC6 6;  1L1O C;  1Y14 B;  3PIP A;  2F4V Q;  1AE3 A;  4OWT B;  1B7Y B;  5IYB G;  4B3S L;  2DGY A;  2ZTC A;  3I4N H;  1N9W A;  1X65 A;  1X9N A;  4XTC S;  1QVF A;  5IYD H;  5M3F G;  2GVB A;  1XJV A;  1Q1E A;  3J81 j;  4RMF A;  3AFP A;  1L2F A;  4DR1 L;  1CKN A;  1YEZ A;  2AWN A;  2D62 A;  1HZA A;  1WJJ A;  2BH2 A;  1EIF A;  1PH3 A;  4LFB Q;  2OTJ A;  3TRZ A;  4NXM Q;  3RLO A;  2NVQ H;  1IXR A;  3B6Y A;  2PQA A;  4JYA Q;  2K4K A;  2MFI A;  5IP7 G;  4LUZ A;  1HNX Q;  5IYD G;  3CD6 A;  2HQL A;  4R4Q A;  3CPW A;  3E9I A;  4DR5 Q;  2IX1 A;  1X6O A;  3W5O A;  1K8G A;  2VS1 A;  4RG1 A;  3ULJ A;  4JI7 Q;  2NVT H;  3S16 H;  4IOA A;  2JA8 H;  5GRO A;  1PYS B;  4IOC A;  2JA7 G;  4LWC A;  1FJG L;  4AYB G;  4DR3 Q;  2I5L X;  3CCQ A;  2Y0S E;  2E2H H;  1PH9 A;  3BJU A;  5M3F H;  1KC8 C;  3KFU A;  4WJ3 M;  1QVC A;  4A3F H;  2AWO A;  4A3M H;  4LF8 Q;  1LTL A;  4DV7 L;  1SN8 A;  2VQF Q;  3CCM A;  1KIX A;  3ULL A;  4EX5 A;  2Z6K A;  4QY7 A;  3S1N H;  4EQ5 A;  1VQM A;  4BY7 H;  3FKI H;  4A3E H;  4LF5 L;  2WAQ G;  3S2D H;  1HZB A;  3RLF A;  5IP7 H;  5GAE C;  4HIM A;  4DPG A;  4X65 L;  3F2C A;  1XMO L;  3RN2 A;  1VQL A;  4YCU A;  2ZJP A;  1Y1V H;  3HOY G;  3K80 C;  4GNX B;  4IPC A;  1PH8 A;  1JE5 A;  2MQH A;  4P73 A;  3GTP H;  1I5F A;  1AH9 A;  4DV1 L;  4NPS A;  1SRO A;  3STB C;  4HJ7 A;  4NXN Q;  2K14 A;  2E8G A;  3S1M H;  1K9M C;  1HH2 P;  3CCJ A;  4K0K L;  2ALY B;  1B70 B;  1U0L A;  1VQ4 A;  3I4M H;  3HOW H;  4L5S A;  3JAM i;  3TRE A;  3I4N G;  4QL5 A;  1LM0 A;  2A1A A;  2L15 A;  4X64 Q;  5JEA J;  2UU9 Q;  3W1B A;  2AMC B;  4DV6 L;  1X3G A;  3ERS X;  3SGI A;  3PO2 G;  3S2H H;  3A5U A;  1Q1B A;  4B3R Q;  4HIO A;  1WYD A;  2F3I A;  2JQO A;  2K5N A;  3HKZ E;  4LUV A;  3K0X A;  3WWV A;  3S17 H;  3I4O A;  5M3M G;  1VQK A;  3GTK H;  5GAD C;  3RN5 A;  3PUX A;  4BBS H;  3GTJ H;  4X6A H;  4JOI C;  4DR4 L;  4JI4 L;  1VQE A;  2CCZ A;  3U50 C;  5C3E H;  1HNZ Q;  3E0E A;  2UXB L;  4Y7N H;  5LMU Q;  4ALP A;  2B3G A;  3UE0 A;  2KEN A;  3KOJ A;  4LF7 Q;  2N49 A;  3CC4 A;  4AQY Q;  2KCM A;  4DUZ L;  1UEB A;  2E2I H;  4P71 A;  1NTG A;  5GAH C;  2V1C C;  4GOP B;  5DLQ E;  1UE5 A;  1K8A C;  4YHH Q;  4GLX A;  1PH1 A;  2IX0 A;  2JA6 G;  1I94 Q;  2ZTD A;  5AJ3 Q;  2VQE L;  4A3C H;  1YNX A;  2YTY A;  4HID A;  1Q81 C;  4L5Q A;  1IBM L;  5C0X I;  3G4S A;  1GKH A;  1N33 Q;  1IBK L;  2ID0 A;  1UE7 A;  2ZM6 L;  1YI2 A;  1TWG H;  5C4X H;  1Y1W H;  1OTC A;  1EIY B;  3PO3 H;  3TEH B;  4DR6 Q;  4DR7 Q;  1VQH A;  2R6G A;  3BZK A;  2JK8 A;  2R93 G;  2C35 B;  2E5L Q;  2UUB Q;  2UUA L;  2HHH L;  1X3E A;  2D0O A;  3HOX G;  3HOW G;  1TXY A;  3PCO B;  1L0W A;  5JJL A;  1PHJ A;  1PVO A;  5IYC H;  4BA2 I;  1OXX K;  3CCV A;  1G6P A;  2N78 A;  2PQA B;  1TWF H;  3RZD H;  2GVA A;  1JJ2 A;  2NN6 G;  2Z6K C;  4H02 A;  3BU2 A;  1SFO H;  2R93 H;  4DK6 C;  2WFW A;  5E7N A;  5C0X J;  2WB1 G;  2NVX H;  1X55 A;  3OW2 A;  1WI5 A;  1MKH A;  2FXQ A;  1UE6 A;  4DUY L;  4KHP Q;  4P75 A;  4A93 H;  2CWP A;  2XTI A;  4A76 A;  4JI5 L;  1PH6 A;  1EUJ A;  4BY1 H;  4QGU A;  3D31 A;  5GQO A;  1HZ9 A;  1QUQ B;  3J7A 5;  1SR3 A;  4APV A;  1S72 A;  2HT1 A;  4BBS G;  4B3M L;  3S1Q H;  3G71 A;  1Q8K A;  4JI8 Q;  1L1O B;  1IBL Q;  4LF4 L;  1XNR L;  1E3P A;  4JI2 Q;  4DV4 Q;  1KXL A;  4GN3 B;  4KHZ A;  4GOP A;  5C44 H;  3T1Y L;  4DV0 Q;  1E1O A;  1V1Q A;  4LFA Q;  2IHE A;  5IYB H;  3HKZ G;  3CCE A;  1D8L A;  2OQ0 A;  3KJO A;  4B3S Q;  2XGT A;  4YWM A;  3RLN A;  2RCN A;  4JBK A;  2OCE A;  2UXD Q;  3F2B A;  3EN2 A;  2EQS A;  3TS2 A;  2VNU D;  5IWA Q;  2A19 A;  5IY0 A;  5BR8 L;  4C3J H;  4DKA C;  3MXN B;  3HOU H;  2K75 A;  2PI2 E;  4A93 G;  3KDF B;  3S14 H;  3CAM A;  4OWX B;  4KLK A;  1JMC A;  4YY3 Q;  4GKK Q;  2JA5 H;  4A75 A;  2Q2U A;  3EBE A;  1TWA H;  2A8V A;  1UE1 A;  2RF4 A;  1OXV A;  3CCL A;  1JJG A;  4JYA L;  1G51 A;  2NN6 I;  1N36 Q;  4OO1 G;  4POF A;  2BA0 A;  1HNX L;  2YTX A;  1VQP A;  4LF9 L;  1QUQ A;  3T1H L;  3NEN A;  4DAY B;  3F8T A;  1T9H A;  3KF6 A;  4C2M H;  5M5X H;  1E1T A;  2HIX A;  5C44 G;  4Y52 H;  3TS0 A;  1B8A A;  3HOZ G;  1MIU A;  2AKW B;  1VQO A;  4A3I H;  4DR3 L;  1IYJ B;  4LF6 L;  1FJG Q;  1W3S A;  2ASB A;  3PF4 A;  1KHI A;  4JI3 Q;  2K5H A;  5EAY A;  4DV7 Q;  2VQF L;  4YWL A;  4JI0 Q;  1YBY A;  3AQQ A;  3J81 i;  1K0R A;  2MO0 A;  3PSI A;  4JBJ A;  4DV3 L;  4A3L H;  4A3G H;  4A3J G;  1XPR A;  4JV5 Q;  3CME A;  4PZ8 A;  4DR1 Q;  1FVI A;  2JEB I;  1XNQ Q;  1C0A A;  3NEM A;  1I3Q H;  4DV1 Q;  2YYZ A;  4A3K H;  2R92 H;  1HNW Q;  4K0K Q;  1IZ6 A;  4AIM A;  1OXU A;  3M9B A;  1BVS A;  2MNA A;  1CUK A;  3L7Z C;  2Z0S A;  3PUY A;  5LMN Q;  3CC7 A;  3ULP A;  3TQY A;  1HZC A;  2R7Z G;  4A3G G;  3G48 A;  2K5V A;  4BXX H;  4BBR H;  5C4J H; 
#chains in the Genus database with same CATH topology
 4X64 L;  3R2I A;  4FO2 A;  1O7Y A;  3J80 c;  1RL2 A;  1A0I A;  1EQT A;  3A8K E;  2EJM A;  2FMM A;  2R92 B;  1SYD A;  4ZLT F;  4HJ5 A;  4GNX A;  3HOY H;  4ZCK A;  1TWG B;  1BF4 A;  1N32 Q;  1GVP A;  2UUC Q;  4O0A A;  2MUY A;  2JA8 B;  2K33 A;  4X3T A;  1JOO A;  5JAV A;  4RCO A;  4GLV B;  1Y1V G;  1IL8 A;  1LAC A;  1WCM G;  4R1J A;  1VQC A;  3KJP A;  3S1R H;  4CKE A;  4A3L G;  2RVL A;  4CBV A;  4E6I A;  4X62 L;  1VQF A;  4HMJ A;  3U58 A;  3MC0 B;  3GTM H;  2F4V L;  4K8I A;  2C5C A;  3H3V C;  4JCV E;  4I7Z C;  1VS0 A;  3ER0 A;  1K3R A;  5F2D A;  5EPK A;  3QG1 A;  4OEL B;  3GTO H;  1X56 A;  1H95 A;  4POG A;  4FXG C;  3UDF A;  4X66 Q;  2KHS A;  4JI7 L;  2Y0S B;  1GUO A;  2EPB A;  2EJF C;  1PH7 A;  2OTL A;  1SMX A;  1YHB A;  4BY7 B;  2NZO A;  2JN4 A;  4LF4 Q;  1TS4 A;  1SE8 A;  2L5T A;  3K5L A;  1Q46 A;  1CKN B;  1EY0 A;  1JOR A;  4DFA A;  3D3R A;  4TSS A;  3HOU G;  2HHH Q;  1TS3 A;  3M4Q A;  2K5Q A;  1ASZ A;  3NP8 A;  4JPB W;  3ICE A;  4ILW A;  4R8N A;  2NN6 H;  3DXJ C;  4A3J B;  5L37 A;  1FGU A;  4N8F A;  4XQN A;  3CKI B;  4PNY A;  1WCM B;  2AHO B;  1WTX A;  2A6H C;  4R4C A;  1B53 A;  1UWV A;  1HFN A;  4IFD G;  3RD4 A;  1NMF A;  4L8J A;  2JA8 G;  3HOY B;  4GNX C;  2SDF A;  1KNA A;  4DF7 A;  1OO9 B;  5EBC A;  2ZJR A;  2EXD A;  2N3S A;  5C4X G;  3KF8 B;  1I4P A;  4H13 C;  1Q3L A;  3FHW A;  3W3A A;  1NMG A;  4UPA A;  2YU9 H;  1IL2 A;  1KAW A;  2A6H D;  4KJN A;  4JV5 L;  4DNI A;  1HCZ A;  3Q23 A;  3QOJ A;  4X65 Q;  2KBN A;  3LGJ A;  3HG9 A;  1EY6 A;  2Z8L A;  1UEA B;  2PZT A;  1PYB A;  4YHH L;  2MGS A;  2O5J C;  5DAU A;  3M4Y A;  1SYE A;  2KHI A;  3W2D A;  1X3P A;  3T1H Q;  1IBM Q;  4DV5 L;  1U5K A;  1ILP A;  4C3I G;  2ZM6 Q;  3DWQ A;  2VW9 A;  5FLM G;  4FF3 A;  2PQE A;  4H0L C;  2WB1 E;  4DR2 Q;  3D4R A;  1QB5 D;  1H9M A;  3GV6 A;  3SDZ A;  3VR6 A;  2CQO A;  1Z9F A;  2A69 C;  1SE4 A;  4B3R L;  1N32 L;  2R3Z A;  3J81 L;  1TWH B;  4I65 A;  4DA2 A;  3I70 A;  1XPU A;  3GTL B;  5ELN A;  3U4Z A;  1TS2 A;  2JA5 G;  3C1F A;  3OMC A;  1SYB A;  5KIX A;  3STB D;  2NZH A;  3I55 A;  4YWK A;  3NBH B;  1F77 A;  2IL8 A;  2K52 A;  3K81 C;  4QIW E;  1E7Z A;  1NBW A;  5IGD A;  4L6T B;  3S15 H;  4HCE A;  1B9M A;  2GN5 A;  1I50 B;  4FDB A;  5M9O A;  4LW1 A;  4OWW B;  1JCK B;  3FPP A;  4JI2 L;  4A3D H;  1KAB A;  5CV9 A;  3CHB D;  2JYO A;  2L55 A;  4DR7 L;  4IFD J;  4XIG S;  4IUN A;  2CFM A;  1RJT A;  5IWA L;  1VDZ A;  2B2Y C;  1WTO A;  4RGT A;  1I50 H;  1PFN A;  4IO9 A;  1BUV T;  3SEB A;  3SK8 A;  1XMQ L;  5J22 A;  4JBW A;  3NE5 B;  3K6O A;  3DLL A;  2JE6 I;  3MFG A;  4LF9 Q;  3EJI A;  1O7I A;  4J15 A;  2KVM A;  1RKN A;  3AEV A;  3GTQ H;  1QG7 A;  1A62 A;  4JI6 L;  4IPD A;  3HOZ H;  2Z9H A;  4FXK C;  4Z9C B;  4KD3 A;  1EQV A;  4AYB E;  5LMN W;  1YIJ A;  5JJK A;  1F2Y A;  1XPO A;  1L1O A;  3G6E A;  1N34 L;  4ID6 A;  5DNF A;  3JC6 6;  1L1O C;  4G57 A;  1Y14 B;  3T53 B;  4OWT B;  2ZTC A;  1X65 A;  4FF4 A;  4XTC S;  1QVF A;  2GVB A;  3J81 j;  2IJ0 A;  1CKN A;  1HZA A;  2BH2 A;  3TRZ A;  3RLO A;  4HR7 B;  2Z4H A;  2PQA A;  1HPC A;  3CD6 A;  2Z1C A;  1K8G A;  3W5O A;  3S16 H;  2VS1 A;  4JI7 Q;  4HTH A;  2F0I A;  1G91 A;  1NR2 A;  2JA8 H;  3LWU A;  1CQF A;  4IOC A;  1ICW A;  2JA7 G;  2B2T A;  2E2H H;  5IT9 L;  4G7H C;  3BJU A;  4X3S A;  1STA A;  1HTL D;  4DV7 L;  2L9H A;  2VQF Q;  4K14 A;  2WAC A;  1Y8N B;  2Z6K A;  2AUJ D;  4DNT B;  4U68 A;  4EQ5 A;  1JB3 A;  3FKI H;  5EKL A;  3DUZ A;  3RLF A;  5IP7 H;  1PRT C;  4YCU A;  2ZJP A;  5LHY 1;  2E2H B;  3K80 C;  4HED A;  2MQH A;  4O1N A;  3GTP H;  1I5F A;  4DV1 L;  3I4L A;  3BVG A;  3PIP 3;  1K9M C;  4K0K L;  2ALY B;  1U0L A;  5A2Q E;  4A3D B;  3TP5 A;  1CT1 D;  2NTS A;  5JEA J;  1EOT A;  1GUS A;  2ENB A;  3ERS X;  3ND8 A;  3S2H H;  5TSS A;  3BG3 A;  3RUZ A;  4DK0 A;  4HIO A;  2CH4 A;  2F3I A;  1PRT F;  2K5N A;  1L0Y B;  3WWV A;  3S17 H;  3OOC A;  1I3Q B;  1EEI D;  4JOI C;  5IGG A;  1ENC A;  5C3W A;  4LF7 Q;  3CC4 A;  4AQY Q;  1UEB A;  5GAH C;  2B8F A;  2EOT A;  2ICE C;  1J9O A;  4YHH Q;  4GLX A;  2FHT A;  1EYA A;  1TT2 A;  4RGN A;  3S17 B;  4R8I A;  1QOH A;  2ZTD A;  1TWC B;  4A3C H;  2A74 C;  4HID A;  1NNX A;  2K32 A;  1N33 Q;  2XN9 C;  1Y1W H;  1YI2 A;  1TWG H;  2J0T D;  3J81 E;  1VQH A;  2R6G A;  4OO1 H;  2C35 B;  5I9O A;  2UUA L;  3MXP A;  1X3E A;  2EYL A;  3HOW G;  1YNN D;  4ULL A;  1GXD C;  4IUT A;  5IYC H;  1OXX K;  1SNQ A;  4ODG A;  3CCV A;  5COR A;  1YNJ C;  1TWF H;  2Z6K C;  4H02 A;  1H9K A;  3TDQ A;  3ERQ A;  1U4P A;  3G6J B;  4ZKB B;  3S16 B;  1WI5 A;  4P75 A;  2WII B;  2CWP A;  4Q0F A;  1EUJ A;  4BY1 H;  3LNN A;  3D31 A;  3I8Z A;  5GQO A;  3J7A F;  1HZ9 A;  1QUQ B;  3C1E A;  3T4A C;  1SR3 A;  4APV A;  1S72 A;  4BBS G;  2SNS A;  1WVL A;  4RH6 A;  3EQL C;  4JI8 Q;  1SBB B;  5JEA H;  1G2T A;  3I73 A;  5KGU A;  2PYK A;  4GN3 B;  3T1Y L;  3S1N B;  4DV0 Q;  3FKI B;  5IYB H;  3CCE A;  5CV4 A;  4B3S Q;  4YWM A;  2RCN A;  4JBK A;  2UXD Q;  4H7B A;  1SMY C;  3EN2 A;  2EQS A;  2A19 A;  2PI2 E;  2DJF C;  3VA7 A;  4QB4 A;  1JE4 A;  4P2C B;  4JK1 C;  2I46 A;  1EY5 A;  1JJG A;  2VUM B;  2B2V C;  2F03 A;  4K6L A;  3C2P A;  3KLS A;  4OO1 G;  1QUQ A;  3A7L A;  3T1H L;  3CU7 A;  3F8T A;  3OW7 A;  3KF6 A;  1ENF A;  2K1B A;  1IYU A;  3HKZ B;  1LTB D;  3N6R A;  1VQO A;  4CDC C;  3H94 A;  1W3S A;  2KUM A;  3PF4 A;  4TKO B;  2K5H A;  5EAY A;  1D5X C;  2VQF L;  2A69 D;  1NSN S;  2F1M A;  1PMR A;  1STG A;  3AQQ A;  2MO0 A;  5JPM C;  1E2Z A;  1GUG A;  1SDF A;  4JV5 Q;  3HP3 A;  4KHV A;  2XWJ B;  4QUC A;  2JEB I;  1XNQ Q;  3NEM A;  2YYZ A;  1MSG A;  2LY7 A;  1HNW Q;  2G5D A;  1BVS A;  1F9Q A;  3PUY A;  2QW7 A;  2NB0 A;  1O80 A;  2Z0S A;  3MZ5 A;  1HZC A;  3CC7 A;  1BCP C;  2R7Z G;  1WD0 A;  1G6Z A;  4BXX H;  1LTR D;  1R9T B;  1TY0 A;  3J7A V;  5C4J H;  4DN4 M;  1LTI D;  3HGB A;  1EY9 A;  2PNH A;  3VA5 A;  2VY3 A;  3AYH B;  5FJ8 H;  4A3K G;  3J80 i;  2F0L A;  4GN5 A;  2X6L A;  4XQQ A;  1VQD A;  5CR3 A;  4A3F G;  2D2C C;  2F0F A;  3H6M A;  1R9T H;  4GS3 A;  3K58 A;  5M5Y H;  1P8L A;  4JG2 A;  3DWA A;  4XT1 B;  3DM3 A;  1W2B A;  5LMU L;  1PZJ D;  3NTI A;  1VQ7 A;  1VQG A;  4CKC A;  3J80 L;  2K6A A;  2O2L D;  1Q90 A;  1FGB D;  4R4O A;  2ZJQ A;  2H4O A;  4UY8 C;  3PIO A;  4R4I A;  2ICI A;  3UDX A;  1KQS A;  2IWH A;  3PV0 A;  3GTG B;  2A68 C;  4ZYS A;  5IGC A;  2SEB D;  1CKM A;  4GN4 B;  4V0B A;  4WFN 3;  2M00 A;  4JC0 A;  2DUD A;  4M8A A;  4TRD A;  1J5E Q;  3NK9 A;  3VYU A;  2Q2H A;  1G29 1;  4UP7 A;  2VL6 A;  2RBM A;  1Q12 A;  4P72 A;  3M85 A;  3Q0A A;  1MBY A;  4OX9 L;  1XMQ Q;  4NXM L;  1DOK A;  5NUC A;  1FYC A;  2DNE A;  4ME3 A;  2A73 B;  2PZW A;  3UE1 A;  2WKC A;  4R9W A;  1GM5 A;  1C4Q A;  1LT6 D;  4IJH A;  3S14 B;  2EYO A;  1H9R A;  3I2Z A;  3OTO Q;  5G3L D;  4DR5 L;  1LO5 D;  2VZA A;  4MNO A;  1SEB D;  1CHP D;  3HFZ B;  5AFW A;  4JI8 L;  3GDE A;  3ZJY C;  5C3E B;  1S5D D;  4QIW B;  2QIL A;  3CW2 C;  1N33 L;  3DMU A;  1Y1W G;  5IYC G;  1TII D;  5G3L F;  1IKM A;  1Q86 C;  1VQ8 A;  4RKL A;  4HJA A;  1GJX A;  2UXD L;  3H0G G;  1YVC A;  2B29 A;  4O2D A;  3MHB A;  4LF5 Q;  5BN5 A;  1LV9 A;  2BCO A;  4UP9 A;  5C0X G;  1S5F D;  5M3M H;  1N8R C;  2AQ2 B;  2F0N A;  1ENA A;  1BBU A;  3MEF A;  5FJ8 G;  3CXC A;  2Z4I A;  4LFB L;  4R4T A;  1EFW A;  3BDO A;  4YCV A;  2B39 A;  3GV3 A;  1X3Q A;  4LF6 Q;  1T5E A;  2HDM A;  4B3M Q;  5JJZ A;  1PV4 A;  2CQA A;  2F0U A;  3QR8 A;  3KLW A;  3M4O H;  5CV5 A;  3CCU A;  4BBR B;  2EYF A;  4A93 B;  2EVB A;  1HJP A;  4WOR A;  3PO3 G;  4LF8 L;  1VQ5 A;  2L0C A;  2HD3 A;  1U9R A;  1F9R A;  3OWF A;  3HOV H;  1W6J A;  5C3E G;  3L2P A;  2E2D C;  1HNW L;  1F2Z A;  5LMN L;  1VCI A;  2EIF A;  1KRT A;  1HXY D;  1BCP D;  3SXH A;  2EXZ A;  1ET6 A;  4KK7 A;  4K8J A;  2F0P A;  4LK1 C;  1VQA A;  2NZ1 D;  3KDF A;  3HOV B;  3UDG A;  2MHV A;  3A8I E;  4XDX A;  1WFQ A;  1C7Y A;  2IHF A;  4C56 C;  1RHP A;  1SNC A;  1ZYR D;  2L12 A;  3E3X A;  1KNE A;  3H15 A;  3BS1 A;  1WTV A;  5DM7 3;  3TZD A;  1AE2 A;  5IT9 E;  5EGT A;  2JSO A;  1D7Q A;  1EEF D;  1I4X A;  4TVA B;  5ELO A;  3UI2 A;  1S40 A;  5IGB A;  1YIT A;  3I7F A;  4JI4 Q;  1M1K C;  2VUM G;  1MGS A;  4BBR G;  3NQT A;  5BN4 A;  1FL0 A;  4RHR A;  4TQU S;  1SSO A;  2XWB B;  4PZ6 A;  1Z7T A;  3A5Z B;  2LKV A;  4AQY L;  4DUZ Q;  3H3V I;  3GQB A;  4RA8 A;  4B08 A;  2N8N A;  2Q8R E;  4KJO A;  1QNU A;  1I94 L;  4QQB X;  3M3Y H;  5AJ3 L;  3QWN A;  3KYH C;  2UXC L;  3Q8D A;  5K36 G;  4DV0 L;  1D5M C;  3HOX B;  1MI2 A;  1EIG A;  2OWO A;  1X3F A;  4B3T Q;  1PFB A;  3BZD B;  3J81 c;  4P74 A;  4KKS A;  4C3H H;  2LSS A;  4GKJ L;  4OX9 Q;  1WTW A;  1VQI A;  2F0J A;  4I7A A;  4X66 L;  2ZTE A;  5ISR A;  3OTO L;  1CZW A;  5DM6 3;  3NSW A;  1STH A;  4M1U B;  1JOQ A;  2JP1 A;  2OQK A;  4JI1 Q;  4C3H B;  1D6E C;  2Q2I A;  1STN A;  4O42 A;  1HR0 L;  1EQR A;  1KAA A;  3X3M A;  1J8I A;  2EE1 A;  3RR5 A;  3WDN A;  4QUF A;  1Q7Y C;  2I5H A;  5HY6 A;  4NB3 A;  2NVQ B;  3H0G H;  1S3O A;  1B7Y B;  4RWS C;  2DGY A;  1EFI D;  3OPO A;  1X9N A;  5M3F G;  4HMI A;  3AFP A;  1MD2 D;  2BDN A;  1L2F A;  2EY2 A;  2AWN A;  1BOS A;  2D62 A;  3SE0 A;  4IQZ A;  3KK7 A;  1I6H B;  1A3V A;  1CZG A;  4FF2 A;  4CDD C;  4EGV A;  5IYD G;  4R4Q A;  3CPW A;  1X6O A;  2KCN A;  3ULJ A;  4RG1 A;  2NVT H;  4IOA A;  4LMQ D;  3SHL A;  4LWC A;  1FJG L;  4DR3 Q;  3H91 A;  3DHQ A;  5EKK A;  2F0T A;  4C3J B;  3KFU A;  3S1Q B;  4A3M H;  2AWO A;  1LTL A;  1SN8 A;  3K5O A;  1SE3 A;  3AMU A;  3TME A;  3OIP A;  2B2W A;  4QY7 A;  2P5Z X;  4BY7 H;  4A3E H;  5C5L A;  2D5D A;  3KLR A;  4X65 L;  2EYH A;  1LTA D;  3TSS A;  3HOY G;  1Y1V H;  2E75 C;  2EYJ A;  1EZ8 A;  2K7V A;  2DN8 A;  5CBE E;  1SRO A;  2K14 A;  4HAE A;  3VYT A;  1B70 B;  1VQ4 A;  5ELF A;  3I4M H;  3A7A B;  4L5S A;  3JAM i;  4NMZ A;  2NTT A;  2O4X A;  4UHV A;  3W1B A;  2G9H D;  2B63 B;  4DV6 L;  3PO2 G;  1Y1V B;  1PDQ A;  3S1M B;  4A3I B;  3BDL A;  2B2V A;  3HKZ E;  3WOF A;  3K0X A;  1M4V A;  2KQ3 A;  3I4O A;  1VQK A;  3RN5 A;  4BBS H;  3IAY A;  1XYI A;  4JI4 L;  4B9X A;  2JA7 B;  2UXB L;  5C4X B;  1GUW A;  2B3G A;  4EQO A;  4PMB A;  2KEN A;  2E2I H;  4P71 A;  1NTG A;  2K04 A;  1PFM A;  1C8C A;  5AJ3 Q;  1YNX A;  2YTY A;  5A2Q L;  1IHZ A;  2XRS D;  4FVM A;  5C0X I;  1JOK A;  1LTS D;  1QNK A;  2ID0 A;  1EIY B;  1OTC A;  4DR6 Q;  4IFD H;  3BZK A;  3PQI A;  2JK8 A;  2RSO A;  2R93 G;  5M5Y B;  2UUB Q;  2B2T C;  3DWP A;  4XQJ A;  3AB9 A;  5HUR A;  1UNS A;  1V1P A;  4KKT A;  2K05 A;  2BE5 C;  1F9S A;  3RZD H;  1JJ2 A;  2KED A;  2NN6 G;  3A56 A;  3T56 B;  4DK6 C;  2OXP A;  2WFW A;  1MKH A;  2FXQ A;  3K59 A;  1DOL A;  5CV7 A;  1FD7 D;  4ZK9 B;  5CMD A;  3K0Y A;  3ND9 A;  5FK9 C;  4B3M L;  1SND A;  3D4W A;  2X69 A;  4GZY C;  3IL8 A;  4LF4 L;  4DV4 Q;  4FXD A;  1KXL A;  1R4Q B;  1XTC D;  4GOP A;  5C44 H;  2QKI C;  5K5P A;  1KDB A;  4LFA Q;  1A3U A;  2OQ0 A;  3RMH A;  3S9W A;  2OEO A;  2F3V A;  2EY1 A;  3QIA A;  2VNU D;  4PV1 C;  4RFB A;  5IY0 A;  3MXN B;  3SK5 A;  1EZ6 A;  2K75 A;  3ONA B;  3S14 H;  4OWX B;  4XXE A;  5D3I B;  4KLK A;  3I4M B;  4L63 B;  1Y8O B;  1Z6H A;  3MEH A;  3L9A X;  5FLX L;  4MIU A;  1HNX L;  1UAP A;  2YTX A;  1SJE D;  2ZT9 C;  4LF9 L;  2IW3 A;  5IGF A;  5C44 G;  4WRD A;  3TS0 A;  1B8A A;  1MIU A;  3CQZ B;  4J8Q A;  4DR3 L;  2ASB A;  4JI3 Q;  3A8J E;  2NBF A;  4C3H G;  1CI3 M;  1YBY A;  1ZYR C;  3FDT A;  3SR1 A;  1ZKO A;  4A3G H;  4A3J G;  2FJ2 A;  1XPR A;  1FR3 A;  3TP8 A;  2E2I B;  4PZ8 A;  4K2K A;  4DR1 Q;  1C0A A;  1I3Q H;  4BWG B;  1Y8P B;  4A3K H;  4J6H A;  1HQM C;  1V1O A;  3M9B A;  2LS0 1;  3ULP A;  3TQY A;  4A3G G;  2K5V A;  1I4H A;  1II3 A;  1ROD A;  1NCV A;  4DV5 Q;  1PLF A;  1K8M A;  1WCM H;  4JW0 A;  1DD2 A;  2KHJ A;  4BA1 I;  4LNQ A;  4J1M A;  1TWC H;  2PCF B;  1CSQ A;  2HDL A;  1BR9 A;  2E74 C;  3CCR A;  4A3K B;  4A3M G;  3KLS X;  1BKB A;  2EJG C;  3LWE A;  3I3C A;  2JJQ A;  1DXM A;  2RCF A;  1BNZ A;  3DEP A;  4CDE C;  2K03 A;  3IRB A;  4LF7 L;  2PO4 A;  1QZG A;  3GTM B;  2IX3 A;  3KBX A;  1J6Q A;  1KLG D;  2NVY B;  2KOL A;  4PZ7 A;  3HOV G;  2F52 A;  3HEJ A;  3PUZ A;  1EWC A;  2WP8 J;  4K6D A;  1HR0 Q;  4F88 A;  5C44 B;  3CMA A;  1LUZ A;  1BBW A;  3CP0 A;  3CCS A;  4BY1 B;  4MZ9 A;  4IAL A;  4C1N K;  2KJX A;  3PGZ A;  1PRT B;  1CK1 A;  3VYS A;  5HGQ A;  4F87 A;  1DZ1 A;  4BY7 G;  2NVY H;  4C3I H;  1AN8 A;  1DOM A;  1K83 B;  4B3T L;  1CSP A;  3BDC A;  3IFD A;  2NVT B;  5IT9 c;  1ZXT A;  3WOE A;  2PMZ B;  4GKJ Q;  2N55 A;  1U4M A;  1VQ9 A;  1PTO C;  5ELD A;  1TVX A;  5EBD A;  4YIJ A;  4A3E G;  3HKS A;  3NXW A;  4JI5 Q;  1PH4 A;  1G8Z D;  3IFT A;  4KV6 A;  4OON A;  1LTT D;  4JI1 L;  4JI6 Q;  4A3C G;  3BVZ A;  1KRS A;  4DAM A;  2AQ3 B;  3GTO B;  4A3B G;  3VR2 A;  4A3J H;  1IBK Q;  4IPH A;  1ICF B;  1YJN A;  2N88 A;  1PFS A;  3K7U C;  1SNP A;  1LLR D;  2R7F A;  2M2L A;  3TN2 A;  4JVZ A;  5I9P A;  3C46 A;  2QDL A;  2K5W A;  2IY5 B;  2R7Z H;  5EQ0 A;  4XYQ A;  1CM9 A;  2A6E C;  4AYB B;  5KEE A;  1MSH A;  2ATW A;  1YHQ A;  5E4X A;  1O78 A;  4HJ9 A;  1ASY A;  4XYO A;  1GUT A;  4IUR A;  1CHQ D;  1KDC A;  1YZ6 A;  1YNN C;  2YU9 B;  1S4Z A;  4OXP A;  1PH5 A;  1HR0 W;  3OWE B;  4JOI A;  3CC2 A;  1LAB A;  1DJR D;  1DYQ A;  1BQQ T;  5IE8 A;  1NJI C;  3I4N B;  3HOZ B;  1H9J A;  2IPK D;  2XIW A;  3K57 A;  2RDF A;  4DV3 Q;  4NP5 A;  3D4D A;  2PMZ E;  4YCW A;  1P16 A;  1PZK D;  1YJW A;  3NWS A;  3V2T A;  1SJH D;  2I07 B;  2WKD A;  4HSP A;  3S1R B;  4GKK L;  5C4Z A;  3M4P A;  1LT3 D;  1GUN A;  1JJC B;  1Z47 A;  2KCC A;  4HJ8 A;  2MO1 A;  2TSS A;  1NY4 A;  5DEH A;  1A2U A;  2ZXR A;  4DAP A;  4N9T A;  1SFO B;  4C3I B;  2AUK A;  2L11 A;  1QJO A;  1WOC A;  1DM0 B;  4DV6 Q;  3JAM c;  4JI3 L;  2B8G A;  2VUM H;  1YJ9 A;  2SOB A;  4KTA A;  1A8V A;  2LFN A;  3CPF A;  1RD9 D;  2QF7 A;  2UUC L;  3PUV A;  3KF6 B;  5FLX c;  4QF4 A;  5CYU A;  1I4G A;  5EJW A;  3F1Z A;  1GO3 E;  5FLX E;  4A3F B;  5J1Z A;  1JT8 A;  3J7Z C;  1KIX A;  3MVV A;  4HN7 A;  4DAY A;  1PA6 A;  3KF8 A;  2HCI A;  4KHP L;  1R4P B;  3EIV A;  4A3D G;  2F3W A;  4KKU A;  4DNR B;  3SVM A;  4CJ1 B;  2PZU A;  2B63 H;  1HQR D;  2JA9 A;  4HSV A;  3NEL A;  3MAQ A;  1KDA A;  1TWH H;  3FP9 A;  1HRJ A;  3SK6 A;  2BA1 A;  3E0J A;  4RGM A;  4IUV A;  1XNR Q;  4RHS A;  4DV4 L;  1QVG A;  4DK3 C;  1EY4 A;  2F0H A;  4LFA L;  1KL9 A;  4DR6 L;  2IT1 A;  2B63 G;  3A55 A;  2B2U C;  1J5E L;  1SRU A;  4X3U A;  3GTQ B;  1B9N A;  1EWI A;  2JEA I;  1K73 C;  5CGK A;  1JWS D;  3PO2 H;  1CKO A;  3UDI A;  4K5W A;  3RNU A;  1EYD A;  2KCT A;  1GHK A;  4FYD A;  1EIH A;  4CHT B;  4LUO A;  1EQQ A;  1E22 A;  3MXN A;  4DXG A;  2EZV A;  1TU2 B;  4HCS A;  1PH2 A;  4EQP A;  5KND A;  4KI0 A;  3S24 A;  4A3G B;  2R7D A;  5KRU A;  1BBX C;  4CJ0 B;  3VR5 A;  1YNJ D;  4PG3 A;  3T51 B;  3NBI A;  5T1G A;  1KD1 C;  2JA6 H;  2PNR C;  3PIP A;  2F4V Q;  5C5M A;  1Y1W B;  1L0X B;  1NAP A;  5IYB G;  4B3S L;  4ZRZ A;  5IYD H;  4WJW A;  1Q1E A;  4RMF A;  1YEZ A;  1WJJ A;  1EIF A;  1PH3 A;  4H44 C;  1SE2 A;  3TP7 A;  3A54 A;  1F2M A;  3B6Y A;  3NHH A;  1T5X D;  2K4K A;  5IP7 G;  4LUZ A;  3K5N A;  3E9I A;  1B4O A;  1C48 A;  3J80 E;  4DR5 Q;  2IX1 A;  1CFM A;  1TKW B;  2F0G A;  5GRO A;  1BXT A;  3CCQ A;  1SAP A;  1EU4 A;  5M3F H;  4A3F H;  2F0V A;  4LF8 Q;  2RQX A;  5CC4 A;  1BCP B;  3CCM A;  1D5Z C;  4EX5 A;  1O7Z A;  1LT5 D;  3S1N H;  1VQM A;  3RZO B;  2XRQ D;  2F0K A;  2WAQ G;  3S2D H;  4HIM A;  4DPG A;  2BDO A;  1EY7 A;  2EYP A;  1A3T A;  3RN2 A;  1XMO L;  1K28 A;  2KEC A;  4GNX B;  1CQV A;  1JE5 A;  5M3F B;  1AH9 A;  5IGE A;  4NPS A;  4HJ7 A;  4NXN Q;  2E8G A;  3CCJ A;  3C3L A;  3MTS A;  4MHE A;  1B50 A;  2JA5 B;  3KUP A;  3TRE A;  2WV6 D;  1LM0 A;  1HUN A;  4A3B B;  4ZQ3 A;  1VMC A;  4X64 Q;  4EQN A;  4QMG A;  2AMC B;  1BDO A;  1RTO A;  1AZP A;  1X3G A;  4KY5 A;  3SGI A;  1U4L A;  4OIK A;  3A5U A;  2VXW A;  1Q1B A;  3PO2 B;  2EDG A;  5ELB A;  3T13 A;  4LUV A;  1MHW C;  3HS0 C;  1WTQ A;  3GTK H;  5GAD C;  4X6A H;  1ONL A;  2X6G A;  1AFP A;  5JVH 3;  5FO7 B;  1VQE A;  2CCZ A;  3P20 A;  4LAA A;  3E0E A;  4ALP A;  3PO3 B;  3SK4 A;  3QOL A;  3QJY A;  1WD1 A;  2N49 A;  4GOP B;  1V8Q A;  2IX0 A;  2JA6 G;  3URY A;  4RGO S;  2VQE L;  3MWY W;  1Q81 C;  4L5Q A;  3FEW X;  2R7Z B;  3G4S A;  1GKH A;  1IBK L;  3PO3 H;  3TEH B;  2E5L Q;  2HHH L;  2HCC A;  2WAQ B;  4XT3 B;  1TXY A;  3PCO B;  1G6P A;  5JJL A;  4BA2 I;  1AEX A;  4EVO A;  1AP0 A;  2GVA A;  4OHJ A;  3BU2 A;  1V1P B;  5E1F A;  1JWU D;  5J39 A;  1I4R A;  1JQY D;  1X55 A;  3OW2 A;  1STY A;  3BYT B;  4KHP Q;  2F4I A;  4A76 A;  4CJ2 C;  4CGY B;  3J7A 5;  3G71 A;  1IBL Q;  3OIQ A;  1E3P A;  1K3B C;  4KHZ A;  1V1Q A;  1D8L A;  2TMP A;  3J7Y W;  4NW2 A;  3F2B A;  1Q8I A;  2HQE A;  5EPJ A;  4C3J H;  2XSC A;  3KDF B;  3P1H A;  4ZUI A;  3H09 A;  1JMC A;  4OIJ A;  2JA5 H;  1A6X A;  4A75 A;  2Q2U A;  5KYL A;  1TWA H;  2A8V A;  1UE1 A;  3CCL A;  1OXV A;  4JYA L;  1K0S A;  3PMF A;  1N36 Q;  4IUU A;  5JPN C;  4POF A;  1VQP A;  3NEN A;  1T9H A;  5M5X H;  3NTH A;  4C2M H;  1E1T A;  1FJG Q;  3GP7 A;  4LF6 L;  3V96 A;  3R3O A;  4F8M A;  1KHI A;  1EYC A;  1TQO A;  3NWT A;  1EY8 A;  3EVQ A;  2A68 D;  3JAM E;  1WTP A;  4YWL A;  1QIL A;  2NUC A;  4CKB A;  1HTP A;  1K0R A;  4BS9 A;  4C2M B;  4IUQ A;  1D2B A;  5FKA C;  2ZXP A;  3CME A;  3IKJ A;  3VR3 A;  2V4D A;  1STB A;  1FVI A;  1I6V C;  1KTK A;  1PYW D;  4KN4 C;  1B3Q A;  4N9P A;  3O13 A;  2K28 A;  4K0K Q;  1IZ6 A;  4AIM A;  5E3F A;  5LMN Q;  4DU9 A;  2JA7 H;  3L7Z C;  4Y7N B;  1ESR A;  2B2U A;  1M8A A;  1VF5 C;  5JVG 3;  4IZ8 A;  5A35 A;  4JBM A;  5FOB B;  2R92 G;  5K36 H;  2BE5 D;  5IOD A;  2QA4 A;  5FLM H;  4DR2 L;  1DGS A;  4QJF A;  5HGT A;  3I91 A;  1BO0 A;  3NUC A;  3CF5 A;  1QZH A;  4DV2 Q;  2BH8 A;  4LFC Q;  4F7X A;  2M9V A;  1BCP F;  4DR4 Q;  1QE6 A;  1XWE A;  5IP9 G;  5FO9 B;  3X3N A;  3VDY A;  5C3X A;  3MA2 B;  5E4W C;  3K7A H;  2EY6 A;  1ILQ A;  4GOP C;  2Y0S G;  1KLU D;  1AZQ A;  3W1G A;  3RZD B;  1C9O A;  1V43 A;  2Q8I B;  5CV6 A;  3L0O A;  2DNC A;  3A74 A;  4B9W A;  2CKZ B;  1IW7 D;  1SXT A;  3PUW A;  1H9S A;  3EA6 A;  2UXC Q;  1NE3 A;  5IP9 H;  3HRZ C;  4MN3 A;  3GTL H;  1S5C D;  1ESF A;  4G7Z C;  3HOW B;  3D6W A;  1S5B D;  1B1Z A;  5ELE A;  4BXX G;  1TWA B;  2RSN A;  3BVM A;  3U4V A;  3G7L A;  4IN3 A;  2MJ8 A;  2YTV A;  1DCZ A;  1LT4 D;  1QWY A;  1G2S A;  1AW7 A;  2F0Q A;  1HA5 A;  3F2D A;  1HNZ L;  3NQI A;  3FKI G;  3HOU B;  2UXB Q;  2CHB D;  4OO1 I;  4V19 0;  1LYL A;  2RKS A;  3HZX A;  2J4X A;  5T1I A;  3ZYY X;  2YV5 A;  1SMY D;  2Q2T A;  4BBS B;  2LXJ A;  1XX8 A;  1RTN A;  5EPL A;  1E2W A;  1PRT D;  3RZO H;  1IBL L;  3EFX D;  5J3B A;  3F2U A;  4RKB A;  1X32 A;  4Q5V A;  1EYG A;  3D0F A;  3I56 A;  3CQZ H;  1N34 Q;  2D0P A;  4ZUJ A;  2WIN B;  2F0M A;  2UUB L;  3PIO 3;  1M90 C;  1FNV A;  1D1K A;  1YHA A;  3HOX H;  1RIP A;  3E6Z X;  3PF5 A;  4A3B H;  1XMO Q;  2XVS A;  4PQX A;  1NUC A;  3DEO A;  1SYG A;  2EY5 A;  1UUP A;  1N36 L;  4KN7 C;  4WJ4 A;  5D3D A;  1GOZ A;  4MTN A;  4DUY Q;  3Q24 A;  4AH6 A;  1E2V A;  4BY1 G;  1JWM D;  3GTK B;  1F9P A;  3OMG A;  2K01 A;  2JA6 B;  4IFD I;  5C6A A;  1E0B A;  4PMC A;  5M3M B;  5FO8 B;  3A0J A;  3I4M G;  2NVX B;  5JEA G;  5I4D A;  2LXK A;  4RCN A;  2PI2 A;  3NBH A;  3U9O A;  3K7A B;  4DGZ A;  4PMW A;  1OXT A;  1VQB A;  3H3V H;  4UP8 A;  1U4R A;  2OT2 A;  4HIK A;  1WTH A;  1VQJ A;  4K5X A;  3E9H A;  4UAI A;  1B44 D;  2F0E A;  5LL6 X;  2H5X A;  5JJI A;  2VB3 X;  5ELC A;  2L4N A;  5D14 A;  1Q82 C;  3GTG H;  3GO5 A;  1ET9 A;  3CRK C;  4NXN L;  2QGQ A;  1HFG A;  2I5M X;  2K50 A;  4DK1 A;  1TR5 A;  4N8X 1;  2QDB A;  4ZKC B;  1ZEQ X;  2CW0 D;  1MJC A;  1MJE A;  2WAQ E;  4A3I G;  2UU9 L;  1CTM A;  2E5L L;  2UUA Q;  4G4K A;  4DV2 L;  4LFC L;  4ABN A;  3S2D B;  1V9P A;  2A5H A;  2ES2 A;  4L5T A;  5CBA E;  4IUP A;  4A3M B;  3OSO A;  1RF2 D;  2E2J H;  5M5W B;  2RHS B;  1JB7 A;  1CA6 A;  1K83 H;  3LX0 A;  1B2T A;  4A4I A;  1XNQ L;  1ML0 D;  3M7N A;  2NYZ D;  3ERO A;  4OEM B;  3Q22 A;  1CA5 A;  2QEX A;  3ITP A;  1F2L A;  2WB1 B;  2CWA A;  3BZC A;  1A2T A;  4IJL A;  4L5R C;  5COY A;  2VQE Q;  5IIF A;  4X62 Q;  1HUM A;  5M5W H;  4QCL A;  3T1Y Q;  1VQ6 A;  3E5S A;  2CH4 W;  3K8A A;  3OYY A;  1EOV A;  1XTD A;  3DM1 A;  5H1S E;  4DAV A;  4NKL A;  3U9S A;  5BR8 Q;  3KBG A;  4GLA C;  3AFQ A;  1GD7 A;  2B2Y A;  4YY3 L;  3JAM L;  2FIN B;  3GD7 A;  1PZI D;  2I0Q A;  5GAG C;  2SNM A;  3H0G B;  1OXS C;  2RHQ B;  4IPG A;  4NDX A;  3TZU A;  2R61 A;  3FVQ A;  2VB2 X;  3VR4 A;  1VQN A;  2DY7 A;  1A63 A;  1SLJ A;  3NTK A;  1PXU A;  2HUG A;  1X54 A;  3FMC A;  3N52 A;  5LL6 S;  2HIV A;  1I6H H;  2XNA C;  4JI0 L;  1E24 A;  1SYF A;  1TWF B;  4OGQ C;  1AE3 A;  1HHV A;  3I4N H;  1FNU A;  1N9W A;  1SYC A;  3K5M A;  1A15 A;  5C4J B;  1XJV A;  2KEE A;  4FF1 A;  4C3J G;  4DR1 L;  4K2L A;  1TY2 A;  4LFB Q;  2BOS A;  2OTJ A;  4NXM Q;  2NVQ H;  5D65 A;  1IXR A;  2EYM A;  4JYA Q;  2JXM B;  1FNW A;  1SNO A;  2MFI A;  1H9S B;  1HNX Q;  2GA4 B;  2HQL A;  1B3A A;  2K5D A;  3R8B A;  1PYS B;  2A6E D;  2CVR A;  4AYB G;  2I5L X;  2Y0S E;  1PH9 A;  2F0W A;  1KC8 C;  3D8G A;  4WJ3 M;  1QVC A;  1S5E D;  2E2J B;  2ZXO A;  3ULL A;  4LF5 L;  3R2T A;  2J7Z A;  1HZB A;  5GAE C;  2KA7 A;  5C0X H;  3F2C A;  5KNC A;  2C9O A;  1VQL A;  3R93 A;  4IPC A;  1PH8 A;  2OF1 A;  5M5X B;  4P73 A;  3STB C;  3S1M H;  1HH2 P;  1WTR A;  3HOW H;  4KD4 A;  2FFK B;  3I4N G;  4QL5 A;  2MP1 A;  4OL7 A;  4UDU C;  2RDG A;  2A1A A;  2L15 A;  2UU9 Q;  3S15 B;  1DON A;  2F0D A;  4MTK A;  4RAU C;  3TP6 A;  2O5I C;  4B3R Q;  1WYD A;  2JQO A;  3QB3 A;  2DY8 A;  2CW0 C;  4KY7 A;  5M3M G;  1EU3 A;  3PUX A;  3GTJ H;  4DR4 L;  2PW5 A;  3U50 C;  5C3E H;  1HNZ Q;  4ME5 A;  1HA6 A;  4Y7N H;  2RDH A;  5LMU Q;  5CV8 A;  3UE0 A;  2DJG C;  3KOJ A;  3AU7 A;  1NR4 A;  2KCM A;  4DUZ L;  1EWH A;  2V1C C;  3MXG A;  1UE5 A;  5DLQ E;  1K8A C;  2PW7 A;  1PH1 A;  1I94 Q;  5BN3 A;  2F0S A;  2D9U A;  3I72 A;  3GTJ B;  1IBM L;  1PTO B;  2R93 B;  2ZM6 L;  1UE7 A;  1IYV A;  5C4X H;  4DR7 Q;  5KNB A;  1TS5 A;  3L3O C;  3P75 A;  1RDP D;  1D1I A;  2D0O A;  3HOX G;  1O7L A;  1L0W A;  1PHJ A;  1PVO A;  2N78 A;  2PQA B;  5I2X A;  2B2W C;  3M7G A;  1SFO H;  2LMC B;  1PTO H;  2R93 H;  4U67 3;  4G7O C;  2QEJ C;  5E7N A;  4X3K A;  5C0X J;  2WB1 G;  1W6K A;  2NVX H;  3MFY A;  1K8O A;  1UE6 A;  4DUY L;  1GHJ A;  4A93 H;  2XTI A;  2NWG A;  5JOB A;  4JI5 L;  1I4Q A;  1PH6 A;  2G9D A;  4QGU A;  1RCV D;  2F0O A;  3MXU A;  2HT1 A;  5IOC A;  3S1Q H;  1Q8K A;  1L1O B;  1VF7 A;  2Z6B A;  1XNR L;  5C4H A;  4K5V A;  4JI2 Q;  5I2Y A;  3Q6S A;  1LTG D;  4CDF C;  1E1O A;  4A3E B;  2IHE A;  2QCP X;  3HKZ G;  3KJO A;  2XGT A;  3QO2 A;  3RLN A;  3BYY B;  2OCE A;  1PTO F;  3TS2 A;  5IWA Q;  3HOU H;  5BR8 L;  3OHX C;  4DKA C;  4KY6 A;  4A93 G;  4C1N I;  3CAM A;  4ZAI A;  3FRP B;  4YY3 Q;  4GKK Q;  5I6Y A;  3EBE A;  2RF4 A;  4DXF A;  2Q8T A;  4FNF A;  3VYR A;  1G51 A;  1PTO D;  2NN6 I;  4LJZ C;  2BA0 A;  1VMP A;  1STE A;  2H1E A;  4DAY B;  1EL0 A;  4KMU C;  2HIX A;  3CRL C;  3GTP B;  4Y52 H;  4FP5 D;  3I90 A;  3HOZ G;  2AKW B;  1JIC A;  4A3I H;  2AQ1 B;  1IYJ B;  2RA4 A;  1SNM A;  3V05 A;  3NPP A;  3TBI B;  4S3S A;  4DV7 Q;  1IW7 C;  1QCB D;  4JI0 Q;  1IKL A;  3S2H B;  3J81 i;  3PSI A;  4JBJ A;  5I6W A;  2PPB C;  3FPU B;  2E76 C;  2FMC A;  4DV3 L;  4A3L H;  3T16 A;  3M3Y B;  3D6C A;  1Y69 U;  4DV1 Q;  2R92 H;  1JC7 A;  1OXU A;  2MNA A;  1CUK A;  3P7J A;  5KYI A;  1JR0 D;  5EKI A;  1XXG A;  2MPM A;  3G48 A;  3M4O B;  2L1B A;  4BBR H; 
#chains in the Genus database with same CATH homology
 4X64 L;  2PNH A;  4DV5 Q;  1WCM H;  2VY3 A;  3AYH B;  5FJ8 H;  4JBM A;  3J80 c;  4A3K G;  2R92 G;  1RL2 A;  2KHJ A;  3J80 i;  4BA1 I;  2QA4 A;  4LNQ A;  1A0I A;  1TWC H;  4GN5 A;  5FLM H;  4DR2 L;  1CSQ A;  1DGS A;  4QJF A;  3CCR A;  1VQD A;  4HJ5 A;  3CF5 A;  4GNX A;  4A3F G;  4A3M G;  4DV2 Q;  1BKB A;  2BH8 A;  1QZH A;  4LFC Q;  3HOY H;  2JJQ A;  1R9T H;  4GS3 A;  1GVP A;  5IP9 G;  4DR4 Q;  5M5Y H;  2UUC Q;  1P8L A;  4JG2 A;  4O0A A;  3VDY A;  3DM3 A;  1W2B A;  3K7A H;  3IRB A;  5LMU L;  1VQ7 A;  1VQG A;  4GOP C;  4GLV B;  4LF7 L;  2Y0S G;  1Y1V G;  4R4O A;  1QZG A;  2ZJQ A;  3W1G A;  1WCM G;  1C9O A;  1J6Q A;  1V43 A;  4UY8 C;  4PZ7 A;  3HOV G;  4R1J A;  1VQC A;  2F52 A;  3PIO A;  4R4I A;  3KJP A;  3UDX A;  3PUZ A;  3S1R H;  3L0O A;  2WP8 J;  1KQS A;  3PV0 A;  1HR0 Q;  4JI4 Q;  4A3L G;  3A74 A;  3CMA A;  2CKZ B;  1LUZ A;  1BBW A;  3CP0 A;  3PUW A;  1VQF A;  4MZ9 A;  4X62 L;  3CCS A;  2UXC Q;  1NE3 A;  5IP9 H;  3U58 A;  3GTL H;  1CKM A;  3PGZ A;  2F4V L;  3GTM H;  4GN4 B;  5HGQ A;  1JT8 A;  4BY7 G;  2NVY H;  4C3I H;  4JC0 A;  4B3T L;  2DUD A;  1J5E Q;  4JCV E;  1CSP A;  1VS0 A;  3ER0 A;  4BXX G;  1K3R A;  2Q2H A;  1G29 1;  3U4V A;  5IT9 c;  4UP7 A;  2VL6 A;  4GKJ Q;  1Q12 A;  2YTV A;  1X56 A;  4P72 A;  3GTO H;  3M85 A;  1VQ9 A;  4POG A;  1H95 A;  4OX9 L;  1XMQ Q;  4NXM L;  3F2D A;  1HNZ L;  3FKI G;  4A3E G;  2UXB Q;  3HKS A;  4ME3 A;  4OO1 I;  1LYL A;  3UE1 A;  1GM5 A;  4JI5 Q;  3UDF A;  4IJH A;  4X66 Q;  3I2Z A;  3OTO Q;  1PH4 A;  4DR5 L;  2YV5 A;  4JI7 L;  4OON A;  2Q2T A;  2LXJ A;  2VZA A;  1PH7 A;  2OTL A;  4MNO A;  4JI1 L;  1SMX A;  1YHB A;  3HFZ B;  4JI6 Q;  2NZO A;  3RZO H;  4JI8 L;  1IBL L;  1KRS A;  3GDE A;  5J3B A;  3ZJY C;  4DAM A;  4LF4 Q;  1SE8 A;  4A3B G;  3CW2 C;  1N33 L;  4A3J H;  1Y1W G;  5IYC G;  4IPH A;  1IBK Q;  1EYG A;  1Q46 A;  1CKN B;  3D0F A;  1YJN A;  3I56 A;  3CQZ H;  1PFS A;  3K7U C;  1Q86 C;  1N34 Q;  2D0P A;  4HJA A;  1VQ8 A;  2R7F A;  2UXD L;  2UUB L;  3HOU G;  3H0G G;  1M90 C;  1YVC A;  2B29 A;  1YHA A;  4O2D A;  2HHH Q;  3M4Q A;  3HOX H;  1RIP A;  1ASZ A;  4LF5 Q;  2IY5 B;  3PF5 A;  4UP9 A;  2R7Z H;  4A3B H;  5C0X G;  1XMO Q;  3ICE A;  5M3M H;  1N8R C;  2ATW A;  1N36 L;  1FGU A;  1YHQ A;  1BBU A;  4HJ9 A;  4WJ4 A;  4MTN A;  3MEF A;  5FJ8 G;  3CXC A;  1ASY A;  4LFB L;  4DUY Q;  4R4T A;  2AHO B;  1EFW A;  1YZ6 A;  4YCV A;  4AH6 A;  4R4C A;  4BY1 G;  1UWV A;  4OXP A;  1PH5 A;  1HR0 W;  4LF6 Q;  4IFD G;  1NMF A;  4JOI A;  4IFD I;  4B3M Q;  3CC2 A;  1PV4 A;  2JA8 G;  3A0J A;  3KLW A;  3M4O H;  4GNX C;  3I4M G;  5IE8 A;  3CCU A;  5JEA G;  1NJI C;  2ZJR A;  2LXK A;  2EXD A;  2N3S A;  2PI2 A;  1HJP A;  3PO3 G;  5C4X G;  3KF8 B;  4PMW A;  1OXT A;  1VQB A;  4LF8 L;  3FHW A;  1VQ5 A;  1NMG A;  3H3V H;  4UP8 A;  4UPA A;  4DV3 Q;  4A3C G;  4HIK A;  2YU9 H;  1VQJ A;  1KAW A;  1IL2 A;  4JV5 L;  3HOV H;  3E9H A;  4DNI A;  2PMZ E;  4YCW A;  1P16 A;  5C3E G;  1YJW A;  2H5X A;  5JJI A;  4X65 Q;  3L2P A;  2KBN A;  3LGJ A;  1HNW L;  4GKK L;  5LMN L;  1VCI A;  1N32 Q;  3M4P A;  2EIF A;  1KRT A;  1JJC B;  1Q82 C;  1Z47 A;  3GO5 A;  3GTG H;  4YHH L;  1PYB A;  4NXN L;  2QGQ A;  2I5M X;  2K50 A;  4HJ8 A;  2KHI A;  2MO1 A;  3T1H Q;  1NY4 A;  4DV5 L;  1U5K A;  1VQA A;  1IBM Q;  3KDF A;  3UDG A;  1MJC A;  1MJE A;  2WAQ E;  2ZM6 Q;  4A3I G;  2VW9 A;  1WFQ A;  5FLM G;  1C7Y A;  2UU9 L;  1WOC A;  2IHF A;  2WB1 E;  4DR2 Q;  4DV6 Q;  2E5L L;  3JAM c;  4JI3 L;  2VUM H;  2UUA Q;  3H15 A;  2CQO A;  4DV2 L;  4LFC L;  1YJ9 A;  1Z9F A;  1V9P A;  1A8V A;  4B3R L;  3CPF A;  4L5T A;  2ES2 A;  1AE2 A;  1N32 L;  2UUC L;  3PUV A;  3KF6 B;  5FLX c;  1XPU A;  5ELN A;  3U4Z A;  2JA5 G;  3F1Z A;  1GO3 E;  1D7Q A;  4TVA B;  5ELO A;  1S40 A;  2E2J H;  3J7Z C;  1YIT A;  3I7F A;  2RHS B;  3STB D;  2NZH A;  1M1K C;  1K83 H;  3I55 A;  1PA6 A;  1JB7 A;  2JA7 H;  4YWK A;  2VUM G;  4BBR G;  3NBH B;  1FL0 A;  4KHP L;  4TQU S;  4A4I A;  1XNQ L;  3EIV A;  3M7N A;  4A3D G;  4PZ6 A;  2K52 A;  3K81 C;  4QIW E;  3A5Z B;  1E7Z A;  2QEX A;  4AQY L;  1NBW A;  4DUZ Q;  3H3V I;  3S15 H;  2B63 H;  2JA9 A;  2GN5 A;  2N8N A;  3NEL A;  1TWH H;  2CWA A;  3BZC A;  4IJL A;  4FDB A;  4L5R C;  1I94 L;  3FP9 A;  4QQB X;  3M3Y H;  5AJ3 L;  2VQE Q;  4LW1 A;  2BA1 A;  4X62 Q;  4OWW B;  1XNR Q;  2UXC L;  3KYH C;  5M5W H;  4DV4 L;  1QVG A;  4JI2 L;  4DK3 C;  4A3D H;  3T1Y Q;  3Q8D A;  1VQ6 A;  5K36 G;  4DV0 L;  4LFA L;  1KL9 A;  4DR6 L;  4DR7 L;  2IT1 A;  4IFD J;  4XIG S;  3K8A A;  3OYY A;  2B63 G;  2CFM A;  2OWO A;  1EOV A;  1X3F A;  1XTD A;  1J5E L;  5H1S E;  1SRU A;  4B3T Q;  3J81 c;  5IWA L;  4P74 A;  5BR8 Q;  1EWI A;  4C3H H;  2JEA I;  1K73 C;  1I50 H;  2LSS A;  4GKJ L;  4IO9 A;  4GLA C;  3AFQ A;  1GD7 A;  3PO2 H;  4YY3 L;  4OX9 Q;  1XMQ L;  1CKO A;  4JBW A;  3GD7 A;  1VQI A;  3UDI A;  3RNU A;  2I0Q A;  2KCT A;  5GAG C;  4X66 L;  3DLL A;  2JE6 I;  2ZTE A;  3OTO L;  1OXS C;  4LUO A;  4LF9 Q;  2RHQ B;  4IPG A;  1EQQ A;  1E22 A;  1O7I A;  4J15 A;  3AEV A;  3GTQ H;  2OQK A;  4JI1 Q;  1A62 A;  1PH2 A;  2Q2I A;  4IPD A;  4JI6 L;  1VQN A;  3HOZ H;  1A63 A;  1SLJ A;  4KI0 A;  3S24 A;  2R7D A;  1HR0 L;  1EQR A;  1X54 A;  4AYB E;  3RR5 A;  5LMN W;  1YIJ A;  5JJK A;  4PG3 A;  1Q7Y C;  2I5H A;  2HIV A;  1XPO A;  5HY6 A;  1L1O A;  3G6E A;  1N34 L;  4NB3 A;  1KD1 C;  1I6H H;  4JI0 L;  2JA6 H;  3H0G H;  1E24 A;  1S3O A;  3JC6 6;  1L1O C;  1Y14 B;  3PIP A;  2F4V Q;  1AE3 A;  4OWT B;  1B7Y B;  5IYB G;  4B3S L;  2DGY A;  2ZTC A;  3I4N H;  1N9W A;  1X65 A;  1X9N A;  4XTC S;  1QVF A;  5IYD H;  5M3F G;  2GVB A;  1XJV A;  1Q1E A;  3J81 j;  4RMF A;  3AFP A;  1L2F A;  4DR1 L;  1CKN A;  1YEZ A;  2AWN A;  2D62 A;  1HZA A;  1WJJ A;  2BH2 A;  1EIF A;  1PH3 A;  4LFB Q;  2OTJ A;  3TRZ A;  4NXM Q;  3RLO A;  2NVQ H;  1IXR A;  3B6Y A;  2PQA A;  4JYA Q;  2K4K A;  2MFI A;  5IP7 G;  4LUZ A;  1HNX Q;  5IYD G;  3CD6 A;  2HQL A;  4R4Q A;  3CPW A;  3E9I A;  4DR5 Q;  2IX1 A;  1X6O A;  3W5O A;  1K8G A;  2VS1 A;  4RG1 A;  3ULJ A;  4JI7 Q;  2NVT H;  3S16 H;  4IOA A;  2JA8 H;  5GRO A;  1PYS B;  4IOC A;  2JA7 G;  4LWC A;  1FJG L;  4AYB G;  4DR3 Q;  2I5L X;  3CCQ A;  2Y0S E;  2E2H H;  1PH9 A;  3BJU A;  5M3F H;  1KC8 C;  3KFU A;  4WJ3 M;  1QVC A;  4A3F H;  2AWO A;  4A3M H;  4LF8 Q;  1LTL A;  4DV7 L;  1SN8 A;  2VQF Q;  3CCM A;  1KIX A;  3ULL A;  4EX5 A;  2Z6K A;  4QY7 A;  3S1N H;  4EQ5 A;  1VQM A;  4BY7 H;  3FKI H;  4A3E H;  4LF5 L;  2WAQ G;  3S2D H;  1HZB A;  3RLF A;  5IP7 H;  5GAE C;  4HIM A;  4DPG A;  4X65 L;  3F2C A;  1XMO L;  3RN2 A;  1VQL A;  4YCU A;  2ZJP A;  1Y1V H;  3HOY G;  3K80 C;  4GNX B;  4IPC A;  1PH8 A;  1JE5 A;  2MQH A;  4P73 A;  3GTP H;  1I5F A;  1AH9 A;  4DV1 L;  4NPS A;  1SRO A;  3STB C;  4HJ7 A;  4NXN Q;  2K14 A;  2E8G A;  3S1M H;  1K9M C;  1HH2 P;  3CCJ A;  4K0K L;  2ALY B;  1B70 B;  1U0L A;  1VQ4 A;  3I4M H;  3HOW H;  4L5S A;  3JAM i;  3TRE A;  3I4N G;  4QL5 A;  1LM0 A;  2A1A A;  2L15 A;  4X64 Q;  5JEA J;  2UU9 Q;  3W1B A;  2AMC B;  4DV6 L;  1X3G A;  3ERS X;  3SGI A;  3PO2 G;  3S2H H;  3A5U A;  1Q1B A;  4B3R Q;  4HIO A;  1WYD A;  2F3I A;  2JQO A;  2K5N A;  3HKZ E;  4LUV A;  3K0X A;  3WWV A;  3S17 H;  3I4O A;  5M3M G;  1VQK A;  3GTK H;  5GAD C;  3RN5 A;  3PUX A;  4BBS H;  3GTJ H;  4X6A H;  4JOI C;  4DR4 L;  4JI4 L;  1VQE A;  2CCZ A;  3U50 C;  5C3E H;  1HNZ Q;  3E0E A;  2UXB L;  4Y7N H;  5LMU Q;  4ALP A;  2B3G A;  3UE0 A;  2KEN A;  3KOJ A;  4LF7 Q;  2N49 A;  3CC4 A;  4AQY Q;  2KCM A;  4DUZ L;  1UEB A;  2E2I H;  4P71 A;  1NTG A;  5GAH C;  2V1C C;  4GOP B;  5DLQ E;  1UE5 A;  1K8A C;  4YHH Q;  4GLX A;  1PH1 A;  2IX0 A;  2JA6 G;  1I94 Q;  2ZTD A;  5AJ3 Q;  2VQE L;  4A3C H;  1YNX A;  2YTY A;  4HID A;  1Q81 C;  4L5Q A;  1IBM L;  5C0X I;  3G4S A;  1GKH A;  1N33 Q;  1IBK L;  2ID0 A;  1UE7 A;  2ZM6 L;  1YI2 A;  1TWG H;  5C4X H;  1Y1W H;  1OTC A;  1EIY B;  3PO3 H;  3TEH B;  4DR6 Q;  4DR7 Q;  1VQH A;  2R6G A;  3BZK A;  2JK8 A;  2R93 G;  2C35 B;  2E5L Q;  2UUB Q;  2UUA L;  2HHH L;  1X3E A;  2D0O A;  3HOX G;  3HOW G;  1TXY A;  3PCO B;  1L0W A;  5JJL A;  1PHJ A;  1PVO A;  5IYC H;  4BA2 I;  1OXX K;  3CCV A;  1G6P A;  2N78 A;  2PQA B;  1TWF H;  3RZD H;  2GVA A;  1JJ2 A;  2NN6 G;  2Z6K C;  4H02 A;  3BU2 A;  1SFO H;  2R93 H;  4DK6 C;  2WFW A;  5E7N A;  5C0X J;  2WB1 G;  2NVX H;  1X55 A;  3OW2 A;  1WI5 A;  1MKH A;  2FXQ A;  1UE6 A;  4DUY L;  4KHP Q;  4P75 A;  4A93 H;  2CWP A;  2XTI A;  4A76 A;  4JI5 L;  1PH6 A;  1EUJ A;  4BY1 H;  4QGU A;  3D31 A;  5GQO A;  1HZ9 A;  1QUQ B;  3J7A 5;  1SR3 A;  4APV A;  1S72 A;  2HT1 A;  4BBS G;  4B3M L;  3S1Q H;  3G71 A;  1Q8K A;  4JI8 Q;  1L1O B;  1IBL Q;  4LF4 L;  1XNR L;  1E3P A;  4JI2 Q;  4DV4 Q;  1KXL A;  4GN3 B;  4KHZ A;  4GOP A;  5C44 H;  3T1Y L;  4DV0 Q;  1E1O A;  1V1Q A;  4LFA Q;  2IHE A;  5IYB H;  3HKZ G;  3CCE A;  1D8L A;  2OQ0 A;  3KJO A;  4B3S Q;  2XGT A;  4YWM A;  3RLN A;  2RCN A;  4JBK A;  2OCE A;  2UXD Q;  3F2B A;  3EN2 A;  2EQS A;  3TS2 A;  2VNU D;  5IWA Q;  2A19 A;  5IY0 A;  5BR8 L;  4C3J H;  4DKA C;  3MXN B;  3HOU H;  2K75 A;  2PI2 E;  4A93 G;  3KDF B;  3S14 H;  3CAM A;  4OWX B;  4KLK A;  1JMC A;  4YY3 Q;  4GKK Q;  2JA5 H;  4A75 A;  2Q2U A;  3EBE A;  1TWA H;  2A8V A;  1UE1 A;  2RF4 A;  1OXV A;  3CCL A;  1JJG A;  4JYA L;  1G51 A;  2NN6 I;  1N36 Q;  4OO1 G;  4POF A;  2BA0 A;  1HNX L;  2YTX A;  1VQP A;  4LF9 L;  1QUQ A;  3T1H L;  3NEN A;  4DAY B;  3F8T A;  1T9H A;  3KF6 A;  4C2M H;  5M5X H;  1E1T A;  2HIX A;  5C44 G;  4Y52 H;  3TS0 A;  1B8A A;  3HOZ G;  1MIU A;  2AKW B;  1VQO A;  4A3I H;  4DR3 L;  1IYJ B;  4LF6 L;  1FJG Q;  1W3S A;  2ASB A;  3PF4 A;  1KHI A;  4JI3 Q;  2K5H A;  5EAY A;  4DV7 Q;  2VQF L;  4YWL A;  4JI0 Q;  1YBY A;  3AQQ A;  3J81 i;  1K0R A;  2MO0 A;  3PSI A;  4JBJ A;  4DV3 L;  4A3L H;  4A3G H;  4A3J G;  1XPR A;  4JV5 Q;  3CME A;  4PZ8 A;  4DR1 Q;  1FVI A;  2JEB I;  1XNQ Q;  1C0A A;  3NEM A;  1I3Q H;  4DV1 Q;  2YYZ A;  4A3K H;  2R92 H;  1HNW Q;  4K0K Q;  1IZ6 A;  4AIM A;  1OXU A;  3M9B A;  1BVS A;  2MNA A;  1CUK A;  3L7Z C;  2Z0S A;  3PUY A;  5LMN Q;  3CC7 A;  3ULP A;  3TQY A;  1HZC A;  2R7Z G;  4A3G G;  3G48 A;  2K5V A;  4BXX H;  4BBR H;  5C4J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...