2KA7A

Nmr solution structure of tm0212 at 40 c
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
124
structure length
124
Chain Sequence
MKMKKYTKTHEWVSIEDKVATVGITNHAQEQLGDVVYVDLPEVGREVKKGEVVASIESVKAAADVYAPLSGKIVEVNEKLDTEPELINKDPEGEGWLFKMEISDEGELEDLLDEQAYQEFCAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine cleavage system H protein
publication title The J-UNIO protocol for automated protein structure determination by NMR in solution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 26
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ka7A00
4G7ZC 3CRLC 3BG3A 2A6HD 3GD7A 4IFDH 3A7AB 3QJYA 1V8QA 3T51B 1GUSA 4H0LC 4DK1A 3PUVA 1H9SB 3T53B 1IYUA 1E2WA 4KKTA 2AUJD 1E2ZA 1TKWB 1OXXK 2JE6I 1Z6HA 2LMCB 3D31A 5JEAG 3CRKC 3PV0A 1T5EA 2DN8A 3LWUA 1GUTA 1Q90A 1ZKOA 5K36G 2A69C 2O5JC 2DNEA 2PCFB 3PUZA 3T56B 2BDOA 4OO1G 3GQBA 1Y69U 3VR6A 1VDZA 5K36H 3A8JE 1OXSC 5A35A 5C0XG 1HQMC 1Y8OB 2EJGC 3PUXA 3VR2A 4BA1I 1K8OA 4XIGS 4LK1C 2D5DA 1K8MA 1Q1EA 1H9SA 2DNCA 2KA7A 4KHZA 3KLRA 2EVBA 1OXTA 1OXVA 2CW0C 2ZT9C 3M4YA 2K7VA 2L5TA 3EQLC 4XTCS 3VA7A 2E75C 2B8GA 1CI3M 2BE5D 2A68D 3I73A 3HGBA 1QJOA 3BDOA 1ONLA 3FPPA 2JXMB 3QIAA 5BN4A 1Z7TA 5BN3A 1DCZA 3ND8A 1HPCA 1HTPA 1PMRA 4PV1C 3RLFA 1H9RA 1CTMA 1Q12A 1GUOA 5JEAH 5KNBA 2A6HC 4RCNA 5KNCA 2EJFC 2A6ED 1LABA 3H94A 3ND9A 3OPOA 1FR3A 3IKJA 1GJXA 2A68C 4G7OC 3I4LA 4OO1H 1Y8PB 3OW7A 1CFMA 5BN5A 2JEAI 1ZYRC 3AB9A 4H13C 5C0XH 2NN6I 1BDOA 2NN6G 1V43A 4BA2I 2O5IC 3LNNA 3L7ZC 2D62A 3QG1A 3DXJC 2NN6H 4L8JA 1A6XA 2AWOA 1Q1BA 1DXMA 1O78A 2D2CC 1O7LA 1GHJA 3MFYA 4GZYC 2IT1A 2E74C 3A8KE 4TQUS 2A6EC 1VF7A 3VR4A 1H9JA 1TU2B 3D4RA 1IYVA 1H9MA 3OOCA 2BA1A 5KNDA 4IQZA 1IW7D 1GUNA 1VCIA 3M7NA 2K33A 3A8IE 2PPBC 1H9KA 2EDGA 2YYZA 2EJMA 1E2VA 1HCZA 3I72A 3IFTA 4HR7B 4TKOB 4KKSA 2A69D 2BE5C 1OXUA 2JEBI 1FYCA 1Y8NB 2F1MA 4OGQC 2QF7A 2KCCA 3U9SA 3SE0A 2V4DA 2BA0A 3WDNA 1GHKA 1GUGA 4DNRB 2AUKA 4JK1C 3PUWA 1IW7C 3A7LA 4JBWA 4KMUC 1DD2A 4DK0A 3TZUA 1B9MA 2B8FA 3N6RA 4I7ZC 3VR3A 1YNNC 4KN4C 2PNRC 2Q8IB 3P20A 1SMYC 3FMCA 3NE5B 4KN7C 2R6GA 4LJZC 1YNJC 1LACA 1G291 2K32A 1EWHA 4H44C 3PUYA 3MXUA 4KKUA 3VR5A 4G7HC 4DNTB 1B9NA 1VF5C 1I6VC 2E76C 4KI0A 4IFDG 3M85A 3W3AA 3SDZA
chains in the Genus database with same CATH superfamily
4PG3A 1STGA 2I5MX 3CMEA 3DEOA 3E9HA 2CQAA 1HNZQ 1E2ZA 1SYFA 2SNSA 2LXKA 1I6HB 4PQXA 2R93H 1T5XD 4ZKCB 4GLAC 3SHLA 1KABA 1PH5A 3BVMA 1JR0D 2EYHA 4A3GG 4C2MH 3J81c 2PQAB 3HOXH 1SMXA 1WTHA 2VL6A 3CCLA 4ZCKA 1RHPA 4A3MG 3AFPA 4JI6Q 2RHSB 3CCQA 2EYMA 3KLRA 4BY7B 2J0TD 3NK9A 4IJLA 1PH8A 2Z4HA 4AYBE 1CI3M 3UDGA 4HIMA 3HOYB 4KHVA 3J81i 1E24A 2OT2A 1MSGA 3FPPA 4MNOA 4NXML 1YITA 2RDFA 3HOVH 1VQHA 1S5CD 1X3EA 4J8QA 3EVQA 4H7BA 1F2YA 4RCNA 1LABA 4LUZA 2JA7G 1I4XA 1CUKA 4YCWA 3QOJA 3Q22A 5C4JB 1QVCA 4IUVA 1J6QA 3ULPA 2IL8A 1XWEA 5EBCA 5FKAC 1SROA 3S1QH 1DXMA 1O78A 4ZRZA 4ZK9B 1QUQA 1TWFB 2K5WA 4YIJA 3KOJA 3CPFA 4RCOA 3VYUA 1A2TA 1EEID 3S1RH 3C2PA 4RH6A 2DY7A 1N36Q 4WORA 4DR6Q 2EDGA 3Q23A 3BDCA 3HOZH 2IHEA 3FRPB 3IFTA 2KECA 1I4GA 3HOWB 3QR8A 1FYCA 1MSHA 1I3QH 3U9SA 1TY2A 2LS01 3PUWA 2JA9A 5JJZA 3BVGA 1K83H 4HMJA 4YY3Q 1SR3A 1EY5A 1Y1WH 1JB7A 4IFDJ 3ITPA 4LFAQ 1ESRA 5C3WA 3CC7A 3NP8A 2ZTEA 3FMCA 4ID6A 1RODA 3CU7A 4DV2Q 1VQPA 4EQNA 2K03A 3I3CA 5J3BA 2LFNA 1I6VC 1EQRA 4A3IH 2F0HA 1S5FD 4QJFA 4K8JA 4N9TA 1VQCA 2RSNA 4G7ZC 5A2QL 1WCMB 4HJ7A 2YTXA 2MPMA 2QEJC 2RBMA 4DAYB 1EY0A 1N32Q 1E2WA 2A1AA 4HIKA 2O4XA 1X54A 5IGGA 5CV4A 4XT3B 1X32A 1LTRD 4MTNA 4XT1B 3S16H 1BCPF 5IOCA 1VDZA 5IODA 4C3IH 1ET9A 1V1PB 3I4OA 2K5HA 2VB3X 1MHWC 3C1FA 4A3JG 1F2MA 2DNCA 3A74A 1FL0A 2KEEA 5JVH3 4KTAA 3RLNA 3ULLA 4HN7A 1PTOH 3GTPH 3PO3H 4JI6L 3BZKA 3H0GB 1PH2A 3CCUA 1Q7YC 2JA6H 2RDHA 2Z9HA 4WJ3M 2N49A 1V1QA 1PMRA 4RWSC 5GADC 4B3MQ 2RQXA 2IW3A 4A93H 1AZQA 1IKMA 5IP9G 4NW2A 4CJ0B 4NKLA 4JW0A 3SVMA 4HEDA 1IKLA 3ND9A 1LTLA 1SXTA 4NXNL 1YEZA 2DY8A 3TP6A 3I4LA 3NWTA 3NTIA 4OIKA 4J6HA 1UNSA 3N52A 4DFAA 4FF2A 4KHPL 4JI8Q 3G7LA 1WTOA 1B7YB 5IGBA 4RAUC 1VQ5A 5DAUA 2R93B 1F9PA 1BBXC 1RKNA 3C46A 1O7YA 2Q2UA 4C2MB 3E0EA 3NENA 3HOXB 1ZXTA 4AYBB 4J1MA 2N78A 2QDLA 3CC2A 4C3JH 1YNND 2R3ZA 3FKIB 3U50C 1GKHA 2NTSA 2BE5C 1KNAA 4DR3Q 1S40A 4RHSA 2MO0A 1ESFA 3SE0A 4RKLA 1ICWA 2QILA 3IRBA 4MN3A 2M2LA 1CA5A 3G71A 3HOVB 2EPBA 5FO7B 1EEFD 1YNNC 2VUMH 3MZ5A 1FNWA 2R6GA 3I55A 1ILQA 4A3DB 1VQKA 1JWSD 5FJ8G 5FLMG 1A63A 3SDZA 4BBRG 3S1NH 3GTGH 3BG3A 1CHQD 1I5FA 2PW7A 1F2LA 2EYLA 3I4MG 1GVPA 2FXQA 3PUVA 1H9SB 2KHJA 3F8TA 3S1RB 1I4HA 3PV0A 1NNXA 4A3KG 1HNXQ 3HOZB 2FJ2A 2K28A 1CA6A 2AQ1B 2PCFB 2QGQA 3OHXC 2Q2HA 3AQQA 1FGUA 5T1IA 3TSSA 5C4ZA 1I3QB 1W6KA 3VA5A 1TS3A 3MTSA 2L5TA 5FLXL 1JJGA 1K83B 4X64Q 4KD3A 1KC8C 1Y1WB 1HQRD 2IPKD 3I73A 4OXPA 1SNCA 4QCLA 4A75A 5ELOA 4JI7L 2SOBA 2F3IA 2PO4A 1XNQL 4A3IB 4LF4L 1EYDA 5KNBA 4HJAA 4QMGA 1EZ8A 4JI0Q 5LMNL 4GLVB 1TVXA 2F0PA 5CBAE 1CSQA 2QCPX 4R4CA 1GJXA 1TIID 4OO1H 1IZ6A 3H6MA 1Y1VG 1EIHA 3V05A 5M3MH 2OCEA 1VQNA 1E1TA 1F77A 2XSCA 3LNNA 4R4IA 4TSSA 3BVZA 5ELEA 1PVOA 1XNRL 4JI8L 1LT5D 2WAQG 4XDXA 3X3MA 2KCTA 3S16B 4IUNA 4GNXB 3NBIA 4R8NA 4B08A 4C3IB 1NR4A 4HJ9A 4FXDA 4X6AH 1IW7D 3W1BA 4XQJA 1H9KA 2B63H 3W2DA 1NE3A 4GN4B 4HR7B 1PTOB 3GTPB 3PO3B 2A69D 4DV5Q 1MKHA 4POGA 4B3RQ 2WFWA 1XXGA 4DV1Q 2JA6B 4GKKQ 4DR3L 3TP8A 1IW7C 4JBWA 5H1SE 5C3EG 1QNKA 2M00A 4HIDA 4LF8L 3N6RA 1JOKA 3BS1A 2K01A 5EPJA 3T13A 4A93B 1JMCA 4B3TQ 1JWUD 3CQZB 4JBMA 1VS0A 3B6YA 2UXBL 2XGTA 4JV5Q 4B3SQ 3SR1A 5C4XH 4DR4Q 1J5EL 2K05A 2R7ZG 3WWVA 4DXGA 4CGYB 4DUZQ 2ZXOA 5CR3A 1WTQA 1EWCA 2RVLA 4JI1L 1LTAD 1LV9A 2F0WA 2RKSA 4ZUJA 4JBJA 4LUOA 4OHJA 2UXCQ 3MEHA 3H3VH 1BQQT 4C3JB 4A76A 3BDLA 3KDFA 3T4AC 1KNEA 2MQHA 3DWAA 4OONA 4LUVA 1YHAA 3PSIA 2PI2E 1B1ZA 1WTPA 1OXTA 2CW0C 4CJ2C 1WFQA 4HCSA 1HR0L 2YV5A 3S1MH 1PDQA 4J15A 2VUMB 1VQ8A 4X64L 3EBEA 1CHPD 3AU7A 3LWEA 4CDEC 1PYBA 1IBMQ 4CDCC 2HQLA 1EFID 2UU9Q 3S1NB 2B2UC 2IHFA 1L0XB 4K8IA 4KY7A 3GTGB 3OW7A 5EPKA 4FDBA 4A3EG 4YHHQ 3R3OA 4BS9A 1N8RC 3O13A 3DM3A 2B2TA 2WB1E 4DV3L 4L8JA 5JVG3 2AWOA 1VQBA 1SE4A 1CKNB 2E74C 1VF7A 3S2DH 5IIFA 3L9AX 4AQYL 1EY9A 1QCBD 1TU2B 2JQOA 2F4VQ 2K33A 4DPGA 2F0FA 3MAQA 4CKBA 2E2DC 3I4NG 3J80E 2N55A 4LFBQ 4M1UB 5M3FH 1XX8A 1JWMD 1BKBA 1STYA 3WDNA 5IYBH 2L12A 3J7YW 4IUUA 1E0BA 4NMZA 1K8AC 4JYAL 2WINB 2WKCA 4QB4A 4KN4C 3I91A 4RMFA 3T1YL 1WYDA 1RCVD 5GAEC 3K80C 2B2UA 3GV3A 2FMMA 3BJUA 2EXDA 4B3TL 3I70A 1CZWA 1JQYD 2GVAA 5M3MB 3M85A 3W3AA 4DR4L 2Q8TA 4QUCA 1PTOD 5FLXc 4H0LC 2MO1A 4DUZL 4ZKBB 2LMCB 2LKVA 5JEAG 1T5EA 1VQAA 2K1BA 2NVXH 1YJWA 3LWUA 1CQFA 1GUTA 1QZGA 1KDBA 2B63B 1A0IA 2HCIA 2HIVA 1Y69U 3A55A 4DNIA 2FMCA 3D6WA 3F2DA 2AQ2B 3CHBD 2A8VA 4RKBA 1K9MC 1IBLL 4OEMB 2F0DA 2EVBA 4GOPB 4A3JH 3VA7A 4K5XA 3OYYA 5CORA 4A3CG 4DA2A 4KD4A 5AJ3Q 1MJCA 1ICFB 1L0WA 4LW1A 1U4LA 1PTOF 5KEEA 1R4PB 4BXXG 1CTMA 1YBYA 5C4XB 3C1EA 1IBML 3MHBA 4V0BA 4CDDC 5IP9H 1B4OA 4P71A 2JA8G 1II3A 2XN9C 1IL8A 2IJ0A 3GV6A 5C0XH 4X3KA 1V43A 2ENBA 3HKZG 4X62L 3DWPA 3QG1A 2PNHA 4ME5A 4NXMQ 3NQTA 2MGSA 4DKAC 5DM63 1O7IA 4BBSB 3NHHA 5KNDA 4QUFA 4QGUA 2IX1A 3F2UA 2KOLA 4APVA 1VQDA 2NVYH 1SFOH 4JI4L 4F88A 2KJXA 5DM73 4U673 3S1MB 5LMUL 3KF8A 1BCPB 2KCCA 3Q6SA 1GUGA 4LFBL 4DNRB 4KY6A 3A7LA 2PW5A 4ZQ3A 1SE2A 4ZAIA 2VXWA 2EYJA 1UE5A 1IXRA 3NE5B 1BUVT 1JE4A 1UE6A 5I6YA 3ICEA 2I5HA 4K2KA 3R93A 1QVGA 3RMHA 2WB1B 1VF5C 5IWAQ 1WOCA 4IFDG 1LTGD 1SYCA 1Q8KA 2IY5B 2HIXA 3NPPA 3PO2H 5FLMH 3QJYA 3J81j 3S2DB 4DK1A 2X6GA 1PRTF 3PQIA 4S3SA 1I4QA 4OIJA 5M5WH 1NUCA 1SDFA 3A5ZB 2AHOB 4A3BG 1WD1A 5K36G 1K0SA 2DNEA 4A3KH 4EVOA 1KQSA 3GQBA 3GDEA 3GTLH 5A35A 1D8LA 4JG2A 5M3FB 4A3LH 3SK8A 1DOLA 2K5VA 3F2CA 4DR5Q 3NQIA 2BH8A 3RR5A 1PFMA 1EOVA 5CV7A 2VY3A 3RZOH 1L0YB 4R4OA 2E2JH 3H15A 5E4WC 5BN4A 5BR8L 5AJ3L 1TS2A 2B3GA 4MIUA 1O80A 5C44G 1XMOQ 4QIWE 3ERSX 4KJNA 4Q5VA 2EJFC 4C3HG 3IKJA 4NP5A 2E8GA 4F7XA 3S9WA 2O5IC 2D62A 1Y1VH 3OMCA 2OF1A 2J7ZA 4K6DA 2NVXB 1J9OA 5EKKA 3S2HH 3MFYA 4GZYC 2VNUD 4UPAA 4FXGC 3M7NA 5LMNW 2PPBC 3URYA 2ZTCA 2E2HH 4NXNQ 3HS0C 1HCZA 5CC4A 3F1ZA 4EGVA 4A3JB 4GOPC 4KHPQ 2QF7A 2V4DA 4DAPA 4A3FH 2OQKA 2UUAL 1TWAH 2C5CA 1I50H 1LTBD 5I4DA 1UUPA 3EJIA 4MZ9A 3CCJA 1BBWA 2Q8IB 3SXHA 4PMBA 3OWEB 2JN4A 1LACA 3MXNA 4G7HC 3QWNA 1VMPA 4K0KL 3T1HL 1FVIA 5CBEE 5GROA 5IYDH 4IFDI 1SLJA 3I7FA 5IWAL 3CCVA 1JJ2A 3GD7A 1ENCA 1B44D 1BOSA 1RJTA 3HOUG 1RTNA 5CV5A 3H3VC 2JA5G 1QVFA 1W3SA 4PMWA 1BCPD 1I4RA 1OXXK 2PZUA 2ZJPA 1RF2D 4L5TA 1JE5A 3KJPA 3TS0A 4DU9A 2EZVA 4JOIC 2NYZD 2NVYB 5IT9E 1SFOB 4LF9L 4P75A 5FO8B 1HQMC 5M5YH 1QB5D 5ISRA 4FVMA 2UXDL 1K8MA 5KYIA 4DR5L 5I2XA 1R4QB 1NJIC 5C4HA 1JT8A 1PFNA 3ULJA 1SNOA 1TWHH 2F0KA 1JICA 3IFDA 4I7AA 2F0NA 4UP9A 2BH2A 2I5LX 3KFUA 5IGFA 2K04A 4IZ8A 1Q12A 3TP5A 1A62A 2R92H 4O42A 5HURA 4O1NA 1YIJA 4P72A 1LTTD 4OWTB 1XMOL 3PO2B 1PFBA 4O0AA 3G48A 1YVCA 2NVQH 2JEAI 1HR0W 3L2PA 4BY7G 2NN6G 2EOTA 5M5WB 4RGMA 1IYJB 3SK5A 3JAME 2JSOA 4JI7Q 2D2CC 3HOYG 1GHJA 1JCKB 2QA4A 1C9OA 4JOIA 1P16A 3R2TA 1EQQA 3DM1A 2F0QA 1XNQQ 4LF4Q 1KHIA 3GTLB 1DONA 5LMNQ 2L11A 1FJGL 2RDGA 1TT2A 1E2VA 4FXKC 5I9PA 2I46A 2NZ1D 4TKOB 5C5MA 4NB3A 3RZOB 2BDNA 1LO5D 3IAYA 1UEAB 5F2DA 4EQOA 4OELB 1XNRQ 1GHKA 3RN2A 3GTQH 2SDFA 4JK1C 4QIWB 2CWAA 1FNVA 1X65A 5D3DA 3CCEA 4WJWA 3K81C 2VQFQ 1TS5A 1BF4A 3U9OA 4LF7L 2H1EA 3VR5A 3BZCA 3D6CA 3HRZC 3M4QA 2CH4W 4HJ5A 1DM0B 2E76C 4KI0A 3STBD 3HOWG 2XWJB 4DK3C 3K58A 2F0UA 2F0TA 2A73B 1XTDA 1VMCA 3EA6A 3CRLC 3FEWX 2XTIA 2V1CC 1BNZA 3S2HB 5EJWA 1RL2A 4LF8Q 1SSOA 4HSVA 1Q82C 3KUPA 1K3BC 4QF4A 3J80L 4X3UA 2PMZE 1STAA 1CK1A 1YZ6A 2E2HB 2UXBQ 1KL9A 1SYGA 2SEBD 4CDFC 5ELDA 3KF6B 2FHTA 1KAAA 3VYRA 1J5EQ 5IGCA 2CHBD 2ZXRA 1CZGA 2WP8J 4WFN3 4DAMA 4A3FB 1S5ED 5J22A 1CM9A 1TWGH 1L1OB 1I50B 3KK7A 4KK7A 4LMQD 1XPOA 1WCMG 2TMPA 2ZT9C 4V190 1N33L 3GTKH 3S1QB 5LL6X 3CKIB 2RCFA 4JI1Q 4LF5L 1PYWD 2F3WA 1F9SA 4K2LA 4YWMA 1AH9A 1QJOA 4YWLA 4A3CH 2OEOA 1ONLA 2JXMB 4WRDA 3PGZA 3PCOB 2R61A 2L4NA 2PQAA 4IUQA 4FYDA 1H95A 1E7ZA 1X3GA 4R4TA 3G6EA 2NTTA 1MD2D 2QDBA 2N3SA 5I2YA 3PF5A 2AKWB 5IYCH 1G2SA 5L37A 4MHEA 4H13C 3AB9A 1HR0Q 2NN6I 2EY6A 2VZAA 5KYLA 3H0GG 1U5KA 2F0VA 3ONAB 2K14A 5E4XA 1CSPA 3X3NA 3M9BA 4B9XA 2E5LL 4IQZA 4X3TA 4L5SA 5M5YB 3CD6A 5DLQE 2Q2TA 1A8VA 2B2WC 3UDFA 3ER0A 3AEVA 3CCRA 1JB3A 1STBA 2DJGC 4JVZA 4KKSA 1EOTA 5ELBA 3GTOH 2ZJRA 2Z6BA 4UHVA 2CWPA 4DV3Q 1TWHB 3QB3A 1AE2A 1LUZA 2AUKA 4UAIA 2F4IA 2R93G 1X3QA 4ZUIA 1QOHA 1B9MA 4AQYQ 3GTMH 3KBXA 1X3FA 2NBFA 1D5XC 1XTCD 2R92B 5M9OA 1GOZA 5CV9A 5CGKA 1VQIA 1ASZA 3HOXG 4EQPA 3J7AV 4DR1Q 4KKUA 4AYBG 1D2BA 2VQFL 4DNTB 1B9NA 2NVQB 3FKIG 3KBGA 1HZBA 3AMUA 1NSNS 1SRUA 1NMGA 4IFDH 5ELCA 1A2UA 1IBKL 4JI5L 2SNMA 5EPLA 3T51B 5G3LF 4JYAQ 5IP7H 1SJED 3T53B 4XQQA 5C0XJ 2AUJD 5D3IB 3T1YQ 3HOVG 1BVSA 1VQLA 1E3PA 2B2WA 3K0XA 2G5DA 1HTLD 1STEA 2A69C 2QEXA 1VQGA 5FK9C 1G91A 3AYHB 4A3BH 2B29A 4RGNA 3VR6A 4A3DG 5K36H 3SEBA 1HH2P 2EJGC 3PUXA 2H4OA 2D5DA 2ZTDA 2DJFC 4DAYA 3IL8A 1WTXA 1WTRA 3GTQB 2HDMA 5IGEA 4BY1H 3OW2A 2Y0SE 3NBHB 5CYUA 2GVBA 1YHQA 2AWNA 1L2FA 1U4RA 1V1PA 4EX5A 3HOZG 1V1OA 4A4IA 2F03A 2L55A 3RLFA 3ZJYC 1B2TA 1DGSA 2NZOA 2I07B 1IBLQ 1N34Q 5DEHA 4KY5A 2MJ8A 4L5RC 1Y8PB 4C3HH 1C8CA 4DV6L 3DWQA 2PMZB 3Q0AA 4A3GH 5C5LA 4BA2I 2PQEA 2D0PA 1Y1WG 4A3MH 2A19A 2CFMA 2K52A 1O7LA 2JJQA 3M4OH 1D5MC 2EYFA 1VQJA 2F0IA 3I56A 4A3IG 1EIGA 3KYHC 2XVSA 1PRTB 2X6LA 1L1OC 3GTKB 1WTVA 1FNUA 2EY2A 4X62Q 1YNJD 4PNYA 4C56C 2JA7H 1Y8NB 4OGQC 3TREA 2BA0A 4RA8A 3U58A 3RN5A 4HSPA 3M7GA 2RSOA 2VQEL 1WD0A 1J8IA 5T1GA 5D65A 3T16A 2ID0A 4KN7C 4C3IG 2EXZA 3RNUA 1YNJC 1X9NA 2HDLA 2RA4A 4JI2L 1PXUA 1CQVA 1XMQQ 2RHQB 1A3VA 1O7ZA 4JI4Q 1TWCH 1OTCA 2JP1A 1S4ZA 1LYLA 3EFXD 4DR1L 3PO3G 5KRUA 5LMUQ 5M5XH 1UEBA 2A6HD 2JA6G 2BOSA 1TKWB 4A93G 1SAPA 1PYSB 1A3TA 1D7QA 2Z4IA 2IWHA 5JOBA 3KLSX 4UDUC 4DV0L 3GTOB 4GN5A 3A5UA 1EQTA 1C7YA 1H9SA 4YCVA 3SK4A 4QL5A 1OXVA 2XRSD 1NCVA 3DHQA 3GTMB 2BCOA 4X66L 3OIQA 2K75A 3A56A 1SYDA 4GNXC 3QIAA 4M8AA 4F87A 2XIWA 2F0MA 1KLGD 4C3JG 1F9QA 1QUQB 1PTOC 2IX3A 1UWVA 1VQMA 1TS4A 2HD3A 4E6IA 1TQOA 1N34L 5K5PA 5IT9L 2KEDA 5HGTA 2NVTH 2VW9A 2NN6H 3KLSA 5JPNC 2VUMG 2EY5A 3G6JB 1EYGA 4LWCA 2LSSA 5BR8Q 3VDYA 2MNAA 3GP7A 3HOYH 4A3BB 4RHRA 2N8NA 1D5ZC 2ICEC 1EYAA 2B2YC 2Y0SB 1ENAA 1JOQA 3FVQA 4BY1B 4DXFA 3CXCA 3E3XA 4LNQA 3PMFA 4N9PA 4KMUC 2O2LD 4NPSA 2UUCL 3JC66 1LLRD 1G2TA 2NUCA 4IPDA 2EY1A 2M9VA 3JAML 4C3HB 4A3GB 3OWFA 4ULLA 1XMQL 1HRJA 4GKJL 1KXLA 2CQOA 3OIPA 1PRTD 1NAPA 4A3MB 1WVLA 5HGQA 2UUAQ 2UUBL 1V8QA 1EZ6A 3RLOA 4TVAB 1GUSA 3M4OB 4CKEA 1IYUA 1SEBD 2HQEA 3SGIA 1PZKD 5GAHC 3CRKC 4FF1A 2DN8A 1RDPD 2B2YA 2F0OA 4K14A 3TQYA 4DUYQ 4U68A 3UE0A 5COYA 3S14H 1PLFA 4K0KQ 4JI3L 3T1HQ 4OO1G 3K5MA 4PZ7A 1K8OA 5M3MG 1MGSA 2JA7B 4AIMA 2JK8A 2KA7A 3WOFA 4WJ4A 3UE1A 1GXDC 1TXYA 4K5WA 5FJ8H 4BBRH 2B8GA 3HKSA 1SNQA 4IPCA 3GTJH 3I4MH 4IPHA 1JJCB 3HZXA 4P73A 3UI2A 2B63G 1DOMA 1HPCA 4PV1C 4TRDA 2VS1A 1TWCB 1H9RA 3NEMA 4LF9Q 2KBNA 1ILPA 3K0YA 3H94A 2UXDQ 4IN3A 5M5XB 1S72A 1C0AA 4N8X1 1AW7A 5BN5A 3K57A 4C1NK 3CP0A 3H91A 4HCEA 4DV7Q 1YNXA 4KJOA 2C35B 1B50A 3HFZB 4UP8A 3P7JA 1S3OA 5EBDA 2K5QA 3H09A 5C4XG 1VCIA 3K6OA 3R2IA 3P75A 1CKOA 2CVRA 1C48A 2G9DA 1NY4A 4DN4M 2MFIA 1E22A 5C6AA 1B70B 3VYSA 1OXUA 1CKNA 2HT1A 4DV4L 3MFGA 5ELNA 1EYCA 1MJEA 1GM5A 2X69A 3CW2C 3CCMA 1KDAA 5J39A 5KIXA 2PNRC 4BBSG 4OWWB 1FJGQ 4H44C 4DR7Q 2WAQE 2K4KA 2NVTB 2D0OA 3FKIH 2HCCA 4FF3A 2DUDA 3J81E 3OTOL 3MVVA 1Q86C 4MTKA 1F2ZA 5C3EH 4LF7Q 1FD7D 2RCNA 2CCZA 4OO1I 2WB1G 4DUYL 3NELA 1Y8OB 2FINB 2R7DA 4LF6L 3FHWA 4A3DH 1R9TH 2MHVA 1Q1EA 4G57A 3RUZA 2K50A 4F8MA 4OL7A 2F3VA 2Z6KC 2K5NA 5IT9c 3K7UC 4NDXA 2R7ZH 3EQLC 4IOCA 5JJLA 2E75C 1K28A 2B39A 2R7FA 3HGBA 1M90C 2CKZB 2YTYA 4DF7A 1Z7TA 3D4DA 1QILA 5BN3A 4AH6A 3ND8A 1EIYB 1HTPA 5I9OA 2PZTA 1HZ9A 2F52A 4GOPA 2Z1CA 2A6ED 4X65Q 2NB0A 5M3FG 5GAGC 1VQ9A 3D0FA 5IYBG 1A15A 1N33Q 1Q46A 1ET6A 1BCPC 2K5DA 4LF5Q 4JC0A 2OQ0A 4C1NI 4DV7L 1HNWL 1A6XA 3M3YH 3CCSA 1HUNA 2IT1A 2A6EC 2KHSA 1H9JA 3S14B 3OOCA 4RFBA 2BA1A 4YCUA 1GUNA 3NXWA 3JAMc 3L3OC 2KQ3A 3M4PA 1HA5A 2EJMA 3J7AF 2Z6KA 2ZXPA 1Q8IA 1U4MA 2WACA 3A0JA 4XXEA 2NWGA 4BBRB 1E1OA 2F0EA 1EWIA 2JEBI 2ZM6L 2F1MA 1RD9D 3TDQA 3GTJB 4DAVA 2PI2A 4Z9CB 3I4MB 4A3EH 3JAMi 2VB2X 4HTHA 3H3VI 3I2ZA 4GLXA 1HNZL 2E5LQ 3DMUA 3W5OA 1X55A 4A3KB 1KAWA 4IPGA 1NMFA 1EIFA 1G291 2N88A 4X3SA 2F0SA 5JJIA 3U4VA 1HHVA 1D1KA 2P5ZX 4DR7L 3CPWA 3KDFB 3LGJA 3K5NA 3A54A 3I4NH 1XYIA 2E2JB 4HMIA 2ASBA 3Q24A 4CKCA 4R8IA 1YJ9A 1IL2A 1SNDA 3TZDA 3R8BA 3S17H 2OTLA 1VQ6A 3QO2A 5AFWA 3V96A 1Q90A 2JYOA 2NZHA 3FPUB 3UDIA 3T56B 5JJKA 3CQZH 2ATWA 3A8JE 4CHTB 3VR2A 5C0XG 3FDTA 1WJJA 1ASYA 1XPUA 3DLLA 4KHZA 1Y1VB 1HZAA 4IJHA 1PH3A 1IBKQ 4JI5Q 1DZ1A 2FFKB 2HHHQ 1SYBA 2K7VA 3EN2A 4XTCS 1EU3A 1JORA 3CAMA 2BE5D 4R1JA 2WAQB 1HFGA 1PH4A 4OWXB 3STBC 4EQ5A 1PZJD 5JEAH 1MBYA 2AMCB 4ZLTF 1SN8A 1N36L 1U4PA 2A5HA 4DR6L 3UDXA 4ODGA 3AFQA 1CFMA 4X65L 3K7AH 4R4QA 4DR2Q 1TWAB 2KENA 3L7ZC 3CF5A 3ERQA 4ZYSA 1I4PA 1LTID 1Q1BA 2EE1A 3E5SA 5C3EB 4ME3A 3K5OA 2AQ3B 4IALA 2KCNA 3V2TA 1B3AA 2Z0SA 4JCVE 3TN2A 1X6OA 4YY3L 4R9WA 4LFAL 1IYVA 2YU9H 5FO9B 1QNUA 1MI2A 2RF4A 4DV2L 1R9TB 4BXXH 3TRZA 1YJNA 3RZDH 1SE8A 3DEPA 3I72A 4DV6Q 3PO2G 2KVMA 4JPBW 2R7ZB 4Y7NH 2EYOA 1CKMA 4FO2A 2JA8H 2ICIA 3HEJA 1LTSD 2EIFA 1XPRA 5ELFA 1QZHA 1N32L 1FGBD 3P20A 1KIXA 1UAPA 1AE3A 3HKZE 1STNA 4ABNA 4A3LG 5IY0A 3ZYYX 1T9HA 3MXUA 3SK6A 1HFNA 5G3LD 3MXGA 4CBVA 1PH6A 3D3RA 1JC7A 2MUYA 4PMCA 1S5BD 3M3YB 2PYKA 5HY6A 4UY8C 2VQEQ 4I65A 4IO9A 1Z6HA 3D31A 1PH1A 1TY0A 4FF4A 1SNMA 4JI2Q 1ZKOA 3U4ZA 2K6AA 2O5JC 4P74A 3QOLA 4B3ML 1EY7A 5C0XI 1K73C 3W1GA 4FNFA 4QY7A 5EAYA 1GO3E 2OWOA 3I8ZA 4LFCQ 1DJRD 4A3EB 3M4YA 1HZCA 1ENFA 2HHHL 1A3UA 2A68D 1W6JA 4H02A 1DYQA 1PA6A 4LAAA 4DV0Q 5FOBB 3PIOA 1G8ZD 5EGTA 4ALPA 3OPOA 1JOOA 2MP1A 1AN8A 2A68C 1BO0A 4G7OC 4A3FG 2KUMA 5E3FA 3I4NB 1U0LA 4RGOS 1BDOA 4XQNA 1N9WA 4X66Q 3DXJC 3I90A 4DR2L 3S17B 2WKDA 1SBBB 2ALYB 4Y52H 2LXJA 3KF8B 3VR4A 2WIIB 4P2CB 3TEHB 2E2IH 2F0JA 5IYDG 4IOAA 5A2QE 4IUTA 1C4QA 5D14A 1YI2A 5C44H 1B8AA 3EIVA 4OX9Q 2Q8RE 2QW7A 1W2BA 3OSOA 1EY6A 4B9WA 5CV6A 3S24A 5EKLA 1RIPA 2B2TC 4PZ8A 4RG1A 2A74C 1EL0A 1LT6D 1SE3A 2B8FA 3HP3A 3LX0A 2CW0D 5IE8A 4L5QA 2LY7A 2TSSA 3MEFA 2F0GA 1HNXL 4BBSH 1EWHA 3PUYA 3CMAA 4GN3B 1KD1C 3K7AB 2H5XA 1TWGB 1SJHD 3VR3A 2F0LA 4YWKA 1HA6A 2XWBB 1K8GA 3E6ZX 2UUCQ 2OTJA 4KV6A 2IX0A 4IURA 3L0OA 1WTWA 1AFPA 2JE6I 3NSWA 2YU9B 3P1HA 3J80c 1B53A 1BR9A 3E0JA 2R92G 1KTKA 1LM0A 1BXTA 3PIO3 3RZDB 1VQOA 3WOEA 1OXSC 4GKJQ 3MWYW 3S15H 2CH4A 4Y7NB 4LK1C 4JI0L 2YTVA 4POFA 2JA8B 2G9HD 1STHA 4DGZA 3J80i 1TR5A 3KJOA 2UUBQ 3CC4A 1XJVA 5I6WA 3HKZB 1I94Q 5JPMC 1RTOA 3D4WA 4N8FA 1PHJA 1PFSA 4LFCL 3PIPA 1F9RA 3FP9A 1NR2A 4HIOA 3KF6A 1ZYRD 3BDOA 1HUMA 2B2VC 3HOUH 2JA5H 1DCZA 3GO5A 3TMEA 3NUCA 4JI3Q 2L15A 3MC0B 2XRQD 4HJ8A 1L1OA 2A6HC 3NTKA 5CMDA 1QE6A 3J81L 2EQSA 1FR3A 1PV4A 1PZID 1CT1D 1ZYRC 4DV5L 2ZJQA 2D9UA 1Q81C 4L6TB 3HG9A 3VYTA 4B3RL 4DV1L 4GKKL 1AEXA 4TQUS 4CJ1B 4PZ6A 3TS2A 2L0CA 1B3QA 1H9MA 2PZWA 3OMGA 3K59A 5LL6S 1I6HH 3A8IE 2KCMA 2YYZA 1K3RA 3MA2B 4JV5L 4B3SL 4JBKA 1LT4D 1SMYD 1X3PA 1KRSA 4FP5D 3MXNB 3G4SA 4HAEA 4OX9L 2EYPA 1Z9FA 3BYYB 2B2VA 4BY7H 1GUWA 1KDCA 4DK0A 3NWSA 2HUGA 3K5LA 3J7ZC 1G51A 4DK6C 5EQ0A 1SMYC 2XNAC 1Z47A 4LJZC 1U9RA 2UXCL 1EUJA 5E7NA 4Q0FA 5FLXE 1QWYA 3TP7A 3EROA 1P8LA 3KLWA 2DGYA 1EQVA 1SYEA 1ZEQX 1MIUA 4RGTA 4DV4Q 3TBIB 2C9OA 3A7AB 5C4JH 4IUPA 4G4KA 3PIP3 1YHBA 1DOKA 4GNXA 4KKTA 1HJPA 1NBWA 1G6ZA 2L9HA 2E2IB 2ES2A 1TWFH 2QKIC 1AP0A 5IYCG 4KLKA 3PUZA 2Z8LA 2BDOA 1D1IA 5C44B 3BU2A 5GQOA 4L63B 3BYTB 4BA1I 1EFWA 4XIGS 2UU9L 2GA4B 1EY4A 4K6LA 3PF4A 1PH7A 1VQ7A 1LT3D 1D6EC 3HOWH 4YHHL 1V9PA 1VQFA 1I94L 3OTOQ 5E1FA 4BWGB 4XYQA 1M1KC 3F2BA 5NUCA 1M4VA 1WI5A 2J4XA 5CV8A 1GUOA 1PRTC 4ILWA 2F4VL 3E9IA 1Q3LA 5KNCA 4LF6Q 3Q8DA 3NBHA 2Q2IA 1GD7A 5LHY1 1X56A 1WCMH 3NTHA 5DNFA 2L1BA 1S5DD 2I0QA 3A8KE 1BBUA 1NTGA 3D8GA 3RD4A 1EY8A 1UE7A 5JAVA 3D4RA 1QG7A 1OO9B 2OXPA 3S15B 3J7A5 1HXYD 1UE1A 4K5VA 1EU4A 5EKIA 1VQ4A 3C3LA 1IHZA 1Y14B 1ML0D 5TSSA 3BZDB 3K8AA 5IP7G 4XYOA 1HNWQ 1SNPA 1M8AA 3HOUB 1VQEA 5IGDA 2JA5B 1PH9A 1DD2A 5KGUA 3TZUA 4I7ZC 4QQBX 3H0GH 1AZPA 1KLUD 3DUZA 3MXPA 2K32A 4UP7A 2KHIA 5J1ZA 4GS3A 2WV6D 2GN5A 2Y0SG 1G6PA 1KRTA 1K0RA 4O2DA 5JEAJ 5C3XA 2ZM6Q 4BY1G
chains in the Genus database with same CATH topology
1STGA 3DEOA 2CQAA 1E2ZA 1SYFA 2SNSA 1I6HB 4PQXA 1T5XD 4ZKCB 3SHLA 1KABA 3BVMA 1JR0D 2EYHA 1RHPA 2EYMA 3KLRA 4BY7B 2J0TD 3NK9A 2Z4HA 1CI3M 3HOYB 4KHVA 2OT2A 1MSGA 3FPPA 2RDFA 1S5CD 4J8QA 3EVQA 4H7BA 1F2YA 4RCNA 1LABA 1I4XA 3QOJA 3Q22A 5C4JB 4IUVA 2IL8A 1XWEA 5EBCA 5FKAC 1DXMA 1O78A 4ZRZA 4ZK9B 1TWFB 2K5WA 4YIJA 4RCOA 3VYUA 1A2TA 1EEID 3C2PA 4RH6A 2DY7A 4WORA 2EDGA 3Q23A 3BDCA 3FRPB 3IFTA 2KECA 1I4GA 3HOWB 1FYCA 1MSHA 3U9SA 1TY2A 2LS01 3PUWA 5JJZA 3BVGA 4HMJA 4IFDJ 1EY5A 3ITPA 5C3WA 1ESRA 3NP8A 3FMCA 4ID6A 1RODA 3CU7A 4EQNA 2K03A 3I3CA 2LFNA 1I6VC 2F0HA 1S5FD 4K8JA 4N9TA 2RSNA 4G7ZC 5A2QL 1WCMB 2MPMA 2QEJC 2RBMA 1EY0A 1E2WA 2O4XA 5IGGA 5CV4A 4XT3B 1X32A 1LTRD 4XT1B 1BCPF 5IOCA 1VDZA 5IODA 1ET9A 1V1PB 2VB3X 3C1FA 1F2MA 2DNCA 2KEEA 5JVH3 4KTAA 4HN7A 1PTOH 3H0GB 2RDHA 4RWSC 1PMRA 2RQXA 2IW3A 1AZQA 1IKMA 4NW2A 4CJ0B 4NKLA 3SVMA 4HEDA 1IKLA 3ND9A 1SXTA 2DY8A 3TP6A 3I4LA 3NWTA 3NTIA 4OIKA 4J6HA 1UNSA 3N52A 4DFAA 4FF2A 3G7LA 1WTOA 5IGBA 4RAUC 2R93B 5DAUA 1F9PA 1BBXC 1RKNA 3C46A 1O7YA 4C2MB 3HOXB 1ZXTA 4AYBB 4J1MA 1YNND 2R3ZA 3FKIB 2NTSA 2BE5C 1KNAA 4RHSA 1ESFA 3SE0A 4RKLA 1ICWA 2QILA 4MN3A 2M2LA 1CA5A 3HOVB 2EPBA 5FO7B 1EEFD 1YNNC 3MZ5A 1FNWA 2R6GA 1ILQA 4A3DB 1JWSD 3SDZA 3BG3A 1CHQD 2PW7A 1F2LA 2EYLA 3PUVA 1H9SB 3S1RB 1I4HA 3PV0A 3HOZB 2FJ2A 2K28A 1CA6A 2AQ1B 2PCFB 3OHXC 5T1IA 3TSSA 5C4ZA 1I3QB 1W6KA 3VA5A 1TS3A 3MTSA 2L5TA 5FLXL 1K83B 4KD3A 1Y1WB 1HQRD 2IPKD 3I73A 1SNCA 4QCLA 2SOBA 2PO4A 4A3IB 1EYDA 5KNBA 4QMGA 1EZ8A 1TVXA 2F0PA 5CBAE 2QCPX 1GJXA 1TIID 4OO1H 3H6MA 1EIHA 3V05A 1F77A 2XSCA 3LNNA 4TSSA 3BVZA 5ELEA 1LT5D 3X3MA 4XDXA 3S16B 4IUNA 3NBIA 4R8NA 4B08A 4C3IB 1NR4A 4FXDA 1IW7D 4XQJA 1H9KA 3W2DA 4HR7B 1PTOB 3GTPB 3PO3B 2A69D 1XXGA 2JA6B 3TP8A 1IW7C 4JBWA 1QNKA 2M00A 3N6RA 1JOKA 3BS1A 2K01A 5EPJA 3T13A 4A93B 1JWUD 3CQZB 3SR1A 2K05A 4DXGA 4CGYB 2ZXOA 5CR3A 1WTQA 1EWCA 2RVLA 1LTAD 1LV9A 2F0WA 2RKSA 4ZUJA 4OHJA 3MEHA 1BQQT 4C3JB 3BDLA 3T4AC 1KNEA 3DWAA 1B1ZA 1WTPA 1OXTA 2CW0C 4CJ2C 4HCSA 1PDQA 2VUMB 1CHPD 3AU7A 3LWEA 1EFID 3S1NB 2B2UC 1L0XB 4K8IA 4KY7A 3GTGB 3OW7A 5EPKA 3R3OA 4BS9A 3O13A 2B2TA 4L8JA 5JVG3 2AWOA 1SE4A 2E74C 1VF7A 5IIFA 3L9AX 1EY9A 1QCBD 1TU2B 2K33A 2F0FA 3MAQA 4CKBA 2E2DC 3J80E 2N55A 4M1UB 1XX8A 1JWMD 1STYA 3WDNA 2L12A 3J7YW 4IUUA 1E0BA 4NMZA 2WINB 2WKCA 4QB4A 4KN4C 3I91A 1RCVD 2B2UA 3GV3A 2FMMA 3I70A 1CZWA 1JQYD 5M3MB 3M85A 3W3AA 2Q8TA 4QUCA 1PTOD 4H0LC 4ZKBB 2LMCB 2LKVA 5JEAG 1T5EA 2K1BA 3LWUA 1CQFA 1GUTA 2B63B 1KDBA 2HCIA 1Y69U 3A55A 2FMCA 3D6WA 2AQ2B 3CHBD 4RKBA 2F0DA 2EVBA 3VA7A 4K5XA 5CORA 4DA2A 4KD4A 1U4LA 1PTOF 5KEEA 1R4PB 1CTMA 5C4XB 3C1EA 3MHBA 4V0BA 1B4OA 1II3A 2XN9C 1IL8A 2IJ0A 3GV6A 5C0XH 4X3KA 1V43A 2ENBA 3DWPA 3QG1A 4ME5A 3NQTA 2MGSA 5DM63 4BBSB 3NHHA 5KNDA 4QUFA 2IX1A 3F2UA 2KOLA 4F88A 2KJXA 5DM73 4U673 3S1MB 3KF8A 1BCPB 2KCCA 3Q6SA 1GUGA 4DNRB 4KY6A 3A7LA 2PW5A 4ZQ3A 1SE2A 4ZAIA 2VXWA 2EYJA 3NE5B 1BUVT 1JE4A 5I6YA 4K2KA 3R93A 3RMHA 2WB1B 1VF5C 4IFDG 1LTGD 1SYCA 3NPPA 3QJYA 3S2DB 4DK1A 2X6GA 1PRTF 4S3SA 1I4QA 4OIJA 1NUCA 1SDFA 1WD1A 5K36G 2DNEA 4EVOA 3GQBA 5A35A 5M3FB 3SK8A 1DOLA 3NQIA 1PFMA 5CV7A 1L0YB 5E4WC 5BN4A 1TS2A 4MIUA 1O80A 4KJNA 4Q5VA 2EJFC 4C3HG 3IKJA 4NP5A 4F7XA 3S9WA 2O5IC 2D62A 3OMCA 2OF1A 2J7ZA 4K6DA 2NVXB 1J9OA 5EKKA 3MFYA 4GZYC 2VNUD 4FXGC 3M7NA 2PPBC 3URYA 3HS0C 1HCZA 5CC4A 4EGVA 4A3JB 2QF7A 2V4DA 4DAPA 2C5CA 1LTBD 5I4DA 1UUPA 3EJIA 2Q8IB 3SXHA 4PMBA 3OWEB 1LACA 3MXNA 4G7HC 3QWNA 1VMPA 5CBEE 4IFDI 3GD7A 1ENCA 1B44D 1BOSA 1RJTA 1RTNA 5CV5A 3H3VC 4PMWA 1BCPD 1I4RA 1OXXK 2PZUA 1RF2D 4DU9A 2EZVA 2NYZD 2NVYB 5IT9E 1SFOB 5FO8B 1HQMC 1QB5D 5ISRA 4FVMA 1K8MA 5KYIA 5I2XA 1R4QB 5C4HA 1PFNA 1SNOA 2F0KA 1JICA 3IFDA 2F0NA 5IGFA 2K04A 4IZ8A 1Q12A 3TP5A 4O42A 5HURA 4O1NA 1LTTD 3PO2B 1PFBA 2JEAI 2NN6G 2EOTA 5M5WB 4RGMA 3SK5A 3JAME 2JSOA 2D2CC 1GHJA 1JCKB 3R2TA 3DM1A 2F0QA 1DONA 3GTLB 2L11A 2RDGA 1TT2A 1E2VA 4FXKC 5I9PA 2I46A 2NZ1D 4TKOB 5C5MA 3RZOB 2BDNA 1LO5D 3IAYA 1UEAB 5F2DA 4EQOA 1GHKA 2SDFA 4JK1C 4QIWB 1FNVA 5D3DA 4WJWA 1TS5A 1BF4A 3U9OA 2H1EA 3VR5A 3D6CA 3HRZC 1DM0B 2E76C 4KI0A 2XWJB 3K58A 2F0UA 2F0TA 2A73B 1VMCA 3EA6A 3CRLC 3FEWX 1BNZA 3S2HB 5EJWA 1SSOA 4HSVA 3KUPA 4QF4A 3J80L 4X3UA 1STAA 1CK1A 2E2HB 1SYGA 2SEBD 5ELDA 2FHTA 1KAAA 3VYRA 5IGCA 2CHBD 2ZXRA 1CZGA 2WP8J 4WFN3 4A3FB 1S5ED 5J22A 1CM9A 1I50B 4KK7A 3KK7A 4LMQD 4V190 2TMPA 2ZT9C 3S1QB 5LL6X 3CKIB 1PYWD 2F3WA 1F9SA 4K2LA 1QJOA 2OEOA 1ONLA 2JXMB 4WRDA 2R61A 2L4NA 4IUQA 4FYDA 2NTTA 1MD2D 2QDBA 5I2YA 1G2SA 4MHEA 4H13C 3AB9A 2NN6I 2EY6A 5KYLA 2F0VA 3ONAB 5E4XA 3X3NA 4B9XA 4IQZA 4X3TA 5M5YB 2B2WC 1JB3A 1STBA 4KKSA 5ELBA 1EOTA 1TWHB 3QB3A 2AUKA 4UAIA 2F4IA 1X3QA 4ZUIA 1QOHA 1B9MA 3KBXA 2NBFA 1D5XC 1XTCD 2R92B 5M9OA 1GOZA 5CV9A 5CGKA 4EQPA 3J7AV 4KKUA 1D2BA 4DNTB 1B9NA 2NVQB 3KBGA 3AMUA 1NSNS 4IFDH 5ELCA 1A2UA 2SNMA 5EPLA 3T51B 5G3LF 1SJED 3T53B 4XQQA 5C0XJ 2AUJD 5D3IB 2B2WA 1HTLD 1STEA 2A69C 5FK9C 1G91A 4RGNA 3VR6A 5K36H 3SEBA 2EJGC 3PUXA 2H4OA 2D5DA 4DAYA 3IL8A 1WTXA 1WTRA 3GTQB 2HDMA 5IGEA 5CYUA 2AWNA 1U4RA 1V1PA 1V1OA 2F03A 2L55A 3RLFA 1B2TA 2I07B 5DEHA 4KY5A 2MJ8A 1Y8PB 1C8CA 3DWQA 2PMZB 3Q0AA 5C5LA 4BA2I 2PQEA 1O7LA 1D5MC 2EYFA 2F0IA 1EIGA 2XVSA 1PRTB 2X6LA 3GTKB 1WTVA 1FNUA 2EY2A 1YNJD 4PNYA 4C56C 1Y8NB 4OGQC 2BA0A 4RA8A 4HSPA 3M7GA 2RSOA 1WD0A 1J8IA 5T1GA 5D65A 3T16A 2ID0A 4KN7C 4C3IG 2EXZA 1YNJC 2HDLA 2RA4A 1PXUA 1CQVA 1A3VA 1O7ZA 2JP1A 1S4ZA 3EFXD 5KRUA 2A6HD 2BOSA 1TKWB 1SAPA 1A3TA 2Z4IA 2IWHA 5JOBA 3KLSX 4UDUC 3GTOB 1EQTA 1H9SA 3SK4A 1OXVA 2XRSD 1NCVA 3DHQA 3GTMB 2BCOA 3OIQA 3A56A 1SYDA 3QIAA 4M8AA 4F87A 2XIWA 2F0MA 1KLGD 4C3JG 1F9QA 1PTOC 2IX3A 1TS4A 4E6IA 1TQOA 5K5PA 5IT9L 2KEDA 5HGTA 2NN6H 3KLSA 5JPNC 2EY5A 3G6JB 3GP7A 4A3BB 4RHRA 1D5ZC 2ICEC 1EYAA 2B2YC 2Y0SB 1ENAA 1JOQA 3FVQA 4BY1B 4DXFA 3PMFA 4N9PA 4KMUC 2O2LD 1LLRD 1G2TA 2NUCA 2EY1A 2M9VA 3JAML 4C3HB 4A3GB 3OWFA 4ULLA 1HRJA 3OIPA 1PRTD 1NAPA 4A3MB 1WVLA 1V8QA 1EZ6A 3M4OB 1GUSA 4CKEA 1IYUA 1SEBD 2HQEA 1PZKD 3CRKC 4FF1A 2DN8A 1RDPD 2B2YA 2F0OA 4K14A 4U68A 5COYA 1PLFA 4OO1G 3K5MA 1K8OA 1MGSA 2JA7B 2KA7A 3WOFA 1GXDC 4K5WA 2B8GA 1SNQA 3HZXA 3UI2A 1DOMA 1HPCA 4PV1C 4TRDA 1TWCB 1H9RA 1ILPA 3K0YA 3H94A 4IN3A 5M5XB 1AW7A 5BN5A 3K57A 4C1NK 3H91A 4HCEA 4KJOA 1B50A 3P7JA 5EBDA 2K5QA 3H09A 1VCIA 3K6OA 3R2IA 3P75A 2CVRA 1C48A 2G9DA 4DN4M 5C6AA 3VYSA 1OXUA 3MFGA 1EYCA 2X69A 1KDAA 5J39A 5KIXA 2PNRC 4H44C 2NVTB 2HCCA 4FF3A 3J81E 3MVVA 1F2ZA 1FD7D 4OO1I 1Y8OB 2FINB 2MHVA 1Q1EA 4G57A 3RUZA 4F8MA 4OL7A 2F3VA 4NDXA 3EQLC 2E75C 2B39A 3HGBA 4DF7A 1Z7TA 3D4DA 1QILA 5BN3A 3ND8A 1HTPA 5I9OA 2PZTA 2Z1CA 2A6ED 2NB0A 1A15A 1ET6A 1BCPC 2K5DA 4C1NI 1A6XA 1HUNA 2IT1A 2A6EC 2KHSA 1H9JA 3S14B 3OOCA 4RFBA 2BA1A 1GUNA 3NXWA 3L3OC 2KQ3A 1HA5A 2EJMA 3J7AF 2ZXPA 1Q8IA 1U4MA 2WACA 4XXEA 2NWGA 4BBRB 2F0EA 2JEBI 2F1MA 1RD9D 3TDQA 3GTJB 4DAVA 4Z9CB 3I4MB 2VB2X 4HTHA 3DMUA 4A3KB 1G291 2N88A 4X3SA 2F0SA 1HHVA 1D1KA 3K5NA 3A54A 1XYIA 2E2JB 4HMIA 3Q24A 4CKCA 4R8IA 1SNDA 3TZDA 3R8BA 3QO2A 5AFWA 3V96A 1Q90A 2JYOA 3FPUB 3T56B 3A8JE 4CHTB 3VR2A 5C0XG 3FDTA 4KHZA 1Y1VB 1DZ1A 2FFKB 1SYBA 2K7VA 4XTCS 1EU3A 1JORA 2BE5D 2WAQB 1HFGA 1PZJD 5JEAH 1MBYA 4ZLTF 1U4PA 2A5HA 4ODGA 1CFMA 1TWAB 3L7ZC 3ERQA 4ZYSA 1I4PA 1LTID 1Q1BA 2EE1A 3E5SA 5C3EB 3K5OA 2AQ3B 4IALA 2KCNA 3V2TA 1B3AA 3TN2A 4R9WA 1IYVA 5FO9B 1QNUA 1MI2A 1R9TB 3DEPA 3I72A 2KVMA 2R7ZB 2EYOA 4FO2A 2ICIA 3HEJA 1LTSD 5ELFA 1FGBD 3P20A 1UAPA 1STNA 4ABNA 3ZYYX 3MXUA 3SK6A 1HFNA 5G3LD 3MXGA 4CBVA 3D3RA 1JC7A 2MUYA 4PMCA 1S5BD 3M3YB 2PYKA 4I65A 1Z6HA 3D31A 1TY0A 4FF4A 1SNMA 1ZKOA 2K6AA 2O5JC 3QOLA 1EY7A 5C0XI 4FNFA 3I8ZA 1DJRD 4A3EB 3M4YA 1ENFA 1A3UA 2A68D 1W6JA 1DYQA 4LAAA 5FOBB 1G8ZD 5EGTA 3OPOA 1JOOA 2MP1A 1AN8A 2A68C 1BO0A 4G7OC 2KUMA 5E3FA 3I4NB 4RGOS 1BDOA 4XQNA 3DXJC 3I90A 3S17B 2WKDA 1SBBB 3VR4A 2WIIB 4P2CB 2F0JA 5A2QE 4IUTA 1C4QA 5D14A 2Q8RE 3OSOA 1EY6A 4B9WA 5CV6A 5EKLA 2B2TC 2A74C 1EL0A 1LT6D 1SE3A 2B8FA 3HP3A 3LX0A 2CW0D 2LY7A 2TSSA 2F0GA 1EWHA 3PUYA 3K7AB 1TWGB 1SJHD 3VR3A 2F0LA 1HA6A 2XWBB 3E6ZX 4KV6A 2IX0A 4IURA 1WTWA 1AFPA 2JE6I 3NSWA 2YU9B 3P1HA 1B53A 1BR9A 3E0JA 1KTKA 1BXTA 3PIO3 3RZDB 3WOEA 1OXSC 3MWYW 4Y7NB 4LK1C 2JA8B 2G9HD 1STHA 4DGZA 1TR5A 5I6WA 3HKZB 5JPMC 1RTOA 3D4WA 1F9RA 1NR2A 1ZYRD 3BDOA 1HUMA 2B2VC 1DCZA 3TMEA 3GO5A 3NUCA 3MC0B 2XRQD 2A6HC 3NTKA 5CMDA 1QE6A 3J81L 1FR3A 1PZID 1CT1D 1ZYRC 2D9UA 4L6TB 3HG9A 3VYTA 1AEXA 4TQUS 4CJ1B 2L0CA 2PZWA 1H9MA 3OMGA 3K59A 5LL6S 3A8IE 2YYZA 3MA2B 1LT4D 1SMYD 1X3PA 4FP5D 4HAEA 2EYPA 3BYYB 2B2VA 1GUWA 1KDCA 4DK0A 3NWSA 2HUGA 3K5LA 5EQ0A 1SMYC 2XNAC 1Z47A 4LJZC 1U9RA 4Q0FA 5FLXE 1QWYA 3TP7A 3EROA 1EQVA 1SYEA 1ZEQX 4RGTA 3TBIB 2C9OA 3A7AB 4IUPA 4G4KA 3PIP3 1DOKA 4KKTA 1G6ZA 2L9HA 2E2IB 2QKIC 1AP0A 3PUZA 2Z8LA 2BDOA 1D1IA 5C44B 4L63B 3BYTB 4BA1I 4XIGS 2GA4B 1EY4A 4K6LA 1LT3D 1D6EC 5E1FA 4BWGB 4XYQA 5NUCA 1M4VA 2J4XA 5CV8A 1GUOA 1PRTC 4ILWA 1Q3LA 5KNCA 3NBHA 5LHY1 5DNFA 3NTHA 2L1BA 1S5DD 3A8KE 3D8GA 3RD4A 1EY8A 5JAVA 3D4RA 1QG7A 1OO9B 2OXPA 3S15B 1HXYD 4K5VA 1EU4A 5EKIA 3C3LA 1IHZA 1ML0D 5TSSA 3BZDB 4XYOA 1SNPA 1M8AA 3HOUB 5IGDA 2JA5B 1DD2A 5KGUA 3TZUA 4I7ZC 1AZPA 1KLUD 3DUZA 3MXPA 2K32A 5J1ZA 2WV6D 5JEAJ 5C3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7Z C;  3CRL C;  3BG3 A;  2A6H D;  3GD7 A;  4IFD H;  3A7A B;  3QJY A;  1V8Q A;  3T51 B;  1GUS A;  4H0L C;  4DK1 A;  3PUV A;  1H9S B;  3T53 B;  1IYU A;  1E2W A;  4KKT A;  2AUJ D;  1E2Z A;  1TKW B;  1OXX K;  2JE6 I;  1Z6H A;  2LMC B;  3D31 A;  5JEA G;  3CRK C;  3PV0 A;  1T5E A;  2DN8 A;  3LWU A;  1GUT A;  1Q90 A;  1ZKO A;  5K36 G;  2A69 C;  2O5J C;  2DNE A;  2PCF B;  3PUZ A;  3T56 B;  2BDO A;  4OO1 G;  3GQB A;  1Y69 U;  3VR6 A;  1VDZ A;  5K36 H;  3A8J E;  1OXS C;  5A35 A;  5C0X G;  1HQM C;  1Y8O B;  2EJG C;  3PUX A;  3VR2 A;  4BA1 I;  1K8O A;  4XIG S;  4LK1 C;  2D5D A;  1K8M A;  1Q1E A;  1H9S A;  2DNC A;  2KA7 A;  4KHZ A;  3KLR A;  2EVB A;  1OXT A;  1OXV A;  2CW0 C;  2ZT9 C;  3M4Y A;  2K7V A;  2L5T A;  3EQL C;  4XTC S;  3VA7 A;  2E75 C;  2B8G A;  1CI3 M;  2BE5 D;  2A68 D;  3I73 A;  3HGB A;  1QJO A;  3BDO A;  1ONL A;  3FPP A;  2JXM B;  3QIA A;  5BN4 A;  1Z7T A;  5BN3 A;  1DCZ A;  3ND8 A;  1HPC A;  1HTP A;  1PMR A;  4PV1 C;  3RLF A;  1H9R A;  1CTM A;  1Q12 A;  1GUO A;  5JEA H;  5KNB A;  2A6H C;  4RCN A;  5KNC A;  2EJF C;  2A6E D;  1LAB A;  3H94 A;  3ND9 A;  3OPO A;  1FR3 A;  3IKJ A;  1GJX A;  2A68 C;  4G7O C;  3I4L A;  4OO1 H;  1Y8P B;  3OW7 A;  1CFM A;  5BN5 A;  2JEA I;  1ZYR C;  3AB9 A;  4H13 C;  5C0X H;  2NN6 I;  1BDO A;  2NN6 G;  1V43 A;  4BA2 I;  2O5I C;  3LNN A;  3L7Z C;  2D62 A;  3QG1 A;  3DXJ C;  2NN6 H;  4L8J A;  1A6X A;  2AWO A;  1Q1B A;  1DXM A;  1O78 A;  2D2C C;  1O7L A;  1GHJ A;  3MFY A;  4GZY C;  2IT1 A;  2E74 C;  3A8K E;  4TQU S;  2A6E C;  1VF7 A;  3VR4 A;  1H9J A;  1TU2 B;  3D4R A;  1IYV A;  1H9M A;  3OOC A;  2BA1 A;  5KND A;  4IQZ A;  1IW7 D;  1GUN A;  1VCI A;  3M7N A;  2K33 A;  3A8I E;  2PPB C;  1H9K A;  2EDG A;  2YYZ A;  2EJM A;  1E2V A;  1HCZ A;  3I72 A;  3IFT A;  4HR7 B;  4TKO B;  4KKS A;  2A69 D;  2BE5 C;  1OXU A;  2JEB I;  1FYC A;  1Y8N B;  2F1M A;  4OGQ C;  2QF7 A;  2KCC A;  3U9S A;  3SE0 A;  2V4D A;  2BA0 A;  3WDN A;  1GHK A;  1GUG A;  4DNR B;  2AUK A;  4JK1 C;  3PUW A;  1IW7 C;  3A7L A;  4JBW A;  4KMU C;  1DD2 A;  4DK0 A;  3TZU A;  1B9M A;  2B8F A;  3N6R A;  4I7Z C;  3VR3 A;  1YNN C;  4KN4 C;  2PNR C;  2Q8I B;  3P20 A;  1SMY C;  3FMC A;  3NE5 B;  4KN7 C;  2R6G A;  4LJZ C;  1YNJ C;  1LAC A;  1G29 1;  2K32 A;  1EWH A;  4H44 C;  3PUY A;  3MXU A;  4KKU A;  3VR5 A;  4G7H C;  4DNT B;  1B9N A;  1VF5 C;  1I6V C;  2E76 C;  4KI0 A;  4IFD G;  3M85 A;  3W3A A;  3SDZ A; 
#chains in the Genus database with same CATH topology
 4PG3 A;  1STG A;  2I5M X;  3CME A;  3DEO A;  3E9H A;  2CQA A;  1HNZ Q;  1E2Z A;  1SYF A;  2SNS A;  2LXK A;  1I6H B;  4PQX A;  2R93 H;  1T5X D;  4ZKC B;  4GLA C;  3SHL A;  1KAB A;  1PH5 A;  3BVM A;  1JR0 D;  2EYH A;  4A3G G;  4C2M H;  3J81 c;  2PQA B;  3HOX H;  1SMX A;  1WTH A;  2VL6 A;  3CCL A;  4ZCK A;  1RHP A;  4A3M G;  3AFP A;  4JI6 Q;  2RHS B;  3CCQ A;  2EYM A;  3KLR A;  4BY7 B;  2J0T D;  3NK9 A;  4IJL A;  1PH8 A;  2Z4H A;  4AYB E;  1CI3 M;  3UDG A;  4HIM A;  3HOY B;  4KHV A;  3J81 i;  1E24 A;  2OT2 A;  1MSG A;  3FPP A;  4MNO A;  4NXM L;  1YIT A;  2RDF A;  3HOV H;  1VQH A;  1S5C D;  1X3E A;  4J8Q A;  3EVQ A;  4H7B A;  1F2Y A;  4RCN A;  1LAB A;  4LUZ A;  2JA7 G;  1I4X A;  1CUK A;  4YCW A;  3QOJ A;  3Q22 A;  5C4J B;  1QVC A;  4IUV A;  1J6Q A;  3ULP A;  2IL8 A;  1XWE A;  5EBC A;  5FKA C;  1SRO A;  3S1Q H;  1DXM A;  1O78 A;  4ZRZ A;  4ZK9 B;  1QUQ A;  1TWF B;  2K5W A;  4YIJ A;  3KOJ A;  3CPF A;  4RCO A;  3VYU A;  1A2T A;  1EEI D;  3S1R H;  3C2P A;  4RH6 A;  2DY7 A;  1N36 Q;  4WOR A;  4DR6 Q;  2EDG A;  3Q23 A;  3BDC A;  3HOZ H;  2IHE A;  3FRP B;  3IFT A;  2KEC A;  1I4G A;  3HOW B;  3QR8 A;  1FYC A;  1MSH A;  1I3Q H;  3U9S A;  1TY2 A;  2LS0 1;  3PUW A;  2JA9 A;  5JJZ A;  3BVG A;  1K83 H;  4HMJ A;  4YY3 Q;  1SR3 A;  1EY5 A;  1Y1W H;  1JB7 A;  4IFD J;  3ITP A;  4LFA Q;  1ESR A;  5C3W A;  3CC7 A;  3NP8 A;  2ZTE A;  3FMC A;  4ID6 A;  1ROD A;  3CU7 A;  4DV2 Q;  1VQP A;  4EQN A;  2K03 A;  3I3C A;  5J3B A;  2LFN A;  1I6V C;  1EQR A;  4A3I H;  2F0H A;  1S5F D;  4QJF A;  4K8J A;  4N9T A;  1VQC A;  2RSN A;  4G7Z C;  5A2Q L;  1WCM B;  4HJ7 A;  2YTX A;  2MPM A;  2QEJ C;  2RBM A;  4DAY B;  1EY0 A;  1N32 Q;  1E2W A;  2A1A A;  4HIK A;  2O4X A;  1X54 A;  5IGG A;  5CV4 A;  4XT3 B;  1X32 A;  1LTR D;  4MTN A;  4XT1 B;  3S16 H;  1BCP F;  5IOC A;  1VDZ A;  5IOD A;  4C3I H;  1ET9 A;  1V1P B;  3I4O A;  2K5H A;  2VB3 X;  1MHW C;  3C1F A;  4A3J G;  1F2M A;  2DNC A;  3A74 A;  1FL0 A;  2KEE A;  5JVH 3;  4KTA A;  3RLN A;  3ULL A;  4HN7 A;  1PTO H;  3GTP H;  3PO3 H;  4JI6 L;  3BZK A;  3H0G B;  1PH2 A;  3CCU A;  1Q7Y C;  2JA6 H;  2RDH A;  2Z9H A;  4WJ3 M;  2N49 A;  1V1Q A;  1PMR A;  4RWS C;  5GAD C;  4B3M Q;  2RQX A;  2IW3 A;  4A93 H;  1AZQ A;  1IKM A;  5IP9 G;  4NW2 A;  4CJ0 B;  4NKL A;  4JW0 A;  3SVM A;  4HED A;  1IKL A;  3ND9 A;  1LTL A;  1SXT A;  4NXN L;  1YEZ A;  2DY8 A;  3TP6 A;  3I4L A;  3NWT A;  3NTI A;  4OIK A;  4J6H A;  1UNS A;  3N52 A;  4DFA A;  4FF2 A;  4KHP L;  4JI8 Q;  3G7L A;  1WTO A;  1B7Y B;  5IGB A;  4RAU C;  1VQ5 A;  5DAU A;  2R93 B;  1F9P A;  1BBX C;  1RKN A;  3C46 A;  1O7Y A;  2Q2U A;  4C2M B;  3E0E A;  3NEN A;  3HOX B;  1ZXT A;  4AYB B;  4J1M A;  2N78 A;  2QDL A;  3CC2 A;  4C3J H;  1YNN D;  2R3Z A;  3FKI B;  3U50 C;  1GKH A;  2NTS A;  2BE5 C;  1KNA A;  4DR3 Q;  1S40 A;  4RHS A;  2MO0 A;  1ESF A;  3SE0 A;  4RKL A;  1ICW A;  2QIL A;  3IRB A;  4MN3 A;  2M2L A;  1CA5 A;  3G71 A;  3HOV B;  2EPB A;  5FO7 B;  1EEF D;  1YNN C;  2VUM H;  3MZ5 A;  1FNW A;  2R6G A;  3I55 A;  1ILQ A;  4A3D B;  1VQK A;  1JWS D;  5FJ8 G;  5FLM G;  1A63 A;  3SDZ A;  4BBR G;  3S1N H;  3GTG H;  3BG3 A;  1CHQ D;  1I5F A;  2PW7 A;  1F2L A;  2EYL A;  3I4M G;  1GVP A;  2FXQ A;  3PUV A;  1H9S B;  2KHJ A;  3F8T A;  3S1R B;  1I4H A;  3PV0 A;  1NNX A;  4A3K G;  1HNX Q;  3HOZ B;  2FJ2 A;  2K28 A;  1CA6 A;  2AQ1 B;  2PCF B;  2QGQ A;  3OHX C;  2Q2H A;  3AQQ A;  1FGU A;  5T1I A;  3TSS A;  5C4Z A;  1I3Q B;  1W6K A;  3VA5 A;  1TS3 A;  3MTS A;  2L5T A;  5FLX L;  1JJG A;  1K83 B;  4X64 Q;  4KD3 A;  1KC8 C;  1Y1W B;  1HQR D;  2IPK D;  3I73 A;  4OXP A;  1SNC A;  4QCL A;  4A75 A;  5ELO A;  4JI7 L;  2SOB A;  2F3I A;  2PO4 A;  1XNQ L;  4A3I B;  4LF4 L;  1EYD A;  5KNB A;  4HJA A;  4QMG A;  1EZ8 A;  4JI0 Q;  5LMN L;  4GLV B;  1TVX A;  2F0P A;  5CBA E;  1CSQ A;  2QCP X;  4R4C A;  1GJX A;  1TII D;  4OO1 H;  1IZ6 A;  3H6M A;  1Y1V G;  1EIH A;  3V05 A;  5M3M H;  2OCE A;  1VQN A;  1E1T A;  1F77 A;  2XSC A;  3LNN A;  4R4I A;  4TSS A;  3BVZ A;  5ELE A;  1PVO A;  1XNR L;  4JI8 L;  1LT5 D;  2WAQ G;  4XDX A;  3X3M A;  2KCT A;  3S16 B;  4IUN A;  4GNX B;  3NBI A;  4R8N A;  4B08 A;  4C3I B;  1NR4 A;  4HJ9 A;  4FXD A;  4X6A H;  1IW7 D;  3W1B A;  4XQJ A;  1H9K A;  2B63 H;  3W2D A;  1NE3 A;  4GN4 B;  4HR7 B;  1PTO B;  3GTP B;  3PO3 B;  2A69 D;  4DV5 Q;  1MKH A;  4POG A;  4B3R Q;  2WFW A;  1XXG A;  4DV1 Q;  2JA6 B;  4GKK Q;  4DR3 L;  3TP8 A;  1IW7 C;  4JBW A;  5H1S E;  5C3E G;  1QNK A;  2M00 A;  4HID A;  4LF8 L;  3N6R A;  1JOK A;  3BS1 A;  2K01 A;  5EPJ A;  3T13 A;  4A93 B;  1JMC A;  4B3T Q;  1JWU D;  3CQZ B;  4JBM A;  1VS0 A;  3B6Y A;  2UXB L;  2XGT A;  4JV5 Q;  4B3S Q;  3SR1 A;  5C4X H;  4DR4 Q;  1J5E L;  2K05 A;  2R7Z G;  3WWV A;  4DXG A;  4CGY B;  4DUZ Q;  2ZXO A;  5CR3 A;  1WTQ A;  1EWC A;  2RVL A;  4JI1 L;  1LTA D;  1LV9 A;  2F0W A;  2RKS A;  4ZUJ A;  4JBJ A;  4LUO A;  4OHJ A;  2UXC Q;  3MEH A;  3H3V H;  1BQQ T;  4C3J B;  4A76 A;  3BDL A;  3KDF A;  3T4A C;  1KNE A;  2MQH A;  3DWA A;  4OON A;  4LUV A;  1YHA A;  3PSI A;  2PI2 E;  1B1Z A;  1WTP A;  1OXT A;  2CW0 C;  4CJ2 C;  1WFQ A;  4HCS A;  1HR0 L;  2YV5 A;  3S1M H;  1PDQ A;  4J15 A;  2VUM B;  1VQ8 A;  4X64 L;  3EBE A;  1CHP D;  3AU7 A;  3LWE A;  4CDE C;  1PYB A;  1IBM Q;  4CDC C;  2HQL A;  1EFI D;  2UU9 Q;  3S1N B;  2B2U C;  2IHF A;  1L0X B;  4K8I A;  4KY7 A;  3GTG B;  3OW7 A;  5EPK A;  4FDB A;  4A3E G;  4YHH Q;  3R3O A;  4BS9 A;  1N8R C;  3O13 A;  3DM3 A;  2B2T A;  2WB1 E;  4DV3 L;  4L8J A;  5JVG 3;  2AWO A;  1VQB A;  1SE4 A;  1CKN B;  2E74 C;  1VF7 A;  3S2D H;  5IIF A;  3L9A X;  4AQY L;  1EY9 A;  1QCB D;  1TU2 B;  2JQO A;  2F4V Q;  2K33 A;  4DPG A;  2F0F A;  3MAQ A;  4CKB A;  2E2D C;  3I4N G;  3J80 E;  2N55 A;  4LFB Q;  4M1U B;  5M3F H;  1XX8 A;  1JWM D;  1BKB A;  1STY A;  3WDN A;  5IYB H;  2L12 A;  3J7Y W;  4IUU A;  1E0B A;  4NMZ A;  1K8A C;  4JYA L;  2WIN B;  2WKC A;  4QB4 A;  4KN4 C;  3I91 A;  4RMF A;  3T1Y L;  1WYD A;  1RCV D;  5GAE C;  3K80 C;  2B2U A;  3GV3 A;  2FMM A;  3BJU A;  2EXD A;  4B3T L;  3I70 A;  1CZW A;  1JQY D;  2GVA A;  5M3M B;  3M85 A;  3W3A A;  4DR4 L;  2Q8T A;  4QUC A;  1PTO D;  5FLX c;  4H0L C;  2MO1 A;  4DUZ L;  4ZKB B;  2LMC B;  2LKV A;  5JEA G;  1T5E A;  1VQA A;  2K1B A;  2NVX H;  1YJW A;  3LWU A;  1CQF A;  1GUT A;  1QZG A;  1KDB A;  2B63 B;  1A0I A;  2HCI A;  2HIV A;  1Y69 U;  3A55 A;  4DNI A;  2FMC A;  3D6W A;  3F2D A;  2AQ2 B;  3CHB D;  2A8V A;  4RKB A;  1K9M C;  1IBL L;  4OEM B;  2F0D A;  2EVB A;  4GOP B;  4A3J H;  3VA7 A;  4K5X A;  3OYY A;  5COR A;  4A3C G;  4DA2 A;  4KD4 A;  5AJ3 Q;  1MJC A;  1ICF B;  1L0W A;  4LW1 A;  1U4L A;  1PTO F;  5KEE A;  1R4P B;  4BXX G;  1CTM A;  1YBY A;  5C4X B;  3C1E A;  1IBM L;  3MHB A;  4V0B A;  4CDD C;  5IP9 H;  1B4O A;  4P71 A;  2JA8 G;  1II3 A;  2XN9 C;  1IL8 A;  2IJ0 A;  3GV6 A;  5C0X H;  4X3K A;  1V43 A;  2ENB A;  3HKZ G;  4X62 L;  3DWP A;  3QG1 A;  2PNH A;  4ME5 A;  4NXM Q;  3NQT A;  2MGS A;  4DKA C;  5DM6 3;  1O7I A;  4BBS B;  3NHH A;  5KND A;  4QUF A;  4QGU A;  2IX1 A;  3F2U A;  2KOL A;  4APV A;  1VQD A;  2NVY H;  1SFO H;  4JI4 L;  4F88 A;  2KJX A;  5DM7 3;  4U67 3;  3S1M B;  5LMU L;  3KF8 A;  1BCP B;  2KCC A;  3Q6S A;  1GUG A;  4LFB L;  4DNR B;  4KY6 A;  3A7L A;  2PW5 A;  4ZQ3 A;  1SE2 A;  4ZAI A;  2VXW A;  2EYJ A;  1UE5 A;  1IXR A;  3NE5 B;  1BUV T;  1JE4 A;  1UE6 A;  5I6Y A;  3ICE A;  2I5H A;  4K2K A;  3R93 A;  1QVG A;  3RMH A;  2WB1 B;  1VF5 C;  5IWA Q;  1WOC A;  4IFD G;  1LTG D;  1SYC A;  1Q8K A;  2IY5 B;  2HIX A;  3NPP A;  3PO2 H;  5FLM H;  3QJY A;  3J81 j;  3S2D B;  4DK1 A;  2X6G A;  1PRT F;  3PQI A;  4S3S A;  1I4Q A;  4OIJ A;  5M5W H;  1NUC A;  1SDF A;  3A5Z B;  2AHO B;  4A3B G;  1WD1 A;  5K36 G;  1K0S A;  2DNE A;  4A3K H;  4EVO A;  1KQS A;  3GQB A;  3GDE A;  3GTL H;  5A35 A;  1D8L A;  4JG2 A;  5M3F B;  4A3L H;  3SK8 A;  1DOL A;  2K5V A;  3F2C A;  4DR5 Q;  3NQI A;  2BH8 A;  3RR5 A;  1PFM A;  1EOV A;  5CV7 A;  2VY3 A;  3RZO H;  1L0Y B;  4R4O A;  2E2J H;  3H15 A;  5E4W C;  5BN4 A;  5BR8 L;  5AJ3 L;  1TS2 A;  2B3G A;  4MIU A;  1O80 A;  5C44 G;  1XMO Q;  4QIW E;  3ERS X;  4KJN A;  4Q5V A;  2EJF C;  4C3H G;  3IKJ A;  4NP5 A;  2E8G A;  4F7X A;  3S9W A;  2O5I C;  2D62 A;  1Y1V H;  3OMC A;  2OF1 A;  2J7Z A;  4K6D A;  2NVX B;  1J9O A;  5EKK A;  3S2H H;  3MFY A;  4GZY C;  2VNU D;  4UPA A;  4FXG C;  3M7N A;  5LMN W;  2PPB C;  3URY A;  2ZTC A;  2E2H H;  4NXN Q;  3HS0 C;  1HCZ A;  5CC4 A;  3F1Z A;  4EGV A;  4A3J B;  4GOP C;  4KHP Q;  2QF7 A;  2V4D A;  4DAP A;  4A3F H;  2OQK A;  2UUA L;  1TWA H;  2C5C A;  1I50 H;  1LTB D;  5I4D A;  1UUP A;  3EJI A;  4MZ9 A;  3CCJ A;  1BBW A;  2Q8I B;  3SXH A;  4PMB A;  3OWE B;  2JN4 A;  1LAC A;  3MXN A;  4G7H C;  3QWN A;  1VMP A;  4K0K L;  3T1H L;  1FVI A;  5CBE E;  5GRO A;  5IYD H;  4IFD I;  1SLJ A;  3I7F A;  5IWA L;  3CCV A;  1JJ2 A;  3GD7 A;  1ENC A;  1B44 D;  1BOS A;  1RJT A;  3HOU G;  1RTN A;  5CV5 A;  3H3V C;  2JA5 G;  1QVF A;  1W3S A;  4PMW A;  1BCP D;  1I4R A;  1OXX K;  2PZU A;  2ZJP A;  1RF2 D;  4L5T A;  1JE5 A;  3KJP A;  3TS0 A;  4DU9 A;  2EZV A;  4JOI C;  2NYZ D;  2NVY B;  5IT9 E;  1SFO B;  4LF9 L;  4P75 A;  5FO8 B;  1HQM C;  5M5Y H;  1QB5 D;  5ISR A;  4FVM A;  2UXD L;  1K8M A;  5KYI A;  4DR5 L;  5I2X A;  1R4Q B;  1NJI C;  5C4H A;  1JT8 A;  1PFN A;  3ULJ A;  1SNO A;  1TWH H;  2F0K A;  1JIC A;  3IFD A;  4I7A A;  2F0N A;  4UP9 A;  2BH2 A;  2I5L X;  3KFU A;  5IGF A;  2K04 A;  4IZ8 A;  1Q12 A;  3TP5 A;  1A62 A;  2R92 H;  4O42 A;  5HUR A;  4O1N A;  1YIJ A;  4P72 A;  1LTT D;  4OWT B;  1XMO L;  3PO2 B;  1PFB A;  4O0A A;  3G48 A;  1YVC A;  2NVQ H;  2JEA I;  1HR0 W;  3L2P A;  4BY7 G;  2NN6 G;  2EOT A;  5M5W B;  4RGM A;  1IYJ B;  3SK5 A;  3JAM E;  2JSO A;  4JI7 Q;  2D2C C;  3HOY G;  1GHJ A;  1JCK B;  2QA4 A;  1C9O A;  4JOI A;  1P16 A;  3R2T A;  1EQQ A;  3DM1 A;  2F0Q A;  1XNQ Q;  4LF4 Q;  1KHI A;  3GTL B;  1DON A;  5LMN Q;  2L11 A;  1FJG L;  2RDG A;  1TT2 A;  1E2V A;  4FXK C;  5I9P A;  2I46 A;  2NZ1 D;  4TKO B;  5C5M A;  4NB3 A;  3RZO B;  2BDN A;  1LO5 D;  3IAY A;  1UEA B;  5F2D A;  4EQO A;  4OEL B;  1XNR Q;  1GHK A;  3RN2 A;  3GTQ H;  2SDF A;  4JK1 C;  4QIW B;  2CWA A;  1FNV A;  1X65 A;  5D3D A;  3CCE A;  4WJW A;  3K81 C;  2VQF Q;  1TS5 A;  1BF4 A;  3U9O A;  4LF7 L;  2H1E A;  3VR5 A;  3BZC A;  3D6C A;  3HRZ C;  3M4Q A;  2CH4 W;  4HJ5 A;  1DM0 B;  2E76 C;  4KI0 A;  3STB D;  3HOW G;  2XWJ B;  4DK3 C;  3K58 A;  2F0U A;  2F0T A;  2A73 B;  1XTD A;  1VMC A;  3EA6 A;  3CRL C;  3FEW X;  2XTI A;  2V1C C;  1BNZ A;  3S2H B;  5EJW A;  1RL2 A;  4LF8 Q;  1SSO A;  4HSV A;  1Q82 C;  3KUP A;  1K3B C;  4QF4 A;  3J80 L;  4X3U A;  2PMZ E;  1STA A;  1CK1 A;  1YZ6 A;  2E2H B;  2UXB Q;  1KL9 A;  1SYG A;  2SEB D;  4CDF C;  5ELD A;  3KF6 B;  2FHT A;  1KAA A;  3VYR A;  1J5E Q;  5IGC A;  2CHB D;  2ZXR A;  1CZG A;  2WP8 J;  4WFN 3;  4DAM A;  4A3F B;  1S5E D;  5J22 A;  1CM9 A;  1TWG H;  1L1O B;  1I50 B;  3KK7 A;  4KK7 A;  4LMQ D;  1XPO A;  1WCM G;  2TMP A;  2ZT9 C;  4V19 0;  1N33 L;  3GTK H;  3S1Q B;  5LL6 X;  3CKI B;  2RCF A;  4JI1 Q;  4LF5 L;  1PYW D;  2F3W A;  1F9S A;  4K2L A;  4YWM A;  1AH9 A;  1QJO A;  4YWL A;  4A3C H;  2OEO A;  1ONL A;  2JXM B;  4WRD A;  3PGZ A;  3PCO B;  2R61 A;  2L4N A;  2PQA A;  4IUQ A;  4FYD A;  1H95 A;  1E7Z A;  1X3G A;  4R4T A;  3G6E A;  2NTT A;  1MD2 D;  2QDB A;  2N3S A;  5I2Y A;  3PF5 A;  2AKW B;  5IYC H;  1G2S A;  5L37 A;  4MHE A;  4H13 C;  3AB9 A;  1HR0 Q;  2NN6 I;  2EY6 A;  2VZA A;  5KYL A;  3H0G G;  1U5K A;  2F0V A;  3ONA B;  2K14 A;  5E4X A;  1CSP A;  3X3N A;  3M9B A;  4B9X A;  2E5L L;  4IQZ A;  4X3T A;  4L5S A;  5M5Y B;  3CD6 A;  5DLQ E;  2Q2T A;  1A8V A;  2B2W C;  3UDF A;  3ER0 A;  3AEV A;  3CCR A;  1JB3 A;  1STB A;  2DJG C;  4JVZ A;  4KKS A;  1EOT A;  5ELB A;  3GTO H;  2ZJR A;  2Z6B A;  4UHV A;  2CWP A;  4DV3 Q;  1TWH B;  3QB3 A;  1AE2 A;  1LUZ A;  2AUK A;  4UAI A;  2F4I A;  2R93 G;  1X3Q A;  4ZUI A;  1QOH A;  1B9M A;  4AQY Q;  3GTM H;  3KBX A;  1X3F A;  2NBF A;  1D5X C;  1XTC D;  2R92 B;  5M9O A;  1GOZ A;  5CV9 A;  5CGK A;  1VQI A;  1ASZ A;  3HOX G;  4EQP A;  3J7A V;  4DR1 Q;  4KKU A;  4AYB G;  1D2B A;  2VQF L;  4DNT B;  1B9N A;  2NVQ B;  3FKI G;  3KBG A;  1HZB A;  3AMU A;  1NSN S;  1SRU A;  1NMG A;  4IFD H;  5ELC A;  1A2U A;  1IBK L;  4JI5 L;  2SNM A;  5EPL A;  3T51 B;  5G3L F;  4JYA Q;  5IP7 H;  1SJE D;  3T53 B;  4XQQ A;  5C0X J;  2AUJ D;  5D3I B;  3T1Y Q;  3HOV G;  1BVS A;  1VQL A;  1E3P A;  2B2W A;  3K0X A;  2G5D A;  1HTL D;  1STE A;  2A69 C;  2QEX A;  1VQG A;  5FK9 C;  1G91 A;  3AYH B;  4A3B H;  2B29 A;  4RGN A;  3VR6 A;  4A3D G;  5K36 H;  3SEB A;  1HH2 P;  2EJG C;  3PUX A;  2H4O A;  2D5D A;  2ZTD A;  2DJF C;  4DAY A;  3IL8 A;  1WTX A;  1WTR A;  3GTQ B;  2HDM A;  5IGE A;  4BY1 H;  3OW2 A;  2Y0S E;  3NBH B;  5CYU A;  2GVB A;  1YHQ A;  2AWN A;  1L2F A;  1U4R A;  1V1P A;  4EX5 A;  3HOZ G;  1V1O A;  4A4I A;  2F03 A;  2L55 A;  3RLF A;  3ZJY C;  1B2T A;  1DGS A;  2NZO A;  2I07 B;  1IBL Q;  1N34 Q;  5DEH A;  4KY5 A;  2MJ8 A;  4L5R C;  1Y8P B;  4C3H H;  1C8C A;  4DV6 L;  3DWQ A;  2PMZ B;  3Q0A A;  4A3G H;  5C5L A;  4BA2 I;  2PQE A;  2D0P A;  1Y1W G;  4A3M H;  2A19 A;  2CFM A;  2K52 A;  1O7L A;  2JJQ A;  3M4O H;  1D5M C;  2EYF A;  1VQJ A;  2F0I A;  3I56 A;  4A3I G;  1EIG A;  3KYH C;  2XVS A;  1PRT B;  2X6L A;  1L1O C;  3GTK B;  1WTV A;  1FNU A;  2EY2 A;  4X62 Q;  1YNJ D;  4PNY A;  4C56 C;  2JA7 H;  1Y8N B;  4OGQ C;  3TRE A;  2BA0 A;  4RA8 A;  3U58 A;  3RN5 A;  4HSP A;  3M7G A;  2RSO A;  2VQE L;  1WD0 A;  1J8I A;  5T1G A;  5D65 A;  3T16 A;  2ID0 A;  4KN7 C;  4C3I G;  2EXZ A;  3RNU A;  1YNJ C;  1X9N A;  2HDL A;  2RA4 A;  4JI2 L;  1PXU A;  1CQV A;  1XMQ Q;  2RHQ B;  1A3V A;  1O7Z A;  4JI4 Q;  1TWC H;  1OTC A;  2JP1 A;  1S4Z A;  1LYL A;  3EFX D;  4DR1 L;  3PO3 G;  5KRU A;  5LMU Q;  5M5X H;  1UEB A;  2A6H D;  2JA6 G;  2BOS A;  1TKW B;  4A93 G;  1SAP A;  1PYS B;  1A3T A;  1D7Q A;  2Z4I A;  2IWH A;  5JOB A;  3KLS X;  4UDU C;  4DV0 L;  3GTO B;  4GN5 A;  3A5U A;  1EQT A;  1C7Y A;  1H9S A;  4YCV A;  3SK4 A;  4QL5 A;  1OXV A;  2XRS D;  1NCV A;  3DHQ A;  3GTM B;  2BCO A;  4X66 L;  3OIQ A;  2K75 A;  3A56 A;  1SYD A;  4GNX C;  3QIA A;  4M8A A;  4F87 A;  2XIW A;  2F0M A;  1KLG D;  4C3J G;  1F9Q A;  1QUQ B;  1PTO C;  2IX3 A;  1UWV A;  1VQM A;  1TS4 A;  2HD3 A;  4E6I A;  1TQO A;  1N34 L;  5K5P A;  5IT9 L;  2KED A;  5HGT A;  2NVT H;  2VW9 A;  2NN6 H;  3KLS A;  5JPN C;  2VUM G;  2EY5 A;  3G6J B;  1EYG A;  4LWC A;  2LSS A;  5BR8 Q;  3VDY A;  2MNA A;  3GP7 A;  3HOY H;  4A3B B;  4RHR A;  2N8N A;  1D5Z C;  2ICE C;  1EYA A;  2B2Y C;  2Y0S B;  1ENA A;  1JOQ A;  3FVQ A;  4BY1 B;  4DXF A;  3CXC A;  3E3X A;  4LNQ A;  3PMF A;  4N9P A;  4KMU C;  2O2L D;  4NPS A;  2UUC L;  3JC6 6;  1LLR D;  1G2T A;  2NUC A;  4IPD A;  2EY1 A;  2M9V A;  3JAM L;  4C3H B;  4A3G B;  3OWF A;  4ULL A;  1XMQ L;  1HRJ A;  4GKJ L;  1KXL A;  2CQO A;  3OIP A;  1PRT D;  1NAP A;  4A3M B;  1WVL A;  5HGQ A;  2UUA Q;  2UUB L;  1V8Q A;  1EZ6 A;  3RLO A;  4TVA B;  1GUS A;  3M4O B;  4CKE A;  1IYU A;  1SEB D;  2HQE A;  3SGI A;  1PZK D;  5GAH C;  3CRK C;  4FF1 A;  2DN8 A;  1RDP D;  2B2Y A;  2F0O A;  4K14 A;  3TQY A;  4DUY Q;  4U68 A;  3UE0 A;  5COY A;  3S14 H;  1PLF A;  4K0K Q;  4JI3 L;  3T1H Q;  4OO1 G;  3K5M A;  4PZ7 A;  1K8O A;  5M3M G;  1MGS A;  2JA7 B;  4AIM A;  2JK8 A;  2KA7 A;  3WOF A;  4WJ4 A;  3UE1 A;  1GXD C;  1TXY A;  4K5W A;  5FJ8 H;  4BBR H;  2B8G A;  3HKS A;  1SNQ A;  4IPC A;  3GTJ H;  3I4M H;  4IPH A;  1JJC B;  3HZX A;  4P73 A;  3UI2 A;  2B63 G;  1DOM A;  1HPC A;  4PV1 C;  4TRD A;  2VS1 A;  1TWC B;  1H9R A;  3NEM A;  4LF9 Q;  2KBN A;  1ILP A;  3K0Y A;  3H94 A;  2UXD Q;  4IN3 A;  5M5X B;  1S72 A;  1C0A A;  4N8X 1;  1AW7 A;  5BN5 A;  3K57 A;  4C1N K;  3CP0 A;  3H91 A;  4HCE A;  4DV7 Q;  1YNX A;  4KJO A;  2C35 B;  1B50 A;  3HFZ B;  4UP8 A;  3P7J A;  1S3O A;  5EBD A;  2K5Q A;  3H09 A;  5C4X G;  1VCI A;  3K6O A;  3R2I A;  3P75 A;  1CKO A;  2CVR A;  1C48 A;  2G9D A;  1NY4 A;  4DN4 M;  2MFI A;  1E22 A;  5C6A A;  1B70 B;  3VYS A;  1OXU A;  1CKN A;  2HT1 A;  4DV4 L;  3MFG A;  5ELN A;  1EYC A;  1MJE A;  1GM5 A;  2X69 A;  3CW2 C;  3CCM A;  1KDA A;  5J39 A;  5KIX A;  2PNR C;  4BBS G;  4OWW B;  1FJG Q;  4H44 C;  4DR7 Q;  2WAQ E;  2K4K A;  2NVT B;  2D0O A;  3FKI H;  2HCC A;  4FF3 A;  2DUD A;  3J81 E;  3OTO L;  3MVV A;  1Q86 C;  4MTK A;  1F2Z A;  5C3E H;  4LF7 Q;  1FD7 D;  2RCN A;  2CCZ A;  4OO1 I;  2WB1 G;  4DUY L;  3NEL A;  1Y8O B;  2FIN B;  2R7D A;  4LF6 L;  3FHW A;  4A3D H;  1R9T H;  2MHV A;  1Q1E A;  4G57 A;  3RUZ A;  2K50 A;  4F8M A;  4OL7 A;  2F3V A;  2Z6K C;  2K5N A;  5IT9 c;  3K7U C;  4NDX A;  2R7Z H;  3EQL C;  4IOC A;  5JJL A;  2E75 C;  1K28 A;  2B39 A;  2R7F A;  3HGB A;  1M90 C;  2CKZ B;  2YTY A;  4DF7 A;  1Z7T A;  3D4D A;  1QIL A;  5BN3 A;  4AH6 A;  3ND8 A;  1EIY B;  1HTP A;  5I9O A;  2PZT A;  1HZ9 A;  2F52 A;  4GOP A;  2Z1C A;  2A6E D;  4X65 Q;  2NB0 A;  5M3F G;  5GAG C;  1VQ9 A;  3D0F A;  5IYB G;  1A15 A;  1N33 Q;  1Q46 A;  1ET6 A;  1BCP C;  2K5D A;  4LF5 Q;  4JC0 A;  2OQ0 A;  4C1N I;  4DV7 L;  1HNW L;  1A6X A;  3M3Y H;  3CCS A;  1HUN A;  2IT1 A;  2A6E C;  2KHS A;  1H9J A;  3S14 B;  3OOC A;  4RFB A;  2BA1 A;  4YCU A;  1GUN A;  3NXW A;  3JAM c;  3L3O C;  2KQ3 A;  3M4P A;  1HA5 A;  2EJM A;  3J7A F;  2Z6K A;  2ZXP A;  1Q8I A;  1U4M A;  2WAC A;  3A0J A;  4XXE A;  2NWG A;  4BBR B;  1E1O A;  2F0E A;  1EWI A;  2JEB I;  2ZM6 L;  2F1M A;  1RD9 D;  3TDQ A;  3GTJ B;  4DAV A;  2PI2 A;  4Z9C B;  3I4M B;  4A3E H;  3JAM i;  2VB2 X;  4HTH A;  3H3V I;  3I2Z A;  4GLX A;  1HNZ L;  2E5L Q;  3DMU A;  3W5O A;  1X55 A;  4A3K B;  1KAW A;  4IPG A;  1NMF A;  1EIF A;  1G29 1;  2N88 A;  4X3S A;  2F0S A;  5JJI A;  3U4V A;  1HHV A;  1D1K A;  2P5Z X;  4DR7 L;  3CPW A;  3KDF B;  3LGJ A;  3K5N A;  3A54 A;  3I4N H;  1XYI A;  2E2J B;  4HMI A;  2ASB A;  3Q24 A;  4CKC A;  4R8I A;  1YJ9 A;  1IL2 A;  1SND A;  3TZD A;  3R8B A;  3S17 H;  2OTL A;  1VQ6 A;  3QO2 A;  5AFW A;  3V96 A;  1Q90 A;  2JYO A;  2NZH A;  3FPU B;  3UDI A;  3T56 B;  5JJK A;  3CQZ H;  2ATW A;  3A8J E;  4CHT B;  3VR2 A;  5C0X G;  3FDT A;  1WJJ A;  1ASY A;  1XPU A;  3DLL A;  4KHZ A;  1Y1V B;  1HZA A;  4IJH A;  1PH3 A;  1IBK Q;  4JI5 Q;  1DZ1 A;  2FFK B;  2HHH Q;  1SYB A;  2K7V A;  3EN2 A;  4XTC S;  1EU3 A;  1JOR A;  3CAM A;  2BE5 D;  4R1J A;  2WAQ B;  1HFG A;  1PH4 A;  4OWX B;  3STB C;  4EQ5 A;  1PZJ D;  5JEA H;  1MBY A;  2AMC B;  4ZLT F;  1SN8 A;  1N36 L;  1U4P A;  2A5H A;  4DR6 L;  3UDX A;  4ODG A;  3AFQ A;  1CFM A;  4X65 L;  3K7A H;  4R4Q A;  4DR2 Q;  1TWA B;  2KEN A;  3L7Z C;  3CF5 A;  3ERQ A;  4ZYS A;  1I4P A;  1LTI D;  1Q1B A;  2EE1 A;  3E5S A;  5C3E B;  4ME3 A;  3K5O A;  2AQ3 B;  4IAL A;  2KCN A;  3V2T A;  1B3A A;  2Z0S A;  4JCV E;  3TN2 A;  1X6O A;  4YY3 L;  4R9W A;  4LFA L;  1IYV A;  2YU9 H;  5FO9 B;  1QNU A;  1MI2 A;  2RF4 A;  4DV2 L;  1R9T B;  4BXX H;  3TRZ A;  1YJN A;  3RZD H;  1SE8 A;  3DEP A;  3I72 A;  4DV6 Q;  3PO2 G;  2KVM A;  4JPB W;  2R7Z B;  4Y7N H;  2EYO A;  1CKM A;  4FO2 A;  2JA8 H;  2ICI A;  3HEJ A;  1LTS D;  2EIF A;  1XPR A;  5ELF A;  1QZH A;  1N32 L;  1FGB D;  3P20 A;  1KIX A;  1UAP A;  1AE3 A;  3HKZ E;  1STN A;  4ABN A;  4A3L G;  5IY0 A;  3ZYY X;  1T9H A;  3MXU A;  3SK6 A;  1HFN A;  5G3L D;  3MXG A;  4CBV A;  1PH6 A;  3D3R A;  1JC7 A;  2MUY A;  4PMC A;  1S5B D;  3M3Y B;  2PYK A;  5HY6 A;  4UY8 C;  2VQE Q;  4I65 A;  4IO9 A;  1Z6H A;  3D31 A;  1PH1 A;  1TY0 A;  4FF4 A;  1SNM A;  4JI2 Q;  1ZKO A;  3U4Z A;  2K6A A;  2O5J C;  4P74 A;  3QOL A;  4B3M L;  1EY7 A;  5C0X I;  1K73 C;  3W1G A;  4FNF A;  4QY7 A;  5EAY A;  1GO3 E;  2OWO A;  3I8Z A;  4LFC Q;  1DJR D;  4A3E B;  3M4Y A;  1HZC A;  1ENF A;  2HHH L;  1A3U A;  2A68 D;  1W6J A;  4H02 A;  1DYQ A;  1PA6 A;  4LAA A;  4DV0 Q;  5FOB B;  3PIO A;  1G8Z D;  5EGT A;  4ALP A;  3OPO A;  1JOO A;  2MP1 A;  1AN8 A;  2A68 C;  1BO0 A;  4G7O C;  4A3F G;  2KUM A;  5E3F A;  3I4N B;  1U0L A;  4RGO S;  1BDO A;  4XQN A;  1N9W A;  4X66 Q;  3DXJ C;  3I90 A;  4DR2 L;  3S17 B;  2WKD A;  1SBB B;  2ALY B;  4Y52 H;  2LXJ A;  3KF8 B;  3VR4 A;  2WII B;  4P2C B;  3TEH B;  2E2I H;  2F0J A;  5IYD G;  4IOA A;  5A2Q E;  4IUT A;  1C4Q A;  5D14 A;  1YI2 A;  5C44 H;  1B8A A;  3EIV A;  4OX9 Q;  2Q8R E;  2QW7 A;  1W2B A;  3OSO A;  1EY6 A;  4B9W A;  5CV6 A;  3S24 A;  5EKL A;  1RIP A;  2B2T C;  4PZ8 A;  4RG1 A;  2A74 C;  1EL0 A;  1LT6 D;  1SE3 A;  2B8F A;  3HP3 A;  3LX0 A;  2CW0 D;  5IE8 A;  4L5Q A;  2LY7 A;  2TSS A;  3MEF A;  2F0G A;  1HNX L;  4BBS H;  1EWH A;  3PUY A;  3CMA A;  4GN3 B;  1KD1 C;  3K7A B;  2H5X A;  1TWG B;  1SJH D;  3VR3 A;  2F0L A;  4YWK A;  1HA6 A;  2XWB B;  1K8G A;  3E6Z X;  2UUC Q;  2OTJ A;  4KV6 A;  2IX0 A;  4IUR A;  3L0O A;  1WTW A;  1AFP A;  2JE6 I;  3NSW A;  2YU9 B;  3P1H A;  3J80 c;  1B53 A;  1BR9 A;  3E0J A;  2R92 G;  1KTK A;  1LM0 A;  1BXT A;  3PIO 3;  3RZD B;  1VQO A;  3WOE A;  1OXS C;  4GKJ Q;  3MWY W;  3S15 H;  2CH4 A;  4Y7N B;  4LK1 C;  4JI0 L;  2YTV A;  4POF A;  2JA8 B;  2G9H D;  1STH A;  4DGZ A;  3J80 i;  1TR5 A;  3KJO A;  2UUB Q;  3CC4 A;  1XJV A;  5I6W A;  3HKZ B;  1I94 Q;  5JPM C;  1RTO A;  3D4W A;  4N8F A;  1PHJ A;  1PFS A;  4LFC L;  3PIP A;  1F9R A;  3FP9 A;  1NR2 A;  4HIO A;  3KF6 A;  1ZYR D;  3BDO A;  1HUM A;  2B2V C;  3HOU H;  2JA5 H;  1DCZ A;  3GO5 A;  3TME A;  3NUC A;  4JI3 Q;  2L15 A;  3MC0 B;  2XRQ D;  4HJ8 A;  1L1O A;  2A6H C;  3NTK A;  5CMD A;  1QE6 A;  3J81 L;  2EQS A;  1FR3 A;  1PV4 A;  1PZI D;  1CT1 D;  1ZYR C;  4DV5 L;  2ZJQ A;  2D9U A;  1Q81 C;  4L6T B;  3HG9 A;  3VYT A;  4B3R L;  4DV1 L;  4GKK L;  1AEX A;  4TQU S;  4CJ1 B;  4PZ6 A;  3TS2 A;  2L0C A;  1B3Q A;  1H9M A;  2PZW A;  3OMG A;  3K59 A;  5LL6 S;  1I6H H;  3A8I E;  2KCM A;  2YYZ A;  1K3R A;  3MA2 B;  4JV5 L;  4B3S L;  4JBK A;  1LT4 D;  1SMY D;  1X3P A;  1KRS A;  4FP5 D;  3MXN B;  3G4S A;  4HAE A;  4OX9 L;  2EYP A;  1Z9F A;  3BYY B;  2B2V A;  4BY7 H;  1GUW A;  1KDC A;  4DK0 A;  3NWS A;  2HUG A;  3K5L A;  3J7Z C;  1G51 A;  4DK6 C;  5EQ0 A;  1SMY C;  2XNA C;  1Z47 A;  4LJZ C;  1U9R A;  2UXC L;  1EUJ A;  5E7N A;  4Q0F A;  5FLX E;  1QWY A;  3TP7 A;  3ERO A;  1P8L A;  3KLW A;  2DGY A;  1EQV A;  1SYE A;  1ZEQ X;  1MIU A;  4RGT A;  4DV4 Q;  3TBI B;  2C9O A;  3A7A B;  5C4J H;  4IUP A;  4G4K A;  3PIP 3;  1YHB A;  1DOK A;  4GNX A;  4KKT A;  1HJP A;  1NBW A;  1G6Z A;  2L9H A;  2E2I B;  2ES2 A;  1TWF H;  2QKI C;  1AP0 A;  5IYC G;  4KLK A;  3PUZ A;  2Z8L A;  2BDO A;  1D1I A;  5C44 B;  3BU2 A;  5GQO A;  4L63 B;  3BYT B;  4BA1 I;  1EFW A;  4XIG S;  2UU9 L;  2GA4 B;  1EY4 A;  4K6L A;  3PF4 A;  1PH7 A;  1VQ7 A;  1LT3 D;  1D6E C;  3HOW H;  4YHH L;  1V9P A;  1VQF A;  1I94 L;  3OTO Q;  5E1F A;  4BWG B;  4XYQ A;  1M1K C;  3F2B A;  5NUC A;  1M4V A;  1WI5 A;  2J4X A;  5CV8 A;  1GUO A;  1PRT C;  4ILW A;  2F4V L;  3E9I A;  1Q3L A;  5KNC A;  4LF6 Q;  3Q8D A;  3NBH A;  2Q2I A;  1GD7 A;  5LHY 1;  1X56 A;  1WCM H;  3NTH A;  5DNF A;  2L1B A;  1S5D D;  2I0Q A;  3A8K E;  1BBU A;  1NTG A;  3D8G A;  3RD4 A;  1EY8 A;  1UE7 A;  5JAV A;  3D4R A;  1QG7 A;  1OO9 B;  2OXP A;  3S15 B;  3J7A 5;  1HXY D;  1UE1 A;  4K5V A;  1EU4 A;  5EKI A;  1VQ4 A;  3C3L A;  1IHZ A;  1Y14 B;  1ML0 D;  5TSS A;  3BZD B;  3K8A A;  5IP7 G;  4XYO A;  1HNW Q;  1SNP A;  1M8A A;  3HOU B;  1VQE A;  5IGD A;  2JA5 B;  1PH9 A;  1DD2 A;  5KGU A;  3TZU A;  4I7Z C;  4QQB X;  3H0G H;  1AZP A;  1KLU D;  3DUZ A;  3MXP A;  2K32 A;  4UP7 A;  2KHI A;  5J1Z A;  4GS3 A;  2WV6 D;  2GN5 A;  2Y0S G;  1G6P A;  1KRT A;  1K0R A;  4O2D A;  5JEA J;  5C3X A;  2ZM6 Q;  4BY1 G; 
#chains in the Genus database with same CATH homology
 1STG A;  3DEO A;  2CQA A;  1E2Z A;  1SYF A;  2SNS A;  1I6H B;  4PQX A;  1T5X D;  4ZKC B;  3SHL A;  1KAB A;  3BVM A;  1JR0 D;  2EYH A;  1RHP A;  2EYM A;  3KLR A;  4BY7 B;  2J0T D;  3NK9 A;  2Z4H A;  1CI3 M;  3HOY B;  4KHV A;  2OT2 A;  1MSG A;  3FPP A;  2RDF A;  1S5C D;  4J8Q A;  3EVQ A;  4H7B A;  1F2Y A;  4RCN A;  1LAB A;  1I4X A;  3QOJ A;  3Q22 A;  5C4J B;  4IUV A;  2IL8 A;  1XWE A;  5EBC A;  5FKA C;  1DXM A;  1O78 A;  4ZRZ A;  4ZK9 B;  1TWF B;  2K5W A;  4YIJ A;  4RCO A;  3VYU A;  1A2T A;  1EEI D;  3C2P A;  4RH6 A;  2DY7 A;  4WOR A;  2EDG A;  3Q23 A;  3BDC A;  3FRP B;  3IFT A;  2KEC A;  1I4G A;  3HOW B;  1FYC A;  1MSH A;  3U9S A;  1TY2 A;  2LS0 1;  3PUW A;  5JJZ A;  3BVG A;  4HMJ A;  4IFD J;  1EY5 A;  3ITP A;  5C3W A;  1ESR A;  3NP8 A;  3FMC A;  4ID6 A;  1ROD A;  3CU7 A;  4EQN A;  2K03 A;  3I3C A;  2LFN A;  1I6V C;  2F0H A;  1S5F D;  4K8J A;  4N9T A;  2RSN A;  4G7Z C;  5A2Q L;  1WCM B;  2MPM A;  2QEJ C;  2RBM A;  1EY0 A;  1E2W A;  2O4X A;  5IGG A;  5CV4 A;  4XT3 B;  1X32 A;  1LTR D;  4XT1 B;  1BCP F;  5IOC A;  1VDZ A;  5IOD A;  1ET9 A;  1V1P B;  2VB3 X;  3C1F A;  1F2M A;  2DNC A;  2KEE A;  5JVH 3;  4KTA A;  4HN7 A;  1PTO H;  3H0G B;  2RDH A;  4RWS C;  1PMR A;  2RQX A;  2IW3 A;  1AZQ A;  1IKM A;  4NW2 A;  4CJ0 B;  4NKL A;  3SVM A;  4HED A;  1IKL A;  3ND9 A;  1SXT A;  2DY8 A;  3TP6 A;  3I4L A;  3NWT A;  3NTI A;  4OIK A;  4J6H A;  1UNS A;  3N52 A;  4DFA A;  4FF2 A;  3G7L A;  1WTO A;  5IGB A;  4RAU C;  2R93 B;  5DAU A;  1F9P A;  1BBX C;  1RKN A;  3C46 A;  1O7Y A;  4C2M B;  3HOX B;  1ZXT A;  4AYB B;  4J1M A;  1YNN D;  2R3Z A;  3FKI B;  2NTS A;  2BE5 C;  1KNA A;  4RHS A;  1ESF A;  3SE0 A;  4RKL A;  1ICW A;  2QIL A;  4MN3 A;  2M2L A;  1CA5 A;  3HOV B;  2EPB A;  5FO7 B;  1EEF D;  1YNN C;  3MZ5 A;  1FNW A;  2R6G A;  1ILQ A;  4A3D B;  1JWS D;  3SDZ A;  3BG3 A;  1CHQ D;  2PW7 A;  1F2L A;  2EYL A;  3PUV A;  1H9S B;  3S1R B;  1I4H A;  3PV0 A;  3HOZ B;  2FJ2 A;  2K28 A;  1CA6 A;  2AQ1 B;  2PCF B;  3OHX C;  5T1I A;  3TSS A;  5C4Z A;  1I3Q B;  1W6K A;  3VA5 A;  1TS3 A;  3MTS A;  2L5T A;  5FLX L;  1K83 B;  4KD3 A;  1Y1W B;  1HQR D;  2IPK D;  3I73 A;  1SNC A;  4QCL A;  2SOB A;  2PO4 A;  4A3I B;  1EYD A;  5KNB A;  4QMG A;  1EZ8 A;  1TVX A;  2F0P A;  5CBA E;  2QCP X;  1GJX A;  1TII D;  4OO1 H;  3H6M A;  1EIH A;  3V05 A;  1F77 A;  2XSC A;  3LNN A;  4TSS A;  3BVZ A;  5ELE A;  1LT5 D;  3X3M A;  4XDX A;  3S16 B;  4IUN A;  3NBI A;  4R8N A;  4B08 A;  4C3I B;  1NR4 A;  4FXD A;  1IW7 D;  4XQJ A;  1H9K A;  3W2D A;  4HR7 B;  1PTO B;  3GTP B;  3PO3 B;  2A69 D;  1XXG A;  2JA6 B;  3TP8 A;  1IW7 C;  4JBW A;  1QNK A;  2M00 A;  3N6R A;  1JOK A;  3BS1 A;  2K01 A;  5EPJ A;  3T13 A;  4A93 B;  1JWU D;  3CQZ B;  3SR1 A;  2K05 A;  4DXG A;  4CGY B;  2ZXO A;  5CR3 A;  1WTQ A;  1EWC A;  2RVL A;  1LTA D;  1LV9 A;  2F0W A;  2RKS A;  4ZUJ A;  4OHJ A;  3MEH A;  1BQQ T;  4C3J B;  3BDL A;  3T4A C;  1KNE A;  3DWA A;  1B1Z A;  1WTP A;  1OXT A;  2CW0 C;  4CJ2 C;  4HCS A;  1PDQ A;  2VUM B;  1CHP D;  3AU7 A;  3LWE A;  1EFI D;  3S1N B;  2B2U C;  1L0X B;  4K8I A;  4KY7 A;  3GTG B;  3OW7 A;  5EPK A;  3R3O A;  4BS9 A;  3O13 A;  2B2T A;  4L8J A;  5JVG 3;  2AWO A;  1SE4 A;  2E74 C;  1VF7 A;  5IIF A;  3L9A X;  1EY9 A;  1QCB D;  1TU2 B;  2K33 A;  2F0F A;  3MAQ A;  4CKB A;  2E2D C;  3J80 E;  2N55 A;  4M1U B;  1XX8 A;  1JWM D;  1STY A;  3WDN A;  2L12 A;  3J7Y W;  4IUU A;  1E0B A;  4NMZ A;  2WIN B;  2WKC A;  4QB4 A;  4KN4 C;  3I91 A;  1RCV D;  2B2U A;  3GV3 A;  2FMM A;  3I70 A;  1CZW A;  1JQY D;  5M3M B;  3M85 A;  3W3A A;  2Q8T A;  4QUC A;  1PTO D;  4H0L C;  4ZKB B;  2LMC B;  2LKV A;  5JEA G;  1T5E A;  2K1B A;  3LWU A;  1CQF A;  1GUT A;  2B63 B;  1KDB A;  2HCI A;  1Y69 U;  3A55 A;  2FMC A;  3D6W A;  2AQ2 B;  3CHB D;  4RKB A;  2F0D A;  2EVB A;  3VA7 A;  4K5X A;  5COR A;  4DA2 A;  4KD4 A;  1U4L A;  1PTO F;  5KEE A;  1R4P B;  1CTM A;  5C4X B;  3C1E A;  3MHB A;  4V0B A;  1B4O A;  1II3 A;  2XN9 C;  1IL8 A;  2IJ0 A;  3GV6 A;  5C0X H;  4X3K A;  1V43 A;  2ENB A;  3DWP A;  3QG1 A;  4ME5 A;  3NQT A;  2MGS A;  5DM6 3;  4BBS B;  3NHH A;  5KND A;  4QUF A;  2IX1 A;  3F2U A;  2KOL A;  4F88 A;  2KJX A;  5DM7 3;  4U67 3;  3S1M B;  3KF8 A;  1BCP B;  2KCC A;  3Q6S A;  1GUG A;  4DNR B;  4KY6 A;  3A7L A;  2PW5 A;  4ZQ3 A;  1SE2 A;  4ZAI A;  2VXW A;  2EYJ A;  3NE5 B;  1BUV T;  1JE4 A;  5I6Y A;  4K2K A;  3R93 A;  3RMH A;  2WB1 B;  1VF5 C;  4IFD G;  1LTG D;  1SYC A;  3NPP A;  3QJY A;  3S2D B;  4DK1 A;  2X6G A;  1PRT F;  4S3S A;  1I4Q A;  4OIJ A;  1NUC A;  1SDF A;  1WD1 A;  5K36 G;  2DNE A;  4EVO A;  3GQB A;  5A35 A;  5M3F B;  3SK8 A;  1DOL A;  3NQI A;  1PFM A;  5CV7 A;  1L0Y B;  5E4W C;  5BN4 A;  1TS2 A;  4MIU A;  1O80 A;  4KJN A;  4Q5V A;  2EJF C;  4C3H G;  3IKJ A;  4NP5 A;  4F7X A;  3S9W A;  2O5I C;  2D62 A;  3OMC A;  2OF1 A;  2J7Z A;  4K6D A;  2NVX B;  1J9O A;  5EKK A;  3MFY A;  4GZY C;  2VNU D;  4FXG C;  3M7N A;  2PPB C;  3URY A;  3HS0 C;  1HCZ A;  5CC4 A;  4EGV A;  4A3J B;  2QF7 A;  2V4D A;  4DAP A;  2C5C A;  1LTB D;  5I4D A;  1UUP A;  3EJI A;  2Q8I B;  3SXH A;  4PMB A;  3OWE B;  1LAC A;  3MXN A;  4G7H C;  3QWN A;  1VMP A;  5CBE E;  4IFD I;  3GD7 A;  1ENC A;  1B44 D;  1BOS A;  1RJT A;  1RTN A;  5CV5 A;  3H3V C;  4PMW A;  1BCP D;  1I4R A;  1OXX K;  2PZU A;  1RF2 D;  4DU9 A;  2EZV A;  2NYZ D;  2NVY B;  5IT9 E;  1SFO B;  5FO8 B;  1HQM C;  1QB5 D;  5ISR A;  4FVM A;  1K8M A;  5KYI A;  5I2X A;  1R4Q B;  5C4H A;  1PFN A;  1SNO A;  2F0K A;  1JIC A;  3IFD A;  2F0N A;  5IGF A;  2K04 A;  4IZ8 A;  1Q12 A;  3TP5 A;  4O42 A;  5HUR A;  4O1N A;  1LTT D;  3PO2 B;  1PFB A;  2JEA I;  2NN6 G;  2EOT A;  5M5W B;  4RGM A;  3SK5 A;  3JAM E;  2JSO A;  2D2C C;  1GHJ A;  1JCK B;  3R2T A;  3DM1 A;  2F0Q A;  1DON A;  3GTL B;  2L11 A;  2RDG A;  1TT2 A;  1E2V A;  4FXK C;  5I9P A;  2I46 A;  2NZ1 D;  4TKO B;  5C5M A;  3RZO B;  2BDN A;  1LO5 D;  3IAY A;  1UEA B;  5F2D A;  4EQO A;  1GHK A;  2SDF A;  4JK1 C;  4QIW B;  1FNV A;  5D3D A;  4WJW A;  1TS5 A;  1BF4 A;  3U9O A;  2H1E A;  3VR5 A;  3D6C A;  3HRZ C;  1DM0 B;  2E76 C;  4KI0 A;  2XWJ B;  3K58 A;  2F0U A;  2F0T A;  2A73 B;  1VMC A;  3EA6 A;  3CRL C;  3FEW X;  1BNZ A;  3S2H B;  5EJW A;  1SSO A;  4HSV A;  3KUP A;  4QF4 A;  3J80 L;  4X3U A;  1STA A;  1CK1 A;  2E2H B;  1SYG A;  2SEB D;  5ELD A;  2FHT A;  1KAA A;  3VYR A;  5IGC A;  2CHB D;  2ZXR A;  1CZG A;  2WP8 J;  4WFN 3;  4A3F B;  1S5E D;  5J22 A;  1CM9 A;  1I50 B;  4KK7 A;  3KK7 A;  4LMQ D;  4V19 0;  2TMP A;  2ZT9 C;  3S1Q B;  5LL6 X;  3CKI B;  1PYW D;  2F3W A;  1F9S A;  4K2L A;  1QJO A;  2OEO A;  1ONL A;  2JXM B;  4WRD A;  2R61 A;  2L4N A;  4IUQ A;  4FYD A;  2NTT A;  1MD2 D;  2QDB A;  5I2Y A;  1G2S A;  4MHE A;  4H13 C;  3AB9 A;  2NN6 I;  2EY6 A;  5KYL A;  2F0V A;  3ONA B;  5E4X A;  3X3N A;  4B9X A;  4IQZ A;  4X3T A;  5M5Y B;  2B2W C;  1JB3 A;  1STB A;  4KKS A;  5ELB A;  1EOT A;  1TWH B;  3QB3 A;  2AUK A;  4UAI A;  2F4I A;  1X3Q A;  4ZUI A;  1QOH A;  1B9M A;  3KBX A;  2NBF A;  1D5X C;  1XTC D;  2R92 B;  5M9O A;  1GOZ A;  5CV9 A;  5CGK A;  4EQP A;  3J7A V;  4KKU A;  1D2B A;  4DNT B;  1B9N A;  2NVQ B;  3KBG A;  3AMU A;  1NSN S;  4IFD H;  5ELC A;  1A2U A;  2SNM A;  5EPL A;  3T51 B;  5G3L F;  1SJE D;  3T53 B;  4XQQ A;  5C0X J;  2AUJ D;  5D3I B;  2B2W A;  1HTL D;  1STE A;  2A69 C;  5FK9 C;  1G91 A;  4RGN A;  3VR6 A;  5K36 H;  3SEB A;  2EJG C;  3PUX A;  2H4O A;  2D5D A;  4DAY A;  3IL8 A;  1WTX A;  1WTR A;  3GTQ B;  2HDM A;  5IGE A;  5CYU A;  2AWN A;  1U4R A;  1V1P A;  1V1O A;  2F03 A;  2L55 A;  3RLF A;  1B2T A;  2I07 B;  5DEH A;  4KY5 A;  2MJ8 A;  1Y8P B;  1C8C A;  3DWQ A;  2PMZ B;  3Q0A A;  5C5L A;  4BA2 I;  2PQE A;  1O7L A;  1D5M C;  2EYF A;  2F0I A;  1EIG A;  2XVS A;  1PRT B;  2X6L A;  3GTK B;  1WTV A;  1FNU A;  2EY2 A;  1YNJ D;  4PNY A;  4C56 C;  1Y8N B;  4OGQ C;  2BA0 A;  4RA8 A;  4HSP A;  3M7G A;  2RSO A;  1WD0 A;  1J8I A;  5T1G A;  5D65 A;  3T16 A;  2ID0 A;  4KN7 C;  4C3I G;  2EXZ A;  1YNJ C;  2HDL A;  2RA4 A;  1PXU A;  1CQV A;  1A3V A;  1O7Z A;  2JP1 A;  1S4Z A;  3EFX D;  5KRU A;  2A6H D;  2BOS A;  1TKW B;  1SAP A;  1A3T A;  2Z4I A;  2IWH A;  5JOB A;  3KLS X;  4UDU C;  3GTO B;  1EQT A;  1H9S A;  3SK4 A;  1OXV A;  2XRS D;  1NCV A;  3DHQ A;  3GTM B;  2BCO A;  3OIQ A;  3A56 A;  1SYD A;  3QIA A;  4M8A A;  4F87 A;  2XIW A;  2F0M A;  1KLG D;  4C3J G;  1F9Q A;  1PTO C;  2IX3 A;  1TS4 A;  4E6I A;  1TQO A;  5K5P A;  5IT9 L;  2KED A;  5HGT A;  2NN6 H;  3KLS A;  5JPN C;  2EY5 A;  3G6J B;  3GP7 A;  4A3B B;  4RHR A;  1D5Z C;  2ICE C;  1EYA A;  2B2Y C;  2Y0S B;  1ENA A;  1JOQ A;  3FVQ A;  4BY1 B;  4DXF A;  3PMF A;  4N9P A;  4KMU C;  2O2L D;  1LLR D;  1G2T A;  2NUC A;  2EY1 A;  2M9V A;  3JAM L;  4C3H B;  4A3G B;  3OWF A;  4ULL A;  1HRJ A;  3OIP A;  1PRT D;  1NAP A;  4A3M B;  1WVL A;  1V8Q A;  1EZ6 A;  3M4O B;  1GUS A;  4CKE A;  1IYU A;  1SEB D;  2HQE A;  1PZK D;  3CRK C;  4FF1 A;  2DN8 A;  1RDP D;  2B2Y A;  2F0O A;  4K14 A;  4U68 A;  5COY A;  1PLF A;  4OO1 G;  3K5M A;  1K8O A;  1MGS A;  2JA7 B;  2KA7 A;  3WOF A;  1GXD C;  4K5W A;  2B8G A;  1SNQ A;  3HZX A;  3UI2 A;  1DOM A;  1HPC A;  4PV1 C;  4TRD A;  1TWC B;  1H9R A;  1ILP A;  3K0Y A;  3H94 A;  4IN3 A;  5M5X B;  1AW7 A;  5BN5 A;  3K57 A;  4C1N K;  3H91 A;  4HCE A;  4KJO A;  1B50 A;  3P7J A;  5EBD A;  2K5Q A;  3H09 A;  1VCI A;  3K6O A;  3R2I A;  3P75 A;  2CVR A;  1C48 A;  2G9D A;  4DN4 M;  5C6A A;  3VYS A;  1OXU A;  3MFG A;  1EYC A;  2X69 A;  1KDA A;  5J39 A;  5KIX A;  2PNR C;  4H44 C;  2NVT B;  2HCC A;  4FF3 A;  3J81 E;  3MVV A;  1F2Z A;  1FD7 D;  4OO1 I;  1Y8O B;  2FIN B;  2MHV A;  1Q1E A;  4G57 A;  3RUZ A;  4F8M A;  4OL7 A;  2F3V A;  4NDX A;  3EQL C;  2E75 C;  2B39 A;  3HGB A;  4DF7 A;  1Z7T A;  3D4D A;  1QIL A;  5BN3 A;  3ND8 A;  1HTP A;  5I9O A;  2PZT A;  2Z1C A;  2A6E D;  2NB0 A;  1A15 A;  1ET6 A;  1BCP C;  2K5D A;  4C1N I;  1A6X A;  1HUN A;  2IT1 A;  2A6E C;  2KHS A;  1H9J A;  3S14 B;  3OOC A;  4RFB A;  2BA1 A;  1GUN A;  3NXW A;  3L3O C;  2KQ3 A;  1HA5 A;  2EJM A;  3J7A F;  2ZXP A;  1Q8I A;  1U4M A;  2WAC A;  4XXE A;  2NWG A;  4BBR B;  2F0E A;  2JEB I;  2F1M A;  1RD9 D;  3TDQ A;  3GTJ B;  4DAV A;  4Z9C B;  3I4M B;  2VB2 X;  4HTH A;  3DMU A;  4A3K B;  1G29 1;  2N88 A;  4X3S A;  2F0S A;  1HHV A;  1D1K A;  3K5N A;  3A54 A;  1XYI A;  2E2J B;  4HMI A;  3Q24 A;  4CKC A;  4R8I A;  1SND A;  3TZD A;  3R8B A;  3QO2 A;  5AFW A;  3V96 A;  1Q90 A;  2JYO A;  3FPU B;  3T56 B;  3A8J E;  4CHT B;  3VR2 A;  5C0X G;  3FDT A;  4KHZ A;  1Y1V B;  1DZ1 A;  2FFK B;  1SYB A;  2K7V A;  4XTC S;  1EU3 A;  1JOR A;  2BE5 D;  2WAQ B;  1HFG A;  1PZJ D;  5JEA H;  1MBY A;  4ZLT F;  1U4P A;  2A5H A;  4ODG A;  1CFM A;  1TWA B;  3L7Z C;  3ERQ A;  4ZYS A;  1I4P A;  1LTI D;  1Q1B A;  2EE1 A;  3E5S A;  5C3E B;  3K5O A;  2AQ3 B;  4IAL A;  2KCN A;  3V2T A;  1B3A A;  3TN2 A;  4R9W A;  1IYV A;  5FO9 B;  1QNU A;  1MI2 A;  1R9T B;  3DEP A;  3I72 A;  2KVM A;  2R7Z B;  2EYO A;  4FO2 A;  2ICI A;  3HEJ A;  1LTS D;  5ELF A;  1FGB D;  3P20 A;  1UAP A;  1STN A;  4ABN A;  3ZYY X;  3MXU A;  3SK6 A;  1HFN A;  5G3L D;  3MXG A;  4CBV A;  3D3R A;  1JC7 A;  2MUY A;  4PMC A;  1S5B D;  3M3Y B;  2PYK A;  4I65 A;  1Z6H A;  3D31 A;  1TY0 A;  4FF4 A;  1SNM A;  1ZKO A;  2K6A A;  2O5J C;  3QOL A;  1EY7 A;  5C0X I;  4FNF A;  3I8Z A;  1DJR D;  4A3E B;  3M4Y A;  1ENF A;  1A3U A;  2A68 D;  1W6J A;  1DYQ A;  4LAA A;  5FOB B;  1G8Z D;  5EGT A;  3OPO A;  1JOO A;  2MP1 A;  1AN8 A;  2A68 C;  1BO0 A;  4G7O C;  2KUM A;  5E3F A;  3I4N B;  4RGO S;  1BDO A;  4XQN A;  3DXJ C;  3I90 A;  3S17 B;  2WKD A;  1SBB B;  3VR4 A;  2WII B;  4P2C B;  2F0J A;  5A2Q E;  4IUT A;  1C4Q A;  5D14 A;  2Q8R E;  3OSO A;  1EY6 A;  4B9W A;  5CV6 A;  5EKL A;  2B2T C;  2A74 C;  1EL0 A;  1LT6 D;  1SE3 A;  2B8F A;  3HP3 A;  3LX0 A;  2CW0 D;  2LY7 A;  2TSS A;  2F0G A;  1EWH A;  3PUY A;  3K7A B;  1TWG B;  1SJH D;  3VR3 A;  2F0L A;  1HA6 A;  2XWB B;  3E6Z X;  4KV6 A;  2IX0 A;  4IUR A;  1WTW A;  1AFP A;  2JE6 I;  3NSW A;  2YU9 B;  3P1H A;  1B53 A;  1BR9 A;  3E0J A;  1KTK A;  1BXT A;  3PIO 3;  3RZD B;  3WOE A;  1OXS C;  3MWY W;  4Y7N B;  4LK1 C;  2JA8 B;  2G9H D;  1STH A;  4DGZ A;  1TR5 A;  5I6W A;  3HKZ B;  5JPM C;  1RTO A;  3D4W A;  1F9R A;  1NR2 A;  1ZYR D;  3BDO A;  1HUM A;  2B2V C;  1DCZ A;  3TME A;  3GO5 A;  3NUC A;  3MC0 B;  2XRQ D;  2A6H C;  3NTK A;  5CMD A;  1QE6 A;  3J81 L;  1FR3 A;  1PZI D;  1CT1 D;  1ZYR C;  2D9U A;  4L6T B;  3HG9 A;  3VYT A;  1AEX A;  4TQU S;  4CJ1 B;  2L0C A;  2PZW A;  1H9M A;  3OMG A;  3K59 A;  5LL6 S;  3A8I E;  2YYZ A;  3MA2 B;  1LT4 D;  1SMY D;  1X3P A;  4FP5 D;  4HAE A;  2EYP A;  3BYY B;  2B2V A;  1GUW A;  1KDC A;  4DK0 A;  3NWS A;  2HUG A;  3K5L A;  5EQ0 A;  1SMY C;  2XNA C;  1Z47 A;  4LJZ C;  1U9R A;  4Q0F A;  5FLX E;  1QWY A;  3TP7 A;  3ERO A;  1EQV A;  1SYE A;  1ZEQ X;  4RGT A;  3TBI B;  2C9O A;  3A7A B;  4IUP A;  4G4K A;  3PIP 3;  1DOK A;  4KKT A;  1G6Z A;  2L9H A;  2E2I B;  2QKI C;  1AP0 A;  3PUZ A;  2Z8L A;  2BDO A;  1D1I A;  5C44 B;  4L63 B;  3BYT B;  4BA1 I;  4XIG S;  2GA4 B;  1EY4 A;  4K6L A;  1LT3 D;  1D6E C;  5E1F A;  4BWG B;  4XYQ A;  5NUC A;  1M4V A;  2J4X A;  5CV8 A;  1GUO A;  1PRT C;  4ILW A;  1Q3L A;  5KNC A;  3NBH A;  5LHY 1;  5DNF A;  3NTH A;  2L1B A;  1S5D D;  3A8K E;  3D8G A;  3RD4 A;  1EY8 A;  5JAV A;  3D4R A;  1QG7 A;  1OO9 B;  2OXP A;  3S15 B;  1HXY D;  4K5V A;  1EU4 A;  5EKI A;  3C3L A;  1IHZ A;  1ML0 D;  5TSS A;  3BZD B;  4XYO A;  1SNP A;  1M8A A;  3HOU B;  5IGD A;  2JA5 B;  1DD2 A;  5KGU A;  3TZU A;  4I7Z C;  1AZP A;  1KLU D;  3DUZ A;  3MXP A;  2K32 A;  5J1Z A;  2WV6 D;  5JEA J;  5C3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...