2KA7A

Nmr solution structure of tm0212 at 40 c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
MKMKKYTKTHEWVSIEDKVATVGITNHAQEQLGDVVYVDLPEVGREVKKGEVVASIESVKAAADVYAPLSGKIVEVNEKLDTEPELINKDPEGEGWLFKMEISDEGELEDLLDEQAYQEFCAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Glycine cleavage system H protein
publication title The J-UNIO protocol for automated protein structure determination by NMR in solution.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 26
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ka7A00
4GZYC 1Y8PB 1CI3M 2QF7A 3ND9A 1IW7C 3FMCA 4DK1A 2BDOA 1HQMC 4H44C 4KI0A 4KN4C 1A6XA 2CW0C 1H9SA 3NE5B 1CFMA 2NN6I 1BDOA 1H9SB 1ZYRC 3FPPA 3PUXA 1VF7A 2K33A 2E75C 1LACA 4LJZC 1QJOA 4OO1G 2JEAI 4BA1I 2O5IC 4JBWA 3M85A 1DD2A 3QJYA 2K7VA 3N6RA 2Q8IB 2YYZA 1TU2B 3LNNA 3SDZA 3QIAA 1IW7D 2BE5D 4KN7C 2A69C 2L5TA 4OO1H 1HPCA 2EDGA 2JXMB 4PV1C 1T5EA 3RLFA 3T56B 3HGBA 1DCZA 2PNRC 1K8MA 3IKJA 1DXMA 2B8GA 1E2ZA 2R6GA 5KNBA 1GHKA 2D2CC 1OXTA 3KLRA 3T53B 4RCNA 4DNTB 3QG1A 1E2VA 2F1MA 4XTCS 5JEAH 5A35A 2A69D 4G7ZC 5C0XH 1GUNA 4KKTA 5KNCA 1YNNC 2BE5C 2EVBA 2AUKA 2KA7A 2E74C 4BA2I 3LWUA 3VR2A 3PUVA 2AWOA 2E76C 1IYVA 1PMRA 4TQUS 1H9RA 2DNCA 3I72A 1EWHA 2O5JC 1GUOA 4KMUC 2ZT9C 1VDZA 1OXVA 3H94A 3P20A 3PV0A 3OW7A 1H9MA 4OGQC 4DNRB 1YNJC 5JEAG 3VR5A 1Q90A 4I7ZC 1GJXA 1OXSC 4TKOB 1O78A 1VCIA 5C0XG 1VF5C 1E2WA 1FYCA 4KKUA 1Q1BA 3D31A 2EJMA 1IYUA 4IQZA 1Y69U 1H9JA 2AUJD 3IFTA 3PUZA 1Q1EA 1SMYC 2D62A 3VR4A 2BA0A 5BN3A 3DXJC 2A6HD 2JE6I 3D4RA 3ND8A 2PPBC 1Q12A 1G291 4XIGS 3CRLC 3OPOA 2JEBI 2D5DA 3GD7A 3A8KE 4H0LC 4KHZA 3M7NA 4H13C 3U9SA 1V43A 1Y8OB 2DN8A 2NN6H 3A8IE 3A7LA 3BG3A 3GQBA 4LK1C 3PUYA 4HR7B 4IFDG 1V8QA 1K8OA 1Z6HA 3MFYA 5BN4A 2V4DA 2A6HC 2BA1A 1HTPA 3EQLC 3PUWA 1HCZA 3T51B 2KCCA 1CTMA 2A68D 4IFDH 2A6ED 1FR3A 5K36H 2EJFC 3WDNA 3M4YA 1GUSA 1H9KA 3VR6A 1GUGA 1B9MA 3AB9A 3I73A 1TKWB 5BN5A 5KNDA 1Y8NB 3L7ZC 4JK1C 3BDOA 3VA7A 2DNEA 1LABA 3W3AA 1O7LA 3OOCA 2IT1A 3SE0A 2NN6G 1OXUA 2EJGC 2PCFB 4KKSA 1ZKOA 2LMCB 4DK0A 4G7HC 2A68C 4G7OC 2A6EC 3I4LA 4L8JA 1Z7TA 3TZUA 3A7AB 3MXUA 5K36G 1ONLA 2K32A 3CRKC 1GUTA 2B8FA 3A8JE 1I6VC 3VR3A 1GHJA 1OXXK 1B9NA
chains in the Genus database with same CATH superfamily
1GVPA 3I4MG 5AJ3L 4ZYSA 3C1EA 2CW0C 2MO1A 2L1BA 1UE1A 4V0BA 3CC7A 2M9VA 1OTCA 4EQOA 4B3RQ 1MIUA 4PZ7A 5DM73 2F0VA 4A3DB 1HR0Q 3EROA 1T5EA 3RUZA 4LF9L 4EQPA 4BXXH 4LFAQ 1EOVA 1EU3A 1QG7A 4BY1G 4A3CG 1NTGA 3B6YA 1EQVA 1WOCA 1C8CA 3U50C 2OQ0A 4F87A 3PO2G 2IW3A 1Y1WH 2A8VA 1YBYA 1SEBD 2WKDA 2Z0SA 2AWOA 3PUVA 1HR0W 5G3LF 4NMZA 2WINB 2B2VA 2UUCL 3MEFA 2SNMA 3HKZB 2EYPA 1SE8A 2F0FA 4OL7A 5C4JB 3K0XA 4LFAL 4L5SA 2ZTCA 5JEAG 1Y1WB 5JEAJ 1OXSC 3DWPA 3QOJA 4B9XA 2YTXA 1QUQB 1Q1BA 2F4IA 1WD1A 1CKMA 1UWVA 4RKBA 3TP6A 1Z47A 2L0CA 2CH4W 4GOPC 1C0AA 3NUCA 1NMFA 4P72A 1SMYD 2R93H 4H0LC 2EE1A 4XQNA 2OTLA 4GKKQ 5IT9E 2JK8A 3PUYA 3HOZH 1PH4A 4GN5A 2HT1A 2RVLA 2R7FA 3H0GH 1ENFA 4UPAA 4IFDH 5FLXE 4NXML 2B63G 4YY3Q 3FRPB 1B2TA 2R93B 2HHHL 2AHOB 1B3AA 4HIDA 1PH5A 1DM0B 3HOZB 5IYDH 4OWXB 2Y0SE 1PTOF 1PRTD 3H0GB 1UUPA 1X56A 2OF1A 4GKKL 5KEEA 4OWWB 3A7AB 2NZOA 4J8QA 1YJWA 4Y7NH 1BUVT 1Q8KA 1Q81C 2PI2E 1ASYA 2QF7A 4YY3L 1NSNS 3URYA 3FKIH 1SSOA 4A3KH 1R4QB 4G4KA 2ASBA 1TQOA 1XMOQ 1EY0A 2JP1A 1EY5A 4Y7NB 4PQXA 1ESFA 1HNZQ 2K4KA 1R9TH 2IWHA 2JQOA 4CKCA 2CW0D 3FKIB 1X32A 3ICEA 4A3KB 4KV6A 2HQLA 1GHKA 1RDPD 4A3EH 4ZAIA 4DNTB 1D5XC 3NQTA 2AWNA 3E0EA 4C3HH 4R9WA 2JA7G 2Y0SB 5CV5A 1R9TB 1EY6A 1LTTD 1XMOL 1I4XA 2XWBB 1XTDA 3STBC 1IYVA 2HCIA 2F0OA 2NZHA 1MI2A 1HNZL 4A3GH 4A93H 2ID0A 3T13A 4A3EB 2K5QA 4C3HB 3UE0A 1VQGA 3PF4A 4K5XA 4JBJA 4LF6L 1TWGH 3WOFA 3JC66 3HOVG 3CD6A 1K0RA 5H1SE 4ZQ3A 1DOMA 1SN8A 4B08A 4A3GB 3BYYB 2ICIA 1Y69U 3NHHA 1SAPA 4A93B 4JI4Q 2D0PA 2Q2IA 1YJ9A 4C3IH 5BN3A 3SK6A 1SXTA 3PCOB 4EVOA 3NTKA 5D14A 1CSQA 5T1GA 4QUFA 1TWGB 3RN2A 1EZ8A 2PQEA 1S5ED 3OYYA 5IYCG 2EYLA 4H13C 3HOXB 2MNAA 5C4XG 1F2ZA 1SRUA 2DJGC 5LMUQ 1ZXTA 3S1MB 2A6HC 2Q2HA 4BBSH 2BOSA 5JJZA 1CTMA 1OO9B 5CV9A 1D7QA 4ZK9B 3I73A 4ALPA 4JPBW 2FMMA 4P73A 5KYIA 4EX5A 2PZWA 2QGQA 4B3SQ 4HMJA 4BBSB 4C2MH 3S1QB 4CGYB 1TWFH 1ZYRD 1IKLA 2MJ8A 1IL8A 1L2FA 3MXUA 1HRJA 1AFPA 3H3VH 1BCPF 3U4VA 1O7IA 1G6PA 4Z9CB 3CC4A 4K2LA 1VQKA 4DK1A 3K5OA 1IYJB 1YHAA 2HD3A 1H9SA 4C2MB 1TWFB 5IGGA 1LACA 1FL0A 3KOJA 2F4VQ 5I6WA 4B3SL 3GP7A 3OTOL 1TU2B 2HQEA 4OO1H 2K1BA 1CK1A 2EDGA 3D0FA 2JA8H 1DCZA 1A3TA 5FLMH 3ERQA 5KNBA 2EPBA 2ZM6L 1KXLA 3LGJA 1SE2A 2F1MA 4PNYA 1N32Q 5C6AA 1CKOA 4K5WA 3CCVA 3TZDA 3U4ZA 4DUYQ 1EY9A 1LV9A 4R1JA 1X9NA 4JI5L 3HOUH 3JAMi 1Q82C 1L0WA 1Q8IA 5IOCA 1LT6D 5E7NA 3P20A 2GA4B 3NSWA 3P1HA 1H9MA 3M4QA 1YNJC 4DPGA 1GJXA 4RWSC 1EQRA 3R8BA 4CKBA 1N32L 1PH2A 2EYMA 4BBRG 1HNXQ 1T5XD 1E2WA 1UE6A 2XIWA 5JJLA 1SNMA 5JOBA 3HOUB 4DUYL 3TRZA 5E3FA 1WTPA 5IWAQ 3I8ZA 1GUWA 3KUPA 1XMQL 5ELOA 4GKJL 5ISRA 3CRLC 2JEBI 3H09A 2H1EA 2KEEA 4UAIA 1A0IA 4KHZA 3S15H 1Y1VG 4LF5Q 1V43A 2DN8A 2NN6H 3QOLA 2SDFA 4KLKA 1IHZA 1YEZA 1SMXA 4TSSA 4DK3C 3K5NA 4AQYL 3AU7A 5CV7A 2J0TD 1BNZA 3P75A 5IWAL 2HIVA 3S15B 4X64Q 2MO0A 4R8IA 1WTOA 1RCVD 4NDXA 3SE0A 3V96A 4KKSA 3KJOA 3UDFA 5E4XA 2M00A 2F0WA 1G2TA 1B44D 4Y52H 1VQ6A 3R2IA 1SYBA 2RBMA 1KABA 5K36G 4MNOA 3Q0AA 1ILQA 3ONAB 4FF3A 3K7AH 1B1ZA 4IURA 1HA6A 1I50H 1CI3M 1IW7C 5JJIA 4ZLTF 4JI8Q 5C44G 4DV7L 4X64L 4X66L 3KDFA 2MQHA 4KTAA 1X3EA 1EYGA 4WJ3M 1MHWC 2I5HA 3K7AB 3J7AF 4ZUIA 3BZKA 1I50B 2DJFC 1SJED 1AN8A 1D2BA 4UHVA 4M8AA 3CXCA 2NZ1D 2F0JA 1X54A 1QOHA 2LXJA 1MD2D 3DEOA 4KKTA 1NE3A 3SK8A 4IJHA 3VA5A 4B3TL 4OIJA 1EOTA 3BDLA 3E3XA 1TR5A 2FXQA 3DUZA 4U673 3BVZA 3ER0A 1HZCA 3J80i 2KUMA 4QMGA 4V190 1YHBA 2G9HD 5IGBA 5KGUA 3I56A 4R4TA 1IBKQ 1EY4A 1Y14B 5IP7H 2Z9HA 2F0EA 4K2KA 1N36Q 1C48A 2EJMA 2UUAQ 2Z4HA 4ZKBB 5I2XA 1J5EQ 1H9JA 3PUZA 2XSCA 4N9TA 3F2BA 2JA6H 3K5MA 1VQ4A 1IZ6A 5ELCA 2JE6I 5DAUA 5CC4A 3TSSA 1NR4A 5DEHA 3TDQA 4OWTB 1SJHD 3JAME 2LKVA 4HJ5A 1KNAA 3U9SA 4ILWA 1RHPA 2VL6A 3I4OA 1EEFD 2WACA 2Z1CA 1S5DD 1J5EL 2BA1A 5JPNC 1L1OC 4J15A 4FVMA 3GTOB 3M9BA 3KBXA 1EWCA 1XPUA 2I46A 4ABNA 4DV0L 3S17H 3M3YB 3J81E 1KD1C 1OXUA 4HEDA 1E22A 2JA5G 4JI2Q 3I4LA 1Z7TA 4C56C 2H4OA 3QR8A 3CCJA 2K32A 1LTGD 4F88A 3PIOA 1JCKB 1AE3A 2CKZB 3S17B 3GTPH 1JJGA 1OXXK 4FXDA 1TWCH 2F0IA 1MSHA 1JB3A 1LO5D 2E75C 5IIFA 2C5CA 4BA1I 1QVFA 4JI2L 4BXXG 3L0OA 1IW7D 1EFWA 2N3SA 4RCOA 4OONA 3GTMH 2PMZE 1RIPA 3SHLA 1U4LA 2L11A 1AE2A 3HOWH 3C3LA 1TWCB 3N52A 3CMEA 4NPSA 5KRUA 1TS4A 3W2DA 4DUZL 3ERSX 5IY0A 3ULPA 2JYOA 4S3SA 2B2TC 1CUKA 1BBWA 4HSVA 1Q46A 4IJLA 4A3JG 2VUMH 2X6LA 3VR2A 3NBIA 1STNA 1E1TA 3GTMB 2A19A 5D3DA 1C4QA 3HOWB 2FJ2A 4A3MH 4JOIC 3CCSA 2PW7A 5FLXL 1I94Q 2RKSA 4JI3Q 4FF1A 1UE7A 4DN4M 4OGQC 5EJWA 1II3A 2VUMB 1BOSA 1PZKD 1BF4A 2F03A 4BY7G 1IYUA 1PH8A 4FP5D 4A3MB 3K5LA 1A2UA 5J3BA 4FNFA 1QB5D 1B4OA 4RH6A 5GADC 2VQEL 4JBKA 2PMZB 1I94L 2XRSD 2UXCQ 3CMAA 3TBIB 4JI3L 3UDGA 1GM5A 4XT3B 4C3JH 3NK9A 1L1OA 5EBCA 4IFDG 1KL9A 1JICA 4DFAA 2IJ0A 3TN2A 3KF8A 1WTHA 5BN4A 2V4DA 1X55A 1HTPA 1HCZA 3GTLH 1V1OA 1MKHA 4A3BG 5ELFA 2E2HH 2XWJB 3GDEA 3EA6A 4C3JB 4JK1C 1STEA 3W3AA 1TT2A 1WTQA 2PCFB 2WFWA 1ZKOA 4X3KA 1ET6A 4RAUC 1MJEA 3GTLB 1JWSD 1EYDA 2E2HB 2P5ZX 5FLXc 3KJPA 1LLRD 1FJGL 1JWUD 1M4VA 2PZTA 1EY8A 4DAVA 2EY6A 1PRTC 1K73C 3NTHA 3ZYYX 1H9SB 2PZUA 5FO7B 3ULJA 3GV3A 3D6CA 2KCMA 4DR1Q 1EIFA 3M85A 2SOBA 2I07B 1AW7A 5FO9B 2YYZA 4IOAA 2X6GA 5LMNW 2A69C 1VQFA 4JV5L 4A3EG 1ENAA 2JXMB 1JC7A 3NEMA 2GVBA 1U4MA 2B2TA 3G6JB 4KHPQ 1J9OA 2EYOA 1ESRA 3VDYA 1D6EC 5A35A 2J7ZA 1S4ZA 4AH6A 3RN5A 5M5YB 1NY4A 4JOIA 4P71A 4A3GG 3KLSA 1PTOC 3CPFA 4YCWA 1VQJA 3I7FA 3RMHA 1M90C 4F7XA 1YNXA 5GQOA 4DR6Q 1SE4A 1LT4D 5IP9H 4KK7A 4L63B 4KHPL 3H6MA 1PHJA 1O78A 3O13A 4QUCA 4A3IG 4C3IG 2KENA 3J81j 4R4QA 2BDNA 5C4JH 4DF7A 4P74A 3VR4A 5C5LA 3OSOA 4DR6L 2L4NA 4P2CB 4B3RL 3EN2A 5CMDA 1HR0L 3OPOA 2QW7A 3CCUA 5ELDA 4K14A 5M3MH 3I4NH 3NENA 3J7A5 1BXTA 5IYBH 1H95A 1G8ZD 4LNQA 1GOZA 2B29A 3RD4A 2H5XA 3WDNA 2X69A 3M4YA 1I4HA 2QDBA 4RGMA 1WVLA 4ME5A 3AB9A 1TWAH 2CWAA 3HOYH 3HG9A 5M3MB 4FYDA 3GV6A 4UDUC 3I4NB 4MTNA 1C9OA 1VQIA 1B70B 4DR3Q 2WB1E 4NXNQ 3PO3H 5G3LD 4G7HC 4DV3Q 1XWEA 1SYCA 3CC2A 3HZXA 5DLQE 1RJTA 2QCPX 1TWAB 2K52A 2B8FA 3HOYB 1PDQA 1RODA 3A8JE 1PH7A 3RZDH 1T9HA 3VR3A 2N49A 1A3VA 2R92G 1A8VA 1MJCA 1PLFA 2RCFA 3BZCA 2KEDA 3FMCA 1TS5A 4OHJA 2BDOA 1HQMC 3I91A 3PO3B 5CR3A 1KNEA 1HA5A 1XNQQ 1BDOA 1ZYRC 3KDFB 1I4QA 4OO1G 4HN7A 3A56A 2SNSA 4NXNL 1F77A 4ULLA 1DD2A 5HY6A 2JA8G 1HH2P 3NQIA 3RZDB 2A1AA 2RA4A 4OELB 2Z4IA 3EIVA 1W6JA 3K57A 1HXYD 1LTID 2CHBD 3Q22A 2PQAA 2A69D 5J39A 4G7ZC 1XNQL 3GTQH 4MN3A 1GUNA 3FHWA 5I4DA 1XTCD 4XQQA 4WFN3 2WB1B 1CM9A 3HRZC 4GS3A 1CSPA 4L5QA 1SDFA 3S1NH 1NBWA 1S5FD 1P16A 3CQZH 1BCPC 1CZGA 2G5DA 2F0MA 2E5LQ 4LF7Q 1WCMG 3GTQB 3CCMA 1PTOD 2B2UC 2DUDA 1VCIA 3ULLA 4RFBA 3R93A 4IUQA 5M5WB 3E6ZX 3IFTA 3M4OH 2ZJRA 3S1NB 3NELA 3CQZB 4DR7Q 5M3FH 2GVAA 4R4IA 3W1BA 4UP8A 3A55A 4QGUA 1G291 3UI2A 4PG3A 4HJAA 1FD7D 1HQRD 3T1YQ 1KQSA 3M4OB 4FXGC 4LK1C 3MXPA 1DGSA 2F0KA 3OHXC 5KIXA 5E1FA 5M3FB 5GAHC 3T51B 4AIMA 1AH9A 1SNPA 5A2QE 1CHPD 4DR7L 1V1QA 3HOXH 4KY7A 5I9PA 2DNEA 3I4MH 3S1MH 3WWVA 1A3UA 1O7LA 5I2YA 3SVMA 5EKIA 3T1YL 3LX0A 4O1NA 1SNOA 1KLGD 2OTJA 2WAQG 3BVMA 1S40A 3TZUA 1Q7YC 3BYTB 4GLVB 1ONLA 4FF2A 3K59A 3ITPA 1TWHH 4RG1A 1VQLA 2F0GA 3I4MB 4JI4L 3S1QH 4A3CH 3TREA 4DR2Q 2UUBQ 2R7DA 4LJZC 4PMWA 1PH9A 1QJOA 3PO2H 3CU7A 5L37A 2K5VA 1HUMA 1ASZA 1TWHB 1SYDA 1S5BD 3L9AX 3EJIA 2L5TA 5FOBB 2OQKA 4MZ9A 4CHTB 1HNWQ 3KYHC 5LMUL 2UU9Q 1TIID 1DXMA 1OXTA 3KLRA 5CV4A 3A0JA 4O42A 3PO2B 1X3PA 3FDTA 1F9PA 3S24A 2CQOA 5JEAH 2ZJPA 4GN4B 2QEJC 1I4PA 4BS9A 5GAGC 3ZJYC 1TXYA 2RDFA 1SNQA 4O0AA 3E5SA 4BA2I 5HURA 4KY5A 4ZCKA 1KHIA 2ENBA 4OEMB 3TS0A 3K80C 2AKWB 2MFIA 1BVSA 2B2UA 1YJNA 4JI1Q 2O2LD 4XQJA 1VDZA 1ENCA 3CKIB 1BBXC 1TVXA 3I3CA 1D5MC 5I6YA 2TMPA 4AYBG 3IRBA 1Q90A 3H91A 1CQFA 2QDLA 4RHSA 4GLAC 2OCEA 3E0JA 2JA6G 4PMBA 5C3EG 1FYCA 2GN5A 1BCPD 1WI5A 5BR8Q 2IL8A 1DOLA 2F4VL 1STHA 2B63H 1RL2A 4HCSA 2HIXA 2LSSA 1PFSA 5CV6A 2WP8J 1GXDC 1CZWA 4X3TA 1WJJA 2IHEA 2F0PA 4C1NK 3M7NA 1HZAA 2O5IC 1L1OB 1KRSA 3CHBD 5IGCA 1LTRD 5C3WA 1Z6HA 3KF8B 3CW2C 2O5JC 5BR8L 2F0HA 2B63B 2A6ED 3NTIA 1KIXA 1TY2A 1BQQT 1B9MA 2C9OA 4WORA 5KNDA 4LUVA 3M7GA 4JI6Q 4DV1Q 2L9HA 2K5NA 1IKMA 5EKLA 4J1MA 2VQFQ 4FO2A 1VMCA 2LFNA 1HNXL 4YWKA 2TSSA 4RGNA 4G57A 1NUCA 4APVA 1A2TA 4J6HA 3GTKH 3MFGA 2MUYA 4HIMA 4JI6L 3FPPA 4RHRA 4CDEC 2JA7H 2EIFA 3L3OC 1SNCA 4JBWA 5LHY1 2DY8A 1CKNA 1IBMQ 2VQFL 5I9OA 4LF5L 4LF8Q 1DONA 3DLLA 3GTKB 3PF5A 1GD7A 2VUMG 3P7JA 2ICEC 2MHVA 2JA7B 1I5FA 1K0SA 3MXGA 4LF4Q 1EL0A 4KD4A 2RSNA 1GKHA 3HOVH 2XN9C 3S2DH 1JORA 5KNCA 4IUVA 4QIWE 1DYQA 2E76C 2I5MX 2JA9A 2FFKB 3C2PA 1EU4A 3VYTA 4NW2A 4DXGA 1UEAB 2ZJQA 4YCUA 3HOVB 3S2DB 2WKCA 3AFQA 1AEXA 3UDIA 5C0XG 1KRTA 3S9WA 4IPGA 1WTRA 1VQ9A 3F2UA 4H7BA 4JI8L 1STBA 3GTJB 1YIJA 1E3PA 1U0LA 4A76A 2K75A 2F0DA 3D6WA 4LWCA 1LT5D 2V1CC 5EPJA 1XNRQ 3CAMA 2ALYB 1F9RA 4Q0FA 5C0XI 4ODGA 2F0NA 2VB3X 1FNWA 4U68A 4HJ7A 1V8QA 2K50A 4QIWB 3SXHA 4RMFA 4TVAB 2K03A 1TS3A 2F0UA 4YHHQ 4JW0A 1TS2A 1PYBA 2NTSA 4DGZA 2KHIA 2F3WA 2Z6KC 1QE6A 5F2DA 2IT1A 1VMPA 1LM0A 2A74C 2YV5A 2XRQD 4FDBA 3GTOH 2N8NA 5FJ8H 1EUJA 1RKNA 1IBKL 3L2PA 5CV8A 3CRKC 3M3YH 1CQVA 1PRTB 2G9DA 1N36L 2UUAL 5IGDA 4FXKC 4YHHL 1EEID 4CDCC 2L15A 4KD3A 1VQMA 4H44C 2BH2A 2MP1A 2I0QA 1W6KA 4KI0A 1KDBA 1M8AA 4A75A 4X65Q 4A3LG 2FINB 1PTOH 3N6RA 4XYQA 1NAPA 4IUNA 3MWYW 1SYGA 2Q2UA 2XTIA 4HCEA 4CKEA 1HPCA 3PMFA 4A3DG 3HGBA 1NNXA 5J1ZA 4O2DA 4PZ6A 3AEVA 2OWOA 1XX8A 5M5XH 3BVGA 3UDXA 1PTOB 2PQAB 4BBRH 1I4GA 2NVYB 2EVBA 2ZXOA 1WD0A 3RNUA 2M2LA 1VQNA 1EQTA 5M5XB 1GUOA 2EZVA 3TP8A 3HKZG 4CJ1B 4BBRB 3PV0A 4K8IA 4I7ZC 3I90A 3RLNA 2R3ZA 2EY1A 4PMCA 1Y1VH 1VF5C 2IX0A 4LMQD 1WTWA 1Y1WG 2F0TA 4KKUA 5FKAC 2NB0A 3I2ZA 3T16A 4MHEA 2VNUD 3UE1A 1SE3A 1STYA 5IT9L 2K14A 3OIPA 3K58A 2IHFA 1Y1VB 1PYWD 1VQ7A 3KK7A 1XYIA 3QO2A 4JI0Q 1EIYB 5KYLA 1Y8OB 4HSPA 3OW2A 2HDMA 3KFUA 4HR7B 4XDXA 1YVCA 4B9WA 3Q24A 4JI7Q 2Z6KA 5K36H 4JCVE 1SBBB 3D4WA 2OT2A 3EBEA 4DV4Q 2L55A 1TKWB 1AZQA 3PO3G 4L5TA 2F3IA 2YU9H 5C44H 2R93G 5C3XA 1BR9A 4LFBQ 2EJGC 2FMCA 4JI0L 3VYRA 4DK0A 3HOZG 3NBHA 4NB3A 2N55A 2CCZA 4L8JA 3H0GG 4UY8C 1JQYD 3KLSX 3W1GA 4IFDJ 3J80E 1KC8C 3RZOB 2NBFA 1QCBD 3E9IA 1GUTA 3PQIA 2BCOA 1W3SA 1I6VC 2YU9B 1XPRA 5C44B 4DV4L 1VS0A 5IYDG 3PUXA 3VYSA 1YITA 2WB1G 4KJNA 2UXCL 3QIAA 3F1ZA 4IFDI 5IT9c 5EPKA 2HDLA 3PGZA 3HP3A 2N88A 2R61A 2LY7A 1B8AA 4A3FH 2Z6BA 1K9MC 3TQYA 1FGUA 3FKIG 5LMNQ 4QCLA 1E2VA 4A3KG 3G71A 2F0SA 4E6IA 2E74C 2HCCA 4JG2A 3IL8A 2Y0SG 3TP7A 1BCPB 4A3FB 3A54A 1JT8A 4LFCQ 1R4PB 1H9RA 1U4RA 2DNCA 5EQ0A 5LL6X 5M5YH 4JYAQ 5A2QL 1QVCA 2AQ3B 2ZT9C 1KTKA 3IFDA 5LMNL 4C3HG 1QZGA 1JJCB 4MIUA 1VQ8A 2UXDQ 2KHSA 5M3FG 3OMCA 5CYUA 1Q1EA 1RTOA 4N8FA 2A5HA 2MGSA 4DR1L 4A93G 3SK4A 1K3RA 2PO4A 1LTAD 2J4XA 1KAWA 2EY5A 1GO3E 1HFGA 3F2DA 3MXNA 3GD7A 1XJVA 1A62A 4IOCA 1VQCA 3BG3A 3A7LA 5IODA 3W5OA 2C35B 2B3GA 4LF9Q 2JA5H 1I4RA 4YWLA 3HOXG 2QILA 1D5ZC 1WTVA 1EIHA 1EZ6A 4IN3A 1SNDA 4IUTA 3LWEA 2A68D 1HZBA 3NWSA 4DA2A 2K04A 1E0BA 3OOCA 2SEBD 2JA5B 1WTXA 5EBDA 4QF4A 2UUCQ 2JN4A 3I55A 3G6EA 3AMUA 1WFQA 1LTLA 2RSOA 4N9PA 4BBSG 5AFWA 1QNKA 1D1IA 3K6OA 3HS0C 3K8AA 2R7ZH 3MTSA 2EY2A 1GHJA 1Y8PB 3Q23A 1F9SA 4CJ2C 2IX1A 1N34Q 4XT1B 4OX9Q 4QJFA 5ELBA 4A3JH 3FVQA 5JAVA 4DAYA 2KOLA 2R7ZB 1CKNB 4F8MA 4DV5Q 2BE5D 1C7YA 2UXBQ 3H15A 2L12A 1U5KA 3DEPA 2PNRC 5FK9C 1X3GA 2R6GA 1CHQD 3DWAA 3T53B 4RCNA 5C4ZA 4XTCS 4A3JB 1XPOA 4TRDA 1S72A 2VW9A 1AP0A 1N34L 4BY7H 3PIO3 1VQAA 4OX9L 2RDGA 3BU2A 1EQQA 3F8TA 4NXMQ 1K3BC 1PRTF 4X3UA 3H3VI 2HHHQ 4K6DA 3DHQA 4DV5L 4DR3L 4TQUS 2K01A 2CQAA 3T1HQ 2UXBL 5FLMG 4DV3L 1PZID 5DNFA 3AQQA 5T1IA 2B2YC 4DNRB 4BY7B 2DY7A 2KCNA 2RDHA 1F9QA 1XXGA 5EAYA 3A5UA 1K83H 4IQZA 3AYHB 3GO5A 3S2HH 2A73B 4IPDA 3S1RH 3MA2B 1E1OA 5HGTA 4OO1I 1N9WA 2D62A 3EVQA 1V9PA 3HOUG 2N78A 4A3BH 2PW5A 1SROA 3T1HL 2K5HA 1U4PA 5M5WH 1VQ5A 3G4SA 1KAAA 3I70A 1K83B 2D9UA 3A8KE 3S2HB 4WRDA 3S1RB 5LL6S 3MAQA 4H02A 2NWGA 4RA8A 4A3BB 5FO8B 3PUWA 5EGTA 2ZXPA 2PYKA 1U9RA 1GUSA 2LS01 4NKLA 2RHSB 1FNVA 2K5DA 4L6TB 5BN5A 2HUGA 4XYOA 2OEOA 3CCEA 3S14H 1CT1D 2AQ2B 2NN6G 1HFNA 1O80A 2E5LL 4LF7L 2A6EC 4CDFC 4GNXC 2B39A 1DJRD 4POGA 3MEHA 5IGFA 3NPPA 2IX3A 4LF6Q 2DGYA 2VZAA 1ICFB 1B9NA 3S14B 5ELNA 4CJ0B 1A6XA 3NE5B 1HZ9A 1CFMA 2NN6I 4K0KQ 4M1UB 1V1PA 2AQ1B 4K8JA 3BZDB 2F3VA 1P8LA 3EFXD 2EYHA 1JOQA 4KN7C 2B2WC 3CCRA 4PV1C 1ICWA 1X3QA 3C1FA 4GLXA 1DOKA 5C4HA 1D1KA 3KF6A 2E2IH 1CA5A 2D2CC 4DAMA 4BY1H 3D8GA 4K0KL 4GOPA 2KA7A 1WYDA 4A3IH 4KY6A 1JMCA 3LWUA 1MGSA 3T4AC 2B2YA 1MBYA 2E2IB 3Q8DA 4R4OA 1S3OA 4LW1A 4KMUC 5NUCA 1OXVA 5JPMC 4BY1B 4CDDC 1SLJA 1O7YA 4A3IB 4C3IB 4ZUJA 1RTNA 1B50A 2XNAC 1QILA 5E4WC 4HAEA 3IAYA 4IALA 4DR2L 2UUBL 3M4PA 1KLUD 3JAML 1X3FA 1BO0A 2CVRA 2F52A 1L0XB 1JE4A 4UP9A 2EXZA 4K5VA 3DM1A 3OTOQ 1HNWL 4DNIA 5IP7G 3CPWA 2UU9L 1JWMD 1QWYA 2YTVA 3PIPA 3E9HA 3OWFA 3SK5A 2ZM6Q 5M9OA 3DMUA 2VY3A 3J81L 1QNUA 1VQHA 4JC0A 3SGIA 2R92H 3D3RA 3NXWA 4WJ4A 4ID6A 1I6HH 3VA7A 5TSSA 5FJ8G 4GNXA 3V2TA 2RQXA 1ML0D 4JI1L 4JI5Q 5IE8A 1B53A 3NBHB 1PH3A 4K6LA 3G48A 3TS2A 4ZKCB 1UNSA 2E8GA 2R92B 4DKAC 2EQSA 1I6HB 4ME3A 3ND9A 1VQBA 3DM3A 1VF7A 3OMGA 2IY5B 2JA8B 2B2WA 1X65A 1N8RC 3QB3A 3JAMc 4P75A 2CFMA 3NWTA 1XMQQ 4GKJQ 1HUNA 3STBD 1W2BA 5D3IB 4L5RC 1IBLQ 1G6ZA 1WCMH 4BWGB 1J8IA 5EPLA 1G51A 1O7ZA 1S5CD 4AQYQ 4QY7A 4UP7A 2NVQH 1LTSD 3J81c 3J81i 4DV1L 3BDCA 2JJQA 1PMRA 1UAPA 1A63A 4OXPA 4X6AH 1LYLA 1WCMB 3KLWA 1EWHA 3FPUB 2ES2A 3HOWG 4YCVA 2NUCA 1Z9FA 4HTHA 4IZ8A 4A4IA 1IBLL 4DR4Q 2WAQE 2NVQB 4DK6C 2E2DC 1QUQA 2EOTA 3D31A 2K6AA 4C1NI 4PZ8A 3C46A 3CF5A 3CP0A 5D65A 2IPKD 4QL5A 4A3MG 1NCVA 1PV4A 4DV7Q 4X66Q 3DXJC 5GAEC 3J80L 2A6HD 1NMGA 2O4XA 3ND8A 1IBML 1FVIA 3U9OA 1STAA 4LF8L 3MXNB 4XIGS 5IGEA 3GTJH 4DR4L 2F0LA 2EXDA 3U58A 3A5ZB 3A8IE 4YIJA 2ZTDA 1B3QA 5IYCH 1F2LA 1EY7A 1QZHA 1MSGA 4RKLA 4LF4L 5C0XJ 2KVMA 5C4XH 1FR3A 3OWEB 2NYZD 3VR6A 2XGTA 1FGBD 1YZ6A 3A74A 1EYAA 1B7YB 4DXFA 1VQEA 3BDOA 3J7AV 1SYEA 4B3TQ 4C3JG 1PFNA 2AMCB 1PH6A 2WAQB 1NR2A 5C4XB 1PXUA 1ET9A 3SEBA 2ATWA 2EYFA 1AZPA 4AYBE 3H94A 3TMEA 3TEHB 4KN4C 1IXRA 4IPCA 2WV6D 2XVSA 5CORA 3CCQA 1XNRL 1SFOH 2K7VA 4A3FG 3LNNA 4IUUA 3J7ZC 4DAYB 3J80c 4NP5A 1VQDA 3G7LA 3CCLA 4EQNA 3H3VC 3F2CA 2KQ3A 4GN3B 3RLFA 3T56B 4EQ5A 1J6QA 1K8MA 1BKBA 1I3QH 1E2ZA 2B8GA 3IKJA 1K8GA 4HJ8A 1EIGA 1JE5A 1SFOB 1RD9D 2RHQB 1YNNC 5C3EH 1YNJD 1Q3LA 3RLOA 1VQPA 4FF4A 4DV0Q 2Z8LA 1I3QB 3I72A 1Q86C 1X6OA 2FHTA 2NVYH 4KHVA 4AYBB 2KCTA 2PI2A 2OXPA 3OW7A 4R4CA 2JA6B 5C3EB 3VR5A 3S16H 2K5WA 2NTTA 5COYA 3FEWX 3MC0B 1DZ1A 2AUJD 4IPHA 4DR5Q 5CBAE 2LXKA 4X65L 3J7YW 4CBVA 2WIIB 3D4RA 5IP9G 2VXWA 5C5MA 1JOKA 1HHVA 3S16B 1K8AC 2ZTEA 2D5DA 4OIKA 3V05A 4EGVA 5J22A 2BH8A 1LT3D 1G91A 2VB2X 2D0OA 1BBUA 3X3MA 4DUZQ 2EJFC 1D8LA 3AFPA 4DR5L 4YWMA 1YI2A 1M1KC 3PIP3 4LUZA 4DV2Q 1SR3A 2QEXA 1KDAA 1Y8NB 3L7ZC 3K7UC 3PSIA 2KECA 4IO9A 1LABA 4I7AA 3K81C 1PZJD 2MPMA 4HMIA 5M3MG 3GTPB 3I4NG 5IYBG 2A68C 2R7ZG 4G7OC 1E24A 5CBEE 3MZ5A 2K28A 4JVZA 4MTKA 3FP9A 1FNUA 5ELEA 1EWIA 1F2YA 4DV6Q 1QVGA 3HOYG 4DV2L 4GZYC 4I65A 2ZXRA 3R2TA 1A15A 1LTBD 4DU9A 3RZOH 2QKIC 2K33A 3MVVA 4B3MQ 2JEAI 1V1PB 2JSOA 5EKKA 1UE5A 2VQEQ 3QJYA 3TP5A 2KBNA 2KJXA 2RF4A 2Q8IB 5K5PA 3SDZA 2PNHA 1JJ2A 1ZEQX 1K28A 5GROA 5JVH3 3SR1A 4X3SA 1G2SA 4N8X1 2YTYA 5CGKA 4DV6L 2I5LX 3KF6B 5JVG3 3GTGH 4WJWA 4JI7L 5JJKA 4POFA 2NVXH 3QG1A 3WOEA 3QWNA 4KJOA 5C0XH 2BE5C 4B3ML 2AUKA 3RR5A 1UEBA 4R8NA 4GOPB 1HTLD 2VS1A 1N33Q 3K0YA 2NVTH 1EYCA 3OIQA 1STGA 1PFBA 4IUPA 4LFBL 3BJUA 3HEJA 3GTGB 3VYUA 1PVOA 1E7ZA 2NVXB 4Q5VA 1YNND 3KBGA 2Q2TA 2B2VC 2Q8TA 3MHBA 4TKOB 1F2MA 4HJ9A 3Q6SA 1EFID 3BS1A 1ILPA 4RGTA 1FJGQ 2NVTB 4HIKA 1SMYC 1SYFA 1N33L 2BA0A 1PA6A 1RF2D 2PPBC 2E2JH 3D4DA 4HIOA 1Q12A 4X62Q 2CWPA 1VQOA 2RCNA 2CH4A 1JR0D 1CA6A 4JV5Q 3GQBA 4QB4A 1K8OA 4XXEA 1HJPA 1JB7A 3MFYA 3NP8A 2K05A 3EQLC 2Q8RE 1LUZA 2KCCA 1IL2A 2E2JB 1H9KA 1TY0A 1NJIC 1PFMA 1GUGA 4LAAA 2KHJA 4JBMA 3DWQA 1L0YB 5AJ3Q 5HGQA 4QQBX 4X62L 4LFCL 4LUOA 1JOOA 4GNXB 1KDCA 4JYAL 2EYJA 2LMCB 4A3LH 2QA4A 1PYSB 3HKSA 3HFZB 4ZRZA 3X3NA 3R3OA 4DAPA 2UXDL 3HKZE 2F0QA 1PH1A 4RGOS 1YHQA 5DM63 4A3DH
chains in the Genus database with same CATH topology
4ZYSA 3C1EA 2CW0C 2L1BA 4V0BA 2M9VA 4EQOA 5DM73 2F0VA 4A3DB 3EROA 1T5EA 3RUZA 4EQPA 1EU3A 1QG7A 1EQVA 1C8CA 4F87A 2IW3A 1SEBD 2WKDA 3PUVA 2AWOA 5G3LF 4NMZA 2WINB 2B2VA 2SNMA 3HKZB 2EYPA 2F0FA 4OL7A 5C4JB 5JEAG 1Y1WB 5JEAJ 1OXSC 3DWPA 3QOJA 4B9XA 1Q1BA 2F4IA 1WD1A 4RKBA 3TP6A 1Z47A 2L0CA 3NUCA 1SMYD 4H0LC 2EE1A 4XQNA 5IT9E 3PUYA 2RVLA 1ENFA 4IFDH 5FLXE 3FRPB 1B2TA 2R93B 1B3AA 1DM0B 3HOZB 1PTOF 1PRTD 1UUPA 3H0GB 2OF1A 5KEEA 3A7AB 4J8QA 1BUVT 2QF7A 1NSNS 3URYA 1SSOA 1R4QB 4G4KA 1TQOA 1EY0A 2JP1A 1EY5A 4Y7NB 4PQXA 1ESFA 2IWHA 4CKCA 2CW0D 3FKIB 1X32A 4A3KB 4KV6A 1GHKA 1RDPD 4ZAIA 4DNTB 1D5XC 3NQTA 2AWNA 4R9WA 2Y0SB 5CV5A 1R9TB 1EY6A 1LTTD 1I4XA 2XWBB 1IYVA 2HCIA 2F0OA 1MI2A 2ID0A 3T13A 4A3EB 2K5QA 4C3HB 4K5XA 3WOFA 4ZQ3A 1DOMA 4B08A 4A3GB 3BYYB 2ICIA 1Y69U 3NHHA 1SAPA 4A93B 5BN3A 3SK6A 1SXTA 4EVOA 3NTKA 5D14A 5T1GA 4QUFA 1TWGB 1EZ8A 2PQEA 1S5ED 2EYLA 4H13C 3HOXB 1F2ZA 1ZXTA 3S1MB 2A6HC 2BOSA 5JJZA 1CTMA 1OO9B 5CV9A 4ZK9B 3I73A 2FMMA 5KYIA 2PZWA 4HMJA 4BBSB 3S1QB 4CGYB 1ZYRD 1IKLA 2MJ8A 1IL8A 3MXUA 1HRJA 1AFPA 1BCPF 4Z9CB 4K2LA 4DK1A 3K5OA 1H9SA 4C2MB 1TWFB 5IGGA 1LACA 5I6WA 3GP7A 1TU2B 2HQEA 4OO1H 2K1BA 1CK1A 2EDGA 1DCZA 1A3TA 3ERQA 5KNBA 2EPBA 1SE2A 2F1MA 4PNYA 5C6AA 4K5WA 3TZDA 1EY9A 1LV9A 1Q8IA 5IOCA 1LT6D 3P20A 2GA4B 3NSWA 3P1HA 1H9MA 1YNJC 1GJXA 4RWSC 3R8BA 4CKBA 2EYMA 1T5XD 1E2WA 2XIWA 1SNMA 5JOBA 3HOUB 5E3FA 1WTPA 3I8ZA 1GUWA 3KUPA 5ISRA 3CRLC 2JEBI 3H09A 2H1EA 2KEEA 4UAIA 4KHZA 1V43A 2DN8A 2NN6H 3QOLA 2SDFA 1IHZA 4TSSA 3K5NA 3AU7A 5CV7A 2J0TD 1BNZA 3P75A 3S15B 4R8IA 1WTOA 1RCVD 4NDXA 3SE0A 3V96A 4KKSA 5E4XA 2M00A 2F0WA 1G2TA 1B44D 3R2IA 1SYBA 2RBMA 1KABA 5K36G 3Q0AA 1ILQA 3ONAB 4FF3A 1B1ZA 4IURA 1HA6A 1CI3M 1IW7C 4ZLTF 4KTAA 3K7AB 3J7AF 4ZUIA 1I50B 1SJED 1AN8A 1D2BA 4M8AA 2NZ1D 2F0JA 1QOHA 1MD2D 3DEOA 4KKTA 3SK8A 3VA5A 4OIJA 1EOTA 3BDLA 1TR5A 3DUZA 4U673 3BVZA 2KUMA 4QMGA 4V190 2G9HD 5IGBA 5KGUA 1EY4A 2F0EA 4K2KA 1C48A 2EJMA 2Z4HA 4ZKBB 5I2XA 1H9JA 3PUZA 2XSCA 4N9TA 3K5MA 5ELCA 2JE6I 5DAUA 5CC4A 3TSSA 1NR4A 5DEHA 3TDQA 1SJHD 3JAME 2LKVA 1KNAA 3U9SA 4ILWA 1RHPA 1EEFD 2WACA 2Z1CA 1S5DD 2BA1A 5JPNC 4FVMA 3GTOB 3KBXA 1EWCA 2I46A 4ABNA 3M3YB 3J81E 1OXUA 4HEDA 3I4LA 1Z7TA 4C56C 2H4OA 2K32A 1LTGD 4F88A 1JCKB 3S17B 1OXXK 4FXDA 2F0IA 1MSHA 1JB3A 1LO5D 2E75C 5IIFA 2C5CA 4BA1I 1IW7D 4RCOA 3SHLA 1U4LA 2L11A 3C3LA 1TWCB 3N52A 5KRUA 1TS4A 3W2DA 2JYOA 4S3SA 2B2TC 4HSVA 2X6LA 3VR2A 3NBIA 1STNA 3GTMB 5D3DA 1C4QA 3HOWB 2FJ2A 2PW7A 5FLXL 2RKSA 4FF1A 4DN4M 4OGQC 5EJWA 1II3A 2VUMB 1BOSA 1PZKD 1BF4A 2F03A 1IYUA 4FP5D 4A3MB 3K5LA 1A2UA 4FNFA 1QB5D 1B4OA 4RH6A 2PMZB 2XRSD 3TBIB 4XT3B 3NK9A 5EBCA 4IFDG 1JICA 4DFAA 2IJ0A 3TN2A 3KF8A 5BN4A 2V4DA 1HTPA 1HCZA 1V1OA 5ELFA 2XWJB 3EA6A 4C3JB 4JK1C 1STEA 3W3AA 1TT2A 1WTQA 2PCFB 1ZKOA 4X3KA 1ET6A 4RAUC 3GTLB 1JWSD 1EYDA 2E2HB 1LLRD 1JWUD 1M4VA 2PZTA 1EY8A 4DAVA 2EY6A 1PRTC 3NTHA 3ZYYX 1H9SB 2PZUA 5FO7B 3GV3A 3D6CA 3M85A 2SOBA 2I07B 1AW7A 5FO9B 2YYZA 2X6GA 2A69C 1ENAA 2JXMB 1JC7A 1U4MA 2B2TA 3G6JB 1J9OA 2EYOA 1ESRA 1D6EC 5A35A 2J7ZA 1S4ZA 5M5YB 3KLSA 1PTOC 3RMHA 4F7XA 1SE4A 1LT4D 4KK7A 4L63B 3H6MA 1O78A 3O13A 4QUCA 4C3IG 2BDNA 4DF7A 3VR4A 5C5LA 3OSOA 2L4NA 4P2CB 5CMDA 3OPOA 5ELDA 4K14A 1BXTA 1G8ZD 1GOZA 3RD4A 3WDNA 2X69A 3M4YA 1I4HA 2QDBA 4RGMA 1WVLA 4ME5A 3AB9A 3HG9A 5M3MB 4FYDA 3GV6A 4UDUC 3I4NB 5G3LD 4G7HC 1XWEA 1SYCA 3HZXA 1RJTA 1TWAB 2QCPX 3HOYB 2B8FA 1PDQA 1RODA 3A8JE 3VR3A 1A3VA 1PLFA 2KEDA 3FMCA 1TS5A 4OHJA 2BDOA 1HQMC 3I91A 3PO3B 5CR3A 1KNEA 1HA5A 1BDOA 1ZYRC 1I4QA 4OO1G 4HN7A 3A56A 2SNSA 1F77A 4ULLA 1DD2A 3NQIA 3RZDB 2RA4A 2Z4IA 1W6JA 3K57A 1HXYD 1LTID 2CHBD 3Q22A 5J39A 2A69D 4G7ZC 4MN3A 1GUNA 5I4DA 1XTCD 4XQQA 4WFN3 2WB1B 1CM9A 3HRZC 1SDFA 1S5FD 1BCPC 1CZGA 2F0MA 3GTQB 1PTOD 2B2UC 1VCIA 4RFBA 3R93A 4IUQA 5M5WB 3E6ZX 3IFTA 3S1NB 3CQZB 3A55A 1G291 3UI2A 1FD7D 1HQRD 3M4OB 4FXGC 4LK1C 3MXPA 2F0KA 3OHXC 5KIXA 5E1FA 5M3FB 3T51B 1SNPA 5A2QE 1CHPD 4KY7A 5I9PA 2DNEA 1A3UA 1O7LA 5I2YA 3SVMA 5EKIA 3LX0A 4O1NA 1SNOA 1KLGD 3BVMA 3TZUA 3BYTB 1ONLA 4FF2A 3K59A 3ITPA 3I4MB 2F0GA 4LJZC 4PMWA 1QJOA 3CU7A 1HUMA 1TWHB 1SYDA 1S5BD 3L9AX 3EJIA 2L5TA 5FOBB 4CHTB 1TIID 1DXMA 1OXTA 3KLRA 5CV4A 4O42A 3PO2B 1X3PA 3FDTA 1F9PA 5JEAH 2QEJC 1I4PA 4BS9A 4BA2I 2RDFA 1SNQA 3E5SA 5HURA 4KY5A 2ENBA 2B2UA 2O2LD 4XQJA 1VDZA 1ENCA 3CKIB 1BBXC 1TVXA 3I3CA 1D5MC 5I6YA 2TMPA 1Q90A 3H91A 1CQFA 4RHSA 3E0JA 4PMBA 1FYCA 1BCPD 2IL8A 1DOLA 1STHA 4HCSA 5CV6A 2WP8J 1GXDC 1CZWA 4X3TA 2F0PA 4C1NK 3M7NA 2O5IC 3CHBD 5IGCA 1LTRD 5C3WA 1Z6HA 2O5JC 2F0HA 2B63B 2A6ED 3NTIA 1TY2A 1BQQT 1B9MA 2C9OA 4WORA 5KNDA 3M7GA 2L9HA 1IKMA 5EKLA 4J1MA 4FO2A 1VMCA 2LFNA 2TSSA 4RGNA 4G57A 1NUCA 1A2TA 4J6HA 3MFGA 2MUYA 3FPPA 4RHRA 4JBWA 3L3OC 1SNCA 5LHY1 2DY8A 5I9OA 1DONA 3GTKB 3P7JA 2ICEC 2MHVA 2JA7B 3MXGA 1EL0A 4KD4A 2RSNA 2XN9C 1JORA 5KNCA 4IUVA 1DYQA 2E76C 2FFKB 3C2PA 1EU4A 3VYTA 4NW2A 4DXGA 1UEAB 3HOVB 3S2DB 2WKCA 1AEXA 5C0XG 3S9WA 1WTRA 3F2UA 4H7BA 1STBA 3GTJB 2F0DA 3D6WA 1LT5D 5EPJA 1F9RA 4Q0FA 5C0XI 4ODGA 2F0NA 2VB3X 1FNWA 4U68A 1V8QA 4QIWB 3SXHA 2K03A 1TS3A 2F0UA 1TS2A 2NTSA 4DGZA 2F3WA 1QE6A 5F2DA 2IT1A 1VMPA 2A74C 2XRQD 1RKNA 5CV8A 3CRKC 1CQVA 1PRTB 2G9DA 5IGDA 4FXKC 1EEID 4KD3A 4H44C 2MP1A 1W6KA 4KI0A 1KDBA 1M8AA 2FINB 1PTOH 3N6RA 4XYQA 1NAPA 4IUNA 3MWYW 1SYGA 4HCEA 4CKEA 1HPCA 3PMFA 3HGBA 5J1ZA 1XX8A 3BVGA 1PTOB 1I4GA 2NVYB 2EVBA 2ZXOA 1WD0A 2M2LA 1EQTA 5M5XB 1GUOA 2EZVA 3TP8A 4CJ1B 4BBRB 3PV0A 4K8IA 4I7ZC 3I90A 2R3ZA 2EY1A 4PMCA 1VF5C 2IX0A 4LMQD 1WTWA 2F0TA 4KKUA 5FKAC 2NB0A 3T16A 4MHEA 2VNUD 1SE3A 1STYA 5IT9L 3OIPA 3K58A 1Y1VB 1PYWD 3KK7A 1XYIA 3QO2A 5KYLA 1Y8OB 4HSPA 2HDMA 4HR7B 4XDXA 4B9WA 3Q24A 5K36H 1SBBB 3D4WA 2OT2A 2L55A 1TKWB 1AZQA 5C3XA 1BR9A 2EJGC 2FMCA 3VYRA 4DK0A 3NBHA 2N55A 4L8JA 1JQYD 3KLSX 3RZOB 4IFDJ 3J80E 2NBFA 1QCBD 1GUTA 2BCOA 1I6VC 2YU9B 5C44B 3PUXA 3VYSA 4KJNA 3QIAA 4IFDI 5EPKA 2HDLA 3HP3A 2N88A 2R61A 2LY7A 4QCLA 1E2VA 2F0SA 4E6IA 2E74C 2HCCA 3IL8A 3TP7A 1BCPB 4A3FB 3A54A 1R4PB 1H9RA 1U4RA 2DNCA 5EQ0A 5LL6X 5A2QL 2AQ3B 2ZT9C 1KTKA 3IFDA 4C3HG 4MIUA 2KHSA 3OMCA 5CYUA 1Q1EA 1RTOA 2A5HA 2MGSA 3SK4A 2PO4A 1LTAD 2J4XA 2EY5A 1HFGA 3MXNA 3GD7A 3BG3A 3A7LA 5IODA 1I4RA 1WTVA 1EIHA 2QILA 1D5ZC 1EZ6A 4IN3A 1SNDA 4IUTA 3LWEA 2A68D 3NWSA 4DA2A 2K04A 1E0BA 3OOCA 2SEBD 2JA5B 1WTXA 5EBDA 4QF4A 3AMUA 2RSOA 4N9PA 5AFWA 1QNKA 1D1IA 3K6OA 3HS0C 3MTSA 2EY2A 1GHJA 1Y8PB 3Q23A 1F9SA 4CJ2C 2IX1A 4XT1B 5ELBA 3FVQA 5JAVA 4DAYA 2KOLA 2R7ZB 4F8MA 2BE5D 2L12A 3DEPA 2PNRC 5FK9C 2R6GA 1CHQD 3DWAA 3T53B 4RCNA 5C4ZA 4XTCS 4A3JB 4TRDA 1AP0A 3PIO3 2RDGA 1PRTF 4X3UA 4K6DA 3DHQA 4TQUS 2K01A 2CQAA 1PZID 5DNFA 5T1IA 2B2YC 4DNRB 4BY7B 2DY7A 2KCNA 2RDHA 1F9QA 1XXGA 4IQZA 3GO5A 2A73B 3MA2B 5HGTA 4OO1I 2D62A 3EVQA 2PW5A 1U4PA 1KAAA 3I70A 1K83B 2D9UA 3A8KE 3S2HB 4WRDA 3S1RB 5LL6S 3MAQA 2NWGA 4RA8A 4A3BB 5FO8B 3PUWA 5EGTA 2ZXPA 2PYKA 1U9RA 1GUSA 2LS01 4NKLA 4L6TB 1FNVA 2K5DA 5BN5A 2HUGA 4XYOA 2OEOA 1CT1D 2AQ2B 2NN6G 1HFNA 1O80A 2A6EC 2B39A 1DJRD 3MEHA 5IGFA 3NPPA 2IX3A 1B9NA 3S14B 4CJ0B 1A6XA 3NE5B 1CFMA 2NN6I 4M1UB 1V1PA 2AQ1B 4K8JA 3BZDB 2F3VA 3EFXD 2EYHA 1JOQA 4KN7C 2B2WC 4PV1C 1ICWA 1X3QA 3C1FA 1DOKA 5C4HA 1D1KA 1CA5A 2D2CC 3D8GA 2KA7A 4KY6A 3LWUA 1MGSA 3T4AC 2B2YA 1MBYA 2E2IB 4KMUC 5NUCA 1OXVA 5JPMC 4BY1B 1O7YA 4A3IB 4C3IB 4ZUJA 1RTNA 1B50A 2XNAC 1QILA 5E4WC 4HAEA 3IAYA 4IALA 1KLUD 3JAML 1BO0A 2CVRA 1L0XB 1JE4A 2EXZA 4K5VA 3DM1A 1JWMD 1QWYA 3OWFA 3SK5A 5M9OA 3DMUA 3J81L 1QNUA 3D3RA 3NXWA 4ID6A 3VA7A 5TSSA 3V2TA 2RQXA 1ML0D 1B53A 4K6LA 4ZKCB 1UNSA 2R92B 1I6HB 3ND9A 1VF7A 3OMGA 2JA8B 2B2WA 3QB3A 3NWTA 1HUNA 5D3IB 1G6ZA 4BWGB 1J8IA 5EPLA 1O7ZA 1S5CD 1LTSD 3BDCA 1PMRA 1UAPA 1WCMB 1EWHA 3FPUB 2NUCA 4HTHA 4IZ8A 2NVQB 2E2DC 2EOTA 3D31A 2K6AA 4C1NI 3C46A 5D65A 2IPKD 1NCVA 3DXJC 3J80L 2A6HD 2O4XA 3ND8A 3U9OA 1STAA 4XIGS 5IGEA 2F0LA 3A8IE 4YIJA 1F2LA 1EY7A 1MSGA 4RKLA 5C0XJ 2KVMA 1FR3A 3OWEB 2NYZD 3VR6A 1FGBD 1EYAA 4DXFA 3BDOA 3J7AV 1SYEA 4C3JG 1PFNA 2WAQB 1NR2A 5C4XB 1PXUA 1ET9A 3SEBA 2EYFA 1AZPA 3H94A 3TMEA 4KN4C 2WV6D 2XVSA 5CORA 2K7VA 3LNNA 4IUUA 4NP5A 3G7LA 4EQNA 3H3VC 2KQ3A 3RLFA 3T56B 1K8MA 3IKJA 2B8GA 1E2ZA 1EIGA 1SFOB 1RD9D 1YNNC 1YNJD 1Q3LA 4FF4A 2Z8LA 1I3QB 3I72A 2FHTA 4KHVA 4AYBB 2OXPA 3OW7A 2JA6B 5C3EB 3VR5A 2K5WA 2NTTA 5COYA 3FEWX 3MC0B 1DZ1A 2AUJD 5CBAE 3J7YW 4CBVA 2WIIB 3D4RA 2VXWA 5C5MA 1JOKA 1HHVA 3S16B 4EGVA 2D5DA 4OIKA 3V05A 5J22A 1LT3D 1G91A 2VB2X 3X3MA 2EJFC 3PIP3 1KDAA 1Y8NB 3L7ZC 2KECA 1LABA 1PZJD 2MPMA 4HMIA 3GTPB 2A68C 4G7OC 5CBEE 3MZ5A 2K28A 1FNUA 5ELEA 1F2YA 4GZYC 4I65A 2ZXRA 3R2TA 1A15A 1LTBD 4DU9A 2QKIC 2K33A 3MVVA 2JEAI 1V1PB 2JSOA 5EKKA 3QJYA 3TP5A 2KJXA 2Q8IB 5K5PA 3SDZA 1ZEQX 5JVH3 3SR1A 4X3SA 1G2SA 5CGKA 5JVG3 4WJWA 3QG1A 3WOEA 3QWNA 4KJOA 5C0XH 2BE5C 2AUKA 4R8NA 1HTLD 3K0YA 1EYCA 1STGA 3OIQA 1PFBA 4IUPA 3HEJA 3GTGB 3VYUA 2NVXB 4Q5VA 1YNND 3KBGA 2B2VC 2Q8TA 3MHBA 4TKOB 1F2MA 3Q6SA 1EFID 3BS1A 1ILPA 4RGTA 2NVTB 1SMYC 1SYFA 2BA0A 1RF2D 2PPBC 3D4DA 1Q12A 1JR0D 1CA6A 3GQBA 4QB4A 1K8OA 4XXEA 3MFYA 3NP8A 2K05A 3EQLC 2Q8RE 2KCCA 2E2JB 1H9KA 1TY0A 1PFMA 1GUGA 4LAAA 3DWQA 1L0YB 1JOOA 1KDCA 2EYJA 2LMCB 4ZRZA 3X3NA 3R3OA 4DAPA 2F0QA 4RGOS 5DM63
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZY C;  1Y8P B;  1CI3 M;  2QF7 A;  3ND9 A;  1IW7 C;  3FMC A;  4DK1 A;  2BDO A;  1HQM C;  4H44 C;  4KI0 A;  4KN4 C;  1A6X A;  2CW0 C;  1H9S A;  3NE5 B;  1CFM A;  2NN6 I;  1BDO A;  1H9S B;  1ZYR C;  3FPP A;  3PUX A;  1VF7 A;  2K33 A;  2E75 C;  1LAC A;  4LJZ C;  1QJO A;  4OO1 G;  2JEA I;  4BA1 I;  2O5I C;  4JBW A;  3M85 A;  1DD2 A;  3QJY A;  2K7V A;  3N6R A;  2Q8I B;  2YYZ A;  1TU2 B;  3LNN A;  3SDZ A;  3QIA A;  1IW7 D;  2BE5 D;  4KN7 C;  2A69 C;  2L5T A;  4OO1 H;  1HPC A;  2EDG A;  2JXM B;  4PV1 C;  1T5E A;  3RLF A;  3T56 B;  3HGB A;  1DCZ A;  2PNR C;  1K8M A;  3IKJ A;  1DXM A;  2B8G A;  1E2Z A;  2R6G A;  5KNB A;  1GHK A;  2D2C C;  1OXT A;  3KLR A;  3T53 B;  4RCN A;  4DNT B;  3QG1 A;  1E2V A;  2F1M A;  4XTC S;  5JEA H;  5A35 A;  2A69 D;  4G7Z C;  5C0X H;  1GUN A;  4KKT A;  5KNC A;  1YNN C;  2BE5 C;  2EVB A;  2AUK A;  2KA7 A;  2E74 C;  4BA2 I;  3LWU A;  3VR2 A;  3PUV A;  2AWO A;  2E76 C;  1IYV A;  1PMR A;  4TQU S;  1H9R A;  2DNC A;  3I72 A;  1EWH A;  2O5J C;  1GUO A;  4KMU C;  2ZT9 C;  1VDZ A;  1OXV A;  3H94 A;  3P20 A;  3PV0 A;  3OW7 A;  1H9M A;  4OGQ C;  4DNR B;  1YNJ C;  5JEA G;  3VR5 A;  1Q90 A;  4I7Z C;  1GJX A;  1OXS C;  4TKO B;  1O78 A;  1VCI A;  5C0X G;  1VF5 C;  1E2W A;  1FYC A;  4KKU A;  1Q1B A;  3D31 A;  2EJM A;  1IYU A;  4IQZ A;  1Y69 U;  1H9J A;  2AUJ D;  3IFT A;  3PUZ A;  1Q1E A;  1SMY C;  2D62 A;  3VR4 A;  2BA0 A;  5BN3 A;  3DXJ C;  2A6H D;  2JE6 I;  3D4R A;  3ND8 A;  2PPB C;  1Q12 A;  1G29 1;  4XIG S;  3CRL C;  3OPO A;  2JEB I;  2D5D A;  3GD7 A;  3A8K E;  4H0L C;  4KHZ A;  3M7N A;  4H13 C;  3U9S A;  1V43 A;  1Y8O B;  2DN8 A;  2NN6 H;  3A8I E;  3A7L A;  3BG3 A;  3GQB A;  4LK1 C;  3PUY A;  4HR7 B;  4IFD G;  1V8Q A;  1K8O A;  1Z6H A;  3MFY A;  5BN4 A;  2V4D A;  2A6H C;  2BA1 A;  1HTP A;  3EQL C;  3PUW A;  1HCZ A;  3T51 B;  2KCC A;  1CTM A;  2A68 D;  4IFD H;  2A6E D;  1FR3 A;  5K36 H;  2EJF C;  3WDN A;  3M4Y A;  1GUS A;  1H9K A;  3VR6 A;  1GUG A;  1B9M A;  3AB9 A;  3I73 A;  1TKW B;  5BN5 A;  5KND A;  1Y8N B;  3L7Z C;  4JK1 C;  3BDO A;  3VA7 A;  2DNE A;  1LAB A;  3W3A A;  1O7L A;  3OOC A;  2IT1 A;  3SE0 A;  2NN6 G;  1OXU A;  2EJG C;  2PCF B;  4KKS A;  1ZKO A;  2LMC B;  4DK0 A;  4G7H C;  2A68 C;  4G7O C;  2A6E C;  3I4L A;  4L8J A;  1Z7T A;  3TZU A;  3A7A B;  3MXU A;  5K36 G;  1ONL A;  2K32 A;  3CRK C;  1GUT A;  2B8F A;  3A8J E;  1I6V C;  3VR3 A;  1GHJ A;  1OXX K;  1B9N A; 
#chains in the Genus database with same CATH topology
 1GVP A;  3I4M G;  5AJ3 L;  4ZYS A;  3C1E A;  2CW0 C;  2MO1 A;  2L1B A;  1UE1 A;  4V0B A;  3CC7 A;  2M9V A;  1OTC A;  4EQO A;  4B3R Q;  1MIU A;  4PZ7 A;  5DM7 3;  2F0V A;  4A3D B;  1HR0 Q;  3ERO A;  1T5E A;  3RUZ A;  4LF9 L;  4EQP A;  4BXX H;  4LFA Q;  1EOV A;  1EU3 A;  1QG7 A;  4BY1 G;  4A3C G;  1NTG A;  3B6Y A;  1EQV A;  1WOC A;  1C8C A;  3U50 C;  2OQ0 A;  4F87 A;  3PO2 G;  2IW3 A;  1Y1W H;  2A8V A;  1YBY A;  1SEB D;  2WKD A;  2Z0S A;  2AWO A;  3PUV A;  1HR0 W;  5G3L F;  4NMZ A;  2WIN B;  2B2V A;  2UUC L;  3MEF A;  2SNM A;  3HKZ B;  2EYP A;  1SE8 A;  2F0F A;  4OL7 A;  5C4J B;  3K0X A;  4LFA L;  4L5S A;  2ZTC A;  5JEA G;  1Y1W B;  5JEA J;  1OXS C;  3DWP A;  3QOJ A;  4B9X A;  2YTX A;  1QUQ B;  1Q1B A;  2F4I A;  1WD1 A;  1CKM A;  1UWV A;  4RKB A;  3TP6 A;  1Z47 A;  2L0C A;  2CH4 W;  4GOP C;  1C0A A;  3NUC A;  1NMF A;  4P72 A;  1SMY D;  2R93 H;  4H0L C;  2EE1 A;  4XQN A;  2OTL A;  4GKK Q;  5IT9 E;  2JK8 A;  3PUY A;  3HOZ H;  1PH4 A;  4GN5 A;  2HT1 A;  2RVL A;  2R7F A;  3H0G H;  1ENF A;  4UPA A;  4IFD H;  5FLX E;  4NXM L;  2B63 G;  4YY3 Q;  3FRP B;  1B2T A;  2R93 B;  2HHH L;  2AHO B;  1B3A A;  4HID A;  1PH5 A;  1DM0 B;  3HOZ B;  5IYD H;  4OWX B;  2Y0S E;  1PTO F;  1PRT D;  3H0G B;  1UUP A;  1X56 A;  2OF1 A;  4GKK L;  5KEE A;  4OWW B;  3A7A B;  2NZO A;  4J8Q A;  1YJW A;  4Y7N H;  1BUV T;  1Q8K A;  1Q81 C;  2PI2 E;  1ASY A;  2QF7 A;  4YY3 L;  1NSN S;  3URY A;  3FKI H;  1SSO A;  4A3K H;  1R4Q B;  4G4K A;  2ASB A;  1TQO A;  1XMO Q;  1EY0 A;  2JP1 A;  1EY5 A;  4Y7N B;  4PQX A;  1ESF A;  1HNZ Q;  2K4K A;  1R9T H;  2IWH A;  2JQO A;  4CKC A;  2CW0 D;  3FKI B;  1X32 A;  3ICE A;  4A3K B;  4KV6 A;  2HQL A;  1GHK A;  1RDP D;  4A3E H;  4ZAI A;  4DNT B;  1D5X C;  3NQT A;  2AWN A;  3E0E A;  4C3H H;  4R9W A;  2JA7 G;  2Y0S B;  5CV5 A;  1R9T B;  1EY6 A;  1LTT D;  1XMO L;  1I4X A;  2XWB B;  1XTD A;  3STB C;  1IYV A;  2HCI A;  2F0O A;  2NZH A;  1MI2 A;  1HNZ L;  4A3G H;  4A93 H;  2ID0 A;  3T13 A;  4A3E B;  2K5Q A;  4C3H B;  3UE0 A;  1VQG A;  3PF4 A;  4K5X A;  4JBJ A;  4LF6 L;  1TWG H;  3WOF A;  3JC6 6;  3HOV G;  3CD6 A;  1K0R A;  5H1S E;  4ZQ3 A;  1DOM A;  1SN8 A;  4B08 A;  4A3G B;  3BYY B;  2ICI A;  1Y69 U;  3NHH A;  1SAP A;  4A93 B;  4JI4 Q;  2D0P A;  2Q2I A;  1YJ9 A;  4C3I H;  5BN3 A;  3SK6 A;  1SXT A;  3PCO B;  4EVO A;  3NTK A;  5D14 A;  1CSQ A;  5T1G A;  4QUF A;  1TWG B;  3RN2 A;  1EZ8 A;  2PQE A;  1S5E D;  3OYY A;  5IYC G;  2EYL A;  4H13 C;  3HOX B;  2MNA A;  5C4X G;  1F2Z A;  1SRU A;  2DJG C;  5LMU Q;  1ZXT A;  3S1M B;  2A6H C;  2Q2H A;  4BBS H;  2BOS A;  5JJZ A;  1CTM A;  1OO9 B;  5CV9 A;  1D7Q A;  4ZK9 B;  3I73 A;  4ALP A;  4JPB W;  2FMM A;  4P73 A;  5KYI A;  4EX5 A;  2PZW A;  2QGQ A;  4B3S Q;  4HMJ A;  4BBS B;  4C2M H;  3S1Q B;  4CGY B;  1TWF H;  1ZYR D;  1IKL A;  2MJ8 A;  1IL8 A;  1L2F A;  3MXU A;  1HRJ A;  1AFP A;  3H3V H;  1BCP F;  3U4V A;  1O7I A;  1G6P A;  4Z9C B;  3CC4 A;  4K2L A;  1VQK A;  4DK1 A;  3K5O A;  1IYJ B;  1YHA A;  2HD3 A;  1H9S A;  4C2M B;  1TWF B;  5IGG A;  1LAC A;  1FL0 A;  3KOJ A;  2F4V Q;  5I6W A;  4B3S L;  3GP7 A;  3OTO L;  1TU2 B;  2HQE A;  4OO1 H;  2K1B A;  1CK1 A;  2EDG A;  3D0F A;  2JA8 H;  1DCZ A;  1A3T A;  5FLM H;  3ERQ A;  5KNB A;  2EPB A;  2ZM6 L;  1KXL A;  3LGJ A;  1SE2 A;  2F1M A;  4PNY A;  1N32 Q;  5C6A A;  1CKO A;  4K5W A;  3CCV A;  3TZD A;  3U4Z A;  4DUY Q;  1EY9 A;  1LV9 A;  4R1J A;  1X9N A;  4JI5 L;  3HOU H;  3JAM i;  1Q82 C;  1L0W A;  1Q8I A;  5IOC A;  1LT6 D;  5E7N A;  3P20 A;  2GA4 B;  3NSW A;  3P1H A;  1H9M A;  3M4Q A;  1YNJ C;  4DPG A;  1GJX A;  4RWS C;  1EQR A;  3R8B A;  4CKB A;  1N32 L;  1PH2 A;  2EYM A;  4BBR G;  1HNX Q;  1T5X D;  1E2W A;  1UE6 A;  2XIW A;  5JJL A;  1SNM A;  5JOB A;  3HOU B;  4DUY L;  3TRZ A;  5E3F A;  1WTP A;  5IWA Q;  3I8Z A;  1GUW A;  3KUP A;  1XMQ L;  5ELO A;  4GKJ L;  5ISR A;  3CRL C;  2JEB I;  3H09 A;  2H1E A;  2KEE A;  4UAI A;  1A0I A;  4KHZ A;  3S15 H;  1Y1V G;  4LF5 Q;  1V43 A;  2DN8 A;  2NN6 H;  3QOL A;  2SDF A;  4KLK A;  1IHZ A;  1YEZ A;  1SMX A;  4TSS A;  4DK3 C;  3K5N A;  4AQY L;  3AU7 A;  5CV7 A;  2J0T D;  1BNZ A;  3P75 A;  5IWA L;  2HIV A;  3S15 B;  4X64 Q;  2MO0 A;  4R8I A;  1WTO A;  1RCV D;  4NDX A;  3SE0 A;  3V96 A;  4KKS A;  3KJO A;  3UDF A;  5E4X A;  2M00 A;  2F0W A;  1G2T A;  1B44 D;  4Y52 H;  1VQ6 A;  3R2I A;  1SYB A;  2RBM A;  1KAB A;  5K36 G;  4MNO A;  3Q0A A;  1ILQ A;  3ONA B;  4FF3 A;  3K7A H;  1B1Z A;  4IUR A;  1HA6 A;  1I50 H;  1CI3 M;  1IW7 C;  5JJI A;  4ZLT F;  4JI8 Q;  5C44 G;  4DV7 L;  4X64 L;  4X66 L;  3KDF A;  2MQH A;  4KTA A;  1X3E A;  1EYG A;  4WJ3 M;  1MHW C;  2I5H A;  3K7A B;  3J7A F;  4ZUI A;  3BZK A;  1I50 B;  2DJF C;  1SJE D;  1AN8 A;  1D2B A;  4UHV A;  4M8A A;  3CXC A;  2NZ1 D;  2F0J A;  1X54 A;  1QOH A;  2LXJ A;  1MD2 D;  3DEO A;  4KKT A;  1NE3 A;  3SK8 A;  4IJH A;  3VA5 A;  4B3T L;  4OIJ A;  1EOT A;  3BDL A;  3E3X A;  1TR5 A;  2FXQ A;  3DUZ A;  4U67 3;  3BVZ A;  3ER0 A;  1HZC A;  3J80 i;  2KUM A;  4QMG A;  4V19 0;  1YHB A;  2G9H D;  5IGB A;  5KGU A;  3I56 A;  4R4T A;  1IBK Q;  1EY4 A;  1Y14 B;  5IP7 H;  2Z9H A;  2F0E A;  4K2K A;  1N36 Q;  1C48 A;  2EJM A;  2UUA Q;  2Z4H A;  4ZKB B;  5I2X A;  1J5E Q;  1H9J A;  3PUZ A;  2XSC A;  4N9T A;  3F2B A;  2JA6 H;  3K5M A;  1VQ4 A;  1IZ6 A;  5ELC A;  2JE6 I;  5DAU A;  5CC4 A;  3TSS A;  1NR4 A;  5DEH A;  3TDQ A;  4OWT B;  1SJH D;  3JAM E;  2LKV A;  4HJ5 A;  1KNA A;  3U9S A;  4ILW A;  1RHP A;  2VL6 A;  3I4O A;  1EEF D;  2WAC A;  2Z1C A;  1S5D D;  1J5E L;  2BA1 A;  5JPN C;  1L1O C;  4J15 A;  4FVM A;  3GTO B;  3M9B A;  3KBX A;  1EWC A;  1XPU A;  2I46 A;  4ABN A;  4DV0 L;  3S17 H;  3M3Y B;  3J81 E;  1KD1 C;  1OXU A;  4HED A;  1E22 A;  2JA5 G;  4JI2 Q;  3I4L A;  1Z7T A;  4C56 C;  2H4O A;  3QR8 A;  3CCJ A;  2K32 A;  1LTG D;  4F88 A;  3PIO A;  1JCK B;  1AE3 A;  2CKZ B;  3S17 B;  3GTP H;  1JJG A;  1OXX K;  4FXD A;  1TWC H;  2F0I A;  1MSH A;  1JB3 A;  1LO5 D;  2E75 C;  5IIF A;  2C5C A;  4BA1 I;  1QVF A;  4JI2 L;  4BXX G;  3L0O A;  1IW7 D;  1EFW A;  2N3S A;  4RCO A;  4OON A;  3GTM H;  2PMZ E;  1RIP A;  3SHL A;  1U4L A;  2L11 A;  1AE2 A;  3HOW H;  3C3L A;  1TWC B;  3N52 A;  3CME A;  4NPS A;  5KRU A;  1TS4 A;  3W2D A;  4DUZ L;  3ERS X;  5IY0 A;  3ULP A;  2JYO A;  4S3S A;  2B2T C;  1CUK A;  1BBW A;  4HSV A;  1Q46 A;  4IJL A;  4A3J G;  2VUM H;  2X6L A;  3VR2 A;  3NBI A;  1STN A;  1E1T A;  3GTM B;  2A19 A;  5D3D A;  1C4Q A;  3HOW B;  2FJ2 A;  4A3M H;  4JOI C;  3CCS A;  2PW7 A;  5FLX L;  1I94 Q;  2RKS A;  4JI3 Q;  4FF1 A;  1UE7 A;  4DN4 M;  4OGQ C;  5EJW A;  1II3 A;  2VUM B;  1BOS A;  1PZK D;  1BF4 A;  2F03 A;  4BY7 G;  1IYU A;  1PH8 A;  4FP5 D;  4A3M B;  3K5L A;  1A2U A;  5J3B A;  4FNF A;  1QB5 D;  1B4O A;  4RH6 A;  5GAD C;  2VQE L;  4JBK A;  2PMZ B;  1I94 L;  2XRS D;  2UXC Q;  3CMA A;  3TBI B;  4JI3 L;  3UDG A;  1GM5 A;  4XT3 B;  4C3J H;  3NK9 A;  1L1O A;  5EBC A;  4IFD G;  1KL9 A;  1JIC A;  4DFA A;  2IJ0 A;  3TN2 A;  3KF8 A;  1WTH A;  5BN4 A;  2V4D A;  1X55 A;  1HTP A;  1HCZ A;  3GTL H;  1V1O A;  1MKH A;  4A3B G;  5ELF A;  2E2H H;  2XWJ B;  3GDE A;  3EA6 A;  4C3J B;  4JK1 C;  1STE A;  3W3A A;  1TT2 A;  1WTQ A;  2PCF B;  2WFW A;  1ZKO A;  4X3K A;  1ET6 A;  4RAU C;  1MJE A;  3GTL B;  1JWS D;  1EYD A;  2E2H B;  2P5Z X;  5FLX c;  3KJP A;  1LLR D;  1FJG L;  1JWU D;  1M4V A;  2PZT A;  1EY8 A;  4DAV A;  2EY6 A;  1PRT C;  1K73 C;  3NTH A;  3ZYY X;  1H9S B;  2PZU A;  5FO7 B;  3ULJ A;  3GV3 A;  3D6C A;  2KCM A;  4DR1 Q;  1EIF A;  3M85 A;  2SOB A;  2I07 B;  1AW7 A;  5FO9 B;  2YYZ A;  4IOA A;  2X6G A;  5LMN W;  2A69 C;  1VQF A;  4JV5 L;  4A3E G;  1ENA A;  2JXM B;  1JC7 A;  3NEM A;  2GVB A;  1U4M A;  2B2T A;  3G6J B;  4KHP Q;  1J9O A;  2EYO A;  1ESR A;  3VDY A;  1D6E C;  5A35 A;  2J7Z A;  1S4Z A;  4AH6 A;  3RN5 A;  5M5Y B;  1NY4 A;  4JOI A;  4P71 A;  4A3G G;  3KLS A;  1PTO C;  3CPF A;  4YCW A;  1VQJ A;  3I7F A;  3RMH A;  1M90 C;  4F7X A;  1YNX A;  5GQO A;  4DR6 Q;  1SE4 A;  1LT4 D;  5IP9 H;  4KK7 A;  4L63 B;  4KHP L;  3H6M A;  1PHJ A;  1O78 A;  3O13 A;  4QUC A;  4A3I G;  4C3I G;  2KEN A;  3J81 j;  4R4Q A;  2BDN A;  5C4J H;  4DF7 A;  4P74 A;  3VR4 A;  5C5L A;  3OSO A;  4DR6 L;  2L4N A;  4P2C B;  4B3R L;  3EN2 A;  5CMD A;  1HR0 L;  3OPO A;  2QW7 A;  3CCU A;  5ELD A;  4K14 A;  5M3M H;  3I4N H;  3NEN A;  3J7A 5;  1BXT A;  5IYB H;  1H95 A;  1G8Z D;  4LNQ A;  1GOZ A;  2B29 A;  3RD4 A;  2H5X A;  3WDN A;  2X69 A;  3M4Y A;  1I4H A;  2QDB A;  4RGM A;  1WVL A;  4ME5 A;  3AB9 A;  1TWA H;  2CWA A;  3HOY H;  3HG9 A;  5M3M B;  4FYD A;  3GV6 A;  4UDU C;  3I4N B;  4MTN A;  1C9O A;  1VQI A;  1B70 B;  4DR3 Q;  2WB1 E;  4NXN Q;  3PO3 H;  5G3L D;  4G7H C;  4DV3 Q;  1XWE A;  1SYC A;  3CC2 A;  3HZX A;  5DLQ E;  1RJT A;  2QCP X;  1TWA B;  2K52 A;  2B8F A;  3HOY B;  1PDQ A;  1ROD A;  3A8J E;  1PH7 A;  3RZD H;  1T9H A;  3VR3 A;  2N49 A;  1A3V A;  2R92 G;  1A8V A;  1MJC A;  1PLF A;  2RCF A;  3BZC A;  2KED A;  3FMC A;  1TS5 A;  4OHJ A;  2BDO A;  1HQM C;  3I91 A;  3PO3 B;  5CR3 A;  1KNE A;  1HA5 A;  1XNQ Q;  1BDO A;  1ZYR C;  3KDF B;  1I4Q A;  4OO1 G;  4HN7 A;  3A56 A;  2SNS A;  4NXN L;  1F77 A;  4ULL A;  1DD2 A;  5HY6 A;  2JA8 G;  1HH2 P;  3NQI A;  3RZD B;  2A1A A;  2RA4 A;  4OEL B;  2Z4I A;  3EIV A;  1W6J A;  3K57 A;  1HXY D;  1LTI D;  2CHB D;  3Q22 A;  2PQA A;  2A69 D;  5J39 A;  4G7Z C;  1XNQ L;  3GTQ H;  4MN3 A;  1GUN A;  3FHW A;  5I4D A;  1XTC D;  4XQQ A;  4WFN 3;  2WB1 B;  1CM9 A;  3HRZ C;  4GS3 A;  1CSP A;  4L5Q A;  1SDF A;  3S1N H;  1NBW A;  1S5F D;  1P16 A;  3CQZ H;  1BCP C;  1CZG A;  2G5D A;  2F0M A;  2E5L Q;  4LF7 Q;  1WCM G;  3GTQ B;  3CCM A;  1PTO D;  2B2U C;  2DUD A;  1VCI A;  3ULL A;  4RFB A;  3R93 A;  4IUQ A;  5M5W B;  3E6Z X;  3IFT A;  3M4O H;  2ZJR A;  3S1N B;  3NEL A;  3CQZ B;  4DR7 Q;  5M3F H;  2GVA A;  4R4I A;  3W1B A;  4UP8 A;  3A55 A;  4QGU A;  1G29 1;  3UI2 A;  4PG3 A;  4HJA A;  1FD7 D;  1HQR D;  3T1Y Q;  1KQS A;  3M4O B;  4FXG C;  4LK1 C;  3MXP A;  1DGS A;  2F0K A;  3OHX C;  5KIX A;  5E1F A;  5M3F B;  5GAH C;  3T51 B;  4AIM A;  1AH9 A;  1SNP A;  5A2Q E;  1CHP D;  4DR7 L;  1V1Q A;  3HOX H;  4KY7 A;  5I9P A;  2DNE A;  3I4M H;  3S1M H;  3WWV A;  1A3U A;  1O7L A;  5I2Y A;  3SVM A;  5EKI A;  3T1Y L;  3LX0 A;  4O1N A;  1SNO A;  1KLG D;  2OTJ A;  2WAQ G;  3BVM A;  1S40 A;  3TZU A;  1Q7Y C;  3BYT B;  4GLV B;  1ONL A;  4FF2 A;  3K59 A;  3ITP A;  1TWH H;  4RG1 A;  1VQL A;  2F0G A;  3I4M B;  4JI4 L;  3S1Q H;  4A3C H;  3TRE A;  4DR2 Q;  2UUB Q;  2R7D A;  4LJZ C;  4PMW A;  1PH9 A;  1QJO A;  3PO2 H;  3CU7 A;  5L37 A;  2K5V A;  1HUM A;  1ASZ A;  1TWH B;  1SYD A;  1S5B D;  3L9A X;  3EJI A;  2L5T A;  5FOB B;  2OQK A;  4MZ9 A;  4CHT B;  1HNW Q;  3KYH C;  5LMU L;  2UU9 Q;  1TII D;  1DXM A;  1OXT A;  3KLR A;  5CV4 A;  3A0J A;  4O42 A;  3PO2 B;  1X3P A;  3FDT A;  1F9P A;  3S24 A;  2CQO A;  5JEA H;  2ZJP A;  4GN4 B;  2QEJ C;  1I4P A;  4BS9 A;  5GAG C;  3ZJY C;  1TXY A;  2RDF A;  1SNQ A;  4O0A A;  3E5S A;  4BA2 I;  5HUR A;  4KY5 A;  4ZCK A;  1KHI A;  2ENB A;  4OEM B;  3TS0 A;  3K80 C;  2AKW B;  2MFI A;  1BVS A;  2B2U A;  1YJN A;  4JI1 Q;  2O2L D;  4XQJ A;  1VDZ A;  1ENC A;  3CKI B;  1BBX C;  1TVX A;  3I3C A;  1D5M C;  5I6Y A;  2TMP A;  4AYB G;  3IRB A;  1Q90 A;  3H91 A;  1CQF A;  2QDL A;  4RHS A;  4GLA C;  2OCE A;  3E0J A;  2JA6 G;  4PMB A;  5C3E G;  1FYC A;  2GN5 A;  1BCP D;  1WI5 A;  5BR8 Q;  2IL8 A;  1DOL A;  2F4V L;  1STH A;  2B63 H;  1RL2 A;  4HCS A;  2HIX A;  2LSS A;  1PFS A;  5CV6 A;  2WP8 J;  1GXD C;  1CZW A;  4X3T A;  1WJJ A;  2IHE A;  2F0P A;  4C1N K;  3M7N A;  1HZA A;  2O5I C;  1L1O B;  1KRS A;  3CHB D;  5IGC A;  1LTR D;  5C3W A;  1Z6H A;  3KF8 B;  3CW2 C;  2O5J C;  5BR8 L;  2F0H A;  2B63 B;  2A6E D;  3NTI A;  1KIX A;  1TY2 A;  1BQQ T;  1B9M A;  2C9O A;  4WOR A;  5KND A;  4LUV A;  3M7G A;  4JI6 Q;  4DV1 Q;  2L9H A;  2K5N A;  1IKM A;  5EKL A;  4J1M A;  2VQF Q;  4FO2 A;  1VMC A;  2LFN A;  1HNX L;  4YWK A;  2TSS A;  4RGN A;  4G57 A;  1NUC A;  4APV A;  1A2T A;  4J6H A;  3GTK H;  3MFG A;  2MUY A;  4HIM A;  4JI6 L;  3FPP A;  4RHR A;  4CDE C;  2JA7 H;  2EIF A;  3L3O C;  1SNC A;  4JBW A;  5LHY 1;  2DY8 A;  1CKN A;  1IBM Q;  2VQF L;  5I9O A;  4LF5 L;  4LF8 Q;  1DON A;  3DLL A;  3GTK B;  3PF5 A;  1GD7 A;  2VUM G;  3P7J A;  2ICE C;  2MHV A;  2JA7 B;  1I5F A;  1K0S A;  3MXG A;  4LF4 Q;  1EL0 A;  4KD4 A;  2RSN A;  1GKH A;  3HOV H;  2XN9 C;  3S2D H;  1JOR A;  5KNC A;  4IUV A;  4QIW E;  1DYQ A;  2E76 C;  2I5M X;  2JA9 A;  2FFK B;  3C2P A;  1EU4 A;  3VYT A;  4NW2 A;  4DXG A;  1UEA B;  2ZJQ A;  4YCU A;  3HOV B;  3S2D B;  2WKC A;  3AFQ A;  1AEX A;  3UDI A;  5C0X G;  1KRT A;  3S9W A;  4IPG A;  1WTR A;  1VQ9 A;  3F2U A;  4H7B A;  4JI8 L;  1STB A;  3GTJ B;  1YIJ A;  1E3P A;  1U0L A;  4A76 A;  2K75 A;  2F0D A;  3D6W A;  4LWC A;  1LT5 D;  2V1C C;  5EPJ A;  1XNR Q;  3CAM A;  2ALY B;  1F9R A;  4Q0F A;  5C0X I;  4ODG A;  2F0N A;  2VB3 X;  1FNW A;  4U68 A;  4HJ7 A;  1V8Q A;  2K50 A;  4QIW B;  3SXH A;  4RMF A;  4TVA B;  2K03 A;  1TS3 A;  2F0U A;  4YHH Q;  4JW0 A;  1TS2 A;  1PYB A;  2NTS A;  4DGZ A;  2KHI A;  2F3W A;  2Z6K C;  1QE6 A;  5F2D A;  2IT1 A;  1VMP A;  1LM0 A;  2A74 C;  2YV5 A;  2XRQ D;  4FDB A;  3GTO H;  2N8N A;  5FJ8 H;  1EUJ A;  1RKN A;  1IBK L;  3L2P A;  5CV8 A;  3CRK C;  3M3Y H;  1CQV A;  1PRT B;  2G9D A;  1N36 L;  2UUA L;  5IGD A;  4FXK C;  4YHH L;  1EEI D;  4CDC C;  2L15 A;  4KD3 A;  1VQM A;  4H44 C;  2BH2 A;  2MP1 A;  2I0Q A;  1W6K A;  4KI0 A;  1KDB A;  1M8A A;  4A75 A;  4X65 Q;  4A3L G;  2FIN B;  1PTO H;  3N6R A;  4XYQ A;  1NAP A;  4IUN A;  3MWY W;  1SYG A;  2Q2U A;  2XTI A;  4HCE A;  4CKE A;  1HPC A;  3PMF A;  4A3D G;  3HGB A;  1NNX A;  5J1Z A;  4O2D A;  4PZ6 A;  3AEV A;  2OWO A;  1XX8 A;  5M5X H;  3BVG A;  3UDX A;  1PTO B;  2PQA B;  4BBR H;  1I4G A;  2NVY B;  2EVB A;  2ZXO A;  1WD0 A;  3RNU A;  2M2L A;  1VQN A;  1EQT A;  5M5X B;  1GUO A;  2EZV A;  3TP8 A;  3HKZ G;  4CJ1 B;  4BBR B;  3PV0 A;  4K8I A;  4I7Z C;  3I90 A;  3RLN A;  2R3Z A;  2EY1 A;  4PMC A;  1Y1V H;  1VF5 C;  2IX0 A;  4LMQ D;  1WTW A;  1Y1W G;  2F0T A;  4KKU A;  5FKA C;  2NB0 A;  3I2Z A;  3T16 A;  4MHE A;  2VNU D;  3UE1 A;  1SE3 A;  1STY A;  5IT9 L;  2K14 A;  3OIP A;  3K58 A;  2IHF A;  1Y1V B;  1PYW D;  1VQ7 A;  3KK7 A;  1XYI A;  3QO2 A;  4JI0 Q;  1EIY B;  5KYL A;  1Y8O B;  4HSP A;  3OW2 A;  2HDM A;  3KFU A;  4HR7 B;  4XDX A;  1YVC A;  4B9W A;  3Q24 A;  4JI7 Q;  2Z6K A;  5K36 H;  4JCV E;  1SBB B;  3D4W A;  2OT2 A;  3EBE A;  4DV4 Q;  2L55 A;  1TKW B;  1AZQ A;  3PO3 G;  4L5T A;  2F3I A;  2YU9 H;  5C44 H;  2R93 G;  5C3X A;  1BR9 A;  4LFB Q;  2EJG C;  2FMC A;  4JI0 L;  3VYR A;  4DK0 A;  3HOZ G;  3NBH A;  4NB3 A;  2N55 A;  2CCZ A;  4L8J A;  3H0G G;  4UY8 C;  1JQY D;  3KLS X;  3W1G A;  4IFD J;  3J80 E;  1KC8 C;  3RZO B;  2NBF A;  1QCB D;  3E9I A;  1GUT A;  3PQI A;  2BCO A;  1W3S A;  1I6V C;  2YU9 B;  1XPR A;  5C44 B;  4DV4 L;  1VS0 A;  5IYD G;  3PUX A;  3VYS A;  1YIT A;  2WB1 G;  4KJN A;  2UXC L;  3QIA A;  3F1Z A;  4IFD I;  5IT9 c;  5EPK A;  2HDL A;  3PGZ A;  3HP3 A;  2N88 A;  2R61 A;  2LY7 A;  1B8A A;  4A3F H;  2Z6B A;  1K9M C;  3TQY A;  1FGU A;  3FKI G;  5LMN Q;  4QCL A;  1E2V A;  4A3K G;  3G71 A;  2F0S A;  4E6I A;  2E74 C;  2HCC A;  4JG2 A;  3IL8 A;  2Y0S G;  3TP7 A;  1BCP B;  4A3F B;  3A54 A;  1JT8 A;  4LFC Q;  1R4P B;  1H9R A;  1U4R A;  2DNC A;  5EQ0 A;  5LL6 X;  5M5Y H;  4JYA Q;  5A2Q L;  1QVC A;  2AQ3 B;  2ZT9 C;  1KTK A;  3IFD A;  5LMN L;  4C3H G;  1QZG A;  1JJC B;  4MIU A;  1VQ8 A;  2UXD Q;  2KHS A;  5M3F G;  3OMC A;  5CYU A;  1Q1E A;  1RTO A;  4N8F A;  2A5H A;  2MGS A;  4DR1 L;  4A93 G;  3SK4 A;  1K3R A;  2PO4 A;  1LTA D;  2J4X A;  1KAW A;  2EY5 A;  1GO3 E;  1HFG A;  3F2D A;  3MXN A;  3GD7 A;  1XJV A;  1A62 A;  4IOC A;  1VQC A;  3BG3 A;  3A7L A;  5IOD A;  3W5O A;  2C35 B;  2B3G A;  4LF9 Q;  2JA5 H;  1I4R A;  4YWL A;  3HOX G;  2QIL A;  1D5Z C;  1WTV A;  1EIH A;  1EZ6 A;  4IN3 A;  1SND A;  4IUT A;  3LWE A;  2A68 D;  1HZB A;  3NWS A;  4DA2 A;  2K04 A;  1E0B A;  3OOC A;  2SEB D;  2JA5 B;  1WTX A;  5EBD A;  4QF4 A;  2UUC Q;  2JN4 A;  3I55 A;  3G6E A;  3AMU A;  1WFQ A;  1LTL A;  2RSO A;  4N9P A;  4BBS G;  5AFW A;  1QNK A;  1D1I A;  3K6O A;  3HS0 C;  3K8A A;  2R7Z H;  3MTS A;  2EY2 A;  1GHJ A;  1Y8P B;  3Q23 A;  1F9S A;  4CJ2 C;  2IX1 A;  1N34 Q;  4XT1 B;  4OX9 Q;  4QJF A;  5ELB A;  4A3J H;  3FVQ A;  5JAV A;  4DAY A;  2KOL A;  2R7Z B;  1CKN B;  4F8M A;  4DV5 Q;  2BE5 D;  1C7Y A;  2UXB Q;  3H15 A;  2L12 A;  1U5K A;  3DEP A;  2PNR C;  5FK9 C;  1X3G A;  2R6G A;  1CHQ D;  3DWA A;  3T53 B;  4RCN A;  5C4Z A;  4XTC S;  4A3J B;  1XPO A;  4TRD A;  1S72 A;  2VW9 A;  1AP0 A;  1N34 L;  4BY7 H;  3PIO 3;  1VQA A;  4OX9 L;  2RDG A;  3BU2 A;  1EQQ A;  3F8T A;  4NXM Q;  1K3B C;  1PRT F;  4X3U A;  3H3V I;  2HHH Q;  4K6D A;  3DHQ A;  4DV5 L;  4DR3 L;  4TQU S;  2K01 A;  2CQA A;  3T1H Q;  2UXB L;  5FLM G;  4DV3 L;  1PZI D;  5DNF A;  3AQQ A;  5T1I A;  2B2Y C;  4DNR B;  4BY7 B;  2DY7 A;  2KCN A;  2RDH A;  1F9Q A;  1XXG A;  5EAY A;  3A5U A;  1K83 H;  4IQZ A;  3AYH B;  3GO5 A;  3S2H H;  2A73 B;  4IPD A;  3S1R H;  3MA2 B;  1E1O A;  5HGT A;  4OO1 I;  1N9W A;  2D62 A;  3EVQ A;  1V9P A;  3HOU G;  2N78 A;  4A3B H;  2PW5 A;  1SRO A;  3T1H L;  2K5H A;  1U4P A;  5M5W H;  1VQ5 A;  3G4S A;  1KAA A;  3I70 A;  1K83 B;  2D9U A;  3A8K E;  3S2H B;  4WRD A;  3S1R B;  5LL6 S;  3MAQ A;  4H02 A;  2NWG A;  4RA8 A;  4A3B B;  5FO8 B;  3PUW A;  5EGT A;  2ZXP A;  2PYK A;  1U9R A;  1GUS A;  2LS0 1;  4NKL A;  2RHS B;  1FNV A;  2K5D A;  4L6T B;  5BN5 A;  2HUG A;  4XYO A;  2OEO A;  3CCE A;  3S14 H;  1CT1 D;  2AQ2 B;  2NN6 G;  1HFN A;  1O80 A;  2E5L L;  4LF7 L;  2A6E C;  4CDF C;  4GNX C;  2B39 A;  1DJR D;  4POG A;  3MEH A;  5IGF A;  3NPP A;  2IX3 A;  4LF6 Q;  2DGY A;  2VZA A;  1ICF B;  1B9N A;  3S14 B;  5ELN A;  4CJ0 B;  1A6X A;  3NE5 B;  1HZ9 A;  1CFM A;  2NN6 I;  4K0K Q;  4M1U B;  1V1P A;  2AQ1 B;  4K8J A;  3BZD B;  2F3V A;  1P8L A;  3EFX D;  2EYH A;  1JOQ A;  4KN7 C;  2B2W C;  3CCR A;  4PV1 C;  1ICW A;  1X3Q A;  3C1F A;  4GLX A;  1DOK A;  5C4H A;  1D1K A;  3KF6 A;  2E2I H;  1CA5 A;  2D2C C;  4DAM A;  4BY1 H;  3D8G A;  4K0K L;  4GOP A;  2KA7 A;  1WYD A;  4A3I H;  4KY6 A;  1JMC A;  3LWU A;  1MGS A;  3T4A C;  2B2Y A;  1MBY A;  2E2I B;  3Q8D A;  4R4O A;  1S3O A;  4LW1 A;  4KMU C;  5NUC A;  1OXV A;  5JPM C;  4BY1 B;  4CDD C;  1SLJ A;  1O7Y A;  4A3I B;  4C3I B;  4ZUJ A;  1RTN A;  1B50 A;  2XNA C;  1QIL A;  5E4W C;  4HAE A;  3IAY A;  4IAL A;  4DR2 L;  2UUB L;  3M4P A;  1KLU D;  3JAM L;  1X3F A;  1BO0 A;  2CVR A;  2F52 A;  1L0X B;  1JE4 A;  4UP9 A;  2EXZ A;  4K5V A;  3DM1 A;  3OTO Q;  1HNW L;  4DNI A;  5IP7 G;  3CPW A;  2UU9 L;  1JWM D;  1QWY A;  2YTV A;  3PIP A;  3E9H A;  3OWF A;  3SK5 A;  2ZM6 Q;  5M9O A;  3DMU A;  2VY3 A;  3J81 L;  1QNU A;  1VQH A;  4JC0 A;  3SGI A;  2R92 H;  3D3R A;  3NXW A;  4WJ4 A;  4ID6 A;  1I6H H;  3VA7 A;  5TSS A;  5FJ8 G;  4GNX A;  3V2T A;  2RQX A;  1ML0 D;  4JI1 L;  4JI5 Q;  5IE8 A;  1B53 A;  3NBH B;  1PH3 A;  4K6L A;  3G48 A;  3TS2 A;  4ZKC B;  1UNS A;  2E8G A;  2R92 B;  4DKA C;  2EQS A;  1I6H B;  4ME3 A;  3ND9 A;  1VQB A;  3DM3 A;  1VF7 A;  3OMG A;  2IY5 B;  2JA8 B;  2B2W A;  1X65 A;  1N8R C;  3QB3 A;  3JAM c;  4P75 A;  2CFM A;  3NWT A;  1XMQ Q;  4GKJ Q;  1HUN A;  3STB D;  1W2B A;  5D3I B;  4L5R C;  1IBL Q;  1G6Z A;  1WCM H;  4BWG B;  1J8I A;  5EPL A;  1G51 A;  1O7Z A;  1S5C D;  4AQY Q;  4QY7 A;  4UP7 A;  2NVQ H;  1LTS D;  3J81 c;  3J81 i;  4DV1 L;  3BDC A;  2JJQ A;  1PMR A;  1UAP A;  1A63 A;  4OXP A;  4X6A H;  1LYL A;  1WCM B;  3KLW A;  1EWH A;  3FPU B;  2ES2 A;  3HOW G;  4YCV A;  2NUC A;  1Z9F A;  4HTH A;  4IZ8 A;  4A4I A;  1IBL L;  4DR4 Q;  2WAQ E;  2NVQ B;  4DK6 C;  2E2D C;  1QUQ A;  2EOT A;  3D31 A;  2K6A A;  4C1N I;  4PZ8 A;  3C46 A;  3CF5 A;  3CP0 A;  5D65 A;  2IPK D;  4QL5 A;  4A3M G;  1NCV A;  1PV4 A;  4DV7 Q;  4X66 Q;  3DXJ C;  5GAE C;  3J80 L;  2A6H D;  1NMG A;  2O4X A;  3ND8 A;  1IBM L;  1FVI A;  3U9O A;  1STA A;  4LF8 L;  3MXN B;  4XIG S;  5IGE A;  3GTJ H;  4DR4 L;  2F0L A;  2EXD A;  3U58 A;  3A5Z B;  3A8I E;  4YIJ A;  2ZTD A;  1B3Q A;  5IYC H;  1F2L A;  1EY7 A;  1QZH A;  1MSG A;  4RKL A;  4LF4 L;  5C0X J;  2KVM A;  5C4X H;  1FR3 A;  3OWE B;  2NYZ D;  3VR6 A;  2XGT A;  1FGB D;  1YZ6 A;  3A74 A;  1EYA A;  1B7Y B;  4DXF A;  1VQE A;  3BDO A;  3J7A V;  1SYE A;  4B3T Q;  4C3J G;  1PFN A;  2AMC B;  1PH6 A;  2WAQ B;  1NR2 A;  5C4X B;  1PXU A;  1ET9 A;  3SEB A;  2ATW A;  2EYF A;  1AZP A;  4AYB E;  3H94 A;  3TME A;  3TEH B;  4KN4 C;  1IXR A;  4IPC A;  2WV6 D;  2XVS A;  5COR A;  3CCQ A;  1XNR L;  1SFO H;  2K7V A;  4A3F G;  3LNN A;  4IUU A;  3J7Z C;  4DAY B;  3J80 c;  4NP5 A;  1VQD A;  3G7L A;  3CCL A;  4EQN A;  3H3V C;  3F2C A;  2KQ3 A;  4GN3 B;  3RLF A;  3T56 B;  4EQ5 A;  1J6Q A;  1K8M A;  1BKB A;  1I3Q H;  1E2Z A;  2B8G A;  3IKJ A;  1K8G A;  4HJ8 A;  1EIG A;  1JE5 A;  1SFO B;  1RD9 D;  2RHQ B;  1YNN C;  5C3E H;  1YNJ D;  1Q3L A;  3RLO A;  1VQP A;  4FF4 A;  4DV0 Q;  2Z8L A;  1I3Q B;  3I72 A;  1Q86 C;  1X6O A;  2FHT A;  2NVY H;  4KHV A;  4AYB B;  2KCT A;  2PI2 A;  2OXP A;  3OW7 A;  4R4C A;  2JA6 B;  5C3E B;  3VR5 A;  3S16 H;  2K5W A;  2NTT A;  5COY A;  3FEW X;  3MC0 B;  1DZ1 A;  2AUJ D;  4IPH A;  4DR5 Q;  5CBA E;  2LXK A;  4X65 L;  3J7Y W;  4CBV A;  2WII B;  3D4R A;  5IP9 G;  2VXW A;  5C5M A;  1JOK A;  1HHV A;  3S16 B;  1K8A C;  2ZTE A;  2D5D A;  4OIK A;  3V05 A;  4EGV A;  5J22 A;  2BH8 A;  1LT3 D;  1G91 A;  2VB2 X;  2D0O A;  1BBU A;  3X3M A;  4DUZ Q;  2EJF C;  1D8L A;  3AFP A;  4DR5 L;  4YWM A;  1YI2 A;  1M1K C;  3PIP 3;  4LUZ A;  4DV2 Q;  1SR3 A;  2QEX A;  1KDA A;  1Y8N B;  3L7Z C;  3K7U C;  3PSI A;  2KEC A;  4IO9 A;  1LAB A;  4I7A A;  3K81 C;  1PZJ D;  2MPM A;  4HMI A;  5M3M G;  3GTP B;  3I4N G;  5IYB G;  2A68 C;  2R7Z G;  4G7O C;  1E24 A;  5CBE E;  3MZ5 A;  2K28 A;  4JVZ A;  4MTK A;  3FP9 A;  1FNU A;  5ELE A;  1EWI A;  1F2Y A;  4DV6 Q;  1QVG A;  3HOY G;  4DV2 L;  4GZY C;  4I65 A;  2ZXR A;  3R2T A;  1A15 A;  1LTB D;  4DU9 A;  3RZO H;  2QKI C;  2K33 A;  3MVV A;  4B3M Q;  2JEA I;  1V1P B;  2JSO A;  5EKK A;  1UE5 A;  2VQE Q;  3QJY A;  3TP5 A;  2KBN A;  2KJX A;  2RF4 A;  2Q8I B;  5K5P A;  3SDZ A;  2PNH A;  1JJ2 A;  1ZEQ X;  1K28 A;  5GRO A;  5JVH 3;  3SR1 A;  4X3S A;  1G2S A;  4N8X 1;  2YTY A;  5CGK A;  4DV6 L;  2I5L X;  3KF6 B;  5JVG 3;  3GTG H;  4WJW A;  4JI7 L;  5JJK A;  4POF A;  2NVX H;  3QG1 A;  3WOE A;  3QWN A;  4KJO A;  5C0X H;  2BE5 C;  4B3M L;  2AUK A;  3RR5 A;  1UEB A;  4R8N A;  4GOP B;  1HTL D;  2VS1 A;  1N33 Q;  3K0Y A;  2NVT H;  1EYC A;  3OIQ A;  1STG A;  1PFB A;  4IUP A;  4LFB L;  3BJU A;  3HEJ A;  3GTG B;  3VYU A;  1PVO A;  1E7Z A;  2NVX B;  4Q5V A;  1YNN D;  3KBG A;  2Q2T A;  2B2V C;  2Q8T A;  3MHB A;  4TKO B;  1F2M A;  4HJ9 A;  3Q6S A;  1EFI D;  3BS1 A;  1ILP A;  4RGT A;  1FJG Q;  2NVT B;  4HIK A;  1SMY C;  1SYF A;  1N33 L;  2BA0 A;  1PA6 A;  1RF2 D;  2PPB C;  2E2J H;  3D4D A;  4HIO A;  1Q12 A;  4X62 Q;  2CWP A;  1VQO A;  2RCN A;  2CH4 A;  1JR0 D;  1CA6 A;  4JV5 Q;  3GQB A;  4QB4 A;  1K8O A;  4XXE A;  1HJP A;  1JB7 A;  3MFY A;  3NP8 A;  2K05 A;  3EQL C;  2Q8R E;  1LUZ A;  2KCC A;  1IL2 A;  2E2J B;  1H9K A;  1TY0 A;  1NJI C;  1PFM A;  1GUG A;  4LAA A;  2KHJ A;  4JBM A;  3DWQ A;  1L0Y B;  5AJ3 Q;  5HGQ A;  4QQB X;  4X62 L;  4LFC L;  4LUO A;  1JOO A;  4GNX B;  1KDC A;  4JYA L;  2EYJ A;  2LMC B;  4A3L H;  2QA4 A;  1PYS B;  3HKS A;  3HFZ B;  4ZRZ A;  3X3N A;  3R3O A;  4DAP A;  2UXD L;  3HKZ E;  2F0Q A;  1PH1 A;  4RGO S;  1YHQ A;  5DM6 3;  4A3D H; 
#chains in the Genus database with same CATH homology
 4ZYS A;  3C1E A;  2CW0 C;  2L1B A;  4V0B A;  2M9V A;  4EQO A;  5DM7 3;  2F0V A;  4A3D B;  3ERO A;  1T5E A;  3RUZ A;  4EQP A;  1EU3 A;  1QG7 A;  1EQV A;  1C8C A;  4F87 A;  2IW3 A;  1SEB D;  2WKD A;  3PUV A;  2AWO A;  5G3L F;  4NMZ A;  2WIN B;  2B2V A;  2SNM A;  3HKZ B;  2EYP A;  2F0F A;  4OL7 A;  5C4J B;  5JEA G;  1Y1W B;  5JEA J;  1OXS C;  3DWP A;  3QOJ A;  4B9X A;  1Q1B A;  2F4I A;  1WD1 A;  4RKB A;  3TP6 A;  1Z47 A;  2L0C A;  3NUC A;  1SMY D;  4H0L C;  2EE1 A;  4XQN A;  5IT9 E;  3PUY A;  2RVL A;  1ENF A;  4IFD H;  5FLX E;  3FRP B;  1B2T A;  2R93 B;  1B3A A;  1DM0 B;  3HOZ B;  1PTO F;  1PRT D;  1UUP A;  3H0G B;  2OF1 A;  5KEE A;  3A7A B;  4J8Q A;  1BUV T;  2QF7 A;  1NSN S;  3URY A;  1SSO A;  1R4Q B;  4G4K A;  1TQO A;  1EY0 A;  2JP1 A;  1EY5 A;  4Y7N B;  4PQX A;  1ESF A;  2IWH A;  4CKC A;  2CW0 D;  3FKI B;  1X32 A;  4A3K B;  4KV6 A;  1GHK A;  1RDP D;  4ZAI A;  4DNT B;  1D5X C;  3NQT A;  2AWN A;  4R9W A;  2Y0S B;  5CV5 A;  1R9T B;  1EY6 A;  1LTT D;  1I4X A;  2XWB B;  1IYV A;  2HCI A;  2F0O A;  1MI2 A;  2ID0 A;  3T13 A;  4A3E B;  2K5Q A;  4C3H B;  4K5X A;  3WOF A;  4ZQ3 A;  1DOM A;  4B08 A;  4A3G B;  3BYY B;  2ICI A;  1Y69 U;  3NHH A;  1SAP A;  4A93 B;  5BN3 A;  3SK6 A;  1SXT A;  4EVO A;  3NTK A;  5D14 A;  5T1G A;  4QUF A;  1TWG B;  1EZ8 A;  2PQE A;  1S5E D;  2EYL A;  4H13 C;  3HOX B;  1F2Z A;  1ZXT A;  3S1M B;  2A6H C;  2BOS A;  5JJZ A;  1CTM A;  1OO9 B;  5CV9 A;  4ZK9 B;  3I73 A;  2FMM A;  5KYI A;  2PZW A;  4HMJ A;  4BBS B;  3S1Q B;  4CGY B;  1ZYR D;  1IKL A;  2MJ8 A;  1IL8 A;  3MXU A;  1HRJ A;  1AFP A;  1BCP F;  4Z9C B;  4K2L A;  4DK1 A;  3K5O A;  1H9S A;  4C2M B;  1TWF B;  5IGG A;  1LAC A;  5I6W A;  3GP7 A;  1TU2 B;  2HQE A;  4OO1 H;  2K1B A;  1CK1 A;  2EDG A;  1DCZ A;  1A3T A;  3ERQ A;  5KNB A;  2EPB A;  1SE2 A;  2F1M A;  4PNY A;  5C6A A;  4K5W A;  3TZD A;  1EY9 A;  1LV9 A;  1Q8I A;  5IOC A;  1LT6 D;  3P20 A;  2GA4 B;  3NSW A;  3P1H A;  1H9M A;  1YNJ C;  1GJX A;  4RWS C;  3R8B A;  4CKB A;  2EYM A;  1T5X D;  1E2W A;  2XIW A;  1SNM A;  5JOB A;  3HOU B;  5E3F A;  1WTP A;  3I8Z A;  1GUW A;  3KUP A;  5ISR A;  3CRL C;  2JEB I;  3H09 A;  2H1E A;  2KEE A;  4UAI A;  4KHZ A;  1V43 A;  2DN8 A;  2NN6 H;  3QOL A;  2SDF A;  1IHZ A;  4TSS A;  3K5N A;  3AU7 A;  5CV7 A;  2J0T D;  1BNZ A;  3P75 A;  3S15 B;  4R8I A;  1WTO A;  1RCV D;  4NDX A;  3SE0 A;  3V96 A;  4KKS A;  5E4X A;  2M00 A;  2F0W A;  1G2T A;  1B44 D;  3R2I A;  1SYB A;  2RBM A;  1KAB A;  5K36 G;  3Q0A A;  1ILQ A;  3ONA B;  4FF3 A;  1B1Z A;  4IUR A;  1HA6 A;  1CI3 M;  1IW7 C;  4ZLT F;  4KTA A;  3K7A B;  3J7A F;  4ZUI A;  1I50 B;  1SJE D;  1AN8 A;  1D2B A;  4M8A A;  2NZ1 D;  2F0J A;  1QOH A;  1MD2 D;  3DEO A;  4KKT A;  3SK8 A;  3VA5 A;  4OIJ A;  1EOT A;  3BDL A;  1TR5 A;  3DUZ A;  4U67 3;  3BVZ A;  2KUM A;  4QMG A;  4V19 0;  2G9H D;  5IGB A;  5KGU A;  1EY4 A;  2F0E A;  4K2K A;  1C48 A;  2EJM A;  2Z4H A;  4ZKB B;  5I2X A;  1H9J A;  3PUZ A;  2XSC A;  4N9T A;  3K5M A;  5ELC A;  2JE6 I;  5DAU A;  5CC4 A;  3TSS A;  1NR4 A;  5DEH A;  3TDQ A;  1SJH D;  3JAM E;  2LKV A;  1KNA A;  3U9S A;  4ILW A;  1RHP A;  1EEF D;  2WAC A;  2Z1C A;  1S5D D;  2BA1 A;  5JPN C;  4FVM A;  3GTO B;  3KBX A;  1EWC A;  2I46 A;  4ABN A;  3M3Y B;  3J81 E;  1OXU A;  4HED A;  3I4L A;  1Z7T A;  4C56 C;  2H4O A;  2K32 A;  1LTG D;  4F88 A;  1JCK B;  3S17 B;  1OXX K;  4FXD A;  2F0I A;  1MSH A;  1JB3 A;  1LO5 D;  2E75 C;  5IIF A;  2C5C A;  4BA1 I;  1IW7 D;  4RCO A;  3SHL A;  1U4L A;  2L11 A;  3C3L A;  1TWC B;  3N52 A;  5KRU A;  1TS4 A;  3W2D A;  2JYO A;  4S3S A;  2B2T C;  4HSV A;  2X6L A;  3VR2 A;  3NBI A;  1STN A;  3GTM B;  5D3D A;  1C4Q A;  3HOW B;  2FJ2 A;  2PW7 A;  5FLX L;  2RKS A;  4FF1 A;  4DN4 M;  4OGQ C;  5EJW A;  1II3 A;  2VUM B;  1BOS A;  1PZK D;  1BF4 A;  2F03 A;  1IYU A;  4FP5 D;  4A3M B;  3K5L A;  1A2U A;  4FNF A;  1QB5 D;  1B4O A;  4RH6 A;  2PMZ B;  2XRS D;  3TBI B;  4XT3 B;  3NK9 A;  5EBC A;  4IFD G;  1JIC A;  4DFA A;  2IJ0 A;  3TN2 A;  3KF8 A;  5BN4 A;  2V4D A;  1HTP A;  1HCZ A;  1V1O A;  5ELF A;  2XWJ B;  3EA6 A;  4C3J B;  4JK1 C;  1STE A;  3W3A A;  1TT2 A;  1WTQ A;  2PCF B;  1ZKO A;  4X3K A;  1ET6 A;  4RAU C;  3GTL B;  1JWS D;  1EYD A;  2E2H B;  1LLR D;  1JWU D;  1M4V A;  2PZT A;  1EY8 A;  4DAV A;  2EY6 A;  1PRT C;  3NTH A;  3ZYY X;  1H9S B;  2PZU A;  5FO7 B;  3GV3 A;  3D6C A;  3M85 A;  2SOB A;  2I07 B;  1AW7 A;  5FO9 B;  2YYZ A;  2X6G A;  2A69 C;  1ENA A;  2JXM B;  1JC7 A;  1U4M A;  2B2T A;  3G6J B;  1J9O A;  2EYO A;  1ESR A;  1D6E C;  5A35 A;  2J7Z A;  1S4Z A;  5M5Y B;  3KLS A;  1PTO C;  3RMH A;  4F7X A;  1SE4 A;  1LT4 D;  4KK7 A;  4L63 B;  3H6M A;  1O78 A;  3O13 A;  4QUC A;  4C3I G;  2BDN A;  4DF7 A;  3VR4 A;  5C5L A;  3OSO A;  2L4N A;  4P2C B;  5CMD A;  3OPO A;  5ELD A;  4K14 A;  1BXT A;  1G8Z D;  1GOZ A;  3RD4 A;  3WDN A;  2X69 A;  3M4Y A;  1I4H A;  2QDB A;  4RGM A;  1WVL A;  4ME5 A;  3AB9 A;  3HG9 A;  5M3M B;  4FYD A;  3GV6 A;  4UDU C;  3I4N B;  5G3L D;  4G7H C;  1XWE A;  1SYC A;  3HZX A;  1RJT A;  1TWA B;  2QCP X;  3HOY B;  2B8F A;  1PDQ A;  1ROD A;  3A8J E;  3VR3 A;  1A3V A;  1PLF A;  2KED A;  3FMC A;  1TS5 A;  4OHJ A;  2BDO A;  1HQM C;  3I91 A;  3PO3 B;  5CR3 A;  1KNE A;  1HA5 A;  1BDO A;  1ZYR C;  1I4Q A;  4OO1 G;  4HN7 A;  3A56 A;  2SNS A;  1F77 A;  4ULL A;  1DD2 A;  3NQI A;  3RZD B;  2RA4 A;  2Z4I A;  1W6J A;  3K57 A;  1HXY D;  1LTI D;  2CHB D;  3Q22 A;  5J39 A;  2A69 D;  4G7Z C;  4MN3 A;  1GUN A;  5I4D A;  1XTC D;  4XQQ A;  4WFN 3;  2WB1 B;  1CM9 A;  3HRZ C;  1SDF A;  1S5F D;  1BCP C;  1CZG A;  2F0M A;  3GTQ B;  1PTO D;  2B2U C;  1VCI A;  4RFB A;  3R93 A;  4IUQ A;  5M5W B;  3E6Z X;  3IFT A;  3S1N B;  3CQZ B;  3A55 A;  1G29 1;  3UI2 A;  1FD7 D;  1HQR D;  3M4O B;  4FXG C;  4LK1 C;  3MXP A;  2F0K A;  3OHX C;  5KIX A;  5E1F A;  5M3F B;  3T51 B;  1SNP A;  5A2Q E;  1CHP D;  4KY7 A;  5I9P A;  2DNE A;  1A3U A;  1O7L A;  5I2Y A;  3SVM A;  5EKI A;  3LX0 A;  4O1N A;  1SNO A;  1KLG D;  3BVM A;  3TZU A;  3BYT B;  1ONL A;  4FF2 A;  3K59 A;  3ITP A;  3I4M B;  2F0G A;  4LJZ C;  4PMW A;  1QJO A;  3CU7 A;  1HUM A;  1TWH B;  1SYD A;  1S5B D;  3L9A X;  3EJI A;  2L5T A;  5FOB B;  4CHT B;  1TII D;  1DXM A;  1OXT A;  3KLR A;  5CV4 A;  4O42 A;  3PO2 B;  1X3P A;  3FDT A;  1F9P A;  5JEA H;  2QEJ C;  1I4P A;  4BS9 A;  4BA2 I;  2RDF A;  1SNQ A;  3E5S A;  5HUR A;  4KY5 A;  2ENB A;  2B2U A;  2O2L D;  4XQJ A;  1VDZ A;  1ENC A;  3CKI B;  1BBX C;  1TVX A;  3I3C A;  1D5M C;  5I6Y A;  2TMP A;  1Q90 A;  3H91 A;  1CQF A;  4RHS A;  3E0J A;  4PMB A;  1FYC A;  1BCP D;  2IL8 A;  1DOL A;  1STH A;  4HCS A;  5CV6 A;  2WP8 J;  1GXD C;  1CZW A;  4X3T A;  2F0P A;  4C1N K;  3M7N A;  2O5I C;  3CHB D;  5IGC A;  1LTR D;  5C3W A;  1Z6H A;  2O5J C;  2F0H A;  2B63 B;  2A6E D;  3NTI A;  1TY2 A;  1BQQ T;  1B9M A;  2C9O A;  4WOR A;  5KND A;  3M7G A;  2L9H A;  1IKM A;  5EKL A;  4J1M A;  4FO2 A;  1VMC A;  2LFN A;  2TSS A;  4RGN A;  4G57 A;  1NUC A;  1A2T A;  4J6H A;  3MFG A;  2MUY A;  3FPP A;  4RHR A;  4JBW A;  3L3O C;  1SNC A;  5LHY 1;  2DY8 A;  5I9O A;  1DON A;  3GTK B;  3P7J A;  2ICE C;  2MHV A;  2JA7 B;  3MXG A;  1EL0 A;  4KD4 A;  2RSN A;  2XN9 C;  1JOR A;  5KNC A;  4IUV A;  1DYQ A;  2E76 C;  2FFK B;  3C2P A;  1EU4 A;  3VYT A;  4NW2 A;  4DXG A;  1UEA B;  3HOV B;  3S2D B;  2WKC A;  1AEX A;  5C0X G;  3S9W A;  1WTR A;  3F2U A;  4H7B A;  1STB A;  3GTJ B;  2F0D A;  3D6W A;  1LT5 D;  5EPJ A;  1F9R A;  4Q0F A;  5C0X I;  4ODG A;  2F0N A;  2VB3 X;  1FNW A;  4U68 A;  1V8Q A;  4QIW B;  3SXH A;  2K03 A;  1TS3 A;  2F0U A;  1TS2 A;  2NTS A;  4DGZ A;  2F3W A;  1QE6 A;  5F2D A;  2IT1 A;  1VMP A;  2A74 C;  2XRQ D;  1RKN A;  5CV8 A;  3CRK C;  1CQV A;  1PRT B;  2G9D A;  5IGD A;  4FXK C;  1EEI D;  4KD3 A;  4H44 C;  2MP1 A;  1W6K A;  4KI0 A;  1KDB A;  1M8A A;  2FIN B;  1PTO H;  3N6R A;  4XYQ A;  1NAP A;  4IUN A;  3MWY W;  1SYG A;  4HCE A;  4CKE A;  1HPC A;  3PMF A;  3HGB A;  5J1Z A;  1XX8 A;  3BVG A;  1PTO B;  1I4G A;  2NVY B;  2EVB A;  2ZXO A;  1WD0 A;  2M2L A;  1EQT A;  5M5X B;  1GUO A;  2EZV A;  3TP8 A;  4CJ1 B;  4BBR B;  3PV0 A;  4K8I A;  4I7Z C;  3I90 A;  2R3Z A;  2EY1 A;  4PMC A;  1VF5 C;  2IX0 A;  4LMQ D;  1WTW A;  2F0T A;  4KKU A;  5FKA C;  2NB0 A;  3T16 A;  4MHE A;  2VNU D;  1SE3 A;  1STY A;  5IT9 L;  3OIP A;  3K58 A;  1Y1V B;  1PYW D;  3KK7 A;  1XYI A;  3QO2 A;  5KYL A;  1Y8O B;  4HSP A;  2HDM A;  4HR7 B;  4XDX A;  4B9W A;  3Q24 A;  5K36 H;  1SBB B;  3D4W A;  2OT2 A;  2L55 A;  1TKW B;  1AZQ A;  5C3X A;  1BR9 A;  2EJG C;  2FMC A;  3VYR A;  4DK0 A;  3NBH A;  2N55 A;  4L8J A;  1JQY D;  3KLS X;  3RZO B;  4IFD J;  3J80 E;  2NBF A;  1QCB D;  1GUT A;  2BCO A;  1I6V C;  2YU9 B;  5C44 B;  3PUX A;  3VYS A;  4KJN A;  3QIA A;  4IFD I;  5EPK A;  2HDL A;  3HP3 A;  2N88 A;  2R61 A;  2LY7 A;  4QCL A;  1E2V A;  2F0S A;  4E6I A;  2E74 C;  2HCC A;  3IL8 A;  3TP7 A;  1BCP B;  4A3F B;  3A54 A;  1R4P B;  1H9R A;  1U4R A;  2DNC A;  5EQ0 A;  5LL6 X;  5A2Q L;  2AQ3 B;  2ZT9 C;  1KTK A;  3IFD A;  4C3H G;  4MIU A;  2KHS A;  3OMC A;  5CYU A;  1Q1E A;  1RTO A;  2A5H A;  2MGS A;  3SK4 A;  2PO4 A;  1LTA D;  2J4X A;  2EY5 A;  1HFG A;  3MXN A;  3GD7 A;  3BG3 A;  3A7L A;  5IOD A;  1I4R A;  1WTV A;  1EIH A;  2QIL A;  1D5Z C;  1EZ6 A;  4IN3 A;  1SND A;  4IUT A;  3LWE A;  2A68 D;  3NWS A;  4DA2 A;  2K04 A;  1E0B A;  3OOC A;  2SEB D;  2JA5 B;  1WTX A;  5EBD A;  4QF4 A;  3AMU A;  2RSO A;  4N9P A;  5AFW A;  1QNK A;  1D1I A;  3K6O A;  3HS0 C;  3MTS A;  2EY2 A;  1GHJ A;  1Y8P B;  3Q23 A;  1F9S A;  4CJ2 C;  2IX1 A;  4XT1 B;  5ELB A;  3FVQ A;  5JAV A;  4DAY A;  2KOL A;  2R7Z B;  4F8M A;  2BE5 D;  2L12 A;  3DEP A;  2PNR C;  5FK9 C;  2R6G A;  1CHQ D;  3DWA A;  3T53 B;  4RCN A;  5C4Z A;  4XTC S;  4A3J B;  4TRD A;  1AP0 A;  3PIO 3;  2RDG A;  1PRT F;  4X3U A;  4K6D A;  3DHQ A;  4TQU S;  2K01 A;  2CQA A;  1PZI D;  5DNF A;  5T1I A;  2B2Y C;  4DNR B;  4BY7 B;  2DY7 A;  2KCN A;  2RDH A;  1F9Q A;  1XXG A;  4IQZ A;  3GO5 A;  2A73 B;  3MA2 B;  5HGT A;  4OO1 I;  2D62 A;  3EVQ A;  2PW5 A;  1U4P A;  1KAA A;  3I70 A;  1K83 B;  2D9U A;  3A8K E;  3S2H B;  4WRD A;  3S1R B;  5LL6 S;  3MAQ A;  2NWG A;  4RA8 A;  4A3B B;  5FO8 B;  3PUW A;  5EGT A;  2ZXP A;  2PYK A;  1U9R A;  1GUS A;  2LS0 1;  4NKL A;  4L6T B;  1FNV A;  2K5D A;  5BN5 A;  2HUG A;  4XYO A;  2OEO A;  1CT1 D;  2AQ2 B;  2NN6 G;  1HFN A;  1O80 A;  2A6E C;  2B39 A;  1DJR D;  3MEH A;  5IGF A;  3NPP A;  2IX3 A;  1B9N A;  3S14 B;  4CJ0 B;  1A6X A;  3NE5 B;  1CFM A;  2NN6 I;  4M1U B;  1V1P A;  2AQ1 B;  4K8J A;  3BZD B;  2F3V A;  3EFX D;  2EYH A;  1JOQ A;  4KN7 C;  2B2W C;  4PV1 C;  1ICW A;  1X3Q A;  3C1F A;  1DOK A;  5C4H A;  1D1K A;  1CA5 A;  2D2C C;  3D8G A;  2KA7 A;  4KY6 A;  3LWU A;  1MGS A;  3T4A C;  2B2Y A;  1MBY A;  2E2I B;  4KMU C;  5NUC A;  1OXV A;  5JPM C;  4BY1 B;  1O7Y A;  4A3I B;  4C3I B;  4ZUJ A;  1RTN A;  1B50 A;  2XNA C;  1QIL A;  5E4W C;  4HAE A;  3IAY A;  4IAL A;  1KLU D;  3JAM L;  1BO0 A;  2CVR A;  1L0X B;  1JE4 A;  2EXZ A;  4K5V A;  3DM1 A;  1JWM D;  1QWY A;  3OWF A;  3SK5 A;  5M9O A;  3DMU A;  3J81 L;  1QNU A;  3D3R A;  3NXW A;  4ID6 A;  3VA7 A;  5TSS A;  3V2T A;  2RQX A;  1ML0 D;  1B53 A;  4K6L A;  4ZKC B;  1UNS A;  2R92 B;  1I6H B;  3ND9 A;  1VF7 A;  3OMG A;  2JA8 B;  2B2W A;  3QB3 A;  3NWT A;  1HUN A;  5D3I B;  1G6Z A;  4BWG B;  1J8I A;  5EPL A;  1O7Z A;  1S5C D;  1LTS D;  3BDC A;  1PMR A;  1UAP A;  1WCM B;  1EWH A;  3FPU B;  2NUC A;  4HTH A;  4IZ8 A;  2NVQ B;  2E2D C;  2EOT A;  3D31 A;  2K6A A;  4C1N I;  3C46 A;  5D65 A;  2IPK D;  1NCV A;  3DXJ C;  3J80 L;  2A6H D;  2O4X A;  3ND8 A;  3U9O A;  1STA A;  4XIG S;  5IGE A;  2F0L A;  3A8I E;  4YIJ A;  1F2L A;  1EY7 A;  1MSG A;  4RKL A;  5C0X J;  2KVM A;  1FR3 A;  3OWE B;  2NYZ D;  3VR6 A;  1FGB D;  1EYA A;  4DXF A;  3BDO A;  3J7A V;  1SYE A;  4C3J G;  1PFN A;  2WAQ B;  1NR2 A;  5C4X B;  1PXU A;  1ET9 A;  3SEB A;  2EYF A;  1AZP A;  3H94 A;  3TME A;  4KN4 C;  2WV6 D;  2XVS A;  5COR A;  2K7V A;  3LNN A;  4IUU A;  4NP5 A;  3G7L A;  4EQN A;  3H3V C;  2KQ3 A;  3RLF A;  3T56 B;  1K8M A;  3IKJ A;  2B8G A;  1E2Z A;  1EIG A;  1SFO B;  1RD9 D;  1YNN C;  1YNJ D;  1Q3L A;  4FF4 A;  2Z8L A;  1I3Q B;  3I72 A;  2FHT A;  4KHV A;  4AYB B;  2OXP A;  3OW7 A;  2JA6 B;  5C3E B;  3VR5 A;  2K5W A;  2NTT A;  5COY A;  3FEW X;  3MC0 B;  1DZ1 A;  2AUJ D;  5CBA E;  3J7Y W;  4CBV A;  2WII B;  3D4R A;  2VXW A;  5C5M A;  1JOK A;  1HHV A;  3S16 B;  4EGV A;  2D5D A;  4OIK A;  3V05 A;  5J22 A;  1LT3 D;  1G91 A;  2VB2 X;  3X3M A;  2EJF C;  3PIP 3;  1KDA A;  1Y8N B;  3L7Z C;  2KEC A;  1LAB A;  1PZJ D;  2MPM A;  4HMI A;  3GTP B;  2A68 C;  4G7O C;  5CBE E;  3MZ5 A;  2K28 A;  1FNU A;  5ELE A;  1F2Y A;  4GZY C;  4I65 A;  2ZXR A;  3R2T A;  1A15 A;  1LTB D;  4DU9 A;  2QKI C;  2K33 A;  3MVV A;  2JEA I;  1V1P B;  2JSO A;  5EKK A;  3QJY A;  3TP5 A;  2KJX A;  2Q8I B;  5K5P A;  3SDZ A;  1ZEQ X;  5JVH 3;  3SR1 A;  4X3S A;  1G2S A;  5CGK A;  5JVG 3;  4WJW A;  3QG1 A;  3WOE A;  3QWN A;  4KJO A;  5C0X H;  2BE5 C;  2AUK A;  4R8N A;  1HTL D;  3K0Y A;  1EYC A;  1STG A;  3OIQ A;  1PFB A;  4IUP A;  3HEJ A;  3GTG B;  3VYU A;  2NVX B;  4Q5V A;  1YNN D;  3KBG A;  2B2V C;  2Q8T A;  3MHB A;  4TKO B;  1F2M A;  3Q6S A;  1EFI D;  3BS1 A;  1ILP A;  4RGT A;  2NVT B;  1SMY C;  1SYF A;  2BA0 A;  1RF2 D;  2PPB C;  3D4D A;  1Q12 A;  1JR0 D;  1CA6 A;  3GQB A;  4QB4 A;  1K8O A;  4XXE A;  3MFY A;  3NP8 A;  2K05 A;  3EQL C;  2Q8R E;  2KCC A;  2E2J B;  1H9K A;  1TY0 A;  1PFM A;  1GUG A;  4LAA A;  3DWQ A;  1L0Y B;  1JOO A;  1KDC A;  2EYJ A;  2LMC B;  4ZRZ A;  3X3N A;  3R3O A;  4DAP A;  2F0Q A;  4RGO S;  5DM6 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...